1XWEA

Nmr structure of c345c (ntr) domain of c5 of complement
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
151
structure length
151
Chain Sequence
GSHMADCGQMQEELDLTISAETRKQTACKPEIAYAYKVSITSITVENVFVKYKATLLDIYKTGEAVAEKDSEITFIKKVTCTNAELVKGRQYLIMGKEALQIKYNASFRYIYPLDSLTWIEYWPRDTTCSSCQAFLANLDEFAEDIFLNGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Complement C5
publication title Functional Insights from the Structure of the Multifunctional C345C Domain of C5 of Complement
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 14
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 2004-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01759 NTR UNC-6/NTR/C345C module
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1xweA01
5FOBB 1GXDC 3HS0C 1XWEA 3MA2B 1UAPA 3OHXC 1PXUA 2QKIC 5JPNC 2WIIB 1BQQT 1JC7A 3T4AC 2TMPA 2I07B 5FO7B 1UEAB 5FO8B 4FXKC 1D2BA 2J0TD 4FXGC 3G6JB 5FO9B 2ICEC 3I70A 3KLSA 2A73B 2XWJB 3L3OC 2WINB 1BR9A 5JPMC 3CKIB 1BUVT 2E2DC 3CU7A 3V96A 1JB3A 1OO9B 2B39A 2XWBB 3HRZC 2A74C 3FRPB 4ILWA
chains in the Genus database with same CATH superfamily
3HOVB 1WTVA 2RBMA 1G91A 2SEBD 1HUMA 3A55A 3H0GB 2NVXB 1MJEA 4P71A 1DOLA 3CCUA 4C1NI 1K8GA 2F0KA 2B63H 3BVGA 1STHA 1EY4A 3CCMA 2O2LD 2QILA 2WINB 4FP5D 4LF4L 3SK8A 1UE5A 3GTMB 5C4ZA 1STGA 3N6RA 1YJWA 4LFAQ 5CGKA 4KJNA 2DN8A 1VF7A 4AIMA 4FVMA 1AEXA 4KLKA 3TDQA 5BN3A 2ZJPA 3CC4A 3ERQA 3PO3H 3GTLH 2HDMA 2KEDA 3RLFA 3D31A 2X6LA 2UU9L 1YNJC 4OX9L 4L63B 1KHIA 3D4DA 3RR5A 2K1BA 1I4XA 1U4LA 1Q1EA 2L0CA 4FO2A 3PUXA 4V0BA 3TP5A 1KAAA 1LLRD 2G9DA 1VQ5A 5JAVA 3A7LA 1C7YA 1S5ED 1IHZA 1SJHD 2O5IC 5C44B 4YWKA 4HSVA 2PCFB 2UUBL 4PG3A 5HY6A 1R9TB 5J1ZA 1P8LA 4O2DA 4IFDG 2G5DA 2MP1A 1I50H 2I0QA 1YI2A 4GS3A 2MNAA 2N49A 3FPUB 4PZ8A 1F77A 4NKLA 4UP7A 4K0KQ 1KTKA 1IL8A 1QVCA 4MN3A 5KYLA 4WFN3 1WTOA 4LF9L 2JEAI 3L9AX 4DUYQ 2B3GA 4OONA 2WKDA 3OIQA 1OXUA 1QVFA 3FDTA 4GOPA 1NCVA 1PZKD 1GJXA 2WB1G 1B53A 4H0LC 3S1QB 3OIPA 2PW5A 1EZ8A 4EGVA 4POGA 1H9JA 4JK1C 1ESRA 4X3UA 1DD2A 1NBWA 5KRUA 3MFGA 4LFBQ 5IYDG 4R8IA 1H9SA 1MI2A 3VR5A 4C3IH 2CFMA 3CPWA 4A3EH 1STAA 1VQPA 3TEHB 3JAML 2Y0SE 3GV3A 5C4JB 1L0XB 1SR3A 1ILPA 3EVQA 3FMCA 4DUZL 3UE1A 3SVMA 5M3MB 4KY7A 2NYZD 1PZJD 1TWAB 1PRTB 4C3JH 1A3VA 1IBLL 4IJLA 3VYSA 4EQPA 2L15A 5M5WB 1OTCA 4EQNA 5ELFA 3HOXH 1X56A 3MEFA 1LTGD 4ME3A 2IW3A 5IWAL 1VQGA 1D6EC 3QG1A 3U58A 1ML0D 1WCMG 1N33Q 2VY3A 3ERSX 5E4WC 4QCLA 1NSNS 2K5QA 1IKMA 3SK4A 1HZCA 2TMPA 3RD4A 5CBAE 2PQEA 4JI6L 3NTKA 1SMXA 1X55A 4X3TA 2X6GA 4A93H 1JMCA 2SNSA 3LX0A 5JJIA 3S15B 4A3BB 3I90A 1LM0A 5LL6X 3CKIB 1AE3A 3OTOQ 1N32L 5FLMG 4DK6C 4A3GH 1Z47A 4A3MG 2A74C 3VR2A 4DR7L 5M5YH 4GOPB 4RKLA 1I4PA 4IPDA 1I3QB 1R4QB 3SHLA 4XXEA 3SE0A 2MPMA 4HAEA 3VA5A 1FYCA 1XPUA 4Y7NH 2LMCB 4AYBE 1OXTA 3E9HA 3D0FA 3MAQA 3HGBA 1UEAB 2HQEA 1H9SB 3UDXA 4A3KG 1QZHA 2EYHA 3RLNA 5I2XA 1J5EL 4WJWA 1KQSA 1D5MC 2JA6H 1S5FD 3OOCA 2QA4A 2ICIA 2NN6I 2HHHL 5IT9L 1DGSA 4IZ8A 4LAAA 4OO1H 2E74C 1K8AC 1A3TA 1EWCA 1N8RC 2L11A 1ZYRC 2RA4A 2ES2A 4LFCL 1TQOA 4A3DB 3I91A 2R93B 1CQVA 3H6MA 3J81c 2ICEC 1X3GA 3W1GA 1K83B 1CK1A 2GA4B 3GTOH 1XPOA 1Q82C 3BU2A 4NW2A 1HNWL 3SK5A 4A3IG 5CV4A 3GO5A 1PZID 2UUCQ 2A8VA 4LMQD 1JE4A 4BWGB 4E6IA 2R7ZH 3M3YB 2IHFA 1CI3M 1VQIA 1Y1WH 4GN4B 3HOUB 1YHAA 2BE5D 2NTSA 4JG2A 2MJ8A 4RAUC 1Y8PB 2D62A 1JQYD 4DNIA 2YTXA 1PYSB 4JI0Q 2EY5A 3QOJA 1KRTA 5FJ8G 5GAGC 3TZDA 3FKIG 3J80L 1Q46A 1AW7A 2B2WC 3TBIB 1KL9A 3P75A 1SMYD 4JOIA 5GAHC 1MSGA 3NHHA 4MTKA 2B8GA 1VQ9A 1IZ6A 5D3DA 2WKCA 3S17B 4ZKBB 2OCEA 4JI5L 4Q0FA 4JI7Q 4KHVA 4DV5L 3CHBD 3U50C 1I94Q 1A15A 4JI1L 2P5ZX 3K5MA 4JYAL 1HZ9A 4B3SQ 1K8OA 1SYEA 2HCCA 3C3LA 1UE7A 2FHTA 4HJ8A 1FJGL 4R4QA 4K6LA 1B3AA 4CDEC 4U673 1PH7A 3BG3A 2KOLA 2NVXH 2PZTA 1BCPC 2I5HA 2JA8B 1ILQA 3BDOA 4DR1L 3PO3G 3GTMH 1SROA 2UXBL 1BUVT 4A3FB 5C0XG 4KKSA 2LKVA 4L5SA 1EIYB 5IYCH 4JBJA 3TP6A 3LGJA 4TQUS 3QB3A 2F0MA 2IX3A 2GVBA 4DV1Q 2M00A 1HH2P 2PZUA 2VB2X 1PFBA 4AQYL 3PUVA 5F2DA 1SBBB 1VQCA 1P16A 2F3IA 4A3JG 4KKTA 4B3ML 2RVLA 3NXWA 2A69D 4ME5A 1OXVA 4DV7L 2K03A 3S16H 1JJCB 2Z6KA 4X62L 3LWEA 3KF6B 4NPSA 4IFDJ 5E7NA 3MHBA 1A2UA 1HNZL 3HOYG 3PGZA 4BBSG 4WJ3M 4JI3Q 2AWOA 5IYBH 4NXML 1JWMD 2K52A 5JVH3 2NVTH 2WAQB 4JV5Q 1G291 4UDUC 5C44H 1QNKA 1XMOQ 5BN4A 3BZDB 3JAMc 2B2TC 1I6HB 5C4XB 2YTVA 1EWHA 2C9OA 4KD3A 4YHHQ 1CZGA 2DY7A 1PTOC 1SN8A 2I5MX 5IGEA 2K5NA 1TU2B 5IGGA 4X64L 4IURA 3T1HQ 3VYUA 4X66L 2KHIA 4R4TA 1KC8C 1KNEA 4C3IG 3JC66 3BS1A 4A3EG 3LNNA 1PFNA 3HOWG 1PH3A 1CFMA 4GLAC 3S1QH 2EJFC 1HNXQ 3A74A 5AJ3Q 3HFZB 2JA7B 1O7LA 1W6JA 1H95A 1GD7A 4RCNA 4FXDA 1XMQQ 2TSSA 2ZT9C 2VNUD 3KLSX 1R4PB 3DUZA 1JT8A 3AB9A 4L5TA 1EIFA 2AKWB 5IGCA 5C4JH 2EQSA 2A6HC 1JORA 4R9WA 1L2FA 5M3MH 3MXPA 3S14B 2UXCQ 1TWAH 3OMCA 5CBEE 5K5PA 2O5JC 1E7ZA 4KKUA 1N36Q 1F2YA 2D5DA 1SSOA 3CQZH 2BA1A 1SE3A 1K0RA 1JB3A 4TVAB 2NWGA 4GKKQ 1ENFA 3I56A 2O4XA 1PH4A 4JI8L 1VQAA 1EU3A 1LT5D 3HP3A 4K8JA 2JA5H 5J3BA 2Q8TA 1ENAA 2PI2A 1Y69U 1BBUA 2KQ3A 2JSOA 5M3FH 1BCPF 1BDOA 1UEBA 1L0WA 2R61A 3CU7A 1W6KA 3G71A 4DNRB 5ELCA 5I6YA 5C4HA 3VR4A 2NN6H 4DPGA 1IBMQ 4LWCA 4IPCA 1I3QH 3NWTA 4F87A 1T5EA 1EY5A 2I5LX 2JA6G 3HOZB 3NBHB 3A8IE 5C5LA 1B9NA 2H5XA 3K81C 4K8IA 2N78A 1DZ1A 1VQHA 5DM63 1GUWA 1EYCA 1S4ZA 3VYRA 3FVQA 2B2YC 3GTKB 3I70A 5IGBA 4DR5L 4G57A 2EJMA 2RQXA 2F03A 2IX0A 2CH4A 2QDLA 4DR4Q 3S24A 3DWPA 2R92H 3I2ZA 2F0SA 2XVSA 2PNRC 3O13A 3RMHA 3W1BA 1PVOA 1BBXC 4KK7A 5D3IB 1NR4A 4DR6L 4A3DH 2CVRA 2R93H 1MIUA 5EKIA 3J80c 1ASYA 3H94A 1Y1WG 3KK7A 1K83H 2PNHA 1SNDA 1UNSA 3RLOA 2ASBA 3Q24A 3BZCA 1NR2A 3RN2A 2C35B 4BY7B 2XGTA 4C2MH 4R4IA 1PTOF 2K5WA 2MQHA 5BN5A 5K36H 3VR3A 2F0LA 1X32A 1JOKA 3HOUH 3Q8DA 1F2ZA 1LACA 1A2TA 1K3BC 2MO1A 3U9SA 1AN8A 4FXGC 1LT6D 3HKZB 1EQQA 2EYLA 1LO5D 2K4KA 5D14A 3L3OC 1B50A 4DV3L 5DEHA 3E0JA 2CQOA 4KY5A 4KJOA 1V1PB 1SE2A 4BY1G 4DA2A 4IQZA 2K50A 2WAQE 4H44C 4OO1I 3K59A 3WWVA 2YU9B 2XN9C 1NJIC 5JOBA 3RZOB 2YTYA 2KHJA 1HA6A 1E2VA 1YEZA 1O7ZA 1G51A 1XTDA 1U5KA 4DAYA 1HR0L 1YITA 4C3HG 3TRZA 1E2WA 4RHSA 2VUMB 3D4RA 2B2UC 2K6AA 1Q81C 5C0XJ 4QUCA 3K7AH 1X3QA 2K14A 5IYCG 3PO2H 5BR8Q 3I7FA 3T1YL 3CCEA 1JJ2A 3C1FA 4TSSA 1ICWA 3F8TA 1IYUA 1Y1VH 1TWCH 3TS0A 1SFOB 2F4VQ 3NSWA 5EKLA 1T9HA 1L0YB 4RHRA 2F1MA 4HCEA 1EY0A 3U4ZA 4YIJA 1VQEA 5IGFA 3OW2A 3M7GA 5DM73 3D3RA 2VQEQ 3CCSA 1FNVA 1QNUA 1GUNA 5FO8B 3F2BA 4GLVB 2B2WA 4DR3L 1LTRD 4LW1A 4QQBX 4BBRB 1VQFA 3OWEB 1KAWA 3I72A 1BNZA 3BJUA 4CDCC 4JI2Q 4I65A 5I4DA 2EE1A 2AQ1B 2JE6I 1B1ZA 2QEJC 2D2CC 2SNMA 4BXXH 1EFWA 2OWOA 3NP8A 2BA0A 4DN4M 2F0DA 4XDXA 1GHKA 4DAYB 2F0GA 3I4MB 4KHPQ 4FF1A 1WVLA 1BBWA 1HCZA 1IBML 2BH2A 1O7IA 1NAPA 1HZBA 2A73B 4O1NA 1I6HH 1I6VC 3D4WA 2V1CC 1C8CA 1D1KA 1YNND 1KABA 1HTPA 4RGOS 5C5MA 2F0TA 5CV5A 4RH6A 1LTID 4HTHA 4IUQA 4IALA 3M4OH 1WYDA 4OIKA 4JI4Q 1CUKA 2L9HA 3S1MB 4X65Q 1VS0A 5FO9B 4Q5VA 3GTGB 3VA7A 1E1OA 5C3EH 1HPCA 3VR6A 2NTTA 3ER0A 3Q22A 1LTSD 3AYHB 2K7VA 2L12A 3BVMA 1I4GA 1QILA 4CJ0B 3MEHA 3OWFA 3H3VH 1Y8OB 4HEDA 3SGIA 3EQLC 4LF6Q 3R2IA 3CW2C 2VQFL 1VQBA 4PZ6A 5CV8A 1RJTA 1E2ZA 2NBFA 2F0UA 1BKBA 1WTQA 1PFSA 2K33A 3K5NA 2F3VA 2JA5G 4RGMA 1J6QA 2RDFA 1K73C 4B3TQ 1HQRD 3IKJA 4MNOA 1TS4A 2PI2E 1DCZA 5M3FG 2RDHA 4ZCKA 3A5UA 2XIWA 4OL7A 3TN2A 4DGZA 2EXZA 1IBKQ 3NTIA 3T16A 3TP7A 2Z6BA 1U4PA 2AWNA 4FF4A 2B2TA 3C1EA 1TWFB 3J81j 2NN6G 1TWGH 1XNRL 5JEAH 2R7FA 3HKZE 3Q6SA 1PFMA 2IPKD 1BCPB 1MGSA 4QUFA 5A2QE 4LF7L 1NUCA 3BVZA 4YY3Q 1BR9A 3T56B 3RZDB 2IT1A 4N9PA 2E2HB 1S5BD 1MD2D 1SYBA 5DNFA 3GTJB 3KOJA 4DXFA 2E2IB 2IL8A 2NVYH 1RODA 3V2TA 4DV0L 2FMCA 1YJNA 2MGSA 4AH6A 3BYYB 2Z9HA 2F0JA 2RCFA 2R92G 3CC2A 4BS9A 4XT1B 3KLSA 5EJWA 4ODGA 1LT4D 2JJQA 4CKBA 4HJ7A 4O42A 4HJAA 1Q86C 2UUAQ 5KNBA 4JVZA 3A7AB 2E5LL 5G3LD 4JBMA 3ITPA 1A62A 3N52A 3CMAA 3U4VA 1O78A 4DV2L 3EN2A 5E3FA 2ATWA 3HS0C 2WB1B 1FGBD 1U0LA 2Z0SA 1Q3LA 3DXJC 3J81i 2M9VA 5IOCA 1AZQA 2Q2UA 1BO0A 1XJVA 1B3QA 2K75A 4WORA 4PMCA 5M5XH 2D9UA 3S1NB 2RKSA 2JK8A 2EYMA 1PMRA 1TWHB 1BXTA 2DJGC 1F9SA 1PTOB 2KENA 1FNWA 2ZTCA 2I46A 5EGTA 3OW7A 1A8VA 2L1BA 5LMNW 2OXPA 2RHQB 1PLFA 1SNMA 1RL2A 