3KOJA

Crystal structure of the ssb domain of q5n255_synp6 protein from synechococcus sp. northeast structural genomics consortium target snr59a.
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
102
structure length
89
Chain Sequence
HHSHMNSCILQATVVEAPQLRYAQDNQTPVAEMVVQFPGAPARLKVVGWGAVAQELQDRCRLNDEVVLEGRLRINSEKQTELTVTRVHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the SSB domain of Q5N255_SYNP6 protein from Synechococcus sp.
rcsb
source organism Synechococcus elongatus pcc 6301
molecule tags Dna binding protein
molecule keywords uncharacterized protein ycf41
total genus 14
structure length 89
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3kojA00
1J6QA 2BA1A 2YV5A 1Q82C 1P16A 2HT1A 3NENA 3CF5A 1YITA 4GKKL 3F2CA 1TWAH 5ELNA 1J5EQ 4IFDJ 3G48A 2R92H 4KLKA 2ZTEA 1KQSA 1YZ6A 3ERSX 1B70B 3RN5A 4JC0A 3CAMA 1OXXK 2K5NA 3CCRA 4DR1L 1VQBA 4A3IH 4O2DA 4IPCA 3PUWA 4LUVA 3AEVA 2XTIA 3M3YH 1K0RA 1EOVA 1WI5A 4LFCQ 4B3RQ 3CCMA 2UXCQ 1V1QA 3RLNA 1MKHA 5H1SE 5IWAL 3S1QH 3JAMi 3PUZA 3M9BA 4P75A 2K4KA 2EIFA 4YCVA 4DV2Q 3B6YA 4GOPC 2UU9Q 1ASYA 2HHHL 5C0XI 2CFMA 1CKNB 4DR2L 1VQDA 2ZTDA 5IP9H 3VDYA 1YJNA 1L2FA 3J81j 4LF9L 3A5UA 3S2DH 2F4VL 4JI8L 3HKZE 3PF4A 1YHQA 4JI3L 5LMUQ 2CQOA 5FLXc 3EIVA 1YI2A 3CPFA 1V9PA 1X55A 4JI4Q 2R6GA 5C3EH 3K7AH 5FJ8H 4BY1G 4DV7L 4X65Q 4GOPB 3GTLH 1K3RA 1NMGA 2KENA 3DLLA 4A3FG 4A3BG 4QJFA 2UUBQ 5GAEC 4EX5A 1Y14B 2DUDA 2R7ZH 2JE6I 1QUQA 1YEZA 4PMWA 1KC8C 4PZ6A 4DK6C 4L5QA 4DK3C 5IWAQ 4GKJQ 4YCUA 4OONA 2GN5A 5FLMG 4DV6Q 3HKZG 1EWIA 1K8AC 4LF8Q 3PF5A 5IY0A 2NZHA 2NN6G 1Q81C 1GD7A 2E8GA 3PSIA 4BY7H 4BBRH 1JT8A 1CKNA 3UDXA 1G51A 1FL0A 4XTCS 1IBKL 3J80i 4APVA 2VQEQ 3E9HA 1PHJA 2K52A 2ZM6L 3K0XA 4LFBQ 3GTKH 2Y0SE 1KHIA 4B3ML 1Q7YC 1XPOA 3T1YQ 1YHBA 2NVTH 2OWOA 3AYHB 2JA6G 1EIFA 4DV7Q 1X6OA 1EUJA 2UXDQ 4LF7L 4O0AA 1OXUA 4NXMQ 5GAHC 1E24A 3NBHB 4X66L 4J15A 4DR7L 2VNUD 3EN2A 5IYBH 2D0OA 3GTPH 2WB1E 3ICEA 5EAYA 1EQQA 1NJIC 1B8AA 2KCMA 2JA7G 4JI6L 1AH9A 1JE5A 3I4NH 1HNZQ 4K0KQ 3BZKA 1XMOL 4LUZA 2A1AA 2JA9A 4YWLA 1K73C 1EYGA 2K5HA 1SRUA 1EIYB 4QGUA 1A63A 4R4IA 3U50C 1BBWA 5GQOA 4POFA 1VQ8A 2NVQH 2R92G 1TWGH 4R4TA 4JI2L 2K50A 3RN2A 4JG2A 4OWTB 4DR5Q 1GM5A 4IOAA 4A3LH 1PFSA 1FJGL 2Q2UA 1BVSA 1Y1WH 2AMCB 4B3MQ 4GLVB 4DPGA 1RL2A 2ZTCA 5IYDG 2N8NA 4A3EH 5IYCG 2L15A 1YIJA 4JOIA 1QUQB 5GROA 2CCZA 4NPSA 3RR5A 4HIMA 4L5RC 2YTVA 3TS0A 5IP7G 4DAYB 1N8RC 1R9TH 1VCIA 2VY3A 3A5ZB 1AE2A 3JAMc 4ME3A 2UUCQ 1I6HH 4IPHA 3UE0A 4AQYL 1NMFA 3A0JA 3CC2A 3HOVG 2JA8H 1HZCA 5BR8Q 4BA1I 1VQIA 4A3KG 3MXNB 3PO3H 2RF4A 2UUAL 3UDFA 4GNXA 1K9MC 3GTJH 1HNXQ 1XNQL 3A74A 4HIKA 4LFCL 1A8VA 5GAGC 2AHOB 2JA8G 4OO1G 3PCOB 4Y52H 3OYYA 2K14A 2VQFQ 4DUYQ 4A3MH 1CKOA 1K83H 2H5XA 1PYBA 3PUVA 3I55A 3H15A 4C3HH 1QVGA 1LM0A 2KHJA 4JBMA 4JOIC 1Q1BA 3Q8DA 1IBMQ 2JQOA 4XIGS 4OXPA 4LFAQ 1PV4A 4KHZA 1QZGA 4B3TQ 2WB1G 4HIOA 1X3GA 4LF9Q 3KYHC 5C3EG 2HIXA 4A3JH 1EQRA 1UWVA 1WYDA 2VW9A 3FKIG 4DV0L 1PH1A 4GN3B 4DUYL 3G71A 3KJPA 2N49A 2WAQE 1BBUA 4DR3Q 4AIMA 4JV5L 3CMAA 4DV1L 2BH2A 3SGIA 5IE8A 1K8GA 4JBWA 4AYBG 3U4VA 1X3EA 1HNXL 2LXKA 1UE1A 4R4OA 3CP0A 4JCVE 3CCJA 4UP8A 4LF4Q 4GNXC 1N36L 4IJLA 3PO2G 3W1GA 1PH4A 3KF6A 4C3JH 2B63H 4DR7Q 2UUCL 3TRZA 1IBKQ 1X3FA 2GVBA 1A0IA 2ASBA 3CCVA 1J5EL 4HJ7A 3G4SA 2Q2TA 2QGQA 5M3MH 1RIPA 1DGSA 1T9HA 5J3BA 2D0PA 3OTOQ 1XJVA 3HOUH 3I4OA 1IL2A 1U5KA 2B3GA 3KLWA 3TEHB 3M85A 2I0QA 4B3SL 4TVAB 4YWMA 4IFDG 2LSSA 2NZOA 4MTNA 5HY6A 2VQFL 2JEAI 2OTJA 1C9OA 4P74A 3TQYA 4GKKQ 3S24A 3K81C 2QA4A 4KHPQ 2UXCL 1E1OA 1S3OA 1HZAA 3CC4A 2I5HA 5IYBG 4DV1Q 1MIUA 1OXSC 1HR0W 1N32Q 4DR3L 4P72A 4C3IH 1LTLA 4DR4L 4R1JA 4AH6A 4JYAL 1X9NA 3AFPA 4JBKA 4QQBX 4A3KH 3GTMH 2PI2E 4A3CG 1Q1EA 3CW2C 1X54A 3PUYA 2WFWA 3M4OH 4JI5L 1LUZA 4B3RL 3IRBA 1Z9FA 3J80c 3GTOH 1VQ4A 2EQSA 1VQMA 2ZJPA 3W5OA 1VQJA 2F4VQ 4KI0A 2AWOA 1UEBA 4A3CH 2LXJA 2K75A 3KDFA 3RZOH 4LF7Q 4JI4L 2HHHQ 4NXML 4JI7Q 3I4MG 2I5LX 4P73A 1VQ9A 4POGA 5JJKA 4LUOA 3M7NA 1MJEA 5E7NA 1FJGQ 4DV4L 1SFOH 4DR5L 4MZ9A 5IP9G 4KHPL 1JMCA 4L5SA 4NB3A 2ALYB 3L7ZC 3M4QA 4DR6Q 1KAWA 4DV2L 2UU9L 1JJ2A 2R93H 1E1TA 4GOPA 1VQAA 5C4JH 1GVPA 3RLOA 3HOWG 3T1HL 2JEBI 5C0XG 3H3VH 4NXNL 1CUKA 4WJ3M 1SLJA 4GKJL 3E0EA 3FHWA 2R7DA 3I56A 3CC7A 4A75A 1GKHA 1VQFA 3L2PA 3I2ZA 1FVIA 3GO5A 4YWKA 4A3FH 1IZ6A 2IT1A 4AQYQ 3I4MH 1PH6A 4JI1Q 3KOJA 1L1OC 4PZ7A 3PO2H 3S1RH 4A4IA 3PIOA 3BU2A 1HR0Q 1L0WA 2XGTA 2KBNA 3AQQA 3J81i 1CSQA 3BJUA 3CXCA 2E2HH 2JK8A 4C2MH 1W2BA 2VUMH 5M5YH 5M3MG 4QIWE 4Y7NH 3S14H 1AE3A 3U4ZA 3S1MH 2D62A 5JEAJ 2JA5H 1I3QH 3DM3A 2F3IA 4DR6L 2MNAA 5M3FH 2PNHA 2WP8J 4PG3A 3GTQH 2R7FA 3K7UC 4JI6Q 2RCNA 4LW1A 3S17H 4A3IG 1ASZA 4X6AH 1I50H 1UE6A 3PGZA 3AFQA 3STBC 1PA6A 2E5LQ 4JV5Q 2DGYA 1M1KC 1UE5A 5ELOA 4DV0Q 2CKZB 1YJWA 4HJAA 3H0GG 1FGUA 1Q46A 3PV0A 4X66Q 1D8LA 1KIXA 4DV3Q 2YYZA 3KF6B 3BZCA 3UE1A 4IOCA 2BH8A 1M90C 2JJQA 4UP7A 3W1BA 5C44H 3FP9A 1W3SA 5IYDH 5IYCH 2KCTA 1HR0L 1X65A 1OXVA 1XNRL 1YBYA 2B29A 2JA7H 1VQLA 4NXNQ 2UXBL 1Q8KA 2ES2A 5C4XG 2CWPA 3HOXG 3OTOL 1PYSB 3D31A 4A3EG 3GDEA 5M5XH 2ID0A 2MO1A 3ULLA 4HIDA 3CCLA 3ULPA 5JJIA 1Q12A 1IXRA 2OQ0A 1L1OB 3PUXA 5C0XJ 3UDIA 4JI1L 5AJ3L 1HNZL 1VS0A 2F52A 4DUZL 4L5TA 3JC66 1XPUA 1Y1VH 3H0GH 4DV5Q 2WAQG 3TREA 2Q2HA 4DAMA 2E5LL 3KFUA 1N32L 2PMZE 1VQPA 2AKWB 1PH7A 1E22A 1E3PA 4UY8C 4IO9A 4LF8L 1N34Q 4OX9Q 3HOZH 1KL9A 1B7YB 3CPWA 4ALPA 2I5MX 4LNQA 5C4XH 3S1NH 3HOXH 4BA2I 1A62A 4R4CA 2C35B 3ZJYC 4HJ8A 3S2HH 1XTDA 4RG1A 1I94L 1SR3A 1I5FA 1YJ9A 3F1ZA 3PIPA 3G6EA 1NE3A 1N9WA 3F2DA 3J81c 2MO0A 4X62L 2Z6KC 1VQCA 3MEFA 2ZJRA 1IBML 1HNWQ 2MFIA 4GS3A 4JI5Q 4JI7L 4A76A 4EQ5A 2Z6KA 2R93G 1NBWA 1Y1VG 4DV3L 1VQHA 1HJPA 3S15H 2IX1A 3ER0A 4YHHL 1IBLL 1VQ6A 4YY3L 1XMQQ 1UE7A 4BBSG 3J7ZC 1WJJA 4LF6Q 3HOZG 3I7FA 1C7YA 4BY7G 4GN5A 4DV6L 1XNQQ 1HZBA 1CKMA 3CCUA 2UXDL 1D7QA 3UDGA 4DV4Q 1E7ZA 3KDFB 2QEXA 1S40A 2PQAA 3HFZB 1QZHA 4LFAL 4HJ5A 4PZ8A 3S16H 5DLQE 4DR1Q 1YHAA 3M4PA 3E9IA 2VUMG 5AJ3Q 4BXXG 1KD1C 4A93G 3J7A5 3FKIH 5LMUL 3RZDH 4JI3Q 1CSPA 1PVOA 1SMXA 4GLAC 3KJOA 1XPRA 2K5VA 3CMEA 3GD7A 1V43A 1N34L 3K80C 2JA6H 1C0AA 1IYJB 5LMNL 2PI2A 4OO1I 2MQHA 2VZAA 1N36Q 2FXQA 4LF4L 4IPGA 1Y1WG 1JB7A 2AWNA 4YY3Q 2IY5B 4A3GH 4YHHQ 3L0OA 1IBLQ 4MNOA 2N78A 4AYBE 2IHEA 3CCQA 1VQOA 4K0KL 2IHFA 1EFWA 3T1HQ 4LF6L 3I4NG 5IP7H 5BR8L 5IT9c 4X65L 2Q2IA 4A3LG 3STBD 5M5WH 1YVCA 1OTCA 2E2IH 1BKBA 1KRSA 1P8LA 2PQAB 3RLFA 1PH2A 2RHSB 1VQKA 2UUBL 3GTGH 2RHQB 1VQEA 2NVYH 4LWCA 2N3SA 3PO3G 4FDBA 1OXTA 1YNXA 1KXLA 1WCMG 4UP9A 2ZM6Q 2BA0A 3CCEA 2V1CC 1PH9A 1O7IA 1TWCH 4DR2Q 2UUAQ 4JYAQ 1PH5A 1XNRQ 4A3GG 4DR4Q 2NN6I 1GO3E 1KRTA 4UPAA 4YCWA 1VQGA 2CWAA 2YU9H 4JI0L 2Z0SA 3NEMA 1SROA 2VS1A 4JI8Q 3TS2A 4GLXA 5LMNW 1WOCA 1H95A 5K36G 1SN8A 4RMFA 4P71A 5FJ8G 2ZJQA 3NELA 1S72A 1PH8A 4TQUS 4OWWB 3CD6A 2A19A 2A8VA 1SE8A 3OW2A 1VQ5A 4DUZQ 2ATWA 4X64Q 1U0LA 3H3VI 3HOVH 5LMNQ 1MJCA 1N33Q 5JJLA 1Z47A 2R7ZG 2VL6A 1Q86C 4IFDI 1JJCB 3CQZH 3CCSA 1WCMH 4GNXB 1NTGA 2Y0SG 1JJGA 1NY4A 4LFBL 1TWHH 1WFQA 1L1OA 4A3MG 5FLMH 4BY1H 1G6PA 2HQLA 1PH3A 4IJHA 2KHIA 4A3DH 3HKSA 4QL5A 1VQNA 2UXBQ 4BBRG 2IX0A 4A3BH 3T1YL 4R4QA 4B3TL 4BBSH 1LYLA 3WWVA 4WJ4A 5HGQA 4A93H 1HZ9A 1QVCA 3K8AA 2GVAA 5GADC 1TWFH 3LGJA 1I94Q 4OX9L 2YTYA 3HOWH 3F8TA 4A3DG 5JEAG 4LF5L 1TXYA 4DKAC 2VQEL 4JI2Q 3RNUA 4BXXH 5M3FG 4GN4B 4DNIA 2OCEA 3F2BA 1XMQL 4DV5L 2JA5G 3HOUG 3EBEA 1G291 1XMOQ 1HH2P 4JBJA 3HOYG 2HIVA 3D0FA 4OWXB 1VQ7A 1N33L 2NVXH 4X64L 4X62Q 3U58A 4H02A 4A3JG 1QVFA 1HNWL 2OQKA 4JI0Q 3ULJA 2B63G 4IPDA 4B3SQ 3HOYH 2OTLA 2YTXA 4QY7A 5C44G 4LF5Q 4HJ9A 2E2JH 2EXDA 3KF8B 1X56A
chains in the Genus database with same CATH superfamily
1SE2A 2BA1A 3EFXD 1TWAH 1J5EQ 3G48A 1KQSA 1YZ6A 3KUPA 2DJGC 3RN5A 5I6WA 3V96A 3CCRA 3D6CA 2L0CA 4DU9A 4ZUJA 1K0RA 4C1NK 3CCMA 2O5IC 2L4NA 3AB9A 1RF2D 5FLXL 3GTLB 4G57A 3M9BA 4A93B 2EIFA 1R4PB 4DR2L 1CKNB 2ZTDA 3VDYA 1HFGA 4LF9L 3S2DH 2RCFA 3TP5A 5KRUA 5I4DA 3M4YA 4JI3L 3CPFA 1X55A 5C3EH 2F0UA 4DV7L 3RD4A 1NMGA 4IUTA 3DLLA 2UUBQ 4QCLA 3K59A 2DUDA 4UHVA 2BE5D 2PCFB 5IWAQ 4GKJQ 3KF8A 1TY2A 3ITPA 2Z8LA 5CBAE 5FLMG 4FF2A 5IY0A 2I46A 2NN6G 5JPNC 1BO0A 4BBRH 2F0FA 4CDEC 2EVBA 1STEA 3J80i 3BVGA 2XSCA 1DYQA 2VQEQ 1V8QA 4HN7A 2K52A 2CW0C 4Y7NB 3OOCA 3GTKH 5M5YB 3A7LA 1YHBA 4I65A 1U4RA 5F2DA 4ME5A 1EIFA 3DM1A 1CTMA 4LF7L 4O0AA 4NXMQ 1S5FD 1LT4D 3EN2A 3OHXC 4L6TB 2XWBB 3D3RA 3MVVA 4HSVA 2RSNA 2KCMA 1AH9A 1JE5A 1M8AA 2DN8A 4LUZA 1STYA 2JA9A 2K5HA 1SRUA 1PYWD 3J81E 1TWGH 4JI2L 3RN2A 2MJ8A 4DR5Q 1PFSA 2Q2UA 3GTPB 1RL2A 2C9OA 3J7YW 3VR3A 1G2SA 5IYCG 3QWNA 4DAYB 2J0TD 1Y8NB 5A2QE 3A5ZB 3UE0A 3HOVG 1F2MA 1HZCA 1PTOD 4FXDA 4OO1H 4BA1I 1KDBA 4A3KG 2EYPA 3PO3H 2RF4A 3P75A 2XN9C 2BCOA 2M2LA 3AU7A 2VB2X 1XNQL 1I4GA 5IGCA 1A8VA 3OYYA 3BS1A 1K83H 1U4LA 3PUVA 4TRDA 1LM0A 1X3PA 3TN2A 2K32A 4JOIC 1Q1BA 4XDXA 3Q8DA 4O42A 5C4ZA 2ICIA 4KHZA 4LF9Q 2WB1G 4HIOA 1X3GA 1DXMA 1PFNA 5C3EG 1SNMA 2HIXA 5KNCA 3FKIG 1ILQA 1SAPA 1PH1A 4DUYL 3G71A 2N49A 4IQZA 5L37A 2O4XA 1YNJD 2QDLA 2LXKA 3CP0A 2RSOA 1I4QA 2NTTA 1GHJA 4K2KA 3W1GA 4C3JH 2B63H 2EE1A 2MHVA 2NN6H 1ML0D 3I4MB 3X3NA 3E3XA 2ASBA 3SHLA 4CJ0B 3G4SA 4RWSC 3EJIA 1DGSA 1T9HA 3OTOQ 3BZDB 4B3SL 2R92B 5HY6A 2OTJA 2JEAI 1C9OA 4P74A 3FVQA 4KHPQ 1TWGB 1BDOA 4DV1Q 4P72A 1SYGA 4C3IH 2F0HA 4DR4L 4R1JA 3TP6A 3AFPA 4G7ZC 3KK7A 1A3TA 1Q1EA 3PUYA 3IRBA 3GTOH 3J80c 2EQSA 3DWQA 3GP7A 2ZJPA 2WAQB 2LXJA 2LS01 2XIWA 4JI7Q 3C3LA 1H9KA 