2WB1G

The complete structure of the archaeal 13-subunit dna-directed rna polymerase
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
113
structure length
113
Chain Sequence
KAQEIILSCEINSIERGSLKNLSIIHMSCNDFNISFDIIDSINIFSQKEKVKAFISKNRLSYTNDDFCGHGYIVTELKDSSSNNGNRYITIISLFGLLVKIISNKESFLKIHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE RPO1N SUBUNIT
publication title Evolution of Complex RNA Polymerase: The Complete Archaeal RNA Polymerase Structure
pubmed doi rcsb
molecule tags Transcription
total genus 12
structure length 113
sequence length 113
chains with identical sequence V
ec nomenclature
pdb deposition date 2009-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF16992 RNA_pol_RpbG DNA-directed RNA polymerase, subunit G
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2wb1G00
1SE8A 2Z0SA 1IZ6A 2LXKA 5C4XG 1Z9FA 3K8AA 1K3RA 4KHPQ 3CPFA 4IFDI 2D62A 1XPOA 3ULPA 3I7FA 3F2BA 2OWOA 3KJOA 4P71A 5E7NA 3DM3A 2JA8H 4DV4L 4X6AH 3I4MG 3JAMi 4GKJL 1VQ5A 2VY3A 1YITA 2R7FA 2HHHQ 3HKZG 1FGUA 3G48A 4NPSA 3S24A 2R6GA 4A3MG 4A3LG 4K0KL 4HJ9A 1YJNA 5GAGC 2B63H 1Q1BA 4JV5L 4JYAL 3UE0A 2Z6KA 1X65A 5FJ8G 4LWCA 3CQZH 4JI3Q 1UE1A 3F8TA 4HJAA 3CMAA 1TWFH 3K0XA 1N34L 1XNQQ 4DR3Q 3KJPA 1KHIA 5C0XJ 1KIXA 4OWWB 3A5UA 1XMOL 4NXNL 1R9TH 1OXTA 5FLMG 1K9MC 4LNQA 4DKAC 3D31A 2VQEL 1A0IA 1SR3A 1Q7YC 4A93H 3DLLA 1N32L 4BBRG 4IJHA 2IHEA 1HR0W 3W1BA 4B3ML 4WJ3M 1IBKL 4UPAA 2NN6I 3GTMH 2WAQE 3CCMA 1P16A 1HZBA 3GO5A 1EYGA 1JMCA 2V1CC 5ELOA 5M3FH 4IPHA 4DR2Q 4GLXA 1XMQL 1QUQA 4JG2A 2IX1A 1SLJA 4JOIC 1AE3A 1PV4A 1NY4A 1V43A 3CCQA 5IYDG 4H02A 5IP9G 4BBSG 4DUYQ 4OO1G 4JBWA 4GOPC 2ZTEA 4Y52H 2AHOB 1VQDA 4JI6Q 4RG1A 2F3IA 4PZ7A 3J81j 3T1HQ 4JI1Q 3RR5A 2OQKA 3CMEA 2HIXA 3PO3H 3MXNB 1Q1EA 2K14A 4YWKA 2HQLA 4B3RQ 5GROA 4DK3C 4IPGA 2ZJRA 1OTCA 3F2DA 1C7YA 2JA6G 4O2DA 3I4NH 1HNWL 3LGJA 4X64L 1PH2A 1N33L 1VQ6A 4A3FH 1X3EA 1C9OA 2UXDQ 4YY3Q 5DLQE 2UXCL 4HIOA 2WP8J 3CCLA 5FJ8H 1Y14B 4MNOA 3K7UC 2NVXH 1QZGA 1KXLA 3KLWA 3M4OH 4AQYL 2WB1G 1E1TA 1I94Q 4DV3L 3CF5A 4LF7L 5FLMH 4X66Q 1EUJA 2LSSA 4LFAQ 4JI8L 4J15A 2ZM6Q 4A76A 1J5EQ 4GKKL 1RIPA 2E2JH 3HOZG 5JJLA 4BBRH 3G71A 1IBMQ 4OX9L 3TS2A 4JI7Q 2N49A 4DV6L 1E24A 1C0AA 2KCTA 4NB3A 4P75A 3TQYA 1PYSB 4PG3A 4DAYB 3RLNA 3UDIA 4DUZL 3U4VA 3S1RH 1KL9A 1VQNA 1HR0L 3I2ZA 3UDGA 4OWTB 1VQMA 4DR4L 1VQOA 4DPGA 4DV2L 4BBSH 1NMGA 4DR6Q 1E3PA 1KRSA 1K83H 5M3MH 1JB7A 4LFBQ 4IFDJ 2UUAQ 3S14H 1KRTA 4OO1I 5C3EH 1JT8A 1PFSA 4POFA 1PH4A 4Y7NH 2YU9H 1JJCB 1I6HH 3J7ZC 2WAQG 1Q86C 1L1OA 3S17H 2DUDA 3OTOL 2N8NA 3KDFB 4A4IA 3E9IA 2YV5A 4YCVA 4KLKA 2JA6H 1XPUA 4DV7Q 3RLFA 2ES2A 3S15H 1B70B 3S2HH 1QVFA 4GLAC 1IBLL 1MIUA 5H1SE 1IYJB 4A93G 5GAEC 1Y1VH 2GVAA 2EXDA 5JJKA 1U0LA 3AQQA 2LXJA 2PMZE 4LW1A 1PH1A 2Z6KC 4A75A 1UE7A 2UXBL 3NBHB 2NZOA 2Y0SE 4X65L 5M3FG 3FKIH 1FJGL 3HOZH 1I5FA 2R92G 4GN3B 3CCJA 1NTGA 3CCSA 2YTYA 1XJVA 3MEFA 2HT1A 3PSIA 1G51A 2ZJQA 1IL2A 2DGYA 1E1OA 2EIFA 1N8RC 3EN2A 3S1QH 2GVBA 2KENA 4A3KG 2Q2HA 4HJ8A 3PO3G 4YHHQ 1IXRA 4KHPL 4L5QA 4JI0Q 4JI2L 4GN4B 4B3SQ 1QVCA 3F2CA 1HNZQ 3I4NG 5LMUL 4LFCQ 5C44H 1MKHA 2JJQA 4X62Q 1OXUA 4A3IG 2K5NA 2B3GA 2ZTDA 2RCNA 1TXYA 2K5VA 4A3FG 1CKNA 1K8AC 3HOUH 1Q81C 3HOWH 4HJ5A 4LUVA 1NE3A 4JCVE 1LTLA 4GNXA 4JI3L 3PO2G 2MFIA 3NENA 1XNQL 1VCIA 2D0OA 3T1YQ 3A5ZB 4XTCS 3PF5A 3CC4A 1L2FA 3KF8B 2YTVA 5M5WH 5IY0A 2Q2TA 3K81C 4GLVB 4LUOA 1M1KC 2JA5H 1MJEA 5LMNQ 3G4SA 4LF8Q 1VQFA 2NVTH 1D8LA 1Q12A 1K8GA 4LF9Q 4P74A 4JYAQ 3GDEA 1GD7A 1EWIA 2JA9A 3HKSA 4MZ9A 4BA1I 4R4CA 1PA6A 1H95A 2RF4A 3PUYA 3RN5A 3PF4A 4BXXG 4HJ7A 5GADC 4LF5Q 1UEBA 1LUZA 5AJ3L 4GOPB 2RHSB 2VZAA 1XMOQ 4QY7A 3G6EA 4DR2L 2NVYH 3NEMA 3GTOH 2PQAB 1SN8A 4OWXB 1S3OA 1N36L 1GO3E 2E5LQ 2R92H 3S1MH 2MQHA 5M3MG 2MNAA 4BY7G 2VQEQ 4GS3A 1YZ6A 2I0QA 1PH6A 1N32Q 1TWAH 2QGQA 5C3EG 2VW9A 4DUYL 4DR1Q 4A3EG 1YJWA 4LF4L 1A63A 2OTJA 5K36G 1G6PA 1CSQA 4A3KH 1BBUA 3T1HL 1SMXA 4JI1L 1D7QA 4EQ5A 3KOJA 3RN2A 3BZKA 4FDBA 2L15A 4IPCA 5GAHC 1EIFA 5IP7H 1X3GA 2A19A 2ALYB 2Y0SG 4IOAA 5IYCG 4DR5Q 4IPDA 1FVIA 2KBNA 4A3IH 1VQ9A 3M9BA 3M4PA 2B29A 5C4XH 3U58A 1VQEA 3OW2A 1Y1VG 2PI2A 3ZJYC 4C3IH 5EAYA 4P73A 4YY3L 2VS1A 3RZOH 1XPRA 3PO2H 1VQGA 3FHWA 2ZTCA 1FL0A 1KAWA 1L1OC 1CKOA 4UP8A 1TWHH 1BBWA 3GTQH 2OTLA 3FKIG 1DGSA 2IY5B 3STBD 4X66L 2ZM6L 2CWAA 1HNWQ 4X64Q 4MTNA 4JI5L 4AYBE 2E2IH 2CQOA 4DK6C 1VQ8A 1S40A 3ULLA 1IBML 4AH6A 2MO0A 2UUBL 4NXML 2KHJA 4JI7L 3W5OA 2AKWB 2ID0A 2JEBI 3RNUA 4BXXH 1YBYA 2OQ0A 2BA0A 4KHZA 4AQYQ 3BZCA 4C2MH 4DAMA 1VQAA 3F1ZA 1VQLA 1L0WA 4JI4Q 4LF7Q 1X6OA 3NELA 4QIWE 4R4TA 5JJIA 2A1AA 1X54A 4JI8Q 1UWVA 4JOIA 4AIMA 4BY7H 5BR8Q 4B3TQ 1YIJA 4R4OA 2VQFL 4DR6L 4A3EH 3PV0A 3EIVA 4ALPA 3HKZE 3E9HA 5C44G 1VQPA 3OYYA 2ASBA 4A3JH 2UUAL 4DV6Q 1B8AA 3GTKH 3HOUG 3HOWG 4GN5A 4A3DH 4IOCA 3J81c 1HR0Q 4POGA 4UP9A 4OXPA 5IYCH 4DV1L 1XNRL 5JEAG 1UE5A 4DR7Q 1YNXA 1QZHA 2JQOA 4A3BG 1BVSA 4DV0L 4A3GG 2JA5G 1V1QA 2E2HH 3H3VH 4LF6Q 5IWAL 1PH9A 1HNXQ 1CSPA 4YCUA 2F52A 5JEAJ 3TRZA 2UU9L 1YHAA 1X9NA 4RMFA 4GKJQ 3S1NH 4GNXC 1VQBA 2FXQA 1WFQA 3B6YA 2AMCB 1WCMG 4C3JH 2F4VL 5IYBG 3GTGH 2R93G 1Y1WG 4JC0A 4EX5A 3AFQA 3M4QA 2XGTA 1QUQB 3CD6A 2UUCQ 2KHIA 1K0RA 3TREA 2EQSA 3W1GA 1E7ZA 3AFPA 4APVA 1W2BA 5IP7G 3S2DH 1I3QH 4HIKA 4OONA 1YJ9A 2JA7G 2HIVA 2JK8A 4B3SL 1GVPA 2I5LX 2K5HA 2RHQB 2PNHA 3IRBA 4YCWA 4DV5Q 3AEVA 1SROA 1HNZL 3M3YH 4AYBG 4IO9A 2OCEA 4LFCL 1SRUA 3UDFA 3Q8DA 3PGZA 3TEHB 4X62L 1A62A 1Q46A 3I55A 3CPWA 3J80c 1OXSC 2AWOA 2JE6I 4KI0A 1X56A 3L7ZC 3E0EA 4C3HH 3ICEA 2WB1E 1PH3A 1WJJA 2KCMA 4PZ6A 4YWMA 4DV4Q 1XTDA 4JI2Q 4DR3L 3J81i 2E8GA 1TWGH 1EFWA 1Q8KA 1CKMA 3K7AH 2BH2A 1WOCA 4A3BH 1MJCA 3M7NA 4A3GH 3T1YL 1HZ9A 1BKBA 3KDFA 4K0KQ 5LMUQ 3I56A 2NVQH 4JV5Q 1V9PA 1Z47A 1N9WA 3HOXG 1VQIA 3HFZB 2QA4A 1B7YB 5C0XG 5LMNL 4LF8L 2H5XA 4LF9L 4HIMA 3KYHC 3A74A 1HZCA 3PIOA 1N34Q 2CFMA 3JC66 4LUZA 3SGIA 3PIPA 1AE2A 5C4JH 3PUVA 1HJPA 2YYZA 3TS0A 4LF5L 4NXNQ 3HOYG 1WCMH 4R4IA 1YI2A 5IYBH 2R93H 3FP9A 1Y1WH 4L5RC 1OXXK 1HZAA 2E5LL 4B3MQ 1G291 2IX0A 1IBKQ 1OXVA 1JE5A 2CWPA 4A3JG 1SFOH 1WI5A 4ME3A 4DR1L 4JI6L 4UY8C 3H0GH 2VUMG 2K75A 1YHQA 1EQRA 4BA2I 4A3DG 2K52A 4IJLA 1M90C 2IT1A 4WJ4A 4TVAB 2C35B 3CCEA 2ATWA 1NMFA 4YWLA 1XMQQ 3HOVG 5AJ3Q 2JA7H 1ASYA 1YEZA 1VQKA 1NJIC 1JJ2A 3S16H 5HY6A 1O7IA 2MO1A 4B3RL 5ELNA 2K4KA 1N36Q 3WWVA 4DR5L 3AYHB 3CCUA 1ASZA 1LM0A 1VQ4A 3PUXA 4PZ8A 2VL6A 4TQUS 2YTXA 2I5HA 1L1OB 4LF4Q 2UXDL 3PUZA 3KF6B 3M85A 1VQJA 4BY1G 1VQ7A 3J80i 3CCRA 3D0FA 1PVOA 3UDXA 1PH7A 1A8VA 2CCZA 4JBKA 1EOVA 3CAMA 1WYDA 1I94L 1CUKA 5GQOA 3RLOA 3I4MH 3GTJH 1JJGA 2NZHA 1VS0A 5J3BA 1J5EL 2BA1A 2XTIA 4LFAL 3PCOB 3L0OA 2AWNA 1N33Q 3GD7A 1YVCA 5IE8A 1J6QA 3HOXH 4A3LH 4A3MH 4QQBX 2A8VA 3A0JA 2QEXA 2UXCQ 5C0XI 1NBWA 1QVGA 2PI2E 3EBEA 2HHHL 4R1JA 1PHJA 2D0PA 1EQQA 2GN5A 1PYBA 4DNIA 4A3CG 1AH9A 3BU2A 4DV3Q 2R7ZG 1Q82C 3HOYH 1S72A 3U4ZA 1T9HA 2CKZB 1KD1C 4JI4L 4GKKQ 1X55A 4R4QA 2N3SA 1I50H 3GTPH 4GOPA 1VQHA 5M5YH 4OX9Q 5BR8L 4LFBL 4JI5Q 4B3TL 4P72A 2I5MX 2PQAA 1VQCA 1RL2A 2UUBQ 4NXMQ 2VUMH 3U50C 3STBC 3UE1A 4DUZQ 2Q2UA 3HOVH 2ZJPA 4HIDA 3CC7A 4IFDG 3VDYA 4DR4Q 5LMNW 1PH5A 3JAMc 4DV2Q 3L2PA 1LYLA 3CW2C 4DV7L 2VNUD 2JA8G 1CKNB 1YHBA 5IYDH 5IP9H 2VQFQ 4DR7L 5HGQA 3RZDH 1U5KA 3H3VI 5FLXc 1KC8C 1E22A 4QGUA 4GNXB 4BY1H 5M5XH 3ER0A 3CCVA 1GKHA 1KQSA 1HNXL 1EIYB 4LF6L 2B63G 5IT9c 4UP7A 3OTOQ 2Q2IA 1W3SA 1HH2P 3I4OA 3CP0A 4QL5A 1UE6A 4DV1Q 1XNRQ 4PMWA 3KF6A 4L5TA 1IBLQ 2K50A 4O0AA 3J7A5 4QJFA 1PH8A 4L5SA 3ERSX 4DV0Q 3H15A 1P8LA 3ULJA 5IWAQ 3KFUA 1TWCH 2JEAI 3GTLH 4JBJA 4A3CH 2UU9Q 3H0GG 2NN6G 1X3FA 2R7ZH 2WFWA 2BH8A 2N78A 4JBMA 2UXBQ 3K80C 4X65Q 2UUCL 4YHHL 2IHFA 1FJGQ 2R7DA 4JI0L 1K73C 1GM5A 3CC2A 4XIGS 3CXCA 2F4VQ 3PUWA 3BJUA 4DV5L
chains in the Genus database with same CATH superfamily
2LXKA 1Z9FA 3VYRA 4IFDH 4JPBW 1OO9B 2MJ8A 5JPMC 3ULPA 3LWUA 4HR7B 1JQYD 3TP8A 3KJOA 2Z9HA 2L12A 4I7ZC 1SAPA 3JAMi 1QG7A 1VQ5A 2R7FA 1EY8A 1FGUA 1PZKD 5L37A 1G8ZD 1W6KA 1SYGA 1Q1BA 4Q0FA 4JYAL 1CQFA 2Z6KA 5FJ8G 3DMUA 3CQZH 1ESRA 3CMAA 3BG3A 2DJGC 5FO8B 1KNEA 4M8AA 4J1MA 1OXTA 4LNQA 2N88A 1Q7YC 4A93H 3DLLA 1N32L 1WTHA 2NN6H 5JAVA 1DCZA 2JN4A 1EU4A 2Z4HA 2F0OA 1JOOA 2E2JB 4GLXA 1QUQA 4JG2A 4JOIC 1AE3A 1NY4A 1J9OA 3CCQA 4H02A 4LK1C 4BBSG 4DUYQ 1O7LA 4JBWA 2C9OA 4Y52H 1B44D 3O13A 3S1RB 2OQKA 1ESFA 2HIXA 2A6HC 4HMJA 3MXNB 4BBSB 1LT4D 1TS3A 5M3MB 3TZDA 5EGTA 5KNBA 1HUMA 1BF4A 4ABNA 1V8QA 4O2DA 1HNWL 3LGJA 2LY7A 1JCKB 1VQ6A 3NSWA 1C9OA 4YY3Q 5DLQE 2H4OA 3K58A 4HIOA 5FJ8H 1O80A 1R4PB 4AQYL 1E1TA 3AB9A 4X3UA 3RUZA 1EUJA 4J15A 1J5EQ 4GKKL 1D5XC 2E2JH 5JJLA 3FPUB 3G71A 1WTVA 4JI7Q 4PMBA 1E24A 4P75A 3TQYA 5CV7A 5FKAC 1PYSB 3M7GA 3EA6A 4PG3A 1GUWA 4DAYB 3U4VA 4TSSA 3S1RH 1VQNA 1HR0L 3I2ZA 3PIO3 2RVLA 2F0DA 4BBSH 4DR6Q 1KRSA 5M3MH 4OO1I 2NB0A 4QMGA 1PH4A 1AFPA 1JJCB 2RCFA 1Q86C 3OTOL 1IYUA 2KCCA 2B2WA 4A4IA 1PTOF 1EFID 3HOWB 1BCPC 5FOBB 1IYJB 3X3NA 3IL8A 1SYFA 5CORA 5FO7B 2PO4A 1PTOB 1EL0A 3T4AC 3VR5A 3UI2A 3BDOA 4O1NA 2R92G 1DOLA 1NTGA 2YTYA 1G51A 1F77A 1N8RC 1F9SA 3K5MA 3V05A 4FF4A 1FNVA 4H7BA 4KHPL 5DEHA 1F9PA 2R92B 1IHZA 4K5XA 4HN7A 4L5QA 1TWAB 2EYPA 1WTXA 3NK9A 5LMUL 1WTRA 1CKNA 4CKEA 1Q81C 3HOWH 4HJ5A 2B2VC 4GNXA 4JI3L 1AZPA 3NENA 3FPPA 1XNQL 3LWEA 3T1YQ 1PTOH 3A5ZB 1ZYRD 5COYA 3Q0AA 3KF8B 2YTVA 1EZ6A 4FVMA 3C46A 2PZWA 1VQFA 1K8GA 4LF9Q 1AP0A 4BA1I 3U9SA 1H95A 5IOCA 1XXGA 5GADC 5AJ3L 2RHSB 4OELB 3G6EA 4DR2L 2F3WA 2CH4A 2R92H 