5J22A

Crystal structure of staphylococcal nuclease variant delta+phs l103d at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEADVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L103D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 36
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5j22A00
3QB3A 4K8JA 1STNA 5I9PA 4QB4A 4MIUA 3MVVA 1KABA 5DAUA 5KEEA 4K14A 2EYHA 5CV4A 4I65A 3T13A 4IALA 5HGTA 4ID6A 1JOQA 1SYCA 2F0FA 2EY2A 5JOBA 2F0IA 2PYKA 1EZ8A 4PNYA 1EYAA 5C5LA 5CGKA 2OF1A 3C1FA 4KHVA 3SXHA 1EY4A 4H7BA 5IIFA 2PZWA 4DGZA 3D4DA 4RKBA 5J1ZA 1JOKA 1KDBA 1STHA 2EYPA 3H6MA 4ZUIA 3RUZA 4KD3A 5IGEA 2F0LA 1EY6A 1A2UA 3EJIA 4J1MA 3D4WA 5CV7A 2F0DA 5CV6A 5KIXA 4QF4A 1SNCA 2EYLA 4K5VA 2RDFA 4KJOA 5CR3A 2EXZA 3ERQA 3LX0A 1EQVA 2F0GA 4YIJA 2PW7A 5M9OA 5IODA 2F0QA 5CV8A 3MXPA 2F3WA 3PMFA 5IGGA 5K5PA 3OMGA 3SK6A 5IOCA 1A2TA 1A3VA 3D8GA 3SHLA 3TP6A 3OSOA 3QOLA 4KV6A 1NUCA 5KGUA 5J22A 4NMZA 5JAVA 1EYDA 1SYEA 2WACA 2EY1A 4KY6A 5E1FA 3HZXA 2PW5A 3S9WA 2F0UA 4ODGA 3EROA 3U9OA 2EYFA 1SYDA 5NUCA 2EYMA 2O4XA 1TQOA 3TP8A 1STBA 3P75A 5C3WA 1RKNA 4ME5A 4WORA 4N9TA 5EKLA 1TT2A 2EY5A 4PMBA 3TP5A 3T16A 2F0HA 1EY7A 4K2KA 2SNSA 5I9OA 4EQNA 1SNMA 4B9WA 5C6AA 4S3SA 2EY6A 4WRDA 3D6CA 1JOOA 4HMJA 2F0JA 2F0VA 2OEOA 4HMIA 2F3VA 3MEHA 2EYOA 4HTHA 4KY5A 1A3TA 3SK4A 3BDLA 3TMEA 2F0NA 2KHSA 4K8IA 5EKKA 3MZ5A 3SK8A 4NP5A 3P1HA 1STAA 1A3UA 5ISRA 4F8MA 1IHZA 3MHBA 2KQ3A 3NQTA 3BDCA 3R3OA 2QDBA 4KD4A 5F2DA 4EVOA 5CV5A 3SK5A 1SYFA 1SYGA 1EY0A 5C4ZA 4DU9A 4DFAA 2SNMA 1II3A 2RBMA 1STGA 4OL7A 1F2ZA 3NP8A 4PMCA 2NUCA 2F0OA 3DHQA 4ZUJA 4J6HA 3SR1A 5HURA 2F0PA 4K5WA 1SYBA 3NXWA 2F0MA 2EYJA 5CC4A 5KRUA 4NDXA 5IGCA 1ENAA 1EYCA 4EQOA 4G57A 2F0TA 