1XWEA

Nmr structure of c345c (ntr) domain of c5 of complement
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
151
structure length
151
Chain Sequence
GSHMADCGQMQEELDLTISAETRKQTACKPEIAYAYKVSITSITVENVFVKYKATLLDIYKTGEAVAEKDSEITFIKKVTCTNAELVKGRQYLIMGKEALQIKYNASFRYIYPLDSLTWIEYWPRDTTCSSCQAFLANLDEFAEDIFLNGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Functional Insights from the Structure of the Multifunctional C345C Domain of C5 of Complement
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Complement C5
total genus 14
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 2004-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01759 NTR UNC-6/NTR/C345C module
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1xweA01
3HS0C 3OHXC 3I70A 2A74C 2E2DC 5JPMC 2WIIB 4FXGC 3V96A 2WINB 1UAPA 2B39A 1BQQT 1BR9A 5FO8B 1JC7A 3L3OC 3HRZC 3CKIB 2XWJB 2ICEC 2QKIC 3FRPB 2TMPA 5FO7B 4ILWA 5FOBB 3CU7A 1XWEA 1BUVT 1JB3A 1UEAB 2J0TD 4FXKC 3MA2B 3KLSA 2I07B 1PXUA 2A73B 1OO9B 3G6JB 1D2BA 5FO9B 3T4AC 2XWBB 5JPNC 1GXDC
chains in the Genus database with same CATH superfamily
5M3FB 3CF5A 1VQMA 2K01A 1Y1VB 5KGUA 4JVZA 3S15H 1JT8A 4BBRG 3OW7A 3BDLA 2PZUA 1YI2A 4R4CA 4RAUC 3HOXB 4LF5Q 4HTHA 5IGGA 1JWSD 2K5DA 3E5SA 1NMGA 1ASZA 1VQHA 1Q46A 4DK3C 3VA7A 3E0JA 4JW0A 3A74A 4DR7Q 1DOLA 2JA5B 1WTRA 1Z47A 1A62A 2WACA 2PZTA 1QB5D 2WFWA 3K80C 3TS2A 2A5HA 4LK1C 1Q12A 3AFQA 3DM1A 3U4ZA 2KJXA 4JCVE 2AKWB 3PSIA 2RCFA 4NDXA 4QF4A 2Y0SG 4KKUA 3QWNA 4JI4Q 1BUVT 1K8GA 4P72A 4YWMA 1QNUA 3F2UA 1GOZA 2IW3A 1ML0D 5E4WC 5M5WH 4K6LA 2OXPA 2VB2X 2NZ1D 3K8AA 3J81c 2KOLA 3I73A 4DKAC 4WORA 3J81L 1VMPA 4KJOA 1L1OA 1PRTB 4JI3Q 2NVTH 3J7AV 4DUYL 2ASBA 1D1IA 3M4OB 3GQBA 4X66L 4MHEA 1NSNS 2L4NA 1HNWQ 1HTPA 3Q8DA 2K03A 2CFMA 3SR1A 3BDOA 2EJFC 4BBSG 5LL6S 2EYFA 5E1FA 2E2JB 5JJZA 4BXXG 1Q7YC 2F4VL 2DGYA 3FPUB 4NW2A 2MO1A 2SNMA 3ERSX 3G7LA 1B9MA 1G291 2CQAA 5JOBA 4QQBX 3PF4A 1NMFA 2DY8A 1RTOA 2F52A 5JPMC 4GKJL 2NVYH 2PQAB 1HUMA 1PRTD 1BQQT 1N34Q 1WCMH 4FDBA 4RCOA 3V05A 2TSSA 1UE5A 1HPCA 5IT9c 5FO7B 5JEAG 1GVPA 1LUZA 5I6WA 1PH2A 4GOPA 3K7UC 4A3BG 3CMEA 4Z9CB 3BYYB 3NELA 3RLNA 3PV0A 3MFYA 2LXKA 4CHTB 4A3BH 4TKOB 2L9HA 4N8X1 3SK6A 1EL0A 3A8JE 2QDLA 3AFPA 2AUJD 3OOCA 4XDXA 2IY5B 5J22A 4P2CB 3HEJA 1CFMA 3OTOL 3RNUA 5GAHC 2B8FA 3OYYA 1N34L 4DV0Q 3NPPA 2PO4A 3TN2A 1CKMA 1SDFA 3GTKB 4IUUA 3GV6A 4M8AA 1CQVA 1F9PA 4BA1I 2UXDQ 3BVZA 1OXUA 2K5HA 1VQ5A 4A93G 4MNOA 1I94Q 3MXNB 4L63B 3CCUA 4ULLA 4K2KA 2MGSA 5IYDH 3HKSA 4A3EG 1S40A 4U68A 4DNTB 4TRDA 5FO8B 4HIMA 4K5XA 1DCZA 2VW9A 1SMXA 4YCWA 3HOVB 1XMQL 1N32Q 1QZHA 5C3EB 2CQOA 5I6YA 1SBBB 2EY2A 1MSGA 3HOYG 4JI0Q 1Q8KA 3UDGA 2D0PA 3N6RA 3NBHB 3R8BA 1VQ8A 4IUVA 4UHVA 4BWGB 1A0IA 2HT1A 4JI6Q 5IP9H 2K5QA 4K14A 4IOAA 1A3VA 3RLOA 2N55A 1B3QA 5LMNW 4C3JH 3MXGA 4RHSA 4CKCA 2A8VA 1PXUA 1X32A 4LF4L 2BOSA 4C3JG 3ITPA 1A8VA 3GV3A 2AWNA 2ZM6Q 4AYBB 4A3MB 2DNEA 3TP6A 1CKNA 1QJOA 1Q8IA 2WAQB 3T1YQ 1EEID 2EJMA 2YYZA 1EY7A 1U5KA 2XTIA 4A93H 2Z1CA 3FHWA 3VYTA 2FHTA 3EVQA 2YTXA 3J80i 1O7IA 1SNCA 1H9JA 1D6EC 1PZKD 1D2BA 1F2YA 2CCZA 2X6LA 4FYDA 5CV5A 3GTGH 3C1EA 4TVAB 1G8ZD 2EQSA 3AQQA 5IOCA 1VF7A 1XNRQ 4BY7B 1LABA 4WRDA 2QEXA 4BS9A 1A3UA 1AEXA 1JOKA 1MJCA 3OMCA 5AJ3Q 1B4OA 1F2MA 4OL7A 2HCIA 2UUBL 3H09A 3NSWA 2JXMB 3ZJYC 1Y69U 1OO9B 5E7NA 5IGCA 2EVBA 1KNEA 3LGJA 2KEEA 2DN8A 1HRJA 1F2LA 1HNZL 3P1HA 4GLVB 5A2QL 5EAYA 4A3IB 5JEAJ 3A56A 5IP7G 4A3LG 2JA8B 3NTHA 2OTLA 1EWHA 5T1IA 3U50C 1KAWA 2QA4A 4HIOA 3X3NA 4A3MH 2HIVA 3H0GB 1A2UA 4HJ5A 2UUCQ 1E3PA 5IIFA 1LO5D 1K8AC 1TT2A 1QWYA 2QGQA 2YV5A 1JJ2A 2F3IA 1CSPA 3HOXH 4DV0L 4L6TB 2JN4A 1EFID 1EQTA 1STEA 4DAPA 2R61A 3NQTA 1M1KC 4GLAC 4DAVA 1UUPA 1PH8A 5COYA 2EXDA 3HOXG 3K5MA 2CWAA 4Y7NH 4DR3L 4G57A 3M3YB 3PQIA 5C44G 1MHWC 5EKIA 1LT3D 2MUYA 3EQLC 2TMPA 2A6ED 1DGSA 4J1MA 2H4OA 3CRLC 2F4VQ 1STNA 3DWQA 4CDCC 4YIJA 4CJ0B 1L0XB 1VQAA 3OSOA 3GTOH 4A3DG 4A3CG 3I56A 4DV7L 1VQPA 1LTBD 1I4GA 5JVH3 3KF8A 1HZAA 4G7OC 2R7DA 5IP7H 2PNHA 4IQZA 2PPBC 5IGEA 1K8OA 1X56A 3H91A 2GVAA 3E0EA 4XXEA 2FXQA 1GKHA 2KHIA 3TSSA 3GTGB 2XGTA 4C1NK 3O13A 3KLSA 1YIJA 2VY3A 4YCUA 4OX9L 1O7ZA 2KHSA 3EA6A 3NEMA 1IHZA 1XPUA 3H3VC 3M4YA 4OWTB 4LFBQ 4X3UA 3TDQA 1SAPA 4HCEA 5M5YH 3E3XA 4A3JB 1PDQA 1BR9A 2ID0A 3K5OA 3LX0A 1V1QA 5FOBB 2XRQD 3KOJA 4Y7NB 2E2HH 5JVG3 1PV4A 4CKBA 1IL8A 4ZUIA 1P8LA 5CBEE 2UUCL 4O1NA 4XT3B 1O7YA 2E2HB 5CMDA 1N32L 1NTGA 3D31A 4X3TA 2XSCA 5ELFA 1WD0A 2OWOA 1AN8A 3URYA 5I2XA 3A8KE 1UWVA 3DEOA 4A3DB 1Q1BA 1VF5C 2M2LA 2OCEA 2PMZE 5LMUQ 5FLXL 4A3JH 3TZDA 3WDNA 3RZDB 1R9TB 2A69D 4WJWA 4X62L 4PMWA 3PO3H 1CZGA 3RLFA 1G6ZA 4A3GG 1B3AA 4QIWB 1S5FD 3LWEA 5IYBH 1KC8C 5EPLA 3J81i 2Z9HA 4RGNA 2QEJC 1TWFH 3HOZH 2NVTB 5KYLA 1CQFA 1PFSA 1SE2A 5JEAH 3AYHB 3RN5A 4FXDA 1WI5A 5CORA 4YY3L 1VQGA 2SDFA 2XIWA 1EU4A 5JJKA 2UXDL 1E2WA 4QGUA 1LTID 4L5TA 1PH9A 2F0QA 5FLMH 1SNQA 1GO3E 3CD6A 1S4ZA 1Z9FA 4XYQA 5BR8L 2KCTA 1WFQA 2B8GA 2YTYA 5JPNC 3K58A 1SNOA 4IPHA 1HCZA 4QY7A 1SJHD 3SDZA 4A3FB 1JE4A 1X54A 2Q8TA 3Q22A 1WTHA 4DNIA 3ZYYX 4LFBL 3CPFA 4P74A 1C0AA 3FRPB 1JOQA 5NUCA 4DR6Q 3DUZA 4LF9Q 4NXMQ 1IBLL 5C0XJ 2R92H 4DV5L 2F0VA 1ICWA 1EFWA 3KUPA 1UE6A 2K7VA 3M9BA 2VL6A 4A3KG 2R92G 2JA7G 2RDHA 2L55A 3EJIA 1Y1VH 4LF6L 4B08A 1PFBA 1GUGA 2E76C 1WTVA 2AQ1B 2AWOA 4MTNA 2F0PA 1GUWA 1VQIA 2E75C 4P73A 1EYCA 1CT1D 1HNZQ 1BDOA 2XN9C 5K36G 2H5XA 1SE8A 4CJ2C 3I4OA 5ELNA 4LF9L 2X69A 1GJXA 1EY8A 2HD3A 5FJ8H 3ND9A 5K5PA 1HQMC 1KABA 2J7ZA 2JQOA 4QMGA 4ZUJA 1CA5A 3NENA 5IWAL 1IL2A 1BCPD 4BY7H 2J0TD 2K4KA 3SK4A 1U9RA 5IE8A 2PCFB 1NNXA 5BN3A 3AMUA 1QUQA 3Q24A 2ATWA 1UE1A 4BY7G 2EYPA 4X65L 3I70A 3NXWA 1Y1WH 4RH6A 2QILA 4JC0A 2A19A 4DF7A 1MJEA 3CW2C 4JV5Q 2QF7A 2VXWA 3J7YW 4GKJQ 2EYMA 3AEVA 4FF2A 3HOVH 3D3RA 5ELCA 2E5LQ 1CHPD 3X3MA 2HDMA 3CU7A 1YBYA 3KDFB 1VQFA 2LSSA 2NVXB 3I4LA 1E1OA 2AQ2B 5C3EH 1TS3A 5C4XB 4JBKA 4I7ZC 1YJ9A 4NXNQ 1IYJB 2DNCA 1C48A 1I3QH 1PH6A 1FL0A 4DR5Q 4HJ9A 3KF6A 3S16H 2K50A 2WINB 3FDTA 3NHHA 3ULJA 1XNRL 2NVQH 3NWSA 3VR2A 2BCOA 3PO2B 3HOUH 1YHAA 5E4XA 1QVFA 4APVA 4GNXA 1LLRD 3J81j 3FVQA 3CCRA 1NJIC 3WWVA 2I5MX 5IODA 1E2VA 3HOUG 2B63H 4JI1Q 3K7AB 3GTKH 2EY6A 4IUPA 1N36Q 1H9RA 1TXYA 1EUJA 1D8LA 3S1MH 2N88A 4PMBA 5C0XH 3GTQB 4HJ7A 5ELBA 4IUQA 5CV9A 3RD4A 3MC0B 4HAEA 3HKZE 5GAEC 4LFAL 4YHHL 3ICEA 1VQKA 4B3MQ 2L0CA 3D4WA 1EIFA 1F77A 1A2TA 4EQ5A 2O5IC 3HOYB 5CV8A 4E6IA 5E3FA 5CBAE 4KHVA 3KYHC 1LT4D 3HS0C 2E8GA 4K2LA 5GROA 4NB3A 3PMFA 2K5WA 1WVLA 1QZGA 4LUVA 3EROA 3BU2A 2KA7A 4V0BA 1ENFA 2M00A 3I4NB 5C4XH 1S5ED 1B1ZA 5C4JB 1Q86C 4G7HC 1IZ6A 3KBXA 5C4JH 2Q2TA 4IJHA 3NE5B 3T56B 2AHOB 4KKSA 1HA5A 5JAVA 2CKZB 5IT9L 4AYBG 4LF4Q 4DGZA 1BNZA 4OWWB 4ID6A 5BR8Q 1RD9D 1B50A 1C4QA 3C46A 4F88A 2N49A 4ALPA 3BYTB 1A6XA 3QO2A 4POFA 3NBHA 2IL8A 3V2TA 1XPRA 5ELEA 3VYRA 1TWHH 1TWCB 2D5DA 4JI8L 1HR0L 2ZXRA 5L37A 5D3DA 5D65A 4LFCQ 1HR0Q 3I2ZA 3B6YA 3VDYA 2VUMH 2KUMA 3I8ZA 1TR5A 2D0OA 2MP1A 5IT9E 1RKNA 5BN5A 2ZJPA 3J7A5 2JA6B 2KCNA 1VQCA 1XX8A 1Y8PB 2A1AA 2JEAI 4DR6L 2JE6I 1CA6A 1HNXL 1MSHA 4PMCA 4L5SA 4A3EH 5GAGC 4RGMA 2MFIA 2PMZB 1B2TA 1GHJA 1HXYD 2LXJA 5C5MA 1QE6A 1CM9A 3A5ZB 1KRSA 1WCMB 3Q0AA 2HHHL 1XJVA 1HNWL 1V1PA 4KY7A 2HHHQ 3GTLB 4B3SL 2BE5D 4JI2Q 2R7FA 4IOCA 4LAAA 3KK7A 3BVMA 2D62A 2N3SA 3QOJA 3PO3G 4BBSB 4RFBA 4ZKBB 5KEEA 2QKIC 2JA8H 1I5FA 1IBKL 5IYBG 3S2HH 2F0IA 4XTCS 1Q3LA 1QOHA 4IUNA 1LT5D 2D2CC 3PIP3 4KMUC 3STBC 3IAYA 1AH9A 2C9OA 2L11A 1BXTA 1NY4A 4C1NI 1DJRD 1JICA 3TS0A 4DUZL 1SMYD 2PQEA 4K6DA 2SEBD 1OXXK 3D6CA 2SOBA 3JAME 4RG1A 3IRBA 3F2BA 3J80E 2E2IB 3GP7A 4NKLA 4PG3A 2ES2A 1A63A 5M5XB 4ZRZA 4XQNA 4LUOA 4A3KB 1HA6A 1TWGB 1U4PA 5J3BA 3SVMA 1IBML 1I4QA 2OQKA 3S16B 2BDNA 1E24A 3G6EA 4Y52H 4NP5A 1EOTA 4R4IA 2F0HA 1YITA 2JYOA 5EQ0A 1E0BA 5LL6X 2B3GA 2EYJA 4XT1B 2J4XA 3PUVA 2XWJB 1DYQA 1LTRD 5IGDA 1SJED 1FR3A 3VR3A 3HOWB 2DJGC 2GN5A 1S5CD 2PZWA 4KKTA 3L7ZC 4O2DA 1EY5A 1XMOQ 2CVRA 2VS1A 5HY6A 1HZ9A 4GN5A 4CGYB 3CCSA 3S1RB 3HFZB 4A93B 3KF8B 3FP9A 1LTSD 5ISRA 1TIID 1HFNA 2WAQE 3UE0A 1IYVA 3BDCA 1EQVA 4ME3A 1J5EL 2K14A 1LM0A 3CP0A 3CC7A 4AQYQ 