3KOJA

Crystal structure of the ssb domain of q5n255_synp6 protein from synechococcus sp. northeast structural genomics consortium target snr59a.
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
102
structure length
89
Chain Sequence
HHSHMNSCILQATVVEAPQLRYAQDNQTPVAEMVVQFPGAPARLKVVGWGAVAQELQDRCRLNDEVVLEGRLRINSEKQTELTVTRVHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein ycf41
publication title Crystal structure of the SSB domain of Q5N255_SYNP6 protein from Synechococcus sp.
rcsb
source organism Synechococcus elongatus pcc 6301
molecule tags Dna binding protein
total genus 14
structure length 89
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3kojA00
4DR6Q 5C44H 1WYDA 2JA5G 4JI2L 4GLVB 1IBKL 2ZJRA 3NBHB 1HZCA 3F1ZA 1EYGA 4BBSH 4A93G 1XMOL 1FGUA 3FHWA 4LFCQ 1EUJA 3F8TA 4JI1L 2R93H 1L2FA 4IPGA 2R92G 2YU9H 5IP9G 2C35B 4YCUA 1GD7A 3EN2A 4LFAL 4LF9Q 3HOYG 2NVQH 2I0QA 2UU9Q 2K52A 4BA1I 2ZJPA 1XPUA 2VL6A 4KHPL 3HKZG 1EFWA 3LGJA 3PCOB 1UEBA 4HIMA 1S40A 1IBKQ 2PQAA 3G71A 4GS3A 1JJGA 1V9PA 4BBRH 1GKHA 1XMOQ 4GKKQ 4JI1Q 4QGUA 1V43A 4TQUS 4O2DA 4LFAQ 4A3KG 2ZTDA 1N36L 2UXCL 4PZ6A 5ELNA 4A3JH 3STBC 4DV5L 2B63H 1FVIA 2F3IA 4A75A 3J7ZC 2F4VL 4IJLA 4K0KL 1HR0L 3PO2G 2Q2HA 3CMEA 4HJ5A 3CCRA 4L5RC 4B3SL 3AYHB 3K7UC 2Z6KC 3HOUH 4OO1G 5C44G 2HIXA 3E0EA 2MQHA 3G48A 3NEMA 2KBNA 4GNXB 4OWWB 1WJJA 1EQRA 2MO0A 4OO1I 3CC2A 2UXCQ 3PV0A 1CKNA 4LF4L 3JAMi 2F4VQ 1D8LA 1NMFA 3KJPA 4AQYL 5FLMH 1HR0Q 1X56A 3TRZA 4K0KQ 1O7IA 4R4QA 2R7DA 1Q82C 2VZAA 1QZHA 1J5EL 1JJCB 2IY5B 3G6EA 4L5QA 1TWAH 1VQMA 4BBRG 1PYSB 2R6GA 3EBEA 4OXPA 3M7NA 1JT8A 2E2IH 4A3MG 1G51A 4R1JA 5LMUL 5IWAL 4LF4Q 4OONA 2GVAA 3W5OA 1N33L 4AQYQ 4A3JG 2B63G 4B3RL 5LMNQ 2ZJQA 1J5EQ 4KHZA 2UUBQ 4QJFA 1SE8A 1EWIA 1SRUA 1U0LA 2IHFA 3KDFA 5IP7H 3HOUG 2AHOB 2YTYA 3PF4A 1LYLA 3K0XA 5LMUQ 3RLFA 5IWAQ 1IBLL 5M3MG 1N33Q 3M85A 4GOPC 4DV2Q 3AEVA 5J3BA 1K9MC 4X65Q 1VQGA 5HGQA 4B3RQ 1VQ4A 4LF5L 4WJ3M 1YITA 5FLMG 4PZ8A 4DR5Q 1PH9A 3I4MH 3S15H 1K83H 2OQ0A 3KJOA 1CKMA 4XTCS 4BY1H 5C4XG 5DLQE 4IPDA 2JA8H 3S17H 2JA7G 3Q8DA 1PVOA 1HJPA 1PH7A 1YVCA 3CPWA 5ELOA 3CCQA 1XPRA 3GTOH 1Q1EA 3KF8B 3PUYA 3HOXH 2AWNA 1SN8A 2GVBA 3PUXA 4UP9A 1QVCA 3U4ZA 2LXJA 2N78A 5C0XJ 3RN5A 4LF5Q 3H3VH 1TWFH 1X3EA 3HOVH 4IO9A 3VDYA 5IYBH 1MKHA 1VQ7A 2E8GA 4GNXA 1YHAA 4QQBX 4QIWE 3OTOQ 3GTLH 2NN6I 3UDGA 2ID0A 3UE1A 4DR3L 1LTLA 2JA5H 4LF7Q 2PI2E 3KLWA 2OWOA 1PH3A 3M4QA 1HZBA 1X6OA 4KHPQ 2A1AA 4DV1L 1YIJA 1UE6A 3EIVA 2HT1A 1OXTA 1VQKA 2NVTH 2BA0A 5IP9H 1Z47A 4A3CG 4BY7G 2HIVA 1HNZQ 1M1KC 4JYAL 4O0AA 4LW1A 3K8AA 4LF8Q 1I3QH 2OCEA 2JEBI 3B6YA 4DR3Q 2R7FA 4JI3L 2ASBA 4OX9L 2VS1A 4UP7A 3HOXG 2KHJA 1IXRA 2EQSA 1VQBA 2WFWA 4OWTB 4DV1Q 1I94Q 3PUVA 2IX0A 1AE2A 4JOIC 1N8RC 3HOVG 4EQ5A 2AMCB 4LFCL 4A3DG 5IYBG 4JBMA 4MTNA 1OXVA 1YZ6A 1QZGA 1Q1BA 4PZ7A 3PIPA 1W3SA 5GAGC 3H3VI 4KLKA 3BU2A 4JV5Q 4HIOA 1YEZA 2NZHA 2ATWA 1I50H 1HZ9A 2XTIA 3UDFA 1CSPA 4GN5A 4P72A 3KDFB 1R9TH 1WI5A 4LUZA 4C2MH 1A8VA 4KI0A 1CUKA 1V1QA 1B70B 4IFDJ 5JJKA 1IYJB 3D0FA 3GTGH 1UWVA 1HNXL 4AYBE 4DKAC 3TS0A 4PG3A 4UPAA 1EIFA 3RN2A 1M90C 1VQ8A 1S3OA 4HJ9A 1QVGA 1SLJA 2LXKA 5IYCH 4JBKA 3S1MH 4A3MH 1MJEA 5IYDG 3FKIG 1WOCA 5GADC 1Y1WH 1A62A 1EQQA 2CQOA 1AE3A 2Q2UA 3S24A 4L5SA 1FJGL 1HNXQ 1XNRL 4A93H 2BH2A 4JG2A 3ULPA 2I5HA 1QVFA 4DV0L 2ES2A 1J6QA 2H5XA 1VQ5A 1UE7A 3T1YQ 4IOCA 3T1HQ 1KRSA 4GKJL 4A3LH 3STBD 3UDXA 3I2ZA 2KENA 3CPFA 5M3MH 3CCJA 4GOPA 4A3FG 3S14H 3CCSA 2XGTA 4BA2I 1AH9A 1FJGQ 2N49A 1YHQA 2PMZE 2YTXA 3BZKA 1XNRQ 3NELA 2UXDL 3ERSX 1IL2A 1Q46A 4LWCA 1GVPA 3M9BA 4R4OA 1GM5A 4JI8L 1XPOA 4DAYB 4AIMA 4AYBG 3BJUA 1EOVA 5C4XH 2VQEL 5LMNL 4DV0Q 1D7QA 3RLOA 1TXYA 2UUBL 2JA7H 2Q2IA 4MNOA 4X62L 1NBWA 3IRBA 1Q86C 2VQFQ 4GKJQ 5IYCG 1P8LA 1KRTA 5E7NA 1MJCA 2QA4A 4DK3C 5JEAJ 2AWOA 1LUZA 5IY0A 1Y1WG 4DR2L 4DV2L 2E5LL 4LF6L 2UXDQ 1DGSA 5JJLA 3K81C 1SR3A 4X65L 2BH8A 4P73A 4JI8Q 2VQEQ 3SGIA 2IT1A 3NENA 4HJAA 1JJ2A 4POFA 2D0PA 4DR5L 3S1RH 3CCUA 3ZJYC 4DPGA 2IX1A 1KL9A 4X62Q 1VQIA 4HIDA 3PO3H 3E9HA 2UUAL 4A76A 4RMFA 4DUYL 1U5KA 1OXUA 1G6PA 4A3LG 3KF6A 2Z0SA 1ASYA 2N8NA 3L2PA 4LF6Q 4HJ8A 4DR2Q 2E5LQ 4GLXA 4JBWA 4NXMQ 1XNQQ 1NY4A 1Z9FA 4A3CH 4BY7H 3CC4A 4NB3A 3G4SA 2WB1G 3KOJA 4IPHA 2JA6H 1SMXA 3W1GA 3GD7A 1KIXA 3TS2A 2UUAQ 4P74A 1WFQA 5AJ3Q 4DUYQ 3J81j 2NZOA 2I5LX 4H02A 3OTOL 4LUVA 3PF5A 3GTKH 1Y1VH 2CFMA 3S16H 4DNIA 4DAMA 1CSQA 4LF7L 1VQDA 4JOIA 3GTQH 2K14A 1VQHA 2RHQB 4A3DH 3AQQA 2Y0SE 4IJHA 4X66L 1FL0A 1VQNA 2VUMH 2NN6G 4YWKA 1S72A 1X9NA 1HNZL 4B3MQ 1BBUA 1E1OA 2CCZA 4DR4L 1B8AA 3RZDH 1N34Q 5GQOA 3CP0A 2F52A 3U4VA 4LF8L 3PO3G 2OTJA 3CCEA 3PGZA 4A3GG 1VQLA 1OXSC 4A3IH 4P75A 1I94L 1RL2A 4X66Q 3E9IA 3W1BA 1HR0W 4RG1A 1N32L 4XIGS 4C3HH 2K5NA 1KC8C 1PA6A 4GOPB 2JA6G 4DR4Q 3MXNB 2YYZA 3HOWH 4DUZL 3HKSA 2JJQA 4PMWA 1NMGA 4JV5L 1X3GA 2OTLA 4L5TA 2UXBL 1Y1VG 1QUQA 4GLAC 4R4TA 4YCWA 4YHHL 1PH4A 3A5UA 1ASZA 4HJ7A 1PHJA 1K3RA 1N32Q 2EXDA 4JI5L 3FKIH 1W2BA 2JQOA 3HOZG 2Y0SG 2VUMG 4LFBL 5IYDH 3KFUA 2D62A 4JI4L 3CF5A 4BXXG 2HQLA 2EIFA 2JE6I 1LM0A 1WCMG 4DUZQ 3S1NH 2UXBQ 4YHHQ 1VQ9A 5JEAG 3S2DH 2VY3A 3AFQA 3ULJA 1T9HA 3RZOH 2MO1A 1Q12A 1CKOA 3J81i 1HZAA 4A3IG 4JI5Q 4LFBQ 4A3FH 2RCNA 4JI4Q 1E3PA 3GO5A 4A3BH 4LNQA 3KF6B 1OTCA 3UDIA 1K0RA 2N3SA 4DV6Q 3HOWG 1TWHH 4DR7L 3U50C 3RLNA 2KHIA 2YTVA 2CWPA 5EAYA 1YJ9A 4NPSA 1VQFA 4AH6A 2PI2A 3T1YL 4LUOA 2ZM6L 2GN5A 2QEXA 3T1HL 2MFIA 1HH2P 4DV3L 4DV7Q 1KD1C 1JB7A 1VQCA 5IE8A 1OXXK 1PV4A 1KQSA 2WP8J 1YHBA 1UE5A 1VQAA 3D31A 3J81c 1VQJA 5BR8Q 1VQ6A 4DR7Q 1L1OA 5C3EG 3S2HH 2FXQA 3K7AH 2R7ZG 1BKBA 5HY6A 3GTJH 4A3EG 3FP9A 4UP8A 1UE1A 1IBML 2KCMA 2ZM6Q 2K5HA 4IPCA 4R4CA 4NXNL 4DV3Q 4HIKA 3A74A 2VQFL 4JI2Q 2NVYH 1A63A 1VS0A 1NJIC 4JI0L 3F2BA 4UY8C 4A3BG 1RIPA 1G291 1E24A 4YCVA 3U58A 3PUZA 4ALPA 1SFOH 3J80c 3OW2A 4A4IA 1PYBA 2Q2TA 4OX9Q 2WB1E 4YY3L 4X64L 3M4OH 1I5FA 1Y14B 1X55A 1IBMQ 4C3JH 2AKWB 2UUCL 4NXNQ 2B29A 5FLXc 3TREA 1XMQL 1PH6A 1Q8KA 2WAQE 3TQYA 3CQZH 4JI0Q 3PSIA 1PH2A 4QL5A 4BBSG 1QUQB 3CXCA 4NXML 1XNQL 5H1SE 4POGA 2L15A 2R93G 4X64Q 4YY3Q 4X6AH 3CCVA 1N36Q 1E7ZA 2E2HH 1L1OC 5M5WH 4DV5Q 2A19A 2UUCQ 1Q7YC 2LSSA 4WJ4A 1XMQQ 1Q81C 1VQEA 2K4KA 1VQOA 1K73C 1X54A 1TWCH 5AJ3L 4B3SQ 5IT9c 4DK6C 3F2DA 3WWVA 1SROA 3H0GH 4A3GH 3PUWA 1GO3E 2K75A 4GN3B 2ALYB 5M5YH 2IHEA 4J15A 3UE0A 1YNXA 1PFSA 3I4OA 5K36G 2MNAA 1X65A 3BZCA 3I7FA 2I5MX 3I4NH 2RHSB 3KYHC 3CMAA 2CWAA 2CKZB 2K5VA 4C3IH 5FJ8H 2A8VA 2PNHA 4R4IA 4B3ML 1C0AA 4P71A 1N9WA 4GN4B 3DM3A 1N34L 5GAHC 2WAQG 3JAMc 3L0OA 2DGYA 4YWMA 3A5ZB 4QY7A 2JA9A 4EX5A 1A0IA 3ULLA 1YBYA 1JE5A 3HOZH 5C0XG 1JMCA 1X3FA 4BXXH 3M4PA 1K8GA 1EIYB 1WCMH 1TWGH 3GDEA 5C0XI 3A0JA 5C4JH 4Y52H 1L1OB 2V1CC 5M3FH 3ICEA 2BA1A 3ER0A 1MIUA 3H0GG 3MEFA 4YWLA 1C7YA 5GAEC 3H15A 1VQPA 1IBLQ 2KCTA 3TEHB 1C9OA 1KHIA 3CD6A 5JJIA 4DR1L 1XTDA 3F2CA 1K8AC 4JC0A 3I4NG 1IZ6A 1I6HH 2PQAB 1KXLA 4JI6L 5M5XH 2NVXH 5FJ8G 4JCVE 1PH1A 3DLLA 1PH5A 3CAMA 3CC7A 2OQKA 2QGQA 3CCMA 4JI7L 5IP7G 3I55A 1XJVA 3S1QH 1PH8A 4OWXB 4ME3A 2D0OA 2ZTEA 3AFPA 3CCLA 2DUDA 4DR1Q 3J7A5 5LMNW 1L0WA 4TVAB 1BVSA 3K80C 4JI6Q 3JC66 3PIOA 2JEAI 2HHHL 2R92H 5C3EH 1HNWL 5GROA 2R7ZH 3I4MG 4DV4L 4DV6L 4A3EH 3HOYH 3HFZB 1B7YB 4JI7Q 3L7ZC 3GTPH 1YJWA 4BY1G 5M3FG 1CKNB 1P16A 3RNUA 1NE3A 1NTGA 1E22A 2K50A 3HKZE 2VW9A 4B3TL 2JA8G 2E2JH 1E1TA 4IOAA 4Y7NH 4GKKL 2ZTCA 3RR5A 4DV7L 4FDBA 3M3YH 4DR6L 1YJNA 2HHHQ 4APVA 1HNWQ 4MZ9A 2YV5A 1YI2A 4DV4Q 4IFDG 2VNUD 4A3KH 5BR8L 3I56A 2JK8A 1H95A 4JYAQ 1BBWA 3OYYA 4LF9L 4JI3Q 4B3TQ 3PO2H 3CW2C 1KAWA 4GNXC 4IFDI 2B3GA 1VCIA 3J80i 4JBJA 2UU9L 2Z6KA 3GTMH 2RF4A
chains in the Genus database with same CATH superfamily
1VF5C 3GV6A 1WYDA 1S5FD 4BBSH 4RKLA 1CHQD 3T51B 3F8TA 4LFCQ 4JI1L 1L2FA 2A73B 2YU9H 2C35B 4YCUA 5EBDA 3HOYG 4KTAA 4BA1I 1STEA 3LGJA 1IBKQ 4XQNA 2F0SA 3R3OA 1V9PA 1XMOQ 3AB9A 3CQZB 4QGUA 1V43A 2CW0D 4PZ6A 1HQRD 2DNCA 1C0AA 4A75A 1JICA 5IT9L 2FINB 3CMEA 3CCRA 3HOUH 4B3SL 1Q8IA 4ZK9B 3G48A 2MQHA 2R3ZA 2TMPA 4U673 4A3GB 1BUVT 2A5HA 3KJPA 1EYCA 3MEHA 2VZAA 4H44C 3M7NA 2N88A 2E2IH 4A3MG 2E76C 2Z6BA 1NR2A 4R1JA 5IWAL 4R8IA 4OONA 3D8GA 1ILQA 2K33A 4FXGC 2VUMB 1DXMA 3TMEA 2L11A 1HFNA 4K5VA 2UUBQ 1U0LA 3KDFA 5IP7H 2EYPA 3HOUG 4RHSA 3DXJC 3E0JA 3AMUA 1LYLA 4KKTA 2EJFC 3K0XA 5LMUQ 3RLFA 2CH4W 4IUPA 5M3MG 4A3IB 2Q8IB 4NP5A 4IUQA 4X65Q 1K9MC 4B3RQ 2M00A 2HCIA 3GV3A 3SHLA 1T5XD 2B2TA 4ME5A 1PH9A 2OQ0A 4BY1H 1S5BD 2JA8H 3Q8DA 1PVOA 1HJPA 3CPWA 1ILPA 1LTGD 3GTOH 2HDMA 3PUYA 4I7AA 5BN5A 1SN8A 2GVBA 3RN5A 4LF5Q 2N78A 1LACA 5IYBH 2XIWA 1I4GA 3BG3A 4GNXA 1O7YA 4QIWE 5C3EB 4CKEA 2PI2E 2OWOA 1HZBA 1X6OA 4IUVA 4KHPQ 2HT1A 2B2TC 5C4ZA 4JYAL 4O0AA 4LF8Q 1IW7D 1K3BC 2OCEA 4DR3Q 5CV9A 1STBA 4HMIA 4KD4A 3V2TA 4OX9L 3HS0C 5CGKA 4OWTB 3PUVA 2IX0A 3NQTA 1N8RC 3GTMB 1JOQA 5C3WA 4LFCL 4A3DG 5IYBG 5BN4A 1OXVA 1YZ6A 1QZGA 1PTOH 3MA2B 2GA4B 3NWTA 3BU2A 1EQTA 4HIOA 1KDCA 4OO1H 2NZHA 2ATWA 1HZ9A 3UDFA 4GN5A 4XDXA 4J1MA 3FVQA 2F03A 5LL6X 4KV6A 1BCPD 3K57A 4KI0A 2L4NA 1B70B 2F0KA 5JJKA 5EBCA 1WTPA 1UWVA 1HNXL 4OIJA 3RN2A 1F77A 5COYA 3K0YA 1S3OA 1RODA 5CV5A 1LABA 3NHHA 5JVH3 2PCFB 1HRJA 5IYDG 5GADC 1EQQA 1YNNC 1AE3A 3MWYW 3S24A 5CBEE 3U9OA 5IGGA 3HG9A 5KNCA 2F0PA 3ULPA 1QVFA 2ES2A 1J6QA 1VQ5A 1EEFD 2PQEA 4MTKA 3UDXA 3CCJA 3CPFA 4GOPA 3I3CA 3S14H 4DF7A 1TWAB 4BA2I 1FJGQ 2MPMA 2UXDL 2NZ1D 4C1NK 1GM5A 3I4NB 4RCNA 4DV0Q 3RLOA 2UUBL 3MTSA 4MNOA 4GKJQ 3IRBA 2EY1A 4XYQA 1CT1D 