3Q6SA

The crystal structure of the heterochromatin protein 1 beta chromoshadow domain complexed with a peptide from shugoshin 1
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
66
structure length
66
Chain Sequence
b'KPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chromobox protein homolog 1
publication title Mitotic centromeric targeting of HP1 and its binding to Sgo1 are dispensable for sister-chromatid cohesion in human cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 12
structure length 66
sequence length 66
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01393 Chromo_shadow Chromo shadow domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3q6sA00
1CA6A 2HCCA 1G2TA 2KUMA 1WD1A 1HA6A 2EOTA 1CA5A 2HCIA 1U4RA 1ML0D 1F9PA 2K05A 3FDTA 1WTVA 1PFMA 4HEDA 4MN3A 1F2LA 1WVLA 1HFNA 2B2WC 2D9UA 2M2LA 4UAIA 4DN4M 1WTXA 2J7ZA 2K1BA 3I90A 1C8CA 1F9RA 2Q8TA 1RHPA 2FHTA 2JYOA 3QO2A 1WTWA 1RJTA 1MI2A 2B2TA 1IKMA 1NCVA 3IL8A 2VXWA 3GV3A 3TZDA 2L12A 1MSGA 1M8AA 4RA8A 2L9HA 3N52A 4HAEA 1VMCA 1ILPA 4CJ0B 2HDMA 2N88A 2B2VA 5AFWA 2IL8A 1PFBA 1WTPA 1DZ1A 1IKLA 1HUMA 1PLFA 2Q8RE 1G91A 2B2YA 1BF4A 2HUGA 1O80A 2MPMA 3ONAB 2MJ8A 1WD0A 1NAPA 1G6ZA 1ICWA 4HSVA 4IUTA 1SAPA 1IL8A 2K03A 4OIKA 2K04A 4XDXA 5D65A 1XYIA 2NZ1D 3P7JA 4RWSC 4XT1B 4CJ1B 1DONA 1E0BA 2B2UA 1U4MA 3D6WA 1F9SA 2KEEA 2MGSA 1Q3LA 1NR4A 1XX8A 3DM1A 4IUPA 3I8ZA 4ZKBB 2MP1A 1SDFA 2RSNA 2X69A 5EPJA 2BDNA 5EPKA 4ZAIA 2R3ZA 1F9QA 2X6GA 5CBEE 5CMDA 2X6LA 5JJZA 1RTOA 1X32A 5DNFA 1O7YA 1NR2A 2DY7A 1ESRA 1LV9A 3KBXA 1AZPA 1JE4A 1J9OA 5EPLA 3KUPA 4ZKCB 4XT3B 1JICA 3R93A 2B2WA 5T1IA 1G2SA 5E4WC 3MTSA 2L4NA 2K01A 1AP0A 5T1GA 1A15A 4X3UA 1QG7A 1HHVA 1X3PA 4IUUA 2K28A 1BNZA 3MWYW 4ZK9B 3FPUB 1RTNA 1EIGA 1X3QA 4HCSA 4IUVA 2L1BA 2KECA 4O42A 2RA4A 2SDFA 1QNKA 1PDQA 3DEOA 5D14A 3GV6A 1TVXA 2KVMA 5EQ0A 3F2UA 3H91A 4RAUC 1KNAA 3TN2A 5COYA 1DOKA 2KEDA 5EKIA 1RODA 2DY8A 2KOLA 4ZLTF 1U4PA 1J8IA 4NW2A 4CJ2C 1WTOA 3I3CA 1ZXTA 3IFDA 1EL0A 1DOLA 2B2TC 3DEPA 1ILQA 5CORA 5CBAE 1EOTA 1SSOA 1WTQA 1GUWA 3UI2A 3Q6SA 5E4XA 1HUNA 1U4LA 2CVRA 1B4OA 4U68A 4X3KA 4OIJA 3I91A 3G7LA 3SVMA 4IURA 1EIHA 1HRJA 2B2VC 2FJ2A 2FINB 2XIWA 1KNEA 2EE1A 1DOMA 2B2YC 1BO0A 4X3TA 4R9WA 2FFKB 3HP3A 4LMQD 4QUFA 2NWGA 4MHEA 2H1EA 1VMPA 4IUQA 2FMMA 1S4ZA 1O7ZA 2RVLA 1AZQA 1B50A 1EQTA 1MSHA 2B2UC 1CM9A 2NYZD 1BBXC 5EJWA 1QE6A 1B3AA 1WTRA 4X3SA 1B2TA 2HDLA 4R8IA 1MGSA 1PFNA 2L11A 2N55A 2RSOA 3LWEA 4QUCA 1B53A 1HFGA 2JP1A 2EPBA
chains in the Genus database with same CATH superfamily
3PO2G 4RGTA 4XTCS 1HR0L 3T1YQ 3KF6B 1WTWA 1OO9B 4KKSA 2QKIC 5BN4A 1MI2A 2JA9A 1ILPA 3TRZA 4KN7C 1PFBA 2EVBA 3P20A 1IKLA 3QIAA 3TP8A 1BF4A 1CKNA 4GN5A 4C3IG 2HIVA 4CDCC 3DLLA 1L0XB 4IUTA 3H0GB 3OW7A 1Y1WH 2E2DC 1IBKL 3CCLA 3E3XA 3TZUA 2JA8B 1ET9A 4EVOA 1YHBA 2SOBA 5EPJA 4JCVE 2YTYA 4EX5A 2VQEQ 2F0FA 4OWTB 1Y1VB 3S2DB 1HZBA 4K6LA 3S1QB 1B3QA 2R93B 3M3YB 2NN6H 3CCJA 4JI1Q 2QA4A 1QVGA 2OEOA 3OMGA 3HOYH 2PI2E 3I4OA 4A3CH 1HHVA 3NEMA 3K5NA 3GV6A 3PF4A 2L55A 3URYA 4PQXA 1P8LA 1SE3A 2WB1B 2F0IA 3H94A 4K0KQ 1NTGA 1VQKA 1HNWQ 4AIMA 1XWEA 3M9BA 3T1YL 4A3KG 4AYBB 4JBMA 2HIXA 4IURA 1LTBD 3LGJA 4BXXG 5M5WB 2EE1A 3TS0A 3PMFA 2PQEA 4LFAQ 1UE1A 3HOUG 2F0MA 5C4JB 2PNRC 1EQTA 1LT5D 3VYSA 1CM9A 1AN8A 2DNCA 1HJPA 3HKSA 4K2LA 3WOFA 3PIO3 1D5ZC 2EJMA 1Y69U 4XYOA 3PF5A 5K36H 5KYLA 4R8IA 4JBJA 1Q81C 2LXJA 2VUMG 2LS01 3NENA 2UUBQ 2F0SA 3F2CA 1PYBA 3A5ZB 1A3VA 2VQEL 1WTVA 1YHQA 2ZXPA 1XMQQ 2EY2A 3R2IA 4DNRB 3CCMA 1Y8PB 1JMCA 5IGBA 3QOJA 2FHTA 5C3XA 5DLQE 2LKVA 4JI1L 2RF4A 4JK1C 2AUJD 3PUZA 3TZDA 3RMHA 2Z1CA 1CK1A 3NUCA 1EEFD 3J7ZC 1Y8NB 2V1CC 1PZKD 3CW2C 1NY4A 1X56A 5C0XI 1I4RA 1N9WA 4L6TB 1EQRA 4Y52H 2UXCL 4BBRG 1Y14B 1IXRA 1QVFA 1EU3A 4S3SA 3D6WA 3V96A 3GTOB 4IUPA 3DXJC 2MP1A 1SDFA 2X69A 1ICFB 3ZYYX 3QR8A 5FLXc 4K0KL 3BJUA 5CMDA 1CTMA 1E2ZA 2KBNA 5C3EB 1CI3M 1E1OA 1O7YA 4A3MH 1V1PA 2ASBA 1VQ4A 5BN5A 3K5OA 4GN3B 5E4WC 4LFAL 1KLUD 3M7NA 3AB9A 5AJ3Q 1DCZA 1ZKOA 2I46A 4DV0Q 1HR0W 1STBA 5I2XA 2ZJRA 4IUVA 1K8GA 3D4WA 2ZM6Q 1CKNB 3M4YA 4YWMA 2KHSA 1N8RC 4IFDH 1OXUA 1E24A 4N9PA 3V05A 1M90C 1BBWA 1ZEQX 1MKHA 2UUBL 4A3EH 1U4PA 2VS1A 3J7AF 2K5DA 2DJFC 1XMQL 4RCOA 1YBYA 2Z6KA 3RUZA 2NVYB 2Z0SA 5FKAC 4QF4A 5A2QL 4GKKQ 2FFKB 4DV5Q 1VMPA 3RZDH 2FMMA 2B63H 2OQ0A 4FF3A 4LUOA 2A68C 3NTKA 3BZDB 4EQPA 1PYSB 3NTIA 4B3TQ 2PZUA 2PQAB 2EY1A 4DKAC 2K33A 5C3WA 1HQMC 1K83H 5ISRA 3CCRA 1SR3A 5C44H 4L5RC 4KLKA 2H5XA 4JI6Q 4CKEA 4KJNA 3WOEA 4DV3Q 2JYOA 2NUCA 1C48A 3U58A 1A2TA 1RJTA 1TWFH 1V1QA 3IL8A 3HOZG 2VXWA 3GV3A 5M9OA 2A6HD 4KKUA 4OL7A 5AJ3L 3N52A 2SNMA 1E22A 1KD1C 1X3FA 4DV0L 2N88A 1Q86C 1YIJA 3GTLH 4GZYC 1II3A 1WTPA 1FYCA 5D3DA 1QB5D 3CP0A 1IYJB 3BDCA 2ZM6L 1ENFA 2MJ8A 3A7LA 4XXEA 1M4VA 2KCCA 2I5HA 3KLRA 1KRTA 2QGQA 5M3FH 1TIID 1HA5A 2B2UA 2ZT9C 3MXPA 4ILWA 5IE8A 1NR4A 4LF7Q 3G4SA 4XYQA 3M4OB 1F2ZA 5IOCA 3OIPA 3RN5A 4C3JG 2ATWA 1PTOB 1NJIC 3PQIA 3ERSX 1N33Q 3D4DA 3R3OA 1TWHH 4C3HG 4GKKL 4DV5L 4DV4Q 4JI7Q 3FKIG 4I65A 4LW1A 1LUZA 1UE5A 5IY0A 3TBIB 3E5SA 1S40A 2EYLA 1FNVA 3DUZA 1B1ZA 4B3TL 1H9SB 4DR5Q 3ICEA 4A3GB 3H91A 2UU9Q 1IYUA 3PCOB 5L37A 3I72A 4C2MH 4U673 3TS2A 2K5VA 4JI6L 3DEPA 5J22A 1EOTA 1UE6A 1G6PA 1VQ7A 4DV3L 4B3SQ 3VYUA 2Z8LA 4OXPA 4X65Q 2KCNA 4HCEA 1I94Q 1KC8C 1LYLA 2NVXH 4NMZA 1GOZA 3W2DA 3JAMi 1IBMQ 4H44C 1R9TH 3HG9A 3H09A 1XXGA 2PI2A 4R4QA 1JJ2A 4X3SA 1KAWA 1W2BA 4YWLA 1EIFA 5I9OA 4A3LH 4EQ5A 4LF7L 3DMUA 1VQNA 5GQOA 1TR5A 2D2CC 2HCCA 1PH7A 4BY1H 3BZCA 4N8FA 3BU2A 4P74A 1PFMA 3RZOB 2RDHA 3NSWA 2B2WC 2D62A 4LF6Q 2J7ZA 5ELOA 5IYCG 3GTPB 3J7AV 3K81C 1BCPD 2MO1A 3NP8A 5CV6A 5JVH3 2JXMB 1ENAA 4IQZA 2HD3A 4DV4L 4JI7L 1BVSA 2AMCB 2F3IA 3HRZC 4Y7NH 1PH9A 5C4XB 4HN7A 4YY3Q 3AYHB 5FJ8G 5D3IB 3S15B 2EYMA 4A3FH 1RCVD 1WCMB 1WD0A 5CV8A 4DR5L 2EYHA 1PH2A 5DM73 1HNXQ 1IL8A 2K03A 4DR7L 1CFMA 2UU9L 3QOLA 4A3DH 2NN6I 3RLNA 2JEAI 2MHVA 2CFMA 2F3WA 1PH8A 2QW7A 2XRSD 2JA7H 1PTOC 3MXNA 3BS1A 3KOJA 3VYRA 3VR4A 5LL6S 4CBVA 4X65L 4BS9A 1I94L 5EPLA 4KK7A 3MXUA 1OXTA 4G57A 4DXFA 3AFQA 1SYCA 4X3UA 3VR3A 4DR4L 1D8LA 2A6EC 4EQNA 4LAAA 3G71A 1IBML 2M9VA 4HR7B 4A3BB 3QG1A 3A54A 1PDQA 1PRTB 1EWHA 3TP6A 2N8NA 2Z6BA 2E2IB 2KVMA 2HQEA 1Q46A 4ID6A 3K57A 3I4MG 1DOKA 4A3JB 5ELEA 5IT9L 1Z6HA 1D2BA 1I4PA 4NW2A 5C0XH 5FO7B 3J81i 4GLXA 1VQPA 4B3MQ 5CORA 4LF6L 4C1NK 4X6AH 3R2TA 3S14B 2EDGA 4OIJA 3H0GH 5IGEA 2PO4A 3D0FA 2QDBA 2JA8H 4YY3L 1C9OA 2NN6G 2QILA 2I5MX 4FF4A 3PO2B 3HOYG 1B50A 4AH6A 5KGUA 3K7UC 2NYZD 1BBXC 2ZJQA 4X62Q 2B3GA 1B3AA 1HNXL 1Y1VH 3S2DH 3QJYA 4CDDC 1HPCA 2R93H 3M3YH 3KDFB 3SXHA 1H9RA 3A74A 1LTLA 3OTOQ 2N3SA 1PH1A 1JWSD 1V1OA 4JG2A 2K05A 2AQ2B 1F2LA 2P5ZX 4C3IB 3HGBA 3CC7A 2TSSA 2B2TA 2JK8A 1YJ9A 1HZAA 3QB3A 1BQQT 4KTAA 2NZHA 2L9HA 1EYDA 3KK7A 1I4GA 1TT2A 5AFWA 3CCEA 3VR2A 1KIXA 2NTSA 3ONAB 4DR3Q 3HKZE 3KF8A 5KNBA 3F1ZA 1XNRL 3MEHA 3KYHC 3PUXA 2XN9C 3VA7A 1Q3LA 2CW0C 2DUDA 1XX8A 5M5WH 1FJGL 4HJAA 3U4ZA 1NNXA 4ZRZA 3M4PA 4B3ML 5IYDH 1GO3E 1F9QA 2JA5G 5C4JH 5I2YA 1J6QA 1VQAA 4QJFA 1HQRD 2NBFA 3VYTA 4YIJA 5CV4A 5G3LF 2NZOA 1SFOB 1K9MC 3P1HA 3MTSA 2K01A 3NK9A 4YWKA 2V4DA 2SEBD 3SE0A 1PRTC 4X62L 5JPMC 4L5TA 2NB0A 1IW7D 3DEOA 5D14A 4A3KB 2VQFQ 4BBSB 4DUZQ 2WAQG 1EY8A 2KEDA 5EGTA 3OTOL 1KRSA 1QVCA 2WAQE 1F77A 4DV7Q 3PO3B 3V2TA 3EJIA 1SRUA 5E4XA 3MXNB 1U4LA 1HUNA 4JPBW 1UUPA 4G7ZC 4WRDA 2RBMA 2F0WA 2VUMB 4CGYB 1ESFA 2WIIB 3GTQB 4A3MG 2D0PA 1VQLA 3GTOH 4QUFA 1AE3A 1RIPA 4RFBA 5IODA 3HOWH 5C3EH 4DR3L 4NPSA 3I55A 2HDLA 1EY9A 2A19A 4IFDG 1EY5A 3K6OA 4PG3A 1DGSA 5GROA 4IPHA 2EOTA 1EWCA 2F3VA 3HEJA 1WYDA 2D0OA 4A3EG 4YHHQ 4I7AA 1WVLA 3ERQA 4IO9A 4F88A 4Q0FA 3AFPA 4QQBX 2UXBQ 2O4XA 1PH6A 3FP9A 4M8AA 4FP5D 4BBRB 1PA6A 4H7BA 4PZ6A 2B8GA 4DV6Q 2KHJA 2RDFA 1YNNC 3UDXA 1HUMA 2JA6B 1STYA 1YJWA 2B63G 2XWBB 2OQKA 3P75A 4HSVA 4OIKA 4XDXA 3RN2A 1MIUA 1EZ6A 4RWSC 4RGNA 5J1ZA 4WJ3M 1S72A 4HMJA 1F9SA 4LWCA 4OO1H 1STEA 1EY7A 2UUAQ 1YNJC 3T13A 5IT9c 2Q2UA 4QL5A 3J7A5 1AFPA 4H13C 4DV7L 2X6GA 5JJZA 1IBLQ 3S1NB 5KNCA 3A0JA 2BA0A 4Q5VA 5C44G 2QCPX 1ESRA 2BH2A 1J9OA 1G2SA 4GNXB 4JI3Q 4HMIA 3C46A 2VY3A 1I50B 4ALPA 1PH4A 1GUGA 2NVTB 3VDYA 2GVBA 3OWEB 1Q8KA 2KECA 3W1GA 5LMNQ 2E8GA 1EUJA 3KF8B 1LT6D 3F2UA 2ALYB 1A6XA 1EY6A 1P16A 5JJLA 4NKLA 5M3FG 4TKOB 2JSOA 1WTOA 1LTGD 4FXKC 3EROA 5HGTA 1DXMA 2GN5A 2ZXOA 5CBAE 1HTPA 3UI2A 3OPOA 4POFA 4BA2I 3G7LA 2UXBL 1FVIA 2ZJPA 3HOVG 1LTRD 1OXSC 3KLWA 2YTVA 1DOMA 3SK5A 1BKBA 2GA4B 2UXDQ 4X3TA 5CV9A 1S4ZA 2AQ3B 4JI2Q 5M5YH 4DV1Q 3G6EA 1PTOH 5M3MG 2H4OA 2F0EA 3PUYA 3HOZB 2C5CA 2UUAL 