4HJ7A

Crystal structure of schizosaccharomyces pombe pot1pc bound to ssdna (ggttagggt)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
138
structure length
138
Chain Sequence
SFSLLSQITPHQRCSFYAQVIKTWYSDKNFTLYVTDYTENELFFPMSPYTSSSRWRGPFGRFSIRCILWDEHDFYCRNYIKEGDYVVMKNVRTKIDHLGYLECILHGDSAKRYNMSIEKVDSEEPELNEIKSRKRLYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protection of telomeres protein 1
publication title Nonspecific Recognition Is Achieved in Pot1pC through the Use of Multiple Binding Modes.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Dna binding protein
total genus 33
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2012-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16686 POT1PC ssDNA-binding domain of telomere protection protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4hj7A00
1QZHA 4DV7Q 3KF6B 3RNUA 4DKAC 1VQMA 1FJGQ 1Q8KA 1AE3A 3PSIA 5E7NA 5M5YH 2I5HA 1SROA 2K75A 3EBEA 3RLFA 1C7YA 1K0RA 2ES2A 3FHWA 2MNAA 1YVCA 2D0PA 4ALPA 4BBSG 4O2DA 3J81j 4C3JH 1PH5A 1ASZA 4R4IA 3NBHB 4P71A 1XNRQ 2NVTH 4MTNA 4OWTB 4JI1Q 1JE5A 2BH2A 1GD7A 3GTGH 4GNXA 1NE3A 3DM3A 4GOPB 4B3RQ 3M3YH 2N8NA 4A3IH 1LYLA 2E2JH 5GROA 1D8LA 1B8AA 4HJ7A 3HOZH 1N32L 4DV1L 4KI0A 1KAWA 3L0OA 3HOUG 1BBUA 1Y1VG 2IHEA 2K5VA 3CW2C 5HGQA 3S17H 4XTCS 4L5RC 2MO1A 4YCUA 3CCRA 4DR4L 3J80i 2AHOB 2C35B 2QGQA 2ZTCA 4DUZQ 4A3MH 1HNZL 4B3TL 4BBSH 4GNXB 2AWNA 3MXNB 3I55A 1ASYA 3OTOQ 2KCTA 4HJ8A 1SE8A 4NXNL 4OX9L 4JBMA 2NVQH 2ZJQA 3STBD 1XNQL 3STBC 5H1SE 3I4MH 5LMUL 3T1YL 3HOWG 2KHIA 4GS3A 1PH8A 1J5EL 2ZJPA 3L7ZC 3M4QA 3HOUH 1Y1VH 2KENA 4JYAQ 4A3KG 4OWXB 1VQKA 3PUXA 5GQOA 1HR0Q 3ULLA 4DV3L 1SRUA 3RZDH 2ASBA 3UE0A 4NXMQ 1I6HH 3J7ZC 3J81c 1OXUA 4AIMA 2ZM6L 3GO5A 2BA0A 2B29A 1IBKL 4LW1A 4A3LH 3GD7A 2NVYH 3HOWH 3RZOH 3M4OH 3S1QH 4DV0Q 4JI5Q 5ELNA 4IOCA 4BXXG 1C9OA 3AQQA 3LGJA 1NY4A 4POFA 5IP9G 4A76A 1UEBA 1VQAA 3GTJH 2R7ZH 4IFDG 4RMFA 1XMQL 4GKJL 4PMWA 2GVBA 1VQLA 1PYBA 4A93G 4JI3L 4A3JG 3HOVH 2K14A 1VQ5A 3IRBA 4P73A 2UXCL 1YITA 1VQ9A 2IX0A 4IPGA 3CPFA 4LF6Q 1DGSA 3VDYA 2MQHA 4B3MQ 1VQ4A 1JJ2A 5FJ8G 3F1ZA 1M90C 1KQSA 1YI2A 5J3BA 4BY1G 1N34L 4PZ8A 5IT9c 4GOPC 1Q1BA 1W3SA 2K5NA 1VQDA 3NELA 3CMEA 1RL2A 4DR7L 1IBMQ 4IFDJ 1KL9A 3CCVA 3BU2A 4BXXH 2F3IA 2OCEA 4IPCA 2R6GA 4JI2L 4OO1G 1VQ6A 2GN5A 5FLMH 1XTDA 5JJLA 2CFMA 4DV6L 3KDFB 5K36G 4LF7Q 4A3DG 2HHHQ 3H0GH 1FL0A 3S2DH 3PUZA 3HOXH 4GNXC 1CUKA 1PA6A 3H3VH 5FJ8H 2VW9A 3CMAA 2VUMG 1XMOL 4BY1H 4NPSA 4TVAB 1L1OA 1IYJB 5M3FG 1HJPA 4X65Q 5IYBH 2ZTEA 1HH2P 4KHPL 2A8VA 3T1HL 4DR6L 1G6PA 4FDBA 1KRTA 4YWMA 1K73C 2UU9L 5IYDH 2RCNA 4GN5A 3TQYA 5IWAL 4A3EG 4A3GG 1OXVA 2JA8H 4QQBX 1NJIC 3E0EA 4HIDA 4BA2I 4UP7A 2Q2IA 2VQFL 2OWOA 4Y7NH 1IBLQ 4B3SQ 3RN5A 2VUMH 3U4ZA 1JT8A 3NEMA 1VQJA 2OQKA 2YTYA 4DAYB 5BR8L 2OTLA 2NN6G 1YNXA 3RR5A 4LFCL 2CKZB 5M3MH 5C3EG 3CCLA 4LFAL 4A3IG 1HNXL 4L5TA 3S2HH 4KHZA 3HOZG 4OO1I 3GTPH 1U0LA 3S1MH 1QZGA 4A3EH 1Y1WG 3EIVA 2JA5H 3PO2G 4A3GH 4JV5Q 3A0JA 4O0AA 1A8VA 3E9IA 4X66L 1Q82C 4JI7L 3MEFA 2QEXA 3CC2A 2CWAA 4A3MG 1M1KC 1N32Q 1E22A 3CAMA 4JBJA 4A4IA 3M9BA 3AFQA 4DR1Q 4Y52H 4EQ5A 4X64L 1FGUA 4JOIA 4NB3A 3H15A 3ULPA 3CPWA 4L5SA 4EX5A 5C3EH 1IL2A 1I94L 4UY8C 1FVIA 2LXJA 3I4MG 1YBYA 4B3TQ 1MIUA 4AYBG 1Q86C 1V43A 3KLWA 1TWCH 1E1TA 1E7ZA 1Q46A 1SMXA 2AMCB 1SN8A 2RHQB 5GAHC 1Y1WH 1EYGA 3PO2H 4A3FG 3W1GA 3HFZB 4OX9Q 3GTQH 3ER0A 4LF4Q 4GKKQ 5GAGC 1IXRA 3UDXA 4YY3L 1BVSA 4MNOA 5LMUQ 3T1YQ 1N33Q 1TWFH 1AE2A 2CQOA 4DV7L 3ZJYC 2CWPA 3RLOA 3WWVA 4C3IH 1U5KA 3PCOB 4A93H 3HOYG 4A3LG 2PMZE 4APVA 5JJKA 1YHAA 5IYCG 4DV3Q 2AKWB 3I56A 4PG3A 3CCSA 1GVPA 4LF8Q 2JK8A 2ID0A 4JI6L 2VY3A 4PZ6A 1XNRL 3KF8B 1WJJA 2LXKA 2R7ZG 1CKNA 1BBWA 2KHJA 1IBKQ 4GN3B 2JE6I 3KOJA 3TS2A 4DK6C 4B3RL 1KD1C 2UUCQ 2JA7H 2JA9A 4HIOA 2PI2A 2VL6A 3UDFA 1JJGA 2HQLA 5IP7G 3HOVG 1K3RA 2KBNA 2WB1G 2R92G 4DV2Q 1L1OC 2UUAL 2D62A 1B7YB 2VQEL 4GKJQ 1XMQQ 4R4CA 1LM0A 5IYCH 3KJOA 2HIXA 4A3BH 1X3EA 1HNWQ 4JI3Q 1CKNB 2VS1A 1GKHA 5HY6A 4IO9A 4DR3Q 3TRZA 1S72A 1A62A 1SLJA 2XGTA 1O7IA 2V1CC 3OTOL 2UXDL 4AYBE 4JG2A 3J7A5 5FLXc 5C0XG 1X6OA 1YJ9A 5FLMG 3G4SA 4JI8Q 4J15A 1JB7A 2K5HA 4JI0L 4DR7Q 1CSPA 5IP7H 3D31A 4GLAC 2IX1A 3H0GG 2H5XA 4HJ5A 4P72A 3HOXG 5M5XH 2R92H 4JYAL 2Z0SA 3JAMi 3D0FA 3HKZG 1VQIA 3KFUA 3CC4A 3A5UA 4DUYL 1HR0L 4JC0A 4DR5L 4P74A 1L0WA 3S1NH 3I4OA 4NXML 4DV6Q 1YZ6A 3F8TA 5IYBG 2NZHA 4LNQA 2Q2TA 2WAQG 3PUYA 2F52A 1AH9A 3I4NH 3UE1A 5C0XJ 1I5FA 1HZ9A 2JEBI 5IYDG 1J6QA 4MZ9A 3NENA 3AYHB 1T9HA 1HR0W 2JA8G 4LF5L 3PUWA 3A74A 3PF5A 2FXQA 4YHHQ 3F2DA 4DV0L 3U58A 2ALYB 4JOIC 1V1QA 4H02A 4KHPQ 2UXBQ 4LFBQ 1PYSB 4DPGA 3T1HQ 1GO3E 1A0IA 3W5OA 2E5LQ 3AFPA 1NMGA 1LTLA 3Q8DA 2UU9Q 1WYDA 2EXDA 1B70B 2WB1E 2Y0SG 4POGA 1R9TH 2JA6H 3PF4A 4QY7A 3A5ZB 4X62L 5M3MG 5AJ3L 3KJPA 4IJHA 1Q12A 4A3CH 4IFDI 3L2PA 3RN2A 1MJEA 2VZAA 1TXYA 4DR2L 2VQFQ 3FKIH 1OXTA 1VQPA 1XPUA 4YCVA 4HJ9A 2F4VL 2JA5G 2Z6KA 2CCZA 4QJFA 4A75A 4IJLA 4OWWB 3RLNA 1KC8C 1IBML 1QVGA 1EQQA 4DV4Q 3H3VI 1YJNA 1L1OB 4GLXA 2UUBL 4OONA 1WI5A 3EN2A 2E2IH 3ULJA 5C44G 1HZCA 1OXSC 1QUQA 1TWGH 1PH2A 4X66Q 3HKZE 2HHHL 3DLLA 4JBKA 5IY0A 4ME3A 1EWIA 2DUDA 2E8GA 3TS0A 2WAQE 2ZJRA 1NTGA 4X64Q 2MO0A 1PH1A 3S1RH 4PZ7A 4R1JA 4X65L 3S14H 1WCMH 3KF6A 3CCJA 2GVAA 1L2FA 2RHSB 3HKSA 1X3FA 3K81C 1N36L 4DV1Q 4AQYL 1PH3A 1QVCA 3OW2A 1KIXA 1OTCA 5C44H 1PH6A 1H95A 3JAMc 1Z47A 2EQSA 2PQAA 2RF4A 3CQZH 1S3OA 1PHJA 1EIYB 4DR4Q 2R7DA 1HZAA 2Y0SE 5C4XG 3GDEA 3K80C 1UWVA 3G71A 1HNZQ 4JI4L 1PFSA 4JCVE 1X65A 4GOPA 2NVXH 4DK3C 1IBLL 4B3SL 2B3GA 4R4OA 3ICEA 4K0KL 1BKBA 4DV5L 4NXNQ 2Q2UA 4DNIA 1PVOA 1XNQQ 3PV0A 1NBWA 3OYYA 2K50A 4BA1I 2PNHA 5LMNL 4QGUA 4LF9L 2JA7G 1JJCB 3K0XA 1QVFA 4C2MH 4BY7H 1YJWA 1P8LA 2PQAB 1K8AC 1J5EQ 2YTXA 1E24A 4JI6Q 3I7FA 3W1BA 3F2CA 2NN6I 4TQUS 2A19A 1V9PA 1FJGL 4JV5L 2ZTDA 3G48A 1KHIA 1RIPA 1JMCA 5C4XH 3AEVA 3GTLH 1OXXK 4A3BG 3TEHB 1NMFA 5LMNW 3K7UC 1YEZA 4BBRG 3UDGA 1VS0A 2XTIA 4DR1L 4A3FH 3B6YA 1C0AA 2ZM6Q 4JI1L 4AH6A 1X56A 1G51A 2UUAQ 4UPAA 1EUJA 2VQEQ 2JQOA 3BZCA 2AWOA 2ATWA 2HIVA 2HT1A 4YWKA 4K0KQ 2I5LX 1KXLA 1Q1EA 3HOYH 2JJQA 3BJUA 3CCEA 3CCUA 1XPOA 2UXDQ 1EQRA 4DAMA 3M85A 1D7QA 2B63G 4LF4L 4GKKL 3E9HA 2WP8J 1A63A 1P16A 2EIFA 3CF5A 1PH7A 4DUZL 1VQGA 3PIOA 4JI0Q 2I5MX 4BBRH 1N33L 2Q2HA 2UXCQ 2Z6KC 3CXCA 1VQOA 4C3HH 1VQFA 3F2BA 1XJVA 1Z9FA 4DUYQ 2R93G 4LUVA 4LUZA 4DR5Q 1N34Q 2E2HH 1X9NA 4KLKA 4L5QA 4LF8L 1YHBA 4R4TA 2N78A 1EFWA 1S40A 3GTMH 1UE5A 5ELOA 1VQBA 1X3GA 2L15A 2BH8A 4IPDA 2NZOA 2I0QA 4JI2Q 1EIFA 2B63H 2JA6G 3I4NG 4GN4B 2UUCL 3CP0A 1YHQA 4LF5Q 2PI2E 3KYHC 2OTJA 5IE8A 1VQNA 4JBWA 4A3CG 1K83H 3ERSX 5JJIA 4DV2L 4A3KH 4WJ4A 1X54A 2IT1A 1SR3A 3FKIG 4R4QA 4IPHA 1W2BA 2VNUD 2K52A 2R93H 3PUVA 2DGYA 5M5WH 2QA4A 1XMOQ 3CCQA 2YU9H 3U50C 1G291 4X62Q 5AJ3Q 1HNWL 4UP8A 4X6AH 1CSQA 1PH9A 4JI5L 4DR3L 1VCIA 2WFWA 1KRSA 3KDFA 4DR6Q 4DR2Q 2BA1A 1TWAH 2IHFA 1GM5A 5IWAQ 1VQ8A 2F4VQ 3BZKA 4JI8L 1WOCA 3GTKH 1N9WA 1VQHA 2OQ0A 3PIPA 2LSSA 4WJ3M 1I50H 5JEAG 4P75A 2A1AA 1EOVA 3PGZA 5IP9H 5C0XI 4HIKA 2K4KA 1SFOH 2UUBQ 4B3ML 3GTOH 1UE7A 5GADC 1XPRA 1N8RC 5BR8Q 3M4PA 4LFCQ 2N49A 4LFAQ 4A3JH 1WCMG 5GAEC 3U4VA 1YIJA 3J80c 1HNXQ 2IY5B 5EAYA 4YCWA 4QL5A 3CC7A 1K9MC 3S15H 3JC66 3I2ZA 3UDIA 1MKHA 3CD6A 4JI7Q 3CCMA 1CKMA 2JEAI 4LF7L 5JEAJ 4YHHL 3PO3G 4OXPA 3K7AH 4XIGS 4LFBL 2UXBL 1N36Q 2R7FA 4AQYQ 1LUZA 3G6EA 2E5LL 1VQ7A 2YTVA 3S24A 2D0OA 2YYZA 1CKOA 2KCMA 3J81i 4YWLA 4A3DH 1I94Q 1TWHH 4QIWE 4UP9A 5C4JH 1Q81C 1X55A 1E3PA 1QUQB 4LUOA 1Q7YC 4JI4Q 3FP9A 1I3QH 4BY7G 3M7NA 2YV5A 1PV4A 4LWCA 1IZ6A 1K8GA 1WFQA 4DV5Q 1UE1A 5M3FH 1PH4A 4HJAA 3SGIA 3TREA 1MJCA 3K8AA 4LF9Q 4RG1A 5LMNQ 4GLVB 3PO3H 1HZBA 1VQCA 4YY3Q 1Y14B 4LF6L 4DV4L 1E1OA 4IOAA 2MFIA 2N3SA 1UE6A 4HIMA 1VQEA 3S16H 5DLQE
chains in the Genus database with same CATH superfamily
1B3QA 1I4GA 4DV7Q 4DKAC 1Q8KA 3PSIA 2DJFC 1SROA 2K33A 1PTOC 1Q8IA 3PO3B 1GUTA 2K04A 2MNAA 5LL6X 1G6ZA 2BE5D 3K59A 5K5PA 2NVTH 4P71A 4K5VA 2WINB 4MTNA 4JI1Q 4DN4M 1A6XA 5D3IB 4B3RQ 3M3YH 5EPKA 5ELFA 4CDFC 4HJ7A 4BY7B 3AU7A 4C56C 2B2YC 3CW2C 1MSHA 4XT3B 5I2YA 4YCUA 5IGCA 2QGQA 2A6HD 4A3FB 3MFYA 1U4LA 2AWNA 1A3VA 3BDOA 1ASYA 3HEJA 4JBMA 4HCEA 2ENBA 3STBC 3T53B 1M4VA 3I4MH 3IKJA 3MFGA 1K0SA 3I8ZA 1J5EL 1Y1VH 2KENA 1TS5A 1VQKA 5I2XA 1HR0Q 3ULLA 3UE0A 4RA8A 2EYLA 3OWFA 1GXDC 2B29A 1IBKL 4MHEA 2E2HB 1DYQA 3GD7A 2F0GA 3GTMB 2EY2A 4JI5Q 2CHBD 1TS3A 2M9VA 4BXXG 2SNMA 3AQQA 5IP9G 4POFA 4A76A 4IFDG 3D4DA 4GKJL 4RMFA 3SE0A 2GVBA 2NVYB 3MC0B 4CKBA 2EXZA 2L55A 5CV5A 2K14A 3ZYYX 1D5MC 4F7XA 1VQ9A 4LF6Q 1DGSA 1QG7A 1BBXC 1JJ2A 1HA6A 2WV6D 3QOJA 1WTHA 1D5ZC 1N34L 1ML0D 2K5NA 3CMEA 2O5JC 2X69A 1K8MA 1IBMQ 2NZ1D 1DOMA 4JI2L 4H13C 2ICEC 2GN5A 5F2DA 1EY0A 3GTKB 3KDFB 1KLUD 5KNBA 1FL0A 1CUKA 3GTOB 2H1EA 3BYTB 3PIO3 1CA6A 5I4DA 4BWGB 5M3FG 5EKKA 4ZYSA 4KY6A 4FF4A 1HH2P 1PFMA 2A8VA 3G7LA 1EY6A 4B9WA 3T1HL 5IYDH 4WJWA 4ZRZA 2QF7A 2Z4HA 4A3EG 3D6CA 1LACA 4QQBX 2QDLA 4BA2I 1JOQA 2Q2IA 5CMDA 3VA7A 3P20A 3K5OA 3RN5A 2OQKA 2NN6G 1HQRD 2CKZB 5M3MH 1WTVA 5CYUA 1HNXL 4ZAIA 3FRPB 2D9UA 1RJTA 2TMPA 1ONLA 3EIVA 5M3FB 4RWSC 1LV9A 1U4PA 4KY5A 4JPBW 3MEFA 2QEXA 3J7YW 2F3VA 3EJIA 4Q5VA 4UAIA 3CC2A 5EPJA 4A3MG 3OSOA 1E22A 3GTPB 4X3TA 1BOSA 4FYDA 4DR1Q 4EQ5A 4A3EB 4NB3A 3PIP3 1VF7A 3VYTA 1C8CA 4FNFA 3NXWA 2PZTA 1E0BA 1WTQA 1MIUA 4AYBG 3KLWA 2O4XA 3WOEA 4G7ZC 1U4RA 1RHPA 2RHQB 3VR6A 4K6LA 3W1GA 3HFZB 3VYRA 2F0LA 2K5DA 4YY3L 2JSOA 4QUCA 