5E1FA

Crystal structure of staphylococcal nuclease variant delta+phs g20e at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDEDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS G20E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5e1fA00
1SNCA 4ID6A 1EY0A 4DFAA 4G57A 4K6DA 4QB4A 4EQOA 1JOOA 4QF4A 5I9PA 1F2ZA 1SYGA 2QDBA 2F0DA 5J39A 2RBMA 3V2TA 3MZ5A 3DHQA 3BDLA 2PW7A 1KDBA 3NQTA 4OL7A 4EQNA 4EVOA 5I6WA 5KYLA 5IGDA 4KY7A 4KY6A 4K2KA 5EKLA 1EY9A 1IHZA 3QOJA 4H7BA 5C4HA 2EY1A 4HMJA 1SNQA 1SYBA 5KGUA 4B9XA 3H6MA 1SYCA 5C6AA 1STBA 1A3TA 3EROA 4KD3A 5HGTA 1SNMA 3LX0A 4ZUJA 2EYOA 4K8JA 5C3WA 1STAA 5E1FA 5CR3A 4NDXA 2SOBA 4K5WA 2EYPA 1KDCA 2EYLA 3E5SA 1EYAA 4J6HA 4KJOA 4KY5A 5J1ZA 4S3SA 2WACA 2F0EA 3D8GA 5JOBA 3D4WA 5F2DA 5IODA 5CC4A 3HEJA 4ME5A 5KRUA 2F0TA 1EY5A 1EZ8A 3D4DA 4QMGA 5ISRA 1F2MA 1RKNA 4HMIA 2LKVA 5E3FA 4ZUIA 2F0VA 3TP6A 3P75A 1A3VA 2KHSA 1EYCA 4KV6A 3TP7A 4R8NA 4IUNA 4F7XA 5KIXA 4KJNA 4NP5A 3SK6A 5IIFA 3BDCA 2F0GA 5C3XA 5JAVA 1KDAA 4N9PA 1EY8A 3T16A 4DF7A 4IALA 5HURA 1SYDA 3SR1A 5IGGA 4RKLA 5DEHA 1II3A 4YIJA 4J1MA 1A2UA 1NUCA 2PZWA 3NXWA 4PMBA 3OSOA 4F8MA 5CV4A 3MXPA 2EY5A 3D6CA 2F0KA 4KTAA 3SK8A 1SYFA 2F0WA 2O4XA 2F0UA 3QB3A 3P1HA 2F0IA 3NUCA 3PMFA 2PYKA 4K5XA 1NSNS 3R3OA 1SNOA 3VA5A 2F0FA 3S9WA 3SXHA 1STGA 5KYIA 2F3VA 3TMEA 2HQEA 4PMCA 5CV6A 4K8IA 3SK5A 5C4ZA 3U9OA 5EGTA 4K5VA 1KAAA 5IOCA 3C1EA 1STNA 2KQ3A 2PQEA 3ITPA 1ENAA 4TRDA 1JORA 2EXZA 1F2YA 4K2LA 5C5LA 3NP8A 2SNMA 4NMZA 2RKSA 3SHLA 5K5PA 2F0LA 2F0SA 3C1FA 2F0PA 4IZ8A 1SNPA 5IGEA 2RDFA 5M9OA 4KHVA 1ENCA 2F0QA 3OMCA 3RUZA 2ENBA 5IGCA 1JOQA 4ODGA 2EYFA 4I65A 2PZUA 5CV8A 2EYMA 3MHBA 4DGZA 5J22A 1EY6A 3SK4A 4NKLA 3TP5A 3DMUA 3QOLA 2F0HA 2OF1A 4LAAA 4WRDA 5NUCA 3T13A 5CGKA 4N9TA 2F0JA 1EZ6A 3HZXA 4PNYA 5I9OA 4RKBA 4WORA 1JOKA 2SNSA 3MVVA 2EY6A 1U9RA 3TP8A 1EQVA 2M00A 4ZQ3A 3NK9A 4KD4A 1TR5A 4HTHA 2F0MA 4E6IA 2F3WA 3OWFA 3EJIA 1A3UA 3NHHA 2OEOA 3ERQA 4DU9A 4EQPA 5I6YA 2EY2A 5C5MA 3OMGA 1AEXA 5DAUA 5IGBA 1STHA 4B9WA 1EY4A 1SNDA 2NUCA 1TT2A 2PW5A 1TQOA 5KEEA 1EYDA 5EKKA 5IGFA 5CV5A 2EYHA 5CV7A 5CV9A 3MEHA 2OXPA 1SYEA 2EYJA 1A2TA 2F0NA 4K14A 2PZTA 1EY7A 3EVQA 1KABA 1STYA 4MIUA 2F0OA
chains in the Genus database with same CATH superfamily
1SNCA 1EY0A 2K28A 2DGYA 4XT3B 5D3IB 1EIYB 4DV5Q 1KNEA 4A93G 4A3GG 4BBRH 1C48A 3OOCA 2MP1A 4RGMA 4OWWB 4BBSH 3OHXC 4B3SQ 3NTKA 1YNJD 2JA7B 5E4WC 1CI3M 4ABNA 2J0TD 1Y1VH 2XN9C 3F1ZA 3DWQA 3TN2A 4DPGA 5HGTA 4GOPA 4JVZA 4LNQA 5C4HA 1WVLA 1FYCA 5J1ZA 1J6QA 3D4WA 3CCRA 2ES2A 5EJWA 3N52A 3U9SA 1E7ZA 3OPOA 3HOXG 2R7ZB 2YTVA 1V43A 4EGVA 3FKIB 2KHSA 1EYCA 4LK1C 3CCSA 4GKKL 1BBXC 1BO0A 2F0GA 3I91A 2BDOA 1EY8A 1MSGA 5HURA 4KI0A 3U4VA 4JI2Q 1NY4A 2B2YA 1OXVA 3HOYG 4XQNA 4A3BH 3NWTA 2EE1A 1SYFA 2O4XA 1X3FA 2EOTA 2NVYH 5IWAL 1UUPA 4YCVA 1HNZL 1IBMQ 1X56A 2SNMA 3BJUA 5C0XI 3C1FA 4KKUA 1K8MA 1SNPA 4LF8Q 3CCQA 5IT9c 3RUZA 4CJ1B 1I4HA 4OELB 2VQEL 3KF8B 1K3RA 2MO1A 4ZKCB 1E24A 2HCIA 4CGYB 4HN7A 2R92B 1K0SA 1LTID 3BVGA 4HJ8A 1JWMD 3PF5A 1K8GA 3G4SA 3HGBA 4RKBA 4HSPA 4A3JH 2N49A 1I3QB 4AH6A 1LTRD 2F0MA 4C3JG 4UP9A 2OQ0A 1E22A 5CBAE 4RAUC 1FNWA 2E8GA 2EY2A 5IGBA 1XTDA 3M9BA 4HSVA 1YJWA 1TT2A 3PUVA 1TQOA 5LMUQ 1AFPA 1LTLA 4KKSA 2ZXPA 1ZXTA 3J80E 2F4VQ 4ID6A 1YJ9A 1YJNA 2I5LX 3BU2A 2CHBD 2F3IA 4X3SA 4YHHQ 1BBUA 5JJLA 5M3FB 3HOZH 3S24A 3EQLC 1E1OA 4POFA 1VQHA 5JVG3 4NXML 3H6MA 1SYCA 1V1PB 2RVLA 3VA7A 5FLMG 2EYOA 5EQ0A 3S17H 3D3RA 2C5CA 2MUYA 4BY1B 4NDXA 2SOBA 4IUTA 4K5WA 3KLSX 1V8QA 4J6HA 4GNXA 5FO9B 4JI3Q 1CKNB 1HR0L 3GV6A 2DJFC 3K7AB 1XWEA 2IX0A 5M5YH 1DGSA 5IYCG 2JA6G 3HOVB 1M4VA 4IUNA 4HJ9A 3CCMA 5C0XH 3RZDH 1BCPD 1WTOA 1DD2A 3J81c 2SEBD 2E75C 1VQJA 1N33L 1DJRD 2GVBA 1FL0A 2VNUD 3MXPA 1UWVA 3BZKA 4GS3A 4BXXG 4LF6Q 4ULLA 5C4XG 3AYHB 1Y14B 3NWSA 3R3OA 4CDFC 1GM5A 4DXGA 3HOUG 1STGA 1QCBD 2K5VA 2I0QA 4IN3A 4P2CB 4YY3L 1PH2A 5IYBG 1SXTA 1VQKA 1WJJA 1EIHA 4LF9Q 3OTOL 1PFMA 1UE6A 1PZKD 4DUYL 1TWAH 4R4OA 1Q8KA 4JBWA 2E5LQ 2LXJA 4WJ4A 3SK4A 3I73A 3H15A 1XPUA 2A6HD 2JA8G 4ZKBB 2RDGA 2JYOA 1A8VA 3HKZB 1XMQQ 2QDLA 4DV1L 4DV3L 1GHJA 4X6AH 4GOPB 1Q12A 4X65Q 1GUWA 4R4CA 4EQPA 1Y8PB 5M5XB 4AYBG 3G6JB 1WTHA 3CQZH 3KBXA 2WB1E 5JJZA 3NENA 2K04A 1H9RA 1ASYA 1XNRL 1MBYA 4G7HC 1V1OA 3UE1A 2R7ZH 4QB4A 2IHEA 3FKIH 4OIKA 4IFDI 2B3GA 1H9KA 3NELA 1K3BC 1LT6D 2CKZB 3GTPB 3PF4A 3KDFB 5EPLA 3NQTA 3L9AX 1GUTA 4A3EB 3HKSA 1SYBA 5C6AA 2DY8A 4APVA 5GAEC 1A3TA 3X3MA 4RGOS 3WOFA 3IAYA 1G2TA 2VUMG 2ZXOA 3E5SA 1HXYD 3BYYB 3FPPA 1SE3A 2KHJA 4U673 1Q86C 1IBLQ 2KCTA 1W6JA 1BCPF 3D4DA 2NVTB 3TP6A 1N34Q 1SAPA 1BCPC 4KV6A 4XT1B 2CH4W 2B63G 4BY7H 4GLAC 1BF4A 4NB3A 1B4OA 2PNHA 1BUVT 1PFBA 5DEHA 1R4PB 3H94A 3MXGA 3NQIA 4DV2Q 2EY5A 1VQLA 2LS01 5G3LF 2ZXRA 3O13A 2I5HA 5E4XA 5CORA 2NWGA 1MSHA 2JA7G 2B2VC 4P71A 3JAML 3F2BA 3MC0B 5JVH3 3M85A 3C2PA 5CV6A 1I4XA 3T1HQ 1J9OA 3GV3A 4XIGS 3H0GH 4K2LA 5C5LA 4ME3A 2Y0SE 4JOIA 3J7AF 4IZ8A 2E2HB 1JJGA 3J7A5 2JN4A 4M1UB 4ZYSA 5BN5A 3ICEA 4OWTB 3KF6A 1LO5D 2PZUA 5CV8A 2A6HC 2F4VL 2NB0A 3VYSA 3FHWA 3S2HH 2HHHL 1R9TH 4A3IH 1VQ8A 2UXBQ 4IFDH 4QIWB 3NK9A 5JEAG 4KD4A 4HTHA 2K5DA 2WAQE 2N3SA 4DR3Q 3EIVA 3K81C 3PCOB 2AWNA 4ZK9B 5A2QL 3OMGA 5DAUA 2R93B 3R2IA 3GDEA 4BY1H 1BR9A 2OXPA 3ND9A 1U4RA 1VQFA 3I4NH 1XXGA 1JR0D 2RF4A 3OIPA 5ELCA 1K8AC 4DUZL 4TVAB 1U4MA 3K7AH 1LV9A 3SDZA 4G57A 4K6DA 4A3LG 3M4QA 2UUBQ 1F9PA 2R92G 3GQBA 1WD0A 2B29A 3NTHA 2RBMA 4EQNA 4LF7L 1HNXQ 2K33A 4H13C 1GUNA 1L0YB 3PIPA 5BN4A 1SNMA 1HA5A 2XRQD 4YCUA 4C3IH 1GUSA 1SE2A 4B3ML 2JP1A 4RA8A 1WTRA 1XPRA 3ZYYX 5F2DA 2F4IA 2PO4A 1I6HB 1WOCA 2H4OA 3LGJA 5JJIA 2ZJQA 1X32A 1YNNC 3CPWA 2Z6KC 4A75A 1S4ZA 3S1MB 3V96A 5JPNC 5EBCA 2JEBI 1J8IA 3SK6A 3BDCA 3TZDA 1LUZA 1Y69U 1SLJA 1II3A 3Q23A 4J1MA 2K14A 4B3RQ 1PMRA 1B70B 5M3FG 1SFOB 1F9SA 3CCEA 1S5BD 4HJAA 1VQ6A 2PYKA 3RR5A 4CKBA 2K1BA 4F88A 5C4ZA 4IUUA 1CZWA 1ENAA 5EAYA 1IKMA 4P74A 1F2YA 1NCVA 2RKSA 4X3UA 2KHIA 2F0LA 2CWAA 3OMCA 2EIFA 4HEDA 3CRKC 1TWCB 1FGBD 5ELFA 3HOVG 1ILPA 1WFQA 3PQIA 3TDQA 1TWFB 2FMMA 4LAAA 5ELOA 4JI6L 1M8AA 1WTVA 2SNSA 1OXSC 4RCNA 4LUZA 2N88A 1HA6A 4FNFA 4ZQ3A 1HTLD 1TR5A 4NPSA 3ONAB 4Y52H 3CC4A 2E2JH 2BCOA 2G5DA 3JAME 3I2ZA 1MJCA 2TSSA 3GTJB 2PW5A 3M3YB 2RQXA 5EKKA 4RHRA 1K83H 5CV9A 4DR1Q 4DR6Q 4O0AA 2G9HD 5C0XJ 4A3KB 1J5EQ 3AEVA 3S15B 3TSSA 1QVFA 2NVTH 5IT9E 3B6YA 3TEHB 2QDBA 1XPOA 2XVSA 4OO1G 2P5ZX 2PW7A 3PO2B 1E2ZA 5IGDA 5M3MB 1TWHH 5EKLA 3MXNB 4FO2A 3NPPA 1SNQA 3HKZG 4JC0A 5GROA 1RHPA 4B9XA 3Q6SA 3M7NA 3EROA 2PNRC 2WINB 4A3FB 4OX9Q 2NN6G 4DAVA 1UAPA 1DM0B 1STAA 1MKHA 4KHPL 3K7UC 3KK7A 1B53A 2EYPA 3IRBA 3I56A 2Z4HA 1XNQQ 1AE3A 5EBDA 4AIMA 2B2WC 1I94Q 2V4DA 3KF8A 2IT1A 1H9JA 1WCMH 1VQ4A 4AQYL 1AN8A 2VQFL 2O5IC 4DV7L 5LL6S 2M9VA 4TKOB 4A3EG 3MXUA 4HR7B 4XYQA 2FINB 1PDQA 4JK1C 4N8FA 3PUWA 1LTGD 3SXHA 2F3VA 3F2UA 1MIUA 4RWSC 1STNA 5DM73 2WV6D 5JPMC 4P72A 4IPCA 3OWEB 2R93H 2HIXA 4WJ3M 1B3AA 2JXMB 1AZQA 4X64L 2LFNA 2AQ3B 2F0PA 2R3ZA 3K6OA 1CTMA 3GTMH 3IL8A 1CT1D 1PH5A 4ODGA 3KLSA 2JA8B 4A93H 2EYFA 3QG1A 4K6LA 4A3GH 4U68A 3I4LA 3L7ZC 1DCZA 5I9OA 2A68C 4WORA 5CYUA 1X9NA 4KN4C 1JQYD 1VQCA 4B3TL 3J81E 1GVPA 1V1PA 1CHPD 1STEA 2ID0A 4JI8L 4FXKC 2QKIC 3K59A 1U4LA 2EVBA 5ELBA 1Y8OB 4IPGA 5IP7G 1EY4A 3H3VI 1CKNA 1C7YA 3KOJA 5IE8A 4RGTA 2BDNA 2HUGA 4A4IA 3HOXH 2A69D 4DV4Q 1PTOH 2OQKA 2PZTA 2UXDL 5FLXc 2VW9A 1D2BA 3PUXA 1I6HH 4JI0L 1LTSD 2F0OA 4DFAA 1JMCA 1EEFD 5LMNL 3HOYH 2L9HA 3RLOA 1C9OA 5I6WA 1KHIA 4GLVB 4GN4B 5C3EB 1S5ED 5KGUA 3RN5A 1FNVA 4KD3A 1L0XB 2B2UA 1L0WA 4OHJA 2R93G 1VQ9A 5FOBB 5IODA 4LUVA 4ME5A 2B63B 2F0TA 1EY5A 3CHBD 5BR8Q 1F2MA 1X3PA 1QUQB 3G7LA 2XGTA 4L8JA 4R8NA 2A8VA 4NP5A 2FFKB 1XX8A 4IFDJ 1IKLA 1BCPB 1VQAA 1YIJA 2PMZB 1SROA 5A35A 2LXKA 3MFGA 2E2DC 3NXWA 3J7ZC 1G6PA 1TS4A 4GKJQ 4C3JH 1OTCA 2Z0SA 3VYUA 1HNWL 4X3KA 1O7LA 2B8GA 4DNRB 5GAGC 3QB3A 4HJ7A 2K52A 3S9WA 3V05A 3TMEA 4PMCA 4LFAL 4DK6C 1KAAA 1WI5A 1EL0A 1PV4A 1KAWA 4GN3B 4LFCQ 4A3DB 2IPKD 1ICWA 1RL2A 4POGA 5LHY1 3M3YH 1HQRD 1GHKA 1I4GA 4C2MH 4LFBL 3A7LA 3S1RB 3H3VH 4FXDA 3URYA 5J22A 3OW2A 4JI7L 3KDFA 2BA0A 4OGQC 4DR5Q 2XWBB 4QL5A 2RHSB 1FVIA 1P16A 3CXCA 1MD2D 4L6TB 3S16B 1G51A 5FLMH 3CW2C 2K7VA 4F87A 1CM9A 3BS1A 3HFZB 1JB3A 4JI5Q 1EWIA 2L1BA 4DU9A 2PQAB 3K5OA 3I55A 5TSSA 1AEXA 2A69C 4IUPA 5C4JH 3M4YA 5IYCH 4G4KA 4RHSA 2JA6H 4RFBA 4DR4Q 1EY7A 1NR2A 3S14B 2BH2A 1H95A 1I4QA 4O2DA 4JBJA 3AU7A 3PUZA 1EQTA 4CKCA 4CDCC 1EEID 1B1ZA 2EJGC 1B2TA 3MZ5A 1HHVA 1G291 2R61A 4BXXH 5C4XH 4QGUA 1GUGA 4FF2A 3HOUH 1PH1A 3NEMA 5IYBH 2K6AA 3GTGB 1W6KA 5D65A 1QVGA 