2WP8J 5CGKA 1WD1A 1XNQQ 5C4ZA 4NP5A 1U4RA 1IBLL 1SROA 5GAEC 3OMCA 3KBGA 2Q2TA 1DD2A 1K8OA 1L1OA 3NQTA 2IW3A 3HOXH 4A3GH 4J15A 1CSPA 3S16B 3SHLA 1WOCA 5JEAJ 4IPCA 3H3VH 5C6AA 3NXWA 3NE5B 1CSQA 2ENBA 3RR5A 1G91A 2A8VA 5LMNL 5KYIA 4LFBQ 4UP7A 4RHRA 4A75A 3CRLC 2E5LQ 2OXPA 3TEHB 4C3HB 2IPKD 4JW0A 4B9XA 3UDFA 1PRTF 4A3LG 1SBBB 2RSNA 2K5QA 5EPKA 4ZAIA 1B70B 4E6IA 2X6LA 5IT9E 4BY1G 1TY2A 3K59A 2DGYA 4FF1A 4L63B 4CDEC 5DNFA 1L2FA 1VQGA 1UE7A 3GTJB 2YYZA 4GNXC 1W6KA 4KJOA 2UXDL 3F2DA 5GADC 1KDAA 1QG7A 4JI2L 1BNZA 3ND9A 1S5CD 4DV1L 3RZOH 3D4RA 5KRUA 2QEJC 3GTPH 4IFDJ 4A3FG 1SNMA 4DF7A 1HNWL 5JJIA 3S2HH 4WFN3 1XNQL 4HIDA 4A3DG 4BY7B 4CJ2C 3I3CA 2DNEA 1EL0A 1DOLA 4GLVB 3S15H 1ILQA 3CCVA 2EJGC 4KD3A 3EN2A 1WCMH 3VA5A 4GOPA 3E6ZX 2JA7G 2B2VC 1QUQA 1PVOA 3C2PA 4A93H 2E2JB 5FK9C 3I4NB 3NPPA 3CD6A 1JCKB 5IP9H 1I4QA 3T1HQ 1MJEA 1BUVT 3MA2B 4RGOS 4RCNA 3RLFA 4LFBL 2D5DA 4H02A 2AWNA 3MHBA 4O2DA 2R7ZH 2L11A 2E5LL 4FF2A 2IJ0A 2JJQA 1HFGA 1EYAA 1EY4A 5I4DA 1MD2D 4LNQA 2K5NA 4DK0A 3K7AB 1DM0B 1HFNA 5C0XG 4A3BH 2M2LA 1CHPD 4MTNA 2MUYA 3VR6A 2E2IH 4FXDA 2E2HB 2F1MA 1GUOA 3U9OA 3EIVA 1I6HB 4A3JH 4OHJA 3H0GG 2F0DA 1VMCA 1D6EC 3CCUA 2IL8A 2JA8G 5I6YA 2XVSA 5FOBB 4TSSA 5CV7A 3CF5A 1K28A 1W6JA 1W3SA 3S14H 2F4IA 3BDLA 2NZ1D 1FNUA 3CKIB 1OXVA 4PNYA 4KMUC 5IYBG 1B44D 2E75C 4JI5Q 4AQYQ 2R93G 1EWIA 1SNPA 5FLMG 3PO2H 1VF5C 2CH4W 3JAML 4J1MA 1NSNS 1IZ6A 1RTOA 5DM63 3J80i 3ZJYC 1LV9A 1L1OB 3CHBD 1KHIA 2C9OA 2LSSA 3I4MB 1YEZA 2EYPA 4IUUA 1NE3A 1VF7A 4YCVA 3CCSA 1PFSA 3ULLA 1F2YA 4C3IH 3GTKB 2AKWB 4B3RQ 1KNAA 3DM3A 2KQ3A 4AYBG 2RCNA 2O5JC 2DJGC 3CXCA 3OOCA 2F0VA 3RLOA 1LT3D 4WJWA 1TS3A 3KLSA 2EIFA 4ZCKA 5LMNW 4AYBE 2XRQD 3UE0A 1A3UA 1I3QH 2WKDA 3L7ZC 4QIWE 3S17B 4HIMA 4ZQ3A 1U0LA 1Z9FA 2UUCQ 2Q2IA 1N32Q 4R9WA 2EY5A 1UWVA 1VCIA 1S5ED 4DXGA 1QZHA 4JBKA 2Z4HA 4JOIA 1LTTD 4DAVA 1SMYD 2AQ1B 2OF1A 4R1JA 3E9IA 3N6RA 1U5KA 1YI2A 1EY0A 1WTRA 4RKBA 4K14A 1MGSA 1MJCA 4K5XA 2LY7A 5LHY1 1SFOH 2ZTEA 4JI5L 4POGA 1G2TA 2N78A 3HKZB 3CQZB 3J81j 4IOCA 1V1PB 1G8ZD 5DAUA 2BH8A 1BCPB 4LUVA 4DN4M 3I90A 1GD7A 3PUWA 4A3KH 4ODGA 1Z7TA 4BBSH 4JI8Q 4PV1C 4WORA 1NCVA 4OO1I 1B9NA 4BXXH 2BOSA 1PZJD 2JEBI 3D3RA 3NBIA 2F0TA 1PYWD 1S5BD 5EKKA 3J81L 2Q8RE 2JA5B 2B2YA 3PO3H 5IIFA 3HOWG 4FVMA 1SAPA 4B3RL 2K04A 5C3EG 3BVMA 3BYTB 2VUMH 2A6ED 1ZYRD 3NELA 2R92H 1E2VA 2IT1A 3G48A 3SDZA 1N33L 2RHQB 2XGTA 3L3OC 3BZKA 4NXNQ 1NR2A 4GLAC 3KBXA 3CMEA 2UUCL 4DAPA 2WAQB 3K0YA 4ZKCB 1N32L 3Q0AA 1JICA 1E3PA 1JT8A 3A7AB 1YJNA 3S1MB 1YHAA 1AP0A 1EYCA 2PW7A 1SE4A 3UDGA 1KAAA 1EIYB 2AUKA 3NTHA 3STBC 3MWYW 3EFXD 2L1BA 3SEBA 4JYAQ 2WFWA 4BBRH 1KTKA 1J8IA 1EQVA 4B3SL 2BE5D 2QDLA 1E1TA 5C0XJ 1I5FA 3LNNA 2EXZA 4L5QA 2A74C 2JA6H 3TMEA 2ID0A 1B4OA 5GAGC 4JI8L 5FO9B 4H0LC 4RH6A 4A3IB 3CU7A 5JAVA 4G7HC 4IUQA 2K6AA 1O7ZA 1LT4D 3I7FA 3NWSA 4L5SA 1TS5A 5C4HA 3S1NH 4MTKA 3H3VC 5I9PA 4N8X1 1Y1WG 1H9JA 4JBWA 3KJPA 1PH3A 1O7IA 2AWOA 1PFNA 2K7VA 2VB3X 1B53A 2JP1A 1V8QA 3M4QA 1CA6A 1GUNA 3TP7A 3H3VI 1XPUA 1CA5A 1SJHD 3FDTA 1BCPC 3MEFA 1TWGB 4HEDA 2KA7A 1E2WA 1I50H 5M5XB 3OYYA 4NXNL 1TWCB 4QY7A 2WV6D 1C8CA 2PZWA 2Q8TA 1RHPA 2CW0D 4DAMA 3C3LA 4A3CG 2F0GA 3GO5A 4IALA 2YU9B 1VQBA 4PZ8A 4OX9Q 1U9RA 2IX3A 3S1QH 2F0JA 2HUGA 3I73A 3Q8DA 4HIOA 2TMPA 4N9TA 5C5MA 1K8MA 3GTMB 1XYIA 2Z6KC 3DM1A 2F0LA 5IGCA 1SNOA 3CPFA 4XQQA 1S5FD 1OTCA 4V190 1WJJA 1IYVA 2AHOB 5F2DA 2G5DA 1SYBA 3M7GA 2CWAA 1KL9A 3HOZH 3HOXG 4A3GG 5EBDA 5M3FB 2Y0SG 5TSSA 1TS2A 2VB2X 1SNDA 3S9WA 1EIGA 2IY5B 1GUSA 1PHJA 1YVCA 1STNA 1PV4A 4KHZA 2EYOA 5K36G 2Y0SE 1SEBD 2F0HA 4KHVA 3SK6A 1V43A 1C7YA 3HOVB 1XTDA 1SJED 4FYDA 4LK1C 3SK8A 1D1KA 5DEHA 1VQOA 4IJHA 3KJOA 4RMFA 4CHTB 1JORA 4JC0A 1R4PB 5M3MB 2E74C 4QB4A 1HRJA 2BDOA 5EBCA 2EZVA 2N49A 3PIPA 4C3HH 1RDPD 4KI0A 2RVLA 2B2UC 2M00A 1CHQD 2B8FA 4C56C 3J7YW 2NTTA 4G7OC 3HOUB 1HCZA 5IGFA 3GTJH 4UPAA 4QUCA 3D8GA 3DWPA 4HTHA 2EPBA 3I4LA 3OIQA 1LLRD 1PZID 4R4CA 4X64Q 1HZCA 1BBUA 1ONLA 1A3TA 2RHSB 1UEAB 4MN3A 3GDEA 3T56B 1WTXA 1A63A 2OTLA 1RL2A 3CPWA 4WJ4A 3JAME 4DK3C 1WCMG 1YNJD 3S1RB 1MSGA 1M8AA 1JQYD 2HDMA 2ZXRA 4BY7H 2PMZE 4A93G 5IP7H 1GUTA 1JJCB 2F52A 1TQOA 4DR2Q 2IWHA 4BY1B 5KIXA 1X9NA 3K5LA 1EZ8A 5D65A 2WINB 4CJ1B 1GVPA 1SYGA 3GTGB 2KEEA 4UDUC 3AQQA 1LTID 2E2JH 3I8ZA 2R7ZG 1D5XC 3DWAA 3MFGA 3I4NH 2BDNA 2CQOA 3E0JA 2XWJB 4DGZA 1JR0D 4M1UB 4A3BG 2EQSA 2K14A 3SGIA 3WWVA 5HURA 4UP8A 2R61A 2CQAA 1JB3A 1V9PA 4F8MA 3MAQA 2VQFL 2IX1A 1IW7C 2K28A 4DUZL 4JV5Q 5ELDA 5FJ8H 2L5TA 4B9WA 2NVYH 1SYFA 4A3JG 1FGBD 1LTAD 1RTNA 3K7AH 4GS3A 4HCSA 3HZXA 3K80C 5LMUQ 2F0QA 2F0KA 3C1FA 3E9HA 3A8KE 1VQEA 1ET6A 2E2HH 1I6HH 4X64L 4QGUA 1TU2B 4LF4Q 1Q12A 4APVA 1WTQA 2RQXA 4BWGB 2ZTCA 5EAYA 3PV0A 3AEVA 3SR1A 3I70A 2FJ2A 2FINB 3A8JE 1SYEA 4IJLA 1BCPF 1RD9D 5E7NA 4P71A 1A2UA 2NWGA 2G9HD 4MHEA 1A0IA 1Q7YC 3Q23A 4DR2L 4J6HA 2IX0A 5EJWA 4HJ5A 2NVQB 4RG1A 3J81E 2JE6I 4YHHL 4P75A 2LFNA 3I4MH 3FHWA 5K5PA 2KUMA 1G51A 1OXXK 1UNSA 1D7QA 1ML0D 4PMCA 1K73C 2A69C 4DR6Q 1VQ8A 1QILA 4KY5A 2CH4A 3M85A 2F0NA 1F9RA 1GM5A 4DV6L 3L0OA 3GTKH 2PZTA 4PMWA 5EKLA 3M4OH 1JB7A 2L12A 3GD7A 4RGMA 2EYFA 3F2BA 4DUYQ 4HAEA 3BDOA 5J3BA 4JV5L 2K5WA 1VQHA 1SN8A 3NBHA 4R4TA 5LMUL 1BXTA 2KCTA 1KDCA 3S17H 3GP7A 3P7JA 3A55A 2L15A 3FVQA 1HXYD 1PMRA 1U4MA 1I4HA 2F0UA 2PQAA 3W3AA 1N34Q 5CC4A 4LF4L 3CMAA 2UXCQ 3EBEA 3KFUA 2R7DA 2K5HA 1CZWA 2GVAA 5ELNA 4ZUJA 3TSSA 1H9KA 4JI3L 1AZPA 4OGQC 3KUPA 1UAPA 4XT3B 2B2WA 2IHEA 3GQBA 4K5VA 5ELBA 2K52A 4C3JB 4BBSG 1YNXA 1TWAB 4DU9A 5FO8B 1TY0A 4QIWB 3ULPA 3CQZH 1X65A 1QJOA 2SDFA 1X54A 3A56A 2A5HA 1PXUA 3MVVA 3PO3G 3Q22A 3FKIB 1Q90A 4TVAB 4LF9Q 2F03A 3TQYA 4KN4C 5EKIA 4LUZA 1T9HA 4ZLTF 3W1BA 1E7ZA 5HY6A 2OWOA 1O7LA 2B2TC 1TXYA 4DR6L 2R92G 2JA5H 2VW9A 2G9DA 1JOQA 1JOKA 3IKJA 1L0YB 3U9SA 2K4KA 1VQFA 3D6CA 2SNSA 4DUYL 5JOBA 3IAYA 4LMQD 3VR5A 3RNUA 1QWYA 2HT1A 1UEBA 1SLJA 1CT1D 5JEAH 1ENCA 2XSCA 4UHVA 4RKLA 3J80L 5C4XH 2A68D 2E76C 3IRBA 2EYJA 1H9SA 4K6DA 1B7YB 1N34L 4DNIA 3S1MH 1R4QB 2PNHA 2RCFA 2OCEA 2YTXA 4DA2A 2D9UA 3NQIA 4QMGA 1SYDA 3HOWB 4A76A 2IHFA 1VQCA 2JA6G 4YCUA 4LFCQ 1EFWA 2B39A 3QWNA 4I7ZC 1QNUA 2I0QA 5E3FA 1KLGD 2EJFC 1CKOA 4JI0Q 4B08A 4QCLA 1QZGA 4LF9L 1A62A 1E0BA 3PSIA 1JWUD 3G6JB 3ER0A 1X55A 4A3IH 4RHSA 4ZKBB 4IZ8A 4ZYSA 1XJVA 2K75A 3K0XA 3OW2A 4HJ8A 1VS0A 2DY7A 2FMCA 4JI4Q 3CCQA 3A8IE 4DR1Q 4LF8Q 2EXDA 3FPPA 3R93A 2A73B 1A8VA 1DYQA 1KABA 4KD4A 1TWGH 4DFAA 5M5XH 3NBHB 1Y1VG 1IHZA 1TWCH 2HHHQ 5CV5A 1TVXA 4J8QA 1I6VC 4ULLA 2Q2HA 2EY6A 1EEID 2I07B 1AH9A 1J5EQ 3NHHA 2MO0A 3L2PA 2C35B 1ZXTA 4EGVA 3IFDA 2YU9H 5JJKA 5ELCA 4FNFA 3I56A 1AE2A 1FR3A 5G3LD 1BR9A 5HGQA 2CVRA 4X3KA 2PCFB 3I91A 3SVMA 4LJZC 1Y1WB 4HJ7A 2ES2A 3GTMH 4HJ9A 4ME5A 1KDBA 3T1HL 4P73A 4LFCL 4ABNA 3HFZB 4C1NI 4EQOA 2WB1G 3HP3A 3PIP3 4KKTA 1MSHA 1SMXA 1VQIA 1KQSA 4JI0L 1STAA 3U50C 2WB1E 1QE6A 1VQJA 1D1IA 2B29A 2BCOA 3ITPA 4NXMQ 5BN3A 2JN4A 2CCZA 1HZ9A 4XQNA 1GHKA 2F4VQ 3HOYB 1CQVA 4OWXB 5CBEE 1H95A 5IYDG 4DNTB 2F0PA 1AW7A 1GKHA 4G4KA 4GKJQ 3H15A 1MHWC 4OELB 5IGGA 4JI4L 1Z47A 4DR1L 4LF8L 5M5YB 5FLXE 1JOOA 3HOVH 2DN8A 4LF5Q 4CJ0B 1T5XD 1B9MA 4HIKA 1SNCA 1YZ6A 4IPDA 2HHHL 4BA1I 4KV6A 1QCBD 1HTLD 1NAPA 1ICWA 4AQYL 4HSPA 1C0AA 2ZTDA 5M3MH 3HS0C 2K50A 1EOVA 1J5EL 2MGSA 4MNOA 3STBD 1XMOQ 4A4IA 4DR7Q 1VQMA 3HOXB 1Q1BA 3KDFA 3FMCA 2A6HC 1I4XA 2Y0SB 2R3ZA 3TDQA 4GOPB 4OEMB 2KENA 1QUQB 2CWPA 1JJGA 1S3OA 1NBWA 1JE4A 1PTOD 2ICEC 3HOUH 3K8AA 1O78A 5T1IA 3PGZA 1SE2A 3MXGA 1A15A 1FGUA 1GXDC 4F87A 5BR8Q 1X3PA 4IN3A 2I5LX 4BY7G 3BVZA 1NMGA 1EQQA 3GTQH 1QNKA 5IP7G 4NXML 3TREA 4DR4Q 5COYA 2F4VL 4CKCA 1CZGA 1IL2A 3J80c 1RODA 3H6MA 2KOLA 1Q8IA 3S1RH 2K32A 3CAMA 3KLSX 3W5OA 1TS4A 1VQDA 4OWWB 1L1OC 4GKJL 4IPGA 1LABA 1JC7A 1LACA 1SSOA 5E1FA 1GUWA 3I4NG 3AU7A 2PYKA 3GTGH 4LF5L 2YV5A 4R8NA 1SMYC 4PMBA 4PZ7A 2A1AA 2O2LD 4MZ9A 1AZQA 3S2HB 4CKBA 1SXTA 3PIOA 1F2MA 4A3MB 1B8AA 2XNAC 1ASZA 3CC4A 2VNUD 2PMZB 4OO1G 1ASYA 1Y8OB 1XMOL 4KY7A 3BG3A 4R4OA 4ZUIA 1VDZA 2HCIA 3T16A 4A93B 1FNWA 3Q24A 4UAIA 1STGA 2MFIA 1NMFA 4GN4B 4ME3A 1K0RA 3QO2A 4XQJA 4K5WA 1XTCD 1IKMA 4V0BA 1EYGA 1JWMD 4A3EB 3T51B 4RA8A 4DV2Q 5BR8L 2L0CA 2R7ZB 1CQFA 1LM0A 1DZ1A 2QEXA 1L0WA 3UDIA 4NB3A 4DAYA 1WFQA 1G6ZA 1C4QA 4X66Q 1ZYRC 3SK4A 3AMUA 1DONA 4KY6A 4XT1B 4UP9A 1FD7D 1LTSD 5J39A 2PW5A 3C1EA 2NVTH 3MFYA 3OSOA 2LXKA 4GOPC 3RZDB 3CC2A 2B63B 3JAMc 1XNRQ 1XPOA 3FRPB 2MQHA 1VQ9A 3EA6A 1FJGQ 3EVQA 1Q1EA 1XPRA 5H1SE 1AEXA 2O5IC 3T4AC 2NVQH 3EQLC 5CYUA 1EFID 4NDXA 4DK6C 5C5LA 2VZAA 5JVG3 1WTHA 2FXQA 3FEWX 5T1GA 1K83B 4XIGS 4KHPQ 5C44B 4JYAL 3BYYB 1K3RA 