5IYDH

Human core-pic in the initial transcribing state (no iis)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
150
structure length
150
Chain Sequence
MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Near-atomic resolution visualization of human transcription promoter opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription, transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 16
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5iydH01
1HZ9A 3KDFB 2AKWB 4RMFA 3M4OH 4PZ6A 2EQSA 3F2DA 3PSIA 4DR1Q 1P16A 3KF8B 4YHHL 4LF5Q 3PO3G 1YEZA 2WP8J 5IP9H 4DV5Q 2ATWA 2EXDA 3F1ZA 2A19A 3KJOA 4GOPB 3HKSA 4LFBQ 2NN6G 3F8TA 2A1AA 3AEVA 2KHJA 1E24A 3CPFA 4JI8Q 1HNWL 1PHJA 2YTYA 5HY6A 5GROA 2GVBA 1GD7A 4DV0Q 2E2JH 4JG2A 1Q8KA 4MTNA 4OWTB 2BA0A 1A62A 1UE6A 4UP8A 2JA6G 3ICEA 4DK6C 2PQAB 4A3MG 3T1HL 3HOYG 2ZM6L 5FLMG 3NELA 3KYHC 1NTGA 1YIJA 1IL2A 3I4NG 4KI0A 3TS2A 3JC66 1K3RA 2PNHA 1SN8A 2UXDQ 4JBMA 1UE7A 4IJHA 3HOVH 3OW2A 3W1BA 2B63G 2K5HA 3CCMA 2LSSA 2VZAA 1VQ6A 4A3DH 1G6PA 4LUVA 3J80c 4A3JH 4X66L 1YITA 3K81C 3HOUH 2IT1A 4PMWA 4K0KL 1NE3A 4R4QA 3L2PA 4A75A 2N3SA 3GD7A 1Y1VG 2CQOA 1CSPA 5C0XG 4P72A 4P74A 3B6YA 1BBUA 3S1QH 4JC0A 4LF5L 1BKBA 3KOJA 2BH2A 3KFUA 3FP9A 1AE2A 4NXNL 4B3RQ 2IX1A 1XTDA 2HQLA 1BVSA 2D62A 2B29A 1GM5A 1VQBA 2IHEA 4JI8L 4LUOA 4DR2L 1RL2A 2UU9Q 4GNXC 3CAMA 1D8LA 1UWVA 3AFQA 4OWXB 3CCEA 1I94L 3I4MG 3S1NH 4GKKQ 4JYAL 4IFDJ 5GAGC 4DV4L 3GTMH 3PF5A 1AE3A 5DLQE 3HFZB 4POGA 3PGZA 1PYSB 2VUMG 3G71A 3SGIA 1RIPA 2OQ0A 4O0AA 4LF8Q 4POFA 2CWAA 1HNXQ 1PFSA 1H95A 1IZ6A 1N8RC 2H5XA 4DV3Q 1V1QA 3PUYA 2Y0SG 1YHAA 4IJLA 2NZOA 2XGTA 5BR8L 4LFAQ 3OTOL 4GKJL 4WJ4A 2JE6I 3S2HH 3CQZH 4A3MH 4JI5Q 3AYHB 1XMQQ 4K0KQ 3UDXA 1VQDA 5IYCG 2ZTCA 1KQSA 3I4NH 1VQEA 2XTIA 1SRUA 2JA5H 3IRBA 4UP9A 1N34Q 5M3FH 2YTVA 2Z0SA 4IOCA 4JI6Q 1VQOA 5ELOA 1PA6A 2IX0A 1SLJA 1GVPA 1G291 4DUYQ 3I55A 4ME3A 4A3IH 1J5EQ 1XMOL 1VQJA 4YWMA 3W1GA 2CKZB 1QZHA 2UXCL 4X6AH 1PYBA 1VQ4A 4LF4L 2CWPA 1E1TA 4BY1H 3ER0A 5JJKA 4GKKL 4JYAQ 4LW1A 4AQYQ 2ID0A 3J81i 3G4SA 4JI7Q 1XPUA 3W5OA 3I4MH 4X62L 3UDGA 4A3JG 2OQKA 4GLAC 1VQLA 3HOYH 1EWIA 1W2BA 4LF8L 1Y14B 1HNXL 2ZJPA 3CCLA 1VQIA 2JQOA 3TREA 4QIWE 4DV7L 3RR5A 1QVGA 1N33Q 4TVAB 1QUQB 2UUCL 4JI5L 1HH2P 1CUKA 1VQ8A 5IYDG 1M90C 1Q86C 3GTPH 1N32Q 4MNOA 2EIFA 4UPAA 4H02A 4A93G 4JI6L 3J81j 3M85A 4P75A 5C4XH 2MQHA 1QVFA 3CD6A 3ULLA 3DM3A 3K0XA 2R7DA 3RZDH 1XMOQ 4DPGA 1Q1BA 4GOPA 4A3IG 5C44G 5IYBG 3DLLA 1PH2A 1T9HA 4IFDG 4JI2Q 1TWAH 2VQFQ 5M5WH 4LF9Q 3ZJYC 4AQYL 1EQQA 4BY1G 1K8AC 3M4PA 2NVXH 4JI7L 3H3VH 2KHIA 1X9NA 1TXYA 2AWNA 1SMXA 4GN4B 4JCVE 1ASYA 4GNXB 4QL5A 3S24A 1S3OA 3RN2A 1KC8C 4IPHA 2KBNA 2GVAA 4DV6L 1U5KA 2I0QA 3CCQA 2JA8H 4YCUA 4HIOA 1YJWA 3J80i 2IHFA 4R4IA 1KRTA 3CPWA 2ALYB 2QEXA 3BJUA 1MIUA 4DR6L 1X65A 1VQHA 5E7NA 4HJAA 2HHHQ 3PF4A 1PH5A 4XTCS 4A3CH 2NZHA 4XIGS 1EQRA 2R7FA 2WAQE 3RNUA 3TRZA 4DAYB 4YY3L 1CSQA 1LM0A 1EIYB 4HJ5A 2KCMA 1JE5A 1CKNB 1KIXA 2UUAL 2DGYA 1U0LA 4HJ9A 1XJVA 3PO3H 1Z9FA 1I5FA 4OX9Q 3M9BA 4OXPA 5IP7G 2ASBA 3S17H 4BBSG 1A63A 3WWVA 3CCRA 4LF9L 4GLXA 4JBWA 3PUVA 4JV5Q 4X65L 3CP0A 5IE8A 4HIKA 1UE5A 1OTCA 4IOAA 3K7AH 2N78A 5EAYA 1IBML 1OXTA 4GOPC 3AFPA 1B7YB 1E7ZA 4JI0Q 4A3LG 4RG1A 1N36L 3UDIA 1IBKQ 5FLMH 1PH9A 4Y52H 1I50H 4L5TA 3U58A 3K80C 2YU9H 4JBKA 4AH6A 2Z6KA 2F52A 3HOZG 5AJ3Q 1XNQL 5H1SE 5FLXc 1Y1WG 1QZGA 1A8VA 1WFQA 2VS1A 3BU2A 1PVOA 1OXXK 1VQPA 2BA1A 2OTJA 4O2DA 2JA7G 5M5YH 1SFOH 4DR7Q 4B3SL 2KCTA 1Y1VH 1LYLA 1JJGA 1VQAA 1HZAA 4YWKA 5M3MH 4AIMA 3HOVG 2Q2IA 1YZ6A 2MFIA 1QVCA 2UUAQ 3MXNB 1IYJB 2RF4A 4TQUS 1PH8A 3U4VA 2UXBL 2C35B 4DR4L 1TWCH 5GAEC 5C0XI 2JA6H 2Q2UA 5C4JH 3OYYA 3K7UC 1KL9A 1YJ9A 4NXML 4GLVB 5LMNL 3D31A 4A3BG 1JT8A 2VNUD 1IBMQ 2UUBQ 2L15A 3D0FA 4A76A 2WB1E 2YTXA 1X54A 4GN5A 5IP7H 3M4QA 1IBKL 1EYGA 2VQEQ 4A3EG 5M5XH 3I56A 4JOIC 5IY0A 2E8GA 4YHHQ 3PIOA 2RHQB 2QGQA 3PUXA 3EIVA 3HOXH 1L0WA 2R93G 1K83H 3BZKA 3RLOA 1IBLQ 3UDFA 2WAQG 1OXVA 4LFBL 4DV2Q 3UE0A 1PV4A 1XNRL 5C3EG 2GN5A 4JI1Q 3KDFA 5K36G 1JJCB 2WFWA 1XPOA 1YHQA 4A3GH 1P8LA 4LWCA 4A3FH 4JI3Q 3I7FA 5IWAL 1YBYA 2AHOB 4HJ8A 2K5NA 4HIMA 1C7YA 2E5LQ 2JA7H 1SR3A 1B70B 1KD1C 2VUMH 2N49A 2YV5A 4DK3C 1CKMA 2R7ZG 3H15A 4R1JA 2MO0A 1Z47A 4NB3A 3STBD 2UUBL 4L5SA 3HOZH 4DR1L 3PO2G 5GQOA 3KLWA 4OO1G 1A0IA 1GO3E 3PUWA 4P71A 4P73A 1EIFA 5GADC 1Q7YC 2VQEL 3S14H 3CCUA 1QUQA 1EUJA 4A3BH 1DGSA 4IO9A 4OO1I 4HIDA 1V43A 4C2MH 1MKHA 3E9HA 1PH7A 4HJ7A 4JBJA 3G6EA 3L0OA 1X3GA 3TQYA 3TS0A 3MEFA 3GTKH 4JI1L 4BXXG 2JA5G 1UE1A 3PCOB 4DR2Q 4DNIA 3T1HQ 2ZM6Q 1VQKA 1KHIA 4R4OA 2UU9L 1I94Q 3KF6A 5JEAJ 4JI3L 1XPRA 5IWAQ 5IYDH 2RCNA 3HOWH 1HJPA 3PUZA 1SE8A 2CFMA 4X66Q 1OXSC 5C44H 1Q81C 4B3TL 3U50C 1YJNA 1NJIC 4A93H 2PI2A 1WOCA 2JK8A 3GTGH 1X56A 1YHBA 2A8VA 4GKJQ 5BR8Q 3S15H 1L1OB 2V1CC 3TEHB 1Q1EA 1C0AA 2VL6A 3L7ZC 2PMZE 1OXUA 5JEAG 3A5UA 4NXNQ 4B3RL 1I3QH 3T1YL 1X6OA 4WJ3M 1HR0L 3CXCA 4AYBG 2VY3A 1VQGA 3GTOH 2HT1A 5C4XG 2B3GA 1J5EL 4JI4Q 2R93H 3H0GG 1PH6A 4PG3A 2I5LX 1B8AA 1L2FA 4A3FG 4KHPL 1LUZA 3G48A 3E0EA 4DV4Q 1Q12A 1VQNA 4LF4Q 5IT9c 2I5MX 2ZTEA 4C3IH 1WJJA 1HR0W 1W3SA 4FDBA 4GNXA 5LMUL 4QJFA 1L1OA 2HIXA 4DV3L 2D0PA 3OTOQ 3CMEA 2LXKA 3CCSA 4IPCA 1S72A 2OWOA 4B3TQ 4LF6Q 2CCZA 4LFAL 1YVCA 4BXXH 4JOIA 1MJCA 1XMQL 3GTJH 2D0OA 4PZ7A 4ALPA 1R9TH 2N8NA 1N33L 1N34L 1HNZL 1NMFA 1PH1A 1LTLA 4A4IA 3EN2A 1N32L 1VQMA 2NVYH 4YCVA 2JEBI 3F2CA 3UE1A 2K52A 4A3LH 4DUYL 4EX5A 5JJLA 3T1YQ 1E1OA 1VQ9A 1CKNA 1HR0Q 1K73C 3KF6B 4DUZL 2JA8G 1WI5A 1TWGH 2I5HA 2UXCQ 3CW2C 2R92G 3GTLH 2JEAI 5HGQA 1WCMH 4Y7NH 4JI4L 1GKHA 1FJGL 3HOWG 4LFCQ 2LXJA 3HOUG 4KHPQ 4YWLA 4L5QA 3NENA 4X62Q 3JAMc 2VQFL 5IYCH 4B3ML 1HZCA 1NMGA 4BBSH 2JJQA 1IXRA 4DR3L 3NBHB 3ULJA 2MNAA 3FHWA 1EOVA 5LMUQ 2YYZA 5ELNA 2F4VQ 4DV7Q 1K8GA 1PH4A 2K14A 4LF6L 3PV0A 3M7NA 4QY7A 3GDEA 1MJEA 2BH8A 2UUCQ 4BY7H 2FXQA 3S1MH 2K5VA 3BZCA 3A74A 3EBEA 4MZ9A 1UEBA 5M3MG 1HNZQ 1AH9A 4DKAC 1Q82C 1JMCA 2DUDA 3CF5A 3FKIG 1FGUA 1NY4A 1L1OC 2MO1A 3VDYA 3NEMA 4R4CA 4R4TA 1KRSA 4APVA 3ULPA 1VQCA 2WB1G 3J81c 1E3PA 2ZTDA 4DUZQ 2NVTH 4AYBE 4UP7A 1I6HH 4A3KH 1FVIA 4YCWA 4JI2L 5JJIA 4KLKA 3CCVA 1YNXA 1FJGQ 1WCMG 4OX9L 2K50A 4LFCL 3HOXG 3H0GH 3S1RH 2NVQH 1C9OA 5GAHC 2Q2TA 4LUZA 3CC2A 4B3MQ 2R6GA 3J7A5 5C3EH 1J6QA 5M3FG 1BBWA 4DR3Q 4DV6Q 1JJ2A 4NPSA 4JV5L 2ZJRA 2E2IH 3GO5A 2QA4A 4DV1L 4UY8C 1SROA 3AQQA 2F4VL 4DR5Q 2ZJQA 4A3GG 1NBWA 1E22A 1N36Q 4DR6Q 1O7IA 3S2DH 1VCIA 1ASZA 1VQ7A 2JA9A 2HHHL 1G51A 4A3EH 4GS3A 1K9MC 3F2BA 4BBRH 1XNQQ 1Q46A 5LMNW 4YY3Q 2R92H 4IFDI 3RLFA 1VS0A 3RLNA 1KAWA 4LNQA 1EFWA 3FKIH 4LF7L 2AWOA 3GTQH 1D7QA 4BY7G 1V9PA 5FJ8H 2K4KA 4DR7L 3K8AA 4GN3B 1FL0A 4X64Q 2K75A 1CKOA 1TWFH 4IPDA 3LGJA 4BA1I 2OTLA 2Z6KC 3CC4A 3PO2H 4X65Q 4DR4Q 2Y0SE 3I2ZA 4C3JH 2IY5B 1PH3A 5IP9G 4QQBX 4NXMQ 3KJPA 5J3BA 3PIPA 2KENA 5LMNQ 4JI0L 3M3YH 1K0RA 4EQ5A 4DV1Q 1JB7A 2PQAA 3CCJA 4DR5L 2PI2E 4L5RC 3HKZG 4IPGA 2ES2A 4QGUA 3E9IA 5AJ3L 1TWHH 2AMCB 1X55A 5C0XJ 5IYBH 3CMAA 2RHSB 4DV5L 2Q2HA 3HKZE 3RZOH 1N9WA 3A0JA 3Q8DA 2HIVA 1VQFA 3I4OA 1YI2A 3A5ZB 2R7ZH 4OONA 3ERSX 4B3SQ 3H3VI 2F3IA 4DAMA 1HNWQ 2B63H 2VW9A 4DV0L 3JAMi 3RN5A 1S40A 1M1KC 1IBLL 4LF7Q 4A3DG 4DV2L 2OCEA 1XNRQ 2UXBQ 1HZBA 1X3FA 5FJ8G 1VQ5A 1WYDA 4X64L 4J15A 4A3CG 4A3KG 1KXLA 4BBRG 4C3HH 3STBC 2E2HH 4OWWB 2UXDL 3CC7A 1X3EA 4KHZA 1Y1WH 3U4ZA 3S16H 2E5LL 3J7ZC 4BA2I 4PZ8A 2NN6I
chains in the Genus database with same CATH superfamily
3QOLA 3M4OH 2EQSA 1TWGB 2F3WA 4H0LC 1EEFD 3KF8B 3N6RA 2E76C 1YEZA 3R3OA 5IP9H 2EXDA 1BCPB 4GOPB 3W2DA 1B1ZA 1TVXA 1KNEA 3AEVA 3CPFA 4DK0A 3HOZB 2YTYA 5HY6A 5GROA 2GVBA 1GD7A 4JG2A 1Q8KA 2MGSA 4OWTB 2E2JB 1UE6A 4UP8A 2JA6G 3T1HL 5FLMG 1CK1A 1R4QB 1V8QA 2UXDQ 1TWHB 3EROA 1UE7A 4IJHA 3CHBD 2LSSA 1H9SA 5L37A 4X66L 4K0KL 1NE3A 4R4QA 1Y1VG 3IFDA 3OIPA 3ZYYX 4JC0A 4B3RQ 2IX1A 1B53A 4MN3A 1GM5A 2K1BA 4XT3B 2IHEA 2Z4IA 4DR2L 5I2XA 4OWXB 1UWVA 3S1NH 2IPKD 4V0BA 1LT4D 2A69D 4DXFA 2VUMG 3D4DA 1RIPA 3UI2A 4LF8Q 4POFA 5K36H 1MBYA 4FYDA 1IZ6A 1QNKA 2H5XA 3PUYA 1SJHD 3OTOL 1YHAA 4GKJL 4WJ4A 2JYOA 4LFAQ 3WOFA 2NVXB 3A8JE 4ZKBB 1SEBD 4A3MH 2XRSD 2KVMA 2XTIA 4UP9A 2P5ZX 2YTVA 5ELOA 1LT3D 2IX0A 1D6EC 3I55A 2XVSA 4R8NA 1VQJA 1A2TA 2CVRA 1PXUA 4HMJA 5D14A 4OELB 2HD3A 5EBCA 3G4SA 3I4MH 1II3A 2EYJA 3Q22A 1VQLA 1HPCA 1JOQA 5JEAH 1QNUA 4LF8L 1HNXL 2EXZA 3RR5A 4O42A 1HRJA 3VA5A 4TVAB 3GTPH 1Q86C 2JXMB 4UPAA 3MEHA 1V1PB 3M85A 5C4XH 2MQHA 1QVFA 3CD6A 1RTNA 1EY7A 1F77A 3WDNA 1XMOQ 1PLFA 4FF2A 5FO8B 4A3IG 3DLLA 5KNDA 3VYUA 1EQQA 1K8AC 2NVXH 1QG7A 1TXYA 2BDNA 1SMXA 4G57A 2YU9B 4JCVE 4LK1C 1SMYD 4DU9A 4DV6L 3K6OA 5DAUA 2I0QA 3CCQA 3J80i 3HRZC 1MIUA 4DR6L 1VQHA 4NMZA 4HJAA 1VF5C 3MXGA 1EIYB 3KLSA 1U4MA 3IAYA 4IURA 4RWSC 1DJRD 2F0WA 4C3HB 3DWPA 1XJVA 4KKTA 1TKWB 2DY8A 4XQQA 2ASBA 1TS4A 4K5VA 4BS9A 3S17H 1KNAA 4J8QA 3CCRA 4BBSG 4JBWA 3PUVA 2F0UA 4JV5Q 3CP0A 1MGSA 5IE8A 3MAQA 1D1KA 1F9SA 1Z7TA 1B4OA 2N78A 3M7GA 4XXEA 4QMGA 3R2IA 3AFPA 4A3LG 2Z9HA 5FLMH 2XSCA 2LY7A 3HS0C 4L5TA 1EIGA 3U58A 4JBKA 4AH6A 1O7YA 1S5DD 2EE1A 5EJWA 3HOZG 5FLXc 4RHSA 1A8VA 1SXTA 5EKIA 2F0IA 3H0GB 1Y1VH 1JJGA 1ONLA 4AIMA 5M3MH 1YZ6A 1GOZA 1QVCA 5C0XI 5IGGA 2M2LA 1HQRD 1YNNC 3S1RB 3QIAA 2VNUD 1IBMQ 2UUBQ 2L15A 5C5MA 3SEBA 5IP7H 2PCFB 3BDCA 3NWTA 5M5XH 3V96A 4BWGB 4JOIC 4YHHQ 5K5PA 2QGQA 2RBMA 3RLOA 2WAQG 1OXVA 1F2LA 5C3EG 4KV6A 2ZXPA 2WAQB 1JJCB 4NDXA 4A3GH 5JPNC 3FRPB 