3KOJA

Crystal structure of the ssb domain of q5n255_synp6 protein from synechococcus sp. northeast structural genomics consortium target snr59a.
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
102
structure length
89
Chain Sequence
HHSHMNSCILQATVVEAPQLRYAQDNQTPVAEMVVQFPGAPARLKVVGWGAVAQELQDRCRLNDEVVLEGRLRINSEKQTELTVTRVHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords uncharacterized protein ycf41
publication title Crystal structure of the SSB domain of Q5N255_SYNP6 protein from Synechococcus sp.
rcsb
source organism Synechococcus elongatus pcc 6301
total genus 14
structure length 89
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3kojA00
1VQ4A 1LTLA 2Q2HA 1YHBA 3UE1A 1VQFA 3J81j 2VQFQ 5IT9c 4PZ8A 2JK8A 4BBRG 4P71A 3CC2A 2LXKA 1VQAA 4QL5A 5FLMH 1AH9A 4R4QA 2MO0A 2D0PA 3RLNA 3T1YL 1Q82C 1VQOA 1HNXL 3PV0A 3I2ZA 1G291 2UXCQ 1N36L 1OXVA 4MNOA 1KD1C 4YCWA 2JEAI 2ZTDA 4DUZQ 3HKSA 2IX0A 5IYDH 2JEBI 1PH1A 2NZOA 3ULLA 2OQKA 2Y0SG 4Y52H 4X66L 3NEMA 2ZJQA 4LF7L 3M3YH 4RG1A 4DV6Q 3K0XA 4DNIA 4NPSA 3HOXG 1PH2A 4JI7Q 1VQ6A 2H5XA 1VQLA 2IT1A 4YY3Q 4LF5L 4DV0Q 1P8LA 3CAMA 1XPRA 2R7DA 4QIWE 4L5RC 2HHHQ 3K81C 4C2MH 1VQNA 3GTGH 4DV3L 2LSSA 3G6EA 2JA5G 3STBC 5JJIA 1XJVA 1ASYA 2CCZA 3SGIA 4A3JG 1R9TH 1EQQA 1UEBA 1SE8A 4DV5Q 2F4VL 2VW9A 1VQBA 2VS1A 3PF5A 2WB1G 2CKZB 3H0GG 5IP7G 3TS0A 1PHJA 5AJ3Q 3D0FA 4L5SA 3CCEA 2QA4A 4LF6Q 4DR4L 4DV1L 1D8LA 2OCEA 4JYAL 3RR5A 1QZHA 3TRZA 5C44G 4K0KL 1QZGA 1K9MC 5HY6A 2JQOA 2N78A 4UP7A 4A3FG 2GVAA 1T9HA 3KDFA 4OWTB 5C0XI 5E7NA 2A8VA 3GTPH 4BBRH 2KHIA 2Q2UA 1RIPA 1KIXA 3PIOA 1KHIA 2QGQA 1I50H 4JI6Q 1L1OA 1KQSA 3KLWA 1YNXA 2K52A 3ICEA 2ZJRA 4JV5L 4YWLA 3STBD 2I5LX 1Y1WG 1PH5A 5BR8L 1DGSA 3JAMi 3W5OA 1IBMQ 2VUMH 1TWCH 3T1YQ 1EOVA 1HNXQ 4RMFA 5LMNL 1PYSB 1XMQL 1N36Q 3T1HL 4DV7Q 1EQRA 4BY7G 1HZ9A 1PFSA 3G48A 2JA7G 3UDGA 5ELOA 4C3JH 2JA5H 1U5KA 4A3CH 2KBNA 4GLVB 4X66Q 4LF7Q 4A3JH 4LF9Q 2YTVA 1V43A 2Q2TA 4PZ7A 1MJCA 5H1SE 1IBLL 1X3EA 1QVFA 4LF5Q 1LM0A 5IP7H 2UUAL 4BBSG 4DV3Q 1KC8C 2L15A 3PGZA 2OQ0A 4DR1L 4NB3A 4QGUA 4EQ5A 5EAYA 1A63A 2PI2E 2IHFA 2F4VQ 2WP8J 4DAYB 3HOYH 3NELA 3TEHB 1FJGL 4X6AH 3K8AA 3PUYA 3HOVG 1E1OA 1X3GA 4GNXC 3KDFB 4DR4Q 4JBWA 1UWVA 3CCSA 4XTCS 4B3TL 1L1OB 1CKMA 4JOIA 3FKIG 4POGA 4NXNL 1XMOQ 4GS3A 3JAMc 4LNQA 1VCIA 5ELNA 1QUQA 1J6QA 3CCQA 2E5LQ 3CMAA 2WAQE 5M5WH 5GAEC 3AFQA 1NY4A 4UP9A 4A4IA 4A75A 2I5MX 4AQYQ 4MZ9A 1YITA 3GTOH 5LMNW 3TS2A 3I4MG 1KRSA 4JV5Q 1X54A 1PH8A 5BR8Q 3U58A 4BY7H 1MKHA 1PA6A 4A93G 1BKBA 4NXML 2UXDL 4KLKA 3M4PA 3RZDH 3RLFA 4DV4Q 2JA9A 4X62L 4ALPA 1XMQQ 3KJOA 3T1HQ 4P73A 3U50C 1A8VA 1E22A 4JI3L 1WFQA 5FJ8G 4BBSH 3EIVA 2UU9L 1CSQA 1TWGH 3ULJA 1J5EL 1IBLQ 4X64L 3MXNB 1MJEA 1KAWA 1TWFH 4IFDJ 2NN6G 3HOVH 3S1MH 2K50A 3CCLA 1E7ZA 4DR1Q 1YI2A 1N32Q 3F8TA 2KCMA 4JI4L 4DR2L 3S15H 2YYZA 2BH8A 3FKIH 3OYYA 1Q81C 1WI5A 5GADC 1E24A 1FJGQ 1W3SA 4O2DA 2E2IH 1XNQQ 1JT8A 1HZBA 2BH2A 1WOCA 2LXJA 4HJAA 1HH2P 1P16A 4A76A 3VDYA 2Z6KA 3L7ZC 1VQKA 1QUQB 4UY8C 1BBWA 2VUMG 3GO5A 4A3LG 2I0QA 2CQOA 5C3EG 2Y0SE 2UUBL 4GN4B 2OTLA 3I4MH 3ZJYC 2IY5B 3KFUA 3CXCA 3DLLA 4OX9L 3HFZB 2FXQA 2IHEA 3CW2C 4A3BG 1X9NA 3FP9A 1C9OA 4BA1I 4GN3B 4A93H 4DV2L 3L0OA 4A3CG 3I4OA 3RN5A 1E1TA 1WYDA 4JC0A 1N9WA 1AE3A 3HKZG 4OWXB 3M85A 3F2CA 5GAHC 3HKZE 3RN2A 1K8AC 1EIYB 4B3MQ 4POFA 5FJ8H 2WB1E 1IXRA 1YHAA 3GTJH 2YTYA 4NXMQ 2BA0A 4AYBG 4QQBX 2UXDQ 1FL0A 4AYBE 3UE0A 4GOPB 4R4IA 4B3SL 2AHOB 1IZ6A 3J80i 2Z0SA 1CKOA 1Q8KA 1TXYA 2PNHA 4TVAB 5IE8A 3HOYG 3M7NA 5JJLA 1EIFA 2E2HH 1LYLA 1VQEA 2UUCL 3GTLH 3U4ZA 3S14H 4UPAA 1A62A 4OONA 1J5EQ 4X64Q 2JA8G 3D31A 1PH4A 1H95A 4P72A 1YBYA 1X3FA 1UE5A 3M9BA 2DGYA 2AWNA 2NVYH 3S1QH 1C7YA 1NMFA 3DM3A 4GN5A 3M4OH 2D62A 4R4OA 1SFOH 2E2JH 4JI4Q 4A3LH 4A3GG 1PH3A 5C3EH 1O7IA 1SRUA 3F2DA 4GLAC 1CSPA 2IX1A 1MIUA 4PG3A 2MO1A 1K0RA 2GN5A 4A3BH 1V1QA 1B7YB 3MEFA 3K80C 1I94L 1IYJB 5C0XJ 3CCVA 2R7ZG 4JI1L 2UXBL 2B63G 5DLQE 2KCTA 3G71A 2ZM6L 2ZTCA 1XPUA 2VZAA 3I56A 1WCMG 4OX9Q 3KOJA 4JOIC 5IYCG 2K4KA 1HR0L 3PUZA 4KHPL 3A0JA 2EXDA 4B3RL 5C4XG 1OXUA 1VQPA 5IWAL 5LMUL 1VQJA 1G6PA 4C3IH 2XGTA 3J80c 1VQ7A 4L5TA 5M3FG 4YCUA 3UDIA 2ID0A 1TWAH 1UE6A 3CCUA 4J15A 4BY1H 1EUJA 2YU9H 4YWMA 3H3VH 4LFBL 3EN2A 2AWOA 3TQYA 2MNAA 4DV1Q 4YHHL 1JE5A 4A3DG 4JYAQ 2JJQA 4DR7L 2JA8H 4B3SQ 3U4VA 2EQSA 3NENA 1YJWA 4K0KQ 2NZHA 3RNUA 4DAMA 4IJLA 2K5VA 4LW1A 1JJGA 2UUCQ 1JJCB 1VQ8A 3J7ZC 4QJFA 4OO1G 1TWHH 2ATWA 2RHSB 3ERSX 4Y7NH 4DR6L 3HOWH 1K73C 4HJ8A 1IBKL 3S1NH 4A3GH 2HQLA 2N8NA 4XIGS 4P74A 4DR5L 1X56A 1VQCA 1N33L 2VL6A 3B6YA 2EIFA 2GVBA 2CFMA 3PCOB 2R7ZH 1NTGA 2B63H 1AE2A 1LUZA 3GDEA 2NVTH 3CD6A 3IRBA 2AKWB 5LMNQ 1WCMH 1HNWL 1HR0W 5IYCH 1FGUA 4BXXH 3CCRA 1I94Q 1YEZA 3PUWA 3E9HA 1Q1EA 2RCNA 4JI1Q 3PO3H 2UXBQ 2Z6KC 1Q12A 3CMEA 4LF8L 4UP8A 2R7FA 4GOPA 3A5UA 2ZM6Q 1K8GA 4IFDG 4HJ5A 1BBUA 5M3FH 1SN8A 4ME3A 1VS0A 1VQDA 5GAGC 4IOCA 2UUAQ 3BU2A 1Z9FA 4B3RQ 1YZ6A 5IWAQ 5LMUQ 2NN6I 4A3DH 3K7AH 3L2PA 1PH9A 3G4SA 1CUKA 3KF6A 1S3OA 1L2FA 4LFBQ 1D7QA 1PH7A 3K7UC 4YHHQ 3A5ZB 1BVSA 3J7A5 2F3IA 2HT1A 1U0LA 3S16H 1SLJA 2F52A 3PO2H 4IOAA 3ULPA 2PI2A 1CKNA 3CC4A 4B3TQ 2N49A 4GLXA 1FVIA 4APVA 3JC66 4DK6C 4DUYL 4JI6L 4NXNQ 1C0AA 5JJKA 5J3BA 3AQQA 1UE7A 4LWCA 2I5HA 3RLOA 1Z47A 2E8GA 1Y14B 1VQHA 1VQGA 2Q2IA 3NBHB 5IYBG 3CCJA 1IBKQ 4DR6Q 3PUVA 4JG2A 1IBML 2R93H 3I7FA 1KRTA 4DR5Q 1XTDA 1HZCA 1L1OC 5IP9G 1N33Q 1GKHA 3BJUA 4LFCL 4A3EH 2K5HA 4DV7L 4KHZA 1SMXA 1PV4A 1YIJA 2NVXH 2HIXA 4X62Q 1N34L 1HNWQ 1SROA 4LF9L 2K5NA 4AH6A 1WJJA 4WJ4A 3CCMA 4FDBA 1G51A 4JI3Q 4DK3C 3RZOH 4BY1G 4DKAC 4A3KG 4GNXB 1Y1VH 3LGJA 2UU9Q 4HIKA 4R1JA 4LF8Q 4IPGA 3H3VI 3AFPA 1GVPA 4HJ9A 1VQ9A 4IPHA 3F1ZA 1Q86C 1M1KC 1NMGA 1XPOA 2N3SA 5M3MH 3KF6B 4JI8L 4LF4L 1V9PA 2YTXA 1OXTA 3KF8B 3UDFA 1QVCA 3H15A 2BA1A 3OTOL 4R4TA 3KJPA 4GKKL 3HOUG 4TQUS 1HNZL 3HOWG 4DR2Q 4A3MG 2R92H 1GM5A 4JBJA 4BA2I 5M5YH 1CKNB 1X6OA 1KXLA 2XTIA 4LUZA 3GTMH 2K75A 1YJNA 2AMCB 2RF4A 1VQIA 1L0WA 1JB7A 1RL2A 2A1AA 4IPDA 4JBMA 2KHJA 5C0XG 4PMWA 1Q46A 1S72A 1XMOL 2ALYB 3CC7A 2OTJA 2MFIA 2OWOA 5IYBH 1OXSC 2ASBA 1K3RA 3HOZG 3PF4A 3J81i 1PYBA 2E5LL 3BZKA 2A19A 2UUBQ 1GD7A 3CP0A 4DUYQ 1YHQA 3S2DH 3UDXA 4JI2L 4AQYL 3E9IA 5IP9H 2V1CC 1B70B 2CWPA 2HIVA 2JA6G 5K36G 3F2BA 4HJ7A 4BXXG 3KYHC 1Q7YC 4DV2Q 4KI0A 3W1GA 1N8RC 5IY0A 3PO3G 4P75A 2PQAA 4HIOA 1VQ5A 3PIPA 2VQEL 4DR3L 4DV4L 2B29A 3HOXH 4LFCQ 4OWWB 2KENA 1ASZA 1YVCA 4O0AA 3I4NG 1W2BA 4JI5L 4A3KH 1I5FA 1M90C 4X65L 4JI0L 1XNRL 4L5QA 3A74A 3WWVA 3W1BA 2MQHA 1NBWA 4YWKA 1JMCA 5HGQA 1E3PA 1N34Q 2NVQH 3S2HH 3CF5A 4MTNA 2QEXA 4LFAL 4GKJL 3PSIA 4QY7A 3BZCA 4R4CA 1KL9A 3H0GH 5GROA 4HIDA 4A3IG 2R6GA 4IJHA 2YV5A 4HIMA 1NJIC 4OO1I 3TREA 2JE6I 2VQFL 3HOUH 1PVOA 1B8AA 4A3MH 1S40A 3PO2G 5FLXc 4H02A 5C44H 1N32L 4GOPC 4JI8Q 4LF4Q 1I6HH 1UE1A 2DUDA 4OXPA 4A3FH 1IL2A 5JEAG 1XNQL 1HJPA 5C4XH 3OTOQ 2UXCL 3M4QA 3J81c 4GKKQ 3HOZH 1HNZQ 5JEAJ 4DUZL 4JCVE 1NE3A 3E0EA 5FLMG 2R93G 4JBKA 2ZTEA 1VQMA 2RHQB 4DV6L 1QVGA 2WFWA 2CWAA 4A3EG 1Y1WH 2JA6H 4JI7L 1YJ9A 2K14A 4PZ6A 4DPGA 3I55A 3CQZH 4LUVA 1PH6A 1SR3A 2C35B 4YY3L 4IPCA 4DV0L 3GD7A 2WAQG 3PUXA 1EWIA 4YCVA 5IYDG 2HHHL 1X65A 2D0OA 2VY3A 2PQAB 5GQOA 4JI2Q 2PMZE 4IFDI 1A0IA 5C4JH 1HR0Q 3I4NH 3S17H 4KHPQ 4B3ML 4DV5L 1GO3E 4GNXA 4IO9A 3FHWA 1EYGA 2JA7H 1Y1VG 5AJ3L 3ER0A 4LF6L 2B3GA 2VQEQ 4LUOA 3AYHB 2ZJPA 1HZAA 3CPWA 2ES2A 4DR3Q 3GTQH 1Q1BA 1I3QH 3GTKH 2VNUD 1EFWA 5M3MG 4JI5Q 3S24A 1JJ2A 4C3HH 4X65Q 4JI0Q 4A3IH 1XNRQ 3S1RH 4WJ3M 1K83H 5M5XH 4DR7Q 4AIMA 3EBEA 1OTCA 3OW2A 4EX5A 3AEVA 3CPFA 1X55A 1OXXK 3Q8DA 4LFAQ 2R92G 4GKJQ
chains in the Genus database with same CATH superfamily
1LTLA 2Q2HA 2YU9B 3J81j 1EYCA 1EEID 1NCVA 2F4IA 2JK8A 4QL5A 2MHVA 5JPNC 3T1YL 1MSHA 1YNNC 3PV0A 1G291 1LTTD 4FF2A 4YCWA 2F0OA 2JEBI 4Y7NB 2NZOA 2PCFB 4A3GB 4LF7L 3SVMA 3M3YH 4DV6Q 1MI2A 4X3TA 2RA4A 2H5XA 1VQLA 2IT1A 4YY3Q 4DK0A 2R7DA 1Z6HA 4L5RC 1CHQD 4C3JG 2R7ZB 3G6EA 5BN4A 1JWMD 3SGIA 4HN7A 4CHTB 1R9TH 5FO8B 1IW7D 3SE0A 3I73A 2F4VL 2VS1A 4KK7A 1PHJA 2OCEA 3G7LA 4DF7A 1QZHA 2MPMA 3FMCA 4FP5D 5M3FB 1HFNA 1QZGA 4ILWA 1K9MC 4L63B 2N78A 3KBXA 4OWTB 3GTPH 1L0XB 2Q2UA 1I50H 2NTSA 3KLWA 1YNXA 3ICEA 4JV5L 1PH5A 1F2YA 2A74C 3JAMi 3W5OA 1IBMQ 3S16B 4CDFC 5J1ZA 3PO2B 3T1YQ 1EOVA 2QCPX 5KYLA 1Y69U 1K0SA 4BY7G 1EQRA 1PFSA 3H3VC 4ZUJA 4C3JH 5DNFA 1U5KA 4GLVB 2O2LD 4LF7Q 2MUYA 4B08A 4LF9Q 2YTVA 3GP7A 4C3HG 3GTJB 2L15A 1WD0A 4HTHA 4ZK9B 3MXNA 2F03A 2X6GA 4RKLA 1A63A 2IHFA 2F4VQ 1DJRD 4DGZA 3MXUA 1ZEQX 3KDFB 4JBWA 1R4QB 1ONLA 1PTOB 3KLSX 3FKIG 4DXFA 3JAMc 5ELNA 4JK1C 1BR9A 2WAQE 4HMJA 4IUQA 1NY4A 2NTTA 1YITA 5M5YB 4JV5Q 3PMFA 5JPMC 1KRSA 4HAEA 3I4MG 1X3QA 4NMZA 2LS01 4BY7H 1MKHA 2Q8RE 3S2DB 2JA9A 5C3WA 4P73A 3K5NA 3CU7A 5FJ8G 5IT9L 1H9SA 1PYWD 1TWGH 1J5EL 4OHJA 4F7XA 3KUPA 1KAWA 1EY0A 3D4RA 4KHVA 2EJFC 3KK7A 5JVH3 1E7ZA 3OWFA 1CZGA 1STAA 2YYZA 3FKIH 1QJOA 4O2DA 1STYA 1JT8A 2B2WA 3DEPA 1BBWA 3GO5A 4A3MB 2R61A 5EKIA 2Y0SE 3I4MH 1JICA 1I6HB 4OX9L 3HFZB 3CW2C 5C4XB 4F88A 4BA1I 3HOZB 4DV2L 3W2DA 1D5XC 3RN5A 5D3IB 1PTOC 3HKZG 3HKZE 1K8AC 5CV7A 5EGTA 5FJ8H 1UEAB 2WB1E 5COYA 1YHAA 2YTYA 3PO3B 4AYBG 4QQBX 2Q8TA 1G6ZA 4AYBE 1PZKD 1Q8KA 2F0SA 4TVAB 4IQZA 3S17B 5IE8A 1QB5D 4Q5VA 3U9OA 1HRJA 3U4ZA 4CJ0B 1SYFA 3MFYA 3S14H 4UPAA 3KLSA 1A62A 1J5EQ 3KLRA 3K6OA 2G9HD 1I3QB 1UE5A 3GTKB 1GHKA 1B3AA 5CMDA 1EY5A 4GN5A 3M4OH 2E2JH 1EZ6A 1FNUA 4A3GG 3QIAA 3MEHA 4GLAC 5ELFA 