4HJ7A

Crystal structure of schizosaccharomyces pombe pot1pc bound to ssdna (ggttagggt)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
138
structure length
138
Chain Sequence
b'SFSLLSQITPHQRCSFYAQVIKTWYSDKNFTLYVTDYTENELFFPMSPYTSSSRWRGPFGRFSIRCILWDEHDFYCRNYIKEGDYVVMKNVRTKIDHLGYLECILHGDSAKRYNMSIEKVDSEEPELNEIKSRKRLYV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protection of telomeres protein 1
publication title Nonspecific Recognition Is Achieved in Pot1pC through the Use of Multiple Binding Modes.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Dna binding protein
total genus 33
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2012-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16686 POT1PC ssDNA-binding domain of telomere protection protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4hj7A00
2D0PA 1HNXL 5FLMH 3PSIA 5C0XG 1K3RA 2HIXA 5HGQA 2JK8A 3NELA 1SE8A 4LNQA 3HOXG 5C4JH 3KJOA 5GAGC 4RG1A 1E22A 3HFZB 2Q2HA 4AYBG 5IYBH 1VQLA 3HOZG 2HIVA 3CCJA 1JJ2A 2JQOA 4YHHL 1X3EA 1IBMQ 2JE6I 4DR4Q 1WJJA 3CPWA 5IE8A 4AQYQ 4GN4B 1T9HA 3J81c 3OTOQ 5M3FG 1E7ZA 2HQLA 4L5SA 4R4CA 1M90C 4X6AH 1QUQB 1AE2A 1LM0A 4C2MH 4X62L 1UE5A 2OQ0A 2RF4A 4Y7NH 1VQOA 1VQ8A 4A3JH 3H3VI 1GO3E 4NXNL 2JEAI 4GOPB 5C0XJ 4A3DG 3RN5A 3J80i 2N3SA 1OXUA 2LXJA 2ES2A 3T1HQ 5HY6A 1N36Q 1UWVA 4DV0Q 4P74A 4KLKA 5AJ3L 4LF9Q 4BY7H 4JOIA 4JI2Q 2UXCL 1NMFA 3RNUA 1V9PA 2CWAA 1RIPA 3CXCA 1VQAA 1IBKQ 1FJGL 4JBJA 3PGZA 1V1QA 2JJQA 4DK3C 3AYHB 4KI0A 3D31A 4GOPC 2UUAQ 4PG3A 4LF8Q 4LF4L 4JV5L 4L5TA 5M5XH 3S1NH 1PV4A 3UE0A 1YJWA 4A75A 1VQ7A 1E1OA 3A5ZB 1SR3A 1XMQQ 1HNZQ 2R93H 1G6PA 4L5RC 4XIGS 2NN6I 1R9TH 2B63H 1YHQA 3S15H 4WJ3M 4YCVA 1VQ4A 4LF6Q 3J7ZC 1VQPA 2R92G 4JI6Q 3CAMA 1YZ6A 2FXQA 3ULLA 3STBD 1Q1BA 5FJ8G 1XJVA 4DAYB 1Y1WH 2ZM6Q 4JI0Q 3PO2H 3KDFA 4OO1I 4DV4L 2ZJQA 4LF7L 4DV7Q 2RHSB 3FKIH 4JI4Q 2NZHA 2I5MX 2WP8J 4YY3Q 4LFAL 1VQCA 1X65A 2K52A 1X56A 2JA6G 2UU9Q 1BVSA 1K73C 1XNRQ 4WJ4A 1D7QA 4A93H 4TVAB 4AH6A 4JYAQ 1KIXA 2ZJRA 2MQHA 1L0WA 5M3MG 2K4KA 4DV2Q 4R4TA 4IFDI 5GAEC 3E9HA 5IP9G 5C3EG 3TRZA 3HOUG 1I6HH 3F1ZA 4IPDA 1Y1VG 4AIMA 3GTPH 1N33Q 2YU9H 4L5QA 3PF4A 4GNXC 3KF6A 3RLNA 2Q2TA 1WFQA 3GTJH 3HOZH 3KLWA 3CCSA 3CC2A 4DR1L 2IT1A 2RHQB 4JOIC 3H15A 3F2DA 3PIPA 2HHHL 2JA7H 3NBHB 4DUZL 3D0FA 1PH1A 4X66L 1KHIA 1LYLA 3TEHB 1YJ9A 4DR6Q 2EXDA 4OONA 4X64Q 4R4IA 3CCMA 1NTGA 1KXLA 4NPSA 1VQFA 1IBLL 1Q46A 1I50H 1YNXA 1C9OA 4NB3A 2F4VQ 1N9WA 3KDFB 3S1RH 2ALYB 4HIDA 1YJNA 1XNQL 4IFDG 4IOCA 1IBML 4GKKQ 4KHPQ 4DR5Q 2CWPA 5E7NA 4A3MH 4LUVA 4AQYL 4PMWA 1EOVA 2VY3A 4NXMQ 3I4OA 1U5KA 3KYHC 2PQAA 4LUZA 2VZAA 4RMFA 1P16A 1YIJA 2JA9A 3K81C 4YCWA 2I5HA 3VDYA 1VQGA 1BBWA 1BBUA 2D0OA 1OXXK 2OCEA 4A3GH 5LMNW 4FDBA 1JE5A 4XTCS 3S24A 2EIFA 4DR2Q 1EFWA 1J6QA 3T1HL 1NJIC 3J80c 1C0AA 3PO3G 4LF5L 2AMCB 3W5OA 4DUYQ 3GTMH 1N36L 3KJPA 1UE6A 2K5NA 4IJHA 4DV0L 5IP7G 2V1CC 3KF6B 4JI2L 3KF8B 3M9BA 4JI5Q 3GTLH 3I4NH 1N34Q 2DUDA 2AHOB 3L2PA 4BY1G 2UUCQ 4POGA 4IFDJ 3ZJYC 2I0QA 1JJCB 4LF8L 2VUMH 1HZBA 2ZTDA 1X3FA 3JAMc 4A3EG 1YHAA 2JEBI 1YITA 4A3FG 1HZAA 1XTDA 3BJUA 4HJAA 4BA1I 2E2HH 1J5EQ 2Z6KA 3W1GA 1PH4A 3T1YL 1HNWQ 2KENA 3U4ZA 4GN5A 1UEBA 2E5LQ 1EQRA 2KCTA 3DM3A 4IPHA 5IYCG 3I56A 1HNZL 4B3TQ 4DR7Q 4B3RL 2ID0A 3TS2A 3GD7A 4JBWA 1VS0A 5LMNQ 5C4XG 1KRSA 1GD7A 1B8AA 2NVYH 1YBYA 1K9MC 1SN8A 1VQ6A 4JI6L 1MJCA 3PUWA 4P71A 5ELOA 3AQQA 3CF5A 3S1QH 1N32Q 1NBWA 1EQQA 4P72A 4DV6Q 2WAQE 1PHJA 4O0AA 4IO9A 4GLXA 3EN2A 4DR3Q 2BH2A 4JI0L 3PUZA 5C44G 4HIKA 2R92H 1PH7A 5C3EH 2IX1A 1CKNA 4DV7L 2A8VA 4A76A 1E24A 4IPGA 4DPGA 4X65L 4JI4L 2H5XA 2MFIA 5IT9c 4JC0A 4GNXA 2GN5A 4YY3L 2UXDL 1HR0W 2E8GA 2UU9L 1XNRL 3WWVA 1B70B 4JI7Q 3MEFA 1QZGA 4JYAL 3I4MG 1Q82C 1CSPA 4IOAA 1MKHA 1WCMH 4DV2L 2R7ZH 3HOYG 1VQDA 4LFBQ 4IPCA 3LGJA 3B6YA 2MNAA 3M85A 4R4OA 1KQSA 1I5FA 4A3BH 3KOJA 2A1AA 1AH9A 3NENA 2UXBQ 2KHJA 4MNOA 4JI8Q 2PI2E 4YCUA 5LMUQ 3F2BA 3PUVA 3PUXA 2ASBA 1IZ6A 2WAQG 3RLOA 4QJFA 4B3ML 3GTOH 3BU2A 2VQEQ 1SMXA 4R4QA 1PH5A 1UE1A 2CQOA 2NVQH 1OXVA 3CW2C 3AEVA 4YWLA 3CP0A 1OXTA 4A3KG 4A3LG 4TQUS 4A3CG 1GM5A 2R7FA 2PMZE 4X64L 4KHZA 3PCOB 4DR1Q 3ULPA 1XPOA 3MXNB 1HR0Q 2HT1A 4LFCL 3HOWH 3RR5A 1M1KC 1MJEA 2Z6KC 3CC4A 1Q12A 2GVAA 3ER0A 3Q8DA 1PH2A 1H95A 2AWOA 1IXRA 4JI3L 4GKKL 1CKNB 1A62A 4MZ9A 2UUBQ 2DGYA 4Y52H 1CKMA 2JA5H 1PVOA 4GNXB 2YTXA 1O7IA 1RL2A 4NXML 2VQFQ 1K83H 1K8GA 3JC66 4DV3Q 3L7ZC 3HKZE 4HJ8A 4ALPA 3IRBA 1QZHA 5FLMG 2IX0A 1ASYA 1TWFH 1VQIA 3HOXH 3K0XA 1PA6A 2NN6G 1Q86C 1HJPA 1PH9A 3G71A 1W3SA 4DR2L 1PH8A 5IYBG 4NXNQ 1K0RA 3BZKA 4DUYL 4HIOA 3GO5A 4O2DA 4JI5L 2E2JH 4JG2A 4OO1G 3CCVA 4DNIA 2MO1A 3HKSA 1N34L 2UUCL 1X55A 4A4IA 4GS3A 2N8NA 5JJKA 1BKBA 1JB7A 2UXCQ 5M3FH 3S1MH 4BBSG 3PV0A 1FJGQ 3UDXA 1CSQA 1EWIA 3CCUA 1J5EL 3BZCA 1HNWL 2OQKA 4LF4Q 4DR7L 3HKZG 3E9IA 1IYJB 1GVPA 4LWCA 1EIYB 1VQ9A 3S2HH 4DR4L 3GTGH 5LMNL 2D62A 1HZCA 1VQJA 4DV5Q 3RZDH 3STBC 1A8VA 2PNHA 3M4QA 1EIFA 1PH6A 3G6EA 3GDEA 3OTOL 5H1SE 4BY7G 4LW1A 1E1TA 4YWMA 2Q2IA 3UDFA 1EUJA 2JA8G 3HOYH 3OYYA 3I2ZA 2CFMA 5IWAQ 5EAYA 2C35B 2N78A 3DLLA 4B3SQ 3S17H 4A3DH 1TWGH 4OXPA 5JJIA 4A3IG 4JCVE 3E0EA 1FGUA 3K7AH 1VQMA 1S3OA 2BH8A 2B3GA 2ATWA 3EBEA 4UPAA 3OW2A 4C3IH 5C0XI 4JI7L 4LF9L 3KFUA 5GAHC 2R93G 4GKJQ 1A0IA 1AE3A 3HOVG 4PZ6A 1IBKL 2I5LX 2LXKA 2B63G 2UUAL 4UP7A 4LFBL 4P73A 4OWWB 4J15A 4BA2I 4C3JH 4A3CH 2VNUD 2YV5A 1VQHA 3I55A 4GN3B 3I7FA 5FJ8H 2ZTCA 2UXBL 1WI5A 4MTNA 4JI8L 1XMOQ 3M3YH 2K14A 1XPUA 2VL6A 4QY7A 3TREA 1XMQL 3CCRA 3TS0A 1DGSA 5BR8Q 1JJGA 2WFWA 4EX5A 3S14H 4K0KQ 2VQEL 3A0JA 1NY4A 1QVGA 3CQZH 2JA6H 2EQSA 1UE7A 2F3IA 2R7DA 4LF6L 1Y14B 1X9NA 2RCNA 4EQ5A 5M3MH 1X6OA 4DUZQ 1Q81C 1HR0L 1I94Q 2NVTH 4X66Q 3A5UA 2ZM6L 1A63A 2PQAB 4IJLA 2WB1E 5IP9H 3G4SA 1FVIA 1P8LA 3HOUH 1QVCA 1Y1VH 3PIOA 1TWHH 3RLFA 2AKWB 4PZ7A 2UUBL 3GTKH 3J7A5 3H0GG 1IBLQ 5M5WH 2NVXH 1E3PA 1YHBA 3PUYA 1XNQQ 4UY8C 4R1JA 4QGUA 2VQFL 1K8AC 1GKHA 3CCQA 4JI1Q 4DV3L 2JA7G 2CCZA 5ELNA 1SRUA 2VW9A 4APVA 2QEXA 4HJ5A 1CUKA 4BBSH 2E2IH 5IY0A 1G291 1L2FA 1NE3A 3NEMA 4DAMA 1N33L 4ME3A 4BXXG 1JT8A 1I3QH 1B7YB 4HJ9A 4OX9Q 2VS1A 4BBRG 4DV1Q 3UDIA 3CCLA 1X54A 4HIMA 2WB1G 2KCMA 3RN2A 4LF5Q 3GTQH 4A3MG 3U50C 3L0OA 5DLQE 3TQYA 1LUZA 1KRTA 3U58A 4DR6L 1OTCA 3AFQA 2JA8H 2K75A 5JJLA 2MO0A 3S2DH 1L1OA 1HNXQ 4QL5A 3JAMi 3CC7A 1VQ5A 4UP8A 4A3GG 3UE1A 2XGTA 3A74A 1QVFA 1Z9FA 2F4VL 4A3IH 5K36G 1TXYA 4KHPL 2R6GA 4DR5L 3T1YQ 5IYDG 3PO3H 3ULJA 4DV5L 2L15A 5JEAG 1CKOA 3M4PA 5IP7H 1TWAH 2YTYA 4GLAC 4YHHQ 2CKZB 3I4NG 4B3RQ 3HOVH 4BY1H 3J81i 1LTLA 2Z0SA 3CMEA 1ASZA 5IWAL 1FL0A 2AWNA 1KC8C 4B3SL 2ZTEA 3PF5A 2VUMG 2KBNA 1G51A 5GADC 2QGQA 4X62Q 4A3EH 4A3FH 1HZ9A 1KAWA 1XPRA 1W2BA 1MIUA 3AFPA 2XTIA 2K50A 1YEZA 3K7UC 3CMAA 3F8TA 4HJ7A 1C7YA 3ICEA 5IYCH 4X65Q 3RZOH 4QQBX 4LUOA 4JBMA 1Q8KA 5J3BA 4GKJL 2UXDQ 3M7NA 4DKAC 3ERSX 5C4XH 2BA1A 5AJ3Q 5JEAJ 4A3JG 4QIWE 5C44H 1S72A 1XMOL 2PI2A 2OTLA 3J81j 1VQBA 1L1OB 2E5LL 2B29A 1VQNA 4B3TL 4JV5Q 1WYDA 2YYZA 5BR8L 2N49A 4K0KL 3H0GH 2QA4A 1KL9A 2IY5B 5M5YH 2A19A 1SROA 4POFA 2NZOA 3S16H 1VQEA 1X3GA 4B3MQ 4GLVB 1JMCA 3I4MH 3M4OH 1WCMG 1Z47A 1N32L 5GQOA 4DV6L 2R7ZG 1I94L 1L1OC 4P75A 4DR3L 1VCIA 3FP9A 1WOCA 4H02A 1SFOH 1YVCA 2Y0SE 3K8AA 4OWTB 2LSSA 1TWCH 4A3BG 1OXSC 2BA0A 3G48A 3W1BA 1Q7YC 1PH3A 4LFCQ 4BXXH 1PYSB 4DV4Q 1PFSA 2Q2UA 4LF7Q 5FLXc 1VQKA 3FHWA 3U4VA 3H3VH 4BBRH 1KD1C 4C3HH 3K80C 1N8RC 4JI3Q 1PYBA 1IL2A 4JI1L 4LFAQ 2IHEA 2KHIA 4UP9A 1QUQA 4AYBE 2K5VA 1SLJA 4A3KH 4A3LH 2YTVA 2F52A 3CPFA 1EYGA 4JBKA 1U0LA 3HOWG 1Q1EA 1V43A 4DK6C 4GOPA 2GVBA 1NMGA 3CCEA 5GROA 1Y1WG 3PO2G 4PZ8A 4OX9L 4OWXB 3SGIA 3F2CA 2OWOA 5LMUL 3CD6A 2OTJA 4DV1L 3FKIG 5IYDH 3UDGA 3EIVA 2ZJPA 2JA5G 2Y0SG 2K5HA 1HH2P 4A93G 2IHFA 1D8LA 1S40A 2HHHQ 1YI2A 4YWKA
chains in the Genus database with same CATH superfamily
4FXGC 3CRKC 4H0LC 2NVXB 3L3OC 4IZ8A 5C4JH 2EE1A 4RG1A 2KOLA 3HOZG 2HIVA 4YHHL 1IBMQ 2JE6I 3QR8A 5IE8A 2F0SA 1I4GA 1E7ZA 1DONA 1AE2A 1LM0A 1ESFA 2OQ0A 1PLFA 2RF4A 5E4WC 5I6YA 1I4XA 4G7OC 4NXNL 2ZXRA 4GOPB 1HQMC 2JA8B 1OXUA 2ES2A 4FNFA 1N36Q 2QILA 4P74A 4LF9Q 5AJ3L 5IGCA 1ENAA 4JI2Q 4A3IB 1NMFA 4HTHA 1FJGL 1F9PA 3PGZA 2JJQA 4BWGB 4DK3C 3AYHB 4GOPC 2P5ZX 3K0YA 4HAEA 1QJOA 4BY1B 3S1NH 1PV4A 3OIPA 3S15B 5T1GA 2TSSA 1SSOA 3ND8A 1XMQQ 4K5WA 2R93H 2B2TA 3SR1A 1G6PA 3HRZC 2B63H 1YHQA 1VQ4A 1EIHA 3Q24A 2FXQA 3STBD 1XJVA 2XWJB 4TKOB 3ND9A 1CFMA 4DV4L 2A74C 4DV7Q 4XT3B 3NTKA 1G91A 5C44B 1MSGA 2JA6G 4KY5A 1W6KA 1XNRQ 1D7QA 4WJ4A 1EYAA 4AH6A 2B8FA 5I2XA 5M3MG 2K4KA 1GUNA 1F2ZA 1I4HA 5M5YB 3E9HA 5IP9G 3Q22A 3M4OB 2YU9H 4L5QA 3PF4A 4WJWA 3KF6A 2Q2TA 3GTJH 2L1BA 4HMIA 1ZXTA 2QKIC 2QW7A 2IT1A 1J9OA 4DUZL 1EWHA 3NWSA 3O13A 1B53A 4H7BA 1XXGA 4X64Q 1RODA 1NTGA 2WB1B 1VQFA 2K03A 3TSSA 1Q46A 1C9OA 2R92G 1YJNA 2ALYB 4FF4A 4KHPQ 2B2TC 4DR5Q 4RFBA 4A3MH 2F0IA 3TN2A 4PMWA 1EOVA 1LO5D 1HHVA 1U5KA 4PV1C 2VZAA 1P16A 2JA9A 4LMQD 4YCWA 3OSOA 3MFYA 1BBUA 5KNBA 2NTTA 1JE5A 5DEHA 2KVMA 2C5CA 3WOEA 3NTHA 5K36H 1EWCA 1NR4A 3J80c 5JEAH 3KJPA 1UE6A 5J1ZA 5C4JB 2V1CC 3KF6B 5CV5A 3KF8B 3GTLH 1Y8PB 2D5DA 1N34Q 2AHOB 4BY1G 4POGA 1RD9D 5EPLA 4FF2A 4K14A 2A69D 5FOBB 3BJUA 3J81E 2E2HH 2LS01 1PH4A 3T1YL 1HNWQ 1JICA 3U4ZA 4DR7Q 3I56A 1B1ZA 3TDQA 3GD7A 2DJFC 1I6VC 1B8AA 2NVYH 3QG1A 1VQ6A 1I4PA 1MJCA 3PUWA 4JI6L 4IUTA 3SK5A 1EQQA 1PHJA 1S4ZA 4KK7A 2WAQE 3HP3A 3VYRA 3EN2A 4IO9A 4DR3Q 3SEBA 4JI0L 5C44G 4MN3A 1PH7A 2IX1A 2A8VA 1PZKD 1O80A 2MFIA 