2WB1G

The complete structure of the archaeal 13-subunit dna-directed rna polymerase
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
113
structure length
113
Chain Sequence
KAQEIILSCEINSIERGSLKNLSIIHMSCNDFNISFDIIDSINIFSQKEKVKAFISKNRLSYTNDDFCGHGYIVTELKDSSSNNGNRYITIISLFGLLVKIISNKESFLKIHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE RPO1N SUBUNIT
publication title Evolution of Complex RNA Polymerase: The Complete Archaeal RNA Polymerase Structure
pubmed doi rcsb
molecule tags Transcription
total genus 12
structure length 113
sequence length 113
chains with identical sequence V
ec nomenclature
pdb deposition date 2009-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF16992 RNA_pol_RpbG DNA-directed RNA polymerase, subunit G
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2wb1G00
1SLJA 3OTOL 3AEVA 2C35B 3BZKA 4YCVA 4HIKA 3CW2C 2K14A 4OWXB 4HJ8A 3ERSX 1RL2A 1K3RA 1V1QA 4HJ9A 1WCMG 1DGSA 3HOZH 3CAMA 1B7YB 1KRTA 4A3BH 1VQ5A 2UXCQ 3RN5A 1Z47A 2B29A 1PH5A 1C9OA 4GS3A 4IPCA 3M3YH 3D31A 2BH8A 4KHZA 2ALYB 1BBUA 1OXVA 2Z6KC 4R4QA 3JAMi 4YHHQ 4GOPB 4LF8Q 4DR3Q 1ASZA 3S15H 3TS2A 1IBML 2GN5A 1E1TA 1N34Q 1QUQB 4A3EH 4X6AH 4KI0A 4DR2L 2R7ZG 3PO3H 4B3TL 4JI7Q 3F2CA 4L5RC 1B8AA 4OO1G 4GOPC 1E22A 5IY0A 3KF6A 2HHHQ 1WJJA 1X56A 3K8AA 4HIOA 2UXBL 4L5SA 4DV3Q 1N36L 2N8NA 1Q81C 4LFAQ 2R93G 1SMXA 1L0WA 5IT9c 3H0GG 4P75A 1K73C 1N33L 2OCEA 4UP7A 1U5KA 1EUJA 2YU9H 4LF7Q 4DR5L 1WI5A 3VDYA 2OTLA 4A3KG 1SR3A 1QVGA 1L1OB 1JJ2A 1QVCA 1Q46A 4K0KQ 4IJHA 2WAQG 1YHBA 2A1AA 4A3MH 3ZJYC 1O7IA 3GDEA 4YCUA 4DPGA 4DR4L 1Q12A 3K81C 4DV1Q 3TRZA 2F52A 1I3QH 1AH9A 3PO2H 2R7DA 3NBHB 3G6EA 4KHPQ 1PH7A 1L1OC 3L2PA 1HR0Q 1I94L 1VQ6A 1KXLA 2B63H 2IX0A 1SE8A 2EQSA 5IP9H 5M5YH 3CCUA 1BBWA 4LF6Q 4LF9Q 3GD7A 3GTOH 2ES2A 4JYAL 1VQ8A 2UUBL 3S1MH 1FJGQ 5ELNA 3WWVA 4POFA 2VW9A 3S1NH 1NJIC 1YNXA 5LMNQ 4NXNL 4C3IH 1HZCA 3K80C 1IBKQ 1VQHA 3HOUH 4LFCQ 4YY3Q 1Y1VH 3OTOQ 3PUVA 1VQDA 1TXYA 5JJKA 1VS0A 1XMQQ 5GADC 1YIJA 4AQYL 3M7NA 4DUZL 4HIMA 1MJCA 4DR6L 4IPDA 4LWCA 4BA1I 2OWOA 3M4QA 3UE1A 4A3LH 3U58A 4LUZA 4B3SL 4BY7H 3STBD 1PYBA 1IBMQ 1G6PA 1TWAH 3CC7A 3L7ZC 4DR2Q 2RHQB 4A3FG 4B3TQ 2A8VA 1YZ6A 5FJ8G 3E9IA 1Z9FA 3S1RH 4A75A 3CMEA 3UDFA 3AQQA 3CCEA 5HY6A 2AWOA 1N36Q 4DNIA 2Y0SG 3NEMA 2VUMG 2GVAA 2ATWA 3RLFA 3AYHB 2F4VL 3S2DH 2WP8J 3RLOA 2YTYA 1N33Q 2UU9L 1H95A 2PNHA 4O0AA 1E1OA 4DR5Q 1QVFA 5M3FH 2HT1A 1LM0A 1X3GA 4QL5A 4GNXC 1KAWA 1XNQL 4HJ5A 2B3GA 3RZDH 1E7ZA 1EYGA 3U50C 2NVXH 4A3DG 4AH6A 4JOIA 5DLQE 5FLXc 1L1OA 1EWIA 2JJQA 4JI8L 4BXXG 1AE3A 4DR4Q 3EN2A 1NE3A 3KYHC 2ZTDA 4Y7NH 3HOVG 1TWCH 1I94Q 2JA9A 4P73A 4PZ8A 3DM3A 4BY1G 3F2DA 4DR7L 4P71A 4JYAQ 3OYYA 2VZAA 2UUBQ 1KD1C 4IOAA 5IP7H 2R92G 2MQHA 2CFMA 3ICEA 2JA5G 3UDXA 4PZ6A 4NXNQ 1GM5A 1K0RA 2K5NA 1B70B 2NVQH 2MNAA 1A8VA 1NTGA 3KJOA 1IZ6A 1RIPA 1IXRA 2JA8H 3HOYH 2RF4A 4BBSH 1Y1WH 2VNUD 1A63A 2AHOB 2IHEA 2NN6I 4J15A 4NXML 4WJ3M 3I55A 4LF5L 2NZHA 4A3JH 2ZJRA 5C0XI 3RN2A 3I4MG 4LFBL 1MIUA 2V1CC 4L5TA 4AQYQ 2AKWB 2A19A 1JB7A 4DUZQ 3E0EA 4DR6Q 3CCJA 2VY3A 3CCSA 1YEZA 3NENA 4EX5A 1CKMA 5IYBH 4B3SQ 1Q82C 4X66L 4DV7L 4GLAC 5GAGC 4QJFA 1HH2P 1PHJA 5C4XH 4QY7A 3HOZG 1E24A 3S16H 1D7QA 4QIWE 4A3BG 2JA7H 3S24A 1X9NA 4H02A 1Y14B 4ME3A 4B3RL 1PVOA 1X3FA 2VQFL 4UP8A 1VQ4A 3UE0A 4WJ4A 1G291 1EQRA 1Q86C 4X64L 1WFQA 1OXUA 3CCVA 2WB1E 1CUKA 5C44H 2F4VQ 1JJGA 4A3EG 1KC8C 1NMFA 4GNXA 2UU9Q 3PO3G 2ZM6L 1HR0W 3U4VA 5HGQA 1LTLA 2VS1A 3T1HL 4QGUA 1YI2A 3F2BA 1NBWA 2E2JH 4A3CH 2WB1G 4BBRH 1XNQQ 1FL0A 3KOJA 5C3EH 3CMAA 3SGIA 4DV6L 1YBYA 3F8TA 4JI8Q 2RCNA 4DV5L 1PA6A 4IJLA 1XPUA 4LUVA 3GTLH 3KDFB 4P74A 4DAMA 3RLNA 3L0OA 1SFOH 3AFQA 4IFDG 3CP0A 4XTCS 2RHSB 4JI3L 4DR7Q 5JJIA 3KJPA 2I0QA 4DAYB 1N32L 2XGTA 4A3MG 1EOVA 1AE2A 3A74A 2R7FA 3K7UC 3PUXA 3CPWA 3LGJA 4DV2L 3E9HA 3M85A 1YJNA 1VQNA 1FGUA 3J80c 1KIXA 3PO2G 1QZHA 1J6QA 3BU2A 4OO1I 3PV0A 3IRBA 1Q7YC 1FVIA 2PI2A 3CCLA 3J7A5 4APVA 4DV0L 2UUAL 1XPRA 2B63G 4IFDJ 2JEBI 5IP9G 2BA0A 1OXSC 1EIFA 4NXMQ 4A3GH 4A93H 2YTVA 2PMZE 4LF5Q 1NY4A 4GKKL 2OQKA 1VQPA 4LFBQ 1P16A 2AMCB 1K9MC 4P72A 5M5XH 1G51A 2GVBA 3HOUG 4JI0L 1VQEA 3HKZE 2Z6KA 1GVPA 1Y1VG 1BKBA 2MO0A 4GLVB 5GROA 4JBMA 1VCIA 3KLWA 4XIGS 2K5VA 4X66Q 4DV7Q 3GTGH 1IYJB 2F3IA 1K8AC 4QQBX 3CPFA 1CSPA 3S17H 1TWFH 1UEBA 2D0OA 2L15A 4OONA 3HKZG 2ZJPA 4UP9A 4GOPA 1IBLL 3UDGA 2HIVA 4B3RQ 3PUZA 1XJVA 2VQFQ 4A3LG 4HIDA 2Q2UA 1C0AA 4IOCA 4BY7G 2LSSA 1QUQA 4JG2A 4X62L 3EIVA 2NVYH 3RZOH 2UXBQ 3TQYA 4GN3B 3HOXH 2ZM6Q 3CC2A 3T1HQ 4JI2L 4JBKA 2WFWA 5C4JH 4L5QA 4IO9A 2KENA 1X55A 3CCQA 1YHQA 3D0FA 1K8GA 3A5ZB 1V9PA 4R4IA 1CKNB 4DV6Q 1QZGA 1LYLA 3GTPH 4DKAC 4DV5Q 3FKIH 4A3IH 2LXKA 2KHJA 5IYCH 3JC66 1UE1A 4JC0A 5M3FG 1XPOA 2E5LL 3S14H 1UE5A 1Q8KA 2CWAA 2HIXA 2YTXA 3KDFA 3KF8B 3PSIA 4JI3Q 4JI4L 3DLLA 1N32Q 2IY5B 1HNWL 2D0PA 1VQMA 4MTNA 2YV5A 4BA2I 3W1GA 1IL2A 1LUZA 5JJLA 4DK3C 4B3ML 2JA6H 3M4OH 3S2HH 1KHIA 2NN6G 1PH9A 2Q2TA 4DV0Q 2UUAQ 1A62A 4LW1A 3J80i 3HOWH 4A4IA 5IYDH 3KFUA 2K52A 2I5HA 5FLMH 1D8LA 1VQJA 1YJ9A 2NVTH 3H3VI 1HZ9A 1T9HA 4HJ7A 4OX9L 4GKKQ 1OXTA 2DUDA 4RG1A 3ULPA 4GKJL 5IP7G 1E3PA 1UE7A 2FXQA 3M9BA 4R4CA 3FP9A 3W5OA 2N49A 4AIMA 3PIOA 4DK6C 3I4NH 3J7ZC 4JI0Q 4R4TA 5IWAL 3CC4A 4LF4L 2JA8G 3G4SA 1Y1WG 3HOYG 4BBSG 5GAHC 2YYZA 2PQAB 3OW2A 1MJEA 1I6HH 2QA4A 4A3JG 2BH2A 2H5XA 5BR8L 4JI1L 3CCMA 5M3MH 2KHIA 3K0XA 3J81c 3T1YL 2JEAI 1ASYA 1IBLQ 4GN4B 2AWNA 1VQ7A 4IPGA 1X65A 3PGZA 4R4OA 4C2MH 3BZCA 5JEAG 5IYBG 1EIYB 1JMCA 5ELOA 1P8LA 2UUCL 1WCMH 4X62Q 2UXDL 2ZTCA 4DR1L 4LFCL 3NELA 1HZBA 1PH4A 1HNXL 5C4XG 1UE6A 4NPSA 2K50A 5GQOA 1PH2A 2ASBA 3EBEA 2JA7G 3RNUA 4JI2Q 2EXDA 3PIPA 1U0LA 1VQFA 1XMQL 1Q1EA 2I5LX 1K83H 2Q2HA 5JEAJ 3A0JA 2Q2IA 1VQ9A 1EFWA 5C44G 2R7ZH 3GTQH 2CKZB 1WYDA 4FDBA 3PF5A 2E8GA 4JBWA 1CKNA 4JI5L 3Q8DA 2KCTA 3ULJA 1XNRL 1L2FA 4YWMA 3FHWA 4MZ9A 4LUOA 2E5LQ 2ID0A 5LMNW 3TS0A 4JI4Q 1S72A 1TWGH 4BBRG 1VQLA 4OXPA 4A3CG 2R93H 5C3EG 3PUWA 1WOCA 3H0GH 1HNWQ 3PCOB 1N9WA 3RR5A 1W3SA 3J81j 1GD7A 1J5EL 3HFZB 4A3KH 5K36G 2K5HA 4YWLA 5J3BA 4B3MQ 2IT1A 1PH6A 2JE6I 1VQGA 1GKHA 2WAQE 4YCWA 4DUYL 4MNOA 4GLXA 1C7YA 3I4OA 3MXNB 3ULLA 1W2BA 5LMUL 1HNZL 4OX9Q 4JCVE 3PUYA 2BA1A 2ZTEA 1VQOA 1UWVA 4GKJQ 1SRUA 4X65L 1VQKA 2QEXA 4JI6L 2K4KA 1X54A 3UDIA 1HZAA 4PZ7A 4JOIC 5H1SE 1PH3A 5IWAQ 4LF4Q 1OXXK 4A3GG 5AJ3L 4A93G 4JV5L 1R9TH 2I5MX 2VQEL 5BR8Q 2XTIA 2R6GA 2PQAA 4JI1Q 4AYBE 4DV4L 1XMOL 3T1YQ 1PH8A 4IFDI 1BVSA 1YVCA 4POGA 4TQUS 4C3HH 3I56A 2CCZA 3CD6A 3W1BA 3J81i 4AYBG 4OWTB 4R1JA 2MFIA 2UUCQ 2UXDQ 1SN8A 1KQSA 4DR1Q 1KL9A 1HNXQ 4JBJA 3ER0A 4PMWA 2N3SA 4X64Q 1PH1A 3GTKH 1GO3E 2KCMA 4NB3A 3BJUA 3TREA 1TWHH 4IPHA 4EQ5A 1SROA 1YJWA 3F1ZA 1PFSA 4RMFA 3U4ZA 4PG3A 3K7AH 2E2IH 1N8RC 1X3EA 1I5FA 3GTJH 2QGQA 3JAMc 4A3FH 3CF5A 2UXCL 4JI5Q 2JK8A 4OWWB 1NMGA 5E7NA 5FJ8H 3HOXG 1XNRQ 4LF8L 2MO1A 3B6YA 3A5UA 3M4PA 3I2ZA 4YHHL 1EQQA 4DR3L 3CXCA 2JQOA 2DGYA 2Y0SE 2VUMH 2HQLA 3G71A 5GAEC 1N34L 4LNQA 3H3VH 3KF6B 1CSQA 4HJAA 4JI7L 3FKIG 4KLKA 4A3IG 1J5EQ 5IYCG 1VQIA 4GNXB 4TVAB 5EAYA 4DV2Q 2HHHL 4C3JH 4DV3L 4A3DH 2CQOA 4ALPA 4DUYQ 4LFAL 4Y52H 4BXXH 3AFPA 1XTDA 3STBC 3H15A 1JE5A 2VL6A 2E2HH 5LMUQ 4UY8C 3PF4A 4LF7L 3TEHB 5C0XG 4YWKA 1HNZQ 1V43A 3MEFA 3HOVH 1CKOA 1YHAA 3S1QH 3CCRA 2JA6G 4X65Q 4JI6Q 4BY1H 4K0KL 1VQBA 3HOWG 1A0IA 3GO5A 5IYDG 4GN5A 2Z0SA 4UPAA 5FLMG 3I7FA 3GTMH 1M1KC 2D62A 1KRSA 2PI2E 5AJ3Q 4DV1L 1M90C 4KHPL 4O2DA 4JV5Q 1VQAA 5C0XJ 2VQEQ 4A76A 1S3OA 2R92H 2IHFA 1JJCB 2OQ0A 3G48A 2N78A 1HR0L 2JA5H 2IX1A 4DV4Q 1HJPA 1XMOQ 1VQCA 3I4NG 1JT8A 4LF6L 2EIFA 4LF9L 2K75A 2LXJA 3HKSA 2CWPA 1PV4A 5IE8A 1FJGL 3I4MH 3CQZH 5M5WH 1S40A 1PYSB 2KBNA 1MKHA 1I50H 1YITA 5LMNL 5M3MG 1Q1BA 1X6OA 2NZOA 1IBKL 2ZJQA 1OTCA 4YY3L 2OTJA
chains in the Genus database with same CATH superfamily
3AEVA 2BOSA 3TN2A 2F0WA 1B7YB 2F0UA 3K6OA 3K57A 2L0CA 4DAPA 4IPCA 4R4QA 2Z6KC 1BBUA 2B2WC 4LF8Q 2CQAA 4YHHQ 1K83B 1STBA 2GN5A 3I4LA 1QUQB 2R7ZG 3F2CA 1B8AA 4RWSC 2Q8IB 1X56A 1SJHD 2XNAC 2UXBL 3E6ZX 3IKJA 1SMXA 1L0WA 2OCEA 1WD0A 1EUJA 2L12A 2RKSA 2K03A 4A3KG 1QVGA 1H9KA 3ND8A 2A68D 1YHBA 4EQPA 4A3MH 2TSSA 3DXJC 4DR4L 1I4GA 3H09A 1Q12A 2R7DA 1L0XB 3VR5A 1TS3A 1HR0Q 1SNCA 1I94L 4RCOA 2B63H 5IP9H 2L9HA 1PFMA 5CMDA 3GD7A 1VQ8A 3NE5B 3WOEA 1G2TA 3WWVA 5D14A 1R9TB 3S1NH 4F88A 1S4ZA 2IJ0A 4NXNL 4HCSA 3HOUH 1Z7TA 3VR2A 3PUVA 3T4AC 5KNDA 1TXYA 2E76C 1HRJA 1VS0A 4N9TA 3R3OA 3C2PA 4DUZL 2F0PA 2F0HA 1Y8NB 1MJCA 3M4QA 3EA6A 1DCZA 1TWHB 3U58A 2EYPA 1V1PB 2KEDA 3K7AB 5LL6X 4PMBA 1G6PA 1RJTA 3L7ZC 4CGYB 5KIXA 2HCIA 1G8ZD 1Z9FA 4BS9A 3MFYA 4A3IB 3CMEA 2IL8A 2L5TA 3UDFA 2PZUA 3NEMA 3RLFA 4B9WA 3K58A 3RLOA 2YTYA 3J80L 1N33Q 2UU9L 5DM63 4O0AA 1E1OA 3FMCA 5M3FH 1LM0A 4GZYC 5FLXc 1L1OA 1AE3A 2F0FA 2E2HB 3EN2A 2ZTDA 4L8JA 2C9OA 1CHQD 3NBHA 4BY1G 4FF3A 4KKTA 3A7AB 5E4XA 1O7YA 4P71A 5FLXE 4MN3A 2VZAA 2UUBQ 1KD1C 5CC4A 2LKVA 2VB2X 3UDXA 2K5NA 5I6WA 1LTTD 1H9MA 2MNAA 1A8VA 1EZ8A 5FO9B 5C6AA 1IXRA 3HOYH 2RF4A 3I55A 2NZHA 5M5WB 4A3JH 3I4MG 5C0XI 4KN7C 5M9OA 3OIQA 1MIUA 2V1CC 4L5TA 1JB7A 2MHVA 3E0EA 4DR6Q 3CU7A 1LTSD 2RDGA 3CCSA 4X66L 4DV7L 1MHWC 4GLAC 2EYHA 1HH2P 1HFNA 5IGBA 1D6EC 3S16H 5IODA 4A3BB 1D7QA 3DUZA 3QG1A 3HGBA 4ME3A 1X3FA 4UP8A 3UE0A 2ZXPA 3S15B 1CFMA 3CCVA 1JJGA 2ZXOA 4FXGC 2R93B 4GNXA 3PO3G 1HR0W 3T1HL 1LTLA 3N6RA 2A6ED 2WB1G 4BBRH 1LTID 3KOJA 1GUOA 1JWUD 2RCNA 1K8MA 5KNBA 1XPUA 2B8GA 3GTLH 1CM9A 4X3KA 4DAMA 3TMEA 3KUPA 3I8ZA 4ZKBB 