3KOJA

Crystal structure of the ssb domain of q5n255_synp6 protein from synechococcus sp. northeast structural genomics consortium target snr59a.
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
102
structure length
89
Chain Sequence
b'HHSHMNSCILQATVVEAPQLRYAQDNQTPVAEMVVQFPGAPARLKVVGWGAVAQELQDRCRLNDEVVLEGRLRINSEKQTELTVTRVHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein ycf41
publication title Crystal structure of the SSB domain of Q5N255_SYNP6 protein from Synechococcus sp.
rcsb
source organism Synechococcus elongatus pcc 6301
molecule tags Dna binding protein
total genus 14
structure length 89
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3kojA00
2AWNA 1Q7YC 2CQOA 1ASYA 2FXQA 4DR5L 1JJGA 3GTKH 1PH2A 1B8AA 1E1TA 2A19A 1U5KA 1OXVA 3MXNB 1O7IA 4R4OA 2ZTEA 2UUAQ 4GKJQ 2JA6H 1VQIA 1YIJA 4A3IH 2E5LQ 4JI5Q 3PO2G 3LGJA 1S72A 1WOCA 3CCJA 1V9PA 4JI0L 3H15A 1IBLL 4QGUA 1XTDA 1IXRA 2WAQG 4DR1Q 2RHQB 1XNRL 4DK6C 3ICEA 1VQJA 1HZBA 1G51A 2ZTCA 5M3FH 1EWIA 3NBHB 4A75A 4A3FH 2AMCB 3S17H 4DR6Q 1IBKQ 1SR3A 4DV6Q 2R6GA 5FLMG 1WCMH 2R93H 3MEFA 4JYAQ 2YV5A 1YITA 2RF4A 1WJJA 4GKKL 2VS1A 5IP7H 5IE8A 4JBMA 4A3MH 4LF5Q 1I3QH 1YZ6A 2ZJRA 1VQPA 4DV0L 3BU2A 4DV7Q 4A3JH 3CQZH 3U4VA 1HR0W 3E9IA 2JA5G 2NN6I 3FKIG 4LNQA 1M1KC 3M7NA 5BR8L 3S1RH 5JEAG 4DV4Q 4GNXB 2Q2TA 3CC4A 2VQFL 1PV4A 4OXPA 4JI4Q 3CCLA 1JE5A 4DR3Q 4OO1G 1KHIA 3ULPA 3HOWH 1AE3A 5GQOA 3HOUH 3H0GH 4LF8Q 4LF6Q 1NMFA 4NXNL 2VW9A 4GN4B 2JE6I 4A3DH 4HIOA 1VQKA 2NZOA 5C0XI 3STBD 4P73A 2QEXA 4LF7Q 4A4IA 1HNWQ 2WB1G 2UUBL 2JQOA 2KHJA 3K81C 3CMAA 4BY7H 3AQQA 1VQDA 1PYSB 2DUDA 4IPDA 3JC66 3NENA 4JI2Q 3WWVA 2GN5A 1HNXQ 4JI8Q 4OX9L 3RLOA 4HJ5A 4B3ML 3I7FA 2IHEA 3VDYA 1K8GA 1VQNA 3F2CA 2E2HH 2XTIA 1EIYB 1V43A 4LF9Q 1XNRQ 3HKSA 4IPGA 5DLQE 1VQOA 3U4ZA 3GTPH 3HOZG 2OTLA 3RR5A 3TREA 1EIFA 3ER0A 5C4JH 5IYBH 1Y1WG 4RG1A 1PFSA 1Q1EA 3KJOA 1N8RC 4JI6L 3J81i 4BBRG 3E0EA 3AFQA 2R7ZG 2ZM6Q 1GVPA 1JJ2A 2WFWA 3M3YH 2Q2UA 3RLNA 1G291 2CFMA 3S15H 1VCIA 4MZ9A 4WJ3M 4IFDG 3T1HL 4BY1G 1I50H 3G71A 4A3FG 2I0QA 5C3EG 2UUAL 1K73C 1PH7A 4GKJL 3F1ZA 1K83H 4X66Q 1OTCA 2E5LL 2XGTA 3TS0A 2K75A 4GLXA 1XMQQ 1SLJA 3BZKA 2VQEQ 5IP7G 3A0JA 1JMCA 4A3MG 1YVCA 3KDFB 4JCVE 2JA5H 1QZGA 1S40A 3RN2A 1TWGH 3S2DH 3STBC 3K7AH 4DKAC 3K80C 2ZTDA 4DR6L 1NMGA 2Q2IA 4P71A 1IBKL 3G4SA 1A62A 4YCVA 2UXBQ 1H95A 4JYAL 2ID0A 4C2MH 3GTJH 4PZ7A 3F2DA 2BH2A 3PCOB 3CD6A 2HIVA 2JA7H 3D31A 1ASZA 3HOYG 4LF5L 3S14H 4UP9A 4APVA 2IX0A 1PA6A 3HOUG 3H0GG 4P74A 3W1GA 2MO1A 4UP8A 4AIMA 3FHWA 2D0OA 4DV7L 1AH9A 3U50C 4IOAA 3J81j 1QUQA 4GS3A 3A5ZB 2B63G 1J5EQ 4LFBQ 4DV4L 1OXTA 1PH5A 1HZAA 1YEZA 4J15A 4HIDA 4JI4L 3A5UA 1XNQQ 4DR3L 1LUZA 3IRBA 2R92G 3S1QH 4TQUS 4OO1I 1XPUA 3PUWA 3RZDH 3HKZG 4LF8L 4YCUA 2BA0A 4LF6L 2DGYA 1VQCA 2RCNA 5C44G 5M5XH 3PF5A 3PUYA 1LTLA 3PUXA 4MNOA 3G6EA 3ERSX 3UDXA 1L1OA 2N3SA 3CW2C 4UY8C 4ALPA 4LF7L 3I4MG 3EBEA 4AYBE 5IWAQ 1HNWL 4EX5A 3J80c 4HJ8A 3T1HQ 3HOZH 1E1OA 4GN3B 3UDIA 2Y0SG 3CP0A 3F2BA 1Y1WH 3I2ZA 2KBNA 2LXJA 3Q8DA 3GTGH 1N33Q 4P72A 1V1QA 5E7NA 5IYBG 2LSSA 4JI2L 5ELNA 1HNXL 4JI8L 5IYDG 4BBRH 2GVBA 1B70B 4NXMQ 2R7ZH 3CCSA 2HT1A 2F3IA 4O2DA 1C9OA 4DV3Q 4LF9L 3TRZA 3T1YQ 1N32Q 4BY1H 1EOVA 4LFCQ 4MTNA 1X3FA 5C3EH 4A3LH 5JJIA 4HJ9A 1KD1C 4KHZA 3ULJA 3JAMi 1HNZQ 3E9HA 4HIMA 1XMOQ 4PMWA 3RLFA 1X6OA 3CCUA 1Q86C 1VQ7A 4B3TQ 1BBWA 1SE8A 4DAYB 1KRTA 4YWKA 3UE0A 2IHFA 2ZM6L 1XJVA 1Q82C 3CCRA 1YHQA 1MJEA 5IP9G 5C4XH 2K5VA 4IFDI 4A93H 1VQ8A 4EQ5A 3M4QA 2VZAA 4X66L 3G48A 4GOPA 4LF4Q 1LYLA 3J7A5 1PH4A 3L0OA 5AJ3Q 1L1OC 2VUMH 4A3KH 3HOYH 4HIKA 1BKBA 1XMQL 1TWCH 4DPGA 2VQEL 2JA7G 4DNIA 3S16H 2AWOA 3W1BA 3M85A 4JOIA 4X65Q 3CCVA 1S3OA 3KF6A 2K5HA 1Q12A 2B63H 3OYYA 1IBMQ 2Z6KA 1KC8C 3RZOH 3PF4A 4LW1A 3HOVH 2UXBL 2R92H 1EQRA 1Z9FA 2D0PA 2ZJQA 1OXUA 1X56A 2NVTH 2PQAB 2WAQE 1GM5A 4JBKA 2B29A 1K3RA 5C44H 2JEBI 4A76A 2IX1A 1FVIA 5J3BA 4B3RQ 1VS0A 2F52A 4LFBL 1J5EL 3I4MH 3CCQA 2B3GA 1D7QA 1XNQL 4L5TA 5M5YH 2Z0SA 4IJLA 1VQEA 2IT1A 2YTVA 4LUOA 1FJGQ 3CPWA 2MO0A 4DUZQ 1L0WA 2ALYB 1WYDA 3S1NH 2YTXA 2NZHA 1WFQA 1TXYA 5IYDH 1KRSA 5C0XJ 4GOPC 1KXLA 1EUJA 1HH2P 3J7ZC 1XPRA 1UE6A 2V1CC 5IWAL 3EN2A 3I55A 2PQAA 3PUVA 1TWAH 4L5RC 4JOIC 4TVAB 4LFAQ 2IY5B 1YNXA 3PO3G 4A3LG 4QQBX 4P75A 1PH9A 1OXSC 4IPCA 1N36Q 1QUQB 1N33L 1JT8A 3CCMA 2UU9Q 2Z6KC 1Q1BA 1W2BA 2JJQA 1LM0A 4O0AA 4NXML 4QJFA 1HZCA 4X62Q 2WB1E 5IP9H 1SMXA 4DV3L 1NE3A 4OWXB 3T1YL 3KFUA 1N32L 3GD7A 1JJCB 2E8GA 1W3SA 5C4XG 3PGZA 3CAMA 3K7UC 1YBYA 1VQGA 4R1JA 4LFCL 4A93G 1QVCA 4JI1Q 1SRUA 3AEVA 1HNZL 1L1OB 1XMOL 4JG2A 2VUMG 4X6AH 4A3BG 2JA8H 4B3TL 5JJKA 5HY6A 2E2JH 4DR2Q 4ME3A 4DR4Q 1Q81C 3OW2A 4JI3Q 4XIGS 3UDFA 4X64Q 4DV2Q 4JI7Q 4AQYQ 1IL2A 4LF4L 3HOVG 1VQHA 5AJ3L 4YHHQ 3KJPA 4DAMA 4OWTB 3RNUA 1Y1VH 3D0FA 4IOCA 2OTJA 1NBWA 1HZ9A 4X65L 2OCEA 4DV5Q 1BBUA 3F8TA 1PH3A 4WJ4A 4QY7A 1UE7A 2OQKA 1DGSA 1QVGA 2PMZE 1IBML 2CCZA 2UXDQ 3HOXH 1VQ5A 4HJAA 3H3VH 3PUZA 4LUVA 2ES2A 2F4VL 3PSIA 1SN8A 1VQAA 4BBSH 1YJ9A 5LMUQ 2KCTA 5M5WH 1HJPA 3ZJYC 2UUCQ 1FGUA 2I5LX 1R9TH 5GAHC 1N34Q 5FJ8H 2GVAA 1I94Q 4DUYQ 2VNUD 1CKNB 2K4KA 3M4PA 1HR0L 4UPAA 3ULLA 1M90C 1VQBA 4K0KQ 1A8VA 4B3RL 4GOPB 3FP9A 2AKWB 4H02A 1C0AA 2JEAI 5JEAJ 1VQ4A 4BXXG 4RMFA 1YHBA 3K0XA 4IJHA 2N78A 3H3VI 1KIXA 3PV0A 3L2PA 4Y7NH 1KL9A 1CKMA 2MFIA 3M4OH 3PO3H 3KF6B 1FJGL 3OTOQ 4A3GG 4DUZL 1EQQA 3I4NG 2A1AA 1TWFH 2RHSB 5LMNQ 4HJ7A 4YY3Q 1C7YA 4A3CG 4JV5L 1I6HH 1UEBA 1PH6A 1VQ9A 4OONA 2YYZA 1E22A 4JBWA 1T9HA 4LUZA 4Y52H 1OXXK 4L5SA 4JBJA 1CKNA 1K9MC 3JAMc 5M3MH 1CSQA 2D62A 4GN5A 4LFAL 4BA2I 4L5QA 3HKZE 5EAYA 3HFZB 4C3JH 1AE2A 3I56A 2Q2HA 2CWPA 1MIUA 5GAGC 1N36L 3S1MH 1SFOH 1NJIC 1VQMA 1D8LA 2UU9L 4A3BH 2LXKA 3AFPA 4IPHA 5GADC 3CF5A 1E3PA 1P8LA 2JA8G 1Y14B 2EIFA 1X65A 4X62L 1KQSA 4POFA 4B3SQ 2OQ0A 2OWOA 2Y0SE 4YWMA 4YWLA 3U58A 1X9NA 1P16A 4DV1Q 2I5MX 1JB7A 4JI1L 2F4VQ 1N9WA 1MJCA 4DR7Q 4KHPQ 2MQHA 1Y1VG 1X3EA 5HGQA 5ELOA 4DR2L 1HR0Q 3DM3A 1KAWA 1UWVA 1YJWA 3M9BA 4DR4L 2CWAA 3CXCA 4JI3L 4IFDJ 2YTYA 4X64L 4NPSA 1E24A 2MNAA 4DV2L 3HOXG 3CCEA 2NVYH 3A74A 4PG3A 2BA1A 4AQYL 2NVXH 4PZ8A 4JI7L 4BBSG 1RL2A 1GKHA 2JK8A 2VL6A 2L15A 3GDEA 4YHHL 2HHHQ 2VY3A 2UXCQ 1G6PA 2K5NA 1YHAA 2ZJPA 5FJ8G 3GTLH 4DV5L 1WI5A 4JV5Q 3BJUA 3RN5A 1IYJB 4DR5Q 4JC0A 3GTQH 1MKHA 4GLVB 5IYCG 4BXXH 1E7ZA 2N8NA 2HIXA 4R4QA 2ASBA 4QIWE 2UXDL 4LWCA 5GROA 4A3EG 1QZHA 5LMUL 3PIOA 4GNXA 3S24A 2UUCL 3KOJA 4OWWB 2CKZB 3J81c 4A3KG 1N34L 4JI0Q 4A3GH 4A3CH 3KLWA 4DUYL 1I94L 1IBLQ 3I4NH 1X3GA 3NEMA 3CC7A 1EYGA 3GO5A 2QA4A 3KF8B 2WP8J 3K8AA 1SROA 4K0KL 3TQYA 3TEHB 5JJLA 2PI2E 5H1SE 4R4CA 1VQLA 1QVFA 3L7ZC 1A0IA 3PO2H 4KLKA 1RIPA 2EQSA 1UE1A 1XPOA 2JA6G 2ATWA 3W5OA 4A3IG 1PH1A 1PH8A 2KHIA 4GKKQ 1A63A 3DLLA 1CSPA 5M3MG 1BVSA 3OTOL 4DV0Q 2N49A 5LMNL 1J6QA 3B6YA 4YY3L 2NN6G 4AH6A 1GO3E 5GAEC 2H5XA 1EFWA 5M3FG 1IZ6A 5BR8Q 4R4TA 1Z47A 4DK3C 5IY0A 5FLMH 3KYHC 4QL5A 1K8AC 2VQFQ 4AYBG 3GTMH 1WCMG 4C3IH 1FL0A 4JI5L 3S2HH 3UE1A 2R93G 3EIVA 4FDBA 4BA1I 1L2FA 3NELA 4PZ6A 4NB3A 4DR1L 1VQFA 4NXNQ 4XTCS 3FKIH 4A3JG 5C0XG 3CC2A 1Q8KA 3CMEA 2EXDA 2A8VA 3GTOH 5FLXc 4GNXC 2K14A 3PIPA 2C35B 2AHOB 4DV6L 1VQ6A 2K50A 2UUBQ 4B3SL 1YJNA 1NY4A 4POGA 2KCMA 1YI2A 1PYBA 4IO9A 4DV1L 3HOWG 2PNHA 4C3HH 5IT9c 1CUKA 4OX9Q 4YCWA 2YU9H 3CPFA 2R7DA 4B3MQ 4DR7L 4A3DG 4KHPL 2K52A 2KENA 1B7YB 1TWHH 3UDGA 1Q46A 2JA9A 4UP7A 2PI2A 1UE5A 2R7FA 3AYHB 3I4OA 1PVOA 5K36G 1X55A 1X54A 2HQLA 3KDFA 5IYCH 2E2IH 1CKOA 2I5HA 4BY7G 3BZCA 2QGQA 4R4IA 4A3EH 4KI0A 3J80i 3SGIA 2BH8A 2NVQH 1I5FA 4JI6Q 1U0LA 5LMNW 2HHHL 1K0RA 1NTGA 1PHJA 2UXCL 3TS2A 4GLAC 1GD7A
chains in the Genus database with same CATH superfamily
5EPKA 5G3LD 3M4YA 1ASYA 4DR5L 2HDLA 4U68A 1U5KA 1OXVA 1HRJA 4FVMA 1YIJA 4A3IH 2E5LQ 1S72A 2A68D 4JI0L 3H15A 1IBLL 2B39A 4QGUA 1XTDA 3J7AV 2NN6H 1SFOB 4DK6C 1HZBA 4A3BB 3NBHB 4A3FH 4A75A 1SNQA 4XYOA 4JYAQ 1YITA 1XXGA 5CV5A 4F7XA 3EQLC 4F8MA 4GKKL 4LF5Q 2B2YC 2L55A 5DM63 1SE4A 2NN6I 4O1NA 2NVTB 1BDOA 1HPCA 2K32A 1TY0A 2VQFL 4OEMB 4MHEA 2F0GA 1KHIA 2LFNA 3I4MB 1SAPA 4LF6Q 2B2TA 2Q8TA 4DK0A 2D5DA 5C4ZA 2QEXA 2SNMA 4A4IA 4KY7A 4X3TA 3S1NB 1HNWQ 2UUBL 2JQOA 3KK7A 4CBVA 5FLXE 4FP5D 3DEPA 1B1ZA 3WWVA 4JI2Q 4EGVA 4JI8Q 3KLRA 4A3GB 2XTIA 1XNRQ 3IFTA 2GA4B 1KNAA 2CH4A 3SK5A 2OTLA 5CMDA 1DOLA 1GUGA 1BXTA 4CDEC 1PFSA 1N8RC 4JI6L 2R61A 4C1NK 1EYCA 1G91A 2ZM6Q 2Q2UA 2VB2X 2ZXRA 1V1PA 4A3FG 2I0QA 2E2JB 3F1ZA 1K83H 3LX0A 2EY6A 3S2HB 2E5LL 4I7ZC 3TN2A 2K5DA 1GHJA 3BZKA 1XMQQ 2WINB 4DXFA 2A6HC 5FLXL 5JEAH 2RCFA 1B2TA 4P71A 1QNUA 1A62A 4KK7A 4YCVA 4KD3A 1NSNS 4JYAL 4OO1H 5EPLA 1LTRD 4K6DA 1PFMA 3HOYG 4LF5L 4UP9A 5IT9L 4P74A 3W1GA 5C3WA 4IOAA 3PMFA 3TZDA 1F9SA 1QUQA 4LFBQ 1OXTA 3ONAB 3SR1A 3IRBA 2R92G 3S1QH 4OO1I 2N88A 4A3EB 4LF6L 2Z8LA 1VQCA 4RWSC 3P20A 1NNXA 3PUYA 1PRTD 3UI2A 1HNWL 4ULLA 2F0EA 4HJ8A 3T1HQ 3NQIA 3F2BA 3CP0A 3I2ZA 1B3AA 1V1QA 4A3IB 5J39A 5ELNA 5EBCA 4JI2L 1HCZA 4JI8L 2GVBA 2R7ZH 5IGFA 2O5JC 3I4LA 4FYDA 2F3IA 2O4XA 1NR4A 4O2DA 1STNA 2VB3X 3T1YQ 4IFDH 2F0HA 4BY1H 1GUNA 2I46A 3SDZA 4FF1A 4LFCQ 4MTNA 5C3EH 5JJIA 3ULJA 4AYBB 2EYFA 1X6OA 3CCUA 3V05A 1SE8A 2A74C 4RFBA 2ZM6L 4Z9CB 4KJNA 2TMPA 5IP9G 5C4XH 1R4PB 4IFDI 4A93H 3QOJA 2VZAA 5BN5A 4GOPA 1PTOC 4LF4Q 1A15A 5AJ3Q 1L1OC 2IWHA 2VUMH 1ILPA 3MEHA 1BKBA 1XMQL 2TSSA 2PQEA 3MXPA 4DNIA 3S16H 2AWOA 3W1BA 3M85A 4DFAA 3MVVA 2K5HA 4R8NA 3D4DA 2LMCB 3OIQA 1DZ1A 3N6RA 2MJ8A 1YNNC 3HOVH 1EQRA 1GUWA 