5E1FA

Crystal structure of staphylococcal nuclease variant delta+phs g20e at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDEDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS G20E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5e1fA00
4F7XA 3TP6A 2RDFA 1EY8A 3QB3A 5KIXA 1RKNA 3C1FA 1STAA 1ENAA 1AEXA 1TR5A 2QDBA 4KHVA 4MIUA 2F0IA 3P75A 3VA5A 2RBMA 4TRDA 4IZ8A 3BDLA 4WRDA 5CV8A 2HQEA 2EYHA 1SNMA 1SYDA 3MEHA 1TT2A 3RUZA 4QF4A 3NHHA 3T16A 5C4HA 5M9OA 1F2YA 2PW5A 2PZUA 2WACA 4B9XA 4HTHA 4DGZA 4K5VA 5IGGA 2LKVA 5IGCA 5KYLA 4RKBA 5IIFA 1EZ8A 5CV7A 1F2ZA 1F2MA 5I9OA 2F0UA 5CGKA 2EYFA 2F0TA 4KTAA 1EY6A 4H7BA 2PZTA 4NMZA 4S3SA 2F0EA 2PW7A 3EJIA 3OMGA 5IGBA 4ZQ3A 1KAAA 2EYMA 1KDAA 5K5PA 2F0WA 3P1HA 5C3XA 1IHZA 1STBA 2M00A 3NP8A 1STYA 3S9WA 5CV4A 4EVOA 4QMGA 1EYCA 2EY2A 2F0MA 1ENCA 2F0KA 1EQVA 1EY0A 4ZUIA 1EYDA 5CV5A 4ODGA 3T13A 5CC4A 2ENBA 1A2TA 4F8MA 5J22A 4NDXA 4LAAA 3SK8A 1SNPA 2F0NA 5I6YA 2EYLA 5EKKA 5ISRA 1A2UA 3D4DA 1EY5A 4K14A 5E3FA 1JOQA 1EYAA 4HMJA 2SNMA 1NSNS 1JOOA 2F0PA 2EXZA 3H6MA 3HZXA 4KD3A 4J6HA 4KD4A 3D8GA 4K8IA 3HEJA 4KJNA 1TQOA 2EYOA 3TP8A 5C3WA 5C4ZA 2OXPA 5IGFA 3DHQA 2F0DA 1A3TA 3PMFA 3MHBA 1A3UA 1SYFA 2SNSA 5JOBA 3SR1A 2SOBA 3NQTA 5C6AA 2EY5A 1EY9A 1SNOA 2KQ3A 5EKLA 4RKLA 2F0GA 5CR3A 2EYPA 5DAUA 1JORA 2F0JA 2F0HA 2PQEA 3MZ5A 4IUNA 3BDCA 4PNYA 4DFAA 1KDCA 2F0VA 2F0QA 1STNA 4K5XA 4KJOA 4I65A 4NKLA 4PMBA 3ERQA 4N9PA 4G57A 2NUCA 1SNCA 1SNDA 5F2DA 3EROA 2F0FA 3D4WA 3OSOA 3SHLA 3TP7A 1SYCA 1SYGA 2F0OA 2F0SA 4PMCA 5IGEA 5KRUA 1EZ6A 1SNQA 3E5SA 2OF1A 3TP5A 4DU9A 5HURA 4NP5A 2EY1A 1EY7A 4QB4A 5J1ZA 2PYKA 5C5MA 1JOKA 3SK6A 4R8NA 2OEOA 4DF7A 5KGUA 2RKSA 3QOJA 4J1MA 4ID6A 2PZWA 2F3WA 4E6IA 3D6CA 2O4XA 4B9WA 2F0LA 3MXPA 5E1FA 4KY7A 4KV6A 1SYEA 4K8JA 1STGA 4K5WA 4ZUJA 2KHSA 3DMUA 4WORA 5DEHA 4HMIA 5IODA 3ITPA 2EYJA 4KY6A 5NUCA 3OMCA 3NUCA 3QOLA 5J39A 3U9OA 4K2LA 1KABA 5C5LA 4KY5A 1U9RA 3OWFA 1KDBA 3EVQA 4N9TA 4ME5A 4IALA 4EQPA 3NK9A 2F3VA 5HGTA 5KYIA 3C1EA 1NUCA 4EQOA 1II3A 5I9PA 3MVVA 5KEEA 3LX0A 3NXWA 1SYBA 4EQNA 5JAVA 4K6DA 4K2KA 3V2TA 5IGDA 5CV6A 1EY4A 5EGTA 3R3OA 1STHA 3TMEA 3SK5A 5I6WA 4YIJA 3SK4A 3SXHA 4OL7A 5IOCA 5CV9A 1A3VA 2EY6A
chains in the Genus database with same CATH superfamily
1EY8A 5IT9L 1PYWD 1CK1A 1DD2A 3VR3A 1E2ZA 2KCMA 3P75A 3VA5A 1LT5D 5CV8A 1XNQL 1VQLA 1RDPD 1RF2D 4DGZA 5IGCA 4FF3A 1GVPA 3SGIA 1CM9A 4LF7Q 3J81i 4KMUC 4OXPA 4IOCA 3EJIA 4U68A 1WFQA 4G7OC 3K80C 4ZKCB 2UXCQ 3W1BA 1D6EC 4KHPL 3HKZE 3T13A 1WI5A 4NDXA 5M3MH 3GTJB 1N32L 1NJIC 4R4CA 3J80c 3HZXA 1VF5C 5FJ8H 1Q1EA 4DK3C 2CW0C 4J8QA 1QVFA 5JOBA 1CKNA 1L2FA 4XTCS 1UE6A 2IL8A 2BCOA 3I2ZA 3FKIH 3K7UC 1PRTB 2VQFQ 3DM3A 4DR6L 1PH9A 4G57A 4DR2Q 2AMCB 4GLXA 1I4QA 3TP7A 3JAME 2C9OA 2L9HA 1YIJA 4HN7A 1VQCA 2B2TA 3S14H 3S15B 1AZPA 3TZDA 2K52A 5CBEE 1F9PA 5KGUA 5M5XH 1NNXA 2NZHA 1PTOH 1RL2A 2PZWA 4RFBA 1KXLA 3MXPA 1FNVA 1EQRA 1EQQA 1VQ9A 4DV6Q 5EPKA 4L5SA 3LWEA 2CFMA 2EYJA 5JVH3 1ZYRD 3NUCA 1TIID 4ABNA 2E74C 1HRJA 4LW1A 4L63B 2K01A 1F2LA 3EVQA 1WTWA 3C1EA 4ILWA 4WJWA 4JI3Q 4DAYB 5KEEA 4LF5Q 4V190 1G2TA 1QB5D 2HIVA 3W2DA 3PO2G 4A3FB 1EY4A 5I2XA 4X64L 1YNND 2JA5G 1FJGL 4HJAA 3PIP3 1MJCA 5G3LD 1D5ZC 5KIXA 4XXEA 2K5HA 2NVYH 4DXFA 3KLRA 4MNOA 3J7YW 4DV2Q 2UUBQ 4FXGC 3I4NG 2DGYA 1H9SB 1YVCA 2RBMA 1B9NA 2L15A 2JA6G 1O80A 1W6JA 4DPGA 3IFTA 2A19A 1EZ8A 5I9OA 4DR7Q 2HHHQ 1SROA 2RDHA 1X56A 1HCZA 2EYMA 3CW2C 1KDAA 1SJHD 1PZKD 3G7LA 5EJWA 1TWCB 2NVTH 1STBA 1HNWQ 5JPNC 4A3LG 1EYCA 4JBKA 1ENCA 2E2IB 2TSSA 1E2WA 5E7NA 1Y1VG 1EYDA 1R9TH 1C9OA 2NTTA 2K50A 1OXXK 2L11A 2AQ3B 5I6YA 2F0NA 2Q8IB 3HOZB 1EY5A 1S3OA 3CCUA 4QCLA 4KJNA 3I4OA 3TEHB 2EYOA 4IPHA 3K5MA 2N3SA 2KOLA 2PCFB 2WB1E 3I73A 4GLAC 4JYAL 1I4PA 3GTGB 3BVZA 3PO2H 2B2WA 1I3QB 5DAUA 2NVXH 3TREA 2JA5H 2YTVA 3IAYA 3P7JA 2FMMA 2V1CC 1Q8IA 3MXGA 2XIWA 4DK6C 5IGEA 4PMCA 5I2YA 1K8GA 5M5WB 1K8OA 4IJLA 3K5LA 4XYQA 2O5IC 4L5RC 2ZXRA 1T9HA 2Q2HA 4E6IA 2JA6H 4QGUA 1E22A 3HKZB 1FD7D 3BZDB 5T1IA 2ATWA 1HA6A 4V0BA 3W5OA 4HJ5A 4KY6A 2QCPX 3K6OA 1PLFA 3T4AC 3G4SA 1VMCA 1C8CA 4JOIC 4C3JB 1VQ5A 1C0AA 2B2VA 1E1OA 4LF8Q 2HIXA 3J81j 1F9SA 2DY7A 4JVZA 3CPWA 1KDBA 3H0GH 4DNRB 4U673 3DXJC 3GTPH 4GOPC 1Y1VH 4IFDI 4B3RL 2RHSB 1CKNB 3MVVA 1SXTA 2Z6KA 5IWAQ 2HT1A 5IT9E 3HOVG 2PQAA 4P72A 1U4RA 4BBSG 2HQLA 5FLMG 3J81c 4DA2A 3CCLA 4YIJA 3OHXC 4IOAA 3M4OH 2G5DA 2XWJB 2A69D 1HH2P 1JWMD 1SSOA 4XT3B 3GTLH 5C4HA 2R93B 1CKMA 5M9OA 1PFMA 4QIWB 1KC8C 4GN4B 4OIKA 4IFDH 4FXDA 1HQMC 1E24A 2NWGA 1PZID 2EYFA 2LFNA 4XQQA 1QNKA 2EXDA 1NR4A 3J80E 3P1HA 2M00A 1JJ2A 1MSHA 4LFAL 1STYA 2Z4IA 1IW7C 3MAQA 4F8MA 1SNPA 5EKIA 1JOQA 1A2UA 4F88A 1KLGD 5C4JH 2VUMG 1NSNS 2EXZA 3GD7A 3S2HH 2WKDA 4J6HA 1MJEA 3HOYG 2FHTA 4A3BB 3QG1A 4AYBB 1PH2A 3N6RA 3HOVH 3JC66 3R8BA 3WDNA 2FFKB 1SMXA 2VS1A 3A8JE 4BBSH 1FNWA 4AH6A 5JVG3 4DFAA 2YTXA 4PNYA 4PZ6A 3P20A 5M3FG 5H1SE 1SNDA 5F2DA 1N33Q 1B53A 2M9VA 5IYBG 1BXTA 4UHVA 3OOCA 2AUKA 5J1ZA 4A3JG 2K5DA 4FVMA 4XIGS 4GKKQ 1WTXA 1N34L 5C44G 1CSQA 3D31A 3W1GA 1W3SA 4ZLTF 2KCNA 3GO5A 2K6AA 3CF5A 4RHRA 3KFUA 1TS4A 3ULPA 2DJGC 2E5LL 1HA5A 2CQAA 2AUJD 3CC7A 2WB1B 2NN6G 3BJUA 5LL6X 2I5HA 1J5EQ 1QUQA 1X3EA 1SFOH 3A5ZB 3MFGA 5IY0A 5I9PA 3B6YA 2LMCB 4IJHA 4O42A 3NEMA 1Y1WG 2IW3A 3NELA 1UUPA 4Y7NB 2VUMH 1EIHA 4EGVA 1BO0A 3RN2A 3HOYH 2HCCA 2HD3A 1DJRD 3SXHA 1XNQQ 5IOCA 1SJED 3E5SA 2IX1A 2RDFA 1YNJC 1G51A 2JK8A 1MKHA 3RZOH 1NE3A 2RCFA 4A3DG 2LY7A 5M3FH 1FYCA 1VQMA 5D3DA 1TT2A 2NZ1D 5C4XB 1G6ZA 5IYBH 1V1PA 4EQ5A 2Q8RE 1NAPA 2VW9A 4B3ML 4CKEA 3CCQA 3NQIA 5J3BA 4A3JH 1HNZQ 3E9HA 1LO5D 1VQHA 2F0TA 1XMQL 5GAGC 1PRTC 4JG2A 5C44H 3TN2A 2CW0D 4NXNL 4MHEA 4LF4L 4IPCA 4UP9A 4C3HB 4TSSA 2MPMA 4C3IB 4PG3A 1RD9D 2KHJA 1X9NA 4Q0FA 5J22A 3S1QH 2AQ1B 5E3FA 4X65Q 3E0EA 2F0PA 4A3KG 1VQ4A 2RCNA 2L1BA 3PV0A 1BVSA 4XQJA 1K0RA 4DR6Q 4JI4L 5JJKA 1A3TA 1A3UA 1C4QA 3A0JA 1Y1WH 1DCZA 4RAUC 3CXCA 1BBUA 3DWPA 2F03A 3AU7A 4HAEA 1STNA 1PXUA 3L2PA 3NSWA 5CMDA 2ZTDA 3FRPB 4JPBW 4JI5Q 4K6LA 1SYGA 5KRUA 1LACA 1IBML 3KJOA 1B4OA 4EX5A 2ICIA 4A3DH 5C5MA 1I6VC 4DAPA 2UU9L 4PV1C 4IFDJ 4LFCQ 4DN4M 1Z7TA 2CHBD 3F2BA 4B9WA 5HY6A 4A4IA 1BR9A 4KV6A 1QNUA 1QILA 2VY3A 4WORA 2JYOA 4TKOB 5DEHA 3FEWX 3RLOA 1V1OA 2VB2X 3O13A 3BVMA 1Y69U 4OIJA 2AKWB 3J81E 3GTQH 3M4QA 4ME5A 2G9DA 3GTKB 5HGQA 4AQYL 1FJGQ 1QVGA 5I4DA 3H91A 3H15A 2PPBC 3HOWG 3L7ZC 4ZAIA 4A3KH 3SE0A 1Y8NB 5KNDA 1S5FD 2EY6A 3G48A 2ES2A 1TWHB 2I5MX 1SAPA 3GQBA 1H9JA 1DZ1A 3SVMA 1BDOA 1CI3M 1EWCA 1PV4A 1S5DD 2HCIA 2K14A 5CORA 3A7LA 2MGSA 2Z6BA 4B3SQ 4L5TA 4TQUS 3PUYA 4M8AA 2PW7A 3K0YA 4ZQ3A 1CQVA 3T53B 2IHFA 2RA4A 4A3IG 4H13C 1TY0A 4X66Q 1QUQB 3S24A 2A74C 4QMGA 5IYCG 2ZM6L 1MHWC 1EIGA 1L0YB 2BOSA 2CWAA 4X3KA 3KDFA 4JYAQ 4DNIA 3TS2A 1I50B 2D2CC 3KJPA 4HMJA 3OTOQ 5ELFA 4YHHQ 3M4PA 3HEJA 3HOXG 5C3EB 2SNSA 4DV0L 3V05A 1RTOA 4YY3L 3HOWH 4R1JA 1XMOQ 3MZ5A 1WYDA 1XJVA 3KLWA 1GD7A 1V1PB 3I72A 2PMZE 5BN4A 2JA9A 3AFPA 3RN5A 3GTMH 1WTRA 3VYRA 4RA8A 1I94L 2OEOA 4DV1Q 3PO3B 1YJWA 5GROA 3T51B 4KKSA 3S15H 5D3IB 1SYEA 4ZUJA 3ULJA 2KHSA 2K03A 3NBHA 1HZBA 2EZVA 2PO4A 4X3UA 3GV6A 3U4ZA 4I7AA 1SR3A 4A93B 2UUCQ 1H9MA 2RF4A 5IYCH 4EQPA 1V43A 1AW7A 4JI7Q 3DEOA 1BUVT 2D5DA 1GUOA 1QCBD 2F4VQ 3HOZG 4OX9L 1SYBA 4CKBA 1EUJA 5D65A 3S1MB 3D4RA 2X6GA 5CV6A 3VYTA 1K28A 2IWHA 1EFID 2Z0SA 2BH2A 3ERSX 2UXDQ 4GKJL 3LWUA 3HOXH 4PZ8A 3K58A 4OEMB 4GNXA 3RMHA 1YHBA 2LKVA 4ZCKA 3KF6A 4HSVA 1TWFH 1UEAB 4RHSA 4HIKA 5D14A 4JI8L 1NY4A 1ET6A 2Z8LA 4JI2L 2IY5B 5E4XA 1Q86C 4A3GB 2DJFC 1AE3A 4HR7B 3HRZC 1IW7D 4QF4A 1VQOA 1NBWA 4DR1L 3VR5A 2PW5A 4CDEC 4HTHA 2AWOA 2N49A 3CCRA 2R7FA 1L1OA 1JB7A 3S16B 2FJ2A 4KTAA 1HFNA 1VQPA 3FKIG 2VL6A 1JJGA 5BR8L 4O2DA 2IPKD 2RDGA 4YCUA 1X3FA 2EJFC 4BY1G 3TZUA 3X3MA 2RHQB 2C5CA 5IYDG 1GUWA 1TWCH 5CC4A 1YJ9A 1WCMG 1GM5A 1G91A 1CTMA 1E0BA 2E2IH 4GS3A 5ELDA 1HNXQ 1QE6A 1VQEA 3A8KE 4HJ8A 4DR3L 1I5FA 3Q6SA 3HOZH 2KA7A 4ULLA 2A5HA 2BDNA 1YITA 1TWAB 3H09A 3MEFA 4DAVA 1JORA 1S5BD 2PQEA 1NTGA 4JV5L 2J0TD 2NUCA 2OWOA 1I3QH 3CC2A 1W6KA 2WAQB 1X6OA 3PUVA 4DV3Q 4DU9A 1MSGA 1EY7A 4GLVB 4QB4A 2V4DA 1TWGH 3J80L 2IT1A 2A68C 3QJYA 1ESFA 2F3WA 4LUVA 5DM73 1QZGA 3HKSA 1XWEA 3TS0A 1B44D 2JA7G 2CWPA 3QR8A 4X3SA 3DMUA 1IYVA 3KDFB 3RNUA 2HUGA 1CFMA 1PYBA 3Q24A 3M7GA 4A3MB 4LFBL 3HGBA 1YNJD 4BY1H 3MXNA 2XWBB 5IYDH 4C3JH 3CCEA 3NTIA 1NMGA 5LMUL 2E2JB 3M9BA 1VQ6A 1O7IA 1WCMH 2J4XA 1P16A 4HCEA 3RD4A 1UE1A 2K28A 2MJ8A 1K3BC 4UAIA 2Y0SG 5ELCA 4JI6L 1RKNA 4B3MQ 1D5XC 2B39A 2XSCA 3RLNA 1XMQQ 1QJOA 3MEHA 4MTKA 4BBRB 1F2YA 3J7AV 1F9RA 1EU4A 2AWNA 1JE5A 