4IFDG 4XTCS 2I0QA 1AE2A 3K7UC 3CPWA 1B2TA 2LMCB 4J8QA 3N52A 4HAEA 3PO2G 2CVRA 1HQMC 3BU2A 1QZHA 3J7A5 3SK5A 4DV0L 4CBVA 1WTHA 3VYTA 1BCPD 1SNQA 4A3GH 4G7HC 4LF5Q 4RKLA 1GUWA 4LFBQ 1LT3D 1F9QA 3NWTA 3IL8A 4C3IB 4P72A 3TSSA 5M5XH 2GVBA 2V4DA 4CDCC 5I2YA 4JI0L 2Z6KA 5G3LF 4GLVB 3DEOA 3M4OH 1EY9A 1FNWA 1TWFH 1UEBA 2Z6BA 2JXMB 2F0IA 2D0OA 4UP9A 2HIVA 1HHVA 2VQFQ 3DMUA 4HIDA 1QUQA 1B1ZA 2HDLA 2ICIA 4JG2A 5ELFA 5IGEA 2EYOA 1TWAB 3EIVA 4GN3B 4I7ZC 3NSWA 1MSGA 1X55A 4RH6A 4XT1B 2O4XA 1LYLA 3IFDA 3GTPH 4K8JA 5HURA 1A2TA 1UE1A 1XPOA 2E5LL 3S14H 4G57A 1Q8KA 4JI4L 3OOCA 1QE6A 3S1QB 2IY5B 1STHA 4MIUA 3BVZA 4DAYA 1LUZA 4B3ML 1C48A 2ZT9C 4JW0A 1KHIA 2JA6H 3GTMB 2EE1A 2NN6G 4IN3A 2A69C 4LW1A 2JA5B 2K52A 1D8LA 1F2YA 1EYCA 3H3VI 4OX9L 1B9NA 2FXQA 2XWJB 4AIMA 1SEBD 2F3WA 3PIOA 5IWAL 1Y1WB 2JA8G 4BBSG 4K8IA 1EY0A 1K8OA 3D4DA 3EJIA 1I6HH 2DY8A 3FDTA 4CJ0B 4JI1L 3E5SA 5M3MH 2H1EA 3SK8A 4O1NA 4CJ2C 1I4RA 1ASYA 1V1PA 5JEAG 4C2MH 1ZXTA 2LS01 3QR8A 4CJ1B 1H9SA 2BE5D 2UXDL 4DF7A 1QNUA 4LFCL 1YNJC 2EXZA 2K50A 4QIWB 1PH2A 3EBEA 2JA7G 3RNUA 4JI2Q 1U0LA 4OEMB 1VQFA 4XT3B 1LT5D 1K83H 4CKBA 1VQ9A 2HUGA 5C44B 5D65A 2CKZB 3PF5A 4JI5L 4OO1H 3Q8DA 5FLXL 4MZ9A 1E0BA 4DK1A 2E2JB 2ID0A 4A3CG 3TS0A 1S72A 4OXPA 1EY6A 3R2IA 4LAAA 1EYDA 3SHLA 3KF8A 3PCOB 3RR5A 1W3SA 2EJGC 4A3MB 1SBBB 1E2ZA 4YWLA 4C56C 2IT1A 1SFOB 1PH6A 2PW5A 2SNMA 1VMPA 2E75C 1FNUA 4IFDH 1PXUA 1SRUA 3KBXA 1KNAA 3BYYB 1QILA 4X65L 1X54A 4BWGB 1KDAA 4JOIC 1PH3A 1FYCA 1HPCA 1HA6A 2A5HA 5AJ3L 3HOUB 4A93G 4JV5L 1R9TH 5IGCA 2VQEL 1BCPF 4DV4L 1PH8A 2F0MA 1A15A 5EPKA 4TQUS 1QWYA 4C3HH 4QUFA 2Z8LA 2IPKD 3J81i 4E6IA 4R1JA 2MFIA 2UUCQ 5EPLA 2M9VA 5DEHA 5CV7A 4PMWA 4X64Q 2G9DA 3RD4A 3FPPA 4PMCA 1I4PA 3HP3A 2PW7A 4K5XA 4NB3A 1S5FD 1TWHH 1SROA 2PNRC 3R8BA 3K7AH 2E2IH 1N8RC 2NVYB 4I7AA 2KVMA 2QGQA 4A3FH 1EY7A 3CF5A 2UXCL 3HOXB 5FJ8H 1PZKD 1CQFA 4ILWA 1XNRQ 3PIP3 3L3OC 1U4LA 1K3BC 3T16A 2JYOA 3B6YA 3C1EA 3BZDB 1BF4A 4XYOA 2HQLA 4EVOA 4OGQC 1VF5C 4JI7L 3FKIG 4DV2Q 3P1HA 2K04A 4DV3L 4A3DH 4HR7B 4DUYQ 4Y52H 2QCPX 1STEA 3AB9A 2VL6A 3AU7A 4WJWA 4ZCKA 5LMUQ 2E2HH 4UY8C 4HMIA 5C0XG 4YWKA 1HNZQ 3A55A 1EQVA 4JI6Q 3MXUA 3HOWB 1JB3A 5CV8A 3GO5A 5FLMG 2AQ3B 2QILA 3MZ5A 5KRUA 2EY2A 2PI2E 1M1KC 5I9OA 1M90C 4KHPL 4O2DA 2XIWA 2O5JC 2IHFA 1JJCB 3I4NG 1FGBD 4LMQD 1LLRD 1WTXA 1PTOD 5FKAC 1TQOA 5M5WH 1S40A 1PYSB 5LMNL 2KEEA 3NP8A 3S16B 1NNXA 3QJYA 1KLGD 5K5PA 3OTOL 3BZKA 3CW2C 2K14A 4ZUIA 1RL2A 1WD1A 1K3RA 1V1QA 4HJ9A 1WCMG 3CAMA 4A3BH 1VQ5A 1Z47A 1PH5A 1C9OA 3M3YH 2BH8A 1PTOH 4KHZA 1OXVA 2F0JA 3JAMi 4TKOB 1LACA 3V96A 3A8JE 4DR3Q 3S15H 2QEJC 3TS2A 1EOTA 1B50A 4BBRB 4X6AH 2R7ZB 4KKUA 4IQZA 4B3TL 4L5RC 3TP7A 4EQNA 4U68A 3M4YA 4CKCA 3H6MA 3K8AA 1U9RA 1N36L 4NMZA 1Q81C 5COYA 2WIIB 3H0GG 1K73C 3LX0A 5EKIA 4LF7Q 2K6AA 4DR5L 1WI5A 4ID6A 4R8IA 4A3KB 2OTLA 1SR3A 4H13C 1L1OB 4ULLA 1STNA 3AMUA 4IJHA 1VF7A 2WAQG 3MC0B 4K0KQ 3ZJYC 2G5DA 4DPGA 1I4HA 3K81C 5DNFA 3NBHB 1L1OC 4ZYSA 1XWEA 1SE8A 1WVLA 2VXWA 4LF6Q 4LF9Q 4JYAL 3S1MH 1FJGQ 5ELNA 3K5OA 4PQXA 4POFA 4XQQA 2F0LA 2DJGC 4C3IH 1TWFB 1IBKQ 3Q24A 4YY3Q 4JK1C 1TKWB 5JJKA 2CW0C 1YIJA 3M7NA 2E2DC 1K0SA 3NQTA 4KN4C 4IPDA 5EJWA 4DN4M 2OWOA 3G6JB 4A3LH 4B3SL 2FINB 3Q23A 3FPUB 1TWAH 1D5ZC 3GTJB 1KLUD 2A8VA 1TIID 3GTPB 3E9IA 4A75A 1GUTA 3AQQA 3BYTB 4DNIA 2Y0SG 2VUMG 2GVAA 3S14B 3AYHB 2F4VL 2WP8J 3NPPA 2PNHA 3L9AX 3C3LA 4U673 5DAUA 1QVFA 1X3GA 4GNXC 1JORA 4C3JG 1ICFB 3Q6SA 2F0EA 1EYGA 3U50C 2JA6B 4JOIA 1TY2A 4JI8L 4BXXG 2R3ZA 5KYIA 4ZLTF 3K5MA 4DR4Q 1SYCA 1XX8A 3KYHC 4Y7NH 1I94Q 4P73A 4BY1B 3DM3A 2KQ3A 5EGTA 3PQIA 5IP7H 4NXNQ 3MHBA 4QUCA 1NTGA 1RIPA 3NTIA 5M3MB 2VNUD 1Y1WH 1A63A 3BVMA 2IHEA 4TRDA 2NN6I 4WJ3M 4R9WA 4K6LA 4ME5A 3I4MB 4IURA 2ZXRA 3HG9A 1I50B 2C5CA 4C2MB 4DUZQ 2PPBC 2XN9C 1YEZA 4EX5A 1UNSA 1CKMA 3WDNA 4QJFA 4S3SA 3HOZG 1E24A 4HTHA 4QIWE 2KJXA 2F4IA 2QDBA 2M2LA 5IOCA 2KOLA 2JN4A 3P75A 4KMUC 3H94A 1G291 1Q86C 3I91A 1G6ZA 2Q8RE 5C44H 4A3EG 1KC8C 4DU9A 2NB0A 2UU9Q 3U4VA 1FNVA 2BDNA 3A7LA 2J4XA 1NBWA 3F2BA 1JOQA 2WB1B 2E2JH 1UAPA 5C3EH 1SDFA 3W3AA 2Z1CA 4DV5L 3U9SA 2BE5C 4X3UA 5CYUA 4P74A 5K36H 3RLNA 1SFOH 1H9JA 2FFKB 2QDLA 4JI3L 5JJIA 4DAYB 4IALA 2XGTA 1N32L 1EOVA 3A74A 3PUXA 5IGFA 3LGJA 2EDGA 1A2UA 1SYBA 3PO2B 1FGUA 1ZKOA 1Q7YC 1FVIA 1ZEQX 2LFNA 4DNTB 1SXTA 2JEBI 1ILQA 2JSOA 2B2VA 4V190 1SE2A 1TVXA 1VQPA 4C3HB 1K9MC 1G51A 2KCCA 5ELCA 3SK4A 1GVPA 1Y1VG 5BN5A 4JBMA 4KKSA 3KLWA 4X66Q 2K5VA 4DV7Q 2F3IA 1CSPA 1JE4A 2L15A 2E2IB 3BDLA 1PRTF 1LTAD 1IBLL 2X6LA 1H9SB 3UDGA 3PUZA 5C5MA 4A3FB 1XJVA 1RHPA 4IOCA 4BY7G 1HQRD 2NVYH 3HS0C 3T56B 4B9XA 1TU2B 3HOXH 3T1HQ 2WFWA 4CDEC 3DWQA 4IO9A 1BOSA 2KENA 3CCQA 1YHQA 3M7GA 3A5ZB 3J7AF 3HRZC 1IL8A 4DKAC 4A3DB 2LXKA 3I3CA 2A74C 3NTHA 4L63B 5IYCH 1KABA 1DONA 4JC0A 1NAPA 4FXDA 2HIXA 2YTXA 3KF8B 1QCBD 1C4QA 2NVXB 3DLLA 1F9SA 2D0PA 1LTGD 4I65A 2MP1A 3W1GA 2F0SA 5JJLA 3NQIA 4DK3C 2E74C 1I4XA 1PH9A 4DV0Q 5CV4A 3J80i 4IUUA 2B2YC 3HOWH 5IYDH 1QNKA 3KFUA 4HCEA 2I5HA 1H9RA 1VQJA 3KBGA 1D2BA 3GV3A 2PYKA 4CDDC 4CHTB 4DGZA 1HZ9A 2OXPA 1R4QB 2DUDA 1E3PA 5KGUA 3IFTA 1AZQA 3FP9A 2N49A 2RDFA 3VA5A 5EBDA 3J7ZC 4JI0Q 4R4TA 4LF4L 4BBSB 1HTLD 4KV6A 1MJEA 2TMPA 3DM1A 5BR8L 2X69A 2O2LD 2KCNA 3CCMA 2O5IC 1KNEA 3J81c 3T1YL 1NSNS 1BQQT 4IPGA 1X65A 4R4OA 1EIYB 4M8AA 5IYBG 4FF1A 3VR6A 3M3YB 1P8LA 1PTOB 2ZTCA 2F0GA 5C4XG 1HZBA 1PH4A 4N8FA 4NPSA 5GQOA 2ASBA 2H4OA 2JA7B 3J81E 4K5WA 2EXDA 2GA4B 5C4ZA 1S5DD 1PTOC 1CQVA 3A0JA 1YNNC 1AP0A 4RHRA 3TP8A 1BNZA 3GTQH 2R7ZH 1CKNA 2KCTA 4YWMA 2E5LQ 4JI4Q 3OPOA 1VQLA 2L1BA 1IKLA 5C4HA 2DN8A 2FMMA 4K5VA 4A3KH 5A35A 3SVMA 4B3MQ 2CW0D 5C3WA 1VQGA 1GKHA 3MXPA 3OMGA 2AQ2B 4GLXA 1LABA 1C7YA 3BDOA 3E0JA 3I4OA 1W2BA 1T5XD 1GJXA 4OX9Q 3PUYA 2BA1A 3LNNA 2EOTA 3S1MB 2QEXA 3GV6A 2K4KA 3SE0A 1RTOA 4OHJA 4FVMA 5IWAQ 2FJ2A 2XTIA 4JI1Q 2PQAA 1NR2A 4AYBE 1M8AA 1XMOL 4QF4A 3PIO3 1YVCA 3X3NA 1KDCA 2RCFA 3HKZB 2CCZA 3GTGB 2UXDQ 1SN8A 1PH1A 2N3SA 3GTKH 1Q8IA 1GO3E 2EPBA 3TREA 1YJWA 5D3IB 3F1ZA 4PNYA 1IHZA 4PG3A 3I70A 4UAIA 3HZXA 3SR1A 3GTJH 3JAMc 4KJOA 4JI5Q 2JK8A 1CA5A 5E7NA 2EY6A 3MVVA 5C4JB 2MO1A 3A5UA 3I2ZA 3OIPA 4KD4A 3CXCA 3ZYYX 1K28A 3A56A 1IYUA 1PMRA 3TDQA 4LNQA 1N34L 1EQTA 2PCFB 3FKIB 4KLKA 4A3IG 5EAYA 4XQNA 1J9OA 2HHHL 5EQ0A 4OL7A 3FVQA 2K01A 2CQOA 4Y7NB 4ALPA 4LFAL 4YIJA 3P20A 3H15A 1JE5A 5CR3A 1EU3A 1YHAA 2OT2A 3MXNA 4OIJA 4DNRB 4X65Q 1JR0D 1PZJD 4BY1H 1VQBA 3I7FA 2D62A 4DV1L 2NVTB 5AJ3Q 4JV5Q 1VQAA 3ND9A 1X32A 2X6GA 1S3OA 1JQYD 2VQEQ 3G48A 1O7ZA 2IX1A 4DV4Q 1FD7D 5JJZA 2EIFA 3C46A 5IE8A 2RA4A 3I4MH 3A8KE 1MKHA 1JC7A 1I50H 1TS2A 1X6OA 1ZYRC 1A3TA 1OTCA 3I72A 2OTJA 1SLJA 4HIKA 1F2LA 3HEJA 4OWXB 2XSCA 3ERSX 1WCMB 2HCCA 4G7ZC 1ENAA 1KRTA 2UXCQ 3I90A 2B29A 1QJOA 2K7VA 3QWNA 3D31A 1RD9D 4GOPB 1WTPA 2WV6D 2DNEA 3CRLC 1IBML 4CDFC 1E1TA 1GUSA 4KI0A 4DR2L 3PO3H 5C3EB 4JI7Q 1I4QA 4GOPC 2MPMA 4L5SA 4DV3Q 2B2YA 2N55A 2N8NA 2R93G 1DD2A 3H0GB 5IT9c 1NUCA 1EEFD 4UP7A 2PO4A 3EROA 2WAQB 2K33A 2J0TD 1O7IA 3MEHA 4YCUA 1ESFA 1TY0A 5IT9E 4K6DA 3PO2H 3G6EA 4KHPQ 1ET9A 3NHHA 1VQ6A 3VYRA 2IX0A 1BBWA 4ZKCB 2ES2A 4OIKA 3J81L 5E1FA 2NYZD 1T5EA 2Z4IA 1NJIC 2EYLA 5LMNQ 5E3FA 3OWFA 1VQHA 5CBEE 1BUVT 1RTNA 4V0BA 3OTOQ 1KDBA 1VQDA 1ML0D 1ONLA 2SOBA 1XMQQ 5GADC 4AQYL 1CT1D 2NWGA 3CHBD 4HIMA 1U4PA 4BA1I 4LWCA 3UE1A 2EZVA 1B4OA 4LUZA 3STBD 4DA2A 1V8QA 1PYBA 2OEOA 3CC7A 1JICA 3KLSA 2FHTA 4M1UB 4XYQA 4B3TQ 1ENFA 3EVQA 1YZ6A 2IWHA 4UHVA 4K2KA 3CCEA 5HY6A 1N36Q 2Y0SB 2VUMB 3X3MA 4H0LC 1H95A 2A73B 2SDFA 3LWEA 1WTQA 4DR5Q 1AFPA 1SE4A 4QL5A 4C3JB 2EVBA 1XNQL 4HJ5A 2B3GA 2BCOA 3F2UA 3H3VC 2I46A 2DY7A 3NWSA 2G9HD 2NVXH 5I9PA 1EWIA 2F3VA 2A6HC 2RVLA 1NE3A 3HOVG 2NN6H 1TWCH 5J22A 2JA9A 2K5QA 4PZ8A 1BBXC 4DR7L 1OO9B 5E4WC 1X3QA 2RDHA 4JYAQ 3D6CA 3OYYA 2D2CC 5FK9C 2AUKA 1NCVA 3O13A 1YNND 5FO7B 2R92G 3TP5A 4IOAA 2JA5G 4PZ6A 1GM5A 1B70B 4Q5VA 5AFWA 3KJOA 1IZ6A 2JA8H 4BBSH 2XVSA 1JOKA 2AHOB 1WTRA 4NXML 3BS1A 4DXFA 3CQZB 5L37A 2ZJRA 5EBCA 1MBYA 1G2SA 2B2VC 2A19A 1G91A 1AN8A 3BVGA 1C8CA 3CCJA 2J7ZA 2VY3A 4H44C 2K32A 4WFN3 3NENA 1HUNA 5JEAH 1FR3A 4B3SQ 1Q82C 1PFBA 2XWBB 1UEAB 1PHJA 4K14A 4QY7A 2JA7H 3GTQB 5KYLA 1EEID 1EY5A 4B3RL 1VQ4A 2MUYA 4WJ4A 3DWAA 4X64L 1OXUA 1JCKB 4A3EB 2F4VQ 4RGMA 2KA7A 3KLSX 2ZM6L 5HGQA 1YI2A 4QGUA 1MD2D 4A3CH 1W6KA 1FL0A 3CMAA 3SGIA 4DV6L 3F8TA 4JI8Q 4DK0A 4LUVA 1KAAA 1EWHA 2HQEA 3L0OA 4HMJA 3UI2A 3CP0A 4FF4A 4A3MG 1VQNA 4DV2L 3E9HA 1I3QB 5IIFA 3J80c 2WINB 4OO1I 3PV0A 2PZTA 3IRBA 1BR9A 3OW7A 2UUAL 1XPRA 2B63G 5IP9G 2BA0A 1OXSC 3GTOB 1DM0B 1QG7A 1SAPA 4A93H 4GKKL 3J80E 3VA7A 3URYA 3IAYA 1AEXA 1XTCD 1EIGA 3HOUG 1SSOA 1Y1VB 2N88A 3HKZE 3GTKB 5GROA 1VCIA 2M00A 4XIGS 3GTGH 1K8AC 4QQBX 3EFXD 3S17H 4N9PA 3D4RA 4CKEA 3W2DA 1QB5D 4GOPA 1VDZA 4KD3A 5ISRA 4BY7B 1IW7D 1SYGA 2IX3A 3PMFA 3U9OA 4X62L 1Y8OB 1V1OA 2UXBQ 1B3AA 5T1IA 1MI2A 5TSSA 3CC2A 4JBKA 3S1RB 5C4JH 4L5QA 5IT9L 3D0FA 1V9PA 1CKNB 1QZGA 1NR4A 4DV5Q 4KHVA 3FKIH 2KHJA 3JC66 5M3FG 2NBFA 2Q8TA 3QO2A 3KDFA 1UE5A 5JVH3 2B8FA 2CH4W 3RZDB 3PSIA 4JI3Q 4ODGA 1N32Q 1ZYRD 1HNWL 1A3UA 1VQMA 2YV5A 5C0XH 4BA2I 5ELEA 1HUMA 5CV6A 3RUZA 1A62A 2EYJA 1Q90A 5FLMH 2NVTH 3G7LA 1BXTA 4QMGA 3I73A 4RG1A 4GKJL 3W5OA 3I4NH 2NVQB 1SNOA 4DK6C 4UDUC 3CKIB 2KUMA 3HOYG 1PTOF 1SNMA 5GAHC 2RSOA 2PQAB 2YYZA 4ZUJA 3OW2A 4A3JG 1CHPD 3K0XA 3R93A 2JEAI 1IBLQ 4GN4B 3QOJA 2AWNA 1VQ7A 3PGZA 3BZCA 2B2TC 1L0YB 5ELOA 1WCMH 3TBIB 5C4XB 3T51B 4DR1L 2EYMA 3NELA 1HNXL 3PO3B 