2MO0A

Backbone 1h, 13c, and 15n chemical shift assignments for cold shock protein, tacsp
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
68
structure length
68
Chain Sequence
MKKGTVKWFNAEKGYGFIQQEEGPDVFVHFTAIEADGFRTLNEGEHVEFEVEPGRGGKGPQAKKVRRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cold-shock DNA-binding domain protein
publication title Structure and flexibility of the thermophilic cold-shock protein of Thermus aquaticus
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Dna binding protein
total genus 8
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2014-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2mo0A00
4DV0Q 2KHJA 4A3CH 3BJUA 1PVOA 3M85A 4TVAB 3VDYA 3H3VH 2YTXA 5DLQE 4DPGA 1PV4A 2IHEA 1LTLA 1D8LA 2JA5G 1C9OA 2HIVA 4HIMA 3RNUA 3PIPA 1FL0A 1VCIA 2D0OA 5GAEC 2MQHA 4LF8Q 5M3MG 3S2DH 1E1TA 1VQCA 4PZ7A 3J81i 4NXML 2QEXA 1AE2A 4JI5L 3SGIA 5M5YH 4POFA 1YHQA 5C4XG 3KF8B 4IJLA 3HOXG 4DR2L 2R92H 3TRZA 1P8LA 3CPFA 2RHQB 1PH6A 4DV2L 2NVYH 4AIMA 1N33Q 5FLMH 1J5EL 3K7AH 2GVBA 2OQ0A 1SE8A 1SROA 1X3FA 3HKZG 2HHHL 2EXDA 2K52A 1UE6A 4LUVA 4UPAA 5JEAJ 4GN3B 4GKJQ 5IWAQ 2B29A 4JI8L 1TWHH 3STBC 1SMXA 2F3IA 4JI8Q 3CXCA 1HNXQ 2HQLA 1E24A 3ULLA 1WJJA 5IT9c 2UUAL 2UXCQ 4JI3Q 2JA5H 3A5UA 1QVFA 3G6EA 1UEBA 4TQUS 3G71A 1X3EA 3KYHC 4PMWA 3PUYA 2LXJA 3A74A 4X66L 1HNZQ 4DUYL 5LMNL 2Z0SA 4X66Q 3ZJYC 4XIGS 4FDBA 4DUYQ 5M3MH 1Q81C 4P74A 3J81j 1Q12A 1T9HA 4NB3A 3W1BA 2MO0A 2DGYA 5ELNA 4A3FG 2NZOA 4YHHQ 2YV5A 5C4XH 4AQYL 5IY0A 3HOXH 4H02A 1MJEA 3UE1A 4LNQA 4OX9Q 2IHFA 4BY1G 4DUZL 4JI0Q 3E9IA 3M4OH 1PH7A 1J6QA 2K75A 4GLAC 2VQEL 1MJCA 4DR3Q 4OWTB 3BZCA 3ULPA 3T1YQ 3S14H 2ZM6L 3GTJH 3GD7A 4KLKA 2RF4A 3KF6A 3JAMi 3CD6A 1XPUA 1I5FA 1PA6A 2IX1A 1W3SA 5BR8Q 3DLLA 2E2IH 4JBJA 2N3SA 2GVAA 4YWMA 1BBUA 2B3GA 4X65Q 2A1AA 4BBRG 4C3JH 3MXNB 3CCJA 4LF5Q 2WAQG 1G291 4JI6L 4K0KQ 1G6PA 1YHAA 3RN5A 4JI2L 1VQEA 4DKAC 4QY7A 2PI2A 4A3FH 4ME3A 4QGUA 4HIKA 1IBKL 4B3RL 4DR5L 1IBKQ 1HNWL 4IO9A 2E5LL 4IPHA 4GOPA 1Q7YC 4Y7NH 4OWXB 4O0AA 4UP9A 4BY1H 1L2FA 2ZTDA 3KJPA 3OYYA 4J15A 2CKZB 4A3EH 1VQFA 1GVPA 2VQFL 1IBLL 2VZAA 1Q8KA 1P16A 3IRBA 3G4SA 4HJAA 4L5SA 4BA2I 2I5MX 4OO1G 1FVIA 1S3OA 4LF7Q 3A5ZB 2Q2UA 4GKKL 2H5XA 1E22A 3M4PA 4DNIA 4GKKQ 3Q8DA 2K5VA 2OCEA 3UDIA 1CKOA 4DAMA 2JA8G 4BBRH 2BA0A 2NN6I 5M5XH 1KC8C 2UUCQ 3ICEA 4IFDI 4YY3L 1AE3A 3UDXA 2RCNA 4GOPC 2NVTH 4DV7L 1L0WA 3I7FA 2LSSA 1GM5A 3NBHB 1XJVA 1VQPA 2K4KA 4DV1L 2JA6G 1QUQA 2AHOB 3I4MG 2N78A 1IYJB 1NMFA 1V43A 4GNXC 4A3DG 1I94L 3HOWG 2Z6KC 1X56A 1N36L 1I6HH 1N32L 4JYAQ 5IYCG 1S72A 3HOZG 2WAQE 1K8AC 3T1HQ 5C44G 1R9TH 1YHBA 2E8GA 3KFUA 4HIDA 3PF5A 4JBMA 4RMFA 2I5LX 4MTNA 3GTOH 2K5HA 2NN6G 4IFDG 4IPCA 4L5QA 3H15A 2JA8H 1L1OB 5JJLA 4KHPL 1E3PA 4KHPQ 4DR4Q 2MNAA 1OXTA 2ATWA 1HZCA 1JJGA 1Z9FA 5LMUL 3L7ZC 3PSIA 4JI1L 5LMUQ 2JA6H 5FJ8G 3I4MH 3CC7A 5E7NA 4A76A 1EOVA 1VQHA 3HOWH 4LWCA 4A3DH 4JV5L 1LYLA 2N49A 4OXPA 3CCRA 2QA4A 5K36G 4LFBL 1X65A 3OTOL 1Z47A 2XTIA 1EUJA 5IYCH 4A3IG 3U50C 4X62L 3S17H 3HOZH 4JC0A 2YU9H 1YI2A 5C44H 4DK6C 4NXMQ 1KIXA 4JI5Q 1MKHA 2EQSA 3K80C 3MEFA 4QJFA 1DGSA 1VQAA 3CMEA 4DR2Q 3LGJA 4R4TA 4HIOA 4YCVA 2C35B 4DV2Q 1YEZA 4GN5A 1YJ9A 4A3EG 4OWWB 5GQOA 3NELA 4GS3A 1J5EQ 4BXXG 1K3RA 2HHHQ 1QVGA 4BA1I 2UU9L 4PZ8A 3M7NA 2NZHA 1KAWA 1HZBA 4P75A 4KHZA 3CCVA 1VQNA 4P71A 2VUMG 1XNRL 3CMAA 1N34L 1CSQA 1XNRQ 5FJ8H 1XMOL 3AFQA 2UUAQ 2ZJQA 1E7ZA 2ZTCA 1CKNA 1X3GA 4MNOA 4EX5A 3S1MH 4DR1L 4A3JG 4R4IA 1HR0L 3NENA 1HR0Q 3CC2A 4A3IH 3PIOA 1V9PA 5LMNQ 2A19A 5AJ3L 2WFWA 3EBEA 1BBWA 5GROA 2CQOA 3AYHB 1K0RA 2IX0A 5JJKA 1FJGL 3M3YH 4YCWA 1FJGQ 3K7UC 5GADC 4AQYQ 2HT1A 3S1NH 4IFDJ 5M3FG 2UUBL 1UE5A 1OXUA 3G48A 3F2CA 4DUZQ 1HH2P 1EYGA 2UUBQ 4BY7G 1X54A 4LFCL 4LFCQ 1CSPA 2BH8A 2RHSB 2L15A 3PCOB 2PI2E 3PUZA 3J81c 1TWGH 2VQEQ 2WP8J 4B3SL 2HIXA 4BXXH 3UDGA 4LF4L 3HOYG 3TREA 1I3QH 1YBYA 2ZM6Q 3KDFA 1YNXA 3AFPA 4LF9L 1XPRA 4P73A 2VUMH 1NTGA 3S2HH 1YIJA 1PH2A 4OO1I 2PQAA 2I5HA 1SLJA 1SRUA 2Q2IA 3L2PA 3F1ZA 1VQOA 1X9NA 2XGTA 3PUWA 1GD7A 1X55A 1IZ6A 1B7YB 4JI6Q 4A3JH 1OTCA 4NPSA 2Q2TA 3D31A 1HZAA 4L5RC 1KXLA 1A8VA 2ZJRA 2KHIA 4JI2Q 2KCMA 2ZJPA 1W2BA 1QZGA 3ERSX 1PYBA 4DK3C 1UE7A 1KRTA 1K9MC 4B3RQ 4DR5Q 1HNWQ 4NXNL 1K83H 2E5LQ 4NXNQ 5M3FH 4BY7H 4DV3L 1NY4A 1B8AA 4LUZA 4PG3A 2VQFQ 1IBLQ 2YYZA 2F4VL 3KF6B 3GTKH 4P72A 1U5KA 3F2BA 4GNXA 3RR5A 1VQ9A 4IPGA 3HOYH 3PUVA 1SFOH 1K8GA 1VS0A 2Z6KA 3EIVA 3JC66 4IPDA 4APVA 4X64L 1YJWA 1YITA 2CCZA 1D7QA 2YTYA 2R7ZG 4JG2A 1Q1BA 1H95A 1JJ2A 2GN5A 1EWIA 1Y1VG 2BA1A 2CWAA 3A0JA 3M9BA 1BKBA 4YY3Q 1XNQL 4A3BG 2R93G 2YTVA 3K0XA 3JAMc 4DV7Q 4JI4L 3B6YA 4GOPB 1VQ7A 3RLNA 4DV6L 4DV1Q 5GAGC 1IBML 1IBMQ 1S40A 3CPWA 1WOCA 4JOIA 1I94Q 2PMZE 4GLVB 2ES2A 4GNXB 3TS0A 1HJPA 4DR6L 1N36Q 4UP8A 4AH6A 3KJOA 3RN2A 3I2ZA 4DR7L 1N32Q 2UXBL 2UXBQ 2UXDL 4L5TA 3J80c 1JE5A 3CCUA 4LF6L 4LF6Q 1EQRA 5C4JH 4BBSG 3D0FA 1ASYA 4XTCS 1FGUA 3UDFA 2R7ZH 2R6GA 2AMCB 1RIPA 3CQZH 4O2DA 3CCMA 1Y1VH 1Q46A 4MZ9A 4A3BH 2R93H 1QUQB 1NE3A 4JOIC 4DV4L 3AQQA 1VQBA 3F2DA 4UY8C 4A93G 3FKIG 3I4OA 3EN2A 4JI1Q 1OXXK 2JA9A 2K50A 4HJ5A 5LMNW 3AEVA 4JV5Q 3CW2C 4YWLA 3KOJA 1UWVA 4JCVE 4QL5A 1PH5A 3S15H 1EIYB 4LFBQ 5HGQA 1KQSA 4PZ6A 3E0EA 1L1OC 3OTOQ 2JA7G 1EIFA 5GAHC 1E1OA 1TXYA 1CUKA 2D62A 2IT1A 4X62Q 2QGQA 1XMQL 1PH3A 3RLOA 4AYBE 1A0IA 4QQBX 4HJ7A 5J3BA 3OW2A 5IE8A 4POGA 2E2JH 3PO2G 4BBSH 3CCSA 4OONA 5IP9G 4DV0L 3ULJA 4IOAA 3HKSA 2K5NA 2N8NA 1MIUA 1VQMA 3HFZB 1IL2A 1UE1A 3S1RH 2UU9Q 2Y0SG 2OWOA 2ASBA 3L0OA 5C3EG 2OQKA 4A3GG 2R7DA 3FKIH 4YWKA 4A93H 2ZTEA 4UP7A 4HJ8A 4LF8L 1N34Q 1A63A 3CCEA 3BU2A 1OXVA 1XMOQ 1EFWA 1HZ9A 3S1QH 3CP0A 3CCLA 4EQ5A 5C0XI 3UE0A 2NVQH 3STBD 4DR1Q 3RLFA 3DM3A 1B70B 2JA7H 1N33L 1O7IA 4A75A 5AJ3Q 1VQIA 1JT8A 1X6OA 4A3MG 2JEAI 2JEBI 4R4OA 2KCTA 2EIFA 4LUOA 4GKJL 4IJHA 3U4ZA 1PHJA 3PO2H 5IWAL 1YVCA 3S16H 5IP9H 4GN4B 2MFIA 1VQ6A 3M4QA 1KD1C 1HNXL 5JJIA 3PV0A 3TQYA 2UXCL 4B3SQ 1WYDA 4IOCA 1Y14B 4JI3L 1NMGA 3S24A 4A3LG 4Y52H 3GTMH 4A4IA 4LF4Q 4R4QA 4C3IH 5C3EH 1G51A 1KHIA 4A3GH 1TWAH 1TWCH 3K8AA 1CKNB 4LF9Q 2B63G 5C0XG 1Q1EA 4DV5L 3J7A5 3CCQA 4DV5Q 4YHHL 1GO3E 3E9HA 1EQQA 2KENA 3U4VA 4ALPA 1V1QA 1VQ4A 1PH9A 4OX9L 1XTDA 4JI0L 1GKHA 4WJ4A 3PO3G 3ER0A 4C3HH 4A3MH 4QIWE 1WCMG 1K73C 3I4NG 2Y0SE 1Q82C 4DR3L 3I56A 1BVSA 2F52A 3T1YL 1PFSA 2D0PA 2AWOA 3GO5A 2MO1A 4R1JA 4GLXA 3KLWA 2ALYB 4JBKA 4DV3Q 1VQGA 5BR8L 1QVCA 2JQOA 2F4VQ 3KDFB 5IP7G 3GTPH 5FLXc 4X65L 2VS1A 2OTJA 1XPOA 4A3LH 4LF5L 2PQAB 1OXSC 1U0LA 3HOVG 2CFMA 4K0KL 1KRSA 1Q86C 4WJ3M 3TS2A 2WB1G 3H0GG 4RG1A 5M5WH 4X64Q 2B63H 3F8TA 3HKZE 1N9WA 2LXKA 1QZHA 2FXQA 3K81C 3J80i 1M1KC 5IYDG 1PYSB 1VQDA 1Y1WG 1XNQQ 4DAYB 3H3VI 3PUXA 3U58A 1JB7A 3PO3H 3BZKA 4AYBG 1C0AA 1IXRA 2E2HH 4JI4Q 1RL2A 2AWNA 3RZDH 1WCMH 1VQ8A 2OTLA 4DV6Q 3I4NH 1VQKA 2A8VA 3WWVA 1ASZA 3GTQH 3RZOH 4LF7L 1TWFH 2BH2A 4DR6Q 1NBWA 1WFQA 4A3KG 4DR7Q 5IP7H 2CWPA 1A62A 3J7ZC 1M90C 2I0QA 2UUCL 2UXDQ 3CC4A 3HOVH 4C2MH 5IYBG 3W1GA 1LM0A 1HNZL 3GTLH 3W5OA 3CF5A 4JBWA 2VW9A 1YZ6A 3H0GH 5C0XJ 4HJ9A 2JK8A 1L1OA 2VY3A 5JEAG 3HOUG 5EAYA 1I50H 2KBNA 2PNHA 4YCUA 1YJNA 4A3CG 1KL9A 1PH8A 2JJQA 5IYDH 3TEHB 2Q2HA 1Y1WH 1LUZA 4LFAL 4KI0A 4LFAQ 1VQ5A 3PGZA 4DV4Q 4B3ML 5ELOA 4B3MQ 3I55A 1N8RC 2AKWB 2VL6A 4JYAL 2K14A 3GTGH 3GDEA 3FHWA 1HR0W 4JI7L 3T1HL 3PF4A 4JI7Q 1SN8A 2WB1E 2V1CC 3FP9A 1VQLA 4X6AH 2R92G 2JE6I 1AH9A 4A3KH 1JMCA 4B3TL 4LW1A 4B3TQ 1SR3A 1JJCB 5FLMG 1XMQQ 5H1SE 1VQJA 1WI5A 1NJIC 5IYBH 5HY6A 2VNUD 3CAMA 2ID0A 2NVXH 2R7FA 1CKMA 3NEMA 1PH1A 2DUDA 1PH4A 4R4CA 1C7YA 4DR4L 3HOUH 2IY5B
chains in the Genus database with same CATH superfamily
2KHJA 4N9PA 4TVAB 2SOBA 2IHEA 1LTLA 3NPPA 4HIMA 4CDEC 1STAA 2D0OA 1JB3A 5GAEC 4PZ7A 2QEXA 4M8AA 3SGIA 5EKIA 4N8X1 4K2LA 3TRZA 2Z4HA 4FXKC 4AIMA 1SNCA 4DV2L 2GVBA 1SE8A 2HHHL 4LUVA 4GKJQ 3A55A 1KNAA 1JWUD 5E4WC 1H9SB 4JI8L 1TWHH 4JI8Q 2F3IA 4PV1C 3CXCA 2B2YC 2HQLA 2L4NA 1WJJA 3CHBD 5IT9c 2UUAL 1KDAA 3G6EA 1SYBA 2B2WC 1KLUD 3PUYA 2EY5A 3R8BA 4DUYL 2BDNA 4DUYQ 1F9PA 4DXGA 1KTKA 2DGYA 2K03A 2O2LD 4CDFC 5C4XH 1EYDA 2KECA 4WJWA 4AQYL 3UE1A 2IHFA 1Y69U 1RCVD 3EQLC 2XIWA 3HS0C 5EBCA 4HEDA 2RBMA 1MJCA 5D3IB 3T1YQ 1SEBD 3JAMi 1I5FA 5M9OA 4JBJA 2N3SA 2EVBA 3CCJA 3HOWB 3OSOA 1YHAA 4HSVA 1RTNA 2PI2A 5JVG3 4ME3A 4CKCA 1IBKL 1IBKQ 3J7YW 1GUNA 1S5FD 4Y7NH 4UP9A 4BY1H 2ZTDA 5CV4A 1IBLL 1LT4D 1ZXTA 1P16A 3PQIA 4HJAA 2I5MX 1FR3A 5EJWA 3A5ZB 2Q2UA 4GKKL 4GKKQ 2OCEA 2JA8G 5T1GA 1BDOA 1D5MC 1EOTA 4YIJA 3BVZA 4BBRH 4DAMA 4IFDI 3ICEA 4YY3L 1AE3A 3UDXA 2NVTH 3R93A 1L0WA 3D4RA 3P1HA 4DV1L 1QUQA 1V43A 3AU7A 1R4QB 4A3DG 3HOWG 1U4LA 1X56A 1MD2D 2BCOA 3NQIA 3SR1A 2WAQE 4F7XA 2ICIA 1R9TH 4HIDA 3PF5A 4JBMA 4OO1H 3CRLC 5EBDA 2NN6G 2LFNA 4TRDA 4F87A 3S2HB 1EY8A 3I91A 4RGMA 1L1OB 1TKWB 5JJLA 2XNAC 5C5LA 3PSIA 4UHVA 4JI1L 4CDDC 2QEJC 1TS3A 2QA4A 2K5QA 4OXPA 1K83B 4LFBL 3CKIB 1Z47A 3HOZH 3U50C 3S17H 4KN7C 3Q6SA 4HN7A 1TVXA 5C44H 4NXMQ 3A7AB 1HTPA 3HOYB 2EQSA 1SFOB 1TT2A 5BN3A 4DR2Q 1YNND 1YNJD 4HIOA 4XDXA 4YCVA 2C35B 1F2YA 1YEZA 4GN5A 3OWFA 3OIQA 4IZ8A 1F2LA 4BXXG 1QVGA 5NUCA 2KA7A 4PZ8A 2UU9L 4EGVA 3WDNA 1LTBD 1IKLA 1CSQA 3G7LA 2A68D 3T4AC 1X3GA 3S1MH 1FNVA 1U9RA 2K5DA 4Q0FA 1HR0L 1AZQA 2MJ8A 1HR0Q 4WFN3 1ZYRC 1K28A 1STBA 1VF5C 3AYHB 2IX0A 3K7UC 5GADC 1UE5A 1OXUA 3F2CA 1TIID 4OIJA 1BUVT 2VQEQ 1I6VC 3PUZA 2WP8J 2HIXA 1LT5D 3A8KE 3HOYG 3TREA 1I3QH 2ZM6Q 2R93B 2VUMH 1NTGA 4OO1I 1SRUA 2Q2IA 