2MO0A

Backbone 1h, 13c, and 15n chemical shift assignments for cold shock protein, tacsp
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
68
structure length
68
Chain Sequence
b'MKKGTVKWFNAEKGYGFIQQEEGPDVFVHFTAIEADGFRTLNEGEHVEFEVEPGRGGKGPQAKKVRRI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cold-shock DNA-binding domain protein
publication title Structure and flexibility of the thermophilic cold-shock protein of Thermus aquaticus
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Dna binding protein
total genus 8
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2014-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2mo0A00
3FHWA 1O7IA 2I5LX 4YWKA 4DKAC 4QIWE 2D0PA 4A75A 1N36Q 1HNXQ 1B8AA 1N9WA 1Q1EA 1YITA 1IXRA 3KJOA 2QA4A 1BBUA 1E1OA 4JC0A 1VQ5A 4JI7Q 2PMZE 1BBWA 1OXSC 2LXKA 4MTNA 2HIXA 2KCMA 1EIFA 4DV6Q 1A8VA 3F1ZA 4ME3A 3TQYA 4AQYQ 4IPHA 3U58A 1SMXA 1TWHH 5IP7G 1CKNB 4FDBA 3WWVA 3CC4A 4YHHL 4IOCA 2JA6G 2Q2TA 1CSQA 4K0KQ 1WCMH 2KENA 2V1CC 4LUZA 5C3EH 3ULPA 1K9MC 5HGQA 3M3YH 2I5HA 4NB3A 3S17H 1KD1C 1V1QA 1E24A 4X66Q 3D31A 5LMNL 1EUJA 2PI2E 2UU9L 4B3MQ 4LF6L 4DR4L 2OQKA 2ZTDA 1UEBA 2VY3A 1J5EL 1ASZA 1VQ8A 5M5XH 3G4SA 3E9IA 3HOUG 3HOZH 1YIJA 1M90C 4GNXA 2RHQB 1OXUA 2MFIA 2K5VA 1YHAA 1C9OA 5JEAJ 5K36G 4POGA 1VQIA 2IX0A 2E2HH 3HFZB 2VW9A 3CCQA 3BZCA 1XPOA 4IJHA 1HZBA 5C0XJ 1KIXA 4QQBX 2K75A 1N33L 4ALPA 3ER0A 2Z0SA 4A93H 1N32Q 1OXTA 1V43A 1N8RC 4DAYB 1WI5A 1X9NA 1U5KA 2IT1A 2B63H 4LF7Q 4MZ9A 5C4XH 4GKKL 1WOCA 4IOAA 3PO3G 1QZHA 1KXLA 5AJ3L 4HJAA 4JI5L 3J7A5 1N34L 1PYSB 1GO3E 3H0GH 1VQPA 1QZGA 3L7ZC 2ZM6Q 1L1OC 1IZ6A 3DLLA 2HIVA 4R4CA 4DV2L 3HKSA 5JEAG 3J81c 4HIDA 3M4PA 2BA1A 2Q2IA 4J15A 3GO5A 4UP7A 4IO9A 3AQQA 3UDGA 3I4NH 3CCRA 3PO2G 5FLMH 3K0XA 3TREA 2E5LL 5GAGC 1TWFH 1YI2A 2D0OA 4LW1A 1HZAA 2VQFL 1PV4A 3KFUA 3S2DH 1C0AA 2K4KA 3HOXH 2UXBL 2FXQA 1PH1A 1JB7A 2ES2A 2N49A 4DV5Q 1NTGA 2B3GA 3M4OH 1EQRA 2R7FA 3PUYA 4JBKA 2RHSB 2CWAA 1YJWA 4JI8Q 1Y1VH 4BBRH 1PHJA 1OTCA 4UP8A 1WJJA 4IFDJ 1HNWQ 1JJCB 4JYAL 1KRTA 2WAQG 3UDIA 4DV7L 5IP9H 4B3TQ 4JV5L 3W1GA 4A3CG 4L5SA 4GLXA 1OXXK 2JQOA 4GOPC 4JI4Q 1HZCA 5IWAQ 1I94L 1NE3A 1GD7A 3MEFA 4IPDA 3RNUA 2YTYA 3CCJA 4DR3L 3S1NH 2JA5H 2Q2HA 2IHEA 5M5YH 1P8LA 4JI2L 1DGSA 3HKZG 5HY6A 5GADC 1XJVA 1SFOH 1K83H 4DR6L 1IBLL 4LUOA 1CUKA 4OXPA 3JAMi 2YTVA 1VQHA 4A3GH 3K7UC 3NBHB 3BZKA 2I0QA 4P74A 2VNUD 1B7YB 1PH6A 1L1OB 3OTOQ 4R4TA 3M4QA 3OW2A 4LF8L 4XIGS 2ID0A 5E7NA 4C2MH 4LFCQ 4IFDG 1BVSA 5GAHC 1QUQB 3PUVA 4A3KG 4KHPQ 2K50A 4LF5L 4LFAQ 4YY3Q 1VQMA 3GTKH 5IYDH 1VQ7A 4BY1H 3HOYH 4JI6Q 1I50H 3CF5A 3DM3A 3CC2A 3I55A 2RF4A 4JI1Q 1LM0A 5M3FG 1R9TH 3AFQA 1E22A 4POFA 4DV4Q 5M3MG 1MIUA 2LSSA 2XTIA 4HJ8A 4GN5A 3F2BA 1KQSA 3I4OA 4YWLA 1YVCA 2VS1A 1NJIC 2UXCQ 3B6YA 2CKZB 4BY7H 1VQBA 5JJLA 1LTLA 3F2CA 1XMOQ 2EIFA 2VUMH 3IRBA 4WJ4A 4YWMA 1VS0A 3RLFA 1BKBA 2Z6KA 3KDFA 4A3FG 1KL9A 5J3BA 2ZTCA 3FP9A 4LUVA 3G71A 4IPGA 4A3JH 3AEVA 1NY4A 5C44G 3ERSX 1UE1A 4JI3Q 2UUBQ 4DPGA 2D62A 1N36L 1A62A 3J81j 1HNXL 3S2HH 4OO1G 4B3RQ 2PQAA 4TQUS 5FJ8G 4A3BG 1UE5A 1XPRA 5IYCG 4JI7L 3CCSA 4DUZQ 4NXNQ 4YCVA 4B3SQ 4EQ5A 1IBKQ 5C0XI 3H3VI 2E2JH 4AH6A 1XMQQ 2R93G 4KLKA 4DV6L 4DV1L 2F4VQ 4AQYL 5IP7H 4HIOA 2R7DA 4UPAA 3KF6A 2JA6H 3KYHC 3S1QH 1VQLA 2R93H 3TS2A 5FLXc 4AIMA 4K0KL 1X3EA 1A0IA 1P16A 2E8GA 5ELOA 2NVTH 3AYHB 3RLOA 1VQKA 1AH9A 3Q8DA 4B3ML 3I4MG 3KOJA 2YV5A 2YTXA 2WB1G 3K7AH 3UDXA 3ULLA 4X64Q 4BBSG 4R1JA 2OQ0A 1Q82C 4C3JH 4JI0Q 3HOUH 1Q46A 3CD6A 4DR2Q 1MJEA 4DUYQ 4JOIC 4DV0Q 4GOPA 4RG1A 2ZTEA 4JG2A 1VQDA 2XGTA 1Q1BA 4LF6Q 1T9HA 1TXYA 1Y14B 3D0FA 5IYBG 3CCUA 1J5EQ 2CFMA 1X6OA 1OXVA 1D7QA 3NELA 4DR1Q 1PH9A 2F52A 4IPCA 3J80c 1JT8A 4LF4Q 4R4IA 4X65L 1I5FA 1HR0L 3STBC 4A3DG 4C3HH 4UY8C 1WYDA 1VQGA 2GN5A 3PCOB 1PH4A 4L5QA 3BU2A 1K8AC 4LF9Q 2UUAQ 3PO3H 3RZDH 1QVGA 2PI2A 2HQLA 2Y0SE 4PZ8A 1A63A 1MKHA 1SN8A 4P75A 5GROA 2NN6G 3CMAA 3HOWG 2ZM6L 1N33Q 2IY5B 5LMUQ 3K81C 1LYLA 2UXDQ 3CCVA 4A4IA 4A3DH 1W3SA 3PO2H 1D8LA 1CKNA 1TWAH 2F3IA 4NXMQ 1VQJA 2NZHA 1AE2A 4AYBE 4JI5Q 3STBD 3F2DA 2A8VA 1JJGA 1L2FA 3UDFA 4DNIA 4WJ3M 1X56A 1Y1WG 2PNHA 4DV2Q 4PG3A 3E9HA 4HIMA 3HKZE 3I56A 4O2DA 1EIYB 1YJNA 3S1MH 4JI8L 1HH2P 1HNWL 2AKWB 3AFPA 2KHIA 1S3OA 2ATWA 4A3CH 4LFBQ 2ZJQA 2VQFQ 3GTOH 1XMQL 2GVBA 5IT9c 3T1YQ 1K0RA 1XNQQ 2R7ZG 1VQNA 3TEHB 4PZ6A 5IWAL 3W1BA 4A3MG 1VQCA 3FKIG 1Z9FA 2NVYH 2ZJRA 2R7ZH 3KJPA 3NEMA 4BA1I 3GTMH 2NVQH 3S16H 1VQOA 1EOVA 4RMFA 4OWXB 1K8GA 2E2IH 3GTPH 4DV3Q 4DR7Q 4A3LG 4BXXG 1IBMQ 4JV5Q 3RN2A 1KRSA 1TWCH 1VQ4A 2WFWA 1HNZL 3GDEA 2JA7G 2VQEQ 1EWIA 1I94Q 3OTOL 1S40A 1FJGQ 4NPSA 1SRUA 5GAEC 2QEXA 4A3EG 4X62Q 3S14H 4A3IG 1IBLQ 4A3KH 2AWOA 2K5HA 1S72A 4KHPL 1CKMA 2RCNA 2MNAA 1Q8KA 4H02A 2C35B 1PA6A 4YY3L 3CQZH 4LFAL 3HOVG 1E3PA 1SROA 4JI6L 3NENA 4JBMA 3CW2C 3T1HQ 4A76A 5M3FH 2ZJPA 3GTGH 3U50C 2R92G 1PH2A 3GD7A 4HJ5A 5M3MH 4LF5Q 1X3GA 4GKJQ 1YBYA 3CMEA 1XPUA 3ZJYC 4L5RC 1K73C 3PUWA 4JOIA 1Q7YC 2GVAA 2JEBI 3CCLA 4DR5L 2CQOA 4HIKA 1XMOL 1UE6A 5GQOA 1QVFA 2VL6A 1JMCA 4OWTB 2HHHQ 3VDYA 3PGZA 4OX9Q 1PH8A 4A3FH 2ASBA 3G6EA 5LMNW 5C44H 4GNXB 1XNRQ 4GN4B 1WFQA 2MO0A 1VQEA 4JI3L 4APVA 1G51A 3GTJH 2UUBL 2UUCQ 3M7NA 1YHBA 1GKHA 5DLQE 1L1OA 2Q2UA 1MJCA 5FJ8H 5BR8Q 4A3BH 4B3RL 5IYCH 3H15A 3MXNB 4GLAC 3SGIA 4LNQA 1VCIA 3E0EA 4DUZL 1YHQA 4B3SL 1IBKL 2MO1A 5IE8A 1PH7A 1I6HH 1PYBA 4QY7A 2JA9A 2R6GA 2F4VL 1YNXA 4GN3B 5H1SE 1RL2A 5EAYA 3RN5A 2BA0A 3PUXA 4X66L 1JJ2A 4GLVB 1HR0W 2AWNA 4QGUA 3I4MH 2L15A 4BBSH 4JBJA 4YHHQ 4R4OA 4DV1Q 4X64L 4HJ7A 3JAMc 1C7YA 4R4QA 3CXCA 2CWPA 2BH2A 1WCMG 5C3EG 1VQ6A 4JI0L 2OWOA 1GM5A 3S24A 5M5WH 3RZOH 3I2ZA 1SLJA 2YU9H 5LMNQ 3EIVA 4DR2L 2UU9Q 4DUYL 4DR4Q 1FVIA 4LWCA 4DV0L 1B70B 4YCWA 1NBWA 3CC7A 2AMCB 3PF4A 1W2BA 4IFDI 5IYBH 1YZ6A 3HOZG 3K8AA 1NMFA 4OONA 2IX1A 2K14A 2HT1A 4JBWA 1N32L 2K5NA 4DR1L 4UP9A 1ASYA 4BA2I 2JE6I 2NVXH 2AHOB 3F8TA 3RLNA 4LF4L 5C4JH 4LF7L 2VZAA 1X65A 4X6AH 4MNOA 4DK6C 4YCUA 1E1TA 2BH8A 1AE3A 3CP0A 4LF9L 2UUAL 2B29A 1VQAA 2OTJA 1EYGA 1FL0A 2Z6KC 3RR5A 4DK3C 1X3FA 4EX5A 3HOWH 4A93G 2DGYA 5JJKA 1G6PA 2WAQE 4QJFA 5LMUL 2MQHA 3L0OA 4X65Q 1HR0Q 3OYYA 3CPWA 4HJ9A 2B63G 2UXDL 4GKKQ 1XTDA 1PVOA 1IL2A 1UE7A 5AJ3Q 5C4XG 1N34Q 4IJLA 3EN2A 3A0JA 3H0GG 1E7ZA 4NXML 2EXDA 4DV5L 4GS3A 3ICEA 1Y1WH 2JEAI 2NZOA 5IYDG 1GVPA 3I4NG 1KHIA 1M1KC 2E5LQ 1K3RA 1LUZA 5FLMG 1CSPA 4B3TL 2EQSA 2JA8G 4DAMA 2UXBQ 1J6QA 1YEZA 3HOXG 4JI4L 2OCEA 2JA8H 1Q81C 4LFBL 4OO1I 3TS0A 4TVAB 2A19A 3PF5A 1SE8A 1V9PA 3T1YL 1XNQL 5C0XG 4A3MH 3FKIH 2A1AA 1Y1VG 2KCTA 2Y0SG 4BBRG 4C3IH 1EQQA 4JYAQ 4DV7Q 3KLWA 3H3VH 4JCVE 1RIPA 4KHZA 1FGUA 5IP9G 4A3LH 2K52A 4BXXH 4DR7L 2YYZA 3PSIA 4XTCS 4DV3L 4GNXC 1IBML 1IYJB 1VQ9A 1UWVA 3PUZA 3KDFB 3UE1A 2I5MX 4DR3Q 4OWWB 2JA7H 4JI2Q 2VQEL 2KHJA 4LFCL 4AYBG 2JA5G 3S15H 1FJGL 4DR6Q 4A3EH 4Y52H 3JC66 1U0LA 4PMWA 4A3IH 4X62L 4A3GG 3CCEA 1Q12A 3W5OA 4L5TA 3CCMA 3CAMA 3M9BA 3LGJA 4LF8Q 1PH5A 3HOVH 2PQAB 3A74A 4KI0A 1HNZQ 3CPFA 4JI1L 1L0WA 1PH3A 1X54A 2IHFA 3T1HL 4DV4L 3I7FA 4P71A 1KC8C 2R92H 3KF6B 5JJIA 3K80C 4BY1G 3J7ZC 3HOYG 1HJPA 3J80i 4QL5A 4GKJL 2UXCL 3G48A 1X55A 2JK8A 2LXJA 4O0AA 2H5XA 1JE5A 3UE0A 1EFWA 3M85A 3U4ZA 4PZ7A 3EBEA 1SR3A 2N78A 3PIPA 1QVCA 2KBNA 2N3SA 4P73A 3TRZA 3J81i 1NMGA 2N8NA 3PIOA 3PV0A 3A5UA 2HHHL 4OX9L 2NN6I 4P72A 3GTQH 4GOPB 2JJQA 3U4VA 3L2PA 2CCZA 4BY7G 1HZ9A 1KAWA 1VQFA 1CKOA 3S1RH 1TWGH 2OTLA 1XNRL 3GTLH 4DR5Q 2UUCL 2VUMG 1H95A 2QGQA 1Z47A 2WP8J 3KF8B 4Y7NH 1Q86C 5IY0A 2DUDA 2WB1E 4NXNL 3ULJA 2ALYB 1PFSA 5ELNA 4A3JG 1QUQA 5BR8L 1G291 1YJ9A 3BJUA 3A5ZB 1I3QH
chains in the Genus database with same CATH superfamily
3FHWA 4DKAC 4QIWE 1EWHA 1B8AA 2XNAC 2LY7A 2F0FA 4JC0A 2FMMA 2B2WA 2LXKA 3NTKA 2HIXA 2KCMA 3E0JA 3NP8A 2I07B 1U4LA 1ZYRC 5C4HA 4DV6Q 3F1ZA 4ME3A 4AQYQ 3U58A 1SMXA 4FDBA 3SE0A 1D5XC 2Q2TA 1CSQA 2JSOA 2I5HA 1BOSA 1ESRA 1KD1C 5LMNL 2UU9L 5ISRA 1ASZA 1UEBA 3E9IA 1YIJA 5FO8B 1M90C 1OXUA 3NE5B 1C9OA 4CJ1B 4KN4C 3HOXB 4HSPA 1A2TA 3SK8A 3P7JA 4M1UB 3CCQA 4IJHA 5JOBA 2NTSA 2Z0SA 1I4PA 1PTOD 5C4ZA 1N8RC 1AZQA 4JPBW 1K0SA 4LF7Q 4MZ9A 3QIAA 4IOAA 1WOCA 4FVMA 5AJ3L 5C3WA 3S1NB 2JA5B 4S3SA 1QWYA 1DOLA 3DLLA 2HIVA 1SFOH 3M4PA 2Q2IA 4IO9A 3GO5A 3I4NH 3PO2G 3K0XA 1AW7A 2EOTA 5GAGC 1PTOB 4MHEA 2M2LA 1HZAA 2VQFL 1SNPA 1U4MA 2K4KA 1GUTA 4DV5Q 2B3GA 2R92B 1EQRA 4IZ8A 4KV6A 4FF2A 4RFBA 2CWAA 1YJWA 4OIKA 4BBRH 1HNWQ 4FP5D 3UDIA 4B3TQ 4K14A 4JI4Q 3MAQA 1HZCA 3WOEA 4DNRB 1HTLD 1NSNS 3CRKC 4DAPA 1U4PA 1P8LA 5CV6A 3HKZG 1FR3A 3TBIB 4ZUJA 4LUOA 1CUKA 2YTVA 1EOTA 1JOQA 3P75A 1L1OB 1PFNA 3OW2A 2ID0A 5E4XA 5E7NA 4ZUIA 5IIFA 5IT9E 1CQFA 2KCCA 2F0IA 4TRDA 1VQ7A 3HOYH 1QE6A 1I50H 2AUKA 3VYTA 4IUPA 3R93A 3NUCA 2AUJD 2XTIA 4HJ8A 1KQSA 1UEAB 2KA7A 3FPUB 2CKZB 1VQBA 2BE5C 3F2CA 5C5MA 1DONA 4WJ4A 3J7AF 2EJMA 2X6LA 2MUYA 3FP9A 3G71A 4IPGA 4O42A 3SR1A 2RQXA 2TSSA 4C3JB 3HOUB 5FK9C 3NSWA 1N36L 3S2HH 5CBAE 2AQ1B 2F0VA 1XPRA 3CCSA 4NXNQ 1IBKQ 5J1ZA 2DY7A 2HDMA 4KLKA 3OHXC 5IP7H 3S1QH 2MHVA 1VQLA 4F88A 5FLXc 1X3EA 1A0IA 3MXUA 1I4QA 3R8BA 2E74C 3RLOA 1VQKA 2NVTH 3C1FA 4B3ML 4G4KA 4X64Q 4FF3A 2OQ0A 2K05A 3O13A 1B9MA 4DR2Q 1MJEA 4GOPA 1SYBA 2G9DA 3CU7A 3QB3A 1VQDA 5FLXE 1Q1BA 4LF6Q 3CCUA 3D0FA 3VR2A 4CDEC 1OXVA 2EY6A 2F03A 4CHTB 1PH9A 4IPCA 3J80c 1D1KA 3DUZA 4LF4Q 4ZAIA 3FEWX 2WKCA 1LTAD 4C3HH 4UY8C 1VQGA 3DEPA 1RF2D 2O5IC 3PO3H 2F3VA 3S16B 5I9PA 2ZM6L 1N33Q 2UXDQ 1H9RA 5C3XA 4A3DH 5C5LA 1TWAH 