1MIUA 2MO1A 1DOMA 5C0XJ 1MD2D 3Q23A 2R7ZG 4JI1L 3DWAA 3G71A 2WKDA 4QF4A 4MHEA 4OX9Q 2D2CC 3PUZA 1F9QA 1OXUA 1VQPA 1Y8NB 5EQ0A 4DAVA 1G6PA 4C3IH 1QE6A 4Z9CB 5M3FG 4YCUA 2N55A 1LO5D 2ID0A 5KIXA 1TWAH 1UE6A 4B9WA 1EUJA 2YU9H 3H3VH 4LFBL 3ERQA 4DV1Q 4OIKA 4JYAQ 2JJQA 4DR7L 3QJYA 2EQSA 3NENA 4KY5A 4TRDA 4K0KQ 1I4PA 4I7ZC 4ZQ3A 1JJGA 1VQ8A 5C5LA 3IFTA 4OO1G 1D1IA 3FPUB 1CA5A 4Y7NH 4ZLTF 4A3GH 2HQLA 4XIGS 2XRSD 1SMYD 2VB3X 3NQIA 1B3QA 5FO9B 2EIFA 2PQEA 3P20A 2R7ZH 5I6YA 1LUZA 4XQNA 1ML0D 1X3PA 2AKWB 5LMNQ 1Z7TA 4BXXH 1CTMA 3BVZA 3R8BA 1UNSA 4YIJA 4JI1Q 2VUMB 2K33A 1VF7A 4GOPA 3DWPA 4HJ5A 5M3FH 4ME3A 1SJHD 5A35A 4IOCA 2RDGA 3HOXB 3BU2A 1A3TA 1EY7A 1Z9FA 1YZ6A 4G57A 4UDUC 2JA5B 3K58A 2EYPA 3OIQA 3R93A 3CKIB 5C3XA 2EOTA 1JOOA 1L2FA 4LFBQ 1TIID 1EY9A 1TVXA 4KJOA 5E4XA 4RHSA 3S16H 3PO2H 2PI2A 2CVRA 1ZYRD 1HUMA 5JJKA 4JI6L 1B53A 4R9WA 3HOYB 2KJXA 1Z47A 2E8GA 1PFMA 1VQGA 4EQNA 2K32A 3LNNA 1QOHA 4OGQC 4RCOA 1CQFA 1ESFA 3NWTA 2RQXA 1MBYA 1XTDA 1L1OC 2XWJB 1GKHA 4LFCL 2K5HA 1V1PA 4CKCA 2BDOA 2AUJD 2F0TA 4ME5A 4FO2A 1AFPA 3JAME 4N9TA 3ZYYX 4X62Q 3WOEA 1WJJA 2M2LA 3VR5A 4JI3Q 2UU9Q 3TP6A 4HIKA 4IPGA 3AFPA 1B4OA 1VQ9A 5ELCA 1PTOH 3RZDB 4I7AA 5KEEA 2N3SA 1SYDA 2YTXA 1OXTA 3UDFA 4H0LC 1K83B 5M5XB 4A3MG 1KXLA 5M5YH 1II3A 1YJNA 1CZWA 2AMCB 1L0WA 1B2TA 1RL2A 1WTXA 3HOVB 5C4XG 4FF4A 4HSVA 3HOZG 2J4XA 3J81i 1GD7A 3S2DH 4HR7B 3PIO3 5G3LD 3KBGA 2V1CC 5K36G 4NDXA 3KYHC 3W1GA 3AU7A 2EYMA 2OT2A 3NK9A 5IY0A 3PO3G 4P75A 4DV4L 2B29A 4LFCQ 2F0QA 1LTRD 4JI0L 3WWVA 5HGQA 4XYOA 1R9TB 1RKNA 4MTNA 4R4CA 4IALA 5GROA 4HIDA 5C5MA 2R6GA 4IJHA 2YV5A 2VQFL 4A3MH 4IN3A 1S40A 1SE2A 4NW2A 1I6HH 4OXPA 4A3FH 4FF1A 5C4XH 2E2HB 2UXCL 1LT5D 3J81c 3HOZH 1CK1A 3R2TA 5JEAJ 4DUZL 4JCVE 3K5MA 5FLMG 3BVMA 3W3AA 2NVYB 2K14A 3MHBA 1YJ9A 3S1QB 4XQQA 1PH6A 1SR3A 3PUXA 5IYDG 4UHVA 1X65A 2VY3A 3MC0B 3WOFA 4DU9A 4IFDI 3S17H 1KDAA 4IO9A 3SK6A 3FHWA 2HDLA 1U9RA 3EQLC 2EY6A 3CPWA 4LK1C 3OWEB 1I3QH 4BWGB 2EYFA 3GTKH 4LJZC 1FNWA 4JI0Q 1EZ8A 1ET9A 4AIMA 4X3SA 1A3UA 2Z6BA 1DOKA 2R92G 1A3VA 3Q8DA 2WV6D 4V190 1YHBA 3UE1A 2VQFQ 4PZ8A 5JJZA 3CC2A 5FLMH 4K5XA 4R4QA 3RLNA 3NUCA 1HNXL 1CT1D 3HGBA 3I2ZA 2HCCA 2UXCQ 3MFGA 2EXZA 1CFMA 1OXVA 1N36L 1KD1C 3X3NA 2ZTDA 1SE4A 4DUZQ 5IYDH 1YNJC 2EY1A 4Y52H 3NEMA 3QO2A 1SEBD 4K14A 4K8JA 4NPSA 3HOXG 2F0MA 1XPRA 3BDOA 3K81C 4DV3L 2JA5G 3STBC 2K03A 1ASYA 5M9OA 2D9UA 1WCMB 1VQBA 3PF5A 3H0GG 5IP7G 1F2MA 2B2YC 1A2UA 3L9AX 1SNCA 3CCEA 3TMEA 1TWGB 3G6JB 3MA2B 3TRZA 2O5IC 5CR3A 2XWBB 2A8VA 4RGTA 4A3DB 1RIPA 3K7AB 1KHIA 4HCEA 1F2LA 1L1OA 2ENBA 5FOBB 2K28A 5BR8L 1RTOA 3OHXC 3NQTA 2VUMH 1PRTF 1LTID 1WTQA 1HNXQ 1PYSB 2NWGA 3A8JE 2Z1CA 1N36Q 1J8IA 3A56A 1HZ9A 3G48A 5EKLA 1ZKOA 5ELOA 2JA5H 3X3MA 5FLXL 2Q2TA 4PZ7A 5A2QE 3NP8A 1JWSD 1XX8A 4CDEC 4CKBA 5IP7H 4DV3Q 1LT4D 2FMMA 1K8OA 2F0FA 2NVXB 2HUGA 2WP8J 4XT3B 3HOYH 5E4WC 4X6AH 2FINB 1BCPC 3HOVG 1S5FD 3RZOB 1Y1VB 4GNXC 1BUVT 4KD4A 2QDBA 3NWSA 1CKMA 1E0BA 4RFBA 1S4ZA 4JOIA 4V0BA 5KYIA 4POGA 4NXNL 1WTOA 1XMOQ 1VCIA 2E5LQ 2L9HA 3VYSA 5EBCA 5GAEC 4A4IA 1T5XD 1PZID 3TP7A 4AQYQ 3GTOH 1DD2A 1X54A 3NBIA 4KV6A 2F0IA 5BR8Q 3U58A 3CRKC 1PA6A 2I07B 1BKBA 1LV9A 5KRUA 4NXML 2UXDL 5G3LF 3RZDH 3RLFA 1LTBD 1M4VA 4ALPA 2A6HC 3VR4A 2K05A 3KJOA 3SEBA 3U50C 4M8AA 1E22A 2AQ3B 4LAAA 3T13A 1LTGD 4C3IB 2Z8LA 3K5LA 1MJEA 1SE3A 1DYQA 4J1MA 1TWAB 3HOVH 4A3KB 1L0YB 2B2UA 1YI2A 1N32Q 2D5DA 2Z4IA 2KCMA 4JI4L 1QNUA 1HQMC 3BZDB 3OYYA 4PNYA 5GADC 1IL8A 1XNQQ 2F0UA 2HQEA 2XIWA 1HH2P 1P16A 2Z6KA 1QUQB 1NNXA 3NTIA 4A3LG 2PW5A 2I0QA 4N8FA 4GN4B 1NR4A 2IY5B 3KFUA 3CXCA 3DLLA 1TS3A 5D65A 3U9SA 3Q24A 1X9NA 3ITPA 3I70A 1WTVA 1E1TA 4JC0A 1EU4A 3J81E 4B3MQ 1M8AA 1Y1WB 1IHZA 2H1EA 4EGVA 4NXMQ 2UXDQ 1FL0A 4GOPB 4R4IA 4XDXA 4B3SL 1AEXA 1IZ6A 4DAYA 3J80i 1TXYA 5C4JB 5ELBA 2PZWA 1CM9A 2L4NA 3E0JA 2E2HH 2JA7B 1Q3LA 1JORA 4OONA 3D31A 1H95A 3GTQB 4TSSA 1HTPA 2DGYA 2AWNA 3DM1A 5EPJA 2NVYH 3S1QH 1A6XA 4WORA 1NMFA 1NUCA 4A3IB 1C7YA 2D62A 4JI4Q 4A3LH 1FNVA 1O7IA 1SRUA 5DEHA 3N52A 2IX1A 3D6WA 2TMPA 4JW0A 5LHY1 1B7YB 5J39A 3S9WA 3K80C 1I94L 2PYKA 3BDLA 2EYLA 3MVVA 5CYUA 1WCMG 3KOJA 1CI3M 2B2YA 3A0JA 1SDFA 4KN4C 3J80c 4L5TA 3UDIA 4ZAIA 4ID6A 3CCUA 4J15A 1LT6D 2AWOA 3TQYA 1FR3A 4A93B 4C2MB 4A3DG 2DJFC 5ELEA 3HRZC 4B3SQ 2NZHA 5F2DA 2K5VA 4LW1A 3J7ZC 3Q6SA 1HQRD 1TU2B 4DR6L 1K73C 3I90A 2Z9HA 2K5QA 1X56A 2WKCA 4UAIA 3HG9A 1N33L 3NBHA 2BE5C 2CFMA 1NTGA 1AE2A 2CW0C 3GDEA 1WCMH 1RF2D 1FGUA 5D14A 1I94Q 1PMRA 2EJMA 1SYGA 1WTPA 3MZ5A 1Q12A 3CMEA 1TWCB 4G7ZC 3DXJC 4QCLA 1SN8A 1U4LA 2X69A 1VQDA 1B9NA 4QIWB 1ZXTA 2NN6I 4K5VA 4A3DH 3K7AH 3L2PA 3G4SA 5JVG3 1F77A 5IODA 3KF6A 1S3OA 5E3FA 1D7QA 2F52A 4IOAA 3CC4A 1C0AA 2QDLA 2JXMB 4FF3A 2HDMA 5J3BA 1G8ZD 1UE7A 3OPOA 2KECA 4A3FB 4JVZA 1Y14B 1IW7C 4DR6Q 5IYBG 4ODGA 5EKKA 4OEMB 4JG2A 1KRTA 3SR1A 1AN8A 1N33Q 1XXGA 1HPCA 2L11A 4DV7L 1DZ1A 4KHZA 1SMXA 1PV4A 1YIJA 2NVXH 4C3IG 4MTKA 2P5ZX 2ZXRA 1SROA 1I6VC 4AH6A 1STHA 3BG3A 3H09A 3CCMA 4FDBA 1G51A 3RZOH 4RAUC 4A3KG 1Y1VH 2LY7A 3A54A 4FNFA 4MIUA 5JOBA 4IPHA 1NMGA 1JC7A 2KEDA 5M3MH 4PQXA 3M4YA 4LF4L 4WFN3 4BBSB 1ILQA 3H15A 2BA1A 3OTOL 4R4TA 4GKKL 2J7ZA 1KNAA 1HNZL 3BDCA 2F0DA 1CKNB 1X6OA 3GTMH 1JB7A 2A1AA 4PMWA 1Q46A 3URYA 1S72A 3CC7A 1JE4A 5IYBH 1OXSC 2ASBA 1K3RA 3CHBD 1KNEA 3K0YA 2A19A 4H44C 1YHQA 3CP0A 3UDXA 5IGDA 2SOBA 2EZVA 2CWPA 2HIVA 2E2IB 4HJ7A 3HS0C 4BXXG 1HTLD 4XT1B 4DV2Q 3D8GA 1D1KA 1LLRD 4L8JA 4HIOA 3PIPA 1EY4A 1I4GA 1GUTA 2ZT9C 4DR3L 1YVCA 4O0AA 4CGYB 2IX3A 1D5MC 1W2BA 4A3KH 4S3SA 1XNRL 4L5QA 1JOKA 3D6CA 3FVQA 2F0EA 4YWKA 1BNZA 1E3PA 5KGUA 1I4RA 2V4DA 4GKJL 4QY7A 1EEFD 4ULLA 1KL9A 2PZUA 4A3IG 4HIMA 1NJIC 3QG1A 1B8AA 3PO2G 1TY0A 1LTAD 5C44H 4X3UA 2EJGC 4C1NK 3J7YW 4LF4Q 1PXUA 2B2TC 2DUDA 2K7VA 3QOJA 1HJPA 3OTOQ 4GKKQ 4H7BA 4F8MA 1HNZQ 1O7LA 4K5WA 3FPPA 4JBKA 3LWUA 2EYJA 1VQMA 5EBDA 1Y1WH 4JI7L 1PTOF 1SYBA 3I55A 3UI2A 4PV1C 2K5WA 4IUVA 4YCVA 2A6EC 2HHHL 1T5EA 1SFOB 2PQAB 3DWQA 5C3EB 1Y8PB 3A7LA 5C4JH 4DNTB 2JA7H 4A3BB 4DA2A 5AJ3L 3ER0A 4K6DA 1BXTA 4N9PA 3GTQH 4DR3Q 1G2SA 1SSOA 3S24A 4TKOB 1XNRQ 1SNDA 4A3IH 4ZKCB 4WJ3M 4IUNA 4DR7Q 1OTCA 2IWHA 3AEVA 3CPFA 1OXXK 4GKJQ 1PRTD 2PZTA 5CV9A 1EY8A 3NE5B 4BY1B 3J80E 5IT9c 3V2TA 2RKSA 4P71A 2LXKA 1VQAA 1AH9A 1K8MA 2D0PA 2KHSA 3GV6A 1Q82C 1EL0A 4I65A 3GV3A 2EYHA 5I2YA 3L3OC 4MNOA 5KNCA 1TWHB 1W6KA 2RDHA 1HXYD 2DNCA 1JQYD 3HOWB 3S1NB 3ULLA 3F2UA 2OQKA 4NKLA 2ZJQA 3GTOB 2CH4A 3H91A 4DNIA 4JI7Q 5CBAE 4LF5L 3A55A 3CAMA 1VQNA 4QIWE 4A93H 2HHHQ 4C2MH 1B44D 2B63B 2NVTB 2CCZA 1EYDA 2IPKD 3DHQA 2PO4A 2VW9A 4RH6A 3TS0A 1BOSA 3D0FA 5AJ3Q 3RR5A 1WTHA 2IW3A 4RGMA 5HY6A 2JQOA 4A3FG 3KDFA 5C0XI 3NSWA 1IYVA 2QGQA 2B2VC 4JI6Q 1KQSA 1PZJD 2K52A 2ICIA 2ZJRA 5CBEE 3STBD 5C4HA 1PRTB 4NP5A 4KN7C 1A2TA 1PFNA 1TWCH 2ZXOA 5IGBA 4OELB 3T51B 2EDGA 4RMFA 4CJ1B 1LT3D 2QKIC 3T1HL 1G2TA 2BDNA 5C4ZA 2FMCA 5DAUA 3UDGA 4A3CH 1Q8IA 2KBNA 2WINB 3RUZA 3LWEA 1V43A 1J9OA 5H1SE 1PDQA 2K6AA 2SNMA 4K2LA 4LF5Q 2E75C 2UUAL 4BBSG 1QWYA 2E2DC 1KC8C 3PGZA 1TY2A 2OQ0A 4DR1L 1K28A 4NB3A 4QGUA 2PMZB 5EAYA 4DAYB 2F0WA 1X3GA 1XTCD 1UWVA 3D3RA 4R8NA 3CCSA 4XTCS 4B3TL 1I4QA 1HA5A 4QUFA 1WVLA 4GS3A 4LNQA 4K2KA 4CDCC 3AFQA 5CGKA 2I5MX 5T1IA 4MZ9A 3TS2A 5ELDA 2HCIA 3FDTA 1O7ZA 1PH8A 2OEOA 5FO7B 1STNA 1I4XA 3IAYA 1EFID 2E76C 3M4PA 5JAVA 1BCPD 4DV4Q 1O80A 3T1HQ 1A8VA 5C6AA 3TSSA 3VA5A 4BBSH 2I46A 1DXMA 3EIVA 5FK9C 4LMQD 2K04A 1EYAA 5BN5A 4X64L 3MXNB 4FYDA 2B2TA 1TWFH 3OOCA 5L37A 2K50A 3LX0A 4ZRZA 1JR0D 4DR1Q 5BN3A 2NVQB 4F87A 4DR2L 2KEEA 3BS1A 1WTWA 2BH8A 1Q81C 1WI5A 1E24A 4FXDA 1W3SA 2E2IH 3A8KE 1ICWA 2LXJA 4HJAA 3SHLA 4KY7A 4FVMA 4A76A 3VDYA 3L7ZC 2VUMG 3Q22A 3HOUB 2CQOA 2A69D 3NHHA 2EVBA 5C3EG 2UUBL 2OTLA 3VR2A 2FXQA 3J7AF 4A3BG 3FP9A 1C9OA 1CA6A 4ZYSA 5D3DA 2BOSA 1SYCA 3EA6A 1N9WA 4OWXB 1QNKA 3F2CA 1EIYB 5TSSA 2JA6B 5EPKA 3CQZB 2DNEA 1IXRA 1YNND 1H9SB 3OIPA 3OW7A 3UE0A 5CV8A 1KABA 1CKOA 2PNHA 3M7NA 5JJLA 3HOYG 3SDZA 1VQEA 1ENFA 4G4KA 3TP5A 4CKEA 4X64Q 2A68C 1PH4A 1X3FA 3M9BA 4ABNA 4C3HB 1SJED 4R4OA 1SFOH 1PH3A 5C3EH 3F2DA 4PG3A 1K0RA 2GN5A 2PW7A 4A3BH 1QCBD 2F0NA 2CH4W 1IYJB 2O4XA 2HD3A 2UXBL 4CDDC 2B63G 2L0CA 4DNRB 2ZTCA 5IT9E 2VZAA 1XPUA 1HR0L 4KHPL 2RCFA 4B3RL 2DJGC 1F9SA 5LMUL 1HCZA 2WAQB 2GA4B 3HP3A 2A5HA 1GUWA 1SNQA 1VQ7A 2KOLA 3QWNA 1V8QA 4BY1H 4FXKC 4YWMA 3JAML 2B8GA 4U68A 2MNAA 4YHHL 3GTGB 1JE5A 2RVLA 3I8ZA 2B2VA 2L55A 4RA8A 1YJWA 3RNUA 5M3MB 5ISRA 4E6IA 2FFKB 4QJFA 5NUCA 1TWHH 3ERSX 1BF4A 1S5ED 2IL8A 3FEWX 3P1HA 4MN3A 4HJ8A 3HOWH 3S1NH 3I91A 2N8NA 1XYIA 4P74A 4DR5L 3GTMB 3TBIB 1VQCA 1HUNA 3P75A 3B6YA 2GVBA 2SEBD 1STEA 5E1FA 2AUKA 4BBRB 1STBA 2B63H 2NVTH 1OO9B 1IKMA 1B50A 2F0KA 3AB9A 3MXGA 2R3ZA 1HR0W 1TS5A 1ENAA 3CCRA 1YEZA 3PUWA 3E9HA 2UXBQ 2B2WC 4LF8L 2R7FA 1K8GA 4IFDG 2Y0SB 1UUPA 2G5DA 3A8IE 4WRDA 1TT2A 4DAPA 4B3RQ 1KTKA 1D5ZC 1CQVA 5LMUQ 3ND8A 1EWCA 4A3JB 3GQBA 1CUKA 1STGA 2OF1A 3HEJA 2CW0D 1PH7A 2WB1B 1KDBA 3K7UC 4YHHQ 2Z4HA 3A5ZB 3J7A5 1EIHA 2F3IA 1C4QA 4AYBB 1SLJA 3ULPA 2N49A 5IOCA 5C44B 1FVIA 3JC66 4DUYL 4NXNQ 1VF5C 3AQQA 3R2IA 2F3VA 2I5HA 3RLOA 3O13A 3C3LA 1VQHA 5I4DA 1IBML 2R93H 3I7FA 1K3BC 1U4RA 4DR5Q 1S5BD 5IP9G 3BJUA 4A3EH 2SNSA 1H9RA 1MGSA 3T56B 2HIXA 5M5WB 4IFDH 1H9KA 3K59A 2FHTA 2K5NA 4LF9L 4WJ4A 1C48A 2F0HA 4DK3C 3I72A 4G7OC 2CHBD 4R1JA 4RHRA 4LF8Q 1BCPF 3H3VI 3ONAB 1GVPA 2EY2A 2XN9C 3F1ZA 1Q86C 3QR8A 1XPOA 4JI8L 4BS9A 1SNOA 1QVCA 1PTOD 3HOUG 4TQUS 1EOTA 2PNRC 