2NVXH

Rna polymerase ii elongation complex in 5 mm mg+2 with 2'-dutp
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
146
structure length
134
Chain Sequence
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
total genus 16
structure length 134
sequence length 146
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2nvxH00
2LXKA 1G291 1Z9FA 3I2ZA 4LUOA 4L5SA 4KHPQ 1VQFA 4X65Q 3AQQA 2UXBQ 5LMUQ 2A8VA 1J6QA 5E7NA 5J3BA 3CC7A 1XPUA 2GN5A 4JI7Q 3FP9A 4A3KH 2ATWA 2HIXA 2RHQB 1NTGA 4J15A 3GTKH 2WFWA 1A62A 4OX9L 4MTNA 3BJUA 3G4SA 4XIGS 1EUJA 3ULPA 1W3SA 3KLWA 3KYHC 2MO0A 4IJHA 4B3RQ 1D7QA 3OTOL 3Q8DA 4DV6Q 5C4JH 3A74A 3D0FA 3CW2C 1AE2A 2HQLA 5ELNA 4OONA 4DR4L 1EIYB 3HOVG 4B3MQ 1Q1EA 2RCNA 1U0LA 1JE5A 1Q8KA 1TWGH 5HGQA 4IO9A 2AMCB 2F3IA 4IOCA 1XPOA 4A75A 3PF4A 4A3DH 1QZGA 4AYBG 1HR0Q 2R7DA 1FVIA 1K0RA 1MJCA 2OTJA 1OXTA 4LF4L 1SR3A 3L0OA 1N36L 3W5OA 4IPGA 4A3BG 3B6YA 5C0XI 1HZCA 3CCQA 1T9HA 4MZ9A 2R92H 1TWHH 5IE8A 2HIVA 4QJFA 1E1TA 2NVQH 2NVTH 2ZTCA 3IRBA 1VQEA 3PO3H 4QQBX 1FJGL 5BR8Q 2MO1A 3NELA 2VQFL 1E22A 1NE3A 2ES2A 2JA7H 3GTJH 2NN6I 4X62Q 4K0KL 1K8AC 1Y14B 2ZTDA 3CPFA 3KF8B 5FJ8G 4PMWA 3G6EA 3DLLA 1YJWA 3M3YH 4LFBL 2JA6H 2PI2A 1AH9A 1YBYA 1A8VA 3JAMc 3TS0A 5EAYA 4B3SQ 3G71A 4NXMQ 1D8LA 4C3HH 1L1OB 1X55A 3L2PA 4DV5L 3S2HH 4JI5L 1YJNA 5LMNW 4ME3A 2EQSA 1PH2A 5DLQE 2Y0SG 1B70B 4EX5A 1SROA 2H5XA 4JI3Q 1VQBA 3CC2A 4GN4B 4LF5L 4X6AH 3PV0A 5LMNL 1I50H 4DR1Q 2E2IH 3UDIA 2KBNA 1DGSA 2VZAA 4IJLA 3M85A 1HNXQ 1JJGA 4BY7H 3KF6B 2L15A 3U50C 4BBRG 1XMOL 1A63A 1YIJA 3I55A 3HOYH 1R9TH 1VQLA 3CD6A 1VQIA 4DUYL 5C4XH 1SN8A 3PSIA 3BU2A 2F4VL 1XPRA 1MIUA 2WAQE 4DV7L 1N8RC 4DUZQ 3GTGH 4IOAA 4JYAL 4RG1A 3CF5A 2KCMA 4AYBE 5IP7H 3A5UA 2IT1A 4LW1A 3HOXH 4GN3B 3T1HQ 1QVGA 4A76A 4A3FG 4A3CG 4A3LG 5GAEC 1X56A 2CCZA 3CMEA 4JI8L 1E3PA 2VS1A 5M3FH 2BH8A 2R7ZH 4P71A 1GVPA 2Q2TA 3F2BA 4GLXA 4JBWA 5H1SE 5AJ3L 1G6PA 1LM0A 4YY3L 3AFPA 3CQZH 4X64L 1KRSA 2VQEL 1PH8A 4NXNQ 2N8NA 2QEXA 4GKJQ 4PZ6A 2UU9Q 1AE3A 2K75A 1SRUA 2AWNA 1XMQL 4YHHL 1N34Q 1Y1VG 3H0GH 1VCIA 4WJ4A 1VQAA 1S40A 1K9MC 3UDXA 3S1MH 2UUCL 1CUKA 3E9HA 1WCMG 2GVAA 4YWLA 5IYCH 1X9NA 1VQMA 1EQQA 3TEHB 4DV1Q 2OCEA 3NENA 4LFAQ 3MEFA 3RN5A 2E2JH 1JJ2A 3HOZG 3J81j 2Q2IA 1I5FA 2R6GA 2XTIA 3UDGA 1PFSA 1XNQQ 2Y0SE 2VY3A 5GAGC 4O2DA 1EOVA 3I4MG 4A3MH 2N78A 4WJ3M 1J5EL 2D0OA 1JB7A 4OWTB 4A3GH 3CMAA 2UXDQ 1HZBA 2V1CC 4GOPA 5JJLA 1M1KC 4DV0L 1LTLA 4IPCA 4JI1Q 2HHHL 3HOWG 1VS0A 4DR3Q 4A3KG 3KF6A 1WJJA 5IYBH 3RZDH 3I4NH 3ULJA 4LWCA 4HJ8A 1PH7A 2E5LQ 2NVYH 3KDFA 4JI0L 2UUAQ 4JI6Q 3ZJYC 4DV4L 2LSSA 1VQKA 3K7AH 1N33Q 1HNWQ 5C44H 3H3VH 5IWAQ 3JC66 2D0PA 2K4KA 3KJPA 4C3IH 3CPWA 3I56A 2UXCL 1CKMA 3TS2A 2JA5H 2GVBA 1H95A 2N49A 1Q1BA 4YWKA 4A3IH 1XNRQ 2NZHA 2JA8H 4YCVA 3U4VA 1K8GA 4DK6C 2PQAA 2YYZA 1B8AA 5FLXc 1PH4A 1KAWA 3E9IA 3J80i 3HOUH 4A3DG 4DR5L 3UE1A 3KOJA 4XTCS 3F2CA 4IPHA 2OQ0A 2IY5B 4X66Q 1KQSA 1BBWA 1VQ4A 1YEZA 1MJEA 1HNZL 5JEAJ 4NPSA 4LF8L 2WB1E 4IFDG 3U58A 1EIFA 2WAQG 3ERSX 1ASYA 1L2FA 4LF6Q 4GKKL 1MKHA 2F52A 5IP9G 4Y7NH 3CCMA 5FLMH 2CWPA 2IX0A 1IBLL 3CCEA 4HIKA 4JOIC 3CCVA 2E2HH 3WWVA 4B3TL 2VUMH 4YWMA 4BA1I 3CCRA 2VW9A 1UE5A 4P74A 4BY1G 4EQ5A 1GO3E 1OXVA 1YITA 1PV4A 2VNUD 2MFIA 3PUWA 2UUBQ 1HH2P 1TWAH 3EN2A 4LF7L 2B63G 1PVOA 1PH3A 4YHHQ 1O7IA 3FKIG 1E24A 3DM3A 1W2BA 1RL2A 1IYJB 3PUYA 2R93H 1CKOA 5M5XH 1IBKL 4LF9L 3E0EA 1N32Q 2ZM6Q 1GM5A 3A0JA 2ZTEA 3HOVH 2AKWB 2Z0SA 4A93G 3FHWA 1Y1WG 3A5ZB 4JV5L 4C2MH 3S14H 1PYBA 4MNOA 1E1OA 1I94Q 3PO2H 3RLNA 1WOCA 3ER0A 4GLVB 1TXYA 3J7ZC 1IBML 4JI4Q 4DV2L 2YTYA 2JK8A 4IPDA 4DV3Q 4YCUA 5C0XG 3RN2A 3HOYG 3K0XA 4LFCQ 3RLFA 1VQ8A 1UWVA 4A3BH 4HIMA 4GOPB 5M3MH 4DR6L 4UP9A 4AQYQ 4DR2Q 1XJVA 2AHOB 2AWOA 4GOPC 1NMGA 3PF5A 3TQYA 2FXQA 3K8AA 3J80c 3KDFB 5JEAG 1CSPA 2NN6G 3RZOH 4JI2L 4QIWE 2NZOA 3VDYA 1UE1A 4R1JA 3S1QH 4JOIA 1BKBA 2R7ZG 2UXCQ 1QZHA 4KHPL 4X65L 4LNQA 1YJ9A 2UXBL 1Q7YC 4OX9Q 3LGJA 4NB3A 2YTVA 1VQCA 1GKHA 2RF4A 1ASZA 4OO1I 4JI7L 4Y52H 4UY8C 3GO5A 3L7ZC 1E7ZA 1OXUA 2PQAB 3OTOQ 4GS3A 2JE6I 4JBKA 4L5TA 1UE6A 2I5HA 2IX1A 2NVXH 5M5YH 4DR4Q 3HFZB 1VQGA 1QVFA 1BVSA 4B3RL 2PMZE 2Z6KA 3T1YL 3H3VI 1NBWA 2WB1G 3F8TA 3K7UC 1OXSC 4DV6L 1YHBA 5GADC 4BBSH 2OQKA 3I7FA 5C3EG 5JJIA 4IFDJ 1HR0W 1V43A 4B3ML 1X54A 4BXXH 1KL9A 4GNXA 4LF4Q 1NJIC 1N36Q 2KHJA 4P75A 3CC4A 1HR0L 4A3MG 3GTMH 3U4ZA 4APVA 4A3EG 1B7YB 4A4IA 4HJAA 3EIVA 4AH6A 3TRZA 3PUXA 3D31A 1Q81C 1FJGQ 2ASBA 2MQHA 3AEVA 5IYBG 2VQFQ 1S72A 4POGA 2B29A 1I3QH 2IHFA 2MNAA 4A3FH 2Q2UA 4QGUA 4A3JH 1SFOH 4DR7L 4R4TA 4A3CH 2HT1A 4K0KQ 3PIPA 5IYDH 1YI2A 4LFBQ 1CKNA 5BR8L 2ALYB 3ULLA 3CP0A 4TVAB 5C44G 4JBJA 1PH9A 4JCVE 4X62L 4PG3A 3UDFA 1KHIA 1OTCA 3CCUA 4DV5Q 3OW2A 4A3IG 4JI5Q 2BA0A 2JA8G 2ID0A 2Q2HA 1Y1VH 4B3SL 4RMFA 2DUDA 4NXML 3BZKA 2IHEA 2JJQA 4L5RC 3S17H 4LF5Q 3W1GA 2CQOA 1WCMH 1U5KA 5LMNQ 4HIOA 1VQNA 5C0XJ 1Z47A 3OYYA 3HKZE 3RLOA 4JI3L 2PNHA 2YU9H 3NBHB 3HOZH 1XMOQ 1M90C 4DR1L 3GTLH 3M7NA 4DUYQ 1HNXL 3I4MH 2F4VQ 3STBD 4DV7Q 1WI5A 2K52A 3PUZA 3NEMA 1X6OA 2I5LX 4JYAQ 2N3SA 2R92G 4R4IA 1EYGA 4LUVA 3GTOH 1V1QA 3HOWH 1YZ6A 4HJ7A 2LXJA 2QGQA 3MXNB 4GLAC 4DUZL 1YHQA 1PHJA 3ICEA 3PO3G 1G51A 1K83H 4JI8Q 1X3GA 4PZ7A 3K80C 3PGZA 3TREA 4HIDA 2JA7G 3T1HL 2R93G 5AJ3Q 3GTPH 4YY3Q 3T1YQ 1VQHA 2KENA 4X64Q 2VQEQ 4UP8A 3HKSA 2EIFA 1X3EA 1K3RA 4P73A 1RIPA 4QL5A 1QUQA 3PCOB 2JA6G 2K5NA 1XMQQ 1YNXA 2Z6KC 1PYSB 1XTDA 4NXNL 2UUCQ 4GKJL 1P16A 4GNXB 4PZ8A 2UU9L 3PO2G 4LUZA 4AIMA 3CXCA 3S16H 1N34L 1NMFA 1WFQA 2R7FA 4GNXC 1KXLA 4R4QA 1V9PA 3F2DA 3KFUA 1S3OA 1IL2A 5M3MG 3S24A 3GDEA 5IP9H 4DV1L 3CCLA 3M4QA 3K81C 3J81i 2I0QA 4LFAL 1WYDA 4BY7G 2D62A 4DR7Q 1J5EQ 2A1AA 1LUZA 2JA9A 3M9BA 4DAYB 4BY1H 1XNQL 4DV0Q 3AFQA 5C4XG 2HHHQ 1CKNB 4YCWA 1X65A 1C9OA 1BBUA 1FGUA 4TQUS 1L0WA 2UXDL 4JI0Q 4DV4Q 3I4OA 5IP7G 2JQOA 2B63H 4JI1L 4L5QA 3HOXG 2I5MX 1QVCA 2JEBI 4P72A 3FKIH 2RHSB 3M4PA 4QY7A 4DR3L 3S1RH 3F1ZA 2KCTA 1EFWA 4H02A 2CKZB 1KRTA 1JMCA 1Q46A 2E5LL 2UUAL 2ZJQA 4JI6L 1N9WA 5M3FG 1VQ9A 1HZ9A 4KHZA 3SGIA 3CCSA 5FJ8H 1C0AA 1L1OC 5LMUL 1N33L 4ALPA 1HNWL 1C7YA 5IWAL 1P8LA 3HKZG 1SLJA 1EWIA 1UE7A 2VL6A 4KLKA 4A93H 1Y1WH 4DR5Q 2ZJRA 1VQPA 4OWWB 4BBSG 1PH1A 1YVCA 4JBMA 1XNRL 2K50A 3AYHB 4KI0A 4BXXG 2A19A 1HNZQ 1HJPA 2K5HA 3H0GG 4C3JH 1PH6A 2B3GA 4LF8Q 1JJCB 4OXPA 1I6HH 5IYCG 3W1BA 1VQ7A 1VQ5A 4GKKQ 1VQJA 4DK3C 4X66L 1PA6A 3BZCA 1TWCH 1Q12A 1IBLQ 4UPAA 5IT9c 4B3TQ 3S2DH 3UE0A 5K36G 5ELOA 1UEBA 3KJOA 5JJKA 3CCJA 4LF6L 4BBRH 4R4OA 1CSQA 4GN5A 1EQRA 3M4OH 4R4CA 3J7A5 1LYLA 5GAHC 2XGTA 4DPGA 4OWXB 5IYDG 4A3JG 3STBC 4O0AA 2OWOA 4A3GG 1HZAA 1FL0A 4DKAC 1OXXK 1TWFH 1NY4A 2PI2E 2WP8J 1X3FA 4JC0A 4LF7Q 4OO1G 2CWAA 4UP7A 5IY0A 3PIOA 3I4NG 1SMXA 1VQDA 3EBEA 4FDBA 1QUQB 1Q86C 3J81c 2UUBL 3PUVA 1VQ6A 1IBKQ 2YV5A 4DAMA 4A3LH 2E8GA 4LF9Q 1A0IA 4JG2A 1Q82C 5HY6A 1IXRA 1IZ6A 3RR5A 4HJ9A 3H15A 2DGYA 1K73C 2JA5G 1GD7A 2QA4A 1SE8A 2BH2A 2JEAI 1KIXA 2K14A 4JV5Q 1JT8A 1N32L 5C3EH 2ZM6L 1KD1C 1VQOA 1IBMQ 1PH5A 4DV2Q 3HOUG 3GD7A 1L1OA 3GTQH 3S1NH 2CFMA 4POFA 2BA1A 2EXDA 2C35B 5GQOA 1I94L 3CAMA 4JI4L 2K5VA 4DNIA 4DR6Q 4A3EH 4DV3L 4BA2I 1YHAA 3G48A 5GROA 4HJ5A 2OTLA 4LFCL 3RNUA 4IFDI 5FLMG 1KC8C 4JI2Q 2YTXA 3S15H 3JAMi 5M5WH 2VUMG 2ZJPA 4AQYL 4DR2L 2KHIA
chains in the Genus database with same CATH superfamily
3BYTB 3N52A 3I2ZA 1ICFB 1VQFA 1B4OA 2LKVA 5E7NA 1PTOD 4K6DA 4JI7Q 3FP9A 5C4XB 1ZYRD 2PO4A 2HIXA 3GTKH 2WFWA 2K04A 4OX9L 4MTNA 5A2QL 2K6AA 4XIGS 1S5FD 1EUJA 1WD0A 3KYHC 4KK7A 4B3RQ 3OTOL 3Q8DA 4WJWA 1EIHA 3D0FA 1KABA 4C1NI 5M3FB 2F0JA 2HQLA 2EZVA 4DR4L 1Y8OB 1EIYB 3BVGA 1BCPB 1CFMA 1U0LA 4K8JA 1TWGH 3HKZB 3CQZB 1HXYD 4PV1C 1JORA 3HEJA 3BS1A 3T16A 2EY2A 1DCZA 4LF4L 1N36L 4K5XA 4IFDH 1E2ZA 4A3BG 1HZCA 4G57A 1EEFD 2R92H 4ZKCB 2NVQH 2ZXPA 2E2JB 1FJGL 1NUCA 2MO1A 2VQFL 4OIJA 4K0KL 5JJZA 1PDQA 1YJWA 4LFBL 1EZ8A 1I4RA 5C4ZA 1I4HA 1SAPA 3JAMc 4B3SQ 1D6EC 1X55A 3A54A 4MTKA 2EQSA 3E0JA 1PH2A 2EYFA 1B70B 1V8QA 1SROA 5IIFA 4LF5L 2Z9HA 3M85A 1CTMA 2L15A 4QF4A 3HOUB 5C0XH 3HOYH 1PXUA 1R9TH 4DUYL 3A56A 1SN8A 3PSIA 1VMPA 3BU2A 4IUVA 5J39A 1U4RA 1MIUA 2B2YA 4L8JA 3I70A 3CF5A 3A5UA 2IT1A 3HOXH 4GN3B 2L5TA 4DK1A 2WKCA 4A3LG 3OIPA 1D2BA 1X56A 4HMIA 1E3PA 2R7ZH 2BH8A 4P71A 4GLXA 4JBWA 4DGZA 2K7VA 4NXNQ 2VQEL 1ZYRC 2QEXA 3S9WA 2UU9Q 4HMJA 1TY0A 3Q24A 3R93A 3C46A 3H0GH 1K9MC 1PYWD 3UDXA 2R93B 3E9HA 4X3KA 5IYCH 1VQMA 5EKKA 3NENA 4J6HA 1SE2A 2JP1A 1B3AA 5K36H 1A2TA 2G9DA 1XNQQ 1CT1D 2SNSA 1B9MA 4F8MA 3PO2B 2N78A 4WJ3M 1SNDA 5EGTA 1LO5D 2EY1A 1JB7A 1HZBA 3VR3A 4GOPA 4OO1H 1W6JA 4A3BB 3D4WA 1VS0A 4ZAIA 3KF6A 4CDDC 3ULJA 4LWCA 1SEBD 1PH7A 4JI6Q 1VQKA 3NWTA 3T51B 2RVLA 2K4KA 4LK1C 5CYUA 4CBVA 3TS2A 2JA5H 3OWEB 4A3IH 1XNRQ 1STGA 2NZHA 4FF4A 3TP5A 2MP1A 5FLXc 3J80i 4IN3A 4J1MA 3A7AB 4X66Q 1MJEA 4NPSA 4IFDG 1QOHA 4RGNA 1ASYA 2WAQG 4YIJA 1WTQA 1MKHA 2F52A 5IP9G 1SNMA 3FPPA 5FLMH 2CWPA 1B53A 4I7AA 2VUMH 4YWMA 3ZYYX 2VW9A 1YITA 1PV4A 2VNUD 2MGSA 3M4OB 3PUWA 4LMQD 1FD7D 4LF7L 4CKBA 4U673 1PVOA 1CZWA 1PH3A 1IYJB 3RMHA 3VA5A 1I3QB 1IBKL 4EQNA 4A3JB 3E0EA 2KCNA 2ZM6Q 2ZTEA 1SNCA 5A2QE 3TDQA 4C2MH 1I94Q 1WOCA 1SJHD 5FO8B 2SNMA 5I2XA 4YCUA 5C0XG 5L37A 3HOYG 3K0XA 2BCOA 5M3MH 3ITPA 4UP9A 1JOOA 3BVZA 1XJVA 5EPLA 2L4NA 4TKOB 4GOPC 4OL7A 1BNZA 3J80c 3KDFB 1CSPA 1JCKB 1UE1A 2PPBC 2R7ZG 1QZHA 4HCSA 4LNQA 3MXNA 1XWEA 1SXTA 4RHRA 4UY8C 3GO5A 3T13A 1OXUA 4FO2A 4DAVA 2VB3X 