3Q6SA

The crystal structure of the heterochromatin protein 1 beta chromoshadow domain complexed with a peptide from shugoshin 1
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
66
structure length
66
Chain Sequence
KPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chromobox protein homolog 1
publication title Mitotic centromeric targeting of HP1 and its binding to Sgo1 are dispensable for sister-chromatid cohesion in human cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 12
structure length 66
sequence length 66
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01393 Chromo_shadow Chromo shadow domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3q6sA00
2X69A 1PFMA 2SDFA 3ONAB 3QO2A 4ZLTF 1WTOA 1SSOA 4IUTA 1X3QA 1EIGA 1VMCA 2RVLA 3D6WA 2Q8TA 1WVLA 1G2TA 2FFKB 2B2WA 3KUPA 1B53A 1IL8A 1A15A 3LWEA 3IL8A 5EPLA 2B2YA 1BO0A 1IKLA 1U4MA 2B2YC 2X6LA 1WD0A 2D9UA 5DNFA 1X32A 1PFNA 2Q8RE 2J7ZA 2H1EA 3I8ZA 3I91A 2N55A 2NWGA 1B50A 2M2LA 4IURA 5EQ0A 2FJ2A 3IFDA 3TN2A 2B2UC 2MGSA 1X3PA 1Q3LA 1MSHA 2K1BA 1XX8A 3DEOA 5CBEE 4ZK9B 3F2UA 1JE4A 1B4OA 1SAPA 2B2TC 4MN3A 5CMDA 2L1BA 1BBXC 1KNAA 2RSOA 1KNEA 4HCSA 5D14A 2CVRA 1XYIA 4HSVA 2VXWA 1B3AA 4ZKCB 4RAUC 2R3ZA 4MHEA 1WD1A 1F9RA 5JJZA 4XT3B 2KOLA 3DM1A 1ILQA 5CBAE 1C8CA 2X6GA 5EPKA 2B2WC 2FHTA 2EE1A 2HDMA 4IUQA 5COYA 4ZKBB 5T1GA 1PFBA 4X3TA 5CORA 4OIJA 1O7ZA 2NZ1D 4QUFA 1O80A 1ML0D 1AP0A 1HA6A 3P7JA 1EQTA 1PLFA 2K05A 4ZAIA 2BDNA 2K28A 2MPMA 2JYOA 5E4XA 1MI2A 5EJWA 1U4PA 1RJTA 1MSGA 1DOKA 1JICA 2MP1A 1DOLA 5D65A 3R93A 1DOMA 4U68A 1E0BA 1ESRA 2B2VA 2FMMA 1F2LA 2DY7A 1QE6A 2KEDA 1WTVA 4R8IA 4RWSC 1BF4A 3HP3A 1U4RA 2HDLA 1HFNA 2N88A 3DEPA 4CJ1B 1AZPA 3TZDA 2L4NA 2EOTA 1EOTA 1ZXTA 2EPBA 3MWYW 2XIWA 4UAIA 1PDQA 1WTQA 1AZQA 4CJ0B 1HHVA 1EL0A 1ILPA 2FINB 2HCIA 2KEEA 4O42A 4IUVA 5E4WC 4OIKA 3UI2A 1DONA 1NR2A 1SDFA 3GV3A 1QG7A 4CJ2C 4HEDA 4NW2A 1F9SA 2L9HA 5AFWA 1G2SA 2RSNA 1RHPA 2KECA 1QNKA 2K04A 1M8AA 1WTXA 3SVMA 4X3UA 1ICWA 2DY8A 3MTSA 4X3KA 1EIHA 1S4ZA 5EPJA 2B2VC 1F9QA 1RODA 4IUUA 1MGSA 1G6ZA 1GUWA 4RA8A 3KBXA 1B2TA 4HAEA 3FPUB 1U4LA 1TVXA 2K03A 4DN4M 2MJ8A 1J9OA 2JP1A 4XDXA 1WTPA 1CA5A 5EKIA 1WTWA 2B2UA 2KVMA 2RA4A 2HCCA 1HFGA 1RTOA 1CA6A 4LMQD 1DZ1A 5T1IA 1G91A 1BNZA 3FDTA 1HRJA 2KUMA 1VMPA 3GV6A 4R9WA 1F9PA 1NCVA 1WTRA 3N52A 1NAPA 1LV9A 3H91A 1CM9A 3Q6SA 1O7YA 1RTNA 1HUMA 3I90A 4X3SA 2IL8A 2HUGA 2B2TA 2NYZD 2K01A 2L12A 3I3CA 3G7LA 4QUCA 1IKMA 1NR4A 4IUPA 4XT1B 1J8IA 2L11A 1HUNA
chains in the Genus database with same CATH superfamily
2C9OA 2R92G 4DKAC 2E2JH 1WD0A 3G6EA 1EY7A 2OCEA 4BBRG 3S1NH 1Y1WB 2VUMH 4GZYC 3S15B 4TSSA 2IX1A 4L63B 5EBCA 1I6VC 4P72A 1XTDA 4K5VA 2D62A 3SK6A 3KK7A 1ICFB 1F9RA 1R4QB 1K83H 2FXQA 1NJIC 2FHTA 3M4OH 2F0TA 3KLSX 2ZM6L 1TS4A 2JA6B 1C48A 1Q46A 4X3TA 2XWJB 1PH2A 1N32L 1G6PA 2VB3X 1EYAA 4KHPQ 3ULPA 3TBIB 4HR7B 1PLFA 4DXFA 2EY5A 5BR8Q 2BDNA 4KY6A 3NENA 1TT2A 3KDFA 1M1KC 3CC7A 4LFBQ 3KF8B 4HJ8A 2IHFA 2WINB 2KCMA 3EA6A 2HDLA 2EYMA 4C3IH 1EOTA 1JB7A 1PDQA 1YHAA 4IFDI 3STBC 2FINB 4DK6C 4JI7L 5E4WC 1SNPA 1BQQT 4JCVE 4CKCA 1NBWA 5IT9E 3H3VH 3DLLA 5JEAG 3Q23A 1XMOL 2O5JC 3J7AV 1Q1BA 2YU9H 1KLUD 4PZ6A 1HQRD 1QVGA 4A3KH 2UXCQ 2KHJA 1X65A 2OTLA 2YTXA 4UY8C 4DU9A 1WTHA 5EAYA 3CC2A 3HOZG 5C3EG 3K8AA 1TS5A 2J4XA 1W3SA 2F0OA 2JP1A 1HXYD 5I2XA 2HT1A 4A3GH 2E2HB 4GOPA 3E9IA 2WB1E 1XPUA 5T1IA 4IALA 1V1PA 2LXJA 1D5MC 5IIFA 3GTJB 2B2TA 1CKOA 2A6HD 4JYAQ 1TS2A 5IP7H 1GHJA 1VQAA 2MQHA 3GTGH 1WTOA 1HUNA 4ZLTF 5IY0A 2UXDQ 5FK9C 1B53A 3PO3H 4K6LA 3R3OA 2XRSD 5C44B 2K6AA 4BXXG 3PO2G 2ZJQA 1B70B 1LTID 4IURA 3LWUA 4JBJA 4LAAA 1VQ5A 3CRKC 4Q5VA 1Z6HA 4HIKA 1Y8OB 1N34L 3FKIH 5KIXA 4IN3A 1SYDA 1KHIA 1PH4A 1KRTA 1BBXC 2B39A 4X65L 4JI1L 3I4NH 1FNUA 5M5XB 3RZOB 1IYJB 3N6RA 4QCLA 4RG1A 1A62A 4FF3A 2ZXRA 4DUZL 3RN2A 2X6GA 5FJ8G 4OONA 1VQBA 5JVH3 4DNIA 3HOXG 4DV5Q 2WFWA 3I4MH 3CXCA 3P7JA 3CC4A 2RDFA 1YJ9A 1WYDA 4JI7Q 2MP1A 2B3GA 4ZCKA 3J81j 4XYOA 1DOMA 4GNXC 2JJQA 2XGTA 2BOSA 4Z9CB 1AW7A 1XMOQ 5KNBA 4R8IA 4B3SL 1ZYRC 1PRTD 5EGTA 3DEPA 1UNSA 1FJGL 4NKLA 2QDLA 3TZDA 4BY7H 3KLRA 1D7QA 2EOTA 4XQNA 1Z9FA 3GTQB 1LT6D 2SNSA 4K8JA 4OIKA 3PMFA 4MZ9A 3CCUA 4YWKA 4OWWB 1II3A 4A3BB 3DUZA 4Y7NB 4OO1G 2KECA 1S5DD 1F9QA 3L2PA 5JJLA 1GOZA 1BKBA 4R8NA 5LMNL 4BY1B 4QJFA 3H09A 2R7ZB 4DN4M 3RR5A 3L7ZC 1PH8A 2ASBA 4ZQ3A 2AUKA 5C0XJ 2RA4A 3MA2B 1S72A 3PCOB 2KENA 1HRJA 1CHPD 2F0WA 5I2YA 2KBNA 1NMGA 2Q2HA 4K5WA 3BYYB 4QUCA 3OTOL 1PTOH 4DAPA 2NN6H 5CV6A 5M9OA 3K59A 1Y1WG 5FLMH 1G2TA 2CWAA 1FNWA 1IL8A 3DM3A 3NUCA 2F0IA 2B2YC 3M7GA 3NTKA 4JI1Q 1ONLA 5DNFA 2Q8RE 4KY7A 3A74A 3SK5A 4FXGC 4I7AA 3MFGA 3PUYA 3MFYA 2JA9A 1E1TA 3JAMi 3T51B 1K73C 3NQTA 5I9OA 3QB3A 5C4XH 4MTNA 4TQUS 1W6JA 1I4RA 5LL6X 1PTOF 2A5HA 2JA6G 3KLWA 1QNUA 4LUOA 4XQJA 4A3EB 1AFPA 1EU3A 4NB3A 1OTCA 1VQ6A 3HGBA 1PHJA 4AYBB 1F2MA 4YWLA 1SE3A 2MFIA 3V96A 5JAVA 1WFQA 5G3LF 3GTPH 2JA7H 1QOHA 3SEBA 4A3DB 5M5YH 1I4GA 1VS0A 2XN9C 3K7AH 2KHIA 1VCIA 1SMXA 1ESRA 1TWAB 3ZYYX 1KTKA 3S14B 2DY7A 4FYDA 1EOVA 1HNZL 3WDNA 4DR4Q 3E9HA 3MXGA 1L0YB 4DV7L 3TP6A 1E7ZA 1TY2A 3RN5A 4R4OA 2ZXOA 2PQEA 4ILWA 1SN8A 4KY5A 2AWOA 3UI2A 2B29A 3GV3A 1EIYB 1X55A 4JI0L 2R93H 3BZCA 2ID0A 2KCCA 5HGQA 3Q8DA 1MKHA 5IWAQ 1ET9A 3S1RH 3QOJA 3CAMA 3QR8A 4X6AH 2B2VC 4UDUC 3C1FA 1MGSA 4CKEA 4JBKA 1GKHA 2K52A 1PYBA 1TVXA 2MJ8A 1B9MA 4LF5Q 3NSWA 3CHBD 1GVPA 5IGFA 1RTOA 3F2BA 1F2ZA 3D0FA 3FP9A 1SROA 3OIQA 5IGBA 4XT1B 1J8IA 3OWFA 5C44G 1FGBD 1SSOA 2RBMA 2PMZB 2E76C 3CQZB 2B2YA 1XNRL 2VQFL 2P5ZX 2Z8LA 1B3QA 4KD4A 2A8VA 5C4ZA 2JA5B 3QIAA 2QEXA 3M4PA 4L6TB 4M8AA 3H3VC 3HOYH 3HG9A 4AIMA 1XX8A 2CW0C 3DWQA 2F0GA 2VQEL 5LMUL 1A3VA 2NB0A 2R7FA 4LNQA 4G57A 5GAEC 1XYIA 2CVRA 3A5ZB 4HSVA 4JI2Q 3R2TA 2RKSA 4RGTA 2LSSA 2YYZA 2IX0A 4KK7A 2E5LQ 2OWOA 4EVOA 1K8OA 1Q81C 1VQ4A 1OXVA 1SNMA 1K0RA 2KA7A 2SNMA 2MNAA 3OW2A 1IL2A 1X6OA 4MNOA 3JC66 2GVBA 2Z9HA 1AP0A 4UHVA 2QILA 4FXDA 4BA1I 1HA6A 1UE5A 3R93A 5C4HA 2F0QA 1SR3A 1ESFA 3J7AF 2JA8B 5C0XI 4A3FB 2KJXA 1EZ6A 1IZ6A 1HFNA 2N88A 1GXDC 1E24A 2NVQB 2TSSA 1Q8IA 1QZHA 1ZXTA 1X54A 4A3BG 1J5EL 1Q1EA 3MHBA 4IUVA 1YJWA 1QUQB 4ABNA 2EYJA 4POGA 5AJ3Q 4RGMA 1T5EA 2Z4HA 4DV3L 3KFUA 3HOUH 3S24A 4H0LC 3RZDH 4BY1G 1QNKA 4UPAA 4DV1Q 1IBMQ 1SE4A 2DY8A 2K5QA 3KBGA 3NQIA 2R7ZG 4Y52H 1A63A 1VQGA 3M4YA 1HH2P 4OWTB 1FNVA 3J81L 3FPUB 4RH6A 1U4LA 5JJKA 1BCPB 1U9RA 2K03A 2HCCA 1LYLA 1H9JA 3HOVB 3S17B 1BNZA 1XNRQ 2KUMA 2YTYA 2VQFQ 1XPOA 3TRZA 1K8MA 3A54A 4LFCL 3CCMA 1K8GA 1PH6A 1RTNA 3I90A 5KYLA 2NYZD 1HTPA 2IJ0A 1S40A 1DJRD 3H15A 3M3YB 4IUTA 1IBLQ 1EIGA 1YNND 3O13A 2NVYH 2B2WA 2JEBI 1LABA 2PO4A 3A8KE 4A3MB 1YZ6A 4DNRB 1IKLA 3Q24A 3A7LA 4B3MQ 4O2DA 2NVTH 1NMFA 2NWGA 3NBIA 5EQ0A 5M5WH 2B63H 4R4CA 2PMZE 4IFDG 1AH9A 1EWCA 2OQ0A 3UDXA 2EVBA 1KD1C 2XTIA 1Q3LA 4OELB 4A3EG 2F0FA 5CMDA 2F0UA 4A4IA 4DV0Q 1HR0L 1KNEA 5C5LA 4AYBG 1OXUA 3HFZB 2PZUA 5IYBG 2KOLA 1LUZA 5M3FB 2K4KA 4HSPA 1E1OA 2A6HC 2UUAL 4JV5L 4LF9Q 4A3DG 2Y0SE 5T1GA 2EXDA 1LTBD 5BN4A 2KHSA 3S1MH 1O7ZA 4PQXA 1O80A 1AEXA 2DN8A 2E2DC 1C0AA 1I3QH 1AN8A 1PTOC 5KYIA 1HZAA 5JOBA 2G5DA 1F2LA 1TWFH 3R8BA 2KEDA 1WCMB 1SLJA 1VQEA 4KV6A 4CDCC 1PMRA 4GKKL 1KDBA 4NXNL 1IYUA 1VQ9A 5DLQE 3K5OA 1L0XB 5NUCA 3RMHA 4F8MA 3PQIA 4R1JA 1SJED 4ALPA 1ENCA 2F3IA 2L9HA 3MXNB 3ERQA 1TWCB 4LFCQ 4JI4Q 2PI2A 4HMJA 1I94Q 4G7OC 4B9WA 3NHHA 2PQAA 3PUWA 1D1IA 5JPMC 4DAYA 3HZXA 2K75A 5EKIA 3T16A 3J7A5 2LFNA 1PRTC 1VMPA 1JE5A 3PIO3 3N52A 4IUUA 3H91A 1Q86C 4TKOB 2F1MA 1ENFA 1V9PA 2TMPA 2A6EC 4HTHA 3G7LA 4IUPA 2YV5A 4JI8Q 3GP7A 1XMQQ 4H7BA 2DNEA 4GOPB 3D6WA 3E0EA 2LY7A 2WB1B 2Z4IA 3GTLH 1N36L 2JA5G 1P16A 4K2LA 1LTAD 1HR0Q 1V1PB 3GTKH 2EYOA 4B3TL 1N9WA 2CW0D 2WKCA 1IHZA 3TS0A 1TWHH 3K0XA 5BN3A 3K58A 3P20A 4GOPC 2VB2X 2BA0A 4EQNA 2RDHA 5M3MH 2ZJPA 1UAPA 4DUYQ 2F4VL 1YVCA 4J8QA 2B2TC 1B9NA 3B6YA 3SE0A 4YIJA 2R3ZA 4A3LG 1ENAA 3D4DA 1I50H 1Z7TA 2Z1CA 2A73B 1STBA 4F88A 4GN5A 1L1OC 3NWTA 4ZKBB 2EYHA 4OIJA 1M4VA 2K5VA 2RCNA 4KN7C 2OQKA 2H4OA 2D0OA 5C4JB 2JA8G 3K0YA 4A3FG 2NTTA 3TQYA 1Y1VH 2WIIB 5KGUA 1RJTA 1KIXA 1SYGA 3R2IA 2F0DA 4LFAQ 3IRBA 3HOWH 2F0PA 2MUYA 4RWSC 1D5XC 2CH4A 1A8VA 5JJIA 3OHXC 1I6HB 1N33L 4N9TA 3D31A 3J7ZC 4L5RC 2I07B 2Q2IA 5IODA 4V190 1STGA 1YITA 5HGTA 3BZKA 3I7FA 3A55A 3D8GA 3VA5A 1LACA 4JG2A 3U4VA 4O1NA 4CJ2C 1DXMA 4OHJA 4ME3A 1STHA 2C35B 1G2SA 2VL6A 4LWCA 1EIHA 4C2MB 3D4RA 1PH9A 4LF8L 4GN3B 4X62Q 4DR6Q 3GO5A 4EX5A 4C3JH 1J6QA 3ICEA 3HOVG 4N8X1 2VNUD 3MZ5A 1CKMA 4JBWA 2MO1A 3NBHA 2K14A 1VQ7A 1K3RA 1SEBD 4LK1C 3Q6SA 4DR3Q 2NUCA 3NWSA 2UUCQ 3MEFA 