5KYLA 3NBHB 2Z9HA 2L0CA 2K5WA 1LTLA 2B2UA 4JBMA 4DAMA 3CKIB 2KECA 1UNSA 1HUMA 3CCVA 2JA7H 4FF1A 2BE5C 1VQAA 3UDXA 3NP8A 2ZJRA 3PF4A 4H0LC 4DUYL 2EY2A 4LMQD 1AP0A 2R92B 4XQNA 1OO9B 3FHWA 1RCVD 4DV4Q 2XGTA 1WTVA 5EKKA 3D4DA 4K14A 3ICEA 2SNMA 1HHVA 5M5YB 1O7LA 1JCKB 4GNXB 4FDBA 3KF6B 1WTHA 2ZT9C 2ID0A 3BU2A 3S1RB 3E3XA 4RG1A 3NWTA 4RKLA 5CR3A 2ZXOA 3QWNA 2VQEL 1LTSD 4EVOA 2UU9Q 4NKLA 1LTBD 1OXSC 2JQOA 2Y0SE 4X3TA 3H0GG 1M90C 1L1OB 1KNAA 3OWEB 1EIYB 1FNUA 3MA2B 3QOJA 4A3EG 2CH4A 5E1FA 1PA6A 1Q8KA 5C0XI 2EOTA 4IUPA 3S17B 1X65A 3CMEA 4C2MH 3GTOH 1HZ9A 1PFSA 4JBJA 5IP9G 1GHKA 1U9RA 4X62L 4DV7L 1GXDC 1HZAA 4IALA 1X32A 3AEVA 2JEAI 4EQOA 3T1HQ 4CDFC 4IFDG 4OWTB 4EQNA 1JE4A 5TSSA 4DUZL 1BCPC 1SEBD 1GUSA 1IL2A 2KUMA 2UXBQ 3E6ZX 2X6LA 3S2DH 1A3VA 5FO9B 3KBGA 1FL0A 1ZXTA 2K75A 5M3MB 3K5OA 3I55A 2QW7A 3L0OA 3PIOA 1WOCA 3K81C 2E76C 1D2BA 3VR4A 1ET9A 2NYZD 2QEJC 4WRDA 3HOUB 3BDLA 3S1NB 1CA5A 2EYHA 1SYDA 3UE0A 1QG7A 5FK9C 4IUTA 3C2PA 3FMCA 2PI2A 3J81L 1PH1A 2L4NA 2WP8J 4A3EH 4DV5L 3N52A 2F0EA 2PI2E 4S3SA 1T5EA 1K73C 5JEAG 3HS0C 3A56A 2B8GA 3S14B 1TXYA 3MXNB 1B2TA 4YCVA 1ASZA 1C48A 2FMCA 5IP9H 5M5XB 2R61A 1A2TA 3R2IA 3BZKA 1HXYD 2L5TA 3KOJA 3KUPA 2R7ZG 4C3IH 1ICFB 1KRTA 1PTOD 2F52A 1YBYA 2R6GA 2D62A 1ML0D 2WKCA 1TQOA 5C3WA 5C4ZA 3NBIA 3URYA 3ND8A 2D0OA 1PYSB 2RQXA 4C1NK 2SOBA 3NQTA 5C6AA 4HIDA 2EY5A 5FKAC 5EKLA 2F0GA 2XVSA 2DN8A 2EYPA 2UUAQ 3MFYA 2F0QA 4IUQA 1D8LA 1XNRL 4CJ2C 3EROA 1SMYD 4TVAB 3EA6A 3ND9A 1GO3E 4IPGA 2F4IA 4DK1A 1QVCA 2ZJQA 1Q81C 1HFGA 1IBKL 3JAMi 3IL8A 3CHBD 4POFA 4BY7G 2FXQA 4B3TQ 1ILQA 1STGA 2NVYB 1NCVA 4NXML 1CQFA 4WFN3 1BKBA 4HMIA 3M3YB 3TDQA 3AQQA 5JEAH 2B63G 3STBD 2J7ZA 4NPSA 2O5JC 1LTAD 1PFBA 1LTRD 2RSNA 2JA8B 4GKJQ 1D1KA 5BN5A 4JI0Q 2R7ZH 1Q46A 1U0LA 2OQKA 2NVTB 5DM63 4O1NA 1STHA 4JI8Q 1B7YB 3SK4A 3T1YQ 3OPOA 3TP6A 4LF7L 2D0PA 2PNHA 2DY8A 3KLSX 1K3RA 3RUZA 3G6JB 1HUNA 3I4MG 4UP8A 1CUKA 1TWHH 2UXCL 5BR8Q 3PO2B 3CD6A 4RGMA 2NVXB 3EFXD 3EIVA 2JA5B 2F0UA 2KCCA 1IYJB 1S72A 4OWWB 4JBWA 1O7ZA 4BY7H 2QKIC 1VQ7A 4RGNA 4L8JA 2CVRA 4RWSC 1EOVA 3PUWA 1N8RC 3I4NB 1Y8PB 1Z6HA 4FP5D 2YU9B 4UDUC 2B63H 2JA6B 3NENA 1GOZA 1SE3A 1TU2B 2K04A 1EYAA 2L12A 4FNFA 1K9MC 1JT8A 3CCSA 4JOIA 4DKAC 5K36G 4JV5Q 5IE8A 3TBIB 1Q90A 1Y8OB 4GOPA 4QL5A 4XYOA 4KHPQ 2KQ3A 3L3OC 2Z1CA 2K32A 5LHY1 3NE5B 2F0HA 1N32Q 3M85A 3GTPB 1Y1VB 2B2YC 1LT3D 3SHLA 1HZCA 4DV6L 4CBVA 1U4MA 2PQAB 4A3GG 2EY1A 4JCVE 1O78A 4R8NA 3M4OB 3UDIA 4CGYB 3I4MH 4LF6L 3TSSA 4LNQA 1IYUA 3K7AH 3PSIA 4BS9A 4LF5L 3RZDH 4BA2I 3K8AA 5IODA 3GTLB 2K5QA 1KTKA 5LMUQ 3BZCA 4KI0A 4RGOS 1U4LA 2JEBI 3E0JA 2L55A 3SDZA 1Z47A 4KN7C 4QUCA 1KAWA 1YNNC 1ILPA 2BA0A 2KHIA 4DV2L 4K6DA 4LJZC 3V2TA 5IP7G 4XDXA 3CQZB 1DOLA 4HSPA 5K36H 3IKJA 1H9KA 5LMNL 5A35A 2HHHL 1LM0A 2MFIA 4DR7L 1AEXA 4IURA 2QDBA 2QGQA 4KHVA 1UAPA 5DLQE 1IBLL 3S2HB 2BE5D 1SLJA 1EYGA 4YWMA 3H3VC 3MC0B 2ZJPA 4R9WA 5KNBA 4X64Q 4OO1I 1LTID 3WOFA 1HNWL 4KHZA 3HOVB 4QQBX 4A3GH 4BBSB 5G3LF 1Q7YC 1TS2A 4WJ3M 1F2ZA 1VQJA 1PH6A 2A8VA 1EY6A 2SEBD 3OIPA 3Q23A 2ASBA 5JEAJ 1FGBD 3DM1A 3UDFA 3S9WA 5JJLA 4J15A 2CQOA 1K83H 1KD1C 4DNTB 1GHJA 4APVA 2EJMA 1VMPA 5JPMC 2VQEQ 3V96A 3FPUB 4JI1L 5IGFA 3JAMc 2F0DA 2EVBA 3HG9A 5AFWA 2Q2TA 1IKMA 2E2HB 1RODA 1BQQT 5IP7H 2OCEA 2IHEA 5COYA 1SFOB 1YZ6A 2F0VA 4PMBA 2R3ZA 1SNCA 4BWGB 5KYIA 1M8AA 2F0OA 1H95A 1EZ6A 2IX0A 3TP5A 2OF1A 2VUMB 1LT4D 3HOYB 1PDQA 2TMPA 1B50A 4J1MA 1V9PA 4LF8L 1RJTA 3GTJH 4H02A 1J6QA 1BCPD 1N9WA 4A3FG 3RZOB 4YWKA 3A5UA 5M3FB 1V1QA 5IWAL 3ITPA 4NW2A 4K2LA 1KIXA 1NMFA 2C35B 3KYHC 1CKOA 1DXMA 4A3JB 2RSOA 3SEBA 1XTCD 5C44B 1D1IA 1B3QA 4K2KA 1YEZA 3D6WA 4DR4L 4DXGA 4OWXB 2A6HC 2JSOA 3E9IA 2B2TC 5CV9A 2KVMA 1TVXA 2JXMB 1PHJA 4B3RQ 1X3GA 1I4HA 1D5MC 2XRSD 2WINB 5CBAE 1QWYA 1LYLA 3NHHA 3H3VI 2PZUA 1F77A 2CKZB 4GN5A 1ZEQX 2H1EA 5IIFA 1QZHA 3BYTB 4DAYA 3BVGA 1MD2D 3TRZA 5K5PA 1A63A 1BF4A 4A3FH 1PTOF 1VQKA 4A3DB 4ZUIA 2K33A 3J7AF 4ODGA 2YYZA 2ENBA 4R4OA 1J9OA 4IQZA 2R92H 1VQ8A 5EAYA 1JOOA 2IJ0A 1N33L 4X6AH 2XRQD 5GQOA 4LFAQ 3MHBA 2BDOA 5M5YH 1EU3A 2VNUD 2AQ2B 1EY9A 4ME3A 3HKZG 4GKKL 2F0JA 2KENA 1KDCA 1KHIA 1PZJD 4I65A 3OSOA 4C3JG 4WJ4A 2A73B 4A3KB 2PYKA 3A54A 2RKSA 5FLXc 2N8NA 1DONA 1IZ6A 1PFNA 2F0LA 1UE7A 4KY7A 1SRUA 2N88A 1I6HB 2JE6I 3I91A 2NBFA 3RLFA 3AYHB 3U9OA 2EQSA 4CKCA 5IT9c 3S17H 3GTGH 3M4YA 4KKUA 1N34Q 4DK0A 3PGZA 1WVLA 2I5LX 1M4VA 1VF7A 1EFWA 1LUZA 4IPDA 1NUCA 1II3A 2B2WC 2EDGA 2QILA 2G9HD 3F2UA 2R93G 1VQNA 1TKWB 1PH5A 2XNAC 5M5WH 4PZ7A 1UEBA 2E5LQ 1JWSD 2ALYB 3I3CA 2NTSA 1Z9FA 2Q2UA 1JJCB 3I4LA 1E2VA 1HNZL 3QB3A 1R4PB 3F1ZA 2NVQB 1MGSA 5AJ3L 4L6TB 1ESRA 4OELB 4UY8C 4YCWA 1ICWA 2WACA 2PNRC 4C56C 1OXTA 4KK7A 3CCJA 3HOWB 2N78A 3ZYYX 2Z4HA 4RKBA 3HOUH 3S1NH 1F2MA 2N55A 4A3BG 4YWLA 2PMZB 4AYBG 2B2VC 3OMGA 1VQGA 5EBCA 4X65L 5IGBA 1TY2A 3G6EA 2I0QA 4XT1B 4IUVA 1IHZA 3GTMB 1SE8A 5ELNA 1PRTD 2F0MA 1KLUD 2Z6KC 1SBBB 1PH3A 5DNFA 2WIIB 5ISRA 3F2DA 4N8FA 2IX3A 2JA8G 3H6MA 1T5XD 4IUUA 5CV4A 4NB3A 4KD3A 4JI5L 2ZTCA 2B8FA 2H5XA 3T56B 4NXNQ 4LF4Q 4RMFA 2R93H 2LSSA 4A3IB 4FXKC 1SYFA 4GN3B 4LFCL 1JWUD 4QIWE 1TS5A 1FR3A 3MTSA 4F87A 1Q3LA 2F3IA 2K5VA 1A0IA 2F0FA 3D4WA 4LF6Q 4LUZA 4HIOA 4JI4Q 3UDGA 2WB1G 4LUOA 5ELEA 3A8IE 1I4GA 3SK6A 4DF7A 1KNEA 3HOXB 1JB3A 2DNCA 1VCIA 2O4XA 3DWAA 4R4TA 1PH7A 1U4PA 1TWFB 1LT6D 4K5WA 4RCOA 5LMNW 5C0XG 4A3BH 1IBMQ 5NUCA 5J39A 3CC4A 4AYBE 3I7FA 5C5LA 1XYIA 3EN2A 3Q22A 3M3YH 4N9TA 4K0KL 3NTKA 2K7VA 2F3VA 4P74A 1E3PA 2R7DA 1L0XB 3LX0A 5EPLA 4RCNA 5C4XG 2GVAA 5LMNQ 5JJIA 1CHQD 3I70A 2JA8H 2H4OA 3FVQA 3PF5A 1IBLQ 2RVLA 3PIO3 1P8LA 5ELOA 4Y52H 1PVOA 4AQYQ 1CT1D 5L37A 4B3SL 4CDDC 3PIPA 1JC7A 4C3HG 4IZ8A 4C3IG 4ZRZA 5ELBA 4X66L 1CSPA 4B9XA 1YJNA 1I4RA 4ZKBB 1MIUA 5CGKA 2X69A 2PZTA 5BN3A 3OTOL 3A55A 4YHHL 1E1TA 3OYYA 1F9QA 4Y7NH 5C0XH 1YI2A 3KF8A 1TWGB 2F0KA 4R4QA 1AE2A 1AZQA 5CV5A 3MXUA 4JI1Q 1XMOL 1EIFA 3I4NH 4CDCC 3GV3A 2EIFA 2KCTA 3U58A 3EBEA 2YU9H 5E4WC 5CYUA 4LWCA 1WTPA 1XPUA 3I8ZA 3FKIB 2ZM6Q 5C4XH 3AMUA 1OTCA 3U50C 1G291 4DV1L 3ER0A 3R2TA 5KNCA 3DLLA 4P2CB 4BY1B 1LTGD 1Y14B 4KJOA 2I46A 2K1BA 5FLXE 3PQIA 3OW2A 1N36L 1WCMB 2XN9C 4A3LH 2F0SA 4UP7A 4LF9L 2KEDA 1HR0L 1OXVA 2XTIA 1PTOB 3IFDA 2AHOB 1FGUA 1BCPF 1DGSA 4RH6A 1XXGA 4C3HH 1K8MA 4DV0Q 4HJ9A 4YY3Q 2UUCL 4ZYSA 5A2QL 4Q5VA 4JI7L 4K8JA 3LNNA 2JN4A 1VQIA 4QJFA 2F4VL 4MN3A 3LGJA 3UE1A 1VQDA 2A6HD 4R8IA 2CH4W 1X3PA 1I94Q 1GJXA 2BH8A 2UXDL 5T1GA 4DR4Q 3OWFA 2MO0A 1EEFD 1H9RA 3ZJYC 1WTOA 1LTTD 3NXWA 2MUYA 2JA7B 2HDMA 2A6EC 2K4KA 1XPRA 3R3OA 3TMEA 2ICEC 1U5KA 3WWVA 2WFWA 4DR5L 3CQZH 4PMWA 3C3LA 2KEEA 1ASYA 4I7ZC 3AFQA 1RHPA 3F2CA 2FINB 4G7HC 4MIUA 1OXUA 2F0IA 4OX9Q 5FO7B 4P71A 1B1ZA 3VYUA 2OTJA 3VYSA 4TRDA 2HQEA 4OONA 1SNMA 1GUNA 1JR0D 2NZOA 4BXXG 2GA4B 2E8GA 1V8QA 3FDTA 3K5NA 5CV7A 1SE4A 3FP9A 1B70B 1VDZA 4HCSA 2Y0SB 3GTKH 4KKTA 4FF2A 1S4ZA 3D0FA 4IN3A 1GKHA 5FLMH 1A15A 1HJPA 4JI2Q 5C3EG 1HNXL 1NR2A 2LXJA 1R9TB 2F0WA 3G71A 2MP1A 4DR1Q 1EL0A 3BDOA 3I56A 2I07B 5JJZA 1E7ZA 1EQVA 2MNAA 4L5QA 1W2BA 1BBWA 1HTLD 2ZTEA 4BA1I 4G7ZC 3OIQA 2Q8TA 3D8GA 4K8IA 4C2MB 3TP8A 1G8ZD 1IKLA 2OXPA 3GTOB 3PO3G 4DV3L 1S5CD 1JMCA 4R4IA 4IO9A 4A75A 3SR1A 3BG3A 2JP1A 3MWYW 3ONAB 3CPFA 1CZGA 3KLSA 2E2HH 2QA4A 4DR3Q 3C46A 1VQFA 4A93G 1SNQA 2K05A 4ZK9B 1AH9A 2QDLA 2VQFL 3A7AB 1JOKA 5FOBB 4DR2L 3VDYA 2O2LD 3S2DB 3CCMA 1WD1A 1JQYD 4BXXH 4H44C 1D7QA 1I50H 3KF8B 2A68D 1CA6A 1X55A 5C0XJ 2KBNA 2LS01 1I4XA 1S40A 1EQTA 3OMCA 4OHJA 3H0GB 2QF7A 3QOLA 5C3EH 2VXWA 2NN6I 4KY5A 1K0SA 1Q1BA 5HGTA 2OTLA 4FF4A 3OW7A 1STEA 1HPCA 4A3EB 4JW0A 3K0XA 3HP3A 4B08A 2A1AA 5EGTA 5AJ3Q 1ZYRC 3SK5A 5I6WA 4QY7A 3PO3H 4LFBQ 4JI3L 3CP0A 4F7XA 3DWQA 5FO8B 3C1FA 1STAA 3NPPA 1TR5A 4Z9CB 1C7YA 3RR5A 2NN6H 1X3QA 3T16A 2D9UA 4A93H 4OO1G 5IGGA 3NTHA 4FO2A 4K5VA 1B8AA 1CZWA 1MBYA 4JI6Q 2UUBL 2JJQA 1PRTF 4DV4L 1O7YA 1YNXA 1GUGA 4H7BA 3VR2A 2P5ZX 2EJGC 3BYYB 4MTNA 1WJJA 3S1MH 1DOMA 1SN8A 1EY0A 2M2LA 5GAHC 4LK1C 5C4JB 4KN4C 3VR6A 4LAAA 3SK8A 3TQYA 2EYLA 2DUDA 2DNEA 2WAQG 4HEDA 5EPJA 1WD0A 1RIPA 4GNXC 2QEXA 1Q12A 2NB0A 2WV6D 3DHQA 4DUYQ 3PMFA 1Q82C 1ENFA 1ZKOA 4FYDA 3S16H 4IUNA 3X3NA 1B3AA 3BDCA 3AB9A 3D3RA 3ERQA 4N9PA 3VA7A 1RTNA 1L1OC 2EE1A 1SE2A 5A2QE 1SYCA 2R7ZB 5HURA 3H94A 4A3MG 4NP5A 1G6PA 1LLRD 2E2DC 3J80i 2OQ0A 2MQHA 5EBDA 1JICA 1PMRA 2VZAA 3JAML 4OO1H 1PH8A 1G2SA 3CAMA 3T1HL 3R93A 3U4VA 4K0KQ 4PQXA 3IRBA 3KK7A 3CRKC 1TS3A 4C1NI 3CU7A 4ALPA 1UE5A 3J7A5 1I6HH 2UXBL 3ULLA 1VS0A 1TWAH 2Q2IA 4P75A 3NWSA 5GAEC 2LXKA 1J8IA 1L0WA 1EWHA 2MHVA 3NK9A 4CJ0B 2HDLA 1WTQA 1IXRA 4AIMA 4POGA 4CHTB 4BBRG 2YV5A 4A3CG 5JAVA 1YHAA 4BY7B 1FVIA 1AFPA 5IGDA 1BCPB 1XX8A 2WAQE 2BA1A 1BNZA 4A76A 3DEPA 2K5NA 4X62Q 4DV7Q 2B63B 4UPAA 2B29A 1GUTA 1A62A 1ENAA 1LV9A 1MI2A 3J7ZC 1DYQA 4DUZQ 1KQSA 1EOTA 2R92G 2NVQH 4KLKA 4HIMA 4P73A 4GZYC 2B2YA 4GOPB 4A3MH 5EQ0A 3GP7A 3U9SA 1AN8A 1UWVA 4NMZA 2ZXPA 1M1KC 1DOKA 2E2JH 1B9MA 1KL9A 1VQBA 2A69C 4HJ7A 1KAAA 2E75C 4QUFA 5C3XA 3QO2A 3S1QB 1HR0W 1BOSA 1PTOC 1A8VA 3I4MB 1SDFA 3PCOB 2UUAL 4M1UB 4DV5Q 1KRSA 3K7AB 3A74A 1Y1WB 4KD4A 3RZDB 2F1MA 2SDFA 1R4QB 2GVBA 1YHQA 2EPBA 5LL6S 4BBRH 4A3CH 1N36Q 3KBXA 3FPPA 2VB3X 3GDEA 4LF9Q 1SNOA 3HFZB 1HR0Q 3Q8DA 3DUZA 3W3AA 1SMYC 1HQRD 1S5ED 4JK1C 4A3IH 1DM0B 4K5XA 4MZ9A 4RGTA 1K8AC 4B3TL 1EWIA 2B3GA 3Q0AA 3PUZA 3QIAA 1BBXC 3CRLC 5GADC 3F8TA 3EQLC 2B2UC 3UI2A 3PUXA 4ID6A 1H9SA 3D6CA 3I90A 1EEID 2MO1A 3CMAA 3H3VH 1XNRQ 2KJXA 3M7NA 3STBC 2CCZA 1QOHA 4JI0L 2A6ED 4O0AA 1PH4A 1X54A 3GTQB 3L9AX 3BS1A 4CJ1B 1A6XA 2OT2A 2YTYA 1KABA 4JC0A 3S1RH 1IBKQ 5M3MG 1CHPD 1XTDA 4OGQC 3T1YL 1IL8A 5FJ8G 3HOUG 3K57A 4NXMQ 4DR5Q 1LABA 3K59A 3WOEA 5FLXL 4N8X1 1J5EL 2GN5A 1ONLA 1K83B 1XPOA 4OL7A 1HTPA 4G4KA