4JBKA 1BCPD 1PZKD 3NWSA 1ET9A 2I5HA 2IX1A 1HFNA 4QCLA 1VQGA 1M4VA 3IAYA 3GTPB 2Z6KA 3H3VI 1RDPD 1TKWB 4DV6L 4BBSH 2BDNA 3I7FA 1HR0W 2O5IC 1KLGD 4BXXH 1KL9A 1J8IA 3DM1A 2KHJA 2QF7A 3S16B 1B7YB 4A4IA 3J81L 2QDBA 3CRLC 5E1FA 1ESFA 3QG1A 4XDXA 1Q81C 2WAQB 2ASBA 4HN7A 4FXDA 2B29A 2MNAA 4A3FH 3BDOA 2M2LA 4R4TA 1ET6A 3PIPA 3T53B 3T4AC 2DNCA 1YI2A 5K5PA 3CP0A 4JBJA 5FO7B 3Q23A 1ENAA 4PG3A 4FF1A 1SYEA 3UDFA 4DV5Q 4A3IG 1E2VA 5KNBA 1OO9B 3NTHA 3BZKA 3NPPA 3W2DA 5LMNQ 4XQJA 1WCMH 1DOKA 2K28A 1CK1A 3AU7A 3RLOA 4JI3L 2L0CA 1DOLA 1XMOQ 4JPBW 2K01A 1D5MC 3GTLH 4FF3A 2HUGA 3I4MH 1IHZA 1EU3A 4DV7Q 1WI5A 2Y0SB 2DJGC 1I6HB 3HOYB 3R3OA 4LUVA 1LTGD 1V1QA 2A6EC 1STHA 4HJ7A 3HOWH 4GLAC 2FMCA 3CU7A 1G51A 4JI8Q 4DAPA 3PGZA 2FHTA 1CM9A 3NQIA 2C5CA 4ILWA 5CBAE 4YY3Q 1MSGA 4X64Q 3L9AX 1H9KA 5EPKA 4R9WA 2R7ZB 1RIPA 1TWFB 1QUQA 5JPMC 1YNXA 5EKIA 2Z6KC 3E5SA 4GKJL 1D1KA 1P16A 1BCPC 3K5NA 1WFQA 3OPOA 1V9PA 3R8BA 5M3MG 5JVH3 2RQXA 4DV1L 3M4QA 2LY7A 3QWNA 2QDLA 4M1UB 4F7XA 2WV6D 2D62A 5KEEA 1J5EQ 2JA9A 3GV6A 1O78A 2HHHQ 2RCFA 3JAML 1C9OA 1FGUA 1L0WA 2JSOA 1FR3A 2B63H 4L5QA 3C3LA 2CKZB 2E5LL 3ERQA 2UUAL 1WTVA 1C0AA 5FJ8H 4DXGA 1N33L 3P75A 3VYTA 1AEXA 1DONA 3MFYA 2XIWA 1UE7A 4KLKA 4ZLTF 5D3DA 4BBSG 4OWWB 4L63B 1E0BA 1YVCA 4JBMA 5ELEA 4A3IB 4BXXG 4C3JH 2K5HA 1BUVT 4LF8Q 3R2TA 3LWUA 5T1GA 3OMGA 1RCVD 1VQJA 4DK3C 1GOZA 1VQ5A 4GKKQ 1IBLQ 5ELCA 3KK7A 2A74C 5ELOA 5JJKA 4LF6L 1V1OA 3FDTA 3EROA 1LYLA 1STYA 5G3LD 1I6VC 4DPGA 3TZDA 1AZQA 2OWOA 4A3GG 1FL0A 1Q3LA 1SYCA 5IY0A 4RKBA 1VQDA 4FDBA 3SEBA 1B44D 4DAMA 1A0IA 2EDGA 5HY6A 5I9OA 4FXGC 2FINB 3GTJB 3MZ5A 4C3IG 3H15A 2EY5A 1GD7A 4K8IA 4JV5Q 2K14A 4KY7A 1BO0A 4N9TA 3GTQH 1L1OA 2EXDA 4PMCA 2C35B 1VF7A 3RUZA 2K5VA 3VR6A 4DR6Q 1O7ZA 4A3EH 3P7JA 1Y8NB 2OTLA 2AQ3B 1I50B 2E2IB 4LAAA 5M5WH 1LTBD 4S3SA 4LUOA 1KTKA 1EY7A 3AQQA 2JN4A 2XSCA 3J81E 2A8VA 1Q90A 2F0TA 5J3BA 3X3NA 3D6WA 1XPUA 2GN5A 2ATWA 5FLXL 1HQRD 3GTGB 3MWYW 1A62A 3D3RA 3URYA 1KDBA 1I4PA 2M00A 1WTWA 2MO0A 3OW7A 4G7ZC 3DWAA 2NB0A 2N88A 3D8GA 3CW2C 4N8FA 5ELNA 1H9RA 4OONA 3HOVG 1Q1EA 4IOCA 4IO9A 4K2LA 2F3IA 3PF4A 2E2DC 1QZGA 4X3SA 1FVIA 1K0RA 3NP8A 4NMZA 1XXGA 3SR1A 3W5OA 1EY9A 3CCQA 2XNAC 1MHWC 4Q5VA 2KEDA 2HIVA 4O42A 3EJIA 1VQEA 4CGYB 2Z8LA 3E3XA 3KLRA 1E22A 2ES2A 1JOQA 2JA7H 4X62Q 4M8AA 3CPFA 5FJ8G 3G6EA 4A3GB 2F0UA 1BOSA 1WTXA 1AH9A 1A8VA 3TS0A 3RZDB 3G71A 4ODGA 4NXMQ 1ZEQX 4QMGA 5CBEE 3S2HH 3K5LA 2NVYB 4JI5L 1NR2A 1HUNA 5IGCA 4C3JG 1IYUA 2RA4A 4EX5A 3A55A 3M4YA 1C8CA 4C3IB 1SYFA 3D4RA 3J80L 1HTLD 3H3VC 5HURA 1DGSA 2JA8B 2AUKA 4BY7H 1DJRD 1SBBB 3KF6B 1A63A 2EJMA 3MA2B 3CD6A 2F4VL 2F0DA 1F2ZA 1O7LA 4DUZQ 2E76C 2P5ZX 4JYAL 2KCMA 2PZTA 2Z4HA 4Y7NB 4LW1A 1DOMA 2NN6H 3K59A 2RBMA 3BVMA 1QVGA 4A3CG 1RD9D 2Z6BA 3R2IA 5GAEC 3CRKC 2VS1A 1GVPA 1U4MA 3JAME 3F2BA 5H1SE 5AJ3L 2EYJA 1PH8A 2N8NA 1Q8IA 3IFTA 1SSOA 1TQOA 5LL6S 1XMQL 1Y1VG 4WJ4A 1KAAA 1S40A 2H4OA 1GUOA 2UUCL 4YWLA 5M5XB 1X9NA 3TEHB 2Z4IA 2OCEA 2A73B 2K5WA 1A15A 1BCPF 3HOZG 3HOVB 1PFSA 3DHQA 3TN2A 1U4PA 3KBXA 1PFNA 5GAGC 5KYLA 2J0TD 2PZUA 2HDMA 3ONAB 3OOCA 2UXDQ 3DMUA 4OIKA 4DV0L 1QILA 4IPCA 4JI1Q 3I4NH 4DR3Q 3C2PA 1GXDC 3K7AH 3OSOA 3EQLC 5C6AA 1HNWQ 5C44H 3H3VH 5BN5A 3CPWA 3V2TA 3S1QB 1H95A 4YWKA 2MPMA 3U4VA 4IUQA 4DK6C 2IW3A 1B8AA 1PH4A 1FYCA 1K28A 4DR5L 3UE1A 3KOJA 4XTCS 3QR8A 3G7LA 2IY5B 4ULLA 2A68C 1G2SA 4C3JB 2NVXB 2WB1E 5M5YB 3MFGA 3ERSX 2NZ1D 1G8ZD 1EIGA 1H9SA 2IX0A 5C4HA 3S1NH 1VF5C 3CCRA 4BA1I 1B50A 1HPCA 1HCZA 1KNAA 3QO2A 3VR2A 1HH2P 1GUSA 1JWUD 1TWAH 2EYHA 2OT2A 1YNND 1F9QA 3PUYA 2K05A 4JK1C 4LF9L 1D5XC 1HA5A 1GM5A 1QE6A 2AKWB 2Z0SA 2KECA 3DWQA 4A93G 2HCCA 1Y1WG 3S14H 1NSNS 4MNOA 2F0IA 4DV2L 4ZK9B 4DV3Q 3NXWA 1Y1VB 2PZWA 3MAQA 3RLFA 4LFCQ 1UWVA 4HIMA 2QKIC 4DR2Q 1Y69U 2IL8A 3HOZB 2FXQA 5HGTA 2IX3A 5JEAG 3RZOH 2NN6G 2KJXA 4JI2L 4QIWE 2F0EA 4B08A 4R1JA 3DEPA 4KHPL 4X65L 2B2WC 1DYQA 4V0BA 5EPJA 2UXBL 4OX9Q 3LGJA 3NUCA 4NB3A 1ASZA 1GKHA 1GHKA 3CHBD 3GTOB 3L7ZC 1E7ZA 2ZXRA 3A8IE 2PQAB 3OTOQ 4GS3A 2JE6I 1HHVA 1STNA 1UE6A 4DR4Q 3HFZB 1ONLA 1H9JA 1QVFA 1BVSA 1PTOC 2WINB 2LS01 2PMZE 3F8TA 4CJ2C 1OXSC 2BE5D 5GADC 2OQKA 2XVSA 1II3A 1Y8PB 1X54A 4B3ML 4GNXA 3VR4A 4LF4Q 1N36Q 4FP5D 4CKEA 5COYA 1HR0L 3GTMH 4APVA 4HJAA 3J80E 5EBCA 4KY5A 1DD2A 3D31A 1FJGQ 1NNXA 3HZXA 2VQFQ 1MBYA 2IHFA 5CV9A 1SFOH 5IYDH 4DR7L 4K0KQ 4LFBQ 1CKNA 2EY6A 5BR8L 1G6ZA 2OF1A 5C44G 4JCVE 3FRPB 2G9HD 3KUPA 5KNCA 5I2YA 5G3LF 2BA0A 3SK8A 2ID0A 1X3PA 1L0XB 2Q2HA 5IGGA 3WOEA 3S17H 4L5RC 4LF5Q 5LL6X 1U5KA 3OMCA 1EOTA 2J7ZA 2M9VA 2PNHA 3BDLA 2YU9H 5FKAC 4A93B 4C56C 4DR1L 1Y1WB 3M7NA 2MUYA 4DUYQ 3V05A 1HNXL 2HDLA 1WTPA 3PUZA 3H6MA 1X6OA 1FNVA 2I5LX 2R92G 2EYLA 1YZ6A 2LXJA 2RSNA 1K83H 1X3GA 1PTOH 3K80C 3NBIA 1HUMA 3QB3A 4PZ7A 4RAUC 3TREA 4B9WA 4HIDA 1WVLA 3T1HL 1JE4A 2BDOA 1VQHA 5CGKA 2VQEQ 4UP8A 3HKSA 1X3EA 1K3RA 3EFXD 3PCOB 1KLUD 1LTAD 1ENFA 5DNFA 1JQYD 4AIMA 2PW7A 1N34L 4GNXC 4R4QA 1EYAA 3F2DA 3S24A 4FYDA 4LFAL 4HR7B 1WYDA 1BF4A 1I4XA 4DR7Q 3M9BA 4BY1H 3NBHA 1X65A 3KLSX 3I4OA 1KNEA 3MHBA 3HOXG 3M3YH 3S1RH 3FKIH 3M4PA 2AQ1B 4QY7A 3S15B 2KCCA 3F1ZA 2KCTA 1V1PB 1EFWA 4QUCA 1VQ9A 2A5HA 4KHZA 2WKDA 3SGIA 3K7AB 5LMUL 4ALPA 5IWAL 5C44B 1EWIA 1PRTB 4DN4M 2ZJRA 1PH1A 3GTKB 2K50A 4KI0A 4QUFA 2A19A 4FXKC 2XRQD 3H0GG 1PH6A 1JJCB 2RDFA 4OXPA 5IYCG 2SOBA 2A6HD 4F88A 1TWCH 1Q12A 4UPAA 3OHXC 5K36G 1PMRA 3KJOA 4BBRH 4CDFC 4GN5A 1TWGB 1EQRA 2XWBB 1TR5A 4EGVA 5IYDG 4LF7Q 4OO1G 4UP7A 3PIOA 3EBEA 2R92B 2UUBL 2F0LA 2R3ZA 1IBKQ 5JOBA 2NVQB 2E8GA 2DY8A 1ILQA 1LTID 2V4DA 2B2VC 1K73C 2JA5G 2BH2A 2F0QA 1JT8A 5E4WC 1MI2A 3QJYA 1N32L 5C3EH 1VQOA 3O13A 2CFMA 4POFA 4TSSA 5GQOA 5D3IB 3S14B 4JI4L 4DNIA 1YNJD 4BA2I 4CDCC 4IFDI 1TS2A 5FLMG 1I4GA 2QILA 2VUMG 2ZJPA 4AQYL 5JPNC 2EOTA 3RZOB 4N8X1 5LMUQ 1R9TB 3PQIA 1JWSD 2C9OA 2L12A 2Q8TA 5TSSA 1LT6D 4J15A 5D14A 1GUGA 1QG7A 3HOXB 1W3SA 2VB2X 3KLWA 3IL8A 4DV6Q 5C4JH 1RTOA 2NYZD 1EY5A 5I6YA 1JE5A 1AW7A 1Q8KA 3TSSA 5HGQA 2AMCB 4A75A 1PTOF 4HAEA 4AYBG 2RDHA 3GV3A 1MJCA 3K5MA 1IYVA 3H0GB 3U9SA 1TS3A 4JVZA 5C0XI 1T9HA 4MZ9A 1TWHH 5IE8A 2FJ2A 4QJFA 2NVTH 3IRBA 1J9OA 1ILPA 3PO3H 4QQBX 1NE3A 2PW5A 2F0MA 2HQEA 3KF8B 3DWPA 3I73A 2JA6H 3C1EA 1D8LA 4C3HH 3L2PA 1ICWA 1B9NA 1YJNA 5LMNW 4ME3A 2KA7A 2H5XA 4JI3Q 3CC2A 4F87A 4GN4B 3T56B 3NTKA 4HCEA 3HG9A 4X6AH 3N6RA 2OXPA 1T5XD 3J7AV 3W3AA 3UDIA 2JA5B 2KBNA 2VZAA 1EU4A 3NTIA 4IJLA 5IGFA 2X6LA 4KHVA 1JJGA 1S5DD 3U50C 4BBRG 1YIJA 2KQ3A 4PNYA 1LABA 5C4XH 2N55A 1SJED 1N8RC 3FVQA 4IOAA 1S4ZA 2K1BA 5CV6A 4AYBE 5IP7H 4H44C 5C3WA 4A76A 4A3FG 2F0PA 2VUMB 2CCZA 1SYGA 4K5WA 5M3FH 3PIP3 2Q2TA 4H13C 3AMUA 4KKUA 1G6PA 2KVMA 3CQZH 1KRSA 4GKJQ 4PZ6A 4FVMA 1PZJD 2K75A 1SRUA 4YHHL 1AP0A 3A8JE 5J1ZA 1A3UA 5E3FA 3S1MH 4IQZA 3I8ZA 1TIID 1FNUA 1WCMG 5IOCA 2B8FA 4DV1Q 4H0LC 2E2JH 3J81j 2Q2IA 2R6GA 4ZRZA 2CVRA 5I6WA 4KJOA 4OEMB 2VY3A 4C2MB 1EOVA 3I4MG 2FMMA 4A3MH 4Q0FA 4AYBB 2D0OA 4OWTB 5BN4A 4BWGB 4I7ZC 5ELDA 2F0HA 1LTLA 1H9MA 3HOWG 5IYBH 5M3MB 2K5QA 2E5LQ 3KDFA 4JI0L 2UUAQ 4DV4L 1F2YA 1PRTD 5F2DA 2F3VA 1N33Q 4UAIA 2K5DA 2EYOA 1PFMA 1K3BC 2N49A 1Q1BA 3J7YW 1K8GA 1EFID 3HOUH 4ZQ3A 3BYYB 2O5JC 3F2CA 2OQ0A 1KQSA 1VQ4A 1QB5D 4XYQA 1HNZL 1EIFA 4LF6Q 4G7HC 1CQFA 4BBSB 1NCVA 1HFGA 4JOIC 2E2HH 3WWVA 4B3TL 4P74A 2NTSA 3WDNA 1GO3E 1OXVA 4DNRB 2MFIA 3HRZC 4DK0A 4ID6A 4N9PA 2JYOA 1SNQA 5CMDA 3TZUA 2B63G 1BDOA 4YHHQ 1E24A 1RL2A 1I4QA 2R93H 3X3MA 1CKOA 5KRUA 4A3FB 1FNWA 3RD4A 1BR9A 3A0JA 1EY4A 3QIAA 1AZPA 2NUCA 3H94A 3LNNA 2ICIA 2RKSA 1BXTA 3PO2H 3RLNA 1IBML 1PZID 2YTYA 2JK8A 3LX0A 4KN4C 3RN2A 1CZGA 1VQ8A 4A3BH 3FPUB 1WCMB 4GOPB 4CKCA 3HGBA 2AHOB 2AWOA 1E2WA 1NMGA 1TY2A 3TQYA 4MHEA 3GTLB 2ZXOA 2NZOA 2D9UA 4WRDA 3I4MB 1BKBA 5IODA 1Q7YC 2YTVA 4Y52H 4JI7L 2F0VA 2CH4W 3HOWB 3DUZA 3PMFA 4L5TA 1CA5A 1PRTC 2KEEA 4RA8A 2D2CC 5CV7A 4B3RL 1LACA 1NBWA 2WB1G 4KKTA 1IL8A 3KLSA 5ISRA 2DN8A 3NK9A 4Z9CB 1STEA 1NAPA 4P75A 3CC4A 4A3MG 3U4ZA 4A3EG 3TP6A 3EIVA 4PMBA 3IKJA 3TRZA 2K03A 3PUXA 1LTRD 2MQHA 5IYBG 1S72A 1I3QH 3D4DA 2Q2UA 4A3JH 2IWHA 2ALYB 4XQQA 2L55A 4TVAB 1AN8A 2X6GA 1K8MA 5C5MA 3ULLA 4UHVA 5C3XA 1F2MA 1GUTA 1OTCA 3OW2A 4JI5Q 3TMEA 2IJ0A 2B63B 2B2WA 1EWHA 2QW7A 4B3SL 4RMFA 2DUDA 4ABNA 1SMYD 2IHEA 2JJQA 1RJTA 3K5OA 2CQOA 4HIOA 1VQNA 1NR4A 1Z47A 3OYYA 3HKZE 4IUPA 2NWGA 2F4IA 3NBHB 2D5DA 1M90C 1PLFA 2I46A 3MXPA 2SDFA 2F4VQ 3STBD 3Q0AA 1S5ED 4K6LA 3NEMA 1PFBA 4JYAQ 3F2UA 4X3TA 4R4IA 1EYGA 1IW7D 4DXFA 2QGQA 3MXNB 3QOJA 3K0YA 1YHQA 1PHJA 1SDFA 5J22A 3L3OC 5CV8A 2EE1A 2JA7G 1EQVA 2R93G 5AJ3Q 3GTPH 1STAA 2PYKA 4QL5A 1SNPA 2K5NA 3FMCA 3SHLA 1XMQQ 1PYSB 1SNOA 4NXNL 2UUCQ 3EVQA 2UU9L 3PO2G 4LUZA 3SXHA 3CXCA 3S16H 2R7FA 1KXLA 5FLXE 1ENCA 1C4QA 3KFUA 3S1MB 2KUMA 1SYDA 2WB1B 5IP9H 3CCLA 2I0QA 1D1IA 5CR3A 4BY7G 2A1AA 3GTQB 1F9RA 1XNQL 1HRJA 4DV0Q 3AFQA 4HSVA 4A3MB 4A3EB 5D65A 1BBUA 4TQUS 1ZXTA 1R4QB 2F0FA 4E6IA 2ZT9C 1QVCA 4IURA 5M5WB 3MC0B 4H02A 1KRTA 1JMCA 1Q46A 4JI6L 1N9WA 4DA2A 3CCSA 1C7YA 1SLJA 1GJXA 1G91A 4DR5Q 1VQPA 3P20A 3TP8A 4U68A 1XNRL 1HJPA 2B3GA 3SK6A 3VYSA 3EA6A 1I6HH 1QNKA 1SMYC 4KMUC 3W1BA 3MTSA 3VR5A 4X66L 1PA6A 3BZCA 1B1ZA 5LHY1 5IT9c 4G7OC 3S2DH 4XXEA 4ZCKA 4RCOA 1F9PA 3CCJA 5KGUA 4R4OA 1CSQA 4R4CA 3BZDB 4QB4A 4XYOA 2E2HB 2XGTA 4A3JG 3STBC 4QIWB 3WOFA 4DKAC 1OXXK 1TWFH 1NY4A 1X3FA 4G4KA 4ZUJA 3I4NG 4OELB 1IW7C 1QUQB 2EYMA 2J4XA 3PUVA 2F0WA 4DAYA 2YV5A 4GZYC 4LF9Q 4JG2A 4B9XA 