4F8MA 4RFBA 2MGSA 2Q2HA 3K0YA 2LY7A 5J1ZA 1SYDA 1A6XA 1RODA 4C1NI 4FDBA 1WYDA 2XRQD 4KY6A 5A2QE 2EY5A 5LL6S 5IGDA 1RDPD 4BBRG 3PUWA 1WOCA 4RKBA 3H0GH 2K5WA 3J81j 3SXHA 1GD7A 1J5EL 3HFZB 1F2MA 1CZWA 1F9RA 2WAQE 1DJRD 1D5MC 4MNOA 3C1FA 3MXNB 3MXGA 5BN3A 1O7LA 1CI3M 3TZUA 1S5BD 4PV1C 4JCVE 5BN4A 2ZTEA 1VQOA 3BDCA 1VQKA 1SMYC 3SEBA 3VYSA 1HZAA 4PZ7A 5H1SE 3K5LA 1UUPA 2L55A 1PFNA 4LF4Q 1OXXK 4A3GG 2PMZB 2EY1A 2I5MX 4HEDA 5BR8Q 1STGA 4XQJA 5LHY1 3D8GA 3T1YQ 5F2DA 5G3LD 3OMCA 3I56A 3CD6A 3GQBA 4AYBG 2IW3A 2NTTA 4OWTB 3V05A 4JBJA 3ER0A 1M4VA 1ET6A 2A6HD 4QB4A 2RBMA 4FXKC 1ENCA 3BJUA 4IPHA 3DWPA 1PFSA 5NUCA 4DXGA 3RZOB 1I5FA 4RGOS 3EQLC 3NUCA 1NMGA 5CBAE 4LF8L 4YHHL 1EQQA 5KNCA 2JQOA 2DGYA 2Y0SE 2EJMA 2VUMH 2L11A 4NW2A 3G71A 3FRPB 3H3VH 1CSQA 4HJAA 1DYQA 1D1IA 4C3JH 4FO2A 4RCNA 4HN7A 4BXXH 2ICEC 1TWCB 3STBC 2QW7A 3PF4A 3TEHB 2JP1A 3MEFA 1CKOA 1MGSA 1Y69U 1XXGA 2F0QA 2JA6G 3S2HB 4OELB 5I4DA 1STAA 1A0IA 4GN5A 2Z0SA 1EL0A 1KRSA 2HD3A 2JA8B 4A76A 2OQ0A 4RAUC 2N78A 1HR0L 3K59A 1GOZA 1XMOQ 2F1MA 5EKLA 3OHXC 1E2WA 1JT8A 3HKSA 2LXJA 1EFID 4KJNA 4B08A 3CQZH 3D3RA 2KBNA 4DAVA 1HTPA 2NUCA 2ENBA 1EY4A 5M3MG 1LV9A 4HSPA 3MFGA 4X3TA 2C35B 3DHQA 4YCVA 3A54A 4HJ8A 2KHSA 4LJZC 5CV5A 1TT2A 1DGSA 4NKLA 3HOZH 3D4WA 3RN5A 1ESRA 4GS3A 3RMHA 5CV9A 2ALYB 2NTSA 1JOOA 1ASZA 2F0VA 1N34Q 4A3EH 1D1KA 2EYFA 4OO1G 5ELBA 1E22A 5IY0A 3KF6A 2HHHQ 1WJJA 2WKCA 4HIOA 5I6YA 1TWGB 4LFAQ 1SE3A 4P75A 1N33L 4IUNA 1U5KA 2YU9H 1CTMA 1WTWA 1E2VA 3VDYA 2XRSD 1JJ2A 1QVCA 1Q46A 1EU4A 2A1AA 3GDEA 3TRZA 4DV1Q 2F52A 1I3QH 1AH9A 4ZRZA 1PH7A 3L2PA 3BG3A 4IUTA 4O42A 4A93B 5JAVA 1AZPA 4RHSA 2PZWA 4KY7A 1KXLA 2EQSA 5M5YH 3GP7A 3CCUA 3GTOH 2F0OA 1B53A 2B2TA 2UUBL 1S5ED 3KLRA 2VW9A 3CRKC 1YNXA 5C5LA 1SYFA 4ABNA 5I2XA 1SNPA 1LO5D 1HZCA 3S17B 3K80C 2MJ8A 3LWUA 4LFCQ 1Y1VH 1TS4A 5A2QL 4C3HG 2WKDA 2KECA 4P2CB 3ERQA 1EZ6A 2F03A 2F0TA 1RKNA 1TR5A 2B2WA 4IUQA 4DR6L 5FOBB 2CHBD 4BY7H 2BDOA 1IBMQ 5D3DA 4DR2Q 2RHQB 4A3FG 5FJ8G 4DFAA 3S1RH 2CH4A 3JAME 1U4MA 2AWOA 4G4KA 4X3SA 2ATWA 3SDZA 3S2DH 1PRTB 2P5ZX 2HT1A 3QB3A 1KAWA 1ICWA 3RZDH 1E7ZA 1GXDC 4A3DG 4AH6A 1IW7C 2SNSA 1PRTC 5DLQE 2JJQA 3HOVB 4TSSA 3F2DA 4NDXA 3KK7A 3I4NB 2F0DA 3TZDA 3WOFA 1W6JA 3H91A 1I6VC 2R92B 2MQHA 2CFMA 3ICEA 5CGKA 1K0RA 2PQEA 2NVQH 1IYVA 3TP6A 1VMCA 3QIAA 4J15A 3E3XA 4LF5L 3RN2A 4LFBL 4MHEA 4AQYQ 2AKWB 2NZ1D 4Z9CB 1X3PA 4KK7A 3Q22A 5IYBH 1DZ1A 5GAGC 4J6HA 3T13A 5C4XH 4A3BG 3S24A 2F0NA 4H02A 1X9NA 1Y14B 2B2UC 1PVOA 2VQFL 4Q0FA 4JPBW 4L6TB 3MA2B 1EQRA 4F7XA 1SMYD 1WFQA 4G7OC 2WB1E 1CUKA 2HDMA 5JOBA 1NMFA 4IUPA 1GHJA 5EKKA 4FNFA 2VS1A 1HXYD 1STYA 3SK6A 1XNQQ 2AQ1B 4IUVA 4F87A 1YBYA 5ELDA 1PA6A 2VB3X 2K5DA 1F2ZA 4IJLA 3KDFB 2I07B 3Q0AA 3AFQA 5FO8B 1S5CD 2RHSB 4N8X1 4DR7Q 1GUGA 4RA8A 3KJPA 1SYEA 1YJNA 2R7FA 3M85A 1KIXA 1GHKA 1J6QA 3CCLA 2PI2A 3OWEB 4APVA 2B63B 4IFDJ 3NK9A 1EIFA 4NXMQ 1LTBD 2L4NA 2PMZE 2YTVA 1NY4A 2OQKA 3S1NB 1P16A 3VR3A 2AMCB 4C3IG 3V2TA 1VQEA 3VYUA 1BKBA 2MO0A 5JVG3 1DOLA 1IYJB 3CPFA 1CK1A 4K2LA 2A68C 4R8NA 4OONA 3HKZG 2ZJPA 5EPJA 4B3RQ 4H7BA 4A3LG 1C0AA 2Q2UA 2LSSA 1LTRD 1ILPA 3RZOH 5C3XA 1O78A 3TQYA 5DM73 2ZM6Q 4ZK9B 4JI2L 4EQOA 4MTKA 3J7YW 1K8GA 2SEBD 2B39A 1II3A 4R4IA 4DV6Q 3QOLA 1CA6A 5HGTA 4A3IH 5CORA 5M3FB 1JWSD 2CWAA 3T53B 1DOMA 4XXEA 4MTNA 4ZQ3A 1IL2A 3NBIA 3S2HH 2R61A 2Q2TA 2QF7A 2UUAQ 4A4IA 4HSVA 1IKMA 1BDOA 1YJ9A 1RCVD 5J39A 4HJ7A 1T9HA 4GKKQ 4KY5A 1OXTA 3ULPA 4FYDA 5IP7G 1UE7A 3M9BA 4R4CA 3MAQA 1EIHA 4LK1C 3HOYB 3CC4A 3G4SA 1Y1WG 4A3JB 3ONAB 2QA4A 2BH2A 2H5XA 3JAML 2KHIA 3HOZB 1LT6D 5IGGA 1JMCA 2F0KA 2UUCL 4X62Q 1UE6A 2OF1A 1MSHA 1PDQA 1DOKA 1HA5A 4FF2A 1PZID 3PIPA 1XMQL 1Q1EA 2I5LX 5JEAJ 1Z6HA 2Q2IA 1RF2D 1EY8A 5C44G 1EFWA 1GUNA 2E8GA 4JBWA 4RGTA 1XYIA 4IZ8A 3ULJA 1XNRL 1L2FA 3FHWA 4LUOA 5T1GA 2YU9B 5LMNW 1TWGH 3DEPA 1B44D 2R93H 5C3EG 1HNWQ 1N9WA 3GTLB 3ITPA 5K36G 2K5HA 5J3BA 2JE6I 4EGVA 1F9PA 2DJFC 4FP5D 4YCWA 4DUYL 3NTKA 5JPMC 3ULLA 5LMUL 1PLFA 5M5YB 1HCZA 1HNZL 1UWVA 4GKJQ 1HFGA 4JI6L 2EJFC 3UDIA 1DXMA 1J8IA 1A3VA 2K28A 4WRDA 4A3GB 1O80A 2A6EC 2R6GA 2RSNA 3VR4A 1QOHA 2D9UA 5M5XB 3D6WA 4IFDI 1BVSA 2B2UA 4POGA 1WTVA 1TS5A 5JPNC 3M4OB 3W1BA 4AYBB 2K1BA 1KQSA 4DR1Q 1KL9A 1HNXQ 4JVZA 1PRTD 1B9MA 2KCMA 1BCPB 1Y8PB 4EQ5A 1Q3LA 4RMFA 3U4ZA 1KTKA 3S9WA 2Z9HA 1X3EA 4WORA 4KTAA 4OWWB 1BCPC 3HOXG 1BO0A 3S2DB 2A69D 2D5DA 1SJED 4NP5A 3M4PA 2WACA 4DR3L 1AW7A 3OSOA 4J1MA 1R4PB 3K5NA 4RGNA 5GAEC 3KF6B 1J5EQ 5IYCG 1VQIA 4GNXB 4TVAB 3A8IE 5KEEA 3MWYW 1EWCA 1U4RA 3AFPA 1XTDA 4LF7L 1V43A 3HOVH 3S1QH 1JWMD 3CCRA 1B3QA 4K0KL 1PYWD 3HOWG 3NXWA 5IYDG 4UPAA 3J7AV 2DNCA 3GTMH 5C0XJ 2R92H 1YNJD 2JA5H 4ZAIA 2RQXA 1LT4D 3FEWX 1HJPA 1VQCA 3MTSA 1CZGA 1WTOA 4LF6L 4LF9L 2K75A 2CWPA 1PV4A 1FJGL 1I6HB 1F77A 1SNDA 1EYAA 4XDXA 2FMCA 2K05A 1YITA 2AUJD 3P7JA 4C1NK 4QCLA 1D5XC 1Q1BA 2QKIC 2NZOA 3R2TA 1IBKL 2Z4HA 2ZJQA 4YY3L
chains in the Genus database with same CATH topology
1SLJA 3OTOL 3AEVA 2C35B 3BZKA 4YCVA 4HIKA 3CW2C 2K14A 4OWXB 4HJ8A 3ERSX 1RL2A 1K3RA 1V1QA 4HJ9A 1WCMG 1DGSA 3HOZH 3CAMA 1B7YB 1KRTA 4A3BH 1VQ5A 2UXCQ 3RN5A 1Z47A 2B29A 1PH5A 1C9OA 4GS3A 4IPCA 3M3YH 3D31A 2BH8A 4KHZA 2ALYB 1BBUA 1OXVA 2Z6KC 4R4QA 3JAMi 4YHHQ 4GOPB 4LF8Q 4DR3Q 1ASZA 3S15H 3TS2A 1IBML 2GN5A 1E1TA 1N34Q 1QUQB 4A3EH 4X6AH 4KI0A 4DR2L 2R7ZG 3PO3H 4B3TL 4JI7Q 3F2CA 4L5RC 1B8AA 4OO1G 4GOPC 1E22A 5IY0A 3KF6A 2HHHQ 1WJJA 1X56A 3K8AA 4HIOA 2UXBL 4L5SA 4DV3Q 1N36L 2N8NA 1Q81C 4LFAQ 2R93G 1SMXA 1L0WA 5IT9c 3H0GG 4P75A 1K73C 1N33L 2OCEA 4UP7A 1U5KA 1EUJA 2YU9H 4LF7Q 4DR5L 1WI5A 3VDYA 2OTLA 4A3KG 1SR3A 1QVGA 1L1OB 1JJ2A 1QVCA 1Q46A 4K0KQ 4IJHA 2WAQG 1YHBA 2A1AA 4A3MH 3ZJYC 1O7IA 3GDEA 4YCUA 4DPGA 4DR4L 1Q12A 3K81C 4DV1Q 3TRZA 2F52A 1I3QH 1AH9A 3PO2H 2R7DA 3NBHB 3G6EA 4KHPQ 1PH7A 1L1OC 3L2PA 1HR0Q 1I94L 1VQ6A 1KXLA 2B63H 2IX0A 1SE8A 2EQSA 5IP9H 5M5YH 3CCUA 1BBWA 4LF6Q 4LF9Q 3GD7A 3GTOH 2ES2A 4JYAL 1VQ8A 2UUBL 3S1MH 1FJGQ 5ELNA 3WWVA 4POFA 2VW9A 3S1NH 1NJIC 1YNXA 5LMNQ 4NXNL 4C3IH 1HZCA 3K80C 1IBKQ 1VQHA 3HOUH 4LFCQ 4YY3Q 1Y1VH 3OTOQ 3PUVA 1VQDA 1TXYA 5JJKA 1VS0A 1XMQQ 5GADC 1YIJA 4AQYL 3M7NA 4DUZL 4HIMA 1MJCA 4DR6L 4IPDA 4LWCA 4BA1I 2OWOA 3M4QA 3UE1A 4A3LH 3U58A 4LUZA 4B3SL 4BY7H 3STBD 1PYBA 1IBMQ 1G6PA 1TWAH 3CC7A 3L7ZC 4DR2Q 2RHQB 4A3FG 4B3TQ 2A8VA 1YZ6A 5FJ8G 3E9IA 1Z9FA 3S1RH 4A75A 3CMEA 3UDFA 3AQQA 3CCEA 5HY6A 2AWOA 1N36Q 4DNIA 2Y0SG 3NEMA 2VUMG 2GVAA 2ATWA 3RLFA 3AYHB 2F4VL 3S2DH 2WP8J 3RLOA 2YTYA 1N33Q 2UU9L 1H95A 2PNHA 4O0AA 1E1OA 4DR5Q 1QVFA 5M3FH 2HT1A 1LM0A 1X3GA 4QL5A 4GNXC 1KAWA 1XNQL 4HJ5A 2B3GA 3RZDH 1E7ZA 1EYGA 3U50C 2NVXH 4A3DG 4AH6A 4JOIA 5DLQE 5FLXc 1L1OA 1EWIA 2JJQA 4JI8L 4BXXG 1AE3A 4DR4Q 3EN2A 1NE3A 3KYHC 2ZTDA 4Y7NH 3HOVG 1TWCH 1I94Q 2JA9A 4P73A 4PZ8A 3DM3A 4BY1G 3F2DA 4DR7L 4P71A 4JYAQ 3OYYA 2VZAA 2UUBQ 1KD1C 4IOAA 5IP7H 2R92G 2MQHA 2CFMA 3ICEA 2JA5G 3UDXA 4PZ6A 4NXNQ 1GM5A 1K0RA 2K5NA 1B70B 2NVQH 2MNAA 1A8VA 1NTGA 3KJOA 1IZ6A 1RIPA 1IXRA 2JA8H 3HOYH 2RF4A 4BBSH 1Y1WH 2VNUD 1A63A 2AHOB 2IHEA 2NN6I 4J15A 4NXML 4WJ3M 3I55A 4LF5L 2NZHA 4A3JH 2ZJRA 5C0XI 3RN2A 3I4MG 4LFBL 1MIUA 2V1CC 4L5TA 4AQYQ 2AKWB 2A19A 1JB7A 4DUZQ 3E0EA 4DR6Q 3CCJA 2VY3A 3CCSA 1YEZA 3NENA 4EX5A 1CKMA 5IYBH 4B3SQ 1Q82C 4X66L 4DV7L 4GLAC 5GAGC 4QJFA 1HH2P 1PHJA 5C4XH 4QY7A 3HOZG 1E24A 3S16H 1D7QA 4QIWE 4A3BG 2JA7H 3S24A 1X9NA 4H02A 1Y14B 4ME3A 4B3RL 1PVOA 1X3FA 2VQFL 4UP8A 1VQ4A 3UE0A 4WJ4A 1G291 1EQRA 1Q86C 4X64L 1WFQA 1OXUA 3CCVA 2WB1E 1CUKA 5C44H 2F4VQ 1JJGA 4A3EG 1KC8C 1NMFA 4GNXA 2UU9Q 3PO3G 2ZM6L 1HR0W 3U4VA 5HGQA 1LTLA 2VS1A 3T1HL 4QGUA 1YI2A 3F2BA 1NBWA 2E2JH 4A3CH 2WB1G 4BBRH 1XNQQ 1FL0A 3KOJA 5C3EH 3CMAA 3SGIA 4DV6L 1YBYA 3F8TA 4JI8Q 2RCNA 4DV5L 1PA6A 4IJLA 1XPUA 4LUVA 3GTLH 3KDFB 4P74A 4DAMA 3RLNA 3L0OA 1SFOH 3AFQA 4IFDG 3CP0A 4XTCS 2RHSB 4JI3L 4DR7Q 5JJIA 3KJPA 2I0QA 4DAYB 1N32L 2XGTA 4A3MG 1EOVA 1AE2A 3A74A 2R7FA 3K7UC 3PUXA 3CPWA 3LGJA 4DV2L 3E9HA 3M85A 1YJNA 1VQNA 1FGUA 3J80c 1KIXA 3PO2G 1QZHA 1J6QA 3BU2A 4OO1I 3PV0A 3IRBA 1Q7YC 1FVIA 2PI2A 3CCLA 3J7A5 4APVA 4DV0L 2UUAL 1XPRA 2B63G 4IFDJ 2JEBI 5IP9G 2BA0A 1OXSC 1EIFA 4NXMQ 4A3GH 4A93H 2YTVA 2PMZE 4LF5Q 1NY4A 4GKKL 2OQKA 1VQPA 4LFBQ 1P16A 2AMCB 1K9MC 4P72A 5M5XH 1G51A 2GVBA 3HOUG 4JI0L 1VQEA 3HKZE 2Z6KA 1GVPA 1Y1VG 1BKBA 2MO0A 4GLVB 5GROA 4JBMA 1VCIA 3KLWA 4XIGS 2K5VA 4X66Q 4DV7Q 3GTGH 1IYJB 2F3IA 1K8AC 4QQBX 3CPFA 1CSPA 3S17H 1TWFH 1UEBA 2D0OA 2L15A 4OONA 3HKZG 2ZJPA 4UP9A 4GOPA 1IBLL 3UDGA 2HIVA 4B3RQ 3PUZA 1XJVA 2VQFQ 4A3LG 4HIDA 2Q2UA 1C0AA 4IOCA 4BY7G 2LSSA 1QUQA 4JG2A 4X62L 3EIVA 2NVYH 3RZOH 2UXBQ 3TQYA 4GN3B 3HOXH 2ZM6Q 3CC2A 3T1HQ 4JI2L 4JBKA 2WFWA 5C4JH 4L5QA 4IO9A 2KENA 1X55A 3CCQA 1YHQA 3D0FA 1K8GA 3A5ZB 1V9PA 4R4IA 1CKNB 4DV6Q 1QZGA 1LYLA 3GTPH 4DKAC 4DV5Q 3FKIH 4A3IH 2LXKA 2KHJA 5IYCH 3JC66 1UE1A 4JC0A 5M3FG 1XPOA 2E5LL 3S14H 1UE5A 1Q8KA 2CWAA 2HIXA 2YTXA 3KDFA 3KF8B 3PSIA 4JI3Q 4JI4L 3DLLA 1N32Q 2IY5B 1HNWL 2D0PA 1VQMA 4MTNA 2YV5A 4BA2I 3W1GA 1IL2A 1LUZA 5JJLA 4DK3C 4B3ML 2JA6H 3M4OH 3S2HH 1KHIA 2NN6G 1PH9A 2Q2TA 4DV0Q 2UUAQ 1A62A 4LW1A 3J80i 3HOWH 4A4IA 5IYDH 3KFUA 2K52A 2I5HA 5FLMH 1D8LA 1VQJA 1YJ9A 2NVTH 3H3VI 1HZ9A 1T9HA 4HJ7A 4OX9L 4GKKQ 1OXTA 2DUDA 4RG1A 3ULPA 4GKJL 5IP7G 1E3PA 1UE7A 2FXQA 3M9BA 4R4CA 3FP9A 3W5OA 2N49A 4AIMA 3PIOA 4DK6C 3I4NH 3J7ZC 4JI0Q 4R4TA 5IWAL 3CC4A 4LF4L 2JA8G 3G4SA 1Y1WG 3HOYG 4BBSG 5GAHC 2YYZA 2PQAB 3OW2A 1MJEA 1I6HH 2QA4A 4A3JG 2BH2A 2H5XA 5BR8L 