1XWEA

Nmr structure of c345c (ntr) domain of c5 of complement
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
151
structure length
151
Chain Sequence
GSHMADCGQMQEELDLTISAETRKQTACKPEIAYAYKVSITSITVENVFVKYKATLLDIYKTGEAVAEKDSEITFIKKVTCTNAELVKGRQYLIMGKEALQIKYNASFRYIYPLDSLTWIEYWPRDTTCSSCQAFLANLDEFAEDIFLNGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Complement C5
publication title Functional Insights from the Structure of the Multifunctional C345C Domain of C5 of Complement
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 2004-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01759 NTR UNC-6/NTR/C345C module
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1xweA01
1OO9B 3L3OC 3T4AC 4FXGC 2QKIC 1XWEA 2WIIB 2E2DC 2A74C 2A73B 2ICEC 3FRPB 1UEAB 5FO8B 5JPNC 3HRZC 1PXUA 3CKIB 2XWBB 2TMPA 3I70A 1UAPA 3MA2B 4FXKC 2J0TD 5FO9B 1BR9A 3KLSA 2I07B 5FOBB 1JC7A 1GXDC 1D2BA 2XWJB 4ILWA 3OHXC 1JB3A 5JPMC 3HS0C 2WINB 2B39A 3V96A 3CU7A 1BQQT 5FO7B 1BUVT 3G6JB
chains in the Genus database with same CATH superfamily
2PQAA 3MAQA 4RFBA 2E2IH 5CBAE 1WTWA 2HCCA 4IUTA 2DY7A 2JA7B 4A93B 4PMCA 4F7XA 3OYYA 3NELA 2BDOA 3EA6A 2UUBQ 4C1NK 2F0NA 2RQXA 3WDNA 4X66L 4G7ZC 5C0XG 2A19A 4UP9A 1PLFA 2MNAA 1A2TA 3HOZH 3CC4A 1YJWA 3DHQA 4X62L 5CR3A 4LF4Q 4OX9Q 3SK5A 1H95A 2CWPA 4JI4Q 2KCMA 3HOYB 3O13A 1N32Q 4J8QA 2RHQB 4KLKA 2I5LX 3CQZB 4DV0Q 4A3BG 3PO2G 1CHPD 2X6GA 3A5UA 1J8IA 1K0SA 3MXUA 5M5WB 3K6OA 1EYCA 2A69D 3KLRA 1J6QA 4OELB 1YNJC 1N33Q 2EJMA 2L9HA 2R7FA 1OTCA 4F87A 5EKKA 3GQBA 3GD7A 3A7LA 4WFN3 1ESRA 3BS1A 1BBWA 4IOCA 1PYSB 3MXGA 4GOPC 4HMJA 5KNCA 1N36Q 5CV6A 3SXHA 1TS3A 1XXGA 1QE6A 4HIMA 3RN5A 2NVTH 2B2TA 1ILPA 3K59A 2JA6G 3ICEA 4KMUC 1ET9A 4DV5L 2AHOB 2E74C 1C7YA 1TWHB 2B2UA 1TWAB 3LNNA 2VNUD 4JI7L 4BBSG 3MZ5A 4FP5D 2VQEL 5M5YH 5G3LF 2NBFA 1L0XB 2XRQD 3F2DA 1UE5A 2E5LL 1G291 4DFAA 4YY3Q 2LKVA 2K03A 3S1NH 1A15A 5IY0A 2FINB 2ZTCA 3SK6A 5JVG3 4U68A 2ZJQA 2UXCQ 2J4XA 2IL8A 4ZK9B 1STHA 3VYRA 2A6HD 4UY8C 5JJKA 1TT2A 1RKNA 1C9OA 1SR3A 1VQFA 1PYWD 2Z6KC 1SNMA 1II3A 5IYDH 4GZYC 3VYTA 3J7ZC 4CKCA 1SE3A 1DZ1A 3DWAA 1IBML 3KJPA 3U50C 2BH8A 5E4XA 2EJGC 1O80A 1PH4A 2NUCA 3D31A 1WCMG 5G3LD 1WVLA 2VUMG 2XIWA 2K50A 3UDGA 2YTVA 2EZVA 3FVQA 3OIQA 1GKHA 1HA6A 4GOPA 4DR1Q 2K5QA 4UDUC 3V96A 4BY1B 3HOZG 2K05A 3RZDH 3G6EA 1VQOA 1PFNA 4A4IA 1NMGA 3FP9A 4DUYQ 3PGZA 2LXKA 1HQRD 3PQIA 2JP1A 5LHY1 3T13A 1EL0A 4L5QA 3Q6SA 5I2YA 4DPGA 3TQYA 1W3SA 1FGUA 3K7AH 1CI3M 2DUDA 1M4VA 1EIFA 2LS01 3VYUA 2JA8G 2ZT9C 4KY5A 1IL8A 4K14A 1LTID 1R4PB 3E5SA 1LTSD 2D0OA 3G6JB 3NK9A 5CC4A 3H15A 1SMYD 4DR6L 1EY0A 2D2CC 3A56A 3RMHA 2FMMA 2Q2UA 1VQLA 5IP7H 4ZKCB 1UNSA 3GTKB 4LUZA 3ERQA 4KHZA 3QR8A 3LX0A 4DR5L 2L4NA 2KA7A 2Z6KA 2MQHA 3HOWH 5JAVA 1EUJA 2PCFB 3J80i 3HKZG 3CP0A 4JI6L 2J7ZA 2WB1E 3NWTA 3NQIA 4P72A 5AJ3L 4A3KH 4OO1I 1SXTA 4IZ8A 4A75A 4LFCL 3UE0A 4LF5L 3ULJA 2PNRC 3FKIB 3S1QH 1S5CD 4L63B 1EFWA 2V4DA 4H13C 3HOUH 4DR2L 4M8AA 3F8TA 3MXNA 3T56B 5IP9G 2UUCL 5EJWA 3GO5A 1GUOA 2VB2X 4DAVA 4BA1I 2L0CA 2UUBL 1PTOD 3BVMA 3HKSA 1NR4A 2F0MA 2KJXA 4DNRB 1PZJD 4DXGA 3G4SA 4LF8L 3QG1A 4AIMA 2WAQE 3CRLC 4ZUIA 3S2HB 2ES2A 2BH2A 1NNXA 3AFPA 3M85A 1AP0A 4BBRG 1OXXK 2JQOA 2LY7A 4IUUA 4OHJA 1A6XA 3HOVH 3CC7A 1JICA 4K0KL 1GUGA 3K7UC 4JI4L 3S16H 1AN8A 1I50B 2G5DA 2I5MX 3RZOH 1FNWA 5DLQE 3L2PA 4OIKA 2NVXB 1ZYRC 3X3MA 4JW0A 1QJOA 2Q2HA 3W5OA 5LMUQ 5T1IA 4HIDA 2RCFA 1FJGQ 1CHQD 1TVXA 2B2VC 2JA7H 4A93H 1B53A 4ODGA 3S2DB 4LF7Q 3DWQA 5NUCA 2VQFQ 1PZKD 1IKLA 2B63G 2XWBB 4A3BB 1RF2D 3PO2B 2K04A 4EQNA 4LF6L 5LMNQ 1EU4A 3MEHA 3BZKA 4G7OC 2PNHA 1JQYD 4KKSA 3HOYH 1DOKA 4ZYSA 3CQZH 3C3LA 1STGA 2F0GA 5CBEE 1XNRL 4IUPA 3S15B 5M5WH 4A3CG 5IGEA 2DNCA 1RCVD 1AW7A 3RN2A 3SK8A 2ZM6Q 4FVMA 2B8GA 4OWTB 2F0KA 4RG1A 1D2BA 2XWJB 1QZHA 3HOWG 4GS3A 2JA6B 2PPBC 4RGTA 4B3ML 1G51A 1KNEA 1I4QA 2F0JA 4ZUJA 4V190 4ULLA 1K3BC 1VQBA 3W2DA 3A7AB 5EBCA 4HTHA 3T16A 2O2LD 3A5ZB 4KK7A 3STBD 3U9SA 1UEAB 5JVH3 5ISRA 2F0IA 1CQVA 2PQEA 1H9MA 1L2FA 2A6EC 3FEWX 1TWHH 1WTQA 1Q8IA 1HNXQ 4DV1Q 1UE6A 4DV2Q 1TWAH 3MFYA 1K73C 5D3DA 4IUQA 2IX1A 1EYAA 5IWAL 3PO3G 3GV3A 3J81j 1RTOA 2FMCA 3RUZA 1KTKA 1V1PB 2F0OA 1DXMA 3EJIA 3PIOA 3NBHA 1XPUA 3KYHC 2O5IC 4JI2Q 2Y0SE 5J1ZA 2RDHA 4FXDA 3JAMi 2OQKA 4QF4A 2X69A 2BE5C 2A73B 3J7A5 1R9TB 2HD3A 4B3TL 3DMUA 1X3FA 1I3QB 4LUVA 4JBMA 4DUYL 1WCMB 4HJ5A 1U4RA 1EOVA 2VXWA 1PH5A 5ELEA 3U9OA 1V1OA 2HUGA 3DUZA 1OXVA 1HNWQ 1KHIA 1LTLA 1JR0D 3F2BA 2R93B 1K83B 1B2TA 4QJFA 4U673 1ENCA 2JK8A 2PMZB 1VQ7A 2F4VQ 3QJYA 4KHVA 3R8BA 2XVSA 3TZUA 1SE4A 3UDFA 3ULLA 1B9NA 1BBXC 4XIGS 4RH6A 1A3VA 4K5WA 3TP8A 4BY1H 4CJ1B 5M3FG 2PI2E 3NEMA 2DJFC 3OHXC 1WTPA 2SNMA 3Q23A 1EIHA 2D0PA 4EQ5A 2JYOA 4OO1G 3HOXG 1AEXA 2VS1A 2JA8B 4K8IA 5C4ZA 5JJLA 4XQNA 1X65A 2B2WA 4WJWA 1E2ZA 1CKNB 5JJIA 1JB7A 2KUMA 5IGGA 5LL6X 2Q8RE 1GOZA 4YWKA 5KYIA 3CCJA 2BA1A 1EQQA 1L0YB 1PRTC 4MN3A 3DLLA 1X54A 3RLNA 2PI2A 1IHZA 1NAPA 5BN3A 5A2QL 2LXJA 1IBLL 1BQQT 1HFNA 4YHHL 5ELCA 1P16A 3T1HQ 4A3EG 2XRSD 2BOSA 3GTKH 4YCUA 5C4JB 3HG9A 2MO1A 2SOBA 4QIWB 3NPPA 4Q5VA 2P5ZX 3A74A 1PH9A 2HQLA 3AQQA 1SNDA 5JEAG 5I9PA 4YCWA 1YNND 3SK4A 1WD1A 3VA5A 4PNYA 1U4LA 4HJ9A 3MWYW 1PH6A 1TR5A 4IPCA 5IYBH 2HIVA 3FKIH 1HZ9A 2XSCA 1JOKA 4ME5A 3P1HA 3VR5A 2RA4A 1HR0Q 4HSVA 4BBRB 1K3RA 4X65L 4LF7L 4R9WA 4LFBQ 1B9MA 4DR7L 5C3XA 3NTKA 2A5HA 2A69C 1XMOQ 1MI2A 3S2HH 1FNUA 3H3VH 3OTOQ 1K0RA 1VQAA 2HDLA 3BDLA 4C3IG 1KDCA 1G2SA 3H6MA 1STYA 1XMQL 1WTRA 1I50H 4DAPA 4X3UA 1JWMD 1EYDA 2NVXH 3IKJA 1Q3LA 3UE1A 1TY0A 3PUXA 2F0QA 2QW7A 3SHLA 1Q1EA 5C0XH 1TU2B 3ITPA 4X6AH 3URYA 2B63B 1MIUA 4J15A 4ZLTF 2V1CC 1H9SA 4QY7A 4ZCKA 3S2DH 4GLVB 4P74A 1RHPA 2EVBA 1LTGD 5IYCG 4LMQD 4JYAQ 4KD3A 4A3BH 4X64L 3PO2H 2L12A 2F52A 1PVOA 4DN4M 2EOTA 1EZ6A 3BU2A 4IPGA 1D1KA 2K6AA 3K5LA 4QMGA 1HCZA 4CGYB 4A3LG 2YU9B 1CK1A 2A6HC 1S72A 1ML0D 1RIPA 1A62A 1IBKQ 1C48A 4DV1L 1DOMA 5FO7B 3M9BA 3S15H 4JV5L 2NTSA 3D4WA 4GNXB 1Q8KA 2NYZD 1UEBA 2EJFC 2ICEC 3FPUB 2EYOA 2K1BA 1UE1A 2JA6H 1Q1BA 4O0AA 3JC66 4RCOA 4JI1L 2XNAC 1N9WA 4F88A 1SYFA 1BBUA 1VQMA 4RHSA 1EY4A 1S5DD 2ZTEA 4IURA 3PO3B 1U4MA 1PHJA 1G8ZD 2N3SA 3OWEB 1KAAA 1XPOA 1FVIA 2N78A 2Z1CA 3LWEA 2A1AA 1XPRA 3OIPA 5ELDA 1IYJB 1QOHA 2B2YA 4B3RQ 1YHBA 3EN2A 1JJGA 2TMPA 1SJED 1X3PA 3K8AA 4P71A 5D3IB 5C4XG 1Y69U 2WFWA 1CT1D 4C1NI 5FLMG 2H5XA 1N8RC 1F9PA 1ZKOA 4APVA 4S3SA 5M9OA 3MHBA 1R9TH 1CKMA 5DEHA 1CFMA 1SLJA 4K2KA 4AYBG 1I3QH 5IGBA 5JJZA 1WCMH 4EX5A 2VUMH 3NWSA 1HNZL 4POFA 3MVVA 1C0AA 3GTQB 4MTNA 3EFXD 5FJ8G 3I4LA 3KF8A 1TWCB 1WTXA 2F0TA 2R93H 1K83H 4ZAIA 1VS0A 5M3FB 1C4QA 2MJ8A 1VQ9A 4IUNA 4X3KA 3SR1A 5CORA 4F8MA 1S4ZA 1J5EL 2K14A 3HOXB 2ZTDA 1G6PA 2QF7A 1MJCA 2JA9A 5L37A 4DUZL 4M1UB 2F3IA 3CCMA 4CKBA 3H0GG 4RWSC 4NW2A 4KKUA 2I07B 3ONAB 1HUMA 5CV4A 3E0JA 3GV6A 1LT3D 4DV7Q 1WI5A 1ESFA 2JA8H 1PTOC 2RF4A 1TQOA 5EPJA 4CDEC 2G9DA 3E9HA 3CMAA 3R2IA 3J7AF 5IT9E 1Y1VB 4A3EB 2ALYB 1FR3A 2HCIA 4PZ6A 2EY2A 3CKIB 1B3AA 3DWPA 1PFSA 3X3NA 2QGQA 2UXBQ 4HR7B 1HTLD 1TKWB 2RSNA 5IGDA 3S1MB 4KHPQ 4GKJL 4JI3Q 4OXPA 1HR0L 4MIUA 4IQZA 5FLXE 1F2LA 2WINB 1KXLA 5C4JH 4JI0L 1R4QB 2OT2A 5GAGC 3I3CA 2M9VA 3AU7A 3TBIB 5ELBA 2NVQB 2N49A 1XMOL 5D65A 2PQAB 4XTCS 5GQOA 1AE2A 4R1JA 1XNQL 5HURA 2F0SA 2DNEA 2F0LA 1XX8A 1LTRD 5IP9H 2BDNA 3FDTA 3L7ZC 4GN5A 4Y7NB 1G91A 4B9WA 1TS2A 3I91A 4DV6Q 5CYUA 2R61A 5BR8Q 4IFDJ 1IXRA 1T5XD 2E2JB 4R4CA 2CHBD 4BY7G 1FL0A 4BBRH 2WAQG 2EYJA 4C3IB 2A74C 3WOEA 2AQ2B 4NXNQ 2IPKD 2IT1A 1UAPA 4FXKC 4IPHA 3TSSA 5KEEA 4A3GG 4XXEA 1Z9FA 4IPDA 4LWCA 4KY7A 1D1IA 2R93G 4LF9Q 4HJ8A 4LFAL 3J80E 2MUYA 3VYSA 1K9MC 1MKHA 3DXJC 4OEMB 1Y8PB 1F2YA 3STBC 2E2DC 4P73A 4A3MG 2K7VA 3ND9A 2HHHL 2B63H 4DNTB 2CWAA 1ICWA 1STBA 4IJHA 1EY7A 4DGZA 1SFOB 4FNFA 2E76C 3TZDA 2WKDA 3CCQA 1YBYA 1SNCA 4HIOA 4AQYL 4JBKA 1BNZA 1D6EC 4LW1A 1ONLA 4OWXB 3L3OC 1SMXA 1S5BD 4EGVA 4NMZA 2XN9C 5A35A 3KF6A 2WACA 4XDXA 4A3CH 2PW5A 2YTXA 3L0OA 4Z9CB 1DD2A 1I4RA 2YU9H 4N8X1 3IFDA 4IOAA 1I94Q 4DV3L 1O78A 3ERSX 3A8IE 2QCPX 5T1GA 5DM73 4O42A 1CQFA 3D3RA 2UU9L 2IHFA 1VF5C 2VZAA 1SN8A 3F1ZA 1OXSC 