3ZYYX 2F3IA 1HQMC 1VQJA 1LT3D 4JI5Q 1NR2A 1XX8A 3F2DA 2XSCA 4WJ3M 2PNHA 1H9SB 4A3KB 4HIMA 2B2YA 1YJNA 3I90A 1HH2P 5FOBB 3A8IE 2NTTA 4A3CH 1R9TB 2ZJQA 4K8JA 3GTOH 1BNZA 2PNRC 3SVMA 2GVBA 1VQNA 2MJ8A 4FO2A 5M3FB 1EYAA 1GXDC 1F2YA 2D2CC 4EQOA 4C3IG 3NEMA 4BA1I 2NVQH 2EYLA 4I65A 4DV3Q 4BY7B 2K04A 1HHVA 1PYWD 3RN2A 2BOSA 2VUMB 1EFID 5CV8A 4RGOS 1EY5A 1EWIA 4OHJA 4IFDH 4A3IG 1GHKA 5ELCA 2K5HA 4KHPL 2RCNA 1Q8KA 4LFAL 3CQZH 3HOVG 1E3PA 1SROA 2OF1A 3NENA 4R8NA 1CZWA 3TP7A 5CMDA 2BCOA 1WTHA 1D5MC 3U50C 3DHQA 3CKIB 4HJ5A 5M3MH 4LF5Q 1X3GA 1SNDA 2CVRA 1QNKA 2R93B 3PUWA 5G3LF 1Q7YC 2GVAA 4V190 2CQOA 3DM1A 3KBXA 4KD3A 1B3AA 2VL6A 4UHVA 2HHHQ 2ASBA 3I4MB 2R3ZA 2RDFA 2WB1B 4QMGA 1XNRQ 4F87A 3GTJH 3HEJA 4DU9A 1PZJD 5M9OA 5IGFA 1II3A 2ZXRA 4TSSA 5FJ8H 4B3RL 5IODA 5IYCH 4LAAA 3H15A 1TY0A 1VCIA 3E0EA 1X32A 1DJRD 5IE8A 2EYPA 1PYBA 4QY7A 2XIWA 1O7YA 2JA9A 4Q0FA 2R6GA 2V4DA 5C4JB 3PUXA 3FPPA 4KJNA 1HR0W 2AWNA 1IW7D 3X3MA 2F0EA 4JBJA 3PO2B 4DV1Q 2CWPA 4JK1C 1GM5A 1G2TA 4QF4A 3EIVA 4DV0L 1B70B 4YCWA 1MI2A 1STHA 2RVLA 3HOZG 3S1MB 1NMFA 4OONA 1AZPA 1N32L 1S5ED 1BR9A 2R7ZB 1EIGA 3GTMB 3BG3A 3CP0A 3FKIB 4LF9L 3NQIA 2B29A 2UUAL 4DK3C 2NN6H 4A93G 3K5LA 2NYZD 5EKLA 3I73A 4X65Q 3L0OA 1HR0Q 1ENAA 4HJ9A 5C4XG 1N34Q 4IJLA 3EN2A 2HD3A 2QW7A 2EXDA 4A3EB 3ICEA 1WD0A 1V1PA 1KHIA 3UI2A 1IHZA 5FLMG 1DD2A 3U9SA 3HOXG 4RA8A 1ENCA 3T1YL 2A1AA 2KCTA 2Y0SG 5EPJA 3R2TA 4JCVE 4ZLTF 1PFMA 5IP9G 4C1NI 4XTCS 1IBML 2HCCA 5TSSA 2JA5G 4DR6Q 1FJGL 3PIP3 4QUCA 1U0LA 4PMWA 3W2DA 1O78A 3CCEA 1EU4A 3CAMA 1TWGB 2Z1CA 4LF8Q 1PH5A 2PQAB 3A74A 4KI0A 4X3KA 4JI1L 2NWGA 4XYQA 4Y7NB 1E2VA 4G7HC 3T1HL 5DM73 1STEA 2F0PA 1GHJA 2R92H 4BY1G 4QL5A 2UXCL 1Y69U 3G48A 1X55A 1F2ZA 1JE5A 3KLSX 3SEBA 1LTRD 1QVCA 3J81i 1MD2D 1KNAA 1NMGA 2N8NA 3K59A 2O2LD 2SOBA 3GTQH 4N9TA 1VQFA 5C3EB 4DK1A 2E76C 4IUTA 4DR5Q 2UUCL 2WIIB 1CA5A 4A3JG 1S5CD 4DK0A 1QUQA 1DYQA 1XMQL 3TN2A 2I5LX 4YWKA 2SEBD 5CORA 1HNXQ 1N9WA 1YITA 2QA4A 1HCZA 1BBUA 4I7ZC 1M8AA 5KYLA 4JI7Q 2PMZE 3T16A 4MTNA 2PZTA 4HMJA 2DN8A 2EYHA 4IPHA 4C56C 4CJ2C 3WWVA 2K7VA 4IOCA 4QUFA 4K0KQ 1PDQA 2B63B 3M3YH 4XXEA 3VYRA 4FYDA 1HUMA 1EUJA 4DR4L 2VY3A 1KDCA 1CQVA 1K8OA 4C3JG 1EYDA 3HOUG 1YNJC 2NB0A 3KK7A 2K5VA 1YHAA 1IL8A 5JEAJ 1GUOA 2JA8B 3S2DB 4U68A 1EIHA 2IX0A 5IGGA 3LX0A 2A68D 1XPOA 2D5DA 1Y1VB 5C0XJ 1KIXA 2K75A 4IN3A 4ALPA 3TZDA 2DY8A 3MEHA 1OXTA 1WI5A 1SEBD 5ELEA 5CBEE 1KXLA 1HA6A 1RHPA 4WJWA 5D3DA 4A3IB 1B53A 2ICIA 1BCPD 1K83B 3J81c 5JEAG 3D4DA 5IYDH 1G8ZD 4UP7A 1I4HA 2E5LL 4DXGA 2K01A 1T5EA 1TWFH 2D0OA 4LW1A 1PV4A 2RSOA 1BDOA 3NTHA 2FXQA 1JB7A 2KECA 2RA4A 2N49A 2JN4A 3M4OH 2R7FA 3PUYA 5FLXL 5C0XH 2RHSB 3HP3A 1PHJA 3GTKB 4UP8A 1BCPB 3J81E 5CC4A 4JV5L 4L5SA 1OXXK 2KUMA 4GOPC 4RCNA 5IWAQ 4DXFA 3D6CA 1NE3A 1GD7A 3MEFA 4IPDA 3RNUA 4JI2L 1B50A 5GADC 1RJTA 2IPKD 3HG9A 3JAMi 1QCBD 4DAVA 4A3GH 1JE4A 3K7UC 3BZKA 1I4RA 1ZEQX 3BDCA 3M4QA 1NNXA 3J80L 4RAUC 2TMPA 4C2MH 1EY8A 4LFCQ 1FNWA 1QUQB 3PUVA 3URYA 4A3KG 5CYUA 2PW7A 3LWEA 3GQBA 4G57A 5IOCA 4KKTA 3T53B 1JOKA 1TY2A 5M3FG 1R9TH 4NDXA 1E22A 1L0XB 4DV4Q 2E2JB 1MIUA 2LSSA 3F2BA 4NP5A 5L37A 1YNNC 2EVBA 4YWLA 2JA6B 2VS1A 5A2QE 3S17B 1ONLA 4BY7H 2QILA 5JJLA 1LTLA 1STAA 2VUMH 3RLFA 5M5XB 2ZTCA 3K7AB 3KLSA 4LUVA 3HOZB 1H9KA 5C44G 1WTRA 3D3RA 2UUBQ 1J9OA 1V1OA 1ZXTA 3LWUA 2EYFA 1HXYD 1SYCA 2J0TD 3M7GA 4TQUS 2L4NA 2CH4A 4DUZQ 1VMPA 2ZXOA 5E3FA 3H3VI 4A93B 3IFDA 1G6ZA 3CHBD 1ET9A 2R93G 3TZUA 1B3QA 4DV6L 2F4VQ 2RDGA 1LTTD 1E2ZA 2R7DA 4AQYL 3KF6A 2R93H 2KEEA 4IUNA 5C4XB 1ICFB 1CHPD 3VR3A 3RZDB 3AYHB 1AH9A 3I4MG 4NMZA 2YTXA 2WB1G 4BBSG 1F9QA 4JI0Q 4DUYQ 3C1EA 2ZTEA 2ENBA 1D2BA 2Y0SB 2KQ3A 3KF8A 1SXTA 3FRPB 3NELA 5ELFA 1Z7TA 4FXDA 2SNSA 3RUZA 1PRTF 3JAME 1O7ZA 5T1IA 1DOMA 5M5YB 1JCKB 1IKLA 2NVYB 2PI2A 2HQLA 2Y0SE 1MKHA 4P75A 1HUNA 2F0HA 2P5ZX 3OOCA 2K28A 3K81C 5LMUQ 3GTPB 4MIUA 4X3TA 1W3SA 3PO2H 1CKNA 2E75C 1ZKOA 3TP8A 4NXMQ 1AE2A 1JJGA 3STBD 2C5CA 1VF7A 4FF1A 1X56A 4PG3A 4BY1B 1EIYB 3S1MH 1HNWL 3AFPA 1S3OA 2BDOA 4LFBQ 2VQFQ 2Z4IA 2Z6BA 5IT9c 1XNQQ 2R7ZG 1GUWA 1I4XA 4N9PA 4PNYA 2SNMA 5J22A 3FKIG 2ZJRA 2R7ZH 4NW2A 3GTMH 1VQOA 2B39A 4OWXB 1FNUA 4KY7A 1AFPA 1TWCH 1VQ4A 1HNZL 4DAYA 2VQEQ 4NPSA 4A3JB 2IX3A 5EKIA 1SE2A 4A3EG 4X62Q 1JOOA 1WTQA 3G7LA 1FYCA 2F3WA 1PA6A 2K5QA 1STNA 1KAAA 5EJWA 3U9OA 1CM9A 3GTGH 3A7AB 1YBYA 2LS01 3CMEA 4LMQD 2M9VA 4JOIA 2NUCA 4DA2A 1K3BC 5F2DA 1MSHA 1AEXA 1STBA 1UE6A 1QVFA 1DCZA 4N8X1 1WTWA 1VF5C 4OWTB 5LL6X 3PGZA 4OX9Q 3G6EA 3BZDB 3NPPA 4IUUA 1WFQA 1VMCA 1VQEA 4APVA 1G51A 4L63B 5M5WB 2YU9B 1GKHA 2A6HD 3DWAA 3NBHA 3Q22A 2PZUA 3BDOA 3OIQA 4J6HA 3LNNA 5BR8Q 4GLAC 4E6IA 3Q23A 3VR6A 1YHQA 1IBKL 4HCEA 1PMRA 1YNXA 5H1SE 1B9NA 1RL2A 3RN5A 2XVSA 4X66L 2G9HD 1CTMA 4QGUA 3BVZA 3HOWB 4YHHQ 4X64L 4HJ7A 2BH2A 3CXCA 1WCMG 5C3EG 3S24A 1SLJA 1PRTC 4DR2L 3DWQA 2A74C 2AMCB 1Y1WB 1YZ6A 3TSSA 1O7LA 2EZVA 3NK9A 5KNCA 2GA4B 2AHOB 4LF4L 1SJED 4X6AH 2FFKB 4DK6C 1TIID 1B44D 4A3MB 1SNOA 1PZID 2E2IB 1EYGA 1FL0A 2Z6KC 1X3FA 1PLFA 1G6PA 3GP7A 4QJFA 1MBYA 4QB4A 2UXDL 4XDXA 2B63G 1F2MA 4GKKQ 1HQRD 1OO9B 2FHTA 2RCFA 2CQAA 3M4YA 5KYIA 3H0GG 3S15B 3MA2B 2NZOA 1STYA 1QB5D 2EXZA 4K2LA 2K6AA 2JA8G 4DAMA 2UXBQ 1J6QA 3BDLA 1BXTA 1YEZA 4XT1B 2PO4A 1BO0A 3R2IA 4XT3B 1WTXA 1Q81C 2JA8H 4OO1I 2A19A 1CZGA 1V9PA 4XQQA 1JWSD 2D9UA 3RMHA 1Y1VG 2F1MA 1EQQA 4JYAQ 4C3IH 4DV7Q 3KLWA 3C46A 3H3VH 1RIPA 2K52A 3PSIA 3VA5A 4DV3L 3NQTA 3L9AX 1NR4A 1EY6A 1IYJB 2J7ZA 4DR3Q 2I5MX 4OWWB 1CT1D 5EQ0A 2KHJA 4AYBG 3VYSA 5C44B 3JC66 3DXJC 1AN8A 3S9WA 4A3IH 1PXUA 1Q12A 2CW0C 3M9BA 3GTLB 3LGJA 1Q90A 3HOVH 2FMCA 4ABNA 3CPFA 1L0WA 1PH3A 3MHBA 2IHFA 2A6ED 1EZ6A 1I6HB 4P71A 4CDCC 2JXMB 3EROA 3IKJA 1SYFA 2JK8A 3J7AV 3UE0A 2I46A 4PZ7A 2PPBC 2N78A 3PIPA 3TRZA 3H91A 2XWBB 4BBSB 2VXWA 3NBIA 3AMUA 3PV0A 2HHHL 3HRZC 4GOPB 1WTOA 1HTPA 4FXGC 3U4VA 3RZOB 1XNRL 3K0YA 3MFYA 3S1RH 2QGQA 2WP8J 1Q86C 2WB1E 3AB9A 2ALYB 4DNTB 1YJ9A 5KNDA 1I3QH 1JWMD 4A75A 2D0PA 1IXRA 3KJOA 3DWPA 1XYIA 1VQ5A 3L3OC 1YNND 1OXSC 3K58A 2EDGA 1EIFA 3WOFA 4B9XA 3C2PA 1A8VA 1SYGA 1G2SA 3CC4A 5DEHA 2JA6G 5LHY1 1TU2B 1E0BA 3BS1A 3TMEA 4LUZA 2B8GA 3WDNA 5HGQA 4K6LA 4NB3A 3S17H 5A2QL 1WTPA 5IGEA 3D31A 2OQKA 2ZTDA 1J5EL 4X3UA 1VQ8A 2SDFA 5M5XH 3G4SA 1SFOB 5J39A 1W6KA 3HOZH 3I4NB 1KDBA 4DN4M 1ZYRD 4K6DA 4GNXA 2MFIA 5K36G 1VQIA 3MXGA 1JB3A 5BN5A 4CKBA 4HEDA 3I8ZA 2VW9A 4QQBX 4BBRB 4RCOA 5I2YA 3MXNA 1FD7D 4A93H 1N32Q 3I3CA 2PQEA 1V43A 1X9NA 3I91A 4RH6A 2IT1A 5C4XH 1K28A 3V96A 4HJAA 3J7A5 1N34L 1DXMA 2JYOA 1QZGA 1L1OC 1IZ6A 3MXPA 4XQJA 4DV2L 3HKSA 2RBMA 1X3PA 1SJHD 2FINB 4HIDA 3F2UA 3UDGA 1HFNA 3AQQA 5FLMH 3NWTA 2HQEA 1YI2A 3HOXH 2LKVA 1CI3M 2KJXA 1SNMA 1LT6D 3HGBA 1OTCA 4JI8Q 5A35A 1WJJA 4HSVA 1KRTA 4J1MA 5AFWA 5IP9H 3W1GA 2EJFC 3OMCA 4LK1C 1F9RA 4GLXA 2R61A 5T1GA 2QCPX 1I94L 2F0DA 3S1NH 2JA5H 1U4RA 2Q2HA 3P1HA 5M5YH 5HY6A 1XJVA 3IAYA 4DR6L 2OXPA 1IBLL 2MPMA 2I0QA 1SE3A 2VNUD 1B7YB 3OTOQ 3A55A 1PTOH 4RKBA 4LF8L 4UAIA 4XIGS 2WINB 4ZYSA 1NAPA 4IALA 1TS2A 1SYEA 5GAHC 2Q8TA 1SBBB 2DNEA 1T5XD 4YY3Q 4N8FA 4BY1H 2K03A 4JI6Q 1MHWC 3TP6A 3CF5A 5IGBA 2WKDA 4KHVA 3S2HB 3I55A 2RF4A 4JI1Q 4OGQC 3GV3A 1TWHB 2A69C 4KTAA 3AU7A 5KIXA 4GN5A 1WCMB 3I4OA 1NJIC 2CH4W 2UXCQ 3B6YA 1XMOQ 1SMYC 4ZRZA 3J7YW 5I6WA 5JPNC 1VS0A 2NVTB 1BKBA 2Z6KA 3KDFA 4A3FG 4HMIA 1KABA 4A3JH 1D6EC 4ME5A 1NY4A 3ERSX 5IT9L 2F0NA 4JI3Q 4DPGA 4RHSA 2HDLA 2EJGC 3KBGA 4PMCA 1A62A 3J81j 1HNXL 5D3IB 1B4OA 4OO1G 2E2HB 4ZQ3A 4A3BG 2BE5D 4JI7L 2MGSA 5FO9B 4B3SQ 1HA5A 4B08A 1HFGA 1XMQQ 5EBCA 5IGCA 4HIOA 3QOJA 1Z6HA 3KYHC 1C4QA 4C3HB 4XQNA 3TS2A 4AIMA 4K0KL 1P16A 1LABA 2E8GA 3H0GB 3PO3B 1UNSA 2IWHA 3Q8DA 1WD1A 1V1PB 3UDXA 1Q82C 3NXWA 4C3JH 3HOUH 4A3DB 2F0OA 2L12A 2NBFA 4JOIC 3T13A 1VDZA 4JG2A 2XGTA 4TKOB 5IYBG 2CFMA 1X6OA 1UAPA 4CKCA 3QJYA 4CDFC 1D1IA 2PYKA 4DR1Q 2F52A 1TR5A 3GTOB 1SYDA 4KK7A 1JORA 1WYDA 2GN5A 1PH4A 4AYBB 4L5QA 3BU2A 1K8AC 3A54A 1QVGA 2N55A 4PZ8A 1SN8A 3HOWG 1PRTD 5GROA 1S5DD 1LO5D 5JEAH 3CCVA 4A4IA 1D8LA 4EGVA 2PZWA 5FKAC 4XYOA 2KCNA 4AYBE 2A8VA 4DNIA 3UDFA 2O5JC 1Y1WG 1QJOA 3SK4A 1KDAA 3E9HA 2XRSD 3OWEB 1PRTB 2Z8LA 1SNCA 2AKWB 2KHIA 2ATWA 4WFN3 5FO7B 3V05A 1K0RA 4JW0A 4PZ6A 5IWAL 4A3MG 1VQCA 4PQXA 1Z9FA 3KJPA 1BQQT 5M3MB 3S16H 3NTIA 1PZKD 1K8GA 4DR7Q 2E2IH 4A3LG 4BXXG 4JV5Q 2NZ1D 2JA7G 3GDEA 5D65A 3IL8A 3EA6A 3BYTB 2F0SA 4A3KH 2AWOA 1RODA 1F77A 3GTJB 5KRUA 2C35B 2B2UC 5KEEA 4QCLA 5JVH3 4IUVA 4A76A 2XWJB 2ZJPA 4K5XA 5M3FH 5C6AA 1IKMA 3QWNA 3OMGA 1TT2A 4GKJQ 1DZ1A 2LFNA 1JR0D 2X6GA 3R3OA 4X3SA 3ZJYC 4L5RC 2HCIA 1DOKA 2JEBI 5JAVA 1C48A 4O1NA 3G6JB 1PH8A 2EYOA 4MTKA 5I6YA 5LMNW 1FNVA 5C44H 4GN4B 5CV9A 1TVXA 3MWYW 3N52A 2UUBL 3M7NA 3Q0AA 1YHBA 1KNEA 3BYYB 1IYVA 1L1OA 1IW7C 1TQOA 1RTOA 1MJCA 1Y8PB 2B8FA 3ERQA 4DUZL 2EY1A 3MVVA 2MO1A 1PH7A 1I6HH 3NWSA 4G7OC 1SSOA 1NCVA 4KY6A 2F4VL 4GN3B 3SK6A 1KTKA 1UUPA 1R4QB 2BA0A 4OEMB 4P2CB 1JJ2A 4GLVB 3TDQA 3I4MH 4KKSA 4BBSH 1TS5A 4R4OA 2WACA 1I4GA 3JAMc 1VQ6A 4JI0L 3RZOH 3I2ZA 3IFTA 5LMNQ 4RGTA 1F2LA 2UU9Q 4DUYL 1FVIA 3ND9A 1NBWA 4IFDI 2ZXPA 3BVGA 3K8AA 2HT1A 4BA2I 3K57A 1ASYA 2JE6I 3F8TA 5C4JH 5DM63 4KD4A 4LF7L 2EPBA 4MNOA 4BS9A 4MN3A 4YCUA 2BH8A 1AE3A 1EY7A 2OTJA 4CGYB 3RR5A 1HPCA 4YIJA 4EX5A 1XWEA 5LMUL 5JPMC 1PVOA 1IL2A 1UE7A 5AJ3Q 4FXKC 1BCPF 3A0JA 3QOLA 1E7ZA 1E2WA 4NXML 3S14B 3OPOA 4DV5L 3DMUA 4GS3A 3HZXA 1GOZA 2RDHA 3SK5A 2JEAI 1GVPA 3E3XA 3I4NG 1CSPA 4B3TL 2WV6D 2EQSA 1SDFA 1JQYD 4JI4L 