1GO3E 4BY7G 2VQEQ 1YZ6A 1TWAH 1A63A 4LF4L 1YJWA 2OTJA 3MFGA 3SHLA 1G6PA 4H44C 1SMXA 4EQ5A 3BZKA 2L15A 4BY7B 2WINB 2A19A 2ALYB 2O5IC 5IYCG 1RCVD 4DR5Q 4RKLA 2K01A 1VQ9A 3U58A 3GTKB 5C4ZA 5EBCA 3OW2A 2PI2A 3ZJYC 4NW2A 1H9SA 2LFNA 4R8IA 1BOSA 2E2HB 1DGSA 3STBD 4CJ0B 2CWAA 2XWJB 3A8JE 2HQEA 4X64Q 4MTNA 4AYBE 4DK6C 2K32A 2UUBL 1F2LA 1I4HA 2KHJA 3T51B 3W5OA 5I6YA 2ID0A 2JEBI 4KHVA 2BA0A 2EVBA 3SK4A 4C1NI 1GHKA 4JI4Q 1L0WA 3VR3A 4R4TA 3GTGB 5JJIA 3ERQA 1X54A 1BCPF 1D5ZC 1UWVA 4Z9CB 1K3BC 4B9WA 4BY7H 1SMYD 4B3TQ 3KLRA 4ALPA 3E9HA 3OYYA 4DV6Q 3GTKH 4JK1C 3SVMA 3S2DB 1UNSA 2K03A 1PLFA 1BCPB 1Q90A 3J81c 2IX3A 4POGA 3I91A 4OXPA 5IYCH 5JEAG 2EJMA 1UE5A 3M4YA 1YNXA 1QZHA 3MWYW 4A3BG 2JA5G 2E2HH 1PZID 4LF6Q 1PH9A 4C3HB 2A5HA 5JEAJ 2K5WA 5C6AA 3K7AB 4A3BB 5C5MA 4C1NK 2FXQA 1RHPA 1JWSD 2AMCB 2B2TC 2LS01 4YIJA 1WCMG 2F4VL 4CDFC 3GTGH 4DAVA 2O2LD 2SNMA 3AFQA 4OL7A 1UAPA 5TSSA 3DHQA 1IW7D 5C4JB 2KHIA 3HRZC 1WCMB 1IYVA 3S2DH 4XT3B 1KLUD 4OONA 1LLRD 1YJ9A 2JK8A 3IRBA 1SROA 1CA5A 1HNZL 4AYBG 4RFBA 1PDQA 3TEHB 3I55A 2J4XA 4C3HH 4R8NA 3TP7A 1WJJA 1EOTA 4PZ6A 5FLXL 4AYBB 3J81i 3K7AH 1CKMA 4A3BH 1KABA 2OXPA 3HZXA 2NBFA 3K6OA 3I56A 1EY9A 1Z47A 3HOXG 4HMIA 5C0XG 3BVGA 2H5XA 3MTSA 4LUZA 2KECA 3JC66 3SGIA 3PIPA 1AE2A 2HDMA 2LKVA 4FYDA 5C4JH 3PUVA 4LF5L 2E2IB 3TS0A 1WCMH 1FNUA 3HOXB 1QNKA 2X6LA 4L5RC 1S5DD 1HZAA 3NBIA 5NUCA 1E2VA 4A3JG 1JE5A 2B2YC 4DR1L 3VYTA 5EBDA 1RTOA 1YHQA 1EQRA 4N9PA 1M90C 1B9NA 4EQNA 3CCEA 2C35B 3HOVG 4L63B 1Q8IA 1YEZA 1JJ2A 3GV3A 1B3AA 3DEPA 1N36Q 4PZ8A 2VL6A 2YTXA 3HOVB 1JORA 3A55A 3VYUA 1NAPA 2SOBA 2XWBB 3D0FA 1RODA 3UDXA 1PH7A 2CCZA 1B4OA 4CKCA 5IGFA 3ZYYX 1U4MA 1J5EL 2BA1A 1VF5C 3L0OA 3GD7A 5M5XB 4TRDA 3HOXH 3OMGA 4H0LC 4A3LH 4DN4M 2A8VA 5C0XH 5ELDA 1NBWA 4X3SA 3EBEA 2GN5A 1LTRD 1S5BD 3BU2A 1I4XA 1Q82C 1VF7A 1KD1C 1E0BA 4GKKQ 4KJNA 5HURA 4RGNA 1TWCB 3GTLB 2AUJD 2PQAA 1RL2A 4NXMQ 2Q2UA 3HOVH 5IT9E 3VDYA 2EPBA 1KDCA 4DF7A 5LMNW 2F0VA 1HXYD 3R93A 1LYLA 2BOSA 3LX0A 2VNUD 5C3XA 1Q3LA 1YHBA 3Q22A 2JA8G 4DR7L 5HGQA 4OO1H 2K04A 1M8AA 3CRLC 4DK1A 4QGUA 3R8BA 5M5XH 1EIYB 1HNXL 2SDFA 1CK1A 2JA8B 4KV6A 3OTOQ 1W3SA 3CP0A 4DAPA 2X69A 4DXFA 1LABA 4FP5D 3A56A 1XNRQ 4PMWA 5CC4A 3KF6A 5CBAE 2K50A 2B8FA 4O0AA 4CJ1B 5G3LF 1PH8A 2F0EA 5DNFA 1TWCH 3GTLH 4PMCA 3TN2A 1TWFB 2FMMA 4F88A 1X3FA 2QILA 1JWUD 2WFWA 1MGSA 5D3IB 1R9TB 4LAAA 1LTAD 2UUCL 1PRTC 3K59A 2D9UA 1K73C 3D8GA 3G7LA 2D2CC 2O4XA 4DV5L 1SE8A 2M00A 2Z0SA 5KRUA 2J0TD 4KK7A 3NWTA 5M3FB 1YNNC 4KHPQ 1TS2A 2D62A 5ELCA 2K5DA 2EDGA 5E7NA 1H9RA 1UUPA 2JA8H 2VY3A 5IT9L 3HKZG 2I07B 4NKLA 4HJ9A 1PMRA 1BBXC 2RDGA 3UE0A 1X65A 4JI3Q 4LWCA 1TWFH 2A68D 3ND8A 1XNQQ 1BO0A 1KIXA 1KHIA 4GZYC 3A5UA 4NXNL 1R9TH 2VQEL 1MI2A 4BBRG 1HR0W 3W1BA 1MHWC 1HHVA 4JVZA 2NTTA 2WAQE 1P16A 1HZBA 3OIPA 1MBYA 1EYGA 4G7OC 1CFMA 3NQIA 2ZXOA 2G9HD 5M3FH 4DR2Q 4BBRB 2IX1A 1SLJA 4B9XA 1B9MA 1RJTA 5IYDG 5IP9G 4GOPC 2ZT9C 1ET6A 2K6AA 1GUSA 1VQDA 2F3IA 4PZ7A 4ME5A 3RR5A 3QWNA 1G2SA 1X32A 2E2DC 1Q1EA 2K14A 2HQLA 1K83B 3A8KE 5C3EB 2R61A 1EY7A 3F2DA 2L5TA 3I4NH 1I6HB 1HA5A 4X64L 1X3EA 3S17B 2UXDQ 2NYZD 1FGBD 3CCLA 1H9JA 3IAYA 3KLWA 2WB1G 4RWSC 2F0QA 3K5NA 2L1BA 2LSSA 1QE6A 4BBRH 4TKOB 1K0SA 1V1PA 4I7AA 4OX9L 1HCZA 3KK7A 4DV6L 4NB3A 1AEXA 2WACA 3UDIA 1SE3A 3FKIB 2ENBA 2Q8RE 5E3FA 3UDGA 1VQMA 3EFXD 4DPGA 2GA4B 3PIP3 1K83H 1JB7A 1IKLA 2HCIA 4IFDJ 1HUNA 5C3EH 2MHVA 5KIXA 5K36H 1I6HH 1H9MA 2ICIA 4BWGB 2WAQG 5ELBA 1LO5D 1L1OA 1PRTF 2DUDA 3KBGA 5ELFA 3S17H 1FR3A 2N8NA 4G57A 3E9IA 5DAUA 3NXWA 3WDNA 5C44B 4DV7Q 3RLFA 2ES2A 1QVFA 1IBLL 3HOUB 2WAQB 1MIUA 4A93G 5GAEC 1PRTB 2GVAA 5D65A 2SNSA 5HGTA 1U0LA 1YNJD 2LXJA 3AQQA 4LW1A 2Z6KC 1UE7A 3NBHB 3IFTA 3FKIH 1FJGL 4GN3B 3CCJA 3MEFA 2RBMA 3PSIA 3Q6SA 1IL2A 2CW0C 2GVBA 2KENA 5LL6X 4RAUC 2E74C 2PW5A 2PZUA 4GN4B 4IUNA 2WIIB 1UEAB 1HNZQ 2PCFB 5C44H 1MKHA 2JJQA 3GP7A 1OXUA 4ZKCB 1TS4A 4ZCKA 1SNDA 2K28A 2K5VA 2RCNA 1CA6A 3HOUH 4LUVA 1PYWD 5C3WA 1LTLA 1EYDA 1VCIA 2DN8A 1PZJD 2Q2TA 1E2WA 3K81C 4KN4C 3RZOB 3G4SA 2M2LA 5CYUA 1D8LA 4P74A 3HKSA 1GD7A 1EWIA 1U4LA 4ILWA 4MZ9A 3FMCA 4R4CA 3PF4A 3GTQB 4LF5Q 5A35A 1JOKA 2Z4IA 4U673 4GOPB 3D4WA 1XMOQ 1L0XB 1D5MC 3NEMA 2F03A 4OWXB 1N36L 2MQHA 5M3MG 4DNRB 1ZXTA 4KKTA 4DR1Q 4A3EG 2IPKD 1SNPA 3T1HL 3H94A 4JI1L 1QILA 3KLSA 3ND9A 1D7QA 3FDTA 4FDBA 5GAHC 1EIFA 1X3GA 2ZXPA 4N8FA 4A3EB 3OW7A 5CV5A 1FVIA 2KBNA 1IKMA 3J80L 4M1UB 3C1EA 4A3DB 1EQTA 2VS1A 5BN3A 1XPRA 3RZOH 1VQGA 2ZTCA 1A6XA 2CHBD 1CKOA 3NQTA 2B2WC 3GTQH 5DM63 3SR1A 4K14A 1LTGD 2HCCA 2IY5B 4X66L 1STAA 2ZM6L 4C3JG 3CD6A 2NWGA 3ULLA 4NXML 3RNUA 1YBYA 2OQ0A 4K6LA 2XVSA 4KHZA 3EQLC 3BZCA 1CHQD 1VQLA 4C3JB 4LF7Q 4CJ2C 4JI8Q 4JOIA 2QEJC 2RSNA 1YIJA 2XRSD 4A3EH 2JEAI 3EIVA 1VQPA 1A2TA 2UUAL 3HOWG 4A3DH 1ZKOA 2EYOA 4UDUC 1B53A 1XNRL 3N52A 4DR7Q 4S3SA 4A3GG 1V1QA 4G4KA 1HNXQ 2F52A 3TRZA 4E6IA 5AFWA 4RMFA 2KCNA 4A3GB 4GNXC 1ICWA 3K5OA 1WFQA 1WD0A 3B6YA 1LTSD 4C3JH 4IUTA 1Y1WG 4JC0A 3VA5A 4B08A 2C5CA 2XGTA 1QUQB 2UUCQ 5I2XA 1K0RA 2NZ1D 3W1GA 1Y1WB 2XIWA 2JA7G 1SXTA 1GVPA 2I5LX 2K5HA 4DV5Q 2PNHA 2OCEA 1QB5D 3Q8DA 1A62A 2JE6I 4XYOA 3S16B 2JA7B 1X56A 3L7ZC 3P1HA 5JOBA 2QKIC 4JI2Q 1TWGH 3NTIA 2IW3A 3TZUA 2BH2A 1WOCA 4A3GH 1HZ9A 1BKBA 3DM1A 3KDFA 4MIUA 5C5LA 5FO9B 4IUQA 5EPJA 1VQIA 3HFZB 4LF8L 4HIMA 3A74A 1HZCA 1SYDA 3CKIB 3I4MB 1STBA 4NXNQ 3HOYG 4A3MB 3FP9A 1Y1WH 1SE2A 4P2CB 1EWHA 2V4DA 2TMPA 2E5LL 4CDDC 1WI5A 1ZYRC 1EQVA 4ME3A 4UY8C 3HOYB 2L9HA 2EYJA 4ZUJA 5I9PA 2X6GA 4BA2I 2K52A 4IJLA 2JYOA 2IT1A 2ATWA 2JA7H 3S16H 1I50B 1NJIC 3GTPB 2MUYA 3CCUA 4U68A 1LM0A 4TQUS 2I5HA 3IFDA 2UXDL 3I70A 1G6ZA 1ENCA 1VQ7A 1EOVA 3FVQA 5GQOA 5KEEA 3RZDB 3I4MH 4H13C 5CMDA 3SDZA 1YVCA 2A69D 4A3MH 4C56C 3A0JA 1TY2A 2Q8IB 2PI2E 2D0PA 2PW7A 2IL8A 1AZQA 1AH9A 4KD4A 1CT1D 3HOYH 4R4QA 2WV6D 1I50H 3GTPH 4OX9Q 4JI5Q 5FLXE 3L3OC 2EYHA 1CM9A 3NTHA 3STBC 4C3HG 3PQIA 1WTOA 3GTOB 3L2PA 2Z8LA 5A2QE 4DV7L 1CKNB 3TP6A 2VQFQ 2EYFA 3A7AB 2RKSA 3RZDH 1U5KA 3H3VI 3BVMA 2F4IA 4KKUA 3CRKC 4OEMB 4EGVA 4GNXB 4EQOA 3CCVA 1SMYC 1GKHA 2QCPX 1BUVT 5IT9c 3I4OA 3OPOA 4DV1Q 4KKSA 1IBLQ 1C48A 1HA6A 2OT2A 2TSSA 2F0JA 2PPBC 4L5SA 3J7A5 4DV0Q 2ZXRA 3H15A 2O5JC 3SK6A 1P8LA 3ULJA 4XDXA 2XN9C 4JBJA 4QCLA 1D2BA 2BH8A 4IUUA 3K80C 4FXGC 1EY0A 4K8JA 1FJGQ 3GTOH 3MFYA 1LT6D 4QUCA 2RA4A 3CPFA 4KTAA 3QIAA 1XPOA 4IFDI 3DUZA 4WJWA 2F3VA 2OWOA 3I7FA 3F2BA 1IW7C 4KY5A 4DV4L 4GKJL 1JICA 3K5LA 4IN3A 2HHHQ 4NPSA 4A3LG 4K0KL 3PO3B 5CR3A 1YJNA 3DWAA 4JV5L 5A2QL 3NE5B 1KNAA 1STGA 1UE1A 3NP8A 1SJHD 3K0XA 3KJPA 5C0XJ 1XMOL 4A3FB 1K9MC 4DKAC 1SR3A 2Q8TA 2NVXB 4IJHA 4B3ML 4WJ3M 2AQ3B 4RGOS 4UPAA 2NN6I 2IJ0A 5EKKA 2CQAA 4F87A 3CCMA 5IGDA 3GO5A 3QOJA 1JMCA 3AU7A 5ELOA 5LHY1 1EIHA 1XMQL 2BCOA 1PV4A 1G2TA 4QB4A 4RGMA 4OO1G 3MZ5A 5EKIA 1BQQT 2ZTEA 1I4QA 4G7HC 4CHTB 3J81j 3T1HQ 1SNQA 4JI1Q 1JOQA 4DXGA 3PO3H 5T1IA 4YWKA 5CV8A 1HQMC 2EE1A 3R2IA 4IPGA 5CV4A 4DK3C 1OTCA 1DD2A 1C7YA 1SBBB 2JA6G 2RQXA 1NR4A 1N33L 4A3FH 4G7ZC 2BE5C 2WP8J 2EJFC 1Y14B 2EY1A 4MNOA 3K7UC 5ISRA 1PFMA 1W6JA 3QB3A 2NVXH 2JA6B 1KXLA 1II3A 3S15B 3S2HB 4DV3L 2EJGC 4HSVA 4Q5VA 3CF5A 4LF7L 1Z7TA 4X3TA 4X66Q 3VA7A 4JI8L 4LFAQ 3P75A 2ZM6Q 1Y1VB 1RIPA 2KHSA 3HOZG 3TS2A 2OEOA 3H3VC 2N49A 2B2YA 2KCTA 1LTBD 5KGUA 3RLNA 4DUZL 3WOEA 4ZQ3A 3HOZB 4IURA 4OWTB 1S5FD 4DR4L 3A7LA 4XXEA 1MSGA 4DV2L 1NMGA 3BDLA 4LFBQ 2UUAQ 1Y69U 1KRTA 4F8MA 2G5DA 3E0JA 1PFSA 1IL8A 4O42A 4POFA 1JT8A 1B3QA 1EYAA 3J7ZC 1X3QA 1F9QA 1MD2D 1KTKA 3CU7A 4YCVA 4KLKA 1LT3D 2JA6H 1SNMA 5EQ0A 2A6ED 3S15H 3S2HH 4FF1A 5H1SE 2EZVA 3LNNA 5EJWA 1Y1VH 4J6HA 1NR2A 2EXDA 5JJKA 1CI3M 2N55A 1PH1A 5BN4A 2Y0SE 1A2UA 5M3FG 2VXWA 4OIKA 3HOZH 2NVTB 1DZ1A 1I5FA 4RHSA 3CCSA 1YNND 2HT1A 2ZJQA 1QWYA 4MTKA 1B50A 1E1OA 3EN2A 1HFGA 3TDQA 5D14A 4A3KG 4HJ8A 2NVYB 4YHHQ 1IXRA 5CV6A 1DOKA 1S5CD 1BR9A 1MSHA 4JI2L 1HQRD 1LTTD 5M9OA 3F2CA 2F0SA 3I4NG 4A3KB 5C4XG 4KJOA 4OIJA 2K5NA 1TXYA 3Q24A 3HG9A 4HTHA 1SNCA 4C3IG 1NE3A 1U4PA 3PO2G 3SXHA 3I4NB 2MFIA 3KBXA 5C4XB 2BDNA 1GJXA 2B2UA 3PF5A 1F2ZA 3CC4A 4N8X1 4C3IB 5IY0A 4XT1B 1M1KC 1MJEA 5LL6S 4LF8Q 2NVTH 1O7YA 3PO2B 1Q12A 3GDEA 1A3VA 3D6CA 1PA6A 2RF4A 4FXDA 5CBEE 3FRPB 1EY4A 1UEBA 1LUZA 5I9OA 5KYIA 2VZAA 4QY7A 2NVYH 5K5PA 2PQAB 1STNA 2E5LQ 2A68C 3H6MA 1PH6A 2QGQA 5IGBA 5C3EG 2VW9A 3MEHA 2E75C 4RH6A 4C2MB 5K36G 1CSQA 4A3KH 1S4ZA 1I6VC 1XX8A 4NDXA 4XQNA 3KOJA 5IP7H 2EXZA 2Y0SG 4I65A 4F7XA 3M9BA 5C4XH 2B29A 2QDBA 4V190 1VQEA 4IUPA 1QOHA 3IKJA 4C3IH 2Y0SB 2I46A 4P73A 2WKDA 2K1BA 3PO2H 2M9VA 1KAWA 1L1OC 2L0CA 4UP8A 2AUKA 2Z1CA 1JR0D 3FKIG 2PNRC 2NUCA 1GUOA 4JI5L 1S40A 1IBML 1D1IA 4AH6A 3V96A 3VR2A 1TVXA 2AKWB 1NUCA 1STHA 3VR4A 1F9RA 2B39A 4DU9A 4DAMA 4C2MH 1EY5A 1X6OA 3NELA 3Q23A 2A1AA 4IALA 4AIMA 2EYLA 4CDEC 4R4OA 2VQFL 2EYMA 2AQ1B 3T56B 5C44G 2ASBA 3HOUG 4GN5A 1LT5D 3T13A 4L8JA 1I3QB 3X3MA 1LTID 4IOCA 4UP9A 4DV1L 3MXNA 2JQOA 1DJRD 2QDLA 1T5EA 4DV0L 3H3VH 1ENFA 1HRJA 1CSPA 1ENAA 2FINB 4DNTB 1GOZA 2F0LA 1PTOD 3I4LA 1EZ8A 2F0UA 2R93G 2K33A 3P7JA 3M4QA 3J80E 2EQSA 3J7AV 2R93B 1WTPA 1I3QH 4DAYA 1YNJC 2HIVA 3NPPA 4B3SL 4YCWA 1SFOB 3H0GB 1TQOA 4LFCL 1KAAA 4X62L 2A73B 1Q46A 4K8IA 2F0MA 4KI0A 3E0EA 4WRDA 3GV6A 1TKWB 3ICEA 1F2YA 1PH3A 4YWMA 4DV4Q 1XTDA 2KQ3A 5JPNC 4GKJQ 2E8GA 3NTKA 1MJCA 5JVG3 2WKCA 4K0KQ 4JV5Q 5IGGA 5LMNL 2QA4A 3OMCA 1U4RA 1ZEQX 1I4GA 4BS9A 3GTJB 1SYCA 2F0IA 2YYZA 2F0TA 1V1PB 4R4IA 3NUCA 2R93H 1OXXK 4B3MQ 1G291 1DOMA 2A6HD 2HDLA 1SFOH 3H0GH 2K75A 4A3DG 4CGYB 