4HJ7A

Crystal structure of schizosaccharomyces pombe pot1pc bound to ssdna (ggttagggt)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
138
structure length
138
Chain Sequence
SFSLLSQITPHQRCSFYAQVIKTWYSDKNFTLYVTDYTENELFFPMSPYTSSSRWRGPFGRFSIRCILWDEHDFYCRNYIKEGDYVVMKNVRTKIDHLGYLECILHGDSAKRYNMSIEKVDSEEPELNEIKSRKRLYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nonspecific Recognition Is Achieved in Pot1pC through the Use of Multiple Binding Modes.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Dna binding protein
molecule keywords Protection of telomeres protein 1
total genus 33
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2012-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16686 POT1PC ssDNA-binding domain of telomere protection protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4hj7A00
4KI0A 1PH8A 1HZAA 1L1OA 2VL6A 1OXXK 4A3FG 1FJGQ 2Y0SG 2K5HA 4QY7A 1K3RA 5IP7G 1NY4A 1VQBA 4DV7L 4B3SL 4DR6L 4A3JG 4GOPA 4YWLA 1XNQQ 2WAQG 4JCVE 5BR8L 1L2FA 1QZGA 4MTNA 1WJJA 4JI6L 1UE7A 2F4VQ 5IYDG 4A3BH 1JJGA 4DNIA 4LFAQ 1Z9FA 4DKAC 2OWOA 4ME3A 4X64Q 2E5LL 2VUMH 3HOWG 3H0GG 4DR4Q 4KLKA 3OW2A 3FP9A 4NB3A 2K14A 3AFPA 2GN5A 4JG2A 2UXCQ 2JA9A 3GTOH 2UU9L 4P73A 3T1YL 4C3JH 4GN5A 1SR3A 3PO3H 1Q1BA 4DK3C 5C4XH 5IYCG 4BBSG 1L1OC 5M5XH 2K5VA 4IFDJ 2E2HH 4JI2L 1VQEA 4JI0L 1N33L 2JA6G 4C3IH 2ZTEA 2V1CC 4B3RQ 3RNUA 2Z0SA 1XMOQ 2PMZE 3HOVH 3CC2A 3I2ZA 5ELNA 1K83H 4DV2Q 1Y1VG 4DR7Q 5E7NA 4MZ9A 1VQLA 3L2PA 5C3EH 2HHHQ 1U0LA 4R4OA 3UDFA 4JI6Q 1FL0A 1TWGH 4POGA 3RZOH 4YCWA 3ZJYC 1XNQL 4AQYL 4A3IG 1YHQA 3K0XA 2R7FA 1SFOH 3RLFA 4DR6Q 2VNUD 2RHQB 1IBLQ 2PI2A 1EIYB 1YITA 1N9WA 2IT1A 3K7AH 1SMXA 3VDYA 3S15H 2Y0SE 2PQAA 2MQHA 2N3SA 4PMWA 1IYJB 4IO9A 2KHJA 2XGTA 3M4QA 4YY3Q 3S1RH 1PVOA 2F52A 2E8GA 5IWAL 3CCMA 1OXUA 1XMOL 3CCLA 2VY3A 5LMNQ 4B3RL 4KHPQ 1XJVA 4JI0Q 4A3KG 1N33Q 5C4JH 3NELA 1A8VA 1VQFA 2PQAB 1UEBA 1PH5A 1C9OA 5LMUQ 2UUBL 2F3IA 4HJ7A 4K0KQ 3T1YQ 5AJ3L 1UE1A 3S1NH 4L5RC 1HZ9A 1WFQA 1X9NA 1X65A 3I4MH 1HZBA 3PIPA 1IBKL 3I4NH 4DR4L 3WWVA 2EQSA 4BY1H 5M3MH 1M1KC 1EQQA 3T1HL 4LFAL 4GOPC 3U58A 3F2BA 3T1HQ 4MNOA 1SLJA 5IP7H 1KC8C 1KIXA 1D8LA 3A5UA 4WJ3M 4JI5L 4HJ5A 4L5QA 4LUOA 5GAGC 4YCVA 3KDFA 2R7ZH 2PNHA 2VQFL 3TS0A 3RZDH 2D0PA 1QVGA 4X6AH 3S1MH 5H1SE 1J6QA 5AJ3Q 4A3MG 3GTQH 4K0KL 3K80C 3PF4A 1MJCA 1W2BA 4WJ4A 1YVCA 2VUMG 1SE8A 3HOWH 2I5MX 3H0GH 1EYGA 2MNAA 3STBC 1EUJA 2CQOA 3E0EA 4GNXB 1TXYA 4KHPL 3W1GA 3AYHB 1PH1A 1CSPA 3FKIG 5IWAQ 5C4XG 1HH2P 1BKBA 2JA8H 2B63G 2ZTCA 4UP9A 4XTCS 3TRZA 4UP7A 2NN6G 2WB1G 4OWTB 5C0XJ 1EWIA 4R4CA 3EN2A 2MO1A 4IJLA 1BBUA 1Q7YC 1VQ8A 2UXDL 2R92G 2XTIA 1XMQL 3HOXG 1HNXQ 3S16H 4YWKA 2D62A 1L1OB 1NTGA 5FJ8H 4B3ML 3JC66 3M85A 1SRUA 1YZ6A 4QJFA 2ZM6Q 1IBLL 1Y14B 2WB1E 3CC7A 4DAYB 3K8AA 1DGSA 4AQYQ 4LFCL 5JJKA 5JJIA 4Y52H 3TS2A 1Q81C 1S3OA 4BY7G 1TWHH 4BA2I 5IYBH 1QZHA 2HHHL 4NXMQ 4A3LG 4DR7L 1GKHA 4HJAA 4DV6L 2JE6I 3HOYG 5M3FG 1PFSA 1V43A 2VQEL 4LWCA 3CAMA 2UXBL 3PV0A 1CSQA 1HR0Q 2WP8J 3KLWA 3PCOB 5C0XI 4JI3L 1VQ9A 1X56A 4JI2Q 4DV1Q 1ASZA 3CCEA 3M3YH 5M5WH 4A3EH 2RHSB 1AE2A 1G51A 3BU2A 3BJUA 1VQ5A 2OTLA 2UUAL 1X3GA 4B3TL 1LM0A 3U50C 2NVYH 4LNQA 1QVFA 1N32L 3J81i 3F1ZA 1EQRA 3CCRA 2UU9Q 3B6YA 4DUYL 3GTGH 2JEBI 2OCEA 1C7YA 5FLMG 2C35B 2YTYA 1PH7A 1K8AC 3A0JA 4X64L 3GTJH 3W1BA 3PUZA 2OQ0A 1E1OA 1UWVA 2F4VL 4JI1Q 3KF6A 1VQCA 5BR8Q 1BBWA 1Q1EA 1A0IA 1LYLA 2H5XA 3I4MG 4NPSA 2N78A 1A63A 4B3SQ 4DV7Q 1FVIA 2YTXA 4H02A 2NZHA 2JA7G 4DUZQ 2E2JH 5HY6A 4JI8L 4GOPB 1I94Q 3KF6B 4GLXA 1FGUA 3I55A 4LF8L 1O7IA 1V1QA 4AIMA 3GD7A 1VQGA 2OQKA 4A75A 1XNRQ 3MEFA 4X62Q 5HGQA 1VQ6A 2GVAA 3HKZG 3H3VH 3L7ZC 1YEZA 1VCIA 3K7UC 2CWAA 3KJOA 2I0QA 4PZ6A 3CCUA 3M4OH 4HIDA 4X65Q 3CMEA 2EIFA 2QA4A 1J5EQ 2JA5H 2A19A 2AWOA 3HOUH 3S17H 1G291 2IX0A 5GROA 3G48A 3D0FA 4LF6L 1OXVA 4OWWB 1CKNB 1HNZL 4OONA 1Q46A 2ZJQA 4JOIA 2BA0A 4IOCA 4A76A 1YNXA 3ULPA 2LSSA 4P72A 4JI4Q 3KJPA 3I4OA 1IZ6A 4QIWE 3RN5A 4LF9Q 5M5YH 3GTLH 2HQLA 5IP9H 3S2DH 3STBD 3PUXA 1N34Q 2KBNA 2A8VA 1G6PA 3DM3A 2DGYA 1WI5A 4X66Q 2IHEA 1CKNA 4OXPA 1XPUA 2ID0A 3Q8DA 3F8TA 3GTKH 2ALYB 1IBML 1UE5A 4JBMA 4DV5Q 4QGUA 3AFQA 1Y1WG 1KXLA 2JEAI 1C0AA 3HKZE 3H3VI 1MIUA 3F2CA 3MXNB 1AE3A 1ASYA 3E9IA 3UE0A 1Z47A 1D7QA 3CC4A 1VQPA 1U5KA 2K75A 3OTOL 2CFMA 3KOJA 4JI7Q 1NMFA 2AMCB 3A5ZB 4JBWA 1EOVA 4DR5Q 1B70B 2VW9A 2K52A 4P75A 3ULLA 3ICEA 1W3SA 4GNXA 5GAHC 4A3CG 3S14H 3CMAA 3HFZB 3G71A 5LMNW 2UUCQ 4LF4L 4GLVB 4A3FH 4OX9Q 4FDBA 4DR1L 4L5SA 1PH3A 2K4KA 4RG1A 4POFA 4GKJL 2VZAA 2ZTDA 4R4IA 1MKHA 1I5FA 4R4QA 4C3HH 4JV5Q 1X6OA 2AKWB 1KD1C 1WYDA 1KQSA 3KFUA 3U4VA 4DV3L 4LF7Q 4IPGA 4L5TA 2R93G 3M9BA 3JAMi 1E7ZA 4NXNQ 3PO2G 1E1TA 3H15A 4LF5L 2Z6KA 3M7NA 1PHJA 1N36Q 4GKKQ 5EAYA 1I50H 4XIGS 4JYAL 4LUVA 4GLAC 4HIKA 1VQJA 2Z6KC 3GTPH 1TWCH 4UY8C 1SN8A 1KHIA 2IHFA 4BBSH 2JQOA 3TQYA 2ZJRA 1MJEA 3S1QH 3RR5A 1JB7A 4DV0Q 3NBHB 4A93G 3PUWA 1YHAA 1WCMH 3ERSX 4BBRH 1YJNA 4LF6Q 2B63H 5C44H 5DLQE 3EIVA 1QUQB 5IYCH 4X65L 2AWNA 4A3DH 4UPAA 4P74A 1P8LA 1JJ2A 1N8RC 2B29A 4QQBX 1VQAA 3CW2C 5FJ8G 4X62L 1BVSA 3CCJA 4GKKL 4LFBQ 1XNRL 1A62A 5IY0A 3FKIH 4GS3A 3J80c 4JBJA 4LF5Q 4LF8Q 1YJ9A 2BH2A 1SROA 4JI8Q 4DPGA 1GD7A 1T9HA 3HKSA 3GDEA 1QVCA 1TWAH 3CF5A 4DUZL 1YIJA 1HNWL 4QL5A 3BZCA 1EFWA 5JJLA 4PG3A 3TEHB 1P16A 4R1JA 3PUVA 5M3FH 1XPRA 3CPWA 1VQDA 4JI1L 3CQZH 4Y7NH 1GO3E 4C2MH 3F2DA 2YU9H 1XPOA 4OX9L 3I7FA 4GN3B 1X55A 1KRTA 4DR2L 4DR3L 2ATWA 3KF8B 3RLNA 3I56A 2N49A 4YHHQ 4TVAB 4DR5L 5JEAG 3G4SA 1PV4A 4JC0A 3LGJA 2KCMA 4A4IA 3CCSA 2NVXH 1N32Q 3NEMA 2NZOA 3HOZG 1VQNA 4IFDI 1PH2A 1GM5A 5IYDH 2DUDA 3J81j 4DV4L 1VQ4A 2Q2IA 2I5HA 4DV5L 1RL2A 1K8GA 1VQHA 1WOCA 2WFWA 4JYAQ 1VQMA 3UDXA 3S2HH 1N36L 4P71A 2JA7H 1OXTA 3K81C 4IPHA 3PO3G 1N34L 3I4NG 2HT1A 3L0OA 5M3MG 4DV4Q 4J15A 1IXRA 4JI4L 3PIOA 2ZM6L 1VQKA 2JA6H 4DV3Q 4LF7L 4B3MQ 4BXXG 3ULJA 1K9MC 2B3GA 1HNZQ 1X3FA 3EBEA 2EXDA 4GNXC 1XMQQ 1HNXL 3CXCA 3IRBA 2Q2HA 1VQOA 1IL2A 3PSIA 4YHHL 1CKMA 2Q2TA 3CD6A 4HIOA 4DR3Q 1S40A 4DR2Q 3GO5A 2HIXA 1TWFH 1Q86C 2R92H 4AYBG 2R7DA 1X3EA 1B7YB 1LTLA 3AQQA 2N8NA 3RN2A 1VS0A 1L0WA 4JI7L 3OYYA 1I94L 3UE1A 1JMCA 5GQOA 1Y1VH 1R9TH 2JK8A 4PZ7A 4HIMA 2PI2E 4PZ8A 2OTJA 4AYBE 1HNWQ 3HOUG 5J3BA 2HIVA 3CCVA 1NJIC 4A3LH 1EIFA 4YCUA 1VQ7A 1YI2A 2BA1A 2KCTA 2MO0A 3D31A 1OTCA 4JI5Q 2YYZA 4LFBL 2K50A 3KYHC 4X66L 1PH4A 2A1AA 1CUKA 4ALPA 4A3EG 1H95A 4JOIC 1IBKQ 2QGQA 4IFDG 5IYBG 1LUZA 4LF9L 5GADC 4DUYQ 2CKZB 4APVA 4A3GG 2BH8A 2QEXA 1M90C 3DLLA 3ER0A 4BA1I 1V9PA 5C0XG 5IE8A 3PF5A 2UUBQ 4OO1I 3E9HA 5FLMH 1NBWA 5LMUL 4B3TQ 4R4TA 1Q82C 1PH6A 4BY1G 3CPFA 1YBYA 4DV0L 1J5EL 1HR0L 1HR0W 4O0AA 2YV5A 4GN4B 2NVQH 2Q2UA 4IPDA 5JEAJ 4YWMA 4YY3L 1PH9A 4LW1A 4HJ9A 2R7ZG 1NE3A 2L15A 4A3JH 4NXML 4A3MH 4A3CH 3BZKA 1JJCB 3PUYA 3GTMH 3PO2H 4NXNL 4A3BG 3J7A5 1E24A 1NMGA 2ZJPA 2WAQE 2K5NA 2GVBA 1X54A 2YTVA 2CWPA 3RLOA 3J81c 1KRSA 5GAEC 1I3QH 4JV5L 2R6GA 5FLXc 1PA6A 3SGIA 1VQIA 4GKJQ 2JJQA 2IX1A 3S24A 1K0RA 3M4PA 4DR1Q 1HJPA 4DV2L 4LF4Q 4BXXH 3PGZA 5ELOA 4LUZA 3G6EA 2E2IH 2UUCL 1KL9A 3W5OA 3JAMc 3FHWA 2KHIA 1AH9A 4DAMA 5IT9c 3HOVG 4EX5A 5K36G 3NENA 1JT8A 4A3DG 2JA8G 1B8AA 3OTOQ 5IP9G 3J80i 2UUAQ 4O2DA 2RCNA 4DV1L 2JA5G 5C3EG 4A93H 1YHBA 4JI3Q 2NVTH 2I5LX 3CP0A 2VQFQ 4DK6C 1QUQA 1Q8KA 1WCMG 1OXSC 3HOXH 2UXCL 4BBRG 2LXJA 2VQEQ 4HJ8A 4A3IH 1I6HH 1Y1WH 3HOYH 2UXBQ 2IY5B 5C44G 1IBMQ 4DV6Q 4OO1G 2E5LQ 2RF4A 4IPCA 1PYSB 1UE6A 2VS1A 2FXQA 3U4ZA 3J7ZC 1S72A 2ES2A 4BY7H 4IOAA 1RIPA 3TREA 3KDFB 4LFCQ 3CCQA 4UP8A 3AEVA 1YJWA 1FJGL 2LXKA 1KAWA 1HZCA 2D0OA 4RMFA 2ASBA 3A74A 1K73C 2UXDQ 4OWXB 4A3KH 2CCZA 1Q12A 4AH6A 4EQ5A 1GVPA 5LMNL 3UDGA 1CKOA 4A3GH 1XTDA 3UDIA 1JE5A 4TQUS 2AHOB 4KHZA 1PYBA 1E22A 4JBKA 3HOZH 4IJHA 2R93H 2MFIA 1E3PA 2NN6I 2KENA
chains in the Genus database with same CATH superfamily
1HZAA 1L1OA 1OXXK 3QO2A 4E6IA 2Y0SG 2K5HA 4QY7A 1FJGQ 1K3RA 3TMEA 5IP7G 4DR6L 2HUGA 1DOLA 4JCVE 5BR8L 1QZGA 4MTNA 1WJJA 1UE7A 4K8IA 4DGZA 4DKAC 4ME3A 2GA4B 2VUMH 3ONAB 1S5BD 5EJWA 3BVGA 3GTOH 2UU9L 1H9KA 4P73A 4C3JH 4M1UB 1Q1BA 5C4XH 5IYCG 2PW5A 1G2SA 2QKIC 2E2HH 1VQEA 2ZTEA 2V1CC 3RNUA 1XMOQ 2PMZE 3HOVH 5K36H 4AYBB 2DJGC 2XSCA 2F3WA 5ELNA 2CVRA 4OL7A 2L4NA 4FF4A 1NAPA 3NQIA 4UDUC 1FL0A 4YCWA 5HURA 3D3RA 2JA7B 4HCSA 4AQYL 1U4LA 1ET6A 4KMUC 4ZLTF 4H44C 2DY8A 1EYAA 1I50B 1IBLQ 1JR0D 2CQAA 3T13A 1ONLA 3VDYA 3S15B 2B2WC 1Y8PB 2HQEA 2MQHA 2K03A 2NVXB 1RJTA 2WKDA 1F2MA 1ML0D 3DXJC 2F52A 2DNCA 1XMOL 2Q8IB 4F7XA 3NELA 1VQFA 4A3FB 3SK8A 1C9OA 5LMUQ 2QW7A 3GTMB 4MIUA 5TSSA 2QEJC 1GUWA 1EEID 3U9SA 3HOXB 1HUNA 3I4MH 1VF5C 1A3TA 2L1BA 2NWGA 4DR4L 3WWVA 4BY1H 2B2VA 3T1HQ 1G91A 2WINB 3TS0A 1QVGA 1HFNA 5H1SE 3GTQH 3K80C 3KLSX 1W2BA 1B2TA 3HOWH 1A3UA 3J7YW 2MNAA 3STBC 1TIID 2CQOA 3E0EA 3W1GA 3K59A 5IWAQ 1HH2P 2RSNA 2B63G 4WFN3 5CV5A 4WJWA 1EWIA 3M3YB 1U9RA 2XVSA 2MO1A 3EN2A 3IFDA 1EU3A 1Q7YC 2UXDL 3TZUA 2XTIA 3J7AF 3HOXG 4A3MB 1EL0A 3M85A 4NDXA 1YZ6A 4QJFA 3CC7A 1BF4A 1RF2D 3K8AA 4AQYQ 4EVOA 3TS2A 4K6DA 4FF3A 5E3FA 3E0JA 4NXMQ 5FK9C 4IUTA 2RSOA 2JE6I 4WRDA 2Q8TA 3PV0A 3KF8A 2OXPA 3NBHA 1VQ9A 3PCOB 4JI3L 4DV1Q 4IUUA 3CCEA 4B3TL 1M8AA 3BU2A 4JK1C 1NR2A 4H13C 3R8BA 3CCRA 2UU9Q 3B6YA 4FVMA 2B2WA 5CV9A 1L0XB 3OHXC 1CTMA 1EIGA 1E1OA 1UWVA 4JI1Q 2Z9HA 3MXGA 1A0IA 2H5XA 4NPSA 3IL8A 2A6HD 1Y8NB 2YTXA 5FO8B 3DM1A 3GQBA 3J80L 4DV7Q 4G7HC 1LT5D 2RCFA 4KD3A 1KABA 2D5DA 1GUTA 4LF8L 3GTGB 1O7IA 2OQKA 4HSVA 1VQ6A 5HGQA 1G8ZD 