1QG7A 1I4PA 4GLXA 3PCOB 1EYGA 1K8OA 2UXDQ 1V43A 3MTSA 3PIO3 1S3OA 1WJJA 5FO8B 1JJCB 5EAYA 1TS5A 1H9KA 2A68D 2FJ2A 3IAYA 1VQ5A 1SYCA 4JOIC 1BO0A 3PO3H 1G6ZA 2EXZA 1KRTA 5C4XB 2NN6I 1X32A 2OF1A 4DR4Q 2Q8TA 2L11A 1E1OA 4GOPB 1BDOA 5E3FA 4DV4Q 1YITA 1ASZA 3I56A 4K5VA 1BKBA 1UUPA 4LF4L 1UE7A 5JOBA 4AYBB 4OX9L 3C2PA 5I6YA 3VR6A 5KNDA 2D5DA 1YVCA 3GTGB 5E1FA 1N32L 4Y52H 5HY6A 4ILWA 4DV0L 4CJ0B 3T1YQ 2JEBI 3R3OA 3VA7A 2IJ0A 2PYKA 1A8VA 1ASYA 2L55A 1VQ4A 2YYZA 3CCUA 1DGSA 3GTQH 2OTJA 1N33L 2PZWA 1HXYD 2F03A 3DM1A 1TWCH 5FK9C 3WOFA 4B3SQ 4G4KA 3GTPB 1SE8A 5FO9B 1DJRD 1PH8A 1A2UA 5M3FH 3H0GB 3NQTA 1N36L 1WTHA 1YNNC 1Y1WB 3RNUA 5IE8A 5I2XA 4HCEA 3HOXH 4OO1H 1SAPA 4B08A 3P75A 4RCNA 3SDZA 2YV5A 3SEBA 1I6HB 2NZ1D 4UP8A 5KNBA 4XYOA 2F0UA 1HJPA 1PMRA 4JOIA 3CMEA 5CV8A 5C44B 1B1ZA 1W2BA 1EY8A 3D0FA 3NXWA 3JAME 2L1BA 3OW2A 3BDCA 3GTJB 4OWWB 1EEID 1IYUA 4GKKQ 4ZKBB 1MBYA 5FKAC 4YY3L 4N8FA 1CSPA 2B39A 3MXNB 1VQCA 3SGIA 2H4OA 4A3EH 3P7JA 4YWMA 2UXCL 1EU3A 1MJEA 3J7YW 3PF4A 4X3TA 4RKLA 3TS2A 1J9OA 4QUCA 2RHSB 4DNIA 3SVMA 1KIXA 3AFQA 4CJ2C 5I9OA 3HKZE 4K6DA 4G7HC 2LSSA 2NVYB 1S5ED 1TWFB 3CPFA 5C5MA 3N6RA 5GAEC 4A3DG 1FD7D 3RD4A 5EBDA 5JEAH 1E2WA 2B2VA 2R7DA 4GN3B 2NVQH 3ND8A 1LO5D 4UAIA 4UHVA 3A54A 3M4OB 4QIWE 2EY1A 1B70B 5HGTA 5C4HA 1VQIA 1RD9D 4BY7B 4DR1L 3RR5A 3S1RB 2EYPA 1QNKA 4LF9L 4DAYA 1QUQA 2DY8A 2WAQB 4Y7NH 1LM0A 5CGKA 2JN4A 2RVLA 3I70A 2MFIA 3MC0B 1STNA 4DA2A 3CHBD 2R92G 2D9UA 2I5HA 1X3EA 3NHHA 2E2JH 4A3GB 1X9NA 1VDZA 2KCCA 1SYBA 3I55A 1PFMA 3BG3A 4C3IH 3NE5B 1V8QA 4A3JB 1JJ2A 4JI8Q 1X55A 4OGQC 1Y8NB 2RCNA 4L5TA 1Q90A 3CAMA 3I7FA 1EQTA 1Q82C 1D5ZC 3AB9A 3F2UA 3PF5A 4MNOA 1WYDA 1HZCA 3TP5A 3MA2B 4A3MB 2OQ0A 5DM63 2L15A 4BXXG 3K0YA 1F2MA 5CV7A 5IYCH 1N34Q 3W1GA 4IFDI 3W3AA 2IWHA 3KLSX 1CA6A 3G7LA 5COYA 4WJ4A 1SFOH 1L1OC 1JCKB 3GP7A 2BA0A 1SROA 4I7ZC 1VQDA 2AKWB 4A3LH 4NXMQ 4EVOA 5KIXA 3A8JE 2NN6G 2A8VA 2F0PA 3W1BA 2RDGA 2MO0A 4KY6A 4BWGB 1Y1VG 4C3JG 4KI0A 4X66Q 4UPAA 4KJOA 3NBHB 1EQRA 1EY6A 2EYMA 1LTAD 4I65A 4X62Q 1I6VC 3D4RA 4MHEA 4P2CB 1W6JA 2JA5G 3BVGA 1SYGA 4RHRA 4HMIA 4HN7A 1XJVA 2K33A 2PZUA 4R8NA 2WV6D 4K5XA 3OOCA 4FXGC 1EWHA 2DN8A 2R6GA 2ZXRA 5ELFA 1ENFA 1TWGB 1JORA 1M8AA 1Y8OB 1U0LA 1VQNA 2AUKA 4BS9A 1EFID 5LMUL 2F0EA 4R4OA 5M5XB 1VQ6A 3OW7A 1FJGL 1DCZA 5IGFA 2CKZB 1D8LA 4TRDA 5C4XH 3GTOB 3I4MG 1U4PA 2VY3A 5FLMH 4CDDC 1B3QA 1NY4A 1Z6HA 2VQFL 4EQOA 1HTPA 1KLGD 4CDCC 1L1OA 3M7GA 3IFTA 3J81E 4A3IG 4FF3A 2HT1A 2F1MA 5LMNL 4DV5Q 3PMFA 2AMCB 3T53B 3HFZB 4TVAB 4ABNA 2NZHA 1LYLA 2KCNA 3GTGH 3TP7A 1S5FD 1AZQA 4L8JA 1DYQA 4JI7Q 1V9PA 5K36G 1B50A 2PO4A 2VQEQ 1LV9A 5FJ8H 3ZYYX 5ELNA 3K5NA 2X6LA 5C3EG 1QNUA 3QOLA 2E5LQ 2OTLA 1LT6D 1STEA 4P75A 1E0BA 3K0XA 2IX0A 2CQOA 2F0DA 4JK1C 4R4QA 4IUVA 2ZM6L 1CZGA 5KRUA 4RMFA 2ASBA 3GTPH 1HZAA 3V2TA 1LTTD 1PXUA 3TREA 3H0GH 4E6IA 2M2LA 2K32A 4QQBX 3I72A 1Y1WH 1IYVA 3A55A 2KOLA 1HFGA 1EEFD 1SRUA 1IBMQ 1I6HH 3E9IA 1E22A 1HNXL 4ID6A 1TY2A 4NDXA 4WORA 4DV2L 4FYDA 3BDOA 5C44H 4X3SA 1VQPA 2QKIC 1LACA 3GTJH 1QWYA 2E2HB 3PIP3 4JI2L 3NUCA 5BN4A 2YTYA 1ICFB 2HDMA 1A63A 1CTMA 4A3DB 1SEBD 3G71A 3FPPA 4L5SA 5IT9L 2QDLA 2EPBA 2K75A 3DEPA 5E4WC 2R7ZG 4RGOS 5KYLA 1B8AA 1BVSA 2NVYH 1TWFH 3NTIA 5LMNW 2JSOA 1HNWL 4DF7A 3CF5A 4KD4A 2CW0D 3HGBA 2FHTA 4JBWA 4JI8L 4IN3A 3IRBA 2F0VA 4PG3A 3A8KE 4DR6Q 5FLXL 2F4VL 3M4OH 1CSQA 1WFQA 4JI5Q 2EYHA 1D5XC 1XTDA 1SSOA 2R92B 3KDFA 5CV5A 3H09A 1WTVA 2AQ3B 4BY7H 4IFDG 3S1RH 1H9SB 2PW7A 4DR5Q 1MSHA 3PUVA 1GVPA 5EKLA 4RGNA 2L5TA 2K4KA 3CPWA 2CFMA 3TN2A 2JXMB 1ZEQX 1N34L 4A3GH 4HSPA 3DM3A 4B9XA 1Q12A 5AJ3Q 1KDBA 1YZ6A 3BVZA 1WTOA 1FGBD 3TDQA 1Z7TA 4TKOB 5I4DA 4LFCQ 1JB3A 5LL6S 1Y14B 1STAA 3U4VA 4LF5Q 1PH3A 4NXML 4DR2Q 3PUYA 4C2MB 5IIFA 2B2UC 1B44D 3CCSA 4A3MH 3K5OA 4QUFA 2UUCQ 1AE3A 1BCPF 1S40A 1HQMC 4QCLA 2A68C 3T1HL 1T9HA 4POGA 1BR9A 4LF8Q 1BCPB 1WOCA 3KLSA 4JVZA 1Y1WG 5K5PA 3P20A 5H1SE 4GLAC 4K8JA 3TRZA 3J80L 2Z8LA 2DJGC 4YIJA 4LUOA 1NUCA 1EZ8A 4K0KQ 3MEFA 3RLFA 3GTLB 5C44G 2NZOA 1AZPA 4C3JB 4A3FG 3NTHA 5D14A 4KV6A 3M4QA 4C3HG 1YHAA 3N52A 1PYBA 3D4DA 5M3MG 1BCPD 1D5MC 2JA5B 4LJZC 4C56C 4ZQ3A 2XGTA 2Q2TA 3KBXA 2EXDA 3SE0A 2CVRA 2WB1G 4LFBL 1K8MA 3KDFB 4Q0FA 4LF6Q 4J1MA 3BZDB 1CM9A 1GJXA 2KHSA 3PIPA 3EVQA 3H3VC 3KBGA 3E0EA 3OTOL 2QILA 1VQGA 4CHTB 1HH2P 3D8GA 1PH2A 1JC7A 2F3VA 1MSGA 1XNRQ 2K5DA 3OMCA 2F0HA 1QVGA 3I4MB 2MGSA 2SNSA 4JBJA 3I90A 1TWGH 3KF8B 1KABA 3I4NG 3C1FA 2LMCB 4HAEA 3IL8A 5M5XH 4HCSA 3PV0A 2Q8IB 1Q7YC 4A3IB 2IHEA 3GTOH 2GA4B 4B3MQ 1RODA 1F77A 2C9OA 1YI2A 3C46A 4A76A 3QIAA 2KECA 3TEHB 4JYAL 4NP5A 3J7AV 3KUPA 3HZXA 1CKOA 4LAAA 2MPMA 3NP8A 4R8IA 4A3JG 5C3EB 3WWVA 4AYBE 1JT8A 3M4PA 3EBEA 5F2DA 3BYYB 3VR2A 3Q0AA 1U5KA 3E6ZX 4NKLA 3Q22A 2AQ1B 1QCBD 5IWAQ 4QGUA 1EQVA 1IBKL 1V1QA 3ULPA 1E24A 1M90C 4FF1A 2AWNA 1W6KA 4HIKA 1E1TA 5C0XJ 1XYIA 2F0WA 2F4IA 3UDXA 4I7AA 2TSSA 5IT9c 4ZRZA 5JPMC 1Q81C 3ER0A 1KAWA 4K6LA 1VF7A 4B3TQ 3OSOA 4DK6C 1HR0W 1LT5D 2K28A 4V0BA 4YCVA 3CC2A 2GVAA 1JWUD 5FLXc 2N55A 2SDFA 3M3YB 4R4IA 1KDAA 5J3BA 4DK3C 5KGUA 3BZCA 2NB0A 4B3RL 1KQSA 2ENBA 1IKMA 1ZXTA 2WKCA 1MD2D 3I8ZA 1NJIC 1H9RA 5EQ0A 2PZTA 2E2HH 3R2TA 4HJ7A 5EKIA 4JI5L 1KLUD 3FMCA 1GHJA 1F9QA 1SNOA 3U58A 4N9PA 3VR3A 4XQJA 3JAML 2R7ZB 4OONA 1IW7C 1MHWC 3QWNA 5J39A 1PTOF 3QB3A 1U9RA 1YEZA 2FXQA 4A3DH 2ATWA 3GTMB 4JC0A 1PH1A 1E7ZA 1AFPA 1PTOB 3S14B 1TS4A 2F0FA 3QOJA 4MZ9A 4TSSA 5CMDA 4DR3Q 3T4AC 1UWVA 2BCOA 2B29A 2I0QA 1VQ8A 4CKEA 4JG2A 2OWOA 2Y0SG 2KHJA 4UP7A 3AYHB 3K5MA 1M1KC 2KVMA 2Z9HA 3AEVA 1FNVA 2R3ZA 1A0IA 1IBLQ 1O7LA 3J80c 1EWIA 4KKTA 4YHHQ 2KENA 2R92H 3Q24A 2ZJRA 4IALA 1VQEA 3Q8DA 3HS0C 1YNJD 2VW9A 5IYDG 2CQAA 4DV7L 3LWUA 2KEEA 1SJHD 3H94A 2EE1A 3KF6B 3TMEA 3CCVA 4BXXH 5DNFA 1V1PA 1TXYA 2EY5A 4JPBW 3C1EA 2JJQA 4C2MH 4DK0A 1BOSA 5GADC 1QZGA 1BXTA 2PMZE 3QO2A 4IJLA 2E75C 3FHWA 2UXBL 1C8CA 2EYLA 1JOOA 3PUZA 3AMUA 4X65Q 2K01A 4KHPL 3LGJA 4JI3L 3NBIA 4DR7Q 1DOLA 2WIIB 5IOCA 3NSWA 3CCRA 1JOQA 2Z0SA 2WP8J 1VQKA 3R93A 1SNQA 5J22A 1ENAA 4A3FB 2J0TD 1GM5A 1SBBB 1GXDC 2NN6H 3E3XA 1GUWA 1T5EA 4C3HB 1XMQQ 1QVCA 2D62A 5IODA 2UUAQ 1X3GA 2EYFA 3GTLH 1P8LA 5M3MB 2CCZA 4FF4A 2QDBA 1Q46A 1Y1VH 4C3JH 1LT4D 1PFBA 4FF2A 4FO2A 4QB4A 3OWFA 4H7BA 2SEBD 2QA4A 3D6CA 2WB1B 1SDFA 3S9WA 5IP7G 4DV6L 5BR8L 1GUTA 3S1MH 2JA5H 2B3GA 2LFNA 4OIJA 2IW3A 2K5VA 4TQUS 1X3QA 3BYTB 2E8GA 5EPLA 3KFUA 4WJ3M 4X64Q 2K5NA 2EQSA 2N8NA 3CU7A 4NXNL 1QB5D 3UDIA 3KOJA 1OO9B 3U4ZA 4CBVA 3CXCA 3K57A 1CKNA 4BBSB 4A3KG 4K2LA 1HPCA 3I4NB 1EIYB 2NTTA 3K80C 1LUZA 4O1NA 2G9HD 3HRZC 2QEXA 2F3WA 2OEOA 3EQLC 2O4XA 2O5JC 3I4MH 3HOUG 1NBWA 3VDYA 2B2WC 4JV5Q 4PMWA 2K5HA 2RSOA 3CD6A 4DAMA 1LTBD 1B7YB 3MXPA 3PUWA 1E3PA 4RA8A 4A3IH 1EIGA 3L9AX 1JE5A 4JI1Q 3S17B 1GHKA 3F2CA 1HUNA 3K81C 1XTCD 2KQ3A 2E2IB 2Z4HA 5K36H 5ELOA 3HOVG 1IW7D 3CCEA 1KL9A 2AWOA 2VUMB 5C3EH 1GUNA 1O7YA 4KJNA 1EOTA 1HZBA 1VMCA 1Z47A 1X56A 2GVBA 2AUJD 3J81L 4LNQA 1I94L 3JAMc 2MHVA 3HOZB 1PA6A 3KK7A 2JA7G 4A93G 4GNXC 3TS0A 4QL5A 2JE6I 2K52A 4H0LC 5E7NA 2CW0C 1I4HA 2UXDL 2GN5A 3I73A 1SE2A 5C3WA 1NE3A 1VMPA 3I2ZA 1HA5A 3K58A 3HOYG 4PZ7A 1HNZQ 3KJOA 3DEOA 3MFGA 4RGMA 3H3VI 1YIJA 4DK1A 1CA5A 1XWEA 2KHIA 4JCVE 1NSNS 1VQHA 3FRPB 1NMFA 3M3YH 4DR4L 4R4TA 4DR3L 2HIXA 1PZID 3TP6A 1IZ6A 5HGQA 1F9RA 3V05A 2H1EA 4DV4L 4DAYB 1QUQB 2Z6BA 1YJ9A 1J5EQ 2NVTB 1ZYRD 5C0XI 3HKZB 3EROA 4DUZQ 1BUVT 1DM0B 2R7ZH 3M4YA 4ME3A 1OXUA 2NWGA 2XTIA 3KLWA 4PMBA 2Z4IA 3T1YL 3EIVA 1HRJA 4RAUC 5M5YB 3T51B 1K8GA 3GTMH 2CH4W 2Y0SB 1RJTA 1PTOH 3S14H 1AH9A 2VB3X 1CUKA 3CW2C 3S1NB 5FOBB 1EWCA 4N9TA 2MP1A 4DXFA 4EQPA 1GO3E 4GNXA 3NENA 4CDFC 4B3SL 1KD1C 4IFDH 1PV4A 5I6WA 4XYQA 1PDQA 2ID0A 2I46A 4YWLA 1DONA 2OCEA 1IL2A 4GKJQ 5GAHC 4PQXA 4XT1B 2Q2IA 4L5RC 1JWSD 3CCLA 1OXTA 3HP3A 1K28A 4HJAA 3PSIA 4MTKA 4JI0Q 2CH4A 1G2TA 4G57A 4AH6A 3CRKC 2FFKB 4PV1C 4BA2I 1BCPC 4WRDA 1NCVA 3H91A 5C5LA 1Q86C 2EY6A 1YJNA 4IO9A 1I4GA 1VCIA 1XNQQ 2C35B 4GKKL 2UUAL 1B4OA 3RZDB 4L6TB 1A3TA 3A0JA 1ILQA 5GROA 4DU9A 4RKBA 5IGCA 2IY5B 2ZJPA 5CV9A 1CZWA 2HQEA 3D6WA 2A6ED 2RDFA 1K8AC 2RBMA 4XQQA 1E2VA 1X6OA 3GDEA 2KCTA 2B2YC 4BY1G 1O7ZA 5DAUA 4O2DA 1YHQA 3K7AB 5C6AA 2N88A 4GN4B 5A2QE 4PZ8A 4KN7C 1GUSA 4XT3B 1RTNA 3OMGA 1KC8C 2VL6A 3VR4A 3B6YA 2DGYA 4A3FH 5EGTA 4OL7A 1F2ZA 2BE5D 4LK1C 1H9JA 4C3HH 2B8FA 1PH7A 1LABA 4LFAQ 4H02A 2EDGA 5M3MH 3J81i 1RL2A 1TIID 4KN4C 1A3UA 1QVFA 5AFWA 4HEDA 1I4XA 4H44C 1QILA 3HOWB 2QEJC 2HHHQ 3BJUA 2KEDA 2RKSA 4FDBA 3G48A 1JE4A 1F9SA 5EPKA 1RDPD 1KRSA 2IX3A 1L1OB 1EY9A 5BN5A 4AQYQ 2KBNA 3OPOA 4A3KB 1PRTF 1SYDA 3M7NA 2M00A 1EY5A 1O7IA 3J81c 2ICIA 1NTGA 1KNAA 4NB3A 1GD7A 1PRTB 3S1QB 1L0WA 5JEAJ 4J6HA 3HOUB 3HEJA 1HHVA 4BBSH 4ALPA 3UI2A 1LLRD 1YNXA 3I4NH 1WD0A 2JEAI 2K5WA 4DKAC 1I5FA 3S24A 5IYBG 4NPSA 2OXPA 3FKIG 4DV3Q 5JPNC 1SYEA 4KTAA 4JI6Q 3ZJYC 2C5CA 2UU9Q 3RLOA 1FYCA 1BF4A 1D7QA 1MGSA 1JMCA 2EIFA 1PRTD 3HOVB 1ET6A 3S16B 3I4OA 5TSSA 4A3JH 2B2TC 1VQJA 2ZXPA 3RZOB 1SNPA 3S17H 2ZXOA 1NR2A 1SMYC