3FPUB 1NUCA 1X3QA 1VQ5A 2RKSA 5KNDA 1FL0A 1JE5A 5EQ0A 3X3NA 3K58A 1PRTD 2BE5C 1TWFB 4RAUC 3X3MA 3TN2A 2Z4IA 2VL6A 2DY8A 3S24A 1K3BC 1VQ6A 3J80E 3GTLB 5IYBH 1G291 2JQOA 3LWUA 3MZ5A 5CR3A 1M1KC 1GHJA 5FLMH 3KF6A 3O13A 1D5MC 3PUVA 5NUCA 3K5MA 4DK1A 2KHIA 4MIUA 3LX0A 3OHXC 1EIHA 4K8JA 4IOAA 1KXLA 1KNEA 3OWFA 1YITA 4DV2L 4TRDA 4O1NA 2CHBD 3ULJA 3ND8A 4Z9CB 1GJXA 2H1EA 3DHQA 4GNXA 5KEEA 3HKZG 4K2KA 2KCMA 4X66L 3S16H 1TWHB 3LWEA 2N55A 2J0TD 1I3QB 3IFTA 4C3JH 3F8TA 1HA6A 4L8JA 1TKWB 5IGDA 1TWAH 2XTIA 1F9PA 3T53B 4YCWA 3U4VA 3CRKC 1PH5A 1Q82C 3R8BA 2K1BA 3TP5A 4DPGA 5IWAQ 1N36Q 3DWQA 4OX9L 3BVGA 1K0SA 3FKIH 1STHA 4C2MB 4KHPL 4IFDI 2WKCA 1SNQA 2J4XA 1X6OA 2KJXA 3J81c 2B2VA 1PLFA 1O80A 1HNZQ 2MPMA 4K8IA 2ICIA 4O0AA 1YNND 5ELFA 5JEAG 1T5EA 5A2QE 2RDGA 2R6GA 1MBYA 2NVXB 5C4XG 1CUKA 2OT2A 3RD4A 1R9TB 4UY8C 2PPBC 2LMCB 1X32A 2HQLA 1HR0Q 2CKZB 1K8AC 2OTJA 3NWTA 4JOIC 2QF7A 4P2CB 5I6WA 3L9AX 1BOSA 2L4NA 1DJRD 3B6YA 5IP9G 3I2ZA 4CDFC 1HH2P 4ZK9B 3A5UA 2R92B 1CKMA 1RF2D 4O42A 1LO5D 2RA4A 5GAHC 4DAYB 4FO2A 4JVZA 2BA1A 5A35A 1IBKQ 2R7FA 1EU4A 5FLXL 4Y7NB 4R4IA 4TQUS 3D31A 5IYCH 1X3GA 4A3IG 2Z9HA 1BDOA 5JPNC 4A3FB 1RKNA 3Q6SA 4OONA 1QOHA 4U68A 3MC0B 5IWAL 1N36L 2WACA 4IUNA 4A3DB 4FXGC 2XIWA 3JC66 2B2YC 1BO0A 5LL6X 3UE1A 2Q8IB 1X3EA 4F7XA 1S5DD 2F0OA 2A69D 1WI5A 4FDBA 4P72A 2JA7B 1HNZL 1PTOF 2MNAA 3E0EA 1B2TA 1H9MA 1SE8A 3WDNA 2RSOA
chains in the Genus database with same CATH topology
4RGTA 4XTCS 1WTWA 1OO9B 4KKSA 2QKIC 5BN4A 1MI2A 1ILPA 4KN7C 1PFBA 2EVBA 3P20A 1IKLA 3QIAA 3TP8A 1BF4A 4C3IG 1L0XB 4IUTA 3H0GB 3OW7A 2E2DC 3TZUA 2JA8B 1ET9A 4EVOA 2SOBA 5EPJA 2F0FA 1Y1VB 3S2DB 4K6LA 3S1QB 2R93B 3M3YB 2NN6H 2OEOA 3OMGA 1HHVA 3K5NA 3GV6A 2L55A 3URYA 4PQXA 1SE3A 2WB1B 2F0IA 3H94A 1XWEA 4AYBB 4IURA 1LTBD 5M5WB 2EE1A 3PMFA 2PQEA 2F0MA 5C4JB 2PNRC 1EQTA 1LT5D 3VYSA 1CM9A 1AN8A 2DNCA 4K2LA 3WOFA 3PIO3 1D5ZC 2EJMA 1Y69U 4XYOA 5K36H 5KYLA 4R8IA 2LS01 2F0SA 1A3VA 1WTVA 2ZXPA 2EY2A 3R2IA 4DNRB 1Y8PB 5IGBA 3QOJA 2FHTA 5C3XA 2LKVA 4JK1C 2AUJD 3PUZA 3TZDA 3RMHA 2Z1CA 1CK1A 3NUCA 1EEFD 1Y8NB 1PZKD 5C0XI 1I4RA 4L6TB 1EU3A 4S3SA 3D6WA 3V96A 3GTOB 4IUPA 3DXJC 2MP1A 1SDFA 2X69A 3ZYYX 5CMDA 1CTMA 1E2ZA 5C3EB 1CI3M 1O7YA 1V1PA 5BN5A 3K5OA 5E4WC 1KLUD 3M7NA 3AB9A 1DCZA 1ZKOA 2I46A 1STBA 5I2XA 4IUVA 3D4WA 3M4YA 2KHSA 4IFDH 1OXUA 3V05A 4N9PA 1ZEQX 3J7AF 1U4PA 2K5DA 4RCOA 3RUZA 2NVYB 5FKAC 4QF4A 5A2QL 2FFKB 1VMPA 2FMMA 4FF3A 2A68C 3NTKA 3BZDB 4EQPA 3NTIA 2PZUA 2EY1A 2K33A 5C3WA 1HQMC 5ISRA 4CKEA 4KJNA 3WOEA 2JYOA 2NUCA 1C48A 1A2TA 1RJTA 3IL8A 2VXWA 3GV3A 5M9OA 2A6HD 4KKUA 4OL7A 3N52A 2SNMA 2N88A 4GZYC 1II3A 1WTPA 1FYCA 5D3DA 1QB5D 3BDCA 1ENFA 2MJ8A 3A7LA 4XXEA 1M4VA 2KCCA 3KLRA 1TIID 1HA5A 2B2UA 2ZT9C 3MXPA 4ILWA 1NR4A 4XYQA 3M4OB 1F2ZA 5IOCA 3OIPA 4C3JG 1PTOB 3D4DA 3R3OA 4C3HG 4I65A 3TBIB 3E5SA 2EYLA 1FNVA 3DUZA 1B1ZA 1H9SB 4A3GB 3H91A 1IYUA 3I72A 4U673 3DEPA 5J22A 1EOTA 3VYUA 2Z8LA 2KCNA 4HCEA 4NMZA 1GOZA 3W2DA 4H44C 3HG9A 3H09A 1XXGA 4X3SA 5I9OA 3DMUA 1TR5A 2D2CC 2HCCA 1PFMA 3RZOB 2RDHA 3NSWA 2B2WC 2D62A 2J7ZA 3GTPB 3J7AV 1BCPD 3NP8A 5CV6A 5JVH3 2JXMB 1ENAA 4IQZA 3HRZC 5C4XB 4HN7A 5D3IB 3S15B 2EYMA 1RCVD 1WCMB 1WD0A 5CV8A 2EYHA 5DM73 1IL8A 2K03A 1CFMA 3QOLA 2NN6I 2JEAI 2MHVA 2F3WA 2XRSD 1PTOC 3MXNA 3BS1A 3VYRA 3VR4A 5LL6S 4CBVA 4BS9A 5EPLA 4KK7A 3MXUA 1OXTA 4G57A 4DXFA 1SYCA 4X3UA 3VR3A 2A6EC 4EQNA 4LAAA 2M9VA 4HR7B 4A3BB 3QG1A 1PDQA 3A54A 1PRTB 1EWHA 3TP6A 2E2IB 2KVMA 2HQEA 4ID6A 3K57A 1DOKA 4A3JB 5ELEA 5IT9L 1Z6HA 1D2BA 1I4PA 4NW2A 5C0XH 5FO7B 5CORA 4C1NK 3R2TA 3S14B 2EDGA 4OIJA 5IGEA 2PO4A 2QDBA 2NN6G 2QILA 4FF4A 3PO2B 1B50A 5KGUA 2NYZD 1BBXC 1B3AA 3QJYA 1HPCA 3SXHA 1H9RA 1JWSD 1V1OA 2K05A 2AQ2B 1F2LA 4C3IB 3HGBA 2TSSA 2B2TA 3QB3A 1BQQT 4KTAA 2L9HA 1EYDA 3KK7A 1I4GA 1TT2A 5AFWA 3VR2A 2NTSA 3ONAB 3KF8A 5KNBA 3MEHA 3PUXA 2XN9C 3VA7A 1Q3LA 2CW0C 1XX8A 4ZRZA 1F9QA 5I2YA 1HQRD 2NBFA 3VYTA 4YIJA 5CV4A 5G3LF 1SFOB 3P1HA 3MTSA 2K01A 3NK9A 2V4DA 2SEBD 3SE0A 1PRTC 5JPMC 2NB0A 1IW7D 3DEOA 5D14A 4A3KB 4BBSB 1EY8A 2KEDA 5EGTA 1F77A 3PO3B 3V2TA 3EJIA 5E4XA 1HUNA 1U4LA 1UUPA 4G7ZC 4WRDA 2RBMA 2F0WA 2VUMB 4CGYB 1ESFA 2WIIB 3GTQB 4QUFA 4RFBA 5IODA 2HDLA 1EY9A 4IFDG 1EY5A 3K6OA 2EOTA 1EWCA 2F3VA 3HEJA 1WVLA 3ERQA 4F88A 4Q0FA 2O4XA 4M8AA 4FP5D 4BBRB 4H7BA 2B8GA 2RDFA 1YNNC 1HUMA 2JA6B 1STYA 2XWBB 3P75A 4HSVA 4OIKA 4XDXA 1EZ6A 4RWSC 4RGNA 5J1ZA 4HMJA 1F9SA 4OO1H 1STEA 1EY7A 1YNJC 3T13A 1AFPA 4H13C 2X6GA 5JJZA 3S1NB 5KNCA 4Q5VA 2BA0A 2QCPX 1ESRA 1J9OA 1G2SA 4HMIA 3C46A 1I50B 1GUGA 2NVTB 3OWEB 2KECA 1LT6D 3F2UA 1A6XA 1EY6A 4NKLA 4TKOB 2JSOA 1WTOA 1LTGD 4FXKC 3EROA 5HGTA 1DXMA 2ZXOA 5CBAE 1HTPA 3UI2A 3OPOA 4BA2I 3G7LA 1LTRD 1OXSC 1DOMA 3SK5A 2GA4B 4X3TA 5CV9A 1S4ZA 2AQ3B 1PTOH 2H4OA 2F0EA 3PUYA 3HOZB 2C5CA 2WP8J 5CGKA 1WD1A 5C4ZA 4NP5A 1U4RA 3OMCA 3KBGA 1DD2A 1K8OA 3NQTA 2IW3A 3S16B 3SHLA 5JEAJ 5C6AA 3NXWA 3NE5B 2ENBA 1G91A 5KYIA 4RHRA 3CRLC 2OXPA 4C3HB 2IPKD 4B9XA 1PRTF 1SBBB 2RSNA 2K5QA 5EPKA 4ZAIA 4E6IA 2X6LA 5IT9E 1TY2A 3K59A 4FF1A 4L63B 5DNFA 3GTJB 2YYZA 1W6KA 4KJOA 1KDAA 1QG7A 1BNZA 3ND9A 1S5CD 3D4RA 5KRUA 2QEJC 4IFDJ 1SNMA 4DF7A 4WFN3 4BY7B 4CJ2C 3I3CA 2DNEA 1EL0A 1DOLA 1ILQA 2EJGC 4KD3A 3VA5A 3E6ZX 2B2VC 3C2PA 2E2JB 5FK9C 3I4NB 3NPPA 1JCKB 1I4QA 1BUVT 3MA2B 4RGOS 4RCNA 3RLFA 2D5DA 2AWNA 3MHBA 2L11A 4FF2A 2IJ0A 1HFGA 1EYAA 1EY4A 5I4DA 1MD2D 4DK0A 3K7AB 1DM0B 1HFNA 5C0XG 2M2LA 1CHPD 2MUYA 3VR6A 4FXDA 2E2HB 2F1MA 1GUOA 3U9OA 1I6HB 4OHJA 2F0DA 1VMCA 1D6EC 2IL8A 5I6YA 2XVSA 5FOBB 4TSSA 5CV7A 1W6JA 2F4IA 3BDLA 2NZ1D 1FNUA 3CKIB 1OXVA 4PNYA 4KMUC 1B44D 2E75C 1SNPA 1VF5C 3JAML 4J1MA 1NSNS 1RTOA 5DM63 1LV9A 3CHBD 3I4MB 2C9OA 2EYPA 4IUUA 1VF7A 1F2YA 3GTKB 1KNAA 2KQ3A 2O5JC 3OOCA 2F0VA 1LT3D 4WJWA 1TS3A 3KLSA 2XRQD 1A3UA 2WKDA 3L7ZC 3S17B 4ZQ3A 4R9WA 2EY5A 1VCIA 1S5ED 4DXGA 2Z4HA 1LTTD 4DAVA 1SMYD 2AQ1B 2OF1A 3N6RA 1EY0A 1WTRA 4RKBA 4K14A 1MGSA 4K5XA 2LY7A 5LHY1 1G2TA 3HKZB 3CQZB 1V1PB 1G8ZD 5DAUA 1BCPB 4DN4M 3I90A 3PUWA 4ODGA 1Z7TA 4PV1C 4WORA 1NCVA 4OO1I 1B9NA 2BOSA 1PZJD 2JEBI 3D3RA 3NBIA 2F0TA 1PYWD 1S5BD 5EKKA 3J81L 2Q8RE 2JA5B 2B2YA 5IIFA 4FVMA 1SAPA 2K04A 3BVMA 3BYTB 2A6ED 1ZYRD 1E2VA 2IT1A 3SDZA 3L3OC 1NR2A 3KBXA 4DAPA 2WAQB 3K0YA 4ZKCB 3Q0AA 1JICA 3A7AB 3S1MB 1AP0A 1EYCA 2PW7A 1SE4A 1KAAA 2AUKA 3NTHA 3MWYW 3EFXD 2L1BA 3SEBA 1KTKA 1J8IA 1EQVA 2BE5D 5C0XJ 3LNNA 2EXZA 2A74C 3TMEA 2ID0A 1B4OA 5FO9B 4H0LC 4RH6A 4A3IB 3CU7A 5JAVA 4G7HC 4IUQA 2K6AA 1O7ZA 1LT4D 3NWSA 1TS5A 5C4HA 3H3VC 5I9PA 1H9JA 4JBWA 2AWOA 1PFNA 2K7VA 2VB3X 1B53A 2JP1A 1V8QA 1CA6A 1GUNA 3TP7A 1CA5A 1SJHD 3FDTA 1BCPC 1TWGB 4HEDA 2KA7A 1E2WA 5M5XB 1TWCB 2WV6D 1C8CA 2PZWA 2Q8TA 1RHPA 2CW0D 3C3LA 2F0GA 3GO5A 4IALA 2YU9B 1U9RA 2IX3A 2F0JA 2HUGA 3I73A 2TMPA 4N9TA 5C5MA 1K8MA 3GTMB 1XYIA 3DM1A 2F0LA 5IGCA 1SNOA 4XQQA 1S5FD 4V190 1IYVA 5F2DA 1SYBA 3M7GA 5EBDA 5M3FB 5TSSA 1TS2A 2VB2X 1SNDA 3S9WA 1EIGA 1GUSA 1STNA 5K36G 4KHZA 2EYOA 1SEBD 2F0HA 4KHVA 3SK6A 1V43A 3HOVB 1SJED 4FYDA 4LK1C 3SK8A 1D1KA 5DEHA 4CHTB 1JORA 1R4PB 5M3MB 2E74C 4QB4A 1HRJA 2BDOA 5EBCA 2EZVA 1RDPD 4KI0A 2RVLA 2B2UC 2M00A 1CHQD 2B8FA 4C56C 3J7YW 2NTTA 4G7OC 3HOUB 1HCZA 5IGFA 4QUCA 3D8GA 3DWPA 4HTHA 2EPBA 3I4LA 3OIQA 1LLRD 1PZID 1ONLA 1A3TA 1UEAB 4MN3A 3T56B 1WTXA 3JAME 1YNJD 3S1RB 1MSGA 1M8AA 1JQYD 2HDMA 2ZXRA 1GUTA 1TQOA 2IWHA 4BY1B 5KIXA 3K5LA 1EZ8A 5D65A 2WINB 4CJ1B 1SYGA 3GTGB 2KEEA 4UDUC 1LTID 3I8ZA 1D5XC 3DWAA 3MFGA 2BDNA 3E0JA 2XWJB 4DGZA 1JR0D 4M1UB 5HURA 2R61A 2CQAA 1JB3A 4F8MA 3MAQA 2IX1A 1IW7C 2K28A 5ELDA 2L5TA 4B9WA 1SYFA 1FGBD 1LTAD 1RTNA 4HCSA 3HZXA 2F0QA 2F0KA 3C1FA 3A8KE 1ET6A 1TU2B 1Q12A 1WTQA 2RQXA 4BWGB 3PV0A 3SR1A 3I70A 2FJ2A 2FINB 3A8JE 1SYEA 1BCPF 1RD9D 1A2UA 2NWGA 2G9HD 4MHEA 3Q23A 4J6HA 2IX0A 5EJWA 2NVQB 3J81E 2JE6I 2LFNA 5K5PA 2KUMA 1UNSA 1OXXK 1ML0D 4PMCA 2A69C 1QILA 4KY5A 3M85A 2F0NA 1F9RA 2PZTA 4PMWA 5EKLA 2L12A 3GD7A 4RGMA 2EYFA 4HAEA 3BDOA 2K5WA 3NBHA 1BXTA 1KDCA 3GP7A 3P7JA 3A55A 3FVQA 1HXYD 1PMRA 1U4MA 1I4HA 2F0UA 3W3AA 5CC4A 4ZUJA 1CZWA 3TSSA 1H9KA 1AZPA 4OGQC 3KUPA 1UAPA 4XT3B 2B2WA 3GQBA 4K5VA 5ELBA 4C3JB 1TWAB 4DU9A 5FO8B 1TY0A 4QIWB 1QJOA 2SDFA 3A56A 2A5HA 1PXUA 3MVVA 3Q22A 3FKIB 1Q90A 2F03A 4KN4C 5EKIA 4ZLTF 1O7LA 2B2TC 2G9DA 1JOQA 1JOKA 3IKJA 1L0YB 3U9SA 3D6CA 2SNSA 5JOBA 3IAYA 4LMQD 3VR5A 1QWYA 1CT1D 5JEAH 1ENCA 2XSCA 4RKLA 3J80L 2A68D 2E76C 2EYJA 1H9SA 4K6DA 1R4QB 4DA2A 2D9UA 3NQIA 4QMGA 1SYDA 3HOWB 2B39A 3QWNA 4I7ZC 1QNUA 5E3FA 1KLGD 2EJFC 4B08A 4QCLA 1E0BA 1JWUD 3G6JB 4RHSA 4ZKBB 4IZ8A 4ZYSA 2FMCA 2DY7A 