4QF4A 1KRTA 5E7NA 4DK3C 1GUTA 4X65L 1SR3A 4WRDA 2NN6H 4JI8Q 1G6ZA 4HJAA 4FYDA 1GUGA 3CCUA 3ZJYC 4LJZC 4JPBW 3I4MB 3SEBA 4J8QA 1GUWA 1SEBD 3UI2A 1U5KA 1G6PA 2EYHA 1WTRA 2N8NA 3L2PA 1ASYA 2B2WA 2E5LQ 2K28A 4LF6Q 2EVBA 1SNDA 3CC4A 2XWJB 3G4SA 3KOJA 4IPHA 1SMXA 3W1GA 1TWFB 2F0JA 3GD7A 1HFGA 1KIXA 3TS2A 4P74A 4OIKA 4LUVA 3SXHA 2CFMA 3E5SA 1DYQA 3Q6SA 1MSGA 4JOIA 3DMUA 1TS2A 2LMCB 2EPBA 2K14A 5EPLA 1YNJC 1HUMA 2Y0SE 4IJHA 2NN6G 2A69C 1X9NA 1G2SA 3IKJA 1BBUA 2CCZA 4LF8L 3HZXA 1ZYRD 3N52A 5HGTA 2B2WC 4P75A 3W1BA 4DK0A 1V1OA 4XIGS 4C3HH 1ZXTA 3N6RA 4DR4Q 2YYZA 3HOWH 4FO2A 3KBGA 1STYA 2FHTA 2K1BA 3D3RA 4HSVA 4J6HA 2HD3A 2OTLA 4L5TA 2UXBL 4YHHL 3R2TA 2NTTA 3MZ5A 4K5WA 1SYDA 1PHJA 1I50B 3FKIH 3SVMA 1PLFA 2Y0SG 4K14A 4JI4L 3CF5A 1SYBA 1WTHA 2HQLA 2SOBA 1LM0A 1WTOA 5DM63 2YU9B 1VQ9A 4H7BA 1NCVA 5KIXA 3QJYA 1CKOA 3J81i 2BE5C 4LFBQ 2WKCA 4A3BH 4V0BA 4LNQA 4DU9A 3KF6B 1Z7TA 4K5XA 4A3MB 5CR3A 4RGOS 3HOWG 4DR7L 2Z1CA 3RLNA 2YTVA 1YJ9A 3CRLC 4LUOA 1JB7A 4GKKQ 1KD1C 1PYWD 2QEJC 1KQSA 2K5WA 4G7OC 3I73A 1VQAA 1CQVA 3D31A 3J81c 1NSNS 1VQJA 5M3MB 3S2HH 3L3OC 2R7ZG 1BKBA 5HY6A 1A2TA 2KVMA 2PMZB 2PW7A 1KAAA 3FP9A 1IBML 2IJ0A 2CW0C 2ZM6Q 4R4CA 1A63A 1I4XA 1NJIC 4A3BG 4UY8C 3W3AA 2ICEC 1GHJA 3J80c 4A4IA 4BS9A 2BDOA 2LS01 3C46A 4C3JH 1PRTD 4KN4C 3VYTA 5A2QL 4Q5VA 3S1RB 1PH6A 2WAQE 2JYOA 4IUNA 3CQZH 1EY9A 3EA6A 3PSIA 3PIP3 1PH2A 2O4XA 4QL5A 3CXCA 4CJ2C 2R93G 4X64Q 3VR2A 1IYVA 5CV8A 2QKIC 4ZQ3A 2A19A 2UUCQ 5EQ0A 3KLSA 1Q81C 4QCLA 1VQEA 1JWMD 5C5LA 1VMCA 1I4HA 2NWGA 4A3GH 5CORA 1GO3E 2IWHA 2ALYB 2IHEA 1TY2A 2Z4HA 3I4OA 2MNAA 1X65A 3I7FA 3CMAA 3RUZA 4A3DB 4C3JG 2PNHA 2I46A 4R4IA 4P71A 3K5LA 4CHTB 1ML0D 1SNMA 2F1MA 4HMJA 4X3KA 2WAQG 1WD0A 1AEXA 5KRUA 4QIWB 4YWMA 1PZKD 1PTOD 2JA9A 1B2TA 3S2HB 3J7YW 4BXXH 1K8GA 1TWGH 2V1CC 2BA1A 5E3FA 5JJIA 1EYAA 4JI6L 1G8ZD 2HCCA 1PH5A 3CAMA 4N9PA 3A8KE 1K28A 4XYOA 1FNVA 3I90A 4UDUC 4OWXB 3NTHA 4ME3A 2D0OA 3I91A 1QILA 3AFPA 1D1KA 2DUDA 4DR1Q 3S2DB 1IW7C 4C1NI 2XNAC 2IW3A 4HN7A 4PNYA 3JC66 3EQLC 2R92H 5C3EH 5KEEA 4DV4L 3HFZB 3TP7A 3L7ZC 1AZPA 3A56A 1EY5A 1NE3A 3D4RA 3NPPA 4H13C 5T1IA 4GKKL 3ND9A 2ZTCA 5DEHA 3RD4A 4FDBA 4ULLA 3J81L 2HHHQ 3DWPA 4APVA 1WTQA 2EE1A 2JK8A 1H95A 3K5OA 3OYYA 4LF9L 1CZGA 4DXFA 1BCPC 3P20A 3GTJB 3H6MA 3GTMH 2JA5G 1QJOA 1CK1A 2JSOA 3F1ZA 3J80L 1RF2D 2D2CC 3FHWA 1EUJA 3R8BA 2NVYB 1X3QA 3QR8A 2R92G 1F2YA 3S14B 1GD7A 4LFAL 1SFOB 1DOMA 2QDLA 2NVQH 1IHZA 2UU9Q 2ZJPA 1EFWA 1S40A 3C2PA 5IOCA 2VB2X 5EPJA 4JI1Q 4CKBA 5K36H 2G5DA 3SK4A 1II3A 2QW7A 2UXCL 1SJHD 4S3SA 3IL8A 1FVIA 5CV6A 3J7ZC 1HR0L 5IGCA 3E6ZX 2O5JC 1B53A 4HJ5A 3QO2A 4L5RC 3K7UC 2HIXA 1TWCB 2KBNA 4GNXB 2MO0A 3CC2A 3PV0A 2RSNA 1CKNA 2SEBD 4LF4L 1CZWA 1JWSD 4AQYL 1X56A 4JVZA 1Q82C 3K5NA 1QCBD 1J5EL 4EGVA 3G6EA 3KUPA 1TWAH 5I2YA 1F9RA 5D3IB 3W5OA 4MN3A 4G4KA 1N33L 5CYUA 3FPPA 3OMGA 2F0GA 2MJ8A 2XWBB 1BCPF 1SRUA 1EWIA 3NSWA 4QJFA 1S4ZA 2AHOB 1CI3M 2ZT9C 5IWAQ 3G6JB 2G9HD 5HGQA 4WJ3M 1YITA 1B9NA 4PV1C 3I4MH 4PZ8A 4DR5Q 2H4OA 2IL8A 3KJOA 1I6HB 2NUCA 5C4XG 3Q22A 5M5XB 2A69D 1PH7A 3KF8B 2AWNA 3PUXA 2LXJA 1ZYRC 3V05A 1LT3D 1TWFH 1SMYD 1EOTA 1X3EA 3H3VH 3DUZA 2OEOA 1VQ7A 1B3QA 1GOZA 2XRSD 3GTLH 2R7ZB 2PZUA 2ID0A 1QE6A 3GTPB 2L55A 4NKLA 2C9OA 2A1AA 4DV1L 4K2KA 2E2JB 3EIVA 4Y7NB 4DAYA 1OXTA 3M3YB 2BA0A 3CU7A 4A3CG 4BY7G 3MFYA 5DNFA 2B8GA 3K8AA 3B6YA 3BVZA 1EWHA 4UP7A 2KHJA 2Z9HA 3GP7A 4JBMA 4MTNA 3PIPA 2R93B 2MP1A 5GAGC 4ZYSA 3Q23A 1SNOA 3H3VI 1MSHA 1QNUA 4KLKA 1EEID 1I50H 4FNFA 2F0FA 5IGFA 1Q90A 3H94A 4MHEA 2KEEA 4CDDC 1A8VA 4BBRB 1GXDC 2RKSA 1SJED 3A8JE 1JCKB 3P75A 4AYBE 4UPAA 1LT6D 4A3JB 1ESRA 4C3JB 5JOBA 1QVGA 1SLJA 2LXKA 3NTIA 3VA5A 1Y8OB 2AQ3B 3QWNA 2MUYA 1GHKA 4A3MH 3K5MA 3SE0A 2WAQB 2K5DA 1A62A 2CQOA 2Q2UA 2CHBD 1HNXQ 1XNRL 3JAME 1RD9D 5CV4A 1SYFA 1UE7A 1STNA 4IOCA 4A3LH 3STBD 4KMUC 1PRTC 5M3MH 4A3FG 3O13A 1QNKA 4XT3B 4ZLTF 1AH9A 2N49A 1YHQA 2PMZE 2KEDA 3BZKA 2WKDA 3ERSX 5FO8B 4R4OA 1XPOA 2VQEL 4AYBG 2PNRC 1SDFA 1D7QA 1JQYD 2AUKA 4X62L 1NBWA 1Q86C 1B44D 2VQFQ 4XQQA 5CV7A 2RQXA 2QA4A 3HEJA 2AWOA 1LUZA 2UXDQ 4DR2L 1STHA 1DGSA 2BH8A 1SYEA 1JJ2A 2IT1A 3BDCA 4POFA 2D0PA 4DR5L 3S1RH 5E4XA 1TWGB 1VQIA 3MAQA 3S15B 2UUAL 4DUYL 1G91A 1K83B 1OXUA 4A3LG 2Z0SA 3S17B 1XNQQ 3X3MA 4KY5A 2SNMA 1Z9FA 1PTOC 3VYRA 1O78A 3J81j 5T1GA 3GQBA 1Y1VH 2DY8A 1EU3A 1RTOA 1H9SA 3GTQH 1EIHA 1L0XB 5J22A 1VQHA 3MXUA 2RHQB 4A3DH 2JA5B 2A6HD 4X66L 3R2IA 4DA2A 1DOLA 3EROA 4B3MQ 2R92B 3CP0A 2KHSA 3T4AC 3U9SA 4K2LA 1SAPA 1I3QB 1OXSC 1PRTF 1BF4A 1RL2A 2JP1A 5FO7B 2EYJA 3E9IA 1HR0W 1N32L 2P5ZX 2K5NA 1KC8C 2RDHA 3MXNB 5IGEA 4DUZL 3HKSA 3ND8A 2JJQA 3TBIB 2K04A 2PZTA 1X3GA 1Y1VG 4GLAC 1ASZA 3VR3A 4EQOA 2EXDA 4JI5L 5IYDH 3KBXA 3KFUA 1S5DD 1L0YB 4QUFA 2JE6I 1WCMG 4C2MB 2UXBQ 1JORA 4YHHQ 1SYGA 3S2DH 2NVQB 1F2LA 3GTGB 1LTRD 3RZOH 3PQIA 3D6WA 4KY7A 1HZAA 1X3PA 2F0OA 4JI4Q 4Q0FA 3NUCA 3A55A 4CGYB 4LMQD 3UDIA 2N3SA 1HA5A 1PTOF 1FYCA 1TQOA 4DNTB 5D3DA 5CBAE 2MFIA 4DV3L 2G9DA 2N55A 1VQCA 1PV4A 3K6OA 4ZCKA 5EJWA 1WTXA 1PZID 4DR7Q 5LL6S 3J7AV 1D2BA 4UAIA 3GTJH 1LLRD 4NXNL 4HIKA 1TT2A 1EIGA 5C4XB 2VQFL 4JI2Q 2NVYH 3OHXC 3FPUB 4JI0L 3F2BA 1RIPA 3U58A 1SFOH 1V1PB 3C1FA 1CFMA 5C5MA 3SK8A 2X6LA 4KHVA 1IBMQ 1XX8A 2AKWB 5FLXc 1VF7A 1Y8PB 2LY7A 2HUGA 3D6CA 3NWSA 3TQYA 2CQAA 5G3LD 3PO3B 3A7AB 2XSCA 1QUQB 2QCPX 1XNQL 3ITPA 4X6AH 3CCVA 2L9HA 1N36Q 2F0QA 3OSOA 4DV5Q 3MXGA 4WJ4A 2L0CA 1K73C 4BY7B 1TWCH 5IGBA 3F2DA 1G2TA 2FFKB 3PUWA 4GN3B 1MHWC 3GTKB 2L12A 2Z4IA 3KK7A 1B50A 2I5MX 2RHSB 3KYHC 2BCOA 3OWFA 4LAAA 4B3ML 2EYOA 2ENBA 3VR5A 1N9WA 4IUUA 3DM3A 1H9KA 3LWEA 3JAMc 1GUOA 3GTLB 4K6LA 3A5ZB 3H09A 3HP3A 1YBYA 3DWAA 1BO0A 1SNPA 2VB3X 1X3FA 3M4PA 1EIYB 5C4JH 1SMYC 1L1OB 5M3FH 5HURA 2E74C 4ZKBB 1VQPA 1IBLQ 4FF2A 1AP0A 1C9OA 1XTDA 3F2CA 1K8AC 1IZ6A 1SXTA 1I6HH 1STGA 3NQIA 1KXLA 5M5XH 4JCVE 3DLLA 2Q8TA 3CC7A 2OQKA 4N9TA 4JI7L 2KCNA 1XJVA 1PH8A 4F87A 3VR6A 1XYIA 2ZTEA 1D5XC 1ICFB 3J7A5 1ZKOA 4JI6Q 1BVSA 1WVLA 4A3FB 1HNWL 2R7ZH 1A15A 5ELCA 3GTPH 1YJWA 5M3FG 1CKNB 1D5ZC 1ICWA 1TWHB 1JC7A 4AYBB 2K01A 2E2JH 1E1TA 3BYYB 4Y7NH 4G7ZC 3M3YH 4DR6L 1QWYA 4L63B 4MZ9A 2YV5A 1JOOA 1KNEA 4DV4Q 3I56A 1BBWA 2J0TD 1UAPA 1E2VA 1RJTA 1U9RA 1VCIA 3J80i 1IL2A 2Z6KA 1EZ8A 5ELEA 5C44H 3P1HA 4JI2L 3NBHB 1HZCA 1VDZA 3IFTA 2IPKD 4RGNA 2R93H 1IYUA 3WOFA 3A7LA 3PMFA 5IP9G 4LF9Q 5FLXL 5IT9E 4ZKCB 2K52A 1XPUA 2VL6A 4CBVA 3PCOB 3WOEA 1IKMA 4BBRH 2ZXRA 2EXZA 3NK9A 4F7XA 4EVOA 4TQUS 4O2DA 4LFAQ 1N36L 4A3JH 3STBC 2FMMA 3A8IE 4DV5L 2F3IA 2B2VC 2F4VL 2O5IC 2KCCA 4IJLA 4K0KL 3AYHB 2Z6KC 5C44G 1KTKA 5L37A 3E0EA 1CTMA 4OWWB 1WJJA 2UXCQ 1D1IA 3BZDB 4G7HC 4FXKC 1D8LA 1HR0Q 1PXUA 1O7IA 4R4QA 2RDGA 3JAML 1QZHA 4C3IB 3NP8A 1VQMA 4BBRG 2F4IA 2RBMA 3EBEA 4OXPA 1JT8A 1Y1VB 5ELFA 4LF4Q 2GVAA 1RCVD 3GTQB 1QOHA 4AQYQ 4A3JG 1FGBD 5EKKA 1CA6A 1J5EQ 4KHZA 2B2YA 1WCMB 2RVLA 4M8AA 4C56C 1RHPA 2F0MA 2XN9C 3K58A 5I6WA 2JXMB 1IBLL 1N33Q 3IAYA 3VR4A 1VQ4A 5KYIA 3S15H 1GJXA 1STAA 1K83H 2BDNA 2A6HC 3QOLA 4IPDA 1LT4D 4WFN3 2JA7G 3S17H 4E6IA 1YVCA 1XPRA 3CCQA 1Q1EA 4RHRA 2IX3A 3LX0A 4UP9A 1QVCA 3HOVH 5C0XJ 1HCZA 4ZUIA 4IO9A 3AU7A 4X3TA 1DJRD 4HTHA 3TP6A 1MKHA 2AQ2B 2E8GA 1PFMA 1YHAA 2B2YC 3LWUA 4XXEA 3UE1A 1LTLA 2JA5H 5FOBB 3M4QA 2F3VA 2WACA 3RZOB 2SDFA 1UE6A 1VQKA 2NVTH 3F2UA 1Z47A 4RGMA 2HQEA 1M1KC 3EVQA 1I4PA 1I3QH 2JEBI 1HPCA 2R7FA 2ASBA 4PMBA 1E2ZA 4RGTA 2VS1A 3ONAB 4DV1Q 1IXRA 2EQSA 1VQBA 1I94Q 3PO2B 1A2UA 1HTPA 3HOVG 4EQ5A 2J4XA 2TSSA 3ERQA 1NAPA 1Q1BA 4PZ7A 2F0HA 4KKUA 4JV5Q 4LK1C 2RCFA 3URYA 2A6ED 1CSPA 4P72A 3KDFB 1ENAA 1WI5A 4LUZA 1F2MA 3NXWA 4K8JA 4C2MH 1V1QA 4L8JA 1XTCD 2M9VA 5E4WC 1IYJB 3D0FA 3GTGH 2E2DC 4DKAC 3TS0A 1M90C 1VQ8A 2X69A 4HJ9A 4R8NA 1R4QB 2KQ3A 1ET6A 3P7JA 2R61A 4IZ8A 2RDFA 5IYCH 4JBKA 4KD3A 1HXYD 1WOCA 1D6EC 1JR0D 4A93H 1JOKA 4FF1A 2H5XA 4GZYC 3T1YQ 1AZQA 1KRSA 2KA7A 2DNEA 3CCSA 2XGTA 3H3VC 2YTXA 1XNRQ 3NELA 4FP5D 1Q46A 4LWCA 1EL0A 1MGSA 1AW7A 2LFNA 5C4XH 4B08A 1TXYA 2Q2IA 5IYCG 2I07B 1PFBA 1J9OA 3OIQA 3EFXD 4JW0A 5IY0A 1R4PB 5BN3A 5JJLA 2KECA 3K81C 3OMCA 4P73A 2VQEQ 3SGIA 4A93G 3D4WA 4UHVA 3TDQA 2IX1A 4X62Q 4HIDA 3BVGA 5FKAC 3H91A 3PO3H 3E9HA 4A76A 5C4JB 3T56B 4DXGA 3KF6A 5M3FB 5JVG3 1LT5D 4HJ8A 4DR2Q 4NXMQ 4GLXA 2WINB 1NY4A 4OGQC 4A3CH 1H9JA 4BY7H 2WB1G 2JA6H 2UUAQ 3DWQA 1K8OA 4DUYQ 3PF5A 3GTKH 3KLSX 4ZRZA 3T53B 4DNIA 1CSQA 3MHBA 3QOJA 1K0SA 3AQQA 1VQNA 1FL0A 4YWKA 3FMCA 3OIPA 3V96A 2K05A 2OF1A 2B8FA 1E1OA 4HCEA 4RFBA 1B8AA 1N34Q 2F52A 3PO3G 2OTJA 2EY2A 5TSSA 4OHJA 3PGZA 1VQLA 1I94L 4X66Q 2K32A 4GOPB 5G3LF 4I7ZC 2JA6G 4ID6A 1S5ED 4PMWA 1NMGA 5C4HA 4JV5L 5F2DA 1PH4A 4HJ7A 1N32Q 2IY5B 5C44B 1W2BA 3HOZG 2JQOA 1OO9B 3TZDA 2QILA 4V190 1R9TB 4DUZQ 5M9OA 4DAPA 3S1NH 1HA6A 2K6AA 4CDFC 4RKBA 3AFQA 3DHQA 3ULJA 1Q12A 1SBBB 4JI5Q 4A3FH 1B9MA 4ZUJA 3S1MB 2DN8A 1OTCA 1K0RA 4DV6Q 1TWHH 1Y1WB 1I4QA 1BDOA 4NPSA 1VQFA 2Z8LA 2PI2A 1EU4A 3T1YL 1W6JA 2PW5A 1HH2P 1PDQA 4DV7Q 1U4RA 5IE8A 1LV9A 1TU2B 3I4LA 3TSSA 1UE5A 1UEAB 3T13A 2NB0A 1HUNA 3TZUA 1VQ6A 1FR3A 1FNUA 4A3EG 1QG7A 1DONA 5A2QE 1UE1A 2K5HA 4IPCA 4DV3Q 2K7VA 3K59A 1VS0A 1CA5A 2JA7B 1QB5D 1DZ1A 1G291 3PUZA 5DM73 5C3XA 3MC0B 1PYBA 1TS3A 2CH4A 4YY3L 1Y14B 1ESFA 1X55A 2RF4A 2ZXOA 4DN4M 4NXNQ 3TREA 1XMQL 1WD1A 4M1UB 1Q8KA 4WORA 2F0NA 2EY6A 4JI0Q 4K8IA 1EYDA 4TSSA 4BBSG 5CC4A 4NXML 5H1SE 2EJGC 2F0UA 5C0XH 4POGA 4HEDA 5A35A 1E7ZA 2E2HH 2JN4A 1Q7YC 2LSSA 4DGZA 5JPMC 2K4KA 1X54A 4CKCA 3HRZC 1HQMC 