2NVXH

Rna polymerase ii elongation complex in 5 mm mg+2 with 2'-dutp
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
146
structure length
134
Chain Sequence
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 16
structure length 134
sequence length 146
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2nvxH00
1IBKL 3PV0A 1GVPA 3U50C 4DR5Q 4X62Q 3S15H 1N36L 1OTCA 5C0XJ 3LGJA 1OXTA 2K50A 3AFPA 3PCOB 4QIWE 1VQCA 3TRZA 2E2HH 2NVXH 3S1MH 1LYLA 2N3SA 3CMEA 2F3IA 3U4ZA 2AWOA 4QGUA 4DR7Q 2UXCL 3FP9A 1XPUA 4C3JH 4JI2L 1SN8A 2ID0A 2VUMH 1XTDA 4LFAQ 3ER0A 2OWOA 3ZJYC 5M3FG 5IE8A 3RN5A 4IOAA 1W2BA 4A93H 3PUZA 4YCVA 2QGQA 1XNRQ 3CCSA 2MNAA 4LFCL 1V43A 1XMOQ 2V1CC 1VQLA 4JBKA 3H3VI 1PHJA 1Q1BA 3S1QH 2JQOA 5JJLA 2HQLA 1SE8A 3WWVA 1VQ4A 2JA8H 3U58A 4A3BG 2N78A 2DGYA 1VQ7A 3HOVH 1P8LA 1YJ9A 2WAQG 1O7IA 1NJIC 2UXDL 1GD7A 3L2PA 1UE5A 4JOIA 3RR5A 1JMCA 1OXUA 2NVYH 1E7ZA 2UUBL 1HZ9A 1X3FA 2N49A 2YTVA 2JA6H 1AE2A 2PQAA 5M3MG 4BBSH 4DR6Q 1N34L 4A3DH 1HNWL 2YV5A 1TWGH 3U4VA 4GOPB 2CKZB 4A3JG 1K73C 4GN3B 4B3TQ 2LXJA 2PQAB 4X65Q 3GTJH 1PH7A 2I0QA 3PF4A 1KAWA 2MO1A 2RF4A 2HHHL 5GQOA 1PH8A 3L0OA 2ASBA 3K0XA 4AH6A 4A3MG 4XIGS 1VQMA 4AQYQ 3AFQA 4IJLA 1VQEA 1NMGA 3PGZA 2HIVA 3S24A 4GKKQ 1XNRL 4IFDI 1CSQA 2MFIA 2B63H 4KHPL 4GOPC 3TS0A 4OWWB 2R6GA 3HOYH 2LSSA 1L1OB 5JJKA 4LFBQ 3CCQA 1K9MC 3UDFA 3HOXG 4DUZQ 2R7ZH 3T1HL 3AEVA 4HJ5A 4JI6L 2LXKA 2UU9Q 1EQRA 2A19A 3D0FA 4OWXB 2PNHA 2WFWA 4OONA 4IPDA 4OXPA 2K5NA 2JK8A 4IPCA 5IYDG 1M1KC 4NXNL 1N33L 2IHFA 1LUZA 4A3KG 3CC2A 3I4OA 1GO3E 3EBEA 3GO5A 2VQEL 2JA7H 3BJUA 3I2ZA 1PH3A 3PO2G 4A3GH 4YWLA 4KI0A 1DGSA 4OO1G 1CKNA 2L15A 3J7ZC 3M4OH 5C44H 1VQJA 4GLXA 1Y1WG 2RHQB 4PZ8A 4JI0Q 5JEAG 2EQSA 3PO3G 3KF6A 1I3QH 2Q2IA 3PUXA 2JJQA 1CKNB 3PUVA 1Z9FA 5LMNQ 4BA2I 4AQYL 1EIFA 4DV2Q 4EX5A 4LF8L 3HOZH 3KF6B 1XPOA 1Q1EA 4LF6Q 3HOWH 3TS2A 4GKKL 2MO0A 1YNXA 5IP7H 1LTLA 5GADC 1QUQB 4DV1L 1B7YB 2BH8A 4L5SA 1PVOA 3RN2A 4A3EG 4LFBL 4NPSA 1PYSB 4UP7A 1B8AA 3CQZH 4A3FH 1VQAA 3G48A 1Q7YC 4BXXG 1XNQQ 5IP9G 1HZBA 1Q86C 2CWAA 4C2MH 1YJNA 4JI5L 4LF7Q 1KL9A 4HJ7A 3NEMA 1C9OA 1A63A 4LF5L 2A8VA 4JYAL 1Q8KA 2FXQA 3KLWA 3OYYA 4DV3L 2EXDA 1MIUA 1FJGQ 4GKJQ 1WFQA 4P75A 3H0GH 3KFUA 1KHIA 4APVA 2E5LL 3GTMH 2JA9A 5JEAJ 1MJCA 1VQBA 4DV4Q 3ICEA 4A3CH 2JA5G 1JJ2A 4X66Q 3GTLH 2R93G 1WJJA 2WP8J 1TWHH 3PSIA 4BY7G 4JV5Q 3PUWA 4C3HH 1PV4A 3K8AA 4DV6Q 3ULPA 4UY8C 1UE1A 1KXLA 1QVCA 4X64L 3BU2A 4JI4L 1WCMH 2K14A 1EUJA 2JEAI 2RHSB 4DR4Q 4IPHA 2XTIA 5LMNW 2OTJA 2YTXA 1IBMQ 3HOUG 4JC0A 4JI8Q 1UE7A 4AYBE 2Y0SG 1U5KA 1VQ5A 1WOCA 5ELOA 5M5XH 4YY3Q 3KF8B 3T1YL 4BY1G 1Y1VH 3VDYA 4OX9L 3PO2H 3KOJA 3FKIH 5AJ3Q 1I6HH 4GNXC 5DLQE 3ULLA 2GN5A 3M9BA 3PUYA 2CWPA 3RLOA 1Q82C 3I56A 1EWIA 4P73A 3I4MG 4L5QA 5HGQA 1H95A 1OXSC 1OXXK 1G6PA 1BBUA 1V9PA 4DV4L 5C4XG 1D8LA 4LUOA 2UUAQ 1HR0Q 3MEFA 1E3PA 3PIPA 3EN2A 1J5EQ 2CCZA 4LF9Q 4JYAQ 4JV5L 5JJIA 1TXYA 2H5XA 1I5FA 5IP9H 1UWVA 3DM3A 4DUYL 4DV7L 1HNXL 2UUCL 2ZM6Q 4LF4Q 4B3SL 3S14H 4DV0Q 3F2DA 4DV5Q 3A5UA 4O2DA 2VW9A 2OQKA 3OW2A 4WJ3M 1IBLL 3RLNA 4JI7L 3E9HA 4IJHA 4LNQA 3RNUA 3KYHC 5FLXc 4DR4L 1N32Q 4PZ7A 2VQFQ 1KIXA 2NZOA 4UPAA 3J80i 2K5VA 4BBRH 4X62L 3CCJA 2F52A 4DR5L 4GOPA 4A75A 2QA4A 1G291 4EQ5A 1VS0A 1M90C 5C3EH 2UXBQ 4DR7L 2R93H 1K8AC 2WB1G 5AJ3L 3J7A5 1IL2A 1EQQA 2OQ0A 4GLVB 4J15A 3RZDH 2NVTH 3CCEA 2K75A 4A3IG 4LFAL 4MZ9A 5IYCH 2HT1A 2F4VQ 1PFSA 1Y14B 3OTOQ 4POGA 2R92G 4DK6C 3J80c 1L1OA 2KBNA 4R4OA 1PA6A 1XMOL 4QL5A 4QY7A 1BVSA 1EOVA 4O0AA 1HR0L 4POFA 4B3RQ 3CAMA 4IO9A 4A4IA 2NN6I 1EIYB 1WYDA 3S1RH 2ZM6L 2WAQE 3G6EA 1HR0W 3A74A 4R4CA 1TWAH 2K52A 4DPGA 3KDFB 2AWNA 5E7NA 3J81j 2KCMA 2D62A 2R7DA 1S3OA 3JAMi 5FLMG 1BKBA 3GTOH 1N32L 1K3RA 4Y52H 1XMQQ 5GAEC 5M3FH 4L5TA 4NB3A 3STBD 1I94Q 1PH9A 5IYBG 4MTNA 1X55A 1E22A 4JBWA 4JOIC 4DR6L 4YWMA 2Z6KC 4P71A 4NXMQ 2UXBL 3RLFA 4DKAC 3CCUA 4IOCA 4B3TL 4X65L 4JCVE 3HKZG 2I5MX 1Q12A 3CCLA 2ZTDA 3JAMc 2F4VL 3OTOL 4DK3C 4A3BH 4IFDG 5FJ8G 1QUQA 2A1AA 2KHIA 5IY0A 2VNUD 2IX1A 4DR1Q 5C0XI 1Z47A 4B3RL 2Q2HA 4YCWA 2ZTCA 1FL0A 1RIPA 3KJPA 3K7AH 3CD6A 4DUZL 1IYJB 3M4PA 3CCVA 4TQUS 5M3MH 5LMUQ 3NBHB 3F1ZA 4GN4B 3PIOA 2ZJRA 4A3JH 5IWAQ 2UU9L 3A0JA 1SRUA 3K80C 3EIVA 1U0LA 4K0KQ 2DUDA 4LUVA 5BR8Q 4GLAC 3F2BA 4A3IH 4BA1I 4A3MH 3W1GA 1PH4A 3M85A 3CMAA 2BA1A 4A93G 1PH2A 1I94L 1IZ6A 1PH1A 1VQOA 1L0WA 1K8GA 1SFOH 4IFDJ 1IBKQ 3S2HH 2YYZA 3G4SA 3F8TA 1N36Q 2K5HA 3CP0A 4JI0L 4HJAA 3HOXH 1NTGA 1JE5A 4GNXA 1XJVA 3RZOH 2JA8G 1YVCA 1IXRA 5LMNL 3HOVG 4HIKA 4DR2Q 4DV2L 3L7ZC 2UXCQ 1V1QA 4GNXB 1OXVA 4LF6L 1YBYA 3GTPH 1VQIA 1HJPA 1QVFA 5IYDH 2JE6I 1A0IA 1LM0A 1YZ6A 2ES2A 1VQHA 1X6OA 4R4QA 4XTCS 4A3KH 1X56A 3S17H 3GDEA 1XNQL 4BBSG 4A3DG 1CKOA 4LFCQ 1G51A 2VY3A 4LF7L 5LMUL 3UDGA 1WI5A 4TVAB 5IWAL 3K7UC 3HKSA 3I7FA 1Y1WH 3S1NH 3ERSX 1JT8A 3M4QA 3W5OA 3PO3H 3UE1A 1FJGL 4GKJL 4Y7NH 1VQKA 2OTLA 4UP8A 1L2FA 2UXDQ 4LW1A 4PMWA 2KENA 3GTQH 4JI3Q 1VQ8A 3HOYG 2VL6A 4X66L 4A3EH 2UUBQ 1SR3A 2B29A 3E9IA 1NY4A 3KJOA 2Q2UA 2NZHA 2R7ZG 2I5HA 2PI2E 1E24A 4DV6L 4BXXH 1HNWQ 1D7QA 1K83H 1YHBA 2MQHA 1N8RC 1N34Q 1R9TH 4DR2L 1KRSA 3J81i 1VQ6A 4HIMA 2HHHQ 1SLJA 4ALPA 2Y0SE 4C3IH 4R4IA 2ZTEA 2PMZE 4JBJA 1IBML 4JI8L 2AHOB 1CKMA 4R4TA 3W1BA 3PF5A 3I4MH 2VZAA 4YY3L 2JA7G 4FDBA 4A3GG 4KHPQ 2JA5H 1X3EA 2RCNA 5C44G 2QEXA 2Q2TA 2EIFA 2E8GA 4DAMA 3J81c 1YJWA 1XPRA 4BY7H 2IY5B 2XGTA 3CC4A 4JBMA 5HY6A 3T1HQ 1YEZA 4DR3Q 3I4NG 4JI6Q 3IRBA 5K36G 1X3GA 3HOZG 3D31A 2ZJPA 3CC7A 3HOWG 5GAGC 5IP7G 1X54A 1VQ9A 1EFWA 2BA0A 2ZJQA 4JI3L 3GTGH 1TWFH 2K4KA 2UUAL 4NXNQ 1N33Q 4A3LG 1HH2P 2Z6KA 4A3FG 2D0PA 1J5EL 5EAYA 4LF9L 2BH2A 3AQQA 1HZCA 3KDFA 3HFZB 1YITA 2AKWB 4LF4L 2VQEQ 4DV0L 2E2JH 4DV5L 4BY1H 1NBWA 1FVIA 4A3LH 4RG1A 3NELA 1PYBA 5M5YH 4YHHQ 2D0OA 4OO1I 3BZKA 3H15A 1CSPA 2VQFL 4X6AH 1K0RA 5J3BA 3H0GG 1N9WA 4B3MQ 4LF8Q 1X9NA 1BBWA 3ULJA 4AIMA 5IT9c 3F2CA 1AE3A 3GD7A 3HOUH 2WB1E 4DV1Q 5C4XH 4A3CG 1HZAA 1P16A 3B6YA 1JJGA 3SGIA 4ME3A 2C35B 4YCUA 1ASYA 2YTYA 4KLKA 3E0EA 1VQFA 4JI5Q 1W3SA 4DR3L 1QVGA 2ALYB 4LF5Q 1SROA 5C4JH 1WCMG 3I55A 1RL2A 1MJEA 2ATWA 1C7YA 3Q8DA 1S72A 4JI1Q 1CUKA 2GVBA 3DLLA 4DV3Q 1MKHA 2NN6G 1L1OC 1KRTA 3TREA 4P74A 4UP9A 5M5WH 1E1TA 4HJ9A 3M3YH 2E5LQ 1AH9A 5ELNA 1FGUA 4R1JA 1EYGA 1Y1VG 3K81C 1NMFA 3CCMA 3FKIG 3JC66 4MNOA 1A62A 2HIXA 2YU9H 4HIOA 1TWCH 1J6QA 1X65A 4PG3A 4DNIA 1QZHA 4RMFA 2VUMG 1GM5A 4YHHL 2NVQH 4OWTB 2VS1A 3I4NH 1VQGA 2B3GA 4X64Q 1XMQL 3CXCA 2R92H 1KD1C 1YIJA 1YI2A 4B3ML 4JI4Q 1B70B 3CCRA 1UE6A 4YWKA 4LWCA 3STBC 2R7FA 3UDIA 3H3VH 3S16H 4H02A 1HNZQ 4NXML 2CFMA 3HKZE 3NENA 5GROA 2I5LX 3CPWA 3A5ZB 3CPFA 1NE3A 3FHWA 1YHAA 4AYBG 4LUZA 2CQOA 4QJFA 3T1YQ 1ASZA 1KQSA 4OX9Q 1I50H 3MXNB 2OCEA 1Q46A 1C0AA 4KHZA 5C0XG 1YHQA 3G71A 2IHEA 4PZ6A 4JI2Q 4WJ4A 4JI1L 4GN5A 3CF5A 1VQDA 1T9HA 2KHJA 4JG2A 5FLMH 5GAHC 4A76A 4BBRG 4DR1L 1S40A 1UEBA 3M7NA 5H1SE 3CW2C 5IYBH 2N8NA 4L5RC 2JA6G 4P72A 1PH6A 5C3EG 2E2IH 1GKHA 4DAYB 1Q81C 3UDXA 1JJCB 3TQYA 1A8VA 2PI2A 3BZCA 1VCIA 4GS3A 4DUYQ 3UE0A 1QZGA 2KCTA 2UUCQ 4DV7Q 4HJ8A 1KC8C 1PH5A 4HIDA 2IT1A 5IYCG 1HNXQ 5BR8L 4B3SQ 1VQPA 4K0KL 3TEHB 1SMXA 5FJ8H 3AYHB 2AMCB 2GVAA 4IPGA 1JB7A 4QQBX 1VQNA 3S2DH 1IBLQ 4JI7Q 2B63G 2Z0SA 3GTKH 1HNZL 2JEBI 2IX0A 1E1OA
chains in the Genus database with same CATH superfamily
3C2PA 3PV0A 3S15H 2MHVA 1N36L 5C0XJ 3LGJA 4CDEC 3OW7A 4QIWE 3L3OC 1FR3A 4BY1B 3CMEA 3U4ZA 2AWOA 4CKEA 2UXCL 2CW0D 1XPUA 4J1MA 3OIQA 3P7JA 5DAUA 5L37A 2VUMH 1XTDA 2IL8A 3RN5A 1GUOA 4IOAA 3PUZA 4NDXA 2LY7A 1NR2A 2XRQD 4NP5A 1NCVA 4JBKA 3FPPA 3IL8A 1ET9A 5CV7A 1J8IA 4OIJA 4K2LA 4A3BG 4RKLA 2DGYA 1VQ7A 1O7IA 1NJIC 5D14A 3RR5A 1NNXA 2FMCA 5M5WB 1JMCA 3VR6A 3A56A 1V1OA 1X3FA 2N49A 5KNDA 2HD3A 5JVG3 1HNWL 3T16A 2YV5A 1Z6HA 4CBVA 5I9PA 4B3TQ 2LXJA 4X65Q 2I0QA 2RF4A 3K0XA 4NMZA 2A6ED 1Q8IA 4XIGS 2R92B 2NTSA 3AFQA 2EY2A 1KABA 1NMGA 1XNRL 2EYMA 5JPMC 2B2VA 2MFIA 2B63H 1EU3A 3TS0A 2R6GA 4C1NI 5C4HA 3HOXG 1BCPD 1CT1D 4DN4M 2R7ZH 1QILA 3T1HL 4HJ5A 1A15A 2LXKA 4ZAIA 3H91A 2KOLA 1LLRD 1PFNA 4NXNL 1FNUA 4A3KG 1SMYC 3CC2A 3D4WA 2BE5C 2VQEL 1PH3A 1DOKA 3PO2G 2G5DA 3OMCA 1DGSA 4H0LC 1CKNA 1S5CD 3P75A 1E0BA 4PQXA 5JEAG 1BQQT 5K36H 4EX5A 1SYFA 2EYHA 3KF6B 3TS2A 2MO0A 5IP7H 1LTLA 3GP7A 5FLXL 2BH8A 4L5SA 1PVOA 3RN2A 3PMFA 2X6LA 1PYSB 4A3LH 1AEXA 4A3FH 5IP9G 1O78A 1Q86C 3S1MB 1KL9A 4HJ7A 4V190 5FK9C 2CH4W 2A8VA 2WV6D 1NUCA 3AU7A 1TS2A 2RVLA 4K14A 4B9XA 2B2YA 2LKVA 4GKJQ 4DAYA 4A93B 4RGTA 3H0GH 2E5LL 1SJHD 4FF2A 3GTMH 5JEAJ 4DAPA 5EPKA 1FNWA 2WACA 2WP8J 1TWHH 3KLSX 3S1QB 4JV5Q 2PPBC 2BDOA 3K8AA 4DV6Q 3IFTA 1UE1A 3J7AV 1VF7A 3BVMA 3BU2A 2K14A 3FDTA 5COYA 5LMNW 2NVYB 2OTJA 1UEAB 1K3BC 1IBMQ 1RD9D 2L4NA 4A3DB 5M5XH 2D5DA 3KF8B 4ZLTF 4BY1G 3VDYA 3KOJA 3GTJB 5K5PA 3J80E 3NTKA 2PZUA 5NUCA 1AZPA 2NZ1D 3M9BA 4X3SA 2CWPA 3HG9A 2DN8A 4IUUA 1KTKA 4MTKA 2JSOA 2KEEA 1W6JA 5IODA 1G6PA 1BBUA 4DV4L 2A5HA 1J5EQ 2CCZA 2UUCL 2H5XA 1I5FA 3DM3A 4DV7L 1PTOH 5I4DA 3F2DA 2SDFA 4O2DA 5EJWA 5C0XH 2VW9A 4XQQA 4M8AA 4WJ3M 1ICFB 1VMCA 3RNUA 3MXGA 5FLXc 1N32Q 2VQFQ 4I7ZC 2R61A 4BBRH 4DR5L 1G291 3PIP3 2F0OA 3GV3A 1M90C 4A3GB 2XNAC 3A7AB 3QWNA 1SNMA 1Z7TA 4DR7L 3M4OB 2XVSA 2R93H 1TWCB 1IL2A 1EQQA 1H9JA 4MZ9A 4K8IA 5KIXA 2HT1A 1Y14B 4KD3A 2R92G 4K6DA 3T13A 3HOZB 1JQYD 4KY6A 2O4XA 2F0HA 4R4OA 4OEMB 2B39A 1XMOL 1Q90A 4QY7A 1BVSA 1PRTC 4B3RQ 2F0EA 3CAMA 1JWUD 2F0NA 3H6MA 1EIYB 1I6VC 1WYDA 3S1RH 