1Q82C 2Z1CA 1IXRA 2BOSA 3I90A 2JA7B 2L11A 2JEAI 2CHBD 1O80A 1KIXA 1FGBD 4J8QA 2PMZB 2ZM6L 1KD1C 1YNNC 2EJGC 1GUWA 1TU2B 1PH5A 4DV2Q 3GD7A 1JB3A 2E75C 2BA1A 1CHPD 4EQOA 3S2HB 1JC7A 3CAMA 1I94L 2XN9C 2DY7A 4IALA 3G48A 5GROA 4HJ5A 1EQTA 4C1NK 4KD3A 5T1IA 2L1BA 4JI2Q 1KC8C 1QCBD 4KN7C 1TT2A 2KHIA 1DZ1A 4BY7B 2LXKA 1G291 1Z9FA 4L5SA 4EVOA 4KHPQ 1BQQT 4X65Q 2UXBQ 4OGQC 2L9HA 1STBA 1J6QA 3CC7A 1L0YB 4A3KH 2RHQB 1JICA 3VYUA 1NTGA 4BS9A 3G4SA 3BJUA 5NUCA 3ULPA 5KYIA 4IJHA 2X69A 1D7QA 5EJWA 4RHSA 1RKNA 3A74A 1AE2A 3MEHA 1PRTF 4B3MQ 1D5ZC 2RCNA 4NP5A 1XPOA 4A3DH 4NKLA 1F2LA 1HR0Q 2B2VA 5CV4A 2R7DA 2OTJA 2B2YC 1RTNA 5IGEA 4XQNA 1OXTA 4KY6A 1SR3A 3L0OA 3CKIB 1LV9A 4IPGA 3B6YA 1EYCA 4KTAA 2BE5C 5IGBA 1E1TA 1B3QA 2ZTCA 3TBIB 1TS5A 5BR8Q 3NELA 4KJNA 3GTJH 2NN6I 2ICEC 1K8AC 1Y14B 2ZTDA 3DLLA 4PMWA 2F03A 2PI2A 1YBYA 3I4NB 5EAYA 2R61A 5CV5A 1L1OB 3I4LA 4DV5L 3NQTA 5DLQE 2QCPX 2Y0SG 1VQBA 3VA7A 1U9RA 4RGOS 3PV0A 5LMNL 1I50H 4DR1Q 2E2IH 2A6ED 4RGMA 5M9OA 1WD1A 5I9PA 4CJ0B 1HNXQ 4CHTB 1QNUA 3C1FA 1XMOL 1HTPA 2LMCB 3I55A 1VQLA 1VQIA 3A8KE 1A6XA 2RSOA 2CH4A 4IUTA 1XPRA 1WTHA 2WAQE 4DV7L 3GTGH 4RG1A 4MN3A 1T5EA 3GQBA 4DF7A 2B2UA 3T1HQ 3S1NB 3K57A 3CMEA 4JI8L 4RKLA 5AFWA 5EQ0A 1EY6A 1LM0A 3SK5A 3AFPA 4YY3L 4X64L 2B39A 1TVXA 1TWAB 1AE3A 2HD3A 1N34Q 2AWNA 4V190 1VCIA 5CC4A 1VQAA 5FO9B 1CUKA 2GVAA 1EQQA 1IKMA 2KOLA 4LFAQ 3MEFA 3RN5A 1O7YA 4DFAA 2G5DA 1JJ2A 1I5FA 2JXMB 2XTIA 1W6KA 3UDGA 2Y0SE 4O2DA 3E6ZX 1A3VA 2H1EA 5C5LA 1J5EL 4A3GH 3CMAA 2V1CC 1SE4A 5JJLA 2O2LD 3MVVA 2F0OA 1M1KC 2HHHL 4CJ1B 4A3KG 3RZDH 1WJJA 1KDAA 4HJ8A 2PQEA 3BDCA 2NVYH 3ZJYC 2PNRC 2LSSA 4DNTB 1EZ6A 5IWAQ 3JC66 3NHHA 2D0PA 3KJPA 4C3IH 3I56A 2UXCL 1CKMA 5KIXA 2GVBA 1UNSA 5E4XA 2JA8H 4YCVA 2SEBD 4R8NA 1ML0D 2PQAA 2MHVA 2YYZA 4WFN3 1KAWA 3E9IA 4A3DG 4UDUC 1G2TA 1RHPA 4IPHA 4K14A 2WACA 1BBWA 1GHJA 1YEZA 5JEAJ 4LF8L 3K6OA 2EPBA 3U58A 2F1MA 1L2FA 1C48A 4GKKL 3CCMA 4Y7NH 1IBLL 3CCEA 4HIKA 3CCVA 1UEAB 2PCFB 3S2DB 1QWYA 1UE5A 4BY1G 4EQ5A 4HEDA 1ZKOA 2B2UC 2A6HC 3GTMB 3G6JB 2UUBQ 2EJFC 1EL0A 3EN2A 1KDCA 5FK9C 1O7IA 3FKIG 2HCIA 4EQPA 1AFPA 3DM3A 1W2BA 4DU9A 1IKLA 4RWSC 5M5XH 1MSHA 2EXZA 1SFOB 4XT1B 1N32Q 1DXMA 2XRSD 3HOVH 3FHWA 3OIQA 3A5ZB 1EWCA 2A69D 4JV5L 4TRDA 1PYBA 3TP7A 1E1OA 5DM73 3J7ZC 4JI4Q 3ER0A 4GLVB 1TXYA 5IGDA 4IPDA 1EYDA 1LT3D 4K5VA 2WIIB 4CDEC 1VMCA 2K33A 3S17B 5CORA 4DR6L 4AQYQ 5ELBA 3SVMA 3PF5A 2YU9B 1QJOA 3K8AA 4RH6A 4RCNA 1MD2D 1A3TA 3NSWA 3VDYA 3M7GA 1YNJC 3S1QH 4JOIA 5I4DA 2UXCQ 4X3UA 1YJ9A 5KNDA 3MXGA 4ME5A 3H09A 4OO1I 1VQCA 2RF4A 3PIO3 4ZKBB 4A3KB 4R8IA 2XWJB 1K83B 3VYRA 1PTOB 2NVXH 1XX8A 5IT9L 5M5YH 4HSPA 3T1YL 1F77A 3K7UC 1YHBA 1EEID 5C3EG 2NTTA 4IFDJ 5JJIA 3I91A 1HA6A 3DXJC 1EY8A 1V43A 1H9SB 1NJIC 4A3DB 2CQAA 4NDXA 3SE0A 2F3WA 4AH6A 2TSSA 4I65A 1MGSA 3AEVA 1CHQD 1WTRA 4POGA 5DAUA 4L6TB 4A3CH 4QGUA 1SE3A 2FFKB 1LT4D 2HT1A 2F0SA 5EKLA 1U4LA 4BY1B 1LLRD 1PH9A 2AUJD 4LJZC 4X62L 2IPKD 1LT5D 1KHIA 1RF2D 3CCUA 4P2CB 2JA8G 4WORA 5BN3A 3A7LA 5JAVA 1B2TA 3M3YB 1V1PA 2LFNA 3S1RB 2RDGA 1Y1VH 3FKIB 4NXML 1JR0D 2F0KA 3ND9A 3Q22A 4ZUIA 3W1GA 2DNEA 3OWFA 5C0XJ 3ND8A 1K0SA 4KD4A 4FF2A 3HOZH 4FNFA 5DEHA 2A69C 2CW0D 1EY0A 1GUNA 3FEWX 3AB9A 2K52A 1RODA 2AQ2B 2N3SA 2VXWA 3SK4A 3I72A 1ESRA 1Z7TA 3H91A 4NW2A 3V96A 3GTOH 1TWCB 3K58A 5EBDA 4DUZL 1R4PB 4KV6A 3ICEA 3NE5B 3PO3G 4BBRB 3J7AF 2TMPA 4IUNA 3T1YQ 2KENA 2EIFA 2I07B 3BG3A 4P73A 1UAPA 3SDZA 2JA6G 1XTCD 1XTDA 1DM0B 4C3HG 3I3CA 4GNXB 2E74C 4PZ8A 3GP7A 2NBFA 1M8AA 4MIUA 1NMFA 2B2TA 1Z6HA 1S3OA 1IL2A 4KKSA 2F0NA 3GDEA 4RFBA 3J81i 3K81C 5C3EB 4DAYB 1LUZA 4ZYSA 2K32A 3P1HA 2Q8RE 5C4XG 1CKNB 4YCWA 1LTSD 3HP3A 3D6CA 1XYIA 2UXDL 4JI0Q 4DV4Q 5IP7G 2JQOA 2F0GA 1HQMC 4JI1L 2I5MX 2JEBI 4P72A 4H7BA 2RHSB 4DR3L 4K2KA 5JVG3 2ZJQA 5M3FG 1CQVA 1HZ9A 4OHJA 2A68D 1L1OC 1X32A 1HNWL 2EVBA 1P8LA 3HKZG 2VL6A 4A93H 5ELFA 1Y1WH 3UI2A 3DEOA 3AYHB 4IUUA 1SYBA 1HNZQ 1S5CD 4HTHA 1VQ7A 4PQXA 3IFDA 1JOKA 5C4JB 3Q6SA 2B8GA 4B3TQ 3UE0A 1WTOA 1UEBA 2EYPA 5DM63 5FOBB 1LTTD 3M4OH 4JW0A 3U9OA 5JEAH 3J7A5 5GAHC 2CW0C 4OWXB 4O0AA 3HS0C 1HZAA 2ENBA 2WP8J 4JC0A 2PI2E 2GA4B 2CWAA 1SMXA 1TWHB 1TS4A 2Q8IB 1Q86C 3J81c 1UUPA 1VQ6A 1JWMD 4A3LH 3QOLA 2NVTB 1X3QA 3KBGA 3PO3B 1VDZA 3LWEA 3MXUA 1IZ6A 3RR5A 4HJ9A 2DJFC 1BBXC 3KF8A 2DGYA 2QA4A 1SE8A 2B2TC 4XT3B 1IBMQ 1CA6A 1F9SA 2JA6B 3HOUG 1CI3M 2KHSA 2O4XA 4IZ8A 4C3HB 5IT9E 1S5BD 5A35A 2QEJC 4DV3L 2OEOA 1YHAA 4LFCL 3RNUA 1A2UA 3S15H 2YTXA 2MJ8A 4O1NA 3JAMi 1K8OA 4DR2L 4RGTA
chains in the Genus database with same CATH topology
2LXKA 1G291 1Z9FA 3I2ZA 4LUOA 4L5SA 4KHPQ 1VQFA 4X65Q 3AQQA 2UXBQ 5LMUQ 2A8VA 1J6QA 5E7NA 5J3BA 3CC7A 1XPUA 2GN5A 4JI7Q 3FP9A 4A3KH 2ATWA 2HIXA 2RHQB 1NTGA 4J15A 3GTKH 2WFWA 1A62A 4OX9L 4MTNA 3BJUA 3G4SA 4XIGS 1EUJA 3ULPA 1W3SA 3KLWA 3KYHC 2MO0A 4IJHA 4B3RQ 1D7QA 3OTOL 3Q8DA 4DV6Q 5C4JH 3A74A 3D0FA 3CW2C 1AE2A 2HQLA 5ELNA 4OONA 4DR4L 1EIYB 3HOVG 4B3MQ 1Q1EA 2RCNA 1U0LA 1JE5A 1Q8KA 1TWGH 5HGQA 4IO9A 2AMCB 2F3IA 4IOCA 1XPOA 4A75A 3PF4A 4A3DH 1QZGA 4AYBG 1HR0Q 2R7DA 1FVIA 1K0RA 1MJCA 2OTJA 1OXTA 4LF4L 1SR3A 3L0OA 1N36L 3W5OA 4IPGA 4A3BG 3B6YA 5C0XI 1HZCA 3CCQA 1T9HA 4MZ9A 2R92H 1TWHH 5IE8A 2HIVA 4QJFA 1E1TA 2NVQH 2NVTH 2ZTCA 3IRBA 1VQEA 3PO3H 4QQBX 1FJGL 5BR8Q 2MO1A 3NELA 2VQFL 1E22A 1NE3A 2ES2A 2JA7H 3GTJH 2NN6I 4X62Q 4K0KL 1K8AC 1Y14B 2ZTDA 3CPFA 3KF8B 5FJ8G 4PMWA 3G6EA 3DLLA 1YJWA 3M3YH 4LFBL 2JA6H 2PI2A 1AH9A 1YBYA 1A8VA 3JAMc 3TS0A 5EAYA 4B3SQ 3G71A 4NXMQ 1D8LA 4C3HH 1L1OB 1X55A 3L2PA 4DV5L 3S2HH 4JI5L 1YJNA 5LMNW 4ME3A 2EQSA 1PH2A 5DLQE 2Y0SG 1B70B 4EX5A 1SROA 2H5XA 4JI3Q 1VQBA 3CC2A 4GN4B 4LF5L 4X6AH 3PV0A 5LMNL 1I50H 4DR1Q 2E2IH 3UDIA 2KBNA 1DGSA 2VZAA 4IJLA 3M85A 1HNXQ 1JJGA 4BY7H 3KF6B 2L15A 3U50C 4BBRG 1XMOL 1A63A 1YIJA 3I55A 3HOYH 1R9TH 1VQLA 3CD6A 1VQIA 4DUYL 5C4XH 1SN8A 3PSIA 3BU2A 2F4VL 1XPRA 1MIUA 2WAQE 4DV7L 1N8RC 4DUZQ 3GTGH 4IOAA 4JYAL 4RG1A 3CF5A 2KCMA 4AYBE 5IP7H 3A5UA 2IT1A 4LW1A 3HOXH 4GN3B 3T1HQ 1QVGA 4A76A 4A3FG 4A3CG 4A3LG 5GAEC 1X56A 2CCZA 3CMEA 4JI8L 1E3PA 2VS1A 5M3FH 2BH8A 2R7ZH 4P71A 1GVPA 2Q2TA 3F2BA 4GLXA 4JBWA 5H1SE 5AJ3L 1G6PA 1LM0A 4YY3L 3AFPA 3CQZH 4X64L 1KRSA 2VQEL 1PH8A 4NXNQ 2N8NA 2QEXA 4GKJQ 4PZ6A 2UU9Q 1AE3A 2K75A 1SRUA 2AWNA 1XMQL 4YHHL 1N34Q 1Y1VG 3H0GH 1VCIA 4WJ4A 1VQAA 1S40A 1K9MC 3UDXA 3S1MH 2UUCL 1CUKA 3E9HA 1WCMG 2GVAA 4YWLA 5IYCH 1X9NA 1VQMA 1EQQA 3TEHB 4DV1Q 2OCEA 3NENA 4LFAQ 3MEFA 3RN5A 2E2JH 1JJ2A 3HOZG 3J81j 2Q2IA 1I5FA 2R6GA 2XTIA 3UDGA 1PFSA 1XNQQ 2Y0SE 2VY3A 5GAGC 4O2DA 1EOVA 3I4MG 4A3MH 2N78A 4WJ3M 1J5EL 2D0OA 1JB7A 4OWTB 4A3GH 3CMAA 2UXDQ 1HZBA 2V1CC 4GOPA 5JJLA 1M1KC 4DV0L 1LTLA 4IPCA 4JI1Q 2HHHL 3HOWG 1VS0A 4DR3Q 4A3KG 3KF6A 1WJJA 5IYBH 3RZDH 3I4NH 3ULJA 4LWCA 4HJ8A 1PH7A 2E5LQ 2NVYH 3KDFA 4JI0L 2UUAQ 4JI6Q 3ZJYC 4DV4L 2LSSA 1VQKA 3K7AH 1N33Q 1HNWQ 5C44H 3H3VH 5IWAQ 3JC66 2D0PA 2K4KA 3KJPA 4C3IH 3CPWA 3I56A 2UXCL 1CKMA 3TS2A 2JA5H 2GVBA 1H95A 2N49A 1Q1BA 4YWKA 4A3IH 1XNRQ 2NZHA 2JA8H 4YCVA 3U4VA 1K8GA 4DK6C 2PQAA 2YYZA 1B8AA 5FLXc 1PH4A 1KAWA 3E9IA 3J80i 3HOUH 4A3DG 4DR5L 3UE1A 3KOJA 4XTCS 3F2CA 4IPHA 2OQ0A 2IY5B 4X66Q 1KQSA 1BBWA 1VQ4A 1YEZA 1MJEA 1HNZL 5JEAJ 4NPSA 4LF8L 2WB1E 4IFDG 3U58A 1EIFA 2WAQG 3ERSX 1ASYA 1L2FA 4LF6Q 4GKKL 1MKHA 2F52A 5IP9G 4Y7NH 3CCMA 5FLMH 2CWPA 2IX0A 1IBLL 3CCEA 4HIKA 4JOIC 3CCVA 2E2HH 3WWVA 4B3TL 2VUMH 4YWMA 4BA1I 3CCRA 2VW9A 1UE5A 4P74A 4BY1G 4EQ5A 1GO3E 1OXVA 1YITA 1PV4A 2VNUD 2MFIA 3PUWA 2UUBQ 1HH2P 1TWAH 3EN2A 4LF7L 2B63G 1PVOA 1PH3A 4YHHQ 1O7IA 3FKIG 1E24A 3DM3A 1W2BA 1RL2A 1IYJB 3PUYA 2R93H 1CKOA 5M5XH 1IBKL 4LF9L 3E0EA 1N32Q 2ZM6Q 1GM5A 3A0JA 2ZTEA 3HOVH 2AKWB 2Z0SA 4A93G 3FHWA 1Y1WG 3A5ZB 4JV5L 4C2MH 3S14H 1PYBA 4MNOA 1E1OA 1I94Q 3PO2H 3RLNA 1WOCA 3ER0A 4GLVB 1TXYA 3J7ZC 1IBML 4JI4Q 4DV2L 2YTYA 2JK8A 4IPDA 4DV3Q 4YCUA 5C0XG 3RN2A 3HOYG 3K0XA 4LFCQ 3RLFA 1VQ8A 1UWVA 4A3BH 4HIMA 4GOPB 5M3MH 4DR6L 4UP9A 4AQYQ 4DR2Q 1XJVA 2AHOB 2AWOA 4GOPC 1NMGA 3PF5A 3TQYA 2FXQA 3K8AA 3J80c 3KDFB 5JEAG 1CSPA 2NN6G 3RZOH 4JI2L 4QIWE 2NZOA 3VDYA 1UE1A 4R1JA 3S1QH 4JOIA 1BKBA 2R7ZG 2UXCQ 1QZHA 4KHPL 4X65L 4LNQA 1YJ9A 2UXBL 1Q7YC 4OX9Q 3LGJA 4NB3A 2YTVA 1VQCA 1GKHA 2RF4A 1ASZA 4OO1I 4JI7L 4Y52H 4UY8C 3GO5A 3L7ZC 1E7ZA 1OXUA 2PQAB 3OTOQ 4GS3A 2JE6I 4JBKA 4L5TA 1UE6A 2I5HA 2IX1A 2NVXH 5M5YH 4DR4Q 3HFZB 1VQGA 1QVFA 1BVSA 4B3RL 2PMZE 2Z6KA 3T1YL 3H3VI 1NBWA 2WB1G 3F8TA 3K7UC 1OXSC 4DV6L 1YHBA 5GADC 4BBSH 2OQKA 3I7FA 5C3EG 5JJIA 4IFDJ 1HR0W 1V43A 4B3ML 1X54A 4BXXH 1KL9A 4GNXA 4LF4Q 1NJIC 1N36Q 2KHJA 4P75A 3CC4A 1HR0L 4A3MG 3GTMH 3U4ZA 4APVA 4A3EG 1B7YB 4A4IA 4HJAA 3EIVA 4AH6A 3TRZA 3PUXA 3D31A 1Q81C 1FJGQ 2ASBA 2MQHA 3AEVA 5IYBG 2VQFQ 1S72A 4POGA 2B29A 1I3QH 2IHFA 2MNAA 4A3FH 2Q2UA 4QGUA 4A3JH 1SFOH 4DR7L 4R4TA 4A3CH 2HT1A 4K0KQ 3PIPA 5IYDH 1YI2A 4LFBQ 1CKNA 5BR8L 2ALYB 3ULLA 3CP0A 4TVAB 5C44G 4JBJA 1PH9A 4JCVE 4X62L 4PG3A 3UDFA 1KHIA 1OTCA 3CCUA 4DV5Q 3OW2A 4A3IG 4JI5Q 2BA0A 2JA8G 2ID0A 2Q2HA 1Y1VH 4B3SL 4RMFA 2DUDA 4NXML 3BZKA 2IHEA 2JJQA 4L5RC 3S17H 4LF5Q 3W1GA 2CQOA 1WCMH 1U5KA 5LMNQ 4HIOA 1VQNA 5C0XJ 1Z47A 3OYYA 3HKZE 3RLOA 4JI3L 2PNHA 2YU9H 3NBHB 3HOZH 1XMOQ 1M90C 4DR1L 3GTLH 3M7NA 4DUYQ 1HNXL 3I4MH 2F4VQ 3STBD 4DV7Q 1WI5A 2K52A 3PUZA 3NEMA 1X6OA 2I5LX 4JYAQ 2N3SA 2R92G 4R4IA 1EYGA 4LUVA 3GTOH 1V1QA 3HOWH 1YZ6A 4HJ7A 2LXJA 2QGQA 3MXNB 4GLAC 4DUZL 1YHQA 1PHJA 3ICEA 3PO3G 