5EKIA 3UE0A 5FO9B 1PFSA 3S16B 2EYLA 5I9OA 4CDCC 1PMRA 1U4MA 3HOVB 2CWAA 2K5VA 4C3IH 5FJ8H 1N34L 4OL7A 4HCSA 1IL8A 3RZDB 2DGYA 2WV6D 5J1ZA 3FDTA 3WDNA 4EX5A 3ULLA 1JE5A 2PYKA 4RH6A 5C0XG 1JMCA 1WCMH 1C48A 2NVTB 3GDEA 2D5DA 5C0XI 1JE4A 4HSPA 4Y52H 4R9WA 4RWSC 2XRQD 3ER0A 3ICEA 1MIUA 3FRPB 5GAEC 3H15A 1LTSD 2KCTA 3TEHB 3CD6A 4JC0A 1KABA 2F3WA 3HGBA 4C3IG 5FJ8G 1PH1A 5D14A 2H1EA 5IP7G 1BR9A 1RKNA 4ZAIA 3J81E 1NR4A 1L0WA 1TY0A 4TVAB 3K80C 5AFWA 4DV6L 4JI7Q 4BY1G 1P16A 3RNUA 3HKZE 2JA8G 4B3TL 1SE4A 3MVVA 3J80E 1KDBA 3RR5A 4DV7L 3NTKA 4TKOB 2K03A 1YJNA 5FK9C 1HNWQ 1YI2A 2EY5A 3BS1A 4A3KH 2A6EC 4A93B 4JI3Q 3PO2H 3CW2C 1KAWA 4HAEA 1AN8A 4IQZA 4GNXC 3K7AB 4JBJA 5JEAJ 3NEMA 5JJZA 1SNQA 4DR6Q 4GLVB 1IBKL 2ZJRA 3MXPA 4F8MA 1EYGA 4ABNA 1FGUA 4EQPA 1XMOL 4KN7C 4IPGA 1U4LA 3EN2A 1F9QA 3BYTB 5I2XA 2I0QA 3KF8A 2ZXPA 2WB1B 3HKZG 3M4OB 1EY0A 1W6KA 1UEBA 5KNBA 4HIMA 2PQAA 3G71A 4GS3A 1JJGA 1LO5D 4F88A 1GKHA 4ILWA 5KGUA 1A3UA 4A3KG 2F0TA 2ZTDA 5EKLA 5ELNA 2B63H 3PO2G 1CQFA 1WTWA 2Q2HA 5M5WB 4OO1G 1LTID 4DNRB 1BCPB 3M4YA 4OO1I 1EQRA 2FMCA 3H0GB 1A6XA 5KYLA 5M5YB 3TP5A 4KK7A 3JAMi 2F4VQ 3OPOA 1NMFA 4K0KQ 5FLMH 4OEMB 3TRZA 2R7DA 2JA6B 5LHY1 4IUTA 1JJCB 4L5QA 4JK1C 1XWEA 1PYSB 2R6GA 5JAVA 3J7AF 1FNWA 1G51A 5LMUL 2A74C 1CM9A 5CMDA 3HOZB 2B63G 4B3RL 1RTNA 5K5PA 5LMNQ 2ZJQA 5C6AA 1SE8A 2IHFA 1ET9A 2YTYA 3PF4A 3QB3A 1A3TA 2KJXA 1A3VA 5J39A 2K5QA 3M85A 4GOPC 4DV2Q 3AEVA 4RA8A 5J3BA 4IN3A 1VQGA 4LF5L 5FLMG 2EYFA 4U68A 1CKMA 1KLUD 4XTCS 1TVXA 5DLQE 2NVXB 2MGSA 4QUCA 5ELOA 2EOTA 3HOXH 2EYMA 3CKIB 4IURA 1I4RA 3U4ZA 3S1QB 4KHPL 2E75C 2L5TA 4X3UA 3VDYA 1EY8A 1TR5A 5I9PA 1T5EA 3L9AX 2F0VA 3OTOQ 4QQBX 4KKSA 2NN6I 3UDGA 3S1NB 4DR3L 4A3EB 4RAUC 3HOYB 4FXDA 4QB4A 3KLWA 4LF7Q 4B9WA 2F0LA 1VMPA 1PH3A 1PFNA 2NYZD 1CHPD 1YIJA 1TS4A 3KLRA 5E1FA 3Q24A 5IP9H 2HIVA 1HNZQ 2LKVA 2KOLA 3EJIA 4LW1A 4JI3L 3ZYYX 3C3LA 3HOXG 2WFWA 4X3SA 1AE2A 4JOIC 2AMCB 2A68D 4BBSB 3TN2A 2B2VA 1W3SA 1SYCA 1YEZA 2XTIA 4TRDA 1Z6HA 2CVRA 2C5CA 1R9TH 3I70A 1CUKA 4C3HG 3X3NA 4IFDJ 3RMHA 1NNXA 2HDLA 3R93A 3E3XA 1J8IA 4PG3A 1EIFA 1ZEQX 2B2UA 5KNDA 1I6VC 4PQXA 4RCOA 1HTLD 5ELBA 4DAVA 4FF3A 3S1MH 3HOUB 1MJEA 4PMCA 1FD7D 3FKIG 1Y1WH 5ISRA 1BXTA 1TS5A 2FJ2A 4L5SA 1FJGL 4Z9CB 1O7ZA 4JG2A 2BH2A 4G57A 2E2HB 1GUSA 2I5HA 3SR1A 4DV0L 4YIJA 2DJGC 3T1HQ 5JPNC 3PIO3 4GKJL 1O7LA 3I2ZA 2KENA 3MXNA 1MD2D 5D65A 4HR7B 2NBFA 2E2IB 2AUJD 2OT2A 1GVPA 3M9BA 4JI8L 4KY6A 4WJWA 4AIMA 3BJUA 1EOVA 4DAYB 2F0IA 5LMNL 4O1NA 5EGTA 1KLGD 2B2UC 2JA7H 3I8ZA 4N8X1 1P8LA 1DM0B 1MJCA 2F0EA 3T16A 5I6YA 1Y1WG 2E5LL 4LF6L 4DV2L 2NTSA 3NENA 1ENFA 5EPKA 4DPGA 1KL9A 1Y69U 4RMFA 1EY7A 2Q8RE 4BY1B 5ELDA 2JA8B 2XVSA 3LNNA 4JBWA 1M8AA 1C8CA 3GTOB 1PRTB 4NB3A 1RDPD 3CHBD 4EQNA 1WFQA 3C1EA 3VYSA 5AJ3Q 2NZOA 2I5LX 4H02A 3OTOL 1BBXC 3S16H 4DAMA 1LTBD 4LF7L 1VQDA 3VYUA 2PZWA 1K8MA 1SSOA 2VUMH 1S72A 1MBYA 1HNZL 4DK1A 4DR4L 3RZDH 2L1BA 5GQOA 2BOSA 4XT1B 3U4VA 4CDEC 5JEAH 3CCEA 1V1PA 3CRKC 1WTVA 4A3GG 3HKZB 4A3IH 3SDZA 4RG1A 2EDGA 1PA6A 4IALA 1BOSA 1NUCA 1EZ6A 2V4DA 3DEOA 4A3KB 1EWCA 1PZJD 1QUQA 3QIAA 1PTOB 4R4TA 4YCWA 3A5UA 1Q3LA 3NE5B 1K3RA 4I65A 4LFBL 2VUMG 1ONLA 2D62A 4BXXG 2DY7A 2EIFA 2OXPA 5I4DA 5JEAG 2VY3A 1T9HA 2MO1A 4NDXA 4A3IG 2RCNA 1E3PA 3GO5A 4H0LC 4NW2A 1LTTD 3U50C 2KHIA 1AFPA 2CWPA 5EAYA 2B63B 1F9SA 4AH6A 1V8QA 2ZM6L 2GN5A 1EY6A 1MI2A 2QEXA 3T1HL 5IODA 2RA4A 1OXXK 2WP8J 1YHBA 3D4DA 3FEWX 1H9SB 1DCZA 1SE2A 1LTAD 4KJOA 5BR8Q 5NUCA 1L1OA 5C3EG 2EJMA 2FXQA 3K7AH 2KUMA 4ODGA 2DJFC 1EQVA 4KJNA 4UP8A 2KCMA 1F2ZA 3A74A 1YNND 1B1ZA 1IKLA 2PPBC 1E24A 4YCVA 4ALPA 4N8FA 3OW2A 2Q2TA 2WB1E 4X64L 3M4OH 1I5FA 1F9PA 5DAUA 3S9WA 2UUCL 2B29A 1BQQT 1H9MA 2MHVA 1H9RA 2AQ1B 1B4OA 4P2CB 4K6DA 1DOKA 2ICIA 3Q0AA 2L15A 3VA7A 3A54A 4YY3Q 1TKWB 1L1OC 4OELB 5M5WH 2J7ZA 1U4PA 1XMQQ 1VQOA 3OWEB 5IIFA 5AJ3L 4B3SQ 5IT9c 4DK6C 3WWVA 1SROA 3H0GH 2K75A 5M5YH 1DD2A 3OOCA 2O2LD 4J15A 1S5CD 1YNXA 2M2LA 5K36G 1M4VA 3HOXB 3I72A 4DFAA 3BZCA 4BWGB 3I4NH 2CKZB 1JWUD 2A8VA 1B3AA 2Y0SB 4FVMA 2D9UA 4GN4B 1JB3A 3M7GA 3BVMA 3NBHA 5GAHC 3BDLA 2SNSA 1SNCA 3L0OA 2X6GA 4QY7A 1A0IA 3HOZH 2B39A 1XXGA 3DM1A 2EZVA 3A0JA 2F0DA 4C3HB 1UUPA 4CJ0B 1YNJD 3MEFA 3W2DA 4YWLA 3H0GG 3QG1A 1C7YA 3HOWB 4B9XA 1KHIA 4DR1L 3I4NG 4FF4A 2PQAB 1EFID 2VXWA 1UNSA 1EY4A 2NVXH 3FKIB 4IFDH 1E2WA 1KDAA 1BNZA 2QGQA 2RSOA 3DEPA 3CCMA 3I55A 1ENCA 2QDBA 2PO4A 3S1QH 1GUNA 4NMZA 3CCLA 1O80A 1TIID 5LMNW 3MFGA 2JEAI 3PIOA 2HHHL 3BDOA 5GROA 4A3BB 2QF7A 3I4MG 1SE3A 4A3EH 3HOYH 1HHVA 1B7YB 3G7LA 2A68C 3IFDA 4MIUA 1NTGA 2K50A 1E22A 1X32A 5IGDA 1Y8NB 2VW9A 4IOAA 1KNAA 4QMGA 3NBIA 1D5MC 3SK6A 2VNUD 4IFDG 1C4QA 2WIIB 5BR8L 5FLXE 4L6TB 4XQJA 4O42A 3SK5A 2BE5D 4JYAQ 1E0BA 4CJ1B 2F0WA 4B3TQ 3TP8A 4IFDI 2B3GA 2UU9L 4OX9Q 3OW7A
chains in the Genus database with same CATH topology
4DR6Q 5C44H 1WYDA 2JA5G 4JI2L 4GLVB 1IBKL 2ZJRA 3NBHB 1HZCA 3F1ZA 1EYGA 4BBSH 4A93G 1XMOL 1FGUA 3FHWA 4LFCQ 1EUJA 3F8TA 4JI1L 2R93H 1L2FA 4IPGA 2R92G 2YU9H 5IP9G 2C35B 4YCUA 1GD7A 3EN2A 4LFAL 4LF9Q 3HOYG 2NVQH 2I0QA 2UU9Q 2K52A 4BA1I 2ZJPA 1XPUA 2VL6A 4KHPL 3HKZG 1EFWA 3LGJA 3PCOB 1UEBA 4HIMA 1S40A 1IBKQ 2PQAA 3G71A 4GS3A 1JJGA 1V9PA 4BBRH 1GKHA 1XMOQ 4GKKQ 4JI1Q 4QGUA 1V43A 4TQUS 4O2DA 4LFAQ 4A3KG 2ZTDA 1N36L 2UXCL 4PZ6A 5ELNA 4A3JH 3STBC 4DV5L 2B63H 1FVIA 2F3IA 4A75A 3J7ZC 2F4VL 4IJLA 4K0KL 1HR0L 3PO2G 2Q2HA 3CMEA 4HJ5A 3CCRA 4L5RC 4B3SL 3AYHB 3K7UC 2Z6KC 3HOUH 4OO1G 5C44G 2HIXA 3E0EA 2MQHA 3G48A 3NEMA 2KBNA 4GNXB 4OWWB 1WJJA 1EQRA 2MO0A 4OO1I 3CC2A 2UXCQ 3PV0A 1CKNA 4LF4L 3JAMi 2F4VQ 1D8LA 1NMFA 3KJPA 4AQYL 5FLMH 1HR0Q 1X56A 3TRZA 4K0KQ 1O7IA 4R4QA 2R7DA 1Q82C 2VZAA 1QZHA 1J5EL 1JJCB 2IY5B 3G6EA 4L5QA 1TWAH 1VQMA 4BBRG 1PYSB 2R6GA 3EBEA 4OXPA 3M7NA 1JT8A 2E2IH 4A3MG 1G51A 4R1JA 5LMUL 5IWAL 4LF4Q 4OONA 2GVAA 3W5OA 1N33L 4AQYQ 4A3JG 2B63G 4B3RL 5LMNQ 2ZJQA 1J5EQ 4KHZA 2UUBQ 4QJFA 1SE8A 1EWIA 1SRUA 1U0LA 2IHFA 3KDFA 5IP7H 3HOUG 2AHOB 2YTYA 3PF4A 1LYLA 3K0XA 5LMUQ 3RLFA 5IWAQ 1IBLL 5M3MG 1N33Q 3M85A 4GOPC 4DV2Q 3AEVA 5J3BA 1K9MC 4X65Q 1VQGA 5HGQA 4B3RQ 1VQ4A 4LF5L 4WJ3M 1YITA 5FLMG 4PZ8A 4DR5Q 1PH9A 3I4MH 3S15H 1K83H 2OQ0A 3KJOA 1CKMA 4XTCS 4BY1H 5C4XG 5DLQE 4IPDA 2JA8H 3S17H 2JA7G 3Q8DA 1PVOA 1HJPA 1PH7A 1YVCA 3CPWA 5ELOA 3CCQA 1XPRA 3GTOH 1Q1EA 3KF8B 3PUYA 3HOXH 2AWNA 1SN8A 2GVBA 3PUXA 4UP9A 1QVCA 3U4ZA 2LXJA 2N78A 5C0XJ 3RN5A 4LF5Q 3H3VH 1TWFH 1X3EA 3HOVH 4IO9A 3VDYA 5IYBH 1MKHA 1VQ7A 2E8GA 4GNXA 1YHAA 4QQBX 4QIWE 3OTOQ 3GTLH 2NN6I 3UDGA 2ID0A 3UE1A 4DR3L 1LTLA 2JA5H 4LF7Q 2PI2E 3KLWA 2OWOA 1PH3A 3M4QA 1HZBA 1X6OA 4KHPQ 2A1AA 4DV1L 1YIJA 1UE6A 3EIVA 2HT1A 1OXTA 1VQKA 2NVTH 2BA0A 5IP9H 1Z47A 4A3CG 4BY7G 2HIVA 1HNZQ 1M1KC 4JYAL 4O0AA 4LW1A 3K8AA 4LF8Q 1I3QH 2OCEA 2JEBI 3B6YA 4DR3Q 2R7FA 4JI3L 2ASBA 4OX9L 2VS1A 4UP7A 3HOXG 2KHJA 1IXRA 2EQSA 1VQBA 2WFWA 4OWTB 4DV1Q 1I94Q 3PUVA 2IX0A 1AE2A 4JOIC 1N8RC 3HOVG 4EQ5A 2AMCB 4LFCL 4A3DG 5IYBG 4JBMA 4MTNA 1OXVA 1YZ6A 1QZGA 1Q1BA 4PZ7A 3PIPA 1W3SA 5GAGC 3H3VI 4KLKA 3BU2A 4JV5Q 4HIOA 1YEZA 2NZHA 2ATWA 1I50H 1HZ9A 2XTIA 3UDFA 1CSPA 4GN5A 4P72A 3KDFB 1R9TH 1WI5A 4LUZA 4C2MH 1A8VA 4KI0A 1CUKA 1V1QA 1B70B 4IFDJ 5JJKA 1IYJB 3D0FA 3GTGH 1UWVA 1HNXL 4AYBE 4DKAC 3TS0A 4PG3A 4UPAA 1EIFA 3RN2A 1M90C 1VQ8A 1S3OA 4HJ9A 1QVGA 1SLJA 2LXKA 5IYCH 4JBKA 3S1MH 4A3MH 1MJEA 5IYDG 3FKIG 1WOCA 5GADC 1Y1WH 1A62A 1EQQA 2CQOA 1AE3A 2Q2UA 3S24A 4L5SA 1FJGL 1HNXQ 1XNRL 4A93H 2BH2A 4JG2A 3ULPA 2I5HA 1QVFA 4DV0L 2ES2A 1J6QA 2H5XA 1VQ5A 1UE7A 3T1YQ 4IOCA 3T1HQ 1KRSA 4GKJL 4A3LH 3STBD 3UDXA 3I2ZA 2KENA 3CPFA 5M3MH 3CCJA 4GOPA 4A3FG 3S14H 3CCSA 2XGTA 4BA2I 1AH9A 1FJGQ 2N49A 1YHQA 2PMZE 2YTXA 3BZKA 1XNRQ 3NELA 2UXDL 3ERSX 1IL2A 1Q46A 4LWCA 1GVPA 3M9BA 4R4OA 1GM5A 4JI8L 1XPOA 4DAYB 4AIMA 4AYBG 3BJUA 1EOVA 5C4XH 2VQEL 5LMNL 4DV0Q 1D7QA 3RLOA 1TXYA 2UUBL 2JA7H 2Q2IA 4MNOA 4X62L 1NBWA 3IRBA 1Q86C 2VQFQ 4GKJQ 5IYCG 1P8LA 1KRTA 5E7NA 1MJCA 2QA4A 4DK3C 5JEAJ 2AWOA 1LUZA 5IY0A 1Y1WG 4DR2L 4DV2L 2E5LL 4LF6L 2UXDQ 1DGSA 5JJLA 3K81C 1SR3A 4X65L 2BH8A 4P73A 4JI8Q 2VQEQ 3SGIA 2IT1A 3NENA 4HJAA 1JJ2A 4POFA 2D0PA 4DR5L 3S1RH 3CCUA 3ZJYC 4DPGA 2IX1A 1KL9A 4X62Q 1VQIA 4HIDA 3PO3H 3E9HA 2UUAL 4A76A 4RMFA 4DUYL 1U5KA 1OXUA 1G6PA 4A3LG 3KF6A 2Z0SA 1ASYA 2N8NA 3L2PA 4LF6Q 4HJ8A 4DR2Q 2E5LQ 4GLXA 4JBWA 4NXMQ 1XNQQ 1NY4A 1Z9FA 4A3CH 4BY7H 3CC4A 4NB3A 3G4SA 2WB1G 3KOJA 4IPHA 2JA6H 1SMXA 3W1GA 3GD7A 1KIXA 3TS2A 2UUAQ 4P74A 1WFQA 5AJ3Q 4DUYQ 3J81j 2NZOA 2I5LX 4H02A 3OTOL 4LUVA 3PF5A 3GTKH 1Y1VH 2CFMA 3S16H 4DNIA 4DAMA 1CSQA 4LF7L 1VQDA 4JOIA 3GTQH 2K14A 1VQHA 2RHQB 4A3DH 3AQQA 2Y0SE 4IJHA 4X66L 1FL0A 1VQNA 2VUMH 2NN6G 4YWKA 1S72A 1X9NA 1HNZL 4B3MQ 1BBUA 1E1OA 2CCZA 4DR4L 1B8AA 3RZDH 1N34Q 5GQOA 3CP0A 2F52A 3U4VA 4LF8L 3PO3G 2OTJA 3CCEA 3PGZA 4A3GG 1VQLA 1OXSC 4A3IH 4P75A 1I94L 1RL2A 4X66Q 3E9IA 3W1BA 1HR0W 4RG1A 1N32L 4XIGS 4C3HH 2K5NA 1KC8C 1PA6A 4GOPB 2JA6G 4DR4Q 3MXNB 2YYZA 3HOWH 4DUZL 3HKSA 2JJQA 4PMWA 1NMGA 4JV5L 1X3GA 2OTLA 4L5TA 2UXBL 1Y1VG 1QUQA 4GLAC 4R4TA 4YCWA 4YHHL 1PH4A 3A5UA 1ASZA 4HJ7A 1PHJA 1K3RA 1N32Q 2EXDA 4JI5L 3FKIH 1W2BA 2JQOA 3HOZG 2Y0SG 2VUMG 4LFBL 5IYDH 3KFUA 2D62A 4JI4L 3CF5A 4BXXG 2HQLA 2EIFA 2JE6I 1LM0A 1WCMG 4DUZQ 3S1NH 2UXBQ 4YHHQ 1VQ9A 5JEAG 3S2DH 2VY3A 3AFQA 3ULJA 1T9HA 3RZOH 2MO1A 1Q12A 1CKOA 3J81i 1HZAA 4A3IG 4JI5Q 4LFBQ 4A3FH 2RCNA 4JI4Q 1E3PA 3GO5A 4A3BH 4LNQA 3KF6B 1OTCA 3UDIA 1K0RA 2N3SA 4DV6Q 3HOWG 1TWHH 4DR7L 