2KCCA 1SE3A 2HCCA 4X3KA 1CI3M 5C44B 4DXFA 4HSVA 1G6PA 4DV3Q 3G6JB 1KTKA 2L1BA 1BCPC 2JA5G 5CV7A 2K33A 1GXDC 3K0YA 2HUGA 2A74C 1SN8A 4R1JA 3M4OH 2NVXH 2F0KA 2O5JC 1PTOH 2A68D 3S1MB 5C4HA 1BBXC 2IHFA 2B39A 1JC7A 3HGBA 5I9OA 3U9SA 5C6AA 3HKZB 4FVMA 4P75A 1B44D 2I07B 4UP7A 3RZDH 1R9TH 5G3LD 1B8AA 2Z4HA 3FKIG 2VNUD 4C3IB 5DLQE 2NWGA 4IN3A 1TQOA 4DAMA 2KBNA 3UDFA 4A3DH 4PV1C 4IUTA 4FXGC 1KL9A 4HN7A 3TP5A 1KLGD 1X55A 2IWHA 4OO1I 3UI2A 4JI7L 3HOZB 4ZKCB 4DV7Q 1YHQA 3NWTA 4G4KA 5M3FG 3S1RH 3CAMA 2XNAC 3G71A 2HDLA 4BXXH 3OWEB 5A2QE 2FJ2A 5FLXE 3EFXD 4A3JG 3GTQH 3FEWX 1VQNA 4C2MH 1K8MA 3MHBA 4TQUS 3WOEA 1HUNA 4ZK9B 5C0XI 3F1ZA 1G2SA 5JJLA 2F0UA 3NTKA 1KRTA 1IYUA 3BS1A 1L1OB 2K04A 3J80c 3TEHB 2L12A 1D5ZC 1TWHB 1KNAA 1PTOC 3AU7A 4JG2A 2LFNA 4XQJA 2K5NA 3PIO3 1MKHA 3L0OA 1I6HB 2B63G 4IFDH 1MI2A 2IJ0A 5M3MH 3S14B 4B3RQ 4V190 1BO0A 3SXHA 3PUYA 4K8IA 4C2MB 5C0XG 3IL8A 1GUTA 1U0LA 2G9HD 4C3IG 3R2IA 4L5RC 5EJWA 3I4MH 4TSSA 1PH5A 2EYLA 5GADC 1HZCA 1Y8NB 4KJNA 3SK8A 4X64L 1VQ9A 2A68C 1S3OA 5IYCG 4GNXC 3JAMi 3A55A 3NUCA 4JI3L 5HURA 1BCPF 2NN6I 1I3QB 5CYUA 3DLLA 2NTTA 4OONA 1SFOB 1W6KA 2C5CA 1IW7C 4B3RL 4QB4A 5TSSA 1EIHA 2JA7H 4C3HH 4X6AH 1AE2A 1OXTA 1I4RA 1I4XA 1WTQA 4A3EB 2LS01 1PTOF 1EQQA 3MEFA 4R8NA 4A3FG 3Q23A 2KHJA 1ENAA 2JP1A 1XWEA 1WYDA 5KNBA 3NBIA 2Z8LA 2RHQB 3EN2A 4IFDG 2R6GA 1FVIA 2NN6G 5EPJA 4ZAIA 1BBUA 1SYBA 1YZ6A 4A3BB 4JI0L 1C9OA 2M9VA 1AFPA 2NN6H 4KD3A 4L5QA 1ZKOA 4QCLA 1YNJD 2JA7B 3CCLA 1ONLA 1UNSA 3K0XA 3OPOA 3K5NA 1PHJA 2NZHA 2F0DA 1XMQQ 2Z6KA 3S2DB 2UXCL 5GQOA 2IX3A 2GVBA 1PVOA 4HSPA 1SNMA 3MXPA 1LYLA 4AH6A 2CHBD 2IT1A 1KLUD 4N9TA 2VUMG 3H3VH 3CC2A 4K0KL 2ENBA 3HZXA 4DAYB 2F03A 3H15A 1A3TA 1HR0W 4PQXA 2BH8A 4ZQ3A 3M7NA 4X3SA 3U4VA 1YJWA 4QJFA 5AFWA 3E9IA 4KY6A 3RR5A 4CDEC 1C7YA 4DV2Q 4DR5L 3DMUA 1Y1WG 3PO3B 4LF8Q 3K59A 1K83B 3M4QA 1JR0D 4UP8A 1I4PA 2ZXPA 2I46A 1SYDA 4DR2L 3W2DA 2OTJA 1HHVA 1XPOA 3N52A 2OQ0A 3CCEA 3ULPA 2ZJQA 3QOLA 1L0WA 1U4LA 2K32A 2WV6D 5C3EG 1PRTC 4LMQD 3U58A 1YNNC 2QDBA 1D1KA 5EBDA 2KENA 4DN4M 1QNKA 1EY9A 3I7FA 3FPPA 1U4MA 5EKKA 1MIUA 2F0WA 2R93G 3T51B 1CKNB 3OW2A 4S3SA 1N8RC 2JK8A 4HEDA 1XXGA 4DV4Q 2UXBL 3MVVA 4JBWA 2JA6H 1O78A 1TWAH 4B9WA 2ZT9C 4OXPA 3NTIA 2IPKD 1ZEQX 4PZ6A 1V1OA 4A3IG 1Z6HA 2R7ZG 5ELDA 3GTPH 4XQQA 4CBVA 4A3MG 4J8QA 1TVXA 1YEZA 1D5MC 4KHPL 1H9KA 2RQXA 5DM73 4BY1B 1B53A 2UUAQ 1PZID 2FFKB 2ICIA 4WJ3M 3ULLA 4MIUA 4KI0A 3H3VI 3MFGA 2PNRC 4HJ8A 1PRTF 1J5EQ 3CMAA 3HP3A 4K5VA 1HFGA 1H9SB 1UAPA 2K05A 3H0GH 4JI4L 2EPBA 4IALA 3L3OC 1PZJD 3VYSA 3GTMB 4EVOA 3G4SA 3CQZH 4B9XA 2WB1B 3FMCA 3MXNA 3S17B 4KY5A 1EU3A 1VCIA 2B2VA 1PH3A 1PYBA 4FF3A 1V43A 5CGKA 3ERQA 1PH7A 3CCMA 3KF6B 1K9MC 3K81C 1G91A 3TQYA 1DOKA 2NUCA 3DWAA 3A7LA 4IFDJ 1SYGA 1E7ZA 4DR4Q 3CHBD 2EDGA 3CKIB 2ALYB 4JYAL 1YNXA 4Q0FA 5I9PA 1J8IA 4HJAA 1CHQD 1SNPA 4FXKC 2SNSA 3A54A 3VYUA 4GLXA 4X64Q 1V1PB 4DV6L 2LY7A 3RUZA 2CW0D 2YU9B 4H0LC 4DV3L 1LACA 4DR1L 5IGFA 2AQ3B 4DK0A 4GOPB 3J80L 1VMCA 3CPWA 2A6EC 4DAYA 3DWPA 4YCVA 1WD1A 1EIYB 2JSOA 1RDPD 5C3WA 1B9NA 1BF4A 1JB3A 5C44H 3C2PA 1N33Q 4KN4C 3BZKA 1STGA 1OTCA 1X3FA 4JYAQ 1W2BA 1K28A 4DR1Q 3SK5A 4JOIA 4RGTA 4RKBA 4A3CH 1G51A 1HQRD 2RVLA 1XYIA 5C4ZA 3A7AB 5J39A 5DNFA 1TS5A 1IBKQ 4A3GH 1R4QB 1F9RA 2JA6G 2LKVA 3NK9A 3D4RA 3MAQA 1JCKB 2E74C 5J1ZA 1FJGQ 2Q2HA 3S1NH 1LTGD 4OX9Q 1IBMQ 4I65A 3MEHA 1SYFA 1CK1A 1AZQA 1EYAA 1VQJA 3W1BA 3IKJA 2EOTA 2BH2A 2UU9Q 4C3JB 2D9UA 4IJLA 1STBA 1SR3A 5FLMG 4B3SQ 1AW7A 1NAPA 2RHSB 4C3HB 3S2DH 5I4DA 4PNYA 5D3IB 1QVGA 1ILPA 5D14A 2B2TC 1WTWA 3S15B 2F0SA 1F2ZA 1H9MA 2F0MA 1H95A 2K75A 1K73C 4KK7A 1GD7A 4HIKA 1WOCA 2Z4IA 2YTVA 1X65A 1IXRA 2Q2IA 4JI8Q 4R4QA 3CXCA 1V9PA 5IYDG 2I5HA 4ILWA 1Q90A 1P16A 4DPGA 4RHRA 4UPAA 5IY0A 3OTOQ 2JA9A 3W3AA 2NYZD 4WJ4A 1O80A 4DV4L 2UXBQ 1M8AA 2HIXA 3H94A 1NE3A 2Q8RE 4I7AA 3CCJA 4A3GB 4FP5D 3C1FA 1W6JA 2F0OA 2WIIB 3W5OA 2MHVA 5AJ3L 1HNXQ 2B2YA 1CZWA 1ICFB 4H7BA 2F3VA 2K5VA 1HTLD 1STAA 1VQ4A 1KIXA 3K57A 3R2TA 2PW7A 2BE5C 3OWFA 4HIDA 1I6HH 1NR2A 3TRZA 5K36H 4DFAA 3HOWH 1IBLQ 1PFMA 3TREA 1TY0A 4F8MA 3KJPA 4DV2L 3HOWG 1PLFA 3PUWA 1SE4A 4JBJA 5F2DA 1XMOL 2JA5H 2K6AA 5FKAC 1RL2A 1A15A 2UUBQ 4DNRB 3ND8A 1BCPB 2DY7A 4JI6L 3RZOB 2CH4A 4AIMA 2EYHA 1NUCA 3SE0A 1XNQQ 2F0GA 2ZM6L 1FD7D 2A6HC 3K7AH 4FO2A 1CTMA 1KDCA 1WTPA 1EZ8A 1I50H 4A75A 1EY6A 3P20A 1Z7TA 1WTXA 3Q6SA 2VB3X 1N33L 5M5WB 1D7QA 4OELB 5IGBA 3D4DA 3ER0A 3KLRA 1VQ7A 1JMCA 3RN2A 4CDFC 3DHQA 1JOOA 3LWUA 3CQZB 2FMMA 1IW7D 5I2YA 5IWAQ 1QCBD 1KXLA 1TWFB 1RIPA 2F0NA 4IZ8A 1K3RA 3MA2B 4B3TL 3D6WA 3M4PA 1E1TA 3T4AC 3VR6A 1LTLA 3S9WA 4GKKQ 1WTOA 4J6HA 4JI1L 2F0LA 1WJJA 1K0RA 2N78A 1X3QA 4IPCA 2P5ZX 2Q8IB 1SYCA 4QL5A 3J7AF 4OO1H 4BY1G 3CC4A 3EIVA 1PTOD 2E5LL 1EY4A 2NB0A 2RF4A 1VQ6A 1MBYA 3HOUB 1PTOB 5DEHA 4UDUC 5LMNQ 3P75A 3TP8A 1EYDA 4KTAA 1ENCA 1LT6D 5M3MG 3I91A 2RSNA 3FKIH 4NPSA 3I90A 1GUOA 2KECA 2V1CC 2WKDA 4FF4A 1F9SA 4X62Q 3S17H 1IKMA 2MO0A 3T16A 1SLJA 1BOSA 3PCOB 1JWUD 3PF5A 4EQNA 2L5TA 3A5UA 3C3LA 1ET6A 3I4MB 3HOVG 3IFTA 5IYCH 3NP8A 1KDBA 2Z6BA 2B29A 1U4RA 1VQLA 3OIPA 3T1HL 3P7JA 4BBRH 3ONAB 1I50B 5FLXc 1JJCB 2VQFL 1TU2B 2B2WC 4CDDC 2VQEL 1I4HA 3M85A 5M3FH 5C4XG 4UP9A 5M9OA 2B2VC 2QW7A 5HGQA 2B2UA 3H6MA 4DV1L 2EY1A 4GZYC 2MQHA 4RCNA 5CR3A 2R3ZA 4OO1G 3VA5A 5H1SE 1FNVA 3PO2G 4MN3A 3F2DA 1BKBA 4YWKA 3V96A 3OIQA 1E2ZA 1N36L 1YNJC 1PFNA 2YU9H 3R3OA 3BVGA 1DOMA 4DXGA 5M3MB 1E22A 4KN7C 1VQOA 4ZLTF 2BA1A 4KLKA 3TP7A 3PGZA 1FNWA 3EBEA 3M3YH 4PZ7A 5CV6A 5EBCA 1PYWD 2RDGA 2B2UC 2I0QA 4LFAQ 2UUAL 1S5BD 4KHZA 4LF6Q 1Y8OB 2CH4W 3TMEA 3I4MG 4JI5Q 5EPKA 1C8CA 1PMRA 3OHXC 1YJNA 2F0FA 2B2WA 4OEMB 5C3XA 4O42A 3QB3A 2BDOA 1TY2A 4O0AA 1H9SA 4X66Q 4G7ZC 3UE1A 3SEBA 1T9HA 2K1BA 4ODGA 3HKZG 4ZCKA 1JQYD 1K3BC 2GA4B 3OMGA 4RA8A 2R92B 1UEAB 2PI2A 1T5XD 3DEPA 3FKIB 4OIKA 3S2HB 1ESRA 1GUSA 4RKLA 4P71A 3PO2H 4JI5L 4JI7Q 5CC4A 3WOFA 1WCMG 4A3FH 3HOZG 3R93A 2KVMA 3L9AX 2JA8G 1KQSA 1R4PB 4RMFA 1YNND 4CJ1B 3PIOA 1LTTD 1AZPA 1TWCH 1ZYRC 5BN4A 4DR2Q 1T5EA 4GN4B 4DA2A 2ZXOA 4EQOA 4AYBE 2EE1A 2NTSA 4XYOA 3T53B 2UXCQ 1FJGL 1Q82C 1N9WA 4YWLA 3T13A 2RDFA 1DM0B 1BBWA 1TWAB 4YY3Q 3DM3A 4A4IA 4A3IH 2OEOA 4OHJA 3KLSX 2KQ3A 3UDIA 5EGTA 2B63B 5KYIA 4ZYSA 2Z6KC 2Z0SA 1UE7A 4J15A 3PUXA 1SFOH 2R93B 2EYOA 2BA0A 3BJUA 1Y14B 3F2CA 2F0JA 3BZCA 4B3TQ 5KNDA 4DK6C 3I55A 1TS2A 1YVCA 4NXML 1M90C 4FNFA 1RJTA 1Q81C 3KFUA 5A35A 1AE3A 1HH2P 4BA2I 4OIJA 1GHKA 1SXTA 2RCNA 1QUQB 3HG9A 3S1NB 1PYSB 4LF7Q 1GM5A 5KIXA 1OXVA 1MGSA 5IP9G 1X6OA 3CCQA 4DV6Q 1K83H 3RMHA 3QG1A 4F7XA 4JV5L 5LMNL 2EY5A 2XRSD 3QIAA 2PQAA 1ET9A 1MD2D 5FJ8G 2R7ZH 4PZ8A 4A76A 4DR4L 2NVYB 1B70B 4A3LH 4IURA 1FGUA 4HMIA 1PH4A 2UU9L 2CWPA 4BBRB 2E2IH 4RGOS 4MTKA 1D5XC 1EWCA 3VR4A 3E9HA 3F8TA 5KNCA 1IKLA 3QR8A 1ESFA 5FO9B 2B2YC 2X6GA 4JPBW 2NVQB 4HCSA 4QUCA 4WFN3 1RF2D 4UY8C 5JJIA 4FF1A 1RHPA 1NCVA 4N9PA 2F3WA 1XTCD 4OGQC 2LMCB 1EQRA 2O2LD 2KCMA 2O4XA 3GDEA 2MPMA 1JB7A 3IFDA 3J7ZC 3M7GA 2FMCA 4NMZA 1PA6A 1G2TA 4YHHQ 4DUYQ 1FNUA 4EX5A 1L0YB 5LMUL 3GTPB 3GTJB 1I6VC 5C5LA 2G9DA 3GTLH 2Y0SB 4BBSH 1SRUA 1PH1A 2VQFQ 4R8IA 2F4IA 2K28A 2VZAA 4R4TA 1JE5A 2HQEA 4F87A 2B2TA 3H0GG 2F0EA 2Q2UA 1Y1WB 1Q1EA 3KBGA 2G5DA 4KHPQ 1X3GA 1JJGA 1B7YB 4C56C 3JC66 4H02A 4DR3Q 1X9NA 4GNXB 4POGA 1SEBD 4AQYL 3QJYA 1QVCA 2OT2A 5M5YB 1RODA 1ASYA 4R4OA 1HJPA 3I72A 1EIGA 2XWBB 2RKSA 3TBIB 5T1GA 3DXJC 4HR7B 2PYKA 2H1EA 1CUKA 4K5WA 1STYA 3K5LA 2AUKA 5EKLA 1ZYRD 2K52A 1CSQA 1VQEA 2IX1A 1JWMD 4LFCL 2ZTDA 1XNQL 1EWIA 3BZDB 4IFDI 1VS0A 4IO9A 2WB1E 1QILA 4C3IH 2R7ZB 2IX0A 4JOIC 4HMJA 4LNQA 3NQIA 3SHLA 3TZUA 4JK1C 4X65Q 5M5XH 2HQLA 1NBWA 2PW5A 1YHBA 3I4NG 2WP8J 3L2PA 4B3ML 1EYGA 1FYCA 2OF1A 4OWXB 1TKWB 1RCVD 1EZ6A 5CV4A 3W1GA 2F1MA 1DZ1A 4H44C 2N8NA 3I3CA 1KD1C 2DJFC 3KDFA 3MTSA 3D8GA 2EZVA 1J6QA 1GUNA 1SSOA 1EY0A 4LF5L 4C3HG 3HOYH 3K6OA 1TS4A 4EQPA 1S72A 1L2FA 4DK1A 3S1QB 4QUFA 3GTJH 1O7LA 3PIPA 4GS3A 4GOPC 3SGIA 4LWCA 4DUZQ 4ME5A 2XVSA 2ZTEA 2WB1G 1KHIA 1XTDA 1DXMA 1BVSA 3J81E 1SMYC 2RSOA 4L8JA 2VQEQ 2E2DC 1W3SA 4Q5VA 1SNDA 4KV6A 1CKOA 4EGVA 3BG3A 1NR4A 1JORA 2QCPX 4JBMA 4U673 2ICEC 3PUZA 3I4NH 1VDZA 2AMCB 2CW0C 2MJ8A 2VUMB 1F9QA 4IPDA 4ABNA 1HZBA 2EJGC 2L15A 3D0FA 4RWSC 4QIWE 3T1HQ 5DAUA 4K8JA 1L1OC 3UDXA 1LTAD 1S5DD 4A3KH 1OXSC 3A8IE 3A0JA 2WAQG 4R9WA 2RA4A 3CCVA 1V8QA 5KRUA 2DUDA 2IHEA 3RZOH 3GD7A 1QG7A 5HGTA 4DV1Q 2A73B 1II3A 4XIGS 4DU9A 1M4VA 2A69C 2ZJRA 3GO5A 1DONA 2F0TA 1VQBA 3S24A 1K0SA 1Y1VG 2PI2E 3KJOA 2JJQA 1AP0A 4GN3B 2EIFA 4K0KQ 4JI2L 3E6ZX 2FINB 2NZOA 3S14H 4LW1A 4N8FA 3JAMc 1EOVA 1FGBD 1ILQA 2RBMA 1UEBA 2R93H 4LJZC 3MXUA 3LNNA 2NBFA 3S1QH 4LF7L 1SROA 1X3PA 3STBD 5G3LF 4DV5Q 4H13C 4IPGA 4BY1H 5FK9C 1KAAA 1J9OA 4KD4A 2KEDA 3MZ5A 3GTOB 2E2JH 4GKKL 3G48A 4LUZA 1VQDA 2MNAA 1DD2A 2JEBI 3AB9A 5ELOA 3T1YL 3MWYW 2V4DA 3U9OA 3JAML 3VR5A 1LV9A 2EXZA 1RTNA 2ZTCA 3HRZC 5LHY1 4LF8L 2WKCA 3KLWA 5DM63 4CKEA 2I5LX 1EEFD 3CRKC 1ZXTA 4M1UB 4NXNL 1X3EA 4DR7L 1SYEA 3GTMH 1KDAA 2C35B 4MZ9A 4UAIA 1I94L 2Y0SE 1STHA 1TWGH 2A6HD