5CR3A 1HUMA 2ATWA 3S2DH 4JV5Q 3PUYA 1H9SA 1ZKOA 1X3QA 4A3KG 2K32A 4DKAC 4ZRZA 4R1JA 1LT3D 2Q8TA 1A0IA 2ZTDA 2KCCA 4KJNA 3UI2A 2JA8H 1IYUA 4UDUC 4QJFA 5T1IA 4NXNL 1ET6A 3T1YL 3AFQA 3PO2G 4F8MA 3UDIA 2K4KA 5M3MG 2D5DA 1EWCA 2F0WA 3S1QH 3QWNA 2Z8LA 4LF4Q 1MJEA 3NBIA 1RD9D 3PMFA 3U4ZA 1BNZA 1VQIA 3FDTA 2NVQB 1XMOQ 4ZAIA 2XRSD 4CDDC 4A3FG 1H9MA 2YTXA 2B2TA 4AYBE 2O2LD 1Q81C 3KJPA 3DEOA 2L0CA 3I4OA 3GTOB 4JPBW 3D31A 2A1AA 4LF5Q 4JI1Q 2YU9B 1AP0A 2QILA 3K80C 1X6OA 2Z9HA 1HFNA 2M00A 3M4PA 1UE5A 5G3LD 5J3BA 1TY2A 2RCNA 4L5RC 3OIQA 2VUMH 4L63B 3L0OA 1U5KA 4MTKA 1PRTC 5DM63 2VXWA 5C44B 1NTGA 3DXJC 4TSSA 2JJQA 2UU9L 1U0LA 2EYHA 3MEHA 3J7AV 1DXMA 4A3MB 3BZCA 2B63H 4OXPA 2D9UA 1CQVA 4DNIA 4DV5L 4EQOA 3K58A 1F2ZA 2AQ1B 2L55A 1UE7A 2PI2A 2DNEA 4Y7NB 1KXLA 3RD4A 3CCJA 2ASBA 4HCEA 3BDLA 2JA5B 3DM3A 4B3SL 2JA7H 2ALYB 2EY1A 3I4MB 2MFIA 1JC7A 2KECA 1STBA 3ZJYC 1EIGA 4V0BA 2I5MX 2QW7A 1KDCA 3P20A 3PO3B 1EYAA 1EFID 1UEAB 4GZYC 1SMYD 1QVCA 2UXCQ 4PMWA 4DR7Q 3M4OB 5FO7B 1TWGB 4G7ZC 3C46A 1KDAA 4JI2L 2V1CC 1KQSA 4RKLA 1BDOA 4YIJA 2GVAA 1NUCA 2XTIA 3GTQB 4DV6Q 5JEAH 5AFWA 1OO9B 4DR5L 3Q24A 4KMUC 5D3DA 4HJ5A 1JCKB 1L2FA 4OWXB 5C3EG 2CFMA 2MO0A 1SR3A 3L2PA 4FF1A 1CA6A 2QEJC 1IBML 1X55A 2L5TA 2UUCQ 3C1EA 4C1NK 2KQ3A 1ESFA 1YEZA 2NZOA 3CAMA 3W1GA 4LF8L 1Q8IA 1B3QA 4C3HB 4N8X1 3GTLB 1EQRA 4DR2Q 1YNND 4KHVA 2F0QA 4PZ6A 4A3LH 3NBHB 3H09A 2R92H 2JQOA 2J7ZA 2RCFA 5IP9H 3S14H 1SMXA 3ERSX 4NKLA 1JJCB 1I3QH 3MXNA 3JC66 3R2TA 2KEDA 1HJPA 3MVVA 1FJGQ 3TBIB 5IYDG 1DOLA 1Z9FA 4E6IA 4UHVA 2KENA 5BN3A 3LNNA 4BWGB 3IKJA 1H9SB 5LMUL 1CFMA 2NUCA 1Q1BA 3SGIA 3CKIB 4DV0Q 1FNUA 3FRPB 4A3DG 1TXYA 5CV5A 1X54A 3QR8A 3A74A 4OO1I 5IT9L 1DOMA 2EYJA 3K57A 2OWOA 1O7YA 2A6ED 1F9QA 2CQOA 4Z9CB 3HP3A 3ND8A 4YHHL 4X62Q 2NN6I 2F0DA 5M3FH 2ICEC 1GOZA 1LT4D 3NTIA 1DYQA 2QEXA 1AW7A 4KY7A 4K0KQ 1IHZA 3QOJA 2IX3A 3VDYA 4H02A 4DK1A 4RMFA 3U58A 3RZOB 1LLRD 4QCLA 1NMFA 1SMYC 1X3EA 3E9IA 3RLFA 4JI3L 5CMDA 4JW0A 1LABA 4X66Q 5CC4A 2ZM6Q 4HIMA 2K5NA 1EZ8A 3UDFA 3HOVH 5E7NA 5IP9G 2F0VA 3TP7A 1ENFA 3GTOH 5FLXE 5JAVA 2E74C 2MPMA 1PXUA 2EZVA 1PH4A 1BVSA 1SE4A 2D0PA 1HFGA 4PMBA 5CV4A 4LF6L 3WWVA 1JB7A 3G71A 1HZCA 2CH4A 2JK8A 2RDHA 2YYZA 4DA2A 2HQEA 1WTWA 2R7DA 3GTKB 1IBKQ 1KLGD 1LACA 2EXZA 4LF9L 1PYSB 1IL8A 2RA4A 2C35B 2E5LL 1VDZA 1N32Q 2E2IB 1HZBA 5AJ3Q 2AMCB 2ENBA 5IGCA 3E3XA 4OO1H 4M8AA 3J81L 2K05A 1HZ9A 1IXRA 2UUAQ 3HOWB 1HTPA 1WTQA 1EIFA 2NVXB 4UY8C 1JOKA 1XMQL 1U9RA 4HIKA 2NN6H 4KN7C 3BDOA 3HKZE 4DAYA 1PH3A 4X65L 1BXTA 1HZAA 5M5XH 3NHHA 4PQXA 5JJKA 1T5EA 2K5HA 3NSWA 2G9DA 1W3SA 5C5MA 1C0AA 3TS0A 2SDFA 3JAMi 1EYDA 3DUZA 5CV7A 3F8TA 2A6EC 3RNUA 1A6XA 1QUQA 4JI4Q 3S1NB 1STYA 3BYTB 3FP9A 1Y1WB 4FP5D 3LWUA 1KC8C 1TWGH 2DNCA 3E6ZX 1VF5C 5M5WB 3GTPH 5I9PA 1L1OC 5J39A 3KJOA 2CW0D 1VMPA 2MHVA 4MZ9A 2OCEA 1LM0A 4A3EH 2A68D 1GXDC 2FHTA 4BBRB 4JG2A 4CKEA 1LT5D 2LMCB 1HR0W 1TS5A 3I90A 4BBSB 1X3GA 3I3CA 3VYRA 4GLXA 2Z4IA 4TQUS 3TQYA 2B2VA 4EX5A 3LX0A 3DWAA 3PIOA 2TMPA 1Y1VB 4IOAA 3GD7A 5C44G 4KY5A 1IBLL 1Q90A 3RMHA 1N34L 1T9HA 2BH8A 3A0JA 3PIO3 4A3MG 4J15A 2LKVA 1O7IA 3CC7A 1E3PA 4HAEA 1SBBB 3VR6A 4GKKQ 3KFUA 3CCLA 4IALA 3T56B 4DV2L 1A2UA 2ZT9C 4R4TA 2JA5G 3OSOA 1SSOA 3SK8A 1B50A 4A3BB 1RJTA 3I4MG 1S5CD 1CHQD 3A5ZB 1HUNA 2F0FA 2PQAA 1RCVD 5IP7H 5KYIA 3T1HL 3KLWA 4GOPC 1SEBD 1RTNA 2NVYB 3SEBA 5IWAQ 1HNZQ 3D6WA 3PO3G 2N78A 2E2HH 4JBMA 1NE3A 1PFNA 2X6LA 2BE5D 1ENCA 2N8NA 3KYHC 2JSOA 1NNXA 4KKTA 1V9PA 2VQEQ 1OXTA 4DXFA 2EYMA 3TS2A 2WKDA 1Y8NB 5FKAC 3VYTA 1I6VC 2B2YC 4WRDA 4R8IA 5CGKA 3N6RA 1Q3LA 1EZ6A 2UXBL 3UDGA 5EPJA 3UDXA 4A3JB 1GO3E 2L15A 4QIWE 4DR3L 2OEOA 3C3LA 4BS9A 3W2DA 4CHTB 3RZOH 4BA1I 4H0LC 1IYJB 3MTSA 3D0FA 1ZYRD 4C3HG 1D6EC 2LY7A 1KABA 1PTOD 1YHAA 1PVOA 2UUBL 2CW0C 5JEAJ 1HQMC 1JOOA 3KLRA 3PV0A 4RGNA 1EOTA 1JWUD 2RSOA 4LMQD 1D5MC 3ER0A 3FPUB 5KNBA 1HNXL 1EU4A 1W2BA 2E76C 1VQPA 4B08A 1EY9A 4Q0FA 4KLKA 4ALPA 1N36Q 2K03A 4NXMQ 2IY5B 1TS3A 4DNTB 2WFWA 3I8ZA 3VR3A 4KJOA 2XWJB 3S17B 2HCCA 2MNAA 2F0EA 3Q22A 2MGSA 2GA4B 1U4PA 1A15A 4A3CG 1HR0Q 1RKNA 3T53B 3S1MH 1QOHA 4HMIA 2A19A 3P75A 1A3VA 4JYAQ 5M5YB 1SRUA 1Q82C 4DF7A 3T16A 1SFOH 4HIOA 4B3RL 3RZDB 2DN8A 3K5LA 2PI2E 1N33Q 3CCVA 3D6CA 2F0KA 4DAYB 1S5FD 1ILQA 2B8FA 2F0UA 3P1HA 1JE5A 1KL9A 3HRZC 5DNFA 4QY7A 4K8IA 1KNAA 1QILA 4K5VA 2XSCA 4GNXC 4YY3Q 2KUMA 2BE5C 2EXDA 3DWPA 1M90C 3OTOQ 1TWCH 3EFXD 1KLUD 5M9OA 2XIWA 4OIJA 3TRZA 4DUYQ 5EPKA 1TWFH 2I07B 1TWAB 4R9WA 4X3TA 3U50C 1N8RC 1FGUA 1I50B 2R6GA 3S1NH 1ONLA 1K0RA 2JE6I 1M1KC 5M5WH 4OONA 3FVQA 3E0EA 1PHJA 1KRTA 1E2VA 2EY6A 4RCOA 5FJ8G 4QUFA 2Q8RE 2M2LA 1LYLA 3CPFA 4XQQA 3VR5A 4DV1Q 4DV3Q 3GTJH 3M7GA 2Q8IB 2WKCA 2XNAC 1HCZA 1SNDA 1PTOF 2IHFA 1ZYRC 4DR1L 4C1NI 2WB1B 4A3KH 1JJ2A 4DR6L 5KNCA 1J5EL 2NZHA 4YWKA 2OT2A 1PTOC 3S15H 3TREA 3CQZB 3ULPA 1Q7YC 2B2WA 5ISRA 1XNRQ 1BQQT 3NE5B 5ELNA 3UE0A 2BA1A 4FF4A 3G6EA 4R4QA 3PO2H 2CCZA 5M3MH 3HOWG 4A76A 3DHQA 3HG9A 4PZ7A 4LUOA 3CMAA 4IO9A 4NW2A 4XQJA 1YI2A 4H7BA 2KVMA 2FMCA 1WTPA 1E0BA 4A3FH 1B9NA 3I7FA 2VB2X 4OX9L 2DY7A 1PRTD 4FYDA 4K8JA 3JAMc 1PZJD 5E1FA 1TS2A 1XNQL 5GQOA 3D8GA 1I94L 1I4RA 1K8OA 3NBHA 5D14A 3J80i 2FXQA 2ZJPA 1F77A 5KIXA 3BG3A 4F7XA 1F9RA 1Y1WG 1WD1A 3EA6A 1B44D 2NTSA 4ZCKA 3CCUA 1TKWB 5GADC 4N9PA 1QJOA 1IYVA 3SR1A 4BY7B 1GD7A 1B8AA 2OTJA 2QF7A 4KTAA 1ET9A 4BBRG 1Q1EA 1D7QA 5ELDA 4YCWA 3VA5A 4BBSG 1O78A 1MI2A 3FEWX 1PZID 2R7FA 4TRDA 1Y1VG 1JORA 5I4DA 2Y0SB 3WOEA 3H0GB 5IGEA 2F0SA 4FF3A 1LTAD 3H3VC 1CSPA 1SJED 1BOSA 4EQ5A 4MTNA 1YHQA 4HIDA 2A74C 2K01A 2OTLA 1Z7TA 2YTYA 1NBWA 3A55A 2HHHQ 3S2HB 4I7ZC 1R9TB 1EU3A 4A3IB 3TP8A 2WAQB 1YNJC 3LWEA 4A3BG 3OWFA 1N36L 4PG3A 4B9WA 2D62A 4JOIC 4DV4L 1SYEA 1A2TA 3A54A 4ILWA 1IL2A 1ASZA 3MFYA 3I4NB 4DUZQ 4O42A 3STBD 3EN2A 3T51B 1PYWD 2Q2UA 1AH9A 1JT8A 4JYAL 2I46A 1RODA 2KOLA 3K5MA 1KDBA 5C3EH 1PRTF 1L1OB 4LF7Q 3K5NA 4C56C 2NBFA 4KY6A 1I5FA 4KHZA 2F03A 4A3JG 2QA4A 1O7ZA 4DK3C 3AQQA 1ICFB 2VZAA 4B3MQ 4C3IB 5FLXL 5ELEA 5BR8L 4QMGA 3K8AA 3QO2A 1VQEA 5E3FA 3T4AC 2DJGC 1UEBA 2Q2TA 3DLLA 1PH6A 2N55A 4DAMA 5C3XA 1I50H 5IGGA 1D8LA 1KD1C 5IYDH 4GKJL 1UE1A 2PMZE 4KK7A 1A62A 1FR3A 1TVXA 3HOZG 1KTKA 4L5QA 3CMEA 2NTTA 4MHEA 4FDBA 4A3DH 1NR4A 3MAQA 2K5QA 4LFCL 2EPBA 2L11A 2GN5A 3VR2A 4Q5VA 1VQOA 2ZTEA 1EWHA 4NMZA 5K5PA 3AMUA 1JWSD 4IURA 2AWOA 3S1RH 5IY0A 2HQLA 5L37A 1AZPA 3AB9A 1IZ6A 1JOQA 1DOKA 1WTXA 2DUDA 4DGZA 1EY6A 3OW7A 3TP5A 3QOLA 1QNUA 5NUCA 1B9MA 1NAPA 5C0XG 3HZXA 4PNYA 3VR4A 3S16H 4JI6Q 2Q2IA 4JBKA 3PGZA 4XTCS 3F2DA 4JI5L 1VQMA 1QE6A 3EJIA 4DAPA 4L5SA 2JEAI 1OXUA 2HD3A 3A8IE 5LMNW 4IUQA 1STHA 2E2JB 3MEFA 2ZJRA 4BA2I 5IGFA 4DR4L 1NJIC 1PH9A 1K83B 5K36H 3STBC 2HDMA 2BOSA 1XTCD 3W5OA 1SE8A 2K5WA 1EUJA 3FMCA 2IJ0A 3QIAA 3BZDB 2WIIB 5FO8B 1F2LA 4EVOA 2MQHA 1HPCA 4HCSA 4L5TA 1G2SA 1TY0A 1WYDA 4HMJA 3GTGH 1TWHB 2EJFC 1CSQA 2Z1CA 1ML0D 1D1IA 1S40A 5C3WA 1PA6A 4JV5L 3GO5A 1QNKA 2F1MA 2EYLA 3K0YA 4KHPQ 1LTBD 5DLQE 2WACA 2WB1G 2O5JC 3E0JA 1V1QA 3HEJA 2YV5A 2AKWB 4P73A 1EQQA 2VS1A 4FVMA 5IIFA 3ULJA 3Q8DA 1SJHD 1NMGA 4RG1A 2R7ZG 4AQYQ 1WCMB 3HS0C 1CQFA 3FKIG 5T1GA 2VQFQ 3RN2A 4LF4L 4XYOA 4DV7Q 2NVQH 2J4XA 4MN3A 1VQ7A 1PLFA 4V190 1XMOL 1K73C 4IPHA 3U9OA 2JA9A 5EGTA 2L12A 1YZ6A 4QUCA 4WFN3 3NP8A 3SHLA 1CZGA 2QGQA 3J80c 5K36G 1P8LA 2KCMA 1Q46A 4GNXB 1GUOA 2RDFA 2K50A 4X64Q 3R8BA 4DN4M 4UAIA 1KIXA 4LF5L 1PH8A 3GTMB 1RF2D 4I65A 4JI1L 2RHQB 2YU9H 2PPBC 2RSNA 4A93B 1E2WA 1X65A 4A3GB 4DK0A 3DMUA 2OF1A 3K0XA 1T5XD 4BY7G 2D0OA 4B3TQ 2KBNA 2PCFB 1Z47A 1LTTD 2F3WA 2AQ2B 3WDNA 5HY6A 4JI8Q 5C44H 4LWCA 1XYIA 1UNSA 4H44C 5KEEA 2KCNA 4A3MH 2Y0SG 3CU7A 3H0GG 5HGQA 1BBWA 4IJLA 3HOXB 3H91A 5COYA 3I70A 3PIP3 1PTOB 3ERQA 2UXDQ 2A5HA 3L3OC 4YWMA 5EKIA 1EFWA 1JICA 4JI0Q 4Y7NH 4QF4A 1QB5D 1SYGA 4IOCA 1IW7D 3Q0AA 2VL6A 2JA5H 5LMNQ 3TZUA 2KJXA 3OYYA 1SDFA 3W3AA 3HOYB 1N9WA 5KYLA 1D5ZC 3A5UA 3I4MH 1YITA 4K2KA 3X3NA 5LL6X 4A3IG 1G91A 2HT1A 2WAQG 1DONA 2KEEA 4QQBX 1ESRA 4IFDG 4IQZA 4ZUJA 3PO3H 1MHWC 2L4NA 2K75A 1R4QB 4P75A 4S3SA 3M4OH 4DR7L 2UXCL 4IUVA 2H1EA 2EQSA 4BY1G 2VB3X 4ZUIA 3J81j 3A7AB 3I4NG 1VS0A 1TIID 2CWPA 3CF5A 1VQGA 3GTQH 3BVZA 4DV6L 3DM1A 2X6GA 4RH6A 3D4RA 4MNOA 4PZ8A 4UP7A 3CP0A 4C3JB 1PYBA 3NUCA 4K5XA 1HNWQ 1I4PA 2IX1A 2B2UC 3GP7A 4PV1C 2UUCL 3SVMA 2FJ2A 2AUJD 3SK5A 1G6ZA 5IOCA 4J8QA 4LFAQ 3ITPA 3RLNA 3CRLC 4C3HH 2LSSA 3GTLH 1JE4A 4C3IG 1QZGA 4DR2L 1S5DD 2X69A 2IWHA 2ZTCA 4CBVA 1VQ5A 4LW1A 4LFBQ 4C2MB 2CQAA 2F52A 4O1NA 1EOVA 3E9HA 1VQBA 2F0HA 3A8JE 4JI7Q 2CVRA 3R93A 1CK1A 2F0JA 3AFPA 5GAHC 1FJGL 1TU2B 4CJ0B 1CKOA 4CJ2C 1DZ1A 5KNDA 1HRJA 4CDEC 1A63A 2IL8A 4JCVE 4LJZC 3A56A 2HIVA 2B39A 4DV0L 2EDGA 1YHBA 4A3CH 1E1TA 4YWLA 5C4JB 4ZLTF 4K14A 1GJXA 3EVQA 5A2QE 3QJYA 2JA6B 1IW7C 4MIUA 4OEMB 1Z6HA 4X62L 3KF6B 4IJHA 1YBYA 3W1BA 3KBGA 2EJMA 4GN5A 3V2TA 4OL7A 3KUPA 3J7YW 1PFSA 1C8CA 4K0KL 1B7YB 2Z6BA 3J81i 1MGSA 3PSIA 5C4XB 2NZ1D 1QZHA 2KA7A 1K9MC 2NYZD 2IW3A 1VQDA 3HOUB 3P7JA 1PH7A 1PRTB 4UPAA 2D2CC 4FXGC 1EYGA 1RTOA 3IFTA 3MA2B 4X66L 2ZM6L 5JOBA 2C9OA 2HDLA 3S2DB 2Z6KA 3A8KE 5KRUA 4WJWA 1BKBA 1CUKA 2WP8J 1AE2A 1QG7A 1S3OA 1SYDA 3HOZB 1FD7D 2AUKA 5FJ8H 1CKMA 2PZWA 2QCPX 4I7AA 4NXNQ 1G8ZD 3T1YQ 3SE0A 2F0IA 1NSNS 1SNOA 3CC2A 2AHOB 3S1QB 3MWYW 3GTKH 2Q2HA 1IBKL 1QWYA 4AYBB 1OXXK 2PQEA 3BVMA 3F2CA 2E2IH 1K28A 1VF7A 1N32L 4R4IA 4UP8A 5AJ3L 1S72A 1ZEQX 3G48A 5H1SE 3J80L 2MJ8A 1XJVA 1RIPA 1D5XC 3CD6A 1VMCA 1CA5A 3MHBA 3HOWH 1GKHA 2UUAL 2NVXH 3I72A 1YVCA 3T13A 1L1OA 4N9TA 1WCMG 3EBEA 3DEPA 5I2YA 4IPDA 1KRSA 1EQVA 1O80A 1C4QA 1SN8A 1VCIA 4XXEA 1A3UA 1RDPD 1D1KA 2VUMB 5I6YA 4G7OC 3ULLA 5FK9C 2B2TC 2VY3A 5CBEE 4XDXA 2A73B 1HH2P 5I2XA 2UU9Q 4JI4L 2F0NA 1YNXA 1Y1WH 2ICIA 1VQNA 3IFDA 2H5XA