2I5LX 1VQ9A 3M7NA 1F9SA 1JOQA 1LT3D 2QEJC 1MBYA 5I2XA 4DV2L 1B2TA 4DXGA 2QKIC 1E1TA 2JN4A 1VQAA 5JVH3 3RLOA 3HOWG 4B08A 1PMRA 2JA7B 4WJ3M 1SLJA 4B9XA 3FKIB 1VQFA 1SE4A 5C5LA 5JAVA 3FRPB 2IT1A 4JI1Q 2K7VA 1PTOH 4HAEA 1L0WA 1GXDC 2KBNA 3AQQA 1SYBA 2CQAA 2E2HH 4QIWE 1AE3A 2Q8RE 4M8AA 1EZ6A 2OT2A 2B2WA 2F3IA 1RDPD 5KEEA 2EYMA 3A55A 3MHBA 2WP8J 1STAA 2V4DA 5FLXE 3S17H 1UE6A 3PGZA 4ZCKA 5ELOA 1KIXA 1Q46A 3RMHA 4IOCA 1EY7A 2D2CC 2MP1A 2NVYB 3UE1A 2BH8A 1M90C 2JJQA 1YNNC 4UP7A 1E2WA 1AFPA 1DCZA 1HR0L 3DEOA 1X65A 2UXBL 1EQTA 2CWPA 3OTOL 1PYSB 4A3EG 3GDEA 5M5XH 3TDQA 1Q12A 4JI1L 2B2TA 3GQBA 2Z4HA 1VS0A 2A69D 4K5WA 2CH4A 2HCCA 1WCMB 2Q2HA 1V1PB 2JSOA 2PMZE 1E22A 3EQLC 4IO9A 5C3EB 3HOZH 3CPWA 2QF7A 5C4XH 1BUVT 3M3YB 4C3JB 5JVG3 2B63B 1B9NA 3HOWB 2K04A 1RTNA 1ESFA 4H7BA 2EPBA 1GJXA 1YJ9A 2VUMH 1NE3A 3J81c 4X62L 3A8KE 2Z6KA 1JWSD 1HQMC 1WD0A 4DXFA 3W2DA 1WJJA 2F0PA 1PRTC 4LF6Q 4BY7G 1F77A 4DV6L 1NNXA 4G7OC 1E7ZA 3HFZB 5DM73 1DZ1A 4HJ5A 3P20A 3ERQA 1RKNA 4DR1Q 4CDCC 3N6RA 1JWMD 3MXPA 1TS5A 1BF4A 4UDUC 5I9OA 1KD1C 2A6EC 3NE5B 3RZDH 1CSPA 5EKKA 1PVOA 1CI3M 2H4OA 4KN4C 1V43A 3GTJB 2HUGA 1C0AA 2E2HB 4OO1I 5IT9L 5IGFA 4BS9A 4YHHQ 1F9RA 5IP7H 2KCNA 2L11A 4BBSB 3ND9A 5M5WH 1YVCA 5CV8A 1BKBA 2PQAB 2RHSB 2NVYH 4NDXA 1H9MA 2M00A 1FNVA 1Q8IA 2A6HC 1YNXA 2XNAC 3FPUB 4DN4M 2EY1A 4DR2Q 2UUAQ 1PH5A 2A74C 1XNRQ 3NK9A 4DR4Q 4JI0L 1DOMA 3NEMA 5LL6X 2VS1A 5CV6A 1H95A 1SN8A 4WRDA 4RMFA 5FJ8G 1AN8A 1IW7D 2F3WA 1HTPA 3GTOB 1E2ZA 1VQ5A 3MXUA 2XRQD 1QCBD 3S17B 2R7ZG 5C3XA 4MHEA 3CQZH 1H9JA 4NP5A 2R93B 2Q8IB 4C3HG 2SDFA 1WTPA 4A3MG 5IIFA 1JWUD 1B4OA 4IUUA 3HKSA 4QL5A 1VQNA 5EGTA 4BY7B 2QCPX 5KYIA 1LYLA 5TSSA 4IUVA 2HDLA 3K8AA 3ND8A 1I94Q 5EKLA 2YTYA 4K6LA 2BOSA 3PO2B 4EQNA 1TXYA 4DKAC 2VQEL 2A69C 2A6ED 1SMYD 2A68D 3H09A 3Q0AA 4A3GB 1ET9A 2OCEA 3F2BA 4LMQD 4EQOA 3EBEA 1XMOQ 3IL8A 1WTQA 3HOYG 2HIVA 3D0FA 1VQ7A 1N33L 2AQ3B 2R61A 4A3JG 1HNWL 1QVFA 2OQKA 4JI0Q 3KLSX 3ULJA 4C3JG 2B63G 2F0KA 1NR4A 2EYLA 2YTXA 4FXKC 1WTXA 2OTLA 5C44G 4LF5Q 5CC4A 3H3VI 1ZEQX 1X56A 4GKKL 1P16A 2NB0A 3NENA 3CF5A 1YITA 5ELNA 3MAQA 1W6KA 4F7XA 4HTHA 3ERSX 4JC0A 4HCSA 1OXXK 2K5NA 4ILWA 4DR1L 5FK9C 1VQBA 4A3IH 2F0DA 2WV6D 5ELCA 3PUWA 4LUVA 3MWYW 3AEVA 1XXGA 1WI5A 3M3YH 1SYCA 1UEAB 2NWGA 3DMUA 5IWAL 1EFID 3DWAA 3JAMi 3I90A 3OW7A 3PUZA 1QNKA 4DV2Q 4GOPC 1ASYA 2HHHL 2NVTB 1EYDA 5EPKA 3A5UA 3J80E 4HSPA 1ENFA 3RZDB 3PF4A 1ICWA 1NUCA 3EIVA 2JYOA 2IL8A 3EROA 3K7AH 1WVLA 5FJ8H 4BY1G 4GOPB 1Z7TA 2KENA 3NPPA 1WD1A 2FMMA 4QJFA 2F0JA 5GAEC 4EX5A 3QIAA 1EY4A 1YNND 2K03A 4PMWA 1OO9B 1NR2A 4PZ6A 1SNCA 5EPLA 2RDGA 4YCUA 3K7AB 1Q81C 1GD7A 1E2VA 3PSIA 3IKJA 1PTOF 3UDXA 1F9PA 4APVA 5E3FA 2EY6A 1PHJA 2ZM6L 4K8IA 4GZYC 1Q7YC 3I3CA 2JA6G 4V0BA 1SJED 1B3AA 1OXUA 4X66L 1NSNS 2BDNA 2VNUD 4RCNA 5IYBH 4DFAA 3GTPH 3ICEA 5EAYA 3OIPA 1B8AA 5KNDA 3I4NH 4K0KQ 1XMOL 4ABNA 3V05A 5LHY1 1E0BA 4YWLA 4QGUA 1SNDA 5HURA 2O5JC 1BBWA 3E6ZX 2R92G 4R4TA 3P7JA 2E2DC 4IOAA 4OWTB 4A3LH 4WORA 5HGTA 1Y1WH 2AMCB 4B3MQ 1KDAA 2Z1CA 5IYDG 2CH4W 5GROA 4HIMA 1S5BD 2YTVA 3DXJC 2L5TA 5E1FA 3TS0A 1VCIA 2K05A 4ME3A 4IALA 4IPHA 2K33A 2K5DA 4AQYL 3CC2A 3D8GA 3HEJA 4BBRB 2KHSA 1JOKA 1LLRD 4DNRB 3OMCA 5GAGC 4OO1G 4Y52H 1HCZA 1CKOA 1PYBA 4KTAA 1CZGA 3QB3A 2KHJA 4JBMA 2EJGC 2JQOA 5EBCA 4LFAQ 4IURA 4B3TQ 1F9QA 3KYHC 4ZQ3A 2PMZB 4CDFC 1UWVA 3W3AA 1EOTA 3PQIA 4KKSA 4GN3B 4KJNA 3J7AF 4AIMA 4JV5L 3CMAA 3SGIA 3S9WA 5IE8A 4JBWA 3U4VA 1X3EA 1HNXL 4U673 3VYRA 3CCJA 1MGSA 4IJLA 3Q23A 1N36L 3G7LA 1PH4A 4DR7Q 1HTLD 4KHVA 1IBKQ 1X3FA 1A0IA 4CJ2C 1SYEA 1J5EL 4HJ7A 1KAAA 4YIJA 4IFDH 2Q2TA 3HOUH 1JICA 2D0PA 1XJVA 1IL2A 1U5KA 1HRJA 1EYCA 4YWMA 1DOKA 3H0GB 2LSSA 4NMZA 5JPMC 1JORA 3K81C 4LK1C 1E1OA 2XWJB 1MHWC 2B2UA 1NCVA 5C3WA 1OXSC 1HR0W 1N32Q 2F0WA 1BCPC 3SE0A 2Q8TA 1TS3A 3NWSA 4JYAL 4OGQC 4QQBX 1BR9A 1ZYRC 4A3KH 2XVSA 4A3CG 4B3RL 1LUZA 1VQ4A 1TR5A 4RHSA 1QB5D 2K28A 1STNA 4S3SA 2AWOA 1UEBA 3S15B 1EIHA 4JI4L 2CVRA 4ULLA 1IKLA 1I50B 3D4WA 2NZ1D 4MN3A 4DAYA 3VYSA 4C3IB 3OMGA 5E7NA 4IN3A 1SFOH 2K5WA 4DR5L 3DWPA 5IP9G 2BE5C 2A5HA 4L5SA 1ENCA 5ELBA 1A15A 3TZUA 4DR6Q 1K28A 2UU9L 1T5XD 5I2YA 1JJ2A 3S16B 1QOHA 1FD7D 2JEBI 3FHWA 3I56A 2R7DA 4OIJA 3CC7A 4A3DB 3I2ZA 3GO5A 4JPBW 4CJ1B 1C8CA 4A3FH 3KOJA 4FP5D 4KD3A 3S1RH 4PQXA 3T13A 3RUZA 1MD2D 3J81i 2YU9B 1CSQA 1EU4A 2WKDA 1W2BA 5M5YH 1XX8A 5EPJA 5M3MG 1U4PA 2IJ0A 3QJYA 3SDZA 2D62A 3U4ZA 4QUCA 1I3QH 2MNAA 4XQQA 1EY8A 1B53A 2PNHA 1MSHA 3GTQH 4X6AH 4CBVA 3STBC 1PA6A 4H0LC 3CU7A 2DGYA 2NBFA 2CKZB 1VF5C 3KBGA 1FGUA 3PV0A 4X66Q 1D8LA 2YYZA 3BZCA 3JAML 5C5MA 1Q90A 2N55A 1KNEA 3SK8A 5IYDH 4TSSA 2IWHA 5IYCH 4HEDA 2F4IA 1Q8KA 5CV7A 5C4XG 4X3SA 3D31A 2M9VA 4ID6A 2ID0A 2MO1A 1JQYD 2C5CA 3I4LA 4O1NA 3IAYA 1IXRA 2OQ0A 1L1OB 3PUXA 5JJZA 5AJ3L 4LJZC 4DUZL 3JC66 1Y1VH 4DV5Q 3H6MA 2F03A 1BQQT 2E5LL 3KFUA 3C1EA 2EY5A 1LTTD 4UY8C 5IOCA 4OX9Q 4CGYB 2SNMA 4EGVA 1B7YB 5EQ0A 4ALPA 4LNQA 3S1NH 3HOXH 5KGUA 4BA2I 4CKEA 1A62A 1D5XC 3GTMB 4R4CA 3ZJYC 4HJ8A 2MGSA 1XTDA 1GUGA 5IT9E 3PIPA 2ZJRA 1IBML 2MFIA 2R93G 4A76A 5A2QL 1VQHA 2DJFC 4XYQA 1C4QA 4YHHL 1G2TA 4YY3L 1UE7A 4BBSG 3J7ZC 2LFNA 5CV9A 2CHBD 3CCUA 2UXDL 1S40A 5M5XB 1PTOB 3T56B 2PQAA 2QEXA 3SEBA 1QZHA 4LFAL 4FNFA 3BYYB 5DLQE 3KBXA 4PV1C 1ONLA 5AJ3Q 4BXXG 3J7A5 1SJHD 3FKIH 2RDHA 4JI3Q 4DGZA 5ISRA 4ZLTF 3KJOA 4RH6A 3CMEA 1N34L 4FVMA 3K80C 1IYJB 2PI2A 4IPGA 2IY5B 2AWNA 2VXWA 4A3GH 1IBLQ 4MNOA 5ELFA 1STBA 5M5WB 3T1HQ 5KNBA 4R8IA 4XXEA 3S2DB 4X65L 4QIWB 4A3LG 4C3IG 1P8LA 3GTGH 1VQKA 3SK4A 1A2TA 3S1QB 2F0IA 4KK7A 4LWCA 2N3SA 1LTBD 4UP9A 4ZYSA 1EY6A 3CCEA 1EEID 4A3GG 2NN6I 1KRTA 4UPAA 2YU9H 3BVMA 3BDLA 4K14A 3TS2A 1CA5A 1D1KA 4BWGB 2F1MA 3NSWA 3NELA 1S72A 1EYAA 3R3OA 4TQUS 1SDFA 4RGNA 2EZVA 3H94A 1D5ZC 3OW2A 5LMNQ 2NVQB 1Z47A 1SBBB 1Q86C 4IFDI 1WCMH 3MA2B 2Y0SG 1JJGA 2RDFA 3M7GA 3K5NA 5FO9B 1L1OA 3HOXB 1PLFA 4A3DH 4F88A 1STGA 3K5MA 4A3BH 4QUFA 4B3TL 3FDTA 1SNPA 4BBSH 4WJ4A 1UAPA 4A93H 1HZ9A 1QVCA 4KMUC 3HOWH 4JVZA 3F8TA 4A3DG 5M3FG 4GN4B 5LL6S 3LX0A 4TKOB 2JA5G 1QILA 3HOUG 1G291 1HH2P 4OWXB 1D2BA 2NVXH 3QR8A 3R93A 5I9PA 1EIGA 1L0YB 1Q3LA 1ZKOA 4X62Q 3R2TA 4DF7A 2LMCB 4B3SQ 2HD3A 3DUZA 1SNOA 3T16A 2O2LD 1J6QA 4IFDJ 3MC0B 1I4PA 4KLKA 1XTCD 2ZTEA 5BN5A 3TZDA 1HUMA 3CAMA 1SNQA 3GV6A 4IPCA 4K6DA 4Z9CB 1EOVA 2B2VA 1WTVA 1G91A 2UXCQ 1V1QA 3VR6A 5E4XA 3RLNA 4A3JB 2B2UC 5H1SE 3S1QH 3O13A 2B8FA 3TP8A 4P75A 2K4KA 4ZUIA 2UU9Q 1G6ZA 1LT6D 3B6YA 1SFOB 1HA6A 1PZID 5C0XI 3A54A 1VQDA 2F3VA 4EQPA 4DA2A 3HKZE 2ZT9C 5LMUQ 1YHQA 2CQOA 2LY7A 2KJXA 3TP7A 4JI4Q 1V1PA 3HOZB 2R6GA 3A8IE 2A73B 1K3RA 1TWFB 4A3FG 4A3BG 2ZXRA 1K3BC 2JE6I 5KIXA 5DEHA 1PRTF 1YEZA 1KC8C 4IUQA 4ODGA 4L5QA 4OONA 2GN5A 4DV6Q 4LF8Q 1EWIA 2NZHA 1EY5A 4BY7H 3L3OC 4RKLA 1G51A 1FL0A 1RCVD 1XYIA 3DHQA 3I4NB 4C1NI 4LFBQ 1L0XB 5IGBA 2TSSA 3MFYA 1WTOA 1O7YA 3AYHB 2UXDQ 1EUJA 3PMFA 1GUSA 3NBHB 4UAIA 4DR7L 2D0OA 4RHRA 1AP0A 2WB1E 1EY9A 1WTRA 1NJIC 2RBMA 4X3TA 2JA7G 4CHTB 3UI2A 1TS2A 1GUWA 2A1AA 5EJWA 5CMDA 1IYVA 1EYGA 1K73C 1A63A 1CHQD 5GQOA 1Y1WB 2FINB 1GM5A 2P5ZX 1LO5D 1ZXTA 4FYDA 4GLVB 4DPGA 2ZTCA 2N8NA 3SXHA 1YIJA 2L15A 1QUQB 4NPSA 5FKAC 5IP7G 3LWUA 4X3UA 1R9TH 4L63B 2VY3A 1CM9A 1AE2A 3JAMc 3PIP3 2UUCQ 1NMFA 3A0JA 1I3QB 1VQIA 2FMCA 3MXNB 3OPOA 5ELDA 3UDFA 3GTJH 1LTAD 2NVXB 2JA8G 3PCOB 4RGOS 2K14A 4KY5A 5CV4A 2VQFQ 4DUYQ 4K5XA 2H5XA 1QVGA 2F0EA 4R8NA 5COYA 1S5ED 1IBMQ 3QG1A 4OXPA 2AUKA 2HDMA 2PYKA 1QZGA 5T1IA 1CQVA 2B2VC 1EQRA 1WYDA 2MPMA 3I73A 4IZ8A 1AW7A 2VW9A 3K58A 3F2UA 3C2PA 3FMCA 1BBUA 2B2WC 4DV1L 1BBXC 1K8GA 4AYBG 4R4OA 4JCVE 4H44C 4UP8A 1SYDA 4LF4Q 4GNXC 2Z6BA 3KF6A 4V190 2UUCL 3N52A 5J1ZA 2XRSD 5CV5A 5T1GA 4XT1B 4N8FA 1I6VC 4NW2A 5M3MH 1RIPA 1CA6A 1SE3A 2PW7A 1A3UA 1LV9A 1NAPA 1A6XA 4RFBA 3TEHB 1SEBD 1TVXA 4TVAB 4M1UB 4IFDG 2NZOA 2VQFL 5I6YA 4N9PA 3TQYA 2QW7A 4BY1B 3CC4A 1HZAA 1CFMA 1FYCA 5K5PA 5IYBG 1MIUA 4DR3L 5FO7B 1LTLA 3R2IA 1BCPF 5IGDA 5K36H 2PI2E 1HHVA 3VA7A 3CW2C 3L9AX 5BN3A 4XQNA 3Q24A 3M4OH 1VQMA 2F4VQ 3W5OA 1VQJA 2EOTA 1U9RA 3KDFA 3RZOH 4LF7Q 4NXML 2PPBC 2G5DA 3A56A 4G4KA 1BCPD 5D65A 3Q22A 1MJEA 4DV4L 1B3QA 4MZ9A 4KHPL 1JMCA 4K5VA 4NB3A 4K2LA 3M4QA 2D5DA 1WTHA 4OEMB 2ENBA 2R93H 4GOPA 5C4JH 1GVPA 5C0XG 3H3VH 3SR1A 4NXNL 1CUKA 2AQ1B 4A75A 2F0GA 4RCOA 5IGGA 1IZ6A 1IW7C 1TQOA 2J7ZA 3J80L 4AQYQ 1PH6A 4PZ7A 1JR0D 3PO2H 1DD2A 1HR0Q 2XGTA 1LT5D 3CXCA 1BCPB 1LTSD 1RHPA 2JK8A 4C2MH 3X3MA 3S1MH 2WKCA 5JEAJ 2RVLA 5NUCA 3D6WA 4PG3A 4I7ZC 1DONA 4JI6Q 2RCNA 4LW1A 4A3IG 4H13C 1B9MA 1M1KC 1YJWA 2IW3A 4HJAA 3E5SA 3KF6B 4IUPA 4KJOA 1CZWA 3WOEA 2R7ZB 5C44H 4WFN3 2H1EA 3U9OA 4ZKBB 1XNRL 1YBYA 2JA7H 3LNNA 4NXNQ 5FO8B 2ES2A 1I4HA 5CORA 3ONAB 3I91A 2Z9HA 4RGMA 2E76C 5EKIA 3CCLA 5JJIA 1DJRD 4X3KA 1HNZL 3NP8A 2F0MA 2F52A 4CKCA 3EVQA 4L5TA 5A35A 1Y8PB 3R8BA 3TREA 2PZWA 1IHZA 1PH7A 4Q5VA 4LF8L 4G7HC 1N34Q 1I4XA 1KL9A 4F8MA 5JOBA 2I5MX 4OHJA 4KD4A 2I07B 1SSOA 1HQRD 3K5OA 3JAME 1LABA 2X6LA 2EJMA 2IX3A 2F0VA 1RTOA 3MFGA 3S2HH 4RG1A 1K8OA 1I94L 1SR3A 5G3LD 1N8RC 1JT8A 3QO2A 4GS3A 4JI7L 4EQ5A 1D5MC 1ICFB 1Y1VG 1HJPA 2F0SA 3WDNA 2IX1A 3S15H 1EL0A 3ER0A 1IBLL 1VQ6A 2HCIA 4J8QA 1H9SA 3CRKC 1QWYA 3I7FA 2RQXA 1C7YA 4DAVA 3IFTA 4GN5A 1HZBA 1CKMA 5DAUA 1CK1A 2B2YA 1D7QA 4BXXH 4DV4Q 1D6EC 3KDFB 4QB4A 3NQIA 2GA4B 1GUTA 1TWAB 5J22A 3S16H 2A6HD 3HP3A 1ENAA 1YHAA 3M4PA 2PZTA 4A3FB 1EQVA 2VUMG 1EWHA 1PZKD 4XT3B 3MEHA 4R9WA 4A93G 4A3IB 2Z4IA 2ICEC 1PXUA 1RODA 5LMNL 