4JI1L 3CCMA 5M3MH 2KHIA 3K0XA 3J81c 3T1YL 2JEAI 1ASYA 1IBLQ 4GN4B 2AWNA 1VQ7A 4IPGA 1X65A 3PGZA 4R4OA 4C2MH 3BZCA 5JEAG 5IYBG 1EIYB 1JMCA 5ELOA 1P8LA 2UUCL 1WCMH 4X62Q 2UXDL 2ZTCA 4DR1L 4LFCL 3NELA 1HZBA 1PH4A 1HNXL 5C4XG 1UE6A 4NPSA 2K50A 5GQOA 1PH2A 2ASBA 3EBEA 2JA7G 3RNUA 4JI2Q 2EXDA 3PIPA 1U0LA 1VQFA 1XMQL 1Q1EA 2I5LX 1K83H 2Q2HA 5JEAJ 3A0JA 2Q2IA 1VQ9A 1EFWA 5C44G 2R7ZH 3GTQH 2CKZB 1WYDA 4FDBA 3PF5A 2E8GA 4JBWA 1CKNA 4JI5L 3Q8DA 2KCTA 3ULJA 1XNRL 1L2FA 4YWMA 3FHWA 4MZ9A 4LUOA 2E5LQ 2ID0A 5LMNW 3TS0A 4JI4Q 1S72A 1TWGH 4BBRG 1VQLA 4OXPA 4A3CG 2R93H 5C3EG 3PUWA 1WOCA 3H0GH 1HNWQ 3PCOB 1N9WA 3RR5A 1W3SA 3J81j 1GD7A 1J5EL 3HFZB 4A3KH 5K36G 2K5HA 4YWLA 5J3BA 4B3MQ 2IT1A 1PH6A 2JE6I 1VQGA 1GKHA 2WAQE 4YCWA 4DUYL 4MNOA 4GLXA 1C7YA 3I4OA 3MXNB 3ULLA 1W2BA 5LMUL 1HNZL 4OX9Q 4JCVE 3PUYA 2BA1A 2ZTEA 1VQOA 1UWVA 4GKJQ 1SRUA 4X65L 1VQKA 2QEXA 4JI6L 2K4KA 1X54A 3UDIA 1HZAA 4PZ7A 4JOIC 5H1SE 1PH3A 5IWAQ 4LF4Q 1OXXK 4A3GG 5AJ3L 4A93G 4JV5L 1R9TH 2I5MX 2VQEL 5BR8Q 2XTIA 2R6GA 2PQAA 4JI1Q 4AYBE 4DV4L 1XMOL 3T1YQ 1PH8A 4IFDI 1BVSA 1YVCA 4POGA 4TQUS 4C3HH 3I56A 2CCZA 3CD6A 3W1BA 3J81i 4AYBG 4OWTB 4R1JA 2MFIA 2UUCQ 2UXDQ 1SN8A 1KQSA 4DR1Q 1KL9A 1HNXQ 4JBJA 3ER0A 4PMWA 2N3SA 4X64Q 1PH1A 3GTKH 1GO3E 2KCMA 4NB3A 3BJUA 3TREA 1TWHH 4IPHA 4EQ5A 1SROA 1YJWA 3F1ZA 1PFSA 4RMFA 3U4ZA 4PG3A 3K7AH 2E2IH 1N8RC 1X3EA 1I5FA 3GTJH 2QGQA 3JAMc 4A3FH 3CF5A 2UXCL 4JI5Q 2JK8A 4OWWB 1NMGA 5E7NA 5FJ8H 3HOXG 1XNRQ 4LF8L 2MO1A 3B6YA 3A5UA 3M4PA 3I2ZA 4YHHL 1EQQA 4DR3L 3CXCA 2JQOA 2DGYA 2Y0SE 2VUMH 2HQLA 3G71A 5GAEC 1N34L 4LNQA 3H3VH 3KF6B 1CSQA 4HJAA 4JI7L 3FKIG 4KLKA 4A3IG 1J5EQ 5IYCG 1VQIA 4GNXB 4TVAB 5EAYA 4DV2Q 2HHHL 4C3JH 4DV3L 4A3DH 2CQOA 4ALPA 4DUYQ 4LFAL 4Y52H 4BXXH 3AFPA 1XTDA 3STBC 3H15A 1JE5A 2VL6A 2E2HH 5LMUQ 4UY8C 3PF4A 4LF7L 3TEHB 5C0XG 4YWKA 1HNZQ 1V43A 3MEFA 3HOVH 1CKOA 1YHAA 3S1QH 3CCRA 2JA6G 4X65Q 4JI6Q 4BY1H 4K0KL 1VQBA 3HOWG 1A0IA 3GO5A 5IYDG 4GN5A 2Z0SA 4UPAA 5FLMG 3I7FA 3GTMH 1M1KC 2D62A 1KRSA 2PI2E 5AJ3Q 4DV1L 1M90C 4KHPL 4O2DA 4JV5Q 1VQAA 5C0XJ 2VQEQ 4A76A 1S3OA 2R92H 2IHFA 1JJCB 2OQ0A 3G48A 2N78A 1HR0L 2JA5H 2IX1A 4DV4Q 1HJPA 1XMOQ 1VQCA 3I4NG 1JT8A 4LF6L 2EIFA 4LF9L 2K75A 2LXJA 3HKSA 2CWPA 1PV4A 5IE8A 1FJGL 3I4MH 3CQZH 5M5WH 1S40A 1PYSB 2KBNA 1MKHA 1I50H 1YITA 5LMNL 5M3MG 1Q1BA 1X6OA 2NZOA 1IBKL 2ZJQA 1OTCA 4YY3L 2OTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SLJ A;  3OTO L;  3AEV A;  2C35 B;  3BZK A;  4YCV A;  4HIK A;  3CW2 C;  2K14 A;  4OWX B;  4HJ8 A;  3ERS X;  1RL2 A;  1K3R A;  1V1Q A;  4HJ9 A;  1WCM G;  1DGS A;  3HOZ H;  3CAM A;  1B7Y B;  1KRT A;  4A3B H;  1VQ5 A;  2UXC Q;  3RN5 A;  1Z47 A;  2B29 A;  1PH5 A;  1C9O A;  4GS3 A;  4IPC A;  3M3Y H;  3D31 A;  2BH8 A;  4KHZ A;  2ALY B;  1BBU A;  1OXV A;  2Z6K C;  4R4Q A;  3JAM i;  4YHH Q;  4GOP B;  4LF8 Q;  4DR3 Q;  1ASZ A;  3S15 H;  3TS2 A;  1IBM L;  2GN5 A;  1E1T A;  1N34 Q;  1QUQ B;  4A3E H;  4X6A H;  4KI0 A;  4DR2 L;  2R7Z G;  3PO3 H;  4B3T L;  4JI7 Q;  3F2C A;  4L5R C;  1B8A A;  4OO1 G;  4GOP C;  1E22 A;  5IY0 A;  3KF6 A;  2HHH Q;  1WJJ A;  1X56 A;  3K8A A;  4HIO A;  2UXB L;  4L5S A;  4DV3 Q;  1N36 L;  2N8N A;  1Q81 C;  4LFA Q;  2R93 G;  1SMX A;  1L0W A;  5IT9 c;  3H0G G;  4P75 A;  1K73 C;  1N33 L;  2OCE A;  4UP7 A;  1U5K A;  1EUJ A;  2YU9 H;  4LF7 Q;  4DR5 L;  1WI5 A;  3VDY A;  2OTL A;  4A3K G;  1SR3 A;  1QVG A;  1L1O B;  1JJ2 A;  1QVC A;  1Q46 A;  4K0K Q;  4IJH A;  2WAQ G;  1YHB A;  2A1A A;  4A3M H;  3ZJY C;  1O7I A;  3GDE A;  4YCU A;  4DPG A;  4DR4 L;  1Q12 A;  3K81 C;  4DV1 Q;  3TRZ A;  2F52 A;  1I3Q H;  1AH9 A;  3PO2 H;  2R7D A;  3NBH B;  3G6E A;  4KHP Q;  1PH7 A;  1L1O C;  3L2P A;  1HR0 Q;  1I94 L;  1VQ6 A;  1KXL A;  2B63 H;  2IX0 A;  1SE8 A;  2EQS A;  5IP9 H;  5M5Y H;  3CCU A;  1BBW A;  4LF6 Q;  4LF9 Q;  3GD7 A;  3GTO H;  2ES2 A;  4JYA L;  1VQ8 A;  2UUB L;  3S1M H;  1FJG Q;  5ELN A;  3WWV A;  4POF A;  2VW9 A;  3S1N H;  1NJI C;  1YNX A;  5LMN Q;  4NXN L;  4C3I H;  1HZC A;  3K80 C;  1IBK Q;  1VQH A;  3HOU H;  4LFC Q;  4YY3 Q;  1Y1V H;  3OTO Q;  3PUV A;  1VQD A;  1TXY A;  5JJK A;  1VS0 A;  1XMQ Q;  5GAD C;  1YIJ A;  4AQY L;  3M7N A;  4DUZ L;  4HIM A;  1MJC A;  4DR6 L;  4IPD A;  4LWC A;  4BA1 I;  2OWO A;  3M4Q A;  3UE1 A;  4A3L H;  3U58 A;  4LUZ A;  4B3S L;  4BY7 H;  3STB D;  1PYB A;  1IBM Q;  1G6P A;  1TWA H;  3CC7 A;  3L7Z C;  4DR2 Q;  2RHQ B;  4A3F G;  4B3T Q;  2A8V A;  1YZ6 A;  5FJ8 G;  3E9I A;  1Z9F A;  3S1R H;  4A75 A;  3CME A;  3UDF A;  3AQQ A;  3CCE A;  5HY6 A;  2AWO A;  1N36 Q;  4DNI A;  2Y0S G;  3NEM A;  2VUM G;  2GVA A;  2ATW A;  3RLF A;  3AYH B;  2F4V L;  3S2D H;  2WP8 J;  3RLO A;  2YTY A;  1N33 Q;  2UU9 L;  1H95 A;  2PNH A;  4O0A A;  1E1O A;  4DR5 Q;  1QVF A;  5M3F H;  2HT1 A;  1LM0 A;  1X3G A;  4QL5 A;  4GNX C;  1KAW A;  1XNQ L;  4HJ5 A;  2B3G A;  3RZD H;  1E7Z A;  1EYG A;  3U50 C;  2NVX H;  4A3D G;  4AH6 A;  4JOI A;  5DLQ E;  5FLX c;  1L1O A;  1EWI A;  2JJQ A;  4JI8 L;  4BXX G;  1AE3 A;  4DR4 Q;  3EN2 A;  1NE3 A;  3KYH C;  2ZTD A;  4Y7N H;  3HOV G;  1TWC H;  1I94 Q;  2JA9 A;  4P73 A;  4PZ8 A;  3DM3 A;  4BY1 G;  3F2D A;  4DR7 L;  4P71 A;  4JYA Q;  3OYY A;  2VZA A;  2UUB Q;  1KD1 C;  4IOA A;  5IP7 H;  2R92 G;  2MQH A;  2CFM A;  3ICE A;  2JA5 G;  3UDX A;  4PZ6 A;  4NXN Q;  1GM5 A;  1K0R A;  2K5N A;  1B70 B;  2NVQ H;  2MNA A;  1A8V A;  1NTG A;  3KJO A;  1IZ6 A;  1RIP A;  1IXR A;  2JA8 H;  3HOY H;  2RF4 A;  4BBS H;  1Y1W H;  2VNU D;  1A63 A;  2AHO B;  2IHE A;  2NN6 I;  4J15 A;  4NXM L;  4WJ3 M;  3I55 A;  4LF5 L;  2NZH A;  4A3J H;  2ZJR A;  5C0X I;  3RN2 A;  3I4M G;  4LFB L;  1MIU A;  2V1C C;  4L5T A;  4AQY Q;  2AKW B;  2A19 A;  1JB7 A;  4DUZ Q;  3E0E A;  4DR6 Q;  3CCJ A;  2VY3 A;  3CCS A;  1YEZ A;  3NEN A;  4EX5 A;  1CKM A;  5IYB H;  4B3S Q;  1Q82 C;  4X66 L;  4DV7 L;  4GLA C;  5GAG C;  4QJF A;  1HH2 P;  1PHJ A;  5C4X H;  4QY7 A;  3HOZ G;  1E24 A;  3S16 H;  1D7Q A;  4QIW E;  4A3B G;  2JA7 H;  3S24 A;  1X9N A;  4H02 A;  1Y14 B;  4ME3 A;  4B3R L;  1PVO A;  1X3F A;  2VQF L;  4UP8 A;  1VQ4 A;  3UE0 A;  4WJ4 A;  1G29 1;  1EQR A;  1Q86 C;  4X64 L;  1WFQ A;  1OXU A;  3CCV A;  2WB1 E;  1CUK A;  5C44 H;  2F4V Q;  1JJG A;  4A3E G;  1KC8 C;  1NMF A;  4GNX A;  2UU9 Q;  3PO3 G;  2ZM6 L;  1HR0 W;  3U4V A;  5HGQ A;  1LTL A;  2VS1 A;  3T1H L;  4QGU A;  1YI2 A;  3F2B A;  1NBW A;  2E2J H;  4A3C H;  2WB1 G;  4BBR H;  1XNQ Q;  1FL0 A;  3KOJ A;  5C3E H;  3CMA A;  3SGI A;  4DV6 L;  1YBY A;  3F8T A;  4JI8 Q;  2RCN A;  4DV5 L;  1PA6 A;  4IJL A;  1XPU A;  4LUV A;  3GTL H;  3KDF B;  4P74 A;  4DAM A;  3RLN A;  3L0O A;  1SFO H;  3AFQ A;  4IFD G;  3CP0 A;  4XTC S;  2RHS B;  4JI3 L;  4DR7 Q;  5JJI A;  3KJP A;  2I0Q A;  4DAY B;  1N32 L;  2XGT A;  4A3M G;  1EOV A;  1AE2 A;  3A74 A;  2R7F A;  3K7U C;  3PUX A;  3CPW A;  3LGJ A;  4DV2 L;  3E9H A;  3M85 A;  1YJN A;  1VQN A;  1FGU A;  3J80 c;  1KIX A;  3PO2 G;  1QZH A;  1J6Q A;  3BU2 A;  4OO1 I;  3PV0 A;  3IRB A;  1Q7Y C;  1FVI A;  2PI2 A;  3CCL A;  3J7A 5;  4APV A;  4DV0 L;  2UUA L;  1XPR A;  2B63 G;  4IFD J;  2JEB I;  5IP9 G;  2BA0 A;  1OXS C;  1EIF A;  4NXM Q;  4A3G H;  4A93 H;  2YTV A;  2PMZ E;  4LF5 Q;  1NY4 A;  4GKK L;  2OQK A;  1VQP A;  4LFB Q;  1P16 A;  2AMC B;  1K9M C;  4P72 A;  5M5X H;  1G51 A;  2GVB A;  3HOU G;  4JI0 L;  1VQE A;  3HKZ E;  2Z6K A;  1GVP A;  1Y1V G;  1BKB A;  2MO0 A;  4GLV B;  5GRO A;  4JBM A;  1VCI A;  3KLW A;  4XIG S;  2K5V A;  4X66 Q;  4DV7 Q;  3GTG H;  1IYJ B;  2F3I A;  1K8A C;  4QQB X;  3CPF A;  1CSP A;  3S17 H;  1TWF H;  1UEB A;  2D0O A;  2L15 A;  4OON A;  3HKZ G;  2ZJP A;  4UP9 A;  4GOP A;  1IBL L;  3UDG A;  2HIV A;  4B3R Q;  3PUZ A;  1XJV A;  2VQF Q;  4A3L G;  4HID A;  2Q2U A;  1C0A A;  4IOC A;  4BY7 G;  2LSS A;  1QUQ A;  4JG2 A;  4X62 L;  3EIV A;  2NVY H;  3RZO H;  2UXB Q;  3TQY A;  4GN3 B;  3HOX H;  2ZM6 Q;  3CC2 A;  3T1H Q;  4JI2 L;  4JBK A;  2WFW A;  5C4J H;  4L5Q A;  4IO9 A;  2KEN A;  1X55 A;  3CCQ A;  1YHQ A;  3D0F A;  1K8G A;  3A5Z B;  1V9P A;  4R4I A;  1CKN B;  4DV6 Q;  1QZG A;  1LYL A;  3GTP H;  4DKA C;  4DV5 Q;  3FKI H;  4A3I H;  2LXK A;  2KHJ A;  5IYC H;  3JC6 6;  1UE1 A;  4JC0 A;  5M3F G;  1XPO A;  2E5L L;  3S14 H;  1UE5 A;  1Q8K A;  2CWA A;  2HIX A;  2YTX A;  3KDF A;  3KF8 B;  3PSI A;  4JI3 Q;  4JI4 L;  3DLL A;  1N32 Q;  2IY5 B;  1HNW L;  2D0P A;  1VQM A;  4MTN A;  2YV5 A;  4BA2 I;  3W1G A;  1IL2 A;  1LUZ A;  5JJL A;  4DK3 C;  4B3M L;  2JA6 H;  3M4O H;  3S2H H;  1KHI A;  2NN6 G;  1PH9 A;  2Q2T A;  4DV0 Q;  2UUA Q;  1A62 A;  4LW1 A;  3J80 i;  3HOW H;  4A4I A;  5IYD H;  3KFU A;  2K52 A;  2I5H A;  5FLM H;  1D8L A;  1VQJ A;  1YJ9 A;  2NVT H;  3H3V I;  1HZ9 A;  1T9H A;  4HJ7 A;  4OX9 L;  4GKK Q;  1OXT A;  2DUD A;  4RG1 A;  3ULP A;  4GKJ L;  5IP7 G;  1E3P A;  1UE7 A;  2FXQ A;  3M9B A;  4R4C A;  3FP9 A;  3W5O A;  2N49 A;  4AIM A;  3PIO A;  4DK6 C;  3I4N H;  3J7Z C;  4JI0 Q;  4R4T A;  5IWA L;  3CC4 A;  4LF4 L;  2JA8 G;  3G4S A;  1Y1W G;  3HOY G;  4BBS G;  5GAH C;  2YYZ A;  2PQA B;  3OW2 A;  1MJE A;  1I6H H;  2QA4 A;  4A3J G;  2BH2 A;  2H5X A;  5BR8 L;  4JI1 L;  3CCM A;  5M3M H;  2KHI A;  3K0X A;  3J81 c;  3T1Y L;  2JEA I;  1ASY A;  1IBL Q;  4GN4 B;  2AWN A;  1VQ7 A;  4IPG A;  1X65 A;  3PGZ A;  4R4O A;  4C2M H;  3BZC A;  5JEA G;  5IYB G;  1EIY B;  1JMC A;  5ELO A;  1P8L A;  2UUC L;  1WCM H;  4X62 