5E1FA

Crystal structure of staphylococcal nuclease variant delta+phs g20e at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDEDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS G20E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5e1fA00
4ZUIA 4LAAA 5ISRA 2OEOA 3PMFA 3MZ5A 3NHHA 2EYFA 3OSOA 5EGTA 2F0VA 3SXHA 3TP8A 5CV7A 2SOBA 4MIUA 5C5LA 3D4DA 5J22A 4DGZA 2F0GA 4DU9A 2F0SA 3MXPA 1STBA 5IGBA 1SYEA 5DEHA 1F2ZA 1SYDA 5C3XA 2EYJA 4HMIA 3C1FA 5C3WA 3P1HA 1EY0A 5CV6A 4EQOA 1F2MA 4ID6A 5KGUA 3EVQA 4DF7A 5C4ZA 4I65A 2F0WA 2PQEA 1EYAA 2F3VA 5IODA 1EY4A 1TT2A 4K5XA 1ENCA 2LKVA 3SK8A 4KY5A 1KDCA 5C5MA 1SNPA 3TP6A 3C1EA 2KQ3A 1F2YA 5CC4A 1SYBA 1JOQA 2F0TA 3E5SA 4KHVA 2OXPA 4KTAA 5KEEA 5EKLA 2OF1A 3D4WA 3D8GA 4J6HA 4NP5A 2F0DA 2F0LA 3MVVA 1EY8A 3EJIA 4PNYA 5F2DA 4NKLA 4OL7A 4RKBA 1TQOA 3MHBA 1SNCA 2F0PA 4G57A 1AEXA 3T13A 2F0JA 2F0UA 1KAAA 2F0NA 3QOJA 4H7BA 1ENAA 3VA5A 5KYIA 2WACA 5NUCA 3TMEA 1U9RA 3QB3A 1EYDA 4IZ8A 1EQVA 3NP8A 4WORA 1EZ6A 2QDBA 3T16A 5IGFA 4PMCA 2RBMA 5J39A 2PZUA 2EY1A 4K5WA 4S3SA 5C4HA 5KIXA 2SNMA 4WRDA 2EYMA 5E1FA 2F0MA 1KDAA 2PYKA 3OWFA 5KRUA 4QB4A 4B9XA 1EZ8A 1STAA 4ME5A 1SYFA 3RUZA 4PMBA 3OMGA 4RKLA 1II3A 4KJOA 4KY7A 2HQEA 4QF4A 4ZUJA 5C6AA 4K2KA 4F8MA 4K5VA 2EXZA 1SNOA 4K2LA 2EYOA 5I6WA 2PW7A 2F0FA 4NDXA 2PW5A 4B9WA 4KD3A 5K5PA 2RDFA 2EY2A 2EYPA 1RKNA 2ENBA 5CV8A 4EVOA 4F7XA 3EROA 4K8JA 5IOCA 3H6MA 5J1ZA 1NSNS 1STNA 1STYA 1EY6A 1SNMA 2PZTA 4KJNA 5IGEA 3DMUA 2EYLA 3HZXA 3SK4A 4DFAA 1KABA 2O4XA 4HTHA 2PZWA 3V2TA 5IIFA 3SK6A 1KDBA 2M00A 1TR5A 2F0EA 5I9OA 3MEHA 3HEJA 1SYGA 4KV6A 5KYLA 3ITPA 1EY7A 2F0HA 1SYCA 4K14A 3TP5A 3NXWA 2F0OA 2F0IA 3OMCA 1A2UA 5JOBA 5CGKA 5IGDA 3SHLA 3BDLA 5I6YA 4N9TA 5CV5A 5EKKA 2EY6A 1A3UA 2F0QA 4IALA 4KD4A 1EYCA 4TRDA 5JAVA 2EY5A 5M9OA 4N9PA 3S9WA 3BDCA 2NUCA 4IUNA 5CR3A 3D6CA 5DAUA 2EYHA 1A3VA 5E3FA 4QMGA 3LX0A 3DHQA 5IGGA 2F0KA 2F3WA 4J1MA 5HURA 1STGA 1JORA 1NUCA 4EQPA 1JOOA 4R8NA 5HGTA 3TP7A 3R3OA 4ODGA 3SK5A 2RKSA 5CV9A 5CV4A 3U9OA 5I9PA 1SNDA 5IGCA 2KHSA 1A3TA 4ZQ3A 1JOKA 1STHA 3QOLA 3NK9A 4K6DA 4K8IA 4NMZA 3NQTA 1SNQA 4E6IA 4EQNA 3P75A 1A2TA 3ERQA 4YIJA 1IHZA 1EY5A 3NUCA 1EY9A 2SNSA 3SR1A 4KY6A 4HMJA
chains in the Genus database with same CATH superfamily
1V1QA 2EDGA 3TN2A 4CKCA 2ID0A 5ISRA 2V4DA 3J81c 2A6EC 4P72A 4CHTB 3L9AX 4KKUA 1C7YA 3CKIB 4JV5Q 5EAYA 1Y1WH 1HNWL 3GO5A 4JVZA 4U68A 2HUGA 3TS2A 3PF4A 2E2JB 1FGBD 2XSCA 1AH9A 1XPRA 4LF7Q 2VY3A 3NBIA 2A6HC 4WJWA 2NVXB 3HG9A 2MNAA 5C3EH 1AZPA 4R8IA 1KAWA 1SMXA 3I90A 3BZKA 3D0FA 3OTOL 1KDCA 1O80A 4IUUA 1KLGD 1YNXA 5CBEE 5CC4A 3HOUH 3S24A 4NP5A 4PG3A 1WTOA 4HJ5A 3CCEA 1VQMA 1NJIC 2ZXOA 3PF5A 1Q1BA 3KBGA 1RJTA 1PH4A 2MUYA 2F0UA 2F0NA 2B8FA 1UEAB 3E0JA 2WB1G 3J7AF 3M4QA 1RTOA 5C4HA 3K7AH 4DV3L 2WIIB 5E1FA 1M8AA 4FXGC 1N9WA 2M2LA 4IPCA 1PH6A 1IKLA 4YY3L 3NBHA 1SDFA 4JI0Q 1HHVA 5IP7G 2F0FA 3T1HL 4KD3A 3J80L 2JJQA 1CKNB 3NTKA 3HOVG 1Y1WB 1H9JA 1WI5A 1NE3A 2KCMA 2L15A 3TZUA 3P7JA 2O4XA 3CPFA 4X6AH 1KD1C 2F0HA 4JV5L 2R7ZB 1S4ZA 3H0GG 4I7AA 3CCSA 2WINB 1VQ5A 5LL6X 1PA6A 1OO9B 4LJZC 3S9WA 3KBXA 3SEBA 1D1IA 4B3RQ 4A3FG 1QVCA 1I50B 3BYYB 1E1OA 2F0KA 1XNRQ 3LWEA 3PUXA 4DV6Q 3CXCA 4LF8Q 2R93G 3GTPH 4X64L 1G8ZD 3G48A 2VQEQ 1YIJA 2K5QA 1HCZA 1B3AA 3NK9A 2J0TD 4PMWA 1Y8OB 4EQNA 1EFWA 1A2TA 4YIJA 1IKMA 1YNND 2VQEL 2D9UA 2IX0A 2F4IA 4X66L 2UXDQ 2NTSA 2XGTA 3J7YW 4GNXA 3NHHA 2HHHL 1PXUA 4OIJA 5FO8B 3H94A 3NENA 1BVSA 3FPUB 4OWXB 3U50C 3GTKB 1WTRA 5J22A 4DGZA 5LMUQ 1SYEA 5M3MG 3HOXH 4A3FB 5ELEA 4DF7A 5IODA 2F3VA 2CVRA 2WV6D 1ILPA 2PMZE 1X55A 2IL8A 1E2WA 1WTQA 3A74A 3NE5B 2LS01 1VQPA 1ET6A 1PZKD 2EE1A 3X3MA 1M90C 4NKLA 3DLLA 4RKBA 1HXYD 3BZCA 3OWEB 1FD7D 2O5JC 1L0WA 1JJ2A 1GKHA 1F9RA 4JI3Q 3AEVA 4XQJA 2YYZA 2CKZB 4C1NK 2E2IH 4JI8L 4C3IG 2K75A 1VS0A 4DUYL 1MSGA 3CC4A 2VW9A 4JI3L 3KDFB 1YZ6A 4BXXH 5AJ3L 2D2CC 1WFQA 2Z6KA 1VQFA 3CHBD 4UAIA 3UDGA 1IBML 1PDQA 4UHVA 4C3IH 2K04A 2Z6KC 2LSSA 5ELCA 3HFZB 3TDQA 3P20A 5J1ZA 2PZTA 2A73B 4KJNA 3TRZA 2NN6I 3PUVA 2JEAI 1P8LA 2M00A 2B2VC 3CCJA 4RGNA 3HOXB 4DR7L 3GTGB 1BCPC 5I6YA 1HQMC 3C2PA 4B3SL 4DNIA 1MBYA 1IBLL 2WAQG 3DHQA 3SE0A 4BBSH 1D5XC 1WD0A 3PSIA 1PH7A 3CRLC 2EJFC 1HZ9A 1Q8IA 4DAYA 1PH9A 1VQHA 2A69C 5BR8Q 1FYCA 4O2DA 5K36G 3CW2C 3VYRA 4E6IA 3DM1A 1XJVA 4X65Q 4ME3A 3NUCA 2NZ1D 4KN7C 2N55A 4XT1B 5DLQE 4OO1H 1CHPD 4HMJA 5EGTA 5M3MB 2KCCA 4IUTA 1UE7A 1F9SA 2A5HA 4DUYQ 3FKIB 3PQIA 4BBRB 2K14A 1JCKB 4R4QA 4A93B 3S2HB 3KLSA 2ZTEA 3BZDB 1SEBD 2Y0SB 3EVQA 5FJ8H 1Q12A 2N88A 2B63H 4G7ZC 4LFAL 3S17B 1TWCB 1JOQA 4HCSA 4OEMB 4A3IH 4EX5A 4DV7L 1Z9FA 4OWWB 3HOUB 3BVZA 1XMOL 5F2DA 1H9RA 3HRZC 3MFYA 4DV4Q 1B1ZA 2OQKA 4DV4L 4HSVA 5GAEC 5FLXc 1Z6HA 4JI0L 1CZWA 4X3KA 5M5XB 2ES2A 3LWUA 1BQQT 4WORA 5LMUL 1G6ZA 5J39A 1GXDC 1HNWQ 3G7LA 3R2TA 5H1SE 4A3KH 1XTCD 2WFWA 1BR9A 1YNJC 3E9HA 4JYAQ 2KHJA 4P71A 1PHJA 4KJOA 4EGVA 4ZUJA 1KL9A 2TSSA 1IYJB 1VDZA 3GTOH 4B9WA 3J80i 1BO0A 1LV9A 2WP8J 3NPPA 1KRSA 4KKSA 5M5WB 5CV8A 4ZAIA 2PQAA 4CJ1B 5IOCA 3FKIG 4A3JB 4CDEC 1EY6A 4FF3A 2XVSA 4DKAC 3R2IA 4OELB 1TR5A 4U673 3HEJA 4KN4C 3OTOQ 3VR6A 3OMCA 3H0GB 4IFDJ 2Z6BA 2Z4HA 1KRTA 1SJED 1D7QA 5DM73 4L5RC 3M4OB 1A3VA 1WCMB 5GROA 2B2UC 2I5HA 1V1OA 4DN4M 1JORA 1HH2P 4BBSB 2GVAA 3KLRA 2A74C 4HIMA 4JI6Q 4DR1Q 4K8IA 1BKBA 3IFTA 1VF7A 1TWAB 2PMZB 1WTPA 4M8AA 5IYBG 1UE6A 1RCVD 2D0OA 3F1ZA 1L1OA 1ENFA 4QIWE 1N33Q 4A3JH 4LF9L 2JA6B 4RGMA 2SOBA 3NBHB 1SN8A 3MXGA 1AZQA 4A3KB 4LK1C 1VQOA 3T1YQ 4B3ML 1DOLA 5JEAG 2Q8TA 1PH1A 1A6XA 4C3IB 3UE0A 1DZ1A 1GUTA 4DAMA 2ZTDA 3SK8A 4KY5A 1SNPA 4LNQA 1LYLA 1S40A 1SYBA 2UXBQ 3PIPA 4KHVA 3CQZH 4KTAA 1P16A 3GD7A 3E6ZX 4Y7NH 2F0LA 2KCNA 3KDFA 5EQ0A 2E2IB 3U58A 4HEDA 2OWOA 3K8AA 4G57A 4ZRZA 2OCEA 5KYIA 2JA8H 2WACA 1EQQA 4A3IB 4GKKQ 1G291 3VR3A 1SE2A 1WVLA 2JP1A 2NVYH 4BBRH 2BCOA 4RCOA 2KVMA 1TWFH 5KRUA 1K0SA 1QILA 4DV1Q 1PVOA 1SXTA 1VQIA 5ELNA 4JCVE 1DOKA 4IUVA 1SR3A 4K2LA 4RGTA 3EIVA 4L5SA 2FXQA 1TWAH 4IFDI 1Y8PB 4A76A 4IN3A 2HHHQ 5IYDG 5C0XH 5IY0A 4DNRB 1R4QB 4X3UA 1HNZL 1VQJA 2YU9H 4KV6A 5KYLA 3GTKH 4QQBX 4JBWA 4JI2Q 1PH2A 4DR2Q 4N9TA 3Q8DA 1SE4A 1A3UA 1XX8A 4LUOA 4OO1G 3RN5A 3E3XA 1ICWA 2B2TA 4C3JB 5DAUA 4AIMA 2R92H 1YNJD 2RVLA 2QILA 3J81L 1NBWA 4RHRA 2F1MA 3BDOA 4DA2A 3BVGA 1I94Q 1GVPA 2DY7A 1PYWD 1DD2A 1NNXA 4ODGA 3U9OA 1B9MA 5IGCA 4A3DG 2K28A 5D65A 2PO4A 1ZXTA 4FDBA 1LLRD 2SNSA 1I6HH 3J7AV 3HS0C 1CSPA 3KFUA 3PMFA 2FMCA 1JB3A 1VQBA 2E2HB 3UDFA 1PLFA 2RHQB 2KEDA 5CMDA 1J5EL 3A5ZB 1TKWB 4XT3B 4P74A 1F2ZA 1Q90A 2ZXPA 3CMAA 2B3GA 2XRQD 5C3WA 2L1BA 4WJ3M 3S1NH 1EYAA 1X3QA 1EY4A 3J81E 1LT4D 5C5MA 1PTOF 2NVQH 5KEEA 1QWYA 4J6HA 2WAQE 5KNBA 5I2YA 4H02A 3AB9A 2CQAA 3I2ZA 4YWLA 1MI2A 3MHBA 4L5QA 1L0XB 1IBLQ 3PUYA 3UI2A 1IW7C 4GLXA 1N34Q 2NB0A 2IPKD 1VQ4A 1EZ6A 1GHJA 2GVBA 4UY8C 4JOIC 3CCUA 3S2HH 1VQCA 2NTTA 2O2LD 2ZT9C 3OWFA 3ND9A 5JVH3 5TSSA 2R6GA 1LT3D 5M5YH 5GADC 4NXNL 4PMBA 1G51A 4HSPA 1II3A 1FNWA 4K2KA 4F8MA 4K5VA 4JI5L 3PO3B 1SNOA 4DPGA 3D6WA 2L9HA 2HCCA 4L63B 1H9KA 3EROA 3H6MA 1DXMA 3HOXG 1DOMA 1IBMQ 3AMUA 1JWMD 1K8GA 2JA5G 4IO9A 4I7ZC 4CBVA 1HZCA 4A3GH 2PNRC 3S15B 4A93H 1MGSA 3SHLA 2Q8RE 2Q2UA 2R61A 4GLVB 1R9TB 5FO9B 4GNXB 4C2MH 1BF4A 4FF1A 2EY5A 4N9PA 4JC0A 2ZJQA 2Q2IA 3WWVA 3KJOA 3J80E 1X3GA 4OX9Q 3PO2H 5IT9E 4A3DB 4GOPB 3K5MA 4BY7G 4ILWA 4O0AA 3S15H 2BDOA 4AYBE 3I55A 4A3LG 1UEBA 1JQYD 2B2YC 3T4AC 1J8IA 1U4MA 3SVMA 2KHSA 1A3TA 4IQZA 3I72A 1PRTF 3RR5A 1N33L 1SNQA 4A3GG 1GD7A 2R7ZH 4C3JG 1S5ED 4UP7A 3I4NH 5A35A 5CYUA 2YU9B 3CF5A 1JB7A 3ULLA 1HFNA 4HJAA 3HOVB 2C5CA 3DWPA 4DV2L 1B3QA 1D5ZC 3VYTA 5CBAE 2VQFL 2ZJPA 3FPPA 2DUDA 2EYFA 3KF6B 4XTCS 2E2DC 4A3BG 3TP8A 2Q2HA 3EFXD 1QE6A 2N49A 3MXPA 1XMQL 4AYBB 3M3YB 1XNRL 3GTLB 1OXUA 1V1PB 2R7DA 1ONLA 2JYOA 2BH2A 4Y52H 2JA7H 1G91A 2F0TA 4X64Q 2OXPA 4FVMA 2UU9L 1PTOH 1SNCA 2F0PA 2A68D 4H7BA 5M5XH 1ENAA 3M9BA 4A3IG 1U9RA 1BCPB 3QWNA 2K32A 1CQFA 3V96A 1K83B 2PZUA 5AFWA 2IHEA 1PRTD 2KECA 3G71A 4KLKA 1AFPA 3T1HQ 3S1RH 1STAA 1HUMA 3MAQA 4TVAB 4DXGA 4CGYB 2B2TC 2SEBD 3RLOA 3S14B 2L11A 1G2TA 1SJHD 4YY3Q 2JSOA 4GZYC 1KXLA 1N8RC 3TQYA 4A3EB 4C56C 1FJGQ 1CA6A 4F7XA 3I4NB 4DV2Q 1STNA 2IJ0A 4MNOA 3DMUA 1XWEA 1Q1EA 1BBXC 3QO2A 2PZWA 3M4PA 3SK6A 3EA6A 4QUFA 2CH4A 4NXNQ 3GTPB 1FGUA 3GTLH 1BUVT 1V9PA 4FF4A 1QNKA 3TP5A 1OXXK 5CGKA 3SDZA 5JOBA 1C48A 4KHZA 4DK0A 4H13C 3TBIB 2NN6H 3H15A 5M9OA 1L1OB 4IPDA 4NXMQ 1K8OA 1YJNA 4CDCC 2K05A 3BYTB 2RA4A 4IOAA 1VMCA 5C4XB 2VB2X 2JEBI 2XN9C 2OTJA 5I9PA 4C3HB 4A3EG 4A3KG 3Q22A 4R9WA 3BVMA 4ZQ3A 5LMNL 2IT1A 5EPKA 3SR1A 1I3QH 1X32A 3ULJA 4PV1C 