5IYDH

Human core-pic in the initial transcribing state (no iis)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
150
structure length
150
Chain Sequence
MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Near-atomic resolution visualization of human transcription promoter opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription, transferase/dna/rna
total genus 16
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5iydH01
4BA1I 4DR2Q 4POGA 4L5QA 1UWVA 3A74A 1UE6A 3AYHB 1BBWA 1M90C 2PI2A 5IP9G 5IYBH 4A3BG 4NPSA 4QL5A 3PGZA 3CMAA 2UUCQ 3RLNA 4JI7L 2MO0A 3DM3A 1E7ZA 4NB3A 3UDIA 1PYBA 1Q8KA 4GKJQ 3GTJH 4DV2Q 4B3TL 1K9MC 1L0WA 3I55A 1FVIA 3PUYA 1JT8A 1IBMQ 3M4OH 3KDFA 3W1GA 1XPUA 2NN6G 4GOPC 1VQNA 3CC4A 2YU9H 2H5XA 3TQYA 4LFCQ 1YBYA 1YNXA 3L2PA 1GKHA 1SLJA 4JV5Q 5IP7H 4A3GG 4HIDA 1IBKL 1IXRA 2GVBA 2Q2HA 3D0FA 1N32Q 4DV7L 1ASZA 2UU9L 2R7ZG 2E2JH 3VDYA 2PNHA 1KHIA 1P16A 1X54A 1K3RA 3CP0A 2N78A 4OWTB 4BY1G 2JA5H 2Q2UA 2YYZA 4JI7Q 3HOVG 1VQ9A 4HIMA 4DR3Q 5ELNA 1WCMH 4JI4L 4A3IH 1KL9A 3K80C 3K81C 5IYDG 5IE8A 5GAEC 3ICEA 2NZHA 5IWAL 3HOZH 4P75A 4JI8Q 3RN5A 4OONA 3A5UA 3CW2C 2E5LQ 1N33L 4DV1Q 4LUZA 2HHHQ 3T1HL 3FKIH 3TRZA 2XGTA 2K5HA 2UXCQ 5IP7G 3D31A 3OTOL 2AHOB 1IZ6A 1MJEA 1J5EL 5GAHC 1BBUA 2AMCB 3H3VI 1YVCA 2D62A 1TWCH 4C2MH 1KRSA 4DPGA 1VS0A 3ZJYC 1H95A 2UXBL 4A3IG 4LF7Q 1B8AA 3S2HH 3U4ZA 1VQDA 2VS1A 4QIWE 5IWAQ 1Q86C 1PH1A 2LXKA 1Y1WH 2WP8J 1E24A 1EYGA 2BH2A 4GKKQ 1JB7A 5LMUQ 1N36L 2I0QA 3CC7A 2I5HA 1RIPA 3W1BA 1EWIA 1Z9FA 1LYLA 3AFPA 2ZJPA 1HNZQ 3GTQH 2QA4A 2Z6KA 1LUZA 1E3PA 3CCVA 1J5EQ 3M85A 1VQ4A 4UP9A 4R4IA 1PH7A 3S2DH 3PO3H 1GD7A 4AH6A 2OTLA 1NTGA 5IYCH 2JJQA 4LUVA 3DLLA 3NELA 1D8LA 2CFMA 2EXDA 1UE1A 5LMNL 4A3LH 3CCUA 1FL0A 4DAMA 5FLXc 4JI2L 4HJ5A 3CCLA 1TWGH 2ZJQA 4DV3L 3G48A 3OW2A 2UUAQ 1PVOA 1A62A 3CCSA 3H0GG 3PUVA 1Z47A 1N34Q 4MTNA 5C0XJ 3PO2H 3I4MH 1Q82C 1N9WA 5BR8L 4DR4Q 4GNXA 2R92H 3HOWG 4GNXB 2K4KA 4X62Q 3K7AH 1XNRQ 1X3FA 1JJ2A 2B3GA 3KF6A 4BBRG 2NVTH 4YHHL 1EQQA 1PH5A 1N8RC 1FGUA 4DV4L 2VNUD 2VQFL 4A3KH 3GTPH 2KCMA 3PUWA 4JCVE 5M3FH 1IBLL 3UDFA 1S3OA 1I3QH 4B3SL 3RR5A 1JJGA 1X65A 1Q12A 2IHFA 2YTXA 4IPHA 3HOXG 1U0LA 4GLXA 3RZDH 1VQPA 2YTYA 4DNIA 2R92G 1PV4A 5IP9H 4HJ7A 3NEMA 3ER0A 4X64Q 2BA1A 5HGQA 1OTCA 2UUCL 4K0KL 1VQJA 4IOAA 3RN2A 2A1AA 1PH2A 1CUKA 2YV5A 2VQFQ 2JK8A 4GKJL 4DV2L 1SE8A 4A75A 1EQRA 4O0AA 3IRBA 1XPOA 5C4XH 4B3SQ 4NXMQ 2OQ0A 3NENA 3GTOH 1IBML 3GD7A 4KLKA 3STBC 3MXNB 3BZCA 1QVFA 1PH6A 4LFCL 4UY8C 4A3JG 3H3VH 4JV5L 1OXXK 4A3EG 4A3GH 3EBEA 4LF9L 2BA0A 2HIVA 2N8NA 3AQQA 1N32L 2VW9A 1G6PA 2R7ZH 4BBSH 4BY1H 3HOVH 4K0KQ 4LF8Q 3M9BA 4UP8A 4DK6C 5AJ3Q 3PIPA 3TREA 4DR3L 4L5RC 4A3DH 1L1OC 5IYDH 4TQUS 4DKAC 2ZJRA 2PMZE 4A3CG 1LTLA 2JA6G 2MFIA 3U58A 5C4XG 4JI8L 3HKSA 1QZHA 1PH4A 2E5LL 4DR6Q 4DV1L 1VQOA 1X9NA 1A0IA 2HHHL 4PZ7A 2JQOA 4LW1A 1UE5A 4BXXH 1Y1VG 2UXCL 4LF9Q 2OTJA 5GQOA 2K5VA 3BU2A 3UE1A 1PH8A 1WOCA 4R4TA 4R4OA 3TEHB 3PIOA 3PF5A 4L5SA 2KCTA 3ULJA 4BBSG 1OXTA 2R6GA 1VQ8A 5C3EG 1V9PA 4B3MQ 3A0JA 4DV5L 4DR7Q 1HNWQ 2RCNA 4A3DG 2B63G 1A63A 4LF7L 4QQBX 1HR0W 1CKNA 2L15A 4C3JH 1CKNB 1V1QA 3TS0A 3RZOH 4GKKL 3S16H 5C0XI 1K0RA 4LWCA 5LMUL 2A19A 4IJLA 2D0OA 3STBD 1VQ7A 4BXXG 3ULPA 4IFDJ 1VQIA 4JI0L 2K14A 4PMWA 1HNZL 1HZ9A 2VUMH 4DV0Q 1NE3A 4AQYL 4AIMA 1XMOQ 2JA8G 1VQHA 4KI0A 2OCEA 3KYHC 1KIXA 2IT1A 3UDGA 3GTKH 3GTMH 3J81j 3EN2A 1KC8C 2Z0SA 4DV5Q 1OXVA 3KLWA 1AE2A 1Y14B 4GN4B 4LF6L 2IX1A 4DV6Q 1XJVA 3GTGH 1MJCA 4HJ8A 2RHQB 1WFQA 2UUAL 3SGIA 2UUBQ 2HIXA 3H0GH 4POFA 5JJKA 1L2FA 1N34L 5M5YH 2C35B 2Z6KC 4QGUA 1YEZA 1KAWA 3F2BA 2K52A 3HOWH 3I4NH 4DR4L 1M1KC 1HR0L 4JI0Q 4X62L 3U4VA 2CCZA 2KHJA 2ID0A 4JI6L 2AWOA 3H15A 1NJIC 1FJGQ 2RHSB 1XNRL 4BBRH 2VUMG 4WJ4A 2JA9A 4AQYQ 1HZAA 5JJIA 3KJOA 4J15A 4LFAQ 1HNXQ 1VQ6A 1UEBA 1VQGA 4IO9A 4DAYB 4DR5Q 4YCVA 1G291 3E0EA 3I7FA 1VCIA 4LF6Q 1I50H 4A4IA 1EIFA 1C9OA 4GN5A 1YHBA 2F3IA 4EX5A 5JEAJ 1C7YA 1KQSA 3L7ZC 4QJFA 3HOXH 4GNXC 2ATWA 1MIUA 1HZBA 1VQMA 4A76A 4APVA 5HY6A 3ERSX 3F8TA 4MNOA 3I4NG 1I6HH 1HR0Q 1T9HA 4JI6Q 2QGQA 1I5FA 1YITA 4X64L 2VL6A 2OQKA 3MEFA 4L5TA 1TWHH 3J7ZC 4DUZL 3RLOA 1PFSA 1Q46A 2IX0A 1KRTA 2WAQG 2CWPA 3K7UC 3OYYA 4OWXB 2AWNA 3CCMA 5M3MG 1YIJA 1E1OA 1PH3A 3UE0A 1X55A 1GO3E 2E2HH 4OO1G 2UXDL 3J81i 4OWWB 4NXML 4IFDG 4A3MH 1Q1EA 2ALYB 5E7NA 1RL2A 4P72A 4A3JH 3RNUA 2VY3A 4A3EH 4GLVB 4X6AH 2IHEA 3JC66 4P74A 1JMCA 5FJ8G 2E8GA 3S15H 2MQHA 1NBWA 3S1MH 4DUZQ 1J6QA 5J3BA 2LXJA 4YCUA 4JOIA 1CSQA 1YZ6A 4LF8L 1UE7A 5AJ3L 1GVPA 3S14H 4ALPA 3HOYH 1Q1BA 1VQ5A 3RLFA 4BA2I 3CCEA 4A3CH 1D7QA 2DUDA 2JA6H 1YHAA 2UXDQ 3F2DA 1U5KA 1NMGA 4PZ8A 4A3MG 2R7DA 2K50A 3G4SA 1S72A 4OX9Q 4A93H 4DR6L 4DR1Q 3LGJA 4X65Q 4OO1I 4GN3B 1Y1VH 4IFDI 3CQZH 2KHIA 5C4JH 4HJAA 3J7A5 2JEAI 2JE6I 1E22A 4YCWA 3CC2A 1HJPA 2ZM6L 1S40A 3F1ZA 5C3EH 2CQOA 3CXCA 1SRUA 2NVYH 4NXNL 5EAYA 4B3ML 2F4VL 2K75A 4DR7L 1HNWL 1AH9A 4YWKA 1HZCA 2B63H 3HOYG 5C0XG 5ELOA 3PCOB 4LUOA 4JI5Q 4UPAA 4A3FG 1E1TA 4LF5L 4MZ9A 1TWAH 1NY4A 4Y52H 2B29A 5FLMG 3I4OA 1VQBA 4B3RQ 2EIFA 2WAQE 4IJHA 4A93G 1SN8A 2F52A 1MKHA 2NVXH 4DK3C 1VQEA 1XPRA 2AKWB 5C44G 1K73C 2Y0SG 4DV0L 4LFBL 1XMOL 2JA8H 2V1CC 2VQEQ 2NVQH 1VQFA 2ZM6Q 2CKZB 1I94L 3CCQA 2ZTCA 4NXNQ 3HOUG 2F4VQ 1X56A 4O2DA 2JEBI 1YJ9A 3PF4A 4DUYQ 3L0OA 3J80i 3HFZB 3CF5A 2DGYA 4DV6L 4LF4Q 3T1YQ 1SMXA 4LF5Q 2UUBL 1L1OA 1XNQQ 4X66Q 2IY5B 1L1OB 4OXPA 5GAGC 4YWMA 3KDFB 4P73A 1B70B 2ES2A 1CKMA 4HIKA 5GROA 4GOPA 1VQCA 1VQKA 2MO1A 4GOPB 3F2CA 1FJGL 1V43A 4PG3A 1IL2A 5IYBG 3KFUA 4LFBQ 3M4PA 3I2ZA 1HNXL 4LFAL 1I94Q 3KJPA 4DR5L 4HJ9A 2I5MX 4R1JA 4IOCA 1PYSB 3S1RH 3GTLH 4IPDA 5DLQE 4B3TQ 2E2IH 1TXYA 1A8VA 1EOVA 4EQ5A 5M5WH 1YHQA 2K5NA 2EQSA 3E9HA 3FP9A 3W5OA 1R9TH 1YJWA 2A8VA 4JBJA 1BKBA 3BZKA 4WJ3M 1X3GA 2WB1G 4RMFA 4GLAC 5LMNW 3HKZG 2HT1A 1IBKQ 4KHPL 2NN6I 4C3HH 1LM0A 2N3SA 4DV7Q 2N49A 4R4QA 2UU9Q 4BY7H 4LNQA 4YWLA 3PUXA 4JBMA 4JI1L 2JA5G 5M3MH 4JBWA 2CWAA 1P8LA 2ZTDA 1WCMG 4JI4Q 4JC0A 4XIGS 1DGSA 2JA7H 2Y0SE 1EUJA 3GO5A 3UDXA 3AEVA 3HOZG 4HIOA 1XTDA 3A5ZB 1KXLA 1XMQL 3JAMc 3J81c 1Q81C 1NMFA 1N33Q 4JG2A 1WI5A 4GS3A 3T1HQ 3TS2A 4UP7A 3FKIG 1X6OA 3K0XA 3S24A 3OTOQ 1PH9A 4IPCA 3G6EA 2QEXA 2VZAA 5FJ8H 4KHPQ 1OXSC 3B6YA 1X3EA 3KOJA 4R4CA 1OXUA 4AYBG 3CPFA 1BVSA 4QY7A 1IYJB 1QVGA 4BY7G 4JI1Q 4P71A 1K8AC 3CD6A 2KENA 4KHZA 1PA6A 3BJUA 2UXBQ 3Q8DA 2WFWA 1C0AA 2PI2E 2KBNA 3JAMi 1Q7YC 1QZGA 2Q2TA 3E9IA 2JA7G 4JI3L 2GVAA 4JYAL 4ME3A 4C3IH 5JJLA 2MNAA 3FHWA 1Y1WG 4OX9L 1YJNA 1XMQQ 2NZOA 4DR1L 2FXQA 4X65L 1SROA 1QUQA 4PZ6A 1N36Q 3M3YH 3G71A 1QUQB 1K83H 4RG1A 4JOIC 5IY0A 3S17H 3I56A 4IPGA 5IT9c 2YTVA 1O7IA 1W2BA 2R93H 4JBKA 5GADC 1WYDA 3KF6B 1EFWA 3PO3G 2I5LX 3GDEA 3KF8B 5H1SE 1JE5A 5IYCG 1W3SA 2WB1E 5LMNQ 1AE3A 4A3LG 3HKZE 3CAMA 4JI2Q 4JI5L 1YI2A 1K8GA 4A3FH 1SFOH 4YY3L 3M4QA 2LSSA 3AFQA 1WJJA 4DV3Q 1GM5A 5FLMH 1EIYB 4JI3Q 1QVCA 4JYAQ 3PSIA 4B3RL 1HH2P 2Q2IA 4DR2L 1PHJA 3CMEA 3PO2G 3I4MG 2PQAA 5BR8Q 2PQAB 2RF4A 1JJCB 2ZTEA 4H02A 5C44H 3ULLA 4A3BH 1ASYA 5M5XH 3WWVA 1CSPA 1G51A 2D0PA 3NBHB 4TVAB 2VQEL 2OWOA 2XTIA 3K8AA 3M7NA 4YHHQ 2R93G 1CKOA 2GN5A 3EIVA 3HOUH 4XTCS 1VQAA 5JEAG 1KD1C 3S1NH 5K36G 3PV0A 4DV4Q 1SR3A 3PUZA 3CPWA 3S1QH 4A3KG 1B7YB 2HQLA 3U50C 4DUYL 5M3FG 4Y7NH 1VQLA 4LF4L 1IBLQ 4YY3Q 3T1YL 2ASBA 4AYBE 2R7FA 1XNQL 2BH8A 4X66L 3CCRA 4FDBA 3J80c 1TWFH 3CCJA
chains in the Genus database with same CATH superfamily
4DR2Q 1AN8A 1JQYD 3VYSA 1G6ZA 3A74A 2BE5D 3AYHB 1BBWA 1EZ8A 5A35A 3PIP3 2MO0A 3BDLA 3DHQA 3D3RA 3UDIA 4GKJQ 2XVSA 4B3TL 4MTKA 5CGKA 1HHVA 4OHJA 1L0WA 1SNCA 3GTJB 2B2TC 1UEAB 2MPMA 2YU9H 1CTMA 1KTKA 3L2PA 3T56B 3VYUA 3CHBD 2Q2HA 1ASZA 3OMCA 2KCNA 2R7ZG 2E2JH 2PNHA 4ABNA 1K3RA 2N78A 3SK4A 2Q2UA 2L9HA 1VQ9A 2JA5B 4FF3A 1NR4A 4DR3Q 5ELNA 1ZYRC 4A3IH 3HG9A 3K81C 3K80C 1WCMB 5KNCA 2TMPA 2CQAA 1A3TA 3VR5A 4JI8Q 5JAVA 2CVRA 5AFWA 4OONA 3A5UA 2DN8A 2E5LQ 1ILPA 5LL6S 2K04A 4IURA 3BS1A 3SDZA 3A55A 2K5HA 5G3LF 1IZ6A 2D5DA 5ELDA 3BDCA 3MWYW 3QR8A 3J80L 3NPPA 3ZJYC 1WVLA 4C2MB 1H95A 4A3IG 1BUVT 1YNJD 3SHLA 5IWAQ 1JOKA 1Y1WH 5JPNC 5LMUQ 2K28A 3CC7A 4I7AA 3Q22A 3W1BA 4HN7A 3AFPA 1J5EQ 2NZ1D 1PH7A 4IUVA 2OTLA 3IKJA 1NTGA 4ZCKA 3EJIA 4LUVA 1FR3A 4A3LH 2RCFA 3FMCA 4F87A 1E2VA 4RHRA 3EA6A 3OW2A 2F0QA 5A2QE 4CKCA 3CCSA 3PUVA 1LABA 5C0XJ 3PO2H 4DR4Q 3I4MB 2R92H 2K4KA 3K7AH 2K1BA 1DYQA 1Z7TA 3NTKA 1JJ2A 2IL8A 2NVTH 3GV3A 4V190 2PW7A 1SYEA 5EBCA 5BN3A 1PH5A 1N8RC 3BG3A 4A3KH 3PUWA 1LT4D 1I3QH 5M3FB 1JWUD 2IHFA 4IPHA 3I72A 4A3EB 1GUNA 2R92G 1PV4A 4RGMA 5IP9H 5EKLA 2BA1A 4O42A 5FKAC 4K0KL 2HCIA 2JP1A 2L11A 1PH2A 3H94A 4WRDA 2GA4B 4UAIA 4GKJL 3NK9A 1CFMA 4TKOB 1XPOA 2OQ0A 1JOOA 4ILWA 1IW7C 1D6EC 3BZCA 3OSOA 1PH6A 3H3VH 4A3GH 4XYQA 3SR1A 2N8NA 2AUJD 3D4WA 1JCKB 5ISRA 3R2TA 2ZXOA 1EY5A 4XXEA 5D3IB 5CC4A 3HOVB 3TREA 2CW0C 4DR3L 4A3DH 4DKAC 2PMZE 4FNFA 4KY5A 1KAAA 1BCPD 1LT3D 4JI8L 2I07B 2E5LL 3DWPA 4KY6A 1A0IA 5BN4A 1HFGA 1Y1VG 2OTJA 4LF9Q 5GQOA 2NVXB 1PH8A 1X3PA 1ICWA 3PIOA 4FYDA 2E2DC 3PF5A 2KCTA 1K8MA 1OXTA 5DEHA 4B3MQ 1HNWQ 1JWSD 4A3DG 4IUQA 1SJHD 3VR6A 4QQBX 1A63A 4C3JH 4JW0A 1CKNB 1EYDA 1K3BC 3MC0B 1CA6A 1K0RA 5LMUL 2A19A 4IJLA 3S16B 3STBD 2EJFC 2RBMA 3ULPA 1VQIA 4FVMA 2K14A 1PTOB 1JE4A 2VUMH 1NE3A 1XMOQ 3EQLC 3KYHC 3NQTA 3GTMH 5EKIA 4JPBW 2JN4A 1GUGA 3GTKB 4GN4B 3GTGH 1S5BD 1CHQD 2NTTA 1PFNA 2RHQB 4C3JG 1WFQA 2UUBQ 3QOLA 3E3XA 5JJKA 4POFA 2O2LD 1L2FA 