2RDGA 3SVMA 3NWTA 3T1YQ 1WVLA 1Q3LA 1PFBA 4A93H 3D4WA 3NTIA 4APVA 5IYCG 1JWUD 2AKWB 4A3MB 4PG3A 3CCSA 4LF8Q 2JK8A 3C3LA 3TN2A 2VY3A 2CW0D 4HAEA 1DCZA 4NP5A 1BBWA 3O13A 3TS2A 2PPBC 3SR1A 4V0BA 2UUCQ 1JCKB 1O7YA 4AYBB 2LY7A 3UDFA 1JJGA 1RODA 5IP7G 3HOVG 2OF1A 1K3RA 2KBNA 1TY2A 4DV2Q 1L1OC 1TS2A 2L12A 2UUAL 1NR4A 1XMQQ 1FD7D 3DEPA 3RZDB 5J1ZA 5C3WA 4JI3Q 2VS1A 3G6JB 5HY6A 3SK5A 4FXDA 1S72A 3FDTA 1O7IA 3OTOL 3J7A5 4RHRA 3J80E 2I46A 3P7JA 5FLMG 3M4OB 1EL0A 1J8IA 1TR5A 2FHTA 2H5XA 3HOXG 5M5XH 4JYAL 3JAMi 5I9PA 3T13A 1VQIA 3CC4A 3A5UA 1NUCA 4DR5L 4XXEA 1L0WA 4G7OC 1II3A 3HOVB 3F8TA 5IYBG 1MHWC 2F52A 3DHQA 4K2LA 4QUFA 1E2ZA 3FVQA 1AN8A 4G57A 2N55A 5JVH3 1B9NA 1T9HA 2MP1A 4DF7A 4LF5L 3PF5A 4KHPQ 4JOIC 1V1QA 1GJXA 1GO3E 3KLSA 3VA5A 3W5OA 4HN7A 4POGA 4KN7C 2F0EA 1EZ8A 3PF4A 1SYGA 5T1IA 4LAAA 4X62L 5AJ3L 3TP6A 4G4KA 3S2DB 3HOXB 3L2PA 3RN2A 1MJEA 2VZAA 4DR2L 2VQFQ 3FKIH 4RCOA 1VQPA 1XPUA 1STEA 3A55A 4RGOS 3H3VI 3GV3A 1KDBA 4OONA 2E2IH 3DWQA 2Q8RE 4X66Q 4E6IA 2HHHL 1VF5C 3HS0C 4Y7NB 2ZJRA 1NTGA 4HCSA 1TWGB 2RKSA 3S2HB 3OMCA 5JPNC 3S14H 2PYKA 2GVAA 1TVXA 4AQYL 3T51B 4DK1A 3U9SA 3S1MB 2G5DA 5CV4A 3TP8A 2F0PA 1EIYB 1S3OA 2EYPA 2VB3X 5C4XG 2R7DA 1HZAA 1YNJC 1NR2A 1PFSA 1SE2A 4GOPA 2Z9HA 1F9PA 2B3GA 5KGUA 1F2ZA 3E0JA 4F8MA 1SAPA 3MVVA 1PVOA 1EU3A 3NBIA 3PV0A 4P2CB 2K50A 4LF9L 2PNHA 3K0XA 5E4XA 1J5EQ 4JI6Q 2PQAB 4K0KL 3I7FA 1V9PA 4ZK9B 1KHIA 3GTLH 1STHA 3A8KE 3NPPA 1K3BC 1TWFB 3K7UC 4L8JA 4FF3A 1C0AA 4GZYC 4JI1L 4AH6A 2K5WA 4C3HG 1EUJA 1IHZA 1RTNA 2LKVA 2HT1A 2E76C 2I5LX 4QMGA 1KXLA 2XSCA 1XPOA 2UXDQ 1DD2A 4DAMA 3N6RA 1S5CD 3M85A 2BCOA 2NYZD 1BUVT 4X3SA 1JOOA 1P16A 2DJGC 3CF5A 4EVOA 1PH7A 3PIOA 1N33L 1EY8A 2RQXA 3S9WA 1FNWA 1VQFA 1Z9FA 4LUVA 1L0YB 1N34Q 1EFWA 3BS1A 1AZQA 1UE5A 2I0QA 4JI2Q 1EIFA 1PTOH 3DM1A 3KYHC 1HFNA 1PLFA 3HGBA 4A3CG 4LMQD 3ERSX 1FNVA 4WJ4A 2IT1A 4IPHA 1PMRA 2VNUD 4K6DA 5EBCA 3TBIB 1G291 3QWNA 4ZUJA 4X6AH 1CSQA 4B9XA 4JI5L 4DR3L 2WFWA 1KRSA 1SNMA 2BA1A 2IHFA 4DNTB 2F4VQ 5HGTA 3PIPA 1VQHA 2OQ0A 5JEAG 4HIKA 4R8IA 4LF6L 2K4KA 1SMYD 4ZKBB 1GUWA 5CBAE 2AUKA 4ID6A 2QEJC 4A3JH 1HNXQ 3U4VA 1B9MA 5EAYA 5I6WA 1SYFA 1TU2B 3OW7A 2XRQD 4QL5A 3CC7A 2A74C 1K9MC 2J7ZA 2JEAI 4YHHL 3SK8A 1AZPA 4DAYA 3X3NA 4LFBL 1N36Q 1B1ZA 4OO1H 1SSOA 1C48A 2D0OA 4OIKA 1CKOA 5K36H 1TWHH 4QIWE 2GA4B 1Q81C 1X55A 1E3PA 2F0VA 3FP9A 4WRDA 3RUZA 1I3QH 4LWCA 3K5MA 3SGIA 3Q24A 2EYFA 5LMNQ 4GLVB 4YY3Q 5ELBA 4UHVA 4DV4L 2MFIA 4HIMA 3I90A 3S16H 4C1NI 3BVZA 2H4OA 1QWYA 1PZJD 1W6JA 5M5YH 1QILA 3ND9A 1EYAA 2K75A 3EBEA 2K32A 1YVCA 3SEBA 2D0PA 5FLXL 4ALPA 3J81j 4JVZA 4C3JH 1PH5A 5A35A 1ASZA 4R4IA 4WORA 1GD7A 1Y8PB 2HQEA 4GOPB 4A3IH 2E2JH 1C4QA 2B2WC 1B8AA 4KMUC 3BDCA 4DV1L 1KAWA 1TKWB 1Y1VG 5KEEA 3S17H 4KJOA 2F0HA 3CCRA 4DR4L 3J80i 1XX8A 4BBSH 4MIUA 3L9AX 4GNXB 4J8QA 1O80A 3I55A 3OTOQ 2KCTA 1M8AA 1HCZA 1SE8A 4NXNL 2NVQH 1XNQL 1AEXA 1SYDA 3CU7A 3T1YL 2KHIA 4GS3A 1SNPA 3HOYB 3HOUH 4JYAQ 4A3KG 5CV7A 3PUXA 3GP7A 1NNXA 2ASBA 1I6HH 1RTOA 4TRDA 3J81c 2ZM6L 3GO5A 3TZUA 5DNFA 1TS4A 1KNAA 4K8JA 1AW7A 1ESRA 3HOWH 3S1QH 4IOCA 1NY4A 3LNNA 4CJ2C 2R7ZH 1UEBA 1VQAA 3GTJH 1XMQL 1STBA 3R2IA 4PMWA 2J0TD 1VQLA 2JP1A 4JI3L 1STAA 1VQ5A 1VDZA 4A3KB 2IX0A 2EYOA 5JVG3 4B3MQ 1VQ4A 1WD0A 2YU9B 1YI2A 1LT6D 2L5TA 3IL8A 2XIWA 3NELA 1RL2A 4IFDJ 1KL9A 3BU2A 2F3IA 3E3XA 1G91A 1TWAB 3A8IE 3F2UA 3HRZC 1VQ6A 3C46A 1E2VA 4XDXA 3SK4A 1XTDA 4DXGA 4LF7Q 2HDMA 2HHHQ 1GUGA 1I50B 3H0GH 3D6WA 4ILWA 3VR3A 4BY1H 1F9QA 1IYJB 4KHPL 4LK1C 4ZLTF 4FDBA 1KRTA 3S15B 1K73C 4GN5A 5IWAL 4RKBA 2A6ED 2JA8H 3NQTA 2FMCA 1SJHD 2VQFL 1XYIA 2OWOA 5AFWA 1Y8NB 1SE4A 2Q8TA 4NMZA 3U4ZA 1JT8A 2YTYA 4DAYB 5BR8L 2XRSD 4KKUA 5IGGA 4L5TA 3HOZG 5BN3A 5EKIA 1QZGA 4A3GH 4O0AA 2E2DC 4X66L 2Z4IA 2DY7A 1G2SA 1M1KC 2A68D 3CAMA 1JICA 3M9BA 4Y52H 1DONA 3H15A 3ULPA 3CPWA 1TQOA 1LT3D 3ND8A 5C3EH 2OXPA 3KUPA 1I94L 1ZXTA 1EQVA 1NAPA 2LXJA 2SEBD 1YBYA 1E1TA 2AMCB 1SN8A 3GTGB 1Y1WH 3C2PA 3K57A 3PO2H 3I73A 2F0UA 3ER0A 1HTLD 1IXRA 1EOTA 3UDXA 4QCLA 3HOZB 3T4AC 4MNOA 5LMUQ 1N33Q 1AE2A 3URYA 2ZXRA 3ZJYC 2CWPA 3WWVA 1U5KA 1BF4A 4A3LG 4N9TA 4DV3Q 3OMGA 3I56A 2NB0A 2RVLA 1GVPA 4DA2A 1PRTD 3OHXC 4JI6L 3KF8B 1WJJA 3H3VC 1K8OA 2EJGC 2KHJA 2B2TC 2JE6I 3KOJA 3R2TA 4CJ0B 2JA9A 5JAVA 4HIOA 4OIJA 3KLSX 3TSSA 1GOZA 1ET6A 1T5XD 3OOCA 5KYLA 1CKNB 1GKHA 4IO9A 4DR3Q 3TRZA 1A62A 1SLJA 2XGTA 4FF1A 2UXDL 2F4IA 5FLXc 5C0XG 1X6OA 1YJ9A 1X32A 2K5HA 3QB3A 4IUVA 4DR7Q 3D31A 1CZWA 4GLAC 3Q6SA 4P72A 4U673 4HJ5A 2R92H 1EEID 4JC0A 4RFBA 1JE4A 2JXMB 4DV6Q 4NXML 1YZ6A 2K03A 2Q2TA 4H7BA 5M5XB 1HQMC 1I5FA 4KY7A 1VMCA 2FMMA 4MZ9A 2B2YA 3AYHB 4EQPA 5LL6S 1HR0W 3A74A 2F0NA 2R3ZA 2FXQA 2SNSA 4YHHQ 4DV0L 4LFBQ 4DPGA 4JK1C 3Q23A 2EXDA 2WB1E 1B70B 4HSPA 5ELCA 1R9TH 1DOKA 4QY7A 1HXYD 1IYVA 3D4RA 1PZKD 1PRTB 1Q12A 1EY7A 4IFDI 1JWSD 2A69C 2A5HA 1OXTA 1G8ZD 1BNZA 4HJ9A 2F4VL 2JA5G 2Z6KA 4QJFA 3AMUA 2K7VA 1F2YA 1T5EA 4DV4Q 2MPMA 2ZT9C 2KEEA 1SDFA 3EN2A 3D8GA 1QUQA 3EFXD 1DJRD 5LHY1 1V1OA 1ILPA 5C5LA 3HKZE 3R8BA 1HA5A 4JBKA 1NSNS 2E8GA 3TS0A 4RGNA 4X64Q 2MO0A 1WD1A 1R4PB 4V190 5COYA 2C9OA 4R1JA 4X65L 1L2FA 2RHSB 1X3FA 1BCPD 1N36L 4DV1Q 1PH3A 3OW2A 3MXPA 2JA5B 2L11A 1KDAA 2V4DA 3MXUA 2F0SA 4C3IG 1O78A 3ONAB 2EQSA 2PQAA 4DR4Q 2Y0SE 2AUJD 4JCVE 2F0MA 1X65A 1WTWA 1H9JA 1EYCA 4DK3C 1IBLL 4OHJA 3K5LA 1KLGD 2RDFA 1A2TA 1BKBA 4NXNQ 1XNQQ 1PTOD 1NBWA 4DAPA 5LMNL 2JA7G 1QNUA 2VXWA 1F9RA 5KIXA 4BY7H 1NCVA 2YTXA 1E24A 3V05A 2NN6I 4TQUS 2A19A 4K2KA 4JV5L 2EYMA 2ZTDA 3FEWX 1CQVA 1OXXK 4A3BG 4R8NA 2F0IA 3TEHB 4CBVA 2XTIA 4A3FH 2ZM6Q 4C3IB 2EYJA 3GTLB 2JQOA 3BZCA 5C6AA 2AWOA 2ATWA 2HIVA 4J1MA 4K0KQ 1PFNA 1BR9A 1F9SA 2JJQA 3BJUA 1SYBA 1G2TA 5I6YA 1EQRA 1OO9B 4LF4L 4GKKL 2JA7B 2EIFA 4JI0Q 4BBRH 4HSVA 1UEAB 4DUYQ 4LUZA 4XQJA 3H09A 4A3BB 2E2HH 4KLKA 1YHBA 2N78A 2PW7A 2QKIC 3GTMH 2MGSA 1BCPB 4K5WA 1VQBA 2L15A 5DM73 4L6TB 3U9OA 2JA6G 3I4NG 3MHBA 4GN4B 1Y8OB 5DM63 2Z6BA 1YHQA 2PI2E 2JYOA 4PQXA 4HMJA 1V1PB 2B2VC 1VQNA 5JJIA 3BVMA 1SR3A 2WKDA 1CHQD 3I72A 3S1NB 1PTOB 1ENAA 2KJXA 3U50C 1HNWL 1PH9A 1VCIA 2FFKB 1GM5A 5IWAQ 1KTKA 1LO5D 4OL7A 2WKCA 2B39A 2Q8IB 4JI8L 4DGZA 1WOCA 3GTKH 4PMBA 2LSSA 1EY9A 4P75A 5IP9H 3CKIB 5HURA 4IFDH 2JA6B 3I4NB 5J39A 4B3ML 3D3RA 3GTOH 1UE7A 5GADC 1XPRA 5BR8Q 2N49A 1WCMG 2IY5B 1YIJA 3J80c 1S5ED 2N88A 4PV1C 3CRLC 4QIWB 3JC66 1LT5D 5CC4A 4LF7L 4K8IA 5EKLA 5JEAJ 4XIGS 2EOTA 2IWHA 1LUZA 2E5LL 2SDFA 2F0KA 1I94Q 4UP9A 4B08A 5C4JH 1QUQB 1Q7YC 4JI4Q 1FYCA 4ABNA 2YV5A 1PV4A 3J81L 5M3FH 1WCMB 4HJAA 2B2UC 3TREA 5IGEA 4K5XA 1HZBA 1Y14B 2CH4W 1I3QB 2N3SA 5DLQE 3J7AV 1FJGQ 1AE3A 5E7NA 2I5HA 2F0OA 2NUCA 1C7YA 1K0RA 2ES2A 3FHWA 2NVXB 4BBSG 4O2DA 2KCCA 5IGBA 2ICIA 4OWTB 3NUCA 2BH2A 4GNXA 2NN6H 3DM3A 4XQQA 5E1FA 5KRUA 1D1KA 1LYLA 1PZID 1QB5D 4C2MB 4U68A 1D8LA 4X3KA 4KI0A 4RGTA 2PMZB 3L0OA 3HOUG 1BBUA 3A8JE 4XTCS 4L5RC 2MO1A 5C4XB 1WTRA 1HHVA 5EJWA 2M00A 5CBEE 5T1GA 4DUZQ 4A3MH 1Y69U 1HNZL 1I4HA 4HJ8A 2E74C 3K6OA 2ZJQA 2AQ3B 2C5CA 5H1SE 1CZGA 3KK7A 4FP5D 4BBSB 2MJ8A 5FOBB 5LMUL 4CKEA 3NP8A 3HOWG 2ZJPA 4DNRB 1A2UA 3DWPA 5JPMC 4DV3L 3RZDH 4NXMQ 3L3OC 4HEDA 3HOUB 3MA2B 4C3HB 2BA0A 3FPUB 1JC7A 3KLRA 1KABA 4IUNA 5E3FA 3RZOH 3M4OH 4DV0Q 5ELNA 4RCNA 3C1FA 3HOWB 1PYBA 2OT2A 3HOVH 1K83B 3BVGA 1YITA 1EIGA 3CPFA 1DM0B 5M5WB 4HR7B 3F1ZA 4S3SA 4BY1G 5L37A 2ZXPA 5IT9c 1W3SA 4DR7L 5BN5A 2OCEA 3TZDA 1VMPA 4IPCA 2R6GA 1JOKA 3BDLA 2HCCA 1IYUA 5FLMH 1RKNA 1IW7C 5JJLA 2CFMA 4DV6L 5IGFA 4A3DG 3S2DH 1S4ZA 1SFOB 3HOXH 1WTXA 1PA6A 1MD2D 3H3VH 3BZDB 5FJ8H 2KECA 1CA5A 1XMOL 1ZYRC 2KUMA 2IL8A 5IYBH 4X65Q 2L0CA 1LTID 3LX0A 4K14A 4DR6L 1G6PA 4M8AA 5FK9C 3TQYA 2F0FA 5J22A 1Z7TA 4G7HC 4A3GG 2X6LA 1NJIC 4IUUA 2CH4A 4KD3A 3K7AB 4UP7A 4Y7NH 1IBLQ 2VUMH 1VQJA 3RR5A 1YNXA 2LMCB 4LFCL 4A3DB 5C3EG 4LFAL 3CCLA 1EQTA 4I7AA 3S2HH 4KJNA 1EU4A 2Z8LA 3UI2A 1CK1A 1U0LA 3S1MH 3KBGA 1Y1WG 3PO2G 4JV5Q 3A0JA 1LTSD 1A8VA 3E9IA 1Q82C 2CWAA 5CR3A 1N32Q 3Q0AA 2A68C 2BE5C 3AFQA 4KK7A 3VYSA 4A4IA 4KKSA 4X64L 4A3GB 2O2LD 1HTPA 1IL2A 1YNJD 1FVIA 3I4MG 4B3TQ 1Q86C 2NVTB 1TWCH 1JB3A 1E7ZA 1SMXA 3P75A 1EYGA 3J81E 5C3EB 4OX9Q 3DXJC 3GTQH 3M3YB 4LF4Q 4GKKQ 1CFMA 3C1EA 3KF8A 5GAGC 1X3QA 1HUNA 2JN4A 3TDQA 4BS9A 5IGDA 1BVSA 2A6HC 1TWFH 3K5NA 1Y1WB 1D1IA 3PO2B 4LJZC 1PXUA 5C5MA 3PCOB 2B8GA 2PMZE 1YHAA 3VR4A 2KVMA 2ID0A 3NTKA 3A7LA 4PZ6A 3T56B 2IJ0A 3OIQA 1XNRL 3EROA 1CKNA 1D2BA 2K28A 4GN3B 3I4MB 2PI2A 2VL6A 5ELDA 1Y1VB 2LFNA 2WB1G 2R92G 4KKTA 4RAUC 4EQOA 4MTKA 1DOLA 1LM0A 5CV6A 3RD4A 3KJOA 1PDQA 2HIXA 1L0XB 1BXTA 1HNWQ 2V1CC 3A7AB 3DEOA 4JG2A 1LT4D 1TT2A 2DN8A 3BG3A 4JI8Q 4J15A 4JI0L 1MGSA 1CSPA 4OEMB 4J6HA 2Z0SA 2O5IC 3HKZG 1ENCA 4DUYL 4P74A 3I70A 3I4OA 4LNQA 2WB1B 2ZXOA 3PUYA 2R92B 4F88A 5C0XJ 2B2WA 2JEBI 4N8FA 5IYDG 3H91A 1CQFA 1HFGA 3F2DA 2ALYB 4H02A 1Z6HA 2E5LQ 3AFPA 1NMGA 1LTLA 3Q8DA 3TP7A 2UU9Q 2Y0SG 3A5ZB 5M3MG 1SE3A 4H0LC 4IJHA 4A3CH 4TSSA 1SBBB 2EZVA 1BDOA 1TXYA 3HKZB 4O1NA 1SYCA 4YCVA 1R9TB 2QDBA 4A75A 1JWMD 2KHSA 1KC8C 2K6AA 3K58A 4MN3A 1OXSC 1LTTD 3A56A 2LS01 2XN9C 3DLLA 5IY0A 1SNQA 3NSWA 2SOBA 4NW2A 5JEAH 3QO2A 2KQ3A 2WAQE 1GUSA 2Y0SB 1FNUA 5EQ0A 4NDXA 3I4LA 5M3MB 3S1RH 1MBYA 1B4OA 2EE1A 3KF6A 3CCJA 2PZWA 3MZ5A 3K81C 4RGMA 2L1BA 2PZUA 1QVCA 1OTCA 5C44H 5A2QL 1PH6A 3JAMc 1Z47A 2RF4A 3CQZH 4A93G 1PHJA 1HNZQ 3G71A 4KV6A 3FPPA 4JI4L 5IIFA 4B3SL 4ZQ3A 4R4OA 4UDUC 3ICEA 5CGKA 4XQNA 2HUGA 1ZEQX 3OYYA 4BA1I 3HZXA 1JJCB 1QVFA 2QCPX 1YJWA 1P8LA 4ZUIA 2RA4A 1YNND 1QCBD 3F2CA 