3G7LA 4GNXA 1V8QA 2FJ2A 2ZT9C 3L9AX 1VDZA 2E8GA 4CGYB 3W3AA 3MEFA 1QZGA 5T1IA 1H9SA 3S1NB 1WCMH 1TS3A 1VQDA 4ZKBB 3D4DA 3LGJA 2MNAA 2EYLA 2R93B 2CW0C 2Q8IB 4A3BH 4O1NA 1IHZA 2BDNA 1I4QA 4PMCA 1BR9A 3F2BA 5LMUQ 2ASBA 3RLOA 1TY2A 3E0JA 5COYA 1SMXA 1PH5A 3Q23A 1UE1A 2CQOA 1OXTA 5FKAC 2PMZE 2PZUA 4KHZA 4DR1Q 1HR0Q 3MXNB 4KY7A 1M1KC 1MJEA 1JCKB 3ER0A 1AZQA 3I90A 1Z7TA 2FFKB 5FK9C 5JPNC 2DGYA 4Y52H 4ZUJA 2F0OA 1PVOA 5EKKA 4OIKA 4GNXB 1TQOA 4NXML 3JC66 5CC4A 2YU9B 4K5XA 1FGBD 4ALPA 1QZHA 2IX0A 1H9SB 3GTJB 4G7HC 3VYSA 1LTGD 4FF3A 4ZKCB 1PA6A 2NN6G 1B44D 4MIUA 3P20A 3OMCA 1ONLA 4J1MA 1ENCA 4DUYL 4HIOA 2Z4HA 4K6LA 2E2JH 1ICWA 3EROA 4JG2A 5KNCA 4OO1G 3CCVA 4LAAA 4ILWA 2N8NA 5ELBA 4OELB 2UXCQ 5M3FH 4BBSG 4K2LA 2A6HC 3UDXA 1ZYRC 1EWIA 2RDFA 2RSOA 4DN4M 2A73B 3BZCA 2NZ1D 3I73A 3E9IA 5CBAE 1KLGD 1VQ9A 5CV9A 3GTGH 4DR4L 4DV5Q 5CGKA 1EIGA 2VXWA 3STBC 2EXZA 3GDEA 3R93A 1E1TA 3UDFA 2DNEA 5IWAQ 5EAYA 2WIIB 3GTLB 4OXPA 1TVXA 4JCVE 5EKIA 2BH8A 3JAME 3EBEA 1D5MC 4Z9CB 2R93G 4GKJQ 1CQFA 1ET6A 2E2HB 1IBKL 2EDGA 2SNSA 1BCPB 2LXKA 5BN4A 2UUAL 1CZGA 2B63G 4LFBL 5AFWA 2VNUD 4TSSA 4A3CH 1EY9A 3I55A 1LV9A 4EQNA 5EJWA 2UXBL 1WI5A 4JI8L 2XNAC 1EEID 2NVYB 1XPUA 3TREA 1QE6A 1BCPC 1ESRA 3OWEB 1OO9B 3A0JA 4K6DA 3KBXA 4OEMB 2R7DA 5IT9E 1UNSA 1B4OA 3D4RA 5F2DA 1I94Q 1A63A 3A5UA 2CVRA 1ML0D 1O78A 1P8LA 3I91A 1TWHH 1WCMB 1HRJA 2UUBL 5M5WH 1E3PA 1GUSA 1YHBA 3PUYA 1XNQQ 3K5LA 1BCPF 1GKHA 4A3BB 1U4RA 2OT2A 4HMJA 4APVA 3MEHA 4QIWB 3RMHA 2E2IH 4RH6A 5IGEA 4BXXG 1D5ZC 1B7YB 4OX9Q 2F0JA 4IFDH 1LTTD 3CCLA 3RN2A 2A69C 2B8GA 4LF5Q 2EY2A 1F2LA 4A3MG 5DLQE 1KRTA 2X69A 2K04A 2MO0A 4CDFC 1G8ZD 1VQ5A 1QVFA 4M1UB 4DNTB 2AUKA 5K36G 2R6GA 3LWUA 5JEAG 5IP7H 1H9JA 4KKTA 3HOVH 3J81i 1LTLA 2CHBD 2KHSA 2AWNA 1KC8C 2E2JB 1EEFD 2ZTEA 4A3EH 1G51A 2QGQA 1FD7D 2L0CA 1HZ9A 1KAWA 4A3FH 1MIUA 5CBEE 2K50A 1C7YA 4HJ7A 1D5XC 3SK4A 5M3FB 4QQBX 3PIP3 2KEDA 3M7NA 1ET9A 4XQJA 1R4PB 4MTKA 3J80L 3D4WA 2K6AA 3GTGB 4IURA 2EYOA 3FMCA 1CA5A 4RCNA 2PI2A 1VQBA 2B29A 1WD0A 4B3TL 1T5EA 3H0GH 2QA4A 3C2PA 4KD3A 2IY5B 5ELFA 5E4XA 3S16H 1VQEA 3A7LA 1JMCA 3I4MH 1IKMA 5NUCA 1WCMG 1N32L 4RGOS 2NWGA 3FP9A 4HR7B 1SFOH 1YVCA 3X3NA 4K5VA 4A3BG 1Q7YC 2EJMA 2Z4IA 5HGTA 3H3VH 4BBRH 3FPUB 1S5CD 4JI3Q 1IL2A 4UP9A 1QUQA 1YNJD 4DFAA 3QOLA 3R2IA 4X3SA 1EOTA 2F0GA 2WACA 1EYGA 2F0TA 1Y1WG 3PO2G 1DYQA 4PZ8A 2NBFA 3SGIA 1SMYD 4DV1L 1RTNA 3FKIG 3K5OA 1WD1A 1B3QA 1HH2P 1VMPA 1TWHB 5CMDA 2HHHQ 3A8KE 4YWKA 1HNXL 1PFBA 3E6ZX 2K28A 5M5WB 2JK8A 3NELA 4IALA 4KMUC 5GAGC 1E22A 3HFZB 5DNFA 1LT6D 1C4QA 1JJ2A 2JQOA 1TS5A 4EQPA 2E2IB 1STGA 3ZYYX 4AQYQ 4DAYA 5M3FG 1V1OA 5IOCA 2HQLA 3KBGA 4R4CA 1M90C 2JXMB 1QUQB 1HFGA 1UE5A 1VQ8A 4A3JH 2FMMA 3EVQA 1GO3E 4IUNA 5C0XJ 4A3DG 1EY4A 3V2TA 2LXJA 3T1HQ 2EY5A 4RAUC 4DV0Q 4BY7H 2PYKA 1VQAA 2B2UC 1V1QA 4XYOA 1HXYD 1WTVA 4XQNA 5CYUA 4JV5L 3HOVB 4L5TA 1SE2A 3UE0A 1YJWA 2DNCA 3NPPA 1SJED 4N9TA 1SR3A 1J8IA 5DAUA 1HNZQ 2K7VA 4A3EB 4A3FB 3BZDB 4L5RC 3C3LA 2NN6I 3KLSA 3S15H 4YCVA 3BVZA 4LF6Q 4N8X1 3CAMA 3N6RA 3ULLA 4DAYB 4UDUC 4OO1I 3KDFA 3QJYA 1DOKA 1JWUD 2O4XA 3K5NA 4CJ1B 4JI4Q 3P75A 2H1EA 2RVLA 1MD2D 1BOSA 1X65A 1X56A 3F2UA 2UU9Q 3UI2A 4A93H 2SNMA 2MQHA 4DV2Q 4PMBA 5C0XH 3H0GB 2L55A 2L4NA 5GAEC 3S16B 5C3EG 4UAIA 1C48A 1NR2A 1I6HH 1MSHA 3F1ZA 3I4MB 1N33Q 3RLNA 2LMCB 1STAA 4NW2A 4Q5VA 2B39A 2JA7H 3TP8A 1PH1A 4X66L 3TEHB 4BS9A 4BBRB 4DR6Q 3D6WA 4DAPA 2K05A 3FVQA 1IBLL 2F4VQ 4IFDG 1N9WA 3KDFB 5IODA 1IBML 1LTSD 2EY1A 2CQAA 5KRUA 2KQ3A 2PQAA 4LUZA 4RMFA 4JVZA 3VDYA 2I5HA 3K59A 1BBWA 2QDBA 4V190 1M8AA 1ZEQX 4FDBA 3M7GA 1WTRA 5LHY1 4XTCS 1EY7A 2KEEA 1J6QA 3IAYA 3I3CA 2AMCB 1N36L 4JI5Q 1FNUA 5IP7G 3I4NH 4JI2L 2OXPA 2DUDA 3ERQA 3L2PA 3ZJYC 3MZ5A 2I0QA 1EL0A 1HZBA 1X3FA 3PIO3 1YHAA 4A3EG 1U9RA 4KV6A 4A3FG 4HJAA 4BA1I 2Z6KA 2KENA 4FXKC 4GN5A 1UEBA 3NP8A 4IPHA 3VR2A 2N88A 3DM1A 3TS2A 1TS2A 4A3JB 2OEOA 1VS0A 3Q0AA 5LMNQ 1TY0A 1K9MC 3OWFA 4P71A 4G4KA 3V96A 1NBWA 4DV6Q 4O42A 5E1FA 2BH2A 5G3LD 4RCOA 3DHQA 4DV7L 4BY7B 4KD4A 1E24A 4X65L 3NE5B 1YNJC 5LL6S 5JVG3 2UXDL 1NNXA 2K5DA 1HR0W 1EYCA 1CHQD 1XNRL 2PO4A 3I4MG 1Q82C 3WDNA 1DJRD 2EYMA 3HOYG 5JOBA 1D1IA 4IPCA 2J7ZA 4DGZA 1KQSA 3H94A 1I5FA 3KOJA 2DJGC 3KK7A 3K5MA 4R8IA 4YCUA 1KNEA 1RHPA 4B3ML 3GTOH 2VQEQ 2NVQH 1OXVA 4KN7C 5I2YA 1SXTA 3D6CA 4TQUS 1QILA 4X64L 2EVBA 3HOWH 1UUPA 4ZLTF 2Y0SB 2Z6KC 3TP5A 4A93B 3Q8DA 1IXRA 4MZ9A 1CKMA 1STBA 4LK1C 2JA5H 3HOXB 2YTXA 1RL2A 1I6HB 2NB0A 5KGUA 2VQFQ 4AYBB 2Z8LA 3TP7A 5CV8A 3HS0C 4HEDA 3AU7A 3K0XA 1Q86C 3NXWA 3G71A 1W3SA 2EYFA 2JA7B 5DM73 1PRTD 4NXNQ 1K0RA 2MO1A 3HKSA 1N34L 2Z6BA 3H91A 4A4IA 4KTAA 5JJKA 2CH4W 1BKBA 1JB7A 2SEBD 3S1MH 1FJGQ 5I9PA 2A6EC 3RUZA 1HNWL 2OQKA 4DR7L 1GVPA 1EIYB 3DEPA 3JAML 5EPJA 4DXFA 1PH6A 1JOKA 4OL7A 3OTOL 4BY7G 4LW1A 4YWMA 2Q2IA 2JA8G 3OYYA 1CM9A 2L12A 3HEJA 2C35B 2BDOA 2DY8A 4B3SQ 5KIXA 3I4NB 2QF7A 3BS1A 4A3IG 4IUVA 1S5FD 1S3OA 2ATWA 2F0HA 4UPAA 4C56C 2XIWA 4C3IH 3OW7A 1AE3A 3NQTA 1KDAA 4PZ6A 1BO0A 1IKLA 2I5LX 2Z9HA 5IT9L 3U9OA 2RDHA 4J15A 4BA2I 4C3JH 2YV5A 3I7FA 3P1HA 5FJ8H 4ME5A 5CR3A 2ZTCA 4RKLA 2K14A 2M00A 2VL6A 2RCFA 1DGSA 5BR8Q 4I7AA 4EX5A 3S14H 1CTMA 4K0KQ 4RWSC 1DD2A 3CQZH 2F3IA 4X3KA 4EQ5A 4DUZQ 5ELDA 1HR0L 3X3MA 2ZM6L 2EJGC 4IJLA 1QVCA 4JW0A 2AUJD 1K8MA 4K8JA 3URYA 2AKWB 2JN4A 4PZ7A 2KECA 3GTKH 1SYDA 4UY8C 1YNND 4R1JA 1IW7D 1WTHA 2JA7G 1I3QB 1SRUA 2QEXA 1KDBA 2R3ZA 4HJ5A 4HSPA 1T5XD 1GUOA 4E6IA 2HCCA 3GTOB 4LJZC 1L2FA 1NE3A 3D3RA 4DAMA 5C3XA 3GTQB 2NVQB 4MHEA 1SYBA 2WV6D 1BF4A 4F7XA 3HOWB 4RGMA 4HIMA 2WB1G 2C9OA 3U50C 1CA6A 2F1MA 3TMEA 4ULLA 1OTCA 1PXUA 2K75A 1HPCA 1CZWA 2PW7A 2JA5B 3UE1A 3QWNA 1KLUD 1JQYD 2D2CC 2QDLA 3S9WA 5IGBA 3SXHA 3T1YQ 1EY6A 3ULJA 4DV5L 3M4PA 3I4NG 1AN8A 2CKZB 1JC7A 2F0WA 3T56B 3CMEA 1ASZA 3C46A 4G7ZC 1Q3LA 5IWAL 1Y8NB 4M8AA 4L63B 3PF5A 1AP0A 4ZK9B 1XPRA 4X62Q 1W2BA 1ZKOA 1EU3A 1HTPA 1YEZA 3F8TA 1DZ1A 1VMCA 3S1MB 2KUMA 3RZOH 2XVSA 4JBMA 5J3BA 4GKJL 1SJHD 1E2ZA 3PQIA 1KDCA 5C4XH 1LABA 3DWAA 1GHKA 2Q8RE 1QCBD 3VR4A 5D3DA 4QIWE 1S72A 1LT3D 1XYIA 2E5LL 3NHHA 1JWSD 1VQNA 2YYZA 3MA2B 1IYVA 5IGDA 2D9UA 1SNCA 3CHBD 1KL9A 2XN9C 3OPOA 4POFA 1Z47A 3PMFA 2F0MA 5GQOA 1I94L 4P75A 2SOBA 3BG3A 3FPPA 4C3IB 3K8AA 1SNPA 3KLSX 4OWTB 2LSSA 1A6XA 2BA0A 4N9PA 1PYSB 3VR5A 4LF7Q 3RD4A 3FHWA 4C3JB 4I65A 5JVH3 3K80C 1N8RC 1D6EC 4DU9A 4LFAQ 2KHIA 2K5VA 1SLJA 2IWHA 4A3KH 2YTVA 2F52A 4QMGA 3S14B 1U0LA 4V0BA 1Q1EA 3HOWG 3CQZB 3IKJA 3CCEA 4OX9L 1KABA 2K1BA 3NWTA 5HURA 1B9MA 2F0FA 3FEWX 1SAPA 5IYDH 3EIVA 1C8CA 2JA5G 5ELCA 3GP7A 4EQOA 2GA4B 1YI2A 2D0PA 1AEXA 3GTKB 1K3RA 2PMZB 5TSSA 4LNQA 2VB2X 1H9KA 3KJOA 4XDXA 2Q2HA 4CDCC 3CCJA 1EY0A 2BCOA 5C5LA 1X3QA 1X3EA 2FHTA 4DR4Q 3SK6A 5CV4A 1WJJA 3CPWA 2X6LA 3TP6A 1T9HA 5C4ZA 3J81c 4CHTB 5I6WA 2F0PA 4C2MH 1VQOA 4Y7NH 3H3VI 5A2QL 1Z6HA 1DM0B 2JEAI 2N3SA 3SDZA 1K28A 3EQLC 3OIQA 1II3A 4KLKA 4JOIA 4KN4C 5D3IB 1WTPA 3RNUA 1V9PA 1RIPA 1IBKQ 2UUAQ 3CRLC 4I7ZC 4KI0A 4PG3A 4LF8Q 4LF4L 2HDLA 2EPBA 1DXMA 5M5XH 3NSWA 1VQ7A 4ODGA 1PTOD 3NBHA 3DXJC 1EYDA 3HG9A 1K0SA 3ITPA 1AW7A 1R9TH 2EOTA 3J7ZC 3RZOB 4C3JG 2E2DC 1Q1BA 5FJ8G 5C4XB 2EYJA 2ZJQA 1IW7C 1F9QA 4N8FA 2XRQD 2RHSB 2HDMA 2NZHA 2WP8J 4YY3Q 1VQCA 3G6JB 1ICFB 2K52A 1BVSA 3OMGA 1VF7A 4JYAQ 4TVAB 1KIXA 1IYUA 2RKSA 5EBDA 2PPBC 3TRZA 4IPDA 1Y8OB 3GTPH 5FO9B 2JSOA 3VR6A 2FINB 3HOZH 4KJOA 4B08A 4QCLA 3KLWA 2LFNA 3CC2A 4JOIC 3H15A 3F2DA 3PIPA 1WTXA 4K8IA 3NBHB 3R2TA 3D0FA 5EQ0A 5FLXE 2HHHL 1YJ9A 4CKEA 2EXDA 4R4IA 1QNUA 2L9HA 1KXLA 1CQVA 2F0QA 1I50H 4A3KB 4NB3A 3S1RH 4HIDA 4IOCA 4GKKQ 4HCSA 4J8QA 3M4YA 2CWPA 3BDCA 5E7NA 4A3GB 4AQYL 4CBVA 3NK9A 3I4OA 3KYHC 5C6AA 3R8BA 1A2UA 2B2UA 5KEEA 4FVMA 5LMNW 5DM63 3A55A 3EA6A 2EIFA 4DR2Q 1EFWA 2G9HD 1PYWD 3T1HL 3W5OA 3GTMH 5E3FA 2DN8A 2K5NA 4DV0L 1X3PA 4KJNA 2UUCQ 5EKLA 2MPMA 2K33A 4P2CB 4IUPA 2CH4A 1JJCB 5ELEA 2ZTDA 3JAMc 4B9XA 5CORA 2X6GA 4RA8A 1J5EQ 3W1GA 2EY6A 3DM3A 4B3TQ 1HNZL 1EQTA 2NYZD 4C2MB 4B3RL 4U673 4Y7NB 3J7AF 1E2VA 5C4XG 1GD7A 2NUCA 1G6ZA 1YBYA 1B50A 2B2YA 3HKZB 1GUWA 5ELOA 1PDQA 1N32Q 1KTKA 1C0AA 1JWMD 3K6OA 1U4LA 3PUZA 4HIKA 2RA4A 4DPGA 4JI4L 5IT9c 1SNOA 3W2DA 2F03A 1CK1A 2UU9L 2R61A 1B70B 3NUCA 4JI7Q 1SNQA 5M5XB 1CSPA 4DV2L 2R7ZH 1LTRD 1SEBD 5I9OA 1HA6A 2XRSD 4HN7A 2A68D 4R4OA 1V1PA 3NENA 2KHJA 1R9TB 1WTOA 2R92H 4QJFA 3DMUA 3BU2A 3I8ZA 2IX3A 1STEA 3AEVA 3D8GA 4YWLA 4QUFA 3CP0A 1HFNA 4A3KG 4A3CG 1GM5A 2HT1A 4S3SA 3PCOB 2J0TD 1XPOA 2F0KA 4LFCL 3RR5A 1F77A 3MWYW 1A62A 2I46A 4X3UA 3TBIB 1K83H 2B2YC 3GTPB 4DV3Q 3L7ZC 4HJ8A 3IRBA 3HOZB 1ASYA 1TWFH 1VQIA 3HOXH 2RBMA 3MXGA 1HJPA 3SK8A 1V1PB 3J7AV 3BZKA 4JI5L 5D14A 4FO2A 4DNIA 5BN3A 1QB5D 4CKCA 1X55A 4JPBW 4GS3A 2MGSA 2HD3A 1I50B 3S1RB 1PTOC 3HKZG 1IYJB 1K3BC 4LWCA 2F4IA 3VYUA 5LMNL 4QB4A 1HZCA 1STNA 1VQJA 2EZVA 1A8VA 1SBBB 2PNHA 1X32A 4UHVA 4Q0FA 3G6EA 3HZXA 5H1SE 3J80E 1GHJA 1EUJA 2L5TA 2ENBA 2CFMA 3GTMB 4CKBA 2H4OA 3DLLA 3S17H 1TWGH 1S5BD 3A8IE 3J81L 1FNVA 3DWQA 3E0EA 3QIAA 2HCIA 1FNWA 4J6HA 2B3GA 2WKDA 3OW2A 1RKNA 4LF9L 3E3XA 5GAHC 1A0IA 3HOVG 4UP7A 4OWWB 1SNDA 3BDLA 2QEJC 1VQHA 2K32A 3DUZA 4K2KA 1MI2A 4MTNA 1XMOQ 3BYYB 1A3VA 1D2BA 4QY7A 1XMQL 3CCRA 3TS0A 1JJGA 2WFWA 2VQEL 4ZAIA 2CW0D 1G2TA 1UE7A 2MUYA 2RCNA 4HCEA 2NVTH 4X66Q 2PQAB 2WB1E 3HOUH 1UEAB 2NN6H 3DWPA 1Y1VH 3PIOA 2R7ZB 1R4QB 2E74C 3J7A5 3H0GG 1IBLQ 4DF7A 3MC0B 4FXDA 4OO1H 2VQFL 4JI1Q 2HUGA 2CCZA 2HQEA 1SMYC 2R92B 2A5HA 4BBSH 5IY0A 1BDOA 1G291 1I3QH 2WKCA 1Q90A 4BBRG 