2NVXH

Rna polymerase ii elongation complex in 5 mm mg+2 with 2'-dutp
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
146
structure length
134
Chain Sequence
b'MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 16
structure length 134
sequence length 146
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2nvxH00
1E1OA 4JI8Q 1XTDA 5JEAG 2UUAQ 1SN8A 1N32L 4LF6Q 2JA6G 1PH4A 2A19A 5FLMG 2PQAB 4UP9A 3CMAA 1Q7YC 4P75A 1CKOA 1PA6A 1BBWA 2VQEQ 1HZ9A 2K5NA 3M4PA 1PH2A 4A3KH 3S2DH 2EIFA 3GDEA 2XGTA 1VQ5A 3BZCA 3I4OA 4LF5L 4HIMA 1PV4A 1M90C 4GLAC 3FKIH 4C3HH 1EFWA 4OO1G 5IP7H 3FHWA 4OO1I 4A75A 2RF4A 5IYBG 1VQGA 4L5QA 2UXDQ 4DV0Q 1YHBA 4A3BH 3UDGA 2EQSA 4L5RC 1XNQQ 4A3DH 4ALPA 4IFDG 3S1QH 1I94L 2ASBA 4QJFA 1SE8A 1YBYA 4AYBE 2N3SA 4OXPA 1E24A 1KC8C 4BBRH 4DR4L 3STBD 2YTYA 2ZTDA 2IX0A 4LUVA 4YHHQ 4JCVE 2K5VA 1A0IA 4XIGS 2OWOA 3GTGH 4GLXA 4DUYQ 2QEXA 4A3EH 3STBC 4LNQA 1ASZA 1TWAH 3W1GA 4LFBQ 1K8AC 3HOXG 1E7ZA 3CP0A 4X62Q 5GADC 2C35B 2Z6KA 1XJVA 1OXTA 4GNXB 4LF4Q 1KHIA 1HNWL 2R93H 4JBMA 5IYDG 1TWFH 3J81i 1NMGA 3OTOQ 1D7QA 4QGUA 2CWAA 4JI7L 5LMUL 1TWHH 5FLMH 1XNRQ 1HR0W 4A3IH 2GVBA 5HY6A 4JI8L 1WYDA 4PZ7A 1L1OB 1SROA 3RLFA 1NJIC 2UUAL 4B3MQ 4JI4L 4POGA 2JEBI 3EN2A 4JC0A 4JI3Q 1N33L 4A3GG 3D0FA 4HJ5A 4A3FH 3H0GG 3I56A 2IY5B 1HR0L 1JE5A 2PI2E 2VQEL 2KHIA 1C7YA 3W1BA 5IT9c 4GLVB 4H02A 4POFA 3TS0A 5K36G 3HOYH 2K75A 3JC66 3CCVA 1IBKQ 3I4MG 1LYLA 2PNHA 5JJIA 1NBWA 1X3GA 2CWPA 2QGQA 4DV5Q 3T1YL 2UXDL 5C0XJ 4OWTB 3CC4A 4NXNL 1W3SA 1YEZA 2IHEA 4DR2Q 3RZOH 2D62A 1OXVA 4MNOA 3AEVA 1YHAA 1UEBA 3U4ZA 1V9PA 3E0EA 4IPDA 1HZCA 4GS3A 3RLNA 3H15A 1SFOH 1JT8A 3PIOA 4A3LG 4DUYL 2ZJPA 1GKHA 3HOXH 2Y0SE 3TEHB 1X3FA 1FVIA 1XPUA 1S3OA 1UE6A 3LGJA 2VQFL 1HNXQ 3ICEA 1D8LA 2JJQA 4DK3C 4LF5Q 4AYBG 5IYDH 5FLXc 3GTJH 5C4JH 4BBSH 1LUZA 3K7UC 1LM0A 4IJLA 4DNIA 1U5KA 5GAGC 5M3MH 3EBEA 1EQRA 1L1OA 4A3MG 4LF4L 2NVXH 5BR8Q 4YWMA 3JAMc 1O7IA 4UY8C 3PO2G 5DLQE 2K50A 2OTJA 3OTOL 1PHJA 4A3GH 1XMOL 1I94Q 1VQNA 3M3YH 4C3JH 4A93H 3H0GH 5M3FH 2KBNA 4A76A 2Q2UA 1XNRL 1UE1A 4LUOA 1R9TH 1JJCB 4X66Q 2BH2A 1VQHA 1X55A 2VZAA 2R7FA 2BH8A 5IWAQ 2KCMA 1G6PA 1P8LA 2K52A 1Q1BA 1EWIA 1M1KC 2RHSB 3F1ZA 1C0AA 1W2BA 2QA4A 1X65A 2WAQE 1IBKL 2JA5G 1N8RC 1FJGL 2LXKA 2Q2IA 3GTLH 3PF5A 4GKKQ 1KIXA 4DV5L 1YJ9A 1KD1C 2R92G 4B3TQ 4DAYB 4HJ8A 2MO0A 2AWOA 2MO1A 5FJ8G 4EX5A 1XPOA 3AQQA 4DR2L 1KL9A 2HIXA 3BJUA 3PUVA 3M4QA 3L2PA 3GTKH 4R4CA 1HNZQ 2AWNA 2A1AA 3D31A 3J81c 1G51A 4JI4Q 4B3RQ 5J3BA 4HJ9A 1N33Q 4GOPA 3K8AA 1AE2A 2E2JH 3J7ZC 1FGUA 1JMCA 2YTXA 4LW1A 4DKAC 1HR0Q 4DK6C 4GN3B 3KF8B 1YIJA 1KXLA 4A3MH 3S2HH 2B63H 4YWKA 3JAMi 3PO2H 1L2FA 2JA7G 3PUZA 3U58A 3GTQH 3PCOB 3PUWA 3I55A 5M5XH 3CC7A 1ASYA 3OYYA 4BY7H 3EIVA 1VQEA 3CCRA 1BKBA 2Q2HA 4JOIA 5BR8L 3T1YQ 4FDBA 1QZHA 1JB7A 1IBLQ 4HIOA 1X54A 2UUCQ 3ULJA 5HGQA 4NXNQ 3A74A 4JYAQ 4A3JG 1YHQA 2Y0SG 1Y14B 2OQKA 4X65Q 1N34Q 4L5TA 5ELNA 3L0OA 3ERSX 4X66L 3TQYA 1K73C 3M9BA 3RNUA 4IOAA 2K4KA 2DGYA 2OQ0A 2R7DA 4P71A 4TQUS 3UDIA 2D0PA 4AH6A 2F4VL 1JJGA 5IWAL 1I5FA 3OW2A 1Z47A 1VQAA 1WCMG 2BA1A 2NVYH 4JI2Q 1UE5A 3AYHB 2JA5H 5AJ3Q 4BXXG 4IJHA 4IPHA 2F52A 1J6QA 1WI5A 4DV6Q 2HT1A 2VQFQ 1HH2P 5H1SE 2JA6H 1S40A 1VQMA 3HOUH 5FJ8H 3KDFA 3UE0A 1A8VA 4GKKL 1TWGH 1U0LA 4UP7A 4HIKA 4B3TL 5IP9G 2PQAA 4YWLA 4DV1L 1VQ4A 1XMOQ 4DR1Q 5IYCG 1B7YB 1EOVA 2L15A 3I7FA 2ZJQA 2K5HA 3I2ZA 4DUZL 3S14H 3KJPA 1PH5A 3T1HQ 1HNZL 4B3RL 1V43A 2WAQG 1QVGA 3UE1A 3PF4A 3CXCA 4LF7L 4UPAA 5JJLA 1VQ6A 1FL0A 2LXJA 2ZM6Q 1K8GA 1VQPA 2N49A 4GN5A 4JBJA 5IYBH 3CPWA 2E2HH 2ATWA 4X6AH 3J80c 4MTNA 5C4XG 5M5YH 2R7ZG 1FJGQ 3KOJA 4A3JH 1EIYB 1VQBA 1VQDA 3CC2A 1Y1VG 2CCZA 4B3SL 1IL2A 4JI5Q 4OWXB 1IBLL 4A4IA 4NXMQ 3F8TA 2UUCL 3MEFA 1PFSA 4JYAL 2AHOB 3A0JA 4X65L 1N34L 1YNXA 2BA0A 3CD6A 2N8NA 3GD7A 4QL5A 1WCMH 3CCQA 2WB1E 1VQ7A 4R4QA 2I5MX 3K81C 2HHHL 1K83H 4JI6L 3HOZG 4BXXH 3HKZE 1NMFA 2YYZA 1BVSA 3E9HA 4OONA 4PZ8A 1EYGA 1K0RA 2JA9A 4C3IH 4GNXA 3AFPA 4LUZA 3CCMA 4NB3A 4JI0Q 3NEMA 4JI2L 1IXRA 5C44G 5AJ3L 2ZTEA 3FP9A 4DR7Q 4DV6L 2E5LQ 1J5EQ 1GVPA 2H5XA 1X3EA 2LSSA 4K0KL 4JBWA 1KRSA 2Z6KC 3GO5A 1B8AA 5IP9H 2VUMG 2UXCQ 1TXYA 4RMFA 5C0XG 1RIPA 5IYCH 4DPGA 1Y1WG 3MXNB 1YI2A 1I6HH 4PMWA 4Y52H 2PI2A 3CQZH 2KENA 3W5OA 1K3RA 4DR1L 2NZHA 2I5LX 1PH1A 3S24A 4DR6Q 1B70B 4DR5L 4GN4B 3T1HL 3KYHC 4LF8Q 3HFZB 1CUKA 1Q82C 1KAWA 2XTIA 1VQ9A 4JV5Q 4J15A 4EQ5A 1IBMQ 2F4VQ 1TWCH 3J80i 4DV2Q 5C4XH 2K14A 3I4MH 3HOWG 1RL2A 2CKZB 1X56A 4JI1Q 2VL6A 4BY1G 3J7A5 3PO3G 1PVOA 2ZM6L 4WJ3M 1Y1VH 2E8GA 4A3KG 1OXXK 1N9WA 3K0XA 4OWWB 4KI0A 1Q1EA 4IFDJ 3FKIG 5IP7G 1AH9A 3KF6B 1HJPA 4JI5L 1K9MC 2HIVA 2HQLA 3KLWA 3AFQA 4XTCS 3UDXA 3DLLA 1VQLA 4NXML 2ZTCA 4AIMA 3I4NG 1WJJA 4DV1Q 2A8VA 4A3LH 4A3DG 3J81j 1N36Q 3G4SA 4YY3L 4DUZQ 3K80C 3S1MH 4IOCA 3PUXA 5JEAJ 4AQYQ 4BBRG 3PSIA 5C44H 1I3QH 1X9NA 1KRTA 4LF9Q 1VCIA 5JJKA 3PUYA 1HNXL 4R4OA 4X64Q 3TRZA 2VW9A 2UXBQ 4LF7Q 2N78A 4IPGA 2VUMH 1Q81C 4JI0L 3E9IA 4DR7L 4DR3Q 4DV4Q 3RR5A 3VDYA 2E5LL 1Y1WH 2RHQB 1J5EL 2ES2A 1QVCA 2JA8G 1GD7A 3G6EA 1L1OC 5C3EG 2UXCL 3GTPH 2NVQH 3CPFA 3S17H 3UDFA 4B3SQ 2WB1G 1CKMA 4O0AA 2VNUD 5GAHC 1MKHA 3M4OH 3HKZG 4DV3L 2UUBQ 4NPSA 1XPRA 1VQFA 3HOVG 1YJWA 2B29A 2EXDA 1CKNB 5GROA 4DR6L 4LFCQ 3PO3H 1PYBA 3HOWH 4A3IG 4LF8L 4R4TA 2HHHQ 4BY1H 4JI6Q 2D0OA 4JV5L 5IE8A 1IBML 2NN6G 4DV2L 4A3FG 5LMNQ 1UWVA 2NN6I 3KF6A 4JI1L 3PV0A 1EUJA 1YVCA 1YZ6A 2R92H 3H3VI 4K0KQ 1G291 3I4NH 1VQIA 4KHPL 4LFAQ 1YJNA 4YCWA 1Q12A 1JJ2A 1Q46A 4R1JA 1OXUA 3HOYG 3KFUA 4GKJQ 3M7NA 2Z0SA 2KCTA 2V1CC 1E3PA 1VQJA 4IPCA 2NVTH 2WP8J 2JK8A 4C2MH 1PH8A 1N36L 5M5WH 1VQ8A 3BZKA 3IRBA 4JG2A 5GAEC 1SR3A 4DR5Q 4GOPC 4AQYL 4LF9L 4P72A 1VQCA 3NELA 1P16A 1CSQA 2JA8H 4X64L 4WJ4A 2JA7H 3TS2A 1GO3E 2UXBL 5C3EH 1GM5A 2MFIA 4DR3L 1MJCA 5E7NA 4DV4L 3G71A 1OTCA 4OX9Q 4O2DA 3ULLA 1YITA 4QIWE 5IY0A 4BA2I 4KHZA 1SMXA 1CKNA 2YTVA 4JOIC 3CCUA 1OXSC 3HOVH 4BBSG 1IYJB 4R4IA 3A5UA 5M3MG 4DV7Q 1QVFA 2VY3A 2I0QA 2ID0A 2UUBL 3S1RH 4P74A 3GTOH 4A3CG 4QQBX 3CCLA 5GQOA 2CFMA 2UU9Q 4LF6L 1V1QA 2F3IA 4LFCL 4YY3Q 2R6GA 5LMNW 1KQSA 4A93G 5M3FG 3B6YA 3Q8DA 1UE7A 1A63A 3L7ZC 2YU9H 1SLJA 4UP8A 2ALYB 3PGZA 3H3VH 4P73A 4KLKA 3PIPA 1WFQA 4TVAB 3G48A 3NBHB 3GTMH 3CAMA 3ULPA 5LMNL 5EAYA 5ELOA 2WFWA 2IT1A 1VQKA 3ZJYC 2NZOA 3CCSA 2KHJA 1XMQQ 2JQOA 2MQHA 3K7AH 4DV0L 4RG1A 4YCUA 4LFAL 1T9HA 1L0WA 1XNQL 2Q2TA 5C0XI 1VQOA 4GKJL 1A62A 1EQQA 1IZ6A 1PYSB 4DV3Q 1Z9FA 1EIFA 4MZ9A 1Q8KA 2PMZE 4YHHL 2OCEA 1QUQB 2VS1A 3ER0A 1QZGA 1N32Q 3HKSA 2B3GA 4HIDA 4DAMA 1C9OA 2ZJRA 4HJAA 1MJEA 3TREA 3U4VA 2E2IH 1PH7A 3SGIA 3DM3A 1H95A 2I5HA 3S1NH 1HZBA 2RCNA 3CCEA 4ME3A 1E22A 3WWVA 1SRUA 4L5SA 2R7ZH 4GOPB 3BU2A 1NE3A 1I50H 1Q86C 4X62L 1BBUA 1X6OA 2YV5A 3CW2C 4JBKA 1PH3A 4OX9L 2IHFA 4HJ7A 2B63G 3A5ZB 2GN5A 4A3CH 4KHPQ 4Y7NH 1VS0A 2CQOA 4BA1I 3S16H 4DV7L 1LTLA 4BY7G 2DUDA 3HOZH 4APVA 1WOCA 4DR4Q 1NY4A 4A3BG 3RLOA 2FXQA 4B3ML 4LFBL 2GVAA 4JI3L 2UU9L 3U50C 1HZAA 3CCJA 1PH9A 1E1TA 4LWCA 4QY7A 4GNXC 3CF5A 1PH6A 4PG3A 1NTGA 3NENA 2JEAI 3F2CA 3F2DA 3RN2A 2AMCB 1DGSA 2AKWB 4A3EG 1CSPA 1MIUA 4YCVA 3S15H 1AE3A 4PZ6A 3KJOA 1S72A 2IX1A 3F2BA 3CMEA 1XMQL 4IFDI 1QUQA 3RZDH 1HNWQ 4IO9A 3HOUG 4JI7Q 3M85A 2R93G 5LMUQ 3RN5A 3KDFB 2JE6I 2OTLA 2MNAA
chains in the Genus database with same CATH superfamily
3K5MA 1MSHA 4LF6Q 2JA6G 5FLMG 3CMAA 1CKOA 1BBWA 5L37A 1O80A 1HQRD 4ZK9B 4ZQ3A 3BZCA 3T56B 3BYTB 3S1MB 4OO1G 2FJ2A 4A75A 2MPMA 1VQGA 2E2JB 1XNQQ 2ASBA 1SE8A 1YBYA 3P75A 2IX0A 4JCVE 3GTGH 4GLXA 4KD4A 3NWTA 4MHEA 3HG9A 4A3EH 1TR5A 4KKUA 3STBC 1ASZA 1B9NA 1E7ZA 3T53B 5JVG3 2EY6A 5GADC 2C35B 2EYJA 4JBMA 5IYDG 1LLRD 1TWFH 2CWAA 2HCIA 5LMUL 1TWHH 4NKLA 3C1EA 4A3IH 1HR0W 1SYDA 5HY6A 1NJIC 2UUAL 4JI4L 1BO0A 2JEBI 2RQXA 4JC0A 4JI3Q 4POGA 4A3GG 4HJ5A 3H0GG 2PW7A 1HR0L 1JE5A 1S5ED 3W1BA 1CA6A 3TS0A 3HOYH 2K75A 2PNHA 2A6HD 2B8GA 2QGQA 1X3GA 4DV5Q 5T1IA 4NDXA 1O7ZA 1W3SA 1YEZA 2CW0D 2O4XA 3RZOH 1NAPA 4MNOA 1V9PA 3E0EA 1AZPA 1EFID 3H15A 1VDZA 4HCSA 4ZLTF 4DUYL 1GKHA 3A7AB 1ILPA 3ONAB 3TEHB 1XPUA 1LABA 2Q8TA 2VQFL 3ICEA 1D8LA 2N88A 4DXGA 1U4PA 1LUZA 1U5KA 4IUVA 3JAML 4LF4L 2NVXH 2K50A 2JSOA 2BCOA 1UE1A 2F4IA 1CHPD 4Q0FA 5DEHA 1SSOA 1X55A 1A6XA 2F0KA 2JYOA 1LTRD 4GZYC 1I6HB 3DUZA 1EWIA 1EEID 4K8IA 3KUPA 3HZXA 1C8CA 1TT2A 2WAQE 1IBKL 2JA5G 1BCPB 2KECA 2Q2IA 1N8RC 4X3UA 1F9PA 2WIIB 2F0FA 1YJ9A 1KD1C 2R92G 2MO0A 1L0YB 5FJ8G 2K04A 3AQQA 3V2TA 1Y1VB 3BJUA 2H1EA 1A3TA 5CV5A 3GTKH 1CZWA 4IUNA 2AWNA 3D31A 3J81c 4JI4Q 4B3RQ 4WJWA 5KEEA 4HJ9A 5FLXE 3J7AV 3J7ZC 2YTXA 4DKAC 4QF4A 1HR0Q 1L0XB 4GN3B 1S5DD 3PO2H 1O78A 2JA7G 1SE2A 1B50A 3I55A 3EIVA 1U4MA 2B39A 3CCRA 2Q2HA 1JB7A 3IFTA 1IBLQ 1X54A 2NYZD 2QF7A 2KVMA 3FPUB 1Y14B 2OQKA 1STBA 4X65Q 4EGVA 1RTOA 3L0OA 4X66L 4G4KA 1MHWC 2BDNA 3Q6SA 2K4KA 2DGYA 2OQ0A 4P71A 3UDIA 5I9OA 2D0PA 2K5QA 2F4VL 1JJGA 4IZ8A 5IWAL 2BA1A 2NVYH 2PQEA 4IUUA 1KABA 4IFDH 2X6GA 5C4HA 2VQFQ 3PO3B 4UHVA 3HOWB 3UE0A 4GKKL 5EPJA 1U0LA 4HMIA 4HIKA 3S2DB 1CK1A 1GUWA 1STEA 4RAUC 2HD3A 3FKIB 2AUJD 4CDDC 2L0CA 1ZXTA 1SAPA 1HNZL 4RGMA 3I4NB 5JPNC 2IJ0A 1V43A 2WAQG 5EGTA 3PF4A 4F7XA 3CXCA 4ZKCB 4BBRB 2E76C 3OOCA 1JC7A 2ZM6Q 4C1NK 2N49A 5IYBH 5M5WB 1CT1D 4CBVA 5EBDA 1F2ZA 5C4XG 5M5YH 4QB4A 2R7ZG 1EYDA 1H9RA 2CCZA 2K1BA 1QCBD 3FMCA 3BDLA 5C3EB 4JYAL 2AHOB 1QILA 3A0JA 2WB1B 2BA0A 3CD6A 3OHXC 1WCMH 4IN3A 3S14H 1Y8NB 4R4QA 3K81C 4BXXH 1K83H 4JI6L 3I4LA 