4RHSA 2RSOA 2AQ2B 1FJGL 2I07B 3G48A 3I3CA 3MXNA 3AEVA 3BYYB 4BBRG 1YEZA 1I4RA 3I91A 1VS0A 5FLXE 4CJ1B 5JOBA 2CW0C 2L9HA 1X56A 3SXHA 1DXMA 4A93B 3IFTA 4UPAA 2VQEQ 3TP5A 4JW0A 5C3XA 4FVMA 1Q1EA 3HOYH 1MSGA 3CCUA 3PQIA 1F2LA 3J80L 3E9HA 4DUZL 1VQGA 2Q2HA 4O42A 1STNA 2Z6KC 4RKLA 1V1PA 3F2BA 1XJVA 2K5QA 3W3AA 3WDNA 1RD9D 4L5QA 5CORA 4BBRB 2OEOA 3HP3A 5ELOA 4EGVA 1X3GA 2BH8A 4IPDA 2NZOA 3MAQA 4IUTA 2B63H 1STYA 1XXGA 1S5FD 1A3UA 5KNCA 3QJYA 2F0WA 2OTJA 1FR3A 1ET9A 4JBWA 1F77A 4A3KH 1X54A 3DMUA 3FKIG 1HUMA 2K52A 2R93H 2DGYA 1XMOQ 2YU9H 1GHKA 3DUZA 4TKOB 1I6VC 2DNCA 1B50A 1B2TA 1LABA 4DR6Q 1TWAH 1N9WA 4FO2A 5EBDA 1I50H 1EWCA 2A1AA 1EOVA 5C0XI 2UUBQ 2D2CC 4YIJA 3OIPA 1KAAA 3MWYW 3NHHA 1N8RC 2EY5A 4LFCQ 1I4QA 4LFAQ 1LTBD 2F0DA 2B2TA 4N8X1 3MEHA 3FKIB 3LWEA 4QF4A 3S15H 4CDCC 3I2ZA 1JR0D 3UDIA 1MKHA 5G3LD 1CI3M 3KBXA 2DNEA 1H9MA 4OXPA 2UXBL 3AB9A 2R7FA 2E2IB 3ITPA 1Q90A 4IQZA 1SJED 4X3UA 2YYZA 3J81i 5C4ZA 3T16A 1QJOA 2X6GA 4OGQC 5C4HA 1F2MA 4LUOA 2NTTA 3M7NA 1AFPA 1B53A 1B44D 3H94A 1WFQA 4DV5Q 3S14B 1FGBD 3QIAA 1MJCA 3K8AA 1U4MA 4RG1A 5C4JB 3PO3H 4IOAA 1VQEA 1QZHA 3VR5A 4M1UB 3KF6B 3RNUA 1VQMA 1A3TA 1O7ZA 2F0TA 2P5ZX 2CVRA 3RLFA 1TY0A 3N52A 2XNAC 3NBHB 1XNRQ 5FO9B 3FMCA 1JE5A 3GTGH 2EY1A 1NE3A 3EA6A 2N8NA 5GROA 3HOZH 1BO0A 1N32L 1EEFD 5IT9L 2IHEA 2K5VA 5HGQA 5A2QE 3M4YA 3NE5B 5D65A 2AHOB 2C35B 2NTSA 2ZTCA 4B3TL 1GUOA 1GHJA 3MXNB 3R93A 4OX9L 3STBD 1UAPA 3QR8A 2NBFA 5DAUA 4CDEC 2L4NA 1PH8A 1EZ6A 3L7ZC 1EWHA 3M4QA 1W6KA 2F0JA 4OWXB 2E75C 5GQOA 1IKMA 4L63B 1SRUA 3J7ZC 1OXUA 4QB4A 2BDNA 4AIMA 2BDOA 4KHVA 4LW1A 4A3LH 1SYEA 1EY4A 2NVYH 1STGA 3EVQA 2M2LA 5ELEA 1C9OA 3LGJA 2BOSA 5EPLA 2F0QA 4CHTB 3RZOB 5FO7B 1XTCD 4A3JG 3IRBA 4IALA 1D5XC 4P73A 2UXCL 2XWJB 4IPGA 3CHBD 4XYOA 3VDYA 1LLRD 2MQHA 1JORA 5FJ8G 1M90C 1KQSA 3NK9A 5J3BA 4CGYB 4PZ8A 4GOPC 1Q1BA 2KCNA 1I4XA 1VQDA 2D5DA 3HG9A 3CCVA 4BXXH 1CM9A 4OO1G 4Q0FA 5C0XH 1SMYC 1HRJA 3X3MA 5K36G 2EJMA 3MXGA 3PUZA 1IL8A 4GNXC 3IFDA 2PW5A 4I7ZC 2VW9A 3CMAA 2VUMG 4NPSA 4TVAB 1L1OA 5DEHA 4A3JB 1HJPA 2ZTEA 4KTAA 1KNEA 2A69D 4YWMA 2UU9L 2RCNA 1OXVA 4F87A 2XWBB 3E0EA 4HIDA 1B3AA 4C3JG 4B3SQ 5KNDA 5TSSA 3NEMA 2OTLA 3VYUA 1LTAD 4IUPA 1SXTA 1TWHB 3NWSA 4A3IG 2EJFC 3P1HA 4KHZA 4OO1I 2FINB 3GTPH 2HCIA 3EQLC 2VUMB 2B2VA 2JA5H 3Q22A 4A3EH 1ESFA 4JI7L 5IOCA 2IX3A 1JQYD 3A54A 3S16B 4JBJA 1FGUA 4JOIA 5M5YB 4L5SA 4XT1B 4EX5A 1EIHA 4UY8C 4C3JB 1V43A 5GAHC 1Q46A 3OPOA 4PMCA 3GQBA 2EY6A 5CV9A 4A3IB 2E2JB 3K0YA 4R9WA 2FJ2A 3MTSA 2KA7A 1TWCB 3S17B 2CQOA 4DV7L 3RLOA 2WACA 3GTQB 4C3IH 4N9PA 2PQEA 5JJKA 4C1NK 5JJZA 2NVQB 2LXKA 3V96A 2R7ZG 1ICFB 1IBKQ 2AQ1B 5E4WC 4PNYA 4B3RL 4DK6C 1KD1C 2JA7H 2J4XA 1A15A 1ILQA 2MHVA 2HQLA 4IN3A 3OWEB 4KN4C 2K05A 5IT9E 2XVSA 2WIIB 3LWUA 2D62A 1CT1D 1B7YB 1RCVD 4IUQA 2VQEL 4GKJQ 4R4CA 1RF2D 5IYCH 1I6HB 2MUYA 1SNDA 3DWAA 4NKLA 3SK6A 1X3EA 5M9OA 4A3BH 4H44C 2B2UA 4AYBE 4IZ8A 1WTPA 5D3DA 1IKLA 5I9OA 3G4SA 1JB7A 3S1QB 2QW7A 1I4PA 5IP7H 3QOLA 2IX1A 3H0GG 1H9SA 2EVBA 3J7AF 2R7ZB 3GTJB 1QOHA 3D0FA 2PNRC 3KFUA 1PRTF 1HR0L 3S1NH 1SNOA 2NZHA 5FKAC 2WAQG 2TSSA 1AH9A 3JAML 1SNCA 3UE1A 5KYIA 1HZ9A 4ZKCB 1J6QA 3NENA 3M7GA 1O7LA 2JA8G 3PUWA 1PYWD 3U58A 1UUPA 2UXBQ 1PYSB 3T1HQ 1A0IA 3SHLA 1QE6A 2JA6H 4XYQA 1WYDA 3I4NH 4DFAA 2G9HD 3KJPA 3VR2A 3H0GB 2QILA 1SEBD 4BY1B 2CCZA 2EPBA 1CHPD 4IJLA 2A6EC 4OWWB 2WAQB 3RLNA 3IAYA 1IBML 3WOFA 1QVGA 1GUNA 1EQQA 1YJNA 1L1OB 4GLXA 2UUBL 1WI5A 3ULJA 5C44G 1HZCA 2JA8B 5BN4A 1TWGH 1PH2A 2EYHA 4FF2A 4ME3A 1EWIA 2DUDA 1LTGD 3E5SA 1E2WA 2R61A 1PH1A 2F03A 3QG1A 1WTOA 1J9OA 4PZ7A 1WCMH 3HKSA 1KIXA 1QNKA 3S1RB 1H95A 2NWGA 1K28A 3GDEA 5CV8A 1UNSA 3K80C 1UWVA 1S5BD 2NVXH 1X3PA 5C44B 1ICWA 3CQZB 4DV5L 5FO8B 2PCFB 4DNIA 2Q2UA 4QGUA 2K1BA 4RH6A 4C2MH 3NQIA 4ODGA 1S5DD 1K8AC 3HOYG 3GV6A 5G3LF 3W1BA 1YNNC 4WFN3 2EDGA 3R3OA 1RIPA 1JMCA 3CRKC 5C4XH 2RSNA 1NMFA 2F3WA 5LMNW 3UDGA 1XWEA 1PRTC 4DR1L 3B6YA 2Z1CA 2KEDA 1G51A 2UUAQ 1BCPF 3PMFA 4YWKA 1H9KA 2HDLA 3CCEA 5ISRA 1D7QA 1EYDA 2B63G 1ZKOA 5IODA 1AP0A 2WP8J 5NUCA 1CTMA 4HMIA 1A63A 2K01A 2VB2X 2I5MX 2A73B 2UXCQ 1PTOF 3CXCA 1VQOA 4C3HH 4OELB 2R93G 4I65A 4DR5Q 1X9NA 1LTRD 3W2DA 4LF8L 4R4TA 4CKCA 1S40A 1H9RA 4HTHA 1DZ1A 4DAVA 1U9RA 2UUCL 5EGTA 3CP0A 3SDZA 4LF5Q 5IE8A 3RMHA 1K83H 2RBMA 4DV2L 1W2BA 2B63B 4DU9A 4R4QA 1R4QB 3PUVA 5M5WH 2QA4A 1H9SB 3CCQA 2B8FA 4X62Q 5AJ3Q 4ULLA 4UP8A 2IPKD 2IW3A 3TMEA 3KDFA 4DR2Q 2R93B 1VQ8A 3BZKA 4ZCKA 1ENFA 2CQAA 1D6EC 4WJ3M 1KDCA 3E6ZX 1EY5A 4ME5A 1EFID 4CDDC 1SFOH 3PGZA 4FXKC 1IW7D 2RCFA 3M4PA 2DY8A 4FXGC 5GAEC 1HPCA 1TIID 1RDPD 3JAME 4YCWA 1V8QA 4Z9CB 1ZYRD 3ERQA 3CD6A 1BQQT 2PO4A 3CCMA 1CKMA 3V2TA 4DXFA 4IURA 4JI7Q 2G9DA 3NTHA 3PO3G 3K7AH 4KD4A 4AQYQ 2KOLA 3G6EA 1VQ7A 2F1MA 2YTVA 3S24A 2KCMA 2RDHA 4YWLA 4A3DH 2HD3A 4DK0A 1BCPC 4BY7G 3H6MA 1MI2A 1IZ6A 1K8GA 1UE1A 4EQNA 1PH4A 3NBHA 4LF9Q 1VQCA 1E1OA 1UE6A 5D14A 4A3FG
chains in the Genus database with same CATH topology
1QZHA 4DV7Q 3KF6B 3RNUA 4DKAC 1VQMA 1FJGQ 1Q8KA 1AE3A 3PSIA 5E7NA 5M5YH 2I5HA 1SROA 2K75A 3EBEA 3RLFA 1C7YA 1K0RA 2ES2A 3FHWA 2MNAA 1YVCA 2D0PA 4ALPA 4BBSG 4O2DA 3J81j 4C3JH 1PH5A 1ASZA 4R4IA 3NBHB 4P71A 1XNRQ 2NVTH 4MTNA 4OWTB 4JI1Q 1JE5A 2BH2A 1GD7A 3GTGH 4GNXA 1NE3A 3DM3A 4GOPB 4B3RQ 3M3YH 2N8NA 4A3IH 1LYLA 2E2JH 5GROA 1D8LA 1B8AA 4HJ7A 3HOZH 1N32L 4DV1L 4KI0A 1KAWA 3L0OA 3HOUG 1BBUA 1Y1VG 2IHEA 2K5VA 3CW2C 5HGQA 3S17H 4XTCS 4L5RC 2MO1A 4YCUA 3CCRA 4DR4L 3J80i 2AHOB 2C35B 2QGQA 2ZTCA 4DUZQ 4A3MH 1HNZL 4B3TL 4BBSH 4GNXB 2AWNA 3MXNB 3I55A 1ASYA 3OTOQ 2KCTA 4HJ8A 1SE8A 4NXNL 4OX9L 4JBMA 2NVQH 2ZJQA 3STBD 1XNQL 3STBC 5H1SE 3I4MH 5LMUL 3T1YL 3HOWG 2KHIA 4GS3A 1PH8A 1J5EL 2ZJPA 3L7ZC 3M4QA 3HOUH 1Y1VH 2KENA 4JYAQ 4A3KG 4OWXB 1VQKA 3PUXA 5GQOA 1HR0Q 3ULLA 4DV3L 1SRUA 3RZDH 2ASBA 3UE0A 4NXMQ 1I6HH 3J7ZC 3J81c 1OXUA 4AIMA 2ZM6L 3GO5A 2BA0A 2B29A 1IBKL 4LW1A 4A3LH 3GD7A 2NVYH 3HOWH 3RZOH 3M4OH 3S1QH 4DV0Q 4JI5Q 5ELNA 4IOCA 4BXXG 1C9OA 3AQQA 3LGJA 1NY4A 4POFA 5IP9G 4A76A 1UEBA 1VQAA 3GTJH 2R7ZH 4IFDG 4RMFA 1XMQL 4GKJL 4PMWA 2GVBA 1VQLA 1PYBA 4A93G 4JI3L 4A3JG 3HOVH 2K14A 1VQ5A 3IRBA 4P73A 2UXCL 1YITA 1VQ9A 2IX0A 4IPGA 3CPFA 4LF6Q 1DGSA 3VDYA 2MQHA 4B3MQ 1VQ4A 1JJ2A 5FJ8G 3F1ZA 1M90C 1KQSA 1YI2A 5J3BA 4BY1G 1N34L 4PZ8A 5IT9c 4GOPC 1Q1BA 1W3SA 2K5NA 1VQDA 3NELA 3CMEA 1RL2A 4DR7L 1IBMQ 4IFDJ 1KL9A 3CCVA 3BU2A 4BXXH 2F3IA 2OCEA 4IPCA 2R6GA 4JI2L 4OO1G 1VQ6A 2GN5A 5FLMH 1XTDA 5JJLA 2CFMA 4DV6L 3KDFB 5K36G 4LF7Q 4A3DG 2HHHQ 3H0GH 1FL0A 3S2DH 3PUZA 3HOXH 4GNXC 1CUKA 1PA6A 3H3VH 5FJ8H 2VW9A 3CMAA 2VUMG 1XMOL 4BY1H 4NPSA 4TVAB 1L1OA 1IYJB 5M3FG 1HJPA 4X65Q 5IYBH 2ZTEA 1HH2P 4KHPL 2A8VA 3T1HL 4DR6L 1G6PA 4FDBA 1KRTA 4YWMA 1K73C 2UU9L 5IYDH 2RCNA 4GN5A 3TQYA 5IWAL 4A3EG 4A3GG 1OXVA 2JA8H 4QQBX 1NJIC 3E0EA 4HIDA 4BA2I 4UP7A 2Q2IA 2VQFL 2OWOA 4Y7NH 1IBLQ 4B3SQ 3RN5A 2VUMH 3U4ZA 1JT8A 3NEMA 1VQJA 2OQKA 2YTYA 4DAYB 5BR8L 2OTLA 2NN6G 1YNXA 3RR5A 4LFCL 2CKZB 5M3MH 5C3EG 3CCLA 4LFAL 4A3IG 1HNXL 4L5TA 3S2HH 4KHZA 3HOZG 4OO1I 3GTPH 1U0LA 3S1MH 1QZGA 4A3EH 1Y1WG 3EIVA 2JA5H 3PO2G 4A3GH 4JV5Q 3A0JA 4O0AA 1A8VA 3E9IA 4X66L 1Q82C 4JI7L 3MEFA 2QEXA 3CC2A 2CWAA 4A3MG 1M1KC 1N32Q 1E22A 3CAMA 4JBJA 4A4IA 3M9BA 3AFQA 4DR1Q 4Y52H 4EQ5A 4X64L 1FGUA 4JOIA 4NB3A 3H15A 3ULPA 3CPWA 4L5SA 4EX5A 5C3EH 1IL2A 1I94L 4UY8C 1FVIA 2LXJA 3I4MG 1YBYA 4B3TQ 1MIUA 4AYBG 1Q86C 1V43A 3KLWA 1TWCH 1E1TA 1E7ZA 1Q46A 1SMXA 2AMCB 1SN8A 2RHQB 5GAHC 1Y1WH 1EYGA 3PO2H 4A3FG 3W1GA 3HFZB 4OX9Q 3GTQH 3ER0A 4LF4Q 4GKKQ 5GAGC 1IXRA 3UDXA 4YY3L 1BVSA 4MNOA 5LMUQ 3T1YQ 1N33Q 1TWFH 1AE2A 2CQOA 4DV7L 3ZJYC 2CWPA 3RLOA 3WWVA 4C3IH 1U5KA 3PCOB 4A93H 3HOYG 4A3LG 2PMZE 4APVA 5JJKA 1YHAA 5IYCG 4DV3Q 2AKWB 3I56A 4PG3A 3CCSA 1GVPA 4LF8Q 2JK8A 2ID0A 4JI6L 2VY3A 4PZ6A 1XNRL 3KF8B 1WJJA 2LXKA 2R7ZG 1CKNA 1BBWA 2KHJA 1IBKQ 4GN3B 2JE6I 3KOJA 3TS2A 4DK6C 4B3RL 1KD1C 2UUCQ 2JA7H 2JA9A 4HIOA 2PI2A 2VL6A 3UDFA 1JJGA 2HQLA 5IP7G 3HOVG 1K3RA 2KBNA 2WB1G 2R92G 4DV2Q 1L1OC 2UUAL 2D62A 1B7YB 2VQEL 4GKJQ 1XMQQ 4R4CA 1LM0A 5IYCH 3KJOA 2HIXA 4A3BH 1X3EA 1HNWQ 4JI3Q 1CKNB 2VS1A 1GKHA 5HY6A 4IO9A 4DR3Q 3TRZA 1S72A 1A62A 1SLJA 2XGTA 1O7IA 2V1CC 3OTOL 2UXDL 4AYBE 4JG2A 3J7A5 5FLXc 5C0XG 1X6OA 1YJ9A 5FLMG 3G4SA 4JI8Q 4J15A 1JB7A 2K5HA 4JI0L 4DR7Q 1CSPA 5IP7H 3D31A 4GLAC 2IX1A 3H0GG 2H5XA 4HJ5A 4P72A 3HOXG 5M5XH 2R92H 4JYAL 2Z0SA 3JAMi 3D0FA 3HKZG 1VQIA 3KFUA 3CC4A 3A5UA 4DUYL 1HR0L 4JC0A 4DR5L 4P74A 1L0WA 3S1NH 3I4OA 4NXML 4DV6Q 1YZ6A 3F8TA 5IYBG 2NZHA 4LNQA 2Q2TA 2WAQG 3PUYA 2F52A 1AH9A 3I4NH 3UE1A 5C0XJ 1I5FA 1HZ9A 2JEBI 5IYDG 1J6QA 4MZ9A 3NENA 3AYHB 1T9HA 1HR0W 2JA8G 4LF5L 3PUWA 3A74A 3PF5A 2FXQA 4YHHQ 3F2DA 4DV0L 3U58A 2ALYB 4JOIC 1V1QA 4H02A 4KHPQ 2UXBQ 4LFBQ 1PYSB 4DPGA 3T1HQ 1GO3E 1A0IA 3W5OA 2E5LQ 3AFPA 1NMGA 1LTLA 3Q8DA 2UU9Q 1WYDA 2EXDA 1B70B 2WB1E 2Y0SG 4POGA 1R9TH 2JA6H 3PF4A 4QY7A 3A5ZB 4X62L 5M3MG 5AJ3L 3KJPA 4IJHA 1Q12A 4A3CH 4IFDI 3L2PA 3RN2A 1MJEA 2VZAA 1TXYA 4DR2L 2VQFQ 3FKIH 1OXTA 1VQPA 1XPUA 4YCVA 4HJ9A 2F4VL 2JA5G 2Z6KA 2CCZA 4QJFA 4A75A 4IJLA 4OWWB 3RLNA 1KC8C 1IBML 1QVGA 1EQQA 4DV4Q 3H3VI 1YJNA 1L1OB 4GLXA 2UUBL 4OONA 1WI5A 3EN2A 2E2IH 3ULJA 5C44G 1HZCA 1OXSC 1QUQA 1TWGH 1PH2A 4X66Q 3HKZE 2HHHL 3DLLA 4JBKA 5IY0A 4ME3A 1EWIA 2DUDA 2E8GA 3TS0A 2WAQE 2ZJRA 1NTGA 4X64Q 2MO0A 1PH1A 3S1RH 4PZ7A 4R1JA 4X65L 3S14H 1WCMH 3KF6A 3CCJA 2GVAA 1L2FA 2RHSB 3HKSA 1X3FA 3K81C 1N36L 4DV1Q 4AQYL 1PH3A 1QVCA 3OW2A 1KIXA 1OTCA 5C44H 