Q;  2UXD L;  2ZTC A;  4DR1 L;  4LFC L;  3NEL A;  1HZB A;  1PH4 A;  1HNX L;  5C4X G;  1UE6 A;  4NPS A;  2K50 A;  5GQO A;  1PH2 A;  2ASB A;  3EBE A;  2JA7 G;  3RNU A;  4JI2 Q;  2EXD A;  3PIP A;  1U0L A;  1VQF A;  1XMQ L;  1Q1E A;  2I5L X;  1K83 H;  2Q2H A;  5JEA J;  3A0J A;  2Q2I A;  1VQ9 A;  1EFW A;  5C44 G;  2R7Z H;  3GTQ H;  2CKZ B;  1WYD A;  4FDB A;  3PF5 A;  2E8G A;  4JBW A;  1CKN A;  4JI5 L;  3Q8D A;  2KCT A;  3ULJ A;  1XNR L;  1L2F A;  4YWM A;  3FHW A;  4MZ9 A;  4LUO A;  2E5L Q;  2ID0 A;  5LMN W;  3TS0 A;  4JI4 Q;  1S72 A;  1TWG H;  4BBR G;  1VQL A;  4OXP A;  4A3C G;  2R93 H;  5C3E G;  3PUW A;  1WOC A;  3H0G H;  1HNW Q;  3PCO B;  1N9W A;  3RR5 A;  1W3S A;  3J81 j;  1GD7 A;  1J5E L;  3HFZ B;  4A3K H;  5K36 G;  2K5H A;  4YWL A;  5J3B A;  4B3M Q;  2IT1 A;  1PH6 A;  2JE6 I;  1VQG A;  1GKH A;  2WAQ E;  4YCW A;  4DUY L;  4MNO A;  4GLX A;  1C7Y A;  3I4O A;  3MXN B;  3ULL A;  1W2B A;  5LMU L;  1HNZ L;  4OX9 Q;  4JCV E;  3PUY A;  2BA1 A;  2ZTE A;  1VQO A;  1UWV A;  4GKJ Q;  1SRU A;  4X65 L;  1VQK A;  2QEX A;  4JI6 L;  2K4K A;  1X54 A;  3UDI A;  1HZA A;  4PZ7 A;  4JOI C;  5H1S E;  1PH3 A;  5IWA Q;  4LF4 Q;  1OXX K;  4A3G G;  5AJ3 L;  4A93 G;  4JV5 L;  1R9T H;  2I5M X;  2VQE L;  5BR8 Q;  2XTI A;  2R6G A;  2PQA A;  4JI1 Q;  4AYB E;  4DV4 L;  1XMO L;  3T1Y Q;  1PH8 A;  4IFD I;  1BVS A;  1YVC A;  4POG A;  4TQU S;  4C3H H;  3I56 A;  2CCZ A;  3CD6 A;  3W1B A;  3J81 i;  4AYB G;  4OWT B;  4R1J A;  2MFI A;  2UUC Q;  2UXD Q;  1SN8 A;  1KQS A;  4DR1 Q;  1KL9 A;  1HNX Q;  4JBJ A;  3ER0 A;  4PMW A;  2N3S A;  4X64 Q;  1PH1 A;  3GTK H;  1GO3 E;  2KCM A;  4NB3 A;  3BJU A;  3TRE A;  1TWH H;  4IPH A;  4EQ5 A;  1SRO A;  1YJW A;  3F1Z A;  1PFS A;  4RMF A;  3U4Z A;  4PG3 A;  3K7A H;  2E2I H;  1N8R C;  1X3E A;  1I5F A;  3GTJ H;  2QGQ A;  3JAM c;  4A3F H;  3CF5 A;  2UXC L;  4JI5 Q;  2JK8 A;  4OWW B;  1NMG A;  5E7N A;  5FJ8 H;  3HOX G;  1XNR Q;  4LF8 L;  2MO1 A;  3B6Y A;  3A5U A;  3M4P A;  3I2Z A;  4YHH L;  1EQQ A;  4DR3 L;  3CXC A;  2JQO A;  2DGY A;  2Y0S E;  2VUM H;  2HQL A;  3G71 A;  5GAE C;  1N34 L;  4LNQ A;  3H3V H;  3KF6 B;  1CSQ A;  4HJA A;  4JI7 L;  3FKI G;  4KLK A;  4A3I G;  1J5E Q;  5IYC G;  1VQI A;  4GNX B;  4TVA B;  5EAY A;  4DV2 Q;  2HHH L;  4C3J H;  4DV3 L;  4A3D H;  2CQO A;  4ALP A;  4DUY Q;  4LFA L;  4Y52 H;  4BXX H;  3AFP A;  1XTD A;  3STB C;  3H15 A;  1JE5 A;  2VL6 A;  2E2H H;  5LMU Q;  4UY8 C;  3PF4 A;  4LF7 L;  3TEH B;  5C0X G;  4YWK A;  1HNZ Q;  1V43 A;  3MEF A;  3HOV H;  1CKO A;  1YHA A;  3S1Q H;  3CCR A;  2JA6 G;  4X65 Q;  4JI6 Q;  4BY1 H;  4K0K L;  1VQB A;  3HOW G;  1A0I A;  3GO5 A;  5IYD G;  4GN5 A;  2Z0S A;  4UPA A;  5FLM G;  3I7F A;  3GTM H;  1M1K C;  2D62 A;  1KRS A;  2PI2 E;  5AJ3 Q;  4DV1 L;  1M90 C;  4KHP L;  4O2D A;  4JV5 Q;  1VQA A;  5C0X J;  2VQE Q;  4A76 A;  1S3O A;  2R92 H;  2IHF A;  1JJC B;  2OQ0 A;  3G48 A;  2N78 A;  1HR0 L;  2JA5 H;  2IX1 A;  4DV4 Q;  1HJP A;  1XMO Q;  1VQC A;  3I4N G;  1JT8 A;  4LF6 L;  2EIF A;  4LF9 L;  2K75 A;  2LXJ A;  3HKS A;  2CWP A;  1PV4 A;  5IE8 A;  1FJG L;  3I4M H;  3CQZ H;  5M5W H;  1S40 A;  1PYS B;  2KBN A;  1MKH A;  1I50 H;  1YIT A;  5LMN L;  5M3M G;  1Q1B A;  1X6O A;  2NZO A;  1IBK L;  2ZJQ A;  1OTC A;  4YY3 L;  2OTJ A; 
#chains in the Genus database with same CATH topology
 3AEV A;  2BOS A;  3TN2 A;  2F0W A;  1B7Y B;  2F0U A;  3K6O A;  3K57 A;  2L0C A;  4DAP A;  4IPC A;  4R4Q A;  2Z6K C;  1BBU A;  2B2W C;  4LF8 Q;  2CQA A;  4YHH Q;  1K83 B;  1STB A;  2GN5 A;  3I4L A;  1QUQ B;  2R7Z G;  3F2C A;  1B8A A;  4RWS C;  2Q8I B;  1X56 A;  1SJH D;  2XNA C;  2UXB L;  3E6Z X;  3IKJ A;  1SMX A;  1L0W A;  2OCE A;  1WD0 A;  1EUJ A;  2L12 A;  2RKS A;  2K03 A;  4A3K G;  1QVG A;  1H9K A;  3ND8 A;  2A68 D;  1YHB A;  4EQP A;  4A3M H;  2TSS A;  3DXJ C;  4DR4 L;  1I4G A;  3H09 A;  1Q12 A;  2R7D A;  1L0X B;  3VR5 A;  1TS3 A;  1HR0 Q;  1SNC A;  1I94 L;  4RCO A;  2B63 H;  5IP9 H;  2L9H A;  1PFM A;  5CMD A;  3GD7 A;  1VQ8 A;  3NE5 B;  3WOE A;  1G2T A;  3WWV A;  5D14 A;  1R9T B;  3S1N H;  4F88 A;  1S4Z A;  2IJ0 A;  4NXN L;  4HCS A;  3HOU H;  1Z7T A;  3VR2 A;  3PUV A;  3T4A C;  5KND A;  1TXY A;  2E76 C;  1HRJ A;  1VS0 A;  4N9T A;  3R3O A;  3C2P A;  4DUZ L;  2F0P A;  2F0H A;  1Y8N B;  1MJC A;  3M4Q A;  3EA6 A;  1DCZ A;  1TWH B;  3U58 A;  2EYP A;  1V1P B;  2KED A;  3K7A B;  5LL6 X;  4PMB A;  1G6P A;  1RJT A;  3L7Z C;  4CGY B;  5KIX A;  2HCI A;  1G8Z D;  1Z9F A;  4BS9 A;  3MFY A;  4A3I B;  3CME A;  2IL8 A;  2L5T A;  3UDF A;  2PZU A;  3NEM A;  3RLF A;  4B9W A;  3K58 A;  3RLO A;  2YTY A;  3J80 L;  1N33 Q;  2UU9 L;  5DM6 3;  4O0A A;  1E1O A;  3FMC A;  5M3F H;  1LM0 A;  4GZY C;  5FLX c;  1L1O A;  1AE3 A;  2F0F A;  2E2H B;  3EN2 A;  2ZTD A;  4L8J A;  2C9O A;  1CHQ D;  3NBH A;  4BY1 G;  4FF3 A;  4KKT A;  3A7A B;  5E4X A;  1O7Y A;  4P71 A;  5FLX E;  4MN3 A;  2VZA A;  2UUB Q;  1KD1 C;  5CC4 A;  2LKV A;  2VB2 X;  3UDX A;  2K5N A;  5I6W A;  1LTT D;  1H9M A;  2MNA A;  1A8V A;  1EZ8 A;  5FO9 B;  5C6A A;  1IXR A;  3HOY H;  2RF4 A;  3I55 A;  2NZH A;  5M5W B;  4A3J H;  3I4M G;  5C0X I;  4KN7 C;  5M9O A;  3OIQ A;  1MIU A;  2V1C C;  4L5T A;  1JB7 A;  2MHV A;  3E0E A;  4DR6 Q;  3CU7 A;  1LTS D;  2RDG A;  3CCS A;  4X66 L;  4DV7 L;  1MHW C;  4GLA C;  2EYH A;  1HH2 P;  1HFN A;  5IGB A;  1D6E C;  3S16 H;  5IOD A;  4A3B B;  1D7Q A;  3DUZ A;  3QG1 A;  3HGB A;  4ME3 A;  1X3F A;  4UP8 A;  3UE0 A;  2ZXP A;  3S15 B;  1CFM A;  3CCV A;  1JJG A;  2ZXO A;  4FXG C;  2R93 B;  4GNX A;  3PO3 G;  1HR0 W;  3T1H L;  1LTL A;  3N6R A;  2A6E D;  2WB1 G;  4BBR H;  1LTI D;  3KOJ A;  1GUO A;  1JWU D;  2RCN A;  1K8M A;  5KNB A;  1XPU A;  2B8G A;  3GTL H;  1CM9 A;  4X3K A;  4DAM A;  3TME A;  3KUP A;  3I8Z A;  4ZKB B;  4IFD G;  4XTC S;  2I0Q A;  1AE2 A;  3K7U C;  3CPW A;  1B2T A;  2LMC B;  4J8Q A;  3N52 A;  4HAE A;  3PO2 G;  2CVR A;  1HQM C;  3BU2 A;  1QZH A;  3J7A 5;  3SK5 A;  4DV0 L;  4CBV A;  1WTH A;  3VYT A;  1BCP D;  1SNQ A;  4A3G H;  4G7H C;  4LF5 Q;  4RKL A;  1GUW A;  4LFB Q;  1LT3 D;  1F9Q A;  3NWT A;  3IL8 A;  4C3I B;  4P72 A;  3TSS A;  5M5X H;  2GVB A;  2V4D A;  4CDC C;  5I2Y A;  4JI0 L;  2Z6K A;  5G3L F;  4GLV B;  3DEO A;  3M4O H;  1EY9 A;  1FNW A;  1TWF H;  1UEB A;  2Z6B A;  2JXM B;  2F0I A;  2D0O A;  4UP9 A;  2HIV A;  1HHV A;  2VQF Q;  3DMU A;  4HID A;  1QUQ A;  1B1Z A;  2HDL A;  2ICI A;  4JG2 A;  5ELF A;  5IGE A;  2EYO A;  1TWA B;  3EIV A;  4GN3 B;  4I7Z C;  3NSW A;  1MSG A;  1X55 A;  4RH6 A;  4XT1 B;  2O4X A;  1LYL A;  3IFD A;  3GTP H;  4K8J A;  5HUR A;  1A2T A;  1UE1 A;  1XPO A;  2E5L L;  3S14 H;  4G57 A;  1Q8K A;  4JI4 L;  3OOC A;  1QE6 A;  3S1Q B;  2IY5 B;  1STH A;  4MIU A;  3BVZ A;  4DAY A;  1LUZ A;  4B3M L;  1C48 A;  2ZT9 C;  4JW0 A;  1KHI A;  2JA6 H;  3GTM B;  2EE1 A;  2NN6 G;  4IN3 A;  2A69 C;  4LW1 A;  2JA5 B;  2K52 A;  1D8L A;  1F2Y A;  1EYC A;  3H3V I;  4OX9 L;  1B9N A;  2FXQ A;  2XWJ B;  4AIM A;  1SEB D;  2F3W A;  3PIO A;  5IWA L;  1Y1W B;  2JA8 G;  4BBS G;  4K8I A;  1EY0 A;  1K8O A;  3D4D A;  3EJI A;  1I6H H;  2DY8 A;  3FDT A;  4CJ0 B;  4JI1 L;  3E5S A;  5M3M H;  2H1E A;  3SK8 A;  4O1N A;  4CJ2 C;  1I4R A;  1ASY A;  1V1P A;  5JEA G;  4C2M H;  1ZXT A;  2LS0 1;  3QR8 A;  4CJ1 B;  1H9S A;  2BE5 D;  2UXD L;  4DF7 A;  1QNU A;  4LFC L;  1YNJ C;  2EXZ A;  2K50 A;  4QIW B;  1PH2 A;  3EBE A;  2JA7 G;  3RNU A;  4JI2 Q;  1U0L A;  4OEM B;  1VQF A;  4XT3 B;  1LT5 D;  1K83 H;  4CKB A;  1VQ9 A;  2HUG A;  5C44 B;  5D65 A;  2CKZ B;  3PF5 A;  4JI5 L;  4OO1 H;  3Q8D A;  5FLX L;  4MZ9 A;  1E0B A;  4DK1 A;  2E2J B;  2ID0 A;  4A3C G;  3TS0 A;  1S72 A;  4OXP A;  1EY6 A;  3R2I A;  4LAA A;  1EYD A;  3SHL A;  3KF8 A;  3PCO B;  3RR5 A;  1W3S A;  2EJG C;  4A3M B;  1SBB B;  1E2Z A;  4YWL A;  4C56 C;  2IT1 A;  1SFO B;  1PH6 A;  2PW5 A;  2SNM A;  1VMP A;  2E75 C;  1FNU A;  4IFD H;  1PXU A;  1SRU A;  3KBX A;  1KNA A;  3BYY B;  1QIL A;  4X65 L;  1X54 A;  4BWG B;  1KDA A;  4JOI C;  1PH3 A;  1FYC A;  1HPC A;  1HA6 A;  2A5H A;  5AJ3 L;  3HOU B;  4A93 G;  4JV5 L;  1R9T H;  5IGC A;  2VQE L;  1BCP F;  4DV4 L;  1PH8 A;  2F0M A;  1A15 A;  5EPK A;  4TQU S;  1QWY A;  4C3H H;  4QUF A;  2Z8L A;  2IPK D;  3J81 i;  4E6I A;  4R1J A;  2MFI A;  2UUC Q;  5EPL A;  2M9V A;  5DEH A;  5CV7 A;  4PMW A;  4X64 Q;  2G9D A;  3RD4 A;  3FPP A;  4PMC A;  1I4P A;  3HP3 A;  2PW7 A;  4K5X A;  4NB3 A;  1S5F D;  1TWH H;  1SRO A;  2PNR C;  3R8B A;  3K7A H;  2E2I H;  1N8R C;  2NVY B;  4I7A A;  2KVM A;  2QGQ A;  4A3F H;  1EY7 A;  3CF5 A;  2UXC L;  3HOX B;  5FJ8 H;  1PZK D;  1CQF A;  4ILW A;  1XNR Q;  3PIP 3;  3L3O C;  1U4L A;  1K3B C;  3T16 A;  2JYO A;  3B6Y A;  3C1E A;  3BZD B;  1BF4 A;  4XYO A;  2HQL A;  4EVO A;  4OGQ C;  1VF5 C;  4JI7 L;  3FKI G;  4DV2 Q;  3P1H A;  2K04 A;  4DV3 L;  4A3D H;  4HR7 B;  4DUY Q;  4Y52 H;  2QCP X;  1STE A;  3AB9 A;  2VL6 A;  3AU7 A;  4WJW A;  4ZCK A;  5LMU Q;  2E2H H;  4UY8 C;  4HMI A;  5C0X G;  4YWK A;  1HNZ Q;  3A55 A;  1EQV A;  4JI6 Q;  3MXU A;  3HOW B;  1JB3 A;  5CV8 A;  3GO5 A;  5FLM G;  2AQ3 B;  2QIL A;  3MZ5 A;  5KRU A;  2EY2 A;  2PI2 E;  1M1K C;  5I9O A;  1M90 C;  4KHP L;  4O2D A;  2XIW A;  2O5J C;  2IHF A;  1JJC B;  3I4N G;  1FGB D;  4LMQ D;  1LLR D;  1WTX A;  1PTO D;  5FKA C;  1TQO A;  5M5W H;  1S40 A;  1PYS B;  5LMN L;  2KEE A;  3NP8 A;  