1CKMA 4LUOA 2I07B 4HIKA 1ESFA 1LTTD 2QW7A 2EZVA 2A68D 1JWUD 4LFAL 1PRTD 4A3CH 5FKAC 3GDEA 1A63A 5GQOA 1WCMB 2Z8LA 3G6EA 5DAUA 5IP9H 2JYOA 3MC0B 1UWVA 3PIOA 3I4NH 1VQ4A 2B2YA 1G2TA 1CA5A 4U68A 3T51B 4QGUA 1STNA 2F4IA 3ULLA 2K5VA 4H7BA 1IKLA 3NWSA 3S2HB 4DAMA 2N88A 3X3MA 4A3MB 1V1OA 4BA2I 3PO2G 2OT2A 2BCOA 3IFDA 1IL2A 1Q1BA 2LXJA 2K05A 4IUVA 1GO3E 5A35A 2VS1A 4M1UB 4CHTB 4N9TA 3EFXD 3DMUA 1S3OA 1Y1VG 2D0OA 1RTNA 4A3KB 4KY6A 4CKEA 4RMFA 1ASZA 1PH9A 5CORA 4HJ5A 5I6WA 4CKCA 3KF6A 5CV6A 4A3LG 1FL0A 1SYCA 2Q8RE 2XSCA 4IOAA 3CF5A 1CM9A 1GHJA 3HEJA 2EYPA 3QWNA 3D6CA 3QO2A 1G2SA 4K0KL 2KCTA 3SEBA 1XNQQ 4DUYL 4RFBA 1N34Q 2B63G 4DV6Q 2MFIA 3HOVH 1ONLA 1HXYD 5CV7A 2KCCA 4ZYSA 2Z4HA 4BXXG 3E9IA 4NDXA 1D7QA 2NUCA 3H0GH 1YZ6A 4LFBL 3STBC 4A3IB 3S1RB 1F9QA 5FLXE 2WP8J 5M9OA 1NE3A 2AQ2B 3DM1A 3P7JA 1PYWD 4XIGS 2WV6D 2F0FA 5KYIA 3RNUA 2LY7A 2J7ZA 4DV4Q 3CRLC 3T13A 5ELDA 3UI2A 1SNPA 3SDZA 1PXUA 1K0SA 2B2UA 3FHWA 3JAMi 2FMMA 4RGNA 3K80C 4DR2Q 3GTQB 3I4MH 3FKIB 1A0IA 2LSSA 1X54A 1CSPA 1M8AA 3W2DA 4K2KA 1N33L 5EQ0A 1GKHA 2J4XA 1V8QA 4XQQA 5C3EG 3NEMA 3H91A 3IRBA 4JPBW 4N8X1 1CSQA 4QL5A 1SRUA 2BDNA 3KUPA 2BE5C 3PQIA 4GLXA 3R2TA 2XNAC 3U9OA 1S5CD 4B3RQ 2ALYB 1EQTA 2G9HD 1Z7TA 3OTOL 1C0AA 1Q90A 4YCUA 4POFA 1R9TH 2XWJB 1CQFA 3J7ZC 2FINB 2ZM6Q 3KDFA 3DHQA 3MXUA 1CHQD 2PW7A 2WB1E 1ET6A 5J22A 1SMYC 3C2PA 2CW0D 2K32A 1TS3A 1QB5D 2ZJRA 1WI5A 3PO3B 4LJZC 1QJOA 4NXNQ 3GTLB 4LF8Q 3FP9A 4LF5Q 4KN4C 3NBHA 1K28A 2RSNA 1A6XA 5JEAG 4DU9A 5L37A 4RG1A 1BF4A 3C46A 2NVQB 1ZEQX 3MXNA 4K6DA 4C3JG 4A3JB 3UDIA 1S40A 1YJ9A 3K8AA 4UY8C 1TWFH 2QF7A 4IUUA 2ID0A 3DEOA 4QIWB 3HOXG 2F0VA 2HQLA 5KNCA 4GKJQ 1RF2D 1O80A 2EXDA 5C6AA 1YBYA 3KYHC 4LNQA 2EPBA 1CTMA 1IXRA 4YCWA 1UE1A 5LMUQ 4BBSB 5M5WH 1LTBD 3HOYB 2UUCL 5G3LF 1VQKA 5EBCA 4A93G 2E2JB 2JN4A 5ELEA 1I4HA 2F0QA 2A6ED 2E2IH 4C1NK 2QEXA 2UXDQ 3CCVA 5LMNQ 1V43A 2EJGC 4R4CA 3BYTB 4OHJA 2OTJA 1G6PA 3H3VI 2X69A 1WTWA 1WTHA 4A3GG 1SYDA 4IFDH 5IP7H 4JI0L 2A69C 3KDFB 1NTGA 4PMBA 4N8FA 3A5ZB 1H9KA 3L0OA 1DONA 3S15H 1FGUA 3MWYW 4A3BH 2KVMA 1XX8A 4PNYA 3PIO3 4C3IB 2B29A 4LF4Q 4A3EB 3HOWB 3SR1A 3F1ZA 4FYDA 5FOBB 3J80i 1M4VA 3E3XA 2KJXA 4I7ZC 3HKSA 1C48A 2Q2HA 1V1PA 3T53B 4JI7L 2M2LA 5IYDH 4OO1G 1PRTF 3MXNB 3DWAA 2Z1CA 3A0JA 3UDFA 1WTPA 1I94L 1IW7D 1DOKA 3PSIA 2UU9Q 2Y0SG 1TWHH 4OX9Q 4NMZA 4B3SL 1RCVD 1UE6A 5IE8A 3ICEA 4A3CG 3HG9A 4HMJA 3ND8A 1QG7A 1W3SA 2K04A 4RKBA 4YCVA 5IIFA 5IP9G 3NENA 1EYAA 3I4NG 4G7HC 1WTXA 5A2QL 1VQDA 1RIPA 2WACA 4XYQA 5KEEA 3NTHA 3VDYA 2R7ZG 4XT3B 1D2BA 3G6JB 5JJLA 1CKOA 1J8IA 4L5RC 4DV1L 1VQOA 1GUGA 3I8ZA 2UUBQ 2JEBI 1OO9B 2ZXRA 3J7AV 3MFYA 4R1JA 5HURA 4HMIA 1CKNA 1E3PA 4JC0A 5M5YB 4ZRZA 3R8BA 3M3YH 4DKAC 4HN7A 2CKZB 2OTLA 2VZAA 1PHJA 4X3KA 2VL6A 2EY2A 4LF9Q 3R3OA 1C9OA 1G8ZD 3PCOB 4DK0A 5I9OA 2YYZA 2D0PA 2FXQA 4F88A 4JOIC 4XTCS 5AFWA 1EY9A 2JA6B 2Q8IB 4AYBG 4CDFC 4JI3L 1EZ6A 3P20A 2DUDA 1H9RA 4JV5L 1SDFA 1XMOL 4P2CB 5ISRA 3VYTA 3S17H 3HOVG 3I73A 4YHHL 4DUZQ 1YNJD 1TXYA 3GTOB 4G7OC 3H0GG 3FEWX 3E0EA 1ZKOA 3T1HL 1TY0A 1IBLQ 3A8KE 2ZJQA 4R8NA 2HDLA 1G6ZA 4RA8A 1NMGA 1TS5A 2AUJD 2MHVA 5IWAQ 2WFWA 1Y1WB 2QKIC 1B70B 1HNXL 2DY8A 4M8AA 1LABA 5AJ3L 4KTAA 2F0OA 3OPOA 3CCQA 4GNXB 2JA8H 1CKNB 1QE6A 4ID6A 4JI6Q 2RCNA 2E8GA 1B44D 1XMQL 5J39A 3NPPA 5IGDA 4A3FH 2BOSA 2NZHA 4MZ9A 2LS01 1L1OC 2MUYA 5I2YA 1N32Q 4QIWE 2DNEA 1IYJB 1Q8KA 2UXCL 1EEFD 5T1IA 4OWXB 4DR7Q 3X3NA 5EPJA 5FJ8H 1X3FA 4FNFA 1N36L 3QOLA 5D65A 3FKIH 3L7ZC 3ULJA 4BY1B 5IYBG 4APVA 1NMFA 1AZPA 4HCSA 1VQLA 1EYDA 1LT3D 4IUPA 1U4RA 1AE2A 4GKKL 3GD7A 5C44G 3KBGA 1J5EQ 4JW0A 4J8QA 1QWYA 5EKKA 4OELB 2JQOA 2KEEA 2E76C 4NB3A 4TKOB 5E4XA 2XTIA 1BQQT 1JCKB 1STYA 4H13C 4OEMB 2HHHQ 4Y52H 1MBYA 3A56A 3NUCA 4C3HB 1EOTA 2XRQD 4Z9CB 5KNDA 4LFCQ 1JJGA 4IPGA 2HIXA 3F2DA 1Q8IA 5COYA 2OQ0A 5C4XH 4ZKCB 1B4OA 3I4OA 3M7NA 5JEAJ 5FK9C 1RD9D 1HNWQ 1KD1C 1HQMC 2N3SA 3K58A 4QJFA 1GUSA 4KD4A 5TSSA 3CCLA 1H9MA 5KIXA 5FLXL 5C0XH 1CZWA 3E5SA 2C5CA 4F8MA 4KMUC 3J7AF 1D8LA 5EPLA 2JA7H 4B9WA 4X3SA 3CXCA 1AH9A 3DWQA 3IFTA 4DR4L 1B8AA 3S16B 5M3MG 3RN5A 4QMGA 2NVQH 2MO0A 4ZK9B 2RHSB 4A3JH 1DOMA 3K5OA 2KCMA 1KNAA 3PV0A 4R4OA 4ZUIA 4JBWA 1S5DD 5EAYA 2NVTB 4KHZA 4ZQ3A 2OEOA 5IY0A 1HFNA 1Z6HA 1X6OA 1STEA 1PV4A 3S14H 5FO7B 1Q7YC 5C3XA 3KJOA 1V9PA 4UP9A 4KI0A 3D8GA 1PH6A 4QF4A 1F9PA 3HOYH 4BBSH 5IP7G 4PQXA 4A75A 2PMZB 4JI5Q 1Z9FA 2L4NA 1MKHA 1SNOA 3AQQA 3HRZC 3K6OA 1VF5C 2E2JH 1KLGD 4HSPA 4DV5Q 1TVXA 1II3A 4A3BG 1GXDC 3DLLA 3F2CA 3R93A 4IOCA 4JI1Q 4B9XA 2IJ0A 2CH4W 4ALPA 4JYAQ 1FR3A 1Y8NB 1D1IA 3I3CA 1JR0D 1ZYRD 4JCVE 1FJGQ 2DJFC 5LL6S 2IHEA 2F52A 2HCIA 5KGUA 1TY2A 5H1SE 2FFKB 3ZJYC 3EA6A 1HFGA 3K0YA 1VQNA 5JJKA 3PUYA 1QCBD 4DR1Q 3HOWH 2UXBQ 1HUNA 1JWSD 1I4QA 1JOQA 3EBEA 1KDCA 3PF5A 3HOZH 4O0AA 2QDBA 1YHBA 1F9RA 2R3ZA 3GV6A 2CWAA 4CJ1B 2EIFA 2DGYA 4IN3A 3ND9A 4L8JA 2J0TD 5CYUA 3GTKH 5CR3A 2V4DA 4GNXC 4AQYQ 3PF4A 3OMGA 4OIJA 2IY5B 4B3MQ 3CQZB 4A3DG 1YNNC 5LHY1 2R93G 3M4PA 4PZ7A 5GAEC 2IX1A 2XWBB 2B2VC 4CGYB 5ELBA 4DV7Q 1HR0W 4QY7A 2BH8A 5BR8L 4X62Q 1XYIA 1UAPA 1PDQA 3OHXC 3W5OA 4OWWB 1EQVA 2JA5B 1HNZQ 1JOOA 4NXMQ 5K36G 4IFDI 4DAPA 3NQIA 5M3FB 2F4VL 4RWSC 2L5TA 3HOUG 3PUZA 4L5QA 4HIMA 3EROA 1SJED 3DM3A 4BY7H 2H4OA 2VQEL 3FRPB 1EIHA 3GTPB 1JICA 3LWUA 3W3AA 1PH5A 2SOBA 1E24A 4DFAA 4X64Q 2PZWA 1YIJA 1XPRA 1OXSC 4EX5A 1VCIA 1MHWC 4X66Q 4JI2L 3SXHA 3STBD 1AFPA 1BCPD 1QUQA 2E2DC 2F0PA 1DJRD 4UAIA 3TP8A 2ZXOA 1D5ZC 4IO9A 1KIXA 1K8MA 4ABNA 1PH2A 4XQNA 2R92B 2PYKA 1FVIA 2B8FA 3UDGA 4KHPL 3J81E 5JVG3 2YU9H 3RZOH 2KUMA 1MSHA 5IODA 1DM0B 3M9BA 4IPHA 4KV6A 1X3EA 1SNQA 1VQ6A 3M4QA 3V96A 4ZUJA 3QIAA 2VUMH 2B39A 5EPKA 4C2MB 2JA8G 1E22A 1X3PA 1VMPA 1JE5A 4RGTA 3TREA 2HUGA 4JI4L 2AQ3B 3BDLA 4A4IA 3CPFA 4A3FG 3AFPA 4X65L 1FD7D 3EIVA 2K28A 4ULLA 3S2DB 4JI8Q 1TIID 2XRSD 1CT1D 3CMEA 5HGQA 3WDNA 4P74A 1KDBA 4H02A 1HA5A 5JPMC 1KLUD 1SFOH 1VDZA 3G48A 3P1HA 1VQJA 4LF6L 1MJCA 2K5DA 4PMWA 1F2MA 1PTOD 1B9MA 3IL8A 3GP7A 4IUNA 4MTNA 1HTLD 4DK1A 3CC7A 1QUQB 3BDCA 1HZAA 2E75C 4MIUA 1EIGA 4B3TL 4NP5A 4GN5A 4DXGA 4BY1H 2PMZE 4BBRH 2WAQG 4K5XA 4UHVA 2EY1A 2PQAA 5JJZA 1IBKL 4FDBA 1RDPD 1C4QA 3HZXA 3J7YW 2EY6A 4DR5Q 1CHPD 3KF8A 5FLXc 4ILWA 1KXLA 3K0XA 3H15A 5HGTA 3K7AB 5EBDA 5C4XG 1CA6A 4V190 2OQKA 2EVBA 4DNTB 4K2LA 3PO2B 1QOHA 4C3HH 4YY3L 2A68C 4PV1C 2A6HD 1PRTC 2GVAA 3PUWA 1SYFA 1M1KC 4DR6Q 4C56C 3H09A 1Y1VB 4P75A 1TWCB 2F0EA 3KJPA 1K9MC 3PIPA 2JA7G 5GROA 3CCRA 2BDOA 3AFQA 4G4KA 1NY4A 4JBKA 2GN5A 1L1OA 3KBXA 1SNCA 2FJ2A 2UUAL 3S1MH 4OXPA 4K5VA 1PYBA 1SXTA 4LUZA 2B63B 3GTGH 3MVVA 2EYFA 3D6WA 4XQJA 2HT1A 2JP1A 4J15A 4FF3A 1XXGA 2R7DA 3CD6A 3V05A 2IWHA 4DV3Q 2F3WA 3OYYA 4GOPC 1S72A 4CJ2C 5JPNC 4I7AA 2PQAB 3AU7A 1EFID 3ONAB 3JAME 2NZOA 1SYGA 3KF8B 4OWTB 3GQBA 1DXMA 1ENCA 1BVSA 3UE0A 1T5XD 1IYVA 3FPPA 3S9WA 1QZGA 1SLJA 2F0IA 3OSOA 1HR0Q 5T1GA 4CDDC 4BA1I 3URYA 4J1MA 3M4OB 2L55A 3KLRA 1YHQA 3K57A 4OGQC 1DYQA 1ET9A 2ZXPA 3HOZG 2HD3A 5ELNA 5C0XI 1U4MA 2F0HA 4KN7C 3T1YQ 5C3EB 2F0NA 3AMUA 3RZDH 1I50B 1O7YA 4B08A 2E2HH 1EU4A 1L1OB 4EVOA 3GTJH 2KA7A 3MXGA 4MHEA 5NUCA 2EYJA 3T4AC 5DLQE 1OXXK 4HIOA 2R6GA 3EJIA 2LXKA 1VQ7A 2EYOA 1JB7A 3MZ5A 5CV9A 1E1TA 2Z4IA 4XYOA 3A54A 2LFNA 1V1QA 2A19A 4P73A 3QJYA 4DR3Q 1PA6A 2EDGA 2QGQA 1EYGA 5C3WA 1RHPA 1B2TA 1UUPA 2PO4A 2N55A 2QCPX 1SE4A 1PH1A 1TWGB 4BY7G 1LTAD 1VMCA 1J9OA 2CHBD 3M85A 5IT9E 1KRSA 3CRKC 4FXKC 2YV5A 1N9WA 2CCZA 1WFQA 5IT9c 4K5WA 1XNQL 4C3JB 4ZAIA 3S1NH 1N34L 1EUJA 4DV6L 3TQYA 1Y14B 1QVGA 3Q23A 4GN3B 4J6HA 2AMCB 3HKZG 2CW0C 5GADC 3HOXB 2Q2IA 1PTOH 3GTPH 3G7LA 3BZKA 3NBIA 4DAVA 5CC4A 2NVYB 2VW9A 3SK6A 2F0WA 1JC7A 1RTOA 1WJJA 4LK1C 1EWIA 3TZUA 1STBA 4IUTA 3ULPA 2NB0A 3WOFA 3CCJA 5E1FA 4WJ4A 4ZLTF 1NNXA 1ZXTA 4A93B 2JXMB 3NQTA 2CQAA 3PMFA 4YWMA 1B7YB 3CAMA 3NE5B 3TS2A 1WCMH 4DV4L 3DEPA 1EOVA 2RF4A 2OF1A 1W2BA 3IAYA 2RDGA 1FNUA 4A3GB 2ENBA 4GNXA 4F7XA 4P72A 4X6AH 3M4YA 1LV9A 4DR2L 4UPAA 2VUMG 1GOZA 3J80E 4Y7NB 2B2VA 4TRDA 5CMDA 3K7UC 1SAPA 3Q0AA 5FLMH 1TKWB 2AHOB 3QR8A 1EY7A 3S2HH 2VQFQ 1TR5A 4A3MH 5M5XB 2K5HA 1U9RA 4L6TB 4DK3C 3G4SA 3E6ZX 4FF2A 2A1AA 3NELA 1SE8A 1SEBD 2A6EC 2ZTEA 4EQ5A 2DNCA 2N8NA 3ZYYX 4B3RL 3MA2B 4QB4A 2Q2TA 4A3KH 2WIIB 3TMEA 1EY8A 3CP0A 3S2DH 2JA9A 1D5XC 2Y0SB 1PH8A 4RCOA 1A3UA 4IJHA 2ZM6L 1XNRQ 3RUZA 2KCNA 1I5FA 1HJPA 3KLWA 3AEVA 3A8JE 2ZTDA 3B6YA 1EQRA 4CBVA 3I55A 3F2UA 3I4NB 4GZYC 2A5HA 1KDAA 4LF7Q 4HJ9A 3PIP3 4A76A 4BBRG 3I4LA 2VXWA 2R7ZB 3WOEA 4NXNL 4WRDA 1XWEA 5ELOA 4LF8L 1E0BA 1VQMA 1TS2A 1I4RA 3L2PA 4LF5L 1GUTA 5I9PA 2KBNA 4S3SA 4DF7A 1F2LA 1EY6A 1ICFB 1X65A 1GUOA 3K5LA 1K3RA 1WOCA 1HHVA 4DV0Q 3S1RH 4A3IH 1IW7C 2RSOA 1XTCD 1WD0A 4EQOA 3J7A5 3KFUA 1TT2A 1HRJA 1M90C 4LUVA 4YWLA 4HIDA 1X9NA 3I4MG 1LYLA 4UP8A 3MTSA 2PPBC 3J81L 1YVCA 3H3VC 2E5LQ 1LUZA 4GKJL 2H1EA 4K14A 1WTRA 1EEID 4DV2Q 1EL0A 2KHSA 5LMUL 2Z6KC 1GM5A 3GTQH 4AYBB 2KECA 1AP0A 4G7ZC 1YNXA 2NZ1D 4HR7B 3TSSA 2VB3X 2HIVA 2K01A 2EOTA 3NK9A 2UXDL 1GVPA 1Q12A 1WD1A 2CWPA 1BOSA 5LMNL 1RKNA 1VQ8A 2AUKA 1LTLA 2SDFA 4A3LH