2ZM6L 1WTWA 3NQIA 3VYSA 1ENFA 2NTTA 2C5CA 3RUZA 4EVOA 5E7NA 2QW7A 2RKSA 4KD4A 2R7DA 1HRJA 1I4XA 1PH9A 1QB5D 1JE4A 1JOOA 4YWMA 1KLUD 2UXBL 4NXMQ 1I4HA 4IOCA 1HPCA 1XXGA 2B2TA 1KDCA 3MHBA 4XT3B 1D1IA 4A3BH 2L9HA 5FJ8G 1F2YA 1TY0A 3HGBA 4LK1C 1TS4A 2KHIA 4DR1Q 5C0XI 2A74C 4YCWA 1JWSD 1A2TA 1FL0A 3NBHA 3KJPA 3CD6A 4DUZL 3M4PA 5CV4A 2D9UA 1QE6A 2TSSA 2QCPX 1SRUA 3K80C 2VUMB 1U0LA 4G57A 2DUDA 4BA1I 1PH4A 2KECA 5JAVA 4A93G 3QJYA 1I94L 4S3SA 2B8GA 2F0JA 3DHQA 1QJOA 1LABA 4O1NA 1CQFA 2K5HA 4JI0L 4TSSA 3HOXH 1ZYRC 1JE5A 4HMIA 2EPBA 4GNXA 2XN9C 2PCFB 3S14B 4AYBB 5LMNL 4DR2Q 4DV2L 1ZKOA 5JOBA 3QO2A 2P5ZX 3GTPH 1VQIA 2NYZD 1HJPA 5FO7B 3KF8A 1LM0A 4WJ4A 3WDNA 3UI2A 4XTCS 4A3KH 1X56A 3GDEA 2N88A 4A3DG 1PTOC 2RDHA 2VY3A 4WORA 3UDGA 1QG7A 5KYIA 3RZDB 3HKSA 5JEAH 4XT1B 3JAML 2F0SA 1GHJA 4LW1A 4PMWA 2B63B 1EIGA 5IGFA 2VL6A 1SE2A 2UUBQ 3QOJA 3E9IA 4K2KA 1WVLA 2I5HA 3PQIA 1IKLA 4IUVA 5J1ZA 3I72A 1KRSA 1VQ6A 3D8GA 4N8FA 3GTOB 3X3MA 2Y0SE 1B2TA 2V4DA 1LO5D 4JI8L 1KAAA 1EYDA 1CKMA 1PXUA 4KHPQ 4A3GG 1CI3M 1PRTB 1X3EA 3FEWX 4X3UA 2EIFA 1XPRA 2XGTA 4JBMA 1A3VA 5HY6A 1YEZA 1EZ8A 1X3GA 2L12A 5CBAE 3HOZG 2ZJPA 3VR2A 1X54A 4HCSA 1EFWA 2G9DA 1WTOA 2UUAL 1N33Q 2PW5A 2D0PA 4NW2A 5EAYA 1YITA 3HFZB 5M3MB 5CC4A 2AKWB 2ICEC 4FXGC 4BY1H 2CQAA 4RG1A 3NELA 5ELFA 1LT5D 4KKTA 4A3MB 1M4VA 1CSPA 1K0RA 1MHWC 4KY7A 5J3BA 1X9NA 1JORA 3F2CA 3GTMB 4HSPA 5EKKA 4A3CG 2E2DC 3S2HB 3SGIA 3SXHA 2E74C 1S5ED 1LTBD 4JI5Q 4LF5Q 4RCOA 2ATWA 1BCPF 2Z9HA 2M00A 1CUKA 2GVBA 3DLLA 5JVH3 1B44D 1L1OC 1KRTA 1XX8A 5M5WH 1B4OA 1ENAA 2B2VC 1AH9A 5CGKA 5ELNA 2WKDA 3MVVA 3K81C 3KBGA 4MNOA 3J81L 4CKCA 3S1NB 3T51B 1SYEA 1QZHA 2VUMG 4YHHL 2NVQH 1VQGA 2B3GA 1U4LA 2R92H 1TT2A 1SYBA 5IGEA 1YI2A 3IFDA 4KMUC 4KN4C 4G7ZC 3GTQB 3H94A 4H02A 2L1BA 4A3EB 1PTOD 2CFMA 5GROA 3A5ZB 4ID6A 1ONLA 3CPFA 1NE3A 2RQXA 3E5SA 4QJFA 2CQOA 4AYBG 4OX9Q 3G71A 4JI1L 4C3IB 4GN5A 4I7AA 2KHJA 4A76A 5TSSA 5H1SE 1W6KA 1Y8PB 1PH6A 2JA5B 4RGNA 1JJCB 2F4IA 4ZKBB 1CFMA 5CR3A 3NSWA 1Q3LA 1VCIA 1QZGA 3IAYA 4HJ8A 1PH5A 2IW3A 2IT1A 1NR4A 4B3SQ 5BR8L 2IWHA 5FJ8H 1HCZA 4QQBX 1VQNA 5I6YA 3GTGB 2F0MA 1TWFB 4BS9A 2B63G 2IX0A 3RD4A 3NUCA 4R8IA 1IBKL 3HOUB 3U50C 4X62Q 3S1MH 2F3IA 3R8BA 4K8JA 3FP9A 4C3JH 4JI2L 3DWQA 4QF4A 2ID0A 1TS5A 3ER0A 3ZJYC 2I46A 3LNNA 5EGTA 3I4MB 1W2BA 4A93H 2QGQA 5C4XB 3R93A 2A68C 1STBA 3S1QH 4IALA 1SE8A 4UHVA 1P8LA 5FO9B 2EYJA 1SBBB 1OXUA 2NVYH 3VR4A 5KGUA 2PZWA 5EKIA 1HZ9A 4A3DH 1AE2A 2PQAA 5M3MG 4DR6Q 1N34L 1HUMA 4RHSA 3ITPA 4GN3B 1G6ZA 2YU9B 3GTJH 3PF4A 2ASBA 4A3MG 3K5MA 4AQYQ 3DMUA 4IJLA 5E4XA 2OT2A 2EZVA 1PFMA 1L1OB 3CCQA 1K9MC 2EXZA 4Q5VA 5T1GA 4F8MA 1YNNC 4QUCA 4JI6L 4KKUA 1EQRA 2A19A 3D0FA 5EPJA 4OONA 3GTPB 1F2MA 2JK8A 1FYCA 3DWAA 4DFAA 4XDXA 1SDFA 3C1EA 3W2DA 2L5TA 2RBMA 3E6ZX 3K0YA 3HRZC 4A3GH 3MC0B 4KI0A 2DY7A 3J7ZC 3DEPA 3M4OH 1IW7D 2RHQB 3K5OA 2VXWA 3HKZB 2PW7A 2JJQA 1CKNB 1EEID 3PUVA 1E2VA 4IUQA 3HOZH 3S2DB 1XPOA 1Q1EA 1AZQA 1WTRA 1YNXA 4A3EG 4UP7A 1VQAA 4FF1A 3OHXC 2NVXB 1D1KA 1R4PB 4LF7Q 3NPPA 1A63A 2B2TC 1Q8KA 2FXQA 4DV3L 3EROA 5BN4A 4C3IG 1EQVA 4PMCA 2EXDA 1EYAA 4G7OC 4P75A 1BO0A 4L6TB 4A3CH 2JA5G 2X6GA 2R93G 1WJJA 3PSIA 1PMRA 3PUWA 4B08A 2HUGA 2K5DA 1WTXA 4UY8C 5FLXE 4X64L 4QIWB 5IGBA 4IQZA 1EUJA 2JEAI 4DR4Q 1LACA 2JXMB 3HOUG 4JC0A 3Q24A 4G7HC 4BBSB 3FMCA 5ELOA 2A68D 1TWGB 1OO9B 4GNXC 5DLQE 1T5XD 4ILWA 3MXPA 3G7LA 1Q82C 3I56A 1G2SA 3I4MG 5ISRA 4F7XA 5HGQA 1OXXK 1V9PA 5C4XG 2PQEA 1S5FD 1C8CA 1SXTA 1HR0Q 3MEFA 2Z8LA 1E3PA 3EN2A 4LF9Q 4JVZA 5DM63 4JYAQ 4JV5L 1SJED 4DK1A 4DUYL 4LF4Q 3S14H 1EYCA 5LL6X 1PZID 4JI7L 3D3RA 3RLNA 4IJHA 1UUPA 3WOFA 1KIXA 2F0KA 3CU7A 1DCZA 4H7BA 1GXDC 3J7AF 2JA7B 1SYCA 1MD2D 2EVBA 1WTPA 1F77A 3F2UA 5C44B 1YNND 2Z4HA 4OIKA 3RZDH 1S5DD 2NVQB 4LFAL 5CORA 2F4VQ 3OTOQ 1ILPA 1SNPA 3HOWB 1L1OA 3SK6A 3MWYW 4OELB 1EOVA 3CQZB 4EQNA 4ZKCB 2HDLA 2WAQE 1G2TA 1F9SA 1SE4A 3SDZA 3GTOH 5FLMG 3LX0A 1N32L 4Y52H 4NB3A 3QR8A 5DM73 4MTNA 1E22A 4JBWA 2MP1A 1ENCA 3GTLB 4DKAC 4C3HB 1H9KA 3HKZG 2I5MX 2KUMA 1RDPD 4DA2A 4RFBA 4ODGA 1MI2A 1WCMB 1LT4D 2A1AA 2AQ2B 1CTMA 1ESRA 2KEDA 1D2BA 2IX1A 1AP0A 4B3RL 2ZTCA 5DNFA 1HA5A 2PNRC 1WTQA 1IYUA 4J6HA 4TQUS 5M3MH 1O7YA 1I4PA 5KNBA 5LMUQ 1GUNA 1KLGD 3NBHB 3PIOA 3FKIB 1I6HB 2UU9L 5IWAQ 3Q22A 4C3JB 4DK0A 5F2DA 4K0KQ 4LUVA 4A3MH 3M85A 1JB3A 1JCKB 1PH2A 5A2QL 1VQOA 5CV6A 1L0WA 3A8JE 3S2HH 1STAA 3F8TA 1N36Q 5C6AA 1EQTA 4ZYSA 1YVCA 1IXRA 2KCCA 1J9OA 1CA6A 5J39A 1X3PA 2UXCQ 2D2CC 4GNXB 1D5XC 3H09A 3TN2A 4LF6L 1YBYA 1HQRD 4HAEA 4P2CB 3MTSA 2NUCA 2ES2A 4R4QA 1X6OA 2RSOA 4DAVA 1XNQL 4BBSG 5ELCA 4TVAB 3K7UC 1QNUA 3S1NH 1CHPD 1H9RA 4OHJA 3R2IA 3QOLA 1FJGL 2K6AA 4UP8A 1L2FA 2CHBD 3GTQH 3QB3A 4FO2A 3OIPA 4X66L 4A3EH 1NY4A 4YIJA 3DM1A 5FOBB 2Q2UA 2PI2E 2PMZB 1HNWQ 1LV9A 2J4XA 3I4LA 4CJ1B 1N8RC 1TWAB 1BR9A 4DR2L 4CHTB 1Y8NB 4HIMA 5KRUA 2I07B 1BDOA 3DXJC 4C3IH 4ALPA 2PMZE 4R4TA 2IX3A 2VZAA 4YY3L 4ZUJA 2JA7G 2JA5H 3JAME 4IUTA 2RCNA 3IKJA 5C44G 2QEXA 4DAMA 1JOQA 1YNJC 2OEOA 3T1HQ 4DR3Q 3DUZA 4EGVA 2MUYA 2F3VA 3D31A 2RDGA 3CC7A 3HOWG 5GAGC 3SHLA 1VQ9A 2ZJQA 1F9RA 3MFYA 1SMYD 2OF1A 1TWFH 4CJ2C 3GTGH 4NXNQ 1PFBA 1HH2P 3HOUH 2BE5D 5E1FA 1GJXA 2VQEQ 4EQOA 1V8QA 4DV0L 4A3JB 1BNZA 4DV5L 1AN8A 1PYBA 4JK1C 1EY0A 3CRLC 3BZKA 1X32A 3H15A 3I4MH 1S5BD 3ULJA 4AIMA 1DONA 1AE3A 3GD7A 1EOTA 2WB1E 1SFOB 5C4XH 1P16A 4DXFA 1WD1A 1GUSA 1ASYA 1TVXA 4KLKA 4C3HG 5LHY1 3E0EA 1STNA 4IUNA 4C1NK 1QVGA 4N9PA 2ALYB 5CMDA 5C4JH 1WCMG 3I55A 1MJEA 1C7YA 5ELBA 3Q8DA 1S72A 2L11A 3H3VC 5E4WC 4P74A 5A35A 4MN3A 2E5LQ 4WFN3 2EYOA 1FGUA 4R1JA 1EYGA 2RA4A 1NMFA 3FKIG 1A62A 2Z4IA 2ZXOA 5G3LF 4HIOA 1Y1WB 4C3JG 1X65A 2YU9H 3PO3B 1K8OA 4OWTB 2VS1A 3I4NH 3BDCA 1XMQL 2CH4A 1KD1C 2K04A 2K33A 3CCRA 3N6RA 3STBC 2H4OA 1HNZQ 2B2WC 4QUFA 3NENA 3GQBA 4RGOS 1K83B 2FINB 1R9TB 1MGSA 1YHAA 3P1HA 4LUZA 4TRDA 3OSOA 5D65A 3MXNB 3V05A 1Q46A 1YHQA 4PZ6A 4RKBA 3AMUA 2K05A 1VQDA 5KEEA 5FLMH 1S40A 3M7NA 4RCNA 1SNQA 3L9AX 4XXEA 1ET6A 5IGDA 3J81E 1EEFD 4XYOA 1GKHA 4TKOB 3HZXA 4BY7B 3TQYA 1A8VA 2PI2A 1DJRD 4CKBA 2F03A 2UUCQ 2QDBA 4DV7Q 1SE3A 5IYCG 2GVAA 1JB7A 3S2DH 1U9RA 1TQOA 2Z0SA 1O80A 2JEBI 4OGQC 4DR5Q 1V1PB 5D3IB 1OTCA 2Y0SB 1VQCA 3TRZA 2NVXH 2E2JB 2N3SA 3EJIA 4QGUA 4DR7Q 4Z9CB 1YNJD 4QB4A 1KDAA 1SN8A 2BDNA 4B9WA 1PZJD 2Q8TA 2OWOA 5CBEE 2ENBA 1DOLA 4YCVA 3TP8A 1PRTD 3CCSA 4ZK9B 2RSNA 2MNAA 4LFCL 1V43A 1XMOQ 4N9TA 1VQLA 2DNEA 1PHJA 1I4GA 2HQLA 2N78A 5I9OA 1B1ZA 3E0JA 2UXDL 3EVQA 4XQJA 1UE5A 1E7ZA 3NK9A 1FGBD 4BBSH 4MHEA 1TWGH 4GOPB 1RCVD 4A3JG 2K5WA 2PQAB 4H13C 4U673 1UAPA 1PH7A 1KAWA 2MO1A 2HHHL 5GQOA 3L0OA 3GV6A 4AH6A 1VQMA 1GOZA 1X3QA 3EQLC 2SEBD 1SEBD 3PGZA 4GKKQ 2G9HD 3W3AA 4OWWB 3VR5A 2LSSA 5JJKA 4LFBQ 2KQ3A 2ZXRA 4J8QA 4DUZQ 2F0VA 1JOKA 3AEVA 2HQEA 4IZ8A 1I50B 5HURA 2PNHA 4Q0FA 1LTTD 2K5NA 4IPCA 4K5XA 3BYYB 3U9OA 5BN5A 3QG1A 2E2IB 1GO3E 3EBEA 2JA7H 1ZYRD 4IURA 4OO1G 4R8NA 1RF2D 2L15A 1AFPA 3TSSA 1VQJA 5C44H 4GLXA 1Y1WG 4JI0Q 2IPKD 2F1MA 2O2LD 1CA5A 1U4MA 1SSOA 4U68A 2Q2IA 4F88A 3PO3G 1CHQD 1Z9FA 5LMNQ 4BA2I 4AQYL 1EIFA 4DV2Q 4LF8L 5AFWA 1JR0D 3HOWH 3O13A 1QUQB 4DV1L 1WD0A 4CDCC 2NWGA 4NPSA 1MSHA 3CQZH 3MXNA 4PMBA 1L0XB 2CWAA 1YJNA 2E2HB 2Q8RE 3K5LA 1LTSD 3OMGA 1TS3A 2EY5A 2FMMA 1MIUA 3AB9A 3I73A 2QILA 3I3CA 1MJCA 1VQBA 3GTLH 4BY7G 5ELEA 4C3HH 2JA8B 1IKMA 3ULPA 1B9MA 1EY6A 2EDGA 3HOVB 1QVCA 4JI4L 1WCMH 3NQTA 2FJ2A 1EFID 1V1PA 2DNCA 2PYKA 3KLSA 4JI8Q 1LT3D 3OPOA 4XYQA 2Y0SG 1U5KA 2MPMA 3T1YL 3FKIH 5CV8A 4O42A 5AJ3Q 1I6HH 1HTLD 4HSVA 3ULLA 2GN5A 3BG3A 4QMGA 4P73A 3SK4A 2K5QA 3HOYB 1D8LA 2UUAQ 1O7LA 1HNXL 1SYDA 5C4JB 2CVRA 3A5UA 2JN4A 4DXGA 4ABNA 3OW2A 1IBLL 5LL6S 4DR4L 3KYHC 4UPAA 2EYLA 3CCJA 4GOPA 2F52A 4A75A 2QA4A 4EQ5A 1D5ZC 1ESFA 1JWMD 4XQNA 1GUWA 1K8AC 3J7A5 2OQ0A 2K75A 2CW0C 3I4NB 5IYCH 1PFSA 2J0TD 4POGA 1O7ZA 2EJGC 1DOMA 5EBDA 1PA6A 4QL5A 3DWPA 1HR0L 4IO9A 4C2MB 4RH6A 3G6EA 1BF4A 3A74A 1B3QA 1TWAH 2K52A 2O5IC 2A6HC 4FXDA 4FF3A 1ICWA 4L5TA 1SNOA 3Q6SA 2B2WA 3M7GA 1X55A 4JOIC 2A69C 4LJZC 3K6OA 3RLFA 1VMPA 3BS1A 4B3TL 4X65L 1KDBA 2LFNA 3BDOA 2XRSD 2KVMA 1Q12A 3CCLA 2ZTDA 2F4VL 2LMCB 4DK3C 3OTOL 4IFDG 1QUQA 4PNYA 2A6EC 5FKAC 1B50A 2XSCA 1GUTA 5KNCA 1A6XA 4KY5A 1IYJB 3VYUA 1Y1VB 3PO2B 1BCPC 4A3JH 3A0JA 1WTHA 3NWSA 2F0TA 5BR8Q 4GLAC 4A3IH 5JPNC 1E2ZA 3C3LA 5EBCA 1PH1A 1K8GA 1SFOH 4ZQ3A 1IBKQ 4IFDJ 2YYZA 4F87A 2VB2X 3BVGA 3PIO3 2KCNA 3RZOH 2JA8G 4FNFA 3HOVG 1I4RA 3Q23A 1OXVA 1NAPA 2K03A 2HCCA 3A7LA 2NBFA 1QVFA 2JE6I 2MJ8A 3E3XA 1HA6A 3OWEB 5IT9L 5C5LA 1K0SA 5C3EB 1H9SB 5LMUL 5CYUA 5IWAL 4OO1H 5A2QE 4NKLA 3I7FA 1Y1WH 2NVTB 2K7VA 3M4QA 3W5OA 3PO3H 2GA4B 3UE1A 4GKJL 4Y7NH 2OTLA 3TDQA 3R2TA 3OWFA 1LTGD 1M8AA 4JI3Q 4JPBW 1VQ8A 3HOYG 2F0DA 5IIFA 1SR3A 2B29A 3KLRA 1KXLA 3M4YA 4FF4A 1E24A 4DV6L 1K83H 1N34Q 1R9TH 2DY8A 4LMQD 5D3DA 1SLJA 3KK7A 5M3FB 2ZTEA 1IBML 4JBJA 2EE1A 2WINB 3PF5A 3CKIB 4BY7H 2E8GA 2AQ3B 1YJWA 1PRTF 3FRPB 5EKLA 3CC4A 3I4NG 4JI6Q 3IRBA 2A6HD 2N55A 2WAQB 3LWEA 1G8ZD 1STYA 2BA0A 5J22A 3I70A 1XYIA 2A69D 2Z6KA 1J5EL 3K7AB 3AQQA 1HZCA 1U4PA 2QKIC 3TBIB 1QOHA 2E2JH 4OL7A 1NBWA 1FVIA 4DNTB 4CJ0B 4OO1I 1DYQA 2X69A 4X6AH 2VQFL 4HR7B 1N9WA 1XTCD 1CM9A 4B3MQ 5IT9c 3BYTB 1E2WA 1JJGA 3B6YA 2MGSA 1F2ZA 4ME3A 4YCUA 2YTYA 4BWGB 1ZXTA 1W3SA 4DR3L 1BCPB 1H9MA 4ULLA 4DV3Q 1EU4A 1MKHA 2NN6G 5IGCA 3S17B 4UP9A 4HJ9A 2XIWA 1Y1VG 3CCMA 1CZGA 1SYGA 2PZTA 3JC66 1QNKA 4WRDA 4X3KA 