1XWEA

Nmr structure of c345c (ntr) domain of c5 of complement
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
151
structure length
151
Chain Sequence
b'GSHMADCGQMQEELDLTISAETRKQTACKPEIAYAYKVSITSITVENVFVKYKATLLDIYKTGEAVAEKDSEITFIKKVTCTNAELVKGRQYLIMGKEALQIKYNASFRYIYPLDSLTWIEYWPRDTTCSSCQAFLANLDEFAEDIFLNGC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Complement C5
publication title Functional Insights from the Structure of the Multifunctional C345C Domain of C5 of Complement
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 14
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 2004-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01759 NTR UNC-6/NTR/C345C module
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1xweA01
1UEAB 5FO7B 2A73B 1BUVT 1BR9A 3MA2B 1UAPA 3T4AC 3KLSA 3OHXC 5FO8B 3HRZC 3V96A 2QKIC 2TMPA 2E2DC 2J0TD 2XWJB 1OO9B 4FXKC 2WIIB 2I07B 3CU7A 1JB3A 4FXGC 1PXUA 3HS0C 4ILWA 2XWBB 1D2BA 3FRPB 1GXDC 3CKIB 1BQQT 3G6JB 5JPNC 2A74C 3L3OC 5FO9B 2ICEC 2WINB 2B39A 3I70A 1XWEA 5JPMC 1JC7A 5FOBB
chains in the Genus database with same CATH superfamily
5KNBA 1MIUA 3GTGB 1FR3A 3N52A 4JC0A 1EOVA 4A3BB 5I4DA 2OTJA 1C8CA 5ISRA 4HSVA 2A68D 3EA6A 1A2UA 3MXNA 2PW5A 3E9IA 4JYAL 1BQQT 2NZOA 2A74C 1TQOA 4EVOA 2BOSA 2Z0SA 1KQSA 1X65A 3EJIA 5IGBA 2H4OA 2K05A 5C3EH 1GJXA 1BBXC 4I7ZC 2F0KA 4G7ZC 2B8FA 5M5WH 1SAPA 1EQQA 1SMYC 1JB7A 3S1MB 2EYFA 3BZKA 1N32L 4QY7A 4BBSG 2E75C 3R2IA 4CDCC 1GHJA 5COYA 3RN2A 3DWPA 1VQLA 2D0OA 5JJIA 1RHPA 2WKDA 1W2BA 2TSSA 1NUCA 2F0DA 2G9DA 2J7ZA 3A8IE 5A2QE 1FD7D 5LMUL 3GTMH 2YTYA 3M4YA 4LF7Q 1PTOF 3O13A 1ILQA 2E74C 4V190 1T5XD 4A3CG 3CCEA 1CK1A 4A3FG 1XTCD 3FVQA 3SK6A 4DUYQ 3I70A 1DM0B 4POGA 3TP6A 4PG3A 2F0UA 1KRTA 5IOCA 1BR9A 3AB9A 1IBLQ 1I4HA 3SR1A 1YZ6A 4KY6A 3TP7A 1PZKD 1N9WA 3E3XA 1VQ7A 3U50C 3RZOB 4BY7B 3GTOB 2NZHA 1PXUA 3I7FA 3S2DB 4K2LA 2UXCL 1CTMA 1JJCB 1A0IA 2UXDL 2RHSB 1KAWA 3S14H 4B9XA 3U4ZA 2QF7A 3EN2A 5CV8A 4CKEA 2EPBA 1SROA 1E2ZA 2NVYH 2LY7A 1YBYA 1BCPD 2Y0SG 4A3EB 2VXWA 3TP8A 4E6IA 2B2UC 1G91A 4P72A 5IGFA 4X65Q 2VNUD 2PNRC 4PZ7A 5EJWA 3HOWB 4CGYB 1DONA 4BBSH 1ET9A 4CJ0B 3M7GA 2XWBB 2QA4A 4XYOA 3OTOQ 4JG2A 2ZXRA 1ENCA 3KLWA 2O4XA 3D0FA 4FNFA 1ENFA 3TQYA 1J5EL 2B2TA 4N8FA 1AH9A 3TSSA 1T9HA 4R4QA 5BR8L 4DV5L 4WORA 4DR1Q 1MI2A 2NTSA 2J0TD 1X6OA 1H9KA 2OXPA 4A3CH 4B3ML 1BCPB 4QIWB 4A3FH 4H13C 2FJ2A 1EY9A 1EWHA 1QUQB 1XWEA 3PUYA 2JP1A 2JA9A 3DHQA 4NW2A 2E5LL 2LKVA 3ULJA 4M1UB 3D6WA 3PIO3 5I2XA 5JVH3 5I9PA 1KNAA 3TREA 1Y1WB 4L5RC 3AFQA 1L0WA 2YTXA 4DGZA 4TRDA 3HKZE 5JAVA 4KHVA 4K5XA 1ASYA 4X3KA 3PIOA 1G6ZA 4A93H 1DYQA 1HZ9A 1PH5A 4JYAQ 3FRPB 2K7VA 2IW3A 1BBWA 3LWEA 4KY5A 4G7OC 4FF3A 2WFWA 4X3SA 4B9WA 3GTKH 5E4WC 2WKCA 2E2HH 3VR2A 3M9BA 4LFBL 4OWTB 1DOMA 1C48A 1LYLA 3PUZA 1EL0A 1TIID 3K5OA 1I4QA 1PA6A 1SXTA 1N32Q 1PRTF 2VS1A 2EYLA 2L9HA 1LACA 4AYBG 2GVBA 4KKTA 2NB0A 1WI5A 4KD4A 4Y7NH 4RFBA 1I4PA 1H9JA 2WV6D 4KJOA 1NCVA 4LF9L 3NELA 1BO0A 3JAMc 4ZCKA 1X54A 2NVQH 3OMCA 1FJGL 1LT4D 3HKZB 3RLOA 3PO3G 3CCJA 1L1OC 4DV4L 1KNEA 2Z4HA 2DJGC 5C6AA 2ID0A 1TWGH 2GA4B 3K0XA 1N36L 3GD7A 2F0FA 2G5DA 4ZUIA 3HOYB 3BYTB 3CCQA 4RKLA 1SRUA 4IOCA 2EY5A 1DZ1A 2MPMA 1NBWA 3SK4A 2D62A 3GTGH 3NTHA 1Q1BA 3TEHB 1R9TB 5D3DA 1EYCA 2R93B 3S1NB 1V1OA 3H94A 5M3FB 3TRZA 1S5CD 1X3EA 4BY7G 5FLXL 2OCEA 1CM9A 1JT8A 4GZYC 2E2JB 2UXCQ 3G4SA 1VMCA 3TS2A 2UXDQ 1Q3LA 3UDXA 3VR5A 5M5XB 1D5ZC 5IODA 3JAMi 5DEHA 3KBXA 4MIUA 2YU9B 2K6AA 4NXNL 2EE1A 2KVMA 1HCZA 1HZCA 4HMJA 3HG9A 5EGTA 2ZXPA 4IO9A 3IFTA 3L2PA 1W3SA 4HIMA 1HA6A 3PF5A 4MHEA 3BG3A 5ELOA 4GNXA 3HOWG 3S1MH 2PCFB 2SNSA 1B50A 3A7LA 1OO9B 3PSIA 3CU7A 1MSGA 1PH9A 4OXPA 2UXBL 4JI4Q 3NE5B 2IPKD 1QNKA 1YNNC 2VQFL 4YWLA 3BVMA 4IUQA 3ZYYX 2J4XA 4DR3L 1BUVT 3C3LA 1G2TA 1J5EQ 2DNCA 2RCFA 3T51B 3NHHA 4C3HB 3UE1A 5JJLA 5BR8Q 4DV5Q 3PO3H 5IYBG 3IKJA 3LX0A 1AZQA 1EFWA 2PQAB 4B3MQ 4DV1L 1KAAA 2NVXH 1EUJA 1STNA 2CQAA 3I73A 2E5LQ 3HFZB 3NBHA 1KDBA 2MFIA 1ET6A 3I4MG 2I46A 4G4KA 4FDBA 1S4ZA 4B08A 3BVGA 4IOAA 1Y1WG 3GQBA 3GDEA 1TWFB 3EFXD 3CMEA 1RJTA 1NJIC 3A5ZB 1Y8OB 4ME3A 4C2MH 1QB5D 2F3WA 2XSCA 3RZOH 4BY7H 1KHIA 4EQNA 4UY8C 5D14A 2F3IA 2A6EC 1STGA 2AMCB 2LXJA 4H7BA 4ILWA 3S2DH 2BH8A 1MHWC 1SJHD 3L0OA 3CC7A 1D1IA 2IT1A 3D31A 1PH7A 5E7NA 5FOBB 2RDFA 1R4PB 1KDCA 4A3GG 5KYLA 4LFBQ 2F0TA 1X55A 2F0WA 1F77A 2KJXA 4JVZA 1EYAA 4PV1C 3F2UA 3HOWH 4IPDA 2JN4A 3CF5A 4R9WA 2B8GA 4F87A 2YV5A 1NY4A 5IYCG 2F1MA 3J7AV 1PH8A 3M3YB 4HCEA 4NB3A 5FO9B 2A6HD 3MXPA 2IHFA 4LUVA 2OQ0A 5C5MA 3PIP3 4LF9Q 5HY6A 5C3WA 1B44D 2EZVA 1SFOH 4BBRB 4WJ4A 3CCVA 5EQ0A 1FJGQ 2KHIA 4WFN3 4Y52H 2PI2A 3MEHA 4FF4A 3K57A 5IYBH 3PIPA 4DV4Q 1HTPA 3HOZB 2E2DC 4XTCS 4TVAB 1N36Q 2AKWB 3HEJA 4A4IA 3W2DA 1VQJA 3HOYG 4CDEC 1YHBA 2H5XA 2BDOA 4OWWB 1FGBD 4QJFA 2N3SA 4RHSA 1TS3A 1AP0A 1KABA 1MJCA 1K28A 4JI3L 1I4XA 1VF7A 3G71A 1F9SA 3I4MH 1H9SB 5D65A 3MZ5A 1AE2A 4QUCA 3PUWA 4X64L 1S5DD 1A62A 1Y1WH 1XYIA 1GUWA 3QO2A 2CFMA 3S17B 2K52A 3TN2A 3E6ZX 3M4PA 4FXKC 4HN7A 1DXMA 1CQVA 3KDFB 4YCUA 3UDFA 1K8OA 4JBWA 1RD9D 4GS3A 5CR3A 2NWGA 4NXNQ 4JBJA 2HQEA 1V1PB 2F0QA 1XPOA 1UE6A 1SE2A 2K75A 2KUMA 1I4RA 4DV3L 1GUNA 3S2HH 1IXRA 2AQ3B 2ZJRA 1M4VA 1CZGA 1HHVA 1O7LA 2UXBQ 1EEFD 1SNQA 2EYOA 3C1EA 4FXDA 2VQFQ 3G48A 5IYCH 1SNCA 2OT2A 2L11A 2XNAC 1VQPA 4ME5A 5D3IB 5ELBA 4DR3Q 4A3KB 1X3PA 2A73B 1KDAA 3J7ZC 4C3HG 1SNPA 1GD7A 3ZJYC 3OMGA 1PLFA 3S16B 1LTSD 1SYBA 4QL5A 1VQKA 5JVG3 1OXVA 3TMEA 4OIJA 2HCCA 3K7AB 2D5DA 3F2CA 2Y0SE 4DPGA 3SXHA 4DV1Q 5GAEC 1HUMA 2A5HA 4L5QA 3HOYH 1A8VA 4H0LC 4A3FB 2RSOA 3CAMA 1E7ZA 1AEXA 3ER0A 1XJVA 4APVA 4CDDC 1CI3M 4OHJA 3NWTA 4EQPA 1A2TA 1H95A 2M2LA 1E24A 1WJJA 1R9TH 2OWOA 3E5SA 4MTNA 1BOSA 3S1NH 1HXYD 2XRQD 5T1GA 4L5TA 4J8QA 5E3FA 2R61A 3NEMA 3T53B 1ZYRD 1JB3A 2VB2X 2E2JH 5M5XH 1P8LA 2F03A 3F8TA 3GO5A 2VB3X 2N78A 3H0GG 2YU9H 1ZXTA 5LMNL 3L7ZC 3DXJC 1PH1A 2K03A 1ESFA 2BE5C 1D8LA 1JQYD 4YHHQ 1B2TA 4H02A 5KNCA 1EY5A 1SNDA 1VQCA 4IN3A 2I07B 4C3JB 3P7JA 2WAQG 3PF4A 4OO1I 5IP9G 1Z9FA 2IX0A 1WTXA 4ALPA 2KCMA 1A15A 3H3VH 1X3GA 5C4ZA 1K8MA 3S9WA 2ZTEA 4Y7NB 2PZTA 4BBRG 2B29A 2EY2A 1JJGA 4JW0A 1FNVA 4X6AH 2NYZD 5DLQE 4C3HH 3NQTA 3GTJB 2CH4A 1K8GA 4P75A 5GAGC 4DAPA 3HOZG 1RCVD 1G291 2MO1A 1Y8PB 2XRSD 1STEA 4NMZA 3D4WA 4DN4M 2WB1B 3MFYA 4IZ8A 2R7DA 5C0XG 4JI3Q 2NVTH 2VZAA 3EIVA 1IHZA 4X62L 2ES2A 1O80A 4IFDI 4X64Q 3KYHC 1HZAA 2CQOA 1TWFH 4HIDA 2F0LA 4RHRA 1I6HB 3KBGA 5C5LA 1CUKA 4J15A 4JPBW 4KN4C 3H0GH 2PMZB 4ABNA 4ZYSA 1VQEA 1VQBA 3TZUA 5JJKA 4DV3Q 3NENA 1CSPA 2VL6A 3DEOA 2PO4A 2OTLA 2F0SA 4OL7A 2CVRA 3HP3A 2PYKA 3K5NA 4M8AA 1F2LA 3TZDA 1PVOA 3BZCA 1TU2B 1JOKA 2N88A 4L6TB 1Z47A 5IP9H 2SDFA 5EPKA 3K8AA 4ZKBB 5K36G 1OTCA 3M3YH 2KEEA 2X6LA 4LK1C 3D8GA 3SK8A 4AYBB 5M3MG 2MHVA 4GOPC 5CV5A 1U4RA 1D5MC 4A3KG 3CP0A 4PZ6A 4BBRH 1EWCA 1STYA 3I8ZA 1EY8A 3P1HA 2ZM6L 4K5VA 2CH4W 3HOXB 3BS1A 2IX3A 4FF1A 3D6CA 3PO3B 1PTOB 3HOZH 1EOTA 5GROA 2R3ZA 4IUUA 5JEAG 1ZYRC 2VQEL 2DN8A 2LXKA 2Z6KC 2EJFC 4BY1G 2NVXB 4ODGA 3G6JB 2HDLA 4V0BA 1B9MA 2WINB 5C0XH 5ELFA 2ZJQA 1ICFB 2Z8LA 4ID6A 4Q0FA 4X3UA 4GOPA 1RTOA 2P5ZX 1VQAA 3V05A 3TS0A 2QEJC 3OHXC 1XNRL 2HIVA 3S17H 4DAYB 1U4PA 4RGOS 4CDFC 4C2MB 3LGJA 1E2VA 4O0AA 3TP5A 3MXGA 4DV0L 3IRBA 3CKIB 1UWVA 4XQQA 5LMNQ 2AQ2B 3NQIA 2Z6KA 3DWAA 3CMAA 4QIWE 3PO2G 4HMIA 2MGSA 1QVGA 2RHQB 1E2WA 4DUZL 3H6MA 3B6YA 1JOQA 1FL0A 4PMBA 5CYUA 4R1JA 5AJ3L 1EEID 4C3JG 1WTQA 2PPBC 3D4RA 4K2KA 5ELNA 4JI4L 5I9OA 5K36H 2G9HD 1U4LA 3RD4A 1RTNA 5HGTA 2EJMA 4HJ8A 5M3MH 1HQMC 4RGMA 2CW0C 4DV6L 1TR5A 4LJZC 5C4HA 4A3KH 4PNYA 2HHHL 2UUAL 3D4DA 1SFOB 1VQ5A 3PMFA 1I5FA 5L37A 1VQ9A 3S16H 4K6LA 2A68C 3K7AH 4P73A 3FHWA 3HOVB 2JK8A 1EQTA 4LF8L 2KHJA 3ITPA 5JEAH 1XXGA 1PYWD 2B2UA 5J39A 2RVLA 4RA8A 1K3RA 3OSOA 4BY1H 1EU4A 4CBVA 2WB1G 3RUZA 2NTTA 4X62Q 3CC2A 3DMUA 1A63A 4NKLA 4JOIC 4A75A 4N8X1 4HCSA 4AH6A 5FLXc 1O7YA 3AYHB 1VCIA 4QQBX 1KLGD 3I4MB 1L0YB 5H1SE 1WTOA 3OWEB 1PDQA 4RG1A 3IFDA 2M9VA 1GKHA 1FNWA 2NN6G 4LF6Q 4KN7C 1W6KA 2EDGA 5CMDA 2EY6A 3H09A 4JI0L 5ELEA 5CBEE 1TXYA 2F0MA 3I2ZA 2Q2UA 1KLUD 2KQ3A 1ZKOA 4FXGC 1LTRD 