1FR3A 5KYIA 3S1NB 1QG7A 2WV6D 2KQ3A 3K7UC 3J80E 2CWAA 1JORA 2JYOA 3KJOA 3S17B 3NP8A 4PZ6A 2EVBA 4X65Q 2EIFA 2JA5H 1PDQA 3M4OB 2IX0A 1MSGA 1SYBA 1PRTC 2AQ2B 1CKNB 1SMYC 2BA0A 1J8IA 3OOCA 3ULPA 3I4OA 5I6WA 3DWPA 4A3DB 3PMFA 1DONA 3DM3A 4X66Q 4C3IG 4TKOB 3GTKH 2ALYB 1CM9A 1WTPA 2JEAI 1C0AA 3H3VI 4N9TA 1B1ZA 1AE3A 3E9IA 5C4HA 2A74C 2FINB 1SJED 2RQXA 4JI7Q 5C3WA 4X3KA 5KEEA 2VW9A 4P75A 3ICEA 3HFZB 3PO2B 4JVZA 1K8MA 4GLVB 1EY8A 4FDBA 2XWBB 4L5SA 2K4KA 4GKJL 2Q8RE 4R4IA 5IGBA 3SDZA 1D5MC 1PRTD 3M7GA 4C3HH 4JV5Q 5C6AA 1EYDA 3KLSA 3KFUA 4L5TA 3CRKC 1QOHA 1SNMA 2TSSA 3W2DA 4LF5L 2Z6KA 2R61A 5CR3A 1PHJA 1N36Q 4GKKQ 2A69D 2BE5C 4LUVA 1HHVA 1GXDC 4KJOA 3GTPH 4LJZC 2G9HD 4PQXA 4UY8C 1CK1A 2JQOA 2ZJRA 1MJEA 3RR5A 1ZXTA 1JB7A 4FXDA 1G2TA 3NBHB 4FXKC 5JPMC 3T56B 2NTSA 2R93B 3L3OC 1SAPA 4DNTB 2B63H 5C44H 4KKUA 5ELBA 2K7VA 4A3DH 1GUNA 1JJ2A 1B53A 3OWFA 2B29A 4EGVA 1BCPC 1UAPA 1IHZA 1DXMA 3CW2C 4X62L 3R2TA 2VB3X 4GS3A 4QB4A 4LF5Q 2BH2A 4FNFA 3I70A 2SDFA 1T9HA 4MN3A 3D6WA 2K04A 2NN6H 3CF5A 4S3SA 4LAAA 1P16A 2QF7A 4R1JA 1XPRA 4V190 1VQDA 4Y7NH 3F2DA 2YU9H 1PTOD 4K8JA 1KRTA 3VYSA 2ATWA 4PMBA 3RLNA 5JJZA 3I56A 4TVAB 5JEAG 3LGJA 3Q23A 1N32Q 3T16A 4RHRA 3MAQA 4ZKBB 1RDPD 4XXEA 3U9OA 2A6ED 3NHHA 2I5HA 4HR7B 1RL2A 4IUPA 3UDXA 3KBXA 4OEMB 1K28A 4F8MA 1EQTA 1N34L 4HMIA 3TP5A 1KLUD 3AU7A 4J15A 2K5QA 1IL8A 1TT2A 1B9NA 1VQKA 4B3MQ 2L0CA 3ULJA 3PIP3 1Z6HA 4GNXC 1HNXL 3R2IA 3CXCA 1UUPA 1VQOA 3PSIA 3J81L 1EY9A 1CKMA 3CD6A 3NSWA 1MGSA 1SSOA 2EY2A 2R92H 1EZ6A 1O78A 1STYA 1X3EA 1LTLA 1B7YB 1A3VA 4KY6A 2EPBA 1L0WA 1PRTF 3OYYA 3UE1A 2JK8A 4L63B 2FMMA 4PZ7A 4HIMA 1E0BA 5J3BA 3CCVA 4A3LH 4YCUA 1SJHD 3D4RA 4DAPA 2KCTA 3WDNA 2K50A 4HTHA 1PH4A 2A1AA 1CUKA 3OPOA 1H95A 4JOIC 1IBKQ 4IFDG 5IYBG 1STBA 4LF9L 5GADC 4DUYQ 2CKZB 2HDLA 1V9PA 3E9HA 4OGQC 1PH6A 4DV0L 1PFBA 3K6OA 4PNYA 5BN3A 2VB2X 1HA6A 4LW1A 1NE3A 3S16B 1JJCB 3GTMH 3HG9A 1TY0A 2OT2A 2GVBA 1EEFD 1X54A 4RHSA 5M9OA 3TP6A 4FP5D 1KNAA 1KRSA 3K5NA 4JV5L 5FLXc 2B2YA 4K2KA 3TN2A 4RWSC 4XYOA 1B4OA 1HJPA 2KUMA 4LF4Q 5K5PA 4BXXH 1SEBD 4LUZA 1ZYRC 3MTSA 2E76C 3HKZB 4XQJA 3Q24A 3K5OA 1AH9A 5IT9c 3HOVG 4EX5A 5K36G 1CA6A 4A3DG 3OTOQ 1PZJD 2R92B 2UUAQ 4CHTB 4DV1L 1PRTB 2BOSA 1YHBA 2NVTH 2I5LX 5AFWA 5FLXL 2VQEQ 2LXJA 4HJ8A 2IY5B 4OO1G 4DV6Q 5HGTA 2F0OA 1RTOA 3LX0A 4IPCA 2FXQA 1S72A 3CKIB 3K58A 1RIPA 1HA5A 1I6VC 1A15A 1RCVD 2B2UA 2DNEA 4CKBA 5A2QL 1FJGL 1TS2A 1AZPA 3A74A 1D1IA 4A3GH 1XTDA 1FNWA 1SYDA 2AHOB 5COYA 1PYBA 4I7ZC 5BN4A 1JWMD 3CRLC 2G9DA 5LL6X 2F3VA 1E2WA 1B3QA 2KENA 4NKLA 1PV4A 2NUCA 4KI0A 2RDHA 4A3FG 1RODA 2J0TD 1DD2A 4DV7L 4B3SL 2YU9B 2B2VC 1T5XD 4YWLA 3HOWB 4JI6L 5M5WB 2F4VQ 4A3BH 3X3MA 4DNIA 4LFAQ 1C48A 1WTXA 3HOWG 3EA6A 4DR4Q 3AFPA 2GN5A 4JG2A 5I2XA 2UXCQ 4IQZA 3PO3H 1SR3A 1JOQA 2F0MA 1A6XA 1U4RA 2K5VA 5FO7B 1PLFA 1N33L 2JA6G 4B3RQ 3MA2B 4ZUJA 2Z0SA 3F2UA 5C44B 4QF4A 3C1FA 2EJGC 4DV2Q 2RVLA 4DR7Q 3L2PA 1S5DD 4R4OA 3URYA 2O5IC 4POGA 1YHQA 1YNNC 3K0XA 1SFOH 1KDAA 5I4DA 3SE0A 1EIYB 2F0WA 5CBAE 1YITA 5IGFA 1SMXA 5EPKA 3S15H 3GV3A 3K5MA 2Y0SE 2K6AA 2PQAA 2N3SA 1IYJB 3A56A 4IO9A 4K2LA 3SHLA 3M4QA 2Z6BA 3S1RH 2E8GA 3KLRA 1OXUA 1DOMA 2VY3A 5FO9B 1EY6A 1N33Q 3C1EA 3HOUB 1PTOF 1SE2A 1UEBA 3I73A 2UUBL 4FYDA 1CHQD 3D4DA 3T1YQ 1SYEA 4KHVA 1UE1A 1WD1A 4L5RC 1HZ9A 1HZBA 1EZ8A 2EY1A 2Z8LA 2EQSA 5M3MH 1M1KC 4LFAL 4GOPC 3F2BA 4MNOA 2A5HA 2MUYA 3A5UA 1JQYD 2F1MA 3TZDA 4LUOA 1U4MA 5GAGC 3S1MH 2SOBA 3OWEB 4A3MG 1SE8A 3H0GH 5A35A 1ZKOA 1TXYA 3AYHB 1LTBD 4NW2A 3FKIG 5IIFA 4UP9A 1V1OA 3TRZA 2ENBA 1QJOA 2PW7A 5C0XJ 5C3EB 1VQ8A 1C8CA 1SMYD 1HNXQ 2EYLA 4YWKA 4R9WA 3VR2A 3JC66 1WTRA 4RA8A 4RKLA 4UAIA 3BS1A 1Y14B 1PTOH 2D2CC 1DGSA 5JJKA 2PZWA 1QZHA 5T1IA 3BG3A 4DR7L 1HPCA 1CZGA 4HJAA 2F0QA 4C3HB 3HOYG 5M3FG 1PFSA 2VQEL 3BYYB 4G7OC 1SBBB 4HN7A 1U4PA 1SNOA 3KLWA 5C0XI 1X56A 4RCOA 4JI2Q 4A3EH 2UUAL 1AE2A 3M4YA 3SK4A 4G57A 1N32L 4LNQA 3U50C 2B2YC 3ZYYX 2F0LA 5KNCA 3J81i 3BVZA 4C3HG 2C35B 2YTYA 1S5ED 1BO0A 1PTOC 3PUZA 2OQ0A 5DM73 1FNUA 1QNKA 3CHBD 4OELB 1Q1EA 3VR5A 3X3NA 2N78A 4B3SQ 4N8FA 1FVIA 2JA7G 1EY7A 1LACA 4DUZQ 2CH4A 5HY6A 1I94Q 3QB3A 1FGUA 3I55A 1V1QA 4AIMA 3GD7A 1I4HA 3H3VH 3MEFA 2E75C 4KK7A 3L7ZC 2AQ1B 2M00A 2QA4A 1QILA 2RBMA 2A19A 2V4DA 3HOUH 1G291 5GROA 4LF6L 2IPKD 4OWWB 1HNZL 1MSHA 1Q46A 4IOCA 4A76A 1KDBA 4P72A 5J22A 4C3JG 1TS5A 3KJPA 5CV4A 4P2CB 3RN5A 4QIWB 1LABA 2LS01 2A8VA 1AW7A 2IHEA 1XPUA 5KIXA 3EROA 1IBML 2ICIA 3RMHA 1KXLA 1Y1WG 3H3VC 4JW0A 3D4WA 3HKZE 3GV6A 4KY5A 4BBSB 3UE0A 3CC4A 1VQPA 1U5KA 2K75A 2JSOA 4B9XA 3NWSA 1EOVA 1YNJD 2K52A 3ULLA 4GNXA 5ELFA 4A3CG 4L6TB 4FF2A 2BCOA 5LMNW 3D6CA 3IKJA 4HEDA 4RG1A 3T4AC 4X3TA 4RFBA 2L5TA 1I5FA 4R4QA 3VYRA 2R93G 1SNPA 3JAMi 4K14A 5CV7A 5LL6S 4DAYA 3H15A 3QG1A 4J8QA 4ZK9B 2EY5A 1I50H 2XN9C 2A73B 4K5WA 4LK1C 2K1BA 1TWCH 1KHIA 2Z4IA 2HCCA 5CGKA 4DF7A 3S1QH 1EIHA 3H91A 1PYWD 1YHAA 2B8FA 1F9SA 2AWNA 1F2LA 1N8RC 3HZXA 1PFMA 3OMGA 1WTWA 4C3JB 4GKKL 1A62A 5IY0A 4LF8Q 4JBJA 4IUQA 5EPJA 4JI8Q 4DPGA 5EBCA 4DUZL 4QL5A 1II3A 1EFWA 3TEHB 4IFDH 1I4QA 5M3FH 1EY0A 1EY5A 4DAVA 2QCPX 4C2MH 3VR6A 3MZ5A 2BDNA 4QCLA 1XPOA 4OX9L 3I7FA 4GN3B 2PYKA 4UHVA 4XT1B 4DR3L 4MHEA 3KF8B 2N49A 3G4SA 2EXZA 2H1EA 4JC0A 1JC7A 3LWEA 2EOTA 2F0TA 3I90A 1E2VA 2EJFC 1SYGA 5IYDH 1SE3A 3N52A 1IYUA 2Q2IA 4DV5L 1WOCA 2WFWA 4JYAQ 1KNEA 1GUGA 1N36L 2JA7H 2QDBA 1OXTA 3K81C 2P5ZX 3I4NG 1UNSA 2MHVA 4JI4L 2M9VA 4LF7L 4BXXG 1K9MC 1SNDA 2EXDA 1XMQQ 4J1MA 3IRBA 4KD4A 2KVMA 1IL2A 4G4KA 3A54A 4DR2Q 1TWAB 2HIXA 5CYUA 2XNAC 3P1HA 4AYBG 4K6LA 2NBFA 2K5WA 3RN2A 2KHSA 3S14B 2PO4A 4AYBE 1HNWQ 2OF1A 2HIVA 5IT9E 2PMZB 2H4OA 3D31A 1I6HB 4JI5Q 3BDLA 1OO9B 4O1NA 2EYMA 4CDCC 4ULLA 2HDMA 2K28A 4Q5VA 1TWCB 1WTQA 4APVA 3RZDB 4A3GG 2QEXA 2ZXRA 3DLLA 4BA1I 5IE8A 4OO1I 4B3TQ 1HXYD 1Q82C 3Q0AA 3CPFA 1YBYA 3GTLB 5M5YB 4GN4B 1BR9A 2Q2UA 5JEAJ 3L9AX 4X3SA 4YWMA 4YY3L 3R93A 4GZYC 2R7ZG 3J7AV 3FVQA 4RGOS 5BN5A 2KECA 1CHPD 4A3BG 3OMCA 3DEPA 3OSOA 2YTVA 3J81c 5GAEC 2JJQA 3M4PA 2O5JC 2HCIA 3PGZA 5ELOA 1KDCA 2E2IH 2UUCL 3CU7A 3O13A 3W5OA 4FXGC 1IW7C 5KGUA 1JT8A 2JA8G 3GTJB 1B44D 4O2DA 2RCNA 3S2DB 5EGTA 4JI3Q 4XQNA 4DK6C 1QUQA 1I6HH 2UXBQ 5C44G 1IBMQ 5DNFA 2PZUA 4EQPA 2E5LQ 2VS1A 3EQLC 3U4ZA 4ZQ3A 4BY7H 4IOAA 1IW7D 3KDFB 2KJXA 5J1ZA 4LFCQ 1HRJA 3MXPA 1STGA 4UP8A 3AEVA 3ERQA 3UI2A 2LXKA 1XYIA 2RKSA 2D0OA 1AZQA 5E1FA 2CCZA 4AH6A 1GVPA 3HGBA 4RGNA 4K5VA 1A2TA 1JE5A 4KHZA 3KUPA 2FFKB 1E3PA 2NN6I 1EFID 1PH8A 4H0LC 2AUKA 2JA8B 4DK0A 1JICA 1NY4A 1VQBA 1EY4A 2ZXPA 4GOPA 2F0PA 1C4QA 4IALA 2O4XA 5C4ZA 4RCNA 2E5LL 4X64Q 5FOBB 3H0GG 2R7ZB 5IT9L 3FP9A 4NB3A 3SEBA 1DCZA 4NP5A 4B08A 2JA9A 4GN5A 4DK3C 4XQQA 4BBSG 2N88A 1L1OC 5M5XH 4IFDJ 1PXUA 3HOYB 4ODGA 3CC2A 3I2ZA 1K83H 1W6KA 2O2LD 5E7NA 2C9OA 1VQLA 2HHHQ 5C5MA 3WOFA 1TWGH 2MP1A 1H9SB 1GUOA 3VA5A 3GTPB 2R7FA 4C1NK 3TBIB 4DR6Q 1TS3A 2PI2A 1LV9A 1N9WA 1I4PA 1DYQA 2IT1A 3H0GB 2A69C 4B9WA 2L9HA 3SK5A 2KHJA 4IZ8A 2WAQB 5FKAC 5IWAL 3CCMA 5LMNQ 4B3RL 4A3KG 2A6HC 2IL8A 2PQAB 1O7ZA 1PH5A 3VYUA 2WIIB 2F3IA 3W3AA 4A3JB 4Y7NB 1F9PA 1WFQA 1X9NA 3SXHA 2XRQD 3U58A 2OEOA 1SLJA 1LTID 2B2TC 4WJ3M 1D8LA 4JI5L 4HJ5A 3QWNA 4L8JA 3KDFA 3S1RB 2PNHA 3HEJA 3OIQA 4K0KL 1D5XC 2E2IB 3PF4A 4WJ4A 1YVCA 2I5MX 1EUJA 3I91A 2BDOA 2B63B 4BWGB 2F03A 2NZ1D 3QIAA 1KTKA 2JA8H 2ZTCA 4XTCS 2WB1G 5KRUA 4R4CA 1Y1VB 1R9TB 1BBUA 1DJRD 1CT1D 1XMQL 3HOZB 5G3LD 2D62A 1L1OB 2ZM6Q 2F0HA 3HP3A 1IBLL 3MEHA 4U68A 1G6ZA 4Y52H 1B50A 2F0JA 1Q81C 4BY7G 5IYBH 2HHHL 4QUFA 1Y69U 1MD2D 1S5CD 4KN4C 1V43A 2UXBL 4LWCA 2TMPA 3C3LA 1GHKA 1CSQA 5D65A 1D1KA 1HR0Q 1RTNA 4IN3A 2K5DA 4I65A 3M3YH 1G51A 4RGMA 3BJUA 1VQ5A 1X3GA 1LM0A 1CQVA 2E74C 5I9OA 3QJYA 4RKBA 3DWQA 1Q3LA 1HQMC 1EQRA 2MPMA 4DUYL 2JEBI 3MHBA 1C7YA 2JN4A 3FRPB 5FLMG 1I4GA 2X6GA 3A0JA 4X64L 1SE4A 3W1BA 3VR4A 3KF6A 1VQCA 3HS0C 3NTKA 3FPPA 4HCEA 2MGSA 4H02A 1DOKA 1H9JA 2WKCA 2E2JH 2F0VA 4JI8L 3FPUB 1ESFA 5M3MB 5EKLA 4GLXA 3I4MB 1XNRQ 1BCPD 4X62Q 3HKZG 1ICWA 3N6RA 1VCIA 1X32A 3M4OH 3CCUA 2ICEC 3CMEA 1J5EQ 1FYCA 1CQFA 1Q8IA 2F0NA 2AWOA 3S17H 4HSPA 1STHA 1OXVA 4OONA 2ZJQA 2FMCA 4JOIA 1KAAA 1LTGD 5DAUA 4TRDA 2NVTB 4ME5A 4QIWE 1IZ6A 5M5YH 3V2TA 3GTLH 2HQLA 1GOZA 2DY7A 3STBD 5IP9H 3S2DH 3PUXA 1N34Q 3NE5B 2DGYA 1WI5A 3GTQB 3Q8DA 3F8TA 4Z9CB 4JBMA 1UE5A 2NB0A 4DV5Q 4QGUA 3AFQA 2I46A 2J4XA 1EU4A 4DN4M 1MIUA 1X3PA 3F2CA 3T53B 3EJIA 1Z47A 4RAUC 1D7QA 2QDLA 3KOJA 4C2MB 1AN8A 2AMCB 3A5ZB 3HRZC 4JBWA 4DR5Q 1B70B 1W3SA 1WTHA 1WTVA 3CMAA 3NXWA 4I7AA 4OX9Q 3A7LA 2JXMB 4A3FH 5KNBA 4DR1L 3S1MB 1PH3A 5C4XB 4POFA 5IGCA 2VZAA 2ZTDA 1X6OA 1KD1C 1WYDA 1KQSA 2EYOA 2D9UA 3U4VA 1HTLD 4LF7Q 1HUMA 1TWHB 1ENFA 2F0SA 1FNVA 3MVVA 4NXNQ 3PO2G 1O80A 3ND9A 1XWEA 1MI2A 5EAYA 4JYAL 4HIKA 1VQJA 2Z6KC 1R4PB 3I72A 1SN8A 2IHFA 5JAVA 3TQYA 3S1QB 3NTIA 1TR5A 4A93G 1YNND 1WCMH 1MHWC 3ERSX 1ICFB 4BBRH 4LF6Q 3DEOA 5NUCA 3SR1A 5I2YA 5DLQE 2B2UC 3EIVA 4C3IB 1QUQB 5IYCH 4X65L 4UPAA 1P8LA 4QQBX 5A2QE 4O42A 1VQAA 2K32A 3NK9A 1BVSA 1XNRL 4CKCA 3FKIH 3K0YA 1JWSD 2EYHA 1YIJA 1QVCA 1TWAH 2RDFA 3T51B 5JJLA 4JPBW 4PG3A 1QCBD 3R3OA 1S4ZA 3PUVA 1PFNA 2EDGA 3CPWA 5M3FB 4A3IB 1CFMA 2B2TA 4DK1A 4PV1C 2LFNA 1BNZA 2PCFB 2SNMA 4XDXA 2E2JB 1X55A 5T1GA 3NPPA 4DR2L 5F2DA 3E6ZX 1V8QA 3A8KE 3GTOB 4YHHQ 1SYCA 1TY2A 3NUCA 2KCMA 2NVXH 3NEMA 1IKLA 3HOZG 1F2ZA 2CHBD 1VQNA 4ZYSA 4IFDI 1F9RA 3WOEA 1GM5A 4BS9A 2F0FA 2DUDA 3J81j 1K8GA 1VQHA 1BUVT 1VQMA 4IUVA 4P71A 2NVYB 2F0GA 1LTTD 1GUSA 1R4QB 1EWCA 4DV4Q 1IXRA 