chains in the Genus database with same CATH topology
3HOVB 1WTVA 2RBMA 1G91A 2SEBD 1HUMA 3A55A 3H0GB 2NVXB 1DOLA 4C1NI 2F0KA 3BVGA 1STHA 1EY4A 2O2LD 2QILA 2WINB 4FP5D 3SK8A 3GTMB 5C4ZA 1STGA 3N6RA 5CGKA 4KJNA 2DN8A 1VF7A 4FVMA 1AEXA 3TDQA 5BN3A 3ERQA 2HDMA 2KEDA 3RLFA 3D31A 2X6LA 1YNJC 4L63B 3D4DA 2K1BA 1I4XA 1U4LA 1Q1EA 2L0CA 4FO2A 3PUXA 4V0BA 3TP5A 1KAAA 1LLRD 2G9DA 5JAVA 3A7LA 1S5ED 1IHZA 1SJHD 2O5IC 5C44B 4HSVA 2PCFB 1R9TB 5J1ZA 4IFDG 2MP1A 3FPUB 1F77A 4NKLA 1KTKA 1IL8A 4MN3A 5KYLA 4WFN3 1WTOA 2JEAI 3L9AX 2WKDA 3OIQA 1OXUA 3FDTA 1NCVA 1PZKD 1GJXA 1B53A 4H0LC 3S1QB 3OIPA 2PW5A 1EZ8A 4EGVA 1H9JA 4JK1C 1ESRA 4X3UA 1DD2A 5KRUA 3MFGA 4R8IA 1H9SA 1MI2A 3VR5A 1STAA 3JAML 3GV3A 5C4JB 1L0XB 1ILPA 3EVQA 3FMCA 3SVMA 5M3MB 4KY7A 2NYZD 1PZJD 1TWAB 1PRTB 1A3VA 3VYSA 4EQPA 5M5WB 4EQNA 5ELFA 1LTGD 2IW3A 1D6EC 3QG1A 1ML0D 5E4WC 4QCLA 1NSNS 2K5QA 1IKMA 3SK4A 2TMPA 3RD4A 5CBAE 2PQEA 3NTKA 4X3TA 2X6GA 2SNSA 3LX0A 3S15B 4A3BB 3I90A 5LL6X 3CKIB 1Z47A 2A74C 3VR2A 4RKLA 1I4PA 1I3QB 1R4QB 3SHLA 4XXEA 3SE0A 2MPMA 4HAEA 3VA5A 1FYCA 2LMCB 1OXTA 3MAQA 3HGBA 1UEAB 2HQEA 1H9SB 2EYHA 5I2XA 4WJWA 1D5MC 1S5FD 3OOCA 2ICIA 2NN6I 5IT9L 4LAAA 4IZ8A 4OO1H 2E74C 1A3TA 1EWCA 2L11A 1ZYRC 2RA4A 1TQOA 4A3DB 3I91A 2R93B 1CQVA 3H6MA 2ICEC 1CK1A 1K83B 2GA4B 4NW2A 3SK5A 5CV4A 3GO5A 1PZID 4LMQD 1JE4A 4BWGB 4E6IA 3M3YB 1CI3M 3HOUB 2BE5D 2NTSA 2MJ8A 4RAUC 1Y8PB 2D62A 1JQYD 2EY5A 3QOJA 3TZDA 3J80L 1AW7A 2B2WC 3TBIB 3P75A 1SMYD 1MSGA 3NHHA 2B8GA 5D3DA 2WKCA 3S17B 4ZKBB 4Q0FA 4KHVA 3CHBD 1A15A 3K5MA 1K8OA 1SYEA 2HCCA 3C3LA 2FHTA 4K6LA 1B3AA 4U673 3BG3A 2KOLA 2PZTA 1BCPC 2JA8B 1ILQA 3BDOA 1BUVT 4A3FB 5C0XG 4KKSA 2LKVA 3TP6A 4TQUS 3QB3A 2F0MA 2IX3A 2M00A 2PZUA 2VB2X 1PFBA 3PUVA 5F2DA 1SBBB 4KKTA 2RVLA 3NXWA 2A69D 4ME5A 1OXVA 2K03A 3LWEA 4IFDJ 3MHBA 1A2UA 2AWOA 1JWMD 5JVH3 2WAQB 1G291 4UDUC 1QNKA 5BN4A 3BZDB 2B2TC 1I6HB 5C4XB 1EWHA 2C9OA 4KD3A 1CZGA 2DY7A 1PTOC 5IGEA 1TU2B 5IGGA 4IURA 3VYUA 1KNEA 4C3IG 3BS1A 3LNNA 1PFNA 1CFMA 2EJFC 2JA7B 1O7LA 1W6JA 4RCNA 4FXDA 2TSSA 2ZT9C 2VNUD 3KLSX 1R4PB 3DUZA 3AB9A 5IGCA 2A6HC 1JORA 4R9WA 3MXPA 3S14B 3OMCA 5CBEE 5K5PA 2O5JC 4KKUA 1F2YA 2D5DA 1SSOA 2BA1A 1SE3A 1JB3A 2NWGA 1ENFA 2O4XA 1EU3A 1LT5D 3HP3A 4K8JA 2Q8TA 1ENAA 1Y69U 2KQ3A 2JSOA 1BCPF 1BDOA 2R61A 3CU7A 1W6KA 4DNRB 5ELCA 5I6YA 5C4HA 3VR4A 2NN6H 3NWTA 4F87A 1T5EA 1EY5A 3HOZB 3A8IE 5C5LA 1B9NA 4K8IA 1DZ1A 5DM63 1GUWA 1EYCA 1S4ZA 3VYRA 3FVQA 2B2YC 3GTKB 3I70A 5IGBA 4G57A 2EJMA 2RQXA 2F03A 2IX0A 3DWPA 2F0SA 2XVSA 2PNRC 3O13A 3RMHA 1BBXC 4KK7A 5D3IB 1NR4A 2CVRA 5EKIA 3H94A 3KK7A 1SNDA 1UNSA 3Q24A 1NR2A 4BY7B 1PTOF 2K5WA 5BN5A 5K36H 3VR3A 2F0LA 1X32A 1JOKA 1F2ZA 1LACA 1A2TA 3U9SA 1AN8A 4FXGC 1LT6D 3HKZB 2EYLA 1LO5D 5D14A 3L3OC 1B50A 5DEHA 3E0JA 4KY5A 4KJOA 1V1PB 1SE2A 4DA2A 4IQZA 4H44C 4OO1I 3K59A 2YU9B 2XN9C 5JOBA 3RZOB 1HA6A 1E2VA 1O7ZA 4DAYA 4C3HG 1E2WA 4RHSA 2VUMB 3D4RA 2B2UC 2K6AA 5C0XJ 4QUCA 1X3QA 3C1FA 4TSSA 1ICWA 1IYUA 1SFOB 3NSWA 5EKLA 1L0YB 4RHRA 2F1MA 4HCEA 5IGFA 1EY0A 4YIJA 3M7GA 5DM73 3D3RA 1FNVA 1QNUA 1GUNA 5FO8B 2B2WA 1LTRD 4BBRB 3OWEB 3I72A 1BNZA 4I65A 5I4DA 2EE1A 2AQ1B 2JE6I 1B1ZA 2QEJC 2D2CC 2SNMA 2BA0A 3NP8A 4DN4M 2F0DA 4XDXA 1GHKA 2F0GA 3I4MB 4FF1A 1WVLA 1HCZA 1NAPA 2A73B 4O1NA 1I6VC 3D4WA 1C8CA 1D1KA 1YNND 1KABA 1HTPA 4RGOS 5C5MA 2F0TA 5CV5A 4RH6A 1LTID 4HTHA 4IUQA 4IALA 4OIKA 2L9HA 3S1MB 5FO9B 4Q5VA 3GTGB 3VA7A 1HPCA 3VR6A 2NTTA 3Q22A 1LTSD 2K7VA 2L12A 3BVMA 1QILA 1I4GA 4CJ0B 3MEHA 3OWFA 1Y8OB 4HEDA 3EQLC 3R2IA 5CV8A 1RJTA 1E2ZA 2NBFA 2F0UA 1WTQA 2K33A 3K5NA 2F3VA 4RGMA 2RDFA 1HQRD 3IKJA 1TS4A 1DCZA 2RDHA 2XIWA 4OL7A 3TN2A 4DGZA 2EXZA 3NTIA 3T16A 3TP7A 1U4PA 2AWNA 4FF4A 2B2TA 3C1EA 1TWFB 2NN6G 5JEAH 3Q6SA 1PFMA 2IPKD 1BCPB 1MGSA 4QUFA 5A2QE 1NUCA 3BVZA 1BR9A 3T56B 3RZDB 2IT1A 4N9PA 2E2HB 1S5BD 1MD2D 1SYBA 5DNFA 3GTJB 4DXFA 2E2IB 2IL8A 1RODA 3V2TA 2FMCA 2MGSA 3BYYB 2F0JA 4BS9A 4XT1B 3KLSA 5EJWA 4ODGA 1LT4D 4CKBA 4O42A 5KNBA 3A7AB 5G3LD 3ITPA 3N52A 1O78A 5E3FA 2WB1B 3HS0C 1FGBD 3DXJC 1Q3LA 2M9VA 5IOCA 1AZQA 1BO0A 4WORA 4PMCA 2D9UA 3S1NB 2RKSA 2EYMA 1PMRA 1TWHB 1BXTA 1F9SA 1PTOB 1FNWA 2I46A 5EGTA 3OW7A 2L1BA 2OXPA 1PLFA 1SNMA 2I07B 1ESFA 1LTTD 2EZVA 2A68D 1JWUD 1PRTD 5FKAC 1WCMB 2Z8LA 5DAUA 2JYOA 3MC0B 2B2YA 1G2TA 1CA5A 4U68A 3T51B 1STNA 2F4IA 4H7BA 1IKLA 3NWSA 3S2HB 2N88A 3X3MA 4A3MB 1V1OA 4BA2I 2OT2A 2BCOA 3IFDA 1Q1BA 2K05A 4IUVA 5A35A 4M1UB 4CHTB 4N9TA 3DMUA 3EFXD 4A3KB 1RTNA 4KY6A 4CKEA 5CORA 5I6WA 4CKCA 5CV6A 1SYCA 2Q8RE 2XSCA 1CM9A 1GHJA 3HEJA 2EYPA 3QWNA 3D6CA 1G2SA 3QO2A 3SEBA 4RFBA 1ONLA 1HXYD 5CV7A 2KCCA 4ZYSA 2Z4HA 4NDXA 2NUCA 3S1RB 4A3IB 1F9QA 5FLXE 2WP8J 5M9OA 2AQ2B 3DM1A 3P7JA 1PYWD 4XIGS 2WV6D 2F0FA 5KYIA 2LY7A 2J7ZA 3CRLC 3T13A 5ELDA 3UI2A 1SNPA 3SDZA 1PXUA 2B2UA 2FMMA 4RGNA 3GTQB 3FKIB 1M8AA 3W2DA 4K2KA 5EQ0A 2J4XA 1V8QA 4XQQA 3H91A 2BDNA 3KUPA 2BE5C 3R2TA 2XNAC 3U9OA 1S5CD 1EQTA 2G9HD 1Z7TA 1Q90A 2XWJB 1CQFA 2FINB 3DHQA 3MXUA 1CHQD 2PW7A 1ET6A 5J22A 1SMYC 3C2PA 2CW0D 2K32A 1TS3A 1QB5D 3PO3B 4LJZC 1QJOA 3GTLB 4KN4C 3NBHA 1A6XA 2RSNA 5JEAG 4DU9A 1BF4A 3C46A 2NVQB 1ZEQX 3MXNA 4K6DA 4C3JG 4A3JB 2QF7A 4IUUA 2ID0A 3DEOA 4QIWB 2F0VA 5KNCA 1RF2D 1O80A 5C6AA 2EPBA 1CTMA 4BBSB 1LTBD 3HOYB 5G3LF 5EBCA 2E2JB 5ELEA 1I4HA 2F0QA 2A6ED 4C1NK 1V43A 2EJGC 3BYTB 4OHJA 2X69A 1WTWA 4IFDH 1SYDA 2A69C 4PMBA 1H9KA 1DONA 3MWYW 2KVMA 1XX8A 4PNYA 3PIO3 4C3IB 4A3EB 3HOWB 3SR1A 4FYDA 5FOBB 1M4VA 2KJXA 4I7ZC 1C48A 1V1PA 3T53B 2M2LA 4OO1G 1PRTF 3DWAA 2Z1CA 1WTPA 1IW7D 1DOKA 4NMZA 1RCVD 3HG9A 4HMJA 3ND8A 1QG7A 2K04A 4RKBA 5IIFA 1EYAA 4G7HC 1WTXA 5A2QL 2WACA 4XYQA 5KEEA 3NTHA 4XT3B 1D2BA 3G6JB 1J8IA 1GUGA 3I8ZA 3J7AV 2JEBI 1OO9B 2ZXRA 3MFYA 5HURA 4HMIA 5M5YB 4ZRZA 3R8BA 4HN7A 4X3KA 2EY2A 3R3OA 1G8ZD 4DK0A 5I9OA 2YYZA 4F88A 5AFWA 4XTCS 1EY9A 2JA6B 2Q8IB 1EZ6A 3P20A 1H9RA 1SDFA 4P2CB 5ISRA 3VYTA 3I73A 1YNJD 3GTOB 4G7OC 3FEWX 1ZKOA 1TY0A 3A8KE 4R8NA 2HDLA 1G6ZA 4RA8A 1TS5A 2AUJD 2MHVA 1Y1WB 2QKIC 2DY8A 4M8AA 1LABA 4KTAA 2F0OA 3OPOA 1QE6A 4ID6A 1B44D 5J39A 3NPPA 5IGDA 2BOSA 2LS01 2MUYA 5I2YA 2DNEA 1EEFD 5T1IA 3X3NA 5EPJA 4FNFA 3QOLA 5D65A 3L7ZC 4BY1B 1AZPA 4HCSA 1EYDA 1LT3D 4IUPA 1U4RA 3GD7A 3KBGA 4J8QA 1QWYA 5EKKA 2KEEA 2E76C 4TKOB 5E4XA 1BQQT 1JCKB 1STYA 4H13C 1MBYA 3A56A 3NUCA 4C3HB 1EOTA 2XRQD 4Z9CB 5KNDA 1Q8IA 5COYA 4ZKCB 1B4OA 3M7NA 5JEAJ 5FK9C 1RD9D 1HQMC 3K58A 1GUSA 4KD4A 5TSSA 1H9MA 5KIXA 5FLXL 5C0XH 1CZWA 3E5SA 2C5CA 4F8MA 4KMUC 3J7AF 5EPLA 4B9WA 4X3SA 3DWQA 3IFTA 3S16B 4QMGA 4ZK9B 1DOMA 3K5OA 1KNAA 3PV0A 4ZUIA 4JBWA 1S5DD 2NVTB 4KHZA 4ZQ3A 2OEOA 1HFNA 1Z6HA 1STEA 5FO7B 5C3XA 4KI0A 3D8GA 4QF4A 1F9PA 4PQXA 2PMZB 2L4NA 1SNOA 3HRZC 3K6OA 1VF5C 1KLGD 4HSPA 1TVXA 1II3A 1GXDC 3R93A 4B9XA 2IJ0A 1FR3A 1Y8NB 1D1IA 3I3CA 1JR0D 1ZYRD 5LL6S 2HCIA 5KGUA 1TY2A 2FFKB 3EA6A 1HFGA 3K0YA 3PUYA 1QCBD 1HUNA 1JWSD 1I4QA 1JOQA 1KDCA 2QDBA 1F9RA 2R3ZA 3GV6A 4CJ1B 4IN3A 3ND9A 4L8JA 2J0TD 5CYUA 5CR3A 2V4DA 3OMGA 4OIJA 3CQZB 1YNNC 5LHY1 2IX1A 2XWBB 2B2VC 4CGYB 5ELBA 1XYIA 1UAPA 1PDQA 3OHXC 1EQVA 2JA5B 1JOOA 5K36G 4IFDI 4DAPA 3NQIA 5M3FB 4RWSC 2L5TA 3PUZA 3EROA 1SJED 2H4OA 3FRPB 1EIHA 3GTPB 1JICA 3LWUA 3W3AA 2SOBA 4DFAA 2PZWA 