2AHOB 4HJ8A 1SR3A 4K6DA 1B70B 1KD1C 2N49A 3DWAA 2UUBL 1Z47A 4NB3A 3HOZH 4NP5A 4DR1L 4OO1G 1A0IA 2F0LA 1EIFA 2RCFA 3S14H 4A3BH 1DGSA 1QJOA 4IO9A 5M5WB 4OIKA 1V43A 4C2MH 1F2MA 2PZTA 2F0QA 4HJ7A 1RDPD 3TS0A 1X3GA 1CZWA 3MEFA 3GTKH 1B50A 3BS1A 3T1HQ 1VQKA 4I7ZC 2UU9L 1NSNS 2LMCB 5I9OA 2M9VA 2F0HA 1UAPA 1V1OA 3HOWH 4X3KA 1SE8A 1Q81C 4X66Q 4PMCA 5IIFA 1YJNA 1NJIC 1DYQA 2PI2A 1YHBA 1ENCA 3S15H 1L1OB 3TEHB 1Q1EA 3L7ZC 4MHEA 4AYBB 4HCSA 2B2UC 3T1YL 3MHBA 3NSWA 1JOKA 3CXCA 4AYBG 1GUOA 1VQGA 4OIJA 4OGQC 2QILA 5LHY1 1L2FA 4OHJA 1ET6A 4A3DB 2ENBA 3R8BA 4A3JB 1HR0W 5JVG3 2K32A 4QJFA 2I46A 1Q8IA 1L1OA 3NQIA 3P1HA 4LFAL 2CCZA 5G3LD 2A74C 2A69C 3EVQA 3TZDA 4PZ7A 1R9TH 1WTPA 2IWHA 1G2SA 4A93B 3EN2A 2OT2A 2NVYH 1K83B 1AW7A 4A3LH 1NUCA 3T1YQ 1E1OA 1MD2D 1HR0Q 2JA8G 1STYA 1WI5A 1DOKA 3MFGA 1WTXA 3D6WA 5G3LF 3PQIA 4Y7NH 4L63B 1EOTA 3HOUG 1S4ZA 4KD4A 4L5QA 5E4XA 4B3ML 3BDLA 2MNAA 3ULJA 1QCBD 2F4VQ 3IKJA 1K8GA 1PRTD 3PV0A 4WORA 3TMEA 4QY7A 1MJEA 2BH8A 4MZ9A 5J1ZA 2B2TC 2R93B 1BR9A 1F2YA 3E5SA 1SFOB 1I50B 3ND9A 3NXWA 3DMUA 1DCZA 1EY5A 1KRSA 2F0VA 3ULPA 2NVTH 3MXNA 4H13C 4CDEC 2LKVA 2VB2X 1FVIA 5JJIA 5C5LA 2F0TA 3BVGA 1WCMG 4KHVA 2NVQH 2B8FA 3H0GH 4MIUA 4LUZA 1CTMA 1HTLD 3WOEA 5FK9C 5I4DA 1TR5A 5C3EH 4DV6Q 4KKSA 2ZJRA 2E2IH 3IL8A 2D9UA 5C3WA 4A3GG 1NBWA 2Z8LA 1VCIA 2Y0SB 4ZKCB 2JA9A 1HHVA 2A6HC 4GS3A 1Q90A 5A2QL 3F2BA 1U4PA 4G7OC 1ICWA 3H94A 3C1FA 1TU2B 1VS0A 2QF7A 5IT9E 1V9PA 3K8AA 4U68A 5KYLA 3VA7A 1TWFH 2OTLA 1IKLA 1BXTA 3CC4A 1GHJA 1RJTA 3ERQA 4FO2A 4C3JH 1NNXA 1Y69U 1RODA 3TSSA 5IP9G 5J3BA 5LMNQ 4F8MA 4EQ5A 3MFYA 1STHA 1TS5A 2HCCA 2KECA 3HKZG 4Z9CB 2ES2A 4QGUA 2XNAC 1ICFB 1X55A 5CC4A 5C0XJ 1LTAD 2Q2HA 1N9WA 4L6TB 4OEMB 2L9HA 1EU3A 3A5ZB 3A8IE 3ERSX 3OPOA 4DAMA 1HNWQ 4DV2L 1FD7D 1HZBA 3VR5A 4J15A 3ONAB 1D1IA 1Y8OB 4EGVA 1KXLA 2M00A 1S5CD 3STBC 4RAUC 1HFNA 1PTOF 5DM73 4PZ8A 2NN6I 1TY0A 3NHHA 1G2TA 3KDFB 2A68C 4RMFA 4PZ6A 2K33A 2D5DA 3PSIA 5C4HA 5EPKA 2WP8J 4DV5Q 3F1ZA 2A19A 2ICEC 1PTOD 4KY6A 4CKEA 1CZGA 3HKSA 2IX3A 3KJOA 2NN6G 3F8TA 1CI3M 2A1AA 4WJWA 4C3JB 1PHJA 1CQFA 1G6ZA 2HDMA 2BA0A 4A3MG 3HOYG 2PW5A 3HZXA 3TS2A 1K3RA 2PNHA 1SN8A 3HOVH 2O4XA 1OO9B 4QCLA 4A3DH 3CCMA 2VZAA 2QDBA 1M4VA 3J80c 4C3IB 1YITA 3K81C 3SVMA 3HOUH 4A75A 1X32A 3GD7A 3MTSA 2CQOA 4C3IG 3MA2B 2HDLA 1BBUA 2BH2A 3KFUA 3FP9A 2DNEA 1DZ1A 2XWBB 4CDCC 4NXNL 1JWMD 2A73B 4IUQA 3DUZA 2D62A 1STEA 4KJNA 2PPBC 4JI8L 4LUOA 3S1NB 1EFID 2UU9Q 1I4HA 2MUYA 3GTMH 4IUNA 1AE3A 4POGA 4IFDH 2RDFA 1LABA 1SYDA 3SGIA 1C8CA 3VYRA 1CA6A 2RQXA 4K14A 1PFSA 4ABNA 3SHLA 4DV3Q 1V1QA 4ZYSA 1E0BA 4IJLA 2NZOA 5LL6S 1EWHA 3ND8A 3S2HH 1JB3A 1SAPA 4JI5Q 1TWCB 5CV9A 2ZTCA 3I4NH 1W6KA 1DOLA 2JA5H 1IYUA 4IOCA 3HG9A 1PZJD 2EYMA 1VQOA 5EKKA 1SLJA 2BE5C 1GVPA 2EYLA 2WIIB 3SK8A 4DUYQ 4ME3A 1J5EQ 1VDZA 5CV7A 3W1GA 3V2TA 2UXCL 1JE4A 2NWGA 4RGOS 4BY1H 4EVOA 5JJKA 4AQYQ 3D4WA 3J81i 3RUZA 3W5OA 2EY5A 1IHZA 2WKCA 2XWJB 1XPUA 1STBA 1IW7D 2NYZD 3VR4A 2OQKA 1O7LA 2HUGA 1EWIA 1W2BA 2F1MA 1Y14B 5CV5A 2ZJPA 3S2DB 4IALA 4DV7L 5CV8A 2EYFA 4K8JA 2JP1A 4A3GB 3GP7A 1HH2P 5IYDG 1M90C 1CM9A 2J7ZA 4F7XA 2EIFA 3GTQB 1H9RA 3KBGA 4JI6L 4RKBA 1PRTB 3J81j 3GTMB 4P75A 1EL0A 1U4LA 3OIQA 5ISRA 2E74C 3RZDH 1Q1BA 4BBRB 5C44G 1JR0D 4IFDG 4JI2Q 4AQYL 3H3VH 3EA6A 5KRUA 1SYGA 1X9NA 4GN4B 4GNXB 1A3UA 3S24A 1ESFA 2PNRC 3OMCA 1KLGD 5KNCA 4A3KB 3I72A 1I4PA 4R4IA 4RGMA 1X65A 3GTJB 1ZKOA 1MHWC 1PH5A 4XTCS 4A3CH 1YNJC 3TRZA 2R7FA 4YY3L 1CSQA 1KDAA 3TP7A 2E2IB 1KIXA 3EJIA 3AU7A 5CGKA 3PO3B 4HJ9A 2B2VA 1Z9FA 1I5FA 4OXPA 3SDZA 5IP7G 4LF9L 2IL8A 4QB4A 4X65L 2K01A 1OTCA 4HIKA 1UE5A 4IOAA 1MI2A 5CORA 1TY2A 3OMGA 1B7YB 1E7ZA 3CQZB 4RG1A 3I73A 4Y52H 1PH9A 4YIJA 2YU9H 1PTOC 2F52A 1XNQL 1Y1WG 2SEBD 3K59A 1TIID 2OTJA 2QKIC 5M5YH 1I4QA 4B3SL 3G7LA 1HZAA 1VF7A 1GUNA 2Q2IA 2MFIA 2UUAQ 2F4IA 1A2UA 1D5ZC 1I4RA 3VR6A 4HR7B 5CR3A 3RD4A 5C4JH 1KL9A 3FDTA 4A3BG 3NWSA 1H9SB 2JN4A 1WCMB 1D5MC 4A76A 4RA8A 2CH4A 2YTXA 1X54A 4DAYA 2XIWA 4E6IA 3M4QA 4F87A 5M5XB 2DJGC 1WD1A 2K05A 2KEDA 2HCIA 5KGUA 1PDQA 5ELBA 3HOXH 1K83H 3BZKA 1BDOA 4LAAA 3UDFA 4DV2Q 3SE0A 2GN5A 5K36G 5A35A 1ZYRD 4LWCA 1TS3A 3I7FA 5IOCA 4JI3Q 2VUMB 2SNSA 4N9TA 3P20A 1LTBD 1CKMA 3H15A 4R1JA 3STBD 1EYDA 5IGEA 4PV1C 3KLWA 1Q7YC 1D2BA 4BY7B 5COYA 4QIWB 1CT1D 1E2VA 2RDHA 3AB9A 2X69A 1A3TA 5EPLA 4JBJA 3D8GA 3L0OA 1IKMA 2I07B 2O2LD 2ZM6Q 3S16B 1I94Q 3KF6A 5JEAJ 4JI3L 1XPRA 3VR3A 4ZAIA 4P2CB 1E2ZA 4CDDC 1WTWA 4B3TL 5C44H 1OXSC 4FF4A 3GTGH 4X3SA 3X3MA 2FMMA 2VL6A 1PYWD 2PMZE 4CJ0B 5JEAG 1QE6A 2EPBA 4QUFA 2VY3A 2FINB 3GTOH 1BF4A 3MZ5A 2HT1A 4IUPA 4JI4Q 4RHRA 2R93H 1PH6A 2FMCA 2I5LX 4PNYA 1LUZA 5JJZA 3E0EA 2JA5B 3VR2A 5IT9c 1EY9A 4FDBA 2DN8A 1RCVD 1QOHA 2F0FA 4B3TQ 4IPCA 4LF6Q 3S1QB 4BXXH 4JOIA 1MJCA 2D0OA 4ALPA 1N33L 3TBIB 5AFWA 1ENFA 2A6HD 2EYOA 1VQMA 3F2CA 4CDFC 2K52A 4EX5A 3QO2A 2A68D 2ICIA 4DUZL 1K73C 2I5HA 1TWGH 3CW2C 2ZT9C 2JEAI 4ZUJA 1GKHA 1S5BD 4LFCQ 2LXJA 3NENA 1GHKA 2NB0A 2JA7B 3QJYA 5IYCH 1NMGA 1IXRA 3LNNA 1EZ8A 3URYA 5LMUQ 1KDCA 3C46A 5ELNA 1JC7A 4A3EB 3T13A 4LF6L 3GDEA 2F0EA 1EY6A 3OHXC 4LMQD 3S1MH 3BZCA 1YNND 5M3MG 4DKAC 1Q82C 1JMCA 5DM63 2DUDA 2WB1B 3CF5A 1NY4A 1B44D 4R4CA 1LACA 4R4TA 1VQCA 4DUZQ 1E3PA 2ZTDA 1H9JA 4UP7A 4A3KH 4YCWA 4KLKA 1D5XC 3CCVA 1YNXA 4A3IB 1FJGQ 1IYVA 4OX9L 2K50A 4LFCL 3HOXG 3S1RH 5GAHC 2L1BA 5HURA 4FP5D 2R6GA 1HA5A 2C9OA 1BCPC 4JV5L 5M3FG 4NPSA 2Q8TA 1LTSD 4MTKA 4DR5Q 3HKZB 4B9XA 1PFBA 1ASZA 1VMCA 1K9MC 1CQVA 1YNJD 4IFDI 3M4YA 1KAWA 1JOOA 2AWOA 3J7AF 4DR7L 2K4KA 4ULLA 1BCPD 5IGDA 2KA7A 4X3UA 2K75A 1CKOA 1A3VA 4OO1H 2RSOA 3I2ZA 1PH3A 3PIPA 2KENA 4V190 1EQVA 1K0RA 2KCNA 3FPUB 4IN3A 4IQZA 5M5YB 5FLXE 3H91A 3MXUA 2PMZB 1QWYA 3E9IA 2J4XA 4OL7A 5IYBH 5C4JB 2RHSB 3CMAA 1L0XB 3A0JA 4IUUA 2EJMA 2CHBD 1Z6HA 1I4GA 4OONA 4IUTA 4A3DG 4DV0L 1AEXA 2QDLA 5FLXL 1X3FA 2AQ1B 4X64L 3J81E 4EQPA 1FNVA 2E2HH 2LS01 1GUTA 3CC7A 3U4ZA 3FVQA 4ZQ3A 5FO9B 1O7ZA 3M4OB 1HZ9A 3PO2B 1KTKA 3CU7A 2RA4A 3F2DA 4DR1Q 1P16A 4LF5Q 5I6WA 1B3QA 4L8JA 1EYAA 1STGA 3CKIB 2Q8RE 4BBSB 4LFBQ 4UDUC 3Q0AA 3JAME 4DV0Q 1C48A 2E2JH 4MTNA 4ME5A 1A62A 2K7VA 3ICEA 4DK6C 2PQAB 3TP6A 3NELA 1YIJA 1NTGA 3I4NG 3JC66 3S9WA 3BVMA 3OW2A 2B63G 1LTGD 3QG1A 4KD3A 5FOBB 3HOUB 4DFAA 3SR1A 4A3JH 3MVVA 1XYIA 2IT1A 2K03A 2N3SA 3MWYW 2K5QA 3GV3A 2F3VA 4P72A 3B6YA 3C2PA 1BO0A 3S1QH 3ITPA 4LF5L 1BKBA 3U9OA 1AE2A 3I4MB 5EPJA 1VQBA 4A3FB 4H44C 3CAMA 1I94L 4JPBW 2F0NA 5GAGC 4DV4L 2KUMA 5I9PA 3PF5A 5DLQE 4KY5A 1PYSB 1TS2A 2DY7A 5D3IB 1HNXQ 4I65A 3G6JB 3GTPB 2XGTA 3OWFA 5JPMC 3CQZH 4K0KQ 3AYHB 1SDFA 1XMQQ 1VQDA 1SRUA 5M3FH 4CKCA 2TMPA 1NAPA 1SSOA 1PA6A 3BDOA 3I8ZA 1G291 1LT5D 2K6AA 1XMOL 2IW3A 1QZHA 4X6AH 1PYBA 1DOMA 1VQ4A 1E1TA 2EVBA 1BNZA 4LW1A 2ID0A 1PRTC 1R4PB 5LL6X 4A3JG 4GLAC 5EBDA 2CQAA 2AUKA 1VQIA 2JQOA 1QVGA 2WKDA 1EQTA 1N33Q 5TSSA 1JQYD 1QUQB 5E1FA 2UUCL 5HGTA 2QEJC 4G7ZC 1VQ8A 2A6ED 1N32Q 1SMYC 4MNOA 1LT6D 1WTOA 3FKIB 4A93G 4KKUA 1IL8A 3QR8A 3KK7A 2R7DA 4GOPA 1DONA 5F2DA 5IYBG 4WFN3 1T9HA 4HEDA 3TDQA 3OOCA 5J39A 5M5WH 3J80L 3ZJYC 2KQ3A 4BY1G 3T56B 5CMDA 1EY8A 2KHIA 2R3ZA 1XX8A 4QL5A 1S3OA 3TP8A 3V05A 1KC8C 4IPHA 2KBNA 2GVAA 1K3BC 4B9WA 4HIOA 1I6HB 3CPWA 1MSGA 4DK1A 2ALYB 2QEXA 1UNSA 3BJUA 4ID6A 5D65A 1C4QA 4DA2A 3HOWB 3PF4A 4FNFA 3PMFA 3RNUA 1EQRA 1AP0A 2WAQE 1LM0A 5JAVA 2JA6B 4RH6A 2KCMA 1JE5A 1CKNB 2XN9C 3MC0B 1U0LA 1KLUD 2KEEA 4IZ8A 4OX9Q 1AN8A 3GTLB 1IW7C 2B2WA 3N52A 3WWVA 1A63A 3K0YA 4J6HA 3S17B 4GLXA 2R92B 2B2VC 3QB3A 1H9KA 3K7AH 1IBML 1OXTA 5KEEA 5FO7B 1K28A 2OEOA 4JI0Q 2G5DA 5BN5A 3HP3A 1N36L 1IBKQ 1F9PA 1PFNA 4CHTB 1LLRD 3K80C 1M8AA 3NQTA 2O5IC 1EY0A 1HTPA 2RDGA 4PMBA 5AJ3Q 2WINB 1RHPA 1PVOA 1JWSD 1OXXK 1VQPA 1SNCA 4KMUC 4DR7Q 2KCTA 5M3MB 1LYLA 2PW7A 4HSPA 4YWKA 4CBVA 3HOVG 1IYJB 3TZUA 4TQUS 1PH8A 3U4VA 2UXBL 2EZVA 3SXHA 4DR4L 5GAEC 3OYYA 3K7UC 1YJ9A 4NXML 4ZLTF 2D2CC 2N55A 3D31A 1HUMA 4TKOB 4KY7A 3L9AX 3D0FA 3H6MA 1GUWA 1DD2A 4C2MB 1BQQT 1IBKL 1F9RA 1DM0B 2VQEQ 1EYGA 3I56A 2DJFC 5IY0A 3SK6A 4JW0A 2RHQB 4M1UB 1L0WA 3HGBA 3J7YW 1IBLQ 3SK5A 3UE0A 2EDGA 1PV4A 3PIP3 1ML0D 1TWAB 2MPMA 3SK4A 2SOBA 3RMHA 3NTIA 2ZXOA 4FXDA 1GJXA 1Q3LA 1KDBA 3KF8A 1YHQA 2BE5D 3NE5B 1YBYA 2F0OA 4HIMA 2JA7H 2KCCA 2E5LQ 3S2HB 4CJ2C 2AQ3B 1B3AA 2R7ZG 2MO0A 4L5SA 3PO2G 5E3FA 1GO3E 4P71A 4P73A 2L0CA 5GADC 2VQEL 3LWUA 2GA4B 1QUQA 2NTSA 4HIDA 2G9HD 3QOJA 3E9HA 1PH7A 4HMIA 1TT2A 5IGFA 2KHSA 4BXXG 2JA5G 3PCOB 4R4OA 2Z6BA 2K5DA 4ILWA 4ZRZA 3I91A 1SJED 5IYDH 2NTTA 3PUZA 3HEJA 5IGBA 1WOCA 4S3SA 1X56A 5NUCA 1EYCA 5BR8Q 5DEHA 3A7LA 3QWNA 1C0AA 3IFTA 4C1NI 1G8ZD 1OXUA 2PZWA 3P75A 3EFXD 3A5UA 4B3RL 1EZ6A 1X6OA 1NR2A 4WJ3M 1HR0L 1K8MA 4HSVA 1BBXC 1J5EL 3H0GG 4PG3A 2Q8IB 4DV4Q 1Q12A 4LF4Q 1JICA 2PQEA 2I5MX 3RZDB 4HTHA 1WJJA 1TWFB 4X3TA 1W3SA 4GNXA 4QF4A 3BG3A 1F9QA 3OTOQ 1NCVA 3CMEA 2LXKA 1S72A 2OWOA 3K5NA 4JK1C 1YVCA 1XMQL 2TSSA 2L55A 1Y1VB 2N88A 5KYIA 4C56C 1HNZL 1NMFA 1EY4A 2NVYB 4DAPA 4DNTB 4YCVA 2JEBI 1CFMA 3S15B 5JJLA 2H4OA 1KAAA 3HOYB 2R92G 5HGQA 5CV6A 5C3EB 3KUPA 4Y7NB 4C3JG 4TSSA 4YWLA 2MHVA 2VQFL 4RKLA 1HZCA 2G9DA 3FMCA 2JJQA 4DR3L 4WRDA 4HCEA 2IJ0A 1EOVA 3FHWA 2YYZA 1WTVA 3AMUA 2UUCQ 2FXQA 1SNDA 4A3BB 3A74A 1UEBA 1A6XA 3DM1A 1HNZQ 3C3LA 1AH9A 1U4RA 3FKIG 1FGUA 3VDYA 3NP8A 3GTKB 2WB1G 1XXGA 4AYBE 1I6HH 1HFGA 1PFMA 4KN7C 4FXKC 3NBIA 1C9OA 2NVQB 2Q2TA 1ENAA 2B2YC 2X6LA 3NUCA 5DNFA 4B3MQ 3S14B 3J7A5 4DR3Q 4XDXA 4DV1L 4Q5VA 4UY8C 