chains in the Genus database with same CATH topology
5M3FB 2K01A 1Y1VB 5KGUA 3OW7A 3BDLA 2PZUA 3HOXB 4RAUC 4HTHA 5IGGA 1JWSD 2K5DA 3E5SA 3VA7A 3E0JA 1DOLA 2JA5B 1WTRA 1Z47A 2WACA 2PZTA 1QB5D 2A5HA 4LK1C 1Q12A 3DM1A 2KJXA 4NDXA 4QF4A 4KKUA 3QWNA 1BUVT 1QNUA 3F2UA 1GOZA 2IW3A 1ML0D 5E4WC 4K6LA 2OXPA 2VB2X 2NZ1D 2KOLA 3I73A 4WORA 3J81L 1VMPA 4KJOA 1PRTB 3J7AV 1D1IA 3M4OB 3GQBA 4MHEA 1NSNS 2L4NA 1HTPA 2K03A 3SR1A 3BDOA 2EJFC 5LL6S 2EYFA 5E1FA 2E2JB 5JJZA 3FPUB 4NW2A 5JOBA 2SNMA 3G7LA 1B9MA 1G291 2CQAA 2DY8A 1RTOA 5JPMC 1HUMA 1PRTD 1BQQT 3V05A 4RCOA 2TSSA 1HPCA 5FO7B 5JEAG 5I6WA 4Z9CB 3BYYB 3PV0A 3MFYA 4CHTB 4TKOB 2L9HA 3SK6A 1EL0A 3A8JE 2AUJD 3OOCA 4XDXA 5J22A 4P2CB 3HEJA 1CFMA 2B8FA 3NPPA 2PO4A 3TN2A 1SDFA 3GTKB 4IUUA 3GV6A 4M8AA 1CQVA 1F9PA 4BA1I 3BVZA 1OXUA 4L63B 4ULLA 4K2KA 2MGSA 4U68A 5FO8B 4TRDA 4DNTB 4K5XA 1DCZA 3HOVB 5C3EB 5I6YA 1SBBB 2EY2A 1MSGA 3N6RA 3R8BA 4IUVA 4BWGB 2K5QA 4K14A 1A3VA 2N55A 3MXGA 4RHSA 4CKCA 1PXUA 1X32A 2BOSA 4C3JG 3ITPA 3GV3A 2AWNA 4A3MB 4AYBB 2DNEA 3TP6A 1QJOA 1Q8IA 2WAQB 1EEID 2EJMA 2YYZA 1EY7A 2Z1CA 3VYTA 2FHTA 3EVQA 1SNCA 1H9JA 1D6EC 1PZKD 1D2BA 1F2YA 2X6LA 4FYDA 5CV5A 3C1EA 1G8ZD 5IOCA 1VF7A 4BY7B 1LABA 4WRDA 4BS9A 1A3UA 1AEXA 1JOKA 3OMCA 1B4OA 1F2MA 4OL7A 2HCIA 3H09A 3NSWA 2JXMB 1Y69U 1OO9B 5IGCA 2EVBA 1KNEA 2KEEA 2DN8A 1HRJA 1F2LA 3P1HA 4A3IB 5A2QL 5JEAJ 3A56A 2JA8B 3NTHA 1EWHA 5T1IA 3X3NA 3H0GB 1A2UA 5IIFA 1LO5D 1TT2A 1QWYA 4L6TB 1EFID 1EQTA 1STEA 4DAPA 2R61A 3NQTA 4DAVA 1UUPA 5COYA 3K5MA 4G57A 3M3YB 5EKIA 1LT3D 2MUYA 3EQLC 2TMPA 2A6ED 4J1MA 2H4OA 3CRLC 1STNA 3DWQA 4YIJA 4CJ0B 1L0XB 3OSOA 1LTBD 5JVH3 1I4GA 3KF8A 4G7OC 4IQZA 2PPBC 5IGEA 1K8OA 3H91A 4XXEA 3TSSA 3GTGB 4C1NK 3O13A 3KLSA 1O7ZA 2KHSA 3EA6A 1IHZA 3H3VC 3M4YA 4X3UA 3TDQA 1SAPA 4HCEA 4A3JB 1PDQA 1BR9A 2ID0A 3K5OA 3LX0A 5FOBB 2XRQD 4Y7NB 5JVG3 4CKBA 1IL8A 4ZUIA 5CBEE 2E2HB 4O1NA 4XT3B 1O7YA 5CMDA 4X3TA 3D31A 2XSCA 5ELFA 1WD0A 1AN8A 3URYA 5I2XA 3A8KE 3DEOA 4A3DB 1Q1BA 1VF5C 2M2LA 5FLXL 3TZDA 3WDNA 3RZDB 1R9TB 2A69D 4WJWA 4PMWA 1CZGA 3RLFA 1G6ZA 1B3AA 4QIWB 1S5FD 3LWEA 5EPLA 4RGNA 2QEJC 2NVTB 5KYLA 1CQFA 1SE2A 5JEAH 4FXDA 5CORA 2SDFA 2XIWA 1EU4A 1E2WA 1LTID 2F0QA 1SNQA 1S4ZA 4XYQA 2B8GA 5JPNC 3K58A 1SNOA 1HCZA 1SJHD 3SDZA 4A3FB 1JE4A 2Q8TA 3Q22A 3ZYYX 3FRPB 1JOQA 5NUCA 3DUZA 5C0XJ 2F0VA 1ICWA 3KUPA 2K7VA 2RDHA 2L55A 3EJIA 4B08A 1PFBA 1GUGA 2E76C 1WTVA 2AQ1B 2AWOA 2F0PA 1GUWA 2E75C 1EYCA 1CT1D 1BDOA 2XN9C 5K36G 4CJ2C 2X69A 1GJXA 1EY8A 3ND9A 5K5PA 1HQMC 1KABA 2J7ZA 4QMGA 4ZUJA 1CA5A 1BCPD 2J0TD 3SK4A 1U9RA 2PCFB 5BN3A 3AMUA 3Q24A 2EYPA 3I70A 3NXWA 4RH6A 2QILA 4DF7A 2QF7A 2VXWA 3J7YW 2EYMA 4FF2A 3D3RA 5ELCA 1CHPD 3X3MA 2HDMA 3CU7A 2NVXB 3I4LA 2AQ2B 1TS3A 5C4XB 4I7ZC 2DNCA 1C48A 2WINB 3FDTA 3NHHA 3NWSA 3VR2A 2BCOA 3PO2B 5E4XA 1LLRD 3FVQA 5IODA 1E2VA 3K7AB 2EY6A 4IUPA 1H9RA 2N88A 4PMBA 5C0XH 3GTQB 5ELBA 4IUQA 5CV9A 3RD4A 3MC0B 4HAEA 2L0CA 3D4WA 1F77A 1A2TA 2O5IC 3HOYB 5CV8A 4E6IA 5E3FA 5CBAE 4KHVA 1LT4D 3HS0C 4K2LA 3PMFA 2K5WA 1WVLA 3EROA 2KA7A 4V0BA 1ENFA 2M00A 3I4NB 1S5ED 1B1ZA 5C4JB 4G7HC 3KBXA 3NE5B 3T56B 4KKSA 1HA5A 5JAVA 5IT9L 4DGZA 1BNZA 4ID6A 1RD9D 1B50A 1C4QA 3C46A 4F88A 3BYTB 1A6XA 3QO2A 3NBHA 2IL8A 3V2TA 5ELEA 3VYRA 1TWCB 2D5DA 2ZXRA 5D3DA 5D65A 2KUMA 3I8ZA 1TR5A 2MP1A 5IT9E 1RKNA 5BN5A 2JA6B 2KCNA 1XX8A 1Y8PB 2JEAI 2JE6I 1CA6A 1MSHA 4PMCA 4RGMA 2PMZB 1B2TA 1GHJA 1HXYD 5C5MA 1QE6A 1CM9A 1WCMB 3Q0AA 1V1PA 4KY7A 3GTLB 2BE5D 4LAAA 3KK7A 3BVMA 2D62A 3QOJA 4BBSB 4RFBA 4ZKBB 5KEEA 2QKIC 2F0IA 4XTCS 1Q3LA 1QOHA 4IUNA 1LT5D 2D2CC 3PIP3 4KMUC 3IAYA 2C9OA 2L11A 1BXTA 4C1NI 1DJRD 1JICA 1SMYD 2PQEA 4K6DA 2SEBD 1OXXK 3D6CA 2SOBA 3JAME 3J80E 2E2IB 3GP7A 4NKLA 5M5XB 4ZRZA 4XQNA 4A3KB 1HA6A 1TWGB 1U4PA 3SVMA 1I4QA 3S16B 2BDNA 4NP5A 1EOTA 2F0HA 2JYOA 5EQ0A 1E0BA 5LL6X 2EYJA 4XT1B 2J4XA 3PUVA 2XWJB 1DYQA 1LTRD 5IGDA 1SJED 1FR3A 3VR3A 3HOWB 1S5CD 2PZWA 3L7ZC 4KKTA 1EY5A 2CVRA 4CGYB 3S1RB 4A93B 1LTSD 5ISRA 1TIID 1HFNA 1IYVA 3BDCA 1EQVA 2KCCA 1SE3A 2HCCA 4X3KA 1CI3M 5C44B 4DXFA 4HSVA 3G6JB 1KTKA 2L1BA 1BCPC 5CV7A 2K33A 1GXDC 3K0YA 2HUGA 2A74C 2F0KA 2O5JC 1PTOH 2A68D 3S1MB 5C4HA 1BBXC 2B39A 1JC7A 3HGBA 5I9OA 3U9SA 5C6AA 3HKZB 4FVMA 1B44D 2I07B 5G3LD 2Z4HA 2VNUD 4C3IB 2NWGA 4IN3A 1TQOA 4PV1C 4IUTA 4FXGC 4HN7A 3TP5A 1KLGD 2IWHA 4OO1I 3UI2A 3HOZB 4ZKCB 3NWTA 4G4KA 2XNAC 2HDLA 3OWEB 5A2QE 2FJ2A 5FLXE 3EFXD 3FEWX 1K8MA 3MHBA 4TQUS 3WOEA 1HUNA 4ZK9B 5C0XI 1G2SA 2F0UA 3NTKA 1IYUA 3BS1A 2K04A 2L12A 1D5ZC 1TWHB 1KNAA 1PTOC 3AU7A 2LFNA 4XQJA 3PIO3 1I6HB 4IFDH 1MI2A 2IJ0A 3S14B 4V190 1BO0A 3SXHA 3PUYA 4K8IA 5C0XG 4C2MB 3IL8A 1GUTA 2G9HD 4C3IG 3R2IA 5EJWA 4TSSA 2EYLA 1Y8NB 4KJNA 3SK8A 2A68C 3A55A 3NUCA 5HURA 1BCPF 2NN6I 1I3QB 5CYUA 2NTTA 1SFOB 1W6KA 2C5CA 1IW7C 4QB4A 5TSSA 1EIHA 1OXTA 1I4RA 1I4XA 1WTQA 4A3EB 2LS01 1PTOF 4R8NA 3Q23A 1ENAA 2JP1A 1XWEA 5KNBA 3NBIA 2Z8LA 4IFDG 2R6GA 2NN6G 5EPJA 4ZAIA 1SYBA 4A3BB 2M9VA 1AFPA 2NN6H 4KD3A 1ZKOA 4QCLA 1YNJD 2JA7B 1ONLA 1UNSA 3OPOA 3K5NA 2F0DA 3S2DB 2IX3A 4HSPA 1SNMA 3MXPA 2CHBD 2IT1A 1KLUD 4N9TA 2ENBA 3HZXA 2F03A 1A3TA 4PQXA 4ZQ3A 3M7NA 4X3SA 5AFWA 4KY6A 3DMUA 3PO3B 3K59A 1K83B 1JR0D 1I4PA 2ZXPA 2I46A 1SYDA 3W2DA 1HHVA 3N52A 3QOLA 1U4LA 2K32A 2WV6D 1PRTC 4LMQD 1YNNC 2QDBA 1D1KA 5EBDA 4DN4M 1QNKA 1EY9A 3FPPA 1U4MA 5EKKA 2F0WA 3T51B 4S3SA 4HEDA 1XXGA 3MVVA 4JBWA 1O78A 4B9WA 2ZT9C 3NTIA 2IPKD 1ZEQX 1V1OA 1Z6HA 5ELDA 4XQQA 4CBVA 4J8QA 1TVXA 1D5MC 1H9KA 2RQXA 5DM73 4BY1B 1B53A 1PZID 2FFKB 2ICIA 4MIUA 4KI0A 3MFGA 2PNRC 1PRTF 3HP3A 4K5VA 1HFGA 1H9SB 1UAPA 2K05A 2EPBA 4IALA 3L3OC 1PZJD 3VYSA 3GTMB 4EVOA 4B9XA 2WB1B 3FMCA 3MXNA 3S17B 4KY5A 1EU3A 1VCIA 2B2VA 4FF3A 1V43A 5CGKA 3ERQA 1G91A 1DOKA 2NUCA 3DWAA 3A7LA 4IFDJ 1SYGA 3CHBD 2EDGA 3CKIB 4Q0FA 5I9PA 1J8IA 1CHQD 1SNPA 4FXKC 2SNSA 3A54A 3VYUA 1V1PB 2LY7A 3RUZA 2CW0D 2YU9B 4H0LC 1LACA 5IGFA 2AQ3B 4DK0A 3J80L 1VMCA 2A6EC 4DAYA 3DWPA 1WD1A 2JSOA 1RDPD 5C3WA 1B9NA 1BF4A 1JB3A 3C2PA 4KN4C 1STGA 3SK5A 4RGTA 4RKBA 1HQRD 2RVLA 1XYIA 5C4ZA 3A7AB 5J39A 5DNFA 1TS5A 1R4QB 1F9RA 2LKVA 3NK9A 3D4RA 3MAQA 1JCKB 2E74C 5J1ZA 1LTGD 4I65A 3MEHA 1SYFA 1AZQA 1CK1A 1EYAA 3IKJA 2EOTA 4C3JB 2D9UA 1STBA 1AW7A 1NAPA 4C3HB 5I4DA 4PNYA 5D3IB 1ILPA 5D14A 2B2TC 1WTWA 3S15B 2F0SA 1F2ZA 1H9MA 2F0MA 4KK7A 2Z4IA 4ILWA 1Q90A 4RHRA 3W3AA 2NYZD 1O80A 1M8AA 3H94A 2Q8RE 4A3GB 3C1FA 4FP5D 1W6JA 2F0OA 2WIIB 2MHVA 2B2YA 1CZWA 4H7BA 2F3VA 1HTLD 1STAA 3K57A 3R2TA 2PW7A 2BE5C 3OWFA 1NR2A 5K36H 4DFAA 1PFMA 1TY0A 4F8MA 1PLFA 3PUWA 1SE4A 5F2DA 2K6AA 5FKAC 1A15A 4DNRB 3ND8A 1BCPB 2DY7A 3RZOB 2EYHA 1NUCA 3SE0A 2F0GA 1FD7D 2A6HC 4FO2A 1CTMA 1KDCA 1WTPA 1EZ8A 1EY6A 3P20A 1WTXA 1Z7TA 3Q6SA 2VB3X 5M5WB 5IGBA 3D4DA 3KLRA 3DHQA 1JOOA 3LWUA 3CQZB 2FMMA 1IW7D 5I2YA 1QCBD 1TWFB 2F0NA 4IZ8A 3MA2B 3D6WA 3T4AC 3VR6A 3S9WA 1WTOA 4J6HA 2F0LA 1X3QA 2Q8IB 1SYCA 3J7AF 4OO1H 1PTOD 1EY4A 2NB0A 1MBYA 3HOUB 1PTOB 5DEHA 4UDUC 3P75A 3TP8A 1EYDA 4KTAA 1ENCA 1LT6D 3I91A 2RSNA 3I90A 1GUOA 2KECA 2WKDA 4FF4A 1IKMA 1F9SA 3T16A 1BOSA 1JWUD 4EQNA 2L5TA 3C3LA 1ET6A 3I4MB 3IFTA 3NP8A 1KDBA 1U4RA 3OIPA 3P7JA 3ONAB 1I50B 1TU2B 2B2WC 1I4HA 3M85A 5M9OA 2B2VC 2B2UA 3H6MA 2EY1A 4GZYC 4RCNA 5CR3A 