2L12A 3CMEA 4A3MG 1PH7A 2F4VQ 1VQHA 3TDQA 2HD3A 3SR1A 2HIXA 5E1FA 2X6LA 4GKJL 3NTHA 2F0KA 4R4IA 4XXEA 2IX3A 2OXPA 2MGSA 1JWUD 3DMUA 1STEA 1CHQD 4C3HH 4A3JB 3S1QH 3J80L 3S16H 1JJCB 2Q2UA 1VQJA 1XJVA 4LJZC 5M3FG 4ZKCB 3I4LA 5IYDH 3BVMA 3BG3A 3TP5A 3W5OA 4ZYSA 1AE3A 1KRSA 1L1OA 1A0IA 2JK8A 1ZEQX 1PTOD 3F8TA 3K5NA 4P2CB 1EEID 1SNCA 1SNQA 1D5ZC 4J1MA 3C2PA 3U58A 2ZM6Q 1WCMG 4WJ3M 2R92H 4BWGB 1N32Q 1K3BC 1B8AA 3EVQA 4U68A 1V1OA 3SGIA 3BJUA 2FMMA 3GDEA 4U673 2PNHA 3L9AX 4JPBW 5G3LD 1BF4A 1U4RA 2NZHA 1X3GA 4BBRH 4JI6L 1IW7D 2L4NA 2MHVA 5IYCG 3AFQA 1EU4A 2AQ3B 4JI5L 3S9WA 3NEMA 4GNXB 2K7VA 2HHHL 5C3XA 3IFTA 1LT5D 3I55A 2RQXA 1R9TH 4HIDA 2AKWB 5J39A 2NBFA 4RCOA 1S5CD 3AQQA 3H3VI 2HQLA 4A93B 1BDOA 2A19A 1SE8A 1EFID 4FF1A 4I65A 2K5DA 5A35A 2XRQD 4OX9L 1DM0B 1JCKB 3FPPA 3NE5B 1GUSA 2A6ED 2KVMA 1WOCA 4GKJQ 3BDCA 2NVXH 4R9WA 4MIUA 4K0KL 4BBSB 1CSPA 1D6EC 4A76A 2HUGA 2WB1G 1XXGA 3FVQA 3HS0C 3I3CA 3SXHA 4LF4L 2OF1A 3K80C 2G9HD 1E2WA 1CKNA 5C0XG 1EUJA 1VMCA 1IBKL 3FMCA 3AEVA 1JOOA 1JC7A 1JR0D 1ASZA 3AMUA 2KQ3A 3WOFA 5H1SE 3T13A 1B50A 5JEAH 3M85A 3K5MA 4PNYA 4DV6L 2E2IB 1JT8A 1R4PB 1PV4A 4LF6L 1ET6A 1KNAA 5C3EH 2VS1A 3HOZH 1CK1A 1KLGD 2VXWA 1B3AA 1N34Q 3W3AA 4YHHL 1SFOH 4A3IB 1I4PA 4XT3B 2F0HA 2A69C 3ER0A 1HQMC 3E6ZX 4X65Q 2BH8A 3H0GB 3QG1A 1WI5A 3FEWX 1GJXA 2OEOA 1TWGH 3T1YL 4JK1C 4QUFA 1ML0D 4DUZQ 1YNNC 4EQPA 2MPMA 2IHEA 1EY4A 1YNJD 2AMCB 3WOEA 2Z6BA 1TS3A 4IPHA 3K81C 4ME5A 1S5FD 1NE3A 1PVOA 3GTOH 4BXXH 3PO2H 1RL2A 1Y69U 3W1GA 3MAQA 2QEJC 5F2DA 3RLOA 3MWYW 2XIWA 4H13C 4EQ5A 4B3SQ 2ZJRA 3CW2C 3C46A 1FJGQ 4OX9Q 2CWPA 3PGZA 4ODGA 3LGJA 1SMYD 1F77A 1HNXL 4DR2L 3TP7A 3Q22A 1NNXA 4IOCA 3PIP3 3S2HH 2E2JB 1FL0A 4A75A 2LKVA 5EPJA 5FJ8H 1MJEA 3S1NB 2VUMB 3CRLC 3HOXH 3AU7A 5GROA 1UUPA 1WTPA 2LS01 1IBKQ 5LMNQ 1OO9B 2B2UA 1G91A 4DR5L 3FDTA 2ICIA 4FP5D 4HIMA 3C1EA 5FLXL 1VQNA 4DR7L 2H5XA 1K83B 1HA5A 1S5ED 1QCBD 5FKAC 3M4OB 1IKMA 2L11A 3L3OC 1RIPA 4RKBA 2ZT9C 2N8NA 2Q8TA 1JMCA 2NN6I 4DPGA 4WORA 3M7NA 3OTOQ 1JORA 4L5QA 2VW9A 1U4MA 5ELCA 2F0MA 1T5XD 4YHHQ 2EYPA 4A3JG 1H9KA 1CZWA 3URYA 2M2LA 3E3XA 4OO1H 3S2DH 4R4QA 4AH6A 4APVA 3J81c 1OXXK 3ERSX 4IPDA 4LUZA 4C3IB 1PH1A 3GTMH 1TKWB 4HCSA 4QQBX 1MJCA 4JI3L 3CPWA 1KC8C 2PNRC 2B2WC 2WV6D 1VQFA 2YU9B 5D3IB 2SOBA 2MO0A 1CFMA 2XVSA 3CCSA 4IZ8A 2ICEC 3T1HL 4A3KB 4NXML 2ENBA 1X3FA 2WAQB 3F2CA 5EJWA 3GD7A 1V1QA 1Q7YC 1Y1WH 4F87A 1EYCA 3S15H 1SNOA 1E2ZA 4DA2A 2Y0SB 4A3GB 1RF2D 2UXBL 2PCFB 1AE2A 2R61A 1WTQA 3PIPA 3EIVA 1KQSA 3NXWA 5ELBA 1TQOA 1HNZQ 1PZID 1SDFA 4DV7Q 3GTGB 5DAUA 3Q0AA 3G4SA 3CKIB 4A93G 2JA6H 1YBYA 4OL7A 2N3SA 2BE5D 4CBVA 4DXGA 3PO3B 3I2ZA 4HJAA 5IGDA 1S4ZA 4TVAB 1Q8KA 4JI0Q 1KAWA 5JVG3 1G6ZA 3KBXA 3PF5A 4PZ7A 5EKLA 4PZ8A 4DR1L 3ITPA 3FKIB 4BBSG 1W2BA 2F3WA 5KRUA 1LO5D 3I4NB 4AQYL 1B1ZA 2BCOA 2Z6KA 2IT1A 1TR5A 4XQQA 1PYSB 2IPKD 4X3SA 1SYFA 2C5CA 1NR4A 1FGUA 1K9MC 2N49A 4CHTB 3RLFA 4GN4B 2I5LX 4KI0A 5LMNW 3CCLA 5CV7A 4YWMA 2AQ1B 3I4MB 3KUPA 1S3OA 4X66L 1FYCA 1VQ8A 4NMZA 4WFN3 5IGEA 3HKZE 1GUTA 3TN2A 2EXZA 2FMCA 2K5HA 3JAML 2A69D 4A3IG 3CP0A 4BS9A 2E2HH 4ZK9B 2E75C 4G4KA 4BY7B 3NPPA 4MN3A 5IT9L 3KLSA 4ULLA 2RHSB 3ULLA 1YNXA 2JSOA 4KHVA 4S3SA 3H0GG 5EKKA 1RDPD 4K6DA 1RD9D 5JJZA 3GTJH 1F2YA 5LMUQ 2VQEQ 1UEBA 5E3FA 4PMWA 1MD2D 4QY7A 4DV2L 5K36G 1EZ8A 3A8IE 2N78A 1UE6A 2NZ1D 4QMGA 5KNDA 4H44C 5I6YA 4IPGA 3WWVA 5C44H 1YHQA 2E74C 2CQAA 2L15A 4KMUC 3PUVA 1XNQL 3PUXA 2I46A 4G7HC 2WAQE 1CQVA 2D5DA 3G48A 1HNWL 1DD2A 3K57A 1M90C 1HHVA 4C1NI 5M5XH 3RZOH 1ILPA 2HCIA 2K5NA 4DK0A 1MIUA 5I6WA 1EQQA 1PTOB 1U0LA 3D6CA 3QJYA 1UEAB 3FHWA 2J0TD 1STYA 1F9SA 4P74A 4KLKA 1J5EQ 2VUMG 3SK8A 3RUZA 3OYYA 4HJ7A 3A0JA 3MTSA 4WJWA 4RFBA 4DV3Q 1C9OA 1YHBA 4RA8A 5KNCA 5IOCA 3PF4A 2KCTA 1A3TA 5C4XB 5BN5A 2Q8IB 1CA5A 3KDFB 1WTWA 4JBMA 1O7LA 4LMQD 5C6AA 3HRZC 1T9HA 1TU2B 2BDOA 1IW7C 2DJGC 3C3LA 4DGZA 4DAVA 4DAMA 3GTQH 1D2BA 5J1ZA 3OMCA 3SK4A 1S5BD 2KCNA 2SDFA 3TSSA 4A3BH 4Y7NH 4QB4A 2PI2E 2ZTDA 2AUJD 5EPLA 3NBHB 1A15A 2I5HA 1GD7A 3GTPB 2JA7B 1PRTB 1BO0A 3VR5A 3CCRA 2EDGA 1SYEA 2A68C 4LF7L 5M5YB 1X32A 2A74C 4G7ZC 2H1EA 4C3IG 3K7AB 4HJ5A 4BY1H 3A8JE 2K33A 5FO7B 2R7ZH 3DWPA 4KKSA 2DJFC 1EY8A 1JWMD 3J7YW 2EYFA 1QJOA 5CV4A 4X64L 1B4OA 1YI2A 2RF4A 4CDDC 1EY6A 4QF4A 3CD6A 2HQEA 4ZUJA 1ILQA 3V2TA 5IE8A 4V0BA 4KHPL 5EPKA 1XNQQ 3K7UC 4A3KG 1TIID 5BR8L 1K0SA 1FVIA 1SNDA 5GAGC 2WAQG 2R93B 1PFBA 1BR9A 3BVZA 3A7AB 1HNWQ 4IJHA 3K6OA 3S1RB 3T4AC 4LFBL 2O4XA 2CQOA 2UUAQ 4A3GG 2Y0SG 4JV5Q 2JYOA 1GO3E 4RHRA 1L1OB 2F4IA 3VYUA 4DNTB 1NSNS 1WTVA 2GN5A 1L2FA 5IP7G 1DYQA 3VA7A 4IFDH 2CH4W 1G51A 2EPBA 5CV5A 2VY3A 5LHY1 3J80c 1CT1D 4N8FA 3PO3G 4XYQA 3G6JB 1NY4A 4A3EH 3MVVA 3KF6A 4GKKQ 4NXNQ 2ZTCA 4CGYB 1PA6A 3EQLC 4HCEA 3X3NA 4OEMB 3OIPA 4ZRZA 1VQOA 4DFAA 2ZTEA 2EQSA 2M00A 1JB3A 5IYBH 2K04A 3ND8A 3SVMA 4X3KA 2PW7A 3FKIG 1PH5A 1JOKA 5GQOA 4A3DH 1RODA 3OMGA 1EWIA 3UDIA 1YNJC 2ATWA 1VQMA 3OWEB 4IQZA 3I4NG 1XPRA 1TWAH 4KJOA 3S14H 3HOYB 2UUBL 3CPFA 1D1KA 2B8GA 1OXSC 2IWHA 4JYAL 1Q12A 1H9SA 3KYHC 4LF7Q 1F9PA 1WTRA 2QDBA 1IYVA 2UXDL 3K5LA 2K01A 3I4MG 3NP8A 3QO2A 3ONAB 3T56B 1VF5C 4X64Q 4FXKC 1SMYC 2FFKB 3PIOA 1SYCA 3X3MA 1W6KA 1LTSD 2O2LD 1HPCA 4NP5A 2SEBD 1KAAA 3U50C 1N36Q 4BY7G 3LX0A 4B3TQ 1CKNB 3TREA 1VF7A 3DEOA 2EY2A 4RGNA 3F2UA 4HN7A 1BXTA 3U9SA 2F0JA 2JQOA 2L5TA 4MTKA 2GA4B 2EJMA 3J81E 5DEHA 4MHEA 3MXNA 1WD1A 4JC0A 4EGVA 4DV5L 4FDBA 2PZTA 1BCPD 5CBAE 4POFA 4L5TA 3HOUB 3OPOA 3F1ZA 1PZJD 3RZDB 1NUCA 3VYRA 3BYTB 3JAME 1LTLA 1EQTA 3CQZH 2F0LA 2QKIC 1N8RC 1U4PA 2ALYB 1G8ZD 3CMAA 1I4HA 1HR0W 2JA5H 1VQPA 2NTSA 1GM5A 3UDFA 3D4WA 4KKTA 1PFSA 1JQYD 5ELOA 5IP9G 5I4DA 5JEAJ 4CJ1B 3IKJA 1PH3A 3A56A 4RCNA 2NN6G 4UAIA 1EL0A 1LLRD 5FLMG 2V1CC 2IW3A 1SXTA 5C5MA 2EYLA 2JE6I 1CTMA 1UWVA 1N33Q 2UUBQ 3DXJC 4HEDA 5L37A 5LL6S 2JEAI 2NVYB 4A3LH 2RSNA 2V4DA 4IOAA 2XNAC 3M4QA 4X3UA 5C4XG 3CCVA 1X56A 2NVTB 2B63B 5M5WB 1P8LA 4IPCA 2JA8H 4A3FH 4LF8Q 1GUNA 2UU9L 1CUKA 4QL5A 4P75A 1CA6A 2NVQH 3I70A 5CC4A 3U9OA 3VR2A 2E8GA 4ID6A 3MXPA 2Q2TA 2F52A 1Y8PB 1HUMA 4O0AA 3VR3A 1YEZA 2ES2A 3VYTA 1A2UA 4FO2A 1STNA 3BS1A 2A68D 2JA7G 4K5XA 2OTJA 3P1HA 1EY0A 5CYUA 3BU2A 3S1MB 2DGYA 1WVLA 3IL8A 2BE5C 1H95A 4LUVA 1SE2A 1QZGA 4FF4A 2CKZB 1I3QB 4PMBA 2FJ2A 1LT3D 4CDEC 1RCVD 2B2UC 1E22A 1TWFB 1VDZA 1KABA 3GQBA 2CFMA 2K1BA 3QWNA 1HZCA 2RSOA 5D14A 3HOVH 3S17H 1EEFD 1LTRD 2M9VA 3H6MA 2WKDA 1I5FA 2R93G 3DM1A 1BBWA 5ELNA 4ZUIA 1IXRA 1DCZA 3KF8A 5FLXc 4UP9A 2EIFA 4DK1A 4IUQA 2DUDA 5COYA 3M3YH 3E5SA 4A3MH 3KJPA 1QVCA 4PV1C 1BCPF 3OOCA 1DOKA 1JICA 4KJNA 1DOLA 4BA2I 4DR4L 1E0BA 1C4QA 2AQ2B 1QE6A 3HP3A 2A1AA 4OWXB 4TRDA 1AZPA 1AZQA 3BVGA 2PW5A 4P71A 1H9MA 1EY5A 5ELFA 5IWAL 3W2DA 4KKUA 1NR2A 2I5MX 4IO9A 1TY0A 4JI6Q 2PPBC 3TEHB 5M3FH 4JI5Q 1BVSA 2BA1A 2UU9Q 5IP9H 3GTLB 5AFWA 1RHPA 2HHHQ 1CI3M 3EFXD 5GADC 4L5SA 3SDZA 3GTKB 3TS2A 4LF5L 4OGQC 3J81i 3HOYG 1K8AC 1TWHB 5GAHC 4B08A 4HAEA 5CV9A 5M3MB 4FVMA 1D8LA 5KEEA 1G291 1WCMH 1EYDA 2YTVA 5D3DA 5A2QL 3F2DA 1NCVA 3PV0A 4J15A 3E0JA 3VR4A 4A3CG 1QILA 2IL8A 1I50B 4XIGS 4NDXA 3RNUA 5J3BA 5IGCA 5IYCH 3H94A 5DM73 2X69A 4K0KQ 4PMCA 3QOLA 4LF4Q 4GLAC 2EY1A 1TWCH 2D9UA 1Y1VB 4KN4C 3I91A 2N55A 1VQCA 3M9BA 1GHKA 3EJIA 4YCUA 3UE0A 1KL9A 2QW7A 3HOWB 3I56A 4JI2L 1MSHA 3UDGA 1VQDA 2Z6KC 4GNXA 5CBEE 2F3VA 2E5LL 1SAPA 2Z0SA 3DWAA 5FO9B 2L1BA 3P75A 3HKSA 3STBD 4C1NK 1QB5D 3HOUG 4DV6Q 2XSCA 4GLXA 3HKZB 2VZAA 2CHBD 1CSQA 5E7NA 4YY3L 4LF6Q 2EE1A 4FF2A 2HDMA 2B8FA 3AFPA 3W1BA 5ISRA 1Q82C 2K05A 3FRPB 1PRTF 3NELA 4ZAIA 2K28A 1EQRA 5E4XA 1MI2A 1EYGA 5C0XH 1MSGA 4C3JB 5D65A 3T1YQ 4RHSA 1K28A 4HMIA 4J6HA 3HEJA 4QIWB 3PSIA 4E6IA 2CCZA 4RMFA 2BH2A 4JW0A 5AJ3L 3JAMc 3TMEA 4OXPA 5IT9c 4K8IA 1HZ9A 4DV1L 1DONA 1IBML 1X9NA 1STAA 3J80E 1FR3A 1TXYA 1XTCD 4KD3A 4NW2A 3EBEA 4QGUA 1CQFA 1B7YB 2B63G 1ZKOA 1FD7D 4Q0FA 1M8AA 4DF7A 1Q90A 1WTXA 3AYHB 5C4JH 1KDAA 1X3EA 3VDYA 3UE1A 1HNXQ 4DR2Q 1B2TA 5FOBB 3I72A 4I7ZC 1JWSD 2QCPX 2G9DA 4XDXA 3ULJA 4C3HB 3S1QB 2PZWA 3S16B 1H9RA 1A2TA 3CCEA 1HFGA 1UE7A 2QF7A 1I6HH 2IY5B 1DZ1A 3EN2A 1PZKD 4L8JA 3GV6A 3OW7A 5JPNC 2JN4A 1IBLL 2F0VA 4WJ4A 4DV4L 3A5UA 1EWHA 2F0SA 4GLVB 3G71A 4DR5Q 1LM0A 2L0CA 3KOJA 1QVFA 1PFMA 4B3ML 3TZUA 3EROA 3VR6A 1X3QA 4DR7Q 2F03A 3LWEA 1RKNA 1WJJA 4C2MH 2L55A 4A3CH 1PFNA 2R92B 2J7ZA 3I8ZA 4YY3Q 5C3WA 3RD4A 3IFDA 1ASYA 2RCFA 4DV0L 1ZYRD 2NZOA 2F0NA 4OO1I 4YCWA 4AYBE 4BBRB 1PYWD 5FO8B 3BZDB 4B3RL 2PQAB 4LF9L 1E3PA 4RAUC 5CV8A 4DAYB 1V8QA 3BDOA 1R9TB 1C8CA 1EY9A 5J22A 4K14A 4HJ9A 1V43A 5CORA 4JI3Q 4GS3A 2EY6A 2B2VA 3T1HQ 2EJFC 2HIVA 1EFWA 4NXMQ 