5IYDH

Human core-pic in the initial transcribing state (no iis)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
150
structure length
150
Chain Sequence
b'MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Near-atomic resolution visualization of human transcription promoter opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription, transferase/dna/rna
total genus 16
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5iydH01
3CCEA 1VQLA 3A0JA 2QA4A 4A3IG 4C2MH 2KHIA 2DUDA 4DAYB 3KF8B 1PH1A 1VQGA 4LF7L 4IPGA 1P16A 3L2PA 4DV2Q 1N32L 1ASYA 1VQHA 3FHWA 4R4IA 1X3GA 2Z6KC 3CPFA 2B63G 3K81C 3I7FA 1OXUA 3RLNA 4NXNL 1AE3A 2VL6A 3S24A 3J7ZC 4GOPA 1N8RC 4GLAC 1C9OA 4QY7A 3ER0A 4LF9Q 1Q1EA 2VY3A 1M1KC 1VQ6A 3E0EA 5JEAJ 4A3FH 5C3EH 3UE1A 2I5MX 4QIWE 3KF6B 3CC2A 1AH9A 1XMOQ 1IBLQ 3T1YQ 2I5LX 4X62Q 3M3YH 4A3EG 1YHBA 1QUQB 4LF8L 4XTCS 4A76A 4LUOA 2Z6KA 4PZ8A 3S17H 5IP9G 1VQFA 4A3JH 2R6GA 3SGIA 1SLJA 3U4ZA 4K0KQ 5IYDH 1I6HH 4DK3C 1N36L 1IBKL 1W3SA 1BBUA 4IOAA 2UXCL 4DR3L 4L5QA 3STBD 5C4XH 4KHPQ 1X3EA 1HR0Q 5M5WH 2VUMH 3GTKH 2HQLA 2BA1A 4DV0L 3G48A 2R93G 3HOUG 5JJLA 1GM5A 1HNXQ 2R7FA 4B3TL 4DV6Q 2WFWA 1PH3A 2ZTCA 3CQZH 2NVYH 3I4OA 3U58A 1OXXK 1B70B 4R4CA 4HJ8A 2ZM6L 4JI2Q 3RLFA 4OX9L 4JI5L 1QVFA 2E5LQ 1E24A 1VQEA 4WJ3M 4DV7Q 4JBJA 3CF5A 2OQ0A 3NELA 2CWPA 3KFUA 1N9WA 2JA9A 3OTOL 1SMXA 3CP0A 4DUYQ 1Q81C 4DV1L 4JI1L 2VQFQ 4IPHA 2UUAL 1YIJA 5J3BA 1PV4A 1KRSA 1OXVA 4DR5Q 2NN6G 3J81j 3FKIG 1L0WA 1DGSA 2K50A 1VQNA 2YU9H 2E8GA 3CW2C 2ZTEA 4EX5A 2NZHA 4L5TA 4BBRH 3PUXA 4LF6L 2ID0A 3HOZG 2PMZE 1PFSA 4GN4B 3KDFB 3UDIA 2JK8A 4DV2L 3T1HQ 2QEXA 4C3JH 1IBMQ 4YCVA 3F2BA 1NTGA 4P72A 1NMGA 2KCTA 5LMUQ 4JI4Q 4A3MH 4DR7Q 4A4IA 1RIPA 3W1BA 4A3KH 3HOYG 4A3LG 2Q2HA 1Q46A 4DPGA 2JQOA 4A93G 1GKHA 4LF4Q 1VQCA 4L5RC 2JEBI 3J7A5 1XPUA 1MKHA 3IRBA 4JCVE 3OW2A 1CUKA 2K52A 2MO0A 3UE0A 5LMNQ 2BA0A 4LF9L 5IWAQ 1VQBA 3M4PA 1Z9FA 1YHAA 3PGZA 5M3FH 1JJGA 2ZTDA 3I4NG 4WJ4A 1QVCA 1XMOL 1IBLL 3T1YL 1MIUA 2A8VA 3S14H 2CCZA 1GVPA 4BA2I 2F4VQ 2K5HA 2R7ZH 5BR8Q 3HOVG 4MNOA 3F8TA 1PH4A 1R9TH 1QZHA 3TS2A 1X6OA 4K0KL 3M7NA 2IHFA 1VQJA 2UXDQ 4A3FG 5M3MH 3K8AA 3J80i 5C3EG 3G6EA 5E7NA 3AFQA 2UXBQ 1KL9A 3CCSA 4OXPA 1P8LA 4KHPL 4QL5A 2JA5H 1HR0L 1YJ9A 3HKZE 3AYHB 4ME3A 4LF5L 1IL2A 4GNXA 4UY8C 4DV6L 1VQ7A 5IYDG 4H02A 1FGUA 2K5NA 2YTVA 4APVA 1K8GA 1VQIA 2K4KA 2IT1A 3S16H 1VQ8A 1A63A 1KXLA 1LTLA 3HFZB 5M5XH 2MNAA 3W5OA 4JI2L 4KI0A 4ALPA 2K14A 4A3DG 2GN5A 4UP8A 5C4XG 2EXDA 4JI3Q 2JA8H 3S1QH 4DV7L 2VQEL 3RZDH 2VUMG 4DR6Q 2ZJQA 3U50C 5GAGC 4GN5A 1CKOA 2F52A 4IJHA 3PIPA 1KRTA 3E9IA 3PUZA 4DAMA 4BXXG 2ZJPA 3MEFA 2N3SA 2WAQE 2ES2A 3Q8DA 2VQFL 3TS0A 4OONA 1Q1BA 2WB1G 1Y1VH 1NMFA 3PSIA 1I94Q 4DR5L 2Y0SE 2DGYA 1SRUA 3ZJYC 2N49A 4NPSA 3S2DH 1WCMH 3F2DA 4BY1H 4DV3Q 4OO1G 5H1SE 3W1GA 4JI0Q 5AJ3Q 4LFAQ 3CCRA 1XNRQ 2LXJA 4B3RQ 2PNHA 1JMCA 1YVCA 1A8VA 4DUZQ 1HZ9A 2CQOA 3T1HL 1IBML 4R4TA 1KIXA 1N33L 2UUBL 5LMUL 1FL0A 1VQPA 4JI4L 4O2DA 1NJIC 2OTLA 2JA7H 1XPOA 1UWVA 4B3MQ 1JT8A 1EYGA 2IX0A 2JA6H 2NVTH 3PUWA 3GTMH 3CC7A 1Y14B 2F3IA 4BBRG 4EQ5A 1EQQA 3CC4A 3H15A 1HNWQ 3CMEA 5FLMH 4AYBG 3BZCA 3H0GH 4P75A 5GROA 4TVAB 2BH8A 5LMNL 4FDBA 4HIDA 4LFCQ 1G6PA 4JI6L 3HOXH 5IWAL 4LFBQ 1L1OB 4R1JA 2LSSA 1G291 5FJ8H 3NENA 1K3RA 3ULPA 4IOCA 3UDFA 1N34Q 3ERSX 3GTOH 2F4VL 1C7YA 4P73A 3TREA 1G51A 1HZAA 3L0OA 5IYCH 3J80c 4UP9A 3M9BA 5BR8L 4QGUA 3F1ZA 4HJ9A 3GTLH 3HOWG 2MQHA 1TWHH 3NEMA 3DLLA 1E3PA 4YWMA 1TWAH 4A3CH 2UXDL 4A3IH 1WOCA 1K83H 3PV0A 4JC0A 1K73C 4DK6C 2VZAA 3J81i 4B3SQ 1FJGQ 1L1OC 3GTPH 4HJ5A 3LGJA 3EN2A 5IP7H 3D0FA 1VQOA 4YHHQ 3L7ZC 3KOJA 2PI2E 4R4QA 1U0LA 1WFQA 1YZ6A 4OWWB 2R7ZG 3UDXA 2YTYA 2XGTA 1GO3E 1TWGH 5M5YH 4DR2Q 4YY3Q 4JI7Q 2OQKA 5IYBH 2YYZA 1X55A 4KHZA 4LUVA 1PHJA 4A3GG 4BY7H 2KCMA 4IFDG 4POFA 3S2HH 4JI3L 4GNXB 3I4MH 2JA5G 2NZOA 5C4JH 3VDYA 4UP7A 3A5UA 4DR6L 4DR1Q 1HZBA 5HGQA 1QZGA 2RCNA 3S1RH 2IY5B 1H95A 3STBC 3PO2G 1HJPA 1IXRA 1L1OA 1JE5A 1KC8C 2K5VA 2UUCQ 1EOVA 5GADC 1X56A 5IP9H 1X65A 2HIVA 4IJLA 1I94L 1SR3A 3A5ZB 1I50H 4YWKA 3EIVA 5C0XI 3B6YA 1VQ4A 2HHHQ 4X66Q 4JYAQ 1B7YB 3H3VI 4DV3L 1K8AC 2ZJRA 1SFOH 4GNXC 4JI0L 5AJ3L 4XIGS 3AEVA 3ULJA 4LFAL 4GKJQ 2NN6I 1CKMA 4LW1A 4JV5Q 2VS1A 2L15A 4TQUS 4PMWA 4X62L 4HIOA 4DUZL 3RN2A 5IY0A 1QVGA 1PYBA 2JJQA 3CCVA 3JC66 2Q2UA 2R93H 3KLWA 3U4VA 1PH2A 2IX1A 2IHEA 4IO9A 1T9HA 4RMFA 3A74A 4O0AA 4YCUA 1PVOA 4KLKA 4LNQA 2ASBA 4GKKQ 3M4QA 1WYDA 1WCMG 1VQDA 2Z0SA 2HT1A 4B3ML 4BY1G 3DM3A 1A0IA 1W2BA 2R92H 3FP9A 1Z47A 5GQOA 1C0AA 2I5HA 3HOYH 1HNWL 1S72A 1TWCH 4IFDJ 4GLVB 4DR4Q 4LFCL 2AKWB 4A3BH 1YEZA 4B3TQ 2LXKA 3CCQA 3PUYA 4JOIC 2K75A 3JAMi 4MTNA 4LFBL 1D8LA 4GS3A 4A3JG 1HNXL 1A62A 1MJEA 1J5EQ 4Y52H 3H3VH 1X54A 3CAMA 3KJOA 2D0PA 3K0XA 1N34L 4JI5Q 2CWAA 3GTGH 4RG1A 1VQ9A 3FKIH 3NBHB 5FLMG 3M85A 1UE5A 1UEBA 3J81c 3CCUA 2E5LL 2KBNA 1XJVA 3F2CA 1PH8A 4BBSH 3ULLA 4PZ6A 2FXQA 4DV1Q 4JI1Q 1YHQA 2PQAA 2E2JH 2UUAQ 4JG2A 3HKSA 1U5KA 2MFIA 5FJ8G 2AMCB 4DUYL 1AE2A 1IZ6A 3RNUA 3PF5A 4B3SL 4P74A 1NE3A 2AWNA 1VQAA 5IYCG 1PA6A 4JOIA 4A75A 1VQKA 3EBEA 5DLQE 4A3LH 3I2ZA 4A93H 5IE8A 2JE6I 2UU9Q 4DR2L 2EQSA 1CKNA 1E1TA 2GVAA 3RLOA 4JBWA 4YY3L 1XPRA 1PYSB 4JI7L 3K80C 4LF6Q 1HH2P 2D0OA 2QGQA 1XNQQ 2Q2TA 5C44H 4MZ9A 1JJ2A 2CFMA 3BU2A 5IP7G 2D62A 1E22A 2AWOA 2WP8J 1HNZQ 4BA1I 3I4NH 1K0RA 1TWFH 2B29A 5ELOA 4DR1L 4DR7L 3M4OH 3GDEA 3GO5A 3G4SA 1HR0W 1XMQQ 3MXNB 1I5FA 2C35B 4LF4L 3G71A 2UUCL 3HOVH 5IYBG 1XTDA 3RZOH 2B3GA 2WB1E 3CXCA 1EIYB 5FLXc 4BY7G 1LUZA 4AQYQ 4P71A 4X64Q 1KD1C 2GVBA 3I4MG 1BBWA 4Y7NH 1YI2A 4OWXB 1PH6A 2HHHL 4X66L 3TEHB 1KAWA 4DV5Q 4JYAL 4A3MG 2V1CC 1NBWA 1B8AA 3GD7A 4IPCA 4YWLA 4A3KG 1YJNA 4PZ7A 1Q7YC 4GKJL 3PIOA 1MJCA 4JBKA 4JV5L 1S40A 2ALYB 3PO3H 4C3HH 3BJUA 4OO1I 2N78A 2NVXH 2KHJA 2R7DA 5K36G 4DV4Q 1FVIA 4OWTB 1Y1WH 5JJKA 1WJJA 2CKZB 3BZKA 2KENA 4C3IH 4GKKL 1V43A 5JJIA 1IYJB 1RL2A 4LWCA 1YJWA 4AIMA 1S3OA 1TXYA 5M3FG 5GAEC 2YV5A 3JAMc 4A3DH 4X65Q 3RN5A 2RHSB 2A1AA 4NXMQ 1D7QA 1VCIA 2UXBL 1GD7A 1Q12A 3OYYA 3CCMA 5ELNA 4AYBE 2E2HH 4LF5Q 4JI8Q 4DR4L 2OCEA 1I3QH 4J15A 2B63H 3D31A 3S15H 4BXXH 4DNIA 1J5EL 2R92G 1EWIA 5M3MG 1VQMA 3K7AH 5GAHC 4LF7Q 1OXSC 1UE6A 1Q82C 1O7IA 2MO1A 4HJAA 1UE7A 1X9NA 1PH9A 1N32Q 2VQEQ 1EQRA 1K9MC 4JBMA 3I56A 1Q86C 4A3BG 3GTQH 4LUZA 1CSPA 5C0XG 3PUVA 5LMNW 1VS0A 1JJCB 1KHIA 1L2FA 1YBYA 3KF6A 5IT9c 4A3EH 4NXNQ 2BH2A 3CCJA 2OTJA 2EIFA 3CCLA 1QUQA 3E9HA 3I55A 1CSQA 5EAYA 2E2IH 2JA8G 2N8NA 3S1MH 2PQAB 3WWVA 1NY4A 2UU9L 1EIFA 1VQ5A 4PG3A 4BBSG 4IPDA 3S1NH 1SN8A 1YNXA 2HIXA 2JEAI 1JB7A 4QJFA 1XNQL 5HY6A 1XNRL 1E1OA 1N33Q 1Q8KA 1YITA 1M90C 4LF8Q 4B3RL 2UUBQ 1Y1VG 3HOUH 3PCOB 1PH5A 1HNZL 1CKNB 1SROA 3PF4A 2PI2A 4HIMA 1SE8A 2I0QA 3RR5A 1N36Q 3AQQA 4NB3A 1IBKQ 1LM0A 3KJPA 4IFDI 4A3CG 1OTCA 2A19A 1XMQL 2UXCQ 4GLXA 4YCWA 2NVQH 4DR3Q 4X6AH 4GN3B 3HOWH 2ATWA 2RHQB 2H5XA 5C44G 3KYHC 2VW9A 3HKZG 4L5SA 1OXTA 2VNUD 2Q2IA 4JI6Q 4DV0Q 3AFPA 1UE1A 4X64L 4AQYL 4QQBX 2OWOA 3UDGA 4DV5L 3TRZA 3CPWA 1LYLA 5C0XJ 3TQYA 1E7ZA 4GOPB 1PH7A 1KQSA 2JA7G 3ICEA 2RF4A 2ZM6Q 1HZCA 1BVSA 2YTXA 4UPAA 1X3FA 4AH6A 1V9PA 4OX9Q 3CMAA 2JA6G 4POGA 2AHOB 1ASZA 4DKAC 3GTJH 4HIKA 1V1QA 4DV4L 4HJ7A 1EUJA 3H0GG 5JEAG 2XTIA 3HOXG 3OTOQ 2WAQG 4A3GH 3HOZH 1FJGL 1BKBA 4X65L 4NXML 3PO3G 2Y0SG 4GOPC 1EFWA 4YHHL 3KDFA 4JI8L 1J6QA 1WI5A 3K7UC 4R4OA 3CD6A 1Y1WG 3PO2H
chains in the Genus database with same CATH superfamily
3GTLB 3A0JA 1ZEQX 3KF8B 3P1HA 1VQGA 4A3IB 3I4LA 3VR2A 4LF7L 5IOCA 1SYDA 3L2PA 4DV2Q 2Z9HA 1DD2A 3QJYA 3E3XA 3FHWA 1LV9A 3K81C 1AW7A 2LKVA 4RGTA 3S24A 4RWSC 2SNSA 1C9OA 4QY7A 4CDCC 4LF9Q 4XYQA 1Q1EA 1M1KC 2XRQD 5JEAJ 4CJ2C 3UE1A 1DXMA 2I5MX 3HRZC 3DM1A 1EOTA 2PNRC 1CHPD 4X62Q 1TQOA 3M3YH 3SEBA 4OIKA 3C3LA 1YHBA 1SEBD 4A3EB 3QIAA 4LUOA 3W2DA 3NWTA 4K0KQ 1I4PA 3MZ5A 1N36L 1W3SA 5EGTA 4IOAA 3VYSA 5KRUA 2EY6A 4L5QA 4S3SA 3S1NB 4KHPQ 3GTKH 3I73A 1RJTA 1GM5A 2DY7A 2ZTCA 2NVYH 3I4OA 4U68A 2H4OA 2RSNA 1QVFA 3NHHA 1E24A 3KFUA 2EOTA 2JA9A 4ABNA 3OTOL 1Q81C 1BR9A 4JI1L 2UUAL 2F0MA 2XWJB 4LAAA 3ZYYX 1SXTA 1GUWA 1PTOD 4DR5Q 2NN6G 1EQVA 3J81j 3FKIG 4HCSA 3SK8A 1Y69U 1GUSA 4EX5A 3PUXA 5IIFA 2ID0A 4J6HA 1ENAA 3T1HQ 2B2TA 3A7AB 4C3JH 1CK1A 5LMUQ 4A4IA 5DAUA 3SK4A 4A3LG 2Q2HA 1Q46A 4DPGA 3BVZA 2JQOA 3HOYB 4L5RC 3TP5A 2A6ED 4A93B 5J1ZA 1CUKA 3VR6A 1MSGA 1PXUA 4ZUIA 1JWMD 4E6IA 2R61A 1VQBA 5E4XA 2CW0C 1F9QA 4KHVA 3HG9A 4R8IA 1XMOL 3I4NB 1IBLL 1MIUA 1CT1D 2CCZA 2XNAC 5ELBA 1R9TH 2BE5C 3WOEA 3TS2A 1X6OA 3M7NA 4B9WA 4A3FG 4NKLA 5M3MH 5C3EG 3J80i 2VB2X 5CORA 2MJ8A 3AFQA 1KL9A 3CCSA 2PZTA 1UNSA 4OXPA 3IFDA 3K59A 4ZAIA 1HR0L 1YJ9A 5I9OA 3N52A 5IYDG 1FGUA 2K5NA 2YTVA 1JWUD 4C3IG 1K8GA 2IT1A 2RBMA 4IALA 2K14A 1WD1A 1SMYC 3T56B 2EXDA 2JA8H 2A6HD 2PYKA 4PMCA 4F8MA 3RZDH 2VUMG 5EPLA 2ZJQA 3GTKB 2EVBA 4BXXG 2MP1A 3MEFA 2N3SA 2WAQE 2L4NA 2VQFL 1Z6HA 4KY7A 1NMFA 2NB0A 1I94Q 1BCPD 3S2DH 4CGYB 4F88A 1LTID 3F2DA 1SNDA 2E75C 2TMPA 5AJ3Q 3BZDB 4B3RQ 1A8VA 1CQFA 1JOKA 3IAYA 4O2DA 2OTLA 1CFMA 2PZWA 1HQRD 1IW7D 4B3MQ 1JT8A 3J80L 4XQNA 2JA6H 4DNTB 3S1MB 2BCOA 3CC4A 3H15A 3NSWA 5GROA 2F0JA 4TVAB 1EY7A 5BN4A 2HUGA 2IWHA 1XWEA 1L1OB 1PFNA 2Q8RE 1Q8IA 1A2UA 1ENCA 2ZXPA 4IN3A 1PLFA 3ULPA 1N34Q 1O7YA 3ERSX 3NTIA 3GTOH 3L0OA 5BR8L 4JPBW 4QGUA 1G6ZA 1ML0D 1U4LA 2B2YA 1TWHH 4YWMA 2B2VA 4A3CH 1SBBB 1K83H 1WOCA 5T1IA 3KLSX 3GTPH 1L1OC 1YNJC 2F0OA 2CHBD 2EYOA 2WACA 5KYIA 5ELDA 4YHHQ 