1G51A 1K83H 4JI8Q 1X3GA 4PZ7A 3K80C 3PGZA 3TREA 4HIDA 2JA7G 3T1HL 2R93G 5AJ3Q 3GTPH 4YY3Q 3T1YQ 1VQHA 2KENA 4X64Q 2VQEQ 4UP8A 3HKSA 2EIFA 1X3EA 1K3RA 4P73A 1RIPA 4QL5A 1QUQA 3PCOB 2JA6G 2K5NA 1XMQQ 1YNXA 2Z6KC 1PYSB 1XTDA 4NXNL 2UUCQ 4GKJL 1P16A 4GNXB 4PZ8A 2UU9L 3PO2G 4LUZA 4AIMA 3CXCA 3S16H 1N34L 1NMFA 1WFQA 2R7FA 4GNXC 1KXLA 4R4QA 1V9PA 3F2DA 3KFUA 1S3OA 1IL2A 5M3MG 3S24A 3GDEA 5IP9H 4DV1L 3CCLA 3M4QA 3K81C 3J81i 2I0QA 4LFAL 1WYDA 4BY7G 2D62A 4DR7Q 1J5EQ 2A1AA 1LUZA 2JA9A 3M9BA 4DAYB 4BY1H 1XNQL 4DV0Q 3AFQA 5C4XG 2HHHQ 1CKNB 4YCWA 1X65A 1C9OA 1BBUA 1FGUA 4TQUS 1L0WA 2UXDL 4JI0Q 4DV4Q 3I4OA 5IP7G 2JQOA 2B63H 4JI1L 4L5QA 3HOXG 2I5MX 1QVCA 2JEBI 4P72A 3FKIH 2RHSB 3M4PA 4QY7A 4DR3L 3S1RH 3F1ZA 2KCTA 1EFWA 4H02A 2CKZB 1KRTA 1JMCA 1Q46A 2E5LL 2UUAL 2ZJQA 4JI6L 1N9WA 5M3FG 1VQ9A 1HZ9A 4KHZA 3SGIA 3CCSA 5FJ8H 1C0AA 1L1OC 5LMUL 1N33L 4ALPA 1HNWL 1C7YA 5IWAL 1P8LA 3HKZG 1SLJA 1EWIA 1UE7A 2VL6A 4KLKA 4A93H 1Y1WH 4DR5Q 2ZJRA 1VQPA 4OWWB 4BBSG 1PH1A 1YVCA 4JBMA 1XNRL 2K50A 3AYHB 4KI0A 4BXXG 2A19A 1HNZQ 1HJPA 2K5HA 3H0GG 4C3JH 1PH6A 2B3GA 4LF8Q 1JJCB 4OXPA 1I6HH 5IYCG 3W1BA 1VQ7A 1VQ5A 4GKKQ 1VQJA 4DK3C 4X66L 1PA6A 3BZCA 1TWCH 1Q12A 1IBLQ 4UPAA 5IT9c 4B3TQ 3S2DH 3UE0A 5K36G 5ELOA 1UEBA 3KJOA 5JJKA 3CCJA 4LF6L 4BBRH 4R4OA 1CSQA 4GN5A 1EQRA 3M4OH 4R4CA 3J7A5 1LYLA 5GAHC 2XGTA 4DPGA 4OWXB 5IYDG 4A3JG 3STBC 4O0AA 2OWOA 4A3GG 1HZAA 1FL0A 4DKAC 1OXXK 1TWFH 1NY4A 2PI2E 2WP8J 1X3FA 4JC0A 4LF7Q 4OO1G 2CWAA 4UP7A 5IY0A 3PIOA 3I4NG 1SMXA 1VQDA 3EBEA 4FDBA 1QUQB 1Q86C 3J81c 2UUBL 3PUVA 1VQ6A 1IBKQ 2YV5A 4DAMA 4A3LH 2E8GA 4LF9Q 1A0IA 4JG2A 1Q82C 5HY6A 1IXRA 1IZ6A 3RR5A 4HJ9A 3H15A 2DGYA 1K73C 2JA5G 1GD7A 2QA4A 1SE8A 2BH2A 2JEAI 1KIXA 2K14A 4JV5Q 1JT8A 1N32L 5C3EH 2ZM6L 1KD1C 1VQOA 1IBMQ 1PH5A 4DV2Q 3HOUG 3GD7A 1L1OA 3GTQH 3S1NH 2CFMA 4POFA 2BA1A 2EXDA 2C35B 5GQOA 1I94L 3CAMA 4JI4L 2K5VA 4DNIA 4DR6Q 4A3EH 4DV3L 4BA2I 1YHAA 3G48A 5GROA 4HJ5A 2OTLA 4LFCL 3RNUA 4IFDI 5FLMG 1KC8C 4JI2Q 2YTXA 3S15H 3JAMi 5M5WH 2VUMG 2ZJPA 4AQYL 4DR2L 2KHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LXK A;  1G29 1;  1Z9F A;  3I2Z A;  4LUO A;  4L5S A;  4KHP Q;  1VQF A;  4X65 Q;  3AQQ A;  2UXB Q;  5LMU Q;  2A8V A;  1J6Q A;  5E7N A;  5J3B A;  3CC7 A;  1XPU A;  2GN5 A;  4JI7 Q;  3FP9 A;  4A3K H;  2ATW A;  2HIX A;  2RHQ B;  1NTG A;  4J15 A;  3GTK H;  2WFW A;  1A62 A;  4OX9 L;  4MTN A;  3BJU A;  3G4S A;  4XIG S;  1EUJ A;  3ULP A;  1W3S A;  3KLW A;  3KYH C;  2MO0 A;  4IJH A;  4B3R Q;  1D7Q A;  3OTO L;  3Q8D A;  4DV6 Q;  5C4J H;  3A74 A;  3D0F A;  3CW2 C;  1AE2 A;  2HQL A;  5ELN A;  4OON A;  4DR4 L;  1EIY B;  3HOV G;  4B3M Q;  1Q1E A;  2RCN A;  1U0L A;  1JE5 A;  1Q8K A;  1TWG H;  5HGQ A;  4IO9 A;  2AMC B;  2F3I A;  4IOC A;  1XPO A;  4A75 A;  3PF4 A;  4A3D H;  1QZG A;  4AYB G;  1HR0 Q;  2R7D A;  1FVI A;  1K0R A;  1MJC A;  2OTJ A;  1OXT A;  4LF4 L;  1SR3 A;  3L0O A;  1N36 L;  3W5O A;  4IPG A;  4A3B G;  3B6Y A;  5C0X I;  1HZC A;  3CCQ A;  1T9H A;  4MZ9 A;  2R92 H;  1TWH H;  5IE8 A;  2HIV A;  4QJF A;  1E1T A;  2NVQ H;  2NVT H;  2ZTC A;  3IRB A;  1VQE A;  3PO3 H;  4QQB X;  1FJG L;  5BR8 Q;  2MO1 A;  3NEL A;  2VQF L;  1E22 A;  1NE3 A;  2ES2 A;  2JA7 H;  3GTJ H;  2NN6 I;  4X62 Q;  4K0K L;  1K8A C;  1Y14 B;  2ZTD A;  3CPF A;  3KF8 B;  5FJ8 G;  4PMW A;  3G6E A;  3DLL A;  1YJW A;  3M3Y H;  4LFB L;  2JA6 H;  2PI2 A;  1AH9 A;  1YBY A;  1A8V A;  3JAM c;  3TS0 A;  5EAY A;  4B3S Q;  3G71 A;  4NXM Q;  1D8L A;  4C3H H;  1L1O B;  1X55 A;  3L2P A;  4DV5 L;  3S2H H;  4JI5 L;  1YJN A;  5LMN W;  4ME3 A;  2EQS A;  1PH2 A;  5DLQ E;  2Y0S G;  1B70 B;  4EX5 A;  1SRO A;  2H5X A;  4JI3 Q;  1VQB A;  3CC2 A;  4GN4 B;  4LF5 L;  4X6A H;  3PV0 A;  5LMN L;  1I50 H;  4DR1 Q;  2E2I H;  3UDI A;  2KBN A;  1DGS A;  2VZA A;  4IJL A;  3M85 A;  1HNX Q;  1JJG A;  4BY7 H;  3KF6 B;  2L15 A;  3U50 C;  4BBR G;  1XMO L;  1A63 A;  1YIJ A;  3I55 A;  3HOY H;  1R9T H;  1VQL A;  3CD6 A;  1VQI A;  4DUY L;  5C4X H;  1SN8 A;  3PSI A;  3BU2 A;  2F4V L;  1XPR A;  1MIU A;  2WAQ E;  4DV7 L;  1N8R C;  4DUZ Q;  3GTG H;  4IOA A;  4JYA L;  4RG1 A;  3CF5 A;  2KCM A;  4AYB E;  5IP7 H;  3A5U A;  2IT1 A;  4LW1 A;  3HOX H;  4GN3 B;  3T1H Q;  1QVG A;  4A76 A;  4A3F G;  4A3C G;  4A3L G;  5GAE C;  1X56 A;  2CCZ A;  3CME A;  4JI8 L;  1E3P A;  2VS1 A;  5M3F H;  2BH8 A;  2R7Z H;  4P71 A;  1GVP A;  2Q2T A;  3F2B A;  4GLX A;  4JBW A;  5H1S E;  5AJ3 L;  1G6P A;  1LM0 A;  4YY3 L;  3AFP A;  3CQZ H;  4X64 L;  1KRS A;  2VQE L;  1PH8 A;  4NXN Q;  2N8N A;  2QEX A;  4GKJ Q;  4PZ6 A;  2UU9 Q;  1AE3 A;  2K75 A;  1SRU A;  2AWN A;  1XMQ L;  4YHH L;  1N34 Q;  1Y1V G;  3H0G H;  1VCI A;  4WJ4 A;  1VQA A;  1S40 A;  1K9M C;  3UDX A;  3S1M H;  2UUC L;  1CUK A;  3E9H A;  1WCM G;  2GVA A;  4YWL A;  5IYC H;  1X9N A;  1VQM A;  1EQQ A;  3TEH B;  4DV1 Q;  2OCE A;  3NEN A;  4LFA Q;  3MEF A;  3RN5 A;  2E2J H;  1JJ2 A;  3HOZ G;  3J81 j;  2Q2I A;  1I5F A;  2R6G A;  2XTI A;  3UDG A;  1PFS A;  1XNQ Q;  2Y0S E;  2VY3 A;  5GAG C;  4O2D A;  1EOV A;  3I4M G;  4A3M H;  2N78 A;  4WJ3 M;  1J5E L;  2D0O A;  1JB7 A;  4OWT B;  4A3G H;  3CMA A;  2UXD Q;  1HZB A;  2V1C C;  4GOP A;  5JJL A;  1M1K C;  4DV0 L;  1LTL A;  4IPC A;  4JI1 Q;  2HHH L;  3HOW G;  1VS0 A;  4DR3 Q;  4A3K G;  3KF6 A;  1WJJ A;  5IYB H;  3RZD H;  3I4N H;  3ULJ A;  4LWC A;  4HJ8 A;  1PH7 A;  2E5L Q;  2NVY H;  3KDF A;  4JI0 L;  2UUA Q;  4JI6 Q;  3ZJY C;  4DV4 L;  2LSS A;  1VQK A;  3K7A H;  1N33 Q;  1HNW Q;  5C44 H;  3H3V H;  5IWA Q;  3JC6 6;  2D0P A;  2K4K A;  3KJP A;  4C3I H;  3CPW A;  3I56 A;  2UXC L;  1CKM A;  3TS2 A;  2JA5 H;  2GVB A;  1H95 A;  2N49 A;  1Q1B A;  4YWK A;  4A3I H;  1XNR Q;  2NZH A;  2JA8 H;  4YCV A;  3U4V A;  1K8G A;  4DK6 C;  2PQA A;  2YYZ A;  1B8A A;  5FLX c;  1PH4 A;  1KAW A;  3E9I A;  3J80 i;  3HOU H;  4A3D G;  4DR5 L;  3UE1 A;  3KOJ A;  4XTC S;  3F2C A;  4IPH A;  2OQ0 A;  2IY5 B;  4X66 Q;  1KQS A;  1BBW A;  1VQ4 A;  1YEZ A;  1MJE A;  1HNZ L;  5JEA J;  4NPS A;  4LF8 L;  2WB1 E;  4IFD G;  3U58 A;  1EIF A;  2WAQ G;  3ERS X;  1ASY A;  1L2F A;  4LF6 Q;  4GKK L;  1MKH A;  2F52 A;  5IP9 G;  4Y7N H;  3CCM A;  5FLM H;  2CWP A;  2IX0 A;  1IBL L;  3CCE A;  4HIK A;  4JOI C;  3CCV A;  2E2H H;  3WWV A;  4B3T L;  2VUM H;  4YWM A;  4BA1 I;  3CCR A;  2VW9 A;  1UE5 A;  4P74 A;  4BY1 G;  4EQ5 A;  1GO3 E;  1OXV A;  1YIT A;  1PV4 A;  2VNU D;  2MFI A;  3PUW A;  2UUB Q;  1HH2 P;  1TWA H;  3EN2 A;  4LF7 L;  2B63 G;  1PVO A;  1PH3 A;  4YHH Q;  1O7I A;  3FKI G;  1E24 A;  3DM3 A;  1W2B A;  1RL2 A;  1IYJ B;  3PUY A;  2R93 H;  1CKO A;  5M5X H;  1IBK L;  4LF9 L;  3E0E A;  1N32 Q;  2ZM6 Q;  1GM5 A;  3A0J A;  2ZTE A;  3HOV H;  2AKW B;  2Z0S A;  4A93 G;  3FHW A;  1Y1W G;  3A5Z B;  4JV5 L;  4C2M H;  3S14 H;  1PYB A;  4MNO A;  1E1O A;  1I94 Q;  3PO2 H;  3RLN A;  1WOC A;  3ER0 A;  4GLV B;  1TXY A;  3J7Z C;  1IBM L;  4JI4 Q;  4DV2 L;  2YTY A;  2JK8 A;  4IPD A;  4DV3 Q;  4YCU A;  5C0X G;  3RN2 A;  3HOY G;  3K0X A;  4LFC Q;  3RLF A;  1VQ8 A;  1UWV A;  4A3B H;  4HIM A;  4GOP B;  5M3M H;  4DR6 L;  4UP9 A;  4AQY Q;  4DR2 Q;  1XJV A;  2AHO B;  2AWO A;  4GOP C;  1NMG A;  3PF5 A;  3TQY A;  2FXQ A;  3K8A A;  3J80 c;  3KDF B;  5JEA G;  1CSP A;  2NN6 G;  3RZO H;  4JI2 L;  4QIW E;  2NZO A;  3VDY A;  1UE1 A;  4R1J A;  3S1Q H;  4JOI A;  1BKB A;  2R7Z G;  2UXC Q;  1QZH A;  4KHP L;  4X65 L;  4LNQ A;  1YJ9 A;  2UXB L;  1Q7Y C;  4OX9 Q;  3LGJ A;  4NB3 A;  2YTV A;  1VQC A;  1GKH A;  2RF4 A;  1ASZ A;  4OO1 I;  4JI7 L;  4Y52 H;  4UY8 C;  3GO5 A;  3L7Z C;  1E7Z A;  1OXU A;  2PQA B;  3OTO Q;  4GS3 A;  2JE6 I;  4JBK A;  4L5T A;  1UE6 A;  2I5H A;  2IX1 A;  2NVX H;  5M5Y H;  4DR4 Q;  3HFZ B;  1VQG A;  1QVF A;  1BVS A;  4B3R L;  2PMZ E;  2Z6K A;  3T1Y L;  3H3V I;  1NBW A;  2WB1 G;  3F8T A;  3K7U C;  1OXS C;  4DV6 L;  1YHB A;  5GAD C;  4BBS H;  2OQK A;  3I7F A;  5C3E G;  5JJI A;  4IFD J;  1HR0 W;  1V43 A;  4B3M L;  1X54 A;  4BXX H;  1KL9 A;  4GNX A;  4LF4 Q;  1NJI C;  1N36 Q;  2KHJ A;  4P75 A;  3CC4 A;  1HR0 L;  4A3M G;  3GTM H;  3U4Z A;  4APV A;  4A3E G;  1B7Y B;  4A4I A;  4HJA A;  3EIV A;  4AH6 A;  3TRZ A;  3PUX A;  3D31 A;  1Q81 C;  1FJG Q;  2ASB A;  2MQH A;  3AEV A;  5IYB G;  2VQF Q;  1S72 A;  4POG A;  2B29 A;  1I3Q H;  2IHF A;  2MNA A;  4A3F H;  2Q2U A;  4QGU A;  4A3J H;  1SFO H;  4DR7 L;  4R4T A;  4A3C H;  2HT1 A;  4K0K Q;  3PIP A;  5IYD H;  1YI2 A;  4LFB Q;  1CKN A;  5BR8 L;  2ALY B;  3ULL A;  3CP0 A;  4TVA B;  5C44 G;  4JBJ A;  1PH9 A;  4JCV E;  4X62 L;  4PG3 A;  3UDF A;  1KHI A;  1OTC A;  3CCU A;  4DV5 Q;  3OW2 A;  4A3I G;  4JI5 Q;  2BA0 A;  2JA8 G;  2ID0 A;  2Q2H A;  1Y1V H;  4B3S L;  4RMF A;  2DUD A;  4NXM L;  3BZK A;  2IHE A;  2JJQ A;  4L5R C;  3S17 H;  4LF5 Q;  3W1G A;  2CQO A;  1WCM H;  1U5K A;  5LMN Q;  4HIO A;  1VQN A;  5C0X J;  1Z47 A;  3OYY A;  3HKZ E;  3RLO A;  4JI3 L;  2PNH A;  2YU9 H;  3NBH B;  3HOZ H;  1XMO Q;  1M90 C;  4DR1 L;  3GTL H;  3M7N A;  4DUY Q;  1HNX L;  3I4M H;  2F4V Q;  3STB D;  4DV7 Q;  1WI5 A;  2K52 A;  3PUZ A;  3NEM A;  1X6O A;  2I5L X;  4JYA Q;  2N3S A;  2R92 G;  4R4I A;  1EYG A;  4LUV A;  3GTO H;  1V1Q A;  3HOW H;  1YZ6 A;  4HJ7 A;  2LXJ A;  2QGQ A;  3MXN B;  4GLA C;  4DUZ L;  1YHQ A;  1PHJ A;  3ICE A;  3PO3 G;  1G51 A;  1K83 H;  4JI8 Q;  1X3G