2NVXH

Rna polymerase ii elongation complex in 5 mm mg+2 with 2'-dutp
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
146
structure length
134
Chain Sequence
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
total genus 16
structure length 134
sequence length 146
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2nvxH00
4JI1Q 2JA7H 1KRTA 5EAYA 4PMWA 4L5RC 2AWNA 2K5NA 1CKNA 1C9OA 3JC66 4HIOA 2PQAB 3HOYH 1OXTA 1X9NA 1I94Q 1VQGA 1AH9A 4LF5Q 4NPSA 1IBKQ 1YI2A 4PG3A 1V1QA 3CPWA 3I4NH 5LMNL 4A3FG 3HKZE 3M85A 1N8RC 5IWAL 1XNQQ 4JV5L 1L1OA 2VY3A 5M3FG 1A63A 2PQAA 5FLMH 4DV6Q 1VQKA 1I50H 3DM3A 3UE1A 3J81c 4A3BH 2R92G 1X3GA 3W5OA 4BXXG 4OWXB 1KHIA 2K50A 2K75A 2N49A 1XPUA 4A3CG 5IP7H 1HR0W 3GDEA 2GN5A 2R7DA 4YHHQ 4A3MG 4C3IH 1YNXA 2RF4A 3VDYA 4LFCQ 5GAHC 1K8GA 4DV7L 3MXNB 2EIFA 2MFIA 3J7A5 5LMUQ 3KYHC 1JJCB 4OXPA 1EOVA 5IWAQ 3J7ZC 3F2DA 1EIYB 3CC2A 1QVFA 2ZTEA 2HHHL 2HIXA 2UXDL 1VQ4A 4LF7L 2BA0A 1N36L 5IYBG 1G291 1XPOA 2VS1A 4A93H 3S1NH 4B3RL 4TQUS 1I5FA 4YWKA 1YEZA 3CCMA 1QZGA 4DV3Q 2BA1A 4GNXB 2A8VA 1W2BA 5C0XI 3PO3G 4JI0L 2JQOA 1AE3A 2B63G 4HJAA 4NXNQ 4LFAQ 2HHHQ 2D62A 4DR4L 4AYBE 4GKKQ 1WYDA 1WFQA 4L5TA 3CP0A 4R1JA 2EQSA 1IBLQ 4A3KH 1HNZL 1CKNB 4X62L 1JJ2A 3FKIH 2E2JH 1YJ9A 4A3EG 2NVYH 2QEXA 3WWVA 5AJ3Q 4DUZL 3TRZA 4DNIA 4A3LG 4LF6L 5ELOA 1FJGQ 1VQ9A 4JBKA 4JI4Q 1VQ6A 1KXLA 3HKZG 1E1OA 2JJQA 1HJPA 3AYHB 4C3HH 1SMXA 1NTGA 3PCOB 2KHJA 2UXBQ 4ME3A 2UUCQ 4JI5Q 4YCWA 1RL2A 3KJPA 4QIWE 4DK6C 2Y0SG 4OX9Q 4LW1A 2HT1A 5IT9c 3H3VI 3BU2A 4DV7Q 1FGUA 4LFBQ 1OXSC 4JI2L 5C0XJ 4L5SA 3CF5A 4X66Q 5GROA 3LGJA 1N33Q 4YCUA 1D8LA 1D7QA 3ERSX 2XTIA 4A4IA 1I6HH 2V1CC 4R4CA 4B3ML 3L0OA 2IHEA 5JJIA 2NVXH 3S2HH 4R4IA 3UDFA 2VQFQ 4X6AH 4P73A 3ULLA 3K0XA 1YJWA 4KHPL 3M4QA 4A3JH 1Z47A 4H02A 2CKZB 4JI0Q 1IBKL 1K8AC 3PUXA 4JI2Q 2Y0SE 3F8TA 2ZJPA 2JA6G 2R93H 4K0KL 3HOVH 1PH1A 3S14H 3KF8B 2NVTH 4AQYQ 3AFQA 3CCLA 3L2PA 3T1HQ 5M3MH 1JB7A 3I2ZA 4LUOA 4IJHA 4IOCA 4BBSG 1IBML 1VQEA 1P16A 4A3GG 1K0RA 2KHIA 4GLAC 4QL5A 1G51A 2IY5B 3HOWG 1TWHH 1IXRA 2ALYB 2N3SA 5HGQA 1N34L 3UE0A 4KHPQ 3TREA 3CD6A 1W3SA 5C44H 4BBRG 2VL6A 3D0FA 1O7IA 3K8AA 3S15H 4NB3A 4LFCL 1VQMA 3KDFA 3HOUG 1Q1BA 2K52A 1YZ6A 4JCVE 4C2MH 5M5XH 1LTLA 4JI8Q 4DV1L 4DV2Q 4AQYL 3G6EA 4IFDJ 2B29A 2WB1E 3HOXH 4LWCA 2ZM6Q 1UE7A 3JAMc 4NXML 1EQQA 1MIUA 1N36Q 1VQCA 2NN6G 2Z6KA 4QGUA 3H15A 3GTGH 1KQSA 3U4VA 3HOXG 1UE1A 2HQLA 1PH8A 4DV5Q 2UUAQ 1G6PA 4IPHA 3I7FA 1WOCA 3ULJA 1GO3E 3HOUH 4DR2Q 4IFDG 3PUZA 5LMNW 5IP9H 1PH2A 3GTPH 1YIJA 2R7ZH 3U50C 4AIMA 3STBC 5C44G 2UU9L 4EQ5A 2CQOA 3HFZB 4IOAA 4O2DA 4A3GH 4HJ7A 1X56A 2WAQE 3UDXA 2YTXA 5GAEC 4BBSH 1HNZQ 4QJFA 1WCMG 2PI2A 3FHWA 1QUQA 2AMCB 4J15A 2UXDQ 2VUMH 4DUZQ 1L0WA 1HNWQ 3ICEA 2FXQA 2JA6H 4DR3L 2R93G 1A0IA 2OTLA 2YTYA 3PO2G 1PV4A 3RLFA 5C4XG 4A3JG 3GTJH 3E9HA 2VNUD 4FDBA 5GAGC 1KC8C 3CAMA 3KF6A 3CQZH 3KJOA 1AE2A 5C4XH 4DV4Q 3PO2H 2MO1A 2XGTA 2C35B 1IL2A 3PGZA 5LMNQ 2VQEL 3PUWA 3STBD 2Q2HA 1Q8KA 4DR4Q 4Y52H 2UUBL 2GVAA 2VUMG 3F2BA 2JEAI 1WCMH 1N33L 1QVCA 3BZCA 3K81C 4IPCA 4LF8L 2A19A 1NBWA 1Q12A 4DV6L 4OO1G 1Y14B 2K5VA 3RLOA 1C0AA 2CFMA 4JOIC 5K36G 1JT8A 4APVA 4DUYQ 4JI6L 1B70B 2Z0SA 1OXUA 1UEBA 4DPGA 3M7NA 4GN3B 1J5EQ 1VQJA 3BJUA 2ES2A 2R7ZG 4B3TL 3K7UC 5IP9G 1VQPA 3TS2A 4IO9A 4DR2L 1PYSB 1YVCA 2YTVA 3S2DH 3UDGA 1PH7A 5E7NA 4OWWB 5JJLA 1X65A 2CWPA 2WAQG 1GVPA 3AFPA 4UP7A 2N78A 2AHOB 3M4PA 1XPRA 2E5LQ 1JMCA 4JI7L 1NE3A 1TWAH 2ZTDA 1KAWA 3CC7A 4A3KG 3NENA 4GNXC 3S1RH 1PA6A 4JBWA 4PZ7A 1E1TA 1BBWA 1UE5A 1YHBA 3E0EA 4MTNA 4JC0A 4LF4L 3S1MH 4JYAL 4B3MQ 2UXCL 4UPAA 1NMFA 2B63H 4L5QA 2AWOA 4BBRH 3F2CA 1HR0L 3PO3H 4O0AA 1PH6A 2E5LL 1EQRA 1TWGH 2IX0A 2K4KA 1R9TH 5J3BA 1OTCA 3GTMH 3HOWH 3HKSA 4DKAC 1BVSA 2IT1A 5GADC 3TQYA 2MQHA 3OW2A 3KOJA 4A93G 3PIPA 1NJIC 4NXMQ 4UY8C 1I3QH 3EBEA 1MJEA 5M3MG 4OX9L 1KIXA 2NZOA 3PF4A 3M4OH 2YU9H 4LF6Q 3HOVG 2I5HA 4GN4B 4GOPA 3EIVA 2ATWA 1P8LA 1Q46A 2CWAA 1XMQL 2AKWB 3DLLA 2WFWA 4LUZA 4JI3L 4B3SQ 1EIFA 1L1OC 4EX5A 4YY3L 3A74A 1C7YA 2JE6I 1YHAA 1KL9A 1JE5A 2PNHA 3UDIA 5IP7G 3CCUA 1QUQB 4HJ9A 1EYGA 4A3CH 3CMEA 3U58A 1K3RA 2OTJA 1NMGA 3M3YH 1TWFH 4LFBL 2BH2A 1Q86C 4MNOA 4IJLA 4YHHL 5FLMG 3AQQA 2Q2UA 4IFDI 4IPDA 3KDFB 4HJ5A 5AJ3L 2I5LX 4PZ8A 4POGA 4A3FH 2Q2IA 3I4OA 4LF9Q 3FP9A 1IYJB 3KLWA 4DR3Q 1YJNA 3T1HL 2E2HH 4LF7Q 1XNRQ 4GS3A 1NY4A 3A0JA 3PUYA 2CCZA 3HOYG 4RMFA 4YCVA 4JI1L 2GVBA 3G48A 2JA7G 2HIVA 5H1SE 2JA9A 4P72A 1ASZA 3PSIA 4DR6Q 4DR5L 3RLNA 3ULPA 5M5YH 4MZ9A 4BY1G 4A3LH 3I55A 2QA4A 2UUBQ 2JK8A 4A3EH 4LFAL 2JA8G 2LXJA 3FKIG 3H3VH 5JJKA 4LF9L 1WJJA 1GD7A 4LUVA 2Q2TA 4GKJQ 1SFOH 1V9PA 4XIGS 1JJGA 4JBJA 4X65Q 2ZTCA 1MJCA 2OWOA 1VCIA 2B3GA 1SE8A 5C4JH 3F1ZA 1OXVA 2ZM6L 3PF5A 1XNQL 4JV5Q 2NN6I 5IYCG 5IYDG 1XMOQ 3W1GA 3J81j 4A3DG 1K9MC 1OXXK 4NXNL 1ASYA 1X3FA 2OQ0A 1E24A 2QGQA 4GLVB 2VZAA 3CCEA 2RCNA 4JI8L 4DV5L 1X3EA 3BZKA 3EN2A 3GTKH 2WB1G 1YITA 3A5ZB 3MEFA 4KI0A 4AYBG 4GOPC 4JI7Q 4JI5L 2UUCL 5IYBH 3RZOH 1PFSA 4DV0L 4RG1A 3J80c 3OTOQ 3CCVA 3L7ZC 2UUAL 2ASBA 1N9WA 3S17H 1UWVA 3I4MH 4DK3C 4GOPB 1K73C 1MKHA 2RHSB 3ER0A 4A3MH 1I94L 2IX1A 1PH3A 1PHJA 3SGIA 4DV3L 4POFA 3IRBA 4X64L 4DR7L 4BXXH 1N32L 3GTQH 1E22A 4HIMA 2R92H 4A3BG 2KCMA 3S1QH 3K80C 4DV1Q 4DAMA 1Y1VG 1E3PA 3D31A 5IY0A 3J81i 3CC4A 3OTOL 3OYYA 2VW9A 5M3FH 4DR1L 2F4VQ 3ZJYC 1VQ5A 4GKKL 1SROA 2F3IA 1X54A 2LXKA 4K0KQ 3I4NG 4X62Q 3Q8DA 4OONA 4A3IG 2I5MX 5GQOA 1Y1WH 1VS0A 3S24A 4JI3Q 3A5UA 1PH4A 2D0PA 5HY6A 1LYLA 4P74A 2OQKA 4YWLA 3RNUA 3GD7A 4DUYL 4WJ3M 1VQAA 4A75A 1XJVA 1VQFA 3CW2C 3CMAA 1EWIA 1H95A 5C0XG 1B8AA 3G71A 4LF5L 4ALPA 2ID0A 2RHQB 3CCQA 3J80i 3G4SA 1Q82C 1VQIA 3K7AH 4DV2L 4OO1I 1QVGA 1VQBA 2YV5A 2ZJRA 3PIOA 1SR3A 2L15A 3E9IA 3H0GH 2NVQH 2Z6KC 3I56A 2N8NA 4B3SL 1CKMA 1QZHA 2JA5H 4YY3Q 1RIPA 1TWCH 2MNAA 1IBLL 1FL0A 3NELA 1EUJA 1S72A 4LF4Q 2UXCQ 2A1AA 1U5KA 1S40A 3HOZH 5FJ8H 1T9HA 5LMUL 1CKOA 3KF6B 3CCRA 1PH9A 4JG2A 5FLXc 4DR1Q 3W1BA 1IZ6A 2OCEA 2WP8J 5BR8L 4JI4L 2F4VL 4GKJL 1HNXL 1SN8A 4X66L 1A62A 4JI6Q 4R4QA 1YBYA 1IBMQ 1J6QA 1J5EL 4QY7A 2K14A 1A8VA 1HZCA 2JEBI 2KBNA 2PMZE 1HNWL 2R6GA 1SRUA 2F52A 4GN5A 2KENA 4BY7H 1X6OA 4YWMA 1U0LA 3RN2A 3U4ZA 4P75A 4HJ8A 4R4TA 5C3EG 3CCJA 1PVOA 3CCSA 4DV0Q 3T1YL 1Y1WG 4P71A 4BA1I 5JEAG 1HNXQ 3NEMA 3GTOH 4A3IH 1Q7YC 4UP9A 1GKHA 2VQFL 1B7YB 4AH6A 2PI2E 4WJ4A 1VQLA 2NZHA 5C3EH 4DAYB 1GM5A 3AEVA 4JYAQ 4LF8Q 4A76A 4B3RQ 2BH8A 1Y1VH 1BKBA 3CPFA 4BY7G 4JOIA 4X64Q 4DR7Q 1N32Q 1N34Q 2D0OA 1WI5A 4OWTB 1E7ZA 1L2FA 1VQDA 2R7FA 3KFUA 2UXBL 4GLXA 1VQOA 3TEHB 1LUZA 5M5WH 4UP8A 3T1YQ 3GO5A 1M90C 3GTLH 2LSSA 3RR5A 3S16H 1HH2P 1Z9FA 3PV0A 4QQBX 3I4MG 4PZ6A 1K83H 1M1KC 1VQ8A 1FVIA 4DR5Q 3M9BA 1VQ7A 4BA2I 3PUVA 5BR8Q 3RN5A 1DGSA 1VQNA 3CXCA 1HZBA 1XMQQ 4B3TQ 2DUDA 1L1OB 1UE6A 5FJ8G 3HOZG 4HIKA 2I0QA 3JAMi 1YHQA 1FJGL 4GNXA 1HZAA 1BBUA 1PH5A 4X65L 4Y7NH 4R4OA 2YYZA 1VQHA 4DR6L 1KRSA 1V43A 2DGYA 1TXYA 4KLKA 2JA5G 1Q1EA 5DLQE 1EFWA 2ZJQA 2E8GA 4DV4L 4A3DH 1CUKA 2K5HA 2UU9Q 3H0GG 5IYCH 5ELNA 5IYDH 1X55A 2KCTA 1CSQA 5IE8A 2VQEQ 1SLJA 1HZ9A 1LM0A 4KHZA 1CSPA 3NBHB 3RZDH 4C3JH 1Q81C 2EXDA 2H5XA 5JEAJ 3TS0A 2IHFA 2MO0A 2E2IH 4JBMA 1PYBA 1XMOL 2JA8H 4LNQA 1XNRL 1HR0Q 4XTCS 3B6YA 1S3OA 1XTDA 4TVAB 4BY1H 4HIDA 1KD1C 4IPGA
chains in the Genus database with same CATH superfamily
1BCPF 2EY5A 4L5RC 2EE1A 1LTSD 1CKNA 1C9OA 2K5NA 3HOYH 2PQAB 3T13A 1AH9A 5J39A 4KN4C 3Q24A 2Z1CA 1YI2A 4B9XA 3DWPA 1PRTC 3I4NH 3HG9A 3M85A 2X69A 5IGEA 5TSSA 4JV5L 1L1OA 3AMUA 3EFXD 1A63A 5FLMH 3HS0C 4DV6Q 3OW7A 2F0KA 4N9PA 2HDMA 2CH4W 2N49A 1XPUA 2R7DA 5GAHC 4DV7L 2MFIA 4IUVA 3J7A5 5C4XB 1JJCB 1WTOA 4BY7B 5KRUA 4OGQC 2BA0A 5C3WA 1X32A 2NWGA 5IYBG 4A93H 2B8GA 4B3RL 2Q8IB 1GUWA 1I5FA 3OMCA 4DV3Q 2BA1A 4GNXB 2JQOA 5C5MA 1GHJA 2KJXA 4NXNQ 3QOJA 1GOZA 1HQMC 1TT2A 3KLSA 4GKKQ 4L5TA 4E6IA 1F9QA 1TY2A 2F0DA 3FKIH 5CV6A 3EA6A 3WWVA 4JBKA 4JI4Q 3ND8A 2L12A 1VQ6A 4J1MA 1L0YB 1HJPA 1TWFB 3AYHB 3VR3A 1NTGA 4C3HH 3PCOB 3HRZC 4ME3A 2L0CA 5JPMC 2Y0SG 2JYOA 2HT1A 3BU2A 2L4NA 4LFBQ 1PTOF 5C0XJ 1XXGA 1TS5A 5FO7B 1D8LA 4DAVA 3IFDA 5A2QL 4A4IA 5CV7A 4C3JB 5BN3A 1U4MA 2LMCB 4IZ8A 4KK7A 3ULLA 3K0XA 4KHPL 4A3JH 3P7JA 3FMCA 4H02A 2CKZB 4C1NK 2Y0SE 2R93H 1A2TA 2X6GA 3L2PA 3T1HQ 1KDCA 4IJHA 4MTKA 1IBML 3J80L 2PO4A 1K0RA 3AU7A 3OMGA 4K2LA 4QL5A 4UDUC 1Y8PB 1IXRA 2N3SA 5HGQA 2NYZD 3TREA 5C44H 4BBRG 3D0FA 3K8AA 4NB3A 3OPOA 3FPPA 4DV2Q 4AQYL 4JI8Q 2EYJA 3HOXH 3GTOB 4BS9A 4LWCA 3JAMc 1EQQA 1VQCA 2NN6G 4QGUA 4QB4A 4PNYA 1UE1A 4DV5Q 4IPHA 1EQTA 3ULJA 2F0TA 1B3AA 1CQFA 1SYEA 2R7ZH 4NDXA 2J0TD 4EQ5A 2EY6A 4RKLA 3NQTA 2OXPA 4O2DA 2WAQE 1HNZQ 3NTHA 2UXDQ 4DUZQ 2F3WA 2WIIB 4HCSA 1G6ZA 1KNAA 4R9WA 4CDCC 3TP7A 2OTLA 2NTTA 1PV4A 1K28A 3K7AB 1LT5D 1MSGA 4IUNA 3CAMA 3KF6A 5C4XH 4DV4Q 3MXNA 3NTKA 1KLUD 3PUWA 4DR4Q 2EYPA 1ENFA 2VUMG 3GTMB 3HOWB 2JEAI 2ICIA 1V1PA 2B2TA 2Z4IA 1NBWA 3PMFA 2B2YC 1Y14B 2K5VA 3GV3A 3RLOA 1H9JA 4APVA 2AQ3B 2Z0SA 1OXUA 2SDFA 1SEBD 1VQJA 1ICFB 4GN3B 1RKNA 3PIO3 3TS2A 1VQPA 4DR2L 1CZGA 3TZDA 1D1KA 3MXPA 3UDGA 1PH7A 2CWPA 2WAQG 3A56A 3VYSA 2AHOB 1XPRA 1JMCA 2ZXOA 1AFPA 3DWQA 1NE3A 1TWAH 4KD4A 4WORA 4XQJA 3CC7A 1Y8OB 4PZ7A 1BBWA 2DN8A 1HUMA 3VYUA 2UXCL 4JYAL 1YNJC 4H0LC 4L5QA 3F2CA 1F2YA 2EYOA 3Q22A 3SK4A 1IYVA 1EQRA 3HKSA 4DKAC 3A8KE 1B1ZA 2MQHA 4A3MB 1I3QH 3EQLC 1MJEA 3PF4A 3M4OH 1KIXA 2NZOA 4EQOA 3HOVG 1P8LA 1O7YA 1E2WA 5E4WC 1DXMA 1L1OC 3P1HA 