chains in the Genus database with same CATH topology
3MAQA 4RFBA 5CBAE 1WTWA 2HCCA 4IUTA 2DY7A 2JA7B 4A93B 4PMCA 4F7XA 2BDOA 3EA6A 4C1NK 2F0NA 2RQXA 3WDNA 4G7ZC 5C0XG 1PLFA 1A2TA 3DHQA 5CR3A 3SK5A 3HOYB 3O13A 4J8QA 3CQZB 1CHPD 2X6GA 1J8IA 3MXUA 5M5WB 3K6OA 1EYCA 2A69D 3KLRA 1YNJC 2EJMA 2L9HA 4F87A 5EKKA 3GQBA 3GD7A 3A7LA 4WFN3 1ESRA 3BS1A 3MXGA 4HMJA 5KNCA 5CV6A 3SXHA 1TS3A 1XXGA 1QE6A 2B2TA 1ILPA 3K59A 4KMUC 1ET9A 2E74C 1TWHB 2B2UA 1TWAB 3LNNA 2VNUD 3MZ5A 4FP5D 5G3LF 2NBFA 1L0XB 2XRQD 1G291 4DFAA 2LKVA 2K03A 1A15A 2FINB 3SK6A 5JVG3 4U68A 2J4XA 2IL8A 4ZK9B 1STHA 3VYRA 2A6HD 1TT2A 1RKNA 1PYWD 1SNMA 1II3A 4GZYC 3VYTA 4CKCA 1SE3A 1DZ1A 3DWAA 5E4XA 2EJGC 1O80A 2NUCA 3D31A 5G3LD 1WVLA 2XIWA 2EZVA 3FVQA 3OIQA 1HA6A 2K5QA 4UDUC 3V96A 4BY1B 2K05A 1PFNA 1HQRD 2JP1A 5LHY1 3T13A 1EL0A 3Q6SA 5I2YA 1CI3M 1M4VA 2LS01 3VYUA 2ZT9C 4KY5A 1IL8A 4K14A 1LTID 1R4PB 3E5SA 5CC4A 1LTSD 3G6JB 3NK9A 1SMYD 1EY0A 2D2CC 3A56A 3RMHA 2FMMA 4ZKCB 1UNSA 3GTKB 3ERQA 4KHZA 3LX0A 2L4NA 2KA7A 5JAVA 2PCFB 2J7ZA 3NWTA 3NQIA 4OO1I 1SXTA 4IZ8A 2PNRC 3FKIB 1S5CD 4L63B 2V4DA 4H13C 4M8AA 3T56B 3MXNA 5EJWA 3GO5A 1GUOA 2VB2X 4DAVA 4BA1I 2L0CA 1PTOD 3BVMA 1NR4A 2F0MA 2KJXA 4DNRB 1PZJD 4DXGA 3QG1A 3CRLC 4ZUIA 3S2HB 3M85A 1AP0A 1OXXK 2LY7A 4IUUA 4OHJA 1A6XA 1JICA 1GUGA 1AN8A 1I50B 1FNWA 2NVXB 4OIKA 1ZYRC 3X3MA 1QJOA 5T1IA 1CHQD 1TVXA 2B2VC 3S2DB 1B53A 4ODGA 3DWQA 5NUCA 1PZKD 1IKLA 2XWBB 4A3BB 1RF2D 3PO2B 2K04A 4EQNA 1EU4A 3MEHA 4G7OC 1JQYD 4KKSA 1DOKA 4ZYSA 3C3LA 1STGA 2F0GA 5CBEE 4IUPA 3S15B 5IGEA 2DNCA 1RCVD 1AW7A 3SK8A 4FVMA 2B8GA 2F0KA 1D2BA 2XWJB 2JA6B 2PPBC 4RGTA 1I4QA 1KNEA 4ZUJA 2F0JA 4V190 4ULLA 3W2DA 3A7AB 5EBCA 4HTHA 3T16A 2O2LD 4KK7A 3U9SA 1UEAB 5JVH3 5ISRA 2F0IA 1CQVA 2PQEA 1H9MA 2A6EC 3FEWX 1WTQA 1Q8IA 3MFYA 5D3DA 4IUQA 2IX1A 1EYAA 3GV3A 1RTOA 2FMCA 3RUZA 1KTKA 1V1PB 2F0OA 1DXMA 3EJIA 3NBHA 2O5IC 5J1ZA 2RDHA 4FXDA 4QF4A 2X69A 2BE5C 2A73B 1R9TB 3DMUA 1I3QB 1WCMB 1U4RA 2VXWA 5ELEA 3U9OA 1V1OA 2HUGA 3DUZA 1OXVA 1JR0D 2R93B 1K83B 1B2TA 4U673 1ENCA 2PMZB 3QJYA 4KHVA 3R8BA 2XVSA 3TZUA 1SE4A 1B9NA 1BBXC 4XIGS 4RH6A 1A3VA 4K5WA 3TP8A 4CJ1B 3OHXC 1WTPA 2SNMA 3Q23A 1EIHA 2JYOA 4OO1G 1AEXA 2JA8B 4K8IA 5C4ZA 4XQNA 2B2WA 4WJWA 1E2ZA 2KUMA 5IGGA 5LL6X 2Q8RE 1GOZA 5KYIA 2BA1A 1L0YB 1PRTC 4MN3A 1IHZA 1NAPA 5BN3A 5A2QL 1BQQT 1HFNA 5ELCA 2XRSD 2BOSA 5C4JB 3HG9A 2SOBA 4QIWB 3NPPA 4Q5VA 1SNDA 5JEAG 5I9PA 3SK4A 1YNND 1WD1A 3VA5A 4PNYA 1U4LA 3MWYW 1TR5A 2XSCA 1JOKA 4ME5A 3P1HA 3VR5A 2RA4A 4HSVA 4BBRB 4R9WA 1B9MA 5C3XA 3NTKA 2A5HA 2A69C 1MI2A 1FNUA 2HDLA 3BDLA 4C3IG 1KDCA 1G2SA 3H6MA 1STYA 1WTRA 4DAPA 4X3UA 1JWMD 1EYDA 3IKJA 1Q3LA 1TY0A 3PUXA 2F0QA 3SHLA 1Q1EA 5C0XH 1TU2B 3ITPA 3URYA 2B63B 4ZLTF 1H9SA 1RHPA 2EVBA 1LTGD 4LMQD 4KD3A 2L12A 4DN4M 2EOTA 1EZ6A 1D1KA 2K6AA 3K5LA 4QMGA 1HCZA 4CGYB 2YU9B 1CK1A 2A6HC 1ML0D 1C48A 1DOMA 5FO7B 2NTSA 3D4WA 2NYZD 2EJFC 2ICEC 3FPUB 2EYOA 2K1BA 1Q1BA 4RCOA 2XNAC 4F88A 1SYFA 4RHSA 1EY4A 1S5DD 4IURA 3PO3B 1U4MA 1G8ZD 3OWEB 1KAAA 2Z1CA 3LWEA 3OIPA 5ELDA 1QOHA 2B2YA 2TMPA 1SJED 1X3PA 5D3IB 1Y69U 1CT1D 4C1NI 1F9PA 1ZKOA 4S3SA 5M9OA 3MHBA 5DEHA 1CFMA 4K2KA 5IGBA 5JJZA 3NWSA 3MVVA 3GTQB 3EFXD 3I4LA 3KF8A 1TWCB 1WTXA 2F0TA 4ZAIA 5M3FB 1C4QA 2MJ8A 4IUNA 4X3KA 3SR1A 5CORA 4F8MA 1S4ZA 3HOXB 2QF7A 4M1UB 4CKBA 4RWSC 4NW2A 4KKUA 2I07B 3ONAB 1HUMA 5CV4A 3E0JA 3GV6A 1LT3D 1ESFA 1PTOC 1TQOA 5EPJA 2G9DA 3R2IA 3J7AF 5IT9E 1Y1VB 4A3EB 1FR3A 2HCIA 2EY2A 3CKIB 1B3AA 3DWPA 3X3NA 4HR7B 1HTLD 1TKWB 2RSNA 5IGDA 3S1MB 4MIUA 4IQZA 5FLXE 1F2LA 2WINB 1R4QB 2OT2A 3I3CA 2M9VA 3AU7A 3TBIB 5ELBA 2NVQB 5D65A 4XTCS 5HURA 2F0SA 2DNEA 2F0LA 1XX8A 1LTRD 2BDNA 3FDTA 3L7ZC 4Y7NB 1G91A 4B9WA 1TS2A 3I91A 5CYUA 2R61A 4IFDJ 1T5XD 2E2JB 2CHBD 2EYJA 4C3IB 2A74C 3WOEA 2AQ2B 2IPKD 2IT1A 1UAPA 4FXKC 3TSSA 5KEEA 4XXEA 4KY7A 1D1IA 3J80E 2MUYA 3VYSA 3DXJC 1Y8PB 1F2YA 2E2DC 2K7VA 3ND9A 4DNTB 1ICWA 1STBA 1EY7A 4DGZA 1SFOB 4FNFA 2E76C 3TZDA 2WKDA 1SNCA 1BNZA 1D6EC 1ONLA 3L3OC 1S5BD 4EGVA 4NMZA 2XN9C 5A35A 2WACA 4XDXA 2PW5A 4Z9CB 1DD2A 1I4RA 3IFDA 1O78A 3A8IE 2QCPX 5T1GA 5DM73 4O42A 1CQFA 3D3RA 1VF5C 1OXSC 1QG7A 1I4PA 1K8OA 1V43A 3MTSA 3PIO3 5FO8B 1TS5A 1H9KA 2A68D 2FJ2A 3IAYA 1SYCA 1BO0A 1G6ZA 2EXZA 5C4XB 2NN6I 1X32A 2OF1A 2Q8TA 2L11A 5E3FA 1BDOA 4K5VA 1UUPA 5JOBA 4AYBB 3C2PA 5I6YA 3VR6A 5KNDA 2D5DA 3GTGB 5E1FA 4ILWA 4CJ0B 2JEBI 3R3OA 3VA7A 2IJ0A 2PYKA 2L55A 2YYZA 2PZWA 1HXYD 2F03A 3DM1A 5FK9C 3WOFA 4G4KA 3GTPB 5FO9B 1DJRD 1A2UA 3H0GB 3NQTA 1YNNC 1Y1WB 5I2XA 4HCEA 4OO1H 1SAPA 4B08A 3P75A 4RCNA 3SDZA 3SEBA 1I6HB 2NZ1D 5KNBA 4XYOA 2F0UA 1PMRA 5CV8A 5C44B 1B1ZA 1EY8A 3NXWA 3JAME 2L1BA 3GTJB 3BDCA 1EEID 1IYUA 4ZKBB 1MBYA 5FKAC 2B39A 2H4OA 3P7JA 1EU3A 3J7YW 4X3TA 4RKLA 1J9OA 4QUCA 3SVMA 4CJ2C 5I9OA 4G7HC 4K6DA 5C5MA 2NVYB 1S5ED 1TWFB 3N6RA 1FD7D 3RD4A 5EBDA 5JEAH 1E2WA 2B2VA 3ND8A 1LO5D 4UAIA 3A54A 3M4OB 2EY1A 5HGTA 5C4HA 1RD9D 4BY7B 3S1RB 2EYPA 1QNKA 4DAYA 2DY8A 2WAQB 5CGKA 2RVLA 3I70A 3MC0B 1STNA 4DA2A 3CHBD 2D9UA 3NHHA 4A3GB 1VDZA 2KCCA 1SYBA 1PFMA 3BG3A 3NE5B 1V8QA 4A3JB 4OGQC 1Y8NB 1Q90A 1EQTA 1D5ZC 3AB9A 3F2UA 3TP5A 3MA2B 4A3MB 5DM63 3K0YA 1F2MA 5CV7A 4IFDI 3W3AA 2IWHA 3KLSX 1CA6A 3G7LA 5COYA 1JCKB 3GP7A 2BA0A 4I7ZC 4EVOA 5KIXA 3A8JE 2NN6G 2F0PA 2RDGA 4KY6A 4BWGB 4C3JG 4KI0A 4KJOA 1EY6A 2EYMA 1LTAD 4I65A 1I6VC 3D4RA 4MHEA 4P2CB 1W6JA 3BVGA 1SYGA 4RHRA 4HMIA 4HN7A 2K33A 2PZUA 4R8NA 2WV6D 4K5XA 3OOCA 4FXGC 1EWHA 2DN8A 2R6GA 2ZXRA 5ELFA 1ENFA 1TWGB 1JORA 1M8AA 1Y8OB 2AUKA 4BS9A 1EFID 5M5XB 2F0EA 3OW7A 1DCZA 5IGFA 4TRDA 3GTOB 1U4PA 1Z6HA 4EQOA 1HTPA 1KLGD 3M7GA 3IFTA 3J81E 4FF3A 2F1MA 3PMFA 3T53B 4ABNA 2KCNA 3TP7A 1S5FD 1AZQA 4L8JA 1DYQA 5K36G 1B50A 2PO4A 1LV9A 3ZYYX 3K5NA 2X6LA 1QNUA 3QOLA 1LT6D 1STEA 1E0BA 2IX0A 2F0DA 4JK1C 4IUVA 1CZGA 5KRUA 3V2TA 1LTTD 1PXUA 4E6IA 2M2LA 2K32A 3I72A 1IYVA 3A55A 2KOLA 1HFGA 1EEFD 4ID6A 1TY2A 4NDXA 4WORA 4FYDA 3BDOA 4X3SA 2QKIC 1LACA 1QWYA 2E2HB 3PIP3 3NUCA 5BN4A 2HDMA 1CTMA 4A3DB 1SEBD 3FPPA 5IT9L 2EPBA 3DEPA 5E4WC 4RGOS 5KYLA 3NTIA 2JSOA 4DF7A 4KD4A 2CW0D 3HGBA 2FHTA 4JBWA 4IN3A 2F0VA 3A8KE 5FLXL 2EYHA 1D5XC 1SSOA 2R92B 5CV5A 3H09A 1WTVA 2AQ3B 4IFDG 1H9SB 2PW7A 1MSHA 3PUVA 5EKLA 4RGNA 2L5TA 3TN2A 2JXMB 1ZEQX 4HSPA 4B9XA 1Q12A 1KDBA 3BVZA 1WTOA 1FGBD 3TDQA 1Z7TA 4TKOB 5I4DA 1JB3A 5LL6S 1STAA 3PUYA 4C2MB 5IIFA 2B2UC 1B44D 3K5OA 4QUFA 1BCPF 1HQMC 4QCLA 2A68C 1BR9A 1BCPB 3KLSA 5K5PA 3P20A 4K8JA 3J80L 2Z8LA 4YIJA 1NUCA 1EZ8A 3RLFA 3GTLB 1AZPA 4C3JB 3NTHA 5D14A 4KV6A 4C3HG 3N52A 3D4DA 1BCPD 1D5MC 2JA5B 4LJZC 4C56C 4ZQ3A 3KBXA 3SE0A 2CVRA 1K8MA 4Q0FA 4J1MA 3BZDB 1CM9A 1GJXA 2KHSA 3EVQA 3H3VC 3KBGA 2QILA 4CHTB 3D8GA 1JC7A 2F3VA 1MSGA 2K5DA 3OMCA 2F0HA 3I4MB 2MGSA 2SNSA 3I90A 1KABA 3C1FA 2LMCB 4HAEA 3IL8A 4HCSA 3PV0A 2Q8IB 4A3IB 2GA4B 1RODA 1F77A 2C9OA 3C46A 3QIAA 2KECA 4NP5A 3J7AV 3KUPA 3HZXA 4LAAA 2MPMA 3NP8A 4R8IA 5C3EB 3VR2A 5F2DA 3BYYB 3Q0AA 3E6ZX 4NKLA 3Q22A 2AQ1B 1QCBD 1EQVA 4FF1A 2AWNA 1W6KA 5C0XJ 1XYIA 2F0WA 2F4IA 2TSSA 4ZRZA 5JPMC 4K6LA 1VF7A 3OSOA 1LT5D 2K28A 4V0BA 1JWUD 2N55A 2SDFA 3M3YB 1KDAA 5KGUA 2NB0A 2ENBA 1IKMA 1ZXTA 2WKCA 1MD2D 3I8ZA 1H9RA 5EQ0A 2PZTA 3R2TA 5EKIA 1KLUD 3FMCA 1GHJA 1F9QA 1SNOA 4N9PA 3VR3A 4XQJA 3JAML 