4JBJA 1GM5A 4LUZA 2K75A 1VQIA 4JBMA 2KHJA 4C56C 2MFIA 2OWOA 3S1MB 1PYBA 4DUYQ 3S15B 1ILPA 1IKLA 3VYRA 4JI2L 5IP9H 1B70B 3TN2A 2JA6G 3F2BA 1V1PB 3IKJA 4KTAA 4RCNA 1Q7YC 1MHWC 1N8RC 1RTNA 4WJWA 2VQEL 1B1ZA 2LMCB 1AZQA 3I4LA 3ND9A 1I5FA 1M90C 1JMCA 2NVQH 3FRPB 4IUUA 2B39A 3CF5A 4ZKBB 1NSNS 2K5DA 1XWEA 1EQTA 1RODA 4OO1I 3HOUH 1O78A 3C46A 5FLXc 4H02A 4GOPC 2JYOA 4JI8Q 1RJTA 1BQQT 1UE1A 1IL2A 1ET6A 5JEAG 3GTLB 1NE3A 1QG7A 2A73B 2NBFA 1WTRA 3AMUA 2KQ3A 2RSNA 2NB0A 2OXPA 5KNDA 3R3OA 2JA6H 1R4PB 3CQZH 4DV0L 2WAQG 3MWYW 5GQOA 3VA7A 4JI2Q 3C2PA 2JSOA 4DV5L 2F0LA 1GO3E 4GNXA 1Y1VG 4J8QA 4LF6L 2VQEQ 4LUOA 3AYHB 2ZJPA 1GUGA 1KDCA 5M3MG 1X32A 1JJ2A 4C3HH 3KF8A 1LABA 1ENCA 4OIJA 3VYUA 3EBEA 5A2QL 3OSOA 4HCSA 3OW2A 4ZUIA 2XVSA 4J6HA 4EX5A 2NUCA 2K01A 2A6ED 1KLUD 3OMCA 1VQ4A 5JEAH 1VQFA 3TDQA 4BBRG 4IUTA 2JA8B 1F9RA 2MO0A 3IFDA 1VDZA 1VQOA 1TQOA 2E74C 1WD1A 2JEAI 1JB3A 5IGCA 3HKSA 2IX0A 2RDFA 1D2BA 1PH1A 1DOLA 4QUCA 4XYQA 2Y0SG 4X66L 2L5TA 4KMUC 4RG1A 3K0XA 3SXHA 1PH2A 1VQ6A 3BVGA 4DV0Q 1P8LA 2EPBA 1IYUA 2X6LA 3GTGH 5JJIA 5FKAC 2LSSA 1XJVA 4A3JG 1EQQA 3BYTB 1UEBA 4JPBW 5IGGA 1SE8A 4DV5Q 3RMHA 4PMBA 2XNAC 2WB1G 2CKZB 2C5CA 4L5SA 2QA4A 4LF6Q 4DR4L 4DV1L 1E2VA 1D8LA 2QW7A 4JYAL 3NXWA 5C44G 1ESRA 1TS4A 1TWFB 4K0KL 2TSSA 4UP7A 2GVAA 1T9HA 5E7NA 4BBRH 2KHIA 4CBVA 1KIXA 3PIOA 1O7YA 4DXGA 4YWLA 2I5LX 1Y1WG 4KD3A 1DGSA 4L6TB 3EFXD 3V05A 1BDOA 2IJ0A 5AFWA 5IGFA 5LMNL 1XMQL 4KKUA 1F9PA 4DV7Q 2KVMA 2JA7G 3K5OA 1I4HA 1VMCA 3TZUA 4X66Q 4KY6A 4A3JH 1C8CA 1MJCA 1IBLL 1X3EA 1QVFA 4ZCKA 1LM0A 2KCNA 3J7AV 3J81L 5K5PA 3D4WA 4H13C 4DK1A 4OL7A 2ICEC 2VXWA 4EQ5A 2JN4A 2PI2E 4DN4M 2Q8IB 2KA7A 3RD4A 3NELA 3TEHB 1FJGL 5LL6X 3K8AA 3PUYA 1E1OA 4DR4Q 1QILA 1L1OB 1SAPA 2O5JC 2MGSA 2VB2X 1J6QA 1QUQA 1U4MA 3CCQA 3CMAA 5M5WH 4UP9A 1TR5A 2R92B 4A75A 2L1BA 4FXGC 4X3KA 2EYOA 5LMNW 1E2ZA 1RCVD 1TS2A 3VR3A 4U673 3C1EA 4A93G 4KLKA 4X62L 1XMQQ 3SK4A 5I9OA 4JI3L 1WFQA 2F0VA 2UU9L 1CSQA 3ULJA 3K57A 1IBLQ 2KUMA 1GJXA 1A15A 1EWHA 2SDFA 4B9XA 4IFDJ 1LTSD 2NN6G 3VR6A 1PLFA 4R8IA 3S1MH 3CCLA 2DY7A 3F8TA 3NPPA 3S15H 3S2HB 1FJGQ 2NYZD 2K1BA 3HZXA 3H0GB 4OO1H 1HHVA 1HZBA 2BH2A 1WOCA 3H94A 4UY8C 1VQKA 3E3XA 4Q0FA 1SBBB 3ZJYC 1D6EC 2J0TD 2JP1A 3C1FA 5FLXE 2IHEA 4KKTA 3E5SA 4GN3B 4IURA 5HURA 3L0OA 4A3CG 4KJNA 3I4OA 2EE1A 1WYDA 1AE3A 3M85A 1W6JA 5GAHC 3RN2A 1F2ZA 3VYTA 4POFA 3PQIA 3GTJH 2DN8A 2BA0A 4GZYC 1JOQA 2AHOB 1YNJD 2Z0SA 3I4NB 2NN6H 1EIFA 1LYLA 1V1OA 2UUCL 3GTLH 3QB3A 4K6LA 5CV6A 2JA8G 4P72A 1YBYA 5EPLA 2G9DA 1HFGA 3S1RB 3DM3A 1JCKB 4G7HC 1H9JA 1CSPA 1GHJA 1V1QA 3MEFA 3NTKA 3CCVA 5DLQE 2R93B 2PPBC 2KCTA 2ZM6L 3I56A 1SXTA 4JOIC 5IYCG 2K4KA 1SYEA 4A3EB 2A68D 2EXDA 1SMYC 5IWAL 1VQJA 4EQPA 2XGTA 3M3YB 1H9MA 3PIP3 3D4DA 1EIGA 5EJWA 1U4PA 3EN2A 3E6ZX 1EQVA 1KAAA 2JA8H 3U4VA 2AQ2B 2KCCA 4DAMA 3EROA 4IJLA 2L12A 2UUCQ 1JJCB 2ATWA 5CC4A 2RHSB 1IBKL 2N88A 5T1GA 1SNMA 3H6MA 2VL6A 3PCOB 3BYYB 3GTPB 4KKSA 2B2UC 3CD6A 1VMPA 1I50B 4IZ8A 3IRBA 1HNWL 3NTHA 1GUNA 5IYCH 5K36H 1BO0A 4RKBA 2ZXPA 1ZYRC 4HMIA 1PRTC 1Q1EA 2RCNA 3PO3H 3MAQA 2Z6KC 1AP0A 4UP8A 3A5UA 2ZM6Q 1BBUA 1VS0A 5GAGC 2UUAQ 2F3WA 5IWAQ 2B8FA 4C3JB 4QB4A 3SK5A 1PH9A 4CJ2C 3SK8A 1FYCA 1Y8OB 1JWUD 1Q90A 2M9VA 3T53B 1BVSA 2A6HD 5IIFA 2HT1A 1U0LA 4B3TQ 1CKNA 4GLXA 4APVA 2DY8A 4DK6C 1CHPD 5IGEA 4LWCA 2F0PA 2WACA 3NBHB 3P7JA 3CCJA 2Q2IA 1IBKQ 1FD7D 3PUVA 1NAPA 1HZCA 4N8X1 3CRLC 3V96A 1NR2A 3T4AC 1AW7A 4C1NI 2LKVA 3OMGA 1ICFB 1N34L 1HNWQ 2C9OA 3EJIA 1LACA 1BCPB 4BY7B 4BY1G 1S5DD 2RBMA 4DKAC 4GNXB 1UAPA 3LGJA 2BCOA 2M00A 4HSPA 5CV5A 4HJ9A 5I6WA 1M1KC 2MJ8A 5LL6S 4XXEA 3KF6B 1V9PA 3KF8B 3I3CA 3KJPA 1KLGD 3HOWG 4DR2Q 2R92H 4XQJA 4BA2I 2WIIB 2XTIA 2FJ2A 2RF4A 4IPDA 5C0XG 5HGTA 1XMOL 2ALYB 3TP8A 2OTJA 3PF4A 1B9MA 1GUSA 2E5LL 3BZKA 2UUBQ 3J80L 4AQYL 3E9IA 3FKIB 1EU3A 1S5CD 4KI0A 3DEOA 2AQ1B 1VQ5A 2PQAA 2F1MA 2XRQD 5DM63 3I4MB 4OWWB 3HOXH 5CV4A 1G91A 2KENA 1ASZA 4K8IA 1RHPA 3I4NG 4JI5L 4QMGA 1MSGA 4IUPA 4X65L 3A74A 2H4OA 3W1BA 2MQHA 1NBWA 1N34Q 2NZ1D 3S2HH 1RD9D 4P2CB 2QEXA 4LFAL 3PSIA 4RGOS 1SNPA 3BZCA 4HEDA 3H0GH 2CQAA 1DONA 4EVOA 1HA6A 2F0JA 3TREA 2JE6I 1PVOA 3QOLA 1N32L 3N6RA 4RGNA 5C0XH 1XNQL 5J22A 3M4QA 4DFAA 3EVQA 3S14B 1RDPD 1DCZA 4M1UB 4EQOA 3E0EA 5CORA 2R93G 4O1NA 1EY6A 2ZTEA 2XSCA 2RHQB 2RSOA 2QEJC 4DV6L 2WFWA 1DM0B 2CWAA 4A3EG 1QVGA 4PZ6A 4DPGA 3Q0AA 4LUVA 5DM73 2C35B 4YY3L 4IPCA 3GD7A 3M4OB 1EWIA 4RWSC 2D0OA 3MXPA 2E2JB 5KNBA 4O42A 3MTSA 3IL8A 2PMZE 1PFBA 2QF7A 1A0IA 3WDNA 1HR0Q 3I4NH 3M7GA 1GUOA 4B3ML 4KHPQ 3T16A 1GXDC 4PMCA 1EYGA 2LFNA 5I9PA 3DUZA 1FGBD 1GOZA 2B3GA 2EY5A 1HZAA 2ES2A 2BE5D 1Q1BA 3HKZB 2VNUD 1EFWA 4JI5Q 1E2WA 2MP1A 2QILA 1TKWB 2A69C 5I2XA 3A7AB 4X65Q 3S1RH 1BBXC 1K83H 5M5XH 1AZPA 3DMUA 1X55A 4LFAQ 3TZDA 2F0GA
chains in the Genus database with same CATH topology
1VQ4A 1LTLA 2Q2HA 1YHBA 3UE1A 1VQFA 3J81j 2VQFQ 5IT9c 4PZ8A 2JK8A 4BBRG 4P71A 3CC2A 2LXKA 1VQAA 4QL5A 5FLMH 1AH9A 4R4QA 2MO0A 2D0PA 3RLNA 3T1YL 1Q82C 1VQOA 1HNXL 3PV0A 3I2ZA 1G291 2UXCQ 1N36L 1OXVA 4MNOA 1KD1C 4YCWA 2JEAI 2ZTDA 4DUZQ 3HKSA 2IX0A 5IYDH 2JEBI 1PH1A 2NZOA 3ULLA 2OQKA 2Y0SG 4Y52H 4X66L 3NEMA 2ZJQA 4LF7L 3M3YH 4RG1A 4DV6Q 3K0XA 4DNIA 4NPSA 3HOXG 1PH2A 4JI7Q 1VQ6A 2H5XA 1VQLA 2IT1A 4YY3Q 4LF5L 4DV0Q 1P8LA 3CAMA 1XPRA 2R7DA 4QIWE 4L5RC 2HHHQ 3K81C 4C2MH 1VQNA 3GTGH 4DV3L 2LSSA 3G6EA 2JA5G 3STBC 5JJIA 1XJVA 1ASYA 2CCZA 3SGIA 4A3JG 1R9TH 1EQQA 1UEBA 1SE8A 4DV5Q 2F4VL 2VW9A 1VQBA 2VS1A 3PF5A 2WB1G 2CKZB 3H0GG 5IP7G 3TS0A 1PHJA 5AJ3Q 3D0FA 4L5SA 3CCEA 2QA4A 4LF6Q 4DR4L 4DV1L 1D8LA 2OCEA 4JYAL 3RR5A 1QZHA 3TRZA 5C44G 4K0KL 1QZGA 1K9MC 5HY6A 2JQOA 2N78A 4UP7A 4A3FG 2GVAA 1T9HA 3KDFA 4OWTB 5C0XI 5E7NA 2A8VA 3GTPH 4BBRH 2KHIA 2Q2UA 1RIPA 1KIXA 3PIOA 1KHIA 2QGQA 1I50H 4JI6Q 1L1OA 1KQSA 3KLWA 1YNXA 2K52A 3ICEA 2ZJRA 4JV5L 4YWLA 3STBD 2I5LX 1Y1WG 1PH5A 5BR8L 1DGSA 3JAMi 3W5OA 1IBMQ 2VUMH 1TWCH 3T1YQ 1EOVA 1HNXQ 4RMFA 5LMNL 1PYSB 1XMQL 1N36Q 3T1HL 4DV7Q 1EQRA 4BY7G 1HZ9A 1PFSA 3G48A 2JA7G 3UDGA 5ELOA 4C3JH 2JA5H 1U5KA 4A3CH 2KBNA 4GLVB 4X66Q 4LF7Q 4A3JH 4LF9Q 2YTVA 1V43A 2Q2TA 4PZ7A 1MJCA 5H1SE 1IBLL 1X3EA 1QVFA 4LF5Q 1LM0A 5IP7H 2UUAL 4BBSG 4DV3Q 1KC8C 2L15A 3PGZA 2OQ0A 4DR1L 4NB3A 4QGUA 4EQ5A 5EAYA 1A63A 2PI2E 2IHFA 2F4VQ 2WP8J 4DAYB 3HOYH 3NELA 3TEHB 1FJGL 4X6AH 3K8AA 3PUYA 3HOVG 1E1OA 1X3GA 4GNXC 3KDFB 4DR4Q 4JBWA 1UWVA 3CCSA 4XTCS 4B3TL 1L1OB 1CKMA 4JOIA 3FKIG 4POGA 4NXNL 1XMOQ 4GS3A 3JAMc 4LNQA 1VCIA 5ELNA 1QUQA 1J6QA 3CCQA 2E5LQ 3CMAA 2WAQE 5M5WH 5GAEC 3AFQA 1NY4A 4UP9A 4A4IA 4A75A 2I5MX 4AQYQ 4MZ9A 1YITA 3GTOH 5LMNW 3TS2A 3I4MG 1KRSA 4JV5Q 1X54A 1PH8A 5BR8Q 3U58A 4BY7H 1MKHA 1PA6A 4A93G 1BKBA 4NXML 2UXDL 4KLKA 3M4PA 3RZDH 3RLFA 4DV4Q 2JA9A 4X62L 4ALPA 1XMQQ 3KJOA 3T1HQ 4P73A 3U50C 1A8VA 1E22A 4JI3L 1WFQA 5FJ8G 4BBSH 3EIVA 2UU9L 1CSQA 1TWGH 3ULJA 1J5EL 1IBLQ 4X64L 3MXNB 1MJEA 1KAWA 1TWFH 4IFDJ 2NN6G 3HOVH 3S1MH 2K50A 3CCLA 1E7ZA 4DR1Q 1YI2A 1N32Q 3F8TA 2KCMA 4JI4L 4DR2L 3S15H 2YYZA 2BH8A 3FKIH 3OYYA 1Q81C 1WI5A 5GADC 1E24A 1FJGQ 1W3SA 4O2DA 2E2IH 1XNQQ 1JT8A 1HZBA 2BH2A 1WOCA 2LXJA 4HJAA 1HH2P 1P16A 4A76A 3VDYA 2Z6KA 3L7ZC 1VQKA 1QUQB 4UY8C 1BBWA 2VUMG 3GO5A 4A3LG 2I0QA 2CQOA 5C3EG 2Y0SE 2UUBL 4GN4B 2OTLA 3I4MH 3ZJYC 2IY5B 3KFUA 3CXCA 3DLLA 4OX9L 3HFZB 2FXQA 2IHEA 3CW2C 4A3BG 1X9NA 3FP9A 1C9OA 4BA1I 4GN3B 4A93H 4DV2L 3L0OA 4A3CG 3I4OA 3RN5A 1E1TA 1WYDA 4JC0A 1N9WA 1AE3A 3HKZG 4OWXB 3M85A 3F2CA 5GAHC 3HKZE 3RN2A 1K8AC 1EIYB 4B3MQ 4POFA 5FJ8H 2WB1E 1IXRA 1YHAA 3GTJH 2YTYA 4NXMQ 2BA0A 4AYBG 4QQBX 2UXDQ 1FL0A 4AYBE 3UE0A 4GOPB 4R4IA 4B3SL 2AHOB 1IZ6A 3J80i 2Z0SA 1CKOA 1Q8KA 1TXYA 2PNHA 4TVAB 5IE8A 3HOYG 3M7NA 5JJLA 1EIFA 2E2HH 1LYLA 1VQEA 2UUCL 3GTLH 3U4ZA 3S14H 4UPAA 1A62A 4OONA 1J5EQ 4X64Q 2JA8G 3D31A 1PH4A 1H95A 4P72A 1YBYA 1X3FA 1UE5A 3M9BA 2DGYA 2AWNA 2NVYH 3S1QH 1C7YA 1NMFA 3DM3A 4GN5A 3M4OH 2D62A 4R4OA 1SFOH 2E2JH 4JI4Q 4A3LH 4A3GG 1PH3A 5C3EH 1O7IA 1SRUA 3F2DA 4GLAC 1CSPA 2IX1A 1MIUA 4PG3A 2MO1A 1K0RA 2GN5A 4A3BH 1V1QA 1B7YB 3MEFA 3K80C 1I94L 1IYJB 5C0XJ 3CCVA 2R7ZG 4JI1L 2UXBL 2B63G 5DLQE 2KCTA 3G71A 2ZM6L 2ZTCA 1XPUA 2VZAA 3I56A 1WCMG 4OX9Q 3KOJA 4JOIC 5IYCG 2K4KA 1HR0L 3PUZA 4KHPL 3A0JA 2EXDA 4B3RL 5C4XG 1OXUA 1VQPA 5IWAL 5LMUL 1VQJA 1G6PA 4C3IH 2XGTA 3J80c 1VQ7A 4L5TA 5M3FG 4YCUA 3UDIA 2ID0A 1TWAH 1UE6A 3CCUA 4J15A 4BY1H 1EUJA 2YU9H 4YWMA 3H3VH 4LFBL 3EN2A 2AWOA 3TQYA 2MNAA 4DV1Q 4YHHL 1JE5A 4A3DG 4JYAQ 2JJQA 4DR7L 2JA8H 4B3SQ 3U4VA 2EQSA 3NENA 1YJWA 4K0KQ 2NZHA 3RNUA 4DAMA 4IJLA 2K5VA 4LW1A 1JJGA 2UUCQ 1JJCB 1VQ8A 3J7ZC 4QJFA 4OO1G 1TWHH 2ATWA 2RHSB 3ERSX 4Y7NH 4DR6L 3HOWH 1K73C 4HJ8A 1IBKL 3S1NH 4A3GH 2HQLA 2N8NA 4XIGS 4P74A 4DR5L 1X56A 1VQCA 1N33L 2VL6A 3B6YA 2EIFA 2GVBA 2CFMA 3PCOB 2R7ZH 1NTGA 2B63H 1AE2A 1LUZA 3GDEA 2NVTH 3CD6A 3IRBA 2AKWB 5LMNQ 1WCMH 1HNWL 1HR0W 5IYCH 1FGUA 4BXXH 3CCRA 1I94Q 1YEZA 3PUWA 3E9HA 1Q1EA 2RCNA 4JI1Q 3PO3H 2UXBQ 2Z6KC 1Q12A 3CMEA 4LF8L 4UP8A 2R7FA 4GOPA 3A5UA 2ZM6Q 1K8GA 4IFDG 4HJ5A 1BBUA 5M3FH 1SN8A 4ME3A 1VS0A 1VQDA 5GAGC 4IOCA 2UUAQ 3BU2A 1Z9FA 4B3RQ 1YZ6A 5IWAQ 5LMUQ 2NN6I 4A3DH 3K7AH 3L2PA 1PH9A 3G4SA 1CUKA 3KF6A 1S3OA 1L2FA 4LFBQ 1D7QA 1PH7A 3K7UC 4YHHQ 3A5ZB 1BVSA 3J7A5 2F3IA 2HT1A 1U0LA 3S16H 1SLJA 2F52A 3PO2H 4IOAA 3ULPA 2PI2A 1CKNA 3CC4A 4B3TQ 2N49A 4GLXA 1FVIA 4APVA 3JC66 4DK6C 4DUYL 4JI6L 4NXNQ 1C0AA 5JJKA 5J3BA 3AQQA 1UE7A 4LWCA 2I5HA 3RLOA 1Z47A 2E8GA 1Y14B 1VQHA 1VQGA 2Q2IA 