1OXSC 1VCIA 3SXHA 1AFPA 1BCPD 2E2DC 2F0PA 1DJRD 4UAIA 3TP8A 2ZXOA 1D5ZC 1K8MA 4ABNA 4XQNA 2R92B 2PYKA 2B8FA 3J81E 5JVG3 2KUMA 1MSHA 5IODA 1DM0B 4KV6A 1SNQA 3V96A 4ZUJA 3QIAA 2B39A 5EPKA 4C2MB 1X3PA 1VMPA 4RGTA 2HUGA 2AQ3B 3BDLA 1FD7D 2K28A 4ULLA 3S2DB 1TIID 2XRSD 1CT1D 3WDNA 1KDBA 1HA5A 5JPMC 1KLUD 1VDZA 3P1HA 2K5DA 4PMWA 1F2MA 1PTOD 1B9MA 3IL8A 3GP7A 4IUNA 1HTLD 4DK1A 3BDCA 2E75C 4MIUA 1EIGA 4NP5A 4DXGA 4K5XA 2EY1A 5JJZA 1RDPD 1C4QA 3HZXA 3J7YW 2EY6A 1CHPD 3KF8A 4ILWA 5HGTA 3K7AB 5EBDA 1CA6A 4V190 2EVBA 4DNTB 4K2LA 3PO2B 1QOHA 2A68C 4PV1C 2A6HD 1PRTC 3PUWA 1SYFA 4C56C 3H09A 1Y1VB 1TWCB 2F0EA 2BDOA 4G4KA 3KBXA 1SNCA 2FJ2A 4K5VA 1SXTA 2B63B 3MVVA 2EYFA 3D6WA 4XQJA 2JP1A 4FF3A 1XXGA 3V05A 2IWHA 2F3WA 4CJ2C 5JPNC 3AU7A 1EFID 3ONAB 3JAME 1SYGA 3GQBA 1DXMA 1ENCA 1T5XD 1IYVA 3FPPA 3S9WA 2F0IA 3OSOA 5T1GA 4BA1I 3URYA 4J1MA 3M4OB 2L55A 3KLRA 3K57A 4OGQC 1DYQA 1ET9A 2ZXPA 5C0XI 1U4MA 2F0HA 4KN7C 5C3EB 2F0NA 3AMUA 1I50B 1O7YA 4B08A 1EU4A 4EVOA 2KA7A 3MXGA 4MHEA 5NUCA 2EYJA 3T4AC 1OXXK 2R6GA 3EJIA 2EYOA 3MZ5A 5CV9A 2Z4IA 4XYOA 3A54A 2LFNA 3QJYA 2EDGA 5C3WA 1RHPA 1B2TA 1UUPA 2PO4A 2N55A 2QCPX 1SE4A 1TWGB 1LTAD 1VMCA 1J9OA 2CHBD 3M85A 5IT9E 3CRKC 4FXKC 4K5WA 4C3JB 4ZAIA 3Q23A 4J6HA 3HOXB 2CW0C 1PTOH 3G7LA 4DAVA 3NBIA 5CC4A 2NVYB 3SK6A 2F0WA 1JC7A 1RTOA 4LK1C 3TZUA 1STBA 4IUTA 2NB0A 3WOFA 5E1FA 4ZLTF 1ZXTA 4A93B 2JXMB 3NQTA 2CQAA 3PMFA 3NE5B 3DEPA 2OF1A 3IAYA 2RDGA 1FNUA 4A3GB 2ENBA 4F7XA 3M4YA 1LV9A 1GOZA 3J80E 4Y7NB 2B2VA 4TRDA 5CMDA 3Q0AA 1SAPA 1TKWB 1EY7A 1TR5A 5M5XB 1U9RA 4L6TB 3E6ZX 4FF2A 1SEBD 2A6EC 2DNCA 3ZYYX 3MA2B 4QB4A 2WIIB 3TMEA 1EY8A 1D5XC 2Y0SB 4RCOA 1A3UA 3RUZA 2KCNA 3A8JE 4CBVA 3F2UA 3I4NB 4GZYC 2A5HA 1KDAA 3PIP3 3I4LA 2VXWA 2R7ZB 3WOEA 4WRDA 1XWEA 1E0BA 1TS2A 1I4RA 1GUTA 5I9PA 4S3SA 4DF7A 1F2LA 1EY6A 3K5LA 1GUOA 1HHVA 1IW7C 2RSOA 1XTCD 1WD0A 4EQOA 1TT2A 1HRJA 3MTSA 2PPBC 3J81L 3H3VC 2H1EA 4K14A 1WTRA 1EEID 1EL0A 2KHSA 4AYBB 2KECA 1AP0A 4G7ZC 2NZ1D 4HR7B 3TSSA 2VB3X 2K01A 2EOTA 3NK9A 1Q12A 1WD1A 1BOSA 1RKNA 2AUKA 2SDFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FOB B;  1GXD C;  3HS0 C;  1XWE A;  3MA2 B;  1UAP A;  3OHX C;  1PXU A;  2QKI C;  5JPN C;  2WII B;  1BQQ T;  1JC7 A;  3T4A C;  2TMP A;  2I07 B;  5FO7 B;  1UEA B;  5FO8 B;  4FXK C;  1D2B A;  2J0T D;  4FXG C;  3G6J B;  5FO9 B;  2ICE C;  3I70 A;  3KLS A;  2A73 B;  2XWJ B;  3L3O C;  2WIN B;  1BR9 A;  5JPM C;  3CKI B;  1BUV T;  2E2D C;  3CU7 A;  3V96 A;  1JB3 A;  1OO9 B;  2B39 A;  2XWB B;  3HRZ C;  2A74 C;  3FRP B;  4ILW A; 
#chains in the Genus database with same CATH topology
 3HOV B;  1WTV A;  2RBM A;  1G91 A;  2SEB D;  1HUM A;  3A55 A;  3H0G B;  2NVX B;  1MJE A;  4P71 A;  1DOL A;  3CCU A;  4C1N I;  1K8G A;  2F0K A;  2B63 H;  3BVG A;  1STH A;  1EY4 A;  3CCM A;  2O2L D;  2QIL A;  2WIN B;  4FP5 D;  4LF4 L;  3SK8 A;  1UE5 A;  3GTM B;  5C4Z A;  1STG A;  3N6R A;  1YJW A;  4LFA Q;  5CGK A;  4KJN A;  2DN8 A;  1VF7 A;  4AIM A;  4FVM A;  1AEX A;  4KLK A;  3TDQ A;  5BN3 A;  2ZJP A;  3CC4 A;  3ERQ A;  3PO3 H;  3GTL H;  2HDM A;  2KED A;  3RLF A;  3D31 A;  2X6L A;  2UU9 L;  1YNJ C;  4OX9 L;  4L63 B;  1KHI A;  3D4D A;  3RR5 A;  2K1B A;  1I4X A;  1U4L A;  1Q1E A;  2L0C A;  4FO2 A;  3PUX A;  4V0B A;  3TP5 A;  1KAA A;  1LLR D;  2G9D A;  1VQ5 A;  5JAV A;  3A7L A;  1C7Y A;  1S5E D;  1IHZ A;  1SJH D;  2O5I C;  5C44 B;  4YWK A;  4HSV A;  2PCF B;  2UUB L;  4PG3 A;  5HY6 A;  1R9T B;  5J1Z A;  1P8L A;  4O2D A;  4IFD G;  2G5D A;  2MP1 A;  1I50 H;  2I0Q A;  1YI2 A;  4GS3 A;  2MNA A;  2N49 A;  3FPU B;  4PZ8 A;  1F77 A;  4NKL A;  4UP7 A;  4K0K Q;  1KTK A;  1IL8 A;  1QVC A;  4MN3 A;  5KYL A;  4WFN 3;  1WTO A;  4LF9 L;  2JEA I;  3L9A X;  4DUY Q;  2B3G A;  4OON A;  2WKD A;  3OIQ A;  1OXU A;  1QVF A;  3FDT A;  4GOP A;  1NCV A;  1PZK D;  1GJX A;  2WB1 G;  1B53 A;  4H0L C;  3S1Q B;  3OIP A;  2PW5 A;  1EZ8 A;  4EGV A;  4POG A;  1H9J A;  4JK1 C;  1ESR A;  4X3U A;  1DD2 A;  1NBW A;  5KRU A;  3MFG A;  4LFB Q;  5IYD G;  4R8I A;  1H9S A;  1MI2 A;  3VR5 A;  4C3I H;  2CFM A;  3CPW A;  4A3E H;  1STA A;  1VQP A;  3TEH B;  3JAM L;  2Y0S E;  3GV3 A;  5C4J B;  1L0X B;  1SR3 A;  1ILP A;  3EVQ A;  3FMC A;  4DUZ L;  3UE1 A;  3SVM A;  5M3M B;  4KY7 A;  2NYZ D;  1PZJ D;  1TWA B;  1PRT B;  4C3J H;  1A3V A;  1IBL L;  4IJL A;  3VYS A;  4EQP A;  2L15 A;  5M5W B;  1OTC A;  4EQN A;  5ELF A;  3HOX H;  1X56 A;  3MEF A;  1LTG D;  4ME3 A;  2IW3 A;  5IWA L;  1VQG A;  1D6E C;  3QG1 A;  3U58 A;  1ML0 D;  1WCM G;  1N33 Q;  2VY3 A;  3ERS X;  5E4W C;  4QCL A;  1NSN S;  2K5Q A;  1IKM A;  3SK4 A;  1HZC A;  2TMP A;  3RD4 A;  5CBA E;  2PQE A;  4JI6 L;  3NTK A;  1SMX A;  1X55 A;  4X3T A;  2X6G A;  4A93 H;  1JMC A;  2SNS A;  3LX0 A;  5JJI A;  3S15 B;  4A3B B;  3I90 A;  1LM0 A;  5LL6 X;  3CKI B;  1AE3 A;  3OTO Q;  1N32 L;  5FLM G;  4DK6 C;  4A3G H;  1Z47 A;  4A3M G;  2A74 C;  3VR2 A;  4DR7 L;  5M5Y H;  4GOP B;  4RKL A;  1I4P A;  4IPD A;  1I3Q B;  1R4Q B;  3SHL A;  4XXE A;  3SE0 A;  2MPM A;  4HAE A;  3VA5 A;  1FYC A;  1XPU A;  4Y7N H;  2LMC B;  4AYB E;  1OXT A;  3E9H A;  3D0F A;  3MAQ A;  3HGB A;  1UEA B;  2HQE A;  1H9S B;  3UDX A;  4A3K G;  1QZH A;  2EYH A;  3RLN A;  5I2X A;  1J5E L;  4WJW A;  1KQS A;  1D5M C;  2JA6 H;  1S5F D;  3OOC A;  2QA4 A;  2ICI A;  2NN6 I;  2HHH L;  5IT9 L;  1DGS A;  4IZ8 A;  4LAA A;  4OO1 H;  2E74 C;  1K8A C;  1A3T A;  1EWC A;  1N8R C;  2L11 A;  1ZYR C;  2RA4 A;  2ES2 A;  4LFC L;  1TQO A;  4A3D B;  3I91 A;  2R93 B;  1CQV A;  3H6M A;  3J81 c;  2ICE C;  1X3G A;  3W1G A;  1K83 B;  1CK1 A;  2GA4 B;  3GTO H;  1XPO A;  1Q82 C;  3BU2 A;  4NW2 A;  1HNW L;  3SK5 A;  4A3I G;  5CV4 A;  3GO5 A;  1PZI D;  2UUC Q;  2A8V A;  4LMQ D;  1JE4 A;  4BWG B;  4E6I A;  2R7Z H;  3M3Y B;  2IHF A;  1CI3 M;  1VQI A;  1Y1W H;  4GN4 B;  3HOU B;  1YHA A;  2BE5 D;  2NTS A;  4JG2 A;  2MJ8 A;  4RAU C;  1Y8P B;  2D62 A;  1JQY D;  4DNI A;  2YTX A;  1PYS B;  4JI0 Q;  2EY5 A;  3QOJ A;  1KRT A;  5FJ8 G;  5GAG C;  3TZD A;  3FKI G;  3J80 L;  1Q46 A;  1AW7 A;  2B2W C;  3TBI B;  1KL9 A;  3P75 A;  1SMY D;  4JOI A;  5GAH C;  1MSG A;  3NHH A;  4MTK A;  2B8G A;  1VQ9 A;  1IZ6 A;  5D3D A;  2WKC A;  3S17 B;  4ZKB B;  2OCE A;  4JI5 L;  4Q0F A;  4JI7 Q;  4KHV A;  4DV5 L;  3CHB D;  3U50 C;  1I94 Q;  1A15 A;  4JI1 L;  2P5Z X;  3K5M A;  4JYA L;  1HZ9 A;  4B3S Q;  1K8O A;  1SYE A;  2HCC A;  3C3L A;  1UE7 A;  2FHT A;  4HJ8 A;  1FJG L;  4R4Q A;  4K6L A;  1B3A A;  4CDE C;  4U67 3;  1PH7 A;  3BG3 A;  2KOL A;  2NVX H;  2PZT A;  1BCP C;  2I5H A;  2JA8 B;  1ILQ A;  3BDO A;  4DR1 L;  3PO3 G;  3GTM H;  1SRO A;  2UXB L;  1BUV T;  4A3F B;  5C0X G;  4KKS A;  2LKV A;  4L5S A;  1EIY B;  5IYC H;  4JBJ A;  3TP6 A;  3LGJ A;  4TQU S;  3QB3 A;  2F0M A;  2IX3 A;  2GVB A;  4DV1 Q;  2M00 A;  1HH2 P;  2PZU A;  2VB2 X;  1PFB A;  4AQY L;  3PUV A;  5F2D A;  1SBB B;  1VQC A;  1P16 A;  2F3I A;  4A3J G;  4KKT A;  4B3M L;  2RVL A;  3NXW A;  2A69 D;  4ME5 A;  1OXV A;  4DV7 L;  2K03 A;  3S16 H;  1JJC B;  2Z6K A;  4X62 L;  3LWE A;  3KF6 B;  4NPS A;  4IFD J;  5E7N A;  3MHB A;  1A2U A;  1HNZ L;  3HOY G;  3PGZ A;  4BBS G;  4WJ3 M;  4JI3 Q;  2AWO A;  5IYB H;  4NXM L;  1JWM D;  2K52 A;  5JVH 3;  2NVT H;  2WAQ B;  4JV5 Q;  1G29 1;  4UDU C;  5C44 H;  1QNK A;  1XMO Q;  5BN4 A;  3BZD B;  3JAM c;  2B2T C;  1I6H B;  5C4X B;  2YTV A;  1EWH A;  2C9O A;  4KD3 A;  4YHH Q;  1CZG A;  2DY7 A;  1PTO C;  1SN8 A;  2I5M X;  5IGE A;  2K5N A;  1TU2 B;  5IGG A;  4X64 L;  4IUR A;  3T1H Q;  3VYU A;  4X66 L;  2KHI A;  4R4T A;  1KC8 C;  1KNE A;  4C3I G;  3JC6 6;  3BS1 A;  4A3E G;  3LNN A;  1PFN A;  3HOW G;  1PH3 A;  1CFM A;  4GLA C;  3S1Q H;  2EJF C;  1HNX Q;  3A74 A;  5AJ3 Q;  3HFZ B;  2JA7 B;  1O7L A;  1W6J A;  1H95 A;  1GD7 A;  4RCN A;  4FXD A;  1XMQ Q;  2TSS A;  2ZT9 C;  2VNU D;  3KLS X;  1R4P B;  3DUZ A;  1JT8 A;  3AB9 A;  4L5T A;  1EIF A;  2AKW B;  5IGC A;  5C4J H;  2EQS A;  2A6H C;  1JOR A;  4R9W A;  1L2F A;  5M3M H;  3MXP A;  3S14 B;  2UXC Q;  1TWA H;  3OMC A;  5CBE E;  