2R7ZB 1IW7C 3QWNA 5J39A 1PTOF 3QB3A 1U9RA 3GTMB 1AFPA 1PTOB 3S14B 1TS4A 2F0FA 3QOJA 4TSSA 5CMDA 3T4AC 2BCOA 4CKEA 3K5MA 2KVMA 1FNVA 2R3ZA 1O7LA 4KKTA 3Q24A 4IALA 3HS0C 1YNJD 2CQAA 3LWUA 2KEEA 1SJHD 3H94A 2EE1A 3TMEA 5DNFA 1V1PA 2EY5A 3C1EA 4DK0A 1BOSA 1BXTA 3QO2A 2E75C 1C8CA 2EYLA 1JOOA 3PUZA 3AMUA 2K01A 3NBIA 1DOLA 2WIIB 5IOCA 3NSWA 1JOQA 2WP8J 3R93A 1SNQA 5J22A 1ENAA 4A3FB 2J0TD 1SBBB 1GXDC 2NN6H 1GUWA 1T5EA 4C3HB 2D62A 5IODA 2EYFA 5M3MB 4FF4A 2QDBA 1LT4D 1PFBA 4FF2A 4FO2A 4QB4A 3OWFA 4H7BA 2SEBD 3D6CA 2WB1B 1SDFA 3S9WA 1GUTA 2LFNA 4OIJA 2IW3A 4TQUS 1X3QA 3BYTB 5EPLA 3CU7A 1QB5D 1OO9B 4CBVA 3K57A 4BBSB 4K2LA 1HPCA 3I4NB 2NTTA 4O1NA 2G9HD 3HRZC 2F3WA 2OEOA 3EQLC 2O4XA 2O5JC 2B2WC 4PMWA 2RSOA 1LTBD 3MXPA 3PUWA 4RA8A 1EIGA 3L9AX 3S17B 1GHKA 1HUNA 1XTCD 2KQ3A 2E2IB 2Z4HA 5K36H 1IW7D 2AWOA 2VUMB 1GUNA 1O7YA 4KJNA 1EOTA 1VMCA 1Z47A 2AUJD 3J81L 2MHVA 3HOZB 3KK7A 2JE6I 4H0LC 2CW0C 1I4HA 3I73A 1SE2A 5C3WA 1VMPA 1HA5A 3K58A 3DEOA 3MFGA 4RGMA 4DK1A 1CA5A 1XWEA 1NSNS 3FRPB 1PZID 3TP6A 1F9RA 3V05A 2H1EA 2NVTB 1ZYRD 5C0XI 3HKZB 3EROA 1BUVT 1DM0B 3M4YA 1OXUA 2NWGA 4PMBA 2Z4IA 1HRJA 4RAUC 5M5YB 3T51B 2Y0SB 1RJTA 1PTOH 2VB3X 3S1NB 5FOBB 1EWCA 4N9TA 2MP1A 4DXFA 4EQPA 4IFDH 5I6WA 4XYQA 1PDQA 2ID0A 2I46A 1DONA 4PQXA 4XT1B 1JWSD 1OXTA 3HP3A 1G2TA 4G57A 3CRKC 2FFKB 4PV1C 4BA2I 1BCPC 4WRDA 1NCVA 3H91A 5C5LA 2EY6A 1I4GA 1VCIA 1B4OA 3RZDB 4L6TB 1A3TA 1ILQA 4DU9A 4RKBA 5IGCA 5CV9A 1CZWA 2HQEA 3D6WA 2A6ED 2RDFA 2RBMA 4XQQA 1E2VA 2B2YC 1O7ZA 5DAUA 3K7AB 5C6AA 2N88A 5A2QE 4KN7C 1GUSA 4XT3B 1RTNA 3OMGA 3VR4A 5EGTA 4OL7A 1F2ZA 2BE5D 4LK1C 1H9JA 2B8FA 1LABA 2EDGA 1TIID 4KN4C 1A3UA 5AFWA 4HEDA 1I4XA 4H44C 1QILA 3HOWB 2QEJC 2KEDA 2RKSA 1JE4A 1F9SA 5EPKA 1RDPD 2IX3A 1EY9A 5BN5A 3OPOA 4A3KB 1PRTF 1SYDA 3M7NA 2M00A 1EY5A 2ICIA 1KNAA 1PRTB 3S1QB 5JEAJ 4J6HA 3HOUB 3HEJA 1HHVA 3UI2A 1LLRD 1WD0A 2JEAI 2K5WA 2OXPA 5JPNC 1SYEA 4KTAA 2C5CA 1FYCA 1BF4A 1MGSA 1PRTD 3HOVB 1ET6A 3S16B 5TSSA 2B2TC 2ZXPA 3RZOB 1SNPA 2ZXOA 1NR2A 1SMYC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OO9 B;  3L3O C;  3T4A C;  4FXG C;  2QKI C;  1XWE A;  2WII B;  2E2D C;  2A74 C;  2A73 B;  2ICE C;  3FRP B;  1UEA B;  5FO8 B;  5JPN C;  3HRZ C;  1PXU A;  3CKI B;  2XWB B;  2TMP A;  3I70 A;  1UAP A;  3MA2 B;  4FXK C;  2J0T D;  5FO9 B;  1BR9 A;  3KLS A;  2I07 B;  5FOB B;  1JC7 A;  1GXD C;  1D2B A;  2XWJ B;  4ILW A;  3OHX C;  1JB3 A;  5JPM C;  3HS0 C;  2WIN B;  2B39 A;  3V96 A;  3CU7 A;  1BQQ T;  5FO7 B;  1BUV T;  3G6J B; 
#chains in the Genus database with same CATH topology
 2PQA A;  3MAQ A;  4RFB A;  2E2I H;  5CBA E;  1WTW A;  2HCC A;  4IUT A;  2DY7 A;  2JA7 B;  4A93 B;  4PMC A;  4F7X A;  3OYY A;  3NEL A;  2BDO A;  3EA6 A;  2UUB Q;  4C1N K;  2F0N A;  2RQX A;  3WDN A;  4X66 L;  4G7Z C;  5C0X G;  2A19 A;  4UP9 A;  1PLF A;  2MNA A;  1A2T A;  3HOZ H;  3CC4 A;  1YJW A;  3DHQ A;  4X62 L;  5CR3 A;  4LF4 Q;  4OX9 Q;  3SK5 A;  1H95 A;  2CWP A;  4JI4 Q;  2KCM A;  3HOY B;  3O13 A;  1N32 Q;  4J8Q A;  2RHQ B;  4KLK A;  2I5L X;  3CQZ B;  4DV0 Q;  4A3B G;  3PO2 G;  1CHP D;  2X6G A;  3A5U A;  1J8I A;  1K0S A;  3MXU A;  5M5W B;  3K6O A;  1EYC A;  2A69 D;  3KLR A;  1J6Q A;  4OEL B;  1YNJ C;  1N33 Q;  2EJM A;  2L9H A;  2R7F A;  1OTC A;  4F87 A;  5EKK A;  3GQB A;  3GD7 A;  3A7L A;  4WFN 3;  1ESR A;  3BS1 A;  1BBW A;  4IOC A;  1PYS B;  3MXG A;  4GOP C;  4HMJ A;  5KNC A;  1N36 Q;  5CV6 A;  3SXH A;  1TS3 A;  1XXG A;  1QE6 A;  4HIM A;  3RN5 A;  2NVT H;  2B2T A;  1ILP A;  3K59 A;  2JA6 G;  3ICE A;  4KMU C;  1ET9 A;  4DV5 L;  2AHO B;  2E74 C;  1C7Y A;  1TWH B;  2B2U A;  1TWA B;  3LNN A;  2VNU D;  4JI7 L;  4BBS G;  3MZ5 A;  4FP5 D;  2VQE L;  5M5Y H;  5G3L F;  2NBF A;  1L0X B;  2XRQ D;  3F2D A;  1UE5 A;  2E5L L;  1G29 1;  4DFA A;  4YY3 Q;  2LKV A;  2K03 A;  3S1N H;  1A15 A;  5IY0 A;  2FIN B;  2ZTC A;  3SK6 A;  5JVG 3;  4U68 A;  2ZJQ A;  2UXC Q;  2J4X A;  2IL8 A;  4ZK9 B;  1STH A;  3VYR A;  2A6H D;  4UY8 C;  5JJK A;  1TT2 A;  1RKN A;  1C9O A;  1SR3 A;  1VQF A;  1PYW D;  2Z6K C;  1SNM A;  1II3 A;  5IYD H;  4GZY C;  3VYT A;  3J7Z C;  4CKC A;  1SE3 A;  1DZ1 A;  3DWA A;  1IBM L;  3KJP A;  3U50 C;  2BH8 A;  5E4X A;  2EJG C;  1O80 A;  1PH4 A;  2NUC A;  3D31 A;  1WCM G;  5G3L D;  1WVL A;  2VUM G;  2XIW A;  2K50 A;  3UDG A;  2YTV A;  2EZV A;  3FVQ A;  3OIQ A;  1GKH A;  1HA6 A;  4GOP A;  4DR1 Q;  2K5Q A;  4UDU C;  3V96 A;  4BY1 B;  3HOZ G;  2K05 A;  3RZD H;  3G6E A;  1VQO A;  1PFN A;  4A4I A;  1NMG A;  3FP9 A;  4DUY Q;  3PGZ A;  2LXK A;  1HQR D;  3PQI A;  2JP1 A;  5LHY 1;  3T13 A;  1EL0 A;  4L5Q A;  3Q6S A;  5I2Y A;  4DPG A;  3TQY A;  1W3S A;  1FGU A;  3K7A H;  1CI3 M;  2DUD A;  1M4V A;  1EIF A;  2LS0 1;  3VYU A;  2JA8 G;  2ZT9 C;  4KY5 A;  1IL8 A;  4K14 A;  1LTI D;  1R4P B;  3E5S A;  1LTS D;  2D0O A;  3G6J B;  3NK9 A;  5CC4 A;  3H15 A;  1SMY D;  4DR6 L;  1EY0 A;  2D2C C;  3A56 A;  3RMH A;  2FMM A;  2Q2U A;  1VQL A;  5IP7 H;  4ZKC B;  1UNS A;  3GTK B;  4LUZ A;  3ERQ A;  4KHZ A;  3QR8 A;  3LX0 A;  4DR5 L;  2L4N A;  2KA7 A;  2Z6K A;  2MQH A;  3HOW H;  5JAV A;  1EUJ A;  2PCF B;  3J80 i;  3HKZ G;  3CP0 A;  4JI6 L;  2J7Z A;  2WB1 E;  3NWT A;  3NQI A;  4P72 A;  5AJ3 L;  4A3K H;  4OO1 I;  1SXT A;  4IZ8 A;  4A75 A;  4LFC L;  3UE0 A;  4LF5 L;  3ULJ A;  2PNR C;  3FKI B;  3S1Q H;  1S5C D;  4L63 B;  1EFW A;  2V4D A;  4H13 C;  3HOU H;  4DR2 L;  4M8A A;  3F8T A;  3MXN A;  3T56 B;  5IP9 G;  2UUC L;  5EJW A;  3GO5 A;  1GUO A;  2VB2 X;  4DAV A;  4BA1 I;  2L0C A;  2UUB L;  1PTO D;  3BVM A;  3HKS A;  1NR4 A;  2F0M A;  2KJX A;  4DNR B;  1PZJ D;  4DXG A;  3G4S A;  4LF8 L;  3QG1 A;  4AIM A;  2WAQ E;  3CRL C;  4ZUI A;  3S2H B;  2ES2 A;  2BH2 A;  1NNX A;  3AFP A;  3M85 A;  1AP0 A;  4BBR G;  1OXX K;  2JQO A;  2LY7 A;  4IUU A;  4OHJ A;  1A6X A;  3HOV H;  3CC7 A;  1JIC A;  4K0K L;  1GUG A;  3K7U C;  4JI4 L;  3S16 H;  1AN8 A;  1I50 B;  2G5D A;  2I5M X;  3RZO H;  1FNW A;  5DLQ E;  3L2P A;  4OIK A;  2NVX B;  1ZYR C;  3X3M A;  4JW0 A;  1QJO A;  2Q2H A;  3W5O A;  5LMU Q;  5T1I A;  4HID A;  2RCF A;  1FJG Q;  1CHQ D;  1TVX A;  2B2V C;  2JA7 H;  4A93 H;  1B53 A;  4ODG A;  3S2D B;  4LF7 Q;  3DWQ A;  5NUC A;  2VQF Q;  1PZK D;  1IKL A;  2B63 G;  2XWB B;  4A3B B;  1RF2 D;  3PO2 B;  2K04 A;  4EQN A;  4LF6 L;  5LMN Q;  1EU4 A;  3MEH A;  3BZK A;  4G7O C;  2PNH A;  1JQY D;  4KKS A;  3HOY H;  1DOK A;  4ZYS A;  3CQZ H;  3C3L A;  1STG A;  2F0G A;  5CBE E;  1XNR L;  4IUP A;  3S15 B;  5M5W H;  4A3C G;  5IGE A;  2DNC A;  1RCV D;  1AW7 A;  3RN2 A;  3SK8 A;  2ZM6 Q;  4FVM A;  2B8G A;  4OWT B;  2F0K A;  4RG1 A;  1D2B A;  2XWJ B;  1QZH A;  3HOW G;  4GS3 A;  2JA6 B;  2PPB C;  4RGT A;  4B3M L;  1G51 A;  1KNE A;  1I4Q A;  2F0J A;  4ZUJ A;  4V19 0;  4ULL A;  1K3B C;  1VQB A;  3W2D A;  3A7A B;  5EBC A;  4HTH A;  3T16 A;  2O2L D;  3A5Z B;  4KK7 A;  3STB D;  3U9S A;  1UEA B;  5JVH 3;  5ISR A;  2F0I A;  1CQV A;  2PQE A;  1H9M A;  1L2F A;  2A6E C;  3FEW X;  1TWH H;  1WTQ A;  1Q8I A;  1HNX Q;  4DV1 Q;  1UE6 A;  4DV2 Q;  1TWA H;  3MFY A;  1K73 C;  5D3D A;  4IUQ A;  2IX1 A;  1EYA A;  5IWA L;  3PO3 G;  3GV3 A;  3J81 j;  1RTO A;  2FMC A;  3RUZ A;  1KTK A;  1V1P B;  2F0O A;  1DXM A;  3EJI A;  3PIO A;  3NBH A;  1XPU A;  3KYH C;  2O5I C;  4JI2 Q;  2Y0S E;  5J1Z A;  2RDH A;  4FXD A;  3JAM i;  2OQK A;  4QF4 A;  2X69 A;  2BE5 C;  2A73 B;  3J7A 5;  1R9T B;  2HD3 A;  4B3T L;  3DMU A;  1X3F A;  1I3Q B;  4LUV A;  4JBM A;  4DUY L;  1WCM B;  4HJ5 A;  1U4R A;  1EOV A;  2VXW A;  1PH5 A;  5ELE A;  3U9O A;  1V1O A;  2HUG A;  3DUZ A;  1OXV A;  1HNW Q;  1KHI A;  1LTL A;  1JR0 D;  3F2B A;  2R93 B;  1K83 B;  1B2T A;  4QJF A;  4U67 3;  1ENC A;  2JK8 A;  2PMZ B;  1VQ7 A;  2F4V Q;  3QJY A;  4KHV A;  3R8B A;  2XVS A;  3TZU A;  1SE4 A;  3UDF A;  3ULL A;  1B9N A;  1BBX C;  4XIG S;  4RH6 A;  1A3V A;  4K5W A;  3TP8 A;  4BY1 H;  4CJ1 B;  5M3F G;  2PI2 E;  3NEM A;  2DJF C;  3OHX C;  1WTP A;  2SNM A;  3Q23 A;  1EIH A;  2D0P A;  4EQ5 A;  2JYO A;  4OO1 G;  3HOX G;  1AEX A;  