3U50C 3RLNA 2KHIA 2YTVA 2CWPA 5EAYA 1YJ9A 4NPSA 1VQFA 4AH6A 2PI2A 3T1YL 4LUOA 2ZM6L 2GN5A 2QEXA 3T1HL 2MFIA 1HH2P 4DV3L 4DV7Q 1KD1C 1JB7A 1VQCA 5IE8A 1OXXK 1PV4A 1KQSA 2WP8J 1YHBA 1UE5A 1VQAA 3D31A 3J81c 1VQJA 5BR8Q 1VQ6A 4DR7Q 1L1OA 5C3EG 3S2HH 2FXQA 3K7AH 2R7ZG 1BKBA 5HY6A 3GTJH 4A3EG 3FP9A 4UP8A 1UE1A 1IBML 2KCMA 2ZM6Q 2K5HA 4IPCA 4R4CA 4NXNL 4DV3Q 4HIKA 3A74A 2VQFL 4JI2Q 2NVYH 1A63A 1VS0A 1NJIC 4JI0L 3F2BA 4UY8C 4A3BG 1RIPA 1G291 1E24A 4YCVA 3U58A 3PUZA 4ALPA 1SFOH 3J80c 3OW2A 4A4IA 1PYBA 2Q2TA 4OX9Q 2WB1E 4YY3L 4X64L 3M4OH 1I5FA 1Y14B 1X55A 1IBMQ 4C3JH 2AKWB 2UUCL 4NXNQ 2B29A 5FLXc 3TREA 1XMQL 1PH6A 1Q8KA 2WAQE 3TQYA 3CQZH 4JI0Q 3PSIA 1PH2A 4QL5A 4BBSG 1QUQB 3CXCA 4NXML 1XNQL 5H1SE 4POGA 2L15A 2R93G 4X64Q 4YY3Q 4X6AH 3CCVA 1N36Q 1E7ZA 2E2HH 1L1OC 5M5WH 4DV5Q 2A19A 2UUCQ 1Q7YC 2LSSA 4WJ4A 1XMQQ 1Q81C 1VQEA 2K4KA 1VQOA 1K73C 1X54A 1TWCH 5AJ3L 4B3SQ 5IT9c 4DK6C 3F2DA 3WWVA 1SROA 3H0GH 4A3GH 3PUWA 1GO3E 2K75A 4GN3B 2ALYB 5M5YH 2IHEA 4J15A 3UE0A 1YNXA 1PFSA 3I4OA 5K36G 2MNAA 1X65A 3BZCA 3I7FA 2I5MX 3I4NH 2RHSB 3KYHC 3CMAA 2CWAA 2CKZB 2K5VA 4C3IH 5FJ8H 2A8VA 2PNHA 4R4IA 4B3ML 1C0AA 4P71A 1N9WA 4GN4B 3DM3A 1N34L 5GAHC 2WAQG 3JAMc 3L0OA 2DGYA 4YWMA 3A5ZB 4QY7A 2JA9A 4EX5A 1A0IA 3ULLA 1YBYA 1JE5A 3HOZH 5C0XG 1JMCA 1X3FA 4BXXH 3M4PA 1K8GA 1EIYB 1WCMH 1TWGH 3GDEA 5C0XI 3A0JA 5C4JH 4Y52H 1L1OB 2V1CC 5M3FH 3ICEA 2BA1A 3ER0A 1MIUA 3H0GG 3MEFA 4YWLA 1C7YA 5GAEC 3H15A 1VQPA 1IBLQ 2KCTA 3TEHB 1C9OA 1KHIA 3CD6A 5JJIA 4DR1L 1XTDA 3F2CA 1K8AC 4JC0A 3I4NG 1IZ6A 1I6HH 2PQAB 1KXLA 4JI6L 5M5XH 2NVXH 5FJ8G 4JCVE 1PH1A 3DLLA 1PH5A 3CAMA 3CC7A 2OQKA 2QGQA 3CCMA 4JI7L 5IP7G 3I55A 1XJVA 3S1QH 1PH8A 4OWXB 4ME3A 2D0OA 2ZTEA 3AFPA 3CCLA 2DUDA 4DR1Q 3J7A5 5LMNW 1L0WA 4TVAB 1BVSA 3K80C 4JI6Q 3JC66 3PIOA 2JEAI 2HHHL 2R92H 5C3EH 1HNWL 5GROA 2R7ZH 3I4MG 4DV4L 4DV6L 4A3EH 3HOYH 3HFZB 1B7YB 4JI7Q 3L7ZC 3GTPH 1YJWA 4BY1G 5M3FG 1CKNB 1P16A 3RNUA 1NE3A 1NTGA 1E22A 2K50A 3HKZE 2VW9A 4B3TL 2JA8G 2E2JH 1E1TA 4IOAA 4Y7NH 4GKKL 2ZTCA 3RR5A 4DV7L 4FDBA 3M3YH 4DR6L 1YJNA 2HHHQ 4APVA 1HNWQ 4MZ9A 2YV5A 1YI2A 4DV4Q 4IFDG 2VNUD 4A3KH 5BR8L 3I56A 2JK8A 1H95A 4JYAQ 1BBWA 3OYYA 4LF9L 4JI3Q 4B3TQ 3PO2H 3CW2C 1KAWA 4GNXC 4IFDI 2B3GA 1VCIA 3J80i 4JBJA 2UU9L 2Z6KA 3GTMH 2RF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR6 Q;  5C44 H;  1WYD A;  2JA5 G;  4JI2 L;  4GLV B;  1IBK L;  2ZJR A;  3NBH B;  1HZC A;  3F1Z A;  1EYG A;  4BBS H;  4A93 G;  1XMO L;  1FGU A;  3FHW A;  4LFC Q;  1EUJ A;  3F8T A;  4JI1 L;  2R93 H;  1L2F A;  4IPG A;  2R92 G;  2YU9 H;  5IP9 G;  2C35 B;  4YCU A;  1GD7 A;  3EN2 A;  4LFA L;  4LF9 Q;  3HOY G;  2NVQ H;  2I0Q A;  2UU9 Q;  2K52 A;  4BA1 I;  2ZJP A;  1XPU A;  2VL6 A;  4KHP L;  3HKZ G;  1EFW A;  3LGJ A;  3PCO B;  1UEB A;  4HIM A;  1S40 A;  1IBK Q;  2PQA A;  3G71 A;  4GS3 A;  1JJG A;  1V9P A;  4BBR H;  1GKH A;  1XMO Q;  4GKK Q;  4JI1 Q;  4QGU A;  1V43 A;  4TQU S;  4O2D A;  4LFA Q;  4A3K G;  2ZTD A;  1N36 L;  2UXC L;  4PZ6 A;  5ELN A;  4A3J H;  3STB C;  4DV5 L;  2B63 H;  1FVI A;  2F3I A;  4A75 A;  3J7Z C;  2F4V L;  4IJL A;  4K0K L;  1HR0 L;  3PO2 G;  2Q2H A;  3CME A;  4HJ5 A;  3CCR A;  4L5R C;  4B3S L;  3AYH B;  3K7U C;  2Z6K C;  3HOU H;  4OO1 G;  5C44 G;  2HIX A;  3E0E A;  2MQH A;  3G48 A;  3NEM A;  2KBN A;  4GNX B;  4OWW B;  1WJJ A;  1EQR A;  2MO0 A;  4OO1 I;  3CC2 A;  2UXC Q;  3PV0 A;  1CKN A;  4LF4 L;  3JAM i;  2F4V Q;  1D8L A;  1NMF A;  3KJP A;  4AQY L;  5FLM H;  1HR0 Q;  1X56 A;  3TRZ A;  4K0K Q;  1O7I A;  4R4Q A;  2R7D A;  1Q82 C;  2VZA A;  1QZH A;  1J5E L;  1JJC B;  2IY5 B;  3G6E A;  4L5Q A;  1TWA H;  1VQM A;  4BBR G;  1PYS B;  2R6G A;  3EBE A;  4OXP A;  3M7N A;  1JT8 A;  2E2I H;  4A3M G;  1G51 A;  4R1J A;  5LMU L;  5IWA L;  4LF4 Q;  4OON A;  2GVA A;  3W5O A;  1N33 L;  4AQY Q;  4A3J G;  2B63 G;  4B3R L;  5LMN Q;  2ZJQ A;  1J5E Q;  4KHZ A;  2UUB Q;  4QJF A;  1SE8 A;  1EWI A;  1SRU A;  1U0L A;  2IHF A;  3KDF A;  5IP7 H;  3HOU G;  2AHO B;  2YTY A;  3PF4 A;  1LYL A;  3K0X A;  5LMU Q;  3RLF A;  5IWA Q;  1IBL L;  5M3M G;  1N33 Q;  3M85 A;  4GOP C;  4DV2 Q;  3AEV A;  5J3B A;  1K9M C;  4X65 Q;  1VQG A;  5HGQ A;  4B3R Q;  1VQ4 A;  4LF5 L;  4WJ3 M;  1YIT A;  5FLM G;  4PZ8 A;  4DR5 Q;  1PH9 A;  3I4M H;  3S15 H;  1K83 H;  2OQ0 A;  3KJO A;  1CKM A;  4XTC S;  4BY1 H;  5C4X G;  5DLQ E;  4IPD A;  2JA8 H;  3S17 H;  2JA7 G;  3Q8D A;  1PVO A;  1HJP A;  1PH7 A;  1YVC A;  3CPW A;  5ELO A;  3CCQ A;  1XPR A;  3GTO H;  1Q1E A;  3KF8 B;  3PUY A;  3HOX H;  2AWN A;  1SN8 A;  2GVB A;  3PUX A;  4UP9 A;  1QVC A;  3U4Z A;  2LXJ A;  2N78 A;  5C0X J;  3RN5 A;  4LF5 Q;  3H3V H;  1TWF H;  1X3E A;  3HOV H;  4IO9 A;  3VDY A;  5IYB H;  1MKH A;  1VQ7 A;  2E8G A;  4GNX A;  1YHA A;  4QQB X;  4QIW E;  3OTO Q;  3GTL H;  2NN6 I;  3UDG A;  2ID0 A;  3UE1 A;  4DR3 L;  1LTL A;  2JA5 H;  4LF7 Q;  2PI2 E;  3KLW A;  2OWO A;  1PH3 A;  3M4Q A;  1HZB A;  1X6O A;  4KHP Q;  2A1A A;  4DV1 L;  1YIJ A;  1UE6 A;  3EIV A;  2HT1 A;  1OXT A;  1VQK A;  2NVT H;  2BA0 A;  5IP9 H;  1Z47 A;  4A3C G;  4BY7 G;  2HIV A;  1HNZ Q;  1M1K C;  4JYA L;  4O0A A;  4LW1 A;  3K8A A;  4LF8 Q;  1I3Q H;  2OCE A;  2JEB I;  3B6Y A;  4DR3 Q;  2R7F A;  4JI3 L;  2ASB A;  4OX9 L;  2VS1 A;  4UP7 A;  3HOX G;  2KHJ A;  1IXR A;  2EQS A;  1VQB A;  2WFW A;  4OWT B;  4DV1 Q;  1I94 Q;  3PUV A;  2IX0 A;  1AE2 A;  4JOI C;  1N8R C;  3HOV G;  4EQ5 A;  2AMC B;  4LFC L;  4A3D G;  5IYB G;  4JBM A;  4MTN A;  1OXV A;  1YZ6 A;  1QZG A;  1Q1B A;  4PZ7 A;  3PIP A;  1W3S A;  5GAG C;  3H3V I;  4KLK A;  3BU2 A;  4JV5 Q;  4HIO A;  1YEZ A;  2NZH A;  2ATW A;  1I50 H;  1HZ9 A;  2XTI A;  3UDF A;  1CSP A;  4GN5 A;  4P72 A;  3KDF B;  1R9T H;  1WI5 A;  4LUZ A;  4C2M H;  1A8V A;  4KI0 A;  1CUK A;  1V1Q A;  1B70 B;  4IFD J;  5JJK A;  1IYJ B;  3D0F A;  3GTG H;  1UWV A;  1HNX L;  4AYB E;  4DKA C;  3TS0 A;  4PG3 A;  4UPA A;  1EIF A;  3RN2 A;  1M90 C;  1VQ8 A;  1S3O A;  4HJ9 A;  1QVG A;  1SLJ A;  2LXK A;  5IYC H;  4JBK A;  3S1M H;  4A3M H;  1MJE A;  5IYD G;  3FKI G;  1WOC A;  5GAD C;  1Y1W H;  1A62 A;  1EQQ A;  2CQO A;  1AE3 A;  2Q2U A;  3S24 A;  4L5S A;  1FJG L;  1HNX Q;  1XNR L;  4A93 H;  2BH2 A;  4JG2 A;  3ULP A;  2I5H A;  1QVF A;  4DV0 L;  2ES2 A;  1J6Q A;  2H5X A;  1VQ5 A;  1UE7 A;  3T1Y Q;  4IOC A;  3T1H Q;  1KRS A;  4GKJ L;  4A3L H;  3STB D;  3UDX A;  3I2Z A;  2KEN A;  3CPF A;  5M3M H;  3CCJ A;  4GOP A;  4A3F G;  3S14 H;  3CCS A;  2XGT A;  4BA2 I;  1AH9 A;  1FJG Q;  2N49 A;  1YHQ A;  2PMZ E;  2YTX A;  3BZK A;  1XNR Q;  3NEL A;  2UXD L;  3ERS X;  1IL2 A;  1Q46 A;  4LWC A;  1GVP A;  3M9B A;  4R4O A;  1GM5 A;  4JI8 L;  1XPO A;  4DAY B;  4AIM A;  4AYB G;  3BJU A;  1EOV A;  5C4X H;  2VQE L;  5LMN L;  4DV0 Q;  1D7Q A;  3RLO A;  1TXY A;  2UUB L;  2JA7 H;  2Q2I A;  4MNO A;  4X62 L;  1NBW A;  3IRB A;  1Q86 C;  2VQF Q;  4GKJ Q;  5IYC G;  1P8L A;  1KRT A;  5E7N A;  1MJC A;  2QA4 A;  4DK3 C;  5JEA J;  2AWO A;  1LUZ A;  5IY0 A;  1Y1W G;  4DR2 L;  4DV2 L;  2E5L L;  4LF6 L;  2UXD Q;  1DGS A;  5JJL A;  3K81 C;  1SR3 A;  4X65 L;  2BH8 A;  4P73 A;  4JI8 Q;  2VQE Q;  3SGI A;  2IT1 A;  3NEN A;  4HJA A;  1JJ2 A;  4POF A;  2D0P A;  4DR5 L;  3S1R H;  3CCU A;  3ZJY C;  4DPG A;  2IX1 A;  1KL9 A;  4X62 Q;  1VQI A;  4HID A;  3PO3 H;  3E9H A;  2UUA L;  4A76 A;  4RMF A;  4DUY L;  1U5K A;  1OXU A;  1G6P A;  4A3L G;  3KF6 A;  2Z0S A;  1ASY A;  2N8N A;  3L2P A;  4LF6 Q;  4HJ8 A;  4DR2 Q;  2E5L Q;  4GLX A;  4JBW A;  4NXM Q;  1XNQ Q;  1NY4 A;  1Z9F A;  4A3C H;  4BY7 H;  3CC4 A;  4NB3 A;  3G4S A;  2WB1 G;  3KOJ A;  4IPH A;  2JA6 H;  1SMX A;  3W1G A;  3GD7 A;  1KIX A;  3TS2 A;  2UUA Q;  4P74 A;  1WFQ A;  5AJ3 Q;  4DUY Q;  3J81 j;  2NZO A;  2I5L X;  4H02 A;  3OTO L;  4LUV A;  3PF5 A;  3GTK H;  1Y1V H;  2CFM A;  3S16 H;  4DNI A;  4DAM A;  1CSQ A;  4LF7 L;  1VQD A;  4JOI A;  3GTQ H;  2K14 A;  1VQH A;  2RHQ B;  4A3D H;  3AQQ A;  2Y0S E;  4IJH A;  4X66 L;  1FL0 A;  1VQN A;  2VUM H;  2NN6 G;  4YWK A;  1S72 A;  1X9N A;  1HNZ L;  4B3M Q;  1BBU A;  1E1O A;  2CCZ A;  4DR4 L;  1B8A A;  3RZD H;  1N34 Q;  5GQO A;  3CP0 A;  2F52 A;  3U4V A;  4LF8 L;  3PO3 G;  2OTJ A;  3CCE A;  3PGZ A;  4A3G G;  1VQL A;  1OXS C;  4A3I H;  4P75 A;  1I94 L;  1RL2 A;  4X66 Q;  3E9I A;  3W1B A;  1HR0 W;  4RG1 A;  1N32 L;  4XIG S;  4C3H H;  2K5N A;  1KC8 C;  1PA6 A;  4GOP B;  2JA6 G;  4DR4 Q;  3MXN B;  2YYZ A;  3HOW H;  4DUZ L;  3HKS A;  2JJQ A;  4PMW A;  1NMG A;  4JV5 L;  1X3G A;  2OTL A;  4L5T A;  2UXB L;  1Y1V G;  1QUQ A;  4GLA C;  4R4T A;  4YCW A;  4YHH L;  1PH4 A;  3A5U A;  1ASZ A;  4HJ7 A;  1PHJ A;  1K3R A;  1N32 Q;  2EXD A;  4JI5 L;  3FKI H;  1W2B A;  2JQO A;  3HOZ G;  2Y0S G;  2VUM G;  4LFB L;  5IYD H;  3KFU A;  2D62 A;  4JI4 L;  3CF5 A;  4BXX G;  2HQL A;  2EIF A;  2JE6 I;  1LM0 A;  1WCM G;  4DUZ Q;  3S1N H;  2UXB Q;  4YHH Q;  1VQ9 A;  5JEA G;  3S2D H;  2VY3 A;  3AFQ A;  3ULJ A;  1T9H A;  3RZO H;  2MO1 A;  1Q12 A;  1CKO A;  3J81 i;  1HZA A;  4A3I G;  4JI5 Q;  4LFB Q;  4A3F H;  2RCN A;  4JI4 Q;  1E3P A;  3GO5 A;  4A3B H;  4LNQ A;  3KF6 B;  1OTC A;  3UDI A;  1K0R A;  2N3S A;  4DV6 Q;  3HOW G;  1TWH H;  4DR7 L;  3U50 C;  3RLN A;  2KHI A;  2YTV A;  2CWP A;  5EAY A;  1YJ9 A;  4NPS A;  1VQF A;  4AH6 A;  2PI2 A;  3T1Y L;  4LUO A;  2ZM6 L;  2GN5 A;  2QEX A;  3T1H L;  2MFI A;  1HH2 P;  4DV3 L;  4DV7 Q;  