A;  4PZ7 A;  3K80 C;  3PGZ A;  3TRE A;  4HID A;  2JA7 G;  3T1H L;  2R93 G;  5AJ3 Q;  3GTP H;  4YY3 Q;  3T1Y Q;  1VQH A;  2KEN A;  4X64 Q;  2VQE Q;  4UP8 A;  3HKS A;  2EIF A;  1X3E A;  1K3R A;  4P73 A;  1RIP A;  4QL5 A;  1QUQ A;  3PCO B;  2JA6 G;  2K5N A;  1XMQ Q;  1YNX A;  2Z6K C;  1PYS B;  1XTD A;  4NXN L;  2UUC Q;  4GKJ L;  1P16 A;  4GNX B;  4PZ8 A;  2UU9 L;  3PO2 G;  4LUZ A;  4AIM A;  3CXC A;  3S16 H;  1N34 L;  1NMF A;  1WFQ A;  2R7F A;  4GNX C;  1KXL A;  4R4Q A;  1V9P A;  3F2D A;  3KFU A;  1S3O A;  1IL2 A;  5M3M G;  3S24 A;  3GDE A;  5IP9 H;  4DV1 L;  3CCL A;  3M4Q A;  3K81 C;  3J81 i;  2I0Q A;  4LFA L;  1WYD A;  4BY7 G;  2D62 A;  4DR7 Q;  1J5E Q;  2A1A A;  1LUZ A;  2JA9 A;  3M9B A;  4DAY B;  4BY1 H;  1XNQ L;  4DV0 Q;  3AFQ A;  5C4X G;  2HHH Q;  1CKN B;  4YCW A;  1X65 A;  1C9O A;  1BBU A;  1FGU A;  4TQU S;  1L0W A;  2UXD L;  4JI0 Q;  4DV4 Q;  3I4O A;  5IP7 G;  2JQO A;  2B63 H;  4JI1 L;  4L5Q A;  3HOX G;  2I5M X;  1QVC A;  2JEB I;  4P72 A;  3FKI H;  2RHS B;  3M4P A;  4QY7 A;  4DR3 L;  3S1R H;  3F1Z A;  2KCT A;  1EFW A;  4H02 A;  2CKZ B;  1KRT A;  1JMC A;  1Q46 A;  2E5L L;  2UUA L;  2ZJQ A;  4JI6 L;  1N9W A;  5M3F G;  1VQ9 A;  1HZ9 A;  4KHZ A;  3SGI A;  3CCS A;  5FJ8 H;  1C0A A;  1L1O C;  5LMU L;  1N33 L;  4ALP A;  1HNW L;  1C7Y A;  5IWA L;  1P8L A;  3HKZ G;  1SLJ A;  1EWI A;  1UE7 A;  2VL6 A;  4KLK A;  4A93 H;  1Y1W H;  4DR5 Q;  2ZJR A;  1VQP A;  4OWW B;  4BBS G;  1PH1 A;  1YVC A;  4JBM A;  1XNR L;  2K50 A;  3AYH B;  4KI0 A;  4BXX G;  2A19 A;  1HNZ Q;  1HJP A;  2K5H A;  3H0G G;  4C3J H;  1PH6 A;  2B3G A;  4LF8 Q;  1JJC B;  4OXP A;  1I6H H;  5IYC G;  3W1B A;  1VQ7 A;  1VQ5 A;  4GKK Q;  1VQJ A;  4DK3 C;  4X66 L;  1PA6 A;  3BZC A;  1TWC H;  1Q12 A;  1IBL Q;  4UPA A;  5IT9 c;  4B3T Q;  3S2D H;  3UE0 A;  5K36 G;  5ELO A;  1UEB A;  3KJO A;  5JJK A;  3CCJ A;  4LF6 L;  4BBR H;  4R4O A;  1CSQ A;  4GN5 A;  1EQR A;  3M4O H;  4R4C A;  3J7A 5;  1LYL A;  5GAH C;  2XGT A;  4DPG A;  4OWX B;  5IYD G;  4A3J G;  3STB C;  4O0A A;  2OWO A;  4A3G G;  1HZA A;  1FL0 A;  4DKA C;  1OXX K;  1TWF H;  1NY4 A;  2PI2 E;  2WP8 J;  1X3F A;  4JC0 A;  4LF7 Q;  4OO1 G;  2CWA A;  4UP7 A;  5IY0 A;  3PIO A;  3I4N G;  1SMX A;  1VQD A;  3EBE A;  4FDB A;  1QUQ B;  1Q86 C;  3J81 c;  2UUB L;  3PUV A;  1VQ6 A;  1IBK Q;  2YV5 A;  4DAM A;  4A3L H;  2E8G A;  4LF9 Q;  1A0I A;  4JG2 A;  1Q82 C;  5HY6 A;  1IXR A;  1IZ6 A;  3RR5 A;  4HJ9 A;  3H15 A;  2DGY A;  1K73 C;  2JA5 G;  1GD7 A;  2QA4 A;  1SE8 A;  2BH2 A;  2JEA I;  1KIX A;  2K14 A;  4JV5 Q;  1JT8 A;  1N32 L;  5C3E H;  2ZM6 L;  1KD1 C;  1VQO A;  1IBM Q;  1PH5 A;  4DV2 Q;  3HOU G;  3GD7 A;  1L1O A;  3GTQ H;  3S1N H;  2CFM A;  4POF A;  2BA1 A;  2EXD A;  2C35 B;  5GQO A;  1I94 L;  3CAM A;  4JI4 L;  2K5V A;  4DNI A;  4DR6 Q;  4A3E H;  4DV3 L;  4BA2 I;  1YHA A;  3G48 A;  5GRO A;  4HJ5 A;  2OTL A;  4LFC L;  3RNU A;  4IFD I;  5FLM G;  1KC8 C;  4JI2 Q;  2YTX A;  3S15 H;  3JAM i;  5M5W H;  2VUM G;  2ZJP A;  4AQY L;  4DR2 L;  2KHI A; 
#chains in the Genus database with same CATH topology
 3BYT B;  3N52 A;  3I2Z A;  1ICF B;  1VQF A;  1B4O A;  2LKV A;  5E7N A;  1PTO D;  4K6D A;  4JI7 Q;  3FP9 A;  5C4X B;  1ZYR D;  2PO4 A;  2HIX A;  3GTK H;  2WFW A;  2K04 A;  4OX9 L;  4MTN A;  5A2Q L;  2K6A A;  4XIG S;  1S5F D;  1EUJ A;  1WD0 A;  3KYH C;  4KK7 A;  4B3R Q;  3OTO L;  3Q8D A;  4WJW A;  1EIH A;  3D0F A;  1KAB A;  4C1N I;  5M3F B;  2F0J A;  2HQL A;  2EZV A;  4DR4 L;  1Y8O B;  1EIY B;  3BVG A;  1BCP B;  1CFM A;  1U0L A;  4K8J A;  1TWG H;  3HKZ B;  3CQZ B;  1HXY D;  4PV1 C;  1JOR A;  3HEJ A;  3BS1 A;  3T16 A;  2EY2 A;  1DCZ A;  4LF4 L;  1N36 L;  4K5X A;  4IFD H;  1E2Z A;  4A3B G;  1HZC A;  4G57 A;  1EEF D;  2R92 H;  4ZKC B;  2NVQ H;  2ZXP A;  2E2J B;  1FJG L;  1NUC A;  2MO1 A;  2VQF L;  4OIJ A;  4K0K L;  5JJZ A;  1PDQ A;  1YJW A;  4LFB L;  1EZ8 A;  1I4R A;  5C4Z A;  1I4H A;  1SAP A;  3JAM c;  4B3S Q;  1D6E C;  1X55 A;  3A54 A;  4MTK A;  2EQS A;  3E0J A;  1PH2 A;  2EYF A;  1B70 B;  1V8Q A;  1SRO A;  5IIF A;  4LF5 L;  2Z9H A;  3M85 A;  1CTM A;  2L15 A;  4QF4 A;  3HOU B;  5C0X H;  3HOY H;  1PXU A;  1R9T H;  4DUY L;  3A56 A;  1SN8 A;  3PSI A;  1VMP A;  3BU2 A;  4IUV A;  5J39 A;  1U4R A;  1MIU A;  2B2Y A;  4L8J A;  3I70 A;  3CF5 A;  3A5U A;  2IT1 A;  3HOX H;  4GN3 B;  2L5T A;  4DK1 A;  2WKC A;  4A3L G;  3OIP A;  1D2B A;  1X56 A;  4HMI A;  1E3P A;  2R7Z H;  2BH8 A;  4P71 A;  4GLX A;  4JBW A;  4DGZ A;  2K7V A;  4NXN Q;  2VQE L;  1ZYR C;  2QEX A;  3S9W A;  2UU9 Q;  4HMJ A;  1TY0 A;  3Q24 A;  3R93 A;  3C46 A;  3H0G H;  1K9M C;  1PYW D;  3UDX A;  2R93 B;  3E9H A;  4X3K A;  5IYC H;  1VQM A;  5EKK A;  3NEN A;  4J6H A;  1SE2 A;  2JP1 A;  1B3A A;  5K36 H;  1A2T A;  2G9D A;  1XNQ Q;  1CT1 D;  2SNS A;  1B9M A;  4F8M A;  3PO2 B;  2N78 A;  4WJ3 M;  1SND A;  5EGT A;  1LO5 D;  2EY1 A;  1JB7 A;  1HZB A;  3VR3 A;  4GOP A;  4OO1 H;  1W6J A;  4A3B B;  3D4W A;  1VS0 A;  4ZAI A;  3KF6 A;  4CDD C;  3ULJ A;  4LWC A;  1SEB D;  1PH7 A;  4JI6 Q;  1VQK A;  3NWT A;  3T51 B;  2RVL A;  2K4K A;  4LK1 C;  5CYU A;  4CBV A;  3TS2 A;  2JA5 H;  3OWE B;  4A3I H;  1XNR Q;  1STG A;  2NZH A;  4FF4 A;  3TP5 A;  2MP1 A;  5FLX c;  3J80 i;  4IN3 A;  4J1M A;  3A7A B;  4X66 Q;  1MJE A;  4NPS A;  4IFD G;  1QOH A;  4RGN A;  1ASY A;  2WAQ G;  4YIJ A;  1WTQ A;  1MKH A;  2F52 A;  5IP9 G;  1SNM A;  3FPP A;  5FLM H;  2CWP A;  1B53 A;  4I7A A;  2VUM H;  4YWM A;  3ZYY X;  2VW9 A;  1YIT A;  1PV4 A;  2VNU D;  2MGS A;  3M4O B;  3PUW A;  4LMQ D;  1FD7 D;  4LF7 L;  4CKB A;  4U67 3;  1PVO A;  1CZW A;  1PH3 A;  1IYJ B;  3RMH A;  3VA5 A;  1I3Q B;  1IBK L;  4EQN A;  4A3J B;  3E0E A;  2KCN A;  2ZM6 Q;  2ZTE A;  1SNC A;  5A2Q E;  3TDQ A;  4C2M H;  1I94 Q;  1WOC A;  1SJH D;  5FO8 B;  2SNM A;  5I2X A;  4YCU A;  5C0X G;  5L37 A;  3HOY G;  3K0X A;  2BCO A;  5M3M H;  3ITP A;  4UP9 A;  1JOO A;  3BVZ A;  1XJV A;  5EPL A;  2L4N A;  4TKO B;  4GOP C;  4OL7 A;  1BNZ A;  3J80 c;  3KDF B;  1CSP A;  1JCK B;  1UE1 A;  2PPB C;  2R7Z G;  1QZH A;  4HCS A;  4LNQ A;  3MXN A;  1XWE A;  1SXT A;  4RHR A;  4UY8 C;  3GO5 A;  3T13 A;  1OXU A;  4FO2 A;  4DAV A;  2VB3 X;  4JBK A;  1BCP D;  1PZK D;  3NWS A;  1ET9 A;  2I5H A;  2IX1 A;  1HFN A;  4QCL A;  1VQG A;  1M4V A;  3IAY A;  3GTP B;  2Z6K A;  3H3V I;  1RDP D;  1TKW B;  4DV6 L;  4BBS H;  2BDN A;  3I7F A;  1HR0 W;  2O5I C;  1KLG D;  4BXX H;  1KL9 A;  1J8I A;  3DM1 A;  2KHJ A;  2QF7 A;  3S16 B;  1B7Y B;  4A4I A;  3J81 L;  2QDB A;  3CRL C;  5E1F A;  1ESF A;  3QG1 A;  4XDX A;  1Q81 C;  2WAQ B;  2ASB A;  4HN7 A;  4FXD A;  2B29 A;  2MNA A;  4A3F H;  3BDO A;  2M2L A;  4R4T A;  1ET6 A;  3PIP A;  3T53 B;  3T4A C;  2DNC A;  1YI2 A;  5K5P A;  3CP0 A;  4JBJ A;  5FO7 B;  3Q23 A;  1ENA A;  4PG3 A;  4FF1 A;  1SYE A;  3UDF A;  4DV5 Q;  4A3I G;  1E2V A;  5KNB A;  1OO9 B;  3NTH A;  3BZK A;  3NPP A;  3W2D A;  5LMN Q;  4XQJ A;  1WCM H;  1DOK A;  2K28 A;  1CK1 A;  3AU7 A;  3RLO A;  4JI3 L;  2L0C A;  1DOL A;  1XMO Q;  4JPB W;  2K01 A;  1D5M C;  3GTL H;  4FF3 A;  2HUG A;  3I4M H;  1IHZ A;  1EU3 A;  4DV7 Q;  1WI5 A;  2Y0S B;  2DJG C;  1I6H B;  3HOY B;  3R3O A;  4LUV A;  1LTG D;  1V1Q A;  2A6E C;  1STH A;  4HJ7 A;  3HOW H;  4GLA C;  2FMC A;  3CU7 A;  1G51 A;  4JI8 Q;  4DAP A;  3PGZ A;  2FHT A;  1CM9 A;  3NQI A;  2C5C A;  4ILW A;  5CBA E;  4YY3 Q;  1MSG A;  4X64 Q;  3L9A X;  1H9K A;  5EPK A;  4R9W A;  2R7Z B;  1RIP A;  1TWF B;  1QUQ A;  5JPM C;  1YNX A;  5EKI A;  2Z6K C;  3E5S A;  4GKJ L;  1D1K A;  1P16 A;  1BCP C;  3K5N A;  1WFQ A;  3OPO A;  1V9P A;  3R8B A;  5M3M G;  5JVH 3;  2RQX A;  4DV1 L;  3M4Q A;  2LY7 A;  3QWN A;  2QDL A;  4M1U B;  4F7X A;  2WV6 D;  2D62 A;  5KEE A;  1J5E Q;  2JA9 A;  3GV6 A;  1O78 A;  2HHH Q;  2RCF A;  3JAM L;  1C9O A;  1FGU A;  1L0W A;  2JSO A;  1FR3 A;  2B63 H;  4L5Q A;  3C3L A;  2CKZ B;  2E5L L;  3ERQ A;  2UUA L;  1WTV A;  1C0A A;  5FJ8 H;  4DXG A;  1N33 L;  3P75 A;  3VYT A;  1AEX A;  1DON A;  3MFY A;  2XIW A;  1UE7 A;  4KLK A;  4ZLT F;  5D3D A;  4BBS G;  4OWW B;  4L63 B;  1E0B A;  1YVC A;  4JBM A;  5ELE A;  4A3I B;  4BXX G;  4C3J H;  2K5H A;  1BUV T;  4LF8 Q;  3R2T A;  3LWU A;  5T1G A;  3OMG A;  1RCV D;  1VQJ A;  4DK3 C;  1GOZ A;  1VQ5 A;  4GKK Q;  1IBL Q;  5ELC A;  3KK7 A;  2A74 C;  5ELO A;  5JJK A;  4LF6 L;  1V1O A;  3FDT A;  3ERO A;  1LYL A;  1STY A;  5G3L D;  1I6V C;  4DPG A;  3TZD A;  1AZQ A;  2OWO A;  4A3G G;  1FL0 A;  1Q3L A;  1SYC A;  5IY0 A;  4RKB A;  1VQD A;  4FDB A;  3SEB A;  1B44 D;  4DAM A;  1A0I A;  2EDG A;  5HY6 A;  5I9O A;  4FXG C;  2FIN B;  3GTJ B;  3MZ5 A;  4C3I G;  3H15 A;  2EY5 A;  1GD7 A;  4K8I A;  4JV5 Q;  2K14 A;  4KY7 A;  1BO0 A;  4N9T A;  3GTQ H;  1L1O A;  2EXD A;  4PMC A;  2C35 B;  1VF7 A;  3RUZ A;  2K5V A;  3VR6 A;  4DR6 Q;  1O7Z A;  4A3E H;  3P7J A;  1Y8N B;  2OTL A;  2AQ3 B;  1I50 B;  2E2I B;  4LAA A;  5M5W H;  1LTB D;  4S3S A;  4LUO A;  1KTK A;  1EY7 A;  3AQQ A;  2JN4 A;  2XSC A;  3J81 E;  2A8V A;  1Q90 A;  2F0T A;  5J3B A;  3X3N A;  3D6W A;  1XPU A;  2GN5 A;  2ATW A;  5FLX L;  1HQR D;  3GTG B;  3MWY W;  1A62 A;  3D3R A;  3URY A;  1KDB A;  1I4P A;  2M00 A;  1WTW A;  2MO0 A;  3OW7 A;  4G7Z C;  3DWA A;  2NB0 A;  2N88 A;  3D8G A;  3CW2 C;  4N8F A;  5ELN A;  1H9R A;  4OON A;  