2AWNA 1LTID 1SE8A 3PO2H 5FO7B 3CRKC 3MAQA 1EIFA 4A3GB 3ULPA 2L4NA 3I90A 1D1KA 1HFGA 1QWYA 4B3TL 3S2HB 2YYZA 3K81C 1JOOA 3BDOA 5C0XJ 1PRTB 3DM3A 1AE3A 4C3JH 5KEEA 4IURA 1SN8A 3X3MA 4DR5L 2QW7A 1C0AA 3QWNA 2MQHA 1Q81C 1LTLA 1CHQD 1Z7TA 4DV7L 1JC7A 1JCKB 4TSSA 3W3AA 2KCCA 2VY3A 2ZM6Q 3LNNA 3GTJH 1JWSD 2IX1A 3HOXG 3FKIG 5A35A 2K33A 3WDNA 1B3QA 1N34L 1SBBB 2VQEQ 3Q24A 1U4MA 3IAYA 2R7FA 2E2IB 5I6WA 3VYSA 4I7AA 2ZTDA 3A0JA 3IL8A 1W6JA 1NNXA 3I4LA 1SNOA 3LWUA 3MFGA 2JEBI 2DJFC 3I91A 1F9QA 2M00A 1BCPC 1XNRQ 1EYDA 4A3LG 5J1ZA 5GAHC 3GTPB 1I6HH 5C4XG 1UE1A 2NN6H 3CHBD 1IL8A 1II3A 1WTVA 1JE5A 1WTHA 1H9MA 1PZJD 4DV0Q 1L1OA 1M90C 2QILA 1CKNB 1S5BD 3Q0AA 3G7LA 1TWHH 1Z6HA 5I2YA 3NSWA 2RDHA 5JEAJ 1B9NA 2F52A 3KJPA 1QZGA 4DUZQ 1TWCB 4K0KL 4DF7A 2RCNA 5IGGA 2F0OA 4FF2A 4R8NA 1XX8A 5AJ3Q 4K5WA 4JK1C 1UUPA 1NR4A 1LUZA 3OPOA 5C3XA 5FK9C 2BH2A 1OXXK 1G6PA 4HEDA 3T16A 3I55A 5C44B 2FXQA 4DV6Q 1MGSA 3FDTA 2HHHQ 4ZAIA 2K5VA 3J81E 1Q1EA 1GUGA 3RN5A 2UUAQ 3E0EA 4JI7L 4LUOA 4FYDA 3BDCA 1V8QA 4WJWA 3HOXH 3FKIH 1PTOH 1QVCA 3HOVG 1QCBD 4LF8Q 1TS2A 4LFAL 4C56C 3CRLC 1EIGA 4NP5A 4DNTB 2B2YC 3KF8B 5JJZA 1GUTA 2XTIA 3E9HA 5BN5A 1LM0A 1SE3A 2WAQE 3UDIA 1ASZA 2NVTB 2ALYB 2I5LX 3UI2A 5EAYA 1O7ZA 3RNUA 1HRJA 1VQ6A 2C35B 3KLSA 4A3LH 1FVIA 3W1GA 2IHEA 2WP8J 5C4XH 2UU9L 2K5NA 1HUNA 4JI0Q 1TWAH 1F2YA 1B3AA 5LL6X 3L3OC 2ICEC 5KYIA 3CW2C 4BS9A 3H0GB 3FMCA 2N55A 1PH2A 1AW7A 1ML0D 3Q22A 4LMQD 1V9PA 4CJ2C 4EGVA 1KD1C 4B3TQ 5EBDA 1RL2A 4LFCL 1BKBA 2IWHA 1E1OA 2Q8IB 4AIMA 2PZUA 4YHHL 2RQXA 2ZJPA 4BA2I 4QMGA 1CSQA 1CFMA 3CCSA 4ZK9B 4GN3B 3S1QB 2WAQB 4DR5Q 2KCNA 3BZDB 1I50H 1B1ZA 4DV7Q 1Q8KA 2EY1A 4LAAA 5M9OA 4KK7A 4K14A 5LHY1 4A3IB 1FGUA 5TSSA 3H15A 1N34Q 3NP8A 3H3VC 2QKIC 3HOVH 5BN3A 3ULLA 1V1QA 3SE0A 4IPHA 2I0QA 2OQKA 5FLMG 1HNXL 3ICEA 5ELDA 3RMHA 3EROA 4R4TA 1DJRD 4IUVA 4AQYQ 4NPSA 4DR6L 3W1BA 3VR4A 2HIXA 2F3VA 5DAUA 1KTKA 1QJOA 3VA5A 3M7NA 4GKKL 3AQQA 3G6EA 1B4OA 2SOBA 3A74A 4RGNA 2A8VA 1IBML 2Q2IA 1ZEQX 3QR8A 1EWIA 3VYRA 3NXWA 1EIYB 3MWYW 1TS5A 1U0LA 2JE6I 4DA2A 2KEDA 3K58A 1S40A 3Q8DA 4FO2A 5C4JH 2ZTCA 1E1TA 4KD3A 4K0KQ 1PFBA 4A3GH 5LMNW 1WD0A 1K9MC 2KECA 2K5HA 2PQAA 2ENBA 2HUGA 1DOLA 1IKMA 1D6EC 4JBMA 1XNQL 4DAMA 1GUOA 3KF6B 5DNFA 2ZT9C 4XIGS 4I65A 5IT9L 1CHPD 1Q8IA 4DR2L 1VQ8A 4RAUC 4Z9CB 5C44G 5M3MB 3DM1A 1JJ2A 1FNUA 1I94L 4JI7Q 3T13A 4OEMB 2X6GA 1IYVA 1VQIA 2QGQA 4LFAQ 2EYPA 5J3BA 4JI8L 1STBA 3TBIB 3BYYB 2ATWA 1WTRA 2WIIB 3U9OA 3OOCA 2E2IH 3C46A 5FLMH 3MVVA 2EQSA 1PH6A 3MXNB 1BNZA 1Q90A 2QDLA 4R4CA 1BXTA 4BY1B 4DU9A 4L5SA 2SEBD 4TQUS 2RSNA 3CC4A 4ZKCB 3ND9A 3PGZA 2IJ0A 3A8KE 3PQIA 2O5JC 3A55A 4DNIA 3S15H 4BA1I 1YNXA 2HT1A 4JI2L 1Y69U 1TVXA 3GTPH 1HR0W 1XPRA 4IALA 2R92B 2UU9Q 2XGTA 2DNEA 2NBFA 3HOUB 2EYMA 3GTQB 1LT3D 5GADC 5JPNC 3S1RB 2BDNA 1N33L 2EYHA 2A6HC 2ASBA 5K5PA 1VQOA 2L15A 1HH2P 3FEWX 1JE4A 5DM63 3PO2B 1TWCH 1SYCA 2WB1E 1TT2A 4Q5VA 4FVMA 4LFCQ 1YI2A 1U9RA 1X3FA 4WRDA 5G3LF 1SNMA 4MN3A 2JA5B 4UPAA 1FYCA 1NMGA 1VQHA 3I4NG 1EY7A 3GV6A 4C3IG 4POFA 5KRUA 2HD3A 3GV3A 1MKHA 3Q6SA 1WOCA 2CWPA 2AUKA 1IYJB 1BDOA 5C44H 1H9SA 2PZWA 4IJHA 3KOJA 1J8IA 5J22A 4XT3B 3OWFA 1HPCA 2C5CA 1EQVA 1WVLA 4A3IG 3MA2B 2PMZE 2Q8RE 2JSOA 1RIPA 2JA8B 1IW7D 4L8JA 4K6DA 4O42A 3KDFA 1K8AC 1NMFA 4MZ9A 3QIAA 1A3UA 1VQGA 4K8JA 4RMFA 4X66L 1EY4A 4JI1L 1HNXQ 1T5EA 4A76A 3DEPA 1EZ6A 3SEBA 5IWAL 3I4OA 3J80E 1V1PA 3KJOA 4DR6Q 5FJ8G 4IUTA 3T1YL 1VMPA 3M85A 2LFNA 2JA6B 1X3QA 1WCMB 3H91A 2KBNA 5EPLA 1CQFA 2X69A 4GKKQ 4KMUC 4AYBE 4JBKA 1HR0L 2FMCA 1IBMQ 1QG7A 1CA6A 1ONLA 3DLLA 1C4QA 1L0XB 1NSNS 1SYFA 1O78A 1MSHA 1JWMD 4J1MA 4XT1B 4LF6L 1YJ9A 1G2SA 2RF4A 3AU7A 1GXDC 3K80C 2CCZA 1NR2A 4HR7B 2K01A 3V2TA 4RCNA 4XXEA 2UUCL 1TWHB 2PQEA 4RGTA 1PTOD 2FHTA 2K4KA 1I4GA 2UUBL 4O1NA 1TY2A 1P16A 1LTAD 1HJPA 4YWMA 1XNQQ 3KFUA 4IPGA 2TMPA 4MNOA 5HGQA 4F7XA 4XDXA 4G7HC 4RH6A 2B2VC 3I4NH 3S1QH 1RDPD 4YY3L 4C3IH 1KIXA 4EQOA 4C1NK 3U58A 4DR2Q 2DGYA 1VQMA 1I94Q 3GP7A 4CKBA 4KHPL 3FPUB 1RF2D 3EVQA 4H44C 4KI0A 3NK9A 4UAIA 2F0VA 4A3IH 1UAPA 2ICIA 3R93A 1SE4A 4KTAA 3J81L 2O2LD 4DR7L 1VDZA 5IP7G 3FKIB 4JI8Q 1F9RA 1CA5A 1TY0A 3A54A 3QJYA 3D3RA 1B53A 4O2DA 3NTIA 1EU3A 2B2VA 2Z1CA 5FJ8H 4KV6A 1YVCA 3VA7A 4JI5L 1E22A 4HJ5A 4A3JB 3A56A 4JI2Q 3M4QA 4NDXA 1I3QB 3QOLA 4GN4B 4KLKA 3V96A 1SJED 2R92G 1PZID 4HAEA 2R7ZB 1F2MA 4GLVB 1S5FD 3HOUG 4BWGB 5E4XA 2KENA 4R8IA 3FPPA 1JWUD 5C4XB 3A7AB 2JYOA 1K3BC 4QUFA 2K1BA 3JC66 1N33Q 4R4IA 1M8AA 1TWAB 1F2ZA 1X9NA 3RZDB 3F2BA 4P71A 4RCOA 2EYJA 1DD2A 2KHSA 4YCWA 3NUCA 1PV4A 3RLNA 1IW7C 1NTGA 4F8MA 3VR6A 2JA5G 5IT9E 3J7A5 4A93G 2CHBD 2EIFA 1EYGA 1VQ4A 2EXZA 1QE6A 1BBUA 2D9UA 1YEZA 4DFAA 2EOTA 2C9OA 5HURA 2SNMA 1EY6A 2B2TC 2D2CC 5JPMC 5CBAE 1I50B 1YHAA 5CV7A 1EY0A 2I5HA 3CCUA 4A3DB 2RA4A 4HIKA 2L1BA 3CCRA 4UDUC 1YIJA 3RLFA 3KLRA 4QCLA 1Q46A 2JA8G 2A69D 5IY0A 5IP7H 1Q7YC 4QF4A 4X66Q 2Z9HA 2L5TA 4OGQC 5JOBA 4JI1Q 1A3VA 3UE0A 5IWAQ 4HJ7A 3MC0B 3T1YQ 1L1OB 3ERQA 2JA6G 1WCMG 1PTOC 2RBMA 1M1KC 1HNZL 1PRTD 1HR0Q 1E0BA 1Y1VB 2DUDA 3T4AC 1DGSA 4LF4L 2K04A 1PFSA 2R92H 1CZWA 3HOUH 3EBEA 4GNXB 1BCPF 1VQDA 1BF4A 3GTQH 1QZHA 4DXFA 1YNND 4C1NI 3S1RH 1AFPA 3H3VI 4UP7A 2UUCQ 3STBD 1UE7A 2H1EA 4DK6C 3K6OA 5C4JB 2F4VL 1ICWA 2UUBQ 4G57A 2Q2TA 4A3BG 1QOHA 4CKCA 3SK5A 4JOIA 2Q8TA 2MO0A 5M5YH 2MNAA 2JA5H 4K8IA 3BVZA 1H9RA 5EBCA 1IYUA 3MEFA 4YY3Q 1I6VC 3HS0C 3L9AX 3PUXA 1IBKL 4HJAA 5EKLA 4TKOB 4NXML 2EXDA 5CV6A 5KNDA 1EQRA 1YNJD 4ZUJA 4KHPQ 2DY7A 1XMOL 2L0CA 3NBIA 2QEXA 1SEBD 1OXSC 4JCVE 1K83H 3WWVA 3NBHB 2QDBA 4DAYA 2RKSA 4DR7Q 1JICA 2JA8H 4DV2L 4DK1A 1RKNA 1AZPA 2F0NA 1S5ED 3J80c 3VDYA 2A6ED 4KKSA 1O7IA 2PI2E 4ULLA 1HA5A 4QGUA 2NZ1D 2LS01 3WOFA 4AQYL 2JA6H 5IYDG 3N6RA 1WCMH 2AQ1B 3RR5A 4JI5Q 1HQRD 3F2DA 3CQZB 5LMUQ 3HKSA 1GM5A 4A3JG 3ONAB 2F0JA 2F0EA 1Y8NB 3J7AF 3S15B 1YJWA 4GLAC 4PZ8A 2R7ZG 4EQ5A 1V43A 2HCIA 1OXTA 2JA7B 2VUMB 4OO1G 1PFNA 1GHKA 4KJNA 1LLRD 1DOKA 4X3TA 2ZXOA 4DK0A 3OW7A 1D2BA 5I6YA 1D5XC 4PMWA 1A3TA 1EZ8A 3TDQA 1UEBA 4F88A 5KGUA 3AMUA 4GNXC 3J80i 3M4OB 1VQFA 4A3BH 4U673 4OX9L 1XMQL 2A69C 2E8GA 5CV9A 1R4QB 1HTLD 5T1IA 2D0PA 1B7YB 2JJQA 5FKAC 1PH3A 3HGBA 4KY7A 1QUQA 2K32A 4ZLTF 3BDLA 5LL6S 5CC4A 4A3DG 5C0XI 4UHVA 4R4OA 3K5MA 1SDFA 1SLJA 3WOEA 4LF5L 1PRTC 1HNWL 4A3EG 3I3CA 1ILPA 4IFDG 4JI6L 1PYSB 3PCOB 4YCVA 4L63B 3MHBA 3KUPA 4WJ3M 3K5LA 2IY5B 2XWJB 2B63B 4B3RL 3P75A 1ESRA 1G8ZD 1GVPA 1NAPA 3STBC 1Q12A 4ZQ3A 3NWSA 3CCLA 4B3SL 2AUJD 3R2TA 5IYDH 1LV9A 1DCZA 1UEAB 1SR3A 1SYEA 4PQXA 3SDZA 3J80L 1MJEA 1HNZQ 2Q2HA 1Y1VG 1N8RC 4A3JH 4LF4Q 2OEOA 2A19A 3NPPA 4DR4L 1I3QH 4GKJL 1Y14B 1MD2D 2R7ZH 2K5QA 4J6HA 3MXUA 4A3MB 1Q86C 4ZRZA 5CGKA 3JAML 4OO1H 4HSPA 1WTWA 1HFNA 1WFQA 1YNJC 2L55A 3NTKA 2MJ8A 4BXXG 3P20A 3RZDH 1S72A 2F4VQ 3GTLB 2B2YA 2Z6BA 4IQZA 4OELB 2GVAA 3VYUA 5IT9c 3I56A 4LNQA 2BA0A 3OYYA 2GN5A 4OIKA 1STAA 3HZXA 4GN5A 2NUCA 3K0YA 4CHTB 3GTOH 1LT5D 1IBKQ 3AEVA 3I4NB 1AN8A 4NXMQ 1PH4A 1G51A 4KKUA 4C3IB 1JR0D 1F9PA 3AFPA 4PMCA 1XMOQ 2V1CC 4LUZA 3ND8A 4A3DH 2XIWA 2VW9A 5CV4A 5IIFA 5C3EB 4A3EH 4IFDH 3KLSX 1STHA 1XPUA 4DV2Q 4JV5L 5M5WB 4OONA 3HRZC 3T56B 3URYA 1CKNA 4DXGA 4GLXA 1SMXA 2FMMA 1GUSA 3J7YW 1SSOA 5F2DA 3VYTA 1K73C 3E0JA 3C1FA 2JXMB 1QNUA 1YJNA 1S3OA 3OW2A 3HKZG 1Y1VH 1EIHA 1D7QA 2BE5D 5IGCA 1UE5A 2WACA 5A2QL 3GTMB 5FO8B 4U68A 1MBYA 2KCTA 2JA7G 1CKMA 2VUMG 3T1HL 2AHOB 5E1FA 2L12A 1Q82C 1IL2A 1BVSA 4XQJA 1LO5D 1LT6D 2F0GA 5IE8A 1PFMA 5KIXA 3CCMA 2JQOA 4DKAC 4BXXH 4DNRB 1QILA 1WYDA 1QVFA 4XYQA 2O5IC 3MTSA 1VQNA 4OX9Q 1XMQQ 2R93G 2K5WA 3CXCA 1PYBA 5M3FG 2MUYA 2IL8A 4QB4A 4XQNA 3SHLA 2YTVA 3R3OA 1U5KA 1K0SA 3KF8A 2DY8A 1E3PA 2V4DA 1B8AA 3W5OA 1TKWB 4N9TA 1XTDA 2HDMA 1PMRA 3S14B 1GOZA 5NUCA 2LSSA 4LF5Q 1HNWQ 2NVYB 4JI6Q 4UP9A 3QB3A 3F1ZA 1J9OA 4CJ1B 5CORA 2K50A 4B3RQ 1JMCA 2NN6I 2B63G 2K14A 4BBSB 2MP1A 3BJUA 3U4VA 1C9OA 1X56A 1SYDA 4EX5A 4B3SQ 5BN4A 1L2FA 2OF1A 1CT1D 4KHZA 5G3LD 1LABA 3CQZH 3U9SA 4DAVA 1K0RA 1IZ6A 4UP8A 4DR4Q 3UDGA 1KC8C 3CPWA 2QCPX 2N8NA 4GKJQ 1IKLA 4A3MG 4LF7L 1SMYD 1KRSA 5DM73 1KL9A 3EQLC 4P2CB 1YHQA 3DWQA 2JA7H 2VUMH 2FFKB 3OIPA 1LTBD 2K28A 1SYGA 2N49A 3R8BA 1ENAA 4IFDJ 4YWKA 1LTTD 2B39A 4LWCA 2RDGA 3I72A 4DUYL 2I5MX 2F4IA 1YITA 4HTHA 3FP9A 1RODA 3PV0A 3DUZA 2Z4IA 3M4OH 1IBLL 1A6XA 2R93H 1TS4A 5FLXE 5IGEA 2F0HA 5EKIA 5M3FH 1VF5C 1NE3A 2A1AA 1EFID 4RWSC 2CWAA 2EVBA 5M5YB 3K7UC 3QG1A 3BU2A 2E76C 1WTPA 3J81j 2FINB 1B70B 2F0IA 4A93B 5IGDA 4FP5D 1OXUA 3J81c 4RKBA 1JORA 3SGIA 3X3NA 3VR3A 2JEAI 3GTKB 4IJLA 4DK3C 5C3EG 2KA7A 2XN9C 2E2HB 1K83B 2Y0SB 5GQOA 1UNSA 5EPJA 4JV5Q 1GO3E 1HZBA 4S3SA 4GOPB 3KK7A 3A5UA 3ERSX 2BA1A 1KXLA 2AWOA 4X65L 3C2PA 1C7YA 1X32A 5ELCA 2B2WC 2B63H 5AFWA 1PHJA 4P74A 4YIJA 2HQLA 4IUPA 3SVMA 5EKKA 3OTOL 3S24A 2CKZB 3Q23A 2PW7A 2NVQB 2K5DA 4LW1A 2KOLA 1J6QA 3CD6A 3A8JE 4MTKA 4IUNA 4OWXB 3KF6A 3JAME 4IPCA 2R6GA 2BCOA 3OIQA 3K59A 4A3MH 2XVSA 4DR1L 3J81i 3T1HQ 4HIOA 2LMCB 1TWGB 4HJ9A 2B3GA 1CKOA 4N9PA 3CPFA 2B2WA 3PUVA 3QOJA 2F0PA 1WD1A 1LTGD 2EJGC 2PNHA 1VS0A 2CW0D 3GTLH