1PH6A 1H95A 3JAMc 1Z47A 2EQSA 2PQAA 2RF4A 3CQZH 1S3OA 1PHJA 1EIYB 4DR4Q 2R7DA 1HZAA 2Y0SE 5C4XG 3GDEA 3K80C 1UWVA 3G71A 1HNZQ 4JI4L 1PFSA 4JCVE 1X65A 4GOPA 2NVXH 4DK3C 1IBLL 4B3SL 2B3GA 4R4OA 3ICEA 4K0KL 1BKBA 4DV5L 4NXNQ 2Q2UA 4DNIA 1PVOA 1XNQQ 3PV0A 1NBWA 3OYYA 2K50A 4BA1I 2PNHA 5LMNL 4QGUA 4LF9L 2JA7G 1JJCB 3K0XA 1QVFA 4C2MH 4BY7H 1YJWA 1P8LA 2PQAB 1K8AC 1J5EQ 2YTXA 1E24A 4JI6Q 3I7FA 3W1BA 3F2CA 2NN6I 4TQUS 2A19A 1V9PA 1FJGL 4JV5L 2ZTDA 3G48A 1KHIA 1RIPA 1JMCA 5C4XH 3AEVA 3GTLH 1OXXK 4A3BG 3TEHB 1NMFA 5LMNW 3K7UC 1YEZA 4BBRG 3UDGA 1VS0A 2XTIA 4DR1L 4A3FH 3B6YA 1C0AA 2ZM6Q 4JI1L 4AH6A 1X56A 1G51A 2UUAQ 4UPAA 1EUJA 2VQEQ 2JQOA 3BZCA 2AWOA 2ATWA 2HIVA 2HT1A 4YWKA 4K0KQ 2I5LX 1KXLA 1Q1EA 3HOYH 2JJQA 3BJUA 3CCEA 3CCUA 1XPOA 2UXDQ 1EQRA 4DAMA 3M85A 1D7QA 2B63G 4LF4L 4GKKL 3E9HA 2WP8J 1A63A 1P16A 2EIFA 3CF5A 1PH7A 4DUZL 1VQGA 3PIOA 4JI0Q 2I5MX 4BBRH 1N33L 2Q2HA 2UXCQ 2Z6KC 3CXCA 1VQOA 4C3HH 1VQFA 3F2BA 1XJVA 1Z9FA 4DUYQ 2R93G 4LUVA 4LUZA 4DR5Q 1N34Q 2E2HH 1X9NA 4KLKA 4L5QA 4LF8L 1YHBA 4R4TA 2N78A 1EFWA 1S40A 3GTMH 1UE5A 5ELOA 1VQBA 1X3GA 2L15A 2BH8A 4IPDA 2NZOA 2I0QA 4JI2Q 1EIFA 2B63H 2JA6G 3I4NG 4GN4B 2UUCL 3CP0A 1YHQA 4LF5Q 2PI2E 3KYHC 2OTJA 5IE8A 1VQNA 4JBWA 4A3CG 1K83H 3ERSX 5JJIA 4DV2L 4A3KH 4WJ4A 1X54A 2IT1A 1SR3A 3FKIG 4R4QA 4IPHA 1W2BA 2VNUD 2K52A 2R93H 3PUVA 2DGYA 5M5WH 2QA4A 1XMOQ 3CCQA 2YU9H 3U50C 1G291 4X62Q 5AJ3Q 1HNWL 4UP8A 4X6AH 1CSQA 1PH9A 4JI5L 4DR3L 1VCIA 2WFWA 1KRSA 3KDFA 4DR6Q 4DR2Q 2BA1A 1TWAH 2IHFA 1GM5A 5IWAQ 1VQ8A 2F4VQ 3BZKA 4JI8L 1WOCA 3GTKH 1N9WA 1VQHA 2OQ0A 3PIPA 2LSSA 4WJ3M 1I50H 5JEAG 4P75A 2A1AA 1EOVA 3PGZA 5IP9H 5C0XI 4HIKA 2K4KA 1SFOH 2UUBQ 4B3ML 3GTOH 1UE7A 5GADC 1XPRA 1N8RC 5BR8Q 3M4PA 4LFCQ 2N49A 4LFAQ 4A3JH 1WCMG 5GAEC 3U4VA 1YIJA 3J80c 1HNXQ 2IY5B 5EAYA 4YCWA 4QL5A 3CC7A 1K9MC 3S15H 3JC66 3I2ZA 3UDIA 1MKHA 3CD6A 4JI7Q 3CCMA 1CKMA 2JEAI 4LF7L 5JEAJ 4YHHL 3PO3G 4OXPA 3K7AH 4XIGS 4LFBL 2UXBL 1N36Q 2R7FA 4AQYQ 1LUZA 3G6EA 2E5LL 1VQ7A 2YTVA 3S24A 2D0OA 2YYZA 1CKOA 2KCMA 3J81i 4YWLA 4A3DH 1I94Q 1TWHH 4QIWE 4UP9A 5C4JH 1Q81C 1X55A 1E3PA 1QUQB 4LUOA 1Q7YC 4JI4Q 3FP9A 1I3QH 4BY7G 3M7NA 2YV5A 1PV4A 4LWCA 1IZ6A 1K8GA 1WFQA 4DV5Q 1UE1A 5M3FH 1PH4A 4HJAA 3SGIA 3TREA 1MJCA 3K8AA 4LF9Q 4RG1A 5LMNQ 4GLVB 3PO3H 1HZBA 1VQCA 4YY3Q 1Y14B 4LF6L 4DV4L 1E1OA 4IOAA 2MFIA 2N3SA 1UE6A 4HIMA 1VQEA 3S16H 5DLQE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QZH A;  4DV7 Q;  3KF6 B;  3RNU A;  4DKA C;  1VQM A;  1FJG Q;  1Q8K A;  1AE3 A;  3PSI A;  5E7N A;  5M5Y H;  2I5H A;  1SRO A;  2K75 A;  3EBE A;  3RLF A;  1C7Y A;  1K0R A;  2ES2 A;  3FHW A;  2MNA A;  1YVC A;  2D0P A;  4ALP A;  4BBS G;  4O2D A;  3J81 j;  4C3J H;  1PH5 A;  1ASZ A;  4R4I A;  3NBH B;  4P71 A;  1XNR Q;  2NVT H;  4MTN A;  4OWT B;  4JI1 Q;  1JE5 A;  2BH2 A;  1GD7 A;  3GTG H;  4GNX A;  1NE3 A;  3DM3 A;  4GOP B;  4B3R Q;  3M3Y H;  2N8N A;  4A3I H;  1LYL A;  2E2J H;  5GRO A;  1D8L A;  1B8A A;  4HJ7 A;  3HOZ H;  1N32 L;  4DV1 L;  4KI0 A;  1KAW A;  3L0O A;  3HOU G;  1BBU A;  1Y1V G;  2IHE A;  2K5V A;  3CW2 C;  5HGQ A;  3S17 H;  4XTC S;  4L5R C;  2MO1 A;  4YCU A;  3CCR A;  4DR4 L;  3J80 i;  2AHO B;  2C35 B;  2QGQ A;  2ZTC A;  4DUZ Q;  4A3M H;  1HNZ L;  4B3T L;  4BBS H;  4GNX B;  2AWN A;  3MXN B;  3I55 A;  1ASY A;  3OTO Q;  2KCT A;  4HJ8 A;  1SE8 A;  4NXN L;  4OX9 L;  4JBM A;  2NVQ H;  2ZJQ A;  3STB D;  1XNQ L;  3STB C;  5H1S E;  3I4M H;  5LMU L;  3T1Y L;  3HOW G;  2KHI A;  4GS3 A;  1PH8 A;  1J5E L;  2ZJP A;  3L7Z C;  3M4Q A;  3HOU H;  1Y1V H;  2KEN A;  4JYA Q;  4A3K G;  4OWX B;  1VQK A;  3PUX A;  5GQO A;  1HR0 Q;  3ULL A;  4DV3 L;  1SRU A;  3RZD H;  2ASB A;  3UE0 A;  4NXM Q;  1I6H H;  3J7Z C;  3J81 c;  1OXU A;  4AIM A;  2ZM6 L;  3GO5 A;  2BA0 A;  2B29 A;  1IBK L;  4LW1 A;  4A3L H;  3GD7 A;  2NVY H;  3HOW H;  3RZO H;  3M4O H;  3S1Q H;  4DV0 Q;  4JI5 Q;  5ELN A;  4IOC A;  4BXX G;  1C9O A;  3AQQ A;  3LGJ A;  1NY4 A;  4POF A;  5IP9 G;  4A76 A;  1UEB A;  1VQA A;  3GTJ H;  2R7Z H;  4IFD G;  4RMF A;  1XMQ L;  4GKJ L;  4PMW A;  2GVB A;  1VQL A;  1PYB A;  4A93 G;  4JI3 L;  4A3J G;  3HOV H;  2K14 A;  1VQ5 A;  3IRB A;  4P73 A;  2UXC L;  1YIT A;  1VQ9 A;  2IX0 A;  4IPG A;  3CPF A;  4LF6 Q;  1DGS A;  3VDY A;  2MQH A;  4B3M Q;  1VQ4 A;  1JJ2 A;  5FJ8 G;  3F1Z A;  1M90 C;  1KQS A;  1YI2 A;  5J3B A;  4BY1 G;  1N34 L;  4PZ8 A;  5IT9 c;  4GOP C;  1Q1B A;  1W3S A;  2K5N A;  1VQD A;  3NEL A;  3CME A;  1RL2 A;  4DR7 L;  1IBM Q;  4IFD J;  1KL9 A;  3CCV A;  3BU2 A;  4BXX H;  2F3I A;  2OCE A;  4IPC A;  2R6G A;  4JI2 L;  4OO1 G;  1VQ6 A;  2GN5 A;  5FLM H;  1XTD A;  5JJL A;  2CFM A;  4DV6 L;  3KDF B;  5K36 G;  4LF7 Q;  4A3D G;  2HHH Q;  3H0G H;  1FL0 A;  3S2D H;  3PUZ A;  3HOX H;  4GNX C;  1CUK A;  1PA6 A;  3H3V H;  5FJ8 H;  2VW9 A;  3CMA A;  2VUM G;  1XMO L;  4BY1 H;  4NPS A;  4TVA B;  1L1O A;  1IYJ B;  5M3F G;  1HJP A;  4X65 Q;  5IYB H;  2ZTE A;  1HH2 P;  4KHP L;  2A8V A;  3T1H L;  4DR6 L;  1G6P A;  4FDB A;  1KRT A;  4YWM A;  1K73 C;  2UU9 L;  5IYD H;  2RCN A;  4GN5 A;  3TQY A;  5IWA L;  4A3E G;  4A3G G;  1OXV A;  2JA8 H;  4QQB X;  1NJI C;  3E0E A;  4HID A;  4BA2 I;  4UP7 A;  2Q2I A;  2VQF L;  2OWO A;  4Y7N H;  1IBL Q;  4B3S Q;  3RN5 A;  2VUM H;  3U4Z A;  1JT8 A;  3NEM A;  1VQJ A;  2OQK A;  2YTY A;  4DAY B;  5BR8 L;  2OTL A;  2NN6 G;  1YNX A;  3RR5 A;  4LFC L;  2CKZ B;  5M3M H;  5C3E G;  3CCL A;  4LFA L;  4A3I G;  1HNX L;  4L5T A;  3S2H H;  4KHZ A;  3HOZ G;  4OO1 I;  3GTP H;  1U0L A;  3S1M H;  1QZG A;  4A3E H;  1Y1W G;  3EIV A;  2JA5 H;  3PO2 G;  4A3G H;  4JV5 Q;  3A0J A;  4O0A A;  1A8V A;  3E9I A;  4X66 L;  1Q82 C;  4JI7 L;  3MEF A;  2QEX A;  3CC2 A;  2CWA A;  4A3M G;  1M1K C;  1N32 Q;  1E22 A;  3CAM A;  4JBJ A;  4A4I A;  3M9B A;  3AFQ A;  4DR1 Q;  4Y52 H;  4EQ5 A;  4X64 L;  1FGU A;  4JOI A;  4NB3 A;  3H15 A;  3ULP A;  3CPW A;  4L5S A;  4EX5 A;  5C3E H;  1IL2 A;  1I94 L;  4UY8 C;  1FVI A;  2LXJ A;  3I4M G;  1YBY A;  4B3T Q;  1MIU A;  4AYB G;  1Q86 C;  1V43 A;  3KLW A;  1TWC H;  1E1T A;  1E7Z A;  1Q46 A;  1SMX A;  2AMC B;  1SN8 A;  2RHQ B;  5GAH C;  1Y1W H;  1EYG A;  3PO2 H;  4A3F G;  3W1G A;  3HFZ B;  4OX9 Q;  3GTQ H;  3ER0 A;  4LF4 Q;  4GKK Q;  5GAG C;  1IXR A;  3UDX A;  4YY3 L;  1BVS A;  4MNO A;  5LMU Q;  3T1Y Q;  1N33 Q;  1TWF H;  1AE2 A;  2CQO A;  4DV7 L;  3ZJY C;  2CWP A;  3RLO A;  3WWV A;  4C3I H;  1U5K A;  3PCO B;  4A93 H;  3HOY G;  4A3L G;  2PMZ E;  4APV A;  5JJK A;  1YHA A;  5IYC G;  4DV3 Q;  2AKW B;  3I56 A;  4PG3 A;  3CCS A;  1GVP A;  4LF8 Q;  2JK8 A;  2ID0 A;  4JI6 L;  2VY3 A;  4PZ6 A;  1XNR L;  3KF8 B;  1WJJ A;  2LXK A;  2R7Z G;  1CKN A;  1BBW A;  2KHJ A;  1IBK Q;  4GN3 B;  2JE6 I;  3KOJ A;  3TS2 A;  4DK6 C;  4B3R L;  1KD1 C;  2UUC Q;  2JA7 H;  2JA9 A;  4HIO A;  2PI2 A;  2VL6 A;  3UDF A;  1JJG A;  2HQL A;  5IP7 G;  3HOV G;  1K3R A;  2KBN A;  2WB1 G;  2R92 G;  4DV2 Q;  1L1O C;  2UUA L;  2D62 A;  1B7Y B;  2VQE L;  4GKJ Q;  1XMQ Q;  4R4C A;  1LM0 A;  5IYC H;  3KJO A;  2HIX A;  4A3B H;  1X3E A;  1HNW Q;  4JI3 Q;  1CKN B;  2VS1 A;  1GKH A;  5HY6 A;  4IO9 A;  4DR3 Q;  3TRZ A;  1S72 A;  1A62 A;  1SLJ A;  2XGT A;  1O7I A;  2V1C C;  3OTO L;  2UXD L;  4AYB E;  4JG2 A;  3J7A 5;  5FLX c;  5C0X G;  1X6O A;  1YJ9 A;  5FLM G;  3G4S A;  4JI8 Q;  4J15 A;  1JB7 A;  2K5H A;  4JI0 L;  4DR7 Q;  1CSP A;  5IP7 H;  3D31 A;  4GLA C;  2IX1 A;  3H0G G;  2H5X A;  4HJ5 A;  4P72 A;  3HOX G;  5M5X H;  2R92 H;  4JYA L;  2Z0S A;  3JAM i;  3D0F A;  3HKZ G;  1VQI A;  3KFU A;  3CC4 A;  3A5U A;  4DUY L;  1HR0 L;  4JC0 A;  4DR5 L;  4P74 A;  1L0W A;  3S1N H;  3I4O A;  4NXM L;  4DV6 Q;  1YZ6 A;  3F8T A;  5IYB G;  2NZH A;  4LNQ A;  2Q2T A;  2WAQ G;  3PUY A;  2F52 A;  1AH9 A;  3I4N H;  3UE1 A;  5C0X J;  1I5F A;  1HZ9 A;  2JEB I;  5IYD G;  1J6Q A;  4MZ9 A;  3NEN A;  3AYH B;  1T9H A;  1HR0 W;  2JA8 G;  4LF5 L;  3PUW A;  3A74 A;  3PF5 A;  2FXQ A;  4YHH Q;  3F2D A;  4DV0 L;  3U58 A;  2ALY B;  4JOI C;  1V1Q A;  4H02 A;  4KHP Q;  2UXB Q;  4LFB Q;  1PYS B;  4DPG A;  3T1H Q;  1GO3 E;  1A0I A;  3W5O A;  2E5L Q;  3AFP A;  1NMG A;  1LTL A;  3Q8D A;  2UU9 Q;  1WYD A;  2EXD A;  1B70 B;  2WB1 E;  2Y0S G;  4POG A;  1R9T H;  2JA6 H;  3PF4 A;  4QY7 A;  3A5Z B;  4X62 L;  5M3M G;  5AJ3 L;  3KJP A;  4IJH A;  1Q12 A;  4A3C H;  4IFD I;  3L2P A;  3RN2 A;  1MJE A;  2VZA A;  1TXY A;  4DR2 L;  2VQF Q;  3FKI H;  1OXT A;  1VQP A;  1XPU A;  4YCV A;  4HJ9 A;  2F4V L;  2JA5 G;  2Z6K A;  2CCZ A;  4QJF A;  4A75 A;  4IJL A;  4OWW B;  3RLN A;  1KC8 C;  1IBM L;  1QVG A;  1EQQ A;  4DV4 Q;  3H3V I;  1YJN A;  1L1O B;  4GLX A;  2UUB L;  4OON A;  1WI5 A;  3EN2 A;  2E2I H;  3ULJ A;  5C44 G;  1HZC A;  1OXS C;  1QUQ A;  1TWG H;  1PH2 A;  4X66 Q;  3HKZ E;  2HHH L;  3DLL A;  4JBK A;  5IY0 A;  4ME3 A;  1EWI A;  2DUD A;  2E8G A;  3TS0 A;  2WAQ E;  2ZJR A;  1NTG A;  4X64 Q;  2MO0 A;  1PH1 A;  3S1R H;  4PZ7 A;  4R1J A;  4X65 L;  3S14 H;  1WCM H;  3KF6 A;  3CCJ A;  2GVA A;  1L2F A;  2RHS B;  3HKS A;  1X3F A;  3K81 C;  1N36 L;  4DV1 Q;  4AQY L;  1PH3 A;  1QVC A;  3OW2 A;  1KIX A;  1OTC A;  5C44 H;  1PH6 A;  1H95 A;  3JAM c;  1Z47 A;  2EQS A;  2PQA A;  2RF4 A;  3CQZ H;  1S3O A;  1PHJ A;  1EIY B;  4DR4 Q;  2R7D A;  1HZA A;  2Y0S E;  5C4X G;  3GDE A;  3K80 C;  1UWV A;  3G71 A;  1HNZ Q;  4JI4 L;  1PFS A;  4JCV E;  1X65 A;  4GOP A;  2NVX H;  4DK3 C;  