3NBHB 5IYBG 3CCJA 1IBKQ 4DR6Q 3PUVA 4JG2A 1IBML 2R93H 3I7FA 1KRTA 4DR5Q 1XTDA 1HZCA 1L1OC 5IP9G 1N33Q 1GKHA 3BJUA 4LFCL 4A3EH 2K5HA 4DV7L 4KHZA 1SMXA 1PV4A 1YIJA 2NVXH 2HIXA 4X62Q 1N34L 1HNWQ 1SROA 4LF9L 2K5NA 4AH6A 1WJJA 4WJ4A 3CCMA 4FDBA 1G51A 4JI3Q 4DK3C 3RZOH 4BY1G 4DKAC 4A3KG 4GNXB 1Y1VH 3LGJA 2UU9Q 4HIKA 4R1JA 4LF8Q 4IPGA 3H3VI 3AFPA 1GVPA 4HJ9A 1VQ9A 4IPHA 3F1ZA 1Q86C 1M1KC 1NMGA 1XPOA 2N3SA 5M3MH 3KF6B 4JI8L 4LF4L 1V9PA 2YTXA 1OXTA 3KF8B 3UDFA 1QVCA 3H15A 2BA1A 3OTOL 4R4TA 3KJPA 4GKKL 3HOUG 4TQUS 1HNZL 3HOWG 4DR2Q 4A3MG 2R92H 1GM5A 4JBJA 4BA2I 5M5YH 1CKNB 1X6OA 1KXLA 2XTIA 4LUZA 3GTMH 2K75A 1YJNA 2AMCB 2RF4A 1VQIA 1L0WA 1JB7A 1RL2A 2A1AA 4IPDA 4JBMA 2KHJA 5C0XG 4PMWA 1Q46A 1S72A 1XMOL 2ALYB 3CC7A 2OTJA 2MFIA 2OWOA 5IYBH 1OXSC 2ASBA 1K3RA 3HOZG 3PF4A 3J81i 1PYBA 2E5LL 3BZKA 2A19A 2UUBQ 1GD7A 3CP0A 4DUYQ 1YHQA 3S2DH 3UDXA 4JI2L 4AQYL 3E9IA 5IP9H 2V1CC 1B70B 2CWPA 2HIVA 2JA6G 5K36G 3F2BA 4HJ7A 4BXXG 3KYHC 1Q7YC 4DV2Q 4KI0A 3W1GA 1N8RC 5IY0A 3PO3G 4P75A 2PQAA 4HIOA 1VQ5A 3PIPA 2VQEL 4DR3L 4DV4L 2B29A 3HOXH 4LFCQ 4OWWB 2KENA 1ASZA 1YVCA 4O0AA 3I4NG 1W2BA 4JI5L 4A3KH 1I5FA 1M90C 4X65L 4JI0L 1XNRL 4L5QA 3A74A 3WWVA 3W1BA 2MQHA 1NBWA 4YWKA 1JMCA 5HGQA 1E3PA 1N34Q 2NVQH 3S2HH 3CF5A 4MTNA 2QEXA 4LFAL 4GKJL 3PSIA 4QY7A 3BZCA 4R4CA 1KL9A 3H0GH 5GROA 4HIDA 4A3IG 2R6GA 4IJHA 2YV5A 4HIMA 1NJIC 4OO1I 3TREA 2JE6I 2VQFL 3HOUH 1PVOA 1B8AA 4A3MH 1S40A 3PO2G 5FLXc 4H02A 5C44H 1N32L 4GOPC 4JI8Q 4LF4Q 1I6HH 1UE1A 2DUDA 4OXPA 4A3FH 1IL2A 5JEAG 1XNQL 1HJPA 5C4XH 3OTOQ 2UXCL 3M4QA 3J81c 4GKKQ 3HOZH 1HNZQ 5JEAJ 4DUZL 4JCVE 1NE3A 3E0EA 5FLMG 2R93G 4JBKA 2ZTEA 1VQMA 2RHQB 4DV6L 1QVGA 2WFWA 2CWAA 4A3EG 1Y1WH 2JA6H 4JI7L 1YJ9A 2K14A 4PZ6A 4DPGA 3I55A 3CQZH 4LUVA 1PH6A 1SR3A 2C35B 4YY3L 4IPCA 4DV0L 3GD7A 2WAQG 3PUXA 1EWIA 4YCVA 5IYDG 2HHHL 1X65A 2D0OA 2VY3A 2PQAB 5GQOA 4JI2Q 2PMZE 4IFDI 1A0IA 5C4JH 1HR0Q 3I4NH 3S17H 4KHPQ 4B3ML 4DV5L 1GO3E 4GNXA 4IO9A 3FHWA 1EYGA 2JA7H 1Y1VG 5AJ3L 3ER0A 4LF6L 2B3GA 2VQEQ 4LUOA 3AYHB 2ZJPA 1HZAA 3CPWA 2ES2A 4DR3Q 3GTQH 1Q1BA 1I3QH 3GTKH 2VNUD 1EFWA 5M3MG 4JI5Q 3S24A 1JJ2A 4C3HH 4X65Q 4JI0Q 4A3IH 1XNRQ 3S1RH 4WJ3M 1K83H 5M5XH 4DR7Q 4AIMA 3EBEA 1OTCA 3OW2A 4EX5A 3AEVA 3CPFA 1X55A 1OXXK 3Q8DA 4LFAQ 2R92G 4GKJQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ4 A;  1LTL A;  2Q2H A;  1YHB A;  3UE1 A;  1VQF A;  3J81 j;  2VQF Q;  5IT9 c;  4PZ8 A;  2JK8 A;  4BBR G;  4P71 A;  3CC2 A;  2LXK A;  1VQA A;  4QL5 A;  5FLM H;  1AH9 A;  4R4Q A;  2MO0 A;  2D0P A;  3RLN A;  3T1Y L;  1Q82 C;  1VQO A;  1HNX L;  3PV0 A;  3I2Z A;  1G29 1;  2UXC Q;  1N36 L;  1OXV A;  4MNO A;  1KD1 C;  4YCW A;  2JEA I;  2ZTD A;  4DUZ Q;  3HKS A;  2IX0 A;  5IYD H;  2JEB I;  1PH1 A;  2NZO A;  3ULL A;  2OQK A;  2Y0S G;  4Y52 H;  4X66 L;  3NEM A;  2ZJQ A;  4LF7 L;  3M3Y H;  4RG1 A;  4DV6 Q;  3K0X A;  4DNI A;  4NPS A;  3HOX G;  1PH2 A;  4JI7 Q;  1VQ6 A;  2H5X A;  1VQL A;  2IT1 A;  4YY3 Q;  4LF5 L;  4DV0 Q;  1P8L A;  3CAM A;  1XPR A;  2R7D A;  4QIW E;  4L5R C;  2HHH Q;  3K81 C;  4C2M H;  1VQN A;  3GTG H;  4DV3 L;  2LSS A;  3G6E A;  2JA5 G;  3STB C;  5JJI A;  1XJV A;  1ASY A;  2CCZ A;  3SGI A;  4A3J G;  1R9T H;  1EQQ A;  1UEB A;  1SE8 A;  4DV5 Q;  2F4V L;  2VW9 A;  1VQB A;  2VS1 A;  3PF5 A;  2WB1 G;  2CKZ B;  3H0G G;  5IP7 G;  3TS0 A;  1PHJ A;  5AJ3 Q;  3D0F A;  4L5S A;  3CCE A;  2QA4 A;  4LF6 Q;  4DR4 L;  4DV1 L;  1D8L A;  2OCE A;  4JYA L;  3RR5 A;  1QZH A;  3TRZ A;  5C44 G;  4K0K L;  1QZG A;  1K9M C;  5HY6 A;  2JQO A;  2N78 A;  4UP7 A;  4A3F G;  2GVA A;  1T9H A;  3KDF A;  4OWT B;  5C0X I;  5E7N A;  2A8V A;  3GTP H;  4BBR H;  2KHI A;  2Q2U A;  1RIP A;  1KIX A;  3PIO A;  1KHI A;  2QGQ A;  1I50 H;  4JI6 Q;  1L1O A;  1KQS A;  3KLW A;  1YNX A;  2K52 A;  3ICE A;  2ZJR A;  4JV5 L;  4YWL A;  3STB D;  2I5L X;  1Y1W G;  1PH5 A;  5BR8 L;  1DGS A;  3JAM i;  3W5O A;  1IBM Q;  2VUM H;  1TWC H;  3T1Y Q;  1EOV A;  1HNX Q;  4RMF A;  5LMN L;  1PYS B;  1XMQ L;  1N36 Q;  3T1H L;  4DV7 Q;  1EQR A;  4BY7 G;  1HZ9 A;  1PFS A;  3G48 A;  2JA7 G;  3UDG A;  5ELO A;  4C3J H;  2JA5 H;  1U5K A;  4A3C H;  2KBN A;  4GLV B;  4X66 Q;  4LF7 Q;  4A3J H;  4LF9 Q;  2YTV A;  1V43 A;  2Q2T A;  4PZ7 A;  1MJC A;  5H1S E;  1IBL L;  1X3E A;  1QVF A;  4LF5 Q;  1LM0 A;  5IP7 H;  2UUA L;  4BBS G;  4DV3 Q;  1KC8 C;  2L15 A;  3PGZ A;  2OQ0 A;  4DR1 L;  4NB3 A;  4QGU A;  4EQ5 A;  5EAY A;  1A63 A;  2PI2 E;  2IHF A;  2F4V Q;  2WP8 J;  4DAY B;  3HOY H;  3NEL A;  3TEH B;  1FJG L;  4X6A H;  3K8A A;  3PUY A;  3HOV G;  1E1O A;  1X3G A;  4GNX C;  3KDF B;  4DR4 Q;  4JBW A;  1UWV A;  3CCS A;  4XTC S;  4B3T L;  1L1O B;  1CKM A;  4JOI A;  3FKI G;  4POG A;  4NXN L;  1XMO Q;  4GS3 A;  3JAM c;  4LNQ A;  1VCI A;  5ELN A;  1QUQ A;  1J6Q A;  3CCQ A;  2E5L Q;  3CMA A;  2WAQ E;  5M5W H;  5GAE C;  3AFQ A;  1NY4 A;  4UP9 A;  4A4I A;  4A75 A;  2I5M X;  4AQY Q;  4MZ9 A;  1YIT A;  3GTO H;  5LMN W;  3TS2 A;  3I4M G;  1KRS A;  4JV5 Q;  1X54 A;  1PH8 A;  5BR8 Q;  3U58 A;  4BY7 H;  1MKH A;  1PA6 A;  4A93 G;  1BKB A;  4NXM L;  2UXD L;  4KLK A;  3M4P A;  3RZD H;  3RLF A;  4DV4 Q;  2JA9 A;  4X62 L;  4ALP A;  1XMQ Q;  3KJO A;  3T1H Q;  4P73 A;  3U50 C;  1A8V A;  1E22 A;  4JI3 L;  1WFQ A;  5FJ8 G;  4BBS H;  3EIV A;  2UU9 L;  1CSQ A;  1TWG H;  3ULJ A;  1J5E L;  1IBL Q;  4X64 L;  3MXN B;  1MJE A;  1KAW A;  1TWF H;  4IFD J;  2NN6 G;  3HOV H;  3S1M H;  2K50 A;  3CCL A;  1E7Z A;  4DR1 Q;  1YI2 A;  1N32 Q;  3F8T A;  2KCM A;  4JI4 L;  4DR2 L;  3S15 H;  2YYZ A;  2BH8 A;  3FKI H;  3OYY A;  1Q81 C;  1WI5 A;  5GAD C;  1E24 A;  1FJG Q;  1W3S A;  4O2D A;  2E2I H;  1XNQ Q;  1JT8 A;  1HZB A;  2BH2 A;  1WOC A;  2LXJ A;  4HJA A;  1HH2 P;  1P16 A;  4A76 A;  3VDY A;  2Z6K A;  3L7Z C;  1VQK A;  1QUQ B;  4UY8 C;  1BBW A;  2VUM G;  3GO5 A;  4A3L G;  2I0Q A;  2CQO A;  5C3E G;  2Y0S E;  2UUB L;  4GN4 B;  2OTL A;  3I4M H;  3ZJY C;  2IY5 B;  3KFU A;  3CXC A;  3DLL A;  4OX9 L;  3HFZ B;  2FXQ A;  2IHE A;  3CW2 C;  4A3B G;  1X9N A;  3FP9 A;  1C9O A;  4BA1 I;  4GN3 B;  4A93 H;  4DV2 L;  3L0O A;  4A3C G;  3I4O A;  3RN5 A;  1E1T A;  1WYD A;  4JC0 A;  1N9W A;  1AE3 A;  3HKZ G;  4OWX B;  3M85 A;  3F2C A;  5GAH C;  3HKZ E;  3RN2 A;  1K8A C;  1EIY B;  4B3M Q;  4POF A;  5FJ8 H;  2WB1 E;  1IXR A;  1YHA A;  3GTJ H;  2YTY A;  4NXM Q;  2BA0 A;  4AYB G;  4QQB X;  2UXD Q;  1FL0 A;  4AYB E;  3UE0 A;  4GOP B;  4R4I A;  4B3S L;  2AHO B;  1IZ6 A;  3J80 i;  2Z0S A;  1CKO A;  1Q8K A;  1TXY A;  2PNH A;  4TVA B;  5IE8 A;  3HOY G;  3M7N A;  5JJL A;  1EIF A;  2E2H H;  1LYL A;  1VQE A;  2UUC L;  3GTL H;  3U4Z A;  3S14 H;  4UPA A;  1A62 A;  4OON A;  1J5E Q;  4X64 Q;  2JA8 G;  3D31 A;  1PH4 A;  1H95 A;  4P72 A;  1YBY A;  1X3F A;  1UE5 A;  3M9B A;  2DGY A;  2AWN A;  2NVY H;  3S1Q H;  1C7Y A;  1NMF A;  3DM3 A;  4GN5 A;  3M4O H;  2D62 A;  4R4O A;  1SFO H;  2E2J H;  4JI4 Q;  4A3L H;  4A3G G;  1PH3 A;  5C3E H;  1O7I A;  1SRU A;  3F2D A;  4GLA C;  1CSP A;  2IX1 A;  1MIU A;  4PG3 A;  2MO1 A;  1K0R A;  2GN5 A;  4A3B H;  1V1Q A;  1B7Y B;  3MEF A;  3K80 C;  1I94 L;  1IYJ B;  5C0X J;  3CCV A;  2R7Z G;  4JI1 L;  2UXB L;  2B63 G;  5DLQ E;  2KCT A;  3G71 A;  2ZM6 L;  2ZTC A;  1XPU A;  2VZA A;  3I56 A;  1WCM G;  4OX9 Q;  3KOJ A;  4JOI C;  5IYC G;  2K4K A;  1HR0 L;  3PUZ A;  4KHP L;  3A0J A;  2EXD A;  4B3R L;  5C4X G;  1OXU A;  1VQP A;  5IWA L;  5LMU L;  1VQJ A;  1G6P A;  4C3I H;  2XGT A;  3J80 c;  1VQ7 A;  4L5T A;  5M3F G;  4YCU A;  3UDI A;  2ID0 A;  1TWA H;  1UE6 A;  3CCU A;  4J15 A;  4BY1 H;  1EUJ A;  2YU9 H;  4YWM A;  3H3V H;  4LFB L;  3EN2 A;  2AWO A;  3TQY A;  2MNA A;  4DV1 Q;  4YHH L;  1JE5 A;  4A3D G;  4JYA Q;  2JJQ A;  4DR7 L;  2JA8 H;  4B3S Q;  3U4V A;  2EQS A;  3NEN A;  1YJW A;  4K0K Q;  2NZH A;  3RNU A;  4DAM A;  4IJL A;  2K5V A;  4LW1 A;  1JJG A;  2UUC Q;  1JJC B;  1VQ8 A;  3J7Z C;  4QJF A;  4OO1 G;  1TWH H;  2ATW A;  2RHS B;  3ERS X;  4Y7N H;  4DR6 L;  3HOW H;  1K73 C;  4HJ8 A;  1IBK L;  3S1N H;  4A3G H;  2HQL A;  2N8N A;  4XIG S;  4P74 A;  4DR5 L;  1X56 A;  1VQC A;  1N33 L;  2VL6 A;  3B6Y A;  2EIF A;  2GVB A;  2CFM A;  3PCO B;  2R7Z H;  1NTG A;  2B63 H;  1AE2 A;  1LUZ A;  3GDE A;  2NVT H;  3CD6 A;  3IRB A;  2AKW B;  5LMN Q;  1WCM H;  1HNW L;  1HR0 W;  5IYC H;  1FGU A;  4BXX H;  3CCR A;  1I94 Q;  1YEZ A;  3PUW A;  3E9H A;  1Q1E A;  2RCN A;  4JI1 Q;  3PO3 H;  2UXB Q;  2Z6K C;  1Q12 A;  3CME A;  4LF8 L;  4UP8 A;  2R7F A;  4GOP A;  3A5U A;  2ZM6 Q;  1K8G A;  4IFD G;  4HJ5 A;  1BBU A;  5M3F H;  1SN8 A;  4ME3 A;  1VS0 A;  1VQD A;  5GAG C;  4IOC A;  2UUA Q;  3BU2 A;  1Z9F A;  4B3R Q;  1YZ6 A;  5IWA Q;  5LMU Q;  2NN6 I;  4A3D H;  3K7A H;  3L2P A;  1PH9 A;  3G4S A;  1CUK A;  3KF6 A;  1S3O A;  1L2F A;  4LFB Q;  1D7Q A;  1PH7 A;  3K7U C;  4YHH Q;  3A5Z B;  1BVS A;  3J7A 5;  2F3I A;  2HT1 A;  1U0L A;  3S16 H;  1SLJ A;  2F52 A;  3PO2 H;  4IOA A;  3ULP A;  2PI2 A;  1CKN A;  3CC4 A;  4B3T Q;  2N49 A;  4GLX A;  1FVI A;  4APV A;  3JC6 6;  4DK6 C;  4DUY L;  4JI6 L;  4NXN Q;  1C0A A;  5JJK A;  5J3B A;  3AQQ A;  1UE7 A;  4LWC A;  2I5H A;  3RLO A;  1Z47 A;  2E8G A;  1Y14 B;  1VQH A;  1VQG A;  2Q2I A;  3NBH B;  5IYB G;  3CCJ A;  1IBK Q;  4DR6 Q;  3PUV A;  4JG2 A;  1IBM L;  2R93 H;  3I7F A;  1KRT A;  4DR5 Q;  1XTD A;  1HZC A;  1L1O C;  5IP9 G;  1N33 Q;  1GKH A;  3BJU A;  4LFC L;  4A3E