4IFDH 3MZ5A 1D8LA 3DEOA 2UXCL 2K5DA 5M5WH 1QVGA 1NAPA 2F0GA 1I6VC 3GDEA 1CK1A 1O78A 4LF6L 1NR2A 1QUQA 4X65L 1EY0A 4EQOA 5ELFA 5KGUA 5C4ZA 4RWSC 5FJ8G 3PIP3 5BR8L 4JOIA 2YTXA 4DK1A 3EN2A 3H3VI 3T51B 1SSOA 3VR5A 5I2XA 2PNHA 2KOLA 5M3FG 3MVVA 1A63A 2ZM6Q 4XQNA 1QVFA 4V0BA 1O7LA 4NXML 3S14H 1VQ6A 1KQSA 3RZOB 4K0KQ 2K33A 1EYDA 2KCTA 2C35B 3Q23A 2ZM6L 3J81i 1X9NA 3QG1A 1HA6A 3M7NA 1SYFA 1S5CD 2HQLA 1CFMA 2H4OA 1JWSD 3L3OC 3KJPA 3ULPA 3T53B 5IYCG 3WOEA 1J5EQ 3OPOA 4LFBL 3JAML 1MJEA 1IL2A 4LF6Q 1PRTB 3M3YH 5IYBH 3F2CA 3I4OA 5IIFA 1O7ZA 3IRBA 1L2FA 1FVIA 4JI7L 1AE2A 3VYSA 4IURA 1YHAA 2I5MX 3EQLC 2E2JH 1TU2B 2QEXA 1CI3M 2R93H 5C0XG 5T1IA 1LTBD 4JW0A 1NMFA 3MFGA 3I4NG 3D6CA 2HT1A 3HOWH 1IL8A 2QEJC 4A3MG 3MEFA 2MP1A 5FLMG 1TY2A 1X3PA 2RQXA 2XWBB 2BE5D 2K01A 3B6YA 3J7ZC 3SK5A 1E0BA 3KF6A 3STBC 2UUCL 4NMZA 1YVCA 2K1BA 2PI2A 1PYSB 1LTSD 4FNFA 4IJHA 3OOCA 5G3LF 1Y69U 1CKOA 2CWPA 4YWMA 2JA8G 1XMQQ 1I50H 3CD6A 4GKJQ 2ALYB 1BCPD 3KLSX 1JE5A 3I56A 3A8JE 1PMRA 4JBJA 1H9SB 1ICFB 1STBA 1SFOH 3L0OA 4UP8A 4HCEA 5EPLA 3P1HA 4IJLA 5CV6A 3FDTA 2B2WA 4OONA 2WKDA 4I65A 4FP5D 2XIWA 2B2YA 1ENCA 3I3CA 3F2DA 1W2BA 1EIYB 4HIOA 1CQVA 1C9OA 2A69D 2Z0SA 1QUQB 5EKLA 3D8GA 1Q82C 2NBFA 1E22A 5HGQA 3DM3A 1PTOB 1TVXA 2CWAA 4A3JG 1F9QA 4OX9L 3QOJA 1SAPA 1ET9A 2PCFB 4IZ8A 3FP9A 3NP8A 4QL5A 2AMCB 1TWCH 4LWCA 2RBMA 1ZYRC 1PV4A 2EY1A 2MQHA 4K5WA 2B63B 1VQ7A 2HDMA 5CORA 1FNUA 5M3FH 4O1NA 2F03A 2VUMG 1HR0Q 3PCOB 5C6AA 1TIID 3DUZA 4DR2L 2CFMA 2XTIA 3S2DH 1K8MA 1LUZA 5K5PA 2B2VA 1NSNS 2VUMB 4P73A 5IGEA 4XQQA 3HZXA 5FKAC 4ZYSA 1I3QB 2BOSA 1I4PA 3H09A 3TS0A 1GUNA 2JA5B 2MO0A 4A3CG 3W1BA 4TRDA 3BJUA 3BDCA 4HJ7A 2B2UA 1NR4A 1XYIA 2Y0SG 1JICA 1KIXA 4MN3A 3F2UA 3A54A 4A3DH 3GTGH 4GKKL 1XMOQ 2IWHA 5JJKA 3RD4A 3TP7A 4UP9A 3M85A 5CV4A 2CW0D 1SNDA 1CT1D 2X6GA 5C4JB 5LMNQ 4A3BH 2R92B 3D3RA 1WJJA 5D3DA 1IHZA 3MXUA 4OWTB 4OO1I 4GN5A 4LF4L 3NTIA 2F52A 2JA9A 4C3JH 2R7ZG 1K0RA 1EQRA 2Q2TA 1AN8A 1YHBA 5E7NA 3SGIA 1Q8KA 4B3MQ 5C3XA 2Z9HA 5C0XJ 2VUMH 2VB3X 4IUQA 1B7YB 5IWAL 2QKIC 1Y8NB 3F2BA 4K5XA 5EBCA 3PO2G 1K28A 4DR5L 2VQFQ 4YHHL 1LABA 1OXSC 4ZKCB 2KQ3A 4QY7A 3E5SA 1IW7D 4QGUA 4PZ6A 3ICEA 4RH6A 4XIGS 3R8BA 4ALPA 5HY6A 4BY1B 1KAAA 4DV7Q 2HDLA 4C3HG 5C44G 2YV5A 4K0KL 2NVQB 4PMCA 3KLWA 1TWGB 4DV5Q 3HKZG 4CJ0B 3J7A5 4QB4A 3IKJA 1HNZQ 3S1MB 3OIPA 4AYBG 1GO3E 4BWGB 2EQSA 4GN4B 4BBSG 4Y7NB 1Y1VH 4MTKA 2PW5A 4A75A 4EVOA 1EOVA 1WCMG 1TS4A 3WOFA 2I0QA 1PYBA 2KEEA 2E5LL 2EYLA 4DFAA 1KTKA 3V2TA 1TXYA 1C8CA 1EY7A 2MPMA 1LTTD 2L55A 3KUPA 1K3RA 3I4LA 1SFOB 1PTOD 2H1EA 4BY7B 2EVBA 3A5UA 2F0QA 4JYAL 5JAVA 4ZK9B 1IZ6A 3MWYW 1ML0D 2L5TA 2BE5C 2K4KA 5EPJA 1WTXA 4A3BB 1HQRD 1T5EA 1VQ8A 4M1UB 3ONAB 3KOJA 3NWTA 3K6OA 3K0YA 5EKIA 1SROA 4BY7H 1TS2A 4ZLTF 3CCLA 2K6AA 3P75A 3NQIA 2IHFA 1Y1VB 1DJRD 1WCMH 1OXTA 1U4RA 3W3AA 2UUBL 3PO3G 5C5LA 2TMPA 2JN4A 4IPGA 2VZAA 1L1OC 1N36L 3K81C 1E7ZA 2F0SA 1GJXA 1EWHA 4X66Q 2UXDL 4AQYL 4HMIA 3C1FA 4LF5L 1MKHA 1MSHA 3M7GA 2QW7A 1LO5D 3S2DB 1CUKA 4L8JA 4OXPA 1K9MC 3TP6A 3GTJH 3C1EA 1YI2A 1PH8A 4KI0A 2E5LQ 4RA8A 1D6EC 5BN4A 2OT2A 1EY8A 2VL6A 1EEFD 4JG2A 4OL7A 4DV0Q 1ZKOA 4Q0FA 5IE8A 4RMFA 1LT6D 2E74C 3T16A 4H44C 5IGFA 3KK7A 3W1GA 5JJLA 1Q3LA 2FHTA 2F0MA 4HN7A 5C3EG 1RTNA 3CCRA 4RGOS 3W5OA 1A8VA 4B9XA 3K59A 4HAEA 3RZOH 3RUZA 3BG3A 4RKLA 1NY4A 1TWHB 1ILQA 4BXXG 5JJIA 2KUMA 2NWGA 4P75A 4IUPA 5FLMH 4DXFA 4BY1G 2ENBA 1AE3A 1KLUD 2ZJRA 1WTWA 4GNXC 1D2BA 1SMYC 1STYA 3RNUA 3SK4A 5JEAJ 5I4DA 4F87A 4R4TA 1VQ9A 2X69A 4LF9Q 4NPSA 4PZ8A 1MJCA 3K58A 4DK6C 2ATWA 5IP9H 3JAMc 1R4PB 2AKWB 2ASBA 3HOZH 3PO2B 2A19A 1XNQL 3A0JA 2IY5B 2CHBD 4DR3Q 1V1PA 3BS1A 3HOVH 1CM9A 2MO1A 1CKNA 4H0LC 3HP3A 3N6RA 1VCIA 1U4LA 3GQBA 4R8NA 1W6JA 1BOSA 1NCVA 1JT8A 2R92G 4B3RL 4YCWA 3A8KE 1VQGA 2GN5A 4KY6A 1HZBA 2K52A 2HCIA 3ERSX 4B08A 1HPCA 2F0VA 2AUKA 1STEA 3HOZB 1ESRA 1TWFB 1BNZA 3C3LA 3I4MB 2CQOA 4R4CA 1B2TA 2EYJA 2ZXRA 4J15A 2B39A 2L12A 4LFBQ 2PQEA 4BY1H 1TT2A 1JWUD 1UE1A 1M4VA 2IW3A 2A8VA 3L7ZC 4PZ7A 5E4WC 3LNNA 1YJWA 2HD3A 1PRTC 2LXJA 1Q46A 4OGQC 3VDYA 3PGZA 5ELOA 3EJIA 2G5DA 4YWKA 4G7HC 1Z47A 2BA0A 3RLNA 2F0JA 4CKEA 3CQZB 1EQVA 4LW1A 2AHOB 1LM0A 3U9SA 5A2QL 2RCNA 5EBDA 1UUPA 1VF5C 1U5KA 4S3SA 1YHQA 5IP7H 1Y1VG 1B8AA 2UUCQ 1EWCA 1BXTA 1V43A 4AH6A 4X62L 1F9PA 2K50A 4RFBA 5KNCA 4BA1I 2VNUD 2JA7B 2FINB 2BDNA 2FFKB 4QIWB 1EUJA 1GUOA 2J4XA 5I6WA 1Q86C 2AWNA 2UUAQ 1O7YA 1SLJA 1S72A 5D14A 4JI4Q 3OYYA 1CKMA 1SNMA 3K57A 2G9HD 2UXBL 4A3CH 3VR4A 5M3MH 5BN3A 1KABA 3U4VA 1EYGA 3I4MH 3S1NB 1PTOC 2RSNA 3MEHA 1SYGA 2X6LA 1J9OA 2R7FA 1EL0A 2Y0SE 2NVXH 2RHSB 1C4QA 3CC2A 2A6ED 1KNAA 5IGDA 1IYUA 1JE4A 1EWIA 3MA2B 2F4VL 4YCUA 4N8X1 4XDXA 2WKCA 1JC7A 3PIO3 1TS3A 1NMGA 3I8ZA 5C4XH 5E3FA 1N32Q 2IX1A 3Q6SA 2KJXA 3PUZA 3NELA 1LTRD 4F88A 4GKJL 2QA4A 4AQYQ 4YCVA 1CTMA 1GUWA 3K0XA 2RKSA 2KHIA 3ND8A 2PI2E 4K6DA 4ABNA 4JI6L 2Z1CA 1I4RA 3ERQA 3MTSA 1EY9A 4UDUC 1R9TH 3IAYA 1VQLA 4PNYA 1PZID 4ZUIA 1IXRA 4HJ9A 3BU2A 3IL8A 2NVTH 3UDXA 4X3SA 4QJFA 3IFDA 4K6LA 2RF4A 2KBNA 1HJPA 1SYDA 4JI1Q 3CMEA 1UAPA 4NW2A 4DR6L 1IBKQ 2LY7A 4DNTB 2F0WA 3S1RB 1QOHA 2LKVA 5AJ3Q 1WTHA 5JVG3 1E24A 2CCZA 3I70A 4TKOB 1DYQA 3T13A 4KMUC 2EZVA 5NUCA 3TMEA 3QB3A 1X6OA 4LUZA 1WOCA 2JXMB 4WRDA 3UE1A 1B53A 4N8FA 2AQ2B 1GUSA 4FYDA 5G3LD 4DUZL 4LFCL 2HQEA 4LF5Q 1VQNA 3HOYH 1EFID 2GA4B 4POGA 4EQ5A 1N36Q 2QCPX 4WFN3 5JPMC 3K5NA 1RKNA 4JBMA 4IFDG 4R4IA 2EIFA 3CRKC 1X3FA 3F8TA 2KENA 3E9IA 5I9OA 4B3SQ 2MHVA 3GTQH 1G2SA 2JE6I 1FNVA 3KF8A 5BN5A 2E2HH 4JI2L 4DR4Q 2F0OA 1A15A 4OIKA 3Q0AA 1NTGA 1C0AA 5CV5A 3CU7A 2JK8A 2NYZD 4IALA 3HOWB 4ZCKA 4L5TA 2MFIA 2MGSA 2BH8A 3U4ZA 5IWAQ 4IPHA 1EIHA 1WYDA 4LMQD 1FJGL 1GUGA 1HA5A 3I91A 4MZ9A 3DEPA 4DV6L 2N8NA 1JOOA 3TZDA 1E2VA 5HGTA 3V05A 5C4JH 2K7VA 1HZAA 2OTLA 3TSSA 3WDNA 4RHSA 3MC0B 1HNXL 2IX3A 2KA7A 4JPBW 4FF2A 2SDFA 3AU7A 3K7UC 2K5VA 1E3PA 3AFQA 3DWAA 1W3SA 2K03A 3RN2A 4DUZQ 3HKSA 3OIQA 3H3VC 5FO7B 3D4DA 3HOYG 3AFPA 5IGBA 5LMNW 1K83H 2AWOA 3N52A 1YEZA 1EOTA 1EIFA 3VR2A 2I46A 4BBRG 2EXDA 5GAHC 3GTQB 2R3ZA 3FMCA 4RG1A 4OHJA 1D5MC 1XNQQ 3FHWA 3STBD 1S5FD 1T5XD 5C44B 3S1MH 2OF1A 3D4WA 1K73C 3FVQA 3GTOB 2MJ8A 4JBKA 4DR1L 3G6JB 2NVYB 3AYHB 3D4RA 3GTJB 3OHXC 2O5IC 2HIXA 4DR6Q 1AEXA 4DR3L 2E76C 1TY0A 2AUJD 1B9NA 2JQOA 4Z9CB 1EU4A 1VMPA 1ESFA 1RD9D 4YHHQ 4DR4L 2N78A 1PFNA 2EYMA 3VYUA 1I4GA 2LMCB 4ME5A 4CDDC 3O13A 2JA8B 3OMGA 1HR0L 1B70B 3CCVA 5ELDA 1ZEQX 3QIAA 5LHY1 2PW7A 3MXNB 3JAMi 4DAVA 2E75C 3ER0A 2YTYA 1GM5A 2EOTA 1I4XA 4A3MB 2OQ0A 3URYA 3OW2A 4HTHA 4C3HH 1PFBA 1B44D 4LFAQ 3JC66 4FXDA 4K14A 1HNXQ 2UU9Q 1PZJD 1FL0A 5ELBA 2LXKA 1JR0D 1ZYRD 2EY6A 4G4KA 4DK3C 4HIKA 2Q8IB 2CW0C 2QDLA 1B50A 2V1CC 3AQQA 2D62A 3I73A 3GV3A 1W6KA 3LX0A 1EEID 1D1KA 1UNSA 3MXNA 2P5ZX 1STGA 1NUCA 4GS3A 1Q7YC 5L37A 2DNEA 5CV9A 1YITA 1BDOA 2B8GA 5LL6S 2XNAC 3NWSA 1GOZA 4JI4L 3NQTA 4A3MH 4GOPA 4A3GB 3Q24A 1QG7A 4MTNA 3I4MG 2R93B 2JA5H 2I07B 1E2ZA 1ASZA 2OEOA 2DJFC 2HIVA 3T56B 2ZTCA 2YTVA 4MIUA 2N3SA 4DU9A 1SE8A 3NSWA 4LF7L 3M4YA 4HR7B 1QCBD 2QGQA 4DV0L 1I4HA 2I5LX 1F2MA 1XPUA 1AP0A 1JJCB 4JK1C 4ZKBB 4APVA 2H5XA 1B4OA 3TEHB 3A55A 1G6PA 3CC7A 2AQ3B 3GV6A 2WAQB 2RDHA 3CAMA 1JJGA 1DM0B 3KYHC 3CCMA 1J6QA 1ASYA 3I7FA 2XRSD 2M9VA 5C44H 1LTAD 2QDBA 4B3TQ 1X56A 5KIXA 4DV3Q 3FRPB 2DN8A 1L0YB 4G7OC 1EZ8A 4O42A 3ZYYX 5JJZA 4A3LH 1BBWA 1MHWC 1QJOA 4X62Q 3HOUG 4KHPL 4QF4A 1QZHA 1X65A 1Y14B 1RF2D 5C4XG 2EYPA 2B2WC 3S17H 1KC8C 1T9HA 1FR3A 2DY8A 5IT9c 2ICEC 3NTHA 1LACA 1N34L 1JMCA 3GTMB 1UWVA 4A93G 2K5HA 3ITPA 1LTID 5K36H 1K8AC 4DAYB 3RMHA 2F0IA 2L0CA 1A2UA 1Y1WG 4PQXA 3BDLA 4X3TA 1HFGA 1GHKA 5FOBB 4KD4A 2DGYA 3RZDB 2NUCA 3FKIH 4IUNA 4NB3A 4ULLA 3PV0A 5CR3A 1DONA 2EYHA 2B29A 3CCQA 4A4IA 4MHEA 1RDPD 2VS1A 5HURA 2AQ1B 2K5WA 1BBUA 2PPBC 4LF8L 3G4SA 2LFNA 3R3OA 1U4PA 4JI8Q 4DV1L 5DNFA 2NZOA 1IYVA 4JI7Q 1H9MA 3PUWA 1EY5A 4LUVA 1HTLD 3QR8A 3PIOA 3EBEA 1MIUA 2EPBA 5E4XA 4DV5L 1F2LA 2D5DA 1CHQD 3GP7A 4BS9A 5CV7A 4HJ8A 5M3FB 1WTVA 4P2CB 5DEHA 3HOYB 1QZGA 4RAUC 5GAGC 3G6EA 3C46A 2B63G 4ID6A 3LGJA 3K5OA 3HOWG 1RL2A 5IT9L 2A6HD 1M1KC 1F2YA 1VQEA 4QCLA 4R1JA 2F0DA 1E1TA 1AW7A 5DM63 3VA7A 1SRUA 3VA5A 1HRJA 3NEMA 2SNMA 4CKBA 2QF7A 2PYKA 2FMMA 5IYCH 4KY7A 5JEAH 1PH3A 1X3EA 2JA7G 5D3IB 1PFMA 2CH4W 2EYOA 2F4VQ 1SE3A 1LTLA 1U0LA 2RDFA 2EY2A 3R93A 2EJMA 2JA6H 4K8JA 1X54A 3S1QH 1SBBB 4BA2I 2Z4IA 5JPNC 5A2QE 5IP9G 4XXEA 1KDBA 2L4NA 1SYCA 5KNDA 2E8GA 2NZHA 4R4OA 1LTGD 3FEWX 3KF8B 2BA1A 4L6TB 3T1YL 4DAPA 2ICIA 1XPOA 3RLFA 5FLXE 5IGGA 3M4OH 1OTCA 1A62A 1S5DD 1VQAA 4J1MA 1RHPA 3S16H 1CA5A 2DJGC 4WJ4A 3H0GH 1JOKA 4XYOA 3S1QB 4RCNA 3HGBA 4JI5Q 3GTMH 3QOLA 1QB5D 1RODA 3A7AB 4LAAA 1S3OA 4V190 1O7IA 1XXGA 1YJ9A 1KNEA 2UUBQ 3OSOA 3SXHA 3DXJC 1PH5A 3TREA 3W2DA 4A3EH 2Z8LA 4J8QA 3K5LA 4LFCQ 3E0EA 3UDIA 3CP0A 4GOPC 3L2PA 2JA6G 5FLXL 1VQDA 2EJGC 2PQAB 3OW7A 2RSOA 4KK7A 4IOCA 4KHPQ 1TWHH 2F3IA 1CZGA 5M5YB 5T1GA 5FK9C 1CSQA 1QNUA 1H9SA 3H91A 4C1NI 3PO3H 2A1AA 3K7AB 3K80C 5COYA 4HIDA 1TWGH 4CDFC 4B3TL 1TQOA 3HKZB 4FO2A 1DGSA 1HTPA 2J7ZA 2K5NA 5EJWA 1RIPA 2WB1B 5IYDH 3JAME 2RCFA 3QJYA 1EQTA 1EU3A 4KKTA 2A68C 1WD1A 1KDAA 1IBKL 4CJ2C 3CPWA 4LF4Q 4JI1L 1SMYD 1EIGA 3D31A 4QUCA 2EXZA 1LT5D 1BCPF 3A56A 1A0IA 4NDXA 4XYQA 1I5FA 5C3EB 4A3FH 1HR0W 3HKZE 2XWJB 2UUAL 1H95A 1HUNA 4GN3B 2RDGA 2WB1E 1YNNC 1Z7TA 2F0EA 4POFA 1I94L 3A8IE 5J3BA 4DR7Q 3NXWA 1KHIA 1Q81C 1S5BD 1I6HB 2D0PA 3J80c 4TSSA 5EKKA 1YBYA 1K3BC 1TS5A 3H3VH 1EYCA 4DR5Q 5C0XI 3DWQA 2G9DA 4GLAC 4UPAA 3RZDH 2NVTB 2VXWA 1N32L 2C9OA 4QMGA 1VQKA 4Q5VA 4FXKC 3ZJYC 2F3WA 1F77A 1PFSA 1I4QA 4EQPA 3HOZG 1MD2D 5GQOA 4TQUS 1V8QA 3A7LA 1OXVA 3X3NA 1STHA 2FJ2A 3S16B 1UE5A 2UXCQ 2DNCA 4C2MB 3J81j 1XTDA 1DCZA 2NN6G
