5E1FA

Crystal structure of staphylococcal nuclease variant delta+phs g20e at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDEDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS G20E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5e1fA00
3MVVA 4NKLA 4K5VA 5C5MA 2EY2A 4EVOA 1KDAA 3EVQA 4TRDA 4HMJA 1EY4A 5C3XA 5C6AA 2SNMA 1EYCA 3R3OA 1A2TA 1F2YA 1U9RA 2OEOA 4IALA 1SYDA 3DHQA 4KY7A 1STNA 2RDFA 3SHLA 1SNDA 3OMCA 4KJNA 3NP8A 4YIJA 5KYIA 5KGUA 3ITPA 4H7BA 5C4HA 5KEEA 5J39A 1TR5A 3PMFA 3C1FA 4ZUJA 3BDCA 2F0LA 1JOOA 5CC4A 1SNPA 2EY6A 3C1EA 4I65A 3TP6A 3OWFA 5M9OA 1SYBA 3QOJA 1STYA 5KYLA 2OXPA 3P1HA 5C4ZA 1F2MA 4EQPA 5HURA 2F0TA 4ZQ3A 3H6MA 2RKSA 3OMGA 5E1FA 1ENCA 4PNYA 2PW5A 1EY7A 5I9OA 2NUCA 3SK6A 3DMUA 1EY0A 1EY6A 4NMZA 4K5WA 4PMBA 5DAUA 5IGBA 2EYFA 4QB4A 2EY5A 5NUCA 4HMIA 2F0QA 3TMEA 4ZUIA 3RUZA 2PW7A 4G57A 1STHA 2EXZA 4K5XA 5EKLA 5KIXA 4DGZA 1AEXA 3E5SA 5CV4A 3TP8A 4DU9A 2F0SA 1EY5A 1NUCA 4K6DA 2F0WA 3D8GA 1SNQA 2KQ3A 3D4DA 1EYAA 3NXWA 4KY6A 5EKKA 4DFAA 4HTHA 1F2ZA 2F0UA 5CV8A 5J22A 2F0OA 1SYGA 2EYLA 3EROA 5CV6A 2SNSA 5E3FA 5F2DA 4MIUA 5CV5A 3SK4A 1A3TA 3U9OA 3VA5A 3S9WA 4NDXA 4QMGA 2F3WA 2F0HA 2O4XA 1SNCA 1TQOA 1SYEA 2F3VA 2SOBA 4F7XA 3NHHA 5DEHA 1KDBA 3MEHA 5EGTA 3HEJA 2F0DA 2M00A 4KD3A 5ISRA 5CV9A 2HQEA 2KHSA 4KV6A 4F8MA 1KABA 2EYOA 4RKLA 5C5LA 5I9PA 3OSOA 2F0EA 1EQVA 1ENAA 2F0FA 3T13A 5IGEA 4IZ8A 4ID6A 2ENBA 1IHZA 4J1MA 2PZTA 4K2LA 4KY5A 1EZ6A 1EYDA 2F0NA 3QB3A 1RKNA 2EYPA 1A2UA 1SYCA 2F0IA 1A3UA 3P75A 4IUNA 4EQNA 3TP7A 5HGTA 1STBA 1EZ8A 4K8JA 5KRUA 1JOQA 5CV7A 4K8IA 4KD4A 4K14A 5IGDA 5K5PA 4PMCA 4WORA 2LKVA 4B9XA 1SYFA 1EY8A 2PZWA 1SNOA 4KHVA 2PYKA 3SXHA 4E6IA 5IGGA 1KDCA 4WRDA 3D4WA 1A3VA 2QDBA 4ODGA 1NSNS 4K2KA 2F0JA 3MZ5A 2EYHA 4NP5A 4RKBA 3HZXA 3NQTA 4EQOA 5IGCA 2PZUA 3NK9A 5IGFA 2F0GA 1JORA 4QF4A 2EY1A 4ME5A 2OF1A 2PQEA 5CGKA 3NUCA 2EYJA 2F0PA 1JOKA 2F0VA 3D6CA 5CR3A 3TP5A 3LX0A 4LAAA 5C3WA 1KAAA 3MHBA 1STAA 3SR1A 5I6YA 1STGA 4R8NA 5JOBA 1EY9A 2RBMA 3T16A 5IOCA 1II3A 3BDLA 4OL7A 1SNMA 2F0MA 1TT2A 4KJOA 4B9WA 3EJIA 2EYMA 4J6HA 3ERQA 3SK5A 5I6WA 3QOLA 4N9TA 3SK8A 3V2TA 4KTAA 4N9PA 2WACA 3MXPA 5IIFA 4DF7A 5JAVA 2F0KA 5IODA 4S3SA 5J1ZA
chains in the Genus database with same CATH superfamily
2FFKB 4XIGS 4B3SL 1YJNA 2NWGA 1A2TA 2AKWB 3U4ZA 3HOZH 3RZOB 3NP8A 1Y69U 2AMCB 2M2LA 4K0KL 4DV6Q 1UEAB 1WD0A 2ZXRA 3CP0A 3MTSA 4IFDG 1BVSA 3I3CA 1N34L 2CQOA 4O0AA 1X3FA 2DJFC 3GTKB 2IJ0A 2JA8G 4KN7C 4BA1I 3J7YW 3E0JA 5E1FA 1Y1VB 4N8FA 1ZEQX 4HJ7A 4BBSB 4ME3A 1SEBD 1Y8PB 3H3VH 2PNHA 4HMIA 1PYSB 3GTJB 2Z8LA 4BBSG 4JV5Q 3CXCA 3S14H 1FL0A 1WI5A 2B2WC 3E9HA 2QEXA 4GKKL 1IZ6A 2JE6I 1NUCA 1GM5A 4QL5A 1HHVA 4H44C 4A3FG 4DV5Q 4A3EB 3TDQA 3OPOA 2NVYB 1IL2A 2A6HD 4MZ9A 5JPNC 3HOWB 2N8NA 3QJYA 5IYBH 5CV5A 1GHJA 4R4CA 4NDXA 1TS3A 2F3WA 1YJ9A 1SYEA 3HOWG 3GTOH 1OO9B 3KBGA 1P16A 5LL6X 4KV6A 1K8MA 2EYOA 2CCZA 2P5ZX 3H3VI 2JK8A 1EQVA 2F0FA 4IZ8A 2R92B 4ZRZA 2ZXPA 1JB7A 3MXNA 1RKNA 3TZDA 2EYPA 3M7GA 5BN5A 2R92G 1B44D 4LFAL 3ZYYX 1X54A 3EA6A 4A93G 4DR4L 2D5DA 1EY8A 2GVBA 2Z9HA 2PYKA 1EIYB 4DA2A 2SDFA 1IYVA 1F9RA 2Q8TA 1N32Q 2L12A 5CBEE 2UUCQ 2VQFQ 3DLLA 2CHBD 4LWCA 4A3FH 4A3BB 3BU2A 3S1NB 5CGKA 4B3RL 5BR8Q 1VQGA 1W3SA 2F0PA 1JOKA 1STEA 4A3BG 1IW7D 1MKHA 1EIHA 2PPBC 4P75A 2AUJD 4F87A 5LHY1 1HJPA 1I6VC 1UE6A 3P20A 1ONLA 2PMZB 1D5XC 4NKLA 1HNXQ 3BVZA 2WFWA 4IALA 1U9RA 1ESRA 1Q12A 4A3KB 2E8GA 5D3DA 4JI4L 3J80i 5J39A 4JCVE 4A93H 4IOAA 4R8IA 1HPCA 4A3KG 1RIPA 5CC4A 1TU2B 4J15A 3L3OC 3TP6A 1X3PA 2NVTB 3GTMB 5JJKA 2Y0SE 1F2MA 1RODA 1AZPA 1VQ4A 1H9SB 1HQMC 1HZBA 5C4XB 2WP8J 4IO9A 5M3FB 1RJTA 1DOMA 3FHWA 4JI5L 1O78A 1HUMA 5C4XG 1F9QA 4OX9L 3RN2A 5IYDG 5M3FG 4KHZA 5C44B 3RZDH 1WTXA 3J81i 4OHJA 4HTHA 1S40A 3CD6A 1EQRA 1L0YB 3PF5A 4GZYC 1QVCA 3J80E 3V05A 1NAPA 3K81C 4U68A 1PXUA 2MO0A 1SMYD 3I2ZA 3NBHB 4HR7B 3T1YQ 4PZ6A 3S15B 4YHHL 1XNRQ 5IT9L 4KY5A 4APVA 2L0CA 2YTYA 3FDTA 3U58A 4EQNA 1GUNA 2R7ZH 2JA6H 1EZ8A 3S1MH 5CV7A 3FVQA 4OO1G 3VR4A 5A35A 5JEAG 1UE7A 4MTKA 4G7ZC 2VZAA 4HJ8A 2K5HA 1LTSD 1EWCA 3F2CA 1U4RA 4LF8L 3PIOA 1N33L 2A19A 2HHHQ 1B50A 4H02A 3G6JB 1Q7YC 3RR5A 1CI3M 3RLOA 4A4IA 1Q82C 5JVH3 1XTDA 4LAAA 5GAGC 4HJAA 4JI7L 4JI2L 3RLFA 2G9HD 1FJGL 5J3BA 3BZCA 1TT2A 2MUYA 1L1OC 5ELOA 3SGIA 4HJ9A 1IBMQ 1CSPA 2A1AA 5LL6S 2RA4A 1D7QA 4DV7L 4KKTA 4JW0A 4DR1L 1U4LA 1GUTA 3A55A 3Q22A 1BCPC 2IT1A 2JP1A 3K6OA 5C3EB 1EY4A 1VQ5A 2K7VA 1TIID 2PI2E 5A2QE 4RA8A 5C3EG 4LK1C 2A6EC 3TSSA 5KEEA 1TWGH 4DR2Q 3HOXB 4DAYA 1C9OA 2K6AA 4GKJL 5JEAH 2XWBB 3W3AA 2K5NA 3A54A 1YJWA 5HURA 1U4MA 2E2HH 3F8TA 1PV4A 5ELFA 2WB1B 1YI2A 2IY5B 2K5QA 4GLVB 5LMUQ 1SROA 1B1ZA 4A3GH 5FLMG 4XT1B 1SXTA 1TY2A 3FP9A 4XDXA 3AQQA 3OW7A 2UXDQ 3DEPA 2KQ3A 4PZ8A 1GD7A 2SNSA 5E3FA 2BA0A 2NVXH 4YY3L 3S2DH 1KC8C 3ERSX 5C0XJ 1KDBA 1L1OB 1S5DD 3J80L 1XMOL 1S5BD 2QEJC 2QKIC 5IGEA 2ZM6L 2VQEQ 4J1MA 2CFMA 1ML0D 2RSNA 1BCPB 1A8VA 3D6WA 4BY7B 1MSHA 1K3RA 2R6GA 4PZ7A 1QNKA 4BY7G 1HR0W 3BVMA 5IGGA 3HKZB 3HFZB 4L63B 1X55A 4HIDA 2EYHA 2A68C 2PZUA 2JJQA 3NK9A 1HRJA 3HKZG 3PUXA 1XMQQ 4BA2I 1ZKOA 3NTHA 1CUKA 2UXBL 3JAMc 2B63H 2KA7A 3J81L 4X66L 2XN9C 4OXPA 2Q2UA 5C0XH 1II3A 1ZYRD 2IHEA 4OWTB 3VR2A 4B9WA 3NTKA 1YNJC 3QOLA 3DWPA 4KTAA 3A74A 1N8RC 1T5EA 4OIJA 3OW2A 1FNUA 5J1ZA 3OIQA 5JVG3 3L9AX 3MVVA 4FDBA 3NPPA 4HMJA 5KNBA 2JA5H 2SNMA 2OEOA 1F2YA 3CU7A 3HOUB 4HIOA 3FRPB 1CTMA 1KRTA 2D0OA 3M3YB 1ESFA 5IWAL 3HOUG 1WTHA 2F3IA 2ZJRA 1PMRA 2AQ2B 2OWOA 3M4YA 1JE4A 2N55A 3QOJA 5C0XI 1OXSC 1R4QB 2D2CC 3ULLA 5IYCG 2H1EA 3OMGA 4NXNL 2DNEA 5I9OA 4U673 1YNND 4BY1B 4NMZA 2EZVA 3KF6B 4JI1L 1HUNA 1A0IA 3PIO3 3S1QB 3PQIA 3T53B 1R9TB 3PO2H 2L11A 4PG3A 3BJUA 1CZWA 3VYUA 1E1OA 5KIXA 4B3MQ 1AEXA 1QWYA 4AYBG 2RHSB 1D1KA 4L5RC 3FPPA 1HZ9A 4K6DA 4FF1A 3D8GA 3TS2A 2R93B 5DNFA 1JJGA 1PTOD 2I5HA 5M5WH 1G2TA 1PRTC 2EYLA 4QIWE 1RHPA 3F2UA 3QIAA 4P74A 3S9WA 2R93G 4M1UB 3RLNA 3F2BA 5DLQE 2ATWA 1B9MA 1VS0A 2VUMG 3KK7A 4DXGA 3G6EA 5C5LA 3CQZB 4KLKA 3CCUA 4ID6A 4LF7L 4DR6L 2HQLA 1G91A 2UXCQ 3KDFA 3L7ZC 4DR3Q 4LF6Q 1PA6A 5ELDA 5FO7B 2KEDA 4KMUC 1EU4A 1XXGA 3K80C 3L2PA 4Y7NB 3T1HQ 3VDYA 3D4WA 1Q8IA 1E2ZA 3CCRA 3RMHA 2X6LA 1QZGA 4N8X1 1VQEA 2ZJQA 3M4OB 5FLXE 5FLXc 4HCEA 4WFN3 5LMNQ 1JMCA 2NYZD 3LX0A 4DR7Q 2RDHA 5I6YA 1GUWA 1STGA 1S5FD 3A7AB 3CCEA 1VQ9A 4A3DG 1WTVA 1YHBA 2TSSA 5CORA 1L2FA 2QDLA 5M5XH 1Q86C 1PYWD 5C4JH 3TREA 4EVOA 2FJ2A 4C3JG 4TRDA 1AE3A 1PH7A 4B3SQ 2Z6KA 2KHIA 4UP7A 1PRTB 2JQOA 1HA6A 1YZ6A 3SHLA 3GTPB 1NNXA 3FMCA 3CKIB 4JYAL 4K0KQ 4A3IH 3H0GB 1MHWC 2DNCA 4LF5L 1PVOA 2J4XA 3RN5A 2A74C 3OWFA 3PUYA 3GO5A 1N34Q 5KYLA 4IUTA 4FO2A 1GUGA 2ICEC 4CKCA 1JQYD 2C9OA 4UPAA 4PNYA 3FKIB 3KLSX 4ZAIA 4ZK9B 3S16B 1DYQA 4X3KA 4JBKA 3DMUA 1EY6A 4PMBA 4MHEA 1QVGA 4MTNA 4ABNA 1K8GA 2EYFA 3UDIA 2CKZB 5NUCA 3FKIG 1CQFA 2OTLA 3RUZA 3B6YA 3H91A 2HIXA 2UUBL 3S1RH 4GKKQ 4C2MB 3DM3A 4A3DH 2A5HA 2KCCA 4F88A 5T1GA 3IAYA 2E2IB 5CV6A 5J22A 3VA5A 1SE2A 1Q1BA 4OEMB 3H3VC 1E2WA 3CHBD 4F7XA 2WINB 5EGTA 2B2TC 1Y14B 4LMQD 3LGJA 1EWIA 1PH4A 4R1JA 4HCSA 5BN4A 4C3HB 1EYDA 4YWLA 1HTLD 3I4MH 2CH4A 2N88A 1WFQA 1GO3E 3A5UA 2X6GA 5FO9B 5IP7G 4C3HG 2NBFA 1XNQL 4LFAQ 4DR4Q 2PZWA 2EJFC 1PTOF 2E2JB 4XQQA 1NMFA 4EQ5A 5IGCA 2Q8IB 2KCTA 4ME5A 2KBNA 1Y1WG 4B3RQ 3NUCA 1TWFH 3HOZB 3C46A 3TBIB 2F0VA 4O42A 4ZLTF 4BWGB 3URYA 2D9UA 4LFBL 2FMCA 3AYHB 4JK1C 4JI0Q 1H95A 1HFGA 1KNEA 1S3OA 5I2YA 4FP5D 4LF4L 2A69D 2NZOA 4K5VA 3KFUA 2B2WA 4IQZA 1BO0A 3R3OA 4IPHA 1M4VA 1FNVA 3ND9A 2ZTDA 4YCWA 4JI8L 4JI4Q 3S14B 3OTOL 1TR5A 3HKSA 3PMFA 4RGTA 4ZUJA 2AQ1B 4WJWA 1EOTA 1QG7A 4CBVA 2NZHA 4C3IH 1TWCH 1SJHD 2H4OA 1FGBD 3L0OA 1MD2D 3F1ZA 4GN4B 2WV6D 1BBXC 2B2VC 3GTQH 1Y1WH 2ZXOA 1T9HA 4LUOA 5JPMC 3GTOB 4GLAC 5IYBG 3K59A 1YITA 1H9SA 2CW0D 1I94L 2EXZA 4JI5Q 4G7OC 4DGZA 4Y52H 5KNDA 1F9PA 4OX9Q 1QB5D 3R93A 1LT4D 2EVBA 2JA8B 4DFAA 1IKLA 3I4NH 5JJIA 3TEHB 3CCSA 5CYUA 2EJGC 5JJZA 2R3ZA 1B9NA 4MNOA 4C1NI 2F0HA 4IPDA 3UE1A 2SEBD 3BVGA 1SMXA 1CKNB 5FJ8H 4IUPA 2HDLA 5D14A 4YHHQ 5EKIA 2KCMA 1CT1D 3D3RA 3NBHA 4KN4C 1Y8OB 1K0SA 4A3FB 1HQRD 4DV1Q 4ZYSA 3QB3A 1C0AA 1WJJA 4RMFA 5COYA 2IL8A 1WTWA 4B08A 1PH6A 1Y8NB 2O5IC 3KOJA 5D65A 4POFA 3UDFA 4EQOA 1PFBA 3HZXA 2DUDA 4LF8Q 2BE5D 1N33Q 3W5OA 1HA5A 1J5EL 4XXEA 2YU9H 4CDEC 1TWAH 2AWOA 2NN6I 5EQ0A 2KHJA 4A93B 1PFMA 2EJMA 4JI2Q 4JI7Q 1TWHH 1FJGQ 3I56A 4O1NA 1IXRA 4J6HA 3VYRA 5I6WA 2Z0SA 2WACA 2XRQD 2EPBA 4DV7Q 5C5MA 4DR1Q 3M4QA 1KDAA 1WYDA 1XX8A 2EOTA 4TVAB 3DHQA 2KENA 2CH4W 3LNNA 1M1KC 4GS3A 1K73C 4DUYL 1LTAD 2ALYB 2UU9L 4ZKCB 3MA2B 2F0LA 1QNUA 1N9WA 1JCKB 