3S16 B;  1NNX A;  3QJY A;  1KLG D;  5K5P A;  3OTO L;  3BZK A;  3CW2 C;  2K14 A;  4ZUI A;  1RL2 A;  1WD1 A;  1K3R A;  1V1Q A;  4HJ9 A;  1WCM G;  3CAM A;  4A3B H;  1VQ5 A;  1Z47 A;  1PH5 A;  1C9O A;  3M3Y H;  2BH8 A;  1PTO H;  4KHZ A;  1OXV A;  2F0J A;  3JAM i;  4TKO B;  1LAC A;  3V96 A;  3A8J E;  4DR3 Q;  3S15 H;  2QEJ C;  3TS2 A;  1EOT A;  1B50 A;  4BBR B;  4X6A H;  2R7Z B;  4KKU A;  4IQZ A;  4B3T L;  4L5R C;  3TP7 A;  4EQN A;  4U68 A;  3M4Y A;  4CKC A;  3H6M A;  3K8A A;  1U9R A;  1N36 L;  4NMZ A;  1Q81 C;  5COY A;  2WII B;  3H0G G;  1K73 C;  3LX0 A;  5EKI A;  4LF7 Q;  2K6A A;  4DR5 L;  1WI5 A;  4ID6 A;  4R8I A;  4A3K B;  2OTL A;  1SR3 A;  4H13 C;  1L1O B;  4ULL A;  1STN A;  3AMU A;  4IJH A;  1VF7 A;  2WAQ G;  3MC0 B;  4K0K Q;  3ZJY C;  2G5D A;  4DPG A;  1I4H A;  3K81 C;  5DNF A;  3NBH B;  1L1O C;  4ZYS A;  1XWE A;  1SE8 A;  1WVL A;  2VXW A;  4LF6 Q;  4LF9 Q;  4JYA L;  3S1M H;  1FJG Q;  5ELN A;  3K5O A;  4PQX A;  4POF A;  4XQQ A;  2F0L A;  2DJG C;  4C3I H;  1TWF B;  1IBK Q;  3Q24 A;  4YY3 Q;  4JK1 C;  1TKW B;  5JJK A;  2CW0 C;  1YIJ A;  3M7N A;  2E2D C;  1K0S A;  3NQT A;  4KN4 C;  4IPD A;  5EJW A;  4DN4 M;  2OWO A;  3G6J B;  4A3L H;  4B3S L;  2FIN B;  3Q23 A;  3FPU B;  1TWA H;  1D5Z C;  3GTJ B;  1KLU D;  2A8V A;  1TII D;  3GTP B;  3E9I A;  4A75 A;  1GUT A;  3AQQ A;  3BYT B;  4DNI A;  2Y0S G;  2VUM G;  2GVA A;  3S14 B;  3AYH B;  2F4V L;  2WP8 J;  3NPP A;  2PNH A;  3L9A X;  3C3L A;  4U67 3;  5DAU A;  1QVF A;  1X3G A;  4GNX C;  1JOR A;  4C3J G;  1ICF B;  3Q6S A;  2F0E A;  1EYG A;  3U50 C;  2JA6 B;  4JOI A;  1TY2 A;  4JI8 L;  4BXX G;  2R3Z A;  5KYI A;  4ZLT F;  3K5M A;  4DR4 Q;  1SYC A;  1XX8 A;  3KYH C;  4Y7N H;  1I94 Q;  4P73 A;  4BY1 B;  3DM3 A;  2KQ3 A;  5EGT A;  3PQI A;  5IP7 H;  4NXN Q;  3MHB A;  4QUC A;  1NTG A;  1RIP A;  3NTI A;  5M3M B;  2VNU D;  1Y1W H;  1A63 A;  3BVM A;  2IHE A;  4TRD A;  2NN6 I;  4WJ3 M;  4R9W A;  4K6L A;  4ME5 A;  3I4M B;  4IUR A;  2ZXR A;  3HG9 A;  1I50 B;  2C5C A;  4C2M B;  4DUZ Q;  2PPB C;  2XN9 C;  1YEZ A;  4EX5 A;  1UNS A;  1CKM A;  3WDN A;  4QJF A;  4S3S A;  3HOZ G;  1E24 A;  4HTH A;  4QIW E;  2KJX A;  2F4I A;  2QDB A;  2M2L A;  5IOC A;  2KOL A;  2JN4 A;  3P75 A;  4KMU C;  3H94 A;  1G29 1;  1Q86 C;  3I91 A;  1G6Z A;  2Q8R E;  5C44 H;  4A3E G;  1KC8 C;  4DU9 A;  2NB0 A;  2UU9 Q;  3U4V A;  1FNV A;  2BDN A;  3A7L A;  2J4X A;  1NBW A;  3F2B A;  1JOQ A;  2WB1 B;  2E2J H;  1UAP A;  5C3E H;  1SDF A;  3W3A A;  2Z1C A;  4DV5 L;  3U9S A;  2BE5 C;  4X3U A;  5CYU A;  4P74 A;  5K36 H;  3RLN A;  1SFO H;  1H9J A;  2FFK B;  2QDL A;  4JI3 L;  5JJI A;  4DAY B;  4IAL A;  2XGT A;  1N32 L;  1EOV A;  3A74 A;  3PUX A;  5IGF A;  3LGJ A;  2EDG A;  1A2U A;  1SYB A;  3PO2 B;  1FGU A;  1ZKO A;  1Q7Y C;  1FVI A;  1ZEQ X;  2LFN A;  4DNT B;  1SXT A;  2JEB I;  1ILQ A;  2JSO A;  2B2V A;  4V19 0;  1SE2 A;  1TVX A;  1VQP A;  4C3H B;  1K9M C;  1G51 A;  2KCC A;  5ELC A;  3SK4 A;  1GVP A;  1Y1V G;  5BN5 A;  4JBM A;  4KKS A;  3KLW A;  4X66 Q;  2K5V A;  4DV7 Q;  2F3I A;  1CSP A;  1JE4 A;  2L15 A;  2E2I B;  3BDL A;  1PRT F;  1LTA D;  1IBL L;  2X6L A;  1H9S B;  3UDG A;  3PUZ A;  5C5M A;  4A3F B;  1XJV A;  1RHP A;  4IOC A;  4BY7 G;  1HQR D;  2NVY H;  3HS0 C;  3T56 B;  4B9X A;  1TU2 B;  3HOX H;  3T1H Q;  2WFW A;  4CDE C;  3DWQ A;  4IO9 A;  1BOS A;  2KEN A;  3CCQ A;  1YHQ A;  3M7G A;  3A5Z B;  3J7A F;  3HRZ C;  1IL8 A;  4DKA C;  4A3D B;  2LXK A;  3I3C A;  2A74 C;  3NTH A;  4L63 B;  5IYC H;  1KAB A;  1DON A;  4JC0 A;  1NAP A;  4FXD A;  2HIX A;  2YTX A;  3KF8 B;  1QCB D;  1C4Q A;  2NVX B;  3DLL A;  1F9S A;  2D0P A;  1LTG D;  4I65 A;  2MP1 A;  3W1G A;  2F0S A;  5JJL A;  3NQI A;  4DK3 C;  2E74 C;  1I4X A;  1PH9 A;  4DV0 Q;  5CV4 A;  3J80 i;  4IUU A;  2B2Y C;  3HOW H;  5IYD H;  1QNK A;  3KFU A;  4HCE A;  2I5H A;  1H9R A;  1VQJ A;  3KBG A;  1D2B A;  3GV3 A;  2PYK A;  4CDD C;  4CHT B;  4DGZ A;  1HZ9 A;  2OXP A;  1R4Q B;  2DUD A;  1E3P A;  5KGU A;  3IFT A;  1AZQ A;  3FP9 A;  2N49 A;  2RDF A;  3VA5 A;  5EBD A;  3J7Z C;  4JI0 Q;  4R4T A;  4LF4 L;  4BBS B;  1HTL D;  4KV6 A;  1MJE A;  2TMP A;  3DM1 A;  5BR8 L;  2X69 A;  2O2L D;  2KCN A;  3CCM A;  2O5I C;  1KNE A;  3J81 c;  3T1Y L;  1NSN S;  1BQQ T;  4IPG A;  1X65 A;  4R4O A;  1EIY B;  4M8A A;  5IYB G;  4FF1 A;  3VR6 A;  3M3Y B;  1P8L A;  1PTO B;  2ZTC A;  2F0G A;  5C4X G;  1HZB A;  1PH4 A;  4N8F A;  4NPS A;  5GQO A;  2ASB A;  2H4O A;  2JA7 B;  3J81 E;  4K5W A;  2EXD A;  2GA4 B;  5C4Z A;  1S5D D;  1PTO C;  1CQV A;  3A0J A;  1YNN C;  1AP0 A;  4RHR A;  3TP8 A;  1BNZ A;  3GTQ H;  2R7Z H;  1CKN A;  2KCT A;  4YWM A;  2E5L Q;  4JI4 Q;  3OPO A;  1VQL A;  2L1B A;  1IKL A;  5C4H A;  2DN8 A;  2FMM A;  4K5V A;  4A3K H;  5A35 A;  3SVM A;  4B3M Q;  2CW0 D;  5C3W A;  1VQG A;  1GKH A;  3MXP A;  3OMG A;  2AQ2 B;  4GLX A;  1LAB A;  1C7Y A;  3BDO A;  3E0J A;  3I4O A;  1W2B A;  1T5X D;  1GJX A;  4OX9 Q;  3PUY A;  2BA1 A;  3LNN A;  2EOT A;  3S1M B;  2QEX A;  3GV6 A;  2K4K A;  3SE0 A;  1RTO A;  4OHJ A;  4FVM A;  5IWA Q;  2FJ2 A;  2XTI A;  4JI1 Q;  2PQA A;  1NR2 A;  4AYB E;  1M8A A;  1XMO L;  4QF4 A;  3PIO 3;  1YVC A;  3X3N A;  1KDC A;  2RCF A;  3HKZ B;  2CCZ A;  3GTG B;  2UXD Q;  1SN8 A;  1PH1 A;  2N3S A;  3GTK H;  1Q8I A;  1GO3 E;  2EPB A;  3TRE A;  1YJW A;  5D3I B;  3F1Z A;  4PNY A;  1IHZ A;  4PG3 A;  3I70 A;  4UAI A;  3HZX A;  3SR1 A;  3GTJ H;  3JAM c;  4KJO A;  4JI5 Q;  2JK8 A;  1CA5 A;  5E7N A;  2EY6 A;  3MVV A;  5C4J B;  2MO1 A;  3A5U A;  3I2Z A;  3OIP A;  4KD4 A;  3CXC A;  3ZYY X;  1K28 A;  3A56 A;  1IYU A;  1PMR A;  3TDQ A;  4LNQ A;  1N34 L;  1EQT A;  2PCF B;  3FKI B;  4KLK A;  4A3I G;  5EAY A;  4XQN A;  1J9O A;  2HHH L;  5EQ0 A;  4OL7 A;  3FVQ A;  2K01 A;  2CQO A;  4Y7N B;  4ALP A;  4LFA L;  4YIJ A;  3P20 A;  3H15 A;  1JE5 A;  5CR3 A;  1EU3 A;  1YHA A;  2OT2 A;  3MXN A;  4OIJ A;  4DNR B;  4X65 Q;  1JR0 D;  1PZJ D;  4BY1 H;  1VQB A;  3I7F A;  2D62 A;  4DV1 L;  2NVT B;  5AJ3 Q;  4JV5 Q;  1VQA A;  3ND9 A;  1X32 A;  2X6G A;  1S3O A;  1JQY D;  2VQE Q;  3G48 A;  1O7Z A;  2IX1 A;  4DV4 Q;  1FD7 D;  5JJZ A;  2EIF A;  3C46 A;  5IE8 A;  2RA4 A;  3I4M H;  3A8K E;  1MKH A;  1JC7 A;  1I50 H;  1TS2 A;  1X6O A;  1ZYR C;  1A3T A;  1OTC A;  3I72 A;  2OTJ A;  1SLJ A;  4HIK A;  1F2L A;  3HEJ A;  4OWX B;  2XSC A;  3ERS X;  1WCM B;  2HCC A;  4G7Z C;  1ENA A;  1KRT A;  2UXC Q;  3I90 A;  2B29 A;  1QJO A;  2K7V A;  3QWN A;  3D31 A;  1RD9 D;  4GOP B;  1WTP A;  2WV6 D;  2DNE A;  3CRL C;  1IBM L;  4CDF C;  1E1T A;  1GUS A;  4KI0 A;  4DR2 L;  3PO3 H;  5C3E B;  4JI7 Q;  1I4Q A;  4GOP C;  2MPM A;  4L5S A;  4DV3 Q;  2B2Y A;  2N55 A;  2N8N A;  2R93 G;  1DD2 A;  3H0G B;  5IT9 c;  1NUC A;  1EEF D;  4UP7 A;  2PO4 A;  3ERO A;  2WAQ B;  2K33 A;  2J0T D;  1O7I A;  3MEH A;  4YCU A;  1ESF A;  1TY0 A;  5IT9 E;  4K6D A;  3PO2 H;  3G6E A;  4KHP Q;  1ET9 A;  3NHH A;  1VQ6 A;  3VYR A;  2IX0 A;  1BBW A;  4ZKC B;  2ES2 A;  4OIK A;  3J81 L;  5E1F A;  2NYZ D;  1T5E A;  2Z4I A;  1NJI C;  2EYL A;  5LMN Q;  5E3F A;  3OWF A;  1VQH A;  5CBE E;  1BUV T;  1RTN A;  4V0B A;  3OTO Q;  1KDB A;  1VQD A;  1ML0 D;  1ONL A;  2SOB A;  1XMQ Q;  5GAD C;  4AQY L;  1CT1 D;  2NWG A;  3CHB D;  4HIM A;  1U4P A;  4BA1 I;  4LWC A;  3UE1 A;  2EZV A;  1B4O A;  4LUZ A;  3STB D;  4DA2 A;  1V8Q A;  1PYB A;  2OEO A;  3CC7 A;  1JIC A;  3KLS A;  2FHT A;  4M1U B;  4XYQ A;  4B3T Q;  1ENF A;  3EVQ A;  1YZ6 A;  2IWH A;  4UHV A;  4K2K A;  3CCE A;  5HY6 A;  1N36 Q;  2Y0S B;  2VUM B;  3X3M A;  4H0L C;  1H95 A;  2A73 B;  2SDF A;  3LWE A;  1WTQ A;  4DR5 Q;  1AFP A;  1SE4 A;  4QL5 A;  4C3J B;  2EVB A;  1XNQ L;  4HJ5 A;  2B3G A;  2BCO A;  3F2U A;  3H3V C;  2I46 A;  2DY7 A;  3NWS A;  2G9H D;  2NVX H;  5I9P A;  1EWI A;  2F3V A;  2A6H C;  2RVL A;  1NE3 A;  3HOV G;  2NN6 H;  1TWC H;  5J22 A;  2JA9 A;  2K5Q A;  4PZ8 A;  1BBX C;  4DR7 L;  1OO9 B;  5E4W C;  1X3Q A;  2RDH A;  4JYA Q;  3D6C A;  3OYY A;  2D2C C;  5FK9 C;  2AUK A;  1NCV A;  3O13 A;  1YNN D;  5FO7 B;  2R92 G;  3TP5 A;  4IOA A;  2JA5 G;  4PZ6 A;  1GM5 A;  1B70 B;  4Q5V A;  5AFW A;  3KJO A;  1IZ6 A;  2JA8 H;  4BBS H;  2XVS A;  1JOK A;  2AHO B;  1WTR A;  4NXM L;  3BS1 A;  4DXF A;  3CQZ B;  5L37 A;  2ZJR A;  5EBC A;  1MBY A;  1G2S A;  2B2V C;  2A19 A;  1G91 A;  1AN8 A;  3BVG A;  1C8C A;  3CCJ A;  2J7Z A;  2VY3 A;  4H44 C;  2K32 A;  4WFN 3;  3NEN A;  1HUN A;  5JEA H;  1FR3 A;  4B3S Q;  1Q82 C;  1PFB A;  2XWB B;  1UEA B;  1PHJ A;  4K14 A;  4QY7 A;  2JA7 H;  3GTQ B;  5KYL A;  1EEI D;  1EY5 A;  4B3R L;  1VQ4 A;  2MUY A;  4WJ4 A;  3DWA A;  4X64 L;  1OXU A;  1JCK B;  4A3E B;  2F4V Q;  4RGM A;  2KA7 A;  3KLS X;  2ZM6 L;  5HGQ A;  1YI2 A;  4QGU A;  1MD2 D;  4A3C H;  1W6K A;  1FL0 A;  3CMA A;  3SGI A;  4DV6 L;  3F8T A;  4JI8 Q;  4DK0 A;  4LUV A;  1KAA A;  1EWH A;  2HQE A;  3L0O A;  4HMJ A;  3UI2 A;  3CP0 A;  4FF4 A;  4A3M G;  1VQN A;  4DV2 L;  3E9H A;  1I3Q B;  5IIF A;  3J80 c;  2WIN B;  4OO1 I;  3PV0 A;  2PZT A;  3IRB A;  1BR9 A;  3OW7 A;  2UUA L;  1XPR A;  2B63 G;  5IP9 G;  2BA0 A;  1OXS C;  3GTO B;  1DM0 B;  1QG7 A;  1SAP A;  4A93 H;  4GKK L;  3J80 E;  3VA7 A;  3URY A;  3IAY A;  1AEX A;  1XTC D;  1EIG A;  3HOU G;  1SSO A;  1Y1V B;  2N88 A;  3HKZ E;  3GTK B;  5GRO A;  1VCI A;  2M00 A;  4XIG S;  3GTG H;  1K8A C;  4QQB X;  3EFX D;  3S17 H;  