3Q6SA

The crystal structure of the heterochromatin protein 1 beta chromoshadow domain complexed with a peptide from shugoshin 1
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
66
structure length
66
Chain Sequence
KPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell cycle
molecule keywords Chromobox protein homolog 1
publication title Mitotic centromeric targeting of HP1 and its binding to Sgo1 are dispensable for sister-chromatid cohesion in human cells.
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 66
sequence length 66
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01393 Chromo_shadow Chromo shadow domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3q6sA00
1EOTA 1M8AA 2Q8RE 1U4RA 2L1BA 3F2UA 1PDQA 1PFNA 2EPBA 2MP1A 5D14A 3DEPA 5CORA 1EIGA 1SDFA 2N55A 2H1EA 3GV3A 4XDXA 1SSOA 3MTSA 1BF4A 2RSNA 4U68A 4QUCA 4ZKBB 2B2VA 4IUTA 1QE6A 3IFDA 1ZXTA 4IUVA 1XYIA 1HHVA 1AZPA 1EQTA 3HP3A 3TN2A 4DN4M 2R3ZA 1DONA 3MWYW 2HUGA 4RWSC 1DOLA 4XT1B 4O42A 1PFBA 4OIJA 5EPLA 1WVLA 1EIHA 2L9HA 4X3SA 1WTXA 3N52A 4UAIA 1MI2A 4HSVA 1RHPA 3I3CA 3TZDA 2MGSA 3DM1A 5T1IA 1G6ZA 4X3UA 1F2LA 2B2VC 2NZ1D 1AP0A 3UI2A 1NR2A 1MSGA 2DY7A 5EPKA 1QNKA 2BDNA 3I90A 1CA6A 1HFNA 1VMCA 3FDTA 4QUFA 1WTRA 4R8IA 2JP1A 2CVRA 2X69A 1DOKA 1F9RA 1F9SA 1U4PA 1ML0D 3G7LA 1BNZA 2B2TC 2JYOA 5CBAE 2HDMA 5E4WC 2Q8TA 1O7ZA 2MJ8A 2MPMA 5E4XA 2K03A 2KEDA 4LMQD 2EE1A 1BBXC 3R93A 1IKLA 3P7JA 2NWGA 2NYZD 1CM9A 1TVXA 1KNAA 1F9PA 1AZQA 1DOMA 2K04A 4R9WA 1HFGA 2M2LA 3I8ZA 3IL8A 1WD0A 1RJTA 1RTNA 1U4LA 1B4OA 4IUUA 1XX8A 1MSHA 2VXWA 1JICA 5EPJA 1PLFA 1VMPA 2K28A 2L12A 1HUNA 2FINB 4MN3A 3I91A 1PFMA 1WD1A 1LV9A 2B2UA 2K1BA 2EOTA 3LWEA 4ZLTF 1B50A 1WTWA 5CBEE 2HCIA 2K01A 1RODA 4IUPA 1X32A 2J7ZA 4HEDA 1C8CA 3ONAB 1HUMA 2HCCA 5EJWA 3KBXA 1B3AA 1SAPA 4RA8A 4X3KA 4IURA 1E0BA 2FFKB 4RAUC 2B2YA 1NCVA 5JJZA 4HAEA 1S4ZA 2B2UC 1BO0A 3Q6SA 1WTQA 2RVLA 2XIWA 3QO2A 1JE4A 2SDFA 2FHTA 5AFWA 1CA5A 3H91A 1IL8A 4NW2A 5COYA 2X6LA 4ZAIA 3FPUB 3GV6A 4XT3B 5EKIA 1A15A 1EL0A 5DNFA 1F9QA 1KNEA 1RTOA 5T1GA 2L4NA 1WTPA 2B2YC 2B2WA 1X3PA 2IL8A 4ZKCB 2HDLA 1G91A 2N88A 2K05A 1WTOA 2D9UA 2KOLA 1ILPA 1DZ1A 1QG7A 2KVMA 4OIKA 4X3TA 2KECA 1ICWA 1NAPA 1X3QA 2L11A 5EQ0A 1ESRA 2FJ2A 1B53A 4MHEA 1J9OA 3KUPA 4CJ0B 1Q3LA 2RA4A 1WTVA 3DEOA 2B2WC 4CJ2C 1G2SA 1O7YA 4HCSA 2RSOA 5CMDA 1U4MA 2FMMA 1MGSA 2B2TA 1NR4A 1O80A 2KUMA 4ZK9B 4CJ1B 2KEEA 1J8IA 2DY8A 1IKMA 1HRJA 2X6GA 5D65A 1G2TA 1ILQA 4IUQA 1GUWA 3D6WA 3SVMA 1B2TA 1HA6A
chains in the Genus database with same CATH superfamily
2EYPA 4DUZQ 3EA6A 3RZDH 2OXPA 1SJHD 3H0GH 1Q7YC 3S1MH 1VQ9A 1S40A 1HQRD 2EJMA 4IUVA 3CCQA 2KA7A 5BN5A 4BS9A 2VUMB 1D5XC 3HP3A 3MWYW 1K73C 3Q8DA 4J6HA 1STAA 3DXJC 3STBC 4H7BA 2C35B 1WTXA 3BVGA 4A93G 1Z9FA 2NVYB 2JJQA 4LFCL 3DM1A 4XXEA 4JVZA 2GVBA 1VQFA 2JA8G 5J39A 5EPKA 1YVCA 4C3JB 1Y8OB 1KD1C 2F0JA 1LTID 3NBHB 4EX5A 1IBKQ 2RDFA 1KXLA 3T53B 2UUAQ 5A2QE 5IYDH 4HSPA 2NBFA 1HZCA 3KDFA 3GTPB 3EQLC 4GOPA 1B7YB 4A3FG 1EQQA 3I4MH 1Y1VG 1HNWQ 1BUVT 4IUUA 3HRZC 1QUQB 3OPOA 5KYLA 3CMAA 1EZ6A 3RD4A 1N36L 1PXUA 1TWFB 3G6JB 4HJ5A 1SE3A 4FF4A 4HEDA 3GTQH 1SLJA 2ZTDA 3S9WA 3HOXH 2JA7B 2UXBQ 3A7AB 3ZYYX 1AEXA 4HJ7A 1ZYRD 3DWPA 1RD9D 3URYA 3OMGA 4HJ9A 1XNQL 1GUGA 3RUZA 2K52A 1X3EA 4HMJA 2F4IA 2L4NA 5CC4A 1WTPA 1PTOD 3SXHA 1K8GA 4QMGA 2QW7A 3AU7A 4PV1C 1N9WA 1TS2A 2WAQE 3VA7A 3BJUA 1J9OA 3B6YA 3QR8A 5KYIA 4IFDG 1ENCA 1LABA 1EZ8A 1MKHA 2ES2A 3W3AA 1VQLA 4BY7H 1K3RA 1EEFD 1KABA 4JI3Q 3TEHB 4P74A 1PH8A 4LK1C 1EYGA 1JWSD 1R9TH 1GUSA 1G6PA 1QB5D 3CCSA 4Y7NB 3MTSA 5BR8L 1Q86C 3HOWG 1KTKA 3K7AH 4RG1A 1SMYC 1HHVA 4X6AH 2F0PA 1EY6A 2F0UA 3ULJA 2CH4A 2H5XA 2AWOA 1I4GA 2R93B 3TP7A 2Q2HA 2IPKD 2F4VQ 1AP0A 5DAUA 1NR2A 3J81c 2VNUD 2R7ZB 1SYGA 4JC0A 2OCEA 2D62A 2DNEA 3A54A 1A2TA 4JOIC 2X69A 3PO3G 1JR0D 1ML0D 4MTNA 3G7LA 1E3PA 1IW7C 4YHHL 4KHPL 3RN2A 4KD4A 3KF6B 1KC8C 3TDQA 2EVBA 2D5DA 4ZYSA 4RCOA 2A6HD 3Q24A 1DOMA 3D31A 3VDYA 2IJ0A 3I8ZA 5JEAJ 5IGGA 2MNAA 4DNTB 2A8VA 4R4OA 2F0IA 1PRTB 4C1NI 5I6YA 4DR7L 2EYOA 5KNDA 3S2DH 1JB7A 1PYSB 3LWEA 3MFGA 1CUKA 2UUBL 4NMZA 4LWCA 2E2IB 1X32A 4WRDA 3ERSX 4JI1Q 4A3CH 3PIP3 3I56A 4DV1Q 2B2YA 1TR5A 4LFAL 1SNQA 1HH2P 4XQNA 4GNXB 1EUJA 1IBML 5COYA 2X6LA 2KCCA 1FYCA 1JOOA 1E2VA 4AYBB 3S17B 1P16A 4HMIA 2IL8A 4BBRB 1G91A 4L8JA 3T1YL 3GP7A 1QG7A 3HOXG 2NVYH 3OIQA 2KVMA 1NAPA 4NDXA 5EQ0A 1W2BA 3ER0A 3BZKA 5I4DA 1YHQA 5EKLA 1FD7D 4C3JH 1KIXA 1VF7A 2TSSA 2B63B 1NR4A 2F0LA 1SXTA 2DY8A 1EYDA 2VB2X 3K5LA 1B2TA 3VR6A 1SJED 2K5VA 3U4VA 1U4RA 2UXCL 2AKWB 1PFNA 1U0LA 3J7ZC 3GTPH 1R4PB 5CV4A 3T13A 3LWUA 3BDCA 5IGFA 1HQMC 1BF4A 2RDGA 2R6GA 2MUYA 1OXTA 3C46A 1I4QA 5LMNL 3OWFA 1AZPA 4H0LC 3X3NA 1H9KA 4A3JH 3NEMA 2OTLA 4UP7A 1JQYD 2EYHA 3PO2B 1JWUD 1TWFH 1SR3A 4DPGA 3S1NB 3KYHC 3UI2A 4EQNA 3ND8A 1QNKA 3FPPA 3R2IA 1TY0A 4QUFA 3CCRA 2B39A 3J7A5 5KNBA 1VF5C 1DOKA 1OO9B 4E6IA 2FMCA 2KHIA 2WKCA 2A6ED 1YJWA 4J1MA 2UUCL 2HDMA 5E4WC 1I6VC 3JAMi 4YWKA 4LF6Q 1GXDC 2UXDL 1EEID 2WAQB 3R93A 1IKLA 4DK1A 1SBBB 1KRTA 1QOHA 2ZT9C 1XMQL 1WD0A 1PA6A 4PZ8A 4K6DA 4ZRZA 3H3VI 4KI0A 4N9TA 1ASYA 2RCFA 2IX3A 3VR4A 3A7LA 4IPGA 5CV5A 4JV5L 1X3FA 3LGJA 1CFMA 4A93B 3HOYH 1LTLA 3S16B 3DLLA 2JA8B 2AWNA 1XTDA 4RAUC 1TS5A 1CSQA 2BA1A 1WTQA 3OTOQ 1AE2A 4DA2A 4ZAIA 5J22A 1XNRL 2A68C 4UPAA 3L3OC 1L0XB 2I46A 4A3MB 4A3FB 1N34Q 1Y1VB 1WJJA 1EFID 3OOCA 1D1IA 3A0JA 4DV0L 2MFIA 2A19A 2C5CA 2SNSA 4FXGC 5K36G 1ESRA 1F77A 2R7ZH 2F0MA 1KAWA 3NP8A 2EY5A 2ID0A 5F2DA 4KHVA 1BBWA 2K7VA 3HOVG 1ILQA 1B8AA 3EIVA 1VQBA 3BZCA 1XJVA 2RHQB 4OO1G 4JI8L 4C2MB 4Y52H 3MHBA 4B08A 1QJOA 3TBIB 1VQDA 1C0AA 4B3RQ 1EQVA 3GO5A 2B2VA 4YCVA 3M4YA 4TSSA 1DONA 5TSSA 4A3KG 4M8AA 4RCNA 1Y8NB 1VS0A 2CQOA 3OW7A 2ALYB 1TXYA 2NN6H 4K6LA 4DAYA 5JPMC 2O5JC 4HSVA 3PF5A 3I70A 1M1KC 2E2IH 1STGA 3DUZA 1U9RA 1IBLL 5C4ZA 1CQVA 1FNUA 1V1QA 1VQNA 4JPBW 3NWSA 3CKIB 1DD2A 4DR5Q 1OXUA 2CWAA 5GAEC 3QG1A 4A3JG 3NXWA 3S17H 2M2LA 1RTNA 3HOWB 2NUCA 1KLUD 1BCPF 3UDFA 1XX8A 3M4QA 5ELBA 4DV2Q 2L12A 2FINB 4X62L 2CFMA 1YNJD 1UEAB 4C3HG 3UE1A 3K6OA 3P20A 3TP8A 1BQQT 2B63H 2N3SA 5IT9E 1D8LA 1F2YA 5LMUL 3VR5A 1IYUA 2AUKA 2K5DA 3QIAA 1RIPA 3PO3B 4RGTA 4DR2L 3HOZH 3S1MB 1VQHA 4BXXG 4NW2A 3T51B 1PVOA 1G8ZD 5CR3A 4O2DA 1F9QA 5JVG3 1RTOA 4BY1G 3CRKC 3AFQA 3FHWA 1NBWA 4K8JA 5EGTA 1YNND 3HOYG 2PI2E 1B1ZA 2AMCB 1XPOA 1K8AC 4FF1A 4DAMA 4DKAC 2QDBA 2I5LX 3HZXA 3VR2A 1SYDA 3ZJYC 1STBA 3KUPA 1QVCA 4DAPA 2PMZB 3CC7A 5I2YA 1IYJB 2K14A 3AQQA 2D2CC 3C1FA 1PYWD 4HIOA 3GD7A 2EYMA 2KUMA 2KEEA 3M85A 1HRJA 5GADC 4WJ4A 3D4DA 2F0KA 1IW7D 1HA6A 1EU3A 1HPCA 1Q90A 3A74A 2MP1A 3MVVA 4DNIA 4PNYA 5G3LD 4ZKBB 1YHAA 1QE6A 2ZTEA 2YTXA 4CDCC 2E2JB 4ALPA 4LF4Q 3CCMA 2RQXA 1BXTA 1LT6D 5C4JB 1K8OA 4X66Q 2UU9Q 1F2MA 4UAIA 3GTQB 3HOXB 4A93H 1KLGD 3R3OA 2MGSA 4Q0FA 3PUZA 5M3FH 4DV7Q 1T9HA 4IO9A 3CCJA 4ABNA 4DV6Q 4IPDA 1LM0A 4DV3L 3BG3A 4P75A 4IZ8A 3E5SA 4QL5A 1U4PA 2EQSA 1FNWA 3H6MA 1J5EQ 5BN4A 2A69D 1X56A 1WYDA 5CYUA 3J80i 4X64L 5AJ3Q 3TQYA 2NWGA 2IX0A 2Y0SE 1X9NA 4A3MH 4B3TQ 2NN6G 4DR3Q 4A3FH 4RHRA 1SNOA 1Y1VH 3S24A 1Q1BA 2Z0SA 2EXZA 3K0YA 1L1OC 3G4SA 3AMUA 2F0GA 2EOTA 4GKKQ 3HOUH 1VQCA 1QVFA 4A3IG 2QILA 4ZQ3A 5C0XH 3JAML 1QZGA 1EY4A 4OWXB 1B9MA 4LFBQ 2ZTCA 3RR5A 3CQZB 4DV5Q 3M3YH 2D0OA 2ZXPA 1QZHA 2Z4IA 4IUNA 4A76A 3UE0A 5GROA 2L0CA 2Z8LA 3CHBD 2L15A 4C1NK 4QY7A 1VQPA 1EQRA 1V8QA 1IBKL 2Q2IA 1I50H 2PYKA 4KD3A 4IFDI 3U50C 2UUAL 2QF7A 4IFDH 1PH4A 2JK8A 2SNMA 3LNNA 2XSCA 5I2XA 4FF2A 1KDCA 1G51A 5DM73 1MJEA 3HOZG 3MXUA 4G4KA 3OYYA 3SK6A 3QB3A 3SVMA 1N32Q 4RGMA 2YTVA 2PQAB 4LNQA 4GKJQ 1YHBA 4ZUIA 2WIIB 4DR1L 1CT1D 3DWQA 2G9HD 1DGSA 2RSNA 2V1CC 3NQTA 3HOWH 4GN5A 1HZAA 1SNCA 3JC66 4F7XA 3TS0A 4JI5Q 3GTGB 2UXBL 4OXPA 5BN3A 3A5ZB 1PH1A 2YV5A 3MXPA 1XMOQ 2NTSA 4KMUC 4JI4Q 2B8FA 1D7QA 3PIO3 1SMXA 1V1PB 2SOBA 1UE1A 3KF8A 3CPWA 3JAME 2I5HA 2DGYA 2D0PA 3PO3H 2B2TC 5CBAE 3HOVB 2KHSA 4R8NA 3PV0A 4LMQD 5M9OA 1TY2A 3RZOB 5C3WA 3K8AA 5M3FG 4FXDA 4EQOA 1Z7TA 1OXSC 2RF4A 3BYYB 4J8QA 4A3KB 4ZLTF 5CBEE 3NWTA 1CKNB 1VQ5A 2K5WA 1HA5A 4X3KA 2VS1A 2BOSA 3RNUA 1ASZA 5GQOA 2R92G 1YBYA 3PUWA 1M4VA 5JJZA 4A3MG 3Q6SA 4OHJA 4G7OC 4LF5L 2RVLA 2XIWA 1B9NA 4H02A 4A3GG 3GV6A 4GLVB 1LT3D 3SDZA 5JJIA 3H15A 4A3JB 2ENBA 2E2JH 4A3LG 2B2WA 3S2HB 3GTOB 2F4VL 5CV7A 4K5VA 2N88A 5IT9c 4P72A 5C4JH 2KOLA 1K83B 1DZ1A 4OGQC 3HOUG 4A3BG 3I4NH 2XRSD 2FJ2A 5C0XG 4JI7Q 3NHHA 1RL2A 4CJ0B 4C3HB 5JJKA 3EFXD 2VQFQ 4R4QA 1V1PA 4XTCS 2NZHA 3ERQA 3MZ5A 2ATWA 5ELOA 5FKAC 1N8RC 2A73B 2X6GA 1KL9A 1T5XD 2Z9HA 3G6EA 4JCVE 1PH7A 