3A8IE 3FPPA 3R93A 2A73B 1DYQA 1KABA 4KD4A 4DFAA 1IHZA 5CV5A 1TVXA 4J8QA 1I6VC 4ULLA 2EY6A 1EEID 2I07B 3NHHA 4EGVA 1ZXTA 3IFDA 5ELCA 4FNFA 5G3LD 1FR3A 1BR9A 2CVRA 4X3KA 2PCFB 3I91A 3SVMA 4LJZC 1Y1WB 4ME5A 1KDBA 4ABNA 4C1NI 4EQOA 3HP3A 3PIP3 4KKTA 1MSHA 1STAA 1QE6A 2BCOA 1D1IA 3ITPA 5BN3A 4XQNA 1GHKA 3HOYB 1CQVA 5CBEE 4DNTB 2F0PA 1AW7A 4G4KA 5IGGA 1Z47A 5M5YB 5FLXE 1JOOA 2DN8A 4CJ0B 1T5XD 1B9MA 1SNCA 4BA1I 4KV6A 1QCBD 1HTLD 1NAPA 1ICWA 4HSPA 3HS0C 2MGSA 3HOXB 1Q1BA 3FMCA 2A6HC 1I4XA 2Y0SB 2R3ZA 3TDQA 1JE4A 1PTOD 2ICEC 1O78A 5T1IA 1SE2A 3MXGA 1A15A 1GXDC 4F87A 1X3PA 4IN3A 3BVZA 1QNKA 5COYA 4CKCA 1CZGA 1RODA 3H6MA 2KOLA 1Q8IA 2K32A 3KLSX 1TS4A 1LABA 1JC7A 1LACA 1SSOA 5E1FA 1GUWA 3AU7A 2PYKA 4R8NA 1SMYC 4PMBA 2O2LD 1AZQA 3S2HB 4CKBA 1SXTA 1F2MA 4A3MB 2XNAC 2VNUD 2PMZB 4OO1G 1Y8OB 4KY7A 3BG3A 4ZUIA 1VDZA 2HCIA 3T16A 4A93B 1FNWA 3Q24A 4UAIA 1STGA 3QO2A 4XQJA 4K5WA 1XTCD 1IKMA 4V0BA 1JWMD 4A3EB 3T51B 4RA8A 2L0CA 2R7ZB 1CQFA 1DZ1A 4DAYA 1G6ZA 1C4QA 1ZYRC 3SK4A 3AMUA 1DONA 4KY6A 4XT1B 1FD7D 1LTSD 5J39A 2PW5A 3C1EA 3MFYA 3OSOA 3RZDB 2B63B 3FRPB 3EA6A 3EVQA 1Q1EA 1AEXA 2O5IC 3T4AC 3EQLC 5CYUA 1EFID 4NDXA 5C5LA 5JVG3 3FEWX 5T1GA 1K83B 4XIGS 5C44B 3BYYB 3FPUB 1NUCA 1X3QA 2RKSA 5KNDA 5EQ0A 3X3NA 3K58A 1PRTD 2BE5C 1TWFB 4RAUC 3X3MA 3TN2A 2Z4IA 2DY8A 3J80E 3GTLB 1G291 3LWUA 3MZ5A 5CR3A 1GHJA 3O13A 3PUVA 1D5MC 5NUCA 3K5MA 4DK1A 4MIUA 3LX0A 3OHXC 1EIHA 4K8JA 1KNEA 3OWFA 4TRDA 4O1NA 2CHBD 3ND8A 4Z9CB 1GJXA 2H1EA 3DHQA 5KEEA 4K2KA 1TWHB 3LWEA 2N55A 2J0TD 1I3QB 3IFTA 1HA6A 4L8JA 1TKWB 5IGDA 1F9PA 3T53B 3CRKC 3R8BA 2K1BA 3TP5A 3DWQA 3BVGA 1STHA 4C2MB 4IFDI 2WKCA 1SNQA 2J4XA 2KJXA 2B2VA 1PLFA 1O80A 2MPMA 4K8IA 2ICIA 1YNND 5ELFA 5JEAG 1T5EA 5A2QE 2RDGA 2R6GA 1MBYA 2NVXB 3RD4A 2OT2A 1R9TB 2PPBC 2LMCB 1X32A 3NWTA 2QF7A 4P2CB 5I6WA 3L9AX 1BOSA 2L4NA 1DJRD 4ZK9B 2R92B 4O42A 1RF2D 1LO5D 2RA4A 4FO2A 2BA1A 5A35A 1EU4A 5FLXL 4Y7NB 4TQUS 3D31A 1BDOA 5JPNC 4A3FB 1RKNA 3Q6SA 1QOHA 4U68A 3MC0B 2WACA 4IUNA 4A3DB 4FXGC 2XIWA 2B2YC 1BO0A 5LL6X 2Q8IB 4F7XA 1S5DD 2F0OA 2A69D 2JA7B 1PTOF 1B2TA 1H9MA 3WDNA 2RSOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CA6 A;  2HCC A;  1G2T A;  2KUM A;  1WD1 A;  1HA6 A;  2EOT A;  1CA5 A;  2HCI A;  1U4R A;  1ML0 D;  1F9P A;  2K05 A;  3FDT A;  1WTV A;  1PFM A;  4HED A;  4MN3 A;  1F2L A;  1WVL A;  1HFN A;  2B2W C;  2D9U A;  2M2L A;  4UAI A;  4DN4 M;  1WTX A;  2J7Z A;  2K1B A;  3I90 A;  1C8C A;  1F9R A;  2Q8T A;  1RHP A;  2FHT A;  2JYO A;  3QO2 A;  1WTW A;  1RJT A;  1MI2 A;  2B2T A;  1IKM A;  1NCV A;  3IL8 A;  2VXW A;  3GV3 A;  3TZD A;  2L12 A;  1MSG A;  1M8A A;  4RA8 A;  2L9H A;  3N52 A;  4HAE A;  1VMC A;  1ILP A;  4CJ0 B;  2HDM A;  2N88 A;  2B2V A;  5AFW A;  2IL8 A;  1PFB A;  1WTP A;  1DZ1 A;  1IKL A;  1HUM A;  1PLF A;  2Q8R E;  1G91 A;  2B2Y A;  1BF4 A;  2HUG A;  1O80 A;  2MPM A;  3ONA B;  2MJ8 A;  1WD0 A;  1NAP A;  1G6Z A;  1ICW A;  4HSV A;  4IUT A;  1SAP A;  1IL8 A;  2K03 A;  4OIK A;  2K04 A;  4XDX A;  5D65 A;  1XYI A;  2NZ1 D;  3P7J A;  4RWS C;  4XT1 B;  4CJ1 B;  1DON A;  1E0B A;  2B2U A;  1U4M A;  3D6W A;  1F9S A;  2KEE A;  2MGS A;  1Q3L A;  1NR4 A;  1XX8 A;  3DM1 A;  4IUP A;  3I8Z A;  4ZKB B;  2MP1 A;  1SDF A;  2RSN A;  2X69 A;  5EPJ A;  2BDN A;  5EPK A;  4ZAI A;  2R3Z A;  1F9Q A;  2X6G A;  5CBE E;  5CMD A;  2X6L A;  5JJZ A;  1RTO A;  1X32 A;  5DNF A;  1O7Y A;  1NR2 A;  2DY7 A;  1ESR A;  1LV9 A;  3KBX A;  1AZP A;  1JE4 A;  1J9O A;  5EPL A;  3KUP A;  4ZKC B;  4XT3 B;  1JIC A;  3R93 A;  2B2W A;  5T1I A;  1G2S A;  5E4W C;  3MTS A;  2L4N A;  2K01 A;  1AP0 A;  5T1G A;  1A15 A;  4X3U A;  1QG7 A;  1HHV A;  1X3P A;  4IUU A;  2K28 A;  1BNZ A;  3MWY W;  4ZK9 B;  3FPU B;  1RTN A;  1EIG A;  1X3Q A;  4HCS A;  4IUV A;  2L1B A;  2KEC A;  4O42 A;  2RA4 A;  2SDF A;  1QNK A;  1PDQ A;  3DEO A;  5D14 A;  3GV6 A;  1TVX A;  2KVM A;  5EQ0 A;  3F2U A;  3H91 A;  4RAU C;  1KNA A;  3TN2 A;  5COY A;  1DOK A;  2KED A;  5EKI A;  1ROD A;  2DY8 A;  2KOL A;  4ZLT F;  1U4P A;  1J8I A;  4NW2 A;  4CJ2 C;  1WTO A;  3I3C A;  1ZXT A;  3IFD A;  1EL0 A;  1DOL A;  2B2T C;  3DEP A;  1ILQ A;  5COR A;  5CBA E;  1EOT A;  1SSO A;  1WTQ A;  1GUW A;  3UI2 A;  3Q6S A;  5E4X A;  1HUN A;  1U4L A;  2CVR A;  1B4O A;  4U68 A;  4X3K A;  4OIJ A;  3I91 A;  3G7L A;  3SVM A;  4IUR A;  1EIH A;  1HRJ A;  2B2V C;  2FJ2 A;  2FIN B;  2XIW A;  1KNE A;  2EE1 A;  1DOM A;  2B2Y C;  1BO0 A;  4X3T A;  4R9W A;  2FFK B;  3HP3 A;  4LMQ D;  4QUF A;  2NWG A;  4MHE A;  2H1E A;  1VMP A;  4IUQ A;  2FMM A;  1S4Z A;  1O7Z A;  2RVL A;  1AZQ A;  1B50 A;  1EQT A;  1MSH A;  2B2U C;  1CM9 A;  2NYZ D;  1BBX C;  5EJW A;  1QE6 A;  1B3A A;  1WTR A;  4X3S A;  1B2T A;  2HDL A;  4R8I A;  1MGS A;  1PFN A;  2L11 A;  2N55 A;  2RSO A;  3LWE A;  4QUC A;  1B53 A;  1HFG A;  2JP1 A;  2EPB A; 
#chains in the Genus database with same CATH topology
 3PO2 G;  4RGT A;  4XTC S;  1HR0 L;  3T1Y Q;  3KF6 B;  1WTW A;  1OO9 B;  4KKS A;  2QKI C;  5BN4 A;  1MI2 A;  2JA9 A;  1ILP A;  3TRZ A;  4KN7 C;  1PFB A;  2EVB A;  3P20 A;  1IKL A;  3QIA A;  3TP8 A;  1BF4 A;  1CKN A;  4GN5 A;  4C3I G;  2HIV A;  4CDC C;  3DLL A;  1L0X B;  4IUT A;  3H0G B;  3OW7 A;  1Y1W H;  2E2D C;  1IBK L;  3CCL A;  3E3X A;  3TZU A;  2JA8 B;  1ET9 A;  4EVO A;  1YHB A;  2SOB A;  5EPJ A;  4JCV E;  2YTY A;  4EX5 A;  2VQE Q;  2F0F A;  4OWT B;  1Y1V B;  3S2D B;  1HZB A;  4K6L A;  3S1Q B;  1B3Q A;  2R93 B;  3M3Y B;  2NN6 H;  3CCJ A;  4JI1 Q;  2QA4 A;  1QVG A;  2OEO A;  3OMG A;  3HOY H;  2PI2 E;  3I4O A;  4A3C H;  1HHV A;  3NEM A;  3K5N A;  3GV6 A;  3PF4 A;  2L55 A;  3URY A;  4PQX A;  1P8L A;  1SE3 A;  2WB1 B;  2F0I A;  3H94 A;  4K0K Q;  1NTG A;  1VQK A;  1HNW Q;  4AIM A;  1XWE A;  3M9B A;  3T1Y L;  4A3K G;  4AYB B;  4JBM A;  2HIX A;  4IUR A;  1LTB D;  3LGJ A;  4BXX G;  5M5W B;  2EE1 A;  3TS0 A;  3PMF A;  2PQE A;  4LFA Q;  1UE1 A;  3HOU G;  2F0M A;  5C4J B;  2PNR C;  1EQT A;  1LT5 D;  3VYS A;  1CM9 A;  1AN8 A;  2DNC A;  1HJP A;  3HKS A;  4K2L A;  3WOF A;  3PIO 3;  1D5Z C;  2EJM A;  1Y69 U;  4XYO A;  3PF5 A;  5K36 H;  5KYL A;  4R8I A;  4JBJ A;  1Q81 C;  2LXJ A;  2VUM G;  2LS0 1;  3NEN A;  2UUB Q;  2F0S A;  3F2C A;  1PYB A;  3A5Z B;  1A3V A;  2VQE L;  1WTV A;  1YHQ A;  2ZXP A;  1XMQ Q;  2EY2 A;  3R2I A;  4DNR B;  3CCM A;  1Y8P B;  1JMC A;  5IGB A;  3QOJ A;  2FHT A;  5C3X A;  5DLQ E;  2LKV A;  4JI1 L;  2RF4 A;  4JK1 C;  2AUJ D;  3PUZ A;  3TZD A;  3RMH A;  2Z1C A;  1CK1 A;  3NUC A;  1EEF D;  3J7Z C;  1Y8N B;  2V1C C;  1PZK D;  3CW2 C;  1NY4 A;  1X56 A;  5C0X I;  1I4R A;  1N9W A;  4L6T B;  1EQR A;  4Y52 H;  2UXC L;  4BBR G;  1Y14 B;  1IXR A;  1QVF A;  1EU3 A;  4S3S A;  3D6W A;  3V96 A;  3GTO B;  4IUP A;  3DXJ C;  2MP1 A;  1SDF A;  2X69 A;  1ICF B;  3ZYY X;  3QR8 A;  5FLX c;  4K0K L;  3BJU A;  5CMD A;  1CTM A;  1E2Z A;  2KBN A;  5C3E B;  1CI3 M;  1E1O A;  1O7Y A;  4A3M H;  1V1P A;  2ASB A;  1VQ4 A;  5BN5 A;  3K5O A;  4GN3 B;  5E4W C;  4LFA L;  1KLU D;  3M7N A;  3AB9 A;  5AJ3 Q;  1DCZ A;  1ZKO A;  2I46 A;  4DV0 Q;  1HR0 W;  1STB A;  5I2X A;  2ZJR A;  4IUV A;  1K8G A;  3D4W A;  2ZM6 Q;  1CKN B;  3M4Y A;  4YWM A;  2KHS A;  1N8R C;  4IFD H;  1OXU A;  1E24 A;  4N9P A;  3V05 A;  1M90 C;  1BBW A;  1ZEQ X;  1MKH A;  2UUB L;  4A3E H;  1U4P A;  2VS1 A;  3J7A F;  2K5D A;  2DJF C;  1XMQ L;  4RCO A;  1YBY A;  2Z6K A;  3RUZ A;  2NVY B;  2Z0S A;  5FKA C;  4QF4 A;  5A2Q L;  4GKK Q;  2FFK B;  4DV5 Q;  1VMP A;  3RZD H;  2FMM A;  2B63 H;  2OQ0 A;  4FF3 A;  4LUO A;  2A68 C;  3NTK A;  3BZD B;  4EQP A;  1PYS B;  3NTI A;  4B3T Q;  2PZU A;  2PQA B;  2EY1 A;  4DKA C;  2K33 A;  5C3W A;  1HQM C;  1K83 H;  5ISR A;  3CCR A;  1SR3 A;  5C44 H;  4L5R C;  4KLK A;  2H5X A;  4JI6 Q;  4CKE A;  4KJN A;  3WOE A;  4DV3 Q;  2JYO A;  2NUC A;  1C48 A;  3U58 A;  1A2T A;  1RJT A;  1TWF H;  1V1Q A;  3IL8 A;  3HOZ G;  2VXW A;  3GV3 A;  5M9O A;  2A6H D;  4KKU A;  4OL7 A;  5AJ3 L;  3N52 A;  2SNM A;  1E22 A;  1KD1 C;  1X3F A;  4DV0 L;  2N88 A;  1Q86 C;  1YIJ A;  3GTL H;  4GZY C;  1II3 A;  1WTP A;  1FYC A;  5D3D A;  1QB5 D;  3CP0 A;  1IYJ B;  3BDC A;  2ZM6 L;  1ENF A;  2MJ8 A;  3A7L A;  4XXE A;  1M4V A;  2KCC A;  2I5H A;  3KLR A;  1KRT A;  2QGQ A;  5M3F H;  1TII D;  1HA5 A;  2B2U A;  2ZT9 C;  3MXP A;  4ILW A;  5IE8 A;  1NR4 A;  4LF7 Q;  3G4S A;  4XYQ A;  3M4O B;  1F2Z A;  5IOC A;  3OIP A;  3RN5 A;  4C3J G;  2ATW A;  1PTO B;  1NJI C;  3PQI A;  3ERS X;  1N33 Q;  3D4D A;  3R3O A;  1TWH H;  4C3H G;  4GKK