1IBL L;  4B3S L;  2B3G A;  4R4O A;  3ICE A;  4K0K L;  1BKB A;  4DV5 L;  4NXN Q;  2Q2U A;  4DNI A;  1PVO A;  1XNQ Q;  3PV0 A;  1NBW A;  3OYY A;  2K50 A;  4BA1 I;  2PNH A;  5LMN L;  4QGU A;  4LF9 L;  2JA7 G;  1JJC B;  3K0X A;  1QVF A;  4C2M H;  4BY7 H;  1YJW A;  1P8L A;  2PQA B;  1K8A C;  1J5E Q;  2YTX A;  1E24 A;  4JI6 Q;  3I7F A;  3W1B A;  3F2C A;  2NN6 I;  4TQU S;  2A19 A;  1V9P A;  1FJG L;  4JV5 L;  2ZTD A;  3G48 A;  1KHI A;  1RIP A;  1JMC A;  5C4X H;  3AEV A;  3GTL H;  1OXX K;  4A3B G;  3TEH B;  1NMF A;  5LMN W;  3K7U C;  1YEZ A;  4BBR G;  3UDG A;  1VS0 A;  2XTI A;  4DR1 L;  4A3F H;  3B6Y A;  1C0A A;  2ZM6 Q;  4JI1 L;  4AH6 A;  1X56 A;  1G51 A;  2UUA Q;  4UPA A;  1EUJ A;  2VQE Q;  2JQO A;  3BZC A;  2AWO A;  2ATW A;  2HIV A;  2HT1 A;  4YWK A;  4K0K Q;  2I5L X;  1KXL A;  1Q1E A;  3HOY H;  2JJQ A;  3BJU A;  3CCE A;  3CCU A;  1XPO A;  2UXD Q;  1EQR A;  4DAM A;  3M85 A;  1D7Q A;  2B63 G;  4LF4 L;  4GKK L;  3E9H A;  2WP8 J;  1A63 A;  1P16 A;  2EIF A;  3CF5 A;  1PH7 A;  4DUZ L;  1VQG A;  3PIO A;  4JI0 Q;  2I5M X;  4BBR H;  1N33 L;  2Q2H A;  2UXC Q;  2Z6K C;  3CXC A;  1VQO A;  4C3H H;  1VQF A;  3F2B A;  1XJV A;  1Z9F A;  4DUY Q;  2R93 G;  4LUV A;  4LUZ A;  4DR5 Q;  1N34 Q;  2E2H H;  1X9N A;  4KLK A;  4L5Q A;  4LF8 L;  1YHB A;  4R4T A;  2N78 A;  1EFW A;  1S40 A;  3GTM H;  1UE5 A;  5ELO A;  1VQB A;  1X3G A;  2L15 A;  2BH8 A;  4IPD A;  2NZO A;  2I0Q A;  4JI2 Q;  1EIF A;  2B63 H;  2JA6 G;  3I4N G;  4GN4 B;  2UUC L;  3CP0 A;  1YHQ A;  4LF5 Q;  2PI2 E;  3KYH C;  2OTJ A;  5IE8 A;  1VQN A;  4JBW A;  4A3C G;  1K83 H;  3ERS X;  5JJI A;  4DV2 L;  4A3K H;  4WJ4 A;  1X54 A;  2IT1 A;  1SR3 A;  3FKI G;  4R4Q A;  4IPH A;  1W2B A;  2VNU D;  2K52 A;  2R93 H;  3PUV A;  2DGY A;  5M5W H;  2QA4 A;  1XMO Q;  3CCQ A;  2YU9 H;  3U50 C;  1G29 1;  4X62 Q;  5AJ3 Q;  1HNW L;  4UP8 A;  4X6A H;  1CSQ A;  1PH9 A;  4JI5 L;  4DR3 L;  1VCI A;  2WFW A;  1KRS A;  3KDF A;  4DR6 Q;  4DR2 Q;  2BA1 A;  1TWA H;  2IHF A;  1GM5 A;  5IWA Q;  1VQ8 A;  2F4V Q;  3BZK A;  4JI8 L;  1WOC A;  3GTK H;  1N9W A;  1VQH A;  2OQ0 A;  3PIP A;  2LSS A;  4WJ3 M;  1I50 H;  5JEA G;  4P75 A;  2A1A A;  1EOV A;  3PGZ A;  5IP9 H;  5C0X I;  4HIK A;  2K4K A;  1SFO H;  2UUB Q;  4B3M L;  3GTO H;  1UE7 A;  5GAD C;  1XPR A;  1N8R C;  5BR8 Q;  3M4P A;  4LFC Q;  2N49 A;  4LFA Q;  4A3J H;  1WCM G;  5GAE C;  3U4V A;  1YIJ A;  3J80 c;  1HNX Q;  2IY5 B;  5EAY A;  4YCW A;  4QL5 A;  3CC7 A;  1K9M C;  3S15 H;  3JC6 6;  3I2Z A;  3UDI A;  1MKH A;  3CD6 A;  4JI7 Q;  3CCM A;  1CKM A;  2JEA I;  4LF7 L;  5JEA J;  4YHH L;  3PO3 G;  4OXP A;  3K7A H;  4XIG S;  4LFB L;  2UXB L;  1N36 Q;  2R7F A;  4AQY Q;  1LUZ A;  3G6E A;  2E5L L;  1VQ7 A;  2YTV A;  3S24 A;  2D0O A;  2YYZ A;  1CKO A;  2KCM A;  3J81 i;  4YWL A;  4A3D H;  1I94 Q;  1TWH H;  4QIW E;  4UP9 A;  5C4J H;  1Q81 C;  1X55 A;  1E3P A;  1QUQ B;  4LUO A;  1Q7Y C;  4JI4 Q;  3FP9 A;  1I3Q H;  4BY7 G;  3M7N A;  2YV5 A;  1PV4 A;  4LWC A;  1IZ6 A;  1K8G A;  1WFQ A;  4DV5 Q;  1UE1 A;  5M3F H;  1PH4 A;  4HJA A;  3SGI A;  3TRE A;  1MJC A;  3K8A A;  4LF9 Q;  4RG1 A;  5LMN Q;  4GLV B;  3PO3 H;  1HZB A;  1VQC A;  4YY3 Q;  1Y14 B;  4LF6 L;  4DV4 L;  1E1O A;  4IOA A;  2MFI A;  2N3S A;  1UE6 A;  4HIM A;  1VQE A;  3S16 H;  5DLQ E; 
#chains in the Genus database with same CATH topology
 1B3Q A;  1I4G A;  4DV7 Q;  4DKA C;  1Q8K A;  3PSI A;  2DJF C;  1SRO A;  2K33 A;  1PTO C;  1Q8I A;  3PO3 B;  1GUT A;  2K04 A;  2MNA A;  5LL6 X;  1G6Z A;  2BE5 D;  3K59 A;  5K5P A;  2NVT H;  4P71 A;  4K5V A;  2WIN B;  4MTN A;  4JI1 Q;  4DN4 M;  1A6X A;  5D3I B;  4B3R Q;  3M3Y H;  5EPK A;  5ELF A;  4CDF C;  4HJ7 A;  4BY7 B;  3AU7 A;  4C56 C;  2B2Y C;  3CW2 C;  1MSH A;  4XT3 B;  5I2Y A;  4YCU A;  5IGC A;  2QGQ A;  2A6H D;  4A3F B;  3MFY A;  1U4L A;  2AWN A;  1A3V A;  3BDO A;  1ASY A;  3HEJ A;  4JBM A;  4HCE A;  2ENB A;  3STB C;  3T53 B;  1M4V A;  3I4M H;  3IKJ A;  3MFG A;  1K0S A;  3I8Z A;  1J5E L;  1Y1V H;  2KEN A;  1TS5 A;  1VQK A;  5I2X A;  1HR0 Q;  3ULL A;  3UE0 A;  4RA8 A;  2EYL A;  3OWF A;  1GXD C;  2B29 A;  1IBK L;  4MHE A;  2E2H B;  1DYQ A;  3GD7 A;  2F0G A;  3GTM B;  2EY2 A;  4JI5 Q;  2CHB D;  1TS3 A;  2M9V A;  4BXX G;  2SNM A;  3AQQ A;  5IP9 G;  4POF A;  4A76 A;  4IFD G;  3D4D A;  4GKJ L;  4RMF A;  3SE0 A;  2GVB A;  2NVY B;  3MC0 B;  4CKB A;  2EXZ A;  2L55 A;  5CV5 A;  2K14 A;  3ZYY X;  1D5M C;  4F7X A;  1VQ9 A;  4LF6 Q;  1DGS A;  1QG7 A;  1BBX C;  1JJ2 A;  1HA6 A;  2WV6 D;  3QOJ A;  1WTH A;  1D5Z C;  1N34 L;  1ML0 D;  2K5N A;  3CME A;  2O5J C;  2X69 A;  1K8M A;  1IBM Q;  2NZ1 D;  1DOM A;  4JI2 L;  4H13 C;  2ICE C;  2GN5 A;  5F2D A;  1EY0 A;  3GTK B;  3KDF B;  1KLU D;  5KNB A;  1FL0 A;  1CUK A;  3GTO B;  2H1E A;  3BYT B;  3PIO 3;  1CA6 A;  5I4D A;  4BWG B;  5M3F G;  5EKK A;  4ZYS A;  4KY6 A;  4FF4 A;  1HH2 P;  1PFM A;  2A8V A;  3G7L A;  1EY6 A;  4B9W A;  3T1H L;  5IYD H;  4WJW A;  4ZRZ A;  2QF7 A;  2Z4H A;  4A3E G;  3D6C A;  1LAC A;  4QQB X;  2QDL A;  4BA2 I;  1JOQ A;  2Q2I A;  5CMD A;  3VA7 A;  3P20 A;  3K5O A;  3RN5 A;  2OQK A;  2NN6 G;  1HQR D;  2CKZ B;  5M3M H;  1WTV A;  5CYU A;  1HNX L;  4ZAI A;  3FRP B;  2D9U A;  1RJT A;  2TMP A;  1ONL A;  3EIV A;  5M3F B;  4RWS C;  1LV9 A;  1U4P A;  4KY5 A;  4JPB W;  3MEF A;  2QEX A;  3J7Y W;  2F3V A;  3EJI A;  4Q5V A;  4UAI A;  3CC2 A;  5EPJ A;  4A3M G;  3OSO A;  1E22 A;  3GTP B;  4X3T A;  1BOS A;  4FYD A;  4DR1 Q;  4EQ5 A;  4A3E B;  4NB3 A;  3PIP 3;  1VF7 A;  3VYT A;  1C8C A;  4FNF A;  3NXW A;  2PZT A;  1E0B A;  1WTQ A;  1MIU A;  4AYB G;  3KLW A;  2O4X A;  3WOE A;  4G7Z C;  1U4R A;  1RHP A;  2RHQ B;  3VR6 A;  4K6L A;  3W1G A;  3HFZ B;  3VYR A;  2F0L A;  2K5D A;  4YY3 L;  2JSO A;  4QUC A;  2RDG A;  3SVM A;  3NWT A;  3T1Y Q;  1WVL A;  1Q3L A;  1PFB A;  4A93 H;  3D4W A;  3NTI A;  4APV A;  5IYC G;  1JWU D;  2AKW B;  4A3M B;  4PG3 A;  3CCS A;  4LF8 Q;  2JK8 A;  3C3L A;  3TN2 A;  2VY3 A;  2CW0 D;  4HAE A;  1DCZ A;  4NP5 A;  1BBW A;  3O13 A;  3TS2 A;  2PPB C;  3SR1 A;  4V0B A;  2UUC Q;  1JCK B;  1O7Y A;  4AYB B;  2LY7 A;  3UDF A;  1JJG A;  1ROD A;  5IP7 G;  3HOV G;  2OF1 A;  1K3R A;  2KBN A;  1TY2 A;  4DV2 Q;  1L1O C;  1TS2 A;  2L12 A;  2UUA L;  1NR4 A;  1XMQ Q;  1FD7 D;  3DEP A;  3RZD B;  5J1Z A;  5C3W A;  4JI3 Q;  2VS1 A;  3G6J B;  5HY6 A;  3SK5 A;  4FXD A;  1S72 A;  3FDT A;  1O7I A;  3OTO L;  3J7A 5;  4RHR A;  3J80 E;  2I46 A;  3P7J A;  5FLM G;  3M4O B;  1EL0 A;  1J8I A;  1TR5 A;  2FHT A;  2H5X A;  3HOX G;  5M5X H;  4JYA L;  3JAM i;  5I9P A;  3T13 A;  1VQI A;  3CC4 A;  3A5U A;  1NUC A;  4DR5 L;  4XXE A;  1L0W A;  4G7O C;  1II3 A;  3HOV B;  3F8T A;  5IYB G;  1MHW C;  2F52 A;  3DHQ A;  4K2L A;  4QUF A;  1E2Z A;  3FVQ A;  1AN8 A;  4G57 A;  2N55 A;  5JVH 3;  1B9N A;  1T9H A;  2MP1 A;  4DF7 A;  4LF5 L;  3PF5 A;  4KHP Q;  4JOI C;  1V1Q A;  1GJX A;  1GO3 E;  3KLS A;  3VA5 A;  3W5O A;  4HN7 A;  4POG A;  4KN7 C;  2F0E A;  1EZ8 A;  3PF4 A;  1SYG A;  5T1I A;  4LAA A;  4X62 L;  5AJ3 L;  3TP6 A;  4G4K A;  3S2D B;  3HOX B;  3L2P A;  3RN2 A;  1MJE A;  2VZA A;  4DR2 L;  2VQF Q;  3FKI H;  4RCO A;  1VQP A;  1XPU A;  1STE A;  3A55 A;  4RGO S;  3H3V I;  3GV3 A;  1KDB A;  4OON A;  2E2I H;  3DWQ A;  2Q8R E;  4X66 Q;  4E6I A;  2HHH L;  1VF5 C;  3HS0 C;  4Y7N B;  2ZJR A;  1NTG A;  4HCS A;  1TWG B;  2RKS A;  3S2H B;  3OMC A;  5JPN C;  3S14 H;  2PYK A;  2GVA A;  1TVX A;  4AQY L;  3T51 B;  4DK1 A;  3U9S A;  3S1M B;  2G5D A;  5CV4 A;  3TP8 A;  2F0P A;  1EIY B;  1S3O A;  2EYP A;  2VB3 X;  5C4X G;  2R7D A;  1HZA A;  1YNJ C;  1NR2 A;  1PFS A;  1SE2 A;  4GOP A;  2Z9H A;  1F9P A;  2B3G A;  5KGU A;  1F2Z A;  3E0J A;  4F8M A;  1SAP A;  3MVV A;  1PVO A;  1EU3 A;  3NBI A;  3PV0 A;  4P2C B;  2K50 A;  4LF9 L;  2PNH A;  3K0X A;  5E4X A;  1J5E Q;  4JI6 Q;  2PQA B;  4K0K L;  3I7F A;  1V9P A;  4ZK9 B;  1KHI A;  3GTL H;  1STH A;  3A8K E;  3NPP A;  1K3B C;  1TWF B;  3K7U C;  4L8J A;  4FF3 A;  1C0A A;  4GZY C;  4JI1 L;  4AH6 A;  2K5W A;  4C3H G;  1EUJ A;  1IHZ A;  1RTN A;  2LKV A;  2HT1 A;  2E76 C;  2I5L X;  4QMG A;  1KXL A;  2XSC A;  1XPO A;  2UXD Q;  1DD2 A;  4DAM A;  3N6R A;  1S5C D;  3M85 A;  2BCO A;  2NYZ D;  1BUV T;  4X3S A;  1JOO A;  1P16 A;  2DJG C;  3CF5 A;  4EVO A;  1PH7 A;  3PIO A;  1N33 L;  1EY8 A;  2RQX A;  3S9W A;  1FNW A;  1VQF A;  1Z9F A;  4LUV A;  1L0Y B;  1N34 Q;  1EFW A;  3BS1 A;  1AZQ A;  1UE5 A;  2I0Q A;  4JI2 Q;  1EIF A;  1PTO H;  3DM1 A;  3KYH C;  1HFN A;  1PLF A;  3HGB A;  4A3C G;  4LMQ D;  3ERS X;  1FNV A;  4WJ4 A;  2IT1 A;  4IPH A;  1PMR A;  2VNU D;  4K6D A;  5EBC A;  3TBI B;  1G29 1;  3QWN A;  4ZUJ A;  4X6A H;  1CSQ A;  4B9X A;  4JI5 L;  4DR3 L;  2WFW A;  1KRS A;  1SNM A;  2BA1 A;  2IHF A;  4DNT B;  2F4V Q;  5HGT A;  3PIP A;  1VQH A;  2OQ0 A;  5JEA G;  4HIK A;  4R8I A;  4LF6 L;  2K4K A;  1SMY D;  4ZKB B;  1GUW A;  5CBA E;  2AUK A;  4ID6 A;  2QEJ C;  4A3J H;  1HNX Q;  3U4V A;  1B9M A;  5EAY A;  5I6W A;  1SYF A;  1TU2 B;  3OW7 A;  2XRQ D;  4QL5 A;  3CC7 A;  2A74 C;  1K9M C;  2J7Z A;  2JEA I;  4YHH L;  3SK8 A;  1AZP A;  4DAY A;  3X3N A;  4LFB L;  1N36 Q;  1B1Z A;  4OO1 H;  1SSO A;  1C48 A;  2D0O A;  4OIK A;  1CKO A;  5K36 H;  1TWH H;  4QIW E;  2GA4 B;  1Q81 C;  1X55 A;  1E3P A;  2F0V A;  3FP9 A;  4WRD A;  3RUZ A;  1I3Q H;  4LWC A;  3K5M A;  3SGI A;  3Q24 A;  