3L2PA 2ENBA 3SXHA 4JI6Q 4A3JH 2Q2TA 1HZAA 3H91A 1KXLA 1A8VA 1O78A 1W2BA 5KYIA 4JI2Q 4DK3C 2YU9B 3C3LA 1FNWA 1LT3D 3W3AA 4DV3L 2E2JB 1G8ZD 4RFBA 3KF6B 3GTKH 1SE3A 1U5KA 2PQEA 1JOQA 4G7ZC 1VS0A 5IGFA 4UAIA 3EIVA 1AN8A 1YITA 4A93B 4OL7A 2CCZA 1F77A 4C56C 2A74C 4K8JA 3A0JA 2BA1A 1XNQL 2R93G 5IODA 4IUQA 3K0XA 5TSSA 5DAUA 4BWGB 1VQ7A 2G9DA 3NQTA 3RLNA 4DV6L 2F0IA 1UEAB 3CPWA 2LMCB 4C1NK 4ZK9B 3S1NB 1ZEQX 3OPOA 4DR6L 2EOTA 4AH6A 4DR7L 1N32Q 3K0YA 3VA5A 1JE5A 3LX0A 3CCUA 4LF6L 4LF6Q 5I9PA 2Y0SB 5HGTA 1JWSD 3I70A 4TSSA 3CCMA 3BDOA 3NXWA 1GHJA 1M8AA 3F2DA 4A93G 1GXDC 3TDQA 3EN2A 1HQRD 3AEVA 4IALA 5CV7A 3T56B 4X3KA 2Z9HA 5HGQA 1MGSA 2F0PA 2IT1A 5KEEA 4RCNA 2ZXPA 3KF8A 5HURA 4QQBX 4HJ7A 3OW2A 4POGA 1X32A 1KABA 4L8JA 2Z8LA 2F0QA 4BBSH 4IOAA 3MTSA 4IUPA 2K5NA 3IKJA 3BVMA 4ILWA 1II3A 4C3IG 2Y0SG 3P7JA 4OGQC 2B2TC 1GUSA 2OQKA 3FKIH 1V8QA 2ZTEA 4UP7A 4HJ8A 1N34Q 1A63A 3BU2A 3RZDB 3I4NB 1DM0B 2Z1CA 3J7AV 4J6HA 2NVQH 3RLFA 4HCSA 1B70B 2JA7H 3J7AF 5AJ3Q 3L9AX 4CGYB 2KCTA 3C1FA 4JPBW 4PQXA 1PHJA 1YVCA 2J7ZA 3GTLB 3S16H 5IP9H 4GN4B 4DAVA 1DONA 1KD1C 5E4XA 1HNXL 1I50B 2UXCL 4XQNA 1Y14B 2FJ2A 4Y52H 4A4IA 4LF4Q 1L0XB 5C3EH 1TWAH 1UAPA 3K8AA 4AYBB 5D3DA 1CQVA 1Q1EA 2F0GA 3CCQA 1V1QA 1XTDA 3HRZC 2EYJA 1DJRD 5ELCA 3ER0A 2RDGA 4P2CB 1SYFA 3I4NG 2MP1A 1NAPA 3P75A 4DR3L 1NCVA 3I56A 1BVSA 1FYCA 3H6MA 1PFSA 1HUNA 4PMCA 2L5TA 4GLXA 2RSNA 1RJTA 2ALYB 2R3ZA 3HGBA 4JBKA 3DEOA 2F0UA 1FD7D 2F3VA 5BR8L 4ZLTF 2F4VQ 5FLXc 2WKCA 2VS1A 2AQ1B 3E6ZX 2CFMA 3S1RB 4K0KL 2PCFB 4WJ3M 3KLRA 1EWHA 4KMUC 4J8QA 1ML0D 2FXQA 1M1KC 1IW7C 5IYDG 3GV3A 2GA4B 1FNUA 3NBHA 4DAYB 3U58A 3PO3H 4AYBG 1C0AA 1IXRA 1QCBD 2CH4A 2KOLA 1VQ8A 1JICA 2F0OA 3ITPA 3WWVA 5IGDA 3JAML 4K5XA 1ASZA 4HCEA 1PFMA 1PLFA 1PRTB 4LF7L 1TWFH 1MBYA 1PRTF 1NBWA 1C8CA 4CJ1B 5IP7H 1ONLA 1SYGA 2UUCL 3CC4A 3HOVH 3P20A 3TMEA 2RKSA 3W5OA 3CF5A 2JK8A 4KHVA 5JEAG 1JOOA 2KBNA 2F0FA 2PNHA 4A3CG 1KL9A 4O1NA 1D5ZC 1LUZA 3PGZA 4DV4Q 4M1UB 2AKWB 4JYAL 4B9XA 3W2DA 3EFXD 1C4QA 3FHWA 3MZ5A 3PF4A 1CK1A 1SN8A 3K57A 5ELDA 5C4ZA 3HKZB 2BE5C 1KLGD 1JMCA 4DGZA 5FLMG 2HDLA 2VB3X 5H1SE 2J4XA 1HFNA 5IYBH 2VNUD 1ET9A 2ID0A 4C3JB 3TBIB 2R7FA 3MFGA 3R3OA 1PH4A 1RHPA 2X6LA 3HOUH 1Y8OB 2B63B 4DV0Q 1A6XA 3BJUA 3M85A 3VDYA 2YTXA 1EWCA 4A3FB 1NNXA 3GQBA 1C9OA 2XRSD 4MN3A 2NTSA 2B2UC 5G3LD 1VMPA 5I2YA 1Z7TA 2I46A 2MQHA 5KNBA 5M3MG 1E1TA 1VQCA 3J81i 1B50A 3MXUA 5M5YH 1C48A 1V1PA 3RZOB 2R92H 4OIKA 5EPJA 1PH6A 1N33Q 1EU4A 1J5EL 3K7AH 2OQ0A 1SROA 1X3FA 2ZXOA 3HKZG 5JEAJ 1ZYRD 2PNRC 5IWAQ 2B29A 2KCNA 4FNFA 1JE4A 1E24A 3ULLA 4C3JG 2JA5H 3A5UA 1E0BA 4TQUS 3KYHC 4PMWA 1A15A 5LMNL 4FDBA 4P74A 2EY1A 1Q12A 1T9HA 1Z6HA 4FO2A 5ELNA 4YHHQ 2FMCA 4A3FG 2O5JC 2YV5A 5IY0A 3HOXH 4I7ZC 1MJEA 4OX9Q 3M4OH 4DUZL 4JI0Q 3E9IA 1EY9A 1J6QA 5BN4A 4GLAC 1HA5A 3S14H 5CV9A 3GTJH 4DNTB 3CD6A 1XPUA 3NWTA 2IX1A 3NHHA 2FMMA 4NDXA 4YWMA 4X65Q 2B3GA 2A1AA 4ZUIA 4LF5Q 2IW3A 3DMUA 2EXZA 1HQMC 3TZDA 1QE6A 4G4KA 4DKAC 5ISRA 3UI2A 4B3RL 4QGUA 4DR5L 1HNWL 3NBIA 4H13C 4GOPA 1Q7YC 5KNCA 4OWXB 3KJPA 3OYYA 3Q22A 1VQFA 1GVPA 2VQFL 2VZAA 5LL6S 1KNEA 4RHSA 1RD9D 1HA6A 5KNDA 4L5SA 4LJZC 1FVIA 1S3OA 3Q0AA 1WD0A 3KUPA 2H5XA 1E22A 1CA5A 1CKOA 1EZ8A 5M5XH 2MUYA 2NN6I 4DV7L 3I7FA 4EVOA 3NTKA 3JAME 1B4OA 4IUUA 4A3IB 1VQPA 2K4KA 2AHOB 2N78A 1IYJB 1NMFA 3HG9A 1I94L 1CM9A 4KY7A 4XT1B 3NTHA 1N36L 4C1NI 5IYCG 1IYUA 3D4WA 1K8AC 3IL8A 3T1HQ 2SDFA 5EKLA 4A3EB 1EY7A 1TWGB 3EROA 2IJ0A 1D1IA 2RCFA 2XWJB 5L37A 2X69A 2E2IB 4JK1C 3IAYA 1E3PA 2OT2A 1B53A 2ATWA 1HZCA 3WOEA 3L7ZC 2JA6H 1U4MA 3I4MH 3CC7A 2EDGA 1VQHA 2K28A 4JV5L 1O7YA 2K33A 2R61A 4A3IG 1MSHA 2YU9H 3V2TA 1MKHA 2G9HD 3MEFA 5CV8A 1DGSA 3CMEA 1IKMA 1CHPD 4IFDH 3LGJA 3R2TA 4DV2Q 4A3EG 4OWWB 5GQOA 3NELA 1QILA 1K3RA 2HHHQ 1DOLA 4BA1I 1ET6A 2NZHA 3CCVA 3I3CA 5D14A 1AW7A 2L9HA 5FJ8H 1HFGA 1XMOL 2UUAQ 1TR5A 1BOSA 1E7ZA 2ZTCA 4EX5A 2A6HC 5K36H 3CC2A 3EA6A 2A19A 2D2CC 4V190 2A5HA 4U673 1BBWA 4S3SA 2CQOA 1XWEA 1FJGL 3M3YH 1FJGQ 3ZYYX 4WORA 4AQYQ 3S1NH 1EYGA 4BY7G 1G6ZA 4XQQA 1HH2P 1QNKA 1EQTA 2RHSB 3PCOB 5BN5A 2JA8B 5LHY1 3A7LA 3UDGA 1Y1VB 1SNOA 1YBYA 4A3BB 2ZT9C 3KDFA 1GUOA 1XPRA 3GP7A 1PTOB 1VQOA 2Q8RE 1PTOF 2N88A 5JJZA 3OWEB 4A3DB 3D31A 1F9RA 2SNSA 2ZJPA 3ERSX 1BCPB 1BCPF 1JR0D 3SK4A 1K9MC 1E2WA 4HAEA 5M3FH 5JOBA 1IW7D 4PG3A 3H3VC 1IBLQ 2I07B 4P72A 1VQ9A 3F2BA 2KHSA 1STYA 3JC66 4IPDA 1EY5A 3TP7A 2EY6A 3H94A 2YTYA 4JG2A 1H9MA 1JJ2A 1Y1VG 4FVMA 4YY3Q 4A3BG 1MHWC 3DWAA 4JI4L 4RA8A 4DV1Q 1NUCA 1STHA 2RA4A 1PRTC 1WOCA 4JOIA 3TS0A 2VB2X 2NYZD 3NUCA 4EQNA 3RN2A 1T5XD 3N6RA 2UXDL 3Q23A 3J80c 4F88A 1RDPD 2B2VC 2CVRA 1EQRA 3U9OA 3D0FA 4IUVA 1TWCB 1UNSA 5FO8B 1ASYA 4A3GB 1FGUA 2R7ZH 2R6GA 3CQZH 3C1EA 3FMCA 1QUQB 2KEDA 2QKIC 3AQQA 1WTPA 1I4QA 4DAPA 4JI1Q 5F2DA 5EQ0A 3KK7A 2QILA 4U68A 1UWVA 4KY6A 3S15H 4HTHA 4LFBQ 1KQSA 2NBFA 3E0EA 3HEJA 2F4IA 4OEMB 1CUKA 2QGQA 1PH3A 4AYBE 2EYHA 5J3BA 5IE8A 2JYOA 3PO2G 2OXPA 4KTAA 4OONA 3ULJA 2PMZB 3HKSA 5I4DA 2EZVA 1MIUA 3HFZB 1UE1A 3S1RH 2UU9Q 4A3GG 2R7DA 5FOBB 4LF8L 2E2HB 1X3QA 3SHLA 5IGCA 3UE0A 1CT1D 2RQXA 3QR8A 2WACA 2F0VA 3S9WA 1JT8A 1X6OA 4K6LA 2JEBI 4R4OA 4LUOA 3V05A 1SDFA 4IJHA 5C4JB 1VQ6A 2Z6BA 3TQYA 1EY4A 4IOCA 4JI3L 1JOKA 4A3LG 4R4QA 1Y1WB 4LAAA 1G51A 1KHIA 3ND9A 3MXNA 5C0XG 4ABNA 1ESFA 3J7A5 1GO3E 1ILPA 3SEBA 2E76C 2NB0A 4CDCC 4C3HH 4A3MH 1PZJD 4A3KB 1K73C 2F52A 4KK7A 2DNCA 2AWOA 3CRKC 3DHQA 1MSGA 2AUKA 1F2MA 3KLWA 4K14A 4DV3Q 3OMGA 4FF1A 1QVCA 2JQOA 4QB4A 1AEXA 1XPOA 1U0LA 2A6EC 2JSOA 1A3VA 1XTCD 2WB1G 5M5WH 2B63H 3F8TA 3HKZE 2LXKA 1D2BA 3J80i 3S1QB 4LMQD 2RDHA 1VQDA 1Y1WG 1XNQQ 3BZDB 3H3VI 3PUXA 1JB7A 4K8IA 3SDZA 3SVMA 1WCMH 3FRPB 4DV6Q 4NW2A 4FP5D 1TS4A 3RZOH 2BH2A 4DR6Q 3OHXC 1LO5D 1WFQA 3NSWA 3SK6A 4A3KG 4DR7Q 3BG3A 1A62A 1M90C 4ZQ3A 1BBXC 2I0QA 4RHRA 1WTRA 4C3IB 4HJ9A 2HD3A 1WVLA 1EIYB 3H0GH 5C0XJ 4YCUA 5J22A 2IX3A 2Q2HA 3MWYW 1VQ5A 2JP1A 3SK5A 3A56A 4K2KA 1N8RC 2K14A 2EJGC 4KJOA 4JI7L 4JI7Q 2K04A 1BF4A 2EYPA 2V1CC 4RGOS 3DEPA 4NMZA 3BYYB 1GUTA 3EVQA 4B3TL 4B3TQ 2AUJD 1SR3A 2F0NA 3GTPB 1G2SA 5HY6A 1XYIA 3CAMA 4DR4L 3NEMA 1C7YA 4MIUA 2CQAA 3BDLA 5EGTA 1PV4A 2L12A 2QCPX 1D8LA 2F0KA 4X3SA 2HIVA 3RNUA 4Y7NB 3PIPA 1V1OA 4BY1B 3FPPA 3MXPA 4RCOA 1VDZA 3S2DH 4CBVA 1AE2A 1TQOA 4JI5L 3PMFA 4POFA 1YHQA 5C4XG 3KF8B 4IJLA 4KKUA 3GTQB 1P8LA 3CPFA 2RHQB 4ZCKA 2NVYH 5DNFA 2A6HD 2F0SA 1HCZA 4BBRB 4UPAA 3NWSA 2OF1A 2L1BA 3STBC 1SMXA 2AQ3B 1HNXQ 2F0HA 2F0MA 2UXCQ 1QVFA 3G71A 1TY0A 1X3EA 4X66L 1PXUA 2Z0SA 3F2UA 4X66Q 4XIGS 4NP5A 3C46A 2NZOA 1R9TB 1NR4A 4H02A 4BY1G 2DY8A 1W6JA 5I2XA 2K75A 3QO2A 1PMRA 1O80A 1L0YB 3J81E 4DR3Q 2B39A 4OWTB 1IYVA 3BZCA 3ULPA 3GD7A 2NVXB 2RF4A 4RWSC 1EU3A 1PTOC 4QUCA 3K6OA 1W3SA 5BR8Q 3DLLA 2E2IH 2GVAA 1BBUA 1STGA 3VR5A 4BBRG 4ZRZA 2WAQG 1G291 1SAPA 4K0KQ 1G6PA 1BCPC 3RN5A 4E6IA 1VQEA 1EYAA 4QY7A 3S17B 5T1IA 2E75C 4IO9A 4IPHA 2E5LL 2MGSA 2KJXA 4HMIA 4EQPA 2L55A 4J15A 3I90A 4H7BA 3OMCA 4ULLA 2PW7A 2NWGA 1F9SA 5FLXE 3IRBA 4OO1G 1K8MA 5ELEA 4LF7Q 1BQQT 2K32A 5FO9B 1PRTD 4DNIA 3Q8DA 2K5VA 4K5WA 3UDIA 4ZAIA 4O42A 1EFID 2UUCQ 2E2DC 2RCNA 1TS5A 1GM5A 3NBHB 4XYOA 5M3MB 3R2IA 1CA6A 3MEHA 1SXTA 4JYAQ 1S72A 2EJMA 3HOZG 1SE2A 1LTGD 5C44G 2E8GA 3KFUA 2FHTA 2A73B 1EY0A 2I5LX 1STNA 1I3QB 4MTNA 1D1KA 2K5HA 5CORA 2VUMB 3DUZA 1WTXA 2Q8IB 2WKDA 2JA8H 1E2ZA 4ZKCB 4A3JB 1LABA 1OXTA 1SMYC 1WTVA 1JJGA 3QJYA 1Z9FA 5LMUL 4HMJA 5LMUQ 4A76A 1EOVA 2KCCA 3HOWH 4LWCA 2M9VA 4A3DH 4QUFA 1SNDA 1LYLA 2N49A 4GZYC 4IUTA 3OTOL 2XTIA 5JPMC 4R8NA 4X62L 1YI2A 3GTKB 1KIXA 3K80C 3A8JE 4ID6A 3CU7A 3DWQA 2NN6H 3QOLA 4R4TA 3MVVA 2OEOA 4RH6A 3VYRA 2RDFA 5ELFA 4F8MA 1J5EQ 4QMGA 4ODGA 1HZBA 4KHZA 1XXGA 1OO9B 4P71A 3TSSA 4XXEA 2VUMG 1XNRL 3CMAA 1XNRQ 2HCCA 4I7AA 1CKNA 1ENCA 1JCKB 4DR1L 4A3JG 1R4PB 4R4IA 5IT9L 1I6HB 5LMNQ 1V1PB 2WFWA 3EBEA 1CHQD 2B8FA 5GROA 1EL0A 1I4HA 5JJKA 4YCWA 2UUBL 4DUZQ 2UUBQ 3GTOB 1X54A 2JN4A 1CSPA 4B3SL 2PI2E 4BXXH 4PNYA 3PIP3 3T53B 3QOJA 1YNXA 4LF9L 3S2HH 1PH2A 2PQAA 2I5HA 1SLJA 2EJFC 2XGTA 3PUWA 5DM63 2PW5A 1IZ6A 1B7YB 4QCLA 5IOCA 4L5RC 2KHIA 2KCMA 2XVSA 2A6ED 1UE7A 1DYQA 1KRTA 4B3RQ 4DR5Q 1HNWQ 4DNRB 4NXNL 1K83H 4NXNQ 1SE4A 2AQ2B 1NY4A 1B1ZA 1B8AA 4LUZA 1ICWA 4KKSA 2VQFQ 3LWEA 4DK1A 4GNXA 4IPGA 3HOYH 2V4DA 3PUVA 1SFOH 1K8GA 2Z6KA 1QG7A 1H9JA 4APVA 2KUMA 1KDBA 4X64L 4B9WA 3QG1A 1D7QA 1O7LA 1A2UA 1KAAA 1DZ1A 1H95A 1Q1BA 4L6TB 1EWIA 1ILQA 2CWAA 4R8IA 5LL6X 1ESRA 3A8IE 2YTVA 4CKEA 4K5VA 3JAMc 4DV7Q 2QDLA 4GOPB 2JA7B 3FPUB 1ENAA 5GAGC 2L0CA 4OELB 1IBML 5CYUA 1IBMQ 1S40A 1G91A 1I94Q 2PMZE 3VA7A 5A2QL 1DOKA 4GNXB 2CW0C 1N36Q 4UP8A 3S16B 5KYLA 3VR4A 2IL8A 5I9OA 1EY6A 4HR7B 5C4JH 5I6YA 5C3EB 4BBSG 5ELBA 1S5DD 1TWAB 4ZKBB 1KDCA 3UDFA 4O2DA 2AMCB 1RIPA 5CV5A 1B9MA 1EEFD 2CHBD 2R93H 1W6KA 3NK9A 4UY8C 3FKIG 3VYTA 3D3RA 2JA9A 2K50A 4HJ5A 2Z4IA 4JV5Q 4YWLA 3KOJA 2NTTA 2B2TA 4QL5A 1TU2B 2FFKB 5JPNC 4BY7B 2F03A 2JA7G 2PZTA 1E1OA 1TXYA 5GAHC 1XMQL 3RLOA 1A0IA 3I72A 4G7OC 2WV6D 1S5ED 2E2JH 3I8ZA 3CCSA 3EJIA 5IP9G 2EYOA 3M4YA 4CJ2C 4R9WA 1QOHA 2N8NA 1GUWA 2FINB 1GOZA 1H9SA 1S4ZA 4XQJA 2ASBA 5C3EG 4A93H 3PO3B 5CBAE 4H0LC 3DWPA 1OXVA 1XMOQ 3S1QH 3TZUA 1M4VA 2DY7A 5CR3A 5C0XI 3GV6A 3STBD 2F0EA 3E0JA 3DM3A 1HPCA 1EEID 1S5BD 1TWFB 4A75A 1VMCA 4N8FA 1J8IA 3RD4A 4GKJL 3TN2A 3HOVB 3U4ZA 1MI2A 4IUNA 5CGKA 5JVH3 2MFIA 1HUMA 2F0LA 1CFMA 3PV0A 1WYDA 5IT9E 3S24A 4C3IH 2KVMA 5COYA 1SYCA 5EPKA 4OHJA 1SNMA 5CC4A 4DV5L 4DV5Q 3NTIA 4DA2A 