2MO0A

Backbone 1h, 13c, and 15n chemical shift assignments for cold shock protein, tacsp
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
68
structure length
68
Chain Sequence
MKKGTVKWFNAEKGYGFIQQEEGPDVFVHFTAIEADGFRTLNEGEHVEFEVEPGRGGKGPQAKKVRRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Cold-shock DNA-binding domain protein
publication title Structure and flexibility of the thermophilic cold-shock protein of Thermus aquaticus
pubmed doi rcsb
source organism Thermus aquaticus
total genus 8
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2014-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2mo0A00
4PZ8A 1L0WA 4MNOA 3K0XA 3OYYA 4JI1L 4UP9A 3CW2C 2IX1A 4DNIA 2MO1A 1TWHH 2B3GA 1QVGA 1U5KA 4BBSG 1TWAH 2HHHL 3I7FA 5LMNQ 3F2CA 3GTLH 4A3BG 2PMZE 2IY5B 3M4OH 1G51A 1CUKA 1VQ7A 2WAQE 5IYBH 3J81i 1B70B 1A0IA 2K5NA 1XNQL 4POFA 5LMUL 3CCSA 1PH5A 5C3EG 4JI0Q 1PA6A 3H3VI 1R9TH 3CPFA 2D0PA 3STBD 2UXBL 1W3SA 4IOAA 2ZTDA 4QL5A 3ER0A 1BVSA 4DV7Q 3AFPA 3G6EA 3PO2G 3HKZG 2OQKA 2VL6A 2VS1A 3W1GA 5IYBG 3J81c 3FHWA 2WB1G 4H02A 5C0XJ 2E2JH 3A5UA 4C2MH 3L2PA 3M85A 1KIXA 4DR1L 1OXSC 4P73A 3J7A5 1YBYA 4KI0A 3RLOA 1B8AA 4OO1I 4A3EH 1TXYA 2YTXA 2JA9A 2Z6KA 4DV4Q 2K5VA 2ZM6Q 3S17H 1UWVA 1YITA 2K5HA 3K7UC 2B29A 2MNAA 2RHQB 3G48A 1PYBA 3CCLA 1I3QH 4BA1I 4JV5L 2KCTA 2MQHA 4EX5A 1VQFA 2I5HA 5HY6A 3G4SA 4BA2I 4LFBL 1C0AA 4HIMA 3U58A 4PZ6A 4A3EG 1E24A 3I55A 4GOPB 4A3LH 1M90C 1NY4A 4IO9A 1Y1WH 5C0XI 1PH7A 2E2IH 1XNRQ 3M3YH 4JI8Q 2CFMA 3KLWA 1XPRA 4IJLA 2EXDA 3BZCA 4GNXA 1XPUA 3I4NH 2PQAB 1Q81C 4IJHA 3DM3A 1PH1A 1XJVA 4JBJA 4TQUS 1TWFH 3UE1A 4MZ9A 1NJIC 2R7FA 4ALPA 3RN5A 2UXDL 3PIPA 3FKIH 1VQHA 1Q1BA 2K14A 3NENA 5LMNW 1XMOL 3HOUH 3PUWA 2ZJRA 1KL9A 1MJCA 3CCUA 2RHSB 3HOZG 4JI7L 2LXKA 3HKZE 3PV0A 4DV1L 3I4NG 1X56A 2BH2A 1K73C 4OO1G 1SROA 1JJCB 3CXCA 4IPGA 1UE6A 4NXNQ 2K50A 2VZAA 3TRZA 1VQAA 2Y0SE 4DUYL 2OQ0A 4R4QA 1IBKL 1BBWA 4HIKA 3CP0A 4J15A 1EIFA 3NELA 1A8VA 1CSQA 1X6OA 2QA4A 2UUBL 4LF6L 4RMFA 4A76A 1EWIA 1FL0A 4IOCA 3TS0A 1JB7A 1IXRA 4LNQA 4JI4Q 2VNUD 3ULLA 3AQQA 2ZJPA 1SR3A 2VQEQ 1X55A 1KQSA 1QUQB 3UDFA 4DV3Q 4NPSA 1EFWA 3WWVA 5HGQA 5C0XG 4DR5L 5C4JH 3L7ZC 3CCRA 4P71A 5LMNL 1WCMH 4JI3Q 3HOYH 1PYSB 2YTYA 5DLQE 4A3KG 2N3SA 1I50H 2GVBA 2AMCB 4YWKA 4PMWA 2MFIA 1D7QA 1TWCH 4POGA 2GVAA 2DGYA 3CMEA 2WP8J 1J5EQ 1GD7A 2UU9L 1OXVA 2EQSA 1PVOA 4PG3A 1H95A 1GVPA 1NE3A 4JI7Q 4A3FH 1WCMG 1PH6A 5IYDH 4AIMA 3W1BA 4DAYB 2V1CC 1FJGQ 3J7ZC 1K9MC 4LFAL 1CKMA 4GOPA 1YJNA 2CWAA 4BBSH 1KHIA 5BR8Q 1VQLA 1AE3A 1Y1VH 4JG2A 3PUVA 1C7YA 3KFUA 4GN4B 3MXNB 5IYCG 2NVYH 1UE1A 2OTLA 3M9BA 2UUBQ 2Z6KC 4L5RC 4LF6Q 4DV4L 3PUYA 4P72A 1X65A 2ZM6L 3S1NH 5IYDG 1VQEA 2DUDA 3CC2A 2PQAA 2K52A 2PI2A 4DR3L 2JEAI 3M4PA 4GN5A 2Z0SA 4FDBA 3PSIA 1NBWA 2A1AA 4DR5Q 1SN8A 2D62A 2ALYB 1VQKA 4BXXH 1Y1VG 1PV4A 4LF4Q 3PO2H 1VQ8A 3BZKA 3UDXA 1VQNA 1Y14B 2JA7H 4K0KL 4DV6L 3GTGH 4DAMA 4X64L 2EIFA 5M3FH 4LF7Q 2UU9Q 1N9WA 1XNRL 4JYAQ 4JI8L 4OX9Q 1MIUA 1T9HA 3AYHB 4GNXC 1HR0W 4BXXG 3KF6A 4JI6Q 1UEBA 1X3EA 2VW9A 4DK3C 3E9HA 2YV5A 4LF9Q 4JI2L 3A0JA 4LFAQ 2NN6I 3S2HH 2RCNA 2JA7G 1N32Q 1P16A 3MEFA 5FLMH 2NVXH 1G291 5AJ3L 5M3FG 2Y0SG 2VY3A 5M5WH 1QUQA 5K36G 1J6QA 1PH3A 4Y52H 1E1OA 3KYHC 4WJ3M 3UDGA 1K8AC 2YU9H 4GN3B 3CF5A 5JJIA 2Q2TA 5GROA 2AHOB 2KENA 4UP8A 4DR3Q 1Q82C 4LUVA 3CCVA 4XIGS 1IZ6A 4NXNL 4YCUA 5FLMG 1NMFA 1IYJB 3EIVA 4MTNA 3H3VH 3RLFA 3S2DH 3W5OA 4IPDA 4DR7Q 5E7NA 1HR0L 3I2ZA 1VQPA 4HIOA 4JBMA 4K0KQ 4DV6Q 4GKJL 5IP9H 1YHBA 4X64Q 4YY3Q 4JOIA 3RR5A 4A3MH 1N33Q 4JI4L 1VQ5A 5JJLA 2I5MX 4R4TA 4XTCS 4KLKA 3G71A 2VQEL 1LUZA 2VUMH 1CSPA 4DV3L 4QIWE 4KHPQ 1AH9A 1EYGA 2PI2E 4NXMQ 3HOZH 1HJPA 3K80C 1XMQQ 4JI3L 3F2DA 3K8AA 4BY7H 3NBHB 4C3JH 4JI2Q 1FGUA 2E5LL 1X3GA 1WOCA 1KD1C 5JJKA 2KHIA 1X3FA 5IP9G 4A3IH 1IBML 4A3MG 3STBC 3PO3H 5AJ3Q 2R6GA 2NN6G 2XTIA 3CCMA 3ULJA 1CKOA 3I4OA 1J5EL 2VUMG 3BU2A 2PNHA 3PUZA 5GQOA 4L5TA 2YTVA 4QY7A 3U4VA 1XPOA 4NB3A 2VQFQ 3ZJYC 4BY7G 4R4IA 1S40A 3F1ZA 4X65Q 5IWAL 1FJGL 1UE5A 1SFOH 1PH4A 1EIYB 4GOPC 4YCWA 2NZOA 1ASZA 4A3IG 1C9OA 1YZ6A 5FJ8H 2HQLA 1VS0A 5BR8L 2JA5H 3PO3G 2JQOA 1KXLA 1X54A 2ZTCA 4GLVB 4OXPA 4A3KH 2CWPA 3RN2A 4JBWA 2KCMA 1QZGA 1HR0Q 2JK8A 3AEVA 3KOJA 4GKJQ 3M4QA 2R7ZH 4X6AH 1Q1EA 2R7DA 2OCEA 4LF8L 1VQOA 1RIPA 5M3MH 2F3IA 3I56A 4R1JA 4HJ7A 5GADC 1VQ9A 5EAYA 1YVCA 3UDIA 2Q2UA 2BA0A 1SMXA 5FJ8G 1MJEA 3OW2A 2JA5G 2AKWB 3K81C 4LF4L 1N36L 1KAWA 3GTMH 4GKKL 3FP9A 4AYBG 2E5LQ 2OTJA 3TS2A 3AFQA 5J3BA 3CCEA 3J80c 2F52A 1IBMQ 2D0OA 4B3TQ 2R7ZG 2UUCQ 2A8VA 1VQDA 3TREA 2YYZA 3D31A 4LF7L 4JYAL 5M3MG 4A3JH 5IYCH 4OX9L 4DK6C 4A93H 4C3HH 2E8GA 2ZJQA 1Q86C 4JI6L 1E7ZA 2A19A 3KDFB 3L0OA 1I5FA 3U50C 4C3IH 1PHJA 5IWAQ 4LF9L 3PF4A 1WJJA 3CCQA 3HOXH 1N32L 3D0FA 4OWXB 3ERSX 2Q2HA 1VQCA 3H15A 2ZTEA 2B63H 3RNUA 3S16H 3Q8DA 4R4OA 1Q8KA 2HIVA 3OTOQ 4A3JG 2R93H 1HZAA 2N49A 4A93G 1Q12A 1HZBA 1OXXK 2FXQA 3E0EA 4LUOA 3CCJA 2H5XA 4BBRH 1YIJA 3JAMc 3H0GH 4OWWB 4LF8Q 5IY0A 1S72A 3HOXG 2NZHA 2KHJA 1BKBA 2I5LX 2BA1A 4WJ4A 2CKZB 4YHHQ 2B63G 1KC8C 1N36Q 2IHFA 4DR4L 2UXCQ 4IPHA 4GKKQ 3IRBA 3B6YA 1PH8A 4DR7L 4IFDJ 2R93G 1K3RA 3CAMA 3E9IA 2K75A 1VQMA 4UPAA 1P8LA 1HNZQ 3GTJH 4JOIC 4DPGA 4BBRG 5FLXc 1OTCA 4YY3L 1WFQA 1N33L 2CQOA 3H0GG 1PFSA 2ASBA 4OWTB 3GTQH 4KHPL 4X62L 3T1YQ 4R4CA 4L5QA 1N34Q 4NXML 3TQYA 1YNXA 4O0AA 1XMQL 4A3GG 1GKHA 3PUXA 4AYBE 3PIOA 1KRSA 1VQ6A 3S15H 4X66Q 4HIDA 4DV5Q 1Q7YC 2UUAL 2CCZA 4LWCA 4A3DH 1K8GA 4HJ8A 1IBLQ 4AH6A 1VQ4A 4JI5Q 3GO5A 1HNWL 4HJ5A 4LFCL 3S24A 3S1MH 4GLAC 1I94Q 1Q46A 3T1HQ 1S3OA 4IFDI 1SRUA 1Z9FA 2VQFL 2IT1A 3GTPH 1JE5A 4X65L 4LF5L 4DUZL 4RG1A 4PZ7A 2ATWA 1N8RC 2WFWA 1VQGA 4HJAA 4A3DG 4B3SQ 2Q2IA 2F4VL 5GAGC 5C44H 1HNXQ 3RZOH 4DR4Q 2QEXA 5IP7H 1EQRA 4ME3A 1B7YB 4B3RQ 2JEBI 1A62A 2BH8A 3HKSA 3U4ZA 4P75A 3ULPA 1YJ9A 1PH9A 3UE0A 3F2BA 1QVCA 1K83H 3KDFA 4AQYQ 1HZ9A 5ELNA 1VCIA 2JA6H 4X62Q 3PGZA 4DR2Q 4UP7A 1VQBA 5JEAJ 4B3MQ 1X9NA 1CKNB 1MKHA 4JI1Q 5C44G 1V1QA 1GO3E 5IP7G 4O2DA 4DR6L 1EQQA 3GTKH 4LUZA 1V9PA 3HFZB 1VQIA 3NEMA 4JCVE 2HHHQ 2UUAQ 3GD7A 1D8LA 1K0RA 2UUCL 4B3TL 2R92H 1KRTA 1HNWQ 1L1OB 3ICEA 1EOVA 3JC66 2HIXA 4GS3A 1Z47A 4LFCQ 2JA6G 1XNQQ 5M5YH 4BY1H 5LMUQ 3CQZH 1GM5A 1QVFA 1O7IA 2NVQH 1I6HH 4IPCA 1NMGA 1JJGA 1YHQA 2UXBQ 3BJUA 4LF5Q 1UE7A 3CMAA 4LW1A 4DUZQ 1LYLA 3KJPA 3HOVH 3S14H 4IFDG 2R92G 3A5ZB 5C4XH 4A3CH 4QQBX 1G6PA 4L5SA 4DV2L 2F4VQ 3J81j 2K4KA 3OTOL 4BY1G 3J80i 3I4MH 4A3LG 4LFBQ 1Y1WG 4DR1Q 1WYDA 3SGIA 2XGTA 4YCVA 3EN2A 3KF8B 1QZHA 3S1RH 2KBNA 3HOVG 1E3PA 5GAHC 3VDYA 2NVTH 4A3CG 1YHAA 1L1OC 5C4XG 4YHHL 3M7NA 1AE2A 2UXCL 2WB1E 4APVA 4JV5Q 2JJQA 3RZDH 1YI2A 3F8TA 4TVAB 4DR6Q 3EBEA 1HNZL 3I4MG 4GLXA 2IHEA 2GN5A 3FKIG 3KF6B 4YWMA 3GTOH 3HOUG 1EUJA 2RF4A 1LM0A 4DV0L 2LSSA 3PCOB 1BBUA 1LTLA 1SE8A 2AWNA 5GAEC 3KJOA 3CC7A 2WAQG 1DGSA 4KHZA 2E2HH 3T1YL 1N34L 4OONA 1SLJA 2JE6I 3LGJA 2L15A 1OXUA 3JAMi 4JBKA 2N8NA 4Y7NH 1YJWA 2ID0A 2I0QA 2IX0A 2JA8H 4X66L 2LXJA 3A74A 3TEHB 1PH2A 4DV5L 1V43A 1A63A 1JJ2A 2OWOA 1E22A 1W2BA 3HOWH 4QGUA 1WI5A 4DV2Q 1IBLL 4JI5L 1FVIA 1VQJA 1TWGH 5IT9c 1JMCA 1JT8A 2C35B 2MO0A 4A4IA 3GDEA 5IE8A 5M5XH 1I94L 1XTDA 3T1HL 4DKAC 3PF5A 2ES2A 1CKNA 4JI0L 2UXDQ 4A75A 5JEAG 1XMOQ 2JA8G 4HJ9A 1E1TA 3CD6A 1M1KC 3S1QH 4DV7L 4DV1Q 3HOYG 4YWLA 5H1SE 3CPWA 1HH2P 4UY8C 4A3GH 3HOWG 1L1OA 2N78A 4B3SL 2HT1A 1HNXL 3CC4A 1HZCA 1U0LA 4QJFA 1L2FA 1IL2A 5ELOA 4EQ5A 4B3RL 4DUYQ 4P74A 3DLLA 1IBKQ 1OXTA 4GNXB 2AWOA 1ASYA 4A3BH 2QGQA 3K7AH 4DV0Q 4AQYL 1YEZA 3RLNA 1RL2A 4DR2L 4A3FG 5C3EH 4B3ML 1NTGA 4JC0A
chains in the Genus database with same CATH superfamily
4PZ8A 1SNPA 2B8FA 3K0XA 5EBDA 3CW2C 3BDCA 1QVGA 1U5KA 3GTLH 2HQEA 2WAQE 2RA4A 3J81i 1XNQL 3CCSA 1B9NA 2KQ3A 1R9TH 2UXBL 1W3SA 2AUJD 2FMCA 1F2YA 2NTTA 3AFPA 3K58A 5DAUA 3J81c 4H02A 2E2JH 5C4ZA 3SXHA 1LTID 4DR1L 4P73A 4K6DA 1BDOA 1B4OA 4NMZA 1B8AA 1NUCA 4A3EH 1TXYA 2YTXA 3FVQA 2MPMA 5I6WA 5IGFA 2F0LA 5NUCA 2B29A 4IURA 4CKBA 2MNAA 2MP1A 1I3QH 3KK7A 4JV5L 1VQFA 5C6AA 3EJIA 3K5MA 1UUPA 2L0CA 2F0KA 4HCEA 3I55A 5JVH3 4GOPB 2QF7A 1EY5A 1PH7A 5FK9C 3DMUA 1X3QA 3K59A 1XPRA 5A2QL 4J6HA 2D5DA 2EXDA 4GNXA 1XPUA 1HA5A 4HR7B 4QIWB 2PQAB 4IJHA 2PO4A 4HMJA 3I4LA 1LTGD 1PZJD 4MZ9A 4RGTA 2K14A 1UNSA 4ZAIA 1MD2D 3PUWA 2HDMA 3TSSA 2RHSB 5ELEA 5D65A 1EIGA 1QE6A 4JI7L 3C46A 4OO1G 1JJCB 2K7VA 4IPGA 2K50A 3I8ZA 2OQ0A 1IBKL 3GTJB 4P2CB 1EIFA 3VR2A 1CTMA 1V1PA 1SYBA 1G91A 5M3FB 1I6VC 2UUBL 2XWBB 4RMFA 3TS0A 4JI4Q 3ULLA 2ZJPA 2VXWA 1X55A 3DWPA 4DV3Q 2K5DA 2K28A 4DR5L 3ITPA 5C4JH 3S15B 1GHJA 1STYA 1PYSB 2L11A 4A3KG 3MTSA 1CZWA 1D7QA 2MFIA 2EY5A 5M5WB 4POGA 2GVAA 2DGYA 1R4QB 4RCNA 1HQMC 2UU9L 1LTAD 1OXVA 2RBMA 1U4PA 1JWSD 1AZQA 1GVPA 5IYDH 3NQTA 3W1BA 4DAYB 1WTXA 4LFAL 1CKMA 3H6MA 1FYCA 4BBSH 1U4MA 2CWAA 1KHIA 3ZYYX 4UHVA 3AMUA 5J39A 1STGA 1PMRA 1QWYA 5A35A 2I07B 2IW3A 1ESRA 1KLUD 2PI2A 2GA4B 4BY7B 4FDBA 2D2CC 1NBWA 1SN8A 1TIID 2ALYB 1VQKA 4BXXH 1PV4A 3UDXA 3A55A 1VQNA 1B3QA 1BF4A 4X64L 3KLSA 5M5YB 3QOLA 2EIFA 2K05A 3CQZB 3ERQA 1U4LA 4OX9Q 1PFMA 2ENBA 1K8MA 3I72A 4N9TA 3SK4A 4JI6Q 1S5ED 4DK3C 3E9HA 4LF9Q 2RCFA 2JA7G 2BOSA 3MEFA 3MFYA 1G8ZD 3R2TA 2VY3A 3VR3A 3IAYA 5K36G 4J8QA 1E1OA 5FO8B 3J80E 1K8AC 2YU9H 2OT2A 4GN3B 1WTWA 1WVLA 1Q82C 4LUVA 4OELB 3Q24A 2SNMA 3T4AC 2ICEC 4FP5D 2Q8IB 3RZDB 3H3VH 4ME5A 1GOZA 4CJ1B 3W5OA 3GTOB 4DAVA 5E7NA 2EZVA 1KABA 2EYPA 1VQPA 4ULLA 4K0KQ 4GKJL 1PRTF 4YY3Q 4A3MH 4JI4L 