chains in the Genus database with same CATH topology
2EDGA 3TN2A 4CKCA 2ID0A 5ISRA 2V4DA 2A6EC 4CHTB 3L9AX 4KKUA 3CKIB 3GO5A 4U68A 2HUGA 2E2JB 1FGBD 2XSCA 3NBIA 2A6HC 4WJWA 2NVXB 3HG9A 1AZPA 4R8IA 3I90A 1KDCA 1O80A 4IUUA 1KLGD 5CBEE 5CC4A 4NP5A 1WTOA 2ZXOA 1Q1BA 3KBGA 1RJTA 2MUYA 2F0UA 2F0NA 2B8FA 1UEAB 3E0JA 3J7AF 5C4HA 1RTOA 2WIIB 5E1FA 1M8AA 4FXGC 2M2LA 1IKLA 3NBHA 1SDFA 1HHVA 2F0FA 4KD3A 3J80L 3NTKA 1Y1WB 1H9JA 3TZUA 3P7JA 2O4XA 2F0HA 2R7ZB 1S4ZA 2WINB 5LL6X 1OO9B 3S9WA 4LJZC 3KBXA 3SEBA 1D1IA 1I50B 3BYYB 2F0KA 3LWEA 3PUXA 1G8ZD 2K5QA 1HCZA 1B3AA 3NK9A 2J0TD 4PMWA 1Y8OB 4EQNA 1A2TA 4YIJA 1IKMA 1YNND 2D9UA 2IX0A 2F4IA 2NTSA 3J7YW 3NHHA 1PXUA 4OIJA 5FO8B 3H94A 3FPUB 3GTKB 1WTRA 5J22A 4DGZA 1SYEA 4A3FB 5ELEA 4DF7A 5IODA 2F3VA 2CVRA 2WV6D 1ILPA 2IL8A 1E2WA 1WTQA 3NE5B 2LS01 1ET6A 1PZKD 2EE1A 3X3MA 4NKLA 4RKBA 1HXYD 3OWEB 1FD7D 2O5JC 1F9RA 4XQJA 2YYZA 4C1NK 4C3IG 1MSGA 2D2CC 3CHBD 4UAIA 1PDQA 2K04A 5ELCA 3TDQA 3P20A 5J1ZA 2PZTA 2A73B 4KJNA 2NN6I 3PUVA 2JEAI 2M00A 2B2VC 4RGNA 3HOXB 3GTGB 1BCPC 5I6YA 1HQMC 3C2PA 1MBYA 3DHQA 3SE0A 1D5XC 1WD0A 3CRLC 2EJFC 1Q8IA 4DAYA 2A69C 1FYCA 5K36G 3VYRA 4E6IA 3DM1A 4KN7C 3NUCA 2NZ1D 4XT1B 2N55A 4OO1H 1CHPD 4HMJA 5EGTA 5M3MB 2KCCA 4IUTA 1F9SA 2A5HA 3FKIB 4BBRB 1JCKB 4A93B 3S2HB 3KLSA 3BZDB 1SEBD 2Y0SB 3EVQA 1Q12A 2N88A 4G7ZC 3S17B 1TWCB 1JOQA 4HCSA 3HOUB 3BVZA 5F2DA 1H9RA 3HRZC 3MFYA 1B1ZA 4HSVA 1Z6HA 1CZWA 4X3KA 5M5XB 3LWUA 1BQQT 4WORA 1G6ZA 5J39A 1GXDC 3G7LA 3R2TA 1XTCD 1BR9A 1YNJC 4KJOA 4EGVA 4ZUJA 2TSSA 1VDZA 4B9WA 1BO0A 1LV9A 2WP8J 3NPPA 5M5WB 4KKSA 5CV8A 4ZAIA 4CJ1B 5IOCA 4A3JB 1EY6A 4FF3A 2XVSA 3R2IA 1TR5A 4U673 3HEJA 4KN4C 3VR6A 3OMCA 3H0GB 4IFDJ 2Z4HA 1SJED 5DM73 3M4OB 1A3VA 1WCMB 2B2UC 1V1OA 4DN4M 1JORA 4BBSB 3KLRA 2A74C 4K8IA 3IFTA 1VF7A 1TWAB 2PMZB 1WTPA 4M8AA 1RCVD 1ENFA 2JA6B 4RGMA 2SOBA 3MXGA 1AZQA 4A3KB 4LK1C 1DOLA 5JEAG 2Q8TA 1A6XA 4C3IB 1DZ1A 1GUTA 3SK8A 4KY5A 1SNPA 1SYBA 4KHVA 4KTAA 3GD7A 3E6ZX 2F0LA 2KCNA 5EQ0A 2E2IB 4HEDA 4G57A 4ZRZA 5KYIA 2WACA 4A3IB 1G291 3VR3A 1SE2A 1WVLA 2JP1A 2BCOA 4RCOA 2KVMA 5KRUA 1QILA 1SXTA 1DOKA 4IUVA 4K2LA 4RGTA 4IFDI 1Y8PB 4IN3A 5C0XH 4DNRB 1R4QB 4X3UA 4KV6A 5KYLA 4JBWA 4N9TA 1SE4A 1A3UA 1XX8A 4OO1G 1ICWA 2B2TA 4C3JB 5DAUA 1YNJD 2RVLA 2QILA 3J81L 4RHRA 2F1MA 3BDOA 4DA2A 3BVGA 2DY7A 1PYWD 1DD2A 4ODGA 3U9OA 1B9MA 5IGCA 2K28A 5D65A 2PO4A 1ZXTA 1LLRD 2SNSA 3J7AV 3HS0C 3PMFA 2FMCA 1JB3A 2E2HB 1PLFA 2KEDA 5CMDA 1TKWB 4XT3B 1F2ZA 1Q90A 2ZXPA 2XRQD 5C3WA 2L1BA 1EYAA 1X3QA 1EY4A 3J81E 1LT4D 5C5MA 1PTOF 5KEEA 1QWYA 4J6HA 5KNBA 5I2YA 3AB9A 2CQAA 1MI2A 3MHBA 1L0XB 3PUYA 3UI2A 1IW7C 2NB0A 2IPKD 1EZ6A 1GHJA 2O2LD 2NTTA 2ZT9C 3OWFA 3ND9A 5JVH3 5TSSA 2R6GA 1LT3D 4PMBA 4HSPA 1II3A 1FNWA 4K2KA 4F8MA 4K5VA 3PO3B 1SNOA 3D6WA 2L9HA 2HCCA 4L63B 1H9KA 3EROA 3H6MA 1DXMA 1DOMA 3AMUA 1JWMD 4I7ZC 4CBVA 2PNRC 3S15B 1MGSA 3SHLA 2Q8RE 2R61A 1R9TB 5FO9B 1BF4A 4FF1A 2EY5A 4N9PA 3J80E 5IT9E 4A3DB 3K5MA 4ILWA 2BDOA 1JQYD 2B2YC 3T4AC 1J8IA 1U4MA 3SVMA 2KHSA 1A3TA 4IQZA 3I72A 1PRTF 1SNQA 4C3JG 1S5ED 5A35A 5CYUA 2YU9B 1HFNA 3HOVB 2C5CA 3DWPA 1D5ZC 5CBAE 3VYTA 3FPPA 2EYFA 4XTCS 2E2DC 3TP8A 3EFXD 1QE6A 3MXPA 3M3YB 4AYBB 3GTLB 1OXUA 1V1PB 1ONLA 2JYOA 1G91A 2F0TA 2OXPA 4FVMA 1PTOH 1SNCA 2F0PA 2A68D 4H7BA 1ENAA 1U9RA 1BCPB 3QWNA 2K32A 1CQFA 3V96A 1K83B 2PZUA 5AFWA 1PRTD 2KECA 1AFPA 1STAA 1HUMA 3MAQA 4DXGA 4CGYB 2B2TC 2SEBD 3S14B 2L11A 1G2TA 1SJHD 2JSOA 4GZYC 4A3EB 4C56C 1CA6A 4F7XA 3I4NB 1STNA 2IJ0A 3DMUA 1XWEA 1Q1EA 1BBXC 3QO2A 2PZWA 3SK6A 3EA6A 4QUFA 3GTPB 1BUVT 4FF4A 1QNKA 3TP5A 1OXXK 5CGKA 3SDZA 5JOBA 1C48A 4KHZA 4DK0A 4H13C 3TBIB 2NN6H 5M9OA 1K8OA 2K05A 3BYTB 2RA4A 1VMCA 5C4XB 2VB2X 2JEBI 2XN9C 5I9PA 4C3HB 3Q22A 4R9WA 3BVMA 4ZQ3A 2IT1A 5EPKA 3SR1A 1X32A 4PV1C 4IFDH 3MZ5A 3DEOA 2K5DA 1NAPA 2F0GA 1I6VC 1CK1A 1O78A 1NR2A 1EY0A 4EQOA 5ELFA 5KGUA 5C4ZA 4RWSC 3PIP3 4DK1A 3T51B 1SSOA 3VR5A 5I2XA 2KOLA 3MVVA 4XQNA 4V0BA 1O7LA 3RZOB 2K33A 1EYDA 3Q23A 3QG1A 1HA6A 3M7NA 1SYFA 1S5CD 1CFMA 2H4OA 1JWSD 3L3OC 3T53B 3WOEA 3OPOA 3JAML 1PRTB 5IIFA 1O7ZA 3VYSA 4IURA 3EQLC 1TU2B 1CI3M 5C0XG 5T1IA 1LTBD 3MFGA 3D6CA 1IL8A 2QEJC 2MP1A 1TY2A 1X3PA 2RQXA 2XWBB 2BE5D 2K01A 3SK5A 1E0BA 4NMZA 2K1BA 4FNFA 1LTSD 5G3LF 3OOCA 1Y69U 1BCPD 3KLSX 3A8JE 1PMRA 1H9SB 1STBA 4HCEA 5EPLA 3P1HA 5CV6A 3FDTA 2B2WA 2WKDA 4I65A 4FP5D 2XIWA 2B2YA 1ENCA 3I3CA 1CQVA 2A69D 5EKLA 3D8GA 2NBFA 1PTOB 1TVXA 1F9QA 3QOJA 1SAPA 1ET9A 2PCFB 4IZ8A 3NP8A 2RBMA 1ZYRC 2EY1A 4K5WA 2B63B 2HDMA 5CORA 1FNUA 4O1NA 2F03A 5C6AA 1TIID 3DUZA 1K8MA 5K5PA 2B2VA 1NSNS 2VUMB 5IGEA 4XQQA 3HZXA 5FKAC 4ZYSA 1I3QB 2BOSA 1I4PA 3H09A 1GUNA 2JA5B 4TRDA 3BDCA 2B2UA 1NR4A 1XYIA 1JICA 4MN3A 3F2UA 3A54A 2IWHA 3RD4A 3TP7A 3M85A 5CV4A 2CW0D 1SNDA 1CT1D 2X6GA 5C4JB 2R92B 3D3RA 5D3DA 1IHZA 3MXUA 4OO1I 3NTIA 1AN8A 5C3XA 5C0XJ 2VB3X 4IUQA 2QKIC 1Y8NB 4K5XA 5EBCA 1LABA 1OXSC 4ZKCB 2KQ3A 3E5SA 1IW7D 4RH6A 4XIGS 3R8BA 4BY1B 1KAAA 2HDLA 4C3HG 2NVQB 4PMCA 1TWGB 4CJ0B 4QB4A 3IKJA 3S1MB 3OIPA 4BWGB 4Y7NB 2PW5A 4EVOA 1TS4A 3WOFA 2KEEA 2EYLA 4DFAA 1KTKA 3V2TA 1C8CA 1EY7A 2MPMA 1LTTD 2L55A 3KUPA 3I4LA 1SFOB 1PTOD 2H1EA 4BY7B 2EVBA 2F0QA 5JAVA 4ZK9B 3MWYW 1ML0D 2L5TA 2BE5C 5EPJA 1WTXA 4A3BB 1HQRD 1T5EA 4M1UB 3ONAB 3NWTA 3K6OA 3K0YA 5EKIA 1TS2A 4ZLTF 2K6AA 3P75A 3NQIA 1Y1VB 1DJRD 1OXTA 1U4RA 3W3AA 5C5LA 2TMPA 2F0SA 1GJXA 1EWHA 4HMIA 3C1FA 1MSHA 3M7GA 1LO5D 3S2DB 4L8JA 3TP6A 3C1EA 4KI0A 4RA8A 1D6EC 5BN4A 2OT2A 1EY8A 1EEFD 4OL7A 1ZKOA 4Q0FA 1LT6D 2E74C 3T16A 4H44C 5IGFA 3KK7A 1Q3LA 2FHTA 2F0MA 4HN7A 1RTNA 4RGOS 4B9XA 3K59A 4HAEA 3RUZA 3BG3A 4RKLA 1TWHB 1ILQA 2KUMA 2NWGA 4IUPA 4DXFA 2ENBA 1KLUD 1WTWA 1D2BA 1SMYC 1STYA 3SK4A 5JEAJ 5I4DA 4F87A 2X69A 3K58A 1R4PB 3PO2B 2CHBD 1V1PA 3BS1A 1CM9A 4H0LC 3HP3A 3N6RA 1VCIA 1U4LA 3GQBA 4R8NA 1W6JA 1BOSA 1NCVA 3A8KE 4KY6A 2HCIA 4B08A 1HPCA 2F0VA 2AUKA 1STEA 3HOZB 1ESRA 1TWFB 1BNZA 3C3LA 3I4MB 1B2TA 2EYJA 2ZXRA 2B39A 2L12A 2PQEA 1TT2A 1JWUD 1M4VA 2IW3A 3L7ZC 5E4WC 3LNNA 1PRTC 4OGQC 3EJIA 4G7HC 1Z47A 2BA0A 2F0JA 4CKEA 3CQZB 1EQVA 5A2QL 3U9SA 5EBDA 1UUPA 1VF5C 4S3SA 1EWCA 1BXTA 1V43A 2JA7B 1F9PA 4RFBA 5KNCA 2VNUD 4BA1I 2FINB 2BDNA 2FFKB 4QIWB 1GUOA 2J4XA 5I6WA 2AWNA 1O7YA 5D14A 1SNMA 3K57A 2G9HD 3VR4A 5BN3A 1KABA 3S1NB 1PTOC 2RSNA 3MEHA 1SYGA 2X6LA 1J9OA 1EL0A 1C4QA 2A6ED 1KNAA 5IGDA 1IYUA 1JE4A 3MA2B 4XDXA 2WKCA 1JC7A 3PIO3 1TS3A 3I8ZA 5E3FA 2IX1A 3Q6SA 2KJXA 3PUZA 1LTRD 4F88A 1CTMA 1GUWA 2RKSA 3ND8A 4K6DA 4ABNA 2Z1CA 1I4RA 3ERQA 3MTSA 1EY9A 4UDUC 3IAYA 4PNYA 1PZID 4ZUIA 3IL8A 4X3SA 3IFDA 4K6LA 1SYDA 1UAPA 4NW2A 2LY7A 4DNTB 2F0WA 3S1RB 1QOHA 2LKVA 5JVG3 3I70A 4TKOB 1DYQA 3T13A 4KMUC 2EZVA 5NUCA 3TMEA 3QB3A 2JXMB 4WRDA 1B53A 2AQ2B 1GUSA 4FYDA 5G3LD 2HQEA 1EFID 2GA4B 2QCPX 4WFN3 5JPMC 3K5NA 1RKNA 4IFDG 3CRKC 5I9OA 2MHVA 1G2SA 2JE6I 1FNVA 3KF8A 5BN5A 2F0OA 1A15A 4OIKA 3Q0AA 5CV5A 3CU7A 2NYZD 4IALA 3HOWB 2MGSA 1EIHA 4LMQD 1GUGA 1HA5A 3I91A 3DEPA 3TZDA 1JOOA 1E2VA 5HGTA 3V05A 2K7VA 3TSSA 3WDNA 4RHSA 3MC0B 2IX3A 2KA7A 4FF2A 2SDFA 3AU7A 3DWAA 2K03A 3OIQA 3H3VC 5FO7B 3D4DA 5IGBA 2AWOA 3N52A 1EOTA 3VR2A 2I46A 3GTQB 2R3ZA 3FMCA 4OHJA 1D5MC 1S5FD 1T5XD 5C44B 2OF1A 3D4WA 3FVQA 3GTOB 2MJ8A 3G6JB 2NVYB 3D4RA 3GTJB 3OHXC 2O5IC 1AEXA 2E76C 1TY0A 2AUJD 1B9NA 4Z9CB 1EU4A 1VMPA 1ESFA 1RD9D 1PFNA 2EYMA 3VYUA 1I4GA 2LMCB 4ME5A 2JA8B 3O13A 3OMGA 5ELDA 1ZEQX 3QIAA 5LHY1 2PW7A 4DAVA 2E75C 2EOTA 1I4XA 4A3MB 