H;  2K5H A;  4DV7 L;  4KHZ A;  1SMX A;  1PV4 A;  1YIJ A;  2NVX H;  2HIX A;  4X62 Q;  1N34 L;  1HNW Q;  1SRO A;  4LF9 L;  2K5N A;  4AH6 A;  1WJJ A;  4WJ4 A;  3CCM A;  4FDB A;  1G51 A;  4JI3 Q;  4DK3 C;  3RZO H;  4BY1 G;  4DKA C;  4A3K G;  4GNX B;  1Y1V H;  3LGJ A;  2UU9 Q;  4HIK A;  4R1J A;  4LF8 Q;  4IPG A;  3H3V I;  3AFP A;  1GVP A;  4HJ9 A;  1VQ9 A;  4IPH A;  3F1Z A;  1Q86 C;  1M1K C;  1NMG A;  1XPO A;  2N3S A;  5M3M H;  3KF6 B;  4JI8 L;  4LF4 L;  1V9P A;  2YTX A;  1OXT A;  3KF8 B;  3UDF A;  1QVC A;  3H15 A;  2BA1 A;  3OTO L;  4R4T A;  3KJP A;  4GKK L;  3HOU G;  4TQU S;  1HNZ L;  3HOW G;  4DR2 Q;  4A3M G;  2R92 H;  1GM5 A;  4JBJ A;  4BA2 I;  5M5Y H;  1CKN B;  1X6O A;  1KXL A;  2XTI A;  4LUZ A;  3GTM H;  2K75 A;  1YJN A;  2AMC B;  2RF4 A;  1VQI A;  1L0W A;  1JB7 A;  1RL2 A;  2A1A A;  4IPD A;  4JBM A;  2KHJ A;  5C0X G;  4PMW A;  1Q46 A;  1S72 A;  1XMO L;  2ALY B;  3CC7 A;  2OTJ A;  2MFI A;  2OWO A;  5IYB H;  1OXS C;  2ASB A;  1K3R A;  3HOZ G;  3PF4 A;  3J81 i;  1PYB A;  2E5L L;  3BZK A;  2A19 A;  2UUB Q;  1GD7 A;  3CP0 A;  4DUY Q;  1YHQ A;  3S2D H;  3UDX A;  4JI2 L;  4AQY L;  3E9I A;  5IP9 H;  2V1C C;  1B70 B;  2CWP A;  2HIV A;  2JA6 G;  5K36 G;  3F2B A;  4HJ7 A;  4BXX G;  3KYH C;  1Q7Y C;  4DV2 Q;  4KI0 A;  3W1G A;  1N8R C;  5IY0 A;  3PO3 G;  4P75 A;  2PQA A;  4HIO A;  1VQ5 A;  3PIP A;  2VQE L;  4DR3 L;  4DV4 L;  2B29 A;  3HOX H;  4LFC Q;  4OWW B;  2KEN A;  1ASZ A;  1YVC A;  4O0A A;  3I4N G;  1W2B A;  4JI5 L;  4A3K H;  1I5F A;  1M90 C;  4X65 L;  4JI0 L;  1XNR L;  4L5Q A;  3A74 A;  3WWV A;  3W1B A;  2MQH A;  1NBW A;  4YWK A;  1JMC A;  5HGQ A;  1E3P A;  1N34 Q;  2NVQ H;  3S2H H;  3CF5 A;  4MTN A;  2QEX A;  4LFA L;  4GKJ L;  3PSI A;  4QY7 A;  3BZC A;  4R4C A;  1KL9 A;  3H0G H;  5GRO A;  4HID A;  4A3I G;  2R6G A;  4IJH A;  2YV5 A;  4HIM A;  1NJI C;  4OO1 I;  3TRE A;  2JE6 I;  2VQF L;  3HOU H;  1PVO A;  1B8A A;  4A3M H;  1S40 A;  3PO2 G;  5FLX c;  4H02 A;  5C44 H;  1N32 L;  4GOP C;  4JI8 Q;  4LF4 Q;  1I6H H;  1UE1 A;  2DUD A;  4OXP A;  4A3F H;  1IL2 A;  5JEA G;  1XNQ L;  1HJP A;  5C4X H;  3OTO Q;  2UXC L;  3M4Q A;  3J81 c;  4GKK Q;  3HOZ H;  1HNZ Q;  5JEA J;  4DUZ L;  4JCV E;  1NE3 A;  3E0E A;  5FLM G;  2R93 G;  4JBK A;  2ZTE A;  1VQM A;  2RHQ B;  4DV6 L;  1QVG A;  2WFW A;  2CWA A;  4A3E G;  1Y1W H;  2JA6 H;  4JI7 L;  1YJ9 A;  2K14 A;  4PZ6 A;  4DPG A;  3I55 A;  3CQZ H;  4LUV A;  1PH6 A;  1SR3 A;  2C35 B;  4YY3 L;  4IPC A;  4DV0 L;  3GD7 A;  2WAQ G;  3PUX A;  1EWI A;  4YCV A;  5IYD G;  2HHH L;  1X65 A;  2D0O A;  2VY3 A;  2PQA B;  5GQO A;  4JI2 Q;  2PMZ E;  4IFD I;  1A0I A;  5C4J H;  1HR0 Q;  3I4N H;  3S17 H;  4KHP Q;  4B3M L;  4DV5 L;  1GO3 E;  4GNX A;  4IO9 A;  3FHW A;  1EYG A;  2JA7 H;  1Y1V G;  5AJ3 L;  3ER0 A;  4LF6 L;  2B3G A;  2VQE Q;  4LUO A;  3AYH B;  2ZJP A;  1HZA A;  3CPW A;  2ES2 A;  4DR3 Q;  3GTQ H;  1Q1B A;  1I3Q H;  3GTK H;  2VNU D;  1EFW A;  5M3M G;  4JI5 Q;  3S24 A;  1JJ2 A;  4C3H H;  4X65 Q;  4JI0 Q;  4A3I H;  1XNR Q;  3S1R H;  4WJ3 M;  1K83 H;  5M5X H;  4DR7 Q;  4AIM A;  3EBE A;  1OTC A;  3OW2 A;  4EX5 A;  3AEV A;  3CPF A;  1X55 A;  1OXX K;  3Q8D A;  4LFA Q;  2R92 G;  4GKJ Q; 
#chains in the Genus database with same CATH topology
 1LTL A;  2Q2H A;  2YU9 B;  3J81 j;  1EYC A;  1EEI D;  1NCV A;  2F4I A;  2JK8 A;  4QL5 A;  2MHV A;  5JPN C;  3T1Y L;  1MSH A;  1YNN C;  3PV0 A;  1G29 1;  1LTT D;  4FF2 A;  4YCW A;  2F0O A;  2JEB I;  4Y7N B;  2NZO A;  2PCF B;  4A3G B;  4LF7 L;  3SVM A;  3M3Y H;  4DV6 Q;  1MI2 A;  4X3T A;  2RA4 A;  2H5X A;  1VQL A;  2IT1 A;  4YY3 Q;  4DK0 A;  2R7D A;  1Z6H A;  4L5R C;  1CHQ D;  4C3J G;  2R7Z B;  3G6E A;  5BN4 A;  1JWM D;  3SGI A;  4HN7 A;  4CHT B;  1R9T H;  5FO8 B;  1IW7 D;  3SE0 A;  3I73 A;  2F4V L;  2VS1 A;  4KK7 A;  1PHJ A;  2OCE A;  3G7L A;  4DF7 A;  1QZH A;  2MPM A;  3FMC A;  4FP5 D;  5M3F B;  1HFN A;  1QZG A;  4ILW A;  1K9M C;  4L63 B;  2N78 A;  3KBX A;  4OWT B;  3GTP H;  1L0X B;  2Q2U A;  1I50 H;  2NTS A;  3KLW A;  1YNX A;  3ICE A;  4JV5 L;  1PH5 A;  1F2Y A;  2A74 C;  3JAM i;  3W5O A;  1IBM Q;  3S16 B;  4CDF C;  5J1Z A;  3PO2 B;  3T1Y Q;  1EOV A;  2QCP X;  5KYL A;  1Y69 U;  1K0S A;  4BY7 G;  1EQR A;  1PFS A;  3H3V C;  4ZUJ A;  4C3J H;  5DNF A;  1U5K A;  4GLV B;  2O2L D;  4LF7 Q;  2MUY A;  4B08 A;  4LF9 Q;  2YTV A;  3GP7 A;  4C3H G;  3GTJ B;  2L15 A;  1WD0 A;  4HTH A;  4ZK9 B;  3MXN A;  2F03 A;  2X6G A;  4RKL A;  1A63 A;  2IHF A;  2F4V Q;  1DJR D;  4DGZ A;  3MXU A;  1ZEQ X;  3KDF B;  4JBW A;  1R4Q B;  1ONL A;  1PTO B;  3KLS X;  3FKI G;  4DXF A;  3JAM c;  5ELN A;  4JK1 C;  1BR9 A;  2WAQ E;  4HMJ A;  4IUQ A;  1NY4 A;  2NTT A;  1YIT A;  5M5Y B;  4JV5 Q;  3PMF A;  5JPM C;  1KRS A;  4HAE A;  3I4M G;  1X3Q A;  4NMZ A;  2LS0 1;  4BY7 H;  1MKH A;  2Q8R E;  3S2D B;  2JA9 A;  5C3W A;  4P73 A;  3K5N A;  3CU7 A;  5FJ8 G;  5IT9 L;  1H9S A;  1PYW D;  1TWG H;  1J5E L;  4OHJ A;  4F7X A;  3KUP A;  1KAW A;  1EY0 A;  3D4R A;  4KHV A;  2EJF C;  3KK7 A;  5JVH 3;  1E7Z A;  3OWF A;  1CZG A;  1STA A;  2YYZ A;  3FKI H;  1QJO A;  4O2D A;  1STY A;  1JT8 A;  2B2W A;  3DEP A;  1BBW A;  3GO5 A;  4A3M B;  2R61 A;  5EKI A;  2Y0S E;  3I4M H;  1JIC A;  1I6H B;  4OX9 L;  3HFZ B;  3CW2 C;  5C4X B;  4F88 A;  4BA1 I;  3HOZ B;  4DV2 L;  3W2D A;  1D5X C;  3RN5 A;  5D3I B;  1PTO C;  3HKZ G;  3HKZ E;  1K8A C;  5CV7 A;  5EGT A;  5FJ8 H;  1UEA B;  2WB1 E;  5COY A;  1YHA A;  2YTY A;  3PO3 B;  4AYB G;  4QQB X;  2Q8T A;  1G6Z A;  4AYB E;  1PZK D;  1Q8K A;  2F0S A;  4TVA B;  4IQZ A;  3S17 B;  5IE8 A;  1QB5 D;  4Q5V A;  3U9O A;  1HRJ A;  3U4Z A;  4CJ0 B;  1SYF A;  3MFY A;  3S14 H;  4UPA A;  3KLS A;  1A62 A;  1J5E Q;  3KLR A;  3K6O A;  2G9H D;  1I3Q B;  1UE5 A;  3GTK B;  1GHK A;  1B3A A;  5CMD A;  1EY5 A;  4GN5 A;  3M4O H;  2E2J H;  1EZ6 A;  1FNU A;  4A3G G;  3QIA A;  3MEH A;  4GLA C;  5ELF A;  1MIU A;  2MO1 A;  1DOM A;  5C0X J;  1MD2 D;  3Q23 A;  2R7Z G;  4JI1 L;  3DWA A;  3G71 A;  2WKD A;  4QF4 A;  4MHE A;  4OX9 Q;  2D2C C;  3PUZ A;  1F9Q A;  1OXU A;  1VQP A;  1Y8N B;  5EQ0 A;  4DAV A;  1G6P A;  4C3I H;  1QE6 A;  4Z9C B;  5M3F G;  4YCU A;  2N55 A;  1LO5 D;  2ID0 A;  5KIX A;  1TWA H;  1UE6 A;  4B9W A;  1EUJ A;  2YU9 H;  3H3V H;  4LFB L;  3ERQ A;  4DV1 Q;  4OIK A;  4JYA Q;  2JJQ A;  4DR7 L;  3QJY A;  2EQS A;  3NEN A;  4KY5 A;  4TRD A;  4K0K Q;  1I4P A;  4I7Z C;  4ZQ3 A;  1JJG A;  1VQ8 A;  5C5L A;  3IFT A;  4OO1 G;  1D1I A;  3FPU B;  1CA5 A;  4Y7N H;  4ZLT F;  4A3G H;  2HQL A;  4XIG S;  2XRS D;  1SMY D;  2VB3 X;  3NQI A;  1B3Q A;  5FO9 B;  2EIF A;  2PQE A;  3P20 A;  2R7Z H;  5I6Y A;  1LUZ A;  4XQN A;  1ML0 D;  1X3P A;  2AKW B;  5LMN Q;  1Z7T A;  4BXX H;  1CTM A;  3BVZ A;  3R8B A;  1UNS A;  4YIJ A;  4JI1 Q;  2VUM B;  2K33 A;  1VF7 A;  4GOP A;  3DWP A;  4HJ5 A;  5M3F H;  4ME3 A;  1SJH D;  5A35 A;  4IOC A;  2RDG A;  3HOX B;  3BU2 A;  1A3T A;  1EY7 A;  1Z9F A;  1YZ6 A;  4G57 A;  4UDU C;  2JA5 B;  3K58 A;  2EYP A;  3OIQ A;  3R93 A;  3CKI B;  5C3X A;  2EOT A;  1JOO A;  1L2F A;  4LFB Q;  1TII D;  1EY9 A;  1TVX A;  4KJO A;  5E4X A;  4RHS A;  3S16 H;  3PO2 H;  2PI2 A;  2CVR A;  1ZYR D;  1HUM A;  5JJK A;  4JI6 L;  1B53 A;  4R9W A;  3HOY B;  2KJX A;  1Z47 A;  2E8G A;  1PFM A;  1VQG A;  4EQN A;  2K32 A;  3LNN A;  1QOH A;  4OGQ C;  4RCO A;  1CQF A;  1ESF A;  3NWT A;  2RQX A;  1MBY A;  1XTD A;  1L1O C;  2XWJ B;  1GKH A;  4LFC L;  2K5H A;  1V1P A;  4CKC A;  2BDO A;  2AUJ D;  2F0T A;  4ME5 A;  4FO2 A;  1AFP A;  3JAM E;  4N9T A;  3ZYY X;  4X62 Q;  3WOE A;  1WJJ A;  2M2L A;  3VR5 A;  4JI3 Q;  2UU9 Q;  3TP6 A;  4HIK A;  4IPG A;  3AFP A;  1B4O A;  1VQ9 A;  5ELC A;  1PTO H;  3RZD B;  4I7A A;  5KEE A;  2N3S A;  1SYD A;  2YTX A;  1OXT A;  3UDF A;  4H0L C;  1K83 B;  5M5X B;  4A3M G;  1KXL A;  5M5Y H;  1II3 A;  1YJN A;  1CZW A;  2AMC B;  1L0W A;  1B2T A;  1RL2 A;  1WTX A;  3HOV B;  5C4X G;  4FF4 A;  4HSV A;  3HOZ G;  2J4X A;  3J81 i;  1GD7 A;  3S2D H;  4HR7 B;  3PIO 3;  5G3L D;  3KBG A;  2V1C C;  5K36 G;  4NDX A;  3KYH C;  3W1G A;  3AU7 A;  2EYM A;  2OT2 A;  3NK9 A;  5IY0 A;  3PO3 G;  4P75 A;  4DV4 L;  2B29 A;  4LFC Q;  2F0Q A;  1LTR D;  4JI0 L;  3WWV A;  5HGQ A;  4XYO A;  1R9T B;  1RKN A;  4MTN A;  4R4C A;  4IAL A;  5GRO A;  4HID A;  5C5M A;  2R6G A;  4IJH A;  2YV5 A;  2VQF L;  4A3M H;  4IN3 A;  1S40 A;  1SE2 A;  4NW2 A;  1I6H H;  4OXP A;  4A3F H;  4FF1 A;  5C4X H;  2E2H B;  2UXC L;  1LT5 D;  3J81 c;  3HOZ H;  1CK1 A;  3R2T A;  5JEA J;  4DUZ L;  4JCV E;  3K5M A;  5FLM G;  3BVM A;  3W3A A;  2NVY B;  2K14 A;  3MHB A;  1YJ9 A;  3S1Q B;  4XQQ A;  1PH6 A;  1SR3 A;  3PUX A;  5IYD G;  4UHV A;  1X65 A;  2VY3 A;  3MC0 B;  3WOF A;  4DU9 A;  4IFD I;  3S17 H;  1KDA A;  4IO9 A;  3SK6 A;  3FHW A;  2HDL A;  1U9R A;  3EQL C;  2EY6 A;  3CPW A;  4LK1 C;  3OWE B;  1I3Q H;  4BWG B;  2EYF A;  3GTK H;  4LJZ C;  1FNW A;  4JI0 Q;  1EZ8 A;  1ET9 A;  4AIM A;  4X3S A;  1A3U A;  2Z6B A;  1DOK A;  2R92 G;  1A3V A;  3Q8D A;  2WV6 D;  4V19 0;  1YHB A;  3UE1 A;  2VQF Q;  4PZ8 A;  5JJZ A;  3CC2 A;  5FLM H;  4K5X A;  4R4Q A;  3RLN A;  3NUC A;  1HNX L;  1CT1 D;  3HGB A;  3I2Z A;  2HCC A;  2UXC Q;  3MFG A;  2EXZ A;  1CFM A;  1OXV A;  1N36 L;  1KD1 C;  3X3N A;  2ZTD A;  1SE4 A;  4DUZ Q;  5IYD H;  1YNJ C;  2EY1 A;  4Y52 H;  3NEM A;  3QO2 A;  1SEB D;  