2MQHA 4HCEA 1S4ZA 4DK1A 4LF4L 1Y1WG 1JB7A 1QG7A 3HS0C 3L0OA 2N78A 4AYBE 2IHEA 1VQOA 4ZKCB 1EFWA 3BDOA 4U68A 3I4NG 1TKWB 2Q2IA 3HRZC 1OTCA 1R4QB 2K1BA 2F0OA 3RLFA 4C56C 2UUBL 2RHQB 1VQEA 5IGEA 3PO3G 3NUCA 1OXTA 4FDBA 1Y69U 1WCMG 2ZM6Q 4C2MB 1PH9A 2EY2A 1TWCH 2RA4A 1GO3E 2Z0SA 1PRTD 2DNEA 4GLXA 2AUJD 4NKLA 1WOCA 3LWEA 5K36G 1HPCA 4P71A 3D4RA 2EXZA 4QMGA 3CD6A 4OWWB 2R3ZA 4A3MB 1N33Q 5JJLA 3A8JE 2VL6A 4K8JA 4MTKA 1KLUD 1TS4A 1Y1VB 3GTKB 1NTGA 1NY4A 5E4WC 4BY1H 5FLMH 2HQLA 3HZXA 1I6HB 2KHIA 2UXBQ 4BBRG 2IX0A 3T1YL 4J6HA 3OIQA 1T5EA 2EJFC 5HGQA 2GVAA 3NBIA 1TWFH 2X69A 4N8X1 3LGJA 3NXWA 5GADC 4OX9L 5C0XH 5JEAG 4LF5L 3FPPA 4JI2Q 1BNZA 4DNIA 1SMYC 2A68C 2VB3X 5JEAH 1KDCA 2KVMA 2SNSA 1KNAA 4X64L 1JOOA 3U58A 4H02A 4HR7B 2ZXOA 2EYJA 5CYUA 4DK0A 3PIO3 4QY7A 2WB1B 1D1IA 4HJ9A 2E2JH 2EXDA 3KF8B 4A3JH 3NHHA 4FF3A 1Q82C 2YV5A 2HT1A 3S1NB 3F2CA 2JA5B 2JXMB 4JW0A 2R92H 1LTRD 2EDGA 1B70B 3QOJA 1S5DD 4O2DA 4DNTB 2XTIA 4LFCQ 4B3RQ 1MKHA 3NBHA 4YCVA 4XQJA 3MXGA 2CFMA 2KUMA 5IP9H 1YJNA 3K6OA 1L2FA 5M9OA 3J81j 3SK5A 3URYA 2F4VL 4JI8L 3E0JA 1LTGD 3AMUA 2DY8A 5FLXc 1YI2A 4N9TA 1V9PA 1X3QA 5C6AA 4X65Q 1V1OA 3K0YA 3GTLH 2PZUA 4ZRZA 2KOLA 2WACA 1Y14B 2R7ZH 1BXTA 1QUQA 2L1BA 5CR3A 4CKBA 4DK6C 4DK3C 1HUNA 3J81L 1UNSA 3S14B 1QJOA 3HKZG 1K8AC 3PF5A 3HG9A 3CHBD 2E8GA 1CKNA 4XTCS 1IBKL 1PTOC 3E9HA 1O7LA 2KA7A 3K0XA 4KN7C 1G8ZD 3S1MB 1KTKA 2Y0SE 1KHIA 4B3ML 4AYBB 3NQTA 1XPOA 3T1YQ 3BVZA 2NVTH 2OWOA 3PO3B 4DV7Q 1X6OA 5GAHC 1E24A 4J15A 3GTQB 5C44B 1HA5A 3HKZB 1EQQA 1TY0A 5J39A 4JI6L 1JB3A 2F0TA 2L55A 1HNZQ 3BZKA 1Z6HA 3WOFA 1GUNA 3NTIA 4OL7A 1EIYB 1AEXA 4E6IA 2F0LA 4R4IA 4P2CB 2L9HA 3U50C 5C4JB 2K5QA 4POFA 1VQ8A 4FF1A 2NVQH 4QF4A 2K50A 4JG2A 1FJGL 1Y8OB 1TT2A 1M4VA 1BVSA 1STHA 1QE6A 3GTGB 4A3EH 1H9RA 1KLGD 4JOIA 1PFBA 2CCZA 4RKBA 3HOUB 2TMPA 3RR5A 4L5RC 1CQFA 1TU2B 2E75C 4PMBA 3U9SA 1IYUA 4C3HB 2JP1A 1FR3A 2CW0D 5C4HA 3K57A 4OELB 1I6HH 4RA8A 1TIID 4Q0FA 2JA8H 3FEWX 5BR8Q 2NYZD 3ZYYX 1GHKA 3V2TA 2UUAL 2FJ2A 4GNXA 3I8ZA 5KYLA 1K9MC 1HNXQ 3A7AB 1RJTA 3A74A 1F2LA 4LFCL 4HIKA 2AHOB 1BOSA 4A3MH 4KV6A 3I55A 3BYTB 4C3HH 3H15A 4F87A 1PRTB 3CQZB 5DM63 2KCCA 1SXTA 4XIGS 1PV4A 1MI2A 3T51B 4DV0L 1EEFD 1SYFA 1MSGA 4PMCA 2EYFA 3KJPA 4FXGC 2WAQE 4DR3Q 1PFMA 1B50A 2JA6B 2BH2A 1ILPA 5CGKA 2IPKD 1LTID 1UE1A 2ZXPA 3H3VC 1YNJC 3I72A 1J8IA 5M3FB 4MIUA 1VMPA 3PO2G 2BDOA 3TRZA 1EWCA 2GVBA 3CCVA 2PNRC 4J1MA 2X6GA 2QGQA 5CBEE 5J3BA 1KABA 1F2ZA 3I4OA 1IL8A 1H9SB 2B3GA 2KEDA 3KLWA 3M85A 2I0QA 3C46A 4MTNA 3D4DA 4GKKQ 3S24A 2QA4A 3CKIB 1HXYD 1S3OA 3TBIB 2UXCL 2I5HA 1CT1D 3HGBA 2B2YC 3M4OB 2LKVA 4AH6A 2NUCA 4RAUC 1X9NA 4KKUA 4JBKA 2B8GA 4ZK9B 3GTMH 1X54A 2WFWA 1FNWA 4JI5L 1Z9FA 3VYUA 3VR5A 1HFNA 2KQ3A 4KI0A 3DEPA 4A3CH 1O78A 1I4RA 2K75A 2HHHQ 3VR2A 3I4MG 3SVMA 4P73A 4POGA 5JJKA 4LAAA 4LUOA 2G9HD 1FJGQ 2WIIB 1EY0A 2QILA 3S1RB 2ALYB 3L7ZC 2QDBA 2EYHA 1KAWA 2G9DA 5D3DA 5D14A 4EVOA 3T1HL 3MZ5A 2OEOA 2E2IB 4GKJL 3E0EA 1GKHA 3L2PA 1FVIA 4DAPA 4YWKA 3I4MH 1L1OC 4A4IA 3PIOA 3BU2A 3BG3A 1FNUA 4FO2A 3KLRA 1ESRA 3HOYB 3HOVB 3BJUA 3MXNA 5BN4A 1RD9D 3S14H 4Y7NH 2D9UA 2B39A 2JA5H 2DY7A 3I70A 3DM3A 4DR6L 5M3FH 2HQEA 5C4XB 1ET6A 4HMIA 2R7FA 3K7UC 4JK1C 2KECA 1ASZA 1I50H 1GOZA 4JV5Q 3AFQA 2Y0SB 2E5LQ 1C48A 2FHTA 3VA5A 1UE5A 4DV0Q 3H0GG 4DV3Q 2PO4A 1JC7A 1XWEA 4KY7A 3W1BA 3FP9A 1W3SA 1TWHB 2KCTA 5D3IB 1OXVA 4RGTA 2AQ2B 2B29A 1VQLA 2WINB 1GUOA 2KEEA 3VR4A 3HOXG 3ULLA 4HIDA 3C1FA 3ULPA 2MUYA 5C0XJ 3UDIA 1QNUA 1XPUA 1R9TB 3H0GH 3G6JB 2WAQG 4DAMA 4CDDC 1N32L 1VF7A 1VQPA 2AKWB 1E3PA 2K01A 1J9OA 3S2HB 3T53B 1A3VA 3IFDA 4WJWA 1CHPD 1DM0B 5AFWA 4A3KB 2SOBA 3OSOA 2C35B 4HMJA 5IODA 1I5FA 3NWTA 3F1ZA 3G6EA 1N9WA 3F2DA 2MO0A 4L8JA 2Z6KC 1VQCA 3MEFA 1HNWQ 4JI5Q 2OF1A 4PNYA 1JCKB 1NBWA 4DV3L 3RZOB 2RKSA 4I7AA 1XMQQ 3NTHA 1S5CD 3NTKA 2EYOA 2FFKB 3HOZG 1XNQQ 3Q6SA 3J7AV 3UDGA 3EA6A 2NTSA 4PZ8A 1F2YA 1II3A 4ZAIA 2J4XA 3E9IA 1FGBD 3P1HA 4XYOA 5LMUL 1SMXA 1W6JA 3OWEB 4GLAC 1XPRA 2K5VA 3GD7A 3VYTA 2JA6H 4KY6A 1U4MA 2VZAA 1N36Q 2FXQA 2E74C 1DOLA 4YY3Q 1JE4A 3CCQA 3CRLC 3T4AC 2IHFA 4K0KL 1AZPA 4LF6L 3K5LA 2PQEA 4FF4A 5BR8L 5IT9c 3GV3A 4B9WA 1IKMA 3STBD 2E2IH 4A3EB 1KRSA 1PH2A 2SEBD 3MTSA 4KKTA 1KXLA 2K6AA 2BA0A 2V1CC 1O7IA 1EU3A 1X32A 2F0NA 1PZJD 5FOBB 4JYAQ 2VUMB 2JA8B 1K8MA 4YCWA 1VQGA 1O7ZA 2CWAA 4JI8Q 1SROA 5LMNW 3BDCA 1K0SA 1EZ8A 2ZJQA 2F0QA 1PH8A 5ELEA 2A19A 5G3LF 1SE8A 2A8VA 3TMEA 4DUZQ 2ATWA 4X64Q 1U0LA 3HOVH 1MJCA 1JJCB 1TWCB 2DNCA 3CCSA 2OXPA 4GNXB 4A3BB 2PW5A 1B1ZA 1O80A 4LFBL 1TWHH 1PDQA 1WFQA 3OWFA 3SK6A 1G6PA 1PH3A 4IJHA 1UUPA 5EBDA 4OIKA 1VMCA 4R4QA 3WWVA 3QOLA 1A2UA 1VDZA 2N88A 3RNUA 2E2JB 2L12A 5DNFA 1K83B 1XMQL 4DV5L 3KLSA 1B44D 4JBJA 2B2TC 1ZYRD 3TSSA 4IUNA 4IPDA 3HOYH 3H91A 1LACA 5M3MB 1AZQA 1WTWA
chains in the Genus database with same CATH topology
1J6QA 2BA1A 2YV5A 1Q82C 1P16A 2HT1A 3NENA 3CF5A 1YITA 4GKKL 3F2CA 1TWAH 5ELNA 1J5EQ 4IFDJ 3G48A 2R92H 4KLKA 2ZTEA 1KQSA 1YZ6A 3ERSX 1B70B 3RN5A 4JC0A 3CAMA 1OXXK 2K5NA 3CCRA 4DR1L 1VQBA 4A3IH 4O2DA 4IPCA 3PUWA 4LUVA 3AEVA 2XTIA 3M3YH 1K0RA 1EOVA 1WI5A 4LFCQ 4B3RQ 3CCMA 2UXCQ 1V1QA 3RLNA 1MKHA 5H1SE 5IWAL 3S1QH 3JAMi 3PUZA 3M9BA 4P75A 2K4KA 2EIFA 4YCVA 4DV2Q 3B6YA 4GOPC 2UU9Q 1ASYA 2HHHL 5C0XI 2CFMA 1CKNB 4DR2L 1VQDA 2ZTDA 5IP9H 3VDYA 1YJNA 1L2FA 3J81j 4LF9L 3A5UA 3S2DH 2F4VL 4JI8L 3HKZE 3PF4A 1YHQA 4JI3L 5LMUQ 2CQOA 5FLXc 3EIVA 1YI2A 3CPFA 1V9PA 1X55A 4JI4Q 2R6GA 5C3EH 3K7AH 5FJ8H 4BY1G 4DV7L 4X65Q 4GOPB 3GTLH 1K3RA 1NMGA 2KENA 3DLLA 4A3FG 4A3BG 4QJFA 2UUBQ 5GAEC 4EX5A 1Y14B 2DUDA 2R7ZH 2JE6I 1QUQA 1YEZA 4PMWA 1KC8C 4PZ6A 4DK6C 4L5QA 4DK3C 5IWAQ 4GKJQ 4YCUA 4OONA 2GN5A 5FLMG 4DV6Q 3HKZG 1EWIA 1K8AC 4LF8Q 3PF5A 5IY0A 2NZHA 2NN6G 1Q81C 1GD7A 2E8GA 3PSIA 4BY7H 4BBRH 1JT8A 1CKNA 3UDXA 1G51A 1FL0A 4XTCS 1IBKL 3J80i 4APVA 2VQEQ 3E9HA 1PHJA 2K52A 2ZM6L 3K0XA 4LFBQ 3GTKH 2Y0SE 1KHIA 4B3ML 1Q7YC 1XPOA 3T1YQ 1YHBA 2NVTH 2OWOA 3AYHB 2JA6G 1EIFA 4DV7Q 1X6OA 1EUJA 2UXDQ 4LF7L 4O0AA 1OXUA 4NXMQ 5GAHC 1E24A 3NBHB 4X66L 4J15A 4DR7L 2VNUD 3EN2A 5IYBH 2D0OA 3GTPH 2WB1E 3ICEA 5EAYA 1EQQA 1NJIC 1B8AA 2KCMA 2JA7G 4JI6L 1AH9A 1JE5A 3I4NH 1HNZQ 4K0KQ 3BZKA 1XMOL 4LUZA 2A1AA 2JA9A 4YWLA 1K73C 1EYGA 2K5HA 1SRUA 1EIYB 4QGUA 1A63A 4R4IA 3U50C 1BBWA 5GQOA 4POFA 1VQ8A 2NVQH 2R92G 1TWGH 4R4TA 4JI2L 2K50A 3RN2A 4JG2A 4OWTB 4DR5Q 1GM5A 4IOAA 4A3LH 1PFSA 1FJGL 2Q2UA 1BVSA 1Y1WH 2AMCB 4B3MQ 4GLVB 4DPGA 1RL2A 2ZTCA 5IYDG 2N8NA 4A3EH 5IYCG 2L15A 1YIJA 4JOIA 1QUQB 5GROA 2CCZA 4NPSA 3RR5A 4HIMA 4L5RC 2YTVA 3TS0A 5IP7G 4DAYB 1N8RC 1R9TH 1VCIA 2VY3A 3A5ZB 1AE2A 3JAMc 4ME3A 2UUCQ 1I6HH 4IPHA 3UE0A 4AQYL 1NMFA 3A0JA 3CC2A 3HOVG 2JA8H 1HZCA 5BR8Q 4BA1I 1VQIA 4A3KG 3MXNB 3PO3H 2RF4A 2UUAL 3UDFA 4GNXA 1K9MC 3GTJH 1HNXQ 1XNQL 3A74A 4HIKA 4LFCL 1A8VA 5GAGC 2AHOB 2JA8G 4OO1G 3PCOB 4Y52H 3OYYA 2K14A 2VQFQ 4DUYQ 4A3MH 1CKOA 1K83H 2H5XA 1PYBA 3PUVA 3I55A 3H15A 4C3HH 1QVGA 1LM0A 2KHJA 4JBMA 4JOIC 1Q1BA 3Q8DA 1IBMQ 2JQOA 4XIGS 4OXPA 4LFAQ 1PV4A 4KHZA 1QZGA 4B3TQ 2WB1G 4HIOA 1X3GA 4LF9Q 3KYHC 5C3EG 2HIXA 4A3JH 1EQRA 1UWVA 1WYDA 2VW9A 3FKIG 4DV0L 1PH1A 4GN3B 4DUYL 3G71A 3KJPA 2N49A 2WAQE 1BBUA 4DR3Q 4AIMA 4JV5L 3CMAA 4DV1L 2BH2A 3SGIA 5IE8A 1K8GA 4JBWA 4AYBG 3U4VA 1X3EA 1HNXL 2LXKA 1UE1A 4R4OA 3CP0A 4JCVE 3CCJA 4UP8A 4LF4Q 4GNXC 1N36L 4IJLA 3PO2G 3W1GA 1PH4A 3KF6A 4C3JH 2B63H 4DR7Q 2UUCL 3TRZA 1IBKQ 1X3FA 2GVBA 1A0IA 2ASBA 3CCVA 1J5EL 4HJ7A 3G4SA 2Q2TA 2QGQA 5M3MH 1RIPA 1DGSA 1T9HA 5J3BA 2D0PA 3OTOQ 1XJVA 3HOUH 3I4OA 1IL2A 1U5KA 2B3GA 3KLWA 3TEHB 3M85A 2I0QA 4B3SL 4TVAB 4YWMA 4IFDG 2LSSA 2NZOA 4MTNA 5HY6A 2VQFL 2JEAI 2OTJA 1C9OA 4P74A 3TQYA 4GKKQ 3S24A 3K81C 2QA4A 4KHPQ 2UXCL 1E1OA 1S3OA 1HZAA 3CC4A 2I5HA 5IYBG 4DV1Q 1MIUA 1OXSC 1HR0W 1N32Q 4DR3L 4P72A 4C3IH 1LTLA 4DR4L 4R1JA 4AH6A 4JYAL 1X9NA 3AFPA 4JBKA 4QQBX 4A3KH 3GTMH 2PI2E 4A3CG 1Q1EA 3CW2C 1X54A 3PUYA 2WFWA 3M4OH 4JI5L 1LUZA 4B3RL 3IRBA 1Z9FA 3J80c 3GTOH 1VQ4A 2EQSA 1VQMA 2ZJPA 3W5OA 1VQJA 2F4VQ 4KI0A 2AWOA 1UEBA 4A3CH 2LXJA 2K75A 3KDFA 3RZOH 4LF7Q 4JI4L 2HHHQ 4NXML 4JI7Q 3I4MG 2I5LX 4P73A 1VQ9A 4POGA 5JJKA 4LUOA 3M7NA 1MJEA 5E7NA 1FJGQ 4DV4L 1SFOH 4DR5L 4MZ9A 5IP9G 4KHPL 1JMCA 4L5SA 4NB3A 2ALYB 3L7ZC 3M4QA 4DR6Q 1KAWA 4DV2L 2UU9L 1JJ2A 2R93H 1E1TA 4GOPA 1VQAA 5C4JH 1GVPA 3RLOA 3HOWG 3T1HL 2JEBI 5C0XG 3H3VH 4NXNL 1CUKA 4WJ3M 1SLJA 4GKJL 3E0EA 3FHWA 2R7DA 3I56A 3CC7A 4A75A 1GKHA 1VQFA 3L2PA 3I2ZA 1FVIA 3GO5A 4YWKA 4A3FH 1IZ6A 2IT1A 4AQYQ 3I4MH 1PH6A 4JI1Q 3KOJA 1L1OC 4PZ7A 3PO2H 3S1RH 4A4IA 3PIOA 3BU2A 1HR0Q 1L0WA 2XGTA 2KBNA 3AQQA 3J81i 1CSQA 3BJUA 3CXCA 2E2HH 2JK8A 4C2MH 1W2BA 2VUMH 5M5YH 5M3MG 4QIWE 4Y7NH 3S14H 1AE3A 3U4ZA 3S1MH 2D62A 5JEAJ 2JA5H 1I3QH 3DM3A 2F3IA 4DR6L 2MNAA 5M3FH 2PNHA 2WP8J 4PG3A 3GTQH 2R7FA 3K7UC 4JI6Q 2RCNA 4LW1A 3S17H 4A3IG 1ASZA 4X6AH 1I50H 1UE6A 3PGZA 3AFQA 3STBC 1PA6A 2E5LQ 4JV5Q 2DGYA 1M1KC 1UE5A 5ELOA 4DV0Q 2CKZB 1YJWA 4HJAA 3H0GG 1FGUA 1Q46A 3PV0A 4X66Q 1D8LA 1KIXA 4DV3Q 2YYZA 3KF6B 3BZCA 3UE1A 4IOCA 2BH8A 1M90C 2JJQA 4UP7A 3W1BA 5C44H 3FP9A 1W3SA 5IYDH 5IYCH 2KCTA 1HR0L 1X65A 1OXVA 1XNRL 1YBYA 2B29A 2JA7H 1VQLA 4NXNQ 2UXBL 1Q8KA 2ES2A 5C4XG 2CWPA 3HOXG 3OTOL 1PYSB 3D31A 4A3EG 3GDEA 5M5XH 2ID0A 2MO1A 3ULLA 4HIDA 3CCLA 3ULPA 5JJIA 1Q12A 1IXRA 2OQ0A 1L1OB 3PUXA 5C0XJ 3UDIA 4JI1L 5AJ3L 1HNZL 1VS0A 2F52A 4DUZL 4L5TA 3JC66 1XPUA 1Y1VH 3H0GH 4DV5Q 2WAQG 3TREA 2Q2HA 4DAMA 2E5LL 3KFUA 1N32L 2PMZE 1VQPA 2AKWB 1PH7A 1E22A 1E3PA 4UY8C 4IO9A 4LF8L 1N34Q 4OX9Q 3HOZH 1KL9A 1B7YB 3CPWA 4ALPA 2I5MX 4LNQA 5C4XH 3S1NH 3HOXH 4BA2I 1A62A 4R4CA 2C35B 3ZJYC 4HJ8A 3S2HH 1XTDA 4RG1A 1I94L 1SR3A 1I5FA 1YJ9A 3F1ZA 3PIPA 3G6EA 1NE3A 1N9WA 3F2DA 3J81c 2MO0A 4X62L 2Z6KC 1VQCA 3MEFA 2ZJRA 1IBML 1HNWQ 2MFIA 4GS3A 4JI5Q 4JI7L 4A76A 4EQ5A 2Z6KA 2R93G 1NBWA 1Y1VG 4DV3L 1VQHA 1HJPA 3S15H 2IX1A 3ER0A 4YHHL 1IBLL 1VQ6A 4YY3L 1XMQQ 1UE7A 4BBSG 3J7ZC 1WJJA 4LF6Q 3HOZG 3I7FA 1C7YA 4BY7G 4GN5A 4DV6L 1XNQQ 1HZBA 1CKMA 3CCUA 2UXDL 1D7QA 3UDGA 4DV4Q 1E7ZA 3KDFB 2QEXA 1S40A 2PQAA 3HFZB 1QZHA 4LFAL 4HJ5A 4PZ8A 3S16H 5DLQE 4DR1Q 1YHAA 3M4PA 3E9IA 2VUMG 5AJ3Q 4BXXG 1KD1C 4A93G 3J7A5 3FKIH 5LMUL 3RZDH 4JI3Q 1CSPA 1PVOA 1SMXA 4GLAC 3KJOA 1XPRA 2K5VA 3CMEA 3GD7A 1V43A 1N34L 3K80C 2JA6H 1C0AA 1IYJB 5LMNL 2PI2A 4OO1I 2MQHA 2VZAA 1N36Q 2FXQA 4LF4L 4IPGA 1Y1WG 1JB7A 2AWNA 4YY3Q 2IY5B 4A3GH 4YHHQ 3L0OA 1IBLQ 4MNOA 2N78A 4AYBE 2IHEA 3CCQA 1VQOA 4K0KL 2IHFA 1EFWA 3T1HQ 4LF6L 3I4NG 5IP7H 5BR8L 5IT9c 4X65L 2Q2IA 4A3LG 3STBD 5M5WH 1YVCA 1OTCA 2E2IH 1BKBA 1KRSA 1P8LA 2PQAB 3RLFA 1PH2A 2RHSB 1VQKA 2UUBL 3GTGH 2RHQB 1VQEA 2NVYH 4LWCA 2N3SA 3PO3G 4FDBA 1OXTA 1YNXA 1KXLA 1WCMG 4UP9A 2ZM6Q 2BA0A 3CCEA 2V1CC 1PH9A 1O7IA 1TWCH 4DR2Q 2UUAQ 4JYAQ 1PH5A 1XNRQ 4A3GG 4DR4Q 2NN6I 1GO3E 1KRTA 4UPAA 4YCWA 1VQGA 2CWAA 2YU9H 4JI0L 2Z0SA 3NEMA 1SROA 2VS1A 4JI8Q 3TS2A 4GLXA 5LMNW 1WOCA 1H95A 5K36G 1SN8A 4RMFA 4P71A 5FJ8G 2ZJQA 3NELA 1S72A 1PH8A 4TQUS 4OWWB 3CD6A 2A19A 2A8VA 1SE8A 3OW2A 1VQ5A 4DUZQ 2ATWA 4X64Q 1U0LA 3H3VI 3HOVH 5LMNQ 1MJCA 1N33Q 5JJLA 1Z47A 2R7ZG 2VL6A 1Q86C 4IFDI 1JJCB 3CQZH 3CCSA 1WCMH 4GNXB 1NTGA 2Y0SG 1JJGA 1NY4A 4LFBL 1TWHH 1WFQA 1L1OA 4A3MG 5FLMH 4BY1H 1G6PA 2HQLA 1PH3A 4IJHA 2KHIA 4A3DH 3HKSA 4QL5A 1VQNA 2UXBQ 4BBRG 2IX0A 4A3BH 3T1YL 4R4QA 4B3TL 4BBSH 1LYLA 3WWVA 4WJ4A 5HGQA 4A93H 1HZ9A 1QVCA 3K8AA 2GVAA 5GADC 1TWFH 3LGJA 1I94Q 4OX9L 2YTYA 3HOWH 3F8TA 4A3DG 5JEAG 4LF5L 1TXYA 4DKAC 2VQEL 4JI2Q 3RNUA 4BXXH 5M3FG 4GN4B 4DNIA 2OCEA 3F2BA 1XMQL 4DV5L 2JA5G 3HOUG 3EBEA 1G291 1XMOQ 1HH2P 4JBJA 3HOYG 2HIVA 3D0FA 4OWXB 1VQ7A 1N33L 2NVXH 4X64L 4X62Q 3U58A 4H02A 4A3JG 1QVFA 1HNWL 2OQKA 4JI0Q 3ULJA 2B63G 4IPDA 4B3SQ 3HOYH 2OTLA 2YTXA 4QY7A 5C44G 4LF5Q 4HJ9A 2E2JH 2EXDA 3KF8B 1X56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J6Q A;  2BA1 A;  2YV5 A;  1Q82 C;  1P16 A;  2HT1 A;  3NEN A;  3CF5 A;  1YIT A;  4GKK L;  3F2C A;  1TWA H;  5ELN A;  1J5E Q;  4IFD J;  3G48 A;  2R92 H;  4KLK A;  2ZTE A;  1KQS A;  1YZ6 A;  3ERS X;  1B70 B;  3RN5 A;  4JC0 A;  3CAM A;  1OXX K;  2K5N A;  3CCR A;  4DR1 L;  1VQB A;  4A3I H;  4O2D A;  4IPC A;  3PUW A;  4LUV A;  3AEV A;  2XTI A;  3M3Y H;  1K0R A;  1EOV A;  1WI5 A;  4LFC Q;  4B3R Q;  3CCM A;  2UXC Q;  1V1Q A;  3RLN A;  1MKH A;  5H1S E;  5IWA L;  3S1Q H;  3JAM i;  3PUZ A;  3M9B A;  4P75 A;  2K4K A;  2EIF A;  4YCV A;  4DV2 Q;  3B6Y A;  4GOP C;  2UU9 Q;  1ASY A;  2HHH L;  5C0X I;  2CFM A;  1CKN B;  4DR2 L;  1VQD A;  2ZTD A;  5IP9 H;  3VDY A;  1YJN A;  1L2F A;  3J81 j;  4LF9 L;  3A5U A;  3S2D H;  2F4V L;  4JI8 L;  3HKZ E;  3PF4 A;  1YHQ A;  4JI3 L;  5LMU Q;  2CQO A;  5FLX c;  3EIV A;  1YI2 A;  3CPF A;  1V9P A;  1X55 A;  4JI4 Q;  2R6G A;  5C3E H;  3K7A H;  5FJ8 H;  4BY1 G;  4DV7 L;  4X65 Q;  4GOP B;  3GTL H;  1K3R A;  1NMG A;  2KEN A;  3DLL A;  4A3F G;  4A3B G;  4QJF A;  2UUB Q;  5GAE C;  4EX5 A;  1Y14 B;  2DUD A;  2R7Z H;  2JE6 I;  1QUQ A;  1YEZ A;  4PMW A;  1KC8 C;  4PZ6 A;  4DK6 C;  4L5Q A;  4DK3 C;  5IWA Q;  4GKJ Q;  4YCU A;  4OON A;  2GN5 A;  5FLM G;  4DV6 Q;  3HKZ G;  1EWI A;  1K8A C;  4LF8 Q;  3PF5 A;  5IY0 A;  2NZH A;  2NN6 G;  1Q81 C;  1GD7 A;  2E8G A;  3PSI A;  4BY7 H;  4BBR H;  1JT8 A;  1CKN A;  3UDX A;  1G51 A;  1FL0 A;  4XTC S;  1IBK L;  3J80 i;  4APV A;  2VQE Q;  3E9H A;  1PHJ A;  2K52 A;  2ZM6 L;  3K0X A;  4LFB Q;  3GTK H;  2Y0S E;  1KHI A;  4B3M L;  1Q7Y C;  1XPO A;  3T1Y Q;  1YHB A;  2NVT H;  2OWO A;  3AYH B;  2JA6 G;  1EIF A;  4DV7 Q;  1X6O A;  1EUJ A;  2UXD Q;  4LF7 L;  4O0A A;  1OXU A;  4NXM Q;  5GAH C;  1E24 A;  3NBH B;  4X66 L;  4J15 A;  4DR7 L;  2VNU D;  3EN2 A;  5IYB H;  2D0O A;  3GTP H;  2WB1 E;  3ICE A;  5EAY A;  1EQQ A;  1NJI C;  1B8A A;  2KCM A;  2JA7 G;  4JI6 L;  1AH9 A;  1JE5 A;  3I4N H;  1HNZ Q;  4K0K Q;  3BZK A;  1XMO L;  4LUZ A;  2A1A A;  2JA9 A;  4YWL A;  1K73 C;  1EYG A;  2K5H A;  1SRU A;  1EIY B;  4QGU A;  1A63 A;  4R4I A;  3U50 C;  1BBW A;  5GQO A;  4POF A;  1VQ8 A;  2NVQ H;  2R92 G;  1TWG H;  4R4T A;  4JI2 L;  2K50 A;  3RN2 A;  4JG2 A;  4OWT B;  4DR5 Q;  1GM5 A;  4IOA A;  4A3L H;  1PFS A;  1FJG L;  2Q2U A;  1BVS A;  1Y1W H;  2AMC B;  4B3M Q;  4GLV B;  4DPG A;  1RL2 A;  2ZTC A;  5IYD G;  2N8N A;  4A3E H;  5IYC G;  2L15 A;  1YIJ A;  4JOI A;  1QUQ B;  5GRO A;  2CCZ A;  4NPS A;  3RR5 A;  4HIM A;  4L5R C;  2YTV A;  3TS0 A;  5IP7 G;  4DAY B;  1N8R C;  1R9T H;  1VCI A;  2VY3 A;  3A5Z B;  1AE2 A;  3JAM c;  4ME3 A;  2UUC Q;  1I6H H;  4IPH A;  3UE0 A;  4AQY L;  1NMF A;  3A0J A;  3CC2 A;  3HOV G;  2JA8 H;  1HZC A;  5BR8 Q;  4BA1 I;  1VQI A;  4A3K G;  3MXN B;  3PO3 H;  2RF4 A;  2UUA L;  3UDF A;  4GNX A;  1K9M C;  3GTJ H;  1HNX Q;  1XNQ L;  3A74 A;  4HIK A;  4LFC L;  1A8V A;  5GAG C;  2AHO B;  2JA8 G;  4OO1 G;  3PCO B;  4Y52 H;  3OYY A;  2K14 A;  2VQF Q;  4DUY Q;  4A3M H;  1CKO A;  1K83 H;  2H5X A;  1PYB A;  3PUV A;  3I55 A;  3H15 A;  4C3H H;  1QVG A;  1LM0 A;  2KHJ A;  4JBM A;  4JOI C;  1Q1B A;  3Q8D A;  1IBM Q;  2JQO A;  4XIG S;  4OXP A;  4LFA Q;  1PV4 A;  4KHZ A;  1QZG A;  4B3T Q;  2WB1 G;  4HIO A;  1X3G A;  4LF9 Q;  3KYH C;  5C3E G;  2HIX A;  4A3J H;  1EQR A;  1UWV A;  1WYD A;  2VW9 A;  3FKI G;  4DV0 L;  1PH1 A;  4GN3 B;  4DUY L;  3G71 A;  3KJP A;  2N49 A;  2WAQ E;  1BBU A;  4DR3 Q;  4AIM A;  4JV5 L;  3CMA A;  4DV1 L;  2BH2 A;  3SGI A;  5IE8 A;  1K8G A;  4JBW A;  4AYB G;  3U4V A;  1X3E A;  1HNX L;  2LXK A;  1UE1 A;  4R4O A;  3CP0 A;  4JCV E;  3CCJ A;  4UP8 A;  4LF4 Q;  4GNX C;  1N36 L;  4IJL A;  3PO2 G;  3W1G A;  1PH4 A;  3KF6 A;  4C3J H;  2B63 H;  4DR7 Q;  2UUC L;  3TRZ A;  1IBK Q;  1X3F A;  2GVB A;  1A0I A;  2ASB A;  3CCV A;  1J5E L;  4HJ7 A;  3G4S A;  2Q2T A;  2QGQ A;  5M3M H;  1RIP A;  1DGS A;  1T9H A;  5J3B A;  2D0P A;  3OTO Q;  1XJV A;  3HOU H;  3I4O A;  1IL2 A;  1U5K A;  2B3G A;  3KLW A;  3TEH B;  3M85 A;  2I0Q A;  4B3S L;  4TVA B;  4YWM A;  4IFD G;  2LSS A;  2NZO A;  4MTN A;  5HY6 A;  2VQF L;  2JEA I;  2OTJ A;  1C9O A;  4P74 A;  3TQY A;  4GKK Q;  3S24 A;  3K81 C;  2QA4 A;  4KHP Q;  2UXC L;  1E1O A;  1S3O A;  1HZA A;  3CC4 A;  2I5H A;  5IYB G;  4DV1 Q;  1MIU A;  1OXS C;  1HR0 W;  1N32 Q;  4DR3 L;  4P72 A;  4C3I H;  1LTL A;  4DR4 L;  4R1J A;  4AH6 A;  4JYA L;  1X9N A;  3AFP A;  4JBK A;  4QQB X;  4A3K H;  3GTM H;  2PI2 E;  4A3C G;  1Q1E A;  3CW2 C;  1X54 A;  3PUY A;  2WFW A;  3M4O H;  4JI5 L;  1LUZ A;  4B3R L;  3IRB A;  1Z9F A;  3J80 c;  3GTO H;  1VQ4 A;  2EQS A;  1VQM A;  2ZJP A;  3W5O A;  1VQJ A;  2F4V Q;  4KI0 A;  2AWO A;  1UEB A;  4A3C H;  2LXJ A;  2K75 A;  3KDF A;  3RZO H;  4LF7 Q;  4JI4 L;  2HHH Q;  4NXM L;  4JI7 Q;  3I4M G;  2I5L X;  4P73 A;  1VQ9 A;  4POG A;  5JJK A;  4LUO A;  3M7N A;  1MJE A;  5E7N A;  1FJG Q;  4DV4 L;  1SFO H;  4DR5 L;  4MZ9 A;  5IP9 G;  4KHP L;  1JMC A;  4L5S A;  4NB3 A;  2ALY B;  3L7Z C;  3M4Q A;  4DR6 Q;  1KAW A;  4DV2 L;  2UU9 L;  1JJ2 A;  2R93 H;  1E1T A;  4GOP A;  1VQA A;  5C4J H;  1GVP A;  3RLO A;  3HOW G;  3T1H L;  2JEB I;  5C0X G;  3H3V H;  4NXN L;  1CUK A;  4WJ3 M;  1SLJ A;  4GKJ L;  3E0E A;  3FHW A;  2R7D A;  3I56 A;  3CC7 A;  4A75 A;  1GKH A;  1VQF A;  3L2P A;  3I2Z A;  1FVI A;  3GO5 A;  4YWK A;  4A3F H;  1IZ6 A;  2IT1 A;  4AQY Q;  3I4M H;  1PH6 A;  4JI1 Q;  3KOJ A;  1L1O C;  4PZ7 A;  3PO2 H;  3S1R H;  4A4I A;  3PIO A;  3BU2 A;  1HR0 Q;  1L0W A;  2XGT A;  2KBN A;  3AQQ A;  3J81 i;  1CSQ A;  3BJU A;  3CXC A;  2E2H H;  2JK8 A;  4C2M H;  1W2B A;  2VUM H;  5M5Y H;  5M3M G;  4QIW E;  4Y7N H;  3S14 H;  1AE3 A;  3U4Z A;  3S1M H;  2D62 A;  5JEA J;  2JA5 H;  1I3Q H;  3DM3 A;  2F3I A;  4DR6 L;  2MNA A;  5M3F H;  2PNH A;  2WP8 J;  4PG3 A;  3GTQ H;  2R7F A;  3K7U C;  4JI6 Q;  2RCN A;  4LW1 A;  3S17 H;  4A3I G;  1ASZ A;  4X6A H;  1I50 H;  1UE6 A;  3PGZ A;  3AFQ A;  3STB C;  1PA6 A;  2E5L Q;  4JV5 Q;  2DGY A;  1M1K C;  1UE5 A;  5ELO A;  4DV0 Q;  2CKZ B;  1YJW A;  4HJA A;  3H0G G;  1FGU A;  1Q46 A;  3PV0 A;  4X66 Q;  1D8L A;  1KIX A;  4DV3 Q;  2YYZ A;  3KF6 B;  3BZC A;  3UE1 A;  4IOC A;  2BH8 A;  1M90 C;  2JJQ A;  4UP7 A;  3W1B A;  5C44 H;  3FP9 A;  1W3S A;  5IYD H;  5IYC H;  2KCT A;  1HR0 L;  1X65 A;  1OXV A;  1XNR L;  1YBY A;  2B29 A;  2JA7 H;  1VQL A;  4NXN Q;  2UXB L;  1Q8K A;  2ES2 A;  5C4X G;  2CWP A;  3HOX G;  3OTO L;  1PYS B;  3D31 A;  4A3E G;  3GDE A;  5M5X H;  2ID0 A;  2MO1 A;  3ULL A;  4HID A;  3CCL A;  3ULP A;  5JJI A;  1Q12 A;  1IXR A;  2OQ0 A;  1L1O B;  3PUX A;  5C0X J;  3UDI A;  4JI1 L;  5AJ3 L;  1HNZ L;  1VS0 A;  2F52 A;  4DUZ L;  4L5T A;  3JC6 6;  1XPU A;  1Y1V H;  3H0G H;  4DV5 Q;  2WAQ G;  3TRE A;  2Q2H A;  4DAM A;  2E5L L;  3KFU A;  1N32 L;  2PMZ E;  1VQP A;  2AKW B;  1PH7 A;  1E22 A;  1E3P A;  4UY8 C;  4IO9 A;  4LF8 L;  1N34 Q;  4OX9 Q;  3HOZ H;  1KL9 A;  1B7Y B;  3CPW A;  4ALP A;  2I5M X;  4LNQ A;  5C4X H;  3S1N H;  3HOX H;  4BA2 I;  1A62 A;  