chains in the Genus database with same CATH topology
5KNBA 3GTGB 1FR3A 3N52A 4A3BB 5I4DA 1C8CA 5ISRA 4HSVA 2A68D 3EA6A 1A2UA 3MXNA 2PW5A 1BQQT 2A74C 1TQOA 4EVOA 2BOSA 3EJIA 5IGBA 2H4OA 2K05A 1GJXA 1BBXC 4I7ZC 2F0KA 4G7ZC 2B8FA 1SAPA 1SMYC 3S1MB 2EYFA 2E75C 3R2IA 1GHJA 5COYA 3DWPA 1RHPA 2WKDA 2TSSA 1NUCA 2F0DA 2G9DA 2J7ZA 3A8IE 5A2QE 1FD7D 3M4YA 1PTOF 3O13A 1ILQA 2E74C 4V190 1T5XD 1CK1A 1XTCD 3FVQA 3SK6A 3I70A 1DM0B 3TP6A 2F0UA 5IOCA 1BR9A 3AB9A 1I4HA 3SR1A 4KY6A 3TP7A 1PZKD 3RZOB 4BY7B 3GTOB 1PXUA 3S2DB 4K2LA 1CTMA 4B9XA 2QF7A 5CV8A 4CKEA 2EPBA 1E2ZA 2LY7A 1BCPD 4A3EB 2VXWA 3TP8A 4E6IA 2B2UC 1G91A 5IGFA 2VNUD 2PNRC 5EJWA 3HOWB 4CGYB 1DONA 1ET9A 4CJ0B 3M7GA 2XWBB 4XYOA 2ZXRA 1ENCA 2O4XA 4FNFA 1ENFA 2B2TA 3TSSA 4WORA 1MI2A 2NTSA 2J0TD 1H9KA 2OXPA 1BCPB 4QIWB 4H13C 2FJ2A 1EY9A 1EWHA 1XWEA 3PUYA 2JP1A 3DHQA 4NW2A 2LKVA 4M1UB 3D6WA 3PIO3 5I2XA 5JVH3 5I9PA 1KNAA 1Y1WB 4DGZA 4TRDA 5JAVA 4KHVA 4K5XA 4X3KA 1G6ZA 1DYQA 3FRPB 2K7VA 2IW3A 3LWEA 4KY5A 4G7OC 4FF3A 4X3SA 4B9WA 5E4WC 2WKCA 3VR2A 1DOMA 1C48A 3PUZA 1EL0A 1TIID 3K5OA 1I4QA 1SXTA 1PRTF 2EYLA 2L9HA 1LACA 4KKTA 2NB0A 4KD4A 4RFBA 1I4PA 1H9JA 2WV6D 4KJOA 1NCVA 1BO0A 3OMCA 1LT4D 3HKZB 1KNEA 2Z4HA 5C6AA 2ID0A 2GA4B 3GD7A 2F0FA 4ZUIA 3HOYB 3BYTB 4RKLA 2EY5A 1DZ1A 2MPMA 3SK4A 2D62A 3NTHA 1Q1BA 1R9TB 5D3DA 1EYCA 2R93B 3S1NB 1V1OA 3H94A 5M3FB 1S5CD 5FLXL 1CM9A 4GZYC 2E2JB 1VMCA 3VR5A 1Q3LA 5M5XB 1D5ZC 5IODA 5DEHA 3KBXA 4MIUA 2YU9B 2K6AA 2EE1A 2KVMA 1HCZA 4HMJA 3HG9A 5EGTA 2ZXPA 3IFTA 1HA6A 4MHEA 3BG3A 2PCFB 2SNSA 1B50A 3A7LA 1OO9B 3CU7A 1MSGA 3NE5B 2IPKD 1QNKA 1YNNC 3BVMA 4IUQA 3ZYYX 2J4XA 1BUVT 3C3LA 1G2TA 2DNCA 3T51B 3NHHA 4C3HB 3IKJA 3LX0A 1AZQA 1KAAA 1STNA 2CQAA 3I73A 3NBHA 1KDBA 1ET6A 2I46A 4G4KA 1S4ZA 4B08A 3BVGA 3GQBA 1TWFB 3EFXD 1RJTA 1Y8OB 1QB5D 2F3WA 2XSCA 4EQNA 5D14A 2A6EC 1STGA 4ILWA 4H7BA 1SJHD 1D1IA 2IT1A 3D31A 5FOBB 2RDFA 1R4PB 1KDCA 5KYLA 2F0TA 2F0WA 1F77A 2KJXA 1EYAA 4PV1C 3F2UA 4R9WA 2B8GA 4F87A 2F1MA 3J7AV 3M3YB 4HCEA 5FO9B 2A6HD 3MXPA 3PIP3 5C5MA 5C3WA 1B44D 2EZVA 4BBRB 5EQ0A 4WFN3 3MEHA 4FF4A 3K57A 1HTPA 3HOZB 2E2DC 4XTCS 3HEJA 3W2DA 2BDOA 1FGBD 4RHSA 1TS3A 1AP0A 1KABA 1I4XA 1VF7A 1F9SA 1H9SB 5D65A 3MZ5A 4QUCA 3PUWA 1S5DD 1XYIA 1GUWA 3QO2A 3S17B 3TN2A 3E6ZX 4FXKC 4HN7A 1DXMA 1CQVA 1K8OA 4JBWA 1RD9D 5CR3A 2NWGA 2HQEA 1V1PB 2F0QA 1SE2A 2KUMA 1I4RA 1GUNA 2AQ3B 1M4VA 1CZGA 1HHVA 1O7LA 1EEFD 1SNQA 2EYOA 3C1EA 4FXDA 1SNCA 2OT2A 2L11A 2XNAC 4ME5A 5D3IB 5ELBA 4A3KB 1X3PA 2A73B 1KDAA 4C3HG 1SNPA 3OMGA 1PLFA 3S16B 1LTSD 1SYBA 5JVG3 1OXVA 3TMEA 4OIJA 2HCCA 3K7AB 2D5DA 3SXHA 1HUMA 2A5HA 4H0LC 4A3FB 2RSOA 1AEXA 1CI3M 4OHJA 3NWTA 4EQPA 1A2TA 2M2LA 3E5SA 1BOSA 1HXYD 2XRQD 5T1GA 4J8QA 5E3FA 2R61A 3T53B 1ZYRD 1JB3A 2VB2X 2F03A 3GO5A 2VB3X 1ZXTA 3L7ZC 3DXJC 2K03A 1ESFA 2BE5C 1JQYD 1B2TA 5KNCA 1EY5A 1SNDA 4IN3A 2I07B 4C3JB 3P7JA 4OO1I 2IX0A 1WTXA 1A15A 5C4ZA 1K8MA 3S9WA 4Y7NB 2PZTA 2EY2A 1FNVA 2NYZD 3NQTA 3GTJB 4DAPA 1RCVD 1G291 1Y8PB 2XRSD 1STEA 4NMZA 3D4WA 4DN4M 2WB1B 3MFYA 4IZ8A 5C0XG 1IHZA 1O80A 4IFDI 2F0LA 4RHRA 1I6HB 3KBGA 5C5LA 4KN4C 2PMZB 4ABNA 4ZYSA 3TZUA 3DEOA 2PO4A 2F0SA 4OL7A 2CVRA 3HP3A 2PYKA 3K5NA 4M8AA 1F2LA 3TZDA 1TU2B 1JOKA 2N88A 4L6TB 1Z47A 2SDFA 5EPKA 4ZKBB 5K36G 2KEEA 2X6LA 4LK1C 3D8GA 3SK8A 4AYBB 2MHVA 5CV5A 1U4RA 1D5MC 1EWCA 1STYA 3I8ZA 1EY8A 3P1HA 4K5VA 3HOXB 3BS1A 2IX3A 4FF1A 3D6CA 3PO3B 1PTOB 1EOTA 2R3ZA 4IUUA 5JEAG 1ZYRC 2DN8A 2EJFC 2NVXB 4ODGA 3G6JB 2HDLA 4V0BA 1B9MA 2WINB 5C0XH 5ELFA 2Z8LA 4ID6A 4Q0FA 4X3UA 1RTOA 3V05A 2QEJC 3OHXC 1U4PA 4RGOS 4C2MB 1E2VA 3TP5A 3MXGA 3CKIB 4XQQA 2AQ2B 3NQIA 3DWAA 4HMIA 2MGSA 1E2WA 3H6MA 1JOQA 4PMBA 5CYUA 1EEID 4C3JG 1WTQA 2PPBC 3D4RA 4K2KA 5I9OA 5K36H 2G9HD 1U4LA 3RD4A 1RTNA 5HGTA 2EJMA 1HQMC 4RGMA 2CW0C 1TR5A 4LJZC 5C4HA 4PNYA 3D4DA 1SFOB 3PMFA 4K6LA 2A68C 3HOVB 1EQTA 3ITPA 5JEAH 1XXGA 1PYWD 2B2UA 5J39A 2RVLA 4RA8A 3OSOA 1EU4A 4CBVA 3RUZA 2NTTA 3DMUA 4NKLA 4HCSA 1O7YA 1VCIA 1KLGD 3I4MB 1L0YB 1WTOA 3OWEB 1PDQA 3IFDA 2M9VA 1FNWA 2NN6G 4KN7C 1W6KA 2EDGA 5CMDA 2EY6A 3H09A 5ELEA 5CBEE 2F0MA 1KLUD 2KQ3A 1ZKOA 4FXGC 1LTRD 2AWNA 1LTID 5FO7B 3CRKC 3MAQA 4A3GB 2L4NA 3I90A 1D1KA 1HFGA 1QWYA 3S2HB 2YYZA 1JOOA 3BDOA 5C0XJ 1PRTB 5KEEA 4IURA 3X3MA 3QWNA 1CHQD 1Z7TA 1JCKB 1JC7A 4TSSA 3W3AA 2KCCA 3LNNA 1JWSD 2IX1A 5A35A 2K33A 3WDNA 1SBBB 3Q24A 1U4MA 3IAYA 2E2IB 5I6WA 3VYSA 3IL8A 1W6JA 3I4LA 1SNOA 3LWUA 3MFGA 2JEBI 3I91A 1F9QA 2M00A 1BCPC 1EYDA 5J1ZA 3GTPB 2NN6H 3CHBD 1IL8A 1II3A 1WTVA 1H9MA 1PZJD 2QILA 1S5BD 3Q0AA 3G7LA 1Z6HA 5I2YA 3NSWA 2RDHA 5JEAJ 1B9NA 1TWCB 4DF7A 5IGGA 2F0OA 4FF2A 4R8NA 1XX8A 4K5WA 4JK1C 1UUPA 1NR4A 3OPOA 5C3XA 5FK9C 1OXXK 4HEDA 3T16A 5C44B 1MGSA 3FDTA 4ZAIA 3J81E 1Q1EA 1GUGA 4FYDA 3BDCA 1V8QA 4WJWA 1PTOH 1QCBD 1TS2A 4C56C 3CRLC 1EIGA 4NP5A 4DNTB 2B2YC 5JJZA 1GUTA 5BN5A 1SE3A 2NVTB 3UI2A 1O7ZA 1HRJA 3KLSA 2WP8J 1HUNA 1F2YA 1B3AA 5LL6X 3L3OC 2ICEC 5KYIA 4BS9A 3H0GB 3FMCA 2N55A 1AW7A 1ML0D 3Q22A 4LMQD 4CJ2C 4EGVA 5EBDA 2IWHA 2Q8IB 2PZUA 2RQXA 4BA2I 4QMGA 1CFMA 4ZK9B 3S1QB 2WAQB 2KCNA 3BZDB 1B1ZA 2EY1A 4LAAA 5M9OA 4KK7A 4K14A 5LHY1 4A3IB 5TSSA 3NP8A 3H3VC 2QKIC 5BN3A 3SE0A 5ELDA 3RMHA 3EROA 1DJRD 4IUVA 3VR4A 2F3VA 5DAUA 1KTKA 1QJOA 3VA5A 3M7NA 1B4OA 2SOBA 4RGNA 1ZEQX 3VYRA 3NXWA 3MWYW 1TS5A 2JE6I 4DA2A 2KEDA 3K58A 4FO2A 4KD3A 1PFBA 1WD0A 2KECA 2ENBA 2HUGA 1DOLA 1IKMA 1D6EC 1GUOA 5DNFA 2ZT9C 4XIGS 4I65A 5IT9L 1CHPD 1Q8IA 4RAUC 4Z9CB 5M3MB 3DM1A 1FNUA 3T13A 2X6GA 1IYVA 3TBIB 2EYPA 1STBA 3BYYB 1WTRA 2WIIB 3U9OA 3OOCA 3C46A 3MVVA 1BNZA 1Q90A 1BXTA 4BY1B 4DU9A 2SEBD 4TQUS 2RSNA 4ZKCB 3ND9A 2IJ0A 3A8KE 2O5JC 3A55A 4BA1I 1Y69U 1TVXA 2R92B 4IALA 2DNEA 2NBFA 3HOUB 2EYMA 3GTQB 1LT3D 5JPNC 3S1RB 2BDNA 2EYHA 2A6HC 5K5PA 3FEWX 1JE4A 5DM63 3PO2B 1SYCA 1TT2A 4Q5VA 4FVMA 1U9RA 4WRDA 5G3LF 1SNMA 4MN3A 2JA5B 1FYCA 1EY7A 3GV6A 4C3IG 5KRUA 3GV3A 3Q6SA 2AUKA 1BDOA 1J8IA 1H9SA 2PZWA 5J22A 4XT3B 3OWFA 1HPCA 2C5CA 1EQVA 1WVLA 3MA2B 2Q8RE 2JSOA 2JA8B 1IW7D 4L8JA 4K6DA 4O42A 3QIAA 1A3UA 4K8JA 1EY4A 1T5EA 3DEPA 3SEBA 1EZ6A 3J80E 1V1PA 4IUTA 1VMPA 3M85A 2LFNA 2JA6B 1X3QA 1WCMB 3H91A 5EPLA 1CQFA 2X69A 4KMUC 2FMCA 1QG7A 1CA6A 1ONLA 1C4QA 1L0XB 1NSNS 1SYFA 1O78A 1MSHA 1JWMD 4J1MA 4XT1B 1G2SA 3AU7A 1GXDC 1NR2A 4HR7B 2K01A 3V2TA 4RCNA 4XXEA 1TWHB 2PQEA 4RGTA 1PTOD 2FHTA 1I4GA 4O1NA 1TY2A 1LTAD 2TMPA 4F7XA 4XDXA 4G7HC 4RH6A 2B2VC 1RDPD 4EQOA 4C1NK 3GP7A 4CKBA 3FPUB 1RF2D 3EVQA 4H44C 4KI0A 3NK9A 4UAIA 2F0VA 1UAPA 2ICIA 3R93A 1SE4A 4KTAA 3J81L 2O2LD 1VDZA 3FKIB 1F9RA 1CA5A 1TY0A 3A54A 3QJYA 3D3RA 1B53A 3NTIA 1EU3A 2B2VA 2Z1CA 4KV6A 3VA7A 4A3JB 3A56A 4NDXA 1I3QB 3QOLA 3V96A 1SJED 1PZID 4HAEA 2R7ZB 1F2MA 1S5FD 4BWGB 5E4XA 4R8IA 3FPPA 1JWUD 5C4XB 3A7AB 2JYOA 4QUFA 2K1BA 1M8AA 1TWAB 1F2ZA 3RZDB 4RCOA 2EYJA 1DD2A 2KHSA 3NUCA 1IW7C 4F8MA 3VR6A 5IT9E 2CHBD 2EXZA 1QE6A 2D9UA 4DFAA 2EOTA 2C9OA 5HURA 2SNMA 1EY6A 2B2TC 2D2CC 5JPMC 5CBAE 1I50B 5CV7A 1EY0A 4A3DB 2RA4A 2L1BA 4UDUC 3RLFA 3KLRA 4QCLA 2A69D 4QF4A 2L5TA 4OGQC 5JOBA 1A3VA 3MC0B 3ERQA 1PTOC 2RBMA 1PRTD 1E0BA 1Y1VB 3T4AC 2K04A 1CZWA 1BCPF 1BF4A 4DXFA 1YNND 4C1NI 1AFPA 2H1EA 3K6OA 5C4JB 1ICWA 4G57A 1QOHA 4CKCA 3SK5A 2Q8TA 4K8IA 3BVZA 