1MI2A 3C1EA 4GKJQ 1K8OA 4RH6A 4FYDA 2B2UC 4J8QA 4EQPA 2ASBA 1GVPA 2GA4B 2PQAB 4LUVA 3CF5A 4NPSA 4DV0L 1WOCA 3BZKA 2BH2A 1FVIA 2Q2HA 2L55A 2MJ8A 5M3MH 4IFDI 4A3JG 4A3CG 2HT1A 4NB3A 4JC0A 3TP8A 4A3EH 1VQCA 3AU7A 4UY8C 4XTCS 2JA6B 3GD7A 3S1MB 3EROA 4G4KA 2R7ZG 1C48A 4XYQA 2PNRC 2KCNA 2JA6G 1BOSA 4YY3Q 5HGQA 2RCFA 1PH1A 1FD7D 2XGTA 4LW1A 3V96A 2F0EA 1XMOQ 2ZM6Q 4FXGC 1SR3A 3R2IA 1L1OA 4X3TA 5EPKA 1RTNA 4HN7A 1JOQA 5KRUA 1R4PB 4KD4A 3KYHC 2EE1A 1G6ZA 4KHVA 3SXHA 1MSGA 4CJ0B 3NWSA 2GVAA 2I46A 2IX0A 4ODGA 1JJCB 4A3JH 4CDDC 3IRBA 4A3CH 4YCUA 1TS2A 4CDCC 1MJCA 4ILWA 4X62L 2JEBI 1U5KA 4HEDA 3E6ZX 1S72A 2PCFB 2UXBQ 3BS1A 2B3GA 5AJ3L 2N49A 4X66Q 1WD1A 1EIGA 2RBMA 4AQYL 1LACA 5JAVA 4FF3A 2BA1A 2RSOA 2YYZA 1GUSA 3QWNA 5ELEA 3U50C 1I4XA 2E2HB 1DOKA 5C6AA 1SYDA 2WAQE 1ILPA 3IL8A 4YIJA 4A3GB 3MC0B 3ITPA 4QQBX 1JICA 3GTLH 1V9PA 5IWAQ 4Q0FA 4L5SA 3M85A 1QVFA 3M4PA 3KLSA 3PCOB 4A3GG 2IW3A 1EU3A 1QCBD 2LFNA 4I65A 4L6TB 3KUPA 4LJZC 1LT6D 1SJED 2OXPA 4DK1A 3CCMA 4HJ5A 5H1SE 2BCOA 2F0TA 4JBJA 2RKSA 1PH5A 4LNQA 2NVXB 2FINB 4NXNQ 1E3PA 2PW5A 3S2DB 5LMNW 4JI1Q 1HTPA 4QB4A 2D62A 4IPGA 1U0LA 1SLJA 4TQUS 4ZUIA 1SAPA 1PH9A 4P71A 4K5XA 5C44H 3KF6A 4X65L 4DNTB 3TRZA 3VR6A 1TS5A 2WKDA 1F2ZA 2K14A 5CV8A 3PO3H 3TN2A 1VQDA 2ZTCA 4R4OA 1YVCA 1IBKL 1ZXTA 1ET6A 4IUUA 3S2HH 4R4IA 1DCZA 5FO8B 4P72A 1VCIA 4P73A 3NHHA 3R8BA 5ELBA 3J81j 2KHSA 3H15A 5BR8L 1HH2P 4K2LA 1E0BA 1LLRD 4LF7Q 2E75C 4DR6Q 1GJXA 2B63B 1EFID 1IYJB 2MHVA 1PZID 1KD1C 2ID0A 1LTTD 1S4ZA 4FVMA 2VB3X 2B63G 1H9RA 2L15A 1ZYRC 3RD4A 5C0XG 1HNXL 1B4OA 3MZ5A 3VYTA 1LT5D 1O7IA 4RHRA 3A0JA 4JBMA 3HGBA 2JA5B 4RCNA 2F4VL 2PQEA 3J7A5 1NE3A 3J7AV 1B53A 2JA5G 5CR3A 3HOVH 3D6CA 3BZDB 1E2VA 2TMPA 4GOPC 1GHKA 1EFWA 5CBAE 3PIPA 5IIFA 4DR5L 1RDPD 3WWVA 3CCJA 2ES2A 4B3TL 1JWSD 2RQXA 1SNDA 4NW2A 1VQHA 2AQ3B 4JYAQ 3JAME 3C2PA 1FYCA 1C8CA 4LF5Q 1CKMA 2EY6A 4HIKA 3PO2G 2K01A 3K7AH 2EQSA 1SYBA 2DY8A 3ND8A 5M5WB 4XYOA 1JT8A 4X64L 3H6MA 5GROA 1ENCA 1EY7A 1K83B 2NUCA 1K8AC 3LWEA 1YNXA 1QZHA 5FK9C 4BBRH 1XYIA 2Z4HA 1B70B 3WOEA 2UUBQ 1I6HH 2FHTA 1XPOA 3N6RA 1EY5A 1VQJA 3OHXC 4FXKC 1O7ZA 1LTBD 3NXWA 4KY6A 5EKKA 5E4WC 5A2QL 3Q8DA 1HZAA 1WCMH 2J0TD 1DZ1A 4GOPB 5IE8A 1AP0A 4CJ1B 1XPUA 5DEHA 3MEHA 5ISRA 1N36L 1B8AA 1ENFA 5GQOA 3M7NA 1IBLL 4AYBB 4IOCA 1WTOA 2JEAI 2IX3A 2IHFA 2PZTA 1XPRA 3STBC 4IUNA 2CQAA 1STBA 3J7ZC 2NB0A 3GV6A 4K14A 2K5DA 1XNQQ 1ASZA 4A3MH 1SYFA 2A68D 2PMZE 4WRDA 1X56A 3AFPA 2VUMB 2RHQB 1SFOH 4K2KA 2F0JA 3ICEA 1VQNA 5M5XB 2EDGA 2HD3A 1EEID 5C4JB 4JG2A 3VR3A 3MFYA 3NE5B 3QO2A 2JA7H 1Q1EA 3SE0A 1JJ2A 4H0LC 3MHBA 3T16A 4DK6C 4LFBQ 2F0MA 2EYMA 4A3IG 1LV9A 3FPUB 1J6QA 2F03A 3MXPA 2G5DA 2LSSA 4LF4Q 1LTLA 1H9MA 4YWKA 1X3GA 3A8KE 1BR9A 3OMCA 1E7ZA 2CWPA 4JI8Q 1WTRA 5KYIA 1ASYA 5C4HA 3OTOQ 2JXMB 2UUAQ 3S1RB 3HP3A 4IJLA 3NQIA 3DUZA 4A3DB 1ILQA 4DAMA 1STYA 2B2TA 3JAML 5FKAC 1HNZL 2MO1A 2AUKA 2K32A 4C3JB 1NTGA 2HCIA 4I7AA 1GUOA 1CA5A 3S17H 1BCPF 3VA7A 1JR0D 1LT3D 1F9SA 1PTOH 2VQEL 1LUZA 1STHA 3JC66 3K7UC 1I94Q 3NSWA 2Z6BA 1G291 1PRTD 3EFXD 3I4MB 1VQ6A 1KIXA 2NVQH 1TKWB 4WJ4A 3I4MG 1A3TA 3PIP3 2Y0SB 4AIMA 2JN4A 1SBBB 1VQFA 2O4XA 2VB2X 3X3NA 1I50H 1EIFA 3CPFA 1Z6HA 2BDOA 1BBUA 2Y0SG 1MBYA 1RCVD 1KABA 4RKLA 3ONAB 1A15A 2LMCB 3OSOA 1X3QA 3T13A 1CKNA 3CC4A 1KNAA 1PH2A 3FEWX 1BNZA 4TSSA 5EPJA 1A3UA 4G7HC 4KHPL 4PMCA 4WORA 1IYUA 3AMUA 1NCVA 1SSOA 4ZCKA 2HIVA 1EUJA 5I2XA 3CC7A 2BOSA 1S5CD 2EIFA 1TXYA 1PDQA 2F4IA 2R7FA 2QW7A 2K03A 1VQBA 3DEOA 2OF1A 2KVMA 3KLRA 4X3SA 3UI2A 4RCOA 1J5EQ 3G4SA 1GXDC 1NY4A 2MNAA 2K5WA 1LTRD 3UDGA 3CCLA 2B2VA 2LS01 1SNMA 4DK3C 4KJOA 3D31A 2B8GA 4N9TA 4C3IB 3V2TA 1TWCB 4DF7A 3MAQA 2F0KA 2WB1E 1I4GA 1XWEA 4LUZA 1VQMA 4C3IG 3GTQB 1Y1WB 4H13C 4OELB 3KF8B 3Q6SA 4IUQA 3I4OA 1HNWL 1AFPA 4B3ML 4EGVA 4RAUC 4DUYQ 2UU9Q 5K36H 4DV4L 1CQVA 2NZ1D 4KK7A 1DM0B 3WDNA 5FLXL 1S5ED 3F2DA 4JVZA 2N78A 1ICFB 3P1HA 3S24A 5C4ZA 4TKOB 4NXML 1GKHA 3GTGH 5EAYA 4DV0Q 3I4NG 1V1PB 1OXXK 4QGUA 2HCCA 5IGBA 4I7ZC 2PQAA 2VW9A 2XVSA 2F0QA 4Q5VA 1C4QA 4CKBA 2QGQA 1H9JA 3IFDA 5CV4A 1NBWA 3A8JE 1VMPA 5FJ8G 1VQKA 4DR3L 1TY0A 3E9IA 3P7JA 1SNQA 1O7LA 3KBXA 3Q24A 1UAPA 5KNCA 2I0QA 2J7ZA 2JA9A 1L0XB 1YEZA 1D2BA 3HKZE 4GLXA 1V8QA 3ZJYC 1BQQT 3OOCA 3W1BA 2A6HC 4OGQC 2L5TA 4DV3L 4OONA 1B2TA 1E22A 2F1MA 1WTQA 2M00A 2AWNA 1G2SA 4KD3A 4JI3L 2B2YC 1M8AA 4DNRB 4JOIC 2B39A 1IHZA 5ELCA 4DAPA 2YU9B 4DN4M 3O13A 3HOYG 1UEBA 3TP7A 4GNXC 3CCQA 4FXDA 5IGDA 4IURA 1TWHB 1P8LA 1PRTF 5DM73 2QF7A 1A63A 1KHIA 1YIJA 3M9BA 2KOLA 3X3MA 1VDZA 2EY1A 3NTIA 4X62Q 2GN5A 3E0EA 5M5YH 2B2UA 5C3WA 2NN6H 1PFNA 1A62A 1WTPA 3NEMA 1YHAA 1JE5A 4OWXB 4IFDJ 3T4AC 1STAA 5AJ3Q 4AQYQ 1IW7C 4DKAC 5GAHC 3Q23A 4N9PA 1M90C 4PMWA 3CW2C 5IODA 2RF4A 1Q81C 2EY2A 4AYBE 2QCPX 2K75A 4PQXA 4R9WA 1Y1VG 4JI6L 1U4PA 2VS1A 3HOYH 2FMMA 5M3MB 3G7LA 2E5LL 2KECA 4EX5A 2RCNA 1T5XD 2K5VA 5M3MG 1JOOA 1I3QH 3AFQA 1X9NA 2B8FA 1K28A 1VMCA 1AN8A 2OCEA 3HG9A 4A3EG 3I70A 5IT9E 5IT9c 1OXUA 2MP1A 3BYTB 4GNXB 1HR0L 1LTGD 3OYYA 1LTID 3RZOH 2EY5A 4IFDH 3EQLC 1QUQB 1DD2A 5EKLA 3E5SA 2HDMA 3N52A 2JA8H 4X65Q 3K5MA 3PUZA 2MQHA 4L5QA 2FXQA 1BXTA 3GTKH 2XSCA 2RVLA 3RZDB 1IBKQ 1Y1VH 4LF9L 1CHQD 1SDFA 1TQOA 2F3VA 2SOBA 4BBSH 4M8AA 2QILA 1J8IA 4XQJA 4A3JB 3HEJA 2K4KA 1O7YA 3GTJH 4LFCL 3IFTA 3BYYB 1D8LA 1SMYC 2M9VA 2Q2TA 1Z47A 1A2UA 3P75A 2NVYH 2E2DC 1PZJD 1VQLA 4JI0L 3HOWH 4DV2L 2R7ZB 4K8IA 1QJOA 2H5XA 5K5PA 4DUZL 1QILA 1X32A 1D1IA 4QIWB 4KKUA 1VF5C 5ELNA 1FGUA 3CC2A 3GDEA 4QF4A 3TZUA 5IY0A 2F4VQ 2R92H 2XTIA 3GTLB 3CPWA 3DM1A 3SR1A 3CMAA 5E4XA 3A7LA 3I90A 3T51B 3I55A 3MEFA 4WJ3M 1EL0A 2VNUD 1JC7A 4DR5Q 1E1TA 4UHVA 1UNSA 4V0BA 4KY7A 4B3TQ 4A3BH 3S1NH 1Q3LA 1B7YB 1AW7A 2A73B 4X6AH 4DV6L 2MPMA 1MJEA 1KXLA 4Z9CB 3KJPA 5FOBB 1JWUD 3MXGA 3I4LA 3PUVA 1TWGB 1RD9D 1I4RA 1DONA 5C44G 1VQ7A 1CKOA 4RGOS 3PO3B 3J80c 2NTSA 3KJOA 2BH8A 3PGZA 4GN3B 4X64Q 3S2HB 2YTXA 5I4DA 2Z4IA 3PO3G 4OIKA 4A3KH 2ZT9C 3D4RA 4DK0A 4JV5L 4DV1L 2YV5A 5GAEC 3U9SA 1DJRD 3K5LA 1O80A 2DGYA 2F0WA 2IPKD 2PO4A 4DV5L 2NVTH 1UE5A 3GTMH 2ICIA 1YHQA 4RFBA 2CWAA 2F0OA 4RGNA 3MFGA 1W2BA 4FNFA 3SK4A 4UP9A 5JEAJ 2ZTEA 5GADC 4IPCA 2DN8A 4IJHA 1HFNA 1BUVT 1KLGD 1SNCA 2I5MX 5C4XH 2WKCA 1ET9A 1DGSA 2DY7A 3J81E 3J81c 1LO5D 5M3FH 1I4HA 3MXNB 5IYDH 2HQEA 4F8MA 1N36Q 1K0RA 3A5ZB 1HXYD 1HZCA 4GOPA 1IBLQ 2L4NA 3GV3A 3TQYA 2F0NA 2F0IA 1QE6A 1UWVA 3HOVB 4HSPA 2A8VA 1FR3A 4K8JA 1Q46A 4XQNA 1EOVA 3HOVG 4E6IA 2JSOA 1Q8KA 1K9MC 4AH6A 2AHOB 3I73A 3NQTA 5IGFA 4P2CB 1N32L 1ICWA 3S15H 3A56A 1LYLA 1CA6A 2UUCL 5CMDA 2VQFL 1DOLA 4RHSA 2K50A 1I5FA 4OO1H 2O5JC 1EQTA 2LY7A 2K52A 2O2LD 3K5OA 3K0XA 1BBWA 3HOXG 4QUCA 1BKBA 3VR5A 1D6EC 3K7AB 1RTOA 1Q90A 1NR4A 5BN3A 1AE2A 3JAMi 1EQQA 3AB9A 2KEEA 2MFIA 3NWTA 2WB1G 1STNA 2RDFA 2OQ0A 4BBRB 2ZJPA 3CMEA 4MN3A 2VXWA 3A8IE 5EJWA 2Z1CA 1RL2A 4OO1I 4UAIA 1I6HB 3I72A 4BBRG 3BDCA 3K57A 3EIVA 2G9DA 4YCVA 4IN3A 3ULJA 5M9OA 1WVLA 3WOFA 1JB3A 1BCPD 1H9KA 4ZQ3A 4CJ2C 1WCMB 1HNZQ 5AFWA 5C3EH 2E74C 1EYGA 3NENA 3SK6A 1IL8A 2L9HA 1WCMG 2A6ED 3SDZA 3TMEA 1YNNC 1L0WA 3U4VA 1HCZA 1I4QA 3HOXH 3OWEB 3PO2B 2K28A 1SE3A 2F0SA 3I91A 2Q8RE 2NTTA 1VF7A 1EYAA 1KTKA 2OTJA 3HRZC 5F2DA 1PHJA 1GOZA 4A3MB 1OXVA 1PTOC 5FLMH 2XNAC 3QG1A 4RWSC 3T1YL 1D5ZC 1SFOB 4A3MG 3DXJC 5CV9A 1XNRL 2VL6A 4KKSA 1CZGA 4R4QA 4RGMA 1V1OA 2JA7B 1PZKD 2VY3A 3TS0A 1Z7TA 1NR2A 1VQPA 2XWJB 2JA7G 4KHPQ 1V43A 2LKVA 3SEBA 1UE1A 4KI0A 1X6OA 4YWMA 1A3VA 4BS9A 2D0PA 2QDBA 1NSNS 2QA4A 1F2LA 2F0GA 1MIUA 2YTVA 3K58A 1AZQA 2HHHL 1PLFA 3G71A 4BY7H 1KAWA 2LXJA 3DWQA 1KAAA 1K3BC 2IX1A 1EWHA 5DM63 3BDLA 3BG3A 4A3LG 4C1NK 2MGSA 1IBML 3EJIA 2RDGA 3SK5A 1TS4A 1EEFD 3SK8A 4QUFA 2HUGA 4S3SA 3LWUA 3IKJA 3C3LA 2F52A 3RNUA 3EVQA 3I8ZA 1E24A 1NMGA 5C3XA 3ULPA 1CSQA 4DAYB 3S17B 3PV0A 3D0FA 4BY1G 1PTOB 4V190 4A75A 1HNWQ 5KGUA 3AEVA 4DR2L 4R4TA 3C1FA 3CRKC 3E3XA 4DV4Q 3KF8A 3UE0A 1DXMA 4A3IB 1YNJD 5TSSA 3CRLC 5IP9G 1Z9FA 1K83H 2NVQB 3NELA 1X3EA 2XIWA 1B3QA 4DPGA 4NXMQ 1A6XA 2XRSD 2X69A 3HOUH 4IUVA 1EY0A 1I50B 2IWHA 5DAUA 5LMUL 4QCLA 1OXTA 3R2TA 1UUPA 1JWMD 3M3YH 4UDUC 1CFMA 4JBWA 5E7NA 1V1PA 3T56B 3QR8A 4ZKBB 4A3LH 4DU9A 5IYCH 2UXDL 1YBYA 3D4DA 4L5TA 3OIPA 2F0UA 2PI2A 1SYGA 2OQKA 3I7FA 3U9OA 4MIUA 2CVRA 4QMGA 1BF4A 4GN5A 4BY1H 5HY6A 2KUMA 4DV3Q 4POGA 5D3IB 2F0DA 3S1QH 1R9TH 4JI3Q 5I9PA 4DNIA 1LM0A 3STBD 2K33A 2ENBA 5IP9H 2R93H 1SYCA 1W6KA 3H94A 2DJGC 5G3LD 5HGTA 1CHPD 3CCVA 3H09A 2Q2IA 4B9XA 3Q0AA 2VUMH 1SNOA 2EXDA 4C56C 4L8JA 1TVXA 1VQ8A 4RKBA 4NP5A 4A76A 4FF4A 1XMQL 3HS0C 3CQZH 1JORA 1B3AA 3CAMA 5EBDA 5EPLA 1CK1A 3W2DA 2E76C 1QOHA 1XJVA 2EYJA 1X65A 3GQBA 4RG1A 2KJXA 1IKMA 1TWFB 4CDFC 5JOBA 1EY9A 3H0GG 4HIMA 4UP8A 3G48A 4HSVA 4Y7NH 1G6PA 5L37A 5K36G 1AH9A 4DAVA 3EN2A 1KQSA 2I07B 1F77A 1I4PA 3GTGB 1W6JA 3M4OH 1EYCA 2A69C 1VQAA 4JI6Q 2OT2A 4KJNA 2E5LQ 1SN8A 4H7BA 5T1IA 1SNPA 1VQIA 3J7AF 1J9OA 3EBEA 4C3JH 2B2YA 4CHTB 3BDOA 1CM9A 2V1CC 4JOIA 3KLWA 2JYOA 4HAEA 2N3SA 4K5WA 3GTPH 1HR0Q 3ER0A 4OWWB 4BXXG 3MXUA 2C5CA 2C35B 1KL9A 4QY7A 3W1GA 2PW7A 3PUWA 4G57A 4GNXA 3H0GH 2WAQB 1KRSA 2Z6KC 4JPBW 3SVMA 2CW0C 4O2DA 2WAQG 3K0YA 1QUQA 1KLUD 1SRUA 3VYSA 2B29A 3I4NB 1VQOA 3FKIH 3S16H 2I5LX 2K05A 3MWYW 1OTCA 4LF9Q 2V4DA 1PYBA 4LFCQ 3KDFB 1ENAA 4CKEA 4ULLA 5JJLA 1NJIC 4QJFA 4C2MH 1EZ6A 1SE8A 2UXCL 3UDXA 2L1BA 1C7YA 5M5YB 3NBIA 3HOZG 4FF2A 2K1BA 2E2IH 4DXFA 1PFSA 4LF6L 1RF2D 3DWAA 4DV2Q 1G8ZD 3K8AA 4DUZQ 3T1HL 2K04A 2NN6G 1KDCA 4BXXH 3PSIA 2WIIB 1PH8A 1V1QA 1G51A 4PV1C 2R61A 1MGSA 2LXKA 2BDNA 5IP7H 4XT3B 5LMNL 4C3HH 3HOYB 3GP7A 2BE5C 5EBCA 2UUAL 3TP5A 4DR7L 1SE4A 1PH3A 1BDOA 1FNWA 4ALPA 1LABA 1TWAB 4R8NA 5IOCA 1I3QB 4CGYB 4OL7A 2R7DA 3ERQA 1D5MC 3PF4A 5G3LF 4K6LA 2E2JH 3K5NA 1XTCD 4X3UA
