5IYDH

Human core-pic in the initial transcribing state (no iis)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
150
structure length
150
Chain Sequence
MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Near-atomic resolution visualization of human transcription promoter opening.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5iydH01
1OXXK 3RZOH 3HOXG 2HHHQ 4JI4L 4DR5L 4JI2L 4C3HH 4GOPA 3F2DA 2CCZA 3GTJH 2IT1A 3S15H 1A63A 2JJQA 4OX9L 4UY8C 2PQAB 4DNIA 3OW2A 3BU2A 1K9MC 3U4ZA 3S2DH 3GTOH 4BXXH 2CKZB 1C0AA 4APVA 3DM3A 1PV4A 4DV4L 4YWMA 3L2PA 1Q81C 4X62L 1PHJA 2D62A 3CW2C 1G291 1Y1VH 2QGQA 1XTDA 4LFAQ 2JA8G 3S1RH 1PH8A 3M4QA 3H15A 5BR8Q 2R7DA 1XMQQ 4NXML 3HOWG 2A19A 2ZTEA 3K8AA 3CC7A 4GNXB 4HIOA 1VQJA 2HIXA 4GOPB 1VQ6A 4X65L 3W5OA 1VQEA 3RN2A 3ERSX 3ULPA 2E5LL 4DUYL 4DV3L 2JEAI 4HJAA 4DUZQ 4DR3Q 1PH5A 1JJ2A 1EYGA 2E2HH 4LFBL 1BBWA 3GD7A 4BY7G 3J80i 5FLMH 3T1HQ 5M3FG 3J7A5 3E0EA 4P75A 3L0OA 3B6YA 1E1OA 1C9OA 4JI3L 3I56A 4AYBE 4X66L 2JA7H 2AHOB 3CCSA 1Q1EA 1EWIA 2R7FA 4XTCS 4JI5L 1P16A 4DAMA 3GTKH 3S1MH 1N34Q 2JE6I 3CCJA 2K4KA 2YYZA 3AEVA 2VUMH 3PUWA 4P72A 3WWVA 2ES2A 4DR7L 3ULJA 4JI4Q 2BH2A 4JI2Q 2BH8A 1QZHA 4B3ML 1Q8KA 1DGSA 5C4XG 1HNXL 4OX9Q 3K81C 1UE6A 4OWTB 4HIMA 3RLOA 3EBEA 2NVTH 1X54A 4C3JH 2WAQG 2D0PA 1VQ7A 2I5HA 2ATWA 1AE2A 2MNAA 4DV4Q 4POGA 1YHQA 1I3QH 2H5XA 3GTQH 4A4IA 1VQ4A 5IYDH 2ZTCA 4TVAB 4X62Q 1EQRA 3G4SA 3HOUG 1Y1WG 2AWOA 3M7NA 1NMFA 4OONA 3PO2H 3TREA 2I5MX 4DV0L 4X65Q 4A3EG 1HZCA 1YZ6A 1Q86C 2E5LQ 4C2MH 2ID0A 4JI0L 2VL6A 4O0AA 3RLNA 2JEBI 4DV3Q 1E1TA 2GVAA 1V43A 2B3GA 2VQEL 2R7ZG 4LFBQ 4PZ6A 4DAYB 2R93H 1L1OC 3J81j 3UDFA 3CXCA 4QJFA 3JAMc 4A3DG 4BBRG 3OTOL 3HOZH 1K3RA 3M3YH 1QVCA 3CD6A 4JI3Q 2I0QA 4X66Q 1VQPA 3G71A 1L0WA 1XPOA 2WB1G 2K5VA 5C3EH 5LMUQ 2Q2UA 4JI5Q 3I4OA 4JI8L 1YNXA 1YVCA 3UDIA 4JOIA 3FKIG 2VQFL 1NJIC 4A3GH 1X56A 2PNHA 4DR7Q 3TS0A 3S2HH 4PZ8A 4IPHA 5IP9H 4L5RC 4B3MQ 1OXUA 2Z0SA 1X6OA 3U58A 1HNXQ 4LF6Q 2WP8J 2YTXA 1NMGA 1SR3A 4YHHQ 4A3BG 1VQHA 2N49A 3CCRA 2YU9H 1PA6A 4GLXA 1EIYB 1KL9A 4JBWA 2V1CC 4MNOA 2NN6I 4HJ8A 4JBJA 4JBKA 3HOVH 1HJPA 1JJGA 1PH9A 2KENA 4HIDA 1FGUA 2GN5A 2YTYA 5IP7H 3NEMA 5HY6A 2CWPA 3FP9A 4DV0Q 1W2BA 1S40A 1AH9A 3RR5A 1Q7YC 3M85A 4JI0Q 4DR6L 1J5EL 3CP0A 2VQEQ 5IYBG 4UPAA 3UDXA 3S16H 3I4NH 2IY5B 4B3SQ 3OTOQ 2ZJRA 3M9BA 4LF5L 3FHWA 3PCOB 2VZAA 3JC66 4MZ9A 1EQQA 3CCQA 1QVGA 1PH7A 1Z9FA 3H0GG 3CPWA 3HFZB 4JI8Q 1D8LA 1VQNA 3G6EA 2VQFQ 3TRZA 2GVBA 4A3CG 2KHJA 1XPRA 4OWXB 4IJLA 4OWWB 1A0IA 2Y0SG 4YCUA 3U50C 3JAMi 3PF5A 2Q2IA 4GLAC 1KRSA 5M3MH 2ZTDA 3PO3H 2RHSB 1IZ6A 1Q82C 3UE1A 4LF9L 4GS3A 3PIPA 4DV6L 2AWNA 4A3MH 3HKZG 4AH6A 1PVOA 4JBMA 1HH2P 2NZOA 1OTCA 2K50A 4BXXG 5ELOA 3NBHB 4NB3A 3PGZA 3KYHC 1YHBA 3H3VI 4BBSH 1U5KA 1K0RA 2LXJA 3OYYA 3U4VA 1YIJA 1I94L 2UUBL 2ZJQA 1XNQL 1XNRL 1Y1VG 3UDGA 1KC8C 1AE3A 3IRBA 1J5EQ 4DR6Q 2F3IA 3PUZA 2OCEA 2HT1A 3CCUA 2A8VA 4Y7NH 4DR4L 4LW1A 4IO9A 4LF8L 5ELNA 2UU9L 2JK8A 4LF5Q 3UE0A 5JEAG 1KQSA 5FLMG 5LMUL 4IJHA 4PMWA 3CCVA 2WAQE 1PYSB 1K83H 1LYLA 1CSQA 5E7NA 2JA7G 4L5TA 3NELA 1YJ9A 2MO0A 1LUZA 1N36L 1K8AC 4LF6L 5JJIA 2VUMG 3J81c 2YTVA 4LUOA 4RMFA 4YHHL 1HZAA 2DUDA 4DV1L 4LF9Q 4DV6Q 4GKJL 2JA5H 3KLWA 2Q2HA 4POFA 1LTLA 4B3TL 1VQ9A 5LMNL 1BBUA 2K75A 1KAWA 1IBLL 3KF6A 2PI2E 4IPDA 4X64Q 4YCVA 2YV5A 1UEBA 4NXNL 3ER0A 2K5NA 5IYDG 1I94Q 2UUBQ 1XNQQ 3T1YL 1WFQA 4DK3C 1IBML 1XNRQ 1WCMH 2WB1E 4UP9A 4FDBA 1FL0A 1E24A 2ALYB 2KHIA 3S1NH 1YEZA 5FLXc 2JA6H 3PO2G 1SMXA 1HZBA 4JG2A 1IBKL 1C7YA 2NN6G 4DR4Q 4GN3B 4LF8Q 4B3SL 2F4VL 1UE5A 1X3GA 3SGIA 2QEXA 2UU9Q 4KHPL 3STBC 1V1QA 1PH1A 2R93G 4BY1H 2KCTA 1EOVA 3KF6B 5FJ8H 1VQAA 4LNQA 3CQZH 4GNXC 4L5QA 4LF7L 1MIUA 5GAHC 4HJ9A 4GOPC 1VQCA 5IT9c 3CCMA 3K0XA 4KLKA 3HOZG 2VS1A 3KFUA 1PYBA 4A3KH 3GTMH 4DR2Q 2A1AA 2PI2A 3KOJA 1N9WA 3KJOA 4IFDG 5DLQE 4JCVE 2NZHA 2IHEA 5C3EG 2B29A 4JYAQ 3PIOA 1MKHA 2ASBA 1EUJA 2JQOA 1N36Q 1NTGA 4A3GG 2EIFA 5IP9G 3ULLA 1Q12A 2MO1A 2XTIA 3K80C 4DV1Q 3PUYA 1X3FA 4R4CA 1OXVA 4GKJQ 3I4MH 3S17H 2UUAL 4PZ7A 3W1BA 4B3TQ 2AKWB 5LMNQ 4QQBX 3HOYH 1HNWL 1IBLQ 4LWCA 4IOCA 4LFCL 3KDFA 4XIGS 2MFIA 4R1JA 4NXNQ 2AMCB 3GTGH 3HOVG 2OTLA 4NPSA 3TS2A 3T1YQ 4DV7L 1IBMQ 5AJ3L 4BA1I 3J81i 2RCNA 4UP7A 4A3LH 4IFDI 3M4PA 2RF4A 4J15A 1VQDA 5IP7G 1IBKQ 4LUVA 2F52A 2JA9A 3I2ZA 2F4VQ 3PV0A 1TWFH 1SRUA 4R4OA 4YCWA 1PH3A 4K0KL 1VQBA 1M1KC 1JE5A 2Y0SE 4YY3L 3W1GA 3RNUA 4R4QA 4EX5A 4KHPQ 3AYHB 3I7FA 3GTLH 3I4NG 4A93H 1A62A 1VQFA 3KDFB 3S24A 1E7ZA 4P71A 5IYCH 4LF7Q 1D7QA 1L2FA 4DR1L 2CQOA 2XGTA 4A3IH 1GM5A 5GADC 4QL5A 4JI6Q 4LF4L 1NBWA 3HKZE 2B63H 5C44H 2Z6KC 1SN8A 4R4IA 5JEAJ 1S3OA 4A3FH 2NVQH 3S14H 2OQKA 2RHQB 1KHIA 5M5YH 2R92H 4A3JH 3HKSA 5GAEC 1K8GA 1S72A 4MTNA 5M5WH 3ICEA 4JI1L 2ZM6L 4KI0A 2N3SA 2IHFA 1L1OA 3ZJYC 3HOXH 1N8RC 1M90C 3CCEA 1XPUA 4A3CH 4JV5L 1IYJB 2WFWA 2LSSA 1VQMA 1E3PA 2UUAQ 1HNWQ 1VQ5A 5M3MG 3PO3G 4X64L 4LFCQ 1CUKA 1GVPA 2UUCL 2Q2TA 5IY0A 4A3MG 1O7IA 1TWCH 4B3RL 1X55A 3CMEA 4JC0A 4GNXA 1QVFA 2I5LX 4DV7Q 5AJ3Q 1N33L 1IL2A 3RN5A 1SROA 4OO1I 3F2CA 2OWOA 1XJVA 4BBSG 2JA8H 5J3BA 4HJ5A 3CF5A 4QY7A 5C0XG 2UXBQ 1L1OB 3HOWH 5C4JH 4K0KQ 3RLFA 2BA0A 5EAYA 4YY3Q 1CKNA 4JOIC 1RIPA 4O2DA 5IE8A 1GO3E 3CCLA 4X6AH 1T9HA 2PMZE 1E22A 2N78A 4YWLA 4DR1Q 1YITA 4KHZA 1TWHH 4JI7L 2IX1A 3MEFA 3TEHB 4BY7H 4DR2L 2OTJA 5M3FH 1X65A 1YBYA 1UWVA 4LF4Q 1GD7A 1B70B 1HR0W 1J6QA 1ASYA 4JYAL 3F8TA 1SLJA 1NE3A 1BVSA 5LMNW 1CKMA 2C35B 4DPGA 3MXNB 4JI1Q 2ZM6Q 4AQYL 1HNZL 2E2JH 1FJGL 3PSIA 4Y52H 1CKNB 3TQYA 1I50H 2OQ0A 1HR0L 3M4OH 2UXCL 1P8LA 1PFSA 3PUVA 1PH2A 4JV5Q 4IFDJ 5C0XI 3CMAA 2KBNA 3F2BA 5C4XH 1H95A 4ME3A 4A76A 4YWKA 1V9PA 1B7YB 2K5HA 3D31A 1B8AA 2K14A 4DV2L 1UE1A 2JA5G 2UUCQ 3EN2A 2ZJPA 1I6HH 4DR5Q 4B3RQ 5M5XH 5JJLA 2K52A 1MJEA 1A8VA 3J7ZC 1N33Q 4AYBG 3VDYA 1IXRA 3D0FA 1JJCB 5K36G 1EIFA 1Q46A 2NVYH 1HZ9A 5IWAL 3HOUH 1MJCA 2Z6KA 1VQOA 4UP8A 1Y1WH 1WCMG 2E8GA 5H1SE 3A74A 3NENA 3PUXA 3I55A 4AIMA 4A3EH 1N32L 2JA6G 2EQSA 5GQOA 2D0OA 2R7ZH 4PG3A 4NXMQ 4JI7Q 1YJNA 1KIXA 2FXQA 4JI6L 4TQUS 1TWGH 3GDEA 1TXYA 3AFQA 1QUQA 1WOCA 3GO5A 3F1ZA 4BY1G 4BBRH 5FJ8G 4ALPA 4A3DH 4H02A 2CFMA 4DUYQ 1GKHA 4GKKL 2L15A 1LM0A 4WJ3M 2DGYA 1X3EA 4A3KG 3S1QH 2EXDA 2UXDL 1YI2A 1JT8A 3A5UA 4AQYQ 1HNZQ 1FJGQ 4EQ5A 3E9HA 1EFWA 4WJ4A 4DV5L 2VW9A 1VQIA 3FKIH 1HR0Q 2UXCQ 1XMOL 1K73C 1VCIA 4GN5A 3KF8B 3BZKA 1WJJA 1X9NA 3CAMA 1W3SA 1SFOH 1PH6A 3GTPH 2CWAA 2HQLA 2R6GA 2KCMA 5GAGC 2NVXH 5JJKA 4IPCA 2LXKA 4LUZA 1Q1BA 1QUQB 5HGQA 4A75A 4DV2Q 3EIVA 1I5FA 1U0LA 2HHHL 1RL2A 4A3BH 3I4MG 1OXTA 4R4TA 5GROA 4DKAC 3HOYG 2VNUD 1KRTA 2BA1A 4RG1A 1VS0A 1Y14B 4QGUA 3E9IA 2N8NA 4P73A 2QA4A 5IWAQ 3KJPA 1PH4A 3CC2A 2UXBL 3A0JA 3J80c 1UE7A 3Q8DA 3CPFA 1Z47A 1JB7A 4L5SA 4A3LG 1N32Q 2E2IH 1NY4A 1G51A 4OXPA 1JMCA 1SE8A 1FVIA 4LFAL 1KD1C 4HIKA 4IPGA 5IYBH 5BR8L 1XMQL 1WI5A 3AFPA 3K7AH 4QIWE 4BA2I 1TWAH 4DK6C 1KXLA 3PF4A 3AQQA 5C0XJ 2HIVA 1CKOA 4OO1G 3L7ZC 4A93G 5IYCG 3RZDH 3K7UC 2VY3A 4GLVB 4DUZL 4DR3L 3LGJA 1VQKA 4GKKQ 1CSPA 3A5ZB 4C3IH 4A3IG 4P74A 3T1HL 1QZGA 1OXSC 2PQAA 1WYDA 3H3VH 2UXDQ 1YJWA 2B63G 3BZCA 5C44G 3H0GH 4GN4B 3STBD 1VQLA 4DV5Q 4A3FG 1R9TH 1ASZA 3BJUA 1VQ8A 4IOAA 1XMOQ 2R92G 2MQHA 4HJ7A 4A3JG 2IX0A 3G48A 1BKBA 1YHAA 1G6PA 3CC4A 1VQGA 1N34L 3DLLA
chains in the Genus database with same CATH superfamily
3DWQA 2HHHQ 3F2UA 4DR5L 2EYLA 1CK1A 1K0SA 3I4NB 1II3A 1HXYD 3BU2A 3U4ZA 3S2DH 3MC0B 4BXXH 3VR2A 2K03A 1LACA 2TSSA 1PHJA 2D62A 1Y1VH 2A6HD 2JA8G 2L9HA 1PH8A 2PZWA 5DAUA 1HUNA 1V1PB 1LTSD 4QIWB 2LFNA 5ELEA 3W5OA 4PQXA 5JEAH 1JJ2A 3HEJA 1BBWA 1ENAA 3GD7A 1SYFA 2ICIA 4A3MB 3E0EA 4QUFA 1BQQT 3QR8A 4JI3L 2JA7H 1TR5A 2KEEA 4JI5L 4DAMA 1I6VC 4ZKCB 1GUNA 1QOHA 1I4XA 2RCFA 3X3NA 1ENFA 1UNSA 2KVMA 4JI2Q 5C4XG 3FVQA 2V4DA 3K81C 1UE6A 4HIMA 3MFYA 2D2CC 5G3LD 2D0PA 5CV8A 1YHQA 1I3QH 5M9OA 1K83B 1U4LA 3G4SA 2WIIB 3M7NA 2PMZB 3MFGA 4X65Q 1HZCA 2E5LQ 1PTOB 3RUZA 1V43A 2B3GA 5DNFA 3K5OA 4PZ6A 2R93H 1L1OC 2MGSA 1B1ZA 4QUCA 1DJRD 1VMCA 2NWGA 1O7ZA 1NCVA 3N6RA 1GHJA 3NTIA 5LMUQ 2EYHA 3H09A 1RCVD 3I4OA 1YNXA 1NJIC 2PNHA 4PZ8A 5IP9H 2JA6B 1OXUA 5EPKA 4H13C 4LF6Q 1PMRA 1HTPA 4M8AA 4YHHQ 2N49A 3CQZB 4IUVA 3SK5A 2NUCA 1HJPA 1B53A 1S40A 5HY6A 4DV0Q 3LWEA 2GA4B 3TP6A 1Q7YC 4JI0Q 4DR6L 2AQ3B 3CP0A 5EPLA 3I4NH 3S17B 3M9BA 1LLRD 1BCPF 2FHTA 1PLFA 1ESFA 1L0XB 2A74C 3GTGB 1PH7A 3H0GG 4JI8Q 1SXTA 3FRPB 3NBHA 2VQFQ 4J8QA 4FF3A 1RTOA 1XPRA 4OWXB 4HCSA 2ZXOA 2J7ZA 3IL8A 1A0IA 5DEHA 1JR0D 1GOZA 2F0IA 4DXGA 3JAMi 5EQ0A 1F9PA 2SEBD 5M3MH 2ZTDA 4C3HG 1JWMD 4DV6L 4A3MH 1PVOA 4AH6A 2BDOA 2K50A 5ELOA 3NBHB 3PGZA 3BG3A 2EY2A 1SNPA 3H3VI 4A3FB 2LXJA 3U4VA 1I94L 1YIJA 1XNQL 5C0XH 1XNRL 1CQFA 4HMJA 5M5WB 1J5EQ 1C48A 2HT1A 4CKBA 1QG7A 2A8VA 3QO2A 4ZRZA 3URYA 4IO9A 1MGSA 1FNWA 3C46A 4TKOB 2K1BA 3QOJA 4E6IA 1WD0A 4PMWA 1SNMA 1K83H 1CSQA 5KRUA 2F0JA 1STHA 2JA8B 2VUMG 1PTOH 1CFMA 5J1ZA 1Z7TA 4LF9Q 3OIQA 4R9WA 2L0CA 2B2VA 3J81L 3NSWA 2BOSA 3K6OA 4X64Q 5EKIA 4FF2A 5I2YA 1KLGD 3ER0A 2JXMB 2QKIC 1XXGA 1EYDA 1HHVA 3J80E 1YEZA 2JA6H 1PRTD 1SNQA 2AQ2B 4IUNA 1SMXA 1IBKL 4DR4Q 5KEEA 2QEXA 1EFID 4KV6A 1PH1A 4LNQA 1JQYD 2KCTA 5FLXL 1VQAA 3CQZH 1MIUA 3A8IE 2R3ZA 1VQCA 4HJ9A 3NPPA 5IT9c 3CCMA 4XYQA 1PYBA 1HFNA 1LTID 4OIJA 4G7ZC 4KMUC 4JW0A 3KJOA 2IHEA 1JWUD 2WACA 4CJ2C 2C5CA 2N55A 3RMHA 1Q12A 3PUYA 1BUVT 1X3FA 4R4CA 3S17H 3W1BA 1WTPA 4B08A 1IKLA 1SSOA 1KDBA 2MFIA 4NXNQ 3GTGH 