chains in the Genus database with same CATH topology
1EY8A 5IT9L 1PYWD 1CK1A 1DD2A 3VR3A 1E2ZA 3P75A 3VA5A 1LT5D 5CV8A 1RDPD 1RF2D 4DGZA 5IGCA 4FF3A 1CM9A 4KMUC 3EJIA 4U68A 4G7OC 4ZKCB 1D6EC 3T13A 4NDXA 3GTJB 3HZXA 1VF5C 1Q1EA 2CW0C 4J8QA 5JOBA 4XTCS 2IL8A 2BCOA 1PRTB 4G57A 1I4QA 3TP7A 3JAME 2C9OA 2L9HA 4HN7A 3S15B 2B2TA 1AZPA 3TZDA 5CBEE 1F9PA 5KGUA 2PZWA 1PTOH 4RFBA 3MXPA 1FNVA 5EPKA 3LWEA 2EYJA 5JVH3 1ZYRD 3NUCA 1TIID 4ABNA 2E74C 1HRJA 4L63B 2K01A 1F2LA 3EVQA 1WTWA 3C1EA 4ILWA 4WJWA 5KEEA 4V190 1G2TA 1QB5D 3W2DA 4A3FB 1EY4A 5I2XA 1YNND 3PIP3 5G3LD 1D5ZC 5KIXA 4XXEA 4DXFA 3KLRA 3J7YW 4FXGC 1H9SB 2RBMA 1B9NA 1O80A 1W6JA 3IFTA 1EZ8A 5I9OA 2RDHA 1HCZA 2EYMA 1KDAA 1SJHD 1PZKD 3G7LA 5EJWA 1TWCB 1STBA 5JPNC 1EYCA 1ENCA 2E2IB 2TSSA 1E2WA 1EYDA 2NTTA 1OXXK 2L11A 2AQ3B 5I6YA 2F0NA 2Q8IB 3HOZB 1EY5A 4QCLA 4KJNA 2EYOA 3K5MA 2KOLA 2PCFB 3I73A 1I4PA 3GTGB 3BVZA 2B2WA 1I3QB 5DAUA 3IAYA 3P7JA 2FMMA 1Q8IA 3MXGA 2XIWA 5IGEA 4PMCA 5I2YA 5M5WB 1K8OA 3K5LA 4XYQA 2O5IC 2ZXRA 4E6IA 3HKZB 1FD7D 3BZDB 5T1IA 1HA6A 4V0BA 4KY6A 2QCPX 3K6OA 1PLFA 3T4AC 1VMCA 1C8CA 4C3JB 2B2VA 1F9SA 2DY7A 1KDBA 4DNRB 4U673 3DXJC 4IFDI 3MVVA 1SXTA 5IT9E 1U4RA 4DA2A 4YIJA 3OHXC 2XWJB 2A69D 1JWMD 1SSOA 4XT3B 5C4HA 2R93B 5M9OA 1PFMA 4QIWB 4OIKA 4IFDH 4FXDA 1HQMC 2NWGA 1PZID 2EYFA 2LFNA 4XQQA 1QNKA 1NR4A 3J80E 3P1HA 2M00A 1MSHA 1STYA 2Z4IA 1IW7C 3MAQA 4F8MA 1SNPA 5EKIA 1JOQA 1A2UA 4F88A 1KLGD 1NSNS 2EXZA 3GD7A 4A3BB 2WKDA 4J6HA 2FHTA 3QG1A 4AYBB 3N6RA 3R8BA 3WDNA 2FFKB 3A8JE 1FNWA 5JVG3 4DFAA 4PNYA 3P20A 1SNDA 5F2DA 1B53A 2M9VA 1BXTA 3OOCA 2AUKA 5J1ZA 2K5DA 4FVMA 4XIGS 1WTXA 3D31A 4ZLTF 2KCNA 3GO5A 2K6AA 4RHRA 1TS4A 1HA5A 2CQAA 2AUJD 2WB1B 2NN6G 5LL6X 3MFGA 5I9PA 2LMCB 4O42A 2IW3A 1UUPA 4Y7NB 1EIHA 4EGVA 1BO0A 2HCCA 1DJRD 3SXHA 5IOCA 1SJED 3E5SA 2IX1A 2RDFA 1YNJC 2LY7A 1FYCA 5D3DA 1TT2A 2NZ1D 5C4XB 1G6ZA 1V1PA 2Q8RE 1NAPA 4CKEA 3NQIA 1LO5D 2F0TA 1PRTC 3TN2A 2CW0D 4MHEA 4C3HB 4TSSA 2MPMA 4C3IB 1RD9D 4Q0FA 5J22A 2AQ1B 5E3FA 2F0PA 2L1BA 3PV0A 4XQJA 1A3TA 1A3UA 1C4QA 1DCZA 4RAUC 3DWPA 2F03A 3AU7A 4HAEA 1STNA 1PXUA 3NSWA 5CMDA 3FRPB 4K6LA 1SYGA 5KRUA 1LACA 1B4OA 2ICIA 5C5MA 1I6VC 4DAPA 4PV1C 4IFDJ 4DN4M 1Z7TA 2CHBD 4B9WA 1BR9A 4KV6A 1QNUA 1QILA 4WORA 2JYOA 4TKOB 5DEHA 3FEWX 1V1OA 2VB2X 3O13A 3BVMA 1Y69U 4OIJA 3J81E 4ME5A 2G9DA 3GTKB 5I4DA 3H91A 2PPBC 3L7ZC 4ZAIA 3SE0A 1Y8NB 5KNDA 1S5FD 2EY6A 1TWHB 1SAPA 3GQBA 1H9JA 1DZ1A 3SVMA 1BDOA 1CI3M 1EWCA 1S5DD 2HCIA 5CORA 3A7LA 2MGSA 4TQUS 3PUYA 4M8AA 2PW7A 3K0YA 4ZQ3A 1CQVA 3T53B 2RA4A 4H13C 1TY0A 2A74C 4QMGA 1EIGA 1L0YB 2BOSA 4X3KA 1I50B 2D2CC 4HMJA 5ELFA 3HEJA 5C3EB 2SNSA 3V05A 1RTOA 3MZ5A 3I72A 1V1PB 5BN4A 1WTRA 3VYRA 4RA8A 2OEOA 3PO3B 3T51B 4KKSA 5D3IB 1SYEA 4ZUJA 2KHSA 2K03A 3NBHA 2EZVA 2PO4A 4X3UA 3GV6A 4A93B 1H9MA 4EQPA 1V43A 1AW7A 3DEOA 1BUVT 2D5DA 1GUOA 1QCBD 1SYBA 4CKBA 5D65A 3S1MB 3D4RA 2X6GA 5CV6A 3VYTA 2IWHA 1EFID 3LWUA 3K58A 3RMHA 2LKVA 4HSVA 1UEAB 4RHSA 5D14A 1ET6A 2Z8LA 5E4XA 4A3GB 4HR7B 3HRZC 1IW7D 4QF4A 3VR5A 2PW5A 4HTHA 2AWOA 3S16B 2FJ2A 4KTAA 1HFNA 2IPKD 2RDGA 2EJFC 3TZUA 3X3MA 2C5CA 1GUWA 5CC4A 1G91A 1CTMA 1E0BA 5ELDA 1QE6A 3A8KE 3Q6SA 2KA7A 4ULLA 2A5HA 2BDNA 1TWAB 3H09A 4DAVA 1JORA 1S5BD 2PQEA 2J0TD 2NUCA 1W6KA 2WAQB 3PUVA 4DU9A 1MSGA 1EY7A 4QB4A 2V4DA 3J80L 2IT1A 2A68C 3QJYA 1ESFA 2F3WA 5DM73 1XWEA 1B44D 4X3SA 3DMUA 1IYVA 2HUGA 1CFMA 3Q24A 3M7GA 4A3MB 3HGBA 1YNJD 3MXNA 2XWBB 3NTIA 2E2JB 2J4XA 4HCEA 3RD4A 2K28A 2MJ8A 4UAIA 5ELCA 1RKNA 1D5XC 2B39A 2XSCA 1QJOA 3MEHA 4BBRB 1F2YA 3J7AV 1F9RA 1EU4A 2AWNA 5KYLA 2L0CA 2K5WA 2B2UA 3CKIB 2KECA 1UNSA 1HUMA 4FF1A 2BE5C 3NP8A 4H0LC 2EY2A 4LMQD 1AP0A 2R92B 4XQNA 1OO9B 1RCVD 1WTVA 5EKKA 3D4DA 4K14A 2SNMA 1HHVA 5M5YB 1O7LA 1JCKB 2ZT9C 2ID0A 3S1RB 3NWTA 4RKLA 5CR3A 2ZXOA 3QWNA 1LTSD 4EVOA 4NKLA 1LTBD 1OXSC 4X3TA 1KNAA 3OWEB 1FNUA 3MA2B 3QOJA 5E1FA 5C0XI 2EOTA 4IUPA 3S17B 1GHKA 1U9RA 1GXDC 4IALA 1X32A 2JEAI 4EQOA 4IFDG 4EQNA 1JE4A 5TSSA 1BCPC 1SEBD 1GUSA 2KUMA 3E6ZX 2X6LA 1A3VA 5FO9B 3KBGA 1ZXTA 5M3MB 3K5OA 2E76C 1D2BA 3VR4A 1ET9A 2NYZD 2QEJC 4WRDA 3HOUB 3BDLA 3S1NB 1CA5A 2EYHA 1SYDA 1QG7A 5FK9C 4IUTA 3C2PA 3FMCA 3J81L 2L4NA 2WP8J 3N52A 2F0EA 4S3SA 1T5EA 5JEAG 3HS0C 3A56A 2B8GA 3S14B 1B2TA 1C48A 2FMCA 5M5XB 2R61A 1A2TA 3R2IA 1HXYD 2L5TA 3KUPA 1PTOD 2R6GA 2D62A 1ML0D 2WKCA 1TQOA 5C3WA 5C4ZA 3NBIA 3URYA 3ND8A 2RQXA 4C1NK 2SOBA 3NQTA 5C6AA 2EY5A 5FKAC 5EKLA 2F0GA 2XVSA 2DN8A 2EYPA 3MFYA 2F0QA 4IUQA 4CJ2C 3EROA 1SMYD 3EA6A 3ND9A 2F4IA 4DK1A 1HFGA 3IL8A 3CHBD 1ILQA 1STGA 2NVYB 1NCVA 1CQFA 4WFN3 4HMIA 3M3YB 3TDQA 5JEAH 2J7ZA 2O5JC 1LTAD 1PFBA 1LTRD 2RSNA 2JA8B 1D1KA 5BN5A 2NVTB 5DM63 4O1NA 1STHA 3SK4A 3OPOA 3TP6A 2DY8A 3KLSX 3RUZA 3G6JB 1HUNA 3PO2B 4RGMA 2NVXB 3EFXD 2JA5B 2F0UA 2KCCA 4JBWA 1O7ZA 2QKIC 4RGNA 4L8JA 2CVRA 4RWSC 3PUWA 3I4NB 1Y8PB 1Z6HA 4FP5D 2YU9B 4UDUC 2JA6B 1GOZA 1SE3A 1TU2B 2K04A 1EYAA 2L12A 4FNFA 5K36G 3TBIB 1Q90A 1Y8OB 4XYOA 2KQ3A 3L3OC 2Z1CA 2K32A 5LHY1 3NE5B 2F0HA 3M85A 3GTPB 1Y1VB 2B2YC 1LT3D 3SHLA 4CBVA 1U4MA 2EY1A 1O78A 4R8NA 3M4OB 4CGYB 3TSSA 1IYUA 4BS9A 4BA2I 5IODA 3GTLB 2K5QA 1KTKA 4KI0A 4RGOS 1U4LA 2JEBI 3E0JA 2L55A 3SDZA 1Z47A 4KN7C 4QUCA 1YNNC 1ILPA 2BA0A 4K6DA 4LJZC 3V2TA 4XDXA 3CQZB 1DOLA 4HSPA 5K36H 3IKJA 1H9KA 5A35A 1AEXA 4IURA 2QDBA 4KHVA 1UAPA 3S2HB 2BE5D 3H3VC 3MC0B 4R9WA 5KNBA 4OO1I 1LTID 3WOFA 4KHZA 3HOVB 4BBSB 5G3LF 1TS2A 1F2ZA 1EY6A 2SEBD 3OIPA 3Q23A 5JEAJ 1FGBD 3DM1A 3S9WA 4DNTB 1GHJA 2EJMA 1VMPA 5JPMC 3V96A 3FPUB 5IGFA 2F0DA 2EVBA 3HG9A 5AFWA 1IKMA 2E2HB 1RODA 1BQQT 5COYA 1SFOB 2F0VA 4PMBA 2R3ZA 1SNCA 4BWGB 5KYIA 1M8AA 2F0OA 1EZ6A 2IX0A 3TP5A 2OF1A 2VUMB 1LT4D 3HOYB 1PDQA 2TMPA 1B50A 4J1MA 1RJTA 1BCPD 3RZOB 5M3FB 3ITPA 4NW2A 4K2LA 1DXMA 4A3JB 2RSOA 3SEBA 1XTCD 5C44B 1D1IA 4K2KA 3D6WA 4DXGA 2A6HC 2JSOA 2B2TC 5CV9A 2KVMA 1TVXA 2JXMB 1I4HA 1D5MC 2XRSD 2WINB 5CBAE 1QWYA 3NHHA 2PZUA 1F77A 1ZEQX 2H1EA 5IIFA 3BYTB 4DAYA 3BVGA 1MD2D 5K5PA 1BF4A 1PTOF 4A3DB 4ZUIA 2K33A 3J7AF 4ODGA 2YYZA 2ENBA 1J9OA 4IQZA 1JOOA 2IJ0A 2XRQD 3MHBA 2BDOA 1EU3A 2VNUD 2AQ2B 1EY9A 2F0JA 1KDCA 1PZJD 4I65A 3OSOA 4C3JG 2A73B 4A3KB 2PYKA 3A54A 2RKSA 1DONA 1PFNA 2F0LA 4KY7A 2N88A 1I6HB 2JE6I 3I91A 2NBFA 3RLFA 3U9OA 4CKCA 3M4YA 4KKUA 4DK0A 1WVLA 1M4VA 1VF7A 1NUCA 1II3A 2B2WC 2EDGA 2QILA 2G9HD 3F2UA 1TKWB 2XNAC 1JWSD 3I3CA 2NTSA 3I4LA 1E2VA 3QB3A 1R4PB 2NVQB 1MGSA 4L6TB 1ESRA 1ICWA 2WACA 2PNRC 4C56C 1OXTA 4KK7A 3HOWB 3ZYYX 2Z4HA 4RKBA 1F2MA 2N55A 2PMZB 2B2VC 3OMGA 5EBCA 5IGBA 1TY2A 4XT1B 4IUVA 1IHZA 3GTMB 1PRTD 2F0MA 1KLUD 1SBBB 5DNFA 2WIIB 5ISRA 2IX3A 5CV4A 1T5XD 3H6MA 4IUUA 4KD3A 2B8FA 3T56B 4A3IB 4FXKC 1SYFA 1JWUD 1TS5A 1FR3A 3MTSA 4F87A 1Q3LA 2F0FA 3D4WA 5ELEA 3A8IE 1I4GA 3SK6A 4DF7A 1KNEA 3HOXB 1JB3A 2DNCA 1VCIA 2O4XA 3DWAA 1U4PA 1TWFB 1LT6D 4K5WA 4RCOA 5C0XG 5NUCA 5J39A 5C5LA 1XYIA 3Q22A 4N9TA 3NTKA 2K7VA 2F3VA 1L0XB 3LX0A 5EPLA 4RCNA 1CHQD 3I70A 2H4OA 3FVQA 2RVLA 3PIO3 1CT1D 1JC7A 4C3HG 4IZ8A 4C3IG 4ZRZA 5ELBA 4B9XA 1I4RA 4ZKBB 5CGKA 2X69A 2PZTA 5BN3A 3A55A 1F9QA 5C0XH 3KF8A 1TWGB 2F0KA 1AZQA 5CV5A 3MXUA 3GV3A 5E4WC 5CYUA 1WTPA 3I8ZA 3FKIB 3AMUA 1G291 3R2TA 5KNCA 4P2CB 4BY1B 1LTGD 4KJOA 2I46A 2K1BA 5FLXE 1WCMB 2XN9C 2F0SA 2KEDA 1OXVA 1PTOB 3IFDA 1BCPF 4RH6A 1XXGA 1K8MA 4ZYSA 5A2QL 4Q5VA 4K8JA 3LNNA 4MN3A 2A6HD 4R8IA 1X3PA 1GJXA 5T1GA 3OWFA 1EEFD 1H9RA 1WTOA 1LTTD 3NXWA 2MUYA 2JA7B 2HDMA 2A6EC 3R3OA 3TMEA 2ICEC 