2KQ3A 3HKZE 1HNXQ 2YYZA 1F2YA 1K0RA 2JA9A 4GNXA 4CDEC 1HPCA 5AJ3L 2ZTEA 4DV6L 2E5LQ 2Z6KC 1G2SA 2VUMG 2UXCQ 1TXYA 4V0BA 3MVVA 3ND9A 3N52A 4PMWA 3MAQA 4UDUC 2I5LX 2SDFA 2K7VA 3KYHC 2B2VA 3RD4A 4LF8Q 1Q82C 2XTIA 1VQ9A 4J15A 1SNQA 1Y69U 3FVQA 2F4VQ 4DV2Q 2K14A 1WD1A 1GUNA 3A8IE 1PVOA 1RTNA 1A3VA 4XQNA 1OXXK 1BCPF 4CGYB 1S5FD 1B9MA 1AH9A 3KF6B 4RGOS 3KLWA 3AFQA 4XTCS 1U4LA 1V1PA 3V05A 1VQLA 4NXML 4DGZA 2A8VA 2AQ1B 2Q8RE 1HFNA 4BBSB 1SEBD 3K80C 2NUCA 3PUXA 5C44H 1I3QH 3PUYA 1EY0A 1O7YA 2IW3A 2VW9A 4A93B 5M3FB 1BR9A 4OEMB 2VB2X 5CV7A 1Q81C 3WDNA 2WACA 4DR7L 3RR5A 1Y1WH 3NBIA 4CKEA 2ES2A 1DOKA 3I73A 2F0QA 1L1OC 4ZKBB 1EYCA 4X3SA 2NVQH 3CPFA 3GTPH 2JXMB 2WKCA 3X3MA 1MKHA 3HKZG 3U9SA 2KCCA 3HOVG 5IGBA 2EXDA 4CDCC 1CKNB 5GROA 1XX8A 1IKMA 4G7HC 3X3NA 3G6JB 4A3IG 4R4TA 4BY1H 2FINB 4JI6Q 3T4AC 5IE8A 2SOBA 2F0HA 5FK9C 2F03A 4JI1L 2E2DC 5JJZA 4OL7A 1WTPA 3NTIA 3TN2A 3TP6A 1YJNA 1JJ2A 1EY8A 1SNPA 3HOYG 1Q46A 4R1JA 2B2WC 4N8FA 1M8AA 1VQJA 2NVTH 2JK8A 1LT4D 4KJOA 1PH8A 1SYBA 1VQ8A 5M5XB 3SE0A 4AQYL 4P72A 1EWHA 1CSQA 2JA8H 3OSOA 2UXBL 2MFIA 4DR3L 2QDBA 1VMPA 2B8FA 1I4GA 4O2DA 4Z9CB 1YITA 4QIWE 4ABNA 4PV1C 1OXSC 3PMFA 3NUCA 4XQQA 1JOQA 1E2WA 2IPKD 2VY3A 2XN9C 3S1RH 1TWAB 3GTOH 4QQBX 4FXDA 3DWAA 2FHTA 3SHLA 3HOUB 2F3IA 4LFCL 5FO8B 1KQSA 3Q8DA 2R93B 1UE7A 3SK6A 4UP8A 1JOOA 5JVH3 1EZ6A 1TY2A 3G48A 3NBHB 2JA6B 3ULPA 3LNNA 5KNBA 2EYFA 3GV3A 5ELOA 4KJNA 3OIQA 3GQBA 3CCSA 3ND8A 4DV0L 3K7AH 4RGNA 4RG1A 4YCUA 1ENAA 2Q2TA 1WTVA 3TP8A 1IZ6A 3SEBA 2E2HB 2L55A 2PCFB 4YHHL 1XTCD 1QUQB 3MZ5A 1N32Q 2B3GA 4RH6A 3BG3A 3OIPA 4DAMA 1MJEA 3ZYYX 2A5HA 2I5HA 3AMUA 1D2BA 3CCEA 1E22A 1JWMD 1CQFA 4MN3A 4L5SA 1NE3A 1I50H 4IUQA 1Q86C 4JBKA 3TP7A 4ZRZA 1A3UA 4A3CH 5CMDA 3W2DA 2MHVA 2TMPA 4U673 3T16A 5BN5A 3HOZH 2M2LA 1NY4A 5E4XA 2FXQA 2UU9L 5CV4A 2F0SA 1ZKOA 1PH9A 4LWCA 2D5DA 2BOSA 4A3GB 3QR8A 3H0GB 3CHBD 3RN2A 1KLUD 1GUGA 1CTMA 2F0TA 3I3CA 4YCVA 3S15H 1AE3A 3KJOA 4IFDG 1ET6A 3NQTA 1TWCB 2L11A 1H9JA 4R8NA 4KN7C 3M85A 1BBXC 2Z4IA 3SXHA 1H9SA 1E1OA 3J81L 4B9XA 1D5MC 5CORA 4LMQD 1Q7YC 4FO2A 4FXGC 2K5NA 2KEDA 2A74C 4A3KH 3SVMA 2EIFA 5ELBA 2G5DA 5IGEA 4HIMA 1D1KA 4GLAC 1RDPD 3K58A 3NK9A 5IP7H 4OO1I 5A2QE 4NW2A 5IYBG 1GJXA 2UXDQ 4DV0Q 1YHBA 1I4XA 3KLSA 3VYUA 3UDGA 4A3BH 4A3DH 4ALPA 4RHSA 2L12A 4AYBE 1E24A 1KC8C 4DR4L 5IODA 2YTYA 4YHHQ 3K59A 3I72A 2OWOA 4XIGS 3HGBA 1R4QB 4MIUA 3HS0C 4ILWA 1VMCA 4LNQA 3D3RA 1K8AC 3HOXG 4MTKA 1PDQA 4GNXB 3DM1A 2Z9HA 4QGUA 2JA5B 4ZUJA 2EY5A 4H0LC 1XNRQ 2GVBA 2R92B 5BN3A 1J8IA 1L1OB 3EN2A 3D0FA 4A3FH 3NQIA 3I56A 2PI2E 2F0MA 4C2MB 1STYA 5IT9L 2EZVA 5DM73 3J7AF 3JC66 1PRTC 2CVRA 1A2TA 1EU3A 5JJIA 5COYA 1XYIA 1NBWA 2CWPA 1F77A 2G9HD 5C0XJ 2JA7B 4LAAA 2XRQD 4K2KA 3CC4A 4H44C 1OXVA 3AEVA 1UEBA 1Q8IA 4IPDA 4GS3A 3E0JA 2ICEC 1SFOH 1JT8A 4DN4M 4EQPA 2B2UA 3AU7A 4XYOA 4DNTB 2Z6BA 3G7LA 4C56C 4TSSA 4DK3C 4AYBG 3M7GA 4FXKC 5FLXc 5C4JH 4DNIA 4A3MG 3EBEA 4L6TB 4UY8C 5BR8Q 4H13C 2OTJA 5LL6X 5FO7B 1XMOL 3URYA 4A76A 1ML0D 1GUOA 1R9TH 1JJCB 1G91A 4KN4C 5CGKA 3NSWA 2R7FA 3TBIB 2KCMA 5EPKA 2RA4A 5LHY1 1Q1BA 2WAQB 3F1ZA 2D2CC 3LWEA 3WOFA 3OWEB 1LTAD 1KIXA 4DV5L 3S1NB 3LX0A 2MO1A 5C4XB 4EX5A 5J39A 2R7ZB 2HIXA 3CU7A 3PUVA 3M4QA 1HRJA 1QG7A 2F3WA 3VA5A 3VYSA 4XQJA 1AFPA 1I4PA 4HSPA 5J3BA 1EL0A 2E2JH 4RKLA 1JMCA 3DXJC 1B3AA 4HMJA 3KF8B 1KXLA 2EYLA 3S2HH 4YWKA 4BWGB 1PTOC 1L2FA 3ERQA 3PUZA 3A56A 1R4PB 3PUWA 2X69A 3H6MA 4FDBA 2TSSA 2VUMB 5EKIA 4K5VA 1DOMA 5HGQA 5IGCA 2CQAA 4A3JG 2QILA 2DNEA 1PFNA 1HCZA 3PIO3 1XXGA 3ERSX 3M9BA 3RNUA 2K32A 4IOAA 2RSOA 5FKAC 2A69D 3AYHB 4DAYA 3D8GA 1IW7D 5H1SE 4J8QA 2QEJC 5E1FA 2J0TD 4JW0A 1EIGA 5JEAH 1KAAA 2QW7A 2EDGA 2RDHA 2IWHA 5CBEE 1XMOQ 4XYQA 4TRDA 3I7FA 1B7YB 5DM63 4DR1Q 2ZJQA 2K5HA 3I2ZA 1UEAB 4K8JA 2NTTA 4B3RL 5T1GA 2EXZA 2RSNA 2MGSA 4DNRB 1XWEA 4IUTA 1YNJD 4KKSA 3VYTA 2LXJA 4GN5A 4X6AH 1TS3A 2E74C 3C1FA 1KLGD 2R3ZA 3J80c 3GTGB 4EQNA 1U9RA 4JI5Q 1IBLL 4A4IA 3F8TA 1PFSA 3MFGA 2HQEA 4X65L 1YNXA 3HKZB 2N8NA 3GD7A 3HOZG 1B3QA 2I5MX 1STNA 4FP5D 1TWFB 3HOVB 3E9HA 4C3IH 2AQ2B 1ONLA 1SNCA 1D6EC 1TWHB 4IUPA 3NEMA 4A3IB 2P5ZX 2XVSA 2NBFA 5KGUA 3EFXD 4OGQC 4X3TA 2H5XA 3OW7A 2C5CA 1BDOA 5IP9H 4JVZA 2JP1A 1E0BA 5IYCH 2YU9B 3R93A 1EIHA 1DYQA 3GTMB 3MXNB 1I6HH 4Y52H 2PI2A 3CQZH 2KENA 2NZHA 1AEXA 1PH1A 3HOYB 3S24A 3PQIA 4WORA 5D14A 5EKLA 4GN4B 5CV6A 1CUKA 5A35A 3WOEA 5K36H 2EYOA 5HGTA 3J80i 3RZOB 3I4MH 1I4RA 1X56A 2IX3A 4WJ3M 2ZM6L 1Y1VH 2E8GA 4ZAIA 4A3KG 1N9WA 4OWWB 1Q1EA 4K5XA 5IP7G 2I46A 1K9MC 2NZ1D 2HIVA 3UDXA 3DLLA 2ZTCA 1WJJA 1PRTB 1M4VA 5D3DA 1BF4A 4A3DG 3J81j 3MFYA 3G4SA 3DHQA 5LL6S 1X9NA 2NVXB 3PSIA 1SYCA 1KRTA 2EY2A 3NHHA 1HNXL 2O2LD 3S16B 2N78A 4IPGA 3MHBA 2E5LL 5NUCA 2UXCL 4KY5A 1KNAA 5IGDA 2IL8A 5GAHC 3M4OH 4DV3L 2UUBQ 2DNCA 5JAVA 1YJWA 3DEOA 3IL8A 4HEDA 1SBBB 3PO3H 3HOWH 1TS5A 4LF8L 1JB3A 1IL8A 2NN6G 4DV2L 4A3FG 1UWVA 2RDFA 1EUJA 1EZ8A 3I4NH 1JWSD 1PZKD 3QB3A 3N6RA 3M7NA 2Z0SA 2KCTA 1E3PA 1ICWA 2SNSA 3VR6A 3J7YW 2ZXOA 3EVQA 1SJHD 5M5WH 4JG2A 5GAEC 1SR3A 2KUMA 1VQCA 3UI2A 3NELA 1RKNA 1GO3E 1WTOA 5C3EH 2A6EC 1IHZA 4QIWB 5KNCA 3G71A 1OTCA 3I91A 5IY0A 1AN8A 4KHZA 1SMXA 3CCUA 4BA2I 1UNSA 3P7JA 3NTHA 5ELFA 1IYJB 4DV7Q 1BCPD 1QVFA 1SE4A 1PTOB 2EY1A 4P74A 5GQOA 2CFMA 2X6LA 1CFMA 2RCFA 2RVLA 3P20A 2RBMA 2ALYB 2MP1A 1EQTA 3CRLC 5EAYA 1VQKA 1EQVA 2A68D 2KHJA 2BE5C 1F9SA 5D3IB 2HDMA 5C0XI 1A62A 4I65A 3RUZA 1EQQA 1PYSB 4DV3Q 2F0DA 1EIFA 1Q8KA 2PMZE 3MXPA 2H4OA 4KTAA 2VS1A 3ER0A 5M5YB 4HIDA 1TS4A 4TKOB 4FNFA 4HJAA 3U4VA 2E2IH 3GP7A 3J80E 1WD0A 1LV9A 4PMBA 2RCNA 5FLXL 4ME3A 1NNXA 3BYYB 1SMYD 1PZJD 3BU2A 3IAYA 1Z7TA 4X62L 1JWUD 2YV5A 3S14B 4HJ7A 2GN5A 5J1ZA 1SNMA 1SJED 2QKIC 4Y7NH 3HOXB 1CHQD 3TZUA 1LTLA 2DUDA 1NR4A 1PRTF 4KK7A 3RLOA 4CKCA 1HZAA 4DF7A 4GNXC 3CF5A 2O5IC 4PG3A 2JEAI 1W6KA 3F2CA 3F2DA 3SDZA 2AMCB 4A3EG 1JORA 4CJ1B 3QWNA 1HNWQ 4IFDI 3RZDH 4HSVA 4IO9A 4DK1A 4JI7Q 1ENFA 2JE6I 2OTLA 4JI8Q 5JEAG 1JE4A 1QE6A 2B2VC 1N32L 2NWGA 1PH4A 1HA6A 1QWYA 2K05A 1B44D 4P75A 5JPMC 1BOSA 1PA6A 4HR7B 2VQEQ 1HZ9A 2F0UA 3M4PA 1PH2A 1F2MA 4B08A 1VQ5A 5ISRA 1F9RA 4LF5L 1M90C 1K28A 4C3HH 2VB3X 1Q90A 3T13A 1I3QB 3BDOA 1V1OA 2RF4A 4L5QA 4AYBB 5C3XA 4L5RC 2PZUA 3D6WA 3S1QH 4A3MB 2N3SA 4OXPA 3STBD 2L4NA 4KMUC 4LUVA 3GTQB 1D5XC 1A0IA 3QOJA 3K5NA 1STGA 5ELEA 1YNNC 3K5OA 3H3VC 5C4ZA 1EWCA 1TWAH 4LFBQ 1LACA 4C3IG 2QCPX 3VR5A 4X62Q 1OXTA 1KHIA 5KRUA 2R93H 1E2VA 1NMGA 3OTOQ 3A8KE 5FOBB 1CA5A 1WTXA 1PTOF 5FLMH 1B1ZA 4PZ7A 1BQQT 1S4ZA 4K6LA 1SYEA 1S5BD 1DJRD 3VR3A 2IY5B 4OO1H 2NVTB 1ILQA 4DU9A 2EPBA 4GLVB 5K36G 3CCVA 3I4MG 1LYLA 1FGBD 2UXDL 1CI3M 2DY8A 4NXNL 4N9PA 4DR2Q 4HN7A 2D62A 3A55A 2A6HC 5I6WA 1AW7A 1NR2A 1SNDA 1TQOA 2EVBA 5I2YA 4A3JB 4N8X1 2FMCA 2F3VA 3R2TA 3KLRA 2CW0C 4M8AA 3HP3A 2Y0SE 3S1RB 3GTOB 1PFMA 1X3FA 2K01A 1S3OA 1UE6A 5K5PA 4LF5Q 5IYDH 1DZ1A 3GTJH 1ICFB 1K0SA 1LM0A 4IJLA 5M3MH 3PO2G 3JAMc 1KDCA 1Y8OB 3SK4A 1PHJA 4A3GH 3M3YH 4C3JH 1GUSA 3H0GH 2KBNA 2Q2UA 1XNRL 1HA5A 4LUOA 3K7AB 3FPPA 5IT9E 3FRPB 1VQHA 2BH8A 2PYKA 5KYIA 1P8LA 4ME5A 4XT3B 1M1KC 4DFAA 2RHSB 1W2BA 2QA4A 1X65A 1FJGL 3GTLH 2LXKA 4WRDA 3PF5A 2CH4W 4B3TQ 2AWOA 1EOTA 1GHJA 1XPOA 1DCZA 2F0WA 1ENCA 1T5XD 1I50B 3NE5B 3MA2B 3Q23A 4J1MA 4R4CA 3NXWA 2A1AA 1G51A 4GOPA 1AE2A 5ELDA 4DK6C 2Z8LA 3HOZB 1RCVD 2B63H 3JAMi 2CHBD 4ZUIA 1CQVA 3U58A 1F9QA 2EJGC 3PCOB 2ICIA 3CC7A 1ASYA 3OYYA 4BY7H 1NSNS 2K5DA 1KDBA 1VQEA 1BKBA 4JOIA 5BR8L 4YIJA 5DNFA 2UUCQ 2K5WA 3OPOA 1JR0D 5G3LF 4NXNQ 1YHQA 2Y0SG 3KK7A 1N34Q 5ELNA 3S15B 4HTHA 3QIAA 2EOTA 2HCCA 1K73C 1JCKB 3S17B 4KY6A 4TQUS 4XT1B 2LMCB 1WVLA 1Z47A 1PZID 1WCMG 4JI2Q 2JA5H 1UE5A 4BXXG 4IJHA 4IPHA 2F52A 1J6QA 5E4WC 5DAUA 2K28A 1S40A 1VQMA 5FJ8H 3KDFA 1DXMA 2L1BA 2LFNA 4OELB 3TZDA 1A8VA 5CBAE 1TWGH 1LT3D 4A3KB 4UP7A 3BS1A 1LT6D 1X3PA 2PQAA 4YWLA 4DV1L 3IFDA 3KLSX 1K3BC 3HEJA 1I4HA 4ZYSA 4DUZL 3KJPA 4B9WA 2F0VA 2XRSD 1PH5A 3T1HQ 3AB9A 4CKBA 4PQXA 4A3DB 3UE1A 2PNRC 4LF7L 4UPAA 1VQ6A 5I4DA 3A7LA 1FL0A 1VQPA 4JBJA 3CPWA 4MTNA 4FYDA 1FJGQ 3KOJA 3CC2A 4B3SL 1IL2A 4OWXB 1PLFA 1II3A 2PZTA 2PZWA 5EQ0A 1VQ7A 1RHPA 1V8QA 2HHHL 2F0NA 3EJIA 2D9UA 1V1PB 1BVSA 4OONA 1EYGA 2BE5D 4M1UB 2I07B 3AFPA 4O1NA 3CCMA 4JI0Q 1IXRA 5C44G 1J5EQ 4K0KL 2K6AA 2LS01 4EQOA 3NWSA 4A3FB 2DJGC 1RIPA 4DPGA 1Y1WG 4R9WA 1VF7A 1SNOA 1YI2A 4HCEA 2F0LA 2M9VA 1K3RA 4S3SA 4DR1L 1FD7D 2N55A 4DR6Q 4DR5L 3HFZB 1HXYD 4F8MA 3EROA 4QUFA 4JV5Q 3L3OC 1IBMQ 2B2YC 5C5MA 5C4XH 3VA7A 3J7A5 2VL6A 4BY1G 3TMEA 2SEBD 4G57A 4RHRA 4K14A 1SYGA 1SFOB 1UAPA 4KI0A 1STHA 4IFDJ 4C3HG 4Q5VA 1C48A 1HJPA 4JI5L 2HQLA 5A2QL 4AIMA 4DV1Q 4A3LH 5C4JB 5AFWA 3I70A 1N36Q 1EU4A 2B2TC 5IGFA 4DUZQ 3S1MH 2MUYA 4KHVA 1H9KA 4K6DA 4LF9Q 2B2UC 3C2PA 1VCIA 4QMGA 1SDFA 3R8BA 5JJKA 4X64Q 4LF7Q 1C4QA 2VUMH 1FR3A 3E9IA 3QOLA 3JAME 4DV4Q 3I8ZA 2JA8G 1LTBD 1HQMC 5CC4A 2F0IA 3G6EA 3FDTA 3UDFA 4B3SQ 1CKMA 1LT5D 2VNUD 2Z1CA 3SK5A 1GUTA 4NPSA 1VQFA 4EVOA 1E2ZA 5CV8A 1LTGD 2XWBB 2HHHQ 3D6CA 4RFBA 1HFGA 1BUVT 5LMNQ 2J7ZA 2NN6I 3KF6A 3PV0A 1QOHA 4LK1C 1WTRA 3SR1A 1YZ6A 4K0KQ 3H3VI 3Q0AA 1PXUA 1G291 1VQIA 4FVMA 2ZXPA 4LFAQ 3KFUA 4GKJQ 5TSSA 3DWPA 2V1CC 4IPCA 4CJ2C 4FF1A 3S2HB 1YNND 2GA4B 3BZKA 3IRBA 4DR5Q 2LY7A 4DXFA 1P16A 3TS2A 5JOBA 1MJCA 1DD2A 4OX9Q 3FEWX 1EY9A 1CKNA 3HOVH 4A3EB 1SXTA 4R4IA 3A5UA 5M3MG 1G8ZD 1MBYA 2WINB 4OIKA 2UUBL 4A3CG 2F0GA 3CCLA 1V1QA 4C3JG 3QG1A 1DONA 1A63A 4G7ZC 2YU9H 3PGZA 