3FVQA 1PTOD 2K7VA 4ALPA 1GKHA 3HZXA 3PO3G 5KGUA 2JXMB 4FXGC 2Y0SE 1Q82C 3KLSX 1BCPD 3T1YL 3GO5A 4R1JA 1VQGA 3HOUB 1FGBD 3KDFB 5IP7G 3GTPH 4FYDA 1BXTA 5E3FA 2IWHA 3HOVG 1JC7A 1Q86C 1CZGA 2SNMA 4RG1A 3SK8A 5C5MA 2EE1A 2WIIB 1N9WA 5IGGA 4FF2A 1GUGA 5M5YB 4Q5VA 5CBEE 4JI4Q 2R92B 2F0JA 3ND8A 2NUCA 1RL2A 3RZDH 3I4NH 1IHZA 3MXGA 2B8GA 3K7AB 5K5PA 1B44D 1LTAD 3GTQH 4KD4A 3PO2B 4G57A 2H1EA 3AB9A 1F9QA 2UXDQ 3J7ZC 5C4HA 5IYBG 1LM0A 1PZKD 4QIWB 3GTMB 3GTLH 2JA5B 2VY3A 1L1OA 2DJGC 3HOUG 1I50H 1AFPA 2BE5D 1WTHA 4Z9CB 5A2QE 1PH8A 5IYDH 3TEHB 3VYSA 1QB5D 4B3ML 2PPBC 5ELOA 4B3MQ 3HOXB 3M4OB 1EIHA 1B2TA 2WINB 3H09A 4BS9A 3GDEA 1HR0W 3E3XA 5IGEA 4RKLA 2KQ3A 3FP9A 5IGBA 3J80E 1VQLA 1SMYD 1A2TA 4MHEA 2B2UA 2K6AA 3S14B 3GTJB 1K0SA 2R92G 1LTTD 4N9TA 4LW1A 1VQJA 1WI5A 2NVXH 1PH1A 1QNUA 5JEAH 1PZID 4A3CH 1PVOA 3H3VH 3O13A 5DLQE 4DPGA 1H9RA 2JA5G 2XWBB 1FL0A 1VCIA 5FO7B 2A69C 4LF8Q 2X6GA 4NXML 2XN9C 2HUGA 4H44C 1EZ6A 2ZXRA 3HOXG 4DR2L 1UUPA 2E74C 4EQOA 5FLMH 2EXDA 2K52A 1UE6A 4C2MB 5M5XB 1GHKA 4GN3B 3VYUA 2M2LA 2WB1B 1Y8PB 1A3UA 2VXWA 1B3AA 3A54A 1I4RA 4JI3Q 5J39A 1HNZL 1UEBA 1BO0A 5CMDA 3J81L 1HNZQ 2LXJA 3A74A 4NKLA 3ZJYC 5M3MH 4DF7A 1Q81C 3J81j 4NB3A 3GTGB 1Q90A 3W1BA 2MO0A 4PMBA 4LNQA 3RMHA 1X3PA 3E5SA 5E1FA 1PH7A 2F0TA 3LWUA 2VQEL 1S5CD 3X3NA 2ZM6L 1F2ZA 4KLKA 3V96A 3KF6A 4WRDA 1PA6A 2JA6B 5JAVA 3I4MB 4IQZA 4C3JH 1TY2A 3I73A 3MXNB 4JI6L 3BDCA 5C3WA 2O4XA 5FLXL 1QJOA 4JI2L 4A3FH 4HIKA 2EPBA 2EYFA 4O0AA 2H4OA 1L2FA 2CKZB 1Q8KA 4JW0A 1Y8NB 3URYA 4IURA 3OOCA 4FXDA 3G4SA 5CV6A 3K58A 4I65A 4BA2I 1ENFA 3M4PA 1TWHB 1B3QA 2BA0A 1KC8C 2CW0D 3WOFA 3VR6A 1WD1A 4HSPA 4GOPC 2SEBD 4J1MA 2LSSA 1XJVA 2HQEA 3BYTB 2JA6G 3I4MG 1CI3M 3TP5A 4GNXC 2TMPA 4DFAA 2Z6KC 3M3YB 5C4XB 1I6HH 2D9UA 3K59A 1N32L 1O7ZA 3OW7A 3MAQA 1YHBA 4RMFA 3GTOH 4IFDG 2LY7A 2HCIA 4IPCA 4L5QA 3H15A 3T51B 4KHPL 4KHPQ 1SBBB 4DR4Q 2MNAA 1DD2A 2IPKD 1NR2A 1STEA 5FJ8G 5E7NA 2G5DA 2NZ1D 2F1MA 4ZYSA 4JVZA 3CCRA 5K36G 1X65A 3K5OA 5M3FB 1EQVA 2KEEA 3ERQA 5IYCH 1EUJA 2B2YA 4JC0A 1JQYD 1U4PA 2J0TD 4RGTA 4DK6C 4JI5Q 2B2WA 4V0BA 4QJFA 1LT6D 1VQAA 2F0WA 3G6JB 1YJ9A 4GS3A 4DN4M 3NE5B 1SJHD 2WAQB 3M7NA 4RKBA 1KAWA 4P75A 3KLSA 4TKOB 2NVTB 1VQNA 3VR2A 4KY5A 1N34L 5D65A 3D8GA 3M7GA 4ME5A 3AFQA 2K05A 2ZJQA 1DOMA 2M00A 4FF4A 4MNOA 1WTQA 5A35A 2RVLA 3T16A 3NENA 4B08A 4X3TA 5KIXA 3PIOA 1V9PA 4A3IH 1CTMA 1RTOA 5AJ3L 3K5MA 1H9KA 1K0RA 3LNNA 2HT1A 4IFDJ 1J9OA 5M3FG 3T13A 3G48A 2D5DA 4LFCL 4G7HC 4LFCQ 1HRJA 4A3EH 2BH8A 3J81c 1ICFB 2L15A 3Q24A 1JORA 1TWGH 2R7ZB 3CQZB 1EYCA 2BDOA 4LF4L 1HTLD 3QIAA 3AFPA 2DNEA 4P73A 1YIJA 1X9NA 4DXFA 3F1ZA 1GD7A 1X55A 1OTCA 4NPSA 3S15B 1E2VA 2ZJRA 1QZGA 3HOZB 1PYBA 4DAYA 4L63B 4IN3A 5C44B 1GJXA 4LK1C 1EIGA 2XRQD 2E5LQ 4BY7H 1VF7A 3NP8A 2YYZA 2F4VL 3K5LA 3RR5A 4KV6A 1SYDA 2RSOA 5C6AA 1Q8IA 1PFBA 1YJWA 2P5ZX 2R7ZG 2EY2A 2B2VA 2GN5A 3M9BA 1BKBA 3S1MB 4DK0A 2QF7A 1QWYA 3B6YA 1SSOA 1K3BC 1Q3LA 2N55A 4GLVB 2ES2A 1HJPA 3VR3A 3QB3A 3KJOA 3I2ZA 1CZWA 1RF2D 1PYWD 2LKVA 2UXBL 2UXBQ 1IL8A 4L5TA 3TP8A 2C9OA 3MC0B 2MPMA 3DM1A 4XTCS 4X3UA 3IFDA 1Y1VH 1Q46A 4MZ9A 4A3BH 3MHBA 1PDQA 2Q8TA 5DEHA 1NE3A 4JOIC 4DV4L 1LV9A 1VQBA 3I4OA 1PTOH 4DU9A 4C3HB 1OXXK 4A3MB 5LMNW 2EYMA 3BS1A 3BVGA 3CW2C 1PH5A 4JCVE 2DN8A 1ZKOA 1TS2A 3IFTA 4PZ6A 3OTOQ 1L1OC 2ICEC 4MTKA 1EIFA 1SNQA 4X62Q 2D62A 1T5EA 5C3XA 4CJ0B 2C5CA 2A69D 2K5WA 3K5NA 2K01A 5AFWA 4DV0L 5M5WB 1CQFA 3DXJC 2F3WA 3FDTA 1IL2A 1VQMA 2O5IC 5EKKA 1K8OA 5G3LF 1JWMD 2TSSA 1WTOA 2OWOA 1BNZA 3L0OA 4YWKA 1LTSD 5FK9C 3U9SA 3CCEA 5KRUA 4KJNA 4XT3B 1WCMB 1YNNC 1YNJC 1HZ9A 1D5XC 1A3TA 3CP0A 1EFWA 1LTID 3CCLA 4EQ5A 3MA2B 1B9NA 4DR1Q 1SJED 4RAUC 4FF3A 1N33L 1O7IA 4C3HG 1LTRD 1VQIA 2EYLA 5DM73 4A3MG 2JEAI 4KKTA 3MFYA 2EIFA 2A68C 1HXYD 2PYKA 3PO2H 5IWAL 5J1ZA 1I4GA 3H0GB 3M4QA 5JJIA 5I6WA 4B3SQ 1D6EC 4ZUJA 1NMGA 3GTMH 4CKBA 2K1BA 4A3GH 1TWCH 1CKNB 4LF9Q 2B63G 4UDUC 2PZWA 4RGNA 1LLRD 4YHHL 2HDMA 3E9HA 1EQQA 1SYEA 2KENA 3U4VA 1VQ4A 1I4PA 1PH9A 4OX9L 1AP0A 4JI0L 4WJ4A 2XSCA 4QIWE 1WCMG 2D0PA 4QF4A 2MO1A 4BBSB 1I4XA 3KBXA 4X65L 3FEWX 2OTJA 2PO4A 3I4LA 4A3LH 4LF5L 2PQAB 1OXSC 4K6DA 3OIPA 1LACA 1HHVA 3PIO3 1G2TA 1KRSA 3L3OC 3TS2A 3H0GG 4X64Q 3FKIB 1WTWA 3KBGA 3RUZA 5C0XH 1AZPA 1QZHA 3K81C 3S2DB 1PYSB 3C2PA 2BOSA 2NVQB 3BZKA 2QDBA 3N52A 2E2HH 2LS01 2AWNA 2OTLA 2NVYB 2F0DA 3SE0A 1VQKA 2A8VA 3ONAB 4XYQA 1BR9A 5EPLA 2CWPA 3D4DA 2L11A 5IIFA 3D6WA 4C2MH 3W1GA 4JBWA 2VW9A 1YZ6A 1PFNA 2MHVA 3J80L 5EAYA 2QW7A 1YJNA 2JJQA 1U4RA 1Y1WH 4LFAL 3AMUA 4KI0A 4KN4C 5FKAC 1RKNA 1SNPA 4LFAQ 3X3MA 3I55A 1XX8A 2VL6A 1DXMA 3GTGH 4KD3A 3T1HL 2PZUA 1DCZA 2WB1E 3TP6A 3HP3A 2CH4W 4X6AH 3QWNA 2JE6I 1AH9A 1NSNS 4A3KH 1JJCB 1RODA 1XMQQ 4CHTB 1NJIC 2DJFC 1CKMA 2DUDA 3D6CA 4R4CA 2IY5B
chains in the Genus database with same CATH topology
4DV0Q 2KHJA 4A3CH 3BJUA 1PVOA 3M85A 4TVAB 3VDYA 3H3VH 2YTXA 5DLQE 4DPGA 1PV4A 2IHEA 1LTLA 1D8LA 2JA5G 1C9OA 2HIVA 4HIMA 3RNUA 3PIPA 1FL0A 1VCIA 2D0OA 5GAEC 2MQHA 4LF8Q 5M3MG 3S2DH 1E1TA 1VQCA 4PZ7A 3J81i 4NXML 2QEXA 1AE2A 4JI5L 3SGIA 5M5YH 4POFA 1YHQA 5C4XG 3KF8B 4IJLA 3HOXG 4DR2L 2R92H 3TRZA 1P8LA 3CPFA 2RHQB 1PH6A 4DV2L 2NVYH 4AIMA 1N33Q 5FLMH 1J5EL 3K7AH 2GVBA 2OQ0A 1SE8A 1SROA 1X3FA 3HKZG 2HHHL 2EXDA 2K52A 1UE6A 4LUVA 4UPAA 5JEAJ 4GN3B 4GKJQ 5IWAQ 2B29A 4JI8L 1TWHH 3STBC 1SMXA 2F3IA 4JI8Q 3CXCA 1HNXQ 2HQLA 1E24A 3ULLA 1WJJA 5IT9c 2UUAL 2UXCQ 4JI3Q 2JA5H 3A5UA 1QVFA 3G6EA 1UEBA 4TQUS 3G71A 1X3EA 3KYHC 4PMWA 3PUYA 2LXJA 3A74A 4X66L 1HNZQ 4DUYL 5LMNL 2Z0SA 4X66Q 3ZJYC 4XIGS 4FDBA 4DUYQ 5M3MH 1Q81C 4P74A 3J81j 1Q12A 1T9HA 4NB3A 3W1BA 2MO0A 2DGYA 5ELNA 4A3FG 2NZOA 4YHHQ 2YV5A 5C4XH 4AQYL 5IY0A 3HOXH 4H02A 1MJEA 3UE1A 4LNQA 4OX9Q 2IHFA 4BY1G 4DUZL 4JI0Q 3E9IA 3M4OH 1PH7A 1J6QA 2K75A 4GLAC 2VQEL 1MJCA 4DR3Q 4OWTB 3BZCA 3ULPA 3T1YQ 3S14H 2ZM6L 3GTJH 3GD7A 4KLKA 2RF4A 3KF6A 3JAMi 3CD6A 1XPUA 1I5FA 1PA6A 2IX1A 1W3SA 5BR8Q 3DLLA 2E2IH 4JBJA 2N3SA 2GVAA 4YWMA 1BBUA 2B3GA 4X65Q 2A1AA 4BBRG 4C3JH 3MXNB 3CCJA 4LF5Q 2WAQG 1G291 4JI6L 4K0KQ 1G6PA 1YHAA 3RN5A 4JI2L 1VQEA 4DKAC 4QY7A 2PI2A 4A3FH 4ME3A 4QGUA 4HIKA 1IBKL 4B3RL 4DR5L 1IBKQ 1HNWL 4IO9A 2E5LL 4IPHA 4GOPA 1Q7YC 4Y7NH 4OWXB 4O0AA 4UP9A 4BY1H 1L2FA 2ZTDA 3KJPA 3OYYA 4J15A 2CKZB 4A3EH 1VQFA 1GVPA 2VQFL 1IBLL 2VZAA 1Q8KA 1P16A 3IRBA 3G4SA 4HJAA 4L5SA 4BA2I 2I5MX 4OO1G 1FVIA 1S3OA 4LF7Q 3A5ZB 2Q2UA 4GKKL 2H5XA 1E22A 3M4PA 4DNIA 4GKKQ 3Q8DA 2K5VA 2OCEA 3UDIA 1CKOA 4DAMA 2JA8G 4BBRH 2BA0A 2NN6I 5M5XH 1KC8C 2UUCQ 3ICEA 4IFDI 4YY3L 1AE3A 3UDXA 2RCNA 4GOPC 2NVTH 4DV7L 1L0WA 3I7FA 2LSSA 1GM5A 3NBHB 1XJVA 1VQPA 2K4KA 4DV1L 2JA6G 1QUQA 2AHOB 3I4MG 2N78A 1IYJB 1NMFA 1V43A 4GNXC 4A3DG 1I94L 3HOWG 2Z6KC 1X56A 1N36L 1I6HH 1N32L 4JYAQ 5IYCG 1S72A 3HOZG 2WAQE 1K8AC 3T1HQ 5C44G 1R9TH 1YHBA 2E8GA 3KFUA 4HIDA 3PF5A 4JBMA 4RMFA 2I5LX 4MTNA 3GTOH 2K5HA 2NN6G 4IFDG 4IPCA 4L5QA 3H15A 2JA8H 1L1OB 5JJLA 4KHPL 1E3PA 4KHPQ 4DR4Q 2MNAA 1OXTA 2ATWA 1HZCA 1JJGA 1Z9FA 5LMUL 3L7ZC 3PSIA 4JI1L 5LMUQ 2JA6H 5FJ8G 3I4MH 3CC7A 5E7NA 4A76A 1EOVA 1VQHA 3HOWH 4LWCA 4A3DH 4JV5L 1LYLA 2N49A 4OXPA 3CCRA 2QA4A 5K36G 4LFBL 1X65A 3OTOL 1Z47A 2XTIA 1EUJA 5IYCH 4A3IG 3U50C 4X62L 3S17H 3HOZH 4JC0A 2YU9H 1YI2A 5C44H 4DK6C 4NXMQ 1KIXA 4JI5Q 1MKHA 2EQSA 3K80C 3MEFA 4QJFA 1DGSA 1VQAA 3CMEA 4DR2Q 3LGJA 4R4TA 4HIOA 4YCVA 2C35B 4DV2Q 1YEZA 4GN5A 1YJ9A 4A3EG 4OWWB 5GQOA 3NELA 4GS3A 1J5EQ 4BXXG 1K3RA 2HHHQ 1QVGA 4BA1I 2UU9L 4PZ8A 3M7NA 2NZHA 1KAWA 1HZBA 4P75A 4KHZA 3CCVA 1VQNA 4P71A 2VUMG 1XNRL 3CMAA 1N34L 1CSQA 1XNRQ 5FJ8H 1XMOL 3AFQA 2UUAQ 2ZJQA 1E7ZA 2ZTCA 1CKNA 1X3GA 4MNOA 4EX5A 3S1MH 4DR1L 4A3JG 4R4IA 1HR0L 3NENA 1HR0Q 3CC2A 4A3IH 3PIOA 1V9PA 5LMNQ 2A19A 5AJ3L 2WFWA 3EBEA 1BBWA 5GROA 2CQOA 3AYHB 1K0RA 2IX0A 5JJKA 1FJGL 3M3YH 4YCWA 1FJGQ 3K7UC 5GADC 4AQYQ 2HT1A 3S1NH 4IFDJ 5M3FG 2UUBL 1UE5A 1OXUA 3G48A 3F2CA 4DUZQ 1HH2P 1EYGA 2UUBQ 4BY7G 1X54A 4LFCL 4LFCQ 1CSPA 2BH8A 2RHSB 2L15A 3PCOB 2PI2E 3PUZA 3J81c 1TWGH 2VQEQ 2WP8J 4B3SL 2HIXA 4BXXH 3UDGA 4LF4L 3HOYG 3TREA 1I3QH 1YBYA 2ZM6Q 3KDFA 1YNXA 3AFPA 4LF9L 1XPRA 4P73A 2VUMH 1NTGA 3S2HH 1YIJA 1PH2A 4OO1I 2PQAA 2I5HA 1SLJA 1SRUA 2Q2IA 3L2PA 3F1ZA 1VQOA 1X9NA 2XGTA 3PUWA 1GD7A 1X55A 1IZ6A 1B7YB 4JI6Q 4A3JH 1OTCA 4NPSA 2Q2TA 3D31A 1HZAA 4L5RC 1KXLA 1A8VA 2ZJRA 2KHIA 4JI2Q 2KCMA 2ZJPA 1W2BA 1QZGA 3ERSX 1PYBA 4DK3C 1UE7A 1KRTA 1K9MC 4B3RQ 4DR5Q 1HNWQ 4NXNL 1K83H 2E5LQ 4NXNQ 5M3FH 4BY7H 4DV3L 1NY4A 1B8AA 4LUZA 4PG3A 2VQFQ 1IBLQ 2YYZA 2F4VL 3KF6B 3GTKH 4P72A 1U5KA 3F2BA 4GNXA 3RR5A 1VQ9A 4IPGA 3HOYH 3PUVA 1SFOH 1K8GA 1VS0A 2Z6KA 3EIVA 3JC66 4IPDA 4APVA 4X64L 1YJWA 1YITA 2CCZA 1D7QA 2YTYA 2R7ZG 4JG2A 1Q1BA 1H95A 1JJ2A 2GN5A 1EWIA 1Y1VG 2BA1A 2CWAA 3A0JA 3M9BA 1BKBA 4YY3Q 1XNQL 4A3BG 2R93G 2YTVA 3K0XA 3JAMc 4DV7Q 4JI4L 3B6YA 4GOPB 1VQ7A 3RLNA 4DV6L 4DV1Q 5GAGC 1IBML 1IBMQ 1S40A 3CPWA 1WOCA 4JOIA 1I94Q 2PMZE 4GLVB 2ES2A 4GNXB 3TS0A 1HJPA 4DR6L 1N36Q 4UP8A 4AH6A 3KJOA 3RN2A 3I2ZA 4DR7L 1N32Q 2UXBL 2UXBQ 2UXDL 4L5TA 3J80c 1JE5A 3CCUA 4LF6L 4LF6Q 1EQRA 5C4JH 4BBSG 3D0FA 1ASYA 4XTCS 1FGUA 3UDFA 2R7ZH 2R6GA 2AMCB 1RIPA 3CQZH 4O2DA 3CCMA 1Y1VH 1Q46A 4MZ9A 4A3BH 2R93H 1QUQB 1NE3A 4JOIC 4DV4L 3AQQA 1VQBA 3F2DA 4UY8C 4A93G 3FKIG 3I4OA 3EN2A 4JI1Q 1OXXK 2JA9A 2K50A 4HJ5A 5LMNW 3AEVA 4JV5Q 3CW2C 4YWLA 3KOJA 1UWVA 4JCVE 4QL5A 1PH5A 3S15H 1EIYB 4LFBQ 5HGQA 1KQSA 4PZ6A 3E0EA 1L1OC 3OTOQ 2JA7G 1EIFA 5GAHC 1E1OA 1TXYA 1CUKA 2D62A 2IT1A 