1H9RA 5EBCA 1IYUA 1I6VC 3HS0C 3L9AX 3PUXA 5EKLA 4TKOB 5CV6A 5KNDA 1YNJD 4ZUJA 2DY7A 2L0CA 3NBIA 1SEBD 1OXSC 2QDBA 4DAYA 2RKSA 1JICA 4DK1A 1RKNA 1AZPA 2F0NA 1S5ED 2A6ED 4KKSA 4ULLA 1HA5A 2NZ1D 2LS01 3WOFA 3N6RA 2AQ1B 1HQRD 3CQZB 3ONAB 2F0JA 2F0EA 1Y8NB 3J7AF 3S15B 1V43A 2HCIA 1OXTA 2JA7B 2VUMB 4OO1G 1PFNA 1GHKA 4KJNA 1LLRD 1DOKA 4X3TA 2ZXOA 4DK0A 3OW7A 1D2BA 5I6YA 1D5XC 4PMWA 1A3TA 1EZ8A 3TDQA 4F88A 5KGUA 3AMUA 3M4OB 4U673 2A69C 5CV9A 1R4QB 1HTLD 5T1IA 5FKAC 3HGBA 4KY7A 2K32A 4ZLTF 3BDLA 5LL6S 5CC4A 5C0XI 3K5MA 1SDFA 3WOEA 1PRTC 3I3CA 1ILPA 4IFDG 4L63B 3MHBA 3KUPA 3K5LA 2XWJB 2B63B 3P75A 1ESRA 1G8ZD 1NAPA 1Q12A 4ZQ3A 3NWSA 2AUJD 3R2TA 1LV9A 1DCZA 1UEAB 3SDZA 1SYEA 4PQXA 3J80L 2OEOA 3NPPA 1MD2D 2K5QA 4J6HA 3MXUA 4A3MB 4ZRZA 5CGKA 3JAML 4OO1H 4HSPA 1WTWA 1HFNA 1YNJC 2L55A 3NTKA 2MJ8A 3P20A 3GTLB 2B2YA 4IQZA 3VYUA 2BA0A 4OIKA 1STAA 3HZXA 2NUCA 3K0YA 4CHTB 1LT5D 3I4NB 1AN8A 4KKUA 4C3IB 1JR0D 1F9PA 4PMCA 3ND8A 2XIWA 5CV4A 5IIFA 5C3EB 4IFDH 3KLSX 1STHA 5M5WB 3HRZC 3T56B 3URYA 4DXGA 2FMMA 1GUSA 3J7YW 1SSOA 5F2DA 3VYTA 3E0JA 3C1FA 2JXMB 1QNUA 1EIHA 2BE5D 5IGCA 2WACA 5A2QL 3GTMB 5FO8B 4U68A 1MBYA 5E1FA 2L12A 4XQJA 1LO5D 1LT6D 2F0GA 1PFMA 5KIXA 4DNRB 1QILA 4XYQA 2O5IC 3MTSA 2K5WA 2MUYA 2IL8A 4QB4A 4XQNA 3SHLA 3R3OA 3KF8A 2DY8A 2V4DA 1TKWB 4N9TA 2HDMA 1PMRA 3S14B 1GOZA 5NUCA 2NVYB 3QB3A 1J9OA 4CJ1B 5CORA 2NN6I 4BBSB 2MP1A 1SYDA 5BN4A 2OF1A 1CT1D 4KHZA 5G3LD 1LABA 3U9SA 4DAVA 2QCPX 1IKLA 1SMYD 5DM73 3EQLC 4P2CB 3DWQA 2FFKB 3OIPA 1LTBD 2K28A 1SYGA 3R8BA 1ENAA 4IFDJ 1LTTD 2B39A 2RDGA 3I72A 2F4IA 4HTHA 1RODA 3PV0A 3DUZA 2Z4IA 1A6XA 5IGEA 1TS4A 5FLXE 2F0HA 5EKIA 1VF5C 1EFID 4RWSC 2EVBA 5M5YB 3QG1A 2E76C 1WTPA 2FINB 2F0IA 4A93B 5IGDA 4FP5D 1OXUA 4RKBA 1JORA 3X3NA 3VR3A 2JEAI 3GTKB 2KA7A 2XN9C 2E2HB 1K83B 2Y0SB 1UNSA 5EPJA 4S3SA 3KK7A 2BA1A 2AWOA 3C2PA 1X32A 5ELCA 2B2WC 5AFWA 4YIJA 4IUPA 3SVMA 5EKKA 3Q23A 2PW7A 2NVQB 2K5DA 2KOLA 3A8JE 4IUNA 3JAME 3K59A 2R6GA 2BCOA 3OIQA 2XVSA 2LMCB 1TWGB 4N9PA 2B2WA 3PUVA 3QOJA 2F0PA 1WD1A 1LTGD 2EJGC 2CW0D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UEA B;  5FO7 B;  2A73 B;  1BUV T;  1BR9 A;  3MA2 B;  1UAP A;  3T4A C;  3KLS A;  3OHX C;  5FO8 B;  3HRZ C;  3V96 A;  2QKI C;  2TMP A;  2E2D C;  2J0T D;  2XWJ B;  1OO9 B;  4FXK C;  2WII B;  2I07 B;  3CU7 A;  1JB3 A;  4FXG C;  1PXU A;  3HS0 C;  4ILW A;  2XWB B;  1D2B A;  3FRP B;  1GXD C;  3CKI B;  1BQQ T;  3G6J B;  5JPN C;  2A74 C;  3L3O C;  5FO9 B;  2ICE C;  2WIN B;  2B39 A;  3I70 A;  1XWE A;  5JPM C;  1JC7 A;  5FOB B; 
#chains in the Genus database with same CATH topology
 5KNB A;  1MIU A;  3GTG B;  1FR3 A;  3N52 A;  4JC0 A;  1EOV A;  4A3B B;  5I4D A;  2OTJ A;  1C8C A;  5ISR A;  4HSV A;  2A68 D;  3EA6 A;  1A2U A;  3MXN A;  2PW5 A;  3E9I A;  4JYA L;  1BQQ T;  2NZO A;  2A74 C;  1TQO A;  4EVO A;  2BOS A;  2Z0S A;  1KQS A;  1X65 A;  3EJI A;  5IGB A;  2H4O A;  2K05 A;  5C3E H;  1GJX A;  1BBX C;  4I7Z C;  2F0K A;  4G7Z C;  2B8F A;  5M5W H;  1SAP A;  1EQQ A;  1SMY C;  1JB7 A;  3S1M B;  2EYF A;  3BZK A;  1N32 L;  4QY7 A;  4BBS G;  2E75 C;  3R2I A;  4CDC C;  1GHJ A;  5COY A;  3RN2 A;  3DWP A;  1VQL A;  2D0O A;  5JJI A;  1RHP A;  2WKD A;  1W2B A;  2TSS A;  1NUC A;  2F0D A;  2G9D A;  2J7Z A;  3A8I E;  5A2Q E;  1FD7 D;  5LMU L;  3GTM H;  2YTY A;  3M4Y A;  4LF7 Q;  1PTO F;  3O13 A;  1ILQ A;  2E74 C;  4V19 0;  1T5X D;  4A3C G;  3CCE A;  1CK1 A;  4A3F G;  1XTC D;  3FVQ A;  3SK6 A;  4DUY Q;  3I70 A;  1DM0 B;  4POG A;  3TP6 A;  4PG3 A;  2F0U A;  1KRT A;  5IOC A;  1BR9 A;  3AB9 A;  1IBL Q;  1I4H A;  3SR1 A;  1YZ6 A;  4KY6 A;  3TP7 A;  1PZK D;  1N9W A;  3E3X A;  1VQ7 A;  3U50 C;  3RZO B;  4BY7 B;  3GTO B;  2NZH A;  1PXU A;  3I7F A;  3S2D B;  4K2L A;  2UXC L;  1CTM A;  1JJC B;  1A0I A;  2UXD L;  2RHS B;  1KAW A;  3S14 H;  4B9X A;  3U4Z A;  2QF7 A;  3EN2 A;  5CV8 A;  4CKE A;  2EPB A;  1SRO A;  1E2Z A;  2NVY H;  2LY7 A;  1YBY A;  1BCP D;  2Y0S G;  4A3E B;  2VXW A;  3TP8 A;  4E6I A;  2B2U C;  1G91 A;  4P72 A;  5IGF A;  4X65 Q;  2VNU D;  2PNR C;  4PZ7 A;  5EJW A;  3HOW B;  4CGY B;  1DON A;  4BBS H;  1ET9 A;  4CJ0 B;  3M7G A;  2XWB B;  2QA4 A;  4XYO A;  3OTO Q;  4JG2 A;  2ZXR A;  1ENC A;  3KLW A;  2O4X A;  3D0F A;  4FNF A;  1ENF A;  3TQY A;  1J5E L;  2B2T A;  4N8F A;  1AH9 A;  3TSS A;  1T9H A;  4R4Q A;  5BR8 L;  4DV5 L;  4WOR A;  4DR1 Q;  1MI2 A;  2NTS A;  2J0T D;  1X6O A;  1H9K A;  2OXP A;  4A3C H;  4B3M L;  1BCP B;  4QIW B;  4A3F H;  4H13 C;  2FJ2 A;  1EY9 A;  1EWH A;  1QUQ B;  1XWE A;  3PUY A;  2JP1 A;  2JA9 A;  3DHQ A;  4NW2 A;  2E5L L;  2LKV A;  3ULJ A;  4M1U B;  3D6W A;  3PIO 3;  5I2X A;  5JVH 3;  5I9P A;  1KNA A;  3TRE A;  1Y1W B;  4L5R C;  3AFQ A;  1L0W A;  2YTX A;  4DGZ A;  4TRD A;  3HKZ E;  5JAV A;  4KHV A;  4K5X A;  1ASY A;  4X3K A;  3PIO A;  1G6Z A;  4A93 H;  1DYQ A;  1HZ9 A;  1PH5 A;  4JYA Q;  3FRP B;  2K7V A;  2IW3 A;  1BBW A;  3LWE A;  4KY5 A;  4G7O C;  4FF3 A;  2WFW A;  4X3S A;  4B9W A;  3GTK H;  5E4W C;  2WKC A;  2E2H H;  3VR2 A;  3M9B A;  4LFB L;  4OWT B;  1DOM A;  1C48 A;  1LYL A;  3PUZ A;  1EL0 A;  1TII D;  3K5O A;  1I4Q A;  1PA6 A;  1SXT A;  1N32 Q;  1PRT F;  2VS1 A;  2EYL A;  2L9H A;  1LAC A;  4AYB G;  2GVB A;  4KKT A;  2NB0 A;  1WI5 A;  4KD4 A;  4Y7N H;  4RFB A;  1I4P A;  1H9J A;  2WV6 D;  4KJO A;  1NCV A;  4LF9 L;  3NEL A;  1BO0 A;  3JAM c;  4ZCK A;  1X54 A;  2NVQ H;  3OMC A;  1FJG L;  1LT4 D;  3HKZ B;  3RLO A;  3PO3 G;  3CCJ A;  1L1O C;  4DV4 L;  1KNE A;  2Z4H A;  2DJG C;  5C6A A;  2ID0 A;  1TWG H;  2GA4 B;  3K0X A;  1N36 L;  3GD7 A;  2F0F A;  2G5D A;  4ZUI A;  3HOY B;  3BYT B;  3CCQ A;  4RKL A;  1SRU A;  4IOC A;  2EY5 A;  1DZ1 A;  2MPM A;  1NBW A;  3SK4 A;  2D62 A;  3GTG H;  3NTH A;  1Q1B A;  3TEH B;  1R9T B;  5D3D A;  1EYC A;  2R93 B;  3S1N B;  1V1O A;  3H94 A;  5M3F B;  3TRZ A;  1S5C D;  1X3E A;  4BY7 G;  5FLX L;  2OCE A;  1CM9 A;  1JT8 A;  4GZY C;  2E2J B;  2UXC Q;  3G4S A;  1VMC A;  3TS2 A;  2UXD Q;  1Q3L A;  3UDX A;  3VR5 A;  5M5X B;  1D5Z C;  5IOD A;  3JAM i;  5DEH A;  3KBX A;  4MIU A;  2YU9 B;  2K6A A;  4NXN L;  2EE1 A;  2KVM A;  1HCZ A;  1HZC A;  4HMJ A;  3HG9 A;  5EGT A;  2ZXP A;  4IO9 A;  3IFT A;  3L2P A;  1W3S A;  4HIM A;  1HA6 A;  3PF5 A;  4MHE A;  3BG3 A;  5ELO A;  4GNX A;  3HOW G;  3S1M H;  2PCF B;  2SNS A;  1B50 A;  3A7L A;  1OO9 B;  3PSI A;  3CU7 A;  1MSG A;  1PH9 A;  4OXP A;  2UXB L;  4JI4 Q;  3NE5 B;  2IPK D;  1QNK A;  1YNN C;  2VQF L;  4YWL A;  3BVM A;  4IUQ A;  3ZYY X;  2J4X A;  4DR3 L;  1BUV T;  3C3L A;  1G2T A;  1J5E Q;  2DNC A;  2RCF A;  3T51 B;  3NHH A;  4C3H B;  3UE1 A;  5JJL A;  5BR8 Q;  4DV5 Q;  3PO3 H;  5IYB G;  3IKJ A;  3LX0 A;  1AZQ A;  1EFW A;  2PQA B;  4B3M Q;  4DV1 L;  1KAA A;  2NVX H;  1EUJ A;  1STN A;  2CQA A;  3I73 A;  2E5L Q;  3HFZ B;  3NBH A;  1KDB A;  2MFI A;  1ET6 A;  3I4M G;  2I46 A;  4G4K A;  4FDB A;  1S4Z A;  4B08 A;  3BVG A;  4IOA A;  1Y1W G;  3GQB A;  3GDE A;  1TWF B;  3EFX D;  3CME A;  1RJT A;  1NJI C;  3A5Z B;  1Y8O B;  4ME3 A;  4C2M H;  1QB5 D;  2F3W A;  2XSC A;  3RZO H;  4BY7 H;  1KHI A;  4EQN A;  4UY8 C;  5D14 A;  2F3I A;  2A6E C;  1STG A;  2AMC B;  2LXJ A;  4H7B A;  4ILW A;  3S2D H;  2BH8 A;  1MHW C;  1SJH D;  3L0O A;  3CC7 A;  1D1I A;  2IT1 A;  3D31 A;  1PH7 A;  5E7N A;  5FOB B;  2RDF A;  1R4P B;  1KDC A;  4A3G G;  5KYL A;  4LFB Q;  2F0T A;  1X55 A;  2F0W A;  1F77 A;  2KJX A;  4JVZ A;  1EYA A;  4PV1 C;  3F2U A;  3HOW H;  4IPD A;  2JN4 A;  3CF5 A;  4R9W A;  2B8G A;  4F87 A;  2YV5 A;  1NY4 A;  5IYC G;  2F1M A;  3J7A V;  1PH8 A;  3M3Y B;  4HCE A;  4NB3 A;  5FO9 B;  2A6H D;  3MXP A;  2IHF A;  4LUV A;  2OQ0 A;  5C5M A;  3PIP 3;  4LF9 Q;  5HY6 A;  5C3W A;  1B44 D;  2EZV A;  1SFO H;  4BBR B;  4WJ4 A;  3CCV A;  5EQ0 A;  1FJG Q;  2KHI A;  4WFN 3;  4Y52 H;  2PI2 A;  3MEH A;  4FF4 A;  3K57 A;  5IYB H;  3PIP A;  4DV4 Q;  1HTP A;  3HOZ B;  2E2D C;  4XTC S;  4TVA B;  1N36 Q;  2AKW B;  3HEJ A;  4A4I A;  3W2D A;  1VQJ A;  3HOY G;  4CDE C;  1YHB A;  2H5X A;  2BDO A;  4OWW B;  