chains in the Genus database with same CATH topology
2FFKB 4XIGS 2NWGA 1A2TA 3RZOB 3NP8A 1Y69U 2M2LA 1UEAB 1WD0A 2ZXRA 3MTSA 4IFDG 3I3CA 3GTKB 2IJ0A 4KN7C 4BA1I 3J7YW 3E0JA 5E1FA 1Y1VB 1ZEQX 4BBSB 1SEBD 1Y8PB 4HMIA 3GTJB 2Z8LA 2B2WC 2JE6I 1NUCA 1HHVA 4H44C 4A3EB 3TDQA 3OPOA 2NVYB 2A6HD 5JPNC 3HOWB 3QJYA 5CV5A 1GHJA 4NDXA 1TS3A 2F3WA 1SYEA 1OO9B 3KBGA 5LL6X 4KV6A 1K8MA 2EYOA 1EQVA 2F0FA 4IZ8A 2R92B 4ZRZA 2ZXPA 3MXNA 1RKNA 3TZDA 2EYPA 3M7GA 5BN5A 1B44D 3ZYYX 3EA6A 2D5DA 1EY8A 2PYKA 4DA2A 2SDFA 1IYVA 1F9RA 2Q8TA 2L12A 5CBEE 2CHBD 4A3BB 3S1NB 5CGKA 2F0PA 1JOKA 1STEA 1IW7D 1EIHA 2PPBC 4F87A 2AUJD 5LHY1 1I6VC 3P20A 1ONLA 2PMZB 1D5XC 4NKLA 3BVZA 4IALA 1U9RA 1ESRA 1Q12A 4A3KB 5D3DA 5J39A 4R8IA 1HPCA 5CC4A 1TU2B 3L3OC 3TP6A 1X3PA 2NVTB 3GTMB 1F2MA 1RODA 1AZPA 1H9SB 1HQMC 5C4XB 2WP8J 5M3FB 1RJTA 1DOMA 1O78A 1HUMA 1F9QA 4KHZA 5C44B 1WTXA 4OHJA 4HTHA 1L0YB 4GZYC 3J80E 3V05A 1NAPA 4U68A 1PXUA 1SMYD 4HR7B 3S15B 5IT9L 4KY5A 2L0CA 3FDTA 4EQNA 1GUNA 1EZ8A 5CV7A 3FVQA 4OO1G 3VR4A 5A35A 5JEAG 4G7ZC 1LTSD 1EWCA 1U4RA 1B50A 3G6JB 1CI3M 5JVH3 4LAAA 3RLFA 2G9HD 1TT2A 2MUYA 5LL6S 2RA4A 4KKTA 1U4LA 1GUTA 3A55A 3Q22A 1BCPC 2IT1A 2JP1A 3K6OA 5C3EB 1EY4A 2K7VA 1TIID 5A2QE 4RA8A 4LK1C 2A6EC 3TSSA 5KEEA 3HOXB 4DAYA 2K6AA 5JEAH 2XWBB 3W3AA 3A54A 5HURA 1U4MA 5ELFA 2WB1B 2K5QA 1B1ZA 4XT1B 1SXTA 1TY2A 4XDXA 3OW7A 3DEPA 2KQ3A 2SNSA 5E3FA 2BA0A 5C0XJ 1KDBA 1S5DD 3J80L 1S5BD 2QEJC 2QKIC 5IGEA 4J1MA 1ML0D 2RSNA 1BCPB 3D6WA 4BY7B 1MSHA 2R6GA 1QNKA 3BVMA 5IGGA 3HKZB 4L63B 2EYHA 2A68C 2PZUA 3NK9A 1HRJA 3PUXA 4BA2I 1ZKOA 3NTHA 2KA7A 3J81L 2XN9C 5C0XH 1II3A 1ZYRD 3VR2A 4B9WA 3NTKA 1YNJC 3QOLA 3DWPA 4KTAA 1T5EA 4OIJA 1FNUA 5J1ZA 3OIQA 5JVG3 3L9AX 3MVVA 3NPPA 4HMJA 5KNBA 2SNMA 2OEOA 1F2YA 3CU7A 3HOUB 3FRPB 1CTMA 3M3YB 1ESFA 1PMRA 2AQ2B 3M4YA 1JE4A 2N55A 3QOJA 5C0XI 1OXSC 1R4QB 2D2CC 2H1EA 3OMGA 2DNEA 5I9OA 4U673 1YNND 4BY1B 4NMZA 2EZVA 1HUNA 3PIO3 3S1QB 3T53B 1R9TB 2L11A 1CZWA 3VYUA 5KIXA 1AEXA 1QWYA 1D1KA 3FPPA 4K6DA 4FF1A 3D8GA 2R93B 5DNFA 1PTOD 1G2TA 1PRTC 2EYLA 1RHPA 3F2UA 3QIAA 3S9WA 4M1UB 1B9MA 3KK7A 4DXGA 5C5LA 3CQZB 4ID6A 1G91A 3L7ZC 5ELDA 5FO7B 2KEDA 4KMUC 1EU4A 1XXGA 4Y7NB 3D4WA 1Q8IA 1E2ZA 3RMHA 2X6LA 3M4OB 5FLXE 4HCEA 4WFN3 2NYZD 3LX0A 2RDHA 5I6YA 1GUWA 1STGA 1S5FD 3A7AB 1WTVA 2TSSA 5CORA 1PYWD 4EVOA 2FJ2A 4C3JG 4TRDA 1PRTB 1HA6A 3SHLA 3GTPB 3FMCA 3CKIB 3H0GB 2DNCA 2J4XA 2A74C 3OWFA 3PUYA 3GO5A 5KYLA 4IUTA 4FO2A 1GUGA 2ICEC 4CKCA 1JQYD 2C9OA 4PNYA 3FKIB 3KLSX 4ZAIA 4ZK9B 3S16B 1DYQA 4X3KA 3DMUA 1EY6A 4PMBA 4MHEA 4ABNA 2EYFA 5NUCA 1CQFA 3RUZA 3H91A 4C2MB 2A5HA 2KCCA 4F88A 5T1GA 3IAYA 2E2IB 5CV6A 5J22A 3VA5A 1SE2A 1Q1BA 3H3VC 1E2WA 3CHBD 4F7XA 2WINB 5EGTA 2B2TC 4LMQD 4HCSA 5BN4A 4C3HB 1EYDA 1HTLD 2N88A 2X6GA 5FO9B 4C3HG 2NBFA 2PZWA 2EJFC 1PTOF 2E2JB 4XQQA 5IGCA 2Q8IB 4ME5A 3NUCA 3HOZB 3C46A 3TBIB 2F0VA 4O42A 4ZLTF 4BWGB 3URYA 2D9UA 2FMCA 4JK1C 1HFGA 1KNEA 5I2YA 4FP5D 2A69D 4K5VA 2B2WA 4IQZA 1BO0A 3R3OA 1M4VA 1FNVA 3ND9A 3S14B 1TR5A 4RGTA 3PMFA 4ZUJA 2AQ1B 4WJWA 1EOTA 1QG7A 4CBVA 1SJHD 2H4OA 1FGBD 1MD2D 2WV6D 1BBXC 2B2VC 2ZXOA 5JPMC 3GTOB 3K59A 1H9SA 2CW0D 2EXZA 4G7OC 4DGZA 5KNDA 1F9PA 1QB5D 3R93A 1LT4D 2EVBA 2JA8B 4DFAA 1IKLA 5CYUA 2EJGC 5JJZA 2R3ZA 1B9NA 4C1NI 2F0HA 2SEBD 3BVGA 4IUPA 2HDLA 5D14A 5EKIA 1CT1D 3D3RA 3NBHA 4KN4C 1Y8OB 4A3FB 1HQRD 4ZYSA 3QB3A 5COYA 2IL8A 1WTWA 4B08A 1Y8NB 2O5IC 5D65A 4EQOA 1PFBA 3HZXA 2BE5D 1HA5A 4XXEA 2AWOA 2NN6I 5EQ0A 4A93B 1PFMA 2EJMA 4O1NA 4J6HA 3VYRA 5I6WA 2WACA 2XRQD 2EPBA 5C5MA 1KDAA 1XX8A 2EOTA 3DHQA 3LNNA 1LTAD 4ZKCB 3MA2B 2F0LA 1QNUA 1K8OA 1JCKB 1MI2A 3C1EA 4RH6A 4FYDA 2B2UC 4J8QA 4EQPA 2GA4B 2L55A 2MJ8A 4IFDI 3TP8A 3AU7A 4XTCS 2JA6B 3GD7A 3S1MB 3EROA 4G4KA 1C48A 4XYQA 2PNRC 2KCNA 1BOSA 1FD7D 3V96A 2F0EA 4FXGC 3R2IA 4X3TA 5EPKA 1RTNA 4HN7A 1JOQA 5KRUA 1R4PB 4KD4A 2EE1A 1G6ZA 4KHVA 3SXHA 1MSGA 4CJ0B 3NWSA 2I46A 2IX0A 4ODGA 1TS2A 4ILWA 2JEBI 4HEDA 3E6ZX 2PCFB 3BS1A 1WD1A 1EIGA 2RBMA 1LACA 5JAVA 4FF3A 2BA1A 2RSOA 2YYZA 1GUSA 3QWNA 5ELEA 1I4XA 2E2HB 1DOKA 5C6AA 1SYDA 1ILPA 3IL8A 4YIJA 4A3GB 3MC0B 3ITPA 1JICA 4Q0FA 3M85A 3KLSA 2IW3A 1EU3A 1QCBD 2LFNA 4I65A 4L6TB 3KUPA 4LJZC 1LT6D 1SJED 2OXPA 4DK1A 2BCOA 2F0TA 2RKSA 2NVXB 2FINB 2PW5A 3S2DB 1HTPA 4QB4A 2D62A 4TQUS 4ZUIA 1SAPA 4K5XA 4DNTB 3VR6A 1TS5A 2WKDA 1F2ZA 5CV8A 3TN2A 1ZXTA 1ET6A 4IUUA 1DCZA 5FO8B 1VCIA 3NHHA 3R8BA 5ELBA 2KHSA 4K2LA 1E0BA 1LLRD 2E75C 1GJXA 2B63B 1EFID 2MHVA 1PZID 2ID0A 1LTTD 1S4ZA 2VB3X 4FVMA 1H9RA 1ZYRC 3RD4A 5C0XG 1B4OA 3MZ5A 3VYTA 1LT5D 4RHRA 3HGBA 2JA5B 4RCNA 2PQEA 3J7AV 1B53A 5CR3A 3D6CA 3BZDB 1E2VA 2TMPA 1GHKA 5CBAE 5IIFA 1RDPD 1JWSD 2RQXA 1SNDA 4NW2A 2AQ3B 3JAME 3C2PA 1FYCA 1C8CA 2EY6A 2K01A 1SYBA 2DY8A 3ND8A 5M5WB 4XYOA 3H6MA 1ENCA 1EY7A 1K83B 2NUCA 3LWEA 5FK9C 1XYIA 2Z4HA 3WOEA 2FHTA 3N6RA 1EY5A 3OHXC 4FXKC 1O7ZA 1LTBD 3NXWA 4KY6A 5EKKA 5E4WC 5A2QL 2J0TD 1DZ1A 1AP0A 4CJ1B 5DEHA 3MEHA 5ISRA 1ENFA 3M7NA 4AYBB 1WTOA 2JEAI 2IX3A 2PZTA 4IUNA 2CQAA 1STBA 2NB0A 3GV6A 4K14A 2K5DA 1SYFA 2A68D 4WRDA 2VUMB 4K2KA 2F0JA 5M5XB 2EDGA 1EEID 5C4JB 3VR3A 3MFYA 3NE5B 3QO2A 1Q1EA 3SE0A 4H0LC 3MHBA 3T16A 2F0MA 2EYMA 1LV9A 3FPUB 2F03A 3MXPA 1H9MA 3A8KE 1BR9A 3OMCA 1WTRA 5KYIA 5C4HA 2JXMB 3S1RB 3HP3A 3NQIA 3DUZA 4A3DB 1ILQA 1STYA 2B2TA 3JAML 5FKAC 2AUKA 2K32A 4C3JB 2HCIA 1GUOA 1CA5A 1BCPF 3VA7A 1JR0D 1LT3D 1F9SA 1PTOH 1STHA 3NSWA 1G291 1PRTD 3EFXD 3I4MB 1TKWB 1A3TA 3PIP3 2Y0SB 1SBBB 2O4XA 2VB2X 3X3NA 1Z6HA 2BDOA 1MBYA 1RCVD 1KABA 4RKLA 3ONAB 1A15A 2LMCB 3OSOA 1X3QA 3T13A 1KNAA 3FEWX 1BNZA 4TSSA 5EPJA 1A3UA 4G7HC 4PMCA 4WORA 1IYUA 3AMUA 1NCVA 1SSOA 5I2XA 2BOSA 1S5CD 2F4IA 1PDQA 2K03A 3DEOA 2OF1A 2KVMA 3KLRA 4X3SA 3UI2A 4RCOA 1GXDC 2K5WA 1LTRD 2B2VA 2LS01 1SNMA 4KJOA 3D31A 2B8GA 4N9TA 4C3IB 3V2TA 1TWCB 4DF7A 3MAQA 2F0KA 1I4GA 1XWEA 4C3IG 3GTQB 1Y1WB 4H13C 3Q6SA 4IUQA 1AFPA 4EGVA 4RAUC 5K36H 1CQVA 2NZ1D 4KK7A 1DM0B 3WDNA 5FLXL 1S5ED 3P1HA 5C4ZA 4TKOB 1V1PB 1OXXK 2HCCA 5IGBA 4I7ZC 2XVSA 2F0QA 4Q5VA 1C4QA 4CKBA 1H9JA 3IFDA 5CV4A 3A8JE 1VMPA 1TY0A 3P7JA 1SNQA 1O7LA 3KBXA 3Q24A 1UAPA 5KNCA 2J7ZA 1L0XB 1D2BA 1V8QA 1BQQT 3OOCA 2A6HC 4OGQC 2L5TA 1B2TA 2F1MA 1WTQA 2M00A 2AWNA 1G2SA 4KD3A 2B2YC 1M8AA 4DNRB 2B39A 1IHZA 5ELCA 4DAPA 2YU9B 4DN4M 3O13A 3TP7A 4FXDA 5IGDA 4IURA 1TWHB 1PRTF 5DM73 2QF7A 2KOLA 3X3MA 1VDZA 2EY1A 3NTIA 2B2UA 5C3WA 2NN6H 1PFNA 1WTPA 4IFDJ 3T4AC 1STAA 1IW7C 3Q23A 4N9PA 4PMWA 5IODA 2EY2A 2QCPX 4R9WA 4PQXA 1U4PA 2FMMA 5M3MB 3G7LA 2KECA 1T5XD 1JOOA 2B8FA 1VMCA 1AN8A 3HG9A 3I70A 5IT9E 1OXUA 2MP1A 3BYTB 1LTGD 1LTID 2EY5A 4IFDH 3EQLC 1DD2A 5EKLA 3E5SA 2HDMA 3N52A 3K5MA 3PUZA 1BXTA 2XSCA 2RVLA 3RZDB 1CHQD 1SDFA 1TQOA 2F3VA 2SOBA 4M8AA 2QILA 1J8IA 4XQJA 4A3JB 3HEJA 1O7YA 3IFTA 3BYYB 1SMYC 2M9VA 1Z47A 1A2UA 3P75A 2E2DC 1PZJD 2R7ZB 4K8IA 1QJOA 5K5PA 1QILA 1X32A 1D1IA 4QIWB 4KKUA 1VF5C 4QF4A 3TZUA 3GTLB 3DM1A 3SR1A 5E4XA 3A7LA 3I90A 3T51B 1EL0A 2VNUD 1JC7A 1UNSA 4V0BA 4KY7A 1Q3LA 1AW7A 2A73B 2MPMA 4Z9CB 5FOBB 1JWUD 3MXGA 3I4LA 3PUVA 1TWGB 1RD9D 1I4RA 1DONA 4RGOS 3PO3B 2NTSA 3S2HB 5I4DA 2Z4IA 4OIKA 2ZT9C 3D4RA 4DK0A 3U9SA 1DJRD 3K5LA 1O80A 2F0WA 2IPKD 2PO4A 2ICIA 4RFBA 2F0OA 4RGNA 3MFGA 4FNFA 3SK4A 5JEAJ 2DN8A 1HFNA 1BUVT 1KLGD 1SNCA 2WKCA 1ET9A 2DY7A 3J81E 1LO5D 1I4HA 2HQEA 4F8MA 1HXYD 2L4NA 3GV3A 2F0NA 2F0IA 1QE6A 3HOVB 4HSPA 1FR3A 4K8JA 4XQNA 4E6IA 2JSOA 3I73A 3NQTA 5IGFA 4P2CB 1ICWA 3A56A 1CA6A 5CMDA 