2CQAA 1Z9FA 2D0PA 1OXUA 4OIJA 2PQAB 1GM5A 2B29A 1K3RA 3VA5A 2DN8A 1W6JA 3GV6A 4LFBL 3QG1A 2B3GA 1EU3A 2N55A 2EDGA 3QB3A 1U9RA 2Z0SA 1DYQA 1W6KA 4DUZQ 2ALYB 1WYDA 3PO2B 1TXYA 1I6VC 1EUJA 2WAQB 2KVMA 3Q22A 1HQRD 2DJFC 3PUVA 4DAPA 4DU9A 1K0SA 3OMGA 2BE5D 1C4QA 3NWSA 3PO3G 1S5BD 5CBEE 4IPCA 3R8BA 1QUQB 2Z6KC 2OT2A 1LABA 2F0QA 4O0AA 3DEOA 4QJFA 5KYIA 1NE3A 3T1YL 3PQIA 1ET6A 2CW0D 2Z4IA 1WTQA 5C4XG 3CAMA 4LFCL 2E2DC 3HS0C 4A93G 4RHSA 4PV1C 5EGTA 1FYCA 5A2QE 2X6GA 1WTXA 1G2SA 3NK9A 2VUMG 3V2TA 1WD0A 5HY6A 4ME3A 3I91A 3OW2A 4JI3Q 3IL8A 4XIGS 3D8GA 1TWHB 4K14A 1LTBD 2WB1B 4LF4L 1Q8IA 3HOVG 1GJXA 5AJ3L 4YHHQ 2M2LA 2E2IB 4OWTB 4RGTA 3S1QB 4DV5Q 2RVLA 2UXDQ 3HOXH 3SVMA 1ZKOA 1EEFD 2PNRC 5EJWA 3H3VH 5M5WH 5JVG3 3D4RA 4TSSA 1FGUA 2I5LX 2UUCQ 1STGA 5GAHC 5JOBA 2GVAA 2VNUD 1CKNB 3M4PA 2G9HD 2JA6B 4KN4C 1A8VA 3K0YA 4KN7C 4GOPB 2F0UA 3FP9A 4BXXG 5A2QL 4IJHA 3K0XA 3H3VI 4BY1B 4Y7NH 1KABA 3QR8A 3WDNA 2Z9HA 5C3EB 3BZDB 1HA5A 4DUZL 1QJOA 2RHSB 5LMNQ 1C7YA 4JV5L 1UEBA 5CYUA 1VQ9A 1G8ZD 2RDHA 4A3MB 1I3QB 3VR3A 4I65A 4L5SA 5FO8B 4JBJA 1E2ZA 3JAMc 3VR2A 1CSQA 2D62A 5M3MH 1RJTA 3HKZE 2XRQD 5EAYA 4JW0A 4C3JH 3I56A 5GAGC 3S1MH 3WOFA 5GADC 4S3SA 1P8LA 4ZCKA 3EROA 3H0GB 1Y14B 1KQSA 2F0DA 2OQ0A 1AEXA 2AQ1B 2Y0SE 1OO9B 1DM0B 1PZID 4DV1Q 2F4VQ 3ITPA 1K8MA 1A6XA 1UWVA 1U4PA 1ENAA 3M9BA 2PYKA 3CXCA 4JI3L 3A54A 4NPSA 1E24A 3H09A 2F0TA 3HOXG 3CCEA 4PG3A 4KTAA 4RCOA 4YHHL 2L15A 4V0BA 1EY7A 3GTPB 1YHAA 4DV5L 2WKDA 1M8AA 1D1KA 1KAAA 3GTQH 1JR0D 1MKHA 2EY5A 2K7VA 2N8NA 5LL6S 2HIXA 2UXDL 3DM1A 4QIWE 1ZYRD 4LWCA 1PMRA 2F03A 3PIOA 3S15B 2UUCL 3HEJA 3KOJA 4OWWB 2CKZB 3J81c 4A3KG 3KLWA 3X3MA 4WFN3 3GO5A 1XTCD 3J80E 1IYUA 1SROA 4DF7A 5IGDA 3TQYA 4XDXA 5JJLA 3HGBA 3L7ZC 1V8QA 2L0CA 3D6WA 2JA5B 1XPOA 2EQSA 1B50A 2ATWA 1PH1A 3K7AB 5M3MG 3LWUA 1TKWB 3KUPA 2N49A 5LMNL 1J6QA 5KNBA 2Q8IB 3B6YA 4C3JG 4DV0Q 3K5NA 3IAYA 1GO3E 1PTOF 1JWUD 2K03A 3MA2B 1BNZA 2V4DA 1IZ6A 2JA7B 3D6CA 4DK3C 5IGBA 4HR7B 2EPBA 3GTMH 2R93G 4C3IH 1FL0A 4ZAIA 1EZ8A 4BA1I 1L2FA 5DM73 4PZ6A 3G6JB 4NB3A 4CDCC 5EKLA 4NXNQ 4XTCS 3FKIH 4A3JG 2B8FA 3CMEA 3RZDB 4IURA 2AHOB 3SK8A 5D65A 2A6ED 4POGA 1M4VA 4CJ0B 1CHQD 4DV1L 3HOWG 3J80L 2NUCA 4C3HH 2YU9H 4A3DG 3UDGA 1Q46A 3KLSA 3DWPA 3I4OA 3AYHB 1X55A 1X54A 3RMHA 3KDFA 5KNCA 4F88A 1CKOA 3BVMA 4H0LC 1Y69U 2QGQA 2NVQH 1F2LA 3H6MA 5LMNW 1LTSD 4GLAC 4X3KA 2CVRA 3OPOA 1JJGA 1PH2A 2A19A 4R4OA 3MXNB 1O7IA 4GKJQ 2PCFB 3JAML 1VQIA 4JI5Q 1PFNA 2QKIC 3E0JA 2QF7A 3ICEA 3J81E 5M3FH 1G51A 3BVZA 1EWIA 4DR6Q 3S17H 1IBKQ 3ERQA 1WCMH 4XT3B 5JPNC 1WJJA 5J1ZA 4C3IG 1U4LA 2MGSA 5IE8A 4RKLA 3ND9A 1MD2D 4DV0L 3BU2A 3HRZC 3CQZH 3U4VA 3E9IA 1EY9A 3FKIG 2ZXPA 3M7NA 3N52A 5I6YA 3CC4A 1F77A 2K04A 4JI4Q 3TMEA 3P1HA 3ULPA 1AE3A 4LF8Q 3T4AC 1SXTA 4NXNL 5M5YB 1CQVA 4HIOA 1ZXTA 3DWQA 1G6ZA 2A6HD 4P73A 3FPUB 2Z4HA 4LF7Q 1II3A 3GTQB 4BY7H 3AQQA 1WTPA 4KHVA 1PYSB 2DUDA 1ET9A 1I4PA 3JC66 3J81L 4QMGA 3RLOA 5EQ0A 3F2CA 2E2HH 1V43A 3VYTA 5DLQE 4IPGA 4CJ2C 1I4QA 3TREA 1EIFA 4DK1A 1Y1WG 5KIXA 4EQOA 4DXGA 5D3DA 1BF4A 5CV7A 2RQXA 4BBRG 4QIWB 2O5IC 2K28A 1HXYD 3VR5A 4IUQA 2B2TC 3S9WA 2JA8B 1EIGA 3NHHA 1K73C 4GKJL 3FDTA 3TS0A 2AUKA 1TVXA 3R2TA 1FNWA 3A0JA 1JMCA 1YVCA 3KDFB 4JCVE 1QZGA 3RN2A 3STBC 2UXCL 2ZT9C 4DKAC 3K80C 2ZTDA 5COYA 2QEJC 1NMGA 5C6AA 4DR6L 1IBKL 3F2DA 4C2MH 3GTJH 4PZ7A 2FMCA 1GHKA 3CD6A 2HIVA 1EOTA 1RDPD 2EZVA 1ASZA 2LKVA 1H9RA 4BBSB 1SE3A 4UP8A 1BUVT 4WRDA 3C1FA 4GS3A 2B63G 1J5EQ 5CV6A 4HIDA 4JI4L 1GUOA 3A5UA 3A8IE 3AU7A 1NAPA 1PTOD 2NYZD 4TQUS 4LF8L 1S5ED 4YCUA 2DGYA 2RCNA 5C44G 2F0MA 5M5XH 3G6EA 2N3SA 3CW2C 4UY8C 4ALPA 4LF7L 3I4MG 4AYBE 4EX5A 3MZ5A 1YNND 1E1OA 3V96A 5I4DA 2QILA 2LXJA 3I8ZA 4HN7A 5E7NA 1N33Q 5IYDG 1YNJC 2AQ2B 1B70B 3CCSA 2HT1A 4WORA 1C9OA 1HTLD 3FVQA 2Q8RE 1SNMA 5M3FB 2G9DA 1X3FA 1WCMB 3BDLA 3I90A 1XMOQ 2FMMA 4PMWA 5C5MA 3QIAA 2L9HA 1BBWA 4B3TQ 3BYYB 4YWKA 3UE0A 1Q82C 2B2UA 4FO2A 4LMQD 1YHQA 3CQZB 1VQ8A 3NWTA 3K5LA 2EYJA 5FO7B 3J7A5 3L0OA 5EKIA 1AN8A 3R3OA 4ID6A 1JOKA 3HOYH 1TWCH 2DNEA 4JOIA 1MSHA 3MXGA 1IBMQ 3RZOH 1PZJD 3NTKA 3GTLB 2RKSA 4LW1A 2R92H 2MPMA 4BY7B 2F0PA 1STHA 2XNAC 2WAQE 4JBKA 2JEBI 4A76A 2A5HA 2KJXA 2SDFA 4B3RQ 4RAUC 1A2TA 1VS0A 2F52A 4N8FA 1J5EL 5IT9E 1D7QA 3Q24A 4IJLA 1FJGQ 3CPWA 2MO0A 3QOLA 2YTXA 1F2ZA 1TQOA 4KJOA 1KRSA 5C0XJ 2NTSA 3IFDA 4GOPC 3CU7A 3J7ZC 1XPRA 2V1CC 3EN2A 2JXMB 1IL8A 1SJHD 2PQAA 1TWAH 3VR4A 2IW3A 2IY5B 4P75A 1PH9A 1N33L 2K5WA 1JT8A 1Q1BA 1JORA 1DCZA 2L5TA 5T1GA 1KLGD 2B8GA 1HZCA 2OEOA 3H94A 2WB1E 5IP9H 1MHWC 3ZYYX 3GD7A 2E8GA 4R1JA 3K7UC 1YBYA 1LO5D 1AZQA 2BDNA 4C2MB 1XMOL 4NKLA 4JG2A 3C46A 4B3TL 1ESFA 3O13A 2PO4A 4YIJA 3LNNA 1Q81C 2CH4W 3A8JE 5K5PA 3MFGA 4JI7Q 1SEBD 4KKTA 4L63B 1IL2A 1VQHA 1X3QA 4DAMA 4K6LA 1Y1VH 2OTJA 1HZ9A 1KDCA 3F8TA 1B9NA 4WJ4A 3EA6A 1DGSA 1IBML 1SYGA 2ES2A 1STAA 3NUCA 2A69C 1R9TH 3E6ZX 1N34Q 5FJ8H 2F0NA 2O2LD 5BN4A 4DUYQ 2K4KA 1HR0L 3ULLA 3F2UA 1TY2A 4B3RL 1D5ZC 2AKWB 1C0AA 2JEAI 1VQ4A 4ILWA 4RMFA 5DEHA 4DAVA 1KIXA 3PV0A 3L2PA 4CDDC 1CKMA 4A3FB 3M4OH 3PO3H 1FJGL 1SYEA 3TP8A 1EQQA 3I4NG 1TWFH 1I6HH 4YY3Q 3PIP3 1O7LA 2YYZA 1E22A 4H44C 4Y52H 1K9MC 1CKNA 4XXEA 3TP7A 3I3CA 4KKSA 3GP7A 1UNSA 4L5QA 1AE2A 2Q2HA 4LAAA 2XN9C 1NJIC 3AFPA 4IPHA 2IL8A 3CF5A 1TWCB 1CTMA 4POFA 3NTIA 4YWLA 1P16A 3RZOB 2I5MX 4XQNA 5T1IA 3A56A 2R92B 2P5ZX 4DR7Q 1Y1VG 5ELOA 1SYFA 3BS1A 5IGCA 5I6WA 2J4XA 5IIFA 1KLUD 2X69A 1ICWA 4HTHA 4RKBA 4JI7L 2NVYH 3NPPA 2NVXH 3T53B 4PZ8A 4R8IA 1RL2A 3GDEA 5C5LA 2EYHA 2PZUA 5FJ8G 1WI5A 4JV5Q 1IYJB 4JC0A 1PDQA 4G7OC 4BXXH 1E7ZA 4R4QA 5L37A 4CDFC 3A55A 1N34L 3DXJC 4PMBA 4DUYL 3OW7A 1X3GA 1K83B 1QE6A 2WP8J 1LACA 4L6TB 3QWNA 1STEA 4TKOB 1K8OA 2EY2A 1UE1A 2JA6G 3T13A 2KHIA 2KOLA 1XX8A 4YY3L 3BG3A 2H5XA 3MAQA 1EFWA 5BR8Q 4KV6A 1K8AC 5IY0A 4QL5A 1H9JA 1R4QB 1O78A 3PIO3 2F0KA 4DR1L 5C0XG 2A73B 1MI2A 1DONA 2H4OA 4JPBW 3GTOH 1RODA 3PIPA 1G2TA 4DV6L 3SEBA 1VQ6A 1PTOH 1YJNA 1L0YB 3K6OA 1YI2A 3MTSA 2B2VA 1S5CD 4IO9A 2PNHA 1I4HA 1UEAB 4ZKCB 4DR7L 2K52A 1B7YB 2ICEC 2JA9A 1RF2D 5FK9C 4QUFA 1TS5A 2I5HA 1H9KA 2R7ZB 3J7YW 3BZCA 4OHJA 3J80i 1I5FA 1U0LA 4A3KH 1NTGA 3Q23A 3PO3B 3M4OB 1GD7A 5E1FA 1TWFB 2CQOA 2OXPA 2FXQA 5E4XA 3GTKH 1B8AA 1BO0A 2UUAQ 2ENBA 2HCIA 5C4XB 1WOCA 3MC0B 1EZ6A 3BDCA 1V9PA 4A93B 1C48A 2RHQB 5I9PA 1EL0A 2VUMB 1VQJA 2ZTCA 5KGUA 2AMCB 1EY0A 1SR3A 3S16B 2R93H 3K57A 3MEFA 2YV5A 2RF4A 1X3PA 5IP7H 1TR5A 4JBMA 1YZ6A 2ZJRA 1VQPA 3HOVB 4A3JH 1JOOA 1GXDC 3MXNA 2JA5G 4LNQA 1RCVD 5BR8L 1S5FD 4DV4Q 1QOHA 1PV4A 4OXPA 3CCLA 1JE5A 4DR3Q 5FKAC 5CBAE 4DA2A 3HOWH 3HOUH 4X3SA 2VW9A 4GN4B 5AFWA 4IALA 4A3DH 3HP3A 5EBDA 3STBD 1GOZA 4Q0FA 2KHJA 3K81C 1VMCA 1C8CA 1SNPA 1F9PA 3NENA 2GN5A 1HNXQ 3J7AF 4KD4A 4N8X1 1DXMA 3EJIA 2IHEA 1H9MA 3VDYA 2R3ZA 4LF9Q 1B9MA 1VQOA 1E2VA 2KEEA 3R93A 3HOZG 4OGQC 5C4JH 3ER0A 5IYBH 1O7ZA 4RG1A 2K05A 2F0IA 1Q1EA 3NQTA 3J81i 5D14A 3E0EA 3AFQA 4ME5A 1GVPA 1JJ2A 3M3YH 3RLNA 1G291 2HQEA 1ML0D 1Y8OB 1I50H 3G71A 2UUAL 1OTCA 2XGTA 1SDFA 3P75A 5IP7G 1YNJD 5C4HA 2BOSA 3JAME 1S40A 1QWYA 1TWGH 3S2DH 2F0VA 1PYWD 4XYQA 2NB0A 3G4SA 1BCPB 1H95A 1JQYD 2BH2A 3C3LA 1IYVA 3S14H 3K59A 3HOXB 4KKUA 4APVA 2IX0A 1PA6A 3HOUG 3FHWA 2D0OA 5M5WB 3U50C 2QCPX 3J81j 4DV4L 1PH5A 4DR3L 1LUZA 4I7AA 1Z6HA 2FFKB 3HKZG 2BA0A 4OELB 5J22A 1S4ZA 3PF5A 4Y7NB 1LTLA 3C1EA 1I4RA 1DOMA 4B9WA 5KEEA 5IWAQ 3D4WA 3VYSA 1Y8PB 1STBA 4GN3B 3UDIA 2Y0SG 1Y1WH 2KBNA 3Q8DA 1QB5D 3GTGH 4P72A 5IYBG 2LSSA 1HQMC 3CRKC 1HNXL 4BBRH 5M3MB 1TS2A 4C3JB 4LF9L 3S1MB 2BCOA 1Q3LA 3OMCA 1EOVA 4A3LH 3L3OC 2WACA 4KHZA 2R93B 1HNZQ 4HIMA 1VMPA 3RLFA 1Q86C 1VQ7A 1TS4A 3CCRA 2K33A 5JPMC 1MJEA 2K5VA 1B3QA 1A3UA 3M4QA 5JAVA 3G48A 4G4KA 1LYLA 3U9SA 1WVLA 1A3VA 5D3IB 4HIKA 5A35A 4DPGA 1SMYC 4X65Q 4RHRA 4A3DB 2B63H 3OYYA 3NBIA 1KC8C 3PF4A 2DNCA 3BVGA 2ZJQA 4UHVA 1HUNA 1FR3A 2DY7A 3QO2A 2NVTH 4IZ8A 5C44H 2NZ1D 1SNDA 1FVIA 3I4MH 3CCQA 2RA4A 3AMUA 4QCLA 4EQPA 5IODA 1VQEA 2IT1A 4LUOA 2B2UC 3S1NH 3HZXA 1SJED 2QDBA 5IYDH 5ISRA 3CHBD 1HH2P 1T5EA 1UE6A 5IWAL 1IKLA 3K5OA 1LTTD 4L5RC 4JOIC 4TVAB 2A69D 4LFAQ 4A3LG 3L9AX 2BDOA 4QQBX 2OF1A 2KCCA 1N36Q 3GTMB 4K2LA 4DN4M 4C3IB 3CCMA 1CA6A 2JJQA 4FF2A 1LM0A 3I70A 2I07B 3TDQA 4OWXB 1UAPA 2EY1A 3FKIB 1TWGB 5E3FA 5DAUA 3PGZA 1QVCA 4JI1Q 4HCSA 1EYDA 1EY5A 1SRUA 3AEVA 1HNZL 1H9SB 1NCVA 2JSOA 4A3BG 5KNDA 1IHZA 3K58A 2E2JH 4DR2Q 4C3HB 2E75C 3M7GA 1EIHA 1PRTB 5M9OA 4K5XA 2LS01 4MN3A 2YU9B 1LV9A 2EJGC 3UDFA 4X64Q 2DY8A 4DV2Q 4HEDA 3GV3A 4IOCA 1NBWA 4X65L 4HMIA 1BBUA 5LHY1 2NVQB 4QY7A 3P7JA 1UE7A 4ZKBB 3RUZA 1QVGA 2CCZA 1VQ5A 1VQAA 2WKCA 4LK1C 4IUVA 5LMUQ 1YJ9A 2XWBB 1VDZA 1GUTA 2HUGA 1JWSD 3WOEA 1Y1WB 3GTGB 1LTID 4UPAA 4CKCA 1VQBA 1DOKA 2X6LA 2MP1A 1STYA 2ZXOA 4BBRB 3K5MA 5JEAJ 1EQVA 1YHBA 3NTHA 1T5XD 2N78A 2WIIB 1KL9A 2MFIA 3S17B 5E4WC 3OTOQ 4A3GG 4A3CG 1ENCA 4OONA 4JBWA 1FGBD 1EQTA 1PZKD 1OXXK 1MGSA 3MWYW 4HAEA 4LFAL 4BA2I 4HSPA 3AB9A 1D2BA 1N36L 1MIUA 1VQMA 1AW7A 1D8LA 4K5VA 4XQQA 2LXKA 3OSOA 2K1BA 1E3PA 3NP8A 2A6EC 2OWOA 1SYDA 2B63B 1X32A 4YWMA 1F9QA 4CGYB 4E6IA 1ZEQX 4JI1L 4KHPQ 4V190 1CK1A 4DR2L 1HR0Q 3DM3A 5C44B 1KAWA 1YJWA 1TIID 2K6AA 4IFDJ 2YTYA 5CC4A 4X64L 1J8IA 4R9WA 4C1NI 5I2YA 2E2HB 1RTOA 4DV2L 2K5QA 3A74A 2BA1A 1IW7C 4IUNA 2VY3A 1LT6D 2ZJPA 3Q0AA 5IGGA 1VF7A 1ICFB 1QILA 4GLVB 5IYCG 2ASBA 2NWGA 5GROA 4MIUA 4A3EG 5LMUL 2VXWA 4GNXA 4JVZA 4ZLTF 3I4NH 3NEMA 2QA4A 3KF8B 4RGNA 2JYOA 5ELDA 1E2WA 2FHTA 2PI2E 4IN3A 5H1SE 1VQLA 4CKEA 