1KD1 C;  1JB7 A;  1VQC A;  5IE8 A;  1OXX K;  1PV4 A;  1KQS A;  2WP8 J;  1YHB A;  1UE5 A;  1VQA A;  3D31 A;  3J81 c;  1VQJ A;  5BR8 Q;  1VQ6 A;  4DR7 Q;  1L1O A;  5C3E G;  3S2H H;  2FXQ A;  3K7A H;  2R7Z G;  1BKB A;  5HY6 A;  3GTJ H;  4A3E G;  3FP9 A;  4UP8 A;  1UE1 A;  1IBM L;  2KCM A;  2ZM6 Q;  2K5H A;  4IPC A;  4R4C A;  4NXN L;  4DV3 Q;  4HIK A;  3A74 A;  2VQF L;  4JI2 Q;  2NVY H;  1A63 A;  1VS0 A;  1NJI C;  4JI0 L;  3F2B A;  4UY8 C;  4A3B G;  1RIP A;  1G29 1;  1E24 A;  4YCV A;  3U58 A;  3PUZ A;  4ALP A;  1SFO H;  3J80 c;  3OW2 A;  4A4I A;  1PYB A;  2Q2T A;  4OX9 Q;  2WB1 E;  4YY3 L;  4X64 L;  3M4O H;  1I5F A;  1Y14 B;  1X55 A;  1IBM Q;  4C3J H;  2AKW B;  2UUC L;  4NXN Q;  2B29 A;  5FLX c;  3TRE A;  1XMQ L;  1PH6 A;  1Q8K A;  2WAQ E;  3TQY A;  3CQZ H;  4JI0 Q;  3PSI A;  1PH2 A;  4QL5 A;  4BBS G;  1QUQ B;  3CXC A;  4NXM L;  1XNQ L;  5H1S E;  4POG A;  2L15 A;  2R93 G;  4X64 Q;  4YY3 Q;  4X6A H;  3CCV A;  1N36 Q;  1E7Z A;  2E2H H;  1L1O C;  5M5W H;  4DV5 Q;  2A19 A;  2UUC Q;  1Q7Y C;  2LSS A;  4WJ4 A;  1XMQ Q;  1Q81 C;  1VQE A;  2K4K A;  1VQO A;  1K73 C;  1X54 A;  1TWC H;  5AJ3 L;  4B3S Q;  5IT9 c;  4DK6 C;  3F2D A;  3WWV A;  1SRO A;  3H0G H;  4A3G H;  3PUW A;  1GO3 E;  2K75 A;  4GN3 B;  2ALY B;  5M5Y H;  2IHE A;  4J15 A;  3UE0 A;  1YNX A;  1PFS A;  3I4O A;  5K36 G;  2MNA A;  1X65 A;  3BZC A;  3I7F A;  2I5M X;  3I4N H;  2RHS B;  3KYH C;  3CMA A;  2CWA A;  2CKZ B;  2K5V A;  4C3I H;  5FJ8 H;  2A8V A;  2PNH A;  4R4I A;  4B3M L;  1C0A A;  4P71 A;  1N9W A;  4GN4 B;  3DM3 A;  1N34 L;  5GAH C;  2WAQ G;  3JAM c;  3L0O A;  2DGY A;  4YWM A;  3A5Z B;  4QY7 A;  2JA9 A;  4EX5 A;  1A0I A;  3ULL A;  1YBY A;  1JE5 A;  3HOZ H;  5C0X G;  1JMC A;  1X3F A;  4BXX H;  3M4P A;  1K8G A;  1EIY B;  1WCM H;  1TWG H;  3GDE A;  5C0X I;  3A0J A;  5C4J H;  4Y52 H;  1L1O B;  2V1C C;  5M3F H;  3ICE A;  2BA1 A;  3ER0 A;  1MIU A;  3H0G G;  3MEF A;  4YWL A;  1C7Y A;  5GAE C;  3H15 A;  1VQP A;  1IBL Q;  2KCT A;  3TEH B;  1C9O A;  1KHI A;  3CD6 A;  5JJI A;  4DR1 L;  1XTD A;  3F2C A;  1K8A C;  4JC0 A;  3I4N G;  1IZ6 A;  1I6H H;  2PQA B;  1KXL A;  4JI6 L;  5M5X H;  2NVX H;  5FJ8 G;  4JCV E;  1PH1 A;  3DLL A;  1PH5 A;  3CAM A;  3CC7 A;  2OQK A;  2QGQ A;  3CCM A;  4JI7 L;  5IP7 G;  3I55 A;  1XJV A;  3S1Q H;  1PH8 A;  4OWX B;  4ME3 A;  2D0O A;  2ZTE A;  3AFP A;  3CCL A;  2DUD A;  4DR1 Q;  3J7A 5;  5LMN W;  1L0W A;  4TVA B;  1BVS A;  3K80 C;  4JI6 Q;  3JC6 6;  3PIO A;  2JEA I;  2HHH L;  2R92 H;  5C3E H;  1HNW L;  5GRO A;  2R7Z H;  3I4M G;  4DV4 L;  4DV6 L;  4A3E H;  3HOY H;  3HFZ B;  1B7Y B;  4JI7 Q;  3L7Z C;  3GTP H;  1YJW A;  4BY1 G;  5M3F G;  1CKN B;  1P16 A;  3RNU A;  1NE3 A;  1NTG A;  1E22 A;  2K50 A;  3HKZ E;  2VW9 A;  4B3T L;  2JA8 G;  2E2J H;  1E1T A;  4IOA A;  4Y7N H;  4GKK L;  2ZTC A;  3RR5 A;  4DV7 L;  4FDB A;  3M3Y H;  4DR6 L;  1YJN A;  2HHH Q;  4APV A;  1HNW Q;  4MZ9 A;  2YV5 A;  1YI2 A;  4DV4 Q;  4IFD G;  2VNU D;  4A3K H;  5BR8 L;  3I56 A;  2JK8 A;  1H95 A;  4JYA Q;  1BBW A;  3OYY A;  4LF9 L;  4JI3 Q;  4B3T Q;  3PO2 H;  3CW2 C;  1KAW A;  4GNX C;  4IFD I;  2B3G A;  1VCI A;  3J80 i;  4JBJ A;  2UU9 L;  2Z6K A;  3GTM H;  2RF4 A; 
#chains in the Genus database with same CATH topology
 1VF5 C;  3GV6 A;  1WYD A;  1S5F D;  4BBS H;  4RKL A;  1CHQ D;  3T51 B;  3F8T A;  4LFC Q;  4JI1 L;  1L2F A;  2A73 B;  2YU9 H;  2C35 B;  4YCU A;  5EBD A;  3HOY G;  4KTA A;  4BA1 I;  1STE A;  3LGJ A;  1IBK Q;  4XQN A;  2F0S A;  3R3O A;  1V9P A;  1XMO Q;  3AB9 A;  3CQZ B;  4QGU A;  1V43 A;  2CW0 D;  4PZ6 A;  1HQR D;  2DNC A;  1C0A A;  4A75 A;  1JIC A;  5IT9 L;  2FIN B;  3CME A;  3CCR A;  3HOU H;  4B3S L;  1Q8I A;  4ZK9 B;  3G48 A;  2MQH A;  2R3Z A;  2TMP A;  4U67 3;  4A3G B;  1BUV T;  2A5H A;  3KJP A;  1EYC A;  3MEH A;  2VZA A;  4H44 C;  3M7N A;  2N88 A;  2E2I H;  4A3M G;  2E76 C;  2Z6B A;  1NR2 A;  4R1J A;  5IWA L;  4R8I A;  4OON A;  3D8G A;  1ILQ A;  2K33 A;  4FXG C;  2VUM B;  1DXM A;  3TME A;  2L11 A;  1HFN A;  4K5V A;  2UUB Q;  1U0L A;  3KDF A;  5IP7 H;  2EYP A;  3HOU G;  4RHS A;  3DXJ C;  3E0J A;  3AMU A;  1LYL A;  4KKT A;  2EJF C;  3K0X A;  5LMU Q;  3RLF A;  2CH4 W;  4IUP A;  5M3M G;  4A3I B;  2Q8I B;  4NP5 A;  4IUQ A;  4X65 Q;  1K9M C;  4B3R Q;  2M00 A;  2HCI A;  3GV3 A;  3SHL A;  1T5X D;  2B2T A;  4ME5 A;  1PH9 A;  2OQ0 A;  4BY1 H;  1S5B D;  2JA8 H;  3Q8D A;  1PVO A;  1HJP A;  3CPW A;  1ILP A;  1LTG D;  3GTO H;  2HDM A;  3PUY A;  4I7A A;  5BN5 A;  1SN8 A;  2GVB A;  3RN5 A;  4LF5 Q;  2N78 A;  1LAC A;  5IYB H;  2XIW A;  1I4G A;  3BG3 A;  4GNX A;  1O7Y A;  4QIW E;  5C3E B;  4CKE A;  2PI2 E;  2OWO A;  1HZB A;  1X6O A;  4IUV A;  4KHP Q;  2HT1 A;  2B2T C;  5C4Z A;  4JYA L;  4O0A A;  4LF8 Q;  1IW7 D;  1K3B C;  2OCE A;  4DR3 Q;  5CV9 A;  1STB A;  4HMI A;  4KD4 A;  3V2T A;  4OX9 L;  3HS0 C;  5CGK A;  4OWT B;  3PUV A;  2IX0 A;  3NQT A;  1N8R C;  3GTM B;  1JOQ A;  5C3W A;  4LFC L;  4A3D G;  5IYB G;  5BN4 A;  1OXV A;  1YZ6 A;  1QZG A;  1PTO H;  3MA2 B;  2GA4 B;  3NWT A;  3BU2 A;  1EQT A;  4HIO A;  1KDC A;  4OO1 H;  2NZH A;  2ATW A;  1HZ9 A;  3UDF A;  4GN5 A;  4XDX A;  4J1M A;  3FVQ A;  2F03 A;  5LL6 X;  4KV6 A;  1BCP D;  3K57 A;  4KI0 A;  2L4N A;  1B70 B;  2F0K A;  5JJK A;  5EBC A;  1WTP A;  1UWV A;  1HNX L;  4OIJ A;  3RN2 A;  1F77 A;  5COY A;  3K0Y A;  1S3O A;  1ROD A;  5CV5 A;  1LAB A;  3NHH A;  5JVH 3;  2PCF B;  1HRJ A;  5IYD G;  5GAD C;  1EQQ A;  1YNN C;  1AE3 A;  3MWY W;  3S24 A;  5CBE E;  3U9O A;  5IGG A;  3HG9 A;  5KNC A;  2F0P A;  3ULP A;  1QVF A;  2ES2 A;  1J6Q A;  1VQ5 A;  1EEF D;  2PQE A;  4MTK A;  3UDX A;  3CCJ A;  3CPF A;  4GOP A;  3I3C A;  3S14 H;  4DF7 A;  1TWA B;  4BA2 I;  1FJG Q;  2MPM A;  2UXD L;  2NZ1 D;  4C1N K;  1GM5 A;  3I4N B;  4RCN A;  4DV0 Q;  3RLO A;  2UUB L;  3MTS A;  4MNO A;  4GKJ Q;  3IRB A;  2EY1 A;  4XYQ A;  1CT1 D;  4QF4 A;  1KRT A;  5E7N A;  4DK3 C;  1GUT A;  4X65 L;  1SR3 A;  4WRD A;  2NN6 H;  4JI8 Q;  1G6Z A;  4HJA A;  4FYD A;  1GUG A;  3CCU A;  3ZJY C;  4LJZ C;  4JPB W;  3I4M B;  3SEB A;  4J8Q A;  1GUW A;  1SEB D;  3UI2 A;  1U5K A;  1G6P A;  2EYH A;  1WTR A;  2N8N A;  3L2P A;  1ASY A;  2B2W A;  2E5L Q;  2K28 A;  4LF6 Q;  2EVB A;  1SND A;  3CC4 A;  2XWJ B;  3G4S A;  3KOJ A;  4IPH A;  1SMX A;  3W1G A;  1TWF B;  2F0J A;  3GD7 A;  1HFG A;  1KIX A;  3TS2 A;  4P74 A;  4OIK A;  4LUV A;  3SXH A;  2CFM A;  3E5S A;  1DYQ A;  3Q6S A;  1MSG A;  4JOI A;  3DMU A;  1TS2 A;  2LMC B;  2EPB A;  2K14 A;  5EPL A;  1YNJ C;  1HUM A;  2Y0S E;  4IJH A;  2NN6 G;  2A69 C;  1X9N A;  1G2S A;  3IKJ A;  1BBU A;  2CCZ A;  4LF8 L;  3HZX A;  1ZYR D;  3N52 A;  5HGT A;  2B2W C;  4P75 A;  3W1B A;  4DK0 A;  1V1O A;  4XIG S;  4C3H H;  1ZXT A;  3N6R A;  4DR4 Q;  2YYZ A;  3HOW H;  4FO2 A;  3KBG A;  1STY A;  2FHT A;  2K1B A;  3D3R A;  4HSV A;  4J6H A;  2HD3 A;  2OTL A;  4L5T A;  2UXB L;  4YHH L;  3R2T A;  2NTT A;  3MZ5 A;  4K5W A;  1SYD A;  1PHJ A;  1I50 B;  3FKI H;  3SVM A;  1PLF A;  2Y0S G;  4K14 A;  4JI4 L;  3CF5 A;  1SYB A;  1WTH A;  2HQL A;  2SOB A;  1LM0 A;  1WTO A;  5DM6 3;  2YU9 B;  1VQ9 A;  4H7B A;  1NCV A;  5KIX A;  3QJY A;  1CKO A;  3J81 i;  2BE5 C;  4LFB Q;  2WKC A;  4A3B H;  4V0B A;  4LNQ A;  4DU9 A;  3KF6 B;  1Z7T A;  4K5X A;  4A3M B;  5CR3 A;  4RGO S;  3HOW G;  4DR7 L;  2Z1C A;  3RLN A;  2YTV A;  1YJ9 A;  3CRL C;  4LUO A;  1JB7 A;  4GKK Q;  1KD1 C;  1PYW D;  2QEJ C;  1KQS A;  2K5W A;  4G7O C;  3I73 A;  1VQA A;  1CQV A;  3D31 A;  3J81 c;  1NSN S;  1VQJ A;  5M3M B;  3S2H H;  3L3O C;  2R7Z G;  1BKB A;  5HY6 A;  1A2T A;  2KVM A;  2PMZ B;  2PW7 A;  1KAA A;  3FP9 A;  1IBM L;  2IJ0 A;  2CW0 C;  2ZM6 Q;  4R4C A;  1A63 A;  1I4X A;  1NJI C;  4A3B G;  4UY8 C;  3W3A A;  2ICE C;  1GHJ A;  3J80 c;  4A4I A;  4BS9 A;  2BDO A;  2LS0 1;  3C46 A;  4C3J H;  1PRT D;  4KN4 C;  3VYT A;  5A2Q L;  4Q5V A;  3S1R B;  1PH6 A;  2WAQ E;  2JYO A;  4IUN A;  3CQZ H;  1EY9 A;  3EA6 A;  3PSI A;  3PIP 3;  1PH2 A;  2O4X A;  4QL5 A;  3CXC A;  4CJ2 C;  2R93 G;  4X64 Q;  3VR2 A;  1IYV A;  5CV8 A;  2QKI C;  4ZQ3 A;  2A19 A;  2UUC Q;  5EQ0 A;  3KLS A;  1Q81 C;  4QCL A;  1VQE A;  1JWM D;  5C5L A;  1VMC A;  1I4H A;  2NWG A;  4A3G H;  5COR A;  1GO3 E;  2IWH A;  2ALY B;  2IHE A;  1TY2 A;  2Z4H A;  3I4O A;  2MNA A;  1X65 A;  3I7F A;  3CMA A;  3RUZ A;  4A3D B;  4C3J G;  2PNH A;  2I46 A;  4R4I A;  4P71 A;  3K5L A;  4CHT B;  1ML0 D;  1SNM A;  2F1M A;  4HMJ A;  4X3K A;  2WAQ G;  1WD0 A;  1AEX A;  5KRU A;  4QIW B;  4YWM A;  1PZK D;  1PTO D;  2JA9 A;  1B2T A;  3S2H B;  3J7Y W;  4BXX H;  1K8G A;  1TWG H;  2V1C C;  2BA1 A;  5E3F A;  5JJI A;  1EYA A;  4JI6 L;  1G8Z D;  2HCC A;  1PH5 A;  3CAM A;  4N9P A;  3A8K E;  1K28 A;  4XYO A;  1FNV A;  3I90 A;  4UDU C;  4OWX B;  3NTH A;  4ME3 A;  2D0O A;  3I91 A;  1QIL A;  3AFP A;  1D1K A;  2DUD A;  4DR1 Q;  3S2D B;  1IW7 C;  4C1N I;  2XNA C;  2IW3 A;  4HN7 A;  4PNY A;  3JC6 6;  3EQL C;  2R92 H;  5C3E H;  5KEE A;  4DV4 L;  3HFZ B;  3TP7 A;  3L7Z C;  1AZP A;  3A56 A;  1EY5 A;  1NE3 A;  3D4R A;  3NPP A;  4H13 C;  5T1I A;  4GKK L;  3ND9 A;  2ZTC A;  5DEH A;  3RD4 A;  4FDB A;  4ULL A;  3J81 L;  2HHH Q;  3DWP A;  4APV A;  1WTQ A;  2EE1 A;  2JK8 A;  1H95 A;  3K5O A;  3OYY A;  4LF9 L;  1CZG A;  4DXF A;  1BCP C;  3P20 A;  3GTJ B;  3H6M A;  3GTM H;  2JA5 G;  1QJO