3TZUA 4NPSA 3TS2A 5K5PA 1Y69U 2RCNA 1X32A 3QWNA 2NBFA 1WD1A 2RF4A 5IP7G 4LUVA 4CKCA 2F4VQ 5JVG3 1DOLA 1BXTA 5JPNC 3HOYB 4KHPQ 4R4QA 4R8IA 4A93H 3S24A 5IYCH 4P71A 1D7QA 4QL5A 4HSPA 4LF4L 2Z6KC 4A3FH 2Z8LA 1KHIA 2M2LA 1K8GA 4MTNA 5M5WH 3ICEA 2ZM6L 4RH6A 3TP7A 2IHFA 4A3CH 4JV5L 2WFWA 3BZDB 3K7AB 1E3PA 2DJFC 1VQMA 2J4XA 3PO3G 1K8MA 1X55A 4GNXA 2I5LX 1A2TA 5AJ3Q 1E2VA 1SROA 3H0GB 4FO2A 4CDFC 4OO1I 2OWOA 2JA8H 1PTOF 3CF5A 1SYCA 2F4IA 3LNNA 2L5TA 4DA2A 4K0KQ 4O2DA 4RAUC 5IE8A 1B44D 3RZOB 2IX1A 2N78A 1YITA 4K5WA 4KHZA 4C3HB 1YBYA 1UWVA 4JYAL 4N9TA 1CKMA 1DXMA 4AQYL 2ZT9C 3PSIA 5E4WC 2OQ0A 2ZXRA 2UXCL 1AFPA 3PUVA 1C4QA 3BYTB 5C0XI 4KD3A 5C4XH 1DCZA 3BVMA 2AUJD 1WTHA 2K5HA 3D31A 1B8AA 1UE1A 3EN2A 4DR5Q 1RODA 4B3RQ 2KA7A 3J7ZC 4HCEA 1MI2A 2FINB 1IXRA 2KECA 2NVYH 3FPPA 3M4OB 1MJCA 3I55A 4AIMA 1B50A 1GUGA 2EQSA 2VUMB 3NUCA 3ND8A 5GQOA 2O5IC 1MD2D 4JI7Q 2EDGA 2FXQA 1QE6A 1TXYA 1X3QA 3HZXA 1WOCA 4BY1G 3H6MA 1YNNC 1GKHA 5FK9C 4YIJA 1I4PA 1Q90A 4A3KG 3P7JA 1YI2A 1EFWA 2SOBA 4WJ4A 4DV5L 1ET9A 4ZYSA 2R7ZB 2A69C 1PH6A 2CWAA 2N88A 1QNUA 2R6GA 5I6WA 4WORA 4PNYA 3DWPA 4IPCA 4LUZA 1GUSA 1TIID 3EIVA 3QIAA 1I5FA 1U0LA 1RL2A 4PMBA 3W3AA 4IALA 2VNUD 4ZUIA 4QGUA 5IWAQ 1PFNA 2CQAA 1UE7A 3M7GA 1JB7A 1STGA 1QB5D 4RCNA 1EEID 1NY4A 3NK9A 1D5XC 1FVIA 2Z1CA 4LFAL 5BR8L 3OOCA 3K7AH 5C5LA 2DNEA 2XWJB 1SYBA 1AW7A 1WTXA 2HIVA 1DM0B 4OO1G 3L7ZC 2VY3A 1CSPA 3A5ZB 3E6ZX 5KIXA 1QZGA 2HDLA 4ODGA 5C44G 3H0GH 2B2VC 1GXDC 2O2LD 4IOAA 3S9WA 3OMGA 4HEDA 1YHAA 1G2TA 3CC4A 5BN4A 2F1MA 1OXXK 3RZOH 3O13A 4C3HH 4GOPA 3S16B 2BDNA 2BCOA 4UY8C 4DNIA 3OW2A 4K5VA 1SAPA 2EY5A 3DM3A 4X3TA 1D1KA 2CH4A 2A69D 3L2PA 1Q81C 3H15A 3C2PA 1E2ZA 3K8AA 1DD2A 1VQJA 2MP1A 4GOPB 1VQ6A 2PZUA 1TKWB 5ELDA 3RN2A 3ERSX 1RD9D 3MHBA 4DV3L 1M4VA 1H9SB 4DR3Q 1IW7C 1XYIA 1PH5A 1BCPB 3T1HQ 3NP8A 4K2KA 4P75A 5BN5A 3B6YA 1E1OA 1C9OA 1TS2A 1Y1VB 1KABA 4X66L 5C6AA 1Q1EA 2LKVA 2LS01 3GV3A 1MBYA 1N34Q 4NMZA 2VUMH 1EYCA 3PUWA 2ES2A 3WWVA 2IPKD 4JI4Q 2C9OA 1JOQA 2BH8A 1QZHA 3CRLC 4ME5A 4OX9Q 3RLOA 2NVTH 2B2WC 1VQ7A 2WAQG 2ATWA 2I5HA 2K28A 4DV4Q 4POGA 1RDPD 1H9JA 1F9RA 1TQOA 2KCCA 1R4PB 4TVAB 4X62Q 5IOCA 3ERQA 1EQRA 4OELB 1QILA 1NMFA 4OONA 4EGVA 1GUOA 3A7AB 3CRKC 3K59A 2VL6A 1E1TA 2GVAA 3CU7A 4LFBQ 1PDQA 1S5ED 2F0NA 3UDFA 3DUZA 4RHRA 3CXCA 1UAPA 3JAMc 1BNZA 2JSOA 3OTOL 1QVCA 3CD6A 4FVMA 3K5LA 3G71A 1EYAA 5LL6S 1XPOA 2KUMA 1CZGA 1DOMA 2K5VA 4NKLA 1G6ZA 2IW3A 2RKSA 1YVCA 3UDIA 1EY0A 1X56A 4DR7Q 3SK8A 1CT1D 1SE3A 4B3MQ 1HNXQ 3H91A 2RSOA 1NMGA 1SR3A 2YTXA 1SDFA 3GP7A 4KY6A 4DN4M 3P20A 4ILWA 3EROA 4CDDC 1KL9A 4JBKA 1F9QA 1PH9A 4OGQC 4A3KB 2HD3A 1H9MA 3G6JB 3EJIA 1LTTD 5IP7H 2K32A 3DM1A 5FO7B 2VQEQ 5IYBG 1CM9A 1KNEA 2B2UA 3S16H 2DN8A 2F0MA 1JB3A 3SDZA 2IY5B 4LF5L 3PCOB 1EQQA 2XVSA 4C3IG 3K57A 4XQNA 3R2TA 3CCQA 3BVZA 1VQNA 1D8LA 2BE5C 4A3CG 1ZXTA 3KBGA 2Z6BA 4RCOA 4OWWB 2XSCA 4CJ1B 3U50C 4GLAC 1KRSA 1YNJD 2B2TC 3PO3H 1Q82C 3T13A 3MXUA 3PIPA 1TY2A 1A2UA 1K8OA 1FR3A 2F0HA 2NYZD 4IUTA 2P5ZX 3E0JA 1D6EC 4RA8A 2EXZA 1A3TA 2ZJQA 1B3AA 2E2DC 2RSNA 2F3IA 3PUZA 2OCEA 3TBIB 5M3MB 4ZQ3A 4TSSA 4LW1A 4LF8L 2UU9L 1CHQD 3UE0A 3I8ZA 2CH4W 5ELFA 1WVLA 3RD4A 2F0LA 3CCVA 2WAQE 3VYSA 1SBBB 1PYSB 5ELBA 2F0FA 5G3LF 4L5TA 3NELA 4IUPA 3JAME 2MO0A 1N36L 1LT6D 2RVLA 2O4XA 2YTVA 3I73A 2X6GA 1W6KA 2WINB 2RDHA 2RDGA 2E75C 1WTWA 1LTLA 4B3TL 4C3JG 1KAWA 3KF6A 2PI2E 3FPUB 1UEBA 3U9SA 3H3VC 2K5NA 3A8JE 2UUBQ 1FYCA 1IBML 2ALYB 3KLSA 4H44C 2E2JB 4DK0A 5KNCA 1Z6HA 1HZBA 3HGBA 4UHVA 1X3GA 1W6JA 2CW0C 3K58A 1ONLA 1V1QA 2F0KA 4BY1H 1EOVA 3KF6B 4GOPC 5GAHC 2K33A 2M00A 3K0XA 3HOZG 4A3KH 2PI2A 1EY8A 4IFDG 5DLQE 1BCPC 2B8GA 4IN3A 1VF7A 4QMGA 5CC4A 5C3EG 4JYAQ 3PIOA 1MKHA 3R2IA 1H9KA 5IT9L 1LV9A 2A68C 1S4ZA 2EIFA 1AZPA 4FP5D 3ULLA 3D8GA 4DV1Q 2G9DA 4OHJA 4GKJQ 2FMMA 2UUAL 2AKWB 5LMNQ 4QQBX 1HNWL 4Q5VA 2F0UA 1IBLQ 3C1FA 1Y8NB 3IKJA 3KDFA 1SYGA 1JICA 5KGUA 2OTLA 3T1YQ 4DV7L 3T51B 4FYDA 2EVBA 1QCBD 4YCWA 4R4OA 2PQEA 1VQBA 3G7LA 1JE5A 1M1KC 3W1GA 3AYHB 4OO1H 3C1EA 1A62A 3KDFB 4LF7Q 3VYTA 1L2FA 2CQOA 2XGTA 3BDLA 1M8AA 1GM5A 1NBWA 2I46A 5C44H 4R4IA 1S3OA 3Q23A 2OQKA 4PV1C 3HKSA 3K5MA 2CW0D 4JI1L 2N3SA 1S5BD 4A93B 3SVMA 3ZJYC 1LTAD 2HQEA 1H9RA 3LWUA 4IQZA 4LFCQ 1SMYC 1SJED 1GVPA 2UUCL 5IY0A 1O7IA 1QVFA 3CMEA 4JC0A 4C3IB 3T16A 1EIHA 1ZYRC 2A68D 4B9XA 1STAA 4G4KA 5T1GA 4HR7B 3K5NA 5I6YA 1RF2D 4PMCA 4BBSG 5J3BA 5C4JH 3Q22A 2MPMA 4YY3Q 1O7LA 3ND9A 1RIPA 3CCLA 2X6LA 2L55A 1E22A 4DR1Q 1NSNS 4KY5A 3TEHB 4DR2L 4B9WA 1WTOA 2FFKB 5COYA 1GD7A 1J6QA 2Q8RE 2R61A 1A3VA 5LMNW 4H0LC 2C35B 5D3DA 3SHLA 3HG9A 2E2JH 2F3WA 4Y52H 1HR0L 4RKLA 1P8LA 3R3OA 2EJFC 4IFDJ 3V05A 3F2BA 2XIWA 3WOEA 1V9PA 5IGCA 3BVGA 1PRTF 2K14A 2JA5G 2F0TA 2KQ3A 1A8VA 3A8KE 4IURA 1N33Q 4AYBG 1Q46A 1HZ9A 1F2ZA 1HRJA 1E0BA 1DZ1A 4UP8A 5J39A 3GTKB 4XYOA 5C4XB 3S1MB 1J8IA 3VYUA 3HS0C 1YJNA 4KN4C 4JI6L 5FJ8G 4ALPA 4H02A 2NVYB 4GKKL 4C3JB 2L11A 5I4DA 1LM0A 1FGBD 1X3EA 2DGYA 3U9OA 1JT8A 1HNZQ 1FJGQ 4EQ5A 1XWEA 1VQIA 1XMOL 1VCIA 1LT5D 3BZKA 3CAMA 5JJKA 2HQLA 5D14A 2LXKA 1Q1BA 4DV2Q 1TVXA 2HHHL 1JOKA 2SDFA 4K6DA 4R4TA 5GROA 4DKAC 3KUPA 1KRTA 2BA1A 2QA4A 3E9IA 4P73A 3HOZB 3KJPA 1IKMA 2EYFA 2AUKA 2UXBL 3A0JA 3SR1A 1PFMA 1Z47A 4L5SA 4A3LG 1N32Q 1SE8A 5IIFA 4HIKA 5IYBH 2HCIA 3NTKA 1WI5A 2Q8TA 5EBCA 1PTOC 1JCKB 3KLSX 1Q3LA 1DOKA 2B39A 3WOFA 3TMEA 1VQKA 4K8JA 3AU7A 4C3IH 1EWHA 1GUWA 4A3IG 4P74A 1ZKOA 3ITPA 1OXSC 2PQAA 1WYDA 2UXDQ 2B63G 4KHVA 1LTRD 2NZ1D 5FOBB 5F2DA 5CV4A 1LTGD 4KK7A 4O42A 3DLLA 1R4QB 5JJZA 3HOXG 1WTQA 4JI2L 1ZEQX 2CCZA 2IT1A 4EQNA 5IGFA 2PQAB 2AQ1B 3D4WA 1F2MA 1K9MC 2EYPA 1VMPA 4CDEC 1PV4A 2A73B 2EJMA 4YWMA 4UAIA 2EY1A 1VF5C 3CW2C 1XTDA 2QEJC 3M4QA 4HMIA 1XMQQ 3HOWG 2A19A 2ZTEA 4GNXB 2HIXA 4X65L 3P1HA 2E5LL 2DJGC 4DUYL 3OHXC 2F0OA 2JEAI 4HJAA 4DUZQ 1EYGA 2E2HH 3J80i 3AMUA 5M3FG 3J7A5 3L0OA 5IT9E 1DYQA 4AYBE 2PO4A 3CCSA 5ISRA 1S5DD 2K05A 3GTKH 1PTOD 4BBSB 3S1MH 5IGGA 3BS1A 3CCJA 1PYWD 3ULJA 4NW2A 3FEWX 1DGSA 1KNAA 3D3RA 5CBAE 1X54A 4C3JH 1O7YA 4LJZC 5C4ZA 3A7LA 3GTQH 1VQ4A 1HPCA 1D2BA 5LHY1 3HOUG 1B9NA 2AWOA 3EA6A 2XWBB 4MHEA 4OEMB 2I5MX 4DV0L 4A3EG 3NTHA 1YZ6A 4JI0L 5E1FA 3RLNA 2JEBI 2PCFB 2KEDA 2NVTB 1A6XA 2LY7A 3J81j 1KAAA 2D5DA 2B8FA 4QJFA 4A3DG 4BBRG 1VDZA 3HOZH 5DM73 1K3RA 1BOSA 4JI3Q 3GQBA 4AYBB 1VQPA 4IFDH 3KK7A 1L0WA 2WB1G 5C3EH 5EKKA 4JI5Q 3KLRA 4JI8L 3JAML 1RTNA 2VQFL 3FKIG 4DXFA 2DNCA 4IPHA 2Z0SA 1X6OA 1QNKA 2WP8J 3MXGA 2Q8IB 3K0YA 4A3BG 1VQHA 3CCRA 2YU9H 2EOTA 1EIYB 2A5HA 2V1CC 4HJ8A 2NN6I 4JBJA 1D5MC 1JJGA 4HIDA 2F0PA 2GN5A 3PIP3 4KN7C 3Q0AA 3NEMA 2CWPA 1NUCA 3M85A 1J5EL 2CVRA 2K6AA 3UDXA 2O5JC 1JWSD 1KDAA 2DY8A 2ZJRA 3JC66 4DGZA 3MA2B 5KYLA 2TMPA 1QVGA 1O78A 3HFZB 4Z9CB 1YNND 2HUGA 4IJLA 4C1NI 3IFDA 2Y0SG 1TWFB 3P75A 1ICFB 2ENBA 1IZ6A 2G9HD 3UE1A 4LF9L 1Y8PB 4GS3A 1IYVA 1G8ZD 2B2YA 4JBMA 1HH2P 4A3IB 2NZOA 1OTCA 5CV9A 2K5WA 2B63B 4J6HA 4CHTB 5I9OA 2NVQB 4BBSH 3OYYA 5NUCA 5K36G 3UDGA 3CHBD 1AE3A 2PYKA 3IRBA 1KC8C 3NWSA 4DR6Q 4F7XA 3ONAB 1IL8A 3CCUA 3PO3B 1NNXA 4QCLA 4DR4L 3HOXB 2EY6A 2JK8A 3VA7A 3BDOA 2F0SA 4FF1A 5FLMG 3MZ5A 4BWGB 2E74C 1TWCB 2HDMA 1LYLA 4WRDA 5E7NA 2NTSA 1CA5A 1YJ9A 1K8AC 3HOWB 4RMFA 5CV7A 1HZAA 5IODA 3PIO3 4DV6Q 2JA5H 3OW7A 3A56A 1BBUA 4M1UB 2K75A 4L8JA 5M3FB 4YCVA 1PXUA 4NXNL 4RGMA 1HA5A 5IYDG 1I94Q 1IYUA 5CR3A 1XNQQ 1XNRQ 4DK3C 1Q8IA 2WB1E 4XDXA 4ZUJA 2XN9C 3PO2G 1I4RA 2PW7A 3J7AV 4JG2A 1C7YA 2NN6G 2WV6D 4B3SL 2F4VL 1UE5A 2F0DA 3E3XA 3STBC 5FO8B 2OT2A 4KHPL 5CV5A 5FJ8H 4GNXC 1T5EA 4L5QA 1I6HB 5D3IB 4CKEA 3KFUA 4Q0FA 3T53B 3GTMH 1L0YB 2SNMA 4N8FA 2A1AA 5CGKA 4DR2Q 3KOJA 1N9WA 3A54A 1IW7D 4RGOS 2ASBA 1EUJA 2JQOA 4MN3A 3SK6A 4A3GG 4HTHA 1XTCD 4A3EB 4XT3B 4ULLA 4DAPA 3K80C 4BY1B 5HURA 1OXVA 1PRTB 3IFTA 4PZ7A 2RQXA 4ZCKA 5TSSA 4FF4A 4LWCA 1LTBD 4A3DB 4R1JA 5EPJA 2AMCB 3VR3A 3MAQA 3HOVG 4OL7A 3NHHA 5AJ3L 1BR9A 2E76C 4DK1A 3J81i 3VA5A 4A3LH 1F9SA 4IFDI 3M4PA 2WKDA 3D4DA 4K8IA 1IBKQ 1VQDA 3FKIB 3NE5B 5JAVA 3I2ZA 1SFOB 3PV0A 1TWFH 3GTPB 4K0KL 2Y0SE 3RNUA 2NVXB 4EX5A 3GTLH 1GJXA 1EY6A 1VQFA 1E7ZA 4XXEA 4A3BB 2VB2X 4A3IH 4JI6Q 5FKAC 2B63H 1ENCA 1SN8A 2NVQH 1HTLD 2RHQB 5M5YH 1HQRD 5HGTA 4EVOA 1S72A 1EZ6A 2F0QA 1EY4A 2DY7A 4C1NK 2E2IB 1EOTA 3OWFA 3HOXH 1N8RC 1XPUA 1IYJB 2LSSA 1TWAB 1VQ5A 4G7HC 5CV6A 1CUKA 5C44B 1LO5D 1RKNA 3RZDB 3H94A 1V1PA 2Q2TA 5CYUA 1TWCH 4B3RL 2FJ2A 2Z4HA 1IL2A 1CA6A 1TT2A 4HSVA 3RN5A 1EEFD 3UI2A 4ZLTF 4HJ5A 4QY7A 2UXBQ 3HOWH 2BA0A 5EAYA 3J7AF 2Y0SB 5ELCA 1GO3E 4CJ0B 3SE0A 1T9HA 2PMZE 4YWLA 4JI7L 5EBDA 3MEFA 1F2YA 3GTJB 3S15B 1CI3M 5M3FH 4LF4Q 1BBXC 3MXPA 1HR0W 1ASYA 5JPMC 3GTOB 3F8TA 4XQJA 1BVSA 1U9RA 1SNCA 3EQLC 5C4JB 4DPGA 2ZM6Q 1EY5A 4O1NA 5EGTA 3TQYA 1MSHA 1I50H 3S1RB 4JV5Q 3CMAA 2KBNA 2QW7A 2BE5D 4YWKA 1B7YB 1I6HH 5M5XH 2K52A 1TY0A 1AP0A 2F0GA 4WJWA 2F0EA 1K28A 3NXWA 2EJGC 2XRQD 3VDYA 3D0FA 4J1MA 3SK4A 5IGBA 1EIFA 3HP3A 5IWAL 3HOUH 4GZYC 2Z6KA 3I90A 1BO0A 1WCMG 2E8GA 3A74A 3PUXA 4RKBA 3X3MA 4A3EH 1AEXA 1X3PA 4PG3A 4NDXA 2WAQB 2MUYA 4TQUS 3GDEA 4RGNA 3AFQA 1QUQA 4A3DH 3F1ZA 4BBRH 2CFMA 4DUYQ 3IAYA 2L15A 1KDCA 4NP5A 3I72A 2B2YC 3S1QH 3A5UA 4AQYQ 4FXKC 5J22A 2PPBC 3PQIA 2VW9A 3FKIH 2UXCQ 5C4HA 1K73C 4GN5A 1SFOH 1WJJA 2JYOA 3GTPH 1W3SA 1TS4A 3PO2B 5GAGC 2KCMA 2NVXH 4R8NA 1QUQB 4C2MB 4A75A 1HQMC 4A3BH 3I4MG 4K6LA 4CBVA 3N52A 2Z9HA 3HOYG 1EY9A 4LK1C 4RG1A 1VS0A 1Y14B 3M3YB 3FDTA 1PH4A 5JOBA 1S5FD 3CC2A 