5K5P A;  2O5J C;  1E7Z A;  4KKU A;  1N36 Q;  1F2Y A;  2D5D A;  1SSO A;  3CQZ H;  2BA1 A;  1SE3 A;  1K0R A;  1JB3 A;  4TVA B;  2NWG A;  4GKK Q;  1ENF A;  3I56 A;  2O4X A;  1PH4 A;  4JI8 L;  1VQA A;  1EU3 A;  1LT5 D;  3HP3 A;  4K8J A;  2JA5 H;  5J3B A;  2Q8T A;  1ENA A;  2PI2 A;  1Y69 U;  1BBU A;  2KQ3 A;  2JSO A;  5M3F H;  1BCP F;  1BDO A;  1UEB A;  1L0W A;  2R61 A;  3CU7 A;  1W6K A;  3G71 A;  4DNR B;  5ELC A;  5I6Y A;  5C4H A;  3VR4 A;  2NN6 H;  4DPG A;  1IBM Q;  4LWC A;  4IPC A;  1I3Q H;  3NWT A;  4F87 A;  1T5E A;  1EY5 A;  2I5L X;  2JA6 G;  3HOZ B;  3NBH B;  3A8I E;  5C5L A;  1B9N A;  2H5X A;  3K81 C;  4K8I A;  2N78 A;  1DZ1 A;  1VQH A;  5DM6 3;  1GUW A;  1EYC A;  1S4Z A;  3VYR A;  3FVQ A;  2B2Y C;  3GTK B;  3I70 A;  5IGB A;  4DR5 L;  4G57 A;  2EJM A;  2RQX A;  2F03 A;  2IX0 A;  2CH4 A;  2QDL A;  4DR4 Q;  3S24 A;  3DWP A;  2R92 H;  3I2Z A;  2F0S A;  2XVS A;  2PNR C;  3O13 A;  3RMH A;  3W1B A;  1PVO A;  1BBX C;  4KK7 A;  5D3I B;  1NR4 A;  4DR6 L;  4A3D H;  2CVR A;  2R93 H;  1MIU A;  5EKI A;  3J80 c;  1ASY A;  3H94 A;  1Y1W G;  3KK7 A;  1K83 H;  2PNH A;  1SND A;  1UNS A;  3RLO A;  2ASB A;  3Q24 A;  3BZC A;  1NR2 A;  3RN2 A;  2C35 B;  4BY7 B;  2XGT A;  4C2M H;  4R4I A;  1PTO F;  2K5W A;  2MQH A;  5BN5 A;  5K36 H;  3VR3 A;  2F0L A;  1X32 A;  1JOK A;  3HOU H;  3Q8D A;  1F2Z A;  1LAC A;  1A2T A;  1K3B C;  2MO1 A;  3U9S A;  1AN8 A;  4FXG C;  1LT6 D;  3HKZ B;  1EQQ A;  2EYL A;  1LO5 D;  2K4K A;  5D14 A;  3L3O C;  1B50 A;  4DV3 L;  5DEH A;  3E0J A;  2CQO A;  4KY5 A;  4KJO A;  1V1P B;  1SE2 A;  4BY1 G;  4DA2 A;  4IQZ A;  2K50 A;  2WAQ E;  4H44 C;  4OO1 I;  3K59 A;  3WWV A;  2YU9 B;  2XN9 C;  1NJI C;  5JOB A;  3RZO B;  2YTY A;  2KHJ A;  1HA6 A;  1E2V A;  1YEZ A;  1O7Z A;  1G51 A;  1XTD A;  1U5K A;  4DAY A;  1HR0 L;  1YIT A;  4C3H G;  3TRZ A;  1E2W A;  4RHS A;  2VUM B;  3D4R A;  2B2U C;  2K6A A;  1Q81 C;  5C0X J;  4QUC A;  3K7A H;  1X3Q A;  2K14 A;  5IYC G;  3PO2 H;  5BR8 Q;  3I7F A;  3T1Y L;  3CCE A;  1JJ2 A;  3C1F A;  4TSS A;  1ICW A;  3F8T A;  1IYU A;  1Y1V H;  1TWC H;  3TS0 A;  1SFO B;  2F4V Q;  3NSW A;  5EKL A;  1T9H A;  1L0Y B;  4RHR A;  2F1M A;  4HCE A;  1EY0 A;  3U4Z A;  4YIJ A;  1VQE A;  5IGF A;  3OW2 A;  3M7G A;  5DM7 3;  3D3R A;  2VQE Q;  3CCS A;  1FNV A;  1QNU A;  1GUN A;  5FO8 B;  3F2B A;  4GLV B;  2B2W A;  4DR3 L;  1LTR D;  4LW1 A;  4QQB X;  4BBR B;  1VQF A;  3OWE B;  1KAW A;  3I72 A;  1BNZ A;  3BJU A;  4CDC C;  4JI2 Q;  4I65 A;  5I4D A;  2EE1 A;  2AQ1 B;  2JE6 I;  1B1Z A;  2QEJ C;  2D2C C;  2SNM A;  4BXX H;  1EFW A;  2OWO A;  3NP8 A;  2BA0 A;  4DN4 M;  2F0D A;  4XDX A;  1GHK A;  4DAY B;  2F0G A;  3I4M B;  4KHP Q;  4FF1 A;  1WVL A;  1BBW A;  1HCZ A;  1IBM L;  2BH2 A;  1O7I A;  1NAP A;  1HZB A;  2A73 B;  4O1N A;  1I6H H;  1I6V C;  3D4W A;  2V1C C;  1C8C A;  1D1K A;  1YNN D;  1KAB A;  1HTP A;  4RGO S;  5C5M A;  2F0T A;  5CV5 A;  4RH6 A;  1LTI D;  4HTH A;  4IUQ A;  4IAL A;  3M4O H;  1WYD A;  4OIK A;  4JI4 Q;  1CUK A;  2L9H A;  3S1M B;  4X65 Q;  1VS0 A;  5FO9 B;  4Q5V A;  3GTG B;  3VA7 A;  1E1O A;  5C3E H;  1HPC A;  3VR6 A;  2NTT A;  3ER0 A;  3Q22 A;  1LTS D;  3AYH B;  2K7V A;  2L12 A;  3BVM A;  1I4G A;  1QIL A;  4CJ0 B;  3MEH A;  3OWF A;  3H3V H;  1Y8O B;  4HED A;  3SGI A;  3EQL C;  4LF6 Q;  3R2I A;  3CW2 C;  2VQF L;  1VQB A;  4PZ6 A;  5CV8 A;  1RJT A;  1E2Z A;  2NBF A;  2F0U A;  1BKB A;  1WTQ A;  1PFS A;  2K33 A;  3K5N A;  2F3V A;  2JA5 G;  4RGM A;  1J6Q A;  2RDF A;  1K73 C;  4B3T Q;  1HQR D;  3IKJ A;  4MNO A;  1TS4 A;  2PI2 E;  1DCZ A;  5M3F G;  2RDH A;  4ZCK A;  3A5U A;  2XIW A;  4OL7 A;  3TN2 A;  4DGZ A;  2EXZ A;  1IBK Q;  3NTI A;  3T16 A;  3TP7 A;  2Z6B A;  1U4P A;  2AWN A;  4FF4 A;  2B2T A;  3C1E A;  1TWF B;  3J81 j;  2NN6 G;  1TWG H;  1XNR L;  5JEA H;  2R7F A;  3HKZ E;  3Q6S A;  1PFM A;  2IPK D;  1BCP B;  1MGS A;  4QUF A;  5A2Q E;  4LF7 L;  1NUC A;  3BVZ A;  4YY3 Q;  1BR9 A;  3T56 B;  3RZD B;  2IT1 A;  4N9P A;  2E2H B;  1S5B D;  1MD2 D;  1SYB A;  5DNF A;  3GTJ B;  3KOJ A;  4DXF A;  2E2I B;  2IL8 A;  2NVY H;  1ROD A;  3V2T A;  4DV0 L;  2FMC A;  1YJN A;  2MGS A;  4AH6 A;  3BYY B;  2Z9H A;  2F0J A;  2RCF A;  2R92 G;  3CC2 A;  4BS9 A;  4XT1 B;  3KLS A;  5EJW A;  4ODG A;  1LT4 D;  2JJQ A;  4CKB A;  4HJ7 A;  4O42 A;  4HJA A;  1Q86 C;  2UUA Q;  5KNB A;  4JVZ A;  3A7A B;  2E5L L;  5G3L D;  4JBM A;  3ITP A;  1A62 A;  3N52 A;  3CMA A;  3U4V A;  1O78 A;  4DV2 L;  3EN2 A;  5E3F A;  2ATW A;  3HS0 C;  2WB1 B;  1FGB D;  1U0L A;  2Z0S A;  1Q3L A;  3DXJ C;  3J81 i;  2M9V A;  5IOC A;  1AZQ A;  2Q2U A;  1BO0 A;  1XJV A;  1B3Q A;  2K75 A;  4WOR A;  4PMC A;  5M5X H;  2D9U A;  3S1N B;  2RKS A;  2JK8 A;  2EYM A;  1PMR A;  1TWH B;  1BXT A;  2DJG C;  1F9S A;  1PTO B;  2KEN A;  1FNW A;  2ZTC A;  2I46 A;  5EGT A;  3OW7 A;  1A8V A;  2L1B A;  5LMN W;  2OXP A;  2RHQ B;  1PLF A;  1SNM A;  1RL2 A;  1CKM A;  4LUO A;  2I07 B;  4HIK A;  1ESF A;  1LTT D;  2QW7 A;  2EZV A;  2A68 D;  1JWU D;  4LFA L;  1PRT D;  4A3C H;  5FKA C;  3GDE A;  1A63 A;  5GQO A;  1WCM B;  2Z8L A;  3G6E A;  5DAU A;  5IP9 H;  2JYO A;  3MC0 B;  1UWV A;  3PIO A;  3I4N H;  1VQ4 A;  2B2Y A;  1G2T A;  1CA5 A;  4U68 A;  3T51 B;  4QGU A;  1STN A;  2F4I A;  3ULL A;  2K5V A;  4H7B A;  1IKL A;  3NWS A;  3S2H B;  4DAM A;  2N88 A;  3X3M A;  4A3M B;  1V1O A;  4BA2 I;  3PO2 G;  2OT2 A;  2BCO A;  3IFD A;  1IL2 A;  1Q1B A;  2LXJ A;  2K05 A;  4IUV A;  1GO3 E;  5A35 A;  2VS1 A;  4M1U B;  4CHT B;  4N9T A;  3EFX D;  3DMU A;  1S3O A;  1Y1V G;  2D0O A;  1RTN A;  4A3K B;  4KY6 A;  4CKE A;  4RMF A;  1ASZ A;  1PH9 A;  5COR A;  4HJ5 A;  5I6W A;  4CKC A;  3KF6 A;  5CV6 A;  4A3L G;  1FL0 A;  1SYC A;  2Q8R E;  2XSC A;  4IOA A;  3CF5 A;  1CM9 A;  1GHJ A;  3HEJ A;  2EYP A;  3QWN A;  3D6C A;  3QO2 A;  1G2S A;  4K0K L;  2KCT A;  3SEB A;  1XNQ Q;  4DUY L;  4RFB A;  1N34 Q;  2B63 G;  4DV6 Q;  2MFI A;  3HOV H;  1ONL A;  1HXY D;  5CV7 A;  2KCC A;  4ZYS A;  2Z4H A;  4BXX G;  3E9I A;  4NDX A;  1D7Q A;  2NUC A;  3H0G H;  1YZ6 A;  4LFB L;  3STB C;  4A3I B;  3S1R B;  1F9Q A;  5FLX E;  2WP8 J;  5M9O A;  1NE3 A;  2AQ2 B;  3DM1 A;  3P7J A;  1PYW D;  4XIG S;  2WV6 D;  2F0F A;  5KYI A;  3RNU A;  2LY7 A;  2J7Z A;  4DV4 Q;  3CRL C;  3T13 A;  5ELD A;  3UI2 A;  1SNP A;  3SDZ A;  1PXU A;  1K0S A;  2B2U A;  3FHW A;  3JAM i;  2FMM A;  4RGN A;  3K80 C;  4DR2 Q;  3GTQ B;  3I4M H;  3FKI B;  1A0I A;  2LSS A;  1X54 A;  1CSP A;  1M8A A;  3W2D A;  4K2K A;  1N33 L;  5EQ0 A;  1GKH A;  2J4X A;  1V8Q A;  4XQQ A;  5C3E G;  3NEM A;  3H91 A;  3IRB A;  4JPB W;  4N8X 1;  1CSQ A;  4QL5 A;  1SRU A;  2BDN A;  3KUP A;  2BE5 C;  3PQI A;  4GLX A;  3R2T A;  2XNA C;  3U9O A;  1S5C D;  4B3R Q;  2ALY B;  1EQT A;  2G9H D;  1Z7T A;  3OTO L;  1C0A A;  1Q90 A;  4YCU A;  4POF A;  1R9T H;  2XWJ B;  1CQF A;  3J7Z C;  2FIN B;  2ZM6 Q;  3KDF A;  3DHQ A;  3MXU A;  1CHQ D;  2PW7 A;  2WB1 E;  1ET6 A;  5J22 A;  1SMY C;  3C2P A;  2CW0 D;  2K32 A;  1TS3 A;  1QB5 D;  2ZJR A;  1WI5 A;  3PO3 B;  4LJZ C;  1QJO A;  4NXN Q;  3GTL B;  4LF8 Q;  3FP9 A;  4LF5 Q;  4KN4 C;  3NBH A;  1K28 A;  2RSN A;  1A6X A;  5JEA G;  4DU9 A;  5L37 A;  4RG1 A;  1BF4 A;  3C46 A;  2NVQ B;  1ZEQ X;  3MXN A;  4K6D A;  4C3J G;  4A3J B;  3UDI A;  1S40 A;  1YJ9 A;  3K8A A;  4UY8 C;  1TWF H;  2QF7 A;  4IUU A;  2ID0 A;  3DEO A;  4QIW B;  3HOX G;  2F0V A;  2HQL A;  5KNC A;  4GKJ Q;  1RF2 D;  1O80 A;  2EXD A;  5C6A A;  1YBY A;  3KYH C;  4LNQ A;  2EPB A;  1CTM A;  1IXR A;  4YCW A;  1UE1 A;  5LMU Q;  4BBS B;  5M5W H;  1LTB D;  3HOY B;  2UUC L;  5G3L F;  1VQK A;  5EBC A;  4A93 G;  2E2J B;  2JN4 A;  5ELE A;  1I4H A;  2F0Q A;  2A6E D;  2E2I H;  4C1N K;  2QEX A;  2UXD Q;  3CCV A;  5LMN Q;  1V43 A;  2EJG C;  4R4C A;  3BYT B;  4OHJ A;  2OTJ A;  1G6P A;  3H3V I;  2X69 A;  1WTW A;  1WTH A;  4A3G G;  1SYD A;  4IFD H;  5IP7 H;  4JI0 L;  2A69 C;  3KDF B;  1NTG A;  4PMB A;  4N8F A;  3A5Z B;  1H9K A;  3L0O A;  1DON A;  3S15 H;  1FGU A;  3MWY W;  4A3B H;  2KVM A;  1XX8 A;  4PNY A;  