1FGB D;  4QJF A;  2N3S A;  4RHS A;  1TS3 A;  1AP0 A;  1KAB A;  1MJC A;  1K28 A;  4JI3 L;  1I4X A;  1VF7 A;  3G71 A;  1F9S A;  3I4M H;  1H9S B;  5D65 A;  3MZ5 A;  1AE2 A;  4QUC A;  3PUW A;  4X64 L;  1S5D D;  1A62 A;  1Y1W H;  1XYI A;  1GUW A;  3QO2 A;  2CFM A;  3S17 B;  2K52 A;  3TN2 A;  3E6Z X;  3M4P A;  4FXK C;  4HN7 A;  1DXM A;  1CQV A;  3KDF B;  4YCU A;  3UDF A;  1K8O A;  4JBW A;  1RD9 D;  4GS3 A;  5CR3 A;  2NWG A;  4NXN Q;  4JBJ A;  2HQE A;  1V1P B;  2F0Q A;  1XPO A;  1UE6 A;  1SE2 A;  2K75 A;  2KUM A;  1I4R A;  4DV3 L;  1GUN A;  3S2H H;  1IXR A;  2AQ3 B;  2ZJR A;  1M4V A;  1CZG A;  1HHV A;  1O7L A;  2UXB Q;  1EEF D;  1SNQ A;  2EYO A;  3C1E A;  4FXD A;  2VQF Q;  3G48 A;  5IYC H;  1SNC A;  2OT2 A;  2L11 A;  2XNA C;  1VQP A;  4ME5 A;  5D3I B;  5ELB A;  4DR3 Q;  4A3K B;  1X3P A;  2A73 B;  1KDA A;  3J7Z C;  4C3H G;  1SNP A;  1GD7 A;  3ZJY C;  3OMG A;  1PLF A;  3S16 B;  1LTS D;  1SYB A;  4QL5 A;  1VQK A;  5JVG 3;  1OXV A;  3TME A;  4OIJ A;  2HCC A;  3K7A B;  2D5D A;  3F2C A;  2Y0S E;  4DPG A;  3SXH A;  4DV1 Q;  5GAE C;  1HUM A;  2A5H A;  4L5Q A;  3HOY H;  1A8V A;  4H0L C;  4A3F B;  2RSO A;  3CAM A;  1E7Z A;  1AEX A;  3ER0 A;  1XJV A;  4APV A;  4CDD C;  1CI3 M;  4OHJ A;  3NWT A;  4EQP A;  1A2T A;  1H95 A;  2M2L A;  1E24 A;  1WJJ A;  1R9T H;  2OWO A;  3E5S A;  4MTN A;  1BOS A;  3S1N H;  1HXY D;  2XRQ D;  5T1G A;  4L5T A;  4J8Q A;  5E3F A;  2R61 A;  3NEM A;  3T53 B;  1ZYR D;  1JB3 A;  2VB2 X;  2E2J H;  5M5X H;  1P8L A;  2F03 A;  3F8T A;  3GO5 A;  2VB3 X;  2N78 A;  3H0G G;  2YU9 H;  1ZXT A;  5LMN L;  3L7Z C;  3DXJ C;  1PH1 A;  2K03 A;  1ESF A;  2BE5 C;  1D8L A;  1JQY D;  4YHH Q;  1B2T A;  4H02 A;  5KNC A;  1EY5 A;  1SND A;  1VQC A;  4IN3 A;  2I07 B;  4C3J B;  3P7J A;  2WAQ G;  3PF4 A;  4OO1 I;  5IP9 G;  1Z9F A;  2IX0 A;  1WTX A;  4ALP A;  2KCM A;  1A15 A;  3H3V H;  1X3G A;  5C4Z A;  1K8M A;  3S9W A;  2ZTE A;  4Y7N B;  2PZT A;  4BBR G;  2B29 A;  2EY2 A;  1JJG A;  4JW0 A;  1FNV A;  4X6A H;  2NYZ D;  5DLQ E;  4C3H H;  3NQT A;  3GTJ B;  2CH4 A;  1K8G A;  4P75 A;  5GAG C;  4DAP A;  3HOZ G;  1RCV D;  1G29 1;  2MO1 A;  1Y8P B;  2XRS D;  1STE A;  4NMZ A;  3D4W A;  4DN4 M;  2WB1 B;  3MFY A;  4IZ8 A;  2R7D A;  5C0X G;  4JI3 Q;  2NVT H;  2VZA A;  3EIV A;  1IHZ A;  4X62 L;  2ES2 A;  1O80 A;  4IFD I;  4X64 Q;  3KYH C;  1HZA A;  2CQO A;  1TWF H;  4HID A;  2F0L A;  4RHR A;  1I6H B;  3KBG A;  5C5L A;  1CUK A;  4J15 A;  4JPB W;  4KN4 C;  3H0G H;  2PMZ B;  4ABN A;  4ZYS A;  1VQE A;  1VQB A;  3TZU A;  5JJK A;  4DV3 Q;  3NEN A;  1CSP A;  2VL6 A;  3DEO A;  2PO4 A;  2OTL A;  2F0S A;  4OL7 A;  2CVR A;  3HP3 A;  2PYK A;  3K5N A;  4M8A A;  1F2L A;  3TZD A;  1PVO A;  3BZC A;  1TU2 B;  1JOK A;  2N88 A;  4L6T B;  1Z47 A;  5IP9 H;  2SDF A;  5EPK A;  3K8A A;  4ZKB B;  5K36 G;  1OTC A;  3M3Y H;  2KEE A;  2X6L A;  4LK1 C;  3D8G A;  3SK8 A;  4AYB B;  5M3M G;  2MHV A;  4GOP C;  5CV5 A;  1U4R A;  1D5M C;  4A3K G;  3CP0 A;  4PZ6 A;  4BBR H;  1EWC A;  1STY A;  3I8Z A;  1EY8 A;  3P1H A;  2ZM6 L;  4K5V A;  2CH4 W;  3HOX B;  3BS1 A;  2IX3 A;  4FF1 A;  3D6C A;  3PO3 B;  1PTO B;  3HOZ H;  1EOT A;  5GRO A;  2R3Z A;  4IUU A;  5JEA G;  1ZYR C;  2VQE L;  2DN8 A;  2LXK A;  2Z6K C;  2EJF C;  4BY1 G;  2NVX B;  4ODG A;  3G6J B;  2HDL A;  4V0B A;  1B9M A;  2WIN B;  5C0X H;  5ELF A;  2ZJQ A;  1ICF B;  2Z8L A;  4ID6 A;  4Q0F A;  4X3U A;  4GOP A;  1RTO A;  2P5Z X;  1VQA A;  3V05 A;  3TS0 A;  2QEJ C;  3OHX C;  1XNR L;  2HIV A;  3S17 H;  4DAY B;  1U4P A;  4RGO S;  4CDF C;  4C2M B;  3LGJ A;  1E2V A;  4O0A A;  3TP5 A;  3MXG A;  4DV0 L;  3IRB A;  3CKI B;  1UWV A;  4XQQ A;  5LMN Q;  2AQ2 B;  3NQI A;  2Z6K A;  3DWA A;  3CMA A;  4QIW E;  3PO2 G;  4HMI A;  2MGS A;  1QVG A;  2RHQ B;  1E2W A;  4DUZ L;  3H6M A;  3B6Y A;  1JOQ A;  1FL0 A;  4PMB A;  5CYU A;  4R1J A;  5AJ3 L;  1EEI D;  4C3J G;  1WTQ A;  2PPB C;  3D4R A;  4K2K A;  5ELN A;  4JI4 L;  5I9O A;  5K36 H;  2G9H D;  1U4L A;  3RD4 A;  1RTN A;  5HGT A;  2EJM A;  4HJ8 A;  5M3M H;  1HQM C;  4RGM A;  2CW0 C;  4DV6 L;  1TR5 A;  4LJZ C;  5C4H A;  4A3K H;  4PNY A;  2HHH L;  2UUA L;  3D4D A;  1SFO B;  1VQ5 A;  3PMF A;  1I5F A;  5L37 A;  1VQ9 A;  3S16 H;  4K6L A;  2A68 C;  3K7A H;  4P73 A;  3FHW A;  3HOV B;  2JK8 A;  1EQT A;  4LF8 L;  2KHJ A;  3ITP A;  5JEA H;  1XXG A;  1PYW D;  2B2U A;  5J39 A;  2RVL A;  4RA8 A;  1K3R A;  3OSO A;  4BY1 H;  1EU4 A;  4CBV A;  2WB1 G;  3RUZ A;  2NTT A;  4X62 Q;  3CC2 A;  3DMU A;  1A63 A;  4NKL A;  4JOI C;  4A75 A;  4N8X 1;  4HCS A;  4AH6 A;  5FLX c;  1O7Y A;  3AYH B;  1VCI A;  4QQB X;  1KLG D;  3I4M B;  1L0Y B;  5H1S E;  1WTO A;  3OWE B;  1PDQ A;  4RG1 A;  3IFD A;  2M9V A;  1GKH A;  1FNW A;  2NN6 G;  4LF6 Q;  4KN7 C;  1W6K A;  2EDG A;  5CMD A;  2EY6 A;  3H09 A;  4JI0 L;  5ELE A;  5CBE E;  1TXY A;  2F0M A;  3I2Z A;  2Q2U A;  1KLU D;  2KQ3 A;  1ZKO A;  4FXG C;  1LTR D;  2AWN A;  1LTI D;  1SE8 A;  3PO2 H;  5FO7 B;  3CRK C;  3MAQ A;  1EIF A;  4A3G B;  3ULP A;  2L4N A;  3I90 A;  1D1K A;  1HFG A;  1QWY A;  4B3T L;  3S2H B;  2YYZ A;  3K81 C;  1JOO A;  3BDO A;  5C0X J;  1PRT B;  3DM3 A;  1AE3 A;  4C3J H;  5KEE A;  4IUR A;  1SN8 A;  3X3M A;  4DR5 L;  2QW7 A;  1C0A A;  3QWN A;  2MQH A;  1Q81 C;  1LTL A;  1CHQ D;  1Z7T A;  4DV7 L;  1JC7 A;  1JCK B;  4TSS A;  3W3A A;  2KCC A;  2VY3 A;  2ZM6 Q;  3LNN A;  3GTJ H;  1JWS D;  2IX1 A;  3HOX G;  3FKI G;  5A35 A;  2K33 A;  3WDN A;  1B3Q A;  1N34 L;  1SBB B;  2VQE Q;  3Q24 A;  1U4M A;  3IAY A;  2R7F A;  2E2I B;  5I6W A;  3VYS A;  4I7A A;  2ZTD A;  3A0J A;  3IL8 A;  1W6J A;  1NNX A;  3I4L A;  1SNO A;  3LWU A;  3MFG A;  2JEB I;  2DJF C;  3I91 A;  1F9Q A;  2M00 A;  1BCP C;  1XNR Q;  1EYD A;  4A3L G;  5J1Z A;  5GAH C;  3GTP B;  1I6H H;  5C4X G;  1UE1 A;  2NN6 H;  3CHB D;  1IL8 A;  1II3 A;  1WTV A;  1JE5 A;  1WTH A;  1H9M A;  1PZJ D;  4DV0 Q;  1L1O A;  1M90 C;  2QIL A;  1CKN B;  1S5B D;  3Q0A A;  3G7L A;  1TWH H;  1Z6H A;  5I2Y A;  3NSW A;  2RDH A;  5JEA J;  1B9N A;  2F52 A;  3KJP A;  1QZG A;  4DUZ Q;  1TWC B;  4K0K L;  4DF7 A;  2RCN A;  5IGG A;  2F0O A;  4FF2 A;  4R8N A;  1XX8 A;  5AJ3 Q;  4K5W A;  4JK1 C;  1UUP A;  1NR4 A;  1LUZ A;  3OPO A;  5C3X A;  5FK9 C;  2BH2 A;  1OXX K;  1G6P A;  4HED A;  3T16 A;  3I55 A;  5C44 B;  2FXQ A;  4DV6 Q;  1MGS A;  3FDT A;  2HHH Q;  4ZAI A;  2K5V A;  3J81 E;  1Q1E A;  1GUG A;  3RN5 A;  2UUA Q;  3E0E A;  4JI7 L;  4LUO A;  4FYD A;  3BDC A;  1V8Q A;  4WJW A;  3HOX H;  3FKI H;  1PTO H;  1QVC A;  3HOV G;  1QCB D;  4LF8 Q;  1TS2 A;  4LFA L;  4C56 C;  3CRL C;  1EIG A;  4NP5 A;  4DNT B;  2B2Y C;  3KF8 B;  5JJZ A;  1GUT A;  2XTI A;  3E9H A;  5BN5 A;  1LM0 A;  1SE3 A;  2WAQ E;  3UDI A;  1ASZ A;  2NVT B;  2ALY B;  2I5L X;  3UI2 A;  5EAY A;  1O7Z A;  3RNU A;  1HRJ A;  1VQ6 A;  2C35 B;  3KLS A;  4A3L H;  1FVI A;  3W1G A;  2IHE A;  2WP8 J;  5C4X H;  2UU9 L;  2K5N A;  1HUN A;  4JI0 Q;  1TWA H;  1F2Y A;  1B3A A;  5LL6 X;  3L3O C;  2ICE C;  5KYI A;  3CW2 C;  4BS9 A;  3H0G B;  3FMC A;  2N55 A;  1PH2 A;  1AW7 A;  1ML0 D;  3Q22 A;  4LMQ D;  1V9P A;  4CJ2 C;  4EGV A;  1KD1 C;  4B3T Q;  5EBD A;  1RL2 A;  4LFC L;  1BKB A;  2IWH A;  1E1O A;  2Q8I B;  4AIM A;  2PZU A;  4YHH L;  2RQX A;  2ZJP A;  4BA2 I;  4QMG A;  1CSQ A;  1CFM A;  3CCS A;  4ZK9 B;  4GN3 B;  3S1Q B;  2WAQ B;  4DR5 Q;  2KCN A;  3BZD B;  1I50 H;  1B1Z A;  4DV7 Q;  1Q8K A;  2EY1 A;  4LAA A;  5M9O A;  4KK7 A;  4K14 A;  5LHY 1;  4A3I B;  1FGU A;  5TSS A;  3H15 A;  1N34 Q;  3NP8 A;  3H3V C;  2QKI C;  3HOV H;  5BN3 A;  3ULL A;  1V1Q A;  3SE0 A;  4IPH A;  2I0Q A;  2OQK A;  5FLM G;  1HNX L;  3ICE A;  5ELD A;  3RMH A;  3ERO A;  4R4T A;  1DJR D;  4IUV A;  4AQY Q;  4NPS A;  4DR6 L;  3W1B A;  3VR4 A;  2HIX A;  2F3V A;  5DAU A;  1KTK A;  1QJO A;  3VA5 A;  3M7N A;  4GKK L;  3AQQ A;  3G6E A;  1B4O A;  2SOB A;  3A74 A;  4RGN A;  2A8V A;  1IBM L;  2Q2I A;  1ZEQ X;  3QR8 A;  1EWI A;  3VYR A;  3NXW A;  1EIY B;  3MWY W;  1TS5 A;  1U0L A;  2JE6 I;  4DA2 A;  2KED A;  3K58 A;  1S40 A;  3Q8D A;  