4U673 3QJYA 3PO2H 4KLKA 1AP0A 2D9UA 3W5OA 4A3IG 2EJMA 3T16A 1PH8A 3SK4A 2F0SA 4HMJA 4LJZC 1BVSA 3OTOL 3KBXA 2NN6G 3GTJB 1Z47A 5FLMH 5ELBA 4Q5VA 1MSGA 4AYBG 4FDBA 3EIVA 5EPJA 3NELA 1VQFA 3GQBA 2E74C 1Q8KA 3RD4A 4CJ1B 5HGTA 1RTNA 5CV4A 3DHQA 2HCCA 4G7HC 5M5XB 1NY4A 4GZYC 2KCMA 1FNUA 3LWEA 5CGKA 3MHBA 1CZGA 1CUKA 1NR2A 4OX9Q 2PPBC 4MTKA 1KDAA 4B3MQ 4KHPL 4L8JA 1TWHH 4UP7A 2PI2A 2F0FA 3IKJA 1CQFA 4PQXA 3A7LA 2B2YA 1PVOA 2E2IH 1TT2A 3E5SA 3TP6A 4G7ZC 4NP5A 2HD3A 4R4IA 2AQ3B 2BH8A 3SGIA 4RH6A 5NUCA 5JVH3 1PHJA 1BR9A 2IX1A 2Q2TA 2AWNA 3TS2A 2RBMA 1Q7YC 5BN3A 2E76C 1E1TA 3VA7A 3MXUA 2ZTEA 2JA6H 5FOBB 3PO2G 3LGJA 2EVBA 3CCJA 1EYAA 4ZRZA 3X3NA 4UDUC 1IXRA 2WAQG 4DR1Q 1XNRL 1O80A 2B2VC 3HOYB 2NTTA 4DV6Q 1WTHA 2R6GA 5FLMG 1D5MC 1HFGA 2C9OA 2Z1CA 2F3VA 4FF4A 4KY6A 2VS1A 1JE4A 1EWCA 4A3MH 1I3QH 4JK1C 1EWHA 5DNFA 3BDOA 4DV7Q 5C0XH 1HR0W 1M1KC 3S1RH 5JEAG 4GNXB 3U9OA 1BCPC 3H91A 5I9OA 2QDLA 4B08A 1SBBB 5F2DA 4OO1G 4XT1B 5GQOA 3H0GH 3H3VC 1WTOA 1NMFA 2XVSA 2F0LA 2JE6I 1RHPA 1VQKA 2NZOA 5C0XI 4XQJA 2PZTA 2WB1G 4DAYA 3DUZA 5I2XA 3CMAA 1PLFA 1VQDA 4TRDA 4IPDA 2D2CC 2C5CA 1WTVA 1V1PB 2A68C 3D3RA 4OX9L 1TWAB 4HJ5A 4FXKC 4B3ML 1DD2A 4O42A 3I7FA 1K8GA 1VQNA 3I4NB 1EIYB 3HKSA 4G57A 1K3BC 1MBYA 3U4ZA 3HG9A 3GTPH 3RR5A 5JJZA 1JWMD 1HUMA 3KJOA 2J0TD 4K2KA 1BQQT 1HHVA 4IUTA 2R7ZG 2WV6D 2WFWA 1LTGD 4QB4A 2L4NA 2CFMA 3S15H 1VCIA 3KBGA 4MZ9A 4IFDG 3T1HL 4WJ3M 4BY1G 2SNSA 1SNOA 1B44D 5C3EG 1PH7A 4X66Q 1JICA 2DJGC 1JOQA 2K75A 4K8JA 4GLXA 1SLJA 2RSOA 2VQEQ 4A3MG 2JA5H 4FNFA 3K7AH 4K5WA 2EYOA 1Y1VB 2Q2IA 1HTPA 3VYUA 2SOBA 2UXBQ 2ID0A 3PCOB 2J7ZA 1A3TA 2JA7H 3D31A 2JP1A 5ELFA 4NMZA 3H0GG 1AH9A 2MO1A 4AIMA 4DV7L 4KY5A 1R9TB 3A5ZB 1HZAA 1YEZA 4ZYSA 4J15A 1PFBA 4N9TA 3C2PA 1XNQQ 2L1BA 3OHXC 3TP5A 1XPUA 3PUWA 3RZDH 4H7BA 4ODGA 2EOTA 4RA8A 4J1MA 1SMYD 2M9VA 1BBXC 3G7LA 3PUXA 4MNOA 3ERSX 4IUUA 1L1OA 3UDXA 2NBFA 4P2CB 3EBEA 1I6HB 1ENFA 1PXUA 3ND8A 3J80c 1EFID 1D5XC 1CT1D 3HOZH 1JCKB 1E0BA 1I4XA 2KCNA 4WJWA 1CZWA 2MUYA 4ABNA 4F87A 3TZUA 4NXMQ 4HSVA 4DV3Q 1EY4A 1N32Q 2AUJD 2MHVA 4K8IA 4M8AA 4HJ9A 2QW7A 3CRLC 1KD1C 3I73A 3JAMi 3I72A 1FNVA 3E9HA 4QUCA 3NSWA 4DAYB 1KRTA 1XJVA 2IHFA 2RDGA 4ZUJA 1B53A 5IGEA 2B2WC 3S1RB 4EQ5A 2EYMA 3DMUA 4X66L 3FMCA 1PH4A 4NW2A 1WTRA 2RDFA 5ELEA 2VQEL 1XYIA 3OWFA 2JA7G 3CCVA 2L11A 2NVYB 2NVXB 1S3OA 3KF6A 1PRTC 1Q12A 2RSNA 1RKNA 2Z6KA 2K01A 5IOCA 2UXBL 2F4IA 1X56A 1EU4A 3E3XA 4OL7A 5J3BA 4J8QA 1RD9D 1IKMA 3OOCA 1SYCA 1SE2A 4C56C 3NXWA 4L5TA 5M5YH 1XNQL 4FXGC 2YTVA 3URYA 1WTWA 1JB3A 1L0WA 2F3WA 1LTAD 2EJFC 1WFQA 2NZHA 4FF3A 2EE1A 5KRUA 1KXLA 1Z7TA 1TU2B 2M00A 1AFPA 3I55A 4NDXA 1ONLA 4QF4A 1YNXA 4BS9A 4CHTB 1OXSC 2UU9Q 1W2BA 4NXML 1LLRD 4X62Q 3FPPA 4DV3L 1SMXA 3KFUA 1ESRA 1N32L 1J9OA 1JJCB 1W3SA 3FRPB 1B4OA 1VQGA 2XSCA 3GTOB 2H1EA 1PTOB 1BCPF 2XRSD 4ZK9B 1L1OB 1QG7A 4X6AH 1QNKA 4DNTB 2JA8H 5JJKA 1LT3D 2IPKD 4DR4Q 2F0OA 5G3LF 3EVQA 5KYLA 5C3XA 3T56B 4AQYQ 4OIKA 3KJPA 1EY6A 3RNUA 3D0FA 2EXZA 2B2WA 4X3UA 4J6HA 2OCEA 3SHLA 2KEDA 2F0WA 1BOSA 2EYLA 1PH3A 2XIWA 1SNCA 3DWAA 4A3KB 2OQKA 1H9SA 1D6EC 2PMZE 5TSSA 4HJAA 2EYPA 2F0JA 3PUZA 4IQZA 3PSIA 1SN8A 4LUVA 2F4VL 2BE5C 4BBSH 2KCTA 1HJPA 3ZJYC 3HOZB 4M1UB 3GTKB 1EY8A 1I4GA 4PNYA 1I94Q 1M90C 1HA6A 3CKIB 4K0KQ 4PMCA 3EFXD 3T51B 1FD7D 4H02A 1F2YA 2CW0C 3A7AB 1IW7D 2XWJB 3KF6B 4UAIA 2A1AA 4HJ7A 1EEID 3OWEB 1ILQA 3VYRA 1PH6A 1T9HA 4LUZA 1U4RA 4A3JB 2KQ3A 1V1OA 1KTKA 2FJ2A 2G5DA 4GN5A 2FINB 1QCBD 3HFZB 2CWPA 1K28A 2KECA 3NE5B 3W2DA 1XWEA 3KLSX 1SFOH 2UU9L 4A3BH 2PW7A 3HOWB 4H13C 5HURA 2JA8G 2EIFA 3HOUB 1X65A 4X62L 1O7YA 4B3SQ 4DGZA 3MFYA 3U58A 1X9NA 3SK6A 1JB7A 1LT4D 4ZUIA 1VF5C 1N9WA 1CHPD 1KDBA 1MJCA 3HKZB 2MQHA 1X3EA 5HGQA 5FO9B 1AZPA 4DR4L 2CWAA 2KHSA 1SYBA 3BYTB 2MNAA 3NBHA 4AQYL 4BBSG 4C3HG 1GKHA 2JK8A 2VL6A 4N9PA 2Y0SB 2HHHQ 1JC7A 2UXCQ 2K5NA 1G6PA 5CV8A 5C4JB 4CKBA 1L0XB 3GTLH 5K36H 4HCEA 1CA5A 2IJ0A 3BJUA 3RN5A 1CM9A 4DNRB 4DR5Q 2L12A 3SXHA 3M3YB 4BWGB 1QZHA 2CHBD 3S24A 1S5DD 1I50B 4JI0Q 4A3GH 4A3CH 1I94L 1IBLQ 2PW5A 3CC7A 1EYGA 4FXDA 4EVOA 3K8AA 4K0KL 3R2IA 2HDMA 3TEHB 2JN4A 4R4CA 1QVFA 1A0IA 1CFMA 1RIPA 1SSOA 2KUMA 3S2DB 4RCNA 1A63A 4GKKQ 3DLLA 1CSPA 3OIPA 2KA7A 5CORA 1CI3M 5LL6X 4B9XA 3W3AA 1U4MA 5CR3A 4AH6A 5GAEC 5M3FG 3S14B 2PZWA 4R4TA 2F1MA 3KYHC 2VQFQ 4ZQ3A 2IX3A 1WCMG 3S2HH 4JI5L 3UE1A 1PRTF 1UUPA 3KF8A 3FEWX 4IUPA 5ELCA 3SE0A 1LT5D 4EQNA 3CC2A 1DJRD 2EXDA 2A8VA 1HFNA 5FLXc 4GNXC 2K14A 2C35B 3A8KE 2K50A 2UUBQ 4B3SL 3VR6A 2LY7A 1ZYRC 1PYBA 1F2MA 3TSSA 3Q6SA 5CV9A 3TBIB 5IT9c 4YCWA 3CPFA 2ICIA 1Q90A 2R7DA 1F9RA 2KENA 2SEBD 1WD1A 1TS3A 4RGMA 1GUSA 1UE5A 2R7FA 2Z6BA 1Y8NB 5K36G 1BCPD 2HQLA 5IYCH 1KNEA 4RGOS 4BY7G 1A2UA 4KMUC 4A3EH 4KI0A 1D1IA 4JI6Q 2HHHL 1K0RA 5EKKA 3TRZA 1NUCA 2PMZB
chains in the Genus database with same CATH topology
2AWNA 1Q7YC 2CQOA 1ASYA 2FXQA 4DR5L 1JJGA 3GTKH 1PH2A 1B8AA 1E1TA 2A19A 1U5KA 1OXVA 3MXNB 1O7IA 4R4OA 2ZTEA 2UUAQ 4GKJQ 2JA6H 1VQIA 1YIJA 4A3IH 2E5LQ 4JI5Q 3PO2G 3LGJA 1S72A 1WOCA 3CCJA 1V9PA 4JI0L 3H15A 1IBLL 4QGUA 1XTDA 1IXRA 2WAQG 4DR1Q 2RHQB 1XNRL 4DK6C 3ICEA 1VQJA 1HZBA 1G51A 2ZTCA 5M3FH 1EWIA 3NBHB 4A75A 4A3FH 2AMCB 3S17H 4DR6Q 1IBKQ 1SR3A 4DV6Q 2R6GA 5FLMG 1WCMH 2R93H 3MEFA 4JYAQ 2YV5A 1YITA 2RF4A 1WJJA 4GKKL 2VS1A 5IP7H 5IE8A 4JBMA 4A3MH 4LF5Q 1I3QH 1YZ6A 2ZJRA 1VQPA 4DV0L 3BU2A 4DV7Q 4A3JH 3CQZH 3U4VA 1HR0W 3E9IA 2JA5G 2NN6I 3FKIG 4LNQA 1M1KC 3M7NA 5BR8L 3S1RH 5JEAG 4DV4Q 4GNXB 2Q2TA 3CC4A 2VQFL 1PV4A 4OXPA 4JI4Q 3CCLA 1JE5A 4DR3Q 4OO1G 1KHIA 3ULPA 3HOWH 1AE3A 5GQOA 3HOUH 3H0GH 4LF8Q 4LF6Q 1NMFA 4NXNL 2VW9A 4GN4B 2JE6I 4A3DH 4HIOA 1VQKA 2NZOA 5C0XI 3STBD 4P73A 2QEXA 4LF7Q 4A4IA 1HNWQ 2WB1G 2UUBL 2JQOA 2KHJA 3K81C 3CMAA 4BY7H 3AQQA 1VQDA 1PYSB 2DUDA 4IPDA 3JC66 3NENA 4JI2Q 3WWVA 2GN5A 1HNXQ 4JI8Q 4OX9L 3RLOA 4HJ5A 4B3ML 3I7FA 2IHEA 3VDYA 1K8GA 1VQNA 3F2CA 2E2HH 2XTIA 1EIYB 1V43A 4LF9Q 1XNRQ 3HKSA 4IPGA 5DLQE 1VQOA 3U4ZA 3GTPH 3HOZG 2OTLA 3RR5A 3TREA 1EIFA 3ER0A 5C4JH 5IYBH 1Y1WG 4RG1A 1PFSA 1Q1EA 3KJOA 1N8RC 4JI6L 3J81i 4BBRG 3E0EA 3AFQA 2R7ZG 2ZM6Q 1GVPA 1JJ2A 2WFWA 3M3YH 2Q2UA 3RLNA 1G291 2CFMA 3S15H 1VCIA 4MZ9A 4WJ3M 4IFDG 3T1HL 4BY1G 1I50H 3G71A 4A3FG 2I0QA 5C3EG 2UUAL 1K73C 1PH7A 4GKJL 3F1ZA 1K83H 4X66Q 1OTCA 2E5LL 2XGTA 3TS0A 2K75A 4GLXA 1XMQQ 1SLJA 3BZKA 2VQEQ 5IP7G 3A0JA 1JMCA 4A3MG 1YVCA 3KDFB 4JCVE 2JA5H 1QZGA 1S40A 3RN2A 1TWGH 3S2DH 3STBC 3K7AH 4DKAC 3K80C 2ZTDA 4DR6L 1NMGA 2Q2IA 4P71A 1IBKL 3G4SA 1A62A 4YCVA 2UXBQ 1H95A 4JYAL 2ID0A 4C2MH 3GTJH 4PZ7A 3F2DA 2BH2A 3PCOB 3CD6A 2HIVA 2JA7H 3D31A 1ASZA 3HOYG 4LF5L 3S14H 4UP9A 4APVA 2IX0A 1PA6A 3HOUG 3H0GG 4P74A 3W1GA 2MO1A 4UP8A 4AIMA 3FHWA 2D0OA 4DV7L 1AH9A 3U50C 4IOAA 3J81j 1QUQA 4GS3A 3A5ZB 2B63G 1J5EQ 4LFBQ 4DV4L 1OXTA 1PH5A 1HZAA 1YEZA 4J15A 4HIDA 4JI4L 3A5UA 1XNQQ 4DR3L 1LUZA 3IRBA 2R92G 3S1QH 4TQUS 4OO1I 1XPUA 3PUWA 3RZDH 3HKZG 4LF8L 4YCUA 2BA0A 4LF6L 2DGYA 1VQCA 2RCNA 5C44G 5M5XH 3PF5A 3PUYA 1LTLA 3PUXA 4MNOA 3G6EA 3ERSX 3UDXA 1L1OA 2N3SA 3CW2C 4UY8C 4ALPA 4LF7L 3I4MG 3EBEA 4AYBE 5IWAQ 1HNWL 4EX5A 3J80c 4HJ8A 3T1HQ 3HOZH 1E1OA 4GN3B 3UDIA 2Y0SG 3CP0A 3F2BA 1Y1WH 3I2ZA 2KBNA 2LXJA 3Q8DA 3GTGH 1N33Q 4P72A 1V1QA 5E7NA 5IYBG 2LSSA 4JI2L 5ELNA 1HNXL 4JI8L 5IYDG 4BBRH 2GVBA 1B70B 4NXMQ 2R7ZH 3CCSA 2HT1A 2F3IA 4O2DA 1C9OA 4DV3Q 4LF9L 3TRZA 3T1YQ 1N32Q 4BY1H 1EOVA 4LFCQ 4MTNA 1X3FA 5C3EH 4A3LH 5JJIA 4HJ9A 1KD1C 4KHZA 3ULJA 3JAMi 1HNZQ 3E9HA 4HIMA 1XMOQ 4PMWA 3RLFA 1X6OA 3CCUA 1Q86C 1VQ7A 4B3TQ 1BBWA 1SE8A 4DAYB 1KRTA 4YWKA 3UE0A 2IHFA 2ZM6L 1XJVA 1Q82C 3CCRA 1YHQA 1MJEA 5IP9G 5C4XH 2K5VA 4IFDI 4A93H 1VQ8A 4EQ5A 3M4QA 2VZAA 4X66L 3G48A 4GOPA 4LF4Q 1LYLA 3J7A5 1PH4A 3L0OA 5AJ3Q 1L1OC 2VUMH 4A3KH 3HOYH 4HIKA 1BKBA 1XMQL 1TWCH 4DPGA 2VQEL 2JA7G 4DNIA 3S16H 2AWOA 3W1BA 3M85A 4JOIA 4X65Q 3CCVA 1S3OA 3KF6A 2K5HA 1Q12A 2B63H 3OYYA 1IBMQ 2Z6KA 1KC8C 3RZOH 3PF4A 4LW1A 3HOVH 2UXBL 2R92H 1EQRA 1Z9FA 2D0PA 2ZJQA 1OXUA 1X56A 2NVTH 2PQAB 2WAQE 1GM5A 4JBKA 2B29A 1K3RA 5C44H 2JEBI 4A76A 2IX1A 1FVIA 5J3BA 4B3RQ 1VS0A 2F52A 4LFBL 1J5EL 3I4MH 3CCQA 2B3GA 1D7QA 1XNQL 4L5TA 5M5YH 2Z0SA 4IJLA 1VQEA 2IT1A 2YTVA 4LUOA 1FJGQ 3CPWA 2MO0A 4DUZQ 1L0WA 2ALYB 1WYDA 3S1NH 2YTXA 2NZHA 1WFQA 1TXYA 5IYDH 1KRSA 5C0XJ 4GOPC 1KXLA 1EUJA 1HH2P 3J7ZC 1XPRA 1UE6A 2V1CC 5IWAL 3EN2A 3I55A 2PQAA 3PUVA 1TWAH 4L5RC 4JOIC 4TVAB 4LFAQ 2IY5B 1YNXA 3PO3G 4A3LG 4QQBX 4P75A 1PH9A 1OXSC 4IPCA 1N36Q 1QUQB 1N33L 1JT8A 3CCMA 2UU9Q 2Z6KC 1Q1BA 1W2BA 2JJQA 1LM0A 4O0AA 4NXML 4QJFA 1HZCA 4X62Q 2WB1E 5IP9H 1SMXA 4DV3L 1NE3A 4OWXB 3T1YL 3KFUA 1N32L 3GD7A 1JJCB 2E8GA 1W3SA 5C4XG 3PGZA 3CAMA 3K7UC 1YBYA 1VQGA 4R1JA 4LFCL 4A93G 1QVCA 4JI1Q 1SRUA 3AEVA 1HNZL 1L1OB 1XMOL 4JG2A 2VUMG 4X6AH 4A3BG 2JA8H 4B3TL 5JJKA 5HY6A 2E2JH 4DR2Q 4ME3A 4DR4Q 1Q81C 3OW2A 4JI3Q 4XIGS 3UDFA 4X64Q 4DV2Q 4JI7Q 4AQYQ 1IL2A 4LF4L 3HOVG 1VQHA 5AJ3L 4YHHQ 3KJPA 4DAMA 4OWTB 3RNUA 1Y1VH 3D0FA 4IOCA 2OTJA 1NBWA 1HZ9A 4X65L 2OCEA 4DV5Q 1BBUA 3F8TA 1PH3A 4WJ4A 4QY7A 1UE7A 2OQKA 1DGSA 1QVGA 2PMZE 1IBML 2CCZA 2UXDQ 3HOXH 1VQ5A 4HJAA 3H3VH 3PUZA 4LUVA 2ES2A 2F4VL 3PSIA 1SN8A 1VQAA 4BBSH 1YJ9A 5LMUQ 2KCTA 5M5WH 1HJPA 3ZJYC 2UUCQ 1FGUA 2I5LX 1R9TH 5GAHC 1N34Q 5FJ8H 2GVAA 1I94Q 4DUYQ 2VNUD 1CKNB 2K4KA 3M4PA 1HR0L 4UPAA 3ULLA 1M90C 1VQBA 4K0KQ 1A8VA 4B3RL 4GOPB 3FP9A 2AKWB 4H02A 1C0AA 2JEAI 5JEAJ 1VQ4A 4BXXG 4RMFA 1YHBA 3K0XA 4IJHA 2N78A 3H3VI 1KIXA 3PV0A 3L2PA 4Y7NH 