3H0GB 2C35B 1YEZA 4DR4L 1LT5D 2K52A 2B2UC 2X6GA 1MSGA 4JI0Q 2CCZA 4JI6L 2B8FA 1FJGQ 3I4NB 3HOWB 4DA2A 1B1ZA 2VUMG 2JA9A 3FEWX 4AQYQ 4O1NA 1HZAA 5CYUA 3C46A 4BBRB 1VQ6A 4DAYA 1SE4A 1VQGA 2ICIA 1CZWA 1BNZA 1I50H 3MAQA 2PW5A 3AU7A 1YHBA 3BDOA 4GN5A 3D4DA 4X3TA 1KQSA 4QJFA 4XYOA 3J81E 5I9PA 2KJXA 3F8TA 5IGGA 1HR0Q 1T9HA 1I6HB 1DONA 1YITA 2VL6A 4L5TA 1TWHH 1SYGA 4F88A 1PFSA 1LV9A 1WTXA 3OYYA 2F0NA 3CCMA 1YIJA 1GO3E 3J81i 4H44C 2ALYB 5E7NA 4A3MB 2RA4A 4A3EH 1D1IA 2J7ZA 2BOSA 4A3JB 2IHEA 3RMHA 5IT9E 3JC66 1W6JA 2XNAC 1J6QA 2LXJA 3S15B 1XWEA 2V4DA 1CSQA 1YZ6A 5IOCA 3DXJC 1GVPA 4BA2I 3S14B 3LNNA 2FMMA 3QWNA 1U4RA 4M1UB 5NUCA 2K50A 1S72A 4OX9Q 4K6DA 3P75A 3CQZH 1A6XA 1J8IA 1E22A 1EEID 2J0TD 1HJPA 3UI2A 2CQOA 1SRUA 4B3ML 2KOLA 4IALA 5C3EB 1HNWL 1LTSD 4JI5Q 3DEOA 2B63B 4UPAA 3V05A 4Y52H 2A68C 2PZWA 5KYLA 3DM1A 4RKLA 4ME5A 1MKHA 4EGVA 1PFBA 2NVXH 2EY6A 2NUCA 1VQEA 2AKWB 1K73C 5I9OA 1XMOL 1KNEA 2ZM6Q 2QW7A 2JA8B 4NXNQ 2F4VQ 4O2DA 2JEBI 4P2CB 4DUYQ 3CF5A 2XWBB 4LF5Q 2UUBL 1L1OB 5GAGC 5JVG3 1NR2A 3KDFB 4HMIA 5C4HA 2EYMA 2EYOA 2L1BA 4HIKA 1IYUA 1VQCA 1JR0D 1VQKA 3F2CA 3U9SA 1FJGL 3ND8A 3WDNA 1B2TA 4ODGA 1RKNA 3NSWA 4R1JA 3T51B 2D2CC 1YNND 5KIXA 1TXYA 1EOVA 1Y8NB 2E2IB 5M5WH 1YHQA 1F2LA 2K5NA 3D6WA 1R9TH 4JBJA 3BZKA 1X3GA 4RHSA 2WB1G 4GLAC 2TSSA 2MGSA 3HKZG 2Z6BA 2JXMB 1PYWD 2Z9HA 2VB2X 4C3HB 4B9XA 4FXGC 4NDXA 3PUXA 4JBMA 4NP5A 2F0SA 5M3MH 1P8LA 3MEHA 4XIGS 2JA7H 1EQTA 4X3UA 2F0MA 1NCVA 1EYCA 1HRJA 2K32A 1WI5A 1X6OA 3B6YA 1F9SA 4RH6A 3CPFA 1QVGA 1IYJB 1LACA 4RWSC 2KENA 4G57A 4KHZA 2UXBQ 5D3DA 2Q2TA 3JAMi 1Q7YC 3W3AA 2JA7G 3HS0C 4ME3A 1SMYC 2A6HD 3K59A 4OX9L 4C3IB 1NAPA 3TMEA 4Q0FA 3AMUA 1ENAA 4RG1A 3EFXD 5IY0A 4ZUJA 3PO3G 4TSSA 2WB1E 5LMNQ 1AE3A 1GUSA 4WJWA 3D4RA 3HKZE 2EVBA 4JI5L 1YI2A 4LAAA 4A3FH 4DFAA 1SFOH 1K8GA 5M9OA 1IL8A 3QG1A 4DV3Q 4OELB 3I8ZA 3W2DA 1BCPB 2LFNA 4RGTA 3CMEA 2PQAA 5F2DA 2RF4A 1O80A 1AW7A 1SYBA 3NBHB 1G51A 5M5XB 3M7NA 4YHHQ 2BDNA 2ZXRA 5K36G 4XTCS 1KD1C 4DV4Q 3HOUB 4XT1B 4DUYL 4K8JA 3OIQA 5HGTA 1H9JA 2K33A 2K5WA 2MP1A 2NN6H 1I6VC 3J80c 1TWFB 3A54A 4L5QA 1DOLA 3J7YW 1M90C 5IODA 1T5EA 2UUCQ 1GHJA 1F9QA 1E7ZA 4OIJA 4H0LC 1PYBA 4LMQD 1Z6HA 1ZEQX 1F2ZA 4HMJA 1H9KA 4ZAIA 4GZYC 3PUYA 1IBMQ 3M4OH 3KDFA 3W1GA 1XPUA 2NN6G 1VQNA 4LFCQ 2YU9B 4ZRZA 1SLJA 1SNOA 4HIDA 2VB3X 1IXRA 1U9RA 1N32Q 3URYA 1IYVA 3VDYA 1X54A 4XDXA 4OWTB 2E2JB 1BF4A 2B8GA 1EL0A 1DOKA 1KL9A 3ONAB 4M8AA 1H9SB 2NZHA 1Q8IA 4A3IB 3HOZH 4QUFA 2HHHQ 2WACA 3FKIH 1LTBD 3FDTA 1QNUA 3OHXC 3NWTA 1PRTD 3SVMA 1MJEA 1BBUA 2AMCB 2D62A 4IQZA 3X3NA 1TWCH 2IJ0A 4RFBA 1VS0A 4RGOS 1E0BA 2DJGC 2UXBL 3S2HH 2VS1A 4QIWE 2K01A 1PH1A 1EYGA 2PNRC 2WP8J 1E24A 2BH2A 1Y1WB 2F3VA 1I4GA 1RIPA 1EWIA 3RUZA 3X3MA 1LYLA 2EDGA 2K5QA 3GTQH 1HNZQ 1V1OA 2PMZB 3CCVA 1SNPA 4R4IA 3S2DH 1GD7A 4AH6A 2JJQA 3DLLA 1HUNA 1KDCA 2CFMA 2EXDA 5LMNL 4FXDA 5FLXc 1TS4A 4DV3L 2UUAQ 1PVOA 1LO5D 1Z47A 4MTNA 1Q82C 1N9WA 3PO2B 1ONLA 2R92B 1XNRQ 3K7AB 1E2ZA 4YHHL 1ET6A 2NVTB 1C48A 3KLRA 4DV4L 5IGFA 2VQFL 3KLSA 2D9UA 3WOEA 4DK0A 4A3KB 1ET9A 1VMCA 1W6KA 1JJGA 1I3QB 3HOXG 3RZDH 2YTYA 1NUCA 1EIHA 1DCZA 2DNCA 5HGQA 1OTCA 2UUCL 2SEBD 1CUKA 4DXGA 1XYIA 1F9PA 4CDDC 5C4XH 3GTOH 1IBML 3GD7A 2XN9C 3STBC 3MXNB 1ZKOA 1QVFA 4LFCL 2EJMA 4N9PA 3GQBA 4A3GB 1TT2A 3AQQA 1N32L 2XSCA 1HFNA 2R7ZH 2EY2A 2FMCA 4PMBA 4K0KQ 1SDFA 3M9BA 5AJ3Q 3PIPA 2X6LA 4ZLTF 4A3DB 4A3CG 2F3WA 2JA6G 2MFIA 5C4XG 5C4ZA 1PRTF 1STGA 1LTTD 4N8X1 5EGTA 1TKWB 1VQOA 2HHHL 3TP5A 4PZ7A 2JQOA 3BU2A 3NP8A 1EY7A 5C5LA 4DF7A 2Z4IA 2KCCA 3TN2A 1VQ8A 3A0JA 5L37A 4DV5L 2RCNA 1B53A 1H9SA 4C3JB 2Q8TA 1I4XA 2IX3A 2A69D 1HNZL 5IGBA 4RCOA 3K5OA 4KI0A 2VUMB 3K0YA 1KIXA 2IT1A 3UDGA 1OXVA 3GTMB 4LF6L 1XJVA 4KV6A 3GTGB 4HJ8A 5DM63 2UUAL 1EEFD 5M5YH 4L8JA 1M1KC 1TY0A 3U4VA 1XNRL 3H15A 1NJIC 2DJFC 4WJ4A 4DNTB 4F8MA 4J15A 1HNXQ 3T16A 3MHBA 5CV7A 4DAYB 2KVMA 5C5MA 1FNUA 1I50B 2F3IA 1GUTA 3L7ZC 3QJYA 3H6MA 1HZBA 1D5ZC 1TVXA 2B2WC 4APVA 3A7LA 1DOMA 2PZUA 4JI6Q 1QILA 2QGQA 4DUZL 3MEFA 3RLOA 1KRTA 1TWHB 3K7UC 1GHKA 4KD4A 5EPLA 2E2HH 4OO1G 2UXDL 4OWWB 4IFDG 3EROA 3H09A 3SK5A 2Z8LA 2L55A 1RL2A 4P72A 3RNUA 2VY3A 2Q8IB 2E8GA 3D6CA 4R8NA 2MQHA 4G7ZC 2FJ2A 3OWFA 4JOIA 5AJ3L 1Q90A 2A6EC 2DUDA 3VR3A 1TS5A 5D65A 3TP8A 1CK1A 1U5KA 3H3VC 3MXNA 4PZ8A 2K6AA 3VA7A 3G4SA 1PMRA 4XQJA 4QCLA 3LGJA 4X65Q 4OO1I 1Y1VH 4IFDI 4CKEA 1I4RA 4HJAA 3J7A5 3CQZB 5FLXL 4I65A 2MJ8A 1SEBD 1JC7A 2OXPA 3CXCA 2NVYH 5FK9C 2K75A 3C2PA 3SE0A 4LUOA 2WKDA 1E1TA 1TWAH 5FLMG 3J80E 1G2SA 3R8BA 4EQOA 4B3RQ 2F52A 4K8IA 4OL7A 4KJNA 4DK3C 1UUPA 5C44G 4LFBL 2NVQH 2CKZB 4G7HC 2EYLA 1QOHA 1ESRA 1X56A 2EE1A 5CV8A 2Z1CA 2O4XA 4DGZA 3J80i 3T4AC 2DGYA 4LF4Q 3L9AX 2RSNA 2ES2A 4CBVA 2LS01 2WB1B 4GOPA 2MO1A 3PIO3 3HKZB 2F0EA 5IYBG 3BVZA 4L63B 5LL6X 1HNXL 4B9WA 1PZJD 4IOCA 3GTLH 4K5WA 2A6HC 2PZTA 5KNBA 1WTWA 1A8VA 3A56A 4KKTA 3E9HA 1SNDA 3W5OA 5M5WB 4FF2A 2A8VA 2WIIB 4WJ3M 1RTNA 3R93A 1R9TB 2F0GA 2EJGC 2LKVA 3T53B 1IBKQ 2N49A 4R4QA 2XWJB 1R4QB 4YWLA 5JPMC 2JA5G 3C3LA 2WAQB 1U4PA 5M3MB 1WCMG 3E0JA 1RHPA 1EUJA 5J39A 2EXZA 3AEVA 2JA7B 4HIOA 1KXLA 1XMQL 3J7AV 1N33Q 3TS2A 3T1HQ 4UP7A 3K0XA 2A73B 4KHVA 2QEXA 2RKSA 1OXSC 3KOJA 3MXGA 1BVSA 1PZKD 1FNWA 5K5PA 2E74C 4U673 2OT2A 1K8AC 1SSOA 3FPPA 5FLXE 3A8IE 3BJUA 3Q8DA 1C0AA 2PI2E 2KBNA 1QZGA 3E9IA 1H9RA 4JI3L 1ZYRD 2GVAA 4HR7B 4JYAL 5JJLA 2MNAA 2B2VA 1YJNA 2NZOA 2FXQA 1QWYA 4X65L 1JOQA 3G71A 3U9OA 1K83H 4X3SA 1V1PA 4DXFA 2L0CA 4JBKA 5GADC 3KF6B 1S5DD 2I5LX 5IYCG 4PMCA 4JI2Q 5J22A 1WTOA 3GTPB 4YY3L 3ZYYX 4A3FB 2HQEA 1SFOB 1GM5A 1EIYB 1K8OA 4HSPA 4B3RL 1HH2P 3L3OC 1PHJA 4MHEA 3I4MG 2PQAB 3NTHA 2WV6D 4CJ2C 4A3BH 1SXTA 3EVQA 2OWOA 2Y0SB 4QIWB 2EYPA 3PQIA 3EIVA 2GN5A 3S1NH 2RVLA 5JEAG 2R61A 3PUZA 1I4HA 1B7YB 2HQLA 5M3FG 4LF4L 1SNMA 2BH8A 3H91A 2AUKA 1EU3A 3DUZA 5TSSA 1A2TA 4BA1I 4POGA 3K5NA 4G4KA 1UE6A 4A3BG 3PGZA 2LMCB 5BN5A 3RLNA 4JI7L 4CDEC 2NB0A 3DM3A 1B9NA 3OOCA 4KY7A 1K28A 4EQNA 4DV2Q 3TZUA 3M7GA 5CR3A 1EWCA 3CU7A 1S4ZA 1PZID 3CC4A 1PTOC 3M4OB 2H5XA 1KDAA 3TQYA 2SNSA 1YBYA 4PV1C 5CORA 3NQIA 5DNFA 1STEA 3E5SA 4L6TB 1IBKL 2GVBA 2EYJA 2HCCA 2KHSA 1GOZA 2J4XA 1KHIA 1LLRD 1P16A 3CP0A 4BY1G 3HOVG 3BYTB 5I6YA 4HIMA 1L0YB 2PCFB 3J7AF 5IYDG 4I7ZC 3TZDA 5IE8A 5GAEC 4DAVA 3HOZB 4QMGA 3S9WA 1N33L 4LUZA 3T1HL 1IW7D 1CA5A 3FKIB 3D31A 4RKBA 1OO9B 2K7VA 5GAHC 2HDLA 1SNQA 3HZXA 5FO9B 4AYBB 3Q24A 2G9HD 1TWCB 4QUCA 4DPGA 1B3QA 2CW0D 3U4ZA 1VQDA 3QOJA 1Q86C 2LXKA 2PYKA 4GKKQ 3S2HB 5ELFA 1JB7A 2I0QA 2I5HA 1Z9FA 3FPUB 2BCOA 2ZJPA 2Z6KA 4IUUA 4KD3A 3GTQB 1PFMA 4XQQA 1TY2A 3PO3H 1SYDA 3S2DB 2ICEC 1RD9D 1UE1A 2A5HA 5CV6A 3CCUA 4DAMA 4JI2L 3CCLA 1TWGH 3G48A 1A62A 3H0GG 1DZ1A 3HOXB 2G9DA 2BE5C 4GNXA 3HOWG 5E3FA 2B3GA 3KF6A 4BBRG 1K0SA 1SYFA 5K36H 4H7BA 4ULLA 4U68A 2VNUD 1X32A 3GTPH 2EYFA 2KCMA 2CH4W 4JCVE 5FOBB 4MIUA 3UDFA 1S3OA 4B3SL 3RR5A 1WTRA 3P1HA 5JVH3 1Q12A 1BDOA 2C9OA 4GLXA 1U0LA 4KMUC 3RZDB 5KNDA 4HJ7A 4X64Q 1FD7D 1QE6A 5I4DA 4R9WA 3Q23A 1FGBD 4FF1A 1VQJA 2F0IA 2A1AA 1HXYD 3I3CA 2VQFQ 2H4OA 2JK8A 1S5CD 2F0WA 3SK8A 4DV2L 1SE8A 1II3A 2FINB 2KEEA 3IRBA 4O0AA 3MA2B 5C4XB 3DMUA 3GTOB 4UY8C 4A3JG 4HTHA 1OXXK 2EOTA 4JK1C 4ZKCB 2F0LA 2WINB 1MSHA 4BBSH 2R7ZB 4LF8Q 4DK6C 1L1OC 1YNJC 1BR9A 4TQUS 2ZJRA 3U58A 1QZHA 1PH4A 3O13A 4DR6Q 4X3KA 1JICA 4BXXH 1DXMA 2NTSA 2K5VA 1DD2A 5KEEA 1EOTA 4BBSG 4K6LA 5E4XA 1AZQA 4WORA 1EZ6A 5C3EG 3TBIB 3R3OA 1LTGD 2B63G 5IIFA 2F0PA 1HR0W 3HGBA 3TS0A 1KNAA 1V1QA 1RTOA 1Y8PB 5CV4A 3RZOH 4GKKL 5C0XI 1VQ7A 4BXXG 2VXWA 4DV0Q 3IFTA 2JA8G 1VQHA 2OCEA 3EN2A 4QF4A 2Z0SA 4DV5Q 4S3SA 2QDLA 3KLWA 2IX1A 1HTPA 2SOBA 2JSOA 3SGIA 5I6WA 2HIXA 4HCSA 3NWSA 5JJZA 5M5YB 1KAWA 2A68D 3F2BA 2KUMA 4ZUIA 2ID0A 2AWOA 1RODA 5JOBA 2QF7A 3KJOA 5JJIA 4LFAQ 1EY0A 4MN3A 4DR5Q 4YCVA 3E0EA 3I7FA 4LF6Q 1VF7A 4A4IA 1EIFA 2IPKD 1CT1D 5T1GA 4EX5A 5JEAJ 4CKBA 1HCZA 3CRKC 3HOXH 2ATWA 3RD4A 1MIUA 4C56C 4CDCC 1D1KA 5HY6A 1PLFA 3ERSX 4IN3A 3NTIA 2ENBA 4C3HG 1I5FA 4X64L 1EU4A 2OQKA 3LWUA 4DU9A 3J7ZC 2B2YC 3KBXA 2IX0A 5COYA 5EBDA 2AWNA 1EQVA 1E1OA 1STBA 2L4NA 1X55A 1BCPC 4DK1A 2E2HB 1Q1EA 5EPJA 4CJ1B 1ICFB 2F0KA 1G91A 4X6AH 5ELBA 1JMCA 5FJ8G 4KN4C 1B3AA 3OWEB 3S1MH 4DUZQ 3S17B 5J3BA 4YCUA 4LF8L 1UE7A 5C3XA 3HOYH 1Q1BA 2Z4HA 3RLFA 1VQ5A 4A3CH 1D7QA 2JA6H 2UXDQ 2ZXPA 2RSOA 4J1MA 2R7DA 1ENCA 4DR6L 4A93H 5I2YA 4GN3B 5C4JH 1Y1VB 3VA5A 2JEAI 1ESFA 3CC2A 3F1ZA 5E4WC 5EAYA 5A2QL 2F0HA 1GUOA 2NVYB 4YWKA 1HZCA 1EIGA 3HOYG 5ELOA 3PCOB 1F2YA 4MZ9A 1NY4A 2B29A 1TWAB 1VQBA 2CHBD 2EIFA 4A93G 1SN8A 1SMYD 1G8ZD 1RF2D 3NUCA 1A3VA 1XPRA 2PQEA 4DV0L 1C4QA 2V1CC 1VQFA 4RCNA 5E1FA 2NVQB 3KUPA 1I94L 3CCQA 3HOUG 1F9RA 3P20A 1YJ9A 4EQPA 3L0OA 1AZPA 4G7OC 3T1YQ 1XNQQ 4X66Q 2F0TA 2IY5B 5EKKA 1B70B 4N9TA 1STNA 2B2TA 5GROA 4TRDA 3ITPA 4GOPB 4PG3A 4K14A 1IL2A 4LFBQ 3MTSA 3M4PA 3I2ZA 4LFAL 3DWAA 4DR5L 1KDBA 2I46A 4NKLA 1PYSB 3S1RH 4IPDA 1RJTA 5DLQE 1PTOF 3GTLB 1TS3A 1EY6A 4UDUC 4EQ5A 3GP7A 1BO0A 3MFYA 1BBXC 1BKBA 4ZYSA 3E6ZX 4F7XA 5LMNW 4V0BA 2HT1A 4KHPL 1LM0A 2N3SA 4DV7Q 2N55A 1J9OA 2UU9Q 4BY7H 4J8QA 4LNQA 4ZQ3A 4JI1L 2CWAA 4Q5VA 2A74C 1STHA 2ZTDA 4JI4Q 4OO1H 4IFDH 3VR2A 3QB3A 3GO5A 4N8FA 3JAMc 2KECA 1WD0A 3S24A 1QNKA 2QKIC 3OTOQ 1PH9A 1X3QA 4IPCA 2VZAA 1O7LA 1NSNS 1X3EA 1ZXTA 4BY7G 5KGUA 3R2IA 1VMPA 3N6RA 2JYOA 3HRZC 1PA6A 2WFWA 1XTCD 1U4MA 1GUWA 1BOSA 3FHWA 1Y1WG 2E75C 3KBGA 1XMQQ 4KJOA 1N36Q 1QUQA 3M3YH 3CKIB 4JOIC 2B2WA 