1I4QA 1C7YA 4A3JH 1Z47A 4FNFA 4JOIC 3AB9A 2NVXB 1LTTD 4WRDA 2I0QA 1SJHD 2JXMB 3I73A 2UXBQ 2KEEA 5EBDA 4O42A 4QIWE 4R4TA 1BUVT 3MEHA 3PUZA 1QG7A 4JI4L 1LTGD 1BCPC 1EIFA 2DNCA 2K5WA 3V05A 1I94L 3L0OA 4RGOS 5TSSA 5M3MG 1ICWA 2ZXPA 4DK3C 2QA4A 1A6XA 4DV4Q 1GUWA 1LT4D 2QGQA 3KF6B 1L0WA 1U5KA 3KJOA 3VYSA 5ELEA 3CCJA 3CCQA 4P73A 3HOZB 4DR1Q 4JI8L 5C3EB 3NTIA 1GUGA 4XTCS 1XMQL 4KHZA 3DHQA 1SFOB 1CM9A 2XWBB 2LXKA 5I9PA 4B9XA 2D0PA 4IFDJ 1E2VA 2K50A 5HURA 4AQYQ 1Y1VG 1JOQA 1TWGB 1EQVA 2RVLA 1BOSA 5HY6A 2O5IC 1H9SB 2WP8J 1PXUA 4B3RQ 4NPSA 3HOWG 3MC0B 4DUYL 1JJGA 4A93H 1A3UA 5A2QE 1VQIA 2K32A 3CU7A 2EJGC 4HIOA 1OXTA 4X66Q 1UE1A 1X3PA 3MXUA 1BBUA 3J80i 3GTOB 2AWNA 1O78A 1SRUA 3HKZG 3PO2B 4PG3A 1JE4A 1VQLA 1HJPA 4N9PA 4IJLA 1SBBB 4BBSH 2AHOB 2R7DA 3T53B 4UP7A 1GUOA 1HCZA 1MHWC 4CKBA 2D2CC 4C3JG 3S2HB 3U4ZA 3ND9A 3CF5A 5FLXE 2R6GA 4LFAL 2OT2A 4DV2Q 3HOXB 1HZBA 5CR3A 1KXLA 1QUQA 2RHQB 4IUNA 3RLNA 1XWEA 2E2IH 4JOIA 1I4XA 1KDCA 4F7XA 1Y14B 3SHLA 4CJ0B 1YJNA 3LNNA 4M1UB 3ZJYC 4UP8A 5K5PA 4LW1A 4A3IH 1YIJA 1DGSA 3IAYA 5IGGA 1Y8NB 5CGKA 5ELDA 1CZGA 4C56C 3H0GH 4X62L 4DR6L 3BDLA 4EQOA 3TP8A 3OSOA 4CDFC 1B44D 1HTLD 3NK9A 4C3HG 2EZVA 3I4OA 5K36H 1NTGA 3S2DB 1JJ2A 1O7IA 2PYKA 4JVZA 4RKLA 4YCVA 4H02A 2LMCB 1J9OA 5IYDG 4DR3L 2GVAA 2RDGA 2UUCL 1MBYA 3GTMB 5DM63 2WACA 1SYBA 2F0EA 1NAPA 1LV9A 4KTAA 2UXCL 1O7YA 3D3RA 1VQKA 4K2KA 1QWYA
chains in the Genus database with same CATH topology
2C9OA 1WD0A 1EY7A 1Y1WB 4GZYC 3S15B 4TSSA 2IX1A 4L63B 5EBCA 1I6VC 4K5VA 2D62A 3SK6A 3KK7A 1F9RA 1R4QB 2FHTA 2F0TA 3KLSX 1TS4A 2JA6B 1C48A 4X3TA 2XWJB 2VB3X 1EYAA 3TBIB 4HR7B 1PLFA 4DXFA 2EY5A 2BDNA 4KY6A 1TT2A 2WINB 3EA6A 2HDLA 2EYMA 1EOTA 1PDQA 4IFDI 2FINB 5E4WC 1SNPA 1BQQT 4CKCA 5IT9E 5JEAG 3Q23A 2O5JC 3J7AV 1Q1BA 1KLUD 1HQRD 4DU9A 1TS5A 2J4XA 2F0OA 2JP1A 1HXYD 5I2XA 2E2HB 5T1IA 4IALA 1V1PA 1D5MC 5IIFA 3GTJB 2B2TA 2A6HD 1TS2A 1GHJA 1HUNA 1WTOA 4ZLTF 5FK9C 1B53A 4K6LA 3R3OA 2XRSD 5C44B 2K6AA 1LTID 4LAAA 4IURA 3LWUA 3CRKC 4Q5VA 1Z6HA 1Y8OB 5KIXA 4IN3A 1SYDA 1BBXC 2B39A 1FNUA 5M5XB 3RZOB 4QCLA 3N6RA 4FF3A 2ZXRA 2X6GA 5JVH3 3P7JA 2RDFA 2MP1A 4XYOA 1DOMA 2BOSA 4Z9CB 1AW7A 5KNBA 4R8IA 1ZYRC 1PRTD 5EGTA 3DEPA 1UNSA 4NKLA 3TZDA 3KLRA 2EOTA 4XQNA 3GTQB 1LT6D 2SNSA 4K8JA 4OIKA 3PMFA 1II3A 4A3BB 3DUZA 4Y7NB 4OO1G 2KECA 1S5DD 1F9QA 1GOZA 4R8NA 4BY1B 3H09A 2R7ZB 4DN4M 3L7ZC 4ZQ3A 2AUKA 5C0XJ 2RA4A 3MA2B 1HRJA 1CHPD 2F0WA 5I2YA 4K5WA 3BYYB 4QUCA 1PTOH 4DAPA 2NN6H 5CV6A 5M9OA 3K59A 1G2TA 1FNWA 1IL8A 3NUCA 2F0IA 2B2YC 3M7GA 3NTKA 1ONLA 5DNFA 2Q8RE 4KY7A 3SK5A 4FXGC 3MFGA 3PUYA 3MFYA 3T51B 3NQTA 5I9OA 3QB3A 4TQUS 1W6JA 1I4RA 5LL6X 1PTOF 2A5HA 1QNUA 4XQJA 4A3EB 1AFPA 1EU3A 3HGBA 4AYBB 1F2MA 1SE3A 3V96A 5JAVA 5G3LF 1QOHA 3SEBA 4A3DB 1I4GA 2XN9C 1VCIA 1ESRA 1TWAB 3ZYYX 1KTKA 3S14B 2DY7A 4FYDA 3WDNA 3MXGA 1L0YB 3TP6A 1TY2A 2ZXOA 2PQEA 4ILWA 4KY5A 2AWOA 3UI2A 3GV3A 2ID0A 2KCCA 1ET9A 3QOJA 2B2VC 4UDUC 3C1FA 1MGSA 4CKEA 1TVXA 2MJ8A 1B9MA 3NSWA 3CHBD 5IGFA 1RTOA 1F2ZA 3OIQA 5IGBA 4XT1B 1J8IA 3OWFA 1FGBD 1SSOA 2RBMA 2PMZB 2E76C 3CQZB 2B2YA 2Z8LA 4KD4A 5C4ZA 2JA5B 3QIAA 4L6TB 4M8AA 3H3VC 3HG9A 1XX8A 2CW0C 3DWQA 2F0GA 1A3VA 2NB0A 4G57A 1XYIA 2CVRA 4HSVA 3R2TA 2RKSA 4RGTA 2YYZA 2IX0A 4KK7A 4EVOA 1K8OA 1OXVA 1SNMA 2KA7A 2SNMA 1AP0A 1HA6A 2QILA 4FXDA 4BA1I 3R93A 5C4HA 2F0QA 1ESFA 3J7AF 2JA8B 5C0XI 4A3FB 2KJXA 1EZ6A 1HFNA 2N88A 1GXDC 2NVQB 2TSSA 1Q8IA 1ZXTA 1Q1EA 3MHBA 4IUVA 4ABNA 2EYJA 4RGMA 1T5EA 2Z4HA 4H0LC 1QNKA 1SE4A 2DY8A 2K5QA 3KBGA 3NQIA 3M4YA 1FNVA 3J81L 3FPUB 4RH6A 1U4LA 1BCPB 1U9RA 2K03A 2HCCA 1H9JA 3HOVB 3S17B 1BNZA 2KUMA 1K8MA 3A54A 1RTNA 3I90A 5KYLA 2NYZD 1HTPA 2IJ0A 1DJRD 3M3YB 4IUTA 1EIGA 1YNND 3O13A 4A3MB 2B2WA 2JEBI 1LABA 2PO4A 3A8KE 4DNRB 1IKLA 3Q24A 3A7LA 2NWGA 3NBIA 5EQ0A 4IFDG 1EWCA 2EVBA 1Q3LA 2F0FA 5CMDA 2F0UA 1KNEA 5C5LA 1OXUA 2PZUA 2KOLA 5M3FB 4HSPA 2A6HC 5T1GA 1LTBD 5BN4A 2KHSA 1O7ZA 4PQXA 1O80A 1AEXA 2DN8A 2E2DC 1AN8A 1PTOC 5KYIA 5JOBA 1F2LA 3R8BA 2KEDA 1WCMB 4KV6A 1PMRA 1KDBA 1IYUA 3K5OA 1L0XB 5NUCA 3RMHA 4F8MA 1SJED 1ENCA 2L9HA 3ERQA 1TWCB 4HMJA 4G7OC 4B9WA 3NHHA 3PUWA 1D1IA 5JPMC 4DAYA 3HZXA 5EKIA 3T16A 2LFNA 1PRTC 1VMPA 3PIO3 3N52A 4IUUA 3H91A 4TKOB 1ENFA 2F1MA 2TMPA 2A6EC 4HTHA 3G7LA 4IUPA 3GP7A 4H7BA 2DNEA 3D6WA 2LY7A 2WB1B 2Z4IA 4K2LA 1LTAD 1V1PB 2EYOA 2CW0D 2WKCA 1IHZA 5BN3A 3K58A 3P20A 2VB2X 2BA0A 4EQNA 2RDHA 1UAPA 4J8QA 2B2TC 1B9NA 3SE0A 4YIJA 2R3ZA 1ENAA 3D4DA 1Z7TA 2Z1CA 2A73B 1STBA 4F88A 3NWTA 4ZKBB 2EYHA 4OIJA 1M4VA 4KN7C 2H4OA 5C4JB 3K0YA 2NTTA 2WIIB 5KGUA 1RJTA 1SYGA 3R2IA 2F0DA 2F0PA 2MUYA 4RWSC 1D5XC 3OHXC 1I6HB 4N9TA 3D31A 2I07B 5IODA 4V190 1STGA 5HGTA 3A55A 3D8GA 3VA5A 1LACA 4O1NA 4CJ2C 1DXMA 4OHJA 1STHA 1G2SA 1EIHA 4C2MB 3D4RA 3GO5A 2VNUD 3MZ5A 4JBWA 3NBHA 1SEBD 4LK1C 3Q6SA 2NUCA 3NWSA 2L12A 3TDQA 3SR1A 5E1FA 2X6LA 3NTHA 2F0KA 4XXEA 2IX3A 2OXPA 2MGSA 1JWUD 3DMUA 1STEA 1CHQD 4A3JB 3J80L 4LJZC 4ZKCB 3I4LA 3BVMA 3BG3A 3TP5A 4ZYSA 1ZEQX 1PTOD 3K5NA 4P2CB 1EEID 1SNCA 1SNQA 1D5ZC 4J1MA 3C2PA 4BWGB 3EVQA 4U68A 1V1OA 2FMMA 4U673 3L9AX 5G3LD 1BF4A 1U4RA 1IW7D 2L4NA 2MHVA 1EU4A 2AQ3B 3S9WA 2K7VA 5C3XA 3IFTA 1LT5D 2RQXA 5J39A 2NBFA 4RCOA 1S5CD 4A93B 1BDOA 1EFID 4FF1A 4I65A 2K5DA 5A35A 2XRQD 1DM0B 1JCKB 3FPPA 3NE5B 1GUSA 2A6ED 2KVMA 3BDCA 4R9WA 4MIUA 4BBSB 1D6EC 2HUGA 1XXGA 3FVQA 3HS0C 3I3CA 3SXHA 2OF1A 2G9HD 1E2WA 5C0XG 1VMCA 3FMCA 1JOOA 1JC7A 1JR0D 3AMUA 2KQ3A 3WOFA 3T13A 1B50A 5JEAH 3M85A 3K5MA 4PNYA 2E2IB 1R4PB 1ET6A 1KNAA 1CK1A 1KLGD 2VXWA 1B3AA 3W3AA 4A3IB 1I4PA 4XT3B 2F0HA 2A69C 1HQMC 3E6ZX 3FEWX 3H0GB 3QG1A 1GJXA 2OEOA 4JK1C 4QUFA 1ML0D 1YNNC 4EQPA 2MPMA 1EY4A 1YNJD 3WOEA 1TS3A 4ME5A 1S5FD 1Y69U 3MAQA 2QEJC 5F2DA 3MWYW 2XIWA 4H13C 3C46A 4ODGA 1SMYD 1F77A 3TP7A 3Q22A 2E2JB 3PIP3 2LKVA 5EPJA 3S1NB 2VUMB 3CRLC 3AU7A 1UUPA 1WTPA 2LS01 1OO9B 2B2UA 1G91A 3FDTA 2ICIA 4FP5D 3C1EA 5FLXL 1K83B 1HA5A 1S5ED 1QCBD 5FKAC 3M4OB 1IKMA 2L11A 3L3OC 4RKBA 2ZT9C 2Q8TA 2NN6I 4WORA 3M7NA 1JORA 1U4MA 5ELCA 2F0MA 1T5XD 2EYPA 1H9KA 1CZWA 3URYA 2M2LA 4OO1H 1OXXK 4C3IB 1TKWB 4HCSA 2PNRC 2B2WC 2WV6D 2YU9B 5D3IB 2SOBA 1CFMA 2XVSA 4IZ8A 2ICEC 4A3KB 2ENBA 2WAQB 5EJWA 3GD7A 4F87A 1EYCA 1SNOA 1E2ZA 4DA2A 2Y0SB 4A3GB 1RF2D 2PCFB 2R61A 1WTQA 3NXWA 5ELBA 1TQOA 1PZID 1SDFA 3GTGB 5DAUA 3Q0AA 3CKIB 4OL7A 2BE5D 4CBVA 4DXGA 3PO3B 5IGDA 1S4ZA 1G6ZA 5JVG3 3KBXA 5EKLA 3ITPA 3FKIB 2F3WA 5KRUA 1LO5D 3I4NB 1B1ZA 2BCOA 2IT1A 1TR5A 4XQQA 2IPKD 4X3SA 1SYFA 2C5CA 1NR4A 4CHTB 3RLFA 4KI0A 5CV7A 2AQ1B 3I4MB 3KUPA 1FYCA 4NMZA 4WFN3 5IGEA 1GUTA 3TN2A 2EXZA 2FMCA 3JAML 2A69D 4BS9A 4ZK9B 2E75C 4G4KA 4BY7B 3NPPA 4MN3A 5IT9L 3KLSA 4ULLA 2JSOA 4KHVA 4S3SA 5EKKA 1RDPD 4K6DA 1RD9D 5JJZA 1F2YA 5E3FA 4PMWA 1MD2D 5K36G 1EZ8A 3A8IE 2NZ1D 4QMGA 5KNDA 4H44C 5I6YA 2E74C 2CQAA 4KMUC 3PUVA 3PUXA 2I46A 4G7HC 1CQVA 2D5DA 1DD2A 3K57A 1HHVA 4C1NI 1ILPA 2HCIA 4DK0A 5I6WA 1PTOB 3D6CA 3QJYA 1UEAB 2J0TD 1STYA 1F9SA 3SK8A 3RUZA 3MTSA 4WJWA 4RFBA 4RA8A 5KNCA 5IOCA 1A3TA 5C4XB 5BN5A 2Q8IB 1CA5A 1WTWA 1O7LA 4LMQD 5C6AA 3HRZC 1TU2B 2BDOA 1IW7C 3C3LA 4DGZA 4DAVA 1D2BA 5J1ZA 3OMCA 3SK4A 1S5BD 2KCNA 2SDFA 3TSSA 4QB4A 2AUJD 5EPLA 3GTPB 1A15A 2JA7B 1PRTB 1BO0A 3VR5A 2EDGA 1SYEA 2A68C 5M5YB 1X32A 2A74C 4G7ZC 2H1EA 4C3IG 3K7AB 3A8JE 2K33A 5FO7B 3DWPA 4KKSA 1EY8A 1JWMD 3J7YW 2EYFA 1QJOA 5CV4A 1B4OA 1EY6A 4QF4A 2HQEA 4ZUJA 1ILQA 3V2TA 4V0BA 5EPKA 1TIID 1SNDA 2R93B 1PFBA 1BR9A 3BVZA 3A7AB 3K6OA 3S1RB 3T4AC 2O4XA 2JYOA 4RHRA 2F4IA 3VYUA 4DNTB 1NSNS 1WTVA 1DYQA 3VA7A 4IFDH 2EPBA 5CV5A 5LHY1 1CT1D 4XYQA 3G6JB 3MVVA 4CGYB 3EQLC 4HCEA 3X3NA 3OIPA 4ZRZA 4DFAA 2M00A 1JB3A 2K04A 3ND8A 3SVMA 4X3KA 2PW7A 1JOKA 1RODA 3OMGA 1YNJC 3OWEB 4IQZA 4KJOA 3HOYB 1D1KA 2B8GA 1OXSC 2IWHA 1Q12A 1H9SA 1F9PA 1WTRA 2QDBA 1IYVA 3K5LA 2K01A 3NP8A 3QO2A 3ONAB 3T56B 1VF5C 4FXKC 1SMYC 2FFKB 1SYCA 3X3MA 1W6KA 1LTSD 2O2LD 1HPCA 4NP5A 2SEBD 1KAAA 3LX0A 1VF7A 3DEOA 2EY2A 4RGNA 3F2UA 4HN7A 1BXTA 3U9SA 2F0JA 2L5TA 2GA4B 2EJMA 3J81E 5DEHA 4MHEA 3MXNA 1WD1A 4EGVA 2PZTA 1BCPD 5CBAE 3HOUB 3OPOA 1PZJD 3RZDB 1NUCA 3VYRA 3BYTB 3JAME 1EQTA 2F0LA 2QKIC 1U4PA 1G8ZD 1I4HA 2NTSA 3D4WA 4KKTA 1JQYD 5I4DA 5JEAJ 4CJ1B 3IKJA 3A56A 4RCNA 2NN6G 4UAIA 1EL0A 1LLRD 2IW3A 1SXTA 5C5MA 2EYLA 2JE6I 1CTMA 3DXJC 4HEDA 2JEAI 5LL6S 2NVYB 2RSNA 2V4DA 2XNAC 4X3UA 2NVTB 2B63B 5M5WB 1GUNA 1CA6A 3I70A 5CC4A 3U9OA 3VR2A 4ID6A 3MXPA 1Y8PB 1HUMA 3VR3A 3VYTA 1A2UA 4FO2A 1STNA 3BS1A 2A68D 4K5XA 3P1HA 1EY0A 5CYUA 3S1MB 1WVLA 3IL8A 2BE5C 1SE2A 4FF4A 1I3QB 4PMBA 2FJ2A 1LT3D 1RCVD 2B2UC 1TWFB 1VDZA 1KABA 