1KL9A 1CKMA 2MFIA 3M4OH 3PO3H 3KF6B 1FJGL 3OTOQ 4A3GG 4DUZL 1EQQA 3I4NG 2A1AA 1TWFH 2RHSB 5LMNQ 4HJ7A 4YY3Q 1C7YA 4A3CG 4JV5L 1I6HH 1UEBA 1PH6A 1VQ9A 4OONA 2YYZA 1E22A 4JBWA 1T9HA 4LUZA 4Y52H 1OXXK 4L5SA 4JBJA 1CKNA 1K9MC 3JAMc 5M3MH 1CSQA 2D62A 4GN5A 4LFAL 4BA2I 4L5QA 3HKZE 5EAYA 3HFZB 4C3JH 1AE2A 3I56A 2Q2HA 2CWPA 1MIUA 5GAGC 1N36L 3S1MH 1SFOH 1NJIC 1VQMA 1D8LA 2UU9L 4A3BH 2LXKA 3AFPA 4IPHA 5GADC 3CF5A 1E3PA 1P8LA 2JA8G 1Y14B 2EIFA 1X65A 4X62L 1KQSA 4POFA 4B3SQ 2OQ0A 2OWOA 2Y0SE 4YWMA 4YWLA 3U58A 1X9NA 1P16A 4DV1Q 2I5MX 1JB7A 4JI1L 2F4VQ 1N9WA 1MJCA 4DR7Q 4KHPQ 2MQHA 1Y1VG 1X3EA 5HGQA 5ELOA 4DR2L 1HR0Q 3DM3A 1KAWA 1UWVA 1YJWA 3M9BA 4DR4L 2CWAA 3CXCA 4JI3L 4IFDJ 2YTYA 4X64L 4NPSA 1E24A 2MNAA 4DV2L 3HOXG 3CCEA 2NVYH 3A74A 4PG3A 2BA1A 4AQYL 2NVXH 4PZ8A 4JI7L 4BBSG 1RL2A 1GKHA 2JK8A 2VL6A 2L15A 3GDEA 4YHHL 2HHHQ 2VY3A 2UXCQ 1G6PA 2K5NA 1YHAA 2ZJPA 5FJ8G 3GTLH 4DV5L 1WI5A 4JV5Q 3BJUA 3RN5A 1IYJB 4DR5Q 4JC0A 3GTQH 1MKHA 4GLVB 5IYCG 4BXXH 1E7ZA 2N8NA 2HIXA 4R4QA 2ASBA 4QIWE 2UXDL 4LWCA 5GROA 4A3EG 1QZHA 5LMUL 3PIOA 4GNXA 3S24A 2UUCL 3KOJA 4OWWB 2CKZB 3J81c 4A3KG 1N34L 4JI0Q 4A3GH 4A3CH 3KLWA 4DUYL 1I94L 1IBLQ 3I4NH 1X3GA 3NEMA 3CC7A 1EYGA 3GO5A 2QA4A 3KF8B 2WP8J 3K8AA 1SROA 4K0KL 3TQYA 3TEHB 5JJLA 2PI2E 5H1SE 4R4CA 1VQLA 1QVFA 3L7ZC 1A0IA 3PO2H 4KLKA 1RIPA 2EQSA 1UE1A 1XPOA 2JA6G 2ATWA 3W5OA 4A3IG 1PH1A 1PH8A 2KHIA 4GKKQ 1A63A 3DLLA 1CSPA 5M3MG 1BVSA 3OTOL 4DV0Q 2N49A 5LMNL 1J6QA 3B6YA 4YY3L 2NN6G 4AH6A 1GO3E 5GAEC 2H5XA 1EFWA 5M3FG 1IZ6A 5BR8Q 4R4TA 1Z47A 4DK3C 5IY0A 5FLMH 3KYHC 4QL5A 1K8AC 2VQFQ 4AYBG 3GTMH 1WCMG 4C3IH 1FL0A 4JI5L 3S2HH 3UE1A 2R93G 3EIVA 4FDBA 4BA1I 1L2FA 3NELA 4PZ6A 4NB3A 4DR1L 1VQFA 4NXNQ 4XTCS 3FKIH 4A3JG 5C0XG 3CC2A 1Q8KA 3CMEA 2EXDA 2A8VA 3GTOH 5FLXc 4GNXC 2K14A 3PIPA 2C35B 2AHOB 4DV6L 1VQ6A 2K50A 2UUBQ 4B3SL 1YJNA 1NY4A 4POGA 2KCMA 1YI2A 1PYBA 4IO9A 4DV1L 3HOWG 2PNHA 4C3HH 5IT9c 1CUKA 4OX9Q 4YCWA 2YU9H 3CPFA 2R7DA 4B3MQ 4DR7L 4A3DG 4KHPL 2K52A 2KENA 1B7YB 1TWHH 3UDGA 1Q46A 2JA9A 4UP7A 2PI2A 1UE5A 2R7FA 3AYHB 3I4OA 1PVOA 5K36G 1X55A 1X54A 2HQLA 3KDFA 5IYCH 2E2IH 1CKOA 2I5HA 4BY7G 3BZCA 2QGQA 4R4IA 4A3EH 4KI0A 3J80i 3SGIA 2BH8A 2NVQH 1I5FA 4JI6Q 1U0LA 5LMNW 2HHHL 1K0RA 1NTGA 1PHJA 2UXCL 3TS2A 4GLAC 1GD7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AWN A;  1Q7Y C;  2CQO A;  1ASY A;  2FXQ A;  4DR5 L;  1JJG A;  3GTK H;  1PH2 A;  1B8A A;  1E1T A;  2A19 A;  1U5K A;  1OXV A;  3MXN B;  1O7I A;  4R4O A;  2ZTE A;  2UUA Q;  4GKJ Q;  2JA6 H;  1VQI A;  1YIJ A;  4A3I H;  2E5L Q;  4JI5 Q;  3PO2 G;  3LGJ A;  1S72 A;  1WOC A;  3CCJ A;  1V9P A;  4JI0 L;  3H15 A;  1IBL L;  4QGU A;  1XTD A;  1IXR A;  2WAQ G;  4DR1 Q;  2RHQ B;  1XNR L;  4DK6 C;  3ICE A;  1VQJ A;  1HZB A;  1G51 A;  2ZTC A;  5M3F H;  1EWI A;  3NBH B;  4A75 A;  4A3F H;  2AMC B;  3S17 H;  4DR6 Q;  1IBK Q;  1SR3 A;  4DV6 Q;  2R6G A;  5FLM G;  1WCM H;  2R93 H;  3MEF A;  4JYA Q;  2YV5 A;  1YIT A;  2RF4 A;  1WJJ A;  4GKK L;  2VS1 A;  5IP7 H;  5IE8 A;  4JBM A;  4A3M H;  4LF5 Q;  1I3Q H;  1YZ6 A;  2ZJR A;  1VQP A;  4DV0 L;  3BU2 A;  4DV7 Q;  4A3J H;  3CQZ H;  3U4V A;  1HR0 W;  3E9I A;  2JA5 G;  2NN6 I;  3FKI G;  4LNQ A;  1M1K C;  3M7N A;  5BR8 L;  3S1R H;  5JEA G;  4DV4 Q;  4GNX B;  2Q2T A;  3CC4 A;  2VQF L;  1PV4 A;  4OXP A;  4JI4 Q;  3CCL A;  1JE5 A;  4DR3 Q;  4OO1 G;  1KHI A;  3ULP A;  3HOW H;  1AE3 A;  5GQO A;  3HOU H;  3H0G H;  4LF8 Q;  4LF6 Q;  1NMF A;  4NXN L;  2VW9 A;  4GN4 B;  2JE6 I;  4A3D H;  4HIO A;  1VQK A;  2NZO A;  5C0X I;  3STB D;  4P73 A;  2QEX A;  4LF7 Q;  4A4I A;  1HNW Q;  2WB1 G;  2UUB L;  2JQO A;  2KHJ A;  3K81 C;  3CMA A;  4BY7 H;  3AQQ A;  1VQD A;  1PYS B;  2DUD A;  4IPD A;  3JC6 6;  3NEN A;  4JI2 Q;  3WWV A;  2GN5 A;  1HNX Q;  4JI8 Q;  4OX9 L;  3RLO A;  4HJ5 A;  4B3M L;  3I7F A;  2IHE A;  3VDY A;  1K8G A;  1VQN A;  3F2C A;  2E2H H;  2XTI A;  1EIY B;  1V43 A;  4LF9 Q;  1XNR Q;  3HKS A;  4IPG A;  5DLQ E;  1VQO A;  3U4Z A;  3GTP H;  3HOZ G;  2OTL A;  3RR5 A;  3TRE A;  1EIF A;  3ER0 A;  5C4J H;  5IYB H;  1Y1W G;  4RG1 A;  1PFS A;  1Q1E A;  3KJO A;  1N8R C;  4JI6 L;  3J81 i;  4BBR G;  3E0E A;  3AFQ A;  2R7Z G;  2ZM6 Q;  1GVP A;  1JJ2 A;  2WFW A;  3M3Y H;  2Q2U A;  3RLN A;  1G29 1;  2CFM A;  3S15 H;  1VCI A;  4MZ9 A;  4WJ3 M;  4IFD G;  3T1H L;  4BY1 G;  1I50 H;  3G71 A;  4A3F G;  2I0Q A;  5C3E G;  2UUA L;  1K73 C;  1PH7 A;  4GKJ L;  3F1Z A;  1K83 H;  4X66 Q;  1OTC A;  2E5L L;  2XGT A;  3TS0 A;  2K75 A;  4GLX A;  1XMQ Q;  1SLJ A;  3BZK A;  2VQE Q;  5IP7 G;  3A0J A;  1JMC A;  4A3M G;  1YVC A;  3KDF B;  4JCV E;  2JA5 H;  1QZG A;  1S40 A;  3RN2 A;  1TWG H;  3S2D H;  3STB C;  3K7A H;  4DKA C;  3K80 C;  2ZTD A;  4DR6 L;  1NMG A;  2Q2I A;  4P71 A;  1IBK L;  3G4S A;  1A62 A;  4YCV A;  2UXB Q;  1H95 A;  4JYA L;  2ID0 A;  4C2M H;  3GTJ H;  4PZ7 A;  3F2D A;  2BH2 A;  3PCO B;  3CD6 A;  2HIV A;  2JA7 H;  3D31 A;  1ASZ A;  3HOY G;  4LF5 L;  3S14 H;  4UP9 A;  4APV A;  2IX0 A;  1PA6 A;  3HOU G;  3H0G G;  4P74 A;  3W1G A;  2MO1 A;  4UP8 A;  4AIM A;  3FHW A;  2D0O A;  4DV7 L;  1AH9 A;  3U50 C;  4IOA A;  3J81 j;  1QUQ A;  4GS3 A;  3A5Z B;  2B63 G;  1J5E Q;  4LFB Q;  4DV4 L;  1OXT A;  1PH5 A;  1HZA A;  1YEZ A;  4J15 A;  4HID A;  4JI4 L;  3A5U A;  1XNQ Q;  4DR3 L;  1LUZ A;  3IRB A;  2R92 G;  3S1Q H;  4TQU S;  4OO1 I;  1XPU A;  3PUW A;  3RZD H;  3HKZ G;  4LF8 L;  4YCU A;  2BA0 A;  4LF6 L;  2DGY A;  1VQC A;  2RCN A;  5C44 G;  5M5X H;  3PF5 A;  3PUY A;  1LTL A;  3PUX A;  4MNO A;  3G6E A;  3ERS X;  3UDX A;  1L1O A;  2N3S A;  3CW2 C;  4UY8 C;  4ALP A;  4LF7 L;  3I4M G;  3EBE A;  4AYB E;  5IWA Q;  1HNW L;  4EX5 A;  3J80 c;  4HJ8 A;  3T1H Q;  3HOZ H;  1E1O A;  4GN3 B;  3UDI A;  2Y0S G;  3CP0 A;  3F2B A;  1Y1W H;  3I2Z A;  2KBN A;  2LXJ A;  3Q8D A;  3GTG H;  1N33 Q;  4P72 A;  1V1Q A;  5E7N A;  5IYB G;  2LSS A;  4JI2 L;  5ELN A;  1HNX L;  4JI8 L;  5IYD G;  4BBR H;  2GVB A;  1B70 B;  4NXM Q;  2R7Z H;  3CCS A;  2HT1 A;  2F3I A;  4O2D A;  1C9O A;  4DV3 Q;  4LF9 L;  3TRZ A;  3T1Y Q;  1N32 Q;  4BY1 H;  1EOV A;  4LFC Q;  4MTN A;  1X3F A;  5C3E H;  4A3L H;  5JJI A;  4HJ9 A;  1KD1 C;  4KHZ A;  3ULJ A;  3JAM i;  1HNZ Q;  3E9H A;  4HIM A;  1XMO Q;  4PMW A;  3RLF A;  1X6O A;  3CCU A;  1Q86 C;  1VQ7 A;  4B3T Q;  1BBW A;  1SE8 A;  4DAY B;  1KRT A;  4YWK A;  3UE0 A;  2IHF A;  2ZM6 L;  1XJV A;  1Q82 C;  3CCR A;  1YHQ A;  1MJE A;  5IP9 G;  5C4X H;  2K5V A;  4IFD I;  4A93 H;  1VQ8 A;  4EQ5 A;  3M4Q A;  2VZA A;  4X66 L;  3G48 A;  4GOP A;  4LF4 Q;  1LYL A;  3J7A 5;  1PH4 A;  3L0O A;  5AJ3 Q;  1L1O C;  2VUM H;  4A3K H;  3HOY H;  4HIK A;  1BKB A;  1XMQ L;  1TWC H;  4DPG A;  2VQE L;  2JA7 G;  4DNI A;  3S16 H;  2AWO A;  3W1B A;  3M85 A;  4JOI A;  4X65 Q;  3CCV A;  1S3O A;  3KF6 A;  2K5H A;  1Q12 A;  2B63 H;  3OYY A;  1IBM Q;  2Z6K A;  1KC8 C;  3RZO H;  3PF4 A;  4LW1 A;  3HOV H;  2UXB L;  2R92 H;  1EQR A;  1Z9F A;  2D0P A;  2ZJQ A;  1OXU A;  1X56 A;  2NVT H;  2PQA B;  2WAQ E;  1GM5 A;  4JBK A;  2B29 A;  1K3R A;  5C44 H;  2JEB I;  4A76 A;  2IX1 A;  1FVI A;  5J3B A;  4B3R Q;  1VS0 A;  2F52 A;  4LFB L;  1J5E L;  3I4M H;  3CCQ A;  2B3G A;  1D7Q A;  1XNQ L;  4L5T A;  5M5Y H;  2Z0S A;  4IJL A;  1VQE A;  2IT1 A;  2YTV A;  4LUO A;  1FJG Q;  3CPW A;  2MO0 A;  4DUZ Q;  1L0W A;  2ALY B;  1WYD A;  3S1N H;  2YTX A;  2NZH A;  1WFQ A;  1TXY A;  5IYD H;  1KRS A;  5C0X J;  4GOP C;  1KXL A;  1EUJ A;  1HH2 P;  3J7Z C;  1XPR A;  1UE6 A;  2V1C C;  5IWA L;  3EN2 A;  3I55 A;  2PQA A;  3PUV A;  1TWA H;  4L5R C;  4JOI C;  4TVA B;  4LFA Q;  2IY5 B;  1YNX A;  3PO3 G;  4A3L G;  4QQB X;  4P75 A;  1PH9 A;  1OXS C;  4IPC A;  1N36 Q;  1QUQ B;  1N33 L;  1JT8 A;  3CCM A;  2UU9 Q;  2Z6K C;  1Q1B A;  1W2B A;  2JJQ A;  1LM0 A;  4O0A A;  4NXM L;  4QJF A;  1HZC A;  4X62 Q;  2WB1 E;  5IP9 H;  1SMX A;  4DV3 L;  1NE3 A;  4OWX B;  3T1Y L;  3KFU A;  1N32 L;  3GD7 A;  1JJC B;  2E8G A;  1W3S A;  5C4X G;  3PGZ A;  3CAM A;  3K7U C;  1YBY A;  1VQG A;  4R1J A;  4LFC L;  4A93 G;  1QVC A;  4JI1 Q;  1SRU A;  3AEV A;  1HNZ L;  1L1O B;  1XMO L;  4JG2 A;  2VUM G;  4X6A H;  4A3B G;  2JA8 H;  4B3T L;  5JJK A;  5HY6 A;  2E2J H;  4DR2 Q;  4ME3 A;  4DR4 Q;  1Q81 C;  3OW2 A;  4JI3 Q;  4XIG S;  3UDF A;  4X64 Q;  4DV2 Q;  4JI7 Q;  4AQY Q;  1IL2 A;  4LF4 L;  3HOV G;  1VQH A;  5AJ3 L;  4YHH Q;  3KJP A;  4DAM A;  4OWT B;  3RNU A;  1Y1V H;  3D0F A;  4IOC A;  2OTJ A;  1NBW A;  1HZ9 A;  4X65 L;  2OCE A;  4DV5 Q;  1BBU A;  3F8T A;  1PH3 A;  4WJ4 A;  4QY7 A;  1UE7 A;  2OQK A;  1DGS A;  1QVG A;  2PMZ E;  1IBM L;  2CCZ A;  2UXD Q;  3HOX H;  1VQ5 A;  4HJA A;  3H3V H;  3PUZ A;  4LUV A;  2ES2 A;  2F4V L;  3PSI A;  1SN8 A;  1VQA A;  4BBS H;  1YJ9 A;  5LMU Q;  2KCT A;  5M5W H;  1HJP A;  3ZJY C;  2UUC Q;  1FGU A;  2I5L X;  1R9T H;  5GAH C;  1N34 Q;  5FJ8 H;  2GVA A;  1I94 Q;  4DUY Q;  2VNU D;  1CKN B;  2K4K A;  3M4P A;  1HR0 L;  4UPA A;  3ULL A;  1M90 C;  1VQB A;  4K0K Q;  1A8V A;  4B3R L;  4GOP B;  3FP9 A;  2AKW B;  4H02 A;  1C0A A;  2JEA I;  5JEA J;  1VQ4 A;  4BXX G;  4RMF A;  1YHB A;  3K0X A;  4IJH A;  2N78 A;  3H3V I;  1KIX A;  3PV0 A;  3L2P A;  4Y7N H;  1KL9 A;  1CKM A;  2MFI A;  3M4O H;  3PO3 H;  3KF6 B;  1FJG L;  3OTO Q;  4A3G G;  4DUZ L;  1EQQ A;  3I4N G;  2A1A A;  1TWF H;  2RHS B;  5LMN Q;  4HJ7 A;  4YY3 Q;  1C7Y A;  4A3C G;  4JV5 