3KOJA

Crystal structure of the ssb domain of q5n255_synp6 protein from synechococcus sp. northeast structural genomics consortium target snr59a.
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
102
structure length
89
Chain Sequence
HHSHMNSCILQATVVEAPQLRYAQDNQTPVAEMVVQFPGAPARLKVVGWGAVAQELQDRCRLNDEVVLEGRLRINSEKQTELTVTRVHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein ycf41
publication title Crystal structure of the SSB domain of Q5N255_SYNP6 protein from Synechococcus sp.
rcsb
source organism Synechococcus elongatus pcc 6301
molecule tags Dna binding protein
total genus 14
structure length 89
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3kojA00
4GOPC 4KHZA 2LSSA 4AQYQ 2F4VQ 2NN6I 2JA8H 4IFDG 1K3RA 4JI7Q 3AFPA 1X55A 4MNOA 3S1QH 4OO1G 4RMFA 1JB7A 5K36G 3CC2A 2VY3A 1EUJA 3JAMc 3RZDH 2JJQA 2YYZA 4POFA 1YJ9A 1WJJA 1PH4A 3L2PA 1C7YA 2BH2A 4A3EH 5C4XH 2CCZA 3S14H 4O0AA 2N78A 3RNUA 2ZM6Q 2UU9L 1D7QA 3GTLH 1EQRA 2WFWA 1HJPA 1PHJA 4GLAC 1Z47A 4YY3L 4PZ6A 3UDFA 1TXYA 1VQCA 1XNRQ 1V43A 4AYBE 1SR3A 4DR1Q 1NJIC 2VQFL 5JJIA 1MKHA 1N34L 1YHBA 4GNXB 1NE3A 1VQDA 3G6EA 2JA5G 1JJCB 1QUQB 1UE5A 1HZCA 1KC8C 1RIPA 2E8GA 1X56A 4JOIC 4IPHA 2R93G 1HNZL 3I4MG 4DR7Q 2B63G 3IRBA 4LWCA 4IFDI 1S3OA 4JI4Q 5M3MG 3M4QA 4OO1I 1Z9FA 2OTJA 5IE8A 2HQLA 4DR6L 1CSQA 1S40A 1Y1VG 3HKSA 2ZTCA 3K7AH 1QVCA 1YZ6A 2AMCB 2ZM6L 4UP9A 1YHAA 3PF5A 4HIMA 5M5YH 1Q1BA 4GKJL 1VQAA 2ZJQA 1OXSC 1EOVA 1UE7A 2IX0A 1Y14B 2NZOA 1HR0Q 4DR4L 3CCMA 4X6AH 5IP7G 1M1KC 4OXPA 1XNRL 2R7ZH 1SN8A 2EQSA 4P72A 1VQOA 5C3EH 4POGA 4GN5A 4DV6L 2VS1A 1J5EQ 1GM5A 1V1QA 3DM3A 4JCVE 3T1HL 2OQKA 4QY7A 2ZTEA 3I4OA 1KRTA 2NVXH 3VDYA 3HOZG 3PO3G 3K0XA 1YVCA 3K7UC 3Q8DA 4JI4L 1K73C 3A74A 5LMNW 4JI0Q 1FL0A 4LF8Q 1YI2A 3DLLA 4X66L 2MO0A 2KBNA 1K8GA 4JBMA 1L1OC 1X3FA 1AE2A 4K0KL 4LFCQ 4QIWE 2L15A 1IL2A 4A4IA 1EWIA 2RHSB 3NEMA 2I0QA 3HOVH 1C9OA 1IYJB 2AWNA 4GN4B 2ZJPA 1EQQA 4JBJA 3PSIA 4A3CG 4R4CA 4A75A 3RZOH 2JA9A 4B3TL 4NXMQ 2NVTH 2UXDQ 1YJWA 1XNQQ 1CKOA 2RF4A 3CC7A 4DR3Q 3M7NA 2UXCL 5AJ3Q 1QZGA 2N8NA 1I3QH 1VQHA 2PI2E 1J5EL 1BBUA 4X64L 2A19A 3HOYG 5IY0A 4R4QA 5C0XJ 1IBKQ 2WB1E 4LF7Q 1OXVA 4LF4Q 3K8AA 4UP8A 2E2IH 4C3IH 2JA5H 4JYAQ 2UXBQ 5GADC 4LF9L 3TS2A 5GROA 2I5LX 1SE8A 2KCMA 1HZ9A 4LF8L 1JJGA 3ULJA 4DV0Q 3I7FA 4DR5L 4DR2Q 2ES2A 5FLMG 2FXQA 2HIVA 4HJ9A 2OTLA 5M3MH 1G51A 2D0PA 3T1YL 2MNAA 4DUZL 3FP9A 1PH9A 2JQOA 2PI2A 1Y1VH 1B8AA 3NELA 4ALPA 4HIOA 1VS0A 5IP9H 1N32L 1IXRA 4GS3A 3W5OA 4R1JA 5IYBG 4NXML 2UXDL 4DR3L 1G291 2IT1A 1I94Q 5AJ3L 1JMCA 2K5HA 4XTCS 4O2DA 2K5NA 2AKWB 4JG2A 3GTJH 4YY3Q 4LF6L 4OWWB 4TQUS 1IBKL 1MIUA 2F52A 2Y0SE 2A8VA 4AYBG 4A3FG 3S1NH 2VQFQ 5J3BA 1N34Q 4JYAL 1IZ6A 4A3GH 3PO2G 1L0WA 3HOZH 3I4NG 1FVIA 2MFIA 3UDIA 3J81i 1VQLA 4AH6A 4DV0L 5IYCG 3I56A 4DR2L 1N36L 5HGQA 1HNZQ 1L2FA 3PO3H 3A0JA 1HNXQ 3EIVA 4BA1I 4FDBA 5JEAJ 1L1OA 3KLWA 3UDGA 2PQAA 4JC0A 2VUMG 2OQ0A 4BY7H 4DR6Q 1KHIA 1YNXA 4JI6L 3HOVG 2AWOA 1KAWA 3J80i 1E1TA 3CPFA 2YTVA 1EIYB 4KHPQ 4YCVA 4BA2I 1C0AA 2VW9A 3S16H 1RL2A 1UE1A 1I94L 2A1AA 4GKJQ 2GVBA 2JEAI 3CP0A 1GVPA 1VQGA 3F8TA 4DR4Q 4A3CH 3CCRA 4BBSH 1UWVA 1OXTA 2K14A 4LFBL 3G4SA 4QJFA 1WYDA 1TWGH 2VL6A 1QVFA 1YEZA 4DPGA 2D62A 4DV6Q 1D8LA 2K50A 1XMOQ 1Q82C 3HOYH 3HFZB 3T1HQ 3LGJA 4A3MG 3UE1A 1HZAA 3BJUA 4L5QA 4R4TA 3UDXA 1HNXL 2CWAA 2NVYH 3CCJA 2OWOA 4LW1A 1VQ8A 1JT8A 1OXXK 3KF8B 4X66Q 4DV2L 5JJLA 5FLMH 1Y1WH 1WI5A 5IP9G 4KHPL 2K52A 4DAMA 2R7DA 1S72A 4LF5Q 3CD6A 4K0KQ 1XPRA 3HOWG 4B3SL 4RG1A 1KL9A 4A3DG 1L1OB 4XIGS 2E5LL 2PQAB 3J7ZC 1MJCA 4P73A 5IYBH 5ELOA 3W1GA 2F3IA 1PH5A 4B3TQ 4A3KH 1VQMA 1K0RA 3ULPA 4JI1L 3U58A 2UXCQ 4EX5A 4DK6C 3HKZE 4X65L 4A3GG 3I2ZA 1Q46A 1GD7A 2Z0SA 4KLKA 4X64Q 3CCVA 4DV3L 2CFMA 2H5XA 1XMOL 1OTCA 3K80C 2UUBL 3GTGH 3S1RH 1U0LA 5IYDG 2E2HH 2WB1G 4P71A 4A3FH 2EIFA 1P16A 4GOPA 1SMXA 1LUZA 4IFDJ 1TWFH 3GTPH 3S2HH 3PO2H 1UEBA 2PMZE 4LF9Q 2R6GA 3CMAA 3EN2A 4HIDA 4A3JG 3J81c 3BZCA 1Q81C 2JA6G 3I4NH 3U50C 5IYCH 1MJEA 2EXDA 4BY7G 4DR5Q 5LMUQ 3GTQH 3H3VH 4DUYL 1VQJA 4IPCA 4YHHL 3BZKA 4LF5L 3PF4A 2IHEA 4BY1G 5GAHC 3T1YQ 1CUKA 3CF5A 5BR8L 4DUZQ 2ID0A 1K8AC 2R92H 2VUMH 4A3LG 1O7IA 1SRUA 4Y7NH 1E22A 2DUDA 4J15A 5GAGC 4DK3C 3M85A 1N32Q 4GN3B 4L5TA 4BBSG 2CKZB 1ASYA 2WP8J 1VQ9A 3M3YH 1W3SA 3S2DH 1VQ7A 1VQBA 3JAMi 4LF6Q 4B3RL 2Z6KC 4KI0A 2Y0SG 2VZAA 5JEAG 5FJ8H 1XJVA 3U4ZA 2BA1A 4JI2Q 4JOIA 3PUWA 5IT9c 3TS0A 3PUXA 4MZ9A 1WFQA 2BA0A 1IBLL 4A3MH 4JBKA 2V1CC 1NMGA 2ASBA 3AFQA 2LXJA 2YTYA 3AYHB 3ERSX 3M9BA 3A5UA 5LMUL 4JI3L 1N36Q 3M4OH 4B3ML 4LUOA 3STBC 2MO1A 1Y1WG 1HZBA 1Q12A 2Q2HA 3J7A5 4GOPB 1R9TH 4AIMA 4BBRH 3CAMA 2LXKA 3RR5A 4HJ7A 1VQPA 1CKMA 1EFWA 3KYHC 3S1MH 1A8VA 1GKHA 1NTGA 2B29A 3W1BA 1QVGA 3ZJYC 4OX9L 4JI6Q 1WCMG 3L0OA 4WJ4A 3U4VA 1I5FA 3HOWH 1Q86C 4L5RC 4A3KG 3G71A 4A3DH 2ATWA 4DV7L 3RN5A 1AH9A 3FKIG 1K83H 3KDFA 4PMWA 2UUCQ 1FJGQ 3OTOQ 2XGTA 1EYGA 4LFBQ 4DAYB 5EAYA 1VQ4A 1PH8A 4DV1L 4UPAA 4JI2L 3PIPA 2PNHA 1X3GA 4GLVB 1PA6A 3GO5A 1N33L 3KF6A 1TWHH 3PCOB 5IYDH 4OONA 3J81j 1XPUA 1OXUA 5LMNQ 1HNWL 1LTLA 5M5XH 4A3BH 3E0EA 4PZ7A 1XPOA 4A3JH 2JA6H 3CC4A 1X54A 3MXNB 1HR0W 1VQEA 2R92G 1A63A 2VQEQ 1NY4A 4LUZA 1XTDA 3ER0A 4ME3A 4DV2Q 1N9WA 1UE6A 3F2BA 3AQQA 2ZJRA 4DV4L 4YCWA 4BY1H 5H1SE 3HOUG 1KRSA 4GKKL 4B3SQ 2IHFA 4YWLA 3PV0A 5M5WH 4A93H 1Q8KA 4A3LH 3PUYA 2JE6I 2KHJA 3RLNA 4DKAC 2HIXA 2E5LQ 3GTKH 2UUCL 1FJGL 3KFUA 3OTOL 1Q1EA 3A5ZB 1ASZA 2NVQH 4NXNL 3CCQA 3WWVA 3RN2A 3L7ZC 4IOCA 1TWAH 4PZ8A 4LFAQ 4JI8Q 1JJ2A 3RLFA 5FJ8G 2UUAL 1P8LA 4JI1Q 2Z6KA 1SLJA 4WJ3M 1SFOH 4X65Q 3HKZG 2VNUD 1AE3A 4DV3Q 4A76A 4UY8C 3F1ZA 1KD1C 2UUBQ 1BKBA 3KDFB 4IOAA 4Y52H 5ELNA 2CWPA 4C3HH 5LMNL 2K75A 4IJLA 3CXCA 4JI5Q 3K81C 2XTIA 1GO3E 5C4JH 1IBML 2K4KA 1X9NA 1CKNB 4TVAB 3H3VI 4BBRG 1H95A 2B3GA 3F2DA 2VQEL 3RLOA 3KF6B 4HJ8A 1A0IA 4DUYQ 4HJAA 4YHHQ 1YJNA 1T9HA 4DV5L 2WAQG 4IJHA 5FLXc 2JA7H 2C35B 4GLXA 3TEHB 5BR8Q 4EQ5A 4B3RQ 1EIFA 3UE0A 1WCMH 5C0XG 2Q2UA 1A62A 4IO9A 1PH6A 3OYYA 3H0GH 5HY6A 4AQYL 4MTNA 1YHQA 2YTXA 2F4VL 1X6OA 4JI8L 4JI7L 1YBYA 4LFAL 2IY5B 3PUVA 1QZHA 1VCIA 3FKIH 3M4PA 1VQIA 5M3FH 1M90C 1PVOA 5GQOA 1FGUA 2RCNA 1KXLA 4X62Q 3H15A 1PFSA 4HJ5A 1KQSA 1VQFA 3CCLA 2IX1A 4A3BG 1YIJA 2R7FA 4JI5L 1B70B 1X3EA 1PH7A 2Q2IA 1IBLQ 4YCUA 3E9HA 1PH2A 2KENA 2CQOA 3AEVA 2RHQB 4YWKA 4YWMA 4OWXB 3SGIA 3STBD 1LM0A 4JI3Q 1E3PA 3ULLA 5C44H 4GNXC 2WAQE 3CCSA 4HIKA 4A3IH 4B3MQ 4DR1L 1Q7YC 4A93G 3S15H 4R4OA 4OX9Q 2AHOB 4BXXH 3J80c 2HHHQ 4JBWA 3HOXG 3HOUH 5C0XI 2JA8G 4QGUA 4QL5A 1KIXA 1VQ5A 4DR7L 4NB3A 3CCUA 1I50H 4DV7Q 4H02A 3MEFA 4QQBX 5DLQE 2E2JH 4LNQA 2N49A 2QGQA 3OW2A 3JC66 4C3JH 2OCEA 1G6PA 1LYLA 3BU2A 4L5SA 3PIOA 4X62L 4A3EG 4JV5Q 5C4XG 1SROA 3GDEA 2ALYB 4DV1Q 1YITA 1XMQQ 5GAEC 3HOXH 1BVSA 2ZTDA 3I55A 2I5HA 4PG3A 2MQHA 1N33Q 1VQ6A 4R4IA 3CCEA 5IWAQ 3CW2C 3S24A 2Q2TA 1HR0L 1HNWQ 3E9IA 3KJPA 1DGSA 4P75A 1JE5A 3NBHB 3TREA 2JA7G 3D0FA 2KCTA 2YV5A 4UP7A 4DNIA 2NZHA 1NBWA 2JK8A 4IPGA 2HHHL 1U5KA 2BH8A 5E7NA 1PV4A 4NPSA 4DV4Q 4C2MH 1X65A 3CPWA 3TRZA 3H0GG 3KOJA 4GKKQ 3NENA 3GTOH 1HH2P 2GVAA 5M3FG 3B6YA 1VQNA 1BBWA 2NN6G 1E24A 4JI0L 5JJKA 1V9PA 3GD7A 4NXNQ 2R93H 2YU9H 1B7YB 4JV5L 3I4MH 2B63H 4IPDA 2N3SA 2UUAQ 1XMQL 3ICEA 1CKNA 2DGYA 1PH1A 4LFCL 1E1OA 3TQYA 2K5VA 4APVA 1N8RC 5IWAL 4P74A 2QEXA 1I6HH 1PH3A 2HT1A 1E7ZA 5C44G 4A3IG 4OWTB 2UU9Q 3S17H 1J6QA 2KHIA 1VQKA 1IBMQ 3FHWA 3CQZH 4GNXA 2GN5A 1W2BA 2QA4A 1XNQL 2R7ZG 1QUQA 2D0OA 5C3EG 1WOCA 1PYBA 3F2CA 1PYSB 4BXXG 1K9MC 3PUZA 2JEBI 5IP7H 4LUVA 4DV5Q 4LF7L 1CSPA 4LF4L 3KJOA 3PGZA 2I5MX 3EBEA 2UXBL 3GTMH 1TWCH 3CMEA 3D31A 1NMFA 3G48A
chains in the Genus database with same CATH superfamily
3DWPA 1CHPD 4GOPC 2JA8H 4IFDG 2XVSA 3TZUA 5JVH3 1K3RA 2XWJB 4DU9A 4MIUA 5BN5A 3BDLA 1B9MA 1BDOA 5K36G 3J81E 2B2WA 1EUJA 5ELEA 2JP1A 2K01A 3CQZB 4HN7A 1YJ9A 4POFA 2BH2A 1PH4A 4O0AA 2N78A 1PFMA 3EA6A 2UU9L 3GTLH 2PW5A 5JPNC 1D5XC 3CHBD 5A35A 1TWCB 2KVMA 1XNRQ 3G6JB 4AYBE 1SR3A 1TY2A 2VQFL 3VA5A 2XRQD 1YHBA 4JW0A 2JA5G 5C4ZA 2FINB 3T4AC 2E8GA 4JOIC 2KCCA 1SYBA 5CR3A 3S14B 4FXKC 1SE4A 1S5ED 3IRBA 2AUKA 1S3OA 4IQZA 5M3MG 4OO1I 1WTHA 5E4WC 4O1NA 1CA6A 5IE8A 1Y1VG 1PFNA 3K7AH 1YZ6A 4IUTA 2FMMA 5M5YH 3A8JE 2PNRC 5CC4A 5CV5A 1A6XA 2ZJQA 1G91A 1BF4A 2IX0A 4X6AH 5IP7G 1TS4A 1XNRL 3D6WA 1TVXA 2EQSA 4P72A 5C3EH 2B2TC 4GN5A 2VS1A 1GM5A 3DM3A 3T1HL 1E2WA 4QY7A 3ND9A 5CV4A 1R4QB 1JC7A 3MFYA 3VDYA 1YVCA 3K7UC 1LTSD 2F03A 1STEA 1FL0A 1GUTA 1PZJD 1LLRD 3QOJA 1FYCA 4QIWE 1IL2A 2RHSB 1C48A 1EQQA 2F0EA 3PSIA 4HCEA 2JA9A 4NXMQ 2NVTH 1EFID 1CKOA 4HSPA 2UXCL 5AJ3Q 1I4XA 1A3UA 1I6VC 2PI2E 2SDFA 4JVZA 3NWSA 5IY0A 4ABNA 3MHBA 1OXVA 4LF4Q 1GOZA 4KHVA 2Q8IB 4FF2A 4NP5A 1G8ZD 5GADC 1SE8A 4OIKA 4MHEA 3EROA 5CV8A 4DV0Q 4DR5L 2ES2A 1SEBD 2FXQA 2HIVA 1SYCA 4XDXA 4HJ9A 3LWUA 5KNCA 1G51A 4DUZL 3FP9A 2JQOA 4G4KA 1B8AA 3NELA 1EWCA 1D1IA 3RMHA 2F0MA 1VS0A 3RD4A 2TSSA 4R1JA 4ID6A 4NXML 4L63B 2K32A 1G291 3PIP3 5AJ3L 4XT3B 5CGKA 3NUCA 1PTOB 1EY6A 4TQUS 2F52A 2A6ED 2A8VA 3S1NH 3CU7A 1IZ6A 4RAUC 3PO2G 3I4NG 2MFIA 3KLSX 4DV0L 1EYCA 5HGQA 3IFTA 5JEAJ 2F0TA 1L1OA 3FDTA 3A56A 4BY7H 1LACA 1YNXA 3ND8A 2PZTA 2AWOA 1E1TA 1EIYB 2SNMA 3GTJB 1RL2A 5C5MA 1NR4A 1EY4A 1UE1A 2GVBA 1LTRD 4DR4Q 1LT3D 1UWVA 1OXTA 3H94A 1Q3LA 3J7AV 4DPGA 3PO3B 4UAIA 5COYA 1D8LA 2K50A 4B9XA 2F0HA 1JR0D 3VYRA 1FNVA 3UE1A 5IGCA 2JXMB 3BJUA 2LFNA 4KV6A 3SK4A 1SDFA 3FEWX 2QDBA 1JT8A 1OXXK 4X3SA 2WIIB 4RFBA 4X66Q 