4PMWA 3C3LA 2KEEA 4I7ZC 1RHPA 2FINB 4G7HC 4MIUA 1OXUA 2F0IA 5FO7B 1B1ZA 3VYUA 3VYSA 4TRDA 2HQEA 1SNMA 1GUNA 1JR0D 2GA4B 1V8QA 3FDTA 3K5NA 5CV7A 1SE4A 1VDZA 4HCSA 2Y0SB 4KKTA 4FF2A 1S4ZA 4IN3A 1A15A 1NR2A 1R9TB 2F0WA 2MP1A 1EL0A 3BDOA 2I07B 5JJZA 1EQVA 1HTLD 4BA1I 4G7ZC 3OIQA 2Q8TA 3D8GA 4K8IA 4C2MB 3TP8A 1G8ZD 1IKLA 2OXPA 3GTOB 1S5CD 3SR1A 3BG3A 2JP1A 3MWYW 3ONAB 1CZGA 3KLSA 3C46A 1SNQA 2K05A 4ZK9B 3A7AB 1JOKA 5FOBB 3S2DB 2O2LD 1WD1A 1JQYD 4H44C 2A68D 1CA6A 5C0XJ 2LS01 1I4XA 1EQTA 3OMCA 4OHJA 3H0GB 2QF7A 3QOLA 2VXWA 2NN6I 4KY5A 1Q1BA 5HGTA 4FF4A 3OW7A 1STEA 1HPCA 4A3EB 4B08A 3HP3A 5EGTA 1ZYRC 3SK5A 5I6WA 4F7XA 3DWQA 5FO8B 3C1FA 1STAA 3NPPA 1TR5A 4Z9CB 2NN6H 1X3QA 3T16A 2D9UA 4OO1G 5IGGA 3NTHA 4FO2A 4K5VA 1CZWA 1MBYA 1PRTF 1O7YA 1GUGA 4H7BA 3VR2A 2EJGC 3BYYB 1DOMA 1EY0A 2M2LA 4LK1C 5C4JB 4KN4C 3VR6A 4LAAA 3SK8A 2EYLA 2DNEA 4HEDA 5EPJA 1WD0A 1Q12A 2NB0A 2WV6D 3DHQA 3PMFA 1ENFA 1ZKOA 4FYDA 4IUNA 3X3NA 1B3AA 3BDCA 3AB9A 3D3RA 3ERQA 4N9PA 3VA7A 1RTNA 5A2QE 2EE1A 1SE2A 1SYCA 2R7ZB 5HURA 3H94A 4NP5A 1LLRD 2E2DC 5EBDA 1JICA 1PMRA 3JAML 4OO1H 1G2SA 3R93A 4PQXA 3KK7A 3CRKC 1TS3A 4C1NI 3CU7A 3NWSA 1J8IA 1EWHA 2MHVA 3NK9A 4CJ0B 2HDLA 1WTQA 4CHTB 5JAVA 4BY7B 1AFPA 5IGDA 1BCPB 1XX8A 2BA1A 1BNZA 3DEPA 2B63B 1GUTA 1MI2A 1ENAA 1LV9A 1DYQA 1EOTA 4GZYC 2B2YA 5EQ0A 3GP7A 3U9SA 1AN8A 4NMZA 2ZXPA 1DOKA 1B9MA 2A69C 1KAAA 2E75C 4QUFA 5C3XA 3QO2A 3S1QB 1BOSA 1PTOC 3I4MB 1SDFA 4M1UB 3K7AB 1Y1WB 4KD4A 3RZDB 2F1MA 2SDFA 1R4QB 2EPBA 5LL6S 3KBXA 3FPPA 2VB3X 1SNOA 3DUZA 3W3AA 1SMYC 1HQRD 1S5ED 4JK1C 1DM0B 4K5XA 4RGTA 3Q0AA 3PUZA 3QIAA 1BBXC 3CRLC 3EQLC 2B2UC 3UI2A 3PUXA 4ID6A 1H9SA 3D6CA 3I90A 1EEID 3M7NA 2KJXA 1QOHA 2A6ED 3GTQB 3L9AX 3BS1A 4CJ1B 1A6XA 2OT2A 1KABA 1CHPD 4OGQC 1IL8A 3K57A 1LABA 3K59A 3WOEA 5FLXL 1ONLA 1K83B 4OL7A 1HTPA 4G4KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F7X A;  3TP6 A;  2RDF A;  1EY8 A;  3QB3 A;  5KIX A;  1RKN A;  3C1F A;  1STA A;  1ENA A;  1AEX A;  1TR5 A;  2QDB A;  4KHV A;  4MIU A;  2F0I A;  3P75 A;  3VA5 A;  2RBM A;  4TRD A;  4IZ8 A;  3BDL A;  4WRD A;  5CV8 A;  2HQE A;  2EYH A;  1SNM A;  1SYD A;  3MEH A;  1TT2 A;  3RUZ A;  4QF4 A;  3NHH A;  3T16 A;  5C4H A;  5M9O A;  1F2Y A;  2PW5 A;  2PZU A;  2WAC A;  4B9X A;  4HTH A;  4DGZ A;  4K5V A;  5IGG A;  2LKV A;  5IGC A;  5KYL A;  4RKB A;  5IIF A;  1EZ8 A;  5CV7 A;  1F2Z A;  1F2M A;  5I9O A;  2F0U A;  5CGK A;  2EYF A;  2F0T A;  4KTA A;  1EY6 A;  4H7B A;  2PZT A;  4NMZ A;  4S3S A;  2F0E A;  2PW7 A;  3EJI A;  3OMG A;  5IGB A;  4ZQ3 A;  1KAA A;  2EYM A;  1KDA A;  5K5P A;  2F0W A;  3P1H A;  5C3X A;  1IHZ A;  1STB A;  2M00 A;  3NP8 A;  1STY A;  3S9W A;  5CV4 A;  4EVO A;  4QMG A;  1EYC A;  2EY2 A;  2F0M A;  1ENC A;  2F0K A;  1EQV A;  1EY0 A;  4ZUI A;  1EYD A;  5CV5 A;  4ODG A;  3T13 A;  5CC4 A;  2ENB A;  1A2T A;  4F8M A;  5J22 A;  4NDX A;  4LAA A;  3SK8 A;  1SNP A;  2F0N A;  5I6Y A;  2EYL A;  5EKK A;  5ISR A;  1A2U A;  3D4D A;  1EY5 A;  4K14 A;  5E3F A;  1JOQ A;  1EYA A;  4HMJ A;  2SNM A;  1NSN S;  1JOO A;  2F0P A;  2EXZ A;  3H6M A;  3HZX A;  4KD3 A;  4J6H A;  4KD4 A;  3D8G A;  4K8I A;  3HEJ A;  4KJN A;  1TQO A;  2EYO A;  3TP8 A;  5C3W A;  5C4Z A;  2OXP A;  5IGF A;  3DHQ A;  2F0D A;  1A3T A;  3PMF A;  3MHB A;  1A3U A;  1SYF A;  2SNS A;  5JOB A;  3SR1 A;  2SOB A;  3NQT A;  5C6A A;  2EY5 A;  1EY9 A;  1SNO A;  2KQ3 A;  5EKL A;  4RKL A;  2F0G A;  5CR3 A;  2EYP A;  5DAU A;  1JOR A;  2F0J A;  2F0H A;  2PQE A;  3MZ5 A;  4IUN A;  3BDC A;  4PNY A;  4DFA A;  1KDC A;  2F0V A;  2F0Q A;  1STN A;  4K5X A;  4KJO A;  4I65 A;  4NKL A;  4PMB A;  3ERQ A;  4N9P A;  4G57 A;  2NUC A;  1SNC A;  1SND A;  5F2D A;  3ERO A;  2F0F A;  3D4W A;  3OSO A;  3SHL A;  3TP7 A;  1SYC A;  1SYG A;  2F0O A;  2F0S A;  4PMC A;  5IGE A;  5KRU A;  1EZ6 A;  1SNQ A;  3E5S A;  2OF1 A;  3TP5 A;  4DU9 A;  5HUR A;  4NP5 A;  2EY1 A;  1EY7 A;  4QB4 A;  5J1Z A;  2PYK A;  5C5M A;  1JOK A;  3SK6 A;  4R8N A;  2OEO A;  4DF7 A;  5KGU A;  2RKS A;  3QOJ A;  4J1M A;  4ID6 A;  2PZW A;  2F3W A;  4E6I A;  3D6C A;  2O4X A;  4B9W A;  2F0L A;  3MXP A;  5E1F A;  4KY7 A;  4KV6 A;  1SYE A;  4K8J A;  1STG A;  4K5W A;  4ZUJ A;  2KHS A;  3DMU A;  4WOR A;  5DEH A;  4HMI A;  5IOD A;  3ITP A;  2EYJ A;  4KY6 A;  5NUC A;  3OMC A;  3NUC A;  3QOL A;  5J39 A;  3U9O A;  4K2L A;  1KAB A;  5C5L A;  4KY5 A;  1U9R A;  3OWF A;  1KDB A;  3EVQ A;  4N9T A;  4ME5 A;  4IAL A;  4EQP A;  3NK9 A;  2F3V A;  5HGT A;  5KYI A;  3C1E A;  1NUC A;  4EQO A;  1II3 A;  5I9P A;  3MVV A;  5KEE A;  3LX0 A;  3NXW A;  1SYB A;  4EQN A;  5JAV A;  4K6D A;  4K2K A;  3V2T A;  5IGD A;  5CV6 A;  1EY4 A;  5EGT A;  3R3O A;  1STH A;  3TME A;  3SK5 A;  5I6W A;  4YIJ A;  3SK4 A;  3SXH A;  4OL7 A;  5IOC A;  5CV9 A;  1A3V A;  2EY6 A; 
#chains in the Genus database with same CATH topology
 1EY8 A;  5IT9 L;  1PYW D;  1CK1 A;  1DD2 A;  3VR3 A;  1E2Z A;  2KCM A;  3P75 A;  3VA5 A;  1LT5 D;  5CV8 A;  1XNQ L;  1VQL A;  1RDP D;  1RF2 D;  4DGZ A;  5IGC A;  4FF3 A;  1GVP A;  3SGI A;  1CM9 A;  4LF7 Q;  3J81 i;  4KMU C;  4OXP A;  4IOC A;  3EJI A;  4U68 A;  1WFQ A;  4G7O C;  3K80 C;  4ZKC B;  2UXC Q;  3W1B A;  1D6E C;  4KHP L;  3HKZ E;  3T13 A;  1WI5 A;  4NDX A;  5M3M H;  3GTJ B;  1N32 L;  1NJI C;  4R4C A;  3J80 c;  3HZX A;  1VF5 C;  5FJ8 H;  1Q1E A;  4DK3 C;  2CW0 C;  4J8Q A;  1QVF A;  5JOB A;  1CKN A;  1L2F A;  4XTC S;  1UE6 A;  2IL8 A;  2BCO A;  3I2Z A;  3FKI H;  3K7U C;  1PRT B;  2VQF Q;  3DM3 A;  4DR6 L;  1PH9 A;  4G57 A;  4DR2 Q;  2AMC B;  4GLX A;  1I4Q A;  3TP7 A;  3JAM E;  2C9O A;  2L9H A;  1YIJ A;  4HN7 A;  1VQC A;  2B2T A;  3S14 H;  3S15 B;  1AZP A;  3TZD A;  2K52 A;  5CBE E;  1F9P A;  5KGU A;  5M5X H;  1NNX A;  2NZH A;  1PTO H;  1RL2 A;  2PZW A;  4RFB A;  1KXL A;  3MXP A;  1FNV A;  1EQR A;  1EQQ A;  1VQ9 A;  4DV6 Q;  5EPK A;  4L5S A;  3LWE A;  2CFM A;  2EYJ A;  5JVH 3;  1ZYR D;  3NUC A;  1TII D;  4ABN A;  2E74 C;  1HRJ A;  4LW1 A;  4L63 B;  2K01 A;  1F2L A;  3EVQ A;  1WTW A;  3C1E A;  4ILW A;  4WJW A;  4JI3 Q;  4DAY B;  5KEE A;  4LF5 Q;  4V19 0;  1G2T A;  1QB5 D;  2HIV A;  3W2D A;  3PO2 G;  4A3F B;  1EY4 A;  5I2X A;  4X64 L;  1YNN D;  2JA5 G;  1FJG L;  4HJA A;  3PIP 3;  1MJC A;  5G3L D;  1D5Z C;  5KIX A;  4XXE A;  2K5H A;  2NVY H;  4DXF A;  3KLR A;  4MNO A;  3J7Y W;  4DV2 Q;  2UUB Q;  4FXG C;  3I4N G;  2DGY A;  1H9S B;  1YVC A;  2RBM A;  1B9N A;  2L15 A;  2JA6 G;  1O80 A;  1W6J A;  4DPG A;  3IFT A;  2A19 A;  1EZ8 A;  5I9O A;  4DR7 Q;  2HHH Q;  1SRO A;  2RDH A;  1X56 A;  1HCZ A;  2EYM A;  3CW2 C;  1KDA A;  1SJH D;  1PZK D;  3G7L A;  5EJW A;  1TWC B;  2NVT H;  1STB A;  1HNW Q;  5JPN C;  4A3L G;  1EYC A;  4JBK A;  1ENC A;  2E2I B;  2TSS A;  1E2W A;  5E7N A;  1Y1V G;  1EYD A;  1R9T H;  1C9O A;  2NTT A;  2K50 A;  1OXX K;  2L11 A;  2AQ3 B;  5I6Y A;  2F0N A;  2Q8I B;  3HOZ B;  1EY5 A;  1S3O A;  3CCU A;  4QCL A;  4KJN A;  3I4O A;  3TEH B;  2EYO A;  4IPH A;  3K5M A;  2N3S A;  2KOL A;  2PCF B;  2WB1 E;  3I73 A;  4GLA C;  4JYA L;  1I4P A;  3GTG B;  3BVZ A;  3PO2 H;  2B2W A;  1I3Q B;  5DAU A;  2NVX H;  3TRE A;  2JA5 H;  2YTV A;  3IAY A;  3P7J A;  2FMM A;  2V1C C;  1Q8I A;  3MXG A;  2XIW A;  4DK6 C;  5IGE A;  4PMC A;  5I2Y A;  1K8G A;  5M5W B;  1K8O A;  4IJL A;  3K5L A;  4XYQ A;  2O5I C;  4L5R C;  2ZXR A;  1T9H A;  2Q2H A;  4E6I A;  2JA6 H;  4QGU A;  1E22 A;  3HKZ B;  1FD7 D;  3BZD B;  5T1I A;  2ATW A;  1HA6 A;  4V0B A;  3W5O A;  4HJ5 A;  4KY6 A;  2QCP X;  3K6O A;  1PLF A;  3T4A C;  3G4S A;  1VMC A;  1C8C A;  4JOI C;  4C3J B;  1VQ5 A;  1C0A A;  2B2V A;  1E1O A;  4LF8 Q;  2HIX A;  3J81 j;  1F9S A;  2DY7 A;  4JVZ A;  3CPW A;  1KDB A;  3H0G H;  4DNR B;  4U67 3;  3DXJ C;  3GTP H;  4GOP C;  1Y1V H;  4IFD I;  4B3R L;  2RHS B;  1CKN B;  3MVV A;  1SXT A;  2Z6K A;  5IWA Q;  2HT1 A;  5IT9 E;  3HOV G;  2PQA A;  4P72 A;  1U4R A;  4BBS G;  2HQL A;  5FLM G;  3J81 c;  4DA2 A;  3CCL A;  4YIJ A;  3OHX C;  4IOA A;  3M4O H;  2G5D A;  2XWJ B;  2A69 D;  1HH2 P;  1JWM D;  1SSO A;  4XT3 B;  3GTL H;  5C4H A;  2R93 B;  1CKM A;  5M9O A;  1PFM A;  4QIW B;  1KC8 C;  4GN4 B;  4OIK A;  4IFD H;  4FXD A;  1HQM C;  1E24 A;  2NWG A;  1PZI D;  2EYF A;  2LFN A;  4XQQ A;  1QNK A;  2EXD A;  1NR4 A;  3J80 E;  3P1H A;  2M00 A;  1JJ2 A;  1MSH A;  4LFA L;  1STY A;  2Z4I A;  1IW7 C;  3MAQ A;  4F8M A;  1SNP A;  5EKI A;  1JOQ A;  1A2U A;  4F88 A;  1KLG D;  5C4J H;  2VUM G;  1NSN S;  2EXZ A;  3GD7 A;  3S2H H;  2WKD A;  4J6H