4X62Q 2QGQA 1XMQL 1PH3A 3RLOA 4AYBE 1A0IA 4QQBX 4HJ7A 5J3BA 3OW2A 5IE8A 4POGA 2E2JH 3PO2G 4BBSH 3CCSA 4OONA 5IP9G 4DV0L 3ULJA 4IOAA 3HKSA 2K5NA 2N8NA 1MIUA 1VQMA 3HFZB 1IL2A 1UE1A 3S1RH 2UU9Q 2Y0SG 2OWOA 2ASBA 3L0OA 5C3EG 2OQKA 4A3GG 2R7DA 3FKIH 4YWKA 4A93H 2ZTEA 4UP7A 4HJ8A 4LF8L 1N34Q 1A63A 3CCEA 3BU2A 1OXVA 1XMOQ 1EFWA 1HZ9A 3S1QH 3CP0A 3CCLA 4EQ5A 5C0XI 3UE0A 2NVQH 3STBD 4DR1Q 3RLFA 3DM3A 1B70B 2JA7H 1N33L 1O7IA 4A75A 5AJ3Q 1VQIA 1JT8A 1X6OA 4A3MG 2JEAI 2JEBI 4R4OA 2KCTA 2EIFA 4LUOA 4GKJL 4IJHA 3U4ZA 1PHJA 3PO2H 5IWAL 1YVCA 3S16H 5IP9H 4GN4B 2MFIA 1VQ6A 3M4QA 1KD1C 1HNXL 5JJIA 3PV0A 3TQYA 2UXCL 4B3SQ 1WYDA 4IOCA 1Y14B 4JI3L 1NMGA 3S24A 4A3LG 4Y52H 3GTMH 4A4IA 4LF4Q 4R4QA 4C3IH 5C3EH 1G51A 1KHIA 4A3GH 1TWAH 1TWCH 3K8AA 1CKNB 4LF9Q 2B63G 5C0XG 1Q1EA 4DV5L 3J7A5 3CCQA 4DV5Q 4YHHL 1GO3E 3E9HA 1EQQA 2KENA 3U4VA 4ALPA 1V1QA 1VQ4A 1PH9A 4OX9L 1XTDA 4JI0L 1GKHA 4WJ4A 3PO3G 3ER0A 4C3HH 4A3MH 4QIWE 1WCMG 1K73C 3I4NG 2Y0SE 1Q82C 4DR3L 3I56A 1BVSA 2F52A 3T1YL 1PFSA 2D0PA 2AWOA 3GO5A 2MO1A 4R1JA 4GLXA 3KLWA 2ALYB 4JBKA 4DV3Q 1VQGA 5BR8L 1QVCA 2JQOA 2F4VQ 3KDFB 5IP7G 3GTPH 5FLXc 4X65L 2VS1A 2OTJA 1XPOA 4A3LH 4LF5L 2PQAB 1OXSC 1U0LA 3HOVG 2CFMA 4K0KL 1KRSA 1Q86C 4WJ3M 3TS2A 2WB1G 3H0GG 4RG1A 5M5WH 4X64Q 2B63H 3F8TA 3HKZE 1N9WA 2LXKA 1QZHA 2FXQA 3K81C 3J80i 1M1KC 5IYDG 1PYSB 1VQDA 1Y1WG 1XNQQ 4DAYB 3H3VI 3PUXA 3U58A 1JB7A 3PO3H 3BZKA 4AYBG 1C0AA 1IXRA 2E2HH 4JI4Q 1RL2A 2AWNA 3RZDH 1WCMH 1VQ8A 2OTLA 4DV6Q 3I4NH 1VQKA 2A8VA 3WWVA 1ASZA 3GTQH 3RZOH 4LF7L 1TWFH 2BH2A 4DR6Q 1NBWA 1WFQA 4A3KG 4DR7Q 5IP7H 2CWPA 1A62A 3J7ZC 1M90C 2I0QA 2UUCL 2UXDQ 3CC4A 3HOVH 4C2MH 5IYBG 3W1GA 1LM0A 1HNZL 3GTLH 3W5OA 3CF5A 4JBWA 2VW9A 1YZ6A 3H0GH 5C0XJ 4HJ9A 2JK8A 1L1OA 2VY3A 5JEAG 3HOUG 5EAYA 1I50H 2KBNA 2PNHA 4YCUA 1YJNA 4A3CG 1KL9A 1PH8A 2JJQA 5IYDH 3TEHB 2Q2HA 1Y1WH 1LUZA 4LFAL 4KI0A 4LFAQ 1VQ5A 3PGZA 4DV4Q 4B3ML 5ELOA 4B3MQ 3I55A 1N8RC 2AKWB 2VL6A 4JYAL 2K14A 3GTGH 3GDEA 3FHWA 1HR0W 4JI7L 3T1HL 3PF4A 4JI7Q 1SN8A 2WB1E 2V1CC 3FP9A 1VQLA 4X6AH 2R92G 2JE6I 1AH9A 4A3KH 1JMCA 4B3TL 4LW1A 4B3TQ 1SR3A 1JJCB 5FLMG 1XMQQ 5H1SE 1VQJA 1WI5A 1NJIC 5IYBH 5HY6A 2VNUD 3CAMA 2ID0A 2NVXH 2R7FA 1CKMA 3NEMA 1PH1A 2DUDA 1PH4A 4R4CA 1C7YA 4DR4L 3HOUH 2IY5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV0 Q;  2KHJ A;  4A3C H;  3BJU A;  1PVO A;  3M85 A;  4TVA B;  3VDY A;  3H3V H;  2YTX A;  5DLQ E;  4DPG A;  1PV4 A;  2IHE A;  1LTL A;  1D8L A;  2JA5 G;  1C9O A;  2HIV A;  4HIM A;  3RNU A;  3PIP A;  1FL0 A;  1VCI A;  2D0O A;  5GAE C;  2MQH A;  4LF8 Q;  5M3M G;  3S2D H;  1E1T A;  1VQC A;  4PZ7 A;  3J81 i;  4NXM L;  2QEX A;  1AE2 A;  4JI5 L;  3SGI A;  5M5Y H;  4POF A;  1YHQ A;  5C4X G;  3KF8 B;  4IJL A;  3HOX G;  4DR2 L;  2R92 H;  3TRZ A;  1P8L A;  3CPF A;  2RHQ B;  1PH6 A;  4DV2 L;  2NVY H;  4AIM A;  1N33 Q;  5FLM H;  1J5E L;  3K7A H;  2GVB A;  2OQ0 A;  1SE8 A;  1SRO A;  1X3F A;  3HKZ G;  2HHH L;  2EXD A;  2K52 A;  1UE6 A;  4LUV A;  4UPA A;  5JEA J;  4GN3 B;  4GKJ Q;  5IWA Q;  2B29 A;  4JI8 L;  1TWH H;  3STB C;  1SMX A;  2F3I A;  4JI8 Q;  3CXC A;  1HNX Q;  2HQL A;  1E24 A;  3ULL A;  1WJJ A;  5IT9 c;  2UUA L;  2UXC Q;  4JI3 Q;  2JA5 H;  3A5U A;  1QVF A;  3G6E A;  1UEB A;  4TQU S;  3G71 A;  1X3E A;  3KYH C;  4PMW A;  3PUY A;  2LXJ A;  3A74 A;  4X66 L;  1HNZ Q;  4DUY L;  5LMN L;  2Z0S A;  4X66 Q;  3ZJY C;  4XIG S;  4FDB A;  4DUY Q;  5M3M H;  1Q81 C;  4P74 A;  3J81 j;  1Q12 A;  1T9H A;  4NB3 A;  3W1B A;  2MO0 A;  2DGY A;  5ELN A;  4A3F G;  2NZO A;  4YHH Q;  2YV5 A;  5C4X H;  4AQY L;  5IY0 A;  3HOX H;  4H02 A;  1MJE A;  3UE1 A;  4LNQ A;  4OX9 Q;  2IHF A;  4BY1 G;  4DUZ L;  4JI0 Q;  3E9I A;  3M4O H;  1PH7 A;  1J6Q A;  2K75 A;  4GLA C;  2VQE L;  1MJC A;  4DR3 Q;  4OWT B;  3BZC A;  3ULP A;  3T1Y Q;  3S14 H;  2ZM6 L;  3GTJ H;  3GD7 A;  4KLK A;  2RF4 A;  3KF6 A;  3JAM i;  3CD6 A;  1XPU A;  1I5F A;  1PA6 A;  2IX1 A;  1W3S A;  5BR8 Q;  3DLL A;  2E2I H;  4JBJ A;  2N3S A;  2GVA A;  4YWM A;  1BBU A;  2B3G A;  4X65 Q;  2A1A A;  4BBR G;  4C3J H;  3MXN B;  3CCJ A;  4LF5 Q;  2WAQ G;  1G29 1;  4JI6 L;  4K0K Q;  1G6P A;  1YHA A;  3RN5 A;  4JI2 L;  1VQE A;  4DKA C;  4QY7 A;  2PI2 A;  4A3F H;  4ME3 A;  4QGU A;  4HIK A;  1IBK L;  4B3R L;  4DR5 L;  1IBK Q;  1HNW L;  4IO9 A;  2E5L L;  4IPH A;  4GOP A;  1Q7Y C;  4Y7N H;  4OWX B;  4O0A A;  4UP9 A;  4BY1 H;  1L2F A;  2ZTD A;  3KJP A;  3OYY A;  4J15 A;  2CKZ B;  4A3E H;  1VQF A;  1GVP A;  2VQF L;  1IBL L;  2VZA A;  1Q8K A;  1P16 A;  3IRB A;  3G4S A;  4HJA A;  4L5S A;  4BA2 I;  2I5M X;  4OO1 G;  1FVI A;  1S3O A;  4LF7 Q;  3A5Z B;  2Q2U A;  4GKK L;  2H5X A;  1E22 A;  3M4P A;  4DNI A;  4GKK Q;  3Q8D A;  2K5V A;  2OCE A;  3UDI A;  1CKO A;  4DAM A;  2JA8 G;  4BBR H;  2BA0 A;  2NN6 I;  5M5X H;  1KC8 C;  2UUC Q;  3ICE A;  4IFD I;  4YY3 L;  1AE3 A;  3UDX A;  2RCN A;  4GOP C;  2NVT H;  4DV7 L;  1L0W A;  3I7F A;  2LSS A;  1GM5 A;  3NBH B;  1XJV A;  1VQP A;  2K4K A;  4DV1 L;  2JA6 G;  1QUQ A;  2AHO B;  3I4M G;  2N78 A;  1IYJ B;  1NMF A;  1V43 A;  4GNX C;  4A3D G;  1I94 L;  3HOW G;  2Z6K C;  1X56 A;  1N36 L;  1I6H H;  1N32 L;  4JYA Q;  5IYC G;  1S72 A;  3HOZ G;  2WAQ E;  1K8A C;  3T1H Q;  5C44 G;  1R9T H;  1YHB A;  2E8G A;  3KFU A;  4HID A;  3PF5 A;  4JBM A;  4RMF A;  2I5L X;  4MTN A;  3GTO H;  2K5H A;  2NN6 G;  4IFD G;  4IPC A;  4L5Q A;  3H15 A;  2JA8 H;  1L1O B;  5JJL A;  4KHP L;  1E3P A;  4KHP Q;  4DR4 Q;  2MNA A;  1OXT A;  2ATW A;  1HZC A;  1JJG A;  1Z9F A;  5LMU L;  3L7Z C;  3PSI A;  4JI1 L;  5LMU Q;  2JA6 H;  5FJ8 G;  3I4M H;  3CC7 A;  5E7N A;  4A76 A;  1EOV A;  1VQH A;  3HOW H;  4LWC A;  4A3D H;  4JV5 L;  1LYL A;  2N49 A;  4OXP A;  3CCR A;  2QA4 A;  5K36 G;  4LFB L;  1X65 A;  3OTO L;  1Z47 A;  2XTI A;  1EUJ A;  5IYC H;  4A3I G;  3U50 C;  4X62 L;  3S17 H;  3HOZ H;  4JC0 A;  2YU9 H;  1YI2 A;  5C44 H;  4DK6 C;  4NXM Q;  1KIX A;  4JI5 Q;  1MKH A;  2EQS A;  3K80 C;  3MEF A;  4QJF A;  1DGS A;  1VQA A;  3CME A;  4DR2 Q;  3LGJ A;  4R4T A;  4HIO A;  4YCV A;  2C35 B;  4DV2 Q;  1YEZ A;  4GN5 A;  1YJ9 A;  4A3E G;  4OWW B;  5GQO A;  3NEL A;  4GS3 A;  1J5E Q;  4BXX G;  1K3R A;  2HHH Q;  1QVG A;  4BA1 I;  2UU9 L;  4PZ8 A;  3M7N A;  2NZH A;  1KAW A;  1HZB A;  4P75 A;  4KHZ A;  3CCV A;  1VQN A;  4P71 A;  2VUM G;  1XNR L;  3CMA A;  1N34 L;  1CSQ A;  1XNR Q;  5FJ8 H;  1XMO L;  3AFQ A;  2UUA Q;  2ZJQ A;  1E7Z A;  2ZTC A;  1CKN A;  1X3G A;  4MNO A;  4EX5 A;  3S1M H;  4DR1 L;  4A3J G;  4R4I A;  1HR0 L;  3NEN A;  1HR0 Q;  3CC2 A;  4A3I H;  3PIO A;  1V9P A;  5LMN Q;  2A19 A;  5AJ3 L;  2WFW A;  3EBE A;  1BBW A;  5GRO A;  2CQO A;  3AYH B;  1K0R A;  2IX0 A;  5JJK A;  1FJG L;  3M3Y H;  4YCW A;  1FJG Q;  3K7U C;  5GAD C;  4AQY Q;  2HT1 A;  3S1N H;  4IFD J;  5M3F G;  2UUB L;  1UE5 A;  1OXU A;  3G48 A;  3F2C A;  4DUZ Q;  1HH2 P;  1EYG A;  2UUB Q;  4BY7 G;  1X54 A;  4LFC L;  4LFC Q;  1CSP A;  2BH8 A;  2RHS B;  2L15 A;  3PCO B;  2PI2 E;  3PUZ A;  3J81 c;  1TWG H;  2VQE Q;  2WP8 J;  4B3S L;  2HIX A;  4BXX H;  3UDG A;  4LF4 L;  3HOY G;  3TRE A;  1I3Q H;  1YBY A;  2ZM6 Q;  3KDF A;  1YNX A;  3AFP A;  4LF9 L;  1XPR A;  4P73 A;  2VUM H;  1NTG A;  3S2H H;  1YIJ A;  1PH2 A;  4OO1 I;  2PQA A;  2I5H A;  1SLJ A;  1SRU A;  2Q2I A;  3L2P A;  3F1Z A;  1VQO A;  1X9N A;  2XGT A;  3PUW A;  1GD7 A;  1X55 A;  1IZ6 A;  1B7Y B;  4JI6 Q;  4A3J H;  1OTC A;  4NPS A;  2Q2T A;  3D31 A;  1HZA A;  4L5R C;  1KXL A;  1A8V A;  2ZJR A;  2KHI A;  4JI2 Q;  2KCM A;  2ZJP A;  1W2B A;  1QZG A;  3ERS X;  1PYB A;  4DK3 C;  1UE7 A;  1KRT A;  1K9M C;  4B3R Q;  4DR5 Q;  1HNW Q;  4NXN L;  1K83 H;  2E5L Q;  4NXN Q;  5M3F H;  4BY7 H;  4DV3 L;  1NY4 A;  1B8A A;  4LUZ A;  4PG3 A;  2VQF Q;  1IBL Q;  2YYZ A;  2F4V L;  3KF6 B;  3GTK H;  4P72 A;  1U5K A;  3F2B A;  4GNX A;  3RR5 A;  1VQ9 A;  4IPG A;  3HOY H;  3PUV A;  1SFO H;  1K8G A;  1VS0 A;  2Z6K A;  3EIV A;  3JC6 6;  4IPD A;  4APV A;  4X64 L;  1YJW A;  1YIT A;  2CCZ A;  1D7Q A;  2YTY A;  2R7Z G;  4JG2 A;  1Q1B A;  1H95 A;  1JJ2 A;  2GN5 A;  1EWI A;  1Y1V G;  2BA1 A;  2CWA A;  3A0J A;  3M9B A;  1BKB A;  4YY3 Q;  1XNQ L;  4A3B G;  2R93 G;  2YTV A;  3K0X A;  3JAM c;  4DV7 Q;  4JI4 L;  3B6Y A;  4GOP B;  1VQ7 A;  3RLN A;  4DV6 L;  4DV1 Q;  5GAG C;  1IBM L;  1IBM Q;  1S40 A;  3CPW A;  1WOC A;  4JOI A;  1I94 Q;  2PMZ E;  4GLV B;  2ES2 A;  4GNX B;  3TS0 A;  1HJP A;  4DR6 L;  1N36 Q;  4UP8 A;  4AH6 A;  3KJO A;  3RN2 A;  3I2Z A;  4DR7 L;  1N32 Q;  2UXB L;  2UXB Q;  2UXD L;  4L5T A;  3J80 c;  1JE5 A;  3CCU A;  4LF6 L;  4LF6 Q;  1EQR A;  5C4J H;  4BBS G;  3D0F A;  1ASY A;  4XTC S;  1FGU A;  3UDF A;  2R7Z H;  2R6G A;  2AMC B;  1RIP A;  3CQZ H;  4O2D A;  3CCM A;  1Y1V H;  1Q46 A;  4MZ9 A;  4A3B H;  2R93 H;  1QUQ B;  1NE3 A;  4JOI C;  4DV4 L;  3AQQ A;  1VQB A;  3F2D A;  4UY8 C;  4A93 G;  3FKI G;  3I4O A;  3EN2 A;  4JI1 Q;  1OXX K;  2JA9 A;  2K50 A;  4HJ5 A;  5LMN W;  3AEV A;  4JV5 Q;  3CW2 C;  4YWL A;  3KOJ A;  1UWV A;  4JCV E;  4QL5 A;  1PH5 A;  3S15 H;  1EIY B;  4LFB Q;  5HGQ A;  1KQS A;  4PZ6 A;  3E0E A;  1L1O C;  3OTO Q;  2JA7 G;  1EIF A;  5GAH C;  1E1O A;  1TXY A;  1CUK A;  2D62 A;  2IT1 A;  4X62 Q;  2QGQ A;  1XMQ L;  1PH3 A;  3RLO A;  4AYB E;  1A0I A;  4QQB X;  4HJ7 A;  5J3B A;  3OW2 A;  5IE8 A;  4POG A;  2E2J H;  3PO2 G;  4BBS H;  3CCS A;  4OON A;  5IP9 G;  