4KTAA 4FO2A 1A2TA 3KOJA 4FVMA 4R4QA 1WFQA 5JJZA 2PCFB 4YY3Q 3GTJB 1EEFD 1D6EC 3IFTA 1WTXA 5IYBH 2N55A 1F2MA 5ISRA 4POFA 4A3GB 3S2HH 1HPCA 2JA5G 5C4JH 3W3AA 2KUMA 4DR6L 3S1RH 2IY5B 3STBC 3PO2G 3PQIA 1PFBA 3EROA 2A68C 4K6LA 5I2XA 1HA6A 1E0BA 2J7ZA 1CTMA 1EY0A 1B7YB 2QDLA 3H3VI 1K8AC 2F0VA 4XIGS 4LFAL 1MBYA 1R4PB 2NN6I 2X6LA 4LW1A 4OL7A 2P5ZX 2VS1A 3K57A 4X62L 3VYUA 3JC66 3OHXC 3KLWA 2AQ2B 1PVOA 1T9HA 1H9JA 4O0AA 3DWAA 2HQEA 4NW2A 3I91A 4EQNA 1TS4A 3FEWX 2KEDA 2PQEA 3DM3A 2F0LA 4L6TB 3FP9A 3GV3A 1SE3A 4FF2A 2I5HA 1HNWL 4IFDJ 1J8IA 4GLVB 3FRPB 4OELB 2LXKA 1DOMA 3PUYA 1HQMC 1D8LA 4GS3A 2EZVA 1VF5C 5CV8A 3H3VH 4Y52H 3PIP3 1S5CD 2XSCA 2NN6H 3FKIH 5FLMG 1LABA 5F2DA 1XJVA 1EWCA 3F2CA 3D4DA 2SOBA 1BOSA 1C4QA 3HKSA 4ID6A 4B3SL 1FJGL 3PF5A 3VYRA 4P74A 1F2ZA 5IYCG 4JOIA 4A75A 3GTOB 4A3LH 4CBVA 1SNPA 1CKNA 1TWHB 1EIHA 5FLXL 4IUQA 5DM63 1FNVA 2Q2TA 4MZ9A 1JJ2A 2CFMA 3OWFA 3GTPB 2WP8J 1E22A 4DNRB 4ZUJA 1RKNA 4KJNA 4BA1I 1HNZQ 5D14A 3GO5A 3I3CA 3MXNB 3OMCA 3T53B 3NQIA 2UUCL 2G9HD 4HSVA 3OIQA 2GVBA 3I4MG 1B50A 1J9OA 5JEAH 4OWXB 4ZCKA 3S2HB 1U4MA 2V1CC 4A3MG 4YWLA 1YJNA 1GUNA 4PZ7A 1Q7YC 3VYTA 1MJCA 1S40A 1FYCA 5JVG3 2E76C 2HCCA 5JPMC 2N78A 5K36G 2R7DA 2F0IA 5JJKA 1F2YA 1I4XA 4C3IH 1EZ6A 4GKKL 2EDGA 5GAEC 1HFNA 5AFWA 1HRJA 5C6AA 5CV7A 3SE0A 4KN7C 1V1PA 1I3QH 4J15A 3ITPA 4EGVA 5C3WA 4BXXH 4DNIA 4K8JA 1RCVD 1S5FD 4LF7Q 3J7AF 2PMZB 1UE6A 1O7IA 1PH9A 4HJAA 4JBMA 4A3BG 3VR3A 2FMMA 1CSPA 1YBYA 1L2FA 2OTJA 3CCJA 3CCLA 1QUQA 3T51B 5M5XB 3I55A 5FLXE 4OHJA 1PYWD 5EAYA 1R4QB 3IKJA 4PG3A 5IGDA 3NQTA 2HIXA 1JB7A 4B3RL 1Q8KA 1YITA 1X3QA 3HOUH 4H44C 1CKNB 3H3VC 3PF4A 3M7GA 3QR8A 2I0QA 3RR5A 1N36Q 4ZLTF 1EY8A 4YCWA 2H5XA 3KYHC 1OXTA 4K5WA 2JYOA 4QQBX 1FD7D 2V4DA 1II3A 3TRZA 4X3TA 3CPWA 1LYLA 5C0XJ 4GOPB 2RDGA 1BVSA 1X3FA 3CMAA 5FKAC 1H9KA 1HFGA 1EYAA 1M4VA 1EUJA 1QG7A 3H0GG 2KECA 3TP7A 3OTOQ 1A3TA 2WAQG 3HOXB 3HOZH 1V8QA 1BKBA 1PRTD 4GOPC 4HAEA 2Y0SB 4NMZA 4TRDA 4YHHL 1G8ZD 3PO2H 1G2SA 1B9NA 4IZ8A 2O5IC 1VQLA 4O1NA 1STYA 3SK6A 4FYDA 4ZYSA 4L63B 1P16A 5CBEE 2OF1A 1V1PB 4CJ0B 2F03A 4QB4A 2L5TA 1X3GA 3CPFA 2B63G 3MTSA 2EJFC 3I7FA 4CDFC 2EJGC 3DEOA 5KIXA 1TWGB 2VL6A 3KUPA 5KNDA 3GV6A 1WTWA 3PIO3 4GLAC 1EYDA 3ER0A 3VA7A 1F9PA 5TSSA 4QIWE 1XMOQ 1WTHA 1QNUA 1IBLQ 1QUQB 1NR2A 4XTCS 4N8X1 2PO4A 2EYLA 3J81E 1XYIA 1ENFA 1TU2B 4RCOA 2L12A 5C4XH 5A2QL 1HR0Q 1JJGA 4DV0L 2BA1A 1HNXQ 2R7FA 2SDFA 2EYFA 2R93B 2L55A 3HOUB 3MC0B 3FMCA 3U58A 1OXXK 1B70B 5C4ZA 4HJ8A 1EYCA 3RLFA 5COYA 4OX9L 2G5DA 2RDFA 1RF2D 1TY2A 1VQEA 3NELA 4HR7B 4KN4C 4MTKA 1N9WA 1SMXA 2EYPA 2F0FA 2VQFQ 4KD4A 3OPOA 2EYHA 4DA2A 3EA6A 3T13A 2K50A 2YU9H 5A35A 2E8GA 4N8FA 2NZHA 3U9OA 4L5TA 4N9TA 1YNND 1HTPA 3IL8A 3HOZB 1NAPA 2JK8A 2E2JB 2QEXA 4P72A 4A3MH 2K03A 1DZ1A 1GUTA 1UEAB 4LF4Q 1VQCA 3J7A5 2K6AA 4H7BA 1MKHA 4JCVE 1I4GA 5K36H 3OW2A 1QJOA 2K52A 3JAME 2RQXA 5LHY1 3BDCA 3X3NA 1B9MA 2HDLA 1Z9FA 4X3UA 2ZTDA 1JWSD 1CHQD 1RD9D 1DONA 3T1YL 3M4OB 1GVPA 4BA2I 1SYFA 1JOOA 2K5HA 2R7ZH 5BR8Q 3HOVG 4MNOA 1QZHA 2KOLA 1E2ZA 2IHFA 1EU4A 2K5WA 4CKBA 4IUNA 5E7NA 3G6EA 4K2LA 4F87A 3MXGA 1B3QA 4IFDH 4C3HG 2ENBA 5IT9E 3AYHB 4ME3A 1IL2A 1STNA 1PZJD 4APVA 4Q0FA 1SYEA 4R9WA 4FF3A 4OIJA 1PTOH 4M1UB 2MNAA 3W5OA 4A3DG 1QNKA 2GN5A 4DV7L 5C4XB 4Z9CB 4DR6Q 2NUCA 4HCEA 4CDEC 2MPMA 2F52A 4IJHA 2OT2A 4OONA 3BDOA 3PSIA 2WB1B 2DGYA 1X32A 2N49A 2C5CA 3KBXA 1WCMH 3G7LA 4LFAQ 3TN2A 3CCRA 5FO7B 2LXJA 5I4DA 3EFXD 1SNCA 3NPPA 4WJWA 4R4TA 4JI4L 1NJIC 4CJ1B 1UWVA 1EFID 1AZPA 2IX0A 3GTMH 3PUWA 2YU9B 3CC7A 2JN4A 3QOJA 2F3IA 4BBRG 1HNWQ 3D4RA 5EPJA 2PZUA 1E2WA 1KLGD 3H0GH 3O13A 2BH8A 2KCCA 5LMNL 4HIDA 1G6PA 4RCNA 4AYBB 5IWAL 1G91A 5ELCA 4R1JA 3TP6A 3OSOA 3NENA 1STAA 3K6OA 4QF4A 2O2LD 2F4VL 4P73A 4HJ9A 4UP9A 3HOWG 3F1ZA 4DAPA 2CH4W 4KJOA 3DLLA 1HCZA 2M9VA 4EQPA 1TS2A 2F0HA 2VZAA 4B3SQ 4ILWA 2F0KA 1FJGQ 2D2CC 4G7OC 5IP7H 1VQOA 1GUGA 1U0LA 2HCIA 4DXGA 3UDXA 2R7ZB 1EY5A 5FO8B 4ME5A 1TS5A 1LT4D 2CW0D 1STEA 4H0LC 4LUVA 1GHKA 2F0EA 2C9OA 2NZOA 3VDYA 1ZKOA 2AQ1B 4IQZA 3P75A 1Q90A 1H95A 1HJPA 1IXRA 1A3UA 1L1OA 1KC8C 2UUCQ 4XQQA 1EOVA 3UI2A 2HIVA 4IJLA 1SR3A 3A5ZB 1S4ZA 5C0XI 3FPPA 4DV3L 2ZJRA 1FR3A 2A69C 2LS01 5IGBA 3ULJA 4RKLA 2L15A 4PMWA 4HIOA 3RN2A 1PYBA 2JJQA 2Q2UA 1PH2A 2IX1A 2LMCB 4RMFA 4YCUA 1ZYRD 4GKKQ 3KLSA 4LNQA 2KCNA 2K5QA 2RDHA 1VQDA 3I70A 2HT1A 1PTOC 1MD2D 4BY1G 2R92H 1WCMB 1Z47A 1C0AA 2F0PA 3DHQA 3T16A 1S72A 3MAQA 1JICA 1YEZA 1BF4A 4B3TQ 3M3YB 1UUPA 2VXWA 4MTNA 4A3JG 5C0XH 4XT1B 1HNXL 1Q3LA 2X69A 1A62A 1MJEA 2K04A 1W6JA 1X54A 3CAMA 4PV1C 1ICFB 4HTHA 4ZKBB 4JI5Q 1F9RA 3GTMB 1IL8A 2N88A 3CCUA 3M85A 3J81c 1UEBA 2KBNA 3ULLA 4K8IA 4DV1Q 2PQAA 4I7AA 4JG2A 4PNYA 1U5KA 5FJ8G 1AE2A 3CRKC 5KNBA 3AMUA 1C8CA 2NVYB 1NE3A 3K5MA 1VDZA 3EBEA 3NUCA 4YIJA 3RLOA 1XPRA 4JI7L 2LY7A 4X3SA 1AP0A 2AWOA 4DR1L 2B29A 2K01A 1NR4A 3GDEA 1HR0W 4LF4L 3HOVH 3RZOH 1XTDA 2B3GA 1LTAD 3CXCA 4BY7G 1YNJD 3HEJA 4P2CB 4X66L 3TEHB 1KAWA 4C3JB 1O7ZA 4A3KG 3HS0C 3SVMA 4WRDA 2A6HC 4C3HH 3T4AC 1H9MA 3BJUA 4LJZC 2KHJA 4OWTB 1Y1WH 2IPKD 2CKZB 3BZKA 2KENA 4IURA 1V43A 5JJIA 1YJWA 1S3OA 1TXYA 5M3FG 5EKLA 4RGOS 3CKIB 3JAMc 4A3DH 2RHSB 1MSHA 5CGKA 2A68D 3K58A 2E2HH 2DN8A 4DR4L 1L0XB 1CA5A 5C5MA 1R9TB 2J0TD 3OMGA 1EIGA 1EWIA 1VQMA 2R92B 3K7AH 4EVOA 3A56A 1OXSC 5M3MB 1Q82C 3MXNA 3R2TA 1IW7C 2VQEQ 5ELEA 1SDFA 2F3WA 3GTQH 2WINB 2K32A 3E5SA 4LUZA 3C1EA 3SK5A 1RHPA 3PUVA 1KHIA 3KF6A 2EY1A 5IT9c 1LTGD 1U4RA 5IODA 1SE4A 3TZUA 1CSQA 5J22A 2PQAB 1SE2A 2JA8B 4BBSG 4IPDA 3RZDB 5J39A 3TSSA 5L37A 2TSSA 2JEAI 5CMDA 4QJFA 3F2UA 3DUZA 5LL6S 1Y1VG 4RHSA 2GA4B 1SROA 5EJWA 1H9SB 3J80E 2PI2A 4IUUA 4JVZA 3S2DB 2KJXA 4ZRZA 1HXYD 5HURA 3HOWH 5C44G 4JI6Q 4DV0Q 3HKZB 4X64L 3URYA 3NBIA 2JA7G 3TQYA 1KQSA 3ICEA 3V05A 2EYJA 2YTXA 3LX0A 4UPAA 4OX9Q 1BBXC 2JA6B 2IJ0A 1ASZA 4DKAC 3RZOB 4DV4L 1JCKB 4BS9A 4KY6A 5NUCA 1S5BD 1LACA 4CDDC 1B3AA 3CRLC 4X65L 4NXML 3SDZA 3PO3G 4NP5A 1PTOF 4RH6A 2B8GA 1I6VC 3CD6A 4R4OA 3K5LA 2FHTA 1S5DD 3CCEA 1Y1WB 4L8JA 3NP8A 2QA4A 1TKWB 4A3IG 4C2MH 4DAYB 2NTSA 4G7ZC 3TDQA 4IPGA 1K83B 4I65A 3A8JE 1WD0A 1O78A 4R4IA 2MGSA 2Z6KC 5DNFA 4KV6A 2E2HB 1T5EA 3BYYB 3RLNA 1OXUA 1AE3A 3J7ZC 4GOPA 5EKIA 1N8RC 3BVMA 1SYBA 3K7AB 2A74C 2LFNA 1KABA 3E0EA 1VQ6A 4A3FH 5C3EH 3KF6B 3RUZA 5C4JB 2O4XA 3GTQB 1S5ED 3T1YQ 3S1RB 3HGBA 4A3EG 4A76A 4PZ8A 3S17H 5IP9G 4A3JH 2BDNA 2R6GA 1SLJA 3LNNA 3E0JA 3SGIA 3U4ZA 5IYDH 3J7YW 4DK3C 1IBKL 1F2LA 1BBUA 4RGNA 2NZ1D 1Y1WG 4FXGC 1X3EA 5M5WH 2VUMH 2HQLA 3G48A 3R8BA 1STGA 2XIWA 4B3TL 2KQ3A 3CQZH 4R4CA 5I9PA 3EQLC 2EXZA 4JI5L 3CU7A 3A8IE 4IUVA 1AFPA 4DV7Q 4HMIA 1EWHA 5CV9A 3CF5A 2OQ0A 1XX8A 2O5JC 2CWPA 2HDMA 2B2WC 3CP0A 4DUYQ 4DV1L 3PMFA 3QG1A 4IPHA 3QOLA 1YIJA 5J3BA 1PV4A 1KRSA 1OXVA 4DK1A 4LMQD 4CKCA 1I4HA 1C48A 1D1KA 1DGSA 3FKIB 2ZTEA 4F7XA 5EQ0A 2PMZE 4DN4M 4ZKCB 4QUCA 3Q23A 1WTOA 2PW7A 4X3KA 2ZT9C 4YCVA 3F2BA 1NTGA 1NMGA 2KCTA 1SNMA 4JI4Q 4DR7Q 1RIPA 4FF1A 1B44D 5CBAE 4A3KH 3HOYG 5ELFA 4A93G 2JEBI 2DJFC 3MFGA 1Y8OB 3A54A 2MO0A 4KKTA 1LO5D 1F9SA 1SNQA 1DYQA 2EJMA 3UE0A 5LMNQ 5IWAQ 1KTKA 5M3FH 1YHAA 3PGZA 5JPNC 3I4NG 4WJ4A 5FO9B 3NXWA 1EY6A 4C56C 3Q24A 2CQAA 3S14H 2F4VQ 1K28A 2Q8TA 4CHTB 4DF7A 1JE4A 2RA4A 3K8AA 4G57A 4A3FB 1ICWA 5C3EB 5JAVA 4MIUA 4WORA 2UXBQ 5JOBA 1BDOA 1DCZA 2IX3A 4QL5A 2JA5H 4K5VA 2EYMA 5G3LF 2NBFA 4DV6L 1VQ7A 2B8FA 3S17B 4A3JB 1A63A 1VQ8A 4C3IB 1HUNA 1KXLA 1STBA 3HFZB 1MGSA 2SNMA 4JI2L 1VF7A 3S1QH 2VQEL 1GUOA 3P20A 5GAGC 5M5WB 1CKOA 2VUMB 1KRTA 3E9IA 3PUZA 4C1NK 4RHRA 1I3QB 3TS0A 1Y1VH 4K5XA 1X3PA 1SJHD 2Y0SE 1SRUA 1PRTB 3D8GA 4NPSA 5I2YA 1B2TA 5FK9C 4RFBA 4DV3Q 4OO1G 2D9UA 1XNRQ 2PNHA 1YVCA 1HZ9A 1IBML 1PDQA 1FL0A 1TR5A 1Y8NB 3TP8A 1VQPA 2JA7H 1XPOA 4J1MA 3BDLA 1IYVA 1PRTC 2NVTH 2F0SA 2M2LA 5FLMH 2FJ2A 1B53A 4P75A 2F3VA 3BYTB 2WV6D 3S9WA 4JI6L 4DK0A 3NBHA 1H9RA 1ILQA 1K0SA 4IOCA 3NTKA 1HUMA 4R8NA 1G51A 3J80c 5IYCH 5CV5A 3H94A 5C4HA 3GTLH 1D5MC 1SAPA 3KBGA 2D5DA 1TWAH 2UXDL 2M00A 4A3IH 1GHJA 4JC0A 1K73C 4DGZA 4HJ5A 3LGJA 3EN2A 3EJIA 3S14B 2IW3A 2F0TA 1YZ6A 2YTYA 1KLUD 1GO3E 2ICEC 5M5YH 4JI7Q 4M8AA 2OQKA 1ZXTA 2NTTA 3Q0AA 2YYZA 1OO9B 1CM9A 4KHZA 4A3GG 4JI3L 3I4MH 4UP7A 3WOFA 3ONAB 3A5UA 5D3IB 4DR1Q 1HZBA 5HGQA 1QZGA 2RCNA 2JA5B 2AUJD 4MHEA 3U9SA 1JE5A 3PO2B 2VB3X 3R2IA 4FF4A 5IP9H 1X65A 1HTLD 3D6CA 1I50H 3R3OA 1ILPA 3B6YA 1VQ4A 1GOZA 4KKSA 4X66Q 2MHVA 4JI0L 1SFOH 4K2KA 4DUZL 2EE1A 4DAVA 2KHSA 2IHEA 4IO9A 1JB3A 1DOLA 4KLKA 2A73B 3FVQA 1WYDA 1ET9A 1RODA 3ERQA 1W2BA 3H09A 5A2QE 3HOYH 1FNWA 2OEOA 2FINB 2QKIC 4LFCL 4DR4Q 2AKWB 4A3BH 3CCQA 3M4YA 2K75A 2ICIA 4LFBL 2HD3A 1YNNC 3OOCA 3TBIB 4GZYC 3C46A 2NYZD 3K0XA 1LTRD 2CWAA 3DXJC 2NVTB 4RG1A 1VQ9A 2OXPA 3NBHB 1UE5A 1FGBD 1PH8A 3BS1A 2FXQA 1YHQA 2F0GA 2MFIA 4DUYL 5EKKA 1IZ6A 1SJED 5BN5A 1NSNS 2AWNA 2K05A 4HN7A 1VQAA 1PA6A 5DLQE 4A93H 2A5HA 1IKMA 2JE6I 4DR2L 4A3CG 1E1TA 2NVQH 2K5DA 4JBWA 1PYSB 4LF6Q 1TWAB 5JVH3 1U4PA 4XT3B 2F0WA 3I4NH 1K0RA 1TWFH 1TVXA 4DR7L 5IGEA 3G4SA 1I5FA 2C35B 3I90A 3MVVA 4HEDA 3R93A 5M5YB 5DM73 1MHWC 5IYBG 2WB1E 3Q22A 2PPBC 5FLXc 4QUFA 2RKSA 4P71A 5K5PA 4X64Q 1KD1C 1EY9A 2L11A 4FNFA 1BBWA 4WFN3 4Y7NH 1PH6A 2HHHL 3I4MB 4JYAL 3MFYA 1NBWA 1B8AA 3GD7A 4TSSA 5EPKA 4A3MB 4GKJL 1TIID 2AQ3B 4JV5L 1BXTA 3X3MA 4HSPA 2NVXH 4OO1I 4DV4Q 5KYLA 1IYUA 2Z8LA 1I50B 1RL2A 4LWCA 3SHLA 4AIMA 2YV5A 4X65Q 1SFOB 1TT2A 4NXMQ 1VCIA 2MUYA 4XYOA 2UXBL 1PRTF 3OYYA 3CCMA 4LF5Q 