2F4VL 1WTRA 1E22A 3Q23A 4DR6Q 3S2DH 1VQ7A 1G51A 5D3DA 4A3EH 3LX0A 1XNQQ 1Q46A 2R92H 4LJZC 3DXJC 3NPPA 3RLFA 3RLNA 1EWCA 4LNQA 1EFWA 3GTQH 4BY7G 5FJ8H 1FR3A 1SNOA 1SYCA 5C4XB 4NKLA 1FL0A 4N9PA 5I2YA 4IPDA 2QCPX 4BA1I 3PIO3 1PZID 2Y0SE 1G91A 2IY5B 4JI0L 4H7BA 3TP5A 4DV1Q 5T1IA 3CCJA 3BVZA 3GV6A 1FGBD 4L5RC 5AJ3L 2AMCB 3I4LA 3T53B 4DV5L 3HKZE 4N8X1 4CKBA 1VQFA 5C0XH 3I4OA 1SYBA 4G4KA 2F0PA 4RCOA 1YI2A 3H3VI 2Z1CA 2AUJD 2B63H 2VW9A 3RN5A 3JAMi 4RFBA 5CBAE 1B9NA 1XNRQ 1SYFA 2UXBQ 2B2YA 2NBFA 4EQOA 1VQ5A 1WYDA 2K5WA 4BBRG 3OW7A 4K5XA 4RGNA 4C3HH 4OWWB 5T1GA 5JVH3 1X3EA 2NZ1D 3S16H 5IGCA 1CA5A 3H3VC 2AKWB 1S5ED 4YHHL 2PYKA 4I7AA 3Q6SA 3PO3G 2WV6D 1H9MA 2ATWA 1X3QA 4ZCKA 5C3XA 2KHJA 1E24A 2B2UA 4JI8Q 1HNWL 2QW7A 3BYYB 1CHPD 3DWQA 3KBXA 4XT1B 2ZM6L 2FFKB 2SNMA 3KYHC 3MXPA 1I4XA 4PQXA 1IL2A 4KI0A 4RGTA 3J7AV 4JBMA 3W1BA 1VQ6A 2K5HA 1G6PA 2AQ2B 4LUVA 3Q24A 1PZKD 4PMWA 3J80E 2R7ZB 3L2PA 1J8IA 1ZEQX 4XQNA 1SYEA 1CSPA 5C0XG 3L3OC 4P74A 1FNUA 2CH4W 3KOJA 2K04A 3K7AB 1GUGA 2B8GA 1XTDA 2HQLA 1BVSA 2B29A 5ELEA 3HOXB 5CYUA 4ZK9B 3I90A 3NK9A 4UHVA 1RL2A 3R2TA 4RCNA 4GNXC 1XTCD 3CCEA 1D8LA 4GKKQ 3AFQA 3I4MG 4JYAL 4IFDJ 1F2ZA 2LFNA 1W6JA 3HFZB 4CJ1B 3PGZA 5EQ0A 3G71A 3K58A 1O78A 2OQ0A 4O0AA 2VXWA 4K2LA 1STAA 2CWAA 1H95A 1N8RC 2MP1A 2Y0SG 1HQMC 5BR8L 1MSHA 2JE6I 3UDXA 5IYCG 1KQSA 2RKSA 4CGYB 1VQEA 5M3FB 3IRBA 1N34Q 1U9RA 2EJGC 2Z0SA 3NTKA 4JI6Q 2J0TD 2EY2A 3K5OA 3C1EA 2C5CA 4A3IH 4YWMA 2CKZB 4LF4L 2CWPA 3ER0A 3CRKC 4GKKL 4JYAQ 4JI7Q 4X62L 5EKLA 3UDGA 1K0SA 3HOYH 2L11A 1EEID 5J22A 1ET9A 2L4NA 3CCLA 3TREA 4QIWE 4KJOA 4DNRB 1BCPF 1XWEA 4JI5L 1CUKA 2MJ8A 2L5TA 4H02A 2PO4A 3ULLA 3DM3A 3K0XA 4DPGA 1PH2A 1TWAH 3GTOB 2VQFQ 4LF9Q 3BYTB 2SDFA 4K5WA 1WTQA 3M4PA 4JI7L 5FKAC 4M8AA 3EQLC 4R8IA 2AWNA 1R9TB 1ASYA 1QILA 3RN2A 4DN4M 3D3RA 1U5KA 2JA8H 4O1NA 4YCUA 2R61A 4N8FA 2IHFA 4R9WA 1YJWA 1KRTA 3K5MA 2B2TA 5C6AA 2KJXA 3I70A 5E7NA 2HHHQ 4NW2A 2NZHA 4XIGS 1EIHA 4DAYB 4HJ5A 2DNCA 1VMPA 4ODGA 1SE2A 2UUAL 1T5EA 2DGYA 3PO3H 3A55A 3M9BA 5CV4A 3DEPA 3KLSX 1RD9D 1WVLA 2F0KA 2XRQD 2RVLA 3OSOA 3F2UA 5EAYA 3E6ZX 3U9SA 1T5XD 4GOPC 4A3MB 1HXYD 1B2TA 1AFPA 1SE3A 3UDIA 4J1MA 1I50H 3A54A 2Z6KA 5C4ZA 4HN7A 3D4RA 2CW0D 2EJFC 4K8IA 2BOSA 2NVTB 4IUVA 5H1SE 1QZGA 1WFQA 2VS1A 3BU2A 1ESRA 2BA1A 3M3YB 4O2DA 2OXPA 2JA7G 1PTOH 1E2WA 5KIXA 1SFOH 1VQAA 5I6YA 3MXNB 1SNQA 2RF4A 2C35B 3TN2A 1TWCH 2JA6H 3T16A 2Q2UA 3RZOB 2H1EA 2A5HA 4GLVB 5LMNL 1V1PA 1JT8A 4ZUIA 4B08A 3W3AA 1DXMA 1I6VC 4KN4C 2WB1E 4FXGC 4GN5A 4C1NK 4DAVA 5BN4A 4A3EG 5IODA 2E8GA 2RSNA 3PIOA 3P7JA 3PUXA 1Y1WB 3EIVA 2R93G 5M9OA 4LFBL 1XNRL 1GUSA 4JI1Q 1RKNA 3KDFA 3R93A 2WFWA 5C44B 1I3QB 2EYPA 1XPOA 1O80A 1P8LA 2L12A 1ILPA 4A3FH 5IWAL 2K5NA 2A6EC 1C7YA 3LWEA 4JVZA 1LTRD 4GZYC 2VUMH 2YV5A 4DK3C 2JSOA 5GQOA 5ELCA 1RF2D 3PUWA 1JORA 3CCUA 1EUJA 4OO1I 4XQJA 1EU4A 3I3CA 4K6LA 1MKHA 4KK7A 4TRDA 4DF7A 2PZUA 3FEWX 3G6EA 3TQYA 1GXDC 4JI1L 2KOLA 1UE1A 4DR2Q 4DNIA 4C3HG 1KHIA 4FF3A 1ZXTA 5IWAQ 2RCNA 1NR4A 1HJPA 1RTOA 2CFMA 2HQEA 3U50C 3OWEB 4A93H 1SBBB 3H09A 2E2DC 2JK8A 2NN6H 2A8VA 4GKJQ 3E0JA 2V1CC 1PMRA 1B9MA 4NXNQ 1X3PA 1I3QH 1Y8NB 5JOBA 5C4XG 2B3GA 4FVMA 5A2QE 1B8AA 4A3FG 4KHPL 3G48A 4XYQA 1VQNA 2B2WC 2E75C 2ZTEA 4QUCA 2ZXRA 4C3IH 4G7HC 3E3XA 3VYSA 3KLRA 3CRLC 5LMUL 3S1MB 5EGTA 2EY1A 1LTID 2HIXA 2D0PA 4DV3L 2F03A 3CCSA 1SNPA 2EY6A 3GTJH 1UUPA 2N8NA 2E2HB 2WACA 1N34L 3NTHA 1PH1A 1LTLA 4A4IA 2JA8B 3GTGB 1N32L 1JWUD 3UE1A 4DUYL 1TQOA 1VQ9A 1CKNA 3KF6B 3K57A 2UXCQ 2X6GA 3GTLH 4U673 3A56A 2OF1A 1WCMH 4JI4L 1FJGL 1HCZA 3DEOA 4DXGA 4KHPQ 4X62Q 3JAMc 2VB3X 1CHQD 4BBSH 3T51B 2F0GA 3NBHB 3A8KE 1WD0A 3O13A 3I4NB 4DV7Q 2V4DA 3DHQA 1Y8PB 5BN3A 1PH4A 2K14A 5KNBA 2CW0C 3M7NA 4BY7H 1SE4A 2K5VA 2O5JC 4F88A 2FJ2A 3EBEA 3T4AC 1ILQA 3GQBA 1A15A 2MO1A 1L1OC 1BOSA 3NEMA 4APVA 5E4WC 3J81c 3VYTA 1PRTF 4JI2L 4HAEA 1STNA 2F0MA 1S5FD 3NBHA 1PTOB 2FHTA 1WTHA 3CC2A 4UAIA 1BUVT 2B63B 4BY1B 1LO5D 1J6QA 4EQNA 1BBWA 1JJ2A 2EYHA 1KABA 3GO5A 2QA4A 1SROA 3AQQA 4KTAA 2ZJQA 3A7AB 1N36Q 1O7IA 4Q0FA 2F0JA 1LTTD 2HHHL 4K2KA 1HUNA 4BBRH 5LMNW 4YY3Q 4DGZA 1JCKB 2NUCA 3BZDB 3FKIH 1SNMA 4LF7L 1D7QA 1ZYRC 4GN3B 4X64Q 2BCOA 4FF1A 3LGJA 2BDOA 4XYOA 1L0YB 3D6CA 2Z6KC 3PO2H 4X65Q 4DR4Q 5ELDA 2B39A 4QQBX 1AZPA 4NXMQ 3KJPA 3M3YH 1JB7A 2EOTA 2PQAA 5IT9L 1J9OA 4DR5L 2PI2E 4IPGA 3J81L 2F0SA 1TWHH 1AZQA 1QB5D 1LV9A 2K28A 2Z4HA 3RZOH 5ELFA 3X3NA 1FNWA 2HIVA 3Q8DA 3FPPA 2R7ZH 1K8OA 4B3SQ 2F3IA 3K5LA 1UEAB 1IBLL 1S40A 1M1KC 4LF7Q 1HA6A 2OCEA 3HOVB 5FJ8G 5CBEE 4A3CG 2F0DA 4A3KG 2UXDL 4KHZA 3JAML 1Y1WH 1FYCA 2E5LL 3J7ZC 4BA2I 3HOWG
chains in the Genus database with same CATH topology
1HZ9A 3KDFB 2AKWB 4RMFA 3M4OH 4PZ6A 2EQSA 3F2DA 3PSIA 4DR1Q 1P16A 3KF8B 4YHHL 4LF5Q 3PO3G 1YEZA 2WP8J 5IP9H 4DV5Q 2ATWA 2EXDA 3F1ZA 2A19A 3KJOA 4GOPB 3HKSA 4LFBQ 2NN6G 3F8TA 2A1AA 3AEVA 2KHJA 1E24A 3CPFA 4JI8Q 1HNWL 1PHJA 2YTYA 5HY6A 5GROA 2GVBA 1GD7A 4DV0Q 2E2JH 4JG2A 1Q8KA 4MTNA 4OWTB 2BA0A 1A62A 1UE6A 4UP8A 2JA6G 3ICEA 4DK6C 2PQAB 4A3MG 3T1HL 3HOYG 2ZM6L 5FLMG 3NELA 3KYHC 1NTGA 1YIJA 1IL2A 3I4NG 4KI0A 3TS2A 3JC66 1K3RA 2PNHA 1SN8A 2UXDQ 4JBMA 1UE7A 4IJHA 3HOVH 3OW2A 3W1BA 2B63G 2K5HA 3CCMA 2LSSA 2VZAA 1VQ6A 4A3DH 1G6PA 4LUVA 3J80c 4A3JH 4X66L 1YITA 3K81C 3HOUH 2IT1A 4PMWA 4K0KL 1NE3A 4R4QA 3L2PA 4A75A 2N3SA 3GD7A 1Y1VG 2CQOA 1CSPA 5C0XG 4P72A 4P74A 3B6YA 1BBUA 3S1QH 4JC0A 4LF5L 1BKBA 3KOJA 2BH2A 3KFUA 3FP9A 1AE2A 4NXNL 4B3RQ 2IX1A 1XTDA 2HQLA 1BVSA 2D62A 2B29A 1GM5A 1VQBA 2IHEA 4JI8L 4LUOA 4DR2L 1RL2A 2UU9Q 4GNXC 3CAMA 1D8LA 1UWVA 3AFQA 4OWXB 3CCEA 1I94L 3I4MG 3S1NH 4GKKQ 4JYAL 4IFDJ 5GAGC 4DV4L 3GTMH 3PF5A 1AE3A 5DLQE 3HFZB 4POGA 3PGZA 1PYSB 2VUMG 3G71A 3SGIA 1RIPA 2OQ0A 4O0AA 4LF8Q 4POFA 2CWAA 1HNXQ 1PFSA 1H95A 1IZ6A 1N8RC 2H5XA 4DV3Q 1V1QA 3PUYA 2Y0SG 1YHAA 4IJLA 2NZOA 2XGTA 5BR8L 4LFAQ 3OTOL 4GKJL 4WJ4A 2JE6I 3S2HH 3CQZH 4A3MH 4JI5Q 3AYHB 1XMQQ 4K0KQ 3UDXA 1VQDA 5IYCG 2ZTCA 1KQSA 3I4NH 1VQEA 2XTIA 1SRUA 2JA5H 3IRBA 4UP9A 1N34Q 5M3FH 2YTVA 2Z0SA 4IOCA 4JI6Q 1VQOA 5ELOA 1PA6A 2IX0A 1SLJA 1GVPA 1G291 4DUYQ 3I55A 4ME3A 4A3IH 1J5EQ 1XMOL 1VQJA 4YWMA 3W1GA 2CKZB 1QZHA 2UXCL 4X6AH 1PYBA 1VQ4A 4LF4L 2CWPA 1E1TA 4BY1H 3ER0A 5JJKA 4GKKL 4JYAQ 4LW1A 4AQYQ 2ID0A 3J81i 3G4SA 4JI7Q 1XPUA 3W5OA 3I4MH 4X62L 3UDGA 4A3JG 2OQKA 4GLAC 1VQLA 3HOYH 1EWIA 1W2BA 4LF8L 1Y14B 1HNXL 2ZJPA 3CCLA 1VQIA 2JQOA 3TREA 4QIWE 4DV7L 3RR5A 1QVGA 1N33Q 4TVAB 1QUQB 2UUCL 4JI5L 1HH2P 1CUKA 1VQ8A 5IYDG 1M90C 1Q86C 3GTPH 1N32Q 4MNOA 2EIFA 4UPAA 4H02A 4A93G 4JI6L 3J81j 3M85A 4P75A 5C4XH 2MQHA 1QVFA 3CD6A 3ULLA 3DM3A 3K0XA 2R7DA 3RZDH 1XMOQ 4DPGA 1Q1BA 4GOPA 4A3IG 5C44G 5IYBG 3DLLA 1PH2A 1T9HA 4IFDG 4JI2Q 1TWAH 2VQFQ 5M5WH 4LF9Q 3ZJYC 4AQYL 1EQQA 4BY1G 1K8AC 3M4PA 2NVXH 4JI7L 3H3VH 2KHIA 1X9NA 1TXYA 2AWNA 1SMXA 4GN4B 4JCVE 1ASYA 4GNXB 4QL5A 3S24A 1S3OA 3RN2A 1KC8C 4IPHA 2KBNA 2GVAA 4DV6L 1U5KA 2I0QA 3CCQA 2JA8H 4YCUA 4HIOA 1YJWA 3J80i 2IHFA 4R4IA 1KRTA 3CPWA 2ALYB 2QEXA 3BJUA 1MIUA 4DR6L 1X65A 1VQHA 5E7NA 4HJAA 2HHHQ 3PF4A 1PH5A 4XTCS 4A3CH 2NZHA 4XIGS 1EQRA 2R7FA 2WAQE 3RNUA 3TRZA 4DAYB 4YY3L 1CSQA 1LM0A 1EIYB 4HJ5A 2KCMA 1JE5A 1CKNB 1KIXA 2UUAL 2DGYA 1U0LA 4HJ9A 1XJVA 3PO3H 1Z9FA 1I5FA 4OX9Q 3M9BA 4OXPA 5IP7G 2ASBA 3S17H 4BBSG 1A63A 3WWVA 3CCRA 4LF9L 4GLXA 4JBWA 3PUVA 4JV5Q 4X65L 3CP0A 5IE8A 4HIKA 1UE5A 1OTCA 4IOAA 3K7AH 2N78A 5EAYA 1IBML 1OXTA 4GOPC 3AFPA 1B7YB 1E7ZA 4JI0Q 4A3LG 4RG1A 1N36L 3UDIA 1IBKQ 5FLMH 1PH9A 4Y52H 1I50H 4L5TA 3U58A 3K80C 2YU9H 4JBKA 4AH6A 2Z6KA 2F52A 3HOZG 5AJ3Q 1XNQL 5H1SE 5FLXc 1Y1WG 1QZGA 1A8VA 1WFQA 2VS1A 3BU2A 1PVOA 1OXXK 1VQPA 2BA1A 2OTJA 4O2DA 2JA7G 5M5YH 1SFOH 4DR7Q 4B3SL 2KCTA 1Y1VH 1LYLA 1JJGA 1VQAA 1HZAA 4YWKA 5M3MH 4AIMA 3HOVG 2Q2IA 1YZ6A 2MFIA 1QVCA 2UUAQ 3MXNB 1IYJB 2RF4A 4TQUS 1PH8A 3U4VA 2UXBL 2C35B 4DR4L 1TWCH 5GAEC 5C0XI 2JA6H 2Q2UA 5C4JH 3OYYA 3K7UC 1KL9A 1YJ9A 4NXML 4GLVB 5LMNL 3D31A 4A3BG 1JT8A 2VNUD 1IBMQ 2UUBQ 2L15A 3D0FA 4A76A 2WB1E 2YTXA 1X54A 4GN5A 5IP7H 3M4QA 1IBKL 1EYGA 2VQEQ 4A3EG 5M5XH 3I56A 4JOIC 5IY0A 2E8GA 4YHHQ 3PIOA 2RHQB 2QGQA 3PUXA 3EIVA 3HOXH 1L0WA 2R93G 1K83H 3BZKA 3RLOA 1IBLQ 3UDFA 2WAQG 1OXVA 4LFBL 4DV2Q 3UE0A 1PV4A 1XNRL 5C3EG 2GN5A 4JI1Q 3KDFA 5K36G 1JJCB 2WFWA 1XPOA 1YHQA 4A3GH 1P8LA 4LWCA 4A3FH 4JI3Q 3I7FA 5IWAL 1YBYA 2AHOB 4HJ8A 2K5NA 4HIMA 1C7YA 2E5LQ 2JA7H 1SR3A 1B70B 1KD1C 2VUMH 2N49A 2YV5A 4DK3C 1CKMA 2R7ZG 3H15A 4R1JA 2MO0A 1Z47A 4NB3A 3STBD 2UUBL 4L5SA 3HOZH 4DR1L 3PO2G 5GQOA 3KLWA 4OO1G 1A0IA 1GO3E 3PUWA 4P71A 4P73A 1EIFA 5GADC 1Q7YC 2VQEL 3S14H 3CCUA 1QUQA 1EUJA 4A3BH 1DGSA 4IO9A 4OO1I 4HIDA 1V43A 4C2MH 1MKHA 3E9HA 1PH7A 4HJ7A 4JBJA 3G6EA 3L0OA 1X3GA 3TQYA 3TS0A 3MEFA 3GTKH 4JI1L 4BXXG 2JA5G 1UE1A 3PCOB 4DR2Q 4DNIA 3T1HQ 2ZM6Q 1VQKA 1KHIA 4R4OA 2UU9L 1I94Q 3KF6A 5JEAJ 4JI3L 1XPRA 5IWAQ 5IYDH 2RCNA 3HOWH 1HJPA 3PUZA 1SE8A 2CFMA 4X66Q 1OXSC 5C44H 1Q81C 4B3TL 3U50C 1YJNA 1NJIC 4A93H 2PI2A 1WOCA 2JK8A 3GTGH 1X56A 1YHBA 2A8VA 4GKJQ 5BR8Q 3S15H 1L1OB 2V1CC 3TEHB 1Q1EA 1C0AA 2VL6A 3L7ZC 2PMZE 1OXUA 5JEAG 3A5UA 4NXNQ 4B3RL 1I3QH 3T1YL 1X6OA 4WJ3M 1HR0L 3CXCA 4AYBG 2VY3A 1VQGA 3GTOH 2HT1A 5C4XG 2B3GA 1J5EL 4JI4Q 2R93H 3H0GG 1PH6A 4PG3A 2I5LX 1B8AA 1L2FA 4A3FG 4KHPL 1LUZA 3G48A 3E0EA 4DV4Q 1Q12A 1VQNA 4LF4Q 5IT9c 2I5MX 2ZTEA 4C3IH 1WJJA 1HR0W 1W3SA 4FDBA 4GNXA 5LMUL 4QJFA 1L1OA 2HIXA 4DV3L 2D0PA 3OTOQ 3CMEA 2LXKA 3CCSA 4IPCA 