1GXDC 1F9SA 5IP7G 2RCFA 3BG3A 1EYGA 4A3IB 1RJTA 1K3RA 3M3YH 4ZK9B 1X3PA 2Q2UA 3AQQA 3E5SA 5CV9A 2PQEA 3H3VC 4LF9Q 1IYJB 2NTSA 1H9KA 2CCZA 4CHTB 3BDLA 1EOTA 1LTTD 2GVBA 2QCPX 4G7OC 5EKKA 4MZ9A 2E74C 1QJOA 5FO8B 3HOZB 1F77A 2DY7A 3I55A 2JA8G 4ULLA 2WB1B 2E2DC 1UUPA 1GD7A 2PZUA 1SFOH 1V9PA 2K5WA 1MJCA 1VCIA 4JV5Q 2ZM6L 1K8OA 3MFGA 2NN6I 2F3VA 5CBEE 5EPKA 4A3DG 1DM0B 1X3FA 1GUGA 1E24A 1LV9A 2OQ0A 4DV5L 4JI8L 1U4LA 4IN3A 5J1ZA 1U4PA 1STHA 1X3EA 5A2QE 3MEFA 2J4XA 3N52A 1WTQA 1JC7A 1O7LA 4PMBA 2I07B 1ENAA 3L7ZC 1AN8A 2HDLA 4GOPB 2K28A 3NPPA 1K73C 1LT6D 4A3MH 3CRKC 4RAUC 1I94L 1PH3A 1PHJA 4EGVA 3SXHA 5BN5A 1E22A 3S9WA 2R92H 2HD3A 2CVRA 2EJFC 1CQVA 1Y1VG 5IY0A 1PTOD 5COYA 3VA7A 3OTOL 2RDGA 4DR1L 2EYHA 1SROA 1EEFD 3K57A 1BO0A 1SYCA 4A3IG 3Q8DA 2F0QA 3RMHA 4JI3Q 1W6JA 3V2TA 4YWLA 4A3DB 4OIJA 3D8GA 3RNUA 1VQAA 1XJVA 4FNFA 1PTOH 3CW2C 3OIQA 4HAEA 1SSOA 2ID0A 4XDXA 3VR2A 5EPLA 1QVGA 2K04A 5M5WB 3RZOB 1EU3A 3QR8A 1HQRD 3GTKB 1B9MA 1DJRD 1CKMA 2MGSA 2VXWA 3BVMA 2A74C 1TWCH 2MNAA 1F9RA 1FL0A 2L9HA 3NELA 1S72A 2UXCQ 1T9HA 5LMUL 3P20A 3CCRA 2SNSA 3W1BA 1RTNA 4JI4L 4FF1A 1YBYA 1J5EL 1HZCA 2EYFA 4XYQA 4A3FB 1HNWL 2R6GA 1SRUA 1FGBD 1HFGA 1HCZA 1PFBA 3SVMA 1U0LA 4K5XA 3U4ZA 1S5DD 2E2HB 1JCKB 2XNAC 4DV0Q 5AFWA 2K5DA 1EZ8A 2EJGC 1Q7YC 1SJED 4N8X1 3H0GB 1A3TA 3BS1A 1GKHA 2VQFL 2PI2E 1VDZA 1VQLA 2NZHA 4B3RQ 5I9PA 3I91A 1B50A 4ABNA 1LACA 3CPFA 4MN3A 2F0HA 4K14A 2UXBL 1JICA 3KFUA 5I4DA 1LUZA 2KCNA 3RR5A 2KOLA 1SJHD 2F0OA 3A7LA 4O1NA 1PTOC 2RKSA 2Z4HA 3PUVA 1EY8A 1XMQQ 1SYBA 5FJ8G 2ZXPA 2I0QA 2RQXA 2K33A 1HZAA 1PH5A 4RGNA 1I4QA 3KF8A 5KNBA 1EFWA 2K5HA 4TKOB 1X55A 1CSQA 2A68C 1HZ9A 1LM0A 1I4HA 1G91A 4KTAA 3EVQA 2M00A 1S5FD 2H5XA 3U9OA 2C9OA 5IT9E 5JAVA 2JA8H 2O2LD 3S1RB 4BY1H 1HFNA 5JJZA 2F0EA 1B44D 5EAYA 4PMWA 4ODGA 3JC66 1QCBD 1OXTA 1X9NA 1VQGA 4S3SA 3HKZB 3W2DA 5C3EB 1NR4A 4PG3A 1V1QA 3BDCA 5LMNL 3H94A 4A3FG 4V190 5BN4A 1XNQQ 5EPJA 2DJGC 2VY3A 3SHLA 2P5ZX 1SFOB 2CHBD 1M4VA 2CW0C 4DNRB 3UE1A 1X3GA 4OWXB 1KHIA 2K50A 2K75A 5I6WA 1HR0W 1IKMA 1K8MA 4A93B 4C3IH 3VDYA 4LFCQ 3EJIA 1K8GA 1YNND 3JAML 5LMUQ 3F2DA 5IWAQ 2PW5A 3A8IE 1QVFA 2ZTEA 2AUJD 4LF7L 1EIHA 1ET6A 2MJ8A 2VS1A 2HUGA 5FK9C 2WAQB 2V4DA 1V1PB 3ITPA 1QZGA 1EY0A 4FF2A 1L0XB 2QW7A 1W2BA 2H1EA 5C44B 4HJAA 2D62A 1EY4A 1WFQA 2DY8A 2IWHA 1QB5D 1JJ2A 2E2JH 1YJ9A 5I9OA 3R2TA 3BYYB 4A3LG 1Q90A 5ELOA 2PYKA 2JJQA 4FYDA 2XRSD 2UUCQ 4YCWA 1RL2A 2K05A 2JA8B 1TWHB 4RHRA 1R9TB 4IUPA 2WKDA 3VR6A 3VR5A 1FGUA 1C8CA 4L5SA 5KNDA 1PFMA 4YCUA 1TWGB 1PRTB 1TKWB 1H9MA 2R93B 1I6HH 2PPBC 2ZT9C 4G4KA 4B3ML 2A6HC 2IHEA 2NVXH 3MC0B 5C4ZA 3DM1A 4OL7A 4JI0Q 4BBRB 1B9NA 3BVGA 3E0JA 3PUXA 4ZUJA 4JI2Q 1EL0A 3S1QB 1SMYC 1PH1A 2NZ1D 3CU7A 1P16A 4A3GG 4GLAC 4RA8A 4Q5VA 3HOWG 4DAYA 2MHVA 3U9SA 2NVYB 1W3SA 3CD6A 1UAPA 3JAME 1O7IA 3S15H 4IFDH 1Q1BA 2K52A 1YZ6A 4JCVE 3RUZA 1NAPA 3G6EA 4IFDJ 2WB1E 1Y1VB 5NUCA 2ZM6Q 1FNVA 4NXML 4ZUIA 1SNMA 3GTGH 1KQSA 4DN4M 3HOXG 4RHSA 1KTKA 4IFDG 2JSOA 4K5WA 1EU4A 1YIJA 1PZKD 1JWUD 5E3FA 3STBC 5C44G 3D6WA 3HFZB 1Y8NB 2FMCA 2MP1A 4A3GH 4HJ7A 4BBSB 3UDXA 5GAEC 2GA4B 2PI2A 2AMCB 1S5ED 2VUMB 1L0WA 3GTGB 1HNWQ 3I73A 5A35A 2FXQA 3E3XA 2R93G 4K8IA 2DJFC 3PO2G 3RLFA 4A3JG 1SYGA 3E9HA 2VNUD 1SNOA 1GUSA 3CQZH 5KNCA 2XGTA 2C35B 4C56C 1IL2A 4H7BA 1HXYD 1O80A 1WD1A 4Y52H 2FFKB 1BQQT 3NXWA 3F2BA 3NQIA 4IPCA 1QVCA 2K01A 2E2IB 1EIGA 4OO1G 4JI6L 1B70B 3IL8A 5DM63 1J5EQ 3K7UC 5IP9G 3LNNA 2LS01 4DK1A 1PYSB 4H44C 5IOCA 2JXMB 5JJLA 1X65A 4UP7A 2E5LQ 1PMRA 3KLSX 3T16A 2YU9B 1CA6A 3P75A 3I4MB 4DNTB 1JOKA 5D3DA 2M2LA 1E1TA 1UE5A 1YHBA 4MTNA 3UI2A 1WTRA 4UPAA 1EY6A 2Z9HA 1NMFA 3T51B 3PO3B 1FNWA 1F2MA 1M8AA 1R9TH 1OTCA 2IX0A 1LLRD 2K4KA 5J3BA 3GTMH 1D6EC 3HOWH 3C3LA 1GUTA 1G2SA 1NJIC 4NXMQ 1A6XA 3Q0AA 4I7ZC 5M3MG 4WRDA 2YU9H 2I5HA 2F0MA 1DONA 1E0BA 1TQOA 2ATWA 2CWAA 1HA5A 3K5LA 2AKWB 2WFWA 4LUZA 4JI3L 1EIFA 4YY3L 2E75C 3A74A 3PO2B 2JE6I 3TBIB 1YHAA 2PNHA 4HJ9A 5JVG3 3U58A 2OTJA 1NMGA 1TWFH 2F03A 2BH2A 2PW7A 4IJLA 5FLMG 4IFDI 1CA5A 1JE4A 2BE5C 3R93A 5ELCA 4HJ5A 1JB3A 2ENBA 4PZ8A 4POGA 4A3FH 2Q2IA 1R4QB 4CGYB 1XNRQ 4CBVA 1NY4A 5I2YA 2PZTA 2XN9C 3I70A 3PUYA 5KIXA 3C46A 4XT1B 3G48A 4MHEA 2HIVA 3DEPA 3O13A 3PSIA 1MBYA 4HN7A 3ULPA 4BY1G 1PRTD 2LKVA 4ZKCB 2QA4A 5M5XB 2UUBQ 4LFAL 5JJKA 2LXJA 4LF9L 1WJJA 4LUVA 4GKJQ 2XSCA 4XIGS 4X65Q 2ZTCA 2D9UA 3ZYYX 1SE8A 3F1ZA 1OXVA 3OIPA 1CHQD 3I8ZA 3J81j 1GJXA 3HP3A 1FNUA 1K9MC 1WVLA 5D14A 5KYLA 1QNKA 2A6ED 3J81L 1STNA 3EN2A 1YITA 4JI7Q 4AYBG 4C2MB 2UUCL 4F7XA 3I4NB 1PFSA 4DV0L 2F0IA 2F0VA 3J80c 3H6MA 2HCIA 3CCVA 5CR3A 4U673 2QDLA 3FVQA 1N9WA 4RFBA 1WTXA 4OEMB 1I6HB 2RHSB 4C3IG 5J22A 2B2UC 1HTLD 2BCOA 1KDAA 4POFA 3IRBA 3T53B 1N32L 1TU2B 4BXXH 1KABA 4I7AA 4HR7B 4A3BG 1DOKA 3K80C 4N9TA 1E3PA 3J81i 3CC4A 3OYYA 1XYIA 4UHVA 5DEHA 3ZJYC 1MHWC 1NUCA 2F3IA 4R8IA 1LO5D 4JW0A 4K0KQ 5GQOA 4CDDC 2PNRC 1VS0A 4WFN3 3RD4A 3A54A 1A15A 2F0GA 2E2JB 4C3HB 3AB9A 3GD7A 4WJ3M 1MGSA 4A75A 4IUQA 1VQFA 2FHTA 2EDGA 1B8AA 4LF5L 4HMJA 3G4SA 2RA4A 1VQIA 1VQBA 3FKIB 2YV5A 5C4HA 1STEA 1IHZA 2QILA 1SR3A 4FF4A 1CK1A 4B3SL 1QILA 1VF7A 1RIPA 2NB0A 1VMPA 2A1AA 1BF4A 1WTVA 3HOZH 5FJ8H 4TSSA 1CT1D 4JG2A 4DR1Q 2OCEA 4GKJL 1CZWA 1V1OA 5FLXE 4X66L 1A62A 2KBNA 2BDNA 3T56B 3SE0A 3WOFA 4B9WA 2KA7A 1PVOA 1EY7A 1Q8IA 1U9RA 2G9HD 4KMUC 3T1YL 1MI2A 2AQ2B 1BXTA 3NEMA 3HOXB 4A3IH 3K59A 3GTOH 1FD7D 4KHVA 3AEVA 4LF8Q 2B8FA 1Y1VH 1BKBA 4DR7Q 2TMPA 4OWTB 1D5XC 1WI5A 1E7ZA 1VQDA 3SDZA 4GLXA 3TEHB 3T1YQ 5M5WH 4UP8A 5ELBA 3GO5A 3S16H 4FXKC 2QF7A 4PZ6A 1M1KC 1STAA 1VQ8A 2IX3A 1VQ7A 4WJWA 2EPBA 3CXCA 1RDPD 5FO9B 4B3TQ 3HOZG 3TP8A 1YHQA 1FJGL 2YYZA 2F1MA 3BYTB 2DGYA 1Q1EA 4IALA 2F0WA 2E8GA 4A3DH 1CUKA 5IYCH 1BDOA 2KCTA 5EJWA 3S16B 2VQEQ 1SLJA 1KAAA 1VMCA 3L3OC 3RZDH 2EXDA 4F88A 4LK1C 1PYBA 1XMOL 2Y0SB 3NBIA 1SYFA 2R61A 1II3A 3H91A 1XTDA 4TVAB 4HIDA 1SYDA 5DAUA 4JI1Q 2JA7H 1A3UA 4HIOA 3R8BA 2Z6BA 3KUPA 2A73B 4LF5Q 4NPSA 1IBKQ 2PZWA 2WKCA 4NP5A 3HKZE 5IWAL 5IGCA 4KY6A 4LJZC 3SEBA 1UNSA 2WV6D 3EROA 1DZ1A 4A3BH 3CQZB 4BXXG 4A3CG 5IP7H 4M1UB 3GDEA 2GN5A 4YHHQ 1YNXA 3M4YA 4KJOA 4NMZA 4OIKA 2D5DA 2OF1A 5FOBB 2EIFA 3BZDB 1LTID 3J7ZC 3CC2A 1EIYB 1HTPA 1VQ4A 3SK8A 1N36L 1G291 1XPOA 3S1NH 2KHSA 4TQUS 4YWKA 4G57A 1YEZA 2KQ3A 1I4RA 2B2WC 1AP0A 1EY9A 3PO3G 1AE3A 2SNMA 2VB2X 3MXGA 1EEID 1B3QA 4LFAQ 4DR4L 5FLXL 3CP0A 1F2LA 1I3QB 2EQSA 4R1JA 2EOTA 4A3KH 1CKNB 4X62L 2QEXA 5AJ3Q 3QJYA 4DUZL 2G5DA 4DNIA 3S14B 4LF6L 1FJGQ 5CGKA 3HKZG 1E1OA 3RZDB 4BWGB 2X6LA 4DK0A 3KJPA 2B2UA 4OX9Q 2OT2A 4LW1A 3H3VI 3OHXC 4NKLA 1H9RA 4DV7Q 2E76C 1OXSC 3NSWA 1R4PB 3CF5A 4X66Q 4L8JA 5CMDA 3ERSX 2F4IA 3J7YW 2V1CC 4R4CA 3L0OA 4UAIA 2AQ1B 5EKIA 3S2HH 4R4IA 4J6HA 2QDBA 4K2KA 3S2DB 1K8AC 1WD0A 4KJNA 3F8TA 2ZJPA 2JA6G 1F9PA 3HOVH 3NHHA 3KF8B 2NVTH 4AQYQ 3AFQA 3CCLA 5M3MH 1LTRD 3FEWX 3TP6A 4IOCA 2EY1A 3SK5A 2IY5B 1TWHH 2ALYB 2D2CC 2VL6A 1JOOA 5T1GA 2BDOA 3KDFA 5M5XH 4DV1L 5IGDA 3KLRA 1UE7A 5E4XA 1N36Q 1I6VC 5E1FA 2IJ0A 3U4VA 1O7ZA 4GZYC 1G6PA 1PH8A 2UUAQ 1FR3A 5LL6S 4AYBB 1GO3E 4A3KB 3PUZA 5LMNW 5IP9H 3DEOA 1PH2A 3GTPH 4AIMA 2UU9L 4IUTA 2CQOA 3KBGA 1HPCA 4PV1C 4OO1H 2YTXA 3URYA 4QJFA 1Y69U 4K6LA 4J15A 4KKUA 4YIJA 3S15B 1A0IA 4ZRZA 5L37A 5C4XG 2K1BA 2L5TA 1KC8C 1TS3A 1AE2A 3PO2H 1MD2D 3J7AV 1U4RA 4X3UA 3GTPB 3F2UA 2VQEL 3STBD 3SK6A 2LY7A 3MAQA 3TSSA 1N33L 3K81C 2A19A 4O42A 1Q12A 3QOLA 1C0AA 2CFMA 3NE5B 3M7NA 3S1MB 1UEBA 4DPGA 1UEAB 4ZCKA 1SAPA 3BJUA 2R7ZG 2NVTB 2B2YA 1EWHA 4B3TL 4C1NI 4X3TA 3GQBA 4C3HG 1YVCA 2YTVA 5E7NA 1GVPA 4G7ZC 2N78A 2R92B 3M4PA 4JI7L 4KV6A 2NN6H 1KLGD 5ISRA 1TWAB 4ID6A 3NENA 4GNXC 3S1RH 4BY1B 2IPKD 2L11A 4JC0A 4LF4L 3S1MH 1HR0L 1SMYD 1PH6A 5KGUA 1D1IA 2I46A 4I65A 1BVSA 3HEJA 5GADC 5M3FB 4A93G 1LTAD 3PIPA 4UY8C 2CQAA 3EBEA 4OX9L 4CJ0B 4LF6Q 3EIVA 2JP1A 1SE2A 1Q46A 5K5PA 1XMQL 1EFID 1IL8A 3MZ5A 4B3SQ 4EX5A 1TY0A 2A69D 1GUNA 1QUQB 1C4QA 4MNOA 4DU9A 4XQQA 3K0YA 2N88A 3KDFB 4IPDA 1G8ZD 1AEXA 5AJ3L 4QF4A 1IKLA 4DGZA 1D5MC 4DR3Q 2E2HH 3T1HL 4GS3A 3A0JA 2RVLA 1NNXA 3HOYG 4YCVA 4ZLTF 1RD9D 4P72A 3J81E 1QWYA 3HOUB 3RLNA 2B2WA 4A3LH 1QG7A 4NW2A 2JK8A 2IW3A 2Q2TA 4CJ1B 4JBJA 1AZQA 5IODA 3PF5A 1EYCA 5IYDG 1GHKA 1PRTF 3M4OB 1ASYA 1LTGD 2QGQA 2XWJB 4KN7C 2VZAA 3BDOA 4GLVB 2KEDA 3CCEA 1T5XD 1YNNC 5C6AA 3NWTA 4K5VA 4KI0A 4GOPC 2A68D 1C48A 5IYBH 3K5MA 3RZOH 4A3BB 4RG1A 4IURA 2CW0D 4QUCA 2UUAL 4FVMA 1B2TA 2ASBA 3S17H 1UWVA 3I4MH 3FDTA 3SGIA 4DV3L 4X64L 1STGA 1I4GA 4HIMA 2F0FA 3MEHA 3N6RA 2KCMA 3PIP3 3S1QH 4DV1Q 3D31A 2LFNA 4IUUA 2VW9A 1ICWA 1BNZA 1STYA 1DYQA 4GKKL 1CTMA 3A7AB 3QO2A 2LXKA 3I4NG 1S5BD 2N55A 4LAAA 1Y1WH 1RF2D 3S24A 1BCPD 2EXZA 4IQZA 4Y7NB 3A5UA 2D0PA 1WTPA 4P74A 2OQKA 2XRQD 2B39A 4Q0FA 3CMAA 3W3AA 5C0XG 3G71A 3IAYA 3OOCA 2RHQB 3TP5A 3CCQA 3J80i 4FXGC 4XQNA 5C5LA 4C3JG 1BBXC 2ZJRA 3PIOA 3TN2A 3G7LA 3I56A 1SBBB 1OO9B 1QZHA 3I72A 2FMMA 3V96A 3C2PA 1IBLL 2HQEA 4LF4Q 2F0LA 1WCMB 3GV6A 1I4XA 4P2CB 1STBA 1CKOA 1BUVT 3KF6B 1X3QA 2F4VL 1IZ6A 2WP8J 1JOQA 2RDHA 4KD3A 3ERQA 2M9VA 1SN8A 4K8JA 2PMZB 4R4QA 1IBMQ 1J6QA 2TSSA 4QY7A 3J7AF 4M8AA 1B4OA 4GN5A 2F0PA 2KENA 2K5QA 4YWMA 1QNUA 3RN2A 1K0SA 4P75A 5C3EG 3CCJA 3CCSA 3D4DA 4KY5A 1IYUA 2H4OA 1SXTA 3WOEA 5EQ0A 5JEAG 1EYAA 1SNDA 5EBCA 1D5ZC 3TMEA 5D65A 2B2VA 3QWNA 4AH6A 1TR5A 4WJ4A 1PLFA 1GM5A 4A76A 2NUCA 2BH8A 2WACA 4PMCA 2XWBB 4N8FA 1WTWA 4X64Q 1SDFA 2D0OA 3KBXA 1L2FA 3J80E 3A55A 