A;  1MJE A;  3HOY G;  2FHT A;  4A3B B;  3QG1 A;  4AYB B;  1PH2 A;  3N6R A;  3HOV H;  3JC6 6;  3R8B A;  3WDN A;  2FFK B;  1SMX A;  2VS1 A;  3A8J E;  4BBS H;  1FNW A;  4AH6 A;  5JVG 3;  4DFA A;  2YTX A;  4PNY A;  4PZ6 A;  3P20 A;  5M3F G;  5H1S E;  1SND A;  5F2D A;  1N33 Q;  1B53 A;  2M9V A;  5IYB G;  1BXT A;  4UHV A;  3OOC A;  2AUK A;  5J1Z A;  4A3J G;  2K5D A;  4FVM A;  4XIG S;  4GKK Q;  1WTX A;  1N34 L;  5C44 G;  1CSQ A;  3D31 A;  3W1G A;  1W3S A;  4ZLT F;  2KCN A;  3GO5 A;  2K6A A;  3CF5 A;  4RHR A;  3KFU A;  1TS4 A;  3ULP A;  2DJG C;  2E5L L;  1HA5 A;  2CQA A;  2AUJ D;  3CC7 A;  2WB1 B;  2NN6 G;  3BJU A;  5LL6 X;  2I5H A;  1J5E Q;  1QUQ A;  1X3E A;  1SFO H;  3A5Z B;  3MFG A;  5IY0 A;  5I9P A;  3B6Y A;  2LMC B;  4IJH A;  4O42 A;  3NEM A;  1Y1W G;  2IW3 A;  3NEL A;  1UUP A;  4Y7N B;  2VUM H;  1EIH A;  4EGV A;  1BO0 A;  3RN2 A;  3HOY H;  2HCC A;  2HD3 A;  1DJR D;  3SXH A;  1XNQ Q;  5IOC A;  1SJE D;  3E5S A;  2IX1 A;  2RDF A;  1YNJ C;  1G51 A;  2JK8 A;  1MKH A;  3RZO H;  1NE3 A;  2RCF A;  4A3D G;  2LY7 A;  5M3F H;  1FYC A;  1VQM A;  5D3D A;  1TT2 A;  2NZ1 D;  5C4X B;  1G6Z A;  5IYB H;  1V1P A;  4EQ5 A;  2Q8R E;  1NAP A;  2VW9 A;  4B3M L;  4CKE A;  3CCQ A;  3NQI A;  5J3B A;  4A3J H;  1HNZ Q;  3E9H A;  1LO5 D;  1VQH A;  2F0T A;  1XMQ L;  5GAG C;  1PRT C;  4JG2 A;  5C44 H;  3TN2 A;  2CW0 D;  4NXN L;  4MHE A;  4LF4 L;  4IPC A;  4UP9 A;  4C3H B;  4TSS A;  2MPM A;  4C3I B;  4PG3 A;  1RD9 D;  2KHJ A;  1X9N A;  4Q0F A;  5J22 A;  3S1Q H;  2AQ1 B;  5E3F A;  4X65 Q;  3E0E A;  2F0P A;  4A3K G;  1VQ4 A;  2RCN A;  2L1B A;  3PV0 A;  1BVS A;  4XQJ A;  1K0R A;  4DR6 Q;  4JI4 L;  5JJK A;  1A3T A;  1A3U A;  1C4Q A;  3A0J A;  1Y1W H;  1DCZ A;  4RAU C;  3CXC A;  1BBU A;  3DWP A;  2F03 A;  3AU7 A;  4HAE A;  1STN A;  1PXU A;  3L2P A;  3NSW A;  5CMD A;  2ZTD A;  3FRP B;  4JPB W;  4JI5 Q;  4K6L A;  1SYG A;  5KRU A;  1LAC A;  1IBM L;  3KJO A;  1B4O A;  4EX5 A;  2ICI A;  4A3D H;  5C5M A;  1I6V C;  4DAP A;  2UU9 L;  4PV1 C;  4IFD J;  4LFC Q;  4DN4 M;  1Z7T A;  2CHB D;  3F2B A;  4B9W A;  5HY6 A;  4A4I A;  1BR9 A;  4KV6 A;  1QNU A;  1QIL A;  2VY3 A;  4WOR A;  2JYO A;  4TKO B;  5DEH A;  3FEW X;  3RLO A;  1V1O A;  2VB2 X;  3O13 A;  3BVM A;  1Y69 U;  4OIJ A;  2AKW B;  3J81 E;  3GTQ H;  3M4Q A;  4ME5 A;  2G9D A;  3GTK B;  5HGQ A;  4AQY L;  1FJG Q;  1QVG A;  5I4D A;  3H91 A;  3H15 A;  2PPB C;  3HOW G;  3L7Z C;  4ZAI A;  4A3K H;  3SE0 A;  1Y8N B;  5KND A;  1S5F D;  2EY6 A;  3G48 A;  2ES2 A;  1TWH B;  2I5M X;  1SAP A;  3GQB A;  1H9J A;  1DZ1 A;  3SVM A;  1BDO A;  1CI3 M;  1EWC A;  1PV4 A;  1S5D D;  2HCI A;  2K14 A;  5COR A;  3A7L A;  2MGS A;  2Z6B A;  4B3S Q;  4L5T A;  4TQU S;  3PUY A;  4M8A A;  2PW7 A;  3K0Y A;  4ZQ3 A;  1CQV A;  3T53 B;  2IHF A;  2RA4 A;  4A3I G;  4H13 C;  1TY0 A;  4X66 Q;  1QUQ B;  3S24 A;  2A74 C;  4QMG A;  5IYC G;  2ZM6 L;  1MHW C;  1EIG A;  1L0Y B;  2BOS A;  2CWA A;  4X3K A;  3KDF A;  4JYA Q;  4DNI A;  3TS2 A;  1I50 B;  2D2C C;  3KJP A;  4HMJ A;  3OTO Q;  5ELF A;  4YHH Q;  3M4P A;  3HEJ A;  3HOX G;  5C3E B;  2SNS A;  4DV0 L;  3V05 A;  1RTO A;  4YY3 L;  3HOW H;  4R1J A;  1XMO Q;  3MZ5 A;  1WYD A;  1XJV A;  3KLW A;  1GD7 A;  1V1P B;  3I72 A;  2PMZ E;  5BN4 A;  2JA9 A;  3AFP A;  3RN5 A;  3GTM H;  1WTR A;  3VYR A;  4RA8 A;  1I94 L;  2OEO A;  4DV1 Q;  3PO3 B;  1YJW A;  5GRO A;  3T51 B;  4KKS A;  3S15 H;  5D3I B;  1SYE A;  4ZUJ A;  3ULJ A;  2KHS A;  2K03 A;  3NBH A;  1HZB A;  2EZV A;  2PO4 A;  4X3U A;  3GV6 A;  3U4Z A;  4I7A A;  1SR3 A;  4A93 B;  2UUC Q;  1H9M A;  2RF4 A;  5IYC H;  4EQP A;  1V43 A;  1AW7 A;  4JI7 Q;  3DEO A;  1BUV T;  2D5D A;  1GUO A;  1QCB D;  2F4V Q;  3HOZ G;  4OX9 L;  1SYB A;  4CKB A;  1EUJ A;  5D65 A;  3S1M B;  3D4R A;  2X6G A;  5CV6 A;  3VYT A;  1K28 A;  2IWH A;  1EFI D;  2Z0S A;  2BH2 A;  3ERS X;  2UXD Q;  4GKJ L;  3LWU A;  3HOX H;  4PZ8 A;  3K58 A;  4OEM B;  4GNX A;  3RMH A;  1YHB A;  2LKV A;  4ZCK A;  3KF6 A;  4HSV A;  1TWF H;  1UEA B;  4RHS A;  4HIK A;  5D14 A;  4JI8 L;  1NY4 A;  1ET6 A;  2Z8L A;  4JI2 L;  2IY5 B;  5E4X A;  1Q86 C;  4A3G B;  2DJF C;  1AE3 A;  4HR7 B;  3HRZ C;  1IW7 D;  4QF4 A;  1VQO A;  1NBW A;  4DR1 L;  3VR5 A;  2PW5 A;  4CDE C;  4HTH A;  2AWO A;  2N49 A;  3CCR A;  2R7F A;  1L1O A;  1JB7 A;  3S16 B;  2FJ2 A;  4KTA A;  1HFN A;  1VQP A;  3FKI G;  2VL6 A;  1JJG A;  5BR8 L;  4O2D A;  2IPK D;  2RDG A;  4YCU A;  1X3F A;  2EJF C;  4BY1 G;  3TZU A;  3X3M A;  2RHQ B;  2C5C A;  5IYD G;  1GUW A;  1TWC H;  5CC4 A;  1YJ9 A;  1WCM G;  1GM5 A;  1G91 A;  1CTM A;  1E0B A;  2E2I H;  4GS3 A;  5ELD A;  1HNX Q;  1QE6 A;  1VQE A;  3A8K E;  4HJ8 A;  4DR3 L;  1I5F A;  3Q6S A;  3HOZ H;  2KA7 A;  4ULL A;  2A5H A;  2BDN A;  1YIT A;  1TWA B;  3H09 A;  3MEF A;  4DAV A;  1JOR A;  1S5B D;  2PQE A;  1NTG A;  4JV5 L;  2J0T D;  2NUC A;  2OWO A;  1I3Q H;  3CC2 A;  1W6K A;  2WAQ B;  1X6O A;  3PUV A;  4DV3 Q;  4DU9 A;  1MSG A;  1EY7 A;  4GLV B;  4QB4 A;  2V4D A;  1TWG H;  3J80 L;  2IT1 A;  2A68 C;  3QJY A;  1ESF A;  2F3W A;  4LUV A;  5DM7 3;  1QZG A;  3HKS A;  1XWE A;  3TS0 A;  1B44 D;  2JA7 G;  2CWP A;  3QR8 A;  4X3S A;  3DMU A;  1IYV A;  3KDF B;  3RNU A;  2HUG A;  1CFM A;  1PYB A;  3Q24 A;  3M7G A;  4A3M B;  4LFB L;  3HGB A;  1YNJ D;  4BY1 H;  3MXN A;  2XWB B;  5IYD H;  4C3J H;  3CCE A;  3NTI A;  1NMG A;  5LMU L;  2E2J B;  3M9B A;  1VQ6 A;  1O7I A;  1WCM H;  2J4X A;  1P16 A;  4HCE A;  3RD4 A;  1UE1 A;  2K28 A;  2MJ8 A;  1K3B C;  4UAI A;  2Y0S G;  5ELC A;  4JI6 L;  1RKN A;  4B3M Q;  1D5X C;  2B39 A;  2XSC A;  3RLN A;  1XMQ Q;  1QJO A;  3MEH A;  4MTK A;  4BBR B;  1F2Y A;  3J7A V;  1F9R A;  1EU4 A;  2AWN A;  1JE5 A;  5KYL A;  3NBH B;  2Z9H A;  2L0C A;  2K5W A;  1LTL A;  2B2U A;  4JBM A;  4DAM A;  3CKI B;  2KEC A;  1UNS A;  1HUM A;  3CCV A;  2JA7 H;  4FF1 A;  2BE5 C;  1VQA A;  3UDX A;  3NP8 A;  2ZJR A;  3PF4 A;  4H0L C;  4DUY L;  2EY2 A;  4LMQ D;  1AP0 A;  2R92 B;  4XQN A;  1OO9 B;  3FHW A;  1RCV D;  4DV4 Q;  2XGT A;  1WTV A;  5EKK A;  3D4D A;  4K14 A;  3ICE A;  2SNM A;  1HHV A;  5M5Y B;  1O7L A;  1JCK B;  4GNX B;  4FDB A;  3KF6 B;  1WTH A;  2ZT9 C;  2ID0 A;  3BU2 A;  3S1R B;  3E3X A;  4RG1 A;  3NWT A;  4RKL A;  5CR3 A;  2ZXO A;  3QWN A;  2VQE L;  1LTS D;  4EVO A;  2UU9 Q;  4NKL A;  1LTB D;  1OXS C;  2JQO A;  2Y0S E;  4X3T A;  3H0G G;  1M90 C;  1L1O B;  1KNA A;  3OWE B;  1EIY B;  1FNU A;  3MA2 B;  3QOJ A;  4A3E G;  2CH4 A;  5E1F A;  1PA6 A;  1Q8K A;  5C0X I;  2EOT A;  4IUP A;  3S17 B;  1X65 A;  3CME A;  4C2M H;  3GTO H;  1HZ9 A;  1PFS A;  4JBJ A;  5IP9 G;  1GHK A;  1U9R A;  4X62 L;  4DV7 L;  1GXD C;  1HZA A;  4IAL A;  1X32 A;  3AEV A;  2JEA I;  4EQO A;  3T1H Q;  4CDF C;  4IFD G;  4OWT B;  4EQN A;  1JE4 A;  5TSS A;  4DUZ L;  1BCP C;  1SEB D;  1GUS A;  1IL2 A;  2KUM A;  2UXB Q;  3E6Z X;  2X6L A;  3S2D H;  1A3V A;  5FO9 B;  3KBG A;  1FL0 A;  1ZXT A;  2K75 A;  5M3M B;  3K5O A;  3I55 A;  2QW7 A;  3L0O A;  3PIO A;  1WOC A;  3K81 C;  2E76 C;  1D2B A;  3VR4 A;  1ET9 A;  2NYZ D;  2QEJ C;  4WRD A;  3HOU B;  3BDL A;  3S1N B;  1CA5 A;  2EYH A;  1SYD A;  3UE0 A;  1QG7 A;  5FK9 C;  4IUT A;  3C2P A;  3FMC A;  2PI2 A;  3J81 L;  1PH1 A;  2L4N A;  2WP8 J;  4A3E H;  4DV5 L;  3N52 A;  2F0E A;  2PI2 E;  4S3S A;  1T5E A;  1K73 C;  5JEA G;  3HS0 C;  3A56 A;  2B8G A;  3S14 B;  1TXY A;  3MXN B;  1B2T A;  4YCV A;  1ASZ A;  1C48 A;  2FMC A;  5IP9 H;  5M5X B;  2R61 A;  1A2T A;  3R2I A;  3BZK A;  1HXY D;  2L5T A;  3KOJ A;  3KUP A;  2R7Z G;  4C3I H;  1ICF B;  1KRT A;  1PTO D;  2F52 A;  1YBY A;  2R6G A;  2D62 A;  1ML0 D;  2WKC A;  1TQO A;  5C3W A;  5C4Z A;  3NBI A;  3URY A;  3ND8 A;  2D0O A;  1PYS B;  2RQX A;  4C1N K;  2SOB A;  3NQT A;  5C6A A;  4HID A;  2EY5 A;  5FKA C;  5EKL A;  2F0G A;  2XVS A;  2DN8 A;  2EYP A;  2UUA Q;  3MFY A;  2F0Q A;  4IUQ A;  1D8L A;  1XNR L;  4CJ2 C;  3ERO A;  1SMY D;  4TVA B;  3EA6 A;  3ND9 A;  1GO3 E;  4IPG A;  2F4I A;  4DK1 A;  1QVC A;  2ZJQ A;  1Q81 C;  1HFG A;  1IBK L;  3JAM i;  3IL8 A;  3CHB D;  4POF A;  4BY7 G;  2FXQ A;  4B3T Q;  1ILQ A;  1STG A;  2NVY B;  1NCV A;  4NXM L;  1CQF A;  4WFN 3;  1BKB A;  4HMI A;  3M3Y B;  3TDQ A;  3AQQ A;  5JEA H;  2B63 G;  3STB D;  2J7Z A;  4NPS A;  2O5J C;  1LTA D;  1PFB A;  1LTR D;  2RSN A;  2JA8 B;  4GKJ Q;  1D1K A;  5BN5 A;  4JI0 Q;  2R7Z H;  1Q46 A;  1U0L A;  2OQK A;  2NVT B;  5DM6 3;  4O1N A;  1STH A;  4JI8 Q;  1B7Y B;  3SK4 A;  3T1Y Q;  3OPO A;  3TP6 A;  4LF7 L;  2D0P