3NUCA 4KTAA 4N9PA 5DEHA 4TRDA 4F7XA 1EY9A 3NK9A 4IUNA 5KYLA 2F0WA 2SOBA 1SNOA 3V2TA 1SNPA 2PZUA 4K6DA 2F0EA 2F0KA 3C1EA 1KAAA 2HQEA 5C5MA 4B9XA 5CV9A 4KY7A 1NSNS 1KDCA 2RKSA 1TR5A 3NHHA 5J39A 1STYA 4RKLA 1SNDA 1F2MA 5EGTA 3VA5A 5E3FA 3E5SA 1EY5A 3OWFA 5I6WA 5C3XA 1U9RA 5IGBA 3QOJA 4R8NA 2PQEA 2PZTA 2LKVA 2M00A 3DMUA 4EQPA 5KYIA 1F2YA 4KJNA 4LAAA 1ENCA 1SNQA 2F0SA 4K5XA 4ZQ3A 2ENBA 4DF7A 5I6YA 5IGDA 1AEXA 5C4HA 1JORA 1EY8A 4K2LA 2OXPA 3TP7A 3HEJA 3ITPA 4IZ8A 3OMCA 4QMGA 5IGFA 4NKLA 1KDAA 1EZ6A 3EVQA 4E6IA
chains in the Genus database with same CATH superfamily
1DOLA 2G9HD 5I9PA 4MIUA 4IFDI 3NE5B 3T13A 1JOQA 4J15A 1I3QB 1HR0L 4RHRA 2F0IA 1VQ6A 1FNVA 3BZCA 1BOSA 1EZ8A 5CYUA 3HRZC 2OCEA 1XNRL 1TY2A 3VR2A 2L0CA 3GTQB 1B9MA 1RTOA 3JC66 1N34Q 3K5OA 5A35A 2R92B 1B9NA 3S1NH 2K01A 2L15A 1Y1WB 1FNWA 4BY1H 4C3HB 1QCBD 5J3BA 2EYLA 3UDIA 4A3DG 3J81i 1KHIA 3GTGB 3DM1A 3GTLH 1QNKA 5LMNQ 3S2HB 5FO8B 1E24A 1WYDA 4DR4Q 2R7FA 1Q7YC 3X3NA 2N49A 4DV3L 2D9UA 4LF7Q 4DV6Q 3S14B 3CP0A 2WIIB 2E8GA 3S2DH 1SEBD 1SNMA 1SROA 3IL8A 1XWEA 1QZGA 4H02A 2M2LA 1H9MA 1MHWC 3MC0B 3P1HA 1BQQT 5ISRA 1TWHH 1IHZA 4NB3A 3J81j 2EE1A 1IKMA 2K50A 2AWOA 3DEPA 1VQ7A 1JR0D 1PYWD 4JI2L 4IURA 1A63A 4KHPQ 1AZQA 2B63H 3KDFA 1X3FA 1UUPA 1TS5A 1PH7A 2RHSB 1XPRA 1MKHA 3L0OA 3NTIA 4KN4C 3HOXB 5KYLA 1BUVT 4DV0Q 5T1GA 1LTAD 2VQEL 2HDMA 2VNUD 3ZJYC 4DAMA 5LL6X 3FKIB 1KLGD 3VA5A 1JB7A 1Z6HA 1U9RA 2UXCL 1K3RA 2FMCA 2Y0SE 4A4IA 4DNRB 4Y52H 3W2DA 3GO5A 1XMQQ 4C3JB 2IX0A 4K2LA 1TWGB 3M85A 1XMOQ 1L0WA 3CD6A 2KBNA 1E1OA 1CQFA 1XTDA 3DEOA 2UUAQ 4BY7B 4QB4A 3KFUA 1VQ8A 4DR1Q 2JA8G 2ASBA 4A3CH 2YU9H 4R1JA 1QE6A 3MA2B 1EU3A 3L3OC 5BR8Q 4ULLA 4O1NA 3V05A 3D4RA 1ZYRD 1FL0A 3E9IA 