3J80c 1CHPD 1ML0D 3Q8DA 4ID6A 5C3WA 5KYIA 2E2IH 1JMCA 4OXPA 4A3GB 1NR2A 3S2HB 1TWAH 3TP8A 1DONA 4C56C 1CKOA 3RZDH 3K7UC 1CTMA 4GLVB 4DR3L 3WDNA 4BS9A 3T1HL 4UDUC 1YJWA 3BZCA 3HOVB 1JE4A 4DV5Q 1ASZA 1VQ8A 2ZXPA 2R92G 4HJ7A 4U673 4A3JG 1AZQA 1PZJD 3G48A 1STEA 2OEOA 3MTSA 5EJWA 1VQGA 4XQQA 4I7AA 1N34L 4CGYB 1BCPD 3E5SA 4JI4L 1RJTA 3F2DA 3GTJH 3S15H 1A63A 2JJQA 2LMCB 2PNRC 4OX9L 3GTOH 2K01A 2CKZB 4L63B 4APVA 1PRTC 1C0AA 4DV4L 5K36H 1FNUA 3VR4A 3R93A 4X62L 1G291 2FMCA 1B9MA 2QGQA 1STNA 4LFAQ 3S1RH 4KKSA 5BR8Q 2K5DA 2R7DA 4NXML 3CC7A 4HIOA 1SYDA 1FD7D 1TS3A 1VQEA 2NTTA 2CHBD 3W2DA 3ULPA 4LFBL 5LL6X 4BY7G 1A3UA 5FLMH 3TDQA 3Q24A 1SE2A 3I56A 4DFAA 1SEBD 2AHOB 4F87A 4KJNA 1LABA 1EWIA 4RHSA 2R7FA 4XTCS 1P16A 2RDFA 3DWAA 1F2LA 1EL0A 2JE6I 3AEVA 2K4KA 2PW5A 2YYZA 5T1IA 4P72A 2B2UC 3I4LA 4DR7L 1IHZA 2D9UA 4XT1B 2BH2A 2E2HB 5E4XA 4B3ML 1F77A 1Q8KA 1STYA 4Y7NB 1HNXL 4OWTB 5I2XA 1KTKA 3EBEA 4DAYA 1AE2A 2MNAA 5A2QL 2H5XA 4A4IA 1V1OA 2H4OA 2ZTCA 5IYDH 1MHWC 2VB3X 1SMYD 1Y8OB 2KCNA 4S3SA 1Y1WG 2NB0A 3PO2H 1ZYRD 3TREA 3TP5A 2NN6H 1Q86C 4C2MH 2ID0A 4O0AA 4DV3Q 4L6TB 2VQEL 2R7ZG 4TRDA 4DAYB 3GTQB 1LT3D 4F88A 5KNBA 3M3YH 2I0QA 1AN8A 4X66Q 4IUQA 2Q2UA 2OF1A 4JOIA 4A3GH 1WCMB 3TS0A 3S2HH 1UEAB 4X3SA 3S1NB 4L5RC 1JOOA 3U58A 1KLUD 1A15A 3QOLA 2RBMA 4JVZA 1C8CA 1K3BC 2KJXA 2K5QA 1PA6A 4GLXA 5C3EB 1JORA 4MNOA 4JBWA 3HOVH 4RGTA 3T56B 1EU4A 3D6WA 5E3FA 5JVH3 4DNRB 2KENA 1FGUA 4N8X1 2YTYA 3MEHA 3FP9A 1AH9A 1W2BA 3RR5A 2EYOA 3QJYA 2YU9B 4UPAA 2IJ0A 4B3SQ 3OTOQ 3I4MB 2K04A 3FHWA 4MZ9A 2VZAA 2B2WA 3KBXA 4DNTB 4HN7A 1Z9FA 3CPWA 4I65A 3G6EA 3TRZA 2GVBA 2KHJA 2XRSD 3NWTA 1EZ8A 4IUUA 5A35A 4I7ZC 4MIUA 4YCUA 3PF5A 2Q2IA 1V8QA 3D6CA 2KOLA 1XX8A 2RHSB 3SEBA 2Z4IA 3V2TA 2AWNA 3HKZG 1ILPA 1EY7A 1TS5A 2PZTA 4BXXG 4NB3A 3PMFA 3KYHC 1G91A 1LT4D 1YHBA 3S14B 1U5KA 1K0RA 2SNSA 1SE4A 3D4RA 1PFBA 2UUBL 2R92B 4A3JB 1Y1VG 2EYMA 4Y7NH 3NQTA 5ELNA 4X3UA 4LMQD 4LF5Q 5JEAG 4MTKA 3OIPA 1KQSA 1NR4A 5LMUL 4IJHA 3BYYB 2JA7G 1B3QA 1ESRA 1LUZA 2G5DA 4LF6L 5JJIA 5CORA 4FXGC 1EQTA 3J81c 4KKUA 4LUOA 4YHHL 2DUDA 4CDCC 4DAVA 4DV1L 1U4PA 4X3KA 4GKJL 3KLWA 1FNVA 5AFWA 1SNDA 2JP1A 2Q2HA 4POFA 1U4RA 1HUMA 1TWHB 1D1IA 2WKCA 5LMNL 1VQ9A 4BY7B 3LX0A 1SYEA 1IBLL 4IPDA 1UUPA 2YV5A 4FNFA 3TSSA 4P2CB 1WFQA 3T1YL 1WCMH 2X69A 4UP9A 4FDBA 1FL0A 1E24A 2KHIA 3CKIB 2L4NA 5FLXc 3S1NH 1EWCA 2JA5B 1ET6A 3NBIA 4GN3B 4LF8Q 4G7OC 2UU9Q 3SGIA 2R93G 2B2TA 1E2WA 4LF7L 1HCZA 4KKTA 1GUTA 4KLKA 2VS1A 4IZ8A 1JC7A 4JCVE 2NZHA 3M4YA 2B29A 3DMUA 3J7YW 1N36Q 5C3XA 2I07B 1Y1WB 1NTGA 1I4GA 2EYJA 3L9AX 5IP9G 1GHKA 2MO1A 1CQVA 2XTIA 3I4MH 4B3TQ 3I70A 3HOYH 3GTMB 1TWGB 4IOCA 4LFCL 2EPBA 4XIGS 4JK1C 1J9OA 3T4AC 4DF7A 1IBMQ 4BA1I 4UP7A 2VXWA 3L3OC 4KJOA 4J15A 3TZDA 2F52A 2JA9A 2K7VA 1SRUA 1PH3A 4YY3L 4EQOA 1STBA 3I7FA 3I4NG 3DEPA 4DR1L 5C5MA 4KTAA 2ICEC 5GADC 3HKZE 4QF4A 3AB9A 5JEAJ 3V96A 3S14H 1SNOA 3VYRA 5CBEE 2R92H 4A3JH 4N9PA 5GAEC 4QB4A 3DHQA 3Q6SA 2HCCA 4KI0A 3GTLB 1L1OA 2MJ8A 1M90C 3CCEA 1RHPA 1WTVA 1EU3A 1EQVA 3OPOA 2UUAQ 1BDOA 1HNWQ 5A2QE 5D65A 5M3MG 4X64L 1QJOA 1I4QA 4A3MG 2EE1A 4WFN3 3J81E 5M5YB 4DV7Q 2OXPA 1N33L 1CZWA 1H9SA 3F2CA 1XJVA 2RA4A 1R9TB 1B4OA 1EIGA 5C0XG 1L1OB 3MXNA 3RLFA 2QF7A 4V0BA 1CKNA 4JOIC 4FXDA 5IGDA 1SJHD 4X6AH 3VR5A 1O80A 1TWHH 2QILA 4BY7H 5FLXE 2OTJA 1X65A 2MHVA 4ABNA 5BN3A 3HKZB 1B70B 3VR6A 3S2DB 1SLJA 1NE3A 1I4HA 3DEOA 3QG1A 3MXNB 1MSGA 4JI1Q 3SXHA 3OWEB 5I9PA 1HNZL 1FJGL 4JPBW 1CKNB 3M4OH 1PFSA 1PH2A 1PZKD 3I3CA 3HRZC 5FO9B 5CMDA 4LAAA 2A6EC 3EVQA 1H95A 2L1BA 4ME3A 4A76A 3FMCA 4OIKA 4DU9A 1NAPA 4DV2L 2UUCQ 2ZJPA 5JJLA 2IL8A 1MJEA 2M9VA 1JJCB 1I50B 4ZK9B 1OO9B 1VQOA 2JA7B 1Y1WH 5H1SE 1QWYA 3NENA 3EFXD 3TN2A 2F03A 2JA6G 1N32L 4RWSC 1HFGA 4K14A 4U68A 1TU2B 3KF8A 2D0OA 2R7ZH 1ILQA 4NXMQ 5KNDA 5M5XB 4KD4A 1KIXA 4K2LA 2H1EA 1TWGH 2J0TD 3A55A 5IGEA 3GO5A 2F0WA 3HOUB 3GV6A 3ZYYX 4WJ3M 2L12A 2JN4A 3C3LA 3R8BA 2EXDA 2UXDL 1I3QB 4ZAIA 5EKLA 4G57A 3E9HA 1HR0Q 1YNJC 3OMCA 4K5XA 3KF8B 1X9NA 3BDCA 3QB3A 1B2TA 1PZID 1T5XD 2IX3A 1S5CD 2EZVA 2QDBA 4V190 2A6HC 4BBRB 5HGQA 3OSOA 1G2SA 1OXTA 2R93B 2QDLA 3S1QB 2WB1B 3MVVA 2N8NA 5DM63 4RFBA 3CPFA 2A6ED 2XNAC 1G51A 1U4MA 4HAEA 2F0VA 1KD1C 4IPGA 3NQIA 1XMQL 3AFPA 4QIWE 4BA2I 3J80L 4DK6C 1KXLA 3PF4A 3AQQA 1WTRA 4EQPA 5C0XJ 1BF4A 4A93G 5IYCG 1ICWA 3DXJC 4DUZL 4F8MA 3LGJA 4GKKQ 1HA6A 4H7BA 2IWHA 3H3VH 4ZKBB 2F3VA 4GN4B 2QCPX 3STBD 1VQLA 4A3FG 3I91A 1R9TH 3BJUA 5L37A 1XMOQ 2MQHA 2IX0A 4KY7A 1BKBA 1G6PA 2KHSA 3MWYW 1D5ZC
chains in the Genus database with same CATH topology
1OXXK 3RZOH 3HOXG 2HHHQ 4JI4L 4DR5L 4JI2L 4C3HH 4GOPA 3F2DA 2CCZA 3GTJH 2IT1A 3S15H 1A63A 2JJQA 4OX9L 4UY8C 2PQAB 4DNIA 3OW2A 3BU2A 1K9MC 3U4ZA 3S2DH 3GTOH 4BXXH 2CKZB 1C0AA 4APVA 3DM3A 1PV4A 4DV4L 4YWMA 3L2PA 1Q81C 4X62L 1PHJA 2D62A 3CW2C 1G291 1Y1VH 2QGQA 1XTDA 4LFAQ 2JA8G 3S1RH 1PH8A 3M4QA 3H15A 5BR8Q 2R7DA 1XMQQ 4NXML 3HOWG 2A19A 2ZTEA 3K8AA 3CC7A 4GNXB 4HIOA 1VQJA 2HIXA 4GOPB 1VQ6A 4X65L 3W5OA 1VQEA 3RN2A 3ERSX 3ULPA 2E5LL 4DUYL 4DV3L 2JEAI 4HJAA 4DUZQ 4DR3Q 1PH5A 1JJ2A 1EYGA 2E2HH 4LFBL 1BBWA 3GD7A 4BY7G 3J80i 5FLMH 3T1HQ 5M3FG 3J7A5 3E0EA 4P75A 3L0OA 3B6YA 1E1OA 1C9OA 4JI3L 3I56A 4AYBE 4X66L 2JA7H 2AHOB 3CCSA 1Q1EA 1EWIA 2R7FA 4XTCS 4JI5L 1P16A 4DAMA 3GTKH 3S1MH 1N34Q 2JE6I 3CCJA 2K4KA 2YYZA 3AEVA 2VUMH 3PUWA 4P72A 3WWVA 2ES2A 4DR7L 3ULJA 4JI4Q 2BH2A 4JI2Q 2BH8A 1QZHA 4B3ML 1Q8KA 1DGSA 5C4XG 1HNXL 4OX9Q 3K81C 1UE6A 4OWTB 4HIMA 3RLOA 3EBEA 2NVTH 1X54A 4C3JH 2WAQG 2D0PA 1VQ7A 2I5HA 2ATWA 1AE2A 2MNAA 4DV4Q 4POGA 1YHQA 1I3QH 2H5XA 3GTQH 4A4IA 1VQ4A 5IYDH 2ZTCA 4TVAB 4X62Q 1EQRA 3G4SA 3HOUG 1Y1WG 2AWOA 3M7NA 1NMFA 4OONA 3PO2H 3TREA 2I5MX 4DV0L 4X65Q 4A3EG 1HZCA 1YZ6A 1Q86C 2E5LQ 4C2MH 2ID0A 4JI0L 2VL6A 4O0AA 3RLNA 2JEBI 4DV3Q 1E1TA 2GVAA 1V43A 2B3GA 2VQEL 2R7ZG 4LFBQ 4PZ6A 4DAYB 2R93H 1L1OC 3J81j 3UDFA 3CXCA 4QJFA 3JAMc 4A3DG 4BBRG 3OTOL 3HOZH 1K3RA 3M3YH 1QVCA 3CD6A 4JI3Q 2I0QA 4X66Q 1VQPA 3G71A 1L0WA 1XPOA 2WB1G 2K5VA 5C3EH 5LMUQ 2Q2UA 4JI5Q 3I4OA 4JI8L 1YNXA 1YVCA 3UDIA 4JOIA 3FKIG 2VQFL 1NJIC 4A3GH 1X56A 2PNHA 4DR7Q 3TS0A 3S2HH 4PZ8A 4IPHA 5IP9H 4L5RC 4B3MQ 1OXUA 2Z0SA 1X6OA 3U58A 1HNXQ 4LF6Q 2WP8J 2YTXA 1NMGA 1SR3A 4YHHQ 4A3BG 1VQHA 2N49A 3CCRA 2YU9H 1PA6A 4GLXA 1EIYB 1KL9A 4JBWA 2V1CC 4MNOA 2NN6I 4HJ8A 4JBJA 4JBKA 3HOVH 1HJPA 1JJGA 1PH9A 2KENA 4HIDA 1FGUA 2GN5A 2YTYA 5IP7H 3NEMA 5HY6A 2CWPA 3FP9A 4DV0Q 1W2BA 1S40A 1AH9A 3RR5A 1Q7YC 3M85A 4JI0Q 4DR6L 1J5EL 3CP0A 2VQEQ 5IYBG 4UPAA 3UDXA 3S16H 3I4NH 2IY5B 4B3SQ 3OTOQ 2ZJRA 3M9BA 4LF5L 3FHWA 3PCOB 2VZAA 3JC66 4MZ9A 1EQQA 3CCQA 1QVGA 1PH7A 1Z9FA 3H0GG 3CPWA 3HFZB 4JI8Q 1D8LA 1VQNA 3G6EA 2VQFQ 3TRZA 2GVBA 4A3CG 2KHJA 1XPRA 4OWXB 4IJLA 4OWWB 1A0IA 2Y0SG 4YCUA 3U50C 3JAMi 3PF5A 2Q2IA 4GLAC 1KRSA 5M3MH 2ZTDA 3PO3H 2RHSB 1IZ6A 1Q82C 3UE1A 4LF9L 4GS3A 3PIPA 4DV6L 2AWNA 4A3MH 3HKZG 4AH6A 1PVOA 4JBMA 1HH2P 2NZOA 1OTCA 2K50A 4BXXG 5ELOA 3NBHB 4NB3A 3PGZA 3KYHC 1YHBA 3H3VI 4BBSH 1U5KA 1K0RA 2LXJA 3OYYA 3U4VA 1YIJA 1I94L 2UUBL 2ZJQA 1XNQL 1XNRL 1Y1VG 3UDGA 1KC8C 1AE3A 3IRBA 1J5EQ 4DR6Q 2F3IA 3PUZA 2OCEA 2HT1A 3CCUA 2A8VA 4Y7NH 4DR4L 4LW1A 4IO9A 4LF8L 5ELNA 2UU9L 2JK8A 4LF5Q 3UE0A 5JEAG 1KQSA 5FLMG 5LMUL 4IJHA 4PMWA 3CCVA 2WAQE 1PYSB 1K83H 1LYLA 1CSQA 5E7NA 2JA7G 4L5TA 3NELA 1YJ9A 2MO0A 1LUZA 1N36L 1K8AC 4LF6L 5JJIA 2VUMG 3J81c 2YTVA 4LUOA 4RMFA 4YHHL 1HZAA 2DUDA 4DV1L 4LF9Q 4DV6Q 4GKJL 2JA5H 3KLWA 2Q2HA 4POFA 1LTLA 4B3TL 1VQ9A 5LMNL 1BBUA 2K75A 1KAWA 1IBLL 3KF6A 2PI2E 4IPDA 4X64Q 4YCVA 2YV5A 1UEBA 4NXNL 3ER0A 2K5NA 5IYDG 1I94Q 2UUBQ 1XNQQ 3T1YL 1WFQA 4DK3C 1IBML 1XNRQ 1WCMH 2WB1E 4UP9A 4FDBA 1FL0A 1E24A 2ALYB 2KHIA 3S1NH 1YEZA 5FLXc 2JA6H 3PO2G 1SMXA 1HZBA 4JG2A 1IBKL 1C7YA 2NN6G 4DR4Q 4GN3B 4LF8Q 4B3SL 2F4VL 1UE5A 1X3GA 3SGIA 2QEXA 2UU9Q 4KHPL 3STBC 1V1QA 1PH1A 2R93G 4BY1H 2KCTA 1EOVA 3KF6B 5FJ8H 1VQAA 4LNQA 3CQZH 4GNXC 4L5QA 4LF7L 1MIUA 5GAHC 4HJ9A 4GOPC 1VQCA 5IT9c 3CCMA 3K0XA 4KLKA 3HOZG 2VS1A 3KFUA 1PYBA 4A3KH 3GTMH 4DR2Q 2A1AA 2PI2A 3KOJA 1N9WA 3KJOA 4IFDG 5DLQE 4JCVE 2NZHA 2IHEA 5C3EG 2B29A 4JYAQ 3PIOA 1MKHA 2ASBA 1EUJA 2JQOA 1N36Q 1NTGA 4A3GG 2EIFA 5IP9G 3ULLA 1Q12A 2MO1A 2XTIA 3K80C 4DV1Q 3PUYA 1X3FA 4R4CA 1OXVA 4GKJQ 3I4MH 3S17H 2UUAL 4PZ7A 3W1BA 4B3TQ 2AKWB 5LMNQ 4QQBX 3HOYH 1HNWL 1IBLQ 4LWCA 4IOCA 4LFCL 3KDFA 4XIGS 2MFIA 4R1JA 4NXNQ 2AMCB 3GTGH 3HOVG 2OTLA 4NPSA 3TS2A 3T1YQ 4DV7L 1IBMQ 5AJ3L 4BA1I 3J81i 2RCNA 4UP7A 4A3LH 4IFDI 3M4PA 2RF4A 4J15A 1VQDA 5IP7G 1IBKQ 4LUVA 2F52A 2JA9A 3I2ZA 2F4VQ 3PV0A 1TWFH 1SRUA 4R4OA 4YCWA 1PH3A 4K0KL 1VQBA 1M1KC 1JE5A 2Y0SE 4YY3L 3W1GA 3RNUA 4R4QA 4EX5A 4KHPQ 3AYHB 3I7FA 3GTLH 3I4NG 4A93H 1A62A 1VQFA 3KDFB 3S24A 1E7ZA 4P71A 5IYCH 4LF7Q 1D7QA 1L2FA 4DR1L 2CQOA 2XGTA 4A3IH 1GM5A 5GADC 4QL5A 4JI6Q 4LF4L 1NBWA 3HKZE 2B63H 5C44H 2Z6KC 1SN8A 4R4IA 5JEAJ 1S3OA 4A3FH 2NVQH 3S14H 2OQKA 2RHQB 1KHIA 5M5YH 2R92H 4A3JH 3HKSA 5GAEC 1K8GA 1S72A 4MTNA 5M5WH 3ICEA 4JI1L 2ZM6L 4KI0A 2N3SA 2IHFA 1L1OA 3ZJYC 3HOXH 1N8RC 1M90C 3CCEA 1XPUA 4A3CH 4JV5L 1IYJB 2WFWA 2LSSA 1VQMA 1E3PA 2UUAQ 1HNWQ 1VQ5A 5M3MG 3PO3G 4X64L 4LFCQ 1CUKA 1GVPA 2UUCL 2Q2TA 5IY0A 4A3MG 1O7IA 1TWCH 4B3RL 1X55A 3CMEA 4JC0A 4GNXA 1QVFA 2I5LX 4DV7Q 5AJ3Q 1N33L 1IL2A 3RN5A 1SROA 4OO1I 3F2CA 2OWOA 1XJVA 4BBSG 2JA8H 5J3BA 4HJ5A 3CF5A 4QY7A 5C0XG 2UXBQ 1L1OB 3HOWH 5C4JH 4K0KQ 3RLFA 2BA0A 5EAYA 4YY3Q 1CKNA 4JOIC 1RIPA 4O2DA 5IE8A 1GO3E 3CCLA 4X6AH 1T9HA 2PMZE 1E22A 2N78A 4YWLA 4DR1Q 1YITA 4KHZA 1TWHH 4JI7L 2IX1A 3MEFA 3TEHB 4BY7H 4DR2L 2OTJA 5M3FH 1X65A 1YBYA 1UWVA 4LF4Q 1GD7A 1B70B 1HR0W 1J6QA 1ASYA 4JYAL 3F8TA 1SLJA 1NE3A 1BVSA 5LMNW 1CKMA 2C35B 4DPGA 3MXNB 4JI1Q 2ZM6Q 4AQYL 1HNZL 2E2JH 1FJGL 3PSIA 4Y52H 1CKNB 3TQYA 1I50H 2OQ0A 1HR0L 3M4OH 2UXCL 1P8LA 1PFSA 3PUVA 1PH2A 4JV5Q 4IFDJ 5C0XI 3CMAA 2KBNA 3F2BA 5C4XH 1H95A 4ME3A 4A76A 4YWKA 1V9PA 1B7YB 2K5HA 3D31A 1B8AA 2K14A 4DV2L 1UE1A 2JA5G 2UUCQ 3EN2A 2ZJPA 1I6HH 4DR5Q 4B3RQ 5M5XH 5JJLA 2K52A 1MJEA 1A8VA 3J7ZC 1N33Q 4AYBG 3VDYA 1IXRA 3D0FA 1JJCB 5K36G 1EIFA 1Q46A 2NVYH 1HZ9A 5IWAL 3HOUH 1MJCA 2Z6KA 1VQOA 4UP8A 1Y1WH 1WCMG 2E8GA 5H1SE 3A74A 3NENA 3PUXA 3I55A 4AIMA 4A3EH 1N32L 2JA6G 2EQSA 5GQOA 2D0OA 2R7ZH 4PG3A 4NXMQ 4JI7Q 1YJNA 1KIXA 2FXQA 4JI6L 4TQUS 1TWGH 3GDEA 1TXYA 3AFQA 1QUQA 1WOCA 3GO5A 3F1ZA 4BY1G 4BBRH 5FJ8G 4ALPA 4A3DH 4H02A 2CFMA 4DUYQ 1GKHA 4GKKL 2L15A 1LM0A 4WJ3M 2DGYA 1X3EA 4A3KG 3S1QH 2EXDA 2UXDL 1YI2A 1JT8A 3A5UA 4AQYQ 1HNZQ 1FJGQ 4EQ5A 3E9HA 1EFWA 4WJ4A 4DV5L 2VW9A 1VQIA 3FKIH 1HR0Q 2UXCQ 1XMOL 1K73C 1VCIA 4GN5A 3KF8B 3BZKA 1WJJA 1X9NA 3CAMA 1W3SA 1SFOH 1PH6A 3GTPH 2CWAA 2HQLA 2R6GA 2KCMA 5GAGC 2NVXH 5JJKA 4IPCA 2LXKA 4LUZA 1Q1BA 1QUQB 5HGQA 4A75A 4DV2Q 3EIVA 1I5FA 1U0LA 2HHHL 1RL2A 4A3BH 3I4MG 1OXTA 4R4TA 5GROA 4DKAC 3HOYG 2VNUD 1KRTA 2BA1A 4RG1A 1VS0A 1Y14B 4QGUA 3E9IA 2N8NA 4P73A 2QA4A 5IWAQ 3KJPA 1PH4A 3CC2A 2UXBL 3A0JA 3J80c 1UE7A 3Q8DA 3CPFA 1Z47A 1JB7A 4L5SA 4A3LG 1N32Q 2E2IH 1NY4A 1G51A 4OXPA 1JMCA 1SE8A 1FVIA 4LFAL 1KD1C 4HIKA 4IPGA 5IYBH 5BR8L 1XMQL 1WI5A 3AFPA 3K7AH 4QIWE 4BA2I 1TWAH 4DK6C 1KXLA 3PF4A 3AQQA 5C0XJ 2HIVA 1CKOA 4OO1G 3L7ZC 4A93G 5IYCG 3RZDH 3K7UC 2VY3A 4GLVB 4DUZL 4DR3L 3LGJA 1VQKA 4GKKQ 1CSPA 3A5ZB 4C3IH 4A3IG 4P74A 3T1HL 1QZGA 1OXSC 2PQAA 1WYDA 3H3VH 2UXDQ 1YJWA 2B63G 3BZCA 5C44G 3H0GH 4GN4B 3STBD 1VQLA 4DV5Q 4A3FG 1R9TH 1ASZA 3BJUA 1VQ8A 4IOAA 1XMOQ 2R92G 2MQHA 4HJ7A 4A3JG 2IX0A 3G48A 1BKBA 1YHAA 1G6PA 3CC4A 1VQGA 1N34L 3DLLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OXX K;  3RZO H;  3HOX G;  2HHH Q;  4JI4 L;  4DR5 L;  4JI2 L;  4C3H H;  4GOP A;  3F2D A;  2CCZ A;  3GTJ H;  2IT1 A;  3S15 H;  1A63 A;  2JJQ A;  4OX9 L;  4UY8 C;  2PQA B;  4DNI A;  3OW2 A;  3BU2 A;  1K9M C;  3U4Z A;  3S2D H;  3GTO H;  4BXX H;  2CKZ B;  1C0A A;  4APV A;  3DM3 A;  1PV4 A;  4DV4 L;  4YWM A;  3L2P A;  1Q81 C;  4X62 L;  1PHJ A;  2D62 A;  3CW2 C;  1G29 1;  1Y1V H;  2QGQ A;  1XTD A;  4LFA Q;  2JA8 G;  3S1R H;  1PH8 A;  3M4Q A;  3H15 A;  5BR8 Q;  2R7D A;  1XMQ Q;  4NXM L;  3HOW G;  2A19 A;  2ZTE A;  3K8A A;  3CC7 A;  4GNX B;  4HIO A;  1VQJ A;  2HIX A;  4GOP B;  1VQ6 A;  4X65 L;  3W5O A;  1VQE A;  3RN2 A;  3ERS X;  3ULP A;  2E5L L;  4DUY L;  4DV3 L;  2JEA I;  4HJA A;  4DUZ Q;  4DR3 Q;  1PH5 A;  1JJ2 A;  1EYG A;  2E2H H;  4LFB L;  1BBW A;  3GD7 A;  4BY7 G;  3J80 i;  5FLM H;  3T1H Q;  5M3F G;  3J7A 5;  3E0E A;  4P75 A;  3L0O A;  3B6Y A;  1E1O A;  1C9O A;  4JI3 L;  3I56 A;  4AYB E;  4X66 L;  2JA7 H;  2AHO B;  3CCS A;  1Q1E A;  1EWI A;  2R7F A;  4XTC S;  4JI5 L;  1P16 A;  4DAM A;  3GTK H;  3S1M H;  1N34 Q;  2JE6 I;  3CCJ A;  2K4K A;  2YYZ A;  3AEV A;  2VUM H;  3PUW A;  4P72 A;  3WWV A;  2ES2 A;  4DR7 L;  3ULJ A;  4JI4 Q;  2BH2 A;  4JI2 Q;  2BH8 A;  1QZH A;  4B3M L;  1Q8K A;  1DGS A;  5C4X G;  1HNX L;  4OX9 Q;  3K81 C;  1UE6 A;  4OWT B;  4HIM A;  3RLO A;  3EBE A;  2NVT H;  1X54 A;  4C3J H;  2WAQ G;  2D0P A;  1VQ7 A;  2I5H A;  2ATW A;  1AE2 A;  2MNA A;  4DV4 Q;  4POG A;  1YHQ A;  1I3Q H;  2H5X A;  3GTQ H;  4A4I A;  1VQ4 A;  5IYD H;  2ZTC A;  4TVA B;  4X62 Q;  1EQR A;  3G4S A;  3HOU G;  1Y1W G;  2AWO A;  3M7N A;  1NMF A;  4OON A;  3PO2 H;  3TRE A;  2I5M X;  4DV0 L;  4X65 Q;  4A3E G;  1HZC A;  1YZ6 A;  1Q86 C;  2E5L Q;  4C2M H;  2ID0 A;  4JI0 L;  2VL6 A;  4O0A A;  3RLN A;  2JEB I;  4DV3 Q;  1E1T A;  2GVA A;  1V43 A;  2B3G A;  2VQE L;  2R7Z G;  4LFB Q;  4PZ6 A;  4DAY B;  2R93 H;  1L1O C;  3J81 j;  3UDF A;  3CXC A;  4QJF A;  3JAM c;  4A3D G;  4BBR G;  3OTO L;  3HOZ H;  1K3R A;  3M3Y H;  1QVC A;  3CD6 A;  4JI3 Q;  2I0Q A;  4X66 Q;  1VQP A;  3G71 A;  1L0W A;  1XPO A;  2WB1 G;  2K5V A;  5C3E H;  5LMU Q;  2Q2U A;  4JI5 Q;  3I4O A;  4JI8 L;  1YNX A;  1YVC A;  3UDI A;  4JOI A;  3FKI G;  2VQF L;  1NJI C;  4A3G H;  1X56 A;  2PNH A;  4DR7 Q;  3TS0 A;  3S2H H;  4PZ8 A;  4IPH A;  5IP9 H;  4L5R C;  4B3M Q;  1OXU A;  2Z0S A;  1X6O A;  3U58 A;  1HNX Q;  4LF6 Q;  2WP8 J;  2YTX A;  1NMG A;  1SR3 A;  4YHH Q;  4A3B G;  1VQH A;  2N49 A;  3CCR A;  2YU9 H;  1PA6 A;  4GLX A;  1EIY B;  1KL9 A;  4JBW A;  2V1C C;  4MNO A;  2NN6 I;  4HJ8 A;  4JBJ A;  4JBK A;  3HOV H;  1HJP A;  1JJG A;  1PH9 A;  2KEN A;  4HID A;  1FGU A;  2GN5 A;  2YTY A;  5IP7 H;  3NEM A;  5HY6 A;  2CWP A;  3FP9 A;  4DV0 Q;  1W2B A;  1S40 A;  1AH9 A;  3RR5 A;  1Q7Y C;  3M85 A;  4JI0 Q;  4DR6 L;  1J5E L;  3CP0 A;  2VQE Q;  5IYB G;  4UPA A;  3UDX A;  3S16 H;  3I4N H;  2IY5 B;  4B3S Q;  3OTO Q;  2ZJR A;  3M9B A;  4LF5 L;  3FHW A;  3PCO B;  2VZA A;  3JC6 6;  4MZ9 A;  1EQQ A;  3CCQ A;  1QVG A;  1PH7 A;  1Z9F A;  3H0G G;  3CPW A;  3HFZ B;  4JI8 Q;  1D8L A;  1VQN A;  3G6E A;  2VQF Q;  3TRZ A;  2GVB A;  4A3C G;  2KHJ A;  1XPR A;  4OWX B;  4IJL A;  4OWW B;  1A0I A;  2Y0S G;  4YCU A;  3U50 C;  3JAM i;  3PF5 A;  2Q2I A;  4GLA C;  1KRS A;  5M3M H;  2ZTD A;  3PO3 H;  2RHS B;  1IZ6 A;  1Q82 C;  3UE1 A;  4LF9 L;  4GS3 A;  3PIP A;  4DV6 L;  2AWN A;  4A3M H;  3HKZ G;  4AH6 A;  1PVO A;  4JBM A;  1HH2 P;  2NZO A;  1OTC A;  2K50 A;  4BXX G;  5ELO A;  3NBH B;  4NB3 A;  3PGZ A;  3KYH C;  1YHB A;  3H3V I;  4BBS H;  1U5K A;  1K0R A;  2LXJ A;  3OYY A;  3U4V A;  1YIJ A;  1I94 L;  2UUB L;  2ZJQ A;  1XNQ L;  1XNR L;  1Y1V G;  3UDG A;  1KC8 C;  1AE3 A;  3IRB A;  1J5E Q;  4DR6 Q;  2F3I A;  3PUZ A;  2OCE A;  2HT1 A;  3CCU A;  2A8V A;  4Y7N H;  4DR4 L;  4LW1 A;  4IO9 A;  4LF8 L;  5ELN A;  2UU9 L;  2JK8 A;  4LF5 Q;  3UE0 A;  5JEA G;  1KQS A;  5FLM G;  5LMU L;  4IJH A;  4PMW A;  3CCV A;  2WAQ E;  1PYS B;  1K83 H;  1LYL A;  1CSQ A;  5E7N A;  2JA7 G;  4L5T A;  3NEL A;  1YJ9 A;  2MO0 A;  1LUZ A;  1N36 L;  1K8A C;  4LF6 L;  5JJI A;  2VUM G;  3J81 c;  2YTV A;  4LUO A;  4RMF A;  4YHH L;  1HZA A;  2DUD A;  4DV1 L;  4LF9 Q;  4DV6 Q;  4GKJ L;  2JA5 H;  3KLW A;  2Q2H A;  4POF A;  1LTL A;  4B3T L;  1VQ9 A;  5LMN L;  1BBU A;  2K75 A;  1KAW A;  1IBL L;  3KF6 A;  2PI2 E;  4IPD A;  4X64 Q;  4YCV A;  2YV5 A;  1UEB A;  4NXN L;  3ER0 A;  2K5N A;  5IYD G;  1I94 Q;  2UUB Q;  1XNQ Q;  3T1Y L;  1WFQ A;  4DK3 C;  1IBM L;  1XNR Q;  1WCM H;  2WB1 E;  4UP9 A;  4FDB A;  1FL0 A;  1E24 A;  2ALY B;  2KHI A;  3S1N H;  1YEZ A;  5FLX c;  2JA6 H;  3PO2 G;  1SMX A;  1HZB A;  4JG2 A;  1IBK L;  1C7Y A;  2NN6 G;  4DR4 Q;  4GN3 B;  4LF8 Q;  4B3S L;  2F4V L;  1UE5 A;  1X3G A;  3SGI A;  2QEX A;  2UU9 Q;  4KHP L;  3STB C;  1V1Q A;  1PH1 A;  2R93 G;  4BY1 H;  2KCT A;  1EOV A;  3KF6 B;  5FJ8 H;  1VQA A;  4LNQ A;  3CQZ H;  4GNX C;  4L5Q A;  4LF7 L;  1MIU A;  5GAH C;  4HJ9 A;  4GOP C;  1VQC A;  5IT9 c;  3CCM A;  3K0X A;  4KLK A;  3HOZ G;  2VS1 A;  3KFU A;  1PYB A;  4A3K H;  3GTM H;  4DR2 Q;  2A1A A;  2PI2 A;  3KOJ A;  1N9W A;  3KJO A;  4IFD G;  5DLQ E;  4JCV E;  2NZH A;  2IHE A;  5C3E G;  2B29 A;  4JYA Q;  3PIO A;  1MKH A;  2ASB A;  1EUJ A;  2JQO A;  1N36 Q;  1NTG A;  4A3G G;  2EIF A;  5IP9 G;  3ULL A;  1Q12 A;  2MO1 A;  2XTI A;  3K80 C;  4DV1 Q;  3PUY A;  1X3F A;  4R4C A;  1OXV A;  4GKJ Q;  3I4M H;  3S17 H;  2UUA L;  4PZ7 A;  3W1B A;  4B3T Q;  2AKW B;  5LMN Q;  4QQB X;  3HOY H;  1HNW L;  1IBL Q;  4LWC A;  4IOC A;  4LFC L;  3KDF A;  4XIG S;  2MFI A;  4R1J A;  4NXN Q;  2AMC B;  3GTG H;  3HOV G;  2OTL A;  4NPS A;  3TS2 A;  3T1Y Q;  4DV7 L;  1IBM Q;  5AJ3 L;  4BA1 I;  3J81 i;  2RCN A;  4UP7 A;  4A3L H;  4IFD I;  3M4P A;  2RF4 A;  4J15 A;  1VQD A;  5IP7 G;  1IBK Q;  4LUV A;  2F52 A;  2JA9 A;  3I2Z A;  2F4V Q;  3PV0 A;  1TWF H;  1SRU A;  4R4O A;  4YCW A;  1PH3 A;  4K0K L;  1VQB A;  1M1K C;  1JE5 A;  2Y0S E;  4YY3 L;  3W1G A;  3RNU A;  4R4Q A;  4EX5 A;  4KHP Q;  3AYH B;  3I7F A;  3GTL H;  3I4N G;  4A93 H;  1A62 A;  1VQF A;  3KDF B;  3S24 A;  1E7Z A;  4P71 A;  5IYC H;  4LF7 Q;  1D7Q A;  1L2F A;  4DR1 L;  2CQO A;  2XGT A;  4A3I H;  1GM5 A;  5GAD C;  4QL5 A;  4JI6 Q;  4LF4 L;  1NBW A;  3HKZ E;  2B63 H;  5C44 H;  2Z6K C;  1SN8 A;  4R4I A;  5JEA J;  1S3O A;  4A3F H;  2NVQ H;  3S14 H;  2OQK A;  2RHQ B;  1KHI A;  5M5Y H;  2R92 H;  4A3J H;  3HKS A;  5GAE C;  1K8G A;  1S72 A;  4MTN A;  5M5W H;  3ICE A;  4JI1 L;  2ZM6 L;  4KI0 A;  2N3S A;  2IHF A;  1L1O A;  3ZJY C;  3HOX H;  1N8R C;  1M90 C;  3CCE A;  1XPU A;  4A3C H;  4JV5 L;  1IYJ B;  2WFW A;  2LSS A;  1VQM A;  1E3P A;  2UUA Q;  1HNW Q;  1VQ5 A;  5M3M G;  3PO3 G;  4X64 L;  4LFC Q;  1CUK A;  1GVP A;  2UUC L;  2Q2T A;  5IY0 A;  4A3M G;  1O7I A;  1TWC H;  4B3R L;  1X55 A;  3CME A;  4JC0 A;  4GNX A;  1QVF A;  2I5L X;  4DV7 Q;  5AJ3 Q;  1N33 L;  1IL2 A;  3RN5 A;  1SRO A;  4OO1 I;  3F2C A;  2OWO A;  1XJV A;  4BBS G;  2JA8 H;  5J3B A;  4HJ5 A;  3CF5 A;  4QY7 A;  5C0X G;  2UXB Q;  1L1O B;  3HOW H;  5C4J H;  4K0K Q;  3RLF A;  2BA0 A;  5EAY A;  4YY3 Q;  1CKN A;  4JOI C;  1RIP A;  4O2D A;  5IE8 A;  