3UDIA 1X54A 2KCMA 3IFTA 3GTQH 2F0DA 3L0OA 3IL8A 3U58A 1AZPA 3S2DH 1L1OA 3LX0A 1QWYA 4QL5A 2MHVA 2IJ0A 5CV6A 1H9RA 4OIJA 1K83B 1Z9FA 1RCVD 4KHVA 4KHPL 4DR5L 1JORA 3PO3H 1TWFB 2A6HD 1ZYRD 1CKOA 4YHHQ 1TWAH 2F3VA 1HCZA 3BDOA 3EFXD 1DOMA 3BVMA 1F9SA 1FL0A 4B3SL 1A2TA 2KBNA 4CDEC 2EYHA 4L6TB 1BQQT 2I07B 3I4LA 2XTIA 4X3TA 3ICEA 3CMAA 3A7AB 5IYCH 4X65Q 2XWBB 1U4MA 4C1NI 5I4DA 2UXDQ 1SYEA 3ERSX 2A68C 2BA1A 1MGSA 2G9DA 1RJTA 3HGBA 5AJ3Q 5JEAJ 1D1KA 4IQZA 1TIID 4A3JG 2OTLA 1L1OB 5BR8L 2N49A 3J7YW 1IL8A 1LLRD 2E75C 4K0KL 3KF8A 1ILQA 3S17B 1E2WA 1TWGB 2NZOA 3OOCA 1PMRA 1L0XB 5ISRA 4B3MQ 4R9WA 2R7ZG 3A56A 1BUVT 1L1OC 1BCPD 4DR3L 2RQXA 4H02A 3P7JA 2K01A 1TWCH 1PH3A 3G48A 3W1BA 5J22A 4BXXH 4DV4Q 1PFSA 4DK1A 1VQKA 3U4VA 4C3HH 1PYBA 2IHEA 2IW3A 4FP5D 4XYQA 4A3LH 3CPFA 4JBKA 4DK6C 2K5WA 3LWEA 4OWXB 3F2CA 2VB3X 4EGVA 5LMUL 3CD6A 2OTJA 1JOQA 1MHWC 1SYFA 1Q8IA 2NVTB 2Y0SG 5K5PA 3HOUB 1Y1VB 4A93G 2IHFA 1D8LA 3QO2A 2B2VA 3T13A 1WVLA 3VYTA 4DR1L 2G5DA 5FLMH 3PSIA 3VA7A 5C0XG 2PZWA 2HIXA 5HGQA 3BYTB 1SE8A 3GV6A 4WFN3 3HOXG 3ONAB 2PZTA 4AYBG 5IYBH 1VQLA 4BBSB 4ZUIA 1LT5D 3MHBA 3OHXC 4GN4B 3K57A 3MXNA 3OTOQ 4L5SA 1I4RA 4X6AH 4X62L 2XSCA 3V05A 4FF1A 5J39A 4RGTA 2KCNA 1RF2D 2F0LA 1SE4A 1EFID 1EZ6A 1L0YB 2B2WA 2J4XA 3J80i 3RN5A 3S2DB 1TR5A 4H13C 4ABNA 5HY6A 1UWVA 1S5DD 1QG7A 2UXCL 2KCCA 2CWAA 3CXCA 4JBJA 3PO3B 1E0BA 3D31A 4F88A 1B9NA 1TWAB 2F0UA 4A75A 2B63B 1E1OA 1ILPA 3A5ZB 2KA7A 4ID6A 2B2VC 4XIGS 3Q6SA 4WJ3M 4PNYA 1BXTA 1VQPA 4JI6Q 1PFNA 2AQ1B 1YZ6A 1U4PA 1SYGA 1NAPA 1WTWA 1Y1WH 2ZM6Q 1H9MA 4JI0Q 3PO2H 4NMZA 2L11A 4CJ0B 1BNZA 5C4HA 4LF7L 3MVVA 4R8NA 3FKIH 2LY7A 3FRPB 3T51B 2EYPA 5D65A 2I5MX 4LFAL 3C1EA 4EVOA 1K73C 4F87A 5FLXL 2ZJRA 1L0WA 1NCVA 3CU7A 5G3LF 4R4TA 5L37A 1JR0D 4IFDI 1A3UA 1KAAA 5LL6X 3HOUG 1DOLA 2AQ2B 2ICEC 1Y1VG 2N55A 4AIMA 5JJZA 2B2WC 4OHJA 4GNXC 1WFQA 2O2LD 5BN5A 1FR3A 3CCSA 3H6MA 3VR3A 2RHQB 1TWCB 4KKUA 2KJXA 2NTSA 5A35A 1KHIA 1LYLA 4OGQC 2WAQB 4C3HB 3T4AC 4PQXA 4YIJA 4OONA 3CCMA 4NKLA 4NPSA 4A3MB 1PRTB 2K5QA 1RDPD 2ICIA 1YNXA 1LTBD 4A3DH 1HUNA 4JK1C 1XNQL 1TU2B 5EBCA 4LUVA 4FYDA 1EY5A 5CV7A 2VY3A 4NXMQ 1W6JA 1YIJA 1PRTC 3MTSA 3K81C 3MXUA 4B9WA 1VQGA 3I72A 2D0OA 1OXXK 2OCEA 3NBIA 3EJIA 4WRDA 5KYLA 4A3GH 1S5ED 5JAVA 3WOFA 1A15A 3S24A 1NJIC 3PO3G 4LF5L 4DUYQ 3MFGA 4IJHA 3TZUA 4IUUA 3M9BA 2EJFC 5IGGA 4ZCKA 4IFDJ 2ZXPA 3C1FA 1O7LA 2F0EA 4LF8L 4QF4A 2VUMH 1A3TA 3T53B 1PRTF 1YITA 2JEBI 1HZAA 1XTDA 4ZRZA 4C1NK 2E5LQ 1EQRA 2KCTA 5M9OA 5IYCG 2ID0A 4JBWA 4QUCA 2IPKD 1MBYA 1KRSA 1STYA 1PZID 1SN8A 2PQEA 2BE5D 5JPMC 3CF5A 3AQQA 3S1QH 1QOHA 4P72A 4O0AA 4GLXA 5C5MA 1ENFA 2BOSA 4IUQA 5C3EH 1F2YA 1CKNA 4A76A 1VF5C 5KNDA 4IPGA 2H5XA 4JC0A 2GN5A 4YY3L 2O5IC 3WWVA 4JYAL 4DK0A 3TZDA 1GXDC 1MKHA 4IOAA 4LFBQ 1SDFA 2F3WA 1G2SA 1PZJD 3B6YA 3M85A 2F0NA 2SDFA 1AFPA 1AH9A 2A1AA 2UXBQ 4MNOA 4JI8Q 2PI2E 4CDDC 1SE3A 3PUVA 3PUXA 1IZ6A 2WAQG 2JP1A 4C3HG 4C3IG 3QB3A 1F2MA 2PW5A 2M9VA 3FDTA 1Y1WB 3PO2B 4R4QA 3CW2C 1EZ8A 2AQ3B 4A3LG 3FKIB 2R7FA 1TT2A 3ULPA 4CJ2C 1YNNC 3CC4A 1HQRD 1Q12A 2GVAA 1PH2A 1H95A 2AWOA 4JI3L 4GKKL 1CKNB 5IIFA 2UUBQ 3CKIB 1TS4A 1O7IA 1DCZA 1K8GA 3HKZE 2FMCA 5FLMG 3A8JE 1PH9A 4G57A 4DR2L 4XXEA 2MP1A 5KYIA 4F8MA 4H44C 1PH8A 4RHRA 5IYBG 3GO5A 4O2DA 1FYCA 2UUCL 3MXPA 3R3OA 4A3DB 1PTOH 3QOJA 3PV0A 1EU4A 1CSQA 3CCUA 1J5EL 4LF4Q 4RHSA 3IFDA 1O7ZA 3S2HH 1LTAD 2D62A 3RZDH 3M4QA 1EIFA 3HOYH 3BVGA 2V4DA 3I2ZA 2N78A 3LNNA 1B2TA 4IN3A 1EQVA 5JJIA 2RSNA 3K7AH 1FGUA 1O7YA 1VQMA 1LTID 4GZYC 1SNMA 2VUMB 4JI7L 5C0XI 1CT1D 2M2LA 4TRDA 3KFUA 1Y69U 3AMUA 4P73A 2RDGA 1HA5A 1LT4D 4GN3B 1XTCD 5C3WA 3M3YH 1BBXC 3S1QB 4WORA 5FO8B 1NSNS 1NY4A 5FO7B 1QVGA 5C3EB 2JA6H 2EQSA 3H09A 3MAQA 4LF6L 1Y14B 1X9NA 1K8OA 5M3MH 1X6OA 1Q81C 4DNRB 5IP9H 3E5SA 3G4SA 1FVIA 3GQBA 1JE4A 3RLFA 1GUTA 3K58A 2E76C 1GOZA 3SHLA 1EY8A 2DY7A 2NVXH 1SYCA 4QGUA 1K8AC 4ZYSA 3CCQA 4DV3L 2ZXOA 5ELNA 2VW9A 1GUGA 1QNKA 1TKWB 3KLRA 1CUKA 1LACA 3N52A 3NEMA 3KUPA 1N33L 1B3AA 4ME3A 1JT8A 4HJ9A 2VS1A 2Z1CA 4DV1Q 3DEOA 3GV3A 1UAPA 3NTIA 2LKVA 1HTLD 3VA5A 3TQYA 1LUZA 4DR6L 3AFQA 2JA8H 4KKSA 5JJLA 1CHPD 1HNXQ 4RGNA 3JAMi 3CC7A 5A2QE 4UP8A 4A3GG 2XGTA 3A74A 2F4VL 4A3IH 3SE0A 1TXYA 2BE5C 2PCFB 5IYDG 3AB9A 3NQIA 2L15A 4NP5A 3U9SA 2A6ED 4HSVA 1WTQA 2YTYA 4B3RQ 4GLAC 2PNRC 5EPKA 1XWEA 4BY1H 2Z0SA 2JYOA 2TMPA 4XQQA 2VUMG 2QCPX 1M4VA 5GADC 3AFPA 1NUCA 4XT1B 4DXGA 3K7UC 2F0VA 1PTOB 4LUOA 4U68A 1Q8KA 4DKAC 1PFMA 4ZQ3A 3S2HB 3A54A 4DA2A 5C44H 3RZDB 1XMOL 3J81j 1F9RA 4NDXA 2IL8A 4JV5Q 1WYDA 3HOYB 1JB3A 1CI3M 1STHA 1SFOB 5M5YH 2A19A 1SROA 1X3GA 4GLVB 3M4OH 3K7AB 4DV6L 1XX8A 1GJXA 2OF1A 1HUMA 1VCIA 1WOCA 2Y0SE 4KY6A 3T16A 1OXSC 4LFCQ 1PTOF 2WINB 5IGFA 2Q2UA 5FLXc 1KD1C 4L8JA 4JI1L 3M3YB 3H3VC 4AYBE 1KNAA 2O5JC 5EGTA 1V43A 4GOPA 2GVBA 1NMGA 5GROA 2JA6B 3SVMA 2OWOA 2MJ8A 3I70A 5M3MB 1JOOA 1RTOA 3UDGA 2ZJPA 2K5HA 4RKBA 4DAVA 2Q8TA 1S40A
chains in the Genus database with same CATH topology
2D0PA 1HNXL 5FLMH 3PSIA 5C0XG 1K3RA 2HIXA 5HGQA 2JK8A 3NELA 1SE8A 4LNQA 3HOXG 5C4JH 3KJOA 5GAGC 4RG1A 1E22A 3HFZB 2Q2HA 4AYBG 5IYBH 1VQLA 3HOZG 2HIVA 3CCJA 1JJ2A 2JQOA 4YHHL 1X3EA 1IBMQ 2JE6I 4DR4Q 1WJJA 3CPWA 5IE8A 4AQYQ 4GN4B 1T9HA 3J81c 3OTOQ 5M3FG 1E7ZA 2HQLA 4L5SA 4R4CA 1M90C 4X6AH 1QUQB 1AE2A 1LM0A 4C2MH 4X62L 1UE5A 2OQ0A 2RF4A 4Y7NH 1VQOA 1VQ8A 4A3JH 3H3VI 1GO3E 4NXNL 2JEAI 4GOPB 5C0XJ 4A3DG 3RN5A 3J80i 2N3SA 1OXUA 2LXJA 2ES2A 3T1HQ 5HY6A 1N36Q 1UWVA 4DV0Q 4P74A 4KLKA 5AJ3L 4LF9Q 4BY7H 4JOIA 4JI2Q 2UXCL 1NMFA 3RNUA 1V9PA 2CWAA 1RIPA 3CXCA 1VQAA 1IBKQ 1FJGL 4JBJA 3PGZA 1V1QA 2JJQA 4DK3C 3AYHB 4KI0A 3D31A 4GOPC 2UUAQ 4PG3A 4LF8Q 4LF4L 4JV5L 4L5TA 5M5XH 3S1NH 1PV4A 3UE0A 1YJWA 4A75A 1VQ7A 1E1OA 3A5ZB 1SR3A 1XMQQ 1HNZQ 2R93H 1G6PA 4L5RC 4XIGS 2NN6I 1R9TH 2B63H 1YHQA 3S15H 4WJ3M 4YCVA 1VQ4A 4LF6Q 3J7ZC 1VQPA 2R92G 4JI6Q 3CAMA 1YZ6A 2FXQA 3ULLA 3STBD 1Q1BA 5FJ8G 1XJVA 4DAYB 1Y1WH 2ZM6Q 4JI0Q 3PO2H 3KDFA 4OO1I 4DV4L 2ZJQA 4LF7L 4DV7Q 2RHSB 3FKIH 4JI4Q 2NZHA 2I5MX 2WP8J 4YY3Q 4LFAL 1VQCA 1X65A 2K52A 1X56A 2JA6G 2UU9Q 1BVSA 1K73C 1XNRQ 4WJ4A 1D7QA 4A93H 4TVAB 4AH6A 4JYAQ 1KIXA 2ZJRA 2MQHA 1L0WA 5M3MG 2K4KA 4DV2Q 4R4TA 4IFDI 5GAEC 3E9HA 5IP9G 5C3EG 3TRZA 3HOUG 1I6HH 3F1ZA 4IPDA 1Y1VG 4AIMA 3GTPH 1N33Q 2YU9H 4L5QA 3PF4A 4GNXC 3KF6A 3RLNA 2Q2TA 1WFQA 3GTJH 3HOZH 3KLWA 3CCSA 3CC2A 4DR1L 2IT1A 2RHQB 4JOIC 3H15A 3F2DA 3PIPA 2HHHL 2JA7H 3NBHB 4DUZL 3D0FA 1PH1A 4X66L 1KHIA 1LYLA 3TEHB 1YJ9A 4DR6Q 2EXDA 4OONA 4X64Q 4R4IA 3CCMA 1NTGA 1KXLA 4NPSA 1VQFA 1IBLL 1Q46A 1I50H 1YNXA 1C9OA 4NB3A 2F4VQ 1N9WA 3KDFB 3S1RH 2ALYB 4HIDA 1YJNA 1XNQL 4IFDG 4IOCA 1IBML 4GKKQ 4KHPQ 4DR5Q 2CWPA 5E7NA 4A3MH 4LUVA 4AQYL 4PMWA 1EOVA 2VY3A 4NXMQ 3I4OA 1U5KA 3KYHC 2PQAA 4LUZA 2VZAA 4RMFA 1P16A 1YIJA 2JA9A 3K81C 4YCWA 2I5HA 3VDYA 1VQGA 1BBWA 1BBUA 2D0OA 1OXXK 2OCEA 4A3GH 5LMNW 4FDBA 1JE5A 4XTCS 3S24A 2EIFA 4DR2Q 1EFWA 1J6QA 3T1HL 1NJIC 3J80c 1C0AA 3PO3G 4LF5L 2AMCB 3W5OA 4DUYQ 3GTMH 1N36L 3KJPA 1UE6A 2K5NA 4IJHA 4DV0L 5IP7G 2V1CC 3KF6B 4JI2L 3KF8B 3M9BA 4JI5Q 3GTLH 3I4NH 1N34Q 2DUDA 2AHOB 3L2PA 4BY1G 2UUCQ 4POGA 4IFDJ 3ZJYC 2I0QA 1JJCB 4LF8L 2VUMH 1HZBA 2ZTDA 1X3FA 3JAMc 4A3EG 1YHAA 2JEBI 1YITA 4A3FG 1HZAA 1XTDA 3BJUA 4HJAA 4BA1I 2E2HH 1J5EQ 2Z6KA 3W1GA 1PH4A 3T1YL 1HNWQ 2KENA 3U4ZA 4GN5A 1UEBA 2E5LQ 1EQRA 2KCTA 3DM3A 4IPHA 5IYCG 3I56A 1HNZL 4B3TQ 4DR7Q 4B3RL 2ID0A 3TS2A 3GD7A 4JBWA 1VS0A 5LMNQ 5C4XG 1KRSA 1GD7A 1B8AA 2NVYH 1YBYA 1K9MC 1SN8A 1VQ6A 4JI6L 1MJCA 3PUWA 4P71A 5ELOA 3AQQA 3CF5A 3S1QH 1N32Q 1NBWA 1EQQA 4P72A 4DV6Q 2WAQE 1PHJA 4O0AA 4IO9A 4GLXA 3EN2A 4DR3Q 2BH2A 4JI0L 3PUZA 5C44G 4HIKA 2R92H 1PH7A 5C3EH 2IX1A 1CKNA 4DV7L 2A8VA 4A76A 1E24A 4IPGA 4DPGA 4X65L 4JI4L 2H5XA 2MFIA 5IT9c 4JC0A 4GNXA 2GN5A 4YY3L 2UXDL 1HR0W 2E8GA 2UU9L 1XNRL 3WWVA 1B70B 4JI7Q 3MEFA 1QZGA 4JYAL 3I4MG 1Q82C 1CSPA 4IOAA 1MKHA 1WCMH 4DV2L 2R7ZH 3HOYG 1VQDA 4LFBQ 4IPCA 3LGJA 3B6YA 2MNAA 3M85A 4R4OA 1KQSA 1I5FA 4A3BH 3KOJA 2A1AA 1AH9A 3NENA 2UXBQ 2KHJA 4MNOA 4JI8Q 2PI2E 4YCUA 5LMUQ 3F2BA 3PUVA 3PUXA 2ASBA 1IZ6A 2WAQG 3RLOA 4QJFA 4B3ML 3GTOH 3BU2A 2VQEQ 1SMXA 4R4QA 1PH5A 1UE1A 2CQOA 2NVQH 1OXVA 3CW2C 3AEVA 4YWLA 3CP0A 1OXTA 4A3KG 4A3LG 4TQUS 4A3CG 1GM5A 2R7FA 2PMZE 4X64L 4KHZA 3PCOB 4DR1Q 3ULPA 1XPOA 3MXNB 1HR0Q 2HT1A 4LFCL 3HOWH 3RR5A 1M1KC 1MJEA 2Z6KC 3CC4A 1Q12A 2GVAA 3ER0A 3Q8DA 1PH2A 1H95A 2AWOA 1IXRA 4JI3L 4GKKL 1CKNB 1A62A 4MZ9A 2UUBQ 2DGYA 4Y52H 1CKMA 2JA5H 1PVOA 4GNXB 2YTXA 1O7IA 1RL2A 4NXML 2VQFQ 1K83H 1K8GA 3JC66 4DV3Q 3L7ZC 3HKZE 4HJ8A 4ALPA 3IRBA 1QZHA 5FLMG 2IX0A 1ASYA 1TWFH 1VQIA 3HOXH 3K0XA 1PA6A 2NN6G 1Q86C 1HJPA 1PH9A 3G71A 1W3SA 4DR2L 1PH8A 5IYBG 4NXNQ 1K0RA 3BZKA 4DUYL 4HIOA 3GO5A 4O2DA 4JI5L 2E2JH 4JG2A 4OO1G 3CCVA 4DNIA 2MO1A 3HKSA 1N34L 2UUCL 1X55A 4A4IA 4GS3A 2N8NA 5JJKA 1BKBA 1JB7A 2UXCQ 5M3FH 3S1MH 4BBSG 3PV0A 1FJGQ 3UDXA 1CSQA 1EWIA 3CCUA 1J5EL 3BZCA 1HNWL 2OQKA 4LF4Q 4DR7L 3HKZG 3E9IA 1IYJB 1GVPA 4LWCA 1EIYB 1VQ9A 3S2HH 4DR4L 3GTGH 5LMNL 2D62A 1HZCA 1VQJA 4DV5Q 3RZDH 3STBC 1A8VA 2PNHA 3M4QA 1EIFA 1PH6A 3G6EA 3GDEA 3OTOL 5H1SE 4BY7G 4LW1A 1E1TA 4YWMA 2Q2IA 3UDFA 1EUJA 2JA8G 3HOYH 3OYYA 3I2ZA 2CFMA 5IWAQ 5EAYA 2C35B 2N78A 3DLLA 4B3SQ 3S17H 4A3DH 1TWGH 4OXPA 5JJIA 4A3IG 4JCVE 3E0EA 1FGUA 3K7AH 1VQMA 1S3OA 2BH8A 2B3GA 2ATWA 3EBEA 4UPAA 3OW2A 4C3IH 5C0XI 4JI7L 4LF9L 3KFUA 5GAHC 2R93G 4GKJQ 1A0IA 1AE3A 3HOVG 4PZ6A 1IBKL 2I5LX 2LXKA 2B63G 2UUAL 4UP7A 4LFBL 4P73A 4OWWB 4J15A 