1S72A 2OWOA 4B3TQ 4LF6Q 2CCZA 4LFAL 1YVCA 4BXXH 4JOIA 1MJCA 1XMQL 3GTJH 2D0OA 4PZ7A 4ALPA 1R9TH 2N8NA 1N33L 1N34L 1HNZL 1NMFA 1PH1A 1LTLA 4A4IA 3EN2A 1N32L 1VQMA 2NVYH 4YCVA 2JEBI 3F2CA 3UE1A 2K52A 4A3LH 4DUYL 4EX5A 5JJLA 3T1YQ 1E1OA 1VQ9A 1CKNA 1HR0Q 1K73C 3KF6B 4DUZL 2JA8G 1WI5A 1TWGH 2I5HA 2UXCQ 3CW2C 2R92G 3GTLH 2JEAI 5HGQA 1WCMH 4Y7NH 4JI4L 1GKHA 1FJGL 3HOWG 4LFCQ 2LXJA 3HOUG 4KHPQ 4YWLA 4L5QA 3NENA 4X62Q 3JAMc 2VQFL 5IYCH 4B3ML 1HZCA 1NMGA 4BBSH 2JJQA 1IXRA 4DR3L 3NBHB 3ULJA 2MNAA 3FHWA 1EOVA 5LMUQ 2YYZA 5ELNA 2F4VQ 4DV7Q 1K8GA 1PH4A 2K14A 4LF6L 3PV0A 3M7NA 4QY7A 3GDEA 1MJEA 2BH8A 2UUCQ 4BY7H 2FXQA 3S1MH 2K5VA 3BZCA 3A74A 3EBEA 4MZ9A 1UEBA 5M3MG 1HNZQ 1AH9A 4DKAC 1Q82C 1JMCA 2DUDA 3CF5A 3FKIG 1FGUA 1NY4A 1L1OC 2MO1A 3VDYA 3NEMA 4R4CA 4R4TA 1KRSA 4APVA 3ULPA 1VQCA 2WB1G 3J81c 1E3PA 2ZTDA 4DUZQ 2NVTH 4AYBE 4UP7A 1I6HH 4A3KH 1FVIA 4YCWA 4JI2L 5JJIA 4KLKA 3CCVA 1YNXA 1FJGQ 1WCMG 4OX9L 2K50A 4LFCL 3HOXG 3H0GH 3S1RH 2NVQH 1C9OA 5GAHC 2Q2TA 4LUZA 3CC2A 4B3MQ 2R6GA 3J7A5 5C3EH 1J6QA 5M3FG 1BBWA 4DR3Q 4DV6Q 1JJ2A 4NPSA 4JV5L 2ZJRA 2E2IH 3GO5A 2QA4A 4DV1L 4UY8C 1SROA 3AQQA 2F4VL 4DR5Q 2ZJQA 4A3GG 1NBWA 1E22A 1N36Q 4DR6Q 1O7IA 3S2DH 1VCIA 1ASZA 1VQ7A 2JA9A 2HHHL 1G51A 4A3EH 4GS3A 1K9MC 3F2BA 4BBRH 1XNQQ 1Q46A 5LMNW 4YY3Q 2R92H 4IFDI 3RLFA 1VS0A 3RLNA 1KAWA 4LNQA 1EFWA 3FKIH 4LF7L 2AWOA 3GTQH 1D7QA 4BY7G 1V9PA 5FJ8H 2K4KA 4DR7L 3K8AA 4GN3B 1FL0A 4X64Q 2K75A 1CKOA 1TWFH 4IPDA 3LGJA 4BA1I 2OTLA 2Z6KC 3CC4A 3PO2H 4X65Q 4DR4Q 2Y0SE 3I2ZA 4C3JH 2IY5B 1PH3A 5IP9G 4QQBX 4NXMQ 3KJPA 5J3BA 3PIPA 2KENA 5LMNQ 4JI0L 3M3YH 1K0RA 4EQ5A 4DV1Q 1JB7A 2PQAA 3CCJA 4DR5L 2PI2E 4L5RC 3HKZG 4IPGA 2ES2A 4QGUA 3E9IA 5AJ3L 1TWHH 2AMCB 1X55A 5C0XJ 5IYBH 3CMAA 2RHSB 4DV5L 2Q2HA 3HKZE 3RZOH 1N9WA 3A0JA 3Q8DA 2HIVA 1VQFA 3I4OA 1YI2A 3A5ZB 2R7ZH 4OONA 3ERSX 4B3SQ 3H3VI 2F3IA 4DAMA 1HNWQ 2B63H 2VW9A 4DV0L 3JAMi 3RN5A 1S40A 1M1KC 1IBLL 4LF7Q 4A3DG 4DV2L 2OCEA 1XNRQ 2UXBQ 1HZBA 1X3FA 5FJ8G 1VQ5A 1WYDA 4X64L 4J15A 4A3CG 4A3KG 1KXLA 4BBRG 4C3HH 3STBC 2E2HH 4OWWB 2UXDL 3CC7A 1X3EA 4KHZA 1Y1WH 3U4ZA 3S16H 2E5LL 3J7ZC 4BA2I 4PZ8A 2NN6I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HZ9 A;  3KDF B;  2AKW B;  4RMF A;  3M4O H;  4PZ6 A;  2EQS A;  3F2D A;  3PSI A;  4DR1 Q;  1P16 A;  3KF8 B;  4YHH L;  4LF5 Q;  3PO3 G;  1YEZ A;  2WP8 J;  5IP9 H;  4DV5 Q;  2ATW A;  2EXD A;  3F1Z A;  2A19 A;  3KJO A;  4GOP B;  3HKS A;  4LFB Q;  2NN6 G;  3F8T A;  2A1A A;  3AEV A;  2KHJ A;  1E24 A;  3CPF A;  4JI8 Q;  1HNW L;  1PHJ A;  2YTY A;  5HY6 A;  5GRO A;  2GVB A;  1GD7 A;  4DV0 Q;  2E2J H;  4JG2 A;  1Q8K A;  4MTN A;  4OWT B;  2BA0 A;  1A62 A;  1UE6 A;  4UP8 A;  2JA6 G;  3ICE A;  4DK6 C;  2PQA B;  4A3M G;  3T1H L;  3HOY G;  2ZM6 L;  5FLM G;  3NEL A;  3KYH C;  1NTG A;  1YIJ A;  1IL2 A;  3I4N G;  4KI0 A;  3TS2 A;  3JC6 6;  1K3R A;  2PNH A;  1SN8 A;  2UXD Q;  4JBM A;  1UE7 A;  4IJH A;  3HOV H;  3OW2 A;  3W1B A;  2B63 G;  2K5H A;  3CCM A;  2LSS A;  2VZA A;  1VQ6 A;  4A3D H;  1G6P A;  4LUV A;  3J80 c;  4A3J H;  4X66 L;  1YIT A;  3K81 C;  3HOU H;  2IT1 A;  4PMW A;  4K0K L;  1NE3 A;  4R4Q A;  3L2P A;  4A75 A;  2N3S A;  3GD7 A;  1Y1V G;  2CQO A;  1CSP A;  5C0X G;  4P72 A;  4P74 A;  3B6Y A;  1BBU A;  3S1Q H;  4JC0 A;  4LF5 L;  1BKB A;  3KOJ A;  2BH2 A;  3KFU A;  3FP9 A;  1AE2 A;  4NXN L;  4B3R Q;  2IX1 A;  1XTD A;  2HQL A;  1BVS A;  2D62 A;  2B29 A;  1GM5 A;  1VQB A;  2IHE A;  4JI8 L;  4LUO A;  4DR2 L;  1RL2 A;  2UU9 Q;  4GNX C;  3CAM A;  1D8L A;  1UWV A;  3AFQ A;  4OWX B;  3CCE A;  1I94 L;  3I4M G;  3S1N H;  4GKK Q;  4JYA L;  4IFD J;  5GAG C;  4DV4 L;  3GTM H;  3PF5 A;  1AE3 A;  5DLQ E;  3HFZ B;  4POG A;  3PGZ A;  1PYS B;  2VUM G;  3G71 A;  3SGI A;  1RIP A;  2OQ0 A;  4O0A A;  4LF8 Q;  4POF A;  2CWA A;  1HNX Q;  1PFS A;  1H95 A;  1IZ6 A;  1N8R C;  2H5X A;  4DV3 Q;  1V1Q A;  3PUY A;  2Y0S G;  1YHA A;  4IJL A;  2NZO A;  2XGT A;  5BR8 L;  4LFA Q;  3OTO L;  4GKJ L;  4WJ4 A;  2JE6 I;  3S2H H;  3CQZ H;  4A3M H;  4JI5 Q;  3AYH B;  1XMQ Q;  4K0K Q;  3UDX A;  1VQD A;  5IYC G;  2ZTC A;  1KQS A;  3I4N H;  1VQE A;  2XTI A;  1SRU A;  2JA5 H;  3IRB A;  4UP9 A;  1N34 Q;  5M3F H;  2YTV A;  2Z0S A;  4IOC A;  4JI6 Q;  1VQO A;  5ELO A;  1PA6 A;  2IX0 A;  1SLJ A;  1GVP A;  1G29 1;  4DUY Q;  3I55 A;  4ME3 A;  4A3I H;  1J5E Q;  1XMO L;  1VQJ A;  4YWM A;  3W1G A;  2CKZ B;  1QZH A;  2UXC L;  4X6A H;  1PYB A;  1VQ4 A;  4LF4 L;  2CWP A;  1E1T A;  4BY1 H;  3ER0 A;  5JJK A;  4GKK L;  4JYA Q;  4LW1 A;  4AQY Q;  2ID0 A;  3J81 i;  3G4S A;  4JI7 Q;  1XPU A;  3W5O A;  3I4M H;  4X62 L;  3UDG A;  4A3J G;  2OQK A;  4GLA C;  1VQL A;  3HOY H;  1EWI A;  1W2B A;  4LF8 L;  1Y14 B;  1HNX L;  2ZJP A;  3CCL A;  1VQI A;  2JQO A;  3TRE A;  4QIW E;  4DV7 L;  3RR5 A;  1QVG A;  1N33 Q;  4TVA B;  1QUQ B;  2UUC L;  4JI5 L;  1HH2 P;  1CUK A;  1VQ8 A;  5IYD G;  1M90 C;  1Q86 C;  3GTP H;  1N32 Q;  4MNO A;  2EIF A;  4UPA A;  4H02 A;  4A93 G;  4JI6 L;  3J81 j;  3M85 A;  4P75 A;  5C4X H;  2MQH A;  1QVF A;  3CD6 A;  3ULL A;  3DM3 A;  3K0X A;  2R7D A;  3RZD H;  1XMO Q;  4DPG A;  1Q1B A;  4GOP A;  4A3I G;  5C44 G;  5IYB G;  3DLL A;  1PH2 A;  1T9H A;  4IFD G;  4JI2 Q;  1TWA H;  2VQF Q;  5M5W H;  4LF9 Q;  3ZJY C;  4AQY L;  1EQQ A;  4BY1 G;  1K8A C;  3M4P A;  2NVX H;  4JI7 L;  3H3V H;  2KHI A;  1X9N A;  1TXY A;  2AWN A;  1SMX A;  4GN4 B;  4JCV E;  1ASY A;  4GNX B;  4QL5 A;  3S24 A;  1S3O A;  3RN2 A;  1KC8 C;  4IPH A;  2KBN A;  2GVA A;  4DV6 L;  1U5K A;  2I0Q A;  3CCQ A;  2JA8 H;  4YCU A;  4HIO A;  1YJW A;  3J80 i;  2IHF A;  4R4I A;  1KRT A;  3CPW A;  2ALY B;  2QEX A;  3BJU A;  1MIU A;  4DR6 L;  1X65 A;  1VQH A;  5E7N A;  4HJA A;  2HHH Q;  3PF4 A;  1PH5 A;  4XTC S;  4A3C H;  2NZH A;  4XIG S;  1EQR A;  2R7F A;  2WAQ E;  3RNU A;  3TRZ A;  4DAY B;  4YY3 L;  1CSQ A;  1LM0 A;  1EIY B;  4HJ5 A;  2KCM A;  1JE5 A;  1CKN B;  1KIX A;  2UUA L;  2DGY A;  1U0L A;  4HJ9 A;  1XJV A;  3PO3 H;  1Z9F A;  1I5F A;  4OX9 Q;  3M9B A;  4OXP A;  5IP7 G;  2ASB A;  3S17 H;  4BBS G;  1A63 A;  3WWV A;  3CCR A;  4LF9 L;  4GLX A;  4JBW A;  3PUV A;  4JV5 Q;  4X65 L;  3CP0 A;  5IE8 A;  4HIK A;  1UE5 A;  1OTC A;  4IOA A;  3K7A H;  2N78 A;  5EAY A;  1IBM L;  1OXT A;  4GOP C;  3AFP A;  1B7Y B;  1E7Z A;  4JI0 Q;  4A3L G;  4RG1 A;  1N36 L;  3UDI A;  1IBK Q;  5FLM H;  1PH9 A;  4Y52 H;  1I50 H;  4L5T A;  3U58 A;  3K80 C;  2YU9 H;  4JBK A;  4AH6 A;  2Z6K A;  2F52 A;  3HOZ G;  5AJ3 Q;  1XNQ L;  5H1S E;  5FLX c;  1Y1W G;  1QZG A;  1A8V A;  1WFQ A;  2VS1 A;  3BU2 A;  1PVO A;  1OXX K;  1VQP A;  2BA1 A;  2OTJ A;  4O2D A;  2JA7 G;  5M5Y H;  1SFO H;  4DR7 Q;  4B3S L;  2KCT A;  1Y1V H;  1LYL A;  1JJG A;  1VQA A;  1HZA A;  4YWK A;  5M3M H;  4AIM A;  3HOV G;  2Q2I A;  1YZ6 A;  2MFI A;  1QVC A;  2UUA Q;  3MXN B;  1IYJ B;  2RF4 A;  4TQU S;  1PH8 A;  3U4V A;  2UXB L;  2C35 B;  4DR4 L;  1TWC H;  5GAE C;  5C0X I;  2JA6 H;  2Q2U A;  5C4J H;  3OYY A;  3K7U C;  1KL9 A;  1YJ9 A;  4NXM L;  4GLV B;  5LMN L;  3D31 A;  4A3B G;  1JT8 A;  2VNU D;  1IBM Q;  2UUB Q;  2L15 A;  3D0F A;  4A76 A;  2WB1 E;  2YTX A;  1X54 A;  4GN5 A;  5IP7 H;  3M4Q A;  1IBK L;  1EYG A;  2VQE Q;  4A3E G;  5M5X H;  3I56 A;  4JOI C;  5IY0 A;  2E8G A;  4YHH Q;  3PIO A;  2RHQ B;  2QGQ A;  3PUX A;  3EIV A;  3HOX H;  1L0W A;  2R93 G;  1K83 H;  3BZK A;  3RLO A;  1IBL Q;  3UDF A;  2WAQ G;  1OXV A;  4LFB L;  4DV2 Q;  3UE0 A;  1PV4 A;  1XNR L;  5C3E G;  2GN5 A;  4JI1 Q;  3KDF A;  5K36 G;  1JJC B;  2WFW A;  1XPO A;  1YHQ A;  4A3G H;  1P8L A;  4LWC A;  4A3F H;  4JI3 Q;  3I7F A;  5IWA L;  1YBY A;  2AHO B;  4HJ8 A;  2K5N A;  4HIM A;  1C7Y A;  2E5L Q;  2JA7 H;  1SR3 A;  1B70 B;  1KD1 C;  2VUM H;  2N49 A;  2YV5 A;  4DK3 C;  1CKM A;  2R7Z G;  3H15 A;  4R1J A;  2MO0 A;  1Z47 A;  4NB3 A;  3STB D;  2UUB L;  4L5S A;  3HOZ H;  4DR1 L;  3PO2 G;  5GQO A;  3KLW A;  4OO1 G;  1A0I A;  1GO3 E;  3PUW A;  4P71 A;  4P73 A;  1EIF A;  5GAD C;  1Q7Y C;  2VQE L;  3S14 H;  3CCU A;  1QUQ A;  1EUJ A;  4A3B H;  1DGS A;  4IO9 A;  4OO1 I;  4HID A;  1V43 A;  4C2M H;  1MKH A;  3E9H A;  1PH7 A;  4HJ7 A;  4JBJ A;  3G6E A;  3L0O A;  1X3G A;  3TQY A;  3TS0 A;  3MEF A;  3GTK H;  4JI1 L;  4BXX G;  2JA5 G;  1UE1 A;  3PCO B;  4DR2 Q;  4DNI A;  3T1H Q;  2ZM6 Q;  1VQK A;  1KHI A;  4R4O A;  2UU9 L;  1I94 Q;  3KF6 A;  5JEA J;  4JI3 L;  1XPR A;  5IWA Q;  5IYD H;  2RCN A;  3HOW H;  1HJP A;  3PUZ A;  1SE8 A;  2CFM A;  4X66 Q;  1OXS C;  5C44 H;  1Q81 C;  4B3T L;  3U50 C;  1YJN A;  1NJI C;  4A93 H;  2PI2 A;  1WOC A;  2JK8 A;  3GTG H;  1X56 A;  1YHB A;  2A8V A;  4GKJ Q;  5BR8 Q;  3S15 H;  1L1O B;  2V1C C;  3TEH B;  1Q1E A;  1C0A A;  2VL6 A;  3L7Z C;  2PMZ E;  1OXU A;  5JEA G;  3A5U A;  4NXN Q;  4B3R L;  1I3Q H;  3T1Y L;  1X6O A;  4WJ3 M;  1HR0 L;  3CXC A;  4AYB G;  2VY3 A;  1VQG A;  3GTO H;  2HT1 A;  5C4X G;  2B3G A;  1J5E L;  4JI4 Q;  2R93 H;  3H0G G;  1PH6 A;  4PG3 A;  2I5L X;  1B8A A;  1L2F A;  4A3F G;  4KHP L;  1LUZ A;  3G48 A;  3E0E A;  4DV4 Q;  1Q12 A;  1VQN A;  4LF4 Q;  5IT9 c;  2I5M X;  2ZTE A;  4C3I H;  1WJJ A;  1HR0 W;  1W3S A;  4FDB A;  4GNX A;  5LMU L;  4QJF A;  1L1O A;  2HIX A;  4DV3 L;  2D0P A;  3OTO Q;  3CME A;  2LXK A;  3CCS A;  4IPC A;  1S72 A;  2OWO A;  4B3T Q;  4LF6 Q;  2CCZ A;  4LFA L;  1YVC A;  4BXX H;  4JOI A;  1MJC A;  