1K83B 3S17H 2R93H 1WYDA 3KF8A 1V1PB 1EYAA 3HP3A 1JE5A 1B4OA 4A3LG 2O5IC 3IFDA 3LWEA 3M4QA 2LSSA 5D14A 1TR5A 1STYA 5FLMH 4JI3Q 1MD2D 4JYAQ 3IAYA 1PXUA 3PSIA 2Q2IA 5HURA 4DR2L 3PO2G 1DJRD 5BR8Q 4H02A 2F0JA 5C44H 1CSPA 3FVQA 2D0PA 2N88A 3BVGA 4IUNA 4TVAB 3K8AA 4A3BB 2R93G 1SAPA 3MZ5A 1VQAA 3J81L 1YNNC 3PV0A 3S1NB 1S5FD 3CPWA 2FHTA 5CBEE 4A3KG 3S1QH 3U50C 4Y7NH 3OIPA 1IBLQ 4YY3Q 3T1YL 1XNQL 4X66L 2QDBA 3TP6A 1UWVA 4FF4A 2PI2A 5IP9G 5IYBH 4NPSA 4QL5A 1PRTB 1CQFA 3CMAA 1EY8A 4PQXA 4BY1B 4NB3A 5ELEA 1Q8KA 3GTJH 1K9MC 4WFN3 3I55A 1FVIA 1JT8A 1WTHA 5EJWA 5IT9L 2X69A 4GOPC 4K5VA 4H13C 4R8IA 1YNXA 1U4LA 1A15A 5EPKA 1GKHA 5IGEA 4JV5Q 5IP7H 1SE3A 4A3GG 3T13A 2NBFA 3D0FA 4DV7L 2UU9L 3N52A 3A8JE 4JI7Q 2JA5H 2YYZA 1HQRD 1WCMH 4JI4L 4HAEA 3ICEA 3A8KE 5IWAL 4P75A 2MUYA 3RN5A 3BVMA 3CW2C 4JVZA 3TDQA 4DV1Q 2KEDA 3TRZA 2XGTA 2UXCQ 5IP7G 3OTOL 2AHOB 1CI3M 1J5EL 4J6HA 3H3VI 1YVCA 4C2MH 1KRSA 3BZDB 2F0FA 4LF7Q 1A3UA 1B8AA 1KLGD 4XT3B 2K03A 1HUMA 1N36L 2F0OA 2QA4A 1LUZA 3KLSX 1E3PA 2SDFA 3M85A 1VQ4A 4UP9A 2B2UA 3MFGA 5IYCH 3PO3B 3NELA 1D8LA 2F1MA 1FL0A 2B2VC 5DAUA 1T5XD 2IW3A 4HJ5A 1KLUD 2ZJQA 5CV5A 1TWGB 3K57A 1M8AA 1N34Q 3I4MH 3MXUA 5ELCA 1IKLA 5BR8L 3SXHA 4GNXB 1HTLD 1V8QA 4X62Q 3MXPA 1X3FA 1EQQA 5JEAH 1FGUA 2SNMA 1D5MC 3QO2A 5M3FH 1IBLL 1Y69U 3V2TA 4EVOA 2F03A 1X65A 2YTXA 4E6IA 1VQPA 3QIAA 4DNIA 3ND9A 4OEMB 3NEMA 3ER0A 4KKUA 4B08A 4CJ0B 1LTRD 4BWGB 4K2KA 1WTVA 1VDZA 1BCPF 4IOAA 2C5CA 3RN2A 3JAML 2YV5A 5CV9A 3OW7A 1RDPD 4A75A 3AB9A 1EQRA 1MHWC 4NXMQ 3HEJA 4B3SQ 3NENA 2Q8RE 4KLKA 2CH4A 4IUTA 5C6AA 2NYZD 4OGQC 1PRTC 4JV5L 4A3EG 3EBEA 4LF9L 1ML0D 2BA0A 2E76C 2HIVA 2VW9A 1G6PA 1EY9A 1AP0A 4BBSB 4BY1H 3HOVH 1I4QA 4UP8A 4DAPA 3ERQA 1TQOA 4L5RC 5LHY1 5IYDH 3OMGA 5CMDA 2EY1A 1A2UA 1LTLA 2B39A 4CGYB 5I2XA 1QJOA 3HKSA 3MVVA 1SJED 3I90A 4DV1L 1X9NA 2HD3A 3TSSA 4LW1A 1UE5A 1NNXA 2UXCL 1HA5A 2M00A 3UE1A 1WOCA 4R4TA 4R4OA 3TEHB 1O7ZA 4L5SA 3NE5B 3ULJA 2R6GA 2LY7A 1V9PA 4DR7Q 3M4YA 1S5ED 4FXKC 1TU2B 2RDHA 4LF7L 4IUPA 1AFPA 1CKNA 2F0UA 2L15A 2FFKB 1R4PB 2A6ED 2F0DA 3I91A 3SEBA 4RAUC 2RDGA 3RZOB 3VR4A 3S16H 1SYCA 4PNYA 4LWCA 1WD1A 1D5XC 2D0OA 1TS2A 3F2UA 4IFDJ 1PTOH 3KK7A 4JI0L 3I4LA 4PMWA 3WOFA 1HZ9A 1LTAD 1BXTA 4AIMA 4AQYL 3NBIA 3NHHA 3GTKH 3J81j 1KC8C 2MHVA 3NXWA 1AE2A 1Y14B 3K58A 4NMZA 4DV6Q 2BDOA 1MJCA 4FP5D 3H0GH 1VF5C 2P5ZX 1N34L 2G5DA 2WKCA 2EYHA 2Z6KC 4QGUA 3PMFA 1AEXA 2KA7A 3HOWH 3I4NH 1JORA 1HR0L 4X62L 2KHJA 4LK1C 3G7LA 1DM0B 1IHZA 2RHSB 4BBRH 1HPCA 1QG7A 2IWHA 1SBBB 1UEBA 1WTPA 1EWHA 3BYYB 4IO9A 1G291 1VCIA 3V96A 1C9OA 1C7YA 4KTAA 4GNXC 3JAME 2K05A 1UAPA 2L12A 4Z9CB 1VQMA 4A76A 3DWQA 1MBYA 5T1IA 4MNOA 3I4NG 1CM9A 1I6HH 1EFID 5KRUA 1QCBD 3I73A 4K2LA 1Q46A 1G2TA 2WAQG 1JWMD 2CWPA 4OWXB 2HUGA 5M3MG 1GJXA 1XXGA 1PH3A 3UE0A 4ZKBB 2XIWA 2OEOA 4OIKA 4CDFC 4NXML 4A3MH 1B50A 4A3JH 4GLVB 5C3WA 4P74A 3S15H 4KN7C 1NBWA 1Q3LA 3S1MB 3K6OA 1F77A 2RQXA 1MI2A 4ALPA 3S14H 5C0XH 1JB3A 2RDFA 3VYRA 3CCEA 3HOYB 1I4PA 1YHAA 5DM73 2AQ1B 4K5XA 4YIJA 2JA6B 3F2DA 1STAA 1NMGA 2KQ3A 4A3MG 4DR1Q 2A69C 2F4IA 1O7YA 4A93B 1IKMA 4ZK9B 2KHIA 2ZT9C 2JE6I 5C4JB 1TIID 4YCWA 2ZM6L 1S40A 5C3EH 4NXNL 2F4VL 4DR7L 1AH9A 2QEJC 2B63H 3SK6A 4LJZC 5C0XG 4QB4A 2HDMA 2DY7A 4A3FG 1CZGA 4LF5L 3I4OA 1SE2A 4C1NK 2QILA 2WAQE 4IJHA 4HSVA 2AQ2B 1FYCA 4ID6A 2Y0SG 2JA8H 2VQEQ 1M4VA 2ZTCA 1EY4A 1RCVD 2XRQD 2O5JC 1D2BA 3PF4A 4DV6L 3HFZB 1XX8A 1SMXA 1QB5D 1L1OA 3LX0A 4OXPA 4FO2A 4YWMA 1KABA 4P73A 1UNSA 1CKMA 1BQQT 3Q6SA 3K5MA 1ILQA 3CRLC 1V43A 5FO7B 1C8CA 1H9MA 3KFUA 1LTID 3GV6A 1HA6A 1I94Q 4KKSA 1PDQA 3KJPA 4HJ9A 2I5MX 4B3TQ 3S1RB 1L0XB 2E2IH 4IZ8A 2XRSD 3DEPA 3C1EA 3Q0AA 3D8GA 2EQSA 3FP9A 1ENFA 1YJWA 1MGSA 1CHPD 4RMFA 2NN6I 4C3HH 3K5LA 3C1FA 5FO8B 4BY7B 3G6JB 2H1EA 4JBWA 4JC0A 5J1ZA 1DGSA 5EQ0A 1O78A 2Y0SE 3UDXA 3HOZG 2L5TA 1XTDA 2DNEA 3A5ZB 1WTQA 2QCPX 2NWGA 3J81c 1Q81C 1NMFA 4JG2A 4GS3A 4KK7A 3FKIG 1PTOD 3G6EA 4KHPQ 5FJ8H 4DN4M 2F0VA 4R4CA 4DNRB 1OXUA 4RGNA 4AYBG 1CQVA 4QY7A 1B44D 4JI1Q 4P71A 3CD6A 2M9VA 4HEDA 5CBAE 1E2WA 2PO4A 4HCEA 5G3LD 1FNVA 4XQNA 5IGCA 2PPBC 4CHTB 4C3IH 1GXDC 5KYIA 4DR1L 3P7JA 1SROA 1LT6D 4PZ6A 3IL8A 1QUQB 3M3YB 3I56A 4IPGA 5IT9c 2YTVA 1O7IA 2EY5A 1W2BA 2OF1A 4BS9A 1EFWA 2R93B 3GDEA 2EPBA 3KF8B 5H1SE 1W3SA 2EZVA 2B2YA 1F2MA 3CAMA 3AFQA 1WJJA 3TP7A 1QVCA 4C3IG 3I70A 1HQMC 2DY8A 2R3ZA 2ZTEA 1JJCB 3VYTA 1B9MA 4NW2A 3ULLA 1ASYA 3NBHA 5M5XH 3WWVA 3A7AB 4RA8A 5C44B 2M2LA 2VQEL 2XTIA 1CKOA 3HOUH 1SR3A 1Y8OB 2AQ3B 3FRPB 1VQLA 3S1QB 3OPOA 5IGDA 2ASBA 4Y7NB 4AYBE 2R7FA 4C1NI 3CCRA 4UHVA 4FDBA 1TWFH 3CCJA 2K5DA
chains in the Genus database with same CATH topology
4BA1I 4DR2Q 4POGA 4L5QA 1UWVA 3A74A 1UE6A 3AYHB 1BBWA 1M90C 2PI2A 5IP9G 5IYBH 4A3BG 4NPSA 4QL5A 3PGZA 3CMAA 2UUCQ 3RLNA 4JI7L 2MO0A 3DM3A 1E7ZA 4NB3A 3UDIA 1PYBA 1Q8KA 4GKJQ 3GTJH 4DV2Q 4B3TL 1K9MC 1L0WA 3I55A 1FVIA 3PUYA 1JT8A 1IBMQ 3M4OH 3KDFA 3W1GA 1XPUA 2NN6G 4GOPC 1VQNA 3CC4A 2YU9H 2H5XA 3TQYA 4LFCQ 1YBYA 1YNXA 3L2PA 1GKHA 1SLJA 4JV5Q 5IP7H 4A3GG 4HIDA 1IBKL 1IXRA 2GVBA 2Q2HA 3D0FA 1N32Q 4DV7L 1ASZA 2UU9L 2R7ZG 2E2JH 3VDYA 2PNHA 1KHIA 1P16A 1X54A 1K3RA 3CP0A 2N78A 4OWTB 4BY1G 2JA5H 2Q2UA 2YYZA 4JI7Q 3HOVG 1VQ9A 4HIMA 4DR3Q 5ELNA 1WCMH 4JI4L 4A3IH 1KL9A 3K80C 3K81C 5IYDG 5IE8A 5GAEC 3ICEA 2NZHA 5IWAL 3HOZH 4P75A 4JI8Q 3RN5A 4OONA 3A5UA 3CW2C 2E5LQ 1N33L 4DV1Q 4LUZA 2HHHQ 3T1HL 3FKIH 3TRZA 2XGTA 2K5HA 2UXCQ 5IP7G 3D31A 3OTOL 2AHOB 1IZ6A 1MJEA 1J5EL 5GAHC 1BBUA 2AMCB 3H3VI 1YVCA 2D62A 1TWCH 4C2MH 1KRSA 4DPGA 1VS0A 3ZJYC 1H95A 2UXBL 4A3IG 4LF7Q 1B8AA 3S2HH 3U4ZA 1VQDA 2VS1A 4QIWE 5IWAQ 1Q86C 1PH1A 2LXKA 1Y1WH 2WP8J 1E24A 1EYGA 2BH2A 4GKKQ 1JB7A 5LMUQ 1N36L 2I0QA 3CC7A 2I5HA 1RIPA 3W1BA 1EWIA 1Z9FA 1LYLA 3AFPA 2ZJPA 1HNZQ 3GTQH 2QA4A 2Z6KA 1LUZA 1E3PA 3CCVA 1J5EQ 3M85A 1VQ4A 4UP9A 4R4IA 1PH7A 3S2DH 3PO3H 1GD7A 4AH6A 2OTLA 1NTGA 5IYCH 2JJQA 4LUVA 3DLLA 3NELA 1D8LA 2CFMA 2EXDA 1UE1A 5LMNL 4A3LH 3CCUA 1FL0A 4DAMA 5FLXc 4JI2L 4HJ5A 3CCLA 1TWGH 2ZJQA 4DV3L 3G48A 3OW2A 2UUAQ 1PVOA 1A62A 3CCSA 3H0GG 3PUVA 1Z47A 1N34Q 4MTNA 5C0XJ 3PO2H 3I4MH 1Q82C 1N9WA 5BR8L 4DR4Q 4GNXA 2R92H 3HOWG 4GNXB 2K4KA 4X62Q 3K7AH 1XNRQ 1X3FA 1JJ2A 2B3GA 3KF6A 4BBRG 2NVTH 4YHHL 1EQQA 1PH5A 1N8RC 1FGUA 4DV4L 2VNUD 2VQFL 4A3KH 3GTPH 2KCMA 3PUWA 4JCVE 5M3FH 1IBLL 3UDFA 1S3OA 1I3QH 4B3SL 3RR5A 1JJGA 1X65A 1Q12A 2IHFA 2YTXA 4IPHA 3HOXG 1U0LA 4GLXA 3RZDH 1VQPA 2YTYA 4DNIA 2R92G 1PV4A 5IP9H 4HJ7A 3NEMA 3ER0A 4X64Q 2BA1A 5HGQA 1OTCA 2UUCL 4K0KL 1VQJA 4IOAA 3RN2A 2A1AA 1PH2A 1CUKA 2YV5A 2VQFQ 2JK8A 4GKJL 4DV2L 1SE8A 4A75A 1EQRA 4O0AA 3IRBA 1XPOA 5C4XH 4B3SQ 4NXMQ 2OQ0A 3NENA 3GTOH 1IBML 3GD7A 4KLKA 3STBC 3MXNB 3BZCA 1QVFA 1PH6A 4LFCL 4UY8C 4A3JG 3H3VH 4JV5L 1OXXK 4A3EG 4A3GH 3EBEA 4LF9L 2BA0A 2HIVA 2N8NA 3AQQA 1N32L 2VW9A 1G6PA 2R7ZH 4BBSH 4BY1H 3HOVH 4K0KQ 4LF8Q 3M9BA 4UP8A 4DK6C 5AJ3Q 3PIPA 3TREA 4DR3L 4L5RC 4A3DH 1L1OC 5IYDH 4TQUS 4DKAC 2ZJRA 2PMZE 4A3CG 1LTLA 2JA6G 2MFIA 3U58A 5C4XG 4JI8L 3HKSA 1QZHA 1PH4A 2E5LL 4DR6Q 4DV1L 1VQOA 1X9NA 1A0IA 2HHHL 4PZ7A 2JQOA 4LW1A 1UE5A 4BXXH 1Y1VG 2UXCL 4LF9Q 2OTJA 5GQOA 2K5VA 3BU2A 3UE1A 1PH8A 1WOCA 4R4TA 4R4OA 3TEHB 3PIOA 3PF5A 4L5SA 2KCTA 3ULJA 4BBSG 1OXTA 2R6GA 1VQ8A 5C3EG 1V9PA 4B3MQ 3A0JA 4DV5L 4DR7Q 1HNWQ 2RCNA 4A3DG 2B63G 1A63A 4LF7L 4QQBX 1HR0W 1CKNA 2L15A 4C3JH 1CKNB 1V1QA 3TS0A 3RZOH 4GKKL 3S16H 5C0XI 1K0RA 4LWCA 5LMUL 2A19A 4IJLA 2D0OA 3STBD 1VQ7A 4BXXG 3ULPA 4IFDJ 1VQIA 4JI0L 2K14A 4PMWA 1HNZL 1HZ9A 2VUMH 4DV0Q 1NE3A 4AQYL 4AIMA 1XMOQ 2JA8G 1VQHA 4KI0A 2OCEA 3KYHC 1KIXA 2IT1A 3UDGA 3GTKH 3GTMH 3J81j 3EN2A 1KC8C 2Z0SA 4DV5Q 1OXVA 3KLWA 1AE2A 1Y14B 4GN4B 4LF6L 2IX1A 4DV6Q 1XJVA 3GTGH 1MJCA 4HJ8A 2RHQB 1WFQA 2UUAL 3SGIA 2UUBQ 2HIXA 3H0GH 4POFA 5JJKA 1L2FA 1N34L 5M5YH 2C35B 2Z6KC 4QGUA 1YEZA 1KAWA 3F2BA 2K52A 3HOWH 3I4NH 4DR4L 1M1KC 1HR0L 4JI0Q 4X62L 3U4VA 2CCZA 2KHJA 2ID0A 4JI6L 2AWOA 3H15A 1NJIC 1FJGQ 2RHSB 1XNRL 4BBRH 2VUMG 4WJ4A 2JA9A 4AQYQ 1HZAA 5JJIA 3KJOA 4J15A 4LFAQ 1HNXQ 1VQ6A 1UEBA 1VQGA 4IO9A 4DAYB 4DR5Q 4YCVA 1G291 3E0EA 3I7FA 1VCIA 4LF6Q 1I50H 4A4IA 1EIFA 1C9OA 4GN5A 1YHBA 2F3IA 4EX5A 5JEAJ 1C7YA 1KQSA 3L7ZC 4QJFA 3HOXH 4GNXC 2ATWA 1MIUA 1HZBA 1VQMA 4A76A 4APVA 5HY6A 3ERSX 3F8TA 4MNOA 3I4NG 1I6HH 1HR0Q 1T9HA 4JI6Q 2QGQA 1I5FA 1YITA 4X64L 2VL6A 2OQKA 3MEFA 4L5TA 1TWHH 3J7ZC 4DUZL 3RLOA 1PFSA 1Q46A 2IX0A 1KRTA 2WAQG 2CWPA 3K7UC 3OYYA 4OWXB 2AWNA 3CCMA 5M3MG 1YIJA 1E1OA 1PH3A 3UE0A 1X55A 1GO3E 2E2HH 4OO1G 2UXDL 3J81i 4OWWB 4NXML 4IFDG 4A3MH 1Q1EA 2ALYB 5E7NA 1RL2A 4P72A 4A3JH 3RNUA 2VY3A 4A3EH 4GLVB 4X6AH 2IHEA 3JC66 4P74A 1JMCA 5FJ8G 2E8GA 3S15H 2MQHA 1NBWA 3S1MH 4DUZQ 1J6QA 5J3BA 2LXJA 4YCUA 4JOIA 1CSQA 1YZ6A 4LF8L 1UE7A 5AJ3L 1GVPA 3S14H 4ALPA 3HOYH 1Q1BA 1VQ5A 3RLFA 4BA2I 3CCEA 4A3CH 1D7QA 2DUDA 2JA6H 1YHAA 2UXDQ 3F2DA 1U5KA 1NMGA 4PZ8A 4A3MG 2R7DA 2K50A 3G4SA 1S72A 4OX9Q 4A93H 4DR6L 4DR1Q 3LGJA 4X65Q 4OO1I 4GN3B 1Y1VH 4IFDI 3CQZH 2KHIA 5C4JH 4HJAA 3J7A5 2JEAI 2JE6I 1E22A 4YCWA 3CC2A 1HJPA 2ZM6L 1S40A 3F1ZA 5C3EH 2CQOA 3CXCA 1SRUA 2NVYH 4NXNL 5EAYA 4B3ML 2F4VL 2K75A 4DR7L 1HNWL 1AH9A 4YWKA 1HZCA 2B63H 3HOYG 5C0XG 5ELOA 3PCOB 4LUOA 4JI5Q 4UPAA 4A3FG 1E1TA 4LF5L 4MZ9A 1TWAH 1NY4A 4Y52H 2B29A 5FLMG 3I4OA 1VQBA 4B3RQ 2EIFA 2WAQE 4IJHA 4A93G 1SN8A 2F52A 1MKHA 2NVXH 4DK3C 1VQEA 1XPRA 2AKWB 5C44G 1K73C 2Y0SG 4DV0L 4LFBL 1XMOL 2JA8H 2V1CC 2VQEQ 2NVQH 1VQFA 2ZM6Q 