1HRJA 3GTLH 1M90C 3WDNA 2LSSA 4QQBX 1HH2P 1Z9FA 1HUNA 3I4MG 1K83H 2NVXB 1S5CD 4QUFA 2F0NA 1FVIA 3NTIA 4DR5Q 3K6OA 4BA2I 1HA6A 1TS4A 1DGSA 1ONLA 2DUDA 1UE6A 1DOLA 4HIKA 3JAMi 3I4LA 4GNXA 1RCVD 4RWSC 4DR6L 2L55A 1TXYA 4HEDA 2ZJQA 1NCVA 5M3MB 2UU9Q 2RSNA 3H0GG 3ONAB 4OHJA 5IYDH 5IE8A 1I4PA 4KHZA 1CSPA 2F0SA 3NBHB 4RCNA 2A6EC 1SNQA 2IHFA 2E2IH 3S17B 1BCPC 4RH6A 3V05A 4LNQA 1JR0D 4XTCS 1S3OA 1JQYD 1KD1C 4IPGA 4X6AH 4OELB 2O5JC 5I6YA 1KRTA 4CDFC 1JWMD 2AWNA 3H09A 1I94Q 3CPWA 2FJ2A 1N8RC 3IFTA 3CKIB 5M5YB 4EQPA 5M3FG 1SE4A 2PQAA 5G3LF 3MFYA 3NP8A 1VQKA 1I50H 1NR2A 3DM3A 4DFAA 4DXFA 3J81c 2R92G 5CV8A 3W5OA 1ENCA 3T4AC 2BOSA 1LABA 3GTJB 5LHY1 4A3MG 2RF4A 4K6DA 2BE5D 4C3IB 5EGTA 3MXNB 4KKSA 3KYHC 4OXPA 1EOVA 3ND9A 2HHHL 2HIXA 1B53A 2UXDL 2AUKA 4B08A 2A69C 4HSVA 2RDFA 4A3GB 3R3OA 4QIWB 3CCMA 1S4ZA 5ELFA 1HHVA 2A8VA 3OWFA 2ZXRA 4RKBA 1EY5A 5C0XI 4JI0L 1KDBA 5KEEA 5DM73 2B63G 2K03A 2HCCA 1E2VA 1H9SB 2HHHQ 4AYBE 1WYDA 2QEJC 4JPBW 1IBLQ 2CH4A 1HNZL 4A3EG 2NVYH 3TRZA 3C1FA 1VQ9A 1KXLA 1ZYRC 1H9SA 1SMXA 1JORA 2KHJA 2UXBQ 4JI5Q 4RGTA 1EQVA 3HOYB 4L6TB 4QIWE 4DK6C 3FPUB 3NBHA 4U68A 4F8MA 2NVQB 1LT3D 5IT9c 4ME5A 5K36H 2G9DA 4JI2L 3L9AX 5GROA 3LGJA 1N33Q 1D7QA 1Y1WB 2XTIA 5CORA 3I3CA 5JJIA 2VQFQ 3UDFA 3K58A 3KK7A 3GTQB 3HGBA 4P73A 1YJWA 3M4QA 1Z47A 1IBKL 4K0KL 3S14H 1CI3M 1JB7A 3VR4A 3I2ZA 3LWUA 4LUOA 1YNJD 4BBSG 1VQEA 2KHIA 3LWEA 1G51A 1ESFA 1N34L 5F2DA 4KHPQ 3UE0A 3Q6SA 4LFCL 1VQMA 3HOUG 4C2MH 1LTLA 4F87A 2B29A 2C5CA 1CFMA 5JVH3 3R2IA 2A5HA 1MIUA 2Z6KA 3VA5A 3H15A 3TZUA 4A3EB 2HQLA 4HTHA 3S1NB 3HZXA 3I7FA 1WOCA 2DNEA 4J8QA 3HOUH 5LL6X 4DR2Q 2J7ZA 4DA2A 4QCLA 1DD2A 2R3ZA 5EBDA 2RSOA 3U50C 4HCEA 3C1EA 4IOAA 1CHPD 1TWCB 1X56A 4BBSH 1KNEA 1V8QA 4ZQ3A 1WCMG 3FHWA 1QUQA 2VUMH 2R7ZB 2K6AA 3ICEA 1I50B 5KYIA 2JA6H 4DR3L 2B2VC 2VB3X 2YTYA 3OSOA 3DWAA 3GTJH 4FDBA 5GAGC 3KJOA 2WINB 2MO1A 4FXDA 1DCZA 1RHPA 3PGZA 5LMNQ 1AZPA 2Q2HA 1Q8KA 2UUBL 2GVAA 2NBFA 1WCMH 3BZCA 1Z7TA 4LF8L 3E6ZX 1SE3A 4DV6L 1JT8A 5K36G 4JOIC 4DUYQ 2ES2A 3DMUA 5CBAE 1ZEQX 2EY2A 5FKAC 5HURA 4IO9A 5IT9L 4CKBA 3X3NA 5G3LD 3S2DH 4QMGA 4OWWB 1BCPB 2Z8LA 1WTHA 3AFPA 1Z6HA 1CM9A 4EQNA 1VF5C 3MVVA 1T5EA 2ZTDA 1KAWA 4Z9CB 4A3KG 2EZVA 1PA6A 2F0UA 4JBWA 1SNCA 4FF3A 1EWCA 5CYUA 4H13C 3E0EA 4RCOA 1LTBD 4XXEA 4B3MQ 2L1BA 2B63H 2AWOA 4BBRH 1ZKOA 3PO3H 4O0AA 2E5LL 1TWGH 1QOHA 1XWEA 3K5NA 2IT1A 1SNPA 5JPNC 4G7HC 1RTOA 3TQYA 3OW2A 3KOJA 3D4RA 1PZID 4XT3B 2A6HD 1W6KA 1ILPA 4GN4B 1K83B 4GOPA 3CHBD 3MWYW 3DLLA 4ZAIA 1DOMA 2XVSA 4EVOA 5CC4A 1C7YA 3NK9A 1D2BA 1KL9A 1JE5A 1ML0D 2KEEA 3UDIA 3CCUA 2KUMA 2SEBD 4A3CH 3CMEA 2K32A 4LFBL 1Q86C 2JA6B 4YHHL 4ZKBB 1EZ6A 3MXUA 5C4JB 4X3KA 1ZYRD 3G6JB 3DXJC 2I5LX 4PQXA 3I4OA 3FP9A 3KLWA 1YJNA 3X3MA 4LF7Q 2K7VA 2KECA 1GUOA 4RMFA 4JI1L 2OEOA 2JA7G 1G2TA 5H1SE 2JA9A 1ASZA 4DR6Q 4DR5L 5M5YH 4JK1C 3QIAA 1ILQA 4A3EH 3H3VH 3FKIG 4MIUA 5T1IA 3SR1A 1JJGA 4CDEC 2IL8A 1TVXA 2OWOA 2B3GA 1XNQL 5C4JH 1LT4D 3BVZA 5IYCG 5C3XA 5IGBA 1XMOQ 3W1GA 3TDQA 1TIID 1A3VA 1OXXK 4NXNL 3NUCA 2RCNA 3BZKA 3GTKH 1MSHA 2WB1G 3A5ZB 5IIFA 4JI5L 2SOBA 4TRDA 1PZJD 3K5OA 5ELDA 3NWSA 2B63B 4DAPA 3OTOQ 5M9OA 2O5IC 3MA2B 2QKIC 5JOBA 2Q8RE 4DK3C 2EJMA 1MKHA 3D6CA 3ER0A 2MPMA 3DUZA 2IX1A 2RBMA 4DR7L 3VYTA 1PDQA 1BOSA 3GTQH 3D4WA 1J8IA 2JN4A 4DAMA 2XIWA 5M3FH 5ELEA 2F4VQ 5CV5A 3LX0A 1VQ5A 1X54A 4RGMA 2PCFB 4X62Q 4OONA 4FO2A 4HMIA 5JEAH 2I5MX 4JVZA 2EYLA 3A8JE 3DHQA 1PH4A 1E2ZA 5HY6A 1LYLA 1XX8A 4DUYL 3D3RA 1NSNS 3GTLB 4L63B 1EWIA 1A2UA 1H95A 1FYCA 4ALPA 1ET9A 1Q82C 3K7AH 2FINB 4DV2L 4OO1I 2Q8TA 4CJ2C 2L15A 3E9IA 3H0GH 2NVQH 1PFNA 2Z6KC 4V0BA 2N8NA 1IW7D 2JA5H 1O78A 4YY3Q 1RODA 2O4XA 4FP5D 1EUJA 1U5KA 1S40A 4RGOS 4X3SA 4XYOA 1PH9A 5FLXc 4DF7A 5BR8L 4DXGA 1HNXL 4HSPA 4JI6Q 2EYMA 3MHBA 1ESRA 2K14A 1A8VA 2JEBI 3MTSA 2KVMA 2PMZE 2F52A 2JA5B 2F0JA 3FRPB 1XTCD 4BY7H 1X6OA 5IGGA 4HJ8A 4R4TA 3IKJA 3VYRA 1TS2A 1PXUA 1Y1WG 3M3YB 4P71A 3QB3A 4BA1I 1HNXQ 4UP9A 2JA7B 1B7YB 4CKCA 3I90A 4CKEA 4LMQD 5C3EH 4DAYB 4JYAQ 2DNCA 3Q23A 4BY7G 4JOIA 1N32Q 1N34Q 5HGTA 2KCCA 1PYWD 2R7FA 3OWEB 1VQOA 1PTOB 5D3IB 4KKTA 4A3JB 3PV0A 5EKLA 2B2TC 1AW7A 5DNFA 3M7GA 3PQIA 3S2HB 3M9BA 1IW7C 1F2ZA 5BR8Q 4ZYSA 3RN5A 1VQNA 1JWSD 1HZBA 1L1OB 3HOVB 1BBUA 5I2XA 4X65L 4Y7NH 4R4OA 1VQHA 2ICEC 1KRSA 4KLKA 1V43A 2JA5G 4ILWA 5CV4A 5DLQE 4DV4L 4KY7A 2EVBA 5ELNA 3CRLC 1Q3LA 3QG1A 1BR9A 1Q81C 4C3JH 5JEAJ 3TS0A 4JBMA 2MO0A 2MUYA 5IGFA 1QE6A 1ZXTA 5C0XH 1XNRL 1HR0Q 3GP7A 1J9OA 1EYDA 3B6YA 4R8NA 1K3BC
chains in the Genus database with same CATH topology
4JI1Q 2JA7H 1KRTA 5EAYA 4PMWA 4L5RC 2AWNA 2K5NA 1CKNA 1C9OA 3JC66 4HIOA 2PQAB 3HOYH 1OXTA 1X9NA 1I94Q 1VQGA 1AH9A 4LF5Q 4NPSA 1IBKQ 1YI2A 4PG3A 1V1QA 3CPWA 3I4NH 5LMNL 4A3FG 3HKZE 3M85A 1N8RC 5IWAL 1XNQQ 4JV5L 1L1OA 2VY3A 5M3FG 1A63A 2PQAA 5FLMH 4DV6Q 1VQKA 1I50H 3DM3A 3UE1A 3J81c 4A3BH 2R92G 1X3GA 3W5OA 4BXXG 4OWXB 1KHIA 2K50A 2K75A 2N49A 1XPUA 4A3CG 5IP7H 1HR0W 3GDEA 2GN5A 2R7DA 4YHHQ 4A3MG 4C3IH 1YNXA 2RF4A 3VDYA 4LFCQ 5GAHC 1K8GA 4DV7L 3MXNB 2EIFA 2MFIA 3J7A5 5LMUQ 3KYHC 1JJCB 4OXPA 1EOVA 5IWAQ 3J7ZC 3F2DA 1EIYB 3CC2A 1QVFA 2ZTEA 2HHHL 2HIXA 2UXDL 1VQ4A 4LF7L 2BA0A 1N36L 5IYBG 1G291 1XPOA 2VS1A 4A93H 3S1NH 4B3RL 4TQUS 1I5FA 4YWKA 1YEZA 3CCMA 1QZGA 4DV3Q 2BA1A 4GNXB 2A8VA 1W2BA 5C0XI 3PO3G 4JI0L 2JQOA 1AE3A 2B63G 4HJAA 4NXNQ 4LFAQ 2HHHQ 2D62A 4DR4L 4AYBE 4GKKQ 1WYDA 1WFQA 4L5TA 3CP0A 4R1JA 2EQSA 1IBLQ 4A3KH 1HNZL 1CKNB 4X62L 1JJ2A 3FKIH 2E2JH 1YJ9A 4A3EG 2NVYH 2QEXA 3WWVA 5AJ3Q 4DUZL 3TRZA 4DNIA 4A3LG 4LF6L 5ELOA 1FJGQ 1VQ9A 4JBKA 4JI4Q 1VQ6A 1KXLA 3HKZG 1E1OA 2JJQA 1HJPA 3AYHB 4C3HH 1SMXA 1NTGA 3PCOB 2KHJA 2UXBQ 4ME3A 2UUCQ 4JI5Q 4YCWA 1RL2A 3KJPA 4QIWE 4DK6C 2Y0SG 4OX9Q 4LW1A 2HT1A 5IT9c 3H3VI 3BU2A 4DV7Q 1FGUA 4LFBQ 1OXSC 4JI2L 5C0XJ 4L5SA 3CF5A 4X66Q 5GROA 3LGJA 1N33Q 4YCUA 1D8LA 1D7QA 3ERSX 2XTIA 4A4IA 1I6HH 2V1CC 4R4CA 4B3ML 3L0OA 2IHEA 5JJIA 2NVXH 3S2HH 4R4IA 3UDFA 2VQFQ 4X6AH 4P73A 3ULLA 3K0XA 1YJWA 4KHPL 3M4QA 4A3JH 1Z47A 4H02A 2CKZB 4JI0Q 1IBKL 1K8AC 3PUXA 4JI2Q 2Y0SE 3F8TA 2ZJPA 2JA6G 2R93H 4K0KL 3HOVH 1PH1A 3S14H 3KF8B 2NVTH 4AQYQ 3AFQA 3CCLA 3L2PA 3T1HQ 5M3MH 1JB7A 3I2ZA 4LUOA 4IJHA 4IOCA 4BBSG 1IBML 1VQEA 1P16A 4A3GG 1K0RA 2KHIA 4GLAC 4QL5A 1G51A 2IY5B 3HOWG 1TWHH 1IXRA 2ALYB 2N3SA 5HGQA 1N34L 3UE0A 4KHPQ 3TREA 3CD6A 1W3SA 5C44H 4BBRG 2VL6A 3D0FA 1O7IA 3K8AA 3S15H 4NB3A 4LFCL 1VQMA 3KDFA 3HOUG 1Q1BA 2K52A 1YZ6A 4JCVE 4C2MH 5M5XH 1LTLA 4JI8Q 4DV1L 4DV2Q 4AQYL 3G6EA 4IFDJ 2B29A 2WB1E 3HOXH 4LWCA 2ZM6Q 1UE7A 3JAMc 4NXML 1EQQA 1MIUA 1N36Q 1VQCA 2NN6G 2Z6KA 4QGUA 3H15A 3GTGH 1KQSA 3U4VA 3HOXG 1UE1A 2HQLA 1PH8A 4DV5Q 2UUAQ 1G6PA 4IPHA 3I7FA 1WOCA 3ULJA 1GO3E 3HOUH 4DR2Q 4IFDG 3PUZA 5LMNW 5IP9H 1PH2A 3GTPH 1YIJA 2R7ZH 3U50C 4AIMA 3STBC 5C44G 2UU9L 4EQ5A 2CQOA 3HFZB 4IOAA 4O2DA 4A3GH 4HJ7A 1X56A 2WAQE 3UDXA 2YTXA 5GAEC 4BBSH 1HNZQ 4QJFA 1WCMG 2PI2A 3FHWA 1QUQA 2AMCB 4J15A 2UXDQ 2VUMH 4DUZQ 1L0WA 1HNWQ 3ICEA 2FXQA 2JA6H 4DR3L 2R93G 1A0IA 2OTLA 2YTYA 3PO2G 1PV4A 3RLFA 5C4XG 4A3JG 3GTJH 3E9HA 2VNUD 4FDBA 5GAGC 1KC8C 3CAMA 3KF6A 3CQZH 3KJOA 1AE2A 5C4XH 4DV4Q 3PO2H 2MO1A 2XGTA 2C35B 1IL2A 3PGZA 5LMNQ 2VQEL 3PUWA 3STBD 2Q2HA 1Q8KA 4DR4Q 4Y52H 2UUBL 2GVAA 2VUMG 3F2BA 2JEAI 1WCMH 1N33L 1QVCA 3BZCA 3K81C 4IPCA 4LF8L 2A19A 1NBWA 1Q12A 4DV6L 4OO1G 1Y14B 2K5VA 3RLOA 1C0AA 2CFMA 4JOIC 5K36G 1JT8A 4APVA 4DUYQ 4JI6L 1B70B 2Z0SA 1OXUA 1UEBA 4DPGA 3M7NA 4GN3B 1J5EQ 1VQJA 3BJUA 2ES2A 2R7ZG 4B3TL 3K7UC 5IP9G 1VQPA 3TS2A 4IO9A 4DR2L 1PYSB 1YVCA 2YTVA 3S2DH 3UDGA 1PH7A 5E7NA 4OWWB 5JJLA 1X65A 2CWPA 2WAQG 1GVPA 3AFPA 4UP7A 2N78A 2AHOB 3M4PA 1XPRA 2E5LQ 1JMCA 4JI7L 1NE3A 1TWAH 2ZTDA 1KAWA 3CC7A 4A3KG 3NENA 4GNXC 3S1RH 1PA6A 4JBWA 4PZ7A 1E1TA 1BBWA 1UE5A 1YHBA 3E0EA 4MTNA 4JC0A 4LF4L 3S1MH 4JYAL 4B3MQ 2UXCL 4UPAA 1NMFA 2B63H 4L5QA 2AWOA 4BBRH 3F2CA 1HR0L 3PO3H 4O0AA 1PH6A 2E5LL 1EQRA 1TWGH 2IX0A 2K4KA 1R9TH 5J3BA 1OTCA 3GTMH 3HOWH 3HKSA 4DKAC 1BVSA 2IT1A 5GADC 3TQYA 2MQHA 3OW2A 3KOJA 4A93G 3PIPA 1NJIC 4NXMQ 4UY8C 1I3QH 3EBEA 1MJEA 5M3MG 4OX9L 1KIXA 2NZOA 3PF4A 3M4OH 2YU9H 4LF6Q 3HOVG 2I5HA 4GN4B 4GOPA 3EIVA 2ATWA 1P8LA 1Q46A 2CWAA 1XMQL 2AKWB 3DLLA 2WFWA 4LUZA 4JI3L 4B3SQ 1EIFA 1L1OC 4EX5A 4YY3L 3A74A 1C7YA 2JE6I 1YHAA 1KL9A 1JE5A 2PNHA 3UDIA 5IP7G 3CCUA 1QUQB 4HJ9A 1EYGA 4A3CH 3CMEA 3U58A 1K3RA 2OTJA 1NMGA 3M3YH 1TWFH 4LFBL 2BH2A 1Q86C 4MNOA 4IJLA 4YHHL 5FLMG 3AQQA 2Q2UA 4IFDI 4IPDA 3KDFB 4HJ5A 5AJ3L 2I5LX 4PZ8A 4POGA 4A3FH 2Q2IA 3I4OA 4LF9Q 3FP9A 1IYJB 3KLWA 4DR3Q 1YJNA 3T1HL 2E2HH 4LF7Q 1XNRQ 4GS3A 1NY4A 3A0JA 3PUYA 2CCZA 3HOYG 4RMFA 4YCVA 4JI1L 2GVBA 3G48A 2JA7G 2HIVA 5H1SE 2JA9A 4P72A 1ASZA 3PSIA 4DR6Q 4DR5L 3RLNA 3ULPA 5M5YH 4MZ9A 4BY1G 4A3LH 3I55A 2QA4A 2UUBQ 2JK8A 4A3EH 4LFAL 2JA8G 2LXJA 3FKIG 3H3VH 5JJKA 4LF9L 1WJJA 1GD7A 4LUVA 2Q2TA 4GKJQ 1SFOH 1V9PA 4XIGS 1JJGA 4JBJA 4X65Q 2ZTCA 1MJCA 2OWOA 1VCIA 2B3GA 1SE8A 5C4JH 3F1ZA 1OXVA 2ZM6L 3PF5A 1XNQL 4JV5Q 2NN6I 5IYCG 5IYDG 1XMOQ 3W1GA 3J81j 4A3DG 1K9MC 1OXXK 4NXNL 1ASYA 1X3FA 2OQ0A 1E24A 2QGQA 4GLVB 2VZAA 3CCEA 2RCNA 4JI8L 4DV5L 1X3EA 3BZKA 3EN2A 3GTKH 2WB1G 1YITA 3A5ZB 3MEFA 4KI0A 4AYBG 4GOPC 4JI7Q 4JI5L 2UUCL 5IYBH 3RZOH 1PFSA 4DV0L 4RG1A 3J80c 3OTOQ 3CCVA 3L7ZC 2UUAL 2ASBA 1N9WA 3S17H 1UWVA 3I4MH 4DK3C 4GOPB 1K73C 1MKHA 2RHSB 3ER0A 4A3MH 1I94L 2IX1A 1PH3A 1PHJA 3SGIA 4DV3L 4POFA 3IRBA 4X64L 4DR7L 