2VUMH 3G71A 4K5XA 4G7HC 2XRSD 4DV3L 4KHPQ 1IHZA 3VYSA 3K8AA 3JAME 1A2UA 2B2UC 2E5LL 5EGTA 2D9UA 1EY7A 2NBFA 1KD1C 4A3IH 2F0JA 3PO3H 3U9SA 3CCMA 2NN6G 3ULJA 3I4OA 4XYQA 4BBRB 3BU2A 5GQOA 2YTVA 5C3WA 3F1ZA 5CORA 1UE5A 1QILA 1EIYB 1IKMA 1CK1A 4YCWA 1ASZA 2WV6D 3FPPA 3J7AV 2JQOA 1EQTA 4JBWA 1QZGA 3AEVA 2R7ZH 4G7ZC 1ICWA 1Q1EA 5EPJA 3GTQB 3D4DA 4LF8L 3HG9A 5M3MH 1SNMA 1G2SA 4KD3A 2Q2UA 5ELFA 5KYIA 5FJ8G 3FDTA 1B1ZA 3K81C 1N36L 1TWAB 3SHLA 3GTMH 4AYBG 3AFQA 4A3DB 2LS01 1BCPC 2D0OA 2WB1B 2UUCQ 4F8MA 3HRZC 3LNNA 3NPPA 4OX9L 5KEEA 4DK6C 3J81E 1JE4A 2E8GA 4JI6L 3KUPA 1E7ZA 2A19A 1I5FA 4LF9L 3PIP3 3QR8A 1WJJA 3CCQA 3HOXH 1C8CA 3D0FA 1BOSA 1H9SB 5BN5A 1VQCA 4HSVA 2ZTEA 5ELDA 3Q8DA 4R4OA 3OTOQ 1K28A 3M4YA 5CV4A 2DJGC 1OXXK 3E0EA 3URYA 1V8QA 2EE1A 2IL8A 2FMMA 3X3MA 2IWHA 4OWWB 5IY0A 3S17B 2IPKD 1QB5D 1BKBA 1LTTD 4ZK9B 2I5LX 2BA1A 3GTKB 1EEFD 3WOFA 2LY7A 3DM1A 4F7XA 2PNRC 2P5ZX 4GKKQ 4DK0A 2CHBD 2F0UA 1NSNS 1VQMA 3SK6A 4C56C 4YY3L 1JOKA 3H0GG 3VR6A 2NVQB 5CGKA 4UAIA 4KHPL 3E0JA 3T1YQ 1YNXA 4DXFA 4A3GG 1DOKA 4B9XA 3PIOA 3HOVB 3I90A 1KRSA 3S14B 1GHKA 4DV5Q 2MGSA 4V190 4LJZC 1SNOA 2EVBA 3S1RB 5E1FA 2IT1A 1JR0D 1JE5A 3MWYW 2NVTB 5I2XA 4RG1A 3N52A 1FR3A 2BE5C 1ZXTA 5CV5A 3MXGA 2WFWA 2Q2IA 1ZEQX 1EQRA 1H9KA 4ME3A 2JEBI 1A62A 2BH8A 2OWOA 2PZUA 2G9DA 3UE0A 3F2BA 3KDFA 4H44C 4K8IA 3EFXD 2EXZA 2NTSA 1VF7A 1EY9A 4X62Q 3PGZA 3NBIA 1RD9D 1CKNB 2Z9HA 4JI1Q 1GO3E 1WCMB 4O2DA 4DR6L 2HHHQ 1V9PA 3HFZB 3NEMA 4JCVE 2UUAQ 1D8LA 1K0RA 1PTOF 2UUCL 5KNBA 1EOVA 3EVQA 1SYCA 1SYDA 1CA6A 3JAML 1J9OA 2B2YC 3SK5A 4A3FB 2CH4W 1JJGA 1HRJA 4N9PA 4LF5Q 4QMGA 4DUZQ 4LW1A 4OIJA 1HTPA 4XQNA 2E75C 3U9OA 3J81j 4MN3A 1Y1VB 3OTOL 3I4MH 2B2TC 3FPUB 5JJZA 1WYDA 4RKLA 2XGTA 3NXWA 4YCVA 1QZHA 3S1NB 1U4RA 4KKTA 1E3PA 1F77A 3C1FA 2J7ZA 1AE2A 3F8TA 1ILPA 4GLXA 2M2LA 2IHEA 2GN5A 1O78A 1S5BD 1BBUA 2Y0SB 1AFPA 4KHZA 1DGSA 4JVZA 3T1YL 4RH6A 2K1BA 2JE6I 2L15A 1OXUA 1EZ8A 5JEAH 4Y7NH 2ID0A 3TEHB 1IL8A 4DV5L 3S2HB 1V43A 2RDGA 1PTOB 1QCBD 1E22A 4RGNA 3HOWH 4QGUA 5FOBB 4IQZA 1TWGH 5IT9c 1BO0A 2ES2A 4DKAC 2UXDQ 2EJFC 1XMOQ 1EY6A 4MHEA 1SE2A 5EKKA 1JWMD 3S1QH 1C4QA 3PMFA 2F03A 1L1OA 2HT1A 2F0GA 2EDGA 4DA2A 3CC4A 3S2DB 2L55A 3NSWA 1L2FA 4EQ5A 3LX0A 1OXTA 4GNXB 4A3BH 4F87A 2PQEA 2QGQA 3K7AH 4DV0Q 3J7YW 2N88A 2EYMA 2I46A 2RDFA 5C3EH 1NTGA 4JI1L 3OMCA 4PNYA 3MAQA 2IX1A 2PZTA 2MO1A 1HUNA 4BBSG 2HHHL 3I7FA 5LMNQ 2X69A 1CI3M 2K33A 3NE5B 2PMZE 2IY5B 2E76C 1XYIA 5IYBH 1B70B 1PA6A 3CPFA 3DWQA 1V1PB 1SEBD 2ZTDA 4Z9CB 3HZXA 3G6EA 1DM0B 5KIXA 2WB1G 4A3KB 3A5UA 3LWUA 3TDQA 2FHTA 3M85A 1OXSC 4KN7C 1B2TA 1HCZA 3K0YA 3VA5A 2KEDA 5COYA 2Z6KA 4DV4Q 3T56B 2ZM6Q 1YITA 3OOCA 5IGGA 2A6HD 4EX5A 2MQHA 3CRLC 5HURA 3G4SA 2Z8LA 1C0AA 1D6EC 3VA7A 4IUQA 4R9WA 1HFNA 3KLRA 1M4VA 1Y1WH 2F0SA 1KDBA 2LFNA 4C3HB 3M3YH 2E74C 4DNRB 4QUCA 1F9PA 5EQ0A 1B44D 3BZCA 3K5LA 2B63B 3C3LA 4TQUS 2K5QA 2A73B 5T1IA 2UXDL 3PIPA 3FKIH 3NENA 4QF4A 1XMOL 2ICIA 4MIUA 1E2ZA 5EPLA 3PV0A 3HKZE 3I4NG 2L12A 1IYUA 2BH2A 3T51B 1SROA 3NWSA 4X3UA 2A68D 1W6JA 2DY7A 4HSPA 1BNZA 1KDCA 5DM73 1VMPA 2Z1CA 3NELA 1ENAA 3OWEB 1TS5A 4FXDA 4LF6L 4A76A 1FL0A 4I7ZC 1JB7A 4DU9A 2VNUD 3QOJA 4NPSA 3VYUA 4CDDC 5HGQA 5C0XG 4JI3Q 3CCRA 5LMNL 1YNND 4LAAA 2YTYA 5DLQE 1I50H 1LT6D 1O7ZA 1GUGA 1X3PA 4DXGA 1TWCH 4BS9A 2H4OA 2ZXRA 1KLGD 5C3XA 1DOLA 4OEMB 1AN8A 2EPBA 3BDOA 4JI7Q 2A69D 1WCMG 2V1CC 1IKLA 1K9MC 3SR1A 1I4PA 3BZDB 4U68A 5BR8Q 1VQLA 1AE3A 1C7YA 4FYDA 4WFN3 4GN4B 4V0BA 4ZRZA 3H94A 2PW5A 2UUBQ 2LMCB 4DV4L 4P72A 1STEA 2ZM6L 2R61A 4DR3L 3VYTA 4K14A 1PFBA 3PSIA 4DR5Q 2D62A 1Y1VG 2PYKA 2F0NA 3PO2H 1MBYA 1STHA 4JPBW 3S1MB 1I4XA 1D5MC 3BZKA 3QJYA 3L9AX 3Q22A 5DNFA 5KRUA 2EOTA 4DV6L 1SYGA 4IALA 3GV3A 5M3FH 2UU9Q 1HFGA 4JYAQ 1HHVA 2KCCA 1I6HB 2NYZD 3SE0A 1UEBA 2VW9A 4JI2L 1GUSA 4LFAQ 4M8AA 3GP7A 4AYBB 4N8X1 1TVXA 1JWUD 5AJ3L 2Y0SG 5I6YA 3NUCA 5M5WH 1QUQA 1J6QA 1SYFA 2AQ3B 3KYHC 4WJ3M 4FF3A 5JJIA 1GXDC 2Q2TA 2AHOB 4UP8A 4XIGS 4YCUA 1EYAA 1KNEA 1JQYD 4XQJA 1OO9B 5FLMG 1NMFA 4MTNA 3RLFA 5IGDA 4IPDA 1HXYD 5IOCA 4FF1A 1HR0L 1EOTA 4B08A 3PIO3 1DZ1A 2XSCA 1PZID 4X64Q 2QW7A 4JOIA 3RR5A 1VQ5A 2I5MX 4XTCS 5CV9A 4Q5VA 1LUZA 4IN3A 2RDHA 4QIWE 3VYRA 2QDLA 5IT9E 1EYGA 4NXMQ 3HOZH 1XMQQ 1D5XC 4JI3L 3F2DA 4BY7H 4C3JH 4E6IA 1X3GA 2KHIA 5IP9G 3STBC 2XTIA 3I91A 2PNHA 3H0GB 3PUZA 2IX3A 4L5TA 2C9OA 2RQXA 2VQFQ 2J0TD 4R4IA 1S40A 5FLXE 3R2IA 4X65Q 5IWAL 1SFOH 1PH4A 4A3GB 4GOPC 1EY4A 4IUPA 2NZOA 1C9OA 1QJOA 1YZ6A 5BR8L 1X54A 4OXPA 4IUTA 3OWFA 3RN2A 4ID6A 5D14A 1EEID 1K0SA 4GKJQ 1LACA 1VQOA 2EYJA 4F88A 1TQOA 4KY5A 3UI2A 1SAPA 1TT2A 1YVCA 3C2PA 2BA0A 1SMXA 2JA5G 1B50A 1PTOD 4FF4A 3GTLB 2E5LQ 2OTJA 3TMEA 3CCEA 3KBGA 5BN3A 1WTOA 2YYZA 4JYAL 4A3JH 3NWTA 1CHPD 5IYCH 1R9TB 4A93H 3TP8A 3KDFB 3PF4A 4C3IH 3RZOB 4OWXB 3ERSX 2Q2HA 3H15A 3MHBA 5LL6S 4KHVA 2E2JB 3RNUA 3S16H 2K03A 2R93H 1Q12A 1A3VA 1HZBA 2FXQA 4C3HG 1YIJA 2H5XA 4BBRH 4LF8Q 2KHJA 3MC0B 4XQQA 5FO9B 1I3QB 4WJ4A 4YHHQ 2B63G 1KC8C 1N36Q 3IRBA 3B6YA 1P8LA 2B2VA 5I9PA 1WTHA 1SNCA 4EQNA 2ASBA 4HCSA 4OWTB 4QUFA 3GTQH 1N34Q 4NXML 3TQYA 4EQPA 1XMQL 1GKHA 3MVVA 3DEOA 4HAEA 3SEBA 1Q7YC 4LWCA 4HN7A 4A3DH 1K8GA 1JOQA 2HCIA 1IBLQ 4AH6A 1HNWL 4ODGA 4UDUC 4LFCL 3S24A 3M7GA 1S3OA 2VQFL 4X65L 2K32A 1Z6HA 3H09A 2ATWA 1N8RC 5TSSA 1VQGA 4HJAA 4B3SQ 1ML0D 2F4VL 2QEXA 5IP7H 2F0OA 4B3RQ 3ULPA 3IFDA 1K83H 1LTSD 3R3OA 3HP3A 5ELNA 1EL0A 3GQBA 5FO7B 2JA6H 3NK9A 4DR2Q 1DONA 1VQBA 4RHSA 4XXEA 1XXGA 5C44G 5C4JB 4R8NA 1FD7D 3GTKH 5KGUA 1VQIA 1KRTA 3T16A 1L1OB 4OHJA 2HIXA 1O7LA 2R3ZA 3BVGA 5CV8A 4BY1H 1CQVA 5LMUQ 5E4WC 3IFTA 1QVFA 1O7IA 2NVQH 3OMGA 1YHQA 3BJUA 1LT4D 3CMAA 1IW7D 1DD2A 2TSSA 4XDXA 3HOVH 4IFDG 3S14H 1AEXA 3DUZA 2R92G 3A5ZB 5C4XH 1SYEA 1G6PA 4L5SA 4BBSB 4WORA 2K4KA 1EY8A 1EYCA 1Y1WG 2EYHA 2A6HC 1V1OA 2QCPX 1D2BA 1Q8IA 3SGIA 3EN2A 2OF1A 5CR3A 3S1RH 1VDZA 2KBNA 1AZPA 1SE3A 2WKCA 2NVTH 4A3CG 1L1OC 1TWHB 1BUVT 4YHHL 2WB1E 4APVA 1EYDA 4DR6Q 3EROA 1PRTB 4FO2A 3FKIG 3KF6B 4YWMA 1LM0A 2LSSA 3PCOB 2WAQG 2E2HH 1N34L 3OSOA 4KN4C 1UEAB 4JBKA 2N8NA 2JA8H 1RDPD 3TZUA 1JJ2A 1VMCA 5CMDA 1WTRA 1WI5A 1IBLL 1VQJA 3F2UA 2KCNA 2EJMA 4DAPA 3PF5A 4JI0L 2A68C 2KJXA 4DF7A 1PRTC 1E1TA 3NTHA 4TRDA 1M1KC 4DV7L 4B3SL 1GUTA 4C1NI 2F0MA 1Q90A 2K04A 4B3RL 4DUYQ 4P74A 3DLLA 1ASYA 4X3KA 4A3MB 4NDXA 1YNNC 2VUMB 1S4ZA 2E2IB 4DR2L 5JOBA 2ZXOA 4MNOA 5CV6A 3I4NB 1LT3D 3QWNA 1MHWC 2B3GA 1STBA 4NP5A 4FXGC 1WTQA 3F2CA 4WJWA 1M8AA 2CVRA 4DNTB 1F9SA 1TWFB 4A3IB 3M4OH 1G51A 1CUKA 2X6GA 2A69C 3E6ZX 1A0IA 5JAVA 4POFA 3NP8A 5LMUL 1PH5A 2K01A 2BDNA 4OIKA 3CRKC 1RODA 1AP0A 2D0PA 3STBD 4IOAA 3RUZA 4DGZA 2OEOA 3ER0A 1BVSA 2LKVA 4RGOS 3PO2G 2VL6A 2XRQD 3J80L 4CHTB 1TU2B 3W1GA 4OL7A 3FHWA 5C0XJ 2K5WA 4C2MH 3L2PA 3J7A5 1YBYA 3O13A 3RLOA 4OO1I 3A7AB 3FMCA 2JA9A 3IKJA 1ENFA 2XVSA 4JK1C 1UWVA 2F0EA 2RHQB 5C5LA 1PYBA 3ND9A 1NR4A 3NTIA 3HGBA 2I5HA 4I65A 5HY6A 3GTMB 4O42A 2RKSA 3VR4A 4HIMA 3U58A 4PZ6A 4A3EG 4H7BA 4TKOB 3NHHA 2CFMA 2O2LD 4PMBA 3HOXB 3J7AF 1CT1D 1G6ZA 4OO1H 1Q81C 1XJVA 3QO2A 4Q0FA 4ALPA 2B2WC 3Q6SA 3HOUH 3P20A 1KL9A 1MJCA 4S3SA 5EPKA 3HOZG 1A3TA 3DXJC 4C3JG 4CDCC 3CXCA 1UE6A 3TRZA 2ZT9C 1XX8A 3BYYB 1CZGA 1NAPA 1QNUA 1SJED 1VQAA 1LT5D 2Y0SE 4LK1C 3I3CA 4DUYL 4HIKA 3CP0A 4J15A 3ND8A 1CSQA 3N6RA 4LNQA 1IXRA 1KQSA 2VQEQ 1QUQB 3UDFA 3OHXC 3WWVA 3HOYH 4KMUC 3TN2A 3J81L 2N3SA 1HTLD 2GVBA 3VR5A 2NVXB 4YWKA 4PMWA 2DJFC 1F2ZA 4FXKC 1J5EQ 2SOBA 2EQSA 1NNXA 2G9HD 1PVOA 4IUVA 1NE3A 1G2TA 5J1ZA 2PPBC 1PH6A 2F0VA 1FJGQ 1BR9A 4C1NK 1RCVD 1YJNA 1KDAA 2M00A 4RWSC 5IYCG 2NVYH 2OTLA 3M9BA 1MSHA 1PTOC 4HMIA 3MEHA 4LF6Q 1ZYRD 3D6CA 5IYDG 2DUDA 3CC2A 4C3IG 2K52A 3GV6A 2JEAI 2A1AA 3MA2B 5IODA 2HDLA 1Y14B 2JA7H 2HCCA 4GZYC 1I4RA 3GTGH 4DAMA 2F4IA 1F9RA 4LF7Q 1N9WA 5K36H 2HUGA 1MIUA 1T9HA 4M1UB 3AYHB 4GNXC 4CBVA 4BXXG 3KF6A 1X3EA 4KY6A 3PQIA 2NN6I 2JA5B 2RCNA 2CQAA 2DNCA 2V4DA 1N32Q 1B9MA 2F0IA 1G291 3I4MB 1PH3A 1I4GA 3R93A 4Y52H 5LHY1 1FNUA 1X32A 4RA8A 3CF5A 2QDBA 4CKEA 5CV7A 4DR3Q 2PCFB 4FVMA 5JPMC 2NWGA 2PW7A 2A74C 1IYJB 3EIVA 4FF2A 4CGYB 3I2ZA 4JBMA 4DV6Q 1YHBA 3CHBD 2NN6H 5JJLA 1ZKOA 4KLKA 2VQEL 3BVMA 4L63B 1EWHA 4QCLA 1AH9A 4Y7NB 2PI2E 2DNEA 3L3OC 3MXNA 4JI2Q 1TR5A 2RSNA 3HOWB 1WOCA 3EQLC 3FRPB 3A8JE 1TWGB 1IBML 1X3FA 5JJKA 4A3MG 5D3DA 1RTOA 5AJ3Q 1WTVA 1J5EL 5A2QE 2VUMG 1CKOA 2KECA 2L9HA 1PZKD 3U4VA 1XPOA 4NB3A 3S1QB 1DJRD 5G3LF 3T53B 3Q23A 1FJGL 3AB9A 1TY0A 1TS3A 4A3IG 3A8IE 1PRTD 5FJ8H 2HQLA 1PXUA 3PO3G 2ZTCA 4GLVB 2AQ2B 1HR0Q 3K7AB 3M4QA 1RKNA 1EY0A 2OCEA 4K6LA 2QEJC 3I56A 4RKBA 5GADC 1VQ9A 5EAYA 3UDIA 2F0HA 3OW2A 2AKWB 2KVMA 5I9OA 3E3XA 1KAWA 3FP9A 3TS2A 2EJGC 3J80c 2F52A 2R7ZG 2A8VA 1VQDA 4G57A 1IW7C 4LF7L 5KNDA 5M3MG 3DHQA 1A6XA 3GTPB 1AW7A 1Q86C 2B2YA 2BCOA 1PHJA 3L0OA 2F0DA 5IWAQ 2H1EA 2C5CA 1N32L 5C44B 1ICFB 3SDZA 1Q8KA 2N49A 4LUOA 2B2TA 3KLSX 3K5NA 3JAMc 1SBBB 3NBHA 3H0GH 4DN4M 3A56A 3A54A 4H13C 3HOXG 2A6ED 2NZHA 5C5MA 1J8IA 3RD4A 2EY1A 2AQ1B 2KOLA 1LTRD 4DR4L 4ZKCB 2UXCQ 2R92B 4IFDJ 1Q3LA 1T5XD 1HNZQ 2FJ2A 2K75A 4UPAA 3GTJH 3OIQA 4DPGA 1OTCA 1WFQA 1O7YA 1D1IA 1Y1WB 1PFNA 4G7OC 3M3YB 4R4CA 2G5DA 5I4DA 3BG3A 4AYBE 4IZ8A 3S15H 4IUNA 2DN8A 1SDFA 3P75A 1K8OA 5LL6X 4HJ8A 3NQIA 1VQ4A 1MI2A 4HJ5A 3FKIB 4GLAC 1I94Q 1Q46A 5ELBA 1SRUA 1Z9FA 2WAQB 1CHQD 2A5HA 3MXPA 3E5SA 4PZ7A 4KKUA 1FGBD 1FNVA 1PLFA 1NR2A 1MGSA 3RZOH 1HNXQ 1B7YB 4LFBL 2JP1A 1YJ9A 1Y8NB 4I7AA 1NCVA 4AQYQ 4RCOA 1HZ9A 3SVMA 2KEEA 1VCIA 