1SDFA 2X69A 3PIOA 2ZM6L 2IX3A 4DV3Q 2B3GA 1X3FA 3EBEA 2KOLA 1KLGD 5IOCA 5DEHA 3ITPA 4IUNA 5C3XA 2Q2TA 1NR4A 4DR3Q 1J9OA 4U673 2ZXOA 1S40A 2K05A 1Q86C 2F0UA 4Q0FA 2SNSA 3AQQA 1EYCA 1QNUA 3JAML 4JI7L 4IURA 1JMCA 1Y1VH 1R9TH 2PI2E 2M2LA 2OTJA 3HOUG 1E2ZA 1EIFA 4XT3B 1VQ7A 3OIPA 4RH6A 1I3QB 3JAME 2YYZA 4A93B 4LFBL 4X66L 4XYQA 5EKIA 5E4WC 4ALPA 1EOTA 4F87A 5J39A 5DM63 4A3EG 3VYTA 1XXGA 3FEWX 2QGQA 4WORA 2BH8A 4QMGA 3EFXD 1VF7A 3Q6SA 1QE6A 2UUBQ 1NBWA 4BY1G 1JE4A 2AUJD 3QOJA 1J5EL 1HR0W 4O0AA 2EYJA 4C56C 1PTOB 1B9MA 1JWUD 4NXML 2EYFA 2JA6B 4A3CH 3H94A 1WTOA 3PO2H 1NMGA 3H6MA 2ZJPA 2WAQE 4K5XA 3LWUA 4ZAIA 2EY6A 1LT6D 1I4XA 2IX1A 1K0RA 4DR1Q 2IJ0A 2N55A 3G6EA 5EPLA 3JAMc 3FHWA 4CDDC 4EQOA 4DAMA 3NENA 1B8AA 3SK6A 2PQEA 1V1PA 2JA5G 1BXTA 2K01A 3RUZA 1Q8KA 1OXSC 5D3DA 1ZEQX 1Y1WH 1LTRD 4R8NA 2RF4A 1BOSA 2F0DA 5CBEE 3J7ZC 3TREA 1K8OA 4N8X1 3IAYA 3CCQA 4M8AA 1YJWA 1HZCA 4RMFA 2ASBA 4KJNA 4OWXB 4A3KH 1HCZA 3UDGA 1W6JA 5LMNL 1CKOA 2CW0C 3UDIA 5C0XH 4CJ0B 1AFPA 4TQUS 1E22A 4KN7C 3HOZH 4G7ZC 4IJHA 3V05A 2R93H 1EQVA 2E2DC 1TWGB 1B3AA 2VL6A 1TU2B 3C2PA 3RD4A 3C46A 4A3JG 1JB3A 1XNQQ 2CW0D 2WAQG 4ZRZA 4PMCA 1Q90A 1L2FA 1JJGA 4A3EB 5IYDG 1Z9FA 2OWOA 4KLKA 3OW2A 3K57A 2K14A 3TP7A 2XIWA 3T1YL 1H9RA 4BY7B 1L0YB 4JI2L 4JI0L 3NTHA 4C3IH 4F88A 2A6EC 2BE5D 3BZDB 4BBRB 1BBXC 1Y1VG 2LY7A 4MZ9A 5C3EH 4JI6Q 1U0LA 1VDZA 3ND8A 2KCCA 3UDFA 5C5LA 3RZOH 3ZJYC 1UEAB 1XNQL 4A3IG 3RLFA 2VNUD 2RHQB 5EKKA 5KNDA 1SNCA 3K7AH 4J6HA 4CJ2C 4TSSA 3NQTA 3H09A 1TS4A 4PMWA 3V96A 2C5CA 1AEXA 2KEDA 5KYLA 2XGTA 3MFGA 4YY3Q 5D3IB 1SFOB 1PVOA 4CGYB 3QOLA 4EQNA 3CCLA 4DNRB 4KHPQ 1XJVA 4JI0Q 5C4JH 3G6JB 1A8VA 1DZ1A 3Q22A 4BY1B 3P75A 2I07B 4HJ7A 1ENAA 3IFTA 4K0KQ 5AJ3L 3S1NH 3GP7A 1X65A 3PIPA 1IBKL 3VR3A 3I4NH 2EYPA 1EQQA 3T1HL 1KIXA 1KC8C 5IP7H 1O7YA 5I9PA 4L5QA 1HQRD 3FKIB 4YCVA 2R7ZH 3MXNA 2VQFL 3RZDH 2D0PA 1JOOA 4X6AH 1J6QA 5AJ3Q 3NBIA 1LTAD 1MJCA 2G5DA 2VUMG 1EYGA 4H7BA 4GNXB 1IKMA 4KHPL 1PH1A 2B39A 1STAA 1HFGA 1CSPA 2QILA 5C4XG 1WVLA 1BKBA 4UP7A 5JOBA 1QWYA 2NN6G 4OWTB 3NWTA 4KKSA 5JPNC 4IJLA 3G7LA 2R92G 3S16H 3A8JE 3TSSA 3DHQA 1NTGA 5FJ8H 4B3ML 1SRUA 1BQQT 1Y8OB 2WB1E 4A3GB 4DAYB 1SXTA 5JJIA 4LFCL 5IODA 4CDFC 3S9WA 3P20A 1S3OA 1TWHH 2L11A 4BA2I 3PO3B 5ELCA 4A3LG 1GKHA 5JEAH 4DV6L 3A55A 4V0BA 3CAMA 1ZYRD 2WP8J 1CZWA 2VXWA 1ASZA 4CDEC 5M5WH 2RHSB 2OTLA 4A3BB 1X3QA 1QVFA 2NVYH 3F1ZA 1VMCA 2XRSD 1F2YA 3A8IE 3GTGH 2OCEA 1QB5D 5CORA 2LKVA 1PH7A 1K8AC 3GTJH 1D5ZC 2WACA 4CKEA 2F4IA 2F4VL 2HD3A 2IWHA 5BR8Q 1BBWA 1LYLA 3I4MG 4ABNA 1BCPB 1A63A 2F0IA 4DFAA 2NZHA 2L12A 4GOPB 2NYZD 3KF6B 5IGEA 4KKTA 4A75A 1TVXA 1VQGA 1LT3D 4YIJA 2GVAA 1SNQA 1YEZA 2I0QA 1STNA 4HIDA 1RD9D 2KCNA 5C4JB 1JOKA 1NCVA 1BCPF 3G48A 3D0FA 4DU9A 2KA7A 1GJXA 2DN8A 1ET9A 1YNXA 2LSSA 1M4VA 1PZID 4NMZA 1GHJA 4JI4Q 4LF9Q 3PQIA 1D6EC 4KTAA 4RGTA 3D8GA 2KBNA 1G6PA 1CKNA 4OXPA 2ID0A 4X3UA 1WCMB 3DWAA 1EWHA 3MXNB 1ASYA 1LLRD 1ILPA 3OTOL 2CFMA 3I4NB 1NMFA 1IYVA 5CV6A 2IW3A 1S5FD 5GAHC 3K5LA 3S14H 2UUCQ 3G71A 3E3XA 4FO2A 4LF4L 4MTKA 2J7ZA 2XWJB 4ID6A 1ENCA 1MKHA 1DM0B 2AKWB 5EQ0A 4DV3L 4IPGA 2VUMB 3M9BA 1FGBD 1E7ZA 1RKNA 1E1TA 1NSNS 3K7AB 3M7NA 4XIGS 4GLAC 1O7LA 3EVQA 2EE1A 4KY7A 3I8ZA 4BBSH 2L55A 4DA2A 4DV0Q 3PUWA 1K83B 1MBYA 1YJNA 4R8IA 4OO1H 1V1PB 3MWYW 4P74A 1F77A 4FF1A 5FJ8G 3CCJA 4LFBQ 3J80c 3TDQA 1YJ9A 3RZOB 5EBDA 1SROA 2DJFC 1GD7A 3HKSA 3GDEA 5IGGA 1HNWL 5G3LF 1NUCA 3BZCA 4C1NI 2PPBC 3HOVB 1SYFA 2Z4HA 4JI1L 3CQZH 2JP1A 1GO3E 1WD0A 2E2HB 3MXUA 3BYTB 1ESRA 3VA7A 5CMDA 3AMUA 4DR5L 1RHPA 3BDCA 5ISRA 4CJ1B 3CCSA 4A4IA 3GTKB 5L37A 2NZOA 2KEEA 1PH2A 3PIO3 4A3KB 1TKWB 4DV4L 4DXGA 1VQ4A 1YNJC 2F0KA 4KV6A 2SEBD 3S2HH 1XTCD 3PO3G 4IPHA 3AB9A 5I6YA 2HT1A 3L0OA 5M3MG 2JA5B 1CI3M 2JA6H 3CQZB 1HNZQ 1PMRA 4DXFA 1Y1WB 2Q2HA 4OHJA 4OIKA 4YHHL 2NVQB 2NTTA 3J81E 4HIOA 4ILWA 2WB1B 2RA4A 1TWFH 3GO5A 5JVG3 1LTSD 1ILQA 5LHY1 5CC4A 2R7DA 4LMQD 3SVMA 2N8NA 1JCKB 1VS0A 2FHTA 1I94L 2F0EA 5GQOA 3BDOA 2EJMA 1BDOA 2MJ8A 2ZT9C 4PZ8A 1AP0A 1LT4D 1PZKD 1NJIC 3DUZA 1XX8A 3KK7A 1A2UA 1YI2A 2B8GA 2BA1A 2MO0A 1OTCA 3I3CA 5D14A 3KYHC 4CBVA 5CV8A 2Z1CA 5ELDA 1FD7D 1VMPA 5FLXE 1LUZA 1CA5A 2K33A 1M90C 3ER0A 5C0XG 4ZKCB 3PF5A 5FLMH 5LMUL 4R4TA 1TWFB 3E5SA 1HR0L 2RDGA 2YV5A 5IGDA 2NVQH 2CH4W 4IPDA 1Z7TA 2LMCB 5ELEA 1PH9A 3KBGA 4HJ9A 2L15A 4A3JH 4A3MH 1H9SA 3BZKA 3PUYA 4NXNL 2A68D 2R3ZA 3J7A5 1E24A 1K0SA 4HAEA 2K5NA 3S2HB 2PNRC 2CWPA 3RLOA 1I3QH 1STEA 2R6GA 2Y0SB 4QUCA 3SGIA 1PA6A 3BVMA 1VQIA 4GKJQ 3LNNA 3S24A 3A7AB 1F9QA 4DV2L 1HTPA 1KL9A 2KHIA 1H9MA 2A68C 1K3BC 5IP9G 4HMJA 1TQOA 3J80i 1LO5D 5C3EG 4A93H 3P7JA 3QR8A 3CP0A 2VQFQ 2X6LA 3MFYA 2UXCL 1WCMG 3OW7A 3HOXH 4BBRG 4A3IH 3HOYH 4ZCKA 3FMCA 4ZUIA 1PYSB 1UE6A 3I4LA 5M5XB 5E4XA 2ES2A 2FJ2A 3FDTA 5JVH3 3DMUA 2AQ3B 1T5EA 1KAWA 2EZVA 4OIJA 1K73C 2UXDQ 1I4RA 1Q12A 4EQ5A 1D2BA 2PZTA 4N9PA 1NNXA 3TP8A 4JBKA 2MFIA 3MC0B
chains in the Genus database with same CATH topology
4KI0A 1PH8A 1HZAA 1L1OA 2VL6A 1OXXK 4A3FG 1FJGQ 2Y0SG 2K5HA 4QY7A 1K3RA 5IP7G 1NY4A 1VQBA 4DV7L 4B3SL 4DR6L 4A3JG 4GOPA 4YWLA 1XNQQ 2WAQG 4JCVE 5BR8L 1L2FA 1QZGA 4MTNA 1WJJA 4JI6L 1UE7A 2F4VQ 5IYDG 4A3BH 1JJGA 4DNIA 4LFAQ 1Z9FA 4DKAC 2OWOA 4ME3A 4X64Q 2E5LL 2VUMH 3HOWG 3H0GG 4DR4Q 4KLKA 3OW2A 3FP9A 4NB3A 2K14A 3AFPA 2GN5A 4JG2A 2UXCQ 2JA9A 3GTOH 2UU9L 4P73A 3T1YL 4C3JH 4GN5A 1SR3A 3PO3H 1Q1BA 4DK3C 5C4XH 5IYCG 4BBSG 1L1OC 5M5XH 2K5VA 4IFDJ 2E2HH 4JI2L 1VQEA 4JI0L 1N33L 2JA6G 4C3IH 2ZTEA 2V1CC 4B3RQ 3RNUA 2Z0SA 1XMOQ 2PMZE 3HOVH 3CC2A 3I2ZA 5ELNA 1K83H 4DV2Q 1Y1VG 4DR7Q 5E7NA 4MZ9A 1VQLA 3L2PA 5C3EH 2HHHQ 1U0LA 4R4OA 3UDFA 4JI6Q 1FL0A 1TWGH 4POGA 3RZOH 4YCWA 3ZJYC 1XNQL 4AQYL 4A3IG 1YHQA 3K0XA 2R7FA 1SFOH 3RLFA 4DR6Q 2VNUD 2RHQB 1IBLQ 2PI2A 1EIYB 1YITA 1N9WA 2IT1A 3K7AH 1SMXA 3VDYA 3S15H 2Y0SE 2PQAA 2MQHA 2N3SA 4PMWA 1IYJB 4IO9A 2KHJA 2XGTA 3M4QA 4YY3Q 3S1RH 1PVOA 2F52A 2E8GA 5IWAL 3CCMA 1OXUA 1XMOL 3CCLA 2VY3A 5LMNQ 4B3RL 4KHPQ 1XJVA 4JI0Q 4A3KG 1N33Q 5C4JH 3NELA 1A8VA 1VQFA 2PQAB 1UEBA 1PH5A 1C9OA 5LMUQ 2UUBL 2F3IA 4HJ7A 4K0KQ 3T1YQ 5AJ3L 1UE1A 3S1NH 4L5RC 1HZ9A 1WFQA 1X9NA 1X65A 3I4MH 1HZBA 3PIPA 1IBKL 3I4NH 4DR4L 3WWVA 2EQSA 4BY1H 5M3MH 1M1KC 1EQQA 3T1HL 4LFAL 4GOPC 3U58A 3F2BA 3T1HQ 4MNOA 1SLJA 5IP7H 1KC8C 1KIXA 1D8LA 3A5UA 4WJ3M 4JI5L 4HJ5A 4L5QA 4LUOA 5GAGC 4YCVA 3KDFA 2R7ZH 2PNHA 2VQFL 3TS0A 3RZDH 2D0PA 1QVGA 4X6AH 3S1MH 5H1SE 1J6QA 5AJ3Q 4A3MG 3GTQH 4K0KL 3K80C 3PF4A 1MJCA 1W2BA 4WJ4A 1YVCA 2VUMG 1SE8A 3HOWH 2I5MX 3H0GH 1EYGA 2MNAA 3STBC 1EUJA 2CQOA 3E0EA 4GNXB 1TXYA 4KHPL 3W1GA 3AYHB 1PH1A 1CSPA 3FKIG 5IWAQ 5C4XG 1HH2P 1BKBA 2JA8H 2B63G 2ZTCA 4UP9A 4XTCS 3TRZA 4UP7A 2NN6G 2WB1G 4OWTB 5C0XJ 1EWIA 4R4CA 3EN2A 2MO1A 4IJLA 1BBUA 1Q7YC 1VQ8A 2UXDL 2R92G 2XTIA 1XMQL 3HOXG 1HNXQ 3S16H 4YWKA 2D62A 1L1OB 1NTGA 5FJ8H 4B3ML 3JC66 3M85A 1SRUA 1YZ6A 4QJFA 2ZM6Q 1IBLL 1Y14B 2WB1E 3CC7A 4DAYB 3K8AA 1DGSA 4AQYQ 4LFCL 5JJKA 5JJIA 4Y52H 3TS2A 1Q81C 1S3OA 4BY7G 1TWHH 4BA2I 5IYBH 1QZHA 2HHHL 4NXMQ 4A3LG 4DR7L 1GKHA 4HJAA 4DV6L 2JE6I 3HOYG 5M3FG 1PFSA 1V43A 2VQEL 4LWCA 3CAMA 2UXBL 3PV0A 1CSQA 1HR0Q 2WP8J 3KLWA 3PCOB 5C0XI 4JI3L 1VQ9A 1X56A 4JI2Q 4DV1Q 1ASZA 3CCEA 3M3YH 5M5WH 4A3EH 2RHSB 1AE2A 1G51A 3BU2A 3BJUA 1VQ5A 2OTLA 2UUAL 1X3GA 4B3TL 1LM0A 3U50C 2NVYH 4LNQA 1QVFA 1N32L 3J81i 3F1ZA 1EQRA 3CCRA 2UU9Q 3B6YA 4DUYL 3GTGH 2JEBI 2OCEA 1C7YA 5FLMG 2C35B 2YTYA 1PH7A 1K8AC 3A0JA 4X64L 3GTJH 3W1BA 3PUZA 2OQ0A 1E1OA 1UWVA 2F4VL 4JI1Q 3KF6A 1VQCA 5BR8Q 1BBWA 1Q1EA 1A0IA 1LYLA 2H5XA 3I4MG 4NPSA 2N78A 1A63A 4B3SQ 4DV7Q 1FVIA 2YTXA 4H02A 2NZHA 2JA7G 4DUZQ 2E2JH 5HY6A 4JI8L 4GOPB 1I94Q 3KF6B 4GLXA 1FGUA 3I55A 4LF8L 1O7IA 1V1QA 4AIMA 3GD7A 1VQGA 2OQKA 4A75A 1XNRQ 3MEFA 4X62Q 5HGQA 1VQ6A 2GVAA 3HKZG 3H3VH 3L7ZC 1YEZA 1VCIA 3K7UC 2CWAA 3KJOA 2I0QA 4PZ6A 3CCUA 3M4OH 4HIDA 4X65Q 3CMEA 2EIFA 2QA4A 1J5EQ 2JA5H 2A19A 2AWOA 3HOUH 3S17H 1G291 2IX0A 5GROA 3G48A 3D0FA 4LF6L 1OXVA 4OWWB 1CKNB 1HNZL 4OONA 1Q46A 2ZJQA 4JOIA 2BA0A 4IOCA 4A76A 1YNXA 3ULPA 2LSSA 4P72A 4JI4Q 3KJPA 3I4OA 1IZ6A 4QIWE 3RN5A 4LF9Q 5M5YH 3GTLH 2HQLA 5IP9H 3S2DH 3STBD 3PUXA 1N34Q 2KBNA 2A8VA 1G6PA 3DM3A 2DGYA 1WI5A 4X66Q 2IHEA 1CKNA 4OXPA 1XPUA 2ID0A 3Q8DA 3F8TA 3GTKH 2ALYB 1IBML 1UE5A 4JBMA 4DV5Q 4QGUA 3AFQA 1Y1WG 1KXLA 2JEAI 1C0AA 3HKZE 3H3VI 1MIUA 3F2CA 3MXNB 1AE3A 1ASYA 3E9IA 3UE0A 1Z47A 1D7QA 3CC4A 1VQPA 1U5KA 2K75A 3OTOL 2CFMA 3KOJA 4JI7Q 1NMFA 2AMCB 3A5ZB 4JBWA 1EOVA 4DR5Q 1B70B 2VW9A 2K52A 4P75A 3ULLA 3ICEA 1W3SA 4GNXA 5GAHC 4A3CG 3S14H 3CMAA 3HFZB 3G71A 5LMNW 2UUCQ 4LF4L 4GLVB 4A3FH 4OX9Q 4FDBA 4DR1L 4L5SA 1PH3A 2K4KA 4RG1A 4POFA 4GKJL 2VZAA 2ZTDA 4R4IA 1MKHA 1I5FA 4R4QA 4C3HH 4JV5Q 1X6OA 2AKWB 1KD1C 1WYDA 1KQSA 3KFUA 3U4VA 4DV3L 4LF7Q 4IPGA 4L5TA 2R93G 3M9BA 3JAMi 1E7ZA 4NXNQ 3PO2G 1E1TA 3H15A 4LF5L 2Z6KA 3M7NA 1PHJA 1N36Q 4GKKQ 5EAYA 1I50H 4XIGS 4JYAL 4LUVA 4GLAC 4HIKA 1VQJA 2Z6KC 3GTPH 1TWCH 4UY8C 1SN8A 1KHIA 2IHFA 4BBSH 2JQOA 3TQYA 2ZJRA 1MJEA 3S1QH 3RR5A 1JB7A 4DV0Q 3NBHB 4A93G 3PUWA 1YHAA 1WCMH 3ERSX 4BBRH 1YJNA 4LF6Q 2B63H 5C44H 5DLQE 3EIVA 1QUQB 5IYCH 4X65L 2AWNA 4A3DH 4UPAA 4P74A 1P8LA 1JJ2A 1N8RC 2B29A 4QQBX 1VQAA 3CW2C 5FJ8G 4X62L 1BVSA 3CCJA 4GKKL 4LFBQ 1XNRL 1A62A 5IY0A 3FKIH 4GS3A 3J80c 4JBJA 4LF5Q 4LF8Q 1YJ9A 2BH2A 1SROA 4JI8Q 4DPGA 1GD7A 1T9HA 3HKSA 3GDEA 1QVCA 1TWAH 3CF5A 4DUZL 1YIJA 1HNWL 4QL5A 3BZCA 1EFWA 5JJLA 4PG3A 3TEHB 1P16A 4R1JA 3PUVA 5M3FH 1XPRA 3CPWA 1VQDA 4JI1L 