3GTMH 4KLKA 1WFQA 4TVAB 1AZQA 4LJZC 3S9WA 1GHKA 4L8JA 3ZJYC 2NZOA 4F88A 2A73B 2PW5A 3IKJA 1HUNA 1XMQQ 2JQOA 2MQHA 1VF5C 1T9HA 1L0WA 1RD9D 2PMZB 4NMZA 4WFN3 4FF4A 1Z9FA 4MZ9A 1QNKA 2OCEA 2O5JC 1QZGA 3HKSA 4XXEA 1C9OA 3EA6A 2ZJRA 2RDGA 1DOLA 1H9SB 1HZBA 2QDLA 3WWVA 4GOPB 3OMGA 3BZDB 3QJYA 2B63G 3A5ZB 4V190 4C3IB 3E5SA 4K5WA 3S16H 4DV7L 1EY5A 4BY7G 3NBHA 4A3BG 4B3ML 4X3KA 5CYUA 1LTTD 3CQZB 4P2CB 5FO9B 4ID6A 5C0XH 5KNDA 1DGSA 2XWJB 1JOKA 1MIUA 3MXGA 3VYRA 1S72A 4PZ6A 2IX1A 3F2BA 2KA7A 1QUQA 1OO9B 3I4MB 5LMUQ 3RN5A 3KDFB 2VXWA 2MNAA 2EYPA 2SNMA 1XTDA 2UUAQ 1SN8A 3NTKA 4OIJA 3L9AX 2A19A 2PQAB 4UP9A 1SYFA 3A8JE 3S2DH 3GDEA 2XGTA 1EY7A 3I4OA 2R61A 1PV4A 3A54A 3FKIH 1EFWA 3GTKB 3FHWA 1T5EA 2L9HA 3C3LA 1TIID 2EQSA 4RKBA 1I94L 5EKKA 4QJFA 3TP5A 2Z4HA 4BBRH 3PO2B 5J22A 2ZTDA 2LKVA 4R8IA 3MC0B 1QJOA 2K5VA 4DUYQ 2QEXA 3M4OB 5CR3A 1PTOH 3W1GA 2KCNA 3CP0A 2Z6KA 1XJVA 2NTSA 4LF4Q 1HNWL 2JN4A 1B2TA 4JK1C 1X32A 3J81i 1D7QA 2NVYB 3BVMA 4JI7L 1ZYRC 2HDLA 1RODA 3LWUA 4KY7A 4JI8L 1WYDA 1SROA 3RLFA 4B3MQ 2OXPA 1N33L 1FNUA 1A15A 5I2XA 1PRTD 4DA2A 1HUMA 1ZEQX 2XIWA 2VQEL 3K57A 2KHIA 1C7YA 5IT9c 3K6OA 4K2LA 4H02A 4POFA 4NP5A 2RKSA 2NB0A 1H9MA 1IBKQ 3MXUA 1BNZA 3MWYW 3T1YL 1IKLA 4OWTB 2FFKB 2J4XA 1K8MA 2IHEA 1YHAA 3U4ZA 5ELCA 3K5LA 1HZCA 3RLNA 4DAVA 3PIOA 4A3LG 2DJFC 2Y0SB 3Q24A 3Q22A 3E3XA 2ZJPA 3HOXH 2XSCA 4KKTA 1FVIA 3LGJA 4LFBL 1JQYD 2JJQA 5IOCA 3VR2A 1WCMB 4BBSH 3K7UC 5GAGC 1K83B 2EYHA 1EQRA 1L1OA 4YWMA 1O7IA 5DLQE 2K03A 3OTOL 1I94Q 1VQNA 4A93H 4I7AA 4U68A 5M3FH 3RMHA 1B4OA 4IALA 4X66Q 3H91A 2BH2A 2ENBA 2KJXA 2VZAA 5IWAQ 1G6PA 1ET9A 2K33A 3ITPA 2K52A 3GV6A 1C0AA 5F2DA 4GKKQ 1LO5D 2E2IB 2KHSA 4DAYB 4HJ8A 1HTLD 2B2WA 1IYUA 4DR2L 1KL9A 1TKWB 3TDQA 3H94A 3L2PA 5KIXA 1HNZQ 1PTOD 2EJFC 4Y7NB 2F0OA 1N33Q 1Z6HA 3K8AA 1FGUA 3PIP3 4LW1A 1JICA 1YIJA 4A3MH 3GTQH 5M5XH 5C44B 3D4DA 1QZHA 3T1YQ 4HIOA 3ULJA 3A74A 4JYAQ 4RCOA 1Y1WB 4L5TA 2L5TA 2WKDA 3TQYA 3RZDB 3GTPB 2NVQB 2R7DA 4AH6A 2V4DA 1QB5D 1I5FA 3M4YA 1MD2D 3OW2A 1VQAA 5AJ3Q 2HT1A 1WI5A 4DV6Q 5C6AA 1HH2P 4RA8A 1ESFA 3HOUH 2OF1A 1HHVA 4BY1B 2A69C 1EYAA 1GXDC 1Y8PB 3SK8A 4H7BA 3J81E 4B3TL 1IW7C 5IP9G 1VQ4A 2JA6H 4C3HB 5IYCG 1EOVA 2L15A 4CJ0B 3KF8A 3V96A 1X3QA 4HAEA 5M9OA 4FF2A 4N9TA 4KD3A 2WV6D 5EJWA 1RJTA 1QVGA 3S1QB 2ZXRA 5JJLA 1AP0A 3NPPA 4PMCA 1EEFD 1K8GA 2E2HH 2ATWA 4DK0A 3J80L 4I7ZC 3KBGA 1TS2A 2MJ8A 1TU2B 3I90A 4A3JH 3T51B 1B53A 1VQBA 1VQDA 4C1NI 1Y1VG 1EIYB 1YNJC 2JA8B 4NXMQ 2UUCL 3MEFA 1LTSD 1EY6A 1D5ZC 1N34L 2OT2A 5CV9A 1LTID 4QL5A 3CCQA 2WB1E 1NMFA 4RCNA 4PZ8A 4CDFC 4J6HA 2EE1A 1FYCA 1D1IA 2F0EA 4LUZA 4NB3A 4JI2L 3FP9A 4DR7Q 1GVPA 1X3EA 2LSSA 1CM9A 4JBWA 1KRSA 2EJMA 2F1MA 3GO5A 5C3WA 1WTWA 1B8AA 3TSSA 4RMFA 5C0XG 3BVGA 4DAPA 3W5OA 4OHJA 1B70B 5G3LD 3T1HL 2Q8IB 4FF3A 5IIFA 1KAWA 4BS9A 4UAIA 4EQ5A 3K0YA 1PMRA 1TWCH 4O42A 3PO3G 3HOWG 1RL2A 2CKZB 4JI1Q 3DMUA 4JPBW 2E75C 2FMMA 3K0XA 4QUCA 3FKIG 3KBXA 5KYLA 3EQLC 3I4NG 1BXTA 3H09A 2DN8A 3GTJB 5EPLA 4YY3L 5M3MB 1STAA 4IOCA 1F2LA 5JEAJ 4AQYQ 4BBRG 1FNVA 1J9OA 4KV6A 4IQZA 4R4OA 3TRZA 3P1HA 3M3YB 3W3AA 3CKIB 4C3JB 2UXBQ 2XNAC 4JI0L 3MXNA 4RGTA 4DR3Q 3VDYA 2KOLA 2RHQB 1TY0A 1J5EL 1QVCA 1GD7A 3E6ZX 1PFBA 5C3EG 3S17H 1EY4A 2WB1G 4O0AA 1G2TA 2KEEA 3CRKC 3VR4A 1IYVA 1XPRA 1A2UA 2B29A 4DR6L 1Q3LA 3GTLB 4LFCQ 1I6VC 1PYBA 3BVZA 2D0OA 4JV5L 1NCVA 1IBML 4QCLA 3U9OA 3O13A 3R3OA 2PPBC 1YVCA 2R92H 4KHPL 4ZCKA 4YCWA 1Q12A 1OXUA 2B63B 2AUKA 1GOZA 2C9OA 2WP8J 4C2MH 3F2UA 1KNEA 1N36L 2A6ED 4L63B 4BY7B 4ULLA 1KDAA 4GOPC 5IGGA 4LF9L 1W6JA 4A3BB 4X64L 4WJ4A 2JA7H 1GM5A 1ZYRD 3OMCA 5C5LA 4DV4L 5E7NA 2G9DA 2BDOA 3ULLA 3MEHA 1PYWD 1SE3A 2YTVA 4JOIC 2HUGA 4BBSG 1MI2A 5I9PA 2I0QA 2ID0A 4CHTB 4F87A 2EYMA 3D4RA 2UU9Q 4LF6L 1NUCA 4YY3Q 5LMNW 2R6GA 2NN6H 4A93G 5M3FG 5E3FA 1TWGB 3B6YA 1BCPC 1KTKA 3L7ZC 1SLJA 3H3VH 3NP8A 4P73A 2B2YA 3PIPA 1O7LA 2CH4A 3CAMA 4XDXA 5LMNL 2ZT9C 1RF2D 2WFWA 1QNUA 2IT1A 2AQ3B 2PO4A 3BDCA 1WTHA 4LFAL 1DM0B 4PNYA 1XNQL 4GKJL 1VQOA 1MGSA 4RWSC 1MSGA 2F0JA 2A68C 2B2TA 1S5CD 2DY7A 1U4RA 3C46A 5D65A 4ODGA 3TREA 1WTQA 5BN4A 1PH7A 3SGIA 3DM3A 1H95A 3S1NH 1G6ZA 2R7ZH 1SRUA 5EBCA 1BBUA 1X6OA 1K8OA 3CW2C 1PH3A 4OX9L 3D4WA 3DWQA 1HTPA 2IHFA 1UUPA 4KHPQ 1VS0A 2CQOA 4BA1I 1TVXA 1SMYC 2M00A 3MTSA 4APVA 1WOCA 4DR4Q 1I4QA 2GVAA 4IURA 4JI3L 1FNWA 2OEOA 3U50C 3CCJA 1E1TA 3R2IA 4QY7A 1PH6A 4E6IA 1NTGA 3NENA 5HURA 2AKWB 3QO2A 1R9TB 1CSPA 2F0PA 5I6YA 1CZGA 1XMQL 3CMEA 3OWFA 3HOUG 3DEPA 1ESRA 3HRZC 2R93G 4G7OC
chains in the Genus database with same CATH topology
1E1OA 4JI8Q 1XTDA 5JEAG 2UUAQ 1SN8A 1N32L 4LF6Q 2JA6G 1PH4A 2A19A 5FLMG 2PQAB 4UP9A 3CMAA 1Q7YC 4P75A 1CKOA 1PA6A 1BBWA 2VQEQ 1HZ9A 2K5NA 3M4PA 1PH2A 4A3KH 3S2DH 2EIFA 3GDEA 2XGTA 1VQ5A 3BZCA 3I4OA 4LF5L 4HIMA 1PV4A 1M90C 4GLAC 3FKIH 4C3HH 1EFWA 4OO1G 5IP7H 3FHWA 4OO1I 4A75A 2RF4A 5IYBG 1VQGA 4L5QA 2UXDQ 4DV0Q 1YHBA 4A3BH 3UDGA 2EQSA 4L5RC 1XNQQ 4A3DH 4ALPA 4IFDG 3S1QH 1I94L 2ASBA 4QJFA 1SE8A 1YBYA 4AYBE 2N3SA 4OXPA 1E24A 1KC8C 4BBRH 4DR4L 3STBD 2YTYA 2ZTDA 2IX0A 4LUVA 4YHHQ 4JCVE 2K5VA 1A0IA 4XIGS 2OWOA 3GTGH 4GLXA 4DUYQ 2QEXA 4A3EH 3STBC 4LNQA 1ASZA 1TWAH 3W1GA 4LFBQ 1K8AC 3HOXG 1E7ZA 3CP0A 4X62Q 5GADC 2C35B 2Z6KA 1XJVA 1OXTA 4GNXB 4LF4Q 1KHIA 1HNWL 2R93H 4JBMA 5IYDG 1TWFH 3J81i 1NMGA 3OTOQ 1D7QA 4QGUA 2CWAA 4JI7L 5LMUL 1TWHH 5FLMH 1XNRQ 1HR0W 4A3IH 2GVBA 5HY6A 4JI8L 1WYDA 4PZ7A 1L1OB 1SROA 3RLFA 1NJIC 2UUAL 4B3MQ 4JI4L 4POGA 2JEBI 3EN2A 4JC0A 4JI3Q 1N33L 4A3GG 3D0FA 4HJ5A 4A3FH 3H0GG 3I56A 2IY5B 1HR0L 1JE5A 2PI2E 2VQEL 2KHIA 1C7YA 3W1BA 5IT9c 4GLVB 4H02A 4POFA 3TS0A 5K36G 3HOYH 2K75A 3JC66 3CCVA 1IBKQ 3I4MG 1LYLA 2PNHA 5JJIA 1NBWA 1X3GA 2CWPA 2QGQA 4DV5Q 3T1YL 2UXDL 5C0XJ 4OWTB 3CC4A 4NXNL 1W3SA 1YEZA 2IHEA 4DR2Q 3RZOH 2D62A 1OXVA 4MNOA 3AEVA 1YHAA 1UEBA 3U4ZA 1V9PA 3E0EA 4IPDA 1HZCA 4GS3A 3RLNA 3H15A 1SFOH 1JT8A 3PIOA 4A3LG 4DUYL 2ZJPA 1GKHA 3HOXH 2Y0SE 3TEHB 1X3FA 1FVIA 1XPUA 1S3OA 1UE6A 3LGJA 2VQFL 1HNXQ 3ICEA 1D8LA 2JJQA 4DK3C 4LF5Q 4AYBG 5IYDH 5FLXc 3GTJH 5C4JH 4BBSH 1LUZA 3K7UC 1LM0A 4IJLA 4DNIA 1U5KA 5GAGC 5M3MH 3EBEA 1EQRA 1L1OA 4A3MG 4LF4L 2NVXH 5BR8Q 4YWMA 3JAMc 1O7IA 4UY8C 3PO2G 5DLQE 2K50A 2OTJA 3OTOL 1PHJA 4A3GH 1XMOL 1I94Q 1VQNA 3M3YH 4C3JH 4A93H 3H0GH 5M3FH 2KBNA 4A76A 2Q2UA 1XNRL 1UE1A 4LUOA 1R9TH 1JJCB 4X66Q 2BH2A 1VQHA 1X55A 2VZAA 2R7FA 2BH8A 5IWAQ 2KCMA 1G6PA 1P8LA 2K52A 1Q1BA 1EWIA 1M1KC 2RHSB 3F1ZA 1C0AA 1W2BA 2QA4A 1X65A 2WAQE 1IBKL 2JA5G 1N8RC 1FJGL 2LXKA 2Q2IA 3GTLH 3PF5A 4GKKQ 1KIXA 4DV5L 1YJ9A 1KD1C 2R92G 4B3TQ 4DAYB 4HJ8A 2MO0A 2AWOA 2MO1A 5FJ8G 4EX5A 1XPOA 3AQQA 4DR2L 1KL9A 2HIXA 3BJUA 3PUVA 3M4QA 3L2PA 3GTKH 4R4CA 1HNZQ 2AWNA 2A1AA 3D31A 3J81c 1G51A 4JI4Q 4B3RQ 5J3BA 4HJ9A 1N33Q 4GOPA 3K8AA 1AE2A 2E2JH 3J7ZC 1FGUA 1JMCA 2YTXA 4LW1A 4DKAC 1HR0Q 4DK6C 4GN3B 3KF8B 1YIJA 1KXLA 4A3MH 3S2HH 2B63H 4YWKA 3JAMi 3PO2H 1L2FA 2JA7G 3PUZA 3U58A 3GTQH 3PCOB 3PUWA 3I55A 5M5XH 3CC7A 1ASYA 3OYYA 4BY7H 3EIVA 1VQEA 3CCRA 1BKBA 2Q2HA 4JOIA 5BR8L 3T1YQ 4FDBA 1QZHA 1JB7A 1IBLQ 4HIOA 1X54A 2UUCQ 3ULJA 5HGQA 4NXNQ 3A74A 4JYAQ 4A3JG 1YHQA 2Y0SG 1Y14B 2OQKA 4X65Q 1N34Q 4L5TA 5ELNA 3L0OA 3ERSX 4X66L 3TQYA 1K73C 3M9BA 3RNUA 4IOAA 2K4KA 2DGYA 2OQ0A 2R7DA 4P71A 4TQUS 3UDIA 2D0PA 4AH6A 2F4VL 1JJGA 5IWAL 1I5FA 3OW2A 1Z47A 1VQAA 1WCMG 2BA1A 2NVYH 4JI2Q 1UE5A 3AYHB 2JA5H 5AJ3Q 4BXXG 4IJHA 4IPHA 2F52A 1J6QA 1WI5A 4DV6Q 2HT1A 2VQFQ 1HH2P 5H1SE 2JA6H 1S40A 1VQMA 3HOUH 5FJ8H 3KDFA 3UE0A 1A8VA 4GKKL 1TWGH 1U0LA 4UP7A 4HIKA 4B3TL 5IP9G 2PQAA 4YWLA 4DV1L 1VQ4A 1XMOQ 4DR1Q 5IYCG 1B7YB 1EOVA 2L15A 3I7FA 2ZJQA 2K5HA 3I2ZA 4DUZL 3S14H 3KJPA 1PH5A 3T1HQ 1HNZL 4B3RL 1V43A 2WAQG 1QVGA 3UE1A 3PF4A 3CXCA 4LF7L 4UPAA 5JJLA 1VQ6A 1FL0A 2LXJA 2ZM6Q 1K8GA 1VQPA 2N49A 4GN5A 4JBJA 5IYBH 3CPWA 2E2HH 2ATWA 4X6AH 3J80c 4MTNA 5C4XG 5M5YH 2R7ZG 1FJGQ 3KOJA 4A3JH 1EIYB 1VQBA 1VQDA 3CC2A 1Y1VG 2CCZA 4B3SL 1IL2A 4JI5Q 4OWXB 1IBLL 4A4IA 4NXMQ 3F8TA 2UUCL 3MEFA 1PFSA 4JYAL 2AHOB 3A0JA 4X65L 1N34L 1YNXA 2BA0A 3CD6A 2N8NA 3GD7A 4QL5A 1WCMH 3CCQA 2WB1E 1VQ7A 4R4QA 2I5MX 3K81C 2HHHL 1K83H 4JI6L 3HOZG 4BXXH 3HKZE 1NMFA 2YYZA 1BVSA 3E9HA 4OONA 4PZ8A 1EYGA 1K0RA 2JA9A 4C3IH 4GNXA 3AFPA 4LUZA 3CCMA 4NB3A 4JI0Q 3NEMA 4JI2L 1IXRA 5C44G 5AJ3L 2ZTEA 3FP9A 4DR7Q 4DV6L 2E5LQ 1J5EQ 1GVPA 2H5XA 1X3EA 2LSSA 4K0KL 4JBWA 1KRSA 2Z6KC 3GO5A 1B8AA 5IP9H 2VUMG 2UXCQ 1TXYA 4RMFA 5C0XG 1RIPA 5IYCH 4DPGA 1Y1WG 3MXNB 1YI2A 1I6HH 4PMWA 4Y52H 2PI2A 3CQZH 2KENA 3W5OA 1K3RA 4DR1L 2NZHA 2I5LX 1PH1A 3S24A 4DR6Q 1B70B 4DR5L 4GN4B 3T1HL 3KYHC 4LF8Q 3HFZB 1CUKA 1Q82C 1KAWA 2XTIA 1VQ9A 4JV5Q 4J15A 4EQ5A 1IBMQ 2F4VQ 1TWCH 3J80i 4DV2Q 5C4XH 2K14A 3I4MH 3HOWG 1RL2A 2CKZB 1X56A 4JI1Q 2VL6A 4BY1G 3J7A5 3PO3G 1PVOA 2ZM6L 4WJ3M 1Y1VH 2E8GA 4A3KG 1OXXK 1N9WA 3K0XA 4OWWB 4KI0A 1Q1EA 4IFDJ 3FKIG 5IP7G 1AH9A 3KF6B 1HJPA 4JI5L 1K9MC 2HIVA 2HQLA 3KLWA 3AFQA 4XTCS 3UDXA 3DLLA 1VQLA 4NXML 2ZTCA 4AIMA 3I4NG 1WJJA 4DV1Q 2A8VA 4A3LH 4A3DG 3J81j 1N36Q 3G4SA 4YY3L 4DUZQ 3K80C 3S1MH 4IOCA 3PUXA 5JEAJ 4AQYQ 4BBRG 3PSIA 5C44H 1I3QH 1X9NA 1KRTA 4LF9Q 1VCIA 5JJKA 3PUYA 1HNXL 4R4OA 4X64Q 3TRZA 2VW9A 2UXBQ 4LF7Q 2N78A 4IPGA 2VUMH 1Q81C 4JI0L 3E9IA 4DR7L 4DR3Q 4DV4Q 3RR5A 3VDYA 2E5LL 1Y1WH 2RHQB 1J5EL 2ES2A 1QVCA 2JA8G 1GD7A 3G6EA 1L1OC 5C3EG 2UXCL 3GTPH 2NVQH 3CPFA 3S17H 3UDFA 4B3SQ 2WB1G 1CKMA 4O0AA 2VNUD 5GAHC 1MKHA 3M4OH 3HKZG 4DV3L 2UUBQ 