2CKZB 1I94L 3CCQA 2ZTCA 4NXNQ 3HOUG 2F4VQ 1X56A 4O2DA 2JEBI 1YJ9A 3PF4A 4DUYQ 3L0OA 3J80i 3HFZB 3CF5A 2DGYA 4DV6L 4LF4Q 3T1YQ 1SMXA 4LF5Q 2UUBL 1L1OA 1XNQQ 4X66Q 2IY5B 1L1OB 4OXPA 5GAGC 4YWMA 3KDFB 4P73A 1B70B 2ES2A 1CKMA 4HIKA 5GROA 4GOPA 1VQCA 1VQKA 2MO1A 4GOPB 3F2CA 1FJGL 1V43A 4PG3A 1IL2A 5IYBG 3KFUA 4LFBQ 3M4PA 3I2ZA 1HNXL 4LFAL 1I94Q 3KJPA 4DR5L 4HJ9A 2I5MX 4R1JA 4IOCA 1PYSB 3S1RH 3GTLH 4IPDA 5DLQE 4B3TQ 2E2IH 1TXYA 1A8VA 1EOVA 4EQ5A 5M5WH 1YHQA 2K5NA 2EQSA 3E9HA 3FP9A 3W5OA 1R9TH 1YJWA 2A8VA 4JBJA 1BKBA 3BZKA 4WJ3M 1X3GA 2WB1G 4RMFA 4GLAC 5LMNW 3HKZG 2HT1A 1IBKQ 4KHPL 2NN6I 4C3HH 1LM0A 2N3SA 4DV7Q 2N49A 4R4QA 2UU9Q 4BY7H 4LNQA 4YWLA 3PUXA 4JBMA 4JI1L 2JA5G 5M3MH 4JBWA 2CWAA 1P8LA 2ZTDA 1WCMG 4JI4Q 4JC0A 4XIGS 1DGSA 2JA7H 2Y0SE 1EUJA 3GO5A 3UDXA 3AEVA 3HOZG 4HIOA 1XTDA 3A5ZB 1KXLA 1XMQL 3JAMc 3J81c 1Q81C 1NMFA 1N33Q 4JG2A 1WI5A 4GS3A 3T1HQ 3TS2A 4UP7A 3FKIG 1X6OA 3K0XA 3S24A 3OTOQ 1PH9A 4IPCA 3G6EA 2QEXA 2VZAA 5FJ8H 4KHPQ 1OXSC 3B6YA 1X3EA 3KOJA 4R4CA 1OXUA 4AYBG 3CPFA 1BVSA 4QY7A 1IYJB 1QVGA 4BY7G 4JI1Q 4P71A 1K8AC 3CD6A 2KENA 4KHZA 1PA6A 3BJUA 2UXBQ 3Q8DA 2WFWA 1C0AA 2PI2E 2KBNA 3JAMi 1Q7YC 1QZGA 2Q2TA 3E9IA 2JA7G 4JI3L 2GVAA 4JYAL 4ME3A 4C3IH 5JJLA 2MNAA 3FHWA 1Y1WG 4OX9L 1YJNA 1XMQQ 2NZOA 4DR1L 2FXQA 4X65L 1SROA 1QUQA 4PZ6A 1N36Q 3M3YH 3G71A 1QUQB 1K83H 4RG1A 4JOIC 5IY0A 3S17H 3I56A 4IPGA 5IT9c 2YTVA 1O7IA 1W2BA 2R93H 4JBKA 5GADC 1WYDA 3KF6B 1EFWA 3PO3G 2I5LX 3GDEA 3KF8B 5H1SE 1JE5A 5IYCG 1W3SA 2WB1E 5LMNQ 1AE3A 4A3LG 3HKZE 3CAMA 4JI2Q 4JI5L 1YI2A 1K8GA 4A3FH 1SFOH 4YY3L 3M4QA 2LSSA 3AFQA 1WJJA 4DV3Q 1GM5A 5FLMH 1EIYB 4JI3Q 1QVCA 4JYAQ 3PSIA 4B3RL 1HH2P 2Q2IA 4DR2L 1PHJA 3CMEA 3PO2G 3I4MG 2PQAA 5BR8Q 2PQAB 2RF4A 1JJCB 2ZTEA 4H02A 5C44H 3ULLA 4A3BH 1ASYA 5M5XH 3WWVA 1CSPA 1G51A 2D0PA 3NBHB 4TVAB 2VQEL 2OWOA 2XTIA 3K8AA 3M7NA 4YHHQ 2R93G 1CKOA 2GN5A 3EIVA 3HOUH 4XTCS 1VQAA 5JEAG 1KD1C 3S1NH 5K36G 3PV0A 4DV4Q 1SR3A 3PUZA 3CPWA 3S1QH 4A3KG 1B7YB 2HQLA 3U50C 4DUYL 5M3FG 4Y7NH 1VQLA 4LF4L 1IBLQ 4YY3Q 3T1YL 2ASBA 4AYBE 2R7FA 1XNQL 2BH8A 4X66L 3CCRA 4FDBA 3J80c 1TWFH 3CCJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BA1 I;  4DR2 Q;  4POG A;  4L5Q A;  1UWV A;  3A74 A;  1UE6 A;  3AYH B;  1BBW A;  1M90 C;  2PI2 A;  5IP9 G;  5IYB H;  4A3B G;  4NPS A;  4QL5 A;  3PGZ A;  3CMA A;  2UUC Q;  3RLN A;  4JI7 L;  2MO0 A;  3DM3 A;  1E7Z A;  4NB3 A;  3UDI A;  1PYB A;  1Q8K A;  4GKJ Q;  3GTJ H;  4DV2 Q;  4B3T L;  1K9M C;  1L0W A;  3I55 A;  1FVI A;  3PUY A;  1JT8 A;  1IBM Q;  3M4O H;  3KDF A;  3W1G A;  1XPU A;  2NN6 G;  4GOP C;  1VQN A;  3CC4 A;  2YU9 H;  2H5X A;  3TQY A;  4LFC Q;  1YBY A;  1YNX A;  3L2P A;  1GKH A;  1SLJ A;  4JV5 Q;  5IP7 H;  4A3G G;  4HID A;  1IBK L;  1IXR A;  2GVB A;  2Q2H A;  3D0F A;  1N32 Q;  4DV7 L;  1ASZ A;  2UU9 L;  2R7Z G;  2E2J H;  3VDY A;  2PNH A;  1KHI A;  1P16 A;  1X54 A;  1K3R A;  3CP0 A;  2N78 A;  4OWT B;  4BY1 G;  2JA5 H;  2Q2U A;  2YYZ A;  4JI7 Q;  3HOV G;  1VQ9 A;  4HIM A;  4DR3 Q;  5ELN A;  1WCM H;  4JI4 L;  4A3I H;  1KL9 A;  3K80 C;  3K81 C;  5IYD G;  5IE8 A;  5GAE C;  3ICE A;  2NZH A;  5IWA L;  3HOZ H;  4P75 A;  4JI8 Q;  3RN5 A;  4OON A;  3A5U A;  3CW2 C;  2E5L Q;  1N33 L;  4DV1 Q;  4LUZ A;  2HHH Q;  3T1H L;  3FKI H;  3TRZ A;  2XGT A;  2K5H A;  2UXC Q;  5IP7 G;  3D31 A;  3OTO L;  2AHO B;  1IZ6 A;  1MJE A;  1J5E L;  5GAH C;  1BBU A;  2AMC B;  3H3V I;  1YVC A;  2D62 A;  1TWC H;  4C2M H;  1KRS A;  4DPG A;  1VS0 A;  3ZJY C;  1H95 A;  2UXB L;  4A3I G;  4LF7 Q;  1B8A A;  3S2H H;  3U4Z A;  1VQD A;  2VS1 A;  4QIW E;  5IWA Q;  1Q86 C;  1PH1 A;  2LXK A;  1Y1W H;  2WP8 J;  1E24 A;  1EYG A;  2BH2 A;  4GKK Q;  1JB7 A;  5LMU Q;  1N36 L;  2I0Q A;  3CC7 A;  2I5H A;  1RIP A;  3W1B A;  1EWI A;  1Z9F A;  1LYL A;  3AFP A;  2ZJP A;  1HNZ Q;  3GTQ H;  2QA4 A;  2Z6K A;  1LUZ A;  1E3P A;  3CCV A;  1J5E Q;  3M85 A;  1VQ4 A;  4UP9 A;  4R4I A;  1PH7 A;  3S2D H;  3PO3 H;  1GD7 A;  4AH6 A;  2OTL A;  1NTG A;  5IYC H;  2JJQ A;  4LUV A;  3DLL A;  3NEL A;  1D8L A;  2CFM A;  2EXD A;  1UE1 A;  5LMN L;  4A3L H;  3CCU A;  1FL0 A;  4DAM A;  5FLX c;  4JI2 L;  4HJ5 A;  3CCL A;  1TWG H;  2ZJQ A;  4DV3 L;  3G48 A;  3OW2 A;  2UUA Q;  1PVO A;  1A62 A;  3CCS A;  3H0G G;  3PUV A;  1Z47 A;  1N34 Q;  4MTN A;  5C0X J;  3PO2 H;  3I4M H;  1Q82 C;  1N9W A;  5BR8 L;  4DR4 Q;  4GNX A;  2R92 H;  3HOW G;  4GNX B;  2K4K A;  4X62 Q;  3K7A H;  1XNR Q;  1X3F A;  1JJ2 A;  2B3G A;  3KF6 A;  4BBR G;  2NVT H;  4YHH L;  1EQQ A;  1PH5 A;  1N8R C;  1FGU A;  4DV4 L;  2VNU D;  2VQF L;  4A3K H;  3GTP H;  2KCM A;  3PUW A;  4JCV E;  5M3F H;  1IBL L;  3UDF A;  1S3O A;  1I3Q H;  4B3S L;  3RR5 A;  1JJG A;  1X65 A;  1Q12 A;  2IHF A;  2YTX A;  4IPH A;  3HOX G;  1U0L A;  4GLX A;  3RZD H;  1VQP A;  2YTY A;  4DNI A;  2R92 G;  1PV4 A;  5IP9 H;  4HJ7 A;  3NEM A;  3ER0 A;  4X64 Q;  2BA1 A;  5HGQ A;  1OTC A;  2UUC L;  4K0K L;  1VQJ A;  4IOA A;  3RN2 A;  2A1A A;  1PH2 A;  1CUK A;  2YV5 A;  2VQF Q;  2JK8 A;  4GKJ L;  4DV2 L;  1SE8 A;  4A75 A;  1EQR A;  4O0A A;  3IRB A;  1XPO A;  5C4X H;  4B3S Q;  4NXM Q;  2OQ0 A;  3NEN A;  3GTO H;  1IBM L;  3GD7 A;  4KLK A;  3STB C;  3MXN B;  3BZC A;  1QVF A;  1PH6 A;  4LFC L;  4UY8 C;  4A3J G;  3H3V H;  4JV5 L;  1OXX K;  4A3E G;  4A3G H;  3EBE A;  4LF9 L;  2BA0 A;  2HIV A;  2N8N A;  3AQQ A;  1N32 L;  2VW9 A;  1G6P A;  2R7Z H;  4BBS H;  4BY1 H;  3HOV H;  4K0K Q;  4LF8 Q;  3M9B A;  4UP8 A;  4DK6 C;  5AJ3 Q;  3PIP A;  3TRE A;  4DR3 L;  4L5R C;  4A3D H;  1L1O C;  5IYD H;  4TQU S;  4DKA C;  2ZJR A;  2PMZ E;  4A3C G;  1LTL A;  2JA6 G;  2MFI A;  3U58 A;  5C4X G;  4JI8 L;  3HKS A;  1QZH A;  1PH4 A;  2E5L L;  4DR6 Q;  4DV1 L;  1VQO A;  1X9N A;  1A0I A;  2HHH L;  4PZ7 A;  2JQO A;  4LW1 A;  1UE5 A;  4BXX H;  1Y1V G;  2UXC L;  4LF9 Q;  2OTJ A;  5GQO A;  2K5V A;  3BU2 A;  3UE1 A;  1PH8 A;  1WOC A;  4R4T A;  4R4O A;  3TEH B;  3PIO A;  3PF5 A;  4L5S A;  2KCT A;  3ULJ A;  4BBS G;  1OXT A;  2R6G A;  1VQ8 A;  5C3E G;  1V9P A;  4B3M Q;  3A0J A;  4DV5 L;  4DR7 Q;  1HNW Q;  2RCN A;  4A3D G;  2B63 G;  1A63 A;  4LF7 L;  4QQB X;  1HR0 W;  1CKN A;  2L15 A;  4C3J H;  1CKN B;  1V1Q A;  3TS0 A;  3RZO H;  4GKK L;  3S16 H;  5C0X I;  1K0R A;  4LWC A;  5LMU L;  2A19 A;  4IJL A;  2D0O A;  3STB D;  1VQ7 A;  4BXX G;  3ULP A;  4IFD J;  1VQI A;  4JI0 L;  2K14 A;  4PMW A;  1HNZ L;  1HZ9 A;  2VUM H;  4DV0 Q;  1NE3 A;  4AQY L;  4AIM A;  1XMO Q;  2JA8 G;  1VQH A;  4KI0 A;  2OCE A;  3KYH C;  1KIX A;  2IT1 A;  3UDG A;  3GTK H;  3GTM H;  3J81 j;  3EN2 A;  1KC8 C;  2Z0S A;  4DV5 Q;  1OXV A;  3KLW A;  1AE2 A;  1Y14 B;  4GN4 B;  4LF6 L;  2IX1 A;  4DV6 Q;  1XJV A;  3GTG H;  1MJC A;  4HJ8 A;  2RHQ B;  1WFQ A;  2UUA L;  3SGI A;  2UUB Q;  2HIX A;  3H0G H;  4POF A;  5JJK A;  1L2F A;  1N34 L;  5M5Y H;  2C35 B;  2Z6K C;  4QGU A;  1YEZ A;  1KAW A;  3F2B A;  2K52 A;  3HOW H;  3I4N H;  4DR4 L;  1M1K C;  1HR0 L;  4JI0 Q;  4X62 L;  3U4V A;  2CCZ A;  2KHJ A;  2ID0 A;  4JI6 L;  2AWO A;  3H15 A;  1NJI C;  1FJG Q;  2RHS B;  1XNR L;  4BBR H;  2VUM G;  4WJ4 A;  2JA9 A;  4AQY Q;  1HZA A;  5JJI A;  3KJO A;  4J15 A;  4LFA Q;  1HNX Q;  1VQ6 A;  1UEB A;  1VQG A;  4IO9 A;  4DAY B;  4DR5 Q;  4YCV A;  1G29 1;  3E0E A;  3I7F A;  1VCI A;  4LF6 Q;  1I50 H;  4A4I A;  1EIF A;  1C9O A;  4GN5 A;  1YHB A;  2F3I A;  4EX5 A;  5JEA J;  1C7Y A;  1KQS A;  3L7Z C;  4QJF A;  3HOX H;  4GNX C;  2ATW A;  1MIU A;  1HZB A;  1VQM A;  4A76 A;  4APV A;  5HY6 A;  3ERS X;  3F8T A;  4MNO A;  3I4N G;  1I6H H;  1HR0 Q;  1T9H A;  4JI6 Q;  2QGQ A;  1I5F A;  1YIT A;  4X64 L;  2VL6 A;  2OQK A;  3MEF A;  4L5T A;  1TWH H;  3J7Z C;  4DUZ L;  3RLO A;  1PFS A;  1Q46 A;  2IX0 A;  1KRT A;  2WAQ G;  2CWP A;  3K7U C;  3OYY A;  4OWX B;  2AWN A;  3CCM A;  5M3M G;  1YIJ A;  1E1O A;  1PH3 A;  3UE0 A;  1X55 A;  1GO3 E;  2E2H H;  4OO1 G;  2UXD L;  3J81 i;  4OWW B;  4NXM L;  4IFD G;  4A3M H;  1Q1E A;  2ALY B;  5E7N A;  1RL2 A;  4P72 A;  4A3J H;  3RNU A;  2VY3 A;  4A3E H;  4GLV B;  4X6A H;  2IHE A;  3JC6 6;  4P74 A;  1JMC A;  5FJ8 G;  2E8G A;  3S15 H;  2MQH A;  1NBW A;  3S1M H;  4DUZ Q;  1J6Q A;  5J3B A;  2LXJ A;  4YCU A;  4JOI A;  1CSQ A;  1YZ6 A;  4LF8 L;  1UE7 A;  5AJ3 L;  1GVP A;  3S14 H;  4ALP A;  3HOY H;  1Q1B A;  1VQ5 A;  3RLF A;  4BA2 I;  3CCE A;  4A3C H;  1D7Q A;  2DUD A;  2JA6 H;  1YHA A;  2UXD Q;  3F2D A;  1U5K A;  1NMG A;  4PZ8 A;  4A3M G;  2R7D A;  2K50 A;  3G4S A;  1S72 A;  4OX9 Q;  4A93 H;  4DR6 L;  4DR1 Q;  3LGJ A;  4X65 Q;  4OO1 I;  4GN3 B;  1Y1V H;  4IFD I;  3CQZ H;  2KHI A;  5C4J H;  4HJA A;  3J7A 5;  2JEA I;  2JE6 I;  1E22 A;  4YCW A;  3CC2 A;  1HJP A;  2ZM6 L;  1S40 A;  3F1Z A;  5C3E H;  2CQO A;  3CXC A;  1SRU A;  2NVY H;  4NXN L;  5EAY A;  4B3M L;  2F4V L;  2K75 A;  4DR7 L;  1HNW L;  1AH9 A;  4YWK A;  1HZC A;  2B63 H;  3HOY G;  5C0X G;  5ELO A;  3PCO B;  4LUO A;  4JI5 Q;  4UPA A;  4A3F G;  1E1T A;  4LF5 L;  4MZ9 A;  1TWA H;  1NY4 A;  4Y52 H;  2B29 A;  5FLM G;  3I4O A;  1VQB A;  4B3R Q;  2EIF A;  2WAQ E;  4IJH A;  4A93 G;  1SN8 A;  2F52 A;  1MKH A;  2NVX H;  4DK3 C;  1VQE A;  1XPR A;  2AKW B;  5C44 G;  1K73 C;  2Y0S G;  4DV0 L;  4LFB L;  1XMO L;  2JA8 H;  2V1C C;  2VQE Q;  2NVQ H;  1VQF A;  2ZM6 Q;  2CKZ B;  1I94 L;  3CCQ A;  2ZTC A;  4NXN Q;  3HOU G;  2F4V Q;  1X56 A;  4O2D