3URYA 4HTHA 1PFBA 1B44D 4FXDA 4K14A 1PZJD 5ELBA 1JR0D 1ZYRD 2EY6A 4G4KA 2Q8IB 2CW0C 1B50A 2D62A 3I73A 3GV3A 1W6KA 3LX0A 1EEID 1D1KA 1UNSA 3MXNA 1STGA 1NUCA 2DNEA 5CV9A 1BDOA 2B8GA 5LL6S 2XNAC 3NWSA 1GOZA 3NQTA 4A3GB 3Q24A 1QG7A 2R93B 2I07B 1E2ZA 2OEOA 3T56B 4MIUA 4DU9A 3NSWA 3M4YA 4HR7B 1QCBD 1I4HA 1F2MA 1AP0A 4JK1C 4ZKBB 1B4OA 3A55A 2AQ3B 3GV6A 2WAQB 2RDHA 1DM0B 2XRSD 2M9VA 1LTAD 2QDBA 5KIXA 3FRPB 2DN8A 1L0YB 4G7OC 1EZ8A 4O42A 3ZYYX 5JJZA 1QJOA 4QF4A 1RF2D 2EYPA 2B2WC 1FR3A 2DY8A 2ICEC 3NTHA 1LACA 3GTMB 3ITPA 1LTID 5K36H 3RMHA 2F0IA 2L0CA 1A2UA 4PQXA 3BDLA 4X3TA 1HFGA 1GHKA 5FOBB 4KD4A 3RZDB 2NUCA 4IUNA 5CR3A 4ULLA 3PV0A 1DONA 2EYHA 4MHEA 1RDPD 5HURA 2AQ1B 2K5WA 2PPBC 2LFNA 3R3OA 1U4PA 5DNFA 1IYVA 1H9MA 3PUWA 1EY5A 1HTLD 2EPBA 5E4XA 1F2LA 2D5DA 1CHQD 3GP7A 4BS9A 5CV7A 5M3FB 1WTVA 4P2CB 5DEHA 3HOYB 4RAUC 3C46A 4ID6A 3K5OA 5IT9L 2A6HD 1F2YA 4QCLA 2F0DA 1AW7A 5DM63 3VA7A 3VA5A 1HRJA 2SNMA 4CKBA 2QF7A 2PYKA 2FMMA 4KY7A 5JEAH 5D3IB 1PFMA 2EYOA 1SE3A 2RDFA 3R93A 2EY2A 2EJMA 4K8JA 1SBBB 4BA2I 2Z4IA 5JPNC 5A2QE 4XXEA 1KDBA 2L4NA 1SYCA 5KNDA 1LTGD 3FEWX 2BA1A 4L6TB 4DAPA 2ICIA 3RLFA 5FLXE 5IGGA 1S5DD 4J1MA 1RHPA 1CA5A 1JOKA 4XYOA 3S1QB 4RCNA 3HGBA 3QOLA 1QB5D 1RODA 3A7AB 4LAAA 4V190 1XXGA 1KNEA 3OSOA 3SXHA 3DXJC 3W2DA 2Z8LA 4J8QA 3K5LA 5FLXL 2EJGC 3OW7A 2RSOA 4KK7A 1CZGA 5M5YB 5T1GA 5FK9C 1QNUA 1H9SA 3H91A 4C1NI 3K7AB 5COYA 1TQOA 3HKZB 4FO2A 1HTPA 2J7ZA 5EJWA 2WB1B 3JAME 3QJYA 1EQTA 1EU3A 4KKTA 2A68C 1WD1A 1KDAA 4CJ2C 1SMYD 1EIGA 3D31A 4QUCA 2EXZA 1LT5D 1BCPF 3A56A 4XYQA 4NDXA 5C3EB 2XWJB 1HUNA 2RDGA 1YNNC 1Z7TA 2F0EA 3A8IE 3NXWA 1S5BD 1I6HB 4TSSA 5EKKA 1TS5A 1EYCA 5C0XI 3DWQA 2G9DA 2NVTB 2VXWA 2C9OA 4QMGA 4Q5VA 4FXKC 2F3WA 1F77A 1I4QA 4EQPA 1MD2D 4TQUS 1V8QA 3A7LA 1OXVA 3X3NA 1STHA 2FJ2A 3S16B 2DNCA 4C2MB 1DCZA 2NN6G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZUI A;  4LAA A;  5ISR A;  2OEO A;  3PMF A;  3MZ5 A;  3NHH A;  2EYF A;  3OSO A;  5EGT A;  2F0V A;  3SXH A;  3TP8 A;  5CV7 A;  2SOB A;  4MIU A;  5C5L A;  3D4D A;  5J22 A;  4DGZ A;  2F0G A;  4DU9 A;  2F0S A;  3MXP A;  1STB A;  5IGB A;  1SYE A;  5DEH A;  1F2Z A;  1SYD A;  5C3X A;  2EYJ A;  4HMI A;  3C1F A;  5C3W A;  3P1H A;  1EY0 A;  5CV6 A;  4EQO A;  1F2M A;  4ID6 A;  5KGU A;  3EVQ A;  4DF7 A;  5C4Z A;  4I65 A;  2F0W A;  2PQE A;  1EYA A;  2F3V A;  5IOD A;  1EY4 A;  1TT2 A;  4K5X A;  1ENC A;  2LKV A;  3SK8 A;  4KY5 A;  1KDC A;  5C5M A;  1SNP A;  3TP6 A;  3C1E A;  2KQ3 A;  1F2Y A;  5CC4 A;  1SYB A;  1JOQ A;  2F0T A;  3E5S A;  4KHV A;  2OXP A;  4KTA A;  5KEE A;  5EKL A;  2OF1 A;  3D4W A;  3D8G A;  4J6H A;  4NP5 A;  2F0D A;  2F0L A;  3MVV A;  1EY8 A;  3EJI A;  4PNY A;  5F2D A;  4NKL A;  4OL7 A;  4RKB A;  1TQO A;  3MHB A;  1SNC A;  2F0P A;  4G57 A;  1AEX A;  3T13 A;  2F0J A;  2F0U A;  1KAA A;  2F0N A;  3QOJ A;  4H7B A;  1ENA A;  3VA5 A;  5KYI A;  2WAC A;  5NUC A;  3TME A;  1U9R A;  3QB3 A;  1EYD A;  4IZ8 A;  1EQV A;  3NP8 A;  4WOR A;  1EZ6 A;  2QDB A;  3T16 A;  5IGF A;  4PMC A;  2RBM A;  5J39 A;  2PZU A;  2EY1 A;  4K5W A;  4S3S A;  5C4H A;  5KIX A;  2SNM A;  4WRD A;  2EYM A;  5E1F A;  2F0M A;  1KDA A;  2PYK A;  3OWF A;  5KRU A;  4QB4 A;  4B9X A;  1EZ8 A;  1STA A;  4ME5 A;  1SYF A;  3RUZ A;  4PMB A;  3OMG A;  4RKL A;  1II3 A;  4KJO A;  4KY7 A;  2HQE A;  4QF4 A;  4ZUJ A;  5C6A A;  4K2K A;  4F8M A;  4K5V A;  2EXZ A;  1SNO A;  4K2L A;  2EYO A;  5I6W A;  2PW7 A;  2F0F A;  4NDX A;  2PW5 A;  4B9W A;  4KD3 A;  5K5P A;  2RDF A;  2EY2 A;  2EYP A;  1RKN A;  2ENB A;  5CV8 A;  4EVO A;  4F7X A;  3ERO A;  4K8J A;  5IOC A;  3H6M A;  5J1Z A;  1NSN S;  1STN A;  1STY A;  1EY6 A;  1SNM A;  2PZT A;  4KJN A;  5IGE A;  3DMU A;  2EYL A;  3HZX A;  3SK4 A;  4DFA A;  1KAB A;  2O4X A;  4HTH A;  2PZW A;  3V2T A;  5IIF A;  3SK6 A;  1KDB A;  2M00 A;  1TR5 A;  2F0E A;  5I9O A;  3MEH A;  3HEJ A;  1SYG A;  4KV6 A;  5KYL A;  3ITP A;  1EY7 A;  2F0H A;  1SYC A;  4K14 A;  3TP5 A;  3NXW A;  2F0O A;  2F0I A;  3OMC A;  1A2U A;  5JOB A;  5CGK A;  5IGD A;  3SHL A;  3BDL A;  5I6Y A;  4N9T A;  5CV5 A;  5EKK A;  2EY6 A;  1A3U A;  2F0Q A;  4IAL A;  4KD4 A;  1EYC A;  4TRD A;  5JAV A;  2EY5 A;  5M9O A;  4N9P A;  3S9W A;  3BDC A;  2NUC A;  4IUN A;  5CR3 A;  3D6C A;  5DAU A;  2EYH A;  1A3V A;  5E3F A;  4QMG A;  3LX0 A;  3DHQ A;  5IGG A;  2F0K A;  2F3W A;  4J1M A;  5HUR A;  1STG A;  1JOR A;  1NUC A;  4EQP A;  1JOO A;  4R8N A;  5HGT A;  3TP7 A;  3R3O A;  4ODG A;  3SK5 A;  2RKS A;  5CV9 A;  5CV4 A;  3U9O A;  5I9P A;  1SND A;  5IGC A;  2KHS A;  1A3T A;  4ZQ3 A;  1JOK A;  1STH A;  3QOL A;  3NK9 A;  4K6D A;  4K8I A;  4NMZ A;  3NQT A;  1SNQ A;  4E6I A;  4EQN A;  3P75 A;  1A2T A;  3ERQ A;  4YIJ A;  1IHZ A;  1EY5 A;  3NUC A;  1EY9 A;  2SNS A;  3SR1 A;  4KY6 A;  4HMJ A; 
#chains in the Genus database with same CATH topology
 1V1Q A;  2EDG A;  3TN2 A;  4CKC A;  2ID0 A;  5ISR A;  2V4D A;  3J81 c;  2A6E C;  4P72 A;  4CHT B;  3L9A X;  4KKU A;  1C7Y A;  3CKI B;  4JV5 Q;  5EAY A;  1Y1W H;  1HNW L;  3GO5 A;  4JVZ A;  4U68 A;  2HUG A;  3TS2 A;  3PF4 A;  2E2J B;  1FGB D;  2XSC A;  1AH9 A;  1XPR A;  4LF7 Q;  2VY3 A;  3NBI A;  2A6H C;  4WJW A;  2NVX B;  3HG9 A;  2MNA A;  5C3E H;  1AZP A;  4R8I A;  1KAW A;  1SMX A;  3I90 A;  3BZK A;  3D0F A;  3OTO L;  1KDC A;  1O80 A;  4IUU A;  1KLG D;  1YNX A;  5CBE E;  5CC4 A;  3HOU H;  3S24 A;  4NP5 A;  4PG3 A;  1WTO A;  4HJ5 A;  3CCE A;  1VQM A;  1NJI C;  2ZXO A;  3PF5 A;  1Q1B A;  3KBG A;  1RJT A;  1PH4 A;  2MUY A;  2F0U A;  2F0N A;  2B8F A;  1UEA B;  3E0J A;  2WB1 G;  3J7A F;  3M4Q A;  1RTO A;  5C4H A;  3K7A H;  4DV3 L;  2WII B;  5E1F A;  1M8A A;  4FXG C;  1N9W A;  2M2L A;  4IPC A;  1PH6 A;  1IKL A;  4YY3 L;  3NBH A;  1SDF A;  4JI0 Q;  1HHV A;  5IP7 G;  2F0F A;  3T1H L;  4KD3 A;  3J80 L;  2JJQ A;  1CKN B;  3NTK A;  3HOV G;  1Y1W B;  1H9J A;  1WI5 A;  1NE3 A;  2KCM A;  2L15 A;  3TZU A;  3P7J A;  2O4X A;  3CPF A;  4X6A H;  1KD1 C;  2F0H A;  4JV5 L;  2R7Z B;  1S4Z A;  3H0G G;  4I7A A;  3CCS A;  2WIN B;  1VQ5 A;  5LL6 X;  1PA6 A;  1OO9 B;  4LJZ C;  3S9W A;  3KBX A;  3SEB A;  1D1I A;  4B3R Q;  4A3F G;  1QVC A;  1I50 B;  3BYY B;  1E1O A;  2F0K A;  1XNR Q;  3LWE A;  3PUX A;  4DV6 Q;  3CXC A;  4LF8 Q;  2R93 G;  3GTP H;  4X64 L;  1G8Z D;  3G48 A;  2VQE Q;  1YIJ A;  2K5Q A;  1HCZ A;  1B3A A;  3NK9 A;  2J0T D;  4PMW A;  1Y8O B;  4EQN A;  1EFW A;  1A2T A;  4YIJ A;  1IKM A;  1YNN D;  2VQE L;  2D9U A;  2IX0 A;  2F4I A;  4X66 L;  2UXD Q;  2NTS A;  2XGT A;  3J7Y W;  4GNX A;  3NHH A;  2HHH L;  1PXU A;  4OIJ A;  5FO8 B;  3H94 A;  3NEN A;  1BVS A;  3FPU B;  4OWX B;  3U50 C;  3GTK B;  1WTR A;  5J22 A;  4DGZ A;  5LMU Q;  1SYE A;  5M3M G;  3HOX H;  4A3F B;  5ELE A;  4DF7 A;  5IOD A;  2F3V A;  2CVR A;  2WV6 D;  1ILP A;  2PMZ E;  1X55 A;  2IL8 A;  1E2W A;  1WTQ A;  3A74 A;  3NE5 B;  2LS0 1;  1VQP A;  1ET6 A;  1PZK D;  2EE1 A;  3X3M A;  1M90 C;  4NKL A;  3DLL A;  4RKB A;  1HXY D;  3BZC A;  3OWE B;  1FD7 D;  2O5J C;  1L0W A;  1JJ2 A;  1GKH A;  1F9R A;  4JI3 Q;  3AEV A;  4XQJ A;  2YYZ A;  2CKZ B;  4C1N K;  2E2I H;  4JI8 L;  4C3I G;  2K75 A;  1VS0 A;  4DUY L;  1MSG A;  3CC4 A;  2VW9 A;  4JI3 L;  3KDF B;  1YZ6 A;  4BXX H;  5AJ3 L;  2D2C C;  1WFQ A;  2Z6K A;  1VQF A;  3CHB D;  4UAI A;  3UDG A;  1IBM L;  1PDQ A;  4UHV A;  4C3I H;  2K04 A;  2Z6K C;  2LSS A;  5ELC A;  3HFZ B;  3TDQ A;  3P20 A;  5J1Z A;  2PZT A;  2A73 B;  4KJN A;  3TRZ A;  2NN6 I;  3PUV A;  2JEA I;  1P8L A;  2M00 A;  2B2V C;  3CCJ A;  4RGN A;  3HOX B;  4DR7 L;  3GTG B;  1BCP C;  5I6Y A;  1HQM C;  3C2P A;  4B3S L;  4DNI A;  1MBY A;  1IBL L;  2WAQ G;  3DHQ A;  3SE0 A;  4BBS H;  1D5X C;  1WD0 A;  3PSI A;  1PH7 A;  3CRL C;  2EJF C;  1HZ9 A;  1Q8I A;  4DAY A;  1PH9 A;  1VQH A;  2A69 C;  5BR8 Q;  1FYC A;  4O2D A;  5K36 G;  3CW2 C;  3VYR A;  4E6I A;  3DM1 A;  1XJV A;  4X65 Q;  4ME3 A;  3NUC A;  2NZ1 D;  4KN7 C;  2N55 A;  4XT1 B;  5DLQ E;  4OO1 H;  1CHP D;  4HMJ A;  5EGT A;  5M3M B;  2KCC A;  4IUT A;  1UE7 A;  1F9S A;  2A5H A;  4DUY Q;  3FKI B;  3PQI A;  4BBR B;  2K14 A;  1JCK B;  4R4Q A;  4A93 B;  3S2H B;  3KLS A;  2ZTE A;  3BZD B;  1SEB D;  2Y0S B;  3EVQ A;  5FJ8 H;  1Q12 A;  2N88 A;  2B63 H;  4G7Z C;  4LFA L;  3S17 B;  1TWC B;  1JOQ A;  4HCS A;  4OEM B;  4A3I H;  4EX5 A;  4DV7 L;  1Z9F A;  4OWW B;  3HOU B;  3BVZ A;  1XMO L;  5F2D A;  1H9R A;  3HRZ C;  3MFY A;  4DV4 Q;  1B1Z A;  2OQK A;  4DV4 L;  4HSV A;  5GAE C;  5FLX c;  1Z6H A;  4JI0 L;  1CZW