4N9P A;  3D4R A;  4CKE A;  3W2D A;  1QB5 D;  4GOP A;  1VDZ A;  4KD3 A;  5ISR A;  4BY7 B;  1IW7 D;  1SYG A;  2IX3 A;  3PMF A;  3U9O A;  4X62 L;  1Y8O B;  1V1O A;  2UXB Q;  1B3A A;  5T1I A;  1MI2 A;  5TSS A;  3CC2 A;  4JBK A;  3S1R B;  5C4J H;  4L5Q A;  5IT9 L;  3D0F A;  1V9P A;  1CKN B;  1QZG A;  1NR4 A;  4DV5 Q;  4KHV A;  3FKI H;  2KHJ A;  3JC6 6;  5M3F G;  2NBF A;  2Q8T A;  3QO2 A;  3KDF A;  1UE5 A;  5JVH 3;  2B8F A;  2CH4 W;  3RZD B;  3PSI A;  4JI3 Q;  4ODG A;  1N32 Q;  1ZYR D;  1HNW L;  1A3U A;  1VQM A;  2YV5 A;  5C0X H;  4BA2 I;  5ELE A;  1HUM A;  5CV6 A;  3RUZ A;  1A62 A;  2EYJ A;  1Q90 A;  5FLM H;  2NVT H;  3G7L A;  1BXT A;  4QMG A;  3I73 A;  4RG1 A;  4GKJ L;  3W5O A;  3I4N H;  2NVQ B;  1SNO A;  4DK6 C;  4UDU C;  3CKI B;  2KUM A;  3HOY G;  1PTO F;  1SNM A;  5GAH C;  2RSO A;  2PQA B;  2YYZ A;  4ZUJ A;  3OW2 A;  4A3J G;  1CHP D;  3K0X A;  3R93 A;  2JEA I;  1IBL Q;  4GN4 B;  3QOJ A;  2AWN A;  1VQ7 A;  3PGZ A;  3BZC A;  2B2T C;  1L0Y B;  5ELO A;  1WCM H;  3TBI B;  5C4X B;  3T51 B;  4DR1 L;  2EYM A;  3NEL A;  1HNX L;  3PO3 B;  4F8M A;  4RFB A;  2MGS A;  2Q2H A;  3K0Y A;  2LY7 A;  5J1Z A;  1SYD A;  1A6X A;  1ROD A;  4C1N I;  4FDB A;  1WYD A;  2XRQ D;  4KY6 A;  5A2Q E;  2EY5 A;  5LL6 S;  5IGD A;  1RDP D;  4BBR G;  3PUW A;  1WOC A;  4RKB A;  3H0G H;  2K5W A;  3J81 j;  3SXH A;  1GD7 A;  1J5E L;  3HFZ B;  1F2M A;  1CZW A;  1F9R A;  2WAQ E;  1DJR D;  1D5M C;  4MNO A;  3C1F A;  3MXN B;  3MXG A;  5BN3 A;  1O7L A;  1CI3 M;  3TZU A;  1S5B D;  4PV1 C;  4JCV E;  5BN4 A;  2ZTE A;  1VQO A;  3BDC A;  1VQK A;  1SMY C;  3SEB A;  3VYS A;  1HZA A;  4PZ7 A;  5H1S E;  3K5L A;  1UUP A;  2L55 A;  1PFN A;  4LF4 Q;  1OXX K;  4A3G G;  2PMZ B;  2EY1 A;  2I5M X;  4HED A;  5BR8 Q;  1STG A;  4XQJ A;  5LHY 1;  3D8G A;  3T1Y Q;  5F2D A;  5G3L D;  3OMC A;  3I56 A;  3CD6 A;  3GQB A;  4AYB G;  2IW3 A;  2NTT A;  4OWT B;  3V05 A;  4JBJ A;  3ER0 A;  1M4V A;  1ET6 A;  2A6H D;  4QB4 A;  2RBM A;  4FXK C;  1ENC A;  3BJU A;  4IPH A;  3DWP A;  1PFS A;  5NUC A;  4DXG A;  3RZO B;  1I5F A;  4RGO S;  3EQL C;  3NUC A;  1NMG A;  5CBA E;  4LF8 L;  4YHH L;  1EQQ A;  5KNC A;  2JQO A;  2DGY A;  2Y0S E;  2EJM A;  2VUM H;  2L11 A;  4NW2 A;  3G71 A;  3FRP B;  3H3V H;  1CSQ A;  4HJA A;  1DYQ A;  1D1I A;  4C3J H;  4FO2 A;  4RCN A;  4HN7 A;  4BXX H;  2ICE C;  1TWC B;  3STB C;  2QW7 A;  3PF4 A;  3TEH B;  2JP1 A;  3MEF A;  1CKO A;  1MGS A;  1Y69 U;  1XXG A;  2F0Q A;  2JA6 G;  3S2H B;  4OEL B;  5I4D A;  1STA A;  1A0I A;  4GN5 A;  2Z0S A;  1EL0 A;  1KRS A;  2HD3 A;  2JA8 B;  4A76 A;  2OQ0 A;  4RAU C;  2N78 A;  1HR0 L;  3K59 A;  1GOZ A;  1XMO Q;  2F1M A;  5EKL A;  3OHX C;  1E2W A;  1JT8 A;  3HKS A;  2LXJ A;  1EFI D;  4KJN A;  4B08 A;  3CQZ H;  3D3R A;  2KBN A;  4DAV A;  1HTP A;  2NUC A;  2ENB A;  1EY4 A;  5M3M G;  1LV9 A;  4HSP A;  3MFG A;  4X3T A;  2C35 B;  3DHQ A;  4YCV A;  3A54 A;  4HJ8 A;  2KHS A;  4LJZ C;  5CV5 A;  1TT2 A;  1DGS A;  4NKL A;  3HOZ H;  3D4W A;  3RN5 A;  1ESR A;  4GS3 A;  3RMH A;  5CV9 A;  2ALY B;  2NTS A;  1JOO A;  1ASZ A;  2F0V A;  1N34 Q;  4A3E H;  1D1K A;  2EYF A;  4OO1 G;  5ELB A;  1E22 A;  5IY0 A;  3KF6 A;  2HHH Q;  1WJJ A;  2WKC A;  4HIO A;  5I6Y A;  1TWG B;  4LFA Q;  1SE3 A;  4P75 A;  1N33 L;  4IUN A;  1U5K A;  2YU9 H;  1CTM A;  1WTW A;  1E2V A;  3VDY A;  2XRS D;  1JJ2 A;  1QVC A;  1Q46 A;  1EU4 A;  2A1A A;  3GDE A;  3TRZ A;  4DV1 Q;  2F52 A;  1I3Q H;  1AH9 A;  4ZRZ A;  1PH7 A;  3L2P A;  3BG3 A;  4IUT A;  4O42 A;  4A93 B;  5JAV A;  1AZP A;  4RHS A;  2PZW A;  4KY7 A;  1KXL A;  2EQS A;  5M5Y H;  3GP7 A;  3CCU A;  3GTO H;  2F0O A;  1B53 A;  2B2T A;  2UUB L;  1S5E D;  3KLR A;  2VW9 A;  3CRK C;  1YNX A;  5C5L A;  1SYF A;  4ABN A;  5I2X A;  1SNP A;  1LO5 D;  1HZC A;  3S17 B;  3K80 C;  2MJ8 A;  3LWU A;  4LFC Q;  1Y1V H;  1TS4 A;  5A2Q L;  4C3H G;  2WKD A;  2KEC A;  4P2C B;  3ERQ A;  1EZ6 A;  2F03 A;  2F0T A;  1RKN A;  1TR5 A;  2B2W A;  4IUQ A;  4DR6 L;  5FOB B;  2CHB D;  4BY7 H;  2BDO A;  1IBM Q;  5D3D A;  4DR2 Q;  2RHQ B;  4A3F G;  5FJ8 G;  4DFA A;  3S1R H;  2CH4 A;  3JAM E;  1U4M A;  2AWO A;  4G4K A;  4X3S A;  2ATW A;  3SDZ A;  3S2D H;  1PRT B;  2P5Z X;  2HT1 A;  3QB3 A;  1KAW A;  1ICW A;  3RZD H;  1E7Z A;  1GXD C;  4A3D G;  4AH6 A;  1IW7 C;  2SNS A;  1PRT C;  5DLQ E;  2JJQ A;  3HOV B;  4TSS A;  3F2D A;  4NDX A;  3KK7 A;  3I4N B;  2F0D A;  3TZD A;  3WOF A;  1W6J A;  3H91 A;  1I6V C;  2R92 B;  2MQH A;  2CFM A;  3ICE A;  5CGK A;  1K0R A;  2PQE A;  2NVQ H;  1IYV A;  3TP6 A;  1VMC A;  3QIA A;  4J15 A;  3E3X A;  4LF5 L;  3RN2 A;  4LFB L;  4MHE A;  4AQY Q;  2AKW B;  2NZ1 D;  4Z9C B;  1X3P A;  4KK7 A;  3Q22 A;  5IYB H;  1DZ1 A;  5GAG C;  4J6H A;  3T13 A;  5C4X H;  4A3B G;  3S24 A;  2F0N A;  4H02 A;  1X9N A;  1Y14 B;  2B2U C;  1PVO A;  2VQF L;  4Q0F A;  4JPB W;  4L6T B;  3MA2 B;  1EQR A;  4F7X A;  1SMY D;  1WFQ A;  4G7O C;  2WB1 E;  1CUK A;  2HDM A;  5JOB A;  1NMF A;  4IUP A;  1GHJ A;  5EKK A;  4FNF A;  2VS1 A;  1HXY D;  1STY A;  3SK6 A;  1XNQ Q;  2AQ1 B;  4IUV A;  4F87 A;  1YBY A;  5ELD A;  1PA6 A;  2VB3 X;  2K5D A;  1F2Z A;  4IJL A;  3KDF B;  2I07 B;  3Q0A A;  3AFQ A;  5FO8 B;  1S5C D;  2RHS B;  4N8X 1;  4DR7 Q;  1GUG A;  4RA8 A;  3KJP A;  1SYE A;  1YJN A;  2R7F A;  3M85 A;  1KIX A;  1GHK A;  1J6Q A;  3CCL A;  2PI2 A;  3OWE B;  4APV A;  2B63 B;  4IFD J;  3NK9 A;  1EIF A;  4NXM Q;  1LTB D;  2L4N A;  2PMZ E;  2YTV A;  1NY4 A;  2OQK A;  3S1N B;  1P16 A;  3VR3 A;  2AMC B;  4C3I G;  3V2T A;  1VQE A;  3VYU A;  1BKB A;  2MO0 A;  5JVG 3;  1DOL A;  1IYJ B;  3CPF A;  1CK1 A;  4K2L A;  2A68 C;  4R8N A;  4OON A;  3HKZ G;  2ZJP A;  5EPJ A;  4B3R Q;  4H7B A;  4A3L G;  1C0A A;  2Q2U A;  2LSS A;  1LTR D;  1ILP A;  3RZO H;  5C3X A;  1O78 A;  3TQY A;  5DM7 3;  2ZM6 Q;  4ZK9 B;  4JI2 L;  4EQO A;  4MTK A;  3J7Y W;  1K8G A;  2SEB D;  2B39 A;  1II3 A;  4R4I A;  4DV6 Q;  3QOL A;  1CA6 A;  5HGT A;  4A3I H;  5COR A;  5M3F B;  1JWS D;  2CWA A;  3T53 B;  1DOM A;  4XXE A;  4MTN A;  4ZQ3 A;  1IL2 A;  3NBI A;  3S2H H;  2R61 A;  2Q2T A;  2QF7 A;  2UUA Q;  4A4I A;  4HSV A;  1IKM A;  1BDO A;  1YJ9 A;  1RCV D;  5J39 A;  4HJ7 A;  1T9H A;  4GKK Q;  4KY5 A;  1OXT A;  3ULP A;  4FYD A;  5IP7 G;  1UE7 A;  3M9B A;  4R4C A;  3MAQ A;  1EIH A;  4LK1 C;  3HOY B;  3CC4 A;  3G4S A;  1Y1W G;  4A3J B;  3ONA B;  2QA4 A;  2BH2 A;  2H5X A;  3JAM L;  2KHI A;  3HOZ B;  1LT6 D;  5IGG A;  1JMC A;  2F0K A;  2UUC L;  4X62 Q;  1UE6 A;  2OF1 A;  1MSH A;  1PDQ A;  1DOK A;  1HA5 A;  4FF2 A;  1PZI D;  3PIP A;  1XMQ L;  1Q1E A;  2I5L X;  5JEA J;  1Z6H A;  2Q2I A;  1RF2 D;  1EY8 A;  5C44 G;  1EFW A;  1GUN A;  2E8G A;  4JBW A;  4RGT A;  1XYI A;  4IZ8 A;  3ULJ A;  1XNR L;  1L2F A;  3FHW A;  4LUO A;  5T1G A;  2YU9 B;  5LMN W;  1TWG H;  3DEP A;  1B44 D;  2R93 H;  5C3E G;  1HNW Q;  1N9W A;  3GTL B;  3ITP A;  5K36 G;  2K5H A;  5J3B A;  2JE6 I;  4EGV A;  1F9P A;  2DJF C;  4FP5 D;  4YCW A;  4DUY L;  3NTK A;  5JPM C;  3ULL A;  5LMU L;  1PLF A;  5M5Y B;  1HCZ A;  1HNZ L;  1UWV A;  4GKJ Q;  1HFG A;  4JI6 L;  2EJF C;  3UDI A;  1DXM A;  1J8I A;  1A3V A;  2K28 A;  4WRD A;  4A3G B;  1O80 A;  2A6E C;  2R6G A;  2RSN A;  3VR4 A;  1QOH A;  2D9U A;  5M5X B;  3D6W A;  4IFD I;  1BVS A;  2B2U A;  4POG A;  1WTV A;  1TS5 A;  5JPN C;  3M4O B;  3W1B A;  4AYB B;  2K1B A;  1KQS A;  4DR1 Q;  1KL9 A;  1HNX Q;  4JVZ A;  1PRT D;  1B9M A;  2KCM A;  1BCP B;  1Y8P B;  4EQ5 A;  1Q3L A;  4RMF A;  3U4Z A;  1KTK A;  3S9W A;  2Z9H A;  1X3E A;  4WOR A;  4KTA A;  4OWW B;  1BCP C;  3HOX G;  1BO0 A;  3S2D B;  2A69 D;  2D5D A;  1SJE D;  4NP5 A;  3M4P A;  2WAC A;  4DR3 L;  1AW7 A;  3OSO A;  4J1M A;  1R4P B;  3K5N A;  4RGN A;  5GAE C;  3KF6 B;  1J5E Q;  5IYC G;  1VQI A;  4GNX B;  4TVA B;  3A8I E;  5KEE A;  3MWY W;  1EWC A;  1U4R A;  3AFP A;  1XTD A;  4LF7 L;  1V43 A;  3HOV H;  3S1Q H;  1JWM D;  3CCR A;  1B3Q A;  4K0K L;  1PYW D;  3HOW G;  3NXW A;  5IYD G;  4UPA A;  3J7A V;  2DNC A;  3GTM H;  5C0X J;  2R92 H;  1YNJ D;  2JA5 H;  4ZAI A;  2RQX A;  1LT4 D;  3FEW X;  1HJP A;  1VQC A;  3MTS A;  1CZG A;  1WTO A;  4LF6 L;  4LF9 L;  2K75 A;  2CWP A;  1PV4 A;  1FJG L;  1I6H B;  1F77 A;  1SND A;  1EYA A;  4XDX A;  2FMC A;  2K05 A;  1YIT A;  2AUJ D;  3P7J A;  4C1N K;  4QCL A;  1D5X C;  1Q1B A;  2QKI C;  2NZO A;  3R2T A;  1IBK L;  2Z4H A;  2ZJQ A;  4YY3 L; 
#chains in the Genus database with same CATH homology