3CQZH 4Y7NH 1GO3E 4C2MH 3F2DA 2YU9H 1XPOA 4OX9L 3I7FA 4GN3B 1X55A 1KRTA 4DR2L 4DR3L 2ATWA 3KF8B 3RLNA 3I56A 2N49A 4YHHQ 4TVAB 4DR5L 5JEAG 3G4SA 1PV4A 4JC0A 3LGJA 2KCMA 4A4IA 3CCSA 2NVXH 1N32Q 3NEMA 2NZOA 3HOZG 1VQNA 4IFDI 1PH2A 1GM5A 5IYDH 2DUDA 3J81j 4DV4L 1VQ4A 2Q2IA 2I5HA 4DV5L 1RL2A 1K8GA 1VQHA 1WOCA 2WFWA 4JYAQ 1VQMA 3UDXA 3S2HH 1N36L 4P71A 2JA7H 1OXTA 3K81C 4IPHA 3PO3G 1N34L 3I4NG 2HT1A 3L0OA 5M3MG 4DV4Q 4J15A 1IXRA 4JI4L 3PIOA 2ZM6L 1VQKA 2JA6H 4DV3Q 4LF7L 4B3MQ 4BXXG 3ULJA 1K9MC 2B3GA 1HNZQ 1X3FA 3EBEA 2EXDA 4GNXC 1XMQQ 1HNXL 3CXCA 3IRBA 2Q2HA 1VQOA 1IL2A 3PSIA 4YHHL 1CKMA 2Q2TA 3CD6A 4HIOA 4DR3Q 1S40A 4DR2Q 3GO5A 2HIXA 1TWFH 1Q86C 2R92H 4AYBG 2R7DA 1X3EA 1B7YB 1LTLA 3AQQA 2N8NA 3RN2A 1VS0A 1L0WA 4JI7L 3OYYA 1I94L 3UE1A 1JMCA 5GQOA 1Y1VH 1R9TH 2JK8A 4PZ7A 4HIMA 2PI2E 4PZ8A 2OTJA 4AYBE 1HNWQ 3HOUG 5J3BA 2HIVA 3CCVA 1NJIC 4A3LH 1EIFA 4YCUA 1VQ7A 1YI2A 2BA1A 2KCTA 2MO0A 3D31A 1OTCA 4JI5Q 2YYZA 4LFBL 2K50A 3KYHC 4X66L 1PH4A 2A1AA 1CUKA 4ALPA 4A3EG 1H95A 4JOIC 1IBKQ 2QGQA 4IFDG 5IYBG 1LUZA 4LF9L 5GADC 4DUYQ 2CKZB 4APVA 4A3GG 2BH8A 2QEXA 1M90C 3DLLA 3ER0A 4BA1I 1V9PA 5C0XG 5IE8A 3PF5A 2UUBQ 4OO1I 3E9HA 5FLMH 1NBWA 5LMUL 4B3TQ 4R4TA 1Q82C 1PH6A 4BY1G 3CPFA 1YBYA 4DV0L 1J5EL 1HR0L 1HR0W 4O0AA 2YV5A 4GN4B 2NVQH 2Q2UA 4IPDA 5JEAJ 4YWMA 4YY3L 1PH9A 4LW1A 4HJ9A 2R7ZG 1NE3A 2L15A 4A3JH 4NXML 4A3MH 4A3CH 3BZKA 1JJCB 3PUYA 3GTMH 3PO2H 4NXNL 4A3BG 3J7A5 1E24A 1NMGA 2ZJPA 2WAQE 2K5NA 2GVBA 1X54A 2YTVA 2CWPA 3RLOA 3J81c 1KRSA 5GAEC 1I3QH 4JV5L 2R6GA 5FLXc 1PA6A 3SGIA 1VQIA 4GKJQ 2JJQA 2IX1A 3S24A 1K0RA 3M4PA 4DR1Q 1HJPA 4DV2L 4LF4Q 4BXXH 3PGZA 5ELOA 4LUZA 3G6EA 2E2IH 2UUCL 1KL9A 3W5OA 3JAMc 3FHWA 2KHIA 1AH9A 4DAMA 5IT9c 3HOVG 4EX5A 5K36G 3NENA 1JT8A 4A3DG 2JA8G 1B8AA 3OTOQ 5IP9G 3J80i 2UUAQ 4O2DA 2RCNA 4DV1L 2JA5G 5C3EG 4A93H 1YHBA 4JI3Q 2NVTH 2I5LX 3CP0A 2VQFQ 4DK6C 1QUQA 1Q8KA 1WCMG 1OXSC 3HOXH 2UXCL 4BBRG 2LXJA 2VQEQ 4HJ8A 4A3IH 1I6HH 1Y1WH 3HOYH 2UXBQ 2IY5B 5C44G 1IBMQ 4DV6Q 4OO1G 2E5LQ 2RF4A 4IPCA 1PYSB 1UE6A 2VS1A 2FXQA 3U4ZA 3J7ZC 1S72A 2ES2A 4BY7H 4IOAA 1RIPA 3TREA 3KDFB 4LFCQ 3CCQA 4UP8A 3AEVA 1YJWA 1FJGL 2LXKA 1KAWA 1HZCA 2D0OA 4RMFA 2ASBA 3A74A 1K73C 2UXDQ 4OWXB 4A3KH 2CCZA 1Q12A 4AH6A 4EQ5A 1GVPA 5LMNL 3UDGA 1CKOA 4A3GH 1XTDA 3UDIA 1JE5A 4TQUS 2AHOB 4KHZA 1PYBA 1E22A 4JBKA 3HOZH 4IJHA 2R93H 2MFIA 1E3PA 2NN6I 2KENA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KI0 A;  1PH8 A;  1HZA A;  1L1O A;  2VL6 A;  1OXX K;  4A3F G;  1FJG Q;  2Y0S G;  2K5H A;  4QY7 A;  1K3R A;  5IP7 G;  1NY4 A;  1VQB A;  4DV7 L;  4B3S L;  4DR6 L;  4A3J G;  4GOP A;  4YWL A;  1XNQ Q;  2WAQ G;  4JCV E;  5BR8 L;  1L2F A;  1QZG A;  4MTN A;  1WJJ A;  4JI6 L;  1UE7 A;  2F4V Q;  5IYD G;  4A3B H;  1JJG A;  4DNI A;  4LFA Q;  1Z9F A;  4DKA C;  2OWO A;  4ME3 A;  4X64 Q;  2E5L L;  2VUM H;  3HOW G;  3H0G G;  4DR4 Q;  4KLK A;  3OW2 A;  3FP9 A;  4NB3 A;  2K14 A;  3AFP A;  2GN5 A;  4JG2 A;  2UXC Q;  2JA9 A;  3GTO H;  2UU9 L;  4P73 A;  3T1Y L;  4C3J H;  4GN5 A;  1SR3 A;  3PO3 H;  1Q1B A;  4DK3 C;  5C4X H;  5IYC G;  4BBS G;  1L1O C;  5M5X H;  2K5V A;  4IFD J;  2E2H H;  4JI2 L;  1VQE A;  4JI0 L;  1N33 L;  2JA6 G;  4C3I H;  2ZTE A;  2V1C C;  4B3R Q;  3RNU A;  2Z0S A;  1XMO Q;  2PMZ E;  3HOV H;  3CC2 A;  3I2Z A;  5ELN A;  1K83 H;  4DV2 Q;  1Y1V G;  4DR7 Q;  5E7N A;  4MZ9 A;  1VQL A;  3L2P A;  5C3E H;  2HHH Q;  1U0L A;  4R4O A;  3UDF A;  4JI6 Q;  1FL0 A;  1TWG H;  4POG A;  3RZO H;  4YCW A;  3ZJY C;  1XNQ L;  4AQY L;  4A3I G;  1YHQ A;  3K0X A;  2R7F A;  1SFO H;  3RLF A;  4DR6 Q;  2VNU D;  2RHQ B;  1IBL Q;  2PI2 A;  1EIY B;  1YIT A;  1N9W A;  2IT1 A;  3K7A H;  1SMX A;  3VDY A;  3S15 H;  2Y0S E;  2PQA A;  2MQH A;  2N3S A;  4PMW A;  1IYJ B;  4IO9 A;  2KHJ A;  2XGT A;  3M4Q A;  4YY3 Q;  3S1R H;  1PVO A;  2F52 A;  2E8G A;  5IWA L;  3CCM A;  1OXU A;  1XMO L;  3CCL A;  2VY3 A;  5LMN Q;  4B3R L;  4KHP Q;  1XJV A;  4JI0 Q;  4A3K G;  1N33 Q;  5C4J H;  3NEL A;  1A8V A;  1VQF A;  2PQA B;  1UEB A;  1PH5 A;  1C9O A;  5LMU Q;  2UUB L;  2F3I A;  4HJ7 A;  4K0K Q;  3T1Y Q;  5AJ3 L;  1UE1 A;  3S1N H;  4L5R C;  1HZ9 A;  1WFQ A;  1X9N A;  1X65 A;  3I4M H;  1HZB A;  3PIP A;  1IBK L;  3I4N H;  4DR4 L;  3WWV A;  2EQS A;  4BY1 H;  5M3M H;  1M1K C;  1EQQ A;  3T1H L;  4LFA L;  4GOP C;  3U58 A;  3F2B A;  3T1H Q;  4MNO A;  1SLJ A;  5IP7 H;  1KC8 C;  1KIX A;  1D8L A;  3A5U A;  4WJ3 M;  4JI5 L;  4HJ5 A;  4L5Q A;  4LUO A;  5GAG C;  4YCV A;  3KDF A;  2R7Z H;  2PNH A;  2VQF L;  3TS0 A;  3RZD H;  2D0P A;  1QVG A;  4X6A H;  3S1M H;  5H1S E;  1J6Q A;  5AJ3 Q;  4A3M G;  3GTQ H;  4K0K L;  3K80 C;  3PF4 A;  1MJC A;  1W2B A;  4WJ4 A;  1YVC A;  2VUM G;  1SE8 A;  3HOW H;  2I5M X;  3H0G H;  1EYG A;  2MNA A;  3STB C;  1EUJ A;  2CQO A;  3E0E A;  4GNX B;  1TXY A;  4KHP L;  3W1G A;  3AYH B;  1PH1 A;  1CSP A;  3FKI G;  5IWA Q;  5C4X G;  1HH2 P;  1BKB A;  2JA8 H;  2B63 G;  2ZTC A;  4UP9 A;  4XTC S;  3TRZ A;  4UP7 A;  2NN6 G;  2WB1 G;  4OWT B;  5C0X J;  1EWI A;  4R4C A;  3EN2 A;  2MO1 A;  4IJL A;  1BBU A;  1Q7Y C;  1VQ8 A;  2UXD L;  2R92 G;  2XTI A;  1XMQ L;  3HOX G;  1HNX Q;  3S16 H;  4YWK A;  2D62 A;  1L1O B;  1NTG A;  5FJ8 H;  4B3M L;  3JC6 6;  3M85 A;  1SRU A;  1YZ6 A;  4QJF A;  2ZM6 Q;  1IBL L;  1Y14 B;  2WB1 E;  3CC7 A;  4DAY B;  3K8A A;  1DGS A;  4AQY Q;  4LFC L;  5JJK A;  5JJI A;  4Y52 H;  3TS2 A;  1Q81 C;  1S3O A;  4BY7 G;  1TWH H;  4BA2 I;  5IYB H;  1QZH A;  2HHH L;  4NXM Q;  4A3L G;  4DR7 L;  1GKH A;  4HJA A;  4DV6 L;  2JE6 I;  3HOY G;  5M3F G;  1PFS A;  1V43 A;  2VQE L;  4LWC A;  3CAM A;  2UXB L;  3PV0 A;  1CSQ A;  1HR0 Q;  2WP8 J;  3KLW A;  3PCO B;  5C0X I;  4JI3 L;  1VQ9 A;  1X56 A;  4JI2 Q;  4DV1 Q;  1ASZ A;  3CCE A;  3M3Y H;  5M5W H;  4A3E H;  2RHS B;  1AE2 A;  1G51 A;  3BU2 A;  3BJU A;  1VQ5 A;  2OTL A;  2UUA L;  1X3G A;  4B3T L;  1LM0 A;  3U50 C;  2NVY H;  4LNQ A;  1QVF A;  1N32 L;  3J81 i;  3F1Z A;  1EQR A;  3CCR A;  2UU9 Q;  3B6Y A;  4DUY L;  3GTG H;  2JEB I;  2OCE A;  1C7Y A;  5FLM G;  2C35 B;  2YTY A;  1PH7 A;  1K8A C;  3A0J A;  4X64 L;  3GTJ H;  3W1B A;  3PUZ A;  2OQ0 A;  1E1O A;  1UWV A;  2F4V L;  4JI1 Q;  3KF6 A;  1VQC A;  5BR8 Q;  1BBW A;  1Q1E A;  1A0I A;  1LYL A;  2H5X A;  3I4M G;  4NPS A;  2N78 A;  1A63 A;  4B3S Q;  4DV7 Q;  1FVI A;  2YTX A;  4H02 A;  2NZH A;  2JA7 G;  4DUZ Q;  2E2J H;  5HY6 A;  4JI8 L;  4GOP B;  1I94 Q;  3KF6 B;  4GLX A;  1FGU A;  3I55 A;  4LF8 L;  1O7I A;  1V1Q A;  4AIM A;  3GD7 A;  1VQG A;  2OQK A;  4A75 A;  1XNR Q;  3MEF A;  4X62 Q;  5HGQ A;  1VQ6 A;  2GVA A;  3HKZ G;  3H3V H;  3L7Z C;  1YEZ A;  1VCI A;  3K7U C;  2CWA A;  3KJO A;  2I0Q A;  4PZ6 A;  3CCU A;  3M4O H;  4HID A;  4X65 Q;  3CME A;  2EIF A;  2QA4 A;  1J5E Q;  2JA5 H;  2A19 A;  2AWO A;  3HOU H;  3S17 H;  1G29 1;  2IX0 A;  5GRO A;  3G48 A;  3D0F A;  4LF6 L;  1OXV A;  4OWW B;  1CKN B;  1HNZ L;  4OON A;  1Q46 A;  2ZJQ A;  4JOI A;  2BA0 A;  4IOC A;  4A76 A;  1YNX A;  3ULP A;  2LSS A;  4P72 A;  4JI4 Q;  3KJP A;  3I4O A;  1IZ6 A;  4QIW E;  3RN5 A;  4LF9 Q;  5M5Y H;  3GTL H;  2HQL A;  5IP9 H;  3S2D H;  3STB D;  3PUX A;  1N34 Q;  2KBN A;  2A8V A;  1G6P A;  3DM3 A;  2DGY A;  1WI5 A;  4X66 Q;  2IHE A;  1CKN A;  4OXP A;  1XPU A;  2ID0 A;  3Q8D A;  3F8T A;  3GTK H;  2ALY B;  1IBM L;  1UE5 A;  4JBM A;  4DV5 Q;  4QGU A;  3AFQ A;  1Y1W G;  1KXL A;  2JEA I;  1C0A A;  3HKZ E;  3H3V I;  1MIU A;  3F2C A;  3MXN B;  1AE3 A;  1ASY A;  3E9I A;  3UE0 A;  1Z47 A;  1D7Q A;  3CC4 A;  1VQP A;  1U5K A;  2K75 A;  3OTO L;  2CFM A;  3KOJ A;  4JI7 Q;  1NMF A;  2AMC B;  3A5Z B;  4JBW A;  1EOV A;  4DR5 Q;  1B70 B;  2VW9 A;  2K52 A;  4P75 A;  3ULL A;  3ICE A;  1W3S A;  4GNX A;  5GAH C;  4A3C G;  3S14 H;  3CMA A;  3HFZ B;  3G71 A;  5LMN W;  2UUC Q;  4LF4 L;  4GLV B;  4A3F H;  4OX9 Q;  4FDB A;  4DR1 L;  4L5S A;  1PH3 A;  2K4K A;  4RG1 A;  4POF A;  4GKJ L;  2VZA A;  2ZTD A;  4R4I A;  1MKH A;  1I5F A;  4R4Q A;  4C3H H;  4JV5 Q;  1X6O A;  2AKW B;  1KD1 C;  1WYD A;  1KQS A;  3KFU A;  3U4V A;  4DV3 L;  4LF7 Q;  4IPG A;  4L5T A;  2R93 G;  3M9B A;  3JAM i;  1E7Z A;  4NXN Q;  3PO2 G;  1E1T A;  3H15 A;  4LF5 L;  2Z6K A;  3M7N A;  1PHJ A;  1N36 Q;  4GKK Q;  5EAY A;  1I50 H;  4XIG S;  4JYA L;  4LUV A;  4GLA C;  4HIK A;  1VQJ A;  2Z6K C;  3GTP H;  1TWC H;  4UY8 C;  1SN8 A;  1KHI A;  2IHF A;  4BBS H;  2JQO A;  3TQY A;  2ZJR A;  1MJE A;  3S1Q H;  3RR5 A;  1JB7 A;  4DV0 Q;  3NBH B;  4A93 G;  3PUW A;  1YHA A;  1WCM H;  3ERS X;  4BBR H;  1YJN A;  4LF6 Q;  2B63 H;  5C44 H;  5DLQ E;  3EIV A;  1QUQ B;  5IYC H;  4X65 L;  2AWN A;  4A3D H;  4UPA A;  4P74 A;  1P8L A;  1JJ2 A;  1N8R C;  2B29 A;  4QQB X;  1VQA A;  3CW2 C;  5FJ8 G;  4X62 L;  1BVS A;  3CCJ A;  4GKK L;  4LFB Q;  1XNR L;  1A62 A;  5IY0 A;  3FKI H;  4GS3 A;  3J80 c;  4JBJ A;  4LF5 Q;  4LF8 Q;  1YJ9 A;  2BH2 A;  1SRO A;  4JI8 Q;  4DPG A;  1GD7 A;  1T9H A;  3HKS A;  3GDE A;  1QVC A;  1TWA H;  3CF5 A;  4DUZ L;  1YIJ A;  1HNW L;  4QL5 A;  3BZC A;  1EFW A;  5JJL A;  4PG3 A;  3TEH B;  1P16 A;  4R1J A;  3PUV A;  5M3F H;  1XPR A;  3CPW A;  1VQD A;  4JI1 L;  3CQZ H;  4Y7N H;  1GO3 E;  4C2M H;  3F2D A;  2YU9 H;  1XPO A;  4OX9 L;  3I7F A;  4GN3 B;  1X55 A;  1KRT A;  4DR2 L;  4DR3 L;  2ATW A;  3KF8 B;  3RLN A;  3I56 A;  2N49 A;  4YHH Q;  4TVA B;  4DR5 L;  5JEA G;  3G4S A;  1PV4 A;  4JC0 A;  3LGJ A;  2KCM A;  4A4I A;  3CCS A;  2NVX H;  1N32 Q;  3NEM A;  2NZO A;  3HOZ G;  1VQN A;  4IFD I;  1PH2 A;  1GM5 A;  5IYD H;  2DUD A;  3J81 j;  4DV4 L;  1VQ4 A;  2Q2I A;  2I5H A;  4DV5 L;  1RL2 A;  1K8G A;  1VQH A;  1WOC A;  2WFW A;  4JYA Q;  1VQM A;  3UDX A;  3S2H H;  1N36 L;  4P71 A;  2JA7 H;  1OXT A;  3K81 C;  4IPH A;  3PO3 G;  1N34 L;  3I4N G;  2HT1 A;  3L0O A;  5M3M G;  4DV4 Q;  4J15 A;  1IXR A;  4JI4 L;  3PIO A;  2ZM6 L;  1VQK A;  2JA6 H;  4DV3 Q;  4LF7 L;  4B3M Q;  4BXX G;  3ULJ A;  1K9M C;  2B3G A;  1HNZ Q;  1X3F A;  3EBE A;  2EXD A;  4GNX C;  1XMQ Q;  1HNX L;  3CXC A;  3IRB A;  2Q2H A;  1VQO A;  1IL2 A;  3PSI A;  4YHH L;  1CKM A;  2Q2T A;  3CD6 A;  4HIO A;  4DR3 Q;  1S40 A;  4DR2 Q;  3GO5 A;  2HIX A;  1TWF H;  1Q86 C;  2R92 H;  4AYB G;  2R7D A;  1X3E A;  1B7Y B;  1LTL A;  3AQQ A;  2N8N A;  3RN2 A;  1VS0 A;  1L0W A;  4JI7 L;  3OYY A;  1I94 L;  3UE1 A;  1JMC A;  5GQO A;  1Y1V H;  1R9T H;  2JK8 A;  4PZ7 A;  4HIM A;  2PI2 E;  4PZ8 A;  2OTJ A;  4AYB E;  1HNW Q;  3HOU G;  5J3B A;  2HIV A;  3CCV A;  1NJI C;  4A3L H;  1EIF A;  4YCU A;  1VQ7 A;  1YI2 A;  2BA1 A;  2KCT A;  2MO0 A;  3D31 A;  1OTC A;  4JI5 Q;  2YYZ A;  4LFB L;  2K50 A;  3KYH C;  4X66 L;  1PH4 A;  2A1A A;  1CUK A;  4ALP A;  4A3E G;  1H95 A;  4JOI C;  1IBK Q;  2QGQ A;  4IFD G;  5IYB G;  1LUZ A;  4LF9 L;  5GAD C;  4DUY Q;  2CKZ B;  4APV A;  4A3G G;  2BH8 A;  2QEX A;  1M90 C;  3DLL A;  3ER0 A;  4BA1 I;  1V9P A;  5C0X G;  5IE8 A;  3PF5 A;  2UUB Q;  4OO1 I;  3E9H A;  5FLM H;  1NBW A;  5LMU L;  4B3T Q;  4R4T A;  1Q82 C;  1PH6 A;  4BY1 G;  3CPF A;  1YBY A;  4DV0 L;  1J5E L;  1HR0 L;  1HR0 W;  4O0A A;  2YV5 A;  4GN4 B;  2NVQ H;  2Q2U A;  4IPD A;  5JEA J;  4YWM A;  4YY3 L;  1PH9 A;  4LW1 A;  4HJ9 A;  2R7Z G;  1NE3 A;  2L15 A;  4A3J H;  4NXM L;  4A3M H;  4A3C H;  3BZK A;  1JJC B;  3PUY A;  3GTM H;  3PO2 H;  4NXN L;  4A3B G;  3J7A 5;  1E24 A;  1NMG A;  2ZJP A;  2WAQ E;  2K5N A;  2GVB A;  1X54 A;  2YTV A;  2CWP A;  3RLO A;  3J81 c;  1KRS A;  5GAE C;  1I3Q H;  4JV5 L;  2R6G A;  5FLX c;  1PA6 A;  3SGI A;  1VQI A;  4GKJ Q;  2JJQ A;  2IX1 A;  3S24 A;  1K0R A;  3M4P A;  4DR1 Q;  1HJP A;  4DV2 L;  4LF4 Q;  4BXX H;  3PGZ A;  5ELO A;  4LUZ A;  3G6E A;  2E2I H;  2UUC L;  1KL9 A;  3W5O A;  3JAM c;  3FHW A;  2KHI A;  1AH9 A;  4DAM A;  5IT9 c;  3HOV G;  4EX5 A;  5K36 G;  3NEN A;  1JT8 A;  4A3D G;  2JA8 G;  1B8A A;  3OTO Q;  5IP9 G;  3J80 i;  2UUA Q;  4O2D A;  2RCN A;  4DV1 L;  2JA5 G;  5C3E G;  4A93 H;  1YHB A;  4JI3 Q;  2NVT H;  2I5L X;  3CP0 A;  2VQF Q;  4DK6 C;  1QUQ A;  1Q8K A;  1WCM G;  1OXS C;  3HOX H;  2UXC L;  4BBR G;  2LXJ A;  2VQE Q;  4HJ8 A;  4A3I H;  1I6H H;  1Y1W H;  3HOY H;  2UXB Q;  2IY5 B;  5C44 G;  1IBM Q;  4DV6 Q;  4OO1 G;  2E5L Q;  2RF4 A;  4IPC A;  1PYS B;  1UE6 A;  2VS1 A;  2FXQ A;  3U4Z A;  3J7Z C;  1S72 A;  2ES2 A;  4BY7 H;  4IOA A;  1RIP A;  3TRE A;  3KDF B;  4LFC Q;  3CCQ A;  4UP8 A;  3AEV A;  1YJW A;  1FJG L;  2LXK A;  1KAW A;  1HZC A;  2D0O A;  4RMF A;  2ASB A;  3A74 A;  1K73 C;  2UXD Q;  4OWX B;  4A3K H;  2CCZ A;  1Q12 A;  4AH6 A;  4EQ5 A;  1GVP A;  5LMN L;  3UDG A;  1CKO A;  4A3G H;  1XTD A;  3UDI A;  1JE5 A;  4TQU S;  2AHO B;  4KHZ A;  1PYB A;  1E22 A;  4JBK A;  3HOZ H;  4IJH A;  2R93 H;  2MFI A;  1E3P A;  2NN6 I;  2KEN A; 
#chains in the Genus database with same CATH topology
 1HZA A;  1L1O A;  1OXX K;  3QO2 A;  4E6I A;  2Y0S G;  2K5H A;  4QY7 A;  1FJG Q;  1K3R A;  3TME A;  5IP7 G;  4DR6 L;  2HUG A;  1DOL A;  4JCV E;  5BR8 L;  1QZG A;  4MTN A;  1WJJ A;  1UE7 A;  4K8I A;  4DGZ A;  4DKA C;  4ME3 A;  2GA4 B;  2VUM H;  3ONA B;  1S5B D;  5EJW A;  3BVG A;  3GTO H;  2UU9 L;  1H9K A;  4P73 A;  4C3J H;  4M1U B;  1Q1B A;  5C4X H;  5IYC G;  2PW5 A;  1G2S A;  2QKI C;  2E2H H;  1VQE A;  2ZTE A;  2V1C C;  3RNU A;  1XMO Q;  2PMZ E;  3HOV H;  5K36 H;  4AYB B;  2DJG C;  2XSC A;  2F3W A;  5ELN A;  2CVR A;  4OL7 A;  2L4N A;  4FF4 A;  1NAP A;  3NQI A;  4UDU C;  1FL0 A;  4YCW A;  5HUR A;  3D3R A;  2JA7 B;  4HCS A;  4AQY L;  1U4L A;  1ET6 A;  4KMU C;  4ZLT F;  4H44 C;  2DY8 A;  1EYA A;  1I50 B;  1IBL Q;  1JR0 D;  2CQA A;  3T13 A;  1ONL A;  3VDY A;  3S15 B;  2B2W C;  1Y8P B;  2HQE A;  2MQH A;  2K03 A;  2NVX B;  1RJT A;  2WKD A;  1F2M A;  1ML0 D;  3DXJ C;  2F52 A;  2DNC A;  1XMO L;  2Q8I B;  4F7X A;  3NEL A;  1VQF A;  4A3F B;  3SK8 A;  1C9O A;  5LMU Q;  2QW7 A;  3GTM B;  4MIU A;  5TSS A;  2QEJ C;  1GUW A;  1EEI D;  3U9S A;  3HOX B;  1HUN A;  3I4M H;  1VF5 C;  1A3T A;  2L1B A;  2NWG A;  4DR4 L;  3WWV A;  4BY1 H;  2B2V A;  3T1H Q;  1G91 A;  2WIN B;  3TS0 A;  1QVG A;  1HFN A;  5H1S E;  3GTQ H;  3K80 C;  3KLS X;  1W2B A;  1B2T A;  3HOW H;  1A3U A;  3J7Y W;  2MNA A;  3STB C;  1TII D;  2CQO A;  3E0E A;  3W1G A;  3K59 A;  5IWA Q;  1HH2 P;  2RSN A;  2B63 G;  4WFN 3;  5CV5 A;  4WJW A;  1EWI A;  3M3Y B;  1U9R A;  2XVS A;  2MO1 A;  3EN2 A;  3IFD A;  1EU3 A;  1Q7Y C;  2UXD L;  3TZU A;  2XTI A;  3J7A F;  3HOX G;  4A3M B;  1EL0 A;  3M85 A;  4NDX A;  1YZ6 A;  4QJF A;  3CC7 A;  1BF4 A;  1RF2 D;  3K8A A;  4AQY Q;  4EVO A;  3TS2 A;  4K6D A;  4FF3 A;  5E3F A;  3E0J A;  4NXM Q;  5FK9 C;  4IUT A;  2RSO A;  2JE6 I;  4WRD A;  2Q8T A;  3PV0 A;  3KF8 A;  2OXP A;  3NBH A;  1VQ9 A;  3PCO B;  4JI3 L;  4DV1 Q;  4IUU A;  3CCE A;  4B3T L;  1M8A A;  3BU2 A;  4JK1 C;  1NR2 A;  4H13 C;  3R8B A;  3CCR A;  2UU9 Q;  3B6Y A;  4FVM A;  2B2W A;  5CV9 A;  1L0X B;  3OHX C;  1CTM A;  1EIG A;  1E1O A;  1UWV A;  4JI1 Q;  2Z9H A;  3MXG A;  1A0I A;  2H5X A;  4NPS A;  3IL8 A;  2A6H D;  1Y8N B;  2YTX A;  5FO8 B;  3DM1 A;  3GQB A;  3J80 L;  4DV7 Q;  4G7H C;  1LT5 D;  2RCF A;  4KD3 A;  1KAB A;  2D5D A;  1GUT A;  4LF8 L;  3GTG B;  1O7I A;  2OQK A;  4HSV A;  1VQ6 A;  5HGQ A;  1G8Z D;  1FR3 A;  5KYI A;  3S1N B;  1QG7 A;  2WV6 D;  2KQ3 A;  3K7U C;  3J80 E;  2CWA A;  1JOR A;  2JYO A;  3KJO A;  3S17 B;  3NP8 A;  4PZ6 A;  2EVB A;  4X65 Q;  2EIF A;  2JA5 H;  1PDQ A;  3M4O B;  2IX0 A;  1MSG A;  1SYB A;  1PRT C;  2AQ2 B;  1CKN B;  1SMY C;  2BA0 A;  1J8I A;  3OOC A;  3ULP A;  3I4O A;  5I6W A;  3DWP A;  4A3D B;  3PMF A;  1DON A;  3DM3 A;  4X66 Q;  4C3I G;  4TKO B;  3GTK H;  2ALY B;  1CM9 A;  1WTP A;  2JEA I;  1C0A A;  3H3V I;  4N9T A;  1B1Z A;  1AE3 A;  3E9I A;  5C4H A;  2A74 C;  2FIN B;  1SJE D;  2RQX A;  4JI7 Q;  5C3W A;  4X3K A;  5KEE A;  2VW9 A;  4P75 A;  3ICE A;  3HFZ B;  3PO2 B;  4JVZ A;  1K8M A;  4GLV B;  1EY8 A;  4FDB A;  2XWB B;  4L5S A;  2K4K A;  4GKJ L;  2Q8R E;  4R4I A;  5IGB A;  3SDZ A;  1D5M C;  1PRT D;  3M7G A;  4C3H H;  4JV5 Q;  5C6A A;  1EYD A;  3KLS A;  3KFU A;  4L5T A;  3CRK C;  1QOH A;  1SNM A;  2TSS A;  3W2D A;  4LF5 L;  2Z6K A;  2R61 A;  5CR3 A;  1PHJ A;  1N36 Q;  4GKK Q;  2A69 D;  2BE5 C;  4LUV A;  1HHV A;  1GXD C;  4KJO A;  3GTP H;  4LJZ C;  2G9H D;  4PQX A;  4UY8 C;  1CK1 A;  2JQO A;  2ZJR A;  1MJE A;  3RR5 A;  1ZXT A;  1JB7 A;  4FXD A;  1G2T A;  3NBH B;  4FXK C;  5JPM C;  3T56 B;  2NTS A;  2R93 B;  3L3O C;  1SAP A;  4DNT B;  2B63 H;  5C44 H;  4KKU A;  5ELB A;  2K7V A;  4A3D H;  1GUN A;  1JJ2 A;  1B53 A;  3OWF A;  2B29 A;  4EGV A;  1BCP C;  1UAP A;  1IHZ A;  1DXM A;  3CW2 C;  4X62 L;  3R2T A;  2VB3 X;  4GS3 A;  4QB4 A;  4LF5 Q;  2BH2 A;  4FNF A;  3I70 A;  2SDF A;  1T9H A;  4MN3 A;  3D6W A;  2K04 A;  2NN6 H;  3CF5 A;  4S3S A;  4LAA A;  1P16 A;  2QF7 A;  4R1J A;  1XPR A;  4V19 0;  1VQD A;  4Y7N H;  3F2D A;  2YU9 H;  1PTO D;  4K8J A;  1KRT A;  3VYS A;  2ATW A;  4PMB A;  3RLN A;  5JJZ A;  3I56 A;  4TVA B;  5JEA G;  3LGJ A;  3Q23 A;  1N32 Q;  3T16 A;  4RHR A;  3MAQ A;  4ZKB B;  1RDP D;  4XXE A;  3U9O A;  2A6E D;  3NHH A;  2I5H A;  4HR7 B;  1RL2 A;  4IUP A;  3UDX A;  3KBX A;  4OEM B;  1K28 A;  4F8M A;  1EQT A;  1N34 L;  4HMI A;  3TP5 A;  1KLU D;  3AU7 A;  4J15 A;  2K5Q A;  1IL8 A;  1TT2 A;  1B9N A;  1VQK A;  4B3M Q;  2L0C A;  3ULJ A;  3PIP 3;  1Z6H A;  4GNX C;  1HNX L;  3R2I A;  3CXC A;  1UUP A;  1VQO A;  3PSI A;  3J81 L;  1EY9 A;  1CKM A;  3CD6 A;  3NSW A;  1MGS A;  1SSO A;  2EY2 A;  2R92 H;  1EZ6 A;  1O78 A;  1STY A;  1X3E A;  1LTL A;  1B7Y B;  1A3V A;  4KY6 A;  2EPB A;  1L0W A;  1PRT F;  3OYY A;  3UE1 A;  2JK8 A;  4L63 B;  2FMM A;  4PZ7 A;  4HIM A;  1E0B A;  5J3B A;  3CCV A;  4A3L H;  4YCU A;  1SJH D;  3D4R A;  4DAP A;  2KCT A;  3WDN A;  2K50 A;  4HTH A;  1PH4 A;  2A1A A;  1CUK A;  3OPO A;  1H95 A;  4JOI C;  1IBK Q;  4IFD G;  5IYB G;  1STB A;  4LF9 L;  5GAD C;  4DUY Q;  2CKZ B;  2HDL A;  1V9P A;  3E9H A;  4OGQ C;  1PH6 A;  4DV0 L;  1PFB A;  3K6O A;  4PNY A;  5BN3 A;  2VB2 X;  1HA6 A;  4LW1 A;  1NE3 A;  3S16 B;  1JJC B;  3GTM H;  3HG9 A;  1TY0 A;  2OT2 A;  2GVB A;  1EEF D;  1X54 A;  4RHS A;  5M9O A;  3TP6 A;  4FP5 D;  1KNA A;  1KRS A;  3K5N A;  4JV5 L;  5FLX c;  2B2Y A;  4K2K A;  3TN2 A;  4RWS C;  4XYO A;  1B4O A;  1HJP A;  2KUM A;  4LF4 Q;  5K5P A;  4BXX H;  1SEB D;  4LUZ A;  1ZYR C;  3MTS A;  2E76 C;  3HKZ B;  4XQJ A;  3Q24 A;  3K5O A;  1AH9 A;  5IT9 c;  3HOV G;  4EX5 A;  5K36 G;  1CA6 A;  4A3D G;  3OTO Q;  1PZJ D;  2R92 B;  2UUA Q;  4CHT B;  4DV1 L;  1PRT B;  2BOS A;  1YHB A;  2NVT H;  2I5L X;  5AFW A;  5FLX L;  2VQE Q;  2LXJ A;  4HJ8 A;  2IY5 B;  4OO1 G;  4DV6 Q;  5HGT A;  2F0O A;  1RTO A;  3LX0 A;  4IPC A;  2FXQ A;  1S72 A;  3CKI B;  3K58 A;  1RIP A;  1HA5 A;  1I6V C;  1A15 A;  1RCV D;  2B2U A;  2DNE A;  4CKB A;  