4X64Q 3CXCA 3D6CA 1B70B 1UE6A 3H3VH 2R7FA 3UDIA 1DZ1A 4NXML 3C46A 1HUNA 1PYWD 3NTIA 3CPWA 1FNVA 4UDUC 1IHZA 3C1FA 1ASZA 1KQSA 1PTOF 1I50H 1WTVA 5C5MA 1C0AA 2IHEA 2L55A 3CRKC 3I91A 3CF5A 4JG2A 4DR1L 2SNSA 1H9SA 3SEBA 2N8NA 4RAUC 4P72A 2E2IH 5C3EG 3VA5A 2BCOA 1Q81C 3UDXA 1Y8OB 3BZDB 4GS3A 4DUYQ 4HIDA 1PZKD 4HCEA 4IFDH 3AYHB 2AMCB 1KNAA 3SR1A 4JI7Q 3GTKH 1HNZL 3KUPA 1GVPA 1OXTA 2K50A 3AFPA 3PCOB 2QEJC 2E2HH 3K57A 1LYLA 3WOEA 5M5YB 1BBXC 1VF5C 2F0WA 4LFAQ 3NTHA 2AQ1B 1D6EC 2B2UA 5IE8A 5M3FG 4FYDA 1XNRQ 2EYPA 2V1CC 4RGMA 3ERQA 3H3VI 1Q1BA 5JJLA 2JQOA 3WWVA 2M2LA 1TKWB 4ZRZA 1B3AA 3K58A 3U58A 1VQ4A 2JA8H 3HOVH 3OOCA 1YJ9A 2WAQG 1ZEQX 1GD7A 3L2PA 3A8IE 3EA6A 4JOIA 5T1IA 1HHVA 2UUBL 1SNCA 3M3YB 2YTVA 2F0FA 5M9OA 2JA6H 1Y69U 3U4VA 2CKZB 1LTID 1K73C 3HP3A 2WB1B 3NE5B 4ME5A 4A3IB 1PH8A 1VQEA 5CV9A 3VA7A 2HIVA 3S24A 4IFDI 3S16B 1CSQA 1BXTA 1EY9A 4KHPL 4GOPC 3HOYH 2RDFA 3UDFA 2K28A 3BVZA 3RZOB 2KHSA 1GUGA 2UU9Q 4OWXB 4V0BA 2RCFA 2WFWA 4IPDA 4OXPA 3FPUB 5IYDG 3R3OA 1M1KC 1N33L 2EYFA 2IHFA 1LUZA 1RODA 1A2UA 1MSGA 3I4OA 3K5NA 3GO5A 4KK7A 3BJUA 3I2ZA 1UNSA 4YWLA 2XWJB 1XWEA 1STHA 3D6WA 4PZ8A 2F0PA 2EQSA 4R9WA 3KF6A 1I3QH 2R3ZA 3PUXA 4Y7NB 2QF7A 1DM0B 1EY8A 4ZCKA 4LF6Q 4GKKL 3TP7A 5GADC 4K5WA 5ELDA 1B7YB 3S15B 4LFBL 1Q7YC 1B8AA 3CHBD 3G48A 1RJTA 4BXXG 1XNQQ 1HZBA 1R4QB 4C2MH 3NBIA 4JI5L 2F0GA 3NEMA 1C9OA 1KNEA 4LF5L 1T5EA 1F9PA 2AUKA 4UAIA 3KLWA 3OYYA 4IUPA 2LS01 4EQPA 1EY5A 1BOSA 1FJGQ 1G91A 1WFQA 2EY1A 3J80L 3KFUA 1KHIA 3P20A 4APVA 2JA9A 5E3FA 4DV4Q 4KN7C 3ICEA 1JJ2A 4L8JA 4X66Q 3TZUA 1PV4A 2FFKB 1IL8A 1EWCA 4HEDA 1IYVA 2RHSB 5BN3A 4IPHA 2XTIA 2NN6H 4X3TA 2HDMA 2YTXA 3BDLA 1C4QA 2ZXPA 3N52A 1UE7A 4AYBE 4HMJA 2O5JC 1VQ5A 1WOCA 4LAAA 4YY3Q 2E75C 1B9NA 1EY7A 1Y1VH 4OX9L 4L63B 3PO2H 1GHKA 3TZDA 1STEA 1HFNA 3PUYA 1D5MC 3RLOA 3TMEA 1EWIA 3MAQA 1EWHA 4L5QA 4DF7A 1H95A 1OXSC 3ONAB 1L0YB 3A54A 1RHPA 4LUOA 3PIPA 5JJIA 1RTOA 2R7ZB 1TXYA 2EJFC 4KJNA 5IP9H 1UWVA 3T4AC 3VYTA 2ZM6Q 4B3SL 4DV0Q 3ZYYX 4M1UB 4DV5Q 5KYLA 3TP5A 2OQKA 2K01A 2TMPA 3D4DA 3E9HA 4LNQA 3T53B 2E76C 2JYOA 4PZ7A 2F0QA 2NZOA 3J80i 2K5VA 3RMHA 4X62L 1F2LA 3MA2B 2DJFC 3D4RA 1VS0A 5C3EH 2UXBQ 1ILQA 2WB1G 5AJ3L 3G6JB 4H44C 4GLVB 4J15A 2NVTH 3CCEA 1TIID 2EOTA 3NHHA 1EZ6A 4FVMA 4A3IG 1DD2A 3NWTA 4DK6C 3J80c 1JICA 4IN3A 2KBNA 5CV5A 4O0AA 1I4QA 4WJWA 2JP1A 4POFA 4A3FB 2PO4A 4A4IA 2NN6I 3MFGA 1HTPA 2K32A 1HR0W 4R4CA 4DPGA 3KDFB 4CDFC 4I65A 2AWNA 3V96A 3J81j 3QIAA 2KCMA 2D62A 3ND8A 1S3OA 3JAMi 1BKBA 5HGTA 1HXYD 1K3RA 1XMQQ 5GAEC 3H0GB 5M3FH 2AUJD 3STBD 1I94Q 5IYBG 3NXWA 4DR6L 2Z6KC 4P71A 4RHRA 4MIUA 3CCUA 1TWHB 4HTHA 1II3A 1ML0D 4JCVE 5FO8B 1HFGA 3X3NA 3SVMA 4DGZA 3HEJA 3JAMc 2EJMA 5C3XA 3GTKB 5IY0A 5JJZA 3HS0C 5EPLA 2VNUD 1Z47A 3URYA 2Q2HA 3J7YW 1A3UA 1S4ZA 1RIPA 3K7AH 2SNMA 1CQVA 5M5XB 3CCVA 4GN4B 3F1ZA 1BUVT 2ZJRA 2EY6A 2C9OA 3KBXA 3I8ZA 3SE0A 1QCBD 3EIVA 4CDDC 1DXMA 3F2BA 3W1GA 2ICIA 3CMAA 2BA1A 2Z1CA 1IZ6A 2ZT9C 2L0CA 1SAPA 5I2YA 3MXUA 3G4SA 3Q0AA 3CP0A 3VR3A 4HJAA 1NTGA 3MEHA 3ND9A 1PTOB 4ZUIA 1XJVA 2Q8IB 1IW7C 1VDZA 4KKSA 3L7ZC 5C3WA 1B53A 1V1QA 2A73B 5IYDH 4BBRB 1A0IA 1YZ6A 1VQHA 3S17H 2JA6B 1CKOA 4LFCQ 1AW7A 1JC7A 1G51A 4LF7L 1WI5A 2R93B 2IJ0A 3NP8A 1QWYA 3ERSX 1JT8A 1RTNA 4KJOA 2SOBA 5DEHA 1VQKA 1TU2B 2UXDQ 3FVQA 2B2YC 2DJGC 2KENA 4DNRB 1FD7D 1CZWA 4KV6A 4GZYC 3KJOA 2NZHA 5I2XA 2R7ZG 4BXXH 3S1RB 2WKCA 1D7QA 1HQMC 1YHBA 1STGA 2MQHA 2Z6BA 3J81i 2KA7A 1EY4A 2VB3X 2HCIA 4KTAA 5IT9E 2HHHQ 3DEOA 4QCLA 4R4IA 2QDLA 4CGYB 2XWBB 2J7ZA 2H1EA 2AHOB 3W1BA 4FDBA 2WIIB 2Q2TA 2IY5B 3J81c 1SNDA 1I3QB 2F0IA 1K8MA 3SK5A 2F0UA 4A3BB 5K36G 4C56C 2OXPA 4HN7A 5IGGA 4E6IA 5IP7G 2B2UC 4KHVA 1EL0A 4JI3L 2K4KA 4A3LG 4A3FG 4JYAL 4LF9L 4RA8A 2BH2A 3KDFA 4LF4L 3EFXD 2M9VA 4FXKC 1PDQA 5M5YH 4YHHQ 2D0OA 4PV1C 3H0GG 4LF8Q 1BBWA 1RKNA 2F0LA 4DV1Q 1HZAA 4G4KA 4DU9A 2B8FA 2C35B 3HOXB 1NSNS 1TY2A 1VQFA 1SROA 1EIHA 1RL2A 4JI1Q 3VYRA 3LWUA 1MBYA 3TREA 4A3KB 1E1TA 2FHTA 4RWSC 5G3LD 3M3YH 1CK1A 2HIXA 2K1BA 1PLFA 1TWCH 1J6QA 4PG3A 4DNIA 4RMFA 4JW0A 1GM5A 3V2TA 4B3ML 3A8KE 2BOSA 3T56B 1YIJA 4JI4Q 4N8X1 4YWKA 4LWCA 1TR5A 3S16H 1K28A 3HKZE 2I5LX 4FP5D 3FHWA 3A55A 3T1YQ 1LTAD 5IOCA 3S9WA 3SK8A 1LTRD 4K6LA 3MZ5A 2OCEA 4KHZA 5C0XG 3TP6A 4JI2Q 4K5VA 3U9SA 3I90A 1T9HA 5GAHC 4BBRG 1UEBA 3CW2C 2KJXA 5IYBH 4L5RC 2JA6G 2F3WA 4DAYB 5I6WA 5C4ZA 1LT6D 3BZCA 1U4RA 3UE0A 2KCTA 1HNXQ 2NB0A 1KC8C 4K0KL 1VQPA 3TEHB 1SMXA 1F9QA 4IPGA 1A3TA 3K59A 1C48A 5EQ0A 1IBLQ 4HIKA 1E1OA
chains in the Genus database with same CATH topology
1IBKL 3PV0A 1GVPA 3U50C 4DR5Q 4X62Q 3S15H 1N36L 1OTCA 5C0XJ 3LGJA 1OXTA 2K50A 3AFPA 3PCOB 4QIWE 1VQCA 3TRZA 2E2HH 2NVXH 3S1MH 1LYLA 2N3SA 3CMEA 2F3IA 3U4ZA 2AWOA 4QGUA 4DR7Q 2UXCL 3FP9A 1XPUA 4C3JH 4JI2L 1SN8A 2ID0A 2VUMH 1XTDA 4LFAQ 3ER0A 2OWOA 3ZJYC 5M3FG 5IE8A 3RN5A 4IOAA 1W2BA 4A93H 3PUZA 4YCVA 2QGQA 1XNRQ 3CCSA 2MNAA 4LFCL 1V43A 1XMOQ 2V1CC 1VQLA 4JBKA 3H3VI 1PHJA 1Q1BA 3S1QH 2JQOA 5JJLA 2HQLA 1SE8A 3WWVA 1VQ4A 2JA8H 3U58A 4A3BG 2N78A 2DGYA 1VQ7A 3HOVH 1P8LA 1YJ9A 2WAQG 1O7IA 1NJIC 2UXDL 1GD7A 3L2PA 1UE5A 4JOIA 3RR5A 1JMCA 1OXUA 2NVYH 1E7ZA 2UUBL 1HZ9A 1X3FA 2N49A 2YTVA 2JA6H 1AE2A 2PQAA 5M3MG 4BBSH 4DR6Q 1N34L 4A3DH 1HNWL 2YV5A 1TWGH 3U4VA 4GOPB 2CKZB 4A3JG 1K73C 4GN3B 4B3TQ 2LXJA 2PQAB 4X65Q 3GTJH 1PH7A 2I0QA 3PF4A 1KAWA 2MO1A 2RF4A 2HHHL 5GQOA 1PH8A 3L0OA 2ASBA 3K0XA 4AH6A 4A3MG 4XIGS 1VQMA 4AQYQ 3AFQA 4IJLA 1VQEA 1NMGA 3PGZA 2HIVA 3S24A 4GKKQ 1XNRL 4IFDI 1CSQA 2MFIA 2B63H 4KHPL 4GOPC 3TS0A 4OWWB 2R6GA 3HOYH 2LSSA 1L1OB 5JJKA 4LFBQ 3CCQA 1K9MC 3UDFA 3HOXG 4DUZQ 2R7ZH 3T1HL 3AEVA 4HJ5A 4JI6L 2LXKA 2UU9Q 1EQRA 2A19A 3D0FA 4OWXB 2PNHA 2WFWA 4OONA 4IPDA 4OXPA 2K5NA 2JK8A 4IPCA 5IYDG 1M1KC 4NXNL 1N33L 2IHFA 1LUZA 4A3KG 3CC2A 3I4OA 1GO3E 3EBEA 3GO5A 2VQEL 2JA7H 3BJUA 3I2ZA 1PH3A 3PO2G 4A3GH 4YWLA 4KI0A 1DGSA 4OO1G 1CKNA 2L15A 3J7ZC 3M4OH 5C44H 1VQJA 4GLXA 1Y1WG 2RHQB 4PZ8A 4JI0Q 5JEAG 2EQSA 3PO3G 3KF6A 1I3QH 2Q2IA 3PUXA 2JJQA 1CKNB 3PUVA 1Z9FA 5LMNQ 4BA2I 4AQYL 1EIFA 4DV2Q 4EX5A 4LF8L 3HOZH 3KF6B 1XPOA 1Q1EA 4LF6Q 3HOWH 3TS2A 4GKKL 2MO0A 1YNXA 5IP7H 1LTLA 5GADC 1QUQB 4DV1L 1B7YB 2BH8A 4L5SA 1PVOA 3RN2A 4A3EG 4LFBL 4NPSA 1PYSB 4UP7A 1B8AA 3CQZH 4A3FH 1VQAA 3G48A 1Q7YC 4BXXG 1XNQQ 5IP9G 1HZBA 1Q86C 2CWAA 4C2MH 1YJNA 4JI5L 4LF7Q 1KL9A 4HJ7A 3NEMA 1C9OA 1A63A 4LF5L 2A8VA 4JYAL 1Q8KA 2FXQA 3KLWA 3OYYA 4DV3L 2EXDA 1MIUA 1FJGQ 4GKJQ 1WFQA 4P75A 3H0GH 3KFUA 1KHIA 4APVA 2E5LL 3GTMH 2JA9A 5JEAJ 1MJCA 1VQBA 4DV4Q 3ICEA 4A3CH 2JA5G 1JJ2A 4X66Q 3GTLH 2R93G 1WJJA 2WP8J 1TWHH 3PSIA 4BY7G 4JV5Q 3PUWA 4C3HH 1PV4A 3K8AA 4DV6Q 3ULPA 4UY8C 1UE1A 1KXLA 1QVCA 4X64L 3BU2A 4JI4L 1WCMH 2K14A 1EUJA 2JEAI 2RHSB 4DR4Q 4IPHA 2XTIA 5LMNW 2OTJA 2YTXA 1IBMQ 3HOUG 4JC0A 4JI8Q 1UE7A 4AYBE 2Y0SG 1U5KA 1VQ5A 1WOCA 5ELOA 5M5XH 4YY3Q 3KF8B 3T1YL 4BY1G 1Y1VH 3VDYA 4OX9L 3PO2H 3KOJA 3FKIH 5AJ3Q 1I6HH 4GNXC 5DLQE 3ULLA 2GN5A 3M9BA 3PUYA 2CWPA 3RLOA 1Q82C 3I56A 1EWIA 4P73A 3I4MG 4L5QA 5HGQA 1H95A 1OXSC 1OXXK 1G6PA 1BBUA 1V9PA 4DV4L 5C4XG 1D8LA 4LUOA 2UUAQ 1HR0Q 3MEFA 1E3PA 3PIPA 3EN2A 1J5EQ 2CCZA 4LF9Q 4JYAQ 4JV5L 5JJIA 1TXYA 2H5XA 1I5FA 5IP9H 1UWVA 3DM3A 4DUYL 4DV7L 1HNXL 2UUCL 2ZM6Q 4LF4Q 4B3SL 3S14H 4DV0Q 3F2DA 4DV5Q 3A5UA 4O2DA 2VW9A 2OQKA 3OW2A 4WJ3M 1IBLL 3RLNA 4JI7L 3E9HA 4IJHA 4LNQA 3RNUA 3KYHC 5FLXc 4DR4L 1N32Q 4PZ7A 2VQFQ 1KIXA 2NZOA 4UPAA 3J80i 2K5VA 4BBRH 4X62L 3CCJA 2F52A 4DR5L 4GOPA 4A75A 2QA4A 1G291 4EQ5A 1VS0A 1M90C 5C3EH 2UXBQ 4DR7L 2R93H 1K8AC 2WB1G 5AJ3L 3J7A5 1IL2A 1EQQA 2OQ0A 4GLVB 4J15A 3RZDH 2NVTH 3CCEA 2K75A 4A3IG 4LFAL 4MZ9A 5IYCH 2HT1A 2F4VQ 1PFSA 1Y14B 3OTOQ 4POGA 2R92G 4DK6C 3J80c 1L1OA 2KBNA 4R4OA 1PA6A 1XMOL 4QL5A 4QY7A 1BVSA 1EOVA 4O0AA 1HR0L 4POFA 4B3RQ 3CAMA 4IO9A 4A4IA 2NN6I 1EIYB 1WYDA 3S1RH 2ZM6L 2WAQE 3G6EA 1HR0W 3A74A 4R4CA 1TWAH 2K52A 4DPGA 3KDFB 2AWNA 5E7NA 3J81j 2KCMA 2D62A 2R7DA 1S3OA 3JAMi 5FLMG 1BKBA 3GTOH 1N32L 1K3RA 4Y52H 1XMQQ 5GAEC 5M3FH 4L5TA 4NB3A 3STBD 1I94Q 1PH9A 5IYBG 4MTNA 1X55A 1E22A 4JBWA 4JOIC 4DR6L 4YWMA 2Z6KC 4P71A 4NXMQ 2UXBL 3RLFA 4DKAC 3CCUA 4IOCA 4B3TL 4X65L 4JCVE 3HKZG 2I5MX 1Q12A 3CCLA 2ZTDA 3JAMc 2F4VL 3OTOL 4DK3C 4A3BH 4IFDG 5FJ8G 1QUQA 2A1AA 2KHIA 5IY0A 2VNUD 2IX1A 4DR1Q 5C0XI 1Z47A 4B3RL 2Q2HA 4YCWA 2ZTCA 1FL0A 1RIPA 3KJPA 3K7AH 3CD6A 4DUZL 1IYJB 3M4PA 3CCVA 4TQUS 5M3MH 5LMUQ 3NBHB 3F1ZA 4GN4B 3PIOA 2ZJRA 4A3JH 5IWAQ 2UU9L 3A0JA 1SRUA 3K80C 3EIVA 1U0LA 4K0KQ 2DUDA 4LUVA 5BR8Q 4GLAC 3F2BA 4A3IH 4BA1I 4A3MH 3W1GA 1PH4A 3M85A 3CMAA 2BA1A 4A93G 1PH2A 1I94L 1IZ6A 1PH1A 1VQOA 1L0WA 1K8GA 1SFOH 4IFDJ 1IBKQ 3S2HH 2YYZA 3G4SA 3F8TA 1N36Q 2K5HA 3CP0A 4JI0L 4HJAA 3HOXH 1NTGA 1JE5A 4GNXA 1XJVA 3RZOH 2JA8G 1YVCA 1IXRA 5LMNL 3HOVG 4HIKA 4DR2Q 4DV2L 3L7ZC 2UXCQ 1V1QA 4GNXB 1OXVA 4LF6L 1YBYA 3GTPH 1VQIA 1HJPA 1QVFA 5IYDH 2JE6I 1A0IA 1LM0A 1YZ6A 2ES2A 1VQHA 1X6OA 4R4QA 4XTCS 4A3KH 1X56A 3S17H 3GDEA 1XNQL 4BBSG 4A3DG 1CKOA 4LFCQ 1G51A 2VY3A 4LF7L 5LMUL 3UDGA 1WI5A 4TVAB 5IWAL 3K7UC 3HKSA 3I7FA 1Y1WH 3S1NH 3ERSX 1JT8A 3M4QA 3W5OA 3PO3H 3UE1A 1FJGL 4GKJL 4Y7NH 1VQKA 2OTLA 4UP8A 1L2FA 2UXDQ 4LW1A 4PMWA 2KENA 3GTQH 4JI3Q 1VQ8A 3HOYG 2VL6A 4X66L 4A3EH 2UUBQ 1SR3A 2B29A 3E9IA 1NY4A 3KJOA 2Q2UA 2NZHA 2R7ZG 2I5HA 2PI2E 1E24A 4DV6L 4BXXH 1HNWQ 1D7QA 1K83H 1YHBA 2MQHA 1N8RC 1N34Q 1R9TH 4DR2L 1KRSA 3J81i 1VQ6A 4HIMA 2HHHQ 1SLJA 4ALPA 2Y0SE 4C3IH 