4AYBE 2OCEA 2B63H 1CZWA 3D31A 3S15H 3P7JA 1A3VA 1J5EL 1LTSD 5GAHC 2A69D 2MO1A 1X9NA 1UE7A 4OO1H 1Q86C 2IL8A 2WKDA 4A3BB 1HHVA 4K14A 1WVLA 2BE5D 5LMNW 1JJCB 2BH2A 5CC4A 4KK7A 3FDTA 3NWSA 3MXPA 4TKOB 1PTOB 3E9HA 3I8ZA 2E2IH 3S1MH 2N8NA 2UU9L 1PMRA 1NY4A 3WWVA 1SYGA 1SN8A 3AU7A 1XNQL 3AB9A 5HY6A 1XNRL 1E1OA 1N33Q 1KNAA 2B2UC 2ZXOA 2UUBQ 4JK1C 3PCOB 1PH5A 4HIMA 1SMYD 3E6ZX 4NB3A 1IBKQ 1LM0A 3KJPA 1K8OA 1XMQL 4X6AH 4GLXA 4G7HC 2NVQB 1T5XD 1A15A 4GN3B 3K5NA 2L1BA 2JP1A 2RHQB 4L5SA 2VW9A 1F77A 2KVMA 4AQYL 1AZQA 1WTQA 2G9DA 4DV5L 2VNUD 1E7ZA 1EEID 1PH7A 1TWFB 3I72A 3KLRA 4J8QA 4POGA 1GJXA 3RMHA 1V1OA 2AHOB 3GTJH 4PQXA 1LT5D 4N9PA 4RAUC 2A6EC 4JW0A 2L9HA 5JEAG 3H0GB 3HOXG 2FFKB 4Y7NB 3MEHA 4A3GH 4PMBA 2WAQB 2EY2A 2Y0SG 4KY5A 3V96A 4UHVA 3KDFA 4JI8L 1WI5A 3K7UC 2NVXB 1AN8A 2J4XA 3ND8A 1H9SA 2KHIA 2DUDA 1NNXA 4ODGA 5C3XA 1PH1A 1ZYRC 3OIPA 4IUTA 3MA2B 1N32L 1RDPD 1ASYA 1VQHA 1I4RA 3RD4A 2B63B 3S15B 1WTRA 4NXNL 2WKCA 2X6GA 2QILA 2VY3A 5KNCA 1BCPB 1RTOA 4KKUA 1AH9A 2Z6BA 3CC2A 1ESRA 3A55A 2I5LX 4ZK9B 1BQQT 3V2TA 4LF8L 1QOHA 3J7AV 1LT6D 2Z6KA 3G6JB 1VQFA 1K3BC 1L0YB 3MXUA 1I6HH 2DNEA 3GP7A 2QCPX 1D5ZC 2E2IB 1LLRD 5LL6X 1BCPC 2UXCL 2KA7A 4DR3L 3STBD 4DAYA 1ONLA 2DY8A 2R93G 5JJLA 3HOUG 4LK1C 3CHBD 4DV6Q 2WFWA 2F0NA 1PH3A 1E2VA 1Y8PB 2ZM6L 1QCBD 4JI2Q 2K33A 2E5LQ 1WTPA 2B2TC 4WJ3M 4JBJA 4FP5D 5CV4A 3K5OA 3L3OC 4V190 3QO2A 5G3LD 4XQJA 1VMCA 1L0WA 1VQNA 1U9RA 3SXHA 3CW2C 3DWPA 1GXDC 4BBRH 4LF6L 3HOZG 1SNOA 1HA5A 1PFSA 4GN4B 3VR5A 3KDFB 3UDIA 1IBMQ 3Q6SA 4DV2L 1UAPA 3C1FA 3W1BA 2B2WA 1GKHA 2PW5A 1XPUA 3IRBA 5FOBB 2BA0A 4LF9L 1DJRD 1ESFA 1EL0A 3M4PA 3QB3A 4K6DA 1QVCA 2A8VA 3F8TA 1PH4A 3HOVB 1PZID 4K0KL 1JQYD 2UXDQ 1VQJA 1AEXA 1JC7A 4RKBA 2XN9C 1CZGA 1D5XC 4XDXA 1P8LA 4KHPL 1QILA 3HKZE 5IGFA 2NWGA 4LF5L 4C3HB 4GNXA 4UY8C 4H02A 5I6WA 2F0QA 1VQIA 1IHZA 2K4KA 1XTCD 3S16H 4QCLA 1RTNA 3LWEA 1LTLA 1JR0D 2DJGC 1I6HB 5M5XH 2EPBA 4KI0A 4ALPA 4UP8A 5C4XG 4JI3Q 5BN3A 4A3DB 3DWQA 3U50C 4GN5A 3PIPA 1KAAA 4DAMA 3D4WA 2ZJPA 2ES2A 1O80A 2ZXRA 3Q8DA 4NDXA 1Q1BA 2WB1G 4DU9A 1EZ8A 4U673 4DR5L 1EU3A 3ZJYC 3K0YA 5KEEA 2F4IA 4BY1H 5H1SE 3W1GA 4JI0Q 2AUKA 1A6XA 1JMCA 5DEHA 4DUZQ 3KK7A 3NTHA 2CQOA 3T1HL 1KIXA 1N33L 2UUBL 5LMUL 2B2YC 5CV6A 2B2VC 1EYGA 2Z1CA 3LWUA 1Y14B 5CYUA 4EQ5A 1EQQA 5EBCA 3CMEA 4BBRB 4AYBG 2H1EA 3BZCA 4LFCQ 1MI2A 5M9OA 2RCFA 4FDBA 1D1IA 3HOXH 4LFBQ 4DFAA 2LSSA 1G291 1KNEA 2RSOA 1Z7TA 4OGQC 5FJ8H 4KMUC 1K3RA 1LT3D 3UDFA 2QDBA 1C7YA 3TREA 1HZAA 3M9BA 3MWYW 1EQTA 1LTBD 2L0CA 2XWBB 4DXFA 2MQHA 3NEMA 3HOWB 1E3PA 3PV0A 4DK6C 3J81i 2JXMB 2Q8IB 3A7LA 3D0FA 3L7ZC 4FXDA 5C5LA 2PI2E 4OWWB 2R7ZG 1BCPF 2EY5A 2XGTA 1TWGH 2QEJC 4DR2Q 2K1BA 3GQBA 2E74C 4ZQ3A 1X55A 1PHJA 5IGCA 4BY7H 2KCMA 4IFDG 4GNXB 4QMGA 1KDBA 4O42A 4OEMB 2K5VA 5GADC 3S16B 1X56A 3OWEB 5I6YA 4RGMA 1I94L 1B4OA 4C2MB 3NE5B 4YWKA 3EIVA 2HHHQ 4JYAQ 1VMPA 3OW7A 1EY4A 4GNXC 5AJ3L 2Z4IA 3AEVA 4GKJQ 1DOKA 1CKMA 2RVLA 1KDAA 4JV5Q 4TQUS 1PFMA 1XXGA 3C2PA 3H6MA 5IY0A 1QVGA 2R93H 3CCVA 3U4VA 3VA5A 3A74A 3HP3A 3HZXA 2ASBA 3M4QA 1B1ZA 2Z0SA 1WCMG 4B3ML 1A0IA 1NCVA 2R3ZA 5GQOA 3J81L 4BY1B 4B9XA 1TWCH 2CVRA 1LTTD 5KGUA 2BDOA 3ND9A 2F1MA 4JOIC 3JAMi 4CKEA 4FXKC 1J5EQ 3KJOA 2D0PA 1N34L 3GTGH 5T1GA 2E5LL 2I46A 3H91A 5EBDA 2BOSA 4BBSH 4PZ6A 4JI1Q 2E2JH 2UUAQ 2AMCB 4C1NI 3RNUA 3CQZB 5D3DA 2DNCA 2JSOA 1VQKA 1CA6A 4ULLA 3I2ZA 2I07B 5IE8A 2UU9Q 2EQSA 2GVAA 4YY3L 4QIWB 1DM0B 3K80C 1HH2P 2D0OA 2QGQA 1XNQQ 3DMUA 1QE6A 5C44H 1BNZA 2QF7A 3BU2A 5IP7G 2D62A 2E2DC 1SSOA 5ELOA 3M4OH 3D6WA 1BO0A 1XMQQ 4H13C 4RA8A 3G71A 1KDCA 2XRSD 3VR4A 1EIYB 1LUZA 4AQYQ 3L9AX 4BY7B 1PZKD 4C3JG 3JAML 1YI2A 3SR1A 4I7ZC 3D3RA 4DV5Q 1CQVA 4EQOA 4IPCA 3PIOA 4A3KB 4JBKA 4KD3A 2ALYB 2Z4HA 3PO3H 2XVSA 1SYCA 4BWGB 1FVIA 1TY0A 2B39A 1WJJA 1IYJB 1K8MA 1TS3A 5HGTA 1I4QA 5M3FB 1QB5D 3RN5A 2A1AA 1D7QA 1CI3M 1GD7A 1Q12A 3KF8A 4UDUC 4V0BA 5ELNA 4JI8Q 3EVQA 1D2BA 5IT9L 3A8KE 3DEPA 3TMEA 2K7VA 2R92G 5M3MG 1N32Q 1EQRA 1K9MC 1TWCB 3I56A 5IGGA 5C0XG 3MHBA 1JOQA 1VS0A 2FMCA 5D65A 4A3EH 3QWNA 1WTVA 4NXNQ 2EIFA 1JORA 3GTGB 2F0DA 1M8AA 2JA8G 5E4WC 1EIFA 1VQ5A 3S1QB 4MN3A 1YNXA 1QWYA 1W6KA 3S1NH 4BBSB 3BG3A 1G2TA 3TZDA 3WDNA 1M90C 4LF8Q 1NUCA 1HNZL 1Y1VB 1SE8A 3AQQA 4HMJA 1O7LA 5E1FA 4IFDI 1OTCA 2A19A 2KEEA 2UXCQ 4DR3Q 2K28A 4Q5VA 2ATWA 1ET6A 2F0UA 3HKZG 2Q2IA 4IUPA 3AFPA 1UE1A 5C44B 2OWOA 1BUVT 1FNUA 3BVGA 3UDGA 2QW7A 1STHA 2RF4A 2ZM6Q 2JA7B 2CH4A 1HZCA 4AH6A 2JA6G 1V9PA 2B2UA 4XXEA 3NK9A 4B08A 4HIKA 1V1QA 4HJ7A 2XTIA 3N6RA 4G4KA 2SEBD 2WIIB 3FPUB 1EFWA 4UAIA 5E3FA 3PO3B 1J6QA 1IKLA 5CR3A
chains in the Genus database with same CATH topology
3CCEA 1VQLA 3A0JA 2QA4A 4A3IG 4C2MH 2KHIA 2DUDA 4DAYB 3KF8B 1PH1A 1VQGA 4LF7L 4IPGA 1P16A 3L2PA 4DV2Q 1N32L 1ASYA 1VQHA 3FHWA 4R4IA 1X3GA 2Z6KC 3CPFA 2B63G 3K81C 3I7FA 1OXUA 3RLNA 4NXNL 1AE3A 2VL6A 3S24A 3J7ZC 4GOPA 1N8RC 4GLAC 1C9OA 4QY7A 3ER0A 4LF9Q 1Q1EA 2VY3A 1M1KC 1VQ6A 3E0EA 5JEAJ 4A3FH 5C3EH 3UE1A 2I5MX 4QIWE 3KF6B 3CC2A 1AH9A 1XMOQ 1IBLQ 3T1YQ 2I5LX 4X62Q 3M3YH 4A3EG 1YHBA 1QUQB 4LF8L 4XTCS 4A76A 4LUOA 2Z6KA 4PZ8A 3S17H 5IP9G 1VQFA 4A3JH 2R6GA 3SGIA 1SLJA 3U4ZA 4K0KQ 5IYDH 1I6HH 4DK3C 1N36L 1IBKL 1W3SA 1BBUA 4IOAA 2UXCL 4DR3L 4L5QA 3STBD 5C4XH 4KHPQ 1X3EA 1HR0Q 5M5WH 2VUMH 3GTKH 2HQLA 2BA1A 4DV0L 3G48A 2R93G 3HOUG 5JJLA 1GM5A 1HNXQ 2R7FA 4B3TL 4DV6Q 2WFWA 1PH3A 2ZTCA 3CQZH 2NVYH 3I4OA 3U58A 1OXXK 1B70B 4R4CA 4HJ8A 2ZM6L 4JI2Q 3RLFA 4OX9L 4JI5L 1QVFA 2E5LQ 1E24A 1VQEA 4WJ3M 4DV7Q 4JBJA 3CF5A 2OQ0A 3NELA 2CWPA 3KFUA 1N9WA 2JA9A 3OTOL 1SMXA 3CP0A 4DUYQ 1Q81C 4DV1L 4JI1L 2VQFQ 4IPHA 2UUAL 1YIJA 5J3BA 1PV4A 1KRSA 1OXVA 4DR5Q 2NN6G 3J81j 3FKIG 1L0WA 1DGSA 2K50A 1VQNA 2YU9H 2E8GA 3CW2C 2ZTEA 4EX5A 2NZHA 4L5TA 4BBRH 3PUXA 4LF6L 2ID0A 3HOZG 2PMZE 1PFSA 4GN4B 3KDFB 3UDIA 2JK8A 4DV2L 3T1HQ 2QEXA 4C3JH 1IBMQ 4YCVA 3F2BA 1NTGA 4P72A 1NMGA 2KCTA 5LMUQ 4JI4Q 4A3MH 4DR7Q 4A4IA 1RIPA 3W1BA 4A3KH 3HOYG 4A3LG 2Q2HA 1Q46A 4DPGA 2JQOA 4A93G 1GKHA 4LF4Q 1VQCA 4L5RC 2JEBI 3J7A5 1XPUA 1MKHA 3IRBA 4JCVE 3OW2A 1CUKA 2K52A 2MO0A 3UE0A 5LMNQ 2BA0A 4LF9L 5IWAQ 1VQBA 3M4PA 1Z9FA 1YHAA 3PGZA 5M3FH 1JJGA 2ZTDA 3I4NG 4WJ4A 1QVCA 1XMOL 1IBLL 3T1YL 1MIUA 2A8VA 3S14H 2CCZA 1GVPA 4BA2I 2F4VQ 2K5HA 2R7ZH 5BR8Q 3HOVG 4MNOA 3F8TA 1PH4A 1R9TH 1QZHA 3TS2A 1X6OA 4K0KL 3M7NA 2IHFA 1VQJA 2UXDQ 4A3FG 5M3MH 3K8AA 3J80i 5C3EG 3G6EA 5E7NA 3AFQA 2UXBQ 1KL9A 3CCSA 4OXPA 1P8LA 4KHPL 4QL5A 2JA5H 1HR0L 1YJ9A 3HKZE 3AYHB 4ME3A 4LF5L 1IL2A 4GNXA 4UY8C 4DV6L 1VQ7A 5IYDG 4H02A 1FGUA 2K5NA 2YTVA 4APVA 1K8GA 1VQIA 2K4KA 2IT1A 3S16H 1VQ8A 1A63A 1KXLA 1LTLA 3HFZB 5M5XH 2MNAA 3W5OA 4JI2L 4KI0A 4ALPA 2K14A 4A3DG 2GN5A 4UP8A 5C4XG 2EXDA 4JI3Q 2JA8H 3S1QH 4DV7L 2VQEL 3RZDH 2VUMG 4DR6Q 2ZJQA 3U50C 5GAGC 4GN5A 1CKOA 2F52A 4IJHA 3PIPA 1KRTA 3E9IA 3PUZA 4DAMA 4BXXG 2ZJPA 3MEFA 2N3SA 2WAQE 2ES2A 3Q8DA 2VQFL 3TS0A 4OONA 1Q1BA 2WB1G 1Y1VH 1NMFA 3PSIA 1I94Q 4DR5L 2Y0SE 2DGYA 1SRUA 3ZJYC 2N49A 4NPSA 3S2DH 1WCMH 3F2DA 4BY1H 4DV3Q 4OO1G 5H1SE 3W1GA 4JI0Q 5AJ3Q 4LFAQ 3CCRA 1XNRQ 2LXJA 4B3RQ 2PNHA 1JMCA 1YVCA 1A8VA 4DUZQ 1HZ9A 2CQOA 3T1HL 1IBML 4R4TA 1KIXA 1N33L 2UUBL 5LMUL 1FL0A 1VQPA 4JI4L 4O2DA 1NJIC 2OTLA 2JA7H 1XPOA 1UWVA 4B3MQ 1JT8A 1EYGA 2IX0A 2JA6H 2NVTH 3PUWA 3GTMH 3CC7A 1Y14B 2F3IA 4BBRG 4EQ5A 1EQQA 3CC4A 3H15A 1HNWQ 3CMEA 5FLMH 4AYBG 3BZCA 3H0GH 4P75A 5GROA 4TVAB 2BH8A 5LMNL 4FDBA 4HIDA 4LFCQ 1G6PA 4JI6L 3HOXH 5IWAL 4LFBQ 1L1OB 4R1JA 2LSSA 1G291 5FJ8H 3NENA 1K3RA 3ULPA 4IOCA 3UDFA 1N34Q 3ERSX 3GTOH 2F4VL 1C7YA 4P73A 3TREA 1G51A 1HZAA 3L0OA 5IYCH 3J80c 4UP9A 3M9BA 5BR8L 4QGUA 3F1ZA 4HJ9A 3GTLH 3HOWG 2MQHA 1TWHH 3NEMA 3DLLA 1E3PA 4YWMA 1TWAH 4A3CH 2UXDL 4A3IH 1WOCA 1K83H 3PV0A 4JC0A 1K73C 4DK6C 2VZAA 3J81i 4B3SQ 1FJGQ 1L1OC 3GTPH 4HJ5A 3LGJA 3EN2A 5IP7H 3D0FA 1VQOA 4YHHQ 3L7ZC 3KOJA 2PI2E 4R4QA 1U0LA 1WFQA 1YZ6A 4OWWB 2R7ZG 3UDXA 2YTYA 2XGTA 1GO3E 1TWGH 5M5YH 4DR2Q 4YY3Q 4JI7Q 2OQKA 5IYBH 2YYZA 1X55A 4KHZA 4LUVA 1PHJA 4A3GG 4BY7H 2KCMA 4IFDG 4POFA 3S2HH 4JI3L 4GNXB 3I4MH 2JA5G 2NZOA 5C4JH 3VDYA 4UP7A 3A5UA 4DR6L 4DR1Q 1HZBA 5HGQA 1QZGA 2RCNA 3S1RH 2IY5B 1H95A 3STBC 3PO2G 1HJPA 1IXRA 1L1OA 1JE5A 1KC8C 2K5VA 2UUCQ 1EOVA 5GADC 1X56A 5IP9H 1X65A 2HIVA 4IJLA 1I94L 1SR3A 3A5ZB 1I50H 4YWKA 3EIVA 5C0XI 3B6YA 1VQ4A 2HHHQ 4X66Q 4JYAQ 1B7YB 3H3VI 4DV3L 1K8AC 2ZJRA 1SFOH 4GNXC 4JI0L 5AJ3L 4XIGS 3AEVA 3ULJA 4LFAL 4GKJQ 2NN6I 1CKMA 4LW1A 4JV5Q 2VS1A 2L15A 4TQUS 4PMWA 4X62L 4HIOA 4DUZL 3RN2A 5IY0A 1QVGA 1PYBA 2JJQA 3CCVA 3JC66 2Q2UA 2R93H 3KLWA 3U4VA 1PH2A 2IX1A 2IHEA 4IO9A 1T9HA 4RMFA 3A74A 4O0AA 4YCUA 1PVOA 4KLKA 4LNQA 2ASBA 4GKKQ 3M4QA 1WYDA 1WCMG 1VQDA 2Z0SA 2HT1A 4B3ML 4BY1G 3DM3A 1A0IA 1W2BA 2R92H 3FP9A 1Z47A 5GQOA 1C0AA 2I5HA 3HOYH 1HNWL 1S72A 1TWCH 4IFDJ 4GLVB 4DR4Q 4LFCL 2AKWB 4A3BH 1YEZA 4B3TQ 2LXKA 3CCQA 3PUYA 4JOIC 2K75A 3JAMi 4MTNA 4LFBL 1D8LA 4GS3A 4A3JG 1HNXL 1A62A 1MJEA 1J5EQ 4Y52H 3H3VH 1X54A 3CAMA 3KJOA 2D0PA 3K0XA 1N34L 4JI5Q 2CWAA 3GTGH 4RG1A 1VQ9A 3FKIH 3NBHB 5FLMG 3M85A 1UE5A 1UEBA 3J81c 3CCUA 2E5LL 2KBNA 1XJVA 3F2CA 1PH8A 4BBSH 3ULLA 4PZ6A 2FXQA 4DV1Q 4JI1Q 1YHQA 2PQAA 2E2JH 2UUAQ 4JG2A 3HKSA 1U5KA 2MFIA 5FJ8G 2AMCB 4DUYL 1AE2A 1IZ6A 3RNUA 3PF5A 4B3SL 4P74A 1NE3A 2AWNA 1VQAA 5IYCG 1PA6A 4JOIA 4A75A 1VQKA 3EBEA 5DLQE 4A3LH 3I2ZA 4A93H 5IE8A 2JE6I 2UU9Q 4DR2L 2EQSA 1CKNA 1E1TA 2GVAA 3RLOA 4JBWA 4YY3L 1XPRA 1PYSB 4JI7L 3K80C 4LF6Q 1HH2P 2D0OA 2QGQA 1XNQQ 2Q2TA 5C44H 4MZ9A 1JJ2A 2CFMA 3BU2A 5IP7G 2D62A 1E22A 2AWOA 2WP8J 1HNZQ 4BA1I 3I4NH 1K0RA 1TWFH 2B29A 5ELOA 4DR1L 4DR7L 3M4OH 3GDEA 3GO5A 3G4SA 1HR0W 1XMQQ 3MXNB 1I5FA 2C35B 4LF4L 3G71A 2UUCL 3HOVH 5IYBG 1XTDA 3RZOH 2B3GA 2WB1E 3CXCA 1EIYB 5FLXc 4BY7G 1LUZA 4AQYQ 4P71A 4X64Q 1KD1C 2GVBA 3I4MG 1BBWA 4Y7NH 1YI2A 4OWXB 1PH6A 2HHHL 4X66L 3TEHB 1KAWA 4DV5Q 4JYAL 4A3MG 2V1CC 1NBWA 1B8AA 3GD7A 4IPCA 4YWLA 4A3KG 1YJNA 4PZ7A 1Q7YC 4GKJL 3PIOA 1MJCA 4JBKA 4JV5L 1S40A 2ALYB 3PO3H 4C3HH 3BJUA 4OO1I 2N78A 2NVXH 2KHJA 2R7DA 5K36G 4DV4Q 1FVIA 4OWTB 1Y1WH 5JJKA 1WJJA 2CKZB 3BZKA 2KENA 4C3IH 4GKKL 1V43A 5JJIA 1IYJB 1RL2A 4LWCA 1YJWA 4AIMA 1S3OA 1TXYA 5M3FG 5GAEC 2YV5A 3JAMc 4A3DH 4X65Q 3RN5A 2RHSB 2A1AA 4NXMQ 1D7QA 1VCIA 2UXBL 1GD7A 1Q12A 3OYYA 3CCMA 5ELNA 4AYBE 2E2HH 4LF5Q 4JI8Q 4DR4L 2OCEA 1I3QH 4J15A 2B63H 3D31A 3S15H 4BXXH 4DNIA 1J5EL 2R92G 1EWIA 5M3MG 1VQMA 3K7AH 5GAHC 4LF7Q 1OXSC 1UE6A 1Q82C 1O7IA 2MO1A 4HJAA 1UE7A 1X9NA 1PH9A 1N32Q 2VQEQ 1EQRA 1K9MC 4JBMA 3I56A 1Q86C 4A3BG 3GTQH 4LUZA 1CSPA 5C0XG 3PUVA 5LMNW 1VS0A 1JJCB 1KHIA 1L2FA 1YBYA 3KF6A 5IT9c 4A3EH 4NXNQ 2BH2A 3CCJA 2OTJA 2EIFA 3CCLA 1QUQA 3E9HA 3I55A 1CSQA 5EAYA 2E2IH 2JA8G 2N8NA 3S1MH 2PQAB 3WWVA 1NY4A 2UU9L 1EIFA 1VQ5A 4PG3A 4BBSG 4IPDA 3S1NH 1SN8A 1YNXA 2HIXA 2JEAI 1JB7A 4QJFA 1XNQL 5HY6A 1XNRL 1E1OA 1N33Q 1Q8KA 1YITA 1M90C 4LF8Q 4B3RL 2UUBQ 1Y1VG 3HOUH 3PCOB 1PH5A 1HNZL 1CKNB 1SROA 3PF4A 2PI2A 4HIMA 1SE8A 2I0QA 3RR5A 1N36Q 3AQQA 4NB3A 1IBKQ 1LM0A 3KJPA 4IFDI 4A3CG 1OTCA 2A19A 1XMQL 2UXCQ 4GLXA 4YCWA 2NVQH 4DR3Q 4X6AH 4GN3B 3HOWH 2ATWA 2RHQB 2H5XA 5C44G 3KYHC 2VW9A 3HKZG 4L5SA 1OXTA 2VNUD 2Q2IA 4JI6Q 4DV0Q 3AFPA 1UE1A 4X64L 4AQYL 4QQBX 2OWOA 3UDGA 4DV5L 3TRZA 3CPWA 1LYLA 5C0XJ 3TQYA 1E7ZA 4GOPB 1PH7A 1KQSA 2JA7G 3ICEA 2RF4A 2ZM6Q 1HZCA 1BVSA 2YTXA 4UPAA 1X3FA 4AH6A 1V9PA 4OX9Q 3CMAA 2JA6G 4POGA 2AHOB 1ASZA 4DKAC 3GTJH 4HIKA 1V1QA 4DV4L 4HJ7A 1EUJA 3H0GG 5JEAG 2XTIA 3HOXG 3OTOQ 2WAQG 4A3GH 3HOZH 1FJGL 1BKBA 4X65L 4NXML 3PO3G 2Y0SG 4GOPC 1EFWA 4YHHL 3KDFA 4JI8L 1J6QA 1WI5A 3K7UC 4R4OA 3CD6A 1Y1WG 3PO2H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCE A;  1VQL A;  3A0J A;  2QA4 A;  4A3I G;  4C2M H;  2KHI A;  2DUD A;  4DAY B;  3KF8 B;  1PH1 A;  1VQG A;  4LF7 L;  4IPG A;  1P16 A;  3L2P A;  4DV2 Q;  1N32 L;  1ASY A;  1VQH A;  3FHW A;  4R4I A;  1X3G A;  2Z6K C;  3CPF A;  2B63 G;  3K81 C;  3I7F A;  1OXU A;  3RLN A;  4NXN L;  1AE3 A;  2VL6 A;  3S24 A;  3J7Z C;  4GOP A;  1N8R C;  4GLA C;  1C9O A;  4QY7 A;  3ER0 A;  4LF9 Q;  1Q1E A;  2VY3 A;  1M1K C;  1VQ6 A;  3E0E A;  5JEA J;  4A3F H;  5C3E H;  3UE1 A;  2I5M X;  4QIW E;  3KF6 B;  3CC2 A;  1AH9 A;  1XMO Q;  1IBL Q;  3T1Y Q;  2I5L X;  4X62 Q;  3M3Y H;  4A3E G;  1YHB A;  1QUQ B;  4LF8 L;  4XTC S;  4A76 A;  4LUO A;  2Z6K A;  4PZ8 A;  3S17 H;  5IP9 G;  1VQF A;  4A3J H;  2R6G A;  3SGI A;  1SLJ A;  3U4Z A;  4K0K Q;  5IYD H;  1I6H H;  4DK3 C;  1N36 L;  1IBK L;  1W3S A;  1BBU A;  4IOA A;  2UXC L;  4DR3 L;  4L5Q A;  3STB D;  5C4X H;  4KHP Q;  1X3E A;  1HR0 Q;  5M5W H;  2VUM H;  3GTK H;  2HQL A;  2BA1 A;  4DV0 L;  3G48 A;  2R93 G;  3HOU G;  5JJL A;  1GM5 A;  1HNX Q;  2R7F A;  4B3T L;  4DV6 Q;  2WFW A;  1PH3 A;  2ZTC A;  3CQZ H;  2NVY H;  3I4O A;  3U58 A;  1OXX K;  1B70 B;  4R4C A;  4HJ8 A;  2ZM6 L;  4JI2 Q;  3RLF A;  4OX9 L;  4JI5 L;  1QVF A;  2E5L Q;  1E24 A;  1VQE A;  4WJ3 M;  4DV7 Q;  4JBJ A;  3CF5 A;  2OQ0 A;  3NEL A;  2CWP A;  3KFU A;  1N9W A;  2JA9 A;  3OTO L;  1SMX A;  3CP0 A;  4DUY Q;  1Q81 C;  4DV1 L;  4JI1 L;  2VQF Q;  4IPH A;  2UUA L;  1YIJ A;  5J3B A;  1PV4 A;  1KRS A;  1OXV A;  4DR5 Q;  2NN6 G;  3J81 j;  3FKI G;  1L0W A;  1DGS A;  2K50 A;  1VQN A;  2YU9 H;  2E8G A;  3CW2 C;  2ZTE A;  4EX5 A;  2NZH A;  4L5T A;  4BBR H;  3PUX A;  4LF6 L;  2ID0 A;  3HOZ G;  2PMZ E;  1PFS A;  4GN4 B;  3KDF B;  3UDI A;  2JK8 A;  4DV2 L;  3T1H Q;  2QEX A;  4C3J H;  1IBM Q;  4YCV A;  3F2B A;  1NTG A;  4P72 A;  1NMG A;  2KCT A;  5LMU Q;  4JI4 Q;  4A3M H;  4DR7 Q;  4A4I A;  1RIP A;  3W1B A;  4A3K H;  3HOY G;  4A3L G;  2Q2H A;  1Q46 A;  4DPG A;  2JQO A;  4A93 G;  1GKH A;  4LF4 Q;  1VQC A;  4L5R C;  2JEB I;  3J7A 5;  1XPU A;  1MKH A;  3IRB A;  4JCV E;  3OW2 A;  1CUK A;  2K52 A;  2MO0 A;  3UE0 A;  5LMN Q;  2BA0 A;  4LF9 L;  5IWA Q;  1VQB A;  3M4P A;  1Z9F A;  1YHA A;  3PGZ A;  5M3F H;  1JJG A;  2ZTD A;  3I4N G;  4WJ4 A;  1QVC A;  1XMO L;  1IBL L;  3T1Y L;  1MIU A;  2A8V A;  3S14 H;  2CCZ A;  1GVP A;  4BA2 I;  2F4V Q;  2K5H A;  2R7Z H;  5BR8 Q;  3HOV G;  4MNO A;  3F8T A;  1PH4 A;  1R9T H;  1QZH A;  3TS2 A;  1X6O A;  4K0K L;  3M7N A;  2IHF A;  1VQJ A;  2UXD Q;  4A3F G;  5M3M H;  3K8A A;  3J80 i;  5C3E G;  3G6E A;  5E7N A;  3AFQ A;  2UXB Q;  1KL9 A;  3CCS A;  4OXP A;  1P8L A;  4KHP L;  4QL5 A;  2JA5 H;  1HR0 L;  1YJ9 A;  3HKZ E;  3AYH B;  4ME3 A;  4LF5 L;  1IL2 A;  4GNX A;  4UY8 C;  4DV6 L;  1VQ7 A;  5IYD G;  4H02 A;  1FGU A;  2K5N A;  2YTV A;  4APV A;  1K8G A;  1VQI A;  2K4K A;  2IT1 A;  3S16 H;  1VQ8 A;  1A63 A;  1KXL A;  1LTL A;  3HFZ B;  5M5X H;  2MNA A;  3W5O A;  4JI2 L;  4KI0 A;  4ALP A;  2K14 A;  4A3D G;  2GN5 A;  4UP8 A;  5C4X G;  2EXD A;  4JI3 Q;  2JA8 H;  3S1Q H;  4DV7 L;  2VQE L;  3RZD H;  2VUM G;  4DR6 Q;  2ZJQ A;  3U50 C;  5GAG C;  4GN5 A;  1CKO A;  2F52 A;  4IJH A;  3PIP A;  1KRT A;  3E9I A;  3PUZ A;  4DAM A;  4BXX G;  2ZJP A;  3MEF A;  2N3S A;  2WAQ E;  2ES2 A;  3Q8D A;  2VQF L;  3TS0 A;  4OON A;  1Q1B A;  2WB1 G;  1Y1V H;  1NMF A;  3PSI A;  1I94 Q;  4DR5 L;  2Y0S E;  2DGY A;  1SRU A;  3ZJY C;  2N49 A;  4NPS A;  3S2D H;  1WCM H;  3F2D A;  4BY1 H;  4DV3 Q;  4OO1 G;  5H1S E;  3W1G A;  4JI0 Q;  5AJ3 Q;  4LFA Q;  3CCR A;  1XNR Q;  2LXJ A;  4B3R Q;  2PNH A;  1JMC A;  1YVC A;  1A8V A;  4DUZ Q;  1HZ9 A;  2CQO A;  3T1H L;  1IBM L;  4R4T A;  1KIX A;  1N33 L;  2UUB L;  5LMU L;  1FL0 A;  1VQP A;  4JI4 L;  4O2D A;  1NJI C;  2OTL A;  2JA7 H;  1XPO A;  1UWV A;  4B3M Q;  1JT8 A;  1EYG A;  2IX0 A;  2JA6 H;  2NVT H;  3PUW A;  3GTM H;  3CC7 A;  1Y14 B;  2F3I A;  4BBR G;  4EQ5 A;  1EQQ A;  3CC4 A;  3H15 A;  1HNW Q;  3CME A;  5FLM H;  4AYB G;  3BZC A;  3H0G H;  4P75 A;  5GRO A;  4TVA B;  2BH8 A;  5LMN L;  4FDB A;  4HID A;  4LFC Q;  1G6P A;  4JI6 L;  3HOX H;  5IWA L;  4LFB Q;  1L1O B;  4R1J A;  2LSS A;  1G29 1;  5FJ8 H;  3NEN A;  1K3R A;  3ULP A;  4IOC A;  3UDF A;  1N34 Q;  3ERS X;  3GTO H;  2F4V L;  1C7Y A;  4P73 A;  3TRE A;  1G51 A;  1HZA A;  3L0O A;  5IYC H;  3J80 c;  4UP9 A;  3M9B A;  5BR8 L;  4QGU A;  3F1Z A;  4HJ9 A;  3GTL H;  3HOW G;  2MQH A;  1TWH H;  3NEM A;  3DLL A;  1E3P A;  4YWM A;  1TWA H;  4A3C H;  2UXD L;  4A3I H;  1WOC A;  1K83 H;  3PV0 A;  4JC0 A;  1K73 C;  4DK6 C;  2VZA A;  3J81 i;  4B3S Q;  1FJG Q;  1L1O C;  3GTP H;  4HJ5 A;  3LGJ A;  3EN2 A;  5IP7 H;  3D0F A;  1VQO A;  4YHH Q;  3L7Z C;  3KOJ A;  2PI2 E;  4R4Q A;  1U0L A;  1WFQ A;  1YZ6 A;  4OWW B;  2R7Z G;  3UDX A;  2YTY A;  2XGT A;  1GO3 E;  1TWG H;  5M5Y H;  4DR2 Q;  4YY3 Q;  4JI7 Q;  2OQK A;  5IYB H;  2YYZ A;  1X55 A;  4KHZ A;  4LUV A;  1PHJ A;  4A3G G;  4BY7 H;  2KCM A;  4IFD G;  4POF A;  3S2H H;  4JI3 L;  4GNX B;  3I4M H;  2JA5 G;  2NZO A;  5C4J H;  3VDY A;  4UP7 A;  3A5U A;  4DR6 L;  4DR1 Q;  1HZB A;  5HGQ A;  1QZG A;  2RCN A;  3S1R H;  2IY5 B;  1H95 A;  3STB C;  3PO2 G;  1HJP A;  1IXR A;  1L1O A;  1JE5 A;  1KC8 C;  2K5V A;  2UUC Q;  1EOV A;  5GAD C;  1X56 A;  5IP9 H;  1X65 A;  2HIV A;  4IJL A;  1I94 L;  1SR3 A;  3A5Z B;  1I50 H;  4YWK A;  3EIV A;  5C0X I;  3B6Y A;  1VQ4 A;  2HHH Q;  4X66 Q;  4JYA Q;  1B7Y B;  3H3V I;  4DV3 L;  1K8A C;  2ZJR A;  1SFO H;  4GNX C;  4JI0 L;  5AJ3 L;  4XIG S;  3AEV A;  3ULJ A;  4LFA L;  4GKJ Q;  2NN6 I;  1CKM A;  4LW1 A;  4JV5 Q;  2VS1 A;  2L15 A;  4TQU S;  4PMW A;  4X62 L;  4HIO A;  4DUZ L;  3RN2 A;  5IY0 A;  1QVG A;  1PYB A;  2JJQ A;  3CCV A;  3JC6 6;  2Q2U A;  2R93 H;  3KLW A;  3U4V A;  1PH2 A;  2IX1 A;  2IHE A;  4IO9 A;  1T9H A;  4RMF A;  3A74 A;  4O0A A;  4YCU A;  1PVO A;  4KLK A;  4LNQ A;  2ASB A;  4GKK Q;  3M4Q A;  1WYD A;  1WCM G;  1VQD A;  2Z0S A;  2HT1 A;  4B3M L;  4BY1 G;  3DM3 A;  1A0I A;  1W2B A;  2R92 H;  3FP9 A;  1Z47 A;  5GQO A;  1C0A A;  2I5H A;  3HOY H;  1HNW L;  1S72 A;  1TWC H;  4IFD J;  4GLV B;  4DR4 Q;  4LFC L;  2AKW B;  4A3B H;  1YEZ A;  4B3T Q;  2LXK A;  3CCQ A;  3PUY A;  4JOI C;  2K75 A;  3JAM i;  4MTN A;  4LFB L;  1D8L A;  4GS3 A;  4A3J G;  1HNX L;  1A62 A;  1MJE A;  1J5E Q;  4Y52 H;  3H3V H;  1X54 A;  3CAM A;  3KJO A;  2D0P A;  3K0X A;  1N34 L;  4JI5 Q;  2CWA A;  3GTG H;  4RG1 A;  1VQ9 A;  3FKI H;  3NBH B;  5FLM G;  3M85 A;  1UE5 A;  1UEB A;  3J81 c;  3CCU A;  2E5L L;  2KBN A;  1XJV A;  3F2C A;  1PH8 A;  4BBS H;  3ULL A;  4PZ6 A;  2FXQ A;  4DV1 Q;  4JI1 Q;  1YHQ A;  2PQA A;  2E2J H;  2UUA Q;  4JG2 A;  3HKS A;  1U5K A;  2MFI A;  5FJ8 G;  2AMC B;  4DUY L;  1AE2 A;  1IZ6 A;  3RNU A;  3PF5 A;  4B3S L;  4P74 A;  1NE3 A;  2AWN A;  1VQA A;  5IYC G;  1PA6 A;  4JOI A;  4A75 A;  1VQK A;  3EBE A;  5DLQ E;  4A3L H;  3I2Z A;  4A93 H;  5IE8 A;  2JE6 I;  2UU9 Q;  4DR2 L;  2EQS A;  1CKN A;  1E1T A;  2GVA A;  3RLO A;  4JBW A;  4YY3 L;  1XPR A;  1PYS B;  4JI7 L;  3K80 C;  4LF6 Q;  1HH2 P;  2D0O A;  2QGQ A;  1XNQ Q;  2Q2T A;  5C44 H;  4MZ9 A;  1JJ2 A;  2CFM