chains in the Genus database with same CATH topology
1SNCA 1EY0A 2K28A 4XT3B 5D3IB 1KNEA 1C48A 3OOCA 2MP1A 4RGMA 3OHXC 3NTKA 1YNJD 2JA7B 5E4WC 1CI3M 4ABNA 2J0TD 2XN9C 3TN2A 5HGTA 3DWQA 5C4HA 1WVLA 1FYCA 5J1ZA 3D4WA 5EJWA 3N52A 3U9SA 3OPOA 2R7ZB 1V43A 4EGVA 3FKIB 2KHSA 1EYCA 4LK1C 1BBXC 1BO0A 2F0GA 3I91A 2BDOA 1EY8A 1MSGA 5HURA 4KI0A 2B2YA 1OXVA 4XQNA 3NWTA 2EE1A 1SYFA 2O4XA 2EOTA 1UUPA 2SNMA 5C0XI 3C1FA 4KKUA 1K8MA 1SNPA 3RUZA 4CJ1B 1I4HA 4ZKCB 2HCIA 4CGYB 4HN7A 2R92B 1LTID 3BVGA 1JWMD 3HGBA 4RKBA 4HSPA 1I3QB 1LTRD 2F0MA 4C3JG 5CBAE 4RAUC 1FNWA 2EY2A 5IGBA 4HSVA 1TT2A 3PUVA 1TQOA 1AFPA 4KKSA 2ZXPA 1ZXTA 3J80E 4ID6A 2CHBD 4X3SA 5M3FB 3EQLC 5JVG3 3H6MA 1SYCA 1V1PB 2RVLA 3VA7A 2EYOA 5EQ0A 3D3RA 2C5CA 2MUYA 4BY1B 4NDXA 2SOBA 4IUTA 4K5WA 3KLSX 1V8QA 4J6HA 5FO9B 3GV6A 3K7AB 1XWEA 2IX0A 3HOVB 1M4VA 4IUNA 5C0XH 1BCPD 1WTOA 1DD2A 2SEBD 2E75C 1DJRD 2VNUD 3MXPA 4ULLA 3NWSA 3R3OA 4DXGA 1STGA 1QCBD 4IN3A 4P2CB 1SXTA 1EIHA 1PFMA 1PZKD 4JBWA 3SK4A 3I73A 2A6HD 4ZKBB 2RDGA 2JYOA 3HKZB 1GHJA 1Q12A 1GUWA 4EQPA 1Y8PB 5M5XB 3G6JB 3KBXA 5JJZA 2K04A 1H9RA 1MBYA 4G7HC 1V1OA 4QB4A 4IFDI 4OIKA 1H9KA 1LT6D 3GTPB 5EPLA 3NQTA 3L9AX 1GUTA 4A3EB 1SYBA 5C6AA 2DY8A 1A3TA 3X3MA 4RGOS 3WOFA 3IAYA 1G2TA 2ZXOA 3E5SA 1HXYD 3BYYB 3FPPA 1SE3A 4U673 1W6JA 1BCPF 3D4DA 2NVTB 3TP6A 1SAPA 1BCPC 4KV6A 4XT1B 1BF4A 1B4OA 1BUVT 1PFBA 5DEHA 1R4PB 3H94A 3MXGA 3NQIA 2EY5A 2LS01 5G3LF 2ZXRA 3O13A 5E4XA 5CORA 2NWGA 1MSHA 2B2VC 3JAML 3MC0B 5JVH3 3M85A 3C2PA 5CV6A 1I4XA 1J9OA 3GV3A 4XIGS 4K2LA 5C5LA 3J7AF 4IZ8A 2E2HB 4M1UB 4ZYSA 5BN5A 1LO5D 2PZUA 5CV8A 2A6HC 2NB0A 3VYSA 4IFDH 4QIWB 3NK9A 5JEAG 4KD4A 4HTHA 2K5DA 4ZK9B 2AWNA 5A2QL 3OMGA 5DAUA 2R93B 3R2IA 1BR9A 2OXPA 3ND9A 1U4RA 1XXGA 1JR0D 3OIPA 5ELCA 1U4MA 1LV9A 3SDZA 4G57A 4K6DA 1F9PA 3GQBA 1WD0A 3NTHA 2RBMA 4EQNA 2K33A 4H13C 1GUNA 1L0YB 5BN4A 1SNMA 1HA5A 2XRQD 1GUSA 1SE2A 2JP1A 4RA8A 1WTRA 3ZYYX 5F2DA 2F4IA 2PO4A 1I6HB 2H4OA 1X32A 1YNNC 1S4ZA 3S1MB 3V96A 5JPNC 5EBCA 2JEBI 1J8IA 3SK6A 3BDCA 3TZDA 1Y69U 1II3A 3Q23A 4J1MA 1PMRA 1SFOB 1F9SA 1S5BD 2PYKA 4CKBA 2K1BA 4F88A 5C4ZA 4IUUA 1CZWA 1ENAA 1IKMA 1F2YA 1NCVA 2RKSA 4X3UA 2F0LA 3OMCA 4HEDA 3CRKC 1TWCB 1FGBD 5ELFA 1ILPA 3TDQA 1TWFB 2FMMA 4LAAA 1M8AA 1WTVA 2SNSA 1OXSC 4RCNA 2N88A 1HA6A 4FNFA 4ZQ3A 1HTLD 1TR5A 3ONAB 2BCOA 3JAME 2TSSA 3GTJB 2PW5A 3M3YB 2RQXA 5EKKA 4RHRA 5CV9A 2G9HD 5C0XJ 4A3KB 3S15B 3TSSA 5IT9E 2QDBA 2XVSA 4OO1G 2PW7A 3PO2B 1E2ZA 5IGDA 5M3MB 5EKLA 4FO2A 3NPPA 1SNQA 1RHPA 4B9XA 3Q6SA 3M7NA 3EROA 2PNRC 2WINB 4A3FB 2NN6G 4DAVA 1UAPA 1DM0B 1STAA 3KK7A 1B53A 2EYPA 2Z4HA 5EBDA 2B2WC 2V4DA 3KF8A 2IT1A 1H9JA 1AN8A 2O5IC 5LL6S 2M9VA 4TKOB 3MXUA 4HR7B 4XYQA 2FINB 1PDQA 4JK1C 3PUWA 1LTGD 3SXHA 2F3VA 3F2UA 4RWSC 1STNA 5DM73 2WV6D 5JPMC 3OWEB 1B3AA 2JXMB 1AZQA 2LFNA 2AQ3B 2F0PA 2R3ZA 3K6OA 1CTMA 3IL8A 1CT1D 4ODGA 3KLSA 2JA8B 2EYFA 3QG1A 4K6LA 4U68A 3I4LA 3L7ZC 1DCZA 5I9OA 2A68C 4WORA 5CYUA 4KN4C 1JQYD 3J81E 1V1PA 1CHPD 1STEA 2ID0A 4FXKC 2QKIC 3K59A 1U4LA 2EVBA 5ELBA 1Y8OB 1EY4A 4RGTA 2BDNA 2HUGA 2A69D 1PTOH 2PZTA 1D2BA 3PUXA 1LTSD 2F0OA 4DFAA 1EEFD 2L9HA 5I6WA 5C3EB 1S5ED 5KGUA 1FNVA 4KD3A 1L0XB 2B2UA 4OHJA 5FOBB 5IODA 4ME5A 2B63B 2F0TA 1EY5A 3CHBD 1F2MA 1X3PA 3G7LA 4L8JA 4R8NA 4NP5A 2FFKB 1XX8A 4IFDJ 1IKLA 1BCPB 2PMZB 5A35A 3NXWA 3MFGA 2E2DC 1TS4A 3VYUA 4X3KA 1O7LA 2B8GA 4DNRB 3QB3A 3S9WA 3V05A 3TMEA 4PMCA 1KAAA 1EL0A 4A3DB 2IPKD 1ICWA 5LHY1 1HQRD 1GHKA 1I4GA 3A7LA 3S1RB 4FXDA 3URYA 5J22A 2BA0A 4OGQC 2XWBB 1MD2D 4L6TB 3S16B 4F87A 2K7VA 1CM9A 3BS1A 1JB3A 2L1BA 4DU9A 3K5OA 5TSSA 1AEXA 2A69C 4IUPA 3M4YA 4G4KA 4RHSA 4RFBA 1EY7A 1NR2A 3S14B 1I4QA 3AU7A 3PUZA 1EQTA 4CKCA 1EEID 1B1ZA 2EJGC 1B2TA 3MZ5A 1HHVA 1G291 2R61A 1GUGA 4FF2A 2K6AA 3GTGB 1W6KA 5D65A 5CR3A 1HUMA 3PUYA 1H9SA 1ZKOA 1X3QA 2K32A 4ZRZA 1LT3D 2Q8TA 2KCCA 4KJNA 3UI2A 1IYUA 4UDUC 5T1IA 1ET6A 4F8MA 2D5DA 1EWCA 2F0WA 3QWNA 2Z8LA 1RD9D 3NBIA 3PMFA 1BNZA 2NVQB 3FDTA 4ZAIA 2XRSD 1H9MA 2B2TA 2O2LD 3DEOA 2L0CA 3GTOB 3D31A 2YU9B 1AP0A 2QILA 1HFNA 2M00A 5G3LD 1TY2A 3OIQA 4L63B 1PRTC 5DM63 2VXWA 5C44B 3DXJC 4TSSA 2EYHA 3MEHA 3J7AV 1DXMA 4A3MB 2D9UA 1CQVA 4EQOA 3K58A 1F2ZA 2AQ1B 2L55A 2DNEA 4Y7NB 3RD4A 4HCEA 3BDLA 2JA5B 2EY1A 3I4MB 1JC7A 2KECA 1STBA 1EIGA 4V0BA 1KDCA 3P20A 3PO3B 1EYAA 1EFID 1UEAB 4GZYC 1SMYD 4PMWA 3M4OB 5FO7B 1TWGB 4G7ZC 3C46A 1KDAA 4RKLA 1BDOA 4YIJA 1NUCA 3GTQB 5JEAH 5AFWA 1OO9B 3Q24A 4KMUC 5D3DA 1JCKB 4FF1A 1CA6A 2QEJC 2L5TA 3C1EA 4C1NK 2KQ3A 1ESFA 1Q8IA 4C3HB 3GTLB 1YNND 4KHVA 2F0QA 3H09A 2J7ZA 4NKLA 3MXNA 3R2TA 2KEDA 3MVVA 3TBIB 1DOLA 4E6IA 5BN3A 3LNNA 4BWGB 3IKJA 1H9SB 1CFMA 2NUCA 1Q1BA 3CKIB 1FNUA 3FRPB 4OO1I 5CV5A 5IT9L 1DOMA 2EYJA 3K57A 1O7YA 2A6ED 1F9QA 4Z9CB 3HP3A 3ND8A 2NN6I 2F0DA 2ICEC 1GOZA 1LT4D 3NTIA 1DYQA 1AW7A 4KY7A 1IHZA 3QOJA 2IX3A 4DK1A 3RZOB 1LLRD 4QCLA 1SMYC 3RLFA 5CMDA 1LABA 5CC4A 1EZ8A 2F0VA 3TP7A 1ENFA 5FLXE 5JAVA 2E74C 2MPMA 1PXUA 2EZVA 1SE4A 1HFGA 4PMBA 5CV4A 2RDHA 2YYZA 4DA2A 2HQEA 1WTWA 3GTKB 1KLGD 1LACA 2EXZA 1IL8A 2RA4A 1VDZA 2E2IB 2ENBA 5IGCA 4OO1H 4M8AA 3J81L 2K05A 3HOWB 1HTPA 1WTQA 2NVXB 1JOKA 1U9RA 2NN6H 4KN7C 3BDOA 4DAYA 1BXTA 3NHHA 4PQXA 1T5EA 3NSWA 2G9DA 5C5MA 2SDFA 1EYDA 3DUZA 5CV7A 2A6EC 1A6XA 3S1NB 1STYA 3BYTB 1Y1WB 4FP5D 3LWUA 2DNCA 3E6ZX 1VF5C 5M5WB 5I9PA 5J39A 2CW0D 1VMPA 2MHVA 2A68D 1GXDC 2FHTA 4BBRB 4CKEA 1LT5D 2LMCB 1TS5A 3I90A 4BBSB 3I3CA 3VYRA 2Z4IA 4TQUS 2B2VA 3LX0A 3DWAA 2TMPA 1Y1VB 3GD7A 4KY5A 1Q90A 3RMHA 3PIO3 2LKVA 4HAEA 1SBBB 3VR6A 4IALA 3T56B 1A2UA 2ZT9C 3OSOA 1SSOA 3SK8A 1B50A 4A3BB 1RJTA 1S5CD 1CHQD 1HUNA 2F0FA 1RCVD 5KYIA 1SEBD 1RTNA 2NVYB 3SEBA 3D6WA 1PFNA 2X6LA 2BE5D 1ENCA 2JSOA 4KKTA 1OXTA 4DXFA 2EYMA 2WKDA 1Y8NB 5FKAC 3VYTA 1I6VC 2B2YC 4WRDA 4R8IA 5CGKA 3N6RA 1Q3LA 1EZ6A 5EPJA 4A3JB 2OEOA 3C3LA 4BS9A 3W2DA 4CHTB 4BA1I 4H0LC 3MTSA 1ZYRD 4C3HG 1D6EC 2LY7A 1KABA 1PTOD 2CW0C 5JEAJ 1HQMC 1JOOA 3KLRA 3PV0A 4RGNA 1EOTA 1JWUD 2RSOA 4LMQD 1D5MC 5KNBA 3FPUB 1EU4A 2E76C 4B08A 1EY9A 4Q0FA 2K03A 1TS3A 4DNTB 3I8ZA 3VR3A 4KJOA 2XWJB 3S17B 2HCCA 2F0EA 3Q22A 2MGSA 2GA4B 1U4PA 1A15A 1RKNA 3T53B 1QOHA 4HMIA 3P75A 1A3VA 5M5YB 4DF7A 3T16A 3RZDB 2DN8A 3K5LA 3D6CA 2F0KA 1S5FD 1ILQA 2B8FA 2F0UA 3P1HA 3HRZC 5DNFA 4K8IA 1KNAA 1QILA 4K5VA 2XSCA 2KUMA 2BE5C 3DWPA 3EFXD 1KLUD 5M9OA 2XIWA 4OIJA 5EPKA 2I07B 1TWAB 4R9WA 4X3TA 1I50B 2R6GA 1ONLA 2JE6I 3FVQA 1E2VA 2EY6A 4RCOA 4QUFA 2Q8RE 2M2LA 4XQQA 3VR5A 3M7GA 2Q8IB 2WKCA 2XNAC 1HCZA 1SNDA 1PTOF 1ZYRC 4C1NI 2WB1B 5KNCA 2OT2A 1PTOC 3CQZB 2B2WA 5ISRA 1BQQT 3NE5B 2BA1A 4FF4A 3DHQA 3HG9A 4NW2A 4XQJA 4H7BA 2KVMA 2FMCA 1WTPA 1E0BA 1B9NA 2VB2X 2DY7A 1PRTD 4FYDA 4K8JA 1PZJD 5E1FA 1TS2A 3D8GA 1I4RA 1K8OA 3NBHA 5D14A 1F77A 5KIXA 3BG3A 4F7XA 1F9RA 1WD1A 3EA6A 1B44D 2NTSA 1TKWB 4N9PA 1QJOA 1IYVA 3SR1A 4BY7B 2QF7A 4KTAA 1ET9A 1Q1EA 5ELDA 3VA5A 1O78A 1MI2A 3FEWX 1PZID 4TRDA 1JORA 5I4DA 2Y0SB 3WOEA 3H0GB 5IGEA 2F0SA 4FF3A 1LTAD 3H3VC 1SJED 1BOSA 2A74C 2K01A 1Z7TA 3A55A 3S2HB 4I7ZC 1R9TB 1EU3A 4A3IB 3TP8A 2WAQB 1YNJC 3LWEA 3OWFA 4B9WA 2D62A 1SYEA 1A2TA 3A54A 4ILWA 3MFYA 3I4NB 4O42A 3T51B 1PYWD 2I46A 1RODA 2KOLA 3K5MA 1KDBA 1PRTF 3K5NA 4C56C 2NBFA 4KY6A 4KHZA 2F03A 1O7ZA 4C3IB 5FLXL 5ELEA 4QMGA 3QO2A 5E3FA 3T4AC 2N55A 5C3XA 5IGGA 4KK7A 1FR3A 1TVXA 1KTKA 2NTTA 4MHEA 1NR4A 3MAQA 2K5QA 2EPBA 2L11A 3VR2A 4Q5VA 1EWHA 4NMZA 5K5PA 3AMUA 1JWSD 4IURA 2AWOA 1AZPA 3AB9A 1JOQA 1DOKA 1WTXA 4DGZA 1EY6A 