4R4IA 2ZTEA 2PMZE 4JBJA 1IBML 4JI8L 2AHOB 1CKMA 4R4TA 3W1BA 3PF5A 3I4MH 2VZAA 4YY3L 2JA7G 4FDBA 4A3GG 4KHPQ 2JA5H 1X3EA 2RCNA 5C44G 2QEXA 2Q2TA 2EIFA 2E8GA 4DAMA 3J81c 1YJWA 1XPRA 4BY7H 2IY5B 2XGTA 3CC4A 4JBMA 5HY6A 3T1HQ 1YEZA 4DR3Q 3I4NG 4JI6Q 3IRBA 5K36G 1X3GA 3HOZG 3D31A 2ZJPA 3CC7A 3HOWG 5GAGC 5IP7G 1X54A 1VQ9A 1EFWA 2BA0A 2ZJQA 4JI3L 3GTGH 1TWFH 2K4KA 2UUAL 4NXNQ 1N33Q 4A3LG 1HH2P 2Z6KA 4A3FG 2D0PA 1J5EL 5EAYA 4LF9L 2BH2A 3AQQA 1HZCA 3KDFA 3HFZB 1YITA 2AKWB 4LF4L 2VQEQ 4DV0L 2E2JH 4DV5L 4BY1H 1NBWA 1FVIA 4A3LH 4RG1A 3NELA 1PYBA 5M5YH 4YHHQ 2D0OA 4OO1I 3BZKA 3H15A 1CSPA 2VQFL 4X6AH 1K0RA 5J3BA 3H0GG 1N9WA 4B3MQ 4LF8Q 1X9NA 1BBWA 3ULJA 4AIMA 5IT9c 3F2CA 1AE3A 3GD7A 3HOUH 2WB1E 4DV1Q 5C4XH 4A3CG 1HZAA 1P16A 3B6YA 1JJGA 3SGIA 4ME3A 2C35B 4YCUA 1ASYA 2YTYA 4KLKA 3E0EA 1VQFA 4JI5Q 1W3SA 4DR3L 1QVGA 2ALYB 4LF5Q 1SROA 5C4JH 1WCMG 3I55A 1RL2A 1MJEA 2ATWA 1C7YA 3Q8DA 1S72A 4JI1Q 1CUKA 2GVBA 3DLLA 4DV3Q 1MKHA 2NN6G 1L1OC 1KRTA 3TREA 4P74A 4UP9A 5M5WH 1E1TA 4HJ9A 3M3YH 2E5LQ 1AH9A 5ELNA 1FGUA 4R1JA 1EYGA 1Y1VG 3K81C 1NMFA 3CCMA 3FKIG 3JC66 4MNOA 1A62A 2HIXA 2YU9H 4HIOA 1TWCH 1J6QA 1X65A 4PG3A 4DNIA 1QZHA 4RMFA 2VUMG 1GM5A 4YHHL 2NVQH 4OWTB 2VS1A 3I4NH 1VQGA 2B3GA 4X64Q 1XMQL 3CXCA 2R92H 1KD1C 1YIJA 1YI2A 4B3ML 4JI4Q 1B70B 3CCRA 1UE6A 4YWKA 4LWCA 3STBC 2R7FA 3UDIA 3H3VH 3S16H 4H02A 1HNZQ 4NXML 2CFMA 3HKZE 3NENA 5GROA 2I5LX 3CPWA 3A5ZB 3CPFA 1NE3A 3FHWA 1YHAA 4AYBG 4LUZA 2CQOA 4QJFA 3T1YQ 1ASZA 1KQSA 4OX9Q 1I50H 3MXNB 2OCEA 1Q46A 1C0AA 4KHZA 5C0XG 1YHQA 3G71A 2IHEA 4PZ6A 4JI2Q 4WJ4A 4JI1L 4GN5A 3CF5A 1VQDA 1T9HA 2KHJA 4JG2A 5FLMH 5GAHC 4A76A 4BBRG 4DR1L 1S40A 1UEBA 3M7NA 5H1SE 3CW2C 5IYBH 2N8NA 4L5RC 2JA6G 4P72A 1PH6A 5C3EG 2E2IH 1GKHA 4DAYB 1Q81C 3UDXA 1JJCB 3TQYA 1A8VA 2PI2A 3BZCA 1VCIA 4GS3A 4DUYQ 3UE0A 1QZGA 2KCTA 2UUCQ 4DV7Q 4HJ8A 1KC8C 1PH5A 4HIDA 2IT1A 5IYCG 1HNXQ 5BR8L 4B3SQ 1VQPA 4K0KL 3TEHB 1SMXA 5FJ8H 3AYHB 2AMCB 2GVAA 4IPGA 1JB7A 4QQBX 1VQNA 3S2DH 1IBLQ 4JI7Q 2B63G 2Z0SA 3GTKH 1HNZL 2JEBI 2IX0A 1E1OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBK L;  3PV0 A;  1GVP A;  3U50 C;  4DR5 Q;  4X62 Q;  3S15 H;  1N36 L;  1OTC A;  5C0X J;  3LGJ A;  1OXT A;  2K50 A;  3AFP A;  3PCO B;  4QIW E;  1VQC A;  3TRZ A;  2E2H H;  2NVX H;  3S1M H;  1LYL A;  2N3S A;  3CME A;  2F3I A;  3U4Z A;  2AWO A;  4QGU A;  4DR7 Q;  2UXC L;  3FP9 A;  1XPU A;  4C3J H;  4JI2 L;  1SN8 A;  2ID0 A;  2VUM H;  1XTD A;  4LFA Q;  3ER0 A;  2OWO A;  3ZJY C;  5M3F G;  5IE8 A;  3RN5 A;  4IOA A;  1W2B A;  4A93 H;  3PUZ A;  4YCV A;  2QGQ A;  1XNR Q;  3CCS A;  2MNA A;  4LFC L;  1V43 A;  1XMO Q;  2V1C C;  1VQL A;  4JBK A;  3H3V I;  1PHJ A;  1Q1B A;  3S1Q H;  2JQO A;  5JJL A;  2HQL A;  1SE8 A;  3WWV A;  1VQ4 A;  2JA8 H;  3U58 A;  4A3B G;  2N78 A;  2DGY A;  1VQ7 A;  3HOV H;  1P8L A;  1YJ9 A;  2WAQ G;  1O7I A;  1NJI C;  2UXD L;  1GD7 A;  3L2P A;  1UE5 A;  4JOI A;  3RR5 A;  1JMC A;  1OXU A;  2NVY H;  1E7Z A;  2UUB L;  1HZ9 A;  1X3F A;  2N49 A;  2YTV A;  2JA6 H;  1AE2 A;  2PQA A;  5M3M G;  4BBS H;  4DR6 Q;  1N34 L;  4A3D H;  1HNW L;  2YV5 A;  1TWG H;  3U4V A;  4GOP B;  2CKZ B;  4A3J G;  1K73 C;  4GN3 B;  4B3T Q;  2LXJ A;  2PQA B;  4X65 Q;  3GTJ H;  1PH7 A;  2I0Q A;  3PF4 A;  1KAW A;  2MO1 A;  2RF4 A;  2HHH L;  5GQO A;  1PH8 A;  3L0O A;  2ASB A;  3K0X A;  4AH6 A;  4A3M G;  4XIG S;  1VQM A;  4AQY Q;  3AFQ A;  4IJL A;  1VQE A;  1NMG A;  3PGZ A;  2HIV A;  3S24 A;  4GKK Q;  1XNR L;  4IFD I;  1CSQ A;  2MFI A;  2B63 H;  4KHP L;  4GOP C;  3TS0 A;  4OWW B;  2R6G A;  3HOY H;  2LSS A;  1L1O B;  5JJK A;  4LFB Q;  3CCQ A;  1K9M C;  3UDF A;  3HOX G;  4DUZ Q;  2R7Z H;  3T1H L;  3AEV A;  4HJ5 A;  4JI6 L;  2LXK A;  2UU9 Q;  1EQR A;  2A19 A;  3D0F A;  4OWX B;  2PNH A;  2WFW A;  4OON A;  4IPD A;  4OXP A;  2K5N A;  2JK8 A;  4IPC A;  5IYD G;  1M1K C;  4NXN L;  1N33 L;  2IHF A;  1LUZ A;  4A3K G;  3CC2 A;  3I4O A;  1GO3 E;  3EBE A;  3GO5 A;  2VQE L;  2JA7 H;  3BJU A;  3I2Z A;  1PH3 A;  3PO2 G;  4A3G H;  4YWL A;  4KI0 A;  1DGS A;  4OO1 G;  1CKN A;  2L15 A;  3J7Z C;  3M4O H;  5C44 H;  1VQJ A;  4GLX A;  1Y1W G;  2RHQ B;  4PZ8 A;  4JI0 Q;  5JEA G;  2EQS A;  3PO3 G;  3KF6 A;  1I3Q H;  2Q2I A;  3PUX A;  2JJQ A;  1CKN B;  3PUV A;  1Z9F A;  5LMN Q;  4BA2 I;  4AQY L;  1EIF A;  4DV2 Q;  4EX5 A;  4LF8 L;  3HOZ H;  3KF6 B;  1XPO A;  1Q1E A;  4LF6 Q;  3HOW H;  3TS2 A;  4GKK L;  2MO0 A;  1YNX A;  5IP7 H;  1LTL A;  5GAD C;  1QUQ B;  4DV1 L;  1B7Y B;  2BH8 A;  4L5S A;  1PVO A;  3RN2 A;  4A3E G;  4LFB L;  4NPS A;  1PYS B;  4UP7 A;  1B8A A;  3CQZ H;  4A3F H;  1VQA A;  3G48 A;  1Q7Y C;  4BXX G;  1XNQ Q;  5IP9 G;  1HZB A;  1Q86 C;  2CWA A;  4C2M H;  1YJN A;  4JI5 L;  4LF7 Q;  1KL9 A;  4HJ7 A;  3NEM A;  1C9O A;  1A63 A;  4LF5 L;  2A8V A;  4JYA L;  1Q8K A;  2FXQ A;  3KLW A;  3OYY A;  4DV3 L;  2EXD A;  1MIU A;  1FJG Q;  4GKJ Q;  1WFQ A;  4P75 A;  3H0G H;  3KFU A;  1KHI A;  4APV A;  2E5L L;  3GTM H;  2JA9 A;  5JEA J;  1MJC A;  1VQB A;  4DV4 Q;  3ICE A;  4A3C H;  2JA5 G;  1JJ2 A;  4X66 Q;  3GTL H;  2R93 G;  1WJJ A;  2WP8 J;  1TWH H;  3PSI A;  4BY7 G;  4JV5 Q;  3PUW A;  4C3H H;  1PV4 A;  3K8A A;  4DV6 Q;  3ULP A;  4UY8 C;  1UE1 A;  1KXL A;  1QVC A;  4X64 L;  3BU2 A;  4JI4 L;  1WCM H;  2K14 A;  1EUJ A;  2JEA I;  2RHS B;  4DR4 Q;  4IPH A;  2XTI A;  5LMN W;  2OTJ A;  2YTX A;  1IBM Q;  3HOU G;  4JC0 A;  4JI8 Q;  1UE7 A;  4AYB E;  2Y0S G;  1U5K A;  1VQ5 A;  1WOC A;  5ELO A;  5M5X H;  4YY3 Q;  3KF8 B;  3T1Y L;  4BY1 G;  1Y1V H;  3VDY A;  4OX9 L;  3PO2 H;  3KOJ A;  3FKI H;  5AJ3 Q;  1I6H H;  4GNX C;  5DLQ E;  3ULL A;  2GN5 A;  3M9B A;  3PUY A;  2CWP A;  3RLO A;  1Q82 C;  3I56 A;  1EWI A;  4P73 A;  3I4M G;  4L5Q A;  5HGQ A;  1H95 A;  1OXS C;  1OXX K;  1G6P A;  1BBU A;  1V9P A;  4DV4 L;  5C4X G;  1D8L A;  4LUO A;  2UUA Q;  1HR0 Q;  3MEF A;  1E3P A;  3PIP A;  3EN2 A;  1J5E Q;  2CCZ A;  4LF9 Q;  4JYA Q;  4JV5 L;  5JJI A;  1TXY A;  2H5X A;  1I5F A;  5IP9 H;  1UWV A;  3DM3 A;  4DUY L;  4DV7 L;  1HNX L;  2UUC L;  2ZM6 Q;  4LF4 Q;  4B3S L;  3S14 H;  4DV0 Q;  3F2D A;  4DV5 Q;  3A5U A;  4O2D A;  2VW9 A;  2OQK A;  3OW2 A;  4WJ3 M;  1IBL L;  3RLN A;  4JI7 L;  3E9H A;  4IJH A;  4LNQ A;  3RNU A;  3KYH C;  5FLX c;  4DR4 L;  1N32 Q;  4PZ7 A;  2VQF Q;  1KIX A;  2NZO A;  4UPA A;  3J80 i;  2K5V A;  4BBR H;  4X62 L;  3CCJ A;  2F52 A;  4DR5 L;  4GOP A;  4A75 A;  2QA4 A;  1G29 1;  4EQ5 A;  1VS0 A;  1M90 C;  5C3E H;  2UXB Q;  4DR7 L;  2R93 H;  1K8A C;  2WB1 G;  5AJ3 L;  3J7A 5;  1IL2 A;  1EQQ A;  2OQ0 A;  4GLV B;  4J15 A;  3RZD H;  2NVT H;  3CCE A;  2K75 A;  4A3I G;  4LFA L;  4MZ9 A;  5IYC H;  2HT1 A;  2F4V Q;  1PFS A;  1Y14 B;  3OTO Q;  4POG A;  2R92 G;  4DK6 C;  3J80 c;  1L1O A;  2KBN A;  4R4O A;  1PA6 A;  1XMO L;  4QL5 A;  4QY7 A;  1BVS A;  1EOV A;  4O0A A;  1HR0 L;  4POF A;  4B3R Q;  3CAM A;  4IO9 A;  4A4I A;  2NN6 I;  1EIY B;  1WYD A;  3S1R H;  2ZM6 L;  2WAQ E;  3G6E A;  1HR0 W;  3A74 A;  4R4C A;  1TWA H;  2K52 A;  4DPG A;  3KDF B;  2AWN A;  5E7N A;  3J81 j;  2KCM A;  2D62 A;  2R7D A;  1S3O A;  3JAM i;  5FLM G;  1BKB A;  3GTO H;  1N32 L;  1K3R A;  4Y52 H;  1XMQ Q;  5GAE C;  5M3F H;  4L5T A;  4NB3 A;  3STB D;  1I94 Q;  1PH9 A;  5IYB G;  4MTN A;  1X55 A;  1E22 A;  4JBW A;  4JOI C;  4DR6 L;  4YWM A;  2Z6K C;  4P71 A;  4NXM Q;  2UXB L;  3RLF A;  4DKA C;  3CCU A;  4IOC A;  4B3T L;  4X65 L;  4JCV E;  3HKZ G;  2I5M X;  1Q12 A;  3CCL A;  2ZTD A;  3JAM c;  2F4V L;  3OTO L;  4DK3 C;  4A3B H;  4IFD G;  5FJ8 G;  1QUQ A;  2A1A A;  2KHI A;  5IY0 A;  2VNU D;  2IX1 A;  4DR1 Q;  5C0X I;  1Z47 A;  4B3R L;  2Q2H A;  4YCW A;  2ZTC A;  1FL0 A;  1RIP A;  3KJP A;  3K7A H;  3CD6 A;  4DUZ L;  1IYJ B;  3M4P A;  3CCV A;  4TQU S;  5M3M H;  5LMU Q;  3NBH B;  3F1Z A;  4GN4 B;  3PIO A;  2ZJR A;  4A3J H;  5IWA Q;  2UU9 L;  3A0J A;  1SRU A;  3K80 C;  3EIV A;  1U0L A;  4K0K Q;  2DUD A;  4LUV A;  5BR8 Q;  4GLA C;  3F2B A;  4A3I H;  4BA1 I;  4A3M H;  3W1G A;  1PH4 A;  3M85 A;  3CMA A;  2BA1 A;  4A93 G;  1PH2 A;  1I94 L;  1IZ6 A;  1PH1 A;  1VQO A;  1L0W A;  1K8G A;  1SFO H;  4IFD J;  1IBK Q;  3S2H H;  2YYZ A;  3G4S A;  3F8T A;  1N36 Q;  2K5H A;  3CP0 A;  4JI0 L;  4HJA A;  3HOX H;  1NTG A;  1JE5 A;  4GNX A;  1XJV A;  3RZO H;  2JA8 G;  1YVC A;  1IXR A;  5LMN L;  3HOV G;  4HIK A;  4DR2 Q;  4DV2 L;  3L7Z C;  2UXC Q;  1V1Q A;  4GNX B;  1OXV A;  4LF6 L;  1YBY A;  3GTP H;  1VQI A;  1HJP A;  1QVF A;  5IYD H;  2JE6 I;  1A0I A;  1LM0 A;  1YZ6 A;  2ES2 A;  1VQH A;  1X6O A;  4R4Q A;  4XTC S;  4A3K H;  1X56 A;  3S17 H;  3GDE A;  1XNQ L;  4BBS G;  4A3D G;  1CKO A;  4LFC Q;  1G51 A;  2VY3 A;  4LF7 L;  5LMU L;  3UDG A;  1WI5 A;  4TVA B;  5IWA L;  3K7U C;  3HKS A;  3I7F A;  1Y1W H;  3S1N H;  3ERS X;  1JT8 A;  3M4Q A;  3W5O A;  3PO3 H;  3UE1 A;  1FJG L;  4GKJ L;  4Y7N H;  1VQK A;  2OTL A;  4UP8 A;  1L2F A;  2UXD Q;  4LW1 A;  4PMW A;  2KEN A;  3GTQ H;  4JI3 Q;  1VQ8 A;  3HOY G;  2VL6 A;  4X66 L;  4A3E H;  2UUB Q;  1SR3 A;  2B29 A;  3E9I A;  1NY4 A;  3KJO A;  2Q2U A;  2NZH A;  2R7Z G;  2I5H A;  2PI2 E;  1E24 A;  4DV6 L;  4BXX H;  1HNW Q;  1D7Q A;  1K83 H;  1YHB A;  2MQH A;  1N8R C;  1N34 Q;  1R9T H;  4DR2 L;  1KRS A;  3J81 i;  1VQ6 A;  4HIM A;  2HHH Q;  1SLJ A;  4ALP A;  2Y0S E;  4C3I H;  4R4I A;  2ZTE A;  2PMZ E;  4JBJ A;  1IBM L;  4JI8 L;  2AHO B;  1CKM A;  4R4T A;  3W1B A;  3PF5 A;  3I4M H;  2VZA A;  4YY3 L;  2JA7 G;  4FDB A;  4A3G G;  4KHP Q;  2JA5 H;  1X3E A;  2RCN A;  5C44 G;  2QEX A;  2Q2T A;  2EIF A;  2E8G A;  4DAM A;  3J81 c;  1YJW A;  1XPR A;  4BY7 H;  2IY5 B;  2XGT A;  3CC4 A;  4JBM A;  5HY6 A;  3T1H Q;  1YEZ A;  4DR3 Q;  3I4N G;  4JI6 Q;  3IRB A;  5K36 G;  1X3G A;  3HOZ G;  3D31 A;  2ZJP A;  3CC7 A;  3HOW G;  5GAG C;  5IP7 G;  1X54 A;  1VQ9 A;  1EFW A;  2BA0 A;  2ZJQ A;  4JI3 L;  3GTG H;  1TWF H;  2K4K A;  2UUA L;  4NXN Q;  1N33 Q;  4A3L G;  1HH2 P;  2Z6K A;  4A3F G;  2D0P A;  1J5E L;  5EAY A;  4LF9 L;  2BH2 A;  3AQQ A;  1HZC A;  3KDF A;  3HFZ B;  1YIT A;  2AKW B;  4LF4 L;  2VQE Q;  4DV0 L;  2E2J H;  4DV5 L;  4BY1 H;  1NBW A;  1FVI A;  4A3L H;  4RG1 A;  3NEL A;  1PYB A;  5M5Y H;  4YHH Q;  2D0O A;  4OO1 I;  3BZK A;  3H15 A;  1CSP A;  2VQF L;  4X6A H;  1K0R A;  5J3B A;  3H0G G;  1N9W A;  4B3M Q;  4LF8 Q;  1X9N A;  1BBW A;  3ULJ A;  4AIM A;  5IT9 c;  3F2C A;  1AE3 A;  3GD7 A;  3HOU H;  2WB1 E;  4DV1 Q;  5C4X H;  4A3C G;  1HZA A;  1P16 A;  3B6Y A;  1JJG A;  3SGI A;  4ME3 A;  2C35 B;  4YCU A;  1ASY A;  2YTY A;  4KLK A;  3E0E A;  1VQF A;  4JI5 Q;  1W3S A;  4DR3 L;  1QVG A;  2ALY B;  4LF5 Q;  1SRO A;  5C4J H;  1WCM G;  3I55 A;  1RL2 A;  1MJE A;  2ATW A;  1C7Y A;  3Q8D A;  1S72 A;  4JI1 Q;  1CUK A;  2GVB A;  3DLL A;  4DV3 Q;  1MKH A;  2NN6 G;  1L1O C;  1KRT A;  3TRE A;  4P74 A;  4UP9 A;  5M5W H;  1E1T A;  4HJ9 A;  3M3Y H;  2E5L Q;  1AH9 A;  5ELN A;  1FGU A;  4R1J A;  1EYG A;  1Y1V G;  3K81 C;  1NMF A;  3CCM A;  3FKI G;  3JC6 6;  4MNO A;  1A62 A;  2HIX A;  2YU9 H;  4HIO A;  1TWC H;  1J6Q A;  1X65 A;  4PG3 A;  4DNI A;  1QZH A;  4RMF A;  2VUM G;  1GM5 A;  4YHH L;  2NVQ H;  4OWT B;  2VS1 A;  3I4N H;  1VQG A;  2B3G A;  4X64 Q;  1XMQ L;  3CXC A;  2R92 H;  1KD1 C;  1YIJ A;  1YI2 A;  4B3M L;  4JI4 Q;  1B70 B;  3CCR A;  1UE6 A;  4YWK A;  4LWC A;  3STB C;  2R7F A;  3UDI A;  3H3V H;  3S16 H;  4H02 A;  1HNZ Q;  4NXM L;  2CFM A;  3HKZ E;  3NEN A;  5GRO A;  2I5L X;  3CPW A;  3A5Z B;  3CPF A;  1NE3 A;  3FHW A;  1YHA A;  4AYB G;  4LUZ A;  2CQO A;  4QJF A;  3T1Y Q;  1ASZ A;  1KQS A;  4OX9 Q;  1I50 H;  3MXN B;  2OCE A;  1Q46 A;  1C0A A;  4KHZ A;  5C0X G;  1YHQ A;  3G71 A;  2IHE A;  4PZ6 A;  4JI2 Q;  4WJ4 A;  4JI1 L;  4GN5 A;  3CF5 A;  1VQD A;  1T9H A;  2KHJ A;  4JG2 A;  5FLM H;  5GAH C;  4A76 A;  4BBR G;  4DR1 L;  1S40 A;  1UEB A;  3M7N A;  5H1S E;  3CW2 C;  5IYB H;  2N8N A;  4L5R C;  2JA6 G;  4P72 A;  1PH6 A;  5C3E G;  2E2I H;  1GKH A;  4DAY B;  1Q81 C;  3UDX A;  1JJC B;  3TQY A;  1A8V A;  2PI2 A;  3BZC A;  1VCI A;  4GS3 A;  4DUY Q;  3UE0 A;  1QZG A;  2KCT A;  2UUC Q;  4DV7 Q;  4HJ8 A;  1KC8 C;  1PH5 A;  4HID A;  2IT1 A;  5IYC G;  1HNX Q;  5BR8 L;  4B3S Q;  1VQP A;  4K0K L;  3TEH B;  1SMX A;  5FJ8 H;  3AYH B;  2AMC B;  2GVA A;  4IPG A;  1JB7 A;  4QQB X;  1VQN A;  3S2D H;  1IBL Q;  4JI7 Q;  2B63 G;  2Z0S A;  3GTK H;  1HNZ L;  2JEB I;  2IX0 A;  1E1O A; 
#chains in the Genus database with same CATH topology
 3C2P A;  3PV0 A;  3S15 H;  2MHV A;  1N36 L;  5C0X J;  3LGJ A;  4CDE C;  3OW7 A;  4QIW E;  3L3O C;  1FR3 A;  4BY1 B;  3CME A;  3U4Z A;  2AWO A;  4CKE A;  2UXC L;  2CW0 D;  1XPU A;  4J1M A;  3OIQ A;  3P7J A;  5DAU A;  5L37 A;  2VUM H;  1XTD A;  2IL8 A;  3RN5 A;  1GUO A;  4IOA A;  3PUZ A;  4NDX A;  2LY7 A;  1NR2 A;  2XRQ D;  4NP5 A;  1NCV A;  4JBK A;  3FPP A;  3IL8 A;  1ET9 A;  5CV7 A;  1J8I A;  4OIJ A;  4K2L A;  4A3B G;  4RKL A;  2DGY A;  1VQ7 A;  1O7I A;  1NJI C;  5D14 A;  3RR5 A;  1NNX A;  2FMC A;  5M5W B;  1JMC A;  3VR6 A;  3A56 A;  1V1O A;  1X3F A;  2N49 A;  5KND A;  2HD3 A;  5JVG 3;  1HNW L;  3T16 A;  2YV5 A;  1Z6H A;  4CBV A;  5I9P A;  4B3T Q;  2LXJ A;  4X65 Q;  2I0Q A;  2RF4 A;  3K0X A;  4NMZ A;  2A6E D;  1Q8I A;  4XIG S;  2R92 B;  2NTS A;  3AFQ A;  2EY2 A;  1KAB A;  1NMG A;  1XNR L;  2EYM A;  5JPM C;  2B2V A;  2MFI A;  2B63 H;  1EU3 A;  3TS0 A;  2R6G A;  4C1N I;  5C4H A;  3HOX G;  1BCP D;  1CT1 D;  4DN4 M;  2R7Z H;  1QIL A;  3T1H L;  4HJ5 A;  1A15 A;  2LXK A;  4ZAI A;  3H91 A;  2KOL A;  1LLR D;  1PFN A;  4NXN L;  1FNU A;  4A3K G;  1SMY C;  3CC2 A;  3D4W A;  2BE5 C;  2VQE L;  1PH3 A;  1DOK A;  3PO2 G;  2G5D A;  3OMC A;  1DGS A;  4H0L C;  1CKN A;  1S5C D;  3P75 A;  1E0B A;  4PQX A;  5JEA G;  1BQQ T;  5K36 H;  4EX5 A;  1SYF A;  2EYH A;  3KF6 B;  3TS2 A;  2MO0 A;  5IP7 H;  1LTL A;  3GP7 A;  5FLX L;  2BH8 A;  4L5S A;  1PVO A;  3RN2 A;  3PMF A;  2X6L A;  1PYS B;  4A3L H;  1AEX A;  4A3F H;  5IP9 G;  1O78 A;  1Q86 C;  3S1M B;  1KL9 A;  4HJ7 A;  4V19 0;  5FK9 C;  2CH4 W;  2A8V A;  2WV6 D;  1NUC A;  3AU7 A;  1TS2 A;  2RVL A;  4K14 A;  4B9X A;  2B2Y A;  2LKV A;  4GKJ Q;  4DAY A;  4A93 B;  4RGT A;  3H0G H;  2E5L L;  1SJH D;  4FF2 A;  3GTM H;  5JEA J;  4DAP A;  5EPK A;  1FNW A;  2WAC A;  2WP8 J;  1TWH H;  3KLS X;  3S1Q B;  4JV5 Q;  2PPB C;  2BDO A;  3K8A A;  4DV6 Q;  3IFT A;  1UE1 A;  3J7A V;  1VF7 A;  3BVM A;  3BU2 A;  2K14 A;  3FDT A;  5COY A;  5LMN W;  2NVY B;  2OTJ A;  1UEA B;  1K3B C;  1IBM Q;  1RD9 D;  2L4N A;  4A3D B;  5M5X H;  2D5D A;  3KF8 B;  4ZLT F;  4BY1 G;  3VDY A;  3KOJ A;  3GTJ B;  5K5P A;  3J80 E;  3NTK A;  2PZU A;  5NUC A;  1AZP A;  2NZ1 D;  3M9B A;  4X3S A;  2CWP A;  3HG9 A;  2DN8 A;  4IUU A;  1KTK A;  4MTK A;  2JSO A;  2KEE A;  1W6J A;  5IOD A;  1G6P A;  1BBU A;  4DV4 L;  2A5H A;  1J5E Q;  2CCZ A;  2UUC L;  2H5X A;  1I5F A;  3DM3 A;  4DV7 L;  1PTO H;  5I4D A;  3F2D A;  2SDF A;  4O2D A;  5EJW A;  5C0X H;  2VW9 A;  4XQQ A;  4M8A A;  4WJ3 M;  1ICF B;  1VMC A;  3RNU A;  3MXG A;  5FLX c;  1N32 Q;  2VQF Q;  4I7Z C;  2R61 A;  4BBR H;  4DR5 L;  1G29 1;  3PIP 3;  2F0O A;  3GV3 A;  1M90 C;  4A3G B;  2XNA C;  3A7A B;  3QWN A;  1SNM A;  1Z7T A;  4DR7 L;  3M4O B;  2XVS A;  2R93 H;  1TWC B;  1IL2 A;  1EQQ A;  1H9J A;  4MZ9 A;  4K8I A;  5KIX A;  2HT1 A;  1Y14 B;  4KD3 A;  2R92 G;  4K6D A;  3T13 A;  3HOZ B;  1JQY D;  4KY6 A;  2O4X A;  2F0H A;  4R4O A;  4OEM B;  2B39 A;  1XMO L;  1Q90 A;  4QY7 A;  1BVS A;  1PRT C;  4B3R Q;  2F0E A;  3CAM A;  1JWU D;  2F0N A;  3H6M A;  1EIY B;  1I6V C;  1WYD A;  3S1R H;  2ZM6 L;  1WTW A;  3NQI A;  3VYS A;  1ENF A;  2NTT A;  2C5C A;  3RUZ A;  4EVO A;  5E7N A;  2QW7 A;  2RKS A;  4KD4 A;  2R7D A;  1HRJ A;  1I4X A;  1PH9 A;  1QB5 D;  1JE4 A;  1JOO A;  4YWM A;  1KLU D;  2UXB L;  4NXM Q;  1I4H A;  4IOC A;  1HPC A;  1XXG A;  2B2T A;  1KDC A;  3MHB A;  4XT3 B;  1D1I A;  4A3B H;  2L9H A;  5FJ8 G;  1F2Y A;  1TY0 A;  3HGB A;  4LK1 C;  1TS4 A;  2KHI A;  4DR1 Q;  5C0X I;  2A74 C;  4YCW A;  1JWS D;  1A2T A;  1FL0 A;  3NBH A;  3KJP A;  3CD6 A;  4DUZ L;  3M4P A;  5CV4 A;  2D9U A;  1QE6 A;  2TSS A;  2QCP X;  1SRU A;  3K80 C;  2VUM B;  1U0L A;  4G57 A;  2DUD A;  4BA1 I;  1PH4 A;  2KEC A;  5JAV A;  4A93 G;  3QJY A;  1I94 L;  4S3S A;  2B8G A;  2F0J A;  3DHQ A;  1QJO A;  1LAB A;  4O1N A;  1CQF A;  2K5H A;  4JI0 L;  4TSS A;  3HOX H;  1ZYR C;  1JE5 A;  4HMI A;  2EPB A;  4GNX A;  2XN9 C;  2PCF B;  3S14 B;  4AYB B;  5LMN L;  4DR2 Q;  4DV2 L;  1ZKO A;  5JOB A;  3QO2 A;  2P5Z X;  3GTP H;  1VQI A;  2NYZ D;  1HJP A;  5FO7 B;  3KF8 A;  1LM0 A;  4WJ4 A;  3WDN A;  3UI2 A;  4XTC S;  4A3K H;  1X56 A;  3GDE A;  2N88 A;  4A3D G;  1PTO C;  2RDH A;  2VY3 A;  4WOR A;  3UDG A;  1QG7 A;  5KYI A;  3RZD B;  3HKS A;  5JEA H;  4XT1 B;  3JAM L;  2F0S A;  1GHJ A;  4LW1 A;  4PMW A;  2B63 B;  1EIG A;  5IGF A;  2VL6 A;  1SE2 A;  2UUB Q;  3QOJ A;  3E9I A;  4K2K A;  1WVL A;  2I5H A;  3PQI A;  1IKL A;  4IUV A;  5J1Z A;  3I72 A;  1KRS A;  1VQ6 A;  3D8G A;  4N8F A;  3GTO B;  3X3M A;  2Y0S E;  1B2T A;  2V4D A;  1LO5 D;  4JI8 L;  1KAA A;  1EYD A;  1CKM A;  1PXU A;  4KHP Q;  4A3G G;  1CI3 M;  1PRT B;  1X3E A;  3FEW X;  4X3U A;  2EIF A;  1XPR A;  2XGT A;  4JBM A;  1A3V A;  5HY6 A;  1YEZ A;  1EZ8 A;  1X3G A;  2L12 A;  5CBA E;  3HOZ G;  2ZJP A;  3VR2 A;  1X54 A;  4HCS A;  1EFW A;  2G9D A;  1WTO A;  2UUA L;  1N33 Q;  2PW5 A;  2D0P A;  4NW2 A;  5EAY A;  1YIT A;  3HFZ B;  5M3M B;  5CC4 A;  2AKW B;  2ICE C;  4FXG C;  4BY1 H;  2CQA A;  4RG1 A;  3NEL A;  5ELF A;  1LT5 D;  4KKT A;  4A3M B;  1M4V A;  1CSP A;  1K0R A;  1MHW C;  4KY7 A;  5J3B A;  1X9N A;  1JOR A;  3F2C A;  3GTM B;  4HSP A;  5EKK A;  4A3C G;  2E2D C;  3S2H B;  3SGI A;  3SXH A;  2E74 C;  1S5E D;  1LTB D;  4JI5 Q;  4LF5 Q;  4RCO A;  2ATW A;  1BCP F;  2Z9H A;  2M00 A;  1CUK A;  2GVB A;  3DLL A;  5JVH 3;  1B44 D;  1L1O C;  1KRT A;  1XX8 A;  5M5W H;  1B4O A;  1ENA A;  2B2V C;  1AH9 A;  5CGK A;  5ELN A;  2WKD A;  3MVV A;  3K81 C;  3KBG A;  4MNO A;  3J81 L;  4CKC A;  3S1N B;  3T51 B;  1SYE A;  1QZH A;  2VUM G;  4YHH L;  2NVQ H;  1VQG A;  2B3G A;  1U4L A;  2R92 H;  1TT2 A;  1SYB A;  5IGE A;  1YI2 A;  3IFD A;  4KMU C;  4KN4 C;  4G7Z C;  3GTQ B;  3H94 A;  4H02 A;  2L1B A;  4A3E B;  1PTO D;  2CFM A;  5GRO A;  3A5Z B;  4ID6 A;  1ONL A;  3CPF A;  1NE3 A;  2RQX A;  3E5S A;  4QJF A;  2CQO A;  4AYB G;  4OX9 Q;  3G71 A;  4JI1 L;  4C3I B;  4GN5 A;  4I7A A;  2KHJ A;  4A76 A;  5TSS A;  5H1S E;  1W6K A;  1Y8P B;  1PH6 A;  2JA5 B;  4RGN A;  1JJC B;  2F4I A;  4ZKB B;  1CFM A;  5CR3 A;  3NSW A;  1Q3L A;  1VCI A;  1QZG A;  3IAY A;  4HJ8 A;  1PH5 A;  2IW3 A;  2IT1 A;  1NR4 