4V0BA 4LFBL 1LACA 2QDBA 4H13C 5D14A 4ZCKA 3TS0A 1XNQL 3FKIH 4BBRG 2QF7A 2ZT9C 1EY4A 1FGUA 2K33A 3MC0B 3T56B 2OT2A 3H6MA 1LTBD 2YYZA 4GNXC 4RHRA 2CHBD 1VQ9A 2K5DA 3UE1A 2L1BA 4A3FB 4ZKBB 2VQEL 4A3EH 3GTQB 3V2TA 4X62L 2DJFC 2KEDA 3CCMA 1F9PA 1HNZQ 2Q8IB 4A3BB 1X54A 4K2KA 1A2UA 3I7FA 2E2DC 1KC8C 3KF6B 3J7ZC 3HOYG 1HJPA 1H9SA 3J80i 5I2XA 1A3UA 3D4RA 5I9OA 2H5XA 3M85A 3U4ZA 3EBEA 1J8IA 1SR3A 5G3LD 2N3SA 1W6JA 1LV9A 4IUQA 3A5UA 3PIOA 4OX9L 2NN6I 3K5NA 2JJQA 3L2PA 2CCZA 2OTLA 1TWGH 3M3YB 5EPKA 5K5PA 1H95A 4F8MA 5E4WC 1Z47A 3KF8B 4Y7NH 3ULJA 5CV7A 4NXNL 5ELNA 5BR8L 1G291 1EL0A 2PCFB 1O7IA 4Z9CB 1N36Q 2NVXB 3D4WA 1Q1EA 2A69D 3H3VC 1E1OA 1BBWA 4ZKCB 5EPLA 1SMYD 5KGUA 5JVG3 3TQYA 4RGMA 1G91A 1TWHH 3CD6A 5IP7G 1CKNB 4YHHL 1RDPD 1EEID 1WCMH 2KENA 2V1CC 5C3EH 3ULPA 1K9MC 1RCVD 4FNFA 4ODGA 1V1QA 1E24A 2A68C 3A7LA 4M8AA 2PI2E 4X66Q 3MFGA 3Q24A 4B3MQ 4LF6L 4R9WA 2F0MA 3QR8A 2XN9C 2RHQB 1TWFB 4POGA 1BCPC 1PTOF 2L5TA 2E2HH 3HFZB 3M4OB 3BZCA 1HZBA 1N33L 3ER0A 2B2UA 4DAYB 1U5KA 4C3HG 2JA7B 2B63H 1U9RA 4J8QA 1YNJD 3EFXD 4GKKL 3PO3G 1QZHA 4JI5L 1PYSB 1GO3E 3H0GH 3I4LA 4PV1C 1VQPA 2Q8RE 3L7ZC 2ZM6Q 4R4CA 4CKEA 1B2TA 4LJZC 4A3GB 2BA1A 4A3DG 4J15A 5ELBA 1ILPA 2BDNA 3CCRA 1B1ZA 2AQ3B 3TREA 3S2DH 3J80E 3KFUA 1C0AA 3A56A 4C2MB 2UXBL 1PH1A 2ES2A 1NTGA 4F7XA 1CFMA 1EYCA 4JBKA 3KLRA 1Y1VH 5BN3A 4Q5VA 1FGBD 1BBXC 4IFDJ 1JJCB 4JYAL 1RKNA 4KMUC 2WAQG 3T4AC 5DAUA 3VA7A 4DV7L 4A3CG 2JQOA 2B2VC 4RGNA 2YTYA 3CCJA 4DR3L 1ICWA 2B2TC 2IHEA 3Q6SA 1DGSA 4L8JA 5CR3A 3PIO3 1K83H 2L0CA 4OXPA 1EU3A 1VQHA 3P20A 1XTCD 3NBHB 2H1EA 4P74A 1PH6A 4R4TA 4IFDG 1BVSA 3RD4A 2PW5A 4I7AA 4KHPQ 2K50A 1ESFA 4LF5L 4LFAQ 1VQMA 3GTKH 3J81L 3DM3A 3CC2A 2EE1A 3VR4A 1LM0A 3NHHA 3AFQA 4POFA 2KHSA 5M3MG 1K8MA 5CV4A 1ML0D 1BUVT 4CDDC 1YVCA 5HGTA 4KKUA 4WORA 2F0LA 1D5ZC 2EIFA 2K32A 3IRBA 1EEFD 4YWMA 5I4DA 4H0LC 1SNQA 3VR5A 3QO2A 1KL9A 2L11A 5J3BA 3AEVA 2H4OA 1UE1A 3FMCA 4HN7A 2D62A 2J4XA 3HS0C 1LTGD 1LTID 4B3RQ 1WTVA 2PQAA 4IURA 5FJ8G 1UE5A 5IYCG 1EZ8A 2IW3A 4YCVA 4EQ5A 5C0XI 2E2JH 4AH6A 4DV1L 3K5OA 4UPAA 2JA6H 4ID6A 4EVOA 2X69A 5ELDA 5ELOA 1PTOC 2F0GA 3KOJA 1V8QA 2YV5A 2F0UA 3ULLA 3K7AH 1CK1A 4R1JA 1Q46A 4B9WA 2C9OA 1LLRD 3DEOA 4DV0Q 5K36H 4RG1A 4DFAA 1BF4A 1T9HA 1TXYA 1Y14B 1J5EQ 4OL7A 4GZYC 2L9HA 1D7QA 1EQTA 1JT8A 4R4IA 4X65L 1I5FA 1HR0L 3STBC 4OELB 3PCOB 4LF9Q 2UUAQ 2O4XA 3RZDH 1TS3A 4HTHA 1A63A 3CMAA 2NN6G 1R4PB 3HKZB 3ONAB 2IY5B 3W3AA 1LYLA 1H9JA 5BN4A 1TWCB 1ET6A 2G5DA 2EY2A 2VB2X 5IGDA 5CGKA 2NZHA 1L2FA 2A5HA 2B2WC 3QG1A 4DV2Q 3SDZA 3EVQA 3HOYB 3HKZE 1I50B 3H09A 4O2DA 4ULLA 3I56A 3K6OA 1QNUA 3A8KE 4JI8L 5DNFA 1AP0A 3JAML 3T1YQ 3TEHB 1JICA 3W1BA 2AQ2B 3GTGB 1IYUA 1A15A 2NVYH 3CRLC 1RTNA 1EOVA 4RMFA 3GTPH 1IBMQ 1KRSA 2WFWA 4H7BA 2EYJA 4K5VA 1I94Q 2QDLA 3OTOL 1S40A 4EQNA 1FJGQ 1SRUA 5GAEC 3VYUA 2QEXA 1MSGA 4PMBA 3S14H 1IBLQ 1S72A 4NKLA 1CKMA 1JC7A 2F4IA 2MNAA 4H02A 4HAEA 2F0TA 4YY3L 2RSNA 2MP1A 4JVZA 1Y8OB 4JI6L 2XRQD 1MGSA 4JBMA 3CW2C 3T1HQ 4WRDA 2KVMA 1TS4A 3I70A 4OIJA 3SHLA 2R92G 1I6VC 3GD7A 1PH2A 3S1QB 3FDTA 2HUGA 2IL8A 5E1FA 3OW7A 2A6HC 1GJXA 1XPUA 2F0WA 1K73C 1KLGD 1Q3LA 1LTSD 3CCLA 4DR5L 4HIKA 5HURA 1XMOL 5GQOA 1JMCA 3VDYA 1KLUD 4A3FH 1EY9A 1SE4A 2F0JA 4GNXB 1GUSA 2K1BA 2MO0A 4JI3L 2UUCQ 3EQLC 2DJGC 4UDUC 3PMFA 5COYA 4BWGB 5DLQE 2Q2UA 4OO1H 2PMZB 3FVQA 4A3BH 1Y8NB 5EBDA 2F0KA 3MXNB 2F0QA 3SGIA 4LNQA 4KJOA 4B3SL 4U673 4KN7C 1NUCA 5EAYA 4RWSC 4DF7A 5NUCA 3EJIA 2L15A 5JJZA 3OWFA 2FJ2A 4R8IA 1TWAB 1C7YA 4R4QA 2B2VA 2IJ0A 2OWOA 1STGA 5M5WH 2YU9H 2B2TA 4DR4Q 4H44C 1A3TA 4LWCA 1DM0B 3CC7A 3PF4A 1A3VA 2A73B 1W2BA 5IYBH 5KNBA 1LT5D 1M4VA 2ICEC 2IX1A 4G7ZC 1EY0A 2K14A 1JWUD 1Q8IA 1ENFA 1S4ZA 2WAQB 4JBWA 4L6TB 4EQPA 4CBVA 2Z9HA 2K5NA 4DR1L 4UP9A 1CA6A 3N6RA 2NVXH 2RKSA 3RLNA 3ND8A 4HCSA 3OIPA 2VZAA 1X65A 1RD9D 2NVQB 1E1TA 4HR7B 3PQIA 1VQAA 4C3IB 3HOWH 1EWCA 2DGYA 5JJKA 2QKIC 2WAQE 2MQHA 1SAPA 4FF4A 3OYYA 4ZK9B 3CPWA 2M00A 1XTDA 3GV6A 3D6WA 4C1NK 4CJ0B 1WVLA 1XXGA 1Y1WH 5IYDG 3ITPA 1H9MA 3CQZB 1M1KC 2E5LQ 1K3RA 1LUZA 5LL6S 1EQVA 4K8IA 3HOVB 3BVMA 2K5WA 2OCEA 4RKLA 3PF5A 4TVAB 1SE8A 1X3QA 3MTSA 5C0XG 3E6ZX 4A3MH 5CV5A 3SXHA 2LMCB 2QEJC 2DNCA 4KHZA 2VB3X 3MZ5A 4BXXH 4DR7L 3I72A 4A3LH 1A6XA 1QOHA 2Z4HA 5EGTA 1UWVA 3A8JE 3TP5A 2A6EC 2KOLA 3KDFB 3KUPA 3PUZA 2JA7H 1O80A 1PFBA 1S5FD 4JI2Q 1ILQA 4LFCL 3S15H 2EYMA 4IQZA 1QILA 3OSOA 1L0YB 3X3NA 4Y52H 4A3GG 3W5OA 4L5TA 3S1RB 2N88A 3D8GA 3K5MA 1S5BD 5EKKA 3E5SA 4DV4L 4K5WA 1I3QB 1LT4D 1HRJA 5JJIA 3K80C 2L55A 4GKJL 1F9SA 1GUNA 2LXJA 4O0AA 1CHQD 4ILWA 4KY5A 1EFWA 2CW0D 2KBNA 4P73A 1C8CA 3T51B 2OEOA 4P72A 4QIWB 1TKWB 2B2YC 1HZ9A 1KAWA 4BY7G 1CKOA 3C3LA 1QG7A 2JP1A 3GTLH 2VUMG 1GUGA 4DGZA 2EY5A 5IY0A 2DUDA 1PFSA 3H94A 3BJUA 3A5ZB
chains in the Genus database with same CATH topology
3FHWA 1O7IA 2I5LX 4YWKA 4DKAC 4QIWE 2D0PA 4A75A 1N36Q 1HNXQ 1B8AA 1N9WA 1Q1EA 1YITA 1IXRA 3KJOA 2QA4A 1BBUA 1E1OA 4JC0A 1VQ5A 4JI7Q 2PMZE 1BBWA 1OXSC 2LXKA 4MTNA 2HIXA 2KCMA 1EIFA 4DV6Q 1A8VA 3F1ZA 4ME3A 3TQYA 4AQYQ 4IPHA 3U58A 1SMXA 1TWHH 5IP7G 1CKNB 4FDBA 3WWVA 3CC4A 4YHHL 4IOCA 2JA6G 2Q2TA 1CSQA 4K0KQ 1WCMH 2KENA 2V1CC 4LUZA 5C3EH 3ULPA 1K9MC 5HGQA 3M3YH 2I5HA 4NB3A 3S17H 1KD1C 1V1QA 1E24A 4X66Q 3D31A 5LMNL 1EUJA 2PI2E 2UU9L 4B3MQ 4LF6L 4DR4L 2OQKA 2ZTDA 1UEBA 2VY3A 1J5EL 1ASZA 1VQ8A 5M5XH 3G4SA 3E9IA 3HOUG 3HOZH 1YIJA 1M90C 4GNXA 2RHQB 1OXUA 2MFIA 2K5VA 1YHAA 1C9OA 5JEAJ 5K36G 4POGA 1VQIA 2IX0A 2E2HH 3HFZB 2VW9A 3CCQA 3BZCA 1XPOA 4IJHA 1HZBA 5C0XJ 1KIXA 4QQBX 2K75A 1N33L 4ALPA 3ER0A 2Z0SA 4A93H 1N32Q 1OXTA 1V43A 1N8RC 4DAYB 1WI5A 1X9NA 1U5KA 2IT1A 2B63H 4LF7Q 4MZ9A 5C4XH 4GKKL 1WOCA 4IOAA 3PO3G 1QZHA 1KXLA 5AJ3L 4HJAA 4JI5L 3J7A5 1N34L 1PYSB 1GO3E 3H0GH 1VQPA 1QZGA 3L7ZC 2ZM6Q 1L1OC 1IZ6A 3DLLA 2HIVA 4R4CA 4DV2L 3HKSA 5JEAG 3J81c 4HIDA 3M4PA 2BA1A 2Q2IA 4J15A 3GO5A 4UP7A 4IO9A 3AQQA 3UDGA 3I4NH 3CCRA 3PO2G 5FLMH 3K0XA 3TREA 2E5LL 5GAGC 1TWFH 1YI2A 2D0OA 4LW1A 1HZAA 2VQFL 1PV4A 3KFUA 3S2DH 1C0AA 2K4KA 3HOXH 2UXBL 2FXQA 1PH1A 1JB7A 2ES2A 2N49A 4DV5Q 1NTGA 2B3GA 3M4OH 1EQRA 2R7FA 3PUYA 4JBKA 2RHSB 2CWAA 1YJWA 4JI8Q 1Y1VH 4BBRH 1PHJA 1OTCA 4UP8A 1WJJA 4IFDJ 1HNWQ 1JJCB 4JYAL 1KRTA 2WAQG 3UDIA 4DV7L 5IP9H 4B3TQ 4JV5L 3W1GA 4A3CG 4L5SA 4GLXA 1OXXK 2JQOA 4GOPC 4JI4Q 1HZCA 5IWAQ 1I94L 1NE3A 1GD7A 3MEFA 4IPDA 3RNUA 2YTYA 3CCJA 4DR3L 3S1NH 2JA5H 2Q2HA 2IHEA 5M5YH 1P8LA 4JI2L 1DGSA 3HKZG 5HY6A 5GADC 1XJVA 1SFOH 1K83H 4DR6L 1IBLL 4LUOA 1CUKA 4OXPA 3JAMi 2YTVA 1VQHA 4A3GH 3K7UC 3NBHB 3BZKA 2I0QA 4P74A 2VNUD 1B7YB 1PH6A 1L1OB 3OTOQ 4R4TA 3M4QA 3OW2A 4LF8L 4XIGS 2ID0A 5E7NA 4C2MH 4LFCQ 4IFDG 1BVSA 5GAHC 1QUQB 3PUVA 4A3KG 4KHPQ 2K50A 4LF5L 4LFAQ 4YY3Q 1VQMA 3GTKH 5IYDH 1VQ7A 4BY1H 3HOYH 4JI6Q 1I50H 3CF5A 3DM3A 3CC2A 3I55A 2RF4A 4JI1Q 1LM0A 5M3FG 1R9TH 3AFQA 1E22A 4POFA 4DV4Q 5M3MG 1MIUA 2LSSA 2XTIA 4HJ8A 4GN5A 3F2BA 1KQSA 3I4OA 4YWLA 1YVCA 2VS1A 1NJIC 2UXCQ 3B6YA 2CKZB 4BY7H 1VQBA 5JJLA 1LTLA 3F2CA 1XMOQ 2EIFA 2VUMH 3IRBA 4WJ4A 4YWMA 1VS0A 3RLFA 1BKBA 2Z6KA 3KDFA 4A3FG 1KL9A 5J3BA 2ZTCA 3FP9A 4LUVA 3G71A 4IPGA 4A3JH 3AEVA 1NY4A 5C44G 3ERSX 1UE1A 4JI3Q 2UUBQ 4DPGA 2D62A 1N36L 1A62A 3J81j 1HNXL 3S2HH 4OO1G 4B3RQ 2PQAA 4TQUS 5FJ8G 4A3BG 1UE5A 1XPRA 5IYCG 4JI7L 3CCSA 4DUZQ 4NXNQ 4YCVA 4B3SQ 4EQ5A 1IBKQ 5C0XI 3H3VI 2E2JH 4AH6A 1XMQQ 2R93G 4KLKA 4DV6L 4DV1L 2F4VQ 4AQYL 5IP7H 4HIOA 2R7DA 4UPAA 3KF6A 2JA6H 3KYHC 3S1QH 1VQLA 2R93H 3TS2A 5FLXc 4AIMA 4K0KL 1X3EA 1A0IA 1P16A 2E8GA 5ELOA 2NVTH 3AYHB 3RLOA 1VQKA 1AH9A 3Q8DA 4B3ML 3I4MG 3KOJA 2YV5A 2YTXA 2WB1G 3K7AH 3UDXA 3ULLA 4X64Q 4BBSG 4R1JA 2OQ0A 1Q82C 4C3JH 4JI0Q 3HOUH 1Q46A 3CD6A 4DR2Q 1MJEA 4DUYQ 4JOIC 4DV0Q 4GOPA 4RG1A 2ZTEA 4JG2A 1VQDA 2XGTA 1Q1BA 4LF6Q 1T9HA 1TXYA 1Y14B 3D0FA 5IYBG 3CCUA 1J5EQ 2CFMA 1X6OA 1OXVA 1D7QA 3NELA 4DR1Q 1PH9A 2F52A 4IPCA 3J80c 1JT8A 4LF4Q 4R4IA 4X65L 1I5FA 1HR0L 3STBC 4A3DG 4C3HH 4UY8C 1WYDA 1VQGA 2GN5A 3PCOB 1PH4A 4L5QA 3BU2A 1K8AC 4LF9Q 2UUAQ 3PO3H 3RZDH 1QVGA 2PI2A 2HQLA 2Y0SE 4PZ8A 1A63A 1MKHA 1SN8A 4P75A 5GROA 2NN6G 3CMAA 3HOWG 2ZM6L 1N33Q 2IY5B 5LMUQ 3K81C 1LYLA 2UXDQ 3CCVA 4A4IA 4A3DH 1W3SA 3PO2H 1D8LA 1CKNA 1TWAH 2F3IA 4NXMQ 1VQJA 2NZHA 1AE2A 4AYBE 4JI5Q 3STBD 3F2DA 2A8VA 1JJGA 1L2FA 3UDFA 4DNIA 4WJ3M 1X56A 1Y1WG 2PNHA 4DV2Q 4PG3A 3E9HA 4HIMA 3HKZE 3I56A 4O2DA 1EIYB 1YJNA 3S1MH 4JI8L 1HH2P 1HNWL 2AKWB 3AFPA 2KHIA 1S3OA 2ATWA 4A3CH 4LFBQ 2ZJQA 2VQFQ 3GTOH 1XMQL 2GVBA 5IT9c 3T1YQ 1K0RA 1XNQQ 2R7ZG 1VQNA 3TEHB 4PZ6A 5IWAL 3W1BA 4A3MG 1VQCA 3FKIG 1Z9FA 2NVYH 2ZJRA 2R7ZH 3KJPA 3NEMA 4BA1I 3GTMH 2NVQH 3S16H 1VQOA 1EOVA 4RMFA 4OWXB 1K8GA 2E2IH 3GTPH 4DV3Q 4DR7Q 4A3LG 4BXXG 1IBMQ 4JV5Q 3RN2A 1KRSA 1TWCH 1VQ4A 2WFWA 1HNZL 3GDEA 2JA7G 2VQEQ 1EWIA 1I94Q 3OTOL 1S40A 1FJGQ 4NPSA 1SRUA 5GAEC 2QEXA 4A3EG 4X62Q 3S14H 4A3IG 1IBLQ 4A3KH 2AWOA 2K5HA 1S72A 4KHPL 1CKMA 2RCNA 2MNAA 1Q8KA 4H02A 2C35B 1PA6A 4YY3L 3CQZH 4LFAL 3HOVG 1E3PA 1SROA 4JI6L 3NENA 4JBMA 3CW2C 3T1HQ 4A76A 5M3FH 2ZJPA 3GTGH 3U50C 2R92G 1PH2A 3GD7A 4HJ5A 5M3MH 4LF5Q 1X3GA 4GKJQ 1YBYA 3CMEA 1XPUA 3ZJYC 4L5RC 1K73C 3PUWA 4JOIA 1Q7YC 2GVAA 2JEBI 3CCLA 4DR5L 2CQOA 4HIKA 1XMOL 1UE6A 5GQOA 1QVFA 2VL6A 1JMCA 4OWTB 2HHHQ 3VDYA 3PGZA 4OX9Q 1PH8A 4A3FH 2ASBA 3G6EA 5LMNW 5C44H 4GNXB 1XNRQ 4GN4B 1WFQA 2MO0A 1VQEA 4JI3L 4APVA 1G51A 3GTJH 2UUBL 2UUCQ 3M7NA 1YHBA 1GKHA 5DLQE 1L1OA 2Q2UA 1MJCA 5FJ8H 5BR8Q 4A3BH 4B3RL 5IYCH 3H15A 3MXNB 4GLAC 3SGIA 