A;  2PNH A;  2DY8 A;  3KLS X;  1K3R A;  3RUZ A;  3G6J B;  1HUN A;  3I4M G;  4UP8 A;  1CUK A;  1TWH H;  2UXC L;  5BR8 Q;  3PO2 B;  3CD6 A;  4RGM A;  2NVX B;  3EFX D;  3EIV A;  2JA5 B;  2F0U A;  2KCC A;  1IYJ B;  1S72 A;  4OWW B;  4JBW A;  1O7Z A;  4BY7 H;  2QKI C;  1VQ7 A;  4RGN A;  4L8J A;  2CVR A;  4RWS C;  1EOV A;  3PUW A;  1N8R C;  3I4N B;  1Y8P B;  1Z6H A;  4FP5 D;  2YU9 B;  4UDU C;  2B63 H;  2JA6 B;  3NEN A;  1GOZ A;  1SE3 A;  1TU2 B;  2K04 A;  1EYA A;  2L12 A;  4FNF A;  1K9M C;  1JT8 A;  3CCS A;  4JOI A;  4DKA C;  5K36 G;  4JV5 Q;  5IE8 A;  3TBI B;  1Q90 A;  1Y8O B;  4GOP A;  4QL5 A;  4XYO A;  4KHP Q;  2KQ3 A;  3L3O C;  2Z1C A;  2K32 A;  5LHY 1;  3NE5 B;  2F0H A;  1N32 Q;  3M85 A;  3GTP B;  1Y1V B;  2B2Y C;  1LT3 D;  3SHL A;  1HZC A;  4DV6 L;  4CBV A;  1U4M A;  2PQA B;  4A3G G;  2EY1 A;  4JCV E;  1O78 A;  4R8N A;  3M4O B;  3UDI A;  4CGY B;  3I4M H;  4LF6 L;  3TSS A;  4LNQ A;  1IYU A;  3K7A H;  3PSI A;  4BS9 A;  4LF5 L;  3RZD H;  4BA2 I;  3K8A A;  5IOD A;  3GTL B;  2K5Q A;  1KTK A;  5LMU Q;  3BZC A;  4KI0 A;  4RGO S;  1U4L A;  2JEB I;  3E0J A;  2L55 A;  3SDZ A;  1Z47 A;  4KN7 C;  4QUC A;  1KAW A;  1YNN C;  1ILP A;  2BA0 A;  2KHI A;  4DV2 L;  4K6D A;  4LJZ C;  3V2T A;  5IP7 G;  4XDX A;  3CQZ B;  1DOL A;  4HSP A;  5K36 H;  3IKJ A;  1H9K A;  5LMN L;  5A35 A;  2HHH L;  1LM0 A;  2MFI A;  4DR7 L;  1AEX A;  4IUR A;  2QDB A;  2QGQ A;  4KHV A;  1UAP A;  5DLQ E;  1IBL L;  3S2H B;  2BE5 D;  1SLJ A;  1EYG A;  4YWM A;  3H3V C;  3MC0 B;  2ZJP A;  4R9W A;  5KNB A;  4X64 Q;  4OO1 I;  1LTI D;  3WOF A;  1HNW L;  4KHZ A;  3HOV B;  4QQB X;  4A3G H;  4BBS B;  5G3L F;  1Q7Y C;  1TS2 A;  4WJ3 M;  1F2Z A;  1VQJ A;  1PH6 A;  2A8V A;  1EY6 A;  2SEB D;  3OIP A;  3Q23 A;  2ASB A;  5JEA J;  1FGB D;  3DM1 A;  3UDF A;  3S9W A;  5JJL A;  4J15 A;  2CQO A;  1K83 H;  1KD1 C;  4DNT B;  1GHJ A;  4APV A;  2EJM A;  1VMP A;  5JPM C;  2VQE Q;  3V96 A;  3FPU B;  4JI1 L;  5IGF A;  3JAM c;  2F0D A;  2EVB A;  3HG9 A;  5AFW A;  2Q2T A;  1IKM A;  2E2H B;  1ROD A;  1BQQ T;  5IP7 H;  2OCE A;  2IHE A;  5COY A;  1SFO B;  1YZ6 A;  2F0V A;  4PMB A;  2R3Z A;  1SNC A;  4BWG B;  5KYI A;  1M8A A;  2F0O A;  1H95 A;  1EZ6 A;  2IX0 A;  3TP5 A;  2OF1 A;  2VUM B;  1LT4 D;  3HOY B;  1PDQ A;  2TMP A;  1B50 A;  4J1M A;  1V9P A;  4LF8 L;  1RJT A;  3GTJ H;  4H02 A;  1J6Q A;  1BCP D;  1N9W A;  4A3F G;  3RZO B;  4YWK A;  3A5U A;  5M3F B;  1V1Q A;  5IWA L;  3ITP A;  4NW2 A;  4K2L A;  1KIX A;  1NMF A;  2C35 B;  3KYH C;  1CKO A;  1DXM A;  4A3J B;  2RSO A;  3SEB A;  1XTC D;  5C44 B;  1D1I A;  1B3Q A;  4K2K A;  1YEZ A;  3D6W A;  4DR4 L;  4DXG A;  4OWX B;  2A6H C;  2JSO A;  3E9I A;  2B2T C;  5CV9 A;  2KVM A;  1TVX A;  2JXM B;  1PHJ A;  4B3R Q;  1X3G A;  1I4H A;  1D5M C;  2XRS D;  2WIN B;  5CBA E;  1QWY A;  1LYL A;  3NHH A;  3H3V I;  2PZU A;  1F77 A;  2CKZ B;  4GN5 A;  1ZEQ X;  2H1E A;  5IIF A;  1QZH A;  3BYT B;  4DAY A;  3BVG A;  1MD2 D;  3TRZ A;  5K5P A;  1A63 A;  1BF4 A;  4A3F H;  1PTO F;  1VQK A;  4A3D B;  4ZUI A;  2K33 A;  3J7A F;  4ODG A;  2YYZ A;  2ENB A;  4R4O A;  1J9O A;  4IQZ A;  2R92 H;  1VQ8 A;  5EAY A;  1JOO A;  2IJ0 A;  1N33 L;  4X6A H;  2XRQ D;  5GQO A;  4LFA Q;  3MHB A;  2BDO A;  5M5Y H;  1EU3 A;  2VNU D;  2AQ2 B;  1EY9 A;  4ME3 A;  3HKZ G;  4GKK L;  2F0J A;  2KEN A;  1KDC A;  1KHI A;  1PZJ D;  4I65 A;  3OSO A;  4C3J G;  4WJ4 A;  2A73 B;  4A3K B;  2PYK A;  3A54 A;  2RKS A;  5FLX c;  2N8N A;  1DON A;  1IZ6 A;  1PFN A;  2F0L A;  1UE7 A;  4KY7 A;  1SRU A;  2N88 A;  1I6H B;  2JE6 I;  3I91 A;  2NBF A;  3RLF A;  3AYH B;  3U9O A;  2EQS A;  4CKC A;  5IT9 c;  3S17 H;  3GTG H;  3M4Y A;  4KKU A;  1N34 Q;  4DK0 A;  3PGZ A;  1WVL A;  2I5L X;  1M4V A;  1VF7 A;  1EFW A;  1LUZ A;  4IPD A;  1NUC A;  1II3 A;  2B2W C;  2EDG A;  2QIL A;  2G9H D;  3F2U A;  2R93 G;  1VQN A;  1TKW B;  1PH5 A;  2XNA C;  5M5W H;  4PZ7 A;  1UEB A;  2E5L Q;  1JWS D;  2ALY B;  3I3C A;  2NTS A;  1Z9F A;  2Q2U A;  1JJC B;  3I4L A;  1E2V A;  1HNZ L;  3QB3 A;  1R4P B;  3F1Z A;  2NVQ B;  1MGS A;  5AJ3 L;  4L6T B;  1ESR A;  4OEL B;  4UY8 C;  4YCW A;  1ICW A;  2WAC A;  2PNR C;  4C56 C;  1OXT A;  4KK7 A;  3CCJ A;  3HOW B;  2N78 A;  3ZYY X;  2Z4H A;  4RKB A;  3HOU H;  3S1N H;  1F2M A;  2N55 A;  4A3B G;  4YWL A;  2PMZ B;  4AYB G;  2B2V C;  3OMG A;  1VQG A;  5EBC A;  4X65 L;  5IGB A;  1TY2 A;  3G6E A;  2I0Q A;  4XT1 B;  4IUV A;  1IHZ A;  3GTM B;  1SE8 A;  5ELN A;  1PRT D;  2F0M A;  1KLU D;  2Z6K C;  1SBB B;  1PH3 A;  5DNF A;  2WII B;  5ISR A;  3F2D A;  4N8F A;  2IX3 A;  2JA8 G;  3H6M A;  1T5X D;  4IUU A;  5CV4 A;  4NB3 A;  4KD3 A;  4JI5 L;  2ZTC A;  2B8F A;  2H5X A;  3T56 B;  4NXN Q;  4LF4 Q;  4RMF A;  2R93 H;  2LSS A;  4A3I B;  4FXK C;  1SYF A;  4GN3 B;  4LFC L;  1JWU D;  4QIW E;  1TS5 A;  1FR3 A;  3MTS A;  4F87 A;  1Q3L A;  2F3I A;  2K5V A;  1A0I A;  2F0F A;  3D4W A;  4LF6 Q;  4LUZ A;  4HIO A;  4JI4 Q;  3UDG A;  2WB1 G;  4LUO A;  5ELE A;  3A8I E;  1I4G A;  3SK6 A;  4DF7 A;  1KNE A;  3HOX B;  1JB3 A;  2DNC A;  1VCI A;  2O4X A;  3DWA A;  4R4T A;  1PH7 A;  1U4P A;  1TWF B;  1LT6 D;  4K5W A;  4RCO A;  5LMN W;  5C0X G;  4A3B H;  1IBM Q;  5NUC A;  5J39 A;  3CC4 A;  4AYB E;  3I7F A;  5C5L A;  1XYI A;  3EN2 A;  3Q22 A;  3M3Y H;  4N9T A;  4K0K L;  3NTK A;  2K7V A;  2F3V A;  4P74 A;  1E3P A;  2R7D A;  1L0X B;  3LX0 A;  5EPL A;  4RCN A;  5C4X G;  2GVA A;  5LMN Q;  5JJI A;  1CHQ D;  3I70 A;  2JA8 H;  2H4O A;  3FVQ A;  3PF5 A;  1IBL Q;  2RVL A;  3PIO 3;  1P8L A;  5ELO A;  4Y52 H;  1PVO A;  4AQY Q;  1CT1 D;  5L37 A;  4B3S L;  4CDD C;  3PIP A;  1JC7 A;  4C3H G;  4IZ8 A;  4C3I G;  4ZRZ A;  5ELB A;  4X66 L;  1CSP A;  4B9X A;  1YJN A;  1I4R A;  4ZKB B;  1MIU A;  5CGK A;  2X69 A;  2PZT A;  5BN3 A;  3OTO L;  3A55 A;  4YHH L;  1E1T A;  3OYY A;  1F9Q A;  4Y7N H;  5C0X H;  1YI2 A;  3KF8 A;  1TWG B;  2F0K A;  4R4Q A;  1AE2 A;  1AZQ A;  5CV5 A;  3MXU A;  4JI1 Q;  1XMO L;  1EIF A;  3I4N H;  4CDC C;  3GV3 A;  2EIF A;  2KCT A;  3U58 A;  3EBE A;  2YU9 H;  5E4W C;  5CYU A;  4LWC A;  1WTP A;  1XPU A;  3I8Z A;  3FKI B;  2ZM6 Q;  5C4X H;  3AMU A;  1OTC A;  3U50 C;  1G29 1;  4DV1 L;  3ER0 A;  3R2T A;  5KNC A;  3DLL A;  4P2C B;  4BY1 B;  1LTG D;  1Y14 B;  4KJO A;  2I46 A;  2K1B A;  5FLX E;  3PQI A;  3OW2 A;  1N36 L;  1WCM B;  2XN9 C;  4A3L H;  2F0S A;  4UP7 A;  4LF9 L;  2KED A;  1HR0 L;  1OXV A;  2XTI A;  1PTO B;  3IFD A;  2AHO B;  1FGU A;  1BCP F;  1DGS A;  4RH6 A;  1XXG A;  4C3H H;  1K8M A;  4DV0 Q;  4HJ9 A;  4YY3 Q;  2UUC L;  4ZYS A;  5A2Q L;  4Q5V A;  4JI7 L;  4K8J A;  3LNN A;  2JN4 A;  1VQI A;  4QJF A;  2F4V L;  4MN3 A;  3LGJ A;  3UE1 A;  1VQD A;  2A6H D;  4R8I A;  2CH4 W;  1X3P A;  1I94 Q;  1GJX A;  2BH8 A;  2UXD L;  5T1G A;  4DR4 Q;  3OWF A;  2MO0 A;  1EEF D;  1H9R A;  3ZJY C;  1WTO A;  1LTT D;  3NXW A;  2MUY A;  2JA7 B;  2HDM A;  2A6E C;  2K4K A;  1XPR A;  3R3O A;  3TME A;  2ICE C;  1U5K A;  3WWV A;  2WFW A;  4DR5 L;  3CQZ H;  4PMW A;  3C3L A;  2KEE A;  1ASY A;  4I7Z C;  3AFQ A;  1RHP A;  3F2C A;  2FIN B;  4G7H C;  4MIU A;  1OXU A;  2F0I A;  4OX9 Q;  5FO7 B;  4P71 A;  1B1Z A;  3VYU A;  2OTJ A;  3VYS A;  4TRD A;  2HQE A;  4OON A;  1SNM A;  1GUN A;  1JR0 D;  2NZO A;  4BXX G;  2GA4 B;  2E8G A;  1V8Q A;  3FDT A;  3K5N A;  5CV7 A;  1SE4 A;  3FP9 A;  1B70 B;  1VDZ A;  4HCS A;  2Y0S B;  3GTK H;  4KKT A;  4FF2 A;  1S4Z A;  3D0F A;  4IN3 A;  1GKH A;  5FLM H;  1A15 A;  1HJP A;  4JI2 Q;  5C3E G;  1HNX L;  1NR2 A;  2LXJ A;  1R9T B;  2F0W A;  3G71 A;  2MP1 A;  4DR1 Q;  1EL0 A;  3BDO A;  3I56 A;  2I07 B;  5JJZ A;  1E7Z A;  1EQV A;  2MNA A;  4L5Q A;  1W2B A;  1BBW A;  1HTL D;  2ZTE A;  4BA1 I;  4G7Z C;  3OIQ A;  2Q8T A;  3D8G A;  4K8I A;  4C2M B;  3TP8 A;  1G8Z D;  1IKL A;  2OXP A;  3GTO B;  3PO3 G;  4DV3 L;  1S5C D;  1JMC A;  4R4I A;  4IO9 A;  4A75 A;  3SR1 A;  3BG3 A;  2JP1 A;  3MWY W;  3ONA B;  3CPF A;  1CZG A;  3KLS A;  2E2H H;  2QA4 A;  4DR3 Q;  3C46 A;  1VQF A;  4A93 G;  1SNQ A;  2K05 A;  4ZK9 B;  1AH9 A;  2QDL A;  2VQF L;  3A7A B;  1JOK A;  5FOB B;  4DR2 L;  3VDY A;  2O2L D;  3S2D B;  3CCM A;  1WD1 A;  1JQY D;  4BXX H;  4H44 C;  1D7Q A;  1I50 H;  3KF8 B;  2A68 D;  1CA6 A;  1X55 A;  5C0X J;  2KBN A;  2LS0 1;  1I4X A;  1S40 A;  1EQT A;  3OMC A;  4OHJ A;  3H0G B;  2QF7 A;  3QOL A;  5C3E H;  2VXW A;  2NN6 I;  4KY5 A;  1K0S A;  1Q1B A;  5HGT A;  2OTL A;  4FF4 A;  3OW7 A;  1STE A;  1HPC A;  4A3E B;  4JW0 A;  3K0X A;  3HP3 A;  4B08 A;  2A1A