4DV0 L;  3ULJ A;  4IOA A;  3HKS A;  2K5N A;  2N8N A;  1MIU A;  1VQM A;  3HFZ B;  1IL2 A;  1UE1 A;  3S1R H;  2UU9 Q;  2Y0S G;  2OWO A;  2ASB A;  3L0O A;  5C3E G;  2OQK A;  4A3G G;  2R7D A;  3FKI H;  4YWK A;  4A93 H;  2ZTE A;  4UP7 A;  4HJ8 A;  4LF8 L;  1N34 Q;  1A63 A;  3CCE A;  3BU2 A;  1OXV A;  1XMO Q;  1EFW A;  1HZ9 A;  3S1Q H;  3CP0 A;  3CCL A;  4EQ5 A;  5C0X I;  3UE0 A;  2NVQ H;  3STB D;  4DR1 Q;  3RLF A;  3DM3 A;  1B70 B;  2JA7 H;  1N33 L;  1O7I A;  4A75 A;  5AJ3 Q;  1VQI A;  1JT8 A;  1X6O A;  4A3M G;  2JEA I;  2JEB I;  4R4O A;  2KCT A;  2EIF A;  4LUO A;  4GKJ L;  4IJH A;  3U4Z A;  1PHJ A;  3PO2 H;  5IWA L;  1YVC A;  3S16 H;  5IP9 H;  4GN4 B;  2MFI A;  1VQ6 A;  3M4Q A;  1KD1 C;  1HNX L;  5JJI A;  3PV0 A;  3TQY A;  2UXC L;  4B3S Q;  1WYD A;  4IOC A;  1Y14 B;  4JI3 L;  1NMG A;  3S24 A;  4A3L G;  4Y52 H;  3GTM H;  4A4I A;  4LF4 Q;  4R4Q A;  4C3I H;  5C3E H;  1G51 A;  1KHI A;  4A3G H;  1TWA H;  1TWC H;  3K8A A;  1CKN B;  4LF9 Q;  2B63 G;  5C0X G;  1Q1E A;  4DV5 L;  3J7A 5;  3CCQ A;  4DV5 Q;  4YHH L;  1GO3 E;  3E9H A;  1EQQ A;  2KEN A;  3U4V A;  4ALP A;  1V1Q A;  1VQ4 A;  1PH9 A;  4OX9 L;  1XTD A;  4JI0 L;  1GKH A;  4WJ4 A;  3PO3 G;  3ER0 A;  4C3H H;  4A3M H;  4QIW E;  1WCM G;  1K73 C;  3I4N G;  2Y0S E;  1Q82 C;  4DR3 L;  3I56 A;  1BVS A;  2F52 A;  3T1Y L;  1PFS A;  2D0P A;  2AWO A;  3GO5 A;  2MO1 A;  4R1J A;  4GLX A;  3KLW A;  2ALY B;  4JBK A;  4DV3 Q;  1VQG A;  5BR8 L;  1QVC A;  2JQO A;  2F4V Q;  3KDF B;  5IP7 G;  3GTP H;  5FLX c;  4X65 L;  2VS1 A;  2OTJ A;  1XPO A;  4A3L H;  4LF5 L;  2PQA B;  1OXS C;  1U0L A;  3HOV G;  2CFM A;  4K0K L;  1KRS A;  1Q86 C;  4WJ3 M;  3TS2 A;  2WB1 G;  3H0G G;  4RG1 A;  5M5W H;  4X64 Q;  2B63 H;  3F8T A;  3HKZ E;  1N9W A;  2LXK A;  1QZH A;  2FXQ A;  3K81 C;  3J80 i;  1M1K C;  5IYD G;  1PYS B;  1VQD A;  1Y1W G;  1XNQ Q;  4DAY B;  3H3V I;  3PUX A;  3U58 A;  1JB7 A;  3PO3 H;  3BZK A;  4AYB G;  1C0A A;  1IXR A;  2E2H H;  4JI4 Q;  1RL2 A;  2AWN A;  3RZD H;  1WCM H;  1VQ8 A;  2OTL A;  4DV6 Q;  3I4N H;  1VQK A;  2A8V A;  3WWV A;  1ASZ A;  3GTQ H;  3RZO H;  4LF7 L;  1TWF H;  2BH2 A;  4DR6 Q;  1NBW A;  1WFQ A;  4A3K G;  4DR7 Q;  5IP7 H;  2CWP A;  1A62 A;  3J7Z C;  1M90 C;  2I0Q A;  2UUC L;  2UXD Q;  3CC4 A;  3HOV H;  4C2M H;  5IYB G;  3W1G A;  1LM0 A;  1HNZ L;  3GTL H;  3W5O A;  3CF5 A;  4JBW A;  2VW9 A;  1YZ6 A;  3H0G H;  5C0X J;  4HJ9 A;  2JK8 A;  1L1O A;  2VY3 A;  5JEA G;  3HOU G;  5EAY A;  1I50 H;  2KBN A;  2PNH A;  4YCU A;  1YJN A;  4A3C G;  1KL9 A;  1PH8 A;  2JJQ A;  5IYD H;  3TEH B;  2Q2H A;  1Y1W H;  1LUZ A;  4LFA L;  4KI0 A;  4LFA Q;  1VQ5 A;  3PGZ A;  4DV4 Q;  4B3M L;  5ELO A;  4B3M Q;  3I55 A;  1N8R C;  2AKW B;  2VL6 A;  4JYA L;  2K14 A;  3GTG H;  3GDE A;  3FHW A;  1HR0 W;  4JI7 L;  3T1H L;  3PF4 A;  4JI7 Q;  1SN8 A;  2WB1 E;  2V1C C;  3FP9 A;  1VQL A;  4X6A H;  2R92 G;  2JE6 I;  1AH9 A;  4A3K H;  1JMC A;  4B3T L;  4LW1 A;  4B3T Q;  1SR3 A;  1JJC B;  5FLM G;  1XMQ Q;  5H1S E;  1VQJ A;  1WI5 A;  1NJI C;  5IYB H;  5HY6 A;  2VNU D;  3CAM A;  2ID0 A;  2NVX H;  2R7F A;  1CKM A;  3NEM A;  1PH1 A;  2DUD A;  1PH4 A;  4R4C A;  1C7Y A;  4DR4 L;  3HOU H;  2IY5 B; 
#chains in the Genus database with same CATH topology
 2KHJ A;  4N9P A;  4TVA B;  2SOB A;  2IHE A;  1LTL A;  3NPP A;  4HIM A;  4CDE C;  1STA A;  2D0O A;  1JB3 A;  5GAE C;  4PZ7 A;  2QEX A;  4M8A A;  3SGI A;  5EKI A;  4N8X 1;  4K2L A;  3TRZ A;  2Z4H A;  4FXK C;  4AIM A;  1SNC A;  4DV2 L;  2GVB A;  1SE8 A;  2HHH L;  4LUV A;  4GKJ Q;  3A55 A;  1KNA A;  1JWU D;  5E4W C;  1H9S B;  4JI8 L;  1TWH H;  4JI8 Q;  2F3I A;  4PV1 C;  3CXC A;  2B2Y C;  2HQL A;  2L4N A;  1WJJ A;  3CHB D;  5IT9 c;  2UUA L;  1KDA A;  3G6E A;  1SYB A;  2B2W C;  1KLU D;  3PUY A;  2EY5 A;  3R8B A;  4DUY L;  2BDN A;  4DUY Q;  1F9P A;  4DXG A;  1KTK A;  2DGY A;  2K03 A;  2O2L D;  4CDF C;  5C4X H;  1EYD A;  2KEC A;  4WJW A;  4AQY L;  3UE1 A;  2IHF A;  1Y69 U;  1RCV D;  3EQL C;  2XIW A;  3HS0 C;  5EBC A;  4HED A;  2RBM A;  1MJC A;  5D3I B;  3T1Y Q;  1SEB D;  3JAM i;  1I5F A;  5M9O A;  4JBJ A;  2N3S A;  2EVB A;  3CCJ A;  3HOW B;  3OSO A;  1YHA A;  4HSV A;  1RTN A;  2PI2 A;  5JVG 3;  4ME3 A;  4CKC A;  1IBK L;  1IBK Q;  3J7Y W;  1GUN A;  1S5F D;  4Y7N H;  4UP9 A;  4BY1 H;  2ZTD A;  5CV4 A;  1IBL L;  1LT4 D;  1ZXT A;  1P16 A;  3PQI A;  4HJA A;  2I5M X;  1FR3 A;  5EJW A;  3A5Z B;  2Q2U A;  4GKK L;  4GKK Q;  2OCE A;  2JA8 G;  5T1G A;  1BDO A;  1D5M C;  1EOT A;  4YIJ A;  3BVZ A;  4BBR H;  4DAM A;  4IFD I;  3ICE A;  4YY3 L;  1AE3 A;  3UDX A;  2NVT H;  3R93 A;  1L0W A;  3D4R A;  3P1H A;  4DV1 L;  1QUQ A;  1V43 A;  3AU7 A;  1R4Q B;  4A3D G;  3HOW G;  1U4L A;  1X56 A;  1MD2 D;  2BCO A;  3NQI A;  3SR1 A;  2WAQ E;  4F7X A;  2ICI A;  1R9T H;  4HID A;  3PF5 A;  4JBM A;  4OO1 H;  3CRL C;  5EBD A;  2NN6 G;  2LFN A;  4TRD A;  4F87 A;  3S2H B;  1EY8 A;  3I91 A;  4RGM A;  1L1O B;  1TKW B;  5JJL A;  2XNA C;  5C5L A;  3PSI A;  4UHV A;  4JI1 L;  4CDD C;  2QEJ C;  1TS3 A;  2QA4 A;  2K5Q A;  4OXP A;  1K83 B;  4LFB L;  3CKI B;  1Z47 A;  3HOZ H;  3U50 C;  3S17 H;  4KN7 C;  3Q6S A;  4HN7 A;  1TVX A;  5C44 H;  4NXM Q;  3A7A B;  1HTP A;  3HOY B;  2EQS A;  1SFO B;  1TT2 A;  5BN3 A;  4DR2 Q;  1YNN D;  1YNJ D;  4HIO A;  4XDX A;  4YCV A;  2C35 B;  1F2Y A;  1YEZ A;  4GN5 A;  3OWF A;  3OIQ A;  4IZ8 A;  1F2L A;  4BXX G;  1QVG A;  5NUC A;  2KA7 A;  4PZ8 A;  2UU9 L;  4EGV A;  3WDN A;  1LTB D;  1IKL A;  1CSQ A;  3G7L A;  2A68 D;  3T4A C;  1X3G A;  3S1M H;  1FNV A;  1U9R A;  2K5D A;  4Q0F A;  1HR0 L;  1AZQ A;  2MJ8 A;  1HR0 Q;  4WFN 3;  1ZYR C;  1K28 A;  1STB A;  1VF5 C;  3AYH B;  2IX0 A;  3K7U C;  5GAD C;  1UE5 A;  1OXU A;  3F2C A;  1TII D;  4OIJ A;  1BUV T;  2VQE Q;  1I6V C;  3PUZ A;  2WP8 J;  2HIX A;  1LT5 D;  3A8K E;  3HOY G;  3TRE A;  1I3Q H;  2ZM6 Q;  2R93 B;  2VUM H;  1NTG A;  4OO1 I;  1SRU A;  2Q2I A;  3L2P A;  2ENB A;  3SXH A;  4JI6 Q;  4A3J H;  2Q2T A;  1HZA A;  3H91 A;  1KXL A;  1A8V A;  1O78 A;  1W2B A;  5KYI A;  4JI2 Q;  4DK3 C;  2YU9 B;  3C3L A;  1FNW A;  1LT3 D;  3W3A A;  4DV3 L;  2E2J B;  1G8Z D;  4RFB A;  3KF6 B;  3GTK H;  1SE3 A;  1U5K A;  2PQE A;  1JOQ A;  4G7Z C;  1VS0 A;  5IGF A;  4UAI A;  3EIV A;  1AN8 A;  1YIT A;  4A93 B;  4OL7 A;  2CCZ A;  1F77 A;  4C56 C;  2A74 C;  4K8J A;  3A0J A;  2BA1 A;  1XNQ L;  2R93 G;  5IOD A;  4IUQ A;  3K0X A;  5TSS A;  5DAU A;  4BWG B;  1VQ7 A;  2G9D A;  3NQT A;  3RLN A;  4DV6 L;  2F0I A;  1UEA B;  3CPW A;  2LMC B;  4C1N K;  4ZK9 B;  3S1N B;  1ZEQ X;  3OPO A;  4DR6 L;  2EOT A;  4AH6 A;  4DR7 L;  1N32 Q;  3K0Y A;  3VA5 A;  1JE5 A;  3LX0 A;  3CCU A;  4LF6 L;  4LF6 Q;  5I9P A;  2Y0S B;  5HGT A;  1JWS D;  3I70 A;  4TSS A;  3CCM A;  3BDO A;  3NXW A;  1GHJ A;  1M8A A;  3F2D A;  4A93 G;  1GXD C;  3TDQ A;  3EN2 A;  1HQR D;  3AEV A;  4IAL A;  5CV7 A;  3T56 B;  4X3K A;  2Z9H A;  5HGQ A;  1MGS A;  2F0P A;  2IT1 A;  5KEE A;  4RCN A;  2ZXP A;  3KF8 A;  5HUR A;  4QQB X;  4HJ7 A;  3OW2 A;  4POG A;  1X32 A;  1KAB A;  4L8J A;  2Z8L A;  2F0Q A;  4BBS H;  4IOA A;  3MTS A;  4IUP A;  2K5N A;  3IKJ A;  3BVM A;  4ILW A;  1II3 A;  4C3I G;  2Y0S G;  3P7J A;  4OGQ C;  2B2T C;  1GUS A;  2OQK A;  3FKI H;  1V8Q A;  2ZTE A;  4UP7 A;  4HJ8 A;  1N34 Q;  1A63 A;  3BU2 A;  3RZD B;  3I4N B;  1DM0 B;  2Z1C A;  3J7A V;  4J6H A;  2NVQ H;  3RLF A;  4HCS A;  1B70 B;  2JA7 H;  3J7A F;  5AJ3 Q;  3L9A X;  4CGY B;  2KCT A;  3C1F A;  4JPB W;  4PQX A;  1PHJ A;  1YVC A;  2J7Z A;  3GTL B;  3S16 H;  5IP9 H;  4GN4 B;  4DAV A;  1DON A;  1KD1 C;  5E4X A;  1HNX L;  1I50 B;  2UXC L;  4XQN A;  1Y14 B;  2FJ2 A;  4Y52 H;  4A4I A;  4LF4 Q;  1L0X B;  5C3E H;  1TWA H;  1UAP A;  3K8A A;  4AYB B;  5D3D A;  1CQV A;  1Q1E A;  2F0G A;  3CCQ A;  1V1Q A;  1XTD A;  3HRZ C;  2EYJ A;  1DJR D;  5ELC A;  3ER0 A;  2RDG A;  4P2C B;  1SYF A;  3I4N G;  2MP1 A;  1NAP A;  3P75 A;  4DR3 L;  1NCV A;  3I56 A;  1BVS A;  1FYC A;  3H6M A;  1PFS A;  1HUN A;  4PMC A;  2L5T A;  4GLX A;  2RSN A;  1RJT A;  2ALY B;  2R3Z A;  3HGB A;  4JBK A;  3DEO A;  2F0U A;  1FD7 D;  2F3V A;  5BR8 L;  4ZLT F;  2F4V Q;  5FLX c;  2WKC A;  2VS1 A;  2AQ1 B;  3E6Z X;  2CFM A;  3S1R B;  4K0K L;  2PCF B;  4WJ3 M;  3KLR A;  1EWH A;  4KMU C;  4J8Q A;  1ML0 D;  2FXQ A;  1M1K C;  1IW7 C;  5IYD G;  3GV3 A;  2GA4 B;  1FNU A;  3NBH A;  4DAY B;  3U58 A;  3PO3 H;  4AYB G;  1C0A A;  1IXR A;  1QCB D;  2CH4 A;  2KOL A;  1VQ8 A;  1JIC A;  2F0O A;  3ITP A;  3WWV A;  5IGD A;  3JAM L;  4K5X A;  1ASZ A;  4HCE A;  1PFM A;  1PLF A;  1PRT B;  4LF7 L;  1TWF H;  1MBY A;  1PRT F;  1NBW A;  1C8C A;  4CJ1 B;  5IP7 H;  1ONL A;  1SYG A;  2UUC L;  3CC4 A;  3HOV H;  3P20 A;  3TME A;  2RKS A;  3W5O A;  3CF5 A;  2JK8 A;  4KHV A;  5JEA G;  1JOO A;  2KBN A;  2F0F A;  2PNH A;  4A3C G;  1KL9 A;  4O1N A;  1D5Z C;  1LUZ A;  3PGZ A;  4DV4 Q;  4M1U B;  2AKW B;  4JYA L;  4B9X A;  3W2D A;  3EFX D;  1C4Q A;  3FHW A;  3MZ5 A;  3PF4 A;  1CK1 A;  1SN8 A;  3K57 A;  5ELD A;  5C4Z A;  3HKZ B;  2BE5 C;  1KLG D;  1JMC A;  4DGZ A;  5FLM G;  2HDL A;  2VB3 X;  5H1S E;  2J4X A;  1HFN A;  5IYB H;  2VNU D;  1ET9 A;  2ID0 A;  4C3J B;  3TBI B;  2R7F A;  3MFG A;  3R3O A;  1PH4 A;  1RHP A;  2X6L A;  3HOU H;  1Y8O B;  2B63 B;  4DV0 Q;  1A6X A;  3BJU A;  3M85 A;  3VDY A;  2YTX A;  1EWC A;  4A3F B;  1NNX