2R3ZA 4OO1G 3VA5A 1FNVA 4MN3A 3V96A 3OIQA 1E2ZA 1YNJC 1PFNA 3R3OA 3BVGA 1DOMA 4DXGA 5M3MB 4KN7C 4ZLTF 2BA1A 3TP7A 1FNWA 5CV6A 5EBCA 1PYWD 2RDGA 2B2UC 1S5BD 4KHZA 1Y8OB 3TMEA 5EPKA 1C8CA 1PMRA 3OHXC 2F0FA 2B2WA 5C3XA 4O42A 3QB3A 2BDOA 1TY2A 1H9SA 4G7ZC 3SEBA 2K1BA 4ODGA 1JQYD 2GA4B 3OMGA 4RA8A 2R92B 1UEAB 1T5XD 3DEPA 3FKIB 4OIKA 3S2HB 1ESRA 1GUSA 4RKLA 5CC4A 3WOFA 3R93A 2KVMA 3L9AX 1R4PB 1YNND 4CJ1B 1LTTD 1AZPA 1ZYRC 5BN4A 1T5EA 4DA2A 2ZXOA 4EQOA 2EE1A 2NTSA 4XYOA 3T53B 3T13A 2RDFA 1DM0B 1TWAB 2OEOA 4OHJA 3KLSX 2KQ3A 5EGTA 2B63B 5KYIA 4ZYSA 3PUXA 2R93B 2EYOA 2BA0A 2F0JA 5KNDA 1TS2A 4FNFA 1RJTA 5A35A 4BA2I 4OIJA 1GHKA 1SXTA 3S1NB 3HG9A 5KIXA 1OXVA 1MGSA 3RMHA 3QG1A 4F7XA 2EY5A 2XRSD 3QIAA 1ET9A 1MD2D 2NVYB 4IURA 4HMIA 4BBRB 4RGOS 1D5XC 1EWCA 3VR4A 5KNCA 1IKLA 1ESFA 5FO9B 2B2YC 2X6GA 2NVQB 4HCSA 4QUCA 4WFN3 1RF2D 4FF1A 1RHPA 1NCVA 4N9PA 2F3WA 1XTCD 4OGQC 2LMCB 2O2LD 2O4XA 2MPMA 3IFDA 3M7GA 2FMCA 4NMZA 1G2TA 1FNUA 1L0YB 3GTPB 3GTJB 1I6VC 5C5LA 2G9DA 2Y0SB 4R8IA 2F4IA 2K28A 2HQEA 4F87A 2B2TA 2F0EA 1Y1WB 1Q1EA 3KBGA 4C56C 1SEBD 3QJYA 2OT2A 5M5YB 1RODA 3I72A 1EIGA 2XWBB 2RKSA 3TBIB 5T1GA 3DXJC 4HR7B 2PYKA 2H1EA 4K5WA 1STYA 3K5LA 2AUKA 5EKLA 1ZYRD 2IX1A 1JWMD 3BZDB 4IFDI 1QILA 2R7ZB 2IX0A 4HMJA 3NQIA 3SHLA 3TZUA 4JK1C 2PW5A 2WP8J 1FYCA 2OF1A 1TKWB 1RCVD 1EZ6A 5CV4A 2F1MA 1DZ1A 3I3CA 4H44C 3MTSA 3D8GA 2EZVA 1GUNA 1SSOA 1EY0A 4C3HG 3K6OA 1TS4A 4EQPA 4DK1A 3S1QB 4QUFA 1O7LA 2XVSA 4ME5A 1DXMA 3J81E 1SMYC 2RSOA 4L8JA 2E2DC 4Q5VA 1SNDA 4KV6A 4EGVA 3BG3A 1NR4A 1JORA 2QCPX 4U673 2ICEC 3PUZA 1VDZA 2CW0C 2MJ8A 2VUMB 1F9QA 4ABNA 2EJGC 4RWSC 5DAUA 4K8JA 1LTAD 1S5DD 1OXSC 3A8IE 4R9WA 2RA4A 1V8QA 5KRUA 3GD7A 1QG7A 5HGTA 2A73B 1II3A 4XIGS 4DU9A 1M4VA 2A69C 3GO5A 1DONA 2F0TA 1AP0A 3E6ZX 2FINB 1FGBD 1ILQA 2RBMA 4LJZC 3MXUA 3LNNA 2NBFA 1X3PA 5G3LF 4H13C 5FK9C 1KAAA 1J9OA 2KEDA 3MZ5A 4KD4A 3GTOB 1DD2A 2JEBI 3AB9A 3MWYW 2V4DA 3U9OA 3JAML 3VR5A 1LV9A 2EXZA 1RTNA 3HRZC 5LHY1 2WKCA 5DM63 4CKEA 1EEFD 3CRKC 1ZXTA 4M1UB 1SYEA 1KDAA 4UAIA 1STHA 2A6HD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HS0 C;  3OHX C;  3I70 A;  2A74 C;  2E2D C;  5JPM C;  2WII B;  4FXG C;  3V96 A;  2WIN B;  1UAP A;  2B39 A;  1BQQ T;  1BR9 A;  5FO8 B;  1JC7 A;  3L3O C;  3HRZ C;  3CKI B;  2XWJ B;  2ICE C;  2QKI C;  3FRP B;  2TMP A;  5FO7 B;  4ILW A;  5FOB B;  3CU7 A;  1XWE A;  1BUV T;  1JB3 A;  1UEA B;  2J0T D;  4FXK C;  3MA2 B;  3KLS A;  2I07 B;  1PXU A;  2A73 B;  1OO9 B;  3G6J B;  1D2B A;  5FO9 B;  3T4A C;  2XWB B;  5JPN C;  1GXD C; 
#chains in the Genus database with same CATH topology
 5M3F B;  3CF5 A;  1VQM A;  2K01 A;  1Y1V B;  5KGU A;  4JVZ A;  3S15 H;  1JT8 A;  4BBR G;  3OW7 A;  3BDL A;  2PZU A;  1YI2 A;  4R4C A;  4RAU C;  3HOX B;  4LF5 Q;  4HTH A;  5IGG A;  1JWS D;  2K5D A;  3E5S A;  1NMG A;  1ASZ A;  1VQH A;  1Q46 A;  4DK3 C;  3VA7 A;  3E0J A;  4JW0 A;  3A74 A;  4DR7 Q;  1DOL A;  2JA5 B;  1WTR A;  1Z47 A;  1A62 A;  2WAC A;  2PZT A;  1QB5 D;  2WFW A;  3K80 C;  3TS2 A;  2A5H A;  4LK1 C;  1Q12 A;  3AFQ A;  3DM1 A;  3U4Z A;  2KJX A;  4JCV E;  2AKW B;  3PSI A;  2RCF A;  4NDX A;  4QF4 A;  2Y0S G;  4KKU A;  3QWN A;  4JI4 Q;  1BUV T;  1K8G A;  4P72 A;  4YWM A;  1QNU A;  3F2U A;  1GOZ A;  2IW3 A;  1ML0 D;  5E4W C;  5M5W H;  4K6L A;  2OXP A;  2VB2 X;  2NZ1 D;  3K8A A;  3J81 c;  2KOL A;  3I73 A;  4DKA C;  4WOR A;  3J81 L;  1VMP A;  4KJO A;  1L1O A;  1PRT B;  4JI3 Q;  2NVT H;  3J7A V;  4DUY L;  2ASB A;  1D1I A;  3M4O B;  3GQB A;  4X66 L;  4MHE A;  1NSN S;  2L4N A;  1HNW Q;  1HTP A;  3Q8D A;  2K03 A;  2CFM A;  3SR1 A;  3BDO A;  2EJF C;  4BBS G;  5LL6 S;  2EYF A;  5E1F A;  2E2J B;  5JJZ A;  4BXX G;  1Q7Y C;  2F4V L;  2DGY A;  3FPU B;  4NW2 A;  2MO1 A;  2SNM A;  3ERS X;  3G7L A;  1B9M A;  1G29 1;  2CQA A;  5JOB A;  4QQB X;  3PF4 A;  1NMF A;  2DY8 A;  1RTO A;  2F52 A;  5JPM C;  4GKJ L;  2NVY H;  2PQA B;  1HUM A;  1PRT D;  1BQQ T;  1N34 Q;  1WCM H;  4FDB A;  4RCO A;  3V05 A;  2TSS A;  1UE5 A;  1HPC A;  5IT9 c;  5FO7 B;  5JEA G;  1GVP A;  1LUZ A;  5I6W A;  1PH2 A;  4GOP A;  3K7U C;  4A3B G;  3CME A;  4Z9C B;  3BYY B;  3NEL A;  3RLN A;  3PV0 A;  3MFY A;  2LXK A;  4CHT B;  4A3B H;  4TKO B;  2L9H A;  4N8X 1;  3SK6 A;  1EL0 A;  3A8J E;  2QDL A;  3AFP A;  2AUJ D;  3OOC A;  4XDX A;  2IY5 B;  5J22 A;  4P2C B;  3HEJ A;  1CFM A;  3OTO L;  3RNU A;  5GAH C;  2B8F A;  3OYY A;  1N34 L;  4DV0 Q;  3NPP A;  2PO4 A;  3TN2 A;  1CKM A;  1SDF A;  3GTK B;  4IUU A;  3GV6 A;  4M8A A;  1CQV A;  1F9P A;  4BA1 I;  2UXD Q;  3BVZ A;  1OXU A;  2K5H A;  1VQ5 A;  4A93 G;  4MNO A;  1I94 Q;  3MXN B;  4L63 B;  3CCU A;  4ULL A;  4K2K A;  2MGS A;  5IYD H;  3HKS A;  4A3E G;  1S40 A;  4U68 A;  4DNT B;  4TRD A;  5FO8 B;  4HIM A;  4K5X A;  1DCZ A;  2VW9 A;  1SMX A;  4YCW A;  3HOV B;  1XMQ L;  1N32 Q;  1QZH A;  5C3E B;  2CQO A;  5I6Y A;  1SBB B;  2EY2 A;  1MSG A;  3HOY G;  4JI0 Q;  1Q8K A;  3UDG A;  2D0P A;  3N6R A;  3NBH B;  3R8B A;  1VQ8 A;  4IUV A;  4UHV A;  4BWG B;  1A0I A;  2HT1 A;  4JI6 Q;  5IP9 H;  2K5Q A;  4K14 A;  4IOA A;  1A3V A;  3RLO A;  2N55 A;  1B3Q A;  5LMN W;  4C3J H;  3MXG A;  4RHS A;  4CKC A;  2A8V A;  1PXU A;  1X32 A;  4LF4 L;  2BOS A;  4C3J G;  3ITP A;  1A8V A;  3GV3 A;  2AWN A;  2ZM6 Q;  4AYB B;  4A3M B;  2DNE A;  3TP6 A;  1CKN A;  1QJO A;  1Q8I A;  2WAQ B;  3T1Y Q;  1EEI D;  2EJM A;  2YYZ A;  1EY7 A;  1U5K A;  2XTI A;  4A93 H;  2Z1C A;  3FHW A;  3VYT A;  2FHT A;  3EVQ A;  2YTX A;  3J80 i;  1O7I A;  1SNC A;  1H9J A;  1D6E C;  1PZK D;  1D2B A;  1F2Y A;  2CCZ A;  2X6L A;  4FYD A;  5CV5 A;  3GTG H;  3C1E A;  4TVA B;  1G8Z D;  2EQS A;  3AQQ A;  5IOC A;  1VF7 A;  1XNR Q;  4BY7 B;  1LAB A;  4WRD A;  2QEX A;  4BS9 A;  1A3U A;  1AEX A;  1JOK A;  1MJC A;  3OMC A;  5AJ3 Q;  1B4O A;  1F2M A;  4OL7 A;  2HCI A;  2UUB L;  3H09 A;  3NSW A;  2JXM B;  3ZJY C;  1Y69 U;  1OO9 B;  5E7N A;  5IGC A;  2EVB A;  1KNE A;  3LGJ A;  2KEE A;  2DN8 A;  1HRJ A;  1F2L A;  1HNZ L;  3P1H A;  4GLV B;  5A2Q L;  5EAY A;  4A3I B;  5JEA J;  3A56 A;  5IP7 G;  4A3L G;  2JA8 B;  3NTH A;  2OTL A;  1EWH A;  5T1I A;  3U50 C;  1KAW A;  2QA4 A;  4HIO A;  3X3N A;  4A3M H;  2HIV A;  3H0G B;  1A2U A;  4HJ5 A;  2UUC Q;  1E3P A;  5IIF A;  1LO5 D;  1K8A C;  1TT2 A;  1QWY A;  2QGQ A;  2YV5 A;  1JJ2 A;  2F3I A;  1CSP A;  3HOX H;  4DV0 L;  4L6T B;  2JN4 A;  1EFI D;  1EQT A;  1STE A;  4DAP A;  2R61 A;  3NQT A;  1M1K C;  4GLA C;  4DAV A;  1UUP A;  1PH8 A;  5COY A;  2EXD A;  3HOX G;  3K5M A;  2CWA A;  4Y7N H;  4DR3 L;  4G57 A;  3M3Y B;  3PQI A;  5C44 G;  1MHW C;  5EKI A;  1LT3 D;  2MUY A;  3EQL C;  2TMP A;  2A6E D;  1DGS A;  4J1M A;  2H4O A;  3CRL C;  2F4V Q;  1STN A;  3DWQ A;  4CDC C;  4YIJ A;  4CJ0 B;  1L0X B;  1VQA A;  3OSO A;  3GTO H;  4A3D G;  4A3C G;  3I56 A;  4DV7 L;  1VQP A;  1LTB D;  1I4G A;  5JVH 3;  3KF8 A;  1HZA A;  4G7O C;  2R7D A;  5IP7 H;  2PNH A;  4IQZ A;  2PPB C;  5IGE A;  1K8O A;  1X56 A;  3H91 A;  2GVA A;  3E0E A;  4XXE A;  2FXQ A;  1GKH A;  2KHI A;  3TSS A;  3GTG B;  2XGT A;  4C1N K;  3O13 A;  3KLS A;  1YIJ A;  2VY3 A;  4YCU A;  4OX9 L;  1O7Z A;  2KHS A;  3EA6 A;  3NEM A;  1IHZ A;  1XPU A;  3H3V C;  3M4Y A;  4OWT B;  4LFB Q;  4X3U A;  3TDQ A;  1SAP A;  4HCE A;  5M5Y H;  3E3X A;  4A3J B;  1PDQ A;  1BR9 A;  2ID0 A;  3K5O A;  3LX0 A;  1V1Q A;  5FOB B;  2XRQ D;  3KOJ A;  4Y7N B;  2E2H H;  5JVG 3;  1PV4 A;  4CKB A;  1IL8 A;  4ZUI A;  1P8L A;  5CBE E;  2UUC L;  4O1N A;  4XT3 B;  1O7Y A;  2E2H B;  5CMD A;  1N32 L;  1NTG A;  3D31 A;  4X3T A;  2XSC A;  5ELF A;  1WD0 A;  2OWO A;  1AN8 A;  3URY A;  5I2X A;  3A8K E;  1UWV A;  3DEO A;  4A3D B;  1Q1B A;  1VF5 C;  2M2L A;  2OCE A;  2PMZ E;  5LMU Q;  5FLX L;  4A3J H;  3TZD A;  3WDN A;  3RZD B;  1R9T B;  2A69 D;  4WJW A;  4X62 L;  4PMW A;  3PO3 H;  1CZG A;  3RLF A;  1G6Z A;  4A3G G;  1B3A A;  4QIW B;  1S5F D;  3LWE A;  5IYB H;  1KC8 C;  5EPL A;  3J81 i;  2Z9H A;  4RGN A;  2QEJ C;  1TWF H;  3HOZ H;  2NVT B;  5KYL A;  1CQF A;  1PFS A;  1SE2 A;  5JEA H;  3AYH B;  3RN5 