L;  4DV5 L;  4DV4 Q;  4JI7 Q;  3FKI G;  4I65 A;  4LW1 A;  1LUZ A;  1UE5 A;  5IY0 A;  3TBI B;  3E5S A;  1S40 A;  2EYL A;  1FNV A;  3DUZ A;  1B1Z A;  4B3T L;  1H9S B;  4DR5 Q;  3ICE A;  4A3G B;  3H91 A;  2UU9 Q;  1IYU A;  3PCO B;  5L37 A;  3I72 A;  4C2M H;  4U67 3;  3TS2 A;  2K5V A;  4JI6 L;  3DEP A;  5J22 A;  1EOT A;  1UE6 A;  1G6P A;  1VQ7 A;  4DV3 L;  4B3S Q;  3VYU A;  2Z8L A;  4OXP A;  4X65 Q;  2KCN A;  4HCE A;  1I94 Q;  1KC8 C;  1LYL A;  2NVX H;  4NMZ A;  1GOZ A;  3W2D A;  3JAM i;  1IBM Q;  4H44 C;  1R9T H;  3HG9 A;  3H09 A;  1XXG A;  2PI2 A;  4R4Q A;  1JJ2 A;  4X3S A;  1KAW A;  1W2B A;  4YWL A;  1EIF A;  5I9O A;  4A3L H;  4EQ5 A;  4LF7 L;  3DMU A;  1VQN A;  5GQO A;  1TR5 A;  2D2C C;  2HCC A;  1PH7 A;  4BY1 H;  3BZC A;  4N8F A;  3BU2 A;  4P74 A;  1PFM A;  3RZO B;  2RDH A;  3NSW A;  2B2W C;  2D62 A;  4LF6 Q;  2J7Z A;  5ELO A;  5IYC G;  3GTP B;  3J7A V;  3K81 C;  1BCP D;  2MO1 A;  3NP8 A;  5CV6 A;  5JVH 3;  2JXM B;  1ENA A;  4IQZ A;  2HD3 A;  4DV4 L;  4JI7 L;  1BVS A;  2AMC B;  2F3I A;  3HRZ C;  4Y7N H;  1PH9 A;  5C4X B;  4HN7 A;  4YY3 Q;  3AYH B;  5FJ8 G;  5D3I B;  3S15 B;  2EYM A;  4A3F H;  1RCV D;  1WCM B;  1WD0 A;  5CV8 A;  4DR5 L;  2EYH A;  1PH2 A;  5DM7 3;  1HNX Q;  1IL8 A;  2K03 A;  4DR7 L;  1CFM A;  2UU9 L;  3QOL A;  4A3D H;  2NN6 I;  3RLN A;  2JEA I;  2MHV A;  2CFM A;  2F3W A;  1PH8 A;  2QW7 A;  2XRS D;  2JA7 H;  1PTO C;  3MXN A;  3BS1 A;  3KOJ A;  3VYR A;  3VR4 A;  5LL6 S;  4CBV A;  4X65 L;  4BS9 A;  1I94 L;  5EPL A;  4KK7 A;  3MXU A;  1OXT A;  4G57 A;  4DXF A;  3AFQ A;  1SYC A;  4X3U A;  3VR3 A;  4DR4 L;  1D8L A;  2A6E C;  4EQN A;  4LAA A;  3G71 A;  1IBM L;  2M9V A;  4HR7 B;  4A3B B;  3QG1 A;  3A54 A;  1PDQ A;  1PRT B;  1EWH A;  3TP6 A;  2N8N A;  2Z6B A;  2E2I B;  2KVM A;  2HQE A;  1Q46 A;  4ID6 A;  3K57 A;  3I4M G;  1DOK A;  4A3J B;  5ELE A;  5IT9 L;  1Z6H A;  1D2B A;  1I4P A;  4NW2 A;  5C0X H;  5FO7 B;  3J81 i;  4GLX A;  1VQP A;  4B3M Q;  5COR A;  4LF6 L;  4C1N K;  4X6A H;  3R2T A;  3S14 B;  2EDG A;  4OIJ A;  3H0G H;  5IGE A;  2PO4 A;  3D0F A;  2QDB A;  2JA8 H;  4YY3 L;  1C9O A;  2NN6 G;  2QIL A;  2I5M X;  4FF4 A;  3PO2 B;  3HOY G;  1B50 A;  4AH6 A;  5KGU A;  3K7U C;  2NYZ D;  1BBX C;  2ZJQ A;  4X62 Q;  2B3G A;  1B3A A;  1HNX L;  1Y1V H;  3S2D H;  3QJY A;  4CDD C;  1HPC A;  2R93 H;  3M3Y H;  3KDF B;  3SXH A;  1H9R A;  3A74 A;  1LTL A;  3OTO Q;  2N3S A;  1PH1 A;  1JWS D;  1V1O A;  4JG2 A;  2K05 A;  2AQ2 B;  1F2L A;  2P5Z X;  4C3I B;  3HGB A;  3CC7 A;  2TSS A;  2B2T A;  2JK8 A;  1YJ9 A;  1HZA A;  3QB3 A;  1BQQ T;  4KTA A;  2NZH A;  2L9H A;  1EYD A;  3KK7 A;  1I4G A;  1TT2 A;  5AFW A;  3CCE A;  3VR2 A;  1KIX A;  2NTS A;  3ONA B;  4DR3 Q;  3HKZ E;  3KF8 A;  5KNB A;  3F1Z A;  1XNR L;  3MEH A;  3KYH C;  3PUX A;  2XN9 C;  3VA7 A;  1Q3L A;  2CW0 C;  2DUD A;  1XX8 A;  5M5W H;  1FJG L;  4HJA A;  3U4Z A;  1NNX A;  4ZRZ A;  3M4P A;  4B3M L;  5IYD H;  1GO3 E;  1F9Q A;  2JA5 G;  5C4J H;  5I2Y A;  1J6Q A;  1VQA A;  4QJF A;  1HQR D;  2NBF A;  3VYT A;  4YIJ A;  5CV4 A;  5G3L F;  2NZO A;  1SFO B;  1K9M C;  3P1H A;  3MTS A;  2K01 A;  3NK9 A;  4YWK A;  2V4D A;  2SEB D;  3SE0 A;  1PRT C;  4X62 L;  5JPM C;  4L5T A;  2NB0 A;  1IW7 D;  3DEO A;  5D14 A;  4A3K B;  2VQF Q;  4BBS B;  4DUZ Q;  2WAQ G;  1EY8 A;  2KED A;  5EGT A;  3OTO L;  1KRS A;  1QVC A;  2WAQ E;  1F77 A;  4DV7 Q;  3PO3 B;  3V2T A;  3EJI A;  1SRU A;  5E4X A;  3MXN B;  1U4L A;  1HUN A;  4JPB W;  1UUP A;  4G7Z C;  4WRD A;  2RBM A;  2F0W A;  2VUM B;  4CGY B;  1ESF A;  2WII B;  3GTQ B;  4A3M G;  2D0P A;  1VQL A;  3GTO H;  4QUF A;  1AE3 A;  1RIP A;  4RFB A;  5IOD A;  3HOW H;  5C3E H;  4DR3 L;  4NPS A;  3I55 A;  2HDL A;  1EY9 A;  2A19 A;  4IFD G;  1EY5 A;  3K6O A;  4PG3 A;  1DGS A;  5GRO A;  4IPH A;  2EOT A;  1EWC A;  2F3V A;  3HEJ A;  1WYD A;  2D0O A;  4A3E G;  4YHH Q;  4I7A A;  1WVL A;  3ERQ A;  4IO9 A;  4F88 A;  4Q0F A;  3AFP A;  4QQB X;  2UXB Q;  2O4X A;  1PH6 A;  3FP9 A;  4M8A A;  4FP5 D;  4BBR B;  1PA6 A;  4H7B A;  4PZ6 A;  2B8G A;  4DV6 Q;  2KHJ A;  2RDF A;  1YNN C;  3UDX A;  1HUM A;  2JA6 B;  1STY A;  1YJW A;  2B63 G;  2XWB B;  2OQK A;  3P75 A;  4HSV A;  4OIK A;  4XDX A;  3RN2 A;  1MIU A;  1EZ6 A;  4RWS C;  4RGN A;  5J1Z A;  4WJ3 M;  1S72 A;  4HMJ A;  1F9S A;  4LWC A;  4OO1 H;  1STE A;  1EY7 A;  2UUA Q;  1YNJ C;  3T13 A;  5IT9 c;  2Q2U A;  4QL5 A;  3J7A 5;  1AFP A;  4H13 C;  4DV7 L;  2X6G A;  5JJZ A;  1IBL Q;  3S1N B;  5KNC A;  3A0J A;  2BA0 A;  4Q5V A;  5C44 G;  2QCP X;  1ESR A;  2BH2 A;  1J9O A;  1G2S A;  4GNX B;  4JI3 Q;  4HMI A;  3C46 A;  2VY3 A;  1I50 B;  4ALP A;  1PH4 A;  1GUG A;  2NVT B;  3VDY A;  2GVB A;  3OWE B;  1Q8K A;  2KEC A;  3W1G A;  5LMN Q;  2E8G A;  1EUJ A;  3KF8 B;  1LT6 D;  3F2U A;  2ALY B;  1A6X A;  1EY6 A;  1P16 A;  5JJL A;  4NKL A;  5M3F G;  4TKO B;  2JSO A;  1WTO A;  1LTG D;  4FXK C;  3ERO A;  5HGT A;  1DXM A;  2GN5 A;  2ZXO A;  5CBA E;  1HTP A;  3UI2 A;  3OPO A;  4POF A;  4BA2 I;  3G7L A;  2UXB L;  1FVI A;  2ZJP A;  3HOV G;  1LTR D;  1OXS C;  3KLW A;  2YTV A;  1DOM A;  3SK5 A;  1BKB A;  2GA4 B;  2UXD Q;  4X3T A;  5CV9 A;  1S4Z A;  2AQ3 B;  4JI2 Q;  5M5Y H;  4DV1 Q;  3G6E A;  1PTO H;  5M3M G;  2H4O A;  2F0E A;  3PUY A;  3HOZ B;  2C5C A;  2UUA L;  2WP8 J;  5CGK A;  1WD1 A;  1XNQ Q;  5C4Z A;  4NP5 A;  1U4R A;  1IBL L;  1SRO A;  5GAE C;  3OMC A;  3KBG A;  2Q2T A;  1DD2 A;  1K8O A;  1L1O A;  3NQT A;  2IW3 A;  3HOX H;  4A3G H;  4J15 A;  1CSP A;  3S16 B;  3SHL A;  1WOC A;  5JEA J;  4IPC A;  3H3V H;  5C6A A;  3NXW A;  3NE5 B;  1CSQ A;  2ENB A;  3RR5 A;  1G91 A;  2A8V A;  5LMN L;  5KYI A;  4LFB Q;  4UP7 A;  4RHR A;  4A75 A;  3CRL C;  2E5L Q;  2OXP A;  3TEH B;  4C3H B;  2IPK D;  4JW0 A;  4B9X A;  3UDF A;  1PRT F;  4A3L G;  1SBB B;  2RSN A;  2K5Q A;  5EPK A;  4ZAI A;  1B70 B;  4E6I A;  2X6L A;  5IT9 E;  4BY1 G;  1TY2 A;  3K59 A;  2DGY A;  4FF1 A;  4L63 B;  4CDE C;  5DNF A;  1L2F A;  1VQG A;  1UE7 A;  3GTJ B;  2YYZ A;  4GNX C;  1W6K A;  4KJO A;  2UXD L;  3F2D A;  5GAD C;  1KDA A;  1QG7 A;  4JI2 L;  1BNZ A;  3ND9 A;  1S5C D;  4DV1 L;  3RZO H;  3D4R A;  5KRU A;  2QEJ C;  3GTP H;  4IFD J;  4A3F G;  1SNM A;  4DF7 A;  1HNW L;  5JJI A;  3S2H H;  4WFN 3;  1XNQ L;  4HID A;  4A3D G;  4BY7 B;  4CJ2 C;  3I3C A;  2DNE A;  1EL0 A;  1DOL A;  4GLV B;  3S15 H;  1ILQ A;  3CCV A;  2EJG C;  4KD3 A;  3EN2 A;  1WCM H;  3VA5 A;  4GOP A;  3E6Z X;  2JA7 G;  2B2V C;  1QUQ A;  1PVO A;  3C2P A;  4A93 H;  2E2J B;  5FK9 C;  3I4N B;  3NPP A;  3CD6 A;  1JCK B;  5IP9 H;  1I4Q A;  3T1H Q;  1MJE A;  1BUV T;  3MA2 B;  4RGO S;  4RCN A;  3RLF A;  4LFB L;  2D5D A;  4H02 A;  2AWN A;  3MHB A;  4O2D A;  2R7Z H;  2L11 A;  2E5L L;  4FF2 A;  2IJ0 A;  2JJQ A;  1HFG A;  1EYA A;  1EY4 A;  5I4D A;  1MD2 D;  4LNQ A;  2K5N A;  4DK0 A;  3K7A B;  1DM0 B;  1HFN A;  5C0X G;  4A3B H;  2M2L A;  1CHP D;  4MTN A;  2MUY A;  3VR6 A;  2E2I H;  4FXD A;  2E2H B;  2F1M A;  1GUO A;  3U9O A;  3EIV A;  1I6H B;  4A3J H;  4OHJ A;  3H0G G;  2F0D A;  1VMC A;  1D6E C;  3CCU A;  2IL8 A;  2JA8 G;  5I6Y A;  2XVS A;  5FOB B;  4TSS A;  5CV7 A;  3CF5 A;  1K28 A;  1W6J A;  1W3S A;  3S14 H;  2F4I A;  3BDL A;  2NZ1 D;  1FNU A;  3CKI B;  1OXV A;  4PNY A;  4KMU C;  5IYB G;  1B44 D;  2E75 C;  4JI5 Q;  4AQY Q;  2R93 G;  1EWI A;  1SNP A;  5FLM G;  3PO2 H;  1VF5 C;  2CH4 W;  3JAM L;  4J1M A;  1NSN S;  1IZ6 A;  1RTO A;  5DM6 3;  3J80 i;  3ZJY C;  1LV9 A;  1L1O B;  3CHB D;  1KHI A;  2C9O A;  2LSS A;  3I4M B;  1YEZ A;  2EYP A;  4IUU A;  1NE3 A;  1VF7 A;  4YCV A;  3CCS A;  1PFS A;  3ULL A;  1F2Y A;  4C3I H;  3GTK B;  2AKW B;  4B3R Q;  1KNA A;  3DM3 A;  2KQ3 A;  4AYB G;  2RCN A;  2O5J C;  2DJG C;  3CXC A;  3OOC A;  2F0V A;  3RLO A;  1LT3 D;  4WJW A;  1TS3 A;  3KLS A;  2EIF A;  4ZCK A;  5LMN W;  4AYB E;  2XRQ D;  3UE0 A;  1A3U A;  1I3Q H;  2WKD A;  3L7Z C;  4QIW E;  3S17 B;  4HIM A;  4ZQ3 A;  1U0L A;  1Z9F A;  2UUC Q;  2Q2I A;  1N32 Q;  4R9W A;  2EY5 A;  1UWV A;  1VCI A;  1S5E D;  4DXG A;  1QZH A;  4JBK A;  2Z4H A;  4JOI A;  1LTT D;  4DAV A;  1SMY D;  2AQ1 B;  2OF1 A;  4R1J A;  3E9I A;  3N6R A;  1U5K A;  1YI2 A;  1EY0 A;  1WTR A;  4RKB A;  4K14 A;  1MGS A;  1MJC A;  4K5X A;  2LY7 A;  5LHY 1;  1SFO H;  2ZTE A;  4JI5 L;  4POG A;  1G2T A;  2N78 A;  3HKZ B;  3CQZ B;  3J81 j;  4IOC A;  1V1P B;  1G8Z D;  5DAU A;  2BH8 A;  1BCP B;  4LUV A;  4DN4 M;  3I90 A;  1GD7 A;  3PUW A;  4A3K H;  4ODG A;  1Z7T A;  4BBS H;  4JI8 Q;  4PV1 C;  