2VS1 A;  2JA8 B;  4K8I A;  5C4Z A;  5JJL A;  4XQN A;  1X65 A;  2B2W A;  4WJW A;  1E2Z A;  1CKN B;  5JJI A;  1JB7 A;  2KUM A;  5IGG A;  5LL6 X;  2Q8R E;  1GOZ A;  4YWK A;  5KYI A;  3CCJ A;  2BA1 A;  1EQQ A;  1L0Y B;  1PRT C;  4MN3 A;  3DLL A;  1X54 A;  3RLN A;  2PI2 A;  1IHZ A;  1NAP A;  5BN3 A;  5A2Q L;  2LXJ A;  1IBL L;  1BQQ T;  1HFN A;  4YHH L;  5ELC A;  1P16 A;  3T1H Q;  4A3E G;  2XRS D;  2BOS A;  3GTK H;  4YCU A;  5C4J B;  3HG9 A;  2MO1 A;  2SOB A;  4QIW B;  3NPP A;  4Q5V A;  2P5Z X;  3A74 A;  1PH9 A;  2HQL A;  3AQQ A;  1SND A;  5JEA G;  5I9P A;  4YCW A;  1YNN D;  3SK4 A;  1WD1 A;  3VA5 A;  4PNY A;  1U4L A;  4HJ9 A;  3MWY W;  1PH6 A;  1TR5 A;  4IPC A;  5IYB H;  2HIV A;  3FKI H;  1HZ9 A;  2XSC A;  1JOK A;  4ME5 A;  3P1H A;  3VR5 A;  2RA4 A;  1HR0 Q;  4HSV A;  4BBR B;  1K3R A;  4X65 L;  4LF7 L;  4R9W A;  4LFB Q;  1B9M A;  4DR7 L;  5C3X A;  3NTK A;  2A5H A;  2A69 C;  1XMO Q;  1MI2 A;  3S2H H;  1FNU A;  3H3V H;  3OTO Q;  1K0R A;  1VQA A;  2HDL A;  3BDL A;  4C3I G;  1KDC A;  1G2S A;  3H6M A;  1STY A;  1XMQ L;  1WTR A;  1I50 H;  4DAP A;  4X3U A;  1JWM D;  1EYD A;  2NVX H;  3IKJ A;  1Q3L A;  3UE1 A;  1TY0 A;  3PUX A;  2F0Q A;  2QW7 A;  3SHL A;  1Q1E A;  5C0X H;  1TU2 B;  3ITP A;  4X6A H;  3URY A;  2B63 B;  1MIU A;  4J15 A;  4ZLT F;  2V1C C;  1H9S A;  4QY7 A;  4ZCK A;  3S2D H;  4GLV B;  4P74 A;  1RHP A;  2EVB A;  1LTG D;  5IYC G;  4LMQ D;  4JYA Q;  4KD3 A;  4A3B H;  4X64 L;  3PO2 H;  2L12 A;  2F52 A;  1PVO A;  4DN4 M;  2EOT A;  1EZ6 A;  3BU2 A;  4IPG A;  1D1K A;  2K6A A;  3K5L A;  4QMG A;  1HCZ A;  4CGY B;  4A3L G;  2YU9 B;  1CK1 A;  2A6H C;  1S72 A;  1ML0 D;  1RIP A;  1A62 A;  1IBK Q;  1C48 A;  4DV1 L;  1DOM A;  5FO7 B;  3M9B A;  3S15 H;  4JV5 L;  2NTS A;  3D4W A;  4GNX B;  1Q8K A;  2NYZ D;  1UEB A;  2EJF C;  2ICE C;  3FPU B;  2EYO A;  2K1B A;  1UE1 A;  2JA6 H;  1Q1B A;  4O0A A;  3JC6 6;  4RCO A;  4JI1 L;  2XNA C;  1N9W A;  4F88 A;  1SYF A;  1BBU A;  1VQM A;  4RHS A;  1EY4 A;  1S5D D;  2ZTE A;  4IUR A;  3PO3 B;  1U4M A;  1PHJ A;  1G8Z D;  2N3S A;  3OWE B;  1KAA A;  1XPO A;  1FVI A;  2N78 A;  2Z1C A;  3LWE A;  2A1A A;  1XPR A;  3OIP A;  5ELD A;  1IYJ B;  1QOH A;  2B2Y A;  4B3R Q;  1YHB A;  3EN2 A;  1JJG A;  2TMP A;  1SJE D;  1X3P A;  3K8A A;  4P71 A;  5D3I B;  5C4X G;  1Y69 U;  2WFW A;  1CT1 D;  4C1N I;  5FLM G;  2H5X A;  1N8R C;  1F9P A;  1ZKO A;  4APV A;  4S3S A;  5M9O A;  3MHB A;  1R9T H;  1CKM A;  5DEH A;  1CFM A;  1SLJ A;  4K2K A;  4AYB G;  1I3Q H;  5IGB A;  5JJZ A;  1WCM H;  4EX5 A;  2VUM H;  3NWS A;  1HNZ L;  4POF A;  3MVV A;  1C0A A;  3GTQ B;  4MTN A;  3EFX D;  5FJ8 G;  3I4L A;  3KF8 A;  1TWC B;  1WTX A;  2F0T A;  2R93 H;  1K83 H;  4ZAI A;  1VS0 A;  5M3F B;  1C4Q A;  2MJ8 A;  1VQ9 A;  4IUN A;  4X3K A;  3SR1 A;  5COR A;  4F8M A;  1S4Z A;  1J5E L;  2K14 A;  3HOX B;  2ZTD A;  1G6P A;  2QF7 A;  1MJC A;  2JA9 A;  5L37 A;  4DUZ L;  4M1U B;  2F3I A;  3CCM A;  4CKB A;  3H0G G;  4RWS C;  4NW2 A;  4KKU A;  2I07 B;  3ONA B;  1HUM A;  5CV4 A;  3E0J A;  3GV6 A;  1LT3 D;  4DV7 Q;  1WI5 A;  1ESF A;  2JA8 H;  1PTO C;  2RF4 A;  1TQO A;  5EPJ A;  4CDE C;  2G9D A;  3E9H A;  3CMA A;  3R2I A;  3J7A F;  5IT9 E;  1Y1V B;  4A3E B;  2ALY B;  1FR3 A;  2HCI A;  4PZ6 A;  2EY2 A;  3CKI B;  1B3A A;  3DWP A;  1PFS A;  3X3N A;  2QGQ A;  2UXB Q;  4HR7 B;  1HTL D;  1TKW B;  2RSN A;  5IGD A;  3S1M B;  4KHP Q;  4GKJ L;  4JI3 Q;  4OXP A;  1HR0 L;  4MIU A;  4IQZ A;  5FLX E;  1F2L A;  2WIN B;  1KXL A;  5C4J H;  4JI0 L;  1R4Q B;  2OT2 A;  5GAG C;  3I3C A;  2M9V A;  3AU7 A;  3TBI B;  5ELB A;  2NVQ B;  2N49 A;  1XMO L;  5D65 A;  2PQA B;  4XTC S;  5GQO A;  1AE2 A;  4R1J A;  1XNQ L;  5HUR A;  2F0S A;  2DNE A;  2F0L A;  1XX8 A;  1LTR D;  5IP9 H;  2BDN A;  3FDT A;  3L7Z C;  4GN5 A;  4Y7N B;  1G91 A;  4B9W A;  1TS2 A;  3I91 A;  4DV6 Q;  5CYU A;  2R61 A;  5BR8 Q;  4IFD J;  1IXR A;  1T5X D;  2E2J B;  4R4C A;  2CHB D;  4BY7 G;  1FL0 A;  4BBR H;  2WAQ G;  2EYJ A;  4C3I B;  2A74 C;  3WOE A;  2AQ2 B;  4NXN Q;  2IPK D;  2IT1 A;  1UAP A;  4FXK C;  4IPH A;  3TSS A;  5KEE A;  4A3G G;  4XXE A;  1Z9F A;  4IPD A;  4LWC A;  4KY7 A;  1D1I A;  2R93 G;  4LF9 Q;  4HJ8 A;  4LFA L;  3J80 E;  2MUY A;  3VYS A;  1K9M C;  1MKH A;  3DXJ C;  4OEM B;  1Y8P B;  1F2Y A;  3STB C;  2E2D C;  4P73 A;  4A3M G;  2K7V A;  3ND9 A;  2HHH L;  2B63 H;  4DNT B;  2CWA A;  1ICW A;  1STB A;  4IJH A;  1EY7 A;  4DGZ A;  1SFO B;  4FNF A;  2E76 C;  3TZD A;  2WKD A;  3CCQ A;  1YBY A;  1SNC A;  4HIO A;  4AQY L;  4JBK A;  1BNZ A;  1D6E C;  4LW1 A;  1ONL A;  4OWX B;  3L3O C;  1SMX A;  1S5B D;  4EGV A;  4NMZ A;  2XN9 C;  5A35 A;  3KF6 A;  2WAC A;  4XDX A;  4A3C H;  2PW5 A;  2YTX A;  3L0O A;  4Z9C B;  1DD2 A;  1I4R A;  2YU9 H;  4N8X 1;  3IFD A;  4IOA A;  1I94 Q;  4DV3 L;  1O78 A;  3ERS X;  3A8I E;  2QCP X;  5T1G A;  5DM7 3;  4O42 A;  1CQF A;  3D3R A;  2UU9 L;  2IHF A;  1VF5 C;  2VZA A;  1SN8 A;  3F1Z A;  1OXS C;  1QG7 A;  1I4P A;  4GLX A;  3PCO B;  1EYG A;  1K8O A;  2UXD Q;  1V43 A;  3MTS A;  3PIO 3;  1S3O A;  1WJJ A;  5FO8 B;  1JJC B;  5EAY A;  1TS5 A;  1H9K A;  2A68 D;  2FJ2 A;  3IAY A;  1VQ5 A;  1SYC A;  4JOI C;  1BO0 A;  3PO3 H;  1G6Z A;  2EXZ A;  1KRT A;  5C4X B;  2NN6 I;  1X32 A;  2OF1 A;  4DR4 Q;  2Q8T A;  2L11 A;  1E1O A;  4GOP B;  1BDO A;  5E3F A;  4DV4 Q;  1YIT A;  1ASZ A;  3I56 A;  4K5V A;  1BKB A;  1UUP A;  4LF4 L;  1UE7 A;  5JOB A;  4AYB B;  4OX9 L;  3C2P A;  5I6Y A;  3VR6 A;  5KND A;  2D5D A;  1YVC A;  3GTG B;  5E1F A;  1N32 L;  4Y52 H;  5HY6 A;  4ILW A;  4DV0 L;  4CJ0 B;  3T1Y Q;  2JEB I;  3R3O A;  3VA7 A;  2IJ0 A;  2PYK A;  1A8V A;  1ASY A;  2L55 A;  1VQ4 A;  2YYZ A;  3CCU A;  1DGS A;  3GTQ H;  2OTJ A;  1N33 L;  2PZW A;  1HXY D;  2F03 A;  3DM1 A;  1TWC H;  5FK9 C;  3WOF A;  4B3S Q;  4G4K A;  3GTP B;  1SE8 A;  5FO9 B;  1DJR D;  1PH8 A;  1A2U A;  5M3F H;  3H0G B;  3NQT A;  1N36 L;  1WTH A;  1YNN C;  1Y1W B;  3RNU A;  5IE8 A;  5I2X A;  4HCE A;  3HOX H;  4OO1 H;  1SAP A;  4B08 A;  3P75 A;  4RCN A;  3SDZ A;  2YV5 A;  3SEB A;  1I6H B;  2NZ1 D;  4UP8 A;  5KNB A;  4XYO A;  2F0U A;  1HJP A;  1PMR A;  4JOI A;  3CME A;  5CV8 A;  5C44 B;  1B1Z A;  1W2B A;  1EY8 A;  3D0F A;  3NXW A;  3JAM E;  2L1B A;  3OW2 A;  3BDC A;  3GTJ B;  4OWW B;  1EEI D;  1IYU A;  4GKK Q;  4ZKB B;  1MBY A;  5FKA C;  4YY3 L;  4N8F A;  1CSP A;  2B39 A;  3MXN B;  1VQC A;  3SGI A;  2H4O A;  4A3E H;  3P7J A;  4YWM A;  2UXC L;  1EU3 A;  1MJE A;  3J7Y W;  3PF4 A;  4X3T A;  4RKL A;  3TS2 A;  1J9O A;  4QUC A;  2RHS B;  4DNI A;  3SVM A;  1KIX A;  3AFQ A;  4CJ2 C;  5I9O A;  3HKZ E;  4K6D A;  4G7H C;  2LSS A;  2NVY B;  1S5E D;  1TWF B;  3CPF A;  5C5M A;  3N6R A;  5GAE C;  4A3D G;  1FD7 D;  3RD4 A;  5EBD A;  5JEA H;  1E2W A;  2B2V A;  2R7D A;  4GN3 B;  2NVQ H;  3ND8 A;  1LO5 D;  4UAI A;  4UHV A;  3A54 A;  3M4O B;  4QIW E;  2EY1 A;  1B70 B;  5HGT A;  5C4H A;  1VQI A;  1RD9 D;  4BY7 B;  4DR1 L;  3RR5 A;  3S1R B;  2EYP A;  1QNK A;  4LF9 L;  4DAY A;  1QUQ A;  2DY8 A;  2WAQ B;  4Y7N H;  1LM0 A;  5CGK A;  2JN4 A;  2RVL A;  3I70 A;  2MFI A;  3MC0 B;  1STN A;  4DA2 A;  3CHB D;  2R92 G;  2D9U A;  2I5H A;  1X3E A;  3NHH A;  2E2J H;  4A3G B;  1X9N A;  1VDZ A;  2KCC A;  1SYB A;  3I55 A;  1PFM A;  3BG3 A;  4C3I H;  3NE5 B;  1V8Q A;  4A3J B;  1JJ2 A;  4JI8 Q;  1X55 A;  4OGQ C;  1Y8N B;  2RCN A;  4L5T A;  1Q90 A;  3CAM A;  3I7F A;  1EQT A;  1Q82 C;  1D5Z C;  3AB9 A;  3F2U A;  3PF5 A;  4MNO A;  1WYD A;  1HZC A;  3TP5 A;  3MA2 B;  4A3M B;  2OQ0 A;  5DM6 3;  2L15 A;  4BXX G;  3K0Y A;  1F2M A;  5CV7 A;  5IYC H;  1N34 Q;  3W1G A;  4IFD I;  3W3A A;  2IWH A;  3KLS X;  1CA6 A;  3G7L A;  5COY A;  4WJ4 A;  1SFO H;  1L1O C;  1JCK B;  3GP7 A;  2BA0 A;  1SRO A;  4I7Z C;  1VQD A;  2AKW B;  4A3L H;  4NXM Q;  4EVO A;  5KIX A;  3A8J E;  2NN6 G;  2A8V A;  2F0P A;  3W1B A;  2RDG A;  2MO0 A;  4KY6 A;  4BWG B;  1Y1V G;  4C3J G;  4KI0 A;  4X66 Q;  4UPA A;  4KJO A;  3NBH B;  1EQR A;  1EY6 A;  2EYM A;  1LTA D;  4I65 A;  4X62 Q;  1I6V C;  3D4R