2EYF A;  5LMN Q;  4GLV B;  4YY3 Q;  5ELB A;  4UHV A;  4DV4 L;  2MFI A;  4HIM A;  3I90 A;  3S16 H;  4C1N I;  3BVZ A;  2H4O A;  1QWY A;  1PZJ D;  1W6J A;  5M5Y H;  1QIL A;  3ND9 A;  1EYA A;  2K75 A;  3EBE A;  2K32 A;  1YVC A;  3SEB A;  2D0P A;  5FLX L;  4ALP A;  3J81 j;  4JVZ A;  4C3J H;  1PH5 A;  5A35 A;  1ASZ A;  4R4I A;  4WOR A;  1GD7 A;  1Y8P B;  2HQE A;  4GOP B;  4A3I H;  2E2J H;  1C4Q A;  2B2W C;  1B8A A;  4KMU C;  3BDC A;  4DV1 L;  1KAW A;  1TKW B;  1Y1V G;  5KEE A;  3S17 H;  4KJO A;  2F0H A;  3CCR A;  4DR4 L;  3J80 i;  1XX8 A;  4BBS H;  4MIU A;  3L9A X;  4GNX B;  4J8Q A;  1O80 A;  3I55 A;  3OTO Q;  2KCT A;  1M8A A;  1HCZ A;  1SE8 A;  4NXN L;  2NVQ H;  1XNQ L;  1AEX A;  1SYD A;  3CU7 A;  3T1Y L;  2KHI A;  4GS3 A;  1SNP A;  3HOY B;  3HOU H;  4JYA Q;  4A3K G;  5CV7 A;  3PUX A;  3GP7 A;  1NNX A;  2ASB A;  1I6H H;  1RTO A;  4TRD A;  3J81 c;  2ZM6 L;  3GO5 A;  3TZU A;  5DNF A;  1TS4 A;  1KNA A;  4K8J A;  1AW7 A;  1ESR A;  3HOW H;  3S1Q H;  4IOC A;  1NY4 A;  3LNN A;  4CJ2 C;  2R7Z H;  1UEB A;  1VQA A;  3GTJ H;  1XMQ L;  1STB A;  3R2I A;  4PMW A;  2J0T D;  1VQL A;  2JP1 A;  4JI3 L;  1STA A;  1VQ5 A;  1VDZ A;  4A3K B;  2IX0 A;  2EYO A;  5JVG 3;  4B3M Q;  1VQ4 A;  1WD0 A;  2YU9 B;  1YI2 A;  1LT6 D;  2L5T A;  3IL8 A;  2XIW A;  3NEL A;  1RL2 A;  4IFD J;  1KL9 A;  3BU2 A;  2F3I A;  3E3X A;  1G91 A;  1TWA B;  3A8I E;  3F2U A;  3HRZ C;  1VQ6 A;  3C46 A;  1E2V A;  4XDX A;  3SK4 A;  1XTD A;  4DXG A;  4LF7 Q;  2HDM A;  2HHH Q;  1GUG A;  1I50 B;  3H0G H;  3D6W A;  4ILW A;  3VR3 A;  4BY1 H;  1F9Q A;  1IYJ B;  4KHP L;  4LK1 C;  4ZLT F;  4FDB A;  1KRT A;  3S15 B;  1K73 C;  4GN5 A;  5IWA L;  4RKB A;  2A6E D;  2JA8 H;  3NQT A;  2FMC A;  1SJH D;  2VQF L;  1XYI A;  2OWO A;  5AFW A;  1Y8N B;  1SE4 A;  2Q8T A;  4NMZ A;  3U4Z A;  1JT8 A;  2YTY A;  4DAY B;  5BR8 L;  2XRS D;  4KKU A;  5IGG A;  4L5T A;  3HOZ G;  5BN3 A;  5EKI A;  1QZG A;  4A3G H;  4O0A A;  2E2D C;  4X66 L;  2Z4I A;  2DY7 A;  1G2S A;  1M1K C;  2A68 D;  3CAM A;  1JIC A;  3M9B A;  4Y52 H;  1DON A;  3H15 A;  3ULP A;  3CPW A;  1TQO A;  1LT3 D;  3ND8 A;  5C3E H;  2OXP A;  3KUP A;  1I94 L;  1ZXT A;  1EQV A;  1NAP A;  2LXJ A;  2SEB D;  1YBY A;  1E1T A;  2AMC B;  1SN8 A;  3GTG B;  1Y1W H;  3C2P A;  3K57 A;  3PO2 H;  3I73 A;  2F0U A;  3ER0 A;  1HTL D;  1IXR A;  1EOT A;  3UDX A;  4QCL A;  3HOZ B;  3T4A C;  4MNO A;  5LMU Q;  1N33 Q;  1AE2 A;  3URY A;  2ZXR A;  3ZJY C;  2CWP A;  3WWV A;  1U5K A;  1BF4 A;  4A3L G;  4N9T A;  4DV3 Q;  3OMG A;  3I56 A;  2NB0 A;  2RVL A;  1GVP A;  4DA2 A;  1PRT D;  3OHX C;  4JI6 L;  3KF8 B;  1WJJ A;  3H3V C;  1K8O A;  2EJG C;  2KHJ A;  2B2T C;  2JE6 I;  3KOJ A;  3R2T A;  4CJ0 B;  2JA9 A;  5JAV A;  4HIO A;  4OIJ A;  3KLS X;  3TSS A;  1GOZ A;  1ET6 A;  1T5X D;  3OOC A;  5KYL A;  1CKN B;  1GKH A;  4IO9 A;  4DR3 Q;  3TRZ A;  1A62 A;  1SLJ A;  2XGT A;  4FF1 A;  2UXD L;  2F4I A;  5FLX c;  5C0X G;  1X6O A;  1YJ9 A;  1X32 A;  2K5H A;  3QB3 A;  4IUV A;  4DR7 Q;  3D31 A;  1CZW A;  4GLA C;  3Q6S A;  4P72 A;  4U67 3;  4HJ5 A;  2R92 H;  1EEI D;  4JC0 A;  4RFB A;  1JE4 A;  2JXM B;  4DV6 Q;  4NXM L;  1YZ6 A;  2K03 A;  2Q2T A;  4H7B A;  5M5X B;  1HQM C;  1I5F A;  4KY7 A;  1VMC A;  2FMM A;  4MZ9 A;  2B2Y A;  3AYH B;  4EQP A;  5LL6 S;  1HR0 W;  3A74 A;  2F0N A;  2R3Z A;  2FXQ A;  2SNS A;  4YHH Q;  4DV0 L;  4LFB Q;  4DPG A;  4JK1 C;  3Q23 A;  2EXD A;  2WB1 E;  1B70 B;  4HSP A;  5ELC A;  1R9T H;  1DOK A;  4QY7 A;  1HXY D;  1IYV A;  3D4R A;  1PZK D;  1PRT B;  1Q12 A;  1EY7 A;  4IFD I;  1JWS D;  2A69 C;  2A5H A;  1OXT A;  1G8Z D;  1BNZ A;  4HJ9 A;  2F4V L;  2JA5 G;  2Z6K A;  4QJF A;  3AMU A;  2K7V A;  1F2Y A;  1T5E A;  4DV4 Q;  2MPM A;  2ZT9 C;  2KEE A;  1SDF A;  3EN2 A;  3D8G A;  1QUQ A;  3EFX D;  1DJR D;  5LHY 1;  1V1O A;  1ILP A;  5C5L A;  3HKZ E;  3R8B A;  1HA5 A;  4JBK A;  1NSN S;  2E8G A;  3TS0 A;  4RGN A;  4X64 Q;  2MO0 A;  1WD1 A;  1R4P B;  4V19 0;  5COY A;  2C9O A;  4R1J A;  4X65 L;  1L2F A;  2RHS B;  1X3F A;  1BCP D;  1N36 L;  4DV1 Q;  1PH3 A;  3OW2 A;  3MXP A;  2JA5 B;  2L11 A;  1KDA A;  2V4D A;  3MXU A;  2F0S A;  4C3I G;  1O78 A;  3ONA B;  2EQS A;  2PQA A;  4DR4 Q;  2Y0S E;  2AUJ D;  4JCV E;  2F0M A;  1X65 A;  1WTW A;  1H9J A;  1EYC A;  4DK3 C;  1IBL L;  4OHJ A;  3K5L A;  1KLG D;  2RDF A;  1A2T A;  1BKB A;  4NXN Q;  1XNQ Q;  1PTO D;  1NBW A;  4DAP A;  5LMN L;  2JA7 G;  1QNU A;  2VXW A;  1F9R A;  5KIX A;  4BY7 H;  1NCV A;  2YTX A;  1E24 A;  3V05 A;  2NN6 I;  4TQU S;  2A19 A;  4K2K A;  4JV5 L;  2EYM A;  2ZTD A;  3FEW X;  1CQV A;  1OXX K;  4A3B G;  4R8N A;  2F0I A;  3TEH B;  4CBV A;  2XTI A;  4A3F H;  2ZM6 Q;  4C3I B;  2EYJ A;  3GTL B;  2JQO A;  3BZC A;  5C6A A;  2AWO A;  2ATW A;  2HIV A;  4J1M A;  4K0K Q;  1PFN A;  1BR9 A;  1F9S A;  2JJQ A;  3BJU A;  1SYB A;  1G2T A;  5I6Y A;  1EQR A;  1OO9 B;  4LF4 L;  4GKK L;  2JA7 B;  2EIF A;  4JI0 Q;  4BBR H;  4HSV A;  1UEA B;  4DUY Q;  4LUZ A;  4XQJ A;  3H09 A;  4A3B B;  2E2H H;  4KLK A;  1YHB A;  2N78 A;  2PW7 A;  2QKI C;  3GTM H;  2MGS A;  1BCP B;  4K5W A;  1VQB A;  2L15 A;  5DM7 3;  4L6T B;  3U9O A;  2JA6 G;  3I4N G;  3MHB A;  4GN4 B;  1Y8O B;  5DM6 3;  2Z6B A;  1YHQ A;  2PI2 E;  2JYO A;  4PQX A;  4HMJ A;  1V1P B;  2B2V C;  1VQN A;  5JJI A;  3BVM A;  1SR3 A;  2WKD A;  1CHQ D;  3I72 A;  3S1N B;  1PTO B;  1ENA A;  2KJX A;  3U50 C;  1HNW L;  1PH9 A;  1VCI A;  2FFK B;  1GM5 A;  5IWA Q;  1KTK A;  1LO5 D;  4OL7 A;  2WKC A;  2B39 A;  2Q8I B;  4JI8 L;  4DGZ A;  1WOC A;  3GTK H;  4PMB A;  2LSS A;  1EY9 A;  4P75 A;  5IP9 H;  3CKI B;  5HUR A;  4IFD H;  2JA6 B;  3I4N B;  5J39 A;  4B3M L;  3D3R A;  3GTO H;  1UE7 A;  5GAD C;  1XPR A;  5BR8 Q;  2N49 A;  1WCM G;  2IY5 B;  1YIJ A;  3J80 c;  1S5E D;  2N88 A;  4PV1 C;  3CRL C;  4QIW B;  3JC6 6;  1LT5 D;  5CC4 A;  4LF7 L;  4K8I A;  5EKL A;  5JEA J;  4XIG S;  2EOT A;  2IWH A;  1LUZ A;  2E5L L;  2SDF A;  2F0K A;  1I94 Q;  4UP9 A;  4B08 A;  5C4J H;  1QUQ B;  1Q7Y C;  4JI4 Q;  1FYC A;  4ABN A;  2YV5 A;  1PV4 A;  3J81 L;  5M3F H;  1WCM B;  4HJA A;  2B2U C;  3TRE A;  5IGE A;  4K5X A;  1HZB A;  1Y14 B;  2CH4 W;  1I3Q B;  2N3S A;  5DLQ E;  3J7A V;  1FJG Q;  1AE3 A;  5E7N A;  2I5H A;  2F0O A;  2NUC A;  1C7Y A;  1K0R A;  2ES2 A;  3FHW A;  2NVX B;  4BBS G;  4O2D A;  2KCC A;  5IGB A;  2ICI A;  4OWT B;  3NUC A;  2BH2 A;  4GNX A;  2NN6 H;  3DM3 A;  4XQQ A;  5E1F A;  5KRU A;  1D1K A;  1LYL A;  1PZI D;  1QB5 D;  4C2M B;  4U68 A;  1D8L A;  4X3K A;  4KI0 A;  4RGT A;  2PMZ B;  3L0O A;  3HOU G;  1BBU A;  3A8J E;  4XTC S;  4L5R C;  2MO1 A;  5C4X B;  1WTR A;  1HHV A;  5EJW A;  2M00 A;  5CBE E;  5T1G A;  4DUZ Q;  4A3M H;  1Y69 U;  1HNZ L;  1I4H A;  4HJ8 A;  2E74 C;  3K6O A;  2ZJQ A;  2AQ3 B;  2C5C A;  5H1S E;  1CZG A;  3KK7 A;  4FP5 D;  4BBS B;  2MJ8 A;  5FOB B;  5LMU L;  4CKE A;  3NP8 A;  3HOW G;  2ZJP A;  4DNR B;  1A2U A;  3DWP A;  5JPM C;  4DV3 L;  3RZD H;  4NXM Q;  3L3O C;  4HED A;  3HOU B;  3MA2 B;  4C3H B;  2BA0 A;  3FPU B;  1JC7 A;  3KLR A;  1KAB A;  4IUN A;  5E3F A;  3RZO H;  3M4O H;  4DV0 Q;  5ELN A;  4RCN A;  3C1F A;  3HOW B;  1PYB A;  2OT2 A;  3HOV H;  1K83 B;  3BVG A;  1YIT A;  1EIG A;  3CPF A;  1DM0 B;  5M5W B;  4HR7 B;  3F1Z A;  4S3S A;  4BY1 G;  5L37 A;  2ZXP A;  5IT9 c;  1W3S A;  4DR7 L;  5BN5 A;  2OCE A;  3TZD A;  1VMP A;  4IPC A;  2R6G A;  1JOK A;  3BDL A;  2HCC A;  1IYU A;  5FLM H;  1RKN A;  1IW7 C;  5JJL A;  2CFM A;  4DV6 L;  5IGF A;  4A3D G;  3S2D H;  1S4Z A;  1SFO B;  3HOX H;  1WTX A;  1PA6 A;  1MD2 D;  3H3V H;  3BZD B;  5FJ8 H;  2KEC A;  1CA5 A;  1XMO L;  1ZYR C;  2KUM A;  2IL8 A;  5IYB H;  4X65 Q;  2L0C A;  1LTI D;  3LX0 A;  4K14 A;  4DR6 L;  1G6P A;  4M8A A;  5FK9 C;  3TQY A;  2F0F A;  5J22 A;  1Z7T A;  4G7H C;  4A3G G;  2X6L A;  1NJI C;  4IUU A;  2CH4 A;  4KD3 A;  3K7A B;  4UP7 A;  4Y7N H;  1IBL Q;  2VUM H;  1VQJ A;  3RR5 A;  1YNX A;  2LMC B;  4LFC L;  4A3D B;  5C3E G;  4LFA L;  3CCL A;  1EQT A;  4I7A A;  3S2H H;  4KJN A;  1EU4 A;  2Z8L A;  3UI2 A;  1CK1 A;  1U0L A;  3S1M H;  3KBG A;  1Y1W G;  3PO2 G;  4JV5 Q;  3A0J A;  1LTS D;  1A8V A;  3E9I A;  1Q82 C;  2CWA A;  5CR3 A;  1N32 Q;  3Q0A A;  2A68 C;  2BE5 C;  3AFQ A;  4KK7 A;  3VYS A;  4A4I A;  4KKS A;  4X64 L;  4A3G B;  2O2L D;  1HTP A;  1IL2 A;  1YNJ D;  1FVI A;  3I4M G;  4B3T Q;  1Q86 C;  2NVT B;  1TWC H;  1JB3 A;  1E7Z A;  1SMX A;  3P75 A;  1EYG A;  3J81 E;  5C3E B;  4OX9 Q;  3DXJ C;  3GTQ H;  3M3Y B;  4LF4 Q;  4GKK Q;  1CFM A;  3C1E A;  3KF8 A;  5GAG C;  1X3Q A;  1HUN A;  2JN4 A;  3TDQ A;  4BS9 A;  5IGD A;  1BVS A;  2A6H C;  1TWF H;  3K5N A;  1Y1W B;  1D1I A;  3PO2 B;  4LJZ C;  1PXU A;  5C5M A;  3PCO B;  2B8G A;  2PMZ E;  1YHA A;  3VR4 A;  2KVM A;  2ID0 A;  3NTK A;  3A7L A;  4PZ6 A;  3T56 B;  2IJ0 A;  3OIQ A;  1XNR L;  3ERO A;  1CKN A;  1D2B A;  2K28 A;  4GN3 B;  3I4M B;  2PI2 A;  2VL6 A;  5ELD A;  1Y1V B;  2LFN A;  2WB1 G;  2R92 G;  4KKT A;  4RAU C;  4EQO A;  4MTK A;  1DOL A;  1LM0 A;  5CV6 A;  3RD4 A;  3KJO A;  1PDQ A;  2HIX A;  1L0X B;  1BXT A;  1HNW Q;  2V1C C;  3A7A B;  3DEO A;  4JG2 A;  1LT4 D;  1TT2 A;  2DN8 A;  3BG3 A;  4JI8 Q;  4J15 A;  4JI0 L;  1MGS A;  1CSP A;  4OEM B;  4J6H A;  2Z0S A;  2O5I C;  3HKZ G;  1ENC A;  4DUY L;  4P74 A;  3I70 A;  3I4O A;  4LNQ A;  2WB1 B;  2ZXO A;  3PUY A;  2R92 B;  4F88 A;  5C0X J;  2B2W A;  2JEB