3EVQA 2DJFC 4RGMA 2R7DA 5F2DA 1SJED 1XPRA 2ENBA 1IKLA 3D3RA 4A3DG 1B53A 1L1OB 1SYDA 4CKCA 4XIGS 2O2LD 5FO9B 3J7ZC 4P73A 5IYBH 1RTOA 3W1GA 1JQYD 1K0RA 4UDUC 1RD9D 3P1HA 3HZXA 4KLKA 1GD7A 3GTGH 2H5XA 5JOBA 1OTCA 1FGBD 5IYDG 1F2MA 2EIFA 1L0XB 4ZUIA 1LUZA 4IFDJ 1TWFH 4LF9Q 1F9PA 2F0QA 3CMAA 3BZCA 3U50C 1EOTA 4BY7G 1U4MA 1WCMB 3NPPA 3PF4A 4CKEA 3T1YQ 4A3KB 1AN8A 2AUJD 5BR8L 2RDFA 1E22A 3S9WA 1N32Q 4I7ZC 2EY6A 4GN3B 1GUNA 1CQFA 4FF3A 3S1RB 2E2HB 1VQ9A 3M3YH 3S2HB 2M00A 1SAPA 1VQ7A 1VQBA 2Z1CA 4WRDA 2B2WC 5FJ8H 3GTQB 2F0OA 5EBDA 4JI2Q 1GHJA 3PUWA 3TS0A 3JAME 1DCZA 1WFQA 2BA0A 1WTRA 2V1CC 1EIHA 3M9BA 4JI3L 1GUGA 2IW3A 3STBC 2MO1A 2Q2HA 4CJ0B 1DOKA 1PRTC 2LXKA 3RR5A 1CKMA 2E74C 1I50B 1QVGA 2EVBA 3L0OA 1I5FA 4OHJA 1EYAA 1V1PA 4ZUJA 1SYGA 1BQQT 2IPKD 2ATWA 3ONAB 3RN5A 5L37A 1HTPA 2MP1A 2XGTA 4A3MB 1EYGA 3VR2A 4LFBQ 1D5MC 1PH8A 4DV1L 4JI2L 1QNUA 2PNHA 1FNUA 2PMZB 4OEMB 1N33L 4BBRB 5KGUA 3Q23A 3S1MB 3UI2A 5LMNQ 1ICFB 2F0FA 1G6ZA 2EJMA 3MA2B 1XPOA 1NR2A 2XN9C 3CRLC 4KY6A 1WTXA 2JA6H 1UAPA 5C4HA 1O7ZA 1SBBB 1VQEA 1A63A 3T13A 4ME3A 1UE6A 3SK8A 3HOUG 2MJ8A 1ILQA 4B3SQ 4WJWA 5M5WH 2JE6I 1GUSA 3KFUA 2NVQH 4NXNL 2NUCA 3L7ZC 1F9QA 4IOCA 3RLFA 1V1PB 2H1EA 4JI1Q 2QEJC 5FJ8G 3NHHA 4PQXA 5M5XB 3HKZG 4DV3Q 3G7LA 1KD1C 1BKBA 5IOCA 3OPOA 5LMNL 2OEOA 3DEOA 1B44D 4R8NA 3E0JA 4FYDA 3K81C 1CTMA 2XTIA 3I3CA 5C4JH 1X9NA 4BY1B 1MI2A 1H95A 2RBMA 3QO2A 3GTMB 1B50A 3K5MA 4HJ8A 3GTKB 1LTAD 4YHHQ 4CGYB 1SYFA 3OHXC 1ESRA 2B2UC 4KN4C 2KEEA 1TWAB 4EQ5A 1EIFA 1E2ZA 1WCMH 1SFOB 1M4VA 2Q2UA 1JOOA 4C3HB 1EY7A 5GQOA 1FGUA 1B9NA 3A8KE 4HJ5A 1PFSA 3CCLA 4WORA 2A5HA 2F0NA 1PH7A 2Q2IA 1IBLQ 1YNND 2WV6D 4YCUA 4DK1A 4H0LC 1DM0B 4YWMA 4GNXC 3CCSA 4BWGB 1STGA 3Q24A 2BDNA 1Q7YC 4QUCA 3FKIB 2QKIC 3DWQA 5ELDA 3J80c 4JBWA 3I90A 1U4RA 4X3TA 4DR7L 4NB3A 1I50H 2KECA 5EPJA 5FKAC 2L55A 4LNQA 2LY7A 3OMGA 1KABA 4C3JH 3A7AB 2SEBD 1LT5D 5C4XG 1TR5A 4OO1H 1XMQQ 1CZWA 5D3DA 1HPCA 1KLGD 5IWAQ 1HR0L 4KMUC 1HNWQ 3E9IA 2F0GA 4NDXA 4B9WA 3BYYB 2F0SA 2YV5A 4DNIA 2NZHA 1NBWA 1HA6A 1XX8A 2JK8A 4IPGA 5E7NA 1BCPF 4C2MH 3TRZA 3KOJA 4GKKQ 3NQIA 4HTHA 1HH2P 5E1FA 3B6YA 1V9PA 2RCFA 2UUAQ 1BUVT 1XMQL 2JN4A 3ICEA 3NBIA 1UNSA 2E2DC 2B2YA 5LL6S 3VYTA 5IWAL 2RVLA 1I6HH 2AQ2B 1SE3A 2HT1A 1E7ZA 3S17H 4OWTB 2R7ZG 2XSCA 3FHWA 1AZPA 4R9WA 3PMFA 2JA5B 1CK1A 2A6HD 2K28A 3EBEA 3GTMH 1FD7D 3CMEA 1LTLA 3QOLA 2FFKB 1S5BD 4KHZA 2LSSA 4AQYQ 1Y1VB 2NN6I 3TZDA 1V1OA 4JI7Q 1BXTA 1CI3M 3BVZA 3S1QH 4OO1G 5FOBB 3CC2A 2KUMA 1JICA 3DM1A 2YYZA 4DF7A 1WJJA 4JK1C 3VR6A 4A3EH 4C1NI 1IW7C 3RNUA 1EQRA 2R3ZA 5LL6X 2HQEA 1HJPA 4K2KA 4GLAC 1Z47A 3HOXB 4PZ6A 3UDFA 4K6DA 2F4IA 1VQCA 3VA7A 2JA8B 2L0CA 3MAQA 1DJRD 2A68C 2EYLA 4C3IG 1EY9A 1JJCB 1UE5A 1HZCA 3I72A 1RIPA 1KC8C 1PZID 1X56A 2L11A 4FO2A 3CKIB 1HNZL 4O42A 3F2UA 1VMCA 4ZCKA 3BVMA 3M4QA 2TMPA 1DOMA 4DR6L 4KJNA 2ZTCA 1QVCA 2AMCB 1YHAA 3PF5A 4RA8A 4GKJL 1EY5A 4J6HA 2NYZD 1EOVA 1UE7A 1Y14B 2NZOA 3AMUA 3PQIA 1BOSA 3QR8A 4OXPA 1EEFD 1WTWA 1VQOA 2P5ZX 2G9HD 3NTKA 4HEDA 1HUNA 1JB3A 2ZTEA 3K7AB 5T1GA 4ZK9B 4DAVA 4ZYSA 5CV9A 5LMNW 4JI0Q 5M5YB 1YI2A 2KBNA 2EYFA 1ILPA 1HQRD 1J8IA 4QUFA 5C3EB 2I0QA 3HOVH 4TRDA 3HP3A 3SK6A 1LTTD 4ILWA 4B3TL 1XNQQ 4XYQA 1RJTA 4DR3Q 2KQ3A 1QZGA 2J4XA 4X64L 2A19A 3HOYG 2RSOA 3I4NB 3A54A 1IBKQ 4LF7Q 2WB1E 1B4OA 2E2IH 2JA5H 4JYAQ 2E75C 2EY1A 2I5LX 3I7FA 2OTLA 3GV3A 5M3MH 2D0PA 1SXTA 1PH9A 2EJFC 5C3WA 3FPUB 1Y1VH 1XTCD 2NWGA 4ALPA 1T5EA 1S5CD 3W5OA 1F77A 4DR3L 5HURA 1TS5A 4XTCS 1VF5C 2K5NA 4O2DA 3WOEA 3H3VC 3N6RA 4JG2A 5EPKA 4OGQC 4LF6L 1IBKL 4ME5A 4KY5A 2Y0SE 4XYOA 4AYBG 2VQFQ 4JYAL 2XRSD 2MPMA 1L0WA 2OF1A 1JWUD 1FVIA 1VF7A 5IYCG 3I56A 3M7GA 1L2FA 5JVG3 4HR7B 1CHQD 2VUMG 2IL8A 1X3QA 3HOVG 3P7JA 5EGTA 4KHPQ 4BA2I 2QF7A 2VW9A 1I4QA 1WVLA 3IL8A 3S1NB 2F3WA 2JEAI 1GVPA 2HD3A 1WYDA 1XWEA 1I4HA 2VL6A 3ERQA 1EU3A 3MFGA 2CQAA 5D3IB 2D62A 1L0YB 1XMOQ 3T1HQ 3TBIB 4BY7B 3HGBA 4KY7A 4L8JA 2NVYH 4FXGC 4FXDA 5HGTA 1TS2A 1STBA 1S5DD 1H9JA 1W6JA 1ZYRC 4HAEA 1MD2D 4KHPL 2K52A 4LF5Q 1EWHA 1PTOF 3CD6A 3HOWG 1TU2B 1AFPA 1KDCA 1WTOA 4V190 2DJGC 3K58A 1PH5A 4L6TB 1FR3A 2UXCQ 3D4DA 3I2ZA 4V0BA 1XMOL 3IFDA 1Z6HA 3K80C 3SE0A 4N8X1 3D4WA 1CQVA 4B3RQ 1P16A 4RWSC 1SMXA 3U9OA 2B2YC 2F0UA 5FLXL 3PO2H 2WKDA 3I4NH 1SNPA 4G7OC 4DR5Q 5LMUQ 1VMPA 4LF5L 4C56C 4EQNA 1K28A 1CA5A 4DUZQ 1D6EC 3AU7A 2R92H 4A3LG 1O7IA 5FK9C 2IWHA 4J15A 1BCPC 3GTGB 2CKZB 2EYJA 1TQOA 3RUZA 4EQPA 1Q8IA 2EXZA 1TWFB 3I73A 5CBEE 2RDHA 1K8OA 3JAMi 4B3RL 2Z6KC 5IT9c 3MXNA 1R4PB 3K5NA 1ENCA 1NMGA 2LXJA 2YTYA 3M4OH 1A3TA 5LMUL 4B3ML 1WD1A 1HZBA 3HOUB 2V4DA 1SYEA 3CAMA 4YIJA 4HJ7A 1EFWA 1MSGA 3M3YB 4OX9L 1F2YA 4NMZA 3U9SA 4WJ4A 5G3LF 3U4VA 2HCIA 3D4RA 3BDCA 4A3DH 3G71A 2PCFB 4XQJA 3HKZB 5EAYA 4ZKCB 4UPAA 4CJ2C 2PPBC 2VB3X 4RGOS 3KF6A 1TWHH 2CW0C 3PCOB 5IYDH 3J81j 3K0YA 3WOFA 4JPBW 4DNRB 2N88A 4PZ7A 1VDZA 3K59A 2B8FA 2F1MA 3CC4A 1X54A 3DEPA 3MXNB 4N9TA 4F7XA 3GTOB 2R92G 1H9KA 2B39A 1N9WA 1RDPD 4CDDC 2ZJRA 2B8GA 3P75A 5H1SE 5EQ0A 2IHFA 3PV0A 4A93H 3RLNA 2NTSA 4DKAC 2HIXA 5JPMC 1Q1EA 1ASZA 2H4OA 4TSSA 4JI8Q 5AFWA 4WJ3M 1P8LA 3BS1A 2L9HA 1AE3A 1RODA 2JA6B 4Y52H 2CWPA 2O4XA 2ZT9C 3CXCA 4OL7A 2Z8LA 2LMCB 3H3VI 4RKLA 5M5WB 1PFBA 3KF6B 2NVQB 4I7AA 5FLXc 3T51B 2JA7H 3TEHB 4K6LA 4OELB 5BR8Q 5I9OA 2O5JC 4CJ1B 3R3OA 2BE5C 3OYYA 5HY6A 3KUPA 2F4VL 4MTNA 1WTPA 3NTIA 4JI8L 3PUVA 3Q0AA 5M3FH 1HCZA 5C4JB 2RCNA 2PQEA 1A2UA 1KQSA 1ZKOA 2R7FA 1X3EA 1DXMA 2PZWA 1PH2A 2NTTA 3AEVA 4YWKA 3STBD 4JI3Q 5ELFA 1PRTD 4DR1L 4A93G 3S15H 2B2VC 2GA4B 1HFNA 3HOUH 5C0XI 4QGUA 4QL5A 1KIXA 4H02A 1KNEA 3MEFA 4QQBX 2E2JH 3OW2A 1TIID 2QGQA 1G6PA 2FMCA 2DY7A 1SROA 4G57A 4F87A 2Z4IA 3GDEA 4DV1Q 5ELBA 1F9SA 1BVSA 2R7ZB 2MQHA 1N33Q 1JOKA 3CW2C 3J80L 2Z4HA 1OO9B 3KJPA 1DGSA 2K7VA 2MHVA 1WD0A 2D9UA 5IGFA 2JA7G 2KCTA 1IHZA 1Q90A 2XNAC 1PV4A 5IGBA 4C3JB 1X65A 4RHSA 3CPWA 3GTOH 2CH4A 3LNNA 2GVAA 3D8GA 5M3FG 2NN6G 3GD7A 4NXNQ 2R93H 1X32A 2B63H 3DWAA 2N3SA 2IX3A 1HRJA 2DGYA 4LFCL 2MUYA 3RZOB 5I9PA 4X3UA 3TQYA 2EJGC 1N8RC 3KK7A 4P74A 5A2QL 1Y8OB 2WAQB 1SSOA 4C2MB 2GN5A 1QUQA 1PYBA 1PYSB 1K9MC 4ZAIA 4Q0FA 4LUVA 4PNYA 3QG1A 4QF4A 2UXBL 3OOCA 5KEEA 2QILA 1QB5D 1I6HB 2EE1A 1X55A 1W6KA 4RMFA 4Z9CB 3S17B 2JYOA 1ML0D 4EQOA 2PO4A 3RZDH 3L2PA 5C4XH 4PV1C 2CCZA 2L4NA 2KCNA 3L3OC 1PTOC 1UEAB 1GUWA 2WFWA 1RKNA 1PHJA 4YY3L 1V43A 2SOBA 4J1MA 1H9SA 1N34L 3S1QB 2M9VA 1U4PA 1NE3A 3MC0B 1QUQB 1SNMA 1JWMD 2R93G 3MTSA 4A3EB 5I2XA 4DR7Q 1B3QA 2B63G 4LWCA 4JI4Q 1YNJC 2AQ1B 3P20A 1ONLA 3S16B 4K14A 2HQLA 1CSQA 1S40A 3HKSA 3H6MA 3QIAA 3GV6A 1TWGB 1Q1BA 2EY5A 1VQAA 1OXSC 1HR0Q 1NSNS 3HOYB 4DNTB 4K5VA 1QE6A 3V2TA 2R7ZH 1SN8A 2C5CA 5BN4A 3C1EA 4POGA 2L1BA 4DV6L 4KD4A 4CDFC 1KRTA 3KBGA 2NVXH 3PO3G 4JI4L 3Q8DA 1K73C 1H9SB 4LF8Q 1D1KA 2E76C 2XWBB 4JBMA 1L1OC 1WTVA 1SNCA 4K0KL 3K6OA 4A4IA 1EWIA 5ELCA 4RCNA 4GN4B 4A3CG 4R4CA 3RZOH 1ENFA 2ZXOA 4AYBB 3CC7A 2RF4A 3M7NA 4IUNA 2N8NA 4RKBA 1BNZA 4R4QA 4K5WA 1F2LA 3K8AA 4C3IH 4M1UB 5GROA 2KCMA 4LF8L 2VUMB 1JJGA 4DR2Q 1TKWB 3HOVB 5FLMG 2DNCA 5K5PA 3VR3A 1Y69U 2MNAA 2PI2A 1LT4D 1IW7D 3NK9A 4LK1C 4ZQ3A 4HIOA 5IP9H 3EQLC 4GS3A 4ULLA 4PMCA 5CV7A 1I94Q 2E2IB 2ICIA 2K5HA 3EFXD 2B2TA 4OWWB 2RQXA 2EOTA 2A68D 3R2TA 4A3FG 4KKUA 3TP6A 3EJIA 4A3GH 5M3MB 2FJ2A 4IZ8A 3HOZH 3J81i 3NTHA 4KD3A 4AH6A 1N36L 1VQLA 2X6LA 4DR2L 1SMYC 1HNZQ 4BA1I 4FDBA 3HOWB 2F0KA 4QIWB 1PLFA 1AEXA 3UDGA 2A69C 4JC0A 2OQ0A 2RSNA 4DR6Q 2J0TD 4JI6L 1K83B 1CFMA 3LX0A 4YCVA 1S5FD 3S16H 3T53B 1I94L 2D5DA 3J80E 1G2TA 5IGDA 4GKJQ 1EL0A 4BBSH 2K14A 4QJFA 1TWGH 1QVFA 1STYA 1HTLD 1YEZA 4CDEC 5CV6A 1STNA 1Q82C 3HOYH 5EKIA 4GZYC 3HFZB 4A3MG 4C1NK 4R4TA 5E3FA 2OWOA 4K8IA 4LW1A 1VQ8A 3WDNA 5D14A 4XT1B 1TS3A 4DV2L 5JJLA 1Y1WH 1WI5A 5IP9G 4DAMA 1HFGA 1S72A 2DY8A 4RG1A 1I4PA 1GUOA 2E5LL 3HEJA 1MJCA 5KYIA 2F3IA 4M8AA 4NW2A 4B3TQ 5DEHA 1II3A 4H13C 2HCCA 3ULPA 2OXPA 1KLUD 2NVYB 4X65L 4A3GG 1Q46A 5KIXA 2Z0SA 4X64Q 1TY0A 2CFMA 2UUBL 3HOZG 1NNXA 2WB1G 3D6CA 3GTPH 1UEBA 2PMZE 2O5IC 2OT2A 4HIDA 3MEHA 1BR9A 3EN2A 4A3JG 3J81c 1J9OA 5IYCH 1MJEA 2EXDA 3R2IA 1QG7A 3H3VH 4DUYL 4IPCA 2IHEA 2R61A 4BY1G 5GAHC 3CF5A 2ZXPA 2VUMH 1G2SA 4Y7NH 5GAGC 4DAYA 4DK3C 3SVMA 4L5TA 4BBSG 1ASYA 1NUCA 1QNKA 2WP8J 1XXGA 1W3SA 1DZ1A 2Z9HA 3S2DH 3VYUA 3PO2B 4LF6Q 4DA2A 4KI0A 1PXUA 2Y0SG 3LWEA 2VXWA 5JEAG 1HA5A 2KEDA 2BA1A 3TSSA 5FO7B 3FMCA 2ZXRA 2CHBD 2ASBA 3AFQA 2R92B 3ERSX 3A5UA 1LTGD 1Y1WG 3OIQA 4ZLTF 4EVOA 1Q12A 3J7A5 4IUUA 1R9TH 4I65A 1VQPA 2B29A 3ZJYC 4CDCC 3HOWH 4FF4A 5IT9L 1KNAA 4DV7L 4DAPA 3FKIG 5C0XH 1K83H 3KDFA 3URYA 2UUCQ 3MXPA 3OTOQ 4DAYB 1DOLA 2PYKA 1VQ4A 3M4OB 3BZDB 1PA6A 1IYUA 3GO5A 2F0PA 1GJXA 3NP8A 3NSWA 4OONA 1XPUA 4LJZC 1O7LA 5IGEA 4A3BH 2I46A 2C9OA 1UUPA 4IUPA 1HR0W 4A3DB 1ZYRD 2VQEQ 1NY4A 4LUZA 4KKSA 3J7AF 2EDGA 2Q8RE 5EJWA 4DV4L 2YU9B 4E6IA 1Q8KA 4A3LH 2KHJA 3CRKC 1BO0A 2UUCL 3OTOL 3CCQA 1TWHB 3WWVA 3A7LA 4PZ8A 1JJ2A 1JE4A 1HQMC 1SLJA 3K5LA 1AP0A 4UHVA 4KKTA 3FPPA 3KDFB 2K75A 4IJLA 3SEBA 3SHLA 5IGGA 1GO3E 1IBML 1CKNB 4TVAB 4A93B 2B3GA 2VQEL 2EPBA 3RLOA 3OSOA 3V05A 1A0IA 4HJAA 1T9HA 4DV5L 5CBAE 3OW7A 1BCPD 3JAML 5C0XG 1A62A 4IO9A 4FF1A 3H0GH 1YHQA 3KLRA 1X6OA 1YBYA 4K8JA 3R93A 1QZHA 3M4PA 1VQIA 3A55A 1M90C 1B1ZA 1PVOA 3TP8A 3K57A 2F0LA 1F9RA 1KXLA 4X62Q 3H91A 2MGSA 1ZXTA 5DM73 4A3BG 5J39A 4CHTB 4Q5VA 1YIJA 3J7YW 2JA7B 3E9HA 3KLSA 2KENA 3SDZA 2RHQB 3SGIA 4XXEA 1LABA 1LM0A 1E3PA 5C44H 4A3IH 4B3MQ 4WFN3 1Y8PB 4HMIA 1SNQA 