L;  1I6H H;  1UEB A;  1PH6 A;  1VQ9 A;  4OON A;  2YYZ A;  1E22 A;  4JBW A;  1T9H A;  4LUZ A;  4Y52 H;  1OXX K;  4L5S A;  4JBJ A;  1CKN A;  1K9M C;  3JAM c;  5M3M H;  1CSQ A;  2D62 A;  4GN5 A;  4LFA L;  4BA2 I;  4L5Q A;  3HKZ E;  5EAY A;  3HFZ B;  4C3J H;  1AE2 A;  3I56 A;  2Q2H A;  2CWP A;  1MIU A;  5GAG C;  1N36 L;  3S1M H;  1SFO H;  1NJI C;  1VQM A;  1D8L A;  2UU9 L;  4A3B H;  2LXK A;  3AFP A;  4IPH A;  5GAD C;  3CF5 A;  1E3P A;  1P8L A;  2JA8 G;  1Y14 B;  2EIF A;  1X65 A;  4X62 L;  1KQS A;  4POF A;  4B3S Q;  2OQ0 A;  2OWO A;  2Y0S E;  4YWM A;  4YWL A;  3U58 A;  1X9N A;  1P16 A;  4DV1 Q;  2I5M X;  1JB7 A;  4JI1 L;  2F4V Q;  1N9W A;  1MJC A;  4DR7 Q;  4KHP Q;  2MQH A;  1Y1V G;  1X3E A;  5HGQ A;  5ELO A;  4DR2 L;  1HR0 Q;  3DM3 A;  1KAW A;  1UWV A;  1YJW A;  3M9B A;  4DR4 L;  2CWA A;  3CXC A;  4JI3 L;  4IFD J;  2YTY A;  4X64 L;  4NPS A;  1E24 A;  2MNA A;  4DV2 L;  3HOX G;  3CCE A;  2NVY H;  3A74 A;  4PG3 A;  2BA1 A;  4AQY L;  2NVX H;  4PZ8 A;  4JI7 L;  4BBS G;  1RL2 A;  1GKH A;  2JK8 A;  2VL6 A;  2L15 A;  3GDE A;  4YHH L;  2HHH Q;  2VY3 A;  2UXC Q;  1G6P A;  2K5N A;  1YHA A;  2ZJP A;  5FJ8 G;  3GTL H;  4DV5 L;  1WI5 A;  4JV5 Q;  3BJU A;  3RN5 A;  1IYJ B;  4DR5 Q;  4JC0 A;  3GTQ H;  1MKH A;  4GLV B;  5IYC G;  4BXX H;  1E7Z A;  2N8N A;  2HIX A;  4R4Q A;  2ASB A;  4QIW E;  2UXD L;  4LWC A;  5GRO A;  4A3E G;  1QZH A;  5LMU L;  3PIO A;  4GNX A;  3S24 A;  2UUC L;  3KOJ A;  4OWW B;  2CKZ B;  3J81 c;  4A3K G;  1N34 L;  4JI0 Q;  4A3G H;  4A3C H;  3KLW A;  4DUY L;  1I94 L;  1IBL Q;  3I4N H;  1X3G A;  3NEM A;  3CC7 A;  1EYG A;  3GO5 A;  2QA4 A;  3KF8 B;  2WP8 J;  3K8A A;  1SRO A;  4K0K L;  3TQY A;  3TEH B;  5JJL A;  2PI2 E;  5H1S E;  4R4C A;  1VQL A;  1QVF A;  3L7Z C;  1A0I A;  3PO2 H;  4KLK A;  1RIP A;  2EQS A;  1UE1 A;  1XPO A;  2JA6 G;  2ATW A;  3W5O A;  4A3I G;  1PH1 A;  1PH8 A;  2KHI A;  4GKK Q;  1A63 A;  3DLL A;  1CSP A;  5M3M G;  1BVS A;  3OTO L;  4DV0 Q;  2N49 A;  5LMN L;  1J6Q A;  3B6Y A;  4YY3 L;  2NN6 G;  4AH6 A;  1GO3 E;  5GAE C;  2H5X A;  1EFW A;  5M3F G;  1IZ6 A;  5BR8 Q;  4R4T A;  1Z47 A;  4DK3 C;  5IY0 A;  5FLM H;  3KYH C;  4QL5 A;  1K8A C;  2VQF Q;  4AYB G;  3GTM H;  1WCM G;  4C3I H;  1FL0 A;  4JI5 L;  3S2H H;  3UE1 A;  2R93 G;  3EIV A;  4FDB A;  4BA1 I;  1L2F A;  3NEL A;  4PZ6 A;  4NB3 A;  4DR1 L;  1VQF A;  4NXN Q;  4XTC S;  3FKI H;  4A3J G;  5C0X G;  3CC2 A;  1Q8K A;  3CME A;  2EXD A;  2A8V A;  3GTO H;  5FLX c;  4GNX C;  2K14 A;  3PIP A;  2C35 B;  2AHO B;  4DV6 L;  1VQ6 A;  2K50 A;  2UUB Q;  4B3S L;  1YJN A;  1NY4 A;  4POG A;  2KCM A;  1YI2 A;  1PYB A;  4IO9 A;  4DV1 L;  3HOW G;  2PNH A;  4C3H H;  5IT9 c;  1CUK A;  4OX9 Q;  4YCW A;  2YU9 H;  3CPF A;  2R7D A;  4B3M Q;  4DR7 L;  4A3D G;  4KHP L;  2K52 A;  2KEN A;  1B7Y B;  1TWH H;  3UDG A;  1Q46 A;  2JA9 A;  4UP7 A;  2PI2 A;  1UE5 A;  2R7F A;  3AYH B;  3I4O A;  1PVO A;  5K36 G;  1X55 A;  1X54 A;  2HQL A;  3KDF A;  5IYC H;  2E2I H;  1CKO A;  2I5H A;  4BY7 G;  3BZC A;  2QGQ A;  4R4I A;  4A3E H;  4KI0 A;  3J80 i;  3SGI A;  2BH8 A;  2NVQ H;  1I5F A;  4JI6 Q;  1U0L A;  5LMN W;  2HHH L;  1K0R A;  1NTG A;  1PHJ A;  2UXC L;  3TS2 A;  4GLA C;  1GD7 A; 
#chains in the Genus database with same CATH topology
 5EPK A;  5G3L D;  3M4Y A;  1ASY A;  4DR5 L;  2HDL A;  4U68 A;  1U5K A;  1OXV A;  1HRJ A;  4FVM A;  1YIJ A;  4A3I H;  2E5L Q;  1S72 A;  2A68 D;  4JI0 L;  3H15 A;  1IBL L;  2B39 A;  4QGU A;  1XTD A;  3J7A V;  2NN6 H;  1SFO B;  4DK6 C;  1HZB A;  4A3B B;  3NBH B;  4A3F H;  4A75 A;  1SNQ A;  4XYO A;  4JYA Q;  1YIT A;  1XXG A;  5CV5 A;  4F7X A;  3EQL C;  4F8M A;  4GKK L;  4LF5 Q;  2B2Y C;  2L55 A;  5DM6 3;  1SE4 A;  2NN6 I;  4O1N A;  2NVT B;  1BDO A;  1HPC A;  2K32 A;  1TY0 A;  2VQF L;  4OEM B;  4MHE A;  2F0G A;  1KHI A;  2LFN A;  3I4M B;  1SAP A;  4LF6 Q;  2B2T A;  2Q8T A;  4DK0 A;  2D5D A;  5C4Z A;  2QEX A;  2SNM A;  4A4I A;  4KY7 A;  4X3T A;  3S1N B;  1HNW Q;  2UUB L;  2JQO A;  3KK7 A;  4CBV A;  5FLX E;  4FP5 D;  3DEP A;  1B1Z A;  3WWV A;  4JI2 Q;  4EGV A;  4JI8 Q;  3KLR A;  4A3G B;  2XTI A;  1XNR Q;  3IFT A;  2GA4 B;  1KNA A;  2CH4 A;  3SK5 A;  2OTL A;  5CMD A;  1DOL A;  1GUG A;  1BXT A;  4CDE C;  1PFS A;  1N8R C;  4JI6 L;  2R61 A;  4C1N K;  1EYC A;  1G91 A;  2ZM6 Q;  2Q2U A;  2VB2 X;  2ZXR A;  1V1P A;  4A3F G;  2I0Q A;  2E2J B;  3F1Z A;  1K83 H;  3LX0 A;  2EY6 A;  3S2H B;  2E5L L;  4I7Z C;  3TN2 A;  2K5D A;  1GHJ A;  3BZK A;  1XMQ Q;  2WIN B;  4DXF A;  2A6H C;  5FLX L;  5JEA H;  2RCF A;  1B2T A;  4P71 A;  1QNU A;  1A62 A;  4KK7 A;  4YCV A;  4KD3 A;  1NSN S;  4JYA L;  4OO1 H;  5EPL A;  1LTR D;  4K6D A;  1PFM A;  3HOY G;  4LF5 L;  4UP9 A;  5IT9 L;  4P74 A;  3W1G A;  5C3W A;  4IOA A;  3PMF A;  3TZD A;  1F9S A;  1QUQ A;  4LFB Q;  1OXT A;  3ONA B;  3SR1 A;  3IRB A;  2R92 G;  3S1Q H;  4OO1 I;  2N88 A;  4A3E B;  4LF6 L;  2Z8L A;  1VQC A;  4RWS C;  3P20 A;  1NNX A;  3PUY A;  1PRT D;  3UI2 A;  1HNW L;  4ULL A;  2F0E A;  4HJ8 A;  3T1H Q;  3NQI A;  3F2B A;  3CP0 A;  3I2Z A;  1B3A A;  1V1Q A;  4A3I B;  5J39 A;  5ELN A;  5EBC A;  4JI2 L;  1HCZ A;  4JI8 L;  2GVB A;  2R7Z H;  5IGF A;  2O5J C;  3I4L A;  4FYD A;  2F3I A;  2O4X A;  1NR4 A;  4O2D A;  1STN A;  2VB3 X;  3T1Y Q;  4IFD H;  2F0H A;  4BY1 H;  1GUN A;  2I46 A;  3SDZ A;  4FF1 A;  4LFC Q;  4MTN A;  5C3E H;  5JJI A;  3ULJ A;  4AYB B;  2EYF A;  1X6O A;  3CCU A;  3V05 A;  1SE8 A;  2A74 C;  4RFB A;  2ZM6 L;  4Z9C B;  4KJN A;  2TMP A;  5IP9 G;  5C4X H;  1R4P B;  4IFD I;  4A93 H;  3QOJ A;  2VZA A;  5BN5 A;  4GOP A;  1PTO C;  4LF4 Q;  1A15 A;  5AJ3 Q;  1L1O C;  2IWH A;  2VUM H;  1ILP A;  3MEH A;  1BKB A;  1XMQ L;  2TSS A;  2PQE A;  3MXP A;  4DNI A;  3S16 H;  2AWO A;  3W1B A;  3M85 A;  4DFA A;  3MVV A;  2K5H A;  4R8N A;  3D4D A;  2LMC B;  3OIQ A;  1DZ1 A;  3N6R A;  2MJ8 A;  1YNN C;  3HOV H;  1EQR A;  1GUW A;  2CQA A;  1Z9F A;  2D0P A;  1OXU A;  4OIJ A;  2PQA B;  1GM5 A;  2B29 A;  1K3R A;  3VA5 A;  2DN8 A;  1W6J A;  3GV6 A;  4LFB L;  3QG1 A;  2B3G A;  1EU3 A;  2N55 A;  2EDG A;  3QB3 A;  1U9R A;  2Z0S A;  1DYQ A;  1W6K A;  4DUZ Q;  2ALY B;  1WYD A;  3PO2 B;  1TXY A;  1I6V C;  1EUJ A;  2WAQ B;  2KVM A;  3Q22 A;  1HQR D;  2DJF C;  3PUV A;  4DAP A;  4DU9 A;  1K0S A;  3OMG A;  2BE5 D;  1C4Q A;  3NWS A;  3PO3 G;  1S5B D;  5CBE E;  4IPC A;  3R8B A;  1QUQ B;  2Z6K C;  2OT2 A;  1LAB A;  2F0Q A;  4O0A A;  3DEO A;  4QJF A;  5KYI A;  1NE3 A;  3T1Y L;  3PQI A;  1ET6 A;  2CW0 D;  2Z4I A;  1WTQ A;  5C4X G;  3CAM A;  4LFC L;  2E2D C;  3HS0 C;  4A93 G;  4RHS A;  4PV1 C;  5EGT A;  1FYC A;  5A2Q E;  2X6G A;  1WTX A;  1G2S A;  3NK9 A;  2VUM G;  3V2T A;  1WD0 A;  5HY6 A;  4ME3 A;  3I91 A;  3OW2 A;  4JI3 Q;  3IL8 A;  4XIG S;  3D8G A;  1TWH B;  4K14 A;  1LTB D;  2WB1 B;  4LF4 L;  1Q8I A;  3HOV G;  1GJX A;  5AJ3 L;  4YHH Q;  2M2L A;  2E2I B;  4OWT B;  4RGT A;  3S1Q B;  4DV5 Q;  2RVL A;  2UXD Q;  3HOX H;  3SVM A;  1ZKO A;  1EEF D;  2PNR C;  5EJW A;  3H3V H;  5M5W H;  5JVG 3;  3D4R A;  4TSS A;  1FGU A;  2I5L X;  2UUC Q;  1STG A;  5GAH C;  5JOB A;  2GVA A;  2VNU D;  1CKN B;  3M4P A;  2G9H D;  2JA6 B;  4KN4 C;  1A8V A;  3K0Y A;  4KN7 C;  4GOP B;  2F0U A;  3FP9 A;  4BXX G;  5A2Q L;  4IJH A;  3K0X A;  3H3V I;  4BY1 B;  4Y7N H;  1KAB A;  3QR8 A;  3WDN A;  2Z9H A;  5C3E B;  3BZD B;  1HA5 A;  4DUZ L;  1QJO A;  2RHS B;  5LMN Q;  1C7Y A;  4JV5 L;  1UEB A;  5CYU A;  1VQ9 A;  1G8Z D;  2RDH A;  4A3M B;  1I3Q B;  3VR3 A;  4I65 A;  4L5S A;  5FO8 B;  4JBJ A;  1E2Z A;  3JAM c;  3VR2 A;  1CSQ A;  2D62 A;  5M3M H;  1RJT A;  3HKZ E;  2XRQ D;  5EAY A;  4JW0 A;  4C3J H;  3I56 A;  5GAG C;  3S1M H;  3WOF A;  5GAD C;  4S3S A;  1P8L A;  4ZCK A;  3ERO A;  3H0G B;  1Y14 B;  1KQS A;  2F0D A;  2OQ0 A;  1AEX A;  2AQ1 B;  2Y0S E;  1OO9 B;  1DM0 B;  1PZI D;  4DV1 Q;  2F4V Q;  3ITP A;  1K8M A;  1A6X A;  1UWV A;  1U4P A;  1ENA A;  3M9B A;  2PYK A;  3CXC A;  4JI3 L;  3A54 A;  4NPS A;  1E24 A;  3H09 A;  2F0T A;  3HOX G;  3CCE A;  4PG3 A;  4KTA A;  4RCO A;  4YHH L;  2L15 A;  4V0B A;  1EY7 A;  3GTP B;  1YHA A;  4DV5 L;  2WKD A;  1M8A A;  1D1K A;  1KAA A;  3GTQ H;  1JR0 D;  1MKH A;  2EY5 A;  2K7V A;  2N8N A;  5LL6 S;  2HIX A;  2UXD L;  3DM1 A;  4QIW E;  1ZYR D;  4LWC A;  1PMR A;  2F03 A;  3PIO A;  3S15 B;  2UUC L;  3HEJ A;  3KOJ A;  4OWW B;  2CKZ B;  3J81 c;  4A3K G;  3KLW A;  3X3M A;  4WFN 3;  3GO5 A;  1XTC D;  3J80 E;  1IYU A;  1SRO A;  4DF7 A;  5IGD A;  3TQY A;  4XDX A;  5JJL A;  3HGB A;  3L7Z C;  1V8Q A;  2L0C A;  3D6W A;  2JA5 B;  1XPO A;  2EQS A;  1B50 A;  2ATW A;  1PH1 A;  3K7A B;  5M3M G;  3LWU A;  1TKW B;  3KUP A;  2N49 A;  5LMN L;  1J6Q A;  5KNB A;  2Q8I B;  3B6Y A;  4C3J G;  4DV0 Q;  3K5N A;  3IAY A;  1GO3 E;  1PTO F;  1JWU D;  2K03 A;  3MA2 B;  1BNZ A;  2V4D A;  1IZ6 A;  2JA7 B;  3D6C A;  4DK3 C;  5IGB A;  4HR7 B;  2EPB A;  3GTM H;  2R93 G;  4C3I H;  1FL0 A;  4ZAI A;  1EZ8 A;  4BA1 I;  1L2F A;  5DM7 3;  4PZ6 A;  3G6J B;  4NB3 A;  4CDC C;  5EKL A;  4NXN Q;  4XTC S;  3FKI H;  4A3J G;  2B8F A;  3CME A;  3RZD B;  4IUR A;  2AHO B;  3SK8 A;  5D65 A;  2A6E D;  4POG A;  1M4V A;  4CJ0 B;  1CHQ D;  4DV1 L;  3HOW G;  3J80 L;  2NUC A;  4C3H H;  2YU9 H;  4A3D G;  3UDG A;  1Q46 A;  3KLS A;  3DWP A;  3I4O A;  3AYH B;  1X55 A;  1X54 A;  3RMH A;  3KDF A;  5KNC A;  4F88 A;  1CKO