4LNQA 1VCIA 3E0EA 4DUZL 1YHQA 4B3SL 1IBKL 2MO1A 5IE8A 1PH7A 1I6HH 1PYBA 4QY7A 2JA9A 2R6GA 2F4VL 1YNXA 4GN3B 5H1SE 1RL2A 5EAYA 3RN5A 2BA0A 3PUXA 4X66L 1JJ2A 4GLVB 1HR0W 2AWNA 4QGUA 3I4MH 2L15A 4BBSH 4JBJA 4YHHQ 4R4OA 4DV1Q 4X64L 4HJ7A 3JAMc 1C7YA 4R4QA 3CXCA 2CWPA 2BH2A 1WCMG 5C3EG 1VQ6A 4JI0L 2OWOA 1GM5A 3S24A 5M5WH 3RZOH 3I2ZA 1SLJA 2YU9H 5LMNQ 3EIVA 4DR2L 2UU9Q 4DUYL 4DR4Q 1FVIA 4LWCA 4DV0L 1B70B 4YCWA 1NBWA 3CC7A 2AMCB 3PF4A 1W2BA 4IFDI 5IYBH 1YZ6A 3HOZG 3K8AA 1NMFA 4OONA 2IX1A 2K14A 2HT1A 4JBWA 1N32L 2K5NA 4DR1L 4UP9A 1ASYA 4BA2I 2JE6I 2NVXH 2AHOB 3F8TA 3RLNA 4LF4L 5C4JH 4LF7L 2VZAA 1X65A 4X6AH 4MNOA 4DK6C 4YCUA 1E1TA 2BH8A 1AE3A 3CP0A 4LF9L 2UUAL 2B29A 1VQAA 2OTJA 1EYGA 1FL0A 2Z6KC 3RR5A 4DK3C 1X3FA 4EX5A 3HOWH 4A93G 2DGYA 5JJKA 1G6PA 2WAQE 4QJFA 5LMUL 2MQHA 3L0OA 4X65Q 1HR0Q 3OYYA 3CPWA 4HJ9A 2B63G 2UXDL 4GKKQ 1XTDA 1PVOA 1IL2A 1UE7A 5AJ3Q 5C4XG 1N34Q 4IJLA 3EN2A 3A0JA 3H0GG 1E7ZA 4NXML 2EXDA 4DV5L 4GS3A 3ICEA 1Y1WH 2JEAI 2NZOA 5IYDG 1GVPA 3I4NG 1KHIA 1M1KC 2E5LQ 1K3RA 1LUZA 5FLMG 1CSPA 4B3TL 2EQSA 2JA8G 4DAMA 2UXBQ 1J6QA 1YEZA 3HOXG 4JI4L 2OCEA 2JA8H 1Q81C 4LFBL 4OO1I 3TS0A 4TVAB 2A19A 3PF5A 1SE8A 1V9PA 3T1YL 1XNQL 5C0XG 4A3MH 3FKIH 2A1AA 1Y1VG 2KCTA 2Y0SG 4BBRG 4C3IH 1EQQA 4JYAQ 4DV7Q 3KLWA 3H3VH 4JCVE 1RIPA 4KHZA 1FGUA 5IP9G 4A3LH 2K52A 4BXXH 4DR7L 2YYZA 3PSIA 4XTCS 4DV3L 4GNXC 1IBML 1IYJB 1VQ9A 1UWVA 3PUZA 3KDFB 3UE1A 2I5MX 4DR3Q 4OWWB 2JA7H 4JI2Q 2VQEL 2KHJA 4LFCL 4AYBG 2JA5G 3S15H 1FJGL 4DR6Q 4A3EH 4Y52H 3JC66 1U0LA 4PMWA 4A3IH 4X62L 4A3GG 3CCEA 1Q12A 3W5OA 4L5TA 3CCMA 3CAMA 3M9BA 3LGJA 4LF8Q 1PH5A 3HOVH 2PQAB 3A74A 4KI0A 1HNZQ 3CPFA 4JI1L 1L0WA 1PH3A 1X54A 2IHFA 3T1HL 4DV4L 3I7FA 4P71A 1KC8C 2R92H 3KF6B 5JJIA 3K80C 4BY1G 3J7ZC 3HOYG 1HJPA 3J80i 4QL5A 4GKJL 2UXCL 3G48A 1X55A 2JK8A 2LXJA 4O0AA 2H5XA 1JE5A 3UE0A 1EFWA 3M85A 3U4ZA 4PZ7A 3EBEA 1SR3A 2N78A 3PIPA 1QVCA 2KBNA 2N3SA 4P73A 3TRZA 3J81i 1NMGA 2N8NA 3PIOA 3PV0A 3A5UA 2HHHL 4OX9L 2NN6I 4P72A 3GTQH 4GOPB 2JJQA 3U4VA 3L2PA 2CCZA 4BY7G 1HZ9A 1KAWA 1VQFA 1CKOA 3S1RH 1TWGH 2OTLA 1XNRL 3GTLH 4DR5Q 2UUCL 2VUMG 1H95A 2QGQA 1Z47A 2WP8J 3KF8B 4Y7NH 1Q86C 5IY0A 2DUDA 2WB1E 4NXNL 3ULJA 2ALYB 1PFSA 5ELNA 4A3JG 1QUQA 5BR8L 1G291 1YJ9A 3BJUA 3A5ZB 1I3QH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FHW A;  1O7I A;  2I5L X;  4YWK A;  4DKA C;  4QIW E;  2D0P A;  4A75 A;  1N36 Q;  1HNX Q;  1B8A A;  1N9W A;  1Q1E A;  1YIT A;  1IXR A;  3KJO A;  2QA4 A;  1BBU A;  1E1O A;  4JC0 A;  1VQ5 A;  4JI7 Q;  2PMZ E;  1BBW A;  1OXS C;  2LXK A;  4MTN A;  2HIX A;  2KCM A;  1EIF A;  4DV6 Q;  1A8V A;  3F1Z A;  4ME3 A;  3TQY A;  4AQY Q;  4IPH A;  3U58 A;  1SMX A;  1TWH H;  5IP7 G;  1CKN B;  4FDB A;  3WWV A;  3CC4 A;  4YHH L;  4IOC A;  2JA6 G;  2Q2T A;  1CSQ A;  4K0K Q;  1WCM H;  2KEN A;  2V1C C;  4LUZ A;  5C3E H;  3ULP A;  1K9M C;  5HGQ A;  3M3Y H;  2I5H A;  4NB3 A;  3S17 H;  1KD1 C;  1V1Q A;  1E24 A;  4X66 Q;  3D31 A;  5LMN L;  1EUJ A;  2PI2 E;  2UU9 L;  4B3M Q;  4LF6 L;  4DR4 L;  2OQK A;  2ZTD A;  1UEB A;  2VY3 A;  1J5E L;  1ASZ A;  1VQ8 A;  5M5X H;  3G4S A;  3E9I A;  3HOU G;  3HOZ H;  1YIJ A;  1M90 C;  4GNX A;  2RHQ B;  1OXU A;  2MFI A;  2K5V A;  1YHA A;  1C9O A;  5JEA J;  5K36 G;  4POG A;  1VQI A;  2IX0 A;  2E2H H;  3HFZ B;  2VW9 A;  3CCQ A;  3BZC A;  1XPO A;  4IJH A;  1HZB A;  5C0X J;  1KIX A;  4QQB X;  2K75 A;  1N33 L;  4ALP A;  3ER0 A;  2Z0S A;  4A93 H;  1N32 Q;  1OXT A;  1V43 A;  1N8R C;  4DAY B;  1WI5 A;  1X9N A;  1U5K A;  2IT1 A;  2B63 H;  4LF7 Q;  4MZ9 A;  5C4X H;  4GKK L;  1WOC A;  4IOA A;  3PO3 G;  1QZH A;  1KXL A;  5AJ3 L;  4HJA A;  4JI5 L;  3J7A 5;  1N34 L;  1PYS B;  1GO3 E;  3H0G H;  1VQP A;  1QZG A;  3L7Z C;  2ZM6 Q;  1L1O C;  1IZ6 A;  3DLL A;  2HIV A;  4R4C A;  4DV2 L;  3HKS A;  5JEA G;  3J81 c;  4HID A;  3M4P A;  2BA1 A;  2Q2I A;  4J15 A;  3GO5 A;  4UP7 A;  4IO9 A;  3AQQ A;  3UDG A;  3I4N H;  3CCR A;  3PO2 G;  5FLM H;  3K0X A;  3TRE A;  2E5L L;  5GAG C;  1TWF H;  1YI2 A;  2D0O A;  4LW1 A;  1HZA A;  2VQF L;  1PV4 A;  3KFU A;  3S2D H;  1C0A A;  2K4K A;  3HOX H;  2UXB L;  2FXQ A;  1PH1 A;  1JB7 A;  2ES2 A;  2N49 A;  4DV5 Q;  1NTG A;  2B3G A;  3M4O H;  1EQR A;  2R7F A;  3PUY A;  4JBK A;  2RHS B;  2CWA A;  1YJW A;  4JI8 Q;  1Y1V H;  4BBR H;  1PHJ A;  1OTC A;  4UP8 A;  1WJJ A;  4IFD J;  1HNW Q;  1JJC B;  4JYA L;  1KRT A;  2WAQ G;  3UDI A;  4DV7 L;  5IP9 H;  4B3T Q;  4JV5 L;  3W1G A;  4A3C G;  4L5S A;  4GLX A;  1OXX K;  2JQO A;  4GOP C;  4JI4 Q;  1HZC A;  5IWA Q;  1I94 L;  1NE3 A;  1GD7 A;  3MEF A;  4IPD A;  3RNU A;  2YTY A;  3CCJ A;  4DR3 L;  3S1N H;  2JA5 H;  2Q2H A;  2IHE A;  5M5Y H;  1P8L A;  4JI2 L;  1DGS A;  3HKZ G;  5HY6 A;  5GAD C;  1XJV A;  1SFO H;  1K83 H;  4DR6 L;  1IBL L;  4LUO A;  1CUK A;  4OXP A;  3JAM i;  2YTV A;  1VQH A;  4A3G H;  3K7U C;  3NBH B;  3BZK A;  2I0Q A;  4P74 A;  2VNU D;  1B7Y B;  1PH6 A;  1L1O B;  3OTO Q;  4R4T A;  3M4Q A;  3OW2 A;  4LF8 L;  4XIG S;  2ID0 A;  5E7N A;  4C2M H;  4LFC Q;  4IFD G;  1BVS A;  5GAH C;  1QUQ B;  3PUV A;  4A3K G;  4KHP Q;  2K50 A;  4LF5 L;  4LFA Q;  4YY3 Q;  1VQM A;  3GTK H;  5IYD H;  1VQ7 A;  4BY1 H;  3HOY H;  4JI6 Q;  1I50 H;  3CF5 A;  3DM3 A;  3CC2 A;  3I55 A;  2RF4 A;  4JI1 Q;  1LM0 A;  5M3F G;  1R9T H;  3AFQ A;  1E22 A;  4POF A;  4DV4 Q;  5M3M G;  1MIU A;  2LSS A;  2XTI A;  4HJ8 A;  4GN5 A;  3F2B A;  1KQS A;  3I4O A;  4YWL A;  1YVC A;  2VS1 A;  1NJI C;  2UXC Q;  3B6Y A;  2CKZ B;  4BY7 H;  1VQB A;  5JJL A;  1LTL A;  3F2C A;  1XMO Q;  2EIF A;  2VUM H;  3IRB A;  4WJ4 A;  4YWM A;  1VS0 A;  3RLF A;  1BKB A;  2Z6K A;  3KDF A;  4A3F G;  1KL9 A;  5J3B A;  2ZTC A;  3FP9 A;  4LUV A;  3G71 A;  4IPG A;  4A3J H;  3AEV A;  1NY4 A;  5C44 G;  3ERS X;  1UE1 A;  4JI3 Q;  2UUB Q;  4DPG A;  2D62 A;  1N36 L;  1A62 A;  3J81 j;  1HNX L;  3S2H H;  4OO1 G;  4B3R Q;  2PQA A;  4TQU S;  5FJ8 G;  4A3B G;  1UE5 A;  1XPR A;  5IYC G;  4JI7 L;  3CCS A;  4DUZ Q;  4NXN Q;  4YCV A;  4B3S Q;  4EQ5 A;  1IBK Q;  5C0X I;  3H3V I;  2E2J H;  4AH6 A;  1XMQ Q;  2R93 G;  4KLK A;  4DV6 L;  4DV1 L;  2F4V Q;  4AQY L;  5IP7 H;  4HIO A;  2R7D A;  4UPA A;  3KF6 A;  2JA6 H;  3KYH C;  3S1Q H;  1VQL A;  2R93 H;  3TS2 A;  5FLX c;  4AIM A;  4K0K L;  1X3E A;  1A0I A;  1P16 A;  2E8G A;  5ELO A;  2NVT H;  3AYH B;  3RLO A;  1VQK A;  1AH9 A;  3Q8D A;  4B3M L;  3I4M G;  3KOJ A;  2YV5 A;  2YTX A;  2WB1 G;  3K7A H;  3UDX A;  3ULL A;  4X64 Q;  4BBS G;  4R1J A;  2OQ0 A;  1Q82 C;  4C3J H;  4JI0 Q;  3HOU H;  1Q46 A;  3CD6 A;  4DR2 Q;  1MJE A;  4DUY Q;  4JOI C;  4DV0 Q;  4GOP A;  4RG1 A;  2ZTE A;  4JG2 A;  1VQD A;  2XGT A;  1Q1B A;  4LF6 Q;  1T9H A;  1TXY A;  1Y14 B;  3D0F A;  5IYB G;  3CCU A;  1J5E Q;  2CFM A;  1X6O A;  1OXV A;  1D7Q A;  3NEL A;  4DR1 Q;  1PH9 A;  2F52 A;  4IPC A;  3J80 c;  1JT8 A;  4LF4 Q;  4R4I A;  4X65 L;  1I5F A;  1HR0 L;  3STB C;  4A3D G;  4C3H H;  4UY8 C;  1WYD A;  1VQG A;  2GN5 A;  3PCO B;  1PH4 A;  4L5Q A;  3BU2 A;  1K8A C;  4LF9 Q;  2UUA Q;  3PO3 H;  3RZD H;  1QVG A;  2PI2 A;  2HQL A;  2Y0S E;  4PZ8 A;  1A63 A;  1MKH A;  1SN8 A;  4P75 A;  5GRO A;  2NN6 G;  3CMA A;  3HOW G;  2ZM6 L;  1N33 Q;  2IY5 B;  5LMU Q;  3K81 C;  1LYL A;  2UXD Q;  3CCV A;  4A4I A;  4A3D H;  1W3S A;  3PO2 H;  1D8L A;  1CKN A;  1TWA H;  2F3I A;  4NXM Q;  1VQJ A;  2NZH A;  1AE2 A;  4AYB E;  4JI5 Q;  3STB D;  3F2D A;  2A8V A;  1JJG A;  1L2F A;  3UDF A;  4DNI A;  4WJ3 M;  1X56 A;  1Y1W G;  2PNH A;  4DV2 Q;  4PG3 A;  3E9H A;  4HIM A;  3HKZ E;  3I56 A;  4O2D A;  1EIY B;  1YJN A;  3S1M H;  4JI8 L;  1HH2 P;  1HNW L;  2AKW B;  3AFP A;  2KHI A;  1S3O A;  2ATW A;  4A3C H;  4LFB Q;  2ZJQ A;  2VQF Q;  3GTO H;  1XMQ L;  2GVB A;  5IT9 c;  3T1Y Q;  1K0R A;  1XNQ Q;  2R7Z G;  1VQN A;  3TEH B;  4PZ6 A;  5IWA L;  3W1B A;  4A3M G;  1VQC A;  3FKI G;  1Z9F A;  2NVY H;  2ZJR A;  2R7Z H;  3KJP A;  3NEM A;  4BA1 I;  3GTM H;  2NVQ H;  3S16 H;  1VQO A;  1EOV A;  4RMF A;  4OWX B;  1K8G A;  2E2I H;  3GTP H;  4DV3 Q;  4DR7 Q;  4A3L G;  4BXX G;  1IBM Q;  4JV5 Q;  3RN2 A;  1KRS A;  1TWC H;  1VQ4 A;  2WFW A;  1HNZ L;  3GDE A;  2JA7 G;  2VQE Q;  1EWI A;  1I94 Q;  3OTO L;  1S40 A;  1FJG Q;  4NPS A;  1SRU A;  5GAE C;  2QEX A;  4A3E G;  4X62 Q;  3S14 H;  4A3I G;  1IBL Q;  4A3K H;  2AWO A;  2K5H A;  1S72 A;  4KHP L;  1CKM A;  2RCN A;  2MNA A;  1Q8K A;  4H02 A;  2C35 B;  1PA6 A;  4YY3 L;  3CQZ H;  4LFA L;  3HOV G;  1E3P A;  1SRO A;  4JI6 L;  3NEN A;  4JBM A;  3CW2 C;  3T1H Q;  4A76 A;  5M3F H;  2ZJP A;  3GTG H;  3U50 C;  2R92 G;  1PH2 A;  3GD7 A;  4HJ5 A;  5M3M H;  4LF5 Q;  1X3G A;  4GKJ Q;  1YBY A;  3CME A;  1XPU A;  3ZJY C;  4L5R C;  1K73 C;  3PUW A;  4JOI A;  1Q7Y C;  2GVA A;  2JEB I;  3CCL A;  4DR5 L;  2CQO A;  4HIK A;  1XMO L;  1UE6 A;  5GQO A;  1QVF A;  2VL6 A;  1JMC A;  4OWT B;  2HHH Q;  3VDY A;  3PGZ A;  4OX9 Q;  1PH8 A;  4A3F H;  2ASB A;  3G6E A;  5LMN W;  5C44 H;  4GNX B;  1XNR Q;  4GN4 B;  1WFQ A;  2MO0 A;  1VQE A;  4JI3 L;  4APV A;  1G51 A;  3GTJ H;  2UUB L;  2UUC Q;  3M7N A;  1YHB A;  1GKH A;  5DLQ E;  1L1O A;  2Q2U A;  1MJC A;  5FJ8 H;  5BR8 Q;  4A3B H;  4B3R L;  5IYC H;  3H15 A;  3MXN B;  4GLA C;  3SGI A;  4LNQ A;  1VCI A;  3E0E A;  4DUZ L;  1YHQ A;  4B3S L;  1IBK L;  2MO1 A;  5IE8 A;  1PH7 A;  1I6H H;  1PYB A;  4QY7 A;  2JA9 A;  2R6G A;  2F4V L;  1YNX A;  4GN3 B;  5H1S E;  