3AYHB 2B3GA 2JA6G 4NXMQ 2IHFA 5ELDA 3SK4A 4OL7A 5D14A 2RKSA 1SDFA 4CHTB 2BA0A 4XDXA 4HJAA 2G5DA 1K8MA 4FP5D 3RLOA 1BCPC 4CGYB 2K33A 4BY1B 1S5DD 4HTHA 1EIHA 4JI1L 4B3SL 5IIFA 3HOYB 1H9SB 2HHHQ 3N52A 4DV1L 1JB3A 3CAMA 1HZ9A 2AHOB 1PTOF 2QA4A 4X3UA 3M9BA 5IGCA 3NBHA 2P5ZX 3UDXA 1XTCD 1CKMA 1NE3A 1A0IA 3F1ZA 4R8IA 2LKVA 4RGNA 3QJYA 4IOCA 1MBYA 5ELNA 2MPMA 3CQZH 2K03A 4LFCQ 5IP9G 4A3EG 1PMRA 4H13C 1QUQA 1VQJA 1RJTA 4V190 5CGKA 4IQZA 2CCZA 2MQHA 1BDOA 1Y14B 1VMPA 2PZTA 1PRTD 2BH2A 1Q8KA 2B2UA 4J15A 2WKDA 3QWNA 4IPHA 1EFWA 1FJGQ 5E1FA 1E1OA 2DJGC 1B3AA 1HXYD 2WP8J 4ILWA 2PNRC 3MXNB 4FDBA 4PMWA 3M4PA 1CHQD 1D5ZC 3J80L 3FVQA 1V43A 3QO2A 2JEAI 3WOEA 1MD2D 4HIMA 1I4XA 3T4AC 4RMFA 3RMHA 4GS3A 5T1GA 3I4LA 1T5EA 4DV4Q 1D6EC 1JC7A 3GTGH 2D9UA 1ILPA 3GTLB 2F3WA 3KLSX 2Q2TA 1OXVA 1H9SA 3NSWA 5IGEA 5LL6X 4MHEA 5K36H 4WFN3 4AQYL 3DWAA 1XNQQ 5HGTA 4HCSA 5CMDA 4LF6L 1MGSA 5D3IB 4ZCKA 4A3IB 3NK9A 3HOVH 5E3FA 5JAVA 2BE5C 3BDOA 4OO1I 1Y69U 3CC2A 2F3IA 4OO1H 1K3BC 3RZOH 1JOQA 4WJWA 1SSOA 2EXDA 5C3XA 1I3QH 1IZ6A 3I4NG 3IFDA 4MZ9A 1HNXL 5EBDA 1WVLA 1CK1A 4A3KH 1K0SA 2JE6I 4K2KA 1YI2A 3EVQA 3HG9A 1TWHB 2PO4A 3I4OA 1I94Q 2JA5H 4LF9Q 2WACA 3OTOL 2BDNA 1IL2A 4Q5VA 3W2DA 3EJIA 1ET9A 3HOZB 1XPRA 3OIPA 1F9RA 2AQ1B 3J80E 2OQKA 3KF6A 3MXNA 1UNSA 2PPBC 4G7HC 5E4XA 1N34L 4JI6Q 4M1UB 1B44D 2GVAA 2JXMB 2CW0D 4JI0Q 1KNAA 1DCZA 2VW9A 1L1OB 1A3UA 1CSPA 3PMFA 3L2PA 1AZQA 3GTOH 3S2HH 2VQEQ 1Y1WG 2HQEA 1Q46A 2IHEA 1K83H 3CU7A 3KK7A 4FXKC 3JAMc 5EPJA 4A3DG 1STNA 3KFUA 3I2ZA 1E24A 1UUPA 1SE8A 5NUCA 5IWAQ 3R8BA 1LTAD 1PFMA 3UDIA 3M7GA 4HN7A 4N8X1 4GOPC 3J7AF 4C3HH 5JPNC 1E2WA 1NMFA 4I7AA 4DAVA 3TS2A 5FJ8H 1SEBD 4LF8L 2OQ0A 4GNXA 4B3RL 4KHZA 1V9PA 4KJNA 3PUVA 3H91A 1K9MC 2IY5B 4BXXH 3FPUB 2F0TA 4HIDA 1BKBA 4BY1H 3FKIH 4QF4A 3K7UC 2K05A 4KN7C 3G71A 2ZJRA 4KLKA 1PZKD 5M3FB 5KGUA 4N9PA 4OELB 2EJGC 3BS1A 2EJFC 1Q3LA 1WTVA 4K0KQ 1O80A 5JEAH 3OW2A 5FOBB 3C2PA 3IKJA 5D65A 3RN5A 1ZKOA 4IJLA 1IYVA 2R92B 2OT2A 4POGA 2F03A 4CDDC 4DV2L 2IW3A 5I9PA 1VQ6A 4A3GB 3NELA 1YJ9A 1X54A 3STBD 1ZXTA 2WV6D 1Y8PB 3BVMA 2KQ3A 2HUGA 2HIVA 1PTOH 4JBWA 1TT2A 3CP0A 1MI2A 1A3VA 4NXNL 2CWPA 5HURA 3HOUB 4A3BB 1G6ZA 5CV8A 3PQIA 1HNZL 4QIWE 2LXJA 3I90A 1HFNA 2O2LD 3M3YB 3SK8A 3EN2A 4OWWB 2M9VA 2Q8TA 3A5UA 2JA6B 4QCLA 3OSOA 4ULLA 2F0HA 2NN6I 1STEA 3M4OB 1Q1EA 1PH2A 5M3MH 2HQLA 2YU9B 1I50B 2ICIA 2JA5G 3GTLH 1MSHA 3P75A 2UXDQ 1JOKA 2OF1A 4UHVA 5E7NA 2J7ZA 2WB1G 4HIKA 3PIPA 4RH6A 5K5PA 1QILA 3T16A 2EY1A 1KDBA 2CQAA 3D8GA 3WDNA 4NPSA 3TREA 4LJZC 4A3IH 4DR6L 4KY7A 2EZVA 4HAEA 2PZWA 3FMCA 3PSIA 1BO0A 1VQ8A 4LF4L 1A8VA 4BBSG 1JE4A 1GUNA 4GLAC 4X66L 3S14B 4YCWA 2DN8A 3VYSA 4DV7L 2B2YC 3DMUA 1X3PA 3GQBA 3R2TA 4ZKCB 4A3EB 4DV6L 4P71A 4DU9A 2Y0SG 1UEBA 4R4TA 2Z6KA 1TWHH 1PTOC 3MFYA 1HTLD 1X3QA 5ELFA 4DXGA 5FJ8G 4GN3B 2K4KA 4KK7A 2BCOA 3AEVA 1LTSD 2RA4A 3CCLA 1S5ED 1J5EL 2B2TA 1AE3A 4KY5A 5I6WA 5AJ3L 1IKMA 2VZAA 1CZGA 3BVZA 3MA2B 4DR3L 4UP9A 1BCPB 2Q8RE 3I72A 1SMYD 3F2UA 3FKIG 1PDQA 3KBGA 2E2HB 1SN8A 1GO3E 2OWOA 1UE6A 2J4XA 1I6HB 4U68A 1XYIA 1UE5A 1SYBA 2KENA 4GKKL 4IFDJ 4X3SA 3F2BA 3SK5A 4LF7Q 4FF3A 1A63A 1PH3A 5JEAG 2KBNA 3HKZG 4JI8Q 2E5LQ 5T1IA 4GZYC 1O78A 4JW0A 4LFBL 3U9SA 1CA6A 1PFSA 1FVIA 4XIGS 3ITPA 3U4ZA 2ZM6Q 4G7ZC 1VQAA 1EIFA 2HD3A 1G291 2K5QA 4X65L 1VQKA 3E6ZX 4OX9Q 1PYBA 5DEHA 4B3MQ 1E2ZA 2BH8A 2EE1A 1HCZA 5HGQA 3CCUA 3P1HA 4C56C 3HEJA 1QVGA 4GN4B 1IBLQ 2WB1E 4R9WA 5EKKA 2N78A 4KKTA 1W3SA 1U5KA 3I4NB 1DM0B 2ICEC 4K8IA 4JYAQ 1WOCA 2A6HC 2K5HA 4XYOA 3A8JE 2K32A 5G3LF 3T1HL 1D1KA 3J80c 1WD1A 2RBMA 1XWEA 5IE8A 1YNXA 1L0WA 3TZUA 1TWCB 4RHSA 3ONAB 2HCCA 1KQSA 4QQBX 1I5FA 1A3TA 1E0BA 1K28A 1NTGA 1S5CD 3NPPA 2PW5A 1JJCB 5H1SE 2R92H 3C1EA 3FP9A 3GTKH 1LLRD 2YTYA 5AFWA 3KLRA 5M3MG 2PCFB 2I07B 4JI5L 3HGBA 1OXXK 3VYUA 1VQ4A 4A3GH 2EYJA 1XMOL 1FGBD 4LUOA 4JI4L 3K59A 2WINB 4A3LH 4IALA 2A74C 4LUZA 1Y1WB 1N33Q 1VQOA 1SROA 3ULPA 2L5TA 4DUZL 1HJPA 2KECA 1TQOA 4A3DB 4A3BH 5C0XI 4L5SA 1SYFA 2N49A 2JN4A 4S3SA 2LSSA 5A35A 1PHJA 3D0FA 3A55A 2I0QA 1FNVA 1EU4A 4UY8C 1NUCA 4FYDA 5C3EG 2GN5A 3V2TA 1AW7A 1M8AA 4G57A 3K58A 2L1BA 3FRPB 2ZJPA 2JA6H 1Q82C 3HKZE 3M4OH 2MHVA 3GTMB 3TSSA 1CI3M 2YU9H 1SYEA 1RCVD 2LY7A 3VR3A 1V1OA 3EBEA 1I4HA 5FLXL 5EAYA 2K6AA 1RF2D 1RDPD 3LX0A 4OIJA 1HR0Q 4JOIA 1PZJD 2KCNA 2IWHA 2FXQA 5FK9C 3I3CA 1GHJA 4OWTB 1C7YA 1S3OA 1JMCA 2NZ1D 2B2VC 2CHBD 3RLNA 4V0BA 1Q12A 1WCMH 3PF4A 1HNWL 1EY7A 2JP1A 5CV6A 4YIJA 1TWGB 1J6QA 1JT8A 1GKHA 4MTKA 5IY0A 3KJOA 5KEEA 5IYCH 3S14H 2XTIA 1YZ6A 4QGUA 2A5HA 2NYZD 2QGQA 3E0EA 5IP9H 2NVQB 5KIXA 3KDFB 5A2QL 1LTRD 4A3EH 1TKWB 3IL8A 3U58A 4JI7L 2IX1A 2PZUA 4GOPB 1B4OA 3Q23A 2ZXOA 3UDGA 2NB0A 5J3BA 1SFOH 1LV9A 1OTCA 4X64Q 1RODA 1LO5D 1W6JA 5EJWA 4NXML 4DR4Q 1SAPA 3CC4A 4IURA 5M5WH 2FFKB 2A68D 3PCOB 1YJNA 3V96A 1JJGA 3H09A 1EOVA 1I3QB 3F2DA 1ZEQX 1WTHA 4B9WA 2E2HH 2HHHL 1I6HH 1EL0A 3WWVA 1HR0W 2E8GA 5FLXE 2HIXA 4C3IH 2LXKA 4JI3L 3G48A 2F0DA 4DNRB 4EQ5A 4PZ6A 2JA5B 4EGVA 2ZJQA 4FO2A 1BVSA 1EY5A 1TU2B 2M00A 4KJOA 2AQ3B 1G2SA 2XN9C 3TP6A 1U4MA 3NTKA 3CXCA 1S5FD 2WB1B 4ZK9B 1TS3A 1VQIA 3E3XA 2K50A 3SEBA 2EY6A 4AYBE 2PQAA 4DUYQ 1EOTA 4IPCA 3Q0AA 3M7NA 4BBSB 2B8GA 1EIGA 2I5MX 1NJIC 1D5MC 4RKBA 3ND9A 1ENFA 2XWBB 4AH6A 3BZDB 4K5XA 1EQTA 4RWSC 4YY3Q 4XT1B 1FJGL 5JJLA 2O5IC 4FVMA 3VYTA 4APVA 2NVXB 2J0TD 2Y0SB 4BWGB 4K14A 1STHA 1TWCH 5C5LA 4DR1Q 2PW7A 3KOJA 3V05A 1VMCA 3FDTA 4IN3A 3E9IA 3IFTA 2PI2A 5C5MA 1QNUA 2F52A 1BNZA 4JI2Q 1O7ZA 2MJ8A 4DV4L 2E74C 1BBXC 5C44H 2F0OA 1CKOA 3FKIB 1YITA 1D2BA 2R7DA 1F9PA 1YIJA 5IGBA 2EIFA 3TMEA 1Y1WH 3QOJA 5IODA 1A2UA 5IYBH 3NBIA 1HUNA 4A3DH 1EY9A 1DYQA 1WCMG 1CKNA 2C9OA 4Z9CB 4XQJA 4HR7B 2GA4B 1UWVA 2HCIA 2K01A 3HKZB 3CF5A 3N6RA 1YNJC 3HFZB 3KBXA 4TQUS 4RA8A 1LTGD 1JORA 5IYCG 5HY6A 4YWMA 1NCVA 1VQ7A 1JWMD 3PUYA 1VDZA 3K5OA 3K5MA 5ELCA 3GTMH 3CCEA 2F3VA 1KAAA 1PTOB 1X65A 1I94L 2HDLA 3SE0A 1NY4A 4LF9L 5IOCA 1JJ2A 4JG2A 5FO8B 2PNHA 4MIUA 3AFPA 4LF5Q 1FL0A 3A8IE 1E7ZA 5M5XH 1YNNC 3L0OA 4RKLA 3E0JA 5C4XG 1KRSA 3S1RB 4CBVA 3X3MA 3BU2A 4JI6L 1MHWC 1PRTF 1N36Q 1QWYA 3RLFA 1TWGH 4P73A 4NP5A 3C3LA 4JI0L 1SE4A 1EWHA 3SHLA 1GUWA 2VQEL 3H0GG 4C3IG 2H4OA 2N8NA 2Q2UA 2NVQH 1SNPA 1C4QA 1C48A 5M3MB 1ONLA 4GLXA 5IWAL 2KHJA 4QUCA 3J81i 3QOLA 2NVTB 1BOSA 4O42A 1PFBA 3S15B 2L9HA 1FR3A 2JEBI 3NENA 4H44C 3PIOA 1M90C 3PGZA 1XPUA 4EVOA 1EWCA 2AUJD 1F9SA 1S72A 3U9OA 4KKUA 2R61A 4B3SQ 1II3A 4U673 5IYDG 1AN8A 1I4PA 5C3EB 1HTPA 2A69C 3HKSA 5DLQE 3I4MG 3CCVA 1U4LA 4K0KL 2JSOA 3CRLC 2L55A 4F87A 1Q81C 4KKSA 2VUMH 3CW2C 5FO9B 3D3RA 1EY8A 5BR8Q 3J7YW 3A56A 4ID6A 4AIMA 2R7FA 1BR9A 1F2ZA 1B50A 1C9OA 1NMGA 1DXMA 1HUMA 1STYA 5DM63 1B3QA 1UE7A 3E9HA 4XQQA 4PQXA 5JOBA 1CQFA 5C44G 2XNAC 4DK3C 1S5BD 2XRQD 1EYCA 4O1NA 1CA5A 2CKZB 3L7ZC 4BBSH 1SNMA 3K5NA 3ICEA 5IYBG 2HT1A 2QDLA 4UP8A 2VL6A 2QKIC 1L2FA 4YHHQ 4KHPQ 2MO0A 1WTOA 2NVXH 2ZXRA 3VA5A 1YEZA 3OMCA 4WORA 3NQIA 4L5RC 1ICWA 2B2WC 1ENAA 4DR7Q 2FMMA 4BY7G 2Q8IB 2JA7H 4KTAA 5FLXc 2UUBQ 3D6WA 5CV9A 4CKEA 1PH5A 5M5YB 4PZ7A 2EPBA 4PMCA 2F0FA 2XWJB 4AQYQ 1GUTA 3AB9A 4LFAQ 1CZWA 2PMZE 4ME5A 4CKBA 4DN4M 1W6KA 1H9JA 1LTTD 1DOLA 5EPLA 4DR5L 1IBMQ 1AFPA 3MXGA 1X55A 2F0EA 4I65A 2G9DA 2XGTA 4P2CB 1TS4A 3CD6A 5LL6S 4DAYB 1F2LA 3MEHA 3OHXC 4K2LA 3H3VH 4NKLA 3VYRA 3T1YQ 1GJXA 1WTRA 5KRUA 3GTKB 1L0YB 4R4IA 1HNXQ 4ZUJA 2EDGA 1LACA 3ULLA 1L1OA 2LFNA 2OEOA 3P7JA 5ELEA 4IOAA 4NB3A 2QCPX 2K04A 2QEJC 1VCIA 3K81C 4L5QA 4Y7NH 2NTTA 2UXCQ 3BYTB 1NSNS 1PLFA 5LHY1 4DK0A 2E76C 3H94A 3I91A 4QJFA 3K80C 1IHZA 2NZOA 5LMNQ 4XYQA 1GD7A 2ASBA 3S1RH 2R93H 1WFQA 5KNCA 4A3CG 1B70B 3SGIA 1NNXA 1KHIA 1XXGA 2VY3A 5I9OA 1A6XA 1KDAA 1MIUA 2B2UC 5IT9L 3S1QB 4QB4A 1A62A 1GUOA 2EYLA 2LS01 2YYZA 4OONA 2F0VA 4LF7L 2VUMG 4JBKA 1GHKA 3T56B 2KCMA 3NE5B 2E2DC 4TRDA 2UUCQ 5GAGC 3NTIA 2E5LL 2NVTH 4LF8Q 3HS0C 3TRZA 3S15H 2VB3X 1PH6A 3W1GA 4DXFA 2ZM6L 2L11A 1XMQQ 3GTJB 1TWAB 1B53A 2JQOA 4I7ZC 4OX9L 4C3JG 1R4QB 1WCMB 5C4HA 4B3ML 4CJ2C 2RSOA 3H3VC 5FLMH 1H95A 3MC0B 4JV5Q 4O0AA 2QEXA 1EWIA 4IUQA 2PQEA 1ZYRC 4POFA 3KJPA 2UU9L 3KLWA 3W1BA 5C3EH 1H9RA 1SE2A 4JYAL 1BCPD 5CORA 1WI5A 2H1EA 3D4RA 4L6TB 1VQEA 3GDEA 1SYCA 2DNCA 4B9XA 2K75A 4IUTA 4BA1I 3I73A 3IAYA 2R3ZA 4MNOA 1K0RA 5C0XJ 1SFOB 1TIID 5IP7H 1XNRQ 5LMNW 4BBRH 3DM3A 5ISRA 5GAHC 1RHPA 3A8KE 3TZDA 3J7AV 4ODGA 1ICFB 2KJXA 2JA7G 5M5WB 1IXRA 2DY7A 1MSGA 4B3TL 5C4XB 1LT5D 4DV0Q 4KN4C 2F0NA 2BDOA 4ME3A 4K5WA 4EQPA 4R1JA 1LT4D 3RZDB 2RDHA 2KEDA 4NXNQ 3EROA 1N33L 3H0GB 4C3IB 3J81L 5FO7B 1CM9A 1TVXA 3IRBA 1HNZQ 4RGOS 2XVSA 1HFGA 3O13A 1CHPD 2DUDA 4F8MA 