A;  3GQB A;  1C9O A;  2XRS D;  4MN3 A;  2NTS A;  2B2U C;  5G3L D;  1VMP A;  5I2Y A;  1Z7T A;  2I46 A;  2MQH A;  5KNB A;  5M3M G;  1E1T A;  1VQC A;  3J81 i;  1B50 A;  3MXU A;  5M5Y H;  1C48 A;  1V1P A;  3RZO B;  2R92 H;  4OIK A;  5EPJ A;  1PH6 A;  1N33 Q;  1EU4 A;  1J5E L;  3K7A H;  2OQ0 A;  1SRO A;  1X3F A;  2ZXO A;  3HKZ G;  5JEA J;  1ZYR D;  2PNR C;  5IWA Q;  2B29 A;  2KCN A;  4FNF A;  1JE4 A;  1E24 A;  3ULL A;  4C3J G;  2JA5 H;  3A5U A;  1E0B A;  4TQU S;  3KYH C;  4PMW A;  1A15 A;  5LMN L;  4FDB A;  4P74 A;  2EY1 A;  1Q12 A;  1T9H A;  1Z6H A;  4FO2 A;  5ELN A;  4YHH Q;  2FMC A;  4A3F G;  2O5J C;  2YV5 A;  5IY0 A;  3HOX H;  4I7Z C;  1MJE A;  4OX9 Q;  3M4O H;  4DUZ L;  4JI0 Q;  3E9I A;  1EY9 A;  1J6Q A;  5BN4 A;  4GLA C;  1HA5 A;  3S14 H;  5CV9 A;  3GTJ H;  4DNT B;  3CD6 A;  1XPU A;  3NWT A;  2IX1 A;  3NHH A;  2FMM A;  4NDX A;  4YWM A;  4X65 Q;  2B3G A;  2A1A A;  4ZUI A;  4LF5 Q;  2IW3 A;  3DMU A;  2EXZ A;  1HQM C;  3TZD A;  1QE6 A;  4G4K A;  4DKA C;  5ISR A;  3UI2 A;  4B3R L;  4QGU A;  4DR5 L;  1HNW L;  3NBI A;  4H13 C;  4GOP A;  1Q7Y C;  5KNC A;  4OWX B;  3KJP A;  3OYY A;  3Q22 A;  1VQF A;  1GVP A;  2VQF L;  2VZA A;  5LL6 S;  1KNE A;  4RHS A;  1RD9 D;  1HA6 A;  5KND A;  4L5S A;  4LJZ C;  1FVI A;  1S3O A;  3Q0A A;  1WD0 A;  3KUP A;  2H5X A;  1E22 A;  1CA5 A;  1CKO A;  1EZ8 A;  5M5X H;  2MUY A;  2NN6 I;  4DV7 L;  3I7F A;  4EVO A;  3NTK A;  3JAM E;  1B4O A;  4IUU A;  4A3I B;  1VQP A;  2K4K A;  2AHO B;  2N78 A;  1IYJ B;  1NMF A;  3HG9 A;  1I94 L;  1CM9 A;  4KY7 A;  4XT1 B;  3NTH A;  1N36 L;  4C1N I;  5IYC G;  1IYU A;  3D4W A;  1K8A C;  3IL8 A;  3T1H Q;  2SDF A;  5EKL A;  4A3E B;  1EY7 A;  1TWG B;  3ERO A;  2IJ0 A;  1D1I A;  2RCF A;  2XWJ B;  5L37 A;  2X69 A;  2E2I B;  4JK1 C;  3IAY A;  1E3P A;  2OT2 A;  1B53 A;  2ATW A;  1HZC A;  3WOE A;  3L7Z C;  2JA6 H;  1U4M A;  3I4M H;  3CC7 A;  2EDG A;  1VQH A;  2K28 A;  4JV5 L;  1O7Y A;  2K33 A;  2R61 A;  4A3I G;  1MSH A;  2YU9 H;  3V2T A;  1MKH A;  2G9H D;  3MEF A;  5CV8 A;  1DGS A;  3CME A;  1IKM A;  1CHP D;  4IFD H;  3LGJ A;  3R2T A;  4DV2 Q;  4A3E G;  4OWW B;  5GQO A;  3NEL A;  1QIL A;  1K3R A;  2HHH Q;  1DOL A;  4BA1 I;  1ET6 A;  2NZH A;  3CCV A;  3I3C A;  5D14 A;  1AW7 A;  2L9H A;  5FJ8 H;  1HFG A;  1XMO L;  2UUA Q;  1TR5 A;  1BOS A;  1E7Z A;  2ZTC A;  4EX5 A;  2A6H C;  5K36 H;  3CC2 A;  3EA6 A;  2A19 A;  2D2C C;  4V19 0;  2A5H A;  4U67 3;  1BBW A;  4S3S A;  2CQO A;  1XWE A;  1FJG L;  3M3Y H;  1FJG Q;  3ZYY X;  4WOR A;  4AQY Q;  3S1N H;  1EYG A;  4BY7 G;  1G6Z A;  4XQQ A;  1HH2 P;  1QNK A;  1EQT A;  2RHS B;  3PCO B;  5BN5 A;  2JA8 B;  5LHY 1;  3A7L A;  3UDG A;  1Y1V B;  1SNO A;  1YBY A;  4A3B B;  2ZT9 C;  3KDF A;  1GUO A;  1XPR A;  3GP7 A;  1PTO B;  1VQO A;  2Q8R E;  1PTO F;  2N88 A;  5JJZ A;  3OWE B;  4A3D B;  3D31 A;  1F9R A;  2SNS A;  2ZJP A;  3ERS X;  1BCP B;  1BCP F;  1JR0 D;  3SK4 A;  1K9M C;  1E2W A;  4HAE A;  5M3F H;  5JOB A;  1IW7 D;  4PG3 A;  3H3V C;  1IBL Q;  2I07 B;  4P72 A;  1VQ9 A;  3F2B A;  2KHS A;  1STY A;  3JC6 6;  4IPD A;  1EY5 A;  3TP7 A;  2EY6 A;  3H94 A;  2YTY A;  4JG2 A;  1H9M A;  1JJ2 A;  1Y1V G;  4FVM A;  4YY3 Q;  4A3B G;  1MHW C;  3DWA A;  4JI4 L;  4RA8 A;  4DV1 Q;  1NUC A;  1STH A;  2RA4 A;  1PRT C;  1WOC A;  4JOI A;  3TS0 A;  2VB2 X;  2NYZ D;  3NUC A;  4EQN A;  3RN2 A;  1T5X D;  3N6R A;  2UXD L;  3Q23 A;  3J80 c;  4F88 A;  1RDP D;  2B2V C;  2CVR A;  1EQR A;  3U9O A;  3D0F A;  4IUV A;  1TWC B;  1UNS A;  5FO8 B;  1ASY A;  4A3G B;  1FGU A;  2R7Z H;  2R6G A;  3CQZ H;  3C1E A;  3FMC A;  1QUQ B;  2KED A;  2QKI C;  3AQQ A;  1WTP A;  1I4Q A;  4DAP A;  4JI1 Q;  5F2D A;  5EQ0 A;  3KK7 A;  2QIL A;  4U68 A;  1UWV A;  4KY6 A;  3S15 H;  4HTH A;  4LFB Q;  1KQS A;  2NBF A;  3E0E A;  3HEJ A;  2F4I A;  4OEM B;  1CUK A;  2QGQ A;  1PH3 A;  4AYB E;  2EYH A;  5J3B A;  5IE8 A;  2JYO A;  3PO2 G;  2OXP A;  4KTA A;  4OON A;  3ULJ A;  2PMZ B;  3HKS A;  5I4D A;  2EZV A;  1MIU A;  3HFZ B;  1UE1 A;  3S1R H;  2UU9 Q;  4A3G G;  2R7D A;  5FOB B;  4LF8 L;  2E2H B;  1X3Q A;  3SHL A;  5IGC A;  3UE0 A;  1CT1 D;  2RQX A;  3QR8 A;  2WAC A;  2F0V A;  3S9W A;  1JT8 A;  1X6O A;  4K6L A;  2JEB I;  4R4O A;  4LUO A;  3V05 A;  1SDF A;  4IJH A;  5C4J B;  1VQ6 A;  2Z6B A;  3TQY A;  1EY4 A;  4IOC A;  4JI3 L;  1JOK A;  4A3L G;  4R4Q A;  1Y1W B;  4LAA A;  1G51 A;  1KHI A;  3ND9 A;  3MXN A;  5C0X G;  4ABN A;  1ESF A;  3J7A 5;  1GO3 E;  1ILP A;  3SEB A;  2E76 C;  2NB0 A;  4CDC C;  4C3H H;  4A3M H;  1PZJ D;  4A3K B;  1K73 C;  2F52 A;  4KK7 A;  2DNC A;  2AWO A;  3CRK C;  3DHQ A;  1MSG A;  2AUK A;  1F2M A;  3KLW A;  4K14 A;  4DV3 Q;  3OMG A;  4FF1 A;  1QVC A;  2JQO A;  4QB4 A;  1AEX A;  1XPO A;  1U0L A;  2A6E C;  2JSO A;  1A3V A;  1XTC D;  2WB1 G;  5M5W H;  2B63 H;  3F8T A;  3HKZ E;  2LXK A;  1D2B A;  3J80 i;  3S1Q B;  4LMQ D;  2RDH A;  1VQD A;  1Y1W G;  1XNQ Q;  3BZD B;  3H3V I;  3PUX A;  1JB7 A;  4K8I A;  3SDZ A;  3SVM A;  1WCM H;  3FRP B;  4DV6 Q;  4NW2 A;  4FP5 D;  1TS4 A;  3RZO H;  2BH2 A;  4DR6 Q;  3OHX C;  1LO5 D;  1WFQ A;  3NSW A;  3SK6 A;  4A3K G;  4DR7 Q;  3BG3 A;  1A62 A;  1M90 C;  4ZQ3 A;  1BBX C;  2I0Q A;  4RHR A;  1WTR A;  4C3I B;  4HJ9 A;  2HD3 A;  1WVL A;  1EIY B;  3H0G H;  5C0X J;  4YCU A;  5J22 A;  2IX3 A;  2Q2H A;  3MWY W;  1VQ5 A;  2JP1 A;  3SK5 A;  3A56 A;  4K2K A;  1N8R C;  2K14 A;  2EJG C;  4KJO A;  4JI7 L;  4JI7 Q;  2K04 A;  1BF4 A;  2EYP A;  2V1C C;  4RGO S;  3DEP A;  4NMZ A;  3BYY B;  1GUT A;  3EVQ A;  4B3T L;  4B3T Q;  2AUJ D;  1SR3 A;  2F0N A;  3GTP B;  1G2S A;  5HY6 A;  1XYI A;  3CAM A;  4DR4 L;  3NEM A;  1C7Y A;  4MIU A;  2CQA A;  3BDL A;  5EGT A;  1PV4 A;  2L12 A;  2QCP X;  1D8L A;  2F0K A;  4X3S A;  2HIV A;  3RNU A;  4Y7N B;  3PIP A;  1V1O A;  4BY1 B;  3FPP A;  3MXP A;  4RCO A;  1VDZ A;  3S2D H;  4CBV A;  1AE2 A;  1TQO A;  4JI5 L;  3PMF A;  4POF A;  1YHQ A;  5C4X G;  3KF8 B;  4IJL A;  4KKU A;  3GTQ B;  1P8L A;  3CPF A;  2RHQ B;  4ZCK A;  2NVY H;  5DNF A;  2A6H D;  2F0S A;  1HCZ A;  4BBR B;  4UPA A;  3NWS A;  2OF1 A;  2L1B A;  3STB C;  1SMX A;  2AQ3 B;  1HNX Q;  2F0H A;  2F0M A;  2UXC Q;  1QVF A;  3G71 A;  1TY0 A;  1X3E A;  4X66 L;  1PXU A;  2Z0S A;  3F2U A;  4X66 Q;  4XIG S;  4NP5 A;  3C46 A;  2NZO A;  1R9T B;  1NR4 A;  4H02 A;  4BY1 G;  2DY8 A;  1W6J A;  5I2X A;  2K75 A;  3QO2 A;  1PMR A;  1O80 A;  1L0Y B;  3J81 E;  4DR3 Q;  2B39 A;  4OWT B;  1IYV A;  3BZC A;  3ULP A;  3GD7 A;  2NVX B;  2RF4 A;  4RWS C;  1EU3 A;  1PTO C;  4QUC A;  3K6O A;  1W3S A;  5BR8 Q;  3DLL A;  2E2I H;  2GVA A;  1BBU A;  1STG A;  3VR5 A;  4BBR G;  4ZRZ A;  2WAQ G;  1G29 1;  1SAP A;  4K0K Q;  1G6P A;  1BCP C;  3RN5 A;  4E6I A;  1VQE A;  1EYA A;  4QY7 A;  3S17 B;  5T1I A;  2E75 C;  4IO9 A;  4IPH A;  2E5L L;  2MGS A;  2KJX A;  4HMI A;  4EQP A;  2L55 A;  4J15 A;  3I90 A;  4H7B A;  3OMC A;  4ULL A;  2PW7 A;  2NWG A;  1F9S A;  5FLX E;  3IRB A;  4OO1 G;  1K8M A;  5ELE A;  4LF7 Q;  1BQQ T;  2K32 A;  5FO9 B;  1PRT D;  4DNI A;  3Q8D A;  2K5V A;  4K5W A;  3UDI A;  4ZAI A;  4O42 A;  1EFI D;  2UUC Q;  2E2D C;  2RCN A;  1TS5 A;  1GM5 A;  3NBH B;  4XYO A;  5M3M B;  3R2I A;  1CA6 A;  3MEH A;  1SXT A;  4JYA Q;  1S72 A;  2EJM A;  3HOZ G;  1SE2 A;  1LTG D;  5C44 G;  2E8G A;  3KFU A;  2FHT A;  2A73 B;  1EY0 A;  2I5L X;  1STN A;  1I3Q B;  4MTN A;  1D1K A;  2K5H A;  5COR A;  2VUM B;  3DUZ A;  1WTX A;  2Q8I B;  2WKD A;  2JA8 H;  1E2Z A;  4ZKC B;  4A3J B;  1LAB A;  1OXT A;  1SMY C;  1WTV A;  1JJG A;  3QJY A;  1Z9F A;  5LMU L;  4HMJ A;  5LMU Q;  4A76 A;  1EOV A;  2KCC A;  3HOW H;  4LWC A;  2M9V A;  4A3D H;  4QUF A;  1SND A;  1LYL A;  2N49 A;  4GZY C;  4IUT A;  3OTO L;  2XTI A;  5JPM C;  4R8N A;  4X62 L;  1YI2 A;  3GTK B;  1KIX A;  3K80 C;  3A8J E;  4ID6 A;  3CU7 A;  3DWQ A;  2NN6 H;  3QOL A;  4R4T A;  3MVV A;  2OEO A;  4RH6 A;  3VYR A;  2RDF A;  5ELF A;  4F8M A;  1J5E Q;  4QMG A;  4ODG A;  1HZB A;  4KHZ A;  1XXG A;  1OO9 B;  4P71 A;  3TSS A;  4XXE A;  2VUM G;  1XNR L;  3CMA A;  1XNR Q;  2HCC A;  4I7A A;  1CKN A;  1ENC A;  1JCK B;  4DR1 L;  4A3J G;  1R4P B;  4R4I A;  5IT9 L;  1I6H B;  5LMN Q;  1V1P B;  2WFW A;  3EBE A;  1CHQ D;  2B8F A;  5GRO A;  1EL0 A;  1I4H A;  5JJK A;  4YCW A;  2UUB L;  4DUZ Q;  2UUB Q;  3GTO B;  1X54 A;  2JN4 A;  1CSP A;  4B3S L;  2PI2 E;  4BXX H;  4PNY A;  3PIP 3;  3T53 B;  3QOJ A;  1YNX A;  4LF9 L;  3S2H H;  1PH2 A;  2PQA A;  2I5H A;  1SLJ A;  2EJF C;  2XGT A;  3PUW A;  5DM6 3;  2PW5 A;  1IZ6 A;  1B7Y B;  4QCL A;  5IOC A;  4L5R C;  2KHI A;  2KCM A;  2XVS A;  2A6E D;  1UE7 A;  1DYQ A;  1KRT A;  4B3R Q;  4DR5 Q;  1HNW Q;  4DNR B;  4NXN L;  1K83 H;  4NXN Q;  1SE4 A;  2AQ2 B;  1NY4 A;  1B1Z A;  1B8A A;  4LUZ A;  1ICW A;  4KKS A;  2VQF Q;  3LWE A;  4DK1 A;  4GNX A;  4IPG A;  3HOY H;  2V4D A;  3PUV A;  1SFO H;  1K8G A;  2Z6K A;  1QG7 A;  1H9J A;  4APV A;  2KUM A;  1KDB A;  4X64 L;  4B9W A;  3QG1 A;  1D7Q A;  1O7L A;  1A2U A;  1KAA A;  1DZ1 A;  1H95 A;  1Q1B A;  4L6T B;  1EWI A;  1ILQ A;  2CWA A;  4R8I A;  5LL6 X;  1ESR A;  3A8I E;  2YTV A;  4CKE A;  4K5V A;  3JAM c;  4DV7 Q;  2QDL A;  4GOP B;  2JA7 B;  3FPU B;  1ENA A;  5GAG C;  2L0C A;  4OEL B;  1IBM L;  5CYU A;  1IBM Q;  1S40 A;  1G91 A;  1I94 Q;  2PMZ E;  3VA7 A;  5A2Q L;  1DOK A;  4GNX B;  2CW0 C;  1N36 Q;  4UP8 A;  3S16 B;  5KYL A;  3VR4 A;  2IL8 A;  5I9O A;  1EY6 A;  4HR7 B;  5C4J H;  5I6Y A;  5C3E B;  4BBS G;  5ELB A;  1S5D D;  1TWA B;  4ZKB B;  1KDC A;  3UDF A;  4O2D A;  2AMC B;  1RIP A;  5CV5 A;  1B9M A;  1EEF D;  2CHB D;  2R93 H;  1W6K A;  3NK9 A;  4UY8 C;  3FKI G;  3VYT A;  3D3R A;  2JA9 A;  2K50 A;  4HJ5 A;  2Z4I A;  4JV5 Q;  4YWL A;  3KOJ A;  2NTT A;  2B2T A;  4QL5 A;  1TU2 B;  2FFK B;  5JPN C;  4BY7 B;  2F03 A;  2JA7 G;  2PZT A;  1E1O A;  1TXY A;  5GAH C;  1XMQ L;  3RLO A;  1A0I A;  3I72 A;  4G7O C;  2WV6 D;  1S5E D;  2E2J H;  3I8Z A;  3CCS A;  3EJI A;  5IP9 G;  2EYO A;  3M4Y A;  4CJ2 C;  4R9W A;  1QOH A;  2N8N A;  1GUW A;  2FIN B;  1GOZ A;  1H9S A;  1S4Z A;  4XQJ A;  2ASB A;  5C3E G;  4A93 H;  3PO3 B;  5CBA E;  4H0L C;  3DWP A;  1OXV A;  1XMO Q;  3S1Q H;  3TZU A;  1M4V A;  2DY7 A;  5CR3 A;  5C0X I;  3GV6 A;  3STB D;  2F0E A;  3E0J A;  3DM3 A;  1HPC A;  1EEI D;  1S5B D;  1TWF B;  4A75 A;  1VMC A;  4N8F A;  1J8I A;  3RD4 A;  4GKJ L;  3TN2 A;  3HOV B;  3U4Z A;  1MI2 A;  4IUN A;  5CGK A;  5JVH 3;  2MFI A;  1HUM A;  2F0L A;  1CFM A;  3PV0 A;  1WYD A;  5IT9 E;  3S24 A;  4C3I H;  2KVM A;  5COY A;  1SYC A;  5EPK A;  4OHJ A;  1SNM A;  5CC4 A;  4DV5 L;  4DV5 Q;  3NTI A;  4DA2 A;  3FVQ A;  1PTO D;  2K7V A;  4ALP A;  1GKH A;  3HZX A;  3PO3 G;  5KGU A;  2JXM B;  4FXG C;  2Y0S E;  1Q82 C;  3KLS X;  1BCP D;  3T1Y L;  3GO5 A;  4R1J A;  1VQG A;  3HOU B;  1FGB D;  3KDF B;  5IP7 G;  3GTP H;  4FYD A;  1BXT A;  5E3F A;  2IWH A;  3HOV G;  1JC7 A;  1Q86 C;  1CZG A;  2SNM A;  4RG1 A;  3SK8 A;  5C5M A;  2EE1 A;  2WII B;  1N9W A;  5IGG A;  4FF2 A;  1GUG A;  5M5Y B;  4Q5V A;  5CBE E;  4JI4 Q;  2R92 B;  2F0J A;  3ND8 A;  2NUC A;  1RL2 A;  3RZD H;  3I4N H;  1IHZ A;  3MXG A;  2B8G A;  3K7A B;  5K5P A;  1B44 D;  1LTA D;  3GTQ H;  4KD4 A;  3PO2 B;  4G57 A;  2H1E A;  3AB9 A;  1F9Q A;  2UXD Q;  3J7Z C;  5C4H A;  5IYB G;  1LM0 A;  1PZK D;  4QIW B;  3GTM B;  3GTL H;  2JA5 B;  2VY3 A;  1L1O A;  2DJG C;  3HOU G;  1I50 H;  1AFP A;  2BE5 D;  1WTH A;  4Z9C B;  5A2Q E;  1PH8 A;  5IYD H;  3TEH B;  3VYS A;  1QB5 D;  4B3M L;  2PPB C;  5ELO A;  4B3M Q;  3HOX B;  3M4O B;  1EIH A;  1B2T A;  2WIN B;  3H09 A;  4BS9 A;  3GDE A;  1HR0 W;  3E3X A;  5IGE A;  4RKL A;  2KQ3 A;  3FP9 A;  5IGB A;  3J80 E;  1VQL A;  1SMY D;  1A2T A;  4MHE A;  2B2U A;  2K6A A;  3S14 B;  3GTJ B;  1K0S A;  2R92 G;  1LTT D;  4N9T A;  4LW1 A;  1VQJ A;  1WI5 A;  2NVX H;  1PH1 A;  1QNU A;  5JEA H;  1PZI D;  4A3C H;  1PVO A;  3H3V H;  3O13 A;  5DLQ E;  4DPG A;  1H9R A;  2JA5 G;  2XWB B;  1FL0 A;  1VCI A;  5FO7 B;  2A69 C;  4LF8 Q;  2X6G A;  4NXM L;  2XN9 C;  2HUG A;  4H44 C;  1EZ6 A;  2ZXR A;  3HOX G;  4DR2 L;  1UUP A;  2E74 C;  4EQO A;  5FLM H;  2EXD A;  2K52 A;  1UE6 A;  4C2M B;  5M5X B;  1GHK A;  4GN3 B;  3VYU A;  2M2L A;  2WB1 B;  1Y8P B;  1A3U A;  2VXW A;  1B3A A;  3A54 A;  1I4R A;  4JI3 Q;  5J39 A;  1HNZ L;  1UEB A;  1BO0 A;  5CMD A;  3J81 L;  1HNZ Q;  2LXJ A;  3A74 A;  4NKL A;  3ZJY C;  5M3M H;  4DF7 A;  1Q81 C;  3J81 j;  4NB3 A;  3GTG B;  1Q90 A;  3W1B A;  2MO0 A;  4PMB A;  4LNQ A;  3RMH A;  1X3P A;  3E5S A;  5E1F A;  1PH7 A;  2F0T A;  3LWU A;  2VQE L;  1S5C D;  3X3N A;  2ZM6 L;  1F2Z A;  4KLK A;  3V96 A;  3KF6 A;  4WRD A;  1PA6 A;  2JA6 B;  5JAV A;  3I4M B;  4IQZ A;  4C3J H;  1TY2 A;  3I73 A;  3MXN B;  4JI6 L;  3BDC A;  5C3W A;  2O4X A;  5FLX L;  1QJO A;  4JI2 L;  4A3F H;  4HIK A;  2EPB A;  2EYF A;  4O0A A;  2H4O A;  1L2F A;  2CKZ B;  1Q8K A;  4JW0 A;  1Y8N B;  3URY A;  4IUR A;  3OOC A;  4FXD A;  3G4S A;  5CV6 A;  3K58 A;  4I65 A;  4BA2 I;  1ENF A;  3M4P A;  1TWH B;  1B3Q A;  2BA0 A;  1KC8 C;  2CW0 D;  3WOF A;  3VR6 A;  1WD1 A;  4HSP A;  4GOP C;  2SEB D;  4J1M A;  2LSS A;  1XJV A;  2HQE A;  3BYT B;  2JA6 G;  3I4M G;  1CI3 M;  3TP5 A;  4GNX C;  2TMP A;  4DFA A;  2Z6K C;  3M3Y B;  5C4X B;  1I6H H;  2D9U A;  3K59 A;  1N32 L;  1O7Z A;  3OW7 A;  3MAQ A;  1YHB A;  4RMF A;  3GTO H;  4IFD G;  2LY7 A;  2HCI A;  4IPC A;  4L5Q A;  3H15 A;  3T51 B;  4KHP L;  4KHP Q;  1SBB B;  4DR4 Q;  2MNA A;  1DD2 A;  2IPK D;  1NR2 A;  1STE A;  5FJ8 G;  5E7N A;  2G5D A;  2NZ1 D;  2F1M A;  4ZYS A;  4JVZ A;  3CCR A;  5K36 G;  1X65 A;  3K5O A;  5M3F B;  1EQV A;  2KEE A;  3ERQ A;  5IYC H;  1EUJ A;  2B2Y A;  4JC0 A;  1JQY D;  1U4P A;  2J0T D;  4RGT A;  4DK6 C;  4JI5 Q;  2B2W A;  4V0B A;  4QJF A;  1LT6 D;  1VQA A;  2F0W A;  3G6J B;  1YJ9 A;  4GS3 A;  4DN4 M;  3NE5 B;  1SJH D;  2WAQ B;  3M7N A;  4RKB A;  1KAW A;  4P75 A;  3KLS A;  4TKO B;  2NVT B;  1VQN A;  3VR2 A;  4KY5 A;  1N34 L;  5D65 A;  3D8G A;  3M7G A;  4ME5 A;  3AFQ A;  2K05 A;  2ZJQ A;  1DOM A;  2M00 A;  4FF4 A;  4MNO A;  1WTQ A;  5A35 A;  2RVL A;  3T16 A;  3NEN A;  4B08 A;  4X3T A;  5KIX A;  3PIO A;  1V9P A;  4A3I H;  1CTM A;  1RTO A;  5AJ3 L;  3K5M A;  1H9K A;  1K0R A;  3LNN A;  2HT1 A;  4IFD J;  1J9O A;  5M3F G;  3T13 A;  3G48 A;  2D5D A;  4LFC L;  4G7H C;  4LFC Q;  1HRJ A;  4A3E H;  2BH8 A;  3J81 c;  1ICF B;  2L15 A;  3Q24 A;  1JOR A;  1TWG H;  2R7Z B;  3CQZ B;  1EYC A;  2BDO A;  4LF4 L;  1HTL D;  3QIA A;  3AFP A;  2DNE A;  4P73 A;  1YIJ A;  1X9N A;  4DXF A;  3F1Z A;  1GD7 A;  1X55 A;  1OTC A;  4NPS A;  3S15 B;  1E2V A;  2ZJR A;  1QZG A;  3HOZ B;  1PYB A;  4DAY A;  4L63 B;  4IN3 A;  5C44 B;  1GJX A;  4LK1 C;  1EIG A;  2XRQ D;  2E5L Q;  4BY7 H;  1VF7 A;  3NP8 A;  2YYZ A;  2F4V L;  3K5L A;  3RR5 A;  4KV6 A;  1SYD A;  2RSO A;  5C6A A;  1Q8I A;  1PFB A;  1YJW A;  2P5Z X;  2R7Z G;  2EY2 A;  2B2V A;  2GN5 A;  3M9B A;  1BKB A;  3S1M B;  4DK0 A;  2QF7 A;  1QWY A;  3B6Y A;  1SSO A;  1K3B C;  1Q3L A;  2N55 A;  4GLV B;  2ES2 A;  1HJP A;  3VR3 A;  3QB3 A;  3KJO A;  3I2Z A;  1CZW A;  1RF2 D;  1PYW D;  2LKV A;  2UXB L;  2UXB Q;  1IL8 A;  4L5T A;  3TP8 A;  2C9O A;  3MC0 B;  2MPM A;  3DM1 A;  4XTC S;  4X3U A;  3IFD A;  1Y1V H;  1Q46 A;  4MZ9 A;  4A3B H;  3MHB A;  1PDQ A;  2Q8T A;  5DEH A;  1NE3 A;  4JOI C;  4DV4 L;  1LV9 A;  1VQB A;  3I4O A;  1PTO H;  4DU9 A;  4C3H B;  1OXX K;  4A3M B;  5LMN W;  2EYM A;  3BS1 A;  3BVG A;  3CW2 C;  1PH5 A;  4JCV E;  2DN8 A;  1ZKO A;  1TS2 A;  3IFT A;  4PZ6 A;  3OTO Q;  1L1O C;  2ICE C;  4MTK A;  1EIF A;  1SNQ A;  4X62 Q;  2D62 A;  1T5E A;  5C3X A;  4CJ0 B;  2C5C A;  2A69 D;  2K5W A;  3K5N A;  2K01 A;  5AFW A;  4DV0 L;  5M5W B;  1CQF A;  3DXJ C;  2F3W A;  3FDT A;  1IL2 A;  1VQM A;  2O5I C;  5EKK A;  1K8O A;  5G3L F;  1JWM D;  2TSS A;  1WTO A;  2OWO A;  1BNZ A;  3L0O A;  4YWK A;  1LTS D;  5FK9 C;  3U9S A;  3CCE A;  5KRU A;  4KJN A;  4XT3 B;  1WCM B;  1YNN C;  1YNJ C;  1HZ9 A;  1D5X C;  1A3T A;  3CP0 A;  1EFW A;  1LTI D;  3CCL A;  4EQ5 A;  3MA2 B;  1B9N A;  4DR1 Q;  1SJE D;  4RAU C;  4FF3 A;  1N33 L;  1O7I A;  4C3H G;  1LTR D;  1VQI A;  2EYL A;  5DM7 3;  4A3M G;  2JEA I;  4KKT A;  3MFY A;  2EIF A;  2A68 C;  1HXY D;  2PYK A;  3PO2 H;  5IWA L;  5J1Z A;  1I4G A;  3H0G B;  3M4Q A;  5JJI A;  5I6W A;  4B3S Q;  1D6E C;  4ZUJ A;  1NMG A;  3GTM H;  4CKB A;  2K1B A;  4A3G H;  1TWC H;  1CKN B;  4LF9 Q;  2B63 G;  4UDU C;  2PZW A;  4RGN A;  1LLR D;  4YHH L;  2HDM A;  3E9H A;  1EQQ A;  1SYE A;  2KEN A;  3U4V A;  1VQ4 A;  1I4P A;  1PH9 A;  4OX9 L;  1AP0 A;  4JI0 L;  4WJ4 A;  2XSC A;  4QIW E;  1WCM G;  2D0P A;  4QF4 A;  2MO1 A;  4BBS B;  1I4X A;  3KBX A;  4X65 L;  3FEW X;  2OTJ A;  2PO4 A;  3I4L A;  4A3L H;  4LF5 L;  2PQA B;  1OXS C;  4K6D A;  3OIP A;  1LAC A;  1HHV A;  3PIO 3;  1G2T A;  1KRS A;  3L3O C;  3TS2 A;  3H0G G;  4X64 Q;  3FKI B;  1WTW A;  3KBG A;  3RUZ A;  5C0X H;  1AZP A;  1QZH A;  3K81 C;  3S2D B;  1PYS B;  3C2P A;  2BOS A;  2NVQ B;  3BZK A;  2QDB A;  3N52 A;  2E2H H;  2LS0 1;  2AWN A;  2OTL A;  2NVY B;  2F0D A;  3SE0 A;  1VQK A;  2A8V A;  3ONA B;  4XYQ A;  1BR9 A;  5EPL A;  2CWP A;  3D4D A;  2L11 A;  5IIF A;  3D6W A;  4C2M H;  3W1G A;  4JBW A;  2VW9 A;  1YZ6 A;  1PFN A;  2MHV A;  3J80 L;  5EAY A;  2QW7 A;  1YJN A;  2JJQ A;  1U4R A;  1Y1W H;  4LFA L;  3AMU A;  4KI0 A;  4KN4 C;  5FKA C;  1RKN A;  1SNP A;  4LFA Q;  3X3M A;  3I55 A;  1XX8 A;  2VL6 A;  1DXM A;  3GTG H;  4KD3 A;  3T1H L;  2PZU A;  1DCZ A;  2WB1 E;  3TP6 A;  3HP3 A;  2CH4 W;  4X6A H;  3QWN A;  2JE6 I;  1AH9 A;  1NSN S;  4A3K H;  1JJC B;  1ROD A;  1XMQ Q;  4CHT B;  1NJI C;  2DJF C;  1CKM A;  2DUD A;  3D6C A;  4R4C A;  2IY5 B; 
#chains in the Genus database with same CATH homology