1GJXA 4B3MQ 4NW2A 1X9NA 3TP6A 3MFGA 1EQQA 1I50B 4X3TA 4LUZA 1LV9A 2AUKA 3GD7A 1TWCB 5M5XB 1HNWQ 3WOEA 4GS3A 1Z47A 4LFCQ 5M5YH 3CQZH 5CYUA 1UE7A 1DXMA 2MJ8A 4QQBX 1PDQA 4DV2L 1ILQA 2EY2A 2F4VQ 5AFWA 4K2KA 1EFID 4G4KA 3V2TA 1II3A 5CC4A 5GAHC 3VDYA 2F0PA 2UXCL 1W6KA 2JJQA 3RZDH 2CW0D 1YI2A 3PO2B 3EBEA 1HNZL 3I4MG 1XTCD 1CFMA 3GTOH 3HOUG 2RF4A 2VB3X 3QIAA 1SE8A 2AWNA 3KJOA 1SLJA 3LGJA 3IL8A 3K57A 2EYLA 2IX0A 2LXJA 3A74A 3OW7A 1A63A 5EBCA 1W2BA 5DM63 1MSGA 1JMCA 1JT8A 3GDEA 5IE8A 4R8IA 1I94L 1XTDA 4A3EB 2XNAC 1F9QA 5JEAG 3K6OA 4HJ9A 3CD6A 1Y8PB 2MHVA 4DV1Q 3HOYG 3CPWA 4UY8C 1S5FD 3HOWG 2KHSA 1HNXL 1KNAA 1LLRD 1HZCA 1EIHA 4QJFA 1IL2A 2OXPA 4L6TB 1BXTA 4EQOA 4AQYL 2O4XA 1YEZA 3RLNA 1RL2A 5D3IB 4B3ML 4JC0A 4XT1B 1L0WA 4EGVA 5JPNC 3HOZB 3OYYA 4UP9A 4ABNA 4DNIA 1TWHH 4C3JB 1TWAH 5IGCA 2O5JC 4A3BG 5ELCA 2RVLA 1QNKA 3FEWX 3KF8A 1VQ7A 2SEBD 2K5NA 2F0FA 5C3EG 4JI0Q 4H0LC 4ILWA 3H3VI 4OGQC 1SNDA 1EWCA 1QG7A 4QL5A 5EJWA 1E0BA 1R4PB 4IUUA 4DV7Q 1SMYD 1SFOB 1O80A 1BCPF 2NB0A 3HKZG 2OQKA 3D4WA 3R8BA 2VS1A 5IYBG 1ZYRC 3DEPA 2SNSA 5J22A 1KIXA 4O1NA 2EYFA 4KI0A 4DK1A 3DWAA 1YNJD 3A8KE 1F2LA 2K5VA 3S17H 2K5HA 3K7UC 1TS4A 2CH4A 3BDLA 5T1GA 1WTPA 3G48A 3CCLA 4BA1I 4KKSA 3CU7A 2KCTA 1EU3A 4BA2I 2E2DC 1Y69U 2Z4IA 5IT9L 3G6JB 1E24A 4A3JB 4A3LH 1M90C 1NY4A 4IO9A 5C0XI 4A93B 2E2IH 1XNRQ 4JI8Q 3KLWA 2Z6BA 4CDEC 5CBAE 4C3IB 3S9WA 4IJLA 3I4NH 3RMHA 3DM3A 3WDNA 1STAA 1PH1A 3S16B 4JBJA 4KTAA 5FLXL 3UE1A 1TWFH 4RHRA 1NJIC 2R93B 2R7FA 3RN5A 4PMCA 1VQHA 1Q1BA 5LMNW 3P7JA 2ZJRA 3CCUA 4HTHA 1SNQA 3CKIB 1BCPB 2LXKA 4DV1L 1X56A 1K73C 4NXNQ 2F1MA 2VZAA 5C0XH 4R4QA 1BBWA 5KYLA 1E2WA 2X6LA 1A8VA 1X6OA 2QA4A 2J4XA 1EWIA 3QB3A 4IOCA 4N8FA 3AQQA 1SR3A 2XN9C 1EFWA 5BN4A 1TS2A 3L7ZC 4P71A 1WCMH 1CQFA 2AMCB 2KUMA 3CMEA 2WP8J 3V96A 1GD7A 5EKIA 5G3LD 4CJ2C 1PYWD 2YU9B 3P1HA 4PG3A 1RJTA 4QB4A 1H95A 1LABA 4FNFA 4A3FH 2QKIC 1LTBD 2K6AA 4AIMA 3J7ZC 1E2VA 1HUMA 3ONAB 4K5WA 4GOPA 1Y1VH 2F0TA 3PUVA 4JG2A 3KFUA 1ENCA 3MXNB 4JW0A 1K83B 1UE1A 2Z6KC 4L5RC 3PUYA 1X65A 3D6WA 1B53A 1HQRD 2WKDA 2JA6B 1VQEA 3S1NH 3NTKA 2KA7A 2PQAA 1CA5A 3M4PA 1H9JA 2SDFA 2Z0SA 1CM9A 4GN5A 5FKAC 5C4HA 4LF4Q 4KD4A 5IIFA 1VQ8A 4PV1C 3PO3B 4K0KL 4L8JA 4BY1B 2WINB 3H3VC 1XNRL 4JI8L 1JC7A 1SE4A 2F3WA 3K5OA 1C48A 4BWGB 1EQVA 1H9MA 2WACA 1HR0W 1SJHD 2YV5A 3A0JA 5C4XB 3S2HH 3V05A 1PTOH 1P16A 1RTNA 5FLMH 2L4NA 4KK7A 2NVXH 5K5PA 5M3FG 2A6EC 2R7ZB 2Q8RE 2XWJB 2L5TA 4KJOA 5M3MB 3UDGA 1JCKB 5GROA 2KENA 4K2LA 3CCVA 1IZ6A 3I73A 4NXNL 1EU4A 1KAAA 1S5DD 1A2TA 2MUYA 3S2DH 3D8GA 2ZXPA 5DEHA 4DR7Q 3QG1A 4HIOA 2BDOA 5KNCA 5IP9H 2M9VA 1N33Q 2E2HB 4DAYA 4R4TA 1Z7TA 1CSPA 2JA8B 2NUCA 1HJPA 3K80C 3G7LA 3NBHB 1FGUA 4CDFC 4KJNA 2R6GA 5E4XA 2QILA 4QY7A 3ZJYC 1A15A 3BS1A 4BY7G 1FNWA 5IGEA 4K8JA 2JA5H 1VS0A 1KXLA 4A3KH 2CWPA 2KCMA 3BYTB 3KBXA 2JK8A 5M9OA 3KOJA 2F0QA 2B8GA 4X6AH 2R7DA 3MZ5A 1A3UA 1RIPA 2F3IA 4R1JA 1JB3A 4HJ7A 1MJEA 1GUOA 4LF4L 5HGTA 4CKCA 4GKKL 3TBIB 5J3BA 1L0XB 2B2UA 2Z4HA 3M4OB 4KY7A 1IBMQ 4B3TQ 2WIIB 3TREA 3D31A 2EYOA 4C3HH 2ZJQA 3TP5A 3U50C 1BBXC 1WD0A 2FFKB 2JYOA 1Y8OB 1U9RA 2B63H 1KTKA 5EKLA 4C2MB 3MXUA 2HIVA 4A3JG 1HZAA 4A93G 1JICA 3CCJA 2CW0C 4ZQ3A 1S72A 4TSSA 2CKZB 2JXMB 2IHFA 4IPHA 1PH8A 2R93G 4DR7L 1K3RA 3CAMA 3E9IA 4ZUJA 5F2DA 4JOIC 4B9WA 4BBRG 5FLXc 1N33L 2CQOA 1WD1A 2O5IC 1PFSA 2JSOA 1STNA 3SK8A 1IYVA 1ESFA 4X62L 4L5QA 4O0AA 3PUXA 1DOMA 1TKWB 1VQ6A 4X66Q 4HIDA 4K5VA 2F3VA 4XYOA 3H91A 2UUAL 2CCZA 4JI5Q 3GO5A 5CBEE 1RHPA 3HOUB 4EVOA 2PMZB 3T1HQ 4ZYSA 4J1MA 4IFDI 3GTPH 2VB2X 2N55A 4LF5L 4DUZL 4RGMA 5I2YA 1D1KA 5JVG3 4A3DG 4DR4Q 5GAGC 5C44H 1ONLA 3TP7A 2B39A 3HKSA 3U4ZA 4P75A 1PH9A 1QVCA 4HEDA 1SXTA 1H9SA 1ET6A 4UP7A 5JEAJ 5E3FA 1MKHA 1TY2A 1V1QA 5IGBA 3HOYB 1GUWA 5IP7G 2L1BA 3BVZA 4IFDH 2R92H 4ZKBB 4B3TL 3S1MH 1BQQT 5L37A 3ICEA 3JC66 3C1EA 2JN4A 1SMYC 2JA6G 1XNQQ 3D4RA 1GM5A 4CJ0B 1JOOA 1BCPD 1I6HH 4IPCA 1NMGA 2UXBQ 1T5EA 1LYLA 4X3SA 3KJPA 1I4HA 1JORA 4A3CH 2PZWA 1YNJC 3T13A 4A3BB 4BY1G 3J80i 4A3LG 2HD3A 4LFBQ 1QOHA 1DCZA 2NVYB 4DR1Q 1RF2D 3KF8B 5C3EB 4MTKA 3Q0AA 2FINB 3HOVG 4RFBA 5C4XG 1YHAA 4WRDA 3A7LA 1B3AA 1GUNA 1SSOA 1UAPA 1DYQA 3OIPA 3M7NA 2Q8TA 4JV5Q 5ISRA 2RSOA 3HKZB 2B2VC 4TVAB 2JA7B 3GTGB 1EUJA 1I4QA 4DV0L 4ZLTF 1LTLA 3CC7A 5GAEC 4KV6A 1L0YB 3EA6A 2TMPA 4OONA 4U673 3LWEA 4XT3B 1S5CD 3HEJA 3JAMi 4PQXA 1YJWA 2I0QA 2F0WA 4X66L 1D5ZC 4LMQD 1PH2A 4YIJA 3OPOA 4NKLA 2NZ1D 1HPCA 4DV2Q 4JI5L 1FVIA 1ET9A 2C35B 2MO0A 4A4IA 4DFAA 5M5XH 4ZUIA 3T1HL 3HS0C 1CKNA 1EZ6A 4A75A 2B2WA 2JA8G 1VF5C 3TZDA 1LO5D 3D3RA 4RAUC 1HA6A 4YWLA 5H1SE 1HH2P 4A3GH 2N78A 1XWEA 2XIWA 2DY8A 3I70A 1U0LA 1F2MA 5ELOA 3X3NA 1IBKQ 2BE5D 2AWOA 3W2DA 1K3BC 1H9RA 2IJ0A 2EY6A 3W3AA 3AU7A 4A3FG 4ZCKA
chains in the Genus database with same CATH topology
4PZ8A 1L0WA 4MNOA 3K0XA 3OYYA 4JI1L 4UP9A 3CW2C 2IX1A 4DNIA 2MO1A 1TWHH 2B3GA 1QVGA 1U5KA 4BBSG 1TWAH 2HHHL 3I7FA 5LMNQ 3F2CA 3GTLH 4A3BG 2PMZE 2IY5B 3M4OH 1G51A 1CUKA 1VQ7A 2WAQE 5IYBH 3J81i 1B70B 1A0IA 2K5NA 1XNQL 4POFA 5LMUL 3CCSA 1PH5A 5C3EG 4JI0Q 1PA6A 3H3VI 1R9TH 3CPFA 2D0PA 3STBD 2UXBL 1W3SA 4IOAA 2ZTDA 4QL5A 3ER0A 1BVSA 4DV7Q 3AFPA 3G6EA 3PO2G 3HKZG 2OQKA 2VL6A 2VS1A 3W1GA 5IYBG 3J81c 3FHWA 2WB1G 4H02A 5C0XJ 2E2JH 3A5UA 4C2MH 3L2PA 3M85A 1KIXA 4DR1L 1OXSC 4P73A 3J7A5 1YBYA 4KI0A 3RLOA 1B8AA 4OO1I 4A3EH 1TXYA 2YTXA 2JA9A 2Z6KA 4DV4Q 2K5VA 2ZM6Q 3S17H 1UWVA 1YITA 2K5HA 3K7UC 2B29A 2MNAA 2RHQB 3G48A 1PYBA 3CCLA 1I3QH 4BA1I 4JV5L 2KCTA 2MQHA 4EX5A 1VQFA 2I5HA 5HY6A 3G4SA 4BA2I 4LFBL 1C0AA 4HIMA 3U58A 4PZ6A 4A3EG 1E24A 3I55A 4GOPB 4A3LH 1M90C 1NY4A 4IO9A 1Y1WH 5C0XI 1PH7A 2E2IH 1XNRQ 3M3YH 4JI8Q 2CFMA 3KLWA 1XPRA 4IJLA 2EXDA 3BZCA 4GNXA 1XPUA 3I4NH 2PQAB 1Q81C 4IJHA 3DM3A 1PH1A 1XJVA 4JBJA 4TQUS 1TWFH 3UE1A 4MZ9A 1NJIC 2R7FA 4ALPA 3RN5A 2UXDL 3PIPA 3FKIH 1VQHA 1Q1BA 2K14A 3NENA 5LMNW 1XMOL 3HOUH 3PUWA 2ZJRA 1KL9A 1MJCA 3CCUA 2RHSB 3HOZG 4JI7L 2LXKA 3HKZE 3PV0A 4DV1L 3I4NG 1X56A 2BH2A 1K73C 4OO1G 1SROA 1JJCB 3CXCA 4IPGA 1UE6A 4NXNQ 2K50A 2VZAA 3TRZA 1VQAA 2Y0SE 4DUYL 2OQ0A 4R4QA 1IBKL 1BBWA 4HIKA 3CP0A 4J15A 1EIFA 3NELA 1A8VA 1CSQA 1X6OA 2QA4A 2UUBL 4LF6L 4RMFA 4A76A 1EWIA 1FL0A 4IOCA 3TS0A 1JB7A 1IXRA 4LNQA 4JI4Q 2VNUD 3ULLA 3AQQA 2ZJPA 1SR3A 2VQEQ 1X55A 1KQSA 1QUQB 3UDFA 4DV3Q 4NPSA 1EFWA 3WWVA 5HGQA 5C0XG 4DR5L 5C4JH 3L7ZC 3CCRA 4P71A 5LMNL 1WCMH 4JI3Q 3HOYH 1PYSB 2YTYA 5DLQE 4A3KG 2N3SA 1I50H 2GVBA 2AMCB 4YWKA 4PMWA 2MFIA 1D7QA 1TWCH 4POGA 2GVAA 2DGYA 3CMEA 2WP8J 1J5EQ 1GD7A 2UU9L 1OXVA 2EQSA 1PVOA 4PG3A 1H95A 1GVPA 1NE3A 4JI7Q 4A3FH 1WCMG 1PH6A 5IYDH 4AIMA 3W1BA 4DAYB 2V1CC 1FJGQ 3J7ZC 1K9MC 4LFAL 1CKMA 4GOPA 1YJNA 2CWAA 4BBSH 1KHIA 5BR8Q 1VQLA 1AE3A 1Y1VH 4JG2A 3PUVA 1C7YA 3KFUA 4GN4B 3MXNB 5IYCG 2NVYH 1UE1A 2OTLA 3M9BA 2UUBQ 2Z6KC 4L5RC 4LF6Q 4DV4L 3PUYA 4P72A 1X65A 2ZM6L 3S1NH 5IYDG 1VQEA 2DUDA 3CC2A 2PQAA 2K52A 2PI2A 4DR3L 2JEAI 3M4PA 4GN5A 2Z0SA 4FDBA 3PSIA 1NBWA 2A1AA 4DR5Q 1SN8A 2D62A 2ALYB 1VQKA 4BXXH 1Y1VG 1PV4A 4LF4Q 3PO2H 1VQ8A 3BZKA 3UDXA 1VQNA 1Y14B 2JA7H 4K0KL 4DV6L 3GTGH 4DAMA 4X64L 2EIFA 5M3FH 4LF7Q 2UU9Q 1N9WA 1XNRL 4JYAQ 4JI8L 4OX9Q 1MIUA 1T9HA 3AYHB 4GNXC 1HR0W 4BXXG 3KF6A 4JI6Q 1UEBA 1X3EA 2VW9A 4DK3C 3E9HA 2YV5A 4LF9Q 4JI2L 3A0JA 4LFAQ 2NN6I 3S2HH 2RCNA 2JA7G 1N32Q 1P16A 3MEFA 5FLMH 2NVXH 1G291 5AJ3L 5M3FG 2Y0SG 2VY3A 5M5WH 1QUQA 5K36G 1J6QA 1PH3A 4Y52H 1E1OA 3KYHC 4WJ3M 3UDGA 1K8AC 2YU9H 4GN3B 3CF5A 5JJIA 2Q2TA 5GROA 2AHOB 2KENA 4UP8A 4DR3Q 1Q82C 4LUVA 3CCVA 4XIGS 1IZ6A 4NXNL 4YCUA 5FLMG 1NMFA 1IYJB 3EIVA 4MTNA 3H3VH 3RLFA 3S2DH 3W5OA 4IPDA 4DR7Q 5E7NA 1HR0L 3I2ZA 1VQPA 4HIOA 4JBMA 4K0KQ 4DV6Q 4GKJL 5IP9H 1YHBA 4X64Q 4YY3Q 4JOIA 3RR5A 4A3MH 1N33Q 4JI4L 1VQ5A 5JJLA 2I5MX 4R4TA 4XTCS 4KLKA 3G71A 2VQEL 1LUZA 2VUMH 1CSPA 4DV3L 4QIWE 4KHPQ 1AH9A 1EYGA 2PI2E 4NXMQ 3HOZH 1HJPA 3K80C 1XMQQ 4JI3L 3F2DA 3K8AA 4BY7H 3NBHB 4C3JH 4JI2Q 1FGUA 2E5LL 1X3GA 1WOCA 1KD1C 5JJKA 2KHIA 1X3FA 5IP9G 4A3IH 1IBML 4A3MG 3STBC 3PO3H 5AJ3Q 2R6GA 2NN6G 2XTIA 3CCMA 3ULJA 1CKOA 3I4OA 1J5EL 2VUMG 3BU2A 2PNHA 3PUZA 5GQOA 4L5TA 2YTVA 4QY7A 3U4VA 1XPOA 4NB3A 2VQFQ 3ZJYC 4BY7G 4R4IA 1S40A 3F1ZA 4X65Q 5IWAL 1FJGL 1UE5A 1SFOH 1PH4A 1EIYB 4GOPC 4YCWA 2NZOA 1ASZA 4A3IG 1C9OA 1YZ6A 5FJ8H 2HQLA 1VS0A 5BR8L 2JA5H 3PO3G 2JQOA 1KXLA 1X54A 2ZTCA 4GLVB 4OXPA 4A3KH 2CWPA 3RN2A 4JBWA 2KCMA 1QZGA 1HR0Q 2JK8A 3AEVA 3KOJA 4GKJQ 3M4QA 2R7ZH 4X6AH 1Q1EA 2R7DA 2OCEA 4LF8L 1VQOA 1RIPA 5M3MH 2F3IA 3I56A 4R1JA 4HJ7A 5GADC 1VQ9A 5EAYA 1YVCA 3UDIA 2Q2UA 2BA0A 1SMXA 5FJ8G 1MJEA 3OW2A 2JA5G 2AKWB 3K81C 4LF4L 1N36L 1KAWA 3GTMH 4GKKL 3FP9A 4AYBG 2E5LQ 2OTJA 3TS2A 3AFQA 5J3BA 3CCEA 3J80c 2F52A 1IBMQ 2D0OA 4B3TQ 2R7ZG 2UUCQ 2A8VA 1VQDA 3TREA 2YYZA 3D31A 4LF7L 4JYAL 5M3MG 4A3JH 5IYCH 4OX9L 4DK6C 4A93H 4C3HH 2E8GA 2ZJQA 1Q86C 4JI6L 1E7ZA 2A19A 3KDFB 3L0OA 1I5FA 3U50C 4C3IH 1PHJA 5IWAQ 4LF9L 3PF4A 1WJJA 3CCQA 3HOXH 1N32L 3D0FA 4OWXB 3ERSX 2Q2HA 1VQCA 3H15A 2ZTEA 2B63H 3RNUA 3S16H 3Q8DA 4R4OA 1Q8KA 2HIVA 3OTOQ 4A3JG 2R93H 1HZAA 2N49A 4A93G 1Q12A 1HZBA 1OXXK 2FXQA 3E0EA 4LUOA 3CCJA 2H5XA 4BBRH 1YIJA 3JAMc 3H0GH 4OWWB 4LF8Q 5IY0A 1S72A 3HOXG 2NZHA 2KHJA 1BKBA 2I5LX 2BA1A 4WJ4A 2CKZB 4YHHQ 2B63G 1KC8C 1N36Q 2IHFA 4DR4L 2UXCQ 4IPHA 4GKKQ 3IRBA 3B6YA 1PH8A 4DR7L 4IFDJ 2R93G 1K3RA 3CAMA 3E9IA 2K75A 1VQMA 4UPAA 1P8LA 1HNZQ 3GTJH 4JOIC 4DPGA 4BBRG 5FLXc 1OTCA 4YY3L 1WFQA 1N33L 2CQOA 3H0GG 1PFSA 2ASBA 4OWTB 