3OW7A 3TP5A 3QOLA 1QNUA 5NUCA 1B9MA 1NAPA 5C0XG 3HZXA 4PNYA 3VR4A 4XTCS 1QE6A 3EJIA 4DAPA 2JEAI 1OXUA 3A8IE 4IUQA 1STHA 2E2JB 4BA2I 5IGFA 1K83B 5K36H 2HDMA 2BOSA 1XTCD 2K5WA 3FMCA 2IJ0A 3QIAA 3BZDB 2WIIB 5FO8B 1F2LA 4EVOA 1HPCA 4HCSA 1G2SA 1TY0A 4HMJA 1TWHB 2EJFC 2Z1CA 1ML0D 1D1IA 5C3WA 3GO5A 1QNKA 2F1MA 2EYLA 3K0YA 1LTBD 2WACA 2O5JC 3E0JA 3HEJA 4FVMA 5IIFA 1SJHD 1WCMB 3HS0C 1CQFA 5T1GA 4XYOA 2J4XA 4MN3A 1PLFA 4V190 3U9OA 5EGTA 2L12A 4QUCA 4WFN3 3NP8A 3SHLA 1CZGA 5K36G 1GUOA 2RDFA 3R8BA 4DN4M 4UAIA 3GTMB 1RF2D 4I65A 2PPBC 2RSNA 4A93B 1E2WA 4A3GB 4DK0A 3DMUA 2OF1A 1T5XD 2PCFB 1Z47A 1LTTD 2F3WA 2AQ2B 3WDNA 1XYIA 1UNSA 4H44C 5KEEA 2KCNA 3CU7A 3HOXB 3H91A 5COYA 3I70A 3PIP3 1PTOB 3ERQA 2A5HA 3L3OC 5EKIA 1JICA 4QF4A 1QB5D 1SYGA 1IW7D 3Q0AA 3TZUA 2KJXA 1SDFA 3W3AA 3HOYB 5KYLA 1D5ZC 4K2KA 3X3NA 5LL6X 1G91A 1DONA 2KEEA 1ESRA 4IFDG 4IQZA 4ZUJA 2L4NA 1R4QB 4S3SA 4IUVA 2H1EA 2VB3X 4ZUIA 3A7AB 1TIID 3BVZA 3DM1A 2X6GA 4RH6A 3D4RA 4C3JB 3NUCA 4K5XA 1I4PA 2IX1A 2B2UC 3GP7A 4PV1C 3SVMA 2FJ2A 2AUJD 3SK5A 1G6ZA 5IOCA 4J8QA 3ITPA 3CRLC 1JE4A 4C3IG 1S5DD 2X69A 2IWHA 4CBVA 4C2MB 2CQAA 4O1NA 2F0HA 3A8JE 2CVRA 3R93A 1CK1A 2F0JA 1TU2B 4CJ0B 4CJ2C 1DZ1A 5KNDA 1HRJA 2IL8A 4LJZC 3A56A 2B39A 2EDGA 5C4JB 4ZLTF 4K14A 1GJXA 3EVQA 5A2QE 3QJYA 2JA6B 1IW7C 4MIUA 1Z6HA 3KBGA 2EJMA 3V2TA 4OL7A 3KUPA 3J7YW 1C8CA 1MGSA 5C4XB 2NZ1D 2KA7A 2NYZD 2IW3A 3HOUB 3P7JA 1PRTB 2D2CC 4FXGC 1RTOA 3IFTA 3MA2B 5JOBA 2C9OA 2HDLA 3S2DB 3A8KE 5KRUA 4WJWA 2WP8J 1QG7A 1SYDA 3HOZB 1FD7D 2AUKA 2PZWA 2QCPX 1G8ZD 3SE0A 2F0IA 1NSNS 1SNOA 3S1QB 3MWYW 1QWYA 4AYBB 1OXXK 2PQEA 3BVMA 1VF7A 1ZEQX 3J80L 2MJ8A 1D5XC 1VMCA 1CA5A 3MHBA 3I72A 3T13A 4N9TA 3DEPA 5I2YA 1EQVA 1O80A 1C4QA 1VCIA 4XXEA 1A3UA 1RDPD 1D1KA 2VUMB 5I6YA 4G7OC 5FK9C 2B2TC 5CBEE 4XDXA 2A73B 5I2XA 2F0NA 2ICIA 3IFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SNC A;  4ID6 A;  1EY0 A;  4DFA A;  4G57 A;  4K6D A;  4QB4 A;  4EQO A;  1JOO A;  4QF4 A;  5I9P A;  1F2Z A;  1SYG A;  2QDB A;  2F0D A;  5J39 A;  2RBM A;  3V2T A;  3MZ5 A;  3DHQ A;  3BDL A;  2PW7 A;  1KDB A;  3NQT A;  4OL7 A;  4EQN A;  4EVO A;  5I6W A;  5KYL A;  5IGD A;  4KY7 A;  4KY6 A;  4K2K A;  5EKL A;  1EY9 A;  1IHZ A;  3QOJ A;  4H7B A;  5C4H A;  2EY1 A;  4HMJ A;  1SNQ A;  1SYB A;  5KGU A;  4B9X A;  3H6M A;  1SYC A;  5C6A A;  1STB A;  1A3T A;  3ERO A;  4KD3 A;  5HGT A;  1SNM A;  3LX0 A;  4ZUJ A;  2EYO A;  4K8J A;  5C3W A;  1STA A;  5E1F A;  5CR3 A;  4NDX A;  2SOB A;  4K5W A;  2EYP A;  1KDC A;  2EYL A;  3E5S A;  1EYA A;  4J6H A;  4KJO A;  4KY5 A;  5J1Z A;  4S3S A;  2WAC A;  2F0E A;  3D8G A;  5JOB A;  3D4W A;  5F2D A;  5IOD A;  5CC4 A;  3HEJ A;  4ME5 A;  5KRU A;  2F0T A;  1EY5 A;  1EZ8 A;  3D4D A;  4QMG A;  5ISR A;  1F2M A;  1RKN A;  4HMI A;  2LKV A;  5E3F A;  4ZUI A;  2F0V A;  3TP6 A;  3P75 A;  1A3V A;  2KHS A;  1EYC A;  4KV6 A;  3TP7 A;  4R8N A;  4IUN A;  4F7X A;  5KIX A;  4KJN A;  4NP5 A;  3SK6 A;  5IIF A;  3BDC A;  2F0G A;  5C3X A;  5JAV A;  1KDA A;  4N9P A;  1EY8 A;  3T16 A;  4DF7 A;  4IAL A;  5HUR A;  1SYD A;  3SR1 A;  5IGG A;  4RKL A;  5DEH A;  1II3 A;  4YIJ A;  4J1M A;  1A2U A;  1NUC A;  2PZW A;  3NXW A;  4PMB A;  3OSO A;  4F8M A;  5CV4 A;  3MXP A;  2EY5 A;  3D6C A;  2F0K A;  4KTA A;  3SK8 A;  1SYF A;  2F0W A;  2O4X A;  2F0U A;  3QB3 A;  3P1H A;  2F0I A;  3NUC A;  3PMF A;  2PYK A;  4K5X A;  1NSN S;  3R3O A;  1SNO A;  3VA5 A;  2F0F A;  3S9W A;  3SXH A;  1STG A;  5KYI A;  2F3V A;  3TME A;  2HQE A;  4PMC A;  5CV6 A;  4K8I A;  3SK5 A;  5C4Z A;  3U9O A;  5EGT A;  4K5V A;  1KAA A;  5IOC A;  3C1E A;  1STN A;  2KQ3 A;  2PQE A;  3ITP A;  1ENA A;  4TRD A;  1JOR A;  2EXZ A;  1F2Y A;  4K2L A;  5C5L A;  3NP8 A;  2SNM A;  4NMZ A;  2RKS A;  3SHL A;  5K5P A;  2F0L A;  2F0S A;  3C1F A;  2F0P A;  4IZ8 A;  1SNP A;  5IGE A;  2RDF A;  5M9O A;  4KHV A;  1ENC A;  2F0Q A;  3OMC A;  3RUZ A;  2ENB A;  5IGC A;  1JOQ A;  4ODG A;  2EYF A;  4I65 A;  2PZU A;  5CV8 A;  2EYM A;  3MHB A;  4DGZ A;  5J22 A;  1EY6 A;  3SK4 A;  4NKL A;  3TP5 A;  3DMU A;  3QOL A;  2F0H A;  2OF1 A;  4LAA A;  4WRD A;  5NUC A;  3T13 A;  5CGK A;  4N9T A;  2F0J A;  1EZ6 A;  3HZX A;  4PNY A;  5I9O A;  4RKB A;  4WOR A;  1JOK A;  2SNS A;  3MVV A;  2EY6 A;  1U9R A;  3TP8 A;  1EQV A;  2M00 A;  4ZQ3 A;  3NK9 A;  4KD4 A;  1TR5 A;  4HTH A;  2F0M A;  4E6I A;  2F3W A;  3OWF A;  3EJI A;  1A3U A;  3NHH A;  2OEO A;  3ERQ A;  4DU9 A;  4EQP A;  5I6Y A;  2EY2 A;  5C5M A;  3OMG A;  1AEX A;  5DAU A;  5IGB A;  1STH A;  4B9W A;  1EY4 A;  1SND A;  2NUC A;  1TT2 A;  2PW5 A;  1TQO A;  5KEE A;  1EYD A;  5EKK A;  5IGF A;  5CV5 A;  2EYH A;  5CV7 A;  5CV9 A;  3MEH A;  2OXP A;  1SYE A;  2EYJ A;  1A2T A;  2F0N A;  4K14 A;  2PZT A;  1EY7 A;  3EVQ A;  1KAB A;  1STY A;  4MIU A;  2F0O A; 
#chains in the Genus database with same CATH topology
 1SNC A;  1EY0 A;  2K28 A;  2DGY A;  4XT3 B;  5D3I B;  1EIY B;  4DV5 Q;  1KNE A;  4A93 G;  4A3G G;  4BBR H;  1C48 A;  3OOC A;  2MP1 A;  4RGM A;  4OWW B;  4BBS H;  3OHX C;  4B3S Q;  3NTK A;  1YNJ D;  2JA7 B;  5E4W C;  1CI3 M;  4ABN A;  2J0T D;  1Y1V H;  2XN9 C;  3F1Z A;  3DWQ A;  3TN2 A;  4DPG A;  5HGT A;  4GOP A;  4JVZ A;  4LNQ A;  5C4H A;  1WVL A;  1FYC A;  5J1Z A;  1J6Q A;  3D4W A;  3CCR A;  2ES2 A;  5EJW A;  3N52 A;  3U9S A;  1E7Z A;  3OPO A;  3HOX G;  2R7Z B;  2YTV A;  1V43 A;  4EGV A;  3FKI B;  2KHS A;  1EYC A;  4LK1 C;  3CCS A;  4GKK L;  1BBX C;  1BO0 A;  2F0G A;  3I91 A;  2BDO A;  1EY8 A;  1MSG A;  5HUR A;  4KI0 A;  3U4V A;  4JI2 Q;  1NY4 A;  2B2Y A;  1OXV A;  3HOY G;  4XQN A;  4A3B H;  3NWT A;  2EE1 A;  1SYF A;  2O4X A;  1X3F A;  2EOT A;  2NVY H;  5IWA L;  1UUP A;  4YCV A;  1HNZ L;  1IBM Q;  1X56 A;  2SNM A;  3BJU A;  5C0X I;  3C1F A;  4KKU A;  1K8M A;  1SNP A;  4LF8 Q;  3CCQ A;  5IT9 c;  3RUZ A;  4CJ1 B;  1I4H A;  4OEL B;  2VQE L;  3KF8 B;  1K3R A;  2MO1 A;  4ZKC B;  1E24 A;  2HCI A;  4CGY B;  4HN7 A;  2R92 B;  1K0S A;  1LTI D;  3BVG A;  4HJ8 A;  1JWM D;  3PF5 A;  1K8G A;  3G4S A;  3HGB A;  4RKB A;  4HSP A;  4A3J H;  2N49 A;  1I3Q B;  4AH6 A;  1LTR D;  2F0M A;  4C3J G;  4UP9 A;  2OQ0 A;  1E22 A;  5CBA E;  4RAU C;  1FNW A;  2E8G A;  2EY2 A;  5IGB A;  1XTD A;  3M9B A;  4HSV A;  1YJW A;  1TT2 A;  3PUV A;  1TQO A;  5LMU Q;  1AFP A;  1LTL A;  4KKS A;  2ZXP A;  1ZXT A;  3J80 E;  2F4V Q;  4ID6 A;  1YJ9 A;  1YJN A;  2I5L X;  3BU2 A;  2CHB D;  2F3I A;  4X3S A;  4YHH Q;  1BBU A;  5JJL A;  5M3F B;  3HOZ H;  3S24 A;  3EQL C;  1E1O A;  4POF A;  1VQH A;  5JVG 3;  4NXM L;  3H6M A;  1SYC A;  1V1P B;  2RVL A;  3VA7 A;  5FLM G;  2EYO A;  5EQ0 A;  3S17 H;  3D3R A;  2C5C A;  2MUY A;  4BY1 B;  4NDX A;  2SOB A;  4IUT A;  4K5W A;  3KLS X;  1V8Q A;  4J6H A;  4GNX A;  5FO9 B;  4JI3 Q;  1CKN B;  1HR0 L;  3GV6 A;  2DJF C;  3K7A B;  1XWE A;  2IX0 A;  5M5Y H;  1DGS A;  5IYC G;  2JA6 G;  3HOV B;  1M4V A;  4IUN A;  4HJ9 A;  3CCM A;  5C0X H;  3RZD H;  1BCP D;  1WTO A;  1DD2 A;  3J81 c;  2SEB D;  2E75 C;  1VQJ A;  1N33 L;  1DJR D;  2GVB A;  1FL0 A;  2VNU D;  3MXP A;  1UWV A;  3BZK A;  4GS3 A;  4BXX G;  4LF6 Q;  4ULL A;  5C4X G;  3AYH B;  1Y14 B;  3NWS A;  3R3O A;  4CDF C;  1GM5 A;  4DXG A;  3HOU G;  1STG A;  1QCB D;  2K5V A;  2I0Q A;  4IN3 A;  4P2C B;  4YY3 L;  1PH2 A;  5IYB G;  1SXT A;  1VQK A;  1WJJ A;  1EIH A;  4LF9 Q;  3OTO L;  1PFM A;  1UE6 A;  1PZK D;  4DUY L;  1TWA H;  4R4O A;  1Q8K A;  4JBW A;  2E5L Q;  2LXJ A;  4WJ4 A;  3SK4 A;  3I73 A;  3H15 A;  1XPU A;  2A6H D;  2JA8 G;  4ZKB B;  2RDG A;  2JYO A;  1A8V A;  3HKZ B;  1XMQ Q;  2QDL A;  4DV1 L;  4DV3 L;  1GHJ A;  4X6A H;  4GOP B;  1Q12 A;  4X65 Q;  1GUW A;  4R4C A;  4EQP A;  1Y8P B;  5M5X B;  4AYB G;  3G6J B;  1WTH A;  3CQZ H;  3KBX A;  2WB1 E;  5JJZ A;  3NEN A;  2K04 A;  1H9R A;  1ASY A;  1XNR L;  1MBY A;  4G7H C;  1V1O A;  3UE1 A;  2R7Z H;  4QB4 A;  2IHE A;  3FKI H;  4OIK A;  4IFD I;  2B3G A;  1H9K A;  3NEL A;  1K3B C;  1LT6 D;  2CKZ B;  3GTP B;  3PF4 A;  3KDF B;  5EPL A;  3NQT A;  3L9A X;  1GUT A;  4A3E B;  3HKS A;  1SYB A;  5C6A A;  2DY8 A;  4APV A;  5GAE C;  1A3T A;  3X3M A;  4RGO S;  3WOF A;  3IAY A;  1G2T A;  2VUM G;  2ZXO A;  3E5S A;  1HXY D;  3BYY B;  3FPP A;  1SE3 A;  2KHJ A;  4U67 3;  1Q86 C;  1IBL Q;  2KCT A;  1W6J A;  1BCP F;  3D4D A;  2NVT B;  3TP6 A;  1N34 Q;  1SAP A;  1BCP C;  4KV6 A;  4XT1 B;  2CH4 W;  2B63 G;  4BY7 H;  4GLA C;  1BF4 A;  4NB3 A;  1B4O A;  2PNH A;  1BUV T;  1PFB A;  5DEH A;  1R4P B;  3H94 A;  3MXG A;  3NQI A;  4DV2 