1DOLA 4RHSA 4OO1H 2O5JC 1EQTA 2LY7A 2O2LD 3K5OA 4QUCA 3VR5A 1D6EC 3K7AB 1RTOA 1Q90A 1NR4A 5BN3A 3AB9A 2KEEA 3NWTA 1STNA 2RDFA 4BBRB 4MN3A 2VXWA 3A8IE 5EJWA 2Z1CA 4OO1I 4UAIA 1I6HB 3I72A 3BDCA 3K57A 2G9DA 4IN3A 5M9OA 1WVLA 3WOFA 1JB3A 1BCPD 1H9KA 4ZQ3A 4CJ2C 1WCMB 5AFWA 2E74C 3SK6A 1IL8A 2L9HA 2A6ED 3SDZA 3TMEA 1YNNC 1HCZA 1I4QA 3OWEB 3PO2B 2K28A 1SE3A 2F0SA 3I91A 2Q8RE 2NTTA 1VF7A 1EYAA 1KTKA 3HRZC 5F2DA 1GOZA 4A3MB 1OXVA 1PTOC 2XNAC 3QG1A 4RWSC 1D5ZC 1SFOB 3DXJC 5CV9A 4KKSA 1CZGA 4RGMA 1V1OA 2JA7B 1PZKD 1Z7TA 1NR2A 2XWJB 1V43A 2LKVA 3SEBA 4KI0A 1A3VA 4BS9A 2QDBA 1NSNS 1F2LA 2F0GA 3K58A 1AZQA 1PLFA 3DWQA 1KAAA 2IX1A 1EWHA 5DM63 3BDLA 3BG3A 4C1NK 2MGSA 3EJIA 2RDGA 3SK5A 1TS4A 1EEFD 3SK8A 4QUFA 2HUGA 4S3SA 3LWUA 3IKJA 3C3LA 3EVQA 3I8ZA 5C3XA 3S17B 3PV0A 1PTOB 4V190 5KGUA 3C1FA 3CRKC 3KF8A 1DXMA 4A3IB 1YNJD 5TSSA 3CRLC 2NVQB 2XIWA 1A6XA 2XRSD 2X69A 4IUVA 1EY0A 1I50B 2IWHA 5DAUA 4QCLA 1OXTA 1UUPA 1JWMD 3R2TA 4UDUC 1CFMA 4JBWA 1V1PA 3T56B 4ZKBB 4DU9A 3D4DA 3OIPA 2F0UA 1SYGA 3U9OA 4MIUA 2CVRA 4QMGA 1BF4A 2KUMA 5D3IB 2F0DA 5I9PA 2K33A 2ENBA 1SYCA 1W6KA 3H94A 5G3LD 5HGTA 1CHPD 3H09A 4B9XA 3Q0AA 1SNOA 4C56C 4L8JA 1TVXA 4RKBA 4NP5A 4FF4A 3HS0C 1JORA 1B3AA 5EBDA 5EPLA 1CK1A 3W2DA 2E76C 1QOHA 2EYJA 3GQBA 2KJXA 1IKMA 1TWFB 5JOBA 1EY9A 4HSVA 5K36G 4DAVA 2I07B 1F77A 1I4PA 3GTGB 1W6JA 1EYCA 2A69C 2OT2A 4KJNA 4H7BA 5T1IA 1SNPA 3J7AF 1J9OA 2B2YA 4CHTB 3BDOA 1CM9A 2JYOA 4HAEA 4K5WA 3MXUA 2C5CA 2PW7A 3PUWA 4G57A 2WAQB 3SVMA 2CW0C 3K0YA 1KLUD 3VYSA 3I4NB 2K05A 3MWYW 2V4DA 1ENAA 4CKEA 4ULLA 1EZ6A 2L1BA 5M5YB 3NBIA 4FF2A 2K1BA 4DXFA 1RF2D 3DWAA 1G8ZD 2K04A 2NN6G 1KDCA 2WIIB 4PV1C 2R61A 1MGSA 2BDNA 4XT3B 3HOYB 3GP7A 2BE5C 5EBCA 3TP5A 1SE4A 1BDOA 1FNWA 1LABA 5IOCA 1TWAB 4R8NA 1I3QB 4CGYB 4OL7A 3ERQA 1D5MC 5G3LF 4K6LA 3K5NA 1XTCD 4X3UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MVV A;  4NKL A;  4K5V A;  5C5M A;  2EY2 A;  4EVO A;  1KDA A;  3EVQ A;  4TRD A;  4HMJ A;  1EY4 A;  5C3X A;  5C6A A;  2SNM A;  1EYC A;  3R3O A;  1A2T A;  1F2Y A;  1U9R A;  2OEO A;  4IAL A;  1SYD A;  3DHQ A;  4KY7 A;  1STN A;  2RDF A;  3SHL A;  1SND A;  3OMC A;  4KJN A;  3NP8 A;  4YIJ A;  5KYI A;  5KGU A;  3ITP A;  4H7B A;  5C4H A;  5KEE A;  5J39 A;  1TR5 A;  3PMF A;  3C1F A;  4ZUJ A;  3BDC A;  2F0L A;  1JOO A;  5CC4 A;  1SNP A;  2EY6 A;  3C1E A;  4I65 A;  3TP6 A;  3OWF A;  5M9O A;  1SYB A;  3QOJ A;  1STY A;  5KYL A;  2OXP A;  3P1H A;  5C4Z A;  1F2M A;  4EQP A;  5HUR A;  2F0T A;  4ZQ3 A;  3H6M A;  2RKS A;  3OMG A;  5E1F A;  1ENC A;  4PNY A;  2PW5 A;  1EY7 A;  5I9O A;  2NUC A;  3SK6 A;  3DMU A;  1EY0 A;  1EY6 A;  4NMZ A;  4K5W A;  4PMB A;  5DAU A;  5IGB A;  2EYF A;  4QB4 A;  2EY5 A;  5NUC A;  4HMI A;  2F0Q A;  3TME A;  4ZUI A;  3RUZ A;  2PW7 A;  4G57 A;  1STH A;  2EXZ A;  4K5X A;  5EKL A;  5KIX A;  4DGZ A;  1AEX A;  3E5S A;  5CV4 A;  3TP8 A;  4DU9 A;  2F0S A;  1EY5 A;  1NUC A;  4K6D A;  2F0W A;  3D8G A;  1SNQ A;  2KQ3 A;  3D4D A;  1EYA A;  3NXW A;  4KY6 A;  5EKK A;  4DFA A;  4HTH A;  1F2Z A;  2F0U A;  5CV8 A;  5J22 A;  2F0O A;  1SYG A;  2EYL A;  3ERO A;  5CV6 A;  2SNS A;  5E3F A;  5F2D A;  4MIU A;  5CV5 A;  3SK4 A;  1A3T A;  3U9O A;  3VA5 A;  3S9W A;  4NDX A;  4QMG A;  2F3W A;  2F0H A;  2O4X A;  1SNC A;  1TQO A;  1SYE A;  2F3V A;  2SOB A;  4F7X A;  3NHH A;  5DEH A;  1KDB A;  3MEH A;  5EGT A;  3HEJ A;  2F0D A;  2M00 A;  4KD3 A;  5ISR A;  5CV9 A;  2HQE A;  2KHS A;  4KV6 A;  4F8M A;  1KAB A;  2EYO A;  4RKL A;  5C5L A;  5I9P A;  3OSO A;  2F0E A;  1EQV A;  1ENA A;  2F0F A;  3T13 A;  5IGE A;  4IZ8 A;  4ID6 A;  2ENB A;  1IHZ A;  4J1M A;  2PZT A;  4K2L A;  4KY5 A;  1EZ6 A;  1EYD A;  2F0N A;  3QB3 A;  1RKN A;  2EYP A;  1A2U A;  1SYC A;  2F0I A;  1A3U A;  3P75 A;  4IUN A;  4EQN A;  3TP7 A;  5HGT A;  1STB A;  1EZ8 A;  4K8J A;  5KRU A;  1JOQ A;  5CV7 A;  4K8I A;  4KD4 A;  4K14 A;  5IGD A;  5K5P A;  4PMC A;  4WOR A;  2LKV A;  4B9X A;  1SYF A;  1EY8 A;  2PZW A;  1SNO A;  4KHV A;  2PYK A;  3SXH A;  4E6I A;  5IGG A;  1KDC A;  4WRD A;  3D4W A;  1A3V A;  2QDB A;  4ODG A;  1NSN S;  4K2K A;  2F0J A;  3MZ5 A;  2EYH A;  4NP5 A;  4RKB A;  3HZX A;  3NQT A;  4EQO A;  5IGC A;  2PZU A;  3NK9 A;  5IGF A;  2F0G A;  1JOR A;  4QF4 A;  2EY1 A;  4ME5 A;  2OF1 A;  2PQE A;  5CGK A;  3NUC A;  2EYJ A;  2F0P A;  1JOK A;  2F0V A;  3D6C A;  5CR3 A;  3TP5 A;  3LX0 A;  4LAA A;  5C3W A;  1KAA A;  3MHB A;  1STA A;  3SR1 A;  5I6Y A;  1STG A;  4R8N A;  5JOB A;  1EY9 A;  2RBM A;  3T16 A;  5IOC A;  1II3 A;  3BDL A;  4OL7 A;  1SNM A;  2F0M A;  1TT2 A;  4KJO A;  4B9W A;  3EJI A;  2EYM A;  4J6H A;  3ERQ A;  3SK5 A;  5I6W A;  3QOL A;  4N9T A;  3SK8 A;  3V2T A;  4KTA A;  4N9P A;  2WAC A;  3MXP A;  5IIF A;  4DF7 A;  5JAV A;  2F0K A;  5IOD A;  4S3S A;  5J1Z A; 
#chains in the Genus database with same CATH topology
 2FFK B;  4XIG S;  4B3S L;  1YJN A;  2NWG A;  1A2T A;  2AKW B;  3U4Z A;  3HOZ H;  3RZO B;  3NP8 A;  1Y69 U;  2AMC B;  2M2L A;  4K0K L;  4DV6 Q;  1UEA B;  1WD0 A;  2ZXR A;  3CP0 A;  3MTS A;  4IFD G;  1BVS A;  3I3C A;  1N34 L;  2CQO A;  4O0A A;  1X3F A;  2DJF C;  3GTK B;  2IJ0 A;  2JA8 G;  4KN7 C;  4BA1 I;  3J7Y W;  3E0J A;  5E1F A;  1Y1V B;  4N8F A;  1ZEQ X;  4HJ7 A;  4BBS B;  4ME3 A;  1SEB D;  1Y8P B;  3H3V H;  2PNH A;  4HMI A;  1PYS B;  3GTJ B;  2Z8L A;  4BBS G;  4JV5 Q;  3CXC A;  3S14 H;  1FL0 A;  1WI5 A;  2B2W C;  3E9H A;  2QEX A;  4GKK L;  1IZ6 A;  2JE6 I;  1NUC A;  1GM5 A;  4QL5 A;  1HHV A;  4H44 C;  4A3F G;  4DV5 Q;  4A3E B;  3TDQ A;  3OPO A;  2NVY B;  1IL2 A;  2A6H D;  4MZ9 A;  5JPN C;  3HOW B;  2N8N A;  3QJY A;  5IYB H;  5CV5 A;  1GHJ A;  4R4C A;  4NDX A;  1TS3 A;  2F3W A;  1YJ9 A;  1SYE A;  3HOW G;  3GTO H;  1OO9 B;  3KBG A;  1P16 A;  5LL6 X;  4KV6 A;  1K8M A;  2EYO A;  2CCZ A;  2P5Z X;  3H3V I;  2JK8 A;  1EQV A;  2F0F A;  4IZ8 A;  2R92 B;  4ZRZ A;  2ZXP A;  1JB7 A;  3MXN A;  1RKN A;  3TZD A;  2EYP A;  3M7G A;  5BN5 A;  2R92 G;  1B44 D;  4LFA L;  3ZYY X;  1X54 A;  3EA6 A;  4A93 G;  4DR4 L;  2D5D A;  1EY8 A;  2GVB A;  2Z9H A;  2PYK A;  1EIY B;  4DA2 A;  2SDF A;  1IYV A;  1F9R A;  2Q8T A;  1N32 Q;  2L12 A;  5CBE E;  2UUC Q;  2VQF Q;  3DLL A;  2CHB D;  4LWC A;  4A3F H;  4A3B B;  3BU2 A;  3S1N B;  5CGK A;  4B3R L;  5BR8 Q;  1VQG A;  1W3S A;  2F0P A;  1JOK A;  1STE A;  4A3B G;  1IW7 D;  1MKH A;  1EIH A;  2PPB C;  4P75 A;  2AUJ D;  4F87 A;  5LHY 1;  1HJP A;  1I6V C;  1UE6 A;  3P20 A;  1ONL A;  2PMZ B;  1D5X C;  4NKL A;  1HNX Q;  3BVZ A;  2WFW A;  4IAL A;  1U9R A;  1ESR A;  1Q12 A;  4A3K B;  2E8G A;  5D3D A;  4JI4 L;  3J80 i;  5J39 A;  4JCV E;  4A93 H;  4IOA A;  4R8I A;  1HPC A;  4A3K G;  1RIP A;  5CC4 A;  1TU2 B;  4J15 A;  3L3O C;  3TP6 A;  1X3P A;  2NVT B;  3GTM B;  5JJK A;  2Y0S E;  1F2M A;  1ROD A;  1AZP A;  1VQ4 A;  1H9S B;  1HQM C;  1HZB A;  5C4X B;  2WP8 J;  4IO9 A;  5M3F B;  1RJT A;  1DOM A;  3FHW A;  4JI5 L;  1O78 A;  1HUM A;  5C4X G;  1F9Q A;  4OX9 L;  3RN2 A;  5IYD G;  5M3F G;  4KHZ A;  5C44 B;  3RZD H;  1WTX A;  3J81 i;  4OHJ A;  4HTH A;  1S40 A;  3CD6 A;  1EQR A;  1L0Y B;  3PF5 A;  4GZY C;  1QVC A;  3J80 E;  3V05 A;  1NAP A;  3K81 C;  4U68 A;  1PXU A;  2MO0 A;  1SMY D;  3I2Z A;  3NBH B;  4HR7 B;  3T1Y Q;  4PZ6 A;  3S15 B;  4YHH L;  1XNR Q;  5IT9 L;  4KY5 A;  4APV A;  2L0C A;  2YTY A;  3FDT A;  3U58 A;  4EQN A;  1GUN A;  2R7Z H;  2JA6 H;  1EZ8 A;  3S1M H;  5CV7 A;  3FVQ A;  4OO1 G;  3VR4 A;  5A35 A;  5JEA G;  1UE7 A;  4MTK A;  4G7Z C;  2VZA A;  4HJ8 A;  2K5H A;  1LTS D;  1EWC A;  3F2C A;  1U4R A;  4LF8 L;  3PIO A;  1N33 L;  2A19 A;  2HHH Q;  1B50 A;  4H02 A;  3G6J B;  1Q7Y C;  3RR5 A;  1CI3 M;  3RLO A;  4A4I A;  1Q82 C;  5JVH 3;  1XTD A;  4LAA A;  5GAG C;  4HJA A;  4JI7 L;  4JI2 L;  3RLF A;  2G9H D;  1FJG L;  5J3B A;  3BZC A;  1TT2 A;  2MUY A;  1L1O C;  5ELO A;  3SGI A;  4HJ9 A;  1IBM Q;  1CSP A;  2A1A A;  5LL6 S;  2RA4 A;  1D7Q A;  4DV7 L;  4KKT A;  4JW0 A;  4DR1 L;  1U4L A;  1GUT A;  3A55 A;  3Q22 A;  1BCP C;  2IT1 A;  2JP1 A;  3K6O A;  5C3E B;  1EY4 A;  1VQ5 A;  2K7V A;  1TII D;  2PI2 E;  5A2Q E;  4RA8 A;  5C3E G;  4LK1 C;  2A6E C;  3TSS A;  5KEE A;  1TWG H;  4DR2 Q;  3HOX B;  4DAY A;  1C9O A;  2K6A A;  4GKJ L;  5JEA H;  2XWB B;  3W3A A;  2K5N A;  3A54 A;  1YJW A;  5HUR A;  1U4M A;  2E2H H;  3F8T A;  1PV4 A;  5ELF A;  2WB1 B;  1YI2 A;  2IY5 B;  2K5Q A;  4GLV B;  5LMU Q;  1SRO A;  1B1Z A;  4A3G H;  5FLM G;  4XT1 B;  1SXT A;  1TY2 A;  3FP9 A;  4XDX A;  3AQQ A;  3OW7 