A;  1CK1 A;  2JSO A;  3F1Z A;  3J80 L;  1RF2 D;  2D2C C;  3FHW A;  1EUJ A;  3R8B A;  2NVY B;  1X3Q A;  3QR8 A;  2R92 G;  1F2Y A;  3S14 B;  1GD7 A;  4LFA L;  1SFO B;  1DOM A;  2QDL A;  2NVQ H;  1IHZ A;  2UU9 Q;  2ZJP A;  1EFW A;  1S40 A;  3C2P A;  5IOC A;  2VB2 X;  5EPJ A;  4JI1 Q;  4CKB A;  5K36 H;  2G5D A;  3SK4 A;  1II3 A;  2QW7 A;  2UXC L;  1SJH D;  4S3S A;  3IL8 A;  1FVI A;  5CV6 A;  3J7Z C;  1HR0 L;  5IGC A;  3E6Z X;  2O5J C;  1B53 A;  4HJ5 A;  3QO2 A;  4L5R C;  3K7U C;  2HIX A;  1TWC B;  2KBN A;  4GNX B;  2MO0 A;  3CC2 A;  3PV0 A;  2RSN A;  1CKN A;  2SEB D;  4LF4 L;  1CZW A;  1JWS D;  4AQY L;  1X56 A;  4JVZ A;  1Q82 C;  3K5N A;  1QCB D;  1J5E L;  4EGV A;  3G6E A;  3KUP A;  1TWA H;  5I2Y A;  1F9R A;  5D3I B;  3W5O A;  4MN3 A;  4G4K A;  1N33 L;  5CYU A;  3FPP A;  3OMG A;  2F0G A;  2MJ8 A;  2XWB B;  1BCP F;  1SRU A;  1EWI A;  3NSW A;  4QJF A;  1S4Z A;  2AHO B;  1CI3 M;  2ZT9 C;  5IWA Q;  3G6J B;  2G9H D;  5HGQ A;  4WJ3 M;  1YIT A;  1B9N A;  4PV1 C;  3I4M H;  4PZ8 A;  4DR5 Q;  2H4O A;  2IL8 A;  3KJO A;  1I6H B;  2NUC A;  5C4X G;  3Q22 A;  5M5X B;  2A69 D;  1PH7 A;  3KF8 B;  2AWN A;  3PUX A;  2LXJ A;  1ZYR C;  3V05 A;  1LT3 D;  1TWF H;  1SMY D;  1EOT A;  1X3E A;  3H3V H;  3DUZ A;  2OEO A;  1VQ7 A;  1B3Q A;  1GOZ A;  2XRS D;  3GTL H;  2R7Z B;  2PZU A;  2ID0 A;  1QE6 A;  3GTP B;  2L55 A;  4NKL A;  2C9O A;  2A1A A;  4DV1 L;  4K2K A;  2E2J B;  3EIV A;  4Y7N B;  4DAY A;  1OXT A;  3M3Y B;  2BA0 A;  3CU7 A;  4A3C G;  4BY7 G;  3MFY A;  5DNF A;  2B8G A;  3K8A A;  3B6Y A;  3BVZ A;  1EWH A;  4UP7 A;  2KHJ A;  2Z9H A;  3GP7 A;  4JBM A;  4MTN A;  3PIP A;  2R93 B;  2MP1 A;  5GAG C;  4ZYS A;  3Q23 A;  1SNO A;  3H3V I;  1MSH A;  1QNU A;  4KLK A;  1EEI D;  1I50 H;  4FNF A;  2F0F A;  5IGF A;  1Q90 A;  3H94 A;  4MHE A;  2KEE A;  4CDD C;  1A8V A;  4BBR B;  1GXD C;  2RKS A;  1SJE D;  3A8J E;  1JCK B;  3P75 A;  4AYB E;  4UPA A;  1LT6 D;  4A3J B;  1ESR A;  4C3J B;  5JOB A;  1QVG A;  1SLJ A;  2LXK A;  3NTI A;  3VA5 A;  1Y8O B;  2AQ3 B;  3QWN A;  2MUY A;  1GHK A;  4A3M H;  3K5M A;  3SE0 A;  2WAQ B;  2K5D A;  1A62 A;  2CQO A;  2Q2U A;  2CHB D;  1HNX Q;  1XNR L;  3JAM E;  1RD9 D;  5CV4 A;  1SYF A;  1UE7 A;  1STN A;  4IOC A;  4A3L H;  3STB D;  4KMU C;  1PRT C;  5M3M H;  4A3F G;  3O13 A;  1QNK A;  4XT3 B;  4ZLT F;  1AH9 A;  2N49 A;  1YHQ A;  2PMZ E;  2KED A;  3BZK A;  2WKD A;  3ERS X;  5FO8 B;  4R4O A;  1XPO A;  2VQE L;  4AYB G;  2PNR C;  1SDF A;  1D7Q A;  1JQY D;  2AUK A;  4X62 L;  1NBW A;  1Q86 C;  1B44 D;  2VQF Q;  4XQQ A;  5CV7 A;  2RQX A;  2QA4 A;  3HEJ A;  2AWO A;  1LUZ A;  2UXD Q;  4DR2 L;  1STH A;  1DGS A;  2BH8 A;  1SYE A;  1JJ2 A;  2IT1 A;  3BDC A;  4POF A;  2D0P A;  4DR5 L;  3S1R H;  5E4X A;  1TWG B;  1VQI A;  3MAQ A;  3S15 B;  2UUA L;  4DUY L;  1G91 A;  1K83 B;  1OXU A;  4A3L G;  2Z0S A;  3S17 B;  1XNQ Q;  3X3M A;  4KY5 A;  2SNM A;  1Z9F A;  1PTO C;  3VYR A;  1O78 A;  3J81 j;  5T1G A;  3GQB A;  1Y1V H;  2DY8 A;  1EU3 A;  1RTO A;  1H9S A;  3GTQ H;  1EIH A;  1L0X B;  5J22 A;  1VQH A;  3MXU A;  2RHQ B;  4A3D H;  2JA5 B;  2A6H D;  4X66 L;  3R2I A;  4DA2 A;  1DOL A;  3ERO A;  4B3M Q;  2R92 B;  3CP0 A;  2KHS A;  3T4A C;  3U9S A;  4K2L A;  1SAP A;  1I3Q B;  1OXS C;  1PRT F;  1BF4 A;  1RL2 A;  2JP1 A;  5FO7 B;  2EYJ A;  3E9I A;  1HR0 W;  1N32 L;  2P5Z X;  2K5N A;  1KC8 C;  2RDH A;  3MXN B;  5IGE A;  4DUZ L;  3HKS A;  3ND8 A;  2JJQ A;  3TBI B;  2K04 A;  2PZT A;  1X3G A;  1Y1V G;  4GLA C;  1ASZ A;  3VR3 A;  4EQO A;  2EXD A;  4JI5 L;  5IYD H;  3KBX A;  3KFU A;  1S5D D;  1L0Y B;  4QUF A;  2JE6 I;  1WCM G;  4C2M B;  2UXB Q;  1JOR A;  4YHH Q;  1SYG A;  3S2D H;  2NVQ B;  1F2L A;  3GTG B;  1LTR D;  3RZO H;  3PQI A;  3D6W A;  4KY7 A;  1HZA A;  1X3P A;  2F0O A;  4JI4 Q;  4Q0F A;  3NUC A;  3A55 A;  4CGY B;  4LMQ D;  3UDI A;  2N3S A;  1HA5 A;  1PTO F;  1FYC A;  1TQO A;  4DNT B;  5D3D A;  5CBA E;  2MFI A;  4DV3 L;  2G9D A;  2N55 A;  1VQC A;  1PV4 A;  3K6O A;  4ZCK A;  5EJW A;  1WTX A;  1PZI D;  4DR7 Q;  5LL6 S;  3J7A V;  1D2B A;  4UAI A;  3GTJ H;  1LLR D;  4NXN L;  4HIK A;  1TT2 A;  1EIG A;  5C4X B;  2VQF L;  4JI2 Q;  2NVY H;  3OHX C;  3FPU B;  4JI0 L;  3F2B A;  1RIP A;  3U58 A;  1SFO H;  1V1P B;  3C1F A;  1CFM A;  5C5M A;  3SK8 A;  2X6L A;  4KHV A;  1IBM Q;  1XX8 A;  2AKW B;  5FLX c;  1VF7 A;  1Y8P B;  2LY7 A;  2HUG A;  3D6C A;  3NWS A;  3TQY A;  2CQA A;  5G3L D;  3PO3 B;  3A7A B;  2XSC A;  1QUQ B;  2QCP X;  1XNQ L;  3ITP A;  4X6A H;  3CCV A;  2L9H A;  1N36 Q;  2F0Q A;  3OSO A;  4DV5 Q;  3MXG A;  4WJ4 A;  2L0C A;  1K73 C;  4BY7 B;  1TWC H;  5IGB A;  3F2D A;  1G2T A;  2FFK B;  3PUW A;  4GN3 B;  1MHW C;  3GTK B;  2L12 A;  2Z4I A;  3KK7 A;  1B50 A;  2I5M X;  2RHS B;  3KYH C;  2BCO A;  3OWF A;  4LAA A;  4B3M L;  2EYO A;  2ENB A;  3VR5 A;  1N9W A;  4IUU A;  3DM3 A;  1H9K A;  3LWE A;  3JAM c;  1GUO A;  3GTL B;  4K6L A;  3A5Z B;  3H09 A;  3HP3 A;  1YBY A;  3DWA A;  1BO0 A;  1SNP A;  2VB3 X;  1X3F A;  3M4P A;  1EIY B;  5C4J H;  1SMY C;  1L1O B;  5M3F H;  5HUR A;  2E74 C;  4ZKB B;  1VQP A;  1IBL Q;  4FF2 A;  1AP0 A;  1C9O A;  1XTD A;  3F2C A;  1K8A C;  1IZ6 A;  1SXT A;  1I6H H;  1STG A;  3NQI A;  1KXL A;  5M5X H;  4JCV E;  3DLL A;  2Q8T A;  3CC7 A;  2OQK A;  4N9T A;  4JI7 L;  2KCN A;  1XJV A;  1PH8 A;  4F87 A;  3VR6 A;  1XYI A;  2ZTE A;  1D5X C;  1ICF B;  3J7A 5;  1ZKO A;  4JI6 Q;  1BVS A;  1WVL A;  4A3F B;  1HNW L;  2R7Z H;  1A15 A;  5ELC A;  3GTP H;  1YJW A;  5M3F G;  1CKN B;  1D5Z C;  1ICW A;  1TWH B;  1JC7 A;  4AYB B;  2K01 A;  2E2J H;  1E1T A;  3BYY B;  4Y7N H;  4G7Z C;  3M3Y H;  4DR6 L;  1QWY A;  4L63 B;  4MZ9 A;  2YV5 A;  1JOO A;  1KNE A;  4DV4 Q;  3I56 A;  1BBW A;  2J0T D;  1UAP A;  1E2V A;  1RJT A;  1U9R A;  1VCI A;  3J80 i;  1IL2 A;  2Z6K A;  1EZ8 A;  5ELE A;  5C44 H;  3P1H A;  4JI2 L;  3NBH B;  1HZC A;  1VDZ A;  3IFT A;  2IPK D;  4RGN A;  2R93 H;  1IYU A;  3WOF A;  3A7L A;  3PMF A;  5IP9 G;  4LF9 Q;  5FLX L;  5IT9 E;  4ZKC B;  2K52 A;  1XPU A;  2VL6 A;  4CBV A;  3PCO B;  3WOE A;  1IKM A;  4BBR H;  2ZXR A;  2EXZ A;  3NK9 A;  4F7X A;  4EVO A;  4TQU S;  4O2D A;  4LFA Q;  1N36 L;  4A3J H;  3STB C;  2FMM A;  3A8I E;  4DV5 L;  2F3I A;  2B2V C;  2F4V L;  2O5I C;  2KCC A;  4IJL A;  4K0K L;  3AYH B;  2Z6K C;  5C44 G;  1KTK A;  5L37 A;  3E0E A;  1CTM A;  4OWW B;  1WJJ A;  2UXC Q;  1D1I A;  3BZD B;  4G7H C;  4FXK C;  1D8L A;  1HR0 Q;  1PXU A;  1O7I A;  4R4Q A;  2RDG A;  3JAM L;  1QZH A;  4C3I B;  3NP8 A;  1VQM A;  4BBR G;  2F4I A;  2RBM A;  3EBE A;  4OXP A;  1JT8 A;  1Y1V B;  5ELF A;  4LF4 Q;  2GVA A;  1RCV D;  3GTQ B;  1QOH A;  4AQY Q;  4A3J G;  1FGB D;  5EKK A;  1CA6 A;  1J5E Q;  4KHZ A;  2B2Y A;  1WCM B;  2RVL A;  4M8A A;  4C56 C;  1RHP A;  2F0M A;  2XN9 C;  3K58 A;  5I6W A;  2JXM B;  1IBL L;  1N33 Q;  3IAY A;  3VR4 A;  1VQ4 A;  5KYI A;  3S15 H;  1GJX A;  1STA A;  1K83 H;  2BDN A;  2A6H C;  3QOL A;  4IPD A;  1LT4 D;  4WFN 3;  2JA7 G;  3S17 H;  4E6I A;  1YVC A;  1XPR A;  3CCQ A;  1Q1E A;  4RHR A;  2IX3 A;  3LX0 A;  4UP9 A;  1QVC A;  3HOV H;  5C0X J;  1HCZ A;  4ZUI A;  4IO9 A;  3AU7 A;  4X3T A;  1DJR D;  4HTH A;  3TP6 A;  1MKH A;  2AQ2 B;  2E8G A;  1PFM A;  1YHA A;  2B2Y C;  3LWU A;  4XXE A;  3UE1 A;  1LTL A;  2JA5 H;  5FOB B;  3M4Q A;  2F3V A;  2WAC A;  3RZO B;  2SDF A;  1UE6 A;  1VQK A;  2NVT H;  3F2U A;  1Z47 A;  4RGM A;  2HQE A;  1M1K C;  3EVQ A;  1I4P A;  1I3Q H;  2JEB I;  1HPC A;  2R7F A;  2ASB A;  4PMB A;  1E2Z A;  4RGT A;  2VS1 A;  3ONA B;  4DV1 Q;  1IXR A;  2EQS A;  1VQB A;  1I94 Q;  3PO2 B;  1A2U A;  1HTP A;  3HOV G;  4EQ5 A;  2J4X A;  2TSS A;  3ERQ A;  1NAP A;  1Q1B A;  4PZ7 A;  2F0H A;  4KKU A;  4JV5 Q;  4LK1 C;  2RCF A;  3URY A;  2A6E D;  1CSP A;  4P72 A;  3KDF B;  1ENA A;  1WI5 A;  4LUZ A;  1F2M A;  3NXW A;  4K8J A;  4C2M H;  1V1Q A;  4L8J A;  1XTC D;  2M9V A;  5E4W C;  1IYJ B;  3D0F A;  3GTG H;  2E2D C;  4DKA C;  3TS0 A;  1M90 C;  1VQ8 A;  2X69 A;  4HJ9 A;  4R8N A;  1R4Q B;  2KQ3 A;  1ET6 A;  3P7J A;  2R61 A;  4IZ8 A;  2RDF A;  5IYC H;  4JBK A;  4KD3 A;  1HXY D;  1WOC A;  1D6E C;  1JR0 D;  4A93 H;  1JOK A;  4FF1 A;  2H5X A;  4GZY C;  3T1Y Q;  1AZQ A;  1KRS A;  2KA7 A;  2DNE A;  3CCS A;  2XGT A;  3H3V C;  2YTX A;  1XNR Q;  3NEL A;  4FP5 D;  1Q46 A;  4LWC A;  1EL0 A;  1MGS A;  1AW7 A;  2LFN A;  5C4X H;  4B08 A;  1TXY A;  2Q2I A;  5IYC G;  2I07 B;  1PFB A;  1J9O A;  3OIQ A;  3EFX D;  4JW0 A;  5IY0 A;  1R4P B;  5BN3 A;  5JJL A;  2KEC A;  3K81 C;  3OMC A;  4P73 A;  2VQE Q;  3SGI A;  4A93 G;  3D4W A;  4UHV A;  3TDQ A;  2IX1 A;  4X62 Q;  4HID A;  3BVG A;  5FKA C;  3H91 A;  3PO3 H;  3E9H A;  4A76 A;  5C4J B;  3T56 B;  4DXG A;  3KF6 A;  5M3F B;  5JVG 3;  1LT5 D;  4HJ8 A;  4DR2 Q;  4NXM Q;  4GLX A;  2WIN B;  1NY4 A;  4OGQ C;  4A3C H;  1H9J A;  4BY7 H;  2WB1 G;  2JA6 H;  2UUA Q;  3DWQ A;  1K8O A;  4DUY Q;  3PF5 A;  3GTK H;  3KLS X;  4ZRZ A;  3T53 B;  4DNI A;  1CSQ A;  3MHB A;  3QOJ A;  1K0S A;  3AQQ A;  1VQN A;  1FL0 A;  4YWK A;  3FMC A;  3OIP A;  3V96 A;  2K05 A;  2OF1 A;  2B8F A;  1E1O A;  4HCE A;  4RFB A;  1B8A A;  1N34 Q;  2F52 A;  3PO3 G;  2OTJ A;  2EY2 A;  5TSS A;  4OHJ A;  3PGZ A;  1VQL A;  1I94 L;  4X66 Q;  2K32 A;  4GOP B;  5G3L F;  4I7Z C;  2JA6 G;  4ID6 A;  1S5E D;  4PMW A;  1NMG A;  5C4H A;  4JV5 L;  5F2D A;  1PH4 