4K14 A;  4K8J A;  4NPS A;  3HOX G;  2F0M A;  1XPR A;  3BDO A;  3K81 C;  4DV3 L;  2JA5 G;  3STB C;  2K03 A;  1ASY A;  5M9O A;  2D9U A;  1WCM B;  1VQB A;  3PF5 A;  3H0G G;  5IP7 G;  1F2M A;  2B2Y C;  1A2U A;  3L9A X;  1SNC A;  3CCE A;  3TME A;  1TWG B;  3G6J B;  3MA2 B;  3TRZ A;  2O5I C;  5CR3 A;  2XWB B;  2A8V A;  4RGT A;  4A3D B;  1RIP A;  3K7A B;  1KHI A;  4HCE A;  1F2L A;  1L1O A;  2ENB A;  5FOB B;  2K28 A;  5BR8 L;  1RTO A;  3OHX C;  3NQT A;  2VUM H;  1PRT F;  1LTI D;  1WTQ A;  1HNX Q;  1PYS B;  2NWG A;  3A8J E;  2Z1C A;  1N36 Q;  1J8I A;  3A56 A;  1HZ9 A;  3G48 A;  5EKL A;  1ZKO A;  5ELO A;  2JA5 H;  3X3M A;  5FLX L;  2Q2T A;  4PZ7 A;  5A2Q E;  3NP8 A;  1JWS D;  1XX8 A;  4CDE C;  4CKB A;  5IP7 H;  4DV3 Q;  1LT4 D;  2FMM A;  1K8O A;  2F0F A;  2NVX B;  2HUG A;  2WP8 J;  4XT3 B;  3HOY H;  5E4W C;  4X6A H;  2FIN B;  1BCP C;  3HOV G;  1S5F D;  3RZO B;  1Y1V B;  4GNX C;  1BUV T;  4KD4 A;  2QDB A;  3NWS A;  1CKM A;  1E0B A;  4RFB A;  1S4Z A;  4JOI A;  4V0B A;  5KYI A;  4POG A;  4NXN L;  1WTO A;  1XMO Q;  1VCI A;  2E5L Q;  2L9H A;  3VYS A;  5EBC A;  5GAE C;  4A4I A;  1T5X D;  1PZI D;  3TP7 A;  4AQY Q;  3GTO H;  1DD2 A;  1X54 A;  3NBI A;  4KV6 A;  2F0I A;  5BR8 Q;  3U58 A;  3CRK C;  1PA6 A;  2I07 B;  1BKB A;  1LV9 A;  5KRU A;  4NXM L;  2UXD L;  5G3L F;  3RZD H;  3RLF A;  1LTB D;  1M4V A;  4ALP A;  2A6H C;  3VR4 A;  2K05 A;  3KJO A;  3SEB A;  3U50 C;  4M8A A;  1E22 A;  2AQ3 B;  4LAA A;  3T13 A;  1LTG D;  4C3I B;  2Z8L A;  3K5L A;  1MJE A;  1SE3 A;  1DYQ A;  4J1M A;  1TWA B;  3HOV H;  4A3K B;  1L0Y B;  2B2U A;  1YI2 A;  1N32 Q;  2D5D A;  2Z4I A;  2KCM A;  4JI4 L;  1QNU A;  1HQM C;  3BZD B;  3OYY A;  4PNY A;  5GAD C;  1IL8 A;  1XNQ Q;  2F0U A;  2HQE A;  2XIW A;  1HH2 P;  1P16 A;  2Z6K A;  1QUQ B;  1NNX A;  3NTI A;  4A3L G;  2PW5 A;  2I0Q A;  4N8F A;  4GN4 B;  1NR4 A;  2IY5 B;  3KFU A;  3CXC A;  3DLL A;  1TS3 A;  5D65 A;  3U9S A;  3Q24 A;  1X9N A;  3ITP A;  3I70 A;  1WTV A;  1E1T A;  4JC0 A;  1EU4 A;  3J81 E;  4B3M Q;  1M8A A;  1Y1W B;  1IHZ A;  2H1E A;  4EGV A;  4NXM Q;  2UXD Q;  1FL0 A;  4GOP B;  4R4I A;  4XDX A;  4B3S L;  1AEX A;  1IZ6 A;  4DAY A;  3J80 i;  1TXY A;  5C4J B;  5ELB A;  2PZW A;  1CM9 A;  2L4N A;  3E0J A;  2E2H H;  2JA7 B;  1Q3L A;  1JOR A;  4OON A;  3D31 A;  1H95 A;  3GTQ B;  4TSS A;  1HTP A;  2DGY A;  2AWN A;  3DM1 A;  5EPJ A;  2NVY H;  3S1Q H;  1A6X A;  4WOR A;  1NMF A;  1NUC A;  4A3I B;  1C7Y A;  2D62 A;  4JI4 Q;  4A3L H;  1FNV A;  1O7I A;  1SRU A;  5DEH A;  3N52 A;  2IX1 A;  3D6W A;  2TMP A;  4JW0 A;  5LHY 1;  1B7Y B;  5J39 A;  3S9W A;  3K80 C;  1I94 L;  2PYK A;  3BDL A;  2EYL A;  3MVV A;  5CYU A;  1WCM G;  3KOJ A;  1CI3 M;  2B2Y A;  3A0J A;  1SDF A;  4KN4 C;  3J80 c;  4L5T A;  3UDI A;  4ZAI A;  4ID6 A;  3CCU A;  4J15 A;  1LT6 D;  2AWO A;  3TQY A;  1FR3 A;  4A93 B;  4C2M B;  4A3D G;  2DJF C;  5ELE A;  3HRZ C;  4B3S Q;  2NZH A;  5F2D A;  2K5V A;  4LW1 A;  3J7Z C;  3Q6S A;  1HQR D;  1TU2 B;  4DR6 L;  1K73 C;  3I90 A;  2Z9H A;  2K5Q A;  1X56 A;  2WKC A;  4UAI A;  3HG9 A;  1N33 L;  3NBH A;  2BE5 C;  2CFM A;  1NTG A;  1AE2 A;  2CW0 C;  3GDE A;  1WCM H;  1RF2 D;  1FGU A;  5D14 A;  1I94 Q;  1PMR A;  2EJM A;  1SYG A;  1WTP A;  3MZ5 A;  1Q12 A;  3CME A;  1TWC B;  4G7Z C;  3DXJ C;  4QCL A;  1SN8 A;  1U4L A;  2X69 A;  1VQD A;  1B9N A;  4QIW B;  1ZXT A;  2NN6 I;  4K5V A;  4A3D H;  3K7A H;  3L2P A;  3G4S A;  5JVG 3;  1F77 A;  5IOD A;  3KF6 A;  1S3O A;  5E3F A;  1D7Q A;  2F52 A;  4IOA A;  3CC4 A;  1C0A A;  2QDL A;  2JXM B;  4FF3 A;  2HDM A;  5J3B A;  1G8Z D;  1UE7 A;  3OPO A;  2KEC A;  4A3F B;  4JVZ A;  1Y14 B;  1IW7 C;  4DR6 Q;  5IYB G;  4ODG A;  5EKK A;  4OEM B;  4JG2 A;  1KRT A;  3SR1 A;  1AN8 A;  1N33 Q;  1XXG A;  1HPC A;  2L11 A;  4DV7 L;  1DZ1 A;  4KHZ A;  1SMX A;  1PV4 A;  1YIJ A;  2NVX H;  4C3I G;  4MTK A;  2P5Z X;  2ZXR A;  1SRO A;  1I6V C;  4AH6 A;  1STH A;  3BG3 A;  3H09 A;  3CCM A;  4FDB A;  1G51 A;  3RZO H;  4RAU C;  4A3K G;  1Y1V H;  2LY7 A;  3A54 A;  4FNF A;  4MIU A;  5JOB A;  4IPH A;  1NMG A;  1JC7 A;  2KED A;  5M3M H;  4PQX A;  3M4Y A;  4LF4 L;  4WFN 3;  4BBS B;  1ILQ A;  3H15 A;  2BA1 A;  3OTO L;  4R4T A;  4GKK L;  2J7Z A;  1KNA A;  1HNZ L;  3BDC A;  2F0D A;  1CKN B;  1X6O A;  3GTM H;  1JB7 A;  2A1A A;  4PMW A;  1Q46 A;  3URY A;  1S72 A;  3CC7 A;  1JE4 A;  5IYB H;  1OXS C;  2ASB A;  1K3R A;  3CHB D;  1KNE A;  3K0Y A;  2A19 A;  4H44 C;  1YHQ A;  3CP0 A;  3UDX A;  5IGD A;  2SOB A;  2EZV A;  2CWP A;  2HIV A;  2E2I B;  4HJ7 A;  3HS0 C;  4BXX G;  1HTL D;  4XT1 B;  4DV2 Q;  3D8G A;  1D1K A;  1LLR D;  4L8J A;  4HIO A;  3PIP A;  1EY4 A;  1I4G A;  1GUT A;  2ZT9 C;  4DR3 L;  1YVC A;  4O0A A;  4CGY B;  2IX3 A;  1D5M C;  1W2B A;  4A3K H;  4S3S A;  1XNR L;  4L5Q A;  1JOK A;  3D6C A;  3FVQ A;  2F0E A;  4YWK A;  1BNZ A;  1E3P A;  5KGU A;  1I4R A;  2V4D A;  4GKJ L;  4QY7 A;  1EEF D;  4ULL A;  1KL9 A;  2PZU A;  4A3I G;  4HIM A;  1NJI C;  3QG1 A;  1B8A A;  3PO2 G;  1TY0 A;  1LTA D;  5C44 H;  4X3U A;  2EJG C;  4C1N K;  3J7Y W;  4LF4 Q;  1PXU A;  2B2T C;  2DUD A;  2K7V A;  3QOJ A;  1HJP A;  3OTO Q;  4GKK Q;  4H7B A;  4F8M A;  1HNZ Q;  1O7L A;  4K5W A;  3FPP A;  4JBK A;  3LWU A;  2EYJ A;  1VQM A;  5EBD A;  1Y1W H;  4JI7 L;  1PTO F;  1SYB A;  3I55 A;  3UI2 A;  4PV1 C;  2K5W A;  4IUV A;  4YCV A;  2A6E C;  2HHH L;  1T5E A;  1SFO B;  2PQA B;  3DWQ A;  5C3E B;  1Y8P B;  3A7L A;  5C4J H;  4DNT B;  2JA7 H;  4A3B B;  4DA2 A;  5AJ3 L;  3ER0 A;  4K6D A;  1BXT A;  4N9P A;  3GTQ H;  4DR3 Q;  1G2S A;  1SSO A;  3S24 A;  4TKO B;  1XNR Q;  1SND A;  4A3I H;  4ZKC B;  4WJ3 M;  4IUN A;  4DR7 Q;  1OTC A;  2IWH A;  3AEV A;  3CPF A;  1OXX K;  4GKJ Q;  1PRT D;  2PZT A;  5CV9 A;  1EY8 A;  3NE5 B;  4BY1 B;  3J80 E;  5IT9 c;  3V2T A;  2RKS A;  4P71 A;  2LXK A;  1VQA A;  1AH9 A;  1K8M A;  2D0P A;  2KHS A;  3GV6 A;  1Q82 C;  1EL0 A;  4I65 A;  3GV3 A;  2EYH A;  5I2Y A;  3L3O C;  4MNO A;  5KNC A;  1TWH B;  1W6K A;  2RDH A;  1HXY D;  2DNC A;  1JQY D;  3HOW B;  3S1N B;  3ULL A;  3F2U A;  2OQK A;  4NKL A;  2ZJQ A;  3GTO B;  2CH4 A;  3H91 A;  4DNI A;  4JI7 Q;  5CBA E;  4LF5 L;  3A55 A;  3CAM A;  1VQN A;  4QIW E;  4A93 H;  2HHH Q;  4C2M H;  1B44 D;  2B63 B;  2NVT B;  2CCZ A;  1EYD A;  2IPK D;  3DHQ A;  2PO4 A;  2VW9 A;  4RH6 A;  3TS0 A;  1BOS A;  3D0F A;  5AJ3 Q;  3RR5 A;  1WTH A;  2IW3 A;  4RGM A;  5HY6 A;  2JQO A;  4A3F G;  3KDF A;  5C0X I;  3NSW A;  1IYV A;  2QGQ A;  2B2V C;  4JI6 Q;  1KQS A;  1PZJ D;  2K52 A;  2ICI A;  2ZJR A;  5CBE E;  3STB D;  5C4H A;  1PRT B;  4NP5 A;  4KN7 C;  1A2T A;  1PFN A;  1TWC H;  2ZXO A;  5IGB A;  4OEL B;  3T51 B;  2EDG A;  4RMF A;  4CJ1 B;  1LT3 D;  2QKI C;  3T1H L;  1G2T A;  2BDN A;  5C4Z A;  2FMC A;  5DAU A;  3UDG A;  4A3C H;  1Q8I A;  2KBN A;  2WIN B;  3RUZ A;  3LWE A;  1V43 A;  1J9O A;  5H1S E;  1PDQ A;  2K6A A;  2SNM A;  4K2L A;  4LF5 Q;  2E75 C;  2UUA L;  4BBS G;  1QWY A;  2E2D C;  1KC8 C;  3PGZ A;  1TY2 A;  2OQ0 A;  4DR1 L;  1K28 A;  4NB3 A;  4QGU A;  2PMZ B;  5EAY A;  4DAY B;  2F0W A;  1X3G A;  1XTC D;  1UWV A;  3D3R A;  4R8N A;  3CCS A;  4XTC S;  4B3T L;  1I4Q A;  1HA5 A;  4QUF A;  1WVL A;  4GS3 A;  4LNQ A;  4K2K A;  4CDC C;  3AFQ A;  5CGK A;  2I5M X;  5T1I A;  4MZ9 A;  3TS2 A;  5ELD A;  2HCI A;  3FDT A;  1O7Z A;  1PH8 A;  2OEO A;  5FO7 B;  1STN A;  1I4X A;  3IAY A;  1EFI D;  2E76 C;  3M4P A;  5JAV A;  1BCP D;  4DV4 Q;  1O80 A;  3T1H Q;  1A8V A;  5C6A A;  3TSS A;  3VA5 A;  4BBS H;  2I46 A;  1DXM A;  3EIV A;  5FK9 C;  4LMQ D;  2K04 A;  1EYA A;  5BN5 A;  4X64 L;  3MXN B;  4FYD A;  2B2T A;  1TWF H;  3OOC A;  5L37 A;  2K50 A;  3LX0 A;  4ZRZ A;  1JR0 D;  4DR1 Q;  5BN3 A;  2NVQ B;  4F87 A;  4DR2 L;  2KEE A;  3BS1 A;  1WTW A;  2BH8 A;  1Q81 C;  1WI5 A;  1E24 A;  4FXD A;  1W3S A;  2E2I H;  3A8K E;  1ICW A;  2LXJ A;  4HJA A;  3SHL A;  4KY7 A;  4FVM A;  4A76 A;  3VDY A;  3L7Z C;  2VUM G;  3Q22 A;  3HOU B;  2CQO A;  2A69 D;  3NHH A;  2EVB A;  5C3E G;  2UUB L;  2OTL A;  3VR2 A;  2FXQ A;  3J7A F;  4A3B G;  3FP9 A;  1C9O A;  1CA6 A;  4ZYS A;  5D3D A;  2BOS A;  1SYC A;  3EA6 A;  1N9W A;  4OWX B;  1QNK A;  3F2C A;  1EIY B;  5TSS A;  2JA6 B;  5EPK A;  3CQZ B;  2DNE A;  1IXR A;  1YNN D;  1H9S B;  3OIP A;  3OW7 A;  3UE0 A;  5CV8 A;  1KAB A;  1CKO A;  2PNH A;  3M7N A;  5JJL A;  3HOY G;  3SDZ A;  1VQE A;  1ENF A;  4G4K A;  3TP5 A;  4CKE A;  4X64 Q;  2A68 C;  1PH4 A;  1X3F A;  3M9B A;  4ABN A;  4C3H B;  1SJE D;  4R4O A;  1SFO H;  1PH3 A;  5C3E H;  3F2D A;  4PG3 A;  1K0R A;  2GN5 A;  2PW7 A;  4A3B H;  1QCB D;  2F0N A;  2CH4 W;  1IYJ B;  2O4X A;  2HD3 A;  2UXB L;  4CDD C;  2B63 G;  2L0C A;  4DNR B;  2ZTC A;  5IT9 E;  2VZA A;  1XPU A;  1HR0 L;  4KHP L;  2RCF A;  4B3R L;  2DJG C;  1F9S A;  5LMU L;  1HCZ A;  2WAQ B;  2GA4 B;  3HP3 A;  2A5H A;  1GUW A;  1SNQ A;  1VQ7 A;  2KOL A;  3QWN A;  1V8Q A;  4BY1 H;  4FXK C;  4YWM A;  3JAM L;  2B8G A;  4U68 A;  2MNA A;  4YHH L;  3GTG B;  1JE5 A;  2RVL A;  3I8Z A;  2B2V A;  2L55 A;  4RA8 A;  1YJW A;  3RNU A;  5M3M B;  5ISR A;  4E6I A;  2FFK B;  4QJF A;  5NUC A;  1TWH H;  3ERS X;  1BF4 A;  1S5E D;  2IL8 A;  3FEW X;  3P1H A;  4MN3 A;  4HJ8 A;  3HOW H;  3S1N H;  3I91 A;  2N8N A;  1XYI A;  4P74 A;  4DR5 L;  3GTM B;  3TBI B;  1VQC A;  1HUN A;  3P75 A;  3B6Y A;  2GVB A;  2SEB D;  