1RL2 A;  5EAY A;  3RN5 A;  2BA0 A;  3PUX A;  4X66 L;  1JJ2 A;  4GLV B;  1HR0 W;  2AWN A;  4QGU A;  3I4M H;  2L15 A;  4BBS H;  4JBJ A;  4YHH Q;  4R4O A;  4DV1 Q;  4X64 L;  4HJ7 A;  3JAM c;  1C7Y A;  4R4Q A;  3CXC A;  2CWP A;  2BH2 A;  1WCM G;  5C3E G;  1VQ6 A;  4JI0 L;  2OWO A;  1GM5 A;  3S24 A;  5M5W H;  3RZO H;  3I2Z A;  1SLJ A;  2YU9 H;  5LMN Q;  3EIV A;  4DR2 L;  2UU9 Q;  4DUY L;  4DR4 Q;  1FVI A;  4LWC A;  4DV0 L;  1B70 B;  4YCW A;  1NBW A;  3CC7 A;  2AMC B;  3PF4 A;  1W2B A;  4IFD I;  5IYB H;  1YZ6 A;  3HOZ G;  3K8A A;  1NMF A;  4OON A;  2IX1 A;  2K14 A;  2HT1 A;  4JBW A;  1N32 L;  2K5N A;  4DR1 L;  4UP9 A;  1ASY A;  4BA2 I;  2JE6 I;  2NVX H;  2AHO B;  3F8T A;  3RLN A;  4LF4 L;  5C4J H;  4LF7 L;  2VZA A;  1X65 A;  4X6A H;  4MNO A;  4DK6 C;  4YCU A;  1E1T A;  2BH8 A;  1AE3 A;  3CP0 A;  4LF9 L;  2UUA L;  2B29 A;  1VQA A;  2OTJ A;  1EYG A;  1FL0 A;  2Z6K C;  3RR5 A;  4DK3 C;  1X3F A;  4EX5 A;  3HOW H;  4A93 G;  2DGY A;  5JJK A;  1G6P A;  2WAQ E;  4QJF A;  5LMU L;  2MQH A;  3L0O A;  4X65 Q;  1HR0 Q;  3OYY A;  3CPW A;  4HJ9 A;  2B63 G;  2UXD L;  4GKK Q;  1XTD A;  1PVO A;  1IL2 A;  1UE7 A;  5AJ3 Q;  5C4X G;  1N34 Q;  4IJL A;  3EN2 A;  3A0J A;  3H0G G;  1E7Z A;  4NXM L;  2EXD A;  4DV5 L;  4GS3 A;  3ICE A;  1Y1W H;  2JEA I;  2NZO A;  5IYD G;  1GVP A;  3I4N G;  1KHI A;  1M1K C;  2E5L Q;  1K3R A;  1LUZ A;  5FLM G;  1CSP A;  4B3T L;  2EQS A;  2JA8 G;  4DAM A;  2UXB Q;  1J6Q A;  1YEZ A;  3HOX G;  4JI4 L;  2OCE A;  2JA8 H;  1Q81 C;  4LFB L;  4OO1 I;  3TS0 A;  4TVA B;  2A19 A;  3PF5 A;  1SE8 A;  1V9P A;  3T1Y L;  1XNQ L;  5C0X G;  4A3M H;  3FKI H;  2A1A A;  1Y1V G;  2KCT A;  2Y0S G;  4BBR G;  4C3I H;  1EQQ A;  4JYA Q;  4DV7 Q;  3KLW A;  3H3V H;  4JCV E;  1RIP A;  4KHZ A;  1FGU A;  5IP9 G;  4A3L H;  2K52 A;  4BXX H;  4DR7 L;  2YYZ A;  3PSI A;  4XTC S;  4DV3 L;  4GNX C;  1IBM L;  1IYJ B;  1VQ9 A;  1UWV A;  3PUZ A;  3KDF B;  3UE1 A;  2I5M X;  4DR3 Q;  4OWW B;  2JA7 H;  4JI2 Q;  2VQE L;  2KHJ A;  4LFC L;  4AYB G;  2JA5 G;  3S15 H;  1FJG L;  4DR6 Q;  4A3E H;  4Y52 H;  3JC6 6;  1U0L A;  4PMW A;  4A3I H;  4X62 L;  4A3G G;  3CCE A;  1Q12 A;  3W5O A;  4L5T A;  3CCM A;  3CAM A;  3M9B A;  3LGJ A;  4LF8 Q;  1PH5 A;  3HOV H;  2PQA B;  3A74 A;  4KI0 A;  1HNZ Q;  3CPF A;  4JI1 L;  1L0W A;  1PH3 A;  1X54 A;  2IHF A;  3T1H L;  4DV4 L;  3I7F A;  4P71 A;  1KC8 C;  2R92 H;  3KF6 B;  5JJI A;  3K80 C;  4BY1 G;  3J7Z C;  3HOY G;  1HJP A;  3J80 i;  4QL5 A;  4GKJ L;  2UXC L;  3G48 A;  1X55 A;  2JK8 A;  2LXJ A;  4O0A A;  2H5X A;  1JE5 A;  3UE0 A;  1EFW A;  3M85 A;  3U4Z A;  4PZ7 A;  3EBE A;  1SR3 A;  2N78 A;  3PIP A;  1QVC A;  2KBN A;  2N3S A;  4P73 A;  3TRZ A;  3J81 i;  1NMG A;  2N8N A;  3PIO A;  3PV0 A;  3A5U A;  2HHH L;  4OX9 L;  2NN6 I;  4P72 A;  3GTQ H;  4GOP B;  2JJQ A;  3U4V A;  3L2P A;  2CCZ A;  4BY7 G;  1HZ9 A;  1KAW A;  1VQF A;  1CKO A;  3S1R H;  1TWG H;  2OTL A;  1XNR L;  3GTL H;  4DR5 Q;  2UUC L;  2VUM G;  1H95 A;  2QGQ A;  1Z47 A;  2WP8 J;  3KF8 B;  4Y7N H;  1Q86 C;  5IY0 A;  2DUD A;  2WB1 E;  4NXN L;  3ULJ A;  2ALY B;  1PFS A;  5ELN A;  4A3J G;  1QUQ A;  5BR8 L;  1G29 1;  1YJ9 A;  3BJU A;  3A5Z B;  1I3Q H; 
#chains in the Genus database with same CATH topology
 3FHW A;  4DKA C;  4QIW E;  1EWH A;  1B8A A;  2XNA C;  2LY7 A;  2F0F A;  4JC0 A;  2FMM A;  2B2W A;  2LXK A;  3NTK A;  2HIX A;  2KCM A;  3E0J A;  3NP8 A;  2I07 B;  1U4L A;  1ZYR C;  5C4H A;  4DV6 Q;  3F1Z A;  4ME3 A;  4AQY Q;  3U58 A;  1SMX A;  4FDB A;  3SE0 A;  1D5X C;  2Q2T A;  1CSQ A;  2JSO A;  2I5H A;  1BOS A;  1ESR A;  1KD1 C;  5LMN L;  2UU9 L;  5ISR A;  1ASZ A;  1UEB A;  3E9I A;  1YIJ A;  5FO8 B;  1M90 C;  1OXU A;  3NE5 B;  1C9O A;  4CJ1 B;  4KN4 C;  3HOX B;  4HSP A;  1A2T A;  3SK8 A;  3P7J A;  4M1U B;  3CCQ A;  4IJH A;  5JOB A;  2NTS A;  2Z0S A;  1I4P A;  1PTO D;  5C4Z A;  1N8R C;  1AZQ A;  4JPB W;  1K0S A;  4LF7 Q;  4MZ9 A;  3QIA A;  4IOA A;  1WOC A;  4FVM A;  5AJ3 L;  5C3W A;  3S1N B;  2JA5 B;  4S3S A;  1QWY A;  1DOL A;  3DLL A;  2HIV A;  1SFO H;  3M4P A;  2Q2I A;  4IO9 A;  3GO5 A;  3I4N H;  3PO2 G;  3K0X A;  1AW7 A;  2EOT A;  5GAG C;  1PTO B;  4MHE A;  2M2L A;  1HZA A;  2VQF L;  1SNP A;  1U4M A;  2K4K A;  1GUT A;  4DV5 Q;  2B3G A;  2R92 B;  1EQR A;  4IZ8 A;  4KV6 A;  4FF2 A;  4RFB A;  2CWA A;  1YJW A;  4OIK A;  4BBR H;  1HNW Q;  4FP5 D;  3UDI A;  4B3T Q;  4K14 A;  4JI4 Q;  3MAQ A;  1HZC A;  3WOE A;  4DNR B;  1HTL D;  1NSN S;  3CRK C;  4DAP A;  1U4P A;  1P8L A;  5CV6 A;  3HKZ G;  1FR3 A;  3TBI B;  4ZUJ A;  4LUO A;  1CUK A;  2YTV A;  1EOT A;  1JOQ A;  3P75 A;  1L1O B;  1PFN A;  3OW2 A;  2ID0 A;  5E4X A;  5E7N A;  4ZUI A;  5IIF A;  5IT9 E;  1CQF A;  2KCC A;  2F0I A;  4TRD A;  1VQ7 A;  3HOY H;  1QE6 A;  1I50 H;  2AUK A;  3VYT A;  4IUP A;  3R93 A;  3NUC A;  2AUJ D;  2XTI A;  4HJ8 A;  1KQS A;  1UEA B;  2KA7 A;  3FPU B;  2CKZ B;  1VQB A;  2BE5 C;  3F2C A;  5C5M A;  1DON A;  4WJ4 A;  3J7A F;  2EJM A;  2X6L A;  2MUY A;  3FP9 A;  3G71 A;  4IPG A;  4O42 A;  3SR1 A;  2RQX A;  2TSS A;  4C3J B;  3HOU B;  5FK9 C;  3NSW A;  1N36 L;  3S2H H;  5CBA E;  2AQ1 B;  2F0V A;  1XPR A;  3CCS A;  4NXN Q;  1IBK Q;  5J1Z A;  2DY7 A;  2HDM A;  4KLK A;  3OHX C;  5IP7 H;  3S1Q H;  2MHV A;  1VQL A;  4F88 A;  5FLX c;  1X3E A;  1A0I A;  3MXU A;  1I4Q A;  3R8B A;  2E74 C;  3RLO A;  1VQK A;  2NVT H;  3C1F A;  4B3M L;  4G4K A;  4X64 Q;  4FF3 A;  2OQ0 A;  2K05 A;  3O13 A;  1B9M A;  4DR2 Q;  1MJE A;  4GOP A;  1SYB A;  2G9D A;  3CU7 A;  3QB3 A;  1VQD A;  5FLX E;  1Q1B A;  4LF6 Q;  3CCU A;  3D0F A;  3VR2 A;  4CDE C;  1OXV A;  2EY6 A;  2F03 A;  4CHT B;  1PH9 A;  4IPC A;  3J80 c;  1D1K A;  3DUZ A;  4LF4 Q;  4ZAI A;  3FEW X;  2WKC A;  1LTA D;  4C3H H;  4UY8 C;  1VQG A;  3DEP A;  1RF2 D;  2O5I C;  3PO3 H;  2F3V A;  3S16 B;  5I9P A;  2ZM6 L;  1N33 Q;  2UXD Q;  1H9R A;  5C3X A;  4A3D H;  5C5L A;  1TWA H;  3ZYY X;  2F3I A;  1HQM C;  1VQJ A;  1LT3 D;  4JI5 Q;  1NR2 A;  1XX8 A;  3F2D A;  2XSC A;  4WJ3 M;  2PNH A;  1H9S B;  4A3K B;  4HIM A;  2B2Y A;  1YJN A;  3I90 A;  1HH2 P;  5FOB B;  3A8I E;  2NTT A;  4A3C H;  1R9T B;  2ZJQ A;  4K8J A;  3GTO H;  1BNZ A;  2PNR C;  3SVM A;  2GVB A;  1VQN A;  2MJ8 A;  4FO2 A;  5M3F B;  1EYA A;  1GXD C;  1F2Y A;  2D2C C;  4EQO A;  4C3I G;  3NEM A;  4BA1 I;  2NVQ H;  2EYL A;  4I65 A;  4DV3 Q;  4BY7 B;  2K04 A;  1HHV A;  1PYW D;  3RN2 A;  2BOS A;  2VUM B;  1EFI D;  5CV8 A;  4RGO S;  1EY5 A;  1EWI A;  4OHJ A;  4IFD H;  4A3I G;  1GHK A;  5ELC A;  2K5H A;  4KHP L;  2RCN A;  1Q8K A;  4LFA L;  3CQZ H;  3HOV G;  1E3P A;  1SRO A;  2OF1 A;  3NEN A;  4R8N A;  1CZW A;  3TP7 A;  5CMD A;  2BCO A;  1WTH A;  1D5M C;  3U50 C;  3DHQ A;  3CKI B;  4HJ5 A;  5M3M H;  4LF5 Q;  1X3G A;  1SND A;  2CVR A;  1QNK A;  2R93 B;  3PUW A;  5G3L F;  1Q7Y C;  2GVA A;  4V19 0;  2CQO A;  3DM1 A;  3KBX A;  4KD3 A;  1B3A A;  2VL6 A;  4UHV A;  2HHH Q;  2ASB A;  3I4M B;  2R3Z A;  2RDF A;  2WB1 B;  4QMG A;  1XNR Q;  4F87 A;  3GTJ H;  3HEJ A;  4DU9 A;  1PZJ D;  5M9O A;  5IGF A;  1II3 A;  2ZXR A;  4TSS A;  5FJ8 H;  4B3R L;  5IOD A;  5IYC H;  4LAA A;  3H15 A;  1TY0 A;  1VCI A;  3E0E A;  1X32 A;  1DJR D;  5IE8 A;  2EYP A;  1PYB A;  4QY7 A;  2XIW A;  1O7Y A;  2JA9 A;  4Q0F A;  2R6G A;  2V4D A;  5C4J B;  3PUX A;  3FPP A;  4KJN A;  1HR0 W;  2AWN A;  1IW7 D;  3X3M A;  2F0E A;  4JBJ A;  3PO2 B;  4DV1 Q;  2CWP A;  4JK1 C;  1GM5 A;  1G2T A;  4QF4 A;  3EIV A;  4DV0 L;  1B70 B;  4YCW A;  1MI2 A;  1STH A;  2RVL A;  3HOZ G;  3S1M B;  1NMF A;  4OON A;  1AZP A;  1N32 L;  1S5E D;  1BR9 A;  2R7Z B;  1EIG A;  3GTM B;  3BG3 A;  3CP0 A;  3FKI B;  4LF9 L;  3NQI A;  2B29 A;  2UUA L;  4DK3 C;  2NN6 H;  4A93 G;  3K5L A;  2NYZ D;  5EKL A;  3I73 A;  4X65 Q;  3L0O A;  1HR0 Q;  1ENA A;  4HJ9 A;  5C4X G;  1N34 Q;  4IJL A;  3EN2 A;  2HD3 A;  2QW7 A;  2EXD A;  4A3E B;  3ICE A;  1WD0 A;  1V1P A;  1KHI A;  3UI2 A;  1IHZ A;  5FLM G;  1DD2 A;  3U9S A;  3HOX G;  4RA8 A;  1ENC A;  3T1Y L;  2A1A A;  2KCT A;  2Y0S G;  5EPJ A;  3R2T A;  4JCV E;  4ZLT F;  1PFM A;  5IP9 G;  4C1N I;  4XTC S;  1IBM L;  2HCC A;  5TSS A;  2JA5 G;  4DR6 Q;  1FJG L;  3PIP 3;  4QUC A;  1U0L A;  4PMW A;  3W2D A;  1O78 A;  3CCE A;  1EU4 A;  3CAM A;  1TWG B;  2Z1C A;  4LF8 Q;  1PH5 A;  2PQA B;  3A74 A;  4KI0 A;  4X3K A;  4JI1 L;  2NWG A;  4XYQ A;  4Y7N B;  1E2V A;  4G7H C;  3T1H L;  5DM7 3;  1STE A;  2F0P A;  1GHJ A;  2R92 H;  4BY1 G;  4QL5 A;  2UXC L;  1Y69 U;  3G48 A;  1X55 A;  1F2Z A;  1JE5 A;  3KLS X;  3SEB A;  1LTR D;  1QVC A;  3J81 i;  1MD2 D;  1KNA A;  1NMG A;  2N8N A;  3K59 A;  2O2L D;  2SOB A;  3GTQ H;  4N9T A;  1VQF A;  5C3E B;  4DK1 A;  2E76 C;  4IUT A;  4DR5 Q;  2UUC L;  2WII B;  1CA5 A;  4A3J G;  1S5C D;  4DK0 A;  1QUQ A;  1DYQ A;  1XMQ L;  3TN2 A;  2I5L X;  4YWK A;  2SEB D;  5COR A;  1HNX Q;  1N9W A;  1YIT A;  2QA4 A;  1HCZ A;  1BBU A;  4I7Z C;  1M8A A;  5KYL A;  4JI7 Q;  2PMZ E;  3T16 A;  4MTN A;  2PZT A;  4HMJ A;  2DN8 A;  2EYH A;  4IPH A;  4C56 C;  4CJ2 C;  3WWV A;  2K7V A;  4IOC A;  4QUF A;  4K0K Q;  1PDQ A;  2B63 B;  3M3Y H;  4XXE A;  3VYR A;  4FYD A;  1HUM A;  1EUJ A;  4DR4 L;  2VY3 A;  1KDC A;  1CQV A;  1K8O A;  4C3J G;  1EYD A;  3HOU G;  1YNJ C;  2NB0 A;  3KK7 A;  2K5V A;  1YHA A;  1IL8 A;  5JEA J;  1GUO A;  2JA8 B;  3S2D B;  4U68 A;  1EIH A;  2IX0 