4R4C A;  2C35 B;  3ZJY C;  4HJ8 A;  3S2H H;  1XTD A;  4RG1 A;  1I94 L;  1SR3 A;  1I5F A;  1YJ9 A;  3F1Z A;  3PIP A;  3G6E A;  1NE3 A;  1N9W A;  3F2D A;  3J81 c;  2MO0 A;  4X62 L;  2Z6K C;  1VQC A;  3MEF A;  2ZJR A;  1IBM L;  1HNW Q;  2MFI A;  4GS3 A;  4JI5 Q;  4JI7 L;  4A76 A;  4EQ5 A;  2Z6K A;  2R93 G;  1NBW A;  1Y1V G;  4DV3 L;  1VQH A;  1HJP A;  3S15 H;  2IX1 A;  3ER0 A;  4YHH L;  1IBL L;  1VQ6 A;  4YY3 L;  1XMQ Q;  1UE7 A;  4BBS G;  3J7Z C;  1WJJ A;  4LF6 Q;  3HOZ G;  3I7F A;  1C7Y A;  4BY7 G;  4GN5 A;  4DV6 L;  1XNQ Q;  1HZB A;  1CKM A;  3CCU A;  2UXD L;  1D7Q A;  3UDG A;  4DV4 Q;  1E7Z A;  3KDF B;  2QEX A;  1S40 A;  2PQA A;  3HFZ B;  1QZH A;  4LFA L;  4HJ5 A;  4PZ8 A;  3S16 H;  5DLQ E;  4DR1 Q;  1YHA A;  3M4P A;  3E9I A;  2VUM G;  5AJ3 Q;  4BXX G;  1KD1 C;  4A93 G;  3J7A 5;  3FKI H;  5LMU L;  3RZD H;  4JI3 Q;  1CSP A;  1PVO A;  1SMX A;  4GLA C;  3KJO A;  1XPR A;  2K5V A;  3CME A;  3GD7 A;  1V43 A;  1N34 L;  3K80 C;  2JA6 H;  1C0A A;  1IYJ B;  5LMN L;  2PI2 A;  4OO1 I;  2MQH A;  2VZA A;  1N36 Q;  2FXQ A;  4LF4 L;  4IPG A;  1Y1W G;  1JB7 A;  2AWN A;  4YY3 Q;  2IY5 B;  4A3G H;  4YHH Q;  3L0O A;  1IBL Q;  4MNO A;  2N78 A;  4AYB E;  2IHE A;  3CCQ A;  1VQO A;  4K0K L;  2IHF A;  1EFW A;  3T1H Q;  4LF6 L;  3I4N G;  5IP7 H;  5BR8 L;  5IT9 c;  4X65 L;  2Q2I A;  4A3L G;  3STB D;  5M5W H;  1YVC A;  1OTC A;  2E2I H;  1BKB A;  1KRS A;  1P8L A;  2PQA B;  3RLF A;  1PH2 A;  2RHS B;  1VQK A;  2UUB L;  3GTG H;  2RHQ B;  1VQE A;  2NVY H;  4LWC A;  2N3S A;  3PO3 G;  4FDB A;  1OXT A;  1YNX A;  1KXL A;  1WCM G;  4UP9 A;  2ZM6 Q;  2BA0 A;  3CCE A;  2V1C C;  1PH9 A;  1O7I A;  1TWC H;  4DR2 Q;  2UUA Q;  4JYA Q;  1PH5 A;  1XNR Q;  4A3G G;  4DR4 Q;  2NN6 I;  1GO3 E;  1KRT A;  4UPA A;  4YCW A;  1VQG A;  2CWA A;  2YU9 H;  4JI0 L;  2Z0S A;  3NEM A;  1SRO A;  2VS1 A;  4JI8 Q;  3TS2 A;  4GLX A;  5LMN W;  1WOC A;  1H95 A;  5K36 G;  1SN8 A;  4RMF A;  4P71 A;  5FJ8 G;  2ZJQ A;  3NEL A;  1S72 A;  1PH8 A;  4TQU S;  4OWW B;  3CD6 A;  2A19 A;  2A8V A;  1SE8 A;  3OW2 A;  1VQ5 A;  4DUZ Q;  2ATW A;  4X64 Q;  1U0L A;  3H3V I;  3HOV H;  5LMN Q;  1MJC A;  1N33 Q;  5JJL A;  1Z47 A;  2R7Z G;  2VL6 A;  1Q86 C;  4IFD I;  1JJC B;  3CQZ H;  3CCS A;  1WCM H;  4GNX B;  1NTG A;  2Y0S G;  1JJG A;  1NY4 A;  4LFB L;  1TWH H;  1WFQ A;  1L1O A;  4A3M G;  5FLM H;  4BY1 H;  1G6P A;  2HQL A;  1PH3 A;  4IJH A;  2KHI A;  4A3D H;  3HKS A;  4QL5 A;  1VQN A;  2UXB Q;  4BBR G;  2IX0 A;  4A3B H;  3T1Y L;  4R4Q A;  4B3T L;  4BBS H;  1LYL A;  3WWV A;  4WJ4 A;  5HGQ A;  4A93 H;  1HZ9 A;  1QVC A;  3K8A A;  2GVA A;  5GAD C;  1TWF H;  3LGJ A;  1I94 Q;  4OX9 L;  2YTY A;  3HOW H;  3F8T A;  4A3D G;  5JEA G;  4LF5 L;  1TXY A;  4DKA C;  2VQE L;  4JI2 Q;  3RNU A;  4BXX H;  5M3F G;  4GN4 B;  4DNI A;  2OCE A;  3F2B A;  1XMQ L;  4DV5 L;  2JA5 G;  3HOU G;  3EBE A;  1G29 1;  1XMO Q;  1HH2 P;  4JBJ A;  3HOY G;  2HIV A;  3D0F A;  4OWX B;  1VQ7 A;  1N33 L;  2NVX H;  4X64 L;  4X62 Q;  3U58 A;  4H02 A;  4A3J G;  1QVF A;  1HNW L;  2OQK A;  4JI0 Q;  3ULJ A;  2B63 G;  4IPD A;  4B3S Q;  3HOY H;  2OTL A;  2YTX A;  4QY7 A;  5C44 G;  4LF5 Q;  4HJ9 A;  2E2J H;  2EXD A;  3KF8 B;  1X56 A; 
#chains in the Genus database with same CATH topology
 1SE2 A;  2BA1 A;  3EFX D;  1TWA H;  1J5E Q;  3G48 A;  1KQS A;  1YZ6 A;  3KUP A;  2DJG C;  3RN5 A;  5I6W A;  3V96 A;  3CCR A;  3D6C A;  2L0C A;  4DU9 A;  4ZUJ A;  1K0R A;  4C1N K;  3CCM A;  2O5I C;  2L4N A;  3AB9 A;  1RF2 D;  5FLX L;  3GTL B;  4G57 A;  3M9B A;  4A93 B;  2EIF A;  1R4P B;  4DR2 L;  1CKN B;  2ZTD A;  3VDY A;  1HFG A;  4LF9 L;  3S2D H;  2RCF A;  3TP5 A;  5KRU A;  5I4D A;  3M4Y A;  4JI3 L;  3CPF A;  1X55 A;  5C3E H;  2F0U A;  4DV7 L;  3RD4 A;  1NMG A;  4IUT A;  3DLL A;  2UUB Q;  4QCL A;  3K59 A;  2DUD A;  4UHV A;  2BE5 D;  2PCF B;  5IWA Q;  4GKJ Q;  3KF8 A;  1TY2 A;  3ITP A;  2Z8L A;  5CBA E;  5FLM G;  4FF2 A;  5IY0 A;  2I46 A;  2NN6 G;  5JPN C;  1BO0 A;  4BBR H;  2F0F A;  4CDE C;  2EVB A;  1STE A;  3J80 i;  3BVG A;  2XSC A;  1DYQ A;  2VQE Q;  1V8Q A;  4HN7 A;  2K52 A;  2CW0 C;  4Y7N B;  3OOC A;  3GTK H;  5M5Y B;  3A7L A;  1YHB A;  4I65 A;  1U4R A;  5F2D A;  4ME5 A;  1EIF A;  3DM1 A;  1CTM A;  4LF7 L;  4O0A A;  4NXM Q;  1S5F D;  1LT4 D;  3EN2 A;  3OHX C;  4L6T B;  2XWB B;  3D3R A;  3MVV A;  4HSV A;  2RSN A;  2KCM A;  1AH9 A;  1JE5 A;  1M8A A;  2DN8 A;  4LUZ A;  1STY A;  2JA9 A;  2K5H A;  1SRU A;  1PYW D;  3J81 E;  1TWG H;  4JI2 L;  3RN2 A;  2MJ8 A;  4DR5 Q;  1PFS A;  2Q2U A;  3GTP B;  1RL2 A;  2C9O A;  3J7Y W;  3VR3 A;  1G2S A;  5IYC G;  3QWN A;  4DAY B;  2J0T D;  1Y8N B;  5A2Q E;  3A5Z B;  3UE0 A;  3HOV G;  1F2M A;  1HZC A;  1PTO D;  4FXD A;  4OO1 H;  4BA1 I;  1KDB A;  4A3K G;  2EYP A;  3PO3 H;  2RF4 A;  3P75 A;  2XN9 C;  2BCO A;  2M2L A;  3AU7 A;  2VB2 X;  1XNQ L;  1I4G A;  5IGC A;  1A8V A;  3OYY A;  3BS1 A;  1K83 H;  1U4L A;  3PUV A;  4TRD A;  1LM0 A;  1X3P A;  3TN2 A;  2K32 A;  4JOI C;  1Q1B A;  4XDX A;  3Q8D A;  4O42 A;  5C4Z A;  2ICI A;  4KHZ A;  4LF9 Q;  2WB1 G;  4HIO A;  1X3G A;  1DXM A;  1PFN A;  5C3E G;  1SNM A;  2HIX A;  5KNC A;  3FKI G;  1ILQ A;  1SAP A;  1PH1 A;  4DUY L;  3G71 A;  2N49 A;  4IQZ A;  5L37 A;  2O4X A;  1YNJ D;  2QDL A;  2LXK A;  3CP0 A;  2RSO A;  1I4Q A;  2NTT A;  1GHJ A;  4K2K A;  3W1G A;  4C3J H;  2B63 H;  2EE1 A;  2MHV A;  2NN6 H;  1ML0 D;  3I4M B;  3X3N A;  3E3X A;  2ASB A;  3SHL A;  4CJ0 B;  3G4S A;  4RWS C;  3EJI A;  1DGS A;  1T9H A;  3OTO Q;  3BZD B;  4B3S L;  2R92 B;  5HY6 A;  2OTJ A;  2JEA I;  1C9O A;  4P74 A;  3FVQ A;  4KHP Q;  1TWG B;  1BDO A;  4DV1 Q;  4P72 A;  1SYG A;  4C3I H;  2F0H A;  4DR4 L;  4R1J A;  3TP6 A;  3AFP A;  4G7Z C;  3KK7 A;  1A3T A;  1Q1E A;  3PUY A;  3IRB A;  3GTO H;  3J80 c;  2EQS A;  3DWQ A;  3GP7 A;  2ZJP A;  2WAQ B;  2LXJ A;  2LS0 1;  2XIW A;  4JI7 Q;  3C3L A;  1H9K A;  2I5L X;  1VQ9 A;  3M7N A;  1F9S A;  1JOQ A;  1LT3 D;  2QEJ C;  1MBY A;  5I2X A;  4DV2 L;  1B2T A;  4DXG A;  2QKI C;  1E1T A;  2JN4 A;  1VQA A;  5JVH 3;  3RLO A;  3HOW G;  4B08 A;  1PMR A;  2JA7 B;  4WJ3 M;  1SLJ A;  4B9X A;  3FKI B;  1VQF A;  1SE4 A;  5C5L A;  5JAV A;  3FRP B;  2IT1 A;  4JI1 Q;  2K7V A;  1PTO H;  4HAE A;  1L0W A;  1GXD C;  2KBN A;  3AQQ A;  1SYB A;  2CQA A;  2E2H H;  4QIW E;  1AE3 A;  2Q8R E;  4M8A A;  1EZ6 A;  2OT2 A;  2B2W A;  2F3I A;  1RDP D;  5KEE A;  2EYM A;  3A55 A;  3MHB A;  2WP8 J;  1STA A;  2V4D A;  5FLX E;  3S17 H;  1UE6 A;  3PGZ A;  4ZCK A;  5ELO A;  1KIX A;  1Q46 A;  3RMH A;  4IOC A;  1EY7 A;  2D2C C;  2MP1 A;  2NVY B;  3UE1 A;  2BH8 A;  1M90 C;  2JJQ A;  1YNN C;  4UP7 A;  1E2W A;  1AFP A;  1DCZ A;  1HR0 L;  3DEO A;  1X65 A;  2UXB L;  1EQT A;  2CWP A;  3OTO L;  1PYS B;  4A3E G;  3GDE A;  5M5X H;  3TDQ A;  1Q12 A;  4JI1 L;  2B2T A;  3GQB A;  2Z4H A;  1VS0 A;  2A69 D;  4K5W A;  2CH4 A;  2HCC A;  1WCM B;  2Q2H A;  1V1P B;  2JSO A;  2PMZ E;  1E22 A;  3EQL C;  4IO9 A;  5C3E B;  3HOZ H;  3CPW A;  2QF7 A;  5C4X H;  1BUV T;  3M3Y B;  4C3J B;  5JVG 3;  2B63 B;  1B9N A;  3HOW B;  2K04 A;  1RTN A;  1ESF A;  4H7B A;  2EPB A;  1GJX A;  1YJ9 A;  2VUM H;  1NE3 A;  3J81 c;  4X62 L;  3A8K E;  2Z6K A;  1JWS D;  1HQM C;  1WD0 A;  4DXF A;  3W2D A;  1WJJ A;  2F0P A;  1PRT C;  4LF6 Q;  4BY7 G;  1F77 A;  4DV6 L;  1NNX A;  4G7O C;  1E7Z A;  3HFZ B;  5DM7 3;  1DZ1 A;  4HJ5 A;  3P20 A;  3ERQ A;  1RKN A;  4DR1 Q;  4CDC C;  3N6R A;  1JWM D;  3MXP A;  1TS5 A;  1BF4 A;  4UDU C;  5I9O A;  1KD1 C;  2A6E C;  3NE5 B;  3RZD H;  1CSP A;  5EKK A;  1PVO A;  1CI3 M;  2H4O A;  4KN4 C;  1V43 A;  3GTJ B;  2HUG A;  1C0A A;  2E2H B;  4OO1 I;  5IT9 L;  5IGF A;  4BS9 A;  4YHH Q;  1F9R A;  5IP7 H;  2KCN A;  2L11 A;  4BBS B;  3ND9 A;  5M5W H;  1YVC A;  5CV8 A;  1BKB A;  2PQA B;  2RHS B;  2NVY H;  4NDX A;  1H9M A;  2M00 A;  1FNV A;  1Q8I A;  2A6H C;  1YNX A;  2XNA C;  3FPU B;  4DN4 M;  2EY1 A;  4DR2 Q;  2UUA Q;  1PH5 A;  2A74 C;  1XNR Q;  3NK9 A;  4DR4 Q;  4JI0 L;  1DOM A;  3NEM A;  5LL6 X;  2VS1 A;  5CV6 A;  1H95 A;  1SN8 A;  4WRD A;  4RMF A;  5FJ8 G;  1AN8 A;  1IW7 D;  2F3W A;  1HTP A;  3GTO B;  1E2Z A;  1VQ5 A;  3MXU A;  2XRQ D;  1QCB D;  3S17 B;  2R7Z G;  5C3X A;  4MHE A;  3CQZ H;  1H9J A;  4NP5 A;  2R93 B;  2Q8I B;  4C3H G;  2SDF A;  1WTP A;  4A3M G;  5IIF A;  1JWU D;  1B4O A;  4IUU A;  3HKS A;  4QL5 A;  1VQN A;  5EGT A;  4BY7 B;  2QCP X;  5KYI A;  1LYL A;  5TSS A;  4IUV A;  2HDL A;  3K8A A;  3ND8 A;  1I94 Q;  5EKL A;  2YTY A;  4K6L A;  2BOS A;  3PO2 B;  4EQN A;  1TXY A;  4DKA C;  2VQE L;  2A69 C;  2A6E D;  1SMY D;  2A68 D;  3H09 A;  3Q0A A;  4A3G B;  1ET9 A;  2OCE A;  3F2B A;  4LMQ D;  4EQO A;  3EBE A;  1XMO Q;  3IL8 A;  1WTQ A;  3HOY G;  2HIV A;  3D0F A;  1VQ7 A;  1N33 L;  2AQ3 B;  2R61 A;  4A3J G;  1HNW L;  1QVF A;  2OQK A;  4JI0 Q;  3KLS X;  3ULJ A;  4C3J G;  2B63 G;  2F0K A;  1NR4 A;  2EYL A;  2YTX A;  4FXK C;  1WTX A;  2OTL A;  5C44 G;  4LF5 Q;  5CC4 A;  3H3V I;  1ZEQ X;  1X56 A;  4GKK L;  1P16 A;  2NB0 A;  3NEN A;  3CF5 A;  1YIT A;  5ELN A;  3MAQ A;  1W6K A;  4F7X A;  4HTH A;  3ERS X;  4JC0 A;  4HCS A;  1OXX K;  2K5N A;  4ILW A;  4DR1 L;  5FK9 C;  1VQB A;  4A3I H;  2F0D A;  2WV6 D;  5ELC A;  3PUW A;  4LUV A;  3MWY W;  3AEV A;  1XXG A;  1WI5 A;  3M3Y H;  1SYC A;  1UEA B;  2NWG A;  3DMU A;  5IWA L;  1EFI D;  3DWA