1STE A;  5E1F A;  2AUK A;  4BBR B;  1STB A;  2B63 H;  2NVT H;  1OO9 B;  1IKM A;  1B50 A;  2F0K A;  3AB9 A;  3MXG A;  2R3Z A;  1HR0 W;  1TS5 A;  1ENA A;  3CCR A;  1YEZ A;  3PUW A;  3E9H A;  2UXB Q;  2B2W C;  4LF8 L;  2R7F A;  1K8G A;  4IFD G;  2Y0S B;  1UUP A;  2G5D A;  3A8I E;  4WRD A;  1TT2 A;  4DAP A;  4B3R Q;  1KTK A;  1D5Z C;  1CQV A;  5LMU Q;  3ND8 A;  1EWC A;  4A3J B;  3GQB A;  1CUK A;  1STG A;  2OF1 A;  3HEJ A;  2CW0 D;  1PH7 A;  2WB1 B;  1KDB A;  3K7U C;  4YHH Q;  2Z4H A;  3A5Z B;  3J7A 5;  1EIH A;  2F3I A;  1C4Q A;  4AYB B;  1SLJ A;  3ULP A;  2N49 A;  5IOC A;  5C44 B;  1FVI A;  3JC6 6;  4DUY L;  4NXN Q;  1VF5 C;  3AQQ A;  3R2I A;  2F3V A;  2I5H A;  3RLO A;  3O13 A;  3C3L A;  1VQH A;  5I4D A;  1IBM L;  2R93 H;  3I7F A;  1K3B C;  1U4R A;  4DR5 Q;  1S5B D;  5IP9 G;  3BJU A;  4A3E H;  2SNS A;  1H9R A;  1MGS A;  3T56 B;  2HIX A;  5M5W B;  4IFD H;  1H9K A;  3K59 A;  2FHT A;  2K5N A;  4LF9 L;  4WJ4 A;  1C48 A;  2F0H A;  4DK3 C;  3I72 A;  4G7O C;  2CHB D;  4R1J A;  4RHR A;  4LF8 Q;  1BCP F;  3H3V I;  3ONA B;  1GVP A;  2EY2 A;  2XN9 C;  3F1Z A;  1Q86 C;  3QR8 A;  1XPO A;  4JI8 L;  4BS9 A;  1SNO A;  1QVC A;  1PTO D;  3HOU G;  4TQU S;  1EOT A;  2PNR C;  4JBJ A;  1GM5 A;  4LUZ A;  2K75 A;  1VQI A;  4JBM A;  2KHJ A;  4C56 C;  2MFI A;  2OWO A;  3S1M B;  1PYB A;  4DUY Q;  3S15 B;  1ILP A;  1IKL A;  3VYR A;  4JI2 L;  5IP9 H;  1B70 B;  3TN2 A;  2JA6 G;  3F2B A;  1V1P B;  3IKJ A;  4KTA A;  4RCN A;  1Q7Y C;  1MHW C;  1N8R C;  1RTN A;  4WJW A;  2VQE L;  1B1Z A;  2LMC B;  1AZQ A;  3I4L A;  3ND9 A;  1I5F A;  1M90 C;  1JMC A;  2NVQ H;  3FRP B;  4IUU A;  2B39 A;  3CF5 A;  4ZKB B;  1NSN S;  2K5D A;  1XWE A;  1EQT A;  1ROD A;  4OO1 I;  3HOU H;  1O78 A;  3C46 A;  5FLX c;  4H02 A;  4GOP C;  2JYO A;  4JI8 Q;  1RJT A;  1BQQ T;  1UE1 A;  1IL2 A;  1ET6 A;  5JEA G;  3GTL B;  1NE3 A;  1QG7 A;  2A73 B;  2NBF A;  1WTR A;  3AMU A;  2KQ3 A;  2RSN A;  2NB0 A;  2OXP A;  5KND A;  3R3O A;  2JA6 H;  1R4P B;  3CQZ H;  4DV0 L;  2WAQ G;  3MWY W;  5GQO A;  3VA7 A;  4JI2 Q;  3C2P A;  2JSO A;  4DV5 L;  2F0L A;  1GO3 E;  4GNX A;  1Y1V G;  4J8Q A;  4LF6 L;  2VQE Q;  4LUO A;  3AYH B;  2ZJP A;  1GUG A;  1KDC A;  5M3M G;  1X32 A;  1JJ2 A;  4C3H H;  3KF8 A;  1LAB A;  1ENC A;  4OIJ A;  3VYU A;  3EBE A;  5A2Q L;  3OSO A;  4HCS A;  3OW2 A;  4ZUI A;  2XVS A;  4J6H A;  4EX5 A;  2NUC A;  2K01 A;  2A6E D;  1KLU D;  3OMC A;  1VQ4 A;  5JEA H;  1VQF A;  3TDQ A;  4BBR G;  4IUT A;  2JA8 B;  1F9R A;  2MO0 A;  3IFD A;  1VDZ A;  1VQO A;  1TQO A;  2E74 C;  1WD1 A;  2JEA I;  1JB3 A;  5IGC A;  3HKS A;  2IX0 A;  2RDF A;  1D2B A;  1PH1 A;  1DOL A;  4QUC A;  4XYQ A;  2Y0S G;  4X66 L;  2L5T A;  4KMU C;  4RG1 A;  3K0X A;  3SXH A;  1PH2 A;  1VQ6 A;  3BVG A;  4DV0 Q;  1P8L A;  2EPB A;  1IYU A;  2X6L A;  3GTG H;  5JJI A;  5FKA C;  2LSS A;  1XJV A;  4A3J G;  1EQQ A;  3BYT B;  1UEB A;  4JPB W;  5IGG A;  1SE8 A;  4DV5 Q;  3RMH A;  4PMB A;  2XNA C;  2WB1 G;  2CKZ B;  2C5C A;  4L5S A;  2QA4 A;  4LF6 Q;  4DR4 L;  4DV1 L;  1E2V A;  1D8L A;  2QW7 A;  4JYA L;  3NXW A;  5C44 G;  1ESR A;  1TS4 A;  1TWF B;  4K0K L;  2TSS A;  4UP7 A;  2GVA A;  1T9H A;  5E7N A;  4BBR H;  2KHI A;  4CBV A;  1KIX A;  3PIO A;  1O7Y A;  4DXG A;  4YWL A;  2I5L X;  1Y1W G;  4KD3 A;  1DGS A;  4L6T B;  3EFX D;  3V05 A;  1BDO A;  2IJ0 A;  5AFW A;  5IGF A;  5LMN L;  1XMQ L;  4KKU A;  1F9P A;  4DV7 Q;  2KVM A;  2JA7 G;  3K5O A;  1I4H A;  1VMC A;  3TZU A;  4X66 Q;  4KY6 A;  4A3J H;  1C8C A;  1MJC A;  1IBL L;  1X3E A;  1QVF A;  4ZCK A;  1LM0 A;  2KCN A;  3J7A V;  3J81 L;  5K5P A;  3D4W A;  4H13 C;  4DK1 A;  4OL7 A;  2ICE C;  2VXW A;  4EQ5 A;  2JN4 A;  2PI2 E;  4DN4 M;  2Q8I B;  2KA7 A;  3RD4 A;  3NEL A;  3TEH B;  1FJG L;  5LL6 X;  3K8A A;  3PUY A;  1E1O A;  4DR4 Q;  1QIL A;  1L1O B;  1SAP A;  2O5J C;  2MGS A;  2VB2 X;  1J6Q A;  1QUQ A;  1U4M A;  3CCQ A;  3CMA A;  5M5W H;  4UP9 A;  1TR5 A;  2R92 B;  4A75 A;  2L1B A;  4FXG C;  4X3K A;  2EYO A;  5LMN W;  1E2Z A;  1RCV D;  1TS2 A;  3VR3 A;  4U67 3;  3C1E A;  4A93 G;  4KLK A;  4X62 L;  1XMQ Q;  3SK4 A;  5I9O A;  4JI3 L;  1WFQ A;  2F0V A;  2UU9 L;  1CSQ A;  3ULJ A;  3K57 A;  1IBL Q;  2KUM A;  1GJX A;  1A15 A;  1EWH A;  2SDF A;  4B9X A;  4IFD J;  1LTS D;  2NN6 G;  3VR6 A;  1PLF A;  4R8I A;  3S1M H;  3CCL A;  2DY7 A;  3F8T A;  3NPP A;  3S15 H;  3S2H B;  1FJG Q;  2NYZ D;  2K1B A;  3HZX A;  3H0G B;  4OO1 H;  1HHV A;  1HZB A;  2BH2 A;  1WOC A;  3H94 A;  4UY8 C;  1VQK A;  3E3X A;  4Q0F A;  1SBB B;  3ZJY C;  1D6E C;  2J0T D;  2JP1 A;  3C1F A;  5FLX E;  2IHE A;  4KKT A;  3E5S A;  4GN3 B;  4IUR A;  5HUR A;  3L0O A;  4A3C G;  4KJN A;  3I4O A;  2EE1 A;  1WYD A;  1AE3 A;  3M85 A;  1W6J A;  5GAH C;  3RN2 A;  1F2Z A;  3VYT A;  4POF A;  3PQI A;  3GTJ H;  2DN8 A;  2BA0 A;  4GZY C;  1JOQ A;  2AHO B;  1YNJ D;  2Z0S A;  3I4N B;  2NN6 H;  1EIF A;  1LYL A;  1V1O A;  2UUC L;  3GTL H;  3QB3 A;  4K6L A;  5CV6 A;  2JA8 G;  4P72 A;  1YBY A;  5EPL A;  2G9D A;  1HFG A;  3S1R B;  3DM3 A;  1JCK B;  4G7H C;  1H9J A;  1CSP A;  1GHJ A;  1V1Q A;  3MEF A;  3NTK A;  3CCV A;  5DLQ E;  2R93 B;  2PPB C;  2KCT A;  2ZM6 L;  3I56 A;  1SXT A;  4JOI C;  5IYC G;  2K4K A;  1SYE A;  4A3E B;  2A68 D;  2EXD A;  1SMY C;  5IWA L;  1VQJ A;  4EQP A;  2XGT A;  3M3Y B;  1H9M A;  3PIP 3;  3D4D A;  1EIG A;  5EJW A;  1U4P A;  3EN2 A;  3E6Z X;  1EQV A;  1KAA A;  2JA8 H;  3U4V A;  2AQ2 B;  2KCC A;  4DAM A;  3ERO A;  4IJL A;  2L12 A;  2UUC Q;  1JJC B;  2ATW A;  5CC4 A;  2RHS B;  1IBK L;  2N88 A;  5T1G A;  1SNM A;  3H6M A;  2VL6 A;  3PCO B;  3BYY B;  3GTP B;  4KKS A;  2B2U C;  3CD6 A;  1VMP A;  1I50 B;  4IZ8 A;  3IRB A;  1HNW L;  3NTH A;  1GUN A;  5IYC H;  5K36 H;  1BO0 A;  4RKB A;  2ZXP A;  1ZYR C;  4HMI A;  1PRT C;  1Q1E A;  2RCN A;  3PO3 H;  3MAQ A;  2Z6K C;  1AP0 A;  4UP8 A;  3A5U A;  2ZM6 Q;  1BBU A;  1VS0 A;  5GAG C;  2UUA Q;  2F3W A;  5IWA Q;  2B8F A;  4C3J B;  4QB4 A;  3SK5 A;  1PH9 A;  4CJ2 C;  3SK8 A;  1FYC A;  1Y8O B;  1JWU D;  1Q90 A;  2M9V A;  3T53 B;  1BVS A;  2A6H D;  5IIF A;  2HT1 A;  1U0L A;  4B3T Q;  1CKN A;  4GLX A;  4APV A;  2DY8 A;  4DK6 C;  1CHP D;  5IGE A;  4LWC A;  2F0P A;  2WAC A;  3NBH B;  3P7J A;  3CCJ A;  2Q2I A;  1IBK Q;  1FD7 D;  3PUV A;  1NAP A;  1HZC A;  4N8X 1;  3CRL C;  3V96 A;  1NR2 A;  3T4A C;  1AW7 A;  4C1N I;  2LKV A;  3OMG A;  1ICF B;  1N34 L;  1HNW Q;  2C9O A;  3EJI A;  1LAC A;  1BCP B;  4BY7 B;  4BY1 G;  1S5D D;  2RBM A;  4DKA C;  4GNX B;  1UAP A;  3LGJ A;  2BCO A;  2M00 A;  4HSP A;  5CV5 A;  4HJ9 A;  5I6W A;  1M1K C;  2MJ8 A;  5LL6 S;  4XXE A;  3KF6 B;  1V9P A;  3KF8 B;  3I3C A;  3KJP A;  1KLG D;  3HOW G;  4DR2 Q;  2R92 H;  4XQJ A;  4BA2 I;  2WII B;  2XTI A;  2FJ2 A;  2RF4 A;  4IPD A;  5C0X G;  5HGT A;  1XMO L;  2ALY B;  3TP8 A;  2OTJ A;  3PF4 A;  1B9M A;  1GUS A;  2E5L L;  3BZK A;  2UUB Q;  3J80 L;  4AQY L;  3E9I A;  3FKI B;  1EU3 A;  1S5C D;  4KI0 A;  3DEO A;  2AQ1 B;  1VQ5 A;  2PQA A;  2F1M A;  2XRQ D;  5DM6 3;  3I4M B;  4OWW B;  3HOX H;  5CV4 A;  1G91 A;  2KEN A;  1ASZ A;  4K8I A;  1RHP A;  3I4N G;  4JI5 L;  4QMG A;  1MSG A;  4IUP A;  4X65 L;  3A74 A;  2H4O A;  3W1B A;  2MQH A;  1NBW A;  1N34 Q;  2NZ1 D;  3S2H H;  1RD9 D;  4P2C B;  2QEX A;  4LFA L;  3PSI A;  4RGO S;  1SNP A;  3BZC A;  4HED A;  3H0G H;  2CQA A;  1DON A;  4EVO A;  1HA6 A;  2F0J A;  3TRE A;  2JE6 I;  1PVO A;  3QOL A;  1N32 L;  3N6R A;  4RGN A;  5C0X H;  1XNQ L;  5J22 A;  3M4Q A;  4DFA A;  3EVQ A;  3S14 B;  1RDP D;  1DCZ A;  4M1U B;  4EQO A;  3E0E A;  5COR A;  2R93 G;  4O1N A;  1EY6 A;  2ZTE A;  2XSC A;  2RHQ B;  2RSO A;  2QEJ C;  4DV6 L;  2WFW A;  1DM0 B;  2CWA A;  4A3E G;  1QVG A;  4PZ6 A;  4DPG A;  3Q0A A;  4LUV A;  5DM7 3;  2C35 B;  4YY3 L;  4IPC A;  3GD7 A;  3M4O B;  1EWI A;  4RWS C;  2D0O A;  3MXP A;  2E2J B;  5KNB A;  4O42 A;  3MTS A;  3IL8 A;  2PMZ E;  1PFB A;  2QF7 A;  1A0I A;  3WDN A;  1HR0 Q;  3I4N H;  3M7G A;  1GUO A;  4B3M L;  4KHP Q;  3T16 A;  1GXD C;  4PMC A;  1EYG A;  2LFN A;  5I9P A;  3DUZ A;  1FGB D;  1GOZ A;  2B3G A;  2EY5 A;  1HZA A;  2ES2 A;  2BE5 D;  1Q1B A;  3HKZ B;  2VNU D;  1EFW A;  4JI5 Q;  1E2W A;  2MP1 A;  2QIL A;  1TKW B;  2A69 C;  5I2X A;  3A7A B;  4X65 Q;  3S1R H;  1BBX C;  1K83 H;  5M5X H;  1AZP A;  3DMU A;  1X55 A;  4LFA Q;  3TZD A;  2F0G A; 
#chains in the Genus database with same CATH homology