3PIO 3;  4C3I B;  2B29 A;  4LF4 Q;  4A3E B;  3HOW B;  3SR1 A;  3F1Z A;  4FYD A;  5FOB B;  3J80 i;  1M4V A;  3E3X A;  2KJX A;  4I7Z C;  3HKS A;  1C48 A;  2Q2H A;  1V1P A;  3T53 B;  4JI7 L;  2M2L A;  5IYD H;  4OO1 G;  1PRT F;  3MXN B;  3DWA A;  2Z1C A;  3A0J A;  3UDF A;  1WTP A;  1I94 L;  1IW7 D;  1DOK A;  3PSI A;  2UU9 Q;  2Y0S G;  1TWH H;  4OX9 Q;  4NMZ A;  4B3S L;  1RCV D;  1UE6 A;  5IE8 A;  3ICE A;  4A3C G;  3HG9 A;  4HMJ A;  3ND8 A;  1QG7 A;  1W3S A;  2K04 A;  4RKB A;  4YCV A;  5IIF A;  5IP9 G;  3NEN A;  1EYA A;  3I4N G;  4G7H C;  1WTX A;  5A2Q L;  1VQD A;  1RIP A;  2WAC A;  4XYQ A;  5KEE A;  3NTH A;  3VDY A;  2R7Z G;  4XT3 B;  1D2B A;  3G6J B;  5JJL A;  1CKO A;  1J8I A;  4L5R C;  4DV1 L;  1VQO A;  1GUG A;  3I8Z A;  2UUB Q;  2JEB I;  1OO9 B;  2ZXR A;  3J7A V;  3MFY A;  4R1J A;  5HUR A;  4HMI A;  1CKN A;  1E3P A;  4JC0 A;  5M5Y B;  4ZRZ A;  3R8B A;  3M3Y H;  4DKA C;  4HN7 A;  2CKZ B;  2OTL A;  2VZA A;  1PHJ A;  4X3K A;  2VL6 A;  2EY2 A;  4LF9 Q;  3R3O A;  1C9O A;  1G8Z D;  3PCO B;  4DK0 A;  5I9O A;  2YYZ A;  2D0P A;  2FXQ A;  4F88 A;  4JOI C;  4XTC S;  5AFW A;  1EY9 A;  2JA6 B;  2Q8I B;  4AYB G;  4CDF C;  4JI3 L;  1EZ6 A;  3P20 A;  2DUD A;  1H9R A;  4JV5 L;  1SDF A;  1XMO L;  4P2C B;  5ISR A;  3VYT A;  3S17 H;  3HOV G;  3I73 A;  4YHH L;  4DUZ Q;  1YNJ D;  1TXY A;  3GTO B;  4G7O C;  3H0G G;  3FEW X;  3E0E A;  1ZKO A;  3T1H L;  1TY0 A;  1IBL Q;  3A8K E;  2ZJQ A;  4R8N A;  2HDL A;  1G6Z A;  4RA8 A;  1NMG A;  1TS5 A;  2AUJ D;  2MHV A;  5IWA Q;  2WFW A;  1Y1W B;  2QKI C;  1B70 B;  1HNX L;  2DY8 A;  4M8A A;  1LAB A;  5AJ3 L;  4KTA A;  2F0O A;  3OPO A;  3CCQ A;  4GNX B;  2JA8 H;  1CKN B;  1QE6 A;  4ID6 A;  4JI6 Q;  2RCN A;  2E8G A;  1B44 D;  1XMQ L;  5J39 A;  3NPP A;  5IGD A;  4A3F H;  2BOS A;  2NZH A;  4MZ9 A;  2LS0 1;  1L1O C;  2MUY A;  5I2Y A;  1N32 Q;  4QIW E;  2DNE A;  1IYJ B;  1Q8K A;  2UXC L;  1EEF D;  5T1I A;  4OWX B;  4DR7 Q;  3X3N A;  5EPJ A;  5FJ8 H;  1X3F A;  4FNF A;  1N36 L;  3QOL A;  5D65 A;  3FKI H;  3L7Z C;  3ULJ A;  4BY1 B;  5IYB G;  4APV A;  1NMF A;  1AZP A;  4HCS A;  1VQL A;  1EYD A;  1LT3 D;  4IUP A;  1U4R A;  1AE2 A;  4GKK L;  3GD7 A;  5C44 G;  3KBG A;  1J5E Q;  4JW0 A;  4J8Q A;  1QWY A;  5EKK A;  4OEL B;  2JQO A;  2KEE A;  2E76 C;  4NB3 A;  4TKO B;  5E4X A;  2XTI A;  1BQQ T;  1JCK B;  1STY A;  4H13 C;  4OEM B;  2HHH Q;  4Y52 H;  1MBY A;  3A56 A;  3NUC A;  4C3H B;  1EOT A;  2XRQ D;  4Z9C B;  5KND A;  4LFC Q;  1JJG A;  4IPG A;  2HIX A;  3F2D A;  1Q8I A;  5COY A;  2OQ0 A;  5C4X H;  4ZKC B;  1B4O A;  3I4O A;  3M7N A;  5JEA J;  5FK9 C;  1RD9 D;  1HNW Q;  1KD1 C;  1HQM C;  2N3S A;  3K58 A;  4QJF A;  1GUS A;  4KD4 A;  5TSS A;  3CCL A;  1H9M A;  5KIX A;  5FLX L;  5C0X H;  1CZW A;  3E5S A;  2C5C A;  4F8M A;  4KMU C;  3J7A F;  1D8L A;  5EPL A;  2JA7 H;  4B9W A;  4X3S A;  3CXC A;  1AH9 A;  3DWQ A;  3IFT A;  4DR4 L;  1B8A A;  3S16 B;  5M3M G;  3RN5 A;  4QMG A;  2NVQ H;  2MO0 A;  4ZK9 B;  2RHS B;  4A3J H;  1DOM A;  3K5O A;  2KCM A;  1KNA A;  3PV0 A;  4R4O A;  4ZUI A;  4JBW A;  1S5D D;  5EAY A;  2NVT B;  4KHZ A;  4ZQ3 A;  2OEO A;  5IY0 A;  1HFN A;  1Z6H A;  1X6O A;  1STE A;  1PV4 A;  3S14 H;  5FO7 B;  1Q7Y C;  5C3X A;  3KJO A;  1V9P A;  4UP9 A;  4KI0 A;  3D8G A;  1PH6 A;  4QF4 A;  1F9P A;  3HOY H;  4BBS H;  5IP7 G;  4PQX A;  4A75 A;  2PMZ B;  4JI5 Q;  1Z9F A;  2L4N A;  1MKH A;  1SNO A;  3AQQ A;  3HRZ C;  3K6O A;  1VF5 C;  2E2J H;  1KLG D;  4HSP A;  4DV5 Q;  1TVX A;  1II3 A;  4A3B G;  1GXD C;  3DLL A;  3F2C A;  3R93 A;  4IOC A;  4JI1 Q;  4B9X A;  2IJ0 A;  2CH4 W;  4ALP A;  4JYA Q;  1FR3 A;  1Y8N B;  1D1I A;  3I3C A;  1JR0 D;  1ZYR D;  4JCV E;  1FJG Q;  2DJF C;  5LL6 S;  2IHE A;  2F52 A;  2HCI A;  5KGU A;  1TY2 A;  5H1S E;  2FFK B;  3ZJY C;  3EA6 A;  1HFG A;  3K0Y A;  1VQN A;  5JJK A;  3PUY A;  1QCB D;  4DR1 Q;  3HOW H;  2UXB Q;  1HUN A;  1JWS D;  1I4Q A;  1JOQ A;  3EBE A;  1KDC A;  3PF5 A;  3HOZ H;  4O0A A;  2QDB A;  1YHB A;  1F9R A;  2R3Z A;  3GV6 A;  2CWA A;  4CJ1 B;  2EIF A;  2DGY A;  4IN3 A;  3ND9 A;  4L8J A;  2J0T D;  5CYU A;  3GTK H;  5CR3 A;  2V4D A;  4GNX C;  4AQY Q;  3PF4 A;  3OMG A;  4OIJ A;  2IY5 B;  4B3M Q;  3CQZ B;  4A3D G;  1YNN C;  5LHY 1;  2R93 G;  3M4P A;  4PZ7 A;  5GAE C;  2IX1 A;  2XWB B;  2B2V C;  4CGY B;  5ELB A;  4DV7 Q;  1HR0 W;  4QY7 A;  2BH8 A;  5BR8 L;  4X62 Q;  1XYI A;  1UAP A;  1PDQ A;  3OHX C;  3W5O A;  4OWW B;  1EQV A;  2JA5 B;  1HNZ Q;  1JOO A;  4NXM Q;  5K36 G;  4IFD I;  4DAP A;  3NQI A;  5M3F B;  2F4V L;  4RWS C;  2L5T A;  3HOU G;  3PUZ A;  4L5Q A;  4HIM A;  3ERO A;  1SJE D;  3DM3 A;  4BY7 H;  2H4O A;  2VQE L;  3FRP B;  1EIH A;  3GTP B;  1JIC A;  3LWU A;  3W3A A;  1PH5 A;  2SOB A;  1E24 A;  4DFA A;  4X64 Q;  2PZW A;  1YIJ A;  1XPR A;  1OXS C;  4EX5 A;  1VCI A;  1MHW C;  4X66 Q;  4JI2 L;  3SXH A;  3STB D;  1AFP A;  1BCP D;  1QUQ A;  2E2D C;  2F0P A;  1DJR D;  4UAI A;  3TP8 A;  2ZXO A;  1D5Z C;  4IO9 A;  1KIX A;  1K8M A;  4ABN A;  1PH2 A;  4XQN A;  2R92 B;  2PYK A;  1FVI A;  2B8F A;  3UDG A;  4KHP L;  3J81 E;  5JVG 3;  2YU9 H;  3RZO H;  2KUM A;  1MSH A;  5IOD A;  1DM0 B;  3M9B A;  4IPH A;  4KV6 A;  1X3E A;  1SNQ A;  1VQ6 A;  3M4Q A;  3V96 A;  4ZUJ A;  3QIA A;  2VUM H;  2B39 A;  5EPK A;  4C2M B;  2JA8 G;  1E22 A;  1X3P A;  1VMP A;  1JE5 A;  4RGT A;  3TRE A;  2HUG A;  4JI4 L;  2AQ3 B;  3BDL A;  4A4I A;  3CPF A;  4A3F G;  3AFP A;  4X65 L;  1FD7 D;  3EIV A;  2K28 A;  4ULL A;  3S2D B;  4JI8 Q;  1TII D;  2XRS D;  1CT1 D;  3CME A;  5HGQ A;  3WDN A;  4P74 A;  1KDB A;  4H02 A;  1HA5 A;  5JPM C;  1KLU D;  1SFO H;  1VDZ A;  3G48 A;  3P1H A;  1VQJ A;  4LF6 L;  1MJC A;  2K5D A;  4PMW A;  1F2M A;  1PTO D;  1B9M A;  3IL8 A;  3GP7 A;  4IUN A;  4MTN A;  1HTL D;  4DK1 A;  3CC7 A;  1QUQ B;  3BDC A;  1HZA A;  2E75 C;  4MIU A;  1EIG A;  4B3T L;  4NP5 A;  4GN5 A;  4DXG A;  4BY1 H;  2PMZ E;  4BBR H;  2WAQ G;  4K5X A;  4UHV A;  2EY1 A;  2PQA A;  5JJZ A;  1IBK L;  4FDB A;  1RDP D;  1C4Q A;  3HZX A;  3J7Y W;  2EY6 A;  4DR5 Q;  1CHP D;  3KF8 A;  5FLX c;  4ILW A;  1KXL A;  3K0X A;  3H15 A;  5HGT A;  3K7A B;  5EBD A;  5C4X G;  1CA6 A;  4V19 0;  2OQK A;  2EVB A;  4DNT B;  4K2L A;  3PO2 B;  1QOH A;  4C3H H;  4YY3 L;  2A68 C;  4PV1 C;  2A6H D;  1PRT C;  2GVA A;  3PUW A;  1SYF A;  1M1K C;  4DR6 Q;  4C56 C;  3H09 A;  1Y1V B;  4P75 A;  1TWC B;  2F0E A;  3KJP A;  1K9M C;  3PIP A;  2JA7 G;  5GRO A;  3CCR A;  2BDO A;  3AFQ A;  4G4K A;  1NY4 A;  4JBK A;  2GN5 A;  1L1O A;  3KBX A;  1SNC A;  2FJ2 A;  2UUA L;  3S1M H;  4OXP A;  4K5V A;  1PYB A;  1SXT A;  4LUZ A;  2B63 B;  3GTG H;  3MVV A;  2EYF A;  3D6W A;  4XQJ A;  2HT1 A;  2JP1 A;  4J15 A;  4FF3 A;  1XXG A;  2R7D A;  3CD6 A;  3V05 A;  2IWH A;  4DV3 Q;  2F3W A;  3OYY A;  4GOP C;  1S72 A;  4CJ2 C;  5JPN C;  4I7A A;  2PQA B;  3AU7 A;  1EFI D;  3ONA B;  3JAM E;  2NZO A;  1SYG A;  3KF8 B;  4OWT B;  3GQB A;  1DXM A;  1ENC A;  1BVS A;  3UE0 A;  1T5X D;  1IYV A;  3FPP A;  3S9W A;  1QZG A;  1SLJ A;  2F0I A;  3OSO A;  1HR0 Q;  5T1G A;  4CDD C;  4BA1 I;  3URY A;  4J1M A;  3M4O B;  2L55 A;  3KLR A;  1YHQ A;  3K57 A;  4OGQ C;  1DYQ A;  1ET9 A;  2ZXP A;  3HOZ G;  2HD3 A;  5ELN A;  5C0X I;  1U4M A;  2F0H A;  4KN7 C;  3T1Y Q;  5C3E B;  2F0N A;  3AMU A;  3RZD H;  1I50 B;  1O7Y A;  4B08 A;  2E2H H;  1EU4 A;  1L1O B;  4EVO A;  3GTJ H;  2KA7 A;  3MXG A;  4MHE A;  5NUC A;  2EYJ A;  3T4A C;  5DLQ E;  1OXX K;  4HIO A;  2R6G A;  3EJI A;  2LXK A;  1VQ7 A;  2EYO A;  1JB7 A;  3MZ5 A;  5CV9 A;  1E1T A;  2Z4I A;  4XYO A;  3A54 A;  2LFN A;  1V1Q A;  2A19 A;  4P73 A;  3QJY A;  4DR3 Q;  1PA6 A;  2EDG A;  2QGQ A;  1EYG A;  5C3W A;  1RHP A;  1B2T A;  1UUP A;  2PO4 A;  2N55 A;  2QCP X;  1SE4 A;  1PH1 A;  1TWG B;  4BY7 G;  1LTA D;  1VMC A;  1J9O A;  2CHB D;  3M85 A;  5IT9 E;  1KRS A;  3CRK C;  4FXK C;  2YV5 A;  1N9W A;  2CCZ A;  1WFQ A;  5IT9 c;  4K5W A;  1XNQ L;  4C3J B;  4ZAI A;  3S1N H;  1N34 L;  1EUJ A;  4DV6 L;  3TQY A;  1Y14 B;  1QVG A;  3Q23 A;  4GN3 B;  4J6H A;  