1GO3 E;  3CCL A;  4X6A H;  1T9H A;  2PMZ E;  1E22 A;  2N78 A;  4YWL A;  4DR1 Q;  1YIT A;  4KHZ A;  1TWH H;  4JI7 L;  2IX1 A;  3MEF A;  3TEH B;  4BY7 H;  4DR2 L;  2OTJ A;  5M3F H;  1X65 A;  1YBY A;  1UWV A;  4LF4 Q;  1GD7 A;  1B70 B;  1HR0 W;  1J6Q A;  1ASY A;  4JYA L;  3F8T A;  1SLJ A;  1NE3 A;  1BVS A;  5LMN W;  1CKM A;  2C35 B;  4DPG A;  3MXN B;  4JI1 Q;  2ZM6 Q;  4AQY L;  1HNZ L;  2E2J H;  1FJG L;  3PSI A;  4Y52 H;  1CKN B;  3TQY A;  1I50 H;  2OQ0 A;  1HR0 L;  3M4O H;  2UXC L;  1P8L A;  1PFS A;  3PUV A;  1PH2 A;  4JV5 Q;  4IFD J;  5C0X I;  3CMA A;  2KBN A;  3F2B A;  5C4X H;  1H95 A;  4ME3 A;  4A76 A;  4YWK A;  1V9P A;  1B7Y B;  2K5H A;  3D31 A;  1B8A A;  2K14 A;  4DV2 L;  1UE1 A;  2JA5 G;  2UUC Q;  3EN2 A;  2ZJP A;  1I6H H;  4DR5 Q;  4B3R Q;  5M5X H;  5JJL A;  2K52 A;  1MJE A;  1A8V A;  3J7Z C;  1N33 Q;  4AYB G;  3VDY A;  1IXR A;  3D0F A;  1JJC B;  5K36 G;  1EIF A;  1Q46 A;  2NVY H;  1HZ9 A;  5IWA L;  3HOU H;  1MJC A;  2Z6K A;  1VQO A;  4UP8 A;  1Y1W H;  1WCM G;  2E8G A;  5H1S E;  3A74 A;  3NEN A;  3PUX A;  3I55 A;  4AIM A;  4A3E H;  1N32 L;  2JA6 G;  2EQS A;  5GQO A;  2D0O A;  2R7Z H;  4PG3 A;  4NXM Q;  4JI7 Q;  1YJN A;  1KIX A;  2FXQ A;  4JI6 L;  4TQU S;  1TWG H;  3GDE A;  1TXY A;  3AFQ A;  1QUQ A;  1WOC A;  3GO5 A;  3F1Z A;  4BY1 G;  4BBR H;  5FJ8 G;  4ALP A;  4A3D H;  4H02 A;  2CFM A;  4DUY Q;  1GKH A;  4GKK L;  2L15 A;  1LM0 A;  4WJ3 M;  2DGY A;  1X3E A;  4A3K G;  3S1Q H;  2EXD A;  2UXD L;  1YI2 A;  1JT8 A;  3A5U A;  4AQY Q;  1HNZ Q;  1FJG Q;  4EQ5 A;  3E9H A;  1EFW A;  4WJ4 A;  4DV5 L;  2VW9 A;  1VQI A;  3FKI H;  1HR0 Q;  2UXC Q;  1XMO L;  1K73 C;  1VCI A;  4GN5 A;  3KF8 B;  3BZK A;  1WJJ A;  1X9N A;  3CAM A;  1W3S A;  1SFO H;  1PH6 A;  3GTP H;  2CWA A;  2HQL A;  2R6G A;  2KCM A;  5GAG C;  2NVX H;  5JJK A;  4IPC A;  2LXK A;  4LUZ A;  1Q1B A;  1QUQ B;  5HGQ A;  4A75 A;  4DV2 Q;  3EIV A;  1I5F A;  1U0L A;  2HHH L;  1RL2 A;  4A3B H;  3I4M G;  1OXT A;  4R4T A;  5GRO A;  4DKA C;  3HOY G;  2VNU D;  1KRT A;  2BA1 A;  4RG1 A;  1VS0 A;  1Y14 B;  4QGU A;  3E9I A;  2N8N A;  4P73 A;  2QA4 A;  5IWA Q;  3KJP A;  1PH4 A;  3CC2 A;  2UXB L;  3A0J A;  3J80 c;  1UE7 A;  3Q8D A;  3CPF A;  1Z47 A;  1JB7 A;  4L5S A;  4A3L G;  1N32 Q;  2E2I H;  1NY4 A;  1G51 A;  4OXP A;  1JMC A;  1SE8 A;  1FVI A;  4LFA L;  1KD1 C;  4HIK A;  4IPG A;  5IYB H;  5BR8 L;  1XMQ L;  1WI5 A;  3AFP A;  3K7A H;  4QIW E;  4BA2 I;  1TWA H;  4DK6 C;  1KXL A;  3PF4 A;  3AQQ A;  5C0X J;  2HIV A;  1CKO A;  4OO1 G;  3L7Z C;  4A93 G;  5IYC G;  3RZD H;  3K7U C;  2VY3 A;  4GLV B;  4DUZ L;  4DR3 L;  3LGJ A;  1VQK A;  4GKK Q;  1CSP A;  3A5Z B;  4C3I H;  4A3I G;  4P74 A;  3T1H L;  1QZG A;  1OXS C;  2PQA A;  1WYD A;  3H3V H;  2UXD Q;  1YJW A;  2B63 G;  3BZC A;  5C44 G;  3H0G H;  4GN4 B;  3STB D;  1VQL A;  4DV5 Q;  4A3F G;  1R9T H;  1ASZ A;  3BJU A;  1VQ8 A;  4IOA A;  1XMO Q;  2R92 G;  2MQH A;  4HJ7 A;  4A3J G;  2IX0 A;  3G48 A;  1BKB A;  1YHA A;  1G6P A;  3CC4 A;  1VQG A;  1N34 L;  3DLL A; 
#chains in the Genus database with same CATH topology
 3DWQ A;  2HHH Q;  3F2U A;  4DR5 L;  2EYL A;  1CK1 A;  1K0S A;  3I4N B;  1II3 A;  1HXY D;  3BU2 A;  3U4Z A;  3S2D H;  3MC0 B;  4BXX H;  3VR2 A;  2K03 A;  1LAC A;  2TSS A;  1PHJ A;  2D62 A;  1Y1V H;  2A6H D;  2JA8 G;  2L9H A;  1PH8 A;  2PZW A;  5DAU A;  1HUN A;  1V1P B;  1LTS D;  4QIW B;  2LFN A;  5ELE A;  3W5O A;  4PQX A;  5JEA H;  1JJ2 A;  3HEJ A;  1BBW A;  1ENA A;  3GD7 A;  1SYF A;  2ICI A;  4A3M B;  3E0E A;  4QUF A;  1BQQ T;  3QR8 A;  4JI3 L;  2JA7 H;  1TR5 A;  2KEE A;  4JI5 L;  4DAM A;  1I6V C;  4ZKC B;  1GUN A;  1QOH A;  1I4X A;  2RCF A;  3X3N A;  1ENF A;  1UNS A;  2KVM A;  4JI2 Q;  5C4X G;  3FVQ A;  2V4D A;  3K81 C;  1UE6 A;  4HIM A;  3MFY A;  2D2C C;  5G3L D;  2D0P A;  5CV8 A;  1YHQ A;  1I3Q H;  5M9O A;  1K83 B;  1U4L A;  3G4S A;  2WII B;  3M7N A;  2PMZ B;  3MFG A;  4X65 Q;  1HZC A;  2E5L Q;  1PTO B;  3RUZ A;  1V43 A;  2B3G A;  5DNF A;  3K5O A;  4PZ6 A;  2R93 H;  1L1O C;  2MGS A;  1B1Z A;  4QUC A;  1DJR D;  1VMC A;  2NWG A;  1O7Z A;  1NCV A;  3N6R A;  1GHJ A;  3NTI A;  5LMU Q;  2EYH A;  3H09 A;  1RCV D;  3I4O A;  1YNX A;  1NJI C;  2PNH A;  4PZ8 A;  5IP9 H;  2JA6 B;  1OXU A;  5EPK A;  4H13 C;  4LF6 Q;  1PMR A;  1HTP A;  4M8A A;  4YHH Q;  2N49 A;  3CQZ B;  4IUV A;  3SK5 A;  2NUC A;  1HJP A;  1B53 A;  1S40 A;  5HY6 A;  4DV0 Q;  3LWE A;  2GA4 B;  3TP6 A;  1Q7Y C;  4JI0 Q;  4DR6 L;  2AQ3 B;  3CP0 A;  5EPL A;  3I4N H;  3S17 B;  3M9B A;  1LLR D;  1BCP F;  2FHT A;  1PLF A;  1ESF A;  1L0X B;  2A74 C;  3GTG B;  1PH7 A;  3H0G G;  4JI8 Q;  1SXT A;  3FRP B;  3NBH A;  2VQF Q;  4J8Q A;  4FF3 A;  1RTO A;  1XPR A;  4OWX B;  4HCS A;  2ZXO A;  2J7Z A;  3IL8 A;  1A0I A;  5DEH A;  1JR0 D;  1GOZ A;  2F0I A;  4DXG A;  3JAM i;  5EQ0 A;  1F9P A;  2SEB D;  5M3M H;  2ZTD A;  4C3H G;  1JWM D;  4DV6 L;  4A3M H;  1PVO A;  4AH6 A;  2BDO A;  2K50 A;  5ELO A;  3NBH B;  3PGZ A;  3BG3 A;  2EY2 A;  1SNP A;  3H3V I;  4A3F B;  2LXJ A;  3U4V A;  1I94 L;  1YIJ A;  1XNQ L;  5C0X H;  1XNR L;  1CQF A;  4HMJ A;  5M5W B;  1J5E Q;  1C48 A;  2HT1 A;  4CKB A;  1QG7 A;  2A8V A;  3QO2 A;  4ZRZ A;  3URY A;  4IO9 A;  1MGS A;  1FNW A;  3C46 A;  4TKO B;  2K1B A;  3QOJ A;  4E6I A;  1WD0 A;  4PMW A;  1SNM A;  1K83 H;  1CSQ A;  5KRU A;  2F0J A;  1STH A;  2JA8 B;  2VUM G;  1PTO H;  1CFM A;  5J1Z A;  1Z7T A;  4LF9 Q;  3OIQ A;  4R9W A;  2L0C A;  2B2V A;  3J81 L;  3NSW A;  2BOS A;  3K6O A;  4X64 Q;  5EKI A;  4FF2 A;  5I2Y A;  1KLG D;  3ER0 A;  2JXM B;  2QKI C;  1XXG A;  1EYD A;  1HHV A;  3J80 E;  1YEZ A;  2JA6 H;  1PRT D;  1SNQ A;  2AQ2 B;  4IUN A;  1SMX A;  1IBK L;  4DR4 Q;  5KEE A;  2QEX A;  1EFI D;  4KV6 A;  1PH1 A;  4LNQ A;  1JQY D;  2KCT A;  5FLX L;  1VQA A;  3CQZ H;  1MIU A;  3A8I E;  2R3Z A;  1VQC A;  4HJ9 A;  3NPP A;  5IT9 c;  3CCM A;  4XYQ A;  1PYB A;  1HFN A;  1LTI D;  4OIJ A;  4G7Z C;  4KMU C;  4JW0 A;  3KJO A;  2IHE A;  1JWU D;  2WAC A;  4CJ2 C;  2C5C A;  2N55 A;  3RMH A;  1Q12 A;  3PUY A;  1BUV T;  1X3F A;  4R4C A;  3S17 H;  3W1B A;  1WTP A;  4B08 A;  1IKL A;  1SSO A;  1KDB A;  2MFI A;  4NXN Q;  3GTG H;  3TZU A;  4NPS A;  3TS2 A;  5K5P A;  1Y69 U;  2RCN A;  1X32 A;  3QWN A;  2NBF A;  1WD1 A;  2RF4 A;  5IP7 G;  4LUV A;  4CKC A;  2F4V Q;  5JVG 3;  1DOL A;  1BXT A;  5JPN C;  3HOY B;  4KHP Q;  4R4Q A;  4R8I A;  4A93 H;  3S24 A;  5IYC H;  4P71 A;  1D7Q A;  4QL5 A;  4HSP A;  4LF4 L;  2Z6K C;  4A3F H;  2Z8L A;  1KHI A;  2M2L A;  1K8G A;  4MTN A;  5M5W H;  3ICE A;  2ZM6 L;  4RH6 A;  3TP7 A;  2IHF A;  4A3C H;  4JV5 L;  2WFW A;  3BZD B;  3K7A B;  1E3P A;  2DJF C;  1VQM A;  2J4X A;  3PO3 G;  1K8M A;  1X55 A;  4GNX A;  2I5L X;  1A2T A;  5AJ3 Q;  1E2V A;  1SRO A;  3H0G B;  4FO2 A;  4CDF C;  4OO1 I;  2OWO A;  2JA8 H;  1PTO F;  3CF5 A;  1SYC A;  2F4I A;  3LNN A;  2L5T A;  4DA2 A;  4K0K Q;  4O2D A;  4RAU C;  5IE8 A;  1B44 D;  3RZO B;  2IX1 A;  2N78 A;  1YIT A;  4K5W A;  4KHZ A;  4C3H B;  1YBY A;  1UWV A;  4JYA L;  4N9T A;  1CKM A;  1DXM A;  4AQY L;  2ZT9 C;  3PSI A;  5E4W C;  2OQ0 A;  2ZXR A;  2UXC L;  1AFP A;  3PUV A;  1C4Q A;  3BYT B;  5C0X I;  4KD3 A;  5C4X H;  1DCZ A;  3BVM A;  2AUJ D;  1WTH A;  2K5H A;  3D31 A;  1B8A A;  1UE1 A;  3EN2 A;  4DR5 Q;  1ROD A;  4B3R Q;  2KA7 A;  3J7Z C;  4HCE A;  1MI2 A;  2FIN B;  1IXR A;  2KEC A;  2NVY H;  3FPP A;  3M4O B;  1MJC A;  3I55 A;  4AIM A;  1B50 A;  1GUG A;  2EQS A;  2VUM B;  3NUC A;  3ND8 A;  5GQO A;  2O5I C;  1MD2 D;  4JI7 Q;  2EDG A;  2FXQ A;  1QE6 A;  1TXY A;  1X3Q A;  3HZX A;  1WOC A;  4BY1 G;  3H6M A;  1YNN C;  1GKH A;  5FK9 C;  4YIJ A;  1I4P A;  1Q90 A;  4A3K G;  3P7J A;  1YI2 A;  1EFW A;  2SOB A;  4WJ4 A;  4DV5 L;  1ET9 A;  4ZYS A;  2R7Z B;  2A69 C;  1PH6 A;  2CWA A;  2N88 A;  1QNU A;  2R6G A;  5I6W A;  4WOR A;  4PNY A;  3DWP A;  4IPC A;  4LUZ A;  1GUS A;  1TII D;  3EIV A;  3QIA A;  1I5F A;  1U0L A;  1RL2 A;  4PMB A;  3W3A A;  4IAL A;  2VNU D;  4ZUI A;  4QGU A;  5IWA Q;  1PFN A;  2CQA A;  1UE7 A;  3M7G A;  1JB7 A;  1STG A;  1QB5 D;  4RCN A;  1EEI D;  1NY4 A;  3NK9 A;  1D5X C;  1FVI A;  2Z1C A;  4LFA L;  5BR8 L;  3OOC A;  3K7A H;  5C5L A;  2DNE A;  2XWJ B;  1SYB A;  1AW7 A;  1WTX A;  2HIV A;  1DM0 B;  4OO1 G;  3L7Z C;  2VY3 A;  1CSP A;  3A5Z B;  3E6Z X;  5KIX A;  1QZG A;  2HDL A;  4ODG A;  5C44 G;  3H0G H;  2B2V C;  1GXD C;  2O2L D;  4IOA A;  3S9W A;  3OMG A;  4HED A;  1YHA A;  1G2T A;  3CC4 A;  5BN4 A;  2F1M A;  1OXX K;  3RZO H;  3O13 A;  4C3H H;  4GOP A;  3S16 B;  2BDN A;  2BCO A;  4UY8 C;  4DNI A;  3OW2 A;  4K5V A;  1SAP A;  2EY5 A;  3DM3 A;  4X3T A;  1D1K A;  2CH4 A;  2A69 D;  3L2P A;  1Q81 C;  3H15 A;  3C2P A;  1E2Z A;  3K8A A;  1DD2 A;  1VQJ A;  2MP1 A;  4GOP B;  1VQ6 A;  2PZU A;  1TKW B;  5ELD A;  3RN2 A;  3ERS X;  1RD9 D;  3MHB A;  4DV3 L;  1M4V A;  1H9S B;  4DR3 Q;  1IW7 C;  1XYI A;  1PH5 A;  1BCP B;  3T1H Q;  3NP8 A;  4K2K A;  4P75 A;  5BN5 A;  3B6Y A;  1E1O A;  1C9O A;  1TS2 A;  1Y1V B;  1KAB A;  4X66 L;  5C6A A;  1Q1E A;  2LKV A;  2LS0 1;  3GV3 A;  1MBY A;  1N34 Q;  4NMZ A;  2VUM H;  1EYC A;  3PUW A;  2ES2 A;  3WWV A;  2IPK D;  4JI4 Q;  2C9O A;  1JOQ A;  2BH8 A;  1QZH A;  3CRL C;  4ME5 A;  4OX9 Q;  3RLO A;  2NVT H;  2B2W C;  1VQ7 A;  2WAQ G;  2ATW A;  