 4DV0 Q;  2KHJ A;  4A3C H;  3BJU A;  1PVO A;  3M85 A;  4TVA B;  3VDY A;  3H3V H;  2YTX A;  5DLQ E;  4DPG A;  1PV4 A;  2IHE A;  1LTL A;  1D8L A;  2JA5 G;  1C9O A;  2HIV A;  4HIM A;  3RNU A;  3PIP A;  1FL0 A;  1VCI A;  2D0O A;  5GAE C;  2MQH A;  4LF8 Q;  5M3M G;  3S2D H;  1E1T A;  1VQC A;  4PZ7 A;  3J81 i;  4NXM L;  2QEX A;  1AE2 A;  4JI5 L;  3SGI A;  5M5Y H;  4POF A;  1YHQ A;  5C4X G;  3KF8 B;  4IJL A;  3HOX G;  4DR2 L;  2R92 H;  3TRZ A;  1P8L A;  3CPF A;  2RHQ B;  1PH6 A;  4DV2 L;  2NVY H;  4AIM A;  1N33 Q;  5FLM H;  1J5E L;  3K7A H;  2GVB A;  2OQ0 A;  1SE8 A;  1SRO A;  1X3F A;  3HKZ G;  2HHH L;  2EXD A;  2K52 A;  1UE6 A;  4LUV A;  4UPA A;  5JEA J;  4GN3 B;  4GKJ Q;  5IWA Q;  2B29 A;  4JI8 L;  1TWH H;  3STB C;  1SMX A;  2F3I A;  4JI8 Q;  3CXC A;  1HNX Q;  2HQL A;  1E24 A;  3ULL A;  1WJJ A;  5IT9 c;  2UUA L;  2UXC Q;  4JI3 Q;  2JA5 H;  3A5U A;  1QVF A;  3G6E A;  1UEB A;  4TQU S;  3G71 A;  1X3E A;  3KYH C;  4PMW A;  3PUY A;  2LXJ A;  3A74 A;  4X66 L;  1HNZ Q;  4DUY L;  5LMN L;  2Z0S A;  4X66 Q;  3ZJY C;  4XIG S;  4FDB A;  4DUY Q;  5M3M H;  1Q81 C;  4P74 A;  3J81 j;  1Q12 A;  1T9H A;  4NB3 A;  3W1B A;  2MO0 A;  2DGY A;  5ELN A;  4A3F G;  2NZO A;  4YHH Q;  2YV5 A;  5C4X H;  4AQY L;  5IY0 A;  3HOX H;  4H02 A;  1MJE A;  3UE1 A;  4LNQ A;  4OX9 Q;  2IHF A;  4BY1 G;  4DUZ L;  4JI0 Q;  3E9I A;  3M4O H;  1PH7 A;  1J6Q A;  2K75 A;  4GLA C;  2VQE L;  1MJC A;  4DR3 Q;  4OWT B;  3BZC A;  3ULP A;  3T1Y Q;  3S14 H;  2ZM6 L;  3GTJ H;  3GD7 A;  4KLK A;  2RF4 A;  3KF6 A;  3JAM i;  3CD6 A;  1XPU A;  1I5F A;  1PA6 A;  2IX1 A;  1W3S A;  5BR8 Q;  3DLL A;  2E2I H;  4JBJ A;  2N3S A;  2GVA A;  4YWM A;  1BBU A;  2B3G A;  4X65 Q;  2A1A A;  4BBR G;  4C3J H;  3MXN B;  3CCJ A;  4LF5 Q;  2WAQ G;  1G29 1;  4JI6 L;  4K0K Q;  1G6P A;  1YHA A;  3RN5 A;  4JI2 L;  1VQE A;  4DKA C;  4QY7 A;  2PI2 A;  4A3F H;  4ME3 A;  4QGU A;  4HIK A;  1IBK L;  4B3R L;  4DR5 L;  1IBK Q;  1HNW L;  4IO9 A;  2E5L L;  4IPH A;  4GOP A;  1Q7Y C;  4Y7N H;  4OWX B;  4O0A A;  4UP9 A;  4BY1 H;  1L2F A;  2ZTD A;  3KJP A;  3OYY A;  4J15 A;  2CKZ B;  4A3E H;  1VQF A;  1GVP A;  2VQF L;  1IBL L;  2VZA A;  1Q8K A;  1P16 A;  3IRB A;  3G4S A;  4HJA A;  4L5S A;  4BA2 I;  2I5M X;  4OO1 G;  1FVI A;  1S3O A;  4LF7 Q;  3A5Z B;  2Q2U A;  4GKK L;  2H5X A;  1E22 A;  3M4P A;  4DNI A;  4GKK Q;  3Q8D A;  2K5V A;  2OCE A;  3UDI A;  1CKO A;  4DAM A;  2JA8 G;  4BBR H;  2BA0 A;  2NN6 I;  5M5X H;  1KC8 C;  2UUC Q;  3ICE A;  4IFD I;  4YY3 L;  1AE3 A;  3UDX A;  2RCN A;  4GOP C;  2NVT H;  4DV7 L;  1L0W A;  3I7F A;  2LSS A;  1GM5 A;  3NBH B;  1XJV A;  1VQP A;  2K4K A;  4DV1 L;  2JA6 G;  1QUQ A;  2AHO B;  3I4M G;  2N78 A;  1IYJ B;  1NMF A;  1V43 A;  4GNX C;  4A3D G;  1I94 L;  3HOW G;  2Z6K C;  1X56 A;  1N36 L;  1I6H H;  1N32 L;  4JYA Q;  5IYC G;  1S72 A;  3HOZ G;  2WAQ E;  1K8A C;  3T1H Q;  5C44 G;  1R9T H;  1YHB A;  2E8G A;  3KFU A;  4HID A;  3PF5 A;  4JBM A;  4RMF A;  2I5L X;  4MTN A;  3GTO H;  2K5H A;  2NN6 G;  4IFD G;  4IPC A;  4L5Q A;  3H15 A;  2JA8 H;  1L1O B;  5JJL A;  4KHP L;  1E3P A;  4KHP Q;  4DR4 Q;  2MNA A;  1OXT A;  2ATW A;  1HZC A;  1JJG A;  1Z9F A;  5LMU L;  3L7Z C;  3PSI A;  4JI1 L;  5LMU Q;  2JA6 H;  5FJ8 G;  3I4M H;  3CC7 A;  5E7N A;  4A76 A;  1EOV A;  1VQH A;  3HOW H;  4LWC A;  4A3D H;  4JV5 L;  1LYL A;  2N49 A;  4OXP A;  3CCR A;  2QA4 A;  5K36 G;  4LFB L;  1X65 A;  3OTO L;  1Z47 A;  2XTI A;  1EUJ A;  5IYC H;  4A3I G;  3U50 C;  4X62 L;  3S17 H;  3HOZ H;  4JC0 A;  2YU9 H;  1YI2 A;  5C44 H;  4DK6 C;  4NXM Q;  1KIX A;  4JI5 Q;  1MKH A;  2EQS A;  3K80 C;  3MEF A;  4QJF A;  1DGS A;  1VQA A;  3CME A;  4DR2 Q;  3LGJ A;  4R4T A;  4HIO A;  4YCV A;  2C35 B;  4DV2 Q;  1YEZ A;  4GN5 A;  1YJ9 A;  4A3E G;  4OWW B;  5GQO A;  3NEL A;  4GS3 A;  1J5E Q;  4BXX G;  1K3R A;  2HHH Q;  1QVG A;  4BA1 I;  2UU9 L;  4PZ8 A;  3M7N A;  2NZH A;  1KAW A;  1HZB A;  4P75 A;  4KHZ A;  3CCV A;  1VQN A;  4P71 A;  2VUM G;  1XNR L;  3CMA A;  1N34 L;  1CSQ A;  1XNR Q;  5FJ8 H;  1XMO L;  3AFQ A;  2UUA Q;  2ZJQ A;  1E7Z A;  2ZTC A;  1CKN A;  1X3G A;  4MNO A;  4EX5 A;  3S1M H;  4DR1 L;  4A3J G;  4R4I A;  1HR0 L;  3NEN A;  1HR0 Q;  3CC2 A;  4A3I H;  3PIO A;  1V9P A;  5LMN Q;  2A19 A;  5AJ3 L;  2WFW A;  3EBE A;  1BBW A;  5GRO A;  2CQO A;  3AYH B;  1K0R A;  2IX0 A;  5JJK A;  1FJG L;  3M3Y H;  4YCW A;  1FJG Q;  3K7U C;  5GAD C;  4AQY Q;  2HT1 A;  3S1N H;  4IFD J;  5M3F G;  2UUB L;  1UE5 A;  1OXU A;  3G48 A;  3F2C A;  4DUZ Q;  1HH2 P;  1EYG A;  2UUB Q;  4BY7 G;  1X54 A;  4LFC L;  4LFC Q;  1CSP A;  2BH8 A;  2RHS B;  2L15 A;  3PCO B;  2PI2 E;  3PUZ A;  3J81 c;  1TWG H;  2VQE Q;  2WP8 J;  4B3S L;  2HIX A;  4BXX H;  3UDG A;  4LF4 L;  3HOY G;  3TRE A;  1I3Q H;  1YBY A;  2ZM6 Q;  3KDF A;  1YNX A;  3AFP A;  4LF9 L;  1XPR A;  4P73 A;  2VUM H;  1NTG A;  3S2H H;  1YIJ A;  1PH2 A;  4OO1 I;  2PQA A;  2I5H A;  1SLJ A;  1SRU A;  2Q2I A;  3L2P A;  3F1Z A;  1VQO A;  1X9N A;  2XGT A;  3PUW A;  1GD7 A;  1X55 A;  1IZ6 A;  1B7Y B;  4JI6 Q;  4A3J H;  1OTC A;  4NPS A;  2Q2T A;  3D31 A;  1HZA A;  4L5R C;  1KXL A;  1A8V A;  2ZJR A;  2KHI A;  4JI2 Q;  2KCM A;  2ZJP A;  1W2B A;  1QZG A;  3ERS X;  1PYB A;  4DK3 C;  1UE7 A;  1KRT A;  1K9M C;  4B3R Q;  4DR5 Q;  1HNW Q;  4NXN L;  1K83 H;  2E5L Q;  4NXN Q;  5M3F H;  4BY7 H;  4DV3 L;  1NY4 A;  1B8A A;  4LUZ A;  4PG3 A;  2VQF Q;  1IBL Q;  2YYZ A;  2F4V L;  3KF6 B;  3GTK H;  4P72 A;  1U5K A;  3F2B A;  4GNX A;  3RR5 A;  1VQ9 A;  4IPG A;  3HOY H;  3PUV A;  1SFO H;  1K8G A;  1VS0 A;  2Z6K A;  3EIV A;  3JC6 6;  4IPD A;  4APV A;  4X64 L;  1YJW A;  1YIT A;  2CCZ A;  1D7Q A;  2YTY A;  2R7Z G;  4JG2 A;  1Q1B A;  1H95 A;  1JJ2 A;  2GN5 A;  1EWI A;  1Y1V G;  2BA1 A;  2CWA A;  3A0J A;  3M9B A;  1BKB A;  4YY3 Q;  1XNQ L;  4A3B G;  2R93 G;  2YTV A;  3K0X A;  3JAM c;  4DV7 Q;  4JI4 L;  3B6Y A;  4GOP B;  1VQ7 A;  3RLN A;  4DV6 L;  4DV1 Q;  5GAG C;  1IBM L;  1IBM Q;  1S40 A;  3CPW A;  1WOC A;  4JOI A;  1I94 Q;  2PMZ E;  4GLV B;  2ES2 A;  4GNX B;  3TS0 A;  1HJP A;  4DR6 L;  1N36 Q;  4UP8 A;  4AH6 A;  3KJO A;  3RN2 A;  3I2Z A;  4DR7 L;  1N32 Q;  2UXB L;  2UXB Q;  2UXD L;  4L5T A;  3J80 c;  1JE5 A;  3CCU A;  4LF6 L;  4LF6 Q;  1EQR A;  5C4J H;  4BBS G;  3D0F A;  1ASY A;  4XTC S;  1FGU A;  3UDF A;  2R7Z H;  2R6G A;  2AMC B;  1RIP A;  3CQZ H;  4O2D A;  3CCM A;  1Y1V H;  1Q46 A;  4MZ9 A;  4A3B H;  2R93 H;  1QUQ B;  1NE3 A;  4JOI C;  4DV4 L;  3AQQ A;  1VQB A;  3F2D A;  4UY8 C;  4A93 G;  3FKI G;  3I4O A;  3EN2 A;  4JI1 Q;  1OXX K;  2JA9 A;  2K50 A;  4HJ5 A;  5LMN W;  3AEV A;  4JV5 Q;  3CW2 C;  4YWL A;  3KOJ A;  1UWV A;  4JCV E;  4QL5 A;  1PH5 A;  3S15 H;  1EIY B;  4LFB Q;  5HGQ A;  1KQS A;  4PZ6 A;  3E0E A;  1L1O C;  3OTO Q;  2JA7 G;  1EIF A;  5GAH C;  1E1O A;  1TXY A;  1CUK A;  2D62 A;  2IT1 A;  4X62 Q;  2QGQ A;  1XMQ L;  1PH3 A;  3RLO A;  4AYB E;  1A0I A;  4QQB X;  4HJ7 A;  5J3B A;  3OW2 A;  5IE8 A;  4POG A;  2E2J H;  3PO2 G;  4BBS H;  3CCS A;  4OON A;  5IP9 G;  4DV0 L;  3ULJ A;  4IOA A;  3HKS A;  2K5N A;  2N8N A;  1MIU A;  1VQM A;  3HFZ B;  1IL2 A;  1UE1 A;  3S1R H;  2UU9 Q;  2Y0S G;  2OWO A;  2ASB A;  3L0O A;  5C3E G;  2OQK A;  4A3G G;  2R7D A;  3FKI H;  4YWK A;  4A93 H;  2ZTE A;  4UP7 A;  4HJ8 A;  4LF8 L;  1N34 Q;  1A63 A;  3CCE A;  3BU2 A;  1OXV A;  1XMO Q;  1EFW A;  1HZ9 A;  3S1Q H;  3CP0 A;  3CCL A;  4EQ5 A;  5C0X I;  3UE0 A;  2NVQ H;  3STB D;  4DR1 Q;  3RLF A;  3DM3 A;  1B70 B;  2JA7 H;  1N33 L;  1O7I A;  4A75 A;  5AJ3 Q;  1VQI A;  1JT8 A;  1X6O A;  4A3M G;  2JEA I;  2JEB I;  4R4O A;  2KCT A;  2EIF A;  4LUO A;  4GKJ L;  4IJH A;  3U4Z A;  1PHJ A;  3PO2 H;  5IWA L;  1YVC A;  3S16 H;  5IP9 H;  4GN4 B;  2MFI A;  1VQ6 A;  3M4Q A;  1KD1 C;  1HNX L;  5JJI A;  3PV0 A;  3TQY A;  2UXC L;  4B3S Q;  1WYD A;  4IOC A;  1Y14 B;  4JI3 L;  1NMG A;  3S24 A;  4A3L G;  4Y52 H;  3GTM H;  4A4I A;  4LF4 Q;  4R4Q A;  4C3I H;  5C3E H;  1G51 A;  1KHI A;  4A3G H;  1TWA H;  1TWC H;  3K8A A;  1CKN B;  4LF9 Q;  2B63 G;  5C0X G;  1Q1E A;  4DV5 L;  3J7A 5;  3CCQ A;  4DV5 Q;  4YHH L;  1GO3 E;  3E9H A;  1EQQ A;  2KEN A;  3U4V A;  4ALP A;  1V1Q A;  1VQ4 A;  1PH9 A;  4OX9 L;  1XTD A;  4JI0 L;  1GKH A;  4WJ4 A;  3PO3 G;  3ER0 A;  4C3H H;  4A3M H;  4QIW E;  1WCM G;  1K73 C;  3I4N G;  2Y0S E;  1Q82 C;  4DR3 L;  3I56 A;  1BVS A;  2F52 A;  3T1Y L;  1PFS A;  2D0P A;  2AWO A;  3GO5 A;  2MO1 A;  4R1J A;  4GLX A;  3KLW A;  2ALY B;  4JBK A;  4DV3 Q;  1VQG A;  5BR8 L;  1QVC A;  2JQO A;  2F4V Q;  3KDF B;  5IP7 G;  3GTP H;  5FLX c;  4X65 L;  2VS1 A;  2OTJ A;  1XPO A;  4A3L H;  4LF5 L;  2PQA B;  1OXS C;  1U0L A;  3HOV G;  2CFM A;  4K0K L;  1KRS A;  1Q86 C;  4WJ3 M;  3TS2 A;  2WB1 G;  3H0G G;  4RG1 A;  5M5W H;  4X64 Q;  2B63 H;  3F8T A;  3HKZ E;  1N9W A;  2LXK A;  1QZH A;  2FXQ A;  3K81 C;  3J80 i;  1M1K C;  5IYD G;  1PYS B;  1VQD A;  1Y1W G;  1XNQ Q;  4DAY B;  3H3V I;  3PUX A;  3U58 A;  1JB7 A;  3PO3 H;  3BZK A;  4AYB G;  1C0A A;  1IXR A;  2E2H H;  4JI4 Q;  1RL2 A;  2AWN A;  3RZD H;  1WCM H;  1VQ8 A;  2OTL A;  4DV6 Q;  3I4N H;  1VQK A;  2A8V A;  3WWV A;  1ASZ A;  3GTQ H;  3RZO H;  4LF7 L;  1TWF H;  2BH2 A;  4DR6 Q;  1NBW A;  1WFQ A;  4A3K G;  4DR7 Q;  5IP7 H;  2CWP A;  1A62 A;  3J7Z C;  1M90 C;  2I0Q A;  2UUC L;  2UXD Q;  3CC4 A;  3HOV H;  4C2M H;  5IYB G;  3W1G A;  1LM0 A;  1HNZ L;  3GTL H;  3W5O A;  3CF5 A;  4JBW A;  2VW9 A;  1YZ6 A;  3H0G H;  5C0X J;  4HJ9 A;  2JK8 A;  1L1O A;  2VY3 A;  5JEA G;  3HOU G;  5EAY A;  1I50 H;  2KBN A;  2PNH A;  4YCU A;  1YJN A;  4A3C G;  1KL9 A;  1PH8 A;  2JJQ A;  5IYD H;  3TEH B;  2Q2H A;  1Y1W H;  1LUZ A;  4LFA L;  4KI0 A;  4LFA Q;  1VQ5 A;  3PGZ A;  4DV4 Q;  4B3M L;  5ELO A;  4B3M Q;  3I55 A;  1N8R C;  2AKW B;  2VL6 A;  4JYA L;  2K14 A;  3GTG H;  3GDE A;  3FHW A;  1HR0 W;  4JI7 L;  3T1H L;  3PF4 A;  4JI7 Q;  1SN8 A;  2WB1 E;  2V1C C;  3FP9 A;  1VQL A;  4X6A H;  2R92 G;  2JE6 I;  1AH9 A;  4A3K H;  1JMC A;  4B3T L;  4LW1 A;  4B3T Q;  1SR3 A;  1JJC B;  5FLM G;  1XMQ Q;  5H1S E;  1VQJ A;  1WI5 A;  1NJI C;  5IYB H;  5HY6 A;  2VNU D;  3CAM A;  2ID0 A;  2NVX H;  2R7F A;  1CKM A;  3NEM A;  1PH1 A;  2DUD A;  1PH4 A;  4R4C A;  1C7Y A;  4DR4 L;  3HOU H;  2IY5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...