4IUVA 1E3PA 2AHOB 2V4DA 5EQ0A 1SNCA 4P73A 5LHY1 3I4NH 1DXMA 4GN3B 1TXYA 3Q8DA 4OGQC 2F0QA 2XTIA 5K5PA 1W2BA 4C2MH 5KGUA 1L0YB 1JE4A 1NUCA 1S4ZA 3RN5A 1D1IA 2K5HA 4FXDA 3HKZG 3HOUH 3LNNA 4LMQD 1A15A 1TT2A 5M3FB 3TP5A 1IBLQ 2NVTB 3T16A 4A3JB 4DUYQ 3T1HQ 4A3IG 2EZVA 4GLVB 3Q0AA 4S3SA 3CPWA 2VB3X 2JA5B 4JI3L 3D6CA 5L37A 4HCEA 2KHIA 4NW2A 4R4OA 4HJ5A 3HP3A 5C4XB 1VMPA 2CQOA 3BZKA 3A5UA 5D65A 4HAEA 5C4ZA 4XXEA 3G6EA 1QUQB 4V0BA 1QILA 4LW1A 4XQJA 4DV7L 5D14A 1VF7A 4QQBX 3FMCA 2F0MA 1ESFA 3PIOA 1TU2B 3I70A 1ENAA 2NTTA 4HCSA 1CKOA 2Q2HA 3F8TA 1UEBA 1TKWB 1QVGA 3AU7A 4XQNA 2WB1B 4F87A 4C1NI 3GQBA 1VQJA 2NZ1D 4TQUS 4KN7C 3TREA 2JEAI 2Z6KC 1YNXA 2UUCL 3E5SA 5JVH3 2NWGA 3A5ZB 3NELA 2JJQA 2K03A 2QF7A 2B39A 2R92G 2A6ED 1JWSD 2IW3A 1Y1WG 5IGDA 1WD0A 1SJED 5TSSA 2VW9A 2JQOA 5D3DA 2FJ2A 5KNBA 3J7A5 2EJFC 5M5YH 2C35B 1WTQA 1TS2A 4ID6A 1YHQA 3ERSX 1HCZA 2KUMA 3TDQA 4DV4Q 3GTLB 4GZYC 1UE1A 4PNYA 1IBKL 3OWEB 1QG7A 4JI5Q 2D0OA 1FR3A 1VQBA 2OF1A 3GV3A 1SE8A 4CJ2C 1HQMC 4H7BA 2QDLA 1HHVA 4RKBA 3NWTA 3AYHB 2XN9C 3BYYB 3EJIA 4HSPA 3U4VA 4DR7Q 1CQVA 4HN7A 3S2DB 1A6XA 1XX8A 1TWAH 3S16H 1I6HH 3D3RA 3FP9A 1C48A 3GTOH 1Q8KA 1VQGA 4JI1L 4GOPC 4OO1G 3WOEA 4YCVA 3MFYA 4JYAQ 1B2TA 1L0XB 2O2LD 1L1OA 3CCRA 5EKIA 4DUZL 3MXNB 4WRDA 1LTLA 4HMIA 1MSHA 4EGVA 5EKKA 1Y69U 1OXVA 2XVSA 2Y0SB 3FKIG 1O7LA 1SE2A 2DNCA 2LXKA 1MGSA 1WJJA 2MPMA 5IIFA 2N3SA 1WCMH 5I2YA 2KHJA 1I94L 5JAVA 4DV5Q 4C3JG 4J6HA 4C3IB 1QWYA 1AW7A 3FPPA 5C3EH 2H4OA 2K05A 2NTSA 3KDFB 4BY7G 2BE5D 1WTRA 2MQHA 4DNTB 1AFPA 4K6DA 3S1QB 1BR9A 2ZTEA 2JA8H 3JAME 3EQLC 2YU9B 1W6JA 5IP7H 1HFGA 3E0EA 1HUMA 5C0XI 5BN3A 5ELOA 1K8OA 1M4VA 4DR3Q 1S5CD 1KC8C 5FOBB 3UDXA 4AYBB 1GUWA 2RA4A 3R2IA 4LF4Q 