1XMQ L;  3GTJ H;  2D0O A;  4PZ7 A;  4ALP A;  1R9T H;  2N8N A;  1N33 L;  1N34 L;  1HNZ L;  1NMF A;  1PH1 A;  1LTL A;  4A4I A;  3EN2 A;  1N32 L;  1VQM A;  2NVY H;  4YCV A;  2JEB I;  3F2C A;  3UE1 A;  2K52 A;  4A3L H;  4DUY L;  4EX5 A;  5JJL A;  3T1Y Q;  1E1O A;  1VQ9 A;  1CKN A;  1HR0 Q;  1K73 C;  3KF6 B;  4DUZ L;  2JA8 G;  1WI5 A;  1TWG H;  2I5H A;  2UXC Q;  3CW2 C;  2R92 G;  3GTL H;  2JEA I;  5HGQ A;  1WCM H;  4Y7N H;  4JI4 L;  1GKH A;  1FJG L;  3HOW G;  4LFC Q;  2LXJ A;  3HOU G;  4KHP Q;  4YWL A;  4L5Q A;  3NEN A;  4X62 Q;  3JAM c;  2VQF L;  5IYC H;  4B3M L;  1HZC A;  1NMG A;  4BBS H;  2JJQ A;  1IXR A;  4DR3 L;  3NBH B;  3ULJ A;  2MNA A;  3FHW A;  1EOV A;  5LMU Q;  2YYZ A;  5ELN A;  2F4V Q;  4DV7 Q;  1K8G A;  1PH4 A;  2K14 A;  4LF6 L;  3PV0 A;  3M7N A;  4QY7 A;  3GDE A;  1MJE A;  2BH8 A;  2UUC Q;  4BY7 H;  2FXQ A;  3S1M H;  2K5V A;  3BZC A;  3A74 A;  3EBE A;  4MZ9 A;  1UEB A;  5M3M G;  1HNZ Q;  1AH9 A;  4DKA C;  1Q82 C;  1JMC A;  2DUD A;  3CF5 A;  3FKI G;  1FGU A;  1NY4 A;  1L1O C;  2MO1 A;  3VDY A;  3NEM A;  4R4C A;  4R4T A;  1KRS A;  4APV A;  3ULP A;  1VQC A;  2WB1 G;  3J81 c;  1E3P A;  2ZTD A;  4DUZ Q;  2NVT H;  4AYB E;  4UP7 A;  1I6H H;  4A3K H;  1FVI A;  4YCW A;  4JI2 L;  5JJI A;  4KLK A;  3CCV A;  1YNX A;  1FJG Q;  1WCM G;  4OX9 L;  2K50 A;  4LFC L;  3HOX G;  3H0G H;  3S1R H;  2NVQ H;  1C9O A;  5GAH C;  2Q2T A;  4LUZ A;  3CC2 A;  4B3M Q;  2R6G A;  3J7A 5;  5C3E H;  1J6Q A;  5M3F G;  1BBW A;  4DR3 Q;  4DV6 Q;  1JJ2 A;  4NPS A;  4JV5 L;  2ZJR A;  2E2I H;  3GO5 A;  2QA4 A;  4DV1 L;  4UY8 C;  1SRO A;  3AQQ A;  2F4V L;  4DR5 Q;  2ZJQ A;  4A3G G;  1NBW A;  1E22 A;  1N36 Q;  4DR6 Q;  1O7I A;  3S2D H;  1VCI A;  1ASZ A;  1VQ7 A;  2JA9 A;  2HHH L;  1G51 A;  4A3E H;  4GS3 A;  1K9M C;  3F2B A;  4BBR H;  1XNQ Q;  1Q46 A;  5LMN W;  4YY3 Q;  2R92 H;  4IFD I;  3RLF A;  1VS0 A;  3RLN A;  1KAW A;  4LNQ A;  1EFW A;  3FKI H;  4LF7 L;  2AWO A;  3GTQ H;  1D7Q A;  4BY7 G;  1V9P A;  5FJ8 H;  2K4K A;  4DR7 L;  3K8A A;  4GN3 B;  1FL0 A;  4X64 Q;  2K75 A;  1CKO A;  1TWF H;  4IPD A;  3LGJ A;  4BA1 I;  2OTL A;  2Z6K C;  3CC4 A;  3PO2 H;  4X65 Q;  4DR4 Q;  2Y0S E;  3I2Z A;  4C3J H;  2IY5 B;  1PH3 A;  5IP9 G;  4QQB X;  4NXM Q;  3KJP A;  5J3B A;  3PIP A;  2KEN A;  5LMN Q;  4JI0 L;  3M3Y H;  1K0R A;  4EQ5 A;  4DV1 Q;  1JB7 A;  2PQA A;  3CCJ A;  4DR5 L;  2PI2 E;  4L5R C;  3HKZ G;  4IPG A;  2ES2 A;  4QGU A;  3E9I A;  5AJ3 L;  1TWH H;  2AMC B;  1X55 A;  5C0X J;  5IYB H;  3CMA A;  2RHS B;  4DV5 L;  2Q2H A;  3HKZ E;  3RZO H;  1N9W A;  3A0J A;  3Q8D A;  2HIV A;  1VQF A;  3I4O A;  1YI2 A;  3A5Z B;  2R7Z H;  4OON A;  3ERS X;  4B3S Q;  3H3V I;  2F3I A;  4DAM A;  1HNW Q;  2B63 H;  2VW9 A;  4DV0 L;  3JAM i;  3RN5 A;  1S40 A;  1M1K C;  1IBL L;  4LF7 Q;  4A3D G;  4DV2 L;  2OCE A;  1XNR Q;  2UXB Q;  1HZB A;  1X3F A;  5FJ8 G;  1VQ5 A;  1WYD A;  4X64 L;  4J15 A;  4A3C G;  4A3K G;  1KXL A;  4BBR G;  4C3H H;  3STB C;  2E2H H;  4OWW B;  2UXD L;  3CC7 A;  1X3E A;  4KHZ A;  1Y1W H;  3U4Z A;  3S16 H;  2E5L L;  3J7Z C;  4BA2 I;  4PZ8 A;  2NN6 I; 
#chains in the Genus database with same CATH topology
 3QOL A;  3M4O H;  2EQS A;  1TWG B;  2F3W A;  4H0L C;  1EEF D;  3KF8 B;  3N6R A;  2E76 C;  1YEZ A;  3R3O A;  5IP9 H;  2EXD A;  1BCP B;  4GOP B;  3W2D A;  1B1Z A;  1TVX A;  1KNE A;  3AEV A;  3CPF A;  4DK0 A;  3HOZ B;  2YTY A;  5HY6 A;  5GRO A;  2GVB A;  1GD7 A;  4JG2 A;  1Q8K A;  2MGS A;  4OWT B;  2E2J B;  1UE6 A;  4UP8 A;  2JA6 G;  3T1H L;  5FLM G;  1CK1 A;  1R4Q B;  1V8Q A;  2UXD Q;  1TWH B;  3ERO A;  1UE7 A;  4IJH A;  3CHB D;  2LSS A;  1H9S A;  5L37 A;  4X66 L;  4K0K L;  1NE3 A;  4R4Q A;  1Y1V G;  3IFD A;  3OIP A;  3ZYY X;  4JC0 A;  4B3R Q;  2IX1 A;  1B53 A;  4MN3 A;  1GM5 A;  2K1B A;  4XT3 B;  2IHE A;  2Z4I A;  4DR2 L;  5I2X A;  4OWX B;  1UWV A;  3S1N H;  2IPK D;  4V0B A;  1LT4 D;  2A69 D;  4DXF A;  2VUM G;  3D4D A;  1RIP A;  3UI2 A;  4LF8 Q;  4POF A;  5K36 H;  1MBY A;  4FYD A;  1IZ6 A;  1QNK A;  2H5X A;  3PUY A;  1SJH D;  3OTO L;  1YHA A;  4GKJ L;  4WJ4 A;  2JYO A;  4LFA Q;  3WOF A;  2NVX B;  3A8J E;  4ZKB B;  1SEB D;  4A3M H;  2XRS D;  2KVM A;  2XTI A;  4UP9 A;  2P5Z X;  2YTV A;  5ELO A;  1LT3 D;  2IX0 A;  1D6E C;  3I55 A;  2XVS A;  4R8N A;  1VQJ A;  1A2T A;  2CVR A;  1PXU A;  4HMJ A;  5D14 A;  4OEL B;  2HD3 A;  5EBC A;  3G4S A;  3I4M H;  1II3 A;  2EYJ A;  3Q22 A;  1VQL A;  1HPC A;  1JOQ A;  5JEA H;  1QNU A;  4LF8 L;  1HNX L;  2EXZ A;  3RR5 A;  4O42 A;  1HRJ A;  3VA5 A;  4TVA B;  3GTP H;  1Q86 C;  2JXM B;  4UPA A;  3MEH A;  1V1P B;  3M85 A;  5C4X H;  2MQH A;  1QVF A;  3CD6 A;  1RTN A;  1EY7 A;  1F77 A;  3WDN A;  1XMO Q;  1PLF A;  4FF2 A;  5FO8 B;  4A3I G;  3DLL A;  5KND A;  3VYU A;  1EQQ A;  1K8A C;  2NVX H;  1QG7 A;  1TXY A;  2BDN A;  1SMX A;  4G57 A;  2YU9 B;  4JCV E;  4LK1 C;  1SMY D;  4DU9 A;  4DV6 L;  3K6O A;  5DAU A;  2I0Q A;  3CCQ A;  3J80 i;  3HRZ C;  1MIU A;  4DR6 L;  1VQH A;  4NMZ A;  4HJA A;  1VF5 C;  3MXG A;  1EIY B;  3KLS A;  1U4M A;  3IAY A;  4IUR A;  4RWS C;  1DJR D;  2F0W A;  4C3H B;  3DWP A;  1XJV A;  4KKT A;  1TKW B;  2DY8 A;  4XQQ A;  2ASB A;  1TS4 A;  4K5V A;  4BS9 A;  3S17 H;  1KNA A;  4J8Q A;  3CCR A;  4BBS G;  4JBW A;  3PUV A;  2F0U A;  4JV5 Q;  3CP0 A;  1MGS A;  5IE8 A;  3MAQ A;  1D1K A;  1F9S A;  1Z7T A;  1B4O A;  2N78 A;  3M7G A;  4XXE A;  4QMG A;  3R2I A;  3AFP A;  4A3L G;  2Z9H A;  5FLM H;  2XSC A;  2LY7 A;  3HS0 C;  4L5T A;  1EIG A;  3U58 A;  4JBK A;  4AH6 A;  1O7Y A;  1S5D D;  2EE1 A;  5EJW A;  3HOZ G;  5FLX c;  4RHS A;  1A8V A;  1SXT A;  5EKI A;  2F0I A;  3H0G B;  1Y1V H;  1JJG A;  1ONL A;  4AIM A;  5M3M H;  1YZ6 A;  1GOZ A;  1QVC A;  5C0X I;  5IGG A;  2M2L A;  1HQR D;  1YNN C;  3S1R B;  3QIA A;  2VNU D;  1IBM Q;  2UUB Q;  2L15 A;  5C5M A;  3SEB A;  5IP7 H;  2PCF B;  3BDC A;  3NWT A;  5M5X H;  3V96 A;  4BWG B;  4JOI C;  4YHH Q;  5K5P A;  2QGQ A;  2RBM A;  3RLO A;  2WAQ G;  1OXV A;  1F2L A;  5C3E G;  4KV6 A;  2ZXP A;  2WAQ B;  1JJC B;  4NDX A;  4A3G H;  5JPN C;  3FRP B;  2AHO B;  4HJ8 A;  1SR3 A;  4K6D A;  1B70 B;  1KD1 C;  2N49 A;  3DWA A;  2UUB L;  1Z47 A;  4NB3 A;  3HOZ H;  4NP5 A;  4DR1 L;  4OO1 G;  1A0I A;  2F0L A;  1EIF A;  2RCF A;  3S14 H;  4A3B H;  1DGS A;  1QJO A;  4IO9 A;  5M5W B;  4OIK A;  1V43 A;  4C2M H;  1F2M A;  2PZT A;  2F0Q A;  4HJ7 A;  1RDP D;  3TS0 A;  1X3G A;  1CZW A;  3MEF A;  3GTK H;  1B50 A;  3BS1 A;  3T1H Q;  1VQK A;  4I7Z C;  2UU9 L;  1NSN S;  2LMC B;  5I9O A;  2M9V A;  2F0H A;  1UAP A;  1V1O A;  3HOW H;  4X3K A;  1SE8 A;  1Q81 C;  4X66 Q;  4PMC A;  5IIF A;  1YJN A;  1NJI C;  1DYQ A;  2PI2 A;  1YHB A;  1ENC A;  3S15 H;  1L1O B;  3TEH B;  1Q1E A;  3L7Z C;  4MHE A;  4AYB B;  4HCS A;  2B2U C;  3T1Y L;  3MHB A;  3NSW A;  1JOK A;  3CXC A;  4AYB G;  1GUO A;  1VQG A;  4OIJ A;  4OGQ C;  2QIL A;  5LHY 1;  1L2F A;  4OHJ A;  1ET6 A;  4A3D B;  2ENB A;  3R8B A;  4A3J B;  1HR0 W;  5JVG 3;  2K32 A;  4QJF A;  2I46 A;  1Q8I A;  1L1O A;  3NQI A;  3P1H A;  4LFA L;  2CCZ A;  5G3L D;  2A74 C;  2A69 C;  3EVQ A;  3TZD A;  4PZ7 A;  1R9T H;  1WTP A;  2IWH A;  1G2S A;  4A93 B;  3EN2 A;  2OT2 A;  2NVY H;  1K83 B;  1AW7 A;  4A3L H;  1NUC A;  3T1Y Q;  1E1O A;  1MD2 D;  1HR0 Q;  2JA8 G;  1STY A;  1WI5 A;  1DOK A;  3MFG A;  1WTX A;  3D6W A;  5G3L F;  3PQI A;  4Y7N H;  4L63 B;  1EOT A;  3HOU G;  1S4Z A;  4KD4 A;  4L5Q A;  5E4X A;  4B3M L;  3BDL A;  2MNA A;  3ULJ A;  1QCB D;  2F4V Q;  3IKJ A;  1K8G A;  1PRT D;  3PV0 A;  4WOR A;  3TME A;  4QY7 A;  1MJE A;  2BH8 A;  4MZ9 A;  5J1Z A;  2B2T C;  2R93 B;  1BR9 A;  1F2Y A;  3E5S A;  1SFO B;  1I50 B;  3ND9 A;  3NXW A;  3DMU A;  1DCZ A;  1EY5 A;  1KRS A;  2F0V A;  3ULP A;  2NVT H;  3MXN A;  4H13 C;  4CDE C;  2LKV A;  2VB2 X;  1FVI A;  5JJI A;  5C5L A;  2F0T A;  3BVG A;  1WCM G;  4KHV A;  2NVQ H;  2B8F A;  3H0G H;  4MIU A;  4LUZ A;  1CTM A;  1HTL D;  3WOE A;  5FK9 C;  5I4D A;  1TR5 A;  5C3E H;  4DV6 Q;  4KKS A;  2ZJR A;  2E2I H;  3IL8 A;  2D9U A;  5C3W A;  4A3G G;  1NBW A;  2Z8L A;  1VCI A;  2Y0S B;  4ZKC B;  2JA9 A;  1HHV A;  2A6H C;  4GS3 A;  1Q90 A;  5A2Q L;  3F2B A;  1U4P A;  4G7O C;  1ICW A;  3H94 A;  3C1F A;  1TU2 B;  1VS0 A;  2QF7 A;  5IT9 E;  1V9P A;  3K8A A;  4U68 A;  5KYL A;  3VA7 A;  1TWF H;  2OTL A;  1IKL A;  1BXT A;  3CC4 A;  1GHJ A;  1RJT A;  3ERQ A;  4FO2 A;  4C3J H;  1NNX A;  1Y69 U;  1ROD A;  3TSS A;  5IP9 G;  5J3B A;  5LMN Q;  4F8M A;  4EQ5 A;  3MFY A;  1STH A;  1TS5 A;  2HCC A;  2KEC A;  3HKZ G;  4Z9C B;  2ES2 A;  4QGU A;  2XNA C;  1ICF B;  1X55 A;  5CC4 A;  5C0X J;  1LTA D;  2Q2H A;  1N9W A;  4L6T B;  4OEM B;  2L9H A;  1EU3 A;  3A5Z B;  3A8I E;  3ERS X;  3OPO A;  4DAM A;  1HNW Q;  4DV2 L;  1FD7 D;  1HZB A;  3VR5 A;  4J15 A;  3ONA B;  1D1I A;  1Y8O B;  4EGV A;  1KXL A;  2M00 A;  1S5C D;  3STB C;  4RAU C;  1HFN A;  1PTO F;  5DM7 3;  4PZ8 A;  2NN6 I;  1TY0 A;  3NHH A;  1G2T A;  3KDF B;  2A68 C;  4RMF A;  4PZ6 A;  2K33 A;  2D5D A;  3PSI A;  5C4H A;  5EPK A;  2WP8 J;  4DV5 Q;  3F1Z A;  2A19 A;  2ICE C;  1PTO D;  4KY6 A;  4CKE A;  1CZG A;  3HKS A;  2IX3 A;  3KJO A;  2NN6 G;  3F8T A;  1CI3 M;  2A1A A;  4WJW A;  4C3J B;  1PHJ A;  1CQF A;  1G6Z A;  2HDM A;  2BA0 A;  4A3M G;  3HOY G;  2PW5 A;  3HZX A;  3TS2 A;  1K3R A;  2PNH A;  1SN8 A;  3HOV