3GTQH 4KHPL 4X62L 3T1YQ 4R4CA 4L5QA 1N34Q 4NXML 3TQYA 1YNXA 4O0AA 1XMQL 4A3GG 1GKHA 3PUXA 4AYBE 3PIOA 1KRSA 1VQ6A 3S15H 4X66Q 4HIDA 4DV5Q 1Q7YC 2UUAL 2CCZA 4LWCA 4A3DH 1K8GA 4HJ8A 1IBLQ 4AH6A 1VQ4A 4JI5Q 3GO5A 1HNWL 4HJ5A 4LFCL 3S24A 3S1MH 4GLAC 1I94Q 1Q46A 3T1HQ 1S3OA 4IFDI 1SRUA 1Z9FA 2VQFL 2IT1A 3GTPH 1JE5A 4X65L 4LF5L 4DUZL 4RG1A 4PZ7A 2ATWA 1N8RC 2WFWA 1VQGA 4HJAA 4A3DG 4B3SQ 2Q2IA 2F4VL 5GAGC 5C44H 1HNXQ 3RZOH 4DR4Q 2QEXA 5IP7H 1EQRA 4ME3A 1B7YB 4B3RQ 2JEBI 1A62A 2BH8A 3HKSA 3U4ZA 4P75A 3ULPA 1YJ9A 1PH9A 3UE0A 3F2BA 1QVCA 1K83H 3KDFA 4AQYQ 1HZ9A 5ELNA 1VCIA 2JA6H 4X62Q 3PGZA 4DR2Q 4UP7A 1VQBA 5JEAJ 4B3MQ 1X9NA 1CKNB 1MKHA 4JI1Q 5C44G 1V1QA 1GO3E 5IP7G 4O2DA 4DR6L 1EQQA 3GTKH 4LUZA 1V9PA 3HFZB 1VQIA 3NEMA 4JCVE 2HHHQ 2UUAQ 3GD7A 1D8LA 1K0RA 2UUCL 4B3TL 2R92H 1KRTA 1HNWQ 1L1OB 3ICEA 1EOVA 3JC66 2HIXA 4GS3A 1Z47A 4LFCQ 2JA6G 1XNQQ 5M5YH 4BY1H 5LMUQ 3CQZH 1GM5A 1QVFA 1O7IA 2NVQH 1I6HH 4IPCA 1NMGA 1JJGA 1YHQA 2UXBQ 3BJUA 4LF5Q 1UE7A 3CMAA 4LW1A 4DUZQ 1LYLA 3KJPA 3HOVH 3S14H 4IFDG 2R92G 3A5ZB 5C4XH 4A3CH 4QQBX 1G6PA 4L5SA 4DV2L 2F4VQ 3J81j 2K4KA 3OTOL 4BY1G 3J80i 3I4MH 4A3LG 4LFBQ 1Y1WG 4DR1Q 1WYDA 3SGIA 2XGTA 4YCVA 3EN2A 3KF8B 1QZHA 3S1RH 2KBNA 3HOVG 1E3PA 5GAHC 3VDYA 2NVTH 4A3CG 1YHAA 1L1OC 5C4XG 4YHHL 3M7NA 1AE2A 2UXCL 2WB1E 4APVA 4JV5Q 2JJQA 3RZDH 1YI2A 3F8TA 4TVAB 4DR6Q 3EBEA 1HNZL 3I4MG 4GLXA 2IHEA 2GN5A 3FKIG 3KF6B 4YWMA 3GTOH 3HOUG 1EUJA 2RF4A 1LM0A 4DV0L 2LSSA 3PCOB 1BBUA 1LTLA 1SE8A 2AWNA 5GAEC 3KJOA 3CC7A 2WAQG 1DGSA 4KHZA 2E2HH 3T1YL 1N34L 4OONA 1SLJA 2JE6I 3LGJA 2L15A 1OXUA 3JAMi 4JBKA 2N8NA 4Y7NH 1YJWA 2ID0A 2I0QA 2IX0A 2JA8H 4X66L 2LXJA 3A74A 3TEHB 1PH2A 4DV5L 1V43A 1A63A 1JJ2A 2OWOA 1E22A 1W2BA 3HOWH 4QGUA 1WI5A 4DV2Q 1IBLL 4JI5L 1FVIA 1VQJA 1TWGH 5IT9c 1JMCA 1JT8A 2C35B 2MO0A 4A4IA 3GDEA 5IE8A 5M5XH 1I94L 1XTDA 3T1HL 4DKAC 3PF5A 2ES2A 1CKNA 4JI0L 2UXDQ 4A75A 5JEAG 1XMOQ 2JA8G 4HJ9A 1E1TA 3CD6A 1M1KC 3S1QH 4DV7L 4DV1Q 3HOYG 4YWLA 5H1SE 3CPWA 1HH2P 4UY8C 4A3GH 3HOWG 1L1OA 2N78A 4B3SL 2HT1A 1HNXL 3CC4A 1HZCA 1U0LA 4QJFA 1L2FA 1IL2A 5ELOA 4EQ5A 4B3RL 4DUYQ 4P74A 3DLLA 1IBKQ 1OXTA 4GNXB 2AWOA 1ASYA 4A3BH 2QGQA 3K7AH 4DV0Q 4AQYL 1YEZA 3RLNA 1RL2A 4DR2L 4A3FG 5C3EH 4B3ML 1NTGA 4JC0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PZ8 A;  1L0W A;  4MNO A;  3K0X A;  3OYY A;  4JI1 L;  4UP9 A;  3CW2 C;  2IX1 A;  4DNI A;  2MO1 A;  1TWH H;  2B3G A;  1QVG A;  1U5K A;  4BBS G;  1TWA H;  2HHH L;  3I7F A;  5LMN Q;  3F2C A;  3GTL H;  4A3B G;  2PMZ E;  2IY5 B;  3M4O H;  1G51 A;  1CUK A;  1VQ7 A;  2WAQ E;  5IYB H;  3J81 i;  1B70 B;  1A0I A;  2K5N A;  1XNQ L;  4POF A;  5LMU L;  3CCS A;  1PH5 A;  5C3E G;  4JI0 Q;  1PA6 A;  3H3V I;  1R9T H;  3CPF A;  2D0P A;  3STB D;  2UXB L;  1W3S A;  4IOA A;  2ZTD A;  4QL5 A;  3ER0 A;  1BVS A;  4DV7 Q;  3AFP A;  3G6E A;  3PO2 G;  3HKZ G;  2OQK A;  2VL6 A;  2VS1 A;  3W1G A;  5IYB G;  3J81 c;  3FHW A;  2WB1 G;  4H02 A;  5C0X J;  2E2J H;  3A5U A;  4C2M H;  3L2P A;  3M85 A;  1KIX A;  4DR1 L;  1OXS C;  4P73 A;  3J7A 5;  1YBY A;  4KI0 A;  3RLO A;  1B8A A;  4OO1 I;  4A3E H;  1TXY A;  2YTX A;  2JA9 A;  2Z6K A;  4DV4 Q;  2K5V A;  2ZM6 Q;  3S17 H;  1UWV A;  1YIT A;  2K5H A;  3K7U C;  2B29 A;  2MNA A;  2RHQ B;  3G48 A;  1PYB A;  3CCL A;  1I3Q H;  4BA1 I;  4JV5 L;  2KCT A;  2MQH A;  4EX5 A;  1VQF A;  2I5H A;  5HY6 A;  3G4S A;  4BA2 I;  4LFB L;  1C0A A;  4HIM A;  3U58 A;  4PZ6 A;  4A3E G;  1E24 A;  3I55 A;  4GOP B;  4A3L H;  1M90 C;  1NY4 A;  4IO9 A;  1Y1W H;  5C0X I;  1PH7 A;  2E2I H;  1XNR Q;  3M3Y H;  4JI8 Q;  2CFM A;  3KLW A;  1XPR A;  4IJL A;  2EXD A;  3BZC A;  4GNX A;  1XPU A;  3I4N H;  2PQA B;  1Q81 C;  4IJH A;  3DM3 A;  1PH1 A;  1XJV A;  4JBJ A;  4TQU S;  1TWF H;  3UE1 A;  4MZ9 A;  1NJI C;  2R7F A;  4ALP A;  3RN5 A;  2UXD L;  3PIP A;  3FKI H;  1VQH A;  1Q1B A;  2K14 A;  3NEN A;  5LMN W;  1XMO L;  3HOU H;  3PUW A;  2ZJR A;  1KL9 A;  1MJC A;  3CCU A;  2RHS B;  3HOZ G;  4JI7 L;  2LXK A;  3HKZ E;  3PV0 A;  4DV1 L;  3I4N G;  1X56 A;  2BH2 A;  1K73 C;  4OO1 G;  1SRO A;  1JJC B;  3CXC A;  4IPG A;  1UE6 A;  4NXN Q;  2K50 A;  2VZA A;  3TRZ A;  1VQA A;  2Y0S E;  4DUY L;  2OQ0 A;  4R4Q A;  1IBK L;  1BBW A;  4HIK A;  3CP0 A;  4J15 A;  1EIF A;  3NEL A;  1A8V A;  1CSQ A;  1X6O A;  2QA4 A;  2UUB L;  4LF6 L;  4RMF A;  4A76 A;  1EWI A;  1FL0 A;  4IOC A;  3TS0 A;  1JB7 A;  1IXR A;  4LNQ A;  4JI4 Q;  2VNU D;  3ULL A;  3AQQ A;  2ZJP A;  1SR3 A;  2VQE Q;  1X55 A;  1KQS A;  1QUQ B;  3UDF A;  4DV3 Q;  4NPS A;  1EFW A;  3WWV A;  5HGQ A;  5C0X G;  4DR5 L;  5C4J H;  3L7Z C;  3CCR A;  4P71 A;  5LMN L;  1WCM H;  4JI3 Q;  3HOY H;  1PYS B;  2YTY A;  5DLQ E;  4A3K G;  2N3S A;  1I50 H;  2GVB A;  2AMC B;  4YWK A;  4PMW A;  2MFI A;  1D7Q A;  1TWC H;  4POG A;  2GVA A;  2DGY A;  3CME A;  2WP8 J;  1J5E Q;  1GD7 A;  2UU9 L;  1OXV A;  2EQS A;  1PVO A;  4PG3 A;  1H95 A;  1GVP A;  1NE3 A;  4JI7 Q;  4A3F H;  1WCM G;  1PH6 A;  5IYD H;  4AIM A;  3W1B A;  4DAY B;  2V1C C;  1FJG Q;  3J7Z C;  1K9M C;  4LFA L;  1CKM A;  4GOP A;  1YJN A;  2CWA A;  4BBS H;  1KHI A;  5BR8 Q;  1VQL A;  1AE3 A;  1Y1V H;  4JG2 A;  3PUV A;  1C7Y A;  3KFU A;  4GN4 B;  3MXN B;  5IYC G;  2NVY H;  1UE1 A;  2OTL A;  3M9B A;  2UUB Q;  2Z6K C;  4L5R C;  4LF6 Q;  4DV4 L;  3PUY A;  4P72 A;  1X65 A;  2ZM6 L;  3S1N H;  5IYD G;  1VQE A;  2DUD A;  3CC2 A;  2PQA A;  2K52 A;  2PI2 A;  4DR3 L;  2JEA I;  3M4P A;  4GN5 A;  2Z0S A;  4FDB A;  3PSI A;  1NBW A;  2A1A A;  4DR5 Q;  1SN8 A;  2D62 A;  2ALY B;  1VQK A;  4BXX H;  1Y1V G;  1PV4 A;  4LF4 Q;  3PO2 H;  1VQ8 A;  3BZK A;  3UDX A;  1VQN A;  1Y14 B;  2JA7 H;  4K0K L;  4DV6 L;  3GTG H;  4DAM A;  4X64 L;  2EIF A;  5M3F H;  4LF7 Q;  2UU9 Q;  1N9W A;  1XNR L;  4JYA Q;  4JI8 L;  4OX9 Q;  1MIU A;  1T9H A;  3AYH B;  4GNX C;  1HR0 W;  4BXX G;  3KF6 A;  4JI6 Q;  1UEB A;  1X3E A;  2VW9 A;  4DK3 C;  3E9H A;  2YV5 A;  4LF9 Q;  4JI2 L;  3A0J A;  4LFA Q;  2NN6 I;  3S2H H;  2RCN A;  2JA7 G;  1N32 Q;  1P16 A;  3MEF A;  5FLM H;  2NVX H;  1G29 1;  5AJ3 L;  5M3F G;  2Y0S G;  2VY3 A;  5M5W H;  1QUQ A;  5K36 G;  1J6Q A;  1PH3 A;  4Y52 H;  1E1O A;  3KYH C;  4WJ3 M;  3UDG A;  1K8A C;  2YU9 H;  4GN3 B;  3CF5 A;  5JJI A;  2Q2T A;  5GRO A;  2AHO B;  2KEN A;  4UP8 A;  4DR3 Q;  1Q82 C;  4LUV A;  3CCV A;  4XIG S;  1IZ6 A;  4NXN L;  4YCU A;  5FLM G;  1NMF A;  1IYJ B;  3EIV A;  4MTN A;  3H3V H;  3RLF A;  3S2D H;  3W5O A;  4IPD A;  4DR7 Q;  5E7N A;  1HR0 L;  3I2Z A;  1VQP A;  4HIO A;  4JBM A;  4K0K Q;  4DV6 Q;  4GKJ L;  5IP9 H;  1YHB A;  4X64 Q;  4YY3 Q;  4JOI A;  3RR5 A;  4A3M H;  1N33 Q;  4JI4 L;  1VQ5 A;  5JJL A;  2I5M X;  4R4T A;  4XTC S;  4KLK A;  3G71 A;  2VQE L;  1LUZ A;  2VUM H;  1CSP A;  4DV3 L;  4QIW E;  4KHP Q;  1AH9 A;  1EYG A;  2PI2 E;  4NXM Q;  3HOZ H;  1HJP A;  3K80 C;  1XMQ Q;  4JI3 L;  3F2D A;  3K8A A;  4BY7 H;  3NBH B;  4C3J H;  4JI2 Q;  1FGU A;  2E5L L;  1X3G A;  1WOC A;  1KD1 C;  5JJK A;  2KHI A;  1X3F A;  5IP9 G;  4A3I H;  1IBM L;  4A3M G;  3STB C;  3PO3 H;  5AJ3 Q;  2R6G A;  2NN6 G;  2XTI A;  3CCM A;  3ULJ A;  1CKO A;  3I4O A;  1J5E L;  2VUM G;  3BU2 A;  2PNH A;  3PUZ A;  5GQO A;  4L5T A;  2YTV A;  4QY7 A;  3U4V A;  1XPO A;  4NB3 A;  2VQF Q;  3ZJY C;  4BY7 G;  4R4I A;  1S40 A;  3F1Z A;  4X65 Q;  5IWA L;  1FJG L;  1UE5 A;  1SFO H;  1PH4 A;  1EIY B;  4GOP C;  4YCW A;  2NZO A;  1ASZ A;  4A3I G;  1C9O A;  1YZ6 A;  5FJ8 H;  2HQL A;  1VS0 A;  5BR8 L;  2JA5 H;  3PO3 G;  2JQO A;  1KXL A;  1X54 A;  2ZTC A;  4GLV B;  4OXP A;  4A3K H;  2CWP A;  3RN2 A;  4JBW A;  2KCM A;  1QZG A;  1HR0 Q;  2JK8 A;  3AEV A;  3KOJ A;  4GKJ Q;  3M4Q A;  2R7Z H;  4X6A H;  1Q1E A;  2R7D A;  2OCE A;  4LF8 L;  1VQO A;  1RIP A;  5M3M H;  2F3I A;  3I56 A;  4R1J A;  4HJ7 A;  5GAD C;  1VQ9 A;  5EAY A;  1YVC A;  3UDI A;  2Q2U A;  2BA0 A;  1SMX A;  5FJ8 G;  1MJE A;  3OW2 A;  2JA5 G;  2AKW B;  3K81 C;  4LF4 L;  1N36 L;  1KAW A;  3GTM H;  4GKK L;  3FP9 A;  4AYB G;  2E5L Q;  2OTJ A;  3TS2 A;  3AFQ A;  5J3B A;  3CCE A;  3J80 c;  2F52 A;  1IBM Q;  2D0O A;  4B3T Q;  2R7Z G;  2UUC Q;  2A8V A;  1VQD A;  3TRE A;  2YYZ A;  3D31 A;  4LF7 L;  4JYA L;  5M3M G;  4A3J H;  5IYC H;  4OX9 L;  4DK6 C;  4A93 H;  4C3H H;  2E8G A;  2ZJQ A;  1Q86 C;  4JI6 L;  1E7Z A;  2A19 A;  3KDF B;  3L0O A;  1I5F A;  3U50 C;  4C3I H;  1PHJ A;  5IWA Q;  4LF9 L;  3PF4 A;  1WJJ A;  3CCQ A;  3HOX H;  1N32 L;  3D0F A;  4OWX B;  3ERS X;  2Q2H A;  1VQC A;  3H15 A;  2ZTE A;  2B63 H;  3RNU A;  3S16 H;  3Q8D A;  4R4O A;  1Q8K A;  2HIV A;  3OTO Q;  4A3J G;  2R93 H;  1HZA A;  2N49 A;  4A93 G;  1Q12 A;  1HZB A;  1OXX K;  2FXQ A;  3E0E A;  4LUO A;  3CCJ A;  2H5X A;  4BBR H;  1YIJ A;  3JAM c;  3H0G H;  4OWW B;  4LF8 Q;  5IY0 A;  1S72 A;  3HOX G;  2NZH A;  2KHJ A;  1BKB A;  2I5L X;  2BA1 A;  4WJ4 A;  2CKZ B;  4YHH Q;  2B63 G;  1KC8 C;  1N36 Q;  2IHF A;  4DR4 L;  2UXC Q;  4IPH A;  4GKK Q;  3IRB A;  3B6Y A;  1PH8 A;  4DR7 L;  4IFD J;  2R93 G;  1K3R A;  3CAM A;  3E9I A;  2K75 A;  1VQM A;  4UPA A;  1P8L A;  1HNZ Q;  3GTJ H;  4JOI C;  4DPG A;  4BBR G;  5FLX c;  1OTC A;  4YY3 L;  1WFQ A;  1N33 L;  2CQO A;  3H0G G;  1PFS A;  2ASB A;  4OWT B;  3GTQ H;  4KHP L;  4X62 L;  3T1Y Q;  4R4C A;  4L5Q A;  1N34 Q;  4NXM L;  3TQY A;  1YNX A;  4O0A A;  1XMQ L;  4A3G G;  1GKH A;  3PUX A;  4AYB E;  3PIO A;  1KRS A;  1VQ6 