 1VQ4 A;  1LTL A;  2Q2H A;  1YHB A;  3UE1 A;  1VQF A;  3J81 j;  2VQF Q;  5IT9 c;  4PZ8 A;  2JK8 A;  4BBR G;  4P71 A;  3CC2 A;  2LXK A;  1VQA A;  4QL5 A;  5FLM H;  1AH9 A;  4R4Q A;  2MO0 A;  2D0P A;  3RLN A;  3T1Y L;  1Q82 C;  1VQO A;  1HNX L;  3PV0 A;  3I2Z A;  1G29 1;  2UXC Q;  1N36 L;  1OXV A;  4MNO A;  1KD1 C;  4YCW A;  2JEA I;  2ZTD A;  4DUZ Q;  3HKS A;  2IX0 A;  5IYD H;  2JEB I;  1PH1 A;  2NZO A;  3ULL A;  2OQK A;  2Y0S G;  4Y52 H;  4X66 L;  3NEM A;  2ZJQ A;  4LF7 L;  3M3Y H;  4RG1 A;  4DV6 Q;  3K0X A;  4DNI A;  4NPS A;  3HOX G;  1PH2 A;  4JI7 Q;  1VQ6 A;  2H5X A;  1VQL A;  2IT1 A;  4YY3 Q;  4LF5 L;  4DV0 Q;  1P8L A;  3CAM A;  1XPR A;  2R7D A;  4QIW E;  4L5R C;  2HHH Q;  3K81 C;  4C2M H;  1VQN A;  3GTG H;  4DV3 L;  2LSS A;  3G6E A;  2JA5 G;  3STB C;  5JJI A;  1XJV A;  1ASY A;  2CCZ A;  3SGI A;  4A3J G;  1R9T H;  1EQQ A;  1UEB A;  1SE8 A;  4DV5 Q;  2F4V L;  2VW9 A;  1VQB A;  2VS1 A;  3PF5 A;  2WB1 G;  2CKZ B;  3H0G G;  5IP7 G;  3TS0 A;  1PHJ A;  5AJ3 Q;  3D0F A;  4L5S A;  3CCE A;  2QA4 A;  4LF6 Q;  4DR4 L;  4DV1 L;  1D8L A;  2OCE A;  4JYA L;  3RR5 A;  1QZH A;  3TRZ A;  5C44 G;  4K0K L;  1QZG A;  1K9M C;  5HY6 A;  2JQO A;  2N78 A;  4UP7 A;  4A3F G;  2GVA A;  1T9H A;  3KDF A;  4OWT B;  5C0X I;  5E7N A;  2A8V A;  3GTP H;  4BBR H;  2KHI A;  2Q2U A;  1RIP A;  1KIX A;  3PIO A;  1KHI A;  2QGQ A;  1I50 H;  4JI6 Q;  1L1O A;  1KQS A;  3KLW A;  1YNX A;  2K52 A;  3ICE A;  2ZJR A;  4JV5 L;  4YWL A;  3STB D;  2I5L X;  1Y1W G;  1PH5 A;  5BR8 L;  1DGS A;  3JAM i;  3W5O A;  1IBM Q;  2VUM H;  1TWC H;  3T1Y Q;  1EOV A;  1HNX Q;  4RMF A;  5LMN L;  1PYS B;  1XMQ L;  1N36 Q;  3T1H L;  4DV7 Q;  1EQR A;  4BY7 G;  1HZ9 A;  1PFS A;  3G48 A;  2JA7 G;  3UDG A;  5ELO A;  4C3J H;  2JA5 H;  1U5K A;  4A3C H;  2KBN A;  4GLV B;  4X66 Q;  4LF7 Q;  4A3J H;  4LF9 Q;  2YTV A;  1V43 A;  2Q2T A;  4PZ7 A;  1MJC A;  5H1S E;  1IBL L;  1X3E A;  1QVF A;  4LF5 Q;  1LM0 A;  5IP7 H;  2UUA L;  4BBS G;  4DV3 Q;  1KC8 C;  2L15 A;  3PGZ A;  2OQ0 A;  4DR1 L;  4NB3 A;  4QGU A;  4EQ5 A;  5EAY A;  1A63 A;  2PI2 E;  2IHF A;  2F4V Q;  2WP8 J;  4DAY B;  3HOY H;  3NEL A;  3TEH B;  1FJG L;  4X6A H;  3K8A A;  3PUY A;  3HOV G;  1E1O A;  1X3G A;  4GNX C;  3KDF B;  4DR4 Q;  4JBW A;  1UWV A;  3CCS A;  4XTC S;  4B3T L;  1L1O B;  1CKM A;  4JOI A;  3FKI G;  4POG A;  4NXN L;  1XMO Q;  4GS3 A;  3JAM c;  4LNQ A;  1VCI A;  5ELN A;  1QUQ A;  1J6Q A;  3CCQ A;  2E5L Q;  3CMA A;  2WAQ E;  5M5W H;  5GAE C;  3AFQ A;  1NY4 A;  4UP9 A;  4A4I A;  4A75 A;  2I5M X;  4AQY Q;  4MZ9 A;  1YIT A;  3GTO H;  5LMN W;  3TS2 A;  3I4M G;  1KRS A;  4JV5 Q;  1X54 A;  1PH8 A;  5BR8 Q;  3U58 A;  4BY7 H;  1MKH A;  1PA6 A;  4A93 G;  1BKB A;  4NXM L;  2UXD L;  4KLK A;  3M4P A;  3RZD H;  3RLF A;  4DV4 Q;  2JA9 A;  4X62 L;  4ALP A;  1XMQ Q;  3KJO A;  3T1H Q;  4P73 A;  3U50 C;  1A8V A;  1E22 A;  4JI3 L;  1WFQ A;  5FJ8 G;  4BBS H;  3EIV A;  2UU9 L;  1CSQ A;  1TWG H;  3ULJ A;  1J5E L;  1IBL Q;  4X64 L;  3MXN B;  1MJE A;  1KAW A;  1TWF H;  4IFD J;  2NN6 G;  3HOV H;  3S1M H;  2K50 A;  3CCL A;  1E7Z A;  4DR1 Q;  1YI2 A;  1N32 Q;  3F8T A;  2KCM A;  4JI4 L;  4DR2 L;  3S15 H;  2YYZ A;  2BH8 A;  3FKI H;  3OYY A;  1Q81 C;  1WI5 A;  5GAD C;  1E24 A;  1FJG Q;  1W3S A;  4O2D A;  2E2I H;  1XNQ Q;  1JT8 A;  1HZB A;  2BH2 A;  1WOC A;  2LXJ A;  4HJA A;  1HH2 P;  1P16 A;  4A76 A;  3VDY A;  2Z6K A;  3L7Z C;  1VQK A;  1QUQ B;  4UY8 C;  1BBW A;  2VUM G;  3GO5 A;  4A3L G;  2I0Q A;  2CQO A;  5C3E G;  2Y0S E;  2UUB L;  4GN4 B;  2OTL A;  3I4M H;  3ZJY C;  2IY5 B;  3KFU A;  3CXC A;  3DLL A;  4OX9 L;  3HFZ B;  2FXQ A;  2IHE A;  3CW2 C;  4A3B G;  1X9N A;  3FP9 A;  1C9O A;  4BA1 I;  4GN3 B;  4A93 H;  4DV2 L;  3L0O A;  4A3C G;  3I4O A;  3RN5 A;  1E1T A;  1WYD A;  4JC0 A;  1N9W A;  1AE3 A;  3HKZ G;  4OWX B;  3M85 A;  3F2C A;  5GAH C;  3HKZ E;  3RN2 A;  1K8A C;  1EIY B;  4B3M Q;  4POF A;  5FJ8 H;  2WB1 E;  1IXR A;  1YHA A;  3GTJ H;  2YTY A;  4NXM Q;  2BA0 A;  4AYB G;  4QQB X;  2UXD Q;  1FL0 A;  4AYB E;  3UE0 A;  4GOP B;  4R4I A;  4B3S L;  2AHO B;  1IZ6 A;  3J80 i;  2Z0S A;  1CKO A;  1Q8K A;  1TXY A;  2PNH A;  4TVA B;  5IE8 A;  3HOY G;  3M7N A;  5JJL A;  1EIF A;  2E2H H;  1LYL A;  1VQE A;  2UUC L;  3GTL H;  3U4Z A;  3S14 H;  4UPA A;  1A62 A;  4OON A;  1J5E Q;  4X64 Q;  2JA8 G;  3D31 A;  1PH4 A;  1H95 A;  4P72 A;  1YBY A;  1X3F A;  1UE5 A;  3M9B A;  2DGY A;  2AWN A;  2NVY H;  3S1Q H;  1C7Y A;  1NMF A;  3DM3 A;  4GN5 A;  3M4O H;  2D62 A;  4R4O A;  1SFO H;  2E2J H;  4JI4 Q;  4A3L H;  4A3G G;  1PH3 A;  5C3E H;  1O7I A;  1SRU A;  3F2D A;  4GLA C;  1CSP A;  2IX1 A;  1MIU A;  4PG3 A;  2MO1 A;  1K0R A;  2GN5 A;  4A3B H;  1V1Q A;  1B7Y B;  3MEF A;  3K80 C;  1I94 L;  1IYJ B;  5C0X J;  3CCV A;  2R7Z G;  4JI1 L;  2UXB L;  2B63 G;  5DLQ E;  2KCT A;  3G71 A;  2ZM6 L;  2ZTC A;  1XPU A;  2VZA A;  3I56 A;  1WCM G;  4OX9 Q;  3KOJ A;  4JOI C;  5IYC G;  2K4K A;  1HR0 L;  3PUZ A;  4KHP L;  3A0J A;  2EXD A;  4B3R L;  5C4X G;  1OXU A;  1VQP A;  5IWA L;  5LMU L;  1VQJ A;  1G6P A;  4C3I H;  2XGT A;  3J80 c;  1VQ7 A;  4L5T A;  5M3F G;  4YCU A;  3UDI A;  2ID0 A;  1TWA H;  1UE6 A;  3CCU A;  4J15 A;  4BY1 H;  1EUJ A;  2YU9 H;  4YWM A;  3H3V H;  4LFB L;  3EN2 A;  2AWO A;  3TQY A;  2MNA A;  4DV1 Q;  4YHH L;  1JE5 A;  4A3D G;  4JYA Q;  2JJQ A;  4DR7 L;  2JA8 H;  4B3S Q;  3U4V A;  2EQS A;  3NEN A;  1YJW A;  4K0K Q;  2NZH A;  3RNU A;  4DAM A;  4IJL A;  2K5V A;  4LW1 A;  1JJG A;  2UUC Q;  1JJC B;  1VQ8 A;  3J7Z C;  4QJF A;  4OO1 G;  1TWH H;  2ATW A;  2RHS B;  3ERS X;  4Y7N H;  4DR6 L;  3HOW H;  1K73 C;  4HJ8 A;  1IBK L;  3S1N H;  4A3G H;  2HQL A;  2N8N A;  4XIG S;  4P74 A;  4DR5 L;  1X56 A;  1VQC A;  1N33 L;  2VL6 A;  3B6Y A;  2EIF A;  2GVB A;  2CFM A;  3PCO B;  2R7Z H;  1NTG A;  2B63 H;  1AE2 A;  1LUZ A;  3GDE A;  2NVT H;  3CD6 A;  3IRB A;  2AKW B;  5LMN Q;  1WCM H;  1HNW L;  1HR0 W;  5IYC H;  1FGU A;  4BXX H;  3CCR A;  1I94 Q;  1YEZ A;  3PUW A;  3E9H A;  1Q1E A;  2RCN A;  4JI1 Q;  3PO3 H;  2UXB Q;  2Z6K C;  1Q12 A;  3CME A;  4LF8 L;  4UP8 A;  2R7F A;  4GOP A;  3A5U A;  2ZM6 Q;  1K8G A;  4IFD G;  4HJ5 A;  1BBU A;  5M3F H;  1SN8 A;  4ME3 A;  1VS0 A;  1VQD A;  5GAG C;  4IOC A;  2UUA Q;  3BU2 A;  1Z9F A;  4B3R Q;  1YZ6 A;  5IWA Q;  5LMU Q;  2NN6 I;  4A3D H;  3K7A H;  3L2P A;  1PH9 A;  3G4S A;  1CUK A;  3KF6 A;  1S3O A;  1L2F A;  4LFB Q;  1D7Q A;  1PH7 A;  3K7U C;  4YHH Q;  3A5Z B;  1BVS A;  3J7A 5;  2F3I A;  2HT1 A;  1U0L A;  3S16 H;  1SLJ A;  2F52 A;  3PO2 H;  4IOA A;  3ULP A;  2PI2 A;  1CKN A;  3CC4 A;  4B3T Q;  2N49 A;  4GLX A;  1FVI A;  4APV A;  3JC6 6;  4DK6 C;  4DUY L;  4JI6 L;  4NXN Q;  1C0A A;  5JJK A;  5J3B A;  3AQQ A;  1UE7 A;  4LWC A;  2I5H A;  3RLO A;  1Z47 A;  2E8G A;  1Y14 B;  1VQH A;  1VQG A;  2Q2I A;  3NBH B;  5IYB G;  3CCJ A;  1IBK Q;  4DR6 Q;  3PUV A;  4JG2 A;  1IBM L;  2R93 H;  3I7F A;  1KRT A;  4DR5 Q;  1XTD A;  1HZC A;  1L1O C;  5IP9 G;  1N33 Q;  1GKH A;  3BJU A;  4LFC L;  4A3E H;  2K5H A;  4DV7 L;  4KHZ A;  1SMX A;  1PV4 A;  1YIJ A;  2NVX H;  2HIX A;  4X62 Q;  1N34 L;  1HNW Q;  1SRO A;  4LF9 L;  2K5N A;  4AH6 A;  1WJJ A;  4WJ4 A;  3CCM A;  4FDB A;  1G51 A;  4JI3 Q;  4DK3 C;  3RZO H;  4BY1 G;  4DKA C;  4A3K G;  4GNX B;  1Y1V H;  3LGJ A;  2UU9 Q;  4HIK A;  4R1J A;  4LF8 Q;  4IPG A;  3H3V I;  3AFP A;  1GVP A;  4HJ9 A;  1VQ9 A;  4IPH A;  3F1Z A;  1Q86 C;  1M1K C;  1NMG A;  1XPO A;  2N3S A;  5M3M H;  3KF6 B;  4JI8 L;  4LF4 L;  1V9P A;  2YTX A;  1OXT A;  3KF8 B;  3UDF A;  1QVC A;  3H15 A;  2BA1 A;  3OTO L;  4R4T A;  3KJP A;  4GKK L;  3HOU G;  4TQU S;  1HNZ L;  3HOW G;  4DR2 Q;  4A3M G;  2R92 H;  1GM5 A;  4JBJ A;  4BA2 I;  5M5Y H;  1CKN B;  1X6O A;  1KXL A;  2XTI A;  4LUZ A;  3GTM H;  2K75 A;  1YJN A;  2AMC B;  2RF4 A;  1VQI A;  1L0W A;  1JB7 A;  1RL2 A;  2A1A A;  4IPD A;  4JBM A;  2KHJ A;  5C0X G;  4PMW A;  1Q46 A;  1S72 A;  1XMO L;  2ALY B;  3CC7 A;  2OTJ A;  2MFI A;  2OWO A;  5IYB H;  1OXS C;  2ASB A;  1K3R A;  3HOZ G;  3PF4 A;  3J81 i;  1PYB A;  2E5L L;  3BZK A;  2A19 A;  2UUB Q;  1GD7 A;  3CP0 A;  4DUY Q;  1YHQ A;  3S2D H;  3UDX A;  4JI2 L;  4AQY L;  3E9I A;  5IP9 H;  2V1C C;  1B70 B;  2CWP A;  2HIV A;  2JA6 G;  5K36 G;  3F2B A;  4HJ7 A;  4BXX G;  3KYH C;  1Q7Y C;  4DV2 Q;  4KI0 A;  3W1G A;  1N8R C;  5IY0 A;  3PO3 G;  4P75 A;  2PQA A;  4HIO A;  1VQ5 A;  3PIP A;  2VQE L;  4DR3 L;  4DV4 L;  2B29 A;  3HOX H;  4LFC Q;  4OWW B;  2KEN A;  1ASZ A;  1YVC A;  4O0A A;  3I4N G;  1W2B A;  4JI5 L;  4A3K H;  1I5F A;  1M90 C;  4X65 L;  4JI0 L;  1XNR L;  4L5Q A;  3A74 A;  3WWV A;  3W1B A;  2MQH A;  1NBW A;  4YWK A;  1JMC A;  5HGQ A;  1E3P A;  1N34 Q;  2NVQ H;  3S2H H;  3CF5 A;  4MTN A;  2QEX A;  4LFA L;  4GKJ L;  3PSI A;  4QY7 A;  3BZC A;  4R4C A;  1KL9 A;  3H0G H;  5GRO A;  4HID A;  4A3I G;  2R6G A;  4IJH A;  2YV5 A;  4HIM A;  1NJI C;  4OO1 I;  3TRE A;  2JE6 I;  2VQF L;  3HOU H;  1PVO A;  1B8A A;  4A3M H;  1S40 A;  3PO2 G;  5FLX c;  4H02 A;  5C44 H;  1N32 L;  4GOP C;  4JI8 Q;  4LF4 Q;  1I6H H;  1UE1 A;  2DUD A;  4OXP A;  4A3F H;  1IL2 A;  5JEA G;  1XNQ L;  1HJP A;  5C4X H;  3OTO Q;  2UXC L;  3M4Q A;  3J81 c;  4GKK Q;  3HOZ H;  1HNZ Q;  5JEA J;  4DUZ L;  4JCV E;  1NE3 A;  3E0E A;  5FLM G;  2R93 G;  4JBK A;  2ZTE A;  1VQM A;  2RHQ B;  4DV6 L;  1QVG A;  2WFW A;  2CWA A;  4A3E G;  1Y1W H;  2JA6 H;  4JI7 L;  1YJ9 A;  2K14 A;  4PZ6 A;  4DPG A;  3I55 A;  3CQZ H;  4LUV A;  1PH6 A;  1SR3 A;  2C35 B;  4YY3 L;  4IPC A;  4DV0 L;  3GD7 A;  2WAQ G;  3PUX A;  1EWI A;  4YCV A;  5IYD G;  2HHH L;  1X65 A;  2D0O A;  2VY3 A;  2PQA B;  5GQO A;  4JI2 Q;  2PMZ E;  4IFD I;  1A0I A;  5C4J H;  1HR0 Q;  3I4N H;  3S17 H;  4KHP Q;  4B3M L;  4DV5 L;  1GO3 E;  4GNX A;  4IO9 A;  3FHW A;  1EYG A;  2JA7 H;  1Y1V G;  5AJ3 L;  3ER0 A;  4LF6 L;  2B3G A;  2VQE Q;  4LUO A;  3AYH B;  2ZJP A;  1HZA A;  3CPW A;  2ES2 A;  4DR3 Q;  3GTQ H;  1Q1B A;  1I3Q H;  3GTK H;  2VNU D;  1EFW A;  5M3M G;  4JI5 Q;  3S24 A;  1JJ2 A;  4C3H H;  4X65 Q;  4JI0 Q;  4A3I H;  1XNR Q;  3S1R H;  4WJ3 M;  1K83 H;  5M5X H;  4DR7 Q;  4AIM A;  3EBE A;  1OTC A;  3OW2 A;  4EX5 A;  3AEV A;  3CPF A;  1X55 A;  1OXX K;  3Q8D A;  4LFA Q;  2R92 G;  4GKJ Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...