A;  4B3S Q;  5BR8 L;  2IWH A;  5FJ8 H;  1HCZ A;  4QQB X;  1VQN A;  5I6Y A;  3GTG B;  2F0M A;  1TWF B;  4BS9 A;  2B63 G;  2IX0 A;  3RD4 A;  3NUC A;  4R8I A;  1IBK L;  3HOU B;  3U50 C;  4X62 Q;  3S1M H;  2F3I A;  3R8B A;  4K8J A;  3FP9 A;  4C3J H;  4JI2 L;  3DWQ A;  4QF4 A;  2ID0 A;  1TS5 A;  3ER0 A;  3ZJY C;  2I46 A;  3LNN A;  5EGT A;  3I4M B;  1W2B A;  4A93 H;  2QGQ A;  5C4X B;  3R93 A;  2A68 C;  1STB A;  3S1Q H;  4IAL A;  1SE8 A;  4UHV A;  1P8L A;  5FO9 B;  2EYJ A;  1SBB B;  1OXU A;  2NVY H;  3VR4 A;  5KGU A;  2PZW A;  5EKI A;  1HZ9 A;  4A3D H;  1AE2 A;  2PQA A;  5M3M G;  4DR6 Q;  1N34 L;  1HUM A;  4RHS A;  3ITP A;  4GN3 B;  1G6Z A;  2YU9 B;  3GTJ H;  3PF4 A;  2ASB A;  4A3M G;  3K5M A;  4AQY Q;  3DMU A;  4IJL A;  5E4X A;  2OT2 A;  2EZV A;  1PFM A;  1L1O B;  3CCQ A;  1K9M C;  2EXZ A;  4Q5V A;  5T1G A;  4F8M A;  1YNN C;  4QUC A;  4JI6 L;  4KKU A;  1EQR A;  2A19 A;  3D0F A;  5EPJ A;  4OON A;  3GTP B;  1F2M A;  2JK8 A;  1FYC A;  3DWA A;  4DFA A;  4XDX A;  1SDF A;  3C1E A;  3W2D A;  2L5T A;  2RBM A;  3E6Z X;  3K0Y A;  3HRZ C;  4A3G H;  3MC0 B;  4KI0 A;  2DY7 A;  3J7Z C;  3DEP A;  3M4O H;  1IW7 D;  2RHQ B;  3K5O A;  2VXW A;  3HKZ B;  2PW7 A;  2JJQ A;  1CKN B;  1EEI D;  3PUV A;  1E2V A;  4IUQ A;  3HOZ H;  3S2D B;  1XPO A;  1Q1E A;  1AZQ A;  1WTR A;  1YNX A;  4A3E G;  4UP7 A;  1VQA A;  4FF1 A;  3OHX C;  2NVX B;  1D1K A;  1R4P B;  4LF7 Q;  3NPP A;  1A63 A;  2B2T C;  1Q8K A;  2FXQ A;  4DV3 L;  3ERO A;  5BN4 A;  4C3I G;  1EQV A;  4PMC A;  2EXD A;  1EYA A;  4G7O C;  4P75 A;  1BO0 A;  4L6T B;  4A3C H;  2JA5 G;  2X6G A;  2R93 G;  1WJJ A;  3PSI A;  1PMR A;  3PUW A;  4B08 A;  2HUG A;  2K5D A;  1WTX A;  4UY8 C;  5FLX E;  4X64 L;  4QIW B;  5IGB A;  4IQZ A;  1EUJ A;  2JEA I;  4DR4 Q;  1LAC A;  2JXM B;  3HOU G;  4JC0 A;  3Q24 A;  4G7H C;  4BBS B;  3FMC A;  5ELO A;  2A68 D;  1TWG B;  1OO9 B;  4GNX C;  5DLQ E;  1T5X D;  4ILW A;  3MXP A;  3G7L A;  1Q82 C;  3I56 A;  1G2S A;  3I4M G;  5ISR A;  4F7X A;  5HGQ A;  1OXX K;  1V9P A;  5C4X G;  2PQE A;  1S5F D;  1C8C A;  1SXT A;  1HR0 Q;  3MEF A;  2Z8L A;  1E3P A;  3EN2 A;  4LF9 Q;  4JVZ A;  5DM6 3;  4JYA Q;  4JV5 L;  1SJE D;  4DK1 A;  4DUY L;  4LF4 Q;  3S14 H;  1EYC A;  5LL6 X;  1PZI D;  4JI7 L;  3D3R A;  3RLN A;  4IJH A;  1UUP A;  3WOF A;  1KIX A;  2F0K A;  3CU7 A;  1DCZ A;  4H7B A;  1GXD C;  3J7A F;  2JA7 B;  1SYC A;  1MD2 D;  2EVB A;  1WTP A;  1F77 A;  3F2U A;  5C44 B;  1YNN D;  2Z4H A;  4OIK A;  3RZD H;  1S5D D;  2NVQ B;  4LFA L;  5COR A;  2F4V Q;  3OTO Q;  1ILP A;  1SNP A;  3HOW B;  1L1O A;  3SK6 A;  3MWY W;  4OEL B;  1EOV A;  3CQZ B;  4EQN A;  4ZKC B;  2HDL A;  2WAQ E;  1G2T A;  1F9S A;  1SE4 A;  3SDZ A;  3GTO H;  5FLM G;  3LX0 A;  1N32 L;  4Y52 H;  4NB3 A;  3QR8 A;  5DM7 3;  4MTN A;  1E22 A;  4JBW A;  2MP1 A;  1ENC A;  3GTL B;  4DKA C;  4C3H B;  1H9K A;  3HKZ G;  2I5M X;  2KUM A;  1RDP D;  4DA2 A;  4RFB A;  4ODG A;  1MI2 A;  1WCM B;  1LT4 D;  2A1A A;  2AQ2 B;  1CTM A;  1ESR A;  2KED A;  1D2B A;  2IX1 A;  1AP0 A;  4B3R L;  2ZTC A;  5DNF A;  1HA5 A;  2PNR C;  1WTQ A;  1IYU A;  4J6H A;  4TQU S;  5M3M H;  1O7Y A;  1I4P A;  5KNB A;  5LMU Q;  1GUN A;  1KLG D;  3NBH B;  3PIO A;  3FKI B;  1I6H B;  2UU9 L;  5IWA Q;  3Q22 A;  4C3J B;  4DK0 A;  5F2D A;  4K0K Q;  4LUV A;  4A3M H;  3M85 A;  1JB3 A;  1JCK B;  1PH2 A;  5A2Q L;  1VQO A;  5CV6 A;  1L0W A;  3A8J E;  3S2H H;  1STA A;  3F8T A;  1N36 Q;  5C6A A;  1EQT A;  4ZYS A;  1YVC A;  1IXR A;  2KCC A;  1J9O A;  1CA6 A;  5J39 A;  1X3P A;  2UXC Q;  2D2C C;  4GNX B;  1D5X C;  3H09 A;  3TN2 A;  4LF6 L;  1YBY A;  1HQR D;  4HAE A;  4P2C B;  3MTS A;  2NUC A;  2ES2 A;  4R4Q A;  1X6O A;  2RSO A;  4DAV A;  1XNQ L;  4BBS G;  5ELC A;  4TVA B;  3K7U C;  1QNU A;  3S1N H;  1CHP D;  1H9R A;  4OHJ A;  3R2I A;  3QOL A;  1FJG L;  2K6A A;  4UP8 A;  1L2F A;  2CHB D;  3GTQ H;  3QB3 A;  4FO2 A;  3OIP A;  4X66 L;  4A3E H;  1NY4 A;  4YIJ A;  3DM1 A;  5FOB B;  2Q2U A;  2PI2 E;  2PMZ B;  1HNW Q;  1LV9 A;  2J4X A;  3I4L A;  4CJ1 B;  1N8R C;  1TWA B;  1BR9 A;  4DR2 L;  4CHT B;  1Y8N B;  4HIM A;  5KRU A;  2I07 B;  1BDO A;  3DXJ C;  4C3I H;  4ALP A;  2PMZ E;  4R4T A;  2IX3 A;  2VZA A;  4YY3 L;  4ZUJ A;  2JA7 G;  2JA5 H;  3JAM E;  4IUT A;  2RCN A;  3IKJ A;  5C44 G;  2QEX A;  4DAM A;  1JOQ A;  1YNJ C;  2OEO A;  3T1H Q;  4DR3 Q;  3DUZ A;  4EGV A;  2MUY A;  2F3V A;  3D31 A;  2RDG A;  3CC7 A;  3HOW G;  5GAG C;  3SHL A;  1VQ9 A;  2ZJQ A;  1F9R A;  3MFY A;  1SMY D;  2OF1 A;  1TWF H;  4CJ2 C;  3GTG H;  4NXN Q;  1PFB A;  1HH2 P;  3HOU H;  2BE5 D;  5E1F A;  1GJX A;  2VQE Q;  4EQO A;  1V8Q A;  4DV0 L;  4A3J B;  1BNZ A;  4DV5 L;  1AN8 A;  1PYB A;  4JK1 C;  1EY0 A;  3CRL C;  3BZK A;  1X32 A;  3H15 A;  3I4M H;  1S5B D;  3ULJ A;  4AIM A;  1DON A;  1AE3 A;  3GD7 A;  1EOT A;  2WB1 E;  1SFO B;  5C4X H;  1P16 A;  4DXF A;  1WD1 A;  1GUS A;  1ASY A;  1TVX A;  4KLK A;  4C3H G;  5LHY 1;  3E0E A;  1STN A;  4IUN A;  4C1N K;  1QVG A;  4N9P A;  2ALY B;  5CMD A;  5C4J H;  1WCM G;  3I55 A;  1MJE A;  1C7Y A;  5ELB A;  3Q8D A;  1S72 A;  2L11 A;  3H3V C;  5E4W C;  4P74 A;  5A35 A;  4MN3 A;  2E5L Q;  4WFN 3;  2EYO A;  1FGU A;  4R1J A;  1EYG A;  2RA4 A;  1NMF A;  3FKI G;  1A62 A;  2Z4I A;  2ZXO A;  5G3L F;  4HIO A;  1Y1W B;  4C3J G;  1X65 A;  2YU9 H;  3PO3 B;  1K8O A;  4OWT B;  2VS1 A;  3I4N H;  3BDC A;  1XMQ L;  2CH4 A;  1KD1 C;  2K04 A;  2K33 A;  3CCR A;  3N6R A;  3STB C;  2H4O A;  1HNZ Q;  2B2W C;  4QUF A;  3NEN A;  3GQB A;  4RGO S;  1K83 B;  2FIN B;  1R9T B;  1MGS A;  1YHA A;  3P1H A;  4LUZ A;  4TRD A;  3OSO A;  5D65 A;  3MXN B;  3V05 A;  1Q46 A;  1YHQ A;  4PZ6 A;  4RKB A;  3AMU A;  2K05 A;  1VQD A;  5KEE A;  5FLM H;  1S40 A;  3M7N A;  4RCN A;  1SNQ A;  3L9A X;  4XXE A;  1ET6 A;  5IGD A;  3J81 E;  1EEF D;  4XYO A;  1GKH A;  4TKO B;  3HZX A;  4BY7 B;  3TQY A;  1A8V A;  2PI2 A;  1DJR D;  4CKB A;  2F03 A;  2UUC Q;  2QDB A;  4DV7 Q;  1SE3 A;  5IYC G;  2GVA A;  1JB7 A;  3S2D H;  1U9R A;  1TQO A;  2Z0S A;  1O80 A;  2JEB I;  4OGQ C;  4DR5 Q;  1V1P B;  5D3I B;  1OTC A;  2Y0S B;  1VQC A;  3TRZ A;  2NVX H;  2E2J B;  2N3S A;  3EJI A;  4QGU A;  4DR7 Q;  4Z9C B;  1YNJ D;  4QB4 A;  1KDA A;  1SN8 A;  2BDN A;  4B9W A;  1PZJ D;  2Q8T A;  2OWO A;  5CBE E;  2ENB A;  1DOL A;  4YCV A;  3TP8 A;  1PRT D;  3CCS A;  4ZK9 B;  2RSN A;  2MNA A;  4LFC L;  1V43 A;  1XMO Q;  4N9T A;  1VQL A;  2DNE A;  1PHJ A;  1I4G A;  2HQL A;  2N78 A;  5I9O A;  1B1Z A;  3E0J A;  2UXD L;  3EVQ A;  4XQJ A;  1UE5 A;  1E7Z A;  3NK9 A;  1FGB D;  4BBS H;  4MHE A;  1TWG H;  4GOP B;  1RCV D;  4A3J G;  2K5W A;  2PQA B;  4H13 C;  4U67 3;  1UAP A;  1PH7 A;  1KAW A;  2MO1 A;  2HHH L;  5GQO A;  3L0O A;  3GV6 A;  4AH6 A;  1VQM A;  1GOZ A;  1X3Q A;  3EQL C;  2SEB D;  1SEB D;  3PGZ A;  4GKK Q;  2G9H D;  3W3A A;  4OWW B;  3VR5 A;  2LSS A;  5JJK A;  4LFB Q;  2KQ3 A;  2ZXR A;  4J8Q A;  4DUZ Q;  2F0V A;  1JOK A;  3AEV A;  2HQE A;  4IZ8 A;  1I50 B;  5HUR A;  2PNH A;  4Q0F A;  1LTT D;  2K5N A;  4IPC A;  4K5X A;  3BYY B;  3U9O A;  5BN5 A;  3QG1 A;  2E2I B;  1GO3 E;  3EBE A;  2JA7 H;  1ZYR D;  4IUR A;  4OO1 G;  4R8N A;  1RF2 D;  2L15 A;  1AFP A;  3TSS A;  1VQJ A;  5C44 H;  4GLX A;  1Y1W G;  4JI0 Q;  2IPK D;  2F1M A;  2O2L D;  1CA5 A;  1U4M A;  1SSO A;  4U68 A;  2Q2I A;  4F88 A;  3PO3 G;  1CHQ D;  1Z9F A;  5LMN Q;  4BA2 I;  4AQY L;  1EIF A;  4DV2 Q;  4LF8 L;  5AFW A;  1JR0 D;  3HOW H;  3O13 A;  1QUQ B;  4DV1 L;  1WD0 A;  4CDC C;  2NWG A;  4NPS A;  1MSH A;  3CQZ H;  3MXN A;  4PMB A;  1L0X B;  2CWA A;  1YJN A;  2E2H B;  2Q8R E;  3K5L A;  1LTS D;  3OMG A;  1TS3 A;  2EY5 A;  2FMM A;  1MIU A;  3AB9 A;  3I73 A;  2QIL A;  3I3C A;  1MJC A;  1VQB A;  3GTL H;  4BY7 G;  5ELE A;  4C3H H;  2JA8 B;  1IKM A;  3ULP A;  1B9M A;  1EY6 A;  2EDG A;  3HOV B;  1QVC A;  4JI4 L;  1WCM H;  3NQT A;  2FJ2 A;  1EFI D;  1V1P A;  2DNC A;  2PYK A;  3KLS A;  4JI8 Q;  1LT3 D;  3OPO A;  4XYQ A;  2Y0S G;  1U5K A;  2MPM A;  3T1Y L;  3FKI H;  5CV8 A;  4O42 A;  5AJ3 Q;  1I6H H;  1HTL D;  4HSV A;  3ULL A;  2GN5 A;  3BG3 A;  4QMG A;  4P73 A;  3SK4 A;  2K5Q A;  3HOY B;  1D8L A;  2UUA Q;  1O7L A;  1HNX L;  1SYD A;  5C4J B;  2CVR A;  3A5U A;  2JN4 A;  4DXG A;  4ABN A;  3OW2 A;  1IBL L;  5LL6 S;  4DR4 L;  3KYH C;  4UPA A;  2EYL A;  3CCJ A;  4GOP A;  2F52 A;  4A75 A;  2QA4 A;  4EQ5 A;  1D5Z C;  1ESF A;  1JWM D;  4XQN A;  1GUW A;  1K8A C;  3J7A 5;  2OQ0 A;  2K75 A;  2CW0 C;  3I4N B;  5IYC H;  1PFS A;  2J0T D;  4POG A;  1O7Z A;  2EJG C;  1DOM A;  5EBD A;  1PA6 A;  4QL5 A;  3DWP A;  1HR0 L;  4IO9 A;  4C2M B;  4RH6 A;  3G6E A;  1BF4 A;  3A74 A;  1B3Q A;  1TWA H;  2K52 A;  2O5I C;  2A6H C;  4FXD A;  4FF3 A;  1ICW A;  4L5T A;  1SNO A;  3Q6S A;  2B2W A;  3M7G A;  1X55 A;  4JOI C;  2A69 C;  4LJZ C;  3K6O A;  3RLF A;  1VMP A;  3BS1 A;  4B3T L;  4X65 L;  1KDB A;  2LFN A;  3BDO A;  2XRS D;  2KVM A;  1Q12 A;  3CCL A;  2ZTD A;  2F4V L;  2LMC B;  4DK3 C;  3OTO L;  4IFD G;  1QUQ A;  4PNY A;  2A6E C;  5FKA C;  1B50 A;  2XSC A;  1GUT A;  5KNC A;  1A6X A;  4KY5 A;  1IYJ B;  3VYU A;  1Y1V B;  3PO2 B;  1BCP C;  4A3J H;  3A0J A;  1WTH A;  3NWS A;  2F0T A;  5BR8 Q;  4GLA C;  4A3I H;  5JPN C;  1E2Z A;  3C3L A;  5EBC A;  1PH1 A;  1K8G A;  1SFO H;  4ZQ3 A;  1IBK Q;  4IFD J;  2YYZ A;  4F87 A;  2VB2 X;  3BVG A;  3PIO 3;  2KCN A;  3RZO H;  2JA8 G;  4FNF A;  3HOV G;  1I4R A;  3Q23 A;  1OXV A;  1NAP A;  2K03 A;  2HCC A;  3A7L A;  2NBF A;  1QVF A;  2JE6 I;  2MJ8 A;  3E3X A;  1HA6 A;  3OWE B;  5IT9 L;  5C5L A;  1K0S A;  5C3E B;  1H9S B;  5LMU L;  5CYU A;  5IWA L;  4OO1 H;  5A2Q E;  4NKL A;  3I7F A;  1Y1W H;  2NVT B;  2K7V A;  3M4Q A;  3W5O A;  3PO3 H;  2GA4 B;  3UE1 A;  4GKJ L;  4Y7N H;  2OTL A;  3TDQ A;  3R2T A;  3OWF A;  1LTG D;  1M8A A;  4JI3 Q;  4JPB W;  1VQ8 A;  3HOY G;  2F0D A;  5IIF A;  1SR3 A;  2B29 A;  3KLR A;  1KXL A;  3M4Y A;  4FF4 A;  1E24 A;  4DV6 L;  1K83 H;  1N34 Q;  1R9T H;  2DY8 A;  4LMQ D;  5D3D A;  1SLJ A;  3KK7 A;  5M3F B;  2ZTE A;  1IBM L;  4JBJ A;  2EE1 A;  2WIN B;  3PF5 A;  3CKI B;  4BY7 H;  2E8G A;  2AQ3 B;  1YJW A;  1PRT F;  3FRP B;  5EKL A;  3CC4 A;  3I4N G;  4JI6 Q;  3IRB A;  2A6H D;  2N55 A;  2WAQ B;  3LWE A;  1G8Z D;  1STY A;  2BA0 A;  5J22 A;  3I70 A;  1XYI A;  2A69 D;  2Z6K A;  1J5E L;  3K7A B;  3AQQ A;  1HZC A;  1U4P A;  2QKI C;  3TBI B;  1QOH A;  2E2J H;  4OL7 A;  1NBW A;  1FVI A;  4DNT B;  4CJ0 B;  4OO1 I;  1DYQ A;  2X69 A;  4X6A H;  2VQF L;  4HR7 B;  1N9W A;  1XTC D;  1CM9 A;  4B3M Q;  5IT9 c;  3BYT B;  1E2W A;  1JJG A;  3B6Y A;  2MGS A;  1F2Z A;  4ME3 A;  4YCU A;  2YTY A;  4BWG B;  1ZXT A;  1W3S A;  4DR3 L;  1BCP B;  1H9M A;  4ULL A;  4DV3 Q;  1EU4 A;  1MKH A;  2NN6 G;  5IGC A;  3S17 B;  4UP9 A;  4HJ9 A;  2XIW A;  1Y1V G;  3CCM A;  1CZG A;  1SYG A;  2PZT A;  3JC6 6;  1QNK A;  4WRD A;  4X3K A;  4X64 Q;  3CXC A;  3D6C A;  1B70 B;  1UE6 A;  3H3V H;  2R7F A;  3UDI A;  1DZ1 A;  4NXM L;  3C46 A;  1HUN A;  1PYW D;  3NTI A;  3CPW A;  1FNV A;  4UDU C;  1IHZ A;  3C1F A;  1ASZ A;  1KQS A;  1PTO F;  1I50 H;  1WTV A;  5C5M A;  1C0A A;  2IHE A;  2L55 A;  3CRK C;  3I91 A;  3CF5 A;  4JG2 A;  4DR1 L;  2SNS A;  1H9S A;  3SEB A;  2N8N A;  4RAU C;  4P72 A;  2E2I H;  5C3E G;  3VA5 A;  2BCO A;  1Q81 C;  3UDX A;  1Y8O B;  3BZD B;  4GS3 A;  4DUY Q;  4HID A;  1PZK D;  4HCE A;  4IFD H;  3AYH B;  2AMC B;  1KNA A;  3SR1 A;  4JI7 Q;  3GTK H;  1HNZ L;  3KUP A;  1GVP A;  1OXT A;  2K50 A;  3AFP A;  3PCO B;  2QEJ C;  2E2H H;  3K57 A;  1LYL A;  3WOE A;  5M5Y B;  1BBX C;  1VF5 C;  2F0W A;  4LFA Q;  3NTH A;  2AQ1 B;  1D6E C;  2B2U A;  5IE8 A;  5M3F G;  4FYD A;  1XNR Q;  2EYP A;  2V1C C;  4RGM A;  3ERQ A;  3H3V I;  1Q1B A;  5JJL A;  2JQO A;  3WWV A;  2M2L A;  1TKW B;  4ZRZ A;  1B3A A;  3K58 A;  3U58 A;  1VQ4 A;  2JA8 H;  3HOV H;  3OOC A;  1YJ9 A;  2WAQ G;  1ZEQ X;  1GD7 A;  3L2P A;  3A8I E;  3EA6 A;  4JOI A;  5T1I A;  1HHV A;  2UUB L;  1SNC A;  3M3Y B;  2YTV A;  2F0F A;  5M9O A;  2JA6 H;  1Y69 U;  3U4V A;  2CKZ B;  1LTI D;  1K73 C;  3HP3 A;  2WB1 B;  3NE5 B;  4ME5 A;  4A3I B;  1PH8 A;  1VQE A;  5CV9 A;  3VA7 A;  2HIV A;  3S24 A;  4IFD I;  3S16 B;  1CSQ A;  1BXT A;  1EY9 A;  4KHP L;  4GOP C;  3HOY H;  2RDF A;  3UDF A;  2K28 A;  3BVZ A;  3RZO B;  2KHS A;  1GUG A;  2UU9 Q;  4OWX B;  4V0B A;  2RCF A;  2WFW A;  4IPD A;  4OXP A;  3FPU B;  5IYD G;  3R3O A;  1M1K C;  1N33 L;  2EYF A;  2IHF A;  1LUZ A;  1ROD A;  1A2U A;  1MSG A;  3I4O A;  3K5N A;  3GO5 A;  4KK7 A;  3BJU A;  3I2Z A;  1UNS A;  4YWL A;  2XWJ B;  1XWE A;  1STH A;  3D6W A;  4PZ8 A;  2F0P A;  2EQS A;  4R9W A;  3KF6 A;  1I3Q H;  2R3Z A;  3PUX A;  4Y7N B;  2QF7 A;  1DM0 B;  1EY8 A;  4ZCK A;  4LF6 Q;  4GKK L;  3TP7 A;  5GAD C;  4K5W A;  5ELD A;  1B7Y B;  3S15 B;  4LFB L;  1Q7Y C;  1B8A A;  3CHB D;  3G48 A;  1RJT A;  4BXX G;  1XNQ Q;  1HZB A;  1R4Q B;  4C2M H;  3NBI A;  4JI5 L;  2F0G A;  3NEM A;  1C9O A;  1KNE A;  4LF5 L;  1T5E A;  1F9P A;  2AUK A;  4UAI A;  3KLW A;  3OYY A;  4IUP A;  2LS0 1;  4EQP A;  1EY5 A;  1BOS A;  1FJG Q;  1G91 A;  1WFQ A;  2EY1 A;  3J80 L;  3KFU A;  1KHI A;  3P20 A;  4APV A;  2JA9 A;  5E3F A;  4DV4 Q;  4KN7 C;  3ICE A;  1JJ2 A;  4L8J A;  4X66 Q;  3TZU A;  1PV4 A;  2FFK B;  1IL8 A;  1EWC A;  4HED A;  1IYV A;  2RHS B;  5BN3 A;  4IPH A;  2XTI A;  2NN6 H;  4X3T A;  2HDM A;  2YTX A;  3BDL A;  1C4Q A;  2ZXP A;  3N52 A;  1UE7 A;  4AYB E;  4HMJ A;  2O5J C;  1VQ5 A;  1WOC A;  4LAA A;  4YY3 Q;  2E75 C;  1B9N A;  1EY7 A;  1Y1V H;  4OX9 L;  4L63 B;  3PO2 H;  1GHK A;  3TZD A;  1STE A;  1HFN A;  3PUY A;  1D5M C;  3RLO A;  3TME A;  1EWI A;  3MAQ A;  1EWH A;  4L5Q A;  4DF7 A;  1H95 A;  1OXS C;  3ONA B;  1L0Y B;  3A54 A;  1RHP A;  4LUO A;  3PIP A;  5JJI A;  1RTO A;  2R7Z B;  1TXY A;  2EJF C;  4KJN A;  5IP9 H;  1UWV A;  3T4A C;  3VYT A;  2ZM6 Q;  4B3S L;  4DV0 Q;  3ZYY X;  4M1U B;  4DV5 Q;  5KYL A;  3TP5 A;  2OQK A;  2K01 A;  2TMP A;  3D4D A;  3E9H A;  4LNQ A;  3T53 B;  2E76 C;  2JYO A;  4PZ7 A;  2F0Q A;  2NZO A;  3J80 i;  2K5V A;  3RMH A;  4X62 L;  1F2L A;  3MA2 B;  2DJF C;  3D4R A;  1VS0 A;  5C3E H;  2UXB Q;  1ILQ A;  2WB1 G;  5AJ3 L;  3G6J B;  4H44 C;  4GLV B;  4J15 A;  2NVT H;  3CCE A;  1TII D;  2EOT A;  3NHH A;  1EZ6 A;  4FVM A;  4A3I G;  1DD2 A;  3NWT A;  4DK6 C;  3J80 c;  1JIC A;  4IN3 A;  2KBN A;  5CV5 A;  4O0A A;  1I4Q A;  4WJW A;  2JP1 A;  4POF A;  4A3F B;  2PO4 A;  4A4I A;  2NN6 I;  3MFG A;  1HTP A;  2K32 A;  1HR0 W;  4R4C A;  4DPG A;  3KDF B;  4CDF C;  4I65 A;  2AWN A;  3V96 A;  3J81 j;  3QIA A;  2KCM A;  2D62 A;  3ND8 A;  1S3O A;  3JAM i;  1BKB A;  5HGT A;  1HXY D;  1K3R A;  1XMQ Q;  5GAE C;  3H0G B;  5M3F H;  2AUJ D;  3STB D;  1I94 Q;  5IYB G;  3NXW A;  4DR6 L;  2Z6K C;  4P71 A;  4RHR A;  4MIU A;  3CCU A;  1TWH B;  4HTH A;  1II3 A;  1ML0 D;  4JCV E;  5FO8 B;  1HFG A;  3X3N A;  3SVM A;  4DGZ A;  3HEJ A;  3JAM c;  2EJM A;  5C3X A;  3GTK B;  5IY0 A;  5JJZ A;  3HS0 C;  5EPL A;  2VNU D;  1Z47 A;  3URY A;  2Q2H A;  3J7Y W;  1A3U A;  1S4Z A;  1RIP A;  3K7A H;  2SNM A;  1CQV A;  5M5X B;  3CCV A;  4GN4 B;  3F1Z A;  1BUV T;  2ZJR A;  2EY6 A;  2C9O A;  3KBX A;  3I8Z A;  3SE0 A;  1QCB D;  3EIV A;  4CDD C;  1DXM A;  3F2B A;  3W1G A;  2ICI A;  3CMA A;  2BA1 A;  2Z1C A;  1IZ6 A;  2ZT9 C;  2L0C A;  1SAP A;  5I2Y A;  3MXU A;  3G4S A;  3Q0A A;  3CP0 A;  3VR3 A;  4HJA A;  1NTG A;  3MEH A;  3ND9 A;  1PTO B;  4ZUI A;  1XJV A;  2Q8I B;  1IW7 C;  1VDZ A;  4KKS A;  3L7Z C;  5C3W A;  1B53 A;  1V1Q A;  2A73 B;  5IYD H;  4BBR B;  1A0I A;  1YZ6 A;  1VQH A;  3S17 H;  2JA6 B;  1CKO A;  4LFC Q;  1AW7 A;  1JC7 A;  1G51 A;  4LF7 L;  1WI5 A;  2R93 B;  2IJ0 A;  3NP8 A;  1QWY A;  3ERS X;  1JT8 A;  1RTN A;  4KJO A;  2SOB A;  5DEH A;  1VQK A;  1TU2 B;  2UXD Q;  3FVQ A;  2B2Y C;  2DJG C;  2KEN A;  4DNR B;  1FD7 D;  1CZW A;  4KV6 A;  4GZY C;  3KJO A;  2NZH A;  5I2X A;  2R7Z G;  4BXX H;  3S1R B;  2WKC A;  1D7Q A;  1HQM C;  1YHB A;  1STG A;  2MQH A;  2Z6B A;  3J81 i;  2KA7 A;  1EY4 A;  2VB3 X;  2HCI A;  4KTA A;  5IT9 E;  2HHH Q;  3DEO A;  4QCL A;  4R4I A;  2QDL A;  4CGY B;  2XWB B;  2J7Z A;  2H1E A;  2AHO B;  3W1B A;  4FDB A;  2WII B;  2Q2T A;  2IY5 B;  3J81 c;  1SND A;  1I3Q B;  2F0I A;  1K8M A;  3SK5 A;  2F0U A;  4A3B B;  5K36 G;  4C56 C;  2OXP A;  4HN7 A;  5IGG A;  4E6I A;  5IP7 G;  2B2U C;  4KHV A;  1EL0 A;  4JI3 L;  2K4K A;  4A3L G;  4A3F G;  4JYA L;  4LF9 L;  4RA8 A;  2BH2 A;  3KDF A;  4LF4 L;  3EFX D;  2M9V A;  4FXK C;  1PDQ A;  5M5Y H;  4YHH Q;  2D0O A;  4PV1 C;  3H0G G;  4LF8 Q;  1BBW A;  1RKN A;  2F0L A;  4DV1 Q;  1HZA A;  4G4K A;  4DU9 A;  2B8F A;  2C35 B;  3HOX B;  1NSN S;  1TY2 A;  1VQF A;  1SRO A;  1EIH A;  1RL2 A;  4JI1 Q;  3VYR A;  3LWU A;  1MBY A;  3TRE A;  4A3K B;  1E1T A;  2FHT A;  4RWS C;  5G3L D;  3M3Y H;  1CK1 A;  2HIX A;  2K1B A;  1PLF A;  1TWC H;  1J6Q A;  4PG3 A;  4DNI A;  4RMF A;  4JW0 A;  1GM5 A;  3V2T A;  4B3M L;  3A8K E;  2BOS A;  3T56 B;  1YIJ A;  4JI4 Q;  4N8X 1;  4YWK A;  4LWC A;  1TR5 A;  3S16 H;  1K28 A;  3HKZ E;  2I5L X;  4FP5 D;  3FHW A;  3A55 A;  3T1Y Q;  1LTA D;  5IOC A;  3S9W A;  3SK8 A;  1LTR D;  4K6L A;  3MZ5 A;  2OCE A;  4KHZ A;  5C0X G;  3TP6 A;  4JI2 Q;  4K5V A;  3U9S A;  3I90 A;  1T9H A;  5GAH C;  4BBR G;  1UEB A;  3CW2 C;  2KJX A;  5IYB H;  4L5R C;  2JA6 G;  2F3W A;  4DAY B;  5I6W A;  5C4Z A;  1LT6 D;  3BZC A;  1U4R A;  3UE0 A;  2KCT A;  1HNX Q;  2NB0 A;  1KC8 C;  4K0K L;  1VQP A;  3TEH B;  1SMX A;  1F9Q A;  4IPG A;  1A3T A;  3K59 A;  1C48 A;  5EQ0 A;  1IBL Q;  4HIK A;  1E1O A; 
#chains in the Genus database with same CATH homology