2I5H A;  2K28 A;  4DV4 Q;  4POG A;  1RDP D;  1H9J A;  1F9R A;  1TQO A;  2KCC A;  1R4P B;  4TVA B;  4X62 Q;  5IOC A;  3ERQ A;  1EQR A;  4OEL B;  1QIL A;  1NMF A;  4OON A;  4EGV A;  1GUO A;  3A7A B;  3CRK C;  3K59 A;  2VL6 A;  1E1T A;  2GVA A;  3CU7 A;  4LFB Q;  1PDQ A;  1S5E D;  2F0N A;  3UDF A;  3DUZ A;  4RHR A;  3CXC A;  1UAP A;  3JAM c;  1BNZ A;  2JSO A;  3OTO L;  1QVC A;  3CD6 A;  4FVM A;  3K5L A;  3G71 A;  1EYA A;  5LL6 S;  1XPO A;  2KUM A;  1CZG A;  1DOM A;  2K5V A;  4NKL A;  1G6Z A;  2IW3 A;  2RKS A;  1YVC A;  3UDI A;  1EY0 A;  1X56 A;  4DR7 Q;  3SK8 A;  1CT1 D;  1SE3 A;  4B3M Q;  1HNX Q;  3H91 A;  2RSO A;  1NMG A;  1SR3 A;  2YTX A;  1SDF A;  3GP7 A;  4KY6 A;  4DN4 M;  3P20 A;  4ILW A;  3ERO A;  4CDD C;  1KL9 A;  4JBK A;  1F9Q A;  1PH9 A;  4OGQ C;  4A3K B;  2HD3 A;  1H9M A;  3G6J B;  3EJI A;  1LTT D;  5IP7 H;  2K32 A;  3DM1 A;  5FO7 B;  2VQE Q;  5IYB G;  1CM9 A;  1KNE A;  2B2U A;  3S16 H;  2DN8 A;  2F0M A;  1JB3 A;  3SDZ A;  2IY5 B;  4LF5 L;  3PCO B;  1EQQ A;  2XVS A;  4C3I G;  3K57 A;  4XQN A;  3R2T A;  3CCQ A;  3BVZ A;  1VQN A;  1D8L A;  2BE5 C;  4A3C G;  1ZXT A;  3KBG A;  2Z6B A;  4RCO A;  4OWW B;  2XSC A;  4CJ1 B;  3U50 C;  4GLA C;  1KRS A;  1YNJ D;  2B2T C;  3PO3 H;  1Q82 C;  3T13 A;  3MXU A;  3PIP A;  1TY2 A;  1A2U A;  1K8O A;  1FR3 A;  2F0H A;  2NYZ D;  4IUT A;  2P5Z X;  3E0J A;  1D6E C;  4RA8 A;  2EXZ A;  1A3T A;  2ZJQ A;  1B3A A;  2E2D C;  2RSN A;  2F3I A;  3PUZ A;  2OCE A;  3TBI B;  5M3M B;  4ZQ3 A;  4TSS A;  4LW1 A;  4LF8 L;  2UU9 L;  1CHQ D;  3UE0 A;  3I8Z A;  2CH4 W;  5ELF A;  1WVL A;  3RD4 A;  2F0L A;  3CCV A;  2WAQ E;  3VYS A;  1SBB B;  1PYS B;  5ELB A;  2F0F A;  5G3L F;  4L5T A;  3NEL A;  4IUP A;  3JAM E;  2MO0 A;  1N36 L;  1LT6 D;  2RVL A;  2O4X A;  2YTV A;  3I73 A;  2X6G A;  1W6K A;  2WIN B;  2RDH A;  2RDG A;  2E75 C;  1WTW A;  1LTL A;  4B3T L;  4C3J G;  1KAW A;  3KF6 A;  2PI2 E;  3FPU B;  1UEB A;  3U9S A;  3H3V C;  2K5N A;  3A8J E;  2UUB Q;  1FYC A;  1IBM L;  2ALY B;  3KLS A;  4H44 C;  2E2J B;  4DK0 A;  5KNC A;  1Z6H A;  1HZB A;  3HGB A;  4UHV A;  1X3G A;  1W6J A;  2CW0 C;  3K58 A;  1ONL A;  1V1Q A;  2F0K A;  4BY1 H;  1EOV A;  3KF6 B;  4GOP C;  5GAH C;  2K33 A;  2M00 A;  3K0X A;  3HOZ G;  4A3K H;  2PI2 A;  1EY8 A;  4IFD G;  5DLQ E;  1BCP C;  2B8G A;  4IN3 A;  1VF7 A;  4QMG A;  5CC4 A;  5C3E G;  4JYA Q;  3PIO A;  1MKH A;  3R2I A;  1H9K A;  5IT9 L;  1LV9 A;  2A68 C;  1S4Z A;  2EIF A;  1AZP A;  4FP5 D;  3ULL A;  3D8G A;  4DV1 Q;  2G9D A;  4OHJ A;  4GKJ Q;  2FMM A;  2UUA L;  2AKW B;  5LMN Q;  4QQB X;  1HNW L;  4Q5V A;  2F0U A;  1IBL Q;  3C1F A;  1Y8N B;  3IKJ A;  3KDF A;  1SYG A;  1JIC A;  5KGU A;  2OTL A;  3T1Y Q;  4DV7 L;  3T51 B;  4FYD A;  2EVB A;  1QCB D;  4YCW A;  4R4O A;  2PQE A;  1VQB A;  3G7L A;  1JE5 A;  1M1K C;  3W1G A;  3AYH B;  4OO1 H;  3C1E A;  1A62 A;  3KDF B;  4LF7 Q;  3VYT A;  1L2F A;  2CQO A;  2XGT A;  3BDL A;  1M8A A;  1GM5 A;  1NBW A;  2I46 A;  5C44 H;  4R4I A;  1S3O A;  3Q23 A;  2OQK A;  4PV1 C;  3HKS A;  3K5M A;  2CW0 D;  4JI1 L;  2N3S A;  1S5B D;  4A93 B;  3SVM A;  3ZJY C;  1LTA D;  2HQE A;  1H9R A;  3LWU A;  4IQZ A;  4LFC Q;  1SMY C;  1SJE D;  1GVP A;  2UUC L;  5IY0 A;  1O7I A;  1QVF A;  3CME A;  4JC0 A;  4C3I B;  3T16 A;  1EIH A;  1ZYR C;  2A68 D;  4B9X A;  1STA A;  4G4K A;  5T1G A;  4HR7 B;  3K5N A;  5I6Y A;  1RF2 D;  4PMC A;  4BBS G;  5J3B A;  5C4J H;  3Q22 A;  2MPM A;  4YY3 Q;  1O7L A;  3ND9 A;  1RIP A;  3CCL A;  2X6L A;  2L55 A;  1E22 A;  4DR1 Q;  1NSN S;  4KY5 A;  3TEH B;  4DR2 L;  4B9W A;  1WTO A;  2FFK B;  5COY A;  1GD7 A;  1J6Q A;  2Q8R E;  2R61 A;  1A3V A;  5LMN W;  4H0L C;  2C35 B;  5D3D A;  3SHL A;  3HG9 A;  2E2J H;  2F3W A;  4Y52 H;  1HR0 L;  4RKL A;  1P8L A;  3R3O A;  2EJF C;  4IFD J;  3V05 A;  3F2B A;  2XIW A;  3WOE A;  1V9P A;  5IGC A;  3BVG A;  1PRT F;  2K14 A;  2JA5 G;  2F0T A;  2KQ3 A;  1A8V A;  3A8K E;  4IUR A;  1N33 Q;  4AYB G;  1Q46 A;  1HZ9 A;  1F2Z A;  1HRJ A;  1E0B A;  1DZ1 A;  4UP8 A;  5J39 A;  3GTK B;  4XYO A;  5C4X B;  3S1M B;  1J8I A;  3VYU A;  3HS0 C;  1YJN A;  4KN4 C;  4JI6 L;  5FJ8 G;  4ALP A;  4H02 A;  2NVY B;  4GKK L;  4C3J B;  2L11 A;  5I4D A;  1LM0 A;  1FGB D;  1X3E A;  2DGY A;  3U9O A;  1JT8 A;  1HNZ Q;  1FJG Q;  4EQ5 A;  1XWE A;  1VQI A;  1XMO L;  1VCI A;  1LT5 D;  3BZK A;  3CAM A;  5JJK A;  2HQL A;  5D14 A;  2LXK A;  1Q1B A;  4DV2 Q;  1TVX A;  2HHH L;  1JOK A;  2SDF A;  4K6D A;  4R4T A;  5GRO A;  4DKA C;  3KUP A;  1KRT A;  2BA1 A;  2QA4 A;  3E9I A;  4P73 A;  3HOZ B;  3KJP A;  1IKM A;  2EYF A;  2AUK A;  2UXB L;  3A0J A;  3SR1 A;  1PFM A;  1Z47 A;  4L5S A;  4A3L G;  1N32 Q;  1SE8 A;  5IIF A;  4HIK A;  5IYB H;  2HCI A;  3NTK A;  1WI5 A;  2Q8T A;  5EBC A;  1PTO C;  1JCK B;  3KLS X;  1Q3L A;  1DOK A;  2B39 A;  3WOF A;  3TME A;  1VQK A;  4K8J A;  3AU7 A;  4C3I H;  1EWH A;  1GUW A;  4A3I G;  4P74 A;  1ZKO A;  3ITP A;  1OXS C;  2PQA A;  1WYD A;  2UXD Q;  2B63 G;  4KHV A;  1LTR D;  2NZ1 D;  5FOB B;  5F2D A;  5CV4 A;  1LTG D;  4KK7 A;  4O42 A;  3DLL A;  1R4Q B;  5JJZ A;  3HOX G;  1WTQ A;  4JI2 L;  1ZEQ X;  2CCZ A;  2IT1 A;  4EQN A;  5IGF A;  2PQA B;  2AQ1 B;  3D4W A;  1F2M A;  1K9M C;  2EYP A;  1VMP A;  4CDE C;  1PV4 A;  2A73 B;  2EJM A;  4YWM A;  4UAI A;  2EY1 A;  1VF5 C;  3CW2 C;  1XTD A;  2QEJ C;  3M4Q A;  4HMI A;  1XMQ Q;  3HOW G;  2A19 A;  2ZTE A;  4GNX B;  2HIX A;  4X65 L;  3P1H A;  2E5L L;  2DJG C;  4DUY L;  3OHX C;  2F0O A;  2JEA I;  4HJA A;  4DUZ Q;  1EYG A;  2E2H H;  3J80 i;  3AMU A;  5M3F G;  3J7A 5;  3L0O A;  5IT9 E;  1DYQ A;  4AYB E;  2PO4 A;  3CCS A;  5ISR A;  1S5D D;  2K05 A;  3GTK H;  1PTO D;  4BBS B;  3S1M H;  5IGG A;  3BS1 A;  3CCJ A;  1PYW D;  3ULJ A;  4NW2 A;  3FEW X;  1DGS A;  1KNA A;  3D3R A;  5CBA E;  1X54 A;  4C3J H;  1O7Y A;  4LJZ C;  5C4Z A;  3A7L A;  3GTQ H;  1VQ4 A;  1HPC A;  1D2B A;  5LHY 1;  3HOU G;  1B9N A;  2AWO A;  3EA6 A;  2XWB B;  4MHE A;  4OEM B;  2I5M X;  4DV0 L;  4A3E G;  3NTH A;  1YZ6 A;  4JI0 L;  5E1F A;  3RLN A;  2JEB I;  2PCF B;  2KED A;  2NVT B;  1A6X A;  2LY7 A;  3J81 j;  1KAA A;  2D5D A;  2B8F A;  4QJF A;  4A3D G;  4BBR G;  1VDZ A;  3HOZ H;  5DM7 3;  1K3R A;  1BOS A;  4JI3 Q;  3GQB A;  4AYB B;  1VQP A;  4IFD H;  3KK7 A;  1L0W A;  2WB1 G;  5C3E H;  5EKK A;  4JI5 Q;  3KLR A;  4JI8 L;  3JAM L;  1RTN A;  2VQF L;  3FKI G;  4DXF A;  2DNC A;  4IPH A;  2Z0S A;  1X6O A;  1QNK A;  2WP8 J;  3MXG A;  2Q8I B;  3K0Y A;  4A3B G;  1VQH A;  3CCR A;  2YU9 H;  2EOT A;  1EIY B;  2A5H A;  2V1C C;  4HJ8 A;  2NN6 I;  4JBJ A;  1D5M C;  1JJG A;  4HID A;  2F0P A;  2GN5 A;  3PIP 3;  4KN7 C;  3Q0A A;  3NEM A;  2CWP A;  1NUC A;  3M85 A;  1J5E L;  2CVR A;  2K6A A;  3UDX A;  2O5J C;  1JWS D;  1KDA A;  2DY8 A;  2ZJR A;  3JC6 6;  4DGZ A;  3MA2 B;  5KYL A;  2TMP A;  1QVG A;  1O78 A;  3HFZ B;  4Z9C B;  1YNN D;  2HUG A;  4IJL A;  4C1N I;  3IFD A;  2Y0S G;  1TWF B;  3P75 A;  1ICF B;  2ENB A;  1IZ6 A;  2G9H D;  3UE1 A;  4LF9 L;  1Y8P B;  4GS3 A;  1IYV A;  1G8Z D;  2B2Y A;  4JBM A;  1HH2 P;  4A3I B;  2NZO A;  1OTC A;  5CV9 A;  2K5W A;  2B63 B;  4J6H A;  4CHT B;  5I9O A;  2NVQ B;  4BBS H;  3OYY A;  5NUC A;  5K36 G;  3UDG A;  3CHB D;  1AE3 A;  2PYK A;  3IRB A;  1KC8 C;  3NWS A;  4DR6 Q;  4F7X A;  3ONA B;  1IL8 A;  3CCU A;  3PO3 B;  1NNX A;  4QCL A;  4DR4 L;  3HOX B;  2EY6 A;  2JK8 A;  3VA7 A;  3BDO A;  2F0S A;  4FF1 A;  5FLM G;  3MZ5 A;  4BWG B;  2E74 C;  1TWC B;  2HDM A;  1LYL A;  4WRD A;  5E7N A;  2NTS A;  1CA5 A;  1YJ9 A;  1K8A C;  3HOW B;  4RMF A;  5CV7 A;  1HZA A;  5IOD A;  3PIO 3;  4DV6 Q;  2JA5 H;  3OW7 A;  3A56 A;  1BBU A;  4M1U B;  2K75 A;  4L8J A;  5M3F B;  4YCV A;  1PXU A;  4NXN L;  4RGM A;  1HA5 A;  5IYD G;  1I94 Q;  1IYU A;  5CR3 A;  1XNQ Q;  1XNR Q;  4DK3 C;  1Q8I A;  2WB1 E;  4XDX A;  4ZUJ A;  2XN9 C;  3PO2 G;  1I4R A;  2PW7 A;  3J7A V;  4JG2 A;  1C7Y A;  2NN6 G;  2WV6 D;  4B3S L;  2F4V L;  1UE5 A;  2F0D A;  3E3X A;  3STB C;  5FO8 B;  2OT2 A;  4KHP L;  5CV5 A;  5FJ8 H;  4GNX C;  1T5E A;  4L5Q A;  1I6H B;  5D3I B;  4CKE A;  3KFU A;  4Q0F A;  3T53 B;  3GTM H;  1L0Y B;  2SNM A;  4N8F A;  2A1A A;  5CGK A;  4DR2 Q;  3KOJ A;  1N9W A;  3A54 A;  1IW7 D;  4RGO S;  2ASB A;  1EUJ A;  2JQO A;  4MN3 A;  3SK6 A;  4A3G G;  4HTH A;  1XTC D;  4A3E B;  4XT3 B;  4ULL A;  4DAP A;  3K80 C;  4BY1 B;  5HUR A;  1OXV A;  1PRT B;  3IFT A;  4PZ7 A;  2RQX A;  4ZCK A;  5TSS A;  4FF4 A;  4LWC A;  1LTB D;  4A3D B;  4R1J A;  5EPJ A;  2AMC B;  3VR3 A;  3MAQ A;  3HOV G;  4OL7 A;  3NHH A;  5AJ3 L;  1BR9 A;  2E76 C;  4DK1 A;  3J81 i;  3VA5 A;  4A3L H;  1F9S A;  4IFD I;  3M4P A;  2WKD A;  3D4D A;  4K8I A;  1IBK Q;  1VQD A;  3FKI B;  3NE5 B;  5JAV A;  3I2Z A;  1SFO B;  3PV0 A;  1TWF H;  3GTP B;  4K0K L;  2Y0S E;  3RNU A;  2NVX B;  4EX5 A;  3GTL H;  1GJX A;  1EY6 A;  1VQF A;  1E7Z A;  4XXE A;  4A3B B;  2VB2 X;  4A3I H;  4JI6 Q;  5FKA C;  2B63 H;  1ENC A;  1SN8 A;  2NVQ H;  1HTL D;  2RHQ B;  5M5Y H;  1HQR D;  5HGT A;  4EVO A;  1S72 A;  1EZ6 A;  2F0Q A;  1EY4 A;  2DY7 A;  4C1N K;  2E2I B;  1EOT A;  3OWF A;  3HOX H;  1N8R C;  1XPU A;  1IYJ B;  2LSS A;  1TWA B;  1VQ5 A;  4G7H C;  5CV6 A;  1CUK A;  5C44 B;  1LO5 D;  1RKN A;  3RZD B;  3H94 A;  1V1P A;  2Q2T A;  5CYU A;  1TWC H;  4B3R L;  2FJ2 A;  2Z4H