5A2Q L;  1FJG L;  1TS2 A;  1AZP A;  3A74 A;  1D1I A;  4A3G H;  1XTD A;  1FNW A;  1SYD A;  2AHO B;  5COY A;  1PYB A;  4I7Z C;  5BN4 A;  1JWM D;  3CRL C;  2G9D A;  5LL6 X;  2F3V A;  1E2W A;  1B3Q A;  2KEN A;  4NKL A;  1PV4 A;  2NUC A;  4KI0 A;  2RDH A;  4A3F G;  1ROD A;  2J0T D;  1DD2 A;  4DV7 L;  4B3S L;  2YU9 B;  2B2V C;  1T5X D;  4YWL A;  3HOW B;  4JI6 L;  5M5W B;  2F4V Q;  4A3B H;  3X3M A;  4DNI A;  4LFA Q;  1C48 A;  1WTX A;  3HOW G;  3EA6 A;  4DR4 Q;  3AFP A;  2GN5 A;  4JG2 A;  5I2X A;  2UXC Q;  4IQZ A;  3PO3 H;  1SR3 A;  1JOQ A;  2F0M A;  1A6X A;  1U4R A;  2K5V A;  5FO7 B;  1PLF A;  1N33 L;  2JA6 G;  4B3R Q;  3MA2 B;  4ZUJ A;  2Z0S A;  3F2U A;  5C44 B;  4QF4 A;  3C1F A;  2EJG C;  4DV2 Q;  2RVL A;  4DR7 Q;  3L2P A;  1S5D D;  4R4O A;  3URY A;  2O5I C;  4POG A;  1YHQ A;  1YNN C;  3K0X A;  1SFO H;  1KDA A;  5I4D A;  3SE0 A;  1EIY B;  2F0W A;  5CBA E;  1YIT A;  5IGF A;  1SMX A;  5EPK A;  3S15 H;  3GV3 A;  3K5M A;  2Y0S E;  2K6A A;  2PQA A;  2N3S A;  1IYJ B;  3A56 A;  4IO9 A;  4K2L A;  3SHL A;  3M4Q A;  2Z6B A;  3S1R H;  2E8G A;  3KLR A;  1OXU A;  1DOM A;  2VY3 A;  5FO9 B;  1EY6 A;  1N33 Q;  3C1E A;  3HOU B;  1PTO F;  1SE2 A;  1UEB A;  3I73 A;  2UUB L;  4FYD A;  1CHQ D;  3D4D A;  3T1Y Q;  1SYE A;  4KHV A;  1UE1 A;  1WD1 A;  4L5R C;  1HZ9 A;  1HZB A;  1EZ8 A;  2EY1 A;  2Z8L A;  2EQS A;  5M3M H;  1M1K C;  4LFA L;  4GOP C;  3F2B A;  4MNO A;  2A5H A;  2MUY A;  3A5U A;  1JQY D;  2F1M A;  3TZD A;  4LUO A;  1U4M A;  5GAG C;  3S1M H;  2SOB A;  3OWE B;  4A3M G;  1SE8 A;  3H0G H;  5A35 A;  1ZKO A;  1TXY A;  3AYH B;  1LTB D;  4NW2 A;  3FKI G;  5IIF A;  4UP9 A;  1V1O A;  3TRZ A;  2ENB A;  1QJO A;  2PW7 A;  5C0X J;  5C3E B;  1VQ8 A;  1C8C A;  1SMY D;  1HNX Q;  2EYL A;  4YWK A;  4R9W A;  3VR2 A;  3JC6 6;  1WTR A;  4RA8 A;  4RKL A;  4UAI A;  3BS1 A;  1Y14 B;  1PTO H;  2D2C C;  1DGS A;  5JJK A;  2PZW A;  1QZH A;  5T1I A;  3BG3 A;  4DR7 L;  1HPC A;  1CZG A;  4HJA A;  2F0Q A;  4C3H B;  3HOY G;  5M3F G;  1PFS A;  2VQE L;  3BYY B;  4G7O C;  1SBB B;  4HN7 A;  1U4P A;  1SNO A;  3KLW A;  5C0X I;  1X56 A;  4RCO A;  4JI2 Q;  4A3E H;  2UUA L;  1AE2 A;  3M4Y A;  3SK4 A;  4G57 A;  1N32 L;  4LNQ A;  3U50 C;  2B2Y C;  3ZYY X;  2F0L A;  5KNC A;  3J81 i;  3BVZ A;  4C3H G;  2C35 B;  2YTY A;  1S5E D;  1BO0 A;  1PTO C;  3PUZ A;  2OQ0 A;  5DM7 3;  1FNU A;  1QNK A;  3CHB D;  4OEL B;  1Q1E A;  3VR5 A;  3X3N A;  2N78 A;  4B3S Q;  4N8F A;  1FVI A;  2JA7 G;  1EY7 A;  1LAC A;  4DUZ Q;  2CH4 A;  5HY6 A;  1I94 Q;  3QB3 A;  1FGU A;  3I55 A;  1V1Q A;  4AIM A;  3GD7 A;  1I4H A;  3H3V H;  3MEF A;  2E75 C;  4KK7 A;  3L7Z C;  2AQ1 B;  2M00 A;  2QA4 A;  1QIL A;  2RBM A;  2A19 A;  2V4D A;  3HOU H;  1G29 1;  5GRO A;  4LF6 L;  2IPK D;  4OWW B;  1HNZ L;  1MSH A;  1Q46 A;  4IOC A;  4A76 A;  1KDB A;  4P72 A;  5J22 A;  4C3J G;  1TS5 A;  3KJP A;  5CV4 A;  4P2C B;  3RN5 A;  4QIW B;  1LAB A;  2LS0 1;  2A8V A;  1AW7 A;  2IHE A;  1XPU A;  5KIX A;  3ERO A;  1IBM L;  2ICI A;  3RMH A;  1KXL A;  1Y1W G;  3H3V C;  4JW0 A;  3D4W A;  3HKZ E;  3GV6 A;  4KY5 A;  4BBS B;  3UE0 A;  3CC4 A;  1VQP A;  1U5K A;  2K75 A;  2JSO A;  4B9X A;  3NWS A;  1EOV A;  1YNJ D;  2K52 A;  3ULL A;  4GNX A;  5ELF A;  4A3C G;  4L6T B;  4FF2 A;  2BCO A;  5LMN W;  3D6C A;  3IKJ A;  4HED A;  4RG1 A;  3T4A C;  4X3T A;  4RFB A;  2L5T A;  1I5F A;  4R4Q A;  3VYR A;  2R93 G;  1SNP A;  3JAM i;  4K14 A;  5CV7 A;  5LL6 S;  4DAY A;  3H15 A;  3QG1 A;  4J8Q A;  4ZK9 B;  2EY5 A;  1I50 H;  2XN9 C;  2A73 B;  4K5W A;  4LK1 C;  2K1B A;  1TWC H;  1KHI A;  2Z4I A;  2HCC A;  5CGK A;  4DF7 A;  3S1Q H;  1EIH A;  3H91 A;  1PYW D;  1YHA A;  2B8F A;  1F9S A;  2AWN A;  1F2L A;  1N8R C;  3HZX A;  1PFM A;  3OMG A;  1WTW A;  4C3J B;  4GKK L;  1A62 A;  5IY0 A;  4LF8 Q;  4JBJ A;  4IUQ A;  5EPJ A;  4JI8 Q;  4DPG A;  5EBC A;  4DUZ L;  4QL5 A;  1II3 A;  1EFW A;  3TEH B;  4IFD H;  1I4Q A;  5M3F H;  1EY0 A;  1EY5 A;  4DAV A;  2QCP X;  4C2M H;  3VR6 A;  3MZ5 A;  2BDN A;  4QCL A;  1XPO A;  4OX9 L;  3I7F A;  4GN3 B;  2PYK A;  4UHV A;  4XT1 B;  4DR3 L;  4MHE A;  3KF8 B;  2N49 A;  3G4S A;  2EXZ A;  2H1E A;  4JC0 A;  1JC7 A;  3LWE A;  2EOT A;  2F0T A;  3I90 A;  1E2V A;  2EJF C;  1SYG A;  5IYD H;  1SE3 A;  3N52 A;  1IYU A;  2Q2I A;  4DV5 L;  1WOC A;  2WFW A;  4JYA Q;  1KNE A;  1GUG A;  1N36 L;  2JA7 H;  2QDB A;  1OXT A;  3K81 C;  2P5Z X;  3I4N G;  1UNS A;  2MHV A;  4JI4 L;  2M9V A;  4LF7 L;  4BXX G;  1K9M C;  1SND A;  2EXD A;  1XMQ Q;  4J1M A;  3IRB A;  4KD4 A;  2KVM A;  1IL2 A;  4G4K A;  3A54 A;  4DR2 Q;  1TWA B;  2HIX A;  5CYU A;  2XNA C;  3P1H A;  4AYB G;  4K6L A;  2NBF A;  2K5W A;  3RN2 A;  2KHS A;  3S14 B;  2PO4 A;  4AYB E;  1HNW Q;  2OF1 A;  2HIV A;  5IT9 E;  2PMZ B;  2H4O A;  3D31 A;  1I6H B;  4JI5 Q;  3BDL A;  1OO9 B;  4O1N A;  2EYM A;  4CDC C;  4ULL A;  2HDM A;  2K28 A;  4Q5V A;  1TWC B;  1WTQ A;  4APV A;  3RZD B;  4A3G G;  2QEX A;  2ZXR A;  3DLL A;  4BA1 I;  5IE8 A;  4OO1 I;  4B3T Q;  1HXY D;  1Q82 C;  3Q0A A;  3CPF A;  1YBY A;  3GTL B;  5M5Y B;  4GN4 B;  1BR9 A;  2Q2U A;  5JEA J;  3L9A X;  4X3S A;  4YWM A;  4YY3 L;  3R93 A;  4GZY C;  2R7Z G;  3J7A V;  3FVQ A;  4RGO S;  5BN5 A;  2KEC A;  1CHP D;  4A3B G;  3OMC A;  3DEP A;  3OSO A;  2YTV A;  3J81 c;  5GAE C;  2JJQ A;  3M4P A;  2O5J C;  2HCI A;  3PGZ A;  5ELO A;  1KDC A;  2E2I H;  2UUC L;  3CU7 A;  3O13 A;  3W5O A;  4FXG C;  1IW7 C;  5KGU A;  1JT8 A;  2JA8 G;  3GTJ B;  1B44 D;  4O2D A;  2RCN A;  3S2D B;  5EGT A;  4JI3 Q;  4XQN A;  4DK6 C;  1QUQ A;  1I6H H;  2UXB Q;  5C44 G;  1IBM Q;  5DNF A;  2PZU A;  4EQP A;  2E5L Q;  2VS1 A;  3EQL C;  3U4Z A;  4ZQ3 A;  4BY7 H;  4IOA A;  1IW7 D;  3KDF B;  2KJX A;  5J1Z A;  4LFC Q;  1HRJ A;  3MXP A;  1STG A;  4UP8 A;  3AEV A;  3ERQ A;  3UI2 A;  2LXK A;  1XYI A;  2RKS A;  2D0O A;  1AZQ A;  5E1F A;  2CCZ A;  4AH6 A;  1GVP A;  3HGB A;  4RGN A;  4K5V A;  1A2T A;  1JE5 A;  4KHZ A;  3KUP A;  2FFK B;  1E3P A;  2NN6 I;  1EFI D;  1PH8 A;  4H0L C;  2AUK A;  2JA8 B;  4DK0 A;  1JIC A;  1NY4 A;  1VQB A;  1EY4 A;  2ZXP A;  4GOP A;  2F0P A;  1C4Q A;  4IAL A;  2O4X A;  5C4Z A;  4RCN A;  2E5L L;  4X64 Q;  5FOB B;  3H0G G;  2R7Z B;  5IT9 L;  3FP9 A;  4NB3 A;  3SEB A;  1DCZ A;  4NP5 A;  4B08 A;  2JA9 A;  4GN5 A;  4DK3 C;  4XQQ A;  4BBS G;  2N88 A;  1L1O C;  5M5X H;  4IFD J;  1PXU A;  3HOY B;  4ODG A;  3CC2 A;  3I2Z A;  1K83 H;  1W6K A;  2O2L D;  5E7N A;  2C9O A;  1VQL A;  2HHH Q;  5C5M A;  3WOF A;  1TWG H;  2MP1 A;  1H9S B;  1GUO A;  3VA5 A;  3GTP B;  2R7F A;  4C1N K;  3TBI B;  4DR6 Q;  1TS3 A;  2PI2 A;  1LV9 A;  1N9W A;  1I4P A;  1DYQ A;  2IT1 A;  3H0G B;  2A69 C;  4B9W A;  2L9H A;  3SK5 A;  2KHJ A;  4IZ8 A;  2WAQ B;  5FKA C;  5IWA L;  3CCM A;  5LMN Q;  4B3R L;  4A3K G;  2A6H C;  2IL8 A;  2PQA B;  1O7Z A;  1PH5 A;  3VYU A;  2WII B;  2F3I A;  3W3A A;  4A3J B;  4Y7N B;  1F9P A;  1WFQ A;  1X9N A;  3SXH A;  2XRQ D;  3U58 A;  2OEO A;  1SLJ A;  1LTI D;  2B2T C;  4WJ3 M;  1D8L A;  4JI5 L;  4HJ5 A;  3QWN A;  4L8J A;  3KDF A;  3S1R B;  2PNH A;  3HEJ A;  3OIQ A;  4K0K L;  1D5X C;  2E2I B;  3PF4 A;  4WJ4 A;  1YVC A;  2I5M X;  1EUJ A;  3I91 A;  2BDO A;  2B63 B;  4BWG B;  2F03 A;  2NZ1 D;  3QIA A;  1KTK A;  2JA8 H;  2ZTC A;  4XTC S;  2WB1 G;  5KRU A;  4R4C A;  1Y1V B;  1R9T B;  1BBU A;  1DJR D;  1CT1 D;  1XMQ L;  3HOZ B;  5G3L D;  2D62 A;  1L1O B;  2ZM6 Q;  2F0H A;  3HP3 A;  1IBL L;  3MEH A;  4U68 A;  1G6Z A;  4Y52 H;  1B50 A;  2F0J A;  1Q81 C;  4BY7 G;  5IYB H;  2HHH L;  4QUF A;  1Y69 U;  1MD2 D;  1S5C D;  4KN4 C;  1V43 A;  2UXB L;  4LWC A;  2TMP A;  3C3L A;  1GHK A;  1CSQ A;  5D65 A;  1D1K A;  1HR0 Q;  1RTN A;  4IN3 A;  2K5D A;  4I65 A;  3M3Y H;  1G51 A;  4RGM A;  3BJU A;  1VQ5 A;  1X3G A;  1LM0 A;  1CQV A;  2E74 C;  5I9O A;  3QJY A;  4RKB A;  3DWQ A;  1Q3L A;  1HQM C;  1EQR A;  2MPM A;  4DUY L;  2JEB I;  3MHB A;  1C7Y A;  2JN4 A;  3FRP B;  5FLM G;  1I4G A;  2X6G A;  3A0J A;  4X64 L;  1SE4 A;  3W1B A;  3VR4 A;  3KF6 A;  1VQC A;  3HS0 C;  3NTK A;  3FPP A;  4HCE A;  2MGS A;  4H02 A;  1DOK A;  1H9J A;  2WKC A;  2E2J H;  2F0V A;  4JI8 L;  3FPU B;  1ESF A;  5M3M B;  5EKL A;  4GLX A;  3I4M B;  1XNR Q;  1BCP D;  4X62 Q;  3HKZ G;  1ICW A;  3N6R A;  1VCI A;  1X32 A;  3M4O H;  3CCU A;  2ICE C;  3CME A;  1J5E Q;  1FYC A;  1CQF A;  1Q8I A;  2F0N A;  2AWO A;  3S17 H;  4HSP A;  1STH A;  1OXV A;  4OON A;  2ZJQ A;  2FMC A;  4JOI A;  1KAA A;  1LTG D;  5DAU A;  4TRD A;  2NVT B;  4ME5 A;  4QIW E;  1IZ6 A;  5M5Y H;  3V2T A;  3GTL H;  2HQL A;  1GOZ A;  2DY7 A;  3STB D;  5IP9 H;  3S2D H;  3PUX A;  1N34 Q;  3NE5 B;  2DGY A;  1WI5 A;  3GTQ B;  3Q8D A;  3F8T A;  4Z9C B;  4JBM A;  1UE5 A;  2NB0 A;  4DV5 Q;  4QGU A;  3AFQ A;  2I46 A;  2J4X A;  1EU4 A;  4DN4 M;  1MIU A;  1X3P A;  3F2C A;  3T53 B;  3EJI A;  1Z47 A;  4RAU C;  1D7Q A;  2QDL A;  3KOJ A;  4C2M B;  1AN8 A;  2AMC B;  3A5Z B;  3HRZ C;  4JBW A;  4DR5 Q;  1B70 B;  1W3S A;  1WTH A;  1WTV A;  3CMA A;  3NXW A;  4I7A A;  4OX9 Q;  3A7L A;  2JXM B;  4A3F H;  5KNB A;  4DR1 L;  3S1M B;  1PH3 A;  5C4X B;  4POF A;  5IGC A;  2VZA A;  2ZTD A;  1X6O A;  1KD1 C;  1WYD A;  1KQS A;  2EYO A;  2D9U A;  3U4V A;  1HTL D;  4LF7 Q;  1HUM A;  1TWH B;  1ENF A;  2F0S A;  1FNV A;  3MVV A;  4NXN Q;  3PO2 G;  1O80 A;  3ND9 A;  1XWE A;  1MI2 A;  5EAY A;  4JYA L;  4HIK A;  1VQJ A;  2Z6K