4BXXH 1N32L 3GTQH 1E22A 4HIMA 2R92H 4A3BG 2KCMA 3S1QH 3K80C 4DV1Q 4DAMA 1Y1VG 1E3PA 3D31A 5IY0A 3J81i 3CC4A 3OTOL 3OYYA 2VW9A 5M3FH 4DR1L 2F4VQ 3ZJYC 1VQ5A 4GKKL 1SROA 2F3IA 1X54A 2LXKA 4K0KQ 3I4NG 4X62Q 3Q8DA 4OONA 4A3IG 2I5MX 5GQOA 1Y1WH 1VS0A 3S24A 4JI3Q 3A5UA 1PH4A 2D0PA 5HY6A 1LYLA 4P74A 2OQKA 4YWLA 3RNUA 3GD7A 4DUYL 4WJ3M 1VQAA 4A75A 1XJVA 1VQFA 3CW2C 3CMAA 1EWIA 1H95A 5C0XG 1B8AA 3G71A 4LF5L 4ALPA 2ID0A 2RHQB 3CCQA 3J80i 3G4SA 1Q82C 1VQIA 3K7AH 4DV2L 4OO1I 1QVGA 1VQBA 2YV5A 2ZJRA 3PIOA 1SR3A 2L15A 3E9IA 3H0GH 2NVQH 2Z6KC 3I56A 2N8NA 4B3SL 1CKMA 1QZHA 2JA5H 4YY3Q 1RIPA 1TWCH 2MNAA 1IBLL 1FL0A 3NELA 1EUJA 1S72A 4LF4Q 2UXCQ 2A1AA 1U5KA 1S40A 3HOZH 5FJ8H 1T9HA 5LMUL 1CKOA 3KF6B 3CCRA 1PH9A 4JG2A 5FLXc 4DR1Q 3W1BA 1IZ6A 2OCEA 2WP8J 5BR8L 4JI4L 2F4VL 4GKJL 1HNXL 1SN8A 4X66L 1A62A 4JI6Q 4R4QA 1YBYA 1IBMQ 1J6QA 1J5EL 4QY7A 2K14A 1A8VA 1HZCA 2JEBI 2KBNA 2PMZE 1HNWL 2R6GA 1SRUA 2F52A 4GN5A 2KENA 4BY7H 1X6OA 4YWMA 1U0LA 3RN2A 3U4ZA 4P75A 4HJ8A 4R4TA 5C3EG 3CCJA 1PVOA 3CCSA 4DV0Q 3T1YL 1Y1WG 4P71A 4BA1I 5JEAG 1HNXQ 3NEMA 3GTOH 4A3IH 1Q7YC 4UP9A 1GKHA 2VQFL 1B7YB 4AH6A 2PI2E 4WJ4A 1VQLA 2NZHA 5C3EH 4DAYB 1GM5A 3AEVA 4JYAQ 4LF8Q 4A76A 4B3RQ 2BH8A 1Y1VH 1BKBA 3CPFA 4BY7G 4JOIA 4X64Q 4DR7Q 1N32Q 1N34Q 2D0OA 1WI5A 4OWTB 1E7ZA 1L2FA 1VQDA 2R7FA 3KFUA 2UXBL 4GLXA 1VQOA 3TEHB 1LUZA 5M5WH 4UP8A 3T1YQ 3GO5A 1M90C 3GTLH 2LSSA 3RR5A 3S16H 1HH2P 1Z9FA 3PV0A 4QQBX 3I4MG 4PZ6A 1K83H 1M1KC 1VQ8A 1FVIA 4DR5Q 3M9BA 1VQ7A 4BA2I 3PUVA 5BR8Q 3RN5A 1DGSA 1VQNA 3CXCA 1HZBA 1XMQQ 4B3TQ 2DUDA 1L1OB 1UE6A 5FJ8G 3HOZG 4HIKA 2I0QA 3JAMi 1YHQA 1FJGL 4GNXA 1HZAA 1BBUA 1PH5A 4X65L 4Y7NH 4R4OA 2YYZA 1VQHA 4DR6L 1KRSA 1V43A 2DGYA 1TXYA 4KLKA 2JA5G 1Q1EA 5DLQE 1EFWA 2ZJQA 2E8GA 4DV4L 4A3DH 1CUKA 2K5HA 2UU9Q 3H0GG 5IYCH 5ELNA 5IYDH 1X55A 2KCTA 1CSQA 5IE8A 2VQEQ 1SLJA 1HZ9A 1LM0A 4KHZA 1CSPA 3NBHB 3RZDH 4C3JH 1Q81C 2EXDA 2H5XA 5JEAJ 3TS0A 2IHFA 2MO0A 2E2IH 4JBMA 1PYBA 1XMOL 2JA8H 4LNQA 1XNRL 1HR0Q 4XTCS 3B6YA 1S3OA 1XTDA 4TVAB 4BY1H 4HIDA 1KD1C 4IPGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI1 Q;  2JA7 H;  1KRT A;  5EAY A;  4PMW A;  4L5R C;  2AWN A;  2K5N A;  1CKN A;  1C9O A;  3JC6 6;  4HIO A;  2PQA B;  3HOY H;  1OXT A;  1X9N A;  1I94 Q;  1VQG A;  1AH9 A;  4LF5 Q;  4NPS A;  1IBK Q;  1YI2 A;  4PG3 A;  1V1Q A;  3CPW A;  3I4N H;  5LMN L;  4A3F G;  3HKZ E;  3M85 A;  1N8R C;  5IWA L;  1XNQ Q;  4JV5 L;  1L1O A;  2VY3 A;  5M3F G;  1A63 A;  2PQA A;  5FLM H;  4DV6 Q;  1VQK A;  1I50 H;  3DM3 A;  3UE1 A;  3J81 c;  4A3B H;  2R92 G;  1X3G A;  3W5O A;  4BXX G;  4OWX B;  1KHI A;  2K50 A;  2K75 A;  2N49 A;  1XPU A;  4A3C G;  5IP7 H;  1HR0 W;  3GDE A;  2GN5 A;  2R7D A;  4YHH Q;  4A3M G;  4C3I H;  1YNX A;  2RF4 A;  3VDY A;  4LFC Q;  5GAH C;  1K8G A;  4DV7 L;  3MXN B;  2EIF A;  2MFI A;  3J7A 5;  5LMU Q;  3KYH C;  1JJC B;  4OXP A;  1EOV A;  5IWA Q;  3J7Z C;  3F2D A;  1EIY B;  3CC2 A;  1QVF A;  2ZTE A;  2HHH L;  2HIX A;  2UXD L;  1VQ4 A;  4LF7 L;  2BA0 A;  1N36 L;  5IYB G;  1G29 1;  1XPO A;  2VS1 A;  4A93 H;  3S1N H;  4B3R L;  4TQU S;  1I5F A;  4YWK A;  1YEZ A;  3CCM A;  1QZG A;  4DV3 Q;  2BA1 A;  4GNX B;  2A8V A;  1W2B A;  5C0X I;  3PO3 G;  4JI0 L;  2JQO A;  1AE3 A;  2B63 G;  4HJA A;  4NXN Q;  4LFA Q;  2HHH Q;  2D62 A;  4DR4 L;  4AYB E;  4GKK Q;  1WYD A;  1WFQ A;  4L5T A;  3CP0 A;  4R1J A;  2EQS A;  1IBL Q;  4A3K H;  1HNZ L;  1CKN B;  4X62 L;  1JJ2 A;  3FKI H;  2E2J H;  1YJ9 A;  4A3E G;  2NVY H;  2QEX A;  3WWV A;  5AJ3 Q;  4DUZ L;  3TRZ A;  4DNI A;  4A3L G;  4LF6 L;  5ELO A;  1FJG Q;  1VQ9 A;  4JBK A;  4JI4 Q;  1VQ6 A;  1KXL A;  3HKZ G;  1E1O A;  2JJQ A;  1HJP A;  3AYH B;  4C3H H;  1SMX A;  1NTG A;  3PCO B;  2KHJ A;  2UXB Q;  4ME3 A;  2UUC Q;  4JI5 Q;  4YCW A;  1RL2 A;  3KJP A;  4QIW E;  4DK6 C;  2Y0S G;  4OX9 Q;  4LW1 A;  2HT1 A;  5IT9 c;  3H3V I;  3BU2 A;  4DV7 Q;  1FGU A;  4LFB Q;  1OXS C;  4JI2 L;  5C0X J;  4L5S A;  3CF5 A;  4X66 Q;  5GRO A;  3LGJ A;  1N33 Q;  4YCU A;  1D8L A;  1D7Q A;  3ERS X;  2XTI A;  4A4I A;  1I6H H;  2V1C C;  4R4C A;  4B3M L;  3L0O A;  2IHE A;  5JJI A;  2NVX H;  3S2H H;  4R4I A;  3UDF A;  2VQF Q;  4X6A H;  4P73 A;  3ULL A;  3K0X A;  1YJW A;  4KHP L;  3M4Q A;  4A3J H;  1Z47 A;  4H02 A;  2CKZ B;  4JI0 Q;  1IBK L;  1K8A C;  3PUX A;  4JI2 Q;  2Y0S E;  3F8T A;  2ZJP A;  2JA6 G;  2R93 H;  4K0K L;  3HOV H;  1PH1 A;  3S14 H;  3KF8 B;  2NVT H;  4AQY Q;  3AFQ A;  3CCL A;  3L2P A;  3T1H Q;  5M3M H;  1JB7 A;  3I2Z A;  4LUO A;  4IJH A;  4IOC A;  4BBS G;  1IBM L;  1VQE A;  1P16 A;  4A3G G;  1K0R A;  2KHI A;  4GLA C;  4QL5 A;  1G51 A;  2IY5 B;  3HOW G;  1TWH H;  1IXR A;  2ALY B;  2N3S A;  5HGQ A;  1N34 L;  3UE0 A;  4KHP Q;  3TRE A;  3CD6 A;  1W3S A;  5C44 H;  4BBR G;  2VL6 A;  3D0F A;  1O7I A;  3K8A A;  3S15 H;  4NB3 A;  4LFC L;  1VQM A;  3KDF A;  3HOU G;  1Q1B A;  2K52 A;  1YZ6 A;  4JCV E;  4C2M H;  5M5X H;  1LTL A;  4JI8 Q;  4DV1 L;  4DV2 Q;  4AQY L;  3G6E A;  4IFD J;  2B29 A;  2WB1 E;  3HOX H;  4LWC A;  2ZM6 Q;  1UE7 A;  3JAM c;  4NXM L;  1EQQ A;  1MIU A;  1N36 Q;  1VQC A;  2NN6 G;  2Z6K A;  4QGU A;  3H15 A;  3GTG H;  1KQS A;  3U4V A;  3HOX G;  1UE1 A;  2HQL A;  1PH8 A;  4DV5 Q;  2UUA Q;  1G6P A;  4IPH A;  3I7F A;  1WOC A;  3ULJ A;  1GO3 E;  3HOU H;  4DR2 Q;  4IFD G;  3PUZ A;  5LMN W;  5IP9 H;  1PH2 A;  3GTP H;  1YIJ A;  2R7Z H;  3U50 C;  4AIM A;  3STB C;  5C44 G;  2UU9 L;  4EQ5 A;  2CQO A;  3HFZ B;  4IOA A;  4O2D A;  4A3G H;  4HJ7 A;  1X56 A;  2WAQ E;  3UDX A;  2YTX A;  5GAE C;  4BBS H;  1HNZ Q;  4QJF A;  1WCM G;  2PI2 A;  3FHW A;  1QUQ A;  2AMC B;  4J15 A;  2UXD Q;  2VUM H;  4DUZ Q;  1L0W A;  1HNW Q;  3ICE A;  2FXQ A;  2JA6 H;  4DR3 L;  2R93 G;  1A0I A;  2OTL A;  2YTY A;  3PO2 G;  1PV4 A;  3RLF A;  5C4X G;  4A3J G;  3GTJ H;  3E9H A;  2VNU D;  4FDB A;  5GAG C;  1KC8 C;  3CAM A;  3KF6 A;  3CQZ H;  3KJO A;  1AE2 A;  5C4X H;  4DV4 Q;  3PO2 H;  2MO1 A;  2XGT A;  2C35 B;  1IL2 A;  3PGZ A;  5LMN Q;  2VQE L;  3PUW A;  3STB D;  2Q2H A;  1Q8K A;  4DR4 Q;  4Y52 H;  2UUB L;  2GVA A;  2VUM G;  3F2B A;  2JEA I;  1WCM H;  1N33 L;  1QVC A;  3BZC A;  3K81 C;  4IPC A;  4LF8 L;  2A19 A;  1NBW A;  1Q12 A;  4DV6 L;  4OO1 G;  1Y14 B;  2K5V A;  3RLO A;  1C0A A;  2CFM A;  4JOI C;  5K36 G;  1JT8 A;  4APV A;  4DUY Q;  4JI6 L;  1B70 B;  2Z0S A;  1OXU A;  1UEB A;  4DPG A;  3M7N A;  4GN3 B;  1J5E Q;  1VQJ A;  3BJU A;  2ES2 A;  2R7Z G;  4B3T L;  3K7U C;  5IP9 G;  1VQP A;  3TS2 A;  4IO9 A;  4DR2 L;  1PYS B;  1YVC A;  2YTV A;  3S2D H;  3UDG A;  1PH7 A;  5E7N A;  4OWW B;  5JJL A;  1X65 A;  2CWP A;  2WAQ G;  1GVP A;  3AFP A;  4UP7 A;  2N78 A;  2AHO B;  3M4P A;  1XPR A;  2E5L Q;  1JMC A;  4JI7 L;  1NE3 A;  1TWA H;  2ZTD A;  1KAW A;  3CC7 A;  4A3K G;  3NEN A;  4GNX C;  3S1R H;  1PA6 A;  4JBW A;  4PZ7 A;  1E1T A;  1BBW A;  1UE5 A;  1YHB A;  3E0E A;  4MTN A;  4JC0 A;  4LF4 L;  3S1M H;  4JYA L;  4B3M Q;  2UXC L;  4UPA A;  1NMF A;  2B63 H;  4L5Q A;  2AWO A;  4BBR H;  3F2C A;  1HR0 L;  3PO3 H;  4O0A A;  1PH6 A;  2E5L L;  1EQR A;  1TWG H;  2IX0 A;  2K4K A;  1R9T H;  5J3B A;  1OTC A;  3GTM H;  3HOW H;  3HKS A;  4DKA C;  1BVS A;  2IT1 A;  5GAD C;  3TQY A;  2MQH A;  3OW2 A;  3KOJ A;  4A93 G;  3PIP A;  1NJI C;  4NXM Q;  4UY8 C;  1I3Q H;  3EBE A;  1MJE A;  5M3M G;  4OX9 L;  1KIX A;  2NZO A;  3PF4 A;  3M4O H;  2YU9 H;  4LF6 Q;  3HOV G;  2I5H A;  4GN4 B;  4GOP A;  3EIV A;  2ATW A;  1P8L A;  1Q46 A;  2CWA A;  1XMQ L;  2AKW B;  3DLL A;  2WFW A;  4LUZ A;  4JI3 L;  4B3S Q;  1EIF A;  1L1O C;  4EX5 A;  4YY3 L;  3A74 A;  1C7Y A;  2JE6 I;  1YHA A;  1KL9 A;  1JE5 A;  2PNH A;  3UDI A;  5IP7 G;  3CCU A;  1QUQ B;  4HJ9 A;  1EYG A;  4A3C H;  3CME A;  3U58 A;  1K3R A;  2OTJ A;  1NMG A;  3M3Y H;  1TWF H;  4LFB L;  2BH2 A;  1Q86 C;  4MNO A;  4IJL A;  4YHH L;  5FLM G;  3AQQ A;  2Q2U A;  4IFD I;  4IPD A;  3KDF B;  4HJ5 A;  5AJ3 L;  2I5L X;  4PZ8 A;  4POG A;  4A3F H;  2Q2I A;  3I4O A;  4LF9 Q;  3FP9 A;  1IYJ B;  3KLW A;  4DR3 Q;  1YJN A;  3T1H L;  2E2H H;  4LF7 Q;  1XNR Q;  4GS3 A;  1NY4 A;  3A0J A;  3PUY A;  2CCZ A;  3HOY G;  4RMF A;  4YCV A;  4JI1 L;  2GVB A;  3G48 A;  2JA7 G;  2HIV A;  5H1S E;  2JA9 A;  4P72 A;  1ASZ A;  3PSI A;  4DR6 Q;  4DR5 L;  3RLN A;  3ULP A;  5M5Y H;  4MZ9 A;  4BY1 G;  4A3L H;  3I55 A;  2QA4 A;  2UUB Q;  2JK8 A;  4A3E H;  4LFA L;  2JA8 G;  2LXJ A;  3FKI G;  3H3V H;  5JJK A;  4LF9 L;  1WJJ A;  1GD7 A;  4LUV A;  2Q2T A;  4GKJ Q;  1SFO H;  1V9P A;  4XIG S;  1JJG A;  4JBJ A;  4X65 Q;  2ZTC A;  1MJC A;  2OWO A;  1VCI A;  2B3G A;  1SE8 A;  5C4J H;  3F1Z A;  1OXV A;  2ZM6 L;  3PF5 A;  1XNQ L;  4JV5 Q;  2NN6 I;  5IYC G;  5IYD G;  1XMO Q;  3W1G A;  3J81 j;  4A3D G;  1K9M C;  1OXX K;  4NXN L;  1ASY A;  1X3F A;  2OQ0 A;  1E24 A;  2QGQ A;  4GLV B;  2VZA A;  3CCE A;  2RCN A;  4JI8 L;  4DV5 L;  1X3E A;  3BZK A;  3EN2 A;  3GTK H;  2WB1 G;  1YIT A;  3A5Z B;  3MEF A;  4KI0 A;  4AYB G;  4GOP C;  4JI7 Q;  4JI5 L;  2UUC L;  5IYB H;  3RZO H;  1PFS A;  4DV0 L;  4RG1 A;  3J80 c;  3OTO Q;  3CCV A;  3L7Z C;  2UUA L;  2ASB A;  1N9W A;  3S17 H;  1UWV A;  3I4M H;  4DK3 C;  4GOP B;  1K73 C;  1MKH A;  2RHS B;  3ER0 A;  4A3M H;  1I94 L;  2IX1 A;  1PH3 A;  1PHJ A;  3SGI A;  4DV3 L;  4POF A;  3IRB A;  4X64 L;  4DR7 L;  4BXX H;  1N32 L;  3GTQ H;  1E22 