H;  2O4X A;  1OO9 B;  4QCL A;  4A3D H;  3CCM A;  2VZA A;  2QDB A;  1M4V A;  3J80 c;  4C3I B;  1YIT A;  3K81 C;  3SVM A;  3HOU H;  4A75 A;  1X32 A;  3GD7 A;  3MTS A;  2CQO A;  4C3I G;  3MA2 B;  2HDL A;  1BBU A;  2BH2 A;  3KFU A;  3FP9 A;  2DNE A;  1DZ1 A;  2XWB B;  4CDC C;  4NXN L;  1JWM D;  2A73 B;  4IUQ A;  3DUZ A;  2D62 A;  1STE A;  4KJN A;  2PPB C;  4JI8 L;  4LUO A;  3S1N B;  1EFI D;  2UU9 Q;  1I4H A;  2MUY A;  3GTM H;  4IUN A;  1AE3 A;  4POG A;  4IFD H;  2RDF A;  1LAB A;  1SYD A;  3SGI A;  1C8C A;  3VYR A;  1CA6 A;  2RQX A;  4K14 A;  1PFS A;  4ABN A;  3SHL A;  4DV3 Q;  1V1Q A;  4ZYS A;  1E0B A;  4IJL A;  2NZO A;  5LL6 S;  1EWH A;  3ND8 A;  3S2H H;  1JB3 A;  1SAP A;  4JI5 Q;  1TWC B;  5CV9 A;  2ZTC A;  3I4N H;  1W6K A;  1DOL A;  2JA5 H;  1IYU A;  4IOC A;  3HG9 A;  1PZJ D;  2EYM A;  1VQO A;  5EKK A;  1SLJ A;  2BE5 C;  1GVP A;  2EYL A;  2WII B;  3SK8 A;  4DUY Q;  4ME3 A;  1J5E Q;  1VDZ A;  5CV7 A;  3W1G A;  3V2T A;  2UXC L;  1JE4 A;  2NWG A;  4RGO S;  4BY1 H;  4EVO A;  5JJK A;  4AQY Q;  3D4W A;  3J81 i;  3RUZ A;  3W5O A;  2EY5 A;  1IHZ A;  2WKC A;  2XWJ B;  1XPU A;  1STB A;  1IW7 D;  2NYZ D;  3VR4 A;  2OQK A;  1O7L A;  2HUG A;  1EWI A;  1W2B A;  2F1M A;  1Y14 B;  5CV5 A;  2ZJP A;  3S2D B;  4IAL A;  4DV7 L;  5CV8 A;  2EYF A;  4K8J A;  2JP1 A;  4A3G B;  3GP7 A;  1HH2 P;  5IYD G;  1M90 C;  1CM9 A;  2J7Z A;  4F7X A;  2EIF A;  3GTQ B;  1H9R A;  3KBG A;  4JI6 L;  4RKB A;  1PRT B;  3J81 j;  3GTM B;  4P75 A;  1EL0 A;  1U4L A;  3OIQ A;  5ISR A;  2E74 C;  3RZD H;  1Q1B A;  4BBR B;  5C44 G;  1JR0 D;  4IFD G;  4JI2 Q;  4AQY L;  3H3V H;  3EA6 A;  5KRU A;  1SYG A;  1X9N A;  4GN4 B;  4GNX B;  1A3U A;  3S24 A;  1ESF A;  2PNR C;  3OMC A;  1KLG D;  5KNC A;  4A3K B;  3I72 A;  1I4P A;  4R4I A;  4RGM A;  1X65 A;  3GTJ B;  1ZKO A;  1MHW C;  1PH5 A;  4XTC S;  4A3C H;  1YNJ C;  3TRZ A;  2R7F A;  4YY3 L;  1CSQ A;  1KDA A;  3TP7 A;  2E2I B;  1KIX A;  3EJI A;  3AU7 A;  5CGK A;  3PO3 B;  4HJ9 A;  2B2V A;  1Z9F A;  1I5F A;  4OXP A;  3SDZ A;  5IP7 G;  4LF9 L;  2IL8 A;  4QB4 A;  4X65 L;  2K01 A;  1OTC A;  4HIK A;  1UE5 A;  4IOA A;  1MI2 A;  5COR A;  1TY2 A;  3OMG A;  1B7Y B;  1E7Z A;  3CQZ B;  4RG1 A;  3I73 A;  4Y52 H;  1PH9 A;  4YIJ A;  2YU9 H;  1PTO C;  2F52 A;  1XNQ L;  1Y1W G;  2SEB D;  3K59 A;  1TII D;  2OTJ A;  2QKI C;  5M5Y H;  1I4Q A;  4B3S L;  3G7L A;  1HZA A;  1VF7 A;  1GUN A;  2Q2I A;  2MFI A;  2UUA Q;  2F4I A;  1A2U A;  1D5Z C;  1I4R A;  3VR6 A;  4HR7 B;  5CR3 A;  3RD4 A;  5C4J H;  1KL9 A;  3FDT A;  4A3B G;  3NWS A;  1H9S B;  2JN4 A;  1WCM B;  1D5M C;  4A76 A;  4RA8 A;  2CH4 A;  2YTX A;  1X54 A;  4DAY A;  2XIW A;  4E6I A;  3M4Q A;  4F87 A;  5M5X B;  2DJG C;  1WD1 A;  2K05 A;  2KED A;  2HCI A;  5KGU A;  1PDQ A;  5ELB A;  3HOX H;  1K83 H;  3BZK A;  1BDO A;  4LAA A;  3UDF A;  4DV2 Q;  3SE0 A;  2GN5 A;  5K36 G;  5A35 A;  1ZYR D;  4LWC A;  1TS3 A;  3I7F A;  5IOC A;  4JI3 Q;  2VUM B;  2SNS A;  4N9T A;  3P20 A;  1LTB D;  1CKM A;  3H15 A;  4R1J A;  3STB D;  1EYD A;  5IGE A;  4PV1 C;  3KLW A;  1Q7Y C;  1D2B A;  4BY7 B;  5COY A;  4QIW B;  1CT1 D;  1E2V A;  2RDH A;  3AB9 A;  2X69 A;  1A3T A;  5EPL A;  4JBJ A;  3D8G A;  3L0O A;  1IKM A;  2I07 B;  2O2L D;  2ZM6 Q;  3S16 B;  1I94 Q;  3KF6 A;  5JEA J;  4JI3 L;  1XPR A;  3VR3 A;  4ZAI A;  4P2C B;  1E2Z A;  4CDD C;  1WTW A;  4B3T L;  5C44 H;  1OXS C;  4FF4 A;  3GTG H;  4X3S A;  3X3M A;  2FMM A;  2VL6 A;  1PYW D;  2PMZ E;  4CJ0 B;  5JEA G;  1QE6 A;  2EPB A;  4QUF A;  2VY3 A;  2FIN B;  3GTO H;  1BF4 A;  3MZ5 A;  2HT1 A;  4IUP A;  4JI4 Q;  4RHR A;  2R93 H;  1PH6 A;  2FMC A;  2I5L X;  4PNY A;  1LUZ A;  5JJZ A;  3E0E A;  2JA5 B;  3VR2 A;  5IT9 c;  1EY9 A;  4FDB A;  2DN8 A;  1RCV D;  1QOH A;  2F0F A;  4B3T Q;  4IPC A;  4LF6 Q;  3S1Q B;  4BXX H;  4JOI A;  1MJC A;  2D0O A;  4ALP A;  1N33 L;  3TBI B;  5AFW A;  1ENF A;  2A6H D;  2EYO A;  1VQM A;  3F2C A;  4CDF C;  2K52 A;  4EX5 A;  3QO2 A;  2A68 D;  2ICI A;  4DUZ L;  1K73 C;  2I5H A;  1TWG H;  3CW2 C;  2ZT9 C;  2JEA I;  4ZUJ A;  1GKH A;  1S5B D;  4LFC Q;  2LXJ A;  3NEN A;  1GHK A;  2NB0 A;  2JA7 B;  3QJY A;  5IYC H;  1NMG A;  1IXR A;  3LNN A;  1EZ8 A;  3URY A;  5LMU Q;  1KDC A;  3C46 A;  5ELN A;  1JC7 A;  4A3E B;  3T13 A;  4LF6 L;  3GDE A;  2F0E A;  1EY6 A;  3OHX C;  4LMQ D;  3S1M H;  3BZC A;  1YNN D;  5M3M G;  4DKA C;  1Q82 C;  1JMC A;  5DM6 3;  2DUD A;  2WB1 B;  3CF5 A;  1NY4 A;  1B44 D;  4R4C A;  1LAC A;  4R4T A;  1VQC A;  4DUZ Q;  1E3P A;  2ZTD A;  1H9J A;  4UP7 A;  4A3K H;  4YCW A;  4KLK A;  1D5X C;  3CCV A;  1YNX A;  4A3I B;  1FJG Q;  1IYV A;  4OX9 L;  2K50 A;  4LFC L;  3HOX G;  3S1R H;  5GAH C;  2L1B A;  5HUR A;  4FP5 D;  2R6G A;  1HA5 A;  2C9O A;  1BCP C;  4JV5 L;  5M3F G;  4NPS A;  2Q8T A;  1LTS D;  4MTK A;  4DR5 Q;  3HKZ B;  4B9X A;  1PFB A;  1ASZ A;  1VMC A;  1K9M C;  1CQV A;  1YNJ D;  4IFD I;  3M4Y A;  1KAW A;  1JOO A;  2AWO A;  3J7A F;  4DR7 L;  2K4K A;  4ULL A;  1BCP D;  5IGD A;  2KA7 A;  4X3U A;  2K75 A;  1CKO A;  1A3V A;  4OO1 H;  2RSO A;  3I2Z A;  1PH3 A;  3PIP A;  2KEN A;  4V19 0;  1EQV A;  1K0R A;  2KCN A;  3FPU B;  4IN3 A;  4IQZ A;  5M5Y B;  5FLX E;  3H91 A;  3MXU A;  2PMZ B;  1QWY A;  3E9I A;  2J4X A;  4OL7 A;  5IYB H;  5C4J B;  2RHS B;  3CMA A;  1L0X B;  3A0J A;  4IUU A;  2EJM A;  2CHB D;  1Z6H A;  1I4G A;  4OON A;  4IUT A;  4A3D G;  4DV0 L;  1AEX A;  2QDL A;  5FLX L;  1X3F A;  2AQ1 B;  4X64 L;  3J81 E;  4EQP A;  1FNV A;  2E2H H;  2LS0 1;  1GUT A;  3CC7 A;  3U4Z A;  3FVQ A;  4ZQ3 A;  5FO9 B;  1O7Z A;  3M4O B;  1HZ9 A;  3PO2 B;  1KTK A;  3CU7 A;  2RA4 A;  3F2D A;  4DR1 Q;  1P16 A;  4LF5 Q;  5I6W A;  1B3Q A;  4L8J A;  1EYA A;  1STG A;  3CKI B;  2Q8R E;  4BBS B;  4LFB Q;  4UDU C;  3Q0A A;  3JAM E;  4DV0 Q;  1C48 A;  2E2J H;  4MTN A;  4ME5 A;  1A62 A;  2K7V A;  3ICE A;  4DK6 C;  2PQA B;  3TP6 A;  3NEL A;  1YIJ A;  1NTG A;  3I4N G;  3JC6 6;  3S9W A;  3BVM A;  3OW2 A;  2B63 G;  1LTG D;  3QG1 A;  4KD3 A;  5FOB B;  3HOU B;  4DFA A;  3SR1 A;  4A3J H;  3MVV A;  1XYI A;  2IT1 A;  2K03 A;  2N3S A;  3MWY W;  2K5Q A;  3GV3 A;  2F3V A;  4P72 A;  3B6Y A;  3C2P A;  1BO0 A;  3S1Q H;  3ITP A;  4LF5 L;  1BKB A;  3U9O A;  1AE2 A;  3I4M B;  5EPJ A;  1VQB A;  4A3F B;  4H44 C;  3CAM A;  1I94 L;  4JPB W;  2F0N A;  5GAG C;  4DV4 L;  2KUM A;  5I9P A;  3PF5 A;  5DLQ E;  4KY5 A;  1PYS B;  1TS2 A;  2DY7 A;  5D3I B;  1HNX Q;  4I65 A;  3G6J B;  3GTP B;  2XGT A;  3OWF A;  5JPM C;  3CQZ H;  4K0K Q;  3AYH B;  1SDF A;  1XMQ Q;  1VQD A;  1SRU A;  5M3F H;  4CKC A;  2TMP A;  1NAP A;  1SSO A;  1PA6 A;  3BDO A;  3I8Z A;  1G29 1;  1LT5 D;  2K6A A;  1XMO L;  2IW3 A;  1QZH A;  4X6A H;  1PYB A;  1DOM A;  1VQ4 A;  1E1T A;  2EVB A;  1BNZ A;  4LW1 A;  2ID0 A;  1PRT C;  1R4P B;  5LL6 X;  4A3J G;  4GLA C;  5EBD A;  2CQA A;  2AUK A;  1VQI A;  2JQO A;  1QVG A;  2WKD A;  1EQT A;  1N33 Q;  5TSS A;  1JQY D;  1QUQ B;  5E1F A;  2UUC L;  5HGT A;  2QEJ C;  4G7Z C;  1VQ8 A;  2A6E D;  1N32 Q;  1SMY C;  4MNO A;  1LT6 D;  1WTO A;  3FKI B;  4A93 G;  4KKU A;  1IL8 A;  3QR8 A;  3KK7 A;  2R7D A;  4GOP A;  1DON A;  5F2D A;  5IYB G;  4WFN 3;  1T9H A;  4HED A;  3TDQ A;  3OOC A;  5J39 A;  5M5W H;  3J80 L;  3ZJY C;  2KQ3 A;  4BY1 G;  3T56 B;  5CMD A;  1EY8 A;  2KHI A;  2R3Z A;  1XX8 A;  4QL5 A;  1S3O A;  3TP8 A;  3V05 A;  1KC8 C;  4IPH A;  2KBN A;  2GVA A;  1K3B C;  4B9W A;  4HIO A;  1I6H B;  3CPW A;  1MSG A;  4DK1 A;  2ALY B;  2QEX A;  1UNS A;  3BJU A;  4ID6 A;  5D65 A;  1C4Q A;  4DA2 A;  3HOW B;  3PF4 A;  4FNF A;  3PMF A;  3RNU A;  1EQR A;  1AP0 A;  2WAQ E;  1LM0 A;  5JAV A;  2JA6 B;  4RH6 A;  2KCM A;  1JE5 A;  1CKN B;  2XN9 C;  3MC0 B;  1U0L A;  1KLU D;  2KEE A;  4IZ8 A;  4OX9 Q;  1AN8 A;  3GTL B;  1IW7 C;  2B2W A;  3N52 A;  3WWV A;  1A63 A;  3K0Y A;  4J6H A;  3S17 B;  4GLX A;  2R92 B;  2B2V C;  3QB3 A;  1H9K A;  3K7A H;  1IBM L;  1OXT A;  5KEE A;  5FO7 B;  1K28 A;  2OEO A;  4JI0 Q;  2G5D A;  5BN5 A;  3HP3 A;  1N36 L;  1IBK Q;  1F9P A;  1PFN A;  4CHT B;  1LLR D;  3K80 C;  1M8A A;  3NQT A;  2O5I C;  1EY0 A;  1HTP A;  2RDG A;  4PMB A;  5AJ3 Q;  2WIN B;  1RHP A;  1PVO A;  1JWS D;  1OXX K;  1VQP A;  1SNC A;  4KMU C;  4DR7 Q;  2KCT A;  5M3M B;  1LYL A;  2PW7 A;  4HSP A;  4YWK A;  4CBV A;  3HOV G;  1IYJ B;  3TZU A;  4TQU S;  1PH8 A;  3U4V A;  2UXB L;  2EZV A;  3SXH A;  4DR4 L;  5GAE C;  3OYY A;  3K7U C;  1YJ9 A;  4NXM L;  4ZLT F;  2D2C C;  2N55 A;  3D31 A;  1HUM A;  4TKO B;  4KY7 A;  3L9A X;  3D0F A;  3H6M A;  1GUW A;  1DD2 A;  4C2M B;  1BQQ T;  1IBK L;  1F9R A;  1DM0 B;  2VQE Q;  1EYG A;  3I56 A;  2DJF C;  5IY0 A;  3SK6 A;  4JW0 A;  2RHQ B;  4M1U B;  1L0W A;  3HGB A;  3J7Y W;  1IBL Q;  3SK5 A;  3UE0 A;  2EDG A;  1PV4 A;  3PIP 3;  1ML0 D;  1TWA B;  2MPM A;  3SK4 A;  2SOB A;  3RMH A;  3NTI A;  2ZXO A;  4FXD A;  1GJX A;  1Q3L A;  1KDB A;  3KF8 A;  1YHQ A;  2BE5 D;  3NE5 B;  1YBY A;  2F0O A;  4HIM A;  2JA7 H;  2KCC A;  2E5L Q;  3S2H B;  4CJ2 C;  2AQ3 B;  1B3A A;  2R7Z G;  2MO0 A;  4L5S A;  3PO2 G;  5E3F A;  1GO3 E;  4P71 A;  4P73 A;  2L0C A;  5GAD C;  2VQE L;  3LWU A;  2GA4 B;  1QUQ A;  2NTS A;  4HID A;  2G9H D;  3QOJ A;  3E9H A;  1PH7 A;  4HMI A;  1TT2 A;  5IGF A;  2KHS A;  4BXX G;  2JA5 G;  3PCO B;  4R4O A;  2Z6B A;  2K5D A;  4ILW A;  4ZRZ A;  3I91 A;  1SJE