4OX9Q 5M3FB 2HHHQ 1DD2A 1PRTB 3HOXG 1A2TA 1K0SA 2JA8G 1EZ8A 1VQ5A 1K3BC 3CCUA 3W2DA 5KRUA 2N49A 4RHRA 3OMCA 1LTBD 3BU2A 4L5SA 3PIOA 4X62L 3NQTA 2ALYB 1YITA 2F0IA 5GAEC 4HMJA 2ZTDA 4NKLA 3I55A 2I5HA 1I4RA 2CW0D 5EBCA 4R4IA 1H9RA 5NUCA 3T16A 3S15B 4KN7C 3S24A 2F0VA 3TP7A 3KBXA 3MWYW 4P75A 1JE5A 3I4LA 3H09A 2PZUA 1HUMA 3TREA 3MZ5A 4UP7A 2B2UA 2E2JB 4OIJA 2HHHL 1U5KA 2BH8A 5LHY1 3H0GG 3BYTB 3I91A 2RDGA 2LS01 4H7BA 3OIPA 1E24A 4K5XA 5JJKA 1I4GA 3Q22A 2YU9H 3I4MH 2K5QA 3NWTA 3OWFA 4IPDA 4QMGA 1AZQA 5KNBA 2WKCA 3C1FA 1PH1A 3K5OA 4F8MA 2K5VA 1JCKB 1STHA 1M8AA 4U68A 1I3QB 4S3SA 1PH3A 4RCOA 2NB0A 5C44G 4A3IG 1J6QA 5JAVA 1VQKA 1EZ6A 3CQZH 4GNXA 5T1IA 2QA4A 2D0OA 5C3EG 2ICEC 3PUZA 5ISRA 2JEBI 1EY8A 3NXWA 1EYDA 2R93B 1QILA 4LF4L 5I2YA 3PGZA 3KJOA 2B63B 1E0BA 1TWCH 3D31A 1NMFA 2BE5D 2K5DA 3G48A 2WINB 1MGSA 2F4VQ 2J7ZA 3A8IE 3AFPA 4MNOA 1E2VA 1XYIA 1JB7A 1DONA 2VY3A 2X6GA 4DN4M 3JAMc 2JJQA 1C7YA 3S14H 1SJHD 2ZM6Q 1D7QA 1RTNA 2D2CC 5I6YA 3I70A 5DNFA 1MHWC 1TXYA 3BG3A 4DR1Q 1NJIC 5JJIA 1JORA 2A6EC 1MKHA 1CM9A 4GNXB 1VQDA 3G6EA 3GP7A 1Z7TA 1V8QA 3RZDB 1NAPA 4IPHA 5IT9E 5C4XB 5EKKA 3I4MG 4IFDI 4IURA 2AQ3B 4EGVA 3DXJC 2NN6H 5KNDA 1Z9FA 2OTJA 1FNWA 2ZM6L 4UP9A 3QJYA 4HIMA 1F2ZA 3O13A 1IKMA 4P2CB 3BVGA 4DR4L 3CCMA 1M1KC 3W3AA 2I07B 4PMBA 3QB3A 4J8QA 4N8FA 1HXYD 1J5EQ 1V1QA 4JCVE 2OQKA 3E5SA 3I4OA 4ZKBB 2XIWA 4MN3A 3K0XA 1ET9A 3A74A 4DFAA 3DLLA 4X66L 2MO0A 4LAAA 1K8GA 3TMEA 1X3FA 1AE2A 2DNEA 4LFCQ 2L15A 1TT2A 4U673 2K05A 5DM63 3NEMA 1C9OA 1IYJB 2AWNA 2ZJPA 2KJXA 1B2TA 4JBJA 2PW7A 4A75A 1GHKA 1NCVA 2NZ1D 1IL8A 1EEID 4LMQD 1YJWA 4A3FB 2UXDQ 2NVXB 5C6AA 1I3QH 1VQHA 1J5EL 1BBUA 5C0XJ 4UP8A 3TDQA 2UXBQ 1PTOH 4LF9L 3TS2A 5FO8B 1SNOA 3HS0C 4ODGA 4IN3A 1HZ9A 1U4LA 3ULJA 1WTQA 3T1YL 2NBFA 1ENAA 3Q6SA 1N32L 4IUQA 1PTOD 1IXRA 5FLXE 2EZVA 4FVMA 5E4XA 5IYBG 1ET6A 2UXDL 2F0WA 4BS9A 2IT1A 3SK5A 4C3IB 1JMCA 4K2LA 2AKWB 2BDOA 3GTJH 4YY3Q 2EYMA 3MXGA 4CKBA 1MIUA 1D2BA 3IKJA 5J3BA 1N34Q 4H44C 3KF8A 3E3XA 4IALA 3UDIA 3PO3H 3A0JA 1HNXQ 3EIVA 1YNJD 1QOHA 3KLWA 1KDBA 2PQAA 2QW7A 1A15A 1KHIA 1X3PA 1KAWA 1Y8NB 3J80i 1C0AA 3CPFA 2YTVA 4DK0A 2A1AA 1QCBD 2G5DA 2F0DA 1D5ZC 2CVRA 3AB9A 3CP0A 4A3GB 1VQGA 3F8TA 4HSVA 4A3CH 5J22A 3CCRA 3HOZB 3G4SA 4LFBL 1RHPA 2WB1B 1BBXC 1LT6D 2A74C 4DV6Q 1RF2D 2WACA 4A3JB 3LGJA 1HZAA 1PMRA 2EYHA 1SE2A 4L5QA 1PZKD 5CORA 3UDXA 2EYPA 1HNXL 2CWAA 2IJ0A 3CCJA 3FRPB 3KF8B 5FLMH 2K1BA 2K6AA 3VYSA 4BBSB 4K0KQ 4B3SL 3T56B 1KL9A 2N55A 3GQBA 2K33A 2X69A 5G3LD 2PQAB 1HHVA 2HDLA 5ELOA 4A3KH 2Y0SB 1VQMA 1C4QA 4RGNA 1KTKA 3MXUA 4JI1L 3U58A 4EX5A 4DK6C 1ZEQX 3HKZE 3E6ZX 4DV3L 1KDAA 1SNDA 3CCVA 3S1RH 1U0LA 2E2HH 4P71A 4A3FH 2Z6BA 4GOPA 2LKVA 1Y1WB 4B08A 3S2HH 2R6GA 2JA6G 1Q81C 1MSHA 3GTQH 1VQJA 2L12A 4YHHL 3BZKA 1STAA 3MVVA 1QJOA 4X3KA 1CUKA 4QCLA 4F88A 5EPLA 1K8AC 2ID0A 1SRUA 2DUDA 3M85A 1S4ZA 1MBYA 3PIO3 3OWEB 3ZYYX 1K8MA 3GTPB 3J81L 2VB2X 4FP5D 3TP5A 4R8IA 1XJVA 2VZAA 3VR5A 1LO5D 3U4ZA 4JOIA 3C3LA 3PUXA 4MZ9A 1IBLL 4JBKA 4A3MH 1YNNC 3AYHB 1SMYD 1N36Q 4Y7NB 2HDMA 1ICWA 4LUOA 4FNFA 4G7HC 4GOPB 2A69D 4AIMA 4BBRH 3KYHC 3S1MH 1A8VA 1GKHA 1NTGA 3W1BA 3S2DB 4JI6Q 1WCMG 3ITPA 3DUZA 1PYWD 4HCSA 1Q86C 4KJOA 4L5RC 4A3KG 4DXFA 1AH9A 5DAUA 3NE5B 4PMWA 1FJGQ 1O7YA 5D65A 2M2LA 2KOLA 3PIPA 1X3GA 4GLVB 5I6WA 2RKSA 1R9TB 1EY0A 1OXUA 2DN8A 3L9AX 1HNWL 5IODA 1JOQA 5M5XH 3IAYA 3E0EA 4A3JH 4DV2Q 1XTDA 3ER0A 3F2BA 3AQQA 3HRZC 4YCWA 4BY1H 1KRSA 4GKKL 5J1ZA 4YWLA 1RCVD 2F0JA 1DYQA 3PUYA 2E5LQ 1IYVA 3GTKH 2QCPX 4XQNA 1FJGL 3A5ZB 4C3JG 3RN2A 1O78A 1TWAH 4DGZA 4LFAQ 2UUAL 4A3BB 1U9RA 2Z6KA 1SFOH 4X65Q 2VNUD 4UY8C 4A76A 2Q8TA 3F1ZA 2UUBQ 5TSSA 3SR1A 4IOAA 5ELNA 4C3HH 5JEAH 4JI5Q 1GXDC 2K4KA 4BBRG 3F2DA 2SNSA 4RH6A 5IIFA 1YJNA 4DUYQ 2WAQG 3VR4A 3DHQA 2A6HC 4IJHA 2C35B 4GLXA 2K03A 1JWSD 3UE0A 5A2QE 1PH6A 2KHSA 4AQYL 4KK7A 2YTXA 1ESFA 1CT1D 4JI7L 4LFAL 2IY5B 1EIGA 1VCIA 3FKIH 3SXHA 1BCPB 3GTLB 1LV9A 2G9DA 4DXGA 3H15A 3NBHA 1VQFA 2IX1A 4JI5L 5C5LA 1B70B 1EQVA 4MTKA 2CQOA 1EQTA 2KA7A 4OWXB 1B3AA 1QWYA 3BDOA 3ULLA 4HIKA 2WAQE 3H0GB 2K5WA 5CYUA 1O80A 2K04A 4R4OA 2AHOB 2L5TA 4CBVA 4BXXH 3HG9A 4DV7Q 2CH4W 5DLQE 5JJZA 1T5XD 5C3XA 3JC66 2OCEA 1KAAA 4IFDH 1LYLA 4G7ZC 4IUVA 4A3EG 4C3HG 1C8CA 4JV5Q 3X3MA 5K36H 1EU4A 2RA4A 4XQQA 2BOSA 5KYLA 5C44B 4A3IB 4N9PA 4PG3A 4TKOB 1VQ6A 3CCEA 2Q2TA 3DMUA 3I8ZA 4QB4A 3NBHB 3D0FA 2EYOA 3C2PA 1H9MA 2JSOA 4NPSA 4DV4Q 3V96A 4ZRZA 3NENA 3C46A 2HUGA 3FVQA 1VQNA 1BBWA 3R8BA 4JI0L 4KTAA 2EY2A 1B7YB 4JV5L 1CKNA 3N52A 5CMDA 1E1OA 2A73B 2NVTB 4APVA 3X3NA 5I4DA 4RGTA 3TN2A 2QEXA 2UU9Q 2KHIA 3M4YA 1PRTF 2QDLA 1AW7A 1PDQA 1IBMQ 2F3VA 1W2BA 1XNQL 1LTID 1WOCA 2FHTA 1CZGA 3F2CA 5BN3A 4BXXG 3QWNA 2B2VA 5IP7H 4DV5Q 4LF7L 1CSPA 1A3VA 2I5MX 5EKLA 3I4MB 5M9OA 2BCOA 3HOXH
chains in the Genus database with same CATH topology
4GOPC 4KHZA 2LSSA 4AQYQ 2F4VQ 2NN6I 2JA8H 4IFDG 1K3RA 4JI7Q 3AFPA 1X55A 4MNOA 3S1QH 4OO1G 4RMFA 1JB7A 5K36G 3CC2A 2VY3A 1EUJA 3JAMc 3RZDH 2JJQA 2YYZA 4POFA 1YJ9A 1WJJA 1PH4A 3L2PA 1C7YA 2BH2A 4A3EH 5C4XH 2CCZA 3S14H 4O0AA 2N78A 3RNUA 2ZM6Q 2UU9L 1D7QA 3GTLH 1EQRA 2WFWA 1HJPA 1PHJA 4GLAC 1Z47A 4YY3L 4PZ6A 3UDFA 1TXYA 1VQCA 1XNRQ 1V43A 4AYBE 1SR3A 4DR1Q 1NJIC 2VQFL 5JJIA 1MKHA 1N34L 1YHBA 4GNXB 1NE3A 1VQDA 3G6EA 2JA5G 1JJCB 1QUQB 1UE5A 1HZCA 1KC8C 1RIPA 2E8GA 1X56A 4JOIC 4IPHA 2R93G 1HNZL 3I4MG 4DR7Q 2B63G 3IRBA 4LWCA 4IFDI 1S3OA 4JI4Q 5M3MG 3M4QA 4OO1I 1Z9FA 2OTJA 5IE8A 2HQLA 4DR6L 1CSQA 1S40A 1Y1VG 3HKSA 2ZTCA 3K7AH 1QVCA 1YZ6A 2AMCB 2ZM6L 4UP9A 1YHAA 3PF5A 4HIMA 5M5YH 1Q1BA 4GKJL 1VQAA 2ZJQA 1OXSC 1EOVA 1UE7A 2IX0A 1Y14B 2NZOA 1HR0Q 4DR4L 3CCMA 4X6AH 5IP7G 1M1KC 4OXPA 1XNRL 2R7ZH 1SN8A 2EQSA 4P72A 1VQOA 5C3EH 4POGA 4GN5A 4DV6L 2VS1A 1J5EQ 1GM5A 1V1QA 3DM3A 4JCVE 3T1HL 2OQKA 4QY7A 2ZTEA 3I4OA 1KRTA 2NVXH 3VDYA 3HOZG 3PO3G 3K0XA 1YVCA 3K7UC 3Q8DA 4JI4L 1K73C 3A74A 5LMNW 4JI0Q 1FL0A 4LF8Q 1YI2A 3DLLA 4X66L 2MO0A 2KBNA 1K8GA 4JBMA 1L1OC 1X3FA 1AE2A 4K0KL 4LFCQ 4QIWE 2L15A 1IL2A 4A4IA 1EWIA 2RHSB 3NEMA 2I0QA 3HOVH 1C9OA 1IYJB 2AWNA 4GN4B 2ZJPA 1EQQA 4JBJA 3PSIA 4A3CG 4R4CA 4A75A 3RZOH 2JA9A 4B3TL 4NXMQ 2NVTH 2UXDQ 1YJWA 1XNQQ 1CKOA 2RF4A 3CC7A 4DR3Q 3M7NA 2UXCL 5AJ3Q 1QZGA 2N8NA 1I3QH 1VQHA 2PI2E 1J5EL 1BBUA 4X64L 2A19A 3HOYG 5IY0A 4R4QA 5C0XJ 1IBKQ 2WB1E 4LF7Q 1OXVA 4LF4Q 3K8AA 4UP8A 2E2IH 4C3IH 2JA5H 4JYAQ 2UXBQ 5GADC 4LF9L 3TS2A 5GROA 2I5LX 1SE8A 2KCMA 1HZ9A 4LF8L 1JJGA 3ULJA 4DV0Q 3I7FA 4DR5L 4DR2Q 2ES2A 5FLMG 2FXQA 2HIVA 4HJ9A 2OTLA 5M3MH 1G51A 2D0PA 3T1YL 2MNAA 4DUZL 3FP9A 1PH9A 2JQOA 2PI2A 1Y1VH 1B8AA 3NELA 4ALPA 4HIOA 1VS0A 5IP9H 1N32L 1IXRA 4GS3A 3W5OA 4R1JA 5IYBG 4NXML 2UXDL 4DR3L 1G291 2IT1A 1I94Q 5AJ3L 1JMCA 2K5HA 4XTCS 4O2DA 2K5NA 2AKWB 4JG2A 3GTJH 4YY3Q 4LF6L 4OWWB 4TQUS 1IBKL 1MIUA 2F52A 2Y0SE 2A8VA 4AYBG 4A3FG 3S1NH 2VQFQ 5J3BA 1N34Q 4JYAL 1IZ6A 4A3GH 3PO2G 1L0WA 3HOZH 3I4NG 1FVIA 2MFIA 3UDIA 3J81i 1VQLA 4AH6A 4DV0L 5IYCG 3I56A 4DR2L 1N36L 5HGQA 1HNZQ 1L2FA 3PO3H 3A0JA 1HNXQ 3EIVA 4BA1I 4FDBA 5JEAJ 1L1OA 3KLWA 3UDGA 2PQAA 4JC0A 2VUMG 2OQ0A 4BY7H 4DR6Q 1KHIA 1YNXA 4JI6L 3HOVG 2AWOA 1KAWA 3J80i 1E1TA 3CPFA 2YTVA 1EIYB 4KHPQ 4YCVA 4BA2I 1C0AA 2VW9A 3S16H 1RL2A 1UE1A 1I94L 2A1AA 4GKJQ 2GVBA 2JEAI 3CP0A 1GVPA 1VQGA 3F8TA 4DR4Q 4A3CH 3CCRA 4BBSH 1UWVA 1OXTA 2K14A 4LFBL 3G4SA 4QJFA 1WYDA 1TWGH 2VL6A 1QVFA 1YEZA 4DPGA 2D62A 4DV6Q 1D8LA 2K50A 1XMOQ 1Q82C 3HOYH 3HFZB 3T1HQ 3LGJA 4A3MG 3UE1A 1HZAA 3BJUA 4L5QA 4R4TA 3UDXA 1HNXL 2CWAA 2NVYH 3CCJA 2OWOA 4LW1A 1VQ8A 1JT8A 1OXXK 3KF8B 4X66Q 4DV2L 5JJLA 5FLMH 1Y1WH 1WI5A 5IP9G 4KHPL 2K52A 4DAMA 2R7DA 1S72A 4LF5Q 3CD6A 4K0KQ 1XPRA 3HOWG 4B3SL 4RG1A 1KL9A 4A3DG 1L1OB 4XIGS 2E5LL 2PQAB 3J7ZC 1MJCA 4P73A 5IYBH 5ELOA 3W1GA 2F3IA 1PH5A 4B3TQ 4A3KH 1VQMA 1K0RA 3ULPA 4JI1L 3U58A 2UXCQ 4EX5A 4DK6C 3HKZE 4X65L 4A3GG 3I2ZA 1Q46A 1GD7A 2Z0SA 4KLKA 4X64Q 3CCVA 4DV3L 2CFMA 2H5XA 1XMOL 1OTCA 3K80C 2UUBL 3GTGH 3S1RH 1U0LA 5IYDG 2E2HH 2WB1G 4P71A 4A3FH 2EIFA 1P16A 4GOPA 1SMXA 1LUZA 4IFDJ 1TWFH 3GTPH 3S2HH 3PO2H 1UEBA 2PMZE 4LF9Q 2R6GA 3CMAA 3EN2A 4HIDA 4A3JG 3J81c 3BZCA 1Q81C 2JA6G 3I4NH 3U50C 5IYCH 1MJEA 2EXDA 4BY7G 4DR5Q 5LMUQ 3GTQH 3H3VH 4DUYL 1VQJA 4IPCA 4YHHL 3BZKA 4LF5L 3PF4A 2IHEA 4BY1G 5GAHC 3T1YQ 1CUKA 3CF5A 5BR8L 4DUZQ 2ID0A 1K8AC 2R92H 2VUMH 4A3LG 1O7IA 1SRUA 4Y7NH 1E22A 2DUDA 4J15A 5GAGC 4DK3C 3M85A 1N32Q 4GN3B 4L5TA 4BBSG 2CKZB 1ASYA 2WP8J 1VQ9A 3M3YH 1W3SA 3S2DH 1VQ7A 1VQBA 3JAMi 4LF6Q 4B3RL 2Z6KC 4KI0A 2Y0SG 2VZAA 5JEAG 5FJ8H 1XJVA 3U4ZA 2BA1A 4JI2Q 4JOIA 3PUWA 5IT9c 3TS0A 3PUXA 4MZ9A 1WFQA 2BA0A 1IBLL 4A3MH 4JBKA 2V1CC 1NMGA 2ASBA 3AFQA 2LXJA 2YTYA 3AYHB 3ERSX 3M9BA 3A5UA 5LMUL 4JI3L 1N36Q 3M4OH 4B3ML 4LUOA 3STBC 2MO1A 1Y1WG 1HZBA 1Q12A 2Q2HA 3J7A5 4GOPB 1R9TH 4AIMA 4BBRH 3CAMA 2LXKA 3RR5A 4HJ7A 1VQPA 1CKMA 1EFWA 3KYHC 3S1MH 1A8VA 1GKHA 1NTGA 2B29A 3W1BA 1QVGA 3ZJYC 4OX9L 4JI6Q 1WCMG 3L0OA 4WJ4A 3U4VA 1I5FA 3HOWH 1Q86C 4L5RC 4A3KG 3G71A 4A3DH 2ATWA 4DV7L 3RN5A 1AH9A 3FKIG 1K83H 3KDFA 4PMWA 2UUCQ 1FJGQ 3OTOQ 2XGTA 1EYGA 4LFBQ 4DAYB 5EAYA 1VQ4A 1PH8A 4DV1L 4UPAA 4JI2L 3PIPA 2PNHA 1X3GA 4GLVB 1PA6A 3GO5A 1N33L 3KF6A 1TWHH 3PCOB 5IYDH 4OONA 3J81j 1XPUA 1OXUA 5LMNQ 1HNWL 1LTLA 5M5XH 4A3BH 3E0EA 4PZ7A 1XPOA 4A3JH 2JA6H 3CC4A 1X54A 3MXNB 1HR0W 1VQEA 2R92G 1A63A 2VQEQ 1NY4A 4LUZA 1XTDA 3ER0A 4ME3A 4DV2Q 1N9WA 1UE6A 3F2BA 3AQQA 2ZJRA 4DV4L 4YCWA 4BY1H 5H1SE 3HOUG 1KRSA 4GKKL 4B3SQ 2IHFA 4YWLA 3PV0A 