A;  3S15 H;  4X66 Q;  4HID A;  4DV5 Q;  1Q7Y C;  2UUA L;  2CCZ A;  4LWC A;  4A3D H;  1K8G A;  4HJ8 A;  1IBL Q;  4AH6 A;  1VQ4 A;  4JI5 Q;  3GO5 A;  1HNW L;  4HJ5 A;  4LFC L;  3S24 A;  3S1M H;  4GLA C;  1I94 Q;  1Q46 A;  3T1H Q;  1S3O A;  4IFD I;  1SRU A;  1Z9F A;  2VQF L;  2IT1 A;  3GTP H;  1JE5 A;  4X65 L;  4LF5 L;  4DUZ L;  4RG1 A;  4PZ7 A;  2ATW A;  1N8R C;  2WFW A;  1VQG A;  4HJA A;  4A3D G;  4B3S Q;  2Q2I A;  2F4V L;  5GAG C;  5C44 H;  1HNX Q;  3RZO H;  4DR4 Q;  2QEX A;  5IP7 H;  1EQR A;  4ME3 A;  1B7Y B;  4B3R Q;  2JEB I;  1A62 A;  2BH8 A;  3HKS A;  3U4Z A;  4P75 A;  3ULP A;  1YJ9 A;  1PH9 A;  3UE0 A;  3F2B A;  1QVC A;  1K83 H;  3KDF A;  4AQY Q;  1HZ9 A;  5ELN A;  1VCI A;  2JA6 H;  4X62 Q;  3PGZ A;  4DR2 Q;  4UP7 A;  1VQB A;  5JEA J;  4B3M Q;  1X9N A;  1CKN B;  1MKH A;  4JI1 Q;  5C44 G;  1V1Q A;  1GO3 E;  5IP7 G;  4O2D A;  4DR6 L;  1EQQ A;  3GTK H;  4LUZ A;  1V9P A;  3HFZ B;  1VQI A;  3NEM A;  4JCV E;  2HHH Q;  2UUA Q;  3GD7 A;  1D8L A;  1K0R A;  2UUC L;  4B3T L;  2R92 H;  1KRT A;  1HNW Q;  1L1O B;  3ICE A;  1EOV A;  3JC6 6;  2HIX A;  4GS3 A;  1Z47 A;  4LFC Q;  2JA6 G;  1XNQ Q;  5M5Y H;  4BY1 H;  5LMU Q;  3CQZ H;  1GM5 A;  1QVF A;  1O7I A;  2NVQ H;  1I6H H;  4IPC A;  1NMG A;  1JJG A;  1YHQ A;  2UXB Q;  3BJU A;  4LF5 Q;  1UE7 A;  3CMA A;  4LW1 A;  4DUZ Q;  1LYL A;  3KJP A;  3HOV H;  3S14 H;  4IFD G;  2R92 G;  3A5Z B;  5C4X H;  4A3C H;  4QQB X;  1G6P A;  4L5S A;  4DV2 L;  2F4V Q;  3J81 j;  2K4K A;  3OTO L;  4BY1 G;  3J80 i;  3I4M H;  4A3L G;  4LFB Q;  1Y1W G;  4DR1 Q;  1WYD A;  3SGI A;  2XGT A;  4YCV A;  3EN2 A;  3KF8 B;  1QZH A;  3S1R H;  2KBN A;  3HOV G;  1E3P A;  5GAH C;  3VDY A;  2NVT H;  4A3C G;  1YHA A;  1L1O C;  5C4X G;  4YHH L;  3M7N A;  1AE2 A;  2UXC L;  2WB1 E;  4APV A;  4JV5 Q;  2JJQ A;  3RZD H;  1YI2 A;  3F8T A;  4TVA B;  4DR6 Q;  3EBE A;  1HNZ L;  3I4M G;  4GLX A;  2IHE A;  2GN5 A;  3FKI G;  3KF6 B;  4YWM A;  3GTO H;  3HOU G;  1EUJ A;  2RF4 A;  1LM0 A;  4DV0 L;  2LSS A;  3PCO B;  1BBU A;  1LTL A;  1SE8 A;  2AWN A;  5GAE C;  3KJO A;  3CC7 A;  2WAQ G;  1DGS A;  4KHZ A;  2E2H H;  3T1Y L;  1N34 L;  4OON A;  1SLJ A;  2JE6 I;  3LGJ A;  2L15 A;  1OXU A;  3JAM i;  4JBK A;  2N8N A;  4Y7N H;  1YJW A;  2ID0 A;  2I0Q A;  2IX0 A;  2JA8 H;  4X66 L;  2LXJ A;  3A74 A;  3TEH B;  1PH2 A;  4DV5 L;  1V43 A;  1A63 A;  1JJ2 A;  2OWO A;  1E22 A;  1W2B A;  3HOW H;  4QGU A;  1WI5 A;  4DV2 Q;  1IBL L;  4JI5 L;  1FVI A;  1VQJ A;  1TWG H;  5IT9 c;  1JMC A;  1JT8 A;  2C35 B;  2MO0 A;  4A4I A;  3GDE A;  5IE8 A;  5M5X H;  1I94 L;  1XTD A;  3T1H L;  4DKA C;  3PF5 A;  2ES2 A;  1CKN A;  4JI0 L;  2UXD Q;  4A75 A;  5JEA G;  1XMO Q;  2JA8 G;  4HJ9 A;  1E1T A;  3CD6 A;  1M1K C;  3S1Q H;  4DV7 L;  4DV1 Q;  3HOY G;  4YWL A;  5H1S E;  3CPW A;  1HH2 P;  4UY8 C;  4A3G H;  3HOW G;  1L1O A;  2N78 A;  4B3S L;  2HT1 A;  1HNX L;  3CC4 A;  1HZC A;  1U0L A;  4QJF A;  1L2F A;  1IL2 A;  5ELO A;  4EQ5 A;  4B3R L;  4DUY Q;  4P74 A;  3DLL A;  1IBK Q;  1OXT A;  4GNX B;  2AWO A;  1ASY A;  4A3B H;  2QGQ A;  3K7A H;  4DV0 Q;  4AQY L;  1YEZ A;  3RLN A;  1RL2 A;  4DR2 L;  4A3F G;  5C3E H;  4B3M L;  1NTG A;  4JC0 A; 
#chains in the Genus database with same CATH topology
 4PZ8 A;  1SNP A;  2B8F A;  3K0X A;  5EBD A;  3CW2 C;  3BDC A;  1QVG A;  1U5K A;  3GTL H;  2HQE A;  2WAQ E;  2RA4 A;  3J81 i;  1XNQ L;  3CCS A;  1B9N A;  2KQ3 A;  1R9T H;  2UXB L;  1W3S A;  2AUJ D;  2FMC A;  1F2Y A;  2NTT A;  3AFP A;  3K58 A;  5DAU A;  3J81 c;  4H02 A;  2E2J H;  5C4Z A;  3SXH A;  1LTI D;  4DR1 L;  4P73 A;  4K6D A;  1BDO A;  1B4O A;  4NMZ A;  1B8A A;  1NUC A;  4A3E H;  1TXY A;  2YTX A;  3FVQ A;  2MPM A;  5I6W A;  5IGF A;  2F0L A;  5NUC A;  2B29 A;  4IUR A;  4CKB A;  2MNA A;  2MP1 A;  1I3Q H;  3KK7 A;  4JV5 L;  1VQF A;  5C6A A;  3EJI A;  3K5M A;  1UUP A;  2L0C A;  2F0K A;  4HCE A;  3I55 A;  5JVH 3;  4GOP B;  2QF7 A;  1EY5 A;  1PH7 A;  5FK9 C;  3DMU A;  1X3Q A;  3K59 A;  1XPR A;  5A2Q L;  4J6H A;  2D5D A;  2EXD A;  4GNX A;  1XPU A;  1HA5 A;  4HR7 B;  4QIW B;  2PQA B;  4IJH A;  2PO4 A;  4HMJ A;  3I4L A;  1LTG D;  1PZJ D;  4MZ9 A;  4RGT A;  2K14 A;  1UNS A;  4ZAI A;  1MD2 D;  3PUW A;  2HDM A;  3TSS A;  2RHS B;  5ELE A;  5D65 A;  1EIG A;  1QE6 A;  4JI7 L;  3C46 A;  4OO1 G;  1JJC B;  2K7V A;  4IPG A;  2K50 A;  3I8Z A;  2OQ0 A;  1IBK L;  3GTJ B;  4P2C B;  1EIF A;  3VR2 A;  1CTM A;  1V1P A;  1SYB A;  1G91 A;  5M3F B;  1I6V C;  2UUB L;  2XWB B;  4RMF A;  3TS0 A;  4JI4 Q;  3ULL A;  2ZJP A;  2VXW A;  1X55 A;  3DWP A;  4DV3 Q;  2K5D A;  2K28 A;  4DR5 L;  3ITP A;  5C4J H;  3S15 B;  1GHJ A;  1STY A;  1PYS B;  2L11 A;  4A3K G;  3MTS A;  1CZW A;  1D7Q A;  2MFI A;  2EY5 A;  5M5W B;  4POG A;  2GVA A;  2DGY A;  1R4Q B;  4RCN A;  1HQM C;  2UU9 L;  1LTA D;  1OXV A;  2RBM A;  1U4P A;  1JWS D;  1AZQ A;  1GVP A;  5IYD H;  3NQT A;  3W1B A;  4DAY B;  1WTX A;  4LFA L;  1CKM A;  3H6M A;  1FYC A;  4BBS H;  1U4M A;  2CWA A;  1KHI A;  3ZYY X;  4UHV A;  3AMU A;  5J39 A;  1STG A;  1PMR A;  1QWY A;  5A35 A;  2I07 B;  2IW3 A;  1ESR A;  1KLU D;  2PI2 A;  2GA4 B;  4BY7 B;  4FDB A;  2D2C C;  1NBW A;  1SN8 A;  1TII D;  2ALY B;  1VQK A;  4BXX H;  1PV4 A;  3UDX A;  3A55 A;  1VQN A;  1B3Q A;  1BF4 A;  4X64 L;  3KLS A;  5M5Y B;  3QOL A;  2EIF A;  2K05 A;  3CQZ B;  3ERQ A;  1U4L A;  4OX9 Q;  1PFM A;  2ENB A;  1K8M A;  3I72 A;  4N9T A;  3SK4 A;  4JI6 Q;  1S5E D;  4DK3 C;  3E9H A;  4LF9 Q;  2RCF A;  2JA7 G;  2BOS A;  3MEF A;  3MFY A;  1G8Z D;  3R2T A;  2VY3 A;  3VR3 A;  3IAY A;  5K36 G;  4J8Q A;  1E1O A;  5FO8 B;  3J80 E;  1K8A C;  2YU9 H;  2OT2 A;  4GN3 B;  1WTW A;  1WVL A;  1Q82 C;  4LUV A;  4OEL B;  3Q24 A;  2SNM A;  3T4A C;  2ICE C;  4FP5 D;  2Q8I B;  3RZD B;  3H3V H;  4ME5 A;  1GOZ A;  4CJ1 B;  3W5O A;  3GTO B;  4DAV A;  5E7N A;  2EZV A;  1KAB A;  2EYP A;  1VQP A;  4ULL A;  4K0K Q;  4GKJ L;  1PRT F;  4YY3 Q;  4A3M H;  4JI4 L;  2VUM H;  3G71 A;  4K5X A;  4G7H C;  2XRS D;  4DV3 L;  4KHP Q;  1IHZ A;  3VYS A;  3K8A A;  3JAM E;  1A2U A;  2B2U C;  2E5L L;  5EGT A;  2D9U A;  1EY7 A;  2NBF A;  1KD1 C;  4A3I H;  2F0J A;  3PO3 H;  3U9S A;  3CCM A;  2NN6 G;  3ULJ A;  3I4O A;  4XYQ A;  4BBR B;  3BU2 A;  5GQO A;  2YTV A;  5C3W A;  3F1Z A;  5COR A;  1UE5 A;  1QIL A;  1EIY B;  1IKM A;  1CK1 A;  4YCW A;  1ASZ A;  2WV6 D;  3FPP A;  3J7A V;  2JQO A;  1EQT A;  4JBW A;  1QZG A;  3AEV A;  2R7Z H;  4G7Z C;  1ICW A;  1Q1E A;  5EPJ A;  3GTQ B;  3D4D A;  4LF8 L;  3HG9 A;  5M3M H;  1SNM A;  1G2S A;  4KD3 A;  2Q2U A;  5ELF A;  5KYI A;  5FJ8 G;  3FDT A;  1B1Z A;  3K81 C;  1N36 L;  1TWA B;  3SHL A;  3GTM H;  4AYB G;  3AFQ A;  4A3D B;  2LS0 1;  1BCP C;  2D0O A;  2WB1 B;  2UUC Q;  4F8M A;  3HRZ C;  3LNN A;  3NPP A;  4OX9 L;  5KEE A;  4DK6 C;  3J81 E;  1JE4 A;  2E8G A;  4JI6 L;  3KUP A;  1E7Z A;  2A19 A;  1I5F A;  4LF9 L;  3PIP 3;  3QR8 A;  1WJJ A;  3CCQ A;  3HOX H;  1C8C A;  3D0F A;  1BOS A;  1H9S B;  5BN5 A;  1VQC A;  4HSV A;  2ZTE A;  5ELD A;  3Q8D A;  4R4O A;  3OTO Q;  1K28 A;  3M4Y A;  5CV4 A;  2DJG C;  1OXX K;  3E0E A;  3URY A;  1V8Q A;  2EE1 A;  2IL8 A;  2FMM A;  3X3M A;  2IWH A;  4OWW B;  5IY0 A;  3S17 B;  2IPK D;  1QB5 D;  1BKB A;  1LTT D;  4ZK9 B;  2I5L X;  2BA1 A;  3GTK B;  1EEF D;  3WOF A;  2LY7 A;  3DM1 A;  4F7X A;  2PNR C;  2P5Z X;  4GKK Q;  4DK0 A;  2CHB D;  2F0U A;  1NSN S;  1VQM A;  3SK6 A;  4C56 C;  4YY3 L;  1JOK A;  3H0G G;  3VR6 A;  2NVQ B;  5CGK A;  4UAI A;  4KHP L;  3E0J A;  3T1Y Q;  1YNX A;  4DXF A;  4A3G G;  1DOK A;  4B9X A;  3PIO A;  3HOV B;  3I90 A;  1KRS A;  3S14 B;  1GHK A;  4DV5 Q;  2MGS A;  4V19 0;  4LJZ C;  1SNO A;  2EVB A;  3S1R B;  5E1F A;  2IT1 A;  1JR0 D;  1JE5 A;  3MWY W;  2NVT B;  5I2X A;  4RG1 A;  3N52 A;  1FR3 A;  2BE5 C;  1ZXT A;  5CV5 A;  3MXG A;  2WFW A;  2Q2I A;  1ZEQ X;  1EQR A;  1H9K A;  4ME3 A;  2JEB I;  1A62 A;  2BH8 A;  2OWO A;  2PZU A;  2G9D A;  3UE0 A;  3F2B A;  3KDF A;  4H44 C;  4K8I A;  3EFX D;  2EXZ A;  2NTS A;  1VF7 A;  1EY9 A;  4X62 Q;  3PGZ A;  3NBI A;  1RD9 D;  1CKN B;  2Z9H A;  4JI1 Q;  1GO3 E;  1WCM B;  4O2D A;  4DR6 L;  2HHH Q;  1V9P A;  3HFZ B;  3NEM A;  4JCV E;  2UUA Q;  1D8L A;  1K0R A;  1PTO F;  2UUC L;  5KNB A;  1EOV A;  3EVQ A;  1SYC A;  1SYD A;  1CA6 A;  3JAM L;  1J9O A;  2B2Y C;  3SK5 A;  4A3F B;  2CH4 W;  1JJG A;  1HRJ A;  4N9P A;  4LF5 Q;  4QMG A;  4DUZ Q;  4LW1 A;  4OIJ A;  1HTP A;  4XQN A;  2E75 C;  3U9O A;  3J81 j;  4MN3 A;  1Y1V B;  3OTO L;  3I4M H;  2B2T C;  3FPU B;  5JJZ A;  1WYD A;  4RKL A;  2XGT A;  3NXW A;  4YCV A;  1QZH A;  3S1N B;  1U4R A;  4KKT A;  1E3P A;  1F77 A;  3C1F A;  2J7Z A;  1AE2 A;  3F8T A;  1ILP A;  4GLX A;  2M2L A;  2IHE A;  2GN5 A;  1O78 A;  1S5B D;  1BBU A;  2Y0S B;  1AFP A;  4KHZ A;  1DGS A;  4JVZ A;  3T1Y L;  4RH6 A;  2K1B A;  2JE6 I;  2L15 A;  1OXU A;  1EZ8 A;  5JEA H;  4Y7N H;  2ID0 A;  3TEH B;  1IL8 A;  4DV5 L;  3S2H B;  1V43 A;  2RDG A;  1PTO B;  1QCB D;  1E22 A;  4RGN A;  3HOW H;  4QGU A;  5FOB B;  4IQZ A;  1TWG H;  5IT9 c;  1BO0 A;  2ES2 A;  4DKA C;  2UXD Q;  2EJF C;  1XMO Q;  1EY6 A;  4MHE A;  1SE2 A;  5EKK A;  1JWM D;  3S1Q H;  1C4Q A;  3PMF A;  2F03 A;  1L1O A;  2HT1 A;  2F0G A;  2EDG A;  4DA2 A;  3CC4 A;  3S2D B;  2L55 A;  3NSW A;  1L2F A;  4EQ5 A;  3LX0 A;  1OXT A;  4GNX B;  4A3B H;  4F87 A;  2PQE A;  2QGQ A;  3K7A H;  4DV0 Q;  3J7Y W;  2N88 A;  2EYM A;  2I46 A;  2RDF A;  5C3E H;  1NTG A;  4JI1 L;  3OMC A;  4PNY A;  3MAQ A;  2IX1 A;  2PZT A;  2MO1 A;  1HUN A;  4BBS G;  2HHH L;  3I7F A;  5LMN Q;  2X69 A;  1CI3 M;  2K33 A;  3NE5 B;  2PMZ E;  2IY5 B;  2E76 C;  1XYI A;  5IYB H;  1B70 B;  1PA6 A;  3CPF A;  3DWQ A;  1V1P B;  1SEB D;  2ZTD A;  4Z9C B;  3HZX A;  3G6E A;  1DM0 B;  5KIX A;  2WB1 G;  4A3K B;  3A5U A;  3LWU A;  3TDQ A;  2FHT A;  3M85 A;  1OXS C;  4KN7 C;  1B2T A;  1HCZ A;  3K0Y A;  3VA5 A;  2KED A;  5COY A;  2Z6K A;  4DV4 Q;  3T56 B;  2ZM6 Q;  1YIT A;  3OOC A;  5IGG A;  2A6H D;  4EX5 A;  2MQH A;  3CRL C;  5HUR A;  3G4S A;  2Z8L A;  1C0A A;  1D6E C;  3VA7 A;  4IUQ A;  4R9W A;  1HFN A;  3KLR A;  1M4V A;  1Y1W H;  2F0S A;  1KDB A;  2LFN A;  4C3H B;  3M3Y H;  2E74 C;  4DNR B;  4QUC A;  1F9P A;  5EQ0 A;  1B44 D;  3BZC A;  3K5L A;  2B63 B;  3C3L A;  4TQU S;  2K5Q A;  2A73 B;  5T1I A;  2UXD L;  3PIP A;  3FKI H;  3NEN A;  4QF4 A;  1XMO L;  2ICI A;  4MIU A;  1E2Z A;  5EPL A;  3PV0 A;  3HKZ E;  3I4N G;  2L12 A;  1IYU A;  2BH2 A;  3T51 B;  1SRO A;  3NWS A;  4X3U A;  2A68 D;  1W6J A;  2DY7 A;  4HSP A;  1BNZ A;  1KDC A;  5DM7 3;  1VMP A;  2Z1C A;  3NEL A;  1ENA A;  3OWE B;  1TS5 A;  4FXD A;  4LF6 L;  4A76 A;  1FL0 A;  4I7Z C;  1JB7 A;  4DU9 A;  2VNU D;  3QOJ A;  4NPS A;  3VYU A;  4CDD C;  5HGQ A;  5C0X G;  4JI3 Q;  3CCR A;  5LMN L;  1YNN D;  4LAA A;  2YTY A;  5DLQ E;  1I50 H;  1LT6 D;  1O7Z A;  1GUG A;  1X3P A;  4DXG A;  1TWC H;  4BS9 A;  2H4O A;  2ZXR A;  1KLG D;  5C3X A;  1DOL A;  4OEM B;  1AN8 A;  2EPB A;  3BDO A;  4JI7 Q;  2A69 D;  1WCM G;  2V1C C;  1IKL A;  1K9M C;  3SR1 A;  1I4P A;  3BZD B;  4U68 A;  5BR8 Q;  1VQL A;  1AE3 A;  1C7Y A;  4FYD A;  4WFN 3;  4GN4 B;  4V0B A;  4ZRZ A;  3H94 A;  2PW5 A;  2UUB Q;  2LMC B;  4DV4 L;  4P72 A;  1STE A;  2ZM6 L;  2R61 A;  4DR3 L;  3VYT A;  4K14 A;  1PFB A;  3PSI A;  4DR5 Q;  2D62 A;  1Y1V G;  2PYK A;  2F0N A;  3PO2 H;  1MBY A;  1STH A;  4JPB W;  3S1M B;  1I4X A;  1D5M C;  3BZK A;  3QJY A;  3L9A X;  3Q22 A;  5DNF A;  5KRU A;  2EOT A;  4DV6 L;  1SYG A;  4IAL A;  3GV3 A;  5M3F H;  2UU9 Q;  1HFG A;  4JYA Q;  1HHV A;  2KCC A;  1I6H B;  2NYZ D;  3SE0 A;  1UEB A;  2VW9 A;  4JI2 L;  1GUS A;  4LFA Q;  4M8A A;  3GP7 A;  4AYB B;  4N8X 1;  1TVX A;  1JWU D;  5AJ3 L;  2Y0S G;  5I6Y A;  3NUC A;  5M5W H;  1QUQ A;  1J6Q A;  1SYF A;  2AQ3 B;  3KYH C;  4WJ3 M;  4FF3 A;  5JJI A;  1GXD C;  2Q2T A;  2AHO B;  4UP8 A;  4XIG S;  4YCU A;  1EYA A;  1KNE A;  1JQY D;  4XQJ A;  1OO9 B;  5FLM G;  1NMF A;  4MTN A;  3RLF A;  5IGD A;  4IPD A;  1HXY D;  5IOC A;  4FF1 A;  1HR0 L;  1EOT A;  4B08 A;  3PIO 3;  1DZ1 A;  2XSC A;  1PZI D;  4X64 Q;  2QW7 A;  4JOI A;  3RR5 A;  1VQ5 A;  2I5M X;  4XTC S;  5CV9 A;  4Q5V A;  1LUZ A;  4IN3 A;  2RDH A;  4QIW E;  3VYR A;  2QDL A;  5IT9 E;  1EYG A;  4NXM Q;  3HOZ H;  1XMQ Q;  1D5X C;  4JI3 L;  3F2D A;  4BY7 H;  4C3J H;  4E6I A;  1X3G A;  2KHI A;  5IP9 G;  3STB C;  2XTI A;  3I91 A;  2PNH A;  3H0G B;  3PUZ A;  2IX3 A;  4L5T A;  2C9O A;  2RQX A;  2VQF Q;  2J0T D;  4R4I A;  1S40 A;  5FLX E;  3R2I A;  4X65 Q;  5IWA L;  1SFO H;  1PH4 A;  4A3G B;  4GOP C;  1EY4 A;  4IUP A;  2NZO A;  1C9O A;  1QJO A;  1YZ6 A;  5BR8 L;  1X54 A;  4OXP A;  4IUT A;  3OWF A;  3RN2 A;  4ID6 A;  5D14 A;  1EEI D;  1K0S A;  4GKJ Q;  1LAC A;  1VQO A;  2EYJ A;  4F88 A;  1TQO A;  4KY5 A;  3UI2 A;  1SAP A;  1TT2 A;  1YVC A;  3C2P A;  2BA0 A;  1SMX A;  2JA5 G;  1B50 A;  1PTO D;  4FF4 A;  3GTL B;  2E5L Q;  2OTJ A;  3TME A;  3CCE A;  3KBG A;  5BN3 A;  1WTO A;  2YYZ A;  4JYA L;  4A3J H;  3NWT A;  1CHP D;  5IYC H;  1R9T B;  4A93 H;  3TP8 A;  3KDF B;  3PF4 A;  4C3I H;  3RZO B;  4OWX B;  3ERS X;  2Q2H A;  3H15 A;  3MHB A;  5LL6 S;  4KHV A;  2E2J B;  3RNU A;  3S16 H;  2K03 A;  2R93 H;  1Q12 A;  1A3V A;  1HZB A;  2FXQ A;  4C3H G;  1YIJ A;  2H5X A;  4BBR H;  4LF8 Q;  2KHJ A;  3MC0 B;  4XQQ A;  5FO9 B;  1I3Q B;  4WJ4 A;  4YHH Q;  2B63 G;  1KC8 C;  1N36 Q;  3IRB A;  3B6Y A;  1P8L A;  2B2V A;  5I9P A;  1WTH A;  1SNC A;  4EQN A;  2ASB A;  4HCS A;  4OWT B;  4QUF A;  3GTQ H;  1N34 Q;  4NXM L;  3TQY A;  4EQP A;  1XMQ L;  1GKH A;  3MVV A;  3DEO A;  4HAE A;  3SEB A;  1Q7Y C;  4LWC A;  4HN7 A;  4A3D H;  1K8G A;  1JOQ A;  2HCI A;  1IBL Q;  4AH6 A;  1HNW L;  4ODG A;  4UDU C;  4LFC L;  3S24 A;  3M7G A;  1S3O A;  2VQF L;  4X65 L;  2K32 A;  1Z6H A;  3H09 A;  2ATW A;  1N8R C;  5TSS A;  1VQG A;  4HJA A;  4B3S Q;  1ML0 D;  2F4V L;  2QEX A;  5IP7 H;  2F0O A;  4B3R Q;  3ULP A;  3IFD A;  1K83 H;  1LTS D;  3R3O A;  3HP3 A;  5ELN A;  1EL0 A;  3GQB A;  5FO7 B;  2JA6 H;  3NK9 A;  4DR2 Q;  1DON A;  1VQB A;  4RHS A;  4XXE A;  1XXG A;  5C44 G;  5C4J B;  4R8N A;  1FD7 D;  3GTK H;  5KGU A;  1VQI A;  1KRT A;  3T16 A;  1L1O B;  4OHJ A;  2HIX A;  1O7L A;  2R3Z A;  3BVG A;  5CV8 A;  4BY1 H;  1CQV A;  5LMU Q;  5E4W C;  3IFT A;  1QVF A;  1O7I A;  2NVQ H;  3OMG A;  1YHQ A;  3BJU A;  1LT4 D;  3CMA A;  1IW7 D;  1DD2 A;  2TSS A;  4XDX A;  3HOV H;  4IFD G;  3S14 H;  1AEX A;  3DUZ A;  2R92 G;  3A5Z B;  5C4X H;  1SYE A;  1G6P A;  4L5S A;  4BBS B;  4WOR A;  2K4K A;  1EY8 A;  1EYC A;  1Y1W G;  2EYH A;  2A6H C;  1V1O A;  2QCP X;  1D2B A;  1Q8I A;  3SGI A;  3EN2 A;  2OF1 A;  5CR3 A;  3S1R H;  1VDZ A;  2KBN A;  1AZP A;  1SE3 A;  2WKC A;  2NVT H;  4A3C G;  1L1O C;  1TWH B;  1BUV T;  4YHH L;  2WB1 E;  4APV A;  1EYD A;  4DR6 Q;  3ERO A;  1PRT B;  4FO2 A;  3FKI G;  3KF6 B;  4YWM A;  1LM0 A;  2LSS A;  3PCO B;  2WAQ G;  2E2H H;  1N34 L;  3OSO A;  4KN4 C;  1UEA B;  4JBK A;  2N8N A;  2JA8 H;  1RDP D;  3TZU A;  1JJ2 A;  1VMC A;  5CMD A;  1WTR A;  1WI5 A;  1IBL L;  1VQJ A;  3F2U A;  2KCN A;  2EJM A;  4DAP A;  3PF5 A;  4JI0 L;  2A68 C;  2KJX A;  4DF7 A;  1PRT C;  1E1T A;  3NTH A;  4TRD A;  1M1K C;  4DV7 L;  4B3S L;  1GUT A;  4C1N I;  2F0M A;  1Q90 A;  2K04 A;  4B3R L;  4DUY Q;  4P74 A;  3DLL A;  1ASY A;  4X3K A;  4A3M B;  4NDX A;  1YNN C;  2VUM B;  1S4Z A;  2E2I B;  4DR2 L;  5JOB A;  2ZXO A;  4MNO A;  5CV6 A;  3I4N B;  1LT3 D;  3QWN A;  1MHW C;  2B3G A;  1STB A;  4NP5 A;  4FXG C;  1WTQ A;  3F2C A;  4WJW A;  1M8A A;  2CVR A;  4DNT B;  1F9S A;  1TWF B;  4A3I B;  3M4O H;  1G51 A;  1CUK A;  2X6G A;  2A69 C;  3E6Z X;  1A0I A;  5JAV A;  4POF A;  3NP8 A;  5LMU L;  1PH5 A;  2K01 A;  2BDN A;  4OIK A;  3CRK C;  1ROD A;  1AP0 A;  2D0P A;  3STB D;  4IOA A;  3RUZ A;  4DGZ A;  2OEO A;  3ER0 A;  1BVS A;  2LKV A;  4RGO S;  3PO2 G;  2VL6 A;  2XRQ D;  3J80 L;  4CHT B;  1TU2 B;  3W1G A;  4OL7 A;  3FHW A;  5C0X J;  2K5W A;  4C2M H;  3L2P A;  3J7A 5;  1YBY A;  3O13 A;  3RLO A;  4OO1 I;  3A7A B;  3FMC A;  2JA9 A;  3IKJ A;  1ENF A;  2XVS A;  4JK1 C;  1UWV A;  2F0E A;  2RHQ B;  5C5L A;  1PYB A;  3ND9 A;  1NR4 A;  3NTI A;  3HGB A;  2I5H A;  4I65 A;  5HY6 A;  3GTM B;  4O42 A;  2RKS A;  3VR4 A;  4HIM A;  3U58 A;  4PZ6 A;  4A3E G;  4H7B A;  4TKO B;  3NHH A;  2CFM A;  2O2L D;  4PMB A;  3HOX B;  3J7A F;  1CT1 D;  1G6Z A;  4OO1 H;  1Q81 C;  1XJV A;  3QO2 A;  4Q0F A;  4ALP A;  2B2W C;  3Q6S A;  3HOU H;  3P20 A;  1KL9 A;  1MJC A;  4S3S A;  5EPK A;  3HOZ G;  1A3T A;  3DXJ C;  4C3J G;  4CDC C;  3CXC A;  1UE6 A;  3TRZ A;  2ZT9 C;  1XX8 A;  3BYY B;  1CZG A;  1NAP A;  1QNU A;  1SJE D;  1VQA A;  1LT5 D;  2Y0S E;  4LK1 C;  3I3C A;  4DUY L;  4HIK A;  3CP0 A;  4J15 A;  3ND8 A;  1CSQ A;  3N6R A;  4LNQ A;  1IXR A;  1KQS A;  2VQE Q;  1QUQ B;  3UDF A;  3OHX C;  3WWV A;  3HOY H;  4KMU C;  3TN2 A;  3J81 L;  2N3S A;  1HTL D;  2GVB A;  3VR5 A;  2NVX B;  4YWK A;  4PMW A;  2DJF C;  1F2Z A;  4FXK C;  1J5E Q;  2SOB A;  2EQS A;  1NNX A;  2G9H D;  1PVO A;  4IUV A;  1NE3 A;  1G2T A;  5J1Z A;  2PPB C;  1PH6 A;  2F0V A;  1FJG Q;  1BR9 A;  4C1N K;  1RCV D;  1YJN A;  1KDA A;  2M00 A;  4RWS C;  5IYC G;  2NVY H;  2OTL A;  3M9B A;  1MSH A;  1PTO C;  4HMI A;  3MEH A;  4LF6 Q;  1ZYR D;  3D6C A;  5IYD G;  2DUD A;  3CC2 A;  4C3I G;  2K52 A;  3GV6 A;  2JEA I;  2A1A A;  3MA2 B;  5IOD A;  2HDL A;  1Y14 B;  2JA7 H;  2HCC A;  4GZY C;  1I4R A;  3GTG H;  4DAM A;  2F4I A;  1F9R A;  4LF7 Q;  1N9W A;  5K36 H;  2HUG A;  1MIU A;  1T9H A;  4M1U B;  3AYH B;  4GNX C;  4CBV A;  4BXX G;  3KF6 A;  1X3E A;  4KY6 A;  3PQI A;  2NN6 I;  2JA5 B;  2RCN A;  2CQA A;  2DNC A;  2V4D A;  1N32 Q;  1B9M A;  2F0I A;  1G29 1;  3I4M B;  1PH3 A;  1I4G A;  3R93 A;  4Y52 H;  5LHY 1;  1FNU A;  1X32 A;  4RA8 A;  3CF5 A;  2QDB A;  4CKE A;  5CV7 A;  4DR3 Q;  2PCF B;  4FVM A;  5JPM C;  2NWG A;  2PW7 A;  2A74 C;  1IYJ B;  3EIV A;  4FF2 A;  4CGY B;  3I2Z A;  4JBM A;  4DV6 Q;  1YHB A;  3CHB D;  2NN6 H;  5JJL A;  1ZKO A;  4KLK A;  2VQE L;  3BVM A;  4L63 B;  1EWH A;  4QCL A;  1AH9 A;  4Y7N B;  2PI2 E;  2DNE A;  3L3O C;  3MXN A;  4JI2 Q;  1TR5 A;  2RSN A;  3HOW B;  1WOC A;  3EQL C;  3FRP B;  3A8J E;  1TWG B;  1IBM L;  1X3F A;  5JJK A;  4A3M G;  5D3D A;  1RTO A;  5AJ3 Q;  1WTV A;  1J5E L;  5A2Q E;  2VUM G;  1CKO A;  2KEC A;  2L9H A;  1PZK D;  3U4V A;  1XPO A;  4NB3 A;  3S1Q B;  1DJR D;  5G3L F;  3T53 B;  3Q23 A;  1FJG L;  3AB9 A;  1TY0 A;  1TS3 A;  4A3I G;  3A8I E;  1PRT D;  5FJ8 H;  2HQL A;  1PXU A;  3PO3 G;  2ZTC A;  4GLV B;  2AQ2 B;  1HR0 Q;  3K7A B;  3M4Q A;  1RKN A;  1EY0 A;  2OCE A;  4K6L A;  2QEJ C;  3I56 A;  4RKB A;  5GAD C;  1VQ9 A;  5EAY A;  3UDI A;  2F0H A;  