4BA2I 4C3JH 4A3CH 2VNUD 2YV5A 1VQHA 3I55A 4GN3B 3I7FA 5FJ8H 2ZTCA 2UXBL 1WI5A 4MTNA 4JI8L 1XMOQ 3M3YH 2K14A 1XPUA 2VL6A 4QY7A 3TREA 1XMQL 3CCRA 3TS0A 1DGSA 5BR8Q 1JJGA 2WFWA 4EX5A 3S14H 4K0KQ 2VQEL 3A0JA 1NY4A 1QVGA 3CQZH 2JA6H 2EQSA 1UE7A 2F3IA 2R7DA 4LF6L 1Y14B 1X9NA 2RCNA 4EQ5A 5M3MH 1X6OA 4DUZQ 1Q81C 1HR0L 1I94Q 2NVTH 4X66Q 3A5UA 2ZM6L 1A63A 2PQAB 4IJLA 2WB1E 5IP9H 3G4SA 1FVIA 1P8LA 3HOUH 1QVCA 1Y1VH 3PIOA 1TWHH 3RLFA 2AKWB 4PZ7A 2UUBL 3GTKH 3J7A5 3H0GG 1IBLQ 5M5WH 2NVXH 1E3PA 1YHBA 3PUYA 1XNQQ 4UY8C 4R1JA 4QGUA 2VQFL 1K8AC 1GKHA 3CCQA 4JI1Q 4DV3L 2JA7G 2CCZA 5ELNA 1SRUA 2VW9A 4APVA 2QEXA 4HJ5A 1CUKA 4BBSH 2E2IH 5IY0A 1G291 1L2FA 1NE3A 3NEMA 4DAMA 1N33L 4ME3A 4BXXG 1JT8A 1I3QH 1B7YB 4HJ9A 4OX9Q 2VS1A 4BBRG 4DV1Q 3UDIA 3CCLA 1X54A 4HIMA 2WB1G 2KCMA 3RN2A 4LF5Q 3GTQH 4A3MG 3U50C 3L0OA 5DLQE 3TQYA 1LUZA 1KRTA 3U58A 4DR6L 1OTCA 3AFQA 2JA8H 2K75A 5JJLA 2MO0A 3S2DH 1L1OA 1HNXQ 4QL5A 3JAMi 3CC7A 1VQ5A 4UP8A 4A3GG 3UE1A 2XGTA 3A74A 1QVFA 1Z9FA 2F4VL 4A3IH 5K36G 1TXYA 4KHPL 2R6GA 4DR5L 3T1YQ 5IYDG 3PO3H 3ULJA 4DV5L 2L15A 5JEAG 1CKOA 3M4PA 5IP7H 1TWAH 2YTYA 4GLAC 4YHHQ 2CKZB 3I4NG 4B3RQ 3HOVH 4BY1H 3J81i 1LTLA 2Z0SA 3CMEA 1ASZA 5IWAL 1FL0A 2AWNA 1KC8C 4B3SL 2ZTEA 3PF5A 2VUMG 2KBNA 1G51A 5GADC 2QGQA 4X62Q 4A3EH 4A3FH 1HZ9A 1KAWA 1XPRA 1W2BA 1MIUA 3AFPA 2XTIA 2K50A 1YEZA 3K7UC 3CMAA 3F8TA 4HJ7A 1C7YA 3ICEA 5IYCH 4X65Q 3RZOH 4QQBX 4LUOA 4JBMA 1Q8KA 5J3BA 4GKJL 2UXDQ 3M7NA 4DKAC 3ERSX 5C4XH 2BA1A 5AJ3Q 5JEAJ 4A3JG 4QIWE 5C44H 1S72A 1XMOL 2PI2A 2OTLA 3J81j 1VQBA 1L1OB 2E5LL 2B29A 1VQNA 4B3TL 4JV5Q 1WYDA 2YYZA 5BR8L 2N49A 4K0KL 3H0GH 2QA4A 1KL9A 2IY5B 5M5YH 2A19A 1SROA 4POFA 2NZOA 3S16H 1VQEA 1X3GA 4B3MQ 4GLVB 1JMCA 3I4MH 3M4OH 1WCMG 1Z47A 1N32L 5GQOA 4DV6L 2R7ZG 1I94L 1L1OC 4P75A 4DR3L 1VCIA 3FP9A 1WOCA 4H02A 1SFOH 1YVCA 2Y0SE 3K8AA 4OWTB 2LSSA 1TWCH 4A3BG 1OXSC 2BA0A 3G48A 3W1BA 1Q7YC 1PH3A 4LFCQ 4BXXH 1PYSB 4DV4Q 1PFSA 2Q2UA 4LF7Q 5FLXc 1VQKA 3FHWA 3U4VA 3H3VH 4BBRH 1KD1C 4C3HH 3K80C 1N8RC 4JI3Q 1PYBA 1IL2A 4JI1L 4LFAQ 2IHEA 2KHIA 4UP9A 1QUQA 4AYBE 2K5VA 1SLJA 4A3KH 4A3LH 2YTVA 2F52A 3CPFA 1EYGA 4JBKA 1U0LA 3HOWG 1Q1EA 1V43A 4DK6C 4GOPA 2GVBA 1NMGA 3CCEA 5GROA 1Y1WG 3PO2G 4PZ8A 4OX9L 4OWXB 3SGIA 3F2CA 2OWOA 5LMUL 3CD6A 2OTJA 4DV1L 3FKIG 5IYDH 3UDGA 3EIVA 2ZJPA 2JA5G 2Y0SG 2K5HA 1HH2P 4A93G 2IHFA 1D8LA 1S40A 2HHHQ 1YI2A 4YWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D0P A;  1HNX L;  5FLM H;  3PSI A;  5C0X G;  1K3R A;  2HIX A;  5HGQ A;  2JK8 A;  3NEL A;  1SE8 A;  4LNQ A;  3HOX G;  5C4J H;  3KJO A;  5GAG C;  4RG1 A;  1E22 A;  3HFZ B;  2Q2H A;  4AYB G;  5IYB H;  1VQL A;  3HOZ G;  2HIV A;  3CCJ A;  1JJ2 A;  2JQO A;  4YHH L;  1X3E A;  1IBM Q;  2JE6 I;  4DR4 Q;  1WJJ A;  3CPW A;  5IE8 A;  4AQY Q;  4GN4 B;  1T9H A;  3J81 c;  3OTO Q;  5M3F G;  1E7Z A;  2HQL A;  4L5S A;  4R4C A;  1M90 C;  4X6A H;  1QUQ B;  1AE2 A;  1LM0 A;  4C2M H;  4X62 L;  1UE5 A;  2OQ0 A;  2RF4 A;  4Y7N H;  1VQO A;  1VQ8 A;  4A3J H;  3H3V I;  1GO3 E;  4NXN L;  2JEA I;  4GOP B;  5C0X J;  4A3D G;  3RN5 A;  3J80 i;  2N3S A;  1OXU A;  2LXJ A;  2ES2 A;  3T1H Q;  5HY6 A;  1N36 Q;  1UWV A;  4DV0 Q;  4P74 A;  4KLK A;  5AJ3 L;  4LF9 Q;  4BY7 H;  4JOI A;  4JI2 Q;  2UXC L;  1NMF A;  3RNU A;  1V9P A;  2CWA A;  1RIP A;  3CXC A;  1VQA A;  1IBK Q;  1FJG L;  4JBJ A;  3PGZ A;  1V1Q A;  2JJQ A;  4DK3 C;  3AYH B;  4KI0 A;  3D31 A;  4GOP C;  2UUA Q;  4PG3 A;  4LF8 Q;  4LF4 L;  4JV5 L;  4L5T A;  5M5X H;  3S1N H;  1PV4 A;  3UE0 A;  1YJW A;  4A75 A;  1VQ7 A;  1E1O A;  3A5Z B;  1SR3 A;  1XMQ Q;  1HNZ Q;  2R93 H;  1G6P A;  4L5R C;  4XIG S;  2NN6 I;  1R9T H;  2B63 H;  1YHQ A;  3S15 H;  4WJ3 M;  4YCV A;  1VQ4 A;  4LF6 Q;  3J7Z C;  1VQP A;  2R92 G;  4JI6 Q;  3CAM A;  1YZ6 A;  2FXQ A;  3ULL A;  3STB D;  1Q1B A;  5FJ8 G;  1XJV A;  4DAY B;  1Y1W H;  2ZM6 Q;  4JI0 Q;  3PO2 H;  3KDF A;  4OO1 I;  4DV4 L;  2ZJQ A;  4LF7 L;  4DV7 Q;  2RHS B;  3FKI H;  4JI4 Q;  2NZH A;  2I5M X;  2WP8 J;  4YY3 Q;  4LFA L;  1VQC A;  1X65 A;  2K52 A;  1X56 A;  2JA6 G;  2UU9 Q;  1BVS A;  1K73 C;  1XNR Q;  4WJ4 A;  1D7Q A;  4A93 H;  4TVA B;  4AH6 A;  4JYA Q;  1KIX A;  2ZJR A;  2MQH A;  1L0W A;  5M3M G;  2K4K A;  4DV2 Q;  4R4T A;  4IFD I;  5GAE C;  3E9H A;  5IP9 G;  5C3E G;  3TRZ A;  3HOU G;  1I6H H;  3F1Z A;  4IPD A;  1Y1V G;  4AIM A;  3GTP H;  1N33 Q;  2YU9 H;  4L5Q A;  3PF4 A;  4GNX C;  3KF6 A;  3RLN A;  2Q2T A;  1WFQ A;  3GTJ H;  3HOZ H;  3KLW A;  3CCS A;  3CC2 A;  4DR1 L;  2IT1 A;  2RHQ B;  4JOI C;  3H15 A;  3F2D A;  3PIP A;  2HHH L;  2JA7 H;  3NBH B;  4DUZ L;  3D0F A;  1PH1 A;  4X66 L;  1KHI A;  1LYL A;  3TEH B;  1YJ9 A;  4DR6 Q;  2EXD A;  4OON A;  4X64 Q;  4R4I A;  3CCM A;  1NTG A;  1KXL A;  4NPS A;  1VQF A;  1IBL L;  1Q46 A;  1I50 H;  1YNX A;  1C9O A;  4NB3 A;  2F4V Q;  1N9W A;  3KDF B;  3S1R H;  2ALY B;  4HID A;  1YJN A;  1XNQ L;  4IFD G;  4IOC A;  1IBM L;  4GKK Q;  4KHP Q;  4DR5 Q;  2CWP A;  5E7N A;  4A3M H;  4LUV A;  4AQY L;  4PMW A;  1EOV A;  2VY3 A;  4NXM Q;  3I4O A;  1U5K A;  3KYH C;  2PQA A;  4LUZ A;  2VZA A;  4RMF A;  1P16 A;  1YIJ A;  2JA9 A;  3K81 C;  4YCW A;  2I5H A;  3VDY A;  1VQG A;  1BBW A;  1BBU A;  2D0O A;  1OXX K;  2OCE A;  4A3G H;  5LMN W;  4FDB A;  1JE5 A;  4XTC S;  3S24 A;  2EIF A;  4DR2 Q;  1EFW A;  1J6Q A;  3T1H L;  1NJI C;  3J80 c;  1C0A A;  3PO3 G;  4LF5 L;  2AMC B;  3W5O A;  4DUY Q;  3GTM H;  1N36 L;  3KJP A;  1UE6 A;  2K5N A;  4IJH A;  4DV0 L;  5IP7 G;  2V1C C;  3KF6 B;  4JI2 L;  3KF8 B;  3M9B A;  4JI5 Q;  3GTL H;  3I4N H;  1N34 Q;  2DUD A;  2AHO B;  3L2P A;  4BY1 G;  2UUC Q;  4POG A;  4IFD J;  3ZJY C;  2I0Q A;  1JJC B;  4LF8 L;  2VUM H;  1HZB A;  2ZTD A;  1X3F A;  3JAM c;  4A3E G;  1YHA A;  2JEB I;  1YIT A;  4A3F G;  1HZA A;  1XTD A;  3BJU A;  4HJA A;  4BA1 I;  2E2H H;  1J5E Q;  2Z6K A;  3W1G A;  1PH4 A;  3T1Y L;  1HNW Q;  2KEN A;  3U4Z A;  4GN5 A;  1UEB A;  2E5L Q;  1EQR A;  2KCT A;  3DM3 A;  4IPH A;  5IYC G;  3I56 A;  1HNZ L;  4B3T Q;  4DR7 Q;  4B3R L;  2ID0 A;  3TS2 A;  3GD7 A;  4JBW A;  1VS0 A;  5LMN Q;  5C4X G;  1KRS A;  1GD7 A;  1B8A A;  2NVY H;  1YBY A;  1K9M C;  1SN8 A;  1VQ6 A;  4JI6 L;  1MJC A;  3PUW A;  4P71 A;  5ELO A;  3AQQ A;  3CF5 A;  3S1Q H;  1N32 Q;  1NBW A;  1EQQ A;  4P72 A;  4DV6 Q;  2WAQ E;  1PHJ A;  4O0A A;  4IO9 A;  4GLX A;  3EN2 A;  4DR3 Q;  2BH2 A;  4JI0 L;  3PUZ A;  5C44 G;  4HIK A;  2R92 H;  1PH7 A;  5C3E H;  2IX1 A;  1CKN A;  4DV7 L;  2A8V A;  4A76 A;  1E24 A;  4IPG A;  4DPG A;  4X65 L;  4JI4 L;  2H5X A;  2MFI A;  5IT9 c;  4JC0 A;  4GNX A;  2GN5 A;  4YY3 L;  2UXD L;  1HR0 W;  2E8G A;  2UU9 L;  1XNR L;  3WWV A;  1B70 B;  4JI7 Q;  3MEF A;  1QZG A;  4JYA L;  3I4M G;  1Q82 C;  1CSP A;  4IOA A;  1MKH A;  1WCM H;  4DV2 L;  2R7Z H;  3HOY G;  1VQD A;  4LFB Q;  4IPC A;  3LGJ A;  3B6Y A;  2MNA A;  3M85 A;  4R4O A;  1KQS A;  1I5F A;  4A3B H;  3KOJ A;  2A1A A;  1AH9 A;  3NEN A;  2UXB Q;  2KHJ A;  4MNO A;  4JI8 Q;  2PI2 E;  4YCU A;  5LMU Q;  3F2B A;  3PUV A;  3PUX A;  2ASB A;  1IZ6 A;  2WAQ G;  3RLO A;  4QJF A;  4B3M L;  3GTO H;  3BU2 A;  2VQE Q;  1SMX A;  4R4Q A;  1PH5 A;  1UE1 A;  2CQO A;  2NVQ H;  1OXV A;  3CW2 C;  3AEV A;  4YWL A;  3CP0 A;  1OXT A;  4A3K G;  4A3L G;  4TQU S;  4A3C G;  1GM5 A;  2R7F A;  2PMZ E;  4X64 L;  4KHZ A;  3PCO B;  4DR1 Q;  3ULP A;  1XPO A;  3MXN B;  1HR0 Q;  2HT1 A;  4LFC L;  3HOW H;  3RR5 A;  1M1K C;  1MJE A;  2Z6K C;  3CC4 A;  1Q12 A;  2GVA A;  3ER0 A;  3Q8D A;  1PH2 A;  1H95 A;  2AWO A;  1IXR A;  4JI3 L;  4GKK L;  1CKN B;  1A62 A;  4MZ9 A;  2UUB Q;  2DGY A;  4Y52 H;  1CKM A;  2JA5 H;  1PVO A;  4GNX B;  2YTX A;  1O7I A;  1RL2 A;  4NXM L;  2VQF Q;  1K83 H;  1K8G A;  3JC6 6;  4DV3 Q;  3L7Z C;  3HKZ E;  4HJ8 A;  4ALP A;  3IRB A;  1QZH A;  5FLM G;  2IX0 A;  1ASY A;  1TWF H;  1VQI A;  3HOX H;  3K0X A;  1PA6 A;  2NN6 G;  1Q86 C;  1HJP A;  1PH9 A;  3G71 A;  1W3S A;  4DR2 L;  1PH8 A;  5IYB G;  4NXN Q;  1K0R A;  3BZK A;  4DUY L;  4HIO A;  3GO5 A;  4O2D A;  4JI5 L;  2E2J H;  4JG2 A;  4OO1 G;  3CCV A;  4DNI A;  2MO1 A;  3HKS A;  1N34 L;  2UUC L;  1X55 A;  4A4I A;  4GS3 A;  2N8N A;  5JJK A;  1BKB A;  1JB7 A;  2UXC Q;  5M3F H;  3S1M H;  4BBS G;  3PV0 A;  1FJG Q;  3UDX A;  1CSQ A;  1EWI A;  3CCU A;  1J5E L;  3BZC A;  1HNW L;  2OQK A;  4LF4 Q;  4DR7 L;  3HKZ G;  3E9I A;  1IYJ B;  1GVP A;  4LWC A;  1EIY B;  1VQ9 A;  3S2H H;  4DR4 L;  3GTG H;  5LMN L;  2D62 A;  1HZC A;  1VQJ A;  4DV5 Q;  3RZD H;  3STB C;  1A8V A;  2PNH A;  3M4Q A;  1EIF A;  1PH6 A;  3G6E A;  3GDE A;  3OTO L;  5H1S E;  4BY7 G;  4LW1 A;  1E1T A;  4YWM A;  2Q2I A;  3UDF A;  1EUJ A;  2JA8 G;  3HOY H;  3OYY A;  3I2Z A;  2CFM A;  5IWA Q;  5EAY A;  2C35 B;  2N78 A;  3DLL A;  4B3S Q;  3S17 H;  4A3D H;  1TWG H;  4OXP A;  5JJI A;  4A3I G;  4JCV E;  3E0E A;  1FGU A;  3K7A H;  1VQM A;  1S3O A;  2BH8 A;  2B3G A;  2ATW A;  3EBE A;  4UPA A;  3OW2 A;  4C3I H;  5C0X I;  4JI7 L;  4LF9 L;  3KFU A;  5GAH C;  2R93 G;  4GKJ Q;  1A0I A;  1AE3 A;  3HOV G;  4PZ6 A;  1IBK L;  2I5L X;  2LXK A;  2B63 G;  2UUA L;  4UP7 A;  4LFB L;  4P73 A;  4OWW B;  4J15 A;  4BA2 I;  4C3J H;  4A3C H;  2VNU D;  2YV5 A;  1VQH A;  3I55 A;  4GN3 B;  3I7F A;  5FJ8 H;  2ZTC A;  2UXB L;  1WI5 A;  4MTN A;  4JI8 L;  1XMO Q;  3M3Y H;  2K14 A;  1XPU A;  2VL6 A;  4QY7 A;  3TRE A;  1XMQ L;  3CCR A;  3TS0 A;  1DGS A;  5BR8 Q;  1JJG A;  