Q;  2EY5 A;  1VQL A;  2LS0 1;  5G3L F;  2ZXR A;  3O13 A;  2I5H A;  5E4X A;  5COR A;  2NWG A;  1MSH A;  2JA7 G;  2B2V C;  4P71 A;  3JAM L;  3F2B A;  3MC0 B;  5JVH 3;  3M85 A;  3C2P A;  5CV6 A;  1I4X A;  3T1H Q;  1J9O A;  3GV3 A;  4XIG S;  3H0G H;  4K2L A;  5C5L A;  4ME3 A;  2Y0S E;  4JOI A;  3J7A F;  4IZ8 A;  2E2H B;  1JJG A;  3J7A 5;  2JN4 A;  4M1U B;  4ZYS A;  5BN5 A;  3ICE A;  4OWT B;  3KF6 A;  1LO5 D;  2PZU A;  5CV8 A;  2A6H C;  2F4V L;  2NB0 A;  3VYS A;  3FHW A;  3S2H H;  2HHH L;  1R9T H;  4A3I H;  1VQ8 A;  2UXB Q;  4IFD H;  4QIW B;  3NK9 A;  5JEA G;  4KD4 A;  4HTH A;  2K5D A;  2WAQ E;  2N3S A;  4DR3 Q;  3EIV A;  3K81 C;  3PCO B;  2AWN A;  4ZK9 B;  5A2Q L;  3OMG A;  5DAU A;  2R93 B;  3R2I A;  3GDE A;  4BY1 H;  1BR9 A;  2OXP A;  3ND9 A;  1U4R A;  1VQF A;  3I4N H;  1XXG A;  1JR0 D;  2RF4 A;  3OIP A;  5ELC A;  1K8A C;  4DUZ L;  4TVA B;  1U4M A;  3K7A H;  1LV9 A;  3SDZ A;  4G57 A;  4K6D A;  4A3L G;  3M4Q A;  2UUB Q;  1F9P A;  2R92 G;  3GQB A;  1WD0 A;  2B29 A;  3NTH A;  2RBM A;  4EQN A;  4LF7 L;  1HNX Q;  2K33 A;  4H13 C;  1GUN A;  1L0Y B;  3PIP A;  5BN4 A;  1SNM A;  1HA5 A;  2XRQ D;  4YCU A;  4C3I H;  1GUS A;  1SE2 A;  4B3M L;  2JP1 A;  4RA8 A;  1WTR A;  1XPR A;  3ZYY X;  5F2D A;  2F4I A;  2PO4 A;  1I6H B;  1WOC A;  2H4O A;  3LGJ A;  5JJI A;  2ZJQ A;  1X32 A;  1YNN C;  3CPW A;  2Z6K C;  4A75 A;  1S4Z A;  3S1M B;  3V96 A;  5JPN C;  5EBC A;  2JEB I;  1J8I A;  3SK6 A;  3BDC A;  3TZD A;  1LUZ A;  1Y69 U;  1SLJ A;  1II3 A;  3Q23 A;  4J1M A;  2K14 A;  4B3R Q;  1PMR A;  1B70 B;  5M3F G;  1SFO B;  1F9S A;  3CCE A;  1S5B D;  4HJA A;  1VQ6 A;  2PYK A;  3RR5 A;  4CKB A;  2K1B A;  4F88 A;  5C4Z A;  4IUU A;  1CZW A;  1ENA A;  5EAY A;  1IKM A;  4P74 A;  1F2Y A;  1NCV A;  2RKS A;  4X3U A;  2KHI A;  2F0L A;  2CWA A;  3OMC A;  2EIF A;  4HED A;  3CRK C;  1TWC B;  1FGB D;  5ELF A;  3HOV G;  1ILP A;  1WFQ A;  3PQI A;  3TDQ A;  1TWF B;  2FMM A;  4LAA A;  5ELO A;  4JI6 L;  1M8A A;  1WTV A;  2SNS A;  1OXS C;  4RCN A;  4LUZ A;  2N88 A;  1HA6 A;  4FNF A;  4ZQ3 A;  1HTL D;  1TR5 A;  4NPS A;  3ONA B;  4Y52 H;  3CC4 A;  2E2J H;  2BCO A;  2G5D A;  3JAM E;  3I2Z A;  1MJC A;  2TSS A;  3GTJ B;  2PW5 A;  3M3Y B;  2RQX A;  5EKK A;  4RHR A;  1K83 H;  5CV9 A;  4DR1 Q;  4DR6 Q;  4O0A A;  2G9H D;  5C0X J;  4A3K B;  1J5E Q;  3AEV A;  3S15 B;  3TSS A;  1QVF A;  2NVT H;  5IT9 E;  3B6Y A;  3TEH B;  2QDB A;  1XPO A;  2XVS A;  4OO1 G;  2P5Z X;  2PW7 A;  3PO2 B;  1E2Z A;  5IGD A;  5M3M B;  1TWH H;  5EKL A;  3MXN B;  4FO2 A;  3NPP A;  1SNQ A;  3HKZ G;  4JC0 A;  5GRO A;  1RHP A;  4B9X A;  3Q6S A;  3M7N A;  3ERO A;  2PNR C;  2WIN B;  4A3F B;  4OX9 Q;  2NN6 G;  4DAV A;  1UAP A;  1DM0 B;  1STA A;  1MKH A;  4KHP L;  3K7U C;  3KK7 A;  1B53 A;  2EYP A;  3IRB A;  3I56 A;  2Z4H A;  1XNQ Q;  1AE3 A;  5EBD A;  4AIM A;  2B2W C;  1I94 Q;  2V4D A;  3KF8 A;  2IT1 A;  1H9J A;  1WCM H;  1VQ4 A;  4AQY L;  1AN8 A;  2VQF L;  2O5I C;  4DV7 L;  5LL6 S;  2M9V A;  4TKO B;  4A3E G;  3MXU A;  4HR7 B;  4XYQ A;  2FIN B;  1PDQ A;  4JK1 C;  4N8F A;  3PUW A;  1LTG D;  3SXH A;  2F3V A;  3F2U A;  1MIU A;  4RWS C;  1STN A;  5DM7 3;  2WV6 D;  5JPM C;  4P72 A;  4IPC A;  3OWE B;  2R93 H;  2HIX A;  4WJ3 M;  1B3A A;  2JXM B;  1AZQ A;  4X64 L;  2LFN A;  2AQ3 B;  2F0P A;  2R3Z A;  3K6O A;  1CTM A;  3GTM H;  3IL8 A;  1CT1 D;  1PH5 A;  4ODG A;  3KLS A;  2JA8 B;  4A93 H;  2EYF A;  3QG1 A;  4K6L A;  4A3G H;  4U68 A;  3I4L A;  3L7Z C;  1DCZ A;  5I9O A;  2A68 C;  4WOR A;  5CYU A;  1X9N A;  4KN4 C;  1JQY D;  1VQC A;  4B3T L;  3J81 E;  1GVP A;  1V1P A;  1CHP D;  1STE A;  2ID0 A;  4JI8 L;  4FXK C;  2QKI C;  3K59 A;  1U4L A;  2EVB A;  5ELB A;  1Y8O B;  4IPG A;  5IP7 G;  1EY4 A;  3H3V I;  1CKN A;  1C7Y A;  3KOJ A;  5IE8 A;  4RGT A;  2BDN A;  2HUG A;  4A4I A;  3HOX H;  2A69 D;  4DV4 Q;  1PTO H;  2OQK A;  2PZT A;  2UXD L;  5FLX c;  2VW9 A;  1D2B A;  3PUX A;  1I6H H;  4JI0 L;  1LTS D;  2F0O A;  4DFA A;  1JMC A;  1EEF D;  5LMN L;  3HOY H;  2L9H A;  3RLO A;  1C9O A;  5I6W A;  1KHI A;  4GLV B;  4GN4 B;  5C3E B;  1S5E D;  5KGU A;  3RN5 A;  1FNV A;  4KD3 A;  1L0X B;  2B2U A;  1L0W A;  4OHJ A;  2R93 G;  1VQ9 A;  5FOB B;  5IOD A;  4LUV A;  4ME5 A;  2B63 B;  2F0T A;  1EY5 A;  3CHB D;  5BR8 Q;  1F2M A;  1X3P A;  1QUQ B;  3G7L A;  2XGT A;  4L8J A;  4R8N A;  2A8V A;  4NP5 A;  2FFK B;  1XX8 A;  4IFD J;  1IKL A;  1BCP B;  1VQA A;  1YIJ A;  2PMZ B;  1SRO A;  5A35 A;  2LXK A;  3MFG A;  2E2D C;  3NXW A;  3J7Z C;  1G6P A;  1TS4 A;  4GKJ Q;  4C3J H;  1OTC A;  2Z0S A;  3VYU A;  1HNW L;  4X3K A;  1O7L A;  2B8G A;  4DNR B;  5GAG C;  3QB3 A;  4HJ7 A;  2K52 A;  3S9W A;  3V05 A;  3TME A;  4PMC A;  4LFA L;  4DK6 C;  1KAA A;  1WI5 A;  1EL0 A;  1PV4 A;  1KAW A;  4GN3 B;  4LFC Q;  4A3D B;  2IPK D;  1ICW A;  1RL2 A;  4POG A;  5LHY 1;  3M3Y H;  1HQR D;  1GHK A;  1I4G A;  4C2M H;  4LFB L;  3A7L A;  3S1R B;  3H3V H;  4FXD A;  3URY A;  5J22 A;  3OW2 A;  4JI7 L;  3KDF A;  2BA0 A;  4OGQ C;  4DR5 Q;  2XWB B;  4QL5 A;  2RHS B;  1FVI A;  1P16 A;  3CXC A;  1MD2 D;  4L6T B;  3S16 B;  1G51 A;  5FLM H;  3CW2 C;  2K7V A;  4F87 A;  1CM9 A;  3BS1 A;  3HFZ B;  1JB3 A;  4JI5 Q;  1EWI A;  2L1B A;  4DU9 A;  2PQA B;  3K5O A;  3I55 A;  5TSS A;  1AEX A;  2A69 C;  4IUP A;  5C4J H;  3M4Y A;  5IYC H;  4G4K A;  4RHS A;  2JA6 H;  4RFB A;  4DR4 Q;  1EY7 A;  1NR2 A;  3S14 B;  2BH2 A;  1H95 A;  1I4Q A;  4O2D A;  4JBJ A;  3AU7 A;  3PUZ A;  1EQT A;  4CKC A;  4CDC C;  1EEI D;  1B1Z A;  2EJG C;  1B2T A;  3MZ5 A;  1HHV A;  1G29 1;  2R61 A;  4BXX H;  5C4X H;  4QGU A;  1GUG A;  4FF2 A;  3HOU H;  1PH1 A;  3NEM A;  5IYB H;  2K6A A;  3GTG B;  1W6K A;  5D65 A;  1QVG A;  5CR3 A;  1HUM A;  2ATW A;  3S2D H;  4JV5 Q;  3PUY A;  1H9S A;  1ZKO A;  1X3Q A;  4A3K G;  2K32 A;  4DKA C;  4ZRZ A;  4R1J A;  1LT3 D;  2Q8T A;  1A0I A;  2ZTD A;  2KCC A;  4KJN A;  3UI2 A;  2JA8 H;  1IYU A;  4UDU C;  4QJF A;  5T1I A;  4NXN L;  1ET6 A;  3T1Y L;  3AFQ A;  3PO2 G;  4F8M A;  3UDI A;  2K4K A;  5M3M G;  2D5D A;  1EWC A;  2F0W A;  3S1Q H;  3QWN A;  2Z8L A;  4LF4 Q;  1MJE A;  3NBI A;  1RD9 D;  3PMF A;  3U4Z A;  1BNZ A;  1VQI A;  3FDT A;  2NVQ B;  1XMO Q;  4ZAI A;  2XRS D;  4CDD C;  4A3F G;  1H9M A;  2YTX A;  2B2T A;  4AYB E;  2O2L D;  1Q81 C;  3KJP A;  3DEO A;  2L0C A;  3I4O A;  3GTO B;  4JPB W;  3D31 A;  2A1A A;  4LF5 Q;  4JI1 Q;  2YU9 B;  1AP0 A;  2QIL A;  3K80 C;  1X6O A;  2Z9H A;  1HFN A;  2M00 A;  3M4P A;  1UE5 A;  5G3L D;  5J3B A;  1TY2 A;  2RCN A;  4L5R C;  3OIQ A;  2VUM H;  4L63 B;  3L0O A;  1U5K A;  4MTK A;  1PRT C;  5DM6 3;  2VXW A;  5C44 B;  1NTG A;  3DXJ C;  4TSS A;  2JJQ A;  2UU9 L;  1U0L A;  2EYH A;  3MEH A;  3J7A V;  1DXM A;  4A3M B;  3BZC A;  2B63 H;  4OXP A;  2D9U A;  1CQV A;  4DNI A;  4DV5 L;  4EQO A;  3K58 A;  1F2Z A;  2AQ1 B;  2L55 A;  1UE7 A;  2PI2 A;  2DNE A;  4Y7N B;  1KXL A;  3RD4 A;  3CCJ A;  2ASB A;  4HCE A;  3BDL A;  2JA5 B;  3DM3 A;  4B3S L;  2JA7 H;  2ALY B;  2EY1 A;  3I4M B;  2MFI A;  1JC7 A;  2KEC A;  1STB A;  3ZJY C;  1EIG A;  4V0B A;  2I5M X;  2QW7 A;  1KDC A;  3P20 A;  3PO3 B;  1EYA A;  1EFI D;  1UEA B;  4GZY C;  1SMY D;  1QVC A;  2UXC Q;  4PMW A;  4DR7 Q;  3M4O B;  5FO7 B;  1TWG B;  4G7Z C;  3C46 A;  1KDA A;  4JI2 L;  2V1C C;  1KQS A;  4RKL A;  1BDO A;  4YIJ A;  2GVA A;  1NUC A;  2XTI A;  3GTQ B;  4DV6 Q;  5JEA H;  5AFW A;  1OO9 B;  4DR5 L;  3Q24 A;  4KMU C;  5D3D A;  4HJ5 A;  1JCK B;  1L2F A;  4OWX B;  5C3E G;  2CFM A;  2MO0 A;  1SR3 A;  3L2P A;  4FF1 A;  1CA6 A;  2QEJ C;  1IBM L;  1X55 A;  2L5T A;  2UUC Q;  3C1E A;  4C1N K;  2KQ3 A;  1ESF A;  1YEZ A;  2NZO A;  3CAM A;  3W1G A;  4LF8 L;  1Q8I A;  1B3Q A;  4C3H B;  4N8X 1;  3GTL B;  1EQR A;  4DR2 Q;  1YNN D;  4KHV A;  2F0Q A;  4PZ6 A;  4A3L H;  3NBH B;  3H09 A;  2R92 H;  2JQO A;  2J7Z A;  2RCF A;  5IP9 H;  3S14 H;  1SMX A;  3ERS X;  4NKL A;  1JJC B;  1I3Q H;  3MXN A;  3JC6 6;  3R2T A;  2KED A;  1HJP A;  3MVV A;  1FJG Q;  3TBI B;  5IYD G;  1DOL A;  1Z9F A;  4E6I A;  4UHV A;  2KEN A;  5BN3 A;  3LNN A;  4BWG B;  3IKJ A;  1H9S B;  5LMU L;  1CFM A;  2NUC A;  1Q1B A;  3SGI A;  3CKI B;  4DV0 Q;  1FNU A;  3FRP B;  4A3D G;  1TXY A;  5CV5 A;  1X54 A;  3QR8 A;  3A74 A;  4OO1 I;  5IT9 L;  1DOM A;  2EYJ A;  3K57 A;  2OWO A;  1O7Y A;  2A6E D;  1F9Q A;  2CQO A;  4Z9C B;  3HP3 A;  3ND8 A;  4YHH L;  4X62 Q;  2NN6 I;  2F0D A;  5M3F H;  2ICE C;  1GOZ A;  1LT4 D;  3NTI A;  1DYQ A;  2QEX A;  1AW7 A;  4KY7 A;  4K0K Q;  1IHZ A;  3QOJ A;  2IX3 A;  3VDY A;  4H02 A;  4DK1 A;  4RMF A;  3U58 A;  3RZO B;  1LLR D;  4QCL A;  1NMF A;  1SMY C;  1X3E A;  3E9I A;  3RLF A;  4JI3 L;  5CMD A;  4JW0 A;  1LAB A;  4X66 Q;  5CC4 A;  2ZM6 Q;  4HIM A;  2K5N A;  1EZ8 A;  3UDF A;  3HOV H;  5E7N A;  5IP9 G;  2F0V A;  3TP7 A;  1ENF A;  3GTO H;  5FLX E;  5JAV A;  2E74 C;  2MPM A;  1PXU A;  2EZV A;  1PH4 A;  1BVS A;  1SE4 A;  2D0P A;  1HFG A;  4PMB A;  5CV4 A;  4LF6 L;  3WWV A;  1JB7 A;  3G71 A;  1HZC A;  2CH4 A;  2JK8 A;  2RDH A;  2YYZ A;  4DA2 A;  2HQE A;  1WTW A;  2R7D A;  3GTK B;  1IBK Q;  1KLG D;  1LAC A;  2EXZ A;  4LF9 L;  1PYS B;  1IL8 A;  2RA4 A;  2C35 B;  2E5L L;  1VDZ A;  1N32 Q;  2E2I B;  1HZB A;  5AJ3 Q;  2AMC B;  2ENB A;  5IGC A;  3E3X A;  4OO1 H;  4M8A A;  3J81 L;  2K05 A;  1HZ9 A;  1IXR A;  2UUA Q;  3HOW B;  1HTP A;  1WTQ A;  1EIF A;  2NVX B;  4UY8 C;  1JOK A;  1XMQ L;  1U9R A;  4HIK A;  2NN6 H;  4KN7 C;  3BDO A;  3HKZ E;  4DAY A;  1PH3 A;  4X65 L;  1BXT A;  1HZA A;  5M5X H;  3NHH A;  4PQX A;  5JJK A;  1T5E A;  2K5H A;  3NSW A;  2G9D A;  1W3S A;  5C5M A;  1C0A A;  3TS0 A;  2SDF A;  3JAM i;  1EYD A;  3DUZ A;  5CV7 A;  3F8T A;  2A6E C;  3RNU A;  1A6X A;  1QUQ A;  4JI4 Q;  3S1N B;  1STY A;  3BYT B;  3FP9 A;  1Y1W B;  4FP5 D;  3LWU A;  1KC8 C;  1TWG H;  2DNC A;  3E6Z X;  1VF5 C;  5M5W B;  3GTP H;  5I9P A;  1L1O C;  5J39 A;  3KJO A;  2CW0 D;  1VMP A;  2MHV A;  4MZ9 A;  2OCE A;  1LM0 A;  4A3E H;  2A68 D;  1GXD C;  2FHT A;  4BBR B;  4JG2 A;  4CKE A;  1LT5 D;  2LMC B;  1HR0 W;  1TS5 A;  3I90 A;  4BBS B;  1X3G A;  3I3C A;  3VYR A;  4GLX A;  2Z4I A;  4TQU S;  3TQY A;  2B2V A;  4EX5 A;  3LX0 A;  3DWA A;  3PIO A;  2TMP A;  1Y1V B;  4IOA A;  3GD7 A;  5C44 G;  4KY5 A;  1IBL L;  1Q90 A;  3RMH A;  1N34 L;  1T9H A;  2BH8 A;  3A0J A;  3PIO 3;  4A3M G;  4J15 A;  2LKV A;  1O7I A;  3CC7 A;  1E3P A;  4HAE A;  1SBB B;  3VR6 A;  4GKK Q;  3KFU A;  3CCL A;  4IAL A;  3T56 B;  4DV2 L;  1A2U A;  2ZT9 C;  4R4T A;  2JA5 G;  3OSO A;  1SSO A;  3SK8 A;  1B50 A;  4A3B B;  1RJT A;  3I4M G;  1S5C D;  1CHQ D;  3A5Z B;  1HUN A;  2F0F A;  2PQA A;  1RCV D;  5IP7 H;  5KYI A;  3T1H L;  3KLW A;  4GOP C;  1SEB D;  1RTN A;  2NVY B;  3SEB A;  5IWA Q;  1HNZ Q;  3D6W A;  3PO3 G;  2N78 A;  2E2H H;  4JBM A;  1NE3 A;  1PFN A;  2X6L A;  2BE5 D;  1ENC A;  2N8N A;  3KYH C;  2JSO A;  1NNX A;  4KKT A;  1V9P A;  2VQE Q;  1OXT A;  4DXF A;  2EYM A;  3TS2 A;  2WKD A;  1Y8N B;  5FKA C;  3VYT A;  1I6V C;  2B2Y C;  4WRD A;  4R8I A;  5CGK A;  3N6R A;  1Q3L A;  1EZ6 A;  2UXB L;  3UDG A;  5EPJ A;  3UDX A;  4A3J B;  1GO3 E;  2L15 A;  4QIW E;  4DR3 L;  2OEO A;  3C3L A;  4BS9 A;  3W2D A;  4CHT B;  3RZO H;  4BA1 I;  4H0L C;  1IYJ B;  3MTS A;  3D0F A;  1ZYR D;  4C3H G;  1D6E C;  2LY7 A;  1KAB A;  1PTO D;  1YHA A;  1PVO A;  2UUB L;  2CW0 C;  5JEA J;  1HQM C;  1JOO A;  3KLR A;  3PV0 A;  4RGN A;  1EOT A;  1JWU D;  2RSO A;  4LMQ D;  1D5M C;  3ER0 A;  3FPU B;  5KNB A;  1HNX L;  1EU4 A;  1W2B A;  2E76 C;  1VQP A;  4B08 A;  1EY9 A;  4Q0F A;  4KLK A;  4ALP A;  1N36 Q;  2K03 A;  4NXM Q;  2IY5 B;  1TS3 A;  4DNT B;  2WFW A;  3I8Z A;  3VR3 A;  4KJO A;  2XWJ B;  3S17 B;  2HCC A;  2MNA A;  2F0E A;  3Q22 A;  2MGS A;  2GA4 B;  1U4P A;  1A15 A;  4A3C G;  1HR0 Q;  1RKN A;  3T53 B;  3S1M H;  1QOH A;  4HMI A;  2A19 A;  3P75 A;  1A3V A;  4JYA Q;  5M5Y B;  1SRU A;  1Q82 C;  4DF7 A;  3T16 A;  1SFO H;  4HIO A;  4B3R L;  3RZD B;  2DN8 A;  3K5L A;  2PI2 E;  1N33 Q;  3CCV A;  3D6C A;  2F0K A;  4DAY B;  1S5F D;  1ILQ A;  2B8F A;  2F0U A;  3P1H A;  1JE5 A;  1KL9 A;  3HRZ C;  5DNF A;  4QY7 A;  4K8I A;  1KNA A;  1QIL A;  4K5V A;  2XSC A;  4GNX C;  4YY3 Q;  2KUM A;  2BE5 C;  2EXD A;  3DWP A;  1M90 C;  3OTO Q;  1TWC H;  3EFX D;  1KLU D;  5M9O A;  2XIW A;  4OIJ A;  3TRZ A;  4DUY Q;  5EPK A;  1TWF H;  2I07 B;  1TWA B;  4R9W A;  4X3T A;  3U50 C;  1N8R C;  1FGU A;  1I50 B;  2R6G A;  3S1N H;  1ONL A;  1K0R A;  2JE6 I;  1M1K C;  5M5W H;  4OON A;  3FVQ A;  3E0E A;  1PHJ A;  1KRT A;  1E2V A;  2EY6 A;  4RCO A;  5FJ8 G;  4QUF A;  2Q8R E;  2M2L A;  1LYL A;  3CPF A;  4XQQ A;  3VR5 A;  4DV1 Q;  4DV3 Q;  3GTJ H;  3M7G A;  2Q8I B;  2WKC A;  2XNA C;  1HCZ A;  1SND A;  1PTO F;  2IHF A;  1ZYR C;  4DR1 L;  4C1N I;  2WB1 B;  4A3K H;  1JJ2 A;  4DR6 L;  5KNC A;  1J5E L;  2NZH A;  4YWK A;  2OT2 A;  1PTO C;  3S15 H;  3TRE A;  3CQZ B;  3ULP A;  1Q7Y C;  2B2W A;  5ISR A;  1XNR Q;  1BQQ T;  3NE5 B;  5ELN A;  3UE0 A;  2BA1 A;  4FF4 A;  3G6E A;  4R4Q A;  3PO2 H;  2CCZ A;  5M3M H;  3HOW G;  4A76 A;  3DHQ A;  3HG9 A;  4PZ7 A;  4LUO A;  3CMA A;  4IO9 A;  4NW2 A;  4XQJ A;  1YI2 A;  4H7B A;  2KVM A;  2FMC A;  1WTP A;  1E0B A;  4A3F H;  1B9N A;  3I7F A;  2VB2 X;  4OX9 L;  2DY7 A;  1PRT D;  4FYD A;  4K8J A;  3JAM c;  1PZJ D;  5E1F A;  1TS2 A;  1XNQ L;  5GQO A;  3D8G A;  1I94 L;  1I4R A;  1K8O A;  3NBH A;  5D14 A;  3J80 i;  2FXQ A;  2ZJP A;  1F77 A;  5KIX A;  3BG3 A;  4F7X A;  1F9R A;  1Y1W G;  1WD1 A;  3EA6 A;  1B44 D;  2NTS A;  4ZCK A;  3CCU A;  1TKW B;  5GAD C;  4N9P A;  1QJO A;  1IYV A;  3SR1 A;  4BY7 B;  1GD7 A;  1B8A A;  2OTJ A;  2QF7 A;  4KTA A;  1ET9 A;  4BBR G;  1Q1E A;  1D7Q A;  5ELD A;  4YCW A;  3VA5 A;  4BBS G;  1O78 A;  1MI2 A;  3FEW X;  1PZI D;  2R7F A;  4TRD A;  1Y1V G;  1JOR A;  5I4D A;  2Y0S B;  3WOE A;  3H0G B;  5IGE A;  2F0S A;  4FF3 A;  1LTA D;  3H3V C;  1CSP A;  1SJE D;  1BOS A;  4EQ5 A;  4MTN A;  1YHQ A;  4HID A;  2A74 C;  2K01 A;  2OTL A;  1Z7T A;  2YTY A;  1NBW A;  3A55 A;  2HHH Q;  3S2H B;  4I7Z C;  1R9T B;  1EU3 A;  4A3I B;  3TP8 A;  2WAQ B;  1YNJ C;  3LWE A;  4A3B G;  3OWF A;  1N36 L;  4PG3 A;  4B9W A;  2D62 A;  4JOI C;  4DV4 L;  1SYE A;  1A2T A;  3A54 A;  4ILW A;  1IL2 A;  1ASZ A;  3MFY A;  3I4N B;  4DUZ Q;  4O42 A;  3STB D;  3EN2 A;  3T51 B;  1PYW D;  2Q2U A;  1AH9 A;  1JT8 A;  4JYA L;  2I46 A;  1ROD A;  2KOL A;  3K5M A;  1KDB A;  5C3E H;  1PRT F;  1L1O B;  4LF7 Q;  3K5N A;  4C56 C;  2NBF A;  4KY6 A;  1I5F A;  4KHZ A;  2F03 A;  4A3J G;  2QA4 A;  1O7Z A;  4DK3 C;  3AQQ A;  1ICF B;  2VZA A;  4B3M Q;  4C3I B;  5FLX L;  5ELE A;  5BR8 L;  4QMG A;  3K8A A;  3QO2 A;  1VQE A;  5E3F A;  3T4A C;  2DJG C;  1UEB A;  2Q2T A;  3DLL A;  1PH6 A;  2N55 A;  4DAM A;  5C3X A;  1I50 H;  5IGG A;  1D8L A;  1KD1 C;  5IYD H;  4GKJ L;  1UE1 A;  2PMZ E;  4KK7 A;  1A62 A;  1FR3 A;  1TVX A;  3HOZ G;  1KTK A;  4L5Q A;  3CME A;  2NTT A;  4MHE A;  4FDB A;  4A3D H;  1NR4 A;  3MAQ A;  2K5Q A;  4LFC L;  2EPB A;  2L11 A;  2GN5 A;  3VR2 A;  4Q5V A;  1VQO A;  2ZTE A;  1EWH A;  4NMZ A;  5K5P A;  3AMU A;  1JWS D;  4IUR A;  2AWO A;  3S1R H;  5IY0 A;  2HQL A;  5L37 A;  1AZP A;  3AB9 A;  1IZ6 A;  1JOQ A;  1DOK A;  1WTX A;  2DUD A;  4DGZ A;  1EY6 A;  3OW7 A;  3TP5 A;  3QOL A;  1QNU A;  5NUC A;  1B9M A;  1NAP A;  5C0X G;  3HZX A;  4PNY A;  3VR4 A;  3S16 H;  4JI6 Q;  2Q2I A;  4JBK A;  3PGZ A;  4XTC S;  3F2D A;  4JI5 L;  1VQM A;  1QE6 A;  3EJI A;  4DAP A;  4L5S A;  2JEA I;  1OXU A;  2HD3 A;  3A8I E;  5LMN W;  4IUQ A;  1STH A;  2E2J B;  3MEF A;  2ZJR A;  4BA2 I;  5IGF A;  4DR4 L;  1NJI C;  1PH9 A;  1K83 B;  5K36 H;  3STB C;  2HDM A;  2BOS A;  1XTC D;  3W5O A;  1SE8 A;  2K5W A;  1EUJ A;  3FMC A;  2IJ0 A;  3QIA A;  3BZD B;  2WII B;  5FO8 B;  1F2L A;  4EVO A;  2MQH A;  1HPC A;  4HCS A;  4L5T A;  1G2S A;  1TY0 A;  1WYD A;  4HMJ A;  3GTG H;  1TWH B;  2EJF C;  1CSQ A;  2Z1C A;  1ML0 D;  1D1I A;  1S40 A;  5C3W A;  1PA6 A;  4JV5 L;  3GO5 A;  1QNK A;  2F1M A;  2EYL A;  3K0Y A;  4KHP Q;  1LTB D;  5DLQ E;  2WAC A;  2WB1 G;  2O5J C;  3E0J A;  1V1Q A;  3HEJ A;  2YV5 A;  2AKW B;  4P73 A;  1EQQ A;  2VS1 A;  4FVM A;  5IIF A;  3ULJ A;  3Q8D A;  1SJH D;  1NMG A;  4RG1 A;  2R7Z G;  4AQY Q;  1WCM B;  3HS0 C;  1CQF A;  3FKI G;  5T1G A;  2VQF Q;  3RN2 A;  4LF4 L;  4XYO A;  4DV7 Q;  2NVQ H;  2J4X A;  4MN3 A;  1VQ7 A;  1PLF A;  4V19 0;  1XMO L;  1K73 C;  4IPH A;  3U9O A;  2JA9 A;  5EGT A;  2L12 A;  1YZ6 A;  4QUC A;  4WFN 3;  3NP8 A;  3SHL A;  1CZG A;  2QGQ A;  3J80 c;  5K36 G;  1P8L A;  2KCM A;  1Q46 A;  4GNX B;  1GUO A;  2RDF A;  2K50 A;  4X64 Q;  3R8B A;  4DN4 M;  4UAI A;  1KIX A;  4LF5 L;  1PH8 A;  3GTM B;  1RF2 D;  4I65 A;  4JI1 L;  2RHQ B;  2YU9 H;  2PPB C;  2RSN A;  4A93 B;  1E2W A;  1X65 A;  4A3G B;  4DK0 A;  3DMU A;  2OF1 A;  3K0X A;  1T5X D;  4BY7 G;  2D0O A;  4B3T Q;  2KBN A;  2PCF B;  1Z47 A;  1LTT D;  2F3W A;  2AQ2 B;  3WDN A;  5HY6 A;  4JI8 Q;  5C44 H;  4LWC A;  1XYI A;  1UNS A;  4H44 C;  5KEE