A;  4FXD A;  1WI5 A;  5COR A;  4YY3 L;  1VQG A;  2SDF A;  2XIW A;  1EU4 A;  5JJK A;  2UXD L;  1E2W A;  4QGU A;  1LTI D;  4L5T A;  1PH9 A;  2F0Q A;  5FLM H;  1SNQ A;  1GO3 E;  3CD6 A;  1S4Z A;  1Z9F A;  4XYQ A;  5BR8 L;  2KCT A;  1WFQ A;  2B8G A;  2YTY A;  5JPN C;  3K58 A;  1SNO A;  4IPH A;  1HCZ A;  4QY7 A;  1SJH D;  3SDZ A;  4A3F B;  1JE4 A;  1X54 A;  2Q8T A;  3Q22 A;  1WTH A;  4DNI A;  3ZYY X;  4LFB L;  3CPF A;  4P74 A;  1C0A A;  3FRP B;  1JOQ A;  5NUC A;  4DR6 Q;  3DUZ A;  4LF9 Q;  4NXM Q;  1IBL L;  5C0X J;  2R92 H;  4DV5 L;  2F0V A;  1ICW A;  1EFW A;  3KUP A;  1UE6 A;  2K7V A;  3M9B A;  2VL6 A;  4A3K G;  2R92 G;  2JA7 G;  2RDH A;  2L55 A;  3EJI A;  1Y1V H;  4LF6 L;  4B08 A;  1PFB A;  1GUG A;  2E76 C;  1WTV A;  2AQ1 B;  2AWO A;  4MTN A;  2F0P A;  1GUW A;  1VQI A;  2E75 C;  4P73 A;  1EYC A;  1CT1 D;  1HNZ Q;  1BDO A;  2XN9 C;  5K36 G;  2H5X A;  1SE8 A;  4CJ2 C;  3I4O A;  5ELN A;  4LF9 L;  2X69 A;  1GJX A;  1EY8 A;  2HD3 A;  5FJ8 H;  3ND9 A;  5K5P A;  1HQM C;  1KAB A;  2J7Z A;  2JQO A;  4QMG A;  4ZUJ A;  1CA5 A;  3NEN A;  5IWA L;  1IL2 A;  1BCP D;  4BY7 H;  2J0T D;  2K4K A;  3SK4 A;  1U9R A;  5IE8 A;  2PCF B;  1NNX A;  5BN3 A;  3AMU A;  1QUQ A;  3Q24 A;  2ATW A;  1UE1 A;  4BY7 G;  2EYP A;  4X65 L;  3I70 A;  3NXW A;  1Y1W H;  4RH6 A;  2QIL A;  4JC0 A;  2A19 A;  4DF7 A;  1MJE A;  3CW2 C;  4JV5 Q;  2QF7 A;  2VXW A;  3J7Y W;  4GKJ Q;  2EYM A;  3AEV A;  4FF2 A;  3HOV H;  3D3R A;  5ELC A;  2E5L Q;  1CHP D;  3X3M A;  2HDM A;  3CU7 A;  1YBY A;  3KDF B;  1VQF A;  2LSS A;  2NVX B;  3I4L A;  1E1O A;  2AQ2 B;  5C3E H;  1TS3 A;  5C4X B;  4JBK A;  4I7Z C;  1YJ9 A;  4NXN Q;  1IYJ B;  2DNC A;  1C48 A;  1I3Q H;  1PH6 A;  1FL0 A;  4DR5 Q;  4HJ9 A;  3KF6 A;  3S16 H;  2K50 A;  2WIN B;  3FDT A;  3NHH A;  3ULJ A;  1XNR L;  2NVQ H;  3NWS A;  3VR2 A;  2BCO A;  3PO2 B;  3HOU H;  1YHA A;  5E4X A;  1QVF A;  4APV A;  4GNX A;  1LLR D;  3J81 j;  3FVQ A;  3CCR A;  1NJI C;  3WWV A;  2I5M X;  5IOD A;  1E2V A;  3HOU G;  2B63 H;  4JI1 Q;  3K7A B;  3GTK H;  2EY6 A;  4IUP A;  1N36 Q;  1H9R A;  1TXY A;  1EUJ A;  1D8L A;  3S1M H;  2N88 A;  4PMB A;  5C0X H;  3GTQ B;  4HJ7 A;  5ELB A;  4IUQ A;  5CV9 A;  3RD4 A;  3MC0 B;  4HAE A;  3HKZ E;  5GAE C;  4LFA L;  4YHH L;  3ICE A;  1VQK A;  4B3M Q;  2L0C A;  3D4W A;  1EIF A;  1F77 A;  1A2T A;  4EQ5 A;  2O5I C;  3HOY B;  5CV8 A;  4E6I A;  5E3F A;  5CBA E;  4KHV A;  3KYH C;  1LT4 D;  3HS0 C;  2E8G A;  4K2L A;  5GRO A;  4NB3 A;  3PMF A;  2K5W A;  1WVL A;  1QZG A;  4LUV A;  3ERO A;  3BU2 A;  2KA7 A;  4V0B A;  1ENF A;  2M00 A;  3I4N B;  5C4X H;  1S5E D;  1B1Z A;  5C4J B;  1Q86 C;  4G7H C;  1IZ6 A;  3KBX A;  5C4J H;  2Q2T A;  4IJH A;  3NE5 B;  3T56 B;  2AHO B;  4KKS A;  1HA5 A;  5JAV A;  2CKZ B;  5IT9 L;  4AYB G;  4LF4 Q;  4DGZ A;  1BNZ A;  4OWW B;  4ID6 A;  5BR8 Q;  1RD9 D;  1B50 A;  1C4Q A;  3C46 A;  4F88 A;  2N49 A;  4ALP A;  3BYT B;  1A6X A;  3QO2 A;  4POF A;  3NBH A;  2IL8 A;  3V2T A;  1XPR A;  5ELE A;  3VYR A;  1TWH H;  1TWC B;  2D5D A;  4JI8 L;  1HR0 L;  2ZXR A;  5L37 A;  5D3D A;  5D65 A;  4LFC Q;  1HR0 Q;  3I2Z A;  3B6Y A;  3VDY A;  2VUM H;  2KUM A;  3I8Z A;  1TR5 A;  2D0O A;  2MP1 A;  5IT9 E;  1RKN A;  5BN5 A;  2ZJP A;  3J7A 5;  2JA6 B;  2KCN A;  1VQC A;  1XX8 A;  1Y8P B;  2A1A A;  2JEA I;  4DR6 L;  2JE6 I;  1CA6 A;  1HNX L;  1MSH A;  4PMC A;  4L5S A;  4A3E H;  5GAG C;  4RGM A;  2MFI A;  2PMZ B;  1B2T A;  1GHJ A;  1HXY D;  2LXJ A;  5C5M A;  1QE6 A;  1CM9 A;  3A5Z B;  1KRS A;  1WCM B;  3Q0A A;  2HHH L;  1XJV A;  1HNW L;  1V1P A;  4KY7 A;  2HHH Q;  3GTL B;  4B3S L;  2BE5 D;  4JI2 Q;  2R7F A;  4IOC A;  4LAA A;  3KK7 A;  3BVM A;  2D62 A;  2N3S A;  3QOJ A;  3PO3 G;  4BBS B;  4RFB A;  4ZKB B;  5KEE A;  2QKI C;  2JA8 H;  1I5F A;  1IBK L;  5IYB G;  3S2H H;  2F0I A;  4XTC S;  1Q3L A;  1QOH A;  4IUN A;  1LT5 D;  2D2C C;  3PIP 3;  4KMU C;  3STB C;  3IAY A;  1AH9 A;  2C9O A;  2L11 A;  1BXT A;  1NY4 A;  4C1N I;  1DJR D;  1JIC A;  3TS0 A;  4DUZ L;  1SMY D;  2PQE A;  4K6D A;  2SEB D;  1OXX K;  3D6C A;  2SOB A;  3JAM E;  4RG1 A;  3IRB A;  3F2B A;  3J80 E;  2E2I B;  3GP7 A;  4NKL A;  4PG3 A;  2ES2 A;  1A63 A;  5M5X B;  4ZRZ A;  4XQN A;  4LUO A;  4A3K B;  1HA6 A;  1TWG B;  1U4P A;  5J3B A;  3SVM A;  1IBM L;  1I4Q A;  2OQK A;  3S16 B;  2BDN A;  1E24 A;  3G6E A;  4Y52 H;  4NP5 A;  1EOT A;  4R4I A;  2F0H A;  1YIT A;  2JYO A;  5EQ0 A;  1E0B A;  5LL6 X;  2B3G A;  2EYJ A;  4XT1 B;  2J4X A;  3PUV A;  2XWJ B;  1DYQ A;  1LTR D;  5IGD A;  1SJE D;  1FR3 A;  3VR3 A;  3HOW B;  2DJG C;  2GN5 A;  1S5C D;  2PZW A;  4KKT A;  3L7Z C;  4O2D A;  1EY5 A;  1XMO Q;  2CVR A;  2VS1 A;  5HY6 A;  1HZ9 A;  4GN5 A;  4CGY B;  3CCS A;  3S1R B;  3HFZ B;  4A93 B;  3KF8 B;  3FP9 A;  1LTS D;  5ISR A;  1TII D;  1HFN A;  2WAQ E;  3UE0 A;  1IYV A;  3BDC A;  1EQV A;  4ME3 A;  1J5E L;  2K14 A;  1LM0 A;  3CP0 A;  3CC7 A;  4AQY Q;  2KCC A;  1SE3 A;  2HCC A;  4X3K A;  1CI3 M;  5C44 B;  4DXF A;  4HSV A;  1G6P A;  4DV3 Q;  3G6J B;  1KTK A;  2L1B A;  1BCP C;  2JA5 G;  5CV7 A;  2K33 A;  1GXD C;  3K0Y A;  2HUG A;  2A74 C;  1SN8 A;  4R1J A;  3M4O H;  2NVX H;  2F0K A;  2O5J C;  1PTO H;  2A68 D;  3S1M B;  5C4H A;  1BBX C;  2IHF A;  2B39 A;  1JC7 A;  3HGB A;  5I9O A;  3U9S A;  5C6A A;  3HKZ B;  4FVM A;  4P75 A;  1B44 D;  2I07 B;  4UP7 A;  3RZD H;  1R9T H;  5G3L D;  1B8A A;  2Z4H A;  3FKI G;  2VNU D;  4C3I B;  5DLQ E;  2NWG A;  4IN3 A;  1TQO A;  4DAM A;  2KBN A;  3UDF A;  4A3D H;  4PV1 C;  4IUT A;  4FXG C;  1KL9 A;  4HN7 A;  3TP5 A;  1KLG D;  1X55 A;  2IWH A;  4OO1 I;  3UI2 A;  4JI7 L;  3HOZ B;  4ZKC B;  4DV7 Q;  1YHQ A;  3NWT A;  4G4K A;  5M3F G;  3S1R H;  3CAM A;  2XNA C;  3G71 A;  2HDL A;  4BXX H;  3OWE B;  5A2Q E;  2FJ2 A;  5FLX E;  3EFX D;  4A3J G;  3GTQ H;  3FEW X;  1VQN A;  4C2M H;  1K8M A;  3MHB A;  4TQU S;  3WOE A;  1HUN A;  4ZK9 B;  5C0X I;  3F1Z A;  1G2S A;  5JJL A;  2F0U A;  3NTK A;  1KRT A;  1IYU A;  3BS1 A;  1L1O B;  2K04 A;  3J80 c;  3TEH B;  2L12 A;  1D5Z C;  1TWH B;  1KNA A;  1PTO C;  3AU7 A;  4JG2 A;  2LFN A;  4XQJ A;  2K5N A;  3PIO 3;  1MKH A;  3L0O A;  1I6H B;  2B63 G;  4IFD H;  1MI2 A;  2IJ0 A;  5M3M H;  3S14 B;  4B3R Q;  4V19 0;  1BO0 A;  3SXH A;  3PUY A;  4K8I A;  4C2M B;  5C0X G;  3IL8 A;  1GUT A;  1U0L A;  2G9H D;  4C3I G;  3R2I A;  4L5R C;  5EJW A;  3I4M H;  4TSS A;  1PH5 A;  2EYL A;  5GAD C;  1HZC A;  1Y8N B;  4KJN A;  3SK8 A;  4X64 L;  1VQ9 A;  2A68 C;  1S3O A;  5IYC G;  4GNX C;  3JAM i;  3A55 A;  3NUC A;  4JI3 L;  5HUR A;  1BCP F;  2NN6 I;  1I3Q B;  5CYU A;  3DLL A;  2NTT A;  4OON A;  1SFO B;  1W6K A;  2C5C A;  1IW7 C;  4B3R L;  4QB4 A;  5TSS A;  1EIH A;  2JA7 H;  4C3H H;  4X6A H;  1AE2 A;  1OXT A;  1I4R A;  1I4X A;  1WTQ A;  4A3E B;  2LS0 1;  1PTO F;  1EQQ A;  3MEF A;  4R8N A;  4A3F G;  3Q23 A;  2KHJ A;  1ENA A;  2JP1 A;  1XWE A;  1WYD A;  5KNB A;  3NBI A;  2Z8L A;  2RHQ B;  3EN2 A;  4IFD G;  2R6G A;  1FVI A;  2NN6 G;  5EPJ A;  4ZAI A;  1BBU A;  1SYB A;  1YZ6 A;  4A3B B;  4JI0 L;  1C9O A;  2M9V A;  1AFP A;  2NN6 H;  4KD3 A;  4L5Q A;  1ZKO A;  4QCL A;  1YNJ D;  2JA7 B;  3CCL A;  1ONL A;  1UNS A;  3K0X A;  3OPO A;  3K5N A;  1PHJ A;  2NZH A;  2F0D A;  1XMQ Q;  2Z6K A;  3S2D B;  2UXC L;  5GQO A;  2IX3 A;  2GVB A;  1PVO A;  4HSP A;  1SNM A;  3MXP A;  1LYL A;  4AH6 A;  2CHB D;  2IT1 A;  1KLU D;  4N9T A;  2VUM G;  3H3V H;  3CC2 A;  4K0K L;  2ENB A;  3HZX A;  4DAY B;  2F03 A;  3H15 A;  1A3T A;  1HR0 W;  4PQX A;  2BH8 A;  4ZQ3 A;  3M7N A;  4X3S A;  3U4V A;  1YJW A;  4QJF A;  5AFW A;  3E9I A;  4KY6 A;  3RR5 A;  4CDE C;  1C7Y A;  4DV2 Q;  4DR5 L;  3DMU A;  1Y1W G;  3PO3 B;  4LF8 Q;  3K59 A;  1K83 B;  3M4Q A;  1JR0 D;  4UP8 A;  1I4P A;  2ZXP A;  2I46 A;  1SYD A;  4DR2 L;  3W2D A;  2OTJ A;  1HHV A;  1XPO A;  3N52 A;  2OQ0 A;  3CCE A;  3ULP A;  2ZJQ A;  3QOL A;  1L0W A;  1U4L A;  2K32 A;  2WV6 D;  5C3E G;  1PRT C;  4LMQ D;  3U58 A;  1YNN C;  2QDB A;  1D1K A;  5EBD A;  2KEN A;  4DN4 M;  1QNK A;  1EY9 A;  3I7F A;  3FPP A;  1U4M