2WFW A;  4EX5 A;  3S14 H;  4K0K Q;  2VQE L;  3A0J A;  1NY4 A;  1QVG A;  3CQZ H;  2JA6 H;  2EQS A;  1UE7 A;  2F3I A;  2R7D A;  4LF6 L;  1Y14 B;  1X9N A;  2RCN A;  4EQ5 A;  5M3M H;  1X6O A;  4DUZ Q;  1Q81 C;  1HR0 L;  1I94 Q;  2NVT H;  4X66 Q;  3A5U A;  2ZM6 L;  1A63 A;  2PQA B;  4IJL A;  2WB1 E;  5IP9 H;  3G4S A;  1FVI A;  1P8L A;  3HOU H;  1QVC A;  1Y1V H;  3PIO A;  1TWH H;  3RLF A;  2AKW B;  4PZ7 A;  2UUB L;  3GTK H;  3J7A 5;  3H0G G;  1IBL Q;  5M5W H;  2NVX H;  1E3P A;  1YHB A;  3PUY A;  1XNQ Q;  4UY8 C;  4R1J A;  4QGU A;  2VQF L;  1K8A C;  1GKH A;  3CCQ A;  4JI1 Q;  4DV3 L;  2JA7 G;  2CCZ A;  5ELN A;  1SRU A;  2VW9 A;  4APV A;  2QEX A;  4HJ5 A;  1CUK A;  4BBS H;  2E2I H;  5IY0 A;  1G29 1;  1L2F A;  1NE3 A;  3NEM A;  4DAM A;  1N33 L;  4ME3 A;  4BXX G;  1JT8 A;  1I3Q H;  1B7Y B;  4HJ9 A;  4OX9 Q;  2VS1 A;  4BBR G;  4DV1 Q;  3UDI A;  3CCL A;  1X54 A;  4HIM A;  2WB1 G;  2KCM A;  3RN2 A;  4LF5 Q;  3GTQ H;  4A3M G;  3U50 C;  3L0O A;  5DLQ E;  3TQY A;  1LUZ A;  1KRT A;  3U58 A;  4DR6 L;  1OTC A;  3AFQ A;  2JA8 H;  2K75 A;  5JJL A;  2MO0 A;  3S2D H;  1L1O A;  1HNX Q;  4QL5 A;  3JAM i;  3CC7 A;  1VQ5 A;  4UP8 A;  4A3G G;  3UE1 A;  2XGT A;  3A74 A;  1QVF A;  1Z9F A;  2F4V L;  4A3I H;  5K36 G;  1TXY A;  4KHP L;  2R6G A;  4DR5 L;  3T1Y Q;  5IYD G;  3PO3 H;  3ULJ A;  4DV5 L;  2L15 A;  5JEA G;  1CKO A;  3M4P A;  5IP7 H;  1TWA H;  2YTY A;  4GLA C;  4YHH Q;  2CKZ B;  3I4N G;  4B3R Q;  3HOV H;  4BY1 H;  3J81 i;  1LTL A;  2Z0S A;  3CME A;  1ASZ A;  5IWA L;  1FL0 A;  2AWN A;  1KC8 C;  4B3S L;  2ZTE A;  3PF5 A;  2VUM G;  2KBN A;  1G51 A;  5GAD C;  2QGQ A;  4X62 Q;  4A3E H;  4A3F H;  1HZ9 A;  1KAW A;  1XPR A;  1W2B A;  1MIU A;  3AFP A;  2XTI A;  2K50 A;  1YEZ A;  3K7U C;  3CMA A;  3F8T A;  4HJ7 A;  1C7Y A;  3ICE A;  5IYC H;  4X65 Q;  3RZO H;  4QQB X;  4LUO A;  4JBM A;  1Q8K A;  5J3B A;  4GKJ L;  2UXD Q;  3M7N A;  4DKA C;  3ERS X;  5C4X H;  2BA1 A;  5AJ3 Q;  5JEA J;  4A3J G;  4QIW E;  5C44 H;  1S72 A;  1XMO L;  2PI2 A;  2OTL A;  3J81 j;  1VQB A;  1L1O B;  2E5L L;  2B29 A;  1VQN A;  4B3T L;  4JV5 Q;  1WYD A;  2YYZ A;  5BR8 L;  2N49 A;  4K0K L;  3H0G H;  2QA4 A;  1KL9 A;  2IY5 B;  5M5Y H;  2A19 A;  1SRO A;  4POF A;  2NZO A;  3S16 H;  1VQE A;  1X3G A;  4B3M Q;  4GLV B;  1JMC A;  3I4M H;  3M4O H;  1WCM G;  1Z47 A;  1N32 L;  5GQO A;  4DV6 L;  2R7Z G;  1I94 L;  1L1O C;  4P75 A;  4DR3 L;  1VCI A;  3FP9 A;  1WOC A;  4H02 A;  1SFO H;  1YVC A;  2Y0S E;  3K8A A;  4OWT B;  2LSS A;  1TWC H;  4A3B G;  1OXS C;  2BA0 A;  3G48 A;  3W1B A;  1Q7Y C;  1PH3 A;  4LFC Q;  4BXX H;  1PYS B;  4DV4 Q;  1PFS A;  2Q2U A;  4LF7 Q;  5FLX c;  1VQK A;  3FHW A;  3U4V A;  3H3V H;  4BBR H;  1KD1 C;  4C3H H;  3K80 C;  1N8R C;  4JI3 Q;  1PYB A;  1IL2 A;  4JI1 L;  4LFA Q;  2IHE A;  2KHI A;  4UP9 A;  1QUQ A;  4AYB E;  2K5V A;  1SLJ A;  4A3K H;  4A3L H;  2YTV A;  2F52 A;  3CPF A;  1EYG A;  4JBK A;  1U0L A;  3HOW G;  1Q1E A;  1V43 A;  4DK6 C;  4GOP A;  2GVB A;  1NMG A;  3CCE A;  5GRO A;  1Y1W G;  3PO2 G;  4PZ8 A;  4OX9 L;  4OWX B;  3SGI A;  3F2C A;  2OWO A;  5LMU L;  3CD6 A;  2OTJ A;  4DV1 L;  3FKI G;  5IYD H;  3UDG A;  3EIV A;  2ZJP A;  2JA5 G;  2Y0S G;  2K5H A;  1HH2 P;  4A93 G;  2IHF A;  1D8L A;  1S40 A;  2HHH Q;  1YI2 A;  4YWK A; 
#chains in the Genus database with same CATH topology
 4FXG C;  3CRK C;  4H0L C;  2NVX B;  3L3O C;  4IZ8 A;  5C4J H;  2EE1 A;  4RG1 A;  2KOL A;  3HOZ G;  2HIV A;  4YHH L;  1IBM Q;  2JE6 I;  3QR8 A;  5IE8 A;  2F0S A;  1I4G A;  1E7Z A;  1DON A;  1AE2 A;  1LM0 A;  1ESF A;  2OQ0 A;  1PLF A;  2RF4 A;  5E4W C;  5I6Y A;  1I4X A;  4G7O C;  4NXN L;  2ZXR A;  4GOP B;  1HQM C;  2JA8 B;  1OXU A;  2ES2 A;  4FNF A;  1N36 Q;  2QIL A;  4P74 A;  4LF9 Q;  5AJ3 L;  5IGC A;  1ENA A;  4JI2 Q;  4A3I B;  1NMF A;  4HTH A;  1FJG L;  1F9P A;  3PGZ A;  2JJQ A;  4BWG B;  4DK3 C;  3AYH B;  4GOP C;  2P5Z X;  3K0Y A;  4HAE A;  1QJO A;  4BY1 B;  3S1N H;  1PV4 A;  3OIP A;  3S15 B;  5T1G A;  2TSS A;  1SSO A;  3ND8 A;  1XMQ Q;  4K5W A;  2R93 H;  2B2T A;  3SR1 A;  1G6P A;  3HRZ C;  2B63 H;  1YHQ A;  1VQ4 A;  1EIH A;  3Q24 A;  2FXQ A;  3STB D;  1XJV A;  2XWJ B;  4TKO B;  3ND9 A;  1CFM A;  4DV4 L;  2A74 C;  4DV7 Q;  4XT3 B;  3NTK A;  1G91 A;  5C44 B;  1MSG A;  2JA6 G;  4KY5 A;  1W6K A;  1XNR Q;  1D7Q A;  4WJ4 A;  1EYA A;  4AH6 A;  2B8F A;  5I2X A;  5M3M G;  2K4K A;  1GUN A;  1F2Z A;  1I4H A;  5M5Y B;  3E9H A;  5IP9 G;  3Q22 A;  3M4O B;  2YU9 H;  4L5Q A;  3PF4 A;  4WJW A;  3KF6 A;  2Q2T A;  3GTJ H;  2L1B A;  4HMI A;  1ZXT A;  2QKI C;  2QW7 A;  2IT1 A;  1J9O A;  4DUZ L;  1EWH A;  3NWS A;  3O13 A;  1B53 A;  4H7B A;  1XXG A;  4X64 Q;  1ROD A;  1NTG A;  2WB1 B;  1VQF A;  2K03 A;  3TSS A;  1Q46 A;  1C9O A;  2R92 G;  1YJN A;  2ALY B;  4FF4 A;  4KHP Q;  2B2T C;  4DR5 Q;  4RFB A;  4A3M H;  2F0I A;  3TN2 A;  4PMW A;  1EOV A;  1LO5 D;  1HHV A;  1U5K A;  4PV1 C;  2VZA A;  1P16 A;  2JA9 A;  4LMQ D;  4YCW A;  3OSO A;  3MFY A;  1BBU A;  5KNB A;  2NTT A;  1JE5 A;  5DEH A;  2KVM A;  2C5C A;  3WOE A;  3NTH A;  5K36 H;  1EWC A;  1NR4 A;  3J80 c;  5JEA H;  3KJP A;  1UE6 A;  5J1Z A;  5C4J B;  2V1C C;  3KF6 B;  5CV5 A;  3KF8 B;  3GTL H;  1Y8P B;  2D5D A;  1N34 Q;  2AHO B;  4BY1 G;  4POG A;  1RD9 D;  5EPL A;  4FF2 A;  4K14 A;  2A69 D;  5FOB B;  3BJU A;  3J81 E;  2E2H H;  2LS0 1;  1PH4 A;  3T1Y L;  1HNW Q;  1JIC A;  3U4Z A;  4DR7 Q;  3I56 A;  1B1Z A;  3TDQ A;  3GD7 A;  2DJF C;  1I6V C;  1B8A A;  2NVY H;  3QG1 A;  1VQ6 A;  1I4P A;  1MJC A;  3PUW A;  4JI6 L;  4IUT A;  3SK5 A;  1EQQ A;  1PHJ A;  1S4Z A;  4KK7 A;  2WAQ E;  3HP3 A;  3VYR A;  3EN2 A;  4IO9 A;  4DR3 Q;  3SEB A;  4JI0 L;  5C44 G;  4MN3 A;  1PH7 A;  2IX1 A;  2A8V A;  1PZK D;  1O80 A;  2MFI A;  3G7L A;  4GNX A;  1V8Q A;  2FJ2 A;  2ZT9 C;  3L9A X;  1VDZ A;  2E8G A;  4CGY B;  3W3A A;  3MEF A;  1QZG A;  5T1I A;  1H9S A;  3S1N B;  1WCM H;  1TS3 A;  1VQD A;  4ZKB B;  3D4D A;  3LGJ A;  2MNA A;  2EYL A;  2R93 B;  2CW0 C;  2Q8I B;  4A3B H;  4O1N A;  1IHZ A;  2BDN A;  1I4Q A;  4PMC A;  1BR9 A;  3F2B A;  5LMU Q;  2ASB A;  3RLO A;  1TY2 A;  3E0J A;  5COY A;  1SMX A;  1PH5 A;  3Q23 A;  1UE1 A;  2CQO A;  1OXT A;  5FKA C;  2PMZ E;  2PZU A;  4KHZ A;  4DR1 Q;  1HR0 Q;  3MXN B;  4KY7 A;  1M1K C;  1MJE A;  1JCK B;  3ER0 A;  1AZQ A;  3I90 A;  1Z7T A;  2FFK B;  5FK9 C;  5JPN C;  2DGY A;  4Y52 H;  4ZUJ A;  2F0O A;  1PVO A;  5EKK A;  4OIK A;  4GNX B;  1TQO A;  4NXM L;  3JC6 6;  5CC4 A;  2YU9 B;  4K5X A;  1FGB D;  4ALP A;  1QZH A;  2IX0 A;  1H9S B;  3GTJ B;  4G7H C;  3VYS A;  1LTG D;  4FF3 A;  4ZKC B;  1PA6 A;  2NN6 G;  1B44 D;  4MIU A;  3P20 A;  3OMC A;  1ONL A;  4J1M A;  1ENC A;  4DUY L;  4HIO A;  2Z4H A;  4K6L A;  2E2J H;  1ICW A;  3ERO A;  4JG2 A;  5KNC A;  4OO1 G;  3CCV A;  4LAA A;  4ILW A;  2N8N A;  5ELB A;  4OEL B;  2UXC Q;  5M3F H;  4BBS G;  4K2L A;  2A6H C;  3UDX A;  1ZYR C;  1EWI A;  2RDF A;  2RSO A;  4DN4 M;  2A73 B;  3BZC A;  2NZ1 D;  3I73 A;  3E9I A;  5CBA E;  1KLG D;  1VQ9 A;  5CV9 A;  3GTG H;  4DR4 L;  4DV5 Q;  5CGK A;  1EIG A;  2VXW A;  3STB C;  2EXZ A;  3GDE A;  3R93 A;  1E1T A;  3UDF A;  2DNE A;  5IWA Q;  5EAY A;  2WII B;  3GTL B;  4OXP A;  1TVX A;  4JCV E;  5EKI A;  2BH8 A;  3JAM E;  3EBE A;  1D5M C;  4Z9C B;  2R93 G;  4GKJ Q;  1CQF A;  1ET6 A;  2E2H B;  1IBK L;  2EDG A;  2SNS A;  1BCP B;  2LXK A;  5BN4 A;  2UUA L;  1CZG A;  2B63 G;  4LFB L;  5AFW A;  2VNU D;  4TSS A;  4A3C H;  1EY9 A;  3I55 A;  1LV9 A;  4EQN A;  5EJW A;  2UXB L;  1WI5 A;  4JI8 L;  2XNA C;  1EEI D;  2NVY B;  1XPU A;  3TRE A;  1QE6 A;  1BCP C;  1ESR A;  3OWE B;  1OO9 B;  3A0J A;  4K6D A;  3KBX A;  4OEM B;  2R7D A;  5IT9 E;  1UNS A;  1B4O A;  3D4R A;  5F2D A;  1I94 Q;  1A63 A;  3A5U A;  2CVR A;  1ML0 D;  1O78 A;  1P8L A;  3I91 A;  1TWH H;  1WCM B;  1HRJ A;  2UUB L;  5M5W H;  1E3P A;  1GUS A;  1YHB A;  3PUY A;  1XNQ Q;  3K5L A;  1BCP F;  1GKH A;  4A3B B;  1U4R A;  2OT2 A;  4HMJ A;  4APV A;  3MEH A;  4QIW B;  3RMH A;  2E2I H;  4RH6 A;  5IGE A;  4BXX G;  1D5Z C;  1B7Y B;  4OX9 Q;  2F0J A;  4IFD H;  1LTT D;  3CCL A;  3RN2 A;  2A69 C;  2B8G A;  4LF5 Q;  2EY2 A;  1F2L A;  4A3M G;  5DLQ E;  1KRT A;  2X69 A;  2K04 A;  2MO0 A;  4CDF C;  1G8Z D;  1VQ5 A;  1QVF A;  4M1U B;  4DNT B;  2AUK A;  5K36 G;  2R6G A;  3LWU A;  5JEA G;  5IP7 H;  1H9J A;  4KKT A;  3HOV H;  3J81 i;  1LTL A;  2CHB D;  2KHS A;  2AWN A;  1KC8 C;  2E2J B;  1EEF D;  2ZTE A;  4A3E H;  1G51 A;  2QGQ A;  1FD7 D;  2L0C A;  1HZ9 A;  1KAW A;  4A3F H;  1MIU A;  5CBE E;  2K50 A;  1C7Y A;  4HJ7 A;  1D5X C;  3SK4 A;  5M3F B;  4QQB X;  3PIP 3;  2KED A;  3M7N A;  1ET9 A;  4XQJ A;  1R4P B;  4MTK A;  3J80 L;  3D4W A;  2K6A A;  3GTG B;  4IUR A;  2EYO A;  3FMC A;  1CA5 A;  4RCN A;  2PI2 A;  1VQB A;  2B29 A;  1WD0 A;  4B3T L;  1T5E A;  3H0G H;  2QA4 A;  3C2P A;  4KD3 A;  2IY5 B;  5ELF A;  5E4X A;  3S16 H;  1VQE A;  3A7L A;  1JMC A;  3I4M H;  1IKM A;  5NUC A;  1WCM G;  1N32 L;  4RGO S;  2NWG A;  3FP9 A;  4HR7 B;  1SFO H;  1YVC A;  3X3N A;  4K5V A;  4A3B G;  1Q7Y C;  2EJM A;  2Z4I A;  5HGT A;  3H3V H;  4BBR H;  3FPU B;  1S5C D;  4JI3 Q;  1IL2 A;  4UP9 A;  1QUQ A;  1YNJ D;  4DFA A;  3QOL A;  3R2I A;  4X3S A;  1EOT A;  2F0G A;  2WAC A;  1EYG A;  2F0T A;  1Y1W G;  3PO2 G;  1DYQ A;  4PZ8 A;  2NBF A;  3SGI A;  1SMY D;  4DV1 L;  1RTN A;  3FKI G;  