A;  2UXD Q;  3DEP A;  2KQ3 A;  4PZ8 A;  1GD7 A;  2SNS A;  5E3F A;  2BA0 A;  2NVX H;  4YY3 L;  3S2D H;  1KC8 C;  3ERS X;  5C0X J;  1KDB A;  1L1O B;  1S5D D;  3J80 L;  1XMO L;  1S5B D;  2QEJ C;  2QKI C;  5IGE A;  2ZM6 L;  2VQE Q;  4J1M A;  2CFM A;  1ML0 D;  2RSN A;  1BCP B;  1A8V A;  3D6W A;  4BY7 B;  1MSH A;  1K3R A;  2R6G A;  4PZ7 A;  1QNK A;  4BY7 G;  1HR0 W;  3BVM A;  5IGG A;  3HKZ B;  3HFZ B;  4L63 B;  1X55 A;  4HID A;  2EYH A;  2A68 C;  2PZU A;  2JJQ A;  3NK9 A;  1HRJ A;  3HKZ G;  3PUX A;  1XMQ Q;  4BA2 I;  1ZKO A;  3NTH A;  1CUK A;  2UXB L;  3JAM c;  2B63 H;  2KA7 A;  3J81 L;  4X66 L;  2XN9 C;  4OXP A;  2Q2U A;  5C0X H;  1II3 A;  1ZYR D;  2IHE A;  4OWT B;  3VR2 A;  4B9W A;  3NTK A;  1YNJ C;  3QOL A;  3DWP A;  4KTA A;  3A74 A;  1N8R C;  1T5E A;  4OIJ A;  3OW2 A;  1FNU A;  5J1Z A;  3OIQ A;  5JVG 3;  3L9A X;  3MVV A;  4FDB A;  3NPP A;  4HMJ A;  5KNB A;  2JA5 H;  2SNM A;  2OEO A;  1F2Y A;  3CU7 A;  3HOU B;  4HIO A;  3FRP B;  1CTM A;  1KRT A;  2D0O A;  3M3Y B;  1ESF A;  5IWA L;  3HOU G;  1WTH A;  2F3I A;  2ZJR A;  1PMR A;  2AQ2 B;  2OWO A;  3M4Y A;  1JE4 A;  2N55 A;  3QOJ A;  5C0X I;  1OXS C;  1R4Q B;  2D2C C;  3ULL A;  5IYC G;  2H1E A;  3OMG A;  4NXN L;  2DNE A;  5I9O A;  4U67 3;  1YNN D;  4BY1 B;  4NMZ A;  2EZV A;  3KF6 B;  4JI1 L;  1HUN A;  1A0I A;  3PIO 3;  3S1Q B;  3PQI A;  3T53 B;  1R9T B;  3PO2 H;  2L11 A;  4PG3 A;  3BJU A;  1CZW A;  3VYU A;  1E1O A;  5KIX A;  4B3M Q;  1AEX A;  1QWY A;  4AYB G;  2RHS B;  1D1K A;  4L5R C;  3FPP A;  1HZ9 A;  4K6D A;  4FF1 A;  3D8G A;  3TS2 A;  2R93 B;  5DNF A;  1JJG A;  1PTO D;  2I5H A;  5M5W H;  1G2T A;  1PRT C;  2EYL A;  4QIW E;  1RHP A;  3F2U A;  3QIA A;  4P74 A;  3S9W A;  2R93 G;  4M1U B;  3RLN A;  3F2B A;  5DLQ E;  2ATW A;  1B9M A;  1VS0 A;  2VUM G;  3KK7 A;  4DXG A;  3G6E A;  5C5L A;  3CQZ B;  4KLK A;  3CCU A;  4ID6 A;  4LF7 L;  4DR6 L;  2HQL A;  1G91 A;  2UXC Q;  3KDF A;  3L7Z C;  4DR3 Q;  4LF6 Q;  1PA6 A;  5ELD A;  5FO7 B;  2KED A;  4KMU C;  1EU4 A;  1XXG A;  3K80 C;  3L2P A;  4Y7N B;  3T1H Q;  3VDY A;  3D4W A;  1Q8I A;  1E2Z A;  3CCR A;  3RMH A;  2X6L A;  1QZG A;  4N8X 1;  1VQE A;  2ZJQ A;  3M4O B;  5FLX E;  5FLX c;  4HCE A;  4WFN 3;  5LMN Q;  1JMC A;  2NYZ D;  3LX0 A;  4DR7 Q;  2RDH A;  5I6Y A;  1GUW A;  1STG A;  1S5F D;  3A7A B;  3CCE A;  1VQ9 A;  4A3D G;  1WTV A;  1YHB A;  2TSS A;  5COR A;  1L2F A;  2QDL A;  5M5X H;  1Q86 C;  1PYW D;  5C4J H;  3TRE A;  4EVO A;  2FJ2 A;  4C3J G;  4TRD A;  1AE3 A;  1PH7 A;  4B3S Q;  2Z6K A;  2KHI A;  4UP7 A;  1PRT B;  2JQO A;  1HA6 A;  1YZ6 A;  3SHL A;  3GTP B;  1NNX A;  3FMC A;  3CKI B;  4JYA L;  4K0K Q;  4A3I H;  3H0G B;  1MHW C;  2DNC A;  4LF5 L;  1PVO A;  2J4X A;  3RN5 A;  2A74 C;  3OWF A;  3PUY A;  3GO5 A;  1N34 Q;  5KYL A;  4IUT A;  4FO2 A;  1GUG A;  2ICE C;  4CKC A;  1JQY D;  2C9O A;  4UPA A;  4PNY A;  3FKI B;  3KLS X;  4ZAI A;  4ZK9 B;  3S16 B;  1DYQ A;  4X3K A;  4JBK A;  3DMU A;  1EY6 A;  4PMB A;  4MHE A;  1QVG A;  4MTN A;  4ABN A;  1K8G A;  2EYF A;  3UDI A;  2CKZ B;  5NUC A;  3FKI G;  1CQF A;  2OTL A;  3RUZ A;  3B6Y A;  3H91 A;  2HIX A;  2UUB L;  3S1R H;  4GKK Q;  4C2M B;  3DM3 A;  4A3D H;  2A5H A;  2KCC A;  4F88 A;  5T1G A;  3IAY A;  2E2I B;  5CV6 A;  5J22 A;  3VA5 A;  1SE2 A;  1Q1B A;  4OEM B;  3H3V C;  1E2W A;  3CHB D;  4F7X A;  2WIN B;  5EGT A;  2B2T C;  1Y14 B;  4LMQ D;  3LGJ A;  1EWI A;  1PH4 A;  4R1J A;  4HCS A;  5BN4 A;  4C3H B;  1EYD A;  4YWL A;  1HTL D;  3I4M H;  2CH4 A;  2N88 A;  1WFQ A;  1GO3 E;  3A5U A;  2X6G A;  5FO9 B;  5IP7 G;  4C3H G;  2NBF A;  1XNQ L;  4LFA Q;  4DR4 Q;  2PZW A;  2EJF C;  1PTO F;  2E2J B;  4XQQ A;  1NMF A;  4EQ5 A;  5IGC A;  2Q8I B;  2KCT A;  4ME5 A;  2KBN A;  1Y1W G;  4B3R Q;  3NUC A;  1TWF H;  3HOZ B;  3C46 A;  3TBI B;  2F0V A;  4O42 A;  4ZLT F;  4BWG B;  3URY A;  2D9U A;  4LFB L;  2FMC A;  3AYH B;  4JK1 C;  4JI0 Q;  1H95 A;  1HFG A;  1KNE A;  1S3O A;  5I2Y A;  4FP5 D;  4LF4 L;  2A69 D;  2NZO A;  4K5V A;  3KFU A;  2B2W A;  4IQZ A;  1BO0 A;  3R3O A;  4IPH A;  1M4V A;  1FNV A;  3ND9 A;  2ZTD A;  4YCW A;  4JI8 L;  4JI4 Q;  3S14 B;  3OTO L;  1TR5 A;  3HKS A;  3PMF A;  4RGT A;  4ZUJ A;  2AQ1 B;  4WJW A;  1EOT A;  1QG7 A;  4CBV A;  2NZH A;  4C3I H;  1TWC H;  1SJH D;  2H4O A;  1FGB D;  3L0O A;  1MD2 D;  3F1Z A;  4GN4 B;  2WV6 D;  1BBX C;  2B2V C;  3GTQ H;  1Y1W H;  2ZXO A;  1T9H A;  4LUO A;  5JPM C;  3GTO B;  4GLA C;  5IYB G;  3K59 A;  1YIT A;  1H9S A;  2CW0 D;  1I94 L;  2EXZ A;  4JI5 Q;  4G7O C;  4DGZ A;  4Y52 H;  5KND A;  1F9P A;  4OX9 Q;  1QB5 D;  3R93 A;  1LT4 D;  2EVB A;  2JA8 B;  4DFA A;  1IKL A;  3I4N H;  5JJI A;  3TEH B;  3CCS A;  5CYU A;  2EJG C;  5JJZ A;  2R3Z A;  1B9N A;  4MNO A;  4C1N I;  2F0H A;  4IPD A;  3UE1 A;  2SEB D;  3BVG A;  1SMX A;  1CKN B;  5FJ8 H;  4IUP A;  2HDL A;  5D14 A;  4YHH Q;  5EKI A;  2KCM A;  1CT1 D;  3D3R A;  3NBH A;  4KN4 C;  1Y8O B;  1K0S A;  4A3F B;  1HQR D;  4DV1 Q;  4ZYS A;  3QB3 A;  1C0A A;  1WJJ A;  4RMF A;  5COY A;  2IL8 A;  1WTW A;  4B08 A;  1PH6 A;  1Y8N B;  2O5I C;  3KOJ A;  5D65 A;  4POF A;  3UDF A;  4EQO A;  1PFB A;  3HZX A;  2DUD A;  4LF8 Q;  2BE5 D;  1N33 Q;  3W5O A;  1HA5 A;  1J5E L;  4XXE A;  2YU9 H;  4CDE C;  1TWA H;  2AWO A;  2NN6 I;  5EQ0 A;  2KHJ A;  4A93 B;  1PFM A;  2EJM A;  4JI2 Q;  4JI7 Q;  1TWH H;  1FJG Q;  3I56 A;  4O1N A;  1IXR A;  4J6H A;  3VYR A;  5I6W A;  2Z0S A;  2WAC A;  2XRQ D;  2EPB A;  4DV7 Q;  5C5M A;  4DR1 Q;  3M4Q A;  1KDA A;  1WYD A;  1XX8 A;  2EOT A;  4TVA B;  3DHQ A;  2KEN A;  2CH4 W;  3LNN A;  1M1K C;  4GS3 A;  1K73 C;  4DUY L;  1LTA D;  2ALY B;  2UU9 L;  4ZKC B;  3MA2 B;  2F0L A;  1QNU A;  1N9W A;  1JCK B;  1MI2 A;  3C1E A;  4GKJ Q;  1K8O A;  4RH6 A;  4FYD A;  2B2U C;  4J8Q A;  4EQP A;  2ASB A;  1GVP A;  2GA4 B;  2PQA B;  4LUV A;  3CF5 A;  4NPS A;  4DV0 L;  1WOC A;  3BZK A;  2BH2 A;  1FVI A;  2Q2H A;  2L55 A;  2MJ8 A;  5M3M H;  4IFD I;  4A3J G;  4A3C G;  2HT1 A;  4NB3 A;  4JC0 A;  3TP8 A;  4A3E H;  1VQC A;  3AU7 A;  4UY8 C;  4XTC S;  2JA6 B;  3GD7 A;  3S1M B;  3ERO A;  4G4K A;  2R7Z G;  1C48 A;  4XYQ A;  2PNR C;  2KCN A;  2JA6 G;  1BOS A;  4YY3 Q;  5HGQ A;  2RCF A;  1PH1 A;  1FD7 D;  2XGT A;  4LW1 A;  3V96 A;  2F0E A;  1XMO Q;  2ZM6 Q;  4FXG C;  1SR3 A;  3R2I A;  1L1O A;  4X3T A;  5EPK A;  1RTN A;  4HN7 A;  1JOQ A;  5KRU A;  1R4P B;  4KD4 A;  3KYH C;  2EE1 A;  1G6Z A;  4KHV A;  3SXH A;  1MSG A;  4CJ0 B;  3NWS A;  2GVA A;  2I46 A;  2IX0 A;  4ODG A;  1JJC B;  4A3J H;  4CDD C;  3IRB A;  4A3C H;  4YCU A;  1TS2 A;  4CDC C;  1MJC A;  4ILW A;  4X62 L;  2JEB I;  1U5K A;  4HED A;  3E6Z X;  1S72 A;  2PCF B;  2UXB Q;  3BS1 A;  2B3G A;  5AJ3 L;  2N49 A;  4X66 Q;  1WD1 A;  1EIG A;  2RBM A;  4AQY L;  1LAC A;  5JAV A;  4FF3 A;  2BA1 A;  2RSO A;  2YYZ A;  1GUS A;  3QWN A;  5ELE A;  3U50 C;  1I4X A;  2E2H B;  1DOK A;  5C6A A;  1SYD A;  2WAQ E;  1ILP A;  3IL8 A;  4YIJ A;  4A3G B;  3MC0 B;  3ITP A;  4QQB X;  1JIC A;  3GTL H;  1V9P A;  5IWA Q;  4Q0F A;  4L5S A;  3M85 A;  1QVF A;  3M4P A;  3KLS A;  3PCO B;  4A3G G;  2IW3 A;  1EU3 A;  1QCB D;  2LFN A;  4I65 A;  4L6T B;  3KUP A;  4LJZ C;  1LT6 D;  1SJE D;  2OXP A;  4DK1 A;  3CCM A;  4HJ5 A;  5H1S E;  2BCO A;  2F0T A;  4JBJ A;  2RKS A;  1PH5 A;  4LNQ A;  2NVX B;  2FIN B;  4NXN Q;  1E3P A;  2PW5 A;  3S2D B;  5LMN W;  4JI1 Q;  1HTP A;  4QB4 A;  2D62 A;  4IPG A;  1U0L A;  1SLJ A;  4TQU S;  4ZUI A;  1SAP A;  1PH9 A;  4P71 A;  4K5X A;  5C44 H;  3KF6 A;  4X65 L;  4DNT B;  3TRZ A;  3VR6 A;  1TS5 A;  2WKD A;  1F2Z A;  2K14 A;  5CV8 A;  3PO3 H;  3TN2 A;  1VQD A;  2ZTC A;  4R4O A;  1YVC A;  1IBK L;  1ZXT A;  1ET6 A;  4IUU A;  3S2H H;  4R4I A;  1DCZ A;  5FO8 B;  4P72 A;  1VCI A;  4P73 A;  3NHH A;  3R8B A;  5ELB A;  3J81 j;  2KHS A;  3H15 A;  5BR8 L;  1HH2 P;  4K2L A;  1E0B A;  1LLR D;  4LF7 Q;  2E75 C;  4DR6 Q;  1GJX A;  2B63 B;  1EFI D;  1IYJ B;  2MHV A;  1PZI D;  1KD1 C;  2ID0 A;  1LTT D;  1S4Z A;  4FVM A;  2VB3 X;  2B63 G;  1H9R A;  2L15 A;  1ZYR C;  3RD4 A;  5C0X G;  1HNX L;  1B4O A;  3MZ5 A;  3VYT A;  1LT5 D;  1O7I A;  4RHR A;  3A0J A;  4JBM A;  3HGB A;  2JA5 B;  4RCN A;  2F4V L;  2PQE A;  3J7A 5;  1NE3 A;  3J7A V;  1B53 A;  2JA5 G;  5CR3 A;  3HOV H;  3D6C A;  3BZD B;  1E2V A;  2TMP A;  4GOP C;  1GHK A;  1EFW A;  5CBA E;  3PIP A;  5IIF A;  4DR5 L;  1RDP D;  3WWV A;  3CCJ A;  2ES2 A;  4B3T L;  1JWS D;  2RQX A;  1SND A;  4NW2 A;  1VQH A;  2AQ3 B;  4JYA Q;  3JAM E;  3C2P A;  1FYC