A;  2KCN A;  4A3M H;  2Y0S G;  3CU7 A;  3H0G G;  5HGQ A;  1BBW A;  4IJL A;  3HOX B;  3H91 A;  5COY A;  3I70 A;  3PIP 3;  1PTO B;  3ERQ A;  2UXD Q;  2A5H A;  3L3O C;  4YWM A;  5EKI A;  1EFW A;  1JIC A;  4JI0 Q;  4Y7N H;  4QF4 A;  1QB5 D;  1SYG A;  4IOC A;  1IW7 D;  3Q0A A;  2VL6 A;  2JA5 H;  5LMN Q;  3TZU A;  2KJX A;  3OYY A;  1SDF A;  3W3A A;  3HOY B;  1N9W A;  5KYL A;  1D5Z C;  3A5U A;  3I4M H;  1YIT A;  4K2K A;  3X3N A;  5LL6 X;  4A3I G;  1G91 A;  2HT1 A;  2WAQ G;  1DON A;  2KEE A;  4QQB X;  1ESR A;  4IFD G;  4IQZ A;  4ZUJ A;  3PO3 H;  1MHW C;  2L4N A;  2K75 A;  1R4Q B;  4P75 A;  4S3S A;  3M4O H;  4DR7 L;  2UXC L;  4IUV A;  2H1E A;  2EQS A;  4BY1 G;  2VB3 X;  4ZUI A;  3J81 j;  3A7A B;  3I4N G;  1VS0 A;  1TII D;  2CWP A;  3CF5 A;  1VQG A;  3GTQ H;  3BVZ A;  4DV6 L;  3DM1 A;  2X6G A;  4RH6 A;  3D4R A;  4MNO A;  4PZ8 A;  4UP7 A;  3CP0 A;  4C3J B;  1PYB A;  3NUC A;  4K5X A;  1HNW Q;  1I4P A;  2IX1 A;  2B2U C;  3GP7 A;  4PV1 C;  2UUC L;  3SVM A;  2FJ2 A;  2AUJ D;  3SK5 A;  1G6Z A;  5IOC A;  4J8Q A;  4LFA Q;  3ITP A;  3RLN A;  3CRL C;  4C3H H;  2LSS A;  3GTL H;  1JE4 A;  4C3I G;  1QZG A;  4DR2 L;  1S5D D;  2X69 A;  2IWH A;  2ZTC A;  4CBV A;  1VQ5 A;  4LW1 A;  4LFB Q;  4C2M B;  2CQA A;  2F52 A;  4O1N A;  1EOV A;  3E9H A;  1VQB A;  2F0H A;  3A8J E;  4JI7 Q;  2CVR A;  3R93 A;  1CK1 A;  2F0J A;  3AFP A;  5GAH C;  1FJG L;  1TU2 B;  4CJ0 B;  1CKO A;  4CJ2 C;  1DZ1 A;  5KND A;  1HRJ A;  4CDE C;  1A63 A;  2IL8 A;  4JCV E;  4LJZ C;  3A56 A;  2HIV A;  2B39 A;  4DV0 L;  2EDG A;  1YHB A;  4A3C H;  1E1T A;  4YWL A;  5C4J B;  4ZLT F;  4K14 A;  1GJX A;  3EVQ A;  5A2Q E;  3QJY A;  2JA6 B;  1IW7 C;  4MIU A;  4OEM B;  1Z6H A;  4X62 L;  3KF6 B;  4IJH A;  1YBY A;  3W1B A;  3KBG A;  2EJM A;  4GN5 A;  3V2T A;  4OL7 A;  3KUP A;  3J7Y W;  1PFS A;  1C8C A;  4K0K L;  1B7Y B;  2Z6B A;  3J81 i;  1MGS A;  3PSI A;  5C4X B;  2NZ1 D;  1QZH A;  2KA7 A;  1K9M C;  2NYZ D;  2IW3 A;  1VQD A;  3HOU B;  3P7J A;  1PH7 A;  1PRT B;  4UPA A;  2D2C C;  4FXG C;  1EYG A;  1RTO A;  3IFT A;  3MA2 B;  4X66 L;  2ZM6 L;  5JOB A;  2C9O A;  2HDL A;  3S2D B;  2Z6K A;  3A8K E;  5KRU A;  4WJW A;  1BKB A;  1CUK A;  2WP8 J;  1AE2 A;  1QG7 A;  1S3O A;  1SYD A;  3HOZ B;  1FD7 D;  2AUK A;  5FJ8 H;  1CKM A;  2PZW A;  2QCP X;  4I7A A;  4NXN Q;  1G8Z D;  3T1Y Q;  3SE0 A;  2F0I A;  1NSN S;  1SNO A;  3CC2 A;  2AHO B;  3S1Q B;  3MWY W;  3GTK H;  2Q2H A;  1IBK L;  1QWY A;  4AYB B;  1OXX K;  2PQE A;  3BVM A;  3F2C A;  2E2I H;  1K28 A;  1VF7 A;  1N32 L;  4R4I A;  4UP8 A;  5AJ3 L;  1S72 A;  1ZEQ X;  3G48 A;  5H1S E;  3J80 L;  2MJ8 A;  1XJV A;  1RIP A;  1D5X C;  3CD6 A;  1VMC A;  1CA5 A;  3MHB A;  3HOW H;  1GKH A;  2UUA L;  2NVX H;  3I72 A;  1YVC A;  3T13 A;  1L1O A;  4N9T A;  1WCM G;  3EBE A;  3DEP A;  5I2Y A;  4IPD A;  1KRS A;  1EQV A;  1O80 A;  1C4Q A;  1SN8 A;  1VCI A;  4XXE A;  1A3U A;  1RDP D;  1D1K A;  2VUM B;  5I6Y A;  4G7O C;  3ULL A;  5FK9 C;  2B2T C;  2VY3 A;  5CBE E;  4XDX A;  2A73 B;  1HH2 P;  5I2X A;  2UU9 Q;  4JI4 L;  2F0N A;  1YNX A;  1Y1W H;  2ICI A;  1VQN A;  3IFD A;  2H5X A; 
#chains in the Genus database with same CATH homology
 1SNC A;  1EY0 A;  2K28 A;  4XT3 B;  5D3I B;  1KNE A;  1C48 A;  3OOC A;  2MP1 A;  4RGM A;  3OHX C;  3NTK A;  1YNJ D;  2JA7 B;  5E4W C;  1CI3 M;  4ABN A;  2J0T D;  2XN9 C;  3TN2 A;  5HGT A;  3DWQ A;  5C4H A;  1WVL A;  1FYC A;  5J1Z A;  3D4W A;  5EJW A;  3N52 A;  3U9S A;  3OPO A;  2R7Z B;  1V43 A;  4EGV A;  3FKI B;  2KHS A;  1EYC A;  4LK1 C;  1BBX C;  1BO0 A;  2F0G A;  3I91 A;  2BDO A;  1EY8 A;  1MSG A;  5HUR A;  4KI0 A;  2B2Y A;  1OXV A;  4XQN A;  3NWT A;  2EE1 A;  1SYF A;  2O4X A;  2EOT A;  1UUP A;  2SNM A;  5C0X I;  3C1F A;  4KKU A;  1K8M A;  1SNP A;  3RUZ A;  4CJ1 B;  1I4H A;  4ZKC B;  2HCI A;  4CGY B;  4HN7 A;  2R92 B;  1LTI D;  3BVG A;  1JWM D;  3HGB A;  4RKB A;  4HSP A;  1I3Q B;  1LTR D;  2F0M A;  4C3J G;  5CBA E;  4RAU C;  1FNW A;  2EY2 A;  5IGB A;  4HSV A;  1TT2 A;  3PUV A;  1TQO A;  1AFP A;  4KKS A;  2ZXP A;  1ZXT A;  3J80 E;  4ID6 A;  2CHB D;  4X3S A;  5M3F B;  3EQL C;  5JVG 3;  3H6M A;  1SYC A;  1V1P B;  2RVL A;  3VA7 A;  2EYO A;  5EQ0 A;  3D3R A;  2C5C A;  2MUY A;  4BY1 B;  4NDX A;  2SOB A;  4IUT A;  4K5W A;  3KLS X;  1V8Q A;  4J6H A;  5FO9 B;  3GV6 A;  3K7A B;  1XWE A;  2IX0 A;  3HOV B;  1M4V A;  4IUN A;  5C0X H;  1BCP D;  1WTO A;  1DD2 A;  2SEB D;  2E75 C;  1DJR D;  2VNU D;  3MXP A;  4ULL A;  3NWS A;  3R3O A;  4DXG A;  1STG A;  1QCB D;  4IN3 A;  4P2C B;  1SXT A;  1EIH A;  1PFM A;  1PZK D;  4JBW A;  3SK4 A;  3I73 A;  2A6H D;  4ZKB B;  2RDG A;  2JYO A;  3HKZ B;  1GHJ A;  1Q12 A;  1GUW A;  4EQP A;  1Y8P B;  5M5X B;  3G6J B;  3KBX A;  5JJZ A;  2K04 A;  1H9R A;  1MBY A;  4G7H C;  1V1O A;  4QB4 A;  4IFD I;  4OIK A;  1H9K A;  1LT6 D;  3GTP B;  5EPL A;  3NQT A;  3L9A X;  1GUT A;  4A3E B;  1SYB A;  5C6A A;  2DY8 A;  1A3T A;  3X3M A;  4RGO S;  3WOF A;  3IAY A;  1G2T A;  2ZXO A;  3E5S A;  1HXY D;  3BYY B;  3FPP A;  1SE3 A;  4U67 3;  1W6J A;  1BCP F;  3D4D A;  2NVT B;  3TP6 A;  1SAP A;  1BCP C;  4KV6 A;  4XT1 B;  1BF4 A;  1B4O A;  1BUV T;  1PFB A;  5DEH A;  1R4P B;  3H94 A;  3MXG A;  3NQI A;  2EY5 A;  2LS0 1;  5G3L F;  2ZXR A;  3O13 A;  5E4X A;  5COR A;  2NWG A;  1MSH A;  2B2V C;  3JAM L;  3MC0 B;  5JVH 3;  3M85 A;  3C2P A;  5CV6 A;  1I4X A;  1J9O A;  3GV3 A;  4XIG S;  4K2L A;  5C5L A;  3J7A F;  4IZ8 A;  2E2H B;  4M1U B;  4ZYS A;  5BN5 A;  1LO5 D;  2PZU A;  5CV8 A;  2A6H C;  2NB0 A;  3VYS A;  4IFD H;  4QIW B;  3NK9 A;  5JEA G;  4KD4 A;  4HTH A;  2K5D A;  4ZK9 B;  2AWN A;  5A2Q L;  3OMG A;  5DAU A;  2R93 B;  3R2I A;  1BR9 A;  2OXP A;  3ND9 A;  1U4R A;  1XXG A;  1JR0 D;  3OIP A;  5ELC A;  1U4M A;  1LV9 A;  3SDZ A;  4G57 A;  4K6D A;  1F9P A;  3GQB A;  1WD0 A;  3NTH A;  2RBM A;  4EQN A;  2K33 A;  4H13 C;  1GUN A;  1L0Y B;  5BN4 A;  1SNM A;  1HA5 A;  2XRQ D;  1GUS A;  1SE2 A;  2JP1 A;  4RA8 A;  1WTR A;  3ZYY X;  5F2D A;  2F4I A;  2PO4 A;  1I6H B;  2H4O A;  1X32 A;  1YNN C;  1S4Z A;  3S1M B;  3V96 A;  5JPN C;  5EBC A;  2JEB I;  1J8I A;  3SK6 A;  3BDC A;  3TZD A;  1Y69 U;  1II3 A;  3Q23 A;  4J1M A;  1PMR A;  1SFO B;  1F9S A;  1S5B D;  2PYK A;  4CKB A;  2K1B A;  4F88 A;  5C4Z A;  4IUU A;  1CZW A;  1ENA A;  1IKM A;  1F2Y A;  1NCV A;  2RKS A;  4X3U A;  2F0L A;  3OMC A;  4HED A;  3CRK C;  1TWC B;  1FGB D;  5ELF A;  1ILP A;  3TDQ A;  1TWF B;  2FMM A;  4LAA A;  1M8A A;  1WTV A;  2SNS A;  1OXS C;  4RCN A;  2N88 A;  1HA6 A;  4FNF A;  4ZQ3 A;  1HTL D;  1TR5 A;  3ONA B;  2BCO A;  3JAM E;  2TSS A;  3GTJ B;  2PW5 A;  3M3Y B;  2RQX A;  5EKK A;  4RHR A;  5CV9 A;  2G9H D;  5C0X J;  4A3K B;  3S15 B;  3TSS A;  5IT9 E;  2QDB A;  2XVS A;  4OO1 G;  2PW7 A;  3PO2 B;  1E2Z A;  5IGD A;  5M3M B;  5EKL A;  4FO2 A;  3NPP A;  1SNQ A;  1RHP A;  4B9X A;  3Q6S A;  3M7N A;  3ERO A;  2PNR C;  2WIN B;  4A3F B;  2NN6 G;  4DAV A;  1UAP A;  1DM0 B;  1STA A;  3KK7 A;  1B53 A;  2EYP A;  2Z4H A;  5EBD A;  2B2W C;  2V4D A;  3KF8 A;  2IT1 A;  1H9J A;  1AN8 A;  2O5I C;  5LL6 S;  2M9V A;  4TKO B;  3MXU A;  4HR7 B;  4XYQ A;  2FIN B;  1PDQ A;  4JK1 C;  3PUW A;  1LTG D;  3SXH A;  2F3V A;  3F2U A;  4RWS C;  1STN A;  5DM7 3;  2WV6 D;  5JPM C;  3OWE B;  1B3A A;  2JXM B;  1AZQ A;  2LFN A;  2AQ3 B;  2F0P A;  2R3Z A;  3K6O A;  1CTM A;  3IL8 A;  1CT1 D;  4ODG A;  3KLS A;  2JA8 B;  2EYF A;  3QG1 A;  4K6L A;  4U68 A;  3I4L A;  3L7Z C;  1DCZ A;  5I9O A;  2A68 C;  4WOR A;  5CYU A;  4KN4 C;  1JQY D;  3J81 E;  1V1P A;  1CHP D;  1STE A;  2ID0 A;  4FXK C;  2QKI C;  3K59 A;  1U4L A;  2EVB A;  5ELB A;  1Y8O B;  1EY4 A;  4RGT A;  2BDN A;  2HUG A;  2A69 D;  1PTO H;  2PZT A;  1D2B A;  3PUX A;  1LTS D;  2F0O A;  4DFA A;  1EEF D;  2L9H A;  5I6W A;  5C3E B;  1S5E D;  5KGU A;  1FNV A;  4KD3 A;  1L0X B;  2B2U A;  4OHJ A;  5FOB B;  5IOD A;  4ME5 A;  2B63 B;  2F0T A;  1EY5 A;  3CHB D;  1F2M A;  1X3P A;  3G7L A;  4L8J A;  4R8N A;  4NP5 A;  2FFK B;  1XX8 A;  4IFD J;  1IKL A;  1BCP B;  2PMZ B;  5A35 A;  3NXW A;  3MFG A;  2E2D C;  1TS4 A;  3VYU A;  4X3K A;  1O7L A;  2B8G A;  4DNR B;  3QB3 A;  3S9W A;  3V05 A;  3TME A;  4PMC A;  1KAA A;  1EL0 A;  4A3D B;  2IPK D;  1ICW A;  5LHY 1;  1HQR D;  1GHK A;  1I4G A;  3A7L A;  3S1R B;  4FXD A;  3URY A;  5J22 A;  2BA0 A;  4OGQ C;  2XWB B;  1MD2 D;  4L6T B;  3S16 B;  4F87 A;  2K7V A;  1CM9 A;  3BS1 A;  1JB3 A;  2L1B A;  4DU9 A;  3K5O A;  5TSS A;  1AEX A;  2A69 C;  4IUP