2G9DA 4WJ4A 4TVAB 1NMFA 4YWLA 1XMQQ 5I6WA 4FF3A 5HY6A 1O7IA 5M5YB 1VMCA 3WWVA 2CH4W 2K05A 4R9WA 1HTLD 4RCOA 1L1OB 3K57A 5J1ZA 4ZAIA 1FYCA 1LV9A 4BY1G 2XRQD 3CCRA 1PVOA 3SEBA 1A8VA 4JBKA 4KY7A 1WYDA 1CUKA 3TP5A 3GTJH 5J3BA 4LFAL 2DNEA 1XTCD 3PCOB 2AWNA 4BY1B 1N33Q 1J6QA 4QQBX 2FJ2A 3J7YW 5C0XI 3KF8A 1PYBA 1PTOC 1DM0B 4A3CG 4DV3Q 2R7ZG 1GHJA 1Y8OB 2D5DA 2P5ZX 1TIID 2CKZB 3JAME 2FFKB 1O78A 5I2YA 5M5YH 4LFBL 5BR8L 2R7ZB 4P72A 4DGZA 3U50C 2B8GA 4PV1C 3UE1A 4DUZQ 4HIDA 1I4PA 2DJFC 4LJZC 3OOCA 1ONLA 1BCPD 4DR4Q 4FXKC 2RDFA 5J22A 4CBVA 4DV2Q 1CTMA 2AQ2B 3WOFA 2LMCB 5FLXc 4XQJA 4RHRA 1E22A 1I4RA 1KC8C 4BY1H 1O7ZA 1PXUA 1KQSA 1A15A 1SNOA 1STEA 1TWGB 2F0NA 2B63G 2Q2IA 3TSSA 3EVQA 4QL5A 1UE6A 3R3OA 4L5TA 4QJFA 2B63B 1NCVA 5IWAQ 3KFUA 3TBIB 1JE4A 1XWEA 4A3CH 2UU9Q 2R7ZH 2N78A 5IODA 4YHHL 3BVZA 3SK5A 2IHFA 2R7DA 4FO2A 4IZ8A 3CC2A 1Z6HA 3CXCA 4OHJA 1DXMA 3GTMB 1IZ6A 5J39A 3W3AA 4MHEA 3JAML 3K8AA 2OF1A 1SEBD 3OSOA 1K3RA 3C3LA 1K8OA 4P71A 3DM3A 3OWEB 2R3ZA 4X6AH 4ZLTF 3I4MG 2KA7A 1YITA 5E4WC 3OWFA 3G48A 3S24A 1R4QB 2DY8A 2R6GA 4A3MG 3L9AX 3S9WA 3H91A 3I72A 5GAGC 2B63H 1JC7A 2EY5A 1EEID 4EQPA 1C4QA 3F8TA 4HJAA 1N34L 4DR3Q 4OWWB 5FLMG 1JWMD 3G6JB 3D31A 1A0IA 2DY7A 3I90A 4JW0A 2F0KA 2IHEA 3M4OB 3C2PA 4ODGA 3W2DA 1IBKL 3GTMH 3T16A 4WORA 5JVH3 1ILPA 5IGCA 2V1CC 4IPHA 1ICFB 1H9KA 1V43A 1ET9A 1CZWA 1D1KA 4HCEA 2AHOB 4JI6Q 2FMCA 4RG1A 4NP5A 3BYTB 3CMEA 2B2VA 1F2MA 3HGBA 4N9TA 4K6DA 1B2TA 1CHPD 3J7AF 4B3RQ 5GROA 2ZJRA 3S14B 1C8CA 2KJXA 3KLSX 4DK0A 1WVLA 1NNXA 1SYEA 4Y7NB 2YU9B 1CZGA 1PH2A 4XYQA 1RTNA 1QCBD 2UXCL 5T1GA 5JJZA 2NTSA 1QZGA 3M4OH 1TT2A 1I94Q 3EJIA 5FLMH 4A76A 1STYA 2MPMA 1IBMQ 4PNYA 1NSNS 1SSOA 4EVOA 1C0AA 1EIGA 1K28A 2A69C 4K2LA 3HEJA 3OHXC 1KL9A 2J7ZA 1VQOA 5EPLA 1GUNA 3I8ZA 3D4DA 1E3PA 3MVVA 1X3PA 3S14H 3S1QB 1WD1A 4Y7NH 2L55A 2ICEC 5BN5A 2YU9H 3E5SA 4KN7C 3E3XA 3KDFB 2YV5A 4HEDA 1XPUA 1B70B 4GLAC 2JSOA 3NWSA 4RGTA 1LACA 2HD3A 2PMZE 4A75A 3NHHA 2UXBL 2NZOA 5CGKA 4X65L 5M5WB 5G3LD 2JA5B 4LMQD 2XNAC 4ULLA 1E2ZA 1TR5A 2H1EA 1XJVA 1GUGA 3DEOA 3HP3A 1HTPA 2A74C 2DGYA 2EIFA 3S1QH 2KOLA 1DYQA 2Q2HA 3PO3G 2JP1A 4K5WA 5IGEA 3S1MB 1DONA 1VDZA 4JI0Q 3SE0A 4B3SQ 3BDCA 1QVCA 3V2TA 1H9SB 4FF2A 4K5VA 1RDPD 4A3IG 4LFCQ 3U9OA 4X62Q 2ZTDA 2B3GA 2QW7A 4A3FG 1K8AC 2XSCA 2VB3X 2F0WA 3MXGA 4JCVE 1RD9D 3ITPA 4A3IB 5JEAH 1BDOA 3VYSA 2B2TA 2D0OA 4XTCS 1L2FA 3K0YA 2FHTA 5M5WH 2F0GA 4GLVB 4LUOA 5ELEA 2JA5H 3QJYA 5LMNQ 1SE4A 4JYAQ 1SDFA 2JA9A 1TWHB 3PUYA 3RN5A 1AN8A 4V0BA 4HJ7A 1WTWA 1WTQA 4BXXG 1ML0D 1QNUA 2KVMA 4ZKBB 1SN8A 4L6TB 3RD4A 1S3OA 3S1MH 2MNAA 4GS3A 2I0QA 1N32Q 1EU3A 4DUYL 5D3DA 2EOTA 1ILQA 1EYCA 1RF2D 2L11A 1CQVA 1BBUA 2EY2A 1FNWA 3RN2A 4IPCA 4PQXA 4IOAA 3E6ZX 4HSPA 4IPDA 2F0FA 2KEEA 4A3JB 4A3IH 3M4PA 2BE5D 1J8IA 2PMZB 1Y1VG 1TU2B 5EAYA 1KDBA 4YY3L 2DNCA 5FK9C 2EY6A 3FHWA 1FL0A 1TWHH 3A8IE 4CDCC 1BBWA 4KD3A 2OTLA 1K8MA 3GQBA 1HNWQ 2E2IH 2CQOA 3BYYB 1VQ8A 4ID6A 2MO0A 4JI7L 4MN3A 3S1NB 4BXXH 2MP1A 4ZUIA 4AQYQ 1VQAA 3F1ZA 5KNCA 3J81E 3EROA 3DXJC 4QIWE 3D4RA 2IWHA 5BR8Q 1A3TA 4DR6L 3PV0A 4NMZA 3HKZE 4K2KA 4A3JH 5C4HA 1B8AA 2Z6BA 2QF7A 3OIQA 1HR0Q 1PFBA 1PFNA 1QJOA 3M3YB 3T53B 3A54A 4ZYSA 1RKNA 3P20A 1BVSA 3DWPA 4RCNA 5IWAL 1HPCA 4YCUA 1KDAA 1PRTD 1T5XD 2UU9L 1YHAA 4KY6A 1X9NA 1Y8PB 1GUTA 3S1NH 1V1OA 1VQBA 1TS5A 2BDOA 4XQQA 1EEFD 2F0PA 2NVQB 3MA2B 1SYBA 2B2UC 5IYBG 3KUPA 4EX5A 5DM73 1SJED 2A6EC 2E76C 5CV9A 5KYLA 3MXUA 3I3CA 3TREA 4APVA 1E7ZA 3AFPA 1W2BA 5IP7G 3FEWX 4HIKA 2MGSA 4DFAA 4ZK9B 3C1FA 2K7VA 2VB2X 2RHQB 3AEVA 4OGQC 3M3YH 3J81L 4IO9A 3UDFA 1SRUA 3PGZA 3CPWA 5I4DA 1L0YB 3J80c 1OXSC 2AWOA 3URYA 3I73A 2WB1E 4UAIA 2KCMA 4DR3L 1EFWA 1Q8KA 3M7NA 3T1YL 2RSOA 5LMUQ 2NVQH 4ZRZA 1V9PA 1N9WA 1B7YB 2F1MA 4QIWB 4LF9L 3KYHC 3PIOA 5EKLA 1N34Q 2CFMA 1GXDC 2F0HA 1HJPA 1S5ED 3HKZB 2KEDA 1YI2A 5IYBH 1U9RA 1BNZA 2RDHA 3NBHA 1EY6A 1G91A 2PQEA 3QO2A 2IX0A 1IBKQ 1OXVA 2CWPA 4JI6L 3R2TA 2VUMG 4RA8A 4CKBA 5AJ3Q 1XYIA 1ASYA 1VQKA 4IQZA 4B3RL 2MO1A 5ELNA 2SEBD 2K4KA 3MHBA 4J8QA 4DR5L 2VUMB 3AYHB 1ASZA 1VQ4A 3PUXA 5EPKA 3QOLA 4QUFA 4WFN3 4LF4Q 1TY0A 2CVRA 3MXPA 4HCSA 3PUZA 3QR8A 3KF6B 3TMEA 3M85A 1VQJA 3J80i 3CHBD 1AW7A 3ONAB 3BZDB 3CAMA 1I94L 1FD7D 3RLOA 1EWCA 1Y8NB 3D6WA 2PYKA 1JJGA 2NZHA 1VS0A 2PZTA 2XTIA 3F2UA 5IE8A 2L4NA 2QEXA 2UXCQ 2HHHL 1QVGA 4R1JA 1PHJA 1EQQA 5IIFA 3MAQA 4DNIA 1JB3A 4KMUC 1S72A 3U4ZA 4X3KA 3DWQA 1T9HA 4JI4L 1X55A 3N6RA 2N3SA 4GOPA 1VQHA 4B3TL 2I5MX 1VQCA 2WB1B 2UUBQ 2VUMH 5E1FA 3BS1A 2JXMB 2ZJPA 5F2DA 3CC7A 4IFDG 1PH5A 3JAMc 3H09A 3CW2C 2HUGA 4IUVA 4DA2A 5IYDH 5IP9H 1KLGD 3D3RA 4QF4A 1HFNA 4LF6L 4RKBA 3ER0A 1VMPA 1D6EC 2K5QA 4UP7A 3MC0B 1B1ZA 1HH2P 3PMFA 3VR6A 4HAEA 3SK8A 3ERSX 2CW0D 5E4XA 3RMHA 3QG1A 4FNFA 2KUMA 3CQZB 3H0GG 2NN6G 3HS0C 4UHVA 4JBMA 2UXBQ 4X65Q 1M4VA 3AMUA 4JI0L 1BXTA 1GM5A 4A93B 4XIGS 1A3UA 2F4VQ 3PUWA 3BJUA 5KNDA
chains in the Genus database with same CATH topology
1SE8A 2Z0SA 1IZ6A 2LXKA 5C4XG 1Z9FA 3K8AA 1K3RA 4KHPQ 3CPFA 4IFDI 2D62A 1XPOA 3ULPA 3I7FA 3F2BA 2OWOA 3KJOA 4P71A 5E7NA 3DM3A 2JA8H 4DV4L 4X6AH 3I4MG 3JAMi 4GKJL 1VQ5A 2VY3A 1YITA 2R7FA 2HHHQ 3HKZG 1FGUA 3G48A 4NPSA 3S24A 2R6GA 4A3MG 4A3LG 4K0KL 4HJ9A 1YJNA 5GAGC 2B63H 1Q1BA 4JV5L 4JYAL 3UE0A 2Z6KA 1X65A 5FJ8G 4LWCA 3CQZH 4JI3Q 1UE1A 3F8TA 4HJAA 3CMAA 1TWFH 3K0XA 1N34L 1XNQQ 4DR3Q 3KJPA 1KHIA 5C0XJ 1KIXA 4OWWB 3A5UA 1XMOL 4NXNL 1R9TH 1OXTA 5FLMG 1K9MC 4LNQA 4DKAC 3D31A 2VQEL 1A0IA 1SR3A 1Q7YC 4A93H 3DLLA 1N32L 4BBRG 4IJHA 2IHEA 1HR0W 3W1BA 4B3ML 4WJ3M 1IBKL 4UPAA 2NN6I 3GTMH 2WAQE 3CCMA 1P16A 1HZBA 3GO5A 1EYGA 1JMCA 2V1CC 5ELOA 5M3FH 4IPHA 4DR2Q 4GLXA 1XMQL 1QUQA 4JG2A 2IX1A 1SLJA 4JOIC 1AE3A 1PV4A 1NY4A 1V43A 3CCQA 5IYDG 4H02A 5IP9G 4BBSG 4DUYQ 4OO1G 4JBWA 4GOPC 2ZTEA 4Y52H 2AHOB 1VQDA 4JI6Q 4RG1A 2F3IA 4PZ7A 3J81j 3T1HQ 4JI1Q 3RR5A 2OQKA 3CMEA 2HIXA 3PO3H 3MXNB 1Q1EA 2K14A 4YWKA 2HQLA 4B3RQ 5GROA 4DK3C 4IPGA 2ZJRA 1OTCA 3F2DA 1C7YA 2JA6G 4O2DA 3I4NH 1HNWL 3LGJA 4X64L 1PH2A 1N33L 1VQ6A 4A3FH 1X3EA 1C9OA 2UXDQ 4YY3Q 5DLQE 2UXCL 4HIOA 2WP8J 3CCLA 5FJ8H 1Y14B 4MNOA 3K7UC 2NVXH 1QZGA 1KXLA 3KLWA 3M4OH 4AQYL 2WB1G 1E1TA 1I94Q 4DV3L 3CF5A 4LF7L 5FLMH 4X66Q 1EUJA 2LSSA 4LFAQ 4JI8L 4J15A 2ZM6Q 4A76A 1J5EQ 4GKKL 1RIPA 2E2JH 3HOZG 5JJLA 4BBRH 3G71A 1IBMQ 4OX9L 3TS2A 4JI7Q 2N49A 4DV6L 1E24A 1C0AA 2KCTA 4NB3A 4P75A 3TQYA 1PYSB 4PG3A 4DAYB 3RLNA 3UDIA 4DUZL 3U4VA 3S1RH 1KL9A 1VQNA 1HR0L 3I2ZA 3UDGA 4OWTB 1VQMA 4DR4L 1VQOA 4DPGA 4DV2L 4BBSH 1NMGA 4DR6Q 1E3PA 1KRSA 1K83H 5M3MH 1JB7A 4LFBQ 4IFDJ 2UUAQ 3S14H 1KRTA 4OO1I 5C3EH 1JT8A 1PFSA 4POFA 1PH4A 4Y7NH 2YU9H 1JJCB 1I6HH 3J7ZC 2WAQG 1Q86C 1L1OA 3S17H 2DUDA 3OTOL 2N8NA 3KDFB 4A4IA 3E9IA 2YV5A 4YCVA 4KLKA 2JA6H 1XPUA 4DV7Q 3RLFA 2ES2A 3S15H 1B70B 3S2HH 1QVFA 4GLAC 1IBLL 1MIUA 5H1SE 1IYJB 4A93G 5GAEC 1Y1VH 2GVAA 2EXDA 5JJKA 1U0LA 3AQQA 2LXJA 2PMZE 4LW1A 1PH1A 2Z6KC 4A75A 1UE7A 2UXBL 3NBHB 2NZOA 2Y0SE 4X65L 5M3FG 3FKIH 1FJGL 3HOZH 1I5FA 2R92G 4GN3B 3CCJA 1NTGA 3CCSA 2YTYA 1XJVA 3MEFA 2HT1A 3PSIA 1G51A 2ZJQA 1IL2A 2DGYA 1E1OA 2EIFA 1N8RC 3EN2A 3S1QH 2GVBA 2KENA 4A3KG 2Q2HA 4HJ8A 3PO3G 4YHHQ 1IXRA 4KHPL 4L5QA 4JI0Q 4JI2L 4GN4B 4B3SQ 1QVCA 3F2CA 1HNZQ 3I4NG 5LMUL 4LFCQ 5C44H 1MKHA 2JJQA 4X62Q 1OXUA 4A3IG 2K5NA 2B3GA 2ZTDA 2RCNA 1TXYA 2K5VA 4A3FG 1CKNA 1K8AC 3HOUH 1Q81C 3HOWH 4HJ5A 4LUVA 1NE3A 4JCVE 1LTLA 4GNXA 4JI3L 3PO2G 2MFIA 3NENA 1XNQL 1VCIA 2D0OA 3T1YQ 3A5ZB 4XTCS 3PF5A 3CC4A 1L2FA 3KF8B 2YTVA 5M5WH 5IY0A 2Q2TA 3K81C 4GLVB 4LUOA 1M1KC 2JA5H 1MJEA 5LMNQ 3G4SA 4LF8Q 1VQFA 2NVTH 1D8LA 1Q12A 1K8GA 4LF9Q 4P74A 4JYAQ 3GDEA 1GD7A 1EWIA 2JA9A 3HKSA 4MZ9A 4BA1I 4R4CA 1PA6A 1H95A 2RF4A 3PUYA 3RN5A 3PF4A 4BXXG 4HJ7A 5GADC 4LF5Q 1UEBA 1LUZA 5AJ3L 4GOPB 2RHSB 2VZAA 1XMOQ 4QY7A 3G6EA 4DR2L 2NVYH 3NEMA 3GTOH 2PQAB 1SN8A 4OWXB 1S3OA 1N36L 1GO3E 2E5LQ 2R92H 3S1MH 2MQHA 5M3MG 2MNAA 4BY7G 2VQEQ 4GS3A 1YZ6A 2I0QA 1PH6A 1N32Q 1TWAH 2QGQA 5C3EG 2VW9A 4DUYL 4DR1Q 4A3EG 1YJWA 4LF4L 1A63A 2OTJA 5K36G 1G6PA 1CSQA 4A3KH 1BBUA 3T1HL 1SMXA 4JI1L 1D7QA 4EQ5A 3KOJA 3RN2A 3BZKA 4FDBA 2L15A 4IPCA 5GAHC 1EIFA 5IP7H 1X3GA 2A19A 2ALYB 2Y0SG 4IOAA 5IYCG 4DR5Q 4IPDA 1FVIA 2KBNA 4A3IH 1VQ9A 3M9BA 3M4PA 2B29A 5C4XH 3U58A 1VQEA 3OW2A 1Y1VG 2PI2A 3ZJYC 4C3IH 5EAYA 4P73A 4YY3L 2VS1A 3RZOH 1XPRA 3PO2H 1VQGA 3FHWA 2ZTCA 1FL0A 1KAWA 1L1OC 1CKOA 4UP8A 1TWHH 1BBWA 3GTQH 2OTLA 3FKIG 1DGSA 2IY5B 3STBD 4X66L 2ZM6L 2CWAA 1HNWQ 4X64Q 4MTNA 4JI5L 4AYBE 2E2IH 2CQOA 4DK6C 1VQ8A 1S40A 3ULLA 1IBML 4AH6A 2MO0A 2UUBL 4NXML 2KHJA 4JI7L 3W5OA 2AKWB 2ID0A 2JEBI 3RNUA 4BXXH 1YBYA 2OQ0A 2BA0A 4KHZA 4AQYQ 3BZCA 4C2MH 4DAMA 1VQAA 3F1ZA 1VQLA 1L0WA 4JI4Q 4LF7Q 1X6OA 3NELA 4QIWE 4R4TA 5JJIA 2A1AA 1X54A 4JI8Q 1UWVA 4JOIA 4AIMA 4BY7H 5BR8Q 4B3TQ 1YIJA 4R4OA 2VQFL 4DR6L 4A3EH 3PV0A 3EIVA 4ALPA 3HKZE 3E9HA 5C44G 1VQPA 3OYYA 2ASBA 4A3JH 2UUAL 4DV6Q 1B8AA 3GTKH 3HOUG 3HOWG 4GN5A 4A3DH 4IOCA 3J81c 1HR0Q 4POGA 4UP9A 4OXPA 5IYCH 4DV1L 1XNRL 5JEAG 1UE5A 4DR7Q 1YNXA 1QZHA 2JQOA 4A3BG 1BVSA 4DV0L 4A3GG 2JA5G 1V1QA 2E2HH 3H3VH 4LF6Q 5IWAL 1PH9A 1HNXQ 1CSPA 4YCUA 2F52A 5JEAJ 3TRZA 2UU9L 1YHAA 1X9NA 4RMFA 4GKJQ 3S1NH 4GNXC 1VQBA 2FXQA 1WFQA 3B6YA 2AMCB 1WCMG 4C3JH 2F4VL 5IYBG 3GTGH 2R93G 1Y1WG 4JC0A 4EX5A 3AFQA 3M4QA 2XGTA 1QUQB 3CD6A 2UUCQ 2KHIA 1K0RA 3TREA 2EQSA 3W1GA 1E7ZA 3AFPA 4APVA 1W2BA 5IP7G 3S2DH 1I3QH 4HIKA 4OONA 1YJ9A 2JA7G 2HIVA 2JK8A 4B3SL 1GVPA 2I5LX 2K5HA 2RHQB 2PNHA 3IRBA 4YCWA 4DV5Q 