A;  3BVM A;  4H0L C;  1Y69 U;  2QGQ A;  2NVQ H;  1F2L A;  3H6M A;  5LMN W;  1LTS D;  4GLA C;  4X3K A;  2CVR A;  3OPO A;  1JJG A;  1PH2 A;  2A19 A;  4R4O A;  3MXN B;  1O7I A;  4GKJ Q;  2PCF B;  3JAM L;  1VQI A;  4JI5 Q;  1PFN A;  2QKI C;  3E0J A;  2QF7 A;  3ICE A;  3J81 E;  5M3F H;  1G51 A;  3BVZ A;  1EWI A;  4DR6 Q;  3S17 H;  1IBK Q;  3ERQ A;  1WCM H;  4XT3 B;  5JPN C;  1WJJ A;  5J1Z A;  4C3I G;  1U4L A;  2MGS A;  5IE8 A;  4RKL A;  3ND9 A;  1MD2 D;  4DV0 L;  3BU2 A;  3HRZ C;  3CQZ H;  3U4V A;  3E9I A;  1EY9 A;  3FKI G;  2ZXP A;  3M7N A;  3N52 A;  5I6Y A;  3CC4 A;  1F77 A;  2K04 A;  4JI4 Q;  3TME A;  3P1H A;  3ULP A;  1AE3 A;  4LF8 Q;  3T4A C;  1SXT A;  4NXN L;  5M5Y B;  1CQV A;  4HIO A;  1ZXT A;  3DWQ A;  1G6Z A;  2A6H D;  4P73 A;  3FPU B;  2Z4H A;  4LF7 Q;  1II3 A;  3GTQ B;  4BY7 H;  3AQQ A;  1WTP A;  4KHV A;  1PYS B;  2DUD A;  1ET9 A;  1I4P A;  3JC6 6;  3J81 L;  4QMG A;  3RLO A;  5EQ0 A;  3F2C A;  2E2H H;  1V43 A;  3VYT A;  5DLQ E;  4IPG A;  4CJ2 C;  1I4Q A;  3TRE A;  1EIF A;  4DK1 A;  1Y1W G;  5KIX A;  4EQO A;  4DXG A;  5D3D A;  1BF4 A;  5CV7 A;  2RQX A;  4BBR G;  4QIW B;  2O5I C;  2K28 A;  1HXY D;  3VR5 A;  4IUQ A;  2B2T C;  3S9W A;  2JA8 B;  1EIG A;  3NHH A;  1K73 C;  4GKJ L;  3FDT A;  3TS0 A;  2AUK A;  1TVX A;  3R2T A;  1FNW A;  3A0J A;  1JMC A;  1YVC A;  3KDF B;  4JCV E;  1QZG A;  3RN2 A;  3STB C;  2UXC L;  2ZT9 C;  4DKA C;  3K80 C;  2ZTD A;  5COY A;  2QEJ C;  1NMG A;  5C6A A;  4DR6 L;  1IBK L;  3F2D A;  4C2M H;  3GTJ H;  4PZ7 A;  2FMC A;  1GHK A;  3CD6 A;  2HIV A;  1EOT A;  1RDP D;  2EZV A;  1ASZ A;  2LKV A;  1H9R A;  4BBS B;  1SE3 A;  4UP8 A;  1BUV T;  4WRD A;  3C1F A;  4GS3 A;  2B63 G;  1J5E Q;  5CV6 A;  4HID A;  4JI4 L;  1GUO A;  3A5U A;  3A8I E;  3AU7 A;  1NAP A;  1PTO D;  2NYZ D;  4TQU S;  4LF8 L;  1S5E D;  4YCU A;  2DGY A;  2RCN A;  5C44 G;  2F0M A;  5M5X H;  3G6E A;  2N3S A;  3CW2 C;  4UY8 C;  4ALP A;  4LF7 L;  3I4M G;  4AYB E;  4EX5 A;  3MZ5 A;  1YNN D;  1E1O A;  3V96 A;  5I4D A;  2QIL A;  2LXJ A;  3I8Z A;  4HN7 A;  5E7N A;  1N33 Q;  5IYD G;  1YNJ C;  2AQ2 B;  1B70 B;  3CCS A;  2HT1 A;  4WOR A;  1C9O A;  1HTL D;  3FVQ A;  2Q8R E;  1SNM A;  5M3F B;  2G9D A;  1X3F A;  1WCM B;  3BDL A;  3I90 A;  1XMO Q;  2FMM A;  4PMW A;  5C5M A;  3QIA A;  2L9H A;  1BBW A;  4B3T Q;  3BYY B;  4YWK A;  3UE0 A;  1Q82 C;  2B2U A;  4FO2 A;  4LMQ D;  1YHQ A;  3CQZ B;  1VQ8 A;  3NWT A;  3K5L A;  2EYJ A;  5FO7 B;  3J7A 5;  3L0O A;  5EKI A;  1AN8 A;  3R3O A;  4ID6 A;  1JOK A;  3HOY H;  1TWC H;  2DNE A;  4JOI A;  1MSH A;  3MXG A;  1IBM Q;  3RZO H;  1PZJ D;  3NTK A;  3GTL B;  2RKS A;  4LW1 A;  2R92 H;  2MPM A;  4BY7 B;  2F0P A;  1STH A;  2XNA C;  2WAQ E;  4JBK A;  2JEB I;  4A76 A;  2A5H A;  2KJX A;  2SDF A;  4B3R Q;  4RAU C;  1A2T A;  1VS0 A;  2F52 A;  4N8F A;  1J5E L;  5IT9 E;  1D7Q A;  3Q24 A;  4IJL A;  1FJG Q;  3CPW A;  2MO0 A;  3QOL A;  2YTX A;  1F2Z A;  1TQO A;  4KJO A;  1KRS A;  5C0X J;  2NTS A;  3IFD A;  4GOP C;  3CU7 A;  3J7Z C;  1XPR A;  2V1C C;  3EN2 A;  2JXM B;  1IL8 A;  1SJH D;  2PQA A;  1TWA H;  3VR4 A;  2IW3 A;  2IY5 B;  4P75 A;  1PH9 A;  1N33 L;  2K5W A;  1JT8 A;  1Q1B A;  1JOR A;  1DCZ A;  2L5T A;  5T1G A;  1KLG D;  2B8G A;  1HZC A;  2OEO A;  3H94 A;  2WB1 E;  5IP9 H;  1MHW C;  3ZYY X;  3GD7 A;  2E8G A;  4R1J A;  3K7U C;  1YBY A;  1LO5 D;  1AZQ A;  2BDN A;  4C2M B;  1XMO L;  4NKL A;  4JG2 A;  3C46 A;  4B3T L;  1ESF A;  3O13 A;  2PO4 A;  4YIJ A;  3LNN A;  1Q81 C;  2CH4 W;  3A8J E;  5K5P A;  3MFG A;  4JI7 Q;  1SEB D;  4KKT A;  4L63 B;  1IL2 A;  1VQH A;  1X3Q A;  4DAM A;  4K6L A;  1Y1V H;  2OTJ A;  1HZ9 A;  1KDC A;  3F8T A;  1B9N A;  4WJ4 A;  3EA6 A;  1DGS A;  1IBM L;  1SYG A;  2ES2 A;  1STA A;  3NUC A;  2A69 C;  1R9T H;  3E6Z X;  1N34 Q;  5FJ8 H;  2F0N A;  2O2L D;  5BN4 A;  4DUY Q;  2K4K A;  1HR0 L;  3ULL A;  3F2U A;  1TY2 A;  4B3R L;  1D5Z C;  2AKW B;  1C0A A;  2JEA I;  1VQ4 A;  4ILW A;  4RMF A;  5DEH A;  4DAV A;  1KIX A;  3PV0 A;  3L2P A;  4CDD C;  1CKM A;  4A3F B;  3M4O H;  3PO3 H;  1FJG L;  1SYE A;  3TP8 A;  1EQQ A;  3I4N G;  1TWF H;  1I6H H;  4YY3 Q;  3PIP 3;  1O7L A;  2YYZ A;  1E22 A;  4H44 C;  4Y52 H;  1K9M C;  1CKN A;  4XXE A;  3TP7 A;  3I3C A;  4KKS A;  3GP7 A;  1UNS A;  4L5Q A;  1AE2 A;  2Q2H A;  4LAA A;  2XN9 C;  1NJI C;  3AFP A;  4IPH A;  2IL8 A;  3CF5 A;  1TWC B;  1CTM A;  4POF A;  3NTI A;  4YWL A;  1P16 A;  3RZO B;  2I5M X;  4XQN A;  5T1I A;  3A56 A;  2R92 B;  2P5Z X;  4DR7 Q;  1Y1V G;  5ELO A;  1SYF A;  3BS1 A;  5IGC A;  5I6W A;  2J4X A;  5IIF A;  1KLU D;  2X69 A;  1ICW A;  4HTH A;  4RKB A;  4JI7 L;  2NVY H;  3NPP A;  2NVX H;  3T53 B;  4PZ8 A;  4R8I A;  1RL2 A;  3GDE A;  5C5L A;  2EYH A;  2PZU A;  5FJ8 G;  1WI5 A;  4JV5 Q;  1IYJ B;  4JC0 A;  1PDQ A;  4G7O C;  4BXX H;  1E7Z A;  4R4Q A;  5L37 A;  4CDF C;  3A55 A;  1N34 L;  3DXJ C;  4PMB A;  4DUY L;  3OW7 A;  1X3G A;  1K83 B;  1QE6 A;  2WP8 J;  1LAC A;  4L6T B;  3QWN A;  1STE A;  4TKO B;  1K8O A;  2EY2 A;  1UE1 A;  2JA6 G;  3T13 A;  2KHI A;  2KOL A;  1XX8 A;  4YY3 L;  3BG3 A;  2H5X A;  3MAQ A;  1EFW A;  5BR8 Q;  4KV6 A;  1K8A C;  5IY0 A;  4QL5 A;  1H9J A;  1R4Q B;  1O78 A;  3PIO 3;  2F0K A;  4DR1 L;  5C0X G;  2A73 B;  1MI2 A;  1DON A;  2H4O A;  4JPB W;  3GTO H;  1ROD A;  3PIP A;  1G2T A;  4DV6 L;  3SEB A;  1VQ6 A;  1PTO H;  1YJN A;  1L0Y B;  3K6O A;  1YI2 A;  3MTS A;  2B2V A;  1S5C D;  4IO9 A;  2PNH A;  1I4H A;  1UEA B;  4ZKC B;  4DR7 L;  2K52 A;  1B7Y B;  2ICE C;  2JA9 A;  1RF2 D;  5FK9 C;  4QUF A;  1TS5 A;  2I5H A;  1H9K A;  2R7Z B;  3J7Y W;  3BZC A;  4OHJ A;  3J80 i;  1I5F A;  1U0L A;  4A3K H;  1NTG A;  3Q23 A;  3PO3 B;  3M4O B;  1GD7 A;  5E1F A;  1TWF B;  2CQO A;  2OXP A;  2FXQ A;  5E4X A;  3GTK H;  1B8A A;  1BO0 A;  2UUA Q;  2ENB A;  2HCI A;  5C4X B;  1WOC A;  3MC0 B;  1EZ6 A;  3BDC A;  1V9P A;  4A93 B;  1C48 A;  2RHQ B;  5I9P A;  1EL0 A;  2VUM B;  1VQJ A;  2ZTC A;  5KGU A;  2AMC B;  1EY0 A;  1SR3 A;  3S16 B;  2R93 H;  3K57 A;  3MEF A;  2YV5 A;  2RF4 A;  1X3P A;  5IP7 H;  1TR5 A;  4JBM A;  1YZ6 A;  2ZJR A;  1VQP A;  3HOV B;  4A3J H;  1JOO A;  1GXD C;  3MXN A;  2JA5 G;  4LNQ A;  1RCV D;  5BR8 L;  1S5F D;  4DV4 Q;  1QOH A;  1PV4 A;  4OXP A;  3CCL A;  1JE5 A;  4DR3 Q;  5FKA C;  5CBA E;  4DA2 A;  3HOW H;  3HOU H;  4X3S A;  2VW9 A;  4GN4 B;  5AFW A;  4IAL A;  4A3D H;  3HP3 A;  5EBD A;  3STB D;  1GOZ A;  4Q0F A;  2KHJ A;  3K81 C;  1VMC A;  1C8C A;  1SNP A;  1F9P A;  3NEN A;  2GN5 A;  1HNX Q;  3J7A F;  4KD4 A;  4N8X 1;  1DXM A;  3EJI A;  2IHE A;  1H9M A;  3VDY A;  2R3Z A;  4LF9 Q;  1B9M A;  1VQO A;  1E2V A;  2KEE A;  3R93 A;  3HOZ G;  4OGQ C;  5C4J H;  3ER0 A;  5IYB H;  1O7Z A;  4RG1 A;  2K05 A;  2F0I A;  1Q1E A;  3NQT A;  3J81 i;  5D14 A;  3E0E A;  3AFQ A;  4ME5 A;  1GVP A;  1JJ2 A;  3M3Y H;  3RLN A;  1G29 1;  2HQE A;  1ML0 D;  1Y8O B;  1I50 H;  3G71 A;  2UUA L;  1OTC A;  2XGT A;  1SDF A;  3P75 A;  5IP7 G;  1YNJ D;  5C4H A;  2BOS A;  3JAM E;  1S40 A;  1QWY A;  1TWG H;  3S2D H;  2F0V A;  1PYW D;  4XYQ A;  2NB0 A;  3G4S A;  1BCP B;  1H95 A;  1JQY D;  2BH2 A;  3C3L A;  1IYV A;  3S14 H;  3K59 A;  3HOX B;  4KKU A;  4APV A;  2IX0 A;  1PA6 A;  3HOU G;  3FHW A;  2D0O A;  5M5W B;  3U50 C;  2QCP X;  3J81 j;  4DV4 L;  1PH5 A;  4DR3 L;  1LUZ A;  4I7A A;  1Z6H A;  2FFK B;  3HKZ G;  2BA0 A;  4OEL B;  5J22 A;  1S4Z A;  3PF5 A;  4Y7N B;  1LTL A;  3C1E A;  1I4R A;  1DOM A;  4B9W A;  5KEE A;  5IWA Q;  3D4W A;  3VYS A;  1Y8P B;  1STB A;  4GN3 B;  3UDI A;  2Y0S G;  1Y1W H;  2KBN A;  3Q8D A;  1QB5 D;  3GTG H;  4P72 A;  5IYB G;  2LSS A;  1HQM C;  3CRK C;  1HNX L;  4BBR H;  5M3M B;  1TS2 A;  4C3J B;  4LF9 L;  3S1M B;  2BCO A;  1Q3L A;  3OMC A;  1EOV A;  4A3L H;  3L3O C;  2WAC A;  4KHZ A;  2R93 B;  1HNZ Q;  4HIM A;  1VMP A;  3RLF A;  1Q86 C;  1VQ7 A;  1TS4 A;  3CCR A;  2K33 A;  5JPM C;  1MJE A;  2K5V A;  1B3Q A;  1A3U A;  3M4Q A;  5JAV A;  3G48 A;  4G4K A;  1LYL A;  3U9S A;  1WVL A;  1A3V A;  5D3I B;  4HIK A;  5A35 A;  4DPG A;  1SMY C;  4X65 Q;  4RHR A;  4A3D B;  2B63 H;  3OYY A;  3NBI A;  1KC8 C;  3PF4 A;  2DNC A;  3BVG A;  2ZJQ A;  4UHV A;  1HUN A;  1FR3 A;  2DY7 A;  3QO2 A;  2NVT H;  4IZ8 A;  5C44 H;  2NZ1 D;  1SND A;  1FVI A;  3I4M H;  3CCQ A;  2RA4 A;  3AMU A;  4QCL A;  4EQP A;  5IOD A;  1VQE A;  2IT1 A;  4LUO A;  2B2U C;  3S1N H;  3HZX A;  1SJE D;  2QDB A;  5IYD H;  5ISR A;  3CHB D;  1HH2 P;  1T5E A;  1UE6 A;  5IWA L;  1IKL A;  3K5O A;  1LTT D;  4L5R C;  4JOI C;  4TVA B;  2A69 D;  4LFA Q;  4A3L G;  3L9A X;  2BDO A;  4QQB X;  2OF1 A;  2KCC A;  1N36 Q;  3GTM B;  4K2L A;  4DN4 M;  4C3I B;  3CCM A;  1CA6 A;  2JJQ A;  4FF2 A;  1LM0 A;  3I70 A;  2I07 B;  3TDQ A;  4OWX B;  1UAP A;  2EY1 A;  3FKI B;  1TWG B;  5E3F A;  5DAU A;  3PGZ A;  1QVC A;  4JI1 Q;  4HCS A;  1EYD A;  1EY5 A;  1SRU A;  3AEV A;  1HNZ L;  1H9S B;  1NCV A;  2JSO A;  4A3B G;  5KND A;  1IHZ A;  3K58 A;  2E2J H;  4DR2 Q;  4C3H B;  2E75 C;  3M7G A;  1EIH A;  1PRT B;  5M9O A;  4K5X A;  2LS0 1;  4MN3 A;  2YU9 B;  1LV9 A;  2EJG C;  3UDF A;  4X64 Q;  2DY8 A;  4DV2 Q;  4HED A;  3GV3 A;  4IOC A;  1NBW A;  4X65 L;  4HMI A;  1BBU A;  5LHY 1;  2NVQ B;  4QY7 A;  3P7J A;  1UE7 A;  4ZKB B;  3RUZ A;  1QVG A;  2CCZ A;  1VQ5 A;  1VQA A;  2WKC A;  4LK1 C;  4IUV A;  5LMU Q;  1YJ9 A;  2XWB B;  1VDZ A;  1GUT