D;  5IYD H;  2NTT A;  3PUZ A;  3HEJ A;  5IGB A;  1WOC A;  4S3S A;  1X56 A;  5NUC A;  1EYC A;  5BR8 Q;  5DEH A;  3A7L A;  3QWN A;  1C0A A;  3IFT A;  4C1N I;  1G8Z D;  1OXU A;  2PZW A;  3P75 A;  3EFX D;  3A5U A;  4B3R L;  1EZ6 A;  1X6O A;  1NR2 A;  4WJ3 M;  1HR0 L;  1K8M A;  4HSV A;  1BBX C;  1J5E L;  3H0G G;  4PG3 A;  2Q8I B;  4DV4 Q;  1Q12 A;  4LF4 Q;  1JIC A;  2PQE A;  2I5M X;  3RZD B;  4HTH A;  1WJJ A;  1TWF B;  4X3T A;  1W3S A;  4GNX A;  4QF4 A;  3BG3 A;  1F9Q A;  3OTO Q;  1NCV A;  3CME A;  2LXK A;  1S72 A;  2OWO A;  3K5N A;  4JK1 C;  1YVC A;  1XMQ L;  2TSS A;  2L55 A;  1Y1V B;  2N88 A;  5KYI A;  4C56 C;  1HNZ L;  1NMF A;  1EY4 A;  2NVY B;  4DAP A;  4DNT B;  4YCV A;  2JEB I;  1CFM A;  3S15 B;  5JJL A;  2H4O A;  1KAA A;  3HOY B;  2R92 G;  5HGQ A;  5CV6 A;  5C3E B;  3KUP A;  4Y7N B;  4C3J G;  4TSS A;  4YWL A;  2MHV A;  2VQF L;  4RKL A;  1HZC A;  2G9D A;  3FMC A;  2JJQ A;  4DR3 L;  4WRD A;  4HCE A;  2IJ0 A;  1EOV A;  3FHW A;  2YYZ A;  1WTV A;  3AMU A;  2UUC Q;  2FXQ A;  1SND A;  4A3B B;  3A74 A;  1UEB A;  1A6X A;  3DM1 A;  1HNZ Q;  3C3L A;  1AH9 A;  1U4R A;  3FKI G;  1FGU A;  3VDY A;  3NP8 A;  3GTK B;  2WB1 G;  1XXG A;  4AYB E;  1I6H H;  1HFG A;  1PFM A;  4KN7 C;  4FXK C;  3NBI A;  1C9O A;  2NVQ B;  2Q2T A;  1ENA A;  2B2Y C;  2X6L A;  3NUC A;  5DNF A;  4B3M Q;  3S14 B;  3J7A 5;  4DR3 Q;  4XDX A;  4DV1 L;  4Q5V A;  4UY8 C;  2F4V L;  1WTR A;  1E22 A;  3Q23 A;  4DR6 Q;  3S2D H;  1VQ7 A;  1G51 A;  5D3D A;  4A3E H;  3LX0 A;  1XNQ Q;  1Q46 A;  2R92 H;  4LJZ C;  3DXJ C;  3NPP A;  3RLF A;  3RLN A;  1EWC A;  4LNQ A;  1EFW A;  3GTQ H;  4BY7 G;  5FJ8 H;  1FR3 A;  1SNO A;  1SYC A;  5C4X B;  4NKL A;  1FL0 A;  4N9P A;  5I2Y A;  4IPD A;  2QCP X;  4BA1 I;  3PIO 3;  1PZI D;  2Y0S E;  1G91 A;  2IY5 B;  4JI0 L;  4H7B A;  3TP5 A;  4DV1 Q;  5T1I A;  3CCJ A;  3BVZ A;  3GV6 A;  1FGB D;  4L5R C;  5AJ3 L;  2AMC B;  3I4L A;  3T53 B;  4DV5 L;  3HKZ E;  4N8X 1;  4CKB A;  1VQF A;  5C0X H;  3I4O A;  1SYB A;  4G4K A;  2F0P A;  4RCO A;  1YI2 A;  3H3V I;  2Z1C A;  2AUJ D;  2B63 H;  2VW9 A;  3RN5 A;  3JAM i;  4RFB A;  5CBA E;  1B9N A;  1XNR Q;  1SYF A;  2UXB Q;  2B2Y A;  2NBF A;  4EQO A;  1VQ5 A;  1WYD A;  2K5W A;  4BBR G;  3OW7 A;  4K5X A;  4RGN A;  4C3H H;  4OWW B;  5T1G A;  5JVH 3;  1X3E A;  2NZ1 D;  3S16 H;  5IGC A;  1CA5 A;  3H3V C;  2AKW B;  1S5E D;  4YHH L;  2PYK A;  4I7A A;  3Q6S A;  3PO3 G;  2WV6 D;  1H9M A;  2ATW A;  1X3Q A;  4ZCK A;  5C3X A;  2KHJ A;  1E24 A;  2B2U A;  4JI8 Q;  1HNW L;  2QW7 A;  3BYY B;  1CHP D;  3DWQ A;  3KBX A;  4XT1 B;  2ZM6 L;  2FFK B;  2SNM A;  3KYH C;  3MXP A;  1I4X A;  4PQX A;  1IL2 A;  4KI0 A;  4RGT A;  3J7A V;  4JBM A;  3W1B A;  1VQ6 A;  2K5H A;  1G6P A;  2AQ2 B;  4LUV A;  3Q24 A;  1PZK D;  4PMW A;  3J80 E;  2R7Z B;  3L2P A;  1J8I A;  1ZEQ X;  4XQN A;  1SYE A;  1CSP A;  5C0X G;  3L3O C;  4P74 A;  1FNU A;  2CH4 W;  3KOJ A;  2K04 A;  3K7A B;  1GUG A;  2B8G A;  1XTD A;  2HQL A;  1BVS A;  2B29 A;  5ELE A;  3HOX B;  5CYU A;  4ZK9 B;  3I90 A;  3NK9 A;  4UHV A;  1RL2 A;  3R2T A;  4RCN A;  4GNX C;  1XTC D;  3CCE A;  1D8L A;  4GKK Q;  3AFQ A;  3I4M G;  4JYA L;  4IFD J;  1F2Z A;  2LFN A;  1W6J A;  3HFZ B;  4CJ1 B;  3PGZ A;  5EQ0 A;  3G71 A;  3K58 A;  1O78 A;  2OQ0 A;  4O0A A;  2VXW A;  4K2L A;  1STA A;  2CWA A;  1H95 A;  1N8R C;  2MP1 A;  2Y0S G;  1HQM C;  5BR8 L;  1MSH A;  2JE6 I;  3UDX A;  5IYC G;  1KQS A;  2RKS A;  4CGY B;  1VQE A;  5M3F B;  3IRB A;  1N34 Q;  1U9R A;  2EJG C;  2Z0S A;  3NTK A;  4JI6 Q;  2J0T D;  2EY2 A;  3K5O A;  3C1E A;  2C5C A;  4A3I H;  4YWM A;  2CKZ B;  4LF4 L;  2CWP A;  3ER0 A;  3CRK C;  4GKK L;  4JYA Q;  4JI7 Q;  4X62 L;  5EKL A;  3UDG A;  1K0S A;  3HOY H;  2L11 A;  1EEI D;  5J22 A;  1ET9 A;  2L4N A;  3CCL A;  3TRE A;  4QIW E;  4KJO A;  4DNR B;  1BCP F;  1XWE A;  4JI5 L;  1CUK A;  2MJ8 A;  2L5T A;  4H02 A;  2PO4 A;  3ULL A;  3DM3 A;  3K0X A;  4DPG A;  1PH2 A;  1TWA H;  3GTO B;  2VQF Q;  4LF9 Q;  3BYT B;  2SDF A;  4K5W A;  1WTQ A;  3M4P A;  4JI7 L;  5FKA C;  4M8A A;  3EQL C;  4R8I A;  2AWN A;  1R9T B;  1ASY A;  1QIL A;  3RN2 A;  4DN4 M;  3D3R A;  1U5K A;  2JA8 H;  4O1N A;  4YCU A;  2R61 A;  4N8F A;  2IHF A;  4R9W A;  1YJW A;  1KRT A;  3K5M A;  2B2T A;  5C6A A;  2KJX A;  3I70 A;  5E7N A;  2HHH Q;  4NW2 A;  2NZH A;  4XIG S;  1EIH A;  4DAY B;  4HJ5 A;  2DNC A;  1VMP A;  4ODG A;  1SE2 A;  2UUA L;  1T5E A;  2DGY A;  3PO3 H;  3A55 A;  3M9B A;  5CV4 A;  3DEP A;  3KLS X;  1RD9 D;  1WVL A;  2F0K A;  2XRQ D;  2RVL A;  3OSO A;  3F2U A;  5EAY A;  3E6Z X;  3U9S A;  1T5X D;  4GOP C;  4A3M B;  1HXY D;  1B2T A;  1AFP A;  1SE3 A;  3UDI A;  4J1M A;  1I50 H;  3A54 A;  2Z6K A;  5C4Z A;  4HN7 A;  3D4R A;  2CW0 D;  2EJF C;  4K8I A;  2BOS A;  2NVT B;  4IUV A;  5H1S E;  1QZG A;  1WFQ A;  2VS1 A;  3BU2 A;  1ESR A;  2BA1 A;  3M3Y B;  4O2D A;  2OXP A;  2JA7 G;  1PTO H;  1E2W A;  5KIX A;  1SFO H;  1VQA A;  5I6Y A;  3MXN B;  1SNQ A;  2RF4 A;  2C35 B;  3TN2 A;  1TWC H;  2JA6 H;  3T16 A;  2Q2U A;  3RZO B;  2H1E A;  2A5H A;  4GLV B;  5LMN L;  1V1P A;  1JT8 A;  4ZUI A;  4B08 A;  3W3A A;  1DXM A;  1I6V C;  4KN4 C;  2WB1 E;  4FXG C;  4GN5 A;  4C1N K;  4DAV A;  5BN4 A;  4A3E G;  5IOD A;  2E8G A;  2RSN A;  3PIO A;  3P7J A;  3PUX A;  1Y1W B;  3EIV A;  2R93 G;  5M9O A;  4LFB L;  1XNR L;  1GUS A;  4JI1 Q;  1RKN A;  3KDF A;  3R93 A;  2WFW A;  5C44 B;  1I3Q B;  2EYP A;  1XPO A;  1O80 A;  1P8L A;  2L12 A;  1ILP A;  4A3F H;  5IWA L;  2K5N A;  2A6E C;  1C7Y A;  3LWE A;  4JVZ A;  1LTR D;  4GZY C;  2VUM H;  2YV5 A;  4DK3 C;  2JSO A;  5GQO A;  5ELC A;  1RF2 D;  3PUW A;  1JOR A;  3CCU A;  1EUJ A;  4OO1 I;  4XQJ A;  1EU4 A;  3I3C A;  4K6L A;  1MKH A;  4KK7 A;  4TRD A;  4DF7 A;  2PZU A;  3FEW X;  3G6E A;  3TQY A;  1GXD C;  4JI1 L;  2KOL A;  1UE1 A;  4DR2 Q;  4DNI A;  4C3H G;  1KHI A;  4FF3 A;  1ZXT A;  5IWA Q;  2RCN A;  1NR4 A;  1HJP A;  1RTO A;  2CFM A;  2HQE A;  3U50 C;  3OWE B;  4A93 H;  1SBB B;  3H09 A;  2E2D C;  2JK8 A;  2NN6 H;  2A8V A;  4GKJ Q;  3E0J A;  2V1C C;  1PMR A;  1B9M A;  4NXN Q;  1X3P A;  1I3Q H;  1Y8N B;  5JOB A;  5C4X G;  2B3G A;  4FVM A;  5A2Q E;  1B8A A;  4A3F G;  4KHP L;  3G48 A;  4XYQ A;  1VQN A;  2B2W C;  2E75 C;  2ZTE A;  4QUC A;  2ZXR A;  4C3I H;  4G7H C;  3E3X A;  3VYS A;  3KLR A;  3CRL C;  5LMU L;  3S1M B;  5EGT A;  2EY1 A;  1LTI D;  2HIX A;  2D0P A;  4DV3 L;  2F03 A;  3CCS A;  1SNP A;  2EY6 A;  3GTJ H;  1UUP A;  2N8N A;  2E2H B;  2WAC A;  1N34 L;  3NTH A;  1PH1 A;  1LTL A;  4A4I A;  2JA8 B;  3GTG B;  1N32 L;  1JWU D;  3UE1 A;  4DUY L;  1TQO A;  1VQ9 A;  1CKN A;  3KF6 B;  3K57 A;  2UXC Q;  2X6G A;  3GTL H;  4U67 3;  3A56 A;  2OF1 A;  1WCM H;  4JI4 L;  1FJG L;  1HCZ A;  3DEO A;  4DXG A;  4KHP Q;  4X62 Q;  3JAM c;  2VB3 X;  1CHQ D;  4BBS H;  3T51 B;  2F0G A;  3NBH B;  3A8K E;  1WD0 A;  3O13 A;  3I4N B;  4DV7 Q;  2V4D A;  3DHQ A;  1Y8P B;  5BN3 A;  1PH4 A;  2K14 A;  5KNB A;  2CW0 C;  3M7N A;  4BY7 H;  1SE4 A;  2K5V A;  2O5J C;  4F88 A;  2FJ2 A;  3EBE A;  3T4A C;  1ILQ A;  3GQB A;  1A15 A;  2MO1 A;  1L1O C;  1BOS A;  3NEM A;  4APV A;  5E4W C;  3J81 c;  3VYT A;  1PRT F;  4JI2 L;  4HAE A;  1STN A;  2F0M A;  1S5F D;  3NBH A;  1PTO B;  2FHT A;  1WTH A;  3CC2 A;  4UAI A;  1BUV T;  2B63 B;  4BY1 B;  1LO5 D;  1J6Q A;  4EQN A;  1BBW A;  1JJ2 A;  2EYH A;  1KAB A;  3GO5 A;  2QA4 A;  1SRO A;  3AQQ A;  4KTA A;  2ZJQ A;  3A7A B;  1N36 Q;  1O7I A;  4Q0F A;  2F0J A;  1LTT D;  2HHH L;  4K2K A;  1HUN A;  4BBR H;  5LMN W;  4YY3 Q;  4DGZ A;  1JCK B;  2NUC A;  3BZD B;  3FKI H;  1SNM A;  4LF7 L;  1D7Q A;  1ZYR C;  4GN3 B;  4X64 Q;  2BCO A;  4FF1 A;  3LGJ A;  2BDO A;  4XYO A;  1L0Y B;  3D6C A;  2Z6K C;  3PO2 H;  4X65 Q;  4DR4 Q;  5ELD A;  2B39 A;  4QQB X;  1AZP A;  4NXM Q;  3KJP A;  3M3Y H;  1JB7 A;  2EOT A;  2PQA A;  5IT9 L;  1J9O A;  4DR5 L;  2PI2 E;  4IPG A;  3J81 L;  2F0S A;  1TWH H;  1AZQ A;  1QB5 D;  1LV9 A;  2K28 A;  2Z4H A;  3RZO H;  5ELF A;  3X3N A;  1FNW A;  2HIV A;  3Q8D A;  3FPP A;  2R7Z H;  1K8O A;  4B3S Q;  2F3I A;  3K5L A;  1UEA B;  1IBL L;  1S40 A;  1M1K C;  4LF7 Q;  1HA6 A;  2OCE A;  3HOV B;  5FJ8 G;  5CBE E;  4A3C G;  2F0D A;  4A3K G;  2UXD L;  4KHZ A;  3JAM L;  1Y1W H;  1FYC A;  2E5L L;  3J7Z C;  4BA2 I;  3HOW G; 
#chains in the Genus database with same CATH homology