3K5O A;  1WD1 A;  1B3Q A;  1HH2 P;  1VMP A;  1TWH B;  5CMD A;  2HHH Q;  3A8K E;  4YWK A;  1HNX L;  1PFB A;  3E6Z X;  2K28 A;  5M5W B;  2JK8 A;  3NEL A;  4IAL A;  4KMU C;  5GAG C;  1E22 A;  3HFZ B;  5DNF A;  1LT6 D;  1C4Q A;  1JJ2 A;  2JQO A;  1TS5 A;  4EQP A;  2E2I B;  1STG A;  3ZYY X;  4AQY Q;  4DAY A;  5M3F G;  1V1O A;  5IOC A;  2HQL A;  3KBG A;  4R4C A;  1M90 C;  2JXM B;  1QUQ B;  1HFG A;  1UE5 A;  1VQ8 A;  4A3J H;  2FMM A;  3EVQ A;  1GO3 E;  4IUN A;  5C0X J;  4A3D G;  1EY4 A;  3V2T A;  2LXJ A;  3T1H Q;  2EY5 A;  4RAU C;  4DV0 Q;  4BY7 H;  2PYK A;  1VQA A;  2B2U C;  1V1Q A;  4XYO A;  1HXY D;  1WTV A;  4XQN A;  5CYU A;  4JV5 L;  3HOV B;  4L5T A;  1SE2 A;  3UE0 A;  1YJW A;  2DNC A;  3NPP A;  1SJE D;  4N9T A;  1SR3 A;  1J8I A;  5DAU A;  1HNZ Q;  2K7V A;  4A3E B;  4A3F B;  3BZD B;  4L5R C;  3C3L A;  2NN6 I;  3KLS A;  3S15 H;  4YCV A;  3BVZ A;  4LF6 Q;  4N8X 1;  3CAM A;  3N6R A;  3ULL A;  4DAY B;  4UDU C;  4OO1 I;  3KDF A;  3QJY A;  1DOK A;  1JWU D;  2O4X A;  3K5N A;  4CJ1 B;  4JI4 Q;  3P75 A;  2H1E A;  2RVL A;  1MD2 D;  1BOS A;  1X65 A;  1X56 A;  3F2U A;  2UU9 Q;  3UI2 A;  4A93 H;  2SNM A;  2MQH A;  4DV2 Q;  4PMB A;  5C0X H;  3H0G B;  2L55 A;  2L4N A;  5GAE C;  3S16 B;  5C3E G;  4UAI A;  1C48 A;  1NR2 A;  1I6H H;  1MSH A;  3F1Z A;  3I4M B;  1N33 Q;  3RLN A;  2LMC B;  1STA A;  4NW2 A;  4Q5V A;  2B39 A;  2JA7 H;  3TP8 A;  1PH1 A;  4X66 L;  3TEH B;  4BS9 A;  4BBR B;  4DR6 Q;  3D6W A;  4DAP A;  2K05 A;  3FVQ A;  1IBL L;  2F4V Q;  4IFD G;  1N9W A;  3KDF B;  5IOD A;  1IBM L;  1LTS D;  2EY1 A;  2CQA A;  5KRU A;  2KQ3 A;  2PQA A;  4LUZ A;  4RMF A;  4JVZ A;  3VDY A;  2I5H A;  3K59 A;  1BBW A;  2QDB A;  4V19 0;  1M8A A;  1ZEQ X;  4FDB A;  3M7G A;  1WTR A;  5LHY 1;  4XTC S;  1EY7 A;  2KEE A;  1J6Q A;  3IAY A;  3I3C A;  2AMC B;  1N36 L;  4JI5 Q;  1FNU A;  5IP7 G;  3I4N H;  4JI2 L;  2OXP A;  2DUD A;  3ERQ A;  3L2P A;  3ZJY C;  3MZ5 A;  2I0Q A;  1EL0 A;  1HZB A;  1X3F A;  3PIO 3;  1YHA A;  4A3E G;  1U9R A;  4KV6 A;  4A3F G;  4HJA A;  4BA1 I;  2Z6K A;  2KEN A;  4FXK C;  4GN5 A;  1UEB A;  3NP8 A;  4IPH A;  3VR2 A;  2N88 A;  3DM1 A;  3TS2 A;  1TS2 A;  4A3J B;  2OEO A;  1VS0 A;  3Q0A A;  5LMN Q;  1TY0 A;  1K9M C;  3OWF A;  4P71 A;  4G4K A;  3V96 A;  1NBW A;  4DV6 Q;  4O42 A;  5E1F A;  2BH2 A;  5G3L D;  4RCO A;  3DHQ A;  4DV7 L;  4BY7 B;  4KD4 A;  1E24 A;  4X65 L;  3NE5 B;  1YNJ C;  5LL6 S;  5JVG 3;  2UXD L;  1NNX A;  2K5D A;  1HR0 W;  1EYC A;  1CHQ D;  1XNR L;  2PO4 A;  3I4M G;  1Q82 C;  3WDN A;  1DJR D;  2EYM A;  3HOY G;  5JOB A;  1D1I A;  4IPC A;  2J7Z A;  4DGZ A;  1KQS A;  3H94 A;  1I5F A;  3KOJ A;  2DJG C;  3KK7 A;  3K5M A;  4R8I A;  4YCU A;  1KNE A;  1RHP A;  4B3M L;  3GTO H;  2VQE Q;  2NVQ H;  1OXV A;  4KN7 C;  5I2Y A;  1SXT A;  3D6C A;  4TQU S;  1QIL A;  4X64 L;  2EVB A;  3HOW H;  1UUP A;  4ZLT F;  2Y0S B;  2Z6K C;  3TP5 A;  4A93 B;  3Q8D A;  1IXR A;  4MZ9 A;  1CKM A;  1STB A;  4LK1 C;  2JA5 H;  3HOX B;  2YTX A;  1RL2 A;  1I6H B;  2NB0 A;  5KGU A;  2VQF Q;  4AYB B;  2Z8L A;  3TP7 A;  5CV8 A;  3HS0 C;  4HED A;  3AU7 A;  3K0X A;  1Q86 C;  3NXW A;  3G71 A;  1W3S A;  2EYF A;  2JA7 B;  5DM7 3;  1PRT D;  4NXN Q;  1K0R A;  2MO1 A;  3HKS A;  1N34 L;  2Z6B A;  3H91 A;  4A4I A;  4KTA A;  5JJK A;  2CH4 W;  1BKB A;  1JB7 A;  2SEB D;  3S1M H;  1FJG Q;  5I9P A;  2A6E C;  3RUZ A;  1HNW L;  2OQK A;  4DR7 L;  1GVP A;  1EIY B;  3DEP A;  3JAM L;  5EPJ A;  4DXF A;  1PH6 A;  1JOK A;  4OL7 A;  3OTO L;  4BY7 G;  4LW1 A;  4YWM A;  2Q2I A;  2JA8 G;  3OYY A;  1CM9 A;  2L12 A;  3HEJ A;  2C35 B;  2BDO A;  2DY8 A;  4B3S Q;  5KIX A;  3I4N B;  2QF7 A;  3BS1 A;  4A3I G;  4IUV A;  1S5F D;  1S3O A;  2ATW A;  2F0H A;  4UPA A;  4C56 C;  2XIW A;  4C3I H;  3OW7 A;  1AE3 A;  3NQT A;  1KDA A;  4PZ6 A;  1BO0 A;  1IKL A;  2I5L X;  2Z9H A;  5IT9 L;  3U9O A;  2RDH A;  4J15 A;  4BA2 I;  4C3J H;  2YV5 A;  3I7F A;  3P1H A;  5FJ8 H;  4ME5 A;  5CR3 A;  2ZTC A;  4RKL A;  2K14 A;  2M00 A;  2VL6 A;  2RCF A;  1DGS A;  5BR8 Q;  4I7A A;  4EX5 A;  3S14 H;  1CTM A;  4K0K Q;  4RWS C;  1DD2 A;  3CQZ H;  2F3I A;  4X3K A;  4EQ5 A;  4DUZ Q;  5ELD A;  1HR0 L;  3X3M A;  2ZM6 L;  2EJG C;  4IJL A;  1QVC A;  4JW0 A;  2AUJ D;  1K8M A;  4K8J A;  3URY A;  2AKW B;  2JN4 A;  4PZ7 A;  2KEC A;  3GTK H;  1SYD A;  4UY8 C;  1YNN D;  4R1J A;  1IW7 D;  1WTH A;  2JA7 G;  1I3Q B;  1SRU A;  2QEX A;  1KDB A;  2R3Z A;  4HJ5 A;  4HSP A;  1T5X D;  1GUO A;  4E6I A;  2HCC A;  3GTO B;  4LJZ C;  1L2F A;  1NE3 A;  3D3R A;  4DAM A;  5C3X A;  3GTQ B;  2NVQ B;  4MHE A;  1SYB A;  2WV6 D;  1BF4 A;  4F7X A;  3HOW B;  4RGM A;  4HIM A;  2WB1 G;  2C9O A;  3U50 C;  1CA6 A;  2F1M A;  3TME A;  4ULL A;  1OTC A;  1PXU A;  2K75 A;  1HPC A;  1CZW A;  2PW7 A;  2JA5 B;  3UE1 A;  3QWN A;  1KLU D;  1JQY D;  2D2C C;  2QDL A;  3S9W A;  5IGB A;  3SXH A;  3T1Y Q;  1EY6 A;  3ULJ A;  4DV5 L;  3M4P A;  3I4N G;  1AN8 A;  2CKZ B;  1JC7 A;  2F0W A;  3T56 B;  3CME A;  1ASZ A;  3C46 A;  4G7Z C;  1Q3L A;  5IWA L;  1Y8N B;  4M8A A;  4L63 B;  3PF5 A;  1AP0 A;  4ZK9 B;  1XPR A;  4X62 Q;  1W2B A;  1ZKO A;  1EU3 A;  1HTP A;  1YEZ A;  3F8T A;  1DZ1 A;  1VMC A;  3S1M B;  2KUM A;  3RZO H;  2XVS A;  4JBM A;  5J3B A;  4GKJ L;  1SJH D;  1E2Z A;  3PQI A;  1KDC A;  5C4X H;  1LAB A;  3DWA A;  1GHK A;  2Q8R E;  1QCB D;  3VR4 A;  5D3D A;  4QIW E;  1S72 A;  1LT3 D;  1XYI A;  2E5L L;  3NHH A;  1JWS D;  1VQN A;  2YYZ A;  3MA2 B;  1IYV A;  5IGD A;  2D9U A;  1SNC A;  3CHB D;  1KL9 A;  2XN9 C;  3OPO A;  4POF A;  1Z47 A;  3PMF A;  2F0M A;  5GQO A;  1I94 L;  4P75 A;  2SOB A;  3BG3 A;  3FPP A;  4C3I B;  3K8A A;  1SNP A;  3KLS X;  4OWT B;  2LSS A;  1A6X A;  2BA0 A;  4N9P A;  1PYS B;  3VR5 A;  4LF7 Q;  3RD4 A;  3FHW A;  4C3J B;  4I65 A;  5JVH 3;  3K80 C;  1N8R C;  1D6E C;  4DU9 A;  4LFA Q;  2KHI A;  2K5V A;  1SLJ A;  2IWH A;  4A3K H;  2YTV A;  2F52 A;  4QMG A;  3S14 B;  1U0L A;  4V0B A;  1Q1E A;  3HOW G;  3CQZ B;  3IKJ A;  3CCE A;  4OX9 L;  1KAB A;  2K1B A;  3NWT A;  5HUR A;  1B9M A;  2F0F A;  3FEW X;  1SAP A;  5IYD H;  3EIV A;  1C8C A;  2JA5 G;  5ELC A;  3GP7 A;  4EQO A;  2GA4 B;  1YI2 A;  2D0P A;  1AEX A;  3GTK B;  1K3R A;  2PMZ B;  5TSS A;  4LNQ A;  2VB2 X;  1H9K A;  3KJO A;  4XDX A;  2Q2H A;  4CDC C;  3CCJ A;  1EY0 A;  2BCO A;  5C5L A;  1X3Q A;  1X3E A;  2FHT A;  4DR4 Q;  3SK6 A;  5CV4 A;  1WJJ A;  3CPW A;  2X6L A;  3TP6 A;  1T9H A;  5C4Z A;  3J81 c;  4CHT B;  5I6W A;  2F0P A;  4C2M H;  1VQO A;  4Y7N H;  3H3V I;  5A2Q L;  1Z6H A;  1DM0 B;  2JEA I;  2N3S A;  3SDZ A;  1K28 A;  3EQL C;  3OIQ A;  1II3 A;  4KLK A;  4JOI A;  4KN4 C;  5D3I B;  1WTP A;  3RNU A;  1V9P A;  1RIP A;  1IBK Q;  2UUA Q;  3CRL C;  4I7Z C;  4KI0 A;  4PG3 A;  4LF8 Q;  4LF4 L;  2HDL A;  2EPB A;  1DXM A;  5M5X H;  3NSW A;  1VQ7 A;  4ODG A;  1PTO D;  3NBH A;  3DXJ C;  1EYD A;  3HG9 A;  1K0S A;  3ITP A;  1AW7 A;  1R9T H;  2EOT A;  3J7Z C;  3RZO B;  4C3J G;  2E2D C;  1Q1B A;  5FJ8 G;  5C4X B;  2EYJ A;  2ZJQ A;  1IW7 C;  1F9Q A;  4N8F A;  2XRQ D;  2RHS B;  2HDM A;  2NZH A;  2WP8 J;  4YY3 Q;  1VQC A;  3G6J B;  1ICF B;  2K52 A;  1BVS A;  3OMG A;  1VF7 A;  4JYA Q;  4TVA B;  1KIX A;  1IYU A;  2RKS A;  5EBD A;  2PPB C;  3TRZ A;  4IPD A;  1Y8O B;  3GTP H;  5FO9 B;  2JSO A;  3VR6 A;  2FIN B;  3HOZ H;  4KJO A;  4B08 A;  4QCL A;  3KLW A;  2LFN A;  3CC2 A;  4JOI C;  3H15 A;  3F2D A;  3PIP A;  1WTX A;  4K8I A;  3NBH B;  3R2T A;  3D0F A;  5EQ0 A;  5FLX E;  2HHH L;  1YJ9 A;  4CKE A;  2EXD A;  4R4I A;  1QNU A;  2L9H A;  1KXL A;  1CQV A;  2F0Q A;  1I50 H;  4A3K B;  4NB3 A;  3S1R H;  4HID A;  4IOC A;  4GKK Q;  4HCS A;  4J8Q A;  3M4Y A;  2CWP A;  3BDC A;  5E7N A;  4A3G B;  4AQY L;  4CBV A;  3NK9 A;  3I4O A;  3KYH C;  5C6A A;  3R8B A;  1A2U A;  2B2U A;  5KEE A;  4FVM A;  5LMN W;  5DM6 3;  3A55 A;  3EA6 A;  2EIF A;  4DR2 Q;  1EFW A;  2G9H D;  1PYW D;  3T1H L;  3W5O A;  3GTM H;  5E3F A;  2DN8 A;  2K5N A;  4DV0 L;  1X3P A;  4KJN A;  2UUC Q;  5EKL A;  2MPM A;  2K33 A;  4P2C B;  4IUP A;  2CH4 A;  1JJC B;  5ELE A;  2ZTD A;  3JAM c;  4B9X A;  5COR A;  2X6G A;  4RA8 A;  1J5E Q;  3W1G A;  2EY6 A;  3DM3 A;  4B3T Q;  1HNZ L;  1EQT A;  2NYZ D;  4C2M B;  4B3R L;  4U67 3;  4Y7N B;  3J7A F;  1E2V A;  5C4X G;  1GD7 A;  2NUC A;  1G6Z A;  1YBY A;  1B50 A;  2B2Y A;  3HKZ B;  1GUW A;  5ELO A;  1PDQ A;  1N32 Q;  1KTK A;  1C0A A;  1JWM D;  3K6O A;  1U4L A;  3PUZ A;  4HIK A;  2RA4 A;  4DPG A;  4JI4 L;  5IT9 c;  1SNO A;  3W2D A;  2F03 A;  1CK1 A;  2UU9 L;  2R61 A;  1B70 B;  3NUC A;  4JI7 Q;  1SNQ A;  5M5X B;  1CSP A;  4DV2 L;  2R7Z H;  1LTR D;  1SEB D;  5I9O A;  1HA6 A;  2XRS D;  4HN7 A;  2A68 D;  4R4O A;  1V1P A;  3NEN A;  2KHJ A;  1R9T B;  1WTO A;  2R92 H;  4QJF A;  3DMU A;  3BU2 A;  3I8Z A;  2IX3 A;  1STE A;  3AEV A;  3D8G A;  4YWL A;  4QUF A;  3CP0 A;  1HFN A;  4A3K G;  4A3C G;  1GM5 A;  2HT1 A;  4S3S A;  3PCO B;  2J0T D;  1XPO A;  2F0K A;  4LFC L;  3RR5 A;  1F77 A;  3MWY W;  1A62 A;  2I46 A;  4X3U A;  3TBI B;  1K83 H;  2B2Y C;  3GTP B;  4DV3 Q;  3L7Z C;  4HJ8 A;  3IRB A;  3HOZ B;  1ASY A;  1TWF H;  1VQI A;  3HOX H;  2RBM A;  3MXG A;  1HJP A;  3SK8 A;  1V1P B;  3J7A V;  3BZK A;  4JI5 L;  5D14 A;  4FO2 A;  4DNI A;  5BN3 A;  1QB5 D;  4CKC A;  1X55 A;  4JPB W;  4GS3 A;  2MGS A;  2HD3 A;  1I50 B;  3S1R B;  1PTO C;  3HKZ G;  1IYJ B;  1K3B C;  