A;  3JAM i;  3I90 A;  3OW7 A;  3PUZ A;  1QNK A;  4DV2 Q;  4GOP C;  1ASY A;  2HHH L;  2NVT B;  1EYD A;  5EPK A;  3A5U A;  3J80 E;  4HSP A;  1ENF A;  3RZD B;  3PF4 A;  1ICW A;  1NUC A;  3EIV A;  2JYO A;  2IL8 A;  3ERO A;  3K7A H;  1WVL A;  5FJ8 H;  4BY1 G;  4GOP B;  1Z7T A;  2KEN A;  3NPP A;  1WD1 A;  2FMM A;  4QJF A;  2F0J A;  5GAE C;  4EX5 A;  3QIA A;  1EY4 A;  1YNN D;  2K03 A;  4PMW A;  1OO9 B;  1NR2 A;  4PZ6 A;  1SNC A;  5EPL A;  2RDG A;  4YCU A;  3K7A B;  1Q81 C;  1GD7 A;  1E2V A;  3PSI A;  3IKJ A;  1PTO F;  3UDX A;  1F9P A;  4APV A;  5E3F A;  2EY6 A;  1PHJ A;  2ZM6 L;  4K8I A;  4GZY C;  1Q7Y C;  3I3C A;  2JA6 G;  4V0B A;  1SJE D;  1B3A A;  1OXU A;  4X66 L;  1NSN S;  2BDN A;  2VNU D;  4RCN A;  5IYB H;  4DFA A;  3GTP H;  3ICE A;  5EAY A;  3OIP A;  1B8A A;  5KND A;  3I4N H;  4K0K Q;  1XMO L;  4ABN A;  3V05 A;  5LHY 1;  1E0B A;  4YWL A;  4QGU A;  1SND A;  5HUR A;  2O5J C;  1BBW A;  3E6Z X;  2R92 G;  4R4T A;  3P7J A;  2E2D C;  4IOA A;  4OWT B;  4A3L H;  4WOR A;  5HGT A;  1Y1W H;  2AMC B;  4B3M Q;  1KDA A;  2Z1C A;  5IYD G;  2CH4 W;  5GRO A;  4HIM A;  1S5B D;  2YTV A;  3DXJ C;  2L5T A;  5E1F A;  3TS0 A;  1VCI A;  2K05 A;  4ME3 A;  4IAL A;  4IPH A;  2K33 A;  2K5D A;  4AQY L;  3CC2 A;  3D8G A;  3HEJ A;  4BBR B;  2KHS A;  1JOK A;  1LLR D;  4DNR B;  3OMC A;  5GAG C;  4OO1 G;  4Y52 H;  1HCZ A;  1CKO A;  1PYB A;  4KTA A;  1CZG A;  3QB3 A;  2KHJ A;  4JBM A;  2EJG C;  2JQO A;  5EBC A;  4LFA Q;  4IUR A;  4B3T Q;  1F9Q A;  3KYH C;  4ZQ3 A;  2PMZ B;  4CDF C;  1UWV A;  3W3A A;  1EOT A;  3PQI A;  4KKS A;  4GN3 B;  4KJN A;  3J7A F;  4AIM A;  4JV5 L;  3CMA A;  3SGI A;  3S9W A;  5IE8 A;  4JBW A;  3U4V A;  1X3E A;  1HNX L;  4U67 3;  3VYR A;  3CCJ A;  1MGS A;  4IJL A;  3Q23 A;  1N36 L;  3G7L A;  1PH4 A;  4DR7 Q;  1HTL D;  4KHV A;  1IBK Q;  1X3F A;  1A0I A;  4CJ2 C;  1SYE A;  1J5E L;  4HJ7 A;  1KAA A;  4YIJ A;  4IFD H;  2Q2T A;  3HOU H;  1JIC A;  2D0P A;  1XJV A;  1IL2 A;  1U5K A;  1HRJ A;  1EYC A;  4YWM A;  1DOK A;  3H0G B;  2LSS A;  4NMZ A;  5JPM C;  1JOR A;  3K81 C;  4LK1 C;  1E1O A;  2XWJ B;  1MHW C;  2B2U A;  1NCV A;  5C3W A;  1OXS C;  1HR0 W;  1N32 Q;  2F0W A;  1BCP C;  3SE0 A;  2Q8T A;  1TS3 A;  3NWS A;  4JYA L;  4OGQ C;  4QQB X;  1BR9 A;  1ZYR C;  4A3K H;  2XVS A;  4A3C G;  4B3R L;  1LUZ A;  1VQ4 A;  1TR5 A;  4RHS A;  1QB5 D;  2K28 A;  1STN A;  4S3S A;  2AWO A;  1UEB A;  3S15 B;  1EIH A;  4JI4 L;  2CVR A;  4ULL A;  1IKL A;  1I50 B;  3D4W A;  2NZ1 D;  4MN3 A;  4DAY A;  3VYS A;  4C3I B;  3OMG A;  5E7N A;  4IN3 A;  1SFO H;  2K5W A;  4DR5 L;  3DWP A;  5IP9 G;  2BE5 C;  2A5H A;  4L5S A;  1ENC A;  5ELB A;  1A15 A;  3TZU A;  4DR6 Q;  1K28 A;  2UU9 L;  1T5X D;  5I2Y A;  1JJ2 A;  3S16 B;  1QOH A;  1FD7 D;  2JEB I;  3FHW A;  3I56 A;  2R7D A;  4OIJ A;  3CC7 A;  4A3D B;  3I2Z A;  3GO5 A;  4JPB W;  4CJ1 B;  1C8C A;  4A3F H;  3KOJ A;  4FP5 D;  4KD3 A;  3S1R H;  4PQX A;  3T13 A;  3RUZ A;  1MD2 D;  3J81 i;  2YU9 B;  1CSQ A;  1EU4 A;  2WKD A;  1W2B A;  5M5Y H;  1XX8 A;  5EPJ A;  5M3M G;  1U4P A;  2IJ0 A;  3QJY A;  3SDZ A;  2D62 A;  3U4Z A;  4QUC A;  1I3Q H;  2MNA A;  4XQQ A;  1EY8 A;  1B53 A;  2PNH A;  1MSH A;  3GTQ H;  4X6A H;  4CBV A;  3STB C;  1PA6 A;  4H0L C;  3CU7 A;  2DGY A;  2NBF A;  2CKZ B;  1VF5 C;  3KBG A;  1FGU A;  3PV0 A;  4X66 Q;  1D8L A;  2YYZ A;  3BZC A;  3JAM L;  5C5M A;  1Q90 A;  2N55 A;  1KNE A;  3SK8 A;  5IYD H;  4TSS A;  2IWH A;  5IYC H;  4HED A;  2F4I A;  1Q8K A;  5CV7 A;  5C4X G;  4X3S A;  3D31 A;  2M9V A;  4ID6 A;  2ID0 A;  2MO1 A;  1JQY D;  2C5C A;  3I4L A;  4O1N A;  3IAY A;  1IXR A;  2OQ0 A;  1L1O B;  3PUX A;  5JJZ A;  5AJ3 L;  4LJZ C;  4DUZ L;  3JC6 6;  1Y1V H;  4DV5 Q;  3H6M A;  2F03 A;  1BQQ T;  2E5L L;  3KFU A;  3C1E A;  2EY5 A;  1LTT D;  4UY8 C;  5IOC A;  4OX9 Q;  4CGY B;  2SNM A;  4EGV A;  1B7Y B;  5EQ0 A;  4ALP A;  4LNQ A;  3S1N H;  3HOX H;  5KGU A;  4BA2 I;  4CKE A;  1A62 A;  1D5X C;  3GTM B;  4R4C A;  3ZJY C;  4HJ8 A;  2MGS A;  1XTD A;  1GUG A;  5IT9 E;  3PIP A;  2ZJR A;  1IBM L;  2MFI A;  2R93 G;  4A76 A;  5A2Q L;  1VQH A;  2DJF C;  4XYQ A;  1C4Q A;  4YHH L;  1G2T A;  4YY3 L;  1UE7 A;  4BBS G;  3J7Z C;  2LFN A;  5CV9 A;  2CHB D;  3CCU A;  2UXD L;  1S40 A;  5M5X B;  1PTO B;  3T56 B;  2PQA A;  2QEX A;  3SEB A;  1QZH A;  4LFA L;  4FNF A;  3BYY B;  5DLQ E;  3KBX A;  4PV1 C;  1ONL A;  5AJ3 Q;  4BXX G;  3J7A 5;  1SJH D;  3FKI H;  2RDH A;  4JI3 Q;  4DGZ A;  5ISR A;  4ZLT F;  3KJO A;  4RH6 A;  3CME A;  1N34 L;  4FVM A;  3K80 C;  1IYJ B;  2PI2 A;  4IPG A;  2IY5 B;  2AWN A;  2VXW A;  4A3G H;  1IBL Q;  4MNO A;  5ELF A;  1STB A;  5M5W B;  3T1H Q;  5KNB A;  4R8I A;  4XXE A;  3S2D B;  4X65 L;  4QIW B;  4A3L G;  4C3I G;  1P8L A;  3GTG H;  1VQK A;  3SK4 A;  1A2T A;  3S1Q B;  2F0I A;  4KK7 A;  4LWC A;  2N3S A;  1LTB D;  4UP9 A;  4ZYS A;  1EY6 A;  3CCE A;  1EEI D;  4A3G G;  2NN6 I;  1KRT A;  4UPA A;  2YU9 H;  3BVM A;  3BDL A;  4K14 A;  3TS2 A;  1CA5 A;  1D1K A;  4BWG B;  2F1M A;  3NSW A;  3NEL A;  1S72 A;  1EYA A;  3R3O A;  4TQU S;  1SDF A;  4RGN A;  2EZV A;  3H94 A;  1D5Z C;  3OW2 A;  5LMN Q;  2NVQ B;  1Z47 A;  1SBB B;  1Q86 C;  4IFD I;  1WCM H;  3MA2 B;  2Y0S G;  1JJG A;  2RDF A;  3M7G A;  3K5N A;  5FO9 B;  1L1O A;  3HOX B;  1PLF A;  4A3D H;  4F88 A;  1STG A;  3K5M A;  4A3B H;  4QUF A;  4B3T L;  3FDT A;  1SNP A;  4BBS H;  4WJ4 A;  1UAP A;  4A93 H;  1HZ9 A;  1QVC A;  4KMU C;  3HOW H;  4JVZ A;  3F8T A;  4A3D G;  5M3F G;  4GN4 B;  5LL6 S;  3LX0 A;  4TKO B;  2JA5 G;  1QIL A;  3HOU G;  1G29 1;  1HH2 P;  4OWX B;  1D2B A;  2NVX H;  3QR8 A;  3R93 A;  5I9P A;  1EIG A;  1L0Y B;  1Q3L A;  1ZKO A;  4X62 Q;  3R2T A;  4DF7 A;  2LMC B;  4B3S Q;  2HD3 A;  3DUZ A;  1SNO A;  3T16 A;  2O2L D;  1J6Q A;  4IFD J;  3MC0 B;  1I4P A;  4KLK A;  1XTC D;  2ZTE A;  5BN5 A;  3TZD A;  1HUM A;  3CAM A;  1SNQ A;  3GV6 A;  4IPC A;  4K6D A;  4Z9C B;  1EOV A;  2B2V A;  1WTV A;  1G91 A;  2UXC Q;  1V1Q A;  3VR6 A;  5E4X A;  3RLN A;  4A3J B;  2B2U C;  5H1S E;  3S1Q H;  3O13 A;  2B8F A;  3TP8 A;  4P75 A;  2K4K A;  4ZUI A;  2UU9 Q;  1G6Z A;  1LT6 D;  3B6Y A;  1SFO B;  1HA6 A;  1PZI D;  5C0X I;  3A54 A;  1VQD A;  2F3V A;  4EQP A;  4DA2 A;  3HKZ E;  2ZT9 C;  5LMU Q;  1YHQ A;  2CQO A;  2LY7 A;  2KJX A;  3TP7 A;  4JI4 Q;  1V1P A;  3HOZ B;  2R6G A;  3A8I E;  2A73 B;  1K3R A;  1TWF B;  4A3F G;  4A3B G;  2ZXR A;  1K3B C;  2JE6 I;  5KIX A;  5DEH A;  1PRT F;  1YEZ A;  1KC8 C;  4IUQ A;  4ODG A;  4L5Q A;  4OON A;  2GN5 A;  4DV6 Q;  4LF8 Q;  1EWI A;  2NZH A;  1EY5 A;  4BY7 H;  3L3O C;  4RKL A;  1G51 A;  1FL0 A;  1RCV D;  1XYI A;  3DHQ A;  3I4N B;  4C1N I;  4LFB Q;  1L0X B;  5IGB A;  2TSS A;  3MFY A;  1WTO A;  1O7Y A;  3AYH B;  2UXD Q;  1EUJ A;  3PMF A;  1GUS A;  3NBH B;  4UAI A;  4DR7 L;  2D0O A;  4RHR A;  1AP0 A;  2WB1 E;  1EY9 A;  1WTR A;  1NJI C;  2RBM A;  4X3T A;  2JA7 G;  4CHT B;  3UI2 A;  1TS2 A;  1GUW A;  2A1A A;  5EJW A;  5CMD A;  1IYV A;  1EYG A;  1K73 C;  1A63 A;  1CHQ D;  5GQO A;  1Y1W B;  2FIN B;  1GM5 A;  2P5Z X;  1LO5 D;  1ZXT A;  4FYD A;  4GLV B;  4DPG A;  2ZTC A;  2N8N A;  3SXH A;  1YIJ A;  2L15 A;  1QUQ B;  4NPS A;  5FKA C;  5IP7 G;  3LWU A;  4X3U A;  1R9T H;  4L63 B;  2VY3 A;  1CM9 A;  1AE2 A;  3JAM c;  3PIP 3;  2UUC Q;  1NMF A;  3A0J A;  1I3Q B;  1VQI A;  2FMC A;  3MXN B;  3OPO A;  5ELD A;  3UDF A;  3GTJ H;  1LTA D;  2NVX B;  2JA8 G;  3PCO B;  4RGO S;  2K14 A;  4KY5 A;  5CV4 A;  2VQF Q;  4DUY Q;  4K5X A;  2H5X A;  1QVG A;  2F0E A;  4R8N A;  5COY A;  1S5E D;  1IBM Q;  3QG1 A;  4OXP A;  2AUK A;  2HDM A;  2PYK A;  1QZG A;  5T1I A;  1CQV A;  2B2V C;  1EQR A;  1WYD A;  2MPM A;  3I73 A;  4IZ8 A;  1AW7 A;  2VW9 A;  3K58 A;  3F2U A;  3C2P A;  3FMC A;  1BBU A;  2B2W C;  4DV1 L;  1BBX C;  1K8G A;  4AYB G;  4R4O A;  4JCV E;  4H44 C;  4UP8 A;  1SYD A;  4LF4 Q;  4GNX C;  2Z6B A;  3KF6 A;  4V19 0;  2UUC L;  3N52 A;  5J1Z A;  2XRS D;  5CV5 A;  5T1G A;  4XT1 B;  4N8F A;  1I6V C;  4NW2 A;  5M3M H;  1RIP A;  1CA6 A;  1SE3 A;  2PW7 A;  1A3U A;  1LV9 A;  1NAP A;  1A6X A;  4RFB A;  3TEH B;  1SEB D;  1TVX A;  4TVA B;  4M1U B;  4IFD G;  2NZO A;  2VQF L;  5I6Y A;  4N9P A;  3TQY A;  2QW7 A;  4BY1 B;  3CC4 A;  1HZA A;  1CFM A;  1FYC A;  5K5P A;  5IYB G;  1MIU A;  4DR3 L;  5FO7 B;  1LTL A;  3R2I A;  1BCP F;  5IGD A;  5K36 H;  2PI2 E;  1HHV A;  3VA7 A;  3CW2 C;  3L9A X;  5BN3 A;  4XQN A;  3Q24 A;  3M4O H;  1VQM A;  2F4V Q;  3W5O A;  1VQJ A;  2EOT A;  1U9R A;  3KDF A;  3RZO H;  4LF7 Q;  4NXM L;  2PPB C;  2G5D A;  3A56 A;  4G4K A;  1BCP D;  5D65 A;  3Q22 A;  1MJE A;  4DV4 L;  1B3Q A;  4MZ9 A;  4KHP L;  1JMC A;  4K5V A;  4NB3 A;  4K2L A;  3M4Q A;  2D5D A;  1WTH A;  4OEM B;  2ENB A;  2R93 H;  4GOP A;  5C4J H;  1GVP A;  5C0X G;  3H3V H;  3SR1 A;  4NXN L;  1CUK A;  2AQ1 B;  4A75 A;  2F0G A;  4RCO A;  5IGG A;  1IZ6 A;  1IW7 C;  1TQO A;  2J7Z A;  3J80 L;  4AQY Q;  1PH6 A;  4PZ7 A;  1JR0 D;  3PO2 H;  1DD2 A;  1HR0 Q;  2XGT A;  1LT5 D;  3CXC A;  1BCP B;  1LTS D;  1RHP A;  2JK8 A;  4C2M H;  3X3M A;  3S1M H;  2WKC A;  5JEA J;  2RVL A;  5NUC A;  3D6W A;  4PG3 A;  4I7Z C;  1DON A;  4JI6 Q;  2RCN A;  4LW1 A;  4A3I G;  4H13 C;  1B9M A;  1M1K C;  1YJW A;  2IW3 A;  4HJA A;  3E5S A;  3KF6 B;  4IUP A;  4KJO A;  1CZW A;  3WOE A;  2R7Z B;  5C44 H;  4WFN 3;  2H1E A;  3U9O A;  4ZKB