3HOV G;  1Q1E A;  4IOC A;  4IO9 A;  4K2L A;  2F3I A;  3PF4 A;  2E2D C;  1QZG A;  4X3S A;  1FVI A;  1K0R A;  3NP8 A;  4NMZ A;  1XXG A;  3SR1 A;  3W5O A;  1EY9 A;  3CCQ A;  2XNA C;  1MHW C;  4Q5V A;  2KED A;  2HIV A;  4O42 A;  3EJI A;  1VQE A;  4CGY B;  2Z8L A;  3E3X A;  3KLR A;  1E22 A;  2ES2 A;  1JOQ A;  2JA7 H;  4X62 Q;  4M8A A;  3CPF A;  5FJ8 G;  3G6E A;  4A3G B;  2F0U A;  1BOS A;  1WTX A;  1AH9 A;  1A8V A;  3TS0 A;  3RZD B;  3G71 A;  4ODG A;  4NXM Q;  1ZEQ X;  4QMG A;  5CBE E;  3S2H H;  3K5L A;  2NVY B;  4JI5 L;  1NR2 A;  1HUN A;  5IGC A;  4C3J G;  1IYU A;  2RA4 A;  4EX5 A;  3A55 A;  3M4Y A;  1C8C A;  4C3I B;  1SYF A;  3D4R A;  3J80 L;  1HTL D;  3H3V C;  5HUR A;  1DGS A;  2JA8 B;  2AUK A;  4BY7 H;  1DJR D;  1SBB B;  3KF6 B;  1A63 A;  2EJM A;  3MA2 B;  3CD6 A;  2F4V L;  2F0D A;  1F2Z A;  1O7L A;  4DUZ Q;  2E76 C;  2P5Z X;  4JYA L;  2KCM A;  2PZT A;  2Z4H A;  4Y7N B;  4LW1 A;  1DOM A;  2NN6 H;  3K59 A;  2RBM A;  3BVM A;  1QVG A;  4A3C G;  1RD9 D;  2Z6B A;  3R2I A;  5GAE C;  3CRK C;  2VS1 A;  1GVP A;  1U4M A;  3JAM E;  3F2B A;  5H1S E;  5AJ3 L;  2EYJ A;  1PH8 A;  2N8N A;  1Q8I A;  3IFT A;  1SSO A;  1TQO A;  5LL6 S;  1XMQ L;  1Y1V G;  4WJ4 A;  1KAA A;  1S40 A;  2H4O A;  1GUO A;  2UUC L;  4YWL A;  5M5X B;  1X9N A;  3TEH B;  2Z4I A;  2OCE A;  2A73 B;  2K5W A;  1A15 A;  1BCP F;  3HOZ G;  3HOV B;  1PFS A;  3DHQ A;  3TN2 A;  1U4P A;  3KBX A;  1PFN A;  5GAG C;  5KYL A;  2J0T D;  2PZU A;  2HDM A;  3ONA B;  3OOC A;  2UXD Q;  3DMU A;  4OIK A;  4DV0 L;  1QIL A;  4IPC A;  4JI1 Q;  3I4N H;  4DR3 Q;  3C2P A;  1GXD C;  3K7A H;  3OSO A;  3EQL C;  5C6A A;  1HNW Q;  5C44 H;  3H3V H;  5BN5 A;  3CPW A;  3V2T A;  3S1Q B;  1H95 A;  4YWK A;  2MPM A;  3U4V A;  4IUQ A;  4DK6 C;  2IW3 A;  1B8A A;  1PH4 A;  1FYC A;  1K28 A;  4DR5 L;  3UE1 A;  3KOJ A;  4XTC S;  3QR8 A;  3G7L A;  2IY5 B;  4ULL A;  2A68 C;  1G2S A;  4C3J B;  2NVX B;  2WB1 E;  5M5Y B;  3MFG A;  3ERS X;  2NZ1 D;  1G8Z D;  1EIG A;  1H9S A;  2IX0 A;  5C4H A;  3S1N H;  1VF5 C;  3CCR A;  4BA1 I;  1B50 A;  1HPC A;  1HCZ A;  1KNA A;  3QO2 A;  3VR2 A;  1HH2 P;  1GUS A;  1JWU D;  1TWA H;  2EYH A;  2OT2 A;  1YNN D;  1F9Q A;  3PUY A;  2K05 A;  4JK1 C;  4LF9 L;  1D5X C;  1HA5 A;  1GM5 A;  1QE6 A;  2AKW B;  2Z0S A;  2KEC A;  3DWQ A;  4A93 G;  2HCC A;  1Y1W G;  3S14 H;  1NSN S;  4MNO A;  2F0I A;  4DV2 L;  4ZK9 B;  4DV3 Q;  3NXW A;  1Y1V B;  2PZW A;  3MAQ A;  3RLF A;  4LFC Q;  1UWV A;  4HIM A;  2QKI C;  4DR2 Q;  1Y69 U;  2IL8 A;  3HOZ B;  2FXQ A;  5HGT A;  2IX3 A;  5JEA G;  3RZO H;  2NN6 G;  2KJX A;  4JI2 L;  4QIW E;  2F0E A;  4B08 A;  4R1J A;  3DEP A;  4KHP L;  4X65 L;  2B2W C;  1DYQ A;  4V0B A;  5EPJ A;  2UXB L;  4OX9 Q;  3LGJ A;  3NUC A;  4NB3 A;  1ASZ A;  1GKH A;  1GHK A;  3CHB D;  3GTO B;  3L7Z C;  1E7Z A;  2ZXR A;  3A8I E;  2PQA B;  3OTO Q;  4GS3 A;  2JE6 I;  1HHV A;  1STN A;  1UE6 A;  4DR4 Q;  3HFZ B;  1ONL A;  1H9J A;  1QVF A;  1BVS A;  1PTO C;  2WIN B;  2LS0 1;  2PMZ E;  3F8T A;  4CJ2 C;  1OXS C;  2BE5 D;  5GAD C;  2OQK A;  2XVS A;  1II3 A;  1Y8P B;  1X54 A;  4B3M L;  4GNX A;  3VR4 A;  4LF4 Q;  1N36 Q;  4FP5 D;  4CKE A;  5COY A;  1HR0 L;  3GTM H;  4APV A;  4HJA A;  3J80 E;  5EBC A;  4KY5 A;  1DD2 A;  3D31 A;  1FJG Q;  1NNX A;  3HZX A;  2VQF Q;  1MBY A;  2IHF A;  5CV9 A;  1SFO H;  5IYD H;  4DR7 L;  4K0K Q;  4LFB Q;  1CKN A;  2EY6 A;  5BR8 L;  1G6Z A;  2OF1 A;  5C44 G;  4JCV E;  3FRP B;  2G9H D;  3KUP A;  5KNC A;  5I2Y A;  5G3L F;  2BA0 A;  3SK8 A;  2ID0 A;  1X3P A;  1L0X B;  2Q2H A;  5IGG A;  3WOE A;  3S17 H;  4L5R C;  4LF5 Q;  5LL6 X;  1U5K A;  3OMC A;  1EOT A;  2J7Z A;  2M9V A;  2PNH A;  3BDL A;  2YU9 H;  5FKA C;  4A93 B;  4C56 C;  4DR1 L;  1Y1W B;  3M7N A;  2MUY A;  4DUY Q;  3V05 A;  1HNX L;  2HDL A;  1WTP A;  3PUZ A;  3H6M A;  1X6O A;  1FNV A;  2I5L X;  2R92 G;  2EYL A;  1YZ6 A;  2LXJ A;  2RSN A;  1K83 H;  1X3G A;  1PTO H;  3K80 C;  3NBI A;  1HUM A;  3QB3 A;  4PZ7 A;  4RAU C;  3TRE A;  4B9W A;  4HID A;  1WVL A;  3T1H L;  1JE4 A;  2BDO A;  1VQH A;  5CGK A;  2VQE Q;  4UP8 A;  3HKS A;  1X3E A;  1K3R A;  3EFX D;  3PCO B;  1KLU D;  1LTA D;  1ENF A;  5DNF A;  1JQY D;  4AIM A;  2PW7 A;  1N34 L;  4GNX C;  4R4Q A;  1EYA A;  3F2D A;  3S24 A;  4FYD A;  4LFA L;  4HR7 B;  1WYD A;  1BF4 A;  1I4X A;  4DR7 Q;  3M9B A;  4BY1 H;  3NBH A;  1X65 A;  3KLS X;  3I4O A;  1KNE A;  3MHB A;  3HOX G;  3M3Y H;  3S1R H;  3FKI H;  3M4P A;  2AQ1 B;  4QY7 A;  3S15 B;  2KCC A;  3F1Z A;  2KCT A;  1V1P B;  1EFW A;  4QUC A;  1VQ9 A;  2A5H A;  4KHZ A;  2WKD A;  3SGI A;  3K7A B;  5LMU L;  4ALP A;  5IWA L;  5C44 B;  1EWI A;  1PRT B;  4DN4 M;  2ZJR A;  1PH1 A;  3GTK B;  2K50 A;  4KI0 A;  4QUF A;  2A19 A;  4FXK C;  2XRQ D;  3H0G G;  1PH6 A;  1JJC B;  2RDF A;  4OXP A;  5IYC G;  2SOB A;  2A6H D;  4F88 A;  1TWC H;  1Q12 A;  4UPA A;  3OHX C;  5K36 G;  1PMR A;  3KJO A;  4BBR H;  4CDF C;  4GN5 A;  1TWG B;  1EQR A;  2XWB B;  1TR5 A;  4EGV A;  5IYD G;  4LF7 Q;  4OO1 G;  4UP7 A;  3PIO A;  3EBE A;  2R92 B;  2UUB L;  2F0L A;  2R3Z A;  1IBK Q;  5JOB A;  2NVQ B;  2E8G A;  2DY8 A;  1ILQ A;  1LTI D;  2V4D A;  2B2V C;  1K73 C;  2JA5 G;  2BH2 A;  2F0Q A;  1JT8 A;  5E4W C;  1MI2 A;  3QJY A;  1N32 L;  5C3E H;  1VQO A;  3O13 A;  2CFM A;  4POF A;  4TSS A;  5GQO A;  5D3I B;  3S14 B;  4JI4 L;  4DNI A;  1YNJ D;  4BA2 I;  4CDC C;  4IFD I;  1TS2 A;  5FLM G;  1I4G A;  2QIL A;  2VUM G;  2ZJP A;  4AQY L;  5JPN C;  2EOT A;  3RZO B;  4N8X 1;  5LMU Q;  1R9T B;  3PQI A;  1JWS D;  2C9O A;  2L12 A;  2Q8T A;  5TSS A;  1LT6 D;  4J15 A;  5D14 A;  1GUG A;  1QG7 A;  3HOX B;  1W3S A;  2VB2 X;  3KLW A;  3IL8 A;  4DV6 Q;  5C4J H;  1RTO A;  2NYZ D;  1EY5 A;  5I6Y A;  1JE5 A;  1AW7 A;  1Q8K A;  3TSS A;  5HGQ A;  2AMC B;  4A75 A;  1PTO F;  4HAE A;  4AYB G;  2RDH A;  3GV3 A;  1MJC A;  3K5M A;  1IYV A;  3H0G B;  3U9S A;  1TS3 A;  4JVZ A;  5C0X I;  1T9H A;  4MZ9 A;  1TWH H;  5IE8 A;  2FJ2 A;  4QJF A;  2NVT H;  3IRB A;  1J9O A;  1ILP A;  3PO3 H;  4QQB X;  1NE3 A;  2PW5 A;  2F0M A;  2HQE A;  3KF8 B;  3DWP A;  3I73 A;  2JA6 H;  3C1E A;  1D8L A;  4C3H H;  3L2P A;  1ICW A;  1B9N A;  1YJN A;  5LMN W;  4ME3 A;  2KA7 A;  2H5X A;  4JI3 Q;  3CC2 A;  4F87 A;  4GN4 B;  3T56 B;  3NTK A;  4HCE A;  3HG9 A;  4X6A H;  3N6R A;  2OXP A;  1T5X D;  3J7A V;  3W3A A;  3UDI A;  2JA5 B;  2KBN A;  2VZA A;  1EU4 A;  3NTI A;  4IJL A;  5IGF A;  2X6L A;  4KHV A;  1JJG A;  1S5D D;  3U50 C;  4BBR G;  1YIJ A;  2KQ3 A;  4PNY A;  1LAB A;  5C4X H;  2N55 A;  1SJE D;  1N8R C;  3FVQ A;  4IOA A;  1S4Z A;  2K1B A;  5CV6 A;  4AYB E;  5IP7 H;  4H44 C;  5C3W A;  4A76 A;  4A3F G;  2F0P A;  2VUM B;  2CCZ A;  1SYG A;  4K5W A;  5M3F H;  3PIP 3;  2Q2T A;  4H13 C;  3AMU A;  4KKU A;  1G6P A;  2KVM A;  3CQZ H;  1KRS A;  4GKJ Q;  4PZ6 A;  4FVM A;  1PZJ D;  2K75 A;  1SRU A;  4YHH L;  1AP0 A;  3A8J E;  5J1Z A;  1A3U A;  5E3F A;  3S1M H;  4IQZ A;  3I8Z A;  1TII D;  1FNU A;  1WCM G;  5IOC A;  2B8F A;  4DV1 Q;  4H0L C;  2E2J H;  3J81 j;  2Q2I A;  2R6G A;  4ZRZ A;  2CVR A;  5I6W A;  4KJO A;  4OEM B;  2VY3 A;  4C2M B;  1EOV A;  3I4M G;  2FMM A;  4A3M H;  4Q0F A;  4AYB B;  2D0O A;  4OWT B;  5BN4 A;  4BWG B;  4I7Z C;  5ELD A;  2F0H A;  1LTL A;  1H9M A;  3HOW G;  5IYB H;  5M3M B;  2K5Q A;  2E5L Q;  3KDF A;  4JI0 L;  2UUA Q;  4DV4 L;  1F2Y A;  1PRT D;  5F2D A;  2F3V A;  1N33 Q;  4UAI A;  2K5D A;  2EYO A;  1PFM A;  1K3B C;  2N49 A;  1Q1B A;  3J7Y W;  1K8G A;  1EFI D;  3HOU H;  4ZQ3 A;  3BYY B;  2O5J C;  3F2C A;  2OQ0 A;  1KQS A;  1VQ4 A;  1QB5 D;  4XYQ A;  1HNZ L;  1EIF A;  4LF6 Q;  4G7H C;  1CQF A;  4BBS B;  1NCV A;  1HFG A;  4JOI C;  2E2H H;  3WWV A;  4B3T L;  4P74 A;  2NTS A;  3WDN A;  1GO3 E;  1OXV A;  4DNR B;  2MFI A;  3HRZ C;  4DK0 A;  4ID6 A;  4N9P A;  2JYO A;  1SNQ A;  5CMD A;  3TZU A;  2B63 G;  1BDO A;  4YHH Q;  1E24 A;  1RL2 A;  1I4Q A;  2R93 H;  3X3M A;  1CKO A;  5KRU A;  4A3F B;  1FNW A;  3RD4 A;  1BR9 A;  3A0J A;  1EY4 A;  3QIA A;  1AZP A;  2NUC A;  3H94 A;  3LNN A;  2ICI A;  2RKS A;  1BXT A;  3PO2 H;  3RLN A;  1IBM L;  1PZI D;  2YTY A;  2JK8 A;  3LX0 A;  4KN4 C;  3RN2 A;  1CZG A;  1VQ8 A;  4A3B H;  3FPU B;  1WCM B;  4GOP B;  4CKC A;  3HGB A;  2AHO B;  2AWO A;  1E2W A;  1NMG A;  1TY2 A;  3TQY A;  4MHE A;  3GTL B;  2ZXO A;  2NZO A;  2D9U A;  4WRD A;  3I4M B;  1BKB A;  5IOD A;  1Q7Y C;  2YTV A;  4Y52 H;  4JI7 L;  2F0V A;  2CH4 W;  3HOW B;  3DUZ A;  3PMF A;  4L5T A;  1CA5 A;  1PRT C;  2KEE A;  4RA8 A;  2D2C C;  5CV7 A;  4B3R L;  1LAC A;  1NBW A;  2WB1 G;  4KKT A;  1IL8 A;  3KLS A;  5ISR A;  2DN8 A;  3NK9 A;  4Z9C B;  1STE A;  1NAP A;  4P75 A;  3CC4 A;  4A3M G;  3U4Z A;  4A3E G;  3TP6 A;  3EIV A;  4PMB A;  3IKJ A;  3TRZ A;  2K03 A;  3PUX A;  1LTR D;  2MQH A;  5IYB G;  1S72 A;  1I3Q H;  3D4D A;  2Q2U A;  4A3J H;  2IWH A;  2ALY B;  4XQQ A;  2L55 A;  4TVA B;  1AN8 A;  2X6G A;  1K8M A;  5C5M A;  3ULL A;  4UHV A;  5C3X A;  1F2M A;  1GUT A;  1OTC A;  3OW2 A;  4JI5 Q;  3TME A;  2IJ0 A;  2B63 B;  2B2W A;  1EWH A;  2QW7 A;  4B3S L;  4RMF A;  2DUD A;  4ABN A;  1SMY D;  2IHE A;  2JJQ A;  1RJT A;  3K5O A;  2CQO A;  4HIO A;  1VQN A;  1NR4 A;  1Z47 A;  3OYY A;  3HKZ E;  4IUP A;  2NWG A;  2F4I A;  3NBH B;  2D5D A;  1M90 C;  1PLF A;  2I46 A;  3MXP A;  2SDF A;  2F4V Q;  