A;  4HIM A;  2R92 H;  4A3B G;  2KCM A;  3S1Q H;  3K80 C;  4DV1 Q;  4DAM A;  1Y1V G;  1E3P A;  3D31 A;  5IY0 A;  3J81 i;  3CC4 A;  3OTO L;  3OYY A;  2VW9 A;  5M3F H;  4DR1 L;  2F4V Q;  3ZJY C;  1VQ5 A;  4GKK L;  1SRO A;  2F3I A;  1X54 A;  2LXK A;  4K0K Q;  3I4N G;  4X62 Q;  3Q8D A;  4OON A;  4A3I G;  2I5M X;  5GQO A;  1Y1W H;  1VS0 A;  3S24 A;  4JI3 Q;  3A5U A;  1PH4 A;  2D0P A;  5HY6 A;  1LYL A;  4P74 A;  2OQK A;  4YWL A;  3RNU A;  3GD7 A;  4DUY L;  4WJ3 M;  1VQA A;  4A75 A;  1XJV A;  1VQF A;  3CW2 C;  3CMA A;  1EWI A;  1H95 A;  5C0X G;  1B8A A;  3G71 A;  4LF5 L;  4ALP A;  2ID0 A;  2RHQ B;  3CCQ A;  3J80 i;  3G4S A;  1Q82 C;  1VQI A;  3K7A H;  4DV2 L;  4OO1 I;  1QVG A;  1VQB A;  2YV5 A;  2ZJR A;  3PIO A;  1SR3 A;  2L15 A;  3E9I A;  3H0G H;  2NVQ H;  2Z6K C;  3I56 A;  2N8N A;  4B3S L;  1CKM A;  1QZH A;  2JA5 H;  4YY3 Q;  1RIP A;  1TWC H;  2MNA A;  1IBL L;  1FL0 A;  3NEL A;  1EUJ A;  1S72 A;  4LF4 Q;  2UXC Q;  2A1A A;  1U5K A;  1S40 A;  3HOZ H;  5FJ8 H;  1T9H A;  5LMU L;  1CKO A;  3KF6 B;  3CCR A;  1PH9 A;  4JG2 A;  5FLX c;  4DR1 Q;  3W1B A;  1IZ6 A;  2OCE A;  2WP8 J;  5BR8 L;  4JI4 L;  2F4V L;  4GKJ L;  1HNX L;  1SN8 A;  4X66 L;  1A62 A;  4JI6 Q;  4R4Q A;  1YBY A;  1IBM Q;  1J6Q A;  1J5E L;  4QY7 A;  2K14 A;  1A8V A;  1HZC A;  2JEB I;  2KBN A;  2PMZ E;  1HNW L;  2R6G A;  1SRU A;  2F52 A;  4GN5 A;  2KEN A;  4BY7 H;  1X6O A;  4YWM A;  1U0L A;  3RN2 A;  3U4Z A;  4P75 A;  4HJ8 A;  4R4T A;  5C3E G;  3CCJ A;  1PVO A;  3CCS A;  4DV0 Q;  3T1Y L;  1Y1W G;  4P71 A;  4BA1 I;  5JEA G;  1HNX Q;  3NEM A;  3GTO H;  4A3I H;  1Q7Y C;  4UP9 A;  1GKH A;  2VQF L;  1B7Y B;  4AH6 A;  2PI2 E;  4WJ4 A;  1VQL A;  2NZH A;  5C3E H;  4DAY B;  1GM5 A;  3AEV A;  4JYA Q;  4LF8 Q;  4A76 A;  4B3R Q;  2BH8 A;  1Y1V H;  1BKB A;  3CPF A;  4BY7 G;  4JOI A;  4X64 Q;  4DR7 Q;  1N32 Q;  1N34 Q;  2D0O A;  1WI5 A;  4OWT B;  1E7Z A;  1L2F A;  1VQD A;  2R7F A;  3KFU A;  2UXB L;  4GLX A;  1VQO A;  3TEH B;  1LUZ A;  5M5W H;  4UP8 A;  3T1Y Q;  3GO5 A;  1M90 C;  3GTL H;  2LSS A;  3RR5 A;  3S16 H;  1HH2 P;  1Z9F A;  3PV0 A;  4QQB X;  3I4M G;  4PZ6 A;  1K83 H;  1M1K C;  1VQ8 A;  1FVI A;  4DR5 Q;  3M9B A;  1VQ7 A;  4BA2 I;  3PUV A;  5BR8 Q;  3RN5 A;  1DGS A;  1VQN A;  3CXC A;  1HZB A;  1XMQ Q;  4B3T Q;  2DUD A;  1L1O B;  1UE6 A;  5FJ8 G;  3HOZ G;  4HIK A;  2I0Q A;  3JAM i;  1YHQ A;  1FJG L;  4GNX A;  1HZA A;  1BBU A;  1PH5 A;  4X65 L;  4Y7N H;  4R4O A;  2YYZ A;  1VQH A;  4DR6 L;  1KRS A;  1V43 A;  2DGY A;  1TXY A;  4KLK A;  2JA5 G;  1Q1E A;  5DLQ E;  1EFW A;  2ZJQ A;  2E8G A;  4DV4 L;  4A3D H;  1CUK A;  2K5H A;  2UU9 Q;  3H0G G;  5IYC H;  5ELN A;  5IYD H;  1X55 A;  2KCT A;  1CSQ A;  5IE8 A;  2VQE Q;  1SLJ A;  1HZ9 A;  1LM0 A;  4KHZ A;  1CSP A;  3NBH B;  3RZD H;  4C3J H;  1Q81 C;  2EXD A;  2H5X A;  5JEA J;  3TS0 A;  2IHF A;  2MO0 A;  2E2I H;  4JBM A;  1PYB A;  1XMO L;  2JA8 H;  4LNQ A;  1XNR L;  1HR0 Q;  4XTC S;  3B6Y A;  1S3O A;  1XTD A;  4TVA B;  4BY1 H;  4HID A;  1KD1 C;  4IPG A; 
#chains in the Genus database with same CATH topology
 1BCP F;  2EY5 A;  4L5R C;  2EE1 A;  1LTS D;  1CKN A;  1C9O A;  2K5N A;  3HOY H;  2PQA B;  3T13 A;  1AH9 A;  5J39 A;  4KN4 C;  3Q24 A;  2Z1C A;  1YI2 A;  4B9X A;  3DWP A;  1PRT C;  3I4N H;  3HG9 A;  3M85 A;  2X69 A;  5IGE A;  5TSS A;  4JV5 L;  1L1O A;  3AMU A;  3EFX D;  1A63 A;  5FLM H;  3HS0 C;  4DV6 Q;  3OW7 A;  2F0K A;  4N9P A;  2HDM A;  2CH4 W;  2N49 A;  1XPU A;  2R7D A;  5GAH C;  4DV7 L;  2MFI A;  4IUV A;  3J7A 5;  5C4X B;  1JJC B;  1WTO A;  4BY7 B;  5KRU A;  4OGQ C;  2BA0 A;  5C3W A;  1X32 A;  2NWG A;  5IYB G;  4A93 H;  2B8G A;  4B3R L;  2Q8I B;  1GUW A;  1I5F A;  3OMC A;  4DV3 Q;  2BA1 A;  4GNX B;  2JQO A;  5C5M A;  1GHJ A;  2KJX A;  4NXN Q;  3QOJ A;  1GOZ A;  1HQM C;  1TT2 A;  3KLS A;  4GKK Q;  4L5T A;  4E6I A;  1F9Q A;  1TY2 A;  2F0D A;  3FKI H;  5CV6 A;  3EA6 A;  3WWV A;  4JBK A;  4JI4 Q;  3ND8 A;  2L12 A;  1VQ6 A;  4J1M A;  1L0Y B;  1HJP A;  1TWF B;  3AYH B;  3VR3 A;  1NTG A;  4C3H H;  3PCO B;  3HRZ C;  4ME3 A;  2L0C A;  5JPM C;  2Y0S G;  2JYO A;  2HT1 A;  3BU2 A;  2L4N A;  4LFB Q;  1PTO F;  5C0X J;  1XXG A;  1TS5 A;  5FO7 B;  1D8L A;  4DAV A;  3IFD A;  5A2Q L;  4A4I A;  5CV7 A;  4C3J B;  5BN3 A;  1U4M A;  2LMC B;  4IZ8 A;  4KK7 A;  3ULL A;  3K0X A;  4KHP L;  4A3J H;  3P7J A;  3FMC A;  4H02 A;  2CKZ B;  4C1N K;  2Y0S E;  2R93 H;  1A2T A;  2X6G A;  3L2P A;  3T1H Q;  1KDC A;  4IJH A;  4MTK A;  1IBM L;  3J80 L;  2PO4 A;  1K0R A;  3AU7 A;  3OMG A;  4K2L A;  4QL5 A;  4UDU C;  1Y8P B;  1IXR A;  2N3S A;  5HGQ A;  2NYZ D;  3TRE A;  5C44 H;  4BBR G;  3D0F A;  3K8A A;  4NB3 A;  3OPO A;  3FPP A;  4DV2 Q;  4AQY L;  4JI8 Q;  2EYJ A;  3HOX H;  3GTO B;  4BS9 A;  4LWC A;  3JAM c;  1EQQ A;  1VQC A;  2NN6 G;  4QGU A;  4QB4 A;  4PNY A;  1UE1 A;  4DV5 Q;  4IPH A;  1EQT A;  3ULJ A;  2F0T A;  1B3A A;  1CQF A;  1SYE A;  2R7Z H;  4NDX A;  2J0T D;  4EQ5 A;  2EY6 A;  4RKL A;  3NQT A;  2OXP A;  4O2D A;  2WAQ E;  1HNZ Q;  3NTH A;  2UXD Q;  4DUZ Q;  2F3W A;  2WII B;  4HCS A;  1G6Z A;  1KNA A;  4R9W A;  4CDC C;  3TP7 A;  2OTL A;  2NTT A;  1PV4 A;  1K28 A;  3K7A B;  1LT5 D;  1MSG A;  4IUN A;  3CAM A;  3KF6 A;  5C4X H;  4DV4 Q;  3MXN A;  3NTK A;  1KLU D;  3PUW A;  4DR4 Q;  2EYP A;  1ENF A;  2VUM G;  3GTM B;  3HOW B;  2JEA I;  2ICI A;  1V1P A;  2B2T A;  2Z4I A;  1NBW A;  3PMF A;  2B2Y C;  1Y14 B;  2K5V A;  3GV3 A;  3RLO A;  1H9J A;  4APV A;  2AQ3 B;  2Z0S A;  1OXU A;  2SDF A;  1SEB D;  1VQJ A;  1ICF B;  4GN3 B;  1RKN A;  3PIO 3;  3TS2 A;  1VQP A;  4DR2 L;  1CZG A;  3TZD A;  1D1K A;  3MXP A;  3UDG A;  1PH7 A;  2CWP A;  2WAQ G;  3A56 A;  3VYS A;  2AHO B;  1XPR A;  1JMC A;  2ZXO A;  1AFP A;  3DWQ A;  1NE3 A;  1TWA H;  4KD4 A;  4WOR A;  4XQJ A;  3CC7 A;  1Y8O B;  4PZ7 A;  1BBW A;  2DN8 A;  1HUM A;  3VYU A;  2UXC L;  4JYA L;  1YNJ C;  4H0L C;  4L5Q A;  3F2C A;  1F2Y A;  2EYO A;  3Q22 A;  3SK4 A;  1IYV A;  1EQR A;  3HKS A;  4DKA C;  3A8K E;  1B1Z A;  2MQH A;  4A3M B;  1I3Q H;  3EQL C;  1MJE A;  3PF4 A;  3M4O H;  1KIX A;  2NZO A;  4EQO A;  3HOV G;  1P8L A;  1O7Y A;  1E2W A;  5E4W C;  1DXM A;  1L1O C;  3P1H A;  1GXD C;  1F9S A;  5IP7 G;  2RCF A;  3BG3 A;  1EYG A;  4A3I B;  1RJT A;  1K3R A;  3M3Y H;  4ZK9 B;  1X3P A;  2Q2U A;  3AQQ A;  3E5S A;  5CV9 A;  2PQE A;  3H3V C;  4LF9 Q;  1IYJ B;  2NTS A;  1H9K A;  2CCZ A;  4CHT B;  3BDL A;  1EOT A;  1LTT D;  2GVB A;  2QCP X;  4G7O C;  5EKK A;  4MZ9 A;  2E74 C;  1QJO A;  5FO8 B;  3HOZ B;  1F77 A;  2DY7 A;  3I55 A;  2JA8 G;  4ULL A;  2WB1 B;  2E2D C;  1UUP A;  1GD7 A;  2PZU A;  1SFO H;  1V9P A;  2K5W A;  1MJC A;  1VCI A;  4JV5 Q;  2ZM6 L;  1K8O A;  3MFG A;  2NN6 I;  2F3V A;  5CBE E;  5EPK A;  4A3D G;  1DM0 B;  1X3F A;  1GUG A;  1E24 A;  1LV9 A;  2OQ0 A;  4DV5 L;  4JI8 L;  1U4L A;  4IN3 A;  5J1Z A;  1U4P A;  1STH A;  1X3E A;  5A2Q E;  3MEF A;  2J4X A;  3N52 A;  1WTQ A;  1JC7 A;  1O7L A;  4PMB A;  2I07 B;  1ENA A;  3L7Z C;  1AN8 A;  2HDL A;  4GOP B;  2K28 A;  3NPP A;  1K73 C;  1LT6 D;  4A3M H;  3CRK C;  4RAU C;  1I94 L;  1PH3 A;  1PHJ A;  4EGV A;  3SXH A;  5BN5 A;  1E22 A;  3S9W A;  2R92 H;  2HD3 A;  2CVR A;  2EJF C;  1CQV A;  1Y1V G;  5IY0 A;  1PTO D;  5COY A;  3VA7 A;  3OTO L;  2RDG A;  4DR1 L;  2EYH A;  1SRO A;  1EEF D;  3K57 A;  1BO0 A;  1SYC A;  4A3I G;  3Q8D A;  2F0Q A;  3RMH A;  4JI3 Q;  1W6J A;  3V2T A;  4YWL A;  4A3D B;  4OIJ A;  3D8G A;  3RNU A;  1VQA A;  1XJV A;  4FNF A;  1PTO H;  3CW2 C;  3OIQ A;  4HAE A;  1SSO A;  2ID0 A;  4XDX A;  3VR2 A;  5EPL A;  1QVG A;  2K04 A;  5M5W B;  3RZO B;  1EU3 A;  3QR8 A;  1HQR D;  3GTK B;  1B9M A;  1DJR D;  1CKM A;  2MGS A;  2VXW A;  3BVM A;  2A74 C;  1TWC H;  2MNA A;  1F9R A;  1FL0 A;  2L9H A;  3NEL A;  1S72 A;  2UXC Q;  1T9H A;  5LMU L;  3P20 A;  3CCR A;  2SNS A;  3W1B A;  1RTN A;  4JI4 L;  4FF1 A;  1YBY A;  1J5E L;  1HZC A;  2EYF A;  4XYQ A;  4A3F B;  1HNW L;  2R6G A;  1SRU A;  1FGB D;  1HFG A;  1HCZ A;  1PFB A;  3SVM A;  1U0L A;  4K5X A;  3U4Z A;  1S5D D;  2E2H B;  1JCK B;  2XNA C;  4DV0 Q;  5AFW A;  2K5D A;  1EZ8 A;  2EJG C;  1Q7Y C;  1SJE D;  4N8X 1;  3H0G B;  1A3T A;  3BS1 A;  1GKH A;  2VQF L;  2PI2 E;  1VDZ A;  1VQL A;  2NZH A;  4B3R Q;  5I9P A;  3I91 A;  1B50 A;  4ABN A;  1LAC A;  3CPF A;  4MN3 A;  2F0H A;  4K14 A;  2UXB L;  1JIC A;  3KFU A;  5I4D A;  1LUZ A;  2KCN A;  3RR5 A;  2KOL A;  1SJH D;  2F0O A;  3A7L A;  4O1N A;  1PTO C;  2RKS A;  2Z4H A;  3PUV A;  1EY8 A;  1XMQ Q;  1SYB A;  5FJ8 G;  2ZXP A;  2I0Q A;  2RQX A;  2K33 A;  1HZA A;  1PH5 A;  4RGN A;  1I4Q A;  3KF8 A;  5KNB A;  1EFW A;  2K5H A;  4TKO B;  1X55 A;  1CSQ A;  2A68 C;  1HZ9 A;  1LM0 A;  1I4H A;  1G91 A;  4KTA A;  3EVQ A;  2M00 A;  1S5F D;  2H5X A;  3U9O A;  2C9O A;  5IT9 E;  5JAV A;  2JA8 H;  2O2L D;  3S1R B;  4BY1 H;  1HFN A;  5JJZ A;  2F0E A;  1B44 D;  5EAY A;  4PMW A;  4ODG A;  3JC6 6;  1QCB D;  1OXT A;  1X9N A;  1VQG A;  4S3S A;  3HKZ B;  3W2D A;  5C3E B;  1NR4 A;  4PG3 A;  1V1Q A;  3BDC A;  5LMN L;  3H94 A;  4A3F G;  4V19 0;  5BN4 A;  1XNQ Q;  5EPJ A;  2DJG C;  2VY3 A;  3SHL A;  2P5Z X;  1SFO B;  2CHB D;  1M4V A;  2CW0 C;  4DNR B;  3UE1 A;  1X3G A;  4OWX B;  1KHI A;  2K50 A;  2K75 A;  5I6W A;  1HR0 W;  1IKM A;  1K8M A;  4A93 B;  4C3I H;  