B;  1XNR L;  1YBY A;  2JA7 H;  3LNN A;  4NXN Q;  5FO8 B;  2ES2 A;  1I4H A;  5COR A;  3ONA B;  3I91 A;  2Z9H A;  4RGM A;  2E76 C;  5EKI A;  3CCL A;  5JJI A;  1DJR D;  4X3K A;  1HNZ L;  3NP8 A;  2F0M A;  2F52 A;  4CKC A;  3EVQ A;  4L5T A;  5A35 A;  1Y8P B;  3R8B A;  3TRE A;  2PZW A;  1IHZ A;  1PH7 A;  4Q5V A;  4LF8 L;  4G7H C;  1N34 Q;  1I4X A;  1KL9 A;  4F8M A;  5JOB A;  2I5M X;  4OHJ A;  4KD4 A;  2I07 B;  1SSO A;  1HQR D;  3K5O A;  3JAM E;  1LAB A;  2X6L A;  2EJM A;  2IX3 A;  2F0V A;  1RTO A;  3MFG A;  3S2H H;  4RG1 A;  1K8O A;  1I94 L;  1SR3 A;  5G3L D;  1N8R C;  1JT8 A;  3QO2 A;  4GS3 A;  4JI7 L;  4EQ5 A;  1D5M C;  1ICF B;  1Y1V G;  1HJP A;  2F0S A;  3WDN A;  2IX1 A;  3S15 H;  1EL0 A;  3ER0 A;  1IBL L;  1VQ6 A;  2HCI A;  4J8Q A;  1H9S A;  3CRK C;  1QWY A;  3I7F A;  2RQX A;  1C7Y A;  4DAV A;  3IFT A;  4GN5 A;  1HZB A;  1CKM A;  5DAU A;  1CK1 A;  2B2Y A;  1D7Q A;  4BXX H;  4DV4 Q;  1D6E C;  3KDF B;  4QB4 A;  3NQI A;  2GA4 B;  1GUT A;  1TWA B;  5J22 A;  3S16 H;  2A6H D;  3HP3 A;  1ENA A;  1YHA A;  3M4P A;  2PZT A;  4A3F B;  1EQV A;  2VUM G;  1EWH A;  1PZK D;  4XT3 B;  3MEH A;  4R9W A;  4A93 G;  4A3I B;  2Z4I A;  2ICE C;  1PXU A;  1ROD A;  5LMN L;  2MQH A;  4HCE A;  1S4Z A;  4DK1 A;  4LF4 L;  1Y1W G;  1JB7 A;  1QG7 A;  3HS0 C;  3L0O A;  2N78 A;  4AYB E;  2IHE A;  1VQO A;  4ZKC B;  1EFW A;  3BDO A;  4U68 A;  3I4N G;  1TKW B;  2Q2I A;  3HRZ C;  1OTC A;  1R4Q B;  2K1B A;  2F0O A;  3RLF A;  4C56 C;  2UUB L;  2RHQ B;  1VQE A;  5IGE A;  3PO3 G;  3NUC A;  1OXT A;  4FDB A;  1Y69 U;  1WCM G;  2ZM6 Q;  4C2M B;  1PH9 A;  2EY2 A;  1TWC H;  2RA4 A;  1GO3 E;  2Z0S A;  1PRT D;  2DNE A;  4GLX A;  2AUJ D;  4NKL A;  1WOC A;  3LWE A;  5K36 G;  1HPC A;  4P71 A;  3D4R A;  2EXZ A;  4QMG A;  3CD6 A;  4OWW B;  2R3Z A;  4A3M B;  1N33 Q;  5JJL A;  3A8J E;  2VL6 A;  4K8J A;  4MTK A;  1KLU D;  1TS4 A;  1Y1V B;  3GTK B;  1NTG A;  1NY4 A;  5E4W C;  4BY1 H;  5FLM H;  2HQL A;  3HZX A;  1I6H B;  2KHI A;  2UXB Q;  4BBR G;  2IX0 A;  3T1Y L;  4J6H A;  3OIQ A;  1T5E A;  2EJF C;  5HGQ A;  2GVA A;  3NBI A;  1TWF H;  2X69 A;  4N8X 1;  3LGJ A;  3NXW A;  5GAD C;  4OX9 L;  5C0X H;  5JEA G;  4LF5 L;  3FPP A;  4JI2 Q;  1BNZ A;  4DNI A;  1SMY C;  2A68 C;  2VB3 X;  5JEA H;  1KDC A;  2KVM A;  2SNS A;  1KNA A;  4X64 L;  1JOO A;  3U58 A;  4H02 A;  4HR7 B;  2ZXO A;  2EYJ A;  5CYU A;  4DK0 A;  3PIO 3;  4QY7 A;  2WB1 B;  1D1I A;  4HJ9 A;  2E2J H;  2EXD A;  3KF8 B;  4A3J H;  3NHH A;  4FF3 A;  1Q82 C;  2YV5 A;  2HT1 A;  3S1N B;  3F2C A;  2JA5 B;  2JXM B;  4JW0 A;  2R92 H;  1LTR D;  2EDG A;  1B70 B;  3QOJ A;  1S5D D;  4O2D A;  4DNT B;  2XTI A;  4LFC Q;  4B3R Q;  1MKH A;  3NBH A;  4YCV A;  4XQJ A;  3MXG A;  2CFM A;  2KUM A;  5IP9 H;  1YJN A;  3K6O A;  1L2F A;  5M9O A;  3J81 j;  3SK5 A;  3URY A;  2F4V L;  4JI8 L;  3E0J A;  1LTG D;  3AMU A;  2DY8 A;  5FLX c;  1YI2 A;  4N9T A;  1V9P A;  1X3Q A;  5C6A A;  4X65 Q;  1V1O A;  3K0Y A;  3GTL H;  2PZU A;  4ZRZ A;  2KOL A;  2WAC A;  1Y14 B;  2R7Z H;  1BXT A;  1QUQ A;  2L1B A;  5CR3 A;  4CKB A;  4DK6 C;  4DK3 C;  1HUN A;  3J81 L;  1UNS A;  3S14 B;  1QJO A;  3HKZ G;  1K8A C;  3PF5 A;  3HG9 A;  3CHB D;  2E8G A;  1CKN A;  4XTC S;  1IBK L;  1PTO C;  3E9H A;  1O7L A;  2KA7 A;  3K0X A;  4KN7 C;  1G8Z D;  3S1M B;  1KTK A;  2Y0S E;  1KHI A;  4B3M L;  4AYB B;  3NQT A;  1XPO A;  3T1Y Q;  3BVZ A;  2NVT H;  2OWO A;  3PO3 B;  4DV7 Q;  1X6O A;  5GAH C;  1E24 A;  4J15 A;  3GTQ B;  5C44 B;  1HA5 A;  3HKZ B;  1EQQ A;  1TY0 A;  5J39 A;  4JI6 L;  1JB3 A;  2F0T A;  2L55 A;  1HNZ Q;  3BZK A;  1Z6H A;  3WOF A;  1GUN A;  3NTI A;  4OL7 A;  1EIY B;  1AEX A;  4E6I A;  2F0L A;  4R4I A;  4P2C B;  2L9H A;  3U50 C;  5C4J B;  2K5Q A;  4POF A;  1VQ8 A;  4FF1 A;  2NVQ H;  4QF4 A;  2K50 A;  4JG2 A;  1FJG L;  1Y8O B;  1TT2 A;  1M4V A;  1BVS A;  1STH A;  1QE6 A;  3GTG B;  4A3E H;  1H9R A;  1KLG D;  4JOI A;  1PFB A;  2CCZ A;  4RKB A;  3HOU B;  2TMP A;  3RR5 A;  4L5R C;  1CQF A;  1TU2 B;  2E75 C;  4PMB A;  3U9S A;  1IYU A;  4C3H B;  2JP1 A;  1FR3 A;  2CW0 D;  5C4H A;  3K57 A;  4OEL B;  1I6H H;  4RA8 A;  1TII D;  4Q0F A;  2JA8 H;  3FEW X;  5BR8 Q;  2NYZ D;  3ZYY X;  1GHK A;  3V2T A;  2UUA L;  2FJ2 A;  4GNX A;  3I8Z A;  5KYL A;  1K9M C;  1HNX Q;  3A7A B;  1RJT A;  3A74 A;  1F2L A;  4LFC L;  4HIK A;  2AHO B;  1BOS A;  4A3M H;  4KV6 A;  3I55 A;  3BYT B;  4C3H H;  3H15 A;  4F87 A;  1PRT B;  3CQZ B;  5DM6 3;  2KCC A;  1SXT A;  4XIG S;  1PV4 A;  1MI2 A;  3T51 B;  4DV0 L;  1EEF D;  1SYF A;  1MSG A;  4PMC A;  2EYF A;  3KJP A;  4FXG C;  2WAQ E;  4DR3 Q;  1PFM A;  1B50 A;  2JA6 B;  2BH2 A;  1ILP A;  5CGK A;  2IPK D;  1LTI D;  1UE1 A;  2ZXP A;  3H3V C;  1YNJ C;  3I72 A;  1J8I A;  5M3F B;  4MIU A;  1VMP A;  3PO2 G;  2BDO A;  3TRZ A;  1EWC A;  2GVB A;  3CCV A;  2PNR C;  4J1M A;  2X6G A;  2QGQ A;  5CBE E;  5J3B A;  1KAB A;  1F2Z A;  3I4O A;  1IL8 A;  1H9S B;  2B3G A;  2KED A;  3KLW A;  3M85 A;  2I0Q A;  3C46 A;  4MTN A;  3D4D A;  4GKK Q;  3S24 A;  2QA4 A;  3CKI B;  1HXY D;  1S3O A;  3TBI B;  2UXC L;  2I5H A;  1CT1 D;  3HGB A;  2B2Y C;  3M4O B;  2LKV A;  4AH6 A;  2NUC A;  4RAU C;  1X9N A;  4KKU A;  4JBK A;  2B8G A;  4ZK9 B;  3GTM H;  1X54 A;  2WFW A;  1FNW A;  4JI5 L;  1Z9F A;  3VYU A;  3VR5 A;  1HFN A;  2KQ3 A;  4KI0 A;  3DEP A;  4A3C H;  1O78 A;  1I4R A;  2K75 A;  2HHH Q;  3VR2 A;  3I4M G;  3SVM A;  4P73 A;  4POG A;  5JJK A;  4LAA A;  4LUO A;  2G9H D;  1FJG Q;  2WII B;  1EY0 A;  2QIL A;  3S1R B;  2ALY B;  3L7Z C;  2QDB A;  2EYH A;  1KAW A;  2G9D A;  5D3D A;  5D14 A;  4EVO A;  3T1H L;  3MZ5 A;  2OEO A;  2E2I B;  4GKJ L;  3E0E A;  1GKH A;  3L2P A;  1FVI A;  4DAP A;  4YWK A;  3I4M H;  1L1O C;  4A4I A;  3PIO A;  3BU2 A;  3BG3 A;  1FNU A;  4FO2 A;  3KLR A;  1ESR A;  3HOY B;  3HOV B;  3BJU A;  3MXN A;  5BN4 A;  1RD9 D;  3S14 H;  4Y7N H;  2D9U A;  2B39 A;  2JA5 H;  2DY7 A;  3I70 A;  3DM3 A;  4DR6 L;  5M3F H;  2HQE A;  5C4X B;  1ET6 A;  4HMI A;  2R7F A;  3K7U C;  4JK1 C;  2KEC A;  1ASZ A;  1I50 H;  1GOZ A;  4JV5 Q;  3AFQ A;  2Y0S B;  2E5L Q;  1C48 A;  2FHT A;  3VA5 A;  1UE5 A;  4DV0 Q;  3H0G G;  4DV3 Q;  2PO4 A;  1JC7 A;  1XWE A;  4KY7 A;  3W1B A;  3FP9 A;  1W3S A;  1TWH B;  2KCT A;  5D3I B;  1OXV A;  4RGT A;  2AQ2 B;  2B29 A;  1VQL A;  2WIN B;  1GUO A;  2KEE A;  3VR4 A;  3HOX G;  3ULL A;  4HID A;  3C1F A;  3ULP A;  2MUY A;  5C0X J;  3UDI A;  1QNU A;  1XPU A;  1R9T B;  3H0G H;  3G6J B;  2WAQ G;  4DAM A;  4CDD C;  1N32 L;  1VF7 A;  1VQP A;  2AKW B;  1E3P A;  2K01 A;  1J9O A;  3S2H B;  3T53 B;  1A3V A;  3IFD A;  4WJW A;  1CHP D;  1DM0 B;  5AFW A;  4A3K B;  2SOB A;  3OSO A;  2C35 B;  4HMJ A;  5IOD A;  1I5F A;  3NWT A;  3F1Z A;  3G6E A;  1N9W A;  3F2D A;  2MO0 A;  4L8J A;  2Z6K C;  1VQC A;  3MEF A;  1HNW Q;  4JI5 Q;  2OF1 A;  4PNY A;  1JCK B;  1NBW A;  4DV3 L;  3RZO B;  2RKS A;  4I7A A;  1XMQ Q;  3NTH A;  1S5C D;  3NTK A;  2EYO A;  2FFK B;  3HOZ G;  1XNQ Q;  3Q6S A;  3J7A V;  3UDG A;  3EA6 A;  2NTS A;  4PZ8 A;  1F2Y A;  1II3 A;  4ZAI A;  2J4X A;  3E9I A;  1FGB D;  3P1H A;  4XYO A;  5LMU L;  1SMX A;  1W6J A;  3OWE B;  4GLA C;  1XPR A;  2K5V A;  3GD7 A;  3VYT A;  2JA6 H;  4KY6 A;  1U4M A;  2VZA A;  1N36 Q;  2FXQ A;  2E74 C;  1DOL A;  4YY3 Q;  1JE4 A;  3CCQ A;  3CRL C;  3T4A C;  2IHF A;  4K0K L;  1AZP A;  4LF6 L;  3K5L A;  2PQE A;  4FF4 A;  5BR8 L;  5IT9 c;  3GV3 A;  4B9W A;  1IKM A;  3STB D;  2E2I H;  4A3E B;  1KRS A;  1PH2 A;  2SEB D;  3MTS A;  4KKT A;  1KXL A;  2K6A A;  2BA0 A;  2V1C C;  1O7I A;  1EU3 A;  1X32 A;  2F0N A;  1PZJ D;  5FOB B;  4JYA Q;  2VUM B;  2JA8 B;  1K8M A;  4YCW A;  1VQG A;  1O7Z A;  2CWA A;  4JI8 Q;  1SRO A;  5LMN W;  3BDC A;  1K0S A;  1EZ8 A;  2ZJQ A;  2F0Q A;  1PH8 A;  5ELE A;  2A19 A;  5G3L F;  1SE8 A;  2A8V A;  3TME A;  4DUZ Q;  2ATW A;  4X64 Q;  1U0L A;  3HOV H;  1MJC A;  1JJC B;  1TWC B;  2DNC A;  3CCS A;  2OXP A;  4GNX B;  4A3B B;  2PW5 A;  1B1Z A;  1O80 A;  4LFB L;  1TWH H;  1PDQ A;  1WFQ A;  3OWF A;  3SK6 A;  1G6P A;  1PH3 A;  4IJH A;  1UUP A;  5EBD A;  4OIK A;  1VMC A;  4R4Q A;  3WWV A;  3QOL A;  1A2U A;  1VDZ A;  2N88 A;  3RNU A;  2E2J B;  2L12 A;  5DNF A;  1K83 B;  1XMQ L;  4DV5 L;  3KLS A;  1B44 D;  4JBJ A;  2B2T C;  1ZYR D;  3TSS A;  4IUN A;  4IPD A;  3HOY H;  3H91 A;  1LAC A;  5M3M B;  1AZQ A;  1WTW A; 
#chains in the Genus database with same CATH homology