3STB D;  3Q0A A;  1S5E D;  4K6L A;  3NEM A;  1PFB A;  4JYA Q;  3F2U A;  4X3T A;  4R4I A;  1EYG A;  1IW7 D;  4DXF A;  2QGQ A;  3MXN B;  3QOJ A;  3K0Y A;  1YHQ A;  1PHJ A;  1SDF A;  5J22 A;  3L3O C;  5CV8 A;  2EE1 A;  2JA7 G;  1EQV A;  2R93 G;  5AJ3 Q;  3GTP H;  1STA A;  2PYK A;  4QL5 A;  1SNP A;  2K5N A;  3FMC A;  3SHL A;  1XMQ Q;  1PYS B;  1SNO A;  4NXN L;  2UUC Q;  3EVQ A;  2UU9 L;  3PO2 G;  4LUZ A;  3SXH A;  3CXC A;  3S16 H;  2R7F A;  1KXL A;  5FLX E;  1ENC A;  1C4Q A;  3KFU A;  3S1M B;  2KUM A;  1SYD A;  2WB1 B;  5IP9 H;  3CCL A;  2I0Q A;  1D1I A;  5CR3 A;  4BY7 G;  2A1A A;  3GTQ B;  1F9R A;  1XNQ L;  1HRJ A;  4DV0 Q;  3AFQ A;  4HSV A;  4A3M B;  4A3E B;  5D65 A;  1BBU A;  4TQU S;  1ZXT A;  1R4Q B;  2F0F A;  4E6I A;  2ZT9 C;  1QVC A;  4IUR A;  5M5W B;  3MC0 B;  4H02 A;  1KRT A;  1JMC A;  1Q46 A;  4JI6 L;  1N9W A;  4DA2 A;  3CCS A;  1C7Y A;  1SLJ A;  1GJX A;  1G91 A;  4DR5 Q;  1VQP A;  3P20 A;  3TP8 A;  4U68 A;  1XNR L;  1HJP A;  2B3G A;  3SK6 A;  3VYS A;  3EA6 A;  1I6H H;  1QNK A;  1SMY C;  4KMU C;  3W1B A;  3MTS A;  3VR5 A;  4X66 L;  1PA6 A;  3BZC A;  1B1Z A;  5LHY 1;  5IT9 c;  4G7O C;  3S2D H;  4XXE A;  4ZCK A;  4RCO A;  1F9P A;  3CCJ A;  5KGU A;  4R4O A;  1CSQ A;  4R4C A;  3BZD B;  4QB4 A;  4XYO A;  2E2H B;  2XGT A;  4A3J G;  3STB C;  4QIW B;  3WOF A;  4DKA C;  1OXX K;  1TWF H;  1NY4 A;  1X3F A;  4G4K A;  4ZUJ A;  3I4N G;  4OEL B;  1IW7 C;  1QUQ B;  2EYM A;  2J4X A;  3PUV A;  2F0W A;  4DAY A;  2YV5 A;  4GZY C;  4LF9 Q;  4JG2 A;  4B9X A;  1Q82 C;  2Z1C A;  1IXR A;  2BOS A;  3I90 A;  2JA7 B;  2L11 A;  2JEA I;  2CHB D;  1O80 A;  1KIX A;  1FGB D;  4J8Q A;  2PMZ B;  2ZM6 L;  1KD1 C;  1YNN C;  2EJG C;  1GUW A;  1TU2 B;  1PH5 A;  4DV2 Q;  3GD7 A;  1JB3 A;  2E75 C;  2BA1 A;  1CHP D;  4EQO A;  3S2H B;  1JC7 A;  3CAM A;  1I94 L;  2XN9 C;  2DY7 A;  4IAL A;  3G48 A;  5GRO A;  4HJ5 A;  1EQT A;  4C1N K;  4KD3 A;  5T1I A;  2L1B A;  4JI2 Q;  1KC8 C;  1QCB D;  4KN7 C;  1TT2 A;  2KHI A;  1DZ1 A;  4BY7 B;  2LXK A;  1G29 1;  1Z9F A;  4L5S A;  4EVO A;  4KHP Q;  1BQQ T;  4X65 Q;  2UXB Q;  4OGQ C;  2L9H A;  1STB A;  1J6Q A;  3CC7 A;  1L0Y B;  4A3K H;  2RHQ B;  1JIC A;  3VYU A;  1NTG A;  4BS9 A;  3G4S A;  3BJU A;  5NUC A;  3ULP A;  5KYI A;  4IJH A;  2X69 A;  1D7Q A;  5EJW A;  4RHS A;  1RKN A;  3A74 A;  1AE2 A;  3MEH A;  1PRT F;  4B3M Q;  1D5Z C;  2RCN A;  4NP5 A;  1XPO A;  4A3D H;  4NKL A;  1F2L A;  1HR0 Q;  2B2V A;  5CV4 A;  2R7D A;  2OTJ A;  2B2Y C;  1RTN A;  5IGE A;  4XQN A;  1OXT A;  4KY6 A;  1SR3 A;  3L0O A;  3CKI B;  1LV9 A;  4IPG A;  3B6Y A;  1EYC A;  4KTA A;  2BE5 C;  5IGB A;  1E1T A;  1B3Q A;  2ZTC A;  3TBI B;  1TS5 A;  5BR8 Q;  3NEL A;  4KJN A;  3GTJ H;  2NN6 I;  2ICE C;  1K8A C;  1Y14 B;  2ZTD A;  3DLL A;  4PMW A;  2F03 A;  2PI2 A;  1YBY A;  3I4N B;  5EAY A;  2R61 A;  5CV5 A;  1L1O B;  3I4L A;  4DV5 L;  3NQT A;  5DLQ E;  2QCP X;  2Y0S G;  1VQB A;  3VA7 A;  1U9R A;  4RGO S;  3PV0 A;  5LMN L;  1I50 H;  4DR1 Q;  2E2I H;  2A6E D;  4RGM A;  5M9O A;  1WD1 A;  5I9P A;  4CJ0 B;  1HNX Q;  4CHT B;  1QNU A;  3C1F A;  1XMO L;  1HTP A;  2LMC B;  3I55 A;  1VQL A;  1VQI A;  3A8K E;  1A6X A;  2RSO A;  2CH4 A;  4IUT A;  1XPR A;  1WTH A;  2WAQ E;  4DV7 L;  3GTG H;  4RG1 A;  4MN3 A;  1T5E A;  3GQB A;  4DF7 A;  2B2U A;  3T1H Q;  3S1N B;  3K57 A;  3CME A;  4JI8 L;  4RKL A;  5AFW A;  5EQ0 A;  1EY6 A;  1LM0 A;  3SK5 A;  3AFP A;  4YY3 L;  4X64 L;  2B39 A;  1TVX A;  1TWA B;  1AE3 A;  2HD3 A;  1N34 Q;  2AWN A;  4V19 0;  1VCI A;  5CC4 A;  1VQA A;  5FO9 B;  1CUK A;  2GVA A;  1EQQ A;  1IKM A;  2KOL A;  4LFA Q;  3MEF A;  3RN5 A;  1O7Y A;  4DFA A;  2G5D A;  1JJ2 A;  1I5F A;  2JXM B;  2XTI A;  1W6K A;  3UDG A;  2Y0S E;  4O2D A;  3E6Z X;  1A3V A;  2H1E A;  5C5L A;  1J5E L;  4A3G H;  3CMA A;  2V1C C;  1SE4 A;  5JJL A;  2O2L D;  3MVV A;  2F0O A;  1M1K C;  2HHH L;  4CJ1 B;  4A3K G;  3RZD H;  1WJJ A;  1KDA A;  4HJ8 A;  2PQE A;  3BDC A;  2NVY H;  3ZJY C;  2PNR C;  2LSS A;  4DNT B;  1EZ6 A;  5IWA Q;  3JC6 6;  3NHH A;  2D0P A;  3KJP A;  4C3I H;  3I56 A;  2UXC L;  1CKM A;  5KIX A;  2GVB A;  1UNS A;  5E4X A;  2JA8 H;  4YCV A;  2SEB D;  4R8N A;  1ML0 D;  2PQA A;  2MHV A;  2YYZ A;  4WFN 3;  1KAW A;  3E9I A;  4A3D G;  4UDU C;  1G2T A;  1RHP A;  4IPH A;  4K14 A;  2WAC A;  1BBW A;  1GHJ A;  1YEZ A;  5JEA J;  4LF8 L;  3K6O A;  2EPB A;  3U58 A;  2F1M A;  1L2F A;  1C48 A;  4GKK L;  3CCM A;  4Y7N H;  1IBL L;  3CCE A;  4HIK A;  3CCV A;  1UEA B;  2PCF B;  3S2D B;  1QWY A;  1UE5 A;  4BY1 G;  4EQ5 A;  4HED A;  1ZKO A;  2B2U C;  2A6H C;  3GTM B;  3G6J B;  2UUB Q;  2EJF C;  1EL0 A;  3EN2 A;  1KDC A;  5FK9 C;  1O7I A;  3FKI G;  2HCI A;  4EQP A;  1AFP A;  3DM3 A;  1W2B A;  4DU9 A;  1IKL A;  4RWS C;  5M5X H;  1MSH A;  2EXZ A;  1SFO B;  4XT1 B;  1N32 Q;  1DXM A;  2XRS D;  3HOV H;  3FHW A;  3OIQ A;  3A5Z B;  1EWC A;  2A69 D;  4JV5 L;  4TRD A;  1PYB A;  3TP7 A;  1E1O A;  5DM7 3;  3J7Z C;  4JI4 Q;  3ER0 A;  4GLV B;  1TXY A;  5IGD A;  4IPD A;  1EYD A;  1LT3 D;  4K5V A;  2WII B;  4CDE C;  1VMC A;  2K33 A;  3S17 B;  5COR A;  4DR6 L;  4AQY Q;  5ELB A;  3SVM A;  3PF5 A;  2YU9 B;  1QJO A;  3K8A A;  4RH6 A;  4RCN A;  1MD2 D;  1A3T A;  3NSW A;  3VDY A;  3M7G A;  1YNJ C;  3S1Q H;  4JOI A;  5I4D A;  2UXC Q;  4X3U A;  1YJ9 A;  5KND A;  3MXG A;  4ME5 A;  3H09 A;  4OO1 I;  1VQC A;  2RF4 A;  3PIO 3;  4ZKB B;  4A3K B;  4R8I A;  2XWJ B;  1K83 B;  3VYR A;  1PTO B;  2NVX H;  1XX8 A;  5IT9 L;  5M5Y H;  4HSP A;  3T1Y L;  1F77 A;  3K7U C;  1YHB A;  1EEI D;  5C3E G;  2NTT A;  4IFD J;  5JJI A;  3I91 A;  1HA6 A;  3DXJ C;  1EY8 A;  1V43 A;  1H9S B;  1NJI C;  4A3D B;  2CQA A;  4NDX A;  3SE0 A;  2F3W A;  4AH6 A;  2TSS A;  4I65 A;  1MGS A;  3AEV A;  1CHQ D;  1WTR A;  4POG A;  5DAU A;  4L6T B;  4A3C H;  4QGU A;  1SE3 A;  2FFK B;  1LT4 D;  2HT1 A;  2F0S A;  5EKL A;  1U4L A;  4BY1 B;  1LLR D;  1PH9 A;  2AUJ D;  4LJZ C;  4X62 L;  2IPK D;  1LT5 D;  1KHI A;  1RF2 D;  3CCU A;  4P2C B;  2JA8 G;  4WOR A;  5BN3 A;  3A7L A;  5JAV A;  1B2T A;  3M3Y B;  1V1P A;  2LFN A;  3S1R B;  2RDG A;  1Y1V H;  3FKI B;  4NXM L;  1JR0 D;  2F0K A;  3ND9 A;  3Q22 A;  4ZUI A;  3W1G A;  2DNE A;  3OWF A;  5C0X J;  3ND8 A;  1K0S A;  4KD4 A;  4FF2 A;  3HOZ H;  4FNF A;  5DEH A;  2A69 C;  2CW0 D;  1EY0 A;  1GUN A;  3FEW X;  3AB9 A;  2K52 A;  1ROD A;  2AQ2 B;  2N3S A;  2VXW A;  3SK4 A;  3I72 A;  1ESR A;  1Z7T A;  3H91 A;  4NW2 A;  3V96 A;  3GTO H;  1TWC B;  3K58 A;  5EBD A;  4DUZ L;  1R4P B;  4KV6 A;  3ICE A;  3NE5 B;  3PO3 G;  4BBR B;  3J7A F;  2TMP A;  4IUN A;  3T1Y Q;  2KEN A;  2EIF A;  2I07 B;  3BG3 A;  4P73 A;  1UAP A;  3SDZ A;  2JA6 G;  1XTC D;  1XTD A;  1DM0 B;  4C3H G;  3I3C A;  4GNX B;  2E74 C;  4PZ8 A;  3GP7 A;  2NBF A;  1M8A A;  4MIU A;  1NMF A;  2B2T A;  1Z6H A;  1S3O A;  1IL2 A;  4KKS A;  2F0N A;  3GDE A;  4RFB A;  3J81 i;  3K81 C;  5C3E B;  4DAY B;  1LUZ A;  4ZYS A;  2K32 A;  3P1H A;  2Q8R E;  5C4X G;  1CKN B;  4YCW A;  1LTS D;  3HP3 A;  3D6C A;  1XYI A;  2UXD L;  4JI0 Q;  4DV4 Q;  5IP7 G;  2JQO A;  2F0G A;  1HQM C;  4JI1 L;  2I5M X;  2JEB I;  4P72 A;  4H7B A;  2RHS B;  4DR3 L;  4K2K A;  5JVG 3;  2ZJQ A;  5M3F G;  1CQV A;  1HZ9 A;  4OHJ A;  2A68 D;  1L1O C;  1X32 A;  1HNW L;  2EVB A;  1P8L A;  3HKZ G;  2VL6 A;  4A93 H;  5ELF A;  1Y1W H;  3UI2 A;  3DEO A;  3AYH B;  4IUU A;  1SYB A;  1HNZ Q;  1S5C D;  4HTH A;  1VQ7 A;  4PQX A;  3IFD A;  1JOK A;  5C4J B;  3Q6S A;  2B8G A;  4B3T Q;  3UE0 A;  1WTO A;  1UEB A;  2EYP A;  5DM6 3;  5FOB B;  1LTT D;  3M4O H;  4JW0 A;  3U9O A;  5JEA H;  3J7A 5;  5GAH C;  2CW0 C;  4OWX B;  4O0A A;  3HS0 C;  1HZA A;  2ENB A;  2WP8 J;  4JC0 A;  2PI2 E;  2GA4 B;  2CWA A;  1SMX A;  1TWH B;  1TS4 A;  2Q8I B;  1Q86 C;  3J81 c;  1UUP A;  1VQ6 A;  1JWM D;  4A3L H;  3QOL A;  2NVT B;  1X3Q A;  3KBG A;  3PO3 B;  1VDZ A;  3LWE A;  3MXU A;  1IZ6 A;  3RR5 A;  4HJ9 A;  2DJF C;  1BBX C;  3KF8 A;  2DGY A;  2QA4 A;  1SE8 A;  2B2T C;  4XT3 B;  1IBM Q;  1CA6 A;  1F9S A;  2JA6 B;  3HOU G;  1CI3 M;  2KHS A;  2O4X A;  4IZ8 A;  4C3H B;  5IT9 E;  1S5B D;  5A35 A;  2QEJ C;  4DV3 L;  2OEO A;  1YHA A;  4LFC L;  3RNU A;  1A2U A;  3S15 H;  2YTX A;  2MJ8 A;  4O1N A;  3JAM i;  1K8O A;  4DR2 L;  4RGT A; 
#chains in the Genus database with same CATH homology