A;  5IGG A;  3LX0 A;  2A68 D;  1XPO A;  2D5D A;  1Y1V B;  5C0X J;  1KIX A;  2K75 A;  4IN3 A;  4ALP A;  3TZD A;  2DY8 A;  3MEH A;  1OXT A;  1WI5 A;  1SEB D;  5ELE A;  5CBE E;  1KXL A;  1HA6 A;  1RHP A;  4WJW A;  5D3D A;  4A3I B;  1B53 A;  2ICI A;  1BCP D;  1K83 B;  3J81 c;  5JEA G;  3D4D A;  5IYD H;  1G8Z D;  4UP7 A;  1I4H A;  2E5L L;  4DXG A;  2K01 A;  1T5E A;  1TWF H;  2D0O A;  4LW1 A;  1PV4 A;  2RSO A;  1BDO A;  3NTH A;  2FXQ A;  1JB7 A;  2KEC A;  2RA4 A;  2N49 A;  2JN4 A;  3M4O H;  2R7F A;  3PUY A;  5FLX L;  5C0X H;  2RHS B;  3HP3 A;  1PHJ A;  3GTK B;  4UP8 A;  1BCP B;  3J81 E;  5CC4 A;  4JV5 L;  4L5S A;  1OXX K;  2KUM A;  4GOP C;  4RCN A;  5IWA Q;  4DXF A;  3D6C A;  1NE3 A;  1GD7 A;  3MEF A;  4IPD A;  3RNU A;  4JI2 L;  1B50 A;  5GAD C;  1RJT A;  2IPK D;  3HG9 A;  3JAM i;  1QCB D;  4DAV A;  4A3G H;  1JE4 A;  3K7U C;  3BZK A;  1I4R A;  1ZEQ X;  3BDC A;  3M4Q A;  1NNX A;  3J80 L;  4RAU C;  2TMP A;  4C2M H;  1EY8 A;  4LFC Q;  1FNW A;  1QUQ B;  3PUV A;  3URY A;  4A3K G;  5CYU A;  2PW7 A;  3LWE A;  3GQB A;  4G57 A;  5IOC A;  4KKT A;  3T53 B;  1JOK A;  1TY2 A;  5M3F G;  1R9T H;  4NDX A;  1E22 A;  1L0X B;  4DV4 Q;  2E2J B;  1MIU A;  2LSS A;  3F2B A;  4NP5 A;  5L37 A;  1YNN C;  2EVB A;  4YWL A;  2JA6 B;  2VS1 A;  5A2Q E;  3S17 B;  1ONL A;  4BY7 H;  2QIL A;  5JJL A;  1LTL A;  1STA A;  2VUM H;  3RLF A;  5M5X B;  2ZTC A;  3K7A B;  3KLS A;  4LUV A;  3HOZ B;  1H9K A;  5C44 G;  1WTR A;  3D3R A;  2UUB Q;  1J9O A;  1V1O A;  1ZXT A;  3LWU A;  2EYF A;  1HXY D;  1SYC A;  2J0T D;  3M7G A;  4TQU S;  2L4N A;  2CH4 A;  4DUZ Q;  1VMP A;  2ZXO A;  5E3F A;  3H3V I;  4A93 B;  3IFD A;  1G6Z A;  3CHB D;  1ET9 A;  2R93 G;  3TZU A;  1B3Q A;  4DV6 L;  2F4V Q;  2RDG A;  1LTT D;  1E2Z A;  2R7D A;  4AQY L;  3KF6 A;  2R93 H;  2KEE A;  4IUN A;  5C4X B;  1ICF B;  1CHP D;  3VR3 A;  3RZD B;  3AYH B;  1AH9 A;  3I4M G;  4NMZ A;  2YTX A;  2WB1 G;  4BBS G;  1F9Q A;  4JI0 Q;  4DUY Q;  3C1E A;  2ZTE A;  2ENB A;  1D2B A;  2Y0S B;  2KQ3 A;  3KF8 A;  1SXT A;  3FRP B;  3NEL A;  5ELF A;  1Z7T A;  4FXD A;  2SNS A;  3RUZ A;  1PRT F;  3JAM E;  1O7Z A;  5T1I A;  1DOM A;  5M5Y B;  1JCK B;  1IKL A;  2NVY B;  2PI2 A;  2HQL A;  2Y0S E;  1MKH A;  4P75 A;  1HUN A;  2F0H A;  2P5Z X;  3OOC A;  2K28 A;  3K81 C;  5LMU Q;  3GTP B;  4MIU A;  4X3T A;  1W3S A;  3PO2 H;  1CKN A;  2E75 C;  1ZKO A;  3TP8 A;  4NXM Q;  1AE2 A;  1JJG A;  3STB D;  2C5C A;  1VF7 A;  4FF1 A;  1X56 A;  4PG3 A;  4BY1 B;  1EIY B;  3S1M H;  1HNW L;  3AFP A;  1S3O A;  2BDO A;  4LFB Q;  2VQF Q;  2Z4I A;  2Z6B A;  5IT9 c;  1XNQ Q;  2R7Z G;  1GUW A;  1I4X A;  4N9P A;  4PNY A;  2SNM A;  5J22 A;  3FKI G;  2ZJR A;  2R7Z H;  4NW2 A;  3GTM H;  1VQO A;  2B39 A;  4OWX B;  1FNU A;  4KY7 A;  1AFP A;  1TWC H;  1VQ4 A;  1HNZ L;  4DAY A;  2VQE Q;  4NPS A;  4A3J B;  2IX3 A;  5EKI A;  1SE2 A;  4A3E G;  4X62 Q;  1JOO A;  1WTQ A;  3G7L A;  1FYC A;  2F3W A;  1PA6 A;  2K5Q A;  1STN A;  1KAA A;  5EJW A;  3U9O A;  1CM9 A;  3GTG H;  3A7A B;  1YBY A;  2LS0 1;  3CME A;  4LMQ D;  2M9V A;  4JOI A;  2NUC A;  4DA2 A;  1K3B C;  5F2D A;  1MSH A;  1AEX A;  1STB A;  1UE6 A;  1QVF A;  1DCZ A;  4N8X 1;  1WTW A;  1VF5 C;  4OWT B;  5LL6 X;  3PGZ A;  4OX9 Q;  3G6E A;  3BZD B;  3NPP A;  4IUU A;  1WFQ A;  1VMC A;  1VQE A;  4APV A;  1G51 A;  4L63 B;  5M5W B;  2YU9 B;  1GKH A;  2A6H D;  3DWA A;  3NBH A;  3Q22 A;  2PZU A;  3BDO A;  3OIQ A;  4J6H A;  3LNN A;  5BR8 Q;  4GLA C;  4E6I A;  3Q23 A;  3VR6 A;  1YHQ A;  1IBK L;  4HCE A;  1PMR A;  1YNX A;  5H1S E;  1B9N A;  1RL2 A;  3RN5 A;  2XVS A;  4X66 L;  2G9H D;  1CTM A;  4QGU A;  3BVZ A;  3HOW B;  4YHH Q;  4X64 L;  4HJ7 A;  2BH2 A;  3CXC A;  1WCM G;  5C3E G;  3S24 A;  1SLJ A;  1PRT C;  4DR2 L;  3DWQ A;  2A74 C;  2AMC B;  1Y1W B;  1YZ6 A;  3TSS A;  1O7L A;  2EZV A;  3NK9 A;  5KNC A;  2GA4 B;  2AHO B;  4LF4 L;  1SJE D;  4X6A H;  2FFK B;  4DK6 C;  1TII D;  1B44 D;  4A3M B;  1SNO A;  1PZI D;  2E2I B;  1EYG A;  1FL0 A;  2Z6K C;  1X3F A;  1PLF A;  1G6P A;  3GP7 A;  4QJF A;  1MBY A;  4QB4 A;  2UXD L;  4XDX A;  2B63 G;  1F2M A;  4GKK Q;  1HQR D;  1OO9 B;  2FHT A;  2RCF A;  2CQA A;  3M4Y A;  5KYI A;  3H0G G;  3S15 B;  3MA2 B;  2NZO A;  1STY A;  1QB5 D;  2EXZ A;  4K2L A;  2K6A A;  2JA8 G;  4DAM A;  2UXB Q;  1J6Q A;  3BDL A;  1BXT A;  1YEZ A;  4XT1 B;  2PO4 A;  1BO0 A;  3R2I A;  4XT3 B;  1WTX A;  1Q81 C;  2JA8 H;  4OO1 I;  2A19 A;  1CZG A;  1V9P A;  4XQQ A;  1JWS D;  2D9U A;  3RMH A;  1Y1V G;  2F1M A;  1EQQ A;  4JYA Q;  4C3I H;  4DV7 Q;  3KLW A;  3C46 A;  3H3V H;  1RIP A;  2K52 A;  3PSI A;  3VA5 A;  4DV3 L;  3NQT A;  3L9A X;  1NR4 A;  1EY6 A;  1IYJ B;  2J7Z A;  4DR3 Q;  2I5M X;  4OWW B;  1CT1 D;  5EQ0 A;  2KHJ A;  4AYB G;  3VYS A;  5C44 B;  3JC6 6;  3DXJ C;  1AN8 A;  3S9W A;  4A3I H;  1PXU A;  1Q12 A;  2CW0 C;  3M9B A;  3GTL B;  3LGJ A;  1Q90 A;  3HOV H;  2FMC A;  4ABN A;  3CPF A;  1L0W A;  1PH3 A;  3MHB A;  2IHF A;  2A6E D;  1EZ6 A;  1I6H B;  4P71 A;  4CDC C;  2JXM B;  3ERO A;  3IKJ A;  1SYF A;  2JK8 A;  3J7A V;  3UE0 A;  2I46 A;  4PZ7 A;  2PPB C;  2N78 A;  3PIP A;  3TRZ A;  3H91 A;  2XWB B;  4BBS B;  2VXW A;  3NBI A;  3AMU A;  3PV0 A;  2HHH L;  3HRZ C;  4GOP B;  1WTO A;  1HTP A;  4FXG C;  3U4V A;  3RZO B;  1XNR L;  3K0Y A;  3MFY A;  3S1R H;  2QGQ A;  2WP8 J;  1Q86 C;  2WB1 E;  3AB9 A;  2ALY B;  4DNT B;  1YJ9 A;  5KND A;  1I3Q H;  1JWM D;  4A75 A;  2D0P A;  1IXR A;  3KJO A;  3DWP A;  1XYI A;  1VQ5 A;  3L3O C;  1YNN D;  1OXS C;  3K58 A;  2EDG A;  1EIF A;  3WOF A;  4B9X A;  3C2P A;  1A8V A;  1SYG A;  1G2S A;  3CC4 A;  5DEH A;  2JA6 G;  5LHY 1;  1TU2 B;  1E0B A;  3BS1 A;  3TME A;  4LUZ A;  2B8G A;  3WDN A;  5HGQ A;  4K6L A;  4NB3 A;  3S17 H;  5A2Q L;  1WTP A;  5IGE A;  3D31 A;  2OQK A;  2ZTD A;  1J5E L;  4X3U A;  1VQ8 A;  2SDF A;  5M5X H;  3G4S A;  1SFO B;  5J39 A;  1W6K A;  3HOZ H;  3I4N B;  1KDB A;  4DN4 M;  1ZYR D;  4K6D A;  4GNX A;  2MFI A;  5K36 G;  1VQI A;  3MXG A;  1JB3 A;  5BN5 A;  4CKB A;  4HED A;  3I8Z A;  2VW9 A;  4QQB X;  4BBR B;  4RCO A;  5I2Y A;  3MXN A;  1FD7 D;  4A93 H;  1N32 Q;  3I3C A;  2PQE A;  1V43 A;  1X9N A;  3I91 A;  4RH6 A;  2IT1 A;  5C4X H;  1K28 A;  3V96 A;  4HJA A;  3J7A 5;  1N34 L;  1DXM A;  2JYO A;  1QZG A;  1L1O C;  1IZ6 A;  3MXP A;  4XQJ A;  4DV2 L;  3HKS A;  2RBM A;  1X3P A;  1SJH D;  2FIN B;  4HID A;  3F2U A;  3UDG A;  1HFN A;  3AQQ A;  5FLM H;  3NWT A;  2HQE A;  1YI2 A;  3HOX H;  2LKV A;  1CI3 M;  2KJX A;  1SNM A;  1LT6 D;  3HGB A;  1OTC A;  4JI8 Q;  5A35 A;  1WJJ A;  4HSV A;  1KRT A;  4J1M A;  5AFW A;  5IP9 H;  3W1G A;  2EJF C;  3OMC A;  4LK1 C;  1F9R A;  4GLX A;  2R61 A;  5T1G A;  2QCP X;  1I94 L;  2F0D A;  3S1N H;  2JA5 H;  1U4R A;  2Q2H A;  3P1H A;  5M5Y H;  5HY6 A;  1XJV A;  3IAY A;  4DR6 L;  2OXP A;  1IBL L;  2MPM A;  2I0Q A;  1SE3 A;  2VNU D;  1B7Y B;  3OTO Q;  3A55 A;  1PTO H;  4RKB A;  4LF8 L;  4UAI A;  4XIG S;  2WIN B;  4ZYS A;  1NAP A;  4IAL A;  1TS2 A;  1SYE A;  5GAH C;  2Q8T A;  1SBB B;  2DNE A;  1T5X D;  4YY3 Q;  4N8F A;  4BY1 H;  2K03 A;  4JI6 Q;  1MHW C;  3TP6 A;  3CF5 A;  5IGB A;  2WKD A;  4KHV A;  3S2H B;  3I55 A;  2RF4 A;  4JI1 Q;  4OGQ C;  3GV3 A;  1TWH B;  2A69 C;  4KTA A;  3AU7 A;  5KIX A;  4GN5 A;  1WCM B;  3I4O A;  1NJI C;  2CH4 W;  2UXC Q;  3B6Y A;  1XMO Q;  1SMY C;  4ZRZ A;  3J7Y W;  5I6W A;  5JPN C;  1VS0 A;  2NVT B;  1BKB A;  2Z6K A;  3KDF A;  4A3F G;  4HMI A;  1KAB A;  4A3J H;  1D6E C;  4ME5 A;  1NY4 A;  3ERS X;  5IT9 L;  2F0N A;  4JI3 Q;  4DPG A;  4RHS A;  2HDL A;  2EJG C;  3KBG A;  4PMC A;  1A62 A;  3J81 j;  1HNX L;  5D3I B;  1B4O A;  4OO1 G;  2E2H B;  4ZQ3 A;  4A3B G;  2BE5 D;  4JI7 L;  2MGS A;  5FO9 B;  4B3S Q;  1HA5 A;  4B08 A;  1HFG A;  1XMQ Q;  5EBC A;  5IGC A;  4HIO A;  3QOJ A;  1Z6H A;  3KYH C;  1C4Q A;  4C3H B;  4XQN A;  3TS2 A;  4AIM A;  4K0K L;  1P16 A;  1LAB A;  2E8G A;  3H0G B;  3PO3 B;  1UNS A;  2IWH A;  3Q8D A;  1WD1 A;  1V1P B;  3UDX A;  1Q82 C;  3NXW A;  4C3J H;  3HOU H;  4A3D B;  2F0O A;  2L12 A;  2NBF A;  4JOI C;  3T13 A;  1VDZ A;  4JG2 A;  2XGT A;  4TKO B;  5IYB G;  2CFM A;  1X6O A;  1UAP A;  4CKC A;  3QJY A;  4CDF C;  1D1I A;  2PYK A;  4DR1 Q;  2F52 A;  1TR5 A;  3GTO B;  1SYD A;  4KK7 A;  1JOR A;  1WYD A;  2GN5 A;  1PH4 A;  4AYB B;  4L5Q A;  3BU2 A;  1K8A C;  3A54 A;  1QVG A;  2N55 A;  4PZ8 A;  1SN8 A;  3HOW G;  1PRT D;  5GRO A;  1S5D D;  1LO5 D;  5JEA H;  3CCV A;  4A4I A;  1D8L A;  4EGV A;  2PZW A;  5FKA C;  4XYO A;  2KCN A;  4AYB E;  2A8V A;  4DNI A;  3UDF A;  2O5J C;  1Y1W G;  1QJO A;  3SK4 A;  1KDA A;  3E9H A;  2XRS D;  3OWE B;  1PRT B;  2Z8L A;  1SNC A;  2AKW B;  2KHI A;  2ATW A;  4WFN 3;  5FO7 B;  3V05 A;  1K0R A;  4JW0 A;  4PZ6 A;  5IWA L;  4A3M G;  1VQC A;  4PQX A;  1Z9F A;  3KJP A;  1BQQ T;  5M3M B;  3S16 H;  3NTI A;  1PZK D;  1K8G A;  4DR7 Q;  2E2I H;  4A3L G;  4BXX G;  4JV5 Q;  2NZ1 D;  2JA7 G;  3GDE A;  5D65 A;  3IL8 A;  3EA6 A;  3BYT B;  2F0S A;  4A3K H;  2AWO A;  1ROD A;  1F77 A;  3GTJ B;  5KRU A;  2C35 B;  2B2U C;  5KEE A;  4QCL A;  5JVH 3;  4IUV A;  4A76 A;  2XWJ B;  2ZJP A;  4K5X A;  5M3F H;  5C6A A;  1IKM A;  3QWN A;  3OMG A;  1TT2 A;  4GKJ Q;  1DZ1 A;  2LFN A;  1JR0 D;  2X6G A;  3R3O A;  4X3S A;  3ZJY C;  4L5R C;  2HCI A;  1DOK A;  2JEB I;  5JAV A;  1C48 A;  4O1N A;  3G6J B;  1PH8 A;  2EYO