3GQBA 2K1BA 3QWNA 2RSOA 5D14A 1EEFD 1LTRD 2M9VA 3H6MA 2WKDA 3DM1A 4ZUIA 1DCZA 3KF8A 4DK1A 4IUQA 5COYA 3E5SA 4PV1C 1BCPF 3OOCA 1DOKA 1JICA 4KJNA 1DOLA 4BA2I 1E0BA 1C4QA 2AQ2B 1QE6A 3HP3A 4TRDA 1AZPA 1AZQA 3BVGA 2PW5A 1H9MA 1EY5A 5ELFA 3W2DA 4KKUA 1NR2A 1TY0A 2PPBC 2BA1A 3GTLB 5AFWA 1RHPA 1CI3M 3EFXD 3SDZA 3GTKB 4OGQC 1TWHB 4B08A 4HAEA 5CV9A 5M3MB 4FVMA 5KEEA 1G291 5D3DA 1EYDA 5A2QL 1NCVA 3PV0A 3E0JA 3VR4A 1QILA 2IL8A 1I50B 4XIGS 4NDXA 5IGCA 3H94A 5DM73 2X69A 4PMCA 3QOLA 2EY1A 2D9UA 1Y1VB 4KN4C 3I91A 2N55A 1GHKA 3EJIA 3HOWB 1MSHA 5CBEE 2F3VA 1SAPA 3DWAA 5FO9B 2L1BA 3P75A 4C1NK 1QB5D 2XSCA 3HKZB 2CHBD 2EE1A 4FF2A 2HDMA 2B8FA 5ISRA 2K05A 3FRPB 1PRTF 4ZAIA 2K28A 5E4XA 1MI2A 5C0XH 1MSGA 4C3JB 5D65A 4RHSA 4HMIA 4J6HA 3HEJA 4QIWB 4E6IA 3TMEA 4K8IA 1DONA 1STAA 3J80E 1FR3A 1XTCD 4KD3A 4NW2A 1CQFA 1ZKOA 1FD7D 4Q0FA 1M8AA 4DF7A 1Q90A 1WTXA 1KDAA 1B2TA 5FOBB 3I72A 4I7ZC 1JWSD 2QCPX 2G9DA 4XDXA 4C3HB 3S1QB 2PZWA 3S16B 1H9RA 1A2TA 1HFGA 1DZ1A 2QF7A 1PZKD 4L8JA 3GV6A 3OW7A 5JPNC 2F0VA 1EWHA 2F0SA 2L0CA 1PFMA 3TZUA 3EROA 3VR6A 1X3QA 2F03A 3LWEA 1RKNA 2L55A 1PFNA 2R92B 2J7ZA 3I8ZA 5C3WA 3RD4A 3IFDA 1ZYRD 2F0NA 4OO1I 4BBRB 1PYWD 5FO8B 3BZDB 4RAUC 5CV8A 1V8QA 3BDOA 1R9TB 1C8CA 1EY9A 5J22A 4K14A 1V43A 5CORA 2EY6A 2B2VA 2EJFC 1I4QA 1Z47A 4FNFA 3AB9A 2NVXB 1LTTD 4WRDA 1SJHD 2JXMB 3I73A 2KEEA 5EBDA 4O42A 1BUVT 3MEHA 3PUZA 1QG7A 1LTGD 1BCPC 2DNCA 2K5WA 3V05A 4RGOS 5TSSA 1ICWA 2ZXPA 1A6XA 1GUWA 1LT4D 3VYSA 5ELEA 3HOZB 5C3EB 3NTIA 1GUGA 4XTCS 4KHZA 3DHQA 1SFOB 1CM9A 2XWBB 5I9PA 4B9XA 4IFDJ 1E2VA 5HURA 1JOQA 1TWGB 1EQVA 2RVLA 1BOSA 2O5IC 1H9SB 2WP8J 1PXUA 3MC0B 1A3UA 5A2QE 3CU7A 2K32A 2EJGC 1OXTA 1X3PA 3MXUA 3GTOB 2AWNA 1O78A 3PO2B 1JE4A 4N9PA 1SBBB 3T53B 1GUOA 1HCZA 4CKBA 2D2CC 4C3JG 3S2HB 3ND9A 5FLXE 2R6GA 2OT2A 3HOXB 5CR3A 4IUNA 1XWEA 1I4XA 1KDCA 4F7XA 3SHLA 4CJ0B 3LNNA 4M1UB 5K5PA 3IAYA 5IGGA 1Y8NB 5CGKA 5ELDA 1CZGA 4C56C 3BDLA 4EQOA 3TP8A 3OSOA 1B44D 1HTLD 3NK9A 4C3HG 2EZVA 5K36H 3S2DB 2PYKA 4RKLA 2LMCB 1J9OA 2RDGA 1MBYA 3GTMB 5DM63 2WACA 1SYBA 2F0EA 1NAPA 1LV9A 4KTAA 1O7YA 3D3RA 4K2KA 1QWYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X69 A;  1PFM A;  2SDF A;  3ONA B;  3QO2 A;  4ZLT F;  1WTO A;  1SSO A;  4IUT A;  1X3Q A;  1EIG A;  1VMC A;  2RVL A;  3D6W A;  2Q8T A;  1WVL A;  1G2T A;  2FFK B;  2B2W A;  3KUP A;  1B53 A;  1IL8 A;  1A15 A;  3LWE A;  3IL8 A;  5EPL A;  2B2Y A;  1BO0 A;  1IKL A;  1U4M A;  2B2Y C;  2X6L A;  1WD0 A;  2D9U A;  5DNF A;  1X32 A;  1PFN A;  2Q8R E;  2J7Z A;  2H1E A;  3I8Z A;  3I91 A;  2N55 A;  2NWG A;  1B50 A;  2M2L A;  4IUR A;  5EQ0 A;  2FJ2 A;  3IFD A;  3TN2 A;  2B2U C;  2MGS A;  1X3P A;  1Q3L A;  1MSH A;  2K1B A;  1XX8 A;  3DEO A;  5CBE E;  4ZK9 B;  3F2U A;  1JE4 A;  1B4O A;  1SAP A;  2B2T C;  4MN3 A;  5CMD A;  2L1B A;  1BBX C;  1KNA A;  2RSO A;  1KNE A;  4HCS A;  5D14 A;  2CVR A;  1XYI A;  4HSV A;  2VXW A;  1B3A A;  4ZKC B;  4RAU C;  2R3Z A;  4MHE A;  1WD1 A;  1F9R A;  5JJZ A;  4XT3 B;  2KOL A;  3DM1 A;  1ILQ A;  5CBA E;  1C8C A;  2X6G A;  5EPK A;  2B2W C;  2FHT A;  2EE1 A;  2HDM A;  4IUQ A;  5COY A;  4ZKB B;  5T1G A;  1PFB A;  4X3T A;  5COR A;  4OIJ A;  1O7Z A;  2NZ1 D;  4QUF A;  1O80 A;  1ML0 D;  1AP0 A;  1HA6 A;  3P7J A;  1EQT A;  1PLF A;  2K05 A;  4ZAI A;  2BDN A;  2K28 A;  2MPM A;  2JYO A;  5E4X A;  1MI2 A;  5EJW A;  1U4P A;  1RJT A;  1MSG A;  1DOK A;  1JIC A;  2MP1 A;  1DOL A;  5D65 A;  3R93 A;  1DOM A;  4U68 A;  1E0B A;  1ESR A;  2B2V A;  2FMM A;  1F2L A;  2DY7 A;  1QE6 A;  2KED A;  1WTV A;  4R8I A;  4RWS C;  1BF4 A;  3HP3 A;  1U4R A;  2HDL A;  1HFN A;  2N88 A;  3DEP A;  4CJ1 B;  1AZP A;  3TZD A;  2L4N A;  2EOT A;  1EOT A;  1ZXT A;  2EPB A;  3MWY W;  2XIW A;  4UAI A;  1PDQ A;  1WTQ A;  1AZQ A;  4CJ0 B;  1HHV A;  1EL0 A;  1ILP A;  2FIN B;  2HCI A;  2KEE A;  4O42 A;  4IUV A;  5E4W C;  4OIK A;  3UI2 A;  1DON A;  1NR2 A;  1SDF A;  3GV3 A;  1QG7 A;  4CJ2 C;  4HED A;  4NW2 A;  1F9S A;  2L9H A;  5AFW A;  1G2S A;  2RSN A;  1RHP A;  2KEC A;  1QNK A;  2K04 A;  1M8A A;  1WTX A;  3SVM A;  4X3U A;  1ICW A;  2DY8 A;  3MTS A;  4X3K A;  1EIH A;  1S4Z A;  5EPJ A;  2B2V C;  1F9Q A;  1ROD A;  4IUU A;  1MGS A;  1G6Z A;  1GUW A;  4RA8 A;  3KBX A;  1B2T A;  4HAE A;  3FPU B;  1U4L A;  1TVX A;  2K03 A;  4DN4 M;  2MJ8 A;  1J9O A;  2JP1 A;  4XDX A;  1WTP A;  1CA5 A;  5EKI A;  1WTW A;  2B2U A;  2KVM A;  2RA4 A;  2HCC A;  1HFG A;  1RTO A;  1CA6 A;  4LMQ D;  1DZ1 A;  5T1I A;  1G91 A;  1BNZ A;  3FDT A;  1HRJ A;  2KUM A;  1VMP A;  3GV6 A;  4R9W A;  1F9P A;  1NCV A;  1WTR A;  3N52 A;  1NAP A;  1LV9 A;  3H91 A;  1CM9 A;  3Q6S A;  1O7Y A;  1RTN A;  1HUM A;  3I90 A;  4X3S A;  2IL8 A;  2HUG A;  2B2T A;  2NYZ D;  2K01 A;  2L12 A;  3I3C A;  3G7L A;  4QUC A;  1IKM A;  1NR4 A;  4IUP A;  4XT1 B;  1J8I A;  2L11 A;  1HUN A; 
#chains in the Genus database with same CATH topology
 2C9O A;  2R92 G;  4DKA C;  2E2J H;  1WD0 A;  3G6E A;  1EY7 A;  2OCE A;  4BBR G;  3S1N H;  1Y1W B;  2VUM H;  4GZY C;  3S15 B;  4TSS A;  2IX1 A;  4L63 B;  5EBC A;  1I6V C;  4P72 A;  1XTD A;  4K5V A;  2D62 A;  3SK6 A;  3KK7 A;  1ICF B;  1F9R A;  1R4Q B;  1K83 H;  2FXQ A;  1NJI C;  2FHT A;  3M4O H;  2F0T A;  3KLS X;  2ZM6 L;  1TS4 A;  2JA6 B;  1C48 A;  1Q46 A;  4X3T A;  2XWJ B;  1PH2 A;  1N32 L;  1G6P A;  2VB3 X;  1EYA A;  4KHP Q;  3ULP A;  3TBI B;  4HR7 B;  1PLF A;  4DXF A;  2EY5 A;  5BR8 Q;  2BDN A;  4KY6 A;  3NEN A;  1TT2 A;  3KDF A;  1M1K C;  3CC7 A;  4LFB Q;  3KF8 B;  4HJ8 A;  2IHF A;  2WIN B;  2KCM A;  3EA6 A;  2HDL A;  2EYM A;  4C3I H;  1EOT A;  1JB7 A;  1PDQ A;  1YHA A;  4IFD I;  3STB C;  2FIN B;  4DK6 C;  4JI7 L;  5E4W C;  1SNP A;  1BQQ T;  4JCV E;  4CKC A;  1NBW A;  5IT9 E;  3H3V H;  3DLL A;  5JEA G;  3Q23 A;  1XMO L;  2O5J C;  3J7A V;  1Q1B A;  2YU9 H;  1KLU D;  4PZ6 A;  1HQR D;  1QVG A;  4A3K H;  2UXC Q;  2KHJ A;  1X65 A;  2OTL A;  2YTX A;  4UY8 C;  4DU9 A;  1WTH A;  5EAY A;  3CC2 A;  3HOZ G;  5C3E G;  3K8A A;  1TS5 A;  2J4X A;  1W3S A;  2F0O A;  2JP1 A;  1HXY D;  5I2X A;  2HT1 A;  4A3G H;  2E2H B;  4GOP A;  3E9I A;  2WB1 E;  1XPU A;  5T1I A;  4IAL A;  1V1P A;  2LXJ A;  1D5M C;  5IIF A;  3GTJ B;  2B2T A;  1CKO A;  2A6H D;  4JYA Q;  1TS2 A;  5IP7 H;  1GHJ A;  1VQA A;  2MQH A;  3GTG H;  1WTO A;  1HUN A;  4ZLT F;  5IY0 A;  2UXD Q;  5FK9 C;  1B53 A;  3PO3 H;  4K6L A;  3R3O A;  2XRS D;  5C44 B;  2K6A A;  4BXX G;  3PO2 G;  2ZJQ A;  1B70 B;  1LTI D;  4IUR A;  3LWU A;  4JBJ A;  4LAA A;  1VQ5 A;  3CRK C;  4Q5V A;  1Z6H A;  4HIK A;  1Y8O B;  1N34 L;  3FKI H;  5KIX A;  4IN3 A;  1SYD A;  1KHI A;  1PH4 A;  1KRT A;  1BBX C;  2B39 A;  4X65 L;  4JI1 L;  3I4N H;  1FNU A;  5M5X B;  3RZO B;  1IYJ B;  3N6R A;  4QCL A;  4RG1 A;  1A62 A;  4FF3 A;  2ZXR A;  4DUZ L;  3RN2 A;  2X6G A;  5FJ8 G;  4OON A;  1VQB A;  5JVH 3;  4DNI A;  3HOX G;  4DV5 Q;  2WFW A;  3I4M H;  3CXC A;  3P7J A;  3CC4 A;  2RDF A;  1YJ9 A;  1WYD A;  4JI7 Q;  2MP1 A;  2B3G A;  4ZCK A;  3J81 j;  4XYO A;  1DOM A;  4GNX C;  2JJQ A;  2XGT A;  2BOS A;  4Z9C B;  1AW7 A;  1XMO Q;  5KNB A;  4R8I A;  4B3S L;  1ZYR C;  1PRT D;  5EGT A;  3DEP A;  1UNS A;  1FJG L;  4NKL A;  2QDL A;  3TZD A;  4BY7 H;  3KLR A;  1D7Q A;  2EOT A;  4XQN A;  1Z9F A;  3GTQ B;  1LT6 D;  2SNS A;  4K8J A;  4OIK A;  3PMF A;  4MZ9 A;  3CCU A;  4YWK A;  4OWW B;  1II3 A;  4A3B B;  3DUZ A;  4Y7N B;  4OO1 G;  2KEC A;  1S5D D;  1F9Q A;  3L2P A;  5JJL A;  1GOZ A;  1BKB A;  4R8N A;  5LMN L;  4BY1 B;  4QJF A;  3H09 A;  2R7Z B;  4DN4 M;  3RR5 A;  3L7Z C;  1PH8 A;  2ASB A;  4ZQ3 A;  2AUK A;  5C0X J;  2RA4 A;  3MA2 B;  1S72 A;  3PCO B;  2KEN A;  1HRJ A;  1CHP D;  2F0W A;  5I2Y A;  2KBN A;  1NMG A;  2Q2H A;  4K5W A;  3BYY B;  4QUC A;  3OTO L;  1PTO H;  4DAP A;  2NN6 H;  5CV6 A;  5M9O A;  3K59 A;  1Y1W G;  5FLM H;  1G2T A;  2CWA A;  1FNW A;  1IL8 A;  3DM3 A;  3NUC A;  2F0I A;  2B2Y C;  3M7G A;  3NTK A;  4JI1 Q;  1ONL A;  5DNF A;  2Q8R E;  4KY7 A;  3A74 A;  3SK5 A;  4FXG C;  4I7A A;  3MFG A;  3PUY A;  3MFY A;  2JA9 A;  1E1T A;  3JAM i;  3T51 B;  1K73 C;  3NQT A;  5I9O A;  3QB3 A;  5C4X H;  4MTN A;  4TQU S;  1W6J A;  1I4R A;  5LL6 X;  1PTO F;  2A5H A;  2JA6 G;  3KLW A;  1QNU A;  4LUO A;  4XQJ A;  4A3E B;  1AFP A;  1EU3 A;  4NB3 A;  1OTC A;  1VQ6 A;  3HGB A;  1PHJ A;  4AYB B;  1F2M A;  4YWL A;  1SE3 A;  2MFI A;  3V96 A;  5JAV A;  1WFQ A;  5G3L F;  3GTP H;  2JA7 H;  1QOH A;  3SEB A;  4A3D B;  5M5Y H;  1I4G A;  1VS0 A;  2XN9 C;  3K7A H;  2KHI A;  1VCI A;  1SMX