5IYBG 1GUNA 4RGMA 3RR5A 2ES2A 2B2TC 2JA9A 4R9WA 4ILWA 3I4NB 2D0PA 1G291 3KF6A 1PLFA 1Q90A 1SE4A 3AFQA 3RN2A 2PYKA 2XNAC 4R4QA 3AQQA 1EYAA 1S72A 2ZM6L 4O2DA 4L6TB 4M1UB 4KHZA 4LFCQ 5M3FG 5IWAL 4A3JG 3HOUB 2EYPA 2ZTCA 3CW2C 1F9QA 2CH4W 3K0YA 1IXRA 2WV6D 4NXNL 1PTOH 3I90A 4Y7NH 5C4XG 4YWKA 3UDFA 2PW7A 1S5FD 2KJXA 5IGGA 3Q24A 5BN5A 4P71A 1VDZA 1ZYRC 4IUUA 1DOKA 1ENFA 2CVRA 4JBJA 3KLSA 1ZEQX 2Q8IB 2O4XA 1HA6A 1M8AA 1NJIC 1V1PB 2HUGA 2JP1A 2DN8A 4DK0A 2AKWB 4X3SA 1AN8A 4EQNA 4B9WA 4UY8C 3IFDA 3M3YB 2WB1G 3SK4A 1K0SA 4OX9L 4H0LC 1UE5A 3HGBA 2IJ0A 4MTKA 1C7YA 3HOWH 1S3OA 1S5DD 1X55A 2UUBQ 1Q46A 3TRZA 4JI7Q 2E74C 5FLMH 1G2SA 1SYFA 3GTQH 1FJGQ 1GHKA 4GNXB 1PZKD 4B3TL 1KNEA 4K0KL 5HURA 3U58A 3W1BA 3P7JA 5C0XJ 1NBWA 3CHBD 1C0AA 1LUZA 4BY1G 1Y1WH 1BF4A 4C3HH 2QCPX 4TRDA 3EIVA 1XNQL 3BVMA 2PMZE 3NK9A 2FXQA 2F0WA 2HD3A 1SNOA 5JEAJ 2A68D 4GLAC 3QR8A 4JK1C 1G8ZD 5M5YB 3GTGH 2Z4IA 4U673 1OTCA 2Q8RE 5K36H 3F2DA 1I5FA 1KLUD 4F88A 4DV2Q 1SNDA 1IL2A 3CPFA 1OXUA 4RMFA 1E7ZA 1Y14B 5IGBA 1RHPA 2LKVA 5KYIA 1CUKA 2RCNA 4LF9Q 3U4ZA 4DF7A 3N6RA 4OONA 4XYOA 2L55A 3VYTA 1QVFA 4LFBQ 5EPLA 3C46A 4ME3A 2BOSA 4R4CA 4XT3B 4DXFA 4DK3C 5CV4A 2EYHA 4DN4M 1TWAB 5FO7B 4DR6Q 2IY5B 1I6HB 1YJWA 2NVYH 2A6EC 4ZK9B 1IW7D 3LWUA 3T4AC 2JYOA 4A3MH 5M5XB 1YVCA 3PUYA 1U4MA 1RL2A 3HOZB 3T1YL 3SXHA 3BYTB 4OO1H 1PFNA 5GAHC 1ONLA 2R61A 3GTJH 2B63G 1KDBA 1WTOA 4LF8L 4UPAA 5G3LF 1B4OA 3HOXH 1P16A 4X3TA 3S1MH 2R6GA 2Y0SG 3J7YW 1JJGA 2XSCA 3OOCA 2B2WC 2Z1CA 1CHQD 1YHAA 5HY6A 1Y8PB 2NVQH 3NTHA 3E3XA 2PPBC 2L4NA 4IUPA 1GKHA 1WCMB 5FJ8G 3DXJC 1EWIA 4C3IG 3TP8A 5ELDA 1L1OB 2SEBD 3MTSA 2XWJB 4C3JH 4FF2A 1UAPA 1TWGH 2YTXA 4PMBA 3IAYA 1BXTA 5C3EB 1VQ9A 2FMMA 4FXKC 4FP5D 4RCNA 