A;  2JEB I;  1YJ9 A;  3PF4 A;  4DUY Q;  3L0O A;  3J80 i;  3HFZ B;  3CF5 A;  2DGY A;  4DV6 L;  4LF4 Q;  3T1Y Q;  1SMX A;  4LF5 Q;  2UUB L;  1L1O A;  1XNQ Q;  4X66 Q;  2IY5 B;  1L1O B;  4OXP A;  5GAG C;  4YWM A;  3KDF B;  4P73 A;  1B70 B;  2ES2 A;  1CKM A;  4HIK A;  5GRO A;  4GOP A;  1VQC A;  1VQK A;  2MO1 A;  4GOP B;  3F2C A;  1FJG L;  1V43 A;  4PG3 A;  1IL2 A;  5IYB G;  3KFU A;  4LFB Q;  3M4P A;  3I2Z A;  1HNX L;  4LFA L;  1I94 Q;  3KJP A;  4DR5 L;  4HJ9 A;  2I5M X;  4R1J A;  4IOC A;  1PYS B;  3S1R H;  3GTL H;  4IPD A;  5DLQ E;  4B3T Q;  2E2I H;  1TXY A;  1A8V A;  1EOV A;  4EQ5 A;  5M5W H;  1YHQ A;  2K5N A;  2EQS A;  3E9H A;  3FP9 A;  3W5O A;  1R9T H;  1YJW A;  2A8V A;  4JBJ A;  1BKB A;  3BZK A;  4WJ3 M;  1X3G A;  2WB1 G;  4RMF A;  4GLA C;  5LMN W;  3HKZ G;  2HT1 A;  1IBK Q;  4KHP L;  2NN6 I;  4C3H H;  1LM0 A;  2N3S A;  4DV7 Q;  2N49 A;  4R4Q A;  2UU9 Q;  4BY7 H;  4LNQ A;  4YWL A;  3PUX A;  4JBM A;  4JI1 L;  2JA5 G;  5M3M H;  4JBW A;  2CWA A;  1P8L A;  2ZTD A;  1WCM G;  4JI4 Q;  4JC0 A;  4XIG S;  1DGS A;  2JA7 H;  2Y0S E;  1EUJ A;  3GO5 A;  3UDX A;  3AEV A;  3HOZ G;  4HIO A;  1XTD A;  3A5Z B;  1KXL A;  1XMQ L;  3JAM c;  3J81 c;  1Q81 C;  1NMF A;  1N33 Q;  4JG2 A;  1WI5 A;  4GS3 A;  3T1H Q;  3TS2 A;  4UP7 A;  3FKI G;  1X6O A;  3K0X A;  3S24 A;  3OTO Q;  1PH9 A;  4IPC A;  3G6E A;  2QEX A;  2VZA A;  5FJ8 H;  4KHP Q;  1OXS C;  3B6Y A;  1X3E A;  3KOJ A;  4R4C A;  1OXU A;  4AYB G;  3CPF A;  1BVS A;  4QY7 A;  1IYJ B;  1QVG A;  4BY7 G;  4JI1 Q;  4P71 A;  1K8A C;  3CD6 A;  2KEN A;  4KHZ A;  1PA6 A;  3BJU A;  2UXB Q;  3Q8D A;  2WFW A;  1C0A A;  2PI2 E;  2KBN A;  3JAM i;  1Q7Y C;  1QZG A;  2Q2T A;  3E9I A;  2JA7 G;  4JI3 L;  2GVA A;  4JYA L;  4ME3 A;  4C3I H;  5JJL A;  2MNA A;  3FHW A;  1Y1W G;  4OX9 L;  1YJN A;  1XMQ Q;  2NZO A;  4DR1 L;  2FXQ A;  4X65 L;  1SRO A;  1QUQ A;  4PZ6 A;  1N36 Q;  3M3Y H;  3G71 A;  1QUQ B;  1K83 H;  4RG1 A;  4JOI C;  5IY0 A;  3S17 H;  3I56 A;  4IPG A;  5IT9 c;  2YTV A;  1O7I A;  1W2B A;  2R93 H;  4JBK A;  5GAD C;  1WYD A;  3KF6 B;  1EFW A;  3PO3 G;  2I5L X;  3GDE A;  3KF8 B;  5H1S E;  1JE5 A;  5IYC G;  1W3S A;  2WB1 E;  5LMN Q;  1AE3 A;  4A3L G;  3HKZ E;  3CAM A;  4JI2 Q;  4JI5 L;  1YI2 A;  1K8G A;  4A3F H;  1SFO H;  4YY3 L;  3M4Q A;  2LSS A;  3AFQ A;  1WJJ A;  4DV3 Q;  1GM5 A;  5FLM H;  1EIY B;  4JI3 Q;  1QVC A;  4JYA Q;  3PSI A;  4B3R L;  1HH2 P;  2Q2I A;  4DR2 L;  1PHJ A;  3CME A;  3PO2 G;  3I4M G;  2PQA A;  5BR8 Q;  2PQA B;  2RF4 A;  1JJC B;  2ZTE A;  4H02 A;  5C44 H;  3ULL A;  4A3B H;  1ASY A;  5M5X H;  3WWV A;  1CSP A;  1G51 A;  2D0P A;  3NBH B;  4TVA B;  2VQE L;  2OWO A;  2XTI A;  3K8A A;  3M7N A;  4YHH Q;  2R93 G;  1CKO A;  2GN5 A;  3EIV A;  3HOU H;  4XTC S;  1VQA A;  5JEA G;  1KD1 C;  3S1N H;  5K36 G;  3PV0 A;  4DV4 Q;  1SR3 A;  3PUZ A;  3CPW A;  3S1Q H;  4A3K G;  1B7Y B;  2HQL A;  3U50 C;  4DUY L;  5M3F G;  4Y7N H;  1VQL A;  4LF4 L;  1IBL Q;  4YY3 Q;  3T1Y L;  2ASB A;  4AYB E;  2R7F A;  1XNQ L;  2BH8 A;  4X66 L;  3CCR A;  4FDB A;  3J80 c;  1TWF H;  3CCJ A; 
#chains in the Genus database with same CATH topology
 4DR2 Q;  1AN8 A;  1JQY D;  3VYS A;  1G6Z A;  3A74 A;  2BE5 D;  3AYH B;  1BBW A;  1EZ8 A;  5A35 A;  3PIP 3;  2MO0 A;  3BDL A;  3DHQ A;  3D3R A;  3UDI A;  4GKJ Q;  2XVS A;  4B3T L;  4MTK A;  5CGK A;  1HHV A;  4OHJ A;  1L0W A;  1SNC A;  3GTJ B;  2B2T C;  1UEA B;  2MPM A;  2YU9 H;  1CTM A;  1KTK A;  3L2P A;  3T56 B;  3VYU A;  3CHB D;  2Q2H A;  1ASZ A;  3OMC A;  2KCN A;  2R7Z G;  2E2J H;  2PNH A;  4ABN A;  1K3R A;  2N78 A;  3SK4 A;  2Q2U A;  2L9H A;  1VQ9 A;  2JA5 B;  4FF3 A;  1NR4 A;  4DR3 Q;  5ELN A;  1ZYR C;  4A3I H;  3HG9 A;  3K81 C;  3K80 C;  1WCM B;  5KNC A;  2TMP A;  2CQA A;  1A3T A;  3VR5 A;  4JI8 Q;  5JAV A;  2CVR A;  5AFW A;  4OON A;  3A5U A;  2DN8 A;  2E5L Q;  1ILP A;  5LL6 S;  2K04 A;  4IUR A;  3BS1 A;  3SDZ A;  3A55 A;  2K5H A;  5G3L F;  1IZ6 A;  2D5D A;  5ELD A;  3BDC A;  3MWY W;  3QR8 A;  3J80 L;  3NPP A;  3ZJY C;  1WVL A;  4C2M B;  1H95 A;  4A3I G;  1BUV T;  1YNJ D;  3SHL A;  5IWA Q;  1JOK A;  1Y1W H;  5JPN C;  5LMU Q;  2K28 A;  3CC7 A;  4I7A A;  3Q22 A;  3W1B A;  4HN7 A;  3AFP A;  1J5E Q;  2NZ1 D;  1PH7 A;  4IUV A;  2OTL A;  3IKJ A;  1NTG A;  4ZCK A;  3EJI A;  4LUV A;  1FR3 A;  4A3L H;  2RCF A;  3FMC A;  4F87 A;  1E2V A;  4RHR A;  3EA6 A;  3OW2 A;  2F0Q A;  5A2Q E;  4CKC A;  3CCS A;  3PUV A;  1LAB A;  5C0X J;  3PO2 H;  4DR4 Q;  3I4M B;  2R92 H;  2K4K A;  3K7A H;  2K1B A;  1DYQ A;  1Z7T A;  3NTK A;  1JJ2 A;  2IL8 A;  2NVT H;  3GV3 A;  4V19 0;  2PW7 A;  1SYE A;  5EBC A;  5BN3 A;  1PH5 A;  1N8R C;  3BG3 A;  4A3K H;  3PUW A;  1LT4 D;  1I3Q H;  5M3F B;  1JWU D;  2IHF A;  4IPH A;  3I72 A;  4A3E B;  1GUN A;  2R92 G;  1PV4 A;  4RGM A;  5IP9 H;  5EKL A;  2BA1 A;  4O42 A;  5FKA C;  4K0K L;  2HCI A;  2JP1 A;  2L11 A;  1PH2 A;  3H94 A;  4WRD A;  2GA4 B;  4UAI A;  4GKJ L;  3NK9 A;  1CFM A;  4TKO B;  1XPO A;  2OQ0 A;  1JOO A;  4ILW A;  1IW7 C;  1D6E C;  3BZC A;  3OSO A;  1PH6 A;  3H3V H;  4A3G H;  4XYQ A;  3SR1 A;  2N8N A;  2AUJ D;  3D4W A;  1JCK B;  5ISR A;  3R2T A;  2ZXO A;  1EY5 A;  4XXE A;  5D3I B;  5CC4 A;  3HOV B;  3TRE A;  2CW0 C;  4DR3 L;  4A3D H;  4DKA C;  2PMZ E;  4FNF A;  4KY5 A;  1KAA A;  1BCP D;  1LT3 D;  4JI8 L;  2I07 B;  2E5L L;  3DWP A;  4KY6 A;  1A0I A;  5BN4 A;  1HFG A;  1Y1V G;  2OTJ A;  4LF9 Q;  5GQO A;  2NVX B;  1PH8 A;  1X3P A;  1ICW A;  3PIO A;  4FYD A;  2E2D C;  3PF5 A;  2KCT A;  1K8M A;  1OXT A;  5DEH A;  4B3M Q;  1HNW Q;  1JWS D;  4A3D G;  4IUQ A;  1SJH D;  3VR6 A;  4QQB X;  1A63 A;  4C3J H;  4JW0 A;  1CKN B;  1EYD A;  1K3B C;  3MC0 B;  1CA6 A;  1K0R A;  5LMU L;  2A19 A;  4IJL A;  3S16 B;  3STB D;  2EJF C;  2RBM A;  3ULP A;  1VQI A;  4FVM A;  2K14 A;  1PTO B;  1JE4 A;  2VUM H;  1NE3 A;  1XMO Q;  3EQL C;  3KYH C;  3NQT A;  3GTM H;  5EKI A;  4JPB W;  2JN4 A;  1GUG A;  3GTK B;  4GN4 B;  3GTG H;  1S5B D;  1CHQ D;  2NTT A;  1PFN A;  2RHQ B;  4C3J G;  1WFQ A;  2UUB Q;  3QOL A;  3E3X A;  5JJK A;  4POF A;  2O2L D;  1L2F A;  3H0G B;  2C35 B;  1YEZ A;  4DR4 L;  1LT5 D;  2K52 A;  2B2U C;  2X6G A;  1MSG A;  4JI0 Q;  2CCZ A;  4JI6 L;  2B8F A;  1FJG Q;  3I4N B;  3HOW B;  4DA2 A;  1B1Z A;  2VUM G;  2JA9 A;  3FEW X;  4AQY Q;  4O1N A;  1HZA A;  5CYU A;  3C46 A;  4BBR B;  1VQ6 A;  4DAY A;  1SE4 A;  1VQG A;  2ICI A;  1CZW A;  1BNZ A;  1I50 H;  3MAQ A;  2PW5 A;  3AU7 A;  1YHB A;  3BDO A;  4GN5 A;  3D4D A;  4X3T A;  1KQS A;  4QJF A;  4XYO A;  3J81 E;  5I9P A;  2KJX A;  3F8T A;  5IGG A;  1HR0 Q;  1T9H A;  1I6H B;  1DON A;  1YIT A;  2VL6 A;  4L5T A;  1TWH H;  1SYG A;  4F88 A;  1PFS A;  1LV9 A;  1WTX A;  3OYY A;  2F0N A;  3CCM A;  1YIJ A;  1GO3 E;  3J81 i;  4H44 C;  2ALY B;  5E7N A;  4A3M B;  2RA4 A;  4A3E H;  1D1I A;  2J7Z A;  2BOS A;  4A3J B;  2IHE A;  3RMH A;  5IT9 E;  3JC6 6;  1W6J A;  2XNA C;  1J6Q A;  2LXJ A;  3S15 B;  1XWE A;  2V4D A;  1CSQ A;  1YZ6 A;  5IOC A;  3DXJ C;  1GVP A;  4BA2 I;  3S14 B;  3LNN A;  2FMM A;  3QWN A;  1U4R A;  4M1U B;  5NUC A;  2K50 A;  1S72 A;  4OX9 Q;  4K6D A;  3P75 A;  3CQZ H;  1A6X A;  1J8I A;  1E22 A;  1EEI D;  2J0T D;  1HJP A;  3UI2 A;  2CQO A;  1SRU A;  4B3M L;  2KOL A;  4IAL A;  5C3E B;  1HNW L;  1LTS D;  4JI5 Q;  3DEO A;  2B63 B;  4UPA A;  3V05 A;  4Y52 H;  2A68 C;  2PZW A;  5KYL A;  3DM1 A;  4RKL A;  4ME5 A;  1MKH A;  4EGV A;  1PFB A;  2NVX H;  2EY6 A;  2NUC A;  1VQE A;  2AKW B;  1K73 C;  5I9O A;  1XMO L;  1KNE A;  2ZM6 Q;  2QW7 A;  2JA8 B;  4NXN Q;  2F4V Q;  4O2D A;  2JEB I;  4P2C B;  4DUY Q;  3CF5 A;  2XWB B;  4LF5 Q;  2UUB L;  1L1O B;  5GAG C;  5JVG 3;  1NR2 A;  3KDF B;  4HMI A;  5C4H A;  2EYM A;  2EYO A;  2L1B A;  4HIK A;  1IYU A;  1VQC A;  1JR0 D;  1VQK A;  3F2C A;  3U9S A;  1FJG L;  3ND8 A;  3WDN A;  1B2T A;  4ODG A;  1RKN A;  3NSW A;  4R1J A;  3T51 B;  2D2C C;  1YNN D;  5KIX A;  1TXY A;  1EOV A;  1Y8N B;  2E2I B;  5M5W H;  1YHQ A;  1F2L A;  2K5N A;  3D6W A;  1R9T H;  4JBJ A;  3BZK A;  1X3G A;  4RHS A;  2WB1 G;  4GLA C;  2TSS A;  2MGS A;  3HKZ G;  2Z6B A;  2JXM B;  1PYW D;  2Z9H A;  2VB2 X;  4C3H B;  4B9X A;  4FXG C;  4NDX A;  3PUX A;  4JBM A;  4NP5 A;  2F0S A;  5M3M H;  1P8L A;  3MEH A;  4XIG S;  2JA7 H;  1EQT A;  4X3U A;  2F0M A;  1NCV A;  1EYC A;  1HRJ A;  2K32 A;  1WI5 A;  1X6O A;  3B6Y A;  1F9S A;  4RH6 A;  3CPF A;  1QVG A;  1IYJ B;  1LAC A;  4RWS C;  2KEN A;  4G57 A;  4KHZ A;  2UXB Q;  5D3D A;  2Q2T A;  3JAM i;  1Q7Y C;  3W3A A;  2JA7 G;  3HS0 C;  4ME3 A;  1SMY C;  2A6H D;  3K59 A;  4OX9 L;  4C3I B;  1NAP A;  3TME A;  4Q0F A;  3AMU A;  1ENA A;  4RG1 A;  3EFX D;  5IY0 A;  4ZUJ A;  3PO3 G;  4TSS A;  2WB1 E;  5LMN Q;  1AE3 A;  1GUS A;  4WJW A;  3D4R A;  3HKZ E;  2EVB A;  4JI5 L;  1YI2 A;  4LAA A;  4A3F H;  4DFA A;  1SFO H;  1K8G A;  5M9O A;  1IL8 A;  3QG1 A;  4DV3 Q;  4OEL B;  3I8Z A;  3W2D A;  1BCP B;  2LFN A;  4RGT A;  3CME A;  2PQA A;  5F2D A;  2RF4 A;  1O80 A;  1AW7 A;  1SYB A;  3NBH B;  1G51 A;  5M5X B;  3M7N A;  4YHH Q;  2BDN A;  2ZXR A;  5K36 G;  4XTC S;  1KD1 C;  4DV4 Q;  3HOU B;  4XT1 B;  4DUY L;  4K8J A;  3OIQ A;  5HGT A;  1H9J A;  2K33 A;  2K5W A;  2MP1 A;  2NN6 H;  1I6V C;  3J80 c;  1TWF B;  3A54 A;  4L5Q A;  1DOL A;  3J7Y W;  1M90 C;  5IOD A;  1T5E A;  2UUC Q;  1GHJ A;  1F9Q A;  1E7Z A;  4OIJ A;  4H0L C;  1PYB A;  4LMQ D;  1Z6H A;  1ZEQ X;  1F2Z A;  4HMJ A;  1H9K A;  4ZAI A;  4GZY C;  3PUY A;  1IBM Q;  3M4O H;  3KDF A;  3W1G A;  1XPU A;  2NN6 G;  1VQN A;  4LFC Q;  2YU9 B;  4ZRZ A;  1SLJ A;  1SNO A;  4HID A;  2VB3 X;  1IXR A;  1U9R A;  1N32 Q;  3URY A;  1IYV A;  3VDY A;  1X54 A;  4XDX A;  4OWT B;  2E2J B;  1BF4 A;  2B8G A;  1EL0 A;  1DOK A;  1KL9 A;  3ONA B;  4M8A A;  1H9S B;  2NZH A;  1Q8I A;  4A3I B;  3HOZ H;  4QUF A;  2HHH Q;  2WAC A;  3FKI H;  1LTB D;  3FDT A;  1QNU A;  3OHX C;  3NWT A;  1PRT D;  3SVM A;  1MJE A;  1BBU A;  2AMC B;  2D62 A;  4IQZ A;  3X3N A;  1TWC H;  2IJ0 A;  4RFB A;  1VS0 A;  4RGO S;  1E0B A;  2DJG C;  2UXB L;  3S2H H;  2VS1 A;  4QIW E;  2K01 A;  1PH1 A;  1EYG A;  2PNR C;  2WP8 J;  1E24 A;  2BH2 A;  1Y1W B;  2F3V A;  1I4G A;  1RIP A;  1EWI A;  3RUZ A;  3X3M A;  1LYL A;  2EDG A;  2K5Q A;  3GTQ H;  1HNZ Q;  1V1O A;  2PMZ B;  3CCV A;  1SNP A;  4R4I A;  3S2D H;  1GD7 A;  4AH6 A;  2JJQ A;  3DLL A;  1HUN A;  1KDC A;  2CFM A;  2EXD A;  5LMN L;  4FXD A;  5FLX c;  1TS4 A;  4DV3 L;  2UUA Q;  1PVO A;  1LO5 D;  1Z47 A;  4MTN A;  1Q82 C;  1N9W A;  3PO2 B;  1ONL A;  2R92 B;  1XNR Q;  3K7A B;  1E2Z A;  4YHH L;  1ET6 A;  2NVT B;  1C48 A;  3KLR A;  4DV4 L;  5IGF A;  2VQF L;  3KLS A;  2D9U A;  3WOE A;  4DK0 A;  4A3K B;  1ET9 A;  1VMC A;  1W6K A;  1JJG A;  1I3Q B;  3HOX G;  3RZD H;  2YTY A;  1NUC A;  1EIH A;  1DCZ A;  2DNC A;  5HGQ A;  1OTC A;  2UUC L;  2SEB D;  1CUK A;  4DXG A;  1XYI A;  1F9P A;  4CDD C;  5C4X H;  3GTO H;  1IBM L;  3GD7 A;  2XN9 C;  3STB C;  3MXN B;  1ZKO A;  1QVF A;  4LFC L;  2EJM A;  4N9P A;  3GQB A;  4A3G B;  1TT2 A;  3AQQ A;  1N32 L;  2XSC A;  1HFN A;  2R7Z H;  2EY2 A;  2FMC A;  4PMB A;  4K0K Q;  1SDF A;  3M9B A;  5AJ3 Q;  3PIP A;  2X6L A;  4ZLT F;  4A3D B;  4A3C G;  2F3W A;  2JA6 G;  2MFI A;  5C4X G;  5C4Z A;  1PRT F;  1STG A;  1LTT D;  4N8X 1;  5EGT A;  1TKW B;  1VQO A;  2HHH L;  3TP5 A;  4PZ7 A;  2JQO A;  3BU2 A;  3NP8 A;  1EY7 A;  5C5L A;  4DF7 A;  2Z4I A;  2KCC A;  3TN2 A;  1VQ8 A;  3A0J A;  5L37 A;  4DV5 L;  2RCN A;  1B53 A;  1H9S A;  4C3J B;  2Q8T A;  1I4X A;  2IX3 A;  2A69 D;  1HNZ L;  5IGB A;  4RCO A;  3K5O A;  4KI0 A;  2VUM B;  3K0Y A;  1KIX A;  2IT1 A;  3UDG A;  1OXV A;  3GTM B;  4LF6 L;  1XJV A;  4KV6 A;  3GTG B;  4HJ8 A;  5DM6 3;  2UUA L;  1EEF D;  5M5Y H;  4L8J A;  1M1K C;  1TY0 A;  3U4V A;  1XNR L;  3H15 A;  1NJI C;  2DJF C;  4WJ4 A;  4DNT B;  4F8M A;  4J15 A;  1HNX Q;  3T16 A;  3MHB A;  5CV7 A;  4DAY B;  2KVM A;  5C5M A;  1FNU A;  1I50 B;  2F3I A;  1GUT A;  3L7Z C;  3QJY A;  3H6M A;  1HZB A;  1D5Z C;  1TVX A;  2B2W C;  4APV A;  3A7L A;  1DOM A;  2PZU A;  4JI6 Q;  1QIL A;  2QGQ A;  4DUZ L;  3MEF A;  3RLO A;  1KRT A;  1TWH B;  3K7U C;  1GHK A;  4KD4 A;  5EPL A;  2E2H H;  4OO1 G;  2UXD L;  4OWW B;  4IFD G;  3ERO A;  3H09 A;  3SK5 A;  2Z8L A;  2L55 A;  1RL2 A;  4P72 A;  3RNU A;  2VY3 A;  2Q8I B;  2E8G A;  3D6C A;  4R8N A;  2MQH A;  4G7Z C;  2FJ2 A;  3OWF A;  4JOI A;  5AJ3 L;  1Q90 A;  2A6E C;  2DUD A;  3VR3 A;  1TS5 A;  5D65 A;  3TP8 A;  1CK1 A;  1U5K A;  3H3V C;  3MXN A;  4PZ8 A;  2K6A A;  3VA7 A;  3G4S A;  1PMR A;  4XQJ A;  4QCL A;  3LGJ A;  4X65 Q;  4OO1 I;  1Y1V H;  4IFD I;  4CKE A;  1I4R A;  4HJA A;  3J7A 5;  3CQZ B;  5FLX L;  4I65 A;  2MJ8 A;  1SEB D;  1JC7 A;  2OXP A;  3CXC A;  2NVY H;  5FK9 C;  2K75 A;  3C2P A;  3SE0 A;  4LUO A;  2WKD A;  1E1T A;  1TWA H;  5FLM G;  3J80 E;  1G2S A;  3R8B A;  4EQO A;  4B3R Q;  2F52 A;  4K8I A;  4OL7 A;  4KJN A;  4DK3 C;  1UUP A;  5C44 G;  4LFB L;  2NVQ H;  2CKZ B;  4G7H C;  2EYL A;  1QOH A;  1ESR A;  1X56 A;  2EE1 A;  5CV8 A;  2Z1C A;  2O4X A;  4DGZ A;  3J80 i;  3T4A C;  2DGY A;  4LF4 Q;  3L9A X;  2RSN A;  2ES2 A;  4CBV A;  2LS0 1;  2WB1 B;  4GOP A;  2MO1 A;  3PIO 3;  3HKZ B;  2F0E A;  5IYB G;  3BVZ A;  4L63 B;  5LL6 X;  1HNX L;  4B9W A;  1PZJ D;  4IOC A;  3GTL H;  4K5W A;  2A6H C;  2PZT A;  5KNB A;  1WTW A;  1A8V A;  3A56 A;  4KKT A;  3E9H A;  1SND A;  3W5O A;  5M5W B;  4FF2 A;  2A8V A;  2WII B;  4WJ3 M;  1RTN A;  3R93 A;  1R9T B;  2F0G A;  2EJG C;  2LKV A;  3T53 B;  1IBK Q;  2N49 A;  4R4Q A;  2XWJ B;  1R4Q B;  4YWL A;  5JPM C;  2JA5 G;  3C3L A;  2WAQ B;  1U4P A;  5M3M B;  1WCM G;  3E0J A;  1RHP A;  1EUJ A;  5J39 A;  2EXZ A;  3AEV A;  2JA7 B;  4HIO A;  1KXL A;  1XMQ L;  3J7A V;  1N33 Q;  3TS2 A;  3T1H Q;  4UP7 A;  3K0X A;  2A73 B;  4KHV A;  2QEX A;  2RKS A;  1OXS C;  3KOJ A;  3MXG A;  1BVS A;  1PZK D;  1FNW A;  5K5P A;  2E74 C;  4U67 3;  2OT2 A;  1K8A C;  1SSO A;  3FPP A;  5FLX E;  3A8I E;  3BJU A;  3Q8D A;  1C0A A;  2PI2 E;  2KBN A;  1QZG A;  3E9I A;  1H9R A;  4JI3 L;  1ZYR D;  2GVA A;  4HR7 B;  4JYA L;  5JJL A;  2MNA A;  2B2V A;  1YJN A;  2NZO A;  2FXQ A;  1QWY A;  4X65 L;  1JOQ A;  3G71 A;  3U9O A;  1K83 H;  4X3S A;  1V1P A;  4DXF A;  2L0C A;  4JBK A;  5GAD C;  3KF6 B;  1S5D D;  2I5L X;  5IYC G;  4PMC A;  4JI2 Q;  5J22 A;  1WTO A;  3GTP B;  4YY3 L;  3ZYY X;  4A3F B;  2HQE A;  1SFO B;  1GM5 A;  1EIY B;  1K8O A;  4HSP A;  4B3R L;  1HH2 P;  3L3O C;  1PHJ A;  4MHE A;  3I4M G;  2PQA B;  3NTH A;  2WV6 D;  4CJ2 C;  4A3B H;  1SXT A;  3EVQ A;  2OWO A;  2Y0S B;  4QIW B;  2EYP A;  3PQI A;  3EIV A;  2GN5 A;  3S1N H;  2RVL A;  5JEA G;  2R61 A;  3PUZ A;  1I4H A;  1B7Y B;  2HQL A;  5M3F G;  4LF4 L;  1SNM A;  2BH8 A;  3H91 A;  2AUK A;  1EU3 A;  3DUZ A;  5TSS A;  1A2T A;  4BA1 I;  4POG A;  3K5N A;  4G4K A;  1UE6 A;  4A3B G;  3PGZ A;  2LMC B;  5BN5 A;  3RLN A;  4JI7 L;  4CDE C;  2NB0 A;  3DM3 A;  1B9N A;  3OOC A;  4KY7 A;  1K28 A;  4EQN A;  4DV2 Q;  3TZU A;  3M7G A;  5CR3 A;  1EWC A;  3CU7 A;  1S4Z A;  1PZI D;  3CC4 A;  1PTO C;  3M4O B;  2H5X A;  1KDA A;  3TQY A;  2SNS A;  1YBY A;  4PV1 C;  5COR A;  3NQI A;  5DNF A;  1STE A;  3E5S A;  4L6T B;  1IBK L;  2GVB A;  2EYJ A;  2HCC A;  2KHS A;  1GOZ A;  2J4X A;  1KHI A;  1LLR D;  1P16 A;  3CP0 A;  4BY1 G;  3HOV G;  3BYT B;  5I6Y A;  4HIM A;  1L0Y B;  2PCF B;  3J7A F;  5IYD G;  4I7Z C;  3TZD A;  5IE8 A;  5GAE C;  4DAV A;  3HOZ B;  4QMG A;  3S9W A;  1N33 L;  4LUZ A;  3T1H L;  1IW7 D;  1CA5 A;  3FKI B;  3D31 A;  4RKB A;  1OO9 B;  2K7V A;  5GAH C;  2HDL A;  1SNQ A;  3HZX A;  5FO9 B;  4AYB B;  3Q24 A;  2G9H D;  1TWC B;  4QUC A;  4DPG A;  1B3Q A;  2CW0 D;  3U4Z A;  1VQD A;  3QOJ A;  1Q86 C;  2LXK A;  2PYK A;  4GKK Q;  3S2H B;  5ELF A;  1JB7 A;  2I0Q A;  2I5H A;  1Z9F A;  3FPU B;  2BCO A;  2ZJP A;  2Z6K A;  4IUU A;  4KD3 A;  3GTQ B;  1PFM A;  4XQQ A;  1TY2 A;  3PO3 H;  1SYD A;  3S2D B;  2ICE C;  1RD9 D;  1UE1 A;  2A5H A;  5CV6 A;  3CCU A;  4DAM A;  4JI2 L;  3CCL A;  1TWG H;  3G48 A;  1A62 A;  3H0G G;  1DZ1 A;  3HOX B;  2G9D A;  2BE5 C;  4GNX A;  3HOW G;  5E3F A;  2B3G A;  3KF6 A;  4BBR G;  1K0S A;  1SYF A;  5K36 H;  4H7B A;  4ULL A;  4U68 A;  2VNU D;  1X32 A;  3GTP H;  2EYF A;  2KCM A;  2CH4 W;  4JCV E;  5FOB B;  4MIU A;  3UDF A;  1S3O A;  4B3S L;  3RR5 A;  1WTR A;  3P1H A;  5JVH 3;  1Q12 A;  1BDO A;  2C9O A;  4GLX A;  1U0L A;  4KMU C;  3RZD B;  5KND A;  4HJ7 A;  4X64 Q;  1FD7 D;  1QE6 A;  5I4D A;  4R9W A;  3Q23 A;  1FGB D;  4FF1 A;  1VQJ A;  2F0I A;  2A1A A;  1HXY D;  3I3C A;  2VQF Q;  2H4O A;  2JK8 A;  1S5C D;  2F0W A;  3SK8 A;  4DV2 L;  1SE8 A;  1II3 A;  2FIN B;  2KEE A;  3IRB A;  4O0A A;  3MA2 B;  5C4X B;  3DMU A;  3GTO B;  4UY8 C;  4A3J G;  4HTH A;  1OXX K;  2EOT A;  4JK1 C;  4ZKC B;  2F0L A;  2WIN B;  1MSH A;  4BBS H;  2R7Z B;  4LF8 Q;  4DK6 C;  1L1O C;  1YNJ C;  1BR9 A;  4TQU S;  2ZJR A;  3U58 A;  1QZH A;  1PH4 A;  3O13 A;  4DR6 Q;  4X3K A;  1JIC A;  4BXX H;  1DXM A;  2NTS A;  2K5V A;  1DD2 A;  5KEE A;  1EOT A;  4BBS G;  4K6L A;  5E4X A;  1AZQ A;  4WOR A;  1EZ6 A;  5C3E G;  3TBI B;  3R3O A;  1LTG D;  2B63 G;  5IIF A;  2F0P A;  1HR0 W;  3HGB A;  3TS0 A;  1KNA A;  1V1Q A;  1RTO A;  1Y8P B;  5CV4 A;  3RZO H;  4GKK L;  5C0X I;  1VQ7 A;  4BXX G;  2VXW A;  4DV0 Q;  3IFT A;  2JA8 G;  1VQH A;  2OCE A;  3EN2 A;  4QF4 A;  2Z0S A;  4DV5 Q;  4S3S A;  2QDL A;  3KLW A;  2IX1 A;  1HTP A;  2SOB A;  2JSO A;  3SGI A;  5I6W A;  2HIX A;  4HCS A;  3NWS A;  5JJZ A;  5M5Y B;  1KAW A;  2A68 D;  3F2B A;  2KUM A;  4ZUI A;  2ID0 A;  2AWO A;  1ROD A;  5JOB A;  2QF7 A;  3KJO A;  5JJI A;  4LFA Q;  1EY0 A;  4MN3 A;  4DR5 Q;  4YCV A;  3E0E A;  3I7F A;  4LF6 Q;  1VF7 A;  4A4I A;  1EIF A;  2IPK D;  1CT1 D;  5T1G A;  4EX5 A;  5JEA J;  4CKB A;  1HCZ A;  3CRK C;  3HOX H;  2ATW A;  3RD4 A;  1MIU A;  4C56 C;  4CDC C;  1D1K A;  5HY6 A;  1PLF A;  3ERS X;  4IN3 A;  3NTI A;  2ENB A;  4C3H G;  1I5F A;  4X64 L;  1EU4 A;  2OQK A;  3LWU A;  4DU9 A;  3J7Z C;  2B2Y C;  3KBX A;  2IX0 A;  5COY A;  5EBD A;  2AWN A;  1EQV A;  1E1O A;  1STB A;  2L4N A;  1X55 A;  1BCP C;  4DK1 A;  2E2H B;  1Q1E A;  5EPJ A;  4CJ1 B;  1ICF B;  2F0K A;  1G91 A;  4X6A H;  5ELB A;  1JMC A;  5FJ8 G;  4KN4 C;  1B3A A;  3OWE B;  3S1M H;  4DUZ Q;  3S17 B;  5J3B A;  4YCU A;  4LF8 L;  1UE7 A;  5C3X A;  3HOY H;  1Q1B A;  2Z4H A;  3RLF A;  1VQ5 A;  4A3C H;  1D7Q A;  2JA6 H;  2UXD Q;  2ZXP A;  2RSO A;  4J1M A;  2R7D A;  1ENC A;  4DR6 L;  4A93 H;  5I2Y A;  4GN3 B;  5C4J H;  1Y1V B;  3VA5 A;  2JEA I;  1ESF A;  3CC2 A;  3F1Z A;  5E4W C;  5EAY A;  5A2Q L;  2F0H A;  1GUO A;  2NVY B;  4YWK A;  1HZC A;  