 1SLJ A;  3OTO L;  3AEV A;  2C35 B;  3BZK A;  4YCV A;  4HIK A;  3CW2 C;  2K14 A;  4OWX B;  4HJ8 A;  3ERS X;  1RL2 A;  1K3R A;  1V1Q A;  4HJ9 A;  1WCM G;  1DGS A;  3HOZ H;  3CAM A;  1B7Y B;  1KRT A;  4A3B H;  1VQ5 A;  2UXC Q;  3RN5 A;  1Z47 A;  2B29 A;  1PH5 A;  1C9O A;  4GS3 A;  4IPC A;  3M3Y H;  3D31 A;  2BH8 A;  4KHZ A;  2ALY B;  1BBU A;  1OXV A;  2Z6K C;  4R4Q A;  3JAM i;  4YHH Q;  4GOP B;  4LF8 Q;  4DR3 Q;  1ASZ A;  3S15 H;  3TS2 A;  1IBM L;  2GN5 A;  1E1T A;  1N34 Q;  1QUQ B;  4A3E H;  4X6A H;  4KI0 A;  4DR2 L;  2R7Z G;  3PO3 H;  4B3T L;  4JI7 Q;  3F2C A;  4L5R C;  1B8A A;  4OO1 G;  4GOP C;  1E22 A;  5IY0 A;  3KF6 A;  2HHH Q;  1WJJ A;  1X56 A;  3K8A A;  4HIO A;  2UXB L;  4L5S A;  4DV3 Q;  1N36 L;  2N8N A;  1Q81 C;  4LFA Q;  2R93 G;  1SMX A;  1L0W A;  5IT9 c;  3H0G G;  4P75 A;  1K73 C;  1N33 L;  2OCE A;  4UP7 A;  1U5K A;  1EUJ A;  2YU9 H;  4LF7 Q;  4DR5 L;  1WI5 A;  3VDY A;  2OTL A;  4A3K G;  1SR3 A;  1QVG A;  1L1O B;  1JJ2 A;  1QVC A;  1Q46 A;  4K0K Q;  4IJH A;  2WAQ G;  1YHB A;  2A1A A;  4A3M H;  3ZJY C;  1O7I A;  3GDE A;  4YCU A;  4DPG A;  4DR4 L;  1Q12 A;  3K81 C;  4DV1 Q;  3TRZ A;  2F52 A;  1I3Q H;  1AH9 A;  3PO2 H;  2R7D A;  3NBH B;  3G6E A;  4KHP Q;  1PH7 A;  1L1O C;  3L2P A;  1HR0 Q;  1I94 L;  1VQ6 A;  1KXL A;  2B63 H;  2IX0 A;  1SE8 A;  2EQS A;  5IP9 H;  5M5Y H;  3CCU A;  1BBW A;  4LF6 Q;  4LF9 Q;  3GD7 A;  3GTO H;  2ES2 A;  4JYA L;  1VQ8 A;  2UUB L;  3S1M H;  1FJG Q;  5ELN A;  3WWV A;  4POF A;  2VW9 A;  3S1N H;  1NJI C;  1YNX A;  5LMN Q;  4NXN L;  4C3I H;  1HZC A;  3K80 C;  1IBK Q;  1VQH A;  3HOU H;  4LFC Q;  4YY3 Q;  1Y1V H;  3OTO Q;  3PUV A;  1VQD A;  1TXY A;  5JJK A;  1VS0 A;  1XMQ Q;  5GAD C;  1YIJ A;  4AQY L;  3M7N A;  4DUZ L;  4HIM A;  1MJC A;  4DR6 L;  4IPD A;  4LWC A;  4BA1 I;  2OWO A;  3M4Q A;  3UE1 A;  4A3L H;  3U58 A;  4LUZ A;  4B3S L;  4BY7 H;  3STB D;  1PYB A;  1IBM Q;  1G6P A;  1TWA H;  3CC7 A;  3L7Z C;  4DR2 Q;  2RHQ B;  4A3F G;  4B3T Q;  2A8V A;  1YZ6 A;  5FJ8 G;  3E9I A;  1Z9F A;  3S1R H;  4A75 A;  3CME A;  3UDF A;  3AQQ A;  3CCE A;  5HY6 A;  2AWO A;  1N36 Q;  4DNI A;  2Y0S G;  3NEM A;  2VUM G;  2GVA A;  2ATW A;  3RLF A;  3AYH B;  2F4V L;  3S2D H;  2WP8 J;  3RLO A;  2YTY A;  1N33 Q;  2UU9 L;  1H95 A;  2PNH A;  4O0A A;  1E1O A;  4DR5 Q;  1QVF A;  5M3F H;  2HT1 A;  1LM0 A;  1X3G A;  4QL5 A;  4GNX C;  1KAW A;  1XNQ L;  4HJ5 A;  2B3G A;  3RZD H;  1E7Z A;  1EYG A;  3U50 C;  2NVX H;  4A3D G;  4AH6 A;  4JOI A;  5DLQ E;  5FLX c;  1L1O A;  1EWI A;  2JJQ A;  4JI8 L;  4BXX G;  1AE3 A;  4DR4 Q;  3EN2 A;  1NE3 A;  3KYH C;  2ZTD A;  4Y7N H;  3HOV G;  1TWC H;  1I94 Q;  2JA9 A;  4P73 A;  4PZ8 A;  3DM3 A;  4BY1 G;  3F2D A;  4DR7 L;  4P71 A;  4JYA Q;  3OYY A;  2VZA A;  2UUB Q;  1KD1 C;  4IOA A;  5IP7 H;  2R92 G;  2MQH A;  2CFM A;  3ICE A;  2JA5 G;  3UDX A;  4PZ6 A;  4NXN Q;  1GM5 A;  1K0R A;  2K5N A;  1B70 B;  2NVQ H;  2MNA A;  1A8V A;  1NTG A;  3KJO A;  1IZ6 A;  1RIP A;  1IXR A;  2JA8 H;  3HOY H;  2RF4 A;  4BBS H;  1Y1W H;  2VNU D;  1A63 A;  2AHO B;  2IHE A;  2NN6 I;  4J15 A;  4NXM L;  4WJ3 M;  3I55 A;  4LF5 L;  2NZH A;  4A3J H;  2ZJR A;  5C0X I;  3RN2 A;  3I4M G;  4LFB L;  1MIU A;  2V1C C;  4L5T A;  4AQY Q;  2AKW B;  2A19 A;  1JB7 A;  4DUZ Q;  3E0E A;  4DR6 Q;  3CCJ A;  2VY3 A;  3CCS A;  1YEZ A;  3NEN A;  4EX5 A;  1CKM A;  5IYB H;  4B3S Q;  1Q82 C;  4X66 L;  4DV7 L;  4GLA C;  5GAG C;  4QJF A;  1HH2 P;  1PHJ A;  5C4X H;  4QY7 A;  3HOZ G;  1E24 A;  3S16 H;  1D7Q A;  4QIW E;  4A3B G;  2JA7 H;  3S24 A;  1X9N A;  4H02 A;  1Y14 B;  4ME3 A;  4B3R L;  1PVO A;  1X3F A;  2VQF L;  4UP8 A;  1VQ4 A;  3UE0 A;  4WJ4 A;  1G29 1;  1EQR A;  1Q86 C;  4X64 L;  1WFQ A;  1OXU A;  3CCV A;  2WB1 E;  1CUK A;  5C44 H;  2F4V Q;  1JJG A;  4A3E G;  1KC8 C;  1NMF A;  4GNX A;  2UU9 Q;  3PO3 G;  2ZM6 L;  1HR0 W;  3U4V A;  5HGQ A;  1LTL A;  2VS1 A;  3T1H L;  4QGU A;  1YI2 A;  3F2B A;  1NBW A;  2E2J H;  4A3C H;  2WB1 G;  4BBR H;  1XNQ Q;  1FL0 A;  3KOJ A;  5C3E H;  3CMA A;  3SGI A;  4DV6 L;  1YBY A;  3F8T A;  4JI8 Q;  2RCN A;  4DV5 L;  1PA6 A;  4IJL A;  1XPU A;  4LUV A;  3GTL H;  3KDF B;  4P74 A;  4DAM A;  3RLN A;  3L0O A;  1SFO H;  3AFQ A;  4IFD G;  3CP0 A;  4XTC S;  2RHS B;  4JI3 L;  4DR7 Q;  5JJI A;  3KJP A;  2I0Q A;  4DAY B;  1N32 L;  2XGT A;  4A3M G;  1EOV A;  1AE2 A;  3A74 A;  2R7F A;  3K7U C;  3PUX A;  3CPW A;  3LGJ A;  4DV2 L;  3E9H A;  3M85 A;  1YJN A;  1VQN A;  1FGU A;  3J80 c;  1KIX A;  3PO2 G;  1QZH A;  1J6Q A;  3BU2 A;  4OO1 I;  3PV0 A;  3IRB A;  1Q7Y C;  1FVI A;  2PI2 A;  3CCL A;  3J7A 5;  4APV A;  4DV0 L;  2UUA L;  1XPR A;  2B63 G;  4IFD J;  2JEB I;  5IP9 G;  2BA0 A;  1OXS C;  1EIF A;  4NXM Q;  4A3G H;  4A93 H;  2YTV A;  2PMZ E;  4LF5 Q;  1NY4 A;  4GKK L;  2OQK A;  1VQP A;  4LFB Q;  1P16 A;  2AMC B;  1K9M C;  4P72 A;  5M5X H;  1G51 A;  2GVB A;  3HOU G;  4JI0 L;  1VQE A;  3HKZ E;  2Z6K A;  1GVP A;  1Y1V G;  1BKB A;  2MO0 A;  4GLV B;  5GRO A;  4JBM A;  1VCI A;  3KLW A;  4XIG S;  2K5V A;  4X66 Q;  4DV7 Q;  3GTG H;  1IYJ B;  2F3I A;  1K8A C;  4QQB X;  3CPF A;  1CSP A;  3S17 H;  1TWF H;  1UEB A;  2D0O A;  2L15 A;  4OON A;  3HKZ G;  2ZJP A;  4UP9 A;  4GOP A;  1IBL L;  3UDG A;  2HIV A;  4B3R Q;  3PUZ A;  1XJV A;  2VQF Q;  4A3L G;  4HID A;  2Q2U A;  1C0A A;  4IOC A;  4BY7 G;  2LSS A;  1QUQ A;  4JG2 A;  4X62 L;  3EIV A;  2NVY H;  3RZO H;  2UXB Q;  3TQY A;  4GN3 B;  3HOX H;  2ZM6 Q;  3CC2 A;  3T1H Q;  4JI2 L;  4JBK A;  2WFW A;  5C4J H;  4L5Q A;  4IO9 A;  2KEN A;  1X55 A;  3CCQ A;  1YHQ A;  3D0F A;  1K8G A;  3A5Z B;  1V9P A;  4R4I A;  1CKN B;  4DV6 Q;  1QZG A;  1LYL A;  3GTP H;  4DKA C;  4DV5 Q;  3FKI H;  4A3I H;  2LXK A;  2KHJ A;  5IYC H;  3JC6 6;  1UE1 A;  4JC0 A;  5M3F G;  1XPO A;  2E5L L;  3S14 H;  1UE5 A;  1Q8K A;  2CWA A;  2HIX A;  2YTX A;  3KDF A;  3KF8 B;  3PSI A;  4JI3 Q;  4JI4 L;  3DLL A;  1N32 Q;  2IY5 B;  1HNW L;  2D0P A;  1VQM A;  4MTN A;  2YV5 A;  4BA2 I;  3W1G A;  1IL2 A;  1LUZ A;  5JJL A;  4DK3 C;  4B3M L;  2JA6 H;  3M4O H;  3S2H H;  1KHI A;  2NN6 G;  1PH9 A;  2Q2T A;  4DV0 Q;  2UUA Q;  1A62 A;  4LW1 A;  3J80 i;  3HOW H;  4A4I A;  5IYD H;  3KFU A;  2K52 A;  2I5H A;  5FLM H;  1D8L A;  1VQJ A;  1YJ9 A;  2NVT H;  3H3V I;  1HZ9 A;  1T9H A;  4HJ7 A;  4OX9 L;  4GKK Q;  1OXT A;  2DUD A;  4RG1 A;  3ULP A;  4GKJ L;  5IP7 G;  1E3P A;  1UE7 A;  2FXQ A;  3M9B A;  4R4C A;  3FP9 A;  3W5O A;  2N49 A;  4AIM A;  3PIO A;  4DK6 C;  3I4N H;  3J7Z C;  4JI0 Q;  4R4T A;  5IWA L;  3CC4 A;  4LF4 L;  2JA8 G;  3G4S A;  1Y1W G;  3HOY G;  4BBS G;  5GAH C;  2YYZ A;  2PQA B;  3OW2 A;  1MJE A;  1I6H H;  2QA4 A;  4A3J G;  2BH2 A;  2H5X A;  5BR8 L;  4JI1 L;  3CCM A;  5M3M H;  2KHI A;  3K0X A;  3J81 c;  3T1Y L;  2JEA I;  1ASY A;  1IBL Q;  4GN4 B;  2AWN A;  1VQ7 A;  4IPG A;  1X65 A;  3PGZ A;  4R4O A;  4C2M H;  3BZC A;  5JEA G;  5IYB G;  1EIY B;  1JMC A;  5ELO A;  1P8L A;  2UUC L;  1WCM H;  4X62 Q;  2UXD L;  2ZTC A;  4DR1 L;  4LFC L;  3NEL A;  1HZB A;  1PH4 A;  1HNX L;  5C4X G;  1UE6 A;  4NPS A;  2K50 A;  5GQO A;  1PH2 A;  2ASB A;  3EBE A;  2JA7 G;  3RNU A;  4JI2 Q;  2EXD A;  3PIP A;  1U0L A;  1VQF A;  1XMQ L;  1Q1E A;  2I5L X;  1K83 H;  2Q2H A;  5JEA J;  3A0J A;  2Q2I A;  1VQ9 A;  1EFW A;  5C44 G;  2R7Z H;  3GTQ H;  2CKZ B;  1WYD A;  4FDB A;  3PF5 A;  2E8G A;  4JBW A;  1CKN A;  4JI5 L;  3Q8D A;  2KCT A;  3ULJ A;  1XNR L;  1L2F A;  4YWM A;  3FHW A;  4MZ9 A;  4LUO A;  2E5L Q;  2ID0 A;  5LMN W;  3TS0 A;  4JI4 Q;  1S72 A;  1TWG H;  4BBR G;  1VQL A;  4OXP A;  4A3C G;  2R93 H;  5C3E G;  3PUW A;  1WOC A;  3H0G H;  1HNW Q;  3PCO B;  1N9W A;  3RR5 A;  1W3S A;  3J81 j;  1GD7 A;  1J5E L;  3HFZ B;  4A3K H;  5K36 G;  2K5H A;  4YWL A;  5J3B A;  4B3M Q;  2IT1 A;  1PH6 A;  2JE6 I;  1VQG A;  1GKH A;  2WAQ E;  4YCW A;  4DUY L;  4MNO A;  4GLX A;  1C7Y A;  3I4O A;  3MXN B;  3ULL A;  1W2B A;  5LMU L;  1HNZ L;  4OX9 Q;  4JCV E;  3PUY A;  2BA1 A;  2ZTE A;  1VQO A;  1UWV A;  4GKJ Q;  1SRU A;  4X65 L;  1VQK A;  2QEX A;  4JI6 L;  2K4K A;  1X54 A;  3UDI A;  1HZA A;  4PZ7 A;  4JOI C;  5H1S E;  1PH3 A;  5IWA Q;  4LF4 Q;  1OXX K;  4A3G G;  5AJ3 L;  4A93 G;  4JV5 L;  1R9T H;  2I5M X;  2VQE L;  5BR8 Q;  2XTI A;  2R6G A;  2PQA A;  4JI1 Q;  4AYB E;  4DV4 L;  1XMO L;  3T1Y Q;  1PH8 A;  4IFD I;  1BVS A;  1YVC A;  4POG A;  4TQU S;  4C3H H;  3I56 A;  2CCZ A;  3CD6 A;  3W1B A;  3J81 i;  4AYB G;  4OWT B;  4R1J A;  2MFI A;  2UUC Q;  2UXD Q;  1SN8 A;  1KQS A;  4DR1 Q;  1KL9 A;  1HNX Q;  4JBJ A;  3ER0 A;  4PMW A;  2N3S A;  4X64 Q;  1PH1 A;  3GTK H;  1GO3 E;  2KCM A;  4NB3 A;  3BJU A;  3TRE A;  1TWH H;  4IPH A;  4EQ5 A;  1SRO A;  1YJW A;  3F1Z A;  1PFS A;  4RMF A;  3U4Z A;  4PG3 A;  3K7A H;  2E2I H;  1N8R C;  1X3E A;  1I5F A;  3GTJ H;  2QGQ A;  3JAM c;  4A3F H;  3CF5 A;  2UXC L;  4JI5 Q;  2JK8 A;  4OWW B;  1NMG A;  5E7N A;  5FJ8 H;  3HOX G;  1XNR Q;  4LF8 L;  2MO1 A;  3B6Y A;  3A5U A;  3M4P A;  3I2Z A;  4YHH L;  1EQQ A;  4DR3 L;  3CXC A;  2JQO A;  2DGY A;  2Y0S E;  2VUM H;  2HQL A;  3G71 A;  5GAE C;  1N34 L;  4LNQ A;  3H3V H;  3KF6 B;  1CSQ A;  4HJA A;  4JI7 L;  3FKI G;  4KLK A;  4A3I G;  1J5E Q;  5IYC G;  1VQI A;  4GNX B;  4TVA B;  5EAY A;  4DV2 Q;  2HHH L;  4C3J H;  4DV3 L;  4A3D H;  2CQO A;  4ALP A;  4DUY Q;  4LFA L;  4Y52 H;  4BXX H;  3AFP A;  1XTD A;  3STB C;  3H15 A;  1JE5 A;  2VL6 A;  2E2H H;  5LMU Q;  4UY8 C;  3PF4 A;  4LF7 L;  3TEH B;  5C0X G;  4YWK A;  1HNZ Q;  1V43 A;  3MEF A;  3HOV H;  1CKO A;  1YHA A;  3S1Q H;  3CCR A;  2JA6 G;  4X65 Q;  4JI6 Q;  4BY1 H;  4K0K L;  1VQB A;  3HOW G;  1A0I A;  3GO5 A;  5IYD G;  4GN5 A;  2Z0S A;  4UPA A;  5FLM G;  3I7F A;  3GTM H;  1M1K C;  2D62 A;  1KRS A;  2PI2 E;  5AJ3 Q;  4DV1 L;  1M90 C;  4KHP L;  4O2D A;  4JV5 Q;  1VQA A;  5C0X J;  2VQE Q;  4A76 A;  1S3O A;  2R92 H;  2IHF A;  1JJC B;  2OQ0 A;  3G48 A;  2N78 A;  1HR0 L;  2JA5 H;  2IX1 A;  4DV4 Q;  1HJP A;  1XMO Q;  1VQC A;  3I4N G;  1JT8 A;  4LF6 L;  2EIF A;  4LF9 L;  2K75 A;  2LXJ A;  3HKS A;  2CWP A;  1PV4 A;  5IE8 A;  1FJG L;  3I4M H;  3CQZ H;  5M5W H;  1S40 A;  1PYS B;  2KBN A;  1MKH A;  1I50 H;  1YIT A;  5LMN L;  5M3M G;  1Q1B A;  1X6O A;  2NZO A;  1IBK L;  2ZJQ A;  1OTC A;  4YY3 L;  2OTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...