4BY7H 4HMJA 2F0JA 4A3CG 5DNFA 2KHSA 3SK8A 2TMPA 2G9DA 1NMGA 2B8FA 3CCJA 2AQ2B 1VQFA 2KVMA 2VQFL 4KKTA 1IKLA 1LLRD 2F0OA 3I7FA 4A3EB 1J6QA 5CMDA 3A74A 1AP0A 4Z9CB 5JJKA 4DK6C 3J81c 1KRSA 3K81C 1N33L 5IT9c 1SRUA 1EY9A 3I4NG 2HQLA 4LK1C 4OHJA 4RGOS 2SOBA 3M7NA 2R7ZB 4APVA 1OXTA 3NBHB 2IT1A 2VS1A 1QUQA 5C0XH 1PRTD 1T9HA 2ZTDA 4RHSA 3HOUG 4YWLA 2BE5C 3J7ZC 4KHPL 1JORA 5M3FH 5ELNA 1CKMA 5JEAH 3AFPA 2HIVA 5E4WC 4C56C 4QUCA 3ONAB 2JA5H 1DGSA 3MVVA 5T1IA 1PTOB 4Y7NB 3FPUB 2C9OA 1J5EQ 1LTBD 2L1BA 4ABNA 3H94A 4NXML 2N78A 1YITA 1IL8A 3MFGA 3KUPA 3HKSA 1G6PA 2UXDQ 1EY4A 1G6ZA 2B29A 5GADC 1HQRD 4X62L 1STHA 3CQZH 5CV7A 5CV6A 3ULPA 4L5RC 4K5VA 2Q2UA 1JT8A 3KJOA 1EFWA 3H0GB 2E5LQ 1VQ4A 4A3GH 2DUDA 2YTYA 3HOWB 5I4DA 5AFWA 5JJZA 4LF5Q 1PFSA 2WAQE 3OIQA 2K5WA 3DM3A 2WB1E 1PXUA 3K8AA 1O7IA 1N32Q 2ZXOA 3G48A 1AZPA 5HGQA 1K0RA 3P75A 1B1ZA 4A76A 2PMZB 4N9TA 3KLWA 4HR7B 4A3KH 1HR0W 1EY7A 2NN6I 1EIFA 3RMHA 2QEJC 4OIJA 3OTOQ 1NE3A 3K5LA 3MEHA 4HTHA 1CTMA 3S24A 1HNZQ 2IHFA 1LTSD 1IYJB 3GTKB 3KOJA 4CJ1B 2KQ3A 1SXTA 4IUTA 3VDYA 2KOLA 4DU9A 1VQKA 5FLXc 4YHHQ 3KYHC 1SMXA 4HEDA 2F0PA 4CDEC 4H44C 1EYGA 1CT1D 2Z6KA 3T1HL 1FNUA 3F1ZA 2F0TA 4F7XA 3C3LA 3MXNA 4HJ8A 5ELFA 2NBFA 4ZYSA 2F0KA 1GXDC 3F2UA 4K6LA 1JCKB 1KDCA 2NVYB 3NHHA 4JW0A 2Q2TA 1WTWA 4RKLA 2JA6H 4A3MB 5JJIA 2RHQB 1OXSC 3D6WA 2PQAB 3S17H 4RGTA 2KCCA 1TY0A 2B2YC 1LABA 2A68C 3GTJB 3NPPA 2VXWA 2QA4A 4L63B 3NP8A 1HUNA 5AJ3Q 1STNA 3S1MB 2WP8J 1JQYD 2UU9L 4UDUC 3CCLA 3NWSA 4GKJL 1VQEA 1LACA 2QGQA 3PCOB 1XPUA 2NVQB 1WCMG 4CDDC 5C5LA 1BCPB 4IFDJ 3VYUA 1I4PA 2XIWA 5FJ8H 4X64L 2PZWA 4C3IH 4L5QA 5C3EG 5DM63 4ZUIA 1DONA 2Q8TA 1QJOA 2EXDA 3BVGA 1EQQA 3PUVA 4JV5L 5IYDH 3I4LA 1IW7C 3Q6SA 1NY4A 