4WOR A;  1NCV A;  4OO1 I;  1B9N A;  4BXX H;  2BOS A;  1PZJ D;  2JEB I;  3D3R A;  3NBI A;  2F0T A;  1PYW D;  1S5B D;  5EKK A;  3J81 L;  2Q8R E;  2JA5 B;  2B2Y A;  3PO3 H;  5IIF A;  3HOW G;  4FVM A;  1SAP A;  4B3R L;  2K04 A;  5C3E G;  3BVM A;  3BYT B;  2VUM H;  2A6E D;  1ZYR D;  3NEL A;  2R92 H;  1E2V A;  2IT1 A;  3G48 A;  3SDZ A;  1N33 L;  2RHQ B;  2XGT A;  3L3O C;  3BZK A;  4NXN Q;  1NR2 A;  4GLA C;  3KBX A;  3CME A;  2UUC L;  4DAP A;  2WAQ B;  3K0Y A;  4ZKC B;  1N32 L;  3Q0A A;  1JIC A;  1E3P A;  1JT8 A;  3A7A B;  1YJN A;  3S1M B;  1YHA A;  1AP0 A;  1EYC A;  2PW7 A;  1SE4 A;  3UDG A;  1KAA A;  1EIY B;  2AUK A;  3NTH A;  3STB C;  3MWY W;  3EFX D;  2L1B A;  3SEB A;  4JYA Q;  2WFW A;  4BBR H;  1KTK A;  1J8I A;  1EQV A;  4B3S L;  2BE5 D;  2QDL A;  1E1T A;  5C0X J;  1I5F A;  3LNN A;  2EXZ A;  4L5Q A;  2A74 C;  2JA6 H;  3TME A;  2ID0 A;  1B4O A;  5GAG C;  4JI8 L;  5FO9 B;  4H0L C;  4RH6 A;  4A3I B;  3CU7 A;  5JAV A;  4G7H C;  4IUQ A;  2K6A A;  1O7Z A;  1LT4 D;  3I7F A;  3NWS A;  4L5S A;  1TS5 A;  5C4H A;  3S1N H;  4MTK A;  3H3V C;  5I9P A;  4N8X 1;  1Y1W G;  1H9J A;  4JBW A;  3KJP A;  1PH3 A;  1O7I A;  2AWO A;  1PFN A;  2K7V A;  2VB3 X;  1B53 A;  2JP1 A;  1V8Q A;  3M4Q A;  1CA6 A;  1GUN A;  3TP7 A;  3H3V I;  1XPU A;  1CA5 A;  1SJH D;  3FDT A;  1BCP C;  3MEF A;  1TWG B;  4HED A;  2KA7 A;  1E2W A;  1I50 H;  5M5X B;  3OYY A;  4NXN L;  1TWC B;  4QY7 A;  2WV6 D;  1C8C A;  2PZW A;  2Q8T A;  1RHP A;  2CW0 D;  4DAM A;  3C3L A;  4A3C G;  2F0G A;  3GO5 A;  4IAL A;  2YU9 B;  1VQB A;  4PZ8 A;  4OX9 Q;  1U9R A;  2IX3 A;  3S1Q H;  2F0J A;  2HUG A;  3I73 A;  3Q8D A;  4HIO A;  2TMP A;  4N9T A;  5C5M A;  1K8M A;  3GTM B;  1XYI A;  2Z6K C;  3DM1 A;  2F0L A;  5IGC A;  1SNO A;  3CPF A;  4XQQ A;  1S5F D;  1OTC A;  4V19 0;  1WJJ A;  1IYV A;  2AHO B;  5F2D A;  2G5D A;  1SYB A;  3M7G A;  2CWA A;  1KL9 A;  3HOZ H;  3HOX G;  4A3G G;  5EBD A;  5M3F B;  2Y0S G;  5TSS A;  1TS2 A;  2VB2 X;  1SND A;  3S9W A;  1EIG A;  2IY5 B;  1GUS A;  1PHJ A;  1YVC A;  1STN A;  1PV4 A;  4KHZ A;  2EYO A;  5K36 G;  2Y0S E;  1SEB D;  2F0H A;  4KHV A;  3SK6 A;  1V43 A;  1C7Y A;  3HOV B;  1XTD A;  1SJE D;  4FYD A;  4LK1 C;  3SK8 A;  1D1K A;  5DEH A;  1VQO A;  4IJH A;  3KJO A;  4RMF A;  4CHT B;  1JOR A;  4JC0 A;  1R4P B;  5M3M B;  2E74 C;  4QB4 A;  1HRJ A;  2BDO A;  5EBC A;  2EZV A;  2N49 A;  3PIP A;  4C3H H;  1RDP D;  4KI0 A;  2RVL A;  2B2U C;  2M00 A;  1CHQ D;  2B8F A;  4C56 C;  3J7Y W;  2NTT A;  4G7O C;  3HOU B;  1HCZ A;  5IGF A;  3GTJ H;  4UPA A;  4QUC A;  3D8G A;  3DWP A;  4HTH A;  2EPB A;  3I4L A;  3OIQ A;  1LLR D;  1PZI D;  4R4C A;  4X64 Q;  1HZC A;  1BBU A;  1ONL A;  1A3T A;  2RHS B;  1UEA B;  4MN3 A;  3GDE A;  3T56 B;  1WTX A;  1A63 A;  2OTL A;  1RL2 A;  3CPW A;  4WJ4 A;  3JAM E;  4DK3 C;  1WCM G;  1YNJ D;  3S1R B;  1MSG A;  1M8A A;  1JQY D;  2HDM A;  2ZXR A;  4BY7 H;  2PMZ E;  4A93 G;  5IP7 H;  1GUT A;  1JJC B;  2F52 A;  1TQO A;  4DR2 Q;  2IWH A;  4BY1 B;  5KIX A;  1X9N A;  3K5L A;  1EZ8 A;  5D65 A;  2WIN B;  4CJ1 B;  1GVP A;  1SYG A;  3GTG B;  2KEE A;  4UDU C;  3AQQ A;  1LTI D;  2E2J H;  3I8Z A;  2R7Z G;  1D5X C;  3DWA A;  3MFG A;  3I4N H;  2BDN A;  2CQO A;  3E0J A;  2XWJ B;  4DGZ A;  1JR0 D;  4M1U B;  4A3B G;  2EQS A;  2K14 A;  3SGI A;  3WWV A;  5HUR A;  4UP8 A;  2R61 A;  2CQA A;  1JB3 A;  1V9P A;  4F8M A;  3MAQ A;  2VQF L;  2IX1 A;  1IW7 C;  2K28 A;  4DUZ L;  4JV5 Q;  5ELD A;  5FJ8 H;  2L5T A;  4B9W A;  2NVY H;  1SYF A;  4A3J G;  1FGB D;  1LTA D;  1RTN A;  3K7A H;  4GS3 A;  4HCS A;  3HZX A;  3K80 C;  5LMU Q;  2F0Q A;  2F0K A;  3C1F A;  3E9H A;  3A8K E;  1VQE A;  1ET6 A;  2E2H H;  1I6H H;  4X64 L;  4QGU A;  1TU2 B;  4LF4 Q;  1Q12 A;  4APV A;  1WTQ A;  2RQX A;  4BWG B;  2ZTC A;  5EAY A;  3PV0 A;  3AEV A;  3SR1 A;  3I70 A;  2FJ2 A;  2FIN B;  3A8J E;  1SYE A;  4IJL A;  1BCP F;  1RD9 D;  5E7N A;  4P71 A;  1A2U A;  2NWG A;  2G9H D;  4MHE A;  1A0I A;  1Q7Y C;  3Q23 A;  4DR2 L;  4J6H A;  2IX0 A;  5EJW A;  4HJ5 A;  2NVQ B;  4RG1 A;  3J81 E;  2JE6 I;  4YHH L;  4P75 A;  2LFN A;  3I4M H;  3FHW A;  5K5P A;  2KUM A;  1G51 A;  1OXX K;  1UNS A;  1D7Q A;  1ML0 D;  4PMC A;  1K73 C;  2A69 C;  4DR6 Q;  1VQ8 A;  1QIL A;  4KY5 A;  2CH4 A;  3M85 A;  2F0N A;  1F9R A;  1GM5 A;  4DV6 L;  3L0O A;  3GTK H;  2PZT A;  4PMW A;  5EKL A;  3M4O H;  1JB7 A;  2L12 A;  3GD7 A;  4RGM A;  2EYF A;  3F2B A;  4DUY Q;  4HAE A;  3BDO A;  5J3B A;  4JV5 L;  2K5W A;  1VQH A;  1SN8 A;  3NBH A;  4R4T A;  5LMU L;  1BXT A;  2KCT A;  1KDC A;  3S17 H;  3GP7 A;  3P7J A;  3A55 A;  2L15 A;  3FVQ A;  1HXY D;  1PMR A;  1U4M A;  1I4H A;  2F0U A;  2PQA A;  3W3A A;  1N34 Q;  5CC4 A;  4LF4 L;  3CMA A;  2UXC Q;  3EBE A;  3KFU A;  2R7D A;  2K5H A;  1CZW A;  2GVA A;  5ELN A;  4ZUJ A;  3TSS A;  1H9K A;  4JI3 L;  1AZP A;  4OGQ C;  3KUP A;  1UAP A;  4XT3 B;  2B2W A;  2IHE A;  3GQB A;  4K5V A;  5ELB A;  2K52 A;  4C3J B;  4BBS G;  1YNX A;  1TWA B;  4DU9 A;  5FO8 B;  1TY0 A;  4QIW B;  3ULP A;  3CQZ H;  1X65 A;  1QJO A;  2SDF A;  1X54 A;  3A56 A;  2A5H A;  1PXU A;  3MVV A;  3PO3 G;  3Q22 A;  3FKI B;  1Q90 A;  4TVA B;  4LF9 Q;  2F03 A;  3TQY A;  4KN4 C;  5EKI A;  4LUZ A;  1T9H A;  4ZLT F;  3W1B A;  1E7Z A;  5HY6 A;  2OWO A;  1O7L A;  2B2T C;  1TXY A;  4DR6 L;  2R92 G;  2JA5 H;  2VW9 A;  2G9D A;  1JOQ A;  1JOK A;  3IKJ A;  1L0Y B;  3U9S A;  2K4K A;  1VQF A;  3D6C A;  2SNS A;  4DUY L;  5JOB A;  3IAY A;  4LMQ D;  3VR5 A;  3RNU A;  1QWY A;  2HT1 A;  1UEB A;  1SLJ A;  1CT1 D;  5JEA H;  1ENC A;  2XSC A;  4UHV A;  4RKL A;  3J80 L;  5C4X H;  2A68 D;  2E76 C;  3IRB A;  2EYJ A;  1H9S A;  4K6D A;  1B7Y B;  1N34 L;  4DNI A;  3S1M H;  1R4Q B;  2PNH A;  2RCF A;  2OCE A;  2YTX A;  4DA2 A;  2D9U A;  3NQI A;  4QMG A;  1SYD A;  3HOW B;  4A76 A;  2IHF A;  1VQC A;  2JA6 G;  4YCU A;  4LFC Q;  1EFW A;  2B39 A;  3QWN A;  4I7Z C;  1QNU A;  2I0Q A;  5E3F A;  1KLG D;  2EJF C;  1CKO A;  4JI0 Q;  4B08 A;  4QCL A;  1QZG A;  4LF9 L;  1A62 A;  1E0B A;  3PSI A;  1JWU D;  3G6J B;  3ER0 A;  1X55 A;  4A3I H;  4RHS A;  4ZKB B;  4IZ8 A;  4ZYS A;  1XJV A;  2K75 A;  3K0X A;  3OW2 A;  4HJ8 A;  1VS0 A;  2DY7 A;  2FMC A;  4JI4 Q;  3CCQ A;  3A8I E;  4DR1 Q;  4LF8 Q;  2EXD A;  3FPP A;  3R93 A;  2A73 B;  1A8V A;  1DYQ A;  1KAB A;  4KD4 A;  1TWG H;  4DFA A;  5M5X H;  3NBH B;  1Y1V G;  1IHZ A;  1TWC H;  2HHH Q;  5CV5 A;  1TVX A;  4J8Q A;  1I6V C;  4ULL A;  2Q2H A;  2EY6 A;  1EEI D;  2I07 B;  1AH9 A;  1J5E Q;  3NHH A;  2MO0 A;  3L2P A;  2C35 B;  1ZXT A;  4EGV A;  3IFD A;  2YU9 H;  5JJK A;  5ELC A;  4FNF A;  3I56 A;  1AE2 A;  1FR3 A;  5G3L D;  1BR9 A;  5HGQ A;  2CVR A;  4X3K A;  2PCF B;  3I91 A;  3SVM A;  4LJZ C;  1Y1W B;  4HJ7 A;  2ES2 A;  3GTM H;  4HJ9 A;  4ME5 A;  1KDB A;  3T1H L;  4P73 A;  4LFC L;  4ABN A;  3HFZ B;  4C1N I;  4EQO A;  2WB1 G;  3HP3 A;  3PIP 3;  4KKT A;  1MSH A;  1SMX A;  1VQI A;  1KQS A;  4JI0 L;  1STA A;  3U50 C;  2WB1 E;  1QE6 A;  1VQJ A;  1D1I A;  2B29 A;  2BCO A;  3ITP A;  4NXM Q;  5BN3 A;  2JN4 A;  2CCZ A;  1HZ9 A;  4XQN A;  1GHK A;  2F4V Q;  3HOY B;  1CQV A;  4OWX B;  5CBE E;  1H95 A;  5IYD G;  4DNT B;  2F0P A;  1AW7 A;  1GKH A;  4G4K A;  4GKJ Q;  3H15 A;  1MHW C;  4OEL B;  5IGG A;  4JI4 L;  1Z47 A;  4DR1 L;  4LF8 L;  5M5Y B;  5FLX E;  1JOO A;  3HOV H;  2DN8 A;  4LF5 Q;  4CJ0 B;  1T5X D;  1B9M A;  4HIK A;  1SNC A;  1YZ6 A;  4IPD A;  2HHH L;  4BA1 I;  4KV6 A;  1QCB D;  1HTL D;  1NAP A;  1ICW A;  4AQY L;  4HSP A;  1C0A A;  2ZTD A;  5M3M H;  3HS0 C;  2K50 A;  1EOV A;  1J5E L;  2MGS A;  4MNO A;  3STB D;  1XMO Q;  4A4I A;  4DR7 Q;  1VQM A;  3HOX B;  1Q1B A;  3KDF A;  3FMC A;  2A6H C;  1I4X A;  2Y0S B;  2R3Z A;  3TDQ A;  4GOP B;  4OEM B;  2KEN A;  1QUQ B;  2CWP A;  1JJG A;  1S3O A;  1NBW A;  1JE4 A;  1PTO D;  2ICE C;  3HOU H;  3K8A A;  1O78 A;  5T1I A;  3PGZ A;  1SE2 A;  3MXG A;  1A15 A;  1FGU A;  1GXD C;  4F87 A;  5BR8 Q;  1X3P A;  4IN3 A;  2I5L X;  4BY7 G;  3BVZ A;  1NMG A;  1EQQ A;  3GTQ H;  1QNK A;  5IP7 G;  4NXM L;  3TRE A;  4DR4 Q;  5COY A;  2F4V L;  4CKC A;  1CZG A;  1IL2 A;  3J80 c;  1ROD A;  3H6M A;  2KOL A;  1Q8I A;  3S1R H;  2K32 A;  3CAM A;  3KLS X;  3W5O A;  1TS4 A;  1VQD A;  4OWW B;  1L1O C;  4GKJ L;  4IPG A;  1LAB A;  1JC7 A;  1LAC A;  1SSO A;  5E1F A;  1GUW A;  3I4N G;  3AU7 A;  2PYK A;  3GTG H;  4LF5 L;  2YV5 A;  4R8N A;  1SMY C;  4PMB A;  4PZ7 A;  2A1A A;  2O2L D;  4MZ9 A;  1AZQ A;  3S2H B;  4CKB A;  1SXT A;  3PIO A;  1F2M A;  