A;  4MHE A;  4P2C B;  1W6J A;  2JA5 G;  3BVG A;  1SYG A;  4RHR A;  4HMI A;  4HN7 A;  1XJV A;  2K33 A;  2PZU A;  4R8N A;  2WV6 D;  4K5X A;  3OOC A;  4FXG C;  1EWH A;  2DN8 A;  2R6G A;  2ZXR A;  5ELF A;  1ENF A;  1TWG B;  1JOR A;  1M8A A;  1Y8O B;  1U0L A;  1VQN A;  2AUK A;  4BS9 A;  1EFI D;  5LMU L;  2F0E A;  4R4O A;  5M5X B;  1VQ6 A;  3OW7 A;  1FJG L;  1DCZ A;  5IGF A;  2CKZ B;  1D8L A;  4TRD A;  5C4X H;  3GTO B;  3I4M G;  1U4P A;  2VY3 A;  5FLM H;  4CDD C;  1B3Q A;  1NY4 A;  1Z6H A;  2VQF L;  4EQO A;  1HTP A;  1KLG D;  4CDC C;  1L1O A;  3M7G A;  3IFT A;  3J81 E;  4A3I G;  4FF3 A;  2HT1 A;  2F1M A;  5LMN L;  4DV5 Q;  3PMF A;  2AMC B;  3T53 B;  3HFZ B;  4TVA B;  4ABN A;  2NZH A;  1LYL A;  2KCN A;  3GTG H;  3TP7 A;  1S5F D;  1AZQ A;  4L8J A;  1DYQ A;  4JI7 Q;  1V9P A;  5K36 G;  1B50 A;  2PO4 A;  2VQE Q;  1LV9 A;  5FJ8 H;  3ZYY X;  5ELN A;  3K5N A;  2X6L A;  5C3E G;  1QNU A;  3QOL A;  2E5L Q;  2OTL A;  1LT6 D;  1STE A;  4P75 A;  1E0B A;  3K0X A;  2IX0 A;  2CQO A;  2F0D A;  4JK1 C;  4R4Q A;  4IUV A;  2ZM6 L;  1CZG A;  5KRU A;  4RMF A;  2ASB A;  3GTP H;  1HZA A;  3V2T A;  1LTT D;  1PXU A;  3TRE A;  3H0G H;  4E6I A;  2M2L A;  2K32 A;  4QQB X;  3I72 A;  1Y1W H;  1IYV A;  3A55 A;  2KOL A;  1HFG A;  1EEF D;  1SRU A;  1IBM Q;  1I6H H;  3E9I A;  1E22 A;  1HNX L;  4ID6 A;  1TY2 A;  4NDX A;  4WOR A;  4DV2 L;  4FYD A;  3BDO A;  5C44 H;  4X3S A;  1VQP A;  2QKI C;  1LAC A;  3GTJ H;  1QWY A;  2E2H B;  3PIP 3;  4JI2 L;  3NUC A;  5BN4 A;  2YTY A;  1ICF B;  2HDM A;  1A63 A;  1CTM A;  4A3D B;  1SEB D;  3G71 A;  3FPP A;  4L5S A;  5IT9 L;  2QDL A;  2EPB A;  2K75 A;  3DEP A;  5E4W C;  2R7Z G;  4RGO S;  5KYL A;  1B8A A;  1BVS A;  2NVY H;  1TWF H;  3NTI A;  5LMN W;  2JSO A;  1HNW L;  4DF7 A;  3CF5 A;  4KD4 A;  2CW0 D;  3HGB A;  2FHT A;  4JBW A;  4JI8 L;  4IN3 A;  3IRB A;  2F0V A;  4PG3 A;  3A8K E;  4DR6 Q;  5FLX L;  2F4V L;  3M4O H;  1CSQ A;  1WFQ A;  4JI5 Q;  2EYH A;  1D5X C;  1XTD A;  1SSO A;  2R92 B;  3KDF A;  5CV5 A;  3H09 A;  1WTV A;  2AQ3 B;  4BY7 H;  4IFD G;  3S1R H;  1H9S B;  2PW7 A;  4DR5 Q;  1MSH A;  3PUV A;  1GVP A;  5EKL A;  4RGN A;  2L5T A;  2K4K A;  3CPW A;  2CFM A;  3TN2 A;  2JXM B;  1ZEQ X;  1N34 L;  4A3G H;  4HSP A;  3DM3 A;  4B9X A;  1Q12 A;  5AJ3 Q;  1KDB A;  1YZ6 A;  3BVZ A;  1WTO A;  1FGB D;  3TDQ A;  1Z7T A;  4TKO B;  5I4D A;  4LFC Q;  1JB3 A;  5LL6 S;  1Y14 B;  1STA A;  3U4V A;  4LF5 Q;  1PH3 A;  4NXM L;  4DR2 Q;  3PUY A;  4C2M B;  5IIF A;  2B2U C;  1B44 D;  3CCS A;  4A3M H;  3K5O A;  4QUF A;  2UUC Q;  1AE3 A;  1BCP F;  1S40 A;  1HQM C;  4QCL A;  2A68 C;  3T1H L;  1T9H A;  4POG A;  1BR9 A;  4LF8 Q;  1BCP B;  1WOC A;  3KLS A;  4JVZ A;  1Y1W G;  5K5P A;  3P20 A;  5H1S E;  4GLA C;  4K8J A;  3TRZ A;  3J80 L;  2Z8L A;  2DJG C;  4YIJ A;  4LUO A;  1NUC A;  1EZ8 A;  4K0K Q;  3MEF A;  3RLF A;  3GTL B;  5C44 G;  2NZO A;  1AZP A;  4C3J B;  4A3F G;  3NTH A;  5D14 A;  4KV6 A;  3M4Q A;  4C3H G;  1YHA A;  3N52 A;  1PYB A;  3D4D A;  5M3M G;  1BCP D;  1D5M C;  2JA5 B;  4LJZ C;  4C56 C;  4ZQ3 A;  2XGT A;  2Q2T A;  3KBX A;  2EXD A;  3SE0 A;  2CVR A;  2WB1 G;  4LFB L;  1K8M A;  3KDF B;  4Q0F A;  4LF6 Q;  4J1M A;  3BZD B;  1CM9 A;  1GJX A;  2KHS A;  3PIP A;  3EVQ A;  3H3V C;  3KBG A;  3E0E A;  3OTO L;  2QIL A;  1VQG A;  4CHT B;  1HH2 P;  3D8G A;  1PH2 A;  1JC7 A;  2F3V A;  1MSG A;  1XNR Q;  2K5D A;  3OMC A;  2F0H A;  1QVG A;  3I4M B;  2MGS A;  2SNS A;  4JBJ A;  3I90 A;  1TWG H;  3KF8 B;  1KAB A;  3I4N G;  3C1F A;  2LMC B;  4HAE A;  3IL8 A;  5M5X H;  4HCS A;  3PV0 A;  2Q8I B;  1Q7Y C;  4A3I B;  2IHE A;  3GTO H;  2GA4 B;  4B3M Q;  1ROD A;  1F77 A;  2C9O A;  1YI2 A;  3C46 A;  4A76 A;  3QIA A;  2KEC A;  3TEH B;  4JYA L;  4NP5 A;  3J7A V;  3KUP A;  3HZX A;  1CKO A;  4LAA A;  2MPM A;  3NP8 A;  4R8I A;  4A3J G;  5C3E B;  3WWV A;  4AYB E;  1JT8 A;  3M4P A;  3EBE A;  5F2D A;  3BYY B;  3VR2 A;  3Q0A A;  1U5K A;  3E6Z X;  4NKL A;  3Q22 A;  2AQ1 B;  1QCB D;  5IWA Q;  4QGU A;  1EQV A;  1IBK L;  1V1Q A;  3ULP A;  1E24 A;  1M90 C;  4FF1 A;  2AWN A;  1W6K A;  4HIK A;  1E1T A;  5C0X J;  1XYI A;  2F0W A;  2F4I A;  3UDX A;  4I7A A;  2TSS A;  5IT9 c;  4ZRZ A;  5JPM C;  1Q81 C;  3ER0 A;  1KAW A;  4K6L A;  1VF7 A;  4B3T Q;  3OSO A;  4DK6 C;  1HR0 W;  1LT5 D;  2K28 A;  4V0B A;  4YCV A;  3CC2 A;  2GVA A;  1JWU D;  5FLX c;  2N55 A;  2SDF A;  3M3Y B;  4R4I A;  1KDA A;  5J3B A;  4DK3 C;  5KGU A;  3BZC A;  2NB0 A;  4B3R L;  1KQS A;  2ENB A;  1IKM A;  1ZXT A;  2WKC A;  1MD2 D;  3I8Z A;  1NJI C;  1H9R A;  5EQ0 A;  2PZT A;  2E2H H;  3R2T A;  4HJ7 A;  5EKI A;  4JI5 L;  1KLU D;  3FMC A;  1GHJ A;  1F9Q A;  1SNO A;  3U58 A;  4N9P A;  3VR3 A;  4XQJ A;  3JAM L;  2R7Z B;  4OON A;  1IW7 C;  1MHW C;  3QWN A;  5J39 A;  1PTO F;  3QB3 A;  1U9R A;  1YEZ A;  2FXQ A;  4A3D H;  2ATW A;  3GTM B;  4JC0 A;  1PH1 A;  1E7Z A;  1AFP A;  1PTO B;  3S14 B;  1TS4 A;  2F0F A;  3QOJ A;  4MZ9 A;  4TSS A;  5CMD A;  4DR3 Q;  3T4A C;  1UWV A;  2BCO A;  2B29 A;  2I0Q A;  1VQ8 A;  4CKE A;  4JG2 A;  2OWO A;  2Y0S G;  2KHJ A;  4UP7 A;  3AYH B;  3K5M A;  1M1K C;  2KVM A;  2Z9H A;  3AEV A;  1FNV A;  2R3Z A;  1A0I A;  1IBL Q;  1O7L A;  3J80 c;  1EWI A;  4KKT A;  4YHH Q;  2KEN A;  2R92 H;  3Q24 A;  2ZJR A;  4IAL A;  1VQE A;  3Q8D A;  3HS0 C;  1YNJ D;  2VW9 A;  5IYD G;  2CQA A;  4DV7 L;  3LWU A;  2KEE A;  1SJH D;  3H94 A;  2EE1 A;  3KF6 B;  3TME A;  3CCV A;  4BXX H;  5DNF A;  1V1P A;  1TXY A;  2EY5 A;  4JPB W;  3C1E A;  2JJQ A;  4C2M H;  4DK0 A;  1BOS A;  5GAD C;  1QZG A;  1BXT A;  2PMZ E;  3QO2 A;  4IJL A;  2E75 C;  3FHW A;  2UXB L;  1C8C A;  2EYL A;  1JOO A;  3PUZ A;  3AMU A;  4X65 Q;  2K01 A;  4KHP L;  3LGJ A;  4JI3 L;  3NBI A;  4DR7 Q;  1DOL A;  2WII B;  5IOC A;  3NSW A;  3CCR A;  1JOQ A;  2Z0S A;  2WP8 J;  1VQK A;  3R93 A;  1SNQ A;  5J22 A;  1ENA A;  4A3F B;  2J0T D;  1GM5 A;  1SBB B;  1GXD C;  2NN6 H;  3E3X A;  1GUW A;  1T5E A;  4C3H B;  1XMQ Q;  1QVC A;  2D62 A;  5IOD A;  2UUA Q;  1X3G A;  2EYF A;  3GTL H;  1P8L A;  5M3M B;  2CCZ A;  4FF4 A;  2QDB A;  1Q46 A;  1Y1V H;  4C3J H;  1LT4 D;  1PFB A;  4FF2 A;  4FO2 A;  4QB4 A;  3OWF A;  4H7B A;  2SEB D;  2QA4 A;  3D6C A;  2WB1 B;  1SDF A;  3S9W A;  5IP7 G;  4DV6 L;  5BR8 L;  1GUT A;  3S1M H;  2JA5 H;  2B3G A;  2LFN A;  4OIJ A;  2IW3 A;  2K5V A;  4TQU S;  1X3Q A;  3BYT B;  2E8G A;  5EPL A;  3KFU A;  4WJ3 M;  4X64 Q;  2K5N A;  2EQS A;  2N8N A;  3CU7 A;  4NXN L;  1QB5 D;  3UDI A;  3KOJ A;  1OO9 B;  3U4Z A;  4CBV A;  3CXC A;  3K57 A;  1CKN A;  4BBS B;  4A3K G;  4K2L A;  1HPC A;  3I4N B;  1EIY B;  2NTT A;  3K80 C;  1LUZ A;  4O1N A;  2G9H D;  3HRZ C;  2QEX A;  2F3W A;  2OEO A;  3EQL C;  2O4X A;  2O5J C;  3I4M H;  3HOU G;  1NBW A;  3VDY A;  2B2W C;  4JV5 Q;  4PMW A;  2K5H A;  2RSO A;  3CD6 A;  4DAM A;  1LTB D;  1B7Y B;  3MXP A;  3PUW A;  1E3P A;  4RA8 A;  4A3I H;  1EIG A;  3L9A X;  1JE5 A;  4JI1 Q;  3S17 B;  1GHK A;  3F2C A;  1HUN A;  3K81 C;  1XTC D;  2KQ3 A;  2E2I B;  2Z4H A;  5K36 H;  5ELO A;  3HOV G;  1IW7 D;  3CCE A;  1KL9 A;  2AWO A;  2VUM B;  5C3E H;  1GUN A;  1O7Y A;  4KJN A;  1EOT A;  1HZB A;  1VMC A;  1Z47 A;  1X56 A;  2GVB A;  2AUJ D;  3J81 L;  4LNQ A;  1I94 L;  3JAM c;  2MHV A;  3HOZ B;  1PA6 A;  3KK7 A;  2JA7 G;  4A93 G;  4GNX C;  3TS0 A;  4QL5 A;  2JE6 I;  2K52 A;  4H0L C;  5E7N A;  2CW0 C;  1I4H A;  2UXD L;  2GN5 A;  3I73 A;  1SE2 A;  5C3W A;  1NE3 A;  1VMP A;  3I2Z A;  1HA5 A;  3K58 A;  3HOY G;  4PZ7 A;  1HNZ Q;  3KJO A;  3DEO A;  3MFG A;  4RGM A;  3H3V I;  1YIJ A;  4DK1 A;  1CA5 A;  1XWE A;  2KHI A;  4JCV E;  1NSN S;  1VQH A;  3FRP B;  1NMF A;  3M3Y H;  4DR4 L;  4R4T A;  4DR3 L;  2HIX A;  1PZI D;  3TP6 A;  1IZ6 A;  5HGQ A;  1F9R A;  3V05 A;  2H1E A;  4DV4 L;  4DAY B;  1QUQ B;  2Z6B A;  1YJ9 A;  1J5E Q;  2NVT B;  1ZYR D;  5C0X I;  3HKZ B;  3ERO A;  4DUZ Q;  1BUV T;  1DM0 B;  2R7Z H;  3M4Y A;  4ME3 A;  1OXU A;  2NWG A;  2XTI A;  3KLW A;  4PMB A;  2Z4I A;  3T1Y L;  3EIV A;  1HRJ A;  4RAU C;  5M5Y B;  3T51 