3BJUA 2F0GA 1WTHA 1JC7A 3S1QH 2F3WA 4BA1I 1UNSA 3D8GA 5IP7G 3K58A 3OSOA 2QKIC 5IP9H 4FF3A 1H9SA 3W3AA 1SE3A 2EY1A 3K7AH 3PGZA 1TS3A 4GS3A 3LGJA 1D5ZC 4DPGA 1Q86C 1D7QA 1QNUA 4Q5VA 2BCOA 1KL9A 3O13A 3TSSA 4K2KA 1F2LA 2SNSA 4DR7L 2F3IA 2EY6A 1JOOA 3PSIA 1ILPA 1ET6A 4AYBE 2PNRC 3TMEA 2CFMA 3M4OH 4L5SA 5C4JB 5KNCA 1HR0Q 3GTPB 1V43A 3MHBA 1UEAB 5F2DA 4A75A 3J7AF 1BBUA 3VA7A 2CCZA 1GO3E 2JE6I 1F2ZA 1N36L 4HJAA 3RD4A 1V1PA 1U4LA 1HPCA 1HA5A 5IGCA 1LT5D 1EYCA 1PH9A 2X6GA 1GVPA 1BVSA 2QEXA 2RSOA 4DR5L 2B2VA 1Y8NB 1RF2D 1PZJD 2K75A 3P20A 4X3UA 4FYDA 3A55A 2OT2A 1RTNA 3KK7A 2B2TA 1K8GA 2BH8A 3UI2A 5EGTA 3CRKC 2WKCA 5C3XA 3TBIB 4GNXA 4DV5L 1TIID 3KF8B 3PO3H 4LAAA 4BBRB 2ENBA 3BZDB 5C4HA 4DV3Q 2F4IA 4JOIA 3ITPA 5LMUL 1JICA 1QB5D 5FLXE 3H3VI 4NKLA 1X3EA 1K73C 3CQZB 3NXWA 1VQIA 3H0GG 3M3YH 4GKKL 1ASYA 1E22A 2WAQB 4QIWB 3E6ZX 5HGTA 3UDGA 4PQXA 1PRTC 3HOWG 4BS9A 1Z7TA 1A0IA 4A3GB 5FLMG 4L5TA 4A3BB 4TKOB 2EJMA 4LF4L 4LUVA 1TS4A 1X32A 4KD3A 4CJ0B 4C3HG 4A3KB 2J4XA 4PMWA 1VQPA 1KNAA 3NBIA 5H1SE 2RDFA 5CR3A 3LX0A 5GAGC 5ELBA 2VQEQ 5K36G 4IJLA 4OEMB 1O80A 4IFDH 4HJ9A 1EYDA 5E1FA 2C5CA 2Z8LA 4LFAQ 2UXCQ 4LFCL 5NUCA 4TSSA 1WI5A 3OW7A 1C4QA 3K6OA 1KD1C 2VUMH 1F9SA 1SJHD 1K8AC 1FGBD 2NN6H 1PH8A 2DGYA 3TN2A 1VQOA 1RJTA 4FO2A 2F03A 3M9BA 4XTCS 4F8MA 4A3MG 2L9HA 1RDPD 2EDGA 5M5XH 1E2VA 3BDCA 1UE7A 4KD4A 5IY0A 3CC7A 2JA6B 2B3GA 3HOZH 5FLXL 4LF6L 1PTOF 4JI8L 3FVQA 4K5WA 3S17B 4KKUA 1LO5D 2K5VA 4EQOA 3HOXG 4HIDA 3DWPA 3STBC 1OXXK 1X56A 1A62A 1B44D 4OWWB 4UP9A 4XT1B 3JAMi 4JI4L 2HDLA 4WJ3M 1KAAA 3I2ZA 4B3RQ 2LSSA 4KY7A 1NSNS 3S15B 4YCWA 3W5OA 1HNWL 1F2MA 1Q1BA 3PO2B 4DV1Q 1ASZA 1ENCA 1LT4D 3CMEA 1SNQA 4CGYB 3FDTA 4B3ML 1U0LA 4YY3L 1NCVA 1EZ6A 