5M5WH 4A93H 1Q8KA 4A3LH 3PUYA 2JE6I 2KHJA 3RLNA 4DKAC 2HIXA 2E5LQ 3GTKH 2UUCL 1FJGL 3KFUA 3OTOL 1Q1EA 3A5ZB 1ASZA 2NVQH 4NXNL 3CCQA 3WWVA 3RN2A 3L7ZC 4IOCA 1TWAH 4PZ8A 4LFAQ 4JI8Q 1JJ2A 3RLFA 5FJ8G 2UUAL 1P8LA 4JI1Q 2Z6KA 1SLJA 4WJ3M 1SFOH 4X65Q 3HKZG 2VNUD 1AE3A 4DV3Q 4A76A 4UY8C 3F1ZA 1KD1C 2UUBQ 1BKBA 3KDFB 4IOAA 4Y52H 5ELNA 2CWPA 4C3HH 5LMNL 2K75A 4IJLA 3CXCA 4JI5Q 3K81C 2XTIA 1GO3E 5C4JH 1IBML 2K4KA 1X9NA 1CKNB 4TVAB 3H3VI 4BBRG 1H95A 2B3GA 3F2DA 2VQEL 3RLOA 3KF6B 4HJ8A 1A0IA 4DUYQ 4HJAA 4YHHQ 1YJNA 1T9HA 4DV5L 2WAQG 4IJHA 5FLXc 2JA7H 2C35B 4GLXA 3TEHB 5BR8Q 4EQ5A 4B3RQ 1EIFA 3UE0A 1WCMH 5C0XG 2Q2UA 1A62A 4IO9A 1PH6A 3OYYA 3H0GH 5HY6A 4AQYL 4MTNA 1YHQA 2YTXA 2F4VL 1X6OA 4JI8L 4JI7L 1YBYA 4LFAL 2IY5B 3PUVA 1QZHA 1VCIA 3FKIH 3M4PA 1VQIA 5M3FH 1M90C 1PVOA 5GQOA 1FGUA 2RCNA 1KXLA 4X62Q 3H15A 1PFSA 4HJ5A 1KQSA 1VQFA 3CCLA 2IX1A 4A3BG 1YIJA 2R7FA 4JI5L 1B70B 1X3EA 1PH7A 2Q2IA 1IBLQ 4YCUA 3E9HA 1PH2A 2KENA 2CQOA 3AEVA 2RHQB 4YWKA 4YWMA 4OWXB 3SGIA 3STBD 1LM0A 4JI3Q 1E3PA 3ULLA 5C44H 4GNXC 2WAQE 3CCSA 4HIKA 4A3IH 4B3MQ 4DR1L 1Q7YC 4A93G 3S15H 4R4OA 4OX9Q 2AHOB 4BXXH 3J80c 2HHHQ 4JBWA 3HOXG 3HOUH 5C0XI 2JA8G 4QGUA 4QL5A 1KIXA 1VQ5A 4DR7L 4NB3A 3CCUA 1I50H 4DV7Q 4H02A 3MEFA 4QQBX 5DLQE 2E2JH 4LNQA 2N49A 2QGQA 3OW2A 3JC66 4C3JH 2OCEA 1G6PA 1LYLA 3BU2A 4L5SA 3PIOA 4X62L 4A3EG 4JV5Q 5C4XG 1SROA 3GDEA 2ALYB 4DV1Q 1YITA 1XMQQ 5GAEC 3HOXH 1BVSA 2ZTDA 3I55A 2I5HA 4PG3A 2MQHA 1N33Q 1VQ6A 4R4IA 3CCEA 5IWAQ 3CW2C 3S24A 2Q2TA 1HR0L 1HNWQ 3E9IA 3KJPA 1DGSA 4P75A 1JE5A 3NBHB 3TREA 2JA7G 3D0FA 2KCTA 2YV5A 4UP7A 4DNIA 2NZHA 1NBWA 2JK8A 4IPGA 2HHHL 1U5KA 2BH8A 5E7NA 1PV4A 4NPSA 4DV4Q 4C2MH 1X65A 3CPWA 3TRZA 3H0GG 3KOJA 4GKKQ 3NENA 3GTOH 1HH2P 2GVAA 5M3FG 3B6YA 1VQNA 1BBWA 2NN6G 1E24A 4JI0L 5JJKA 1V9PA 3GD7A 4NXNQ 2R93H 2YU9H 1B7YB 4JV5L 3I4MH 2B63H 4IPDA 2N3SA 2UUAQ 1XMQL 3ICEA 1CKNA 2DGYA 1PH1A 4LFCL 1E1OA 3TQYA 2K5VA 4APVA 1N8RC 5IWAL 4P74A 2QEXA 1I6HH 1PH3A 2HT1A 1E7ZA 5C44G 4A3IG 4OWTB 2UU9Q 3S17H 1J6QA 2KHIA 1VQKA 1IBMQ 3FHWA 3CQZH 4GNXA 2GN5A 1W2BA 2QA4A 1XNQL 2R7ZG 1QUQA 2D0OA 5C3EG 1WOCA 1PYBA 3F2CA 1PYSB 4BXXG 1K9MC 3PUZA 2JEBI 5IP7H 4LUVA 4DV5Q 4LF7L 1CSPA 4LF4L 3KJOA 3PGZA 2I5MX 3EBEA 2UXBL 3GTMH 1TWCH 3CMEA 3D31A 1NMFA 3G48A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GOP C;  4KHZ A;  2LSS A;  4AQY Q;  2F4V Q;  2NN6 I;  2JA8 H;  4IFD G;  1K3R A;  4JI7 Q;  3AFP A;  1X55 A;  4MNO A;  3S1Q H;  4OO1 G;  4RMF A;  1JB7 A;  5K36 G;  3CC2 A;  2VY3 A;  1EUJ A;  3JAM c;  3RZD H;  2JJQ A;  2YYZ A;  4POF A;  1YJ9 A;  1WJJ A;  1PH4 A;  3L2P A;  1C7Y A;  2BH2 A;  4A3E H;  5C4X H;  2CCZ A;  3S14 H;  4O0A A;  2N78 A;  3RNU A;  2ZM6 Q;  2UU9 L;  1D7Q A;  3GTL H;  1EQR A;  2WFW A;  1HJP A;  1PHJ A;  4GLA C;  1Z47 A;  4YY3 L;  4PZ6 A;  3UDF A;  1TXY A;  1VQC A;  1XNR Q;  1V43 A;  4AYB E;  1SR3 A;  4DR1 Q;  1NJI C;  2VQF L;  5JJI A;  1MKH A;  1N34 L;  1YHB A;  4GNX B;  1NE3 A;  1VQD A;  3G6E A;  2JA5 G;  1JJC B;  1QUQ B;  1UE5 A;  1HZC A;  1KC8 C;  1RIP A;  2E8G A;  1X56 A;  4JOI C;  4IPH A;  2R93 G;  1HNZ L;  3I4M G;  4DR7 Q;  2B63 G;  3IRB A;  4LWC A;  4IFD I;  1S3O A;  4JI4 Q;  5M3M G;  3M4Q A;  4OO1 I;  1Z9F A;  2OTJ A;  5IE8 A;  2HQL A;  4DR6 L;  1CSQ A;  1S40 A;  1Y1V G;  3HKS A;  2ZTC A;  3K7A H;  1QVC A;  1YZ6 A;  2AMC B;  2ZM6 L;  4UP9 A;  1YHA A;  3PF5 A;  4HIM A;  5M5Y H;  1Q1B A;  4GKJ L;  1VQA A;  2ZJQ A;  1OXS C;  1EOV A;  1UE7 A;  2IX0 A;  1Y14 B;  2NZO A;  1HR0 Q;  4DR4 L;  3CCM A;  4X6A H;  5IP7 G;  1M1K C;  4OXP A;  1XNR L;  2R7Z H;  1SN8 A;  2EQS A;  4P72 A;  1VQO A;  5C3E H;  4POG A;  4GN5 A;  4DV6 L;  2VS1 A;  1J5E Q;  1GM5 A;  1V1Q A;  3DM3 A;  4JCV E;  3T1H L;  2OQK A;  4QY7 A;  2ZTE A;  3I4O A;  1KRT A;  2NVX H;  3VDY A;  3HOZ G;  3PO3 G;  3K0X A;  1YVC A;  3K7U C;  3Q8D A;  4JI4 L;  1K73 C;  3A74 A;  5LMN W;  4JI0 Q;  1FL0 A;  4LF8 Q;  1YI2 A;  3DLL A;  4X66 L;  2MO0 A;  2KBN A;  1K8G A;  4JBM A;  1L1O C;  1X3F A;  1AE2 A;  4K0K L;  4LFC Q;  4QIW E;  2L15 A;  1IL2 A;  4A4I A;  1EWI A;  2RHS B;  3NEM A;  2I0Q A;  3HOV H;  1C9O A;  1IYJ B;  2AWN A;  4GN4 B;  2ZJP A;  1EQQ A;  4JBJ A;  3PSI A;  4A3C G;  4R4C A;  4A75 A;  3RZO H;  2JA9 A;  4B3T L;  4NXM Q;  2NVT H;  2UXD Q;  1YJW A;  1XNQ Q;  1CKO A;  2RF4 A;  3CC7 A;  4DR3 Q;  3M7N A;  2UXC L;  5AJ3 Q;  1QZG A;  2N8N A;  1I3Q H;  1VQH A;  2PI2 E;  1J5E L;  1BBU A;  4X64 L;  2A19 A;  3HOY G;  5IY0 A;  4R4Q A;  5C0X J;  1IBK Q;  2WB1 E;  4LF7 Q;  1OXV A;  4LF4 Q;  3K8A A;  4UP8 A;  2E2I H;  4C3I H;  2JA5 H;  4JYA Q;  2UXB Q;  5GAD C;  4LF9 L;  3TS2 A;  5GRO A;  2I5L X;  1SE8 A;  2KCM A;  1HZ9 A;  4LF8 L;  1JJG A;  3ULJ A;  4DV0 Q;  3I7F A;  4DR5 L;  4DR2 Q;  2ES2 A;  5FLM G;  2FXQ A;  2HIV A;  4HJ9 A;  2OTL A;  5M3M H;  1G51 A;  2D0P A;  3T1Y L;  2MNA A;  4DUZ L;  3FP9 A;  1PH9 A;  2JQO A;  2PI2 A;  1Y1V H;  1B8A A;  3NEL A;  4ALP A;  4HIO A;  1VS0 A;  5IP9 H;  1N32 L;  1IXR A;  4GS3 A;  3W5O A;  4R1J A;  5IYB G;  4NXM L;  2UXD L;  4DR3 L;  1G29 1;  2IT1 A;  1I94 Q;  5AJ3 L;  1JMC A;  2K5H A;  4XTC S;  4O2D A;  2K5N A;  2AKW B;  4JG2 A;  3GTJ H;  4YY3 Q;  4LF6 L;  4OWW B;  4TQU S;  1IBK L;  1MIU A;  2F52 A;  2Y0S E;  2A8V A;  4AYB G;  4A3F G;  3S1N H;  2VQF Q;  5J3B A;  1N34 Q;  4JYA L;  1IZ6 A;  4A3G H;  3PO2 G;  1L0W A;  3HOZ H;  3I4N G;  1FVI A;  2MFI A;  3UDI A;  3J81 i;  1VQL A;  4AH6 A;  4DV0 L;  5IYC G;  3I56 A;  4DR2 L;  1N36 L;  5HGQ A;  1HNZ Q;  1L2F A;  3PO3 H;  3A0J A;  1HNX Q;  3EIV A;  4BA1 I;  4FDB A;  5JEA J;  1L1O A;  3KLW A;  3UDG A;  2PQA A;  4JC0 A;  2VUM G;  2OQ0 A;  4BY7 H;  4DR6 Q;  1KHI A;  1YNX A;  4JI6 L;  3HOV G;  2AWO A;  1KAW A;  3J80 i;  1E1T A;  3CPF A;  2YTV A;  1EIY B;  4KHP Q;  4YCV A;  4BA2 I;  1C0A A;  2VW9 A;  3S16 H;  1RL2 A;  1UE1 A;  1I94 L;  2A1A A;  4GKJ Q;  2GVB A;  2JEA I;  3CP0 A;  1GVP A;  1VQG A;  3F8T A;  4DR4 Q;  4A3C H;  3CCR A;  4BBS H;  1UWV A;  1OXT A;  2K14 A;  4LFB L;  3G4S A;  4QJF A;  1WYD A;  1TWG H;  2VL6 A;  1QVF A;  1YEZ A;  4DPG A;  2D62 A;  4DV6 Q;  1D8L A;  2K50 A;  1XMO Q;  1Q82 C;  3HOY H;  3HFZ B;  3T1H Q;  3LGJ A;  4A3M G;  3UE1 A;  1HZA A;  3BJU A;  4L5Q A;  4R4T A;  3UDX A;  1HNX L;  2CWA A;  2NVY H;  3CCJ A;  2OWO A;  4LW1 A;  1VQ8 A;  1JT8 A;  1OXX K;  3KF8 B;  4X66 Q;  4DV2 L;  5JJL A;  5FLM H;  1Y1W H;  1WI5 A;  5IP9 G;  4KHP L;  2K52 A;  4DAM A;  2R7D A;  1S72 A;  4LF5 Q;  3CD6 A;  4K0K Q;  1XPR A;  3HOW G;  4B3S L;  4RG1 A;  1KL9 A;  4A3D G;  1L1O B;  4XIG S;  2E5L L;  2PQA B;  3J7Z C;  1MJC A;  4P73 A;  5IYB H;  5ELO A;  3W1G A;  2F3I A;  1PH5 A;  4B3T Q;  4A3K H;  1VQM A;  1K0R A;  3ULP A;  4JI1 L;  3U58 A;  2UXC Q;  4EX5 A;  4DK6 C;  3HKZ E;  4X65 L;  4A3G G;  3I2Z A;  1Q46 A;  1GD7 A;  2Z0S A;  4KLK A;  4X64 Q;  3CCV A;  4DV3 L;  2CFM A;  2H5X A;  1XMO L;  1OTC A;  3K80 C;  2UUB L;  3GTG H;  3S1R H;  1U0L A;  5IYD G;  2E2H H;  2WB1 G;  4P71 A;  4A3F H;  2EIF A;  1P16 A;  4GOP A;  1SMX A;  1LUZ A;  4IFD J;  1TWF H;  3GTP H;  3S2H H;  3PO2 H;  1UEB A;  2PMZ E;  4LF9 Q;  2R6G A;  3CMA A;  3EN2 A;  4HID A;  4A3J G;  3J81 c;  3BZC A;  1Q81 C;  2JA6 G;  3I4N H;  3U50 C;  5IYC H;  1MJE A;  2EXD A;  4BY7 G;  4DR5 Q;  5LMU Q;  3GTQ H;  3H3V H;  4DUY L;  1VQJ A;  4IPC A;  4YHH L;  3BZK A;  4LF5 L;  3PF4 A;  2IHE A;  4BY1 G;  5GAH C;  3T1Y Q;  1CUK A;  3CF5 A;  5BR8 L;  4DUZ Q;  2ID0 A;  1K8A C;  2R92 H;  2VUM H;  4A3L G;  1O7I A;  1SRU A;  4Y7N H;  1E22 A;  2DUD A;  4J15 A;  5GAG C;  4DK3 C;  3M85 A;  1N32 Q;  4GN3 B;  4L5T A;  4BBS G;  2CKZ B;  1ASY A;  2WP8 J;  1VQ9 A;  3M3Y H;  1W3S A;  3S2D H;  1VQ7 A;  1VQB A;  3JAM i;  4LF6 Q;  4B3R L;  2Z6K C;  4KI0 A;  2Y0S G;  2VZA A;  5JEA G;  5FJ8 H;  1XJV A;  3U4Z A;  2BA1 A;  4JI2 Q;  4JOI A;  3PUW A;  5IT9 c;  3TS0 A;  3PUX A;  4MZ9 A;  1WFQ A;  2BA0 A;  1IBL L;  4A3M H;  4JBK A;  2V1C C;  1NMG A;  2ASB A;  3AFQ A;  2LXJ A;  2YTY A;  3AYH B;  3ERS X;  3M9B A;  3A5U A;  5LMU L;  4JI3 L;  1N36 Q;  3M4O H;  4B3M L;  4LUO A;  3STB C;  2MO1 A;  1Y1W G;  1HZB A;  1Q12 A;  2Q2H A;  3J7A 5;  4GOP B;  1R9T H;  4AIM A;  4BBR H;  3CAM A;  2LXK A;  3RR5 A;  4HJ7 A;  1VQP A;  1CKM A;  1EFW A;  3KYH C;  3S1M H;  1A8V A;  1GKH A;  1NTG A;  2B29 A;  3W1B A;  1QVG A;  3ZJY C;  4OX9 L;  4JI6 Q;  1WCM G;  3L0O A;  4WJ4 A;  3U4V A;  1I5F A;  3HOW H;  1Q86 C;  4L5R C;  4A3K G;  3G71 A;  4A3D H;  2ATW A;  4DV7 L;  3RN5 A;  1AH9 A;  3FKI G;  1K83 H;  3KDF A;  4PMW A;  2UUC Q;  1FJG Q;  3OTO Q;  2XGT A;  1EYG A;  4LFB Q;  4DAY B;  5EAY A;  1VQ4 A;  1PH8 A;  4DV1 L;  4UPA A;  4JI2 L;  3PIP A;  2PNH A;  1X3G A;  4GLV B;  1PA6 A;  3GO5 A;  1N33 L;  3KF6 A;  1TWH H;  3PCO B;  5IYD H;  4OON A;  3J81 j;  1XPU A;  1OXU A;  5LMN Q;  1HNW L;  1LTL A;  5M5X H;  4A3B H;  3E0E A;  4PZ7 A;  1XPO A;  4A3J H;  2JA6 H;  3CC4 A;  1X54 A;  3MXN B;  1HR0 W;  1VQE A;  2R92 G;  1A63 A;  2VQE Q;  1NY4 A;  4LUZ A;  1XTD A;  3ER0 A;  4ME3 A;  4DV2 Q;  1N9W A;  1UE6 A;  3F2B A;  3AQQ A;  2ZJR A;  4DV4 L;  4YCW A;  4BY1 H;  5H1S E;  3HOU G;  1KRS A;  4GKK L;  4B3S Q;  2IHF A;  4YWL A;  3PV0 A;  5M5W H;  4A93 H;  1Q8K A;  4A3L H;  3PUY A;  2JE6 I;  2KHJ A;  3RLN A;  4DKA C;  2HIX A;  2E5L Q;  3GTK H;  2UUC L;  1FJG L;  3KFU A;  3OTO L;  1Q1E A;  3A5Z B;  1ASZ A;  2NVQ H;  4NXN L;  3CCQ A;  3WWV A;  3RN2 A;  3L7Z C;  4IOC A;  1TWA H;  4PZ8 A;  4LFA Q;  4JI8 Q;  1JJ2 A;  3RLF A;  5FJ8 G;  2UUA L;  1P8L A;  4JI1 Q;  2Z6K A;  1SLJ A;  4WJ3 M;  1SFO H;  4X65 Q;  3HKZ G;  2VNU D;  1AE3 A;  4DV3 Q;  4A76 A;  4UY8 C;  3F1Z A;  1KD1 C;  2UUB Q;  1BKB A;  3KDF B;  4IOA A;  4Y52 H;  5ELN A;  2CWP A;  4C3H H;  5LMN L;  2K75 A;  4IJL A;  3CXC A;  4JI5 Q;  3K81 C;  2XTI A;  1GO3 E;  5C4J H;  1IBM L;  2K4K A;  1X9N A;  1CKN B;  4TVA B;  3H3V I;  4BBR G;  1H95 A;  2B3G A;  3F2D A;  2VQE L;  3RLO A;  3KF6 B;  4HJ8 A;  1A0I A;  4DUY Q;  4HJA A;  4YHH Q;  1YJN A;  1T9H A;  4DV5 L;  2WAQ G;  4IJH A;  5FLX c;  2JA7 H;  2C35 B;  4GLX A;  3TEH B;  5BR8 Q;  4EQ5 A;  4B3R Q;  1EIF A;  3UE0 A;  1WCM H;  5C0X G;  2Q2U A;  1A62 A;  4IO9 A;  1PH6 A;  3OYY A;  3H0G H;  5HY6 A;  4AQY L;  4MTN A;  1YHQ A;  2YTX A;  2F4V L;  1X6O A;  4JI8 L;  4JI7 L;  1YBY A;  4LFA L;  2IY5 B;  3PUV A;  1QZH A;  1VCI A;  3FKI H;  3M4P A;  1VQI A;  5M3F H;  1M90 C;  1PVO A;  5GQO A;  1FGU A;  2RCN A;  1KXL A;  4X62 Q;  3H15 A;  1PFS A;  4HJ5 A;  1KQS A;  1VQF A;  3CCL A;  2IX1 A;  4A3B G;  1YIJ A;  2R7F A;  4JI5 L;  1B70 B;  1X3E A;  1PH7 A;  2Q2I A;  1IBL Q;  4YCU A;  3E9H A;  1PH2 A;  2KEN A;  2CQO A;  3AEV A;  2RHQ B;  4YWK A;  4YWM A;  4OWX B;  3SGI A;  3STB D;  1LM0 A;  4JI3 Q;  1E3P A;  3ULL A;  5C44 H;  4GNX C;  2WAQ E;  3CCS A;  4HIK A;  4A3I H;  4B3M Q;  4DR1 L;  1Q7Y C;  4A93 G;  3S15 H;  4R4O A;  4OX9 Q;  2AHO B;  4BXX H;  3J80 c;  2HHH Q;  4JBW A;  3HOX G;  3HOU H;  5C0X I;  2JA8 G;  4QGU A;  4QL5 A;  1KIX A;  1VQ5 A;  4DR7 L;  4NB3 A;  3CCU A;  1I50 H;  4DV7 Q;  4H02 A;  3MEF A;  4QQB X;  5DLQ E;  2E2J H;  4LNQ A;  2N49 A;  2QGQ A;  3OW2 A;  3JC6 6;  4C3J H;  2OCE A;  1G6P A;  1LYL A;  3BU2 A;  4L5S A;  3PIO A;  4X62 L;  4A3E G;  4JV5 Q;  5C4X G;  1SRO A;  3GDE A;  2ALY B;  4DV1 Q;  1YIT A;  1XMQ Q;  5GAE C;  3HOX H;  1BVS A;  2ZTD A;  3I55 A;  2I5H A;  4PG3 A;  2MQH A;  1N33 Q;  1VQ6 A;  4R4I A;  3CCE A;  5IWA Q;  3CW2 C;  3S24 A;  2Q2T A;  1HR0 L;  1HNW Q;  3E9I A;  3KJP A;  1DGS A;  4P75 A;  1JE5 A;  3NBH B;  3TRE A;  2JA7 G;  3D0F A;  2KCT A;  2YV5 A;  4UP7 A;  4DNI A;  2NZH A;  1NBW A;  2JK8 A;  4IPG A;  2HHH L;  1U5K A;  2BH8 A;  5E7N A;  1PV4 A;  4NPS A;  4DV4 Q;  4C2M H;  1X65 A;  3CPW A;  3TRZ A;  3H0G G;  3KOJ A;  4GKK Q;  3NEN A;  3GTO H;  1HH2 P;  2GVA A;  5M3F G;  3B6Y A;  1VQN A;  1BBW A;  2NN6 G;  1E24 A;  4JI0 L;  5JJK A;  1V9P A;  3GD7 A;  4NXN Q;  2R93 H;  2YU9 H;  1B7Y B;  4JV5 L;  3I4M H;  2B63 H;  4IPD A;  2N3S A;  2UUA Q;  1XMQ L;  3ICE A;  1CKN A;  2DGY A;  1PH1 A;  4LFC L;  1E1O A;  3TQY A;  2K5V A;  4APV A;  1N8R C;  5IWA L;  4P74 A;  2QEX A;  1I6H H;  1PH3 A;  2HT1 A;  1E7Z A;  5C44 G;  4A3I G;  4OWT B;  2UU9 Q;  3S17 H;  1J6Q A;  2KHI A;  1VQK A;  1IBM Q;  3FHW A;  3CQZ H;  4GNX A;  2GN5 A;  1W2B A;  2QA4 A;  1XNQ L;  2R7Z G;  1QUQ A;  2D0O A;  5C3E G;  1WOC A;  1PYB A;  3F2C A;  1PYS B;  4BXX G;  1K9M C;  3PUZ A;  2JEB I;  5IP7 H;  4LUV A;  4DV5 Q;  4LF7 L;  1CSP A;  4LF4 L;  3KJO A;  3PGZ A;  2I5M X;  3EBE A;  2UXB L;  3GTM H;  1TWC H;  3CME A;  3D31 A;  1NMF A;  3G48 A; 
#chains in the Genus database with same CATH topology
 3DWP A;  1CHP D;  4GOP C;  2JA8 H;  4IFD G;  2XVS A;  3TZU A;  5JVH 3;  1K3R A;  2XWJ B;  4DU9 A;  4MIU A;  5BN5 A;  3BDL A;  1B9M A;  1BDO A;  5K36 G;  3J81 E;  2B2W A;  1EUJ A;  5ELE A;  2JP1 A;  2K01 A;  3CQZ B;  4HN7 A;  1YJ9 A;  4POF A;  2BH2 A;  1PH4 A;  4O0A A;  2N78 A;  1PFM A;  3EA6 A;  2UU9 L;  3GTL H;  2PW5 A;  5JPN C;  1D5X C;  3CHB D;  5A35 A;  1TWC B;  2KVM A;  1XNR Q;  3G6J B;  4AYB E;  1SR3 A;  1TY2 A;  2VQF L;  3VA5 A;  2XRQ D;  1YHB A;  4JW0 A;  2JA5 G;  5C4Z A;  2FIN B;  3T4A C;  2E8G A;  4JOI C;  2KCC A;  1SYB A;  5CR3 A;  3S14 B;  4FXK C;  1SE4 A;  1S5E D;  3IRB A;  2AUK A;  1S3O A;  4IQZ A;  5M3M G;  4OO1 I;  1WTH A;  5E4W C;  4O1N A;  1CA6 A;  5IE8 A;  1Y1V G;  1PFN A;  3K7A H;  1YZ6 A;  4IUT A;  2FMM A;  5M5Y H;  3A8J E;  2PNR C;  5CC4 A;  5CV5 A;  1A6X A;  2ZJQ A;  1G91 A;  1BF4 A;  2IX0 A;  4X6A H;  5IP7 G;  1TS4 A;  1XNR L;  3D6W A;  1TVX A;  2EQS A;  4P72 A;  5C3E H;  2B2T C;  4GN5 A;  2VS1 A;  1GM5 A;  3DM3 A;  3T1H L;  1E2W A;  4QY7 A;  3ND9 A;  5CV4 A;  1R4Q B;  1JC7 A;  3MFY A;  3VDY A;  1YVC A;  3K7U C;  1LTS D;  2F03 A;  1STE A;  1FL0 A;  1GUT A;  1PZJ D;  1LLR D;  3QOJ A;  1FYC A;  4QIW E;  1IL2 A;  2RHS B;  1C48 A;  1EQQ A;  2F0E A;  3PSI A;  4HCE A;  2JA9 A;  4NXM Q;  2NVT H;  1EFI D;  1CKO A;  4HSP A;  2UXC L;  5AJ3 Q;  1I4X A;  1A3U A;  1I6V C;  2PI2 E;  2SDF A;  4JVZ A;  3NWS A;  5IY0 A;  4ABN A;  3MHB A;  1OXV A;  4LF4 Q;  1GOZ A;  4KHV A;  2Q8I B;  4FF2 A;  4NP5 A;  1G8Z D;  5GAD C;  1SE8 A;  4OIK A;  4MHE A;  3ERO A;  5CV8 A;  4DV0 Q;  4DR5 L;  2ES2 A;  1SEB D;  2FXQ A;  2HIV A;  1SYC A;  4XDX A;  4HJ9 A;  3LWU A;  5KNC A;  1G51 A;  4DUZ L;  3FP9 A;  2JQO A;  4G4K A;  1B8A A;  3NEL A;  1EWC A;  1D1I A;  3RMH A;  2F0M A;  1VS0 A;  3RD4 A;  2TSS A;  4R1J A;  4ID6 A;  4NXM L;  4L63 B;  2K32 A;  1G29 1;  3PIP 3;  5AJ3 L;  4XT3 B;  5CGK A;  3NUC A;  1PTO B;  1EY6 A;  4TQU S;  2F52 A;  2A6E D;  2A8V A;  3S1N H;  3CU7 A;  1IZ6 A;  4RAU C;  3PO2 G;  3I4N G;  2MFI A;  3KLS X;  4DV0 L;  1EYC A;  5HGQ A;  3IFT A;  5JEA J;  2F0T A;  1L1O A;  3FDT A;  3A56 A;  4BY7 H;  1LAC A;  1YNX A;  3ND8 A;  2PZT A;  2AWO A;  1E1T A;  1EIY B;  2SNM A;  3GTJ B;  1RL2 A;  5C5M A;  1NR4 A;  1EY4 A;  1UE1 A;  2GVB A;  1LTR D;  4DR4 Q;  1LT3 D;  1UWV A;  1OXT A;  3H94 A;  1Q3L A;  3J7A V;  4DPG A;  3PO3 B;  4UAI A;  5COY A;  1D8L A;  2K50 A;  4B9X A;  2F0H A;  1JR0 D;  3VYR A;  1FNV A;  3UE1 A;  5IGC A;  2JXM B;  3BJU A;  2LFN A;  4KV6 A;  3SK4 A;  1SDF A;  3FEW X;  2QDB A;  1JT8 A;  1OXX K;  4X3S A;  2WII B;  4RFB A;  4X66 Q;  3EVQ A;  2DJF C;  4RGM A;  2R7D A;  5F2D A;  1SJE D;  1XPR A;  2ENB A;  1IKL A;  3D3R A;  4A3D G;  1B53 A;  1L1O B;  1SYD A;  4CKC A;  4XIG S;  2O2L D;  5FO9 B;  3J7Z C;  4P73 A;  5IYB H;  1RTO A;  3W1G A;  1JQY D;  1K0R A;  4UDU C;  1RD9 D;  3P1H A;  3HZX A;  4KLK A;  1GD7 A;  3GTG H;  2H5X A;  5JOB A;  1OTC A;  1FGB D;  5IYD G;  1F2M A;  2EIF A;  1L0X B;  4ZUI A;  1LUZ A;  4IFD J;  1TWF H;  4LF9 Q;  1F9P A;  2F0Q A;  3CMA A;  3BZC A;  3U50 C;  1EOT A;  4BY7 G;  1U4M A;  1WCM B;  3NPP A;  3PF4 A;  4CKE A;  3T1Y Q;  4A3K B;  1AN8 A;  2AUJ D;  5BR8 L;  2RDF A;  1E22 A;  3S9W A;  1N32 Q;  4I7Z C;  2EY6 A;  4GN3 B;  1GUN A;  1CQF A;  4FF3 A;  3S1R B;  2E2H B;  1VQ9 A;  3M3Y H;  3S2H B;  2M00 A;  1SAP A;  1VQ7 A;  1VQB A;  2Z1C A;  4WRD A;  2B2W C;  5FJ8 H;  3GTQ B;  2F0O A;  5EBD A;  4JI2 Q;  1GHJ A;  3PUW A;  3TS0 A;  3JAM E;  1DCZ A;  1WFQ A;  2BA0 A;  1WTR A;  2V1C C;  1EIH A;  3M9B A;  4JI3 L;  1GUG A;  2IW3 A;  3STB C;  2MO1 A;  2Q2H A;  4CJ0 B;  1DOK A;  1PRT C;  2LXK A;  3RR5 A;  1CKM A;  2E74 C;  1I50 B;  1QVG A;  2EVB A;  3L0O A;  1I5F A;  4OHJ A;  1EYA A;  1V1P A;  4ZUJ A;  1SYG A;  1BQQ T;  2IPK D;  2ATW A;  3ONA B;  3RN5 A;  5L37 A;  1HTP A;  2MP1 A;  2XGT A;  4A3M B;  1EYG A;  3VR2 A;  4LFB Q;  1D5M C;  1PH8 A;  4DV1 L;  4JI2 L;  1QNU A;  2PNH A;  1FNU A;  2PMZ B;  4OEM B;  1N33 L;  4BBR B;  5KGU A;  3Q23 A;  3S1M B;  3UI2 A;  5LMN Q;  1ICF B;  2F0F A;  1G6Z A;  2EJM A;  3MA2 B;  1XPO A;  1NR2 A;  2XN9 C;  3CRL C;  4KY6 A;  1WTX A;  2JA6 H;  1UAP A;  5C4H A;  1O7Z A;  1SBB B;  1VQE A;  1A63 A;  3T13 A;  4ME3 A;  1UE6 A;  3SK8 A;  3HOU G;  2MJ8 A;  1ILQ A;  4B3S Q;  4WJW A;  5M5W H;  2JE6 I;  1GUS A;  3KFU A;  2NVQ H;  4NXN L;  2NUC A;  3L7Z C;  1F9Q A;  4IOC A;  3RLF A;  1V1P B;  2H1E A;  4JI1 Q;  2QEJ C;  5FJ8 G;  3NHH A;  4PQX A;  5M5X B;  3HKZ G;  4DV3 Q;  3G7L A;  1KD1 C;  1BKB A;  5IOC A;  3OPO A;  5LMN L;  2OEO A;  3DEO A;  1B44 D;  4R8N A;  3E0J A;  4FYD A;  3K81 C;  1CTM A;  2XTI A;  3I3C A;  5C4J H;  1X9N A;  4BY1 B;  1MI2 A;  1H95 A;  2RBM A;  3QO2 A;  3GTM B;  1B50 A;  3K5M A;  4HJ8 A;  3GTK B;  1LTA D;  4YHH Q;  4CGY B;  1SYF A;  3OHX C;  1ESR A;  2B2U C;  4KN4 C;  2KEE A;  1TWA B;  4EQ5 A;  1EIF A;  1E2Z A;  1WCM H;  1SFO B;  1M4V A;  2Q2U A;  1JOO A;  4C3H B;  1EY7 A;  5GQO A;  1FGU A;  1B9N A;  3A8K E;  4HJ5 A;  1PFS A;  3CCL A;  4WOR A;  2A5H A;  2F0N A;  1PH7 A;  2Q2I A;  1IBL Q;  1YNN D;  2WV6 D;  4YCU A;  4DK1 A;  4H0L C;  1DM0 B;  4YWM A;  4GNX C;  3CCS A;  4BWG B;  1STG A;  3Q24 A;  2BDN A;  1Q7Y C;  4QUC A;  3FKI B;  2QKI C;  3DWQ A;  5ELD A;  3J80 c;  4JBW A;  3I90 A;  1U4R A;  4X3T A;  4DR7 L;  4NB3 A;  1I50 H;  2KEC A;  5EPJ A;  5FKA C;  2L55 A;  4LNQ A;  2LY7 A;  3OMG A;  1KAB A;  4C3J H;  3A7A B;  2SEB D;  1LT5 D;  5C4X G;  1TR5 A;  4OO1 H;  1XMQ Q;  1CZW A;  5D3D A;  1HPC A;  1KLG D;  5IWA Q;  1HR0 L;  4KMU C;  1HNW Q;  3E9I A;  2F0G A;  4NDX A;  4B9W A;  3BYY B;  2F0S A;  2YV5 A;  4DNI A;  2NZH A;  1NBW A;  1HA6 A;  1XX8 A;  2JK8 A;  4IPG A;  5E7N A;  1BCP F;  4C2M H;  3TRZ A;  3KOJ A;  4GKK Q;  3NQI A;  4HTH A;  1HH2 P;  5E1F A;  3B6Y A;  1V9P A;  2RCF A;  2UUA Q;  1BUV T;  1XMQ L;  2JN4 A;  3ICE A;  3NBI A;  1UNS A;  2E2D C;  2B2Y A;  5LL6 S;  3VYT A;  5IWA L;  2RVL A;  1I6H H;  2AQ2 B;  1SE3 A;  2HT1 A;  1E7Z A;  3S17 H;  4OWT B;  2R7Z G;  2XSC A;  3FHW A;  1AZP