A;  5EKK A;  1MIU A;  2F0W A;  2R93 G;  3T51 B;  1CKN B;  3OW2 A;  4S3S A;  1N8R C;  2JK8 A;  4HED A;  1XXG A;  4DV4 Q;  2UXB L;  3MVV A;  4JBW A;  2JA6 H;  1O78 A;  1TWA H;  4B9W A;  2ZT9 C;  4OXP A;  3NTI A;  2IPK D;  1ZEQ X;  4PZ6 A;  1V1O A;  4A3I G;  1Z6H A;  2R7Z G;  5ELD A;  3GTP H;  4XQQ A;  4CBV A;  4A3M G;  4J8Q A;  1TVX A;  1YEZ A;  1D5M C;  4KHP L;  1H9K A;  2RQX A;  5DM7 3;  4BY1 B;  1B53 A;  2UUA Q;  1PZI D;  2FFK B;  2ICI A;  4WJ3 M;  3ULL A;  4MIU A;  4KI0 A;  3H3V I;  3MFG A;  2PNR C;  4HJ8 A;  1PRT F;  1J5E Q;  3CMA A;  3HP3 A;  4K5V A;  1HFG A;  1H9S B;  1UAP A;  2K05 A;  3H0G H;  4JI4 L;  2EPB A;  4IAL A;  3L3O C;  1PZJ D;  3VYS A;  3GTM B;  4EVO A;  3G4S A;  3CQZ H;  4B9X A;  2WB1 B;  3FMC A;  3MXN A;  3S17 B;  4KY5 A;  1EU3 A;  1VCI A;  2B2V A;  1PH3 A;  1PYB A;  4FF3 A;  1V43 A;  5CGK A;  3ERQ A;  1PH7 A;  3CCM A;  3KF6 B;  1K9M C;  3K81 C;  1G91 A;  3TQY A;  1DOK A;  2NUC A;  3DWA A;  3A7L A;  4IFD J;  1SYG A;  1E7Z A;  4DR4 Q;  3CHB D;  2EDG A;  3CKI B;  2ALY B;  4JYA L;  1YNX A;  4Q0F A;  5I9P A;  1J8I A;  4HJA A;  1CHQ D;  1SNP A;  4FXK C;  2SNS A;  3A54 A;  3VYU A;  4GLX A;  4X64 Q;  1V1P B;  4DV6 L;  2LY7 A;  3RUZ A;  2CW0 D;  2YU9 B;  4H0L C;  4DV3 L;  1LAC A;  4DR1 L;  5IGF A;  2AQ3 B;  4DK0 A;  4GOP B;  3J80 L;  1VMC A;  3CPW A;  2A6E C;  4DAY A;  3DWP A;  4YCV A;  1WD1 A;  1EIY B;  2JSO A;  1RDP D;  5C3W A;  1B9N A;  1BF4 A;  1JB3 A;  5C44 H;  3C2P A;  1N33 Q;  4KN4 C;  3BZK A;  1STG A;  1OTC A;  1X3F A;  4JYA Q;  1W2B A;  1K28 A;  4DR1 Q;  3SK5 A;  4JOI A;  4RGT A;  4RKB A;  4A3C H;  1G51 A;  1HQR D;  2RVL A;  1XYI A;  5C4Z A;  3A7A B;  5J39 A;  5DNF A;  1TS5 A;  1IBK Q;  4A3G H;  1R4Q B;  1F9R A;  2JA6 G;  2LKV A;  3NK9 A;  3D4R A;  3MAQ A;  1JCK B;  2E74 C;  5J1Z A;  1FJG Q;  2Q2H A;  3S1N H;  1LTG D;  4OX9 Q;  1IBM Q;  4I65 A;  3MEH A;  1SYF A;  1CK1 A;  1AZQ A;  1EYA A;  1VQJ A;  3W1B A;  3IKJ A;  2EOT A;  2BH2 A;  2UU9 Q;  4C3J B;  2D9U A;  4IJL A;  1STB A;  1SR3 A;  5FLM G;  4B3S Q;  1AW7 A;  1NAP A;  2RHS B;  4C3H B;  3S2D H;  5I4D A;  4PNY A;  5D3I B;  1QVG A;  1ILP A;  5D14 A;  2B2T C;  1WTW A;  3S15 B;  2F0S A;  1F2Z A;  1H9M A;  2F0M A;  1H95 A;  2K75 A;  1K73 C;  4KK7 A;  1GD7 A;  4HIK A;  1WOC A;  2Z4I A;  2YTV A;  1X65 A;  1IXR A;  2Q2I A;  4JI8 Q;  4R4Q A;  3CXC A;  1V9P A;  5IYD G;  2I5H A;  4ILW A;  1Q90 A;  1P16 A;  4DPG A;  4RHR A;  4UPA A;  5IY0 A;  3OTO Q;  2JA9 A;  3W3A A;  2NYZ D;  4WJ4 A;  1O80 A;  4DV4 L;  2UXB Q;  1M8A A;  2HIX A;  3H94 A;  1NE3 A;  2Q8R E;  4I7A A;  3CCJ A;  4A3G B;  4FP5 D;  3C1F A;  1W6J A;  2F0O A;  2WII B;  3W5O A;  2MHV A;  5AJ3 L;  1HNX Q;  2B2Y A;  1CZW A;  1ICF B;  4H7B A;  2F3V A;  2K5V A;  1HTL D;  1STA A;  1VQ4 A;  1KIX A;  3K57 A;  3R2T A;  2PW7 A;  2BE5 C;  3OWF A;  4HID A;  1I6H H;  1NR2 A;  3TRZ A;  5K36 H;  4DFA A;  3HOW H;  1IBL Q;  1PFM A;  3TRE A;  1TY0 A;  4F8M A;  3KJP A;  4DV2 L;  3HOW G;  1PLF A;  3PUW A;  1SE4 A;  4JBJ A;  5F2D A;  1XMO L;  2JA5 H;  2K6A A;  5FKA C;  1RL2 A;  1A15 A;  2UUB Q;  4DNR B;  3ND8 A;  1BCP B;  2DY7 A;  4JI6 L;  3RZO B;  2CH4 A;  4AIM A;  2EYH A;  1NUC A;  3SE0 A;  1XNQ Q;  2F0G A;  2ZM6 L;  1FD7 D;  2A6H C;  3K7A H;  4FO2 A;  1CTM A;  1KDC A;  1WTP A;  1EZ8 A;  1I50 H;  4A75 A;  1EY6 A;  3P20 A;  1Z7T A;  1WTX A;  3Q6S A;  2VB3 X;  1N33 L;  5M5W B;  1D7Q A;  4OEL B;  5IGB A;  3D4D A;  3ER0 A;  3KLR A;  1VQ7 A;  1JMC A;  3RN2 A;  4CDF C;  3DHQ A;  1JOO A;  3LWU A;  3CQZ B;  2FMM A;  1IW7 D;  5I2Y A;  5IWA Q;  1QCB D;  1KXL A;  1TWF B;  1RIP A;  2F0N A;  4IZ8 A;  1K3R A;  3MA2 B;  4B3T L;  3D6W A;  3M4P A;  1E1T A;  3T4A C;  3VR6 A;  1LTL A;  3S9W A;  4GKK Q;  1WTO A;  4J6H A;  4JI1 L;  2F0L A;  1WJJ A;  1K0R A;  2N78 A;  1X3Q A;  4IPC A;  2P5Z X;  2Q8I B;  1SYC A;  4QL5 A;  3J7A F;  4OO1 H;  4BY1 G;  3CC4 A;  3EIV A;  1PTO D;  2E5L L;  1EY4 A;  2NB0 A;  2RF4 A;  1VQ6 A;  1MBY A;  3HOU B;  1PTO B;  5DEH A;  4UDU C;  5LMN Q;  3P75 A;  3TP8 A;  1EYD A;  4KTA A;  1ENC A;  1LT6 D;  5M3M G;  3I91 A;  2RSN A;  3FKI H;  4NPS A;  3I90 A;  1GUO A;  2KEC A;  2V1C C;  2WKD A;  4FF4 A;  1F9S A;  4X62 Q;  3S17 H;  1IKM A;  2MO0 A;  3T16 A;  1SLJ A;  1BOS A;  3PCO B;  1JWU D;  3PF5 A;  4EQN A;  2L5T A;  3A5U A;  3C3L A;  1ET6 A;  3I4M B;  3HOV G;  3IFT A;  5IYC H;  3NP8 A;  1KDB A;  2Z6B A;  2B29 A;  1U4R A;  1VQL A;  3OIP A;  3T1H L;  3P7J A;  4BBR H;  3ONA B;  1I50 B;  5FLX c;  1JJC B;  2VQF L;  1TU2 B;  2B2W C;  4CDD C;  2VQE L;  1I4H A;  3M85 A;  5M3F H;  5C4X G;  4UP9 A;  5M9O A;  2B2V C;  2QW7 A;  5HGQ A;  2B2U A;  3H6M A;  4DV1 L;  2EY1 A;  4GZY C;  2MQH A;  4RCN A;  5CR3 A;  2R3Z A;  4OO1 G;  3VA5 A;  5H1S E;  1FNV A;  3PO2 G;  4MN3 A;  3F2D A;  1BKB A;  4YWK A;  3V96 A;  3OIQ A;  1E2Z A;  1N36 L;  1YNJ C;  1PFN A;  2YU9 H;  3R3O A;  3BVG A;  1DOM A;  4DXG A;  5M3M B;  1E22 A;  4KN7 C;  1VQO A;  4ZLT F;  2BA1 A;  4KLK A;  3TP7 A;  3PGZ A;  1FNW A;  3EBE A;  3M3Y H;  4PZ7 A;  5CV6 A;  5EBC A;  1PYW D;  2RDG A;  2B2U C;  2I0Q A;  4LFA Q;  2UUA L;  1S5B D;  4KHZ A;  4LF6 Q;  1Y8O B;  2CH4 W;  3TME A;  3I4M G;  4JI5 Q;  5EPK A;  1C8C A;  1PMR A;  3OHX C;  1YJN A;  2F0F A;  2B2W A;  4OEM B;  5C3X A;  4O42 A;  3QB3 A;  2BDO A;  1TY2 A;  4O0A A;  1H9S A;  4X66 Q;  4G7Z C;  3UE1 A;  3SEB A;  1T9H A;  2K1B A;  4ODG A;  3HKZ G;  4ZCK A;  1JQY D;  1K3B C;  2GA4 B;  3OMG A;  4RA8 A;  2R92 B;  1UEA B;  2PI2 A;  1T5X D;  3DEP A;  3FKI B;  4OIK A;  3S2H B;  1ESR A;  1GUS A;  4RKL A;  4P71 A;  3PO2 H;  4JI5 L;  4JI7 Q;  5CC4 A;  3WOF A;  1WCM G;  4A3F H;  3HOZ G;  3R93 A;  2KVM A;  3L9A X;  2JA8 G;  1KQS A;  1R4P B;  4RMF A;  1YNN D;  4CJ1 B;  3PIO A;  1LTT D;  1AZP A;  1TWC H;  1ZYR C;  5BN4 A;  4DR2 Q;  1T5E A;  4GN4 B;  4DA2 A;  2ZXO A;  4EQO A;  4AYB E;  2EE1 A;  2NTS A;  4XYO A;  3T53 B;  2UXC Q;  1FJG L;  1Q82 C;  1N9W A;  4YWL A;  3T13 A;  2RDF A;  1DM0 B;  1BBW A;  1TWA B;  4YY3 Q;  3DM3 A;  4A4I A;  4A3I H;  2OEO A;  4OHJ A;  3KLS X;  2KQ3 A;  3UDI A;  5EGT A;  2B63 B;  5KYI A;  4ZYS A;  2Z6K C;  2Z0S A;  1UE7 A;  4J15 A;  3PUX A;  1SFO H;  2R93 B;  2EYO A;  2BA0 A;  3BJU A;  1Y14 B;  3F2C A;  2F0J A;  3BZC A;  4B3T Q;  5KND A;  4DK6 C;  3I55 A;  1TS2 A;  1YVC A;  4NXM L;  1M90 C;  4FNF A;  1RJT A;  1Q81 C;  3KFU A;  5A35 A;  1AE3 A;  1HH2 P;  4BA2 I;  4OIJ A;  1GHK A;  1SXT A;  2RCN A;  1QUQ B;  3HG9 A;  3S1N B;  1PYS B;  4LF7 Q;  1GM5 A;  5KIX A;  1OXV A;  1MGS A;  5IP9 G;  1X6O A;  3CCQ A;  4DV6 Q;  1K83 H;  3RMH A;  3QG1 A;  4F7X A;  4JV5 L;  5LMN L;  2EY5 A;  2XRS D;  3QIA A;  2PQA A;  1ET9 A;  1MD2 D;  5FJ8 G;  2R7Z H;  4PZ8 A;  4A76 A;  4DR4 L;  2NVY B;  1B70 B;  4A3L H;  4IUR A;  1FGU A;  4HMI A;  1PH4 A;  2UU9 L;  2CWP A;  4BBR B;  2E2I H;  4RGO S;  4MTK A;  1D5X C;  1EWC A;  3VR4 A;  3E9H A;  3F8T A;  5KNC A;  1IKL A;  3QR8 A;  1ESF A;  5FO9 B;  2B2Y C;  2X6G A;  4JPB W;  2NVQ B;  4HCS A;  4QUC A;  4WFN 3;  1RF2 D;  4UY8 C;  5JJI A;  4FF1 A;  1RHP A;  1NCV A;  4N9P A;  2F3W A;  1XTC D;  4OGQ C;  2LMC B;  1EQR A;  2O2L D;  2KCM A;  2O4X A;  3GDE A;  2MPM A;  1JB7 A;  3IFD A;  3J7Z C;  3M7G A;  2FMC A;  4NMZ A;  1PA6 A;  1G2T A;  4YHH Q;  4DUY Q;  1FNU A;  4EX5 A;  1L0Y B;  5LMU L;  3GTP B;  3GTJ B;  1I6V C;  5C5L A;  2G9D A;  3GTL H;  2Y0S B;  4BBS H;  1SRU A;  1PH1 A;  2VQF Q;  4R8I A;  2F4I A;  2K28 A;  2VZA A;  4R4T A;  1JE5 A;  2HQE A;  4F87 A;  2B2T A;  3H0G G;  2F0E A;  2Q2U A;  1Y1W B;  1Q1E A;  3KBG A;  2G5D A;  4KHP Q;  1X3G A;  1JJG A;  1B7Y B;  4C56 C;  3JC6 6;  4H02 A;  4DR3 Q;  1X9N A;  4GNX B;  4POG A;  1SEB D;  4AQY L;  3QJY A;  1QVC A;  2OT2 A;  5M5Y B;  1ROD A;  1ASY A;  4R4O A;  1HJP A;  3I72 A;  1EIG A;  2XWB B;  2RKS A;  3TBI B;  5T1G A;  3DXJ C;  4HR7 B;  2PYK A;  2H1E A;  1CUK A;  4K5W A;  1STY A;  3K5L A;  2AUK A;  5EKL A;  1ZYR D;  2K52 A;  1CSQ A;  1VQE A;  2IX1 A;  1JWM D;  4LFC L;  2ZTD A;  1XNQ L;  1EWI A;  3BZD B;  4IFD I;  