4JBJA 4A4IA 2VXWA 4CDEC 4MN3A 4OEMB 3K57A 1AH9A 4DV5L 4RFBA 1WTWA 4BA2I 4DGZA 3PO2H 1EY0A 1PRTC 1C8CA 3S1NH 1PV4A 1O7LA 1LYLA 5EBCA 3D4WA 1S4ZA 1I4RA 5M5YH 3MAQA 4JBMA 1JCKB 1PH9A 4UDUC 1HR0L 5IGDA 4XT3B 1A15A 1GM5A 1GOZA 5DNFA 2RCNA 3NUCA 4GNXC 4A75A 3I4MB 4KY6A 1EYAA 3CPFA 4DR6Q 2WFWA 2R93G 1N32L 1VQGA 4OIKA 4X3TA 5JVH3 1Q8IA 4GKJL 1SNDA 2R7ZG 4WJ3M 2TMPA 4FNFA 1E22A 1O7YA 2F0QA 1J8IA 2BE5D 4X62Q 3DHQA 3S16H 1EIYB 1G2TA 2JA8H 5C44B 5J1ZA 5C6AA 4QIWB 3J81E 1LTBD 2LMCB 5LMUQ 1QCBD 3DEPA 4YWLA 2N55A 3GV3A 1PZID 4L63B 2SEBD 3WOFA 2E75C 3TN2A 4DR2Q 4PG3A 2OTJA 4PMBA 1LUZA 1ESFA 2A1AA 4YCUA 3L9AX 4DR4L 4LAAA 1BBUA 4TKOB 5FLMG 4TVAB 1X6OA 4N8FA 2F0WA 1MJCA 2V4DA 4CKCA 4KV6A 3J81j 2RHSB 4DFAA 4BY7B 2CVRA 1DJRD 3KF8B 3PUXA 3MEFA 2Z6BA 1RKNA 2JYOA 4DK6C 4HJ8A 3S1QH 1X3GA 3F2CA 3BDLA 4LUVA 1R9TB 3OWEB 4AYBG 5IP7G 2F1MA 4BBRG 3KLSA 4C2MH 3K7AB 3SR1A 4R4CA 1JE5A 2DJFC 2CW0C 5L37A 4X65Q 1JICA 1CTMA 5M5XB 2K28A 5D3DA 3GTJH 1HZBA 2EY2A 1TWAH 1O7IA 2KCTA 2K1BA 4DUYL 4IUPA 3TP5A 2B63G 3I7FA 1SRUA 3CMEA 2AQ2B 2B29A 1FGUA 1GVPA 2A6EC 2MO1A 4DV3Q 1E1TA 3T1HQ 2SDFA 2FHTA 4IJHA 4YY3L 2EYFA 1IL8A 3D6CA 3K0XA 5EKIA 1P8LA 4DF7A 2VQFL 3Q22A 1KNEA 2O4XA 1VQMA 1UAPA 1Z6HA 2IT1A 2Z1CA 3PO2G 3F8TA 2CH4W 4HCEA 1H9MA 2JA9A 4L5TA 4F88A 3S2DB 3W5OA 4JI2L 1ET6A 3DEOA 2K5NA 5C4XH 4CJ1B 4CDFC 2Z6KC 4LW1A 4JK1C 3FEWX 3NTHA 2F0SA 1Z47A 2WAQG 3I55A 2Z4HA
chains in the Genus database with same CATH topology
2EYPA 3EA6A 2OXPA 1SJHD 1HQRD 2EJMA 4IUVA 2VUMB 2KA7A 5BN5A 4BS9A 1D5XC 3HP3A 3MWYW 4J6HA 1STAA 3DXJC 4H7BA 1WTXA 3BVGA 2NVYB 3DM1A 4XXEA 5J39A 5EPKA 4C3JB 1Y8OB 2F0JA 1LTID 2RDFA 3T53B 5A2QE 4HSPA 2NBFA 3GTPB 3EQLC 1BUVT 4IUUA 3HRZC 3OPOA 5KYLA 1EZ6A 3RD4A 1PXUA 1TWFB 3G6JB 1SE3A 4FF4A 4HEDA 3S9WA 2JA7B 3A7AB 3ZYYX 1AEXA 1ZYRD 3DWPA 1RD9D 3URYA 3OMGA 1GUGA 3RUZA 4HMJA 2F4IA 2L4NA 5CC4A 1WTPA 1PTOD 3SXHA 4QMGA 3AU7A 4PV1C 1TS2A 3VA7A 1J9OA 5KYIA 4IFDG 1ENCA 1LABA 1EZ8A 3W3AA 1EEFD 1KABA 4LK1C 1JWSD 1GUSA 1QB5D 4Y7NB 3MTSA 1KTKA 1SMYC 1HHVA 2F0PA 1EY6A 2F0UA 2AWOA 1I4GA 2R93B 3TP7A 2IPKD 1AP0A 5DAUA 1NR2A 2VNUD 2R7ZB 1SYGA 2D62A 2DNEA 3A54A 1A2TA 2X69A 1JR0D 1ML0D 3G7LA 1IW7C 4KD4A 3TDQA 2EVBA 2D5DA 4ZYSA 4RCOA 2A6HD 3Q24A 1DOMA 3D31A 2IJ0A 3I8ZA 5JEAJ 5IGGA 4DNTB 2F0IA 1PRTB 5I6YA 4C1NI 2EYOA 5KNDA 3LWEA 3MFGA 4NMZA 2E2IB 1X32A 4WRDA 3PIP3 2B2YA 1TR5A 1SNQA 4XQNA 5COYA 2X6LA 2KCCA 1FYCA 1JOOA 1E2VA 4AYBB 3S17B 4HMIA 2IL8A 4BBRB 1G91A 4L8JA 3GP7A 1QG7A 3OIQA 2KVMA 1NAPA 4NDXA 5EQ0A 5I4DA 5EKLA 1FD7D 1VF7A 2TSSA 2B63B 1NR4A 2F0LA 1SXTA 2DY8A 1EYDA 2VB2X 3K5LA 1B2TA 3VR6A 1SJED 1U4RA 1PFNA 5CV4A 3T13A 1R4PB 3LWUA 3BDCA 5IGFA 1HQMC 1BF4A 2RDGA 2R6GA 2MUYA 1OXTA 3C46A 1I4QA 1AZPA 3OWFA 4H0LC 3X3NA 1H9KA 1JQYD 2EYHA 3PO2B 1JWUD 3S1NB 3UI2A 4EQNA 3ND8A 1QNKA 3FPPA 3R2IA 1TY0A 4QUFA 2B39A 5KNBA 1VF5C 1DOKA 1OO9B 4E6IA 2FMCA 2WKCA 2A6ED 4J1MA 2HDMA 5E4WC 1I6VC 1GXDC 1EEID 2WAQB 3R93A 1IKLA 4DK1A 1SBBB 1QOHA 2ZT9C 1WD0A 4ZRZA 4K6DA 4KI0A 4N9TA 2IX3A 3VR4A 3A7LA 5CV5A 1CFMA 4A93B 3S16B 2JA8B 2AWNA 4RAUC 1TS5A 2BA1A 1WTQA 4DA2A 4ZAIA 5J22A 2A68C 3L3OC 1L0XB 2I46A 4A3MB 4A3FB 1Y1VB 1EFID 3OOCA 1D1IA 2C5CA 2SNSA 4FXGC 5K36G 1ESRA 1F77A 2F0MA 3NP8A 2EY5A 2ID0A 5F2DA 4KHVA 2K7VA 1ILQA 4OO1G 4C2MB 3MHBA 4B08A 1QJOA 3TBIB 1EQVA 3GO5A 2B2VA 3M4YA 4TSSA 1DONA 5TSSA 4M8AA 4RCNA 1Y8NB 3OW7A 2NN6H 4K6LA 4DAYA 5JPMC 2O5JC 4HSVA 3I70A 1STGA 3DUZA 1U9RA 5C4ZA 1CQVA 1FNUA 3NWSA 3CKIB 1DD2A 1OXUA 3QG1A 3NXWA 2M2LA 1RTNA 3HOWB 2NUCA 1KLUD 1BCPF 1XX8A 5ELBA 2L12A 2FINB 1YNJD 1UEAB 4C3HG 3K6OA 3P20A 3TP8A 1BQQT 5IT9E 1F2YA 3VR5A 1IYUA 2AUKA 2K5DA 3QIAA 3PO3B 4RGTA 3S1MB 4NW2A 3T51B 1G8ZD 5CR3A 1F9QA 5JVG3 1RTOA 3CRKC 4K8JA 5EGTA 1YNND 1B1ZA 4FF1A 2QDBA 3HZXA 3VR2A 1SYDA 1STBA 3KUPA 4DAPA 2PMZB 5I2YA 2D2CC 3C1FA 1PYWD 3GD7A 2EYMA 2KUMA 2KEEA 3M85A 1HRJA 3D4DA 2F0KA 1IW7D 1HA6A 1EU3A 1HPCA 1Q90A 2MP1A 3MVVA 4PNYA 5G3LD 4ZKBB 1QE6A 2E2JB 2RQXA 1BXTA 1LT6D 5C4JB 1K8OA 1F2MA 4UAIA 3GTQB 3HOXB 1KLGD 3R3OA 2MGSA 4Q0FA 3PUZA 4ABNA 3BG3A 4IZ8A 3E5SA 1U4PA 1FNWA 3H6MA 5BN4A 2A69D 5CYUA 2NWGA 2IX0A 2NN6G 4RHRA 1SNOA 1Q1BA 2EXZA 3K0YA 3AMUA 2F0GA 2EOTA 2QILA 4ZQ3A 5C0XH 3JAML 1EY4A 1B9MA 3CQZB 2ZXPA 2Z4IA 4IUNA 2L0CA 2Z8LA 3CHBD 4C1NK 1V8QA 2PYKA 4KD3A 4IFDI 2QF7A 4IFDH 2SNMA 3LNNA 2XSCA 5I2XA 4FF2A 1KDCA 5DM73 3MXUA 4G4KA 3SK6A 3QB3A 3SVMA 4RGMA 4ZUIA 2WIIB 1CT1D 3DWQA 2G9HD 2RSNA 3NQTA 1SNCA 4F7XA 3GTGB 5BN3A 3MXPA 2NTSA 4KMUC 2B8FA 3PIO3 1V1PB 2SOBA 3KF8A 3JAME 2B2TC 5CBAE 3HOVB 2KHSA 4R8NA 3PV0A 4LMQD 5M9OA 1TY2A 3RZOB 5C3WA 4FXDA 4EQOA 1Z7TA 1OXSC 3BYYB 4J8QA 4A3KB 4ZLTF 5CBEE 3NWTA 2K5WA 1HA5A 4X3KA 2BOSA 3PUWA 1M4VA 5JJZA 3Q6SA 4OHJA 4G7OC 2RVLA 2XIWA 1B9NA 3GV6A 1LT3D 3SDZA 4A3JB 2ENBA 2B2WA 3S2HB 3GTOB 5CV7A 4K5VA 2N88A 2KOLA 1K83B 1DZ1A 4OGQC 2XRSD 2FJ2A 5C0XG 3NHHA 4CJ0B 4C3HB 3EFXD 1V1PA 4XTCS 3ERQA 3MZ5A 5FKAC 2A73B 2X6GA 1T5XD 5ELDA 3SK4A 4OL7A 5D14A 2RKSA 1SDFA 4CHTB 2BA0A 4XDXA 1K8MA 4FP5D 1BCPC 4CGYB 2K33A 4BY1B 1S5DD 4HTHA 1EIHA 5IIFA 3HOYB 1H9SB 3N52A 1JB3A 1PTOF 4X3UA 5IGCA 3NBHA 1XTCD 4R8IA 2LKVA 4RGNA 3QJYA 1MBYA 2MPMA 2K03A 1PMRA 4H13C 1RJTA 4V190 5CGKA 4IQZA 1BDOA 1VMPA 2PZTA 1PRTD 2B2UA 2WKDA 3QWNA 5E1FA 1B3AA 1HXYD 2WP8J 4ILWA 2PNRC 4PMWA 1CHQD 1D5ZC 3J80L 3FVQA 1V43A 3QO2A 2JEAI 3WOEA 1MD2D 1I4XA 3T4AC 3RMHA 5T1GA 3I4LA 1T5EA 1D6EC 1JC7A 2D9UA 1ILPA 3GTLB 2F3WA 3KLSX 1OXVA 1H9SA 3NSWA 5IGEA 5LL6X 4MHEA 5K36H 4WFN3 3DWAA 5HGTA 4HCSA 5CMDA 1MGSA 5D3IB 4A3IB 3NK9A 5E3FA 5JAVA 2BE5C 3BDOA 4OO1I 1Y69U 4OO1H 1JOQA 4WJWA 1SSOA 5C3XA 3IFDA 5EBDA 1WVLA 1CK1A 2JE6I 4K2KA 3EVQA 3HG9A 1TWHB 2PO4A 2WACA 2BDNA 4Q5VA 3W2DA 3EJIA 1ET9A 3HOZB 3OIPA 1F9RA 2AQ1B 3J80E 3MXNA 1UNSA 2PPBC 4G7HC 5E4XA 4M1UB 1B44D 2JXMB 2CW0D 1KNAA 1DCZA 1A3UA 3PMFA 1AZQA 2HQEA 3CU7A 3KK7A 4FXKC 5EPJA 1STNA 1UUPA 5NUCA 3R8BA 1LTAD 1PFMA 3M7GA 4HN7A 3J7AF 5JPNC 1E2WA 4DAVA 1SEBD 4KHZA 4KJNA 3PUVA 3H91A 3FPUB 2F0TA 4QF4A 2K05A 4KN7C 1PZKD 5M3FB 5KGUA 4N9PA 2EJGC 3BS1A 2EJFC 1Q3LA 1WTVA 1O80A 5JEAH 5FOBB 3C2PA 3IKJA 5D65A 1ZKOA 1IYVA 2R92B 2OT2A 2F03A 2IW3A 5I9PA 4A3GB 1ZXTA 2WV6D 1Y8PB 3BVMA 2KQ3A 2HUGA 1PTOH 4JBWA 1TT2A 1MI2A 1A3VA 5HURA 3HOUB 4A3BB 1G6ZA 5CV8A 3I90A 1HFNA 2O2LD 3M3YB 3SK8A 2M9VA 2Q8TA 2JA6B 4QCLA 3OSOA 4ULLA 2F0HA 2NN6I 1STEA 3M4OB 1Q1EA 2YU9B 1I50B 2ICIA 1MSHA 3P75A 1JOKA 2OF1A 2J7ZA 4RH6A 5K5PA 1QILA 3T16A 2EY1A 1KDBA 2CQAA 3D8GA 3WDNA 4LJZC 4KY7A 2EZVA 4HAEA 2PZWA 3FMCA 1BO0A 1JE4A 1GUNA 3S14B 2DN8A 3VYSA 2B2YC 3DMUA 1X3PA 3GQBA 3R2TA 4ZKCB 4A3EB 4DU9A 1PTOC 3MFYA 1HTLD 1X3QA 5ELFA 4DXGA 4KK7A 2BCOA 1LTSD 2RA4A 1S5ED 2B2TA 4KY5A 5I6WA 1IKMA 1CZGA 3BVZA 3MA2B 1BCPB 2Q8RE 3I72A 1SMYD 3F2UA 1PDQA 3KBGA 2E2HB 2J4XA 1I6HB 4U68A 1XYIA 1SYBA 4IFDJ 4X3SA 3SK5A 4FF3A 5JEAG 5T1IA 4GZYC 1O78A 3U9SA 1CA6A 4XIGS 3ITPA 4G7ZC 1G291 2K5QA 3E6ZX 5DEHA 1E2ZA 2EE1A 1HCZA 3P1HA 4C56C 3HEJA 4R9WA 5EKKA 4KKTA 3I4NB 1DM0B 2ICEC 4K8IA 2A6HC 4XYOA 3A8JE 2K32A 5G3LF 1D1KA 1WD1A 2RBMA 1XWEA 3TZUA 1TWCB 4RHSA 3ONAB 2HCCA 1A3TA 1E0BA 1S5CD 3NPPA 2PW5A 3C1EA 1LLRD 5AFWA 3KLRA 2PCFB 2I07B 3HGBA 1OXXK 3VYUA 2EYJA 1FGBD 3K59A 2WINB 4IALA 2A74C 1Y1WB 2L5TA 2KECA 1TQOA 4A3DB 5C0XI 1SYFA 4S3SA 5A35A 3A55A 1FNVA 1EU4A 1NUCA 4FYDA 3V2TA 1AW7A 1M8AA 4G57A 3K58A 2L1BA 3FRPB 2MHVA 3GTMB 3TSSA 1CI3M 1SYEA 3VR3A 1RCVD 2LY7A 1V1OA 1I4HA 5FLXL 2K6AA 1RF2D 1RDPD 3LX0A 4OIJA 1PZJD 2KCNA 2IWHA 5FK9C 3I3CA 1GHJA 2NZ1D 2B2VC 2CHBD 4V0BA 1Q12A 1EY7A 2JP1A 5CV6A 4YIJA 1TWGB 5KEEA 2A5HA 2NYZD 2NVQB 5KIXA 5A2QL 1LTRD 1TKWB 3IL8A 2IX1A 2PZUA 1B4OA 3Q23A 2ZXOA 2NB0A 1LV9A 1RODA 1LO5D 1W6JA 5EJWA 1SAPA 4IURA 2FFKB 2A68D 3V96A 3H09A 1I3QB 1ZEQX 4B9WA 1EL0A 5FLXE 2F0DA 4DNRB 2JA5B 4EGVA 4FO2A 1EY5A 4KJOA 1TU2B 2M00A 2AQ3B 1G2SA 2XN9C 3TP6A 1U4MA 3NTKA 1S5FD 2WB1B 4ZK9B 1TS3A 3SEBA 2EY6A 1EOTA 3Q0AA 3M7NA 4BBSB 2B8GA 1EIGA 1D5MC 4RKBA 3ND9A 1ENFA 2XWBB 3BZDB 4K5XA 1EQTA 4RWSC 4XT1B 2O5IC 4FVMA 3VYTA 2NVXB 2J0TD 4BWGB 2Y0SB 4K14A 1STHA 5C5LA 2PW7A 3V05A 1VMCA 3FDTA 4IN3A 3IFTA 5C5MA 1QNUA 1BNZA 1O7ZA 2MJ8A 2E74C 1BBXC 2F0OA 3FKIB 1D2BA 1F9PA 5IGBA 3TMEA 3QOJA 5IODA 1A2UA 3NBIA 1HUNA 1EY9A 1DYQA 2C9OA 4Z9CB 4XQJA 4HR7B 2GA4B 2HCIA 2K01A 3HKZB 3N6RA 1YNJC 3KBXA 4TQUS 4RA8A 1LTGD 1JORA 1NCVA 1JWMD 3PUYA 1VDZA 3K5OA 3K5MA 5ELCA 2F3VA 1KAAA 1PTOB 2HDLA 3SE0A 5IOCA 5FO8B 4MIUA 3A8IE 1YNNC 4RKLA 3E0JA 3S1RB 4CBVA 3X3MA 1PRTF 1QWYA 3RLFA 4NP5A 3C3LA 1SE4A 1EWHA 3SHLA 1GUWA 4C3IG 2H4OA 1SNPA 1C4QA 1C48A 5M3MB 1ONLA 4QUCA 3QOLA 2NVTB 1BOSA 4O42A 