3OW2 A;  2AKW B;  2KVM A;  5I9O A;  3E3X A;  1KAW A;  3FP9 A;  3TS2 A;  2EJG C;  3J80 c;  2F52 A;  2R7Z G;  2A8V A;  1VQD A;  4G57 A;  1IW7 C;  4LF7 L;  5KND A;  5M3M G;  3DHQ A;  1A6X A;  3GTP B;  1AW7 A;  1Q86 C;  2B2Y A;  2BCO A;  1PHJ A;  3L0O A;  2F0D A;  5IWA Q;  2H1E A;  2C5C A;  1N32 L;  5C44 B;  1ICF B;  3SDZ A;  1Q8K A;  2N49 A;  4LUO A;  2B2T A;  3KLS X;  3K5N A;  3JAM c;  1SBB B;  3NBH A;  3H0G H;  4DN4 M;  3A56 A;  3A54 A;  4H13 C;  3HOX G;  2A6E D;  2NZH A;  5C5M A;  1J8I A;  3RD4 A;  2EY1 A;  2AQ1 B;  2KOL A;  1LTR D;  4DR4 L;  4ZKC B;  2UXC Q;  2R92 B;  4IFD J;  1Q3L A;  1T5X D;  1HNZ Q;  2FJ2 A;  2K75 A;  4UPA A;  3GTJ H;  3OIQ A;  4DPG A;  1OTC A;  1WFQ A;  1O7Y A;  1D1I A;  1Y1W B;  1PFN A;  4G7O C;  3M3Y B;  4R4C A;  2G5D A;  5I4D A;  3BG3 A;  4AYB E;  4IZ8 A;  3S15 H;  4IUN A;  2DN8 A;  1SDF A;  3P75 A;  1K8O A;  5LL6 X;  4HJ8 A;  3NQI A;  1VQ4 A;  1MI2 A;  4HJ5 A;  3FKI B;  4GLA C;  1I94 Q;  1Q46 A;  5ELB A;  1SRU A;  1Z9F A;  2WAQ B;  1CHQ D;  2A5H A;  3MXP A;  3E5S A;  4PZ7 A;  4KKU A;  1FGB D;  1FNV A;  1PLF A;  1NR2 A;  1MGS A;  3RZO H;  1HNX Q;  1B7Y B;  4LFB L;  2JP1 A;  1YJ9 A;  1Y8N B;  4I7A A;  1NCV A;  4AQY Q;  4RCO A;  1HZ9 A;  3SVM A;  2KEE A;  1VCI A;  1GJX A;  4B3M Q;  4NW2 A;  1X9N A;  3TP6 A;  3MFG A;  1EQQ A;  1I50 B;  4X3T A;  4LUZ A;  1LV9 A;  2AUK A;  3GD7 A;  1TWC B;  5M5X B;  1HNW Q;  3WOE A;  4GS3 A;  1Z47 A;  4LFC Q;  5M5Y H;  3CQZ H;  5CYU A;  1UE7 A;  1DXM A;  2MJ8 A;  4QQB X;  1PDQ A;  4DV2 L;  1ILQ A;  2EY2 A;  2F4V Q;  5AFW A;  4K2K A;  1EFI D;  4G4K A;  3V2T A;  1II3 A;  5CC4 A;  5GAH C;  3VDY A;  2F0P A;  2UXC L;  1W6K A;  2JJQ A;  3RZD H;  2CW0 D;  1YI2 A;  3PO2 B;  3EBE A;  1HNZ L;  3I4M G;  1XTC D;  1CFM A;  3GTO H;  3HOU G;  2RF4 A;  2VB3 X;  3QIA A;  1SE8 A;  2AWN A;  3KJO A;  1SLJ A;  3LGJ A;  3IL8 A;  3K57 A;  2EYL A;  2IX0 A;  2LXJ A;  3A74 A;  3OW7 A;  1A63 A;  5EBC A;  1W2B A;  5DM6 3;  1MSG A;  1JMC A;  1JT8 A;  3GDE A;  5IE8 A;  4R8I A;  1I94 L;  1XTD A;  4A3E B;  2XNA C;  1F9Q A;  5JEA G;  3K6O A;  4HJ9 A;  3CD6 A;  1Y8P B;  2MHV A;  4DV1 Q;  3HOY G;  3CPW A;  4UY8 C;  1S5F D;  3HOW G;  2KHS A;  1HNX L;  1KNA A;  1LLR D;  1HZC A;  1EIH A;  4QJF A;  1IL2 A;  2OXP A;  4L6T B;  1BXT A;  4EQO A;  4AQY L;  2O4X A;  1YEZ A;  3RLN A;  1RL2 A;  5D3I B;  4B3M L;  4JC0 A;  4XT1 B;  1L0W A;  4EGV A;  5JPN C;  3HOZ B;  3OYY A;  4UP9 A;  4ABN A;  4DNI A;  1TWH H;  4C3J B;  1TWA H;  5IGC A;  2O5J C;  4A3B G;  5ELC A;  2RVL A;  1QNK A;  3FEW X;  3KF8 A;  1VQ7 A;  2SEB D;  2K5N A;  2F0F A;  5C3E G;  4JI0 Q;  4H0L C;  4ILW A;  3H3V I;  4OGQ C;  1SND A;  1EWC A;  1QG7 A;  4QL5 A;  5EJW A;  1E0B A;  1R4P B;  4IUU A;  4DV7 Q;  1SMY D;  1SFO B;  1O80 A;  1BCP F;  2NB0 A;  3HKZ G;  2OQK A;  3D4W A;  3R8B A;  2VS1 A;  5IYB G;  1ZYR C;  3DEP A;  2SNS A;  5J22 A;  1KIX A;  4O1N A;  2EYF A;  4KI0 A;  4DK1 A;  3DWA A;  1YNJ D;  3A8K E;  1F2L A;  2K5V A;  3S17 H;  2K5H A;  3K7U C;  1TS4 A;  2CH4 A;  3BDL A;  5T1G A;  1WTP A;  3G48 A;  3CCL A;  4BA1 I;  4KKS A;  3CU7 A;  2KCT A;  1EU3 A;  4BA2 I;  2E2D C;  1Y69 U;  2Z4I A;  5IT9 L;  3G6J B;  1E24 A;  4A3J B;  4A3L H;  1M90 C;  1NY4 A;  4IO9 A;  5C0X I;  4A93 B;  2E2I H;  1XNR Q;  4JI8 Q;  3KLW A;  2Z6B A;  4CDE C;  5CBA E;  4C3I B;  3S9W A;  4IJL A;  3I4N H;  3RMH A;  3DM3 A;  3WDN A;  1STA A;  1PH1 A;  3S16 B;  4JBJ A;  4KTA A;  5FLX L;  3UE1 A;  1TWF H;  4RHR A;  1NJI C;  2R93 B;  2R7F A;  3RN5 A;  4PMC A;  1VQH A;  1Q1B A;  5LMN W;  3P7J A;  2ZJR A;  3CCU A;  4HTH A;  1SNQ A;  3CKI B;  1BCP B;  2LXK A;  4DV1 L;  1X56 A;  1K73 C;  4NXN Q;  2F1M A;  2VZA A;  5C0X H;  4R4Q A;  1BBW A;  5KYL A;  1E2W A;  2X6L A;  1A8V A;  1X6O A;  2QA4 A;  2J4X A;  1EWI A;  3QB3 A;  4IOC A;  4N8F A;  3AQQ A;  1SR3 A;  2XN9 C;  1EFW A;  5BN4 A;  1TS2 A;  3L7Z C;  4P71 A;  1WCM H;  1CQF A;  2AMC B;  2KUM A;  3CME A;  2WP8 J;  3V96 A;  1GD7 A;  5EKI A;  5G3L D;  4CJ2 C;  1PYW D;  2YU9 B;  3P1H A;  4PG3 A;  1RJT A;  4QB4 A;  1H95 A;  1LAB A;  4FNF A;  4A3F H;  2QKI C;  1LTB D;  2K6A A;  4AIM A;  3J7Z C;  1E2V A;  1HUM A;  3ONA B;  4K5W A;  4GOP A;  1Y1V H;  2F0T A;  3PUV A;  4JG2 A;  3KFU A;  1ENC A;  3MXN B;  4JW0 A;  1K83 B;  1UE1 A;  2Z6K C;  4L5R C;  3PUY A;  1X65 A;  3D6W A;  1B53 A;  1HQR D;  2WKD A;  2JA6 B;  1VQE A;  3S1N H;  3NTK A;  2KA7 A;  2PQA A;  1CA5 A;  3M4P A;  1H9J A;  2SDF A;  2Z0S A;  1CM9 A;  4GN5 A;  5FKA C;  5C4H A;  4LF4 Q;  4KD4 A;  5IIF A;  1VQ8 A;  4PV1 C;  3PO3 B;  4K0K L;  4L8J A;  4BY1 B;  2WIN B;  3H3V C;  1XNR L;  4JI8 L;  1JC7 A;  1SE4 A;  2F3W A;  3K5O A;  1C48 A;  4BWG B;  1EQV A;  1H9M A;  2WAC A;  1HR0 W;  1SJH D;  2YV5 A;  3A0J A;  5C4X B;  3S2H H;  3V05 A;  1PTO H;  1P16 A;  1RTN A;  5FLM H;  2L4N A;  4KK7 A;  2NVX H;  5K5P A;  5M3F G;  2A6E C;  2R7Z B;  2Q8R E;  2XWJ B;  2L5T A;  4KJO A;  5M3M B;  3UDG A;  1JCK B;  5GRO A;  2KEN A;  4K2L A;  3CCV A;  1IZ6 A;  3I73 A;  4NXN L;  1EU4 A;  1KAA A;  1S5D D;  1A2T A;  2MUY A;  3S2D H;  3D8G A;  2ZXP A;  5DEH A;  4DR7 Q;  3QG1 A;  4HIO A;  2BDO A;  5KNC A;  5IP9 H;  2M9V A;  1N33 Q;  2E2H B;  4DAY A;  4R4T A;  1Z7T A;  1CSP A;  2JA8 B;  2NUC A;  1HJP A;  3K80 C;  3G7L A;  3NBH B;  1FGU A;  4CDF C;  4KJN A;  2R6G A;  5E4X A;  2QIL A;  4QY7 A;  3ZJY C;  1A15 A;  3BS1 A;  4BY7 G;  1FNW A;  5IGE A;  4K8J A;  2JA5 H;  1VS0 A;  1KXL A;  4A3K H;  2CWP A;  2KCM A;  3BYT B;  3KBX A;  2JK8 A;  5M9O A;  3KOJ A;  2F0Q A;  2B8G A;  4X6A H;  2R7D A;  3MZ5 A;  1A3U A;  1RIP A;  2F3I A;  4R1J A;  1JB3 A;  4HJ7 A;  1MJE A;  1GUO A;  4LF4 L;  5HGT A;  4CKC A;  4GKK L;  3TBI B;  5J3B A;  1L0X B;  2B2U A;  2Z4H A;  3M4O B;  4KY7 A;  1IBM Q;  4B3T Q;  2WII B;  3TRE A;  3D31 A;  2EYO A;  4C3H H;  2ZJQ A;  3TP5 A;  3U50 C;  1BBX C;  1WD0 A;  2FFK B;  2JYO A;  1Y8O B;  1U9R A;  2B63 H;  1KTK A;  5EKL A;  4C2M B;  3MXU A;  2HIV A;  4A3J G;  1HZA A;  4A93 G;  1JIC A;  3CCJ A;  2CW0 C;  4ZQ3 A;  1S72 A;  4TSS A;  2CKZ B;  2JXM B;  2IHF A;  4IPH A;  1PH8 A;  2R93 G;  4DR7 L;  1K3R A;  3CAM A;  3E9I A;  4ZUJ A;  5F2D A;  4JOI C;  4B9W A;  4BBR G;  5FLX c;  1N33 L;  2CQO A;  1WD1 A;  2O5I C;  1PFS A;  2JSO A;  1STN A;  3SK8 A;  1IYV A;  1ESF A;  4X62 L;  4L5Q A;  4O0A A;  3PUX A;  1DOM A;  1TKW B;  1VQ6 A;  4X66 Q;  4HID A;  4K5V A;  2F3V A;  4XYO A;  3H91 A;  2UUA L;  2CCZ A;  4JI5 Q;  3GO5 A;  5CBE E;  1RHP A;  3HOU B;  4EVO A;  2PMZ B;  3T1H Q;  4ZYS A;  4J1M A;  4IFD I;  3GTP H;  2VB2 X;  2N55 A;  4LF5 L;  4DUZ L;  4RGM A;  5I2Y A;  1D1K A;  5JVG 3;  4A3D G;  4DR4 Q;  5GAG C;  5C44 H;  1ONL A;  3TP7 A;  2B39 A;  3HKS A;  3U4Z A;  4P75 A;  1PH9 A;  1QVC A;  4HED A;  1SXT A;  1H9S A;  1ET6 A;  4UP7 A;  5JEA J;  5E3F A;  1MKH A;  1TY2 A;  1V1Q A;  5IGB A;  3HOY B;  1GUW A;  5IP7 G;  2L1B A;  3BVZ A;  4IFD H;  2R92 H;  4ZKB B;  4B3T L;  3S1M H;  1BQQ T;  5L37 A;  3ICE A;  3JC6 6;  3C1E A;  2JN4 A;  1SMY C;  2JA6 G;  1XNQ Q;  3D4R A;  1GM5 A;  4CJ0 B;  1JOO A;  1BCP D;  1I6H H;  4IPC A;  1NMG A;  2UXB Q;  1T5E A;  1LYL A;  4X3S A;  3KJP A;  1I4H A;  1JOR A;  4A3C H;  2PZW A;  1YNJ C;  3T13 A;  4A3B B;  4BY1 G;  3J80 i;  4A3L G;  2HD3 A;  4LFB Q;  1QOH A;  1DCZ A;  2NVY B;  4DR1 Q;  1RF2 D;  3KF8 B;  5C3E B;  4MTK A;  3Q0A A;  2FIN B;  3HOV G;  4RFB A;  5C4X G;  1YHA A;  4WRD A;  3A7L A;  1B3A A;  1GUN A;  1SSO A;  1UAP A;  1DYQ A;  3OIP A;  3M7N A;  2Q8T A;  4JV5 Q;  5ISR A;  2RSO A;  3HKZ B;  2B2V C;  4TVA B;  2JA7 B;  3GTG B;  1EUJ A;  1I4Q A;  4DV0 L;  4ZLT F;  1LTL A;  3CC7 A;  5GAE C;  4KV6 A;  1L0Y B;  3EA6 A;  2TMP A;  4OON A;  4U67 3;  3LWE A;  4XT3 B;  1S5C D;  3HEJ A;  3JAM i;  4PQX A;  1YJW A;  2I0Q A;  2F0W A;  4X66 L;  1D5Z C;  4LMQ D;  1PH2 A;  4YIJ A;  3OPO A;  4NKL A;  2NZ1 D;  1HPC A;  4DV2 Q;  4JI5 L;  1FVI A;  1ET9 A;  2C35 B;  2MO0 A;  4A4I A;  4DFA A;  5M5X H;  4ZUI A;  3T1H L;  3HS0 C;  1CKN A;  1EZ6 A;  4A75 A;  2B2W A;  2JA8 G;  1VF5 C;  3TZD A;  1LO5 D;  3D3R A;  4RAU C;  1HA6 A;  4YWL A;  5H1S E;  1HH2 P;  4A3G H;  2N78 A;  1XWE A;  2XIW A;  2DY8 A;  3I70 A;  1U0L A;  1F2M A;  5ELO A;  3X3N A;  1IBK Q;  2BE5 D;  2AWO A;  3W2D A;  1K3B C;  1H9R A;  2IJ0 A;  2EY6 A;  3W3A A;  3AU7 A;  4A3F G;  4ZCK A; 
#chains in the Genus database with same CATH homology