4LWC A;  2F4I A;  3VYU A;  5LMN L;  4QB4 A;  1HZC A;  1STN A;  1VQJ A;  2EZV A;  1A8V A;  1SBB B;  2PNH A;  1X32 A;  4UHV A;  4Q0F A;  3G6E A;  3HZX A;  5H1S E;  3J80 E;  1GHJ A;  1EUJ A;  2L5T A;  2ENB A;  2CFM A;  3GTM B;  4CKB A;  2H4O A;  3DLL A;  3S17 H;  1TWG H;  1S5B D;  3A8I E;  3J81 L;  1FNV A;  3DWQ A;  3E0E A;  3QIA A;  2HCI A;  1FNW A;  4J6H A;  2B3G A;  2WKD A;  3OW2 A;  1RKN A;  4LF9 L;  3E3X A;  5GAH C;  1A0I A;  3HOV G;  4UP7 A;  4OWW B;  1SND A;  3BDL A;  2QEJ C;  1VQH A;  2K32 A;  3DUZ A;  4K2K A;  1MI2 A;  4MTN A;  1XMO Q;  3BYY B;  1A3V A;  1D2B A;  4QY7 A;  1XMQ L;  3CCR A;  3TS0 A;  1JJG A;  2WFW A;  2VQE L;  4ZAI A;  2CW0 D;  1G2T A;  1UE7 A;  2MUY A;  2RCN A;  4HCE A;  2NVT H;  4X66 Q;  2PQA B;  2WB1 E;  3HOU H;  1UEA B;  2NN6 H;  3DWP A;  1Y1V H;  3PIO A;  2R7Z B;  1R4Q B;  2E74 C;  3J7A 5;  3H0G G;  1IBL Q;  4DF7 A;  3MC0 B;  4FXD A;  4OO1 H;  2VQF L;  4JI1 Q;  2HUG A;  2CCZ A;  2HQE A;  1SMY C;  2R92 B;  2A5H A;  4BBS H;  5IY0 A;  1BDO A;  1G29 1;  1I3Q H;  2WKC A;  1Q90 A;  4BBR G;  3UDI A;  1X54 A;  2KCM A;  3IFT A;  3GTQ H;  2F0D A;  3L0O A;  3IL8 A;  3U58 A;  1AZP A;  3S2D H;  1L1O A;  3LX0 A;  1QWY A;  4QL5 A;  2MHV A;  2IJ0 A;  5CV6 A;  1H9R A;  4OIJ A;  1K83 B;  1Z9F A;  1RCV D;  4KHV A;  4KHP L;  4DR5 L;  1JOR A;  3PO3 H;  1TWF B;  2A6H D;  1ZYR D;  1CKO A;  4YHH Q;  1TWA H;  2F3V A;  1HCZ A;  3BDO A;  3EFX D;  1DOM A;  3BVM A;  1F9S A;  1FL0 A;  4B3S L;  1A2T A;  2KBN A;  4CDE C;  2EYH A;  4L6T B;  1BQQ T;  2I07 B;  3I4L A;  2XTI A;  4X3T A;  3ICE A;  3CMA A;  3A7A B;  5IYC H;  4X65 Q;  2XWB B;  1U4M A;  4C1N I;  5I4D A;  2UXD Q;  1SYE A;  3ERS X;  2A68 C;  2BA1 A;  1MGS A;  2G9D A;  1RJT A;  3HGB A;  5AJ3 Q;  5JEA J;  1D1K A;  4IQZ A;  1TII D;  4A3J G;  2OTL A;  1L1O B;  5BR8 L;  2N49 A;  3J7Y W;  1IL8 A;  1LLR D;  2E75 C;  4K0K L;  3KF8 A;  1ILQ A;  3S17 B;  1E2W A;  1TWG B;  2NZO A;  3OOC A;  1PMR A;  1L0X B;  5ISR A;  4B3M Q;  4R9W A;  2R7Z G;  3A56 A;  1BUV T;  1L1O C;  1BCP D;  4DR3 L;  2RQX A;  4H02 A;  3P7J A;  2K01 A;  1TWC H;  1PH3 A;  3G48 A;  3W1B A;  5J22 A;  4BXX H;  4DV4 Q;  1PFS A;  4DK1 A;  1VQK A;  3U4V A;  4C3H H;  1PYB A;  2IHE A;  2IW3 A;  4FP5 D;  4XYQ A;  4A3L H;  3CPF A;  4JBK A;  4DK6 C;  2K5W A;  3LWE A;  4OWX B;  3F2C A;  2VB3 X;  4EGV A;  5LMU L;  3CD6 A;  2OTJ A;  1JOQ A;  1MHW C;  1SYF A;  1Q8I A;  2NVT B;  2Y0S G;  5K5P A;  3HOU B;  1Y1V B;  4A93 G;  2IHF A;  1D8L A;  3QO2 A;  2B2V A;  3T13 A;  1WVL A;  3VYT A;  4DR1 L;  2G5D A;  5FLM H;  3PSI A;  3VA7 A;  5C0X G;  2PZW A;  2HIX A;  5HGQ A;  3BYT B;  1SE8 A;  3GV6 A;  4WFN 3;  3HOX G;  3ONA B;  2PZT A;  4AYB G;  5IYB H;  1VQL A;  4BBS B;  4ZUI A;  1LT5 D;  3MHB A;  3OHX C;  4GN4 B;  3K57 A;  3MXN A;  3OTO Q;  4L5S A;  1I4R A;  4X6A H;  4X62 L;  2XSC A;  3V05 A;  4FF1 A;  5J39 A;  4RGT A;  2KCN A;  1RF2 D;  2F0L A;  1SE4 A;  1EFI D;  1EZ6 A;  1L0Y B;  2B2W A;  2J4X A;  3J80 i;  3RN5 A;  3S2D B;  1TR5 A;  4H13 C;  4ABN A;  5HY6 A;  1UWV A;  1S5D D;  1QG7 A;  2UXC L;  2KCC A;  2CWA A;  3CXC A;  4JBJ A;  3PO3 B;  1E0B A;  3D31 A;  4F88 A;  1B9N A;  1TWA B;  2F0U A;  4A75 A;  2B63 B;  1E1O A;  1ILP A;  3A5Z B;  2KA7 A;  4ID6 A;  2B2V C;  4XIG S;  3Q6S A;  4WJ3 M;  4PNY A;  1BXT A;  1VQP A;  4JI6 Q;  1PFN A;  2AQ1 B;  1YZ6 A;  1U4P A;  1SYG A;  1NAP A;  1WTW A;  1Y1W H;  2ZM6 Q;  1H9M A;  4JI0 Q;  3PO2 H;  4NMZ A;  2L11 A;  4CJ0 B;  1BNZ A;  5C4H A;  4LF7 L;  3MVV A;  4R8N A;  3FKI H;  2LY7 A;  3FRP B;  3T51 B;  2EYP A;  5D65 A;  2I5M X;  4LFA L;  3C1E A;  4EVO A;  1K73 C;  4F87 A;  5FLX L;  2ZJR A;  1L0W A;  1NCV A;  3CU7 A;  5G3L F;  4R4T A;  5L37 A;  1JR0 D;  4IFD I;  1A3U A;  1KAA A;  5LL6 X;  3HOU G;  1DOL A;  2AQ2 B;  2ICE C;  1Y1V G;  2N55 A;  4AIM A;  5JJZ A;  2B2W C;  4OHJ A;  4GNX C;  1WFQ A;  2O2L D;  5BN5 A;  1FR3 A;  3CCS A;  3H6M A;  3VR3 A;  2RHQ B;  1TWC B;  4KKU A;  2KJX A;  2NTS A;  5A35 A;  1KHI A;  1LYL A;  4OGQ C;  2WAQ B;  4C3H B;  3T4A C;  4PQX A;  4YIJ A;  4OON A;  3CCM A;  4NKL A;  4NPS A;  4A3M B;  1PRT B;  2K5Q A;  1RDP D;  2ICI A;  1YNX A;  1LTB D;  4A3D H;  1HUN A;  4JK1 C;  1XNQ L;  1TU2 B;  5EBC A;  4LUV A;  4FYD A;  1EY5 A;  5CV7 A;  2VY3 A;  4NXM Q;  1W6J A;  1YIJ A;  1PRT C;  3MTS A;  3K81 C;  3MXU A;  4B9W A;  1VQG A;  3I72 A;  2D0O A;  1OXX K;  2OCE A;  3NBI A;  3EJI A;  4WRD A;  5KYL A;  4A3G H;  1S5E D;  5JAV A;  3WOF A;  1A15 A;  3S24 A;  1NJI C;  3PO3 G;  4LF5 L;  4DUY Q;  3MFG A;  4IJH A;  3TZU A;  4IUU A;  3M9B A;  2EJF C;  5IGG A;  4ZCK A;  4IFD J;  2ZXP A;  3C1F A;  1O7L A;  2F0E A;  4LF8 L;  4QF4 A;  2VUM H;  1A3T A;  3T53 B;  1PRT F;  1YIT A;  2JEB I;  1HZA A;  1XTD A;  4ZRZ A;  4C1N K;  2E5L Q;  1EQR A;  2KCT A;  5M9O A;  5IYC G;  2ID0 A;  4JBW A;  4QUC A;  2IPK D;  1MBY A;  1KRS A;  1STY A;  1PZI D;  1SN8 A;  2PQE A;  2BE5 D;  5JPM C;  3CF5 A;  3AQQ A;  3S1Q H;  1QOH A;  4P72 A;  4O0A A;  4GLX A;  5C5M A;  1ENF A;  2BOS A;  4IUQ A;  5C3E H;  1F2Y A;  1CKN A;  4A76 A;  1VF5 C;  5KND A;  4IPG A;  2H5X A;  4JC0 A;  2GN5 A;  4YY3 L;  2O5I C;  3WWV A;  4JYA L;  4DK0 A;  3TZD A;  1GXD C;  1MKH A;  4IOA A;  4LFB Q;  1SDF A;  2F3W A;  1G2S A;  1PZJ D;  3B6Y A;  3M85 A;  2F0N A;  2SDF A;  1AFP A;  1AH9 A;  2A1A A;  2UXB Q;  4MNO A;  4JI8 Q;  2PI2 E;  4CDD C;  1SE3 A;  3PUV A;  3PUX A;  1IZ6 A;  2WAQ G;  2JP1 A;  4C3H G;  4C3I G;  3QB3 A;  1F2M A;  2PW5 A;  2M9V A;  3FDT A;  1Y1W B;  3PO2 B;  4R4Q A;  3CW2 C;  1EZ8 A;  2AQ3 B;  4A3L G;  3FKI B;  2R7F A;  1TT2 A;  3ULP A;  4CJ2 C;  1YNN C;  3CC4 A;  1HQR D;  1Q12 A;  2GVA A;  1PH2 A;  1H95 A;  2AWO A;  4JI3 L;  4GKK L;  1CKN B;  5IIF A;  2UUB Q;  3CKI B;  1TS4 A;  1O7I A;  1DCZ A;  1K8G A;  3HKZ E;  2FMC A;  5FLM G;  3A8J E;  1PH9 A;  4G57 A;  4DR2 L;  4XXE A;  2MP1 A;  5KYI A;  4F8M A;  4H44 C;  1PH8 A;  4RHR A;  5IYB G;  3GO5 A;  4O2D A;  1FYC A;  2UUC L;  3MXP A;  3R3O A;  4A3D B;  1PTO H;  3QOJ A;  3PV0 A;  1EU4 A;  1CSQ A;  3CCU A;  1J5E L;  4LF4 Q;  4RHS A;  3IFD A;  1O7Z A;  3S2H H;  1LTA D;  2D62 A;  3RZD H;  3M4Q A;  1EIF A;  3HOY H;  3BVG A;  2V4D A;  3I2Z A;  2N78 A;  3LNN A;  1B2T A;  4IN3 A;  1EQV A;  5JJI A;  2RSN A;  3K7A H;  1FGU A;  1O7Y A;  1VQM A;  1LTI D;  4GZY C;  1SNM A;  2VUM B;  4JI7 L;  5C0X I;  1CT1 D;  2M2L A;  4TRD A;  3KFU A;  1Y69 U;  3AMU A;  4P73 A;  2RDG A;  1HA5 A;  1LT4 D;  4GN3 B;  1XTC D;  5C3W A;  3M3Y H;  1BBX C;  3S1Q B;  4WOR A;  5FO8 B;  1NSN S;  1NY4 A;  5FO7 B;  1QVG A;  5C3E B;  2JA6 H;  2EQS A;  3H09 A;  3MAQ A;  4LF6 L;  1Y14 B;  1X9N A;  1K8O A;  5M3M H;  1X6O A;  1Q81 C;  4DNR B;  5IP9 H;  3E5S A;  3G4S A;  1FVI A;  3GQB A;  1JE4 A;  3RLF A;  1GUT A;  3K58 A;  2E76 C;  1GOZ A;  3SHL A;  1EY8 A;  2DY7 A;  2NVX H;  1SYC A;  4QGU A;  1K8A C;  4ZYS A;  3CCQ A;  4DV3 L;  2ZXO A;  5ELN A;  2VW9 A;  1GUG A;  1QNK A;  1TKW B;  3KLR A;  1CUK A;  1LAC A;  3N52 A;  3NEM A;  3KUP A;  1N33 L;  1B3A A;  4ME3 A;  1JT8 A;  4HJ9 A;  2VS1 A;  2Z1C A;  4DV1 Q;  3DEO A;  3GV3 A;  1UAP A;  3NTI A;  2LKV A;  1HTL D;  3VA5 A;  3TQY A;  1LUZ A;  4DR6 L;  3AFQ A;  2JA8 H;  4KKS A;  5JJL A;  1CHP D;  1HNX Q;  4RGN A;  3JAM i;  3CC7 A;  5A2Q E;  4UP8 A;  4A3G G;  2XGT A;  3A74 A;  2F4V L;  4A3I H;  3SE0 A;  1TXY A;  2BE5 C;  2PCF B;  5IYD G;  3AB9 A;  3NQI A;  2L15 A;  4NP5 A;  3U9S A;  2A6E D;  4HSV A;  1WTQ A;  2YTY A;  4B3R Q;  4GLA C;  2PNR C;  5EPK A;  1XWE A;  4BY1 H;  2Z0S A;  2JYO A;  2TMP A;  4XQQ A;  2VUM G;  2QCP X;  1M4V A;  5GAD C;  3AFP A;  1NUC A;  4XT1 B;  4DXG A;  3K7U C;  2F0V A;  1PTO B;  4LUO A;  4U68 A;  1Q8K A;  4DKA C;  1PFM A;  4ZQ3 A;  3S2H B;  3A54 A;  4DA2 A;  5C44 H;  3RZD B;  1XMO L;  3J81 j;  1F9R A;  4NDX A;  2IL8 A;  4JV5 Q;  1WYD A;  3HOY B;  1JB3 A;  1CI3 M;  1STH A;  1SFO B;  5M5Y H;  2A19 A;  1SRO A;  1X3G A;  4GLV B;  3M4O H;  3K7A B;  4DV6 L;  1XX8 A;  1GJX A;  2OF1 A;  1HUM A;  1VCI A;  1WOC A;  2Y0S E;  4KY6 A;  3T16 A;  1OXS C;  4LFC Q;  1PTO F;  2WIN B;  5IGF A;  2Q2U A;  5FLX c;  1KD1 C;  4L8J A;  4JI1 L;  3M3Y B;  3H3V C;  4AYB E;  1KNA A;  2O5J C;  5EGT A;  1V43 A;  4GOP A;  2GVB A;  1NMG A;  5GRO A;  2JA6 B;  3SVM A;  2OWO A;  2MJ8 A;  3I70 A;  5M3M B;  1JOO A;  1RTO A;  3UDG A;  2ZJP A;  2K5H A;  4RKB A;  4DAV A;  2Q8T A;  1S40 A; 
#chains in the Genus database with same CATH homology