A;  1C8C A;  4LF5 Q;  1CKM A;  2EY6 A;  4HIK A;  3PO2 G;  2K01 A;  3K7A H;  2EQS A;  1SYB A;  2DY8 A;  3ND8 A;  5M5W B;  4XYO A;  1JT8 A;  4X64 L;  3H6M A;  5GRO A;  1ENC A;  1EY7 A;  1K83 B;  2NUC A;  1K8A C;  3LWE A;  1YNX A;  1QZH A;  5FK9 C;  4BBR H;  1XYI A;  2Z4H A;  1B70 B;  3WOE A;  2UUB Q;  1I6H H;  2FHT A;  1XPO A;  3N6R A;  1EY5 A;  1VQJ A;  3OHX C;  4FXK C;  1O7Z A;  1LTB D;  3NXW A;  4KY6 A;  5EKK A;  5E4W C;  5A2Q L;  3Q8D A;  1HZA A;  1WCM H;  2J0T D;  1DZ1 A;  4GOP B;  5IE8 A;  1AP0 A;  4CJ1 B;  1XPU A;  5DEH A;  3MEH A;  5ISR A;  1N36 L;  1B8A A;  1ENF A;  5GQO A;  3M7N A;  1IBL L;  4AYB B;  4IOC A;  1WTO A;  2JEA I;  2IX3 A;  2IHF A;  2PZT A;  1XPR A;  3STB C;  4IUN A;  2CQA A;  1STB A;  3J7Z C;  2NB0 A;  3GV6 A;  4K14 A;  2K5D A;  1XNQ Q;  1ASZ A;  4A3M H;  1SYF A;  2A68 D;  2PMZ E;  4WRD A;  1X56 A;  3AFP A;  2VUM B;  2RHQ B;  1SFO H;  4K2K A;  2F0J A;  3ICE A;  1VQN A;  5M5X B;  2EDG A;  2HD3 A;  1EEI D;  5C4J B;  4JG2 A;  3VR3 A;  3MFY A;  3NE5 B;  3QO2 A;  2JA7 H;  1Q1E A;  3SE0 A;  1JJ2 A;  4H0L C;  3MHB A;  3T16 A;  4DK6 C;  4LFB Q;  2F0M A;  2EYM A;  4A3I G;  1LV9 A;  3FPU B;  1J6Q A;  2F03 A;  3MXP A;  2G5D A;  2LSS A;  4LF4 Q;  1LTL A;  1H9M A;  4YWK A;  1X3G A;  3A8K E;  1BR9 A;  3OMC A;  1E7Z A;  2CWP A;  4JI8 Q;  1WTR A;  5KYI A;  1ASY A;  5C4H A;  3OTO Q;  2JXM B;  2UUA Q;  3S1R B;  3HP3 A;  4IJL A;  3NQI A;  3DUZ A;  4A3D B;  1ILQ A;  4DAM A;  1STY A;  2B2T A;  3JAM L;  5FKA C;  1HNZ L;  2MO1 A;  2AUK A;  2K32 A;  4C3J B;  1NTG A;  2HCI A;  4I7A A;  1GUO A;  1CA5 A;  3S17 H;  1BCP F;  3VA7 A;  1JR0 D;  1LT3 D;  1F9S A;  1PTO H;  2VQE L;  1LUZ A;  1STH A;  3JC6 6;  3K7U C;  1I94 Q;  3NSW A;  2Z6B A;  1G29 1;  1PRT D;  3EFX D;  3I4M B;  1VQ6 A;  1KIX A;  2NVQ H;  1TKW B;  4WJ4 A;  3I4M G;  1A3T A;  3PIP 3;  2Y0S B;  4AIM A;  2JN4 A;  1SBB B;  1VQF A;  2O4X A;  2VB2 X;  3X3N A;  1I50 H;  1EIF A;  3CPF A;  1Z6H A;  2BDO A;  1BBU A;  2Y0S G;  1MBY A;  1RCV D;  1KAB A;  4RKL A;  3ONA B;  1A15 A;  2LMC B;  3OSO A;  1X3Q A;  3T13 A;  1CKN A;  3CC4 A;  1KNA A;  1PH2 A;  3FEW X;  1BNZ A;  4TSS A;  5EPJ A;  1A3U A;  4G7H C;  4KHP L;  4PMC A;  4WOR A;  1IYU A;  3AMU A;  1NCV A;  1SSO A;  4ZCK A;  2HIV A;  1EUJ A;  5I2X A;  3CC7 A;  2BOS A;  1S5C D;  2EIF A;  1TXY A;  1PDQ A;  2F4I A;  2R7F A;  2QW7 A;  2K03 A;  1VQB A;  3DEO A;  2OF1 A;  2KVM A;  3KLR A;  4X3S A;  3UI2 A;  4RCO A;  1J5E Q;  3G4S A;  1GXD C;  1NY4 A;  2MNA A;  2K5W A;  1LTR D;  3UDG A;  3CCL A;  2B2V A;  2LS0 1;  1SNM A;  4DK3 C;  4KJO A;  3D31 A;  2B8G A;  4N9T A;  4C3I B;  3V2T A;  1TWC B;  4DF7 A;  3MAQ A;  2F0K A;  2WB1 E;  1I4G A;  1XWE A;  4LUZ A;  1VQM A;  4C3I G;  3GTQ B;  1Y1W B;  4H13 C;  4OEL B;  3KF8 B;  3Q6S A;  4IUQ A;  3I4O A;  1HNW L;  1AFP A;  4B3M L;  4EGV A;  4RAU C;  4DUY Q;  2UU9 Q;  5K36 H;  4DV4 L;  1CQV A;  2NZ1 D;  4KK7 A;  1DM0 B;  3WDN A;  5FLX L;  1S5E D;  3F2D A;  4JVZ A;  2N78 A;  1ICF B;  3P1H A;  3S24 A;  5C4Z A;  4TKO B;  4NXM L;  1GKH A;  3GTG H;  5EAY A;  4DV0 Q;  3I4N G;  1V1P B;  1OXX K;  4QGU A;  2HCC A;  5IGB A;  4I7Z C;  2PQA A;  2VW9 A;  2XVS A;  2F0Q A;  4Q5V A;  1C4Q A;  4CKB A;  2QGQ A;  1H9J A;  3IFD A;  5CV4 A;  1NBW A;  3A8J E;  1VMP A;  5FJ8 G;  1VQK A;  4DR3 L;  1TY0 A;  3E9I A;  3P7J A;  1SNQ A;  1O7L A;  3KBX A;  3Q24 A;  1UAP A;  5KNC A;  2I0Q A;  2J7Z A;  2JA9 A;  1L0X B;  1YEZ A;  1D2B A;  3HKZ E;  4GLX A;  1V8Q A;  3ZJY C;  1BQQ T;  3OOC A;  3W1B A;  2A6H C;  4OGQ C;  2L5T A;  4DV3 L;  4OON A;  1B2T A;  1E22 A;  2F1M A;  1WTQ A;  2M00 A;  2AWN A;  1G2S A;  4KD3 A;  4JI3 L;  2B2Y C;  1M8A A;  4DNR B;  4JOI C;  2B39 A;  1IHZ A;  5ELC A;  4DAP A;  2YU9 B;  4DN4 M;  3O13 A;  3HOY G;  1UEB A;  3TP7 A;  4GNX C;  3CCQ A;  4FXD A;  5IGD A;  4IUR A;  1TWH B;  1P8L A;  1PRT F;  5DM7 3;  2QF7 A;  1A63 A;  1KHI A;  1YIJ A;  3M9B A;  2KOL A;  3X3M A;  1VDZ A;  2EY1 A;  3NTI A;  4X62 Q;  2GN5 A;  3E0E A;  5M5Y H;  2B2U A;  5C3W A;  2NN6 H;  1PFN A;  1A62 A;  1WTP A;  3NEM A;  1YHA A;  1JE5 A;  4OWX B;  4IFD J;  3T4A C;  1STA A;  5AJ3 Q;  4AQY Q;  1IW7 C;  4DKA C;  5GAH C;  3Q23 A;  4N9P A;  1M90 C;  4PMW A;  3CW2 C;  5IOD A;  2RF4 A;  1Q81 C;  2EY2 A;  4AYB E;  2QCP X;  2K75 A;  4PQX A;  4R9W A;  1Y1V G;  4JI6 L;  1U4P A;  2VS1 A;  3HOY H;  2FMM A;  5M3M B;  3G7L A;  2E5L L;  2KEC A;  4EX5 A;  2RCN A;  1T5X D;  2K5V A;  5M3M G;  1JOO A;  1I3Q H;  3AFQ A;  1X9N A;  2B8F A;  1K28 A;  1VMC A;  1AN8 A;  2OCE A;  3HG9 A;  4A3E G;  3I70 A;  5IT9 E;  5IT9 c;  1OXU A;  2MP1 A;  3BYT B;  4GNX B;  1HR0 L;  1LTG D;  3OYY A;  1LTI D;  3RZO H;  2EY5 A;  4IFD H;  3EQL C;  1QUQ B;  1DD2 A;  5EKL A;  3E5S A;  2HDM A;  3N52 A;  2JA8 H;  4X65 Q;  3K5M A;  3PUZ A;  2MQH A;  4L5Q A;  2FXQ A;  1BXT A;  3GTK H;  2XSC A;  2RVL A;  3RZD B;  1IBK Q;  1Y1V H;  4LF9 L;  1CHQ D;  1SDF A;  1TQO A;  2F3V A;  2SOB A;  4BBS H;  4M8A A;  2QIL A;  1J8I A;  4XQJ A;  4A3J B;  3HEJ A;  2K4K A;  1O7Y A;  3GTJ H;  4LFC L;  3IFT A;  3BYY B;  1D8L A;  1SMY C;  2M9V A;  2Q2T A;  1Z47 A;  1A2U A;  3P75 A;  2NVY H;  2E2D C;  1PZJ D;  1VQL A;  4JI0 L;  3HOW H;  4DV2 L;  2R7Z B;  4K8I A;  1QJO A;  2H5X A;  5K5P A;  4DUZ L;  1QIL A;  1X32 A;  1D1I A;  4QIW B;  4KKU A;  1VF5 C;  5ELN A;  1FGU A;  3CC2 A;  3GDE A;  4QF4 A;  3TZU A;  5IY0 A;  2F4V Q;  2R92 H;  2XTI A;  3GTL B;  3CPW A;  3DM1 A;  3SR1 A;  3CMA A;  5E4X A;  3A7L A;  3I90 A;  3T51 B;  3I55 A;  3MEF A;  4WJ3 M;  1EL0 A;  2VNU D;  1JC7 A;  4DR5 Q;  1E1T A;  4UHV A;  1UNS A;  4V0B A;  4KY7 A;  4B3T Q;  4A3B H;  3S1N H;  1Q3L A;  1B7Y B;  1AW7 A;  2A73 B;  4X6A H;  4DV6 L;  2MPM A;  1MJE A;  1KXL A;  4Z9C B;  3KJP A;  5FOB B;  1JWU D;  3MXG A;  3I4L A;  3PUV A;  1TWG B;  1RD9 D;  1I4R A;  1DON A;  5C44 G;  1VQ7 A;  1CKO A;  4RGO S;  3PO3 B;  3J80 c;  2NTS A;  3KJO A;  2BH8 A;  3PGZ A;  4GN3 B;  4X64 Q;  3S2H B;  2YTX A;  5I4D A;  2Z4I A;  3PO3 G;  4OIK A;  4A3K H;  2ZT9 C;  3D4R A;  4DK0 A;  4JV5 L;  4DV1 L;  2YV5 A;  5GAE C;  3U9S A;  1DJR D;  3K5L A;  1O80 A;  2DGY A;  2F0W A;  2IPK D;  2PO4 A;  4DV5 L;  2NVT H;  1UE5 A;  3GTM H;  2ICI A;  1YHQ A;  4RFB A;  2CWA A;  2F0O A;  4RGN A;  3MFG A;  1W2B A;  4FNF A;  3SK4 A;  4UP9 A;  5JEA J;  2ZTE A;  5GAD C;  4IPC A;  2DN8 A;  4IJH A;  1HFN A;  1BUV T;  1KLG D;  1SNC A;  2I5M X;  5C4X H;  2WKC A;  1ET9 A;  1DGS A;  2DY7 A;  3J81 E;  3J81 c;  1LO5 D;  5M3F H;  1I4H A;  3MXN B;  5IYD H;  2HQE A;  4F8M A;  1N36 Q;  1K0R A;  3A5Z B;  1HXY D;  1HZC A;  4GOP A;  1IBL Q;  2L4N A;  3GV3 A;  3TQY A;  2F0N A;  2F0I A;  1QE6 A;  1UWV A;  3HOV B;  4HSP A;  2A8V A;  1FR3 A;  4K8J A;  1Q46 A;  4XQN A;  1EOV A;  3HOV G;  4E6I A;  2JSO A;  1Q8K A;  1K9M C;  4AH6 A;  2AHO B;  3I73 A;  3NQT A;  5IGF A;  4P2C B;  1N32 L;  1ICW A;  3S15 H;  3A56 A;  1LYL A;  1CA6 A;  2UUC L;  5CMD A;  2VQF L;  1DOL A;  4RHS A;  2K50 A;  1I5F A;  4OO1 H;  2O5J C;  1EQT A;  2LY7 A;  2K52 A;  2O2L D;  3K5O A;  3K0X A;  1BBW A;  3HOX G;  4QUC A;  1BKB A;  3VR5 A;  1D6E C;  3K7A B;  1RTO A;  1Q90 A;  1NR4 A;  5BN3 A;  1AE2 A;  3JAM i;  1EQQ A;  3AB9 A;  2KEE A;  2MFI A;  3NWT A;  2WB1 G;  1STN A;  2RDF A;  2OQ0 A;  4BBR B;  2ZJP A;  3CME A;  4MN3 A;  2VXW A;  3A8I E;  5EJW A;  2Z1C A;  1RL2 A;  4OO1 I;  4UAI A;  1I6H B;  3I72 A;  4BBR G;  3BDC A;  3K57 A;  3EIV A;  2G9D A;  4YCV A;  4IN3 A;  3ULJ A;  5M9O A;  1WVL A;  3WOF A;  1JB3 A;  1BCP D;  1H9K A;  4ZQ3 A;  4CJ2 C;  1WCM B;  1HNZ Q;  5AFW A;  5C3E H;  2E74 C;  1EYG A;  3NEN A;  3SK6 A;  1IL8 A;  2L9H A;  1WCM G;  2A6E D;  3SDZ A;  3TME A;  1YNN C;  1L0W A;  3U4V A;  1HCZ A;  1I4Q A;  3HOX H;  3OWE B;  3PO2 B;  2K28 A;  1SE3 A;  2F0S A;  3I91 A;  2Q8R E;  2NTT A;  1VF7 A;  1EYA A;  1KTK A;  2OTJ A;  3HRZ C;  5F2D A;  1PHJ A;  1GOZ A;  4A3M B;  1OXV A;  1PTO C;  5FLM H;  2XNA C;  3QG1 A;  4RWS C;  3T1Y L;  1D5Z C;  1SFO B;  4A3M G;  3DXJ C;  5CV9 A;  1XNR L;  2VL6 A;  4KKS A;  1CZG A;  4R4Q A;  4RGM A;  1V1O A;  2JA7 B;  1PZK D;  2VY3 A;  3TS0 A;  1Z7T A;  1NR2 A;  1VQP A;  2XWJ B;  2JA7 G;  4KHP Q;  1V43 A;  2LKV A;  3SEB A;  1UE1 A;  4KI0 A;  1X6O A;  4YWM A;  1A3V A;  4BS9 A;  2D0P A;  2QDB A;  1NSN S;  2QA4 A;  1F2L A;  2F0G A;  1MIU A;  2YTV A;  3K58 A;  1AZQ A;  2HHH L;  1PLF A;  3G71 A;  4BY7 H;  1KAW A;  2LXJ A;  3DWQ A;  1KAA A;  1K3B C;  2IX1 A;  1EWH A;  5DM6 3;  3BDL A;  3BG3 A;  4A3L