1PFBA 3S15B 2L9HA 1FR3A 2JEBI 4H44C 4EVOA 1EWCA 2AUJD 1F9SA 3U9OA 4KKUA 2R61A 1II3A 4U673 1AN8A 1I4PA 5C3EB 1HTPA 2A69C 1U4LA 2JSOA 3CRLC 2L55A 4F87A 4KKSA 5FO9B 3D3RA 1EY8A 3J7YW 3A56A 4ID6A 1BR9A 1F2ZA 1B50A 1DXMA 1HUMA 1STYA 5DM63 4XQQA 4PQXA 5JOBA 1CQFA 2XNAC 1S5BD 2XRQD 1EYCA 4O1NA 1CA5A 3L7ZC 1SNMA 3K5NA 2QKIC 1WTOA 2ZXRA 3VA5A 3OMCA 4WORA 3NQIA 1ICWA 2B2WC 1ENAA 2FMMA 2Q8IB 4KTAA 3D6WA 5CV9A 4CKEA 5M5YB 2EPBA 4PMCA 2F0FA 2XWJB 1GUTA 3AB9A 1CZWA 4ME5A 4CKBA 4DN4M 1W6KA 1H9JA 1LTTD 1DOLA 5EPLA 1AFPA 3MXGA 2F0EA 4I65A 2G9DA 4P2CB 1TS4A 5LL6S 1F2LA 3MEHA 3OHXC 4K2LA 4NKLA 3VYRA 1GJXA 1WTRA 5KRUA 3GTKB 1L0YB 4ZUJA 2EDGA 1LACA 2LFNA 2OEOA 3P7JA 5ELEA 2QCPX 2K04A 2QEJC 1VCIA 2NTTA 3BYTB 1NSNS 1PLFA 5LHY1 4DK0A 2E76C 3H94A 3I91A 1IHZA 4XYQA 5KNCA 1XXGA 5I9OA 1A6XA 1KDAA 2B2UC 5IT9L 3S1QB 4QB4A 1GUOA 2EYLA 2LS01 2YYZA 2F0VA 1GHKA 3T56B 3NE5B 2E2DC 4TRDA 3NTIA 3HS0C 2VB3X 4DXFA 2L11A 3GTJB 1TWAB 1B53A 4I7ZC 4C3JG 1R4QB 1WCMB 5C4HA 4CJ2C 2RSOA 3H3VC 3MC0B 4IUQA 2PQEA 1ZYRC 1H9RA 1SE2A 1BCPD 5CORA 2H1EA 3D4RA 4L6TB 1SYCA 2DNCA 4B9XA 4IUTA 4BA1I 3I73A 3IAYA 2R3ZA 5C0XJ 1SFOB 1TIID 5ISRA 1RHPA 3A8KE 3TZDA 3J7AV 4ODGA 2KJXA 5M5WB 2DY7A 1MSGA 5C4XB 1LT5D 4KN4C 2F0NA 2BDOA 4K5WA 4EQPA 1LT4D 3RZDB 2RDHA 2KEDA 3EROA 3H0GB 4C3IB 3J81L 5FO7B 1CM9A 1TVXA 4RGOS 2XVSA 1HFGA 3O13A 1CHPD 4F8MA 2VXWA 4MN3A 3K57A 4RFBA 1WTWA 4BA2I 4DGZA 1EY0A 1PRTC 1C8CA 1O7LA 5EBCA 3D4WA 1S4ZA 1I4RA 3MAQA 1JCKB 4UDUC 5IGDA 4XT3B 1A15A 1GOZA 5DNFA 3NUCA 3I4MB 4KY6A 1EYAA 4X3TA 4OIKA 5JVH3 1Q8IA 1SNDA 2TMPA 4FNFA 1O7YA 2F0QA 1J8IA 2BE5D 3DHQA 1G2TA 5C44B 5J1ZA 5C6AA 4QIWB 3J81E 1LTBD 2LMCB 1QCBD 3DEPA 2N55A 3GV3A 1PZID 4L63B 2SEBD 3WOFA 2E75C 3TN2A 4PMBA 1ESFA 3L9AX 4LAAA 4TKOB 2F0WA 2V4DA 4CKCA 4KV6A 4DFAA 4BY7B 2CVRA 1DJRD 3PUXA 1RKNA 2JYOA 3BDLA 1R9TB 3OWEB 2F1MA 3KLSA 3K7AB 3SR1A 2CW0C 1JICA 1CTMA 5M5XB 2K28A 5D3DA 2EY2A 2K1BA 4IUPA 3TP5A 2AQ2B 2A6EC 2SDFA 2FHTA 2EYFA 1IL8A 3D6CA 5EKIA 4DF7A 3Q22A 1KNEA 2O4XA 1UAPA 1Z6HA 2IT1A 2Z1CA 4HCEA 1H9MA 3S2DB 4F88A 1ET6A 3DEOA 4CJ1B 4JK1C 3FEWX 3NTHA 2F0SA 1Z47A 2Z4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EOT A;  1M8A A;  2Q8R E;  1U4R A;  2L1B A;  3F2U A;  1PDQ A;  1PFN A;  2EPB A;  2MP1 A;  5D14 A;  3DEP A;  5COR A;  1EIG A;  1SDF A;  2N55 A;  2H1E A;  3GV3 A;  4XDX A;  1SSO A;  3MTS A;  1BF4 A;  2RSN A;  4U68 A;  4QUC A;  4ZKB B;  2B2V A;  4IUT A;  1QE6 A;  3IFD A;  1ZXT A;  4IUV A;  1XYI A;  1HHV A;  1AZP A;  1EQT A;  3HP3 A;  3TN2 A;  4DN4 M;  2R3Z A;  1DON A;  3MWY W;  2HUG A;  4RWS C;  1DOL A;  4XT1 B;  4O42 A;  1PFB A;  4OIJ A;  5EPL A;  1WVL A;  1EIH A;  2L9H A;  4X3S A;  1WTX A;  3N52 A;  4UAI A;  1MI2 A;  4HSV A;  1RHP A;  3I3C A;  3TZD A;  2MGS A;  3DM1 A;  5T1I A;  1G6Z A;  4X3U A;  1F2L A;  2B2V C;  2NZ1 D;  1AP0 A;  3UI2 A;  1NR2 A;  1MSG A;  2DY7 A;  5EPK A;  1QNK A;  2BDN A;  3I90 A;  1CA6 A;  1HFN A;  1VMC A;  3FDT A;  4QUF A;  1WTR A;  4R8I A;  2JP1 A;  2CVR A;  2X69 A;  1DOK A;  1F9R A;  1F9S A;  1U4P A;  1ML0 D;  3G7L A;  1BNZ A;  2B2T C;  2JYO A;  5CBA E;  2HDM A;  5E4W C;  2Q8T A;  1O7Z A;  2MJ8 A;  2MPM A;  5E4X A;  2K03 A;  2KED A;  4LMQ D;  2EE1 A;  1BBX C;  3R93 A;  1IKL A;  3P7J A;  2NWG A;  2NYZ D;  1CM9 A;  1TVX A;  1KNA A;  1F9P A;  1AZQ A;  1DOM A;  2K04 A;  4R9W A;  1HFG A;  2M2L A;  3I8Z A;  3IL8 A;  1WD0 A;  1RJT A;  1RTN A;  1U4L A;  1B4O A;  4IUU A;  1XX8 A;  1MSH A;  2VXW A;  1JIC A;  5EPJ A;  1PLF A;  1VMP A;  2K28 A;  2L12 A;  1HUN A;  2FIN B;  4MN3 A;  3I91 A;  1PFM A;  1WD1 A;  1LV9 A;  2B2U A;  2K1B A;  2EOT A;  3LWE A;  4ZLT F;  1B50 A;  1WTW A;  5CBE E;  2HCI A;  2K01 A;  1ROD A;  4IUP A;  1X32 A;  2J7Z A;  4HED A;  1C8C A;  3ONA B;  1HUM A;  2HCC A;  5EJW A;  3KBX A;  1B3A A;  1SAP A;  4RA8 A;  4X3K A;  4IUR A;  1E0B A;  2FFK B;  4RAU C;  2B2Y A;  1NCV A;  5JJZ A;  4HAE A;  1S4Z A;  2B2U C;  1BO0 A;  3Q6S A;  1WTQ A;  2RVL A;  2XIW A;  3QO2 A;  1JE4 A;  2SDF A;  2FHT A;  5AFW A;  1CA5 A;  3H91 A;  1IL8 A;  4NW2 A;  5COY A;  2X6L A;  4ZAI A;  3FPU B;  3GV6 A;  4XT3 B;  5EKI A;  1A15 A;  1EL0 A;  5DNF A;  1F9Q A;  1KNE A;  1RTO A;  5T1G A;  2L4N A;  1WTP A;  2B2Y C;  2B2W A;  1X3P A;  2IL8 A;  4ZKC B;  2HDL A;  1G91 A;  2N88 A;  2K05 A;  1WTO A;  2D9U A;  2KOL A;  1ILP A;  1DZ1 A;  1QG7 A;  2KVM A;  4OIK A;  4X3T A;  2KEC A;  1ICW A;  1NAP A;  1X3Q A;  2L11 A;  5EQ0 A;  1ESR A;  2FJ2 A;  1B53 A;  4MHE A;  1J9O A;  3KUP A;  4CJ0 B;  1Q3L A;  2RA4 A;  1WTV A;  3DEO A;  2B2W C;  4CJ2 C;  1G2S A;  1O7Y A;  4HCS A;  2RSO A;  5CMD A;  1U4M A;  2FMM A;  1MGS A;  2B2T A;  1NR4 A;  1O80 A;  2KUM A;  4ZK9 B;  4CJ1 B;  2KEE A;  1J8I A;  2DY8 A;  1IKM A;  1HRJ A;  2X6G A;  5D65 A;  1G2T A;  1ILQ A;  4IUQ A;  1GUW A;  3D6W A;  3SVM A;  1B2T A;  1HA6 A; 
#chains in the Genus database with same CATH topology
 2EYP A;  4DUZ Q;  3EA6 A;  3RZD H;  2OXP A;  1SJH D;  3H0G H;  1Q7Y C;  3S1M H;  1VQ9 A;  1S40 A;  1HQR D;  2EJM A;  4IUV A;  3CCQ A;  2KA7 A;  5BN5 A;  4BS9 A;  2VUM B;  1D5X C;  3HP3 A;  3MWY W;  1K73 C;  3Q8D A;  4J6H A;  1STA A;  3DXJ C;  3STB C;  4H7B A;  2C35 B;  1WTX A;  3BVG A;  4A93 G;  1Z9F A;  2NVY B;  2JJQ A;  4LFC L;  3DM1 A;  4XXE A;  4JVZ A;  2GVB A;  1VQF A;  2JA8 G;  5J39 A;  5EPK A;  1YVC A;  4C3J B;  1Y8O B;  1KD1 C;  2F0J A;  1LTI D;  3NBH B;  4EX5 A;  1IBK Q;  2RDF A;  1KXL A;  3T53 B;  2UUA Q;  5A2Q E;  5IYD H;  4HSP A;  2NBF A;  1HZC A;  3KDF A;  3GTP B;  3EQL C;  4GOP A;  1B7Y B;  4A3F G;  1EQQ A;  3I4M H;  1Y1V G;  1HNW Q;  1BUV T;  4IUU A;  3HRZ C;  1QUQ B;  3OPO A;  5KYL A;  3CMA A;  1EZ6 A;  3RD4 A;  1N36 L;  1PXU A;  1TWF B;  3G6J B;  4HJ5 A;  1SE3 A;  4FF4 A;  4HED A;  3GTQ H;  1SLJ A;  2ZTD A;  3S9W A;  3HOX H;  2JA7 B;  2UXB Q;  3A7A B;  3ZYY X;  1AEX A;  4HJ7 A;  1ZYR D;  3DWP A;  1RD9 D;  3URY A;  3OMG A;  4HJ9 A;  1XNQ L;  1GUG A;  3RUZ A;  2K52 A;  1X3E A;  4HMJ A;  2F4I A;  2L4N A;  5CC4 A;  1WTP A;  1PTO D;  3SXH A;  1K8G A;  4QMG A;  2QW7 A;  3AU7 A;  4PV1 C;  1N9W A;  1TS2 A;  2WAQ E;  3VA7 A;  3BJU A;  1J9O A;  3B6Y A;  3QR8 A;  5KYI A;  4IFD G;  1ENC A;  1LAB A;  1EZ8 A;  1MKH A;  2ES2 A;  3W3A A;  1VQL A;  4BY7 H;  1K3R A;  1EEF D;  1KAB A;  4JI3 Q;  3TEH B;  4P74 A;  1PH8 A;  4LK1 C;  1EYG A;  1JWS D;  1R9T H;  1GUS A;  1G6P A;  1QB5 D;  3CCS A;  4Y7N B;  3MTS A;  5BR8 L;  1Q86 C;  3HOW G;  1KTK A;  3K7A H;  4RG1 A;  1SMY C;  1HHV A;  4X6A H;  2F0P A;  1EY6 A;  2F0U A;  3ULJ A;  2CH4 A;  2H5X A;  2AWO A;  1I4G A;  2R93 B;  3TP7 A;  2Q2H A;  2IPK D;  2F4V Q;  1AP0 A;  5DAU A;  1NR2 A;  3J81 c;  2VNU D;  2R7Z B;  1SYG A;  4JC0 A;  2OCE A;  2D62 A;  2DNE A;  3A54 A;  1A2T A;  4JOI C;  2X69 A;  3PO3 G;  1JR0 D;  1ML0 D;  4MTN A;  3G7L A;  1E3P A;  1IW7 C;  4YHH L;  4KHP L;  3RN2 A;  4KD4 A;  3KF6 B;  1KC8 C;  3TDQ A;  2EVB A;  2D5D A;  4ZYS A;  4RCO A;  2A6H D;  3Q24 A;  1DOM A;  3D31 A;  3VDY A;  2IJ0 A;  3I8Z A;  5JEA J;  5IGG A;  2MNA A;  4DNT B;  2A8V A;  4R4O A;  2F0I A;  1PRT B;  4C1N I;  5I6Y A;  4DR7 L;  2EYO A;  5KND A;  3S2D H;  1JB7 A;  1PYS B;  3LWE A;  3MFG A;  1CUK A;  2UUB L;  4NMZ A;  4LWC A;  2E2I B;  1X32 A;  4WRD A;  3ERS X;  4JI1 Q;  4A3C H;  3PIP 3;  3I56 A;  4DV1 Q;  2B2Y A;  1TR5 A;  4LFA L;  1SNQ A;  1HH2 P;  4XQN A;  4GNX B;  1EUJ A;  1IBM L;  5COY A;  2X6L A;  2KCC A;  1FYC A;  1JOO A;  1E2V A;  4AYB B;  3S17 B;  1P16 A;  4HMI A;  2IL8 A;  4BBR B;  1G91 A;  4L8J A;  3T1Y L;  3GP7 A;  1QG7 A;  3HOX G;  2NVY H;  3OIQ A;  2KVM A;  1NAP A;  4NDX A;  5EQ0 A;  1W2B A;  3ER0 A;  3BZK A;  5I4D A;  1YHQ A;  5EKL A;  1FD7 D;  4C3J H;  1KIX A;  1VF7 A;  2TSS A;  2B63 B;  1NR4 A;  2F0L A;  1SXT A;  2DY8 A;  1EYD A;  2VB2 X;  3K5L A;  1B2T A;  3VR6 A;  1SJE D;  2K5V A;  3U4V A;  1U4R A;  2UXC L;  2AKW B;  1PFN A;  1U0L A;  3J7Z C;  3GTP H;  1R4P B;  5CV4 A;  3T13 A;  3LWU A;  3BDC A;  5IGF A;  1HQM C;  1BF4 A;  2RDG A;  2R6G A;  2MUY A;  1OXT A;  3C46 A;  1I4Q A;  5LMN L;  3OWF A;  1AZP A;  4H0L C;  3X3N A;  1H9K A;  4A3J H;  3NEM A;  2OTL A;  4UP7 A;  1JQY D;  2EYH A;  3PO2 B;  1JWU D;  1TWF H;  1SR3 A;  4DPG A;  3S1N B;  3KYH C;  3UI2 A;  4EQN A;  3ND8 A;  1QNK A;  3FPP A;  3R2I A;  1TY0 A;  4QUF A;  3CCR A;  2B39 A;  3J7A 5;  5KNB A;  1VF5 C;  1DOK A;  1OO9 B;  4E6I A;  2FMC A;  2KHI A;  2WKC A;  2A6E D;  1YJW A;  4J1M A;  2UUC L;  2HDM A;  5E4W C;  1I6V C;  3JAM i;  4YWK A;  4LF6 Q;  1GXD