4NPSA 1XPRA 1VQFA 3HOVG 1YJWA 2B29A 2EXDA 1CKNB 5GROA 4DR6L 4LFCQ 3PO3H 1PYBA 3HOWH 4A3IG 4LF8L 4R4TA 2HHHQ 4BY1H 4JI6Q 2D0OA 4JV5L 5IE8A 1IBML 2NN6G 4DV2L 4A3FG 5LMNQ 1UWVA 2NN6I 3KF6A 4JI1L 3PV0A 1EUJA 1YVCA 1YZ6A 2R92H 3H3VI 4K0KQ 1G291 3I4NH 1VQIA 4KHPL 4LFAQ 1YJNA 4YCWA 1Q12A 1JJ2A 1Q46A 4R1JA 1OXUA 3HOYG 3KFUA 4GKJQ 3M7NA 2Z0SA 2KCTA 2V1CC 1E3PA 1VQJA 4IPCA 2NVTH 2WP8J 2JK8A 4C2MH 1PH8A 1N36L 5M5WH 1VQ8A 3BZKA 3IRBA 4JG2A 5GAEC 1SR3A 4DR5Q 4GOPC 4AQYL 4LF9L 4P72A 1VQCA 3NELA 1P16A 1CSQA 2JA8H 4X64L 4WJ4A 2JA7H 3TS2A 1GO3E 2UXBL 5C3EH 1GM5A 2MFIA 4DR3L 1MJCA 5E7NA 4DV4L 3G71A 1OTCA 4OX9Q 4O2DA 3ULLA 1YITA 4QIWE 5IY0A 4BA2I 4KHZA 1SMXA 1CKNA 2YTVA 4JOIC 3CCUA 1OXSC 3HOVH 4BBSG 1IYJB 4R4IA 3A5UA 5M3MG 4DV7Q 1QVFA 2VY3A 2I0QA 2ID0A 2UUBL 3S1RH 4P74A 3GTOH 4A3CG 4QQBX 3CCLA 5GQOA 2CFMA 2UU9Q 4LF6L 1V1QA 2F3IA 4LFCL 4YY3Q 2R6GA 5LMNW 1KQSA 4A93G 5M3FG 3B6YA 3Q8DA 1UE7A 1A63A 3L7ZC 2YU9H 1SLJA 4UP8A 2ALYB 3PGZA 3H3VH 4P73A 4KLKA 3PIPA 1WFQA 4TVAB 3G48A 3NBHB 3GTMH 3CAMA 3ULPA 5LMNL 5EAYA 5ELOA 2WFWA 2IT1A 1VQKA 3ZJYC 2NZOA 3CCSA 2KHJA 1XMQQ 2JQOA 2MQHA 3K7AH 4DV0L 4RG1A 4YCUA 4LFAL 1T9HA 1L0WA 1XNQL 2Q2TA 5C0XI 1VQOA 4GKJL 1A62A 1EQQA 1IZ6A 1PYSB 4DV3Q 1Z9FA 1EIFA 4MZ9A 1Q8KA 2PMZE 4YHHL 2OCEA 1QUQB 2VS1A 3ER0A 1QZGA 1N32Q 3HKSA 2B3GA 4HIDA 4DAMA 1C9OA 2ZJRA 4HJAA 1MJEA 3TREA 3U4VA 2E2IH 1PH7A 3SGIA 3DM3A 1H95A 2I5HA 3S1NH 1HZBA 2RCNA 3CCEA 4ME3A 1E22A 3WWVA 1SRUA 4L5SA 2R7ZH 4GOPB 3BU2A 1NE3A 1I50H 1Q86C 4X62L 1BBUA 1X6OA 2YV5A 3CW2C 4JBKA 1PH3A 4OX9L 2IHFA 4HJ7A 2B63G 3A5ZB 2GN5A 4A3CH 4KHPQ 4Y7NH 1VS0A 2CQOA 4BA1I 3S16H 4DV7L 1LTLA 4BY7G 2DUDA 3HOZH 4APVA 1WOCA 4DR4Q 1NY4A 4A3BG 3RLOA 2FXQA 4B3ML 4LFBL 2GVAA 4JI3L 2UU9L 3U50C 1HZAA 3CCJA 1PH9A 1E1TA 4LWCA 4QY7A 4GNXC 3CF5A 1PH6A 4PG3A 1NTGA 3NENA 2JEAI 3F2CA 3F2DA 3RN2A 2AMCB 1DGSA 2AKWB 4A3EG 1CSPA 1MIUA 4YCVA 3S15H 1AE3A 4PZ6A 3KJOA 1S72A 2IX1A 3F2BA 3CMEA 1XMQL 4IFDI 1QUQA 3RZDH 1HNWQ 4IO9A 3HOUG 4JI7Q 3M85A 2R93G 5LMUQ 3RN5A 3KDFB 2JE6I 2OTLA 2MNAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E1O A;  4JI8 Q;  1XTD A;  5JEA G;  2UUA Q;  1SN8 A;  1N32 L;  4LF6 Q;  2JA6 G;  1PH4 A;  2A19 A;  5FLM G;  2PQA B;  4UP9 A;  3CMA A;  1Q7Y C;  4P75 A;  1CKO A;  1PA6 A;  1BBW A;  2VQE Q;  1HZ9 A;  2K5N A;  3M4P A;  1PH2 A;  4A3K H;  3S2D H;  2EIF A;  3GDE A;  2XGT A;  1VQ5 A;  3BZC A;  3I4O A;  4LF5 L;  4HIM A;  1PV4 A;  1M90 C;  4GLA C;  3FKI H;  4C3H H;  1EFW A;  4OO1 G;  5IP7 H;  3FHW A;  4OO1 I;  4A75 A;  2RF4 A;  5IYB G;  1VQG A;  4L5Q A;  2UXD Q;  4DV0 Q;  1YHB A;  4A3B H;  3UDG A;  2EQS A;  4L5R C;  1XNQ Q;  4A3D H;  4ALP A;  4IFD G;  3S1Q H;  1I94 L;  2ASB A;  4QJF A;  1SE8 A;  1YBY A;  4AYB E;  2N3S A;  4OXP A;  1E24 A;  1KC8 C;  4BBR H;  4DR4 L;  3STB D;  2YTY A;  2ZTD A;  2IX0 A;  4LUV A;  4YHH Q;  4JCV E;  2K5V A;  1A0I A;  4XIG S;  2OWO A;  3GTG H;  4GLX A;  4DUY Q;  2QEX A;  4A3E H;  3STB C;  4LNQ A;  1ASZ A;  1TWA H;  3W1G A;  4LFB Q;  1K8A C;  3HOX G;  1E7Z A;  3CP0 A;  4X62 Q;  5GAD C;  2C35 B;  2Z6K A;  1XJV A;  1OXT A;  4GNX B;  4LF4 Q;  1KHI A;  1HNW L;  2R93 H;  4JBM A;  5IYD G;  1TWF H;  3J81 i;  1NMG A;  3OTO Q;  1D7Q A;  4QGU A;  2CWA A;  4JI7 L;  5LMU L;  1TWH H;  5FLM H;  1XNR Q;  1HR0 W;  4A3I H;  2GVB A;  5HY6 A;  4JI8 L;  1WYD A;  4PZ7 A;  1L1O B;  1SRO A;  3RLF A;  1NJI C;  2UUA L;  4B3M Q;  4JI4 L;  4POG A;  2JEB I;  3EN2 A;  4JC0 A;  4JI3 Q;  1N33 L;  4A3G G;  3D0F A;  4HJ5 A;  4A3F H;  3H0G G;  3I56 A;  2IY5 B;  1HR0 L;  1JE5 A;  2PI2 E;  2VQE L;  2KHI A;  1C7Y A;  3W1B A;  5IT9 c;  4GLV B;  4H02 A;  4POF A;  3TS0 A;  5K36 G;  3HOY H;  2K75 A;  3JC6 6;  3CCV A;  1IBK Q;  3I4M G;  1LYL A;  2PNH A;  5JJI A;  1NBW A;  1X3G A;  2CWP A;  2QGQ A;  4DV5 Q;  3T1Y L;  2UXD L;  5C0X J;  4OWT B;  3CC4 A;  4NXN L;  1W3S A;  1YEZ A;  2IHE A;  4DR2 Q;  3RZO H;  2D62 A;  1OXV A;  4MNO A;  3AEV A;  1YHA A;  1UEB A;  3U4Z A;  1V9P A;  3E0E A;  4IPD A;  1HZC A;  4GS3 A;  3RLN A;  3H15 A;  1SFO H;  1JT8 A;  3PIO A;  4A3L G;  4DUY L;  2ZJP A;  1GKH A;  3HOX H;  2Y0S E;  3TEH B;  1X3F A;  1FVI A;  1XPU A;  1S3O A;  1UE6 A;  3LGJ A;  2VQF L;  1HNX Q;  3ICE A;  1D8L A;  2JJQ A;  4DK3 C;  4LF5 Q;  4AYB G;  5IYD H;  5FLX c;  3GTJ H;  5C4J H;  4BBS H;  1LUZ A;  3K7U C;  1LM0 A;  4IJL A;  4DNI A;  1U5K A;  5GAG C;  5M3M H;  3EBE A;  1EQR A;  1L1O A;  4A3M G;  4LF4 L;  2NVX H;  5BR8 Q;  4YWM A;  3JAM c;  1O7I A;  4UY8 C;  3PO2 G;  5DLQ E;  2K50 A;  2OTJ A;  3OTO L;  1PHJ A;  4A3G H;  1XMO L;  1I94 Q;  1VQN A;  3M3Y H;  4C3J H;  4A93 H;  3H0G H;  5M3F H;  2KBN A;  4A76 A;  2Q2U A;  1XNR L;  1UE1 A;  4LUO A;  1R9T H;  1JJC B;  4X66 Q;  2BH2 A;  1VQH A;  1X55 A;  2VZA A;  2R7F A;  2BH8 A;  5IWA Q;  2KCM A;  1G6P A;  1P8L A;  2K52 A;  1Q1B A;  1EWI A;  1M1K C;  2RHS B;  3F1Z A;  1C0A A;  1W2B A;  2QA4 A;  1X65 A;  2WAQ E;  1IBK L;  2JA5 G;  1N8R C;  1FJG L;  2LXK A;  2Q2I A;  3GTL H;  3PF5 A;  4GKK Q;  1KIX A;  4DV5 L;  1YJ9 A;  1KD1 C;  2R92 G;  4B3T Q;  4DAY B;  4HJ8 A;  2MO0 A;  2AWO A;  2MO1 A;  5FJ8 G;  4EX5 A;  1XPO A;  3AQQ A;  4DR2 L;  1KL9 A;  2HIX A;  3BJU A;  3PUV A;  3M4Q A;  3L2P A;  3GTK H;  4R4C A;  1HNZ Q;  2AWN A;  2A1A A;  3D31 A;  3J81 c;  1G51 A;  4JI4 Q;  4B3R Q;  5J3B A;  4HJ9 A;  1N33 Q;  4GOP A;  3K8A A;  1AE2 A;  2E2J H;  3J7Z C;  1FGU A;  1JMC A;  2YTX A;  4LW1 A;  4DKA C;  1HR0 Q;  4DK6 C;  4GN3 B;  3KF8 B;  1YIJ A;  1KXL A;  4A3M H;  3S2H H;  2B63 H;  4YWK A;  3JAM i;  3PO2 H;  1L2F A;  2JA7 G;  3PUZ A;  3U58 A;  3GTQ H;  3PCO B;  3PUW A;  3I55 A;  5M5X H;  3CC7 A;  1ASY A;  3OYY A;  4BY7 H;  3EIV A;  1VQE A;  3CCR A;  1BKB A;  2Q2H A;  4JOI A;  5BR8 L;  3T1Y Q;  4FDB A;  1QZH A;  1JB7 A;  1IBL Q;  4HIO A;  1X54 A;  2UUC Q;  3ULJ A;  5HGQ A;  4NXN Q;  3A74 A;  4JYA Q;  4A3J G;  1YHQ A;  2Y0S G;  1Y14 B;  2OQK A;  4X65 Q;  1N34 Q;  4L5T A;  5ELN A;  3L0O A;  3ERS X;  4X66 L;  3TQY A;  1K73 C;  3M9B A;  3RNU A;  4IOA A;  2K4K A;  2DGY A;  2OQ0 A;  2R7D A;  4P71 A;  4TQU S;  3UDI A;  2D0P A;  4AH6 A;  2F4V L;  1JJG A;  5IWA L;  1I5F A;  3OW2 A;  1Z47 A;  1VQA A;  1WCM G;  2BA1 A;  2NVY H;  4JI2 Q;  1UE5 A;  3AYH B;  2JA5 H;  5AJ3 Q;  4BXX G;  4IJH A;  4IPH A;  2F52 A;  1J6Q A;  1WI5 A;  4DV6 Q;  2HT1 A;  2VQF Q;  1HH2 P;  5H1S E;  2JA6 H;  1S40 A;  1VQM A;  3HOU H;  5FJ8 H;  3KDF A;  3UE0 A;  1A8V A;  4GKK L;  1TWG H;  1U0L A;  4UP7 A;  4HIK A;  4B3T L;  5IP9 G;  2PQA A;  4YWL A;  4DV1 L;  1VQ4 A;  1XMO Q;  4DR1 Q;  5IYC G;  1B7Y B;  1EOV A;  2L15 A;  3I7F A;  2ZJQ A;  2K5H A;  3I2Z A;  4DUZ L;  3S14 H;  3KJP A;  1PH5 A;  3T1H Q;  1HNZ L;  4B3R L;  1V43 A;  2WAQ G;  1QVG A;  3UE1 A;  3PF4 A;  3CXC A;  4LF7 L;  4UPA A;  5JJL A;  1VQ6 A;  1FL0 A;  2LXJ A;  2ZM6 Q;  1K8G A;  1VQP A;  2N49 A;  4GN5 A;  4JBJ A;  5IYB H;  3CPW A;  2E2H H;  2ATW A;  4X6A H;  3J80 c;  4MTN A;  5C4X G;  5M5Y H;  2R7Z G;  1FJG Q;  3KOJ A;  4A3J H;  1EIY B;  1VQB A;  1VQD A;  3CC2 A;  1Y1V G;  2CCZ A;  4B3S L;  1IL2 A;  4JI5 Q;  4OWX B;  1IBL L;  4A4I A;  4NXM Q;  3F8T A;  2UUC L;  3MEF A;  1PFS A;  4JYA L;  2AHO B;  3A0J A;  4X65 L;  1N34 L;  1YNX A;  2BA0 A;  3CD6 A;  2N8N A;  3GD7 A;  4QL5 A;  1WCM H;  3CCQ A;  2WB1 E;  1VQ7 A;  4R4Q A;  2I5M X;  3K81 C;  2HHH L;  1K83 H;  4JI6 L;  3HOZ G;  4BXX H;  3HKZ E;  1NMF A;  2YYZ A;  1BVS A;  3E9H A;  4OON A;  4PZ8 A;  1EYG A;  1K0R A;  2JA9 A;  4C3I H;  4GNX A;  3AFP A;  4LUZ A;  3CCM A;  4NB3 A;  4JI0 Q;  3NEM A;  4JI2 L;  1IXR A;  5C44 G;  5AJ3 L;  2ZTE A;  3FP9 A;  4DR7 Q;  4DV6 L;  2E5L Q;  1J5E Q;  1GVP A;  2H5X A;  1X3E A;  2LSS A;  4K0K L;  4JBW A;  1KRS A;  2Z6K C;  3GO5 A;  1B8A A;  5IP9 H;  2VUM G;  2UXC Q;  1TXY A;  4RMF A;  5C0X G;  1RIP A;  5IYC H;  4DPG A;  1Y1W G;  3MXN B;  1YI2 A;  1I6H H;  4PMW A;  4Y52 H;  2PI2 A;  3CQZ H;  2KEN A;  3W5O A;  1K3R A;  4DR1 L;  2NZH A;  2I5L X;  1PH1 A;  3S24 A;  4DR6 Q;  1B70 B;  4DR5 L;  4GN4 B;  3T1H L;  3KYH C;  4LF8 Q;  3HFZ B;  1CUK A;  1Q82 C;  1KAW A;  2XTI A;  1VQ9 A;  4JV5 Q;  4J15 A;  4EQ5 A;  1IBM Q;  2F4V Q;  1TWC H;  3J80 i;  4DV2 Q;  5C4X H;  2K14 A;  3I4M H;  3HOW G;  1RL2 A;  2CKZ B;  1X56 A;  4JI1 Q;  2VL6 A;  4BY1 G;  3J7A 5;  3PO3 G;  1PVO A;  2ZM6 L;  4WJ3 M;  1Y1V H;  2E8G A;  4A3K G;  1OXX K;  1N9W A;  3K0X A;  4OWW B;  4KI0 A;  1Q1E A;  4IFD J;  3FKI G;  5IP7 G;  1AH9 A;  3KF6 B;  1HJP A;  4JI5 L;  1K9M C;  2HIV A;  2HQL A;  3KLW A;  3AFQ A;  4XTC S;  3UDX A;  3DLL A;  1VQL A;  4NXM L;  2ZTC A;  4AIM A;  3I4N G;  1WJJ A;  4DV1 Q;  2A8V A;  4A3L H;  4A3D G;  3J81 j;  1N36 Q;  3G4S A;  4YY3 L;  4DUZ Q;  3K80 C;  3S1M H;  4IOC A;  3PUX A;  5JEA J;  4AQY Q;  4BBR G;  3PSI A;  5C44 H;  1I3Q H;  1X9N A;  1KRT A;  4LF9 Q;  1VCI A;  5JJK A;  3PUY A;  1HNX L;  4R4O A;  4X64 Q;  3TRZ A;  2VW9 A;  2UXB Q;  4LF7 Q;  2N78 A;  4IPG A;  2VUM H;  1Q81 C;  4JI0 L;  3E9I A;  4DR7 L;  4DR3 Q;  4DV4 Q;  3RR5 A;  3VDY A;  2E5L L;  1Y1W H;  2RHQ B;  1J5E L;  2ES2 A;  1QVC A;  2JA8 G;  1GD7 A;  3G6E A;  1L1O C;  5C3E G;  2UXC L;  3GTP H;  2NVQ H;  3CPF A;  3S17 H;  3UDF A;  4B3S Q;  2WB1 G;  1CKM A;  4O0A A;  2VNU D;  5GAH C;  1MKH A;  3M4O H;  3HKZ G;  4DV3 L;  2UUB Q;  4NPS A;  1XPR A;  1VQF A;  