A;  5EGT A;  5AJ3 Q;  1ZYR C;  3SK5 A;  5I6W A;  4QY7 A;  3PO3 H;  4LFB Q;  4JI3 L;  3CP0 A;  4F7X A;  3DWQ A;  5FO8 B;  3C1F A;  1STA A;  3NPP A;  1TR5 A;  4Z9C B;  1C7Y A;  3RR5 A;  2NN6 H;  1X3Q A;  3T16 A;  2D9U A;  4A93 H;  4OO1 G;  5IGG A;  3NTH A;  4FO2 A;  4K5V A;  1B8A A;  1CZW A;  1MBY A;  4JI6 Q;  2UUB L;  2JJQ A;  1PRT F;  4DV4 L;  1O7Y A;  1YNX A;  1GUG A;  4H7B A;  3VR2 A;  2P5Z X;  2EJG C;  3BYY B;  4MTN A;  1WJJ A;  3S1M H;  1DOM A;  1SN8 A;  1EY0 A;  2M2L A;  5GAH C;  4LK1 C;  5C4J B;  4KN4 C;  3VR6 A;  4LAA A;  3SK8 A;  3TQY A;  2EYL A;  2DUD A;  2DNE A;  2WAQ G;  4HED A;  5EPJ A;  1WD0 A;  1RIP A;  4GNX C;  2QEX A;  1Q12 A;  2NB0 A;  2WV6 D;  3DHQ A;  4DUY Q;  3PMF A;  1Q82 C;  1ENF A;  1ZKO A;  4FYD A;  3S16 H;  4IUN A;  3X3N A;  1B3A A;  3BDC A;  3AB9 A;  3D3R A;  3ERQ A;  4N9P A;  3VA7 A;  1RTN A;  1L1O C;  2EE1 A;  1SE2 A;  5A2Q E;  1SYC A;  2R7Z B;  5HUR A;  3H94 A;  4A3M G;  4NP5 A;  1G6P A;  1LLR D;  2E2D C;  3J80 i;  2OQ0 A;  2MQH A;  5EBD A;  1JIC A;  1PMR A;  2VZA A;  3JAM L;  4OO1 H;  1PH8 A;  1G2S A;  3CAM A;  3T1H L;  3R93 A;  3U4V A;  4K0K Q;  4PQX A;  3IRB A;  3KK7 A;  3CRK C;  1TS3 A;  4C1N I;  3CU7 A;  4ALP A;  1UE5 A;  3J7A 5;  1I6H H;  2UXB L;  3ULL A;  1VS0 A;  1TWA H;  2Q2I A;  4P75 A;  3NWS A;  5GAE C;  2LXK A;  1J8I A;  1L0W A;  1EWH A;  2MHV A;  3NK9 A;  4CJ0 B;  2HDL A;  1WTQ A;  1IXR A;  4AIM A;  4POG A;  4CHT B;  4BBR G;  2YV5 A;  4A3C G;  5JAV A;  1YHA A;  4BY7 B;  1FVI A;  1AFP A;  5IGD A;  1BCP B;  1XX8 A;  2WAQ E;  2BA1 A;  1BNZ A;  4A76 A;  3DEP A;  2K5N A;  4X62 Q;  4DV7 Q;  2B63 B;  4UPA A;  2B29 A;  1GUT A;  1A62 A;  1ENA A;  1LV9 A;  1MI2 A;  3J7Z C;  1DYQ A;  4DUZ Q;  1KQS A;  1EOT A;  2R92 G;  2NVQ H;  4KLK A;  4HIM A;  4P73 A;  4GZY C;  2B2Y A;  4GOP B;  4A3M H;  5EQ0 A;  3GP7 A;  3U9S A;  1AN8 A;  1UWV A;  4NMZ A;  2ZXP A;  1M1K C;  1DOK A;  2E2J H;  1B9M A;  1KL9 A;  1VQB A;  2A69 C;  4HJ7 A;  1KAA A;  2E75 C;  4QUF A;  5C3X A;  3QO2 A;  3S1Q B;  1HR0 W;  1BOS A;  1PTO C;  1A8V A;  3I4M B;  1SDF A;  3PCO B;  2UUA L;  4M1U B;  4DV5 Q;  1KRS A;  3K7A B;  3A74 A;  1Y1W B;  4KD4 A;  3RZD B;  2F1M A;  2SDF A;  1R4Q B;  2GVB A;  1YHQ A;  2EPB A;  5LL6 S;  4BBR H;  4A3C H;  1N36 Q;  3KBX A;  3FPP A;  2VB3 X;  3GDE A;  4LF9 Q;  1SNO A;  3HFZ B;  1HR0 Q;  3Q8D A;  3DUZ A;  3W3A A;  1SMY C;  1HQR D;  1S5E D;  4JK1 C;  4A3I H;  1DM0 B;  4K5X A;  4MZ9 A;  4RGT A;  1K8A C;  4B3T L;  1EWI A;  2B3G A;  3Q0A A;  3PUZ A;  3QIA A;  1BBX C;  3CRL C;  5GAD C;  3F8T A;  3EQL C;  2B2U C;  3UI2 A;  3PUX A;  4ID6 A;  1H9S A;  3D6C A;  3I90 A;  1EEI D;  2MO1 A;  3CMA A;  3H3V H;  1XNR Q;  2KJX A;  3M7N A;  3STB C;  2CCZ A;  1QOH A;  4JI0 L;  2A6E D;  4O0A A;  1PH4 A;  1X54 A;  3GTQ B;  3L9A X;  3BS1 A;  4CJ1 B;  1A6X A;  2OT2 A;  2YTY A;  1KAB A;  4JC0 A;  3S1R H;  1IBK Q;  5M3M G;  1CHP D;  1XTD A;  4OGQ C;  3T1Y L;  1IL8 A;  5FJ8 G;  3HOU G;  3K57 A;  4NXM Q;  4DR5 Q;  1LAB A;  3K59 A;  3WOE A;  5FLX L;  4N8X 1;  1J5E L;  2GN5 A;  1ONL A;  1K83 B;  1XPO A;  4OL7 A;  1HTP A;  4G4K A; 
#chains in the Genus database with same CATH homology
 1EY8 A;  5IT9 L;  1PYW D;  1CK1 A;  1DD2 A;  3VR3 A;  1E2Z A;  3P75 A;  3VA5 A;  1LT5 D;  5CV8 A;  1RDP D;  1RF2 D;  4DGZ A;  5IGC A;  4FF3 A;  1CM9 A;  4KMU C;  3EJI A;  4U68 A;  4G7O C;  4ZKC B;  1D6E C;  3T13 A;  4NDX A;  3GTJ B;  3HZX A;  1VF5 C;  1Q1E A;  2CW0 C;  4J8Q A;  5JOB A;  4XTC S;  2IL8 A;  2BCO A;  1PRT B;  4G57 A;  1I4Q A;  3TP7 A;  3JAM E;  2C9O A;  2L9H A;  4HN7 A;  3S15 B;  2B2T A;  1AZP A;  3TZD A;  5CBE E;  1F9P A;  5KGU A;  2PZW A;  1PTO H;  4RFB A;  3MXP A;  1FNV A;  5EPK A;  3LWE A;  2EYJ A;  5JVH 3;  1ZYR D;  3NUC A;  1TII D;  4ABN A;  2E74 C;  1HRJ A;  4L63 B;  2K01 A;  1F2L A;  3EVQ A;  1WTW A;  3C1E A;  4ILW A;  4WJW A;  5KEE A;  4V19 0;  1G2T A;  1QB5 D;  3W2D A;  4A3F B;  1EY4 A;  5I2X A;  1YNN D;  3PIP 3;  5G3L D;  1D5Z C;  5KIX A;  4XXE A;  4DXF A;  3KLR A;  3J7Y W;  4FXG C;  1H9S B;  2RBM A;  1B9N A;  1O80 A;  1W6J A;  3IFT A;  1EZ8 A;  5I9O A;  2RDH A;  1HCZ A;  2EYM A;  1KDA A;  1SJH D;  1PZK D;  3G7L A;  5EJW A;  1TWC B;  1STB A;  5JPN C;  1EYC A;  1ENC A;  2E2I B;  2TSS A;  1E2W A;  1EYD A;  2NTT A;  1OXX K;  2L11 A;  2AQ3 B;  5I6Y A;  2F0N A;  2Q8I B;  3HOZ B;  1EY5 A;  4QCL A;  4KJN A;  2EYO A;  3K5M A;  2KOL A;  2PCF B;  3I73 A;  1I4P A;  3GTG B;  3BVZ A;  2B2W A;  1I3Q B;  5DAU A;  3IAY A;  3P7J A;  2FMM A;  1Q8I A;  3MXG A;  2XIW A;  5IGE A;  4PMC A;  5I2Y A;  5M5W B;  1K8O A;  3K5L A;  4XYQ A;  2O5I C;  2ZXR A;  4E6I A;  3HKZ B;  1FD7 D;  3BZD B;  5T1I A;  1HA6 A;  4V0B A;  4KY6 A;  2QCP X;  3K6O A;  1PLF A;  3T4A C;  1VMC A;  1C8C A;  4C3J B;  2B2V A;  1F9S A;  2DY7 A;  1KDB A;  4DNR B;  4U67 3;  3DXJ C;  4IFD I;  3MVV A;  1SXT A;  5IT9 E;  1U4R A;  4DA2 A;  4YIJ A;  3OHX C;  2XWJ B;  2A69 D;  1JWM D;  1SSO A;  4XT3 B;  5C4H A;  2R93 B;  5M9O A;  1PFM A;  4QIW B;  4OIK A;  4IFD H;  4FXD A;  1HQM C;  2NWG A;  1PZI D;  2EYF A;  2LFN A;  4XQQ A;  1QNK A;  1NR4 A;  3J80 E;  3P1H A;  2M00 A;  1MSH A;  1STY A;  2Z4I A;  1IW7 C;  3MAQ A;  4F8M A;  1SNP A;  5EKI A;  1JOQ A;  1A2U A;  4F88 A;  1KLG D;  1NSN S;  2EXZ A;  3GD7 A;  4A3B B;  2WKD A;  4J6H A;  2FHT A;  3QG1 A;  4AYB B;  3N6R A;  3R8B A;  3WDN A;  2FFK B;  3A8J E;  1FNW A;  5JVG 3;  4DFA A;  4PNY A;  3P20 A;  1SND A;  5F2D A;  1B53 A;  2M9V A;  1BXT A;  3OOC A;  2AUK A;  5J1Z A;  2K5D A;  4FVM A;  4XIG S;  1WTX A;  3D31 A;  4ZLT F;  2KCN A;  3GO5 A;  2K6A A;  4RHR A;  1TS4 A;  1HA5 A;  2CQA A;  2AUJ D;  2WB1 B;  2NN6 G;  5LL6 X;  3MFG A;  5I9P A;  2LMC B;  4O42 A;  2IW3 A;  1UUP A;  4Y7N B;  1EIH A;  4EGV A;  1BO0 A;  2HCC A;  1DJR D;  3SXH A;  5IOC A;  1SJE D;  3E5S A;  2IX1 A;  2RDF A;  1YNJ C;  2LY7 A;  1FYC A;  5D3D A;  1TT2 A;  2NZ1 D;  5C4X B;  1G6Z A;  1V1P A;  2Q8R E;  1NAP A;  4CKE A;  3NQI A;  1LO5 D;  2F0T A;  1PRT C;  3TN2 A;  2CW0 D;  4MHE A;  4C3H B;  4TSS A;  2MPM A;  4C3I B;  1RD9 D;  4Q0F A;  5J22 A;  2AQ1 B;  5E3F A;  2F0P A;  2L1B A;  3PV0 A;  4XQJ A;  1A3T A;  1A3U A;  1C4Q A;  1DCZ A;  4RAU C;  3DWP A;  2F03 A;  3AU7 A;  4HAE A;  1STN A;  1PXU A;  3NSW A;  5CMD A;  3FRP B;  4K6L A;  1SYG A;  5KRU A;  1LAC A;  1B4O A;  2ICI A;  5C5M A;  1I6V C;  4DAP A;  4PV1 C;  4IFD J;  4DN4 M;  1Z7T A;  2CHB D;  4B9W A;  1BR9 A;  4KV6 A;  1QNU A;  1QIL A;  4WOR A;  2JYO A;  4TKO B;  5DEH A;  3FEW X;  1V1O A;  2VB2 X;  3O13 A;  3BVM A;  1Y69 U;  4OIJ A;  3J81 E;  4ME5 A;  2G9D A;  3GTK B;  5I4D A;  3H91 A;  2PPB C;  3L7Z C;  4ZAI A;  3SE0 A;  1Y8N B;  5KND A;  1S5F D;  2EY6 A;  1TWH B;  1SAP A;  3GQB A;  1H9J A;  1DZ1 A;  3SVM A;  1BDO A;  1CI3 M;  1EWC A;  1S5D D;  2HCI A;  5COR A;  3A7L A;  2MGS A;  4TQU S;  3PUY A;  4M8A A;  2PW7 A;  3K0Y A;  4ZQ3 A;  1CQV A;  3T53 B;  2RA4 A;  4H13 C;  1TY0 A;  2A74 C;  4QMG A;  1EIG A;  1L0Y B;  2BOS A;  4X3K A;  1I50 B;  2D2C C;  4HMJ A;  5ELF A;  3HEJ A;  5C3E B;  2SNS A;  3V05 A;  1RTO A;  3MZ5 A;  3I72 A;  1V1P B;  5BN4 A;  1WTR A;  3VYR A;  4RA8 A;  2OEO A;  3PO3 B;  3T51 B;  4KKS A;  5D3I B;  1SYE A;  4ZUJ A;  2KHS A;  2K03 A;  3NBH A;  2EZV A;  2PO4 A;  4X3U A;  3GV6 A;  4A93 B;  1H9M A;  4EQP A;  1V43 A;  1AW7 A;  3DEO A;  1BUV T;  2D5D A;  1GUO A;  1QCB D;  1SYB A;  4CKB A;  5D65 A;  3S1M B;  3D4R A;  2X6G A;  5CV6 A;  3VYT A;  2IWH A;  1EFI D;  3LWU A;  3K58 A;  3RMH A;  2LKV A;  4HSV A;  1UEA B;  4RHS A;  5D14 A;  1ET6 A;  2Z8L A;  5E4X A;  4A3G B;  4HR7 B;  3HRZ C;  1IW7 D;  4QF4 A;  3VR5 A;  2PW5 A;  4HTH A;  2AWO A;  3S16 B;  2FJ2 A;  4KTA A;  1HFN A;  2IPK D;  2RDG A;  2EJF C;  3TZU A;  3X3M A;  2C5C A;  1GUW A;  5CC4 A;  1G91 A;  1CTM A;  1E0B A;  5ELD A;  1QE6 A;  3A8K E;  3Q6S A;  2KA7 A;  4ULL A;  2A5H A;  2BDN A;  1TWA B;  3H09 A;  4DAV A;  1JOR A;  1S5B D;  2PQE A;  2J0T D;  2NUC A;  1W6K A;  2WAQ B;  3PUV A;  4DU9 A;  1MSG A;  1EY7 A;  4QB4 A;  2V4D A;  3J80 L;  2IT1 A;  2A68 C;  3QJY A;  1ESF A;  2F3W A;  5DM7 3;  1XWE A;  1B44 D;  4X3S A;  3DMU A;  1IYV A;  2HUG A;  1CFM A;  3Q24 A;  3M7G A;  4A3M B;  3HGB A;  1YNJ D;  3MXN A;  2XWB B;  3NTI A;  2E2J B;  2J4X A;  4HCE A;  3RD4 A;  2K28 A;  2MJ8 A;  4UAI A;  5ELC A;  1RKN A;  1D5X C;  2B39 A;  2XSC A;  1QJO A;  3MEH A;  4BBR B;  1F2Y A;  3J7A V;  1F9R A;  1EU4 A;  2AWN A;  5KYL A;  2L0C A;  2K5W A;  2B2U A;  3CKI