C;  2UXD L;  1EEI D;  2WAQ B;  3R93 A;  1IKL A;  4DK1 A;  1SBB B;  1KRT A;  1QOH A;  2ZT9 C;  1XMQ L;  1WD0 A;  1PA6 A;  4PZ8 A;  4K6D A;  4ZRZ A;  3H3V I;  4KI0 A;  4N9T A;  1ASY A;  2RCF A;  2IX3 A;  3VR4 A;  3A7L A;  4IPG A;  5CV5 A;  4JV5 L;  1X3F A;  3LGJ A;  1CFM A;  4A93 B;  3HOY H;  1LTL A;  3S16 B;  3DLL A;  2JA8 B;  2AWN A;  1XTD A;  4RAU C;  1TS5 A;  1CSQ A;  2BA1 A;  1WTQ A;  3OTO Q;  1AE2 A;  4DA2 A;  4ZAI A;  5J22 A;  1XNR L;  2A68 C;  4UPA A;  3L3O C;  1L0X B;  2I46 A;  4A3M B;  4A3F B;  1N34 Q;  1Y1V B;  1WJJ A;  1EFI D;  3OOC A;  1D1I A;  3A0J A;  4DV0 L;  2MFI A;  2A19 A;  2C5C A;  2SNS A;  4FXG C;  5K36 G;  1ESR A;  1F77 A;  2R7Z H;  2F0M A;  1KAW A;  3NP8 A;  2EY5 A;  2ID0 A;  5F2D A;  4KHV A;  1BBW A;  2K7V A;  3HOV G;  1ILQ A;  1B8A A;  3EIV A;  1VQB A;  3BZC A;  1XJV A;  2RHQ B;  4OO1 G;  4JI8 L;  4C2M B;  4Y52 H;  3MHB A;  4B08 A;  1QJO A;  3TBI B;  1VQD A;  1C0A A;  4B3R Q;  1EQV A;  3GO5 A;  2B2V A;  4YCV A;  3M4Y A;  4TSS A;  1DON A;  5TSS A;  4A3K G;  4M8A A;  4RCN A;  1Y8N B;  1VS0 A;  2CQO A;  3OW7 A;  2ALY B;  1TXY A;  2NN6 H;  4K6L A;  4DAY A;  5JPM C;  2O5J C;  4HSV A;  3PF5 A;  3I70 A;  1M1K C;  2E2I H;  1STG A;  3DUZ A;  1U9R A;  1IBL L;  5C4Z A;  1CQV A;  1FNU A;  1V1Q A;  1VQN A;  4JPB W;  3NWS A;  3CKI B;  1DD2 A;  4DR5 Q;  1OXU A;  2CWA A;  5GAE C;  3QG1 A;  4A3J G;  3NXW A;  3S17 H;  2M2L A;  1RTN A;  3HOW B;  2NUC A;  1KLU D;  1BCP F;  3UDF A;  1XX8 A;  3M4Q A;  5ELB A;  4DV2 Q;  2L12 A;  2FIN B;  4X62 L;  2CFM A;  1YNJ D;  1UEA B;  4C3H G;  3UE1 A;  3K6O A;  3P20 A;  3TP8 A;  1BQQ T;  2B63 H;  2N3S A;  5IT9 E;  1D8L A;  1F2Y A;  5LMU L;  3VR5 A;  1IYU A;  2AUK A;  2K5D A;  3QIA A;  1RIP A;  3PO3 B;  4RGT A;  4DR2 L;  3HOZ H;  3S1M B;  1VQH A;  4BXX G;  4NW2 A;  3T51 B;  1PVO A;  1G8Z D;  5CR3 A;  4O2D A;  1F9Q A;  5JVG 3;  1RTO A;  4BY1 G;  3CRK C;  3AFQ A;  3FHW A;  1NBW A;  4K8J A;  5EGT A;  1YNN D;  3HOY G;  2PI2 E;  1B1Z A;  2AMC B;  1XPO A;  1K8A C;  4FF1 A;  4DAM A;  4DKA C;  2QDB A;  2I5L X;  3HZX A;  3VR2 A;  1SYD A;  3ZJY C;  1STB A;  3KUP A;  1QVC A;  4DAP A;  2PMZ B;  3CC7 A;  5I2Y A;  1IYJ B;  2K14 A;  3AQQ A;  2D2C C;  3C1F A;  1PYW D;  4HIO A;  3GD7 A;  2EYM A;  2KUM A;  2KEE A;  3M85 A;  1HRJ A;  5GAD C;  4WJ4 A;  3D4D A;  2F0K A;  1IW7 D;  1HA6 A;  1EU3 A;  1HPC A;  1Q90 A;  3A74 A;  2MP1 A;  3MVV A;  4DNI A;  4PNY A;  5G3L D;  4ZKB B;  1YHA A;  1QE6 A;  2ZTE A;  2YTX A;  4CDC C;  2E2J B;  4ALP A;  4LF4 Q;  3CCM A;  2RQX A;  1BXT A;  1LT6 D;  5C4J B;  1K8O A;  4X66 Q;  2UU9 Q;  1F2M A;  4UAI A;  3GTQ B;  3HOX B;  4A93 H;  1KLG D;  3R3O A;  2MGS A;  4Q0F A;  3PUZ A;  5M3F H;  4DV7 Q;  1T9H A;  4IO9 A;  3CCJ A;  4ABN A;  4DV6 Q;  4IPD A;  1LM0 A;  4DV3 L;  3BG3 A;  4P75 A;  4IZ8 A;  3E5S A;  4QL5 A;  1U4P A;  2EQS A;  1FNW A;  3H6M A;  1J5E Q;  5BN4 A;  2A69 D;  1X56 A;  1WYD A;  5CYU A;  3J80 i;  4X64 L;  5AJ3 Q;  3TQY A;  2NWG A;  2IX0 A;  2Y0S E;  1X9N A;  4A3M H;  4B3T Q;  2NN6 G;  4DR3 Q;  4A3F H;  4RHR A;  1SNO A;  1Y1V H;  3S24 A;  1Q1B A;  2Z0S A;  2EXZ A;  3K0Y A;  1L1O C;  3G4S A;  3AMU A;  2F0G A;  2EOT A;  4GKK Q;  3HOU H;  1VQC A;  1QVF A;  4A3I G;  2QIL A;  4ZQ3 A;  5C0X H;  3JAM L;  1QZG A;  1EY4 A;  4OWX B;  1B9M A;  4LFB Q;  2ZTC A;  3RR5 A;  3CQZ B;  4DV5 Q;  3M3Y H;  2D0O A;  2ZXP A;  1QZH A;  2Z4I A;  4IUN A;  4A76 A;  3UE0 A;  5GRO A;  2L0C A;  2Z8L A;  3CHB D;  2L15 A;  4C1N K;  4QY7 A;  1VQP A;  1EQR A;  1V8Q A;  1IBK L;  2Q2I A;  1I50 H;  2PYK A;  4KD3 A;  4IFD I;  3U50 C;  2UUA L;  2QF7 A;  4IFD H;  1PH4 A;  2JK8 A;  2SNM A;  3LNN A;  2XSC A;  5I2X A;  4FF2 A;  1KDC A;  1G51 A;  5DM7 3;  1MJE A;  3HOZ G;  3MXU A;  4G4K A;  3OYY A;  3SK6 A;  3QB3 A;  3SVM A;  1N32 Q;  4RGM A;  2YTV A;  2PQA B;  4LNQ A;  4GKJ Q;  1YHB A;  4ZUI A;  2WII B;  4DR1 L;  1CT1 D;  3DWQ A;  2G9H D;  1DGS A;  2RSN A;  2V1C C;  3NQT A;  3HOW H;  4GN5 A;  1HZA A;  1SNC A;  3JC6 6;  4F7X A;  3TS0 A;  4JI5 Q;  3GTG B;  2UXB L;  4OXP A;  5BN3 A;  3A5Z B;  1PH1 A;  2YV5 A;  3MXP A;  1XMO Q;  2NTS A;  4KMU C;  4JI4 Q;  2B8F A;  1D7Q A;  3PIO 3;  1SMX A;  1V1P B;  2SOB A;  1UE1 A;  3KF8 A;  3CPW A;  3JAM E;  2I5H A;  2DGY A;  2D0P A;  3PO3 H;  2B2T C;  5CBA E;  3HOV B;  2KHS A;  4R8N A;  3PV0 A;  4LMQ D;  5M9O A;  1TY2 A;  3RZO B;  5C3W A;  3K8A A;  5M3F G;  4FXD A;  4EQO A;  1Z7T A;  1OXS C;  2RF4 A;  3BYY B;  4J8Q A;  4A3K B;  4ZLT F;  5CBE E;  3NWT A;  1CKN B;  1VQ5 A;  2K5W A;  1HA5 A;  4X3K A;  2VS1 A;  2BOS A;  3RNU A;  1ASZ A;  5GQO A;  2R92 G;  1YBY A;  3PUW A;  1M4V A;  5JJZ A;  4A3M G;  3Q6S A;  4OHJ A;  4G7O C;  4LF5 L;  2RVL A;  2XIW A;  1B9N A;  4H02 A;  4A3G G;  3GV6 A;  4GLV B;  1LT3 D;  3SDZ A;  5JJI A;  3H15 A;  4A3J B;  2ENB A;  2E2J H;  4A3L G;  2B2W A;  3S2H B;  3GTO B;  2F4V L;  5CV7 A;  4K5V A;  2N88 A;  5IT9 c;  4P72 A;  5C4J H;  2KOL A;  1K83 B;  1DZ1 A;  4OGQ C;  3HOU G;  4A3B G;  3I4N H;  2XRS D;  2FJ2 A;  5C0X G;  4JI7 Q;  3NHH A;  1RL2 A;  4CJ0 B;  4C3H B;  5JJK A;  3EFX D;  2VQF Q;  4R4Q A;  1V1P A;  4XTC S;  2NZH A;  3ERQ A;  3MZ5 A;  2ATW A;  5ELO A;  5FKA C;  1N8R C;  2A73 B;  2X6G A;  1KL9 A;  1T5X D;  2Z9H A;  3G6E A;  4JCV E;  1PH7 A;  3AYH B;  2B3G A;  2JA6 G;  4NXM Q;  2IHF A;  5ELD A;  3SK4 A;  4OL7 A;  5D14 A;  2RKS A;  1SDF A;  4CHT B;  2BA0 A;  4XDX A;  4HJA A;  2G5D A;  1K8M A;  4FP5 D;  3RLO A;  1BCP C;  4CGY B;  2K33 A;  4BY1 B;  1S5D D;  4HTH A;  1EIH A;  4JI1 L;  4B3S L;  5IIF A;  3HOY B;  1H9S B;  2HHH Q;  3N52 A;  4DV1 L;  1JB3 A;  3CAM A;  1HZ9 A;  2AHO B;  1PTO F;  2QA4 A;  4X3U A;  3M9B A;  5IGC A;  3NBH A;  2P5Z X;  3UDX A;  1XTC D;  1CKM A;  1NE3 A;  1A0I A;  3F1Z A;  4R8I A;  2LKV A;  4RGN A;  3QJY A;  4IOC A;  1MBY A;  5ELN A;  2MPM A;  3CQZ H;  2K03 A;  4LFC Q;  5IP9 G;  4A3E G;  1PMR A;  4H13 C;  1QUQ A;  1VQJ A;  1RJT A;  4V19 0;  5CGK A;  4IQZ A;  2CCZ A;  2MQH A;  1BDO A;  1Y14 B;  1VMP A;  2PZT A;  1PRT D;  2BH2 A;  1Q8K A;  2B2U A;  4J15 A;  2WKD A;  3QWN A;  4IPH A;  1EFW A;  1FJG Q;  5E1F A;  1E1O A;  2DJG C;  1B3A A;  1HXY D;  2WP8 J;  4ILW A;  2PNR C;  3MXN B;  4FDB A;  4PMW A;  3M4P A;  1CHQ D;  1D5Z C;  3J80 L;  3FVQ A;  1V43 A;  3QO2 A;  2JEA I;  3WOE A;  1MD2 D;  4HIM A;  1I4X A;  3T4A C;  4RMF A;  3RMH A;  4GS3 A;  5T1G A;  3I4L A;  1T5E A;  4DV4 Q;  1D6E C;  1JC7 A;  3GTG H;  2D9U A;  1ILP A;  3GTL B;  2F3W A;  3KLS X;  2Q2T A;  1OXV A;  1H9S A;  3NSW A;  5IGE A;  5LL6 X;  4MHE A;  5K36 H;  4WFN 3;  4AQY L;  3DWA A;  1XNQ Q;  5HGT A;  4HCS A;  5CMD A;  4LF6 L;  1MGS A;  5D3I B;  4ZCK A;  4A3I B;  3NK9 A;  3HOV H;  5E3F A;  5JAV A;  2BE5 C;  3BDO A;  4OO1 I;  1Y69 U;  3CC2 A;  2F3I A;  4OO1 H;  1K3B C;  3RZO H;  1JOQ A;  4WJW A;  1SSO A;  2EXD A;  5C3X A;  1I3Q H;  1IZ6 A;  3I4N G;  3IFD A;  4MZ9 A;  1HNX L;  5EBD A;  1WVL A;  1CK1 A;  4A3K H;  1K0S A;  2JE6 I;  4K2K A;  1YI2 A;  3EVQ A;  3HG9 A;  1TWH B;  2PO4 A;  3I4O A;  1I94 Q;  2JA5 H;  4LF9 Q;  2WAC A;  3OTO L;  2BDN A;  1IL2 A;  4Q5V A;  3W2D A;  3EJI A;  1ET9 A;  3HOZ B;  1XPR A;  3OIP A;  1F9R A;  2AQ1 B;  3J80 E;  2OQK A;  3KF6 A;  3MXN A;  1UNS A;  2PPB C;  4G7H C;  5E4X A;  1N34 L;  4JI6 Q;  4M1U B;  1B44 D;  2GVA A;  2JXM B;  2CW0 D;  4JI0 Q;  1KNA A;  1DCZ A;  2VW9 A;  1L1O B;  1A3U A;  1CSP A;  3PMF A;  3L2P A;  1AZQ A;  3GTO H;  3S2H H;  2VQE Q;  1Y1W G;  2HQE A;  1Q46 A;  2IHE A;  1K83 H;  3CU7 A;  3KK7 A;  4FXK C;  3JAM c;  5EPJ A;  4A3D G;  1STN A;  3KFU A;  3I2Z A;  1E24 A;  1UUP A;  1SE8 A;  5NUC A;  5IWA Q;  3R8B A;  1LTA D;  1PFM A;  3UDI A;  3M7G A;  4HN7 A;  4N8X 1;  4GOP C;  3J7A F;  4C3H H;  5JPN C;  1E2W A;  1NMF A;  4I7A A;  4DAV A;  3TS2 A;  5FJ8 H;  1SEB D;  4LF8 L;  2OQ0 A;  4GNX A;  4B3R L;  4KHZ A;  1V9P A;  4KJN A;  3PUV A;  3H91 A;  1K9M C;  2IY5 B;  4BXX H;  3FPU B;  2F0T A;  4HID A;  1BKB A;  4BY1 H;  3FKI H;  4QF4 A;  3K7U C;  2K05 A;  4KN7 C;  3G71 A;  2ZJR A;  4KLK A;  1PZK D;  5M3F B;  5KGU A;  4N9P A;  4OEL B;  2EJG C;  3BS1 A;  2EJF C;  1Q3L A;  1WTV A;  4K0K Q;  1O80 A;  5JEA H;  3OW2 A;  5FOB B;  3C2P A;  3IKJ A;  5D65 A;  3RN5 A;  1ZKO A;  4IJL A;  1IYV A;  2R92 B;  2OT2 A;  4POG A;  2F03 A;  4CDD C;  4DV2 L;  2IW3 A;  5I9P A;  1VQ6 A;  4A3G B;  3NEL A;  1YJ9 A;  1X54 A;  3STB D;  1ZXT A;  2WV6 D;  1Y8P B;  3BVM A;  2KQ3 A;  2HUG A;  2HIV A;  1PTO H;  4JBW A;  1TT2 A;  3CP0 A;  1MI2 A;  1A3V