A;  4X3K A;  5M5X B;  2ES2 A;  3LWU A;  1BQQ T;  4WOR A;  5LMU L;  1G6Z A;  5J39 A;  1GXD C;  1HNW Q;  3G7L A;  3R2T A;  5H1S E;  4A3K H;  1XTC D;  2WFW A;  1BR9 A;  1YNJ C;  3E9H A;  4JYA Q;  2KHJ A;  4P71 A;  1PHJ A;  4KJO A;  4EGV A;  4ZUJ A;  1KL9 A;  2TSS A;  1IYJ B;  1VDZ A;  3GTO H;  4B9W A;  3J80 i;  1BO0 A;  1LV9 A;  2WP8 J;  3NPP A;  1KRS A;  4KKS A;  5M5W B;  5CV8 A;  4ZAI A;  2PQA A;  4CJ1 B;  5IOC A;  3FKI G;  4A3J B;  4CDE C;  1EY6 A;  4FF3 A;  2XVS A;  4DKA C;  3R2I A;  4OEL B;  1TR5 A;  4U67 3;  3HEJ A;  4KN4 C;  3OTO Q;  3VR6 A;  3OMC A;  3H0G B;  4IFD J;  2Z6B A;  2Z4H A;  1KRT A;  1SJE D;  1D7Q A;  5DM7 3;  4L5R C;  3M4O B;  1A3V A;  1WCM B;  5GRO A;  2B2U C;  2I5H A;  1V1O A;  4DN4 M;  1JOR A;  1HH2 P;  4BBS B;  2GVA A;  3KLR A;  2A74 C;  4HIM A;  4JI6 Q;  4DR1 Q;  4K8I A;  1BKB A;  3IFT A;  1VF7 A;  1TWA B;  2PMZ B;  1WTP A;  4M8A A;  5IYB G;  1UE6 A;  1RCV D;  2D0O A;  3F1Z A;  1L1O A;  1ENF A;  4QIW E;  1N33 Q;  4A3J H;  4LF9 L;  2JA6 B;  4RGM A;  2SOB A;  3NBH B;  1SN8 A;  3MXG A;  1AZQ A;  4A3K B;  4LK1 C;  1VQO A;  3T1Y Q;  4B3M L;  1DOL A;  5JEA G;  2Q8T A;  1PH1 A;  1A6X A;  4C3I B;  3UE0 A;  1DZ1 A;  1GUT A;  4DAM A;  2ZTD A;  3SK8 A;  4KY5 A;  1SNP A;  4LNQ A;  1LYL A;  1S40 A;  1SYB A;  2UXB Q;  3PIP A;  4KHV A;  3CQZ H;  4KTA A;  1P16 A;  3GD7 A;  3E6Z X;  4Y7N H;  2F0L A;  2KCN A;  3KDF A;  5EQ0 A;  2E2I B;  3U58 A;  4HED A;  2OWO A;  3K8A A;  4G57 A;  4ZRZ A;  2OCE A;  5KYI A;  2JA8 H;  2WAC A;  1EQQ A;  4A3I B;  4GKK Q;  1G29 1;  3VR3 A;  1SE2 A;  1WVL A;  2JP1 A;  2NVY H;  4BBR H;  2BCO A;  4RCO A;  2KVM A;  1TWF H;  5KRU A;  1K0S A;  1QIL A;  4DV1 Q;  1PVO A;  1SXT A;  1VQI A;  5ELN A;  4JCV E;  1DOK A;  4IUV A;  1SR3 A;  4K2L A;  4RGT A;  3EIV A;  4L5S A;  2FXQ A;  1TWA H;  4IFD I;  1Y8P B;  4A76 A;  4IN3 A;  2HHH Q;  5IYD G;  5C0X H;  5IY0 A;  4DNR B;  1R4Q B;  4X3U A;  1HNZ L;  1VQJ A;  2YU9 H;  4KV6 A;  5KYL A;  3GTK H;  4QQB X;  4JBW A;  4JI2 Q;  1PH2 A;  4DR2 Q;  4N9T A;  3Q8D A;  1SE4 A;  1A3U A;  1XX8 A;  4LUO A;  4OO1 G;  3RN5 A;  3E3X A;  1ICW A;  2B2T A;  4C3J B;  5DAU A;  4AIM A;  2R92 H;  1YNJ D;  2RVL A;  2QIL A;  3J81 L;  1NBW A;  4RHR A;  2F1M A;  3BDO A;  4DA2 A;  3BVG A;  1I94 Q;  1GVP A;  2DY7 A;  1PYW D;  1DD2 A;  1NNX A;  4ODG A;  3U9O A;  1B9M A;  5IGC A;  4A3D G;  2K28 A;  5D65 A;  2PO4 A;  1ZXT A;  4FDB A;  1LLR D;  2SNS A;  1I6H H;  3J7A V;  3HS0 C;  1CSP A;  3KFU A;  3PMF A;  2FMC A;  1JB3 A;  1VQB A;  2E2H B;  3UDF A;  1PLF A;  2RHQ B;  2KED A;  5CMD A;  1J5E L;  3A5Z B;  1TKW B;  4XT3 B;  4P74 A;  1F2Z A;  1Q90 A;  2ZXP A;  3CMA A;  2B3G A;  2XRQ D;  5C3W A;  2L1B A;  4WJ3 M;  3S1N H;  1EYA A;  1X3Q A;  1EY4 A;  3J81 E;  1LT4 D;  5C5M A;  1PTO F;  2NVQ H;  5KEE A;  1QWY A;  4J6H A;  2WAQ E;  5KNB A;  5I2Y A;  4H02 A;  3AB9 A;  2CQA A;  3I2Z A;  4YWL A;  1MI2 A;  3MHB A;  4L5Q A;  1L0X B;  1IBL Q;  3PUY A;  3UI2 A;  1IW7 C;  4GLX A;  1N34 Q;  2NB0 A;  2IPK D;  1VQ4 A;  1EZ6 A;  1GHJ A;  2GVB A;  4UY8 C;  4JOI C;  3CCU A;  3S2H H;  1VQC A;  2NTT A;  2O2L D;  2ZT9 C;  3OWF A;  3ND9 A;  5JVH 3;  5TSS A;  2R6G A;  1LT3 D;  5M5Y H;  5GAD C;  4NXN L;  4PMB A;  1G51 A;  4HSP A;  1II3 A;  1FNW A;  4K2K A;  4F8M A;  4K5V A;  4JI5 L;  3PO3 B;  1SNO A;  4DPG A;  3D6W A;  2L9H A;  2HCC A;  4L63 B;  1H9K A;  3ERO A;  3H6M A;  1DXM A;  3HOX G;  1DOM A;  1IBM Q;  3AMU A;  1JWM D;  1K8G A;  2JA5 G;  4IO9 A;  4I7Z C;  4CBV A;  1HZC A;  4A3G H;  2PNR C;  3S15 B;  4A93 H;  1MGS A;  3SHL A;  2Q8R E;  2Q2U A;  2R61 A;  4GLV B;  1R9T B;  5FO9 B;  4GNX B;  4C2M H;  1BF4 A;  4FF1 A;  2EY5 A;  4N9P A;  4JC0 A;  2ZJQ A;  2Q2I A;  3WWV A;  3KJO A;  3J80 E;  1X3G A;  4OX9 Q;  3PO2 H;  5IT9 E;  4A3D B;  4GOP B;  3K5M A;  4BY7 G;  4ILW A;  4O0A A;  3S15 H;  2BDO A;  4AYB E;  3I55 A;  4A3L G;  1UEB A;  1JQY D;  2B2Y C;  3T4A C;  1J8I A;  1U4M A;  3SVM A;  2KHS A;  1A3T A;  4IQZ A;  3I72 A;  1PRT F;  3RR5 A;  1N33 L;  1SNQ A;  4A3G G;  1GD7 A;  2R7Z H;  4C3J G;  1S5E D;  4UP7 A;  3I4N H;  5A35 A;  5CYU A;  2YU9 B;  3CF5 A;  1JB7 A;  3ULL A;  1HFN A;  4HJA A;  3HOV B;  2C5C A;  3DWP A;  4DV2 L;  1B3Q A;  1D5Z C;  3VYT A;  5CBA E;  2VQF L;  2ZJP A;  3FPP A;  2DUD A;  2EYF A;  3KF6 B;  4XTC S;  2E2D C;  4A3B G;  3TP8 A;  2Q2H A;  3EFX D;  1QE6 A;  2N49 A;  3MXP A;  1XMQ L;  4AYB B;  3M3Y B;  1XNR L;  3GTL B;  1OXU A;  1V1P B;  2R7D A;  1ONL A;  2JYO A;  2BH2 A;  4Y52 H;  2JA7 H;  1G91 A;  2F0T A;  4X64 Q;  2OXP A;  4FVM A;  2UU9 L;  1PTO H;  1SNC A;  2F0P A;  2A68 D;  4H7B A;  5M5X H;  1ENA A;  3M9B A;  4A3I G;  1U9R A;  1BCP B;  3QWN A;  2K32 A;  1CQF A;  3V96 A;  1K83 B;  2PZU A;  5AFW A;  2IHE A;  1PRT D;  2KEC A;  3G71 A;  4KLK A;  1AFP A;  3T1H Q;  3S1R H;  1STA A;  1HUM A;  3MAQ A;  4TVA B;  4DXG A;  4CGY B;  2B2T C;  2SEB D;  3RLO A;  3S14 B;  2L11 A;  1G2T A;  1SJH D;  4YY3 Q;  2JSO A;  4GZY C;  1KXL A;  1N8R C;  3TQY A;  4A3E B;  4C56 C;  1FJG Q;  1CA6 A;  4F7X A;  3I4N B;  4DV2 Q;  1STN A;  2IJ0 A;  4MNO A;  3DMU A;  1XWE A;  1Q1E A;  1BBX C;  3QO2 A;  2PZW A;  3M4P A;  3SK6 A;  3EA6 A;  4QUF A;  2CH4 A;  4NXN Q;  3GTP B;  1FGU A;  3GTL H;  1BUV T;  1V9P A;  4FF4 A;  1QNK A;  3TP5 A;  1OXX K;  5CGK A;  3SDZ A;  5JOB A;  1C48 A;  4KHZ A;  4DK0 A;  4H13 C;  3TBI B;  2NN6 H;  3H15 A;  5M9O A;  1L1O B;  4IPD A;  4NXM Q;  1K8O A;  1YJN A;  4CDC C;  2K05 A;  3BYT B;  2RA4 A;  4IOA A;  1VMC A;  5C4X B;  2VB2 X;  2JEB I;  2XN9 C;  2OTJ A;  5I9P A;  4C3H B;  4A3E G;  4A3K G;  3Q22 A;  4R9W A;  3BVM A;  4ZQ3 A;  5LMN L;  2IT1 A;  5EPK A;  3SR1 A;  1I3Q H;  1X32 A;  3ULJ A;  4PV1 C;  4IFD H;  3MZ5 A;  1D8L A;  3DEO A;  2UXC L;  2K5D A;  5M5W H;  1QVG A;  1NAP A;  2F0G A;  1I6V C;  3GDE A;  1CK1 A;  1O78 A;  4LF6 L;  1NR2 A;  1QUQ A;  4X65 L;  1EY0 A;  4EQO A;  5ELF A;  5KGU A;  5C4Z A;  4RWS C;  5FJ8 G;  3PIP 3;  5BR8 L;  4JOI A;  2YTX A;  4DK1 A;  3EN2 A;  3H3V I;  3T51 B;  1SSO A;  3VR5 A;  5I2X A;  2PNH A;  2KOL A;  5M3F G;  3MVV A;  1A63 A;  2ZM6 Q;  4XQN A;  1QVF A;  4V0B A;  1O7L A;  4NXM L;  3S14 H;  1VQ6 A;  1KQS A;  3RZO B;  4K0K Q;  2K33 A;  1EYD A;  2KCT A;  2C35 B;  3Q23 A;  2ZM6 L;  3J81 i;  1X9N A;  3QG1 A;  1HA6 A;  3M7N A;  1SYF A;  1S5C D;  2HQL A;  1CFM A;  2H4O A;  1JWS D;  3L3O C;  3KJP A;  3ULP A;  3T53 B;  5IYC G;  3WOE A;  1J5E Q;  3OPO A;  4LFB L;  3JAM L;  1MJE A;  1IL2 A;  4LF6 Q;  1PRT B;  3M3Y H;  5IYB H;  3F2C A;  3I4O A;  5IIF A;  1O7Z A;  3IRB A;  1L2F A;  1FVI A;  4JI7 L;  1AE2 A;  3VYS A;  4IUR A;  1YHA A;  2I5M X;  3EQL C;  2E2J H;  1TU2 B;  2QEX A;  1CI3 M;  2R93 H;  5C0X G;  5T1I A;  1LTB D;  4JW0 A;  1NMF A;  3MFG A;  3I4N G;  3D6C A;  2HT1 A;  3HOW H;  1IL8 A;  2QEJ C;  4A3M G;  3MEF A;  2MP1 A;  5FLM G;  1TY2 A;  1X3P A;  2RQX A;  2XWB B;  2BE5 D;  2K01 A;  3B6Y A;  3J7Z C;  3SK5 A;  1E0B A;  3KF6 A;  3STB C;  2UUC L;  4NMZ A;  1YVC A;  2K1B A;  2PI2 A;  1PYS B;  1LTS D;  4FNF A;  4IJH A;  3OOC A;  5G3L F;  1Y69 U;  1CKO A;  2CWP A;  4YWM A;  2JA8 G;  1XMQ Q;  1I50 H;  3CD6 A;  4GKJ Q;  2ALY B;  1BCP D;  3KLS X;  1JE5 A;  3I56 A;  3A8J E;  1PMR A;  4JBJ A;  1H9S B;  1ICF B;  1STB A;  1SFO H;  3L0O A;  4UP8 A;  4HCE A;  5EPL A;  3P1H A;  4IJL A;  5CV6 A;  3FDT A;  2B2W A;  4OON A;  2WKD A;  4I65 A;  4FP5 D;  2XIW A;  2B2Y A;  1ENC A;  3I3C A;  3F2D A;  1W2B A;  1EIY B;  4HIO A;  1CQV A;  1C9O A;  2A69 D;  2Z0S A;  1QUQ B;  5EKL A;  3D8G A;  1Q82 C;  2NBF A;  1E22 A;  5HGQ A;  3DM3 A;  1PTO B;  1TVX A;  2CWA A;  4A3J G;  1F9Q A;  4OX9 L;  3QOJ A;  1SAP A;  1ET9 A;  2PCF B;  4IZ8 A;  3FP9 A;  3NP8 A;  4QL5 A;  2AMC B;  1TWC H;  4LWC A;  2RBM A;  1ZYR C;  1PV4 A;  2EY1 A;  2MQH A;  4K5W A;  2B63 B;  1VQ7 A;  2HDM A;  5COR A;  1FNU A;  5M3F H;  4O1N A;  2F03 A;  2VUM G;  1HR0 Q;  3PCO B;  5C6A A;  1TII D;  3DUZ A;  4DR2 L;  2CFM A;  2XTI A;  3S2D H;  1K8M A;  1LUZ A;  5K5P A;  2B2V A;  1NSN S;  2VUM B;  4P73 A;  5IGE A;  4XQQ A;  3HZX A;  5FKA C;  4ZYS A;  1I3Q B;  2BOS A;  1I4P A;  3H09 A;  3TS0 A;  1GUN A;  2JA5 B;  2MO0 A;  4A3C G;  3W1B A;  4TRD A;  3BJU A;  3BDC A;  4HJ7 A;  2B2U A;  1NR4 A;  1XYI A;  2Y0S G;  1JIC A;  1KIX A;  4MN3 A;  3F2U A;  3A54 A;  4A3D H;  3GTG H;  4GKK L;  1XMO Q;  2IWH A;  5JJK A;  3RD4 A;  3TP7 A;  4UP9 A;  3M85 A;  5CV4 A;  2CW0 D;  1SND A;  1CT1 D;  2X6G A;  5C4J B;  5LMN Q;  4A3B H;  2R92 B;  3D3R A;  