A;  3BU2 A;  5IP7 G;  2D62 A;  1E22 A;  2AWO A;  2WP8 J;  1HNZ Q;  4BA1 I;  3I4N H;  1K0R A;  1TWF H;  2B29 A;  5ELO A;  4DR1 L;  4DR7 L;  3M4O H;  3GDE A;  3GO5 A;  3G4S A;  1HR0 W;  1XMQ Q;  3MXN B;  1I5F A;  2C35 B;  4LF4 L;  3G71 A;  2UUC L;  3HOV H;  5IYB G;  1XTD A;  3RZO H;  2B3G A;  2WB1 E;  3CXC A;  1EIY B;  5FLX c;  4BY7 G;  1LUZ A;  4AQY Q;  4P71 A;  4X64 Q;  1KD1 C;  2GVB A;  3I4M G;  1BBW A;  4Y7N H;  1YI2 A;  4OWX B;  1PH6 A;  2HHH L;  4X66 L;  3TEH B;  1KAW A;  4DV5 Q;  4JYA L;  4A3M G;  2V1C C;  1NBW A;  1B8A A;  3GD7 A;  4IPC A;  4YWL A;  4A3K G;  1YJN A;  4PZ7 A;  1Q7Y C;  4GKJ L;  3PIO A;  1MJC A;  4JBK A;  4JV5 L;  1S40 A;  2ALY B;  3PO3 H;  4C3H H;  3BJU A;  4OO1 I;  2N78 A;  2NVX H;  2KHJ A;  2R7D A;  5K36 G;  4DV4 Q;  1FVI A;  4OWT B;  1Y1W H;  5JJK A;  1WJJ A;  2CKZ B;  3BZK A;  2KEN A;  4C3I H;  4GKK L;  1V43 A;  5JJI A;  1IYJ B;  1RL2 A;  4LWC A;  1YJW A;  4AIM A;  1S3O A;  1TXY A;  5M3F G;  5GAE C;  2YV5 A;  3JAM c;  4A3D H;  4X65 Q;  3RN5 A;  2RHS B;  2A1A A;  4NXM Q;  1D7Q A;  1VCI A;  2UXB L;  1GD7 A;  1Q12 A;  3OYY A;  3CCM A;  5ELN A;  4AYB E;  2E2H H;  4LF5 Q;  4JI8 Q;  4DR4 L;  2OCE A;  1I3Q H;  4J15 A;  2B63 H;  3D31 A;  3S15 H;  4BXX H;  4DNI A;  1J5E L;  2R92 G;  1EWI A;  5M3M G;  1VQM A;  3K7A H;  5GAH C;  4LF7 Q;  1OXS C;  1UE6 A;  1Q82 C;  1O7I A;  2MO1 A;  4HJA A;  1UE7 A;  1X9N A;  1PH9 A;  1N32 Q;  2VQE Q;  1EQR A;  1K9M C;  4JBM A;  3I56 A;  1Q86 C;  4A3B G;  3GTQ H;  4LUZ A;  1CSP A;  5C0X G;  3PUV A;  5LMN W;  1VS0 A;  1JJC B;  1KHI A;  1L2F A;  1YBY A;  3KF6 A;  5IT9 c;  4A3E H;  4NXN Q;  2BH2 A;  3CCJ A;  2OTJ A;  2EIF A;  3CCL A;  1QUQ A;  3E9H A;  3I55 A;  1CSQ A;  5EAY A;  2E2I H;  2JA8 G;  2N8N A;  3S1M H;  2PQA B;  3WWV A;  1NY4 A;  2UU9 L;  1EIF A;  1VQ5 A;  4PG3 A;  4BBS G;  4IPD A;  3S1N H;  1SN8 A;  1YNX A;  2HIX A;  2JEA I;  1JB7 A;  4QJF A;  1XNQ L;  5HY6 A;  1XNR L;  1E1O A;  1N33 Q;  1Q8K A;  1YIT A;  1M90 C;  4LF8 Q;  4B3R L;  2UUB Q;  1Y1V G;  3HOU H;  3PCO B;  1PH5 A;  1HNZ L;  1CKN B;  1SRO A;  3PF4 A;  2PI2 A;  4HIM A;  1SE8 A;  2I0Q A;  3RR5 A;  1N36 Q;  3AQQ A;  4NB3 A;  1IBK Q;  1LM0 A;  3KJP A;  4IFD I;  4A3C G;  1OTC A;  2A19 A;  1XMQ L;  2UXC Q;  4GLX A;  4YCW A;  2NVQ H;  4DR3 Q;  4X6A H;  4GN3 B;  3HOW H;  2ATW A;  2RHQ B;  2H5X A;  5C44 G;  3KYH C;  2VW9 A;  3HKZ G;  4L5S A;  1OXT A;  2VNU D;  2Q2I A;  4JI6 Q;  4DV0 Q;  3AFP A;  1UE1 A;  4X64 L;  4AQY L;  4QQB X;  2OWO A;  3UDG A;  4DV5 L;  3TRZ A;  3CPW A;  1LYL A;  5C0X J;  3TQY A;  1E7Z A;  4GOP B;  1PH7 A;  1KQS A;  2JA7 G;  3ICE A;  2RF4 A;  2ZM6 Q;  1HZC A;  1BVS A;  2YTX A;  4UPA A;  1X3F A;  4AH6 A;  1V9P A;  4OX9 Q;  3CMA A;  2JA6 G;  4POG A;  2AHO B;  1ASZ A;  4DKA C;  3GTJ H;  4HIK A;  1V1Q A;  4DV4 L;  4HJ7 A;  1EUJ A;  3H0G G;  5JEA G;  2XTI A;  3HOX G;  3OTO Q;  2WAQ G;  4A3G H;  3HOZ H;  1FJG L;  1BKB A;  4X65 L;  4NXM L;  3PO3 G;  2Y0S G;  4GOP C;  1EFW A;  4YHH L;  3KDF A;  4JI8 L;  1J6Q A;  1WI5 A;  3K7U C;  4R4O A;  3CD6 A;  1Y1W G;  3PO2 H; 
#chains in the Genus database with same CATH topology
 3GTL B;  3A0J A;  1ZEQ X;  3KF8 B;  3P1H A;  1VQG A;  4A3I B;  3I4L A;  3VR2 A;  4LF7 L;  5IOC A;  1SYD A;  3L2P A;  4DV2 Q;  2Z9H A;  1DD2 A;  3QJY A;  3E3X A;  3FHW A;  1LV9 A;  3K81 C;  1AW7 A;  2LKV A;  4RGT A;  3S24 A;  4RWS C;  2SNS A;  1C9O A;  4QY7 A;  4CDC C;  4LF9 Q;  4XYQ A;  1Q1E A;  1M1K C;  2XRQ D;  5JEA J;  4CJ2 C;  3UE1 A;  1DXM A;  2I5M X;  3HRZ C;  3DM1 A;  1EOT A;  2PNR C;  1CHP D;  4X62 Q;  1TQO A;  3M3Y H;  3SEB A;  4OIK A;  3C3L A;  1YHB A;  1SEB D;  4A3E B;  3QIA A;  4LUO A;  3W2D A;  3NWT A;  4K0K Q;  1I4P A;  3MZ5 A;  1N36 L;  1W3S A;  5EGT A;  4IOA A;  3VYS A;  5KRU A;  2EY6 A;  4L5Q A;  4S3S A;  3S1N B;  4KHP Q;  3GTK H;  3I73 A;  1RJT A;  1GM5 A;  2DY7 A;  2ZTC A;  2NVY H;  3I4O A;  4U68 A;  2H4O A;  2RSN A;  1QVF A;  3NHH A;  1E24 A;  3KFU A;  2EOT A;  2JA9 A;  4ABN A;  3OTO L;  1Q81 C;  1BR9 A;  4JI1 L;  2UUA L;  2F0M A;  2XWJ B;  4LAA A;  3ZYY X;  1SXT A;  1GUW A;  1PTO D;  4DR5 Q;  2NN6 G;  1EQV A;  3J81 j;  3FKI G;  4HCS A;  3SK8 A;  1Y69 U;  1GUS A;  4EX5 A;  3PUX A;  5IIF A;  2ID0 A;  4J6H A;  1ENA A;  3T1H Q;  2B2T A;  3A7A B;  4C3J H;  1CK1 A;  5LMU Q;  4A4I A;  5DAU A;  3SK4 A;  4A3L G;  2Q2H A;  1Q46 A;  4DPG A;  3BVZ A;  2JQO A;  3HOY B;  4L5R C;  3TP5 A;  2A6E D;  4A93 B;  5J1Z A;  1CUK A;  3VR6 A;  1MSG A;  1PXU A;  4ZUI A;  1JWM D;  4E6I A;  2R61 A;  1VQB A;  5E4X A;  2CW0 C;  1F9Q A;  4KHV A;  3HG9 A;  4R8I A;  1XMO L;  3I4N B;  1IBL L;  1MIU A;  1CT1 D;  2CCZ A;  2XNA C;  5ELB A;  1R9T H;  2BE5 C;  3WOE A;  3TS2 A;  1X6O A;  3M7N A;  4B9W A;  4A3F G;  4NKL A;  5M3M H;  5C3E G;  3J80 i;  2VB2 X;  5COR A;  2MJ8 A;  3AFQ A;  1KL9 A;  3CCS A;  2PZT A;  1UNS A;  4OXP A;  3IFD A;  3K59 A;  4ZAI A;  1HR0 L;  1YJ9 A;  5I9O A;  3N52 A;  5IYD G;  1FGU A;  2K5N A;  2YTV A;  1JWU D;  4C3I G;  1K8G A;  2IT1 A;  2RBM A;  4IAL A;  2K14 A;  1WD1 A;  1SMY C;  3T56 B;  2EXD A;  2JA8 H;  2A6H D;  2PYK A;  4PMC A;  4F8M A;  3RZD H;  2VUM G;  5EPL A;  2ZJQ A;  3GTK B;  2EVB A;  4BXX G;  2MP1 A;  3MEF A;  2N3S A;  2WAQ E;  2L4N A;  2VQF L;  1Z6H A;  4KY7 A;  1NMF A;  2NB0 A;  1I94 Q;  1BCP D;  3S2D H;  4CGY B;  4F88 A;  1LTI D;  3F2D A;  1SND A;  2E75 C;  2TMP A;  5AJ3 Q;  3BZD B;  4B3R Q;  1A8V A;  1CQF A;  1JOK A;  3IAY A;  4O2D A;  2OTL A;  1CFM A;  2PZW A;  1HQR D;  1IW7 D;  4B3M Q;  1JT8 A;  3J80 L;  4XQN A;  2JA6 H;  4DNT B;  3S1M B;  2BCO A;  3CC4 A;  3H15 A;  3NSW A;  5GRO A;  2F0J A;  4TVA B;  1EY7 A;  5BN4 A;  2HUG A;  2IWH A;  1XWE A;  1L1O B;  1PFN A;  2Q8R E;  1Q8I A;  1A2U A;  1ENC A;  2ZXP A;  4IN3 A;  1PLF A;  3ULP A;  1N34 Q;  1O7Y A;  3ERS X;  3NTI A;  3GTO H;  3L0O A;  5BR8 L;  4JPB W;  4QGU A;  1G6Z A;  1ML0 D;  1U4L A;  2B2Y A;  1TWH H;  4YWM A;  2B2V A;  4A3C H;  1SBB B;  1K83 H;  1WOC A;  5T1I A;  3KLS X;  3GTP H;  1L1O C;  1YNJ C;  2F0O A;  2CHB D;  2EYO A;  2WAC A;  5KYI A;  5ELD A;  4YHH Q;  4KTA A;  4FO2 A;  1A2T A;  3KOJ A;  4FVM A;  4R4Q A;  1WFQ A;  5JJZ A;  2PCF B;  4YY3 Q;  3GTJ B;  1EEF D;  1D6E C;  3IFT A;  1WTX A;  5IYB H;  2N55 A;  1F2M A;  5ISR A;  4POF A;  4A3G B;  3S2H H;  1HPC A;  2JA5 G;  5C4J H;  3W3A A;  2KUM A;  4DR6 L;  3S1R H;  2IY5 B;  3STB C;  3PO2 G;  3PQI A;  1PFB A;  3ERO A;  2A68 C;  4K6L A;  5I2X A;  1HA6 A;  1E0B A;  2J7Z A;  1CTM A;  1EY0 A;  1B7Y B;  2QDL A;  3H3V I;  1K8A C;  2F0V A;  4XIG S;  4LFA L;  1MBY A;  1R4P B;  2NN6 I;  2X6L A;  4LW1 A;  4OL7 A;  2P5Z X;  2VS1 A;  3K57 A;  4X62 L;  3VYU A;  3JC6 6;  3OHX C;  3KLW A;  2AQ2 B;  1PVO A;  1T9H A;  1H9J A;  4O0A A;  3DWA A;  2HQE A;  4NW2 A;  3I91 A;  4EQN A;  1TS4 A;  3FEW X;  2KED A;  2PQE A;  3DM3 A;  2F0L A;  4L6T B;  3FP9 A;  3GV3 A;  1SE3 A;  4FF2 A;  2I5H A;  1HNW L;  4IFD J;  1J8I A;  4GLV B;  3FRP B;  4OEL B;  2LXK A;  1DOM A;  3PUY A;  1HQM C;  1D8L A;  4GS3 A;  2EZV A;  1VF5 C;  5CV8 A;  3H3V H;  4Y52 H;  3PIP 3;  1S5C D;  2XSC A;  2NN6 H;  3FKI H;  5FLM G;  1LAB A;  5F2D A;  1XJV A;  1EWC A;  3F2C A;  3D4D A;  2SOB A;  1BOS A;  1C4Q A;  3HKS A;  4ID6 A;  4B3S L;  1FJG L;  3PF5 A;  3VYR A;  4P74 A;  1F2Z A;  5IYC G;  4JOI A;  4A75 A;  3GTO B;  4A3L H;  4CBV A;  1SNP A;  1CKN A;  1TWH B;  1EIH A;  5FLX L;  4IUQ A;  5DM6 3;  1FNV A;  2Q2T A;  4MZ9 A;  1JJ2 A;  2CFM A;  3OWF A;  3GTP B;  2WP8 J;  1E22 A;  4DNR B;  4ZUJ A;  1RKN A;  4KJN A;  4BA1 I;  1HNZ Q;  5D14 A;  3GO5 A;  3I3C A;  3MXN B;  3OMC A;  3T53 B;  3NQI A;  2UUC L;  2G9H D;  4HSV A;  3OIQ A;  2GVB A;  3I4M G;  1B50 A;  1J9O A;  5JEA H;  4OWX B;  4ZCK A;  3S2H B;  1U4M A;  2V1C C;  4A3M G;  4YWL A;  1YJN A;  1GUN A;  4PZ7 A;  1Q7Y C;  3VYT A;  1MJC A;  1S40 A;  1FYC A;  5JVG 3;  2E76 C;  2HCC A;  5JPM C;  2N78 A;  5K36 G;  2R7D A;  2F0I A;  5JJK A;  1F2Y A;  1I4X A;  4C3I H;  1EZ6 A;  4GKK L;  2EDG A;  5GAE C;  1HFN A;  5AFW A;  1HRJ A;  5C6A A;  5CV7 A;  3SE0 A;  4KN7 C;  1V1P A;  1I3Q H;  4J15 A;  3ITP A;  4EGV A;  5C3W A;  4BXX H;  4DNI A;  4K8J A;  1RCV D;  1S5F D;  4LF7 Q;  3J7A F;  2PMZ B;  1UE6 A;  1O7I A;  1PH9 A;  4HJA A;  4JBM A;  4A3B G;  3VR3 A;  2FMM A;  1CSP A;  1YBY A;  1L2F A;  2OTJ A;  3CCJ A;  3CCL A;  1QUQ A;  3T51 B;  5M5X B;  3I55 A;  5FLX E;  4OHJ A;  1PYW D;  5EAY A;  1R4Q B;  3IKJ A;  4PG3 A;  5IGD A;  3NQT A;  2HIX A;  1JB7 A;  4B3R L;  1Q8K A;  1YIT A;  1X3Q A;  3HOU H;  4H44 C;  1CKN B;  3H3V C;  3PF4 A;  3M7G A;  3QR8 A;  2I0Q A;  3RR5 A;  1N36 Q;  4ZLT F;  1EY8 A;  4YCW A;  2H5X A;  3KYH C;  1OXT A;  4K5W A;  2JYO A;  4QQB X;  1FD7 D;  2V4D A;  1II3 A;  3TRZ A;  4X3T A;  3CPW A;  1LYL A;  5C0X J;  4GOP B;  2RDG A;  1BVS A;  1X3F A;  3CMA A;  5FKA C;  1H9K A;  1HFG A;  1EYA A;  1M4V A;  1EUJ A;  1QG7 A;  3H0G G;  2KEC A;  3TP7 A;  3OTO Q;  1A3T A;  2WAQ G;  3HOX B;  3HOZ H;  1V8Q A;  1BKB A;  1PRT D;  4GOP C;  4HAE A;  2Y0S B;  4NMZ A;  4TRD A;  4YHH L;  1G8Z D;  3PO2 H;  1G2S A;  1B9N A;  4IZ8 A;  2O5I C;  1VQL A;  4O1N A;  1STY A;  3SK6 A;  4FYD A;  4ZYS A;  4L63 B;  1P16 A;  5CBE E;  2OF1 A;  1V1P B;  4CJ0 B;  2F03 A;  4QB4 A;  2L5T A;  1X3G A;  3CPF A;  2B63 G;  3MTS A;  2EJF C;  3I7F A;  4CDF