2AMC B;  3HKZ G;  2CW0 C;  5GAD C;  3HOX B;  2Q2I A;  1PTO H;  3GTP H;  3G7L A;  3BZK A;  3NBI A;  4DAV A;  5CC4 A;  2NVY B;  2VW9 A;  3SK6 A;  2F0W A;  1JC7 A;  1RTO A;  1WJJ A;  4LK1 C;  1EWI A;  3TZU A;  1STB A;  4IUT A;  3ULP A;  2NB0 A;  3WOF A;  3CCJ A;  5E1F A;  4WJ4 A;  4ZLT F;  1NNX A;  1ZXT A;  4A93 B;  2JXM B;  3NQT A;  2CQA A;  3PMF A;  4YWM A;  1B7Y B;  3CAM A;  3NE5 B;  3TS2 A;  1WCM H;  4DV4 L;  3DEP A;  1EOV A;  2RF4 A;  2OF1 A;  1W2B A;  3IAY A;  2RDG A;  1FNU A;  4A3G B;  2ENB A;  4GNX A;  4F7X A;  4P72 A;  4X6A H;  3M4Y A;  1LV9 A;  4DR2 L;  4UPA A;  2VUM G;  1GOZ A;  3J80 E;  4Y7N B;  2B2V A;  4TRD A;  5CMD A;  3K7U C;  1SAP A;  3Q0A A;  5FLM H;  1TKW B;  2AHO B;  3QR8 A;  1EY7 A;  3S2H H;  2VQF Q;  1TR5 A;  4A3M H;  5M5X B;  2K5H A;  1U9R A;  4L6T B;  4DK3 C;  3G4S A;  3E6Z X;  4FF2 A;  2A1A A;  3NEL A;  1SE8 A;  1SEB D;  2A6E C;  2ZTE A;  4EQ5 A;  2DNC A;  2N8N A;  3ZYY X;  4B3R L;  3MA2 B;  4QB4 A;  2Q2T A;  4A3K H;  2WII B;  3TME A;  1EY8 A;  3CP0 A;  3S2D H;  2JA9 A;  1D5X C;  2Y0S B;  1PH8 A;  4RCO A;  1A3U A;  4IJH A;  2ZM6 L;  1XNR Q;  3RUZ A;  2KCN A;  1I5F A;  1HJP A;  3KLW A;  3AEV A;  3A8J E;  2ZTD A;  3B6Y A;  1EQR A;  4CBV A;  3I55 A;  3F2U A;  3I4N B;  4GZY C;  2A5H A;  1KDA A;  4LF7 Q;  4HJ9 A;  3PIP 3;  4A76 A;  4BBR G;  3I4L A;  2VXW A;  2R7Z B;  3WOE A;  4NXN L;  4WRD A;  1XWE A;  5ELO A;  4LF8 L;  1E0B A;  1VQM A;  1TS2 A;  1I4R A;  3L2P A;  4LF5 L;  1GUT A;  5I9P A;  2KBN A;  4S3S A;  4DF7 A;  1F2L A;  1EY6 A;  1ICF B;  1X65 A;  1GUO A;  3K5L A;  1K3R A;  1WOC A;  1HHV A;  4DV0 Q;  3S1R H;  4A3I H;  1IW7 C;  2RSO A;  1XTC D;  1WD0 A;  4EQO A;  3J7A 5;  3KFU A;  1TT2 A;  1HRJ A;  1M90 C;  4LUV A;  4YWL A;  4HID A;  1X9N A;  3I4M G;  1LYL A;  4UP8 A;  3MTS A;  2PPB C;  3J81 L;  1YVC A;  3H3V C;  2E5L Q;  1LUZ A;  4GKJ L;  2H1E A;  4K14 A;  1WTR A;  1EEI D;  4DV2 Q;  1EL0 A;  2KHS A;  5LMU L;  2Z6K C;  1GM5 A;  3GTQ H;  4AYB B;  2KEC A;  1AP0 A;  4G7Z C;  1YNX A;  2NZ1 D;  4HR7 B;  3TSS A;  2VB3 X;  2HIV A;  2K01 A;  2EOT A;  3NK9 A;  2UXD L;  1GVP A;  1Q12 A;  1WD1 A;  2CWP A;  1BOS A;  5LMN L;  1RKN A;  1VQ8 A;  2AUK A;  1LTL A;  2SDF A;  4A3L H; 
#chains in the Genus database with same CATH homology
 3HOV B;  1WTV A;  2RBM A;  1G91 A;  2SEB D;  1HUM A;  3A55 A;  3H0G B;  2NVX B;  1DOL A;  4C1N I;  2F0K A;  3BVG A;  1STH A;  1EY4 A;  2O2L D;  2QIL A;  2WIN B;  4FP5 D;  3SK8 A;  3GTM B;  5C4Z A;  1STG A;  3N6R A;  5CGK A;  4KJN A;  2DN8 A;  1VF7 A;  4FVM A;  1AEX A;  3TDQ A;  5BN3 A;  3ERQ A;  2HDM A;  2KED A;  3RLF A;  3D31 A;  2X6L A;  1YNJ C;  4L63 B;  3D4D A;  2K1B A;  1I4X A;  1U4L A;  1Q1E A;  2L0C A;  4FO2 A;  3PUX A;  4V0B A;  3TP5 A;  1KAA A;  1LLR D;  2G9D A;  5JAV A;  3A7L A;  1S5E D;  1IHZ A;  1SJH D;  2O5I C;  5C44 B;  4HSV A;  2PCF B;  1R9T B;  5J1Z A;  4IFD G;  2MP1 A;  3FPU B;  1F77 A;  4NKL A;  1KTK A;  1IL8 A;  4MN3 A;  5KYL A;  4WFN 3;  1WTO A;  2JEA I;  3L9A X;  2WKD A;  3OIQ A;  1OXU A;  3FDT A;  1NCV A;  1PZK D;  1GJX A;  1B53 A;  4H0L C;  3S1Q B;  3OIP A;  2PW5 A;  1EZ8 A;  4EGV A;  1H9J A;  4JK1 C;  1ESR A;  4X3U A;  1DD2 A;  5KRU A;  3MFG A;  4R8I A;  1H9S A;  1MI2 A;  3VR5 A;  1STA A;  3JAM L;  3GV3 A;  5C4J B;  1L0X B;  1ILP A;  3EVQ A;  3FMC A;  3SVM A;  5M3M B;  4KY7 A;  2NYZ D;  1PZJ D;  1TWA B;  1PRT B;  1A3V A;  3VYS A;  4EQP A;  5M5W B;  4EQN A;  5ELF A;  1LTG D;  2IW3 A;  1D6E C;  3QG1 A;  1ML0 D;  5E4W C;  4QCL A;  1NSN S;  2K5Q A;  1IKM A;  3SK4 A;  2TMP A;  3RD4 A;  5CBA E;  2PQE A;  3NTK A;  4X3T A;  2X6G A;  2SNS A;  3LX0 A;  3S15 B;  4A3B B;  3I90 A;  5LL6 X;  3CKI B;  1Z47 A;  2A74 C;  3VR2 A;  4RKL A;  1I4P A;  1I3Q B;  1R4Q B;  3SHL A;  4XXE A;  3SE0 A;  2MPM A;  4HAE A;  3VA5 A;  1FYC A;  2LMC B;  1OXT A;  3MAQ A;  3HGB A;  1UEA B;  2HQE A;  1H9S B;  2EYH A;  5I2X A;  4WJW A;  1D5M C;  1S5F D;  3OOC A;  2ICI A;  2NN6 I;  5IT9 L;  4LAA A;  4IZ8 A;  4OO1 H;  2E74 C;  1A3T A;  1EWC A;  2L11 A;  1ZYR C;  2RA4 A;  1TQO A;  4A3D B;  3I91 A;  2R93 B;  1CQV A;  3H6M A;  2ICE C;  1CK1 A;  1K83 B;  2GA4 B;  4NW2 A;  3SK5 A;  5CV4 A;  3GO5 A;  1PZI D;  4LMQ D;  1JE4 A;  4BWG B;  4E6I A;  3M3Y B;  1CI3 M;  3HOU B;  2BE5 D;  2NTS A;  2MJ8 A;  4RAU C;  1Y8P B;  2D62 A;  1JQY D;  2EY5 A;  3QOJ A;  3TZD A;  3J80 L;  1AW7 A;  2B2W C;  3TBI B;  3P75 A;  1SMY D;  1MSG A;  3NHH A;  2B8G A;  5D3D A;  2WKC A;  3S17 B;  4ZKB B;  4Q0F A;  4KHV A;  3CHB D;  1A15 A;  3K5M A;  1K8O A;  1SYE A;  2HCC A;  3C3L A;  2FHT A;  4K6L A;  1B3A A;  4U67 3;  3BG3 A;  2KOL A;  2PZT A;  1BCP C;  2JA8 B;  1ILQ A;  3BDO A;  1BUV T;  4A3F B;  5C0X G;  4KKS A;  2LKV A;  3TP6 A;  4TQU S;  3QB3 A;  2F0M A;  2IX3 A;  2M00 A;  2PZU A;  2VB2 X;  1PFB A;  3PUV A;  5F2D A;  1SBB B;  4KKT A;  2RVL A;  3NXW A;  2A69 D;  4ME5 A;  1OXV A;  2K03 A;  3LWE A;  4IFD J;  3MHB A;  1A2U A;  2AWO A;  1JWM D;  5JVH 3;  2WAQ B;  1G29 1;  4UDU C;  1QNK A;  5BN4 A;  3BZD B;  2B2T C;  1I6H B;  5C4X B;  1EWH A;  2C9O A;  4KD3 A;  1CZG A;  2DY7 A;  1PTO C;  5IGE A;  1TU2 B;  5IGG A;  4IUR A;  3VYU A;  1KNE A;  4C3I G;  3BS1 A;  3LNN A;  1PFN A;  1CFM A;  2EJF C;  2JA7 B;  1O7L A;  1W6J A;  4RCN A;  4FXD A;  2TSS A;  2ZT9 C;  2VNU D;  3KLS X;  1R4P B;  3DUZ A;  3AB9 A;  5IGC A;  2A6H C;  1JOR A;  4R9W A;  3MXP A;  3S14 B;  3OMC A;  5CBE E;  5K5P A;  2O5J C;  4KKU A;  1F2Y A;  2D5D A;  1SSO A;  2BA1 A;  1SE3 A;  1JB3 A;  2NWG A;  1ENF A;  2O4X A;  1EU3 A;  1LT5 D;  3HP3 A;  4K8J A;  2Q8T A;  1ENA A;  1Y69 U;  2KQ3 A;  2JSO A;  1BCP F;  1BDO A;  2R61 A;  3CU7 A;  1W6K A;  4DNR B;  5ELC A;  5I6Y A;  5C4H A;  3VR4 A;  2NN6 H;  3NWT A;  4F87 A;  1T5E A;  1EY5 A;  3HOZ B;  3A8I E;  5C5L A;  1B9N A;  4K8I A;  1DZ1 A;  5DM6 3;  1GUW A;  1EYC A;  1S4Z A;  3VYR A;  3FVQ A;  2B2Y C;  3GTK B;  3I70 A;  5IGB A;  4G57 A;  2EJM A;  2RQX A;  2F03 A;  2IX0 A;  3DWP A;  2F0S A;  2XVS A;  2PNR C;  3O13 A;  3RMH A;  1BBX C;  4KK7 A;  5D3I B;  1NR4 A;  2CVR A;  5EKI A;  3H94 A;  3KK7 A;  1SND A;  1UNS A;  3Q24 A;  1NR2 A;  4BY7 B;  1PTO F;  2K5W A;  5BN5 A;  5K36 H;  3VR3 A;  2F0L A;  1X32 A;  1JOK A;  1F2Z A;  1LAC A;  1A2T A;  3U9S A;  1AN8 A;  4FXG C;  1LT6 D;  3HKZ B;  2EYL A;  1LO5 D;  5D14 A;  3L3O C;  1B50 A;  5DEH A;  3E0J A;  4KY5 A;  4KJO A;  1V1P B;  1SE2 A;  4DA2 A;  4IQZ A;  4H44 C;  4OO1 I;  3K59 A;  2YU9 B;  2XN9 C;  5JOB A;  3RZO B;  1HA6 A;  1E2V A;  1O7Z A;  4DAY A;  4C3H G;  1E2W A;  4RHS A;  2VUM B;  3D4R A;  2B2U C;  2K6A A;  5C0X J;  4QUC A;  1X3Q A;  3C1F A;  4TSS A;  1ICW A;  1IYU A;  1SFO B;  3NSW A;  5EKL A;  1L0Y B;  4RHR A;  2F1M A;  4HCE A;  5IGF A;  1EY0 A;  4YIJ A;  3M7G A;  5DM7 3;  3D3R A;  1FNV A;  1QNU A;  1GUN A;  5FO8 B;  2B2W A;  1LTR D;  4BBR B;  3OWE B;  3I72 A;  1BNZ A;  4I65 A;  5I4D A;  2EE1 A;  2AQ1 B;  2JE6 I;  1B1Z A;  2QEJ C;  2D2C C;  2SNM A;  2BA0 A;  3NP8 A;  4DN4 M;  2F0D A;  4XDX A;  1GHK A;  2F0G A;  3I4M B;  4FF1 A;  1WVL A;  1HCZ A;  1NAP A;  2A73 B;  4O1N A;  1I6V C;  3D4W A;  1C8C A;  1D1K A;  1YNN D;  1KAB A;  1HTP A;  4RGO S;  5C5M A;  2F0T A;  5CV5 A;  4RH6 A;  1LTI D;  4HTH A;  4IUQ A;  4IAL A;  4OIK A;  2L9H A;  3S1M B;  5FO9 B;  4Q5V A;  3GTG B;  3VA7 A;  1HPC A;  3VR6 A;  2NTT A;  3Q22 A;  1LTS D;  2K7V A;  2L12 A;  3BVM A;  1QIL A;  1I4G A;  4CJ0 B;  3MEH A;  3OWF A;  1Y8O B;  4HED A;  3EQL C;  3R2I A;  5CV8 A;  1RJT A;  1E2Z A;  2NBF A;  2F0U A;  1WTQ A;  2K33 A;  3K5N A;  2F3V A;  4RGM A;  2RDF A;  1HQR D;  3IKJ A;  1TS4 A;  1DCZ A;  2RDH A;  2XIW A;  4OL7 A;  3TN2 A;  4DGZ A;  2EXZ A;  3NTI A;  3T16 A;  3TP7 A;  1U4P A;  2AWN A;  4FF4 A;  2B2T A;  3C1E A;  1TWF B;  2NN6 G;  5JEA H;  3Q6S A;  1PFM A;  2IPK D;  1BCP B;  1MGS A;  4QUF A;  5A2Q E;  1NUC A;  3BVZ A;  1BR9 A;  3T56 B;  3RZD B;  2IT1 A;  4N9P A;  2E2H B;  1S5B D;  1MD2 D;  1SYB A;  5DNF A;  3GTJ B;  4DXF A;  2E2I B;  2IL8 A;  1ROD A;  3V2T A;  2FMC A;  2MGS