4FO2 A;  5C4J H;  2ZTC A;  1E1T A;  4KD3 A;  4K0K Q;  1PFB A;  4A3G H;  5LMN W;  1WD0 A;  1K9M C;  2KEC A;  2K5H A;  2PQA A;  2ENB A;  2HUG A;  1DOL A;  1IKM A;  1D6E C;  4JBM A;  1XNQ L;  4DAM A;  1GUO A;  3KF6 B;  5DNF A;  2ZT9 C;  4XIG S;  4I65 A;  5IT9 L;  1CHP D;  1Q8I A;  4DR2 L;  1VQ8 A;  4RAU C;  4Z9C B;  5C44 G;  5M3M B;  3DM1 A;  1JJ2 A;  1FNU A;  1I94 L;  4JI7 Q;  3T13 A;  4OEM B;  2X6G A;  1IYV A;  1VQI A;  2QGQ A;  4LFA Q;  2EYP A;  5J3B A;  4JI8 L;  1STB A;  3TBI B;  3BYY B;  2ATW A;  1WTR A;  2WII B;  3U9O A;  3OOC A;  2E2I H;  3C46 A;  5FLM H;  3MVV A;  2EQS A;  1PH6 A;  3MXN B;  1BNZ A;  1Q90 A;  2QDL A;  4R4C A;  1BXT A;  4BY1 B;  4DU9 A;  4L5S A;  2SEB D;  4TQU S;  2RSN A;  3CC4 A;  4ZKC B;  3ND9 A;  3PGZ A;  2IJ0 A;  3A8K E;  3PQI A;  2O5J C;  3A55 A;  4DNI A;  3S15 H;  4BA1 I;  1YNX A;  2HT1 A;  4JI2 L;  1Y69 U;  1TVX A;  3GTP H;  1HR0 W;  1XPR A;  4IAL A;  2R92 B;  2UU9 Q;  2XGT A;  2DNE A;  2NBF A;  3HOU B;  2EYM A;  3GTQ B;  1LT3 D;  5GAD C;  5JPN C;  3S1R B;  2BDN A;  1N33 L;  2EYH A;  2A6H C;  2ASB A;  5K5P A;  1VQO A;  2L15 A;  1HH2 P;  3FEW X;  1JE4 A;  5DM6 3;  3PO2 B;  1TWC H;  1SYC A;  2WB1 E;  1TT2 A;  4Q5V A;  4FVM A;  4LFC Q;  1YI2 A;  1U9R A;  1X3F A;  4WRD A;  5G3L F;  1SNM A;  4MN3 A;  2JA5 B;  4UPA A;  1FYC A;  1NMG A;  1VQH A;  3I4N G;  1EY7 A;  3GV6 A;  4C3I G;  4POF A;  5KRU A;  2HD3 A;  3GV3 A;  1MKH A;  3Q6S A;  1WOC A;  2CWP A;  2AUK A;  1IYJ B;  1BDO A;  5C44 H;  1H9S A;  2PZW A;  4IJH A;  3KOJ A;  1J8I A;  5J22 A;  4XT3 B;  3OWF A;  1HPC A;  2C5C A;  1EQV A;  1WVL A;  4A3I G;  3MA2 B;  2PMZ E;  2Q8R E;  2JSO A;  1RIP A;  2JA8 B;  1IW7 D;  4L8J A;  4K6D A;  4O42 A;  3KDF A;  1K8A C;  1NMF A;  4MZ9 A;  3QIA A;  1A3U A;  1VQG A;  4K8J A;  4RMF A;  4X66 L;  1EY4 A;  4JI1 L;  1HNX Q;  1T5E A;  4A76 A;  3DEP A;  1EZ6 A;  3SEB A;  5IWA L;  3I4O A;  3J80 E;  1V1P A;  3KJO A;  4DR6 Q;  5FJ8 G;  4IUT A;  3T1Y L;  1VMP A;  3M85 A;  2LFN A;  2JA6 B;  1X3Q A;  1WCM B;  3H91 A;  2KBN A;  5EPL A;  1CQF A;  2X69 A;  4GKK Q;  4KMU C;  4AYB E;  4JBK A;  1HR0 L;  2FMC A;  1IBM Q;  1QG7 A;  1CA6 A;  1ONL A;  3DLL A;  1C4Q A;  1L0X B;  1NSN S;  1SYF A;  1O78 A;  1MSH A;  1JWM D;  4J1M A;  4XT1 B;  4LF6 L;  1YJ9 A;  1G2S A;  2RF4 A;  3AU7 A;  1GXD C;  3K80 C;  2CCZ A;  1NR2 A;  4HR7 B;  2K01 A;  3V2T A;  4RCN A;  4XXE A;  2UUC L;  1TWH B;  2PQE A;  4RGT A;  1PTO D;  2FHT A;  2K4K A;  1I4G A;  2UUB L;  4O1N A;  1TY2 A;  1P16 A;  1LTA D;  1HJP A;  4YWM A;  1XNQ Q;  3KFU A;  4IPG A;  2TMP A;  4MNO A;  5HGQ A;  4F7X A;  4XDX A;  4G7H C;  4RH6 A;  2B2V C;  3I4N H;  3S1Q H;  1RDP D;  4YY3 L;  4C3I H;  1KIX A;  4EQO A;  4C1N K;  3U58 A;  4DR2 Q;  2DGY A;  1VQM A;  1I94 Q;  3GP7 A;  4CKB A;  4KHP L;  3FPU B;  1RF2 D;  3EVQ A;  4H44 C;  4KI0 A;  3NK9 A;  4UAI A;  2F0V A;  4A3I H;  1UAP A;  2ICI A;  3R93 A;  1SE4 A;  4KTA A;  3J81 L;  2O2L D;  4DR7 L;  1VDZ A;  5IP7 G;  3FKI B;  4JI8 Q;  1F9R A;  1CA5 A;  1TY0 A;  3A54 A;  3QJY A;  3D3R A;  1B53 A;  4O2D A;  3NTI A;  1EU3 A;  2B2V A;  2Z1C A;  5FJ8 H;  4KV6 A;  1YVC A;  3VA7 A;  4JI5 L;  1E22 A;  4HJ5 A;  4A3J B;  3A56 A;  4JI2 Q;  3M4Q A;  4NDX A;  1I3Q B;  3QOL A;  4GN4 B;  4KLK A;  3V96 A;  1SJE D;  2R92 G;  1PZI D;  4HAE A;  2R7Z B;  1F2M A;  4GLV B;  1S5F D;  3HOU G;  4BWG B;  5E4X A;  2KEN A;  4R8I A;  3FPP A;  1JWU D;  5C4X B;  3A7A B;  2JYO A;  1K3B C;  4QUF A;  2K1B A;  3JC6 6;  1N33 Q;  4R4I A;  1M8A A;  1TWA B;  1F2Z A;  1X9N A;  3RZD B;  3F2B A;  4P71 A;  4RCO A;  2EYJ A;  1DD2 A;  2KHS A;  4YCW A;  3NUC A;  1PV4 A;  3RLN A;  1IW7 C;  1NTG A;  4F8M A;  3VR6 A;  2JA5 G;  5IT9 E;  3J7A 5;  4A93 G;  2CHB D;  2EIF A;  1EYG A;  1VQ4 A;  2EXZ A;  1QE6 A;  1BBU A;  2D9U A;  1YEZ A;  4DFA A;  2EOT A;  2C9O A;  5HUR A;  2SNM A;  1EY6 A;  2B2T C;  2D2C C;  5JPM C;  5CBA E;  1I50 B;  1YHA A;  5CV7 A;  1EY0 A;  2I5H A;  3CCU A;  4A3D B;  2RA4 A;  4HIK A;  2L1B A;  3CCR A;  4UDU C;  1YIJ A;  3RLF A;  3KLR A;  4QCL A;  1Q46 A;  2JA8 G;  2A69 D;  5IY0 A;  5IP7 H;  1Q7Y C;  4QF4 A;  4X66 Q;  2Z9H A;  2L5T A;  4OGQ C;  5JOB A;  4JI1 Q;  1A3V A;  3UE0 A;  5IWA Q;  4HJ7 A;  3MC0 B;  3T1Y Q;  1L1O B;  3ERQ A;  2JA6 G;  1WCM G;  1PTO C;  2RBM A;  1M1K C;  1HNZ L;  1PRT D;  1HR0 Q;  1E0B A;  1Y1V B;  2DUD A;  3T4A C;  1DGS A;  4LF4 L;  2K04 A;  1PFS A;  2R92 H;  1CZW A;  3HOU H;  3EBE A;  4GNX B;  1BCP F;  1VQD A;  1BF4 A;  3GTQ H;  1QZH A;  4DXF A;  1YNN D;  4C1N I;  3S1R H;  1AFP A;  3H3V I;  4UP7 A;  2UUC Q;  3STB D;  1UE7 A;  2H1E A;  4DK6 C;  3K6O A;  5C4J B;  2F4V L;  1ICW A;  2UUB Q;  4G57 A;  2Q2T A;  4A3B G;  1QOH A;  4CKC A;  3SK5 A;  4JOI A;  2Q8T A;  2MO0 A;  5M5Y H;  2MNA A;  2JA5 H;  4K8I A;  3BVZ A;  1H9R A;  5EBC A;  1IYU A;  3MEF A;  4YY3 Q;  1I6V C;  3HS0 C;  3L9A X;  3PUX A;  1IBK L;  4HJA A;  5EKL A;  4TKO B;  4NXM L;  2EXD A;  5CV6 A;  5KND A;  1EQR A;  1YNJ D;  4ZUJ A;  4KHP Q;  2DY7 A;  1XMO L;  2L0C A;  3NBI A;  2QEX A;  1SEB D;  1OXS C;  4JCV E;  1K83 H;  3WWV A;  3NBH B;  2QDB A;  4DAY A;  2RKS A;  4DR7 Q;  1JIC A;  2JA8 H;  4DV2 L;  4DK1 A;  1RKN A;  1AZP A;  2F0N A;  1S5E D;  3J80 c;  3VDY A;  2A6E D;  4KKS A;  1O7I A;  2PI2 E;  4ULL A;  1HA5 A;  4QGU A;  2NZ1 D;  2LS0 1;  3WOF A;  4AQY L;  2JA6 H;  5IYD G;  3N6R A;  1WCM H;  2AQ1 B;  3RR5 A;  4JI5 Q;  1HQR D;  3F2D A;  3CQZ B;  5LMU Q;  3HKS A;  1GM5 A;  4A3J G;  3ONA B;  2F0J A;  2F0E A;  1Y8N B;  3J7A F;  3S15 B;  1YJW A;  4GLA C;  4PZ8 A;  2R7Z G;  4EQ5 A;  1V43 A;  2HCI A;  1OXT A;  2JA7 B;  2VUM B;  4OO1 G;  1PFN A;  1GHK A;  4KJN A;  1LLR D;  1DOK A;  4X3T A;  2ZXO A;  4DK0 A;  3OW7 A;  1D2B A;  5I6Y A;  1D5X C;  4PMW A;  1A3T A;  1EZ8 A;  3TDQ A;  1UEB A;  4F88 A;  5KGU A;  3AMU A;  4GNX C;  3J80 i;  3M4O B;  1VQF A;  4A3B H;  4U67 3;  4OX9 L;  1XMQ L;  2A69 C;  2E8G A;  5CV9 A;  1R4Q B;  1HTL D;  5T1I A;  2D0P A;  1B7Y B;  2JJQ A;  5FKA C;  1PH3 A;  3HGB A;  4KY7 A;  1QUQ A;  2K32 A;  4ZLT F;  3BDL A;  5LL6 S;  5CC4 A;  4A3D G;  5C0X I;  4UHV A;  4R4O A;  3K5M A;  1SDF A;  1SLJ A;  3WOE A;  4LF5 L;  1PRT C;  1HNW L;  4A3E G;  3I3C A;  1ILP A;  4IFD G;  4JI6 L;  1PYS B;  3PCO B;  4YCV A;  4L63 B;  3MHB A;  3KUP A;  4WJ3 M;  3K5L A;  2IY5 B;  2XWJ B;  2B63 B;  4B3R L;  3P75 A;  1ESR A;  1G8Z D;  1GVP A;  1NAP A;  3STB C;  1Q12 A;  4ZQ3 A;  3NWS A;  3CCL A;  4B3S L;  2AUJ D;  3R2T A;  5IYD H;  1LV9 A;  1DCZ A;  1UEA B;  1SR3 A;  1SYE A;  4PQX A;  3SDZ A;  3J80 L;  1MJE A;  1HNZ Q;  2Q2H A;  1Y1V G;  1N8R C;  4A3J H;  4LF4 Q;  2OEO A;  2A19 A;  3NPP A;  4DR4 L;  1I3Q H;  4GKJ L;  1Y14 B;  1MD2 D;  2R7Z H;  2K5Q A;  4J6H A;  3MXU A;  4A3M B;  1Q86 C;  4ZRZ A;  5CGK A;  3JAM L;  4OO1 H;  4HSP A;  1WTW A;  1HFN A;  1WFQ A;  1YNJ C;  2L55 A;  3NTK A;  2MJ8 A;  4BXX G;  3P20 A;  3RZD H;  1S72 A;  2F4V Q;  3GTL B;  2B2Y A;  2Z6B A;  4IQZ A;  4OEL B;  2GVA A;  3VYU A;  5IT9 c;  3I56 A;  4LNQ A;  2BA0 A;  3OYY A;  2GN5 A;  4OIK A;  1STA A;  3HZX A;  4GN5 A;  2NUC A;  3K0Y A;  4CHT B;  3GTO H;  1LT5 D;  1IBK Q;  3AEV A;  3I4N B;  1AN8 A;  4NXM Q;  1PH4 A;  1G51 A;  4KKU A;  4C3I B;  1JR0 D;  1F9P A;  3AFP A;  4PMC A;  1XMO Q;  2V1C C;  4LUZ A;  3ND8 A;  4A3D H;  2XIW A;  2VW9 A;  5CV4 A;  5IIF A;  5C3E B;  4A3E H;  4IFD H;  3KLS X;  1STH A;  1XPU A;  4DV2 Q;  4JV5 L;  5M5W B;  4OON A;  3HRZ C;  3T56 B;  3URY A;  1CKN A;  4DXG A;  4GLX A;  1SMX A;  2FMM A;  1GUS A;  3J7Y W;  1SSO A;  5F2D A;  3VYT A;  1K73 C;  3E0J A;  3C1F A;  2JXM B;  1QNU A;  1YJN A;  1S3O A;  3OW2 A;  3HKZ G;  1Y1V H;  1EIH A;  1D7Q A;  2BE5 D;  5IGC A;  1UE5 A;  2WAC A;  5A2Q L;  3GTM B;  5FO8 B;  4U68 A;  1MBY A;  2KCT A;  2JA7 G;  1CKM A;  2VUM G;  3T1H L;  2AHO B;  5E1F A;  2L12 A;  1Q82 C;  1IL2 A;  1BVS A;  4XQJ A;  1LO5 D;  1LT6 D;  2F0G A;  5IE8 A;  1PFM A;  5KIX A;  3CCM A;  2JQO A;  4DKA C;  4BXX H;  4DNR B;  1QIL A;  1WYD A;  1QVF A;  4XYQ A;  2O5I C;  3MTS A;  1VQN A;  