1EIG A;  3HOY G;  5ELO A;  3PCO B;  1F2Y A;  4MZ9 A;  1NY4 A;  2B29 A;  1TWA B;  1VQB A;  2CHB D;  2EIF A;  4A93 G;  1SN8 A;  1SMY D;  1G8Z D;  1RF2 D;  3NUC A;  1A3V A;  1XPR A;  2PQE A;  4DV0 L;  1C4Q A;  2V1C C;  1VQF A;  4RCN A;  5E1F A;  2NVQ B;  3KUP A;  1I94 L;  3CCQ A;  3HOU G;  1F9R A;  3P20 A;  1YJ9 A;  4EQP A;  3L0O A;  1AZP A;  4G7O C;  3T1Y Q;  1XNQ Q;  4X66 Q;  2F0T A;  2IY5 B;  5EKK A;  1B70 B;  4N9T A;  1STN A;  2B2T A;  5GRO A;  4TRD A;  3ITP A;  4GOP B;  4PG3 A;  4K14 A;  1IL2 A;  4LFB Q;  3MTS A;  3M4P A;  3I2Z A;  4LFA L;  3DWA A;  4DR5 L;  1KDB A;  2I46 A;  4NKL A;  1PYS B;  3S1R H;  4IPD A;  1RJT A;  5DLQ E;  1PTO F;  3GTL B;  1TS3 A;  1EY6 A;  4UDU C;  4EQ5 A;  3GP7 A;  1BO0 A;  3MFY A;  1BBX C;  1BKB A;  4ZYS A;  3E6Z X;  4F7X A;  5LMN W;  4V0B A;  2HT1 A;  4KHP L;  1LM0 A;  2N3S A;  4DV7 Q;  2N55 A;  1J9O A;  2UU9 Q;  4BY7 H;  4J8Q A;  4LNQ A;  4ZQ3 A;  4JI1 L;  2CWA A;  4Q5V A;  2A74 C;  1STH A;  2ZTD A;  4JI4 Q;  4OO1 H;  4IFD H;  3VR2 A;  3QB3 A;  3GO5 A;  4N8F A;  3JAM c;  2KEC A;  1WD0 A;  3S24 A;  1QNK A;  2QKI C;  3OTO Q;  1PH9 A;  1X3Q A;  4IPC A;  2VZA A;  1O7L A;  1NSN S;  1X3E A;  1ZXT A;  4BY7 G;  5KGU A;  3R2I A;  1VMP A;  3N6R A;  2JYO A;  3HRZ C;  1PA6 A;  2WFW A;  1XTC D;  1U4M A;  1GUW A;  1BOS A;  3FHW A;  1Y1W G;  2E75 C;  3KBG A;  1XMQ Q;  4KJO A;  1N36 Q;  1QUQ A;  3M3Y H;  3CKI B;  4JOI C;  2B2W A;  1K83 B;  3S17 H;  2R93 H;  1WYD A;  3KF8 A;  1V1P B;  1EYA A;  3HP3 A;  1JE5 A;  1B4O A;  4A3L G;  2O5I C;  3IFD A;  3LWE A;  3M4Q A;  2LSS A;  5D14 A;  1TR5 A;  1STY A;  5FLM H;  4JI3 Q;  1MD2 D;  4JYA Q;  3IAY A;  1PXU A;  3PSI A;  2Q2I A;  5HUR A;  4DR2 L;  3PO2 G;  1DJR D;  5BR8 Q;  4H02 A;  2F0J A;  5C44 H;  1CSP A;  3FVQ A;  2D0P A;  2N88 A;  3BVG A;  4IUN A;  4TVA B;  3K8A A;  4A3B B;  2R93 G;  1SAP A;  3MZ5 A;  1VQA A;  3J81 L;  1YNN C;  3PV0 A;  3S1N B;  1S5F D;  3CPW A;  2FHT A;  5CBE E;  4A3K G;  3S1Q H;  3U50 C;  4Y7N H;  3OIP A;  1IBL Q;  4YY3 Q;  3T1Y L;  1XNQ L;  4X66 L;  2QDB A;  3TP6 A;  1UWV A;  4FF4 A;  2PI2 A;  5IP9 G;  5IYB H;  4NPS A;  4QL5 A;  1PRT B;  1CQF A;  3CMA A;  1EY8 A;  4PQX A;  4BY1 B;  4NB3 A;  5ELE A;  1Q8K A;  3GTJ H;  1K9M C;  4WFN 3;  3I55 A;  1FVI A;  1JT8 A;  1WTH A;  5EJW A;  5IT9 L;  2X69 A;  4GOP C;  4K5V A;  4H13 C;  4R8I A;  1YNX A;  1U4L A;  1A15 A;  5EPK A;  1GKH A;  5IGE A;  4JV5 Q;  5IP7 H;  1SE3 A;  4A3G G;  3T13 A;  2NBF A;  3D0F A;  4DV7 L;  2UU9 L;  3N52 A;  3A8J E;  4JI7 Q;  2JA5 H;  2YYZ A;  1HQR D;  1WCM H;  4JI4 L;  4HAE A;  3ICE A;  3A8K E;  5IWA L;  4P75 A;  2MUY A;  3RN5 A;  3BVM A;  3CW2 C;  4JVZ A;  3TDQ A;  4DV1 Q;  2KED A;  3TRZ A;  2XGT A;  2UXC Q;  5IP7 G;  3OTO L;  2AHO B;  1CI3 M;  1J5E L;  4J6H A;  3H3V I;  1YVC A;  4C2M H;  1KRS A;  3BZD B;  2F0F A;  4LF7 Q;  1A3U A;  1B8A A;  1KLG D;  4XT3 B;  2K03 A;  1HUM A;  1N36 L;  2F0O A;  2QA4 A;  1LUZ A;  3KLS X;  1E3P A;  2SDF A;  3M85 A;  1VQ4 A;  4UP9 A;  2B2U A;  3MFG A;  5IYC H;  3PO3 B;  3NEL A;  1D8L A;  2F1M A;  1FL0 A;  2B2V C;  5DAU A;  1T5X D;  2IW3 A;  4HJ5 A;  1KLU D;  2ZJQ A;  5CV5 A;  1TWG B;  3K57 A;  1M8A A;  1N34 Q;  3I4M H;  3MXU A;  5ELC A;  1IKL A;  5BR8 L;  3SXH A;  4GNX B;  1HTL D;  1V8Q A;  4X62 Q;  3MXP A;  1X3F A;  1EQQ A;  5JEA H;  1FGU A;  2SNM A;  1D5M C;  3QO2 A;  5M3F H;  1IBL L;  1Y69 U;  3V2T A;  4EVO A;  2F03 A;  1X65 A;  2YTX A;  4E6I A;  1VQP A;  3QIA A;  4DNI A;  3ND9 A;  4OEM B;  3NEM A;  3ER0 A;  4KKU A;  4B08 A;  4CJ0 B;  1LTR D;  4BWG B;  4K2K A;  1WTV A;  1VDZ A;  1BCP F;  4IOA A;  2C5C A;  3RN2 A;  3JAM L;  2YV5 A;  5CV9 A;  3OW7 A;  1RDP D;  4A75 A;  3AB9 A;  1EQR A;  1MHW C;  4NXM Q;  3HEJ A;  4B3S Q;  3NEN A;  2Q8R E;  4KLK A;  2CH4 A;  4IUT A;  5C6A A;  2NYZ D;  4OGQ C;  1PRT C;  4JV5 L;  4A3E G;  3EBE A;  4LF9 L;  1ML0 D;  2BA0 A;  2E76 C;  2HIV A;  2VW9 A;  1G6P A;  1EY9 A;  1AP0 A;  4BBS B;  4BY1 H;  3HOV H;  1I4Q A;  4UP8 A;  4DAP A;  3ERQ A;  1TQO A;  4L5R C;  5LHY 1;  5IYD H;  3OMG A;  5CMD A;  2EY1 A;  1A2U A;  1LTL A;  2B39 A;  4CGY B;  5I2X A;  1QJO A;  3HKS A;  3MVV A;  1SJE D;  3I90 A;  4DV1 L;  1X9N A;  2HD3 A;  3TSS A;  4LW1 A;  1UE5 A;  1NNX A;  2UXC L;  1HA5 A;  2M00 A;  3UE1 A;  1WOC A;  4R4T A;  4R4O A;  3TEH B;  1O7Z A;  4L5S A;  3NE5 B;  3ULJ A;  2R6G A;  2LY7 A;  1V9P A;  4DR7 Q;  3M4Y A;  1S5E D;  4FXK C;  1TU2 B;  2RDH A;  4LF7 L;  4IUP A;  1AFP A;  1CKN A;  2F0U A;  2L15 A;  2FFK B;  1R4P B;  2A6E D;  2F0D A;  3I91 A;  3SEB A;  4RAU C;  2RDG A;  3RZO B;  3VR4 A;  3S16 H;  1SYC A;  4PNY A;  4LWC A;  1WD1 A;  1D5X C;  2D0O A;  1TS2 A;  3F2U A;  4IFD J;  1PTO H;  3KK7 A;  4JI0 L;  3I4L A;  4PMW A;  3WOF A;  1HZ9 A;  1LTA D;  1BXT A;  4AIM A;  4AQY L;  3NBI A;  3NHH A;  3GTK H;  3J81 j;  1KC8 C;  2MHV A;  3NXW A;  1AE2 A;  1Y14 B;  3K58 A;  4NMZ A;  4DV6 Q;  2BDO A;  1MJC A;  4FP5 D;  3H0G H;  1VF5 C;  2P5Z X;  1N34 L;  2G5D A;  2WKC A;  2EYH A;  2Z6K C;  4QGU A;  3PMF A;  1AEX A;  2KA7 A;  3HOW H;  3I4N H;  1JOR A;  1HR0 L;  4X62 L;  2KHJ A;  4LK1 C;  3G7L A;  1DM0 B;  1IHZ A;  2RHS B;  4BBR H;  1HPC A;  1QG7 A;  2IWH A;  1SBB B;  1UEB A;  1WTP A;  1EWH A;  3BYY B;  4IO9 A;  1G29 1;  1VCI A;  3V96 A;  1C9O A;  1C7Y A;  4KTA A;  4GNX C;  3JAM E;  2K05 A;  1UAP A;  2L12 A;  4Z9C B;  1VQM A;  4A76 A;  3DWQ A;  1MBY A;  5T1I A;  4MNO A;  3I4N G;  1CM9 A;  1I6H H;  1EFI D;  5KRU A;  1QCB D;  3I73 A;  4K2L A;  1Q46 A;  1G2T A;  2WAQ G;  1JWM D;  2CWP A;  4OWX B;  2HUG A;  5M3M G;  1GJX A;  1XXG A;  1PH3 A;  3UE0 A;  4ZKB B;  2XIW A;  2OEO A;  4OIK A;  4CDF C;  4NXM L;  4A3M H;  1B50 A;  4A3J H;  4GLV B;  5C3W A;  4P74 A;  3S15 H;  4KN7 C;  1NBW A;  1Q3L A;  3S1M B;  3K6O A;  1F77 A;  2RQX A;  1MI2 A;  4ALP A;  3S14 H;  5C0X H;  1JB3 A;  2RDF A;  3VYR A;  3CCE A;  3HOY B;  1I4P A;  1YHA A;  5DM7 3;  2AQ1 B;  4K5X A;  4YIJ A;  2JA6 B;  3F2D A;  1STA A;  1NMG A;  2KQ3 A;  4A3M G;  4DR1 Q;  2A69 C;  2F4I A;  1O7Y A;  4A93 B;  1IKM A;  4ZK9 B;  2KHI A;  2ZT9 C;  2JE6 I;  5C4J B;  1TII D;  4YCW A;  2ZM6 L;  1S40 A;  5C3E H;  4NXN L;  2F4V L;  4DR7 L;  1AH9 A;  2QEJ C;  2B63 H;  3SK6 A;  4LJZ C;  5C0X G;  4QB4 A;  2HDM A;  2DY7 A;  4A3F G;  1CZG A;  4LF5 L;  3I4O A;  1SE2 A;  4C1N K;  2QIL A;  2WAQ E;  4IJH A;  4HSV A;  2AQ2 B;  1FYC A;  4ID6 A;  2Y0S G;  2JA8 H;  2VQE Q;  1M4V A;  2ZTC A;  1EY4 A;  1RCV D;  2XRQ D;  2O5J C;  1D2B A;  3PF4 A;  4DV6 L;  3HFZ B;  1XX8 A;  1SMX A;  1QB5 D;  1L1O A;  3LX0 A;  4OXP A;  4FO2 A;  4YWM A;  1KAB A;  4P73 A;  1UNS A;  1CKM A;  1BQQ T;  3Q6S A;  3K5M A;  1ILQ A;  3CRL C;  1V43 A;  5FO7 B;  1C8C A;  1H9M A;  3KFU A;  1LTI D;  3GV6 A;  1HA6 A;  1I94 Q;  4KKS A;  1PDQ A;  3KJP A;  4HJ9 A;  2I5M X;  4B3T Q;  3S1R B;  1L0X B;  2E2I H;  4IZ8 A;  2XRS D;  3DEP A;  3C1E A;  3Q0A A;  3D8G A;  2EQS A;  3FP9 A;  1ENF A;  1YJW A;  1MGS A;  1CHP D;  4RMF A;  2NN6 I;  4C3H H;  3K5L A;  3C1F A;  5FO8 B;  4BY7 B;  3G6J B;  2H1E A;  4JBW A;  4JC0 A;  5J1Z A;  1DGS A;  5EQ0 A;  1O78 A;  2Y0S E;  3UDX A;  3HOZ G;  2L5T A;  1XTD A;  2DNE A;  3A5Z B;  1WTQ A;  2QCP X;  2NWG A;  3J81 c;  1Q81 C;  1NMF A;  4JG2 A;  4GS3 A;  4KK7 A;  3FKI G;  1PTO D;  3G6E A;  4KHP Q;  5FJ8 H;  4DN4 M;  2F0V A;  4R4C A;  4DNR B;  1OXU A;  4RGN A;  4AYB G;  1CQV A;  4QY7 A;  1B44 D;  4JI1 Q;  4P71 A;  3CD6 A;  2M9V A;  4HED A;  5CBA E;  1E2W A;  2PO4 A;  4HCE A;  5G3L D;  1FNV A;  4XQN A;  5IGC A;  2PPB C;  4CHT B;  4C3I H;  1GXD C;  5KYI A;  4DR1 L;  3P7J A;  1SRO A;  1LT6 D;  4PZ6 A;  3IL8 A;  1QUQ B;  3M3Y B;  3I56 A;  4IPG A;  5IT9 c;  2YTV A;  1O7I A;  2EY5 A;  1W2B A;  2OF1 A;  4BS9 A;  1EFW A;  2R93 B;  3GDE A;  2EPB A;  3KF8 B;  5H1S E;  1W3S A;  2EZV A;  2B2Y A;  1F2M A;  3CAM A;  3AFQ A;  1WJJ A;  3TP7 A;  1QVC A;  4C3I G;  3I70 A;  1HQM C;  2DY8 A;  2R3Z A;  2ZTE A;  1JJC B;  3VYT A;  1B9M A;  4NW2 A;  3ULL A;  1ASY A;  3NBH A;  5M5X H;  3WWV A;  3A7A B;  4RA8 A;  5C44 B;  2M2L A;  2VQE L;  2XTI A;  1CKO A;  3HOU H;  1SR3 A;  1Y8O B;  2AQ3 B;  3FRP B;  1VQL A;  3S1Q B;  3OPO A;  5IGD A;  2ASB A;  4Y7N B;  4AYB E;  2R7F A;  4C1N I;  3CCR A;  4UHV A;  4FDB A;  1TWF H;  3CCJ A;  2K5D A; 
#chains in the Genus database with same CATH homology