3VDY A;  4LFC Q;  3EJI A;  1K8G A;  1YNN D;  3JAM L;  5LMU Q;  3F2D A;  5IWA Q;  2PW5 A;  3A8I E;  1QVF A;  2ZTE A;  2AUJ D;  4LF7 L;  1EIH A;  1ET6 A;  2MJ8 A;  2VS1 A;  2HUG A;  5FK9 C;  2WAQ B;  2V4D A;  1V1P B;  3ITP A;  1QZG A;  1EY0 A;  4FF2 A;  1L0X B;  2QW7 A;  1W2B A;  2H1E A;  5C44 B;  4HJA A;  2D62 A;  1EY4 A;  1WFQ A;  2DY8 A;  2IWH A;  1QB5 D;  1JJ2 A;  2E2J H;  1YJ9 A;  5I9O A;  3R2T A;  3BYY B;  4A3L G;  1Q90 A;  5ELO A;  2PYK A;  2JJQ A;  4FYD A;  2XRS D;  2UUC Q;  4YCW A;  1RL2 A;  2K05 A;  2JA8 B;  1TWH B;  4RHR A;  1R9T B;  4IUP A;  2WKD A;  3VR6 A;  3VR5 A;  1FGU A;  1C8C A;  4L5S A;  5KND A;  1PFM A;  4YCU A;  1TWG B;  1PRT B;  1TKW B;  1H9M A;  2R93 B;  1I6H H;  2PPB C;  2ZT9 C;  4G4K A;  4B3M L;  2A6H C;  2IHE A;  2NVX H;  3MC0 B;  5C4Z A;  3DM1 A;  4OL7 A;  4JI0 Q;  4BBR B;  1B9N A;  3BVG A;  3E0J A;  3PUX A;  4ZUJ A;  4JI2 Q;  1EL0 A;  3S1Q B;  1SMY C;  1PH1 A;  2NZ1 D;  3CU7 A;  1P16 A;  4A3G G;  4GLA C;  4RA8 A;  4Q5V A;  3HOW G;  4DAY A;  2MHV A;  3U9S A;  2NVY B;  1W3S A;  3CD6 A;  1UAP A;  3JAM E;  1O7I A;  3S15 H;  4IFD H;  1Q1B A;  2K52 A;  1YZ6 A;  4JCV E;  3RUZ A;  1NAP A;  3G6E A;  4IFD J;  2WB1 E;  1Y1V B;  5NUC A;  2ZM6 Q;  1FNV A;  4NXM L;  4ZUI A;  1SNM A;  3GTG H;  1KQS A;  4DN4 M;  3HOX G;  4RHS A;  1KTK A;  4IFD G;  2JSO A;  4K5W A;  1EU4 A;  1YIJ A;  1PZK D;  1JWU D;  5E3F A;  3STB C;  5C44 G;  3D6W A;  3HFZ B;  1Y8N B;  2FMC A;  2MP1 A;  4A3G H;  4HJ7 A;  4BBS B;  3UDX A;  5GAE C;  2GA4 B;  2PI2 A;  2AMC B;  1S5E D;  2VUM B;  1L0W A;  3GTG B;  1HNW Q;  3I73 A;  5A35 A;  2FXQ A;  3E3X A;  2R93 G;  4K8I A;  2DJF C;  3PO2 G;  3RLF A;  4A3J G;  1SYG A;  3E9H A;  2VNU D;  1SNO A;  1GUS A;  3CQZ H;  5KNC A;  2XGT A;  2C35 B;  4C56 C;  1IL2 A;  4H7B A;  1HXY D;  1O80 A;  1WD1 A;  4Y52 H;  2FFK B;  1BQQ T;  3NXW A;  3F2B A;  3NQI A;  4IPC A;  1QVC A;  2K01 A;  2E2I B;  1EIG A;  4OO1 G;  4JI6 L;  1B70 B;  3IL8 A;  5DM6 3;  1J5E Q;  3K7U C;  5IP9 G;  3LNN A;  2LS0 1;  4DK1 A;  1PYS B;  4H44 C;  5IOC A;  2JXM B;  5JJL A;  1X65 A;  4UP7 A;  2E5L Q;  1PMR A;  3KLS X;  3T16 A;  2YU9 B;  1CA6 A;  3P75 A;  3I4M B;  4DNT B;  1JOK A;  5D3D A;  2M2L A;  1E1T A;  1UE5 A;  1YHB A;  4MTN A;  3UI2 A;  1WTR A;  4UPA A;  1EY6 A;  2Z9H A;  1NMF A;  3T51 B;  3PO3 B;  1FNW A;  1F2M A;  1M8A A;  1R9T H;  1OTC A;  2IX0 A;  1LLR D;  2K4K A;  5J3B A;  3GTM H;  1D6E C;  3HOW H;  3C3L A;  1GUT A;  1G2S A;  1NJI C;  4NXM Q;  1A6X A;  3Q0A A;  4I7Z C;  5M3M G;  4WRD A;  2YU9 H;  2I5H A;  2F0M A;  1DON A;  1E0B A;  1TQO A;  2ATW A;  2CWA A;  1HA5 A;  3K5L A;  2AKW B;  2WFW A;  4LUZ A;  4JI3 L;  1EIF A;  4YY3 L;  2E75 C;  3A74 A;  3PO2 B;  2JE6 I;  3TBI B;  1YHA A;  2PNH A;  4HJ9 A;  5JVG 3;  3U58 A;  2OTJ A;  1NMG A;  1TWF H;  2F03 A;  2BH2 A;  2PW7 A;  4IJL A;  5FLM G;  4IFD I;  1CA5 A;  1JE4 A;  2BE5 C;  3R93 A;  5ELC A;  4HJ5 A;  1JB3 A;  2ENB A;  4PZ8 A;  4POG A;  4A3F H;  2Q2I A;  1R4Q B;  4CGY B;  1XNR Q;  4CBV A;  1NY4 A;  5I2Y A;  2PZT A;  2XN9 C;  3I70 A;  3PUY A;  5KIX A;  3C46 A;  4XT1 B;  3G48 A;  4MHE A;  2HIV A;  3DEP A;  3O13 A;  3PSI A;  1MBY A;  4HN7 A;  3ULP A;  4BY1 G;  1PRT D;  2LKV A;  4ZKC B;  2QA4 A;  5M5X B;  2UUB Q;  4LFA L;  5JJK A;  2LXJ A;  4LF9 L;  1WJJ A;  4LUV A;  4GKJ Q;  2XSC A;  4XIG S;  4X65 Q;  2ZTC A;  2D9U A;  3ZYY X;  1SE8 A;  3F1Z A;  1OXV A;  3OIP A;  1CHQ D;  3I8Z A;  3J81 j;  1GJX A;  3HP3 A;  1FNU A;  1K9M C;  1WVL A;  5D14 A;  5KYL A;  1QNK A;  2A6E D;  3J81 L;  1STN A;  3EN2 A;  1YIT A;  4JI7 Q;  4AYB G;  4C2M B;  2UUC L;  4F7X A;  3I4N B;  1PFS A;  4DV0 L;  2F0I A;  2F0V A;  3J80 c;  3H6M A;  2HCI A;  3CCV A;  5CR3 A;  4U67 3;  2QDL A;  3FVQ A;  1N9W A;  4RFB A;  1WTX A;  4OEM B;  1I6H B;  2RHS B;  4C3I G;  5J22 A;  2B2U C;  1HTL D;  2BCO A;  1KDA A;  4POF A;  3IRB A;  3T53 B;  1N32 L;  1TU2 B;  4BXX H;  1KAB A;  4I7A A;  4HR7 B;  4A3B G;  1DOK A;  3K80 C;  4N9T A;  1E3P A;  3J81 i;  3CC4 A;  3OYY A;  1XYI A;  4UHV A;  5DEH A;  3ZJY C;  1MHW C;  1NUC A;  2F3I A;  4R8I A;  1LO5 D;  4JW0 A;  4K0K Q;  5GQO A;  4CDD C;  2PNR C;  1VS0 A;  4WFN 3;  3RD4 A;  3A54 A;  1A15 A;  2F0G A;  2E2J B;  4C3H B;  3AB9 A;  3GD7 A;  4WJ3 M;  1MGS A;  4A75 A;  4IUQ A;  1VQF A;  2FHT A;  2EDG A;  1B8A A;  4LF5 L;  4HMJ A;  3G4S A;  2RA4 A;  1VQI A;  1VQB A;  3FKI B;  2YV5 A;  5C4H A;  1STE A;  1IHZ A;  2QIL A;  1SR3 A;  4FF4 A;  1CK1 A;  4B3S L;  1QIL A;  1VF7 A;  1RIP A;  2NB0 A;  1VMP A;  2A1A A;  1BF4 A;  1WTV A;  3HOZ H;  5FJ8 H;  4TSS A;  1CT1 D;  4JG2 A;  4DR1 Q;  2OCE A;  4GKJ L;  1CZW A;  1V1O A;  5FLX E;  4X66 L;  1A62 A;  2KBN A;  2BDN A;  3T56 B;  3SE0 A;  3WOF A;  4B9W A;  2KA7 A;  1PVO A;  1EY7 A;  1Q8I A;  1U9R A;  2G9H D;  4KMU C;  3T1Y L;  1MI2 A;  2AQ2 B;  1BXT A;  3NEM A;  3HOX B;  4A3I H;  3K59 A;  3GTO H;  1FD7 D;  4KHV A;  3AEV A;  4LF8 Q;  2B8F A;  1Y1V H;  1BKB A;  4DR7 Q;  2TMP A;  4OWT B;  1D5X C;  1WI5 A;  1E7Z A;  1VQD A;  3SDZ A;  4GLX A;  3TEH B;  3T1Y Q;  5M5W H;  4UP8 A;  5ELB A;  3GO5 A;  3S16 H;  4FXK C;  2QF7 A;  4PZ6 A;  1M1K C;  1STA A;  1VQ8 A;  2IX3 A;  1VQ7 A;  4WJW A;  2EPB A;  3CXC A;  1RDP D;  5FO9 B;  4B3T Q;  3HOZ G;  3TP8 A;  1YHQ A;  1FJG L;  2YYZ A;  2F1M A;  3BYT B;  2DGY A;  1Q1E A;  4IAL A;  2F0W A;  2E8G A;  4A3D H;  1CUK A;  5IYC H;  1BDO A;  2KCT A;  5EJW A;  3S16 B;  2VQE Q;  1SLJ A;  1KAA A;  1VMC A;  3L3O C;  3RZD H;  2EXD A;  4F88 A;  4LK1 C;  1PYB A;  1XMO L;  2Y0S B;  3NBI A;  1SYF A;  2R61 A;  1II3 A;  3H91 A;  1XTD A;  4TVA B;  4HID A;  1SYD A;  5DAU A;  4JI1 Q;  2JA7 H;  1A3U A;  4HIO A;  3R8B A;  2Z6B A;  3KUP A;  2A73 B;  4LF5 Q;  4NPS A;  1IBK Q;  2PZW A;  2WKC A;  4NP5 A;  3HKZ E;  5IWA L;  5IGC A;  4KY6 A;  4LJZ C;  3SEB A;  1UNS A;  2WV6 D;  3ERO A;  1DZ1 A;  4A3B H;  3CQZ B;  4BXX G;  4A3C G;  5IP7 H;  4M1U B;  3GDE A;  2GN5 A;  4YHH Q;  1YNX A;  3M4Y A;  4KJO A;  4NMZ A;  4OIK A;  2D5D A;  2OF1 A;  5FOB B;  2EIF A;  3BZD B;  1LTI D;  3J7Z C;  3CC2 A;  1EIY B;  1HTP A;  1VQ4 A;  3SK8 A;  1N36 L;  1G29 1;  1XPO A;  3S1N H;  2KHS A;  4TQU S;  4YWK A;  4G57 A;  1YEZ A;  2KQ3 A;  1I4R A;  2B2W C;  1AP0 A;  1EY9 A;  3PO3 G;  1AE3 A;  2SNM A;  2VB2 X;  3MXG A;  1EEI D;  1B3Q A;  4LFA Q;  4DR4 L;  5FLX L;  3CP0 A;  1F2L A;  1I3Q B;  2EQS A;  4R1J A;  2EOT A;  4A3K H;  1CKN B;  4X62 L;  2QEX A;  5AJ3 Q;  3QJY A;  4DUZ L;  2G5D A;  4DNI A;  3S14 B;  4LF6 L;  1FJG Q;  5CGK A;  3HKZ G;  1E1O A;  3RZD B;  4BWG B;  2X6L A;  4DK0 A;  3KJP A;  2B2U A;  4OX9 Q;  2OT2 A;  4LW1 A;  3H3V I;  3OHX C;  4NKL A;  1H9R A;  4DV7 Q;  2E76 C;  1OXS C;  3NSW A;  1R4P B;  3CF5 A;  4X66 Q;  4L8J A;  5CMD A;  3ERS X;  2F4I A;  3J7Y W;  2V1C C;  4R4C A;  3L0O A;  4UAI A;  2AQ1 B;  5EKI A;  3S2H H;  4R4I A;  4J6H A;  2QDB A;  4K2K A;  3S2D B;  1K8A C;  1WD0 A;  4KJN A;  3F8T A;  2ZJP A;  2JA6 G;  1F9P A;  3HOV H;  3NHH A;  3KF8 B;  2NVT H;  4AQY Q;  3AFQ A;  3CCL A;  5M3M H;  1LTR D;  3FEW X;  3TP6 A;  4IOC A;  2EY1 A;  3SK5 A;  2IY5 B;  1TWH H;  2ALY B;  2D2C C;  2VL6 A;  1JOO A;  5T1G A;  2BDO A;  3KDF A;  5M5X H;  4DV1 L;  5IGD A;  3KLR A;  1UE7 A;  5E4X A;  1N36 Q;  1I6V C;  5E1F A;  2IJ0 A;  3U4V A;  1O7Z A;  4GZY C;  1G6P A;  1PH8 A;  2UUA Q;  1FR3 A;  5LL6 S;  4AYB B;  1GO3 E;  4A3K B;  3PUZ A;  5LMN W;  5IP9 H;  3DEO A;  1PH2 A;  3GTP H;  4AIM A;  2UU9 L;  4IUT A;  2CQO A;  3KBG A;  1HPC A;  4PV1 C;  4OO1 H;  2YTX A;  3URY A;  4QJF A;  1Y69 U;  4K6L A;  4J15 A;  4KKU A;  4YIJ A;  3S15 B;  1A0I A;  4ZRZ A;  5L37 A;  5C4X G;  2K1B A;  2L5T A;  1KC8 C;  1TS3 A;  1AE2 A;  3PO2 H;  1MD2 D;  3J7A V;  1U4R A;  4X3U A;  3GTP B;  3F2U A;  2VQE L;  3STB D;  3SK6 A;  2LY7 A;  3MAQ A;  3TSS A;  1N33 L;  3K81 C;  2A19 A;  4O42 A;  1Q12 A;  3QOL A;  1C0A A;  2CFM A;  3NE5 B;  3M7N A;  3S1M B;  1UEB A;  4DPG A;  1UEA B;  4ZCK A;  1SAP A;  3BJU A;  2R7Z G;  2NVT B;  2B2Y A;  1EWH A;  4B3T L;  4C1N I;  4X3T A;  3GQB A;  4C3H G;  1YVC A;  2YTV A;  5E7N A;  1GVP A;  4G7Z C;  2N78 A;  2R92 B;  3M4P A;  4JI7 L;  4KV6 A;  2NN6 H;  1KLG D;  5ISR A;  1TWA B;  4ID6 A;  3NEN A;  4GNX C;  3S1R H;  4BY1 B;  2IPK D;  2L11 A;  4JC0 A;  4LF4 L;  3S1M H;  1HR0 L;  1SMY D;  1PH6 A;  5KGU A;  1D1I A;  2I46 A;  4I65 A;  1BVS A;  3HEJ A;  5GAD C;  5M3F B;  4A93 G;  1LTA D;  3PIP A;  4UY8 C;  2CQA A;  3EBE A;  4OX9 L;  4CJ0 B;  4LF6 Q;  3EIV A;  2JP1 A;  1SE2 A;  1Q46 A;  5K5P A;  1XMQ L;  1EFI D;  1IL8 A;  3MZ5 A;  4B3S Q;  4EX5 A;  1TY0 A;  2A69 D;  1GUN A;  1QUQ B;  1C4Q A;  4MNO A;  4DU9 A;  4XQQ A;  3K0Y A;  2N88 A;  3KDF B;  4IPD A;  1G8Z D;  1AEX A;  5AJ3 L;  4QF4 A;  1IKL A;  4DGZ A;  1D5M C;  4DR3 Q;  2E2H H;  3T1H L;  4GS3 A;  3A0J A;  2RVL A;  1NNX A;  3HOY G;  4YCV A;  4ZLT F;  1RD9 D;  4P72 A;  3J81 E;  1QWY A;  3HOU B;  3RLN A;  2B2W A;  4A3L H;  1QG7 A;  4NW2 A;  2JK8 A;  2IW3 A;  2Q2T A;  4CJ1 B;  4JBJ A;  1AZQ A;  5IOD A;  3PF5 A;  1EYC A;  5IYD G;  1GHK A;  1PRT F;  3M4O B;  1ASY A;  1LTG D;  2QGQ A;  2XWJ B;  4KN7 C;  2VZA A;  3BDO A;  4GLV B;  2KED A;  3CCE A;  1T5X D;  1YNN C;  5C6A A;  3NWT A;  4K5V A;  4KI0 A;  4GOP C;  2A68 D;  1C48 A;  5IYB H;  3K5M A;  3RZO H;  4A3B B;  4RG1 A;  