A;  4R9W A;  3PMF A;  2JA5 B;  1CK1 A;  2A6H D;  2K28 A;  3EBE A;  3GTM H;  1FD7 D;  3CME A;  1LTL A;  3QOL A;  2FFK B;  1S5B D;  4KHZ A;  2LSS A;  4AQY Q;  1Y1V B;  2NN6 I;  3TZD A;  1V1O A;  4JI7 Q;  1BXT A;  1CI3 M;  3BVZ A;  3S1Q H;  4OO1 G;  5FOB B;  3CC2 A;  2KUM A;  1JIC A;  3DM1 A;  2YYZ A;  4DF7 A;  1WJJ A;  4JK1 C;  3VR6 A;  4A3E H;  4C1N I;  1IW7 C;  3RNU A;  1EQR A;  2R3Z A;  5LL6 X;  2HQE A;  1HJP A;  4K2K A;  4GLA C;  1Z47 A;  3HOX B;  4PZ6 A;  3UDF A;  4K6D A;  2F4I A;  1VQC A;  3VA7 A;  2JA8 B;  2L0C A;  3MAQ A;  1DJR D;  2A68 C;  2EYL A;  4C3I G;  1EY9 A;  1JJC B;  1UE5 A;  1HZC A;  3I72 A;  1RIP A;  1KC8 C;  1PZI D;  1X56 A;  2L11 A;  4FO2 A;  3CKI B;  1HNZ L;  4O42 A;  3F2U A;  1VMC A;  4ZCK A;  3BVM A;  3M4Q A;  2TMP A;  1DOM A;  4DR6 L;  4KJN A;  2ZTC A;  1QVC A;  2AMC B;  1YHA A;  3PF5 A;  4RA8 A;  4GKJ L;  1EY5 A;  4J6H A;  2NYZ D;  1EOV A;  1UE7 A;  1Y14 B;  2NZO A;  3AMU A;  3PQI A;  1BOS A;  3QR8 A;  4OXP A;  1EEF D;  1WTW A;  1VQO A;  2P5Z X;  2G9H D;  3NTK A;  4HED A;  1HUN A;  1JB3 A;  2ZTE A;  3K7A B;  5T1G A;  4ZK9 B;  4DAV A;  4ZYS A;  5CV9 A;  5LMN W;  4JI0 Q;  5M5Y B;  1YI2 A;  2KBN A;  2EYF A;  1ILP A;  1HQR D;  1J8I A;  4QUF A;  5C3E B;  2I0Q A;  3HOV H;  4TRD A;  3HP3 A;  3SK6 A;  1LTT D;  4ILW A;  4B3T L;  1XNQ Q;  4XYQ A;  1RJT A;  4DR3 Q;  2KQ3 A;  1QZG A;  2J4X A;  4X64 L;  2A19 A;  3HOY G;  2RSO A;  3I4N B;  3A54 A;  1IBK Q;  4LF7 Q;  2WB1 E;  1B4O A;  2E2I H;  2JA5 H;  4JYA Q;  2E75 C;  2EY1 A;  2I5L X;  3I7F A;  2OTL A;  3GV3 A;  5M3M H;  2D0P A;  1SXT A;  1PH9 A;  2EJF C;  5C3W A;  3FPU B;  1Y1V H;  1XTC D;  2NWG A;  4ALP A;  1T5E A;  1S5C D;  3W5O A;  1F77 A;  4DR3 L;  5HUR A;  1TS5 A;  4XTC S;  1VF5 C;  2K5N A;  4O2D A;  3WOE A;  3H3V C;  3N6R A;  4JG2 A;  5EPK A;  4OGQ C;  4LF6 L;  1IBK L;  4ME5 A;  4KY5 A;  2Y0S E;  4XYO A;  4AYB G;  2VQF Q;  4JYA L;  2XRS D;  2MPM A;  1L0W A;  2OF1 A;  1JWU D;  1FVI A;  1VF7 A;  5IYC G;  3I56 A;  3M7G A;  1L2F A;  5JVG 3;  4HR7 B;  1CHQ D;  2VUM G;  2IL8 A;  1X3Q A;  3HOV G;  3P7J A;  5EGT A;  4KHP Q;  4BA2 I;  2QF7 A;  2VW9 A;  1I4Q A;  1WVL A;  3IL8 A;  3S1N B;  2F3W A;  2JEA I;  1GVP A;  2HD3 A;  1WYD A;  1XWE A;  1I4H A;  2VL6 A;  3ERQ A;  1EU3 A;  3MFG A;  2CQA A;  5D3I B;  2D62 A;  1L0Y B;  1XMO Q;  3T1H Q;  3TBI B;  4BY7 B;  3HGB A;  4KY7 A;  4L8J A;  2NVY H;  4FXG C;  4FXD A;  5HGT A;  1TS2 A;  1STB A;  1S5D D;  1H9J A;  1W6J A;  1ZYR C;  4HAE A;  1MD2 D;  4KHP L;  2K52 A;  4LF5 Q;  1EWH A;  1PTO F;  3CD6 A;  3HOW G;  1TU2 B;  1AFP A;  1KDC A;  1WTO A;  4V19 0;  2DJG C;  3K58 A;  1PH5 A;  4L6T B;  1FR3 A;  2UXC Q;  3D4D A;  3I2Z A;  4V0B A;  1XMO L;  3IFD A;  1Z6H A;  3K80 C;  3SE0 A;  4N8X 1;  3D4W A;  1CQV A;  4B3R Q;  1P16 A;  4RWS C;  1SMX A;  3U9O A;  2B2Y C;  2F0U A;  5FLX L;  3PO2 H;  2WKD A;  3I4N H;  1SNP A;  4G7O C;  4DR5 Q;  5LMU Q;  1VMP A;  4LF5 L;  4C56 C;  4EQN A;  1K28 A;  1CA5 A;  4DUZ Q;  1D6E C;  3AU7 A;  2R92 H;  4A3L G;  1O7I A;  5FK9 C;  2IWH A;  4J15 A;  1BCP C;  3GTG B;  2CKZ B;  2EYJ A;  1TQO A;  3RUZ A;  4EQP A;  1Q8I A;  2EXZ A;  1TWF B;  3I73 A;  5CBE E;  2RDH A;  1K8O A;  3JAM i;  4B3R L;  2Z6K C;  5IT9 c;  3MXN A;  1R4P B;  3K5N A;  1ENC A;  1NMG A;  2LXJ A;  2YTY A;  3M4O H;  1A3T A;  5LMU L;  4B3M L;  1WD1 A;  1HZB A;  3HOU B;  2V4D A;  1SYE A;  3CAM A;  4YIJ A;  4HJ7 A;  1EFW A;  1MSG A;  3M3Y B;  4OX9 L;  1F2Y A;  4NMZ A;  3U9S A;  4WJ4 A;  5G3L F;  3U4V A;  2HCI A;  3D4R A;  3BDC A;  4A3D H;  3G71 A;  2PCF B;  4XQJ A;  3HKZ B;  5EAY A;  4ZKC B;  4UPA A;  4CJ2 C;  2PPB C;  2VB3 X;  4RGO S;  3KF6 A;  1TWH H;  2CW0 C;  3PCO B;  5IYD H;  3J81 j;  3K0Y A;  3WOF A;  4JPB W;  4DNR B;  2N88 A;  4PZ7 A;  1VDZ A;  3K59 A;  2B8F A;  2F1M A;  3CC4 A;  1X54 A;  3DEP A;  3MXN B;  4N9T A;  4F7X A;  3GTO B;  2R92 G;  1H9K A;  2B39 A;  1N9W A;  1RDP D;  4CDD C;  2ZJR A;  2B8G A;  3P75 A;  5H1S E;  5EQ0 A;  2IHF A;  3PV0 A;  4A93 H;  3RLN A;  2NTS A;  4DKA C;  2HIX A;  5JPM C;  1Q1E A;  1ASZ A;  2H4O A;  4TSS A;  4JI8 Q;  5AFW A;  4WJ3 M;  1P8L A;  3BS1 A;  2L9H A;  1AE3 A;  1ROD A;  2JA6 B;  4Y52 H;  2CWP A;  2O4X A;  2ZT9 C;  3CXC A;  4OL7 A;  2Z8L A;  2LMC B;  3H3V I;  4RKL A;  5M5W B;  1PFB A;  3KF6 B;  2NVQ B;  4I7A A;  5FLX c;  3T51 B;  2JA7 H;  3TEH B;  4K6L A;  4OEL B;  5BR8 Q;  5I9O A;  2O5J C;  4CJ1 B;  3R3O A;  2BE5 C;  3OYY A;  5HY6 A;  3KUP A;  2F4V L;  4MTN A;  1WTP A;  3NTI A;  4JI8 L;  3PUV A;  3Q0A A;  5M3F H;  1HCZ A;  5C4J B;  2RCN A;  2PQE A;  1A2U A;  1KQS A;  1ZKO A;  2R7F A;  1X3E A;  1DXM A;  2PZW A;  1PH2 A;  2NTT A;  3AEV A;  4YWK A;  3STB D;  4JI3 Q;  5ELF A;  1PRT D;  4DR1 L;  4A93 G;  3S15 H;  2B2V C;  2GA4 B;  1HFN A;  3HOU H;  5C0X I;  4QGU A;  4QL5 A;  1KIX A;  4H02 A;  1KNE A;  3MEF A;  4QQB X;  2E2J H;  3OW2 A;  1TII D;  2QGQ A;  1G6P A;  2FMC A;  2DY7 A;  1SRO A;  4G57 A;  4F87 A;  2Z4I A;  3GDE A;  4DV1 Q;  5ELB A;  1F9S A;  1BVS A;  2R7Z B;  2MQH A;  1N33 Q;  1JOK A;  3CW2 C;  3J80 L;  2Z4H A;  1OO9 B;  3KJP A;  1DGS A;  2K7V A;  2MHV A;  1WD0 A;  2D9U A;  5IGF A;  2JA7 G;  2KCT A;  1IHZ A;  1Q90 A;  2XNA C;  1PV4 A;  5IGB A;  4C3J B;  1X65 A;  4RHS A;  3CPW A;  3GTO H;  2CH4 A;  3LNN A;  2GVA A;  3D8G A;  5M3F G;  2NN6 G;  3GD7 A;  4NXN Q;  2R93 H;  1X32 A;  2B63 H;  3DWA A;  2N3S A;  2IX3 A;  1HRJ A;  2DGY A;  4LFC L;  2MUY A;  3RZO B;  5I9P A;  4X3U A;  3TQY A;  2EJG C;  1N8R C;  3KK7 A;  4P74 A;  5A2Q L;  1Y8O B;  2WAQ B;  1SSO A;  4C2M B;  2GN5 A;  1QUQ A;  1PYB A;  1PYS B;  1K9M C;  4ZAI A;  4Q0F A;  4LUV A;  4PNY A;  3QG1 A;  4QF4 A;  2UXB L;  3OOC A;  5KEE A;  2QIL A;  1QB5 D;  1I6H B;  2EE1 A;  1X55 A;  1W6K A;  4RMF A;  4Z9C B;  3S17 B;  2JYO A;  1ML0 D;  4EQO A;  2PO4 A;  3RZD H;  3L2P A;  5C4X H;  4PV1 C;  2CCZ A;  2L4N A;  2KCN A;  3L3O C;  1PTO C;  1UEA B;  1GUW A;  2WFW A;  1RKN A;  1PHJ A;  4YY3 L;  1V43 A;  2SOB A;  4J1M A;  1H9S A;  1N34 L;  3S1Q B;  2M9V A;  1U4P A;  1NE3 A;  3MC0 B;  1QUQ B;  1SNM A;  1JWM D;  2R93 G;  3MTS A;  4A3E B;  5I2X A;  4DR7 Q;  1B3Q A;  2B63 G;  4LWC A;  4JI4 Q;  1YNJ C;  2AQ1 B;  3P20 A;  1ONL A;  3S16 B;  4K14 A;  2HQL A;  1CSQ A;  1S40 A;  3HKS A;  3H6M A;  3QIA A;  3GV6 A;  1TWG B;  1Q1B A;  2EY5 A;  1VQA A;  1OXS C;  1HR0 Q;  1NSN S;  3HOY B;  4DNT B;  4K5V A;  1QE6 A;  3V2T A;  2R7Z H;  1SN8 A;  2C5C A;  5BN4 A;  3C1E A;  4POG A;  2L1B A;  4DV6 L;  4KD4 A;  4CDF C;  1KRT A;  3KBG A;  2NVX H;  3PO3 G;  4JI4 L;  3Q8D A;  1K73 C;  1H9S B;  4LF8 Q;  1D1K A;  2E76 C;  2XWB B;  4JBM A;  1L1O C;  1WTV A;  1SNC A;  4K0K L;  3K6O A;  4A4I A;  1EWI A;  5ELC A;  4RCN A;  4GN4 B;  4A3C G;  4R4C A;  3RZO H;  1ENF A;  2ZXO A;  4AYB B;  3CC7 A;  2RF4 A;  3M7N A;  4IUN A;  2N8N A;  4RKB A;  1BNZ A;  4R4Q A;  4K5W A;  1F2L A;  3K8A A;  4C3I H;  4M1U B;  5GRO A;  2KCM A;  4LF8 L;  2VUM B;  1JJG A;  4DR2 Q;  1TKW B;  3HOV B;  5FLM G;  2DNC A;  5K5P A;  3VR3 A;  1Y69 U;  2MNA A;  2PI2 A;  1LT4 D;  1IW7 D;  3NK9 A;  4LK1 C;  4ZQ3 A;  4HIO A;  5IP9 H;  3EQL C;  4GS3 A;  4ULL A;  4PMC A;  5CV7 A;  1I94 Q;  2E2I B;  2ICI A;  2K5H A;  3EFX D;  2B2T A;  4OWW B;  2RQX A;  2EOT A;  2A68 D;  3R2T A;  4A3F G;  4KKU A;  3TP6 A;  3EJI A;  4A3G H;  5M3M B;  2FJ2 A;  4IZ8 A;  3HOZ H;  3J81 i;  3NTH A;  4KD3 A;  4AH6 A;  1N36 L;  1VQL A;  2X6L A;  4DR2 L;  1SMY C;  1HNZ Q;  4BA1 I;  4FDB A;  3HOW B;  2F0K A;  4QIW B;  1PLF A;  1AEX A;  3UDG A;  2A69 C;  4JC0 A;  2OQ0 A;  2RSN A;  4DR6 Q;  2J0T D;  4JI6 L;  1K83 B;  1CFM A;  3LX0 A;  4YCV A;  1S5F D;  3S16 H;  3T53 B;  1I94 L;  2D5D A;  3J80 E;  1G2T A;  5IGD A;  4GKJ Q;  1EL0 A;  4BBS H;  2K14 A;  4QJF A;  1TWG H;  1QVF A;  1STY A;  1HTL D;  1YEZ A;  4CDE C;  5CV6 A;  1STN A;  1Q82 C;  3HOY H;  5EKI A;  4GZY C;  3HFZ B;  4A3M G;  4C1N K;  4R4T A;  5E3F A;  2OWO A;  4K8I A;  4LW1 A;  1VQ8 A;  3WDN A;  5D14 A;  4XT1 B;  1TS3 A;  4DV2 L;  5JJL A;  1Y1W H;  1WI5 A;  5IP9 G;  4DAM A;  1HFG A;  1S72 A;  2DY8 A;  4RG1 A;  1I4P A;  1GUO A;  2E5L L;  3HEJ A;  1MJC A;  5KYI A;  2F3I A;  4M8A A;  4NW2 A;  4B3T Q;  5DEH A;  1II3 A;  4H13 C;  2HCC A;  3ULP A;  2OXP A;  1KLU D;  2NVY B;  4X65 L;  4A3G G;  1Q46 A;  5KIX A;  2Z0S A;  4X64 Q;  1TY0 A;  2CFM A;  2UUB L;  3HOZ G;  1NNX A;  2WB1 G;  3D6C A;  3GTP H;  1UEB A;  2PMZ E;  2O5I C;  2OT2 A;  4HID A;  3MEH A;  1BR9 A;  3EN2 A;  4A3J G;  3J81 c;  1J9O A;  5IYC H;  1MJE A;  2EXD A;  3R2I A;  1QG7 A;  3H3V H;  4DUY L;  4IPC A;  2IHE A;  2R61 A;  4BY1 G;  5GAH C;  3CF5 A;  2ZXP A;  2VUM H;  1G2S A;  4Y7N H;  5GAG C;  4DAY A;  4DK3 C;  3SVM A;  4L5T A;  4BBS G;  1ASY A;  1NUC A;  1QNK A;  2WP8 J;  1XXG A;  1W3S A;  1DZ1 A;  2Z9H A;  3S2D H;  3VYU A;  3PO2 B;  4LF6 Q;  4DA2 A;  4KI0 A;  1PXU A;  2Y0S G;  3LWE A;  2VXW A;  5JEA G;  1HA5 A;  2KED A;  2BA1 A;  3TSS A;  5FO7 B;  3FMC A;  2ZXR A;  2CHB D;  2ASB A;  3AFQ A;  2R92 B;  3ERS X;  3A5U A;  1LTG D;  1Y1W G;  3OIQ A;  4ZLT F;  4EVO A;  1Q12 A;  3J7A 5;  4IUU A;  1R9T H;  4I65 A;  1VQP A;  2B29 A;  3ZJY C;  4CDC C;  3HOW H;  4FF4 A;  5IT9 L;  1KNA A;  4DV7 L;  4DAP A;  3FKI G;  5C0X H;  1K83 H;  3KDF A;  3URY A;  2UUC Q;  3MXP A;  3OTO Q;  4DAY B;  1DOL A;  2PYK A;  1VQ4 A;  3M4O B;  3BZD