4A3M B;  1B8A A;  2XNA C;  1ASZ A;  3CC4 A;  2VNU D;  2PMZ B;  4OO1 G;  1ASY A;  1Y8O B;  1XMO L;  4KY7 A;  3BG3 A;  4R4O A;  4ZUI A;  1VDZ A;  2HCI A;  3T16 A;  4A93 B;  1FNW A;  3Q24 A;  4UAI A;  1STG A;  2MFI A;  1NMF A;  4GN4 B;  4ME3 A;  1K0R A;  3QO2 A;  4XQJ A;  4K5W A;  1XTC D;  1IKM A;  4V0B A;  1EYG A;  1JWM D;  4A3E B;  3T51 B;  4RA8 A;  4DV2 Q;  5BR8 L;  2L0C A;  2R7Z B;  1CQF A;  1LM0 A;  1DZ1 A;  2QEX A;  1L0W A;  3UDI A;  4NB3 A;  4DAY A;  1WFQ A;  1G6Z A;  1C4Q A;  4X66 Q;  1ZYR C;  3SK4 A;  3AMU A;  1DON A;  4KY6 A;  4XT1 B;  4UP9 A;  1FD7 D;  1LTS D;  5J39 A;  2PW5 A;  3C1E A;  2NVT H;  3MFY A;  3OSO A;  2LXK A;  4GOP C;  3RZD B;  3CC2 A;  2B63 B;  3JAM c;  1XNR Q;  1XPO A;  3FRP B;  2MQH A;  1VQ9 A;  3EA6 A;  1FJG Q;  3EVQ A;  1Q1E A;  1XPR A;  5H1S E;  1AEX A;  2O5I C;  3T4A C;  2NVQ H;  3EQL C;  5CYU A;  1EFI D;  4NDX A;  4DK6 C;  5C5L A;  2VZA A;  5JVG 3;  1WTH A;  2FXQ A;  3FEW X;  5T1G A;  1K83 B;  4XIG S;  4KHP Q;  5C44 B;  4JYA L;  3BYY B;  1K3R A;  3FPU B;  1NUC A;  1X3Q A;  1VQ5 A;  2RKS A;  5KND A;  1FL0 A;  1JE5 A;  5EQ0 A;  3X3N A;  3K58 A;  1PRT D;  2BE5 C;  1TWF B;  4RAU C;  3X3M A;  3TN2 A;  2Z4I A;  2VL6 A;  2DY8 A;  3S24 A;  1K3B C;  1VQ6 A;  3J80 E;  3GTL B;  5IYB H;  1G29 1;  2JQO A;  3LWU A;  3MZ5 A;  5CR3 A;  1M1K C;  1GHJ A;  5FLM H;  3KF6 A;  3O13 A;  1D5M C;  3PUV A;  5NUC A;  3K5M A;  4DK1 A;  2KHI A;  4MIU A;  3LX0 A;  3OHX C;  1EIH A;  4K8J A;  4IOA A;  1KXL A;  1KNE A;  3OWF A;  1YIT A;  4DV2 L;  4TRD A;  4O1N A;  2CHB D;  3ULJ A;  3ND8 A;  4Z9C B;  1GJX A;  2H1E A;  3DHQ A;  4GNX A;  5KEE A;  3HKZ G;  4K2K A;  2KCM A;  4X66 L;  3S16 H;  1TWH B;  3LWE A;  2N55 A;  2J0T D;  1I3Q B;  3IFT A;  4C3J H;  3F8T A;  1HA6 A;  4L8J A;  1TKW B;  5IGD A;  1TWA H;  2XTI A;  1F9P A;  3T53 B;  4YCW A;  3U4V A;  3CRK C;  1PH5 A;  1Q82 C;  3R8B A;  2K1B A;  3TP5 A;  4DPG A;  5IWA Q;  1N36 Q;  3DWQ A;  4OX9 L;  3BVG A;  1K0S A;  3FKI H;  1STH A;  4C2M B;  4KHP L;  4IFD I;  2WKC A;  1SNQ A;  2J4X A;  1X6O A;  2KJX A;  3J81 c;  2B2V A;  1PLF A;  1O80 A;  1HNZ Q;  2MPM A;  4K8I A;  2ICI A;  4O0A A;  1YNN D;  5ELF A;  5JEA G;  1T5E A;  5A2Q E;  2RDG A;  2R6G A;  1MBY A;  2NVX B;  5C4X G;  1CUK A;  2OT2 A;  3RD4 A;  1R9T B;  4UY8 C;  2PPB C;  2LMC B;  1X32 A;  2HQL A;  1HR0 Q;  2CKZ B;  1K8A C;  2OTJ A;  3NWT A;  4JOI C;  2QF7 A;  4P2C B;  5I6W A;  3L9A X;  1BOS A;  2L4N A;  1DJR D;  3B6Y A;  5IP9 G;  3I2Z A;  4CDF C;  1HH2 P;  4ZK9 B;  3A5U A;  2R92 B;  1CKM A;  1RF2 D;  4O42 A;  1LO5 D;  2RA4 A;  5GAH C;  4DAY B;  4FO2 A;  4JVZ A;  2BA1 A;  5A35 A;  1IBK Q;  2R7F A;  1EU4 A;  5FLX L;  4Y7N B;  4R4I A;  4TQU S;  3D31 A;  5IYC H;  1X3G A;  4A3I G;  2Z9H A;  1BDO A;  5JPN C;  4A3F B;  1RKN A;  3Q6S A;  4OON A;  1QOH A;  4U68 A;  3MC0 B;  5IWA L;  1N36 L;  2WAC A;  4IUN A;  4A3D B;  4FXG C;  2XIW A;  3JC6 6;  2B2Y C;  1BO0 A;  5LL6 X;  3UE1 A;  2Q8I B;  1X3E A;  4F7X A;  1S5D D;  2F0O A;  2A69 D;  1WI5 A;  4FDB A;  4P72 A;  2JA7 B;  1HNZ L;  1PTO F;  2MNA A;  3E0E A;  1B2T A;  1H9M A;  1SE8 A;  3WDN A;  2RSO A; 
#chains in the Genus database with same CATH homology
 4RGT A;  4XTC S;  1WTW A;  1OO9 B;  4KKS A;  2QKI C;  5BN4 A;  1MI2 A;  1ILP A;  4KN7 C;  1PFB A;  2EVB A;  3P20 A;  1IKL A;  3QIA A;  3TP8 A;  1BF4 A;  4C3I G;  1L0X B;  4IUT A;  3H0G B;  3OW7 A;  2E2D C;  3TZU A;  2JA8 B;  1ET9 A;  4EVO A;  2SOB A;  5EPJ A;  2F0F A;  1Y1V B;  3S2D B;  4K6L A;  3S1Q B;  2R93 B;  3M3Y B;  2NN6 H;  2OEO A;  3OMG A;  1HHV A;  3K5N A;  3GV6 A;  2L55 A;  3URY A;  4PQX A;  1SE3 A;  2WB1 B;  2F0I A;  3H94 A;  1XWE A;  4AYB B;  4IUR A;  1LTB D;  5M5W B;  2EE1 A;  3PMF A;  2PQE A;  2F0M A;  5C4J B;  2PNR C;  1EQT A;  1LT5 D;  3VYS A;  1CM9 A;  1AN8 A;  2DNC A;  4K2L A;  3WOF A;  3PIO 3;  1D5Z C;  2EJM A;  1Y69 U;  4XYO A;  5K36 H;  5KYL A;  4R8I A;  2LS0 1;  2F0S A;  1A3V A;  1WTV A;  2ZXP A;  2EY2 A;  3R2I A;  4DNR B;  1Y8P B;  5IGB A;  3QOJ A;  2FHT A;  5C3X A;  2LKV A;  4JK1 C;  2AUJ D;  3PUZ A;  3TZD A;  3RMH A;  2Z1C A;  1CK1 A;  3NUC A;  1EEF D;  1Y8N B;  1PZK D;  5C0X I;  1I4R A;  4L6T B;  1EU3 A;  4S3S A;  3D6W A;  3V96 A;  3GTO B;  4IUP A;  3DXJ C;  2MP1 A;  1SDF A;  2X69 A;  3ZYY X;  5CMD A;  1CTM A;  1E2Z A;  5C3E B;  1CI3 M;  1O7Y A;  1V1P A;  5BN5 A;  3K5O A;  5E4W C;  1KLU D;  3M7N A;  3AB9 A;  1DCZ A;  1ZKO A;  2I46 A;  1STB A;  5I2X A;  4IUV A;  3D4W A;  3M4Y A;  2KHS A;  4IFD H;  1OXU A;  3V05 A;  4N9P A;  1ZEQ X;  3J7A F;  1U4P A;  2K5D A;  4RCO A;  3RUZ A;  2NVY B;  5FKA C;  4QF4 A;  5A2Q L;  2FFK B;  1VMP A;  2FMM A;  4FF3 A;  2A68 C;  3NTK A;  3BZD B;  4EQP A;  3NTI A;  2PZU A;  2EY1 A;  2K33 A;  5C3W A;  1HQM C;  5ISR A;  4CKE A;  4KJN A;  3WOE A;  2JYO A;  2NUC A;  1C48 A;  1A2T A;  1RJT A;  3IL8 A;  2VXW A;  3GV3 A;  5M9O A;  2A6H D;  4KKU A;  4OL7 A;  3N52 A;  2SNM A;  2N88 A;  4GZY C;  1II3 A;  1WTP A;  1FYC A;  5D3D A;  1QB5 D;  3BDC A;  1ENF A;  2MJ8 A;  3A7L A;  4XXE A;  1M4V A;  2KCC A;  3KLR A;  1TII D;  1HA5 A;  2B2U A;  2ZT9 C;  3MXP A;  4ILW A;  1NR4 A;  4XYQ A;  3M4O B;  1F2Z A;  5IOC A;  3OIP A;  4C3J G;  1PTO B;  3D4D A;  3R3O A;  4C3H G;  4I65 A;  3TBI B;  3E5S A;  2EYL A;  1FNV A;  3DUZ A;  1B1Z A;  1H9S B;  4A3G B;  3H91 A;  1IYU A;  3I72 A;  4U67 3;  3DEP A;  5J22 A;  1EOT A;  3VYU A;  2Z8L A;  2KCN A;  4HCE A;  4NMZ A;  1GOZ A;  3W2D A;  4H44 C;  3HG9 A;  3H09 A;  1XXG A;  4X3S A;  5I9O A;  3DMU A;  1TR5 A;  2D2C C;  2HCC A;  1PFM A;  3RZO B;  2RDH A;  3NSW A;  2B2W C;  2D62 A;  2J7Z A;  3GTP B;  3J7A V;  1BCP D;  3NP8 A;  5CV6 A;  5JVH 3;  2JXM B;  1ENA A;  4IQZ A;  3HRZ C;  5C4X B;  4HN7 A;  5D3I B;  3S15 B;  2EYM A;  1RCV D;  1WCM B;  1WD0 A;  5CV8 A;  2EYH A;  5DM7 3;  1IL8 A;  2K03 A;  1CFM A;  3QOL A;  2NN6 I;  2JEA I;  2MHV A;  2F3W A;  2XRS D;  1PTO C;  3MXN A;  3BS1 A;  3VYR A;  3VR4 A;  5LL6 S;  4CBV A;  4BS9 A;  5EPL A;  4KK7 A;  3MXU A;  1OXT A;  4G57 A;  4DXF A;  1SYC A;  4X3U A;  3VR3 A;  2A6E C;  4EQN A;  4LAA A;  2M9V A;  4HR7 B;  4A3B B;  3QG1 A;  1PDQ A;  3A54 A;  1PRT B;  1EWH A;  3TP6 A;  2E2I B;  2KVM A;  2HQE A;  4ID6 A;  3K57 A;  1DOK A;  4A3J B;  5ELE A;  5IT9 L;  1Z6H A;  1D2B A;  1I4P A;  4NW2 A;  5C0X H;  5FO7 B;  5COR A;  4C1N K;  3R2T A;  3S14 B;  2EDG A;  4OIJ A;  5IGE A;  2PO4 A;  2QDB A;  2NN6 G;  2QIL A;  4FF4 A;  3PO2 B;  1B50 A;  5KGU A;  2NYZ D;  1BBX C;  1B3A A;  3QJY A;  1HPC A;  3SXH A;  1H9R A;  1JWS D;  1V1O A;  2K05 A;  2AQ2 B;  1F2L A;  4C3I B;  3HGB A;  2TSS A;  2B2T A;  3QB3 A;  1BQQ T;  4KTA A;  2L9H A;  1EYD A;  3KK7 A;  1I4G A;  1TT2 A;  5AFW A;  3VR2 A;  2NTS A;  3ONA B;  3KF8 A;  5KNB A;  3MEH A;  3PUX A;  2XN9 C;  3VA7 A;  1Q3L A;  2CW0 C;  1XX8 A;  4ZRZ A;  1F9Q A;  5I2Y A;  1HQR D;  2NBF A;  3VYT A;  4YIJ A;  5CV4 A;  5G3L F;  1SFO B;  3P1H A;  3MTS A;  2K01 A;  3NK9 A;  2V4D A;  2SEB D;  3SE0 A;  1PRT C;  5JPM C;  2NB0 A;  1IW7 D;  3DEO A;  5D14 A;  4A3K B;  4BBS B;  1EY8 A;  2KED A;  5EGT A;  1F77 A;  3PO3 B;  3V2T A;  3EJI A;  5E4X A;  1HUN A;  1U4L A;  1UUP A;  4G7Z C;  4WRD A;  2RBM A;  2F0W A;  2VUM B;  4CGY B;  1ESF A;  2WII B;  3GTQ B;  4QUF A;  4RFB A;  5IOD A;  2HDL A;  1EY9 A;  4IFD G;  1EY5 A;  3K6O A;  2EOT A;  1EWC A;  2F3V A;  3HEJ A;  1WVL A;  3ERQ A;  4F88 A;  4Q0F A;  2O4X A;  4M8A A;  4FP5 D;  4BBR B;  4H7B A;  2B8G A;  2RDF A;  1YNN C;  1HUM A;  2JA6 B;  1STY A;  2XWB B;  3P75 A;  4HSV A;  4OIK A;  4XDX A;  1EZ6 A;  4RWS C;  4RGN A;  5J1Z A;  4HMJ A;  1F9S A;  4OO1 H;  1STE A;  1EY7 A;  1YNJ C;  3T13 A;  1AFP A;  4H13 C;  2X6G A;  5JJZ A;  3S1N B;  5KNC A;  4Q5V A;  2BA0 A;  2QCP X;  1ESR A;  1J9O A;  1G2S A;  4HMI A;  3C46 A;  1I50 B;  1GUG A;  2NVT B;  3OWE B;  2KEC A;  1LT6 D;  3F2U A;  1A6X A;  1EY6 A;  4NKL A;  4TKO B;  2JSO A;  1WTO A;  1LTG D;  4FXK C;  3ERO A;  5HGT A;  1DXM A;  2ZXO A;  5CBA E;  1HTP A;  3UI2 A;  3OPO A;  4BA2 I;  3G7L A;  1LTR D;  1OXS C;  1DOM A;  3SK5 A;  2GA4 B;  4X3T A;  5CV9 A;  1S4Z A;  2AQ3 B;  1PTO H;  2H4O A;  2F0E A;  3PUY A;  3HOZ B;  2C5C A;  2WP8 J;  5CGK A;  1WD1 A;  5C4Z A;  4NP5 A;  1U4R A;  3OMC A;  3KBG A;  1DD2 A;  1K8O A;  3NQT A;  2IW3 A;  3S16 B;  3SHL A;  5JEA J;  5C6A A;  3NXW A;  3NE5 B;  2ENB A;  1G91 A;  5KYI A;  4RHR A;  3CRL C;  2OXP A;  4C3H B;  2IPK D;  4B9X A;  1PRT F;  1SBB B;  2RSN A;  2K5Q A;  5EPK A;  4ZAI A;  4E6I A;  