3AEVA 1SROA 1HNZL 3M3YH 4AYBG 4IO9A 2OCEA 4LFCL 1SRUA 3UDFA 3Q8DA 3PGZA 3TEHB 4X62L 1A62A 1Q46A 3I55A 3CPWA 3J80c 1OXSC 2AWOA 2JE6I 4KI0A 1X56A 3L7ZC 3E0EA 4C3HH 3ICEA 2WB1E 1PH3A 1WJJA 2KCMA 4PZ6A 4YWMA 4DV4Q 1XTDA 4JI2Q 4DR3L 3J81i 2E8GA 1TWGH 1EFWA 1Q8KA 1CKMA 3K7AH 2BH2A 1WOCA 4A3BH 1MJCA 3M7NA 4A3GH 3T1YL 1HZ9A 1BKBA 3KDFA 4K0KQ 5LMUQ 3I56A 2NVQH 4JV5Q 1V9PA 1Z47A 1N9WA 3HOXG 1VQIA 3HFZB 2QA4A 1B7YB 5C0XG 5LMNL 4LF8L 2H5XA 4LF9L 4HIMA 3KYHC 3A74A 1HZCA 3PIOA 1N34Q 2CFMA 3JC66 4LUZA 3SGIA 3PIPA 1AE2A 5C4JH 3PUVA 1HJPA 2YYZA 3TS0A 4LF5L 4NXNQ 3HOYG 1WCMH 4R4IA 1YI2A 5IYBH 2R93H 3FP9A 1Y1WH 4L5RC 1OXXK 1HZAA 2E5LL 4B3MQ 1G291 2IX0A 1IBKQ 1OXVA 1JE5A 2CWPA 4A3JG 1SFOH 1WI5A 4ME3A 4DR1L 4JI6L 4UY8C 3H0GH 2VUMG 2K75A 1YHQA 1EQRA 4BA2I 4A3DG 2K52A 4IJLA 1M90C 2IT1A 4WJ4A 4TVAB 2C35B 3CCEA 2ATWA 1NMFA 4YWLA 1XMQQ 3HOVG 5AJ3Q 2JA7H 1ASYA 1YEZA 1VQKA 1NJIC 1JJ2A 3S16H 5HY6A 1O7IA 2MO1A 4B3RL 5ELNA 2K4KA 1N36Q 3WWVA 4DR5L 3AYHB 3CCUA 1ASZA 1LM0A 1VQ4A 3PUXA 4PZ8A 2VL6A 4TQUS 2YTXA 2I5HA 1L1OB 4LF4Q 2UXDL 3PUZA 3KF6B 3M85A 1VQJA 4BY1G 1VQ7A 3J80i 3CCRA 3D0FA 1PVOA 3UDXA 1PH7A 1A8VA 2CCZA 4JBKA 1EOVA 3CAMA 1WYDA 1I94L 1CUKA 5GQOA 3RLOA 3I4MH 3GTJH 1JJGA 2NZHA 1VS0A 5J3BA 1J5EL 2BA1A 2XTIA 4LFAL 3PCOB 3L0OA 2AWNA 1N33Q 3GD7A 1YVCA 5IE8A 1J6QA 3HOXH 4A3LH 4A3MH 4QQBX 2A8VA 3A0JA 2QEXA 2UXCQ 5C0XI 1NBWA 1QVGA 2PI2E 3EBEA 2HHHL 4R1JA 1PHJA 2D0PA 1EQQA 2GN5A 1PYBA 4DNIA 4A3CG 1AH9A 3BU2A 4DV3Q 2R7ZG 1Q82C 3HOYH 1S72A 3U4ZA 1T9HA 2CKZB 1KD1C 4JI4L 4GKKQ 1X55A 4R4QA 2N3SA 1I50H 3GTPH 4GOPA 1VQHA 5M5YH 4OX9Q 5BR8L 4LFBL 4JI5Q 4B3TL 4P72A 2I5MX 2PQAA 1VQCA 1RL2A 2UUBQ 4NXMQ 2VUMH 3U50C 3STBC 3UE1A 4DUZQ 2Q2UA 3HOVH 2ZJPA 4HIDA 3CC7A 4IFDG 3VDYA 4DR4Q 5LMNW 1PH5A 3JAMc 4DV2Q 3L2PA 1LYLA 3CW2C 4DV7L 2VNUD 2JA8G 1CKNB 1YHBA 5IYDH 5IP9H 2VQFQ 4DR7L 5HGQA 3RZDH 1U5KA 3H3VI 5FLXc 1KC8C 1E22A 4QGUA 4GNXB 4BY1H 5M5XH 3ER0A 3CCVA 1GKHA 1KQSA 1HNXL 1EIYB 4LF6L 2B63G 5IT9c 4UP7A 3OTOQ 2Q2IA 1W3SA 1HH2P 3I4OA 3CP0A 4QL5A 1UE6A 4DV1Q 1XNRQ 4PMWA 3KF6A 4L5TA 1IBLQ 2K50A 4O0AA 3J7A5 4QJFA 1PH8A 4L5SA 3ERSX 4DV0Q 3H15A 1P8LA 3ULJA 5IWAQ 3KFUA 1TWCH 2JEAI 3GTLH 4JBJA 4A3CH 2UU9Q 3H0GG 2NN6G 1X3FA 2R7ZH 2WFWA 2BH8A 2N78A 4JBMA 2UXBQ 3K80C 4X65Q 2UUCL 4YHHL 2IHFA 1FJGQ 2R7DA 4JI0L 1K73C 1GM5A 3CC2A 4XIGS 3CXCA 2F4VQ 3PUWA 3BJUA 4DV5L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SE8 A;  2Z0S A;  1IZ6 A;  2LXK A;  5C4X G;  1Z9F A;  3K8A A;  1K3R A;  4KHP Q;  3CPF A;  4IFD I;  2D62 A;  1XPO A;  3ULP A;  3I7F A;  3F2B A;  2OWO A;  3KJO A;  4P71 A;  5E7N A;  3DM3 A;  2JA8 H;  4DV4 L;  4X6A H;  3I4M G;  3JAM i;  4GKJ L;  1VQ5 A;  2VY3 A;  1YIT A;  2R7F A;  2HHH Q;  3HKZ G;  1FGU A;  3G48 A;  4NPS A;  3S24 A;  2R6G A;  4A3M G;  4A3L G;  4K0K L;  4HJ9 A;  1YJN A;  5GAG C;  2B63 H;  1Q1B A;  4JV5 L;  4JYA L;  3UE0 A;  2Z6K A;  1X65 A;  5FJ8 G;  4LWC A;  3CQZ H;  4JI3 Q;  1UE1 A;  3F8T A;  4HJA A;  3CMA A;  1TWF H;  3K0X A;  1N34 L;  1XNQ Q;  4DR3 Q;  3KJP A;  1KHI A;  5C0X J;  1KIX A;  4OWW B;  3A5U A;  1XMO L;  4NXN L;  1R9T H;  1OXT A;  5FLM G;  1K9M C;  4LNQ A;  4DKA C;  3D31 A;  2VQE L;  1A0I A;  1SR3 A;  1Q7Y C;  4A93 H;  3DLL A;  1N32 L;  4BBR G;  4IJH A;  2IHE A;  1HR0 W;  3W1B A;  4B3M L;  4WJ3 M;  1IBK L;  4UPA A;  2NN6 I;  3GTM H;  2WAQ E;  3CCM A;  1P16 A;  1HZB A;  3GO5 A;  1EYG A;  1JMC A;  2V1C C;  5ELO A;  5M3F H;  4IPH A;  4DR2 Q;  4GLX A;  1XMQ L;  1QUQ A;  4JG2 A;  2IX1 A;  1SLJ A;  4JOI C;  1AE3 A;  1PV4 A;  1NY4 A;  1V43 A;  3CCQ A;  5IYD G;  4H02 A;  5IP9 G;  4BBS G;  4DUY Q;  4OO1 G;  4JBW A;  4GOP C;  2ZTE A;  4Y52 H;  2AHO B;  1VQD A;  4JI6 Q;  4RG1 A;  2F3I A;  4PZ7 A;  3J81 j;  3T1H Q;  4JI1 Q;  3RR5 A;  2OQK A;  3CME A;  2HIX A;  3PO3 H;  3MXN B;  1Q1E A;  2K14 A;  4YWK A;  2HQL A;  4B3R Q;  5GRO A;  4DK3 C;  4IPG A;  2ZJR A;  1OTC A;  3F2D A;  1C7Y A;  2JA6 G;  4O2D A;  3I4N H;  1HNW L;  3LGJ A;  4X64 L;  1PH2 A;  1N33 L;  1VQ6 A;  4A3F H;  1X3E A;  1C9O A;  2UXD Q;  4YY3 Q;  5DLQ E;  2UXC L;  4HIO A;  2WP8 J;  3CCL A;  5FJ8 H;  1Y14 B;  4MNO A;  3K7U C;  2NVX H;  1QZG A;  1KXL A;  3KLW A;  3M4O H;  4AQY L;  2WB1 G;  1E1T A;  1I94 Q;  4DV3 L;  3CF5 A;  4LF7 L;  5FLM H;  4X66 Q;  1EUJ A;  2LSS A;  4LFA Q;  4JI8 L;  4J15 A;  2ZM6 Q;  4A76 A;  1J5E Q;  4GKK L;  1RIP A;  2E2J H;  3HOZ G;  5JJL A;  4BBR H;  3G71 A;  1IBM Q;  4OX9 L;  3TS2 A;  4JI7 Q;  2N49 A;  4DV6 L;  1E24 A;  1C0A A;  2KCT A;  4NB3 A;  4P75 A;  3TQY A;  1PYS B;  4PG3 A;  4DAY B;  3RLN A;  3UDI A;  4DUZ L;  3U4V A;  3S1R H;  1KL9 A;  1VQN A;  1HR0 L;  3I2Z A;  3UDG A;  4OWT B;  1VQM A;  4DR4 L;  1VQO A;  4DPG A;  4DV2 L;  4BBS H;  1NMG A;  4DR6 Q;  1E3P A;  1KRS A;  1K83 H;  5M3M H;  1JB7 A;  4LFB Q;  4IFD J;  2UUA Q;  3S14 H;  1KRT A;  4OO1 I;  5C3E H;  1JT8 A;  1PFS A;  4POF A;  1PH4 A;  4Y7N H;  2YU9 H;  1JJC B;  1I6H H;  3J7Z C;  2WAQ G;  1Q86 C;  1L1O A;  3S17 H;  2DUD A;  3OTO L;  2N8N A;  3KDF B;  4A4I A;  3E9I A;  2YV5 A;  4YCV A;  4KLK A;  2JA6 H;  1XPU A;  4DV7 Q;  3RLF A;  2ES2 A;  3S15 H;  1B70 B;  3S2H H;  1QVF A;  4GLA C;  1IBL L;  1MIU A;  5H1S E;  1IYJ B;  4A93 G;  5GAE C;  1Y1V H;  2GVA A;  2EXD A;  5JJK A;  1U0L A;  3AQQ A;  2LXJ A;  2PMZ E;  4LW1 A;  1PH1 A;  2Z6K C;  4A75 A;  1UE7 A;  2UXB L;  3NBH B;  2NZO A;  2Y0S E;  4X65 L;  5M3F G;  3FKI H;  1FJG L;  3HOZ H;  1I5F A;  2R92 G;  4GN3 B;  3CCJ A;  1NTG A;  3CCS A;  2YTY A;  1XJV A;  3MEF A;  2HT1 A;  3PSI A;  1G51 A;  2ZJQ A;  1IL2 A;  2DGY A;  1E1O A;  2EIF A;  1N8R C;  3EN2 A;  3S1Q H;  2GVB A;  2KEN A;  4A3K G;  2Q2H A;  4HJ8 A;  3PO3 G;  4YHH Q;  1IXR A;  4KHP L;  4L5Q A;  4JI0 Q;  4JI2 L;  4GN4 B;  4B3S Q;  1QVC A;  3F2C A;  1HNZ Q;  3I4N G;  5LMU L;  4LFC Q;  5C44 H;  1MKH A;  2JJQ A;  4X62 Q;  1OXU A;  4A3I G;  2K5N A;  2B3G A;  2ZTD A;  2RCN A;  1TXY A;  2K5V A;  4A3F G;  1CKN A;  1K8A C;  3HOU H;  1Q81 C;  3HOW H;  4HJ5 A;  4LUV A;  1NE3 A;  4JCV E;  1LTL A;  4GNX A;  4JI3 L;  3PO2 G;  2MFI A;  3NEN A;  1XNQ L;  1VCI A;  2D0O A;  3T1Y Q;  3A5Z B;  4XTC S;  3PF5 A;  3CC4 A;  1L2F A;  3KF8 B;  2YTV A;  5M5W H;  5IY0 A;  2Q2T A;  3K81 C;  4GLV B;  4LUO A;  1M1K C;  2JA5 H;  1MJE A;  5LMN Q;  3G4S A;  4LF8 Q;  1VQF A;  2NVT H;  1D8L A;  1Q12 A;  1K8G A;  4LF9 Q;  4P74 A;  4JYA Q;  3GDE A;  1GD7 A;  1EWI A;  2JA9 A;  3HKS A;  4MZ9 A;  4BA1 I;  4R4C A;  1PA6 A;  1H95 A;  2RF4 A;  3PUY A;  3RN5 A;  3PF4 A;  4BXX G;  4HJ7 A;  5GAD C;  4LF5 Q;  1UEB A;  1LUZ A;  5AJ3 L;  4GOP B;  2RHS B;  2VZA A;  1XMO Q;  4QY7 A;  3G6E A;  4DR2 L;  2NVY H;  3NEM A;  3GTO H;  2PQA B;  1SN8 A;  4OWX B;  1S3O A;  1N36 L;  1GO3 E;  2E5L Q;  2R92 H;  3S1M H;  2MQH A;  5M3M G;  2MNA A;  4BY7 G;  2VQE Q;  4GS3 A;  1YZ6 A;  2I0Q A;  1PH6 A;  1N32 Q;  1TWA H;  2QGQ A;  5C3E G;  2VW9 A;  4DUY L;  4DR1 Q;  4A3E G;  1YJW A;  4LF4 L;  1A63 A;  2OTJ A;  5K36 G;  1G6P A;  1CSQ A;  4A3K H;  1BBU A;  3T1H L;  1SMX A;  4JI1 L;  1D7Q A;  4EQ5 A;  3KOJ A;  3RN2 A;  3BZK A;  4FDB A;  2L15 A;  4IPC A;  5GAH C;  1EIF A;  5IP7 H;  1X3G A;  2A19 A;  2ALY B;  2Y0S G;  4IOA A;  5IYC G;  4DR5 Q;  4IPD A;  1FVI A;  2KBN A;  4A3I H;  1VQ9 A;  3M9B A;  3M4P A;  2B29 A;  5C4X H;  3U58 A;  1VQE A;  3OW2 A;  1Y1V G;  2PI2 A;  3ZJY C;  4C3I H;  5EAY A;  4P73 A;  4YY3 L;  2VS1 A;  3RZO H;  1XPR A;  3PO2 H;  1VQG A;  3FHW A;  2ZTC A;  1FL0 A;  1KAW A;  1L1O C;  1CKO A;  4UP8 A;  1TWH H;  1BBW A;  3GTQ H;  2OTL A;  3FKI G;  1DGS A;  2IY5 B;  3STB D;  4X66 L;  2ZM6 L;  2CWA A;  1HNW Q;  4X64 Q;  4MTN A;  4JI5 L;  4AYB E;  2E2I H;  2CQO A;  4DK6 C;  1VQ8 A;  1S40 A;  3ULL A;  1IBM L;  4AH6 A;  2MO0 A;  2UUB L;  4NXM L;  2KHJ A;  4JI7 L;  3W5O A;  2AKW B;  2ID0 A;  2JEB I;  3RNU A;  4BXX H;  1YBY A;  2OQ0 A;  2BA0 A;  4KHZ A;  4AQY Q;  3BZC A;  4C2M H;  4DAM A;  1VQA A;  3F1Z A;  1VQL A;  1L0W A;  4JI4 Q;  4LF7 Q;  1X6O A;  3NEL A;  4QIW E;  4R4T A;  5JJI A;  2A1A A;  1X54 A;  4JI8 Q;  1UWV A;  4JOI A;  4AIM A;  4BY7 H;  5BR8 Q;  4B3T Q;  1YIJ A;  4R4O A;  2VQF L;  4DR6 L;  4A3E H;  3PV0 A;  3EIV A;  4ALP A;  3HKZ E;  3E9H A;  5C44 G;  1VQP A;  3OYY A;  2ASB A;  4A3J H;  2UUA L;  4DV6 Q;  1B8A A;  3GTK H;  3HOU G;  3HOW G;  4GN5 A;  4A3D H;  4IOC A;  3J81 c;  1HR0 Q;  4POG A;  4UP9 A;  4OXP A;  5IYC H;  4DV1 L;  1XNR L;  5JEA G;  1UE5 A;  4DR7 Q;  1YNX A;  1QZH A;  2JQO A;  4A3B G;  1BVS A;  4DV0 L;  4A3G G;  2JA5 G;  1V1Q A;  2E2H H;  3H3V H;  4LF6 Q;  5IWA L;  1PH9 A;  1HNX Q;  1CSP A;  4YCU A;  2F52 A;  5JEA J;  3TRZ A;  2UU9 L;  1YHA A;  1X9N A;  4RMF A;  4GKJ Q;  3S1N H;  4GNX C;  1VQB A;  2FXQ A;  1WFQ A;  3B6Y A;  2AMC B;  1WCM G;  4C3J H;  2F4V L;  5IYB G;  3GTG H;  2R93 G;  1Y1W G;  4JC0 A;  4EX5 A;  3AFQ A;  3M4Q A;  2XGT A;  1QUQ B;  3CD6 A;  2UUC Q;  2KHI A;  1K0R A;  3TRE A;  2EQS A;  3W1G A;  1E7Z A;  3AFP A;  4APV A;  1W2B A;  5IP7 G;  3S2D H;  1I3Q H;  4HIK A;  4OON A;  1YJ9 A;  2JA7 G;  2HIV A;  2JK8 A;  4B3S L;  1GVP A;  2I5L X;  2K5H A;  2RHQ B;  2PNH A;  3IRB A;  4YCW A;  4DV5 Q;  3AEV A;  1SRO A;  1HNZ L;  3M3Y H;  4AYB G;  4IO9 A;  2OCE A;  4LFC L;  1SRU A;  3UDF A;  3Q8D A;  3PGZ A;  3TEH B;  4X62 L;  1A62 A;  1Q46 A;  3I55 A;  3CPW A;  3J80 c;  1OXS C;  2AWO A;  2JE6 I;  4KI0 A;  1X56 A;  3L7Z C;  3E0E A;  4C3H H;  3ICE A;  2WB1 E;  1PH3 A;  1WJJ A;  2KCM A;  4PZ6 A;  4YWM A;  4DV4 Q;  1XTD A;  4JI2 Q;  4DR3 L;  3J81 i;  2E8G A;  1TWG H;  1EFW A;  1Q8K A;  1CKM A;  3K7A H;  2BH2 A;  1WOC A;  4A3B H;  1MJC A;  3M7N A;  4A3G H;  3T1Y L;  1HZ9 A;  1BKB A;  3KDF A;  4K0K Q;  5LMU Q;  3I56 A;  2NVQ H;  4JV5 Q;  1V9P A;  1Z47 A;  1N9W A;  3HOX G;  1VQI A;  3HFZ B;  2QA4 A;  1B7Y B;  5C0X G;  5LMN L;  4LF8 L;  2H5X A;  4LF9 L;  4HIM A;  3KYH C;  3A74 A;  1HZC A;  3PIO A;  1N34 Q;  2CFM A;  3JC6 6;  4LUZ A;  3SGI A;  3PIP A;  1AE2 A;  5C4J H;  3PUV A;  1HJP A;  2YYZ A;  3TS0 A;  4LF5 L;  4NXN Q;  3HOY G;  1WCM H;  4R4I A;  1YI2 A;  5IYB H;  2R93 H;  3FP9 A;  1Y1W H;  4L5R C;  1OXX K;  1HZA A;  2E5L L;  4B3M Q;  1G29 1;  2IX0 A;  1IBK Q;  1OXV A;  1JE5 A;  2CWP A;  4A3J G;  1SFO H;  1WI5 A;  4ME3 A;  4DR1 L;  4JI6 L;  4UY8 C;  3H0G H;  2VUM G;  2K75 A;  1YHQ A;  1EQR A;  4BA2 I;  4A3D G;  2K52 A;  4IJL A;  1M90 C;  2IT1 A;  4WJ4 A;  4TVA B;  2C35 B;  3CCE A;  2ATW A;  1NMF A;  4YWL A;  1XMQ Q;  3HOV G;  5AJ3 Q;  2JA7 H;  1ASY A;  1YEZ A;  1VQK A;  1NJI C;  1JJ2 A;  3S16 H;  5HY6 A;  1O7I A;  2MO1 A;  4B3R L;  5ELN A;  2K4K A;  1N36 Q;  3WWV A;  4DR5 L;  3AYH B;  3CCU A;  1ASZ A;  1LM0 A;  1VQ4 A;  3PUX A;  4PZ8 A;  2VL6 A;  4TQU S;  2YTX A;  2I5H A;  1L1O B;  4LF4 Q;  2UXD L;  3PUZ A;  3KF6 B;  3M85 A;  1VQJ A;  4BY1 G;  1VQ7 A;  3J80 i;  3CCR A;  3D0F A;  1PVO A;  3UDX A;  1PH7 A;  1A8V A;  2CCZ A;  4JBK A;  1EOV A;  3CAM A;  1WYD A;  1I94 L;  1CUK A;  5GQO A;  3RLO A;  3I4M H;  3GTJ H;  1JJG A;  2NZH A;  1VS0 A;  5J3B A;  1J5E L;  2BA1 A;  2XTI A;  4LFA L;  3PCO B;  3L0O A;  2AWN A;  1N33 Q;  3GD7 A;  1YVC A;  5IE8 A;  1J6Q A;  3HOX H;  4A3L H;  4A3M H;  4QQB X;  2A8V A;  3A0J A;  2QEX A;  2UXC Q;  5C0X I;  1NBW A;  1QVG A;  2PI2 E;  3EBE A;  2HHH L;  4R1J A;  1PHJ A;  2D0P A;  1EQQ A;  2GN5 A;  1PYB A;  4DNI A;  4A3C G;  1AH9 A;  3BU2 A;  4DV3 Q;  2R7Z G;  1Q82 C;  3HOY H;  1S72 A;  3U4Z A;  1T9H A;  2CKZ B;  1KD1 C;  4JI4 L;  4GKK Q;  1X55 A;  4R4Q A;  2N3S A;  1I50 H;  3GTP H;  4GOP A;  1VQH A;  5M5Y H;  4OX9 Q;  5BR8 L;  4LFB L;  4JI5 Q;  4B3T L;  4P72 A;  2I5M X;  2PQA A;  1VQC A;  1RL2 A;  2UUB Q;  4NXM Q;  2VUM H;  3U50 C;  3STB C;  3UE1 A;  4DUZ Q;  2Q2U A;  3HOV H;  2ZJP A;  4HID A;  3CC7 A;  4IFD G;  3VDY A;  4DR4 Q;  5LMN W;  1PH5 A;  3JAM c;  4DV2 Q;  3L2P A;  1LYL A;  3CW2 C;  4DV7 L;  2VNU D;  2JA8 G;  1CKN B;  1YHB A;  5IYD H;  5IP9 H;  2VQF Q;  4DR7 L;  5HGQ A;  3RZD H;  1U5K A;  3H3V I;  5FLX c;  1KC8 C;  1E22 A;  4QGU A;  4GNX B;  4BY1 H;  5M5X H;  3ER0 A;  3CCV A;  1GKH A;  1KQS A;  1HNX L;  1EIY B;  4LF6 L;  2B63 G;  5IT9 c;  4UP7 A;  3OTO Q;  2Q2I A;  1W3S A;  1HH2 P;  3I4O A;  3CP0 A;  4QL5 A;  1UE6 A;  4DV1 Q;  1XNR Q;  4PMW A;  3KF6 A;  4L5T A;  1IBL Q;  2K50 A;  4O0A A;  3J7A 5;  4QJF A;  1PH8 A;  4L5S A;  3ERS X;  4DV0 Q;  3H15 A;  1P8L A;  3ULJ A;  5IWA Q;  3KFU A;  1TWC H;  2JEA I;  3GTL H;  4JBJ A;  4A3C H;  2UU9 Q;  3H0G G;  2NN6 G;  1X3F A;  2R7Z H;  2WFW A;  2BH8 A;  2N78 A;  4JBM A;  2UXB Q;  3K80 C;  4X65 Q;  2UUC L;  4YHH L;  2IHF A;  1FJG Q;  2R7D A;  4JI0 L;  1K73 C;  1GM5 A;  3CC2 A;  4XIG S;  3CXC A;  2F4V Q;  3PUW A;  3BJU A;  4DV5 L; 
#chains in the Genus database with same CATH topology
 2LXK A;  1Z9F A;  3VYR A;  4IFD H;  4JPB W;  1OO9 B;  2MJ8 A;  5JPM C;  3ULP A;  3LWU A;  4HR7 B;  1JQY D;  3TP8 A;  3KJO A;  2Z9H A;  2L12 A;  4I7Z C;  1SAP A;  3JAM i;  1QG7 A;  1VQ5 A;  2R7F A;  1EY8 A;  1FGU A;  1PZK D;  5L37 A;  1G8Z D;  1W6K A;  1SYG A;  1Q1B A;  4Q0F A;  4JYA L;  1CQF A;  2Z6K A;  5FJ8 G;  3DMU A;  3CQZ H;  1ESR A;  3CMA A;  3BG3 A;  2DJG C;  5FO8 B;  1KNE A;  4M8A A;  4J1M A;  1OXT A;  4LNQ A;  2N88 A;  1Q7Y C;  4A93 H;  3DLL A;  1N32 L;  1WTH A;  2NN6 H;  5JAV A;  1DCZ A;  2JN4 A;  1EU4 A;  2Z4H A;  2F0O A;  1JOO A;  2E2J B;  4GLX A;  1QUQ A;  4JG2 A;  4JOI C;  1AE3 A;  1NY4 A;  1J9O A;  3CCQ A;  4H02 A;  4LK1 C;  4BBS G;  4DUY Q;  1O7L A;  4JBW A;  2C9O A;  4Y52 H;  1B44 D;  3O13 A;  3S1R B;  2OQK A;  1ESF A;  2HIX A;  2A6H C;  4HMJ A;  3MXN B;  4BBS B;  1LT4 D;  1TS3 A;  5M3M B;  3TZD A;  5EGT A;  5KNB A;  1HUM A;  1BF4 A;  4ABN A;  1V8Q A;  4O2D A;  1HNW L;  3LGJ A;  2LY7 A;  1JCK B;  1VQ6 A;  3NSW A;  1C9O A;  4YY3 Q;  5DLQ E;  2H4O A;  3K58 A;  4HIO A;  5FJ8 H;  1O80 A;  1R4P B;  4AQY L;  1E1T A;  3AB9 A;  4X3U A;  3RUZ A;  1EUJ A;  4J15 A;  1J5E Q;  4GKK L;  1D5X C;  2E2J H;  5JJL A;  3FPU B;  3G71 A;  1WTV A;  4JI7 Q;  4PMB A;  1E24 A;  4P75 A;  3TQY A;  5CV7 A;  5FKA C;  1PYS B;  3M7G A;  3EA6 A;  4PG3 A;  1GUW A;  4DAY B;  3U4V A;  4TSS A;  3S1R H;  1VQN A;  1HR0 L;  3I2Z A;  3PIO 3;  2RVL A;  2F0D A;  4BBS H;  4DR6 Q;  1KRS A;  5M3M H;  4OO1 I;  2NB0 A;  4QMG A;  1PH4 A;  1AFP A;  1JJC B;  2RCF A;  1Q86 C;  3OTO L;  1IYU A;  2KCC A;  2B2W A;  4A4I A;  1PTO F;  1EFI D;  3HOW B;  1BCP C;  5FOB B;  1IYJ B;  3X3N A;  3IL8 A;  1SYF A;  5COR A;  5FO7 B;  2PO4 A;  1PTO B;  1EL0 A;  3T4A C;  3VR5 A;  3UI2 A;  3BDO A;  4O1N A;  2R92 G;  1DOL A;  1NTG A;  2YTY A;  1G51 A;  1F77 A;  1N8R C;  1F9S A;  3K5M A;  3V05 A;  4FF4 A;  1FNV A;  4H7B A;  4KHP L;  5DEH A;  1F9P A;  2R92 B;  1IHZ A;  4K5X A;  4HN7 A;  4L5Q A;  1TWA B;  2EYP A;  1WTX A;  3NK9 A;  5LMU L;  1WTR A;  1CKN A;  4CKE A;  1Q81 C;  3HOW H;  4HJ5 A;  2B2V C;  4GNX A;  4JI3 L;  1AZP A;  3NEN A;  3FPP A;  1XNQ L;  3LWE A;  3T1Y Q;  1PTO H;  3A5Z B;  1ZYR D;  5COY A;  3Q0A A;  3KF8 B;  2YTV A;  1EZ6 A;  4FVM A;  3C46 A;  2PZW A;  1VQF A;  1K8G A;  4LF9 Q;  1AP0 A;  4BA1 I;  3U9S A;  1H95 A;  5IOC A;  1XXG A;  5GAD C;  5AJ3 L;  2RHS B;  4OEL B;  3G6E A;  4DR2 L;  2F3W A;  2CH4 A;  2R92 H;  1GO3 E;  4BY7 G;  2VQE Q;  1YZ6 A;  1TWA H;  1A63 A;  4LF4 L;  1YJW A;  2OTJ A;  3MFG A;  3SHL A;  1G6P A;  4H44 C;  1SMX A;  4EQ5 A;  3BZK A;  2L15 A;  4BY7 B;  2WIN B;  2A19 A;  2ALY B;  2O5I C;  5IYC G;  1RCV D;  4DR5 Q;  4RKL A;  2K01 A;  1VQ9 A;  3U58 A;  3GTK B;  5C4Z A;  5EBC A;  3OW2 A;  2PI2 A;  3ZJY C;  4NW2 A;  1H9S A;  2LFN A;  4R8I A;  1BOS A;  2E2H B;  1DGS A;  3STB D;  4CJ0 B;  2CWA A;  2XWJ B;  3A8J E;  2HQE A;  4X64 Q;  4MTN A;  4AYB E;  4DK6 C;  2K32 A;  2UUB L;  1F2L A;  1I4H A;  2KHJ A;  3T51 B;  3W5O A;  5I6Y A;  2ID0 A;  2JEB I;  4KHV A;  2BA0 A;  2EVB A;  3SK4 A;  4C1N I;  1GHK A;  4JI4 Q;  1L0W A;  3VR3 A;  4R4T A;  3GTG B;  5JJI A;  3ERQ A;  1X54 A;  1BCP F;  1D5Z C;  1UWV A;  4Z9C B;  1K3B C;  4B9W A;  4BY7 H;  1SMY D;  4B3T Q;  3KLR A;  4ALP A;  3E9H A;  3OYY A;  4DV6 Q;  3GTK H;  4JK1 C;  3SVM A;  3S2D B;  1UNS A;  2K03 A;  1PLF A;  1BCP B;  1Q90 A;  3J81 c;  2IX3 A;  4POG A;  3I91 A;  4OXP A;  5IYC H;  5JEA G;  2EJM A;  1UE5 A;  3M4Y A;  1YNX A;  1QZH A;  3MWY W;  4A3B G;  2JA5 G;  2E2H H;  1PZI D;  4LF6 Q;  1PH9 A;  4C3H B;  2A5H A;  5JEA J;  2K5W A;  5C6A A;  3K7A B;  4A3B B;  5C5M A;  4C1N K;  2FXQ A;  1RHP A;  1JWS D;  2AMC B;  2B2T C;  2LS0 1;  4YIJ A;  1WCM G;  2F4V L;  4CDF C;  3GTG H;  4DAV A;  2O2L D;  2SNM A;  3AFQ A;  4OL7 A;  1UAP A;  5TSS A;  3DHQ A;  1IW7 D;  5C4J B;  2KHI A;  3HRZ C;  1WCM B;  1IYV A;  3S2D H;  4XT3 B;  1KLU D;  4OON A;  1LLR D;  1YJ9 A;  2JK8 A;  3IRB A;  1SRO A;  1CA5 A;  1HNZ L;  4AYB G;  4RFB A;  1PDQ A;  3TEH B;  3I55 A;  2J4X A;  4C3H H;  4R8N A;  3TP7 A;  1WJJ A;  1EOT A;  4PZ6 A;  5FLX L;  4AYB B;  3J81 i;  3K7A H;  1CKM A;  4A3B H;  1KAB A;  2OXP A;  3HZX A;  2NBF A;  3K6O A;  3I56 A;  1EY9 A;  1Z47 A;  3HOX G;  4HMI A;  5C0X G;  3BVG A;  2H5X A;  3MTS A;  4LUZ A;  2KEC A;  3JC6 6;  3SGI A;  3PIP A;  1AE2 A;  2HDM A;  2LKV A;  4FYD A;  5C4J H;  3PUV A;  4LF5 L;  2E2I B;  3TS0 A;  1WCM H;  1FNU A;  3HOX B;  1QNK A;  2X6L A;  4L5R C;  1S5D D;  1HZA A;  3NBI A;  5NUC A;  1E2V A;  4A3J G;  1JE5 A;  2B2Y C;  4DR1 L;  3VYT A;  5EBD A;  1RTO A;  1YHQ A;  1EQR A;  4N9P A;  1M90 C;  1B9N A;  4EQN A;  3CCE A;  2C35 B;  3HOV G;  4L63 B;  1Q8I A;  1YEZ A;  1JJ2 A;  3GV3 A;  1B3A A;  3DEP A;  1N36 Q;  4PZ8 A;  2VL6 A;  2YTX A;  3HOV B;  1JOR A;  3A55 A;  3VYU A;  1NAP A;  2SOB A;  2XWB B;  3D0F A;  1ROD A;  3UDX A;  1PH7 A;  2CCZ A;  1B4O A;  4CKC A;  5IGF A;  3ZYY X;  1U4M A;  1J5E L;  2BA1 A;  1VF5 C;  3L0O A;  3GD7 A;  5M5X B;  4TRD A;  3HOX H;  3OMG A;  4H0L C;  4A3L H;  4DN4 M;  2A8V A;  5C0X H;  5ELD A;  1NBW A;  4X3S A;  3EBE A;  2GN5 A;  1LTR D;  1S5B D;  3BU2 A;  1I4X A;  1Q82 C;  1VF7 A;  1KD1 C;  1E0B A;  4GKK Q;  4KJN A;  5HUR A;  4RGN A;  1TWC B;  3GTL B;  2AUJ D;  2PQA A;  1RL2 A;  4NXM Q;  2Q2U A;  3HOV H;  5IT9 E;  3VDY A;  2EPB A;  1KDC A;  4DF7 A;  5LMN W;  2F0V A;  1HXY D;  3R93 A;  1LYL A;  2BOS A;  3LX0 A;  2VNU D;  5C3X A;  1Q3L A;  1YHB A;  3Q22 A;  2JA8 G;  4DR7 L;  5HGQ A;  4OO1 H;  2K04 A;  1M8A A;  3CRL C;  4DK1 A;  4QGU A;  3R8B A;  5M5X H;  1EIY B;  1HNX L;  2SDF A;  1CK1 A;  2JA8 B;  4KV6 A;  3OTO Q;  1W3S A;  3CP0 A;  4DAP A;  2X69 A;  4DXF A;  1LAB A;  4FP5 D;  3A56 A;  1XNR Q;  4PMW A;  5CC4 A;  3KF6 A;  5CBA E;  2K50 A;  2B8F A;  4O0A A;  4CJ1 B;  5G3L F;  1PH8 A;  2F0E A;  5DNF A;  1TWC H;  3GTL H;  4PMC A;  3TN2 A;  1TWF B;  2FMM A;  4F88 A;  1X3F A;  2QIL A;  1JWU D;  2WFW A;  1MGS A;  5D3I B;  1R9T B;  4LAA A;  1LTA D;  2UUC L;  