A;  1IL2 A;  1CA6 A;  1TT2 A;  4HSV A;  3RN5 A;  1EEF D;  3UI2 A;  4ZLT F;  4HJ5 A;  4QY7 A;  2UXB Q;  3HOW H;  2BA0 A;  5EAY A;  3J7A F;  2Y0S B;  5ELC A;  1GO3 E;  4CJ0 B;  3SE0 A;  1T9H A;  2PMZ E;  4YWL A;  4JI7 L;  5EBD A;  3MEF A;  1F2Y A;  3GTJ B;  3S15 B;  1CI3 M;  5M3F H;  4LF4 Q;  1BBX C;  3MXP A;  1HR0 W;  1ASY A;  5JPM C;  3GTO B;  3F8T A;  4XQJ A;  1BVS A;  1U9R A;  1SNC A;  3EQL C;  5C4J B;  4DPG A;  2ZM6 Q;  1EY5 A;  4O1N A;  5EGT A;  3TQY A;  1MSH A;  1I50 H;  3S1R B;  4JV5 Q;  3CMA A;  2KBN A;  2QW7 A;  2BE5 D;  4YWK A;  1B7Y B;  1I6H H;  5M5X H;  2K52 A;  1TY0 A;  1AP0 A;  2F0G A;  4WJW A;  2F0E A;  1K28 A;  3NXW A;  2EJG C;  2XRQ D;  3VDY A;  3D0F A;  4J1M A;  3SK4 A;  5IGB A;  1EIF A;  3HP3 A;  5IWA L;  3HOU H;  4GZY C;  2Z6K A;  3I90 A;  1BO0 A;  1WCM G;  2E8G A;  3A74 A;  3PUX A;  4RKB A;  3X3M A;  4A3E H;  1AEX A;  1X3P A;  4PG3 A;  4NDX A;  2WAQ B;  2MUY A;  4TQU S;  3GDE A;  4RGN A;  3AFQ A;  1QUQ A;  4A3D H;  3F1Z A;  4BBR H;  2CFM A;  4DUY Q;  3IAY A;  2L15 A;  1KDC A;  4NP5 A;  3I72 A;  2B2Y C;  3S1Q H;  3A5U A;  4AQY Q;  4FXK C;  5J22 A;  2PPB C;  3PQI A;  2VW9 A;  3FKI H;  2UXC Q;  5C4H A;  1K73 C;  4GN5 A;  1SFO H;  1WJJ A;  2JYO A;  3GTP H;  1W3S A;  1TS4 A;  3PO2 B;  5GAG C;  2KCM A;  2NVX H;  4R8N A;  1QUQ B;  4C2M B;  4A75 A;  1HQM C;  4A3B H;  3I4M G;  4K6L A;  4CBV A;  3N52 A;  2Z9H A;  3HOY G;  1EY9 A;  4LK1 C;  4RG1 A;  1VS0 A;  1Y14 B;  3M3Y B;  3FDT A;  1PH4 A;  5JOB A;  1S5F D;  3CC2 A;  3J80 c;  1CHP D;  1ML0 D;  3Q8D A;  4ID6 A;  5C3W A;  5KYI A;  2E2I H;  1JMC A;  4OXP A;  4A3G B;  1NR2 A;  3S2H B;  1TWA H;  3TP8 A;  1DON A;  4C56 C;  1CKO A;  3RZD H;  3K7U C;  1CTM A;  4GLV B;  4DR3 L;  3WDN A;  4BS9 A;  3T1H L;  4UDU C;  1YJW A;  3BZC A;  3HOV B;  1JE4 A;  4DV5 Q;  1ASZ A;  1VQ8 A;  2ZXP A;  2R92 G;  4HJ7 A;  4U67 3;  4A3J G;  1AZQ A;  1PZJ D;  3G48 A;  1STE A;  2OEO A;  3MTS A;  5EJW A;  1VQG A;  4XQQ A;  4I7A A;  1N34 L;  4CGY B;  1BCP D;  3E5S A;  4JI4 L;  1RJT A;  3F2D A;  3GTJ H;  3S15 H;  1A63 A;  2JJQ A;  2LMC B;  2PNR C;  4OX9 L;  3GTO H;  2K01 A;  2CKZ B;  4L63 B;  4APV A;  1PRT C;  1C0A A;  4DV4 L;  5K36 H;  1FNU A;  3VR4 A;  3R93 A;  4X62 L;  1G29 1;  2FMC A;  1B9M A;  2QGQ A;  1STN A;  4LFA Q;  3S1R H;  4KKS A;  5BR8 Q;  2K5D A;  2R7D A;  4NXM L;  3CC7 A;  4HIO A;  1SYD A;  1FD7 D;  1TS3 A;  1VQE A;  2NTT A;  2CHB D;  3W2D A;  3ULP A;  4LFB L;  5LL6 X;  4BY7 G;  1A3U A;  5FLM H;  3TDQ A;  3Q24 A;  1SE2 A;  3I56 A;  4DFA A;  1SEB D;  2AHO B;  4F87 A;  4KJN A;  1LAB A;  1EWI A;  4RHS A;  2R7F A;  4XTC S;  1P16 A;  2RDF A;  3DWA A;  1F2L A;  1EL0 A;  2JE6 I;  3AEV A;  2K4K A;  2PW5 A;  2YYZ A;  5T1I A;  4P72 A;  2B2U C;  3I4L A;  4DR7 L;  1IHZ A;  2D9U A;  4XT1 B;  2BH2 A;  2E2H B;  5E4X A;  4B3M L;  1F77 A;  1Q8K A;  1STY A;  4Y7N B;  1HNX L;  4OWT B;  5I2X A;  1KTK A;  3EBE A;  4DAY A;  1AE2 A;  2MNA A;  5A2Q L;  2H5X A;  4A4I A;  1V1O A;  2H4O A;  2ZTC A;  5IYD H;  1MHW C;  2VB3 X;  1SMY D;  1Y8O B;  2KCN A;  4S3S A;  1Y1W G;  2NB0 A;  3PO2 H;  1ZYR D;  3TRE A;  3TP5 A;  2NN6 H;  1Q86 C;  4C2M H;  2ID0 A;  4O0A A;  4DV3 Q;  4L6T B;  2VQE L;  2R7Z G;  4TRD A;  4DAY B;  3GTQ B;  1LT3 D;  4F88 A;  5KNB A;  3M3Y H;  2I0Q A;  1AN8 A;  4X66 Q;  4IUQ A;  2Q2U A;  2OF1 A;  4JOI A;  4A3G H;  1WCM B;  3TS0 A;  3S2H H;  1UEA B;  4X3S A;  3S1N B;  4L5R C;  1JOO A;  3U58 A;  1KLU D;  1A15 A;  3QOL A;  2RBM A;  4JVZ A;  1C8C A;  1K3B C;  2KJX A;  2K5Q A;  1PA6 A;  4GLX A;  5C3E B;  1JOR A;  4MNO A;  4JBW A;  3HOV H;  4RGT A;  3T56 B;  1EU4 A;  3D6W A;  5E3F A;  5JVH 3;  4DNR B;  2KEN A;  1FGU A;  4N8X 1;  2YTY A;  3MEH A;  3FP9 A;  1AH9 A;  1W2B A;  3RR5 A;  2EYO A;  3QJY A;  2YU9 B;  4UPA A;  2IJ0 A;  4B3S Q;  3OTO Q;  3I4M B;  2K04 A;  3FHW A;  4MZ9 A;  2VZA A;  2B2W A;  3KBX A;  4DNT B;  4HN7 A;  1Z9F A;  3CPW A;  4I65 A;  3G6E A;  3TRZ A;  2GVB A;  2KHJ A;  2XRS D;  3NWT A;  1EZ8 A;  4IUU A;  5A35 A;  4I7Z C;  4MIU A;  4YCU A;  3PF5 A;  2Q2I A;  1V8Q A;  3D6C A;  2KOL A;  1XX8 A;  2RHS B;  3SEB A;  2Z4I A;  3V2T A;  2AWN A;  3HKZ G;  1ILP A;  1EY7 A;  1TS5 A;  2PZT A;  4BXX G;  4NB3 A;  3PMF A;  3KYH C;  1G91 A;  1LT4 D;  1YHB A;  3S14 B;  1U5K A;  1K0R A;  2SNS A;  1SE4 A;  3D4R A;  1PFB A;  2UUB L;  2R92 B;  4A3J B;  1Y1V G;  2EYM A;  4Y7N H;  3NQT A;  5ELN A;  4X3U A;  4LMQ D;  4LF5 Q;  5JEA G;  4MTK A;  3OIP A;  1KQS A;  1NR4 A;  5LMU L;  4IJH A;  3BYY B;  2JA7 G;  1B3Q A;  1ESR A;  1LUZ A;  2G5D A;  4LF6 L;  5JJI A;  5COR A;  4FXG C;  1EQT A;  3J81 c;  4KKU A;  4LUO A;  4YHH L;  2DUD A;  4CDC C;  4DAV A;  4DV1 L;  1U4P A;  4X3K A;  4GKJ L;  3KLW A;  1FNV A;  5AFW A;  1SND A;  2JP1 A;  2Q2H A;  4POF A;  1U4R A;  1HUM A;  1TWH B;  1D1I A;  2WKC A;  5LMN L;  1VQ9 A;  4BY7 B;  3LX0 A;  1SYE A;  1IBL L;  4IPD A;  1UUP A;  2YV5 A;  4FNF A;  3TSS A;  4P2C B;  1WFQ A;  3T1Y L;  1WCM H;  2X69 A;  4UP9 A;  4FDB A;  1FL0 A;  1E24 A;  2KHI A;  3CKI B;  2L4N A;  5FLX c;  3S1N H;  1EWC A;  2JA5 B;  1ET6 A;  3NBI A;  4GN3 B;  4LF8 Q;  4G7O C;  2UU9 Q;  3SGI A;  2R93 G;  2B2T A;  1E2W A;  4LF7 L;  1HCZ A;  4KKT A;  1GUT A;  4KLK A;  2VS1 A;  4IZ8 A;  1JC7 A;  4JCV E;  2NZH A;  3M4Y A;  2B29 A;  3DMU A;  3J7Y W;  1N36 Q;  5C3X A;  2I07 B;  1Y1W B;  1NTG A;  1I4G A;  2EYJ A;  3L9A X;  5IP9 G;  1GHK A;  2MO1 A;  1CQV A;  2XTI A;  3I4M H;  4B3T Q;  3I70 A;  3HOY H;  3GTM B;  1TWG B;  4IOC A;  4LFC L;  2EPB A;  4XIG S;  4JK1 C;  1J9O A;  3T4A C;  4DF7 A;  1IBM Q;  4BA1 I;  4UP7 A;  2VXW A;  3L3O C;  4KJO A;  4J15 A;  3TZD A;  2F52 A;  2JA9 A;  2K7V A;  1SRU A;  1PH3 A;  4YY3 L;  4EQO A;  1STB A;  3I7F A;  3I4N G;  3DEP A;  4DR1 L;  5C5M A;  4KTA A;  2ICE C;  5GAD C;  3HKZ E;  4QF4 A;  3AB9 A;  5JEA J;  3V96 A;  3S14 H;  1SNO A;  3VYR A;  5CBE E;  2R92 H;  4A3J H;  4N9P A;  5GAE C;  4QB4 A;  3DHQ A;  3Q6S A;  2HCC A;  4KI0 A;  3GTL B;  1L1O A;  2MJ8 A;  1M90 C;  3CCE A;  1RHP A;  1WTV A;  1EU3 A;  1EQV A;  3OPO A;  2UUA Q;  1BDO A;  1HNW Q;  5A2Q E;  5D65 A;  5M3M G;  4X64 L;  1QJO A;  1I4Q A;  4A3M G;  2EE1 A;  4WFN 3;  3J81 E;  5M5Y B;  4DV7 Q;  2OXP A;  1N33 L;  1CZW A;  1H9S A;  3F2C A;  1XJV A;  2RA4 A;  1R9T B;  1B4O A;  1EIG A;  5C0X G;  1L1O B;  3MXN A;  3RLF A;  2QF7 A;  4V0B A;  1CKN A;  4JOI C;  4FXD A;  5IGD A;  1SJH D;  4X6A H;  3VR5 A;  1O80 A;  1TWH H;  2QIL A;  4BY7 H;  5FLX E;  2OTJ A;  1X65 A;  2MHV A;  4ABN A;  5BN3 A;  3HKZ B;  1B70 B;  3VR6 A;  3S2D B;  1SLJ A;  1NE3 A;  1I4H A;  3DEO A;  3QG1 A;  3MXN B;  1MSG A;  4JI1 Q;  3SXH A;  3OWE B;  5I9P A;  1HNZ L;  1FJG L;  4JPB W;  1CKN B;  3M4O H;  1PFS A;  1PH2 A;  1PZK D;  3I3C A;  3HRZ C;  5FO9 B;  5CMD A;  4LAA A;  2A6E C;  3EVQ A;  1H95 A;  2L1B A;  4ME3 A;  4A76 A;  3FMC A;  4OIK A;  4DU9 A;  1NAP A;  4DV2 L;  2UUC Q;  2ZJP A;  5JJL A;  2IL8 A;  1MJE A;  2M9V A;  1JJC B;  1I50 B;  4ZK9 B;  1OO9 B;  1VQO A;  2JA7 B;  1Y1W H;  5H1S E;  1QWY A;  3NEN A;  3EFX D;  3TN2 A;  2F03 A;  2JA6 G;  1N32 L;  4RWS C;  1HFG A;  4K14 A;  4U68 A;  1TU2 B;  3KF8 A;  2D0O A;  2R7Z H;  1ILQ A;  4NXM Q;  5KND A;  5M5X B;  4KD4 A;  1KIX A;  4K2L A;  2H1E A;  1TWG H;  2J0T D;  3A55 A;  5IGE A;  3GO5 A;  2F0W A;  3HOU B;  3GV6 A;  3ZYY X;  4WJ3 M;  2L12 A;  2JN4 A;  3C3L A;  3R8B A;  2EXD A;  2UXD L;  1I3Q B;  4ZAI A;  5EKL A;  4G57 A;  3E9H A;  1HR0 Q;  1YNJ C;  3OMC A;  4K5X A;  3KF8 B;  1X9N A;  3BDC A;  3QB3 A;  1B2T A;  1PZI D;  1T5X D;  2IX3 A;  1S5C D;  2EZV A;  2QDB A;  4V19 0;  2A6H C;  4BBR B;  5HGQ A;  3OSO A;  1G2S A;  1OXT A;  2R93 B;  2QDL A;  3S1Q B;  2WB1 B;  3MVV A;  2N8N A;  5DM6 3;  4RFB A;  3CPF A;  2A6E D;  2XNA C;  1G51 A;  1U4M A;  4HAE A;  2F0V A;  1KD1 C;  4IPG A;  3NQI A;  1XMQ L;  3AFP A;  4QIW E;  4BA2 I;  3J80 L;  4DK6 C;  1KXL A;  3PF4 A;  3AQQ A;  1WTR A;  4EQP A;  5C0X J;  1BF4 A;  4A93 G;  5IYC G;  1ICW A;  3DXJ C;  4DUZ L;  4F8M A;  3LGJ A;  4GKK Q;  1HA6 A;  4H7B A;  2IWH A;  3H3V H;  4ZKB B;  2F3V A;  4GN4 B;  2QCP X;  3STB D;  1VQL A;  4A3F G;  3I91 A;  1R9T H;  3BJU A;  5L37 A;  1XMO Q;  2MQH A;  2IX0 A;  4KY7 A;  1BKB A;  1G6P A;  2KHS A;  3MWY W;  1D5Z C; 
#chains in the Genus database with same CATH homology