3HOV G;  1YJW A;  2B29 A;  2EXD A;  1CKN B;  5GRO A;  4DR6 L;  4LFC Q;  3PO3 H;  1PYB A;  3HOW H;  4A3I G;  4LF8 L;  4R4T A;  2HHH Q;  4BY1 H;  4JI6 Q;  2D0O A;  4JV5 L;  5IE8 A;  1IBM L;  2NN6 G;  4DV2 L;  4A3F G;  5LMN Q;  1UWV A;  2NN6 I;  3KF6 A;  4JI1 L;  3PV0 A;  1EUJ A;  1YVC A;  1YZ6 A;  2R92 H;  3H3V I;  4K0K Q;  1G29 1;  3I4N H;  1VQI A;  4KHP L;  4LFA Q;  1YJN A;  4YCW A;  1Q12 A;  1JJ2 A;  1Q46 A;  4R1J A;  1OXU A;  3HOY G;  3KFU A;  4GKJ Q;  3M7N A;  2Z0S A;  2KCT A;  2V1C C;  1E3P A;  1VQJ A;  4IPC A;  2NVT H;  2WP8 J;  2JK8 A;  4C2M H;  1PH8 A;  1N36 L;  5M5W H;  1VQ8 A;  3BZK A;  3IRB A;  4JG2 A;  5GAE C;  1SR3 A;  4DR5 Q;  4GOP C;  4AQY L;  4LF9 L;  4P72 A;  1VQC A;  3NEL A;  1P16 A;  1CSQ A;  2JA8 H;  4X64 L;  4WJ4 A;  2JA7 H;  3TS2 A;  1GO3 E;  2UXB L;  5C3E H;  1GM5 A;  2MFI A;  4DR3 L;  1MJC A;  5E7N A;  4DV4 L;  3G71 A;  1OTC A;  4OX9 Q;  4O2D A;  3ULL A;  1YIT A;  4QIW E;  5IY0 A;  4BA2 I;  4KHZ A;  1SMX A;  1CKN A;  2YTV A;  4JOI C;  3CCU A;  1OXS C;  3HOV H;  4BBS G;  1IYJ B;  4R4I A;  3A5U A;  5M3M G;  4DV7 Q;  1QVF A;  2VY3 A;  2I0Q A;  2ID0 A;  2UUB L;  3S1R H;  4P74 A;  3GTO H;  4A3C G;  4QQB X;  3CCL A;  5GQO A;  2CFM A;  2UU9 Q;  4LF6 L;  1V1Q A;  2F3I A;  4LFC L;  4YY3 Q;  2R6G A;  5LMN W;  1KQS A;  4A93 G;  5M3F G;  3B6Y A;  3Q8D A;  1UE7 A;  1A63 A;  3L7Z C;  2YU9 H;  1SLJ A;  4UP8 A;  2ALY B;  3PGZ A;  3H3V H;  4P73 A;  4KLK A;  3PIP A;  1WFQ A;  4TVA B;  3G48 A;  3NBH B;  3GTM H;  3CAM A;  3ULP A;  5LMN L;  5EAY A;  5ELO A;  2WFW A;  2IT1 A;  1VQK A;  3ZJY C;  2NZO A;  3CCS A;  2KHJ A;  1XMQ Q;  2JQO A;  2MQH A;  3K7A H;  4DV0 L;  4RG1 A;  4YCU A;  4LFA L;  1T9H A;  1L0W A;  1XNQ L;  2Q2T A;  5C0X I;  1VQO A;  4GKJ L;  1A62 A;  1EQQ A;  1IZ6 A;  1PYS B;  4DV3 Q;  1Z9F A;  1EIF A;  4MZ9 A;  1Q8K A;  2PMZ E;  4YHH L;  2OCE A;  1QUQ B;  2VS1 A;  3ER0 A;  1QZG A;  1N32 Q;  3HKS A;  2B3G A;  4HID A;  4DAM A;  1C9O A;  2ZJR A;  4HJA A;  1MJE A;  3TRE A;  3U4V A;  2E2I H;  1PH7 A;  3SGI A;  3DM3 A;  1H95 A;  2I5H A;  3S1N H;  1HZB A;  2RCN A;  3CCE A;  4ME3 A;  1E22 A;  3WWV A;  1SRU A;  4L5S A;  2R7Z H;  4GOP B;  3BU2 A;  1NE3 A;  1I50 H;  1Q86 C;  4X62 L;  1BBU A;  1X6O A;  2YV5 A;  3CW2 C;  4JBK A;  1PH3 A;  4OX9 L;  2IHF A;  4HJ7 A;  2B63 G;  3A5Z B;  2GN5 A;  4A3C H;  4KHP Q;  4Y7N H;  1VS0 A;  2CQO A;  4BA1 I;  3S16 H;  4DV7 L;  1LTL A;  4BY7 G;  2DUD A;  3HOZ H;  4APV A;  1WOC A;  4DR4 Q;  1NY4 A;  4A3B G;  3RLO A;  2FXQ A;  4B3M L;  4LFB L;  2GVA A;  4JI3 L;  2UU9 L;  3U50 C;  1HZA A;  3CCJ A;  1PH9 A;  1E1T A;  4LWC A;  4QY7 A;  4GNX C;  3CF5 A;  1PH6 A;  4PG3 A;  1NTG A;  3NEN A;  2JEA I;  3F2C A;  3F2D A;  3RN2 A;  2AMC B;  1DGS A;  2AKW B;  4A3E G;  1CSP A;  1MIU A;  4YCV A;  3S15 H;  1AE3 A;  4PZ6 A;  3KJO A;  1S72 A;  2IX1 A;  3F2B A;  3CME A;  1XMQ L;  4IFD I;  1QUQ A;  3RZD H;  1HNW Q;  4IO9 A;  3HOU G;  4JI7 Q;  3M85 A;  2R93 G;  5LMU Q;  3RN5 A;  3KDF B;  2JE6 I;  2OTL A;  2MNA A; 
#chains in the Genus database with same CATH topology
 3K5M A;  1MSH A;  4LF6 Q;  2JA6 G;  5FLM G;  3CMA A;  1CKO A;  1BBW A;  5L37 A;  1O80 A;  1HQR D;  4ZK9 B;  4ZQ3 A;  3BZC A;  3T56 B;  3BYT B;  3S1M B;  4OO1 G;  2FJ2 A;  4A75 A;  2MPM A;  1VQG A;  2E2J B;  1XNQ Q;  2ASB A;  1SE8 A;  1YBY A;  3P75 A;  2IX0 A;  4JCV E;  3GTG H;  4GLX A;  4KD4 A;  3NWT A;  4MHE A;  3HG9 A;  4A3E H;  1TR5 A;  4KKU A;  3STB C;  1ASZ A;  1B9N A;  1E7Z A;  3T53 B;  5JVG 3;  2EY6 A;  5GAD C;  2C35 B;  2EYJ A;  4JBM A;  5IYD G;  1LLR D;  1TWF H;  2CWA A;  2HCI A;  5LMU L;  1TWH H;  4NKL A;  3C1E A;  4A3I H;  1HR0 W;  1SYD A;  5HY6 A;  1NJI C;  2UUA L;  4JI4 L;  1BO0 A;  2JEB I;  2RQX A;  4JC0 A;  4JI3 Q;  4POG A;  4A3G G;  4HJ5 A;  3H0G G;  2PW7 A;  1HR0 L;  1JE5 A;  1S5E D;  3W1B A;  1CA6 A;  3TS0 A;  3HOY H;  2K75 A;  2PNH A;  2A6H D;  2B8G A;  2QGQ A;  1X3G A;  4DV5 Q;  5T1I A;  4NDX A;  1O7Z A;  1W3S A;  1YEZ A;  2CW0 D;  2O4X A;  3RZO H;  1NAP A;  4MNO A;  1V9P A;  3E0E A;  1AZP A;  1EFI D;  3H15 A;  1VDZ A;  4HCS A;  4ZLT F;  4DUY L;  1GKH A;  3A7A B;  1ILP A;  3ONA B;  3TEH B;  1XPU A;  1LAB A;  2Q8T A;  2VQF L;  3ICE A;  1D8L A;  2N88 A;  4DXG A;  1U4P A;  1LUZ A;  1U5K A;  4IUV A;  3JAM L;  4LF4 L;  2NVX H;  2K50 A;  2JSO A;  2BCO A;  1UE1 A;  2F4I A;  1CHP D;  4Q0F A;  5DEH A;  1SSO A;  1X55 A;  1A6X A;  2F0K A;  2JYO A;  1LTR D;  4GZY C;  1I6H B;  3DUZ A;  1EWI A;  1EEI D;  4K8I A;  3KUP A;  3HZX A;  1C8C A;  1TT2 A;  2WAQ E;  1IBK L;  2JA5 G;  1BCP B;  2KEC A;  2Q2I A;  1N8R C;  4X3U A;  1F9P A;  2WII B;  2F0F A;  1YJ9 A;  1KD1 C;  2R92 G;  2MO0 A;  1L0Y B;  5FJ8 G;  2K04 A;  3AQQ A;  3V2T A;  1Y1V B;  3BJU A;  2H1E A;  1A3T A;  5CV5 A;  3GTK H;  1CZW A;  4IUN A;  2AWN A;  3D31 A;  3J81 c;  4JI4 Q;  4B3R Q;  4WJW A;  5KEE A;  4HJ9 A;  5FLX E;  3J7A V;  3J7Z C;  2YTX A;  4DKA C;  4QF4 A;  1HR0 Q;  1L0X B;  4GN3 B;  1S5D D;  3PO2 H;  1O78 A;  2JA7 G;  1SE2 A;  1B50 A;  3I55 A;  3EIV A;  1U4M A;  2B39 A;  3CCR A;  2Q2H A;  1JB7 A;  3IFT A;  1IBL Q;  1X54 A;  2NYZ D;  2QF7 A;  2KVM A;  3FPU B;  1Y14 B;  2OQK A;  1STB A;  4X65 Q;  4EGV A;  1RTO A;  3L0O A;  4X66 L;  4G4K A;  1MHW C;  2BDN A;  3Q6S A;  2K4K A;  2DGY A;  2OQ0 A;  4P71 A;  3UDI A;  5I9O A;  2D0P A;  2K5Q A;  2F4V L;  1JJG A;  4IZ8 A;  5IWA L;  2BA1 A;  2NVY H;  2PQE A;  4IUU A;  1KAB A;  4IFD H;  2X6G A;  5C4H A;  2VQF Q;  3PO3 B;  4UHV A;  3HOW B;  3UE0 A;  4GKK L;  5EPJ A;  1U0L A;  4HMI A;  4HIK A;  3S2D B;  1CK1 A;  1GUW A;  1STE A;  4RAU C;  2HD3 A;  3FKI B;  2AUJ D;  4CDD C;  2L0C A;  1ZXT A;  1SAP A;  1HNZ L;  4RGM A;  3I4N B;  5JPN C;  2IJ0 A;  1V43 A;  2WAQ G;  5EGT A;  3PF4 A;  4F7X A;  3CXC A;  4ZKC B;  4BBR B;  2E76 C;  3OOC A;  1JC7 A;  2ZM6 Q;  4C1N K;  2N49 A;  5IYB H;  5M5W B;  1CT1 D;  4CBV A;  5EBD A;  1F2Z A;  5C4X G;  5M5Y H;  4QB4 A;  2R7Z G;  1EYD A;  1H9R A;  2CCZ A;  2K1B A;  1QCB D;  3FMC A;  3BDL A;  5C3E B;  4JYA L;  2AHO B;  1QIL A;  3A0J A;  2WB1 B;  2BA0 A;  3CD6 A;  3OHX C;  1WCM H;  4IN3 A;  3S14 H;  1Y8N B;  4R4Q A;  3K81 C;  4BXX H;  1K83 H;  4JI6 L;  3I4L A;  2KQ3 A;  3HKZ E;  1HNX Q;  2YYZ A;  1F2Y A;  1K0R A;  2JA9 A;  4GNX A;  4CDE C;  1HPC A;  5AJ3 L;  2ZTE A;  4DV6 L;  2E5L Q;  2Z6K C;  1G2S A;  2VUM G;  2UXC Q;  1TXY A;  4V0B A;  3MVV A;  3ND9 A;  3N52 A;  4PMW A;  3MAQ A;  4UDU C;  2I5L X;  2SDF A;  2K7V A;  3KYH C;  2B2V A;  3RD4 A;  4LF8 Q;  1Q82 C;  2XTI A;  1VQ9 A;  4J15 A;  1SNQ A;  1Y69 U;  3FVQ A;  2F4V Q;  4DV2 Q;  2K14 A;  1WD1 A;  1GUN A;  3A8I E;  1PVO A;  1RTN A;  1A3V A;  4XQN A;  1OXX K;  1BCP F;  4CGY B;  1S5F D;  1B9M A;  1AH9 A;  3KF6 B;  4RGO S;  3KLW A;  3AFQ A;  4XTC S;  1U4L A;  1V1P A;  3V05 A;  1VQL A;  4NXM L;  4DGZ A;  2A8V A;  2AQ1 B;  2Q8R E;  1HFN A;  4BBS B;  1SEB D;  3K80 C;  2NUC A;  3PUX A;  5C44 H;  1I3Q H;  3PUY A;  1EY0 A;  1O7Y A;  2IW3 A;  2VW9 A;  4A93 B;  5M3F B;  1BR9 A;  4OEM B;  2VB2 X;  5CV7 A;  1Q81 C;  3WDN A;  2WAC A;  4DR7 L;  3RR5 A;  1Y1W H;  3NBI A;  4CKE A;  2ES2 A;  1DOK A;  3I73 A;  2F0Q A;  1L1O C;  4ZKB B;  1EYC A;  4X3S A;  2NVQ H;  3CPF A;  3GTP H;  2JXM B;  2WKC A;  3X3M A;  1MKH A;  3HKZ G;  3U9S A;  2KCC A;  3HOV G;  5IGB A;  2EXD A;  4CDC C;  1CKN B;  5GRO A;  1XX8 A;  1IKM A;  4G7H C;  3X3N A;  3G6J B;  4A3I G;  4R4T A;  4BY1 H;  2FIN B;  4JI6 Q;  3T4A C;  5IE8 A;  2SOB A;  2F0H A;  5FK9 C;  2F03 A;  4JI1 L;  2E2D C;  5JJZ A;  4OL7 A;  1WTP A;  3NTI A;  3TN2 A;  3TP6 A;  1YJN A;  1JJ2 A;  1EY8 A;  1SNP A;  3HOY G;  1Q46 A;  4R1J A;  2B2W C;  4N8F A;  1M8A A;  1VQJ A;  2NVT H;  2JK8 A;  1LT4 D;  4KJO A;  1PH8 A;  1SYB A;  1VQ8 A;  5M5X B;  3SE0 A;  4AQY L;  4P72 A;  1EWH A;  1CSQ A;  2JA8 H;  3OSO A;  2UXB L;  2MFI A;  4DR3 L;  2QDB A;  1VMP A;  2B8F A;  1I4G A;  4O2D A;  4Z9C B;  1YIT A;  4QIW E;  4ABN A;  4PV1 C;  1OXS C;  3PMF A;  3NUC A;  4XQQ A;  1JOQ A;  1E2W A;  2IPK D;  2VY3 A;  2XN9 C;  3S1R H;  1TWA B;  3GTO H;  4QQB X;  4FXD A;  3DWA A;  2FHT A;  3SHL A;  3HOU B;  2F3I A;  4LFC L;  5FO8 B;  1KQS A;  3Q8D A;  2R93 B;  1UE7 A;  3SK6 A;  4UP8 A;  1JOO A;  5JVH 3;  1EZ6 A;  1TY2 A;  3G48 A;  3NBH B;  2JA6 B;  3ULP A;  3LNN A;  5KNB A;  2EYF A;  3GV3 A;  5ELO A;  4KJN A;  3OIQ A;  3GQB A;  3CCS A;  3ND8 A;  4DV0 L;  3K7A H;  4RGN A;  4RG1 A;  4YCU A;  1ENA A;  2Q2T A;  1WTV A;  3TP8 A;  1IZ6 A;  3SEB A;  2E2H B;  2L55 A;  2PCF B;  4YHH L;  1XTC D;  1QUQ B;  3MZ5 A;  1N32 Q;  2B3G A;  4RH6 A;  3BG3 A;  3OIP A;  4DAM A;  1MJE A;  3ZYY X;  2A5H A;  2I5H A;  3AMU A;  1D2B A;  3CCE A;  1E22 A;  1JWM D;  1CQF A;  4MN3 A;  4L5S A;  1NE3 A;  1I50 H;  4IUQ A;  1Q86 C;  4JBK A;  3TP7 A;  4ZRZ A;  1A3U A;  4A3C H;  5CMD A;  3W2D A;  2MHV A;  2TMP A;  4U67 3;  3T16 A;  5BN5 A;  3HOZ H;  2M2L A;  1NY4 A;  5E4X A;  2FXQ A;  2UU9 L;  5CV4 A;  2F0S A;  1ZKO A;  1PH9 A;  4LWC A;  2D5D A;  2BOS A;  4A3G B;  3QR8 A;  3H0G B;  3CHB D;  3RN2 A;  1KLU D;  1GUG A;  1CTM A;  2F0T A;  3I3C A;  4YCV A;  3S15 H;  1AE3 A;  3KJO A;  4IFD G;  1ET6 A;  3NQT A;  1TWC B;  2L11 A;  1H9J A;  4R8N A;  4KN7 C;  3M85 A;  1BBX C;  2Z4I A;  3SXH A;  1H9S A;  1E1O A;  3J81 L;  4B9X A;  1D5M C;  5COR A;  