A;  4MTK A;  5I6Y A;  5LMN W;  1FNV A;  5C44 H;  4GN4 B;  5CV9 A;  1TVX A;  3MWY W;  3N52 A;  2UUB L;  3M7N A;  3Q0A A;  1YHB A;  1KNE A;  3BYY B;  1IYV A;  1L1O A;  1IW7 C;  1TQO A;  1RTO A;  1MJC A;  1Y8P B;  2B8F A;  3ERQ A;  4DUZ L;  2EY1 A;  3MVV A;  2MO1 A;  1PH7 A;  1I6H H;  3NWS A;  4G7O C;  1SSO A;  1NCV A;  4KY6 A;  2F4V L;  4GN3 B;  3SK6 A;  1KTK A;  1UUP A;  1R4Q B;  2BA0 A;  4OEM B;  4P2C B;  1JJ2 A;  4GLV B;  3TDQ A;  3I4M H;  4KKS A;  4BBS H;  1TS5 A;  4R4O A;  2WAC A;  1I4G A;  3JAM c;  1VQ6 A;  4JI0 L;  3RZO H;  3I2Z A;  3IFT A;  5LMN Q;  4RGT A;  1F2L A;  2UU9 Q;  4DUY L;  1FVI A;  3ND9 A;  1NBW A;  4IFD I;  2ZXP A;  3BVG A;  3K8A A;  2HT1 A;  4BA2 I;  3K57 A;  1ASY A;  2JE6 I;  3F8T A;  5C4J H;  5DM6 3;  4KD4 A;  4LF7 L;  2EPB A;  4MNO A;  4BS9 A;  4MN3 A;  4YCU A;  2BH8 A;  1AE3 A;  1EY7 A;  2OTJ A;  4CGY B;  3RR5 A;  1HPC A;  4YIJ A;  4EX5 A;  1XWE A;  5LMU L;  5JPM C;  1PVO A;  1IL2 A;  1UE7 A;  5AJ3 Q;  4FXK C;  1BCP F;  3A0J A;  3QOL A;  1E7Z A;  1E2W A;  4NXM L;  3S14 B;  3OPO A;  4DV5 L;  3DMU A;  4GS3 A;  3HZX A;  1GOZ A;  2RDH A;  3SK5 A;  2JEA I;  1GVP A;  3E3X A;  3I4N G;  1CSP A;  4B3T L;  2WV6 D;  2EQS A;  1SDF A;  1JQY D;  4JI4 L;  4V0B A;  4LFB L;  1LAC A;  2QDB A;  4H13 C;  5D14 A;  4ZCK A;  3TS0 A;  1XNQ L;  3FKI H;  4BBR G;  2QF7 A;  2ZT9 C;  1EY4 A;  1FGU A;  2K33 A;  3MC0 B;  3T56 B;  2OT2 A;  3H6M A;  1LTB D;  2YYZ A;  4GNX C;  4RHR A;  2CHB D;  1VQ9 A;  2K5D A;  3UE1 A;  2L1B A;  4A3F B;  4ZKB B;  2VQE L;  4A3E H;  3GTQ B;  3V2T A;  4X62 L;  2DJF C;  2KED A;  3CCM A;  1F9P A;  1HNZ Q;  2Q8I B;  4A3B B;  1X54 A;  4K2K A;  1A2U A;  3I7F A;  2E2D C;  1KC8 C;  3KF6 B;  3J7Z C;  3HOY G;  1HJP A;  1H9S A;  3J80 i;  5I2X A;  1A3U A;  3D4R A;  5I9O A;  2H5X A;  3M85 A;  3U4Z A;  3EBE A;  1J8I A;  1SR3 A;  5G3L D;  2N3S A;  1W6J A;  1LV9 A;  4IUQ A;  3A5U A;  3PIO A;  4OX9 L;  2NN6 I;  3K5N A;  2JJQ A;  3L2P A;  2CCZ A;  2OTL A;  1TWG H;  3M3Y B;  5EPK A;  5K5P A;  1H95 A;  4F8M A;  5E4W C;  1Z47 A;  3KF8 B;  4Y7N H;  3ULJ A;  5CV7 A;  4NXN L;  5ELN A;  5BR8 L;  1G29 1;  1EL0 A;  2PCF B;  1O7I A;  4Z9C B;  1N36 Q;  2NVX B;  3D4W A;  1Q1E A;  2A69 D;  3H3V C;  1E1O A;  1BBW A;  4ZKC B;  5EPL A;  1SMY D;  5KGU A;  5JVG 3;  3TQY A;  4RGM A;  1G91 A;  1TWH H;  3CD6 A;  5IP7 G;  1CKN B;  4YHH L;  1RDP D;  1EEI D;  1WCM H;  2KEN A;  2V1C C;  5C3E H;  3ULP A;  1K9M C;  1RCV D;  4FNF A;  4ODG A;  1V1Q A;  1E24 A;  2A68 C;  3A7L A;  4M8A A;  2PI2 E;  4X66 Q;  3MFG A;  3Q24 A;  4B3M Q;  4LF6 L;  4R9W A;  2F0M A;  3QR8 A;  2XN9 C;  2RHQ B;  1TWF B;  4POG A;  1BCP C;  1PTO F;  2L5T A;  2E2H H;  3HFZ B;  3M4O B;  3BZC A;  1HZB A;  1N33 L;  3ER0 A;  2B2U A;  4DAY B;  1U5K A;  4C3H G;  2JA7 B;  2B63 H;  1U9R A;  4J8Q A;  1YNJ D;  3EFX D;  4GKK L;  3PO3 G;  1QZH A;  4JI5 L;  1PYS B;  1GO3 E;  3H0G H;  3I4L A;  4PV1 C;  1VQP A;  2Q8R E;  3L7Z C;  2ZM6 Q;  4R4C A;  4CKE A;  1B2T A;  4LJZ C;  4A3G B;  2BA1 A;  4A3D G;  4J15 A;  5ELB A;  1ILP A;  2BDN A;  3CCR A;  1B1Z A;  2AQ3 B;  3TRE A;  3S2D H;  3J80 E;  3KFU A;  1C0A A;  3A56 A;  4C2M B;  2UXB L;  1PH1 A;  2ES2 A;  1NTG A;  4F7X A;  1CFM A;  1EYC A;  4JBK A;  3KLR A;  1Y1V H;  5BN3 A;  4Q5V A;  1FGB D;  1BBX C;  4IFD J;  1JJC B;  4JYA L;  1RKN A;  4KMU C;  2WAQ G;  3T4A C;  5DAU A;  3VA7 A;  4DV7 L;  4A3C G;  2JQO A;  2B2V C;  4RGN A;  2YTY A;  3CCJ A;  4DR3 L;  1ICW A;  2B2T C;  2IHE A;  3Q6S A;  1DGS A;  4L8J A;  5CR3 A;  3PIO 3;  1K83 H;  2L0C A;  4OXP A;  1EU3 A;  1VQH A;  3P20 A;  1XTC D;  3NBH B;  2H1E A;  4P74 A;  1PH6 A;  4R4T A;  4IFD G;  1BVS A;  3RD4 A;  2PW5 A;  4I7A A;  4KHP Q;  2K50 A;  1ESF A;  4LF5 L;  4LFA Q;  1VQM A;  3GTK H;  3J81 L;  3DM3 A;  3CC2 A;  2EE1 A;  3VR4 A;  1LM0 A;  3NHH A;  3AFQ A;  4POF A;  2KHS A;  5M3M G;  1K8M A;  5CV4 A;  1ML0 D;  1BUV T;  4CDD C;  1YVC A;  5HGT A;  4KKU A;  4WOR A;  2F0L A;  1D5Z C;  2EIF A;  2K32 A;  3IRB A;  1EEF D;  4YWM A;  5I4D A;  4H0L C;  1SNQ A;  3VR5 A;  3QO2 A;  1KL9 A;  2L11 A;  5J3B A;  3AEV A;  2H4O A;  1UE1 A;  3FMC A;  4HN7 A;  2D62 A;  2J4X A;  3HS0 C;  1LTG D;  1LTI D;  4B3R Q;  1WTV A;  2PQA A;  4IUR A;  5FJ8 G;  1UE5 A;  5IYC G;  1EZ8 A;  2IW3 A;  4YCV A;  4EQ5 A;  5C0X I;  2E2J H;  4AH6 A;  4DV1 L;  3K5O A;  4UPA A;  2JA6 H;  4ID6 A;  4EVO A;  2X69 A;  5ELD A;  5ELO A;  1PTO C;  2F0G A;  3KOJ A;  1V8Q A;  2YV5 A;  2F0U A;  3ULL A;  3K7A H;  1CK1 A;  4R1J A;  1Q46 A;  4B9W A;  2C9O A;  1LLR D;  3DEO A;  4DV0 Q;  5K36 H;  4RG1 A;  4DFA A;  1BF4 A;  1T9H A;  1TXY A;  1Y14 B;  1J5E Q;  4OL7 A;  4GZY C;  2L9H A;  1D7Q A;  1EQT A;  1JT8 A;  4R4I A;  4X65 L;  1I5F A;  1HR0 L;  3STB C;  4OEL B;  3PCO B;  4LF9 Q;  2UUA Q;  2O4X A;  3RZD H;  1TS3 A;  4HTH A;  1A63 A;  3CMA A;  2NN6 G;  1R4P B;  3HKZ B;  3ONA B;  2IY5 B;  3W3A A;  1LYL A;  1H9J A;  5BN4 A;  1TWC B;  1ET6 A;  2G5D A;  2EY2 A;  2VB2 X;  5IGD A;  5CGK A;  2NZH A;  1L2F A;  2A5H A;  2B2W C;  3QG1 A;  4DV2 Q;  3SDZ A;  3EVQ A;  3HOY B;  3HKZ E;  1I50 B;  3H09 A;  4O2D A;  4ULL A;  3I56 A;  3K6O A;  1QNU A;  3A8K E;  4JI8 L;  5DNF A;  1AP0 A;  3JAM L;  3T1Y Q;  3TEH B;  1JIC A;  3W1B A;  2AQ2 B;  3GTG B;  1IYU A;  1A15 A;  2NVY H;  3CRL C;  1RTN A;  1EOV A;  4RMF A;  3GTP H;  1IBM Q;  1KRS A;  2WFW A;  4H7B A;  2EYJ A;  4K5V A;  1I94 Q;  2QDL A;  3OTO L;  1S40 A;  4EQN A;  1FJG Q;  1SRU A;  5GAE C;  3VYU A;  2QEX A;  1MSG A;  4PMB A;  3S14 H;  1IBL Q;  1S72 A;  4NKL A;  1CKM A;  1JC7 A;  2F4I A;  2MNA A;  4H02 A;  4HAE A;  2F0T A;  4YY3 L;  2RSN A;  2MP1 A;  4JVZ A;  1Y8O B;  4JI6 L;  2XRQ D;  1MGS A;  4JBM A;  3CW2 C;  3T1H Q;  4WRD A;  2KVM A;  1TS4 A;  3I70 A;  4OIJ A;  3SHL A;  2R92 G;  1I6V C;  3GD7 A;  1PH2 A;  3S1Q B;  3FDT A;  2HUG A;  2IL8 A;  5E1F A;  3OW7 A;  2A6H C;  1GJX A;  1XPU A;  2F0W A;  1K73 C;  1KLG D;  1Q3L A;  1LTS D;  3CCL A;  4DR5 L;  4HIK A;  5HUR A;  1XMO L;  5GQO A;  1JMC A;  3VDY A;  1KLU D;  4A3F H;  1EY9 A;  1SE4 A;  2F0J A;  4GNX B;  1GUS A;  2K1B A;  2MO0 A;  4JI3 L;  2UUC Q;  3EQL C;  2DJG C;  4UDU C;  3PMF A;  5COY A;  4BWG B;  5DLQ E;  2Q2U A;  4OO1 H;  2PMZ B;  3FVQ A;  4A3B H;  1Y8N B;  5EBD A;  2F0K A;  3MXN B;  2F0Q A;  3SGI A;  4LNQ A;  4KJO A;  4B3S L;  4U67 3;  4KN7 C;  1NUC A;  5EAY A;  4RWS C;  4DF7 A;  5NUC A;  3EJI A;  2L15 A;  5JJZ A;  3OWF A;  2FJ2 A;  4R8I A;  1TWA B;  1C7Y A;  4R4Q A;  2B2V A;  2IJ0 A;  2OWO A;  1STG A;  5M5W H;  2YU9 H;  2B2T A;  4DR4 Q;  4H44 C;  1A3T A;  4LWC A;  1DM0 B;  3CC7 A;  3PF4 A;  1A3V A;  2A73 B;  1W2B A;  5IYB H;  5KNB A;  1LT5 D;  1M4V A;  2ICE C;  2IX1 A;  4G7Z C;  1EY0 A;  2K14 A;  1JWU D;  1Q8I A;  1ENF A;  1S4Z A;  2WAQ B;  4JBW A;  4L6T B;  4EQP A;  4CBV A;  2Z9H A;  2K5N A;  4DR1 L;  4UP9 A;  1CA6 A;  3N6R A;  2NVX H;  2RKS A;  3RLN A;  3ND8 A;  4HCS A;  3OIP A;  2VZA A;  1X65 A;  1RD9 D;  2NVQ B;  1E1T A;  4HR7 B;  3PQI A;  1VQA A;  4C3I B;  3HOW H;  1EWC A;  2DGY A;  5JJK A;  2QKI C;  2WAQ E;  2MQH A;  1SAP A;  4FF4 A;  3OYY A;  4ZK9 B;  3CPW A;  2M00 A;  1XTD A;  3GV6 A;  3D6W A;  4C1N K;  4CJ0 B;  1WVL A;  1XXG A;  1Y1W H;  5IYD G;  3ITP A;  1H9M A;  3CQZ B;  1M1K C;  2E5L Q;  1K3R A;  1LUZ A;  5LL6 S;  1EQV A;  4K8I A;  3HOV B;  3BVM A;  2K5W A;  2OCE A;  4RKL A;  3PF5 A;  4TVA B;  1SE8 A;  1X3Q A;  3MTS A;  5C0X G;  3E6Z X;  4A3M H;  5CV5 A;  3SXH A;  2LMC B;  2QEJ C;  2DNC A;  4KHZ A;  2VB3 X;  3MZ5 A;  4BXX H;  4DR7 L;  3I72 A;  4A3L H;  1A6X A;  1QOH A;  2Z4H A;  5EGT A;  1UWV A;  3A8J E;  3TP5 A;  2A6E C;  2KOL A;  3KDF B;  3KUP A;  3PUZ A;  2JA7 H;  1O80 A;  1PFB A;  1S5F D;  4JI2 Q;  1ILQ A;  4LFC L;  3S15 H;  2EYM A;  4IQZ A;  1QIL A;  3OSO A;  1L0Y B;  3X3N A;  4Y52 H;  4A3G G;  3W5O A;  4L5T A;  3S1R B;  2N88 A;  3D8G A;  3K5M A;  1S5B D;  5EKK A;  3E5S A;  4DV4 L;  4K5W A;  1I3Q B;  1LT4 D;  1HRJ A;  5JJI A;  3K80 C;  2L55 A;  4GKJ L;  1F9S A;  1GUN A;  2LXJ A;  4O0A A;  1CHQ D;  4ILW A;  4KY5 A;  1EFW A;  2CW0 D;  2KBN A;  4P73 A;  1C8C A;  3T51 B;  2OEO A;  4P72 A;  4QIW B;  1TKW B;  2B2Y C;  1HZ9 A;  1KAW A;  4BY7 G;  1CKO A;  3C3L A;  1QG7 A;  2JP1 A;  3GTL H;  2VUM G;  1GUG A;  4DGZ A;  2EY5 A;  5IY0 A;  2DUD A;  1PFS A;  3H94 A;  3BJU A;  3A5Z B; 
#chains in the Genus database with same CATH homology