B;  1PA6 A;  1IYU A;  3GO5 A;  2F0P A;  1GJX A;  3NP8 A;  3NSW A;  4OON A;  1XPU A;  4LJZ C;  1O7L A;  5IGE A;  4A3B H;  2I46 A;  2C9O A;  1UUP A;  4IUP A;  1HR0 W;  4A3D B;  1ZYR D;  2VQE Q;  1NY4 A;  4LUZ A;  4KKS A;  3J7A F;  2EDG A;  2Q8R E;  5EJW A;  4DV4 L;  2YU9 B;  4E6I A;  1Q8K A;  4A3L H;  2KHJ A;  3CRK C;  1BO0 A;  2UUC L;  3OTO L;  3CCQ A;  1TWH B;  3WWV A;  3A7L A;  4PZ8 A;  1JJ2 A;  1JE4 A;  1HQM C;  1SLJ A;  3K5L A;  1AP0 A;  4UHV A;  4KKT A;  3FPP A;  3KDF B;  2K75 A;  4IJL A;  3SEB A;  3SHL A;  5IGG A;  1GO3 E;  1IBM L;  1CKN B;  4TVA B;  4A93 B;  2B3G A;  2VQE L;  2EPB A;  3RLO A;  3OSO A;  3V05 A;  1A0I A;  4HJA A;  1T9H A;  4DV5 L;  5CBA E;  3OW7 A;  1BCP D;  3JAM L;  5C0X G;  1A62 A;  4IO9 A;  4FF1 A;  3H0G H;  1YHQ A;  3KLR A;  1X6O A;  1YBY A;  4K8J A;  3R93 A;  1QZH A;  3M4P A;  1VQI A;  3A55 A;  1M90 C;  1B1Z A;  1PVO A;  3TP8 A;  3K57 A;  2F0L A;  1F9R A;  1KXL A;  4X62 Q;  3H91 A;  2MGS A;  1ZXT A;  5DM7 3;  4A3B G;  5J39 A;  4CHT B;  4Q5V A;  1YIJ A;  3J7Y W;  2JA7 B;  3E9H A;  3KLS A;  2KEN A;  3SDZ A;  2RHQ B;  3SGI A;  4XXE A;  1LAB A;  1LM0 A;  1E3P A;  5C44 H;  4A3I H;  4B3M Q;  4WFN 3;  1Y8P B;  4HMI A;  1SNQ A;  4OX9 Q;  5M3F B;  2HHH Q;  1DD2 A;  1PRT B;  3HOX G;  1A2T A;  1K0S A;  2JA8 G;  1EZ8 A;  1VQ5 A;  1K3B C;  3CCU A;  3W2D A;  5KRU A;  2N49 A;  4RHR A;  3OMC A;  1LTB D;  3BU2 A;  4L5S A;  3PIO A;  4X62 L;  3NQT A;  2ALY B;  1YIT A;  2F0I A;  5GAE C;  4HMJ A;  2ZTD A;  4NKL A;  3I55 A;  2I5H A;  1I4R A;  2CW0 D;  5EBC A;  4R4I A;  1H9R A;  5NUC A;  3T16 A;  3S15 B;  4KN7 C;  3S24 A;  2F0V A;  3TP7 A;  3KBX A;  3MWY W;  4P75 A;  1JE5 A;  3I4L A;  3H09 A;  2PZU A;  1HUM A;  3TRE A;  3MZ5 A;  4UP7 A;  2B2U A;  2E2J B;  4OIJ A;  2HHH L;  1U5K A;  2BH8 A;  5LHY 1;  3H0G G;  3BYT B;  3I91 A;  2RDG A;  2LS0 1;  4H7B A;  3OIP A;  1E24 A;  4K5X A;  5JJK A;  1I4G A;  3Q22 A;  2YU9 H;  3I4M H;  2K5Q A;  3NWT A;  3OWF A;  4IPD A;  4QMG A;  1AZQ A;  5KNB A;  2WKC A;  3C1F A;  1PH1 A;  3K5O A;  4F8M A;  2K5V A;  1JCK B;  1STH A;  1M8A A;  4U68 A;  1I3Q B;  4S3S A;  1PH3 A;  4RCO A;  2NB0 A;  5C44 G;  4A3I G;  1J6Q A;  5JAV A;  1VQK A;  1EZ6 A;  3CQZ H;  4GNX A;  5T1I A;  2QA4 A;  2D0O A;  5C3E G;  2ICE C;  3PUZ A;  5ISR A;  2JEB I;  1EY8 A;  3NXW A;  1EYD A;  2R93 B;  1QIL A;  4LF4 L;  5I2Y A;  3PGZ A;  3KJO A;  2B63 B;  1E0B A;  1TWC H;  3D31 A;  1NMF A;  2BE5 D;  2K5D A;  3G48 A;  2WIN B;  1MGS A;  2F4V Q;  2J7Z A;  3A8I E;  3AFP A;  4MNO A;  1E2V A;  1XYI A;  1JB7 A;  1DON A;  2VY3 A;  2X6G A;  4DN4 M;  3JAM c;  2JJQ A;  1C7Y A;  3S14 H;  1SJH D;  2ZM6 Q;  1D7Q A;  1RTN A;  2D2C C;  5I6Y A;  3I70 A;  5DNF A;  1MHW C;  1TXY A;  3BG3 A;  4DR1 Q;  1NJI C;  5JJI A;  1JOR A;  2A6E C;  1MKH A;  1CM9 A;  4GNX B;  1VQD A;  3G6E A;  3GP7 A;  1Z7T A;  1V8Q A;  3RZD B;  1NAP A;  4IPH A;  5IT9 E;  5C4X B;  5EKK A;  3I4M G;  4IFD I;  4IUR A;  2AQ3 B;  4EGV A;  3DXJ C;  2NN6 H;  5KND A;  1Z9F A;  2OTJ A;  1FNW A;  2ZM6 L;  4UP9 A;  3QJY A;  4HIM A;  1F2Z A;  3O13 A;  1IKM A;  4P2C B;  3BVG A;  4DR4 L;  3CCM A;  1M1K C;  3W3A A;  2I07 B;  4PMB A;  3QB3 A;  4J8Q A;  4N8F A;  1HXY D;  1J5E Q;  1V1Q A;  4JCV E;  2OQK A;  3E5S A;  3I4O A;  4ZKB B;  2XIW A;  4MN3 A;  3K0X A;  1ET9 A;  3A74 A;  4DFA A;  3DLL A;  4X66 L;  2MO0 A;  4LAA A;  1K8G A;  3TME A;  1X3F A;  1AE2 A;  2DNE A;  4LFC Q;  2L15 A;  1TT2 A;  4U67 3;  2K05 A;  5DM6 3;  3NEM A;  1C9O A;  1IYJ B;  2AWN A;  2ZJP A;  2KJX A;  1B2T A;  4JBJ A;  2PW7 A;  4A75 A;  1GHK A;  1NCV A;  2NZ1 D;  1IL8 A;  1EEI D;  4LMQ D;  1YJW A;  4A3F B;  2UXD Q;  2NVX B;  5C6A A;  1I3Q H;  1VQH A;  1J5E L;  1BBU A;  5C0X J;  4UP8 A;  3TDQ A;  2UXB Q;  1PTO H;  4LF9 L;  3TS2 A;  5FO8 B;  1SNO A;  3HS0 C;  4ODG A;  4IN3 A;  1HZ9 A;  1U4L A;  3ULJ A;  1WTQ A;  3T1Y L;  2NBF A;  1ENA A;  3Q6S A;  1N32 L;  4IUQ A;  1PTO D;  1IXR A;  5FLX E;  2EZV A;  4FVM A;  5E4X A;  5IYB G;  1ET6 A;  2UXD L;  2F0W A;  4BS9 A;  2IT1 A;  3SK5 A;  4C3I B;  1JMC A;  4K2L A;  2AKW B;  2BDO A;  3GTJ H;  4YY3 Q;  2EYM A;  3MXG A;  4CKB A;  1MIU A;  1D2B A;  3IKJ A;  5J3B A;  1N34 Q;  4H44 C;  3KF8 A;  3E3X A;  4IAL A;  3UDI A;  3PO3 H;  3A0J A;  1HNX Q;  3EIV A;  1YNJ D;  1QOH A;  3KLW A;  1KDB A;  2PQA A;  2QW7 A;  1A15 A;  1KHI A;  1X3P A;  1KAW A;  1Y8N B;  3J80 i;  1C0A A;  3CPF A;  2YTV A;  4DK0 A;  2A1A A;  1QCB D;  2G5D A;  2F0D A;  1D5Z C;  2CVR A;  3AB9 A;  3CP0 A;  4A3G B;  1VQG A;  3F8T A;  4HSV A;  4A3C H;  5J22 A;  3CCR A;  3HOZ B;  3G4S A;  4LFB L;  1RHP A;  2WB1 B;  1BBX C;  1LT6 D;  2A74 C;  4DV6 Q;  1RF2 D;  2WAC A;  4A3J B;  3LGJ A;  1HZA A;  1PMR A;  2EYH A;  1SE2 A;  4L5Q A;  1PZK D;  5COR A;  3UDX A;  2EYP A;  1HNX L;  2CWA A;  2IJ0 A;  3CCJ A;  3FRP B;  3KF8 B;  5FLM H;  2K1B A;  2K6A A;  3VYS A;  4BBS B;  4K0K Q;  4B3S L;  3T56 B;  1KL9 A;  2N55 A;  3GQB A;  2K33 A;  2X69 A;  5G3L D;  2PQA B;  1HHV A;  2HDL A;  5ELO A;  4A3K H;  2Y0S B;  1VQM A;  1C4Q A;  4RGN A;  1KTK A;  3MXU A;  4JI1 L;  3U58 A;  4EX5 A;  4DK6 C;  1ZEQ X;  3HKZ E;  3E6Z X;  4DV3 L;  1KDA A;  1SND A;  3CCV A;  3S1R H;  1U0L A;  2E2H H;  4P71 A;  4A3F H;  2Z6B A;  4GOP A;  2LKV A;  1Y1W B;  4B08 A;  3S2H H;  2R6G A;  2JA6 G;  1Q81 C;  1MSH A;  3GTQ H;  1VQJ A;  2L12 A;  4YHH L;  3BZK A;  1STA A;  3MVV A;  1QJO A;  4X3K A;  1CUK A;  4QCL A;  4F88 A;  5EPL A;  1K8A C;  2ID0 A;  1SRU A;  2DUD A;  3M85 A;  1S4Z A;  1MBY A;  3PIO 3;  3OWE B;  3ZYY X;  1K8M A;  3GTP B;  3J81 L;  2VB2 X;  4FP5 D;  3TP5 A;  4R8I A;  1XJV A;  2VZA A;  3VR5 A;  1LO5 D;  3U4Z A;  4JOI A;  3C3L A;  3PUX A;  4MZ9 A;  1IBL L;  4JBK A;  4A3M H;  1YNN C;  3AYH B;  1SMY D;  1N36 Q;  4Y7N B;  2HDM A;  1ICW A;  4LUO A;  4FNF A;  4G7H C;  4GOP B;  2A69 D;  4AIM A;  4BBR H;  3KYH C;  3S1M H;  1A8V A;  1GKH A;  1NTG A;  3W1B A;  3S2D B;  4JI6 Q;  1WCM G;  3ITP A;  3DUZ A;  1PYW D;  4HCS A;  1Q86 C;  4KJO A;  4L5R C;  4A3K G;  4DXF A;  1AH9 A;  5DAU A;  3NE5 B;  4PMW A;  1FJG Q;  1O7Y A;  5D65 A;  2M2L A;  2KOL A;  3PIP A;  1X3G A;  4GLV B;  5I6W A;  2RKS A;  1R9T B;  1EY0 A;  1OXU A;  2DN8 A;  3L9A X;  1HNW L;  5IOD A;  1JOQ A;  5M5X H;  3IAY A;  3E0E A;  4A3J H;  4DV2 Q;  1XTD A;  3ER0 A;  3F2B A;  3AQQ A;  3HRZ C;  4YCW A;  4BY1 H;  1KRS A;  4GKK L;  5J1Z A;  4YWL A;  1RCV D;  2F0J A;  1DYQ A;  3PUY A;  2E5L Q;  1IYV A;  3GTK H;  2QCP X;  4XQN A;  1FJG L;  3A5Z B;  4C3J G;  3RN2 A;  1O78 A;  1TWA H;  4DGZ A;  4LFA Q;  2UUA L;  4A3B B;  1U9R A;  2Z6K A;  1SFO H;  4X65 Q;  2VNU D;  4UY8 C;  4A76 A;  2Q8T A;  3F1Z A;  2UUB Q;  5TSS A;  3SR1 A;  4IOA A;  5ELN A;  4C3H H;  5JEA H;  4JI5 Q;  1GXD C;  2K4K A;  4BBR G;  3F2D A;  2SNS A;  4RH6 A;  5IIF A;  1YJN A;  4DUY Q;  2WAQ G;  3VR4 A;  3DHQ A;  2A6H C;  4IJH A;  2C35 B;  4GLX A;  2K03 A;  1JWS D;  3UE0 A;  5A2Q E;  1PH6 A;  2KHS A;  4AQY L;  4KK7 A;  2YTX A;  1ESF A;  1CT1 D;  4JI7 L;  4LFA L;  2IY5 B;  1EIG A;  1VCI A;  3FKI H;  3SXH A;  1BCP B;  3GTL B;  1LV9 A;  2G9D A;  4DXG A;  3H15 A;  3NBH A;  1VQF A;  2IX1 A;  4JI5 L;  5C5L A;  1B70 B;  1EQV A;  4MTK A;  2CQO A;  1EQT A;  2KA7 A;  4OWX B;  1B3A A;  1QWY A;  3BDO A;  3ULL A;  4HIK A;  2WAQ E;  3H0G B;  2K5W A;  5CYU A;  1O80 A;  2K04 A;  4R4O A;  2AHO B;  2L5T A;  4CBV A;  4BXX H;  3HG9 A;  4DV7 Q;  2CH4 W;  5DLQ E;  5JJZ A;  1T5X D;  5C3X A;  3JC6 6;  2OCE A;  1KAA A;  4IFD H;  1LYL A;  4G7Z C;  4IUV A;  4A3E G;  4C3H G;  1C8C A;  4JV5 Q;  3X3M A;  5K36 H;  1EU4 A;  2RA4 A;  4XQQ A;  2BOS A;  5KYL A;  5C44 B;  4A3I B;  4N9P A;  4PG3 A;  4TKO B;  1VQ6 A;  3CCE A;  2Q2T A;  3DMU A;  3I8Z A;  4QB4 A;  3NBH B;  3D0F A;  2EYO A;  3C2P A;  1H9M A;  2JSO A;  4NPS A;  4DV4 Q;  3V96 A;  4ZRZ A;  3NEN A;  3C46 A;  2HUG A;  3FVQ A;  1VQN A;  1BBW A;  3R8B A;  4JI0 L;  4KTA A;  2EY2 A;  1B7Y B;  4JV5 L;  1CKN A;  3N52 A;  5CMD A;  1E1O A;  2A73 B;  2NVT B;  4APV A;  3X3N A;  5I4D A;  4RGT A;  3TN2 A;  2QEX A;  2UU9 Q;  2KHI A;  3M4Y A;  1PRT F;  2QDL A;  1AW7 A;  1PDQ A;  1IBM Q;  2F3V A;  1W2B A;  1XNQ L;  1LTI D;  1WOC A;  2FHT A;  1CZG A;  3F2C A;  5BN3 A;  4BXX G;  3QWN A;  2B2V A;  5IP7 H;  4DV5 Q;  4LF7 L;  1CSP A;  1A3V A;  2I5M X;  5EKL A;  3I4M B;  5M9O A;  2BCO A;  3HOX H; 
#chains in the Genus database with same CATH homology