C;  1R4P B;  3I72 A;  1SN8 A;  2IHF A;  5JAV A;  3TQY A;  3S1Q B;  3NTI A;  1TR5 A;  4A93 G;  1YNN D;  1WCM H;  1MHW C;  3ERS X;  1ICF B;  4BBR H;  4LF6 Q;  3DEO A;  5NUC A;  3SR1 A;  5I2Y A;  5DLQ E;  2B2U C;  3EIV A;  4C3I B;  1QUQ B;  5IYC H;  4X65 L;  4UPA A;  1P8L A;  4QQB X;  5A2Q E;  4O42 A;  1VQA A;  2K32 A;  3NK9 A;  1BVS A;  1XNR L;  4CKC A;  3FKI H;  3K0Y A;  1JWS D;  2EYH A;  1YIJ A;  1QVC A;  1TWA H;  2RDF A;  3T51 B;  5JJL A;  4JPB W;  4PG3 A;  1QCB D;  3R3O A;  1S4Z A;  3PUV A;  1PFN A;  2EDG A;  3CPW A;  5M3F B;  4A3I B;  1CFM A;  2B2T A;  4DK1 A;  4PV1 C;  2LFN A;  1BNZ A;  2PCF B;  2SNM A;  4XDX A;  2E2J B;  1X55 A;  5T1G A;  3NPP A;  4DR2 L;  5F2D A;  3E6Z X;  1V8Q A;  3A8K E;  3GTO B;  4YHH Q;  1SYC A;  1TY2 A;  3NUC A;  2KCM A;  2NVX H;  3NEM A;  1IKL A;  3HOZ G;  1F2Z A;  2CHB D;  1VQN A;  4ZYS A;  4IFD I;  1F9R A;  3WOE A;  1GM5 A;  4BS9 A;  2F0F A;  2DUD A;  3J81 j;  1K8G A;  1VQH A;  1BUV T;  1VQM A;  4IUV A;  4P71 A;  2NVY B;  2F0G A;  1LTT D;  1GUS A;  1R4Q B;  1EWC A;  4DV4 Q;  1IXR A;  1SDF A;  2X69 A;  3PIO A;  2ZM6 L;  2IX3 A;  4DV3 Q;  2B3G A;  1X3F A;  3EBE A;  2KOL A;  1KLG D;  5IOC A;  5DEH A;  3ITP A;  4IUN A;  5C3X A;  2Q2T A;  1NR4 A;  4DR3 Q;  1J9O A;  4U67 3;  2ZXO A;  1S40 A;  2K05 A;  1Q86 C;  2F0U A;  4Q0F A;  2SNS A;  3AQQ A;  1EYC A;  1QNU A;  3JAM L;  4JI7 L;  4IUR A;  1JMC A;  1Y1V H;  1R9T H;  2PI2 E;  2M2L A;  2OTJ A;  3HOU G;  1E2Z A;  1EIF A;  4XT3 B;  1VQ7 A;  3OIP A;  4RH6 A;  1I3Q B;  3JAM E;  2YYZ A;  4A93 B;  4LFB L;  4X66 L;  4XYQ A;  5EKI A;  5E4W C;  4ALP A;  1EOT A;  4F87 A;  5J39 A;  5DM6 3;  4A3E G;  3VYT A;  1XXG A;  3FEW X;  2QGQ A;  4WOR A;  2BH8 A;  4QMG A;  3EFX D;  1VF7 A;  3Q6S A;  1QE6 A;  2UUB Q;  1NBW A;  4BY1 G;  1JE4 A;  2AUJ D;  3QOJ A;  1J5E L;  1HR0 W;  4O0A A;  2EYJ A;  4C56 C;  1PTO B;  1B9M A;  1JWU D;  4NXM L;  2EYF A;  2JA6 B;  4A3C H;  3H94 A;  1WTO A;  3PO2 H;  1NMG A;  3H6M A;  2ZJP A;  2WAQ E;  4K5X A;  3LWU A;  4ZAI A;  2EY6 A;  1LT6 D;  1I4X A;  2IX1 A;  1K0R A;  4DR1 Q;  2IJ0 A;  2N55 A;  3G6E A;  5EPL A;  3JAM c;  3FHW A;  4CDD C;  4EQO A;  4DAM A;  3NEN A;  1B8A A;  3SK6 A;  2PQE A;  1V1P A;  2JA5 G;  1BXT A;  2K01 A;  3RUZ A;  1Q8K A;  1OXS C;  5D3D A;  1ZEQ X;  1Y1W H;  1LTR D;  4R8N A;  2RF4 A;  1BOS A;  2F0D A;  5CBE E;  3J7Z C;  3TRE A;  1K8O A;  4N8X 1;  3IAY A;  3CCQ A;  4M8A A;  1YJW A;  1HZC A;  4RMF A;  2ASB A;  4KJN A;  4OWX B;  4A3K H;  1HCZ A;  3UDG A;  1W6J A;  5LMN L;  1CKO A;  2CW0 C;  3UDI A;  5C0X H;  4CJ0 B;  1AFP A;  4TQU S;  1E22 A;  4KN7 C;  3HOZ H;  4G7Z C;  4IJH A;  3V05 A;  2R93 H;  1EQV A;  2E2D C;  1TWG B;  1B3A A;  2VL6 A;  1TU2 B;  3C2P A;  3RD4 A;  3C46 A;  4A3J G;  1JB3 A;  1XNQ Q;  2CW0 D;  2WAQ G;  4ZRZ A;  4PMC A;  1Q90 A;  1L2F A;  1JJG A;  4A3E B;  5IYD G;  1Z9F A;  2OWO A;  4KLK A;  3OW2 A;  3K57 A;  2K14 A;  3TP7 A;  2XIW A;  3T1Y L;  1H9R A;  4BY7 B;  1L0Y B;  4JI2 L;  4JI0 L;  3NTH A;  4C3I H;  4F88 A;  2A6E C;  2BE5 D;  3BZD B;  4BBR B;  1BBX C;  1Y1V G;  2LY7 A;  4MZ9 A;  5C3E H;  4JI6 Q;  1U0L A;  1VDZ A;  3ND8 A;  2KCC A;  3UDF A;  5C5L A;  3RZO H;  3ZJY C;  1UEA B;  1XNQ L;  4A3I G;  3RLF A;  2VNU D;  2RHQ B;  5EKK A;  5KND A;  1SNC A;  3K7A H;  4J6H A;  4CJ2 C;  4TSS A;  3NQT A;  3H09 A;  1TS4 A;  4PMW A;  3V96 A;  2C5C A;  1AEX A;  2KED A;  5KYL A;  2XGT A;  3MFG A;  4YY3 Q;  5D3I B;  1SFO B;  1PVO A;  4CGY B;  3QOL A;  4EQN A;  3CCL A;  4DNR B;  4KHP Q;  1XJV A;  4JI0 Q;  5C4J H;  3G6J B;  1A8V A;  1DZ1 A;  3Q22 A;  4BY1 B;  3P75 A;  2I07 B;  4HJ7 A;  1ENA A;  3IFT A;  4K0K Q;  5AJ3 L;  3S1N H;  3GP7 A;  1X65 A;  3PIP A;  1IBK L;  3VR3 A;  3I4N H;  2EYP A;  1EQQ A;  3T1H L;  1KIX A;  1KC8 C;  5IP7 H;  1O7Y A;  5I9P A;  4L5Q A;  1HQR D;  3FKI B;  4YCV A;  2R7Z H;  3MXN A;  2VQF L;  3RZD H;  2D0P A;  1JOO A;  4X6A H;  1J6Q A;  5AJ3 Q;  3NBI A;  1LTA D;  1MJC A;  2G5D A;  2VUM G;  1EYG A;  4H7B A;  4GNX B;  1IKM A;  4KHP L;  1PH1 A;  2B39 A;  1STA A;  1HFG A;  1CSP A;  2QIL A;  5C4X G;  1WVL A;  1BKB A;  4UP7 A;  5JOB A;  1QWY A;  2NN6 G;  4OWT B;  3NWT A;  4KKS A;  5JPN C;  4IJL A;  3G7L A;  2R92 G;  3S16 H;  3A8J E;  3TSS A;  3DHQ A;  1NTG A;  5FJ8 H;  4B3M L;  1SRU A;  1BQQ T;  1Y8O B;  2WB1 E;  4A3G B;  4DAY B;  1SXT A;  5JJI A;  4LFC L;  5IOD A;  4CDF C;  3S9W A;  3P20 A;  1S3O A;  1TWH H;  2L11 A;  4BA2 I;  3PO3 B;  5ELC A;  4A3L G;  1GKH A;  5JEA H;  4DV6 L;  3A55 A;  4V0B A;  3CAM A;  1ZYR D;  2WP8 J;  1CZW A;  2VXW A;  1ASZ A;  4CDE C;  5M5W H;  2RHS B;  2OTL A;  4A3B B;  1X3Q A;  1QVF A;  2NVY H;  3F1Z A;  1VMC A;  2XRS D;  1F2Y A;  3A8I E;  3GTG H;  2OCE A;  1QB5 D;  5COR A;  2LKV A;  1PH7 A;  1K8A C;  3GTJ H;  1D5Z C;  2WAC A;  4CKE A;  2F4I A;  2F4V L;  2HD3 A;  2IWH A;  5BR8 Q;  1BBW A;  1LYL A;  3I4M G;  4ABN A;  1BCP B;  1A63 A;  2F0I A;  4DFA A;  2NZH A;  2L12 A;  4GOP B;  2NYZ D;  3KF6 B;  5IGE A;  4KKT A;  4A75 A;  1TVX A;  1VQG A;  1LT3 D;  4YIJ A;  2GVA A;  1SNQ A;  1YEZ A;  2I0Q A;  1STN A;  4HID A;  1RD9 D;  2KCN A;  5C4J B;  1JOK A;  1NCV A;  1BCP F;  3G48 A;  3D0F A;  4DU9 A;  2KA7 A;  1GJX A;  2DN8 A;  1ET9 A;  1YNX A;  2LSS A;  1M4V A;  1PZI D;  4NMZ A;  1GHJ A;  4JI4 Q;  4LF9 Q;  3PQI A;  1D6E C;  4KTA A;  4RGT A;  3D8G A;  2KBN A;  1G6P A;  1CKN A;  4OXP A;  2ID0 A;  4X3U A;  1WCM B;  3DWA A;  1EWH A;  3MXN B;  1ASY A;  1LLR D;  1ILP A;  3OTO L;  2CFM A;  3I4N B;  1NMF A;  1IYV A;  5CV6 A;  2IW3 A;  1S5F D;  5GAH C;  3K5L A;  3S14 H;  2UUC Q;  3G71 A;  3E3X A;  4FO2 A;  4LF4 L;  4MTK A;  2J7Z A;  2XWJ B;  4ID6 A;  1ENC A;  1MKH A;  1DM0 B;  2AKW B;  5EQ0 A;  4DV3 L;  4IPG A;  2VUM B;  3M9B A;  1FGB D;  1E7Z A;  1RKN A;  1E1T A;  1NSN S;  3K7A B;  3M7N A;  4XIG S;  4GLA C;  1O7L A;  3EVQ A;  2EE1 A;  4KY7 A;  3I8Z A;  4BBS H;  2L55 A;  4DA2 A;  4DV0 Q;  3PUW A;  1K83 B;  1MBY A;  1YJN A;  4R8I A;  4OO1 H;  1V1P B;  3MWY W;  4P74 A;  1F77 A;  4FF1 A;  5FJ8 G;  3CCJ A;  4LFB Q;  3J80 c;  3TDQ A;  1YJ9 A;  3RZO B;  5EBD A;  1SRO A;  2DJF C;  1GD7 A;  3HKS A;  3GDE A;  5IGG A;  1HNW L;  5G3L F;  1NUC A;  3BZC A;  4C1N I;  2PPB C;  3HOV B;  1SYF A;  2Z4H A;  4JI1 L;  3CQZ H;  2JP1 A;  1GO3 E;  1WD0 A;  2E2H B;  3MXU A;  3BYT B;  1ESR A;  3VA7 A;  5CMD A;  3AMU A;  4DR5 L;  1RHP A;  3BDC A;  5ISR A;  4CJ1 B;  3CCS A;  4A4I A;  3GTK B;  5L37 A;  2NZO A;  2KEE A;  1PH2 A;  3PIO 3;  4A3K B;  1TKW B;  4DV4 L;  4DXG A;  1VQ4 A;  1YNJ C;  2F0K A;  4KV6 A;  2SEB D;  3S2H H;  1XTC D;  3PO3 G;  4IPH A;  3AB9 A;  5I6Y A;  2HT1 A;  3L0O A;  5M3M G;  2JA5 B;  1CI3 M;  2JA6 H;  3CQZ B;  1HNZ Q;  1PMR A;  4DXF A;  1Y1W B;  2Q2H A;  4OHJ A;  4OIK A;  4YHH L;  2NVQ B;  2NTT A;  3J81 E;  4HIO A;  4ILW A;  2WB1 B;  2RA4 A;  1TWF H;  3GO5 A;  5JVG 3;  1LTS D;  1ILQ A;  5LHY 1;  5CC4 A;  2R7D A;  4LMQ D;  3SVM A;  2N8N A;  1JCK B;  1VS0 A;  2FHT A;  1I94 L;  2F0E A;  5GQO A;  3BDO A;  2EJM A;  1BDO A;  2MJ8 A;  2ZT9 C;  4PZ8 A;  1AP0 A;  1LT4 D;  1PZK D;  1NJI C;  3DUZ A;  1XX8 A;  3KK7 A;  1A2U A;  1YI2 A;  2B8G A;  2BA1 A;  2MO0 A;  1OTC A;  3I3C A;  5D14 A;  3KYH C;  4CBV A;  5CV8 A;  2Z1C A;  5ELD A;  1FD7 D;  1VMP A;  5FLX E;  1LUZ A;  1CA5 A;  2K33 A;  1M90 C;  3ER0 A;  5C0X G;  4ZKC B;  3PF5 A;  5FLM H;  5LMU L;  4R4T A;  1TWF B;  3E5S A;  1HR0 L;  2RDG A;  2YV5 A;  5IGD A;  2NVQ H;  2CH4 W;  4IPD A;  1Z7T A;  2LMC B;  5ELE A;  1PH9 A;  3KBG A;  4HJ9 A;  2L15 A;  4A3J H;  4A3M H;  1H9S A;  3BZK A;  3PUY A;  4NXN L;  2A68 D;  2R3Z A;  3J7A 5;  1E24 A;  1K0S A;  4HAE A;  2K5N A;  3S2H B;  2PNR C;  2CWP A;  3RLO A;  1I3Q H;  1STE A;  2R6G A;  2Y0S B;  4QUC A;  3SGI A;  1PA6 A;  3BVM A;  1VQI A;  4GKJ Q;  3LNN A;  3S24 A;  3A7A B;  1F9Q A;  4DV2 L;  1HTP A;  1KL9 A;  2KHI A;  1H9M A;  2A68 C;  1K3B C;  5IP9 G;  4HMJ A;  1TQO A;  3J80 i;  1LO5 D;  5C3E G;  4A93 H;  3P7J A;  3QR8 A;  3CP0 A;  2VQF Q;  2X6L A;  3MFY A;  2UXC L;  1WCM G;  3OW7 A;  3HOX H;  4BBR G;  4A3I H;  3HOY H;  4ZCK A;  3FMC A;  4ZUI A;  1PYS B;  1UE6 A;  3I4L A;  5M5X B;  5E4X A;  2ES2 A;  2FJ2 A;  3FDT A;  5JVH 3;  3DMU A;  2AQ3 B;  1T5E A;  1KAW A;  2EZV A;  4OIJ A;  1K73 C;  2UXD Q;  1I4R A;  1Q12 A;  4EQ5 A;  1D2B A;  2PZT A;  4N9P A;  1NNX A;  3TP8 A;  4JBK A;  2MFI A;  3MC0 B; 
#chains in the Genus database with same CATH homology