 1J6Q A;  2BA1 A;  2YV5 A;  1Q82 C;  1P16 A;  2HT1 A;  3NEN A;  3CF5 A;  1YIT A;  4GKK L;  3F2C A;  1TWA H;  5ELN A;  1J5E Q;  4IFD J;  3G48 A;  2R92 H;  4KLK A;  2ZTE A;  1KQS A;  1YZ6 A;  3ERS X;  1B70 B;  3RN5 A;  4JC0 A;  3CAM A;  1OXX K;  2K5N A;  3CCR A;  4DR1 L;  1VQB A;  4A3I H;  4O2D A;  4IPC A;  3PUW A;  4LUV A;  3AEV A;  2XTI A;  3M3Y H;  1K0R A;  1EOV A;  1WI5 A;  4LFC Q;  4B3R Q;  3CCM A;  2UXC Q;  1V1Q A;  3RLN A;  1MKH A;  5H1S E;  5IWA L;  3S1Q H;  3JAM i;  3PUZ A;  3M9B A;  4P75 A;  2K4K A;  2EIF A;  4YCV A;  4DV2 Q;  3B6Y A;  4GOP C;  2UU9 Q;  1ASY A;  2HHH L;  5C0X I;  2CFM A;  1CKN B;  4DR2 L;  1VQD A;  2ZTD A;  5IP9 H;  3VDY A;  1YJN A;  1L2F A;  3J81 j;  4LF9 L;  3A5U A;  3S2D H;  2F4V L;  4JI8 L;  3HKZ E;  3PF4 A;  1YHQ A;  4JI3 L;  5LMU Q;  2CQO A;  5FLX c;  3EIV A;  1YI2 A;  3CPF A;  1V9P A;  1X55 A;  4JI4 Q;  2R6G A;  5C3E H;  3K7A H;  5FJ8 H;  4BY1 G;  4DV7 L;  4X65 Q;  4GOP B;  3GTL H;  1K3R A;  1NMG A;  2KEN A;  3DLL A;  4A3F G;  4A3B G;  4QJF A;  2UUB Q;  5GAE C;  4EX5 A;  1Y14 B;  2DUD A;  2R7Z H;  2JE6 I;  1QUQ A;  1YEZ A;  4PMW A;  1KC8 C;  4PZ6 A;  4DK6 C;  4L5Q A;  4DK3 C;  5IWA Q;  4GKJ Q;  4YCU A;  4OON A;  2GN5 A;  5FLM G;  4DV6 Q;  3HKZ G;  1EWI A;  1K8A C;  4LF8 Q;  3PF5 A;  5IY0 A;  2NZH A;  2NN6 G;  1Q81 C;  1GD7 A;  2E8G A;  3PSI A;  4BY7 H;  4BBR H;  1JT8 A;  1CKN A;  3UDX A;  1G51 A;  1FL0 A;  4XTC S;  1IBK L;  3J80 i;  4APV A;  2VQE Q;  3E9H A;  1PHJ A;  2K52 A;  2ZM6 L;  3K0X A;  4LFB Q;  3GTK H;  2Y0S E;  1KHI A;  4B3M L;  1Q7Y C;  1XPO A;  3T1Y Q;  1YHB A;  2NVT H;  2OWO A;  3AYH B;  2JA6 G;  1EIF A;  4DV7 Q;  1X6O A;  1EUJ A;  2UXD Q;  4LF7 L;  4O0A A;  1OXU A;  4NXM Q;  5GAH C;  1E24 A;  3NBH B;  4X66 L;  4J15 A;  4DR7 L;  2VNU D;  3EN2 A;  5IYB H;  2D0O A;  3GTP H;  2WB1 E;  3ICE A;  5EAY A;  1EQQ A;  1NJI C;  1B8A A;  2KCM A;  2JA7 G;  4JI6 L;  1AH9 A;  1JE5 A;  3I4N H;  1HNZ Q;  4K0K Q;  3BZK A;  1XMO L;  4LUZ A;  2A1A A;  2JA9 A;  4YWL A;  1K73 C;  1EYG A;  2K5H A;  1SRU A;  1EIY B;  4QGU A;  1A63 A;  4R4I A;  3U50 C;  1BBW A;  5GQO A;  4POF A;  1VQ8 A;  2NVQ H;  2R92 G;  1TWG H;  4R4T A;  4JI2 L;  2K50 A;  3RN2 A;  4JG2 A;  4OWT B;  4DR5 Q;  1GM5 A;  4IOA A;  4A3L H;  1PFS A;  1FJG L;  2Q2U A;  1BVS A;  1Y1W H;  2AMC B;  4B3M Q;  4GLV B;  4DPG A;  1RL2 A;  2ZTC A;  5IYD G;  2N8N A;  4A3E H;  5IYC G;  2L15 A;  1YIJ A;  4JOI A;  1QUQ B;  5GRO A;  2CCZ A;  4NPS A;  3RR5 A;  4HIM A;  4L5R C;  2YTV A;  3TS0 A;  5IP7 G;  4DAY B;  1N8R C;  1R9T H;  1VCI A;  2VY3 A;  3A5Z B;  1AE2 A;  3JAM c;  4ME3 A;  2UUC Q;  1I6H H;  4IPH A;  3UE0 A;  4AQY L;  1NMF A;  3A0J A;  3CC2 A;  3HOV G;  2JA8 H;  1HZC A;  5BR8 Q;  4BA1 I;  1VQI A;  4A3K G;  3MXN B;  3PO3 H;  2RF4 A;  2UUA L;  3UDF A;  4GNX A;  1K9M C;  3GTJ H;  1HNX Q;  1XNQ L;  3A74 A;  4HIK A;  4LFC L;  1A8V A;  5GAG C;  2AHO B;  2JA8 G;  4OO1 G;  3PCO B;  4Y52 H;  3OYY A;  2K14 A;  2VQF Q;  4DUY Q;  4A3M H;  1CKO A;  1K83 H;  2H5X A;  1PYB A;  3PUV A;  3I55 A;  3H15 A;  4C3H H;  1QVG A;  1LM0 A;  2KHJ A;  4JBM A;  4JOI C;  1Q1B A;  3Q8D A;  1IBM Q;  2JQO A;  4XIG S;  4OXP A;  4LFA Q;  1PV4 A;  4KHZ A;  1QZG A;  4B3T Q;  2WB1 G;  4HIO A;  1X3G A;  4LF9 Q;  3KYH C;  5C3E G;  2HIX A;  4A3J H;  1EQR A;  1UWV A;  1WYD A;  2VW9 A;  3FKI G;  4DV0 L;  1PH1 A;  4GN3 B;  4DUY L;  3G71 A;  3KJP A;  2N49 A;  2WAQ E;  1BBU A;  4DR3 Q;  4AIM A;  4JV5 L;  3CMA A;  4DV1 L;  2BH2 A;  3SGI A;  5IE8 A;  1K8G A;  4JBW A;  4AYB G;  3U4V A;  1X3E A;  1HNX L;  2LXK A;  1UE1 A;  4R4O A;  3CP0 A;  4JCV E;  3CCJ A;  4UP8 A;  4LF4 Q;  4GNX C;  1N36 L;  4IJL A;  3PO2 G;  3W1G A;  1PH4 A;  3KF6 A;  4C3J H;  2B63 H;  4DR7 Q;  2UUC L;  3TRZ A;  1IBK Q;  1X3F A;  2GVB A;  1A0I A;  2ASB A;  3CCV A;  1J5E L;  4HJ7 A;  3G4S A;  2Q2T A;  2QGQ A;  5M3M H;  1RIP A;  1DGS A;  1T9H A;  5J3B A;  2D0P A;  3OTO Q;  1XJV A;  3HOU H;  3I4O A;  1IL2 A;  1U5K A;  2B3G A;  3KLW A;  3TEH B;  3M85 A;  2I0Q A;  4B3S L;  4TVA B;  4YWM A;  4IFD G;  2LSS A;  2NZO A;  4MTN A;  5HY6 A;  2VQF L;  2JEA I;  2OTJ A;  1C9O A;  4P74 A;  3TQY A;  4GKK Q;  3S24 A;  3K81 C;  2QA4 A;  4KHP Q;  2UXC L;  1E1O A;  1S3O A;  1HZA A;  3CC4 A;  2I5H A;  5IYB G;  4DV1 Q;  1MIU A;  1OXS C;  1HR0 W;  1N32 Q;  4DR3 L;  4P72 A;  4C3I H;  1LTL A;  4DR4 L;  4R1J A;  4AH6 A;  4JYA L;  1X9N A;  3AFP A;  4JBK A;  4QQB X;  4A3K H;  3GTM H;  2PI2 E;  4A3C G;  1Q1E A;  3CW2 C;  1X54 A;  3PUY A;  2WFW A;  3M4O H;  4JI5 L;  1LUZ A;  4B3R L;  3IRB A;  1Z9F A;  3J80 c;  3GTO H;  1VQ4 A;  2EQS A;  1VQM A;  2ZJP A;  3W5O A;  1VQJ A;  2F4V Q;  4KI0 A;  2AWO A;  1UEB A;  4A3C H;  2LXJ A;  2K75 A;  3KDF A;  3RZO H;  4LF7 Q;  4JI4 L;  2HHH Q;  4NXM L;  4JI7 Q;  3I4M G;  2I5L X;  4P73 A;  1VQ9 A;  4POG A;  5JJK A;  4LUO A;  3M7N A;  1MJE A;  5E7N A;  1FJG Q;  4DV4 L;  1SFO H;  4DR5 L;  4MZ9 A;  5IP9 G;  4KHP L;  1JMC A;  4L5S A;  4NB3 A;  2ALY B;  3L7Z C;  3M4Q A;  4DR6 Q;  1KAW A;  4DV2 L;  2UU9 L;  1JJ2 A;  2R93 H;  1E1T A;  4GOP A;  1VQA A;  5C4J H;  1GVP A;  3RLO A;  3HOW G;  3T1H L;  2JEB I;  5C0X G;  3H3V H;  4NXN L;  1CUK A;  4WJ3 M;  1SLJ A;  4GKJ L;  3E0E A;  3FHW A;  2R7D A;  3I56 A;  3CC7 A;  4A75 A;  1GKH A;  1VQF A;  3L2P A;  3I2Z A;  1FVI A;  3GO5 A;  4YWK A;  4A3F H;  1IZ6 A;  2IT1 A;  4AQY Q;  3I4M H;  1PH6 A;  4JI1 Q;  3KOJ A;  1L1O C;  4PZ7 A;  3PO2 H;  3S1R H;  4A4I A;  3PIO A;  3BU2 A;  1HR0 Q;  1L0W A;  2XGT A;  2KBN A;  3AQQ A;  3J81 i;  1CSQ A;  3BJU A;  3CXC A;  2E2H H;  2JK8 A;  4C2M H;  1W2B A;  2VUM H;  5M5Y H;  5M3M G;  4QIW E;  4Y7N H;  3S14 H;  1AE3 A;  3U4Z A;  3S1M H;  2D62 A;  5JEA J;  2JA5 H;  1I3Q H;  3DM3 A;  2F3I A;  4DR6 L;  2MNA A;  5M3F H;  2PNH A;  2WP8 J;  4PG3 A;  3GTQ H;  2R7F A;  3K7U C;  4JI6 Q;  2RCN A;  4LW1 A;  3S17 H;  4A3I G;  1ASZ A;  4X6A H;  1I50 H;  1UE6 A;  3PGZ A;  3AFQ A;  3STB C;  1PA6 A;  2E5L Q;  4JV5 Q;  2DGY A;  1M1K C;  1UE5 A;  5ELO A;  4DV0 Q;  2CKZ B;  1YJW A;  4HJA A;  3H0G G;  1FGU A;  1Q46 A;  3PV0 A;  4X66 Q;  1D8L A;  1KIX A;  4DV3 Q;  2YYZ A;  3KF6 B;  3BZC A;  3UE1 A;  4IOC A;  2BH8 A;  1M90 C;  2JJQ A;  4UP7 A;  3W1B A;  5C44 H;  3FP9 A;  1W3S A;  5IYD H;  5IYC H;  2KCT A;  1HR0 L;  1X65 A;  1OXV A;  1XNR L;  1YBY A;  2B29 A;  2JA7 H;  1VQL A;  4NXN Q;  2UXB L;  1Q8K A;  2ES2 A;  5C4X G;  2CWP A;  3HOX G;  3OTO L;  1PYS B;  3D31 A;  4A3E G;  3GDE A;  5M5X H;  2ID0 A;  2MO1 A;  3ULL A;  4HID A;  3CCL A;  3ULP A;  5JJI A;  1Q12 A;  1IXR A;  2OQ0 A;  1L1O B;  3PUX A;  5C0X J;  3UDI A;  4JI1 L;  5AJ3 L;  1HNZ L;  1VS0 A;  2F52 A;  4DUZ L;  4L5T A;  3JC6 6;  1XPU A;  1Y1V H;  3H0G H;  4DV5 Q;  2WAQ G;  3TRE A;  2Q2H A;  4DAM A;  2E5L L;  3KFU A;  1N32 L;  2PMZ E;  1VQP A;  2AKW B;  1PH7 A;  1E22 A;  1E3P A;  4UY8 C;  4IO9 A;  4LF8 L;  1N34 Q;  4OX9 Q;  3HOZ H;  1KL9 A;  1B7Y B;  3CPW A;  4ALP A;  2I5M X;  4LNQ A;  5C4X H;  3S1N H;  3HOX H;  4BA2 I;  1A62 A;  4R4C A;  2C35 B;  3ZJY C;  4HJ8 A;  3S2H H;  1XTD A;  4RG1 A;  1I94 L;  1SR3 A;  1I5F A;  1YJ9 A;  3F1Z A;  3PIP A;  3G6E A;  1NE3 A;  1N9W A;  3F2D A;  3J81 c;  2MO0 A;  4X62 L;  2Z6K C;  1VQC A;  3MEF A;  2ZJR A;  1IBM L;  1HNW Q;  2MFI A;  4GS3 A;  4JI5 Q;  4JI7 L;  4A76 A;  4EQ5 A;  2Z6K A;  2R93 G;  1NBW A;  1Y1V G;  4DV3 L;  1VQH A;  1HJP A;  3S15 H;  2IX1 A;  3ER0 A;  4YHH L;  1IBL L;  1VQ6 A;  4YY3 L;  1XMQ Q;  1UE7 A;  4BBS G;  3J7Z C;  1WJJ A;  4LF6 Q;  3HOZ G;  3I7F A;  1C7Y A;  4BY7 G;  4GN5 A;  4DV6 L;  1XNQ Q;  1HZB A;  1CKM A;  3CCU A;  2UXD L;  1D7Q A;  3UDG A;  4DV4 Q;  1E7Z A;  3KDF B;  2QEX A;  1S40 A;  2PQA A;  3HFZ B;  1QZH A;  4LFA L;  4HJ5 A;  4PZ8 A;  3S16 H;  5DLQ E;  4DR1 Q;  1YHA A;  3M4P A;  3E9I A;  2VUM G;  5AJ3 Q;  4BXX G;  1KD1 C;  4A93 G;  3J7A 5;  3FKI H;  5LMU L;  3RZD H;  4JI3 Q;  1CSP A;  1PVO A;  1SMX A;  4GLA C;  3KJO A;  1XPR A;  2K5V A;  3CME A;  3GD7 A;  1V43 A;  1N34 L;  3K80 C;  2JA6 H;  1C0A A;  1IYJ B;  5LMN L;  2PI2 A;  4OO1 I;  2MQH A;  2VZA A;  1N36 Q;  2FXQ A;  4LF4 L;  4IPG A;  1Y1W G;  1JB7 A;  2AWN A;  4YY3 Q;  2IY5 B;  4A3G H;  4YHH Q;  3L0O A;  1IBL Q;  4MNO A;  2N78 A;  4AYB E;  2IHE A;  3CCQ A;  1VQO A;  4K0K L;  2IHF A;  1EFW A;  3T1H Q;  4LF6 L;  3I4N G;  5IP7 H;  5BR8 L;  5IT9 c;  4X65 L;  2Q2I A;  4A3L G;  3STB D;  5M5W H;  1YVC A;  1OTC A;  2E2I H;  1BKB A;  1KRS A;  1P8L A;  2PQA B;  3RLF A;  1PH2 A;  2RHS B;  1VQK A;  2UUB L;  3GTG H;  2RHQ B;  1VQE A;  2NVY H;  4LWC A;  2N3S A;  3PO3 G;  4FDB A;  1OXT A;  1YNX A;  1KXL A;  1WCM G;  4UP9 A;  2ZM6 Q;  2BA0 A;  3CCE A;  2V1C C;  1PH9 A;  1O7I A;  1TWC H;  4DR2 Q;  2UUA Q;  4JYA Q;  1PH5 A;  1XNR Q;  4A3G G;  4DR4 Q;  2NN6 I;  1GO3 E;  1KRT A;  4UPA A;  4YCW A;  1VQG A;  2CWA A;  2YU9 H;  4JI0 L;  2Z0S A;  3NEM A;  1SRO A;  2VS1 A;  4JI8 Q;  3TS2 A;  4GLX A;  5LMN W;  1WOC A;  1H95 A;  5K36 G;  1SN8 A;  4RMF A;  4P71 A;  5FJ8 G;  2ZJQ A;  3NEL A;  1S72 A;  1PH8 A;  4TQU S;  4OWW B;  3CD6 A;  2A19 A;  2A8V A;  1SE8 A;  3OW2 A;  1VQ5 A;  4DUZ Q;  2ATW A;  4X64 Q;  1U0L A;  3H3V I;  3HOV H;  5LMN Q;  1MJC A;  1N33 Q;  5JJL A;  1Z47 A;  2R7Z G;  2VL6 A;  1Q86 C;  4IFD I;  1JJC B;  3CQZ H;  3CCS A;  1WCM H;  4GNX B;  1NTG A;  2Y0S G;  1JJG A;  1NY4 A;  4LFB L;  1TWH H;  1WFQ A;  1L1O A;  4A3M G;  5FLM H;  4BY1 H;  1G6P A;  2HQL A;  1PH3 A;  4IJH A;  2KHI A;  4A3D H;  3HKS A;  4QL5 A;  1VQN A;  2UXB Q;  4BBR G;  2IX0 A;  4A3B H;  3T1Y L;  4R4Q A;  4B3T L;  4BBS H;  1LYL A;  3WWV A;  4WJ4 A;  5HGQ A;  4A93 H;  1HZ9 A;  1QVC A;  3K8A A;  2GVA A;  5GAD C;  1TWF H;  3LGJ A;  1I94 Q;  4OX9 L;  2YTY A;  3HOW H;  3F8T A;  4A3D G;  5JEA G;  4LF5 L;  1TXY A;  4DKA C;  2VQE L;  4JI2 Q;  3RNU A;  4BXX H;  5M3F G;  4GN4 B;  4DNI A;  2OCE A;  3F2B A;  1XMQ L;  4DV5 L;  2JA5 G;  3HOU G;  3EBE A;  1G29 1;  1XMO Q;  1HH2 P;  4JBJ A;  3HOY G;  2HIV A;  3D0F A;  4OWX B;  1VQ7 A;  1N33 L;  2NVX H;  4X64 L;  4X62 Q;  3U58 A;  4H02 A;  4A3J G;  1QVF A;  1HNW L;  2OQK A;  4JI0 Q;  3ULJ A;  2B63 G;  4IPD A;  4B3S Q;  3HOY H;  2OTL A;  2YTX A;  4QY7 A;  5C44 G;  4LF5 Q;  4HJ9 A;  2E2J H;  2EXD A;  3KF8 B;  1X56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...