4LMQ D;  1Q7Y C;  4FO2 A;  4FXG C;  2K5N A;  2KED A;  2A74 C;  4A3K H;  3SVM A;  2EIF A;  5ELB A;  2G5D A;  5IGE A;  4HIM A;  1D1K A;  4GLA C;  1RDP D;  3K58 A;  3NK9 A;  5IP7 H;  4OO1 I;  5A2Q E;  4NW2 A;  5IYB G;  1GJX A;  2UXD Q;  4DV0 Q;  1YHB A;  1I4X A;  3KLS A;  3VYU A;  3UDG A;  4A3B H;  4A3D H;  4ALP A;  4RHS A;  2L12 A;  4AYB E;  1E24 A;  1KC8 C;  4DR4 L;  5IOD A;  2YTY A;  4YHH Q;  3K59 A;  3I72 A;  2OWO A;  4XIG S;  3HGB A;  1R4Q B;  4MIU A;  3HS0 C;  4ILW A;  1VMC A;  4LNQ A;  3D3R A;  1K8A C;  3HOX G;  4MTK A;  1PDQ A;  4GNX B;  3DM1 A;  2Z9H A;  4QGU A;  2JA5 B;  4ZUJ A;  2EY5 A;  4H0L C;  1XNR Q;  2GVB A;  2R92 B;  5BN3 A;  1J8I A;  1L1O B;  3EN2 A;  3D0F A;  4A3F H;  3NQI A;  3I56 A;  2PI2 E;  2F0M A;  4C2M B;  1STY A;  5IT9 L;  2EZV A;  5DM7 3;  3J7A F;  3JC6 6;  1PRT C;  2CVR A;  1A2T A;  1EU3 A;  5JJI A;  5COY A;  1XYI A;  1NBW A;  2CWP A;  1F77 A;  2G9H D;  5C0X J;  2JA7 B;  4LAA A;  2XRQ D;  4K2K A;  3CC4 A;  4H44 C;  1OXV A;  3AEV A;  1UEB A;  1Q8I A;  4IPD A;  4GS3 A;  3E0J A;  2ICE C;  1SFO H;  1JT8 A;  4DN4 M;  4EQP A;  2B2U A;  3AU7 A;  4XYO A;  4DNT B;  2Z6B A;  3G7L A;  4C56 C;  4TSS A;  4DK3 C;  4AYB G;  3M7G A;  4FXK C;  5FLX c;  5C4J H;  4DNI A;  4A3M G;  3EBE A;  4L6T B;  4UY8 C;  5BR8 Q;  4H13 C;  2OTJ A;  5LL6 X;  5FO7 B;  1XMO L;  3URY A;  4A76 A;  1ML0 D;  1GUO A;  1R9T H;  1JJC B;  1G91 A;  4KN4 C;  5CGK A;  3NSW A;  2R7F A;  3TBI B;  2KCM A;  5EPK A;  2RA4 A;  5LHY 1;  1Q1B A;  2WAQ B;  3F1Z A;  2D2C C;  3LWE A;  3WOF A;  3OWE B;  1LTA D;  1KIX A;  4DV5 L;  3S1N B;  3LX0 A;  2MO1 A;  5C4X B;  4EX5 A;  5J39 A;  2R7Z B;  2HIX A;  3CU7 A;  3PUV A;  3M4Q A;  1HRJ A;  1QG7 A;  2F3W A;  3VA5 A;  3VYS A;  4XQJ A;  1AFP A;  1I4P A;  4HSP A;  5J3B A;  1EL0 A;  2E2J H;  4RKL A;  1JMC A;  3DXJ C;  1B3A A;  4HMJ A;  3KF8 B;  1KXL A;  2EYL A;  3S2H H;  4YWK A;  4BWG B;  1PTO C;  1L2F A;  3ERQ A;  3PUZ A;  3A56 A;  1R4P B;  3PUW A;  2X69 A;  3H6M A;  4FDB A;  2TSS A;  2VUM B;  5EKI A;  4K5V A;  1DOM A;  5HGQ A;  5IGC A;  2CQA A;  4A3J G;  2QIL A;  2DNE A;  1PFN A;  1HCZ A;  3PIO 3;  1XXG A;  3ERS X;  3M9B A;  3RNU A;  2K32 A;  4IOA A;  2RSO A;  5FKA C;  2A69 D;  3AYH B;  4DAY A;  3D8G A;  1IW7 D;  5H1S E;  4J8Q A;  2QEJ C;  5E1F A;  2J0T D;  4JW0 A;  1EIG A;  5JEA H;  1KAA A;  2QW7 A;  2EDG A;  2RDH A;  2IWH A;  5CBE E;  1XMO Q;  4XYQ A;  4TRD A;  3I7F A;  1B7Y B;  5DM6 3;  4DR1 Q;  2ZJQ A;  2K5H A;  3I2Z A;  1UEA B;  4K8J A;  2NTT A;  4B3R L;  5T1G A;  2EXZ A;  2RSN A;  2MGS A;  4DNR B;  1XWE A;  4IUT A;  1YNJ D;  4KKS A;  3VYT A;  2LXJ A;  4GN5 A;  4X6A H;  1TS3 A;  2E74 C;  3C1F A;  1KLG D;  2R3Z A;  3J80 c;  3GTG B;  4EQN A;  1U9R A;  4JI5 Q;  1IBL L;  4A4I A;  3F8T A;  1PFS A;  3MFG A;  2HQE A;  4X65 L;  1YNX A;  3HKZ B;  2N8N A;  3GD7 A;  3HOZ G;  1B3Q A;  2I5M X;  1STN A;  4FP5 D;  1TWF B;  3HOV B;  3E9H A;  4C3I H;  2AQ2 B;  1ONL A;  1SNC A;  1D6E C;  1TWH B;  4IUP A;  3NEM A;  4A3I B;  2P5Z X;  2XVS A;  2NBF A;  5KGU A;  3EFX D;  4OGQ C;  4X3T A;  2H5X A;  3OW7 A;  2C5C A;  1BDO A;  5IP9 H;  4JVZ A;  2JP1 A;  1E0B A;  5IYC H;  2YU9 B;  3R93 A;  1EIH A;  1DYQ A;  3GTM B;  3MXN B;  1I6H H;  4Y52 H;  2PI2 A;  3CQZ H;  2KEN A;  2NZH A;  1AEX A;  1PH1 A;  3HOY B;  3S24 A;  3PQI A;  4WOR A;  5D14 A;  5EKL A;  4GN4 B;  5CV6 A;  1CUK A;  5A35 A;  3WOE A;  5K36 H;  2EYO A;  5HGT A;  3J80 i;  3RZO B;  3I4M H;  1I4R A;  1X56 A;  2IX3 A;  4WJ3 M;  2ZM6 L;  1Y1V H;  2E8G A;  4ZAI A;  4A3K G;  1N9W A;  4OWW B;  1Q1E A;  4K5X A;  5IP7 G;  2I46 A;  1K9M C;  2NZ1 D;  2HIV A;  3UDX A;  3DLL A;  2ZTC A;  1WJJ A;  1PRT B;  1M4V A;  5D3D A;  1BF4 A;  4A3D G;  3J81 j;  3MFY A;  3G4S A;  3DHQ A;  5LL6 S;  1X9N A;  2NVX B;  3PSI A;  1SYC A;  1KRT A;  2EY2 A;  3NHH A;  1HNX L;  2O2L D;  3S16 B;  2N78 A;  4IPG A;  3MHB A;  2E5L L;  5NUC A;  2UXC L;  4KY5 A;  1KNA A;  5IGD A;  2IL8 A;  5GAH C;  3M4O H;  4DV3 L;  2UUB Q;  2DNC A;  5JAV A;  1YJW A;  3DEO A;  3IL8 A;  4HED A;  1SBB B;  3PO3 H;  3HOW H;  1TS5 A;  4LF8 L;  1JB3 A;  1IL8 A;  2NN6 G;  4DV2 L;  4A3F G;  1UWV A;  2RDF A;  1EUJ A;  1EZ8 A;  3I4N H;  1JWS D;  1PZK D;  3QB3 A;  3N6R A;  3M7N A;  2Z0S A;  2KCT A;  1E3P A;  1ICW A;  2SNS A;  3VR6 A;  3J7Y W;  2ZXO A;  3EVQ A;  1SJH D;  5M5W H;  4JG2 A;  5GAE C;  1SR3 A;  2KUM A;  1VQC A;  3UI2 A;  3NEL A;  1RKN A;  1GO3 E;  1WTO A;  5C3E H;  2A6E C;  1IHZ A;  4QIW B;  5KNC A;  3G71 A;  1OTC A;  3I91 A;  5IY0 A;  1AN8 A;  4KHZ A;  1SMX A;  3CCU A;  4BA2 I;  1UNS A;  3P7J A;  3NTH A;  5ELF A;  1IYJ B;  4DV7 Q;  1BCP D;  1QVF A;  1SE4 A;  1PTO B;  2EY1 A;  4P74 A;  5GQO A;  2CFM A;  2X6L A;  1CFM A;  2RCF A;  2RVL A;  3P20 A;  2RBM A;  2ALY B;  2MP1 A;  1EQT A;  3CRL C;  5EAY A;  1VQK A;  1EQV A;  2A68 D;  2KHJ A;  2BE5 C;  1F9S A;  5D3I B;  2HDM A;  5C0X I;  1A62 A;  4I65 A;  3RUZ A;  1EQQ A;  1PYS B;  4DV3 Q;  2F0D A;  1EIF A;  1Q8K A;  2PMZ E;  3MXP A;  2H4O A;  4KTA A;  2VS1 A;  3ER0 A;  5M5Y B;  4HID A;  1TS4 A;  4TKO B;  4FNF A;  4HJA A;  3U4V A;  2E2I H;  3GP7 A;  3J80 E;  1WD0 A;  1LV9 A;  4PMB A;  2RCN A;  5FLX L;  4ME3 A;  1NNX A;  3BYY B;  1SMY D;  1PZJ D;  3BU2 A;  3IAY A;  1Z7T A;  4X62 L;  1JWU D;  2YV5 A;  3S14 B;  4HJ7 A;  2GN5 A;  5J1Z A;  1SNM A;  1SJE D;  2QKI C;  4Y7N H;  3HOX B;  1CHQ D;  3TZU A;  1LTL A;  2DUD A;  1NR4 A;  1PRT F;  4KK7 A;  3RLO A;  4CKC A;  1HZA A;  4DF7 A;  4GNX C;  3CF5 A;  2O5I C;  4PG3 A;  2JEA I;  1W6K A;  3F2C A;  3F2D A;  3SDZ A;  2AMC B;  4A3E G;  1JOR A;  4CJ1 B;  3QWN A;  1HNW Q;  4IFD I;  3RZD H;  4HSV A;  4IO9 A;  4DK1 A;  4JI7 Q;  1ENF A;  2JE6 I;  2OTL A;  4JI8 Q;  5JEA G;  1JE4 A;  1QE6 A;  2B2V C;  1N32 L;  2NWG A;  1PH4 A;  1HA6 A;  1QWY A;  2K05 A;  1B44 D;  4P75 A;  5JPM C;  1BOS A;  1PA6 A;  4HR7 B;  2VQE Q;  1HZ9 A;  2F0U A;  3M4P A;  1PH2 A;  1F2M A;  4B08 A;  1VQ5 A;  5ISR A;  1F9R A;  4LF5 L;  1M90 C;  1K28 A;  4C3H H;  2VB3 X;  1Q90 A;  3T13 A;  1I3Q B;  3BDO A;  1V1O A;  2RF4 A;  4L5Q A;  4AYB B;  5C3X A;  4L5R C;  2PZU A;  3D6W A;  3S1Q H;  4A3M B;  2N3S A;  4OXP A;  3STB D;  2L4N A;  4KMU C;  4LUV A;  3GTQ B;  1D5X C;  1A0I A;  3QOJ A;  3K5N A;  1STG A;  5ELE A;  1YNN C;  3K5O A;  3H3V C;  5C4Z A;  1EWC A;  1TWA H;  4LFB Q;  1LAC A;  4C3I G;  2QCP X;  3VR5 A;  4X62 Q;  1OXT A;  1KHI A;  5KRU A;  2R93 H;  1E2V A;  1NMG A;  3OTO Q;  3A8K E;  5FOB B;  1CA5 A;  1WTX A;  1PTO F;  5FLM H;  1B1Z A;  4PZ7 A;  1BQQ T;  1S4Z A;  4K6L A;  1SYE A;  1S5B D;  1DJR D;  3VR3 A;  2IY5 B;  4OO1 H;  2NVT B;  1ILQ A;  4DU9 A;  2EPB A;  4GLV B;  5K36 G;  3CCV A;  3I4M G;  1LYL A;  1FGB D;  2UXD L;  1CI3 M;  2DY8 A;  4NXN L;  4N9P A;  4DR2 Q;  4HN7 A;  2D62 A;  3A55 A;  2A6H C;  5I6W A;  1AW7 A;  1NR2 A;  1SND A;  1TQO A;  2EVB A;  5I2Y A;  4A3J B;  4N8X 1;  2FMC A;  2F3V A;  3R2T A;  3KLR A;  2CW0 C;  4M8A A;  3HP3 A;  2Y0S E;  3S1R B;  3GTO B;  1PFM A;  1X3F A;  2K01 A;  1S3O A;  1UE6 A;  5K5P A;  4LF5 Q;  5IYD H;  1DZ1 A;  3GTJ H;  1ICF B;  1K0S A;  1LM0 A;  4IJL A;  5M3M H;  3PO2 G;  3JAM c;  1KDC A;  1Y8O B;  3SK4 A;  1PHJ A;  4A3G H;  3M3Y H;  4C3J H;  1GUS A;  3H0G H;  2KBN A;  2Q2U A;  1XNR L;  1HA5 A;  4LUO A;  3K7A B;  3FPP A;  5IT9 E;  3FRP B;  1VQH A;  2BH8 A;  2PYK A;  5KYI A;  1P8L A;  4ME5 A;  4XT3 B;  1M1K C;  4DFA A;  2RHS B;  1W2B A;  2QA4 A;  1X65 A;  1FJG L;  3GTL H;  2LXK A;  4WRD A;  3PF5 A;  2CH4 W;  4B3T Q;  2AWO A;  1EOT A;  1GHJ A;  1XPO A;  1DCZ A;  2F0W A;  1ENC A;  1T5X D;  1I50 B;  3NE5 B;  3MA2 B;  3Q23 A;  4J1M A;  4R4C A;  3NXW A;  2A1A A;  1G51 A;  4GOP A;  1AE2 A;  5ELD A;  4DK6 C;  2Z8L A;  3HOZ B;  1RCV D;  2B63 H;  3JAM i;  2CHB D;  4ZUI A;  1CQV A;  3U58 A;  1F9Q A;  2EJG C;  3PCO B;  2ICI A;  3CC7 A;  1ASY A;  3OYY A;  4BY7 H;  1NSN S;  2K5D A;  1KDB A;  1VQE A;  1BKB A;  4JOI A;  5BR8 L;  4YIJ A;  5DNF A;  2UUC Q;  2K5W A;  3OPO A;  1JR0 D;  5G3L F;  4NXN Q;  1YHQ A;  2Y0S G;  3KK7 A;  1N34 Q;  5ELN A;  3S15 B;  4HTH A;  3QIA A;  2EOT A;  2HCC A;  1K73 C;  1JCK B;  3S17 B;  4KY6 A;  4TQU S;  4XT1 B;  2LMC B;  1WVL A;  1Z47 A;  1PZI D;  1WCM G;  4JI2 Q;  2JA5 H;  1UE5 A;  4BXX G;  4IJH A;  4IPH A;  2F52 A;  1J6Q A;  5E4W C;  5DAU A;  2K28 A;  1S40 A;  1VQM A;  5FJ8 H;  3KDF A;  1DXM A;  2L1B A;  2LFN A;  4OEL B;  3TZD A;  1A8V A;  5CBA E;  1TWG H;  1LT3 D;  4A3K B;  4UP7 A;  3BS1 A;  1LT6 D;  1X3P A;  2PQA A;  4YWL A;  4DV1 L;  3IFD A;  3KLS X;  1K3B C;  3HEJ A;  1I4H A;  4ZYS A;  4DUZ L;  3KJP A;  4B9W A;  2F0V A;  2XRS D;  1PH5 A;  3T1H Q;  3AB9 A;  4CKB A;  4PQX A;  4A3D B;  3UE1 A;  2PNR C;  4LF7 L;  4UPA A;  1VQ6 A;  5I4D A;  3A7L A;  1FL0 A;  1VQP A;  4JBJ A;  3CPW A;  4MTN A;  4FYD A;  1FJG Q;  3KOJ A;  3CC2 A;  4B3S L;  1IL2 A;  4OWX B;  1PLF A;  1II3 A;  2PZT A;  2PZW A;  5EQ0 A;  1VQ7 A;  1RHP A;  1V8Q A;  2HHH L;  2F0N A;  3EJI A;  2D9U A;  1V1P B;  1BVS A;  4OON A;  1EYG A;  2BE5 D;  4M1U B;  2I07 B;  3AFP A;  4O1N A;  3CCM A;  4JI0 Q;  1IXR A;  5C44 G;  1J5E Q;  4K0K L;  2K6A A;  2LS0 1;  4EQO A;  3NWS A;  4A3F B;  2DJG C;  1RIP A;  4DPG A;  1Y1W G;  4R9W A;  1VF7 A;  1SNO A;  1YI2 A;  4HCE A;  2F0L A;  2M9V A;  1K3R A;  4S3S A;  4DR1 L;  1FD7 