 3FHW A;  1O7I A;  2I5L X;  4YWK A;  4DKA C;  4QIW E;  2D0P A;  4A75 A;  1N36 Q;  1HNX Q;  1B8A A;  1N9W A;  1Q1E A;  1YIT A;  1IXR A;  3KJO A;  2QA4 A;  1BBU A;  1E1O A;  4JC0 A;  1VQ5 A;  4JI7 Q;  2PMZ E;  1BBW A;  1OXS C;  2LXK A;  4MTN A;  2HIX A;  2KCM A;  1EIF A;  4DV6 Q;  1A8V A;  3F1Z A;  4ME3 A;  3TQY A;  4AQY Q;  4IPH A;  3U58 A;  1SMX A;  1TWH H;  5IP7 G;  1CKN B;  4FDB A;  3WWV A;  3CC4 A;  4YHH L;  4IOC A;  2JA6 G;  2Q2T A;  1CSQ A;  4K0K Q;  1WCM H;  2KEN A;  2V1C C;  4LUZ A;  5C3E H;  3ULP A;  1K9M C;  5HGQ A;  3M3Y H;  2I5H A;  4NB3 A;  3S17 H;  1KD1 C;  1V1Q A;  1E24 A;  4X66 Q;  3D31 A;  5LMN L;  1EUJ A;  2PI2 E;  2UU9 L;  4B3M Q;  4LF6 L;  4DR4 L;  2OQK A;  2ZTD A;  1UEB A;  2VY3 A;  1J5E L;  1ASZ A;  1VQ8 A;  5M5X H;  3G4S A;  3E9I A;  3HOU G;  3HOZ H;  1YIJ A;  1M90 C;  4GNX A;  2RHQ B;  1OXU A;  2MFI A;  2K5V A;  1YHA A;  1C9O A;  5JEA J;  5K36 G;  4POG A;  1VQI A;  2IX0 A;  2E2H H;  3HFZ B;  2VW9 A;  3CCQ A;  3BZC A;  1XPO A;  4IJH A;  1HZB A;  5C0X J;  1KIX A;  4QQB X;  2K75 A;  1N33 L;  4ALP A;  3ER0 A;  2Z0S A;  4A93 H;  1N32 Q;  1OXT A;  1V43 A;  1N8R C;  4DAY B;  1WI5 A;  1X9N A;  1U5K A;  2IT1 A;  2B63 H;  4LF7 Q;  4MZ9 A;  5C4X H;  4GKK L;  1WOC A;  4IOA A;  3PO3 G;  1QZH A;  1KXL A;  5AJ3 L;  4HJA A;  4JI5 L;  3J7A 5;  1N34 L;  1PYS B;  1GO3 E;  3H0G H;  1VQP A;  1QZG A;  3L7Z C;  2ZM6 Q;  1L1O C;  1IZ6 A;  3DLL A;  2HIV A;  4R4C A;  4DV2 L;  3HKS A;  5JEA G;  3J81 c;  4HID A;  3M4P A;  2BA1 A;  2Q2I A;  4J15 A;  3GO5 A;  4UP7 A;  4IO9 A;  3AQQ A;  3UDG A;  3I4N H;  3CCR A;  3PO2 G;  5FLM H;  3K0X A;  3TRE A;  2E5L L;  5GAG C;  1TWF H;  1YI2 A;  2D0O A;  4LW1 A;  1HZA A;  2VQF L;  1PV4 A;  3KFU A;  3S2D H;  1C0A A;  2K4K A;  3HOX H;  2UXB L;  2FXQ A;  1PH1 A;  1JB7 A;  2ES2 A;  2N49 A;  4DV5 Q;  1NTG A;  2B3G A;  3M4O H;  1EQR A;  2R7F A;  3PUY A;  4JBK A;  2RHS B;  2CWA A;  1YJW A;  4JI8 Q;  1Y1V H;  4BBR H;  1PHJ A;  1OTC A;  4UP8 A;  1WJJ A;  4IFD J;  1HNW Q;  1JJC B;  4JYA L;  1KRT A;  2WAQ G;  3UDI A;  4DV7 L;  5IP9 H;  4B3T Q;  4JV5 L;  3W1G A;  4A3C G;  4L5S A;  4GLX A;  1OXX K;  2JQO A;  4GOP C;  4JI4 Q;  1HZC A;  5IWA Q;  1I94 L;  1NE3 A;  1GD7 A;  3MEF A;  4IPD A;  3RNU A;  2YTY A;  3CCJ A;  4DR3 L;  3S1N H;  2JA5 H;  2Q2H A;  2IHE A;  5M5Y H;  1P8L A;  4JI2 L;  1DGS A;  3HKZ G;  5HY6 A;  5GAD C;  1XJV A;  1SFO H;  1K83 H;  4DR6 L;  1IBL L;  4LUO A;  1CUK A;  4OXP A;  3JAM i;  2YTV A;  1VQH A;  4A3G H;  3K7U C;  3NBH B;  3BZK A;  2I0Q A;  4P74 A;  2VNU D;  1B7Y B;  1PH6 A;  1L1O B;  3OTO Q;  4R4T A;  3M4Q A;  3OW2 A;  4LF8 L;  4XIG S;  2ID0 A;  5E7N A;  4C2M H;  4LFC Q;  4IFD G;  1BVS A;  5GAH C;  1QUQ B;  3PUV A;  4A3K G;  4KHP Q;  2K50 A;  4LF5 L;  4LFA Q;  4YY3 Q;  1VQM A;  3GTK H;  5IYD H;  1VQ7 A;  4BY1 H;  3HOY H;  4JI6 Q;  1I50 H;  3CF5 A;  3DM3 A;  3CC2 A;  3I55 A;  2RF4 A;  4JI1 Q;  1LM0 A;  5M3F G;  1R9T H;  3AFQ A;  1E22 A;  4POF A;  4DV4 Q;  5M3M G;  1MIU A;  2LSS A;  2XTI A;  4HJ8 A;  4GN5 A;  3F2B A;  1KQS A;  3I4O A;  4YWL A;  1YVC A;  2VS1 A;  1NJI C;  2UXC Q;  3B6Y A;  2CKZ B;  4BY7 H;  1VQB A;  5JJL A;  1LTL A;  3F2C A;  1XMO Q;  2EIF A;  2VUM H;  3IRB A;  4WJ4 A;  4YWM A;  1VS0 A;  3RLF A;  1BKB A;  2Z6K A;  3KDF A;  4A3F G;  1KL9 A;  5J3B A;  2ZTC A;  3FP9 A;  4LUV A;  3G71 A;  4IPG A;  4A3J H;  3AEV A;  1NY4 A;  5C44 G;  3ERS X;  1UE1 A;  4JI3 Q;  2UUB Q;  4DPG A;  2D62 A;  1N36 L;  1A62 A;  3J81 j;  1HNX L;  3S2H H;  4OO1 G;  4B3R Q;  2PQA A;  4TQU S;  5FJ8 G;  4A3B G;  1UE5 A;  1XPR A;  5IYC G;  4JI7 L;  3CCS A;  4DUZ Q;  4NXN Q;  4YCV A;  4B3S Q;  4EQ5 A;  1IBK Q;  5C0X I;  3H3V I;  2E2J H;  4AH6 A;  1XMQ Q;  2R93 G;  4KLK A;  4DV6 L;  4DV1 L;  2F4V Q;  4AQY L;  5IP7 H;  4HIO A;  2R7D A;  4UPA A;  3KF6 A;  2JA6 H;  3KYH C;  3S1Q H;  1VQL A;  2R93 H;  3TS2 A;  5FLX c;  4AIM A;  4K0K L;  1X3E A;  1A0I A;  1P16 A;  2E8G A;  5ELO A;  2NVT H;  3AYH B;  3RLO A;  1VQK A;  1AH9 A;  3Q8D A;  4B3M L;  3I4M G;  3KOJ A;  2YV5 A;  2YTX A;  2WB1 G;  3K7A H;  3UDX A;  3ULL A;  4X64 Q;  4BBS G;  4R1J A;  2OQ0 A;  1Q82 C;  4C3J H;  4JI0 Q;  3HOU H;  1Q46 A;  3CD6 A;  4DR2 Q;  1MJE A;  4DUY Q;  4JOI C;  4DV0 Q;  4GOP A;  4RG1 A;  2ZTE A;  4JG2 A;  1VQD A;  2XGT A;  1Q1B A;  4LF6 Q;  1T9H A;  1TXY A;  1Y14 B;  3D0F A;  5IYB G;  3CCU A;  1J5E Q;  2CFM A;  1X6O A;  1OXV A;  1D7Q A;  3NEL A;  4DR1 Q;  1PH9 A;  2F52 A;  4IPC A;  3J80 c;  1JT8 A;  4LF4 Q;  4R4I A;  4X65 L;  1I5F A;  1HR0 L;  3STB C;  4A3D G;  4C3H H;  4UY8 C;  1WYD A;  1VQG A;  2GN5 A;  3PCO B;  1PH4 A;  4L5Q A;  3BU2 A;  1K8A C;  4LF9 Q;  2UUA Q;  3PO3 H;  3RZD H;  1QVG A;  2PI2 A;  2HQL A;  2Y0S E;  4PZ8 A;  1A63 A;  1MKH A;  1SN8 A;  4P75 A;  5GRO A;  2NN6 G;  3CMA A;  3HOW G;  2ZM6 L;  1N33 Q;  2IY5 B;  5LMU Q;  3K81 C;  1LYL A;  2UXD Q;  3CCV A;  4A4I A;  4A3D H;  1W3S A;  3PO2 H;  1D8L A;  1CKN A;  1TWA H;  2F3I A;  4NXM Q;  1VQJ A;  2NZH A;  1AE2 A;  4AYB E;  4JI5 Q;  3STB D;  3F2D A;  2A8V A;  1JJG A;  1L2F A;  3UDF A;  4DNI A;  4WJ3 M;  1X56 A;  1Y1W G;  2PNH A;  4DV2 Q;  4PG3 A;  3E9H A;  4HIM A;  3HKZ E;  3I56 A;  4O2D A;  1EIY B;  1YJN A;  3S1M H;  4JI8 L;  1HH2 P;  1HNW L;  2AKW B;  3AFP A;  2KHI A;  1S3O A;  2ATW A;  4A3C H;  4LFB Q;  2ZJQ A;  2VQF Q;  3GTO H;  1XMQ L;  2GVB A;  5IT9 c;  3T1Y Q;  1K0R A;  1XNQ Q;  2R7Z G;  1VQN A;  3TEH B;  4PZ6 A;  5IWA L;  3W1B A;  4A3M G;  1VQC A;  3FKI G;  1Z9F A;  2NVY H;  2ZJR A;  2R7Z H;  3KJP A;  3NEM A;  4BA1 I;  3GTM H;  2NVQ H;  3S16 H;  1VQO A;  1EOV A;  4RMF A;  4OWX B;  1K8G A;  2E2I H;  3GTP H;  4DV3 Q;  4DR7 Q;  4A3L G;  4BXX G;  1IBM Q;  4JV5 Q;  3RN2 A;  1KRS A;  1TWC H;  1VQ4 A;  2WFW A;  1HNZ L;  3GDE A;  2JA7 G;  2VQE Q;  1EWI A;  1I94 Q;  3OTO L;  1S40 A;  1FJG Q;  4NPS A;  1SRU A;  5GAE C;  2QEX A;  4A3E G;  4X62 Q;  3S14 H;  4A3I G;  1IBL Q;  4A3K H;  2AWO A;  2K5H A;  1S72 A;  4KHP L;  1CKM A;  2RCN A;  2MNA A;  1Q8K A;  4H02 A;  2C35 B;  1PA6 A;  4YY3 L;  3CQZ H;  4LFA L;  3HOV G;  1E3P A;  1SRO A;  4JI6 L;  3NEN A;  4JBM A;  3CW2 C;  3T1H Q;  4A76 A;  5M3F H;  2ZJP A;  3GTG H;  3U50 C;  2R92 G;  1PH2 A;  3GD7 A;  4HJ5 A;  5M3M H;  4LF5 Q;  1X3G A;  4GKJ Q;  1YBY A;  3CME A;  1XPU A;  3ZJY C;  4L5R C;  1K73 C;  3PUW A;  4JOI A;  1Q7Y C;  2GVA A;  2JEB I;  3CCL A;  4DR5 L;  2CQO A;  4HIK A;  1XMO L;  1UE6 A;  5GQO A;  1QVF A;  2VL6 A;  1JMC A;  4OWT B;  2HHH Q;  3VDY A;  3PGZ A;  4OX9 Q;  1PH8 A;  4A3F H;  2ASB A;  3G6E A;  5LMN W;  5C44 H;  4GNX B;  1XNR Q;  4GN4 B;  1WFQ A;  2MO0 A;  1VQE A;  4JI3 L;  4APV A;  1G51 A;  3GTJ H;  2UUB L;  2UUC Q;  3M7N A;  1YHB A;  1GKH A;  5DLQ E;  1L1O A;  2Q2U A;  1MJC A;  5FJ8 H;  5BR8 Q;  4A3B H;  4B3R L;  5IYC H;  3H15 A;  3MXN B;  4GLA C;  3SGI A;  4LNQ A;  1VCI A;  3E0E A;  4DUZ L;  1YHQ A;  4B3S L;  1IBK L;  2MO1 A;  5IE8 A;  1PH7 A;  1I6H H;  1PYB A;  4QY7 A;  2JA9 A;  2R6G A;  2F4V L;  1YNX A;  4GN3 B;  5H1S E;  1RL2 A;  5EAY A;  3RN5 A;  2BA0 A;  3PUX A;  4X66 L;  1JJ2 A;  4GLV B;  1HR0 W;  2AWN A;  4QGU A;  3I4M H;  2L15 A;  4BBS H;  4JBJ A;  4YHH Q;  4R4O A;  4DV1 Q;  4X64 L;  4HJ7 A;  3JAM c;  1C7Y A;  4R4Q A;  3CXC A;  2CWP A;  2BH2 A;  1WCM G;  5C3E G;  1VQ6 A;  4JI0 L;  2OWO A;  1GM5 A;  3S24 A;  5M5W H;  3RZO H;  3I2Z A;  1SLJ A;  2YU9 H;  5LMN Q;  3EIV A;  4DR2 L;  2UU9 Q;  4DUY L;  4DR4 Q;  1FVI A;  4LWC A;  4DV0 L;  1B70 B;  4YCW A;  1NBW A;  3CC7 A;  2AMC B;  3PF4 A;  1W2B A;  4IFD I;  5IYB H;  1YZ6 A;  3HOZ G;  3K8A A;  1NMF A;  4OON A;  2IX1 A;  2K14 A;  2HT1 A;  4JBW A;  1N32 L;  2K5N A;  4DR1 L;  4UP9 A;  1ASY A;  4BA2 I;  2JE6 I;  2NVX H;  2AHO B;  3F8T A;  3RLN A;  4LF4 L;  5C4J H;  4LF7 L;  2VZA A;  1X65 A;  4X6A H;  4MNO A;  4DK6 C;  4YCU A;  1E1T A;  2BH8 A;  1AE3 A;  3CP0 A;  4LF9 L;  2UUA L;  2B29 A;  1VQA A;  2OTJ A;  1EYG A;  1FL0 A;  2Z6K C;  3RR5 A;  4DK3 C;  1X3F A;  4EX5 A;  3HOW H;  4A93 G;  2DGY A;  5JJK A;  1G6P A;  2WAQ E;  4QJF A;  5LMU L;  2MQH A;  3L0O A;  4X65 Q;  1HR0 Q;  3OYY A;  3CPW A;  4HJ9 A;  2B63 G;  2UXD L;  4GKK Q;  1XTD A;  1PVO A;  1IL2 A;  1UE7 A;  5AJ3 Q;  5C4X G;  1N34 Q;  4IJL A;  3EN2 A;  3A0J A;  3H0G G;  1E7Z A;  4NXM L;  2EXD A;  4DV5 L;  4GS3 A;  3ICE A;  1Y1W H;  2JEA I;  2NZO A;  5IYD G;  1GVP A;  3I4N G;  1KHI A;  1M1K C;  2E5L Q;  1K3R A;  1LUZ A;  5FLM G;  1CSP A;  4B3T L;  2EQS A;  2JA8 G;  4DAM A;  2UXB Q;  1J6Q A;  1YEZ A;  3HOX G;  4JI4 L;  2OCE A;  2JA8 H;  1Q81 C;  4LFB L;  4OO1 I;  3TS0 A;  4TVA B;  2A19 A;  3PF5 A;  1SE8 A;  1V9P A;  3T1Y L;  1XNQ L;  5C0X G;  4A3M H;  3FKI H;  2A1A A;  1Y1V G;  2KCT A;  2Y0S G;  4BBR G;  4C3I H;  1EQQ A;  4JYA Q;  4DV7 Q;  3KLW A;  3H3V H;  4JCV E;  1RIP A;  4KHZ A;  1FGU A;  5IP9 G;  4A3L H;  2K52 A;  4BXX H;  4DR7 L;  2YYZ A;  3PSI A;  4XTC S;  4DV3 L;  4GNX C;  1IBM L;  1IYJ B;  1VQ9 A;  1UWV A;  3PUZ A;  3KDF B;  3UE1 A;  2I5M X;  4DR3 Q;  4OWW B;  2JA7 H;  4JI2 Q;  2VQE L;  2KHJ A;  4LFC L;  4AYB G;  2JA5 G;  3S15 H;  1FJG L;  4DR6 Q;  4A3E H;  4Y52 H;  3JC6 6;  1U0L A;  4PMW A;  4A3I H;  4X62 L;  4A3G G;  3CCE A;  1Q12 A;  3W5O A;  4L5T A;  3CCM A;  3CAM A;  3M9B A;  3LGJ A;  4LF8 Q;  1PH5 A;  3HOV H;  2PQA B;  3A74 A;  4KI0 A;  1HNZ Q;  3CPF A;  4JI1 L;  1L0W A;  1PH3 A;  1X54 A;  2IHF A;  3T1H L;  4DV4 L;  3I7F A;  4P71 A;  1KC8 C;  2R92 H;  3KF6 B;  5JJI A;  3K80 C;  4BY1 G;  3J7Z C;  3HOY G;  1HJP A;  3J80 i;  4QL5 A;  4GKJ L;  2UXC L;  3G48 A;  1X55 A;  2JK8 A;  2LXJ A;  4O0A A;  2H5X A;  1JE5 A;  3UE0 A;  1EFW A;  3M85 A;  3U4Z A;  4PZ7 A;  3EBE A;  1SR3 A;  2N78 A;  3PIP A;  1QVC A;  2KBN A;  2N3S A;  4P73 A;  3TRZ A;  3J81 i;  1NMG A;  2N8N A;  3PIO A;  3PV0 A;  3A5U A;  2HHH L;  4OX9 L;  2NN6 I;  4P72 A;  3GTQ H;  4GOP B;  2JJQ A;  3U4V A;  3L2P A;  2CCZ A;  4BY7 G;  1HZ9 A;  1KAW A;  1VQF A;  1CKO A;  3S1R H;  1TWG H;  2OTL A;  1XNR L;  3GTL H;  4DR5 Q;  2UUC L;  2VUM G;  1H95 A;  2QGQ A;  1Z47 A;  2WP8 J;  3KF8 B;  4Y7N H;  1Q86 C;  5IY0 A;  2DUD A;  2WB1 E;  4NXN L;  3ULJ A;  2ALY B;  1PFS A;  5ELN A;  4A3J G;  1QUQ A;  5BR8 L;  1G29 1;  1YJ9 A;  3BJU A;  3A5Z B;  1I3Q H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...