1PRT C;  3K59 A;  2D9U A;  1K73 C;  3D8G A;  3G7L A;  2D2C C;  2O4X A;  4DV5 L;  1SE8 A;  2M00 A;  2Z0S A;  5KRU A;  2J0T D;  4KK7 A;  3NWT A;  5M3F B;  1YNN C;  4KHP Q;  1TS2 A;  2D62 A;  5ELC A;  2K5D A;  2EDG A;  5E7N A;  1H9R A;  1UUP A;  2JA8 H;  2VY3 A;  5IT9 L;  3HKZ G;  2I07 B;  4NKL A;  4HJ9 A;  1PMR A;  1BBX C;  2RDG A;  3UE0 A;  1X65 A;  4JI3 Q;  4LWC A;  1TWF H;  2A68 D;  3ND8 A;  1XNQ Q;  1BO0 A;  1KIX A;  1KHI A;  4GZY C;  3A5U A;  4NXN L;  1R9T H;  2VQE L;  1MI2 A;  4BBR G;  1HR0 W;  3W1B A;  1MHW C;  1HHV A;  4JVZ A;  2NTT A;  2WAQ E;  1P16 A;  1HZB A;  3OIP A;  1MBY A;  1EYG A;  4G7O C;  1CFM A;  3NQI A;  2ZXO A;  2G9H D;  5M3F H;  4DR2 Q;  4BBR B;  2IX1 A;  1SLJ A;  4B9X A;  1B9M A;  1RJT A;  5IYD G;  5IP9 G;  4GOP C;  2ZT9 C;  1ET6 A;  2K6A A;  1GUS A;  1VQD A;  2F3I A;  4PZ7 A;  4ME5 A;  3RR5 A;  3QWN A;  1G2S A;  1X32 A;  2E2D C;  1Q1E A;  2K14 A;  2HQL A;  1K83 B;  3A8K E;  5C3E B;  2R61 A;  1EY7 A;  3F2D A;  2L5T A;  3I4N H;  1I6H B;  1HA5 A;  4X64 L;  1X3E A;  3S17 B;  2UXD Q;  2NYZ D;  1FGB D;  3CCL A;  1H9J A;  3IAY A;  3KLW A;  2WB1 G;  4RWS C;  2F0Q A;  3K5N A;  2L1B A;  2LSS A;  1QE6 A;  4BBR H;  4TKO B;  1K0S A;  1V1P A;  4I7A A;  4OX9 L;  1HCZ A;  3KK7 A;  4DV6 L;  4NB3 A;  1AEX A;  2WAC A;  3UDI A;  1SE3 A;  3FKI B;  2ENB A;  2Q8R E;  5E3F A;  3UDG A;  1VQM A;  3EFX D;  4DPG A;  2GA4 B;  3PIP 3;  1K83 H;  1JB7 A;  1IKL A;  2HCI A;  4IFD J;  1HUN A;  5C3E H;  2MHV A;  5KIX A;  5K36 H;  1I6H H;  1H9M A;  2ICI A;  4BWG B;  2WAQ G;  5ELB A;  1LO5 D;  1L1O A;  1PRT F;  2DUD A;  3KBG A;  5ELF A;  3S17 H;  1FR3 A;  2N8N A;  4G57 A;  3E9I A;  5DAU A;  3NXW A;  3WDN A;  5C44 B;  4DV7 Q;  3RLF A;  2ES2 A;  1QVF A;  1IBL L;  3HOU B;  2WAQ B;  1MIU A;  4A93 G;  5GAE C;  1PRT B;  2GVA A;  5D65 A;  2SNS A;  5HGT A;  1U0L A;  1YNJ D;  2LXJ A;  3AQQ A;  4LW1 A;  2Z6K C;  1UE7 A;  3NBH B;  3IFT A;  3FKI H;  1FJG L;  4GN3 B;  3CCJ A;  3MEF A;  2RBM A;  3PSI A;  3Q6S A;  1IL2 A;  2CW0 C;  2GVB A;  2KEN A;  5LL6 X;  4RAU C;  2E74 C;  2PW5 A;  2PZU A;  4GN4 B;  4IUN A;  2WII B;  1UEA B;  1HNZ Q;  2PCF B;  5C44 H;  1MKH A;  2JJQ A;  3GP7 A;  1OXU A;  4ZKC B;  1TS4 A;  4ZCK A;  1SND A;  2K28 A;  2K5V A;  2RCN A;  1CA6 A;  3HOU H;  4LUV A;  1PYW D;  5C3W A;  1LTL A;  1EYD A;  1VCI A;  2DN8 A;  1PZJ D;  2Q2T A;  1E2W A;  3K81 C;  4KN4 C;  3RZO B;  3G4S A;  2M2L A;  5CYU A;  1D8L A;  4P74 A;  3HKS A;  1GD7 A;  1EWI A;  1U4L A;  4ILW A;  4MZ9 A;  3FMC A;  4R4C A;  3PF4 A;  3GTQ B;  4LF5 Q;  5A35 A;  1JOK A;  2Z4I A;  4U67 3;  4GOP B;  3D4W A;  1XMO Q;  1L0X B;  1D5M C;  3NEM A;  2F03 A;  4OWX B;  1N36 L;  2MQH A;  5M3M G;  4DNR B;  1ZXT A;  4KKT A;  4DR1 Q;  4A3E G;  2IPK D;  1SNP A;  3T1H L;  3H94 A;  4JI1 L;  1QIL A;  3KLS A;  3ND9 A;  1D7Q A;  3FDT A;  4FDB A;  5GAH C;  1EIF A;  1X3G A;  2ZXP A;  4N8F A;  4A3E B;  3OW7 A;  5CV5 A;  1FVI A;  2KBN A;  1IKM A;  3J80 L;  4M1U B;  3C1E A;  4A3D B;  1EQT A;  2VS1 A;  5BN3 A;  1XPR A;  3RZO H;  1VQG A;  2ZTC A;  1A6X A;  2CHB D;  1CKO A;  3NQT A;  2B2W C;  3GTQ H;  5DM6 3;  3SR1 A;  4K14 A;  1LTG D;  2HCC A;  2IY5 B;  4X66 L;  1STA A;  2ZM6 L;  4C3J G;  3CD6 A;  2NWG A;  3ULL A;  4NXM L;  3RNU A;  1YBY A;  2OQ0 A;  4K6L A;  2XVS A;  4KHZ A;  3EQL C;  3BZC A;  1CHQ D;  1VQL A;  4C3J B;  4LF7 Q;  4CJ2 C;  4JI8 Q;  4JOI A;  2QEJ C;  2RSN A;  1YIJ A;  2XRS D;  4A3E H;  2JEA I;  3EIV A;  1VQP A;  1A2T A;  2UUA L;  3HOW G;  4A3D H;  1ZKO A;  2EYO A;  4UDU C;  1B53 A;  1XNR L;  3N52 A;  4DR7 Q;  4S3S A;  4A3G G;  1V1Q A;  4G4K A;  1HNX Q;  2F52 A;  3TRZ A;  4E6I A;  5AFW A;  4RMF A;  2KCN A;  4A3G B;  4GNX C;  1ICW A;  3K5O A;  1WFQ A;  1WD0 A;  3B6Y A;  1LTS D;  4C3J H;  4IUT A;  1Y1W G;  4JC0 A;  3VA5 A;  4B08 A;  2C5C A;  2XGT A;  1QUQ B;  2UUC Q;  5I2X A;  1K0R A;  2NZ1 D;  3W1G A;  1Y1W B;  2XIW A;  2JA7 G;  1SXT A;  1GVP A;  2I5L X;  2K5H A;  4DV5 Q;  2PNH A;  2OCE A;  1QB5 D;  3Q8D A;  1A62 A;  2JE6 I;  4XYO A;  3S16 B;  2JA7 B;  1X56 A;  3L7Z C;  3P1H A;  5JOB A;  2QKI C;  4JI2 Q;  1TWG H;  3NTI A;  2IW3 A;  3TZU A;  2BH2 A;  1WOC A;  4A3G H;  1HZ9 A;  1BKB A;  3DM1 A;  3KDF A;  4MIU A;  5C5L A;  5FO9 B;  4IUQ A;  5EPJ A;  1VQI A;  3HFZ B;  4LF8 L;  4HIM A;  3A74 A;  1HZC A;  1SYD A;  3CKI B;  3I4M B;  1STB A;  4NXN Q;  3HOY G;  4A3M B;  3FP9 A;  1Y1W H;  1SE2 A;  4P2C B;  1EWH A;  2V4D A;  2TMP A;  2E5L L;  4CDD C;  1WI5 A;  1ZYR C;  1EQV A;  4ME3 A;  4UY8 C;  3HOY B;  2L9H A;  2EYJ A;  4ZUJ A;  5I9P A;  2X6G A;  4BA2 I;  2K52 A;  4IJL A;  2JYO A;  2IT1 A;  2ATW A;  2JA7 H;  3S16 H;  1I50 B;  1NJI C;  3GTP B;  2MUY A;  3CCU A;  4U68 A;  1LM0 A;  4TQU S;  2I5H A;  3IFD A;  2UXD L;  3I70 A;  1G6Z A;  1ENC A;  1VQ7 A;  1EOV A;  3FVQ A;  5GQO A;  5KEE A;  3RZD B;  3I4M H;  4H13 C;  5CMD A;  3SDZ A;  1YVC A;  2A69 D;  4A3M H;  4C56 C;  3A0J A;  1TY2 A;  2Q8I B;  2PI2 E;  2D0P A;  2PW7 A;  2IL8 A;  1AZQ A;  1AH9 A;  4KD4 A;  1CT1 D;  3HOY H;  4R4Q A;  2WV6 D;  1I50 H;  3GTP H;  4OX9 Q;  4JI5 Q;  5FLX E;  3L3O C;  2EYH A;  1CM9 A;  3NTH A;  3STB C;  4C3H G;  3PQI A;  1WTO A;  3GTO B;  3L2P A;  2Z8L A;  5A2Q E;  4DV7 L;  1CKN B;  3TP6 A;  2VQF Q;  2EYF A;  3A7A B;  2RKS A;  3RZD H;  1U5K A;  3H3V I;  3BVM A;  2F4I A;  4KKU A;  3CRK C;  4OEM B;  4EGV A;  4GNX B;  4EQO A;  3CCV A;  1SMY C;  1GKH A;  2QCP X;  1BUV T;  5IT9 c;  3I4O A;  3OPO A;  4DV1 Q;  4KKS A;  1IBL Q;  1C48 A;  1HA6 A;  2OT2 A;  2TSS A;  2F0J A;  2PPB C;  4L5S A;  3J7A 5;  4DV0 Q;  2ZXR A;  3H15 A;  2O5J C;  3SK6 A;  1P8L A;  3ULJ A;  4XDX A;  2XN9 C;  4JBJ A;  4QCL A;  1D2B A;  2BH8 A;  4IUU A;  3K80 C;  4FXG C;  1EY0 A;  4K8J A;  1FJG Q;  3GTO H;  3MFY A;  1LT6 D;  4QUC A;  2RA4 A;  3CPF A;  4KTA A;  3QIA A;  1XPO A;  4IFD I;  3DUZ A;  4WJW A;  2F3V A;  2OWO A;  3I7F A;  3F2B A;  1IW7 C;  4KY5 A;  4DV4 L;  4GKJ L;  1JIC A;  3K5L A;  4IN3 A;  2HHH Q;  4NPS A;  4A3L G;  4K0K L;  3PO3 B;  5CR3 A;  1YJN A;  3DWA A;  4JV5 L;  5A2Q L;  3NE5 B;  1KNA A;  1STG A;  1UE1 A;  3NP8 A;  1SJH D;  3K0X A;  3KJP A;  5C0X J;  1XMO L;  4A3F B;  1K9M C;  4DKA C;  1SR3 A;  2Q8T A;  2NVX B;  4IJH A;  4B3M L;  4WJ3 M;  2AQ3 B;  4RGO S;  4UPA A;  2NN6 I;  2IJ0 A;  5EKK A;  2CQA A;  4F87 A;  3CCM A;  5IGD A;  3GO5 A;  3QOJ A;  1JMC A;  3AU7 A;  5ELO A;  5LHY 1;  1EIH A;  1XMQ L;  2BCO A;  1PV4 A;  1G2T A;  4QB4 A;  4RGM A;  4OO1 G;  3MZ5 A;  5EKI A;  1BQQ T;  2ZTE A;  1I4Q A;  4G7H C;  4CHT B;  3J81 j;  3T1H Q;  1SNQ A;  4JI1 Q;  1JOQ A;  4DXG A;  3PO3 H;  5T1I A;  4YWK A;  5CV8 A;  1HQM C;  2EE1 A;  3R2I A;  4IPG A;  5CV4 A;  4DK3 C;  1OTC A;  1DD2 A;  1C7Y A;  1SBB B;  2JA6 G;  2RQX A;  1NR4 A;  1N33 L;  4A3F H;  4G7Z C;  2BE5 C;  2WP8 J;  2EJF C;  1Y14 B;  2EY1 A;  4MNO A;  3K7U C;  5ISR A;  1PFM A;  1W6J A;  3QB3 A;  2NVX H;  2JA6 B;  1KXL A;  1II3 A;  3S15 B;  3S2H B;  4DV3 L;  2EJG C;  4HSV A;  4Q5V A;  3CF5 A;  4LF7 L;  1Z7T A;  4X3T A;  4X66 Q;  3VA7 A;  4JI8 L;  4LFA Q;  3P75 A;  2ZM6 Q;  1Y1V B;  1RIP A;  2KHS A;  3HOZ G;  3TS2 A;  2OEO A;  3H3V C;  2N49 A;  2B2Y A;  2KCT A;  1LTB D;  5KGU A;  3RLN A;  4DUZ L;  3WOE A;  4ZQ3 A;  3HOZ B;  4IUR A;  4OWT B;  1S5F D;  4DR4 L;  3A7L A;  4XXE A;  1MSG A;  4DV2 L;  1NMG A;  3BDL A;  4LFB Q;  2UUA Q;  1Y69 U;  1KRT A;  4F8M A;  2G5D A;  3E0J A;  1PFS A;  1IL8 A;  4O42 A;  4POF A;  1JT8 A;  1B3Q A;  1EYA A;  3J7Z C;  1X3Q A;  1F9Q A;  1MD2 D;  1KTK A;  3CU7 A;  4YCV A;  4KLK A;  1LT3 D;  2JA6 H;  1SNM A;  5EQ0 A;  2A6E D;  3S15 H;  3S2H H;  4FF1 A;  5H1S E;  2EZV A;  3LNN A;  5EJW A;  1Y1V H;  4J6H A;  1NR2 A;  2EXD A;  5JJK A;  1CI3 M;  2N55 A;  1PH1 A;  5BN4 A;  2Y0S E;  1A2U A;  5M3F G;  2VXW A;  4OIK A;  3HOZ H;  2NVT B;  1DZ1 A;  1I5F A;  4RHS A;  3CCS A;  1YNN D;  2HT1 A;  2ZJQ A;  1QWY A;  4MTK A;  1B50 A;  1E1O A;  3EN2 A;  1HFG A;  3TDQ A;  5D14 A;  4A3K G;  4HJ8 A;  2NVY B;  4YHH Q;  1IXR A;  5CV6 A;  1DOK A;  1S5C D;  1BR9 A;  1MSH A;  4JI2 L;  1HQR D;  1LTT D;  5M9O A;  3F2C A;  2F0S A;  3I4N G;  4A3K B;  5C4X G;  4KJO A;  4OIJ A;  2K5N A;  1TXY A;  3Q24 A;  3HG9 A;  4HTH A;  1SNC A;  4C3I G;  1NE3 A;  1U4P A;  3PO2 G;  3SXH A;  3I4N B;  2MFI A;  3KBX A;  5C4X B;  2BDN A;  1GJX A;  2B2U A;  3PF5 A;  1F2Z A;  3CC4 A;  4N8X 1;  4C3I B;  5IY0 A;  4XT1 B;  1M1K C;  1MJE A;  5LL6 S;  4LF8 Q;  2NVT H;  1O7Y A;  3PO2 B;  1Q12 A;  3GDE A;  1A3V A;  3D6C A;  1PA6 A;  2RF4 A;  4FXD A;  5CBE E;  3FRP B;  1EY4 A;  1UEB A;  1LUZ A;  5I9O A;  5KYI A;  2VZA A;  4QY7 A;  2NVY H;  5K5P A;  2PQA B;  1STN A;  2E5L Q;  2A68 C;  3H6M A;  1PH6 A;  2QGQ A;  5IGB A;  5C3E G;  2VW9 A;  3MEH A;  2E75 C;  4RH6 A;  4C2M B;  5K36 G;  1CSQ A;  4A3K H;  1S4Z A;  1I6V C;  1XX8 A;  4NDX A;  4XQN A;  3KOJ A;  5IP7 H;  2EXZ A;  2Y0S G;  4I65 A;  4F7X A;  3M9B A;  5C4X H;  2B29 A;  2QDB A;  4V19 0;  1VQE A;  4IUP A;  1QOH A;  3IKJ A;  4C3I H;  2Y0S B;  2I46 A;  4P73 A;  2WKD A;  2K1B A;  3PO2 H;  2M9V A;  1KAW A;  1L1O C;  2L0C A;  4UP8 A;  2AUK A;  2Z1C A;  1JR0 D;  3FKI G;  2PNR C;  2NUC A;  1GUO A;  4JI5 L;  1S40 A;  1IBM L;  1D1I A;  4AH6 A;  3V96 A;  3VR2 A;  1TVX A;  2AKW B;  1NUC A;  1STH A;  3VR4 A;  1F9R A;  2B39 A;  4DU9 A;  4DAM A;  4C2M H;  1EY5 A;  1X6O A;  3NEL A;  3Q23 A;  