A;  4NXN L;  2CWP A;  5HUR A;  3HOU B;  4A3B B;  1G6Z A;  5CV8 A;  3PQI A;  1HNZ L;  4QIW E;  2LXJ A;  3I90 A;  1HFN A;  2O2L D;  3M3Y B;  3SK8 A;  3EN2 A;  4OWW B;  2M9V A;  2Q8T A;  3A5U A;  2JA6 B;  4QCL A;  3OSO A;  4ULL A;  2F0H A;  2NN6 I;  1STE A;  3M4O B;  1Q1E A;  1PH2 A;  5M3M H;  2HQL A;  2YU9 B;  1I50 B;  2ICI A;  2JA5 G;  3GTL H;  1MSH A;  3P75 A;  2UXD Q;  1JOK A;  2OF1 A;  4UHV A;  5E7N A;  2J7Z A;  2WB1 G;  4HIK A;  3PIP A;  4RH6 A;  5K5P A;  1QIL A;  3T16 A;  2EY1 A;  1KDB A;  2CQA A;  3D8G A;  3WDN A;  4NPS A;  3TRE A;  4LJZ C;  4A3I H;  4DR6 L;  4KY7 A;  2EZV A;  4HAE A;  2PZW A;  3FMC A;  3PSI A;  1BO0 A;  1VQ8 A;  4LF4 L;  1A8V A;  4BBS G;  1JE4 A;  1GUN A;  4GLA C;  4X66 L;  3S14 B;  4YCW A;  2DN8 A;  3VYS A;  4DV7 L;  2B2Y C;  3DMU A;  1X3P A;  3GQB A;  3R2T A;  4ZKC B;  4A3E B;  4DV6 L;  4P71 A;  4DU9 A;  2Y0S G;  1UEB A;  4R4T A;  2Z6K A;  1TWH H;  1PTO C;  3MFY A;  1HTL D;  1X3Q A;  5ELF A;  4DXG A;  5FJ8 G;  4GN3 B;  2K4K A;  4KK7 A;  2BCO A;  3AEV A;  1LTS D;  2RA4 A;  3CCL A;  1S5E D;  1J5E L;  2B2T A;  1AE3 A;  4KY5 A;  5I6W A;  5AJ3 L;  1IKM A;  2VZA A;  1CZG A;  3BVZ A;  3MA2 B;  4DR3 L;  4UP9 A;  1BCP B;  2Q8R E;  3I72 A;  1SMY D;  3F2U A;  3FKI G;  1PDQ A;  3KBG A;  2E2H B;  1SN8 A;  1GO3 E;  2OWO A;  1UE6 A;  2J4X A;  1I6H B;  4U68 A;  1XYI A;  1UE5 A;  1SYB A;  2KEN A;  4GKK L;  4IFD J;  4X3S A;  3F2B A;  3SK5 A;  4LF7 Q;  4FF3 A;  1A63 A;  1PH3 A;  5JEA G;  2KBN A;  3HKZ G;  4JI8 Q;  2E5L Q;  5T1I A;  4GZY C;  1O78 A;  4JW0 A;  4LFB L;  3U9S A;  1CA6 A;  1PFS A;  1FVI A;  4XIG S;  3ITP A;  3U4Z A;  2ZM6 Q;  4G7Z C;  1VQA A;  1EIF A;  2HD3 A;  1G29 1;  2K5Q A;  4X65 L;  1VQK A;  3E6Z X;  4OX9 Q;  1PYB A;  5DEH A;  4B3M Q;  1E2Z A;  2BH8 A;  2EE1 A;  1HCZ A;  5HGQ A;  3CCU A;  3P1H A;  4C56 C;  3HEJ A;  1QVG A;  4GN4 B;  1IBL Q;  2WB1 E;  4R9W A;  5EKK A;  2N78 A;  4KKT A;  1W3S A;  1U5K A;  3I4N B;  1DM0 B;  2ICE C;  4K8I A;  4JYA Q;  1WOC A;  2A6H C;  2K5H A;  4XYO A;  3A8J E;  2K32 A;  5G3L F;  3T1H L;  1D1K A;  3J80 c;  1WD1 A;  2RBM A;  1XWE A;  5IE8 A;  1YNX A;  1L0W A;  3TZU A;  1TWC B;  4RHS A;  3ONA B;  2HCC A;  1KQS A;  4QQB X;  1I5F A;  1A3T A;  1E0B A;  1K28 A;  1NTG A;  1S5C D;  3NPP A;  2PW5 A;  1JJC B;  5H1S E;  2R92 H;  3C1E A;  3FP9 A;  3GTK H;  1LLR D;  2YTY A;  5AFW A;  3KLR A;  5M3M G;  2PCF B;  2I07 B;  4JI5 L;  3HGB A;  1OXX K;  3VYU A;  1VQ4 A;  4A3G H;  2EYJ A;  1XMO L;  1FGB D;  4LUO A;  4JI4 L;  3K59 A;  2WIN B;  4A3L H;  4IAL A;  2A74 C;  4LUZ A;  1Y1W B;  1N33 Q;  1VQO A;  1SRO A;  3ULP A;  2L5T A;  4DUZ L;  1HJP A;  2KEC A;  1TQO A;  4A3D B;  4A3B H;  5C0X I;  4L5S A;  1SYF A;  2N49 A;  2JN4 A;  4S3S A;  2LSS A;  5A35 A;  1PHJ A;  3D0F A;  3A55 A;  2I0Q A;  1FNV A;  1EU4 A;  4UY8 C;  1NUC A;  4FYD A;  5C3E G;  2GN5 A;  3V2T A;  1AW7 A;  1M8A A;  4G57 A;  3K58 A;  2L1B A;  3FRP B;  2ZJP A;  2JA6 H;  1Q82 C;  3HKZ E;  3M4O H;  2MHV A;  3GTM B;  3TSS A;  1CI3 M;  2YU9 H;  1SYE A;  1RCV D;  2LY7 A;  3VR3 A;  1V1O A;  3EBE A;  1I4H A;  5FLX L;  5EAY A;  2K6A A;  1RF2 D;  1RDP D;  3LX0 A;  4OIJ A;  1HR0 Q;  4JOI A;  1PZJ D;  2KCN A;  2IWH A;  2FXQ A;  5FK9 C;  3I3C A;  1GHJ A;  4OWT B;  1C7Y A;  1S3O A;  1JMC A;  2NZ1 D;  2B2V C;  2CHB D;  3RLN A;  4V0B A;  1Q12 A;  1WCM H;  3PF4 A;  1HNW L;  1EY7 A;  2JP1 A;  5CV6 A;  4YIJ A;  1TWG B;  1J6Q A;  1JT8 A;  1GKH A;  4MTK A;  5IY0 A;  3KJO A;  5KEE A;  5IYC H;  3S14 H;  2XTI A;  1YZ6 A;  4QGU A;  2A5H A;  2NYZ D;  2QGQ A;  3E0E A;  5IP9 H;  2NVQ B;  5KIX A;  3KDF B;  5A2Q L;  1LTR D;  4A3E H;  1TKW B;  3IL8 A;  3U58 A;  4JI7 L;  2IX1 A;  2PZU A;  4GOP B;  1B4O A;  3Q23 A;  2ZXO A;  3UDG A;  2NB0 A;  5J3B A;  1SFO H;  1LV9 A;  1OTC A;  4X64 Q;  1ROD A;  1LO5 D;  1W6J A;  5EJW A;  4NXM L;  4DR4 Q;  1SAP A;  3CC4 A;  4IUR A;  5M5W H;  2FFK B;  2A68 D;  3PCO B;  1YJN A;  3V96 A;  1JJG A;  3H09 A;  1EOV A;  1I3Q B;  3F2D A;  1ZEQ X;  1WTH A;  4B9W A;  2E2H H;  2HHH L;  1I6H H;  1EL0 A;  3WWV A;  1HR0 W;  2E8G A;  5FLX E;  2HIX A;  4C3I H;  2LXK A;  4JI3 L;  3G48 A;  2F0D A;  4DNR B;  4EQ5 A;  4PZ6 A;  2JA5 B;  4EGV A;  2ZJQ A;  4FO2 A;  1BVS A;  1EY5 A;  1TU2 B;  2M00 A;  4KJO A;  2AQ3 B;  1G2S A;  2XN9 C;  3TP6 A;  1U4M A;  3NTK A;  3CXC A;  1S5F D;  2WB1 B;  4ZK9 B;  1TS3 A;  1VQI A;  3E3X A;  2K50 A;  3SEB A;  2EY6 A;  4AYB E;  2PQA A;  4DUY Q;  1EOT A;  4IPC A;  3Q0A A;  3M7N A;  4BBS B;  2B8G A;  1EIG A;  2I5M X;  1NJI C;  1D5M C;  4RKB A;  3ND9 A;  1ENF A;  2XWB B;  4AH6 A;  3BZD B;  4K5X A;  1EQT A;  4RWS C;  4YY3 Q;  4XT1 B;  1FJG L;  5JJL A;  2O5I C;  4FVM A;  3VYT A;  4APV A;  2NVX B;  2J0T D;  2Y0S B;  4BWG B;  4K14 A;  1STH A;  1TWC H;  5C5L A;  4DR1 Q;  2PW7 A;  3KOJ A;  3V05 A;  1VMC A;  3FDT A;  4IN3 A;  3E9I A;  3IFT A;  2PI2 A;  5C5M A;  1QNU A;  2F52 A;  1BNZ A;  4JI2 Q;  1O7Z A;  2MJ8 A;  4DV4 L;  2E74 C;  1BBX C;  5C44 H;  2F0O A;  1CKO A;  3FKI B;  1YIT A;  1D2B A;  2R7D A;  1F9P A;  1YIJ A;  5IGB A;  2EIF A;  3TME A;  1Y1W H;  3QOJ A;  5IOD A;  1A2U A;  5IYB H;  3NBI A;  1HUN A;  4A3D H;  1EY9 A;  1DYQ A;  1WCM G;  1CKN A;  2C9O A;  4Z9C B;  4XQJ A;  4HR7 B;  2GA4 B;  1UWV A;  2HCI A;  2K01 A;  3HKZ B;  3CF5 A;  3N6R A;  1YNJ C;  3HFZ B;  3KBX A;  4TQU S;  4RA8 A;  1LTG D;  1JOR A;  5IYC G;  5HY6 A;  4YWM A;  1NCV A;  1VQ7 A;  1JWM D;  3PUY A;  1VDZ A;  3K5O A;  3K5M A;  5ELC A;  3GTM H;  3CCE A;  2F3V A;  1KAA A;  1PTO B;  1X65 A;  1I94 L;  2HDL A;  3SE0 A;  1NY4 A;  4LF9 L;  5IOC A;  1JJ2 A;  4JG2 A;  5FO8 B;  2PNH A;  4MIU A;  3AFP A;  4LF5 Q;  1FL0 A;  3A8I E;  1E7Z A;  5M5X H;  1YNN C;  3L0O A;  4RKL A;  3E0J A;  5C4X G;  1KRS A;  3S1R B;  4CBV A;  3X3M A;  3BU2 A;  4JI6 L;  1MHW C;  1PRT F;  1N36 Q;  1QWY A;  3RLF A;  1TWG H;  4P73 A;  4NP5 A;  3C3L A;  4JI0 L;  1SE4 A;  1EWH A;  3SHL A;  1GUW A;  2VQE L;  3H0G G;  4C3I G;  2H4O A;  2N8N A;  2Q2U A;  2NVQ H;  1SNP A;  1C4Q A;  1C48 A;  5M3M B;  1ONL A;  4GLX A;  5IWA L;  2KHJ A;  4QUC A;  3J81 i;  3QOL A;  2NVT B;  1BOS A;  4O42 A;  1PFB A;  3S15 B;  2L9H A;  1FR3 A;  2JEB I;  3NEN A;  4H44 C;  3PIO A;  1M90 C;  3PGZ A;  1XPU A;  4EVO A;  1EWC A;  2AUJ D;  1F9S A;  1S72 A;  3U9O A;  4KKU A;  2R61 A;  4B3S Q;  1II3 A;  4U67 3;  5IYD G;  1AN8 A;  1I4P A;  5C3E B;  1HTP A;  2A69 C;  3HKS A;  5DLQ E;  3I4M G;  3CCV A;  1U4L A;  4K0K L;  2JSO A;  3CRL C;  2L55 A;  4F87 A;  1Q81 C;  4KKS A;  2VUM H;  3CW2 C;  5FO9 B;  3D3R A;  1EY8 A;  5BR8 Q;  3J7Y W;  3A56 A;  4ID6 A;  4AIM A;  2R7F A;  1BR9 A;  1F2Z A;  1B50 A;  1C9O A;  1NMG A;  1DXM A;  1HUM A;  1STY A;  5DM6 3;  1B3Q A;  1UE7 A;  3E9H A;  4XQQ A;  4PQX A;  5JOB A;  1CQF A;  5C44 G;  2XNA C;  4DK3 C;  1S5B D;  2XRQ D;  1EYC A;  4O1N A;  1CA5 A;  2CKZ B;  3L7Z C;  4BBS H;  1SNM A;  3K5N A;  3ICE A;  5IYB G;  2HT1 A;  2QDL A;  4UP8 A;  2VL6 A;  2QKI C;  1L2F A;  4YHH Q;  4KHP Q;  2MO0 A;  1WTO A;  2NVX H;  2ZXR A;  3VA5 A;  1YEZ A;  3OMC A;  4WOR A;  3NQI A;  4L5R C;  1ICW A;  2B2W C;  1ENA A;  4DR7 Q;  2FMM A;  4BY7 G;  2Q8I B;  2JA7 H;  4KTA A;  5FLX c;  2UUB Q;  3D6W A;  5CV9 A;  4CKE A;  1PH5 A;  5M5Y B;  4PZ7 A;  2EPB A;  4PMC A;  2F0F A;  2XWJ B;  4AQY Q;  1GUT A;  3AB9 A;  4LFA Q;  1CZW A;  2PMZ E;  4ME5 A;  4CKB A;  4DN4 M;  1W6K A;  1H9J A;  1LTT D;  1DOL A;  5EPL A;  4DR5 L;  1IBM Q;  1AFP A;  3MXG A;  1X55 A;  2F0E A;  4I65 A;  2G9D A;  2XGT A;  4P2C B;  1TS4 A;  3CD6 A;  5LL6 S;  4DAY B;  1F2L A;  3MEH A;  3OHX C;  4K2L A;  3H3V H;  4NKL A;  3VYR A;  3T1Y Q;  1GJX A;  1WTR A;  5KRU A;  3GTK B;  1L0Y B;  4R4I A;  1HNX Q;  4ZUJ A;  2EDG A;  1LAC A;  3ULL A;  1L1O A;  2LFN A;  2OEO A;  3P7J A;  5ELE A;  4IOA A;  4NB3 A;  2QCP X;  2K04 A;  2QEJ C;  1VCI A;  3K81 C;  4L5Q A;  4Y7N H;  2NTT A;  2UXC Q;  3BYT B;  1NSN S;  1PLF A;  5LHY 1;  4DK0 A;  2E76 C;  3H94 A;  3I91 A;  4QJF A;  3K80 C;  1IHZ A;  2NZO A;  5LMN Q;  4XYQ A;  1GD7 A;  2ASB A;  3S1R H;  2R93 H;  1WFQ A;  5KNC A;  4A3C G;  1B70 B;  3SGI A;  1NNX A;  1KHI A;  1XXG A;  2VY3 A;  5I9O A;  1A6X A;  1KDA A;  1MIU A;  2B2U C;  5IT9 L;  3S1Q B;  4QB4 A;  1A62 A;  1GUO A;  2EYL A;  2LS0 1;  2YYZ A;  4OON A;  2F0V A;  4LF7 L;  2VUM G;  4JBK A;  1GHK A;  3T56 B;  2KCM A;  3NE5 B;  2E2D C;  4TRD A;  2UUC Q;  5GAG C;  3NTI A;  2E5L L;  2NVT H;  4LF8 Q;  3HS0 C;  3TRZ A;  3S15 H;  2VB3 X;  1PH6 A;  3W1G A;  4DXF A;  2ZM6 