 1HZ9 A;  3KDF B;  2AKW B;  4RMF A;  3M4O H;  4PZ6 A;  2EQS A;  3F2D A;  3PSI A;  4DR1 Q;  1P16 A;  3KF8 B;  4YHH L;  4LF5 Q;  3PO3 G;  1YEZ A;  2WP8 J;  5IP9 H;  4DV5 Q;  2ATW A;  2EXD A;  3F1Z A;  2A19 A;  3KJO A;  4GOP B;  3HKS A;  4LFB Q;  2NN6 G;  3F8T A;  2A1A A;  3AEV A;  2KHJ A;  1E24 A;  3CPF A;  4JI8 Q;  1HNW L;  1PHJ A;  2YTY A;  5HY6 A;  5GRO A;  2GVB A;  1GD7 A;  4DV0 Q;  2E2J H;  4JG2 A;  1Q8K A;  4MTN A;  4OWT B;  2BA0 A;  1A62 A;  1UE6 A;  4UP8 A;  2JA6 G;  3ICE A;  4DK6 C;  2PQA B;  4A3M G;  3T1H L;  3HOY G;  2ZM6 L;  5FLM G;  3NEL A;  3KYH C;  1NTG A;  1YIJ A;  1IL2 A;  3I4N G;  4KI0 A;  3TS2 A;  3JC6 6;  1K3R A;  2PNH A;  1SN8 A;  2UXD Q;  4JBM A;  1UE7 A;  4IJH A;  3HOV H;  3OW2 A;  3W1B A;  2B63 G;  2K5H A;  3CCM A;  2LSS A;  2VZA A;  1VQ6 A;  4A3D H;  1G6P A;  4LUV A;  3J80 c;  4A3J H;  4X66 L;  1YIT A;  3K81 C;  3HOU H;  2IT1 A;  4PMW A;  4K0K L;  1NE3 A;  4R4Q A;  3L2P A;  4A75 A;  2N3S A;  3GD7 A;  1Y1V G;  2CQO A;  1CSP A;  5C0X G;  4P72 A;  4P74 A;  3B6Y A;  1BBU A;  3S1Q H;  4JC0 A;  4LF5 L;  1BKB A;  3KOJ A;  2BH2 A;  3KFU A;  3FP9 A;  1AE2 A;  4NXN L;  4B3R Q;  2IX1 A;  1XTD A;  2HQL A;  1BVS A;  2D62 A;  2B29 A;  1GM5 A;  1VQB A;  2IHE A;  4JI8 L;  4LUO A;  4DR2 L;  1RL2 A;  2UU9 Q;  4GNX C;  3CAM A;  1D8L A;  1UWV A;  3AFQ A;  4OWX B;  3CCE A;  1I94 L;  3I4M G;  3S1N H;  4GKK Q;  4JYA L;  4IFD J;  5GAG C;  4DV4 L;  3GTM H;  3PF5 A;  1AE3 A;  5DLQ E;  3HFZ B;  4POG A;  3PGZ A;  1PYS B;  2VUM G;  3G71 A;  3SGI A;  1RIP A;  2OQ0 A;  4O0A A;  4LF8 Q;  4POF A;  2CWA A;  1HNX Q;  1PFS A;  1H95 A;  1IZ6 A;  1N8R C;  2H5X A;  4DV3 Q;  1V1Q A;  3PUY A;  2Y0S G;  1YHA A;  4IJL A;  2NZO A;  2XGT A;  5BR8 L;  4LFA Q;  3OTO L;  4GKJ L;  4WJ4 A;  2JE6 I;  3S2H H;  3CQZ H;  4A3M H;  4JI5 Q;  3AYH B;  1XMQ Q;  4K0K Q;  3UDX A;  1VQD A;  5IYC G;  2ZTC A;  1KQS A;  3I4N H;  1VQE A;  2XTI A;  1SRU A;  2JA5 H;  3IRB A;  4UP9 A;  1N34 Q;  5M3F H;  2YTV A;  2Z0S A;  4IOC A;  4JI6 Q;  1VQO A;  5ELO A;  1PA6 A;  2IX0 A;  1SLJ A;  1GVP A;  1G29 1;  4DUY Q;  3I55 A;  4ME3 A;  4A3I H;  1J5E Q;  1XMO L;  1VQJ A;  4YWM A;  3W1G A;  2CKZ B;  1QZH A;  2UXC L;  4X6A H;  1PYB A;  1VQ4 A;  4LF4 L;  2CWP A;  1E1T A;  4BY1 H;  3ER0 A;  5JJK A;  4GKK L;  4JYA Q;  4LW1 A;  4AQY Q;  2ID0 A;  3J81 i;  3G4S A;  4JI7 Q;  1XPU A;  3W5O A;  3I4M H;  4X62 L;  3UDG A;  4A3J G;  2OQK A;  4GLA C;  1VQL A;  3HOY H;  1EWI A;  1W2B A;  4LF8 L;  1Y14 B;  1HNX L;  2ZJP A;  3CCL A;  1VQI A;  2JQO A;  3TRE A;  4QIW E;  4DV7 L;  3RR5 A;  1QVG A;  1N33 Q;  4TVA B;  1QUQ B;  2UUC L;  4JI5 L;  1HH2 P;  1CUK A;  1VQ8 A;  5IYD G;  1M90 C;  1Q86 C;  3GTP H;  1N32 Q;  4MNO A;  2EIF A;  4UPA A;  4H02 A;  4A93 G;  4JI6 L;  3J81 j;  3M85 A;  4P75 A;  5C4X H;  2MQH A;  1QVF A;  3CD6 A;  3ULL A;  3DM3 A;  3K0X A;  2R7D A;  3RZD H;  1XMO Q;  4DPG A;  1Q1B A;  4GOP A;  4A3I G;  5C44 G;  5IYB G;  3DLL A;  1PH2 A;  1T9H A;  4IFD G;  4JI2 Q;  1TWA H;  2VQF Q;  5M5W H;  4LF9 Q;  3ZJY C;  4AQY L;  1EQQ A;  4BY1 G;  1K8A C;  3M4P A;  2NVX H;  4JI7 L;  3H3V H;  2KHI A;  1X9N A;  1TXY A;  2AWN A;  1SMX A;  4GN4 B;  4JCV E;  1ASY A;  4GNX B;  4QL5 A;  3S24 A;  1S3O A;  3RN2 A;  1KC8 C;  4IPH A;  2KBN A;  2GVA A;  4DV6 L;  1U5K A;  2I0Q A;  3CCQ A;  2JA8 H;  4YCU A;  4HIO A;  1YJW A;  3J80 i;  2IHF A;  4R4I A;  1KRT A;  3CPW A;  2ALY B;  2QEX A;  3BJU A;  1MIU A;  4DR6 L;  1X65 A;  1VQH A;  5E7N A;  4HJA A;  2HHH Q;  3PF4 A;  1PH5 A;  4XTC S;  4A3C H;  2NZH A;  4XIG S;  1EQR A;  2R7F A;  2WAQ E;  3RNU A;  3TRZ A;  4DAY B;  4YY3 L;  1CSQ A;  1LM0 A;  1EIY B;  4HJ5 A;  2KCM A;  1JE5 A;  1CKN B;  1KIX A;  2UUA L;  2DGY A;  1U0L A;  4HJ9 A;  1XJV A;  3PO3 H;  1Z9F A;  1I5F A;  4OX9 Q;  3M9B A;  4OXP A;  5IP7 G;  2ASB A;  3S17 H;  4BBS G;  1A63 A;  3WWV A;  3CCR A;  4LF9 L;  4GLX A;  4JBW A;  3PUV A;  4JV5 Q;  4X65 L;  3CP0 A;  5IE8 A;  4HIK A;  1UE5 A;  1OTC A;  4IOA A;  3K7A H;  2N78 A;  5EAY A;  1IBM L;  1OXT A;  4GOP C;  3AFP A;  1B7Y B;  1E7Z A;  4JI0 Q;  4A3L G;  4RG1 A;  1N36 L;  3UDI A;  1IBK Q;  5FLM H;  1PH9 A;  4Y52 H;  1I50 H;  4L5T A;  3U58 A;  3K80 C;  2YU9 H;  4JBK A;  4AH6 A;  2Z6K A;  2F52 A;  3HOZ G;  5AJ3 Q;  1XNQ L;  5H1S E;  5FLX c;  1Y1W G;  1QZG A;  1A8V A;  1WFQ A;  2VS1 A;  3BU2 A;  1PVO A;  1OXX K;  1VQP A;  2BA1 A;  2OTJ A;  4O2D A;  2JA7 G;  5M5Y H;  1SFO H;  4DR7 Q;  4B3S L;  2KCT A;  1Y1V H;  1LYL A;  1JJG A;  1VQA A;  1HZA A;  4YWK A;  5M3M H;  4AIM A;  3HOV G;  2Q2I A;  1YZ6 A;  2MFI A;  1QVC A;  2UUA Q;  3MXN B;  1IYJ B;  2RF4 A;  4TQU S;  1PH8 A;  3U4V A;  2UXB L;  2C35 B;  4DR4 L;  1TWC H;  5GAE C;  5C0X I;  2JA6 H;  2Q2U A;  5C4J H;  3OYY A;  3K7U C;  1KL9 A;  1YJ9 A;  4NXM L;  4GLV B;  5LMN L;  3D31 A;  4A3B G;  1JT8 A;  2VNU D;  1IBM Q;  2UUB Q;  2L15 A;  3D0F A;  4A76 A;  2WB1 E;  2YTX A;  1X54 A;  4GN5 A;  5IP7 H;  3M4Q A;  1IBK L;  1EYG A;  2VQE Q;  4A3E G;  5M5X H;  3I56 A;  4JOI C;  5IY0 A;  2E8G A;  4YHH Q;  3PIO A;  2RHQ B;  2QGQ A;  3PUX A;  3EIV A;  3HOX H;  1L0W A;  2R93 G;  1K83 H;  3BZK A;  3RLO A;  1IBL Q;  3UDF A;  2WAQ G;  1OXV A;  4LFB L;  4DV2 Q;  3UE0 A;  1PV4 A;  1XNR L;  5C3E G;  2GN5 A;  4JI1 Q;  3KDF A;  5K36 G;  1JJC B;  2WFW A;  1XPO A;  1YHQ A;  4A3G H;  1P8L A;  4LWC A;  4A3F H;  4JI3 Q;  3I7F A;  5IWA L;  1YBY A;  2AHO B;  4HJ8 A;  2K5N A;  4HIM A;  1C7Y A;  2E5L Q;  2JA7 H;  1SR3 A;  1B70 B;  1KD1 C;  2VUM H;  2N49 A;  2YV5 A;  4DK3 C;  1CKM A;  2R7Z G;  3H15 A;  4R1J A;  2MO0 A;  1Z47 A;  4NB3 A;  3STB D;  2UUB L;  4L5S A;  3HOZ H;  4DR1 L;  3PO2 G;  5GQO A;  3KLW A;  4OO1 G;  1A0I A;  1GO3 E;  3PUW A;  4P71 A;  4P73 A;  1EIF A;  5GAD C;  1Q7Y C;  2VQE L;  3S14 H;  3CCU A;  1QUQ A;  1EUJ A;  4A3B H;  1DGS A;  4IO9 A;  4OO1 I;  4HID A;  1V43 A;  4C2M H;  1MKH A;  3E9H A;  1PH7 A;  4HJ7 A;  4JBJ A;  3G6E A;  3L0O A;  1X3G A;  3TQY A;  3TS0 A;  3MEF A;  3GTK H;  4JI1 L;  4BXX G;  2JA5 G;  1UE1 A;  3PCO B;  4DR2 Q;  4DNI A;  3T1H Q;  2ZM6 Q;  1VQK A;  1KHI A;  4R4O A;  2UU9 L;  1I94 Q;  3KF6 A;  5JEA J;  4JI3 L;  1XPR A;  5IWA Q;  5IYD H;  2RCN A;  3HOW H;  1HJP A;  3PUZ A;  1SE8 A;  2CFM A;  4X66 Q;  1OXS C;  5C44 H;  1Q81 C;  4B3T L;  3U50 C;  1YJN A;  1NJI C;  4A93 H;  2PI2 A;  1WOC A;  2JK8 A;  3GTG H;  1X56 A;  1YHB A;  2A8V A;  4GKJ Q;  5BR8 Q;  3S15 H;  1L1O B;  2V1C C;  3TEH B;  1Q1E A;  1C0A A;  2VL6 A;  3L7Z C;  2PMZ E;  1OXU A;  5JEA G;  3A5U A;  4NXN Q;  4B3R L;  1I3Q H;  3T1Y L;  1X6O A;  4WJ3 M;  1HR0 L;  3CXC A;  4AYB G;  2VY3 A;  1VQG A;  3GTO H;  2HT1 A;  5C4X G;  2B3G A;  1J5E L;  4JI4 Q;  2R93 H;  3H0G G;  1PH6 A;  4PG3 A;  2I5L X;  1B8A A;  1L2F A;  4A3F G;  4KHP L;  1LUZ A;  3G48 A;  3E0E A;  4DV4 Q;  1Q12 A;  1VQN A;  4LF4 Q;  5IT9 c;  2I5M X;  2ZTE A;  4C3I H;  1WJJ A;  1HR0 W;  1W3S A;  4FDB A;  4GNX A;  5LMU L;  4QJF A;  1L1O A;  2HIX A;  4DV3 L;  2D0P A;  3OTO Q;  3CME A;  2LXK A;  3CCS A;  4IPC A;  1S72 A;  2OWO A;  4B3T Q;  4LF6 Q;  2CCZ A;  4LFA L;  1YVC A;  4BXX H;  4JOI A;  1MJC A;  1XMQ L;  3GTJ H;  2D0O A;  4PZ7 A;  4ALP A;  1R9T H;  2N8N A;  1N33 L;  1N34 L;  1HNZ L;  1NMF A;  1PH1 A;  1LTL A;  4A4I A;  3EN2 A;  1N32 L;  1VQM A;  2NVY H;  4YCV A;  2JEB I;  3F2C A;  3UE1 A;  2K52 A;  4A3L H;  4DUY L;  4EX5 A;  5JJL A;  3T1Y Q;  1E1O A;  1VQ9 A;  1CKN A;  1HR0 Q;  1K73 C;  3KF6 B;  4DUZ L;  2JA8 G;  1WI5 A;  1TWG H;  2I5H A;  2UXC Q;  3CW2 C;  2R92 G;  3GTL H;  2JEA I;  5HGQ A;  1WCM H;  4Y7N H;  4JI4 L;  1GKH A;  1FJG L;  3HOW G;  4LFC Q;  2LXJ A;  3HOU G;  4KHP Q;  4YWL A;  4L5Q A;  3NEN A;  4X62 Q;  3JAM c;  2VQF L;  5IYC H;  4B3M L;  1HZC A;  1NMG A;  4BBS H;  2JJQ A;  1IXR A;  4DR3 L;  3NBH B;  3ULJ A;  2MNA A;  3FHW A;  1EOV A;  5LMU Q;  2YYZ A;  5ELN A;  2F4V Q;  4DV7 Q;  1K8G A;  1PH4 A;  2K14 A;  4LF6 L;  3PV0 A;  3M7N A;  4QY7 A;  3GDE A;  1MJE A;  2BH8 A;  2UUC Q;  4BY7 H;  2FXQ A;  3S1M H;  2K5V A;  3BZC A;  3A74 A;  3EBE A;  4MZ9 A;  1UEB A;  5M3M G;  1HNZ Q;  1AH9 A;  4DKA C;  1Q82 C;  1JMC A;  2DUD A;  3CF5 A;  3FKI G;  1FGU A;  1NY4 A;  1L1O C;  2MO1 A;  3VDY A;  3NEM A;  4R4C A;  4R4T A;  1KRS A;  4APV A;  3ULP A;  1VQC A;  2WB1 G;  3J81 c;  1E3P A;  2ZTD A;  4DUZ Q;  2NVT H;  4AYB E;  4UP7 A;  1I6H H;  4A3K H;  1FVI A;  4YCW A;  4JI2 L;  5JJI A;  4KLK A;  3CCV A;  1YNX A;  1FJG Q;  1WCM G;  4OX9 L;  2K50 A;  4LFC L;  3HOX G;  3H0G H;  3S1R H;  2NVQ H;  1C9O A;  5GAH C;  2Q2T A;  4LUZ A;  3CC2 A;  4B3M Q;  2R6G A;  3J7A 5;  5C3E H;  1J6Q A;  5M3F G;  1BBW A;  4DR3 Q;  4DV6 Q;  1JJ2 A;  4NPS A;  4JV5 L;  2ZJR A;  2E2I H;  3GO5 A;  2QA4 A;  4DV1 L;  4UY8 C;  1SRO A;  3AQQ A;  2F4V L;  4DR5 Q;  2ZJQ A;  4A3G G;  1NBW A;  1E22 A;  1N36 Q;  4DR6 Q;  1O7I A;  3S2D H;  1VCI A;  1ASZ A;  1VQ7 A;  2JA9 A;  2HHH L;  1G51 A;  4A3E H;  4GS3 A;  1K9M C;  3F2B A;  4BBR H;  1XNQ Q;  1Q46 A;  5LMN W;  4YY3 Q;  2R92 H;  4IFD I;  3RLF A;  1VS0 A;  3RLN A;  1KAW A;  4LNQ A;  1EFW A;  3FKI H;  4LF7 L;  2AWO A;  3GTQ H;  1D7Q A;  4BY7 G;  1V9P A;  5FJ8 H;  2K4K A;  4DR7 L;  3K8A A;  4GN3 B;  1FL0 A;  4X64 Q;  2K75 A;  1CKO A;  1TWF H;  4IPD A;  3LGJ A;  4BA1 I;  2OTL A;  2Z6K C;  3CC4 A;  3PO2 H;  4X65 Q;  4DR4 Q;  2Y0S E;  3I2Z A;  4C3J H;  2IY5 B;  1PH3 A;  5IP9 G;  4QQB X;  4NXM Q;  3KJP A;  5J3B A;  3PIP A;  2KEN A;  5LMN Q;  4JI0 L;  3M3Y H;  1K0R A;  4EQ5 A;  4DV1 Q;  1JB7 A;  2PQA A;  3CCJ A;  4DR5 L;  2PI2 E;  4L5R C;  3HKZ G;  4IPG A;  2ES2 A;  4QGU A;  3E9I A;  5AJ3 L;  1TWH H;  2AMC B;  1X55 A;  5C0X J;  5IYB H;  3CMA A;  2RHS B;  4DV5 L;  2Q2H A;  3HKZ E;  3RZO H;  1N9W A;  3A0J A;  3Q8D A;  2HIV A;  1VQF A;  3I4O A;  1YI2 A;  3A5Z B;  2R7Z H;  4OON A;  3ERS X;  4B3S Q;  3H3V I;  2F3I A;  4DAM A;  1HNW Q;  2B63 H;  2VW9 A;  4DV0 L;  3JAM i;  3RN5 A;  1S40 A;  1M1K C;  1IBL L;  4LF7 Q;  4A3D G;  4DV2 L;  2OCE A;  1XNR Q;  2UXB Q;  1HZB A;  1X3F A;  5FJ8 G;  1VQ5 A;  1WYD A;  4X64 L;  4J15 A;  4A3C G;  4A3K G;  1KXL A;  4BBR G;  4C3H H;  3STB C;  2E2H H;  4OWW B;  2UXD L;  3CC7 A;  1X3E A;  4KHZ A;  1Y1W H;  3U4Z A;  3S16 H;  2E5L L;  3J7Z C;  4BA2 I;  4PZ8 A;  2NN6 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...