1VS0 A;  4IO9 A;  2WB1 E;  1QIL A;  4C3I H;  2R7Z B;  2IX0 A;  4JOI C;  4HMJ A;  4LNQ A;  3NQI A;  3SHL A;  3TZU A;  4JK1 C;  4X65 Q;  5M5X H;  2HQL A;  1NBW A;  2PW5 A;  1YHB A;  3I4N G;  2WP8 J;  3L2P A;  4B3M L;  1EYG A;  1FYC A;  2OF1 A;  4OWX B;  1TKW B;  1RCV D;  1EZ6 A;  5CV4 A;  3W1G A;  2F1M A;  1DZ1 A;  4H44 C;  2N8N A;  3I3C A;  1KD1 C;  2DJF C;  3KDF A;  3MTS A;  3D8G A;  2EZV A;  1J6Q A;  1GUN A;  1SSO A;  1EY0 A;  4LF5 L;  4C3H G;  3HOY H;  3K6O A;  1TS4 A;  4EQP A;  1S72 A;  1L2F A;  4DK1 A;  3S1Q B;  4QUF A;  3GTJ H;  1O7L A;  3PIP A;  4GS3 A;  4GOP C;  3SGI A;  4LWC A;  4DUZ Q;  4ME5 A;  2XVS A;  2ZTE A;  2WB1 G;  1KHI A;  1XTD A;  1DXM A;  1BVS A;  3J81 E;  1SMY C;  2RSO A;  4L8J A;  2VQE Q;  2E2D C;  1W3S A;  4Q5V A;  1SND A;  4KV6 A;  1CKO A;  4EGV A;  3BG3 A;  1NR4 A;  1JOR A;  2QCP X;  4JBM A;  4U67 3;  2ICE C;  3PUZ A;  3I4N H;  1VDZ A;  2AMC B;  2CW0 C;  2MJ8 A;  2VUM B;  1F9Q A;  4IPD A;  4ABN A;  1HZB A;  2EJG C;  2L15 A;  3D0F A;  4RWS C;  4QIW E;  3T1H Q;  5DAU A;  4K8J A;  1L1O C;  3UDX A;  1LTA D;  1S5D D;  4A3K H;  1OXS C;  3A8I E;  3A0J A;  2WAQ G;  4R9W A;  2RA4 A;  3CCV A;  1V8Q A;  5KRU A;  2DUD A;  2IHE A;  3RZO H;  3GD7 A;  1QG7 A;  5HGT A;  4DV1 Q;  2A73 B;  1II3 A;  4XIG S;  4DU9 A;  1M4V A;  2A69 C;  2ZJR A;  3GO5 A;  1DON A;  2F0T A;  1VQB A;  3S24 A;  1K0S A;  1Y1V G;  2PI2 E;  3KJO A;  2JJQ A;  1AP0 A;  4GN3 B;  2EIF A;  4K0K Q;  4JI2 L;  3E6Z X;  2FIN B;  2NZO A;  3S14 H;  4LW1 A;  4N8F A;  3JAM c;  1EOV A;  1FGB D;  1ILQ A;  2RBM A;  1UEB A;  2R93 H;  4LJZ C;  3MXU A;  3LNN A;  2NBF A;  3S1Q H;  4LF7 L;  1SRO A;  1X3P A;  3STB D;  5G3L F;  4DV5 Q;  4H13 C;  4IPG A;  4BY1 H;  5FK9 C;  1KAA A;  1J9O A;  4KD4 A;  2KED A;  3MZ5 A;  3GTO B;  2E2J H;  4GKK L;  3G48 A;  4LUZ A;  1VQD A;  2MNA A;  1DD2 A;  2JEB I;  3AB9 A;  5ELO A;  3T1Y L;  3MWY W;  2V4D A;  3U9O A;  3JAM L;  3VR5 A;  1LV9 A;  2EXZ A;  1RTN A;  2ZTC A;  3HRZ C;  5LHY 1;  4LF8 L;  2WKC A;  3KLW A;  5DM6 3;  4CKE A;  2I5L X;  1EEF D;  3CRK C;  1ZXT A;  4M1U B;  4NXN L;  1X3E A;  4DR7 L;  1SYE A;  3GTM H;  1KDA A;  2C35 B;  4MZ9 A;  4UAI A;  1I94 L;  2Y0S E;  1STH A;  1TWG H;  2A6H D; 
#chains in the Genus database with same CATH homology
 5M3F B;  2K01 A;  1Y1V B;  5KGU A;  3OW7 A;  3BDL A;  2PZU A;  3HOX B;  4RAU C;  4HTH A;  5IGG A;  1JWS D;  2K5D A;  3E5S A;  3VA7 A;  3E0J A;  1DOL A;  2JA5 B;  1WTR A;  1Z47 A;  2WAC A;  2PZT A;  1QB5 D;  2A5H A;  4LK1 C;  1Q12 A;  3DM1 A;  2KJX A;  4NDX A;  4QF4 A;  4KKU A;  3QWN A;  1BUV T;  1QNU A;  3F2U A;  1GOZ A;  2IW3 A;  1ML0 D;  5E4W C;  4K6L A;  2OXP A;  2VB2 X;  2NZ1 D;  2KOL A;  3I73 A;  4WOR A;  3J81 L;  1VMP A;  4KJO A;  1PRT B;  3J7A V;  1D1I A;  3M4O B;  3GQB A;  4MHE A;  1NSN S;  2L4N A;  1HTP A;  2K03 A;  3SR1 A;  3BDO A;  2EJF C;  5LL6 S;  2EYF A;  5E1F A;  2E2J B;  5JJZ A;  3FPU B;  4NW2 A;  5JOB A;  2SNM A;  3G7L A;  1B9M A;  1G29 1;  2CQA A;  2DY8 A;  1RTO A;  5JPM C;  1HUM A;  1PRT D;  1BQQ T;  3V05 A;  4RCO A;  2TSS A;  1HPC A;  5FO7 B;  5JEA G;  5I6W A;  4Z9C B;  3BYY B;  3PV0 A;  3MFY A;  4CHT B;  4TKO B;  2L9H A;  3SK6 A;  1EL0 A;  3A8J E;  2AUJ D;  3OOC A;  4XDX A;  5J22 A;  4P2C B;  3HEJ A;  1CFM A;  2B8F A;  3NPP A;  2PO4 A;  3TN2 A;  1SDF A;  3GTK B;  4IUU A;  3GV6 A;  4M8A A;  1CQV A;  1F9P A;  4BA1 I;  3BVZ A;  1OXU A;  4L63 B;  4ULL A;  4K2K A;  2MGS A;  4U68 A;  5FO8 B;  4TRD A;  4DNT B;  4K5X A;  1DCZ A;  3HOV B;  5C3E B;  5I6Y A;  1SBB B;  2EY2 A;  1MSG A;  3N6R A;  3R8B A;  4IUV A;  4BWG B;  2K5Q A;  4K14 A;  1A3V A;  2N55 A;  3MXG A;  4RHS A;  4CKC A;  1PXU A;  1X32 A;  2BOS A;  4C3J G;  3ITP A;  3GV3 A;  2AWN A;  4A3M B;  4AYB B;  2DNE A;  3TP6 A;  1QJO A;  1Q8I A;  2WAQ B;  1EEI D;  2EJM A;  2YYZ A;  1EY7 A;  2Z1C A;  3VYT A;  2FHT A;  3EVQ A;  1SNC A;  1H9J A;  1D6E C;  1PZK D;  1D2B A;  1F2Y A;  2X6L A;  4FYD A;  5CV5 A;  3C1E A;  1G8Z D;  5IOC A;  1VF7 A;  4BY7 B;  1LAB A;  4WRD A;  4BS9 A;  1A3U A;  1AEX A;  1JOK A;  3OMC A;  1B4O A;  1F2M A;  4OL7 A;  2HCI A;  3H09 A;  3NSW A;  2JXM B;  1Y69 U;  1OO9 B;  5IGC A;  2EVB A;  1KNE A;  2KEE A;  2DN8 A;  1HRJ A;  1F2L A;  3P1H A;  4A3I B;  5A2Q L;  5JEA J;  3A56 A;  2JA8 B;  3NTH A;  1EWH A;  5T1I A;  3X3N A;  3H0G B;  1A2U A;  5IIF A;  1LO5 D;  1TT2 A;  1QWY A;  4L6T B;  1EFI D;  1EQT A;  1STE A;  4DAP A;  2R61 A;  3NQT A;  4DAV A;  1UUP A;  5COY A;  3K5M A;  4G57 A;  3M3Y B;  5EKI A;  1LT3 D;  2MUY A;  3EQL C;  2TMP A;  2A6E D;  4J1M A;  2H4O A;  3CRL C;  1STN A;  3DWQ A;  4YIJ A;  4CJ0 B;  1L0X B;  3OSO A;  1LTB D;  5JVH 3;  1I4G A;  3KF8 A;  4G7O C;  4IQZ A;  2PPB C;  5IGE A;  1K8O A;  3H91 A;  4XXE A;  3TSS A;  3GTG B;  4C1N K;  3O13 A;  3KLS A;  1O7Z A;  2KHS A;  3EA6 A;  1IHZ A;  3H3V C;  3M4Y A;  4X3U A;  3TDQ A;  1SAP A;  4HCE A;  4A3J B;  1PDQ A;  1BR9 A;  2ID0 A;  3K5O A;  3LX0 A;  5FOB B;  2XRQ D;  4Y7N B;  5JVG 3;  4CKB A;  1IL8 A;  4ZUI A;  5CBE E;  2E2H B;  4O1N A;  4XT3 B;  1O7Y A;  5CMD A;  4X3T A;  3D31 A;  2XSC A;  5ELF A;  1WD0 A;  1AN8 A;  3URY A;  5I2X A;  3A8K E;  3DEO A;  4A3D B;  1Q1B A;  1VF5 C;  2M2L A;  5FLX L;  3TZD A;  3WDN A;  3RZD B;  1R9T B;  2A69 D;  4WJW A;  4PMW A;  1CZG A;  3RLF A;  1G6Z A;  1B3A A;  4QIW B;  1S5F D;  3LWE A;  5EPL A;  4RGN A;  2QEJ C;  2NVT B;  5KYL A;  1CQF A;  1SE2 A;  5JEA H;  4FXD A;  5COR A;  2SDF A;  2XIW A;  1EU4 A;  1E2W A;  1LTI D;  2F0Q A;  1SNQ A;  1S4Z A;  4XYQ A;  2B8G A;  5JPN C;  3K58 A;  1SNO A;  1HCZ A;  1SJH D;  3SDZ A;  4A3F B;  1JE4 A;  2Q8T A;  3Q22 A;  3ZYY X;  3FRP B;  1JOQ A;  5NUC A;  3DUZ A;  5C0X J;  2F0V A;  1ICW A;  3KUP A;  2K7V A;  2RDH A;  2L55 A;  3EJI A;  4B08 A;  1PFB A;  1GUG A;  2E76 C;  1WTV A;  2AQ1 B;  2AWO A;  2F0P A;  1GUW A;  2E75 C;  1EYC A;  1CT1 D;  1BDO A;  2XN9 C;  5K36 G;  4CJ2 C;  2X69 A;  1GJX A;  1EY8 A;  3ND9 A;  5K5P A;  1HQM C;  1KAB A;  2J7Z A;  4QMG A;  4ZUJ A;  1CA5 A;  1BCP D;  2J0T D;  3SK4 A;  1U9R A;  2PCF B;  5BN3 A;  3AMU A;  3Q24 A;  2EYP A;  3I70 A;  3NXW A;  4RH6 A;  2QIL A;  4DF7 A;  2QF7 A;  2VXW A;  3J7Y W;  2EYM A;  4FF2 A;  3D3R A;  5ELC A;  1CHP D;  3X3M A;  2HDM A;  3CU7 A;  2NVX B;  3I4L A;  2AQ2 B;  1TS3 A;  5C4X B;  4I7Z C;  2DNC A;  1C48 A;  2WIN B;  3FDT A;  3NHH A;  3NWS A;  3VR2 A;  2BCO A;  3PO2 B;  5E4X A;  1LLR D;  3FVQ A;  5IOD A;  1E2V A;  3K7A B;  2EY6 A;  4IUP A;  1H9R A;  2N88 A;  4PMB A;  5C0X H;  3GTQ B;  5ELB A;  4IUQ A;  5CV9 A;  3RD4 A;  3MC0 B;  4HAE A;  2L0C A;  3D4W A;  1F77 A;  1A2T A;  2O5I C;  3HOY B;  5CV8 A;  4E6I A;  5E3F A;  5CBA E;  4KHV A;  1LT4 D;  3HS0 C;  4K2L A;  3PMF A;  2K5W A;  1WVL A;  3ERO A;  2KA7 A;  4V0B A;  1ENF A;  2M00 A;  3I4N B;  1S5E D;  1B1Z A;  5C4J B;  4G7H C;  3KBX A;  3NE5 B;  3T56 B;  4KKS A;  1HA5 A;  5JAV A;  5IT9 L;  4DGZ A;  1BNZ A;  4ID6 A;  1RD9 D;  1B50 A;  1C4Q A;  3C46 A;  4F88 A;  3BYT B;  1A6X A;  3QO2 A;  3NBH A;  2IL8 A;  3V2T A;  5ELE A;  3VYR A;  1TWC B;  2D5D A;  2ZXR A;  5D3D A;  5D65 A;  2KUM A;  3I8Z A;  1TR5 A;  2MP1 A;  5IT9 E;  1RKN A;  5BN5 A;  2JA6 B;  2KCN A;  1XX8 A;  1Y8P B;  2JEA I;  2JE6 I;  1CA6 A;  1MSH A;  4PMC A;  4RGM A;  2PMZ B;  1B2T A;  1GHJ A;  1HXY D;  5C5M A;  1QE6 A;  1CM9 A;  1WCM B;  3Q0A A;  1V1P A;  4KY7 A;  3GTL B;  2BE5 D;  4LAA A;  3KK7 A;  3BVM A;  2D62 A;  3QOJ A;  4BBS B;  4RFB A;  4ZKB B;  5KEE A;  2QKI C;  2F0I A;  4XTC S;  1Q3L A;  1QOH A;  4IUN A;  1LT5 D;  2D2C C;  3PIP 3;  4KMU C;  3IAY A;  2C9O A;  2L11 A;  1BXT A;  4C1N I;  1DJR D;  1JIC A;  1SMY D;  2PQE A;  4K6D A;  2SEB D;  1OXX K;  3D6C A;  2SOB A;  3JAM E;  3J80 E;  2E2I B;  3GP7 A;  4NKL A;  5M5X B;  4ZRZ A;  4XQN A;  4A3K B;  1HA6 A;  1TWG B;  1U4P A;  3SVM A;  1I4Q A;  3S16 B;  2BDN A;  4NP5 A;  1EOT A;  2F0H A;  2JYO A;  5EQ0 A;  1E0B A;  5LL6 X;  2EYJ A;  4XT1 B;  2J4X A;  3PUV A;  2XWJ B;  1DYQ A;  1LTR D;  5IGD A;  1SJE D;  1FR3 A;  3VR3 A;  3HOW B;  