A;  1ESR A;  1TWA B;  3ZYY X;  1KTK A;  3S14 B;  2DY7 A;  4FYD A;  1EOV A;  1HNZ L;  3WDN A;  4DR4 Q;  3E9H A;  3MXG A;  1L0Y B;  4DV7 L;  3TP6 A;  1E7Z A;  1TY2 A;  3RN5 A;  4R4O A;  2ZXO A;  2PQE A;  4ILW A;  1SN8 A;  4KY5 A;  2AWO A;  3UI2 A;  2B29 A;  3GV3 A;  1EIY B;  1X55 A;  4JI0 L;  2R93 H;  3BZC A;  2ID0 A;  2KCC A;  5HGQ A;  3Q8D A;  1MKH A;  5IWA Q;  1ET9 A;  3S1R H;  3QOJ A;  3CAM A;  3QR8 A;  4X6A H;  2B2V C;  4UDU C;  3C1F A;  1MGS A;  4CKE A;  4JBK A;  1GKH A;  2K52 A;  1PYB A;  1TVX A;  2MJ8 A;  1B9M A;  4LF5 Q;  3NSW A;  3CHB D;  1GVP A;  5IGF A;  1RTO A;  3F2B A;  1F2Z A;  3D0F A;  3FP9 A;  1SRO A;  3OIQ A;  5IGB A;  4XT1 B;  1J8I A;  3OWF A;  5C44 G;  1FGB D;  1SSO A;  2RBM A;  2PMZ B;  2E76 C;  3CQZ B;  2B2Y A;  1XNR L;  2VQF L;  2P5Z X;  2Z8L A;  1B3Q A;  4KD4 A;  2A8V A;  5C4Z A;  2JA5 B;  3QIA A;  2QEX A;  3M4P A;  4L6T B;  4M8A A;  3H3V C;  3HOY H;  3HG9 A;  4AIM A;  1XX8 A;  2CW0 C;  3DWQ A;  2F0G A;  2VQE L;  5LMU L;  1A3V A;  2NB0 A;  2R7F A;  4LNQ A;  4G57 A;  5GAE C;  1XYI A;  2CVR A;  3A5Z B;  4HSV A;  4JI2 Q;  3R2T A;  2RKS A;  4RGT A;  2LSS A;  2YYZ A;  2IX0 A;  4KK7 A;  2E5L Q;  2OWO A;  4EVO A;  1K8O A;  1Q81 C;  1VQ4 A;  1OXV A;  1SNM A;  1K0R A;  2KA7 A;  2SNM A;  2MNA A;  3OW2 A;  1IL2 A;  1X6O A;  4MNO A;  3JC6 6;  2GVB A;  2Z9H A;  1AP0 A;  4UHV A;  2QIL A;  4FXD A;  4BA1 I;  1HA6 A;  1UE5 A;  3R93 A;  5C4H A;  2F0Q A;  1SR3 A;  1ESF A;  3J7A F;  2JA8 B;  5C0X I;  4A3F B;  2KJX A;  1EZ6 A;  1IZ6 A;  1HFN A;  2N88 A;  1GXD C;  1E24 A;  2NVQ B;  2TSS A;  1Q8I A;  1QZH A;  1ZXT A;  1X54 A;  4A3B G;  1J5E L;  1Q1E A;  3MHB A;  4IUV A;  1YJW A;  1QUQ B;  4ABN A;  2EYJ A;  4POG A;  5AJ3 Q;  4RGM A;  1T5E A;  2Z4H A;  4DV3 L;  3KFU A;  3HOU H;  3S24 A;  4H0L C;  3RZD H;  4BY1 G;  1QNK A;  4UPA A;  4DV1 Q;  1IBM Q;  1SE4 A;  2DY8 A;  2K5Q A;  3KBG A;  3NQI A;  2R7Z G;  4Y52 H;  1A63 A;  1VQG A;  3M4Y A;  1HH2 P;  4OWT B;  1FNV A;  3J81 L;  3FPU B;  4RH6 A;  1U4L A;  5JJK A;  1BCP B;  1U9R A;  2K03 A;  2HCC A;  1LYL A;  1H9J A;  3HOV B;  3S17 B;  1BNZ A;  1XNR Q;  2KUM A;  2YTY A;  2VQF Q;  1XPO A;  3TRZ A;  1K8M A;  3A54 A;  4LFC L;  3CCM A;  1K8G A;  1PH6 A;  1RTN A;  3I90 A;  5KYL A;  2NYZ D;  1HTP A;  2IJ0 A;  1S40 A;  1DJR D;  3H15 A;  3M3Y B;  4IUT A;  1IBL Q;  1EIG A;  1YNN D;  3O13 A;  2NVY H;  2B2W A;  2JEB I;  1LAB A;  2PO4 A;  3A8K E;  4A3M B;  1YZ6 A;  4DNR B;  1IKL A;  3Q24 A;  3A7L A;  4B3M Q;  4O2D A;  2NVT H;  1NMF A;  2NWG A;  3NBI A;  5EQ0 A;  5M5W H;  2B63 H;  4R4C A;  2PMZ E;  4IFD G;  1AH9 A;  1EWC A;  2OQ0 A;  3UDX A;  2EVB A;  1KD1 C;  2XTI A;  1Q3L A;  4OEL B;  4A3E G;  2F0F A;  5CMD A;  2F0U A;  4A4I A;  4DV0 Q;  1HR0 L;  1KNE A;  5C5L A;  4AYB G;  1OXU A;  3HFZ B;  2PZU A;  5IYB G;  2KOL A;  1LUZ A;  5M3F B;  2K4K A;  4HSP A;  1E1O A;  2A6H C;  2UUA L;  4JV5 L;  4LF9 Q;  4A3D G;  2Y0S E;  5T1G A;  2EXD A;  1LTB D;  5BN4 A;  2KHS A;  3S1M H;  1O7Z A;  4PQX A;  1O80 A;  1AEX A;  2DN8 A;  2E2D C;  1C0A A;  1I3Q H;  1AN8 A;  1PTO C;  5KYI A;  1HZA A;  5JOB A;  2G5D A;  1F2L A;  1TWF H;  3R8B A;  2KED A;  1WCM B;  1SLJ A;  1VQE A;  4KV6 A;  4CDC C;  1PMR A;  4GKK L;  1KDB A;  4NXN L;  1IYU A;  1VQ9 A;  5DLQ E;  3K5O A;  1L0X B;  5NUC A;  3RMH A;  4F8M A;  3PQI A;  4R1J A;  1SJE D;  4ALP A;  1ENC A;  2F3I A;  2L9H A;  3MXN B;  3ERQ A;  1TWC B;  4LFC Q;  4JI4 Q;  2PI2 A;  4HMJ A;  1I94 Q;  4G7O C;  4B9W A;  3NHH A;  2PQA A;  3PUW A;  1D1I A;  5JPM C;  4DAY A;  3HZX A;  2K75 A;  5EKI A;  3T16 A;  3J7A 5;  2LFN A;  1PRT C;  1VMP A;  1JE5 A;  3PIO 3;  3N52 A;  4IUU A;  3H91 A;  1Q86 C;  4TKO B;  2F1M A;  1ENF A;  1V9P A;  2TMP A;  2A6E C;  4HTH A;  3G7L A;  4IUP A;  2YV5 A;  4JI8 Q;  3GP7 A;  1XMQ Q;  4H7B A;  2DNE A;  4GOP B;  3D6W A;  3E0E A;  2LY7 A;  2WB1 B;  2Z4I A;  3GTL H;  1N36 L;  2JA5 G;  1P16 A;  4K2L A;  1LTA D;  1HR0 Q;  1V1P B;  3GTK H;  2EYO A;  4B3T L;  1N9W A;  2CW0 D;  2WKC A;  1IHZ A;  3TS0 A;  1TWH H;  3K0X A;  5BN3 A;  3K58 A;  3P20 A;  4GOP C;  2VB2 X;  2BA0 A;  4EQN A;  2RDH A;  5M3M H;  2ZJP A;  1UAP A;  4DUY Q;  2F4V L;  1YVC A;  4J8Q A;  2B2T C;  1B9N A;  3B6Y A;  3SE0 A;  4YIJ A;  2R3Z A;  4A3L G;  1ENA A;  3D4D A;  1I50 H;  1Z7T A;  2Z1C A;  2A73 B;  1STB A;  4F88 A;  4GN5 A;  1L1O C;  3NWT A;  4ZKB B;  2EYH A;  4OIJ A;  1M4V A;  2K5V A;  2RCN A;  4KN7 C;  2OQK A;  2H4O A;  2D0O A;  5C4J B;  2JA8 G;  3K0Y A;  4A3F G;  2NTT A;  3TQY A;  1Y1V H;  2WII B;  5KGU A;  1RJT A;  1KIX A;  1SYG A;  3R2I A;  2F0D A;  4LFA Q;  3IRB A;  3HOW H;  2F0P A;  2MUY A;  4RWS C;  1D5X C;  2CH4 A;  1A8V A;  5JJI A;  3OHX C;  1I6H B;  1N33 L;  4N9T A;  3D31 A;  3J7Z C;  4L5R C;  2I07 B;  2Q2I A;  5IOD A;  4V19 0;  1STG A;  1YIT A;  5HGT A;  3BZK A;  3I7F A;  3A55 A;  3D8G A;  3VA5 A;  1LAC A;  4JG2 A;  3U4V A;  4O1N A;  4CJ2 C;  1DXM A;  4OHJ A;  4ME3 A;  1STH A;  2C35 B;  1G2S A;  2VL6 A;  4LWC A;  1EIH A;  4C2M B;  3D4R A;  1PH9 A;  4LF8 L;  4GN3 B;  4X62 Q;  4DR6 Q;  3GO5 A;  4EX5 A;  4C3J H;  1J6Q A;  3ICE A;  3HOV G;  4N8X 1;  2VNU D;  3MZ5 A;  1CKM A;  4JBW A;  2MO1 A;  3NBH A;  2K14 A;  1VQ7 A;  1K3R A;  1SEB D;  4LK1 C;  3Q6S A;  4DR3 Q;  2NUC A;  3NWS A;  2UUC Q;  3MEF A;  2L12 A;  3CME A;  4A3M G;  1PH7 A;  2F4V Q;  1VQH A;  3TDQ A;  2HD3 A;  3SR1 A;  2HIX A;  5E1F A;  2X6L A;  4GKJ L;  3NTH A;  2F0K A;  4R4I A;  4XXE A;  2IX3 A;  2OXP A;  2MGS A;  1JWU D;  3DMU A;  1STE A;  1CHQ D;  4C3H H;  4A3J B;  3S1Q H;  3J80 L;  3S16 H;  1JJC B;  2Q2U A;  1VQJ A;  1XJV A;  4LJZ C;  5M3F G;  4ZKC B;  3I4L A;  5IYD H;  3BVM A;  3BG3 A;  3TP5 A;  3W5O A;  4ZYS A;  1AE3 A;  1KRS A;  1L1O A;  1A0I A;  2JK8 A;  1ZEQ X;  1PTO D;  3F8T A;  3K5N A;  4P2C B;  1EEI D;  1SNC A;  1SNQ A;  1D5Z C;  4J1M A;  3C2P A;  3U58 A;  2ZM6 Q;  1WCM G;  4WJ3 M;  2R92 H;  4BWG B;  1N32 Q;  1K3B C;  1B8A A;  3EVQ A;  4U68 A;  1V1O A;  3SGI A;  3BJU A;  2FMM A;  3GDE A;  4U67 3;  2PNH A;  3L9A X;  4JPB W;  5G3L D;  1BF4 A;  1U4R A;  2NZH A;  1X3G A;  4BBR H;  4JI6 L;  1IW7 D;  2L4N A;  2MHV A;  5IYC G;  3AFQ A;  1EU4 A;  2AQ3 B;  4JI5 L;  3S9W A;  3NEM A;  4GNX B;  2K7V A;  2HHH L;  5C3X A;  3IFT A;  1LT5 D;  3I55 A;  2RQX A;  1R9T H;  4HID A;  2AKW B;  5J39 A;  2NBF A;  4RCO A;  1S5C D;  3AQQ A;  3H3V I;  2HQL A;  4A93 B;  1BDO A;  2A19 A;  1SE8 A;  1EFI D;  4FF1 A;  4I65 A;  2K5D A;  5A35 A;  2XRQ D;  4OX9 L;  1DM0 B;  1JCK B;  3FPP A;  3NE5 B;  1GUS A;  2A6E D;  2KVM A;  1WOC A;  4GKJ Q;  3BDC A;  2NVX H;  4R9W A;  4MIU A;  4K0K L;  4BBS B;  1CSP A;  1D6E C;  4A76 A;  2HUG A;  2WB1 G;  1XXG A;  3FVQ A;  3HS0 C;  3I3C A;  3SXH A;  4LF4 L;  2OF1 A;  3K80 C;  2G9H D;  1E2W A;  1CKN A;  5C0X G;  1EUJ A;  1VMC A;  1IBK L;  3FMC A;  3AEV A;  1JOO A;  1JC7 A;  1JR0 D;  1ASZ A;  3AMU A;  2KQ3 A;  3WOF A;  5H1S E;  3T13 A;  1B50 A;  5JEA H;  3M85 A;  3K5M A;  4PNY A;  4DV6 L;  2E2I B;  1JT8 A;  1R4P B;  1PV4 A;  4LF6 L;  1ET6 A;  1KNA A;  5C3E H;  2VS1 A;  3HOZ H;  1CK1 A;  1KLG D;  2VXW A;  1B3A A;  1N34 Q;  3W3A A;  4YHH L;  1SFO H;  4A3I B;  1I4P A;  4XT3 B;  2F0H A;  2A69 C;  3ER0 A;  1HQM C;  3E6Z X;  4X65 Q;  2BH8 A;  3H0G B;  3QG1 A;  1WI5 A;  3FEW X;  1GJX A;  2OEO A;  1TWG H;  3T1Y L;  4JK1 C;  4QUF A;  1ML0 D;  4DUZ Q;  1YNN C;  4EQP A;  2MPM A;  2IHE A;  1EY4 A;  1YNJ D;  2AMC B;  3WOE A;  2Z6B A;  1TS3 A;  4IPH A;  3K81 C;  4ME5 A;  1S5F D;  1NE3 A;  1PVO A;  3GTO H;  4BXX H;  3PO2 H;  1RL2 A;  1Y69 U;  3W1G A;  3MAQ A;  2QEJ C;  5F2D A;  3RLO A;  3MWY W;  2XIW A;  4H13 C;  4EQ5 A;  4B3S Q;  2ZJR A;  3CW2 C;  3C46 A;  1FJG Q;  4OX9 Q;  2CWP A;  3PGZ A;  4ODG A;  3LGJ A;  1SMY D;  1F77 A;  1HNX L;  4DR2 L;  3TP7 A;  3Q22 A;  1NNX A;  4IOC A;  3PIP 3;  3S2H H;  2E2J B;  1FL0 A;  4A75 A;  2LKV A;  5EPJ A;  5FJ8 H;  1MJE A;  3S1N B;  2VUM B;  3CRL C;  3HOX H;  3AU7 A;  5GRO A;  1UUP A;  1WTP A;  2LS0 1;  1IBK Q;  5LMN Q;  1OO9 B;  2B2U A;  1G91 A;  4DR5 L;  3FDT A;  2ICI A;  4FP5 D;  4HIM A;  3C1E A;  5FLX L;  1VQN A;  4DR7 L;  2H5X A;  1K83 B;  1HA5 A;  1S5E D;  1QCB D;  5FKA C;  3M4O B;  1IKM A;  2L11 A;  3L3O C;  1RIP A;  4RKB A;  2ZT9 C;  2N8N A;  2Q8T A;  1JMC A;  2NN6 I;  4DPG A;  4WOR A;  3M7N A;  3OTO Q;  1JOR A;  4L5Q A;  2VW9 A;  1U4M A;  5ELC A;  2F0M A;  1T5X D;  4YHH Q;  2EYP A;  4A3J G;  1H9K A;  1CZW A;  3URY A;  2M2L A;  3E3X A;  4OO1 H;  3S2D H;  4R4Q A;  4AH6 