I;  4N8F A;  5IYD G;  3H91 A;  1CQF A;  1HFG A;  3F2D A;  2ALY B;  4H02 A;  1Z6H A;  2E5L Q;  3AFP A;  1NMG A;  1LTL A;  3Q8D A;  3TP7 A;  2UU9 Q;  2Y0S G;  3A5Z B;  5M3M G;  1SE3 A;  4H0L C;  4IJH A;  4A3C H;  4TSS A;  1SBB B;  2EZV A;  1BDO A;  1TXY A;  3HKZ B;  4O1N A;  1SYC A;  4YCV A;  1R9T B;  2QDB A;  4A75 A;  1JWM D;  2KHS A;  1KC8 C;  2K6A A;  3K58 A;  4MN3 A;  1OXS C;  1LTT D;  3A56 A;  2LS0 1;  2XN9 C;  3DLL A;  5IY0 A;  1SNQ A;  3NSW A;  2SOB A;  4NW2 A;  5JEA H;  3QO2 A;  2KQ3 A;  2WAQ E;  1GUS A;  2Y0S B;  1FNU A;  5EQ0 A;  4NDX A;  3I4L A;  5M3M B;  3S1R H;  1MBY A;  1B4O A;  2EE1 A;  3KF6 A;  3CCJ A;  2PZW A;  3MZ5 A;  3K81 C;  4RGM A;  2L1B A;  2PZU A;  1QVC A;  1OTC A;  5C44 H;  5A2Q L;  1PH6 A;  3JAM c;  1Z47 A;  2RF4 A;  3CQZ H;  4A93 G;  1PHJ A;  1HNZ Q;  3G71 A;  4KV6 A;  3FPP A;  4JI4 L;  5IIF A;  4B3S L;  4ZQ3 A;  4R4O A;  4UDU C;  3ICE A;  5CGK A;  4XQN A;  2HUG A;  1ZEQ X;  3OYY A;  4BA1 I;  3HZX A;  1JJC B;  1QVF A;  2QCP X;  1YJW A;  1P8L A;  4ZUI A;  2RA4 A;  1YNN D;  1QCB D;  3F2C A;  4RHS A;  2RSO A;  2AQ2 B;  1FJG L;  2I07 B;  3G48 A;  3I3C A;  3MXN A;  3AEV A;  3BYY B;  4BBR G;  1YEZ A;  1I4R A;  3I91 A;  1VS0 A;  5FLX E;  4CJ1 B;  5JOB A;  2CW0 C;  2L9H A;  1X56 A;  3SXH A;  1DXM A;  4A93 B;  3IFT A;  4UPA A;  2VQE Q;  3TP5 A;  4JW0 A;  5C3X A;  4FVM A;  1Q1E A;  3HOY H;  1MSG A;  3CCU A;  3PQI A;  1F2L A;  3J80 L;  3E9H A;  4DUZ L;  1VQG A;  2Q2H A;  4O42 A;  1STN A;  2Z6K C;  4RKL A;  1V1P A;  3F2B A;  1XJV A;  2K5Q A;  3W3A A;  3WDN A;  1RD9 D;  4L5Q A;  5COR A;  4BBR B;  2OEO A;  3HP3 A;  5ELO A;  4EGV A;  1X3G A;  2BH8 A;  4IPD A;  2NZO A;  3MAQ A;  4IUT A;  2B63 H;  1STY A;  1XXG A;  1S5F D;  1A3U A;  5KNC A;  3QJY A;  2F0W A;  2OTJ A;  1FR3 A;  1ET9 A;  4JBW A;  1F77 A;  4A3K H;  1X54 A;  3DMU A;  3FKI G;  1HUM A;  2K52 A;  2R93 H;  2DGY A;  1XMO Q;  2YU9 H;  1GHK A;  3DUZ A;  4TKO B;  1I6V C;  2DNC A;  1B50 A;  1B2T A;  1LAB A;  4DR6 Q;  1TWA H;  1N9W A;  4FO2 A;  5EBD A;  1I50 H;  1EWC A;  2A1A A;  1EOV A;  5C0X I;  2UUB Q;  2D2C C;  4YIJ A;  3OIP A;  1KAA A;  3MWY W;  3NHH A;  1N8R C;  2EY5 A;  4LFC Q;  1I4Q A;  4LFA Q;  1LTB D;  2F0D A;  2B2T A;  4N8X 1;  3MEH A;  3FKI B;  3LWE A;  4QF4 A;  3S15 H;  4CDC C;  3I2Z A;  1JR0 D;  3UDI A;  1MKH A;  5G3L D;  1CI3 M;  3KBX A;  2DNE A;  1H9M A;  4OXP A;  2UXB L;  3AB9 A;  2R7F A;  2E2I B;  3ITP A;  1Q90 A;  4IQZ A;  1SJE D;  4X3U A;  2YYZ A;  3J81 i;  5C4Z A;  3T16 A;  1QJO A;  2X6G A;  4OGQ C;  5C4H A;  1F2M A;  4LUO A;  2NTT A;  3M7N A;  1AFP A;  1B53 A;  1B44 D;  3H94 A;  1WFQ A;  4DV5 Q;  3S14 B;  1FGB D;  3QIA A;  1MJC A;  3K8A A;  1U4M A;  4RG1 A;  5C4J B;  3PO3 H;  4IOA A;  1VQE A;  1QZH A;  3VR5 A;  4M1U B;  3KF6 B;  3RNU A;  1VQM A;  1A3T A;  1O7Z A;  2F0T A;  2P5Z X;  2CVR A;  3RLF A;  1TY0 A;  3N52 A;  2XNA C;  3NBH B;  1XNR Q;  5FO9 B;  3FMC A;  1JE5 A;  3GTG H;  2EY1 A;  1NE3 A;  3EA6 A;  2N8N A;  5GRO A;  3HOZ H;  1BO0 A;  1N32 L;  1EEF D;  5IT9 L;  2IHE A;  2K5V A;  5HGQ A;  5A2Q E;  3M4Y A;  3NE5 B;  5D65 A;  2AHO B;  2C35 B;  2NTS A;  2ZTC A;  4B3T L;  1GUO A;  1GHJ A;  3MXN B;  3R93 A;  4OX9 L;  3STB D;  1UAP A;  3QR8 A;  2NBF A;  5DAU A;  4CDE C;  2L4N A;  1PH8 A;  1EZ6 A;  3L7Z C;  1EWH A;  3M4Q A;  1W6K A;  2F0J A;  4OWX B;  2E75 C;  5GQO A;  1IKM A;  4L63 B;  1SRU A;  3J7Z C;  1OXU A;  4QB4 A;  2BDN A;  4AIM A;  2BDO A;  4KHV A;  4LW1 A;  4A3L H;  1SYE A;  1EY4 A;  2NVY H;  1STG A;  3EVQ A;  2M2L A;  5ELE A;  1C9O A;  3LGJ A;  2BOS A;  5EPL A;  2F0Q A;  4CHT B;  3RZO B;  5FO7 B;  1XTC D;  4A3J G;  3IRB A;  4IAL A;  1D5X C;  4P73 A;  2UXC L;  2XWJ B;  4IPG A;  3CHB D;  4XYO A;  3VDY A;  1LLR D;  2MQH A;  1JOR A;  5FJ8 G;  1M90 C;  1KQS A;  3NK9 A;  5J3B A;  4CGY B;  4PZ8 A;  4GOP C;  1Q1B A;  2KCN A;  1I4X A;  1VQD A;  2D5D A;  3HG9 A;  3CCV A;  4BXX H;  1CM9 A;  4OO1 G;  4Q0F A;  5C0X H;  1SMY C;  1HRJ A;  3X3M A;  5K36 G;  2EJM A;  3MXG A;  3PUZ A;  1IL8 A;  4GNX C;  3IFD A;  2PW5 A;  4I7Z C;  2VW9 A;  3CMA A;  2VUM G;  4NPS A;  4TVA B;  1L1O A;  5DEH A;  4A3J B;  1HJP A;  2ZTE A;  4KTA A;  1KNE A;  2A69 D;  4YWM A;  2UU9 L;  2RCN A;  1OXV A;  4F87 A;  2XWB B;  3E0E A;  4HID A;  1B3A A;  4C3J G;  4B3S Q;  5KND A;  5TSS A;  3NEM A;  2OTL A;  3VYU A;  1LTA D;  4IUP A;  1SXT A;  1TWH B;  3NWS A;  4A3I G;  2EJF C;  3P1H A;  4KHZ A;  4OO1 I;  2FIN B;  3GTP H;  2HCI A;  3EQL C;  2VUM B;  2B2V A;  2JA5 H;  3Q22 A;  4A3E H;  1ESF A;  4JI7 L;  5IOC A;  2IX3 A;  1JQY D;  3A54 A;  3S16 B;  4JBJ A;  1FGU A;  4JOI A;  5M5Y B;  4L5S A;  4XT1 B;  4EX5 A;  1EIH A;  4UY8 C;  4C3J B;  1V43 A;  5GAH C;  1Q46 A;  3OPO A;  4PMC A;  3GQB A;  2EY6 A;  5CV9 A;  4A3I B;  2E2J B;  3K0Y A;  4R9W A;  2FJ2 A;  3MTS A;  2KA7 A;  1TWC B;  3S17 B;  2CQO A;  4DV7 L;  3RLO A;  2WAC A;  3GTQ B;  4C3I H;  4N9P A;  2PQE A;  5JJK A;  4C1N K;  5JJZ A;  2NVQ B;  2LXK A;  3V96 A;  2R7Z G;  1ICF B;  1IBK Q;  2AQ1 B;  5E4W C;  4PNY A;  4B3R L;  4DK6 C;  1KD1 C;  2JA7 H;  2J4X A;  1A15 A;  1ILQ A;  2MHV A;  2HQL A;  4IN3 A;  3OWE B;  4KN4 C;  2K05 A;  5IT9 E;  2XVS A;  2WII B;  3LWU A;  2D62 A;  1CT1 D;  1B7Y B;  1RCV D;  4IUQ A;  2VQE L;  4GKJ Q;  4R4C A;  1RF2 D;  5IYC H;  1I6H B;  2MUY A;  1SND A;  3DWA A;  4NKL A;  3SK6 A;  1X3E A;  5M9O A;  4A3B H;  4H44 C;  2B2U A;  4AYB E;  4IZ8 A;  1WTP A;  5D3D A;  1IKL A;  5I9O A;  3G4S A;  1JB7 A;  3S1Q B;  2QW7 A;  1I4P A;  5IP7 H;  3QOL A;  2IX1 A;  3H0G G;  1H9S A;  2EVB A;  3J7A F;  2R7Z B;  3GTJ B;  1QOH A;  3D0F A;  2PNR C;  3KFU A;  1PRT F;  1HR0 L;  3S1N H;  1SNO A;  2NZH A;  5FKA C;  2WAQ G;  2TSS A;  1AH9 A;  3JAM L;  1SNC A;  3UE1 A;  5KYI A;  1HZ9 A;  4ZKC B;  1J6Q A;  3NEN A;  3M7G A;  1O7L A;  2JA8 G;  3PUW A;  1PYW D;  3U58 A;  1UUP A;  2UXB Q;  1PYS B;  3T1H Q;  1A0I A;  3SHL A;  1QE6 A;  2JA6 H;  4XYQ A;  1WYD A;  3I4N H;  4DFA A;  2G9H D;  3KJP A;  3VR2 A;  3H0G B;  2QIL A;  1SEB D;  4BY1 B;  2CCZ A;  2EPB A;  1CHP D;  4IJL A;  2A6E C;  4OWW B;  2WAQ B;  3RLN A;  3IAY A;  1IBM L;  3WOF A;  1QVG A;  1GUN A;  1EQQ A;  1YJN A;  1L1O B;  4GLX A;  2UUB L;  1WI5 A;  3ULJ A;  5C44 G;  1HZC A;  2JA8 B;  5BN4 A;  1TWG H;  1PH2 A;  2EYH A;  4FF2 A;  4ME3 A;  1EWI A;  2DUD A;  1LTG D;  3E5S A;  1E2W A;  2R61 A;  1PH1 A;  2F03 A;  3QG1 A;  1WTO A;  1J9O A;  4PZ7 A;  1WCM H;  3HKS A;  1KIX A;  1QNK A;  3S1R B;  1H95 A;  2NWG A;  1K28 A;  3GDE A;  5CV8 A;  1UNS A;  3K80 C;  1UWV A;  1S5B D;  2NVX H;  1X3P A;  5C44 B;  1ICW A;  3CQZ B;  4DV5 L;  5FO8 B;  2PCF B;  4DNI A;  2Q2U A;  4QGU A;  2K1B A;  4RH6 A;  4C2M H;  3NQI A;  4ODG A;  1S5D D;  1K8A C;  3HOY G;  3GV6 A;  5G3L F;  3W1B A;  1YNN C;  4WFN 3;  2EDG A;  3R3O A;  1RIP A;  1JMC A;  3CRK C;  5C4X H;  2RSN A;  1NMF A;  2F3W A;  5LMN W;  3UDG A;  1XWE A;  1PRT C;  4DR1 L;  3B6Y A;  2Z1C A;  2KED A;  1G51 A;  2UUA Q;  1BCP F;  3PMF A;  4YWK A;  1H9K A;  2HDL A;  3CCE A;  5ISR A;  1D7Q A;  1EYD A;  2B63 G;  1ZKO A;  5IOD A;  1AP0 A;  2WP8 J;  5NUC A;  1CTM A;  4HMI A;  1A63 A;  2K01 A;  2VB2 X;  2I5M X;  2A73 B;  2UXC Q;  1PTO F;  3CXC A;  1VQO A;  4C3H H;  4OEL B;  2R93 G;  4I65 A;  4DR5 Q;  1X9N A;  1LTR D;  3W2D A;  4LF8 L;  4R4T A;  4CKC A;  1S40 A;  1H9R A;  4HTH A;  1DZ1 A;  4DAV A;  1U9R A;  2UUC L;  5EGT A;  3CP0 A;  3SDZ A;  4LF5 Q;  5IE8 A;  3RMH A;  1K83 H;  2RBM A;  4DV2 L;  1W2B A;  2B63 B;  4DU9 A;  4R4Q A;  1R4Q B;  3PUV A;  5M5W H;  2QA4 A;  1H9S B;  3CCQ A;  2B8F A;  4X62 Q;  5AJ3 Q;  4ULL A;  4UP8 A;  2IPK D;  2IW3 A;  3TME A;  3KDF A;  4DR2 Q;  2R93 B;  1VQ8 A;  3BZK A;  4ZCK A;  1ENF A;  2CQA A;  1D6E C;  4WJ3 M;  1KDC A;  3E6Z X;  1EY5 A;  4ME5 A;  1EFI D;  4CDD C;  1SFO H;  3PGZ A;  4FXK C;  1IW7 D;  2RCF A;  3M4P A;  2DY8 A;  4FXG C;  5GAE C;  1HPC A;  1TII D;  1RDP D;  3JAM E;  4YCW A;  1V8Q A;  4Z9C B;  1ZYR D;  3ERQ A;  3CD6 A;  1BQQ T;  2PO4 A;  3CCM A;  1CKM A;  3V2T A;  4DXF A;  4IUR A;  4JI7 Q;  2G9D A;  3NTH A;  3PO3 G;  3K7A H;  4KD4 A;  4AQY Q;  2KOL A;  3G6E A;  1VQ7 A;  2F1M A;  2YTV A;  3S24 A;  2KCM A;  2RDH A;  4YWL A;  4A3D H;  2HD3 A;  4DK0 A;  1BCP C;  4BY7 G;  3H6M A;  1MI2 A;  1IZ6 A;  1K8G A;  1UE1 A;  4EQN A;  1PH4 A;  3NBH A;  4LF9 Q;  1VQC A;  1E1O A;  1UE6 A;  5D14 A;  4A3F G; 
#chains in the Genus database with same CATH homology