B;  1K8G A;  3GTM H;  2CH4 W;  2Y0S B;  1RJT A;  1PTO H;  3S14 H;  1AH9 A;  2VB3 X;  1CUK A;  3CW2 C;  3S1N B;  5FOB B;  1EWC A;  4N9T A;  2MP1 A;  4DXF A;  4EQP A;  1GO3 E;  4GNX A;  3NEN A;  4CDF C;  4B3S L;  1KD1 C;  4IFD H;  1PV4 A;  5I6W A;  4XYQ A;  1PDQ A;  2ID0 A;  2I46 A;  4YWL A;  1DON A;  2OCE A;  1IL2 A;  4GKJ Q;  5GAH C;  4PQX A;  4XT1 B;  2Q2I A;  4L5R C;  1JWS D;  3CCL A;  1OXT A;  3HP3 A;  1K28 A;  4HJA A;  3PSI A;  4MTK A;  4JI0 Q;  2CH4 A;  1G2T A;  4G57 A;  4AH6 A;  3CRK C;  2FFK B;  4PV1 C;  4BA2 I;  1BCP C;  4WRD A;  1NCV A;  3H91 A;  5C5L A;  1Q86 C;  2EY6 A;  1YJN A;  4IO9 A;  1I4G A;  1VCI A;  1XNQ Q;  2C35 B;  4GKK L;  2UUA L;  1B4O A;  3RZD B;  4L6T B;  1A3T A;  3A0J A;  1ILQ A;  5GRO A;  4DU9 A;  4RKB A;  5IGC A;  2IY5 B;  2ZJP A;  5CV9 A;  1CZW A;  2HQE A;  3D6W A;  2A6E D;  2RDF A;  1K8A C;  2RBM A;  4XQQ A;  1E2V A;  1X6O A;  3GDE A;  2KCT A;  2B2Y C;  4BY1 G;  1O7Z A;  5DAU A;  4O2D A;  1YHQ A;  3K7A B;  5C6A A;  2N88 A;  4GN4 B;  5A2Q E;  4PZ8 A;  4KN7 C;  1GUS A;  4XT3 B;  1RTN A;  3OMG A;  1KC8 C;  2VL6 A;  3VR4 A;  3B6Y A;  2DGY A;  4A3F H;  5EGT A;  4OL7 A;  1F2Z A;  2BE5 D;  4LK1 C;  1H9J A;  4C3H H;  2B8F A;  1PH7 A;  1LAB A;  4LFA Q;  4H02 A;  2EDG A;  5M3M H;  3J81 i;  1RL2 A;  1TII D;  4KN4 C;  1A3U A;  1QVF A;  5AFW A;  4HED A;  1I4X A;  4H44 C;  1QIL A;  3HOW B;  2QEJ C;  2HHH Q;  3BJU A;  2KED A;  2RKS A;  4FDB A;  3G48 A;  1JE4 A;  1F9S A;  5EPK A;  1RDP D;  1KRS A;  2IX3 A;  1L1O B;  1EY9 A;  5BN5 A;  4AQY Q;  2KBN A;  3OPO A;  4A3K B;  1PRT F;  1SYD A;  3M7N A;  2M00 A;  1EY5 A;  1O7I A;  3J81 c;  2ICI A;  1NTG A;  1KNA A;  4NB3 A;  1GD7 A;  1PRT B;  3S1Q B;  1L0W A;  5JEA J;  4J6H A;  3HOU B;  3HEJ A;  1HHV A;  4BBS H;  4ALP A;  3UI2 A;  1LLR D;  1YNX A;  3I4N H;  1WD0 A;  2JEA I;  2K5W A;  4DKA C;  1I5F A;  3S24 A;  5IYB G;  4NPS A;  2OXP A;  3FKI G;  4DV3 Q;  5JPN C;  1SYE A;  4KTA A;  4JI6 Q;  3ZJY C;  2C5C A;  2UU9 Q;  3RLO A;  1FYC A;  1BF4 A;  1D7Q A;  1MGS A;  1JMC A;  2EIF A;  1PRT D;  3HOV B;  1ET6 A;  3S16 B;  3I4O A;  5TSS A;  4A3J H;  2B2T C;  1VQJ A;  2ZXP A;  3RZO B;  1SNP A;  3S17 H;  2ZXO A;  1NR2 A;  1SMY C; 
#chains in the Genus database with same CATH homology
 3MAQ A;  4RFB A;  5CBA E;  1WTW A;  2HCC A;  4IUT A;  2DY7 A;  2JA7 B;  4A93 B;  4PMC A;  4F7X A;  2BDO A;  3EA6 A;  4C1N K;  2F0N A;  2RQX A;  3WDN A;  4G7Z C;  5C0X G;  1PLF A;  1A2T A;  3DHQ A;  5CR3 A;  3SK5 A;  3HOY B;  3O13 A;  4J8Q A;  3CQZ B;  1CHP D;  2X6G A;  1J8I A;  3MXU A;  5M5W B;  3K6O A;  1EYC A;  2A69 D;  3KLR A;  1YNJ C;  2EJM A;  2L9H A;  4F87 A;  5EKK A;  3GQB A;  3GD7 A;  3A7L A;  4WFN 3;  1ESR A;  3BS1 A;  3MXG A;  4HMJ A;  5KNC A;  5CV6 A;  3SXH A;  1TS3 A;  1XXG A;  1QE6 A;  2B2T A;  1ILP A;  3K59 A;  4KMU C;  1ET9 A;  2E74 C;  1TWH B;  2B2U A;  1TWA B;  3LNN A;  2VNU D;  3MZ5 A;  4FP5 D;  5G3L F;  2NBF A;  1L0X B;  2XRQ D;  1G29 1;  4DFA A;  2LKV A;  2K03 A;  1A15 A;  2FIN B;  3SK6 A;  5JVG 3;  4U68 A;  2J4X A;  2IL8 A;  4ZK9 B;  1STH A;  3VYR A;  2A6H D;  1TT2 A;  1RKN A;  1PYW D;  1SNM A;  1II3 A;  4GZY C;  3VYT A;  4CKC A;  1SE3 A;  1DZ1 A;  3DWA A;  5E4X A;  2EJG C;  1O80 A;  2NUC A;  3D31 A;  5G3L D;  1WVL A;  2XIW A;  2EZV A;  3FVQ A;  3OIQ A;  1HA6 A;  2K5Q A;  4UDU C;  3V96 A;  4BY1 B;  2K05 A;  1PFN A;  1HQR D;  2JP1 A;  5LHY 1;  3T13 A;  1EL0 A;  3Q6S A;  5I2Y A;  1CI3 M;  1M4V A;  2LS0 1;  3VYU A;  2ZT9 C;  4KY5 A;  1IL8 A;  4K14 A;  1LTI D;  1R4P B;  3E5S A;  5CC4 A;  1LTS D;  3G6J B;  3NK9 A;  1SMY D;  1EY0 A;  2D2C C;  3A56 A;  3RMH A;  2FMM A;  4ZKC B;  1UNS A;  3GTK B;  3ERQ A;  4KHZ A;  3LX0 A;  2L4N A;  2KA7 A;  5JAV A;  2PCF B;  2J7Z A;  3NWT A;  3NQI A;  4OO1 I;  1SXT A;  4IZ8 A;  2PNR C;  3FKI B;  1S5C D;  4L63 B;  2V4D A;  4H13 C;  4M8A A;  3T56 B;  3MXN A;  5EJW A;  3GO5 A;  1GUO A;  2VB2 X;  4DAV A;  4BA1 I;  2L0C A;  1PTO D;  3BVM A;  1NR4 A;  2F0M A;  2KJX A;  4DNR B;  1PZJ D;  4DXG A;  3QG1 A;  3CRL C;  4ZUI A;  3S2H B;  3M85 A;  1AP0 A;  1OXX K;  2LY7 A;  4IUU A;  4OHJ A;  1A6X A;  1JIC A;  1GUG A;  1AN8 A;  1I50 B;  1FNW A;  2NVX B;  4OIK A;  1ZYR C;  3X3M A;  1QJO A;  5T1I A;  1CHQ D;  1TVX A;  2B2V C;  3S2D B;  1B53 A;  4ODG A;  3DWQ A;  5NUC A;  1PZK D;  1IKL A;  2XWB B;  4A3B B;  1RF2 D;  3PO2 B;  2K04 A;  4EQN A;  1EU4 A;  3MEH A;  4G7O C;  1JQY D;  4KKS A;  1DOK A;  4ZYS A;  3C3L A;  1STG A;  2F0G A;  5CBE E;  4IUP A;  3S15 B;  5IGE A;  2DNC A;  1RCV D;  1AW7 A;  3SK8 A;  4FVM A;  2B8G A;  2F0K A;  1D2B A;  2XWJ B;  2JA6 B;  2PPB C;  4RGT A;  1I4Q A;  1KNE A;  4ZUJ A;  2F0J A;  4V19 0;  4ULL A;  3W2D A;  3A7A B;  5EBC A;  4HTH A;  3T16 A;  2O2L D;  4KK7 A;  3U9S A;  1UEA B;  5JVH 3;  5ISR A;  2F0I A;  1CQV A;  2PQE A;  1H9M A;  2A6E C;  3FEW X;  1WTQ A;  1Q8I A;  3MFY A;  5D3D A;  4IUQ A;  2IX1 A;  1EYA A;  3GV3 A;  1RTO A;  2FMC A;  3RUZ A;  1KTK A;  1V1P B;  2F0O A;  1DXM A;  3EJI A;  3NBH A;  2O5I C;  5J1Z A;  2RDH A;  4FXD A;  4QF4 A;  2X69 A;  2BE5 C;  2A73 B;  1R9T B;  3DMU A;  1I3Q B;  1WCM B;  1U4R A;  2VXW A;  5ELE A;  3U9O A;  1V1O A;  2HUG A;  3DUZ A;  1OXV A;  1JR0 D;  2R93 B;  1K83 B;  1B2T A;  4U67 3;  1ENC A;  2PMZ B;  3QJY A;  4KHV A;  3R8B A;  2XVS A;  3TZU A;  1SE4 A;  1B9N A;  1BBX C;  4XIG S;  4RH6 A;  1A3V A;  4K5W A;  3TP8 A;  4CJ1 B;  3OHX C;  1WTP A;  2SNM A;  3Q23 A;  1EIH A;  2JYO A;  4OO1 G;  1AEX A;  2JA8 B;  4K8I A;  5C4Z A;  4XQN A;  2B2W A;  4WJW A;  1E2Z A;  2KUM A;  5IGG A;  5LL6 X;  2Q8R E;  1GOZ A;  5KYI A;  2BA1 A;  1L0Y B;  1PRT C;  4MN3 A;  1IHZ A;  1NAP A;  5BN3 A;  5A2Q L;  1BQQ T;  1HFN A;  5ELC A;  2XRS D;  2BOS A;  5C4J B;  3HG9 A;  2SOB A;  4QIW B;  3NPP A;  4Q5V A;  1SND A;  5JEA G;  5I9P A;  3SK4 A;  1YNN D;  1WD1 A;  3VA5 A;  4PNY A;  1U4L A;  3MWY W;  1TR5 A;  2XSC A;  1JOK A;  4ME5 A;  3P1H A;  3VR5 A;  2RA4 A;  4HSV A;  4BBR B;  4R9W A;  1B9M A;  5C3X A;  3NTK A;  2A5H A;  2A69 C;  1MI2 A;  1FNU A;  2HDL A;  3BDL A;  4C3I G;  1KDC A;  1G2S A;  3H6M A;  1STY A;  1WTR A;  4DAP A;  4X3U A;  1JWM D;  1EYD A;  3IKJ A;  1Q3L A;  1TY0 A;  3PUX A;  2F0Q A;  3SHL A;  1Q1E A;  5C0X H;  1TU2 B;  3ITP A;  3URY A;  2B63 B;  4ZLT F;  1H9S A;  1RHP A;  2EVB A;  1LTG D;  4LMQ D;  4KD3 A;  2L12 A;  4DN4 M;  2EOT A;  1EZ6 A;  1D1K A;  2K6A A;  3K5L A;  4QMG A;  1HCZ A;  4CGY B;  2YU9 B;  1CK1 A;  2A6H C;  1ML0 D;  1C48 A;  1DOM A;  5FO7 B;  2NTS A;  3D4W A;  2NYZ D;  2EJF C;  2ICE C;  3FPU B;  2EYO A;  2K1B A;  1Q1B A;  4RCO A;  2XNA C;  4F88 A;  1SYF A;  4RHS A;  1EY4 A;  1S5D D;  4IUR A;  3PO3 B;  1U4M A;  1G8Z D;  3OWE B;  1KAA A;  2Z1C A;  3LWE A;  3OIP A;  5ELD A;  1QOH A;  2B2Y A;  2TMP A;  1SJE D;  1X3P A;  5D3I B;  1Y69 U;  1CT1 D;  4C1N I;  1F9P A;  1ZKO A;  4S3S A;  5M9O A;  3MHB A;  5DEH A;  1CFM A;  4K2K A;  5IGB A;  5JJZ A;  3NWS A;  3MVV A;  3GTQ B;  3EFX D;  3I4L A;  3KF8 A;  1TWC B;  1WTX A;  2F0T A;  4ZAI A;  5M3F B;  1C4Q A;  2MJ8 A;  4IUN A;  4X3K A;  3SR1 A;  5COR A;  4F8M A;  1S4Z A;  3HOX B;  2QF7 A;  4M1U B;  4CKB A;  4RWS C;  4NW2 A;  4KKU A;  2I07 B;  3ONA B;  1HUM A;  5CV4 A;  3E0J A;  3GV6 A;  1LT3 D;  1ESF A;  1PTO C;  1TQO A;  5EPJ A;  2G9D A;  3R2I A;  3J7A F;  5IT9 E;  1Y1V B;  4A3E B;  1FR3 A;  2HCI A;  2EY2 A;  3CKI B;  1B3A A;  3DWP A;  3X3N A;  4HR7 B;  1HTL D;  1TKW B;  2RSN A;  5IGD A;  3S1M B;  4MIU A;  4IQZ A;  5FLX E;  1F2L A;  2WIN B;  1R4Q B;  2OT2 A;  3I3C A;  2M9V A;  3AU7 A;  3TBI B;  5ELB A;  2NVQ B;  5D65 A;  4XTC S;  5HUR A;  2F0S A;  2DNE A;  2F0L A;  1XX8 A;  1LTR D;  2BDN A;  3FDT A;  3L7Z C;  4Y7N B;  1G91 A;  4B9W A;  1TS2 A;  3I91 A;  5CYU A;  2R61 A;  4IFD J;  1T5X D;  2E2J B;  2CHB D;  2EYJ A;  4C3I B;  2A74 C;  3WOE A;  2AQ2 B;  2IPK D;  2IT1 A;  1UAP A;  4FXK C;  3TSS A;  5KEE A;  4XXE A;  4KY7 A;  1D1I A;  3J80 E;  2MUY A;  3VYS A;  3DXJ C;  1Y8P B;  1F2Y A;  2E2D C;  2K7V A;  3ND9 A;  4DNT B;  1ICW