C;  2EJG C;  3DEO A;  5KIX A;  1TWG B;  2VL6 A;  3KUP A;  5KND A;  3GV6 A;  1WTW A;  3PIO 3;  4GLA C;  1EYD A;  3ER0 A;  3VA7 A;  1F9P A;  5TSS A;  4QIW E;  1XMO Q;  1WTH A;  1QNU A;  1IBL Q;  1QUQ B;  1NR2 A;  4XTC S;  4N8X 1;  2PO4 A;  2EYL A;  3J81 E;  1XYI A;  1ENF A;  1TU2 B;  4RCO A;  2L12 A;  5C4X H;  5A2Q L;  1HR0 Q;  1JJG A;  4DV0 L;  2BA1 A;  1HNX Q;  2R7F A;  2SDF A;  2EYF A;  2R93 B;  2L55 A;  3HOU B;  3MC0 B;  3FMC A;  3U58 A;  1OXX K;  1B70 B;  5C4Z A;  4HJ8 A;  1EYC A;  3RLF A;  5COY A;  4OX9 L;  2G5D A;  2RDF A;  1RF2 D;  1TY2 A;  1VQE A;  3NEL A;  4HR7 B;  4KN4 C;  4MTK A;  1N9W A;  1SMX A;  2EYP A;  2F0F A;  2VQF Q;  4KD4 A;  3OPO A;  2EYH A;  4DA2 A;  3EA6 A;  3T13 A;  2K50 A;  2YU9 H;  5A35 A;  2E8G A;  4N8F A;  2NZH A;  3U9O A;  4L5T A;  4N9T A;  1YNN D;  1HTP A;  3IL8 A;  3HOZ B;  1NAP A;  2JK8 A;  2E2J B;  2QEX A;  4P72 A;  4A3M H;  2K03 A;  1DZ1 A;  1GUT A;  1UEA B;  4LF4 Q;  1VQC A;  3J7A 5;  2K6A A;  4H7B A;  1MKH A;  4JCV E;  1I4G A;  5K36 H;  3OW2 A;  1QJO A;  2K52 A;  3JAM E;  2RQX A;  5LHY 1;  3BDC A;  3X3N A;  1B9M A;  2HDL A;  1Z9F A;  4X3U A;  2ZTD A;  1JWS D;  1CHQ D;  1RD9 D;  1DON A;  3T1Y L;  3M4O B;  1GVP A;  4BA2 I;  1SYF A;  1JOO A;  2K5H A;  2R7Z H;  5BR8 Q;  3HOV G;  4MNO A;  1QZH A;  2KOL A;  1E2Z A;  2IHF A;  1EU4 A;  2K5W A;  4CKB A;  4IUN A;  5E7N A;  3G6E A;  4K2L A;  4F87 A;  3MXG A;  1B3Q A;  4IFD H;  4C3H G;  2ENB A;  5IT9 E;  3AYH B;  4ME3 A;  1IL2 A;  1STN A;  1PZJ D;  4APV A;  4Q0F A;  1SYE A;  4R9W A;  4FF3 A;  4OIJ A;  1PTO H;  4M1U B;  2MNA A;  3W5O A;  4A3D G;  1QNK A;  2GN5 A;  4DV7 L;  5C4X B;  4Z9C B;  4DR6 Q;  2NUC A;  4HCE A;  4CDE C;  2MPM A;  2F52 A;  4IJH A;  2OT2 A;  4OON A;  3BDO A;  3PSI A;  2WB1 B;  2DGY A;  1X32 A;  2N49 A;  2C5C A;  3KBX A;  1WCM H;  3G7L A;  4LFA Q;  3TN2 A;  3CCR A;  5FO7 B;  2LXJ A;  5I4D A;  3EFX D;  1SNC A;  3NPP A;  4WJW A;  4R4T A;  4JI4 L;  1NJI C;  4CJ1 B;  1UWV A;  1EFI D;  1AZP A;  2IX0 A;  3GTM H;  3PUW A;  2YU9 B;  3CC7 A;  2JN4 A;  3QOJ A;  2F3I A;  4BBR G;  1HNW Q;  3D4R A;  5EPJ A;  2PZU A;  1E2W A;  1KLG D;  3H0G H;  3O13 A;  2BH8 A;  2KCC A;  5LMN L;  4HID A;  1G6P A;  4RCN A;  4AYB B;  5IWA L;  1G91 A;  5ELC A;  4R1J A;  3TP6 A;  3OSO A;  3NEN A;  1STA A;  3K6O A;  4QF4 A;  2O2L D;  2F4V L;  4P73 A;  4HJ9 A;  4UP9 A;  3HOW G;  3F1Z A;  4DAP A;  2CH4 W;  4KJO A;  3DLL A;  1HCZ A;  2M9V A;  4EQP A;  1TS2 A;  2F0H A;  2VZA A;  4B3S Q;  4ILW A;  2F0K A;  1FJG Q;  2D2C C;  4G7O C;  5IP7 H;  1VQO A;  1GUG A;  1U0L A;  2HCI A;  4DXG A;  3UDX A;  2R7Z B;  1EY5 A;  5FO8 B;  4ME5 A;  1TS5 A;  1LT4 D;  2CW0 D;  1STE A;  4H0L C;  4LUV A;  1GHK A;  2F0E A;  2C9O A;  2NZO A;  3VDY A;  1ZKO A;  2AQ1 B;  4IQZ A;  3P75 A;  1Q90 A;  1H95 A;  1HJP A;  1IXR A;  1A3U A;  1L1O A;  1KC8 C;  2UUC Q;  4XQQ A;  1EOV A;  3UI2 A;  2HIV A;  4IJL A;  1SR3 A;  3A5Z B;  1S4Z A;  5C0X I;  3FPP A;  4DV3 L;  2ZJR A;  1FR3 A;  2A69 C;  2LS0 1;  5IGB A;  3ULJ A;  4RKL A;  2L15 A;  4PMW A;  4HIO A;  3RN2 A;  1PYB A;  2JJQ A;  2Q2U A;  1PH2 A;  2IX1 A;  2LMC B;  4RMF A;  4YCU A;  1ZYR D;  4GKK Q;  3KLS A;  4LNQ A;  2KCN A;  2K5Q A;  2RDH A;  1VQD A;  3I70 A;  2HT1 A;  1PTO C;  1MD2 D;  4BY1 G;  2R92 H;  1WCM B;  1Z47 A;  1C0A A;  2F0P A;  3DHQ A;  3T16 A;  1S72 A;  3MAQ A;  1JIC A;  1YEZ A;  1BF4 A;  4B3T Q;  3M3Y B;  1UUP A;  2VXW A;  4MTN A;  4A3J G;  5C0X H;  4XT1 B;  1HNX L;  1Q3L A;  2X69 A;  1A62 A;  1MJE A;  2K04 A;  1W6J A;  1X54 A;  3CAM A;  4PV1 C;  1ICF B;  4HTH A;  4ZKB B;  4JI5 Q;  1F9R A;  3GTM B;  1IL8 A;  2N88 A;  3CCU A;  3M85 A;  3J81 c;  1UEB A;  2KBN A;  3ULL A;  4K8I A;  4DV1 Q;  2PQA A;  4I7A A;  4JG2 A;  4PNY A;  1U5K A;  5FJ8 G;  1AE2 A;  3CRK C;  5KNB A;  3AMU A;  1C8C A;  2NVY B;  1NE3 A;  3K5M A;  1VDZ A;  3EBE A;  3NUC A;  4YIJ A;  3RLO A;  1XPR A;  4JI7 L;  2LY7 A;  4X3S A;  1AP0 A;  2AWO A;  4DR1 L;  2B29 A;  2K01 A;  1NR4 A;  3GDE A;  1HR0 W;  4LF4 L;  3HOV H;  3RZO H;  1XTD A;  2B3G A;  1LTA D;  3CXC A;  4BY7 G;  1YNJ D;  3HEJ A;  4P2C B;  4X66 L;  3TEH B;  1KAW A;  4C3J B;  1O7Z A;  4A3K G;  3HS0 C;  3SVM A;  4WRD A;  2A6H C;  4C3H H;  3T4A C;  1H9M A;  3BJU A;  4LJZ C;  2KHJ A;  4OWT B;  1Y1W H;  2IPK D;  2CKZ B;  3BZK A;  2KEN A;  4IUR A;  1V43 A;  5JJI A;  1YJW A;  1S3O A;  1TXY A;  5M3F G;  5EKL A;  4RGO S;  3CKI B;  3JAM c;  4A3D H;  2RHS B;  1MSH A;  5CGK A;  2A68 D;  3K58 A;  2E2H H;  2DN8 A;  4DR4 L;  1L0X B;  1CA5 A;  5C5M A;  1R9T B;  2J0T D;  3OMG A;  1EIG A;  1EWI A;  1VQM A;  2R92 B;  3K7A H;  4EVO A;  3A56 A;  1OXS C;  5M3M B;  1Q82 C;  3MXN A;  3R2T A;  1IW7 C;  2VQE Q;  5ELE A;  1SDF A;  2F3W A;  3GTQ H;  2WIN B;  2K32 A;  3E5S A;  4LUZ A;  3C1E A;  3SK5 A;  1RHP A;  3PUV A;  1KHI A;  3KF6 A;  2EY1 A;  5IT9 c;  1LTG D;  1U4R A;  5IOD A;  1SE4 A;  3TZU A;  1CSQ A;  5J22 A;  2PQA B;  1SE2 A;  2JA8 B;  4BBS G;  4IPD A;  3RZD B;  5J39 A;  3TSS A;  5L37 A;  2TSS A;  2JEA I;  5CMD A;  4QJF A;  3F2U A;  3DUZ A;  5LL6 S;  1Y1V G;  4RHS A;  2GA4 B;  1SRO A;  5EJW A;  1H9S B;  3J80 E;  2PI2 A;  4IUU A;  4JVZ A;  3S2D B;  2KJX A;  4ZRZ A;  1HXY D;  5HUR A;  3HOW H;  5C44 G;  4JI6 Q;  4DV0 Q;  3HKZ B;  4X64 L;  3URY A;  3NBI A;  2JA7 G;  3TQY A;  1KQS A;  3ICE A;  3V05 A;  2EYJ A;  2YTX A;  3LX0 A;  4UPA A;  4OX9 Q;  1BBX C;  2JA6 B;  2IJ0 A;  1ASZ A;  4DKA C;  3RZO B;  4DV4 L;  1JCK B;  4BS9 A;  4KY6 A;  5NUC A;  1S5B D;  1LAC A;  4CDD C;  1B3A A;  3CRL C;  4X65 L;  4NXM L;  3SDZ A;  3PO3 G;  4NP5 A;  1PTO F;  4RH6 A;  2B8G A;  1I6V C;  3CD6 A;  4R4O A;  3K5L A;  2FHT A;  1S5D D;  3CCE A;  1Y1W B;  4L8J A;  3NP8 A;  2QA4 A;  1TKW B;  4A3I G;  4C2M H;  4DAY B;  2NTS A;  4G7Z C;  3TDQ A;  4IPG A;  1K83 B;  4I65 A;  3A8J E;  1WD0 A;  1O78 A;  4R4I A;  2MGS A;  2Z6K C;  5DNF A;  4KV6 A;  2E2H B;  1T5E A;  3BYY B;  3RLN A;  1OXU A;  1AE3 A;  3J7Z C;  4GOP A;  5EKI A;  1N8R C;  3BVM A;  1SYB A;  3K7A B;  2A74 C;  2LFN A;  1KAB A;  3E0E A;  1VQ6 A;  4A3F H;  5C3E H;  3KF6 B;  3RUZ A;  5C4J B;  2O4X A;  3GTQ B;  1S5E D;  3T1Y Q;  3S1R B;  3HGB A;  4A3E G;  4A76 A;  4PZ8 A;  3S17 H;  5IP9 G;  4A3J H;  2BDN A;  2R6G A;  1SLJ A;  3LNN A;  3E0J A;  3SGI A;  3U4Z A;  5IYD H;  3J7Y W;  4DK3 C;  1IBK L;  1F2L A;  1BBU A;  4RGN A;  2NZ1 D;  1Y1W G;  4FXG C;  1X3E A;  5M5W H;  2VUM H;  2HQL A;  3G48 A;  3R8B A;  1STG A;  2XIW A;  4B3T L;  2KQ3 A;  3CQZ H;  4R4C A;  5I9P A;  3EQL C;  2EXZ A;  4JI5 L;  3CU7 A;  3A8I E;  4IUV A;  1AFP A;  4DV7 Q;  4HMI A;  1EWH A;  5CV9 A;  3CF5 A;  2OQ0 A;  1XX8 A;  2O5J C;  2CWP A;  2HDM A;  2B2W C;  3CP0 A;  4DUY Q;  4DV1 L;  3PMF A;  3QG1 A;  4IPH A;  3QOL A;  1YIJ A;  5J3B A;  1PV4 A;  1KRS A;  1OXV A;  4DK1 A;  4LMQ D;  4CKC A;  1I4H A;  1C48 A;  1D1K A;  1DGS A;  3FKI B;  2ZTE A;  4F7X A;  5EQ0 A;  2PMZ E;  4DN4 M;  4ZKC B;  4QUC A;  3Q23 A;  1WTO A;  2PW7 A;  4X3K A;  2ZT9 C;  4YCV A;  3F2B A;  1NTG A;  1NMG A;  2KCT A;  1SNM A;  4JI4 Q;  4DR7 Q;  1RIP A;  4FF1 A;  1B44 D;  5CBA E;  4A3K H;  3HOY G;  5ELF A;  4A93 G;  2JEB I;  2DJF C;  3MFG A;  1Y8O B;  3A54 A;  2MO0 A;  4KKT A;  1LO5 D;  1F9S A;  1SNQ A;  1DYQ A;  2EJM A;  3UE0 A;  5LMN Q;  5IWA Q;  1KTK A;  5M3F H;  1YHA A;  3PGZ A;  5JPN C;  3I4N G;  4WJ4 A;  5FO9 B;  3NXW A;  1EY6 A;  4C56 C;  3Q24 A;  2CQA A;  3S14 H;  2F4V Q;  1K28 A;  2Q8T A;  4CHT B;  4DF7 A;  1JE4 A;  2RA4 A;  3K8A A;  4G57 A;  4A3F B;  1ICW A;  5C3E B;  5JAV A;  4MIU A;  4WOR A;  2UXB Q;  5JOB A;  1BDO A;  1DCZ A;  2IX3 A;  4QL5 A;  2JA5 H;  4K5V A;  2EYM A;  5G3L F;  2NBF A;  4DV6 L;  1VQ7 A;  2B8F A;  3S17 B;  4A3J B;  1A63 A;  1VQ8 A;  4C3I B;  1HUN A;  1KXL A;  1STB A;  3HFZ B;  1MGS A;  2SNM A;  4JI2 L;  1VF7 A;  3S1Q H;  2VQE L;  1GUO A;  3P20 A;  5GAG C;  5M5W B;  1CKO A;  2VUM B;  1KRT A;  3E9I A;  3PUZ A;  4C1N K;  4RHR A;  1I3Q B;  3TS0 A;  1Y1V H;  4K5X A;  1X3P A;  1SJH D;  2Y0S E;  1SRU A;  1PRT B;  3D8G A;  4NPS A;  5I2Y A;  1B2T A;  5FK9 C;  4RFB A;  4DV3 Q;  4OO1 G;  2D9U A;  1XNR Q;  2PNH A;  1YVC A;  1HZ9 A;  1IBM L;  1PDQ A;  1FL0 A;  1TR5 A;  1Y8N B;  3TP8 A;  1VQP A;  2JA7 H;  1XPO A;  4J1M A;  3BDL A;  1IYV A;  1PRT C;  2NVT H;  2F0S A;  2M2L A;  5FLM H;  2FJ2 A;  1B53 A;  4P75 A;  2F3V A;  3BYT B;  2WV6 D;  3S9W A;  4JI6 L;  4DK0 A;  3NBH A;  1H9R A;  1ILQ A;  1K0S A;  4IOC A;  3NTK A;  1HUM A;  4R8N A;  1G51 A;  3J80 c;  5IYC H;  5CV5 A;  3H94 A;  5C4H A;  3GTL H;  1D5M C;  1SAP A;  3KBG A;  2D5D A;  1TWA H;  2UXD L;  2M00 A;  4A3I H;  1GHJ A;  4JC0 A;  1K73 C;  4DGZ A;  4HJ5 A;  3LGJ A;  3EN2 A;  3EJI A;  3S14 B;  2IW3 A;  2F0T A;  1YZ6 A;  2YTY A;  1KLU D;  1GO3 E;  2ICE C;  5M5Y H;  4JI7 Q;  4M8A A;  2OQK A;  1ZXT A;  2NTT A;  3Q0A A;  2YYZ A;  1OO9 B;  1CM9 A;  4KHZ A;  4A3G G;  4JI3 L;  3I4M H;  4UP7 A;  3WOF A;  3ONA B;  3A5U A;  5D3I B;  4DR1 Q;  1HZB A;  5HGQ A;  1QZG A;  2RCN A;  2JA5 B;  2AUJ D;  4MHE A;  3U9S A;  1JE5 A;  3PO2 B;  2VB3 X;  3R2I A;  4FF4 A;  5IP9 H;  1X65 A;  1HTL D;  3D6C A;  1I50 H;  3R3O A;  1ILP A;  3B6Y A;  1VQ4 A;  1GOZ A;  4KKS A;  4X66 Q;  2MHV A;  4JI0 L;  1SFO H;  4K2K A;  4DUZ L;  2EE1 A;  4DAV A;  2KHS A;  2IHE A;  4IO9 A;  1JB3 A;  1DOL A;  