4OX9 Q;  1XMQ Q;  2R93 G;  2K5W A;  3CXC A;  1PYB A;  5M3F G;  2MUY A;  2IL8 A;  4QB4 A;  4XQN A;  3SHL A;  2YTV A;  3R3O A;  1U5K A;  1K0S A;  3KF8 A;  2DY8 A;  1E3P A;  2V4D A;  1B8A A;  3W5O A;  1TKW B;  4N9T A;  1XTD A;  2HDM A;  1PMR A;  3S14 B;  1GOZ A;  5NUC A;  2LSS A;  4LF5 Q;  1HNW Q;  2NVY B;  4JI6 Q;  4UP9 A;  3QB3 A;  3F1Z A;  1J9O A;  4CJ1 B;  5COR A;  2K50 A;  4B3R Q;  1JMC A;  2NN6 I;  2B63 G;  2K14 A;  4BBS B;  2MP1 A;  3BJU A;  3U4V A;  1C9O A;  1X56 A;  1SYD A;  4EX5 A;  4B3S Q;  5BN4 A;  1L2F A;  2OF1 A;  1CT1 D;  4KHZ A;  5G3L D;  1LAB A;  3CQZ H;  3U9S A;  4DAV A;  1K0R A;  1IZ6 A;  4UP8 A;  4DR4 Q;  3UDG A;  1KC8 C;  3CPW A;  2QCP X;  2N8N A;  4GKJ Q;  1IKL A;  4A3M G;  4LF7 L;  1SMY D;  1KRS A;  5DM7 3;  1KL9 A;  3EQL C;  4P2C B;  1YHQ A;  3DWQ A;  2JA7 H;  2VUM H;  2FFK B;  3OIP A;  1LTB D;  2K28 A;  1SYG A;  2N49 A;  3R8B A;  1ENA A;  4IFD J;  4YWK A;  1LTT D;  2B39 A;  4LWC A;  2RDG A;  3I72 A;  4DUY L;  2I5M X;  2F4I A;  1YIT A;  4HTH A;  3FP9 A;  1ROD A;  3PV0 A;  3DUZ A;  2Z4I A;  3M4O H;  1IBL L;  1A6X A;  2R93 H;  1TS4 A;  5FLX E;  5IGE A;  2F0H A;  5EKI A;  5M3F H;  1VF5 C;  1NE3 A;  2A1A A;  1EFI D;  4RWS C;  2CWA A;  2EVB A;  5M5Y B;  3K7U C;  3QG1 A;  3BU2 A;  2E76 C;  1WTP A;  3J81 j;  2FIN B;  1B70 B;  2F0I A;  4A93 B;  5IGD A;  4FP5 D;  1OXU A;  3J81 c;  4RKB A;  1JOR A;  3SGI A;  3X3N A;  3VR3 A;  2JEA I;  3GTK B;  4IJL A;  4DK3 C;  5C3E G;  2KA7 A;  2XN9 C;  2E2H B;  1K83 B;  2Y0S B;  5GQO A;  1UNS A;  5EPJ A;  4JV5 Q;  1GO3 E;  1HZB A;  4S3S A;  4GOP B;  3KK7 A;  3A5U A;  3ERS X;  2BA1 A;  1KXL A;  2AWO A;  4X65 L;  3C2P A;  1C7Y A;  1X32 A;  5ELC A;  2B2W C;  2B63 H;  5AFW A;  1PHJ A;  4P74 A;  4YIJ A;  2HQL A;  4IUP A;  3SVM A;  5EKK A;  3OTO L;  3S24 A;  2CKZ B;  3Q23 A;  2PW7 A;  2NVQ B;  2K5D A;  4LW1 A;  2KOL A;  1J6Q A;  3CD6 A;  3A8J E;  4MTK A;  4IUN A;  4OWX B;  3KF6 A;  3JAM E;  4IPC A;  2R6G A;  2BCO A;  3OIQ A;  3K59 A;  4A3M H;  2XVS A;  4DR1 L;  3J81 i;  3T1H Q;  4HIO A;  2LMC B;  1TWG B;  4HJ9 A;  2B3G A;  1CKO A;  4N9P A;  3CPF A;  2B2W A;  3PUV A;  3QOJ A;  2F0P A;  1WD1 A;  1LTG D;  2EJG C;  2PNH A;  1VS0 A;  2CW0 D;  3GTL H; 
#chains in the Genus database with same CATH homology
 5KNB A;  3GTG B;  1FR3 A;  3N52 A;  4A3B B;  5I4D A;  1C8C A;  5ISR A;  4HSV A;  2A68 D;  3EA6 A;  1A2U A;  3MXN A;  2PW5 A;  1BQQ T;  2A74 C;  1TQO A;  4EVO A;  2BOS A;  3EJI A;  5IGB A;  2H4O A;  2K05 A;  1GJX A;  1BBX C;  4I7Z C;  2F0K A;  4G7Z C;  2B8F A;  1SAP A;  1SMY C;  3S1M B;  2EYF A;  2E75 C;  3R2I A;  1GHJ A;  5COY A;  3DWP A;  1RHP A;  2WKD A;  2TSS A;  1NUC A;  2F0D A;  2G9D A;  2J7Z A;  3A8I E;  5A2Q E;  1FD7 D;  3M4Y A;  1PTO F;  3O13 A;  1ILQ A;  2E74 C;  4V19 0;  1T5X D;  1CK1 A;  1XTC D;  3FVQ A;  3SK6 A;  3I70 A;  1DM0 B;  3TP6 A;  2F0U A;  5IOC A;  1BR9 A;  3AB9 A;  1I4H A;  3SR1 A;  4KY6 A;  3TP7 A;  1PZK D;  3RZO B;  4BY7 B;  3GTO B;  1PXU A;  3S2D B;  4K2L A;  1CTM A;  4B9X A;  2QF7 A;  5CV8 A;  4CKE A;  2EPB A;  1E2Z A;  2LY7 A;  1BCP D;  4A3E B;  2VXW A;  3TP8 A;  4E6I A;  2B2U C;  1G91 A;  5IGF A;  2VNU D;  2PNR C;  5EJW A;  3HOW B;  4CGY B;  1DON A;  1ET9 A;  4CJ0 B;  3M7G A;  2XWB B;  4XYO A;  2ZXR A;  1ENC A;  2O4X A;  4FNF A;  1ENF A;  2B2T A;  3TSS A;  4WOR A;  1MI2 A;  2NTS A;  2J0T D;  1H9K A;  2OXP A;  1BCP B;  4QIW B;  4H13 C;  2FJ2 A;  1EY9 A;  1EWH A;  1XWE A;  3PUY A;  2JP1 A;  3DHQ A;  4NW2 A;  2LKV A;  4M1U B;  3D6W A;  3PIO 3;  5I2X A;  5JVH 3;  5I9P A;  1KNA A;  1Y1W B;  4DGZ A;  4TRD A;  5JAV A;  4KHV A;  4K5X A;  4X3K A;  1G6Z A;  1DYQ A;  3FRP B;  2K7V A;  2IW3 A;  3LWE A;  4KY5 A;  4G7O C;  4FF3 A;  4X3S A;  4B9W A;  5E4W C;  2WKC A;  3VR2 A;  1DOM A;  1C48 A;  3PUZ A;  1EL0 A;  1TII D;  3K5O A;  1I4Q A;  1SXT A;  1PRT F;  2EYL A;  2L9H A;  1LAC A;  4KKT A;  2NB0 A;  4KD4 A;  4RFB A;  1I4P A;  1H9J A;  2WV6 D;  4KJO A;  1NCV A;  1BO0 A;  3OMC A;  1LT4 D;  3HKZ B;  1KNE A;  2Z4H A;  5C6A A;  2ID0 A;  2GA4 B;  3GD7 A;  2F0F A;  4ZUI A;  3HOY B;  3BYT B;  4RKL A;  2EY5 A;  1DZ1 A;  2MPM A;  3SK4 A;  2D62 A;  3NTH A;  1Q1B A;  1R9T B;  5D3D A;  1EYC A;  2R93 B;  3S1N B;  1V1O A;  3H94 A;  5M3F B;  1S5C D;  5FLX L;  1CM9 A;  4GZY C;  2E2J B;  1VMC A;  3VR5 A;  1Q3L A;  5M5X B;  1D5Z C;  5IOD A;  5DEH A;  3KBX A;  4MIU A;  2YU9 B;  2K6A A;  2EE1 A;  2KVM A;  1HCZ A;  4HMJ A;  3HG9 A;  5EGT A;  2ZXP A;  3IFT A;  1HA6 A;  4MHE A;  3BG3 A;  2PCF B;  2SNS A;  1B50 A;  3A7L A;  1OO9 B;  3CU7 A;  1MSG A;  3NE5 B;  2IPK D;  1QNK A;  1YNN C;  3BVM A;  4IUQ A;  3ZYY X;  2J4X A;  1BUV T;  3C3L A;  1G2T A;  2DNC A;  3T51 B;  3NHH A;  4C3H B;  3IKJ A;  3LX0 A;  1AZQ A;  1KAA A;  1STN A;  2CQA A;  3I73 A;  3NBH A;  1KDB A;  1ET6 A;  2I46 A;  4G4K A;  1S4Z A;  4B08 A;  3BVG A;  3GQB A;  1TWF B;  3EFX D;  1RJT A;  1Y8O B;  1QB5 D;  2F3W A;  2XSC A;  4EQN A;  5D14 A;  2A6E C;  1STG A;  4ILW A;  4H7B A;  1SJH D;  1D1I A;  2IT1 A;  3D31 A;  5FOB B;  2RDF A;  1R4P B;  1KDC A;  5KYL A;  2F0T A;  2F0W A;  1F77 A;  2KJX A;  1EYA A;  4PV1 C;  3F2U A;  4R9W A;  2B8G A;  4F87 A;  2F1M A;  3J7A V;  3M3Y B;  4HCE A;  5FO9 B;  2A6H D;  3MXP A;  3PIP 3;  5C5M A;  5C3W A;  1B44 D;  2EZV A;  4BBR B;  5EQ0 A;  4WFN 3;  3MEH A;  4FF4 A;  3K57 A;  1HTP A;  3HOZ B;  2E2D C;  4XTC S;  3HEJ A;  3W2D A;  2BDO A;  1FGB D;  4RHS A;  1TS3 A;  1AP0 A;  1KAB A;  1I4X A;  1VF7 A;  1F9S A;  1H9S B;  5D65 A;  3MZ5 A;  4QUC A;  3PUW A;  1S5D D;  1XYI A;  1GUW A;  3QO2 A;  3S17 B;  3TN2 A;  3E6Z X;  4FXK C;  4HN7 A;  1DXM A;  1CQV A;  1K8O A;  4JBW A;  1RD9 D;  5CR3 A;  2NWG A;  2HQE A;  1V1P B;  2F0Q A;  1SE2 A;  2KUM A;  1I4R A;  1GUN A;  2AQ3 B;  1M4V A;  1CZG A;  1HHV A;  1O7L A;  1EEF D;  1SNQ A;  2EYO A;  3C1E A;  4FXD A;  1SNC A;  2OT2 A;  2L11 A;  2XNA C;  4ME5 A;  5D3I B;  5ELB A;  4A3K B;  1X3P A;  2A73 B;  1KDA A;  4C3H G;  1SNP A;  3OMG A;  1PLF A;  3S16 B;  1LTS D;  1SYB A;  5JVG 3;  1OXV A;  3TME A;  4OIJ A;  2HCC A;  3K7A B;  2D5D A;  3SXH A;  1HUM A;  2A5H A;  4H0L C;  4A3F B;  2RSO A;  1AEX A;  1CI3 M;  4OHJ A;  3NWT A;  4EQP A;  1A2T A;  2M2L A;  3E5S A;  1BOS A;  1HXY D;  2XRQ D;  5T1G A;  4J8Q A;  5E3F A;  2R61 A;  3T53 B;  1ZYR D;  1JB3 A;  2VB2 X;  2F03 A;  3GO5 A;  2VB3 X;  1ZXT A;  3L7Z C;  3DXJ C;  2K03 A;  1ESF A;  2BE5 C;  1JQY D;  1B2T A;  5KNC A;  1EY5 A;  1SND A;  4IN3 A;  2I07 B;  4C3J B;  3P7J A;  4OO1 I;  2IX0 A;  1WTX A;  1A15 A;  5C4Z A;  1K8M A;  3S9W A;  4Y7N B;  2PZT A;  2EY2 A;  1FNV A;  2NYZ D;  3NQT A;  3GTJ B;  4DAP A;  1RCV D;  1G29 1;  1Y8P B;  2XRS D;  1STE A;  4NMZ A;  3D4W A;  4DN4 M;  2WB1 B;  3MFY A;  4IZ8 A;  5C0X G;  1IHZ A;  1O80 A;  4IFD I;  2F0L A;  4RHR A;  1I6H B;  3KBG A;  5C5L A;  4KN4 C;  2PMZ B;  4ABN A;  4ZYS A;  3TZU A;  3DEO A;  2PO4 A;  2F0S A;  4OL7 A;  2CVR A;  3HP3 A;  2PYK A;  3K5N A;  4M8A A;  1F2L A;  3TZD A;  1TU2 B;  1JOK A;  2N88 A;  4L6T B;  1Z47 A;  2SDF A;  5EPK A;  4ZKB B;  5K36 G;  2KEE A;  2X6L A;  4LK1 C;  3D8G A;  3SK8 A;  4AYB B;  2MHV A;  5CV5 A;  1U4R A;  1D5M C;  1EWC A;  1STY A;  3I8Z A;  1EY8 A;  3P1H A;  4K5V A;  3HOX B;  3BS1 A;  2IX3 A;  4FF1 A;  3D6C A;  3PO3 B;  1PTO B;  1EOT A;  2R3Z A;  4IUU A;  5JEA G;  1ZYR C;  2DN8 A;  2EJF C;  2NVX B;  4ODG A;  3G6J B;  2HDL A;  4V0B A;  1B9M A;  2WIN B;  5C0X H;  5ELF A;  2Z8L A;  4ID6 A;  4Q0F A;  4X3U A;  1RTO A;  3V05 A;  2QEJ C;  3OHX C;  1U4P A;  4RGO S;  4C2M B;  1E2V A;  3TP5 A;  3MXG A;  3CKI B;  4XQQ A;  2AQ2 B;  3NQI A;  3DWA A;  4HMI A;  2MGS A;  1E2W A;  3H6M A;  1JOQ A;  4PMB A;  5CYU A;  1EEI D;  4C3J G;  1WTQ A;  2PPB C;  3D4R A;  4K2K A;  5I9O A;  5K36 H;  2G9H D;  1U4L A;  3RD4 A;  1RTN A;  5HGT A;  2EJM A;  1HQM C;  4RGM A;  2CW0 C;  1TR5 A;  4LJZ C;  5C4H A;  4PNY A;  3D4D A;  1SFO B;  3PMF A;  4K6L A;  2A68 C;  3HOV B;  1EQT A;  3ITP A;  5JEA H;  1XXG A;  1PYW D;  2B2U A;  5J39 A;  2RVL A;  4RA8 