 1OXX K;  3RZO H;  3HOX G;  2HHH Q;  4JI4 L;  4DR5 L;  4JI2 L;  4C3H H;  4GOP A;  3F2D A;  2CCZ A;  3GTJ H;  2IT1 A;  3S15 H;  1A63 A;  2JJQ A;  4OX9 L;  4UY8 C;  2PQA B;  4DNI A;  3OW2 A;  3BU2 A;  1K9M C;  3U4Z A;  3S2D H;  3GTO H;  4BXX H;  2CKZ B;  1C0A A;  4APV A;  3DM3 A;  1PV4 A;  4DV4 L;  4YWM A;  3L2P A;  1Q81 C;  4X62 L;  1PHJ A;  2D62 A;  3CW2 C;  1G29 1;  1Y1V H;  2QGQ A;  1XTD A;  4LFA Q;  2JA8 G;  3S1R H;  1PH8 A;  3M4Q A;  3H15 A;  5BR8 Q;  2R7D A;  1XMQ Q;  4NXM L;  3HOW G;  2A19 A;  2ZTE A;  3K8A A;  3CC7 A;  4GNX B;  4HIO A;  1VQJ A;  2HIX A;  4GOP B;  1VQ6 A;  4X65 L;  3W5O A;  1VQE A;  3RN2 A;  3ERS X;  3ULP A;  2E5L L;  4DUY L;  4DV3 L;  2JEA I;  4HJA A;  4DUZ Q;  4DR3 Q;  1PH5 A;  1JJ2 A;  1EYG A;  2E2H H;  4LFB L;  1BBW A;  3GD7 A;  4BY7 G;  3J80 i;  5FLM H;  3T1H Q;  5M3F G;  3J7A 5;  3E0E A;  4P75 A;  3L0O A;  3B6Y A;  1E1O A;  1C9O A;  4JI3 L;  3I56 A;  4AYB E;  4X66 L;  2JA7 H;  2AHO B;  3CCS A;  1Q1E A;  1EWI A;  2R7F A;  4XTC S;  4JI5 L;  1P16 A;  4DAM A;  3GTK H;  3S1M H;  1N34 Q;  2JE6 I;  3CCJ A;  2K4K A;  2YYZ A;  3AEV A;  2VUM H;  3PUW A;  4P72 A;  3WWV A;  2ES2 A;  4DR7 L;  3ULJ A;  4JI4 Q;  2BH2 A;  4JI2 Q;  2BH8 A;  1QZH A;  4B3M L;  1Q8K A;  1DGS A;  5C4X G;  1HNX L;  4OX9 Q;  3K81 C;  1UE6 A;  4OWT B;  4HIM A;  3RLO A;  3EBE A;  2NVT H;  1X54 A;  4C3J H;  2WAQ G;  2D0P A;  1VQ7 A;  2I5H A;  2ATW A;  1AE2 A;  2MNA A;  4DV4 Q;  4POG A;  1YHQ A;  1I3Q H;  2H5X A;  3GTQ H;  4A4I A;  1VQ4 A;  5IYD H;  2ZTC A;  4TVA B;  4X62 Q;  1EQR A;  3G4S A;  3HOU G;  1Y1W G;  2AWO A;  3M7N A;  1NMF A;  4OON A;  3PO2 H;  3TRE A;  2I5M X;  4DV0 L;  4X65 Q;  4A3E G;  1HZC A;  1YZ6 A;  1Q86 C;  2E5L Q;  4C2M H;  2ID0 A;  4JI0 L;  2VL6 A;  4O0A A;  3RLN A;  2JEB I;  4DV3 Q;  1E1T A;  2GVA A;  1V43 A;  2B3G A;  2VQE L;  2R7Z G;  4LFB Q;  4PZ6 A;  4DAY B;  2R93 H;  1L1O C;  3J81 j;  3UDF A;  3CXC A;  4QJF A;  3JAM c;  4A3D G;  4BBR G;  3OTO L;  3HOZ H;  1K3R A;  3M3Y H;  1QVC A;  3CD6 A;  4JI3 Q;  2I0Q A;  4X66 Q;  1VQP A;  3G71 A;  1L0W A;  1XPO A;  2WB1 G;  2K5V A;  5C3E H;  5LMU Q;  2Q2U A;  4JI5 Q;  3I4O A;  4JI8 L;  1YNX A;  1YVC A;  3UDI A;  4JOI A;  3FKI G;  2VQF L;  1NJI C;  4A3G H;  1X56 A;  2PNH A;  4DR7 Q;  3TS0 A;  3S2H H;  4PZ8 A;  4IPH A;  5IP9 H;  4L5R C;  4B3M Q;  1OXU A;  2Z0S A;  1X6O A;  3U58 A;  1HNX Q;  4LF6 Q;  2WP8 J;  2YTX A;  1NMG A;  1SR3 A;  4YHH Q;  4A3B G;  1VQH A;  2N49 A;  3CCR A;  2YU9 H;  1PA6 A;  4GLX A;  1EIY B;  1KL9 A;  4JBW A;  2V1C C;  4MNO A;  2NN6 I;  4HJ8 A;  4JBJ A;  4JBK A;  3HOV H;  1HJP A;  1JJG A;  1PH9 A;  2KEN A;  4HID A;  1FGU A;  2GN5 A;  2YTY A;  5IP7 H;  3NEM A;  5HY6 A;  2CWP A;  3FP9 A;  4DV0 Q;  1W2B A;  1S40 A;  1AH9 A;  3RR5 A;  1Q7Y C;  3M85 A;  4JI0 Q;  4DR6 L;  1J5E L;  3CP0 A;  2VQE Q;  5IYB G;  4UPA A;  3UDX A;  3S16 H;  3I4N H;  2IY5 B;  4B3S Q;  3OTO Q;  2ZJR A;  3M9B A;  4LF5 L;  3FHW A;  3PCO B;  2VZA A;  3JC6 6;  4MZ9 A;  1EQQ A;  3CCQ A;  1QVG A;  1PH7 A;  1Z9F A;  3H0G G;  3CPW A;  3HFZ B;  4JI8 Q;  1D8L A;  1VQN A;  3G6E A;  2VQF Q;  3TRZ A;  2GVB A;  4A3C G;  2KHJ A;  1XPR A;  4OWX B;  4IJL A;  4OWW B;  1A0I A;  2Y0S G;  4YCU A;  3U50 C;  3JAM i;  3PF5 A;  2Q2I A;  4GLA C;  1KRS A;  5M3M H;  2ZTD A;  3PO3 H;  2RHS B;  1IZ6 A;  1Q82 C;  3UE1 A;  4LF9 L;  4GS3 A;  3PIP A;  4DV6 L;  2AWN A;  4A3M H;  3HKZ G;  4AH6 A;  1PVO A;  4JBM A;  1HH2 P;  2NZO A;  1OTC A;  2K50 A;  4BXX G;  5ELO A;  3NBH B;  4NB3 A;  3PGZ A;  3KYH C;  1YHB A;  3H3V I;  4BBS H;  1U5K A;  1K0R A;  2LXJ A;  3OYY A;  3U4V A;  1YIJ A;  1I94 L;  2UUB L;  2ZJQ A;  1XNQ L;  1XNR L;  1Y1V G;  3UDG A;  1KC8 C;  1AE3 A;  3IRB A;  1J5E Q;  4DR6 Q;  2F3I A;  3PUZ A;  2OCE A;  2HT1 A;  3CCU A;  2A8V A;  4Y7N H;  4DR4 L;  4LW1 A;  4IO9 A;  4LF8 L;  5ELN A;  2UU9 L;  2JK8 A;  4LF5 Q;  3UE0 A;  5JEA G;  1KQS A;  5FLM G;  5LMU L;  4IJH A;  4PMW A;  3CCV A;  2WAQ E;  1PYS B;  1K83 H;  1LYL A;  1CSQ A;  5E7N A;  2JA7 G;  4L5T A;  3NEL A;  1YJ9 A;  2MO0 A;  1LUZ A;  1N36 L;  1K8A C;  4LF6 L;  5JJI A;  2VUM G;  3J81 c;  2YTV A;  4LUO A;  4RMF A;  4YHH L;  1HZA A;  2DUD A;  4DV1 L;  4LF9 Q;  4DV6 Q;  4GKJ L;  2JA5 H;  3KLW A;  2Q2H A;  4POF A;  1LTL A;  4B3T L;  1VQ9 A;  5LMN L;  1BBU A;  2K75 A;  1KAW A;  1IBL L;  3KF6 A;  2PI2 E;  4IPD A;  4X64 Q;  4YCV A;  2YV5 A;  1UEB A;  4NXN L;  3ER0 A;  2K5N A;  5IYD G;  1I94 Q;  2UUB Q;  1XNQ Q;  3T1Y L;  1WFQ A;  4DK3 C;  1IBM L;  1XNR Q;  1WCM H;  2WB1 E;  4UP9 A;  4FDB A;  1FL0 A;  1E24 A;  2ALY B;  2KHI A;  3S1N H;  1YEZ A;  5FLX c;  2JA6 H;  3PO2 G;  1SMX A;  1HZB A;  4JG2 A;  1IBK L;  1C7Y A;  2NN6 G;  4DR4 Q;  4GN3 B;  4LF8 Q;  4B3S L;  2F4V L;  1UE5 A;  1X3G A;  3SGI A;  2QEX A;  2UU9 Q;  4KHP L;  3STB C;  1V1Q A;  1PH1 A;  2R93 G;  4BY1 H;  2KCT A;  1EOV A;  3KF6 B;  5FJ8 H;  1VQA A;  4LNQ A;  3CQZ H;  4GNX C;  4L5Q A;  4LF7 L;  1MIU A;  5GAH C;  4HJ9 A;  4GOP C;  1VQC A;  5IT9 c;  3CCM A;  3K0X A;  4KLK A;  3HOZ G;  2VS1 A;  3KFU A;  1PYB A;  4A3K H;  3GTM H;  4DR2 Q;  2A1A A;  2PI2 A;  3KOJ A;  1N9W A;  3KJO A;  4IFD G;  5DLQ E;  4JCV E;  2NZH A;  2IHE A;  5C3E G;  2B29 A;  4JYA Q;  3PIO A;  1MKH A;  2ASB A;  1EUJ A;  2JQO A;  1N36 Q;  1NTG A;  4A3G G;  2EIF A;  5IP9 G;  3ULL A;  1Q12 A;  2MO1 A;  2XTI A;  3K80 C;  4DV1 Q;  3PUY A;  1X3F A;  4R4C A;  1OXV A;  4GKJ Q;  3I4M H;  3S17 H;  2UUA L;  4PZ7 A;  3W1B A;  4B3T Q;  2AKW B;  5LMN Q;  4QQB X;  3HOY H;  1HNW L;  1IBL Q;  4LWC A;  4IOC A;  4LFC L;  3KDF A;  4XIG S;  2MFI A;  4R1J A;  4NXN Q;  2AMC B;  3GTG H;  3HOV G;  2OTL A;  4NPS A;  3TS2 A;  3T1Y Q;  4DV7 L;  1IBM Q;  5AJ3 L;  4BA1 I;  3J81 i;  2RCN A;  4UP7 A;  4A3L H;  4IFD I;  3M4P A;  2RF4 A;  4J15 A;  1VQD A;  5IP7 G;  1IBK Q;  4LUV A;  2F52 A;  2JA9 A;  3I2Z A;  2F4V Q;  3PV0 A;  1TWF H;  1SRU A;  4R4O A;  4YCW A;  1PH3 A;  4K0K L;  1VQB A;  1M1K C;  1JE5 A;  2Y0S E;  4YY3 L;  3W1G A;  3RNU A;  4R4Q A;  4EX5 A;  4KHP Q;  3AYH B;  3I7F A;  3GTL H;  3I4N G;  4A93 H;  1A62 A;  1VQF A;  3KDF B;  3S24 A;  1E7Z A;  4P71 A;  5IYC H;  4LF7 Q;  1D7Q A;  1L2F A;  4DR1 L;  2CQO A;  2XGT A;  4A3I H;  1GM5 A;  5GAD C;  4QL5 A;  4JI6 Q;  4LF4 L;  1NBW A;  3HKZ E;  2B63 H;  5C44 H;  2Z6K C;  1SN8 A;  4R4I A;  5JEA J;  1S3O A;  4A3F H;  2NVQ H;  3S14 H;  2OQK A;  2RHQ B;  1KHI A;  5M5Y H;  2R92 H;  4A3J H;  3HKS A;  5GAE C;  1K8G A;  1S72 A;  4MTN A;  5M5W H;  3ICE A;  4JI1 L;  2ZM6 L;  4KI0 A;  2N3S A;  2IHF A;  1L1O A;  3ZJY C;  3HOX H;  1N8R C;  1M90 C;  3CCE A;  1XPU A;  4A3C H;  4JV5 L;  1IYJ B;  2WFW A;  2LSS A;  1VQM A;  1E3P A;  2UUA Q;  1HNW Q;  1VQ5 A;  5M3M G;  3PO3 G;  4X64 L;  4LFC Q;  1CUK A;  1GVP A;  2UUC L;  2Q2T A;  5IY0 A;  4A3M G;  1O7I A;  1TWC H;  4B3R L;  1X55 A;  3CME A;  4JC0 A;  4GNX A;  1QVF A;  2I5L X;  4DV7 Q;  5AJ3 Q;  1N33 L;  1IL2 A;  3RN5 A;  1SRO A;  4OO1 I;  3F2C A;  2OWO A;  1XJV A;  4BBS G;  2JA8 H;  5J3B A;  4HJ5 A;  3CF5 A;  4QY7 A;  5C0X G;  2UXB Q;  1L1O B;  3HOW H;  5C4J H;  4K0K Q;  3RLF A;  2BA0 A;  5EAY A;  4YY3 Q;  1CKN A;  4JOI C;  1RIP A;  4O2D A;  5IE8 A;  1GO3 E;  3CCL A;  4X6A H;  1T9H A;  2PMZ E;  1E22 A;  2N78 A;  4YWL A;  4DR1 Q;  1YIT A;  4KHZ A;  1TWH H;  4JI7 L;  2IX1 A;  3MEF A;  3TEH B;  4BY7 H;  4DR2 L;  2OTJ A;  5M3F H;  1X65 A;  1YBY A;  1UWV A;  4LF4 Q;  1GD7 A;  1B70 B;  1HR0 W;  1J6Q A;  1ASY A;  4JYA L;  3F8T A;  1SLJ A;  1NE3 A;  1BVS A;  5LMN W;  1CKM A;  2C35 B;  4DPG A;  3MXN B;  4JI1 Q;  2ZM6 Q;  4AQY L;  1HNZ L;  2E2J H;  1FJG L;  3PSI A;  4Y52 H;  1CKN B;  3TQY A;  1I50 H;  2OQ0 A;  1HR0 L;  3M4O H;  2UXC L;  1P8L A;  1PFS A;  3PUV A;  1PH2 A;  4JV5 Q;  4IFD J;  5C0X I;  3CMA A;  2KBN A;  3F2B A;  5C4X H;  1H95 A;  4ME3 A;  4A76 A;  4YWK A;  1V9P A;  1B7Y B;  2K5H A;  3D31 A;  1B8A A;  2K14 A;  4DV2 L;  1UE1 A;  2JA5 G;  2UUC Q;  3EN2 A;  2ZJP A;  1I6H H;  4DR5 Q;  4B3R Q;  5M5X H;  5JJL A;  2K52 A;  1MJE A;  1A8V A;  3J7Z C;  1N33 Q;  4AYB G;  3VDY A;  1IXR A;  3D0F A;  1JJC B;  5K36 G;  1EIF A;  1Q46 A;  2NVY H;  1HZ9 A;  5IWA L;  3HOU H;  1MJC A;  2Z6K A;  1VQO A;  4UP8 A;  1Y1W H;  1WCM G;  2E8G A;  5H1S E;  3A74 A;  3NEN A;  3PUX A;  3I55 A;  4AIM A;  4A3E H;  1N32 L;  2JA6 G;  2EQS A;  5GQO A;  2D0O A;  2R7Z H;  4PG3 A;  4NXM Q;  4JI7 Q;  1YJN A;  1KIX A;  2FXQ A;  4JI6 L;  4TQU S;  1TWG H;  3GDE A;  1TXY A;  3AFQ A;  1QUQ A;  1WOC A;  3GO5 A;  3F1Z A;  4BY1 G;  4BBR H;  5FJ8 G;  4ALP A;  4A3D H;  4H02 A;  2CFM A;  4DUY Q;  1GKH A;  4GKK L;  2L15 A;  1LM0 A;  4WJ3 M;  2DGY A;  1X3E A;  4A3K G;  3S1Q H;  2EXD A;  2UXD L;  1YI2 A;  1JT8 A;  3A5U A;  4AQY Q;  1HNZ Q;  1FJG Q;  4EQ5 A;  3E9H A;  1EFW A;  4WJ4 A;  4DV5 L;  2VW9 A;  1VQI A;  3FKI H;  1HR0 Q;  2UXC Q;  1XMO L;  1K73 C;  1VCI A;  4GN5 A;  3KF8 B;  3BZK A;  1WJJ A;  1X9N A;  3CAM A;  1W3S A;  1SFO H;  1PH6 A;  3GTP H;  2CWA A;  2HQL A;  2R6G A;  2KCM A;  5GAG C;  2NVX H;  5JJK A;  4IPC A;  2LXK A;  4LUZ A;  1Q1B A;  1QUQ B;  5HGQ A;  4A75 A;  4DV2 Q;  3EIV A;  1I5F A;  1U0L A;  2HHH L;  1RL2 A;  4A3B H;  3I4M G;  1OXT A;  4R4T A;  5GRO A;  4DKA C;  3HOY G;  2VNU D;  1KRT A;  2BA1 A;  4RG1 A;  1VS0 A;  1Y14 B;  4QGU A;  3E9I A;  2N8N A;  4P73 A;  2QA4 A;  5IWA Q;  3KJP A;  1PH4 A;  3CC2 A;  2UXB L;  3A0J A;  3J80 c;  1UE7 A;  3Q8D A;  3CPF A;  1Z47 A;  1JB7 A;  4L5S A;  4A3L G;  1N32 Q;  2E2I H;  1NY4 A;  1G51 A;  4OXP A;  1JMC A;  1SE8 A;  1FVI A;  4LFA L;  1KD1 C;  4HIK A;  4IPG A;  5IYB H;  5BR8 L;  1XMQ L;  1WI5 A;  3AFP A;  3K7A H;  4QIW E;  4BA2 I;  1TWA H;  4DK6 C;  1KXL A;  3PF4 A;  3AQQ A;  5C0X J;  2HIV A;  1CKO A;  4OO1 G;  3L7Z C;  4A93 G;  5IYC G;  3RZD H;  3K7U C;  2VY3 A;  4GLV B;  4DUZ L;  4DR3 L;  3LGJ A;  1VQK A;  4GKK Q;  1CSP A;  3A5Z B;  4C3I H;  4A3I G;  4P74 A;  3T1H L;  1QZG A;  1OXS C;  2PQA A;  1WYD A;  3H3V H;  2UXD Q;  1YJW A;  2B63 G;  3BZC A;  5C44 G;  3H0G H;  4GN4 B;  3STB D;  1VQL A;  4DV5 Q;  4A3F G;  1R9T H;  1ASZ A;  3BJU A;  1VQ8 A;  4IOA A;  1XMO Q;  2R92 G;  2MQH A;  4HJ7 A;  4A3J G;  2IX0 A;  3G48 A;  1BKB A;  1YHA A;  1G6P A;  3CC4 A;  1VQG A;  1N34 L;  3DLL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...