4KLK A;  2A73 B;  3FVQ A;  1WYD A;  1ET9 A;  1ROD A;  3ERQ A;  1W2B A;  3H09 A;  5A2Q E;  3HOY H;  1FNW A;  2OEO A;  2FIN B;  2QKI C;  4LFC L;  4DR4 Q;  2AKW B;  4A3B H;  3CCQ A;  3M4Y A;  2K75 A;  2ICI A;  4LFB L;  2HD3 A;  1YNN C;  3OOC A;  3TBI B;  4GZY C;  3C46 A;  2NYZ D;  3K0X A;  1LTR D;  2CWA A;  3DXJ C;  2NVT B;  4RG1 A;  1VQ9 A;  2OXP A;  3NBH B;  1UE5 A;  1FGB D;  1PH8 A;  3BS1 A;  2FXQ A;  1YHQ A;  2F0G A;  2MFI A;  4DUY L;  5EKK A;  1IZ6 A;  1SJE D;  5BN5 A;  1NSN S;  2AWN A;  2K05 A;  4HN7 A;  1VQA A;  1PA6 A;  5DLQ E;  4A93 H;  2A5H A;  1IKM A;  2JE6 I;  4DR2 L;  4A3C G;  1E1T A;  2NVQ H;  2K5D A;  4JBW A;  1PYS B;  4LF6 Q;  1TWA B;  5JVH 3;  1U4P A;  4XT3 B;  2F0W A;  3I4N H;  1K0R A;  1TWF H;  1TVX A;  4DR7 L;  5IGE A;  3G4S A;  1I5F A;  2C35 B;  3I90 A;  3MVV A;  4HED A;  3R93 A;  5M5Y B;  5DM7 3;  1MHW C;  5IYB G;  2WB1 E;  3Q22 A;  2PPB C;  5FLX c;  4QUF A;  2RKS A;  4P71 A;  5K5P A;  4X64 Q;  1KD1 C;  1EY9 A;  2L11 A;  4FNF A;  1BBW A;  4WFN 3;  4Y7N H;  1PH6 A;  2HHH L;  3I4M B;  4JYA L;  3MFY A;  1NBW A;  1B8A A;  3GD7 A;  4TSS A;  5EPK A;  4A3M B;  4GKJ L;  1TII D;  2AQ3 B;  4JV5 L;  1BXT A;  3X3M A;  4HSP A;  2NVX H;  4OO1 I;  4DV4 Q;  5KYL A;  1IYU A;  2Z8L A;  1I50 B;  1RL2 A;  4LWC A;  3SHL A;  4AIM A;  2YV5 A;  4X65 Q;  1SFO B;  1TT2 A;  4NXM Q;  1VCI A;  2MUY A;  4XYO A;  2UXB L;  1PRT F;  3OYY A;  3CCM A;  4LF5 Q;  4AYB E;  2OCE A;  2B63 H;  1CZW A;  3D31 A;  3S15 H;  3P7J A;  1A3V A;  1J5E L;  1LTS D;  5GAH C;  2A69 D;  2MO1 A;  1X9N A;  1UE7 A;  4OO1 H;  1Q86 C;  2IL8 A;  2WKD A;  4A3B B;  1HHV A;  4K14 A;  1WVL A;  2BE5 D;  5LMN W;  1JJC B;  2BH2 A;  5CC4 A;  4KK7 A;  3FDT A;  3NWS A;  3MXP A;  4TKO B;  1PTO B;  3E9H A;  3I8Z A;  2E2I H;  3S1M H;  2N8N A;  2UU9 L;  1PMR A;  1NY4 A;  3WWV A;  1SYG A;  1SN8 A;  3AU7 A;  1XNQ L;  3AB9 A;  5HY6 A;  1XNR L;  1E1O A;  1N33 Q;  1KNA A;  2B2U C;  2ZXO A;  2UUB Q;  4JK1 C;  3PCO B;  1PH5 A;  4HIM A;  1SMY D;  3E6Z X;  4NB3 A;  1IBK Q;  1LM0 A;  3KJP A;  1K8O A;  1XMQ L;  4X6A H;  4GLX A;  4G7H C;  2NVQ B;  1T5X D;  1A15 A;  4GN3 B;  3K5N A;  2L1B A;  2JP1 A;  2RHQ B;  4L5S A;  2VW9 A;  1F77 A;  2KVM A;  4AQY L;  1AZQ A;  1WTQ A;  2G9D A;  4DV5 L;  2VNU D;  1E7Z A;  1EEI D;  1PH7 A;  1TWF B;  3I72 A;  3KLR A;  4J8Q A;  4POG A;  1GJX A;  3RMH A;  1V1O A;  2AHO B;  3GTJ H;  4PQX A;  1LT5 D;  4N9P A;  4RAU C;  2A6E C;  4JW0 A;  2L9H A;  5JEA G;  3H0G B;  3HOX G;  2FFK B;  4Y7N B;  3MEH A;  4A3G H;  4PMB A;  2WAQ B;  2EY2 A;  2Y0S G;  4KY5 A;  3V96 A;  4UHV A;  3KDF A;  4JI8 L;  1WI5 A;  3K7U C;  2NVX B;  1AN8 A;  2J4X A;  3ND8 A;  1H9S A;  2KHI A;  2DUD A;  1NNX A;  4ODG A;  5C3X A;  1PH1 A;  1ZYR C;  3OIP A;  4IUT A;  3MA2 B;  1N32 L;  1RDP D;  1ASY A;  1VQH A;  1I4R A;  3RD4 A;  2B63 B;  3S15 B;  1WTR A;  4NXN L;  2WKC A;  2X6G A;  2QIL A;  2VY3 A;  5KNC A;  1BCP B;  1RTO A;  4KKU A;  1AH9 A;  2Z6B A;  3CC2 A;  1ESR A;  3A55 A;  2I5L X;  4ZK9 B;  1BQQ T;  3V2T A;  4LF8 L;  1QOH A;  3J7A V;  1LT6 D;  2Z6K A;  3G6J B;  1VQF A;  1K3B C;  1L0Y B;  3MXU A;  1I6H H;  2DNE A;  3GP7 A;  2QCP X;  1D5Z C;  2E2I B;  1LLR D;  5LL6 X;  1BCP C;  2UXC L;  2KA7 A;  4DR3 L;  3STB D;  4DAY A;  1ONL A;  2DY8 A;  2R93 G;  5JJL A;  3HOU G;  4LK1 C;  3CHB D;  4DV6 Q;  2WFW A;  2F0N A;  1PH3 A;  1E2V A;  1Y8P B;  2ZM6 L;  1QCB D;  4JI2 Q;  2K33 A;  2E5L Q;  1WTP A;  2B2T C;  4WJ3 M;  4JBJ A;  4FP5 D;  5CV4 A;  3K5O A;  3L3O C;  4V19 0;  3QO2 A;  5G3L D;  4XQJ A;  1VMC A;  1L0W A;  1VQN A;  1U9R A;  3SXH A;  3CW2 C;  3DWP A;  1GXD C;  4BBR H;  4LF6 L;  3HOZ G;  1SNO A;  1HA5 A;  1PFS A;  4GN4 B;  3VR5 A;  3KDF B;  3UDI A;  1IBM Q;  3Q6S A;  4DV2 L;  1UAP A;  3C1F A;  3W1B A;  2B2W A;  1GKH A;  2PW5 A;  1XPU A;  3IRB A;  5FOB B;  2BA0 A;  4LF9 L;  1DJR D;  1ESF A;  1EL0 A;  3M4P A;  3QB3 A;  4K6D A;  1QVC A;  2A8V A;  3F8T A;  1PH4 A;  3HOV B;  1PZI D;  4K0K L;  1JQY D;  2UXD Q;  1VQJ A;  1AEX A;  1JC7 A;  4RKB A;  2XN9 C;  1CZG A;  1D5X C;  4XDX A;  1P8L A;  4KHP L;  1QIL A;  3HKZ E;  5IGF A;  2NWG A;  4LF5 L;  4C3H B;  4GNX A;  4UY8 C;  4H02 A;  5I6W A;  2F0Q A;  1VQI A;  1IHZ A;  2K4K A;  1XTC D;  3S16 H;  4QCL A;  1RTN A;  3LWE A;  1LTL A;  1JR0 D;  2DJG C;  1I6H B;  5M5X H;  2EPB A;  4KI0 A;  4ALP A;  4UP8 A;  5C4X G;  4JI3 Q;  5BN3 A;  4A3D B;  3DWQ A;  3U50 C;  4GN5 A;  3PIP A;  1KAA A;  4DAM A;  3D4W A;  2ZJP A;  2ES2 A;  1O80 A;  2ZXR A;  3Q8D A;  4NDX A;  1Q1B A;  2WB1 G;  4DU9 A;  1EZ8 A;  4U67 3;  4DR5 L;  1EU3 A;  3ZJY C;  3K0Y A;  5KEE A;  2F4I A;  4BY1 H;  5H1S E;  3W1G A;  4JI0 Q;  2AUK A;  1A6X A;  1JMC A;  5DEH A;  4DUZ Q;  3KK7 A;  3NTH A;  2CQO A;  3T1H L;  1KIX A;  1N33 L;  2UUB L;  5LMU L;  2B2Y C;  5CV6 A;  2B2V C;  1EYG A;  2Z1C A;  3LWU A;  1Y14 B;  5CYU A;  4EQ5 A;  1EQQ A;  5EBC A;  3CME A;  4BBR B;  4AYB G;  2H1E A;  3BZC A;  4LFC Q;  1MI2 A;  5M9O A;  2RCF A;  4FDB A;  1D1I A;  3HOX H;  4LFB Q;  4DFA A;  2LSS A;  1G29 1;  1KNE A;  2RSO A;  1Z7T A;  4OGQ C;  5FJ8 H;  4KMU C;  1K3R A;  1LT3 D;  3UDF A;  2QDB A;  1C7Y A;  3TRE A;  1HZA A;  3M9B A;  3MWY W;  1EQT A;  1LTB D;  2L0C A;  2XWB B;  4DXF A;  2MQH A;  3NEM A;  3HOW B;  1E3P A;  3PV0 A;  4DK6 C;  3J81 i;  2JXM B;  2Q8I B;  3A7L A;  3D0F A;  3L7Z C;  4FXD A;  5C5L A;  2PI2 E;  4OWW B;  2R7Z G;  1BCP F;  2EY5 A;  2XGT A;  1TWG H;  2QEJ C;  4DR2 Q;  2K1B A;  3GQB A;  2E74 C;  4ZQ3 A;  1X55 A;  1PHJ A;  5IGC A;  4BY7 H;  2KCM A;  4IFD G;  4GNX B;  4QMG A;  1KDB A;  4O42 A;  4OEM B;  2K5V A;  5GAD C;  3S16 B;  1X56 A;  3OWE B;  5I6Y A;  4RGM A;  1I94 L;  1B4O A;  4C2M B;  3NE5 B;  4YWK A;  3EIV A;  2HHH Q;  4JYA Q;  1VMP A;  3OW7 A;  1EY4 A;  4GNX C;  5AJ3 L;  2Z4I A;  3AEV A;  4GKJ Q;  1DOK A;  1CKM A;  2RVL A;  1KDA A;  4JV5 Q;  4TQU S;  1PFM A;  1XXG A;  3C2P A;  3H6M A;  5IY0 A;  1QVG A;  2R93 H;  3CCV A;  3U4V A;  3VA5 A;  3A74 A;  3HP3 A;  3HZX A;  2ASB A;  3M4Q A;  1B1Z A;  2Z0S A;  1WCM G;  4B3M L;  1A0I A;  1NCV A;  2R3Z A;  5GQO A;  3J81 L;  4BY1 B;  4B9X A;  1TWC H;  2CVR A;  1LTT D;  5KGU A;  2BDO A;  3ND9 A;  2F1M A;  4JOI C;  3JAM i;  4CKE A;  4FXK C;  1J5E Q;  3KJO A;  2D0P A;  1N34 L;  3GTG H;  5T1G A;  2E5L L;  2I46 A;  3H91 A;  5EBD A;  2BOS A;  4BBS H;  4PZ6 A;  4JI1 Q;  2E2J H;  2UUA Q;  2AMC B;  4C1N I;  3RNU A;  3CQZ B;  5D3D A;  2DNC A;  2JSO A;  1VQK A;  1CA6 A;  4ULL A;  3I2Z A;  2I07 B;  5IE8 A;  2UU9 Q;  2EQS A;  2GVA A;  4YY3 L;  4QIW B;  1DM0 B;  3K80 C;  1HH2 P;  2D0O A;  2QGQ A;  1XNQ Q;  3DMU A;  1QE6 A;  5C44 H;  1BNZ A;  2QF7 A;  3BU2 A;  5IP7 G;  2D62 A;  2E2D C;  1SSO A;  5ELO A;  3M4O H;  3D6W A;  1BO0 A;  1XMQ Q;  4H13 C;  4RA8 A;  3G71 A;  1KDC A;  2XRS D;  3VR4 A;  1EIY B;  1LUZ A;  4AQY Q;  3L9A X;  4BY7 B;  1PZK D;  4C3J G;  3JAM L;  1YI2 A;  3SR1 A;  4I7Z C;  3D3R A;  4DV5 Q;  1CQV A;  4EQO A;  4IPC A;  3PIO A;  4A3K B;  4JBK A;  4KD3 A;  2ALY B;  2Z4H A;  3PO3 H;  2XVS A;  1SYC A;  4BWG B;  1FVI A;  1TY0 A;  2B39 A;  1WJJ A;  1IYJ B;  1K8M A;  1TS3 A;  5HGT A;  1I4Q A;  5M3F B;  1QB5 D;  3RN5 A;  2A1A A;  1D7Q A;  1CI3 M;  1GD7 A;  1Q12 A;  3KF8 A;  4UDU C;  4V0B A;  5ELN A;  4JI8 Q;  3EVQ A;  1D2B A;  5IT9 L;  3A8K E;  3DEP A;  3TME A;  2K7V A;  2R92 G;  5M3M G;  1N32 Q;  1EQR A;  1K9M C;  1TWC B;  3I56 A;  5IGG A;  5C0X G;  3MHB A;  1JOQ A;  1VS0 A;  2FMC A;  5D65 A;  4A3E H;  3QWN A;  1WTV A;  4NXN Q;  2EIF A;  1JOR A;  3GTG B;  2F0D A;  1M8A A;  2JA8 G;  5E4W C;  1EIF A;  1VQ5 A;  3S1Q B;  4MN3 A;  1YNX A;  1QWY A;  1W6K A;  3S1N H;  4BBS B;  3BG3 A;  1G2T A;  3TZD A;  3WDN A;  1M90 C;  4LF8 Q;  1NUC A;  1HNZ L;  1Y1V B;  1SE8 A;  3AQQ A;  4HMJ A;  1O7L A;  5E1F A;  4IFD I;  1OTC A;  2A19 A;  2KEE A;  2UXC Q;  4DR3 Q;  2K28 A;  4Q5V A;  2ATW A;  1ET6 A;  2F0U A;  3HKZ G;  2Q2I A;  4IUP A;  3AFP A;  1UE1 A;  5C44 B;  2OWO A;  1BUV T;  1FNU A;  3BVG A;  3UDG A;  2QW7 A;  1STH A;  2RF4 A;  2ZM6 Q;  2JA7 B;  2CH4 A;  1HZC A;  4AH6 A;  2JA6 G;  1V9P A;  2B2U A;  4XXE A;  3NK9 A;  4B08 A;  4HIK A;  1V1Q A;  4HJ7 A;  2XTI A;  3N6R A;  4G4K A;  2SEB D;  2WII B;  3FPU B;  1EFW A;  4UAI A;  5E3F A;  3PO3 B;  1J6Q A;  1IKL A;  5CR3 A; 
#chains in the Genus database with same CATH homology