2X6L A;  5IT9 E;  1TY2 A;  3K59 A;  4FF1 A;  4L63 B;  5DNF A;  3GTJ B;  2YYZ A;  1W6K A;  4KJO A;  1KDA A;  1QG7 A;  1BNZ A;  3ND9 A;  1S5C D;  3D4R A;  5KRU A;  2QEJ C;  4IFD J;  1SNM A;  4DF7 A;  4WFN 3;  4BY7 B;  4CJ2 C;  3I3C A;  2DNE A;  1EL0 A;  1DOL A;  1ILQ A;  2EJG C;  4KD3 A;  3VA5 A;  3E6Z X;  2B2V C;  3C2P A;  2E2J B;  5FK9 C;  3I4N B;  3NPP A;  1JCK B;  1I4Q A;  1BUV T;  3MA2 B;  4RGO S;  4RCN A;  3RLF A;  2D5D A;  2AWN A;  3MHB A;  2L11 A;  4FF2 A;  2IJ0 A;  1HFG A;  1EYA A;  1EY4 A;  5I4D A;  1MD2 D;  4DK0 A;  3K7A B;  1DM0 B;  1HFN A;  5C0X G;  2M2L A;  1CHP D;  2MUY A;  3VR6 A;  4FXD A;  2E2H B;  2F1M A;  1GUO A;  3U9O A;  1I6H B;  4OHJ A;  2F0D A;  1VMC A;  1D6E C;  2IL8 A;  5I6Y A;  2XVS A;  5FOB B;  4TSS A;  5CV7 A;  1W6J A;  2F4I A;  3BDL A;  2NZ1 D;  1FNU A;  3CKI B;  1OXV A;  4PNY A;  4KMU C;  1B44 D;  2E75 C;  1SNP A;  1VF5 C;  3JAM L;  4J1M A;  1NSN S;  1RTO A;  5DM6 3;  1LV9 A;  3CHB D;  3I4M B;  2C9O A;  2EYP A;  4IUU A;  1VF7 A;  1F2Y A;  3GTK B;  1KNA A;  2KQ3 A;  2O5J C;  3OOC A;  2F0V A;  1LT3 D;  4WJW A;  1TS3 A;  3KLS A;  2XRQ D;  1A3U A;  2WKD A;  3L7Z C;  3S17 B;  4ZQ3 A;  4R9W A;  2EY5 A;  1VCI A;  1S5E D;  4DXG A;  2Z4H A;  1LTT D;  4DAV A;  1SMY D;  2AQ1 B;  2OF1 A;  3N6R A;  1EY0 A;  1WTR A;  4RKB A;  4K14 A;  1MGS A;  4K5X A;  2LY7 A;  5LHY 1;  1G2T A;  3HKZ B;  3CQZ B;  1V1P B;  1G8Z D;  5DAU A;  1BCP B;  4DN4 M;  3I90 A;  3PUW A;  4ODG A;  1Z7T A;  4PV1 C;  4WOR A;  1NCV A;  4OO1 I;  1B9N A;  2BOS A;  1PZJ D;  2JEB I;  3D3R A;  3NBI A;  2F0T A;  1PYW D;  1S5B D;  5EKK A;  3J81 L;  2Q8R E;  2JA5 B;  2B2Y A;  5IIF A;  4FVM A;  1SAP A;  2K04 A;  3BVM A;  3BYT B;  2A6E D;  1ZYR D;  1E2V A;  2IT1 A;  3SDZ A;  3L3O C;  1NR2 A;  3KBX A;  4DAP A;  2WAQ B;  3K0Y A;  4ZKC B;  3Q0A A;  1JIC A;  3A7A B;  3S1M B;  1AP0 A;  1EYC A;  2PW7 A;  1SE4 A;  1KAA A;  2AUK A;  3NTH A;  3MWY W;  3EFX D;  2L1B A;  3SEB A;  1KTK A;  1J8I A;  1EQV A;  2BE5 D;  5C0X J;  3LNN A;  2EXZ A;  2A74 C;  3TME A;  2ID0 A;  1B4O A;  5FO9 B;  4H0L C;  4RH6 A;  4A3I B;  3CU7 A;  5JAV A;  4G7H C;  4IUQ A;  2K6A A;  1O7Z A;  1LT4 D;  3NWS A;  1TS5 A;  5C4H A;  3H3V C;  5I9P A;  1H9J A;  4JBW A;  2AWO A;  1PFN A;  2K7V A;  2VB3 X;  1B53 A;  2JP1 A;  1V8Q A;  1CA6 A;  1GUN A;  3TP7 A;  1CA5 A;  1SJH D;  3FDT A;  1BCP C;  1TWG B;  4HED A;  2KA7 A;  1E2W A;  5M5X B;  1TWC B;  2WV6 D;  1C8C A;  2PZW A;  2Q8T A;  1RHP A;  2CW0 D;  3C3L A;  2F0G A;  3GO5 A;  4IAL A;  2YU9 B;  1U9R A;  2IX3 A;  2F0J A;  2HUG A;  3I73 A;  2TMP A;  4N9T A;  5C5M A;  1K8M A;  3GTM B;  1XYI A;  3DM1 A;  2F0L A;  5IGC A;  1SNO A;  4XQQ A;  1S5F D;  4V19 0;  1IYV A;  5F2D A;  1SYB A;  3M7G A;  5EBD A;  5M3F B;  5TSS A;  1TS2 A;  2VB2 X;  1SND A;  3S9W A;  1EIG A;  1GUS A;  1STN A;  5K36 G;  4KHZ A;  2EYO A;  1SEB D;  2F0H A;  4KHV A;  3SK6 A;  1V43 A;  3HOV B;  1SJE D;  4FYD A;  4LK1 C;  3SK8 A;  1D1K A;  5DEH A;  4CHT B;  1JOR A;  1R4P B;  5M3M B;  2E74 C;  4QB4 A;  1HRJ A;  2BDO A;  5EBC A;  2EZV A;  1RDP D;  4KI0 A;  2RVL A;  2B2U C;  2M00 A;  1CHQ D;  2B8F A;  4C56 C;  3J7Y W;  2NTT A;  4G7O C;  3HOU B;  1HCZ A;  5IGF A;  4QUC A;  3D8G A;  3DWP A;  4HTH A;  2EPB A;  3I4L A;  3OIQ A;  1LLR D;  1PZI D;  1ONL A;  1A3T A;  1UEA B;  4MN3 A;  3T56 B;  1WTX A;  3JAM E;  1YNJ D;  3S1R B;  1MSG A;  1M8A A;  1JQY D;  2HDM A;  2ZXR A;  1GUT A;  1TQO A;  2IWH A;  4BY1 B;  5KIX A;  3K5L A;  1EZ8 A;  5D65 A;  2WIN B;  4CJ1 B;  1SYG A;  3GTG B;  2KEE A;  4UDU C;  1LTI D;  3I8Z A;  1D5X C;  3DWA A;  3MFG A;  2BDN A;  3E0J A;  2XWJ B;  4DGZ A;  1JR0 D;  4M1U B;  5HUR A;  2R61 A;  2CQA A;  1JB3 A;  4F8M A;  3MAQ A;  2IX1 A;  1IW7 C;  2K28 A;  5ELD A;  2L5T A;  4B9W A;  1SYF A;  1FGB D;  1LTA D;  1RTN A;  4HCS A;  3HZX A;  2F0Q A;  2F0K A;  3C1F A;  3A8K E;  1ET6 A;  1TU2 B;  1Q12 A;  1WTQ A;  2RQX A;  4BWG B;  3PV0 A;  3SR1 A;  3I70 A;  2FJ2 A;  2FIN B;  3A8J E;  1SYE A;  1BCP F;  1RD9 D;  1A2U A;  2NWG A;  2G9H D;  4MHE A;  3Q23 A;  4J6H A;  2IX0 A;  5EJW A;  2NVQ B;  3J81 E;  2JE6 I;  2LFN A;  5K5P A;  2KUM A;  1UNS A;  1OXX K;  1ML0 D;  4PMC A;  2A69 C;  1QIL A;  4KY5 A;  3M85 A;  2F0N A;  1F9R A;  2PZT A;  4PMW A;  5EKL A;  2L12 A;  3GD7 A;  4RGM A;  2EYF A;  4HAE A;  3BDO A;  2K5W A;  3NBH A;  1BXT A;  1KDC A;  3GP7 A;  3P7J A;  3A55 A;  3FVQ A;  1HXY D;  1PMR A;  1U4M A;  1I4H A;  2F0U A;  3W3A A;  5CC4 A;  4ZUJ A;  1CZW A;  3TSS A;  1H9K A;  1AZP A;  4OGQ C;  3KUP A;  1UAP A;  4XT3 B;  2B2W A;  3GQB A;  4K5V A;  5ELB A;  4C3J B;  1TWA B;  4DU9 A;  5FO8 B;  1TY0 A;  4QIW B;  1QJO A;  2SDF A;  3A56 A;  2A5H A;  1PXU A;  3MVV A;  3Q22 A;  3FKI B;  1Q90 A;  2F03 A;  4KN4 C;  5EKI A;  4ZLT F;  1O7L A;  2B2T C;  2G9D A;  1JOQ A;  1JOK A;  3IKJ A;  1L0Y B;  3U9S A;  3D6C A;  2SNS A;  5JOB A;  3IAY A;  4LMQ D;  3VR5 A;  1QWY A;  1CT1 D;  5JEA H;  1ENC A;  2XSC A;  4RKL A;  3J80 L;  2A68 D;  2E76 C;  2EYJ A;  1H9S A;  4K6D A;  1R4Q B;  4DA2 A;  2D9U A;  3NQI A;  4QMG A;  1SYD A;  3HOW B;  2B39 A;  3QWN A;  4I7Z C;  1QNU A;  5E3F A;  1KLG D;  2EJF C;  4B08 A;  4QCL A;  1E0B A;  1JWU D;  3G6J B;  4RHS A;  4ZKB B;  4IZ8 A;  4ZYS A;  2FMC A;  2DY7 A;  3A8I E;  3FPP A;  3R93 A;  2A73 B;  1DYQ A;  1KAB A;  4KD4 A;  4DFA A;  1IHZ A;  5CV5 A;  1TVX A;  4J8Q A;  1I6V C;  4ULL A;  2EY6 A;  1EEI D;  2I07 B;  3NHH A;  4EGV A;  1ZXT A;  3IFD A;  5ELC A;  4FNF A;  5G3L D;  1FR3 A;  1BR9 A;  2CVR A;  4X3K A;  2PCF B;  3I91 A;  3SVM A;  4LJZ C;  1Y1W B;  4ME5 A;  1KDB A;  4ABN A;  4C1N I;  4EQO A;  3HP3 A;  3PIP 3;  4KKT A;  1MSH A;  1STA A;  1QE6 A;  2BCO A;  1D1I A;  3ITP A;  5BN3 A;  4XQN A;  1GHK A;  3HOY B;  1CQV A;  5CBE E;  4DNT B;  2F0P A;  1AW7 A;  4G4K A;  5IGG A;  1Z47 A;  5M5Y B;  5FLX E;  1JOO A;  2DN8 A;  4CJ0 B;  1T5X D;  1B9M A;  1SNC A;  4BA1 I;  4KV6 A;  1QCB D;  1HTL D;  1NAP A;  1ICW A;  4HSP A;  3HS0 C;  2MGS A;  3HOX B;  1Q1B A;  3FMC A;  2A6H C;  1I4X A;  2Y0S B;  2R3Z A;  3TDQ A;  1JE4 A;  1PTO D;  2ICE C;  1O78 A;  5T1I A;  1SE2 A;  3MXG A;  1A15 A;  1GXD C;  4F87 A;  1X3P A;  4IN3 A;  3BVZ A;  1QNK A;  5COY A;  4CKC A;  1CZG A;  1ROD A;  3H6M A;  2KOL A;  1Q8I A;  2K32 A;  3KLS X;  1TS4 A;  1LAB A;  1JC7 A;  1LAC A;  1SSO A;  5E1F A;  1GUW A;  3AU7 A;  2PYK A;  4R8N A;  1SMY C;  4PMB A;  2O2L D;  1AZQ A;  3S2H B;  4CKB A;  1SXT A;  1F2M A;  4A3M B;  2XNA C;  2VNU D;  2PMZ B;  4OO1 G;  1Y8O B;  4KY7 A;  3BG3 A;  4ZUI A;  1VDZ A;  2HCI A;  3T16 A;  4A93 B;  1FNW A;  3Q24 A;  4UAI A;  1STG A;  3QO2 A;  4XQJ A;  4K5W A;  1XTC D;  1IKM A;  4V0B A;  1JWM D;  4A3E B;  3T51 B;  4RA8 A;  2L0C A;  2R7Z B;  1CQF A;  1DZ1 A;  4DAY A;  1G6Z A;  1C4Q A;  1ZYR C;  3SK4 A;  3AMU A;  1DON A;  4KY6 A;  4XT1 B;  1FD7 D;  1LTS D;  5J39 A;  2PW5 A;  3C1E A;  3MFY A;  3OSO A;  3RZD B;  2B63 B;  3FRP B;  3EA6 A;  3EVQ A;  1Q1E A;  1AEX A;  2O5I C;  3T4A C;  3EQL C;  5CYU A;  1EFI D;  4NDX A;  5C5L A;  5JVG 3;  3FEW X;  5T1G A;  1K83 B;  4XIG S;  5C44 B;  3BYY B;  3FPU B;  1NUC A;  1X3Q A;  2RKS A;  5KND A;  5EQ0 A;  3X3N A;  3K58 A;  1PRT D;  2BE5 C;  1TWF B;  4RAU C;  3X3M A;  3TN2 A;  2Z4I A;  2DY8 A;  3J80 E;  3GTL B;  1G29 1;  3LWU A;  3MZ5 A;  5CR3 A;  1GHJ A;  3O13 A;  3PUV A;  1D5M C;  5NUC A;  3K5M A;  4DK1 A;  4MIU A;  3LX0 A;  3OHX C;  1EIH A;  4K8J A;  1KNE A;  3OWF A;  4TRD A;  4O1N A;  2CHB D;  3ND8 A;  4Z9C B;  1GJX A;  2H1E A;  3DHQ A;  5KEE A;  4K2K A;  1TWH B;  3LWE A;  2N55 A;  2J0T D;  1I3Q B;  3IFT A;  1HA6 A;  4L8J A;  1TKW B;  5IGD A;  1F9P A;  3T53 B;  3CRK C;  3R8B A;  2K1B A;  3TP5 A;  3DWQ A;  3BVG A;  1STH A;  4C2M B;  4IFD I;  2WKC A;  1SNQ A;  2J4X A;  2KJX A;  2B2V A;  1PLF A;  1O80 A;  2MPM A;  4K8I A;  2ICI A;  1YNN D;  5ELF A;  5JEA G;  1T5E A;  5A2Q E;  2RDG A;  2R6G A;  1MBY A;  2NVX B;  3RD4 A;  2OT2 A;  1R9T B;  2PPB C;  2LMC B;  1X32 A;  3NWT A;  2QF7 A;  4P2C B;  5I6W A;  3L9A X;  1BOS A;  2L4N A;  1DJR D;  4ZK9 B;  2R92 B;  4O42 A;  1RF2 D;  1LO5 D;  2RA4 A;  4FO2 A;  2BA1 A;  5A35 A;  1EU4 A;  5FLX L;  4Y7N B;  4TQU S;  3D31 A;  1BDO A;  5JPN C;  4A3F B;  1RKN A;  3Q6S A;  1QOH A;  4U68 A;  3MC0 B;  2WAC A;  4IUN A;  4A3D B;  4FXG C;  2XIW A;  2B2Y C;  1BO0 A;  5LL6 X;  2Q8I B;  4F7X A;  1S5D D;  2F0O A;  2A69 D;  2JA7 B;  1PTO F;  1B2T A;  1H9M A;  3WDN A;  2RSO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...