1WJJ A;  5D3D A;  1IHZ A;  3MXU A;  4OWT B;  4OO1 I;  4GN5 A;  4LF4 L;  3NTI A;  2F52 A;  2JA9 A;  4C3J H;  2R7Z G;  1K0R A;  1EQR A;  2Q2T A;  1AN8 A;  1YHB A;  5E7N A;  3SGI A;  1Q8K A;  4B3M Q;  5C3X A;  2Z9H A;  5C0X J;  2VUM H;  2VB3 X;  4IUQ A;  1B7Y B;  5IWA L;  2QKI C;  1Y8N B;  3F2B A;  4K5X A;  5EBC A;  3PO2 G;  1K28 A;  4DR5 L;  2VQF Q;  4YHH L;  1LAB A;  1OXS C;  4ZKC B;  2KQ3 A;  4QY7 A;  3E5S A;  1IW7 D;  4QGU A;  4PZ6 A;  3ICE A;  4RH6 A;  4XIG S;  3R8B A;  4ALP A;  5HY6 A;  4BY1 B;  1KAA A;  4DV7 Q;  2HDL A;  4C3H G;  5C44 G;  2YV5 A;  4K0K L;  2NVQ B;  4PMC A;  3KLW A;  1TWG B;  4DV5 Q;  3HKZ G;  4CJ0 B;  3J7A 5;  4QB4 A;  3IKJ A;  1HNZ Q;  3S1M B;  3OIP A;  4AYB G;  1GO3 E;  4BWG B;  2EQS A;  4GN4 B;  4BBS G;  4Y7N B;  1Y1V H;  4MTK A;  2PW5 A;  4A75 A;  4EVO A;  1EOV A;  1WCM G;  1TS4 A;  3WOF A;  2I0Q A;  1PYB A;  2KEE A;  2E5L L;  2EYL A;  4DFA A;  1KTK A;  3V2T A;  1TXY A;  1C8C A;  1EY7 A;  2MPM A;  1LTT D;  2L55 A;  3KUP A;  1K3R A;  3I4L A;  1SFO B;  1PTO D;  2H1E A;  4BY7 B;  2EVB A;  3A5U A;  2F0Q A;  4JYA L;  5JAV A;  4ZK9 B;  1IZ6 A;  3MWY W;  1ML0 D;  2L5T A;  2BE5 C;  2K4K A;  5EPJ A;  1WTX A;  4A3B B;  1HQR D;  1T5E A;  1VQ8 A;  4M1U B;  3ONA B;  3KOJ A;  3NWT A;  3K6O A;  3K0Y A;  5EKI A;  1SRO A;  4BY7 H;  1TS2 A;  4ZLT F;  3CCL A;  2K6A A;  3P75 A;  3NQI A;  2IHF A;  1Y1V B;  1DJR D;  1WCM H;  1OXT A;  1U4R A;  3W3A A;  2UUB L;  3PO3 G;  5C5L A;  2TMP A;  2JN4 A;  4IPG A;  2VZA A;  1L1O C;  1N36 L;  3K81 C;  1E7Z A;  2F0S A;  1GJX A;  1EWH A;  4X66 Q;  2UXD L;  4AQY L;  4HMI A;  3C1F A;  4LF5 L;  1MKH A;  1MSH A;  3M7G A;  2QW7 A;  1LO5 D;  3S2D B;  1CUK A;  4L8J A;  4OXP A;  1K9M C;  3TP6 A;  3GTJ H;  3C1E A;  1YI2 A;  1PH8 A;  4KI0 A;  2E5L Q;  4RA8 A;  1D6E C;  5BN4 A;  2OT2 A;  1EY8 A;  2VL6 A;  1EEF D;  4JG2 A;  4OL7 A;  4DV0 Q;  1ZKO A;  4Q0F A;  5IE8 A;  4RMF A;  1LT6 D;  2E74 C;  3T16 A;  4H44 C;  5IGF A;  3KK7 A;  3W1G A;  5JJL A;  1Q3L A;  2FHT A;  2F0M A;  4HN7 A;  5C3E G;  1RTN A;  3CCR A;  4RGO S;  3W5O A;  1A8V A;  4B9X A;  3K59 A;  4HAE A;  3RZO H;  3RUZ A;  3BG3 A;  4RKL A;  1NY4 A;  1TWH B;  1ILQ A;  4BXX G;  5JJI A;  2KUM A;  2NWG A;  4P75 A;  4IUP A;  5FLM H;  4DXF A;  4BY1 G;  2ENB A;  1AE3 A;  1KLU D;  2ZJR A;  1WTW A;  4GNX C;  1D2B A;  1SMY C;  1STY A;  3RNU A;  3SK4 A;  5JEA J;  5I4D A;  4F87 A;  4R4T A;  1VQ9 A;  2X69 A;  4LF9 Q;  4NPS A;  4PZ8 A;  1MJC A;  3K58 A;  4DK6 C;  2ATW A;  5IP9 H;  3JAM c;  1R4P B;  2AKW B;  2ASB A;  3HOZ H;  3PO2 B;  2A19 A;  1XNQ L;  3A0J A;  2IY5 B;  2CHB D;  4DR3 Q;  1V1P A;  3BS1 A;  3HOV H;  1CM9 A;  2MO1 A;  1CKN A;  4H0L C;  3HP3 A;  3N6R A;  1VCI A;  1U4L A;  3GQB A;  4R8N A;  1W6J A;  1BOS A;  1NCV A;  1JT8 A;  2R92 G;  4B3R L;  4YCW A;  3A8K E;  1VQG A;  2GN5 A;  4KY6 A;  1HZB A;  2K52 A;  2HCI A;  3ERS X;  4B08 A;  1HPC A;  2F0V A;  2AUK A;  1STE A;  3HOZ B;  1ESR A;  1TWF B;  1BNZ A;  3C3L A;  3I4M B;  2CQO A;  4R4C A;  1B2T A;  2EYJ A;  2ZXR A;  4J15 A;  2B39 A;  2L12 A;  4LFB Q;  2PQE A;  4BY1 H;  1TT2 A;  1JWU D;  1UE1 A;  1M4V A;  2IW3 A;  2A8V A;  3L7Z C;  4PZ7 A;  5E4W C;  3LNN A;  1YJW A;  2HD3 A;  1PRT C;  2LXJ A;  1Q46 A;  4OGQ C;  3VDY A;  3PGZ A;  5ELO A;  3EJI A;  2G5D A;  4YWK A;  4G7H C;  1Z47 A;  2BA0 A;  3RLN A;  2F0J A;  4CKE A;  3CQZ B;  1EQV A;  4LW1 A;  2AHO B;  1LM0 A;  3U9S A;  5A2Q L;  2RCN A;  5EBD A;  1UUP A;  1VF5 C;  1U5K A;  4S3S A;  1YHQ A;  5IP7 H;  1Y1V G;  1B8A A;  2UUC Q;  1EWC A;  1BXT A;  1V43 A;  4AH6 A;  4X62 L;  1F9P A;  2K50 A;  4RFB A;  5KNC A;  4BA1 I;  2VNU D;  2JA7 B;  2FIN B;  2BDN A;  2FFK B;  4QIW B;  1EUJ A;  1GUO A;  2J4X A;  5I6W A;  1Q86 C;  2AWN A;  2UUA Q;  1O7Y A;  1SLJ A;  1S72 A;  5D14 A;  4JI4 Q;  3OYY A;  1CKM A;  1SNM A;  3K57 A;  2G9H D;  2UXB L;  4A3C H;  3VR4 A;  5M3M H;  5BN3 A;  1KAB A;  3U4V A;  1EYG A;  3I4M H;  3S1N B;  1PTO C;  2RSN A;  3MEH A;  1SYG A;  2X6L A;  1J9O A;  2R7F A;  1EL0 A;  2Y0S E;  2NVX H;  2RHS B;  1C4Q A;  3CC2 A;  2A6E D;  1KNA A;  5IGD A;  1IYU A;  1JE4 A;  1EWI A;  3MA2 B;  2F4V L;  4YCU A;  4N8X 1;  4XDX A;  2WKC A;  1JC7 A;  3PIO 3;  1TS3 A;  1NMG A;  3I8Z A;  5C4X H;  5E3F A;  1N32 Q;  2IX1 A;  3Q6S A;  2KJX A;  3PUZ A;  3NEL A;  1LTR D;  4F88 A;  4GKJ L;  2QA4 A;  4AQY Q;  4YCV A;  1CTM A;  1GUW A;  3K0X A;  2RKS A;  2KHI A;  3ND8 A;  2PI2 E;  4K6D A;  4ABN A;  4JI6 L;  2Z1C A;  1I4R A;  3ERQ A;  3MTS A;  1EY9 A;  4UDU C;  1R9T H;  3IAY A;  1VQL A;  4PNY A;  1PZI D;  4ZUI A;  1IXR A;  4HJ9 A;  3BU2 A;  3IL8 A;  2NVT H;  3UDX A;  4X3S A;  4QJF A;  3IFD A;  4K6L A;  2RF4 A;  2KBN A;  1HJP A;  1SYD A;  4JI1 Q;  3CME A;  1UAP A;  4NW2 A;  4DR6 L;  1IBK Q;  2LY7 A;  4DNT B;  2F0W A;  3S1R B;  1QOH A;  2LKV A;  5AJ3 Q;  1WTH A;  5JVG 3;  1E24 A;  2CCZ A;  3I70 A;  4TKO B;  1DYQ A;  3T13 A;  4KMU C;  2EZV A;  5NUC A;  3TME A;  3QB3 A;  1X6O A;  4LUZ A;  1WOC A;  2JXM B;  4WRD A;  3UE1 A;  1B53 A;  4N8F A;  2AQ2 B;  1GUS A;  4FYD A;  5G3L D;  4DUZ L;  4LFC L;  2HQE A;  4LF5 Q;  1VQN A;  3HOY H;  1EFI D;  2GA4 B;  4POG A;  4EQ5 A;  1N36 Q;  2QCP X;  4WFN 3;  5JPM C;  3K5N A;  1RKN A;  4JBM A;  4IFD G;  4R4I A;  2EIF A;  3CRK C;  1X3F A;  3F8T A;  2KEN A;  3E9I A;  5I9O A;  4B3S Q;  2MHV A;  3GTQ H;  1G2S A;  2JE6 I;  1FNV A;  3KF8 A;  5BN5 A;  2E2H H;  4JI2 L;  4DR4 Q;  2F0O A;  1A15 A;  4OIK A;  3Q0A A;  1NTG A;  1C0A A;  5CV5 A;  3CU7 A;  2JK8 A;  2NYZ D;  4IAL A;  3HOW B;  4ZCK A;  4L5T A;  2MFI A;  2MGS A;  2BH8 A;  3U4Z A;  5IWA Q;  4IPH A;  1EIH A;  1WYD A;  4LMQ D;  1FJG L;  1GUG A;  1HA5 A;  3I91 A;  4MZ9 A;  3DEP A;  4DV6 L;  2N8N A;  1JOO A;  3TZD A;  1E2V A;  5HGT A;  3V05 A;  5C4J H;  2K7V A;  1HZA A;  2OTL A;  3TSS A;  3WDN A;  4RHS A;  3MC0 B;  1HNX L;  2IX3 A;  2KA7 A;  4JPB W;  4FF2 A;  2SDF A;  3AU7 A;  3K7U C;  2K5V A;  1E3P A;  3AFQ A;  3DWA A;  1W3S A;  2K03 A;  3RN2 A;  4DUZ Q;  3HKS A;  3OIQ A;  3H3V C;  5FO7 B;  3D4D A;  3HOY G;  3AFP A;  5IGB A;  5LMN W;  1K83 H;  2AWO A;  3N52 A;  1YEZ A;  1EOT A;  1EIF A;  3VR2 A;  2I46 A;  4BBR G;  2EXD A;  5GAH C;  3GTQ B;  2R3Z A;  3FMC A;  4RG1 A;  4OHJ A;  1D5M C;  1XNQ Q;  3FHW A;  3STB D;  1S5F D;  1T5X D;  5C44 B;  3S1M H;  2OF1 A;  3D4W A;  1K73 C;  3FVQ A;  3GTO B;  2MJ8 A;  4JBK A;  4DR1 L;  3G6J B;  2NVY B;  3AYH B;  3D4R A;  3GTJ B;  3OHX C;  2O5I C;  2HIX A;  4DR6 Q;  1AEX A;  4DR3 L;  2E76 C;  1TY0 A;  2AUJ D;  1B9N A;  2JQO A;  4Z9C B;  1EU4 A;  1VMP A;  1ESF A;  1RD9 D;  4YHH Q;  4DR4 L;  2N78 A;  1PFN A;  2EYM A;  3VYU A;  1I4G A;  2LMC B;  4ME5 A;  4CDD C;  3O13 A;  2JA8 B;  3OMG A;  1HR0 L;  1B70 B;  3CCV A;  5ELD A;  1ZEQ X;  3QIA A;  5LHY 1;  2PW7 A;  3MXN B;  3JAM i;  4DAV A;  2E75 C;  3ER0 A;  2YTY A;  1GM5 A;  2EOT A;  1I4X A;  4A3M B;  2OQ0 A;  3URY A;  3OW2 A;  4HTH A;  4C3H H;  1PFB A;  1B44 D;  4LFA Q;  3JC6 6;  4FXD A;  4K14 A;  1HNX Q;  2UU9 Q;  1PZJ D;  1FL0 A;  5ELB A;  2LXK A;  1JR0 D;  1ZYR D;  2EY6 A;  4G4K A;  4DK3 C;  4HIK A;  2Q8I B;  2CW0 C;  2QDL A;  1B50 A;  2V1C C;  3AQQ A;  2D62 A;  3I73 A;  3GV3 A;  1W6K A;  3LX0 A;  1EEI D;  1D1K A;  1UNS A;  3MXN A;  2P5Z X;  1STG A;  1NUC A;  4GS3 A;  1Q7Y C;  5L37 A;  2DNE A;  5CV9 A;  1YIT A;  1BDO A;  2B8G A;  5LL6 S;  2XNA C;  3NWS A;  1GOZ A;  4JI4 L;  3NQT A;  4A3M H;  4GOP A;  4A3G B;  3Q24 A;  1QG7 A;  4MTN A;  3I4M G;  2R93 B;  2JA5 H;  2I07 B;  1E2Z A;  1ASZ A;  2OEO A;  2DJF C;  2HIV A;  3T56 B;  2ZTC A;  2YTV A;  4MIU A;  2N3S A;  4DU9 A;  1SE8 A;  3NSW A;  4LF7 L;  3M4Y A;  4HR7 B;  1QCB D;  2QGQ A;  4DV0 L;  1I4H A;  2I5L X;  1F2M A;  1XPU A;  1AP0 A;  1JJC B;  4JK1 C;  4ZKB B;  4APV A;  2H5X A;  1B4O A;  3TEH B;  3A55 A;  1G6P A;  3CC7 A;  2AQ3 B;  3GV6 A;  2WAQ B;  2RDH A;  3CAM A;  1JJG A;  1DM0 B;  3KYH C;  3CCM A;  1J6Q A;  1ASY A;  3I7F A;  2XRS D;  2M9V A;  5C44 H;  1LTA D;  2QDB A;  4B3T Q;  1X56 A;  5KIX A;  4DV3 Q;  3FRP B;  2DN8 A;  1L0Y B;  4G7O C;  1EZ8 A;  4O42 A;  3ZYY X;  5JJZ A;  4A3L H;  1BBW A;  1MHW C;  1QJO A;  4X62 Q;  3HOU G;  4KHP L;  4QF4 A;  1QZH A;  1X65 A;  1Y14 B;  1RF2 D;  5C4X G;  2EYP A;  2B2W C;  3S17 H;  1KC8 C;  1T9H A;  1FR3 A;  2DY8 A;  5IT9 c;  2ICE C;  3NTH A;  1LAC A;  1N34 L;  1JMC A;  3GTM B;  1UWV A;  4A93 G;  2K5H A;  3ITP A;  1LTI D;  5K36 H;  1K8A C;  4DAY B;  3RMH A;  2F0I A;  2L0C A;  1A2U A;  1Y1W G;  4PQX A;  