 3CCE A;  1VQL A;  3A0J A;  2QA4 A;  4A3I G;  4C2M H;  2KHI A;  2DUD A;  4DAY B;  3KF8 B;  1PH1 A;  1VQG A;  4LF7 L;  4IPG A;  1P16 A;  3L2P A;  4DV2 Q;  1N32 L;  1ASY A;  1VQH A;  3FHW A;  4R4I A;  1X3G A;  2Z6K C;  3CPF A;  2B63 G;  3K81 C;  3I7F A;  1OXU A;  3RLN A;  4NXN L;  1AE3 A;  2VL6 A;  3S24 A;  3J7Z C;  4GOP A;  1N8R C;  4GLA C;  1C9O A;  4QY7 A;  3ER0 A;  4LF9 Q;  1Q1E A;  2VY3 A;  1M1K C;  1VQ6 A;  3E0E A;  5JEA J;  4A3F H;  5C3E H;  3UE1 A;  2I5M X;  4QIW E;  3KF6 B;  3CC2 A;  1AH9 A;  1XMO Q;  1IBL Q;  3T1Y Q;  2I5L X;  4X62 Q;  3M3Y H;  4A3E G;  1YHB A;  1QUQ B;  4LF8 L;  4XTC S;  4A76 A;  4LUO A;  2Z6K A;  4PZ8 A;  3S17 H;  5IP9 G;  1VQF A;  4A3J H;  2R6G A;  3SGI A;  1SLJ A;  3U4Z A;  4K0K Q;  5IYD H;  1I6H H;  4DK3 C;  1N36 L;  1IBK L;  1W3S A;  1BBU A;  4IOA A;  2UXC L;  4DR3 L;  4L5Q A;  3STB D;  5C4X H;  4KHP Q;  1X3E A;  1HR0 Q;  5M5W H;  2VUM H;  3GTK H;  2HQL A;  2BA1 A;  4DV0 L;  3G48 A;  2R93 G;  3HOU G;  5JJL A;  1GM5 A;  1HNX Q;  2R7F A;  4B3T L;  4DV6 Q;  2WFW A;  1PH3 A;  2ZTC A;  3CQZ H;  2NVY H;  3I4O A;  3U58 A;  1OXX K;  1B70 B;  4R4C A;  4HJ8 A;  2ZM6 L;  4JI2 Q;  3RLF A;  4OX9 L;  4JI5 L;  1QVF A;  2E5L Q;  1E24 A;  1VQE A;  4WJ3 M;  4DV7 Q;  4JBJ A;  3CF5 A;  2OQ0 A;  3NEL A;  2CWP A;  3KFU A;  1N9W A;  2JA9 A;  3OTO L;  1SMX A;  3CP0 A;  4DUY Q;  1Q81 C;  4DV1 L;  4JI1 L;  2VQF Q;  4IPH A;  2UUA L;  1YIJ A;  5J3B A;  1PV4 A;  1KRS A;  1OXV A;  4DR5 Q;  2NN6 G;  3J81 j;  3FKI G;  1L0W A;  1DGS A;  2K50 A;  1VQN A;  2YU9 H;  2E8G A;  3CW2 C;  2ZTE A;  4EX5 A;  2NZH A;  4L5T A;  4BBR H;  3PUX A;  4LF6 L;  2ID0 A;  3HOZ G;  2PMZ E;  1PFS A;  4GN4 B;  3KDF B;  3UDI A;  2JK8 A;  4DV2 L;  3T1H Q;  2QEX A;  4C3J H;  1IBM Q;  4YCV A;  3F2B A;  1NTG A;  4P72 A;  1NMG A;  2KCT A;  5LMU Q;  4JI4 Q;  4A3M H;  4DR7 Q;  4A4I A;  1RIP A;  3W1B A;  4A3K H;  3HOY G;  4A3L G;  2Q2H A;  1Q46 A;  4DPG A;  2JQO A;  4A93 G;  1GKH A;  4LF4 Q;  1VQC A;  4L5R C;  2JEB I;  3J7A 5;  1XPU A;  1MKH A;  3IRB A;  4JCV E;  3OW2 A;  1CUK A;  2K52 A;  2MO0 A;  3UE0 A;  5LMN Q;  2BA0 A;  4LF9 L;  5IWA Q;  1VQB A;  3M4P A;  1Z9F A;  1YHA A;  3PGZ A;  5M3F H;  1JJG A;  2ZTD A;  3I4N G;  4WJ4 A;  1QVC A;  1XMO L;  1IBL L;  3T1Y L;  1MIU A;  2A8V A;  3S14 H;  2CCZ A;  1GVP A;  4BA2 I;  2F4V Q;  2K5H A;  2R7Z H;  5BR8 Q;  3HOV G;  4MNO A;  3F8T A;  1PH4 A;  1R9T H;  1QZH A;  3TS2 A;  1X6O A;  4K0K L;  3M7N A;  2IHF A;  1VQJ A;  2UXD Q;  4A3F G;  5M3M H;  3K8A A;  3J80 i;  5C3E G;  3G6E A;  5E7N A;  3AFQ A;  2UXB Q;  1KL9 A;  3CCS A;  4OXP A;  1P8L A;  4KHP L;  4QL5 A;  2JA5 H;  1HR0 L;  1YJ9 A;  3HKZ E;  3AYH B;  4ME3 A;  4LF5 L;  1IL2 A;  4GNX A;  4UY8 C;  4DV6 L;  1VQ7 A;  5IYD G;  4H02 A;  1FGU A;  2K5N A;  2YTV A;  4APV A;  1K8G A;  1VQI A;  2K4K A;  2IT1 A;  3S16 H;  1VQ8 A;  1A63 A;  1KXL A;  1LTL A;  3HFZ B;  5M5X H;  2MNA A;  3W5O A;  4JI2 L;  4KI0 A;  4ALP A;  2K14 A;  4A3D G;  2GN5 A;  4UP8 A;  5C4X G;  2EXD A;  4JI3 Q;  2JA8 H;  3S1Q H;  4DV7 L;  2VQE L;  3RZD H;  2VUM G;  4DR6 Q;  2ZJQ A;  3U50 C;  5GAG C;  4GN5 A;  1CKO A;  2F52 A;  4IJH A;  3PIP A;  1KRT A;  3E9I A;  3PUZ A;  4DAM A;  4BXX G;  2ZJP A;  3MEF A;  2N3S A;  2WAQ E;  2ES2 A;  3Q8D A;  2VQF L;  3TS0 A;  4OON A;  1Q1B A;  2WB1 G;  1Y1V H;  1NMF A;  3PSI A;  1I94 Q;  4DR5 L;  2Y0S E;  2DGY A;  1SRU A;  3ZJY C;  2N49 A;  4NPS A;  3S2D H;  1WCM H;  3F2D A;  4BY1 H;  4DV3 Q;  4OO1 G;  5H1S E;  3W1G A;  4JI0 Q;  5AJ3 Q;  4LFA Q;  3CCR A;  1XNR Q;  2LXJ A;  4B3R Q;  2PNH A;  1JMC A;  1YVC A;  1A8V A;  4DUZ Q;  1HZ9 A;  2CQO A;  3T1H L;  1IBM L;  4R4T A;  1KIX A;  1N33 L;  2UUB L;  5LMU L;  1FL0 A;  1VQP A;  4JI4 L;  4O2D A;  1NJI C;  2OTL A;  2JA7 H;  1XPO A;  1UWV A;  4B3M Q;  1JT8 A;  1EYG A;  2IX0 A;  2JA6 H;  2NVT H;  3PUW A;  3GTM H;  3CC7 A;  1Y14 B;  2F3I A;  4BBR G;  4EQ5 A;  1EQQ A;  3CC4 A;  3H15 A;  1HNW Q;  3CME A;  5FLM H;  4AYB G;  3BZC A;  3H0G H;  4P75 A;  5GRO A;  4TVA B;  2BH8 A;  5LMN L;  4FDB A;  4HID A;  4LFC Q;  1G6P A;  4JI6 L;  3HOX H;  5IWA L;  4LFB Q;  1L1O B;  4R1J A;  2LSS A;  1G29 1;  5FJ8 H;  3NEN A;  1K3R A;  3ULP A;  4IOC A;  3UDF A;  1N34 Q;  3ERS X;  3GTO H;  2F4V L;  1C7Y A;  4P73 A;  3TRE A;  1G51 A;  1HZA A;  3L0O A;  5IYC H;  3J80 c;  4UP9 A;  3M9B A;  5BR8 L;  4QGU A;  3F1Z A;  4HJ9 A;  3GTL H;  3HOW G;  2MQH A;  1TWH H;  3NEM A;  3DLL A;  1E3P A;  4YWM A;  1TWA H;  4A3C H;  2UXD L;  4A3I H;  1WOC A;  1K83 H;  3PV0 A;  4JC0 A;  1K73 C;  4DK6 C;  2VZA A;  3J81 i;  4B3S Q;  1FJG Q;  1L1O C;  3GTP H;  4HJ5 A;  3LGJ A;  3EN2 A;  5IP7 H;  3D0F A;  1VQO A;  4YHH Q;  3L7Z C;  3KOJ A;  2PI2 E;  4R4Q A;  1U0L A;  1WFQ A;  1YZ6 A;  4OWW B;  2R7Z G;  3UDX A;  2YTY A;  2XGT A;  1GO3 E;  1TWG H;  5M5Y H;  4DR2 Q;  4YY3 Q;  4JI7 Q;  2OQK A;  5IYB H;  2YYZ A;  1X55 A;  4KHZ A;  4LUV A;  1PHJ A;  4A3G G;  4BY7 H;  2KCM A;  4IFD G;  4POF A;  3S2H H;  4JI3 L;  4GNX B;  3I4M H;  2JA5 G;  2NZO A;  5C4J H;  3VDY A;  4UP7 A;  3A5U A;  4DR6 L;  4DR1 Q;  1HZB A;  5HGQ A;  1QZG A;  2RCN A;  3S1R H;  2IY5 B;  1H95 A;  3STB C;  3PO2 G;  1HJP A;  1IXR A;  1L1O A;  1JE5 A;  1KC8 C;  2K5V A;  2UUC Q;  1EOV A;  5GAD C;  1X56 A;  5IP9 H;  1X65 A;  2HIV A;  4IJL A;  1I94 L;  1SR3 A;  3A5Z B;  1I50 H;  4YWK A;  3EIV A;  5C0X I;  3B6Y A;  1VQ4 A;  2HHH Q;  4X66 Q;  4JYA Q;  1B7Y B;  3H3V I;  4DV3 L;  1K8A C;  2ZJR A;  1SFO H;  4GNX C;  4JI0 L;  5AJ3 L;  4XIG S;  3AEV A;  3ULJ A;  4LFA L;  4GKJ Q;  2NN6 I;  1CKM A;  4LW1 A;  4JV5 Q;  2VS1 A;  2L15 A;  4TQU S;  4PMW A;  4X62 L;  4HIO A;  4DUZ L;  3RN2 A;  5IY0 A;  1QVG A;  1PYB A;  2JJQ A;  3CCV A;  3JC6 6;  2Q2U A;  2R93 H;  3KLW A;  3U4V A;  1PH2 A;  2IX1 A;  2IHE A;  4IO9 A;  1T9H A;  4RMF A;  3A74 A;  4O0A A;  4YCU A;  1PVO A;  4KLK A;  4LNQ A;  2ASB A;  4GKK Q;  3M4Q A;  1WYD A;  1WCM G;  1VQD A;  2Z0S A;  2HT1 A;  4B3M L;  4BY1 G;  3DM3 A;  1A0I A;  1W2B A;  2R92 H;  3FP9 A;  1Z47 A;  5GQO A;  1C0A A;  2I5H A;  3HOY H;  1HNW L;  1S72 A;  1TWC H;  4IFD J;  4GLV B;  4DR4 Q;  4LFC L;  2AKW B;  4A3B H;  1YEZ A;  4B3T Q;  2LXK A;  3CCQ A;  3PUY A;  4JOI C;  2K75 A;  3JAM i;  4MTN A;  4LFB L;  1D8L A;  4GS3 A;  4A3J G;  1HNX L;  1A62 A;  1MJE A;  1J5E Q;  4Y52 H;  3H3V H;  1X54 A;  3CAM A;  3KJO A;  2D0P A;  3K0X A;  1N34 L;  4JI5 Q;  2CWA A;  3GTG H;  4RG1 A;  1VQ9 A;  3FKI H;  3NBH B;  5FLM G;  3M85 A;  1UE5 A;  1UEB A;  3J81 c;  3CCU A;  2E5L L;  2KBN A;  1XJV A;  3F2C A;  1PH8 A;  4BBS H;  3ULL A;  4PZ6 A;  2FXQ A;  4DV1 Q;  4JI1 Q;  1YHQ A;  2PQA A;  2E2J H;  2UUA Q;  4JG2 A;  3HKS A;  1U5K A;  2MFI A;  5FJ8 G;  2AMC B;  4DUY L;  1AE2 A;  1IZ6 A;  3RNU A;  3PF5 A;  4B3S L;  4P74 A;  1NE3 A;  2AWN A;  1VQA A;  5IYC G;  1PA6 A;  4JOI A;  4A75 A;  1VQK A;  3EBE A;  5DLQ E;  4A3L H;  3I2Z A;  4A93 H;  5IE8 A;  2JE6 I;  2UU9 Q;  4DR2 L;  2EQS A;  1CKN A;  1E1T A;  2GVA A;  3RLO A;  4JBW A;  4YY3 L;  1XPR A;  1PYS B;  4JI7 L;  3K80 C;  4LF6 Q;  1HH2 P;  2D0O A;  2QGQ A;  1XNQ Q;  2Q2T A;  5C44 H;  4MZ9 A;  1JJ2 A;  2CFM A;  3BU2 A;  5IP7 G;  2D62 A;  1E22 A;  2AWO A;  2WP8 J;  1HNZ Q;  4BA1 I;  3I4N H;  1K0R A;  1TWF H;  2B29 A;  5ELO A;  4DR1 L;  4DR7 L;  3M4O H;  3GDE A;  3GO5 A;  3G4S A;  1HR0 W;  1XMQ Q;  3MXN B;  1I5F A;  2C35 B;  4LF4 L;  3G71 A;  2UUC L;  3HOV H;  5IYB G;  1XTD A;  3RZO H;  2B3G A;  2WB1 E;  3CXC A;  1EIY B;  5FLX c;  4BY7 G;  1LUZ A;  4AQY Q;  4P71 A;  4X64 Q;  1KD1 C;  2GVB A;  3I4M G;  1BBW A;  4Y7N H;  1YI2 A;  4OWX B;  1PH6 A;  2HHH L;  4X66 L;  3TEH B;  1KAW A;  4DV5 Q;  4JYA L;  4A3M G;  2V1C C;  1NBW A;  1B8A A;  3GD7 A;  4IPC A;  4YWL A;  4A3K G;  1YJN A;  4PZ7 A;  1Q7Y C;  4GKJ L;  3PIO A;  1MJC A;  4JBK A;  4JV5 L;  1S40 A;  2ALY B;  3PO3 H;  4C3H H;  3BJU A;  4OO1 I;  2N78 A;  2NVX H;  2KHJ A;  2R7D A;  5K36 G;  4DV4 Q;  1FVI A;  4OWT B;  1Y1W H;  5JJK A;  1WJJ A;  2CKZ B;  3BZK A;  2KEN A;  4C3I H;  4GKK L;  1V43 A;  5JJI A;  1IYJ B;  1RL2 A;  4LWC A;  1YJW A;  4AIM A;  1S3O A;  1TXY A;  5M3F G;  5GAE C;  2YV5 A;  3JAM c;  4A3D H;  4X65 Q;  3RN5 A;  2RHS B;  2A1A A;  4NXM Q;  1D7Q A;  1VCI A;  2UXB L;  1GD7 A;  1Q12 A;  3OYY A;  3CCM A;  5ELN A;  4AYB E;  2E2H H;  4LF5 Q;  4JI8 Q;  4DR4 L;  2OCE A;  1I3Q H;  4J15 A;  2B63 H;  3D31 A;  3S15 H;  4BXX H;  4DNI A;  1J5E L;  2R92 G;  1EWI A;  5M3M G;  1VQM A;  3K7A H;  5GAH C;  4LF7 Q;  1OXS C;  1UE6 A;  1Q82 C;  1O7I A;  2MO1 A;  4HJA A;  1UE7 A;  1X9N A;  1PH9 A;  1N32 Q;  2VQE Q;  1EQR A;  1K9M C;  4JBM A;  3I56 A;  1Q86 C;  4A3B G;  3GTQ H;  4LUZ A;  1CSP A;  5C0X G;  3PUV A;  5LMN W;  1VS0 A;  1JJC B;  1KHI A;  1L2F A;  1YBY A;  3KF6 A;  5IT9 c;  4A3E H;  4NXN Q;  2BH2 A;  3CCJ A;  2OTJ A;  2EIF A;  3CCL A;  1QUQ A;  3E9H A;  3I55 A;  1CSQ A;  5EAY A;  2E2I H;  2JA8 G;  2N8N A;  3S1M H;  2PQA B;  3WWV A;  1NY4 A;  2UU9 L;  1EIF A;  1VQ5 A;  4PG3 A;  4BBS G;  4IPD A;  3S1N H;  1SN8 A;  1YNX A;  2HIX A;  2JEA I;  1JB7 A;  4QJF A;  1XNQ L;  5HY6 A;  1XNR L;  1E1O A;  1N33 Q;  1Q8K A;  1YIT A;  1M90 C;  4LF8 Q;  4B3R L;  2UUB Q;  1Y1V G;  3HOU H;  3PCO B;  1PH5 A;  1HNZ L;  1CKN B;  1SRO A;  3PF4 A;  2PI2 A;  4HIM A;  1SE8 A;  2I0Q A;  3RR5 A;  1N36 Q;  3AQQ A;  4NB3 A;  1IBK Q;  1LM0 A;  3KJP A;  4IFD I;  4A3C G;  1OTC A;  2A19 A;  1XMQ L;  2UXC Q;  4GLX A;  4YCW A;  2NVQ H;  4DR3 Q;  4X6A H;  4GN3 B;  3HOW H;  2ATW A;  2RHQ B;  2H5X A;  5C44 G;  3KYH C;  2VW9 A;  3HKZ G;  4L5S A;  1OXT A;  2VNU D;  2Q2I A;  4JI6 Q;  4DV0 Q;  3AFP A;  1UE1 A;  4X64 L;  4AQY L;  4QQB X;  2OWO A;  3UDG A;  4DV5 L;  3TRZ A;  3CPW A;  1LYL A;  5C0X J;  3TQY A;  1E7Z A;  4GOP B;  1PH7 A;  1KQS A;  2JA7 G;  3ICE A;  2RF4 A;  2ZM6 Q;  1HZC A;  1BVS A;  2YTX A;  4UPA A;  1X3F A;  4AH6 A;  1V9P A;  4OX9 Q;  3CMA A;  2JA6 G;  4POG A;  2AHO B;  1ASZ A;  4DKA C;  3GTJ H;  4HIK A;  1V1Q A;  4DV4 L;  4HJ7 A;  1EUJ A;  3H0G G;  5JEA G;  2XTI A;  3HOX G;  3OTO Q;  2WAQ G;  4A3G H;  3HOZ H;  1FJG L;  1BKB A;  4X65 L;  4NXM L;  3PO3 G;  2Y0S G;  4GOP C;  1EFW A;  4YHH L;  3KDF A;  4JI8 L;  1J6Q A;  1WI5 A;  3K7U C;  4R4O A;  3CD6 A;  1Y1W G;  3PO2 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...