G;  4C1N K;  2MGS A;  1IBM L;  3EJI A;  2RDG A;  3SK5 A;  1TS4 A;  1EEF D;  3SK8 A;  4QUF A;  2HUG A;  4S3S A;  3LWU A;  3IKJ A;  3C3L A;  2F52 A;  3RNU A;  3EVQ A;  3I8Z A;  1E24 A;  1NMG A;  5C3X A;  3ULP A;  1CSQ A;  4DAY B;  3S17 B;  3PV0 A;  3D0F A;  4BY1 G;  1PTO B;  4V19 0;  4A75 A;  1HNW Q;  5KGU A;  3AEV A;  4DR2 L;  4R4T A;  3C1F A;  3CRK C;  3E3X A;  4DV4 Q;  3KF8 A;  3UE0 A;  1DXM A;  4A3I B;  1YNJ D;  5TSS A;  3CRL C;  5IP9 G;  1Z9F A;  1K83 H;  2NVQ B;  3NEL A;  1X3E A;  2XIW A;  1B3Q A;  4DPG A;  4NXM Q;  1A6X A;  2XRS D;  2X69 A;  3HOU H;  4IUV A;  1EY0 A;  1I50 B;  2IWH A;  5DAU A;  5LMU L;  4QCL A;  1OXT A;  3R2T A;  1UUP A;  1JWM D;  3M3Y H;  4UDU C;  1CFM A;  4JBW A;  5E7N A;  1V1P A;  3T56 B;  3QR8 A;  4ZKB B;  4A3L H;  4DU9 A;  5IYC H;  2UXD L;  1YBY A;  3D4D A;  4L5T A;  3OIP A;  2F0U A;  2PI2 A;  1SYG A;  2OQK A;  3I7F A;  3U9O A;  4MIU A;  2CVR A;  4QMG A;  1BF4 A;  4GN5 A;  4BY1 H;  5HY6 A;  2KUM A;  4DV3 Q;  4POG A;  5D3I B;  2F0D A;  3S1Q H;  1R9T H;  4JI3 Q;  5I9P A;  4DNI A;  1LM0 A;  3STB D;  2K33 A;  2ENB A;  5IP9 H;  2R93 H;  1SYC A;  1W6K A;  3H94 A;  2DJG C;  5G3L D;  5HGT A;  1CHP D;  3CCV A;  3H09 A;  2Q2I A;  4B9X A;  3Q0A A;  2VUM H;  1SNO A;  2EXD A;  4C56 C;  4L8J A;  1TVX A;  1VQ8 A;  4RKB A;  4NP5 A;  4A76 A;  4FF4 A;  1XMQ L;  3HS0 C;  3CQZ H;  1JOR A;  1B3A A;  3CAM A;  5EBD A;  5EPL A;  1CK1 A;  3W2D A;  2E76 C;  1QOH A;  1XJV A;  2EYJ A;  1X65 A;  3GQB A;  4RG1 A;  2KJX A;  1IKM A;  1TWF B;  4CDF C;  5JOB A;  1EY9 A;  3H0G G;  4HIM A;  4UP8 A;  3G48 A;  4HSV A;  4Y7N H;  1G6P A;  5L37 A;  5K36 G;  1AH9 A;  4DAV A;  3EN2 A;  1KQS A;  2I07 B;  1F77 A;  1I4P A;  3GTG B;  1W6J A;  3M4O H;  1EYC A;  2A69 C;  1VQA A;  4JI6 Q;  2OT2 A;  4KJN A;  2E5L Q;  1SN8 A;  4H7B A;  5T1I A;  1SNP A;  1VQI A;  3J7A F;  1J9O A;  3EBE A;  4C3J H;  2B2Y A;  4CHT B;  3BDO A;  1CM9 A;  2V1C C;  4JOI A;  3KLW A;  2JYO A;  4HAE A;  2N3S A;  4K5W A;  3GTP H;  1HR0 Q;  3ER0 A;  4OWW B;  4BXX G;  3MXU A;  2C5C A;  2C35 B;  1KL9 A;  4QY7 A;  3W1G A;  2PW7 A;  3PUW A;  4G57 A;  4GNX A;  3H0G H;  2WAQ B;  1KRS A;  2Z6K C;  4JPB W;  3SVM A;  2CW0 C;  4O2D A;  2WAQ G;  3K0Y A;  1QUQ A;  1KLU D;  1SRU A;  3VYS A;  2B29 A;  3I4N B;  1VQO A;  3FKI H;  3S16 H;  2I5L X;  2K05 A;  3MWY W;  1OTC A;  4LF9 Q;  2V4D A;  1PYB A;  4LFC Q;  3KDF B;  1ENA A;  4CKE A;  4ULL A;  5JJL A;  1NJI C;  4QJF A;  4C2M H;  1EZ6 A;  1SE8 A;  2UXC L;  3UDX A;  2L1B A;  1C7Y A;  5M5Y B;  3NBI A;  3HOZ G;  4FF2 A;  2K1B A;  2E2I H;  4DXF A;  1PFS A;  4LF6 L;  1RF2 D;  3DWA A;  4DV2 Q;  1G8Z D;  3K8A A;  4DUZ Q;  3T1H L;  2K04 A;  2NN6 G;  1KDC A;  4BXX H;  3PSI A;  2WII B;  1PH8 A;  1V1Q A;  1G51 A;  4PV1 C;  2R61 A;  1MGS A;  2LXK A;  2BDN A;  5IP7 H;  4XT3 B;  5LMN L;  4C3H H;  3HOY B;  3GP7 A;  2BE5 C;  5EBC A;  2UUA L;  3TP5 A;  4DR7 L;  1SE4 A;  1PH3 A;  1BDO A;  1FNW A;  4ALP A;  1LAB A;  1TWA B;  4R8N A;  5IOC A;  1I3Q B;  4CGY B;  4OL7 A;  2R7D A;  3ERQ A;  1D5M C;  3PF4 A;  5G3L F;  4K6L A;  2E2J H;  3K5N A;  1XTC D;  4X3U A; 
#chains in the Genus database with same CATH homology
 2FFK B;  4XIG S;  2NWG A;  1A2T A;  3RZO B;  3NP8 A;  1Y69 U;  2M2L A;  1UEA B;  1WD0 A;  2ZXR A;  3MTS A;  4IFD G;  3I3C A;  3GTK B;  2IJ0 A;  4KN7 C;  4BA1 I;  3J7Y W;  3E0J A;  5E1F A;  1Y1V B;  1ZEQ X;  4BBS B;  1SEB D;  1Y8P B;  4HMI A;  3GTJ B;  2Z8L A;  2B2W C;  2JE6 I;  1NUC A;  1HHV A;  4H44 C;  4A3E B;  3TDQ A;  3OPO A;  2NVY B;  2A6H D;  5JPN C;  3HOW B;  3QJY A;  5CV5 A;  1GHJ A;  4NDX A;  1TS3 A;  2F3W A;  1SYE A;  1OO9 B;  3KBG A;  5LL6 X;  4KV6 A;  1K8M A;  2EYO A;  1EQV A;  2F0F A;  4IZ8 A;  2R92 B;  4ZRZ A;  2ZXP A;  3MXN A;  1RKN A;  3TZD A;  2EYP A;  3M7G A;  5BN5 A;  1B44 D;  3ZYY X;  3EA6 A;  2D5D A;  1EY8 A;  2PYK A;  4DA2 A;  2SDF A;  1IYV A;  1F9R A;  2Q8T A;  2L12 A;  5CBE E;  2CHB D;  4A3B B;  3S1N B;  5CGK A;  2F0P A;  1JOK A;  1STE A;  1IW7 D;  1EIH A;  2PPB C;  4F87 A;  2AUJ D;  5LHY 1;  1I6V C;  3P20 A;  1ONL A;  2PMZ B;  1D5X C;  4NKL A;  3BVZ A;  4IAL A;  1U9R A;  1ESR A;  1Q12 A;  4A3K B;  5D3D A;  5J39 A;  4R8I A;  1HPC A;  5CC4 A;  1TU2 B;  3L3O C;  3TP6 A;  1X3P A;  2NVT B;  3GTM B;  1F2M A;  1ROD A;  1AZP A;  1H9S B;  1HQM C;  5C4X B;  2WP8 J;  5M3F B;  1RJT A;  1DOM A;  1O78 A;  1HUM A;  1F9Q A;  4KHZ A;  5C44 B;  1WTX A;  4OHJ A;  4HTH A;  1L0Y B;  4GZY C;  3J80 E;  3V05 A;  1NAP A;  4U68 A;  1PXU A;  1SMY D;  4HR7 B;  3S15 B;  5IT9 L;  4KY5 A;  2L0C A;  3FDT A;  4EQN A;  1GUN A;  1EZ8 A;  5CV7 A;  3FVQ A;  4OO1 G;  3VR4 A;  5A35 A;  5JEA G;  4G7Z C;  1LTS D;  1EWC A;  1U4R A;  1B50 A;  3G6J B;  1CI3 M;  5JVH 3;  4LAA A;  3RLF A;  2G9H D;  1TT2 A;  2MUY A;  5LL6 S;  2RA4 A;  4KKT A;  1U4L A;  1GUT A;  3A55 A;  3Q22 A;  1BCP C;  2IT1 A;  2JP1 A;  3K6O A;  5C3E B;  1EY4 A;  2K7V A;  1TII D;  5A2Q E;  4RA8 A;  4LK1 C;  2A6E C;  3TSS A;  5KEE A;  3HOX B;  4DAY A;  2K6A A;  5JEA H;  2XWB B;  3W3A A;  3A54 A;  5HUR A;  1U4M A;  5ELF A;  2WB1 B;  2K5Q A;  1B1Z A;  4XT1 B;  1SXT A;  1TY2 A;  4XDX A;  3OW7 A;  3DEP A;  2KQ3 A;  2SNS A;  5E3F A;  2BA0 A;  5C0X J;  1KDB A;  1S5D D;  3J80 L;  1S5B D;  2QEJ C;  2QKI C;  5IGE A;  4J1M A;  1ML0 D;  2RSN A;  1BCP B;  3D6W A;  4BY7 B;  1MSH A;  2R6G A;  1QNK A;  3BVM A;  5IGG A;  3HKZ B;  4L63 B;  2EYH A;  2A68 C;  2PZU A;  3NK9 A;  1HRJ A;  3PUX A;  4BA2 I;  1ZKO A;  3NTH A;  2KA7 A;  3J81 L;  2XN9 C;  5C0X H;  1II3 A;  1ZYR D;  3VR2 A;  4B9W A;  3NTK A;  1YNJ C;  3QOL A;  3DWP A;  4KTA A;  1T5E A;  4OIJ A;  1FNU A;  5J1Z A;  3OIQ A;  5JVG 3;  3L9A X;  3MVV A;  3NPP A;  4HMJ A;  5KNB A;  2SNM A;  2OEO A;  1F2Y A;  3CU7 A;  3HOU B;  3FRP B;  1CTM A;  3M3Y B;  1ESF A;  1PMR A;  2AQ2 B;  3M4Y A;  1JE4 A;  2N55 A;  3QOJ A;  5C0X I;  1OXS C;  1R4Q B;  2D2C C;  2H1E A;  3OMG A;  2DNE A;  5I9O A;  4U67 3;  1YNN D;  4BY1 B;  4NMZ A;  2EZV A;  1HUN A;  3PIO 3;  3S1Q B;  3T53 B;  1R9T B;  2L11 A;  1CZW A;  3VYU A;  5KIX A;  1AEX A;  1QWY A;  1D1K A;  3FPP A;  4K6D A;  4FF1 A;  3D8G A;  2R93 B;  5DNF A;  1PTO D;  1G2T A;  1PRT C;  2EYL A;  1RHP A;  3F2U A;  3QIA A;  3S9W A;  4M1U B;  1B9M A;  3KK7 A;  4DXG A;  5C5L A;  3CQZ B;  4ID6 A;  1G91 A;  3L7Z C;  5ELD A;  5FO7 B;  2KED A;  4KMU C;  1EU4 A;  1XXG A;  4Y7N B;  3D4W A;  1Q8I A;  1E2Z A;  3RMH A;  2X6L A;  3M4O B;  5FLX E;  4HCE A;  4WFN 3;  2NYZ D;  3LX0 A;  2RDH A;  5I6Y A;  1GUW A;  1STG A;  1S5F D;  3A7A B;  1WTV A;  2TSS A;  5COR A;  1PYW D;  4EVO A;  2FJ2 A;  4C3J G;  4TRD A;  1PRT B;  1HA6 A;  3SHL A;  3GTP B;  3FMC A;  3CKI B;  3H0G B;  2DNC A;  2J4X A;  2A74 C;  3OWF A;  3PUY A;  3GO5 A;  5KYL A;  4IUT A;  4FO2 A;  1GUG A;  2ICE C;  4CKC A;  1JQY D;  2C9O A;  4PNY A;  3FKI B;  3KLS X;  4ZAI A;  4ZK9 B;  3S16 B;  1DYQ A;  4X3K A;  3DMU A;  1EY6 A;  4PMB A;  4MHE A;  4ABN A;  2EYF A;  5NUC A;  1CQF A;  3RUZ A;  3H91 A;  4C2M B;  2A5H A;  2KCC A;  4F88 A;  5T1G A;  3IAY A;  2E2I B;  5CV6 A;  5J22 A;  3VA5 A;  1SE2 A;  1Q1B A;  3H3V C;  1E2W A;  3CHB D;  4F7X A;  2WIN B;  5EGT A;  2B2T C;  4LMQ D;  4HCS A;  5BN4 A;  4C3H B;  1EYD A;  1HTL D;  2N88 A;  2X6G A;  5FO9 B;  4C3H G;  2NBF A;  2PZW A;  2EJF C;  1PTO F;  2E2J B;  4XQQ A;  5IGC A;  2Q8I B;  4ME5 A;  3NUC A;  3HOZ B;  3C46 A;  3TBI B;  2F0V A;  4O42 A;  4ZLT F;  4BWG B;  3URY A;  2D9U A;  2FMC A;  4JK1 C;  1HFG A;  1KNE A;  5I2Y A;  4FP5 D;  2A69 D;  4K5V A;  2B2W A;  4IQZ A;  1BO0 A;  3R3O A;  1M4V A;  1FNV A;  3ND9 A;  3S14 B;  1TR5 A;  4RGT A;  3PMF A;  4ZUJ A;  2AQ1 B;  4WJW A;  1EOT A;  1QG7 A;  4CBV A;  1SJH D;  2H4O A;  1FGB D;  1MD2 D;  2WV6 D;  1BBX C;  2B2V C;  2ZXO A;  5JPM C;  3GTO B;  3K59 A;  1H9S A;  2CW0 D;  2EXZ A;  4G7O C;  4DGZ A;  5KND A;  1F9P A;  1QB5 D;  3R93 A;  1LT4 D;  2EVB A;  2JA8 B;  4DFA A;  1IKL A;  5CYU A;  2EJG C;  5JJZ A;  2R3Z A;  1B9N A;  4C1N I;  2F0H A;  2SEB D;  3BVG A;  4IUP A;  2HDL A;  5D14 A;  5EKI A;  1CT1 D;  3D3R A;  3NBH A;  4KN4 C;  1Y8O B;  4A3F B;  1HQR D;  4ZYS A;  3QB3 A;  5COY A;  2IL8 A;  1WTW A;  4B08 A;  1Y8N B;  2O5I C;  5D65 A;  4EQO A;  1PFB A;  3HZX A;  2BE5 D;  1HA5 A;  4XXE A;  2AWO A;  2NN6 I;  5EQ0 A;  4A93 B;  1PFM A;  2EJM A;  4O1N A;  4J6H A;  3VYR A;  5I6W A;  2WAC A;  2XRQ D;  2EPB A;  5C5M A;  1KDA A;  1XX8 A;  2EOT A;  3DHQ A;  3LNN A;  1LTA D;  4ZKC B;  3MA2 B;  2F0L A;  1QNU