3BDL A;  4X3T A;  1HFG A;  1GHK A;  5FOB B;  4KD4 A;  2DGY A;  3RZD B;  2NUC A;  3FKI H;  4IUN A;  4NB3 A;  4ULL A;  3PV0 A;  5CR3 A;  1DON A;  2EYH A;  2B29 A;  3CCQ A;  4A4I A;  4MHE A;  1RDP D;  2VS1 A;  5HUR A;  2AQ1 B;  2K5W A;  1BBU A;  2PPB C;  4LF8 L;  3G4S A;  2LFN A;  3R3O A;  1U4P A;  4JI8 Q;  4DV1 L;  5DNF A;  2NZO A;  1IYV A;  4JI7 Q;  1H9M A;  3PUW A;  1EY5 A;  4LUV A;  1HTL D;  3QR8 A;  3PIO A;  3EBE A;  1MIU A;  2EPB A;  5E4X A;  4DV5 L;  1F2L A;  2D5D A;  1CHQ D;  3GP7 A;  4BS9 A;  5CV7 A;  4HJ8 A;  5M3F B;  1WTV A;  4P2C B;  5DEH A;  3HOY B;  1QZG A;  4RAU C;  5GAG C;  3G6E A;  3C46 A;  2B63 G;  4ID6 A;  3LGJ A;  3K5O A;  3HOW G;  1RL2 A;  5IT9 L;  2A6H D;  1M1K C;  1F2Y A;  1VQE A;  4QCL A;  4R1J A;  2F0D A;  1E1T A;  1AW7 A;  5DM6 3;  3VA7 A;  1SRU A;  3VA5 A;  1HRJ A;  3NEM A;  2SNM A;  4CKB A;  2QF7 A;  2PYK A;  2FMM A;  5IYC H;  4KY7 A;  5JEA H;  1PH3 A;  1X3E A;  2JA7 G;  5D3I B;  1PFM A;  2CH4 W;  2EYO A;  2F4V Q;  1SE3 A;  1LTL A;  1U0L A;  2RDF A;  2EY2 A;  3R93 A;  2EJM A;  2JA6 H;  4K8J A;  1X54 A;  3S1Q H;  1SBB B;  4BA2 I;  2Z4I A;  5JPN C;  5A2Q E;  5IP9 G;  4XXE A;  1KDB A;  2L4N A;  1SYC A;  5KND A;  2E8G A;  2NZH A;  4R4O A;  1LTG D;  3FEW X;  3KF8 B;  2BA1 A;  4L6T B;  3T1Y L;  4DAP A;  2ICI A;  1XPO A;  3RLF A;  5FLX E;  5IGG A;  3M4O H;  1OTC A;  1A62 A;  1S5D D;  1VQA A;  4J1M A;  1RHP A;  3S16 H;  1CA5 A;  2DJG C;  4WJ4 A;  3H0G H;  1JOK A;  4XYO A;  3S1Q B;  4RCN A;  3HGB A;  4JI5 Q;  3GTM H;  3QOL A;  1QB5 D;  1ROD A;  3A7A B;  4LAA A;  1S3O A;  4V19 0;  1O7I A;  1XXG A;  1YJ9 A;  1KNE A;  2UUB Q;  3OSO A;  3SXH A;  3DXJ C;  1PH5 A;  3TRE A;  3W2D A;  4A3E H;  2Z8L A;  4J8Q A;  3K5L A;  4LFC Q;  3E0E A;  3UDI A;  3CP0 A;  4GOP C;  3L2P A;  2JA6 G;  5FLX L;  1VQD A;  2EJG C;  2PQA B;  3OW7 A;  2RSO A;  4KK7 A;  4IOC A;  4KHP Q;  1TWH H;  2F3I A;  1CZG A;  5M5Y B;  5T1G A;  5FK9 C;  1CSQ A;  1QNU A;  1H9S A;  3H91 A;  4C1N I;  3PO3 H;  2A1A A;  3K7A B;  3K80 C;  5COY A;  4HID A;  1TWG H;  4CDF C;  4B3T L;  1TQO A;  3HKZ B;  4FO2 A;  1DGS A;  1HTP A;  2J7Z A;  2K5N A;  5EJW A;  1RIP A;  2WB1 B;  5IYD H;  3JAM E;  2RCF A;  3QJY A;  1EQT A;  1EU3 A;  4KKT A;  2A68 C;  1WD1 A;  1KDA A;  1IBK L;  4CJ2 C;  3CPW A;  4LF4 Q;  4JI1 L;  1SMY D;  1EIG A;  3D31 A;  4QUC A;  2EXZ A;  1LT5 D;  1BCP F;  3A56 A;  1A0I A;  4NDX A;  4XYQ A;  1I5F A;  5C3E B;  4A3F H;  1HR0 W;  3HKZ E;  2XWJ B;  2UUA L;  1H95 A;  1HUN A;  4GN3 B;  2RDG A;  2WB1 E;  1YNN C;  1Z7T A;  2F0E A;  4POF A;  1I94 L;  3A8I E;  5J3B A;  4DR7 Q;  3NXW A;  1KHI A;  1Q81 C;  1S5B D;  1I6H B;  2D0P A;  3J80 c;  4TSS A;  5EKK A;  1YBY A;  1K3B C;  1TS5 A;  3H3V H;  1EYC A;  4DR5 Q;  5C0X I;  3DWQ A;  2G9D A;  4GLA C;  4UPA A;  3RZD H;  2NVT B;  2VXW A;  1N32 L;  2C9O A;  4QMG A;  1VQK A;  4Q5V A;  4FXK C;  3ZJY C;  2F3W A;  1F77 A;  1PFS A;  1I4Q A;  4EQP A;  3HOZ G;  1MD2 D;  5GQO A;  4TQU S;  1V8Q A;  3A7L A;  1OXV A;  3X3N A;  1STH A;  2FJ2 A;  3S16 B;  1UE5 A;  2UXC Q;  2DNC A;  4C2M B;  3J81 j;  1XTD A;  1DCZ A;  2NN6 G; 
#chains in the Genus database with same CATH homology
 2EDG A;  3TN2 A;  4CKC A;  2ID0 A;  5ISR A;  2V4D A;  2A6E C;  4CHT B;  3L9A X;  4KKU A;  3CKI B;  3GO5 A;  4U68 A;  2HUG A;  2E2J B;  1FGB D;  2XSC A;  3NBI A;  2A6H C;  4WJW A;  2NVX B;  3HG9 A;  1AZP A;  4R8I A;  3I90 A;  1KDC A;  1O80 A;  4IUU A;  1KLG D;  5CBE E;  5CC4 A;  4NP5 A;  1WTO A;  2ZXO A;  1Q1B A;  3KBG A;  1RJT A;  2MUY A;  2F0U A;  2F0N A;  2B8F A;  1UEA B;  3E0J A;  3J7A F;  5C4H A;  1RTO A;  2WII B;  5E1F A;  1M8A A;  4FXG C;  2M2L A;  1IKL A;  3NBH A;  1SDF A;  1HHV A;  2F0F A;  4KD3 A;  3J80 L;  3NTK A;  1Y1W B;  1H9J A;  3TZU A;  3P7J A;  2O4X A;  2F0H A;  2R7Z B;  1S4Z A;  2WIN B;  5LL6 X;  1OO9 B;  3S9W A;  4LJZ C;  3KBX A;  3SEB A;  1D1I A;  1I50 B;  3BYY B;  2F0K A;  3LWE A;  3PUX A;  1G8Z D;  2K5Q A;  1HCZ A;  1B3A A;  3NK9 A;  2J0T D;  4PMW A;  1Y8O B;  4EQN A;  1A2T A;  4YIJ A;  1IKM A;  1YNN D;  2D9U A;  2IX0 A;  2F4I A;  2NTS A;  3J7Y W;  3NHH A;  1PXU A;  4OIJ A;  5FO8 B;  3H94 A;  3FPU B;  3GTK B;  1WTR A;  5J22 A;  4DGZ A;  1SYE A;  4A3F B;  5ELE A;  4DF7 A;  5IOD A;  2F3V A;  2CVR A;  2WV6 D;  1ILP A;  2IL8 A;  1E2W A;  1WTQ A;  3NE5 B;  2LS0 1;  1ET6 A;  1PZK D;  2EE1 A;  3X3M A;  4NKL A;  4RKB A;  1HXY D;  3OWE B;  1FD7 D;  2O5J C;  1F9R A;  4XQJ A;  2YYZ A;  4C1N K;  4C3I G;  1MSG A;  2D2C C;  3CHB D;  4UAI A;  1PDQ A;  2K04 A;  5ELC A;  3TDQ A;  3P20 A;  5J1Z A;  2PZT A;  2A73 B;  4KJN A;  2NN6 I;  3PUV A;  2JEA I;  2M00 A;  2B2V C;  4RGN A;  3HOX B;  3GTG B;  1BCP C;  5I6Y A;  1HQM C;  3C2P A;  1MBY A;  3DHQ A;  3SE0 A;  1D5X C;  1WD0 A;  3CRL C;  2EJF C;  1Q8I A;  4DAY A;  2A69 C;  1FYC A;  5K36 G;  3VYR A;  4E6I A;  3DM1 A;  4KN7 C;  3NUC A;  2NZ1 D;  4XT1 B;  2N55 A;  4OO1 H;  1CHP D;  4HMJ A;  5EGT A;  5M3M B;  2KCC A;  4IUT A;  1F9S A;  2A5H A;  3FKI B;  4BBR B;  1JCK B;  4A93 B;  3S2H B;  3KLS A;  3BZD B;  1SEB D;  2Y0S B;  3EVQ A;  1Q12 A;  2N88 A;  4G7Z C;  3S17 B;  1TWC B;  1JOQ A;  4HCS A;  3HOU B;  3BVZ A;  5F2D A;  1H9R A;  3HRZ C;  3MFY A;  1B1Z A;  4HSV A;  1Z6H A;  1CZW A;  4X3K A;  5M5X B;  3LWU A;  1BQQ T;  4WOR A;  1G6Z A;  5J39 A;  1GXD C;  3G7L A;  3R2T A;  1XTC D;  1BR9 A;  1YNJ C;  4KJO A;  4EGV A;  4ZUJ A;  2TSS A;  1VDZ A;  4B9W A;  1BO0 A;  1LV9 A;  2WP8 J;  3NPP A;  5M5W B;  4KKS A;  5CV8 A;  4ZAI A;  4CJ1 B;  5IOC A;  4A3J B;  1EY6 A;  4FF3 A;  2XVS A;  3R2I A;  1TR5 A;  4U67 3;  3HEJ A;  4KN4 C;  3VR6 A;  3OMC A;  3H0G B;  4IFD J;  2Z4H A;  1SJE D;  5DM7 3;  3M4O B;  1A3V A;  1WCM B;  2B2U C;  1V1O A;  4DN4 M;  1JOR A;  4BBS B;  3KLR A;  2A74 C;  4K8I A;  3IFT A;  1VF7 A;  1TWA B;  2PMZ B;  1WTP A;  4M8A A;  1RCV D;  1ENF A;  2JA6 B;  4RGM A;  2SOB A;  3MXG A;  1AZQ A;  4A3K B;  4LK1 C;  1DOL A;  5JEA G;  2Q8T A;  1A6X A;  4C3I B;  1DZ1 A;  1GUT A;  3SK8 A;  4KY5 A;  1SNP A;  1SYB A;  4KHV A;  4KTA A;  3GD7 A;  3E6Z X;  2F0L A;  2KCN A;  5EQ0 A;  2E2I B;  4HED A;  4G57 A;  4ZRZ A;  5KYI A;  2WAC A;  4A3I B;  1G29 1;  3VR3 A;  1SE2 A;  1WVL A;  2JP1 A;  2BCO A;  4RCO A;  2KVM A;  5KRU A;  1QIL A;  1SXT A;  1DOK A;  4IUV A;  4K2L A;  4RGT A;  4IFD I;  1Y8P B;  4IN3 A;  5C0X H;  4DNR B;  1R4Q B;  4X3U A;  4KV6 A;  5KYL A;  4JBW A;  4N9T A;  1SE4 A;  1A3U A;  1XX8 A;  4OO1 G;  1ICW A;  2B2T A;  4C3J B;  5DAU A;  1YNJ D;  2RVL A;  2QIL A;  3J81 L;  4RHR A;  2F1M A;  3BDO A;  4DA2 A;  3BVG A;  2DY7 A;  1PYW D;  1DD2 A;  4ODG A;  3U9O A;  1B9M A;  5IGC A;  2K28 A;  5D65 A;  2PO4 A;  1ZXT A;  1LLR D;  2SNS A;  3J7A V;  3HS0 C;  3PMF A;  2FMC A;  1JB3 A;  2E2H B;  1PLF A;  2KED A;  5CMD A;  1TKW B;  4XT3 B;  1F2Z A;  1Q90 A;  2ZXP A;  2XRQ D;  5C3W A;  2L1B A;  1EYA A;  1X3Q A;  1EY4 A;  3J81 E;  1LT4 D;  5C5M A;  1PTO F;  5KEE A;  1QWY A;  4J6H A;  5KNB A;  5I2Y A;  3AB9 A;  2CQA A;  1MI2 A;  3MHB A;  1L0X B;  3PUY A;  3UI2 A;  1IW7 C;  2NB0 A;  2IPK D;  1EZ6 A;  1GHJ A;  2O2L D;  2NTT A;  2ZT9 C;  3OWF A;  3ND9 A;  5JVH 3;  5TSS A;  2R6G A;  1LT3 D;  4PMB A;  4HSP A;  1II3 A;  1FNW A;  4K2K A;  4F8M A;  4K5V A;  3PO3 B;  1SNO A;  3D6W A;  2L9H A;  2HCC A;  4L63 B;  1H9K A;  3ERO A;  3H6M A;  1DXM A;  1DOM A;  3AMU A;  1JWM D;  4I7Z C;  4CBV A;  2PNR C;  3S15 B;  1MGS A;  3SHL A;  2Q8R E;  2R61 A;  1R9T B;  5FO9 B;  1BF4 A;  4FF1 A;  2EY5 A;  4N9P A;  3J80 E;  5IT9 E;  4A3D B;  3K5M A;  4ILW A;  2BDO A;  1JQY D;  2B2Y C;  3T4A C;  1J8I A;  1U4M A;  3SVM A;  2KHS A;  1A3T A;  4IQZ A;  3I72 A;  1PRT F;  1SNQ A;  4C3J G;  1S5E D;  5A35 A;  5CYU A;  2YU9 B;  1HFN A;  3HOV B;  2C5C A;  3DWP A;  1D5Z C;  5CBA E;  3VYT A;  3FPP A;  2EYF A;  4XTC S;  2E2D C;  3TP8 A;  3EFX D;  1QE6 A;  3MXP A;  3M3Y B;  4AYB B;  3GTL B;  1OXU A;  1V1P B;  1ONL A;  2JYO A;  1G91 A;  2F0T A;  2OXP A;  4FVM A;  1PTO H;  1SNC A;  2F0P A;  2A68 D;  4H7B A;  1ENA A;  1U9R A;  1BCP B;  3QWN A;  2K32 A;  1CQF A;  3V96 A;  1K83 B;  2PZU A;  5AFW A;  1PRT D;  2KEC A;  1AFP A;  1STA A;  1HUM A;  3MAQ A;  4DXG A;  4CGY B;  2B2T C;  2SEB D;  3S14 B;  2L11 A;  1G2T A;  1SJH D;  2JSO A;  4GZY C;  4A3E B;  4C56 C;  1CA6 A;  4F7X A;  3I4N B;  1STN A;  2IJ0 A;  3DMU A;  1XWE A;  1Q1E A;  1BBX C;  3QO2 A;  2PZW A;  3SK6 A;  3EA6 A;  4QUF A;  3GTP B;  1BUV T;  4FF4 A;  1QNK A;  3TP5 A;  1OXX K;  5CGK A;  3SDZ A;  5JOB A;  1C48 A;  4KHZ A;  4DK0 A;  4H13 C;  3TBI B;  2NN6 H;  5M9O A;  1K8O A;  2K05 A;  3BYT B;  2RA4 A;  1VMC A;  5C4X B;  2VB2 X;  2JEB I;  2XN9 C;  5I9P A;  4C3H B;  3Q22 A;  4R9W A;  3BVM A;  4ZQ3 A;  2IT1 A;  5EPK A;  3SR1 A;  1X32 A;  4PV1 C;  4IFD H;  3MZ5 A;  3DEO A;  2K5D A;  1NAP A;  2F0G A;  1I6V C;  1CK1 A;  1O78 A;  1NR2 A;  1EY0 A;  4EQO A;  5ELF A;  5KGU A;  5C4Z A;  4RWS C;  3PIP 3;  4DK1 A;  3T51 B;  1SSO A;  3VR5 A;  5I2X A;  2KOL A;  3MVV A;  4XQN A;  4V0B A;  1O7L A;  3RZO B;  2K33 A;  1EYD A;  3Q23 A;  3QG1 A;  1HA6 A;  3M7N A;  1SYF A;  1S5C D;  1CFM A;  2H4O A;  1JWS D;  3L3O C;  3T53 B;  3WOE A;  3OPO A;  3JAM L;  1PRT B;  5IIF A;  1O7Z A;  3VYS A;  4IUR A;  3EQL C;  1TU2 B;  1CI3 M;  5C0X G;  5T1I A;  1LTB D;  3MFG A;  3D6C A;  1IL8 A;  2QEJ C;  2MP1 A;  1TY2 A;  1X3P A;  2RQX A;  2XWB B;  2BE5 D;  2K01 A;  3SK5 A;  1E0B A;  4NMZ A;  2K1B A;  4FNF A;  1LTS D;  5G3L F;  3OOC A;  1Y69 U;  1BCP D;  3KLS X;  3A8J E;  1PMR A;  1H9S B;  1STB A;  4HCE A;  5EPL A;  3P1H A;  5CV6 A;  3FDT A;  2B2W A;  2WKD A;  4I65 A;  4FP5 D;  2XIW A;  2B2Y A;  1ENC A;  3I3C A;  1CQV A;  2A69 D;  5EKL A;  3D8G A;  2NBF A;  1PTO B;  1TVX A;  1F9Q A;  3QOJ A;  1SAP A;  1ET9 A;  2PCF B;  4IZ8 A;  3NP8 A;  2RBM A;  1ZYR C;  2EY1 A;  4K5W A;  2B63 B;  2HDM A;  5COR A;  1FNU A;  4O1N A;  2F03 A;  5C6A A;  1TII D;  3DUZ A;  1K8M A;  5K5P A;  2B2V A;  1NSN S;  2VUM B;  5IGE A;  4XQQ A;  3HZX A;  5FKA C;  4ZYS A;  1I3Q B;  2BOS A;  1I4P A;  3H09 A;  1GUN A;  2JA5 B;  4TRD A;  3BDC A;  2B2U A;  1NR4 A;  1XYI A;  1JIC A;  4MN3 A;  3F2U A;  3A54 A;  2IWH A;  3RD4 A;  3TP7 A;  3M85 A;  5CV4 A;  2CW0 D;  1SND A;  1CT1 D;  2X6G A;  5C4J B;  2R92 B;  3D3R A;  5D3D A;  1IHZ A;  3MXU A;  4OO1 I;  3NTI A;  1AN8 A;  5C3X A;  5C0X J;  2VB3 X;  4IUQ A;  2QKI C;  1Y8N B;  4K5X A;  5EBC A;  1LAB A;  1OXS C;  4ZKC B;  2KQ3 A;  3E5S A;  1IW7 D;  4RH6 A;  4XIG S;  3R8B A;  4BY1 B;  1KAA A;  2HDL A;  4C3H G;  2NVQ B;  4PMC A;  1TWG B;  4CJ0 B;  4QB4 A;  3IKJ A;  3S1M B;  3OIP A;  4BWG B;  4Y7N B;  2PW5 A;  4EVO A;  1TS4 A;  3WOF A;  2KEE A;  2EYL A;  4DFA A;  1KTK A;  3V2T A;  1C8C A;  1EY7 A;  2MPM A;  1LTT D;  2L55 A;  3KUP A;  3I4L A;  1SFO B;  1PTO D;  2H1E A;  4BY7 B;  2EVB A;  2F0Q A;  5JAV A;  4ZK9 B;  3MWY W;  1ML0 D;  2L5T A;  2BE5 C;  5EPJ A;  1WTX A;  4A3B B;  1HQR D;  1T5E A;  4M1U B;  3ONA B;  3NWT A;  3K6O A;  3K0Y A;  5EKI A;  1TS2 A;  4ZLT F;  2K6A A;  3P75 A;  3NQI A;  1Y1V B;  1DJR D;  1OXT A;  1U4R A;  3W3A A;  5C5L A;  2TMP A;  2F0S A;  1GJX A;  1EWH A;  4HMI A;  3C1F A;  1MSH A;  3M7G A;  1LO5 D;  3S2D B;  4L8J A;  3TP6 A;  3C1E A;  4KI0 A;  4RA8 A;  1D6E C;  5BN4 A;  2OT2 A;  1EY8 A;  1EEF D;  4OL7 A;  1ZKO A;  4Q0F A;  1LT6 D;  2E74 C;  3T16 A;  4H44 C;  5IGF A;  3KK7 A;  1Q3L A;  2FHT A;  2F0M A;  4HN7 A;  1RTN A;  4RGO S;  4B9X A;  3K59 A;  4HAE A;  3RUZ A;  3BG3 A;  4RKL A;  1TWH B;  1ILQ A;  2KUM A;  2NWG A;  4IUP A;  4DXF A;  2ENB A;  1KLU D;  1WTW A;  1D2B A;  1SMY C;  1STY A;  3SK4 A;  5JEA J;  5I4D A;  4F87 A;  2X69 A;  3K58 A;  1R4P B;  3PO2 B;  2CHB D;  1V1P A;  3BS1 A;  1CM9 A;  4H0L C;  3HP3 A;  3N6R A;  1VCI A;  1U4L A;  3GQB A;  4R8N A;  1W6J A;  1BOS A;  1NCV A;  3A8K E;  4KY6 A;  2HCI A;  4B08 A;  1HPC A;  2F0V A;  2AUK A;  1STE A;  3HOZ B;  1ESR A;  1TWF B;  1BNZ A;  3C3L A;  3I4M B;  1B2T A;  2EYJ A;  2ZXR A;  2B39 A;  2L12 A;  2PQE A;  1TT2 A;  1JWU D;  1M4V A;  2IW3 A;  3L7Z C;  5E4W C;  3LNN A;  1PRT C;  4OGQ C;  3EJI A;  4G7H C;  1Z47 A;  2BA0 A;  2F0J A;  4CKE A;  3CQZ B;  1EQV A;  5A2Q L;  3U9S A;  5EBD A;  1UUP A;  1VF5 C;  4S3S A;  1EWC A;  1BXT A;  1V43 A;  2JA7 B;  1F9P A;  4RFB A;  5KNC A;  2VNU D;  4BA1 I;  2FIN B;  2BDN A;  2FFK B;  4QIW B;  1GUO A;  2J4X A;  5I6W A;  2AWN A;  1O7Y A;  5D14 A;  1SNM A;  3K57 A;  2G9H D;  3VR4 A;  5BN3 A;  1KAB A;  3S1N B;  1PTO C;  2RSN A;  3MEH A;  1SYG A;  2X6L A;  1J9O A;  1EL0 A;  1C4Q A;  2A6E D;  1KNA A;  5IGD A;  1IYU A;  1JE4 A;  3MA2 B;  4XDX A;  2WKC A;  1JC7 A;  3PIO 3;  1TS3 A;  3I8Z A;  5E3F A;  2IX1 A;  3Q6S A;  2KJX A;  3PUZ A;  1LTR D;  4F88 A;  1CTM A;  1GUW A;  2RKS A;  3ND8 A;  4K6D A;  4ABN A;  2Z1C A;  1I4R A;  3ERQ A;  3MTS A;  1EY9 A;  4UDU C;  3IAY A;  4PNY A;  1PZI D;  4ZUI A;  3IL8 A;  4X3S A;  3IFD A;  4K6L A;  1SYD A;  1UAP A;  4NW2 A;  2LY7 A;  4DNT B;  2F0W A;  3S1R B;  1QOH A;  2LKV A;  5JVG 3;  3I70 A;  4TKO B;  1DYQ A;  3T13 A;  4KMU C;  2EZV A;  5NUC A;  3TME A;  3QB3 A;  2JXM B;  4WRD A;  1B53 A;  2AQ2 B;  1GUS A;  4FYD A;  5G3L D;  2HQE A;  1EFI D;  2GA4 B;  2QCP X;  4WFN 3;  5JPM C;  3K5N A;  1RKN A;  4IFD G;  3CRK C;  5I9O A;  2MHV A;  1G2S A;  2JE6 I;  1FNV A;  3KF8 A;  5BN5 A;  2F0O A;  1A15 A;  4OIK A;  3Q0A A;  5CV5 A;  3CU7 A;  2NYZ D;  4IAL A;  3HOW B;  2MGS A;  1EIH A;  4LMQ D;  1GUG A;  1HA5 A;  3I91 A;  3DEP A;  3TZD A;  1JOO A;  1E2V A;  5HGT A;  3V05 A;  2K7V A;  3TSS A;  3WDN A;  4RHS A;  3MC0 B;  2IX3 A;  2KA7 A;  4FF2 A;  2SDF A;  3AU7 A;  3DWA A;  2K03 A;  3OIQ A;  3H3V C;  5FO7 B;  3D4D A;  5IGB A;  2AWO A;  3N52 A;  1EOT A;  3VR2 A;  2I46 A;  3GTQ B;  2R3Z A;  3FMC A;  4OHJ A;  1D5M C;  1S5F D;  1T5X D;  5C44 B;  2OF1 A;  3D4W A;  3FVQ A;  3GTO B;  2MJ8 A;  3G6J B;  2NVY B;  3D4R A;  3GTJ B;  3OHX C;  2O5I C;  1AEX A;  2E76 C;  1TY0 A;  2AUJ D;  1B9N A;  4Z9C B;  1EU4 A;  1VMP A;  1ESF A;  1RD9 D;  1PFN A;  2EYM A;  3VYU A;  1I4G A;  2LMC B;  4ME5 A;  2JA8 B;  3O13 A;  3OMG A;  5ELD A;  1ZEQ X;  3QIA A;  5LHY 1;  2PW7 A;  4DAV A;  2E75 C;  2EOT A;  1I4X A;  4A3M B;  3URY A;  4HTH A;  1PFB A;  1B44 D;  4FXD A;  4K14 A;  1PZJ D;  5ELB A;  1JR0 D;  1ZYR D;  2EY6 A;  4G4K A;  2Q8I B;  2CW0 C;  1B50 A;  2D62 A;  3I73 A;  3GV3 A;  1W6K A;  3LX0 A;  1EEI D;  1D1K A;  1UNS A;  3MXN A;  1STG A;  1NUC A;  2DNE A;  5CV9 A;  1BDO A;  2B8G A;  5LL6 S;  2XNA C;  3NWS A;  1GOZ A;  3NQT A;  4A3G B;  3Q24 A;  1QG7 A;  2R93 B;  2I07 B;  1E2Z A;  2OEO A;  3T56 B;  4MIU A;  4DU9 A;  3NSW A;  3M4Y A;  4HR7 B;  1QCB D;  1I4H A;  1F2M A;  1AP0 A;  4JK1 C;  4ZKB B;  1B4O A;  3A55 A;  2AQ3 B;  3GV6 A;  2WAQ B;  2RDH A;  1DM0 B;  2XRS D;  2M9V A;  1LTA D;  2QDB A;  5KIX A;  3FRP B;  2DN8 A;  1L0Y B;  4G7O C;  1EZ8 A;  4O42 A;  3ZYY X;  5JJZ A;  1QJO A;  4QF4 A;  1RF2 D;  2EYP A;  2B2W C;  1FR3 A;  2DY8 A;  2ICE C;  3NTH A;  1LAC A;  3GTM B;  3ITP A;  1LTI D;  5K36 H;  3RMH A;  2F0I A;  2L0C A;  1A2U A;  4PQX A;  3BDL A;  4X3T A;  1HFG A;  1GHK A;  5FOB B;  4KD4 A;  3RZD B;  2NUC A;  4IUN A;  5CR3 A;  4ULL A;  3PV0 A;  1DON A;  2EYH A;  4MHE A;  1RDP D;  5HUR A;  2AQ1 B;  2K5W A;  2PPB C;  2LFN A;  3R3O A;  1U4P A;  5DNF A;  1IYV A;  1H9M A;  3PUW A;  1EY5 A;  1HTL D;  2EPB A;  5E4X A;  1F2L A;  2D5D A;  1CHQ D;  3GP7 A;  4BS9 A;  5CV7 A;  5M3F B;  1WTV A;  4P2C B;  5DEH A;  3HOY B;  4RAU C;  3C46 A;  4ID6 A;  3K5O A;  5IT9 L;  2A6H D;  1F2Y A;  4QCL A;  2F0D A;  1AW7 A;  5DM6 3;  3VA7 A;  3VA5 A;  1HRJ A;  2SNM A;  4CKB A;  2QF7 A;  2PYK A;  2FMM A;  4KY7 A;  5JEA H;  5D3I B;  1PFM A;  2EYO A;  1SE3 A;  2RDF A;  3R93 A;  2EY2 A;  2EJM A;  4K8J A;  1SBB B;  4BA2 I;  2Z4I A;  5JPN C;  5A2Q E;  4XXE A;  1KDB A;  2L4N A;  1SYC A;  5KND A;  1LTG D;  3FEW X;  2BA1 A;  4L6T B;  4DAP A;  2ICI A;  3RLF A;  5FLX E;  5IGG A;  1S5D D;  4J1M A;  1RHP A;  1CA5 A;  1JOK A;  4XYO A;  3S1Q B;  4RCN A;  3HGB A;  3QOL A;  1QB5 D;  1ROD A;  3A7A B;  4LAA A;  4V19 0;  1XXG A;  1KNE A;  3OSO A;  3SXH A;  3DXJ C;  3W2D A;  2Z8L A;  4J8Q A;  3K5L A;  5FLX L;  2EJG C;  3OW7 A;  2RSO A;  4KK7 A;  1CZG A;  5M5Y B;  5T1G A;  5FK9 C;  1QNU A;  1H9S A;  3H91 A;  4C1N I;  3K7A B;  5COY A;  1TQO A;  3HKZ B;  4FO2 A;  1HTP A;  2J7Z A;  5EJW A;  2WB1 B;  3JAM E;  3QJY A;  1EQT A;  1EU3 A;  4KKT A;  2A68 C;  1WD1 A;  1KDA A;  4CJ2 C;  1SMY D;  1EIG A;  3D31 A;  4QUC A;  2EXZ A;  1LT5 D;  1BCP F;  3A56 A;  4XYQ A;  4NDX A;  5C3E B;  2XWJ B;  1HUN A;  2RDG A;  1YNN C;  1Z7T A;  2F0E A;  3A8I E;  3NXW A;  1S5B D;  1I6H B;  4TSS A;  5EKK A;  1TS5 A;  1EYC A;  5C0X I;  3DWQ A;  2G9D A;  2NVT B;  2VXW A;  2C9O A;  4QMG A;  4Q5V A;  4FXK C;  2F3W A;  1F77 A;  1I4Q A;  4EQP A;  1MD2 D;  4TQU S;  1V8Q A;  3A7L A;  1OXV A;  3X3N A;  1STH A;  2FJ2 A;  3S16 B;  2DNC A;  4C2M B;  1DCZ A;  2NN6 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...