 2LXK A;  1G29 1;  1Z9F A;  3I2Z A;  4LUO A;  4L5S A;  4KHP Q;  1VQF A;  4X65 Q;  3AQQ A;  2UXB Q;  5LMU Q;  2A8V A;  1J6Q A;  5E7N A;  5J3B A;  3CC7 A;  1XPU A;  2GN5 A;  4JI7 Q;  3FP9 A;  4A3K H;  2ATW A;  2HIX A;  2RHQ B;  1NTG A;  4J15 A;  3GTK H;  2WFW A;  1A62 A;  4OX9 L;  4MTN A;  3BJU A;  3G4S A;  4XIG S;  1EUJ A;  3ULP A;  1W3S A;  3KLW A;  3KYH C;  2MO0 A;  4IJH A;  4B3R Q;  1D7Q A;  3OTO L;  3Q8D A;  4DV6 Q;  5C4J H;  3A74 A;  3D0F A;  3CW2 C;  1AE2 A;  2HQL A;  5ELN A;  4OON A;  4DR4 L;  1EIY B;  3HOV G;  4B3M Q;  1Q1E A;  2RCN A;  1U0L A;  1JE5 A;  1Q8K A;  1TWG H;  5HGQ A;  4IO9 A;  2AMC B;  2F3I A;  4IOC A;  1XPO A;  4A75 A;  3PF4 A;  4A3D H;  1QZG A;  4AYB G;  1HR0 Q;  2R7D A;  1FVI A;  1K0R A;  1MJC A;  2OTJ A;  1OXT A;  4LF4 L;  1SR3 A;  3L0O A;  1N36 L;  3W5O A;  4IPG A;  4A3B G;  3B6Y A;  5C0X I;  1HZC A;  3CCQ A;  1T9H A;  4MZ9 A;  2R92 H;  1TWH H;  5IE8 A;  2HIV A;  4QJF A;  1E1T A;  2NVQ H;  2NVT H;  2ZTC A;  3IRB A;  1VQE A;  3PO3 H;  4QQB X;  1FJG L;  5BR8 Q;  2MO1 A;  3NEL A;  2VQF L;  1E22 A;  1NE3 A;  2ES2 A;  2JA7 H;  3GTJ H;  2NN6 I;  4X62 Q;  4K0K L;  1K8A C;  1Y14 B;  2ZTD A;  3CPF A;  3KF8 B;  5FJ8 G;  4PMW A;  3G6E A;  3DLL A;  1YJW A;  3M3Y H;  4LFB L;  2JA6 H;  2PI2 A;  1AH9 A;  1YBY A;  1A8V A;  3JAM c;  3TS0 A;  5EAY A;  4B3S Q;  3G71 A;  4NXM Q;  1D8L A;  4C3H H;  1L1O B;  1X55 A;  3L2P A;  4DV5 L;  3S2H H;  4JI5 L;  1YJN A;  5LMN W;  4ME3 A;  2EQS A;  1PH2 A;  5DLQ E;  2Y0S G;  1B70 B;  4EX5 A;  1SRO A;  2H5X A;  4JI3 Q;  1VQB A;  3CC2 A;  4GN4 B;  4LF5 L;  4X6A H;  3PV0 A;  5LMN L;  1I50 H;  4DR1 Q;  2E2I H;  3UDI A;  2KBN A;  1DGS A;  2VZA A;  4IJL A;  3M85 A;  1HNX Q;  1JJG A;  4BY7 H;  3KF6 B;  2L15 A;  3U50 C;  4BBR G;  1XMO L;  1A63 A;  1YIJ A;  3I55 A;  3HOY H;  1R9T H;  1VQL A;  3CD6 A;  1VQI A;  4DUY L;  5C4X H;  1SN8 A;  3PSI A;  3BU2 A;  2F4V L;  1XPR A;  1MIU A;  2WAQ E;  4DV7 L;  1N8R C;  4DUZ Q;  3GTG H;  4IOA A;  4JYA L;  4RG1 A;  3CF5 A;  2KCM A;  4AYB E;  5IP7 H;  3A5U A;  2IT1 A;  4LW1 A;  3HOX H;  4GN3 B;  3T1H Q;  1QVG A;  4A76 A;  4A3F G;  4A3C G;  4A3L G;  5GAE C;  1X56 A;  2CCZ A;  3CME A;  4JI8 L;  1E3P A;  2VS1 A;  5M3F H;  2BH8 A;  2R7Z H;  4P71 A;  1GVP A;  2Q2T A;  3F2B A;  4GLX A;  4JBW A;  5H1S E;  5AJ3 L;  1G6P A;  1LM0 A;  4YY3 L;  3AFP A;  3CQZ H;  4X64 L;  1KRS A;  2VQE L;  1PH8 A;  4NXN Q;  2N8N A;  2QEX A;  4GKJ Q;  4PZ6 A;  2UU9 Q;  1AE3 A;  2K75 A;  1SRU A;  2AWN A;  1XMQ L;  4YHH L;  1N34 Q;  1Y1V G;  3H0G H;  1VCI A;  4WJ4 A;  1VQA A;  1S40 A;  1K9M C;  3UDX A;  3S1M H;  2UUC L;  1CUK A;  3E9H A;  1WCM G;  2GVA A;  4YWL A;  5IYC H;  1X9N A;  1VQM A;  1EQQ A;  3TEH B;  4DV1 Q;  2OCE A;  3NEN A;  4LFA Q;  3MEF A;  3RN5 A;  2E2J H;  1JJ2 A;  3HOZ G;  3J81 j;  2Q2I A;  1I5F A;  2R6G A;  2XTI A;  3UDG A;  1PFS A;  1XNQ Q;  2Y0S E;  2VY3 A;  5GAG C;  4O2D A;  1EOV A;  3I4M G;  4A3M H;  2N78 A;  4WJ3 M;  1J5E L;  2D0O A;  1JB7 A;  4OWT B;  4A3G H;  3CMA A;  2UXD Q;  1HZB A;  2V1C C;  4GOP A;  5JJL A;  1M1K C;  4DV0 L;  1LTL A;  4IPC A;  4JI1 Q;  2HHH L;  3HOW G;  1VS0 A;  4DR3 Q;  4A3K G;  3KF6 A;  1WJJ A;  5IYB H;  3RZD H;  3I4N H;  3ULJ A;  4LWC A;  4HJ8 A;  1PH7 A;  2E5L Q;  2NVY H;  3KDF A;  4JI0 L;  2UUA Q;  4JI6 Q;  3ZJY C;  4DV4 L;  2LSS A;  1VQK A;  3K7A H;  1N33 Q;  1HNW Q;  5C44 H;  3H3V H;  5IWA Q;  3JC6 6;  2D0P A;  2K4K A;  3KJP A;  4C3I H;  3CPW A;  3I56 A;  2UXC L;  1CKM A;  3TS2 A;  2JA5 H;  2GVB A;  1H95 A;  2N49 A;  1Q1B A;  4YWK A;  4A3I H;  1XNR Q;  2NZH A;  2JA8 H;  4YCV A;  3U4V A;  1K8G A;  4DK6 C;  2PQA A;  2YYZ A;  1B8A A;  5FLX c;  1PH4 A;  1KAW A;  3E9I A;  3J80 i;  3HOU H;  4A3D G;  4DR5 L;  3UE1 A;  3KOJ A;  4XTC S;  3F2C A;  4IPH A;  2OQ0 A;  2IY5 B;  4X66 Q;  1KQS A;  1BBW A;  1VQ4 A;  1YEZ A;  1MJE A;  1HNZ L;  5JEA J;  4NPS A;  4LF8 L;  2WB1 E;  4IFD G;  3U58 A;  1EIF A;  2WAQ G;  3ERS X;  1ASY A;  1L2F A;  4LF6 Q;  4GKK L;  1MKH A;  2F52 A;  5IP9 G;  4Y7N H;  3CCM A;  5FLM H;  2CWP A;  2IX0 A;  1IBL L;  3CCE A;  4HIK A;  4JOI C;  3CCV A;  2E2H H;  3WWV A;  4B3T L;  2VUM H;  4YWM A;  4BA1 I;  3CCR A;  2VW9 A;  1UE5 A;  4P74 A;  4BY1 G;  4EQ5 A;  1GO3 E;  1OXV A;  1YIT A;  1PV4 A;  2VNU D;  2MFI A;  3PUW A;  2UUB Q;  1HH2 P;  1TWA H;  3EN2 A;  4LF7 L;  2B63 G;  1PVO A;  1PH3 A;  4YHH Q;  1O7I A;  3FKI G;  1E24 A;  3DM3 A;  1W2B A;  1RL2 A;  1IYJ B;  3PUY A;  2R93 H;  1CKO A;  5M5X H;  1IBK L;  4LF9 L;  3E0E A;  1N32 Q;  2ZM6 Q;  1GM5 A;  3A0J A;  2ZTE A;  3HOV H;  2AKW B;  2Z0S A;  4A93 G;  3FHW A;  1Y1W G;  3A5Z B;  4JV5 L;  4C2M H;  3S14 H;  1PYB A;  4MNO A;  1E1O A;  1I94 Q;  3PO2 H;  3RLN A;  1WOC A;  3ER0 A;  4GLV B;  1TXY A;  3J7Z C;  1IBM L;  4JI4 Q;  4DV2 L;  2YTY A;  2JK8 A;  4IPD A;  4DV3 Q;  4YCU A;  5C0X G;  3RN2 A;  3HOY G;  3K0X A;  4LFC Q;  3RLF A;  1VQ8 A;  1UWV A;  4A3B H;  4HIM A;  4GOP B;  5M3M H;  4DR6 L;  4UP9 A;  4AQY Q;  4DR2 Q;  1XJV A;  2AHO B;  2AWO A;  4GOP C;  1NMG A;  3PF5 A;  3TQY A;  2FXQ A;  3K8A A;  3J80 c;  3KDF B;  5JEA G;  1CSP A;  2NN6 G;  3RZO H;  4JI2 L;  4QIW E;  2NZO A;  3VDY A;  1UE1 A;  4R1J A;  3S1Q H;  4JOI A;  1BKB A;  2R7Z G;  2UXC Q;  1QZH A;  4KHP L;  4X65 L;  4LNQ A;  1YJ9 A;  2UXB L;  1Q7Y C;  4OX9 Q;  3LGJ A;  4NB3 A;  2YTV A;  1VQC A;  1GKH A;  2RF4 A;  1ASZ A;  4OO1 I;  4JI7 L;  4Y52 H;  4UY8 C;  3GO5 A;  3L7Z C;  1E7Z A;  1OXU A;  2PQA B;  3OTO Q;  4GS3 A;  2JE6 I;  4JBK A;  4L5T A;  1UE6 A;  2I5H A;  2IX1 A;  2NVX H;  5M5Y H;  4DR4 Q;  3HFZ B;  1VQG A;  1QVF A;  1BVS A;  4B3R L;  2PMZ E;  2Z6K A;  3T1Y L;  3H3V I;  1NBW A;  2WB1 G;  3F8T A;  3K7U C;  1OXS C;  4DV6 L;  1YHB A;  5GAD C;  4BBS H;  2OQK A;  3I7F A;  5C3E G;  5JJI A;  4IFD J;  1HR0 W;  1V43 A;  4B3M L;  1X54 A;  4BXX H;  1KL9 A;  4GNX A;  4LF4 Q;  1NJI C;  1N36 Q;  2KHJ A;  4P75 A;  3CC4 A;  1HR0 L;  4A3M G;  3GTM H;  3U4Z A;  4APV A;  4A3E G;  1B7Y B;  4A4I A;  4HJA A;  3EIV A;  4AH6 A;  3TRZ A;  3PUX A;  3D31 A;  1Q81 C;  1FJG Q;  2ASB A;  2MQH A;  3AEV A;  5IYB G;  2VQF Q;  1S72 A;  4POG A;  2B29 A;  1I3Q H;  2IHF A;  2MNA A;  4A3F H;  2Q2U A;  4QGU A;  4A3J H;  1SFO H;  4DR7 L;  4R4T A;  4A3C H;  2HT1 A;  4K0K Q;  3PIP A;  5IYD H;  1YI2 A;  4LFB Q;  1CKN A;  5BR8 L;  2ALY B;  3ULL A;  3CP0 A;  4TVA B;  5C44 G;  4JBJ A;  1PH9 A;  4JCV E;  4X62 L;  4PG3 A;  3UDF A;  1KHI A;  1OTC A;  3CCU A;  4DV5 Q;  3OW2 A;  4A3I G;  4JI5 Q;  2BA0 A;  2JA8 G;  2ID0 A;  2Q2H A;  1Y1V H;  4B3S L;  4RMF A;  2DUD A;  4NXM L;  3BZK A;  2IHE A;  2JJQ A;  4L5R C;  3S17 H;  4LF5 Q;  3W1G A;  2CQO A;  1WCM H;  1U5K A;  5LMN Q;  4HIO A;  1VQN A;  5C0X J;  1Z47 A;  3OYY A;  3HKZ E;  3RLO A;  4JI3 L;  2PNH A;  2YU9 H;  3NBH B;  3HOZ H;  1XMO Q;  1M90 C;  4DR1 L;  3GTL H;  3M7N A;  4DUY Q;  1HNX L;  3I4M H;  2F4V Q;  3STB D;  4DV7 Q;  1WI5 A;  2K52 A;  3PUZ A;  3NEM A;  1X6O A;  2I5L X;  4JYA Q;  2N3S A;  2R92 G;  4R4I A;  1EYG A;  4LUV A;  3GTO H;  1V1Q A;  3HOW H;  1YZ6 A;  4HJ7 A;  2LXJ A;  2QGQ A;  3MXN B;  4GLA C;  4DUZ L;  1YHQ A;  1PHJ A;  3ICE A;  3PO3 G;  1G51 A;  1K83 H;  4JI8 Q;  1X3G A;  4PZ7 A;  3K80 C;  3PGZ A;  3TRE A;  4HID A;  2JA7 G;  3T1H L;  2R93 G;  5AJ3 Q;  3GTP H;  4YY3 Q;  3T1Y Q;  1VQH A;  2KEN A;  4X64 Q;  2VQE Q;  4UP8 A;  3HKS A;  2EIF A;  1X3E A;  1K3R A;  4P73 A;  1RIP A;  4QL5 A;  1QUQ A;  3PCO B;  2JA6 G;  2K5N A;  1XMQ Q;  1YNX A;  2Z6K C;  1PYS B;  1XTD A;  4NXN L;  2UUC Q;  4GKJ L;  1P16 A;  4GNX B;  4PZ8 A;  2UU9 L;  3PO2 G;  4LUZ A;  4AIM A;  3CXC A;  3S16 H;  1N34 L;  1NMF A;  1WFQ A;  2R7F A;  4GNX C;  1KXL A;  4R4Q A;  1V9P A;  3F2D A;  3KFU A;  1S3O A;  1IL2 A;  5M3M G;  3S24 A;  3GDE A;  5IP9 H;  4DV1 L;  3CCL A;  3M4Q A;  3K81 C;  3J81 i;  2I0Q A;  4LFA L;  1WYD A;  4BY7 G;  2D62 A;  4DR7 Q;  1J5E Q;  2A1A A;  1LUZ A;  2JA9 A;  3M9B A;  4DAY B;  4BY1 H;  1XNQ L;  4DV0 Q;  3AFQ A;  5C4X G;  2HHH Q;  1CKN B;  4YCW A;  1X65 A;  1C9O A;  1BBU A;  1FGU A;  4TQU S;  1L0W A;  2UXD L;  4JI0 Q;  4DV4 Q;  3I4O A;  5IP7 G;  2JQO A;  2B63 H;  4JI1 L;  4L5Q A;  3HOX G;  2I5M X;  1QVC A;  2JEB I;  4P72 A;  3FKI H;  2RHS B;  3M4P A;  4QY7 A;  4DR3 L;  3S1R H;  3F1Z A;  2KCT A;  1EFW A;  4H02 A;  2CKZ B;  1KRT A;  1JMC A;  1Q46 A;  2E5L L;  2UUA L;  2ZJQ A;  4JI6 L;  1N9W A;  5M3F G;  1VQ9 A;  1HZ9 A;  4KHZ A;  3SGI A;  3CCS A;  5FJ8 H;  1C0A A;  1L1O C;  5LMU L;  1N33 L;  4ALP A;  1HNW L;  1C7Y A;  5IWA L;  1P8L A;  3HKZ G;  1SLJ A;  1EWI A;  1UE7 A;  2VL6 A;  4KLK A;  4A93 H;  1Y1W H;  4DR5 Q;  2ZJR A;  1VQP A;  4OWW B;  4BBS G;  1PH1 A;  1YVC A;  4JBM A;  1XNR L;  2K50 A;  3AYH B;  4KI0 A;  4BXX G;  2A19 A;  1HNZ Q;  1HJP A;  2K5H A;  3H0G G;  4C3J H;  1PH6 A;  2B3G A;  4LF8 Q;  1JJC B;  4OXP A;  1I6H H;  5IYC G;  3W1B A;  1VQ7 A;  1VQ5 A;  4GKK Q;  1VQJ A;  4DK3 C;  4X66 L;  1PA6 A;  3BZC A;  1TWC H;  1Q12 A;  1IBL Q;  4UPA A;  5IT9 c;  4B3T Q;  3S2D H;  3UE0 A;  5K36 G;  5ELO A;  1UEB A;  3KJO A;  5JJK A;  3CCJ A;  4LF6 L;  4BBR H;  4R4O A;  1CSQ A;  4GN5 A;  1EQR A;  3M4O H;  4R4C A;  3J7A 5;  1LYL A;  5GAH C;  2XGT A;  4DPG A;  4OWX B;  5IYD G;  4A3J G;  3STB C;  4O0A A;  2OWO A;  4A3G G;  1HZA A;  1FL0 A;  4DKA C;  1OXX K;  1TWF H;  1NY4 A;  2PI2 E;  2WP8 J;  1X3F A;  4JC0 A;  4LF7 Q;  4OO1 G;  2CWA A;  4UP7 A;  5IY0 A;  3PIO A;  3I4N G;  1SMX A;  1VQD A;  3EBE A;  4FDB A;  1QUQ B;  1Q86 C;  3J81 c;  2UUB L;  3PUV A;  1VQ6 A;  1IBK Q;  2YV5 A;  4DAM A;  4A3L H;  2E8G A;  4LF9 Q;  1A0I A;  4JG2 A;  1Q82 C;  5HY6 A;  1IXR A;  1IZ6 A;  3RR5 A;  4HJ9 A;  3H15 A;  2DGY A;  1K73 C;  2JA5 G;  1GD7 A;  2QA4 A;  1SE8 A;  2BH2 A;  2JEA I;  1KIX A;  2K14 A;  4JV5 Q;  1JT8 A;  1N32 L;  5C3E H;  2ZM6 L;  1KD1 C;  1VQO A;  1IBM Q;  1PH5 A;  4DV2 Q;  3HOU G;  3GD7 A;  1L1O A;  3GTQ H;  3S1N H;  2CFM A;  4POF A;  2BA1 A;  2EXD A;  2C35 B;  5GQO A;  1I94 L;  3CAM A;  4JI4 L;  2K5V A;  4DNI A;  4DR6 Q;  4A3E H;  4DV3 L;  4BA2 I;  1YHA A;  3G48 A;  5GRO A;  4HJ5 A;  2OTL A;  4LFC L;  3RNU A;  4IFD I;  5FLM G;  1KC8 C;  4JI2 Q;  2YTX A;  3S15 H;  3JAM i;  5M5W H;  2VUM G;  2ZJP A;  4AQY L;  4DR2 L;  2KHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...