A;  3OSO A;  1EU4 A;  4CBV A;  3RUZ A;  2NTT A;  3DMU A;  4NKL A;  4HCS A;  1O7Y A;  1VCI A;  1KLG D;  3I4M B;  1L0Y B;  1WTO A;  3OWE B;  1PDQ A;  3IFD A;  2M9V A;  1FNW A;  2NN6 G;  4KN7 C;  1W6K A;  2EDG A;  5CMD A;  2EY6 A;  3H09 A;  5ELE A;  5CBE E;  2F0M A;  1KLU D;  2KQ3 A;  1ZKO A;  4FXG C;  1LTR D;  2AWN A;  1LTI D;  5FO7 B;  3CRK C;  3MAQ A;  4A3G B;  2L4N A;  3I90 A;  1D1K A;  1HFG A;  1QWY A;  3S2H B;  2YYZ A;  1JOO A;  3BDO A;  5C0X J;  1PRT B;  5KEE A;  4IUR A;  3X3M A;  3QWN A;  1CHQ D;  1Z7T A;  1JCK B;  1JC7 A;  4TSS A;  3W3A A;  2KCC A;  3LNN A;  1JWS D;  2IX1 A;  5A35 A;  2K33 A;  3WDN A;  1SBB B;  3Q24 A;  1U4M A;  3IAY A;  2E2I B;  5I6W A;  3VYS A;  3IL8 A;  1W6J A;  3I4L A;  1SNO A;  3LWU A;  3MFG A;  2JEB I;  3I91 A;  1F9Q A;  2M00 A;  1BCP C;  1EYD A;  5J1Z A;  3GTP B;  2NN6 H;  3CHB D;  1IL8 A;  1II3 A;  1WTV A;  1H9M A;  1PZJ D;  2QIL A;  1S5B D;  3Q0A A;  3G7L A;  1Z6H A;  5I2Y A;  3NSW A;  2RDH A;  5JEA J;  1B9N A;  1TWC B;  4DF7 A;  5IGG A;  2F0O A;  4FF2 A;  4R8N A;  1XX8 A;  4K5W A;  4JK1 C;  1UUP A;  1NR4 A;  3OPO A;  5C3X A;  5FK9 C;  1OXX K;  4HED A;  3T16 A;  5C44 B;  1MGS A;  3FDT A;  4ZAI A;  3J81 E;  1Q1E A;  1GUG A;  4FYD A;  3BDC A;  1V8Q A;  4WJW A;  1PTO H;  1QCB D;  1TS2 A;  4C56 C;  3CRL C;  1EIG A;  4NP5 A;  4DNT B;  2B2Y C;  5JJZ A;  1GUT A;  5BN5 A;  1SE3 A;  2NVT B;  3UI2 A;  1O7Z A;  1HRJ A;  3KLS A;  2WP8 J;  1HUN A;  1F2Y A;  1B3A A;  5LL6 X;  3L3O C;  2ICE C;  5KYI A;  4BS9 A;  3H0G B;  3FMC A;  2N55 A;  1AW7 A;  1ML0 D;  3Q22 A;  4LMQ D;  4CJ2 C;  4EGV A;  5EBD A;  2IWH A;  2Q8I B;  2PZU A;  2RQX A;  4BA2 I;  4QMG A;  1CFM A;  4ZK9 B;  3S1Q B;  2WAQ B;  2KCN A;  3BZD B;  1B1Z A;  2EY1 A;  4LAA A;  5M9O A;  4KK7 A;  4K14 A;  5LHY 1;  4A3I B;  5TSS A;  3NP8 A;  3H3V C;  2QKI C;  5BN3 A;  3SE0 A;  5ELD A;  3RMH A;  3ERO A;  1DJR D;  4IUV A;  3VR4 A;  2F3V A;  5DAU A;  1KTK A;  1QJO A;  3VA5 A;  3M7N A;  1B4O A;  2SOB A;  4RGN A;  1ZEQ X;  3VYR A;  3NXW A;  3MWY W;  1TS5 A;  2JE6 I;  4DA2 A;  2KED A;  3K58 A;  4FO2 A;  4KD3 A;  1PFB A;  1WD0 A;  2KEC A;  2ENB A;  2HUG A;  1DOL A;  1IKM A;  1D6E C;  1GUO A;  5DNF A;  2ZT9 C;  4XIG S;  4I65 A;  5IT9 L;  1CHP D;  1Q8I A;  4RAU C;  4Z9C B;  5M3M B;  3DM1 A;  1FNU A;  3T13 A;  2X6G A;  1IYV A;  3TBI B;  2EYP A;  1STB A;  3BYY B;  1WTR A;  2WII B;  3U9O A;  3OOC A;  3C46 A;  3MVV A;  1BNZ A;  1Q90 A;  1BXT A;  4BY1 B;  4DU9 A;  2SEB D;  4TQU S;  2RSN A;  4ZKC B;  3ND9 A;  2IJ0 A;  3A8K E;  2O5J C;  3A55 A;  4BA1 I;  1Y69 U;  1TVX A;  2R92 B;  4IAL A;  2DNE A;  2NBF A;  3HOU B;  2EYM A;  3GTQ B;  1LT3 D;  5JPN C;  3S1R B;  2BDN A;  2EYH A;  2A6H C;  5K5P A;  3FEW X;  1JE4 A;  5DM6 3;  3PO2 B;  1SYC A;  1TT2 A;  4Q5V A;  4FVM A;  1U9R A;  4WRD A;  5G3L F;  1SNM A;  4MN3 A;  2JA5 B;  1FYC A;  1EY7 A;  3GV6 A;  4C3I G;  5KRU A;  3GV3 A;  3Q6S A;  2AUK A;  1BDO A;  1J8I A;  1H9S A;  2PZW A;  5J22 A;  4XT3 B;  3OWF A;  1HPC A;  2C5C A;  1EQV A;  1WVL A;  3MA2 B;  2Q8R E;  2JSO A;  2JA8 B;  1IW7 D;  4L8J A;  4K6D A;  4O42 A;  3QIA A;  1A3U A;  4K8J A;  1EY4 A;  1T5E A;  3DEP A;  3SEB A;  1EZ6 A;  3J80 E;  1V1P A;  4IUT A;  1VMP A;  3M85 A;  2LFN A;  2JA6 B;  1X3Q A;  1WCM B;  3H91 A;  5EPL A;  1CQF A;  2X69 A;  4KMU C;  2FMC A;  1QG7 A;  1CA6 A;  1ONL A;  1C4Q A;  1L0X B;  1NSN S;  1SYF A;  1O78 A;  1MSH A;  1JWM D;  4J1M A;  4XT1 B;  1G2S A;  3AU7 A;  1GXD C;  1NR2 A;  4HR7 B;  2K01 A;  3V2T A;  4RCN A;  4XXE A;  1TWH B;  2PQE A;  4RGT A;  1PTO D;  2FHT A;  1I4G A;  4O1N A;  1TY2 A;  1LTA D;  2TMP A;  4F7X A;  4XDX A;  4G7H C;  4RH6 A;  2B2V C;  1RDP D;  4EQO A;  4C1N K;  3GP7 A;  4CKB A;  3FPU B;  1RF2 D;  3EVQ A;  4H44 C;  4KI0 A;  3NK9 A;  4UAI A;  2F0V A;  1UAP A;  2ICI A;  3R93 A;  1SE4 A;  4KTA A;  3J81 L;  2O2L D;  1VDZ A;  3FKI B;  1F9R A;  1CA5 A;  1TY0 A;  3A54 A;  3QJY A;  3D3R A;  1B53 A;  3NTI A;  1EU3 A;  2B2V A;  2Z1C A;  4KV6 A;  3VA7 A;  4A3J B;  3A56 A;  4NDX A;  1I3Q B;  3QOL A;  3V96 A;  1SJE D;  1PZI D;  4HAE A;  2R7Z B;  1F2M A;  1S5F D;  4BWG B;  5E4X A;  4R8I A;  3FPP A;  1JWU D;  5C4X B;  3A7A B;  2JYO A;  4QUF A;  2K1B A;  1M8A A;  1TWA B;  1F2Z A;  3RZD B;  4RCO A;  2EYJ A;  1DD2 A;  2KHS A;  3NUC A;  1IW7 C;  4F8M A;  3VR6 A;  5IT9 E;  2CHB D;  2EXZ A;  1QE6 A;  2D9U A;  4DFA A;  2EOT A;  2C9O A;  5HUR A;  2SNM A;  1EY6 A;  2B2T C;  2D2C C;  5JPM C;  5CBA E;  1I50 B;  5CV7 A;  1EY0 A;  4A3D B;  2RA4 A;  2L1B A;  4UDU C;  3RLF A;  3KLR A;  4QCL A;  2A69 D;  4QF4 A;  2L5T A;  4OGQ C;  5JOB A;  1A3V A;  3MC0 B;  3ERQ A;  1PTO C;  2RBM A;  1PRT D;  1E0B A;  1Y1V B;  3T4A C;  2K04 A;  1CZW A;  1BCP F;  1BF4 A;  4DXF A;  1YNN D;  4C1N I;  1AFP A;  2H1E A;  3K6O A;  5C4J B;  1ICW A;  4G57 A;  1QOH A;  4CKC A;  3SK5 A;  2Q8T A;  4K8I A;  3BVZ A;  1H9R A;  5EBC A;  1IYU A;  1I6V C;  3HS0 C;  3L9A X;  3PUX A;  5EKL A;  4TKO B;  5CV6 A;  5KND A;  1YNJ D;  4ZUJ A;  2DY7 A;  2L0C A;  3NBI A;  1SEB D;  1OXS C;  2QDB A;  4DAY A;  2RKS A;  1JIC A;  4DK1 A;  1RKN A;  1AZP A;  2F0N A;  1S5E D;  2A6E D;  4KKS A;  4ULL A;  1HA5 A;  2NZ1 D;  2LS0 1;  3WOF A;  3N6R A;  2AQ1 B;  1HQR D;  3CQZ B;  3ONA B;  2F0J A;  2F0E A;  1Y8N B;  3J7A F;  3S15 B;  1V43 A;  2HCI A;  1OXT A;  2JA7 B;  2VUM B;  4OO1 G;  1PFN A;  1GHK A;  4KJN A;  1LLR D;  1DOK A;  4X3T A;  2ZXO A;  4DK0 A;  3OW7 A;  1D2B A;  5I6Y A;  1D5X C;  4PMW A;  1A3T A;  1EZ8 A;  3TDQ A;  4F88 A;  5KGU A;  3AMU A;  3M4O B;  4U67 3;  2A69 C;  5CV9 A;  1R4Q B;  1HTL D;  5T1I A;  5FKA C;  3HGB A;  4KY7 A;  2K32 A;  4ZLT F;  3BDL A;  5LL6 S;  5CC4 A;  5C0X I;  3K5M A;  1SDF A;  3WOE A;  1PRT C;  3I3C A;  1ILP A;  4IFD G;  4L63 B;  3MHB A;  3KUP A;  3K5L A;  2XWJ B;  2B63 B;  3P75 A;  1ESR A;  1G8Z D;  1NAP A;  1Q12 A;  4ZQ3 A;  3NWS A;  2AUJ D;  3R2T A;  1LV9 A;  1DCZ A;  1UEA B;  3SDZ A;  1SYE A;  4PQX A;  3J80 L;  2OEO A;  3NPP A;  1MD2 D;  2K5Q A;  4J6H A;  3MXU A;  4A3M B;  4ZRZ A;  5CGK A;  3JAM L;  4OO1 H;  4HSP A;  1WTW A;  1HFN A;  1YNJ C;  2L55 A;  3NTK A;  2MJ8 A;  3P20 A;  3GTL B;  2B2Y A;  4IQZ A;  3VYU A;  2BA0 A;  4OIK A;  1STA A;  3HZX A;  2NUC A;  3K0Y A;  4CHT B;  1LT5 D;  3I4N B;  1AN8 A;  4KKU A;  4C3I B;  1JR0 D;  1F9P A;  4PMC A;  3ND8 A;  2XIW A;  5CV4 A;  5IIF A;  5C3E B;  4IFD H;  3KLS X;  1STH A;  5M5W B;  3HRZ C;  3T56 B;  3URY A;  4DXG A;  2FMM A;  1GUS A;  3J7Y W;  1SSO A;  5F2D A;  3VYT A;  3E0J A;  3C1F A;  2JXM B;  1QNU A;  1EIH A;  2BE5 D;  5IGC A;  2WAC A;  5A2Q L;  3GTM B;  5FO8 B;  4U68 A;  1MBY A;  5E1F A;  2L12 A;  4XQJ A;  1LO5 D;  1LT6 D;  2F0G A;  1PFM A;  5KIX A;  4DNR B;  1QIL A;  4XYQ A;  2O5I C;  3MTS A;  2K5W A;  2MUY A;  2IL8 A;  4QB4 A;  4XQN A;  3SHL A;  3R3O A;  3KF8 A;  2DY8 A;  2V4D A;  1TKW B;  4N9T A;  2HDM A;  1PMR A;  3S14 B;  1GOZ A;  5NUC A;  2NVY B;  3QB3 A;  1J9O A;  4CJ1 B;  5COR A;  2NN6 I;  4BBS B;  2MP1 A;  1SYD A;  5BN4 A;  2OF1 A;  1CT1 D;  4KHZ A;  5G3L D;  1LAB A;  3U9S A;  4DAV A;  2QCP X;  1IKL A;  1SMY D;  5DM7 3;  3EQL C;  4P2C B;  3DWQ A;  2FFK B;  3OIP A;  1LTB D;  2K28 A;  1SYG A;  3R8B A;  1ENA A;  4IFD J;  1LTT D;  2B39 A;  2RDG A;  3I72 A;  2F4I A;  4HTH A;  1ROD A;  3PV0 A;  3DUZ A;  2Z4I A;  1A6X A;  5IGE A;  1TS4 A;  5FLX E;  2F0H A;  5EKI A;  1VF5 C;  1EFI D;  4RWS C;  2EVB A;  5M5Y B;  3QG1 A;  2E76 C;  1WTP A;  2FIN B;  2F0I A;  4A93 B;  5IGD A;  4FP5 D;  1OXU A;  4RKB A;  1JOR A;  3X3N A;  3VR3 A;  2JEA I;  3GTK B;  2KA7 A;  2XN9 C;  2E2H B;  1K83 B;  2Y0S B;  1UNS A;  5EPJ A;  4S3S A;  3KK7 A;  2BA1 A;  2AWO A;  3C2P A;  1X32 A;  5ELC A;  2B2W C;  5AFW A;  4YIJ A;  4IUP A;  3SVM A;  5EKK A;  3Q23 A;  2PW7 A;  2NVQ B;  2K5D A;  2KOL A;  3A8J E;  4IUN A;  3JAM E;  3K59 A;  2R6G A;  2BCO A;  3OIQ A;  2XVS A;  2LMC B;  1TWG B;  4N9P A;  2B2W A;  3PUV A;  3QOJ A;  2F0P A;  1WD1 A;  1LTG D;  2EJG C;  2CW0 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...