L;  2L11 A;  1XMQ Q;  3GTJ B;  1TWA B;  1B53 A;  2JQO A;  4I7Z C;  4OX9 L;  4C3J G;  1R4Q B;  1WCM B;  5C4H A;  4B3M L;  4CJ2 C;  2RSO A;  3H3V C;  5FLM H;  1H95 A;  3MC0 B;  4JV5 Q;  4O0A A;  2QEX A;  1EWI A;  4IUQ A;  2PQE A;  1ZYR C;  4POF A;  3KJP A;  2UU9 L;  3KLW A;  3W1B A;  5C3E H;  1H9R A;  1SE2 A;  4JYA L;  1BCP D;  5COR A;  1WI5 A;  2H1E A;  3D4R A;  4L6T B;  1VQE A;  3GDE A;  1SYC A;  2DNC A;  4B9X A;  2K75 A;  4IUT A;  4BA1 I;  3I73 A;  3IAY A;  2R3Z A;  4MNO A;  1K0R A;  5C0X J;  1SFO B;  1TII D;  5IP7 H;  1XNR Q;  5LMN W;  4BBR H;  3DM3 A;  5ISR A;  5GAH C;  1RHP A;  3A8K E;  3TZD A;  3J7A V;  4ODG A;  1ICF B;  2KJX A;  2JA7 G;  5M5W B;  1IXR A;  2DY7 A;  1MSG A;  4B3T L;  5C4X B;  1LT5 D;  4DV0 Q;  4KN4 C;  2F0N A;  2BDO A;  4ME3 A;  4K5W A;  4EQP A;  4R1J A;  1LT4 D;  3RZD B;  2RDH A;  2KED A;  4NXN Q;  3ERO A;  1N33 L;  3H0G B;  4C3I B;  3J81 L;  5FO7 B;  1CM9 A;  1TVX A;  3IRB A;  1HNZ Q;  4RGO S;  2XVS A;  1HFG A;  3O13 A;  1CHP D;  2DUD A;  4F8M A;  4JBJ A;  4A4I A;  2VXW A;  4CDE C;  4MN3 A;  4OEM B;  3K57 A;  1AH9 A;  4DV5 L;  4RFB A;  1WTW A;  4BA2 I;  4DGZ A;  3PO2 H;  1EY0 A;  1PRT C;  1C8C A;  3S1N H;  1PV4 A;  1O7L A;  1LYL A;  5EBC A;  3D4W A;  1S4Z A;  1I4R A;  5M5Y H;  3MAQ A;  4JBM A;  1JCK B;  1PH9 A;  4UDU C;  1HR0 L;  5IGD A;  4XT3 B;  1A15 A;  1GM5 A;  1GOZ A;  5DNF A;  2RCN A;  3NUC A;  4GNX C;  4A75 A;  3I4M B;  4KY6 A;  1EYA A;  3CPF A;  4DR6 Q;  2WFW A;  2R93 G;  1N32 L;  1VQG A;  4OIK A;  4X3T A;  5JVH 3;  1Q8I A;  4GKJ L;  1SND A;  2R7Z G;  4WJ3 M;  2TMP A;  4FNF A;  1E22 A;  1O7Y A;  2F0Q A;  1J8I A;  2BE5 D;  4X62 Q;  3DHQ A;  3S16 H;  1EIY B;  1G2T A;  2JA8 H;  5C44 B;  5J1Z A;  5C6A A;  4QIW B;  3J81 E;  1LTB D;  2LMC B;  5LMU Q;  1QCB D;  3DEP A;  4YWL A;  2N55 A;  3GV3 A;  1PZI D;  4L63 B;  2SEB D;  3WOF A;  2E75 C;  3TN2 A;  4DR2 Q;  4PG3 A;  2OTJ A;  4PMB A;  1LUZ A;  1ESF A;  2A1A A;  4YCU A;  3L9A X;  4DR4 L;  4LAA A;  1BBU A;  4TKO B;  5FLM G;  4TVA B;  1X6O A;  4N8F A;  2F0W A;  1MJC A;  2V4D A;  4CKC A;  4KV6 A;  3J81 j;  2RHS B;  4DFA A;  4BY7 B;  2CVR A;  1DJR D;  3KF8 B;  3PUX A;  3MEF A;  2Z6B A;  1RKN A;  2JYO A;  4DK6 C;  4HJ8 A;  3S1Q H;  1X3G A;  3F2C A;  3BDL A;  4LUV A;  1R9T B;  3OWE B;  4AYB G;  5IP7 G;  2F1M A;  4BBR G;  3KLS A;  4C2M H;  3K7A B;  3SR1 A;  4R4C A;  1JE5 A;  2DJF C;  2CW0 C;  5L37 A;  4X65 Q;  1JIC A;  1CTM A;  5M5X B;  2K28 A;  5D3D A;  3GTJ H;  1HZB A;  2EY2 A;  1TWA H;  1O7I A;  2KCT A;  2K1B A;  4DUY L;  4IUP A;  3TP5 A;  2B63 G;  3I7F A;  1SRU A;  3CME A;  2AQ2 B;  2B29 A;  1FGU A;  1GVP A;  2A6E C;  2MO1 A;  4DV3 Q;  1E1T A;  3T1H Q;  2SDF A;  2FHT A;  4IJH A;  4YY3 L;  2EYF A;  1IL8 A;  3D6C A;  3K0X A;  5EKI A;  1P8L A;  4DF7 A;  2VQF L;  3Q22 A;  1KNE A;  2O4X A;  1VQM A;  1UAP A;  1Z6H A;  2IT1 A;  2Z1C A;  3PO2 G;  3F8T A;  2CH4 W;  4HCE A;  1H9M A;  2JA9 A;  4L5T A;  4F88 A;  3S2D B;  3W5O A;  4JI2 L;  1ET6 A;  3DEO A;  2K5N A;  5C4X H;  4CJ1 B;  4CDF C;  2Z6K C;  4LW1 A;  4JK1 C;  3FEW X;  3NTH A;  2F0S A;  1Z47 A;  2WAQ G;  3I55 A;  2Z4H A; 
#chains in the Genus database with same CATH homology
 2EYP A;  3EA6 A;  2OXP A;  1SJH D;  1HQR D;  2EJM A;  4IUV A;  2VUM B;  2KA7 A;  5BN5 A;  4BS9 A;  1D5X C;  3HP3 A;  3MWY W;  4J6H A;  1STA A;  3DXJ C;  4H7B A;  1WTX A;  3BVG A;  2NVY B;  3DM1 A;  4XXE A;  5J39 A;  5EPK A;  4C3J B;  1Y8O B;  2F0J A;  1LTI D;  2RDF A;  3T53 B;  5A2Q E;  4HSP A;  2NBF A;  3GTP B;  3EQL C;  1BUV T;  4IUU A;  3HRZ C;  3OPO A;  5KYL A;  1EZ6 A;  3RD4 A;  1PXU A;  1TWF B;  3G6J B;  1SE3 A;  4FF4 A;  4HED A;  3S9W A;  2JA7 B;  3A7A B;  3ZYY X;  1AEX A;  1ZYR D;  3DWP A;  1RD9 D;  3URY A;  3OMG A;  1GUG A;  3RUZ A;  4HMJ A;  2F4I A;  2L4N A;  5CC4 A;  1WTP A;  1PTO D;  3SXH A;  4QMG A;  3AU7 A;  4PV1 C;  1TS2 A;  3VA7 A;  1J9O A;  5KYI A;  4IFD G;  1ENC A;  1LAB A;  1EZ8 A;  3W3A A;  1EEF D;  1KAB A;  4LK1 C;  1JWS D;  1GUS A;  1QB5 D;  4Y7N B;  3MTS A;  1KTK A;  1SMY C;  1HHV A;  2F0P A;  1EY6 A;  2F0U A;  2AWO A;  1I4G A;  2R93 B;  3TP7 A;  2IPK D;  1AP0 A;  5DAU A;  1NR2 A;  2VNU D;  2R7Z B;  1SYG A;  2D62 A;  2DNE A;  3A54 A;  1A2T A;  2X69 A;  1JR0 D;  1ML0 D;  3G7L A;  1IW7 C;  4KD4 A;  3TDQ A;  2EVB A;  2D5D A;  4ZYS A;  4RCO A;  2A6H D;  3Q24 A;  1DOM A;  3D31 A;  2IJ0 A;  3I8Z A;  5JEA J;  5IGG A;  4DNT B;  2F0I A;  1PRT B;  5I6Y A;  4C1N I;  2EYO A;  5KND A;  3LWE A;  3MFG A;  4NMZ A;  2E2I B;  1X32 A;  4WRD A;  3PIP 3;  2B2Y A;  1TR5 A;  1SNQ A;  4XQN A;  5COY A;  2X6L A;  2KCC A;  1FYC A;  1JOO A;  1E2V A;  4AYB B;  3S17 B;  4HMI A;  2IL8 A;  4BBR B;  1G91 A;  4L8J A;  3GP7 A;  1QG7 A;  3OIQ A;  2KVM A;  1NAP A;  4NDX A;  5EQ0 A;  5I4D A;  5EKL A;  1FD7 D;  1VF7 A;  2TSS A;  2B63 B;  1NR4 A;  2F0L A;  1SXT A;  2DY8 A;  1EYD A;  2VB2 X;  3K5L A;  1B2T A;  3VR6 A;  1SJE D;  1U4R A;  1PFN A;  5CV4 A;  3T13 A;  1R4P B;  3LWU A;  3BDC A;  5IGF A;  1HQM C;  1BF4 A;  2RDG A;  2R6G A;  2MUY A;  1OXT A;  3C46 A;  1I4Q A;  1AZP A;  3OWF A;  4H0L C;  3X3N A;  1H9K A;  1JQY D;  2EYH A;  3PO2 B;  1JWU D;  3S1N B;  3UI2 A;  4EQN A;  3ND8 A;  1QNK A;  3FPP A;  3R2I A;  1TY0 A;  4QUF A;  2B39 A;  5KNB A;  1VF5 C;  1DOK A;  1OO9 B;  4E6I A;  2FMC A;  2WKC A;  2A6E D;  4J1M A;  2HDM A;  5E4W C;  1I6V C;  1GXD C;  1EEI D;  2WAQ B;  3R93 A;  1IKL A;  4DK1 A;  1SBB B;  1QOH A;  2ZT9 C;  1WD0 A;  4ZRZ A;  4K6D A;  4KI0 A;  4N9T A;  2IX3 A;  3VR4 A;  3A7L A;  5CV5 A;  1CFM A;  4A93 B;  3S16 B;  2JA8 B;  2AWN A;  4RAU C;  1TS5 A;  2BA1 A;  1WTQ A;  4DA2 A;  4ZAI A;  5J22 A;  2A68 C;  3L3O C;  1L0X B;  2I46 A;  4A3M B;  4A3F B;  1Y1V B;  1EFI D;  3OOC A;  1D1I A;  2C5C A;  2SNS A;  4FXG C;  5K36 G;  1ESR A;  1F77 A;  2F0M A;  3NP8 A;  2EY5 A;  2ID0 A;  5F2D A;  4KHV A;  2K7V A;  1ILQ A;  4OO1 G;  4C2M B;  3MHB A;  4B08 A;  1QJO A;  3TBI B;  1EQV A;  3GO5 A;  2B2V A;  3M4Y A;  4TSS A;  1DON A;  5TSS A;  4M8A A;  4RCN A;  1Y8N B;  3OW7 A;  2NN6 H;  4K6L A;  4DAY A;  5JPM C;  2O5J C;  4HSV A;  3I70 A;  1STG A;  3DUZ A;  1U9R A;  5C4Z A;  1CQV A;  1FNU A;  3NWS A;  3CKI B;  1DD2 A;  1OXU A;  3QG1 A;  3NXW A;  2M2L A;  1RTN A;  3HOW B;  2NUC A;  1KLU D;  1BCP F;  1XX8 A;  5ELB A;  2L12 A;  2FIN B;  1YNJ D;  1UEA B;  4C3H G;  3K6O A;  3P20 A;  3TP8 A;  1BQQ T;  5IT9 E;  1F2Y A;  3VR5 A;  1IYU A;  2AUK A;  2K5D A;  3QIA A;  3PO3 B;  4RGT A;  3S1M B;  4NW2 A;  3T51 B;  1G8Z D;  5CR3 A;  1F9Q A;  5JVG 3;  1RTO A;  3CRK C;  4K8J A;  5EGT A;  1YNN D;  1B1Z A;  4FF1 A;  2QDB A;  3HZX A;  3VR2 A;  1SYD A;  1STB A;  3KUP A;  4DAP A;  2PMZ B;  5I2Y A;  2D2C C;  3C1F A;  1PYW D;  3GD7 A;  2EYM A;  2KUM A;  2KEE A;  3M85 A;  1HRJ A;  3D4D A;  2F0K A;  1IW7 D;  1HA6 A;  1EU3 A;  1HPC A;  1Q90 A;  2MP1 A;  3MVV A;  4PNY A;  5G3L D;  4ZKB B;  1QE6 A;  2E2J B;  2RQX A;  1BXT A;  1LT6 D;  5C4J B;  1K8O A;  1F2M A;  4UAI A;  3GTQ B;  3HOX B;  1KLG D;  3R3O A;  2MGS A;  4Q0F A;  3PUZ A;  4ABN A;  3BG3 A;  4IZ8 A;  3E5S A;  1U4P A;  1FNW A;  3H6M A;  5BN4 A;  2A69 D;  5CYU A;  2NWG A;  2IX0 A;  2NN6 G;  4RHR A;  1SNO A;  1Q1B A;  2EXZ A;  3K0Y A;  3AMU A;  2F0G A;  2EOT A;  2QIL A;  4ZQ3 A;  5C0X H;  3JAM L;  1EY4 A;  1B9M A;  3CQZ B;  2ZXP A;  2Z4I A;  4IUN A;  2L0C A;  2Z8L A;  3CHB D;  4C1N K;  1V8Q A;  2PYK A;  4KD3 A;  4IFD I;  2QF7 A;  4IFD H;  2SNM A;  3LNN A;  2XSC A;  5I2X A;  4FF2 A;  1KDC A;  5DM7 3;  3MXU A;  4G4K A;  3SK6 A;  3QB3 A;  3SVM A;  4RGM A;  4ZUI A;  2WII B;  1CT1 D;  3DWQ A;  2G9H D;  2RSN A;  3NQT A;  1SNC A;  4F7X A;  3GTG B;  5BN3 A;  3MXP A;  2NTS A;  4KMU C;  2B8F A;  3PIO 3;  1V1P B;  2SOB A;  3KF8 A;  3JAM E;  2B2T C;  5CBA E;  3HOV B;  2KHS A;  4R8N A;  3PV0 A;  4LMQ D;  5M9O A;  1TY2 A;  3RZO B;  5C3W A;  4FXD A;  4EQO A;  1Z7T A;  1OXS C;  3BYY B;  4J8Q A;  4A3K B;  4ZLT F;  5CBE E;  3NWT A;  2K5W A;  1HA5 A;  4X3K A;  2BOS A;  3PUW A;  1M4V A;  5JJZ A;  3Q6S A;  4OHJ A;  4G7O C;  2RVL A;  2XIW A;  1B9N A;  3GV6 A;  1LT3 D;  3SDZ A;  4A3J B;  2ENB A;  2B2W A;  3S2H B;  3GTO B;  5CV7 A;  4K5V A;  2N88 A;  2KOL A;  1K83 B;  1DZ1 A;  4OGQ C;  2XRS D;  2FJ2 A;  5C0X G;  3NHH A;  4CJ0 B;  4C3H B;  3EFX D;  1V1P A;  4XTC S;  3ERQ A;  3MZ5 A;  5FKA C;  2A73 B;  2X6G A;  1T5X D;  5ELD A;  3SK4 A;  4OL7 A;  5D14 A;  2RKS A;  1SDF A;  4CHT B;  2BA0 A;  4XDX A;  1K8M A;  4FP5 D;  1BCP C;  4CGY B;  2K33 