A;  4HJ7 A;  1N32 Q;  2IY5 B;  5C44 B;  1W2B A;  3HOZ G;  2JQO A;  1OO9 B;  3TZD A;  2QIL A;  4V19 0;  1R9T B;  4DUZ Q;  5M9O A;  4DAP A;  3S1N H;  1HA6 A;  2K6A A;  4CDF C;  4RKB A;  3AFQ A;  3DHQ A;  3ULJ A;  1Q12 A;  1SBB B;  4JI5 Q;  4A3F H;  1B9M A;  4ZUJ A;  3S1M B;  2DN8 A;  1OTC A;  1K0R A;  4DV6 Q;  1TWH H;  1Y1W B;  1I4Q A;  1BDO A;  4NPS A;  1VQF A;  2Z8L A;  2PI2 A;  1EU4 A;  3T1Y L;  1W6J A;  2PW5 A;  1HH2 P;  1PDQ A;  4DV7 Q;  1U4R A;  5IE8 A;  1LV9 A;  1TU2 B;  3I4L A;  3TSS A;  1UE5 A;  1UEA B;  3T13 A;  2NB0 A;  1HUN A;  3TZU A;  1VQ6 A;  1FR3 A;  1FNU A;  4A3E G;  1QG7 A;  1DON A;  5A2Q E;  1UE1 A;  2K5H A;  4IPC A;  4DV3 Q;  2K7V A;  3K59 A;  1VS0 A;  1CA5 A;  2JA7 B;  1QB5 D;  1DZ1 A;  1G29 1;  3PUZ A;  5DM7 3;  5C3X A;  3MC0 B;  1PYB A;  1TS3 A;  2CH4 A;  4YY3 L;  1Y14 B;  1ESF A;  1X55 A;  2RF4 A;  2ZXO A;  4DN4 M;  4NXN Q;  3TRE A;  1XMQ L;  1WD1 A;  4M1U B;  1Q8K A;  4WOR A;  2F0N A;  2EY6 A;  4JI0 Q;  4K8I A;  1EYD A;  4TSS A;  4BBS G;  5CC4 A;  4NXM L;  5H1S E;  2EJG C;  2F0U A;  5C0X H;  4POG A;  4HED A;  5A35 A;  1E7Z A;  2E2H H;  2JN4 A;  1Q7Y C;  2LSS A;  4DGZ A;  5JPM C;  2K4K A;  1X54 A;  4CKC A;  3HRZ C;  1HQM C;  5EKI A;  3UE0 A;  5FO9 B;  1PFS A;  3S16 B;  2EYL A;  5I9O A;  4CDC C;  1PMR A;  1U4M A;  3HOV B;  2CWA A;  2K5V A;  4C3I H;  5FJ8 H;  1N34 L;  4OL7 A;  4HCS A;  1IL8 A;  3RZD B;  2DGY A;  2WV6 D;  5J1Z A;  3FDT A;  3WDN A;  4EX5 A;  3ULL A;  1JE5 A;  2PYK A;  4RH6 A;  5C0X G;  1JMC A;  1WCM H;  1C48 A;  2NVT B;  3GDE A;  2D5D A;  5C0X I;  1JE4 A;  4HSP A;  4Y52 H;  4R9W A;  4RWS C;  2XRQ D;  3ER0 A;  3ICE A;  1MIU A;  3FRP B;  5GAE C;  3H15 A;  1LTS D;  2KCT A;  3TEH B;  3CD6 A;  4JC0 A;  1KAB A;  2F3W A;  3HGB A;  4C3I G;  5FJ8 G;  1PH1 A;  5D14 A;  2H1E A;  5IP7 G;  1BR9 A;  1RKN A;  4ZAI A;  3J81 E;  1NR4 A;  1L0W A;  1TY0 A;  4TVA B;  3K80 C;  5AFW A;  4DV6 L;  4JI7 Q;  4BY1 G;  1P16 A;  3RNU A;  3HKZ E;  2JA8 G;  4B3T L;  1SE4 A;  3MVV A;  3J80 E;  1KDB A;  3RR5 A;  4DV7 L;  3NTK A;  4TKO B;  2K03 A;  1YJN A;  5FK9 C;  1HNW Q;  1YI2 A;  2EY5 A;  3BS1 A;  4A3K H;  2A6E C;  4A93 B;  4JI3 Q;  3PO2 H;  3CW2 C;  1KAW A;  4HAE A;  1AN8 A;  4IQZ A;  4GNX C;  3K7A B;  4JBJ A;  5JEA J;  3NEM A;  5JJZ A;  1SNQ A;  4DR6 Q;  4GLV B;  1IBK L;  2ZJR A;  3MXP A;  4F8M A;  1EYG A;  4ABN A;  1FGU A;  4EQP A;  1XMO L;  4KN7 C;  4IPG A;  1U4L A;  3EN2 A;  1F9Q A;  3BYT B;  5I2X A;  2I0Q A;  3KF8 A;  2ZXP A;  2WB1 B;  3HKZ G;  3M4O B;  1EY0 A;  1W6K A;  1UEB A;  5KNB A;  4HIM A;  2PQA A;  3G71 A;  4GS3 A;  1JJG A;  1LO5 D;  4F88 A;  1GKH A;  4ILW A;  5KGU A;  1A3U A;  4A3K G;  2F0T A;  2ZTD A;  5EKL A;  5ELN A;  2B63 H;  3PO2 G;  1CQF A;  1WTW A;  2Q2H A;  5M5W B;  4OO1 G;  1LTI D;  4DNR B;  1BCP B;  3M4Y A;  4OO1 I;  1EQR A;  2FMC A;  3H0G B;  1A6X A;  5KYL A;  5M5Y B;  3TP5 A;  4KK7 A;  3JAM i;  2F4V Q;  3OPO A;  1NMF A;  4K0K Q;  5FLM H;  4OEM B;  3TRZ A;  2R7D A;  2JA6 B;  5LHY 1;  4IUT A;  1JJC B;  4L5Q A;  4JK1 C;  1XWE A;  1PYS B;  2R6G A;  5JAV A;  3J7A F;  1FNW A;  1G51 A;  5LMU L;  2A74 C;  1CM9 A;  5CMD A;  3HOZ B;  2B63 G;  4B3R L;  1RTN A;  5K5P A;  5LMN Q;  2ZJQ A;  5C6A A;  1SE8 A;  2IHF A;  1ET9 A;  2YTY A;  3PF4 A;  3QB3 A;  1A3T A;  2KJX A;  1A3V A;  5J39 A;  2K5Q A;  3M85 A;  4GOP C;  4DV2 Q;  3AEV A;  4RA8 A;  5J3B A;  4IN3 A;  1VQG A;  4LF5 L;  5FLM G;  2EYF A;  4U68 A;  1CKM A;  1KLU D;  4XTC S;  1TVX A;  5DLQ E;  2NVX B;  2MGS A;  4QUC A;  5ELO A;  2EOT A;  3HOX H;  2EYM A;  3CKI B;  4IUR A;  1I4R A;  3U4Z A;  3S1Q B;  4KHP L;  2E75 C;  2L5T A;  4X3U A;  3VDY A;  1EY8 A;  1TR5 A;  5I9P A;  1T5E A;  3L9A X;  2F0V A;  3OTO Q;  4QQB X;  4KKS A;  2NN6 I;  3UDG A;  3S1N B;  4DR3 L;  4A3E B;  4RAU C;  3HOY B;  4FXD A;  4QB4 A;  3KLW A;  4LF7 Q;  4B9W A;  2F0L A;  1VMP A;  1PH3 A;  1PFN A;  2NYZ D;  1CHP D;  1YIJ A;  1TS4 A;  3KLR A;  5E1F A;  3Q24 A;  5IP9 H;  2HIV A;  1HNZ Q;  2LKV A;  2KOL A;  3EJI A;  4LW1 A;  4JI3 L;  3ZYY X;  3C3L A;  3HOX G;  2WFW A;  4X3S A;  1AE2 A;  4JOI C;  2AMC B;  2A68 D;  4BBS B;  3TN2 A;  2B2V A;  1W3S A;  1SYC A;  1YEZ A;  2XTI A;  4TRD A;  1Z6H A;  2CVR A;  2C5C A;  1R9T H;  3I70 A;  1CUK A;  4C3H G;  3X3N A;  4IFD J;  3RMH A;  1NNX A;  2HDL A;  3R93 A;  3E3X A;  1J8I A;  4PG3 A;  1EIF A;  1ZEQ X;  2B2U A;  5KND A;  1I6V C;  4PQX A;  4RCO A;  1HTL D;  5ELB A;  4DAV A;  4FF3 A;  3S1M H;  3HOU B;  1MJE A;  4PMC A;  1FD7 D;  3FKI G;  1Y1W H;  5ISR A;  1BXT A;  1TS5 A;  2FJ2 A;  4L5S A;  1FJG L;  4Z9C B;  1O7Z A;  4JG2 A;  2BH2 A;  4G57 A;  2E2H B;  1GUS A;  2I5H A;  3SR1 A;  4DV0 L;  4YIJ A;  2DJG C;  3T1H Q;  5JPN C;  3PIO 3;  4GKJ L;  1O7L A;  3I2Z A;  2KEN A;  3MXN A;  1MD2 D;  5D65 A;  4HR7 B;  2NBF A;  2E2I B;  2AUJ D;  2OT2 A;  1GVP A;  3M9B A;  4JI8 L;  4KY6 A;  4WJW A;  4AIM A;  3BJU A;  1EOV A;  4DAY B;  2F0I A;  5LMN L;  4O1N A;  5EGT A;  1KLG D;  2B2U C;  2JA7 H;  3I8Z A;  4N8X 1;  1P8L A;  1DM0 B;  1MJC A;  2F0E A;  3T16 A;  5I6Y A;  1Y1W G;  2E5L L;  4LF6 L;  4DV2 L;  2NTS A;  3NEN A;  1ENF A;  5EPK A;  4DPG A;  1KL9 A;  1Y69 U;  4RMF A;  1EY7 A;  2Q8R E;  4BY1 B;  5ELD A;  2JA8 B;  2XVS A;  3LNN A;  4JBW A;  1M8A A;  1C8C A;  3GTO B;  1PRT B;  4NB3 A;  1RDP D;  3CHB D;  4EQN A;  1WFQ A;  3C1E A;  3VYS A;  5AJ3 Q;  2NZO A;  2I5L X;  4H02 A;  3OTO L;  1BBX C;  3S16 H;  4DAM A;  1LTB D;  4LF7 L;  1VQD A;  3VYU A;  2PZW A;  1K8M A;  1SSO A;  2VUM H;  1S72 A;  1MBY A;  1HNZ L;  4DK1 A;  4DR4 L;  3RZD H;  2L1B A;  5GQO A;  2BOS A;  4XT1 B;  3U4V A;  4CDE C;  5JEA H;  3CCE A;  1V1P A;  3CRK C;  1WTV A;  4A3G G;  3HKZ B;  4A3I H;  3SDZ A;  4RG1 A;  2EDG A;  1PA6 A;  4IAL A;  1BOS A;  1NUC A;  1EZ6 A;  2V4D A;  3DEO A;  4A3K B;  1EWC A;  1PZJ D;  1QUQ A;  3QIA A;  1PTO B;  4R4T A;  4YCW A;  3A5U A;  1Q3L A;  3NE5 B;  1K3R A;  4I65 A;  4LFB L;  2VUM G;  1ONL A;  2D62 A;  4BXX G;  2DY7 A;  2EIF A;  2OXP A;  5I4D A;  5JEA G;  2VY3 A;  1T9H A;  2MO1 A;  4NDX A;  4A3I G;  2RCN A;  1E3P A;  3GO5 A;  4H0L C;  4NW2 A;  1LTT D;  3U50 C;  2KHI A;  1AFP A;  2CWP A;  5EAY A;  2B63 B;  1F9S A;  4AH6 A;  1V8Q A;  2ZM6 L;  2GN5 A;  1EY6 A;  1MI2 A;  2QEX A;  3T1H L;  5IOD A;  2RA4 A;  1OXX K;  2WP8 J;  1YHB A;  3D4D A;  3FEW X;  1H9S B;  1DCZ A;  1SE2 A;  1LTA D;  4KJO A;  5BR8 Q;  5NUC A;  1L1O A;  5C3E G;  2EJM A;  2FXQ A;  3K7A H;  2KUM A;  4ODG A;  2DJF C;  1EQV A;  4KJN A;  4UP8 A;  2KCM A;  1F2Z A;  3A74 A;  1YNN D;  1B1Z A;  1IKL A;  2PPB C;  1E24 A;  4YCV A;  4ALP A;  4N8F A;  3OW2 A;  2Q2T A;  2WB1 E;  4X64 L;  3M4O H;  1I5F A;  1F9P A;  5DAU A;  3S9W A;  2UUC L;  2B29 A;  1BQQ T;  1H9M A;  2MHV A;  1H9R A;  2AQ1 B;  1B4O A;  4P2C B;  4K6D A;  1DOK A;  2ICI A;  3Q0A A;  2L15 A;  3VA7 A;  3A54 A;  4YY3 Q;  1TKW B;  1L1O C;  4OEL B;  5M5W H;  2J7Z A;  1U4P A;  1XMQ Q;  1VQO A;  3OWE B;  5IIF A;  5AJ3 L;  4B3S Q;  5IT9 c;  4DK6 C;  3WWV A;  1SRO A;  3H0G H;  2K75 A;  5M5Y H;  1DD2 A;  3OOC A;  2O2L D;  4J15 A;  1S5C D;  1YNX A;  2M2L A;  5K36 G;  1M4V A;  3HOX B;  3I72 A;  4DFA A;  3BZC A;  4BWG B;  3I4N H;  2CKZ B;  1JWU D;  2A8V A;  1B3A A;  2Y0S B;  4FVM A;  2D9U A;  4GN4 B;  1JB3 A;  3M7G A;  3BVM A;  3NBH A;  5GAH C;  3BDL A;  2SNS A;  1SNC A;  3L0O A;  2X6G A;  4QY7 A;  1A0I A;  3HOZ H;  2B39 A;  1XXG A;  3DM1 A;  2EZV A;  3A0J A;  2F0D A;  4C3H B;  1UUP A;  4CJ0 B;  1YNJ D;  3MEF A;  3W2D A;  4YWL A;  3H0G G;  3QG1 A;  1C7Y A;  3HOW B;  4B9X A;  1KHI A;  4DR1 L;  3I4N G;  4FF4 A;  2PQA B;  1EFI D;  2VXW A;  1UNS A;  1EY4 A;  2NVX H;  3FKI B;  4IFD H;  1E2W A;  1KDA A;  1BNZ A;  2QGQ A;  2RSO A;  3DEP A;  3CCM A;  3I55 A;  1ENC A;  2QDB A;  2PO4 A;  3S1Q H;  1GUN A;  4NMZ A;  3CCL A;  1O80 A;  1TII D;  5LMN W;  3MFG A;  2JEA I;  3PIO A;  2HHH L;  3BDO A;  5GRO A;  4A3B B;  2QF7 A;  3I4M G;  1SE3 A;  4A3E H;  3HOY H;  1HHV A;  1B7Y B;  3G7L A;  2A68 C;  3IFD A;  4MIU A;  1NTG A;  2K50 A;  1E22 A;  1X32 A;  5IGD A;  1Y8N B;  2VW9 A;  4IOA A;  1KNA A;  4QMG A;  3NBI A;  1D5M C;  3SK6 A;  2VNU D;  4IFD G;  1C4Q A;  2WII B;  5BR8 L;  5FLX E;  4L6T B;  4XQJ A;  4O42 A;  3SK5 A;  2BE5 D;  4JYA Q;  1E0B A;  4CJ1 B;  2F0W A;  4B3T Q;  3TP8 A;  4IFD I;  2B3G A;  2UU9 L;  4OX9 Q;  3OW7 A; 
#chains in the Genus database with same CATH homology