 2D0P A;  1HNX L;  5FLM H;  3PSI A;  5C0X G;  1K3R A;  2HIX A;  5HGQ A;  2JK8 A;  3NEL A;  1SE8 A;  4LNQ A;  3HOX G;  5C4J H;  3KJO A;  5GAG C;  4RG1 A;  1E22 A;  3HFZ B;  2Q2H A;  4AYB G;  5IYB H;  1VQL A;  3HOZ G;  2HIV A;  3CCJ A;  1JJ2 A;  2JQO A;  4YHH L;  1X3E A;  1IBM Q;  2JE6 I;  4DR4 Q;  1WJJ A;  3CPW A;  5IE8 A;  4AQY Q;  4GN4 B;  1T9H A;  3J81 c;  3OTO Q;  5M3F G;  1E7Z A;  2HQL A;  4L5S A;  4R4C A;  1M90 C;  4X6A H;  1QUQ B;  1AE2 A;  1LM0 A;  4C2M H;  4X62 L;  1UE5 A;  2OQ0 A;  2RF4 A;  4Y7N H;  1VQO A;  1VQ8 A;  4A3J H;  3H3V I;  1GO3 E;  4NXN L;  2JEA I;  4GOP B;  5C0X J;  4A3D G;  3RN5 A;  3J80 i;  2N3S A;  1OXU A;  2LXJ A;  2ES2 A;  3T1H Q;  5HY6 A;  1N36 Q;  1UWV A;  4DV0 Q;  4P74 A;  4KLK A;  5AJ3 L;  4LF9 Q;  4BY7 H;  4JOI A;  4JI2 Q;  2UXC L;  1NMF A;  3RNU A;  1V9P A;  2CWA A;  1RIP A;  3CXC A;  1VQA A;  1IBK Q;  1FJG L;  4JBJ A;  3PGZ A;  1V1Q A;  2JJQ A;  4DK3 C;  3AYH B;  4KI0 A;  3D31 A;  4GOP C;  2UUA Q;  4PG3 A;  4LF8 Q;  4LF4 L;  4JV5 L;  4L5T A;  5M5X H;  3S1N H;  1PV4 A;  3UE0 A;  1YJW A;  4A75 A;  1VQ7 A;  1E1O A;  3A5Z B;  1SR3 A;  1XMQ Q;  1HNZ Q;  2R93 H;  1G6P A;  4L5R C;  4XIG S;  2NN6 I;  1R9T H;  2B63 H;  1YHQ A;  3S15 H;  4WJ3 M;  4YCV A;  1VQ4 A;  4LF6 Q;  3J7Z C;  1VQP A;  2R92 G;  4JI6 Q;  3CAM A;  1YZ6 A;  2FXQ A;  3ULL A;  3STB D;  1Q1B A;  5FJ8 G;  1XJV A;  4DAY B;  1Y1W H;  2ZM6 Q;  4JI0 Q;  3PO2 H;  3KDF A;  4OO1 I;  4DV4 L;  2ZJQ A;  4LF7 L;  4DV7 Q;  2RHS B;  3FKI H;  4JI4 Q;  2NZH A;  2I5M X;  2WP8 J;  4YY3 Q;  4LFA L;  1VQC A;  1X65 A;  2K52 A;  1X56 A;  2JA6 G;  2UU9 Q;  1BVS A;  1K73 C;  1XNR Q;  4WJ4 A;  1D7Q A;  4A93 H;  4TVA B;  4AH6 A;  4JYA Q;  1KIX A;  2ZJR A;  2MQH A;  1L0W A;  5M3M G;  2K4K A;  4DV2 Q;  4R4T A;  4IFD I;  5GAE C;  3E9H A;  5IP9 G;  5C3E G;  3TRZ A;  3HOU G;  1I6H H;  3F1Z A;  4IPD A;  1Y1V G;  4AIM A;  3GTP H;  1N33 Q;  2YU9 H;  4L5Q A;  3PF4 A;  4GNX C;  3KF6 A;  3RLN A;  2Q2T A;  1WFQ A;  3GTJ H;  3HOZ H;  3KLW A;  3CCS A;  3CC2 A;  4DR1 L;  2IT1 A;  2RHQ B;  4JOI C;  3H15 A;  3F2D A;  3PIP A;  2HHH L;  2JA7 H;  3NBH B;  4DUZ L;  3D0F A;  1PH1 A;  4X66 L;  1KHI A;  1LYL A;  3TEH B;  1YJ9 A;  4DR6 Q;  2EXD A;  4OON A;  4X64 Q;  4R4I A;  3CCM A;  1NTG A;  1KXL A;  4NPS A;  1VQF A;  1IBL L;  1Q46 A;  1I50 H;  1YNX A;  1C9O A;  4NB3 A;  2F4V Q;  1N9W A;  3KDF B;  3S1R H;  2ALY B;  4HID A;  1YJN A;  1XNQ L;  4IFD G;  4IOC A;  1IBM L;  4GKK Q;  4KHP Q;  4DR5 Q;  2CWP A;  5E7N A;  4A3M H;  4LUV A;  4AQY L;  4PMW A;  1EOV A;  2VY3 A;  4NXM Q;  3I4O A;  1U5K A;  3KYH C;  2PQA A;  4LUZ A;  2VZA A;  4RMF A;  1P16 A;  1YIJ A;  2JA9 A;  3K81 C;  4YCW A;  2I5H A;  3VDY A;  1VQG A;  1BBW A;  1BBU A;  2D0O A;  1OXX K;  2OCE A;  4A3G H;  5LMN W;  4FDB A;  1JE5 A;  4XTC S;  3S24 A;  2EIF A;  4DR2 Q;  1EFW A;  1J6Q A;  3T1H L;  1NJI C;  3J80 c;  1C0A A;  3PO3 G;  4LF5 L;  2AMC B;  3W5O A;  4DUY Q;  3GTM H;  1N36 L;  3KJP A;  1UE6 A;  2K5N A;  4IJH A;  4DV0 L;  5IP7 G;  2V1C C;  3KF6 B;  4JI2 L;  3KF8 B;  3M9B A;  4JI5 Q;  3GTL H;  3I4N H;  1N34 Q;  2DUD A;  2AHO B;  3L2P A;  4BY1 G;  2UUC Q;  4POG A;  4IFD J;  3ZJY C;  2I0Q A;  1JJC B;  4LF8 L;  2VUM H;  1HZB A;  2ZTD A;  1X3F A;  3JAM c;  4A3E G;  1YHA A;  2JEB I;  1YIT A;  4A3F G;  1HZA A;  1XTD A;  3BJU A;  4HJA A;  4BA1 I;  2E2H H;  1J5E Q;  2Z6K A;  3W1G A;  1PH4 A;  3T1Y L;  1HNW Q;  2KEN A;  3U4Z A;  4GN5 A;  1UEB A;  2E5L Q;  1EQR A;  2KCT A;  3DM3 A;  4IPH A;  5IYC G;  3I56 A;  1HNZ L;  4B3T Q;  4DR7 Q;  4B3R L;  2ID0 A;  3TS2 A;  3GD7 A;  4JBW A;  1VS0 A;  5LMN Q;  5C4X G;  1KRS A;  1GD7 A;  1B8A A;  2NVY H;  1YBY A;  1K9M C;  1SN8 A;  1VQ6 A;  4JI6 L;  1MJC A;  3PUW A;  4P71 A;  5ELO A;  3AQQ A;  3CF5 A;  3S1Q H;  1N32 Q;  1NBW A;  1EQQ A;  4P72 A;  4DV6 Q;  2WAQ E;  1PHJ A;  4O0A A;  4IO9 A;  4GLX A;  3EN2 A;  4DR3 Q;  2BH2 A;  4JI0 L;  3PUZ A;  5C44 G;  4HIK A;  2R92 H;  1PH7 A;  5C3E H;  2IX1 A;  1CKN A;  4DV7 L;  2A8V A;  4A76 A;  1E24 A;  4IPG A;  4DPG A;  4X65 L;  4JI4 L;  2H5X A;  2MFI A;  5IT9 c;  4JC0 A;  4GNX A;  2GN5 A;  4YY3 L;  2UXD L;  1HR0 W;  2E8G A;  2UU9 L;  1XNR L;  3WWV A;  1B70 B;  4JI7 Q;  3MEF A;  1QZG A;  4JYA L;  3I4M G;  1Q82 C;  1CSP A;  4IOA A;  1MKH A;  1WCM H;  4DV2 L;  2R7Z H;  3HOY G;  1VQD A;  4LFB Q;  4IPC A;  3LGJ A;  3B6Y A;  2MNA A;  3M85 A;  4R4O A;  1KQS A;  1I5F A;  4A3B H;  3KOJ A;  2A1A A;  1AH9 A;  3NEN A;  2UXB Q;  2KHJ A;  4MNO A;  4JI8 Q;  2PI2 E;  4YCU A;  5LMU Q;  3F2B A;  3PUV A;  3PUX A;  2ASB A;  1IZ6 A;  2WAQ G;  3RLO A;  4QJF A;  4B3M L;  3GTO H;  3BU2 A;  2VQE Q;  1SMX A;  4R4Q A;  1PH5 A;  1UE1 A;  2CQO A;  2NVQ H;  1OXV A;  3CW2 C;  3AEV A;  4YWL A;  3CP0 A;  1OXT A;  4A3K G;  4A3L G;  4TQU S;  4A3C G;  1GM5 A;  2R7F A;  2PMZ E;  4X64 L;  4KHZ A;  3PCO B;  4DR1 Q;  3ULP A;  1XPO A;  3MXN B;  1HR0 Q;  2HT1 A;  4LFC L;  3HOW H;  3RR5 A;  1M1K C;  1MJE A;  2Z6K C;  3CC4 A;  1Q12 A;  2GVA A;  3ER0 A;  3Q8D A;  1PH2 A;  1H95 A;  2AWO A;  1IXR A;  4JI3 L;  4GKK L;  1CKN B;  1A62 A;  4MZ9 A;  2UUB Q;  2DGY A;  4Y52 H;  1CKM A;  2JA5 H;  1PVO A;  4GNX B;  2YTX A;  1O7I A;  1RL2 A;  4NXM L;  2VQF Q;  1K83 H;  1K8G A;  3JC6 6;  4DV3 Q;  3L7Z C;  3HKZ E;  4HJ8 A;  4ALP A;  3IRB A;  1QZH A;  5FLM G;  2IX0 A;  1ASY A;  1TWF H;  1VQI A;  3HOX H;  3K0X A;  1PA6 A;  2NN6 G;  1Q86 C;  1HJP A;  1PH9 A;  3G71 A;  1W3S A;  4DR2 L;  1PH8 A;  5IYB G;  4NXN Q;  1K0R A;  3BZK A;  4DUY L;  4HIO A;  3GO5 A;  4O2D A;  4JI5 L;  2E2J H;  4JG2 A;  4OO1 G;  3CCV A;  4DNI A;  2MO1 A;  3HKS A;  1N34 L;  2UUC L;  1X55 A;  4A4I A;  4GS3 A;  2N8N A;  5JJK A;  1BKB A;  1JB7 A;  2UXC Q;  5M3F H;  3S1M H;  4BBS G;  3PV0 A;  1FJG Q;  3UDX A;  1CSQ A;  1EWI A;  3CCU A;  1J5E L;  3BZC A;  1HNW L;  2OQK A;  4LF4 Q;  4DR7 L;  3HKZ G;  3E9I A;  1IYJ B;  1GVP A;  4LWC A;  1EIY B;  1VQ9 A;  3S2H H;  4DR4 L;  3GTG H;  5LMN L;  2D62 A;  1HZC A;  1VQJ A;  4DV5 Q;  3RZD H;  3STB C;  1A8V A;  2PNH A;  3M4Q A;  1EIF A;  1PH6 A;  3G6E A;  3GDE A;  3OTO L;  5H1S E;  4BY7 G;  4LW1 A;  1E1T A;  4YWM A;  2Q2I A;  3UDF A;  1EUJ A;  2JA8 G;  3HOY H;  3OYY A;  3I2Z A;  2CFM A;  5IWA Q;  5EAY A;  2C35 B;  2N78 A;  3DLL A;  4B3S Q;  3S17 H;  4A3D H;  1TWG H;  4OXP A;  5JJI A;  4A3I G;  4JCV E;  3E0E A;  1FGU A;  3K7A H;  1VQM A;  1S3O A;  2BH8 A;  2B3G A;  2ATW A;  3EBE A;  4UPA A;  3OW2 A;  4C3I H;  5C0X I;  4JI7 L;  4LF9 L;  3KFU A;  5GAH C;  2R93 G;  4GKJ Q;  1A0I A;  1AE3 A;  3HOV G;  4PZ6 A;  1IBK L;  2I5L X;  2LXK A;  2B63 G;  2UUA L;  4UP7 A;  4LFB L;  4P73 A;  4OWW B;  4J15 A;  4BA2 I;  4C3J H;  4A3C H;  2VNU D;  2YV5 A;  1VQH A;  3I55 A;  4GN3 B;  3I7F A;  5FJ8 H;  2ZTC A;  2UXB L;  1WI5 A;  4MTN A;  4JI8 L;  1XMO Q;  3M3Y H;  2K14 A;  1XPU A;  2VL6 A;  4QY7 A;  3TRE A;  1XMQ L;  3CCR A;  3TS0 A;  1DGS A;  5BR8 Q;  1JJG A;  2WFW A;  4EX5 A;  3S14 H;  4K0K Q;  2VQE L;  3A0J A;  1NY4 A;  1QVG A;  3CQZ H;  2JA6 H;  2EQS A;  1UE7 A;  2F3I A;  2R7D A;  4LF6 L;  1Y14 B;  1X9N A;  2RCN A;  4EQ5 A;  5M3M H;  1X6O A;  4DUZ Q;  1Q81 C;  1HR0 L;  1I94 Q;  2NVT H;  4X66 Q;  3A5U A;  2ZM6 L;  1A63 A;  2PQA B;  4IJL A;  2WB1 E;  5IP9 H;  3G4S A;  1FVI A;  1P8L A;  3HOU H;  1QVC A;  1Y1V H;  3PIO A;  1TWH H;  3RLF A;  2AKW B;  4PZ7 A;  2UUB L;  3GTK H;  3J7A 5;  3H0G G;  1IBL Q;  5M5W H;  2NVX H;  1E3P A;  1YHB A;  3PUY A;  1XNQ Q;  4UY8 C;  4R1J A;  4QGU A;  2VQF L;  1K8A C;  1GKH A;  3CCQ A;  4JI1 Q;  4DV3 L;  2JA7 G;  2CCZ A;  5ELN A;  1SRU A;  2VW9 A;  4APV A;  2QEX A;  4HJ5 A;  1CUK A;  4BBS H;  2E2I H;  5IY0 A;  1G29 1;  1L2F A;  1NE3 A;  3NEM A;  4DAM A;  1N33 L;  4ME3 A;  4BXX G;  1JT8 A;  1I3Q H;  1B7Y B;  4HJ9 A;  4OX9 Q;  2VS1 A;  4BBR G;  4DV1 Q;  3UDI A;  3CCL A;  1X54 A;  4HIM A;  2WB1 G;  2KCM A;  3RN2 A;  4LF5 Q;  3GTQ H;  4A3M G;  3U50 C;  3L0O A;  5DLQ E;  3TQY A;  1LUZ A;  1KRT A;  3U58 A;  4DR6 L;  1OTC A;  3AFQ A;  2JA8 H;  2K75 A;  5JJL A;  2MO0 A;  3S2D H;  1L1O A;  1HNX Q;  4QL5 A;  3JAM i;  3CC7 A;  1VQ5 A;  4UP8 A;  4A3G G;  3UE1 A;  2XGT A;  3A74 A;  1QVF A;  1Z9F A;  2F4V L;  4A3I H;  5K36 G;  1TXY A;  4KHP L;  2R6G A;  4DR5 L;  3T1Y Q;  5IYD G;  3PO3 H;  3ULJ A;  4DV5 L;  2L15 A;  5JEA G;  1CKO A;  3M4P A;  5IP7 H;  1TWA H;  2YTY A;  4GLA C;  4YHH Q;  2CKZ B;  3I4N G;  4B3R Q;  3HOV H;  4BY1 H;  3J81 i;  1LTL A;  2Z0S A;  3CME A;  1ASZ A;  5IWA L;  1FL0 A;  2AWN A;  1KC8 C;  4B3S L;  2ZTE A;  3PF5 A;  2VUM G;  2KBN A;  1G51 A;  5GAD C;  2QGQ A;  4X62 Q;  4A3E H;  4A3F H;  1HZ9 A;  1KAW A;  1XPR A;  1W2B A;  1MIU A;  3AFP A;  2XTI A;  2K50 A;  1YEZ A;  3K7U C;  3CMA A;  3F8T A;  4HJ7 A;  1C7Y A;  3ICE A;  5IYC H;  4X65 Q;  3RZO H;  4QQB X;  4LUO A;  4JBM A;  1Q8K A;  5J3B A;  4GKJ L;  2UXD Q;  3M7N A;  4DKA C;  3ERS X;  5C4X H;  2BA1 A;  5AJ3 Q;  5JEA J;  4A3J G;  4QIW E;  5C44 H;  1S72 A;  1XMO L;  2PI2 A;  2OTL A;  3J81 j;  1VQB A;  1L1O B;  2E5L L;  2B29 A;  1VQN A;  4B3T L;  4JV5 Q;  1WYD A;  2YYZ A;  5BR8 L;  2N49 A;  4K0K L;  3H0G H;  2QA4 A;  1KL9 A;  2IY5 B;  5M5Y H;  2A19 A;  1SRO A;  4POF A;  2NZO A;  3S16 H;  1VQE A;  1X3G A;  4B3M Q;  4GLV B;  1JMC A;  3I4M H;  3M4O H;  1WCM G;  1Z47 A;  1N32 L;  5GQO A;  4DV6 L;  2R7Z G;  1I94 L;  1L1O C;  4P75 A;  4DR3 L;  1VCI A;  3FP9 A;  1WOC A;  4H02 A;  1SFO H;  1YVC A;  2Y0S E;  3K8A A;  4OWT B;  2LSS A;  1TWC H;  4A3B G;  1OXS C;  2BA0 A;  3G48 A;  3W1B A;  1Q7Y C;  1PH3 A;  4LFC Q;  4BXX H;  1PYS B;  4DV4 Q;  1PFS A;  2Q2U A;  4LF7 Q;  5FLX c;  1VQK A;  3FHW A;  3U4V A;  3H3V H;  4BBR H;  1KD1 C;  4C3H H;  3K80 C;  1N8R C;  4JI3 Q;  1PYB A;  1IL2 A;  4JI1 L;  4LFA Q;  2IHE A;  2KHI A;  4UP9 A;  1QUQ A;  4AYB E;  2K5V A;  1SLJ A;  4A3K H;  4A3L H;  2YTV A;  2F52 A;  3CPF A;  1EYG A;  4JBK A;  1U0L A;  3HOW G;  1Q1E A;  1V43 A;  4DK6 C;  4GOP A;  2GVB A;  1NMG A;  3CCE A;  5GRO A;  1Y1W G;  3PO2 G;  4PZ8 A;  4OX9 L;  4OWX B;  3SGI A;  3F2C A;  2OWO A;  5LMU L;  3CD6 A;  2OTJ A;  4DV1 L;  3FKI G;  5IYD H;  3UDG A;  3EIV A;  2ZJP A;  2JA5 G;  2Y0S G;  2K5H A;  1HH2 P;  4A93 G;  2IHF A;  1D8L A;  1S40 A;  2HHH Q;  1YI2 A;  4YWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...