2A1A A;  4IAL A;  4AIM A;  2EYL A;  4CDE C;  4R4O A;  2VQF L;  2EYM A;  2AQ1 B;  3T56 B;  5C44 G;  2ASB A;  3HOU G;  4GN5 A;  1LT5 D;  3T13 A;  4L8J A;  1I3Q B;  3X3M A;  1LTI D;  4IOC A;  4UP9 A;  4DV1 L;  3MXN A;  2JQO A;  1DJR D;  2QDL A;  1T5E A;  4DV0 L;  3H3V H;  1ENF A;  1HRJ A;  1CSP A;  1ENA A;  2FIN B;  4DNT B;  1GOZ A;  2F0L A;  1PTO D;  3I4L A;  1EZ8 A;  2F0U A;  2R93 G;  2K33 A;  3P7J A;  3M4Q A;  3J80 E;  2EQS A;  3J7A V;  2R93 B;  1WTP A;  1I3Q H;  4DAY A;  1YNJ C;  2HIV A;  3NPP A;  4B3S L;  4YCW A;  1SFO B;  3H0G B;  1TQO A;  4LFC L;  1KAA A;  4X62 L;  2A73 B;  1Q46 A;  4K8I A;  2F0M A;  4KI0 A;  3E0E A;  4WRD A;  3GV6 A;  1TKW B;  3ICE A;  1F2Y A;  1PH3 A;  4YWM A;  4DV4 Q;  1XTD A;  2KQ3 A;  5JPN C;  4GKJ Q;  2E8G A;  3NTK A;  1MJC A;  5JVG 3;  2WKC A;  4K0K Q;  4JV5 Q;  5IGG A;  5LMN L;  2QA4 A;  3OMC A;  1U4R A;  1ZEQ X;  1I4G A;  4BS9 A;  3GTJ B;  1SYC A;  2F0I A;  2YYZ A;  2F0T A;  1V1P B;  4R4I A;  3NUC A;  2R93 H;  1OXX K;  4B3M Q;  1G29 1;  1DOM A;  2A6H D;  2HDL A;  1SFO H;  3H0G H;  2K75 A;  4A3D G;  4CGY B;  2G9D A;  4WJ4 A;  4TVA B;  1NMF A;  4YWL A;  1XMQ Q;  5I6W A;  4FF3 A;  5HY6 A;  1O7I A;  5M5Y B;  1VMC A;  3WWV A;  2CH4 W;  2K05 A;  4R9W A;  1HTL D;  4RCO A;  1L1O B;  3K57 A;  5J1Z A;  4ZAI A;  1FYC A;  1LV9 A;  4BY1 G;  2XRQ D;  3CCR A;  1PVO A;  3SEB A;  1A8V A;  4JBK A;  4KY7 A;  1WYD A;  1CUK A;  3TP5 A;  3GTJ H;  5J3B A;  4LFA L;  2DNE A;  1XTC D;  3PCO B;  2AWN A;  4BY1 B;  1N33 Q;  1J6Q A;  4QQB X;  2FJ2 A;  3J7Y W;  5C0X I;  3KF8 A;  1PYB A;  1PTO C;  1DM0 B;  4A3C G;  4DV3 Q;  2R7Z G;  1GHJ A;  1Y8O B;  2D5D A;  2P5Z X;  1TII D;  2CKZ B;  3JAM E;  2FFK B;  1O78 A;  5I2Y A;  5M5Y H;  4LFB L;  5BR8 L;  2R7Z B;  4P72 A;  4DGZ A;  3U50 C;  2B8G A;  4PV1 C;  3UE1 A;  4DUZ Q;  4HID A;  1I4P A;  2DJF C;  4LJZ C;  3OOC A;  1ONL A;  1BCP D;  4DR4 Q;  4FXK C;  2RDF A;  5J22 A;  4CBV A;  4DV2 Q;  1CTM A;  2AQ2 B;  3WOF A;  2LMC B;  5FLX c;  4XQJ A;  4RHR A;  1E22 A;  1I4R A;  1KC8 C;  4BY1 H;  1O7Z A;  1PXU A;  1KQS A;  1A15 A;  1SNO A;  1STE A;  1TWG B;  2F0N A;  2B63 G;  2Q2I A;  3TSS A;  3EVQ A;  4QL5 A;  1UE6 A;  3R3O A;  4L5T A;  4QJF A;  2B63 B;  1NCV A;  5IWA Q;  3KFU A;  3TBI B;  1JE4 A;  1XWE A;  4A3C H;  2UU9 Q;  2R7Z H;  2N78 A;  5IOD A;  4YHH L;  3BVZ A;  3SK5 A;  2IHF A;  2R7D A;  4FO2 A;  4IZ8 A;  3CC2 A;  1Z6H A;  3CXC A;  4OHJ A;  1DXM A;  3GTM B;  1IZ6 A;  5J39 A;  3W3A A;  4MHE A;  3JAM L;  3K8A A;  2OF1 A;  1SEB D;  3OSO A;  1K3R A;  3C3L A;  1K8O A;  4P71 A;  3DM3 A;  3OWE B;  2R3Z A;  4X6A H;  4ZLT F;  3I4M G;  2KA7 A;  1YIT A;  5E4W C;  3OWF A;  3G48 A;  3S24 A;  1R4Q B;  2DY8 A;  2R6G A;  4A3M G;  3L9A X;  3S9W A;  3H91 A;  3I72 A;  5GAG C;  2B63 H;  1JC7 A;  2EY5 A;  1EEI D;  4EQP A;  1C4Q A;  3F8T A;  4HJA A;  1N34 L;  4DR3 Q;  4OWW B;  5FLM G;  1JWM D;  3G6J B;  3D31 A;  1A0I A;  2DY7 A;  3I90 A;  4JW0 A;  2F0K A;  2IHE A;  3M4O B;  3C2P A;  4ODG A;  3W2D A;  1IBK L;  3GTM H;  3T16 A;  4WOR A;  5JVH 3;  1ILP A;  5IGC A;  2V1C C;  4IPH A;  1ICF B;  1H9K A;  1V43 A;  1ET9 A;  1CZW A;  1D1K A;  4HCE A;  2AHO B;  4JI6 Q;  2FMC A;  4RG1 A;  4NP5 A;  3BYT B;  3CME A;  2B2V A;  1F2M A;  3HGB A;  4N9T A;  4K6D A;  1B2T A;  1CHP D;  3J7A F;  4B3R Q;  5GRO A;  2ZJR A;  3S14 B;  1C8C A;  2KJX A;  3KLS X;  4DK0 A;  1WVL A;  1NNX A;  1SYE A;  4Y7N B;  2YU9 B;  1CZG A;  1PH2 A;  4XYQ A;  1RTN A;  1QCB D;  2UXC L;  5T1G A;  5JJZ A;  2NTS A;  1QZG A;  3M4O H;  1TT2 A;  1I94 Q;  3EJI A;  5FLM H;  4A76 A;  1STY A;  2MPM A;  1IBM Q;  4PNY A;  1NSN S;  1SSO A;  4EVO A;  1C0A A;  1EIG A;  1K28 A;  2A69 C;  4K2L A;  3HEJ A;  3OHX C;  1KL9 A;  2J7Z A;  1VQO A;  5EPL A;  1GUN A;  3I8Z A;  3D4D A;  1E3P A;  3MVV A;  1X3P A;  3S14 H;  3S1Q B;  1WD1 A;  4Y7N H;  2L55 A;  2ICE C;  5BN5 A;  2YU9 H;  3E5S A;  4KN7 C;  3E3X A;  3KDF B;  2YV5 A;  4HED A;  1XPU A;  1B70 B;  4GLA C;  2JSO A;  3NWS A;  4RGT A;  1LAC A;  2HD3 A;  2PMZ E;  4A75 A;  3NHH A;  2UXB L;  2NZO A;  5CGK A;  4X65 L;  5M5W B;  5G3L D;  2JA5 B;  4LMQ D;  2XNA C;  4ULL A;  1E2Z A;  1TR5 A;  2H1E A;  1XJV A;  1GUG A;  3DEO A;  3HP3 A;  1HTP A;  2A74 C;  2DGY A;  2EIF A;  3S1Q H;  2KOL A;  1DYQ A;  2Q2H A;  3PO3 G;  2JP1 A;  4K5W A;  5IGE A;  3S1M B;  1DON A;  1VDZ A;  4JI0 Q;  3SE0 A;  4B3S Q;  3BDC A;  1QVC A;  3V2T A;  1H9S B;  4FF2 A;  4K5V A;  1RDP D;  4A3I G;  4LFC Q;  3U9O A;  4X62 Q;  2ZTD A;  2B3G A;  2QW7 A;  4A3F G;  1K8A C;  2XSC A;  2VB3 X;  2F0W A;  3MXG A;  4JCV E;  1RD9 D;  3ITP A;  4A3I B;  5JEA H;  1BDO A;  3VYS A;  2B2T A;  2D0O A;  4XTC S;  1L2F A;  3K0Y A;  2FHT A;  5M5W H;  2F0G A;  4GLV B;  4LUO A;  5ELE A;  2JA5 H;  3QJY A;  5LMN Q;  1SE4 A;  4JYA Q;  1SDF A;  2JA9 A;  1TWH B;  3PUY A;  3RN5 A;  1AN8 A;  4V0B A;  4HJ7 A;  1WTW A;  1WTQ A;  4BXX G;  1ML0 D;  1QNU A;  2KVM A;  4ZKB B;  1SN8 A;  4L6T B;  3RD4 A;  1S3O A;  3S1M H;  2MNA A;  4GS3 A;  2I0Q A;  1N32 Q;  1EU3 A;  4DUY L;  5D3D A;  2EOT A;  1ILQ A;  1EYC A;  1RF2 D;  2L11 A;  1CQV A;  1BBU A;  2EY2 A;  1FNW A;  3RN2 A;  4IPC A;  4PQX A;  4IOA A;  3E6Z X;  4HSP A;  4IPD A;  2F0F A;  2KEE A;  4A3J B;  4A3I H;  3M4P A;  2BE5 D;  1J8I A;  2PMZ B;  1Y1V G;  1TU2 B;  5EAY A;  1KDB A;  4YY3 L;  2DNC A;  5FK9 C;  2EY6 A;  3FHW A;  1FL0 A;  1TWH H;  3A8I E;  4CDC C;  1BBW A;  4KD3 A;  2OTL A;  1K8M A;  3GQB A;  1HNW Q;  2E2I H;  2CQO A;  3BYY B;  1VQ8 A;  4ID6 A;  2MO0 A;  4JI7 L;  4MN3 A;  3S1N B;  4BXX H;  2MP1 A;  4ZUI A;  4AQY Q;  1VQA A;  3F1Z A;  5KNC A;  3J81 E;  3ERO A;  3DXJ C;  4QIW E;  3D4R A;  2IWH A;  5BR8 Q;  1A3T A;  4DR6 L;  3PV0 A;  4NMZ A;  3HKZ E;  4K2K A;  4A3J H;  5C4H A;  1B8A A;  2Z6B A;  2QF7 A;  3OIQ A;  1HR0 Q;  1PFB A;  1PFN A;  1QJO A;  3M3Y B;  3T53 B;  3A54 A;  4ZYS A;  1RKN A;  3P20 A;  1BVS A;  3DWP A;  4RCN A;  5IWA L;  1HPC A;  4YCU A;  1KDA A;  1PRT D;  1T5X D;  2UU9 L;  1YHA A;  4KY6 A;  1X9N A;  1Y8P B;  1GUT A;  3S1N H;  1V1O A;  1VQB A;  1TS5 A;  2BDO A;  4XQQ A;  1EEF D;  2F0P A;  2NVQ B;  3MA2 B;  1SYB A;  2B2U C;  5IYB G;  3KUP A;  4EX5 A;  5DM7 3;  1SJE D;  2A6E C;  2E76 C;  5CV9 A;  5KYL A;  3MXU A;  3I3C A;  3TRE A;  4APV A;  1E7Z A;  3AFP A;  1W2B A;  5IP7 G;  3FEW X;  4HIK A;  2MGS A;  4DFA A;  4ZK9 B;  3C1F A;  2K7V A;  2VB2 X;  2RHQ B;  3AEV A;  4OGQ C;  3M3Y H;  3J81 L;  4IO9 A;  3UDF A;  1SRU A;  3PGZ A;  3CPW A;  5I4D A;  1L0Y B;  3J80 c;  1OXS C;  2AWO A;  3URY A;  3I73 A;  2WB1 E;  4UAI A;  2KCM A;  4DR3 L;  1EFW A;  1Q8K A;  3M7N A;  3T1Y L;  2RSO A;  5LMU Q;  2NVQ H;  4ZRZ A;  1V9P A;  1N9W A;  1B7Y B;  2F1M A;  4QIW B;  4LF9 L;  3KYH C;  3PIO A;  5EKL A;  1N34 Q;  2CFM A;  1GXD C;  2F0H A;  1HJP A;  1S5E D;  3HKZ B;  2KED A;  1YI2 A;  5IYB H;  1U9R A;  1BNZ A;  2RDH A;  3NBH A;  1EY6 A;  1G91 A;  2PQE A;  3QO2 A;  2IX0 A;  1IBK Q;  1OXV A;  2CWP A;  4JI6 L;  3R2T A;  2VUM G;  4RA8 A;  4CKB A;  5AJ3 Q;  1XYI A;  1ASY A;  1VQK A;  4IQZ A;  4B3R L;  2MO1 A;  5ELN A;  2SEB D;  2K4K A;  3MHB A;  4J8Q A;  4DR5 L;  2VUM B;  3AYH B;  1ASZ A;  1VQ4 A;  3PUX A;  5EPK A;  3QOL A;  4QUF A;  4WFN 3;  4LF4 Q;  1TY0 A;  2CVR A;  3MXP A;  4HCS A;  3PUZ A;  3QR8 A;  3KF6 B;  3TME A;  3M85 A;  1VQJ A;  3J80 i;  3CHB D;  1AW7 A;  3ONA B;  3BZD B;  3CAM A;  1I94 L;  1FD7 D;  3RLO A;  1EWC A;  1Y8N B;  3D6W A;  2PYK A;  1JJG A;  2NZH A;  1VS0 A;  2PZT A;  2XTI A;  3F2U A;  5IE8 A;  2L4N A;  2QEX A;  2UXC Q;  2HHH L;  1QVG A;  4R1J A;  1PHJ A;  1EQQ A;  5IIF A;  3MAQ A;  4DNI A;  1JB3 A;  4KMU C;  1S72 A;  3U4Z A;  4X3K A;  3DWQ A;  1T9H A;  4JI4 L;  1X55 A;  3N6R A;  2N3S A;  4GOP A;  1VQH A;  4B3T L;  2I5M X;  1VQC A;  2WB1 B;  2UUB Q;  2VUM H;  5E1F A;  3BS1 A;  2JXM B;  2ZJP A;  5F2D A;  3CC7 A;  4IFD G;  1PH5 A;  3JAM c;  3H09 A;  3CW2 C;  2HUG A;  4IUV A;  4DA2 A;  5IYD H;  5IP9 H;  1KLG D;  3D3R A;  4QF4 A;  1HFN A;  4LF6 L;  4RKB A;  3ER0 A;  1VMP A;  1D6E C;  2K5Q A;  4UP7 A;  3MC0 B;  1B1Z A;  1HH2 P;  3PMF A;  3VR6 A;  4HAE A;  3SK8 A;  3ERS X;  2CW0 D;  5E4X A;  3RMH A;  3QG1 A;  4FNF A;  2KUM A;  3CQZ B;  3H0G G;  2NN6 G;  3HS0 C;  4UHV A;  4JBM A;  2UXB Q;  4X65 Q;  1M4V A;  3AMU A;  4JI0 L;  1BXT A;  1GM5 A;  4A93 B;  4XIG S;  1A3U A;  2F4V Q;  3PUW A;  3BJU A;  5KND A; 
#chains in the Genus database with same CATH homology