A;  4APV A;  3J81 c;  1OXX K;  3ERS X;  4IPD A;  4LUZ A;  4C3I B;  1PH1 A;  3GTM H;  1TKW B;  4HCS A;  4QQB X;  1MJC A;  4JI3 L;  3CPW A;  1KC8 C;  2PNR C;  2B2W C;  2WV6 D;  1VQF A;  2YU9 B;  5D3I B;  2SOB A;  2MO0 A;  1CFM A;  2XVS A;  3CCS A;  4IZ8 A;  2ICE C;  3T1H L;  4A3K B;  4NXM L;  2ENB A;  1X3F A;  2WAQ B;  3F2C A;  5EJW A;  3GD7 A;  1V1Q A;  1Q7Y C;  1Y1W H;  4F87 A;  1EYC A;  3S15 H;  1SNO A;  1E2Z A;  4DA2 A;  2Y0S B;  4A3G B;  1RF2 D;  2UXB L;  2PCF B;  1AE2 A;  2R61 A;  1WTQ A;  3PIP A;  3EIV A;  1KQS A;  3NXW A;  5ELB A;  1TQO A;  1HNZ Q;  1PZI D;  1SDF A;  4DV7 Q;  3GTG B;  5DAU A;  3Q0A A;  3G4S A;  3CKI B;  4A93 G;  2JA6 H;  1YBY A;  4OL7 A;  2N3S A;  2BE5 D;  4CBV A;  4DXG A;  3PO3 B;  3I2Z A;  4HJA A;  5IGD A;  1S4Z A;  4TVA B;  1Q8K A;  4JI0 Q;  1KAW A;  5JVG 3;  1G6Z A;  3KBX A;  3PF5 A;  4PZ7 A;  5EKL A;  4PZ8 A;  4DR1 L;  3ITP A;  3FKI B;  4BBS G;  1W2B A;  2F3W A;  5KRU A;  1LO5 D;  3I4N B;  4AQY L;  1B1Z A;  2BCO A;  2Z6K A;  2IT1 A;  1TR5 A;  4XQQ A;  1PYS B;  2IPK D;  4X3S A;  1SYF A;  2C5C A;  1NR4 A;  1FGU A;  1K9M C;  2N49 A;  4CHT B;  3RLF A;  4GN4 B;  2I5L X;  4KI0 A;  5LMN W;  3CCL A;  5CV7 A;  4YWM A;  2AQ1 B;  3I4M B;  3KUP A;  1S3O A;  4X66 L;  1FYC A;  1VQ8 A;  4NMZ A;  4WFN 3;  5IGE A;  3HKZ E;  1GUT A;  3TN2 A;  2EXZ A;  2FMC A;  2K5H A;  3JAM L;  2A69 D;  4A3I G;  3CP0 A;  4BS9 A;  2E2H H;  4ZK9 B;  2E75 C;  4G4K A;  4BY7 B;  3NPP A;  4MN3 A;  5IT9 L;  3KLS A;  4ULL A;  2RHS B;  3ULL A;  1YNX A;  2JSO A;  4KHV A;  4S3S A;  3H0G G;  5EKK A;  1RDP D;  4K6D A;  1RD9 D;  5JJZ A;  3GTJ H;  1F2Y A;  5LMU Q;  2VQE Q;  1UEB A;  5E3F A;  4PMW A;  1MD2 D;  4QY7 A;  4DV2 L;  5K36 G;  1EZ8 A;  3A8I E;  2N78 A;  1UE6 A;  2NZ1 D;  4QMG A;  5KND A;  4H44 C;  5I6Y A;  4IPG A;  3WWV A;  5C44 H;  1YHQ A;  2E74 C;  2CQA A;  2L15 A;  4KMU C;  3PUV A;  1XNQ L;  3PUX A;  2I46 A;  4G7H C;  2WAQ E;  1CQV A;  2D5D A;  3G48 A;  1HNW L;  1DD2 A;  3K57 A;  1M90 C;  1HHV A;  4C1N I;  5M5X H;  3RZO H;  1ILP A;  2HCI A;  2K5N A;  4DK0 A;  1MIU A;  5I6W A;  1EQQ A;  1PTO B;  1U0L A;  3D6C A;  3QJY A;  1UEA B;  3FHW A;  2J0T D;  1STY A;  1F9S A;  4P74 A;  4KLK A;  1J5E Q;  2VUM G;  3SK8 A;  3RUZ A;  3OYY A;  4HJ7 A;  3A0J A;  3MTS A;  4WJW A;  4RFB A;  4DV3 Q;  1C9O A;  1YHB A;  4RA8 A;  5KNC A;  5IOC A;  3PF4 A;  2KCT A;  1A3T A;  5C4X B;  5BN5 A;  2Q8I B;  1CA5 A;  3KDF B;  1WTW A;  4JBM A;  1O7L A;  4LMQ D;  5C6A A;  3HRZ C;  1T9H A;  1TU2 B;  2BDO A;  1IW7 C;  2DJG C;  3C3L A;  4DGZ A;  4DAV A;  4DAM A;  3GTQ H;  1D2B A;  5J1Z A;  3OMC A;  3SK4 A;  1S5B D;  2KCN A;  2SDF A;  3TSS A;  4A3B H;  4Y7N H;  4QB4 A;  2PI2 E;  2ZTD A;  2AUJ D;  5EPL A;  3NBH B;  1A15 A;  2I5H A;  1GD7 A;  3GTP B;  2JA7 B;  1PRT B;  1BO0 A;  3VR5 A;  3CCR A;  2EDG A;  1SYE A;  2A68 C;  4LF7 L;  5M5Y B;  1X32 A;  2A74 C;  4G7Z C;  2H1E A;  4C3I G;  3K7A B;  4HJ5 A;  4BY1 H;  3A8J E;  2K33 A;  5FO7 B;  2R7Z H;  3DWP A;  4KKS A;  2DJF C;  1EY8 A;  1JWM D;  3J7Y W;  2EYF A;  1QJO A;  5CV4 A;  4X64 L;  1B4O A;  1YI2 A;  2RF4 A;  4CDD C;  1EY6 A;  4QF4 A;  3CD6 A;  2HQE A;  4ZUJ A;  1ILQ A;  3V2T A;  5IE8 A;  4V0B A;  4KHP L;  5EPK A;  1XNQ Q;  3K7U C;  4A3K G;  1TII D;  5BR8 L;  1K0S A;  1FVI A;  1SND A;  5GAG C;  2WAQ G;  2R93 B;  1PFB A;  1BR9 A;  3BVZ A;  3A7A B;  1HNW Q;  4IJH A;  3K6O A;  3S1R B;  3T4A C;  4LFB L;  2O4X A;  2CQO A;  2UUA Q;  4A3G G;  2Y0S G;  4JV5 Q;  2JYO A;  1GO3 E;  4RHR A;  1L1O B;  2F4I A;  3VYU A;  4DNT B;  1NSN S;  1WTV A;  2GN5 A;  1L2F A;  5IP7 G;  1DYQ A;  3VA7 A;  4IFD H;  2CH4 W;  1G51 A;  2EPB A;  5CV5 A;  2VY3 A;  5LHY 1;  3J80 c;  1CT1 D;  4N8F A;  3PO3 G;  4XYQ A;  3G6J B;  1NY4 A;  4A3E H;  3MVV A;  3KF6 A;  4GKK Q;  4NXN Q;  2ZTC A;  4CGY B;  1PA6 A;  3EQL C;  4HCE A;  3X3N A;  4OEM B;  3OIP A;  4ZRZ A;  1VQO A;  4DFA A;  2ZTE A;  2EQS A;  2M00 A;  1JB3 A;  5IYB H;  2K04 A;  3ND8 A;  3SVM A;  4X3K A;  2PW7 A;  3FKI G;  1PH5 A;  1JOK A;  5GQO A;  4A3D H;  1ROD A;  3OMG A;  1EWI A;  3UDI A;  1YNJ C;  2ATW A;  1VQM A;  3OWE B;  4IQZ A;  3I4N G;  1XPR A;  1TWA H;  4KJO A;  3S14 H;  3HOY B;  2UUB L;  3CPF A;  1D1K A;  2B8G A;  1OXS C;  2IWH A;  4JYA L;  1Q12 A;  1H9S A;  3KYH C;  4LF7 Q;  1F9P A;  1WTR A;  2QDB A;  1IYV A;  2UXD L;  3K5L A;  2K01 A;  3I4M G;  3NP8 A;  3QO2 A;  3ONA B;  3T56 B;  1VF5 C;  4X64 Q;  4FXK C;  1SMY C;  2FFK B;  3PIO A;  1SYC A;  3X3M A;  1W6K A;  1LTS D;  2O2L D;  1HPC A;  4NP5 A;  2SEB D;  1KAA A;  3U50 C;  1N36 Q;  4BY7 G;  3LX0 A;  4B3T Q;  1CKN B;  3TRE A;  1VF7 A;  3DEO A;  2EY2 A;  4RGN A;  3F2U A;  4HN7 A;  1BXT A;  3U9S A;  2F0J A;  2JQO A;  2L5T A;  4MTK A;  2GA4 B;  2EJM A;  3J81 E;  5DEH A;  4MHE A;  3MXN A;  1WD1 A;  4JC0 A;  4EGV A;  4DV5 L;  4FDB A;  2PZT A;  1BCP D;  5CBA E;  4POF A;  4L5T A;  3HOU B;  3OPO A;  3F1Z A;  1PZJ D;  3RZD B;  1NUC A;  3VYR A;  3BYT B;  3JAM E;  1LTL A;  1EQT A;  3CQZ H;  2F0L A;  2QKI C;  1N8R C;  1U4P A;  2ALY B;  1G8Z D;  3CMA A;  1I4H A;  1HR0 W;  2JA5 H;  1VQP A;  2NTS A;  1GM5 A;  3UDF A;  3D4W A;  4KKT A;  1PFS A;  1JQY D;  5ELO A;  5IP9 G;  5I4D A;  5JEA J;  4CJ1 B;  3IKJ A;  1PH3 A;  3A56 A;  4RCN A;  2NN6 G;  4UAI A;  1EL0 A;  1LLR D;  5FLM G;  2V1C C;  2IW3 A;  1SXT A;  5C5M A;  2EYL A;  2JE6 I;  1CTM A;  1UWV A;  1N33 Q;  2UUB Q;  3DXJ C;  4HED A;  5L37 A;  5LL6 S;  2JEA I;  2NVY B;  4A3L H;  2RSN A;  2V4D A;  4IOA A;  2XNA C;  3M4Q A;  4X3U A;  5C4X G;  3CCV A;  1X56 A;  2NVT B;  2B63 B;  5M5W B;  1P8L A;  4IPC A;  2JA8 H;  4A3F H;  4LF8 Q;  1GUN A;  2UU9 L;  1CUK A;  4QL5 A;  4P75 A;  1CA6 A;  2NVQ H;  3I70 A;  5CC4 A;  3U9O A;  3VR2 A;  2E8G A;  4ID6 A;  3MXP A;  2Q2T A;  2F52 A;  1Y8P B;  1HUM A;  4O0A A;  3VR3 A;  1YEZ A;  2ES2 A;  3VYT A;  1A2U A;  4FO2 A;  1STN A;  3BS1 A;  2A68 D;  2JA7 G;  4K5X A;  2OTJ A;  3P1H A;  1EY0 A;  5CYU A;  3BU2 A;  3S1M B;  2DGY A;  1WVL A;  3IL8 A;  2BE5 C;  1H95 A;  4LUV A;  1SE2 A;  1QZG A;  4FF4 A;  2CKZ B;  1I3Q B;  4PMB A;  2FJ2 A;  1LT3 D;  4CDE C;  1RCV D;  2B2U C;  1E22 A;  1TWF B;  1VDZ A;  1KAB A;  3GQB A;  2CFM A;  2K1B A;  3QWN A;  1HZC A;  2RSO A;  5D14 A;  3HOV H;  3S17 H;  1EEF D;  1LTR D;  2M9V A;  3H6M A;  2WKD A;  1I5F A;  2R93 G;  3DM1 A;  1BBW A;  5ELN A;  4ZUI A;  1IXR A;  1DCZ A;  3KF8 A;  5FLX c;  4UP9 A;  2EIF A;  4DK1 A;  4IUQ A;  2DUD A;  5COY A;  3M3Y H;  3E5S A;  4A3M H;  3KJP A;  1QVC A;  4PV1 C;  1BCP F;  3OOC A;  1DOK A;  1JIC A;  4KJN A;  1DOL A;  4BA2 I;  4DR4 L;  1E0B A;  1C4Q A;  2AQ2 B;  1QE6 A;  3HP3 A;  2A1A A;  4OWX B;  4TRD A;  1AZP A;  1AZQ A;  3BVG A;  2PW5 A;  4P71 A;  1H9M A;  1EY5 A;  5ELF A;  5IWA L;  3W2D A;  4KKU A;  1NR2 A;  2I5M X;  4IO9 A;  1TY0 A;  4JI6 Q;  2PPB C;  3TEH B;  5M3F H;  4JI5 Q;  1BVS A;  2BA1 A;  2UU9 Q;  5IP9 H;  3GTL B;  5AFW A;  1RHP A;  2HHH Q;  1CI3 M;  3EFX D;  5GAD C;  4L5S A;  3SDZ A;  3GTK B;  3TS2 A;  4LF5 L;  4OGQ C;  3J81 i;  3HOY G;  1K8A C;  1TWH B;  5GAH C;  4B08 A;  4HAE A;  5CV9 A;  5M3M B;  4FVM A;  1D8L A;  5KEE A;  1G29 1;  1WCM H;  1EYD A;  2YTV A;  5D3D A;  5A2Q L;  3F2D A;  1NCV A;  3PV0 A;  4J15 A;  3E0J A;  3VR4 A;  4A3C G;  1QIL A;  2IL8 A;  1I50 B;  4XIG S;  4NDX A;  3RNU A;  5J3B A;  5IGC A;  5IYC H;  3H94 A;  5DM7 3;  2X69 A;  4K0K Q;  4PMC A;  3QOL A;  4LF4 Q;  4GLA C;  2EY1 A;  1TWC H;  2D9U A;  1Y1V B;  4KN4 C;  3I91 A;  2N55 A;  1VQC A;  3M9B A;  1GHK A;  3EJI A;  4YCU A;  3UE0 A;  1KL9 A;  2QW7 A;  3HOW B;  3I56 A;  4JI2 L;  1MSH A;  3UDG A;  1VQD A;  2Z6K C;  4GNX A;  5CBE E;  2F3V A;  2E5L L;  1SAP A;  2Z0S A;  3DWA A;  5FO9 B;  2L1B A;  3P75 A;  3HKS A;  3STB D;  4C1N K;  1QB5 D;  3HOU G;  4DV6 Q;  2XSC A;  4GLX A;  3HKZ B;  2VZA A;  2CHB D;  1CSQ A;  5E7N A;  4YY3 L;  4LF6 Q;  2EE1 A;  4FF2 A;  2HDM A;  2B8F A;  3AFP A;  3W1B A;  5ISR A;  1Q82 C;  2K05 A;  3FRP B;  1PRT F;  3NEL A;  4ZAI A;  2K28 A;  1EQR A;  5E4X A;  1MI2 A;  1EYG A;  5C0X H;  1MSG A;  4C3J B;  5D65 A;  3T1Y Q;  4RHS A;  1K28 A;  4HMI A;  4J6H A;  3HEJ A;  4QIW B;  3PSI A;  4E6I A;  2CCZ A;  4RMF A;  2BH2 A;  4JW0 A;  5AJ3 L;  3JAM c;  3TME A;  4OXP A;  5IT9 c;  4K8I A;  1HZ9 A;  4DV1 L;  1DON A;  1IBM L;  1X9N A;  1STA A;  3J80 E;  1FR3 A;  1TXY A;  1XTC D;  4KD3 A;  4NW2 A;  3EBE A;  4QGU A;  1CQF A;  1B7Y B;  2B63 G;  1ZKO A;  1FD7 D;  4Q0F A;  1M8A A;  4DF7 A;  1Q90 A;  1WTX A;  3AYH B;  5C4J H;  1KDA A;  1X3E A;  3VDY A;  3UE1 A;  1HNX Q;  4DR2 Q;  1B2T A;  5FOB B;  3I72 A;  4I7Z C;  1JWS D;  2QCP X;  2G9D A;  4XDX A;  3ULJ A;  4C3H B;  3S1Q B;  2PZW A;  3S16 B;  1H9R A;  1A2T A;  3CCE A;  1HFG A;  1UE7 A;  2QF7 A;  1I6H H;  2IY5 B;  1DZ1 A;  3EN2 A;  1PZK D;  4L8J A;  3GV6 A;  3OW7 A;  5JPN C;  2JN4 A;  1IBL L;  2F0V A;  4WJ4 A;  4DV4 L;  3A5U A;  1EWH A;  2F0S A;  4GLV B;  3G71 A;  4DR5 Q;  1LM0 A;  2L0C A;  3KOJ A;  1QVF A;  1PFM A;  4B3M L;  3TZU A;  3ERO A;  3VR6 A;  1X3Q A;  4DR7 Q;  2F03 A;  3LWE A;  1RKN A;  1WJJ A;  4C2M H;  2L55 A;  4A3C H;  1PFN A;  2R92 B;  2J7Z A;  3I8Z A;  4YY3 Q;  5C3W A;  3RD4 A;  3IFD A;  1ASY A;  2RCF A;  4DV0 L;  1ZYR D;  2NZO A;  2F0N A;  4OO1 I;  4YCW A;  4AYB E;  4BBR B;  1PYW D;  5FO8 B;  3BZD B;  4B3R L;  2PQA B;  4LF9 L;  1E3P A;  4RAU C;  5CV8 A;  4DAY B;  1V8Q A;  3BDO A;  1R9T B;  1C8C A;  1EY9 A;  5J22 A;  4K14 A;  4HJ9 A;  1V43 A;  5COR A;  4JI3 Q;  4GS3 A;  2EY6 A;  2B2V A;  3T1H Q;  2EJF C;  2HIV A;  1EFW A;  4NXM Q;  1I4Q A;  1C7Y A;  4A3J H;  1Z47 A;  4FNF A;  4JOI C;  3AB9 A;  2NVX B;  1LTT D;  4WRD A;  2I0Q A;  1SJH D;  2JXM B;  3I73 A;  2UXB Q;  2KEE A;  5EBD A;  4O42 A;  4QIW E;  4R4T A;  1BUV T;  3MEH A;  3PUZ A;  1QG7 A;  4JI4 L;  1LTG D;  1BCP C;  1EIF A;  2DNC A;  2K5W A;  3V05 A;  1I94 L;  3L0O A;  4RGO S;  5TSS A;  5M3M G;  1ICW A;  2ZXP A;  4DK3 C;  2QA4 A;  1A6X A;  4DV4 Q;  1GUW A;  1LT4 D;  2QGQ A;  3KF6 B;  1L0W A;  1U5K A;  3KJO A;  3VYS A;  5ELE A;  3CCJ A;  3CCQ A;  4P73 A;  3HOZ B;  4DR1 Q;  4JI8 L;  5C3E B;  3NTI A;  1GUG A;  4XTC S;  1XMQ L;  4KHZ A;  3DHQ A;  1SFO B;  1CM9 A;  2XWB B;  2LXK A;  5I9P A;  4B9X A;  2D0P A;  4IFD J;  1E2V A;  2K50 A;  5HUR A;  4AQY Q;  1Y1V G;  1JOQ A;  1TWG B;  1EQV A;  2RVL A;  1BOS A;  5HY6 A;  2O5I C;  1H9S B;  2WP8 J;  1PXU A;  4B3R Q;  4NPS A;  3HOW G;  3MC0 B;  4DUY L;  1JJG A;  4A93 H;  1A3U A;  5A2Q E;  1VQI A;  2K32 A;  3CU7 A;  2EJG C;  4HIO A;  1OXT A;  4X66 Q;  1UE1 A;  1X3P A;  3MXU A;  1BBU A;  3J80 i;  3GTO B;  2AWN A;  1O78 A;  1SRU A;  3HKZ G;  3PO2 B;  4PG3 A;  1JE4 A;  1VQL A;  1HJP A;  4N9P A;  4IJL A;  1SBB B;  4BBS H;  2AHO B;  2R7D A;  3T53 B;  4UP7 A;  1GUO A;  1HCZ A;  1MHW C;  4CKB A;  2D2C C;  4C3J G;  3S2H B;  3U4Z A;  3ND9 A;  3CF5 A;  5FLX E;  2R6G A;  4LFA L;  2OT2 A;  4DV2 Q;  3HOX B;  1HZB A;  5CR3 A;  1KXL A;  1QUQ A;  2RHQ B;  4IUN A;  3RLN A;  1XWE A;  2E2I H;  4JOI A;  1I4X A;  1KDC A;  4F7X A;  1Y14 B;  3SHL A;  4CJ0 B;  1YJN A;  3LNN A;  4M1U B;  3ZJY C;  4UP8 A;  5K5P A;  4LW1 A;  4A3I H;  1YIJ A;  1DGS A;  3IAY A;  5IGG A;  1Y8N B;  5CGK A;  5ELD A;  1CZG A;  4C56 C;  3H0G H;  4X62 L;  4DR6 L;  3BDL A;  4EQO A;  3TP8 A;  3OSO A;  4CDF C;  1B44 D;  1HTL D;  3NK9 A;  4C3H G;  2EZV A;  3I4O A;  5K36 H;  1NTG A;  3S2D B;  1JJ2 A;  1O7I A;  2PYK A;  4JVZ A;  4RKL A;  4YCV A;  4H02 A;  2LMC B;  1J9O A;  5IYD G;  4DR3 L;  2GVA A;  2RDG A;  2UUC L;  1MBY A;  3GTM B;  5DM6 3;  2WAC A;  1SYB A;  2F0E A;  1NAP A;  1LV9 A;  4KTA A;  2UXC L;  1O7Y A;  3D3R A;  1VQK A;  4K2K A;  1QWY A; 
#chains in the Genus database with same CATH homology
 2C9O A;  1WD0 A;  1EY7 A;  1Y1W B;  4GZY C;  3S15 B;  4TSS A;  2IX1 A;  4L63 B;  5EBC A;  1I6V C;  4K5V A;  2D62 A;  3SK6 A;  3KK7 A;  1F9R A;  1R4Q B;  2FHT A;  2F0T A;  3KLS X;  1TS4 A;  2JA6 B;  1C48 A;  4X3T A;  2XWJ B;  2VB3 X;  1EYA A;  3TBI B;  4HR7 B;  1PLF A;  4DXF A;  2EY5 A;  2BDN A;  4KY6 A;  1TT2 A;  2WIN B;  3EA6 A;  2HDL A;  2EYM A;  1EOT A;  1PDQ A;  4IFD I;  2FIN B;  5E4W C;  1SNP A;  1BQQ T;  4CKC A;  5IT9 E;  5JEA G;  3Q23 A;  2O5J C;  3J7A V;  1Q1B A;  1KLU D;  1HQR D;  4DU9 A;  1TS5 A;  2J4X A;  2F0O A;  2JP1 A;  1HXY D;  5I2X A;  2E2H B;  5T1I A;  4IAL A;  1V1P A;  1D5M C;  5IIF A;  3GTJ B;  2B2T A;  2A6H D;  1TS2 A;  1GHJ A;  1HUN A;  1WTO A;  4ZLT F;  5FK9 C;  1B53 A;  4K6L A;  3R3O A;  2XRS D;  5C44 B;  2K6A A;  1LTI D;  4LAA A;  4IUR A;  3LWU A;  3CRK C;  4Q5V A;  1Z6H A;  1Y8O B;  5KIX A;  4IN3 A;  1SYD A;  1BBX C;  2B39 A;  1FNU A;  5M5X B;  3RZO B;  4QCL A;  3N6R A;  4FF3 A;  2ZXR A;  2X6G A;  5JVH 3;  3P7J A;  2RDF A;  2MP1 A;  4XYO A;  1DOM A;  2BOS A;  4Z9C B;  1AW7 A;  5KNB A;  4R8I A;  1ZYR C;  1PRT D;  5EGT A;  3DEP A;  1UNS A;  4NKL A;  3TZD A;  3KLR A;  2EOT A;  4XQN A;  3GTQ B;  1LT6 D;  2SNS A;  4K8J A;  4OIK A;  3PMF A;  1II3 A;  4A3B B;  3DUZ A;  4Y7N B;  4OO1 G;  2KEC A;  1S5D D;  1F9Q A;  1GOZ A;  4R8N A;  4BY1 B;  3H09 A;  2R7Z B;  4DN4 M;  3L7Z C;  4ZQ3 A;  2AUK A;  5C0X J;  2RA4 A;  3MA2 B;  1HRJ A;  1CHP D;  2F0W A;  5I2Y A;  4K5W A;  3BYY B;  4QUC A;  1PTO H;  4DAP A;  2NN6 H;  5CV6 A;  5M9O A;  3K59 A;  1G2T A;  1FNW A;  1IL8 A;  3NUC A;  2F0I A;  2B2Y C;  3M7G A;  3NTK A;  1ONL A;  5DNF A;  2Q8R E;  4KY7 A;  3SK5 A;  4FXG C;  3MFG A;  3PUY A;  3MFY A;  3T51 B;  3NQT A;  5I9O A;  3QB3 A;  4TQU S;  1W6J A;  1I4R A;  5LL6 X;  1PTO F;  2A5H A;  1QNU A;  4XQJ A;  4A3E B;  1AFP A;  1EU3 A;  3HGB A;  4AYB B;  1F2M A;  1SE3 A;  3V96 A;  5JAV A;  5G3L F;  1QOH A;  3SEB A;  4A3D B;  1I4G A;  2XN9 C;  1VCI A;  1ESR A;  1TWA B;  3ZYY X;  1KTK A;  3S14 B;  2DY7 A;  4FYD A;  3WDN A;  3MXG A;  1L0Y B;  3TP6 A;  1TY2 A;  2ZXO A;  2PQE A;  4ILW A;  4KY5 A;  2AWO A;  3UI2 A;  3GV3 A;  2ID0 A;  2KCC A;  1ET9 A;  3QOJ A;  2B2V C;  4UDU C;  3C1F A;  1MGS A;  4CKE A;  1TVX A;  2MJ8 A;  1B9M A;  3NSW A;  3CHB D;  5IGF A;  1RTO A;  1F2Z A;  3OIQ A;  5IGB A;  4XT1 B;  1J8I A;  3OWF A;  1FGB D;  1SSO A;  2RBM A;  2PMZ B;  2E76 C;  3CQZ B;  2B2Y A;  2Z8L A;  4KD4 A;  5C4Z A;  2JA5 B;  3QIA A;  4L6T B;  4M8A A;  3H3V C;  3HG9 A;  1XX8 A;  2CW0 C;  3DWQ A;  2F0G A;  1A3V A;  2NB0 A;  4G57 A;  1XYI A;  2CVR A;  4HSV A;  3R2T A;  2RKS A;  4RGT A;  2YYZ A;  2IX0 A;  4KK7 A;  4EVO A;  1K8O A;  1OXV A;  1SNM A;  2KA7 A;  2SNM A;  1AP0 A;  1HA6 A;  2QIL A;  4FXD A;  4BA1 I;  3R93 A;  5C4H A;  2F0Q A;  1ESF A;  3J7A F;  2JA8 B;  5C0X I;  4A3F B;  2KJX A;  1EZ6 A;  1HFN A;  2N88 A;  1GXD C;  2NVQ B;  2TSS A;  1Q8I A;  1ZXT A;  1Q1E A;  3MHB A;  4IUV A;  4ABN A;  2EYJ A;  4RGM A;  1T5E A;  2Z4H A;  4H0L C;  1QNK A;  1SE4 A;  2DY8 A;  2K5Q A;  3KBG A;  3NQI A;  3M4Y A;  1FNV A;  3J81 L;  3FPU B;  4RH6 A;  1U4L A;  1BCP B;  1U9R A;  2K03 A;  2HCC A;  1H9J A;  3HOV B;  3S17 B;  1BNZ A;  2KUM A;  1K8M A;  3A54 A;  1RTN A;  3I90 A;  5KYL A;  2NYZ D;  1HTP A;  2IJ0 A;  1DJR D;  3M3Y B;  4IUT A;  1EIG A;  1YNN D;  3O13 A;  4A3M B;  2B2W A;  2JEB I;  1LAB A;  2PO4 A;  3A8K E;  4DNR B;  1IKL A;  3Q24 A;  3A7L A;  2NWG A;  3NBI A;  5EQ0 A;  4IFD G;  1EWC A;  2EVB A;  1Q3L A;  2F0F A;  5CMD A;  2F0U A;  1KNE A;  5C5L A;  1OXU A;  2PZU A;  2KOL A;  5M3F B;  4HSP A;  2A6H C;  5T1G A;  1LTB D;  5BN4 A;  2KHS A;  1O7Z A;  4PQX A;  1O80 A;  1AEX A;  2DN8 A;  2E2D C;  1AN8 A;  1PTO C;  5KYI A;  5JOB A;  1F2L A;  3R8B A;  2KED A;  1WCM B;  4KV6 A;  1PMR A;  1KDB A;  1IYU A;  3K5O A;  1L0X B;  5NUC A;  3RMH A;  4F8M A;  1SJE D;  1ENC A;  2L9H A;  3ERQ A;  1TWC B;  4HMJ A;  4G7O C;  4B9W A;  3NHH A;  3PUW A;  1D1I A;  5JPM C;  4DAY A;  3HZX A;  5EKI A;  3T16 A;  2LFN A;  1PRT C;  1VMP A;  3PIO 3;  3N52 A;  4IUU A;  3H91 A;  4TKO B;  1ENF A;  2F1M A;  2TMP A;  2A6E C;  4HTH A;  3G7L A;  4IUP A;  3GP7 A;  4H7B A;  2DNE A;  3D6W A;  2LY7 A;  2WB1 B;  2Z4I A;  4K2L A;  1LTA D;  1V1P B;  2EYO A;  2CW0 D;  2WKC A;  1IHZ A;  5BN3 A;  3K58 A;  3P20 A;  2VB2 X;  2BA0 A;  4EQN A;  2RDH A;  1UAP A;  4J8Q A;  2B2T C;  1B9N A;  3SE0 A;  4YIJ A;  2R3Z A;  1ENA A;  3D4D A;  1Z7T A;  2Z1C A;  2A73 B;  1STB A;  4F88 A;  3NWT A;  4ZKB B;  2EYH A;  4OIJ A;  1M4V A;  4KN7 C;  2H4O A;  5C4J B;  3K0Y A;  2NTT A;  2WII B;  5KGU A;  1RJT A;  1SYG A;  3R2I A;  2F0D A;  2F0P A;  2MUY A;  4RWS C;  1D5X C;  3OHX C;  1I6H B;  4N9T A;  3D31 A;  2I07 B;  5IOD A;  4V19 0;  1STG A;  5HGT A;  3A55 A;  3D8G A;  3VA5 A;  1LAC A;  4O1N A;  4CJ2 C;  1DXM A;  4OHJ A;  1STH A;  1G2S A;  1EIH A;  4C2M B;  3D4R A;  3GO5 A;  2VNU D;  3MZ5 A;  4JBW A;  3NBH A;  1SEB D;  4LK1 C;  3Q6S A;  2NUC A;  3NWS A;  2L12 A;  3TDQ A;  3SR1 A;  5E1F A;  2X6L A;  3NTH A;  2F0K A;  4XXE A;  2IX3 A;  2OXP A;  2MGS A;  1JWU D;  3DMU A;  1STE A;  1CHQ D;  4A3J B;  3J80 L;  4LJZ C;  4ZKC B;  3I4L A;  3BVM A;  3BG3 A;  3TP5 A;  4ZYS A;  1ZEQ X;  1PTO D;  3K5N A;  4P2C B;  1EEI D;  1SNC A;  