 4GOP C;  4KHZ A;  2LSS A;  4AQY Q;  2F4V Q;  2NN6 I;  2JA8 H;  4IFD G;  1K3R A;  4JI7 Q;  3AFP A;  1X55 A;  4MNO A;  3S1Q H;  4OO1 G;  4RMF A;  1JB7 A;  5K36 G;  3CC2 A;  2VY3 A;  1EUJ A;  3JAM c;  3RZD H;  2JJQ A;  2YYZ A;  4POF A;  1YJ9 A;  1WJJ A;  1PH4 A;  3L2P A;  1C7Y A;  2BH2 A;  4A3E H;  5C4X H;  2CCZ A;  3S14 H;  4O0A A;  2N78 A;  3RNU A;  2ZM6 Q;  2UU9 L;  1D7Q A;  3GTL H;  1EQR A;  2WFW A;  1HJP A;  1PHJ A;  4GLA C;  1Z47 A;  4YY3 L;  4PZ6 A;  3UDF A;  1TXY A;  1VQC A;  1XNR Q;  1V43 A;  4AYB E;  1SR3 A;  4DR1 Q;  1NJI C;  2VQF L;  5JJI A;  1MKH A;  1N34 L;  1YHB A;  4GNX B;  1NE3 A;  1VQD A;  3G6E A;  2JA5 G;  1JJC B;  1QUQ B;  1UE5 A;  1HZC A;  1KC8 C;  1RIP A;  2E8G A;  1X56 A;  4JOI C;  4IPH A;  2R93 G;  1HNZ L;  3I4M G;  4DR7 Q;  2B63 G;  3IRB A;  4LWC A;  4IFD I;  1S3O A;  4JI4 Q;  5M3M G;  3M4Q A;  4OO1 I;  1Z9F A;  2OTJ A;  5IE8 A;  2HQL A;  4DR6 L;  1CSQ A;  1S40 A;  1Y1V G;  3HKS A;  2ZTC A;  3K7A H;  1QVC A;  1YZ6 A;  2AMC B;  2ZM6 L;  4UP9 A;  1YHA A;  3PF5 A;  4HIM A;  5M5Y H;  1Q1B A;  4GKJ L;  1VQA A;  2ZJQ A;  1OXS C;  1EOV A;  1UE7 A;  2IX0 A;  1Y14 B;  2NZO A;  1HR0 Q;  4DR4 L;  3CCM A;  4X6A H;  5IP7 G;  1M1K C;  4OXP A;  1XNR L;  2R7Z H;  1SN8 A;  2EQS A;  4P72 A;  1VQO A;  5C3E H;  4POG A;  4GN5 A;  4DV6 L;  2VS1 A;  1J5E Q;  1GM5 A;  1V1Q A;  3DM3 A;  4JCV E;  3T1H L;  2OQK A;  4QY7 A;  2ZTE A;  3I4O A;  1KRT A;  2NVX H;  3VDY A;  3HOZ G;  3PO3 G;  3K0X A;  1YVC A;  3K7U C;  3Q8D A;  4JI4 L;  1K73 C;  3A74 A;  5LMN W;  4JI0 Q;  1FL0 A;  4LF8 Q;  1YI2 A;  3DLL A;  4X66 L;  2MO0 A;  2KBN A;  1K8G A;  4JBM A;  1L1O C;  1X3F A;  1AE2 A;  4K0K L;  4LFC Q;  4QIW E;  2L15 A;  1IL2 A;  4A4I A;  1EWI A;  2RHS B;  3NEM A;  2I0Q A;  3HOV H;  1C9O A;  1IYJ B;  2AWN A;  4GN4 B;  2ZJP A;  1EQQ A;  4JBJ A;  3PSI A;  4A3C G;  4R4C A;  4A75 A;  3RZO H;  2JA9 A;  4B3T L;  4NXM Q;  2NVT H;  2UXD Q;  1YJW A;  1XNQ Q;  1CKO A;  2RF4 A;  3CC7 A;  4DR3 Q;  3M7N A;  2UXC L;  5AJ3 Q;  1QZG A;  2N8N A;  1I3Q H;  1VQH A;  2PI2 E;  1J5E L;  1BBU A;  4X64 L;  2A19 A;  3HOY G;  5IY0 A;  4R4Q A;  5C0X J;  1IBK Q;  2WB1 E;  4LF7 Q;  1OXV A;  4LF4 Q;  3K8A A;  4UP8 A;  2E2I H;  4C3I H;  2JA5 H;  4JYA Q;  2UXB Q;  5GAD C;  4LF9 L;  3TS2 A;  5GRO A;  2I5L X;  1SE8 A;  2KCM A;  1HZ9 A;  4LF8 L;  1JJG A;  3ULJ A;  4DV0 Q;  3I7F A;  4DR5 L;  4DR2 Q;  2ES2 A;  5FLM G;  2FXQ A;  2HIV A;  4HJ9 A;  2OTL A;  5M3M H;  1G51 A;  2D0P A;  3T1Y L;  2MNA A;  4DUZ L;  3FP9 A;  1PH9 A;  2JQO A;  2PI2 A;  1Y1V H;  1B8A A;  3NEL A;  4ALP A;  4HIO A;  1VS0 A;  5IP9 H;  1N32 L;  1IXR A;  4GS3 A;  3W5O A;  4R1J A;  5IYB G;  4NXM L;  2UXD L;  4DR3 L;  1G29 1;  2IT1 A;  1I94 Q;  5AJ3 L;  1JMC A;  2K5H A;  4XTC S;  4O2D A;  2K5N A;  2AKW B;  4JG2 A;  3GTJ H;  4YY3 Q;  4LF6 L;  4OWW B;  4TQU S;  1IBK L;  1MIU A;  2F52 A;  2Y0S E;  2A8V A;  4AYB G;  4A3F G;  3S1N H;  2VQF Q;  5J3B A;  1N34 Q;  4JYA L;  1IZ6 A;  4A3G H;  3PO2 G;  1L0W A;  3HOZ H;  3I4N G;  1FVI A;  2MFI A;  3UDI A;  3J81 i;  1VQL A;  4AH6 A;  4DV0 L;  5IYC G;  3I56 A;  4DR2 L;  1N36 L;  5HGQ A;  1HNZ Q;  1L2F A;  3PO3 H;  3A0J A;  1HNX Q;  3EIV A;  4BA1 I;  4FDB A;  5JEA J;  1L1O A;  3KLW A;  3UDG A;  2PQA A;  4JC0 A;  2VUM G;  2OQ0 A;  4BY7 H;  4DR6 Q;  1KHI A;  1YNX A;  4JI6 L;  3HOV G;  2AWO A;  1KAW A;  3J80 i;  1E1T A;  3CPF A;  2YTV A;  1EIY B;  4KHP Q;  4YCV A;  4BA2 I;  1C0A A;  2VW9 A;  3S16 H;  1RL2 A;  1UE1 A;  1I94 L;  2A1A A;  4GKJ Q;  2GVB A;  2JEA I;  3CP0 A;  1GVP A;  1VQG A;  3F8T A;  4DR4 Q;  4A3C H;  3CCR A;  4BBS H;  1UWV A;  1OXT A;  2K14 A;  4LFB L;  3G4S A;  4QJF A;  1WYD A;  1TWG H;  2VL6 A;  1QVF A;  1YEZ A;  4DPG A;  2D62 A;  4DV6 Q;  1D8L A;  2K50 A;  1XMO Q;  1Q82 C;  3HOY H;  3HFZ B;  3T1H Q;  3LGJ A;  4A3M G;  3UE1 A;  1HZA A;  3BJU A;  4L5Q A;  4R4T A;  3UDX A;  1HNX L;  2CWA A;  2NVY H;  3CCJ A;  2OWO A;  4LW1 A;  1VQ8 A;  1JT8 A;  1OXX K;  3KF8 B;  4X66 Q;  4DV2 L;  5JJL A;  5FLM H;  1Y1W H;  1WI5 A;  5IP9 G;  4KHP L;  2K52 A;  4DAM A;  2R7D A;  1S72 A;  4LF5 Q;  3CD6 A;  4K0K Q;  1XPR A;  3HOW G;  4B3S L;  4RG1 A;  1KL9 A;  4A3D G;  1L1O B;  4XIG S;  2E5L L;  2PQA B;  3J7Z C;  1MJC A;  4P73 A;  5IYB H;  5ELO A;  3W1G A;  2F3I A;  1PH5 A;  4B3T Q;  4A3K H;  1VQM A;  1K0R A;  3ULP A;  4JI1 L;  3U58 A;  2UXC Q;  4EX5 A;  4DK6 C;  3HKZ E;  4X65 L;  4A3G G;  3I2Z A;  1Q46 A;  1GD7 A;  2Z0S A;  4KLK A;  4X64 Q;  3CCV A;  4DV3 L;  2CFM A;  2H5X A;  1XMO L;  1OTC A;  3K80 C;  2UUB L;  3GTG H;  3S1R H;  1U0L A;  5IYD G;  2E2H H;  2WB1 G;  4P71 A;  4A3F H;  2EIF A;  1P16 A;  4GOP A;  1SMX A;  1LUZ A;  4IFD J;  1TWF H;  3GTP H;  3S2H H;  3PO2 H;  1UEB A;  2PMZ E;  4LF9 Q;  2R6G A;  3CMA A;  3EN2 A;  4HID A;  4A3J G;  3J81 c;  3BZC A;  1Q81 C;  2JA6 G;  3I4N H;  3U50 C;  5IYC H;  1MJE A;  2EXD A;  4BY7 G;  4DR5 Q;  5LMU Q;  3GTQ H;  3H3V H;  4DUY L;  1VQJ A;  4IPC A;  4YHH L;  3BZK A;  4LF5 L;  3PF4 A;  2IHE A;  4BY1 G;  5GAH C;  3T1Y Q;  1CUK A;  3CF5 A;  5BR8 L;  4DUZ Q;  2ID0 A;  1K8A C;  2R92 H;  2VUM H;  4A3L G;  1O7I A;  1SRU A;  4Y7N H;  1E22 A;  2DUD A;  4J15 A;  5GAG C;  4DK3 C;  3M85 A;  1N32 Q;  4GN3 B;  4L5T A;  4BBS G;  2CKZ B;  1ASY A;  2WP8 J;  1VQ9 A;  3M3Y H;  1W3S A;  3S2D H;  1VQ7 A;  1VQB A;  3JAM i;  4LF6 Q;  4B3R L;  2Z6K C;  4KI0 A;  2Y0S G;  2VZA A;  5JEA G;  5FJ8 H;  1XJV A;  3U4Z A;  2BA1 A;  4JI2 Q;  4JOI A;  3PUW A;  5IT9 c;  3TS0 A;  3PUX A;  4MZ9 A;  1WFQ A;  2BA0 A;  1IBL L;  4A3M H;  4JBK A;  2V1C C;  1NMG A;  2ASB A;  3AFQ A;  2LXJ A;  2YTY A;  3AYH B;  3ERS X;  3M9B A;  3A5U A;  5LMU L;  4JI3 L;  1N36 Q;  3M4O H;  4B3M L;  4LUO A;  3STB C;  2MO1 A;  1Y1W G;  1HZB A;  1Q12 A;  2Q2H A;  3J7A 5;  4GOP B;  1R9T H;  4AIM A;  4BBR H;  3CAM A;  2LXK A;  3RR5 A;  4HJ7 A;  1VQP A;  1CKM A;  1EFW A;  3KYH C;  3S1M H;  1A8V A;  1GKH A;  1NTG A;  2B29 A;  3W1B A;  1QVG A;  3ZJY C;  4OX9 L;  4JI6 Q;  1WCM G;  3L0O A;  4WJ4 A;  3U4V A;  1I5F A;  3HOW H;  1Q86 C;  4L5R C;  4A3K G;  3G71 A;  4A3D H;  2ATW A;  4DV7 L;  3RN5 A;  1AH9 A;  3FKI G;  1K83 H;  3KDF A;  4PMW A;  2UUC Q;  1FJG Q;  3OTO Q;  2XGT A;  1EYG A;  4LFB Q;  4DAY B;  5EAY A;  1VQ4 A;  1PH8 A;  4DV1 L;  4UPA A;  4JI2 L;  3PIP A;  2PNH A;  1X3G A;  4GLV B;  1PA6 A;  3GO5 A;  1N33 L;  3KF6 A;  1TWH H;  3PCO B;  5IYD H;  4OON A;  3J81 j;  1XPU A;  1OXU A;  5LMN Q;  1HNW L;  1LTL A;  5M5X H;  4A3B H;  3E0E A;  4PZ7 A;  1XPO A;  4A3J H;  2JA6 H;  3CC4 A;  1X54 A;  3MXN B;  1HR0 W;  1VQE A;  2R92 G;  1A63 A;  2VQE Q;  1NY4 A;  4LUZ A;  1XTD A;  3ER0 A;  4ME3 A;  4DV2 Q;  1N9W A;  1UE6 A;  3F2B A;  3AQQ A;  2ZJR A;  4DV4 L;  4YCW A;  4BY1 H;  5H1S E;  3HOU G;  1KRS A;  4GKK L;  4B3S Q;  2IHF A;  4YWL A;  3PV0 A;  5M5W H;  4A93 H;  1Q8K A;  4A3L H;  3PUY A;  2JE6 I;  2KHJ A;  3RLN A;  4DKA C;  2HIX A;  2E5L Q;  3GTK H;  2UUC L;  1FJG L;  3KFU A;  3OTO L;  1Q1E A;  3A5Z B;  1ASZ A;  2NVQ H;  4NXN L;  3CCQ A;  3WWV A;  3RN2 A;  3L7Z C;  4IOC A;  1TWA H;  4PZ8 A;  4LFA Q;  4JI8 Q;  1JJ2 A;  3RLF A;  5FJ8 G;  2UUA L;  1P8L A;  4JI1 Q;  2Z6K A;  1SLJ A;  4WJ3 M;  1SFO H;  4X65 Q;  3HKZ G;  2VNU D;  1AE3 A;  4DV3 Q;  4A76 A;  4UY8 C;  3F1Z A;  1KD1 C;  2UUB Q;  1BKB A;  3KDF B;  4IOA A;  4Y52 H;  5ELN A;  2CWP A;  4C3H H;  5LMN L;  2K75 A;  4IJL A;  3CXC A;  4JI5 Q;  3K81 C;  2XTI A;  1GO3 E;  5C4J H;  1IBM L;  2K4K A;  1X9N A;  1CKN B;  4TVA B;  3H3V I;  4BBR G;  1H95 A;  2B3G A;  3F2D A;  2VQE L;  3RLO A;  3KF6 B;  4HJ8 A;  1A0I A;  4DUY Q;  4HJA A;  4YHH Q;  1YJN A;  1T9H A;  4DV5 L;  2WAQ G;  4IJH A;  5FLX c;  2JA7 H;  2C35 B;  4GLX A;  3TEH B;  5BR8 Q;  4EQ5 A;  4B3R Q;  1EIF A;  3UE0 A;  1WCM H;  5C0X G;  2Q2U A;  1A62 A;  4IO9 A;  1PH6 A;  3OYY A;  3H0G H;  5HY6 A;  4AQY L;  4MTN A;  1YHQ A;  2YTX A;  2F4V L;  1X6O A;  4JI8 L;  4JI7 L;  1YBY A;  4LFA L;  2IY5 B;  3PUV A;  1QZH A;  1VCI A;  3FKI H;  3M4P A;  1VQI A;  5M3F H;  1M90 C;  1PVO A;  5GQO A;  1FGU A;  2RCN A;  1KXL A;  4X62 Q;  3H15 A;  1PFS A;  4HJ5 A;  1KQS A;  1VQF A;  3CCL A;  2IX1 A;  4A3B G;  1YIJ A;  2R7F A;  4JI5 L;  1B70 B;  1X3E A;  1PH7 A;  2Q2I A;  1IBL Q;  4YCU A;  3E9H A;  1PH2 A;  2KEN A;  2CQO A;  3AEV A;  2RHQ B;  4YWK A;  4YWM A;  4OWX B;  3SGI A;  3STB D;  1LM0 A;  4JI3 Q;  1E3P A;  3ULL A;  5C44 H;  4GNX C;  2WAQ E;  3CCS A;  4HIK A;  4A3I H;  4B3M Q;  4DR1 L;  1Q7Y C;  4A93 G;  3S15 H;  4R4O A;  4OX9 Q;  2AHO B;  4BXX H;  3J80 c;  2HHH Q;  4JBW A;  3HOX G;  3HOU H;  5C0X I;  2JA8 G;  4QGU A;  4QL5 A;  1KIX A;  1VQ5 A;  4DR7 L;  4NB3 A;  3CCU A;  1I50 H;  4DV7 Q;  4H02 A;  3MEF A;  4QQB X;  5DLQ E;  2E2J H;  4LNQ A;  2N49 A;  2QGQ A;  3OW2 A;  3JC6 6;  4C3J H;  2OCE A;  1G6P A;  1LYL A;  3BU2 A;  4L5S A;  3PIO A;  4X62 L;  4A3E G;  4JV5 Q;  5C4X G;  1SRO A;  3GDE A;  2ALY B;  4DV1 Q;  1YIT A;  1XMQ Q;  5GAE C;  3HOX H;  1BVS A;  2ZTD A;  3I55 A;  2I5H A;  4PG3 A;  2MQH A;  1N33 Q;  1VQ6 A;  4R4I A;  3CCE A;  5IWA Q;  3CW2 C;  3S24 A;  2Q2T A;  1HR0 L;  1HNW Q;  3E9I A;  3KJP A;  1DGS A;  4P75 A;  1JE5 A;  3NBH B;  3TRE A;  2JA7 G;  3D0F A;  2KCT A;  2YV5 A;  4UP7 A;  4DNI A;  2NZH A;  1NBW A;  2JK8 A;  4IPG A;  2HHH L;  1U5K A;  2BH8 A;  5E7N A;  1PV4 A;  4NPS A;  4DV4 Q;  4C2M H;  1X65 A;  3CPW A;  3TRZ A;  3H0G G;  3KOJ A;  4GKK Q;  3NEN A;  3GTO H;  1HH2 P;  2GVA A;  5M3F G;  3B6Y A;  1VQN A;  1BBW A;  2NN6 G;  1E24 A;  4JI0 L;  5JJK A;  1V9P A;  3GD7 A;  4NXN Q;  2R93 H;  2YU9 H;  1B7Y B;  4JV5 L;  3I4M H;  2B63 H;  4IPD A;  2N3S A;  2UUA Q;  1XMQ L;  3ICE A;  1CKN A;  2DGY A;  1PH1 A;  4LFC L;  1E1O A;  3TQY A;  2K5V A;  4APV A;  1N8R C;  5IWA L;  4P74 A;  2QEX A;  1I6H H;  1PH3 A;  2HT1 A;  1E7Z A;  5C44 G;  4A3I G;  4OWT B;  2UU9 Q;  3S17 H;  1J6Q A;  2KHI A;  1VQK A;  1IBM Q;  3FHW A;  3CQZ H;  4GNX A;  2GN5 A;  1W2B A;  2QA4 A;  1XNQ L;  2R7Z G;  1QUQ A;  2D0O A;  5C3E G;  1WOC A;  1PYB A;  3F2C A;  1PYS B;  4BXX G;  1K9M C;  3PUZ A;  2JEB I;  5IP7 H;  4LUV A;  4DV5 Q;  4LF7 L;  1CSP A;  4LF4 L;  3KJO A;  3PGZ A;  2I5M X;  3EBE A;  2UXB L;  3GTM H;  1TWC H;  3CME A;  3D31 A;  1NMF A;  3G48 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...