D;  2N55 A;  4DR6 Q;  4DR5 L;  3HFZ B;  1HXY D;  4F8M A;  3ERO A;  4QUF A;  4JV5 Q;  3L3O C;  1IBM Q;  2B2Y C;  5C5M A;  5C4X H;  3VA7 A;  3J7A 5;  2VL6 A;  4BY1 G;  3TME A;  2SEB D;  4G57 A;  4RHR A;  4K14 A;  1SYG A;  1SFO B;  1UAP A;  4KI0 A;  1STH A;  4IFD J;  4C3H G;  4Q5V A;  1C48 A;  1HJP A;  4JI5 L;  2HQL A;  5A2Q L;  4AIM A;  4DV1 Q;  4A3L H;  5C4J B;  5AFW A;  3I70 A;  1N36 Q;  1EU4 A;  2B2T C;  5IGF A;  4DUZ Q;  3S1M H;  2MUY A;  4KHV A;  1H9K A;  4K6D A;  4LF9 Q;  2B2U C;  3C2P A;  1VCI A;  4QMG A;  1SDF A;  3R8B A;  5JJK A;  4X64 Q;  4LF7 Q;  1C4Q A;  2VUM H;  1FR3 A;  3E9I A;  3QOL A;  3JAM E;  4DV4 Q;  3I8Z A;  2JA8 G;  1LTB D;  1HQM C;  5CC4 A;  2F0I A;  3G6E A;  3FDT A;  3UDF A;  4B3S Q;  1CKM A;  1LT5 D;  2VNU D;  2Z1C A;  3SK5 A;  1GUT A;  4NPS A;  1VQF A;  4EVO A;  1E2Z A;  5CV8 A;  1LTG D;  2XWB B;  2HHH Q;  3D6C A;  4RFB A;  1HFG A;  1BUV T;  5LMN Q;  2J7Z A;  2NN6 I;  3KF6 A;  3PV0 A;  1QOH A;  4LK1 C;  1WTR A;  3SR1 A;  1YZ6 A;  4K0K Q;  3H3V I;  3Q0A A;  1PXU A;  1G29 1;  1VQI A;  4FVM A;  2ZXP A;  4LFA Q;  3KFU A;  4GKJ Q;  5TSS A;  3DWP A;  2V1C C;  4IPC A;  4CJ2 C;  4FF1 A;  3S2H B;  1YNN D;  2GA4 B;  3BZK A;  3IRB A;  4DR5 Q;  2LY7 A;  4DXF A;  1P16 A;  3TS2 A;  5JOB A;  1MJC A;  1DD2 A;  4OX9 Q;  3FEW X;  1EY9 A;  1CKN A;  3HOV H;  4A3E B;  1SXT A;  4R4I A;  3A5U A;  5M3M G;  1G8Z D;  1MBY A;  2WIN B;  4OIK A;  2UUB L;  4A3C G;  2F0G A;  3CCL A;  1V1Q A;  4C3J G;  3QG1 A;  1DON A;  1A63 A;  4G7Z C;  2YU9 H;  3PGZ A;  3GTM H;  4KLK A;  1WFQ A;  4TVA B;  1AZQ A;  4LJZ C;  3S9W A;  1GHK A;  4L8J A;  3ZJY C;  2NZO A;  4F88 A;  2A73 B;  2PW5 A;  3IKJ A;  1HUN A;  1XMQ Q;  2JQO A;  2MQH A;  1VF5 C;  1T9H A;  1L0W A;  1RD9 D;  2PMZ B;  4NMZ A;  4WFN 3;  4FF4 A;  1Z9F A;  4MZ9 A;  1QNK A;  2OCE A;  2O5J C;  1QZG A;  3HKS A;  4XXE A;  1C9O A;  3EA6 A;  2ZJR A;  2RDG A;  1DOL A;  1H9S B;  1HZB A;  2QDL A;  3WWV A;  4GOP B;  3OMG A;  3BZD B;  3QJY A;  2B63 G;  3A5Z B;  4V19 0;  4C3I B;  3E5S A;  4K5W A;  3S16 H;  4DV7 L;  1EY5 A;  4BY7 G;  3NBH A;  4A3B G;  4B3M L;  4X3K A;  5CYU A;  1LTT D;  3CQZ B;  4P2C B;  5FO9 B;  4ID6 A;  5C0X H;  5KND A;  1DGS A;  2XWJ B;  1JOK A;  1MIU A;  3MXG A;  3VYR A;  1S72 A;  4PZ6 A;  2IX1 A;  3F2B A;  2KA7 A;  1QUQ A;  1OO9 B;  3I4M B;  5LMU Q;  3RN5 A;  3KDF B;  2VXW A;  2MNA A;  2EYP A;  2SNM A;  1XTD A;  2UUA Q;  1SN8 A;  3NTK A;  4OIJ A;  3L9A X;  2A19 A;  2PQA B;  4UP9 A;  1SYF A;  3A8J E;  3S2D H;  3GDE A;  2XGT A;  1EY7 A;  3I4O A;  2R61 A;  1PV4 A;  3A54 A;  3FKI H;  1EFW A;  3GTK B;  3FHW A;  1T5E A;  2L9H A;  3C3L A;  1TII D;  2EQS A;  4RKB A;  1I94 L;  5EKK A;  4QJF A;  3TP5 A;  2Z4H A;  4BBR H;  3PO2 B;  5J22 A;  2ZTD A;  2LKV A;  4R8I A;  3MC0 B;  1QJO A;  2K5V A;  4DUY Q;  2QEX A;  3M4O B;  5CR3 A;  1PTO H;  3W1G A;  2KCN A;  3CP0 A;  2Z6K A;  1XJV A;  2NTS A;  4LF4 Q;  1HNW L;  2JN4 A;  1B2T A;  4JK1 C;  1X32 A;  3J81 i;  1D7Q A;  2NVY B;  3BVM A;  4JI7 L;  1ZYR C;  2HDL A;  1ROD A;  3LWU A;  4KY7 A;  4JI8 L;  1WYD A;  1SRO A;  3RLF A;  4B3M Q;  2OXP A;  1N33 L;  1FNU A;  1A15 A;  5I2X A;  1PRT D;  4DA2 A;  1HUM A;  1ZEQ X;  2XIW A;  2VQE L;  3K57 A;  2KHI A;  1C7Y A;  5IT9 c;  3K6O A;  4K2L A;  4H02 A;  4POF A;  4NP5 A;  2RKS A;  2NB0 A;  1H9M A;  1IBK Q;  3MXU A;  1BNZ A;  3MWY W;  3T1Y L;  1IKL A;  4OWT B;  2FFK B;  2J4X A;  1K8M A;  2IHE A;  1YHA A;  3U4Z A;  5ELC A;  3K5L A;  1HZC A;  3RLN A;  4DAV A;  3PIO A;  4A3L G;  2DJF C;  2Y0S B;  3Q24 A;  3Q22 A;  3E3X A;  2ZJP A;  3HOX H;  2XSC A;  4KKT A;  1FVI A;  3LGJ A;  4LFB L;  1JQY D;  2JJQ A;  5IOC A;  3VR2 A;  1WCM B;  4BBS H;  3K7U C;  5GAG C;  1K83 B;  2EYH A;  1EQR A;  1L1O A;  4YWM A;  1O7I A;  5DLQ E;  2K03 A;  3OTO L;  1I94 Q;  1VQN A;  4A93 H;  4I7A A;  4U68 A;  5M3F H;  3RMH A;  1B4O A;  4IAL A;  4X66 Q;  3H91 A;  2BH2 A;  2ENB A;  2KJX A;  2VZA A;  5IWA Q;  1G6P A;  1ET9 A;  2K33 A;  3ITP A;  2K52 A;  3GV6 A;  1C0A A;  5F2D A;  4GKK Q;  1LO5 D;  2E2I B;  2KHS A;  4DAY B;  4HJ8 A;  1HTL D;  2B2W A;  1IYU A;  4DR2 L;  1KL9 A;  1TKW B;  3TDQ A;  3H94 A;  3L2P A;  5KIX A;  1HNZ Q;  1PTO D;  2EJF C;  4Y7N B;  2F0O A;  1N33 Q;  1Z6H A;  3K8A A;  1FGU A;  3PIP 3;  4LW1 A;  1JIC A;  1YIJ A;  4A3M H;  3GTQ H;  5M5X H;  5C44 B;  3D4D A;  1QZH A;  3T1Y Q;  4HIO A;  3ULJ A;  3A74 A;  4JYA Q;  4RCO A;  1Y1W B;  4L5T A;  2L5T A;  2WKD A;  3TQY A;  3RZD B;  3GTP B;  2NVQ B;  2R7D A;  4AH6 A;  2V4D A;  1QB5 D;  1I5F A;  3M4Y A;  1MD2 D;  3OW2 A;  1VQA A;  5AJ3 Q;  2HT1 A;  1WI5 A;  4DV6 Q;  5C6A A;  1HH2 P;  4RA8 A;  1ESF A;  3HOU H;  2OF1 A;  1HHV A;  4BY1 B;  2A69 C;  1EYA A;  1GXD C;  1Y8P B;  3SK8 A;  4H7B A;  3J81 E;  4B3T L;  1IW7 C;  5IP9 G;  1VQ4 A;  2JA6 H;  4C3H B;  5IYC G;  1EOV A;  2L15 A;  4CJ0 B;  3KF8 A;  3V96 A;  1X3Q A;  4HAE A;  5M9O A;  4FF2 A;  4N9T A;  4KD3 A;  2WV6 D;  5EJW A;  1RJT A;  1QVG A;  3S1Q B;  2ZXR A;  5JJL A;  1AP0 A;  3NPP A;  4PMC A;  1EEF D;  1K8G A;  2E2H H;  2ATW A;  4DK0 A;  3J80 L;  4I7Z C;  3KBG A;  1TS2 A;  2MJ8 A;  1TU2 B;  3I90 A;  4A3J H;  3T51 B;  1B53 A;  1VQB A;  1VQD A;  4C1N I;  1Y1V G;  1EIY B;  1YNJ C;  2JA8 B;  4NXM Q;  2UUC L;  3MEF A;  1LTS D;  1EY6 A;  1D5Z C;  1N34 L;  2OT2 A;  5CV9 A;  1LTI D;  4QL5 A;  3CCQ A;  2WB1 E;  1NMF A;  4RCN A;  4PZ8 A;  4CDF C;  4J6H A;  2EE1 A;  1FYC A;  1D1I A;  2F0E A;  4LUZ A;  4NB3 A;  4JI2 L;  3FP9 A;  4DR7 Q;  1GVP A;  1X3E A;  2LSS A;  1CM9 A;  4JBW A;  1KRS A;  2EJM A;  2F1M A;  3GO5 A;  5C3W A;  1WTW A;  1B8A A;  3TSS A;  4RMF A;  5C0X G;  3BVG A;  4DAP A;  3W5O A;  4OHJ A;  1B70 B;  5G3L D;  3T1H L;  2Q8I B;  4FF3 A;  5IIF A;  1KAW A;  4BS9 A;  4UAI A;  4EQ5 A;  3K0Y A;  1PMR A;  1TWC H;  4O42 A;  3PO3 G;  3HOW G;  1RL2 A;  2CKZ B;  4JI1 Q;  3DMU A;  4JPB W;  2E75 C;  2FMM A;  3K0X A;  4QUC A;  3FKI G;  3KBX A;  5KYL A;  3EQL C;  3I4N G;  1BXT A;  3H09 A;  2DN8 A;  3GTJ B;  5EPL A;  4YY3 L;  5M3M B;  1STA A;  4IOC A;  1F2L A;  5JEA J;  4AQY Q;  4BBR G;  1FNV A;  1J9O A;  4KV6 A;  4IQZ A;  4R4O A;  3TRZ A;  3P1H A;  3M3Y B;  3W3A A;  3CKI B;  4C3J B;  2UXB Q;  2XNA C;  4JI0 L;  3MXN A;  4RGT A;  4DR3 Q;  3VDY A;  2KOL A;  2RHQ B;  1TY0 A;  1J5E L;  1QVC A;  1GD7 A;  3E6Z X;  1PFB A;  5C3E G;  3S17 H;  1EY4 A;  2WB1 G;  4O0A A;  1G2T A;  2KEE A;  3CRK C;  3VR4 A;  1IYV A;  1XPR A;  1A2U A;  2B29 A;  4DR6 L;  1Q3L A;  3GTL B;  4LFC Q;  1I6V C;  1PYB A;  3BVZ A;  2D0O A;  4JV5 L;  1NCV A;  1IBM L;  4QCL A;  3U9O A;  3O13 A;  3R3O A;  2PPB C;  1YVC A;  2R92 H;  4KHP L;  4ZCK A;  4YCW A;  1Q12 A;  1OXU A;  2B63 B;  2AUK A;  1GOZ A;  2C9O A;  2WP8 J;  4C2M H;  3F2U A;  1KNE A;  1N36 L;  2A6E D;  4L63 B;  4BY7 B;  4ULL A;  1KDA A;  4GOP C;  5IGG A;  4LF9 L;  1W6J A;  4A3B B;  4X64 L;  4WJ4 A;  2JA7 H;  1GM5 A;  1ZYR D;  3OMC A;  5C5L A;  4DV4 L;  5E7N A;  2G9D A;  2BDO A;  3ULL A;  3MEH A;  1PYW D;  1SE3 A;  2YTV A;  4JOI C;  2HUG A;  4BBS G;  1MI2 A;  5I9P A;  2I0Q A;  2ID0 A;  4CHT B;  4F87 A;  2EYM A;  3D4R A;  2UU9 Q;  4LF6 L;  1NUC A;  4YY3 Q;  5LMN W;  2R6G A;  2NN6 H;  4A93 G;  5M3F G;  5E3F A;  1TWG B;  3B6Y A;  1BCP C;  1KTK A;  3L7Z C;  1SLJ A;  3H3V H;  3NP8 A;  4P73 A;  2B2Y A;  3PIP A;  1O7L A;  2CH4 A;  3CAM A;  4XDX A;  5LMN L;  2ZT9 C;  1RF2 D;  2WFW A;  1QNU A;  2IT1 A;  2AQ3 B;  2PO4 A;  3BDC A;  1WTH A;  4LFA L;  1DM0 B;  4PNY A;  1XNQ L;  4GKJ L;  1VQO A;  1MGS A;  4RWS C;  1MSG A;  2F0J A;  2A68 C;  2B2T A;  1S5C D;  2DY7 A;  1U4R A;  3C46 A;  5D65 A;  4ODG A;  3TRE A;  1WTQ A;  5BN4 A;  1PH7 A;  3SGI A;  3DM3 A;  1H95 A;  3S1N H;  1G6Z A;  2R7Z H;  1SRU A;  5EBC A;  1BBU A;  1X6O A;  1K8O A;  3CW2 C;  1PH3 A;  4OX9 L;  3D4W A;  3DWQ A;  1HTP A;  2IHF A;  1UUP A;  4KHP Q;  1VS0 A;  2CQO A;  4BA1 I;  1TVX A;  1SMY C;  2M00 A;  3MTS A;  4APV A;  1WOC A;  4DR4 Q;  1I4Q A;  2GVA A;  4IUR A;  4JI3 L;  1FNW A;  2OEO A;  3U50 C;  3CCJ A;  1E1T A;  3R2I A;  4QY7 A;  1PH6 A;  4E6I A;  1NTG A;  3NEN A;  5HUR A;  2AKW B;  3QO2 A;  1R9T B;  1CSP A;  2F0P A;  5I6Y A;  1CZG A;  1XMQ L;  3CME A;  3OWF A;  3HOU G;  3DEP A;  1ESR A;  3HRZ C;  2R93 G;  4G7O C; 
#chains in the Genus database with same CATH homology