1SNQ A;  1D5Z C;  4J1M A;  3C2P A;  4BWG B;  3EVQ A;  4U68 A;  1V1O A;  2FMM A;  4U67 3;  3L9A X;  5G3L D;  1BF4 A;  1U4R A;  1IW7 D;  2L4N A;  2MHV A;  1EU4 A;  2AQ3 B;  3S9W A;  2K7V A;  5C3X A;  3IFT A;  1LT5 D;  2RQX A;  5J39 A;  2NBF A;  4RCO A;  1S5C D;  4A93 B;  1BDO A;  1EFI D;  4FF1 A;  4I65 A;  2K5D A;  5A35 A;  2XRQ D;  1DM0 B;  1JCK B;  3FPP A;  3NE5 B;  1GUS A;  2A6E D;  2KVM A;  3BDC A;  4R9W A;  4MIU A;  4BBS B;  1D6E C;  2HUG A;  1XXG A;  3FVQ A;  3HS0 C;  3I3C A;  3SXH A;  2OF1 A;  2G9H D;  1E2W A;  5C0X G;  1VMC A;  3FMC A;  1JOO A;  1JC7 A;  1JR0 D;  3AMU A;  2KQ3 A;  3WOF A;  3T13 A;  1B50 A;  5JEA H;  3M85 A;  3K5M A;  4PNY A;  2E2I B;  1R4P B;  1ET6 A;  1KNA A;  1CK1 A;  1KLG D;  2VXW A;  1B3A A;  3W3A A;  4A3I B;  1I4P A;  4XT3 B;  2F0H A;  2A69 C;  1HQM C;  3E6Z X;  3FEW X;  3H0G B;  3QG1 A;  1GJX A;  2OEO A;  4JK1 C;  4QUF A;  1ML0 D;  1YNN C;  4EQP A;  2MPM A;  1EY4 A;  1YNJ D;  3WOE A;  1TS3 A;  4ME5 A;  1S5F D;  1Y69 U;  3MAQ A;  2QEJ C;  5F2D A;  3MWY W;  2XIW A;  4H13 C;  3C46 A;  4ODG A;  1SMY D;  1F77 A;  3TP7 A;  3Q22 A;  2E2J B;  3PIP 3;  2LKV A;  5EPJ A;  3S1N B;  2VUM B;  3CRL C;  3AU7 A;  1UUP A;  1WTP A;  2LS0 1;  1OO9 B;  2B2U A;  1G91 A;  3FDT A;  2ICI A;  4FP5 D;  3C1E A;  5FLX L;  1K83 B;  1HA5 A;  1S5E D;  1QCB D;  5FKA C;  3M4O B;  1IKM A;  2L11 A;  3L3O C;  4RKB A;  2ZT9 C;  2Q8T A;  2NN6 I;  4WOR A;  3M7N A;  1JOR A;  1U4M A;  5ELC A;  2F0M A;  1T5X D;  2EYP A;  1H9K A;  1CZW A;  3URY A;  2M2L A;  4OO1 H;  1OXX K;  4C3I B;  1TKW B;  4HCS A;  2PNR C;  2B2W C;  2WV6 D;  2YU9 B;  5D3I B;  2SOB A;  1CFM A;  2XVS A;  4IZ8 A;  2ICE C;  4A3K B;  2ENB A;  2WAQ B;  5EJW A;  3GD7 A;  4F87 A;  1EYC A;  1SNO A;  1E2Z A;  4DA2 A;  2Y0S B;  4A3G B;  1RF2 D;  2PCF B;  2R61 A;  1WTQ A;  3NXW A;  5ELB A;  1TQO A;  1PZI D;  1SDF A;  3GTG B;  5DAU A;  3Q0A A;  3CKI B;  4OL7 A;  2BE5 D;  4CBV A;  4DXG A;  3PO3 B;  5IGD A;  1S4Z A;  1G6Z A;  5JVG 3;  3KBX A;  5EKL A;  3ITP A;  3FKI B;  2F3W A;  5KRU A;  1LO5 D;  3I4N B;  1B1Z A;  2BCO A;  2IT1 A;  1TR5 A;  4XQQ A;  2IPK D;  4X3S A;  1SYF A;  2C5C A;  1NR4 A;  4CHT B;  3RLF A;  4KI0 A;  5CV7 A;  2AQ1 B;  3I4M B;  3KUP A;  1FYC A;  4NMZ A;  4WFN 3;  5IGE A;  1GUT A;  3TN2 A;  2EXZ A;  2FMC A;  3JAM L;  2A69 D;  4BS9 A;  4ZK9 B;  2E75 C;  4G4K A;  4BY7 B;  3NPP A;  4MN3 A;  5IT9 L;  3KLS A;  4ULL A;  2JSO A;  4KHV A;  4S3S A;  5EKK A;  1RDP D;  4K6D A;  1RD9 D;  5JJZ A;  1F2Y A;  5E3F A;  4PMW A;  1MD2 D;  5K36 G;  1EZ8 A;  3A8I E;  2NZ1 D;  4QMG A;  5KND A;  4H44 C;  5I6Y A;  2E74 C;  2CQA A;  4KMU C;  3PUV A;  3PUX A;  2I46 A;  4G7H C;  1CQV A;  2D5D A;  1DD2 A;  3K57 A;  1HHV A;  4C1N I;  1ILP A;  2HCI A;  4DK0 A;  5I6W A;  1PTO B;  3D6C A;  3QJY A;  1UEA B;  2J0T D;  1STY A;  1F9S A;  3SK8 A;  3RUZ A;  3MTS A;  4WJW A;  4RFB A;  4RA8 A;  5KNC A;  5IOC A;  1A3T A;  5C4X B;  5BN5 A;  2Q8I B;  1CA5 A;  1WTW A;  1O7L A;  4LMQ D;  5C6A A;  3HRZ C;  1TU2 B;  2BDO A;  1IW7 C;  3C3L A;  4DGZ A;  4DAV A;  1D2B A;  5J1Z A;  3OMC A;  3SK4 A;  1S5B D;  2KCN A;  2SDF A;  3TSS A;  4QB4 A;  2AUJ D;  5EPL A;  3GTP B;  1A15 A;  2JA7 B;  1PRT B;  1BO0 A;  3VR5 A;  2EDG A;  1SYE A;  2A68 C;  5M5Y B;  1X32 A;  2A74 C;  4G7Z C;  2H1E A;  4C3I G;  3K7A B;  3A8J E;  2K33 A;  5FO7 B;  3DWP A;  4KKS A;  1EY8 A;  1JWM D;  3J7Y W;  2EYF A;  1QJO A;  5CV4 A;  1B4O A;  1EY6 A;  4QF4 A;  2HQE A;  4ZUJ A;  1ILQ A;  3V2T A;  4V0B A;  5EPK A;  1TII D;  1SND A;  2R93 B;  1PFB A;  1BR9 A;  3BVZ A;  3A7A B;  3K6O A;  3S1R B;  3T4A C;  2O4X A;  2JYO A;  4RHR A;  2F4I A;  3VYU A;  4DNT B;  1NSN S;  1WTV A;  1DYQ A;  3VA7 A;  4IFD H;  2EPB A;  5CV5 A;  5LHY 1;  1CT1 D;  4XYQ A;  3G6J B;  3MVV A;  4CGY B;  3EQL C;  4HCE A;  3X3N A;  3OIP A;  4ZRZ A;  4DFA A;  2M00 A;  1JB3 A;  2K04 A;  3ND8 A;  3SVM A;  4X3K A;  2PW7 A;  1JOK A;  1ROD A;  3OMG A;  1YNJ C;  3OWE B;  4IQZ A;  4KJO A;  3HOY B;  1D1K A;  2B8G A;  1OXS C;  2IWH A;  1Q12 A;  1H9S A;  1F9P A;  1WTR A;  2QDB A;  1IYV A;  3K5L A;  2K01 A;  3NP8 A;  3QO2 A;  3ONA B;  3T56 B;  1VF5 C;  4FXK C;  1SMY C;  2FFK B;  1SYC A;  3X3M A;  1W6K A;  1LTS D;  2O2L D;  1HPC A;  4NP5 A;  2SEB D;  1KAA A;  3LX0 A;  1VF7 A;  3DEO A;  2EY2 A;  4RGN A;  3F2U A;  4HN7 A;  1BXT A;  3U9S A;  2F0J A;  2L5T A;  2GA4 B;  2EJM A;  3J81 E;  5DEH A;  4MHE A;  3MXN A;  1WD1 A;  4EGV A;  2PZT A;  1BCP D;  5CBA E;  3HOU B;  3OPO A;  1PZJ D;  3RZD B;  1NUC A;  3VYR A;  3BYT B;  3JAM E;  1EQT A;  2F0L A;  2QKI C;  1U4P A;  1G8Z D;  1I4H A;  2NTS A;  3D4W A;  4KKT A;  1JQY D;  5I4D A;  5JEA J;  4CJ1 B;  3IKJ A;  3A56 A;  4RCN A;  2NN6 G;  4UAI A;  1EL0 A;  1LLR D;  2IW3 A;  1SXT A;  5C5M A;  2EYL A;  2JE6 I;  1CTM A;  3DXJ C;  4HED A;  2JEA I;  5LL6 S;  2NVY B;  2RSN A;  2V4D A;  2XNA C;  4X3U A;  2NVT B;  2B63 B;  5M5W B;  1GUN A;  1CA6 A;  3I70 A;  5CC4 A;  3U9O A;  3VR2 A;  4ID6 A;  3MXP A;  1Y8P B;  1HUM A;  3VR3 A;  3VYT A;  1A2U A;  4FO2 A;  1STN A;  3BS1 A;  2A68 D;  4K5X A;  3P1H A;  1EY0 A;  5CYU A;  3S1M B;  1WVL A;  3IL8 A;  2BE5 C;  1SE2 A;  4FF4 A;  1I3Q B;  4PMB A;  2FJ2 A;  1LT3 D;  1RCV D;  2B2U C;  1TWF B;  1VDZ A;  1KAB A;  3GQB A;  2K1B A;  3QWN A;  2RSO A;  5D14 A;  1EEF D;  1LTR D;  2M9V A;  3H6M A;  2WKD A;  3DM1 A;  4ZUI A;  1DCZ A;  3KF8 A;  4DK1 A;  4IUQ A;  5COY A;  3E5S A;  4PV1 C;  1BCP F;  3OOC A;  1DOK A;  1JIC A;  4KJN A;  1DOL A;  4BA2 I;  1E0B A;  1C4Q A;  2AQ2 B;  1QE6 A;  3HP3 A;  4TRD A;  1AZP A;  1AZQ A;  3BVG A;  2PW5 A;  1H9M A;  1EY5 A;  5ELF A;  3W2D A;  4KKU A;  1NR2 A;  1TY0 A;  2PPB C;  2BA1 A;  3GTL B;  5AFW A;  1RHP A;  1CI3 M;  3EFX D;  3SDZ A;  3GTK B;  4OGQ C;  1TWH B;  4B08 A;  4HAE A;  5CV9 A;  5M3M B;  4FVM A;  5KEE A;  1G29 1;  5D3D A;  1EYD A;  5A2Q L;  1NCV A;  3PV0 A;  3E0J A;  3VR4 A;  1QIL A;  2IL8 A;  1I50 B;  4XIG S;  4NDX A;  5IGC A;  3H94 A;  5DM7 3;  2X69 A;  4PMC A;  3QOL A;  2EY1 A;  2D9U A;  1Y1V B;  4KN4 C;  3I91 A;  2N55 A;  1GHK A;  3EJI A;  3HOW B;  1MSH A;  5CBE E;  2F3V A;  1SAP A;  3DWA A;  5FO9 B;  2L1B A;  3P75 A;  4C1N K;  1QB5 D;  2XSC A;  3HKZ B;  2CHB D;  2EE1 A;  4FF2 A;  2HDM A;  2B8F A;  5ISR A;  2K05 A;  3FRP B;  1PRT F;  4ZAI A;  2K28 A;  5E4X A;  1MI2 A;  5C0X H;  1MSG A;  4C3J B;  5D65 A;  4RHS A;  4HMI A;  4J6H A;  3HEJ A;  4QIW B;  4E6I A;  3TME A;  4K8I A;  1DON A;  1STA A;  3J80 E;  1FR3 A;  1XTC D;  4KD3 A;  4NW2 A;  1CQF A;  1ZKO A;  1FD7 D;  4Q0F A;  1M8A A;  4DF7 A;  1Q90 A;  1WTX A;  1KDA A;  1B2T A;  5FOB B;  3I72 A;  4I7Z C;  1JWS D;  2QCP X;  2G9D A;  4XDX A;  4C3H B;  3S1Q B;  2PZW A;  3S16 B;  1H9R A;  1A2T A;  1HFG A;  1DZ1 A;  2QF7 A;  1PZK D;  4L8J A;  3GV6 A;  3OW7 A;  5JPN C;  2F0V A;  1EWH A;  2F0S A;  2L0C A;  1PFM A;  3TZU A;  3ERO A;  3VR6 A;  1X3Q A;  2F03 A;  3LWE A;  1RKN A;  2L55 A;  1PFN A;  2R92 B;  2J7Z A;  3I8Z A;  5C3W A;  3RD4 A;  3IFD A;  1ZYR D;  2F0N A;  4OO1 I;  4BBR B;  1PYW D;  5FO8 B;  3BZD B;  4RAU C;  5CV8 A;  1V8Q A;  3BDO A;  1R9T B;  1C8C A;  1EY9 A;  5J22 A;  4K14 A;  1V43 A;  5COR A;  2EY6 A;  2B2V A;  2EJF C;  1I4Q A;  1Z47 A;  4FNF A;  3AB9 A;  2NVX B;  1LTT D;  4WRD A;  1SJH D;  2JXM B;  3I73 A;  2KEE A;  5EBD A;  4O42 A;  1BUV T;  3MEH A;  3PUZ A;  1QG7 A;  1LTG D;  1BCP C;  2DNC A;  2K5W A;  3V05 A;  4RGO S;  5TSS A;  1ICW A;  2ZXP A;  1A6X A;  1GUW A;  1LT4 D;  3VYS A;  5ELE A;  3HOZ B;  5C3E B;  3NTI A;  1GUG A;  4XTC S;  4KHZ A;  3DHQ A;  1SFO B;  1CM9 A;  2XWB B;  5I9P A;  4B9X A;  4IFD J;  1E2V A;  5HUR A;  1JOQ A;  1TWG B;  1EQV A;  2RVL A;  1BOS A;  2O5I C;  1H9S B;  2WP8 J;  1PXU A;  3MC0 B;  1A3U A;  5A2Q E;  3CU7 A;  2K32 A;  2EJG C;  1OXT A;  1X3P A;  3MXU A;  3GTO B;  2AWN A;  1O78 A;  3PO2 B;  1JE4 A;  4N9P A;  1SBB B;  3T53 B;  1GUO A;  1HCZ A;  4CKB A;  2D2C C;  4C3J G;  3S2H B;  3ND9 A;  5FLX E;  2R6G A;  2OT2 A;  3HOX B;  5CR3 A;  4IUN A;  1XWE A;  1I4X A;  1KDC A;  4F7X A;  3SHL A;  4CJ0 B;  3LNN A;  4M1U B;  5K5P A;  3IAY A;  5IGG A;  1Y8N B;  5CGK A;  5ELD A;  1CZG A;  4C56 C;  3BDL A;  4EQO A;  3TP8 A;  3OSO A;  1B44 D;  1HTL D;  3NK9 A;  4C3H G;  2EZV A;  5K36 H;  3S2D B;  2PYK A;  4RKL A;  2LMC B;  1J9O A;  2RDG A;  1MBY A;  3GTM B;  5DM6 3;  2WAC A;  1SYB A;  2F0E A;  1NAP A;  1LV9 A;  4KTA A;  1O7Y A;  3D3R A;  4K2K A;  1QWY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...