 1IBK L;  3PV0 A;  1GVP A;  3U50 C;  4DR5 Q;  4X62 Q;  3S15 H;  1N36 L;  1OTC A;  5C0X J;  3LGJ A;  1OXT A;  2K50 A;  3AFP A;  3PCO B;  4QIW E;  1VQC A;  3TRZ A;  2E2H H;  2NVX H;  3S1M H;  1LYL A;  2N3S A;  3CME A;  2F3I A;  3U4Z A;  2AWO A;  4QGU A;  4DR7 Q;  2UXC L;  3FP9 A;  1XPU A;  4C3J H;  4JI2 L;  1SN8 A;  2ID0 A;  2VUM H;  1XTD A;  4LFA Q;  3ER0 A;  2OWO A;  3ZJY C;  5M3F G;  5IE8 A;  3RN5 A;  4IOA A;  1W2B A;  4A93 H;  3PUZ A;  4YCV A;  2QGQ A;  1XNR Q;  3CCS A;  2MNA A;  4LFC L;  1V43 A;  1XMO Q;  2V1C C;  1VQL A;  4JBK A;  3H3V I;  1PHJ A;  1Q1B A;  3S1Q H;  2JQO A;  5JJL A;  2HQL A;  1SE8 A;  3WWV A;  1VQ4 A;  2JA8 H;  3U58 A;  4A3B G;  2N78 A;  2DGY A;  1VQ7 A;  3HOV H;  1P8L A;  1YJ9 A;  2WAQ G;  1O7I A;  1NJI C;  2UXD L;  1GD7 A;  3L2P A;  1UE5 A;  4JOI A;  3RR5 A;  1JMC A;  1OXU A;  2NVY H;  1E7Z A;  2UUB L;  1HZ9 A;  1X3F A;  2N49 A;  2YTV A;  2JA6 H;  1AE2 A;  2PQA A;  5M3M G;  4BBS H;  4DR6 Q;  1N34 L;  4A3D H;  1HNW L;  2YV5 A;  1TWG H;  3U4V A;  4GOP B;  2CKZ B;  4A3J G;  1K73 C;  4GN3 B;  4B3T Q;  2LXJ A;  2PQA B;  4X65 Q;  3GTJ H;  1PH7 A;  2I0Q A;  3PF4 A;  1KAW A;  2MO1 A;  2RF4 A;  2HHH L;  5GQO A;  1PH8 A;  3L0O A;  2ASB A;  3K0X A;  4AH6 A;  4A3M G;  4XIG S;  1VQM A;  4AQY Q;  3AFQ A;  4IJL A;  1VQE A;  1NMG A;  3PGZ A;  2HIV A;  3S24 A;  4GKK Q;  1XNR L;  4IFD I;  1CSQ A;  2MFI A;  2B63 H;  4KHP L;  4GOP C;  3TS0 A;  4OWW B;  2R6G A;  3HOY H;  2LSS A;  1L1O B;  5JJK A;  4LFB Q;  3CCQ A;  1K9M C;  3UDF A;  3HOX G;  4DUZ Q;  2R7Z H;  3T1H L;  3AEV A;  4HJ5 A;  4JI6 L;  2LXK A;  2UU9 Q;  1EQR A;  2A19 A;  3D0F A;  4OWX B;  2PNH A;  2WFW A;  4OON A;  4IPD A;  4OXP A;  2K5N A;  2JK8 A;  4IPC A;  5IYD G;  1M1K C;  4NXN L;  1N33 L;  2IHF A;  1LUZ A;  4A3K G;  3CC2 A;  3I4O A;  1GO3 E;  3EBE A;  3GO5 A;  2VQE L;  2JA7 H;  3BJU A;  3I2Z A;  1PH3 A;  3PO2 G;  4A3G H;  4YWL A;  4KI0 A;  1DGS A;  4OO1 G;  1CKN A;  2L15 A;  3J7Z C;  3M4O H;  5C44 H;  1VQJ A;  4GLX A;  1Y1W G;  2RHQ B;  4PZ8 A;  4JI0 Q;  5JEA G;  2EQS A;  3PO3 G;  3KF6 A;  1I3Q H;  2Q2I A;  3PUX A;  2JJQ A;  1CKN B;  3PUV A;  1Z9F A;  5LMN Q;  4BA2 I;  4AQY L;  1EIF A;  4DV2 Q;  4EX5 A;  4LF8 L;  3HOZ H;  3KF6 B;  1XPO A;  1Q1E A;  4LF6 Q;  3HOW H;  3TS2 A;  4GKK L;  2MO0 A;  1YNX A;  5IP7 H;  1LTL A;  5GAD C;  1QUQ B;  4DV1 L;  1B7Y B;  2BH8 A;  4L5S A;  1PVO A;  3RN2 A;  4A3E G;  4LFB L;  4NPS A;  1PYS B;  4UP7 A;  1B8A A;  3CQZ H;  4A3F H;  1VQA A;  3G48 A;  1Q7Y C;  4BXX G;  1XNQ Q;  5IP9 G;  1HZB A;  1Q86 C;  2CWA A;  4C2M H;  1YJN A;  4JI5 L;  4LF7 Q;  1KL9 A;  4HJ7 A;  3NEM A;  1C9O A;  1A63 A;  4LF5 L;  2A8V A;  4JYA L;  1Q8K A;  2FXQ A;  3KLW A;  3OYY A;  4DV3 L;  2EXD A;  1MIU A;  1FJG Q;  4GKJ Q;  1WFQ A;  4P75 A;  3H0G H;  3KFU A;  1KHI A;  4APV A;  2E5L L;  3GTM H;  2JA9 A;  5JEA J;  1MJC A;  1VQB A;  4DV4 Q;  3ICE A;  4A3C H;  2JA5 G;  1JJ2 A;  4X66 Q;  3GTL H;  2R93 G;  1WJJ A;  2WP8 J;  1TWH H;  3PSI A;  4BY7 G;  4JV5 Q;  3PUW A;  4C3H H;  1PV4 A;  3K8A A;  4DV6 Q;  3ULP A;  4UY8 C;  1UE1 A;  1KXL A;  1QVC A;  4X64 L;  3BU2 A;  4JI4 L;  1WCM H;  2K14 A;  1EUJ A;  2JEA I;  2RHS B;  4DR4 Q;  4IPH A;  2XTI A;  5LMN W;  2OTJ A;  2YTX A;  1IBM Q;  3HOU G;  4JC0 A;  4JI8 Q;  1UE7 A;  4AYB E;  2Y0S G;  1U5K A;  1VQ5 A;  1WOC A;  5ELO A;  5M5X H;  4YY3 Q;  3KF8 B;  3T1Y L;  4BY1 G;  1Y1V H;  3VDY A;  4OX9 L;  3PO2 H;  3KOJ A;  3FKI H;  5AJ3 Q;  1I6H H;  4GNX C;  5DLQ E;  3ULL A;  2GN5 A;  3M9B A;  3PUY A;  2CWP A;  3RLO A;  1Q82 C;  3I56 A;  1EWI A;  4P73 A;  3I4M G;  4L5Q A;  5HGQ A;  1H95 A;  1OXS C;  1OXX K;  1G6P A;  1BBU A;  1V9P A;  4DV4 L;  5C4X G;  1D8L A;  4LUO A;  2UUA Q;  1HR0 Q;  3MEF A;  1E3P A;  3PIP A;  3EN2 A;  1J5E Q;  2CCZ A;  4LF9 Q;  4JYA Q;  4JV5 L;  5JJI A;  1TXY A;  2H5X A;  1I5F A;  5IP9 H;  1UWV A;  3DM3 A;  4DUY L;  4DV7 L;  1HNX L;  2UUC L;  2ZM6 Q;  4LF4 Q;  4B3S L;  3S14 H;  4DV0 Q;  3F2D A;  4DV5 Q;  3A5U A;  4O2D A;  2VW9 A;  2OQK A;  3OW2 A;  4WJ3 M;  1IBL L;  3RLN A;  4JI7 L;  3E9H A;  4IJH A;  4LNQ A;  3RNU A;  3KYH C;  5FLX c;  4DR4 L;  1N32 Q;  4PZ7 A;  2VQF Q;  1KIX A;  2NZO A;  4UPA A;  3J80 i;  2K5V A;  4BBR H;  4X62 L;  3CCJ A;  2F52 A;  4DR5 L;  4GOP A;  4A75 A;  2QA4 A;  1G29 1;  4EQ5 A;  1VS0 A;  1M90 C;  5C3E H;  2UXB Q;  4DR7 L;  2R93 H;  1K8A C;  2WB1 G;  5AJ3 L;  3J7A 5;  1IL2 A;  1EQQ A;  2OQ0 A;  4GLV B;  4J15 A;  3RZD H;  2NVT H;  3CCE A;  2K75 A;  4A3I G;  4LFA L;  4MZ9 A;  5IYC H;  2HT1 A;  2F4V Q;  1PFS A;  1Y14 B;  3OTO Q;  4POG A;  2R92 G;  4DK6 C;  3J80 c;  1L1O A;  2KBN A;  4R4O A;  1PA6 A;  1XMO L;  4QL5 A;  4QY7 A;  1BVS A;  1EOV A;  4O0A A;  1HR0 L;  4POF A;  4B3R Q;  3CAM A;  4IO9 A;  4A4I A;  2NN6 I;  1EIY B;  1WYD A;  3S1R H;  2ZM6 L;  2WAQ E;  3G6E A;  1HR0 W;  3A74 A;  4R4C A;  1TWA H;  2K52 A;  4DPG A;  3KDF B;  2AWN A;  5E7N A;  3J81 j;  2KCM A;  2D62 A;  2R7D A;  1S3O A;  3JAM i;  5FLM G;  1BKB A;  3GTO H;  1N32 L;  1K3R A;  4Y52 H;  1XMQ Q;  5GAE C;  5M3F H;  4L5T A;  4NB3 A;  3STB D;  1I94 Q;  1PH9 A;  5IYB G;  4MTN A;  1X55 A;  1E22 A;  4JBW A;  4JOI C;  4DR6 L;  4YWM A;  2Z6K C;  4P71 A;  4NXM Q;  2UXB L;  3RLF A;  4DKA C;  3CCU A;  4IOC A;  4B3T L;  4X65 L;  4JCV E;  3HKZ G;  2I5M X;  1Q12 A;  3CCL A;  2ZTD A;  3JAM c;  2F4V L;  3OTO L;  4DK3 C;  4A3B H;  4IFD G;  5FJ8 G;  1QUQ A;  2A1A A;  2KHI A;  5IY0 A;  2VNU D;  2IX1 A;  4DR1 Q;  5C0X I;  1Z47 A;  4B3R L;  2Q2H A;  4YCW A;  2ZTC A;  1FL0 A;  1RIP A;  3KJP A;  3K7A H;  3CD6 A;  4DUZ L;  1IYJ B;  3M4P A;  3CCV A;  4TQU S;  5M3M H;  5LMU Q;  3NBH B;  3F1Z A;  4GN4 B;  3PIO A;  2ZJR A;  4A3J H;  5IWA Q;  2UU9 L;  3A0J A;  1SRU A;  3K80 C;  3EIV A;  1U0L A;  4K0K Q;  2DUD A;  4LUV A;  5BR8 Q;  4GLA C;  3F2B A;  4A3I H;  4BA1 I;  4A3M H;  3W1G A;  1PH4 A;  3M85 A;  3CMA A;  2BA1 A;  4A93 G;  1PH2 A;  1I94 L;  1IZ6 A;  1PH1 A;  1VQO A;  1L0W A;  1K8G A;  1SFO H;  4IFD J;  1IBK Q;  3S2H H;  2YYZ A;  3G4S A;  3F8T A;  1N36 Q;  2K5H A;  3CP0 A;  4JI0 L;  4HJA A;  3HOX H;  1NTG A;  1JE5 A;  4GNX A;  1XJV A;  3RZO H;  2JA8 G;  1YVC A;  1IXR A;  5LMN L;  3HOV G;  4HIK A;  4DR2 Q;  4DV2 L;  3L7Z C;  2UXC Q;  1V1Q A;  4GNX B;  1OXV A;  4LF6 L;  1YBY A;  3GTP H;  1VQI A;  1HJP A;  1QVF A;  5IYD H;  2JE6 I;  1A0I A;  1LM0 A;  1YZ6 A;  2ES2 A;  1VQH A;  1X6O A;  4R4Q A;  4XTC S;  4A3K H;  1X56 A;  3S17 H;  3GDE A;  1XNQ L;  4BBS G;  4A3D G;  1CKO A;  4LFC Q;  1G51 A;  2VY3 A;  4LF7 L;  5LMU L;  3UDG A;  1WI5 A;  4TVA B;  5IWA L;  3K7U C;  3HKS A;  3I7F A;  1Y1W H;  3S1N H;  3ERS X;  1JT8 A;  3M4Q A;  3W5O A;  3PO3 H;  3UE1 A;  1FJG L;  4GKJ L;  4Y7N H;  1VQK A;  2OTL A;  4UP8 A;  1L2F A;  2UXD Q;  4LW1 A;  4PMW A;  2KEN A;  3GTQ H;  4JI3 Q;  1VQ8 A;  3HOY G;  2VL6 A;  4X66 L;  4A3E H;  2UUB Q;  1SR3 A;  2B29 A;  3E9I A;  1NY4 A;  3KJO A;  2Q2U A;  2NZH A;  2R7Z G;  2I5H A;  2PI2 E;  1E24 A;  4DV6 L;  4BXX H;  1HNW Q;  1D7Q A;  1K83 H;  1YHB A;  2MQH A;  1N8R C;  1N34 Q;  1R9T H;  4DR2 L;  1KRS A;  3J81 i;  1VQ6 A;  4HIM A;  2HHH Q;  1SLJ A;  4ALP A;  2Y0S E;  4C3I H;  4R4I A;  2ZTE A;  2PMZ E;  4JBJ A;  1IBM L;  4JI8 L;  2AHO B;  1CKM A;  4R4T A;  3W1B A;  3PF5 A;  3I4M H;  2VZA A;  4YY3 L;  2JA7 G;  4FDB A;  4A3G G;  4KHP Q;  2JA5 H;  1X3E A;  2RCN A;  5C44 G;  2QEX A;  2Q2T A;  2EIF A;  2E8G A;  4DAM A;  3J81 c;  1YJW A;  1XPR A;  4BY7 H;  2IY5 B;  2XGT A;  3CC4 A;  4JBM A;  5HY6 A;  3T1H Q;  1YEZ A;  4DR3 Q;  3I4N G;  4JI6 Q;  3IRB A;  5K36 G;  1X3G A;  3HOZ G;  3D31 A;  2ZJP A;  3CC7 A;  3HOW G;  5GAG C;  5IP7 G;  1X54 A;  1VQ9 A;  1EFW A;  2BA0 A;  2ZJQ A;  4JI3 L;  3GTG H;  1TWF H;  2K4K A;  2UUA L;  4NXN Q;  1N33 Q;  4A3L G;  1HH2 P;  2Z6K A;  4A3F G;  2D0P A;  1J5E L;  5EAY A;  4LF9 L;  2BH2 A;  3AQQ A;  1HZC A;  3KDF A;  3HFZ B;  1YIT A;  2AKW B;  4LF4 L;  2VQE Q;  4DV0 L;  2E2J H;  4DV5 L;  4BY1 H;  1NBW A;  1FVI A;  4A3L H;  4RG1 A;  3NEL A;  1PYB A;  5M5Y H;  4YHH Q;  2D0O A;  4OO1 I;  3BZK A;  3H15 A;  1CSP A;  2VQF L;  4X6A H;  1K0R A;  5J3B A;  3H0G G;  1N9W A;  4B3M Q;  4LF8 Q;  1X9N A;  1BBW A;  3ULJ A;  4AIM A;  5IT9 c;  3F2C A;  1AE3 A;  3GD7 A;  3HOU H;  2WB1 E;  4DV1 Q;  5C4X H;  4A3C G;  1HZA A;  1P16 A;  3B6Y A;  1JJG A;  3SGI A;  4ME3 A;  2C35 B;  4YCU A;  1ASY A;  2YTY A;  4KLK A;  3E0E A;  1VQF A;  4JI5 Q;  1W3S A;  4DR3 L;  1QVG A;  2ALY B;  4LF5 Q;  1SRO A;  5C4J H;  1WCM G;  3I55 A;  1RL2 A;  1MJE A;  2ATW A;  1C7Y A;  3Q8D A;  1S72 A;  4JI1 Q;  1CUK A;  2GVB A;  3DLL A;  4DV3 Q;  1MKH A;  2NN6 G;  1L1O C;  1KRT A;  3TRE A;  4P74 A;  4UP9 A;  5M5W H;  1E1T A;  4HJ9 A;  3M3Y H;  2E5L Q;  1AH9 A;  5ELN A;  1FGU A;  4R1J A;  1EYG A;  1Y1V G;  3K81 C;  1NMF A;  3CCM A;  3FKI G;  3JC6 6;  4MNO A;  1A62 A;  2HIX A;  2YU9 H;  4HIO A;  1TWC H;  1J6Q A;  1X65 A;  4PG3 A;  4DNI A;  1QZH A;  4RMF A;  2VUM G;  1GM5 A;  4YHH L;  2NVQ H;  4OWT B;  2VS1 A;  3I4N H;  1VQG A;  2B3G A;  4X64 Q;  1XMQ L;  3CXC A;  2R92 H;  1KD1 C;  1YIJ A;  1YI2 A;  4B3M L;  4JI4 Q;  1B70 B;  3CCR A;  1UE6 A;  4YWK A;  4LWC A;  3STB C;  2R7F A;  3UDI A;  3H3V H;  3S16 H;  4H02 A;  1HNZ Q;  4NXM L;  2CFM A;  3HKZ E;  3NEN A;  5GRO A;  2I5L X;  3CPW A;  3A5Z B;  3CPF A;  1NE3 A;  3FHW A;  1YHA A;  4AYB G;  4LUZ A;  2CQO A;  4QJF A;  3T1Y Q;  1ASZ A;  1KQS A;  4OX9 Q;  1I50 H;  3MXN B;  2OCE A;  1Q46 A;  1C0A A;  4KHZ A;  5C0X G;  1YHQ A;  3G71 A;  2IHE A;  4PZ6 A;  4JI2 Q;  4WJ4 A;  4JI1 L;  4GN5 A;  3CF5 A;  1VQD A;  1T9H A;  2KHJ A;  4JG2 A;  5FLM H;  5GAH C;  4A76 A;  4BBR G;  4DR1 L;  1S40 A;  1UEB A;  3M7N A;  5H1S E;  3CW2 C;  5IYB H;  2N8N A;  4L5R C;  2JA6 G;  4P72 A;  1PH6 A;  5C3E G;  2E2I H;  1GKH A;  4DAY B;  1Q81 C;  3UDX A;  1JJC B;  3TQY A;  1A8V A;  2PI2 A;  3BZC A;  1VCI A;  4GS3 A;  4DUY Q;  3UE0 A;  1QZG A;  2KCT A;  2UUC Q;  4DV7 Q;  4HJ8 A;  1KC8 C;  1PH5 A;  4HID A;  2IT1 A;  5IYC G;  1HNX Q;  5BR8 L;  4B3S Q;  1VQP A;  4K0K L;  3TEH B;  1SMX A;  5FJ8 H;  3AYH B;  2AMC B;  2GVA A;  4IPG A;  1JB7 A;  4QQB X;  1VQN A;  3S2D H;  1IBL Q;  4JI7 Q;  2B63 G;  2Z0S A;  3GTK H;  1HNZ L;  2JEB I;  2IX0 A;  1E1O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...