1S5C D;  2PZW A;  3L7Z C;  4KKT A;  1EY5 A;  2CVR A;  4CGY B;  3S1R B;  4A93 B;  1LTS D;  5ISR A;  1TII D;  1HFN A;  1IYV A;  3BDC A;  1EQV A;  2KCC A;  1SE3 A;  2HCC A;  4X3K A;  1CI3 M;  5C44 B;  4DXF A;  4HSV A;  3G6J B;  1KTK A;  2L1B A;  1BCP C;  5CV7 A;  2K33 A;  1GXD C;  3K0Y A;  2HUG A;  2A74 C;  2F0K A;  2O5J C;  1PTO H;  2A68 D;  3S1M B;  5C4H A;  1BBX C;  2B39 A;  1JC7 A;  3HGB A;  5I9O A;  3U9S A;  5C6A A;  3HKZ B;  4FVM A;  1B44 D;  2I07 B;  5G3L D;  2Z4H A;  2VNU D;  4C3I B;  2NWG A;  4IN3 A;  1TQO A;  4PV1 C;  4IUT A;  4FXG C;  4HN7 A;  3TP5 A;  1KLG D;  2IWH A;  4OO1 I;  3UI2 A;  3HOZ B;  4ZKC B;  3NWT A;  4G4K A;  2XNA C;  2HDL A;  3OWE B;  5A2Q E;  2FJ2 A;  5FLX E;  3EFX D;  3FEW X;  1K8M A;  3MHB A;  4TQU S;  3WOE A;  1HUN A;  4ZK9 B;  5C0X I;  1G2S A;  2F0U A;  3NTK A;  1IYU A;  3BS1 A;  2K04 A;  2L12 A;  1D5Z C;  1TWH B;  1KNA A;  1PTO C;  3AU7 A;  2LFN A;  4XQJ A;  3PIO 3;  1I6H B;  4IFD H;  1MI2 A;  2IJ0 A;  3S14 B;  4V19 0;  1BO0 A;  3SXH A;  3PUY A;  4K8I A;  5C0X G;  4C2M B;  3IL8 A;  1GUT A;  2G9H D;  4C3I G;  3R2I A;  5EJW A;  4TSS A;  2EYL A;  1Y8N B;  4KJN A;  3SK8 A;  2A68 C;  3A55 A;  3NUC A;  5HUR A;  1BCP F;  2NN6 I;  1I3Q B;  5CYU A;  2NTT A;  1SFO B;  1W6K A;  2C5C A;  1IW7 C;  4QB4 A;  5TSS A;  1EIH A;  1OXT A;  1I4R A;  1I4X A;  1WTQ A;  4A3E B;  2LS0 1;  1PTO F;  4R8N A;  3Q23 A;  1ENA A;  2JP1 A;  1XWE A;  5KNB A;  3NBI A;  2Z8L A;  4IFD G;  2R6G A;  2NN6 G;  5EPJ A;  4ZAI A;  1SYB A;  4A3B B;  2M9V A;  1AFP A;  2NN6 H;  4KD3 A;  1ZKO A;  4QCL A;  1YNJ D;  2JA7 B;  1ONL A;  1UNS A;  3OPO A;  3K5N A;  2F0D A;  3S2D B;  2IX3 A;  4HSP A;  1SNM A;  3MXP A;  2CHB D;  2IT1 A;  1KLU D;  4N9T A;  2ENB A;  3HZX A;  2F03 A;  1A3T A;  4PQX A;  4ZQ3 A;  3M7N A;  4X3S A;  5AFW A;  4KY6 A;  3DMU A;  3PO3 B;  3K59 A;  1K83 B;  1JR0 D;  1I4P A;  2ZXP A;  2I46 A;  1SYD A;  3W2D A;  1HHV A;  3N52 A;  3QOL A;  1U4L A;  2K32 A;  2WV6 D;  1PRT C;  4LMQ D;  1YNN C;  2QDB A;  1D1K A;  5EBD A;  4DN4 M;  1QNK A;  1EY9 A;  3FPP A;  1U4M A;  5EKK A;  2F0W A;  3T51 B;  4S3S A;  4HED A;  1XXG A;  3MVV A;  4JBW A;  1O78 A;  4B9W A;  2ZT9 C;  3NTI A;  2IPK D;  1ZEQ X;  1V1O A;  1Z6H A;  5ELD A;  4XQQ A;  4CBV A;  4J8Q A;  1TVX A;  1D5M C;  1H9K A;  2RQX A;  5DM7 3;  4BY1 B;  1B53 A;  1PZI D;  2FFK B;  2ICI A;  4MIU A;  4KI0 A;  3MFG A;  2PNR C;  1PRT F;  3HP3 A;  4K5V A;  1HFG A;  1H9S B;  1UAP A;  2K05 A;  2EPB A;  4IAL A;  3L3O C;  1PZJ D;  3VYS A;  3GTM B;  4EVO A;  4B9X A;  2WB1 B;  3FMC A;  3MXN A;  3S17 B;  4KY5 A;  1EU3 A;  1VCI A;  2B2V A;  4FF3 A;  1V43 A;  5CGK A;  3ERQ A;  1G91 A;  1DOK A;  2NUC A;  3DWA A;  3A7L A;  4IFD J;  1SYG A;  3CHB D;  2EDG A;  3CKI B;  4Q0F A;  5I9P A;  1J8I A;  1CHQ D;  1SNP A;  4FXK C;  2SNS A;  3A54 A;  3VYU A;  1V1P B;  2LY7 A;  3RUZ A;  2CW0 D;  2YU9 B;  4H0L C;  1LAC A;  5IGF A;  2AQ3 B;  4DK0 A;  3J80 L;  1VMC A;  2A6E C;  4DAY A;  3DWP A;  1WD1 A;  2JSO A;  1RDP D;  5C3W A;  1B9N A;  1BF4 A;  1JB3 A;  3C2P A;  4KN4 C;  1STG A;  3SK5 A;  4RGT A;  4RKB A;  1HQR D;  2RVL A;  1XYI A;  5C4Z A;  3A7A B;  5J39 A;  5DNF A;  1TS5 A;  1R4Q B;  1F9R A;  2LKV A;  3NK9 A;  3D4R A;  3MAQ A;  1JCK B;  2E74 C;  5J1Z A;  1LTG D;  4I65 A;  3MEH A;  1SYF A;  1AZQ A;  1CK1 A;  1EYA A;  3IKJ A;  2EOT A;  4C3J B;  2D9U A;  1STB A;  1AW7 A;  1NAP A;  4C3H B;  5I4D A;  4PNY A;  5D3I B;  1ILP A;  5D14 A;  2B2T C;  1WTW A;  3S15 B;  2F0S A;  1F2Z A;  1H9M A;  2F0M A;  4KK7 A;  2Z4I A;  4ILW A;  1Q90 A;  4RHR A;  3W3A A;  2NYZ D;  1O80 A;  1M8A A;  3H94 A;  2Q8R E;  4A3G B;  3C1F A;  4FP5 D;  1W6J A;  2F0O A;  2WII B;  2MHV A;  2B2Y A;  1CZW A;  4H7B A;  2F3V A;  1HTL D;  1STA A;  3K57 A;  3R2T A;  2PW7 A;  2BE5 C;  3OWF A;  1NR2 A;  5K36 H;  4DFA A;  1PFM A;  1TY0 A;  4F8M A;  1PLF A;  3PUW A;  1SE4 A;  5F2D A;  2K6A A;  5FKA C;  1A15 A;  4DNR B;  3ND8 A;  1BCP B;  2DY7 A;  3RZO B;  2EYH A;  1NUC A;  3SE0 A;  2F0G A;  1FD7 D;  2A6H C;  4FO2 A;  1CTM A;  1KDC A;  1WTP A;  1EZ8 A;  1EY6 A;  3P20 A;  1WTX A;  1Z7T A;  3Q6S A;  2VB3 X;  5M5W B;  5IGB A;  3D4D A;  3KLR A;  3DHQ A;  1JOO A;  3LWU A;  3CQZ B;  2FMM A;  1IW7 D;  5I2Y A;  1QCB D;  1TWF B;  2F0N A;  4IZ8 A;  3MA2 B;  3D6W A;  3T4A C;  3VR6 A;  3S9W A;  1WTO A;  4J6H A;  2F0L A;  1X3Q A;  2Q8I B;  1SYC A;  3J7A F;  4OO1 H;  1PTO D;  1EY4 A;  2NB0 A;  1MBY A;  3HOU B;  1PTO B;  5DEH A;  4UDU C;  3P75 A;  3TP8 A;  1EYD A;  4KTA A;  1ENC A;  1LT6 D;  3I91 A;  2RSN A;  3I90 A;  1GUO A;  2KEC A;  2WKD A;  4FF4 A;  1IKM A;  1F9S A;  3T16 A;  1BOS A;  1JWU D;  4EQN A;  2L5T A;  3C3L A;  1ET6 A;  3I4M B;  3IFT A;  3NP8 A;  1KDB A;  1U4R A;  3OIP A;  3P7J A;  3ONA B;  1I50 B;  1TU2 B;  2B2W C;  1I4H A;  3M85 A;  5M9O A;  2B2V C;  2B2U A;  3H6M A;  2EY1 A;  4GZY C;  4RCN A;  5CR3 A;  2R3Z A;  4OO1 G;  3VA5 A;  1FNV A;  4MN3 A;  3V96 A;  3OIQ A;  1E2Z A;  1YNJ C;  1PFN A;  3R3O A;  3BVG A;  1DOM A;  4DXG A;  5M3M B;  4KN7 C;  4ZLT F;  2BA1 A;  3TP7 A;  1FNW A;  5CV6 A;  5EBC A;  1PYW D;  2RDG A;  2B2U C;  1S5B D;  4KHZ A;  1Y8O B;  3TME A;  5EPK A;  1C8C A;  1PMR A;  3OHX C;  2F0F A;  2B2W A;  5C3X A;  4O42 A;  3QB3 A;  2BDO A;  1TY2 A;  1H9S A;  4G7Z C;  3SEB A;  2K1B A;  4ODG A;  1JQY D;  2GA4 B;  3OMG A;  4RA8 A;  2R92 B;  1UEA B;  1T5X D;  3DEP A;  3FKI B;  4OIK A;  3S2H B;  1ESR A;  1GUS A;  4RKL A;  5CC4 A;  3WOF A;  3R93 A;  2KVM A;  3L9A X;  1R4P B;  1YNN D;  4CJ1 B;  1LTT D;  1AZP A;  1ZYR C;  5BN4 A;  1T5E A;  4DA2 A;  2ZXO A;  4EQO A;  2EE1 A;  2NTS A;  4XYO A;  3T53 B;  3T13 A;  2RDF A;  1DM0 B;  1TWA B;  2OEO A;  4OHJ A;  3KLS X;  2KQ3 A;  5EGT A;  2B63 B;  5KYI A;  4ZYS A;  3PUX A;  2R93 B;  2EYO A;  2BA0 A;  2F0J A;  5KND A;  1TS2 A;  4FNF A;  1RJT A;  5A35 A;  4BA2 I;  4OIJ A;  1GHK A;  1SXT A;  3S1N B;  3HG9 A;  5KIX A;  1OXV A;  1MGS A;  3RMH A;  3QG1 A;  4F7X A;  2EY5 A;  2XRS D;  3QIA A;  1ET9 A;  1MD2 D;  2NVY B;  4IUR A;  4HMI A;  4BBR B;  4RGO S;  1D5X C;  1EWC A;  3VR4 A;  5KNC A;  1IKL A;  1ESF A;  5FO9 B;  2B2Y C;  2X6G A;  2NVQ B;  4HCS A;  4QUC A;  4WFN 3;  1RF2 D;  4FF1 A;  1RHP A;  1NCV A;  4N9P A;  2F3W A;  1XTC D;  4OGQ C;  2LMC B;  2O2L D;  2O4X A;  2MPM A;  3IFD A;  3M7G A;  2FMC A;  4NMZ A;  1G2T A;  1FNU A;  1L0Y B;  3GTP B;  3GTJ B;  1I6V C;  5C5L A;  2G9D A;  2Y0S B;  4R8I A;  2F4I A;  2K28 A;  2HQE A;  4F87 A;  2B2T A;  2F0E A;  1Y1W B;  1Q1E A;  3KBG A;  4C56 C;  1SEB D;  3QJY A;  2OT2 A;  5M5Y B;  1ROD A;  3I72 A;  1EIG A;  2XWB B;  2RKS A;  3TBI B;  5T1G A;  3DXJ C;  4HR7 B;  2PYK A;  2H1E A;  4K5W A;  1STY A;  3K5L A;  2AUK A;  5EKL A;  1ZYR D;  2IX1 A;  1JWM D;  3BZD B;  4IFD I;  1QIL A;  2R7Z B;  2IX0 A;  4HMJ A;  3NQI A;  3SHL A;  3TZU A;  4JK1 C;  2PW5 A;  2WP8 J;  1FYC A;  2OF1 A;  1TKW B;  1RCV D;  1EZ6 A;  5CV4 A;  2F1M A;  1DZ1 A;  3I3C A;  4H44 C;  3MTS A;  3D8G A;  2EZV A;  1GUN A;  1SSO A;  1EY0 A;  4C3H G;  3K6O A;  1TS4 A;  4EQP A;  4DK1 A;  3S1Q B;  4QUF A;  1O7L A;  2XVS A;  4ME5 A;  1DXM A;  3J81 E;  1SMY C;  2RSO A;  4L8J A;  2E2D C;  4Q5V A;  1SND A;  4KV6 A;  4EGV A;  3BG3 A;  1NR4 A;  1JOR A;  2QCP X;  4U67 3;  2ICE C;  3PUZ A;  1VDZ A;  2CW0 C;  2MJ8 A;  2VUM B;  1F9Q A;  4ABN A;  2EJG C;  4RWS C;  5DAU A;  4K8J A;  1LTA D;  1S5D D;  1OXS C;  3A8I E;  4R9W A;  2RA4 A;  1V8Q A;  5KRU A;  3GD7 A;  1QG7 A;  5HGT A;  2A73 B;  1II3 A;  4XIG S;  4DU9 A;  1M4V A;  2A69 C;  3GO5 A;  1DON A;  2F0T A;  1AP0 A;  3E6Z X;  2FIN B;  1FGB D;  1ILQ A;  2RBM A;  4LJZ C;  3MXU A;  3LNN A;  2NBF A;  1X3P A;  5G3L F;  4H13 C;  5FK9 C;  1KAA A;  1J9O A;  2KED A;  3MZ5 A;  4KD4 A;  3GTO B;  1DD2 A;  2JEB I;  3AB9 A;  3MWY W;  2V4D A;  3U9O A;  3JAM L;  3VR5 A;  1LV9 A;  2EXZ A;  1RTN A;  3HRZ C;  5LHY 1;  2WKC A;  5DM6 3;  4CKE A;  1EEF D;  3CRK C;  1ZXT A;  4M1U B;  1SYE A;  1KDA A;  4UAI A;  1STH A;  2A6H D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...