4IUR A;  2CW0 D;  4QUC A;  2UUA L;  4FVM A;  1B2T A;  2ASB A;  3S17 H;  1UWV A;  3I4M H;  3FDT A;  3SGI A;  4DV3 L;  4X64 L;  1STG A;  1I4G A;  4HIM A;  2F0F A;  3MEH A;  3N6R A;  2KCM A;  3PIP 3;  3S1Q H;  4DV1 Q;  3D31 A;  2LFN A;  4IUU A;  2VW9 A;  1ICW A;  1BNZ A;  1STY A;  1DYQ A;  4GKK L;  1CTM A;  3A7A B;  3QO2 A;  2LXK A;  3I4N G;  1S5B D;  2N55 A;  4LAA A;  1Y1W H;  1RF2 D;  3S24 A;  1BCP D;  2EXZ A;  4IQZ A;  4Y7N B;  3A5U A;  2D0P A;  1WTP A;  4P74 A;  2OQK A;  2XRQ D;  2B39 A;  4Q0F A;  3CMA A;  3W3A A;  5C0X G;  3G71 A;  3IAY A;  3OOC A;  2RHQ B;  3TP5 A;  3CCQ A;  3J80 i;  4FXG C;  4XQN A;  5C5L A;  4C3J G;  1BBX C;  2ZJR A;  3PIO A;  3TN2 A;  3G7L A;  3I56 A;  1SBB B;  1OO9 B;  1QZH A;  3I72 A;  2FMM A;  3V96 A;  3C2P A;  1IBL L;  2HQE A;  4LF4 Q;  2F0L A;  1WCM B;  3GV6 A;  1I4X A;  4P2C B;  1STB A;  1CKO A;  1BUV T;  3KF6 B;  1X3Q A;  2F4V L;  1IZ6 A;  2WP8 J;  1JOQ A;  2RDH A;  4KD3 A;  3ERQ A;  2M9V A;  1SN8 A;  4K8J A;  2PMZ B;  4R4Q A;  1IBM Q;  1J6Q A;  2TSS A;  4QY7 A;  3J7A F;  4M8A A;  1B4O A;  4GN5 A;  2F0P A;  2KEN A;  2K5Q A;  4YWM A;  1QNU A;  3RN2 A;  1K0S A;  4P75 A;  5C3E G;  3CCJ A;  3CCS A;  3D4D A;  4KY5 A;  1IYU A;  2H4O A;  1SXT A;  3WOE A;  5EQ0 A;  5JEA G;  1EYA A;  1SND A;  5EBC A;  1D5Z C;  3TME A;  5D65 A;  2B2V A;  3QWN A;  4AH6 A;  1TR5 A;  4WJ4 A;  1PLF A;  1GM5 A;  4A76 A;  2NUC A;  2BH8 A;  2WAC A;  4PMC A;  2XWB B;  4N8F A;  1WTW A;  4X64 Q;  1SDF A;  2D0O A;  3KBX A;  1L2F A;  3J80 E;  3A55 A;  1HRJ A;  3GTL H;  1M90 C;  3WDN A;  2LSS A;  4QQB X;  1HH2 P;  1Z9F A;  1HUN A;  3I4M G;  1K83 H;  2NVX B;  1S5C D;  4QUF A;  2F0N A;  1FVI A;  3NTI A;  4DR5 Q;  3K6O A;  4BA2 I;  1HA6 A;  1TS4 A;  1DGS A;  1ONL A;  2DUD A;  1UE6 A;  1DOL A;  4HIK A;  3JAM i;  3I4L A;  4GNX A;  1RCV D;  4RWS C;  4DR6 L;  2L55 A;  1TXY A;  4HED A;  2ZJQ A;  1NCV A;  5M3M B;  2UU9 Q;  2RSN A;  3H0G G;  3ONA B;  4OHJ A;  5IYD H;  5IE8 A;  1I4P A;  4KHZ A;  1CSP A;  2F0S A;  3NBH B;  4RCN A;  2A6E C;  1SNQ A;  2IHF A;  2E2I H;  3S17 B;  1BCP C;  4RH6 A;  3V05 A;  4LNQ A;  1JR0 D;  4XTC S;  1S3O A;  1JQY D;  1KD1 C;  4IPG A;  4X6A H;  4OEL B;  2O5J C;  5I6Y A;  1KRT A;  4CDF C;  1JWM D;  2AWN A;  3H09 A;  1I94 Q;  3CPW A;  2FJ2 A;  1N8R C;  3IFT A;  3CKI B;  5M5Y B;  4EQP A;  5M3F G;  1SE4 A;  2PQA A;  5G3L F;  3MFY A;  3NP8 A;  1VQK A;  1I50 H;  1NR2 A;  3DM3 A;  4DFA A;  4DXF A;  3J81 c;  2R92 G;  5CV8 A;  3W5O A;  1ENC A;  3T4A C;  2BOS A;  1LAB A;  3GTJ B;  5LHY 1;  4A3M G;  2RF4 A;  4K6D A;  2BE5 D;  4C3I B;  5EGT A;  3MXN B;  4KKS A;  3KYH C;  4OXP A;  1EOV A;  3ND9 A;  2HHH L;  2HIX A;  1B53 A;  2UXD L;  2AUK A;  4B08 A;  2A69 C;  4HSV A;  2RDF A;  4A3G B;  3R3O A;  4QIW B;  3CCM A;  1S4Z A;  5ELF A;  1HHV A;  2A8V A;  3OWF A;  2ZXR A;  4RKB A;  1EY5 A;  5C0X I;  4JI0 L;  1KDB A;  5KEE A;  5DM7 3;  2B63 G;  2K03 A;  2HCC A;  1E2V A;  1H9S B;  2HHH Q;  4AYB E;  1WYD A;  2QEJ C;  4JPB W;  1IBL Q;  2CH4 A;  1HNZ L;  4A3E G;  2NVY H;  3TRZ A;  3C1F A;  1VQ9 A;  1KXL A;  1ZYR C;  1H9S A;  1SMX A;  1JOR A;  2KHJ A;  2UXB Q;  4JI5 Q;  4RGT A;  1EQV A;  3HOY B;  4L6T B;  4QIW E;  4DK6 C;  3FPU B;  3NBH A;  4U68 A;  4F8M A;  2NVQ B;  1LT3 D;  5IT9 c;  4ME5 A;  5K36 H;  2G9D A;  4JI2 L;  3L9A X;  5GRO A;  3LGJ A;  1N33 Q;  1D7Q A;  1Y1W B;  2XTI A;  5COR A;  3I3C A;  5JJI A;  2VQF Q;  3UDF A;  3K58 A;  3KK7 A;  3GTQ B;  3HGB A;  4P73 A;  1YJW A;  3M4Q A;  1Z47 A;  1IBK L;  4K0K L;  3S14 H;  1CI3 M;  1JB7 A;  3VR4 A;  3I2Z A;  3LWU A;  4LUO A;  1YNJ D;  4BBS G;  1VQE A;  2KHI A;  3LWE A;  1G51 A;  1ESF A;  1N34 L;  5F2D A;  4KHP Q;  3UE0 A;  3Q6S A;  4LFC L;  1VQM A;  3HOU G;  4C2M H;  1LTL A;  4F87 A;  2B29 A;  2C5C A;  1CFM A;  5JVH 3;  3R2I A;  2A5H A;  1MIU A;  2Z6K A;  3VA5 A;  3H15 A;  3TZU A;  4A3E B;  2HQL A;  4HTH A;  3S1N B;  3HZX A;  3I7F A;  1WOC A;  2DNE A;  4J8Q A;  3HOU H;  5LL6 X;  4DR2 Q;  2J7Z A;  4DA2 A;  4QCL A;  1DD2 A;  2R3Z A;  5EBD A;  2RSO A;  3U50 C;  4HCE A;  3C1E A;  4IOA A;  1CHP D;  1TWC B;  1X56 A;  4BBS H;  1KNE A;  1V8Q A;  4ZQ3 A;  1WCM G;  3FHW A;  1QUQ A;  2VUM H;  2R7Z B;  2K6A A;  3ICE A;  1I50 B;  5KYI A;  2JA6 H;  4DR3 L;  2B2V C;  2VB3 X;  2YTY A;  3OSO A;  3DWA A;  3GTJ H;  4FDB A;  5GAG C;  3KJO A;  2WIN B;  2MO1 A;  4FXD A;  1DCZ A;  1RHP A;  3PGZ A;  5LMN Q;  1AZP A;  2Q2H A;  1Q8K A;  2UUB L;  2GVA A;  2NBF A;  1WCM H;  3BZC A;  1Z7T A;  4LF8 L;  3E6Z X;  1SE3 A;  4DV6 L;  1JT8 A;  5K36 G;  4JOI C;  4DUY Q;  2ES2 A;  3DMU A;  5CBA E;  1ZEQ X;  2EY2 A;  5FKA C;  5HUR A;  4IO9 A;  5IT9 L;  4CKB A;  3X3N A;  5G3L D;  3S2D H;  4QMG A;  4OWW B;  1BCP B;  2Z8L A;  1WTH A;  3AFP A;  1Z6H A;  1CM9 A;  4EQN A;  1VF5 C;  3MVV A;  1T5E A;  2ZTD A;  1KAW A;  4Z9C B;  4A3K G;  2EZV A;  1PA6 A;  2F0U A;  4JBW A;  1SNC A;  4FF3 A;  1EWC A;  5CYU A;  4H13 C;  3E0E A;  4RCO A;  1LTB D;  4XXE A;  4B3M Q;  2L1B A;  2B63 H;  2AWO A;  4BBR H;  1ZKO A;  3PO3 H;  4O0A A;  2E5L L;  1TWG H;  1QOH A;  1XWE A;  3K5N A;  2IT1 A;  1SNP A;  5JPN C;  4G7H C;  1RTO A;  3TQY A;  3OW2 A;  3KOJ A;  3D4R A;  1PZI D;  4XT3 B;  2A6H D;  1W6K A;  1ILP A;  4GN4 B;  1K83 B;  4GOP A;  3CHB D;  3MWY W;  3DLL A;  4ZAI A;  1DOM A;  2XVS A;  4EVO A;  5CC4 A;  1C7Y A;  3NK9 A;  1D2B A;  1KL9 A;  1JE5 A;  1ML0 D;  2KEE A;  3UDI A;  3CCU A;  2KUM A;  2SEB D;  4A3C H;  3CME A;  2K32 A;  4LFB L;  1Q86 C;  2JA6 B;  4YHH L;  4ZKB B;  1EZ6 A;  3MXU A;  5C4J B;  4X3K A;  1ZYR D;  3G6J B;  3DXJ C;  2I5L X;  4PQX A;  3I4O A;  3FP9 A;  3KLW A;  1YJN A;  3X3M A;  4LF7 Q;  2K7V A;  2KEC A;  1GUO A;  4RMF A;  4JI1 L;  2OEO A;  2JA7 G;  1G2T A;  5H1S E;  2JA9 A;  1ASZ A;  4DR6 Q;  4DR5 L;  5M5Y H;  4JK1 C;  3QIA A;  1ILQ A;  4A3E H;  3H3V H;  3FKI G;  4MIU A;  5T1I A;  3SR1 A;  1JJG A;  4CDE C;  2IL8 A;  1TVX A;  2OWO A;  2B3G A;  1XNQ L;  5C4J H;  1LT4 D;  3BVZ A;  5IYC G;  5C3X A;  5IGB A;  1XMO Q;  3W1G A;  3TDQ A;  1TII D;  1A3V A;  1OXX K;  4NXN L;  3NUC A;  2RCN A;  3BZK A;  3GTK H;  1MSH A;  2WB1 G;  3A5Z B;  5IIF A;  4JI5 L;  2SOB A;  4TRD A;  1PZJ D;  3K5O A;  5ELD A;  3NWS A;  2B63 B;  4DAP A;  3OTO Q;  5M9O A;  2O5I C;  3MA2 B;  2QKI C;  5JOB A;  2Q8R E;  4DK3 C;  2EJM A;  1MKH A;  3D6C A;  3ER0 A;  2MPM A;  3DUZ A;  2IX1 A;  2RBM A;  4DR7 L;  3VYT A;  1PDQ A;  1BOS A;  3GTQ H;  3D4W A;  1J8I A;  2JN4 A;  4DAM A;  2XIW A;  5M3F H;  5ELE A;  2F4V Q;  5CV5 A;  3LX0 A;  1VQ5 A;  1X54 A;  4RGM A;  2PCF B;  4X62 Q;  4OON A;  4FO2 A;  4HMI A;  5JEA H;  2I5M X;  4JVZ A;  2EYL A;  3A8J E;  3DHQ A;  1PH4 A;  1E2Z A;  5HY6 A;  1LYL A;  1XX8 A;  4DUY L;  3D3R A;  1NSN S;  3GTL B;  4L63 B;  1EWI A;  1A2U A;  1H95 A;  1FYC A;  4ALP A;  1ET9 A;  1Q82 C;  3K7A H;  2FIN B;  4DV2 L;  4OO1 I;  2Q8T A;  4CJ2 C;  2L15 A;  3E9I A;  3H0G H;  2NVQ H;  1PFN A;  2Z6K C;  4V0B A;  2N8N A;  1IW7 D;  2JA5 H;  1O78 A;  4YY3 Q;  1ROD A;  2O4X A;  4FP5 D;  1EUJ A;  1U5K A;  1S40 A;  4RGO S;  4X3S A;  4XYO A;  1PH9 A;  5FLX c;  4DF7 A;  5BR8 L;  4DXG A;  1HNX L;  4HSP A;  4JI6 Q;  2EYM A;  3MHB A;  1ESR A;  2K14 A;  1A8V A;  2JEB I;  3MTS A;  2KVM A;  2PMZ E;  2F52 A;  2JA5 B;  2F0J A;  3FRP B;  1XTC D;  4BY7 H;  1X6O A;  5IGG A;  4HJ8 A;  4R4T A;  3IKJ A;  3VYR A;  1TS2 A;  1PXU A;  1Y1W G;  3M3Y B;  4P71 A;  3QB3 A;  4BA1 I;  1HNX Q;  4UP9 A;  2JA7 B;  1B7Y B;  4CKC A;  3I90 A;  4CKE A;  4LMQ D;  5C3E H;  4DAY B;  4JYA Q;  2DNC A;  3Q23 A;  4BY7 G;  4JOI A;  1N32 Q;  1N34 Q;  5HGT A;  2KCC A;  1PYW D;  2R7F A;  3OWE B;  1VQO A;  1PTO B;  5D3I B;  4KKT A;  4A3J B;  3PV0 A;  5EKL A;  2B2T C;  1AW7 A;  5DNF A;  3M7G A;  3PQI A;  3S2H B;  3M9B A;  1IW7 C;  1F2Z A;  5BR8 Q;  4ZYS A;  3RN5 A;  1VQN A;  1JWS D;  1HZB A;  1L1O B;  3HOV B;  1BBU A;  5I2X A;  4X65 L;  4Y7N H;  4R4O A;  1VQH A;  2ICE C;  1KRS A;  4KLK A;  1V43 A;  2JA5 G;  4ILW A;  5CV4 A;  5DLQ E;  4DV4 L;  4KY7 A;  2EVB A;  5ELN A;  3CRL C;  1Q3L A;  3QG1 A;  1BR9 A;  1Q81 C;  4C3J H;  5JEA J;  3TS0 A;  4JBM A;  2MO0 A;  2MUY A;  5IGF A;  1QE6 A;  1ZXT A;  5C0X H;  1XNR L;  1HR0 Q;  3GP7 A;  1J9O A;  1EYD A;  3B6Y A;  4R8N A;  1K3B C; 
#chains in the Genus database with same CATH homology