A;  1K8O A;  1JCK B;  1MI2 A;  3C1E A;  4RH6 A;  4FYD A;  2B2U C;  4J8Q A;  4EQP A;  2GA4 B;  2L55 A;  2MJ8 A;  4IFD I;  3TP8 A;  3AU7 A;  4XTC S;  2JA6 B;  3GD7 A;  3S1M B;  3ERO A;  4G4K A;  1C48 A;  4XYQ A;  2PNR C;  2KCN A;  1BOS A;  1FD7 D;  3V96 A;  2F0E A;  4FXG C;  3R2I A;  4X3T A;  5EPK A;  1RTN A;  4HN7 A;  1JOQ A;  5KRU A;  1R4P B;  4KD4 A;  2EE1 A;  1G6Z A;  4KHV A;  3SXH A;  1MSG A;  4CJ0 B;  3NWS A;  2I46 A;  2IX0 A;  4ODG A;  1TS2 A;  4ILW A;  2JEB I;  4HED A;  3E6Z X;  2PCF B;  3BS1 A;  1WD1 A;  1EIG A;  2RBM A;  1LAC A;  5JAV A;  4FF3 A;  2BA1 A;  2RSO A;  2YYZ A;  1GUS A;  3QWN A;  5ELE A;  1I4X A;  2E2H B;  1DOK A;  5C6A A;  1SYD A;  1ILP A;  3IL8 A;  4YIJ A;  4A3G B;  3MC0 B;  3ITP A;  1JIC A;  4Q0F A;  3M85 A;  3KLS A;  2IW3 A;  1EU3 A;  1QCB D;  2LFN A;  4I65 A;  4L6T B;  3KUP A;  4LJZ C;  1LT6 D;  1SJE D;  2OXP A;  4DK1 A;  2BCO A;  2F0T A;  2RKS A;  2NVX B;  2FIN B;  2PW5 A;  3S2D B;  1HTP A;  4QB4 A;  2D62 A;  4TQU S;  4ZUI A;  1SAP A;  4K5X A;  4DNT B;  3VR6 A;  1TS5 A;  2WKD A;  1F2Z A;  5CV8 A;  3TN2 A;  1ZXT A;  1ET6 A;  4IUU A;  1DCZ A;  5FO8 B;  1VCI A;  3NHH A;  3R8B A;  5ELB A;  2KHS A;  4K2L A;  1E0B A;  1LLR D;  2E75 C;  1GJX A;  2B63 B;  1EFI D;  2MHV A;  1PZI D;  2ID0 A;  1LTT D;  1S4Z A;  2VB3 X;  4FVM A;  1H9R A;  1ZYR C;  3RD4 A;  5C0X G;  1B4O A;  3MZ5 A;  3VYT A;  1LT5 D;  4RHR A;  3HGB A;  2JA5 B;  4RCN A;  2PQE A;  3J7A V;  1B53 A;  5CR3 A;  3D6C A;  3BZD B;  1E2V A;  2TMP A;  1GHK A;  5CBA E;  5IIF A;  1RDP D;  1JWS D;  2RQX A;  1SND A;  4NW2 A;  2AQ3 B;  3JAM E;  3C2P A;  1FYC A;  1C8C A;  2EY6 A;  2K01 A;  1SYB A;  2DY8 A;  3ND8 A;  5M5W B;  4XYO A;  3H6M A;  1ENC A;  1EY7 A;  1K83 B;  2NUC A;  3LWE A;  5FK9 C;  1XYI A;  2Z4H A;  3WOE A;  2FHT A;  3N6R A;  1EY5 A;  3OHX C;  4FXK C;  1O7Z A;  1LTB D;  3NXW A;  4KY6 A;  5EKK A;  5E4W C;  5A2Q L;  2J0T D;  1DZ1 A;  1AP0 A;  4CJ1 B;  5DEH A;  3MEH A;  5ISR A;  1ENF A;  3M7N A;  4AYB B;  1WTO A;  2JEA I;  2IX3 A;  2PZT A;  4IUN A;  2CQA A;  1STB A;  2NB0 A;  3GV6 A;  4K14 A;  2K5D A;  1SYF A;  2A68 D;  4WRD A;  2VUM B;  4K2K A;  2F0J A;  5M5X B;  2EDG A;  1EEI D;  5C4J B;  3VR3 A;  3MFY A;  3NE5 B;  3QO2 A;  1Q1E A;  3SE0 A;  4H0L C;  3MHB A;  3T16 A;  2F0M A;  2EYM A;  1LV9 A;  3FPU B;  2F03 A;  3MXP A;  1H9M A;  3A8K E;  1BR9 A;  3OMC A;  1WTR A;  5KYI A;  5C4H A;  2JXM B;  3S1R B;  3HP3 A;  3NQI A;  3DUZ A;  4A3D B;  1ILQ A;  1STY A;  2B2T A;  3JAM L;  5FKA C;  2AUK A;  2K32 A;  4C3J B;  2HCI A;  1GUO A;  1CA5 A;  1BCP F;  3VA7 A;  1JR0 D;  1LT3 D;  1F9S A;  1PTO H;  1STH A;  3NSW A;  1G29 1;  1PRT D;  3EFX D;  3I4M B;  1TKW B;  1A3T A;  3PIP 3;  2Y0S B;  1SBB B;  2O4X A;  2VB2 X;  3X3N A;  1Z6H A;  2BDO A;  1MBY A;  1RCV D;  1KAB A;  4RKL A;  3ONA B;  1A15 A;  2LMC B;  3OSO A;  1X3Q A;  3T13 A;  1KNA A;  3FEW X;  1BNZ A;  4TSS A;  5EPJ A;  1A3U A;  4G7H C;  4PMC A;  4WOR A;  1IYU A;  3AMU A;  1NCV A;  1SSO A;  5I2X A;  2BOS A;  1S5C D;  2F4I A;  1PDQ A;  2K03 A;  3DEO A;  2OF1 A;  2KVM A;  3KLR A;  4X3S A;  3UI2 A;  4RCO A;  1GXD C;  2K5W A;  1LTR D;  2B2V A;  2LS0 1;  1SNM A;  4KJO A;  3D31 A;  2B8G A;  4N9T A;  4C3I B;  3V2T A;  1TWC B;  4DF7 A;  3MAQ A;  2F0K A;  1I4G A;  1XWE A;  4C3I G;  3GTQ B;  1Y1W B;  4H13 C;  3Q6S A;  4IUQ A;  1AFP A;  4EGV A;  4RAU C;  5K36 H;  1CQV A;  2NZ1 D;  4KK7 A;  1DM0 B;  3WDN A;  5FLX L;  1S5E D;  3P1H A;  5C4Z A;  4TKO B;  1V1P B;  1OXX K;  2HCC A;  5IGB A;  4I7Z C;  2XVS A;  2F0Q A;  4Q5V A;  1C4Q A;  4CKB A;  1H9J A;  3IFD A;  5CV4 A;  3A8J E;  1VMP A;  1TY0 A;  3P7J A;  1SNQ A;  1O7L A;  3KBX A;  3Q24 A;  1UAP A;  5KNC A;  2J7Z A;  1L0X B;  1D2B A;  1V8Q A;  1BQQ T;  3OOC A;  2A6H C;  4OGQ C;  2L5T A;  1B2T A;  2F1M A;  1WTQ A;  2M00 A;  2AWN A;  1G2S A;  4KD3 A;  2B2Y C;  1M8A A;  4DNR B;  2B39 A;  1IHZ A;  5ELC A;  4DAP A;  2YU9 B;  4DN4 M;  3O13 A;  3TP7 A;  4FXD A;  5IGD A;  4IUR A;  1TWH B;  1PRT F;  5DM7 3;  2QF7 A;  2KOL A;  3X3M A;  1VDZ A;  2EY1 A;  3NTI A;  2B2U A;  5C3W A;  2NN6 H;  1PFN A;  1WTP A;  4IFD J;  3T4A C;  1STA A;  1IW7 C;  3Q23 A;  4N9P A;  4PMW A;  5IOD A;  2EY2 A;  2QCP X;  4R9W A;  4PQX A;  1U4P A;  2FMM A;  5M3M B;  3G7L A;  2KEC A;  1T5X D;  1JOO A;  2B8F A;  1VMC A;  1AN8 A;  3HG9 A;  3I70 A;  5IT9 E;  1OXU A;  2MP1 A;  3BYT B;  1LTG D;  1LTI D;  2EY5 A;  4IFD H;  3EQL C;  1DD2 A;  5EKL A;  3E5S A;  2HDM A;  3N52 A;  3K5M A;  3PUZ A;  1BXT A;  2XSC A;  2RVL A;  3RZD B;  1CHQ D;  1SDF A;  1TQO A;  2F3V A;  2SOB A;  4M8A A;  2QIL A;  1J8I A;  4XQJ A;  4A3J B;  3HEJ A;  1O7Y A;  3IFT A;  3BYY B;  1SMY C;  2M9V A;  1Z47 A;  1A2U A;  3P75 A;  2E2D C;  1PZJ D;  2R7Z B;  4K8I A;  1QJO A;  5K5P A;  1QIL A;  1X32 A;  1D1I A;  4QIW B;  4KKU A;  1VF5 C;  4QF4 A;  3TZU A;  3GTL B;  3DM1 A;  3SR1 A;  5E4X A;  3A7L A;  3I90 A;  3T51 B;  1EL0 A;  2VNU D;  1JC7 A;  1UNS A;  4V0B A;  4KY7 A;  1Q3L A;  1AW7 A;  2A73 B;  2MPM A;  4Z9C B;  5FOB B;  1JWU D;  3MXG A;  3I4L A;  3PUV A;  1TWG B;  1RD9 D;  1I4R A;  1DON A;  4RGO S;  3PO3 B;  2NTS A;  3S2H B;  5I4D A;  2Z4I A;  4OIK A;  2ZT9 C;  3D4R A;  4DK0 A;  3U9S A;  1DJR D;  3K5L A;  1O80 A;  2F0W A;  2IPK D;  2PO4 A;  2ICI A;  4RFB A;  2F0O A;  4RGN A;  3MFG A;  4FNF A;  3SK4 A;  5JEA J;  2DN8 A;  1HFN A;  1BUV T;  1KLG D;  1SNC A;  2WKC A;  1ET9 A;  2DY7 A;  3J81 E;  1LO5 D;  1I4H A;  2HQE A;  4F8M A;  1HXY D;  2L4N A;  3GV3 A;  2F0N A;  2F0I A;  1QE6 A;  3HOV B;  4HSP A;  1FR3 A;  4K8J A;  4XQN A;  4E6I A;  2JSO A;  3I73 A;  3NQT A;  5IGF A;  4P2C B;  1ICW A;  3A56 A;  1CA6 A;  5CMD A;  1DOL A;  4RHS A;  4OO1 H;  2O5J C;  1EQT A;  2LY7 A;  2O2L D;  3K5O A;  4QUC A;  3VR5 A;  1D6E C;  3K7A B;  1RTO A;  1Q90 A;  1NR4 A;  5BN3 A;  3AB9 A;  2KEE A;  3NWT A;  1STN A;  2RDF A;  4BBR B;  4MN3 A;  2VXW A;  3A8I E;  5EJW A;  2Z1C A;  4OO1 I;  4UAI A;  1I6H B;  3I72 A;  3BDC A;  3K57 A;  2G9D A;  4IN3 A;  5M9O A;  1WVL A;  3WOF A;  1JB3 A;  1BCP D;  1H9K A;  4ZQ3 A;  4CJ2 C;  1WCM B;  5AFW A;  2E74 C;  3SK6 A;  1IL8 A;  2L9H A;  2A6E D;  3SDZ A;  3TME A;  1YNN C;  1HCZ A;  1I4Q A;  3OWE B;  3PO2 B;  2K28 A;  1SE3 A;  2F0S A;  3I91 A;  2Q8R E;  2NTT A;  1VF7 A;  1EYA A;  1KTK A;  3HRZ C;  5F2D A;  1GOZ A;  4A3M B;  1OXV A;  1PTO C;  2XNA C;  3QG1 A;  4RWS C;  1D5Z C;  1SFO B;  3DXJ C;  5CV9 A;  4KKS A;  1CZG A;  4RGM A;  1V1O A;  2JA7 B;  1PZK D;  1Z7T A;  1NR2 A;  2XWJ B;  1V43 A;  2LKV A;  3SEB A;  4KI0 A;  1A3V A;  4BS9 A;  2QDB A;  1NSN S;  1F2L A;  2F0G A;  3K58 A;  1AZQ A;  1PLF A;  3DWQ A;  1KAA A;  2IX1 A;  1EWH A;  5DM6 3;  3BDL A;  3BG3 A;  4C1N K;  2MGS A;  3EJI A;  2RDG A;  3SK5 A;  1TS4 A;  1EEF D;  3SK8 A;  4QUF A;  2HUG A;  4S3S A;  3LWU A;  3IKJ A;  3C3L A;  3EVQ A;  3I8Z A;  5C3X A;  3S17 B;  3PV0 A;  1PTO B;  4V19 0;  5KGU A;  3C1F A;  3CRK C;  3KF8 A;  1DXM A;  4A3I B;  1YNJ D;  5TSS A;  3CRL C;  2NVQ B;  2XIW A;  1A6X A;  2XRS D;  2X69 A;  4IUV A;  1EY0 A;  1I50 B;  2IWH A;  5DAU A;  4QCL A;  1OXT A;  1UUP A;  1JWM D;  3R2T A;  4UDU C;  1CFM A;  4JBW A;  1V1P A;  3T56 B;  4ZKB B;  4DU9 A;  3D4D A;  3OIP A;  2F0U A;  1SYG A;  3U9O A;  4MIU A;  2CVR A;  4QMG A;  1BF4 A;  2KUM A;  5D3I B;  2F0D A;  5I9P A;  2K33 A;  2ENB A;  1SYC A;  1W6K A;  3H94 A;  5G3L D;  5HGT A;  1CHP D;  3H09 A;  4B9X A;  3Q0A A;  1SNO A;  4C56 C;  4L8J A;  1TVX A;  4RKB A;  4NP5 A;  4FF4 A;  3HS0 C;  1JOR A;  1B3A A;  5EBD A;  5EPL A;  1CK1 A;  3W2D A;  2E76 C;  1QOH A;  2EYJ A;  3GQB A;  2KJX A;  1IKM A;  1TWF B;  5JOB A;  1EY9 A;  4HSV A;  5K36 G;  4DAV A;  2I07 B;  1F77 A;  1I4P A;  3GTG B;  1W6J A;  1EYC A;  2A69 C;  2OT2 A;  4KJN A;  4H7B A;  5T1I A;  1SNP A;  3J7A F;  1J9O A;  2B2Y A;  4CHT B;  3BDO A;  1CM9 A;  2JYO A;  4HAE A;  4K5W A;  3MXU A;  2C5C A;  2PW7 A;  3PUW A;  4G57 A;  2WAQ B;  3SVM A;  2CW0 C;  3K0Y A;  1KLU D;  3VYS A;  3I4N B;  2K05 A;  3MWY W;  2V4D A;  1ENA A;  4CKE A;  4ULL A;  1EZ6 A;  2L1B A;  5M5Y B;  3NBI A;  4FF2 A;  2K1B A;  4DXF A;  1RF2 D;  3DWA A;  1G8Z D;  2K04 A;  2NN6 G;  1KDC A;  2WII B;  4PV1 C;  2R61 A;  1MGS A;  2BDN A;  4XT3 B;  3HOY B;  3GP7 A;  2BE5 C;  5EBC A;  3TP5 A;  1SE4 A;  1BDO A;  1FNW A;  1LAB A;  5IOC A;  1TWA B;  4R8N A;  1I3Q B;  4CGY B;  4OL7 A;  3ERQ A;  1D5M C;  5G3L F;  4K6L A;  3K5N A;  1XTC D;  4X3U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...