 1SE8 A;  2Z0S A;  1IZ6 A;  2LXK A;  5C4X G;  1Z9F A;  3K8A A;  1K3R A;  4KHP Q;  3CPF A;  4IFD I;  2D62 A;  1XPO A;  3ULP A;  3I7F A;  3F2B A;  2OWO A;  3KJO A;  4P71 A;  5E7N A;  3DM3 A;  2JA8 H;  4DV4 L;  4X6A H;  3I4M G;  3JAM i;  4GKJ L;  1VQ5 A;  2VY3 A;  1YIT A;  2R7F A;  2HHH Q;  3HKZ G;  1FGU A;  3G48 A;  4NPS A;  3S24 A;  2R6G A;  4A3M G;  4A3L G;  4K0K L;  4HJ9 A;  1YJN A;  5GAG C;  2B63 H;  1Q1B A;  4JV5 L;  4JYA L;  3UE0 A;  2Z6K A;  1X65 A;  5FJ8 G;  4LWC A;  3CQZ H;  4JI3 Q;  1UE1 A;  3F8T A;  4HJA A;  3CMA A;  1TWF H;  3K0X A;  1N34 L;  1XNQ Q;  4DR3 Q;  3KJP A;  1KHI A;  5C0X J;  1KIX A;  4OWW B;  3A5U A;  1XMO L;  4NXN L;  1R9T H;  1OXT A;  5FLM G;  1K9M C;  4LNQ A;  4DKA C;  3D31 A;  2VQE L;  1A0I A;  1SR3 A;  1Q7Y C;  4A93 H;  3DLL A;  1N32 L;  4BBR G;  4IJH A;  2IHE A;  1HR0 W;  3W1B A;  4B3M L;  4WJ3 M;  1IBK L;  4UPA A;  2NN6 I;  3GTM H;  2WAQ E;  3CCM A;  1P16 A;  1HZB A;  3GO5 A;  1EYG A;  1JMC A;  2V1C C;  5ELO A;  5M3F H;  4IPH A;  4DR2 Q;  4GLX A;  1XMQ L;  1QUQ A;  4JG2 A;  2IX1 A;  1SLJ A;  4JOI C;  1AE3 A;  1PV4 A;  1NY4 A;  1V43 A;  3CCQ A;  5IYD G;  4H02 A;  5IP9 G;  4BBS G;  4DUY Q;  4OO1 G;  4JBW A;  4GOP C;  2ZTE A;  4Y52 H;  2AHO B;  1VQD A;  4JI6 Q;  4RG1 A;  2F3I A;  4PZ7 A;  3J81 j;  3T1H Q;  4JI1 Q;  3RR5 A;  2OQK A;  3CME A;  2HIX A;  3PO3 H;  3MXN B;  1Q1E A;  2K14 A;  4YWK A;  2HQL A;  4B3R Q;  5GRO A;  4DK3 C;  4IPG A;  2ZJR A;  1OTC A;  3F2D A;  1C7Y A;  2JA6 G;  4O2D A;  3I4N H;  1HNW L;  3LGJ A;  4X64 L;  1PH2 A;  1N33 L;  1VQ6 A;  4A3F H;  1X3E A;  1C9O A;  2UXD Q;  4YY3 Q;  5DLQ E;  2UXC L;  4HIO A;  2WP8 J;  3CCL A;  5FJ8 H;  1Y14 B;  4MNO A;  3K7U C;  2NVX H;  1QZG A;  1KXL A;  3KLW A;  3M4O H;  4AQY L;  2WB1 G;  1E1T A;  1I94 Q;  4DV3 L;  3CF5 A;  4LF7 L;  5FLM H;  4X66 Q;  1EUJ A;  2LSS A;  4LFA Q;  4JI8 L;  4J15 A;  2ZM6 Q;  4A76 A;  1J5E Q;  4GKK L;  1RIP A;  2E2J H;  3HOZ G;  5JJL A;  4BBR H;  3G71 A;  1IBM Q;  4OX9 L;  3TS2 A;  4JI7 Q;  2N49 A;  4DV6 L;  1E24 A;  1C0A A;  2KCT A;  4NB3 A;  4P75 A;  3TQY A;  1PYS B;  4PG3 A;  4DAY B;  3RLN A;  3UDI A;  4DUZ L;  3U4V A;  3S1R H;  1KL9 A;  1VQN A;  1HR0 L;  3I2Z A;  3UDG A;  4OWT B;  1VQM A;  4DR4 L;  1VQO A;  4DPG A;  4DV2 L;  4BBS H;  1NMG A;  4DR6 Q;  1E3P A;  1KRS A;  1K83 H;  5M3M H;  1JB7 A;  4LFB Q;  4IFD J;  2UUA Q;  3S14 H;  1KRT A;  4OO1 I;  5C3E H;  1JT8 A;  1PFS A;  4POF A;  1PH4 A;  4Y7N H;  2YU9 H;  1JJC B;  1I6H H;  3J7Z C;  2WAQ G;  1Q86 C;  1L1O A;  3S17 H;  2DUD A;  3OTO L;  2N8N A;  3KDF B;  4A4I A;  3E9I A;  2YV5 A;  4YCV A;  4KLK A;  2JA6 H;  1XPU A;  4DV7 Q;  3RLF A;  2ES2 A;  3S15 H;  1B70 B;  3S2H H;  1QVF A;  4GLA C;  1IBL L;  1MIU A;  5H1S E;  1IYJ B;  4A93 G;  5GAE C;  1Y1V H;  2GVA A;  2EXD A;  5JJK A;  1U0L A;  3AQQ A;  2LXJ A;  2PMZ E;  4LW1 A;  1PH1 A;  2Z6K C;  4A75 A;  1UE7 A;  2UXB L;  3NBH B;  2NZO A;  2Y0S E;  4X65 L;  5M3F G;  3FKI H;  1FJG L;  3HOZ H;  1I5F A;  2R92 G;  4GN3 B;  3CCJ A;  1NTG A;  3CCS A;  2YTY A;  1XJV A;  3MEF A;  2HT1 A;  3PSI A;  1G51 A;  2ZJQ A;  1IL2 A;  2DGY A;  1E1O A;  2EIF A;  1N8R C;  3EN2 A;  3S1Q H;  2GVB A;  2KEN A;  4A3K G;  2Q2H A;  4HJ8 A;  3PO3 G;  4YHH Q;  1IXR A;  4KHP L;  4L5Q A;  4JI0 Q;  4JI2 L;  4GN4 B;  4B3S Q;  1QVC A;  3F2C A;  1HNZ Q;  3I4N G;  5LMU L;  4LFC Q;  5C44 H;  1MKH A;  2JJQ A;  4X62 Q;  1OXU A;  4A3I G;  2K5N A;  2B3G A;  2ZTD A;  2RCN A;  1TXY A;  2K5V A;  4A3F G;  1CKN A;  1K8A C;  3HOU H;  1Q81 C;  3HOW H;  4HJ5 A;  4LUV A;  1NE3 A;  4JCV E;  1LTL A;  4GNX A;  4JI3 L;  3PO2 G;  2MFI A;  3NEN A;  1XNQ L;  1VCI A;  2D0O A;  3T1Y Q;  3A5Z B;  4XTC S;  3PF5 A;  3CC4 A;  1L2F A;  3KF8 B;  2YTV A;  5M5W H;  5IY0 A;  2Q2T A;  3K81 C;  4GLV B;  4LUO A;  1M1K C;  2JA5 H;  1MJE A;  5LMN Q;  3G4S A;  4LF8 Q;  1VQF A;  2NVT H;  1D8L A;  1Q12 A;  1K8G A;  4LF9 Q;  4P74 A;  4JYA Q;  3GDE A;  1GD7 A;  1EWI A;  2JA9 A;  3HKS A;  4MZ9 A;  4BA1 I;  4R4C A;  1PA6 A;  1H95 A;  2RF4 A;  3PUY A;  3RN5 A;  3PF4 A;  4BXX G;  4HJ7 A;  5GAD C;  4LF5 Q;  1UEB A;  1LUZ A;  5AJ3 L;  4GOP B;  2RHS B;  2VZA A;  1XMO Q;  4QY7 A;  3G6E A;  4DR2 L;  2NVY H;  3NEM A;  3GTO H;  2PQA B;  1SN8 A;  4OWX B;  1S3O A;  1N36 L;  1GO3 E;  2E5L Q;  2R92 H;  3S1M H;  2MQH A;  5M3M G;  2MNA A;  4BY7 G;  2VQE Q;  4GS3 A;  1YZ6 A;  2I0Q A;  1PH6 A;  1N32 Q;  1TWA H;  2QGQ A;  5C3E G;  2VW9 A;  4DUY L;  4DR1 Q;  4A3E G;  1YJW A;  4LF4 L;  1A63 A;  2OTJ A;  5K36 G;  1G6P A;  1CSQ A;  4A3K H;  1BBU A;  3T1H L;  1SMX A;  4JI1 L;  1D7Q A;  4EQ5 A;  3KOJ A;  3RN2 A;  3BZK A;  4FDB A;  2L15 A;  4IPC A;  5GAH C;  1EIF A;  5IP7 H;  1X3G A;  2A19 A;  2ALY B;  2Y0S G;  4IOA A;  5IYC G;  4DR5 Q;  4IPD A;  1FVI A;  2KBN A;  4A3I H;  1VQ9 A;  3M9B A;  3M4P A;  2B29 A;  5C4X H;  3U58 A;  1VQE A;  3OW2 A;  1Y1V G;  2PI2 A;  3ZJY C;  4C3I H;  5EAY A;  4P73 A;  4YY3 L;  2VS1 A;  3RZO H;  1XPR A;  3PO2 H;  1VQG A;  3FHW A;  2ZTC A;  1FL0 A;  1KAW A;  1L1O C;  1CKO A;  4UP8 A;  1TWH H;  1BBW A;  3GTQ H;  2OTL A;  3FKI G;  1DGS A;  2IY5 B;  3STB D;  4X66 L;  2ZM6 L;  2CWA A;  1HNW Q;  4X64 Q;  4MTN A;  4JI5 L;  4AYB E;  2E2I H;  2CQO A;  4DK6 C;  1VQ8 A;  1S40 A;  3ULL A;  1IBM L;  4AH6 A;  2MO0 A;  2UUB L;  4NXM L;  2KHJ A;  4JI7 L;  3W5O A;  2AKW B;  2ID0 A;  2JEB I;  3RNU A;  4BXX H;  1YBY A;  2OQ0 A;  2BA0 A;  4KHZ A;  4AQY Q;  3BZC A;  4C2M H;  4DAM A;  1VQA A;  3F1Z A;  1VQL A;  1L0W A;  4JI4 Q;  4LF7 Q;  1X6O A;  3NEL A;  4QIW E;  4R4T A;  5JJI A;  2A1A A;  1X54 A;  4JI8 Q;  1UWV A;  4JOI A;  4AIM A;  4BY7 H;  5BR8 Q;  4B3T Q;  1YIJ A;  4R4O A;  2VQF L;  4DR6 L;  4A3E H;  3PV0 A;  3EIV A;  4ALP A;  3HKZ E;  3E9H A;  5C44 G;  1VQP A;  3OYY A;  2ASB A;  4A3J H;  2UUA L;  4DV6 Q;  1B8A A;  3GTK H;  3HOU G;  3HOW G;  4GN5 A;  4A3D H;  4IOC A;  3J81 c;  1HR0 Q;  4POG A;  4UP9 A;  4OXP A;  5IYC H;  4DV1 L;  1XNR L;  5JEA G;  1UE5 A;  4DR7 Q;  1YNX A;  1QZH A;  2JQO A;  4A3B G;  1BVS A;  4DV0 L;  4A3G G;  2JA5 G;  1V1Q A;  2E2H H;  3H3V H;  4LF6 Q;  5IWA L;  1PH9 A;  1HNX Q;  1CSP A;  4YCU A;  2F52 A;  5JEA J;  3TRZ A;  2UU9 L;  1YHA A;  1X9N A;  4RMF A;  4GKJ Q;  3S1N H;  4GNX C;  1VQB A;  2FXQ A;  1WFQ A;  3B6Y A;  2AMC B;  1WCM G;  4C3J H;  2F4V L;  5IYB G;  3GTG H;  2R93 G;  1Y1W G;  4JC0 A;  4EX5 A;  3AFQ A;  3M4Q A;  2XGT A;  1QUQ B;  3CD6 A;  2UUC Q;  2KHI A;  1K0R A;  3TRE A;  2EQS A;  3W1G A;  1E7Z A;  3AFP A;  4APV A;  1W2B A;  5IP7 G;  3S2D H;  1I3Q H;  4HIK A;  4OON A;  1YJ9 A;  2JA7 G;  2HIV A;  2JK8 A;  4B3S L;  1GVP A;  2I5L X;  2K5H A;  2RHQ B;  2PNH A;  3IRB A;  4YCW A;  4DV5 Q;  3AEV A;  1SRO A;  1HNZ L;  3M3Y H;  4AYB G;  4IO9 A;  2OCE A;  4LFC L;  1SRU A;  3UDF A;  3Q8D A;  3PGZ A;  3TEH B;  4X62 L;  1A62 A;  1Q46 A;  3I55 A;  3CPW A;  3J80 c;  1OXS C;  2AWO A;  2JE6 I;  4KI0 A;  1X56 A;  3L7Z C;  3E0E A;  4C3H H;  3ICE A;  2WB1 E;  1PH3 A;  1WJJ A;  2KCM A;  4PZ6 A;  4YWM A;  4DV4 Q;  1XTD A;  4JI2 Q;  4DR3 L;  3J81 i;  2E8G A;  1TWG H;  1EFW A;  1Q8K A;  1CKM A;  3K7A H;  2BH2 A;  1WOC A;  4A3B H;  1MJC A;  3M7N A;  4A3G H;  3T1Y L;  1HZ9 A;  1BKB A;  3KDF A;  4K0K Q;  5LMU Q;  3I56 A;  2NVQ H;  4JV5 Q;  1V9P A;  1Z47 A;  1N9W A;  3HOX G;  1VQI A;  3HFZ B;  2QA4 A;  1B7Y B;  5C0X G;  5LMN L;  4LF8 L;  2H5X A;  4LF9 L;  4HIM A;  3KYH C;  3A74 A;  1HZC A;  3PIO A;  1N34 Q;  2CFM A;  3JC6 6;  4LUZ A;  3SGI A;  3PIP A;  1AE2 A;  5C4J H;  3PUV A;  1HJP A;  2YYZ A;  3TS0 A;  4LF5 L;  4NXN Q;  3HOY G;  1WCM H;  4R4I A;  1YI2 A;  5IYB H;  2R93 H;  3FP9 A;  1Y1W H;  4L5R C;  1OXX K;  1HZA A;  2E5L L;  4B3M Q;  1G29 1;  2IX0 A;  1IBK Q;  1OXV A;  1JE5 A;  2CWP A;  4A3J G;  1SFO H;  1WI5 A;  4ME3 A;  4DR1 L;  4JI6 L;  4UY8 C;  3H0G H;  2VUM G;  2K75 A;  1YHQ A;  1EQR A;  4BA2 I;  4A3D G;  2K52 A;  4IJL A;  1M90 C;  2IT1 A;  4WJ4 A;  4TVA B;  2C35 B;  3CCE A;  2ATW A;  1NMF A;  4YWL A;  1XMQ Q;  3HOV G;  5AJ3 Q;  2JA7 H;  1ASY A;  1YEZ A;  1VQK A;  1NJI C;  1JJ2 A;  3S16 H;  5HY6 A;  1O7I A;  2MO1 A;  4B3R L;  5ELN A;  2K4K A;  1N36 Q;  3WWV A;  4DR5 L;  3AYH B;  3CCU A;  1ASZ A;  1LM0 A;  1VQ4 A;  3PUX A;  4PZ8 A;  2VL6 A;  4TQU S;  2YTX A;  2I5H A;  1L1O B;  4LF4 Q;  2UXD L;  3PUZ A;  3KF6 B;  3M85 A;  1VQJ A;  4BY1 G;  1VQ7 A;  3J80 i;  3CCR A;  3D0F A;  1PVO A;  3UDX A;  1PH7 A;  1A8V A;  2CCZ A;  4JBK A;  1EOV A;  3CAM A;  1WYD A;  1I94 L;  1CUK A;  5GQO A;  3RLO A;  3I4M H;  3GTJ H;  1JJG A;  2NZH A;  1VS0 A;  5J3B A;  1J5E L;  2BA1 A;  2XTI A;  4LFA L;  3PCO B;  3L0O A;  2AWN A;  1N33 Q;  3GD7 A;  1YVC A;  5IE8 A;  1J6Q A;  3HOX H;  4A3L H;  4A3M H;  4QQB X;  2A8V A;  3A0J A;  2QEX A;  2UXC Q;  5C0X I;  1NBW A;  1QVG A;  2PI2 E;  3EBE A;  2HHH L;  4R1J A;  1PHJ A;  2D0P A;  1EQQ A;  2GN5 A;  1PYB A;  4DNI A;  4A3C G;  1AH9 A;  3BU2 A;  4DV3 Q;  2R7Z G;  1Q82 C;  3HOY H;  1S72 A;  3U4Z A;  1T9H A;  2CKZ B;  1KD1 C;  4JI4 L;  4GKK Q;  1X55 A;  4R4Q A;  2N3S A;  1I50 H;  3GTP H;  4GOP A;  1VQH A;  5M5Y H;  4OX9 Q;  5BR8 L;  4LFB L;  4JI5 Q;  4B3T L;  4P72 A;  2I5M X;  2PQA A;  1VQC A;  1RL2 A;  2UUB Q;  4NXM Q;  2VUM H;  3U50 C;  3STB C;  3UE1 A;  4DUZ Q;  2Q2U A;  3HOV H;  2ZJP A;  4HID A;  3CC7 A;  4IFD G;  3VDY A;  4DR4 Q;  5LMN W;  1PH5 A;  3JAM c;  4DV2 Q;  3L2P A;  1LYL A;  3CW2 C;  4DV7 L;  2VNU D;  2JA8 G;  1CKN B;  1YHB A;  5IYD H;  5IP9 H;  2VQF Q;  4DR7 L;  5HGQ A;  3RZD H;  1U5K A;  3H3V I;  5FLX c;  1KC8 C;  1E22 A;  4QGU A;  4GNX B;  4BY1 H;  5M5X H;  3ER0 A;  3CCV A;  1GKH A;  1KQS A;  1HNX L;  1EIY B;  4LF6 L;  2B63 G;  5IT9 c;  4UP7 A;  3OTO Q;  2Q2I A;  1W3S A;  1HH2 P;  3I4O A;  3CP0 A;  4QL5 A;  1UE6 A;  4DV1 Q;  1XNR Q;  4PMW A;  3KF6 A;  4L5T A;  1IBL Q;  2K50 A;  4O0A A;  3J7A 5;  4QJF A;  1PH8 A;  4L5S A;  3ERS X;  4DV0 Q;  3H15 A;  1P8L A;  3ULJ A;  5IWA Q;  3KFU A;  1TWC H;  2JEA I;  3GTL H;  4JBJ A;  4A3C H;  2UU9 Q;  3H0G G;  2NN6 G;  1X3F A;  2R7Z H;  2WFW A;  2BH8 A;  2N78 A;  4JBM A;  2UXB Q;  3K80 C;  4X65 Q;  2UUC L;  4YHH L;  2IHF A;  1FJG Q;  2R7D A;  4JI0 L;  1K73 C;  1GM5 A;  3CC2 A;  4XIG S;  3CXC A;  2F4V Q;  3PUW A;  3BJU A;  4DV5 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...