 1QZH A;  4DV7 Q;  3KF6 B;  3RNU A;  4DKA C;  1VQM A;  1FJG Q;  1Q8K A;  1AE3 A;  3PSI A;  5E7N A;  5M5Y H;  2I5H A;  1SRO A;  2K75 A;  3EBE A;  3RLF A;  1C7Y A;  1K0R A;  2ES2 A;  3FHW A;  2MNA A;  1YVC A;  2D0P A;  4ALP A;  4BBS G;  4O2D A;  3J81 j;  4C3J H;  1PH5 A;  1ASZ A;  4R4I A;  3NBH B;  4P71 A;  1XNR Q;  2NVT H;  4MTN A;  4OWT B;  4JI1 Q;  1JE5 A;  2BH2 A;  1GD7 A;  3GTG H;  4GNX A;  1NE3 A;  3DM3 A;  4GOP B;  4B3R Q;  3M3Y H;  2N8N A;  4A3I H;  1LYL A;  2E2J H;  5GRO A;  1D8L A;  1B8A A;  4HJ7 A;  3HOZ H;  1N32 L;  4DV1 L;  4KI0 A;  1KAW A;  3L0O A;  3HOU G;  1BBU A;  1Y1V G;  2IHE A;  2K5V A;  3CW2 C;  5HGQ A;  3S17 H;  4XTC S;  4L5R C;  2MO1 A;  4YCU A;  3CCR A;  4DR4 L;  3J80 i;  2AHO B;  2C35 B;  2QGQ A;  2ZTC A;  4DUZ Q;  4A3M H;  1HNZ L;  4B3T L;  4BBS H;  4GNX B;  2AWN A;  3MXN B;  3I55 A;  1ASY A;  3OTO Q;  2KCT A;  4HJ8 A;  1SE8 A;  4NXN L;  4OX9 L;  4JBM A;  2NVQ H;  2ZJQ A;  3STB D;  1XNQ L;  3STB C;  5H1S E;  3I4M H;  5LMU L;  3T1Y L;  3HOW G;  2KHI A;  4GS3 A;  1PH8 A;  1J5E L;  2ZJP A;  3L7Z C;  3M4Q A;  3HOU H;  1Y1V H;  2KEN A;  4JYA Q;  4A3K G;  4OWX B;  1VQK A;  3PUX A;  5GQO A;  1HR0 Q;  3ULL A;  4DV3 L;  1SRU A;  3RZD H;  2ASB A;  3UE0 A;  4NXM Q;  1I6H H;  3J7Z C;  3J81 c;  1OXU A;  4AIM A;  2ZM6 L;  3GO5 A;  2BA0 A;  2B29 A;  1IBK L;  4LW1 A;  4A3L H;  3GD7 A;  2NVY H;  3HOW H;  3RZO H;  3M4O H;  3S1Q H;  4DV0 Q;  4JI5 Q;  5ELN A;  4IOC A;  4BXX G;  1C9O A;  3AQQ A;  3LGJ A;  1NY4 A;  4POF A;  5IP9 G;  4A76 A;  1UEB A;  1VQA A;  3GTJ H;  2R7Z H;  4IFD G;  4RMF A;  1XMQ L;  4GKJ L;  4PMW A;  2GVB A;  1VQL A;  1PYB A;  4A93 G;  4JI3 L;  4A3J G;  3HOV H;  2K14 A;  1VQ5 A;  3IRB A;  4P73 A;  2UXC L;  1YIT A;  1VQ9 A;  2IX0 A;  4IPG A;  3CPF A;  4LF6 Q;  1DGS A;  3VDY A;  2MQH A;  4B3M Q;  1VQ4 A;  1JJ2 A;  5FJ8 G;  3F1Z A;  1M90 C;  1KQS A;  1YI2 A;  5J3B A;  4BY1 G;  1N34 L;  4PZ8 A;  5IT9 c;  4GOP C;  1Q1B A;  1W3S A;  2K5N A;  1VQD A;  3NEL A;  3CME A;  1RL2 A;  4DR7 L;  1IBM Q;  4IFD J;  1KL9 A;  3CCV A;  3BU2 A;  4BXX H;  2F3I A;  2OCE A;  4IPC A;  2R6G A;  4JI2 L;  4OO1 G;  1VQ6 A;  2GN5 A;  5FLM H;  1XTD A;  5JJL A;  2CFM A;  4DV6 L;  3KDF B;  5K36 G;  4LF7 Q;  4A3D G;  2HHH Q;  3H0G H;  1FL0 A;  3S2D H;  3PUZ A;  3HOX H;  4GNX C;  1CUK A;  1PA6 A;  3H3V H;  5FJ8 H;  2VW9 A;  3CMA A;  2VUM G;  1XMO L;  4BY1 H;  4NPS A;  4TVA B;  1L1O A;  1IYJ B;  5M3F G;  1HJP A;  4X65 Q;  5IYB H;  2ZTE A;  1HH2 P;  4KHP L;  2A8V A;  3T1H L;  4DR6 L;  1G6P A;  4FDB A;  1KRT A;  4YWM A;  1K73 C;  2UU9 L;  5IYD H;  2RCN A;  4GN5 A;  3TQY A;  5IWA L;  4A3E G;  4A3G G;  1OXV A;  2JA8 H;  4QQB X;  1NJI C;  3E0E A;  4HID A;  4BA2 I;  4UP7 A;  2Q2I A;  2VQF L;  2OWO A;  4Y7N H;  1IBL Q;  4B3S Q;  3RN5 A;  2VUM H;  3U4Z A;  1JT8 A;  3NEM A;  1VQJ A;  2OQK A;  2YTY A;  4DAY B;  5BR8 L;  2OTL A;  2NN6 G;  1YNX A;  3RR5 A;  4LFC L;  2CKZ B;  5M3M H;  5C3E G;  3CCL A;  4LFA L;  4A3I G;  1HNX L;  4L5T A;  3S2H H;  4KHZ A;  3HOZ G;  4OO1 I;  3GTP H;  1U0L A;  3S1M H;  1QZG A;  4A3E H;  1Y1W G;  3EIV A;  2JA5 H;  3PO2 G;  4A3G H;  4JV5 Q;  3A0J A;  4O0A A;  1A8V A;  3E9I A;  4X66 L;  1Q82 C;  4JI7 L;  3MEF A;  2QEX A;  3CC2 A;  2CWA A;  4A3M G;  1M1K C;  1N32 Q;  1E22 A;  3CAM A;  4JBJ A;  4A4I A;  3M9B A;  3AFQ A;  4DR1 Q;  4Y52 H;  4EQ5 A;  4X64 L;  1FGU A;  4JOI A;  4NB3 A;  3H15 A;  3ULP A;  3CPW A;  4L5S A;  4EX5 A;  5C3E H;  1IL2 A;  1I94 L;  4UY8 C;  1FVI A;  2LXJ A;  3I4M G;  1YBY A;  4B3T Q;  1MIU A;  4AYB G;  1Q86 C;  1V43 A;  3KLW A;  1TWC H;  1E1T A;  1E7Z A;  1Q46 A;  1SMX A;  2AMC B;  1SN8 A;  2RHQ B;  5GAH C;  1Y1W H;  1EYG A;  3PO2 H;  4A3F G;  3W1G A;  3HFZ B;  4OX9 Q;  3GTQ H;  3ER0 A;  4LF4 Q;  4GKK Q;  5GAG C;  1IXR A;  3UDX A;  4YY3 L;  1BVS A;  4MNO A;  5LMU Q;  3T1Y Q;  1N33 Q;  1TWF H;  1AE2 A;  2CQO A;  4DV7 L;  3ZJY C;  2CWP A;  3RLO A;  3WWV A;  4C3I H;  1U5K A;  3PCO B;  4A93 H;  3HOY G;  4A3L G;  2PMZ E;  4APV A;  5JJK A;  1YHA A;  5IYC G;  4DV3 Q;  2AKW B;  3I56 A;  4PG3 A;  3CCS A;  1GVP A;  4LF8 Q;  2JK8 A;  2ID0 A;  4JI6 L;  2VY3 A;  4PZ6 A;  1XNR L;  3KF8 B;  1WJJ A;  2LXK A;  2R7Z G;  1CKN A;  1BBW A;  2KHJ A;  1IBK Q;  4GN3 B;  2JE6 I;  3KOJ A;  3TS2 A;  4DK6 C;  4B3R L;  1KD1 C;  2UUC Q;  2JA7 H;  2JA9 A;  4HIO A;  2PI2 A;  2VL6 A;  3UDF A;  1JJG A;  2HQL A;  5IP7 G;  3HOV G;  1K3R A;  2KBN A;  2WB1 G;  2R92 G;  4DV2 Q;  1L1O C;  2UUA L;  2D62 A;  1B7Y B;  2VQE L;  4GKJ Q;  1XMQ Q;  4R4C A;  1LM0 A;  5IYC H;  3KJO A;  2HIX A;  4A3B H;  1X3E A;  1HNW Q;  4JI3 Q;  1CKN B;  2VS1 A;  1GKH A;  5HY6 A;  4IO9 A;  4DR3 Q;  3TRZ A;  1S72 A;  1A62 A;  1SLJ A;  2XGT A;  1O7I A;  2V1C C;  3OTO L;  2UXD L;  4AYB E;  4JG2 A;  3J7A 5;  5FLX c;  5C0X G;  1X6O A;  1YJ9 A;  5FLM G;  3G4S A;  4JI8 Q;  4J15 A;  1JB7 A;  2K5H A;  4JI0 L;  4DR7 Q;  1CSP A;  5IP7 H;  3D31 A;  4GLA C;  2IX1 A;  3H0G G;  2H5X A;  4HJ5 A;  4P72 A;  3HOX G;  5M5X H;  2R92 H;  4JYA L;  2Z0S A;  3JAM i;  3D0F A;  3HKZ G;  1VQI A;  3KFU A;  3CC4 A;  3A5U A;  4DUY L;  1HR0 L;  4JC0 A;  4DR5 L;  4P74 A;  1L0W A;  3S1N H;  3I4O A;  4NXM L;  4DV6 Q;  1YZ6 A;  3F8T A;  5IYB G;  2NZH A;  4LNQ A;  2Q2T A;  2WAQ G;  3PUY A;  2F52 A;  1AH9 A;  3I4N H;  3UE1 A;  5C0X J;  1I5F A;  1HZ9 A;  2JEB I;  5IYD G;  1J6Q A;  4MZ9 A;  3NEN A;  3AYH B;  1T9H A;  1HR0 W;  2JA8 G;  4LF5 L;  3PUW A;  3A74 A;  3PF5 A;  2FXQ A;  4YHH Q;  3F2D A;  4DV0 L;  3U58 A;  2ALY B;  4JOI C;  1V1Q A;  4H02 A;  4KHP Q;  2UXB Q;  4LFB Q;  1PYS B;  4DPG A;  3T1H Q;  1GO3 E;  1A0I A;  3W5O A;  2E5L Q;  3AFP A;  1NMG A;  1LTL A;  3Q8D A;  2UU9 Q;  1WYD A;  2EXD A;  1B70 B;  2WB1 E;  2Y0S G;  4POG A;  1R9T H;  2JA6 H;  3PF4 A;  4QY7 A;  3A5Z B;  4X62 L;  5M3M G;  5AJ3 L;  3KJP A;  4IJH A;  1Q12 A;  4A3C H;  4IFD I;  3L2P A;  3RN2 A;  1MJE A;  2VZA A;  1TXY A;  4DR2 L;  2VQF Q;  3FKI H;  1OXT A;  1VQP A;  1XPU A;  4YCV A;  4HJ9 A;  2F4V L;  2JA5 G;  2Z6K A;  2CCZ A;  4QJF A;  4A75 A;  4IJL A;  4OWW B;  3RLN A;  1KC8 C;  1IBM L;  1QVG A;  1EQQ A;  4DV4 Q;  3H3V I;  1YJN A;  1L1O B;  4GLX A;  2UUB L;  4OON A;  1WI5 A;  3EN2 A;  2E2I H;  3ULJ A;  5C44 G;  1HZC A;  1OXS C;  1QUQ A;  1TWG H;  1PH2 A;  4X66 Q;  3HKZ E;  2HHH L;  3DLL A;  4JBK A;  5IY0 A;  4ME3 A;  1EWI A;  2DUD A;  2E8G A;  3TS0 A;  2WAQ E;  2ZJR A;  1NTG A;  4X64 Q;  2MO0 A;  1PH1 A;  3S1R H;  4PZ7 A;  4R1J A;  4X65 L;  3S14 H;  1WCM H;  3KF6 A;  3CCJ A;  2GVA A;  1L2F A;  2RHS B;  3HKS A;  1X3F A;  3K81 C;  1N36 L;  4DV1 Q;  4AQY L;  1PH3 A;  1QVC A;  3OW2 A;  1KIX A;  1OTC A;  5C44 H;  1PH6 A;  1H95 A;  3JAM c;  1Z47 A;  2EQS A;  2PQA A;  2RF4 A;  3CQZ H;  1S3O A;  1PHJ A;  1EIY B;  4DR4 Q;  2R7D A;  1HZA A;  2Y0S E;  5C4X G;  3GDE A;  3K80 C;  1UWV A;  3G71 A;  1HNZ Q;  4JI4 L;  1PFS A;  4JCV E;  1X65 A;  4GOP A;  2NVX H;  4DK3 C;  1IBL L;  4B3S L;  2B3G A;  4R4O A;  3ICE A;  4K0K L;  1BKB A;  4DV5 L;  4NXN Q;  2Q2U A;  4DNI A;  1PVO A;  1XNQ Q;  3PV0 A;  1NBW A;  3OYY A;  2K50 A;  4BA1 I;  2PNH A;  5LMN L;  4QGU A;  4LF9 L;  2JA7 G;  1JJC B;  3K0X A;  1QVF A;  4C2M H;  4BY7 H;  1YJW A;  1P8L A;  2PQA B;  1K8A C;  1J5E Q;  2YTX A;  1E24 A;  4JI6 Q;  3I7F A;  3W1B A;  3F2C A;  2NN6 I;  4TQU S;  2A19 A;  1V9P A;  1FJG L;  4JV5 L;  2ZTD A;  3G48 A;  1KHI A;  1RIP A;  1JMC A;  5C4X H;  3AEV A;  3GTL H;  1OXX K;  4A3B G;  3TEH B;  1NMF A;  5LMN W;  3K7U C;  1YEZ A;  4BBR G;  3UDG A;  1VS0 A;  2XTI A;  4DR1 L;  4A3F H;  3B6Y A;  1C0A A;  2ZM6 Q;  4JI1 L;  4AH6 A;  1X56 A;  1G51 A;  2UUA Q;  4UPA A;  1EUJ A;  2VQE Q;  2JQO A;  3BZC A;  2AWO A;  2ATW A;  2HIV A;  2HT1 A;  4YWK A;  4K0K Q;  2I5L X;  1KXL A;  1Q1E A;  3HOY H;  2JJQ A;  3BJU A;  3CCE A;  3CCU A;  1XPO A;  2UXD Q;  1EQR A;  4DAM A;  3M85 A;  1D7Q A;  2B63 G;  4LF4 L;  4GKK L;  3E9H A;  2WP8 J;  1A63 A;  1P16 A;  2EIF A;  3CF5 A;  1PH7 A;  4DUZ L;  1VQG A;  3PIO A;  4JI0 Q;  2I5M X;  4BBR H;  1N33 L;  2Q2H A;  2UXC Q;  2Z6K C;  3CXC A;  1VQO A;  4C3H H;  1VQF A;  3F2B A;  1XJV A;  1Z9F A;  4DUY Q;  2R93 G;  4LUV A;  4LUZ A;  4DR5 Q;  1N34 Q;  2E2H H;  1X9N A;  4KLK A;  4L5Q A;  4LF8 L;  1YHB A;  4R4T A;  2N78 A;  1EFW A;  1S40 A;  3GTM H;  1UE5 A;  5ELO A;  1VQB A;  1X3G A;  2L15 A;  2BH8 A;  4IPD A;  2NZO A;  2I0Q A;  4JI2 Q;  1EIF A;  2B63 H;  2JA6 G;  3I4N G;  4GN4 B;  2UUC L;  3CP0 A;  1YHQ A;  4LF5 Q;  2PI2 E;  3KYH C;  2OTJ A;  5IE8 A;  1VQN A;  4JBW A;  4A3C G;  1K83 H;  3ERS X;  5JJI A;  4DV2 L;  4A3K H;  4WJ4 A;  1X54 A;  2IT1 A;  1SR3 A;  3FKI G;  4R4Q A;  4IPH A;  1W2B A;  2VNU D;  2K52 A;  2R93 H;  3PUV A;  2DGY A;  5M5W H;  2QA4 A;  1XMO Q;  3CCQ A;  2YU9 H;  3U50 C;  1G29 1;  4X62 Q;  5AJ3 Q;  1HNW L;  4UP8 A;  4X6A H;  1CSQ A;  1PH9 A;  4JI5 L;  4DR3 L;  1VCI A;  2WFW A;  1KRS A;  3KDF A;  4DR6 Q;  4DR2 Q;  2BA1 A;  1TWA H;  2IHF A;  1GM5 A;  5IWA Q;  1VQ8 A;  2F4V Q;  3BZK A;  4JI8 L;  1WOC A;  3GTK H;  1N9W A;  1VQH A;  2OQ0 A;  3PIP A;  2LSS A;  4WJ3 M;  1I50 H;  5JEA G;  4P75 A;  2A1A A;  1EOV A;  3PGZ A;  5IP9 H;  5C0X I;  4HIK A;  2K4K A;  1SFO H;  2UUB Q;  4B3M L;  3GTO H;  1UE7 A;  5GAD C;  1XPR A;  1N8R C;  5BR8 Q;  3M4P A;  4LFC Q;  2N49 A;  4LFA Q;  4A3J H;  1WCM G;  5GAE C;  3U4V A;  1YIJ A;  3J80 c;  1HNX Q;  2IY5 B;  5EAY A;  4YCW A;  4QL5 A;  3CC7 A;  1K9M C;  3S15 H;  3JC6 6;  3I2Z A;  3UDI A;  1MKH A;  3CD6 A;  4JI7 Q;  3CCM A;  1CKM A;  2JEA I;  4LF7 L;  5JEA J;  4YHH L;  3PO3 G;  4OXP A;  3K7A H;  4XIG S;  4LFB L;  2UXB L;  1N36 Q;  2R7F A;  4AQY Q;  1LUZ A;  3G6E A;  2E5L L;  1VQ7 A;  2YTV A;  3S24 A;  2D0O A;  2YYZ A;  1CKO A;  2KCM A;  3J81 i;  4YWL A;  4A3D H;  1I94 Q;  1TWH H;  4QIW E;  4UP9 A;  5C4J H;  1Q81 C;  1X55 A;  1E3P A;  1QUQ B;  4LUO A;  1Q7Y C;  4JI4 Q;  3FP9 A;  1I3Q H;  4BY7 G;  3M7N A;  2YV5 A;  1PV4 A;  4LWC A;  1IZ6 A;  1K8G A;  1WFQ A;  4DV5 Q;  1UE1 A;  5M3F H;  1PH4 A;  4HJA A;  3SGI A;  3TRE A;  1MJC A;  3K8A A;  4LF9 Q;  4RG1 A;  5LMN Q;  4GLV B;  3PO3 H;  1HZB A;  1VQC A;  4YY3 Q;  1Y14 B;  4LF6 L;  4DV4 L;  1E1O A;  4IOA A;  2MFI A;  2N3S A;  1UE6 A;  4HIM A;  1VQE A;  3S16 H;  5DLQ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...