 4BA1 I;  4DR2 Q;  4POG A;  4L5Q A;  1UWV A;  3A74 A;  1UE6 A;  3AYH B;  1BBW A;  1M90 C;  2PI2 A;  5IP9 G;  5IYB H;  4A3B G;  4NPS A;  4QL5 A;  3PGZ A;  3CMA A;  2UUC Q;  3RLN A;  4JI7 L;  2MO0 A;  3DM3 A;  1E7Z A;  4NB3 A;  3UDI A;  1PYB A;  1Q8K A;  4GKJ Q;  3GTJ H;  4DV2 Q;  4B3T L;  1K9M C;  1L0W A;  3I55 A;  1FVI A;  3PUY A;  1JT8 A;  1IBM Q;  3M4O H;  3KDF A;  3W1G A;  1XPU A;  2NN6 G;  4GOP C;  1VQN A;  3CC4 A;  2YU9 H;  2H5X A;  3TQY A;  4LFC Q;  1YBY A;  1YNX A;  3L2P A;  1GKH A;  1SLJ A;  4JV5 Q;  5IP7 H;  4A3G G;  4HID A;  1IBK L;  1IXR A;  2GVB A;  2Q2H A;  3D0F A;  1N32 Q;  4DV7 L;  1ASZ A;  2UU9 L;  2R7Z G;  2E2J H;  3VDY A;  2PNH A;  1KHI A;  1P16 A;  1X54 A;  1K3R A;  3CP0 A;  2N78 A;  4OWT B;  4BY1 G;  2JA5 H;  2Q2U A;  2YYZ A;  4JI7 Q;  3HOV G;  1VQ9 A;  4HIM A;  4DR3 Q;  5ELN A;  1WCM H;  4JI4 L;  4A3I H;  1KL9 A;  3K80 C;  3K81 C;  5IYD G;  5IE8 A;  5GAE C;  3ICE A;  2NZH A;  5IWA L;  3HOZ H;  4P75 A;  4JI8 Q;  3RN5 A;  4OON A;  3A5U A;  3CW2 C;  2E5L Q;  1N33 L;  4DV1 Q;  4LUZ A;  2HHH Q;  3T1H L;  3FKI H;  3TRZ A;  2XGT A;  2K5H A;  2UXC Q;  5IP7 G;  3D31 A;  3OTO L;  2AHO B;  1IZ6 A;  1MJE A;  1J5E L;  5GAH C;  1BBU A;  2AMC B;  3H3V I;  1YVC A;  2D62 A;  1TWC H;  4C2M H;  1KRS A;  4DPG A;  1VS0 A;  3ZJY C;  1H95 A;  2UXB L;  4A3I G;  4LF7 Q;  1B8A A;  3S2H H;  3U4Z A;  1VQD A;  2VS1 A;  4QIW E;  5IWA Q;  1Q86 C;  1PH1 A;  2LXK A;  1Y1W H;  2WP8 J;  1E24 A;  1EYG A;  2BH2 A;  4GKK Q;  1JB7 A;  5LMU Q;  1N36 L;  2I0Q A;  3CC7 A;  2I5H A;  1RIP A;  3W1B A;  1EWI A;  1Z9F A;  1LYL A;  3AFP A;  2ZJP A;  1HNZ Q;  3GTQ H;  2QA4 A;  2Z6K A;  1LUZ A;  1E3P A;  3CCV A;  1J5E Q;  3M85 A;  1VQ4 A;  4UP9 A;  4R4I A;  1PH7 A;  3S2D H;  3PO3 H;  1GD7 A;  4AH6 A;  2OTL A;  1NTG A;  5IYC H;  2JJQ A;  4LUV A;  3DLL A;  3NEL A;  1D8L A;  2CFM A;  2EXD A;  1UE1 A;  5LMN L;  4A3L H;  3CCU A;  1FL0 A;  4DAM A;  5FLX c;  4JI2 L;  4HJ5 A;  3CCL A;  1TWG H;  2ZJQ A;  4DV3 L;  3G48 A;  3OW2 A;  2UUA Q;  1PVO A;  1A62 A;  3CCS A;  3H0G G;  3PUV A;  1Z47 A;  1N34 Q;  4MTN A;  5C0X J;  3PO2 H;  3I4M H;  1Q82 C;  1N9W A;  5BR8 L;  4DR4 Q;  4GNX A;  2R92 H;  3HOW G;  4GNX B;  2K4K A;  4X62 Q;  3K7A H;  1XNR Q;  1X3F A;  1JJ2 A;  2B3G A;  3KF6 A;  4BBR G;  2NVT H;  4YHH L;  1EQQ A;  1PH5 A;  1N8R C;  1FGU A;  4DV4 L;  2VNU D;  2VQF L;  4A3K H;  3GTP H;  2KCM A;  3PUW A;  4JCV E;  5M3F H;  1IBL L;  3UDF A;  1S3O A;  1I3Q H;  4B3S L;  3RR5 A;  1JJG A;  1X65 A;  1Q12 A;  2IHF A;  2YTX A;  4IPH A;  3HOX G;  1U0L A;  4GLX A;  3RZD H;  1VQP A;  2YTY A;  4DNI A;  2R92 G;  1PV4 A;  5IP9 H;  4HJ7 A;  3NEM A;  3ER0 A;  4X64 Q;  2BA1 A;  5HGQ A;  1OTC A;  2UUC L;  4K0K L;  1VQJ A;  4IOA A;  3RN2 A;  2A1A A;  1PH2 A;  1CUK A;  2YV5 A;  2VQF Q;  2JK8 A;  4GKJ L;  4DV2 L;  1SE8 A;  4A75 A;  1EQR A;  4O0A A;  3IRB A;  1XPO A;  5C4X H;  4B3S Q;  4NXM Q;  2OQ0 A;  3NEN A;  3GTO H;  1IBM L;  3GD7 A;  4KLK A;  3STB C;  3MXN B;  3BZC A;  1QVF A;  1PH6 A;  4LFC L;  4UY8 C;  4A3J G;  3H3V H;  4JV5 L;  1OXX K;  4A3E G;  4A3G H;  3EBE A;  4LF9 L;  2BA0 A;  2HIV A;  2N8N A;  3AQQ A;  1N32 L;  2VW9 A;  1G6P A;  2R7Z H;  4BBS H;  4BY1 H;  3HOV H;  4K0K Q;  4LF8 Q;  3M9B A;  4UP8 A;  4DK6 C;  5AJ3 Q;  3PIP A;  3TRE A;  4DR3 L;  4L5R C;  4A3D H;  1L1O C;  5IYD H;  4TQU S;  4DKA C;  2ZJR A;  2PMZ E;  4A3C G;  1LTL A;  2JA6 G;  2MFI A;  3U58 A;  5C4X G;  4JI8 L;  3HKS A;  1QZH A;  1PH4 A;  2E5L L;  4DR6 Q;  4DV1 L;  1VQO A;  1X9N A;  1A0I A;  2HHH L;  4PZ7 A;  2JQO A;  4LW1 A;  1UE5 A;  4BXX H;  1Y1V G;  2UXC L;  4LF9 Q;  2OTJ A;  5GQO A;  2K5V A;  3BU2 A;  3UE1 A;  1PH8 A;  1WOC A;  4R4T A;  4R4O A;  3TEH B;  3PIO A;  3PF5 A;  4L5S A;  2KCT A;  3ULJ A;  4BBS G;  1OXT A;  2R6G A;  1VQ8 A;  5C3E G;  1V9P A;  4B3M Q;  3A0J A;  4DV5 L;  4DR7 Q;  1HNW Q;  2RCN A;  4A3D G;  2B63 G;  1A63 A;  4LF7 L;  4QQB X;  1HR0 W;  1CKN A;  2L15 A;  4C3J H;  1CKN B;  1V1Q A;  3TS0 A;  3RZO H;  4GKK L;  3S16 H;  5C0X I;  1K0R A;  4LWC A;  5LMU L;  2A19 A;  4IJL A;  2D0O A;  3STB D;  1VQ7 A;  4BXX G;  3ULP A;  4IFD J;  1VQI A;  4JI0 L;  2K14 A;  4PMW A;  1HNZ L;  1HZ9 A;  2VUM H;  4DV0 Q;  1NE3 A;  4AQY L;  4AIM A;  1XMO Q;  2JA8 G;  1VQH A;  4KI0 A;  2OCE A;  3KYH C;  1KIX A;  2IT1 A;  3UDG A;  3GTK H;  3GTM H;  3J81 j;  3EN2 A;  1KC8 C;  2Z0S A;  4DV5 Q;  1OXV A;  3KLW A;  1AE2 A;  1Y14 B;  4GN4 B;  4LF6 L;  2IX1 A;  4DV6 Q;  1XJV A;  3GTG H;  1MJC A;  4HJ8 A;  2RHQ B;  1WFQ A;  2UUA L;  3SGI A;  2UUB Q;  2HIX A;  3H0G H;  4POF A;  5JJK A;  1L2F A;  1N34 L;  5M5Y H;  2C35 B;  2Z6K C;  4QGU A;  1YEZ A;  1KAW A;  3F2B A;  2K52 A;  3HOW H;  3I4N H;  4DR4 L;  1M1K C;  1HR0 L;  4JI0 Q;  4X62 L;  3U4V A;  2CCZ A;  2KHJ A;  2ID0 A;  4JI6 L;  2AWO A;  3H15 A;  1NJI C;  1FJG Q;  2RHS B;  1XNR L;  4BBR H;  2VUM G;  4WJ4 A;  2JA9 A;  4AQY Q;  1HZA A;  5JJI A;  3KJO A;  4J15 A;  4LFA Q;  1HNX Q;  1VQ6 A;  1UEB A;  1VQG A;  4IO9 A;  4DAY B;  4DR5 Q;  4YCV A;  1G29 1;  3E0E A;  3I7F A;  1VCI A;  4LF6 Q;  1I50 H;  4A4I A;  1EIF A;  1C9O A;  4GN5 A;  1YHB A;  2F3I A;  4EX5 A;  5JEA J;  1C7Y A;  1KQS A;  3L7Z C;  4QJF A;  3HOX H;  4GNX C;  2ATW A;  1MIU A;  1HZB A;  1VQM A;  4A76 A;  4APV A;  5HY6 A;  3ERS X;  3F8T A;  4MNO A;  3I4N G;  1I6H H;  1HR0 Q;  1T9H A;  4JI6 Q;  2QGQ A;  1I5F A;  1YIT A;  4X64 L;  2VL6 A;  2OQK A;  3MEF A;  4L5T A;  1TWH H;  3J7Z C;  4DUZ L;  3RLO A;  1PFS A;  1Q46 A;  2IX0 A;  1KRT A;  2WAQ G;  2CWP A;  3K7U C;  3OYY A;  4OWX B;  2AWN A;  3CCM A;  5M3M G;  1YIJ A;  1E1O A;  1PH3 A;  3UE0 A;  1X55 A;  1GO3 E;  2E2H H;  4OO1 G;  2UXD L;  3J81 i;  4OWW B;  4NXM L;  4IFD G;  4A3M H;  1Q1E A;  2ALY B;  5E7N A;  1RL2 A;  4P72 A;  4A3J H;  3RNU A;  2VY3 A;  4A3E H;  4GLV B;  4X6A H;  2IHE A;  3JC6 6;  4P74 A;  1JMC A;  5FJ8 G;  2E8G A;  3S15 H;  2MQH A;  1NBW A;  3S1M H;  4DUZ Q;  1J6Q A;  5J3B A;  2LXJ A;  4YCU A;  4JOI A;  1CSQ A;  1YZ6 A;  4LF8 L;  1UE7 A;  5AJ3 L;  1GVP A;  3S14 H;  4ALP A;  3HOY H;  1Q1B A;  1VQ5 A;  3RLF A;  4BA2 I;  3CCE A;  4A3C H;  1D7Q A;  2DUD A;  2JA6 H;  1YHA A;  2UXD Q;  3F2D A;  1U5K A;  1NMG A;  4PZ8 A;  4A3M G;  2R7D A;  2K50 A;  3G4S A;  1S72 A;  4OX9 Q;  4A93 H;  4DR6 L;  4DR1 Q;  3LGJ A;  4X65 Q;  4OO1 I;  4GN3 B;  1Y1V H;  4IFD I;  3CQZ H;  2KHI A;  5C4J H;  4HJA A;  3J7A 5;  2JEA I;  2JE6 I;  1E22 A;  4YCW A;  3CC2 A;  1HJP A;  2ZM6 L;  1S40 A;  3F1Z A;  5C3E H;  2CQO A;  3CXC A;  1SRU A;  2NVY H;  4NXN L;  5EAY A;  4B3M L;  2F4V L;  2K75 A;  4DR7 L;  1HNW L;  1AH9 A;  4YWK A;  1HZC A;  2B63 H;  3HOY G;  5C0X G;  5ELO A;  3PCO B;  4LUO A;  4JI5 Q;  4UPA A;  4A3F G;  1E1T A;  4LF5 L;  4MZ9 A;  1TWA H;  1NY4 A;  4Y52 H;  2B29 A;  5FLM G;  3I4O A;  1VQB A;  4B3R Q;  2EIF A;  2WAQ E;  4IJH A;  4A93 G;  1SN8 A;  2F52 A;  1MKH A;  2NVX H;  4DK3 C;  1VQE A;  1XPR A;  2AKW B;  5C44 G;  1K73 C;  2Y0S G;  4DV0 L;  4LFB L;  1XMO L;  2JA8 H;  2V1C C;  2VQE Q;  2NVQ H;  1VQF A;  2ZM6 Q;  2CKZ B;  1I94 L;  3CCQ A;  2ZTC A;  4NXN Q;  3HOU G;  2F4V Q;  1X56 A;  4O2D A;  2JEB I;  1YJ9 A;  3PF4 A;  4DUY Q;  3L0O A;  3J80 i;  3HFZ B;  3CF5 A;  2DGY A;  4DV6 L;  4LF4 Q;  3T1Y Q;  1SMX A;  4LF5 Q;  2UUB L;  1L1O A;  1XNQ Q;  4X66 Q;  2IY5 B;  1L1O B;  4OXP A;  5GAG C;  4YWM A;  3KDF B;  4P73 A;  1B70 B;  2ES2 A;  1CKM A;  4HIK A;  5GRO A;  4GOP A;  1VQC A;  1VQK A;  2MO1 A;  4GOP B;  3F2C A;  1FJG L;  1V43 A;  4PG3 A;  1IL2 A;  5IYB G;  3KFU A;  4LFB Q;  3M4P A;  3I2Z A;  1HNX L;  4LFA L;  1I94 Q;  3KJP A;  4DR5 L;  4HJ9 A;  2I5M X;  4R1J A;  4IOC A;  1PYS B;  3S1R H;  3GTL H;  4IPD A;  5DLQ E;  4B3T Q;  2E2I H;  1TXY A;  1A8V A;  1EOV A;  4EQ5 A;  5M5W H;  1YHQ A;  2K5N A;  2EQS A;  3E9H A;  3FP9 A;  3W5O A;  1R9T H;  1YJW A;  2A8V A;  4JBJ A;  1BKB A;  3BZK A;  4WJ3 M;  1X3G A;  2WB1 G;  4RMF A;  4GLA C;  5LMN W;  3HKZ G;  2HT1 A;  1IBK Q;  4KHP L;  2NN6 I;  4C3H H;  1LM0 A;  2N3S A;  4DV7 Q;  2N49 A;  4R4Q A;  2UU9 Q;  4BY7 H;  4LNQ A;  4YWL A;  3PUX A;  4JBM A;  4JI1 L;  2JA5 G;  5M3M H;  4JBW A;  2CWA A;  1P8L A;  2ZTD A;  1WCM G;  4JI4 Q;  4JC0 A;  4XIG S;  1DGS A;  2JA7 H;  2Y0S E;  1EUJ A;  3GO5 A;  3UDX A;  3AEV A;  3HOZ G;  4HIO A;  1XTD A;  3A5Z B;  1KXL A;  1XMQ L;  3JAM c;  3J81 c;  1Q81 C;  1NMF A;  1N33 Q;  4JG2 A;  1WI5 A;  4GS3 A;  3T1H Q;  3TS2 A;  4UP7 A;  3FKI G;  1X6O A;  3K0X A;  3S24 A;  3OTO Q;  1PH9 A;  4IPC A;  3G6E A;  2QEX A;  2VZA A;  5FJ8 H;  4KHP Q;  1OXS C;  3B6Y A;  1X3E A;  3KOJ A;  4R4C A;  1OXU A;  4AYB G;  3CPF A;  1BVS A;  4QY7 A;  1IYJ B;  1QVG A;  4BY7 G;  4JI1 Q;  4P71 A;  1K8A C;  3CD6 A;  2KEN A;  4KHZ A;  1PA6 A;  3BJU A;  2UXB Q;  3Q8D A;  2WFW A;  1C0A A;  2PI2 E;  2KBN A;  3JAM i;  1Q7Y C;  1QZG A;  2Q2T A;  3E9I A;  2JA7 G;  4JI3 L;  2GVA A;  4JYA L;  4ME3 A;  4C3I H;  5JJL A;  2MNA A;  3FHW A;  1Y1W G;  4OX9 L;  1YJN A;  1XMQ Q;  2NZO A;  4DR1 L;  2FXQ A;  4X65 L;  1SRO A;  1QUQ A;  4PZ6 A;  1N36 Q;  3M3Y H;  3G71 A;  1QUQ B;  1K83 H;  4RG1 A;  4JOI C;  5IY0 A;  3S17 H;  3I56 A;  4IPG A;  5IT9 c;  2YTV A;  1O7I A;  1W2B A;  2R93 H;  4JBK A;  5GAD C;  1WYD A;  3KF6 B;  1EFW A;  3PO3 G;  2I5L X;  3GDE A;  3KF8 B;  5H1S E;  1JE5 A;  5IYC G;  1W3S A;  2WB1 E;  5LMN Q;  1AE3 A;  4A3L G;  3HKZ E;  3CAM A;  4JI2 Q;  4JI5 L;  1YI2 A;  1K8G A;  4A3F H;  1SFO H;  4YY3 L;  3M4Q A;  2LSS A;  3AFQ A;  1WJJ A;  4DV3 Q;  1GM5 A;  5FLM H;  1EIY B;  4JI3 Q;  1QVC A;  4JYA Q;  3PSI A;  4B3R L;  1HH2 P;  2Q2I A;  4DR2 L;  1PHJ A;  3CME A;  3PO2 G;  3I4M G;  2PQA A;  5BR8 Q;  2PQA B;  2RF4 A;  1JJC B;  2ZTE A;  4H02 A;  5C44 H;  3ULL A;  4A3B H;  1ASY A;  5M5X H;  3WWV A;  1CSP A;  1G51 A;  2D0P A;  3NBH B;  4TVA B;  2VQE L;  2OWO A;  2XTI A;  3K8A A;  3M7N A;  4YHH Q;  2R93 G;  1CKO A;  2GN5 A;  3EIV A;  3HOU H;  4XTC S;  1VQA A;  5JEA G;  1KD1 C;  3S1N H;  5K36 G;  3PV0 A;  4DV4 Q;  1SR3 A;  3PUZ A;  3CPW A;  3S1Q H;  4A3K G;  1B7Y B;  2HQL A;  3U50 C;  4DUY L;  5M3F G;  4Y7N H;  1VQL A;  4LF4 L;  1IBL Q;  4YY3 Q;  3T1Y L;  2ASB A;  4AYB E;  2R7F A;  1XNQ L;  2BH8 A;  4X66 L;  3CCR A;  4FDB A;  3J80 c;  1TWF H;  3CCJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...