 4JI1 Q;  2JA7 H;  1KRT A;  5EAY A;  4PMW A;  4L5R C;  2AWN A;  2K5N A;  1CKN A;  1C9O A;  3JC6 6;  4HIO A;  2PQA B;  3HOY H;  1OXT A;  1X9N A;  1I94 Q;  1VQG A;  1AH9 A;  4LF5 Q;  4NPS A;  1IBK Q;  1YI2 A;  4PG3 A;  1V1Q A;  3CPW A;  3I4N H;  5LMN L;  4A3F G;  3HKZ E;  3M85 A;  1N8R C;  5IWA L;  1XNQ Q;  4JV5 L;  1L1O A;  2VY3 A;  5M3F G;  1A63 A;  2PQA A;  5FLM H;  4DV6 Q;  1VQK A;  1I50 H;  3DM3 A;  3UE1 A;  3J81 c;  4A3B H;  2R92 G;  1X3G A;  3W5O A;  4BXX G;  4OWX B;  1KHI A;  2K50 A;  2K75 A;  2N49 A;  1XPU A;  4A3C G;  5IP7 H;  1HR0 W;  3GDE A;  2GN5 A;  2R7D A;  4YHH Q;  4A3M G;  4C3I H;  1YNX A;  2RF4 A;  3VDY A;  4LFC Q;  5GAH C;  1K8G A;  4DV7 L;  3MXN B;  2EIF A;  2MFI A;  3J7A 5;  5LMU Q;  3KYH C;  1JJC B;  4OXP A;  1EOV A;  5IWA Q;  3J7Z C;  3F2D A;  1EIY B;  3CC2 A;  1QVF A;  2ZTE A;  2HHH L;  2HIX A;  2UXD L;  1VQ4 A;  4LF7 L;  2BA0 A;  1N36 L;  5IYB G;  1G29 1;  1XPO A;  2VS1 A;  4A93 H;  3S1N H;  4B3R L;  4TQU S;  1I5F A;  4YWK A;  1YEZ A;  3CCM A;  1QZG A;  4DV3 Q;  2BA1 A;  4GNX B;  2A8V A;  1W2B A;  5C0X I;  3PO3 G;  4JI0 L;  2JQO A;  1AE3 A;  2B63 G;  4HJA A;  4NXN Q;  4LFA Q;  2HHH Q;  2D62 A;  4DR4 L;  4AYB E;  4GKK Q;  1WYD A;  1WFQ A;  4L5T A;  3CP0 A;  4R1J A;  2EQS A;  1IBL Q;  4A3K H;  1HNZ L;  1CKN B;  4X62 L;  1JJ2 A;  3FKI H;  2E2J H;  1YJ9 A;  4A3E G;  2NVY H;  2QEX A;  3WWV A;  5AJ3 Q;  4DUZ L;  3TRZ A;  4DNI A;  4A3L G;  4LF6 L;  5ELO A;  1FJG Q;  1VQ9 A;  4JBK A;  4JI4 Q;  1VQ6 A;  1KXL A;  3HKZ G;  1E1O A;  2JJQ A;  1HJP A;  3AYH B;  4C3H H;  1SMX A;  1NTG A;  3PCO B;  2KHJ A;  2UXB Q;  4ME3 A;  2UUC Q;  4JI5 Q;  4YCW A;  1RL2 A;  3KJP A;  4QIW E;  4DK6 C;  2Y0S G;  4OX9 Q;  4LW1 A;  2HT1 A;  5IT9 c;  3H3V I;  3BU2 A;  4DV7 Q;  1FGU A;  4LFB Q;  1OXS C;  4JI2 L;  5C0X J;  4L5S A;  3CF5 A;  4X66 Q;  5GRO A;  3LGJ A;  1N33 Q;  4YCU A;  1D8L A;  1D7Q A;  3ERS X;  2XTI A;  4A4I A;  1I6H H;  2V1C C;  4R4C A;  4B3M L;  3L0O A;  2IHE A;  5JJI A;  2NVX H;  3S2H H;  4R4I A;  3UDF A;  2VQF Q;  4X6A H;  4P73 A;  3ULL A;  3K0X A;  1YJW A;  4KHP L;  3M4Q A;  4A3J H;  1Z47 A;  4H02 A;  2CKZ B;  4JI0 Q;  1IBK L;  1K8A C;  3PUX A;  4JI2 Q;  2Y0S E;  3F8T A;  2ZJP A;  2JA6 G;  2R93 H;  4K0K L;  3HOV H;  1PH1 A;  3S14 H;  3KF8 B;  2NVT H;  4AQY Q;  3AFQ A;  3CCL A;  3L2P A;  3T1H Q;  5M3M H;  1JB7 A;  3I2Z A;  4LUO A;  4IJH A;  4IOC A;  4BBS G;  1IBM L;  1VQE A;  1P16 A;  4A3G G;  1K0R A;  2KHI A;  4GLA C;  4QL5 A;  1G51 A;  2IY5 B;  3HOW G;  1TWH H;  1IXR A;  2ALY B;  2N3S A;  5HGQ A;  1N34 L;  3UE0 A;  4KHP Q;  3TRE A;  3CD6 A;  1W3S A;  5C44 H;  4BBR G;  2VL6 A;  3D0F A;  1O7I A;  3K8A A;  3S15 H;  4NB3 A;  4LFC L;  1VQM A;  3KDF A;  3HOU G;  1Q1B A;  2K52 A;  1YZ6 A;  4JCV E;  4C2M H;  5M5X H;  1LTL A;  4JI8 Q;  4DV1 L;  4DV2 Q;  4AQY L;  3G6E A;  4IFD J;  2B29 A;  2WB1 E;  3HOX H;  4LWC A;  2ZM6 Q;  1UE7 A;  3JAM c;  4NXM L;  1EQQ A;  1MIU A;  1N36 Q;  1VQC A;  2NN6 G;  2Z6K A;  4QGU A;  3H15 A;  3GTG H;  1KQS A;  3U4V A;  3HOX G;  1UE1 A;  2HQL A;  1PH8 A;  4DV5 Q;  2UUA Q;  1G6P A;  4IPH A;  3I7F A;  1WOC A;  3ULJ A;  1GO3 E;  3HOU H;  4DR2 Q;  4IFD G;  3PUZ A;  5LMN W;  5IP9 H;  1PH2 A;  3GTP H;  1YIJ A;  2R7Z H;  3U50 C;  4AIM A;  3STB C;  5C44 G;  2UU9 L;  4EQ5 A;  2CQO A;  3HFZ B;  4IOA A;  4O2D A;  4A3G H;  4HJ7 A;  1X56 A;  2WAQ E;  3UDX A;  2YTX A;  5GAE C;  4BBS H;  1HNZ Q;  4QJF A;  1WCM G;  2PI2 A;  3FHW A;  1QUQ A;  2AMC B;  4J15 A;  2UXD Q;  2VUM H;  4DUZ Q;  1L0W A;  1HNW Q;  3ICE A;  2FXQ A;  2JA6 H;  4DR3 L;  2R93 G;  1A0I A;  2OTL A;  2YTY A;  3PO2 G;  1PV4 A;  3RLF A;  5C4X G;  4A3J G;  3GTJ H;  3E9H A;  2VNU D;  4FDB A;  5GAG C;  1KC8 C;  3CAM A;  3KF6 A;  3CQZ H;  3KJO A;  1AE2 A;  5C4X H;  4DV4 Q;  3PO2 H;  2MO1 A;  2XGT A;  2C35 B;  1IL2 A;  3PGZ A;  5LMN Q;  2VQE L;  3PUW A;  3STB D;  2Q2H A;  1Q8K A;  4DR4 Q;  4Y52 H;  2UUB L;  2GVA A;  2VUM G;  3F2B A;  2JEA I;  1WCM H;  1N33 L;  1QVC A;  3BZC A;  3K81 C;  4IPC A;  4LF8 L;  2A19 A;  1NBW A;  1Q12 A;  4DV6 L;  4OO1 G;  1Y14 B;  2K5V A;  3RLO A;  1C0A A;  2CFM A;  4JOI C;  5K36 G;  1JT8 A;  4APV A;  4DUY Q;  4JI6 L;  1B70 B;  2Z0S A;  1OXU A;  1UEB A;  4DPG A;  3M7N A;  4GN3 B;  1J5E Q;  1VQJ A;  3BJU A;  2ES2 A;  2R7Z G;  4B3T L;  3K7U C;  5IP9 G;  1VQP A;  3TS2 A;  4IO9 A;  4DR2 L;  1PYS B;  1YVC A;  2YTV A;  3S2D H;  3UDG A;  1PH7 A;  5E7N A;  4OWW B;  5JJL A;  1X65 A;  2CWP A;  2WAQ G;  1GVP A;  3AFP A;  4UP7 A;  2N78 A;  2AHO B;  3M4P A;  1XPR A;  2E5L Q;  1JMC A;  4JI7 L;  1NE3 A;  1TWA H;  2ZTD A;  1KAW A;  3CC7 A;  4A3K G;  3NEN A;  4GNX C;  3S1R H;  1PA6 A;  4JBW A;  4PZ7 A;  1E1T A;  1BBW A;  1UE5 A;  1YHB A;  3E0E A;  4MTN A;  4JC0 A;  4LF4 L;  3S1M H;  4JYA L;  4B3M Q;  2UXC L;  4UPA A;  1NMF A;  2B63 H;  4L5Q A;  2AWO A;  4BBR H;  3F2C A;  1HR0 L;  3PO3 H;  4O0A A;  1PH6 A;  2E5L L;  1EQR A;  1TWG H;  2IX0 A;  2K4K A;  1R9T H;  5J3B A;  1OTC A;  3GTM H;  3HOW H;  3HKS A;  4DKA C;  1BVS A;  2IT1 A;  5GAD C;  3TQY A;  2MQH A;  3OW2 A;  3KOJ A;  4A93 G;  3PIP A;  1NJI C;  4NXM Q;  4UY8 C;  1I3Q H;  3EBE A;  1MJE A;  5M3M G;  4OX9 L;  1KIX A;  2NZO A;  3PF4 A;  3M4O H;  2YU9 H;  4LF6 Q;  3HOV G;  2I5H A;  4GN4 B;  4GOP A;  3EIV A;  2ATW A;  1P8L A;  1Q46 A;  2CWA A;  1XMQ L;  2AKW B;  3DLL A;  2WFW A;  4LUZ A;  4JI3 L;  4B3S Q;  1EIF A;  1L1O C;  4EX5 A;  4YY3 L;  3A74 A;  1C7Y A;  2JE6 I;  1YHA A;  1KL9 A;  1JE5 A;  2PNH A;  3UDI A;  5IP7 G;  3CCU A;  1QUQ B;  4HJ9 A;  1EYG A;  4A3C H;  3CME A;  3U58 A;  1K3R A;  2OTJ A;  1NMG A;  3M3Y H;  1TWF H;  4LFB L;  2BH2 A;  1Q86 C;  4MNO A;  4IJL A;  4YHH L;  5FLM G;  3AQQ A;  2Q2U A;  4IFD I;  4IPD A;  3KDF B;  4HJ5 A;  5AJ3 L;  2I5L X;  4PZ8 A;  4POG A;  4A3F H;  2Q2I A;  3I4O A;  4LF9 Q;  3FP9 A;  1IYJ B;  3KLW A;  4DR3 Q;  1YJN A;  3T1H L;  2E2H H;  4LF7 Q;  1XNR Q;  4GS3 A;  1NY4 A;  3A0J A;  3PUY A;  2CCZ A;  3HOY G;  4RMF A;  4YCV A;  4JI1 L;  2GVB A;  3G48 A;  2JA7 G;  2HIV A;  5H1S E;  2JA9 A;  4P72 A;  1ASZ A;  3PSI A;  4DR6 Q;  4DR5 L;  3RLN A;  3ULP A;  5M5Y H;  4MZ9 A;  4BY1 G;  4A3L H;  3I55 A;  2QA4 A;  2UUB Q;  2JK8 A;  4A3E H;  4LFA L;  2JA8 G;  2LXJ A;  3FKI G;  3H3V H;  5JJK A;  4LF9 L;  1WJJ A;  1GD7 A;  4LUV A;  2Q2T A;  4GKJ Q;  1SFO H;  1V9P A;  4XIG S;  1JJG A;  4JBJ A;  4X65 Q;  2ZTC A;  1MJC A;  2OWO A;  1VCI A;  2B3G A;  1SE8 A;  5C4J H;  3F1Z A;  1OXV A;  2ZM6 L;  3PF5 A;  1XNQ L;  4JV5 Q;  2NN6 I;  5IYC G;  5IYD G;  1XMO Q;  3W1G A;  3J81 j;  4A3D G;  1K9M C;  1OXX K;  4NXN L;  1ASY A;  1X3F A;  2OQ0 A;  1E24 A;  2QGQ A;  4GLV B;  2VZA A;  3CCE A;  2RCN A;  4JI8 L;  4DV5 L;  1X3E A;  3BZK A;  3EN2 A;  3GTK H;  2WB1 G;  1YIT A;  3A5Z B;  3MEF A;  4KI0 A;  4AYB G;  4GOP C;  4JI7 Q;  4JI5 L;  2UUC L;  5IYB H;  3RZO H;  1PFS A;  4DV0 L;  4RG1 A;  3J80 c;  3OTO Q;  3CCV A;  3L7Z C;  2UUA L;  2ASB A;  1N9W A;  3S17 H;  1UWV A;  3I4M H;  4DK3 C;  4GOP B;  1K73 C;  1MKH A;  2RHS B;  3ER0 A;  4A3M H;  1I94 L;  2IX1 A;  1PH3 A;  1PHJ A;  3SGI A;  4DV3 L;  4POF A;  3IRB A;  4X64 L;  4DR7 L;  4BXX H;  1N32 L;  3GTQ H;  1E22 A;  4HIM A;  2R92 H;  4A3B G;  2KCM A;  3S1Q H;  3K80 C;  4DV1 Q;  4DAM A;  1Y1V G;  1E3P A;  3D31 A;  5IY0 A;  3J81 i;  3CC4 A;  3OTO L;  3OYY A;  2VW9 A;  5M3F H;  4DR1 L;  2F4V Q;  3ZJY C;  1VQ5 A;  4GKK L;  1SRO A;  2F3I A;  1X54 A;  2LXK A;  4K0K Q;  3I4N G;  4X62 Q;  3Q8D A;  4OON A;  4A3I G;  2I5M X;  5GQO A;  1Y1W H;  1VS0 A;  3S24 A;  4JI3 Q;  3A5U A;  1PH4 A;  2D0P A;  5HY6 A;  1LYL A;  4P74 A;  2OQK A;  4YWL A;  3RNU A;  3GD7 A;  4DUY L;  4WJ3 M;  1VQA A;  4A75 A;  1XJV A;  1VQF A;  3CW2 C;  3CMA A;  1EWI A;  1H95 A;  5C0X G;  1B8A A;  3G71 A;  4LF5 L;  4ALP A;  2ID0 A;  2RHQ B;  3CCQ A;  3J80 i;  3G4S A;  1Q82 C;  1VQI A;  3K7A H;  4DV2 L;  4OO1 I;  1QVG A;  1VQB A;  2YV5 A;  2ZJR A;  3PIO A;  1SR3 A;  2L15 A;  3E9I A;  3H0G H;  2NVQ H;  2Z6K C;  3I56 A;  2N8N A;  4B3S L;  1CKM A;  1QZH A;  2JA5 H;  4YY3 Q;  1RIP A;  1TWC H;  2MNA A;  1IBL L;  1FL0 A;  3NEL A;  1EUJ A;  1S72 A;  4LF4 Q;  2UXC Q;  2A1A A;  1U5K A;  1S40 A;  3HOZ H;  5FJ8 H;  1T9H A;  5LMU L;  1CKO A;  3KF6 B;  3CCR A;  1PH9 A;  4JG2 A;  5FLX c;  4DR1 Q;  3W1B A;  1IZ6 A;  2OCE A;  2WP8 J;  5BR8 L;  4JI4 L;  2F4V L;  4GKJ L;  1HNX L;  1SN8 A;  4X66 L;  1A62 A;  4JI6 Q;  4R4Q A;  1YBY A;  1IBM Q;  1J6Q A;  1J5E L;  4QY7 A;  2K14 A;  1A8V A;  1HZC A;  2JEB I;  2KBN A;  2PMZ E;  1HNW L;  2R6G A;  1SRU A;  2F52 A;  4GN5 A;  2KEN A;  4BY7 H;  1X6O A;  4YWM A;  1U0L A;  3RN2 A;  3U4Z A;  4P75 A;  4HJ8 A;  4R4T A;  5C3E G;  3CCJ A;  1PVO A;  3CCS A;  4DV0 Q;  3T1Y L;  1Y1W G;  4P71 A;  4BA1 I;  5JEA G;  1HNX Q;  3NEM A;  3GTO H;  4A3I H;  1Q7Y C;  4UP9 A;  1GKH A;  2VQF L;  1B7Y B;  4AH6 A;  2PI2 E;  4WJ4 A;  1VQL A;  2NZH A;  5C3E H;  4DAY B;  1GM5 A;  3AEV A;  4JYA Q;  4LF8 Q;  4A76 A;  4B3R Q;  2BH8 A;  1Y1V H;  1BKB A;  3CPF A;  4BY7 G;  4JOI A;  4X64 Q;  4DR7 Q;  1N32 Q;  1N34 Q;  2D0O A;  1WI5 A;  4OWT B;  1E7Z A;  1L2F A;  1VQD A;  2R7F A;  3KFU A;  2UXB L;  4GLX A;  1VQO A;  3TEH B;  1LUZ A;  5M5W H;  4UP8 A;  3T1Y Q;  3GO5 A;  1M90 C;  3GTL H;  2LSS A;  3RR5 A;  3S16 H;  1HH2 P;  1Z9F A;  3PV0 A;  4QQB X;  3I4M G;  4PZ6 A;  1K83 H;  1M1K C;  1VQ8 A;  1FVI A;  4DR5 Q;  3M9B A;  1VQ7 A;  4BA2 I;  3PUV A;  5BR8 Q;  3RN5 A;  1DGS A;  1VQN A;  3CXC A;  1HZB A;  1XMQ Q;  4B3T Q;  2DUD A;  1L1O B;  1UE6 A;  5FJ8 G;  3HOZ G;  4HIK A;  2I0Q A;  3JAM i;  1YHQ A;  1FJG L;  4GNX A;  1HZA A;  1BBU A;  1PH5 A;  4X65 L;  4Y7N H;  4R4O A;  2YYZ A;  1VQH A;  4DR6 L;  1KRS A;  1V43 A;  2DGY A;  1TXY A;  4KLK A;  2JA5 G;  1Q1E A;  5DLQ E;  1EFW A;  2ZJQ A;  2E8G A;  4DV4 L;  4A3D H;  1CUK A;  2K5H A;  2UU9 Q;  3H0G G;  5IYC H;  5ELN A;  5IYD H;  1X55 A;  2KCT A;  1CSQ A;  5IE8 A;  2VQE Q;  1SLJ A;  1HZ9 A;  1LM0 A;  4KHZ A;  1CSP A;  3NBH B;  3RZD H;  4C3J H;  1Q81 C;  2EXD A;  2H5X A;  5JEA J;  3TS0 A;  2IHF A;  2MO0 A;  2E2I H;  4JBM A;  1PYB A;  1XMO L;  2JA8 H;  4LNQ A;  1XNR L;  1HR0 Q;  4XTC S;  3B6Y A;  1S3O A;  1XTD A;  4TVA B;  4BY1 H;  4HID A;  1KD1 C;  4IPG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...