 4PZ8 A;  1L0W A;  4MNO A;  3K0X A;  3OYY A;  4JI1 L;  4UP9 A;  3CW2 C;  2IX1 A;  4DNI A;  2MO1 A;  1TWH H;  2B3G A;  1QVG A;  1U5K A;  4BBS G;  1TWA H;  2HHH L;  3I7F A;  5LMN Q;  3F2C A;  3GTL H;  4A3B G;  2PMZ E;  2IY5 B;  3M4O H;  1G51 A;  1CUK A;  1VQ7 A;  2WAQ E;  5IYB H;  3J81 i;  1B70 B;  1A0I A;  2K5N A;  1XNQ L;  4POF A;  5LMU L;  3CCS A;  1PH5 A;  5C3E G;  4JI0 Q;  1PA6 A;  3H3V I;  1R9T H;  3CPF A;  2D0P A;  3STB D;  2UXB L;  1W3S A;  4IOA A;  2ZTD A;  4QL5 A;  3ER0 A;  1BVS A;  4DV7 Q;  3AFP A;  3G6E A;  3PO2 G;  3HKZ G;  2OQK A;  2VL6 A;  2VS1 A;  3W1G A;  5IYB G;  3J81 c;  3FHW A;  2WB1 G;  4H02 A;  5C0X J;  2E2J H;  3A5U A;  4C2M H;  3L2P A;  3M85 A;  1KIX A;  4DR1 L;  1OXS C;  4P73 A;  3J7A 5;  1YBY A;  4KI0 A;  3RLO A;  1B8A A;  4OO1 I;  4A3E H;  1TXY A;  2YTX A;  2JA9 A;  2Z6K A;  4DV4 Q;  2K5V A;  2ZM6 Q;  3S17 H;  1UWV A;  1YIT A;  2K5H A;  3K7U C;  2B29 A;  2MNA A;  2RHQ B;  3G48 A;  1PYB A;  3CCL A;  1I3Q H;  4BA1 I;  4JV5 L;  2KCT A;  2MQH A;  4EX5 A;  1VQF A;  2I5H A;  5HY6 A;  3G4S A;  4BA2 I;  4LFB L;  1C0A A;  4HIM A;  3U58 A;  4PZ6 A;  4A3E G;  1E24 A;  3I55 A;  4GOP B;  4A3L H;  1M90 C;  1NY4 A;  4IO9 A;  1Y1W H;  5C0X I;  1PH7 A;  2E2I H;  1XNR Q;  3M3Y H;  4JI8 Q;  2CFM A;  3KLW A;  1XPR A;  4IJL A;  2EXD A;  3BZC A;  4GNX A;  1XPU A;  3I4N H;  2PQA B;  1Q81 C;  4IJH A;  3DM3 A;  1PH1 A;  1XJV A;  4JBJ A;  4TQU S;  1TWF H;  3UE1 A;  4MZ9 A;  1NJI C;  2R7F A;  4ALP A;  3RN5 A;  2UXD L;  3PIP A;  3FKI H;  1VQH A;  1Q1B A;  2K14 A;  3NEN A;  5LMN W;  1XMO L;  3HOU H;  3PUW A;  2ZJR A;  1KL9 A;  1MJC A;  3CCU A;  2RHS B;  3HOZ G;  4JI7 L;  2LXK A;  3HKZ E;  3PV0 A;  4DV1 L;  3I4N G;  1X56 A;  2BH2 A;  1K73 C;  4OO1 G;  1SRO A;  1JJC B;  3CXC A;  4IPG A;  1UE6 A;  4NXN Q;  2K50 A;  2VZA A;  3TRZ A;  1VQA A;  2Y0S E;  4DUY L;  2OQ0 A;  4R4Q A;  1IBK L;  1BBW A;  4HIK A;  3CP0 A;  4J15 A;  1EIF A;  3NEL A;  1A8V A;  1CSQ A;  1X6O A;  2QA4 A;  2UUB L;  4LF6 L;  4RMF A;  4A76 A;  1EWI A;  1FL0 A;  4IOC A;  3TS0 A;  1JB7 A;  1IXR A;  4LNQ A;  4JI4 Q;  2VNU D;  3ULL A;  3AQQ A;  2ZJP A;  1SR3 A;  2VQE Q;  1X55 A;  1KQS A;  1QUQ B;  3UDF A;  4DV3 Q;  4NPS A;  1EFW A;  3WWV A;  5HGQ A;  5C0X G;  4DR5 L;  5C4J H;  3L7Z C;  3CCR A;  4P71 A;  5LMN L;  1WCM H;  4JI3 Q;  3HOY H;  1PYS B;  2YTY A;  5DLQ E;  4A3K G;  2N3S A;  1I50 H;  2GVB A;  2AMC B;  4YWK A;  4PMW A;  2MFI A;  1D7Q A;  1TWC H;  4POG A;  2GVA A;  2DGY A;  3CME A;  2WP8 J;  1J5E Q;  1GD7 A;  2UU9 L;  1OXV A;  2EQS A;  1PVO A;  4PG3 A;  1H95 A;  1GVP A;  1NE3 A;  4JI7 Q;  4A3F H;  1WCM G;  1PH6 A;  5IYD H;  4AIM A;  3W1B A;  4DAY B;  2V1C C;  1FJG Q;  3J7Z C;  1K9M C;  4LFA L;  1CKM A;  4GOP A;  1YJN A;  2CWA A;  4BBS H;  1KHI A;  5BR8 Q;  1VQL A;  1AE3 A;  1Y1V H;  4JG2 A;  3PUV A;  1C7Y A;  3KFU A;  4GN4 B;  3MXN B;  5IYC G;  2NVY H;  1UE1 A;  2OTL A;  3M9B A;  2UUB Q;  2Z6K C;  4L5R C;  4LF6 Q;  4DV4 L;  3PUY A;  4P72 A;  1X65 A;  2ZM6 L;  3S1N H;  5IYD G;  1VQE A;  2DUD A;  3CC2 A;  2PQA A;  2K52 A;  2PI2 A;  4DR3 L;  2JEA I;  3M4P A;  4GN5 A;  2Z0S A;  4FDB A;  3PSI A;  1NBW A;  2A1A A;  4DR5 Q;  1SN8 A;  2D62 A;  2ALY B;  1VQK A;  4BXX H;  1Y1V G;  1PV4 A;  4LF4 Q;  3PO2 H;  1VQ8 A;  3BZK A;  3UDX A;  1VQN A;  1Y14 B;  2JA7 H;  4K0K L;  4DV6 L;  3GTG H;  4DAM A;  4X64 L;  2EIF A;  5M3F H;  4LF7 Q;  2UU9 Q;  1N9W A;  1XNR L;  4JYA Q;  4JI8 L;  4OX9 Q;  1MIU A;  1T9H A;  3AYH B;  4GNX C;  1HR0 W;  4BXX G;  3KF6 A;  4JI6 Q;  1UEB A;  1X3E A;  2VW9 A;  4DK3 C;  3E9H A;  2YV5 A;  4LF9 Q;  4JI2 L;  3A0J A;  4LFA Q;  2NN6 I;  3S2H H;  2RCN A;  2JA7 G;  1N32 Q;  1P16 A;  3MEF A;  5FLM H;  2NVX H;  1G29 1;  5AJ3 L;  5M3F G;  2Y0S G;  2VY3 A;  5M5W H;  1QUQ A;  5K36 G;  1J6Q A;  1PH3 A;  4Y52 H;  1E1O A;  3KYH C;  4WJ3 M;  3UDG A;  1K8A C;  2YU9 H;  4GN3 B;  3CF5 A;  5JJI A;  2Q2T A;  5GRO A;  2AHO B;  2KEN A;  4UP8 A;  4DR3 Q;  1Q82 C;  4LUV A;  3CCV A;  4XIG S;  1IZ6 A;  4NXN L;  4YCU A;  5FLM G;  1NMF A;  1IYJ B;  3EIV A;  4MTN A;  3H3V H;  3RLF A;  3S2D H;  3W5O A;  4IPD A;  4DR7 Q;  5E7N A;  1HR0 L;  3I2Z A;  1VQP A;  4HIO A;  4JBM A;  4K0K Q;  4DV6 Q;  4GKJ L;  5IP9 H;  1YHB A;  4X64 Q;  4YY3 Q;  4JOI A;  3RR5 A;  4A3M H;  1N33 Q;  4JI4 L;  1VQ5 A;  5JJL A;  2I5M X;  4R4T A;  4XTC S;  4KLK A;  3G71 A;  2VQE L;  1LUZ A;  2VUM H;  1CSP A;  4DV3 L;  4QIW E;  4KHP Q;  1AH9 A;  1EYG A;  2PI2 E;  4NXM Q;  3HOZ H;  1HJP A;  3K80 C;  1XMQ Q;  4JI3 L;  3F2D A;  3K8A A;  4BY7 H;  3NBH B;  4C3J H;  4JI2 Q;  1FGU A;  2E5L L;  1X3G A;  1WOC A;  1KD1 C;  5JJK A;  2KHI A;  1X3F A;  5IP9 G;  4A3I H;  1IBM L;  4A3M G;  3STB C;  3PO3 H;  5AJ3 Q;  2R6G A;  2NN6 G;  2XTI A;  3CCM A;  3ULJ A;  1CKO A;  3I4O A;  1J5E L;  2VUM G;  3BU2 A;  2PNH A;  3PUZ A;  5GQO A;  4L5T A;  2YTV A;  4QY7 A;  3U4V A;  1XPO A;  4NB3 A;  2VQF Q;  3ZJY C;  4BY7 G;  4R4I A;  1S40 A;  3F1Z A;  4X65 Q;  5IWA L;  1FJG L;  1UE5 A;  1SFO H;  1PH4 A;  1EIY B;  4GOP C;  4YCW A;  2NZO A;  1ASZ A;  4A3I G;  1C9O A;  1YZ6 A;  5FJ8 H;  2HQL A;  1VS0 A;  5BR8 L;  2JA5 H;  3PO3 G;  2JQO A;  1KXL A;  1X54 A;  2ZTC A;  4GLV B;  4OXP A;  4A3K H;  2CWP A;  3RN2 A;  4JBW A;  2KCM A;  1QZG A;  1HR0 Q;  2JK8 A;  3AEV A;  3KOJ A;  4GKJ Q;  3M4Q A;  2R7Z H;  4X6A H;  1Q1E A;  2R7D A;  2OCE A;  4LF8 L;  1VQO A;  1RIP A;  5M3M H;  2F3I A;  3I56 A;  4R1J A;  4HJ7 A;  5GAD C;  1VQ9 A;  5EAY A;  1YVC A;  3UDI A;  2Q2U A;  2BA0 A;  1SMX A;  5FJ8 G;  1MJE A;  3OW2 A;  2JA5 G;  2AKW B;  3K81 C;  4LF4 L;  1N36 L;  1KAW A;  3GTM H;  4GKK L;  3FP9 A;  4AYB G;  2E5L Q;  2OTJ A;  3TS2 A;  3AFQ A;  5J3B A;  3CCE A;  3J80 c;  2F52 A;  1IBM Q;  2D0O A;  4B3T Q;  2R7Z G;  2UUC Q;  2A8V A;  1VQD A;  3TRE A;  2YYZ A;  3D31 A;  4LF7 L;  4JYA L;  5M3M G;  4A3J H;  5IYC H;  4OX9 L;  4DK6 C;  4A93 H;  4C3H H;  2E8G A;  2ZJQ A;  1Q86 C;  4JI6 L;  1E7Z A;  2A19 A;  3KDF B;  3L0O A;  1I5F A;  3U50 C;  4C3I H;  1PHJ A;  5IWA Q;  4LF9 L;  3PF4 A;  1WJJ A;  3CCQ A;  3HOX H;  1N32 L;  3D0F A;  4OWX B;  3ERS X;  2Q2H A;  1VQC A;  3H15 A;  2ZTE A;  2B63 H;  3RNU A;  3S16 H;  3Q8D A;  4R4O A;  1Q8K A;  2HIV A;  3OTO Q;  4A3J G;  2R93 H;  1HZA A;  2N49 A;  4A93 G;  1Q12 A;  1HZB A;  1OXX K;  2FXQ A;  3E0E A;  4LUO A;  3CCJ A;  2H5X A;  4BBR H;  1YIJ A;  3JAM c;  3H0G H;  4OWW B;  4LF8 Q;  5IY0 A;  1S72 A;  3HOX G;  2NZH A;  2KHJ A;  1BKB A;  2I5L X;  2BA1 A;  4WJ4 A;  2CKZ B;  4YHH Q;  2B63 G;  1KC8 C;  1N36 Q;  2IHF A;  4DR4 L;  2UXC Q;  4IPH A;  4GKK Q;  3IRB A;  3B6Y A;  1PH8 A;  4DR7 L;  4IFD J;  2R93 G;  1K3R A;  3CAM A;  3E9I A;  2K75 A;  1VQM A;  4UPA A;  1P8L A;  1HNZ Q;  3GTJ H;  4JOI C;  4DPG A;  4BBR G;  5FLX c;  1OTC A;  4YY3 L;  1WFQ A;  1N33 L;  2CQO A;  3H0G G;  1PFS A;  2ASB A;  4OWT B;  3GTQ H;  4KHP L;  4X62 L;  3T1Y Q;  4R4C A;  4L5Q A;  1N34 Q;  4NXM L;  3TQY A;  1YNX A;  4O0A A;  1XMQ L;  4A3G G;  1GKH A;  3PUX A;  4AYB E;  3PIO A;  1KRS A;  1VQ6 A;  3S15 H;  4X66 Q;  4HID A;  4DV5 Q;  1Q7Y C;  2UUA L;  2CCZ A;  4LWC A;  4A3D H;  1K8G A;  4HJ8 A;  1IBL Q;  4AH6 A;  1VQ4 A;  4JI5 Q;  3GO5 A;  1HNW L;  4HJ5 A;  4LFC L;  3S24 A;  3S1M H;  4GLA C;  1I94 Q;  1Q46 A;  3T1H Q;  1S3O A;  4IFD I;  1SRU A;  1Z9F A;  2VQF L;  2IT1 A;  3GTP H;  1JE5 A;  4X65 L;  4LF5 L;  4DUZ L;  4RG1 A;  4PZ7 A;  2ATW A;  1N8R C;  2WFW A;  1VQG A;  4HJA A;  4A3D G;  4B3S Q;  2Q2I A;  2F4V L;  5GAG C;  5C44 H;  1HNX Q;  3RZO H;  4DR4 Q;  2QEX A;  5IP7 H;  1EQR A;  4ME3 A;  1B7Y B;  4B3R Q;  2JEB I;  1A62 A;  2BH8 A;  3HKS A;  3U4Z A;  4P75 A;  3ULP A;  1YJ9 A;  1PH9 A;  3UE0 A;  3F2B A;  1QVC A;  1K83 H;  3KDF A;  4AQY Q;  1HZ9 A;  5ELN A;  1VCI A;  2JA6 H;  4X62 Q;  3PGZ A;  4DR2 Q;  4UP7 A;  1VQB A;  5JEA J;  4B3M Q;  1X9N A;  1CKN B;  1MKH A;  4JI1 Q;  5C44 G;  1V1Q A;  1GO3 E;  5IP7 G;  4O2D A;  4DR6 L;  1EQQ A;  3GTK H;  4LUZ A;  1V9P A;  3HFZ B;  1VQI A;  3NEM A;  4JCV E;  2HHH Q;  2UUA Q;  3GD7 A;  1D8L A;  1K0R A;  2UUC L;  4B3T L;  2R92 H;  1KRT A;  1HNW Q;  1L1O B;  3ICE A;  1EOV A;  3JC6 6;  2HIX A;  4GS3 A;  1Z47 A;  4LFC Q;  2JA6 G;  1XNQ Q;  5M5Y H;  4BY1 H;  5LMU Q;  3CQZ H;  1GM5 A;  1QVF A;  1O7I A;  2NVQ H;  1I6H H;  4IPC A;  1NMG A;  1JJG A;  1YHQ A;  2UXB Q;  3BJU A;  4LF5 Q;  1UE7 A;  3CMA A;  4LW1 A;  4DUZ Q;  1LYL A;  3KJP A;  3HOV H;  3S14 H;  4IFD G;  2R92 G;  3A5Z B;  5C4X H;  4A3C H;  4QQB X;  1G6P A;  4L5S A;  4DV2 L;  2F4V Q;  3J81 j;  2K4K A;  3OTO L;  4BY1 G;  3J80 i;  3I4M H;  4A3L G;  4LFB Q;  1Y1W G;  4DR1 Q;  1WYD A;  3SGI A;  2XGT A;  4YCV A;  3EN2 A;  3KF8 B;  1QZH A;  3S1R H;  2KBN A;  3HOV G;  1E3P A;  5GAH C;  3VDY A;  2NVT H;  4A3C G;  1YHA A;  1L1O C;  5C4X G;  4YHH L;  3M7N A;  1AE2 A;  2UXC L;  2WB1 E;  4APV A;  4JV5 Q;  2JJQ A;  3RZD H;  1YI2 A;  3F8T A;  4TVA B;  4DR6 Q;  3EBE A;  1HNZ L;  3I4M G;  4GLX A;  2IHE A;  2GN5 A;  3FKI G;  3KF6 B;  4YWM A;  3GTO H;  3HOU G;  1EUJ A;  2RF4 A;  1LM0 A;  4DV0 L;  2LSS A;  3PCO B;  1BBU A;  1LTL A;  1SE8 A;  2AWN A;  5GAE C;  3KJO A;  3CC7 A;  2WAQ G;  1DGS A;  4KHZ A;  2E2H H;  3T1Y L;  1N34 L;  4OON A;  1SLJ A;  2JE6 I;  3LGJ A;  2L15 A;  1OXU A;  3JAM i;  4JBK A;  2N8N A;  4Y7N H;  1YJW A;  2ID0 A;  2I0Q A;  2IX0 A;  2JA8 H;  4X66 L;  2LXJ A;  3A74 A;  3TEH B;  1PH2 A;  4DV5 L;  1V43 A;  1A63 A;  1JJ2 A;  2OWO A;  1E22 A;  1W2B A;  3HOW H;  4QGU A;  1WI5 A;  4DV2 Q;  1IBL L;  4JI5 L;  1FVI A;  1VQJ A;  1TWG H;  5IT9 c;  1JMC A;  1JT8 A;  2C35 B;  2MO0 A;  4A4I A;  3GDE A;  5IE8 A;  5M5X H;  1I94 L;  1XTD A;  3T1H L;  4DKA C;  3PF5 A;  2ES2 A;  1CKN A;  4JI0 L;  2UXD Q;  4A75 A;  5JEA G;  1XMO Q;  2JA8 G;  4HJ9 A;  1E1T A;  3CD6 A;  1M1K C;  3S1Q H;  4DV7 L;  4DV1 Q;  3HOY G;  4YWL A;  5H1S E;  3CPW A;  1HH2 P;  4UY8 C;  4A3G H;  3HOW G;  1L1O A;  2N78 A;  4B3S L;  2HT1 A;  1HNX L;  3CC4 A;  1HZC A;  1U0L A;  4QJF A;  1L2F A;  1IL2 A;  5ELO A;  4EQ5 A;  4B3R L;  4DUY Q;  4P74 A;  3DLL A;  1IBK Q;  1OXT A;  4GNX B;  2AWO A;  1ASY A;  4A3B H;  2QGQ A;  3K7A H;  4DV0 Q;  4AQY L;  1YEZ A;  3RLN A;  1RL2 A;  4DR2 L;  4A3F G;  5C3E H;  4B3M L;  1NTG A;  4JC0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...