B;  2KEC A;  1UNS A;  1HUM A;  4FF1 A;  2BE5 C;  3NP8 A;  4H0L C;  2EY2 A;  4LMQ D;  1AP0 A;  2R92 B;  4XQN A;  1OO9 B;  1RCV D;  1WTV A;  5EKK A;  3D4D A;  4K14 A;  2SNM A;  1HHV A;  5M5Y B;  1O7L A;  1JCK B;  2ZT9 C;  2ID0 A;  3S1R B;  3NWT A;  4RKL A;  5CR3 A;  2ZXO A;  3QWN A;  1LTS D;  4EVO A;  4NKL A;  1LTB D;  1OXS C;  4X3T A;  1KNA A;  3OWE B;  1FNU A;  3MA2 B;  3QOJ A;  5E1F A;  5C0X I;  2EOT A;  4IUP A;  3S17 B;  1GHK A;  1U9R A;  1GXD C;  4IAL A;  1X32 A;  2JEA I;  4EQO A;  4IFD G;  4EQN A;  1JE4 A;  5TSS A;  1BCP C;  1SEB D;  1GUS A;  2KUM A;  3E6Z X;  2X6L A;  1A3V A;  5FO9 B;  3KBG A;  1ZXT A;  5M3M B;  3K5O A;  2E76 C;  1D2B A;  3VR4 A;  1ET9 A;  2NYZ D;  2QEJ C;  4WRD A;  3HOU B;  3BDL A;  3S1N B;  1CA5 A;  2EYH A;  1SYD A;  1QG7 A;  5FK9 C;  4IUT A;  3C2P A;  3FMC A;  3J81 L;  2L4N A;  2WP8 J;  3N52 A;  2F0E A;  4S3S A;  1T5E A;  5JEA G;  3HS0 C;  3A56 A;  2B8G A;  3S14 B;  1B2T A;  1C48 A;  2FMC A;  5M5X B;  2R61 A;  1A2T A;  3R2I A;  1HXY D;  2L5T A;  3KUP A;  1PTO D;  2R6G A;  2D62 A;  1ML0 D;  2WKC A;  1TQO A;  5C3W A;  5C4Z A;  3NBI A;  3URY A;  3ND8 A;  2RQX A;  4C1N K;  2SOB A;  3NQT A;  5C6A A;  2EY5 A;  5FKA C;  5EKL A;  2F0G A;  2XVS A;  2DN8 A;  2EYP A;  3MFY A;  2F0Q A;  4IUQ A;  4CJ2 C;  3ERO A;  1SMY D;  3EA6 A;  3ND9 A;  2F4I A;  4DK1 A;  1HFG A;  3IL8 A;  3CHB D;  1ILQ A;  1STG A;  2NVY B;  1NCV A;  1CQF A;  4WFN 3;  4HMI A;  3M3Y B;  3TDQ A;  5JEA H;  2J7Z A;  2O5J C;  1LTA D;  1PFB A;  1LTR D;  2RSN A;  2JA8 B;  1D1K A;  5BN5 A;  2NVT B;  5DM6 3;  4O1N A;  1STH A;  3SK4 A;  3OPO A;  3TP6 A;  2DY8 A;  3KLS X;  3RUZ A;  3G6J B;  1HUN A;  3PO2 B;  4RGM A;  2NVX B;  3EFX D;  2JA5 B;  2F0U A;  2KCC A;  4JBW A;  1O7Z A;  2QKI C;  4RGN A;  4L8J A;  2CVR A;  4RWS C;  3PUW A;  3I4N B;  1Y8P B;  1Z6H A;  4FP5 D;  2YU9 B;  4UDU C;  2JA6 B;  1GOZ A;  1SE3 A;  1TU2 B;  2K04 A;  1EYA A;  2L12 A;  4FNF A;  5K36 G;  3TBI B;  1Q90 A;  1Y8O B;  4XYO A;  2KQ3 A;  3L3O C;  2Z1C A;  2K32 A;  5LHY 1;  3NE5 B;  2F0H A;  3M85 A;  3GTP B;  1Y1V B;  2B2Y C;  1LT3 D;  3SHL A;  4CBV A;  1U4M A;  2EY1 A;  1O78 A;  4R8N A;  3M4O B;  4CGY B;  3TSS A;  1IYU A;  4BS9 A;  4BA2 I;  5IOD A;  3GTL B;  2K5Q A;  1KTK A;  4KI0 A;  4RGO S;  1U4L A;  2JEB I;  3E0J A;  2L55 A;  3SDZ A;  1Z47 A;  4KN7 C;  4QUC A;  1YNN C;  1ILP A;  2BA0 A;  4K6D A;  4LJZ C;  3V2T A;  4XDX A;  3CQZ B;  1DOL A;  4HSP A;  5K36 H;  3IKJ A;  1H9K A;  5A35 A;  1AEX A;  4IUR A;  2QDB A;  4KHV A;  1UAP A;  3S2H B;  2BE5 D;  3H3V C;  3MC0 B;  4R9W A;  5KNB A;  4OO1 I;  1LTI D;  3WOF A;  4KHZ A;  3HOV B;  4BBS B;  5G3L F;  1TS2 A;  1F2Z A;  1EY6 A;  2SEB D;  3OIP A;  3Q23 A;  5JEA J;  1FGB D;  3DM1 A;  3S9W A;  4DNT B;  1GHJ A;  2EJM A;  1VMP A;  5JPM C;  3V96 A;  3FPU B;  5IGF A;  2F0D A;  2EVB A;  3HG9 A;  5AFW A;  1IKM A;  2E2H B;  1ROD A;  1BQQ T;  5COY A;  1SFO B;  2F0V A;  4PMB A;  2R3Z A;  1SNC A;  4BWG B;  5KYI A;  1M8A A;  2F0O A;  1EZ6 A;  2IX0 A;  3TP5 A;  2OF1 A;  2VUM B;  1LT4 D;  3HOY B;  1PDQ A;  2TMP A;  1B50 A;  4J1M A;  1RJT A;  1BCP D;  3RZO B;  5M3F B;  3ITP A;  4NW2 A;  4K2L A;  1DXM A;  4A3J B;  2RSO A;  3SEB A;  1XTC D;  5C44 B;  1D1I A;  4K2K A;  3D6W A;  4DXG A;  2A6H C;  2JSO A;  2B2T C;  5CV9 A;  2KVM A;  1TVX A;  2JXM B;  1I4H A;  1D5M C;  2XRS D;  2WIN B;  5CBA E;  1QWY A;  3NHH A;  2PZU A;  1F77 A;  1ZEQ X;  2H1E A;  5IIF A;  3BYT B;  4DAY A;  3BVG A;  1MD2 D;  5K5P A;  1BF4 A;  1PTO F;  4A3D B;  4ZUI A;  2K33 A;  3J7A F;  4ODG A;  2YYZ A;  2ENB A;  1J9O A;  4IQZ A;  1JOO A;  2IJ0 A;  2XRQ D;  3MHB A;  2BDO A;  1EU3 A;  2VNU D;  2AQ2 B;  1EY9 A;  2F0J A;  1KDC A;  1PZJ D;  4I65 A;  3OSO A;  4C3J G;  2A73 B;  4A3K B;  2PYK A;  3A54 A;  2RKS A;  1DON A;  1PFN A;  2F0L A;  4KY7 A;  2N88 A;  1I6H B;  2JE6 I;  3I91 A;  2NBF A;  3RLF A;  3U9O A;  4CKC A;  3M4Y A;  4KKU A;  4DK0 A;  1WVL A;  1M4V A;  1VF7 A;  1NUC A;  1II3 A;  2B2W C;  2EDG A;  2QIL A;  2G9H D;  3F2U A;  1TKW B;  2XNA C;  1JWS D;  3I3C A;  2NTS A;  3I4L A;  1E2V A;  3QB3 A;  1R4P B;  2NVQ B;  1MGS A;  4L6T B;  1ESR A;  1ICW A;  2WAC A;  2PNR C;  4C56 C;  1OXT A;  4KK7 A;  3HOW B;  3ZYY X;  2Z4H A;  4RKB A;  1F2M A;  2N55 A;  2PMZ B;  2B2V C;  3OMG A;  5EBC A;  5IGB A;  1TY2 A;  4XT1 B;  4IUV A;  1IHZ A;  3GTM B;  1PRT D;  2F0M A;  1KLU D;  1SBB B;  5DNF A;  2WII B;  5ISR A;  2IX3 A;  5CV4 A;  1T5X D;  3H6M A;  4IUU A;  4KD3 A;  2B8F A;  3T56 B;  4A3I B;  4FXK C;  1SYF A;  1JWU D;  1TS5 A;  1FR3 A;  3MTS A;  4F87 A;  1Q3L A;  2F0F A;  3D4W A;  5ELE A;  3A8I E;  1I4G A;  3SK6 A;  4DF7 A;  1KNE A;  3HOX B;  1JB3 A;  2DNC A;  1VCI A;  2O4X A;  3DWA A;  1U4P A;  1TWF B;  1LT6 D;  4K5W A;  4RCO A;  5C0X G;  5NUC A;  5J39 A;  5C5L A;  1XYI A;  3Q22 A;  4N9T A;  3NTK A;  2K7V A;  2F3V A;  1L0X B;  3LX0 A;  5EPL A;  4RCN A;  1CHQ D;  3I70 A;  2H4O A;  3FVQ A;  2RVL A;  3PIO 3;  1CT1 D;  1JC7 A;  4C3H G;  4IZ8 A;  4C3I G;  4ZRZ A;  5ELB A;  4B9X A;  1I4R A;  4ZKB B;  5CGK A;  2X69 A;  2PZT A;  5BN3 A;  3A55 A;  1F9Q A;  5C0X H;  3KF8 A;  1TWG B;  2F0K A;  1AZQ A;  5CV5 A;  3MXU A;  3GV3 A;  5E4W C;  5CYU A;  1WTP A;  3I8Z A;  3FKI B;  3AMU A;  1G29 1;  3R2T A;  5KNC A;  4P2C B;  4BY1 B;  1LTG D;  4KJO A;  2I46 A;  2K1B A;  5FLX E;  1WCM B;  2XN9 C;  2F0S A;  2KED A;  1OXV A;  1PTO B;  3IFD A;  1BCP F;  4RH6 A;  1XXG A;  1K8M A;  4ZYS A;  5A2Q L;  4Q5V A;  4K8J A;  3LNN A;  4MN3 A;  2A6H D;  4R8I A;  1X3P A;  1GJX A;  5T1G A;  3OWF A;  1EEF D;  1H9R A;  1WTO A;  1LTT D;  3NXW A;  2MUY A;  2JA7 B;  2HDM A;  2A6E C;  3R3O A;  3TME A;  2ICE C;  4PMW A;  3C3L A;  2KEE A;  4I7Z C;  1RHP A;  2FIN B;  4G7H C;  4MIU A;  1OXU A;  2F0I A;  5FO7 B;  1B1Z A;  3VYU A;  3VYS A;  4TRD A;  2HQE A;  1SNM A;  1GUN A;  1JR0 D;  2GA4 B;  1V8Q A;  3FDT A;  3K5N A;  5CV7 A;  1SE4 A;  1VDZ A;  4HCS A;  2Y0S B;  4KKT A;  4FF2 A;  1S4Z A;  4IN3 A;  1A15 A;  1NR2 A;  1R9T B;  2F0W A;  2MP1 A;  1EL0 A;  3BDO A;  2I07 B;  5JJZ A;  1EQV A;  1HTL D;  4BA1 I;  4G7Z C;  3OIQ A;  2Q8T A;  3D8G A;  4K8I A;  4C2M B;  3TP8 A;  1G8Z D;  1IKL A;  2OXP A;  3GTO B;  1S5C D;  3SR1 A;  3BG3 A;  2JP1 A;  3MWY W;  3ONA B;  1CZG A;  3KLS A;  3C46 A;  1SNQ A;  2K05 A;  4ZK9 B;  3A7A B;  1JOK A;  5FOB B;  3S2D B;  2O2L D;  1WD1 A;  1JQY D;  4H44 C;  2A68 D;  1CA6 A;  5C0X J;  2LS0 1;  1I4X A;  1EQT A;  3OMC A;  4OHJ A;  3H0G B;  2QF7 A;  3QOL A;  2VXW A;  2NN6 I;  4KY5 A;  1Q1B A;  5HGT A;  4FF4 A;  3OW7 A;  1STE A;  1HPC A;  4A3E B;  4B08 A;  3HP3 A;  5EGT A;  1ZYR C;  3SK5 A;  5I6W A;  4F7X A;  3DWQ A;  5FO8 B;  3C1F A;  1STA A;  3NPP A;  1TR5 A;  4Z9C B;  2NN6 H;  1X3Q A;  3T16 A;  2D9U A;  4OO1 G;  5IGG A;  3NTH A;  4FO2 A;  4K5V A;  1CZW A;  1MBY A;  1PRT F;  1O7Y A;  1GUG A;  4H7B A;  3VR2 A;  2EJG C;  3BYY B;  1DOM A;  1EY0 A;  2M2L A;  4LK1 C;  5C4J B;  4KN4 C;  3VR6 A;  4LAA A;  3SK8 A;  2EYL A;  2DNE A;  4HED A;  5EPJ A;  1WD0 A;  1Q12 A;  2NB0 A;  2WV6 D;  3DHQ A;  3PMF A;  1ENF A;  1ZKO A;  4FYD A;  4IUN A;  3X3N A;  1B3A A;  3BDC A;  3AB9 A;  3D3R A;  3ERQ A;  4N9P A;  3VA7 A;  1RTN A;  5A2Q E;  2EE1 A;  1SE2 A;  1SYC A;  2R7Z B;  5HUR A;  3H94 A;  4NP5 A;  1LLR D;  2E2D C;  5EBD A;  1JIC A;  1PMR A;  3JAM L;  4OO1 H;  1G2S A;  3R93 A;  4PQX A;  3KK7 A;  3CRK C;  1TS3 A;  4C1N I;  3CU7 A;  3NWS A;  1J8I A;  1EWH A;  2MHV A;  3NK9 A;  4CJ0 B;  2HDL A;  1WTQ A;  4CHT B;  5JAV A;  4BY7 B;  1AFP A;  5IGD A;  1BCP B;  1XX8 A;  2BA1 A;  1BNZ A;  3DEP A;  2B63 B;  1GUT A;  1MI2 A;  1ENA A;  1LV9 A;  1DYQ A;  1EOT A;  4GZY C;  2B2Y A;  5EQ0 A;  3GP7 A;  3U9S A;  1AN8 A;  4NMZ A;  2ZXP A;  1DOK A;  1B9M A;  2A69 C;  1KAA A;  2E75 C;  4QUF A;  5C3X A;  3QO2 A;  3S1Q B;  1BOS A;  1PTO C;  3I4M B;  1SDF A;  4M1U B;  3K7A B;  1Y1W B;  4KD4 A;  3RZD B;  2F1M A;  2SDF A;  1R4Q B;  2EPB A;  5LL6 S;  3KBX A;  3FPP A;  2VB3 X;  1SNO A;  3DUZ A;  3W3A A;  1SMY C;  1HQR D;  1S5E D;  4JK1 C;  1DM0 B;  4K5X A;  4RGT A;  3Q0A A;  3PUZ A;  3QIA A;  1BBX C;  3CRL C;  3EQL C;  2B2U C;  3UI2 A;  3PUX A;  4ID6 A;  1H9S A;  3D6C A;  3I90 A;  1EEI D;  3M7N A;  2KJX A;  1QOH A;  2A6E D;  3GTQ B;  3L9A X;  3BS1 A;  4CJ1 B;  1A6X A;  2OT2 A;  1KAB A;  1CHP D;  4OGQ C;  1IL8 A;  3K57 A;  1LAB A;  3K59 A;  3WOE A;  5FLX L;  1ONL A;  1K83 B;  4OL7 A;  1HTP A;  4G4K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...