 1E1O A;  4JI8 Q;  1XTD A;  5JEA G;  2UUA Q;  1SN8 A;  1N32 L;  4LF6 Q;  2JA6 G;  1PH4 A;  2A19 A;  5FLM G;  2PQA B;  4UP9 A;  3CMA A;  1Q7Y C;  4P75 A;  1CKO A;  1PA6 A;  1BBW A;  2VQE Q;  1HZ9 A;  2K5N A;  3M4P A;  1PH2 A;  4A3K H;  3S2D H;  2EIF A;  3GDE A;  2XGT A;  1VQ5 A;  3BZC A;  3I4O A;  4LF5 L;  4HIM A;  1PV4 A;  1M90 C;  4GLA C;  3FKI H;  4C3H H;  1EFW A;  4OO1 G;  5IP7 H;  3FHW A;  4OO1 I;  4A75 A;  2RF4 A;  5IYB G;  1VQG A;  4L5Q A;  2UXD Q;  4DV0 Q;  1YHB A;  4A3B H;  3UDG A;  2EQS A;  4L5R C;  1XNQ Q;  4A3D H;  4ALP A;  4IFD G;  3S1Q H;  1I94 L;  2ASB A;  4QJF A;  1SE8 A;  1YBY A;  4AYB E;  2N3S A;  4OXP A;  1E24 A;  1KC8 C;  4BBR H;  4DR4 L;  3STB D;  2YTY A;  2ZTD A;  2IX0 A;  4LUV A;  4YHH Q;  4JCV E;  2K5V A;  1A0I A;  4XIG S;  2OWO A;  3GTG H;  4GLX A;  4DUY Q;  2QEX A;  4A3E H;  3STB C;  4LNQ A;  1ASZ A;  1TWA H;  3W1G A;  4LFB Q;  1K8A C;  3HOX G;  1E7Z A;  3CP0 A;  4X62 Q;  5GAD C;  2C35 B;  2Z6K A;  1XJV A;  1OXT A;  4GNX B;  4LF4 Q;  1KHI A;  1HNW L;  2R93 H;  4JBM A;  5IYD G;  1TWF H;  3J81 i;  1NMG A;  3OTO Q;  1D7Q A;  4QGU A;  2CWA A;  4JI7 L;  5LMU L;  1TWH H;  5FLM H;  1XNR Q;  1HR0 W;  4A3I H;  2GVB A;  5HY6 A;  4JI8 L;  1WYD A;  4PZ7 A;  1L1O B;  1SRO A;  3RLF A;  1NJI C;  2UUA L;  4B3M Q;  4JI4 L;  4POG A;  2JEB I;  3EN2 A;  4JC0 A;  4JI3 Q;  1N33 L;  4A3G G;  3D0F A;  4HJ5 A;  4A3F H;  3H0G G;  3I56 A;  2IY5 B;  1HR0 L;  1JE5 A;  2PI2 E;  2VQE L;  2KHI A;  1C7Y A;  3W1B A;  5IT9 c;  4GLV B;  4H02 A;  4POF A;  3TS0 A;  5K36 G;  3HOY H;  2K75 A;  3JC6 6;  3CCV A;  1IBK Q;  3I4M G;  1LYL A;  2PNH A;  5JJI A;  1NBW A;  1X3G A;  2CWP A;  2QGQ A;  4DV5 Q;  3T1Y L;  2UXD L;  5C0X J;  4OWT B;  3CC4 A;  4NXN L;  1W3S A;  1YEZ A;  2IHE A;  4DR2 Q;  3RZO H;  2D62 A;  1OXV A;  4MNO A;  3AEV A;  1YHA A;  1UEB A;  3U4Z A;  1V9P A;  3E0E A;  4IPD A;  1HZC A;  4GS3 A;  3RLN A;  3H15 A;  1SFO H;  1JT8 A;  3PIO A;  4A3L G;  4DUY L;  2ZJP A;  1GKH A;  3HOX H;  2Y0S E;  3TEH B;  1X3F A;  1FVI A;  1XPU A;  1S3O A;  1UE6 A;  3LGJ A;  2VQF L;  1HNX Q;  3ICE A;  1D8L A;  2JJQ A;  4DK3 C;  4LF5 Q;  4AYB G;  5IYD H;  5FLX c;  3GTJ H;  5C4J H;  4BBS H;  1LUZ A;  3K7U C;  1LM0 A;  4IJL A;  4DNI A;  1U5K A;  5GAG C;  5M3M H;  3EBE A;  1EQR A;  1L1O A;  4A3M G;  4LF4 L;  2NVX H;  5BR8 Q;  4YWM A;  3JAM c;  1O7I A;  4UY8 C;  3PO2 G;  5DLQ E;  2K50 A;  2OTJ A;  3OTO L;  1PHJ A;  4A3G H;  1XMO L;  1I94 Q;  1VQN A;  3M3Y H;  4C3J H;  4A93 H;  3H0G H;  5M3F H;  2KBN A;  4A76 A;  2Q2U A;  1XNR L;  1UE1 A;  4LUO A;  1R9T H;  1JJC B;  4X66 Q;  2BH2 A;  1VQH A;  1X55 A;  2VZA A;  2R7F A;  2BH8 A;  5IWA Q;  2KCM A;  1G6P A;  1P8L A;  2K52 A;  1Q1B A;  1EWI A;  1M1K C;  2RHS B;  3F1Z A;  1C0A A;  1W2B A;  2QA4 A;  1X65 A;  2WAQ E;  1IBK L;  2JA5 G;  1N8R C;  1FJG L;  2LXK A;  2Q2I A;  3GTL H;  3PF5 A;  4GKK Q;  1KIX A;  4DV5 L;  1YJ9 A;  1KD1 C;  2R92 G;  4B3T Q;  4DAY B;  4HJ8 A;  2MO0 A;  2AWO A;  2MO1 A;  5FJ8 G;  4EX5 A;  1XPO A;  3AQQ A;  4DR2 L;  1KL9 A;  2HIX A;  3BJU A;  3PUV A;  3M4Q A;  3L2P A;  3GTK H;  4R4C A;  1HNZ Q;  2AWN A;  2A1A A;  3D31 A;  3J81 c;  1G51 A;  4JI4 Q;  4B3R Q;  5J3B A;  4HJ9 A;  1N33 Q;  4GOP A;  3K8A A;  1AE2 A;  2E2J H;  3J7Z C;  1FGU A;  1JMC A;  2YTX A;  4LW1 A;  4DKA C;  1HR0 Q;  4DK6 C;  4GN3 B;  3KF8 B;  1YIJ A;  1KXL A;  4A3M H;  3S2H H;  2B63 H;  4YWK A;  3JAM i;  3PO2 H;  1L2F A;  2JA7 G;  3PUZ A;  3U58 A;  3GTQ H;  3PCO B;  3PUW A;  3I55 A;  5M5X H;  3CC7 A;  1ASY A;  3OYY A;  4BY7 H;  3EIV A;  1VQE A;  3CCR A;  1BKB A;  2Q2H A;  4JOI A;  5BR8 L;  3T1Y Q;  4FDB A;  1QZH A;  1JB7 A;  1IBL Q;  4HIO A;  1X54 A;  2UUC Q;  3ULJ A;  5HGQ A;  4NXN Q;  3A74 A;  4JYA Q;  4A3J G;  1YHQ A;  2Y0S G;  1Y14 B;  2OQK A;  4X65 Q;  1N34 Q;  4L5T A;  5ELN A;  3L0O A;  3ERS X;  4X66 L;  3TQY A;  1K73 C;  3M9B A;  3RNU A;  4IOA A;  2K4K A;  2DGY A;  2OQ0 A;  2R7D A;  4P71 A;  4TQU S;  3UDI A;  2D0P A;  4AH6 A;  2F4V L;  1JJG A;  5IWA L;  1I5F A;  3OW2 A;  1Z47 A;  1VQA A;  1WCM G;  2BA1 A;  2NVY H;  4JI2 Q;  1UE5 A;  3AYH B;  2JA5 H;  5AJ3 Q;  4BXX G;  4IJH A;  4IPH A;  2F52 A;  1J6Q A;  1WI5 A;  4DV6 Q;  2HT1 A;  2VQF Q;  1HH2 P;  5H1S E;  2JA6 H;  1S40 A;  1VQM A;  3HOU H;  5FJ8 H;  3KDF A;  3UE0 A;  1A8V A;  4GKK L;  1TWG H;  1U0L A;  4UP7 A;  4HIK A;  4B3T L;  5IP9 G;  2PQA A;  4YWL A;  4DV1 L;  1VQ4 A;  1XMO Q;  4DR1 Q;  5IYC G;  1B7Y B;  1EOV A;  2L15 A;  3I7F A;  2ZJQ A;  2K5H A;  3I2Z A;  4DUZ L;  3S14 H;  3KJP A;  1PH5 A;  3T1H Q;  1HNZ L;  4B3R L;  1V43 A;  2WAQ G;  1QVG A;  3UE1 A;  3PF4 A;  3CXC A;  4LF7 L;  4UPA A;  5JJL A;  1VQ6 A;  1FL0 A;  2LXJ A;  2ZM6 Q;  1K8G A;  1VQP A;  2N49 A;  4GN5 A;  4JBJ A;  5IYB H;  3CPW A;  2E2H H;  2ATW A;  4X6A H;  3J80 c;  4MTN A;  5C4X G;  5M5Y H;  2R7Z G;  1FJG Q;  3KOJ A;  4A3J H;  1EIY B;  1VQB A;  1VQD A;  3CC2 A;  1Y1V G;  2CCZ A;  4B3S L;  1IL2 A;  4JI5 Q;  4OWX B;  1IBL L;  4A4I A;  4NXM Q;  3F8T A;  2UUC L;  3MEF A;  1PFS A;  4JYA L;  2AHO B;  3A0J A;  4X65 L;  1N34 L;  1YNX A;  2BA0 A;  3CD6 A;  2N8N A;  3GD7 A;  4QL5 A;  1WCM H;  3CCQ A;  2WB1 E;  1VQ7 A;  4R4Q A;  2I5M X;  3K81 C;  2HHH L;  1K83 H;  4JI6 L;  3HOZ G;  4BXX H;  3HKZ E;  1NMF A;  2YYZ A;  1BVS A;  3E9H A;  4OON A;  4PZ8 A;  1EYG A;  1K0R A;  2JA9 A;  4C3I H;  4GNX A;  3AFP A;  4LUZ A;  3CCM A;  4NB3 A;  4JI0 Q;  3NEM A;  4JI2 L;  1IXR A;  5C44 G;  5AJ3 L;  2ZTE A;  3FP9 A;  4DR7 Q;  4DV6 L;  2E5L Q;  1J5E Q;  1GVP A;  2H5X A;  1X3E A;  2LSS A;  4K0K L;  4JBW A;  1KRS A;  2Z6K C;  3GO5 A;  1B8A A;  5IP9 H;  2VUM G;  2UXC Q;  1TXY A;  4RMF A;  5C0X G;  1RIP A;  5IYC H;  4DPG A;  1Y1W G;  3MXN B;  1YI2 A;  1I6H H;  4PMW A;  4Y52 H;  2PI2 A;  3CQZ H;  2KEN A;  3W5O A;  1K3R A;  4DR1 L;  2NZH A;  2I5L X;  1PH1 A;  3S24 A;  4DR6 Q;  1B70 B;  4DR5 L;  4GN4 B;  3T1H L;  3KYH C;  4LF8 Q;  3HFZ B;  1CUK A;  1Q82 C;  1KAW A;  2XTI A;  1VQ9 A;  4JV5 Q;  4J15 A;  4EQ5 A;  1IBM Q;  2F4V Q;  1TWC H;  3J80 i;  4DV2 Q;  5C4X H;  2K14 A;  3I4M H;  3HOW G;  1RL2 A;  2CKZ B;  1X56 A;  4JI1 Q;  2VL6 A;  4BY1 G;  3J7A 5;  3PO3 G;  1PVO A;  2ZM6 L;  4WJ3 M;  1Y1V H;  2E8G A;  4A3K G;  1OXX K;  1N9W A;  3K0X A;  4OWW B;  4KI0 A;  1Q1E A;  4IFD J;  3FKI G;  5IP7 G;  1AH9 A;  3KF6 B;  1HJP A;  4JI5 L;  1K9M C;  2HIV A;  2HQL A;  3KLW A;  3AFQ A;  4XTC S;  3UDX A;  3DLL A;  1VQL A;  4NXM L;  2ZTC A;  4AIM A;  3I4N G;  1WJJ A;  4DV1 Q;  2A8V A;  4A3L H;  4A3D G;  3J81 j;  1N36 Q;  3G4S A;  4YY3 L;  4DUZ Q;  3K80 C;  3S1M H;  4IOC A;  3PUX A;  5JEA J;  4AQY Q;  4BBR G;  3PSI A;  5C44 H;  1I3Q H;  1X9N A;  1KRT A;  4LF9 Q;  1VCI A;  5JJK A;  3PUY A;  1HNX L;  4R4O A;  4X64 Q;  3TRZ A;  2VW9 A;  2UXB Q;  4LF7 Q;  2N78 A;  4IPG A;  2VUM H;  1Q81 C;  4JI0 L;  3E9I A;  4DR7 L;  4DR3 Q;  4DV4 Q;  3RR5 A;  3VDY A;  2E5L L;  1Y1W H;  2RHQ B;  1J5E L;  2ES2 A;  1QVC A;  2JA8 G;  1GD7 A;  3G6E A;  1L1O C;  5C3E G;  2UXC L;  3GTP H;  2NVQ H;  3CPF A;  3S17 H;  3UDF A;  4B3S Q;  2WB1 G;  1CKM A;  4O0A A;  2VNU D;  5GAH C;  1MKH A;  3M4O H;  3HKZ G;  4DV3 L;  2UUB Q;  4NPS A;  1XPR A;  1VQF A;  3HOV G;  1YJW A;  2B29 A;  2EXD A;  1CKN B;  5GRO A;  4DR6 L;  4LFC Q;  3PO3 H;  1PYB A;  3HOW H;  4A3I G;  4LF8 L;  4R4T A;  2HHH Q;  4BY1 H;  4JI6 Q;  2D0O A;  4JV5 L;  5IE8 A;  1IBM L;  2NN6 G;  4DV2 L;  4A3F G;  5LMN Q;  1UWV A;  2NN6 I;  3KF6 A;  4JI1 L;  3PV0 A;  1EUJ A;  1YVC A;  1YZ6 A;  2R92 H;  3H3V I;  4K0K Q;  1G29 1;  3I4N H;  1VQI A;  4KHP L;  4LFA Q;  1YJN A;  4YCW A;  1Q12 A;  1JJ2 A;  1Q46 A;  4R1J A;  1OXU A;  3HOY G;  3KFU A;  4GKJ Q;  3M7N A;  2Z0S A;  2KCT A;  2V1C C;  1E3P A;  1VQJ A;  4IPC A;  2NVT H;  2WP8 J;  2JK8 A;  4C2M H;  1PH8 A;  1N36 L;  5M5W H;  1VQ8 A;  3BZK A;  3IRB A;  4JG2 A;  5GAE C;  1SR3 A;  4DR5 Q;  4GOP C;  4AQY L;  4LF9 L;  4P72 A;  1VQC A;  3NEL A;  1P16 A;  1CSQ A;  2JA8 H;  4X64 L;  4WJ4 A;  2JA7 H;  3TS2 A;  1GO3 E;  2UXB L;  5C3E H;  1GM5 A;  2MFI A;  4DR3 L;  1MJC A;  5E7N A;  4DV4 L;  3G71 A;  1OTC A;  4OX9 Q;  4O2D A;  3ULL A;  1YIT A;  4QIW E;  5IY0 A;  4BA2 I;  4KHZ A;  1SMX A;  1CKN A;  2YTV A;  4JOI C;  3CCU A;  1OXS C;  3HOV H;  4BBS G;  1IYJ B;  4R4I A;  3A5U A;  5M3M G;  4DV7 Q;  1QVF A;  2VY3 A;  2I0Q A;  2ID0 A;  2UUB L;  3S1R H;  4P74 A;  3GTO H;  4A3C G;  4QQB X;  3CCL A;  5GQO A;  2CFM A;  2UU9 Q;  4LF6 L;  1V1Q A;  2F3I A;  4LFC L;  4YY3 Q;  2R6G A;  5LMN W;  1KQS A;  4A93 G;  5M3F G;  3B6Y A;  3Q8D A;  1UE7 A;  1A63 A;  3L7Z C;  2YU9 H;  1SLJ A;  4UP8 A;  2ALY B;  3PGZ A;  3H3V H;  4P73 A;  4KLK A;  3PIP A;  1WFQ A;  4TVA B;  3G48 A;  3NBH B;  3GTM H;  3CAM A;  3ULP A;  5LMN L;  5EAY A;  5ELO A;  2WFW A;  2IT1 A;  1VQK A;  3ZJY C;  2NZO A;  3CCS A;  2KHJ A;  1XMQ Q;  2JQO A;  2MQH A;  3K7A H;  4DV0 L;  4RG1 A;  4YCU A;  4LFA L;  1T9H A;  1L0W A;  1XNQ L;  2Q2T A;  5C0X I;  1VQO A;  4GKJ L;  1A62 A;  1EQQ A;  1IZ6 A;  1PYS B;  4DV3 Q;  1Z9F A;  1EIF A;  4MZ9 A;  1Q8K A;  2PMZ E;  4YHH L;  2OCE A;  1QUQ B;  2VS1 A;  3ER0 A;  1QZG A;  1N32 Q;  3HKS A;  2B3G A;  4HID A;  4DAM A;  1C9O A;  2ZJR A;  4HJA A;  1MJE A;  3TRE A;  3U4V A;  2E2I H;  1PH7 A;  3SGI A;  3DM3 A;  1H95 A;  2I5H A;  3S1N H;  1HZB A;  2RCN A;  3CCE A;  4ME3 A;  1E22 A;  3WWV A;  1SRU A;  4L5S A;  2R7Z H;  4GOP B;  3BU2 A;  1NE3 A;  1I50 H;  1Q86 C;  4X62 L;  1BBU A;  1X6O A;  2YV5 A;  3CW2 C;  4JBK A;  1PH3 A;  4OX9 L;  2IHF A;  4HJ7 A;  2B63 G;  3A5Z B;  2GN5 A;  4A3C H;  4KHP Q;  4Y7N H;  1VS0 A;  2CQO A;  4BA1 I;  3S16 H;  4DV7 L;  1LTL A;  4BY7 G;  2DUD A;  3HOZ H;  4APV A;  1WOC A;  4DR4 Q;  1NY4 A;  4A3B G;  3RLO A;  2FXQ A;  4B3M L;  4LFB L;  2GVA A;  4JI3 L;  2UU9 L;  3U50 C;  1HZA A;  3CCJ A;  1PH9 A;  1E1T A;  4LWC A;  4QY7 A;  4GNX C;  3CF5 A;  1PH6 A;  4PG3 A;  1NTG A;  3NEN A;  2JEA I;  3F2C A;  3F2D A;  3RN2 A;  2AMC B;  1DGS A;  2AKW B;  4A3E G;  1CSP A;  1MIU A;  4YCV A;  3S15 H;  1AE3 A;  4PZ6 A;  3KJO A;  1S72 A;  2IX1 A;  3F2B A;  3CME A;  1XMQ L;  4IFD I;  1QUQ A;  3RZD H;  1HNW Q;  4IO9 A;  3HOU G;  4JI7 Q;  3M85 A;  2R93 G;  5LMU Q;  3RN5 A;  3KDF B;  2JE6 I;  2OTL A;  2MNA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...