A;  3BYY B;  2F0J A;  4BS9 A;  4XT1 B;  3KLS A;  5EJW A;  4ODG A;  1LT4 D;  4CKB A;  4O42 A;  5KNB A;  3A7A B;  5G3L D;  3ITP A;  3N52 A;  1O78 A;  5E3F A;  2WB1 B;  3HS0 C;  1FGB D;  3DXJ C;  1Q3L A;  2M9V A;  5IOC A;  1AZQ A;  1BO0 A;  4WOR A;  4PMC A;  2D9U A;  3S1N B;  2RKS A;  2EYM A;  1PMR A;  1TWH B;  1BXT A;  1F9S A;  1PTO B;  1FNW A;  2I46 A;  5EGT A;  3OW7 A;  2L1B A;  2OXP A;  1PLF A;  1SNM A;  2I07 B;  1ESF A;  1LTT D;  2EZV A;  2A68 D;  1JWU D;  1PRT D;  5FKA C;  1WCM B;  2Z8L A;  5DAU A;  2JYO A;  3MC0 B;  2B2Y A;  1G2T A;  1CA5 A;  4U68 A;  3T51 B;  1STN A;  2F4I A;  4H7B A;  1IKL A;  3NWS A;  3S2H B;  2N88 A;  3X3M A;  4A3M B;  1V1O A;  4BA2 I;  2OT2 A;  2BCO A;  3IFD A;  1Q1B A;  2K05 A;  4IUV A;  5A35 A;  4M1U B;  4CHT B;  4N9T A;  3DMU A;  3EFX D;  4A3K B;  1RTN A;  4KY6 A;  4CKE A;  5COR A;  5I6W A;  4CKC A;  5CV6 A;  1SYC A;  2Q8R E;  2XSC A;  1CM9 A;  1GHJ A;  3HEJ A;  2EYP A;  3QWN A;  3D6C A;  1G2S A;  3QO2 A;  3SEB A;  4RFB A;  1ONL A;  1HXY D;  5CV7 A;  2KCC A;  4ZYS A;  2Z4H A;  4NDX A;  2NUC A;  3S1R B;  4A3I B;  1F9Q A;  5FLX E;  2WP8 J;  5M9O A;  2AQ2 B;  3DM1 A;  3P7J A;  1PYW D;  4XIG S;  2WV6 D;  2F0F A;  5KYI A;  2LY7 A;  2J7Z A;  3CRL C;  3T13 A;  5ELD A;  3UI2 A;  1SNP A;  3SDZ A;  1PXU A;  2B2U A;  2FMM A;  4RGN A;  3GTQ B;  3FKI B;  1M8A A;  3W2D A;  4K2K A;  5EQ0 A;  2J4X A;  1V8Q A;  4XQQ A;  3H91 A;  2BDN A;  3KUP A;  2BE5 C;  3R2T A;  2XNA C;  3U9O A;  1S5C D;  1EQT A;  2G9H D;  1Z7T A;  1Q90 A;  2XWJ B;  1CQF A;  2FIN B;  3DHQ A;  3MXU A;  1CHQ D;  2PW7 A;  1ET6 A;  5J22 A;  1SMY C;  3C2P A;  2CW0 D;  2K32 A;  1TS3 A;  1QB5 D;  3PO3 B;  4LJZ C;  1QJO A;  3GTL B;  4KN4 C;  3NBH A;  1A6X A;  2RSN A;  5JEA G;  4DU9 A;  1BF4 A;  3C46 A;  2NVQ B;  1ZEQ X;  3MXN A;  4K6D A;  4C3J G;  4A3J B;  2QF7 A;  4IUU A;  2ID0 A;  3DEO A;  4QIW B;  2F0V A;  5KNC A;  1RF2 D;  1O80 A;  5C6A A;  2EPB A;  1CTM A;  4BBS B;  1LTB D;  3HOY B;  5G3L F;  5EBC A;  2E2J B;  5ELE A;  1I4H A;  2F0Q A;  2A6E D;  4C1N K;  1V43 A;  2EJG C;  3BYT B;  4OHJ A;  2X69 A;  1WTW A;  4IFD H;  1SYD A;  2A69 C;  4PMB A;  1H9K A;  1DON A;  3MWY W;  2KVM A;  1XX8 A;  4PNY A;  3PIO 3;  4C3I B;  4A3E B;  3HOW B;  3SR1 A;  4FYD A;  5FOB B;  1M4V A;  2KJX A;  4I7Z C;  1C48 A;  1V1P A;  3T53 B;  2M2L A;  4OO1 G;  1PRT F;  3DWA A;  2Z1C A;  1WTP A;  1IW7 D;  1DOK A;  4NMZ A;  1RCV D;  3HG9 A;  4HMJ A;  3ND8 A;  1QG7 A;  2K04 A;  4RKB A;  5IIF A;  1EYA A;  4G7H C;  1WTX A;  5A2Q L;  2WAC A;  4XYQ A;  5KEE A;  3NTH A;  4XT3 B;  1D2B A;  3G6J B;  1J8I A;  1GUG A;  3I8Z A;  3J7A V;  2JEB I;  1OO9 B;  2ZXR A;  3MFY A;  5HUR A;  4HMI A;  5M5Y B;  4ZRZ A;  3R8B A;  4HN7 A;  4X3K A;  2EY2 A;  3R3O A;  1G8Z D;  4DK0 A;  5I9O A;  2YYZ A;  4F88 A;  5AFW A;  4XTC S;  1EY9 A;  2JA6 B;  2Q8I B;  1EZ6 A;  3P20 A;  1H9R A;  1SDF A;  4P2C B;  5ISR A;  3VYT A;  3I73 A;  1YNJ D;  3GTO B;  4G7O C;  3FEW X;  1ZKO A;  1TY0 A;  3A8K E;  4R8N A;  2HDL A;  1G6Z A;  4RA8 A;  1TS5 A;  2AUJ D;  2MHV A;  1Y1W B;  2QKI C;  2DY8 A;  4M8A A;  1LAB A;  4KTA A;  2F0O A;  3OPO A;  1QE6 A;  4ID6 A;  1B44 D;  5J39 A;  3NPP A;  5IGD A;  2BOS A;  2LS0 1;  2MUY A;  5I2Y A;  2DNE A;  1EEF D;  5T1I A;  3X3N A;  5EPJ A;  4FNF A;  3QOL A;  5D65 A;  3L7Z C;  4BY1 B;  1AZP A;  4HCS A;  1EYD A;  1LT3 D;  4IUP A;  1U4R A;  3GD7 A;  3KBG A;  4J8Q A;  1QWY A;  5EKK A;  2KEE A;  2E76 C;  4TKO B;  5E4X A;  1BQQ T;  1JCK B;  1STY A;  4H13 C;  1MBY A;  3A56 A;  3NUC A;  4C3H B;  1EOT A;  2XRQ D;  4Z9C B;  5KND A;  1Q8I A;  5COY A;  4ZKC B;  1B4O A;  3M7N A;  5JEA J;  5FK9 C;  1RD9 D;  1HQM C;  3K58 A;  1GUS A;  4KD4 A;  5TSS A;  1H9M A;  5KIX A;  5FLX L;  5C0X H;  1CZW A;  3E5S A;  2C5C A;  4F8M A;  4KMU C;  3J7A F;  5EPL A;  4B9W A;  4X3S A;  3DWQ A;  3IFT A;  3S16 B;  4QMG A;  4ZK9 B;  1DOM A;  3K5O A;  1KNA A;  3PV0 A;  4ZUI A;  4JBW A;  1S5D D;  2NVT B;  4KHZ A;  4ZQ3 A;  2OEO A;  1HFN A;  1Z6H A;  1STE A;  5FO7 B;  5C3X A;  4KI0 A;  3D8G A;  4QF4 A;  1F9P A;  4PQX A;  2PMZ B;  2L4N A;  1SNO A;  3HRZ C;  3K6O A;  1VF5 C;  1KLG D;  4HSP A;  1TVX A;  1II3 A;  1GXD C;  3R93 A;  4B9X A;  2IJ0 A;  1FR3 A;  1Y8N B;  1D1I A;  3I3C A;  1JR0 D;  1ZYR D;  5LL6 S;  2HCI A;  5KGU A;  1TY2 A;  2FFK B;  3EA6 A;  1HFG A;  3K0Y A;  3PUY A;  1QCB D;  1HUN A;  1JWS D;  1I4Q A;  1JOQ A;  1KDC A;  2QDB A;  1F9R A;  2R3Z A;  3GV6 A;  4CJ1 B;  4IN3 A;  3ND9 A;  4L8J A;  2J0T D;  5CYU A;  5CR3 A;  2V4D A;  3OMG A;  4OIJ A;  3CQZ B;  1YNN C;  5LHY 1;  2IX1 A;  2XWB B;  2B2V C;  4CGY B;  5ELB A;  1XYI A;  1UAP A;  1PDQ A;  3OHX C;  1EQV A;  2JA5 B;  1JOO A;  5K36 G;  4IFD I;  4DAP A;  3NQI A;  5M3F B;  4RWS C;  2L5T A;  3PUZ A;  3ERO A;  1SJE D;  2H4O A;  3FRP B;  1EIH A;  3GTP B;  1JIC A;  3LWU A;  3W3A A;  2SOB A;  4DFA A;  2PZW A;  1OXS C;  1VCI A;  3SXH A;  1AFP A;  1BCP D;  2E2D C;  2F0P A;  1DJR D;  4UAI A;  3TP8 A;  2ZXO A;  1D5Z C;  1K8M A;  4ABN A;  4XQN A;  2R92 B;  2PYK A;  2B8F A;  3J81 E;  5JVG 3;  2KUM A;  1MSH A;  5IOD A;  1DM0 B;  4KV6 A;  1SNQ A;  3V96 A;  4ZUJ A;  3QIA A;  2B39 A;  5EPK A;  4C2M B;  1X3P A;  1VMP A;  4RGT A;  2HUG A;  2AQ3 B;  3BDL A;  1FD7 D;  2K28 A;  4ULL A;  3S2D B;  1TII D;  2XRS D;  1CT1 D;  3WDN A;  1KDB A;  1HA5 A;  5JPM C;  1KLU D;  1VDZ A;  3P1H A;  2K5D A;  4PMW A;  1F2M A;  1PTO D;  1B9M A;  3IL8 A;  3GP7 A;  4IUN A;  1HTL D;  4DK1 A;  3BDC A;  2E75 C;  4MIU A;  1EIG A;  4NP5 A;  4DXG A;  4K5X A;  2EY1 A;  5JJZ A;  1RDP D;  1C4Q A;  3HZX A;  3J7Y W;  2EY6 A;  1CHP D;  3KF8 A;  4ILW A;  5HGT A;  3K7A B;  5EBD A;  1CA6 A;  4V19 0;  2EVB A;  4DNT B;  4K2L A;  3PO2 B;  1QOH A;  2A68 C;  4PV1 C;  2A6H D;  1PRT C;  3PUW A;  1SYF A;  4C56 C;  3H09 A;  1Y1V B;  1TWC B;  2F0E A;  2BDO A;  4G4K A;  3KBX A;  1SNC A;  2FJ2 A;  4K5V A;  1SXT A;  2B63 B;  3MVV A;  2EYF A;  3D6W A;  4XQJ A;  2JP1 A;  4FF3 A;  1XXG A;  3V05 A;  2IWH A;  2F3W A;  4CJ2 C;  5JPN C;  3AU7 A;  1EFI D;  3ONA B;  3JAM E;  1SYG A;  3GQB A;  1DXM A;  1ENC A;  1T5X D;  1IYV A;  3FPP A;  3S9W A;  2F0I A;  3OSO A;  5T1G A;  4BA1 I;  3URY A;  4J1M A;  3M4O B;  2L55 A;  3KLR A;  3K57 A;  4OGQ C;  1DYQ A;  1ET9 A;  2ZXP A;  5C0X I;  1U4M A;  2F0H A;  4KN7 C;  5C3E B;  2F0N A;  3AMU A;  1I50 B;  1O7Y A;  4B08 A;  1EU4 A;  4EVO A;  2KA7 A;  3MXG A;  4MHE A;  5NUC A;  2EYJ A;  3T4A C;  1OXX K;  2R6G A;  3EJI A;  2EYO A;  3MZ5 A;  5CV9 A;  2Z4I A;  4XYO A;  3A54 A;  2LFN A;  3QJY A;  2EDG A;  5C3W A;  1RHP A;  1B2T A;  1UUP A;  2PO4 A;  2N55 A;  2QCP X;  1SE4 A;  1TWG B;  1LTA D;  1VMC A;  1J9O A;  2CHB D;  3M85 A;  5IT9 E;  3CRK C;  4FXK C;  4K5W A;  4C3J B;  4ZAI A;  3Q23 A;  4J6H A;  3HOX B;  2CW0 C;  1PTO H;  3G7L A;  4DAV A;  3NBI A;  5CC4 A;  2NVY B;  3SK6 A;  2F0W A;  1JC7 A;  1RTO A;  4LK1 C;  3TZU A;  1STB A;  4IUT A;  2NB0 A;  3WOF A;  5E1F A;  4ZLT F;  1ZXT A;  4A93 B;  2JXM B;  3NQT A;  2CQA A;  3PMF A;  3NE5 B;  3DEP A;  2OF1 A;  3IAY A;  2RDG A;  1FNU A;  4A3G B;  2ENB A;  4F7X A;  3M4Y A;  1LV9 A;  1GOZ A;  3J80 E;  4Y7N B;  2B2V A;  4TRD A;  5CMD A;  3Q0A A;  1SAP A;  1TKW B;  1EY7 A;  1TR5 A;  5M5X B;  1U9R A;  4L6T B;  3E6Z X;  4FF2 A;  1SEB D;  2A6E C;  2DNC A;  3ZYY X;  3MA2 B;  4QB4 A;  2WII B;  3TME A;  1EY8 A;  1D5X C;  2Y0S B;  4RCO A;  1A3U A;  3RUZ A;  2KCN A;  3A8J E;  4CBV A;  3F2U A;  3I4N B;  4GZY C;  2A5H A;  1KDA A;  3PIP 3;  3I4L A;  2VXW A;  2R7Z B;  3WOE A;  4WRD A;  1XWE A;  1E0B A;  1TS2 A;  1I4R A;  1GUT A;  5I9P A;  4S3S A;  4DF7 A;  1F2L A;  1EY6 A;  3K5L A;  1GUO A;  1HHV A;  1IW7 C;  2RSO A;  1XTC D;  1WD0 A;  4EQO A;  1TT2 A;  1HRJ A;  3MTS A;  2PPB C;  3J81 L;  3H3V C;  2H1E A;  4K14 A;  1WTR A;  1EEI D;  1EL0 A;  2KHS A;  4AYB B;  2KEC A;  1AP0 A;  4G7Z C;  2NZ1 D;  4HR7 B;  3TSS A;  2VB3 X;  2K01 A;  2EOT A;  3NK9 A;  1Q12 A;  1WD1 A;  1BOS A;  1RKN A;  2AUK A;  2SDF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...