A;  4BY1 B;  1S5D D;  4HTH A;  1EIH A;  5IIF A;  3HOY B;  1H9S B;  3N52 A;  1JB3 A;  1PTO F;  4X3U A;  5IGC A;  3NBH A;  1XTC D;  4R8I A;  2LKV A;  4RGN A;  3QJY A;  1MBY A;  2MPM A;  2K03 A;  1PMR A;  4H13 C;  1RJT A;  4V19 0;  5CGK A;  4IQZ A;  1BDO A;  1VMP A;  2PZT A;  1PRT D;  2B2U A;  2WKD A;  3QWN A;  5E1F A;  1B3A A;  1HXY D;  2WP8 J;  4ILW A;  2PNR C;  4PMW A;  1CHQ D;  1D5Z C;  3J80 L;  3FVQ A;  1V43 A;  3QO2 A;  2JEA I;  3WOE A;  1MD2 D;  1I4X A;  3T4A C;  3RMH A;  5T1G A;  3I4L A;  1T5E A;  1D6E C;  1JC7 A;  2D9U A;  1ILP A;  3GTL B;  2F3W A;  3KLS X;  1OXV A;  1H9S A;  3NSW A;  5IGE A;  5LL6 X;  4MHE A;  5K36 H;  4WFN 3;  3DWA A;  5HGT A;  4HCS A;  5CMD A;  1MGS A;  5D3I B;  4A3I B;  3NK9 A;  5E3F A;  5JAV A;  2BE5 C;  3BDO A;  4OO1 I;  1Y69 U;  4OO1 H;  1JOQ A;  4WJW A;  1SSO A;  5C3X A;  3IFD A;  5EBD A;  1WVL A;  1CK1 A;  2JE6 I;  4K2K A;  3EVQ A;  3HG9 A;  1TWH B;  2PO4 A;  2WAC A;  2BDN A;  4Q5V A;  3W2D A;  3EJI A;  1ET9 A;  3HOZ B;  3OIP A;  1F9R A;  2AQ1 B;  3J80 E;  3MXN A;  1UNS A;  2PPB C;  4G7H C;  5E4X A;  4M1U B;  1B44 D;  2JXM B;  2CW0 D;  1KNA A;  1DCZ A;  1A3U A;  3PMF A;  1AZQ A;  2HQE A;  3CU7 A;  3KK7 A;  4FXK C;  5EPJ A;  1STN A;  1UUP A;  5NUC A;  3R8B A;  1LTA D;  1PFM A;  3M7G A;  4HN7 A;  3J7A F;  5JPN C;  1E2W A;  4DAV A;  1SEB D;  4KHZ A;  4KJN A;  3PUV A;  3H91 A;  3FPU B;  2F0T A;  4QF4 A;  2K05 A;  4KN7 C;  1PZK D;  5M3F B;  5KGU A;  4N9P A;  2EJG C;  3BS1 A;  2EJF C;  1Q3L A;  1WTV A;  1O80 A;  5JEA H;  5FOB B;  3C2P A;  3IKJ A;  5D65 A;  1ZKO A;  1IYV A;  2R92 B;  2OT2 A;  2F03 A;  2IW3 A;  5I9P A;  4A3G B;  1ZXT A;  2WV6 D;  1Y8P B;  3BVM A;  2KQ3 A;  2HUG A;  1PTO H;  4JBW A;  1TT2 A;  1MI2 A;  1A3V A;  5HUR A;  3HOU B;  4A3B B;  1G6Z A;  5CV8 A;  3I90 A;  1HFN A;  2O2L D;  3M3Y B;  3SK8 A;  2M9V A;  2Q8T A;  2JA6 B;  4QCL A;  3OSO A;  4ULL A;  2F0H A;  2NN6 I;  1STE A;  3M4O B;  1Q1E A;  2YU9 B;  1I50 B;  2ICI A;  1MSH A;  3P75 A;  1JOK A;  2OF1 A;  2J7Z A;  4RH6 A;  5K5P A;  1QIL A;  3T16 A;  2EY1 A;  1KDB A;  2CQA A;  3D8G A;  3WDN A;  4LJZ C;  4KY7 A;  2EZV A;  4HAE A;  2PZW A;  3FMC A;  1BO0 A;  1JE4 A;  1GUN A;  3S14 B;  2DN8 A;  3VYS A;  2B2Y C;  3DMU A;  1X3P A;  3GQB A;  3R2T A;  4ZKC B;  4A3E B;  4DU9 A;  1PTO C;  3MFY A;  1HTL D;  1X3Q A;  5ELF A;  4DXG A;  4KK7 A;  2BCO A;  1LTS D;  2RA4 A;  1S5E D;  2B2T A;  4KY5 A;  5I6W A;  1IKM A;  1CZG A;  3BVZ A;  3MA2 B;  1BCP B;  2Q8R E;  3I72 A;  1SMY D;  3F2U A;  1PDQ A;  3KBG A;  2E2H B;  2J4X A;  1I6H B;  4U68 A;  1XYI A;  1SYB A;  4IFD J;  4X3S A;  3SK5 A;  4FF3 A;  5JEA G;  5T1I A;  4GZY C;  1O78 A;  3U9S A;  1CA6 A;  4XIG S;  3ITP A;  4G7Z C;  1G29 1;  2K5Q A;  3E6Z X;  5DEH A;  1E2Z A;  2EE1 A;  1HCZ A;  3P1H A;  4C56 C;  3HEJ A;  4R9W A;  5EKK A;  4KKT A;  3I4N B;  1DM0 B;  2ICE C;  4K8I A;  2A6H C;  4XYO A;  3A8J E;  2K32 A;  5G3L F;  1D1K A;  1WD1 A;  2RBM A;  1XWE A;  3TZU A;  1TWC B;  4RHS A;  3ONA B;  2HCC A;  1A3T A;  1E0B A;  1S5C D;  3NPP A;  2PW5 A;  3C1E A;  1LLR D;  5AFW A;  3KLR A;  2PCF B;  2I07 B;  3HGB A;  1OXX K;  3VYU A;  2EYJ A;  1FGB D;  3K59 A;  2WIN B;  4IAL A;  2A74 C;  1Y1W B;  2L5T A;  2KEC A;  1TQO A;  4A3D B;  5C0X I;  1SYF A;  4S3S A;  5A35 A;  3A55 A;  1FNV A;  1EU4 A;  1NUC A;  4FYD A;  3V2T A;  1AW7 A;  1M8A A;  4G57 A;  3K58 A;  2L1B A;  3FRP B;  2MHV A;  3GTM B;  3TSS A;  1CI3 M;  1SYE A;  3VR3 A;  1RCV D;  2LY7 A;  1V1O A;  1I4H A;  5FLX L;  2K6A A;  1RF2 D;  1RDP D;  3LX0 A;  4OIJ A;  1PZJ D;  2KCN A;  2IWH A;  5FK9 C;  3I3C A;  1GHJ A;  2NZ1 D;  2B2V C;  2CHB D;  4V0B A;  1Q12 A;  1EY7 A;  2JP1 A;  5CV6 A;  4YIJ A;  1TWG B;  5KEE A;  2A5H A;  2NYZ D;  2NVQ B;  5KIX A;  5A2Q L;  1LTR D;  1TKW B;  3IL8 A;  2IX1 A;  2PZU A;  1B4O A;  3Q23 A;  2ZXO A;  2NB0 A;  1LV9 A;  1ROD A;  1LO5 D;  1W6J A;  5EJW A;  1SAP A;  4IUR A;  2FFK B;  2A68 D;  3V96 A;  3H09 A;  1I3Q B;  1ZEQ X;  4B9W A;  1EL0 A;  5FLX E;  2F0D A;  4DNR B;  2JA5 B;  4EGV A;  4FO2 A;  1EY5 A;  4KJO A;  1TU2 B;  2M00 A;  2AQ3 B;  1G2S A;  2XN9 C;  3TP6 A;  1U4M A;  3NTK A;  1S5F D;  2WB1 B;  4ZK9 B;  1TS3 A;  3SEB A;  2EY6 A;  1EOT A;  3Q0A A;  3M7N A;  4BBS B;  2B8G A;  1EIG A;  1D5M C;  4RKB A;  3ND9 A;  1ENF A;  2XWB B;  3BZD B;  4K5X A;  1EQT A;  4RWS C;  4XT1 B;  2O5I C;  4FVM A;  3VYT A;  2NVX B;  2J0T D;  4BWG B;  2Y0S B;  4K14 A;  1STH A;  5C5L A;  2PW7 A;  3V05 A;  1VMC A;  3FDT A;  4IN3 A;  3IFT A;  5C5M A;  1QNU A;  1BNZ A;  1O7Z A;  2MJ8 A;  2E74 C;  1BBX C;  2F0O A;  3FKI B;  1D2B A;  1F9P A;  5IGB A;  3TME A;  3QOJ A;  5IOD A;  1A2U A;  3NBI A;  1HUN A;  1EY9 A;  1DYQ A;  2C9O A;  4Z9C B;  4XQJ A;  4HR7 B;  2GA4 B;  2HCI A;  2K01 A;  3HKZ B;  3N6R A;  1YNJ C;  3KBX A;  4TQU S;  4RA8 A;  1LTG D;  1JOR A;  1NCV A;  1JWM D;  3PUY A;  1VDZ A;  3K5O A;  3K5M A;  5ELC A;  2F3V A;  1KAA A;  1PTO B;  2HDL A;  3SE0 A;  5IOC A;  5FO8 B;  4MIU A;  3A8I E;  1YNN C;  4RKL A;  3E0J A;  3S1R B;  4CBV A;  3X3M A;  1PRT F;  1QWY A;  3RLF A;  4NP5 A;  3C3L A;  1SE4 A;  1EWH A;  3SHL A;  1GUW A;  4C3I G;  2H4O A;  1SNP A;  1C4Q A;  1C48 A;  5M3M B;  1ONL A;  4QUC A;  3QOL A;  2NVT B;  1BOS A;  4O42 A;  1PFB A;  3S15 B;  2L9H A;  1FR3 A;  2JEB I;  4H44 C;  4EVO A;  1EWC A;  2AUJ D;  1F9S A;  3U9O A;  4KKU A;  2R61 A;  1II3 A;  4U67 3;  1AN8 A;  1I4P A;  5C3E B;  1HTP A;  2A69 C;  1U4L A;  2JSO A;  3CRL C;  2L55 A;  4F87 A;  4KKS A;  5FO9 B;  3D3R A;  1EY8 A;  3J7Y W;  3A56 A;  4ID6 A;  1BR9 A;  1F2Z A;  1B50 A;  1DXM A;  1HUM A;  1STY A;  5DM6 3;  4XQQ A;  4PQX A;  5JOB A;  1CQF A;  2XNA C;  1S5B D;  2XRQ D;  1EYC A;  4O1N A;  1CA5 A;  3L7Z C;  1SNM A;  3K5N A;  2QKI C;  1WTO A;  2ZXR A;  3VA5 A;  3OMC A;  4WOR A;  3NQI A;  1ICW A;  2B2W C;  1ENA A;  2FMM A;  2Q8I B;  4KTA A;  3D6W A;  5CV9 A;  4CKE A;  5M5Y B;  2EPB A;  4PMC A;  2F0F A;  2XWJ B;  1GUT A;  3AB9 A;  1CZW A;  4ME5 A;  4CKB A;  4DN4 M;  1W6K A;  1H9J A;  1LTT D;  1DOL A;  5EPL A;  1AFP A;  3MXG A;  2F0E A;  4I65 A;  2G9D A;  4P2C B;  1TS4 A;  5LL6 S;  1F2L A;  3MEH A;  3OHX C;  4K2L A;  4NKL A;  3VYR A;  1GJX A;  1WTR A;  5KRU A;  3GTK B;  1L0Y B;  4ZUJ A;  2EDG A;  1LAC A;  2LFN A;  2OEO A;  3P7J A;  5ELE A;  2QCP X;  2K04 A;  2QEJ C;  1VCI A;  2NTT A;  3BYT B;  1NSN S;  1PLF A;  5LHY 1;  4DK0 A;  2E76 C;  3H94 A;  3I91 A;  1IHZ A;  4XYQ A;  5KNC A;  1XXG A;  5I9O A;  1A6X A;  1KDA A;  2B2U C;  5IT9 L;  3S1Q B;  4QB4 A;  1GUO A;  2EYL A;  2LS0 1;  2YYZ A;  2F0V A;  1GHK A;  3T56 B;  3NE5 B;  2E2D C;  4TRD A;  3NTI A;  3HS0 C;  2VB3 X;  4DXF A;  2L11 A;  3GTJ B;  1TWA B;  1B53 A;  4I7Z C;  4C3J G;  1R4Q B;  1WCM B;  5C4H A;  4CJ2 C;  2RSO A;  3H3V C;  3MC0 B;  4IUQ A;  2PQE A;  1ZYR C;  1H9R A;  1SE2 A;  1BCP D;  5COR A;  2H1E A;  3D4R A;  4L6T B;  1SYC A;  2DNC A;  4B9X A;  4IUT A;  4BA1 I;  3I73 A;  3IAY A;  2R3Z A;  5C0X J;  1SFO B;  1TII D;  5ISR A;  1RHP A;  3A8K E;  3TZD A;  3J7A V;  4ODG A;  2KJX A;  5M5W B;  2DY7 A;  1MSG A;  5C4X B;  1LT5 D;  4KN4 C;  2F0N A;  2BDO A;  4K5W A;  4EQP A;  1LT4 D;  3RZD B;  2RDH A;  2KED A;  3ERO A;  3H0G B;  4C3I B;  3J81 L;  5FO7 B;  1CM9 A;  1TVX A;  4RGO S;  2XVS A;  1HFG A;  3O13 A;  1CHP D;  4F8M A;  2VXW A;  4MN3 A;  3K57 A;  4RFB A;  1WTW A;  4BA2 I;  4DGZ A;  1EY0 A;  1PRT C;  1C8C A;  1O7L A;  5EBC A;  3D4W A;  1S4Z A;  1I4R A;  3MAQ A;  1JCK B;  4UDU C;  5IGD A;  4XT3 B;  1A15 A;  1GOZ A;  5DNF A;  3NUC A;  3I4M B;  4KY6 A;  1EYA A;  4X3T A;  4OIK A;  5JVH 3;  1Q8I A;  1SND A;  2TMP A;  4FNF A;  1O7Y A;  2F0Q A;  1J8I A;  2BE5 D;  3DHQ A;  1G2T A;  5C44 B;  5J1Z A;  5C6A A;  4QIW B;  3J81 E;  1LTB D;  2LMC B;  1QCB D;  3DEP A;  2N55 A;  3GV3 A;  1PZI D;  4L63 B;  2SEB D;  3WOF A;  2E75 C;  3TN2 A;  4PMB A;  1ESF A;  3L9A X;  4LAA A;  4TKO B;  2F0W A;  2V4D A;  4CKC A;  4KV6 A;  4DFA A;  4BY7 B;  2CVR A;  1DJR D;  3PUX A;  1RKN A;  2JYO A;  3BDL A;  1R9T B;  3OWE B;  2F1M A;  3KLS A;  3K7A B;  3SR1 A;  2CW0 C;  1JIC A;  1CTM A;  5M5X B;  2K28 A;  5D3D A;  2EY2 A;  2K1B A;  4IUP A;  3TP5 A;  2AQ2 B;  2A6E C;  2SDF A;  2FHT A;  2EYF A;  1IL8 A;  3D6C A;  5EKI A;  4DF7 A;  3Q22 A;  1KNE A;  2O4X A;  1UAP A;  1Z6H A;  2IT1 A;  2Z1C A;  4HCE A;  1H9M A;  3S2D B;  4F88 A;  1ET6 A;  3DEO A;  4CJ1 B;  4JK1 C;  3FEW X;  3NTH A;  2F0S A;  1Z47 A;  2Z4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...