A;  2HUG A;  1JWS D;  3WOE A;  1Y1W B;  3GTG B;  1LTI D;  4UPA A;  4CKC A;  1VQB A;  1DOK A;  2X6L A;  2MP1 A;  1STY A;  2ZXO A;  4BBR B;  3K5M A;  5JEA J;  1EQV A;  1YHB A;  3NTH A;  1T5X D;  2N78 A;  2WII B;  1KL9 A;  2MFI A;  3S17 B;  5E4W C;  3OTO Q;  4A3G G;  4A3C G;  1ENC A;  4OON A;  4JBW A;  1FGB D;  1EQT A;  1PZK D;  1OXX K;  1MGS A;  3MWY W;  4HAE A;  4LFA L;  4BA2 I;  4HSP A;  3AB9 A;  1D2B A;  1N36 L;  1MIU A;  1VQM A;  1AW7 A;  1D8L A;  4K5V A;  4XQQ A;  2LXK A;  3OSO A;  2K1B A;  1E3P A;  3NP8 A;  2A6E C;  2OWO A;  1SYD A;  2B63 B;  1X32 A;  4YWM A;  1F9Q A;  4CGY B;  4E6I A;  1ZEQ X;  4JI1 L;  4KHP Q;  4V19 0;  1CK1 A;  4DR2 L;  1HR0 Q;  3DM3 A;  5C44 B;  1KAW A;  1YJW A;  1TII D;  2K6A A;  4IFD J;  2YTY A;  5CC4 A;  4X64 L;  1J8I A;  4R9W A;  4C1N I;  5I2Y A;  2E2H B;  1RTO A;  4DV2 L;  2K5Q A;  3A74 A;  2BA1 A;  1IW7 C;  4IUN A;  2VY3 A;  1LT6 D;  2ZJP A;  3Q0A A;  5IGG A;  1VF7 A;  1ICF B;  1QIL A;  4GLV B;  5IYC G;  2ASB A;  2NWG A;  5GRO A;  4MIU A;  4A3E G;  5LMU L;  2VXW A;  4GNX A;  4JVZ A;  4ZLT F;  3I4N H;  3NEM A;  2QA4 A;  3KF8 B;  4RGN A;  2JYO A;  5ELD A;  1E2W A;  2FHT A;  2PI2 E;  4IN3 A;  5H1S E;  1VQL A;  4CKE A;  4U67 3;  3QJY A;  3PO2 H;  4KLK A;  1AP0 A;  2D9U A;  3W5O A;  4A3I G;  2EJM A;  3T16 A;  1PH8 A;  3SK4 A;  2F0S A;  4HMJ A;  4LJZ C;  1BVS A;  3OTO L;  3KBX A;  2NN6 G;  3GTJ B;  1Z47 A;  5FLM H;  5ELB A;  4Q5V A;  1MSG A;  4AYB G;  4FDB A;  3EIV A;  5EPJ A;  3NEL A;  1VQF A;  3GQB A;  2E74 C;  1Q8K A;  3RD4 A;  4CJ1 B;  5HGT A;  1RTN A;  5CV4 A;  3DHQ A;  2HCC A;  4G7H C;  5M5X B;  1NY4 A;  4GZY C;  2KCM A;  1FNU A;  3LWE A;  5CGK A;  3MHB A;  1CZG A;  1CUK A;  1NR2 A;  4OX9 Q;  2PPB C;  4MTK A;  1KDA A;  4B3M Q;  4KHP L;  4L8J A;  1TWH H;  4UP7 A;  2PI2 A;  2F0F A;  3IKJ A;  1CQF A;  4PQX A;  3A7L A;  2B2Y A;  1PVO A;  2E2I H;  1TT2 A;  3E5S A;  3TP6 A;  4G7Z C;  4NP5 A;  2HD3 A;  4R4I A;  2AQ3 B;  2BH8 A;  3SGI A;  4RH6 A;  5NUC A;  5JVH 3;  1PHJ A;  1BR9 A;  2IX1 A;  2Q2T A;  2AWN A;  3TS2 A;  2RBM A;  1Q7Y C;  5BN3 A;  2E76 C;  1E1T A;  3VA7 A;  3MXU A;  2ZTE A;  2JA6 H;  5FOB B;  3PO2 G;  3LGJ A;  2EVB A;  3CCJ A;  1EYA A;  4ZRZ A;  3X3N A;  4UDU C;  1IXR A;  2WAQ G;  4DR1 Q;  1XNR L;  1O80 A;  2B2V C;  3HOY B;  2NTT A;  4DV6 Q;  1WTH A;  2R6G A;  5FLM G;  1D5M C;  1HFG A;  2C9O A;  2Z1C A;  2F3V A;  4FF4 A;  4KY6 A;  2VS1 A;  1JE4 A;  1EWC A;  4A3M H;  1I3Q H;  4JK1 C;  1EWH A;  5DNF A;  3BDO A;  4DV7 Q;  5C0X H;  1HR0 W;  1M1K C;  3S1R H;  5JEA G;  4GNX B;  3U9O A;  1BCP C;  3H91 A;  5I9O A;  2QDL A;  4B08 A;  1SBB B;  5F2D A;  4OO1 G;  4XT1 B;  5GQO A;  3H0G H;  3H3V C;  1WTO A;  1NMF A;  2XVS A;  2F0L A;  2JE6 I;  1RHP A;  1VQK A;  2NZO A;  5C0X I;  4XQJ A;  2PZT A;  2WB1 G;  4DAY A;  3DUZ A;  5I2X A;  3CMA A;  1PLF A;  1VQD A;  4TRD A;  4IPD A;  2D2C C;  2C5C A;  1WTV A;  1V1P B;  2A68 C;  3D3R A;  4OX9 L;  1TWA B;  4HJ5 A;  4FXK C;  4B3M L;  1DD2 A;  4O42 A;  3I7F A;  1K8G A;  1VQN A;  3I4N B;  1EIY B;  3HKS A;  4G57 A;  1K3B C;  1MBY A;  3U4Z A;  3HG9 A;  3GTP H;  3RR5 A;  5JJZ A;  1JWM D;  1HUM A;  3KJO A;  2J0T D;  4K2K A;  1BQQ T;  1HHV A;  4IUT A;  2R7Z G;  2WV6 D;  2WFW A;  1LTG D;  4QB4 A;  2L4N A;  2CFM A;  3S15 H;  1VCI A;  3KBG A;  4MZ9 A;  4IFD G;  3T1H L;  4WJ3 M;  4BY1 G;  2SNS A;  1SNO A;  1B44 D;  5C3E G;  1PH7 A;  4X66 Q;  1JIC A;  2DJG C;  1JOQ A;  2K75 A;  4K8J A;  4GLX A;  1SLJ A;  2RSO A;  2VQE Q;  4A3M G;  2JA5 H;  4FNF A;  3K7A H;  4K5W A;  2EYO A;  1Y1V B;  2Q2I A;  1HTP A;  3VYU A;  2SOB A;  2UXB Q;  2ID0 A;  3PCO B;  2J7Z A;  1A3T A;  2JA7 H;  3D31 A;  2JP1 A;  5ELF A;  4NMZ A;  3H0G G;  1AH9 A;  2MO1 A;  4AIM A;  4DV7 L;  4KY5 A;  1R9T B;  3A5Z B;  1HZA A;  1YEZ A;  4ZYS A;  4J15 A;  1PFB A;  4N9T A;  3C2P A;  1XNQ Q;  2L1B A;  3OHX C;  3TP5 A;  1XPU A;  3PUW A;  3RZD H;  4H7B A;  4ODG A;  2EOT A;  4RA8 A;  4J1M A;  1SMY D;  2M9V A;  1BBX C;  3G7L A;  3PUX A;  4MNO A;  3ERS X;  4IUU A;  1L1O A;  3UDX A;  2NBF A;  4P2C B;  3EBE A;  1I6H B;  1ENF A;  1PXU A;  3ND8 A;  3J80 c;  1EFI D;  1D5X C;  1CT1 D;  3HOZ H;  1JCK B;  1E0B A;  1I4X A;  2KCN A;  4WJW A;  1CZW A;  2MUY A;  4ABN A;  4F87 A;  3TZU A;  4NXM Q;  4HSV A;  4DV3 Q;  1EY4 A;  1N32 Q;  2AUJ D;  2MHV A;  4K8I A;  4M8A A;  4HJ9 A;  2QW7 A;  3CRL C;  1KD1 C;  3I73 A;  3JAM i;  3I72 A;  1FNV A;  3E9H A;  4QUC A;  3NSW A;  4DAY B;  1KRT A;  1XJV A;  2IHF A;  2RDG A;  4ZUJ A;  1B53 A;  5IGE A;  2B2W C;  3S1R B;  4EQ5 A;  2EYM A;  3DMU A;  4X66 L;  3FMC A;  1PH4 A;  4NW2 A;  1WTR A;  2RDF A;  5ELE A;  2VQE L;  1XYI A;  3OWF A;  2JA7 G;  3CCV A;  2L11 A;  2NVY B;  2NVX B;  1S3O A;  3KF6 A;  1PRT C;  1Q12 A;  2RSN A;  1RKN A;  2Z6K A;  2K01 A;  5IOC A;  2UXB L;  2F4I A;  1X56 A;  1EU4 A;  3E3X A;  4OL7 A;  5J3B A;  4J8Q A;  1RD9 D;  1IKM A;  3OOC A;  1SYC A;  1SE2 A;  4C56 C;  3NXW A;  4L5T A;  5M5Y H;  1XNQ L;  4FXG C;  2YTV A;  3URY A;  1WTW A;  1JB3 A;  1L0W A;  2F3W A;  1LTA D;  2EJF C;  1WFQ A;  2NZH A;  4FF3 A;  2EE1 A;  5KRU A;  1KXL A;  1Z7T A;  1TU2 B;  2M00 A;  1AFP A;  3I55 A;  4NDX A;  1ONL A;  4QF4 A;  1YNX A;  4BS9 A;  4CHT B;  1OXS C;  2UU9 Q;  1W2B A;  4NXM L;  1LLR D;  4X62 Q;  3FPP A;  4DV3 L;  1SMX A;  3KFU A;  1ESR A;  1N32 L;  1J9O A;  1JJC B;  1W3S A;  3FRP B;  1B4O A;  1VQG A;  2XSC A;  3GTO B;  2H1E A;  1PTO B;  1BCP F;  2XRS D;  4ZK9 B;  1L1O B;  1QG7 A;  4X6A H;  1QNK A;  4DNT B;  2JA8 H;  5JJK A;  1LT3 D;  2IPK D;  4DR4 Q;  2F0O A;  5G3L F;  3EVQ A;  5KYL A;  5C3X A;  3T56 B;  4AQY Q;  4OIK A;  3KJP A;  1EY6 A;  3RNU A;  3D0F A;  2EXZ A;  2B2W A;  4X3U A;  4J6H A;  2OCE A;  3SHL A;  2KED A;  2F0W A;  1BOS A;  2EYL A;  1PH3 A;  2XIW A;  1SNC A;  3DWA A;  4A3K B;  2OQK A;  1H9S A;  1D6E C;  2PMZ E;  5TSS A;  4HJA A;  2EYP A;  2F0J A;  3PUZ A;  4IQZ A;  3PSI A;  1SN8 A;  4LUV A;  2F4V L;  2BE5 C;  4BBS H;  2KCT A;  1HJP A;  3ZJY C;  3HOZ B;  4M1U B;  3GTK B;  1EY8 A;  1I4G A;  4PNY A;  1I94 Q;  1M90 C;  1HA6 A;  3CKI B;  4K0K Q;  4PMC A;  3EFX D;  3T51 B;  1FD7 D;  4H02 A;  1F2Y A;  2CW0 C;  3A7A B;  1IW7 D;  2XWJ B;  3KF6 B;  4UAI A;  2A1A A;  4HJ7 A;  1EEI D;  3OWE B;  1ILQ A;  3VYR A;  1PH6 A;  1T9H A;  4LUZ A;  1U4R A;  4A3J B;  2KQ3 A;  1V1O A;  1KTK A;  2FJ2 A;  2G5D A;  4GN5 A;  2FIN B;  1QCB D;  3HFZ B;  2CWP A;  1K28 A;  2KEC A;  3NE5 B;  3W2D A;  1XWE A;  3KLS X;  1SFO H;  2UU9 L;  4A3B H;  2PW7 A;  3HOW B;  4H13 C;  5HUR A;  2JA8 G;  2EIF A;  3HOU B;  1X65 A;  4X62 L;  1O7Y A;  4B3S Q;  4DGZ A;  3MFY A;  3U58 A;  1X9N A;  3SK6 A;  1JB7 A;  1LT4 D;  4ZUI A;  1VF5 C;  1N9W A;  1CHP D;  1KDB A;  1MJC A;  3HKZ B;  2MQH A;  1X3E A;  5HGQ A;  5FO9 B;  1AZP A;  4DR4 L;  2CWA A;  2KHS A;  1SYB A;  3BYT B;  2MNA A;  3NBH A;  4AQY L;  4BBS G;  4C3H G;  1GKH A;  2JK8 A;  2VL6 A;  4N9P A;  2Y0S B;  2HHH Q;  1JC7 A;  2UXC Q;  2K5N A;  1G6P A;  5CV8 A;  5C4J B;  4CKB A;  1L0X B;  3GTL H;  5K36 H;  4HCE A;  1CA5 A;  2IJ0 A;  3BJU A;  3RN5 A;  1CM9 A;  4DNR B;  4DR5 Q;  2L12 A;  3SXH A;  3M3Y B;  4BWG B;  1QZH A;  2CHB D;  3S24 A;  1S5D D;  1I50 B;  4JI0 Q;  4A3G H;  4A3C H;  1I94 L;  1IBL Q;  2PW5 A;  3CC7 A;  1EYG A;  4FXD A;  4EVO A;  3K8A A;  4K0K L;  3R2I A;  2HDM A;  3TEH B;  2JN4 A;  4R4C A;  1QVF A;  1A0I A;  1CFM A;  1RIP A;  1SSO A;  2KUM A;  3S2D B;  4RCN A;  1A63 A;  4GKK Q;  3DLL A;  1CSP A;  3OIP A;  2KA7 A;  5COR A;  1CI3 M;  5LL6 X;  4B9X A;  3W3A A;  1U4M A;  5CR3 A;  4AH6 A;  5GAE C;  5M3F G;  3S14 B;  2PZW A;  4R4T A;  2F1M A;  3KYH C;  2VQF Q;  4ZQ3 A;  2IX3 A;  1WCM G;  3S2H H;  4JI5 L;  3UE1 A;  1PRT F;  1UUP A;  3KF8 A;  3FEW X;  4IUP A;  5ELC A;  3SE0 A;  1LT5 D;  4EQN A;  3CC2 A;  1DJR D;  2EXD A;  2A8V A;  1HFN A;  5FLX c;  4GNX C;  2K14 A;  2C35 B;  3A8K E;  2K50 A;  2UUB Q;  4B3S L;  3VR6 A;  2LY7 A;  1ZYR C;  1PYB A;  1F2M A;  3TSS A;  3Q6S A;  5CV9 A;  3TBI B;  5IT9 c;  4YCW A;  3CPF A;  2ICI A;  1Q90 A;  2R7D A;  1F9R A;  2KEN A;  2SEB D;  1WD1 A;  1TS3 A;  4RGM A;  1GUS A;  1UE5 A;  2R7F A;  2Z6B A;  1Y8N B;  5K36 G;  1BCP D;  2HQL A;  5IYC H;  1KNE A;  4RGO S;  4BY7 G;  1A2U A;  4KMU C;  4A3E H;  4KI0 A;  1D1I A;  4JI6 Q;  2HHH L;  1K0R A;  5EKK A;  3TRZ A;  1NUC A;  2PMZ B; 
#chains in the Genus database with same CATH homology