 4DR6 Q;  5C44 H;  1WYD A;  2JA5 G;  4JI2 L;  4GLV B;  1IBK L;  2ZJR A;  3NBH B;  1HZC A;  3F1Z A;  1EYG A;  4BBS H;  4A93 G;  1XMO L;  1FGU A;  3FHW A;  4LFC Q;  1EUJ A;  3F8T A;  4JI1 L;  2R93 H;  1L2F A;  4IPG A;  2R92 G;  2YU9 H;  5IP9 G;  2C35 B;  4YCU A;  1GD7 A;  3EN2 A;  4LFA L;  4LF9 Q;  3HOY G;  2NVQ H;  2I0Q A;  2UU9 Q;  2K52 A;  4BA1 I;  2ZJP A;  1XPU A;  2VL6 A;  4KHP L;  3HKZ G;  1EFW A;  3LGJ A;  3PCO B;  1UEB A;  4HIM A;  1S40 A;  1IBK Q;  2PQA A;  3G71 A;  4GS3 A;  1JJG A;  1V9P A;  4BBR H;  1GKH A;  1XMO Q;  4GKK Q;  4JI1 Q;  4QGU A;  1V43 A;  4TQU S;  4O2D A;  4LFA Q;  4A3K G;  2ZTD A;  1N36 L;  2UXC L;  4PZ6 A;  5ELN A;  4A3J H;  3STB C;  4DV5 L;  2B63 H;  1FVI A;  2F3I A;  4A75 A;  3J7Z C;  2F4V L;  4IJL A;  4K0K L;  1HR0 L;  3PO2 G;  2Q2H A;  3CME A;  4HJ5 A;  3CCR A;  4L5R C;  4B3S L;  3AYH B;  3K7U C;  2Z6K C;  3HOU H;  4OO1 G;  5C44 G;  2HIX A;  3E0E A;  2MQH A;  3G48 A;  3NEM A;  2KBN A;  4GNX B;  4OWW B;  1WJJ A;  1EQR A;  2MO0 A;  4OO1 I;  3CC2 A;  2UXC Q;  3PV0 A;  1CKN A;  4LF4 L;  3JAM i;  2F4V Q;  1D8L A;  1NMF A;  3KJP A;  4AQY L;  5FLM H;  1HR0 Q;  1X56 A;  3TRZ A;  4K0K Q;  1O7I A;  4R4Q A;  2R7D A;  1Q82 C;  2VZA A;  1QZH A;  1J5E L;  1JJC B;  2IY5 B;  3G6E A;  4L5Q A;  1TWA H;  1VQM A;  4BBR G;  1PYS B;  2R6G A;  3EBE A;  4OXP A;  3M7N A;  1JT8 A;  2E2I H;  4A3M G;  1G51 A;  4R1J A;  5LMU L;  5IWA L;  4LF4 Q;  4OON A;  2GVA A;  3W5O A;  1N33 L;  4AQY Q;  4A3J G;  2B63 G;  4B3R L;  5LMN Q;  2ZJQ A;  1J5E Q;  4KHZ A;  2UUB Q;  4QJF A;  1SE8 A;  1EWI A;  1SRU A;  1U0L A;  2IHF A;  3KDF A;  5IP7 H;  3HOU G;  2AHO B;  2YTY A;  3PF4 A;  1LYL A;  3K0X A;  5LMU Q;  3RLF A;  5IWA Q;  1IBL L;  5M3M G;  1N33 Q;  3M85 A;  4GOP C;  4DV2 Q;  3AEV A;  5J3B A;  1K9M C;  4X65 Q;  1VQG A;  5HGQ A;  4B3R Q;  1VQ4 A;  4LF5 L;  4WJ3 M;  1YIT A;  5FLM G;  4PZ8 A;  4DR5 Q;  1PH9 A;  3I4M H;  3S15 H;  1K83 H;  2OQ0 A;  3KJO A;  1CKM A;  4XTC S;  4BY1 H;  5C4X G;  5DLQ E;  4IPD A;  2JA8 H;  3S17 H;  2JA7 G;  3Q8D A;  1PVO A;  1HJP A;  1PH7 A;  1YVC A;  3CPW A;  5ELO A;  3CCQ A;  1XPR A;  3GTO H;  1Q1E A;  3KF8 B;  3PUY A;  3HOX H;  2AWN A;  1SN8 A;  2GVB A;  3PUX A;  4UP9 A;  1QVC A;  3U4Z A;  2LXJ A;  2N78 A;  5C0X J;  3RN5 A;  4LF5 Q;  3H3V H;  1TWF H;  1X3E A;  3HOV H;  4IO9 A;  3VDY A;  5IYB H;  1MKH A;  1VQ7 A;  2E8G A;  4GNX A;  1YHA A;  4QQB X;  4QIW E;  3OTO Q;  3GTL H;  2NN6 I;  3UDG A;  2ID0 A;  3UE1 A;  4DR3 L;  1LTL A;  2JA5 H;  4LF7 Q;  2PI2 E;  3KLW A;  2OWO A;  1PH3 A;  3M4Q A;  1HZB A;  1X6O A;  4KHP Q;  2A1A A;  4DV1 L;  1YIJ A;  1UE6 A;  3EIV A;  2HT1 A;  1OXT A;  1VQK A;  2NVT H;  2BA0 A;  5IP9 H;  1Z47 A;  4A3C G;  4BY7 G;  2HIV A;  1HNZ Q;  1M1K C;  4JYA L;  4O0A A;  4LW1 A;  3K8A A;  4LF8 Q;  1I3Q H;  2OCE A;  2JEB I;  3B6Y A;  4DR3 Q;  2R7F A;  4JI3 L;  2ASB A;  4OX9 L;  2VS1 A;  4UP7 A;  3HOX G;  2KHJ A;  1IXR A;  2EQS A;  1VQB A;  2WFW A;  4OWT B;  4DV1 Q;  1I94 Q;  3PUV A;  2IX0 A;  1AE2 A;  4JOI C;  1N8R C;  3HOV G;  4EQ5 A;  2AMC B;  4LFC L;  4A3D G;  5IYB G;  4JBM A;  4MTN A;  1OXV A;  1YZ6 A;  1QZG A;  1Q1B A;  4PZ7 A;  3PIP A;  1W3S A;  5GAG C;  3H3V I;  4KLK A;  3BU2 A;  4JV5 Q;  4HIO A;  1YEZ A;  2NZH A;  2ATW A;  1I50 H;  1HZ9 A;  2XTI A;  3UDF A;  1CSP A;  4GN5 A;  4P72 A;  3KDF B;  1R9T H;  1WI5 A;  4LUZ A;  4C2M H;  1A8V A;  4KI0 A;  1CUK A;  1V1Q A;  1B70 B;  4IFD J;  5JJK A;  1IYJ B;  3D0F A;  3GTG H;  1UWV A;  1HNX L;  4AYB E;  4DKA C;  3TS0 A;  4PG3 A;  4UPA A;  1EIF A;  3RN2 A;  1M90 C;  1VQ8 A;  1S3O A;  4HJ9 A;  1QVG A;  1SLJ A;  2LXK A;  5IYC H;  4JBK A;  3S1M H;  4A3M H;  1MJE A;  5IYD G;  3FKI G;  1WOC A;  5GAD C;  1Y1W H;  1A62 A;  1EQQ A;  2CQO A;  1AE3 A;  2Q2U A;  3S24 A;  4L5S A;  1FJG L;  1HNX Q;  1XNR L;  4A93 H;  2BH2 A;  4JG2 A;  3ULP A;  2I5H A;  1QVF A;  4DV0 L;  2ES2 A;  1J6Q A;  2H5X A;  1VQ5 A;  1UE7 A;  3T1Y Q;  4IOC A;  3T1H Q;  1KRS A;  4GKJ L;  4A3L H;  3STB D;  3UDX A;  3I2Z A;  2KEN A;  3CPF A;  5M3M H;  3CCJ A;  4GOP A;  4A3F G;  3S14 H;  3CCS A;  2XGT A;  4BA2 I;  1AH9 A;  1FJG Q;  2N49 A;  1YHQ A;  2PMZ E;  2YTX A;  3BZK A;  1XNR Q;  3NEL A;  2UXD L;  3ERS X;  1IL2 A;  1Q46 A;  4LWC A;  1GVP A;  3M9B A;  4R4O A;  1GM5 A;  4JI8 L;  1XPO A;  4DAY B;  4AIM A;  4AYB G;  3BJU A;  1EOV A;  5C4X H;  2VQE L;  5LMN L;  4DV0 Q;  1D7Q A;  3RLO A;  1TXY A;  2UUB L;  2JA7 H;  2Q2I A;  4MNO A;  4X62 L;  1NBW A;  3IRB A;  1Q86 C;  2VQF Q;  4GKJ Q;  5IYC G;  1P8L A;  1KRT A;  5E7N A;  1MJC A;  2QA4 A;  4DK3 C;  5JEA J;  2AWO A;  1LUZ A;  5IY0 A;  1Y1W G;  4DR2 L;  4DV2 L;  2E5L L;  4LF6 L;  2UXD Q;  1DGS A;  5JJL A;  3K81 C;  1SR3 A;  4X65 L;  2BH8 A;  4P73 A;  4JI8 Q;  2VQE Q;  3SGI A;  2IT1 A;  3NEN A;  4HJA A;  1JJ2 A;  4POF A;  2D0P A;  4DR5 L;  3S1R H;  3CCU A;  3ZJY C;  4DPG A;  2IX1 A;  1KL9 A;  4X62 Q;  1VQI A;  4HID A;  3PO3 H;  3E9H A;  2UUA L;  4A76 A;  4RMF A;  4DUY L;  1U5K A;  1OXU A;  1G6P A;  4A3L G;  3KF6 A;  2Z0S A;  1ASY A;  2N8N A;  3L2P A;  4LF6 Q;  4HJ8 A;  4DR2 Q;  2E5L Q;  4GLX A;  4JBW A;  4NXM Q;  1XNQ Q;  1NY4 A;  1Z9F A;  4A3C H;  4BY7 H;  3CC4 A;  4NB3 A;  3G4S A;  2WB1 G;  3KOJ A;  4IPH A;  2JA6 H;  1SMX A;  3W1G A;  3GD7 A;  1KIX A;  3TS2 A;  2UUA Q;  4P74 A;  1WFQ A;  5AJ3 Q;  4DUY Q;  3J81 j;  2NZO A;  2I5L X;  4H02 A;  3OTO L;  4LUV A;  3PF5 A;  3GTK H;  1Y1V H;  2CFM A;  3S16 H;  4DNI A;  4DAM A;  1CSQ A;  4LF7 L;  1VQD A;  4JOI A;  3GTQ H;  2K14 A;  1VQH A;  2RHQ B;  4A3D H;  3AQQ A;  2Y0S E;  4IJH A;  4X66 L;  1FL0 A;  1VQN A;  2VUM H;  2NN6 G;  4YWK A;  1S72 A;  1X9N A;  1HNZ L;  4B3M Q;  1BBU A;  1E1O A;  2CCZ A;  4DR4 L;  1B8A A;  3RZD H;  1N34 Q;  5GQO A;  3CP0 A;  2F52 A;  3U4V A;  4LF8 L;  3PO3 G;  2OTJ A;  3CCE A;  3PGZ A;  4A3G G;  1VQL A;  1OXS C;  4A3I H;  4P75 A;  1I94 L;  1RL2 A;  4X66 Q;  3E9I A;  3W1B A;  1HR0 W;  4RG1 A;  1N32 L;  4XIG S;  4C3H H;  2K5N A;  1KC8 C;  1PA6 A;  4GOP B;  2JA6 G;  4DR4 Q;  3MXN B;  2YYZ A;  3HOW H;  4DUZ L;  3HKS A;  2JJQ A;  4PMW A;  1NMG A;  4JV5 L;  1X3G A;  2OTL A;  4L5T A;  2UXB L;  1Y1V G;  1QUQ A;  4GLA C;  4R4T A;  4YCW A;  4YHH L;  1PH4 A;  3A5U A;  1ASZ A;  4HJ7 A;  1PHJ A;  1K3R A;  1N32 Q;  2EXD A;  4JI5 L;  3FKI H;  1W2B A;  2JQO A;  3HOZ G;  2Y0S G;  2VUM G;  4LFB L;  5IYD H;  3KFU A;  2D62 A;  4JI4 L;  3CF5 A;  4BXX G;  2HQL A;  2EIF A;  2JE6 I;  1LM0 A;  1WCM G;  4DUZ Q;  3S1N H;  2UXB Q;  4YHH Q;  1VQ9 A;  5JEA G;  3S2D H;  2VY3 A;  3AFQ A;  3ULJ A;  1T9H A;  3RZO H;  2MO1 A;  1Q12 A;  1CKO A;  3J81 i;  1HZA A;  4A3I G;  4JI5 Q;  4LFB Q;  4A3F H;  2RCN A;  4JI4 Q;  1E3P A;  3GO5 A;  4A3B H;  4LNQ A;  3KF6 B;  1OTC A;  3UDI A;  1K0R A;  2N3S A;  4DV6 Q;  3HOW G;  1TWH H;  4DR7 L;  3U50 C;  3RLN A;  2KHI A;  2YTV A;  2CWP A;  5EAY A;  1YJ9 A;  4NPS A;  1VQF A;  4AH6 A;  2PI2 A;  3T1Y L;  4LUO A;  2ZM6 L;  2GN5 A;  2QEX A;  3T1H L;  2MFI A;  1HH2 P;  4DV3 L;  4DV7 Q;  1KD1 C;  1JB7 A;  1VQC A;  5IE8 A;  1OXX K;  1PV4 A;  1KQS A;  2WP8 J;  1YHB A;  1UE5 A;  1VQA A;  3D31 A;  3J81 c;  1VQJ A;  5BR8 Q;  1VQ6 A;  4DR7 Q;  1L1O A;  5C3E G;  3S2H H;  2FXQ A;  3K7A H;  2R7Z G;  1BKB A;  5HY6 A;  3GTJ H;  4A3E G;  3FP9 A;  4UP8 A;  1UE1 A;  1IBM L;  2KCM A;  2ZM6 Q;  2K5H A;  4IPC A;  4R4C A;  4NXN L;  4DV3 Q;  4HIK A;  3A74 A;  2VQF L;  4JI2 Q;  2NVY H;  1A63 A;  1VS0 A;  1NJI C;  4JI0 L;  3F2B A;  4UY8 C;  4A3B G;  1RIP A;  1G29 1;  1E24 A;  4YCV A;  3U58 A;  3PUZ A;  4ALP A;  1SFO H;  3J80 c;  3OW2 A;  4A4I A;  1PYB A;  2Q2T A;  4OX9 Q;  2WB1 E;  4YY3 L;  4X64 L;  3M4O H;  1I5F A;  1Y14 B;  1X55 A;  1IBM Q;  4C3J H;  2AKW B;  2UUC L;  4NXN Q;  2B29 A;  5FLX c;  3TRE A;  1XMQ L;  1PH6 A;  1Q8K A;  2WAQ E;  3TQY A;  3CQZ H;  4JI0 Q;  3PSI A;  1PH2 A;  4QL5 A;  4BBS G;  1QUQ B;  3CXC A;  4NXM L;  1XNQ L;  5H1S E;  4POG A;  2L15 A;  2R93 G;  4X64 Q;  4YY3 Q;  4X6A H;  3CCV A;  1N36 Q;  1E7Z A;  2E2H H;  1L1O C;  5M5W H;  4DV5 Q;  2A19 A;  2UUC Q;  1Q7Y C;  2LSS A;  4WJ4 A;  1XMQ Q;  1Q81 C;  1VQE A;  2K4K A;  1VQO A;  1K73 C;  1X54 A;  1TWC H;  5AJ3 L;  4B3S Q;  5IT9 c;  4DK6 C;  3F2D A;  3WWV A;  1SRO A;  3H0G H;  4A3G H;  3PUW A;  1GO3 E;  2K75 A;  4GN3 B;  2ALY B;  5M5Y H;  2IHE A;  4J15 A;  3UE0 A;  1YNX A;  1PFS A;  3I4O A;  5K36 G;  2MNA A;  1X65 A;  3BZC A;  3I7F A;  2I5M X;  3I4N H;  2RHS B;  3KYH C;  3CMA A;  2CWA A;  2CKZ B;  2K5V A;  4C3I H;  5FJ8 H;  2A8V A;  2PNH A;  4R4I A;  4B3M L;  1C0A A;  4P71 A;  1N9W A;  4GN4 B;  3DM3 A;  1N34 L;  5GAH C;  2WAQ G;  3JAM c;  3L0O A;  2DGY A;  4YWM A;  3A5Z B;  4QY7 A;  2JA9 A;  4EX5 A;  1A0I A;  3ULL A;  1YBY A;  1JE5 A;  3HOZ H;  5C0X G;  1JMC A;  1X3F A;  4BXX H;  3M4P A;  1K8G A;  1EIY B;  1WCM H;  1TWG H;  3GDE A;  5C0X I;  3A0J A;  5C4J H;  4Y52 H;  1L1O B;  2V1C C;  5M3F H;  3ICE A;  2BA1 A;  3ER0 A;  1MIU A;  3H0G G;  3MEF A;  4YWL A;  1C7Y A;  5GAE C;  3H15 A;  1VQP A;  1IBL Q;  2KCT A;  3TEH B;  1C9O A;  1KHI A;  3CD6 A;  5JJI A;  4DR1 L;  1XTD A;  3F2C A;  1K8A C;  4JC0 A;  3I4N G;  1IZ6 A;  1I6H H;  2PQA B;  1KXL A;  4JI6 L;  5M5X H;  2NVX H;  5FJ8 G;  4JCV E;  1PH1 A;  3DLL A;  1PH5 A;  3CAM A;  3CC7 A;  2OQK A;  2QGQ A;  3CCM A;  4JI7 L;  5IP7 G;  3I55 A;  1XJV A;  3S1Q H;  1PH8 A;  4OWX B;  4ME3 A;  2D0O A;  2ZTE A;  3AFP A;  3CCL A;  2DUD A;  4DR1 Q;  3J7A 5;  5LMN W;  1L0W A;  4TVA B;  1BVS A;  3K80 C;  4JI6 Q;  3JC6 6;  3PIO A;  2JEA I;  2HHH L;  2R92 H;  5C3E H;  1HNW L;  5GRO A;  2R7Z H;  3I4M G;  4DV4 L;  4DV6 L;  4A3E H;  3HOY H;  3HFZ B;  1B7Y B;  4JI7 Q;  3L7Z C;  3GTP H;  1YJW A;  4BY1 G;  5M3F G;  1CKN B;  1P16 A;  3RNU A;  1NE3 A;  1NTG A;  1E22 A;  2K50 A;  3HKZ E;  2VW9 A;  4B3T L;  2JA8 G;  2E2J H;  1E1T A;  4IOA A;  4Y7N H;  4GKK L;  2ZTC A;  3RR5 A;  4DV7 L;  4FDB A;  3M3Y H;  4DR6 L;  1YJN A;  2HHH Q;  4APV A;  1HNW Q;  4MZ9 A;  2YV5 A;  1YI2 A;  4DV4 Q;  4IFD G;  2VNU D;  4A3K H;  5BR8 L;  3I56 A;  2JK8 A;  1H95 A;  4JYA Q;  1BBW A;  3OYY A;  4LF9 L;  4JI3 Q;  4B3T Q;  3PO2 H;  3CW2 C;  1KAW A;  4GNX C;  4IFD I;  2B3G A;  1VCI A;  3J80 i;  4JBJ A;  2UU9 L;  2Z6K A;  3GTM H;  2RF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...