A;  1STB A;  1EY7 A;  4DGZ A;  1SFO B;  4FNF A;  2E76 C;  3TZD A;  2WKD A;  1SNC A;  1BNZ A;  1D6E C;  1ONL A;  3L3O C;  1S5B D;  4EGV A;  4NMZ A;  2XN9 C;  5A35 A;  2WAC A;  4XDX A;  2PW5 A;  4Z9C B;  1DD2 A;  1I4R A;  3IFD A;  1O78 A;  3A8I E;  2QCP X;  5T1G A;  5DM7 3;  4O42 A;  1CQF A;  3D3R A;  1VF5 C;  1OXS C;  1QG7 A;  1I4P A;  1K8O A;  1V43 A;  3MTS A;  3PIO 3;  5FO8 B;  1TS5 A;  1H9K A;  2A68 D;  2FJ2 A;  3IAY A;  1SYC A;  1BO0 A;  1G6Z A;  2EXZ A;  5C4X B;  2NN6 I;  1X32 A;  2OF1 A;  2Q8T A;  2L11 A;  5E3F A;  1BDO A;  4K5V A;  1UUP A;  5JOB A;  4AYB B;  3C2P A;  5I6Y A;  3VR6 A;  5KND A;  2D5D A;  3GTG B;  5E1F A;  4ILW A;  4CJ0 B;  2JEB I;  3R3O A;  3VA7 A;  2IJ0 A;  2PYK A;  2L55 A;  2YYZ A;  2PZW A;  1HXY D;  2F03 A;  3DM1 A;  5FK9 C;  3WOF A;  4G4K A;  3GTP B;  5FO9 B;  1DJR D;  1A2U A;  3H0G B;  3NQT A;  1YNN C;  1Y1W B;  5I2X A;  4HCE A;  4OO1 H;  1SAP A;  4B08 A;  3P75 A;  4RCN A;  3SDZ A;  3SEB A;  1I6H B;  2NZ1 D;  5KNB A;  4XYO A;  2F0U A;  1PMR A;  5CV8 A;  5C44 B;  1B1Z A;  1EY8 A;  3NXW A;  3JAM E;  2L1B A;  3GTJ B;  3BDC A;  1EEI D;  1IYU A;  4ZKB B;  1MBY A;  5FKA C;  2B39 A;  2H4O A;  3P7J A;  1EU3 A;  3J7Y W;  4X3T A;  4RKL A;  1J9O A;  4QUC A;  3SVM A;  4CJ2 C;  5I9O A;  4G7H C;  4K6D A;  5C5M A;  2NVY B;  1S5E D;  1TWF B;  3N6R A;  1FD7 D;  3RD4 A;  5EBD A;  5JEA H;  1E2W A;  2B2V A;  3ND8 A;  1LO5 D;  4UAI A;  3A54 A;  3M4O B;  2EY1 A;  5HGT A;  5C4H A;  1RD9 D;  4BY7 B;  3S1R B;  2EYP A;  1QNK A;  4DAY A;  2DY8 A;  2WAQ B;  5CGK A;  2RVL A;  3I70 A;  3MC0 B;  1STN A;  4DA2 A;  3CHB D;  2D9U A;  3NHH A;  4A3G B;  1VDZ A;  2KCC A;  1SYB A;  1PFM A;  3BG3 A;  3NE5 B;  1V8Q A;  4A3J B;  4OGQ C;  1Y8N B;  1Q90 A;  1EQT A;  1D5Z C;  3AB9 A;  3F2U A;  3TP5 A;  3MA2 B;  4A3M B;  5DM6 3;  3K0Y A;  1F2M A;  5CV7 A;  4IFD I;  3W3A A;  2IWH A;  3KLS X;  1CA6 A;  3G7L A;  5COY A;  1JCK B;  3GP7 A;  2BA0 A;  4I7Z C;  4EVO A;  5KIX A;  3A8J E;  2NN6 G;  2F0P A;  2RDG A;  4KY6 A;  4BWG B;  4C3J G;  4KI0 A;  4KJO A;  1EY6 A;  2EYM A;  1LTA D;  4I65 A;  1I6V C;  3D4R A;  4MHE A;  4P2C B;  1W6J A;  3BVG A;  1SYG A;  4RHR A;  4HMI A;  4HN7 A;  2K33 A;  2PZU A;  4R8N A;  2WV6 D;  4K5X A;  3OOC A;  4FXG C;  1EWH A;  2DN8 A;  2R6G A;  2ZXR A;  5ELF A;  1ENF A;  1TWG B;  1JOR A;  1M8A A;  1Y8O B;  2AUK A;  4BS9 A;  1EFI D;  5M5X B;  2F0E A;  3OW7 A;  1DCZ A;  5IGF A;  4TRD A;  3GTO B;  1U4P A;  1Z6H A;  4EQO A;  1HTP A;  1KLG D;  3M7G A;  3IFT A;  3J81 E;  4FF3 A;  2F1M A;  3PMF A;  3T53 B;  4ABN A;  2KCN A;  3TP7 A;  1S5F D;  1AZQ A;  4L8J A;  1DYQ A;  5K36 G;  1B50 A;  2PO4 A;  1LV9 A;  3ZYY X;  3K5N A;  2X6L A;  1QNU A;  3QOL A;  1LT6 D;  1STE A;  1E0B A;  2IX0 A;  2F0D A;  4JK1 C;  4IUV A;  1CZG A;  5KRU A;  3V2T A;  1LTT D;  1PXU A;  4E6I A;  2M2L A;  2K32 A;  3I72 A;  1IYV A;  3A55 A;  2KOL A;  1HFG A;  1EEF D;  4ID6 A;  1TY2 A;  4NDX A;  4WOR A;  4FYD A;  3BDO A;  4X3S A;  2QKI C;  1LAC A;  1QWY A;  2E2H B;  3PIP 3;  3NUC A;  5BN4 A;  2HDM A;  1CTM A;  4A3D B;  1SEB D;  3FPP A;  5IT9 L;  2EPB A;  3DEP A;  5E4W C;  4RGO S;  5KYL A;  3NTI A;  2JSO A;  4DF7 A;  4KD4 A;  2CW0 D;  3HGB A;  2FHT A;  4JBW A;  4IN3 A;  2F0V A;  3A8K E;  5FLX L;  2EYH A;  1D5X C;  1SSO A;  2R92 B;  5CV5 A;  3H09 A;  1WTV A;  2AQ3 B;  4IFD G;  1H9S B;  2PW7 A;  1MSH A;  3PUV A;  5EKL A;  4RGN A;  2L5T A;  3TN2 A;  2JXM B;  1ZEQ X;  4HSP A;  4B9X A;  1Q12 A;  1KDB A;  3BVZ A;  1WTO A;  1FGB D;  3TDQ A;  1Z7T A;  4TKO B;  5I4D A;  1JB3 A;  5LL6 S;  1STA A;  3PUY A;  4C2M B;  5IIF A;  2B2U C;  1B44 D;  3K5O A;  4QUF A;  1BCP F;  1HQM C;  4QCL A;  2A68 C;  1BR9 A;  1BCP B;  3KLS A;  5K5P A;  3P20 A;  4K8J A;  3J80 L;  2Z8L A;  4YIJ A;  1NUC A;  1EZ8 A;  3RLF A;  3GTL B;  1AZP A;  4C3J B;  3NTH A;  5D14 A;  4KV6 A;  4C3H G;  3N52 A;  3D4D A;  1BCP D;  1D5M C;  2JA5 B;  4LJZ C;  4C56 C;  4ZQ3 A;  3KBX A;  3SE0 A;  2CVR A;  1K8M A;  4Q0F A;  4J1M A;  3BZD B;  1CM9 A;  1GJX A;  2KHS A;  3EVQ A;  3H3V C;  3KBG A;  2QIL A;  4CHT B;  3D8G A;  1JC7 A;  2F3V A;  1MSG A;  2K5D A;  3OMC A;  2F0H A;  3I4M B;  2MGS A;  2SNS A;  3I90 A;  1KAB A;  3C1F A;  2LMC B;  4HAE A;  3IL8 A;  4HCS A;  3PV0 A;  2Q8I B;  4A3I B;  2GA4 B;  1ROD A;  1F77 A;  2C9O A;  3C46 A;  3QIA A;  2KEC A;  4NP5 A;  3J7A V;  3KUP A;  3HZX A;  4LAA A;  2MPM A;  3NP8 A;  4R8I A;  5C3E B;  3VR2 A;  5F2D A;  3BYY B;  3Q0A A;  3E6Z X;  4NKL A;  3Q22 A;  2AQ1 B;  1QCB D;  1EQV A;  4FF1 A;  2AWN A;  1W6K A;  5C0X J;  1XYI A;  2F0W A;  2F4I A;  2TSS A;  4ZRZ A;  5JPM C;  4K6L A;  1VF7 A;  3OSO A;  1LT5 D;  2K28 A;  4V0B A;  1JWU D;  2N55 A;  2SDF A;  3M3Y B;  1KDA A;  5KGU A;  2NB0 A;  2ENB A;  1IKM A;  1ZXT A;  2WKC A;  1MD2 D;  3I8Z A;  1H9R A;  5EQ0 A;  2PZT A;  3R2T A;  5EKI A;  1KLU D;  3FMC A;  1GHJ A;  1F9Q A;  1SNO A;  4N9P A;  3VR3 A;  4XQJ A;  3JAM L;  2R7Z B;  1IW7 C;  3QWN A;  5J39 A;  1PTO F;  3QB3 A;  1U9R A;  3GTM B;  1AFP A;  1PTO B;  3S14 B;  1TS4 A;  2F0F A;  3QOJ A;  4TSS A;  5CMD A;  3T4A C;  2BCO A;  4CKE A;  3K5M A;  2KVM A;  1FNV A;  2R3Z A;  1O7L A;  4KKT A;  3Q24 A;  4IAL A;  3HS0 C;  1YNJ D;  2CQA A;  3LWU A;  2KEE A;  1SJH D;  3H94 A;  2EE1 A;  3TME A;  5DNF A;  1V1P A;  2EY5 A;  3C1E A;  4DK0 A;  1BOS A;  1BXT A;  3QO2 A;  2E75 C;  1C8C A;  2EYL A;  1JOO A;  3PUZ A;  3AMU A;  2K01 A;  3NBI A;  1DOL A;  2WII B;  5IOC A;  3NSW A;  1JOQ A;  2WP8 J;  3R93 A;  1SNQ A;  5J22 A;  1ENA A;  4A3F B;  2J0T D;  1SBB B;  1GXD C;  2NN6 H;  1GUW A;  1T5E A;  4C3H B;  2D62 A;  5IOD A;  2EYF A;  5M3M B;  4FF4 A;  2QDB A;  1LT4 D;  1PFB A;  4FF2 A;  4FO2 A;  4QB4 A;  3OWF A;  4H7B A;  2SEB D;  3D6C A;  2WB1 B;  1SDF A;  3S9W A;  1GUT A;  2LFN A;  4OIJ A;  2IW3 A;  4TQU S;  1X3Q A;  3BYT B;  5EPL A;  3CU7 A;  1QB5 D;  1OO9 B;  4CBV A;  3K57 A;  4BBS B;  4K2L A;  1HPC A;  3I4N B;  2NTT A;  4O1N A;  2G9H D;  3HRZ C;  2F3W A;  2OEO A;  3EQL C;  2O4X A;  2O5J C;  2B2W C;  4PMW A;  2RSO A;  1LTB D;  3MXP A;  3PUW A;  4RA8 A;  1EIG A;  3L9A X;  3S17 B;  1GHK A;  1HUN A;  1XTC D;  2KQ3 A;  2E2I B;  2Z4H A;  5K36 H;  1IW7 D;  2AWO A;  2VUM B;  1GUN A;  1O7Y A;  4KJN A;  1EOT A;  1VMC A;  1Z47 A;  2AUJ D;  3J81 L;  2MHV A;  3HOZ B;  3KK7 A;  2JE6 I;  4H0L C;  2CW0 C;  1I4H A;  3I73 A;  1SE2 A;  5C3W A;  1VMP A;  1HA5 A;  3K58 A;  3DEO A;  3MFG A;  4RGM A;  4DK1 A;  1CA5 A;  1XWE A;  1NSN S;  3FRP B;  1PZI D;  3TP6 A;  1F9R A;  3V05 A;  2H1E A;  2NVT B;  1ZYR D;  5C0X I;  3HKZ B;  3ERO A;  1BUV T;  1DM0 B;  3M4Y A;  1OXU A;  2NWG A;  4PMB A;  2Z4I A;  1HRJ A;  4RAU C;  5M5Y B;  3T51 B;  2Y0S B;  1RJT A;  1PTO H;  2VB3 X;  3S1N B;  5FOB B;  1EWC A;  4N9T A;  2MP1 A;  4DXF A;  4EQP A;  4IFD H;  5I6W A;  4XYQ A;  1PDQ A;  2ID0 A;  2I46 A;  1DON A;  4PQX A;  4XT1 B;  1JWS D;  1OXT A;  3HP3 A;  1G2T A;  4G57 A;  3CRK C;  2FFK B;  4PV1 C;  4BA2 I;  1BCP C;  4WRD A;  1NCV A;  3H91 A;  5C5L A;  2EY6 A;  1I4G A;  1VCI A;  1B4O A;  3RZD B;  4L6T B;  1A3T A;  1ILQ A;  4DU9 A;  4RKB A;  5IGC A;  5CV9 A;  1CZW A;  2HQE A;  3D6W A;  2A6E D;  2RDF A;  2RBM A;  4XQQ A;  1E2V A;  2B2Y C;  1O7Z A;  5DAU A;  3K7A B;  5C6A A;  2N88 A;  5A2Q E;  4KN7 C;  1GUS A;  4XT3 B;  1RTN A;  3OMG A;  3VR4 A;  5EGT A;  4OL7 A;  1F2Z A;  2BE5 D;  4LK1 C;  1H9J A;  2B8F A;  1LAB A;  2EDG A;  1TII D;  4KN4 C;  1A3U A;  5AFW A;  4HED A;  1I4X A;  4H44 C;  1QIL A;  3HOW B;  2QEJ C;  2KED A;  2RKS A;  1JE4 A;  1F9S A;  5EPK A;  1RDP D;  2IX3 A;  1EY9 A;  5BN5 A;  3OPO A;  4A3K B;  1PRT F;  1SYD A;  3M7N A;  2M00 A;  1EY5 A;  2ICI A;  1KNA A;  1PRT B;  3S1Q B;  5JEA J;  4J6H A;  3HOU B;  3HEJ A;  1HHV A;  3UI2 A;  1LLR D;  1WD0 A;  2JEA I;  2K5W A;  2OXP A;  5JPN C;  1SYE A;  4KTA A;  2C5C A;  1FYC A;  1BF4 A;  1MGS A;  1PRT D;  3HOV B;  1ET6 A;  3S16 B;  5TSS A;  2B2T C;  2ZXP A;  3RZO B;  1SNP A;  2ZXO A;  1NR2 A;  1SMY C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...