 4KI0 A;  1PH8 A;  1HZA A;  1L1O A;  2VL6 A;  1OXX K;  4A3F G;  1FJG Q;  2Y0S G;  2K5H A;  4QY7 A;  1K3R A;  5IP7 G;  1NY4 A;  1VQB A;  4DV7 L;  4B3S L;  4DR6 L;  4A3J G;  4GOP A;  4YWL A;  1XNQ Q;  2WAQ G;  4JCV E;  5BR8 L;  1L2F A;  1QZG A;  4MTN A;  1WJJ A;  4JI6 L;  1UE7 A;  2F4V Q;  5IYD G;  4A3B H;  1JJG A;  4DNI A;  4LFA Q;  1Z9F A;  4DKA C;  2OWO A;  4ME3 A;  4X64 Q;  2E5L L;  2VUM H;  3HOW G;  3H0G G;  4DR4 Q;  4KLK A;  3OW2 A;  3FP9 A;  4NB3 A;  2K14 A;  3AFP A;  2GN5 A;  4JG2 A;  2UXC Q;  2JA9 A;  3GTO H;  2UU9 L;  4P73 A;  3T1Y L;  4C3J H;  4GN5 A;  1SR3 A;  3PO3 H;  1Q1B A;  4DK3 C;  5C4X H;  5IYC G;  4BBS G;  1L1O C;  5M5X H;  2K5V A;  4IFD J;  2E2H H;  4JI2 L;  1VQE A;  4JI0 L;  1N33 L;  2JA6 G;  4C3I H;  2ZTE A;  2V1C C;  4B3R Q;  3RNU A;  2Z0S A;  1XMO Q;  2PMZ E;  3HOV H;  3CC2 A;  3I2Z A;  5ELN A;  1K83 H;  4DV2 Q;  1Y1V G;  4DR7 Q;  5E7N A;  4MZ9 A;  1VQL A;  3L2P A;  5C3E H;  2HHH Q;  1U0L A;  4R4O A;  3UDF A;  4JI6 Q;  1FL0 A;  1TWG H;  4POG A;  3RZO H;  4YCW A;  3ZJY C;  1XNQ L;  4AQY L;  4A3I G;  1YHQ A;  3K0X A;  2R7F A;  1SFO H;  3RLF A;  4DR6 Q;  2VNU D;  2RHQ B;  1IBL Q;  2PI2 A;  1EIY B;  1YIT A;  1N9W A;  2IT1 A;  3K7A H;  1SMX A;  3VDY A;  3S15 H;  2Y0S E;  2PQA A;  2MQH A;  2N3S A;  4PMW A;  1IYJ B;  4IO9 A;  2KHJ A;  2XGT A;  3M4Q A;  4YY3 Q;  3S1R H;  1PVO A;  2F52 A;  2E8G A;  5IWA L;  3CCM A;  1OXU A;  1XMO L;  3CCL A;  2VY3 A;  5LMN Q;  4B3R L;  4KHP Q;  1XJV A;  4JI0 Q;  4A3K G;  1N33 Q;  5C4J H;  3NEL A;  1A8V A;  1VQF A;  2PQA B;  1UEB A;  1PH5 A;  1C9O A;  5LMU Q;  2UUB L;  2F3I A;  4HJ7 A;  4K0K Q;  3T1Y Q;  5AJ3 L;  1UE1 A;  3S1N H;  4L5R C;  1HZ9 A;  1WFQ A;  1X9N A;  1X65 A;  3I4M H;  1HZB A;  3PIP A;  1IBK L;  3I4N H;  4DR4 L;  3WWV A;  2EQS A;  4BY1 H;  5M3M H;  1M1K C;  1EQQ A;  3T1H L;  4LFA L;  4GOP C;  3U58 A;  3F2B A;  3T1H Q;  4MNO A;  1SLJ A;  5IP7 H;  1KC8 C;  1KIX A;  1D8L A;  3A5U A;  4WJ3 M;  4JI5 L;  4HJ5 A;  4L5Q A;  4LUO A;  5GAG C;  4YCV A;  3KDF A;  2R7Z H;  2PNH A;  2VQF L;  3TS0 A;  3RZD H;  2D0P A;  1QVG A;  4X6A H;  3S1M H;  5H1S E;  1J6Q A;  5AJ3 Q;  4A3M G;  3GTQ H;  4K0K L;  3K80 C;  3PF4 A;  1MJC A;  1W2B A;  4WJ4 A;  1YVC A;  2VUM G;  1SE8 A;  3HOW H;  2I5M X;  3H0G H;  1EYG A;  2MNA A;  3STB C;  1EUJ A;  2CQO A;  3E0E A;  4GNX B;  1TXY A;  4KHP L;  3W1G A;  3AYH B;  1PH1 A;  1CSP A;  3FKI G;  5IWA Q;  5C4X G;  1HH2 P;  1BKB A;  2JA8 H;  2B63 G;  2ZTC A;  4UP9 A;  4XTC S;  3TRZ A;  4UP7 A;  2NN6 G;  2WB1 G;  4OWT B;  5C0X J;  1EWI A;  4R4C A;  3EN2 A;  2MO1 A;  4IJL A;  1BBU A;  1Q7Y C;  1VQ8 A;  2UXD L;  2R92 G;  2XTI A;  1XMQ L;  3HOX G;  1HNX Q;  3S16 H;  4YWK A;  2D62 A;  1L1O B;  1NTG A;  5FJ8 H;  4B3M L;  3JC6 6;  3M85 A;  1SRU A;  1YZ6 A;  4QJF A;  2ZM6 Q;  1IBL L;  1Y14 B;  2WB1 E;  3CC7 A;  4DAY B;  3K8A A;  1DGS A;  4AQY Q;  4LFC L;  5JJK A;  5JJI A;  4Y52 H;  3TS2 A;  1Q81 C;  1S3O A;  4BY7 G;  1TWH H;  4BA2 I;  5IYB H;  1QZH A;  2HHH L;  4NXM Q;  4A3L G;  4DR7 L;  1GKH A;  4HJA A;  4DV6 L;  2JE6 I;  3HOY G;  5M3F G;  1PFS A;  1V43 A;  2VQE L;  4LWC A;  3CAM A;  2UXB L;  3PV0 A;  1CSQ A;  1HR0 Q;  2WP8 J;  3KLW A;  3PCO B;  5C0X I;  4JI3 L;  1VQ9 A;  1X56 A;  4JI2 Q;  4DV1 Q;  1ASZ A;  3CCE A;  3M3Y H;  5M5W H;  4A3E H;  2RHS B;  1AE2 A;  1G51 A;  3BU2 A;  3BJU A;  1VQ5 A;  2OTL A;  2UUA L;  1X3G A;  4B3T L;  1LM0 A;  3U50 C;  2NVY H;  4LNQ A;  1QVF A;  1N32 L;  3J81 i;  3F1Z A;  1EQR A;  3CCR A;  2UU9 Q;  3B6Y A;  4DUY L;  3GTG H;  2JEB I;  2OCE A;  1C7Y A;  5FLM G;  2C35 B;  2YTY A;  1PH7 A;  1K8A C;  3A0J A;  4X64 L;  3GTJ H;  3W1B A;  3PUZ A;  2OQ0 A;  1E1O A;  1UWV A;  2F4V L;  4JI1 Q;  3KF6 A;  1VQC A;  5BR8 Q;  1BBW A;  1Q1E A;  1A0I A;  1LYL A;  2H5X A;  3I4M G;  4NPS A;  2N78 A;  1A63 A;  4B3S Q;  4DV7 Q;  1FVI A;  2YTX A;  4H02 A;  2NZH A;  2JA7 G;  4DUZ Q;  2E2J H;  5HY6 A;  4JI8 L;  4GOP B;  1I94 Q;  3KF6 B;  4GLX A;  1FGU A;  3I55 A;  4LF8 L;  1O7I A;  1V1Q A;  4AIM A;  3GD7 A;  1VQG A;  2OQK A;  4A75 A;  1XNR Q;  3MEF A;  4X62 Q;  5HGQ A;  1VQ6 A;  2GVA A;  3HKZ G;  3H3V H;  3L7Z C;  1YEZ A;  1VCI A;  3K7U C;  2CWA A;  3KJO A;  2I0Q A;  4PZ6 A;  3CCU A;  3M4O H;  4HID A;  4X65 Q;  3CME A;  2EIF A;  2QA4 A;  1J5E Q;  2JA5 H;  2A19 A;  2AWO A;  3HOU H;  3S17 H;  1G29 1;  2IX0 A;  5GRO A;  3G48 A;  3D0F A;  4LF6 L;  1OXV A;  4OWW B;  1CKN B;  1HNZ L;  4OON A;  1Q46 A;  2ZJQ A;  4JOI A;  2BA0 A;  4IOC A;  4A76 A;  1YNX A;  3ULP A;  2LSS A;  4P72 A;  4JI4 Q;  3KJP A;  3I4O A;  1IZ6 A;  4QIW E;  3RN5 A;  4LF9 Q;  5M5Y H;  3GTL H;  2HQL A;  5IP9 H;  3S2D H;  3STB D;  3PUX A;  1N34 Q;  2KBN A;  2A8V A;  1G6P A;  3DM3 A;  2DGY A;  1WI5 A;  4X66 Q;  2IHE A;  1CKN A;  4OXP A;  1XPU A;  2ID0 A;  3Q8D A;  3F8T A;  3GTK H;  2ALY B;  1IBM L;  1UE5 A;  4JBM A;  4DV5 Q;  4QGU A;  3AFQ A;  1Y1W G;  1KXL A;  2JEA I;  1C0A A;  3HKZ E;  3H3V I;  1MIU A;  3F2C A;  3MXN B;  1AE3 A;  1ASY A;  3E9I A;  3UE0 A;  1Z47 A;  1D7Q A;  3CC4 A;  1VQP A;  1U5K A;  2K75 A;  3OTO L;  2CFM A;  3KOJ A;  4JI7 Q;  1NMF A;  2AMC B;  3A5Z B;  4JBW A;  1EOV A;  4DR5 Q;  1B70 B;  2VW9 A;  2K52 A;  4P75 A;  3ULL A;  3ICE A;  1W3S A;  4GNX A;  5GAH C;  4A3C G;  3S14 H;  3CMA A;  3HFZ B;  3G71 A;  5LMN W;  2UUC Q;  4LF4 L;  4GLV B;  4A3F H;  4OX9 Q;  4FDB A;  4DR1 L;  4L5S A;  1PH3 A;  2K4K A;  4RG1 A;  4POF A;  4GKJ L;  2VZA A;  2ZTD A;  4R4I A;  1MKH A;  1I5F A;  4R4Q A;  4C3H H;  4JV5 Q;  1X6O A;  2AKW B;  1KD1 C;  1WYD A;  1KQS A;  3KFU A;  3U4V A;  4DV3 L;  4LF7 Q;  4IPG A;  4L5T A;  2R93 G;  3M9B A;  3JAM i;  1E7Z A;  4NXN Q;  3PO2 G;  1E1T A;  3H15 A;  4LF5 L;  2Z6K A;  3M7N A;  1PHJ A;  1N36 Q;  4GKK Q;  5EAY A;  1I50 H;  4XIG S;  4JYA L;  4LUV A;  4GLA C;  4HIK A;  1VQJ A;  2Z6K C;  3GTP H;  1TWC H;  4UY8 C;  1SN8 A;  1KHI A;  2IHF A;  4BBS H;  2JQO A;  3TQY A;  2ZJR A;  1MJE A;  3S1Q H;  3RR5 A;  1JB7 A;  4DV0 Q;  3NBH B;  4A93 G;  3PUW A;  1YHA A;  1WCM H;  3ERS X;  4BBR H;  1YJN A;  4LF6 Q;  2B63 H;  5C44 H;  5DLQ E;  3EIV A;  1QUQ B;  5IYC H;  4X65 L;  2AWN A;  4A3D H;  4UPA A;  4P74 A;  1P8L A;  1JJ2 A;  1N8R C;  2B29 A;  4QQB X;  1VQA A;  3CW2 C;  5FJ8 G;  4X62 L;  1BVS A;  3CCJ A;  4GKK L;  4LFB Q;  1XNR L;  1A62 A;  5IY0 A;  3FKI H;  4GS3 A;  3J80 c;  4JBJ A;  4LF5 Q;  4LF8 Q;  1YJ9 A;  2BH2 A;  1SRO A;  4JI8 Q;  4DPG A;  1GD7 A;  1T9H A;  3HKS A;  3GDE A;  1QVC A;  1TWA H;  3CF5 A;  4DUZ L;  1YIJ A;  1HNW L;  4QL5 A;  3BZC A;  1EFW A;  5JJL A;  4PG3 A;  3TEH B;  1P16 A;  4R1J A;  3PUV A;  5M3F H;  1XPR A;  3CPW A;  1VQD A;  4JI1 L;  3CQZ H;  4Y7N H;  1GO3 E;  4C2M H;  3F2D A;  2YU9 H;  1XPO A;  4OX9 L;  3I7F A;  4GN3 B;  1X55 A;  1KRT A;  4DR2 L;  4DR3 L;  2ATW A;  3KF8 B;  3RLN A;  3I56 A;  2N49 A;  4YHH Q;  4TVA B;  4DR5 L;  5JEA G;  3G4S A;  1PV4 A;  4JC0 A;  3LGJ A;  2KCM A;  4A4I A;  3CCS A;  2NVX H;  1N32 Q;  3NEM A;  2NZO A;  3HOZ G;  1VQN A;  4IFD I;  1PH2 A;  1GM5 A;  5IYD H;  2DUD A;  3J81 j;  4DV4 L;  1VQ4 A;  2Q2I A;  2I5H A;  4DV5 L;  1RL2 A;  1K8G A;  1VQH A;  1WOC A;  2WFW A;  4JYA Q;  1VQM A;  3UDX A;  3S2H H;  1N36 L;  4P71 A;  2JA7 H;  1OXT A;  3K81 C;  4IPH A;  3PO3 G;  1N34 L;  3I4N G;  2HT1 A;  3L0O A;  5M3M G;  4DV4 Q;  4J15 A;  1IXR A;  4JI4 L;  3PIO A;  2ZM6 L;  1VQK A;  2JA6 H;  4DV3 Q;  4LF7 L;  4B3M Q;  4BXX G;  3ULJ A;  1K9M C;  2B3G A;  1HNZ Q;  1X3F A;  3EBE A;  2EXD A;  4GNX C;  1XMQ Q;  1HNX L;  3CXC A;  3IRB A;  2Q2H A;  1VQO A;  1IL2 A;  3PSI A;  4YHH L;  1CKM A;  2Q2T A;  3CD6 A;  4HIO A;  4DR3 Q;  1S40 A;  4DR2 Q;  3GO5 A;  2HIX A;  1TWF H;  1Q86 C;  2R92 H;  4AYB G;  2R7D A;  1X3E A;  1B7Y B;  1LTL A;  3AQQ A;  2N8N A;  3RN2 A;  1VS0 A;  1L0W A;  4JI7 L;  3OYY A;  1I94 L;  3UE1 A;  1JMC A;  5GQO A;  1Y1V H;  1R9T H;  2JK8 A;  4PZ7 A;  4HIM A;  2PI2 E;  4PZ8 A;  2OTJ A;  4AYB E;  1HNW Q;  3HOU G;  5J3B A;  2HIV A;  3CCV A;  1NJI C;  4A3L H;  1EIF A;  4YCU A;  1VQ7 A;  1YI2 A;  2BA1 A;  2KCT A;  2MO0 A;  3D31 A;  1OTC A;  4JI5 Q;  2YYZ A;  4LFB L;  2K50 A;  3KYH C;  4X66 L;  1PH4 A;  2A1A A;  1CUK A;  4ALP A;  4A3E G;  1H95 A;  4JOI C;  1IBK Q;  2QGQ A;  4IFD G;  5IYB G;  1LUZ A;  4LF9 L;  5GAD C;  4DUY Q;  2CKZ B;  4APV A;  4A3G G;  2BH8 A;  2QEX A;  1M90 C;  3DLL A;  3ER0 A;  4BA1 I;  1V9P A;  5C0X G;  5IE8 A;  3PF5 A;  2UUB Q;  4OO1 I;  3E9H A;  5FLM H;  1NBW A;  5LMU L;  4B3T Q;  4R4T A;  1Q82 C;  1PH6 A;  4BY1 G;  3CPF A;  1YBY A;  4DV0 L;  1J5E L;  1HR0 L;  1HR0 W;  4O0A A;  2YV5 A;  4GN4 B;  2NVQ H;  2Q2U A;  4IPD A;  5JEA J;  4YWM A;  4YY3 L;  1PH9 A;  4LW1 A;  4HJ9 A;  2R7Z G;  1NE3 A;  2L15 A;  4A3J H;  4NXM L;  4A3M H;  4A3C H;  3BZK A;  1JJC B;  3PUY A;  3GTM H;  3PO2 H;  4NXN L;  4A3B G;  3J7A 5;  1E24 A;  1NMG A;  2ZJP A;  2WAQ E;  2K5N A;  2GVB A;  1X54 A;  2YTV A;  2CWP A;  3RLO A;  3J81 c;  1KRS A;  5GAE C;  1I3Q H;  4JV5 L;  2R6G A;  5FLX c;  1PA6 A;  3SGI A;  1VQI A;  4GKJ Q;  2JJQ A;  2IX1 A;  3S24 A;  1K0R A;  3M4P A;  4DR1 Q;  1HJP A;  4DV2 L;  4LF4 Q;  4BXX H;  3PGZ A;  5ELO A;  4LUZ A;  3G6E A;  2E2I H;  2UUC L;  1KL9 A;  3W5O A;  3JAM c;  3FHW A;  2KHI A;  1AH9 A;  4DAM A;  5IT9 c;  3HOV G;  4EX5 A;  5K36 G;  3NEN A;  1JT8 A;  4A3D G;  2JA8 G;  1B8A A;  3OTO Q;  5IP9 G;  3J80 i;  2UUA Q;  4O2D A;  2RCN A;  4DV1 L;  2JA5 G;  5C3E G;  4A93 H;  1YHB A;  4JI3 Q;  2NVT H;  2I5L X;  3CP0 A;  2VQF Q;  4DK6 C;  1QUQ A;  1Q8K A;  1WCM G;  1OXS C;  3HOX H;  2UXC L;  4BBR G;  2LXJ A;  2VQE Q;  4HJ8 A;  4A3I H;  1I6H H;  1Y1W H;  3HOY H;  2UXB Q;  2IY5 B;  5C44 G;  1IBM Q;  4DV6 Q;  4OO1 G;  2E5L Q;  2RF4 A;  4IPC A;  1PYS B;  1UE6 A;  2VS1 A;  2FXQ A;  3U4Z A;  3J7Z C;  1S72 A;  2ES2 A;  4BY7 H;  4IOA A;  1RIP A;  3TRE A;  3KDF B;  4LFC Q;  3CCQ A;  4UP8 A;  3AEV A;  1YJW A;  1FJG L;  2LXK A;  1KAW A;  1HZC A;  2D0O A;  4RMF A;  2ASB A;  3A74 A;  1K73 C;  2UXD Q;  4OWX B;  4A3K H;  2CCZ A;  1Q12 A;  4AH6 A;  4EQ5 A;  1GVP A;  5LMN L;  3UDG A;  1CKO A;  4A3G H;  1XTD A;  3UDI A;  1JE5 A;  4TQU S;  2AHO B;  4KHZ A;  1PYB A;  1E22 A;  4JBK A;  3HOZ H;  4IJH A;  2R93 H;  2MFI A;  1E3P A;  2NN6 I;  2KEN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...