A;  3M4Y A;  4G4K A;  4RHS A;  4RFB A;  1EY7 A;  1NR2 A;  3S14 B;  1I4Q A;  3AU7 A;  3PUZ A;  1EQT A;  4CKC A;  1EEI D;  1B1Z A;  2EJG C;  1B2T A;  3MZ5 A;  1HHV A;  1G29 1;  2R61 A;  1GUG A;  4FF2 A;  2K6A A;  3GTG B;  1W6K A;  5D65 A;  5CR3 A;  1HUM A;  3PUY A;  1H9S A;  1ZKO A;  1X3Q A;  2K32 A;  4ZRZ A;  1LT3 D;  2Q8T A;  2KCC A;  4KJN A;  3UI2 A;  1IYU A;  4UDU C;  5T1I A;  1ET6 A;  4F8M A;  2D5D A;  1EWC A;  2F0W A;  3QWN A;  2Z8L A;  1RD9 D;  3NBI A;  3PMF A;  1BNZ A;  2NVQ B;  3FDT A;  4ZAI A;  2XRS D;  1H9M A;  2B2T A;  2O2L D;  3DEO A;  2L0C A;  3GTO B;  3D31 A;  2YU9 B;  1AP0 A;  2QIL A;  1HFN A;  2M00 A;  5G3L D;  1TY2 A;  3OIQ A;  4L63 B;  1PRT C;  5DM6 3;  2VXW A;  5C44 B;  3DXJ C;  4TSS A;  2EYH A;  3MEH A;  3J7A V;  1DXM A;  4A3M B;  2D9U A;  1CQV A;  4EQO A;  3K58 A;  1F2Z A;  2AQ1 B;  2L55 A;  2DNE A;  4Y7N B;  3RD4 A;  4HCE A;  3BDL A;  2JA5 B;  2EY1 A;  3I4M B;  1JC7 A;  2KEC A;  1STB A;  1EIG A;  4V0B A;  1KDC A;  3P20 A;  3PO3 B;  1EYA A;  1EFI D;  1UEA B;  4GZY C;  1SMY D;  4PMW A;  3M4O B;  5FO7 B;  1TWG B;  4G7Z C;  3C46 A;  1KDA A;  4RKL A;  1BDO A;  4YIJ A;  1NUC A;  3GTQ B;  5JEA H;  5AFW A;  1OO9 B;  3Q24 A;  4KMU C;  5D3D A;  1JCK B;  4FF1 A;  1CA6 A;  2QEJ C;  2L5T A;  3C1E A;  4C1N K;  2KQ3 A;  1ESF A;  1Q8I A;  4C3H B;  3GTL B;  1YNN D;  4KHV A;  2F0Q A;  3H09 A;  2J7Z A;  4NKL A;  3MXN A;  3R2T A;  2KED A;  3MVV A;  3TBI B;  1DOL A;  4E6I A;  5BN3 A;  3LNN A;  4BWG B;  3IKJ A;  1H9S B;  1CFM A;  2NUC A;  1Q1B A;  3CKI B;  1FNU A;  3FRP B;  4OO1 I;  5CV5 A;  5IT9 L;  1DOM A;  2EYJ A;  3K57 A;  1O7Y A;  2A6E D;  1F9Q A;  4Z9C B;  3HP3 A;  3ND8 A;  2NN6 I;  2F0D A;  2ICE C;  1GOZ A;  1LT4 D;  3NTI A;  1DYQ A;  1AW7 A;  4KY7 A;  1IHZ A;  3QOJ A;  2IX3 A;  4DK1 A;  3RZO B;  1LLR D;  4QCL A;  1SMY C;  3RLF A;  5CMD A;  1LAB A;  5CC4 A;  1EZ8 A;  2F0V A;  3TP7 A;  1ENF A;  5FLX E;  5JAV A;  2E74 C;  2MPM A;  1PXU A;  2EZV A;  1SE4 A;  1HFG A;  4PMB A;  5CV4 A;  2RDH A;  2YYZ A;  4DA2 A;  2HQE A;  1WTW A;  3GTK B;  1KLG D;  1LAC A;  2EXZ A;  1IL8 A;  2RA4 A;  1VDZ A;  2E2I B;  2ENB A;  5IGC A;  4OO1 H;  4M8A A;  3J81 L;  2K05 A;  3HOW B;  1HTP A;  1WTQ A;  2NVX B;  1JOK A;  1U9R A;  2NN6 H;  4KN7 C;  3BDO A;  4DAY A;  1BXT A;  3NHH A;  4PQX A;  1T5E A;  3NSW A;  2G9D A;  5C5M A;  2SDF A;  1EYD A;  3DUZ A;  5CV7 A;  2A6E C;  1A6X A;  3S1N B;  1STY A;  3BYT B;  1Y1W B;  4FP5 D;  3LWU A;  2DNC A;  3E6Z X;  1VF5 C;  5M5W B;  5I9P A;  5J39 A;  2CW0 D;  1VMP A;  2MHV A;  2A68 D;  1GXD C;  2FHT A;  4BBR B;  4CKE A;  1LT5 D;  2LMC B;  1TS5 A;  3I90 A;  4BBS B;  3I3C A;  3VYR A;  2Z4I A;  4TQU S;  2B2V A;  3LX0 A;  3DWA A;  2TMP A;  1Y1V B;  3GD7 A;  4KY5 A;  1Q90 A;  3RMH A;  3PIO 3;  2LKV A;  4HAE A;  1SBB B;  3VR6 A;  4IAL A;  3T56 B;  1A2U A;  2ZT9 C;  3OSO A;  1SSO A;  3SK8 A;  1B50 A;  4A3B B;  1RJT A;  1S5C D;  1CHQ D;  1HUN A;  2F0F A;  1RCV D;  5KYI A;  1SEB D;  1RTN A;  2NVY B;  3SEB A;  3D6W A;  1PFN A;  2X6L A;  2BE5 D;  1ENC A;  2JSO A;  4KKT A;  1OXT A;  4DXF A;  2EYM A;  2WKD A;  1Y8N B;  5FKA C;  3VYT A;  1I6V C;  2B2Y C;  4WRD A;  4R8I A;  5CGK A;  3N6R A;  1Q3L A;  1EZ6 A;  5EPJ A;  4A3J B;  2OEO A;  3C3L A;  4BS9 A;  3W2D A;  4CHT B;  4BA1 I;  4H0L C;  3MTS A;  1ZYR D;  4C3H G;  1D6E C;  2LY7 A;  1KAB A;  1PTO D;  2CW0 C;  5JEA J;  1HQM C;  1JOO A;  3KLR A;  3PV0 A;  4RGN A;  1EOT A;  1JWU D;  2RSO A;  4LMQ D;  1D5M C;  5KNB A;  3FPU B;  1EU4 A;  2E76 C;  4B08 A;  1EY9 A;  4Q0F A;  2K03 A;  1TS3 A;  4DNT B;  3I8Z A;  3VR3 A;  4KJO A;  2XWJ B;  3S17 B;  2HCC A;  2F0E A;  3Q22 A;  2MGS A;  2GA4 B;  1U4P A;  1A15 A;  1RKN A;  3T53 B;  1QOH A;  4HMI A;  3P75 A;  1A3V A;  5M5Y B;  4DF7 A;  3T16 A;  3RZD B;  2DN8 A;  3K5L A;  3D6C A;  2F0K A;  1S5F D;  1ILQ A;  2B8F A;  2F0U A;  3P1H A;  3HRZ C;  5DNF A;  4K8I A;  1KNA A;  1QIL A;  4K5V A;  2XSC A;  2KUM A;  2BE5 C;  3DWP A;  3EFX D;  1KLU D;  5M9O A;  2XIW A;  4OIJ A;  5EPK A;  2I07 B;  1TWA B;  4R9W A;  4X3T A;  1I50 B;  2R6G A;  1ONL A;  2JE6 I;  3FVQ A;  1E2V A;  2EY6 A;  4RCO A;  4QUF A;  2Q8R E;  2M2L A;  4XQQ A;  3VR5 A;  3M7G A;  2Q8I B;  2WKC A;  2XNA C;  1HCZ A;  1SND A;  1PTO F;  1ZYR C;  4C1N I;  2WB1 B;  5KNC A;  2OT2 A;  1PTO C;  3CQZ B;  2B2W A;  5ISR A;  1BQQ T;  3NE5 B;  2BA1 A;  4FF4 A;  3DHQ A;  3HG9 A;  4NW2 A;  4XQJ A;  4H7B A;  2KVM A;  2FMC A;  1WTP A;  1E0B A;  1B9N A;  2VB2 X;  2DY7 A;  1PRT D;  4FYD A;  4K8J A;  1PZJ D;  5E1F A;  1TS2 A;  3D8G A;  1I4R A;  1K8O A;  3NBH A;  5D14 A;  1F77 A;  5KIX A;  3BG3 A;  4F7X A;  1F9R A;  1WD1 A;  3EA6 A;  1B44 D;  2NTS A;  1TKW B;  4N9P A;  1QJO A;  1IYV A;  3SR1 A;  4BY7 B;  2QF7 A;  4KTA A;  1ET9 A;  1Q1E A;  5ELD A;  3VA5 A;  1O78 A;  1MI2 A;  3FEW X;  1PZI D;  4TRD A;  1JOR A;  5I4D A;  2Y0S B;  3WOE A;  3H0G B;  5IGE A;  2F0S A;  4FF3 A;  1LTA D;  3H3V C;  1SJE D;  1BOS A;  2A74 C;  2K01 A;  1Z7T A;  3A55 A;  3S2H B;  4I7Z C;  1R9T B;  1EU3 A;  4A3I B;  3TP8 A;  2WAQ B;  1YNJ C;  3LWE A;  3OWF A;  4B9W A;  2D62 A;  1SYE A;  1A2T A;  3A54 A;  4ILW A;  3MFY A;  3I4N B;  4O42 A;  3T51 B;  1PYW D;  2I46 A;  1ROD A;  2KOL A;  3K5M A;  1KDB A;  1PRT F;  3K5N A;  4C56 C;  2NBF A;  4KY6 A;  4KHZ A;  2F03 A;  1O7Z A;  4C3I B;  5FLX L;  5ELE A;  4QMG A;  3QO2 A;  5E3F A;  3T4A C;  2N55 A;  5C3X A;  5IGG A;  4KK7 A;  1FR3 A;  1TVX A;  1KTK A;  2NTT A;  4MHE A;  1NR4 A;  3MAQ A;  2K5Q A;  2EPB A;  2L11 A;  3VR2 A;  4Q5V A;  1EWH A;  4NMZ A;  5K5P A;  3AMU A;  1JWS D;  4IUR A;  2AWO A;  1AZP A;  3AB9 A;  1JOQ A;  1DOK A;  1WTX A;  4DGZ A;  1EY6 A;  3OW7 A;  3TP5 A;  3QOL A;  1QNU A;  5NUC A;  1B9M A;  1NAP A;  5C0X G;  3HZX A;  4PNY A;  3VR4 A;  4XTC S;  1QE6 A;  3EJI A;  4DAP A;  2JEA I;  1OXU A;  3A8I E;  4IUQ A;  1STH A;  2E2J B;  4BA2 I;  5IGF A;  1K83 B;  5K36 H;  2HDM A;  2BOS A;  1XTC D;  2K5W A;  3FMC A;  2IJ0 A;  3QIA A;  3BZD B;  2WII B;  5FO8 B;  1F2L A;  4EVO A;  1HPC A;  4HCS A;  1G2S A;  1TY0 A;  4HMJ A;  1TWH B;  2EJF C;  2Z1C A;  1ML0 D;  1D1I A;  5C3W A;  3GO5 A;  1QNK A;  2F1M A;  2EYL A;  3K0Y A;  1LTB D;  2WAC A;  2O5J C;  3E0J A;  3HEJ A;  4FVM A;  5IIF A;  1SJH D;  1WCM B;  3HS0 C;  1CQF A;  5T1G A;  4XYO A;  2J4X A;  4MN3 A;  1PLF A;  4V19 0;  3U9O A;  5EGT A;  2L12 A;  4QUC A;  4WFN 3;  3NP8 A;  3SHL A;  1CZG A;  5K36 G;  1GUO A;  2RDF A;  3R8B A;  4DN4 M;  4UAI A;  3GTM B;  1RF2 D;  4I65 A;  2PPB C;  2RSN A;  4A93 B;  1E2W A;  4A3G B;  4DK0 A;  3DMU A;  2OF1 A;  1T5X D;  2PCF B;  1Z47 A;  1LTT D;  2F3W A;  2AQ2 B;  3WDN A;  1XYI A;  1UNS A;  4H44 C;  5KEE A;  2KCN A;  3CU7 A;  3HOX B;  3H91 A;  5COY A;  3I70 A;  3PIP 3;  1PTO B;  3ERQ A;  2A5H A;  3L3O C;  5EKI A;  1JIC A;  4QF4 A;  1QB5 D;  1SYG A;  1IW7 D;  3Q0A A;  3TZU A;  2KJX A;  1SDF A;  3W3A A;  3HOY B;  5KYL A;  1D5Z C;  4K2K A;  3X3N A;  5LL6 X;  1G91 A;  1DON A;  2KEE A;  1ESR A;  4IFD G;  4IQZ A;  4ZUJ A;  2L4N A;  1R4Q B;  4S3S A;  4IUV A;  2H1E A;  2VB3 X;  4ZUI A;  3A7A B;  1TII D;  3BVZ A;  3DM1 A;  2X6G A;  4RH6 A;  3D4R A;  4C3J B;  3NUC A;  4K5X A;  1I4P A;  2IX1 A;  2B2U C;  3GP7 A;  4PV1 C;  3SVM A;  2FJ2 A;  2AUJ D;  3SK5 A;  1G6Z A;  5IOC A;  4J8Q A;  3ITP A;  3CRL C;  1JE4 A;  4C3I G;  1S5D D;  2X69 A;  2IWH A;  4CBV A;  4C2M B;  2CQA A;  4O1N A;  2F0H A;  3A8J E;  2CVR A;  3R93 A;  1CK1 A;  2F0J A;  1TU2 B;  4CJ0 B;  4CJ2 C;  1DZ1 A;  5KND A;  1HRJ A;  2IL8 A;  4LJZ C;  3A56 A;  2B39 A;  2EDG A;  5C4J B;  4ZLT F;  4K14 A;  1GJX A;  3EVQ A;  5A2Q E;  3QJY A;  2JA6 B;  1IW7 C;  4MIU A;  1Z6H A;  3KBG A;  2EJM A;  3V2T A;  4OL7 A;  3KUP A;  3J7Y W;  1C8C A;  1MGS A;  5C4X B;  2NZ1 D;  2KA7 A;  2NYZ D;  2IW3 A;  3HOU B;  3P7J A;  1PRT B;  2D2C C;  4FXG C;  1RTO A;  3IFT A;  3MA2 B;  5JOB A;  2C9O A;  2HDL A;  3S2D B;  3A8K E;  5KRU A;  4WJW A;  2WP8 J;  1QG7 A;  1SYD A;  3HOZ B;  1FD7 D;  2AUK A;  2PZW A;  2QCP X;  1G8Z D;  3SE0 A;  2F0I A;  1NSN S;  1SNO A;  3S1Q B;  3MWY W;  1QWY A;  4AYB B;  1OXX K;  2PQE A;  3BVM A;  1VF7 A;  1ZEQ X;  3J80 L;  2MJ8 A;  1D5X C;  1VMC A;  1CA5 A;  3MHB A;  3I72 A;  3T13 A;  4N9T A;  3DEP A;  5I2Y A;  1EQV A;  1O80 A;  1C4Q A;  1VCI A;  4XXE A;  1A3U A;  1RDP D;  1D1K A;  2VUM B;  5I6Y A;  4G7O C;  5FK9 C;  2B2T C;  5CBE E;  4XDX A;  2A73 B;  5I2X A;  2F0N A;  2ICI A;  3IFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...