 2AWN A;  1Q7Y C;  2CQO A;  1ASY A;  2FXQ A;  4DR5 L;  1JJG A;  3GTK H;  1PH2 A;  1B8A A;  1E1T A;  2A19 A;  1U5K A;  1OXV A;  3MXN B;  1O7I A;  4R4O A;  2ZTE A;  2UUA Q;  4GKJ Q;  2JA6 H;  1VQI A;  1YIJ A;  4A3I H;  2E5L Q;  4JI5 Q;  3PO2 G;  3LGJ A;  1S72 A;  1WOC A;  3CCJ A;  1V9P A;  4JI0 L;  3H15 A;  1IBL L;  4QGU A;  1XTD A;  1IXR A;  2WAQ G;  4DR1 Q;  2RHQ B;  1XNR L;  4DK6 C;  3ICE A;  1VQJ A;  1HZB A;  1G51 A;  2ZTC A;  5M3F H;  1EWI A;  3NBH B;  4A75 A;  4A3F H;  2AMC B;  3S17 H;  4DR6 Q;  1IBK Q;  1SR3 A;  4DV6 Q;  2R6G A;  5FLM G;  1WCM H;  2R93 H;  3MEF A;  4JYA Q;  2YV5 A;  1YIT A;  2RF4 A;  1WJJ A;  4GKK L;  2VS1 A;  5IP7 H;  5IE8 A;  4JBM A;  4A3M H;  4LF5 Q;  1I3Q H;  1YZ6 A;  2ZJR A;  1VQP A;  4DV0 L;  3BU2 A;  4DV7 Q;  4A3J H;  3CQZ H;  3U4V A;  1HR0 W;  3E9I A;  2JA5 G;  2NN6 I;  3FKI G;  4LNQ A;  1M1K C;  3M7N A;  5BR8 L;  3S1R H;  5JEA G;  4DV4 Q;  4GNX B;  2Q2T A;  3CC4 A;  2VQF L;  1PV4 A;  4OXP A;  4JI4 Q;  3CCL A;  1JE5 A;  4DR3 Q;  4OO1 G;  1KHI A;  3ULP A;  3HOW H;  1AE3 A;  5GQO A;  3HOU H;  3H0G H;  4LF8 Q;  4LF6 Q;  1NMF A;  4NXN L;  2VW9 A;  4GN4 B;  2JE6 I;  4A3D H;  4HIO A;  1VQK A;  2NZO A;  5C0X I;  3STB D;  4P73 A;  2QEX A;  4LF7 Q;  4A4I A;  1HNW Q;  2WB1 G;  2UUB L;  2JQO A;  2KHJ A;  3K81 C;  3CMA A;  4BY7 H;  3AQQ A;  1VQD A;  1PYS B;  2DUD A;  4IPD A;  3JC6 6;  3NEN A;  4JI2 Q;  3WWV A;  2GN5 A;  1HNX Q;  4JI8 Q;  4OX9 L;  3RLO A;  4HJ5 A;  4B3M L;  3I7F A;  2IHE A;  3VDY A;  1K8G A;  1VQN A;  3F2C A;  2E2H H;  2XTI A;  1EIY B;  1V43 A;  4LF9 Q;  1XNR Q;  3HKS A;  4IPG A;  5DLQ E;  1VQO A;  3U4Z A;  3GTP H;  3HOZ G;  2OTL A;  3RR5 A;  3TRE A;  1EIF A;  3ER0 A;  5C4J H;  5IYB H;  1Y1W G;  4RG1 A;  1PFS A;  1Q1E A;  3KJO A;  1N8R C;  4JI6 L;  3J81 i;  4BBR G;  3E0E A;  3AFQ A;  2R7Z G;  2ZM6 Q;  1GVP A;  1JJ2 A;  2WFW A;  3M3Y H;  2Q2U A;  3RLN A;  1G29 1;  2CFM A;  3S15 H;  1VCI A;  4MZ9 A;  4WJ3 M;  4IFD G;  3T1H L;  4BY1 G;  1I50 H;  3G71 A;  4A3F G;  2I0Q A;  5C3E G;  2UUA L;  1K73 C;  1PH7 A;  4GKJ L;  3F1Z A;  1K83 H;  4X66 Q;  1OTC A;  2E5L L;  2XGT A;  3TS0 A;  2K75 A;  4GLX A;  1XMQ Q;  1SLJ A;  3BZK A;  2VQE Q;  5IP7 G;  3A0J A;  1JMC A;  4A3M G;  1YVC A;  3KDF B;  4JCV E;  2JA5 H;  1QZG A;  1S40 A;  3RN2 A;  1TWG H;  3S2D H;  3STB C;  3K7A H;  4DKA C;  3K80 C;  2ZTD A;  4DR6 L;  1NMG A;  2Q2I A;  4P71 A;  1IBK L;  3G4S A;  1A62 A;  4YCV A;  2UXB Q;  1H95 A;  4JYA L;  2ID0 A;  4C2M H;  3GTJ H;  4PZ7 A;  3F2D A;  2BH2 A;  3PCO B;  3CD6 A;  2HIV A;  2JA7 H;  3D31 A;  1ASZ A;  3HOY G;  4LF5 L;  3S14 H;  4UP9 A;  4APV A;  2IX0 A;  1PA6 A;  3HOU G;  3H0G G;  4P74 A;  3W1G A;  2MO1 A;  4UP8 A;  4AIM A;  3FHW A;  2D0O A;  4DV7 L;  1AH9 A;  3U50 C;  4IOA A;  3J81 j;  1QUQ A;  4GS3 A;  3A5Z B;  2B63 G;  1J5E Q;  4LFB Q;  4DV4 L;  1OXT A;  1PH5 A;  1HZA A;  1YEZ A;  4J15 A;  4HID A;  4JI4 L;  3A5U A;  1XNQ Q;  4DR3 L;  1LUZ A;  3IRB A;  2R92 G;  3S1Q H;  4TQU S;  4OO1 I;  1XPU A;  3PUW A;  3RZD H;  3HKZ G;  4LF8 L;  4YCU A;  2BA0 A;  4LF6 L;  2DGY A;  1VQC A;  2RCN A;  5C44 G;  5M5X H;  3PF5 A;  3PUY A;  1LTL A;  3PUX A;  4MNO A;  3G6E A;  3ERS X;  3UDX A;  1L1O A;  2N3S A;  3CW2 C;  4UY8 C;  4ALP A;  4LF7 L;  3I4M G;  3EBE A;  4AYB E;  5IWA Q;  1HNW L;  4EX5 A;  3J80 c;  4HJ8 A;  3T1H Q;  3HOZ H;  1E1O A;  4GN3 B;  3UDI A;  2Y0S G;  3CP0 A;  3F2B A;  1Y1W H;  3I2Z A;  2KBN A;  2LXJ A;  3Q8D A;  3GTG H;  1N33 Q;  4P72 A;  1V1Q A;  5E7N A;  5IYB G;  2LSS A;  4JI2 L;  5ELN A;  1HNX L;  4JI8 L;  5IYD G;  4BBR H;  2GVB A;  1B70 B;  4NXM Q;  2R7Z H;  3CCS A;  2HT1 A;  2F3I A;  4O2D A;  1C9O A;  4DV3 Q;  4LF9 L;  3TRZ A;  3T1Y Q;  1N32 Q;  4BY1 H;  1EOV A;  4LFC Q;  4MTN A;  1X3F A;  5C3E H;  4A3L H;  5JJI A;  4HJ9 A;  1KD1 C;  4KHZ A;  3ULJ A;  3JAM i;  1HNZ Q;  3E9H A;  4HIM A;  1XMO Q;  4PMW A;  3RLF A;  1X6O A;  3CCU A;  1Q86 C;  1VQ7 A;  4B3T Q;  1BBW A;  1SE8 A;  4DAY B;  1KRT A;  4YWK A;  3UE0 A;  2IHF A;  2ZM6 L;  1XJV A;  1Q82 C;  3CCR A;  1YHQ A;  1MJE A;  5IP9 G;  5C4X H;  2K5V A;  4IFD I;  4A93 H;  1VQ8 A;  4EQ5 A;  3M4Q A;  2VZA A;  4X66 L;  3G48 A;  4GOP A;  4LF4 Q;  1LYL A;  3J7A 5;  1PH4 A;  3L0O A;  5AJ3 Q;  1L1O C;  2VUM H;  4A3K H;  3HOY H;  4HIK A;  1BKB A;  1XMQ L;  1TWC H;  4DPG A;  2VQE L;  2JA7 G;  4DNI A;  3S16 H;  2AWO A;  3W1B A;  3M85 A;  4JOI A;  4X65 Q;  3CCV A;  1S3O A;  3KF6 A;  2K5H A;  1Q12 A;  2B63 H;  3OYY A;  1IBM Q;  2Z6K A;  1KC8 C;  3RZO H;  3PF4 A;  4LW1 A;  3HOV H;  2UXB L;  2R92 H;  1EQR A;  1Z9F A;  2D0P A;  2ZJQ A;  1OXU A;  1X56 A;  2NVT H;  2PQA B;  2WAQ E;  1GM5 A;  4JBK A;  2B29 A;  1K3R A;  5C44 H;  2JEB I;  4A76 A;  2IX1 A;  1FVI A;  5J3B A;  4B3R Q;  1VS0 A;  2F52 A;  4LFB L;  1J5E L;  3I4M H;  3CCQ A;  2B3G A;  1D7Q A;  1XNQ L;  4L5T A;  5M5Y H;  2Z0S A;  4IJL A;  1VQE A;  2IT1 A;  2YTV A;  4LUO A;  1FJG Q;  3CPW A;  2MO0 A;  4DUZ Q;  1L0W A;  2ALY B;  1WYD A;  3S1N H;  2YTX A;  2NZH A;  1WFQ A;  1TXY A;  5IYD H;  1KRS A;  5C0X J;  4GOP C;  1KXL A;  1EUJ A;  1HH2 P;  3J7Z C;  1XPR A;  1UE6 A;  2V1C C;  5IWA L;  3EN2 A;  3I55 A;  2PQA A;  3PUV A;  1TWA H;  4L5R C;  4JOI C;  4TVA B;  4LFA Q;  2IY5 B;  1YNX A;  3PO3 G;  4A3L G;  4QQB X;  4P75 A;  1PH9 A;  1OXS C;  4IPC A;  1N36 Q;  1QUQ B;  1N33 L;  1JT8 A;  3CCM A;  2UU9 Q;  2Z6K C;  1Q1B A;  1W2B A;  2JJQ A;  1LM0 A;  4O0A A;  4NXM L;  4QJF A;  1HZC A;  4X62 Q;  2WB1 E;  5IP9 H;  1SMX A;  4DV3 L;  1NE3 A;  4OWX B;  3T1Y L;  3KFU A;  1N32 L;  3GD7 A;  1JJC B;  2E8G A;  1W3S A;  5C4X G;  3PGZ A;  3CAM A;  3K7U C;  1YBY A;  1VQG A;  4R1J A;  4LFC L;  4A93 G;  1QVC A;  4JI1 Q;  1SRU A;  3AEV A;  1HNZ L;  1L1O B;  1XMO L;  4JG2 A;  2VUM G;  4X6A H;  4A3B G;  2JA8 H;  4B3T L;  5JJK A;  5HY6 A;  2E2J H;  4DR2 Q;  4ME3 A;  4DR4 Q;  1Q81 C;  3OW2 A;  4JI3 Q;  4XIG S;  3UDF A;  4X64 Q;  4DV2 Q;  4JI7 Q;  4AQY Q;  1IL2 A;  4LF4 L;  3HOV G;  1VQH A;  5AJ3 L;  4YHH Q;  3KJP A;  4DAM A;  4OWT B;  3RNU A;  1Y1V H;  3D0F A;  4IOC A;  2OTJ A;  1NBW A;  1HZ9 A;  4X65 L;  2OCE A;  4DV5 Q;  1BBU A;  3F8T A;  1PH3 A;  4WJ4 A;  4QY7 A;  1UE7 A;  2OQK A;  1DGS A;  1QVG A;  2PMZ E;  1IBM L;  2CCZ A;  2UXD Q;  3HOX H;  1VQ5 A;  4HJA A;  3H3V H;  3PUZ A;  4LUV A;  2ES2 A;  2F4V L;  3PSI A;  1SN8 A;  1VQA A;  4BBS H;  1YJ9 A;  5LMU Q;  2KCT A;  5M5W H;  1HJP A;  3ZJY C;  2UUC Q;  1FGU A;  2I5L X;  1R9T H;  5GAH C;  1N34 Q;  5FJ8 H;  2GVA A;  1I94 Q;  4DUY Q;  2VNU D;  1CKN B;  2K4K A;  3M4P A;  1HR0 L;  4UPA A;  3ULL A;  1M90 C;  1VQB A;  4K0K Q;  1A8V A;  4B3R L;  4GOP B;  3FP9 A;  2AKW B;  4H02 A;  1C0A A;  2JEA I;  5JEA J;  1VQ4 A;  4BXX G;  4RMF A;  1YHB A;  3K0X A;  4IJH A;  2N78 A;  3H3V I;  1KIX A;  3PV0 A;  3L2P A;  4Y7N H;  1KL9 A;  1CKM A;  2MFI A;  3M4O H;  3PO3 H;  3KF6 B;  1FJG L;  3OTO Q;  4A3G G;  4DUZ L;  1EQQ A;  3I4N G;  2A1A A;  1TWF H;  2RHS B;  5LMN Q;  4HJ7 A;  4YY3 Q;  1C7Y A;  4A3C G;  4JV5 L;  1I6H H;  1UEB A;  1PH6 A;  1VQ9 A;  4OON A;  2YYZ A;  1E22 A;  4JBW A;  1T9H A;  4LUZ A;  4Y52 H;  1OXX K;  4L5S A;  4JBJ A;  1CKN A;  1K9M C;  3JAM c;  5M3M H;  1CSQ A;  2D62 A;  4GN5 A;  4LFA L;  4BA2 I;  4L5Q A;  3HKZ E;  5EAY A;  3HFZ B;  4C3J H;  1AE2 A;  3I56 A;  2Q2H A;  2CWP A;  1MIU A;  5GAG C;  1N36 L;  3S1M H;  1SFO H;  1NJI C;  1VQM A;  1D8L A;  2UU9 L;  4A3B H;  2LXK A;  3AFP A;  4IPH A;  5GAD C;  3CF5 A;  1E3P A;  1P8L A;  2JA8 G;  1Y14 B;  2EIF A;  1X65 A;  4X62 L;  1KQS A;  4POF A;  4B3S Q;  2OQ0 A;  2OWO A;  2Y0S E;  4YWM A;  4YWL A;  3U58 A;  1X9N A;  1P16 A;  4DV1 Q;  2I5M X;  1JB7 A;  4JI1 L;  2F4V Q;  1N9W A;  1MJC A;  4DR7 Q;  4KHP Q;  2MQH A;  1Y1V G;  1X3E A;  5HGQ A;  5ELO A;  4DR2 L;  1HR0 Q;  3DM3 A;  1KAW A;  1UWV A;  1YJW A;  3M9B A;  4DR4 L;  2CWA A;  3CXC A;  4JI3 L;  4IFD J;  2YTY A;  4X64 L;  4NPS A;  1E24 A;  2MNA A;  4DV2 L;  3HOX G;  3CCE A;  2NVY H;  3A74 A;  4PG3 A;  2BA1 A;  4AQY L;  2NVX H;  4PZ8 A;  4JI7 L;  4BBS G;  1RL2 A;  1GKH A;  2JK8 A;  2VL6 A;  2L15 A;  3GDE A;  4YHH L;  2HHH Q;  2VY3 A;  2UXC Q;  1G6P A;  2K5N A;  1YHA A;  2ZJP A;  5FJ8 G;  3GTL H;  4DV5 L;  1WI5 A;  4JV5 Q;  3BJU A;  3RN5 A;  1IYJ B;  4DR5 Q;  4JC0 A;  3GTQ H;  1MKH A;  4GLV B;  5IYC G;  4BXX H;  1E7Z A;  2N8N A;  2HIX A;  4R4Q A;  2ASB A;  4QIW E;  2UXD L;  4LWC A;  5GRO A;  4A3E G;  1QZH A;  5LMU L;  3PIO A;  4GNX A;  3S24 A;  2UUC L;  3KOJ A;  4OWW B;  2CKZ B;  3J81 c;  4A3K G;  1N34 L;  4JI0 Q;  4A3G H;  4A3C H;  3KLW A;  4DUY L;  1I94 L;  1IBL Q;  3I4N H;  1X3G A;  3NEM A;  3CC7 A;  1EYG A;  3GO5 A;  2QA4 A;  3KF8 B;  2WP8 J;  3K8A A;  1SRO A;  4K0K L;  3TQY A;  3TEH B;  5JJL A;  2PI2 E;  5H1S E;  4R4C A;  1VQL A;  1QVF A;  3L7Z C;  1A0I A;  3PO2 H;  4KLK A;  1RIP A;  2EQS A;  1UE1 A;  1XPO A;  2JA6 G;  2ATW A;  3W5O A;  4A3I G;  1PH1 A;  1PH8 A;  2KHI A;  4GKK Q;  1A63 A;  3DLL A;  1CSP A;  5M3M G;  1BVS A;  3OTO L;  4DV0 Q;  2N49 A;  5LMN L;  1J6Q A;  3B6Y A;  4YY3 L;  2NN6 G;  4AH6 A;  1GO3 E;  5GAE C;  2H5X A;  1EFW A;  5M3F G;  1IZ6 A;  5BR8 Q;  4R4T A;  1Z47 A;  4DK3 C;  5IY0 A;  5FLM H;  3KYH C;  4QL5 A;  1K8A C;  2VQF Q;  4AYB G;  3GTM H;  1WCM G;  4C3I H;  1FL0 A;  4JI5 L;  3S2H H;  3UE1 A;  2R93 G;  3EIV A;  4FDB A;  4BA1 I;  1L2F A;  3NEL A;  4PZ6 A;  4NB3 A;  4DR1 L;  1VQF A;  4NXN Q;  4XTC S;  3FKI H;  4A3J G;  5C0X G;  3CC2 A;  1Q8K A;  3CME A;  2EXD A;  2A8V A;  3GTO H;  5FLX c;  4GNX C;  2K14 A;  3PIP A;  2C35 B;  2AHO B;  4DV6 L;  1VQ6 A;  2K50 A;  2UUB Q;  4B3S L;  1YJN A;  1NY4 A;  4POG A;  2KCM A;  1YI2 A;  1PYB A;  4IO9 A;  4DV1 L;  3HOW G;  2PNH A;  4C3H H;  5IT9 c;  1CUK A;  4OX9 Q;  4YCW A;  2YU9 H;  3CPF A;  2R7D A;  4B3M Q;  4DR7 L;  4A3D G;  4KHP L;  2K52 A;  2KEN A;  1B7Y B;  1TWH H;  3UDG A;  1Q46 A;  2JA9 A;  4UP7 A;  2PI2 A;  1UE5 A;  2R7F A;  3AYH B;  3I4O A;  1PVO A;  5K36 G;  1X55 A;  1X54 A;  2HQL A;  3KDF A;  5IYC H;  2E2I H;  1CKO A;  2I5H A;  4BY7 G;  3BZC A;  2QGQ A;  4R4I A;  4A3E H;  4KI0 A;  3J80 i;  3SGI A;  2BH8 A;  2NVQ H;  1I5F A;  4JI6 Q;  1U0L A;  5LMN W;  2HHH L;  1K0R A;  1NTG A;  1PHJ A;  2UXC L;  3TS2 A;  4GLA C;  1GD7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...