1M1KC 3QB3A 4K8JA 2ZJPA 4JI3Q 3A8KE 1V8QA 3PUWA 1KABA 2LY7A 1SLJA 4IALA 3NBHA 1DD2A 4C1NK 3H15A 5JJLA 1X3QA 4DKAC 4M8AA 3RLOA 4X65L 1PH5A 1X6OA 2E2JH 3K7AB 2K1BA 4DV7Q 4LF9L 4A3EH 1T5EA 3CCEA 4FF1A 5FKAC 5J1ZA 4FNFA 3H6MA 2VB2X 4PZ6A 4GOPB 4POFA 4JI0L 4FVMA 4IUQA 4JBWA 1YEZA 2EXZA 3MEFA 2R7ZH 1GUGA 2V1CC 1EEID 3OMGA 3M4OB 5IOCA 1VQNA 4RGNA 5COYA 1EIHA 3V96A 5EJWA 5IYCH 4UAIA 1H9SB 4XYQA 5C0XG 2UUCQ 3RLFA 1Y8OB 3L2PA 1WTVA 2EYMA 3S1RH 2UXBL 2KEEA 3GV6A 4WORA 2JA7H 5JEAG 3CAMA 3HOYH 2EY5A 3AMUA 2F0HA 3IFTA 2JA5G 2RQXA 1DJRD 4X66L 1NNXA 2EQSA 2B2UA 2NZHA 1H9KA 3B6YA 1SSOA 1STAA 4DNIA 4UP8A 1IBML 3NQTA 3J80i 3DUZA 1IBKQ 1EY0A 1S5BD 4DFAA 3K57A 4BBRG 4PMCA 3QIAA 2DY7A 1JB3A 4JI6L 1SFOH 1HTLD 3Q22A 2EYJA 3PO3B 3PIPA 4IPGA 2BH2A 2WINB 1B53A 1ML0D 3VR5A 1SAPA 3NUCA 2WAQG 1BCPF 4P75A 5CBAE 1G2TA 3H0GH 1O78A 4A3GG 3PUZA 1QZHA 4RG1A 4PV1C 4BBSB 3MAQA 3KBGA 5J39A 1BCPD 4JI1Q 1E1TA 2MJ8A 2RF4A 1VQCA 3AEVA 2OTJA 1VQLA 2A69D 1KTKA 1AEXA 4A3KG 1EY8A 4R4TA 4P2CB 3DWAA 4QCLA 4DUZQ 3CF5A 3H3VH 2K33A 4LWCA 1HNXQ 1KRTA 1B3QA 3RZOB 2KCMA 2R7DA 2F0FA 1CSQA 3GTKH 2Z6BA 3CMAA 2KENA 3I55A 1HZBA 3CU7A 3K5NA 2ID0A 4FXGC 1I94Q 1HH2P 2PQAA 1XYIA 5GROA 2IHEA 3ULJA 2OWOA 2K5DA 3BVZA 1YNJD 3I72A 1VQ5A 3BG3A 3D4WA 2VUMB 1N9WA 3TZDA 4DAPA 3PIP3 2EIFA 1LM0A 3ICEA 4HSVA 4OIKA 5IODA 3MXPA 1L1OC 4IOCA 1CM9A 2OQKA 4DR2Q 4KV6A 2JA6G 2Z4HA 2I0QA 1GUSA 3IKJA 3S9WA 2F0UA 1BBXC 3EROA 2N88A 4RWSC 4IPHA 4LUOA 5C3WA 1J8IA 2F1MA 2AUKA 5EKLA 3EN2A 1YNND 4OXPA 2CHBD 3G4SA 1VF5C 3UE1A 4AQYL 5CBEE 1HZCA 2E5LL 4DA2A 2GA4B 1PMRA 3MZ5A 1T5XD 3VYSA 2KEDA 4AH6A 3L9AX 5G3LD 3ULLA 1E2WA 4EVOA 4IPCA 3PO2G 2ZM6Q 4ZKCB 1N34L 3PUXA 1PH1A 2E2IB 1GHJA 5IWAQ 4IOAA 4DAYB 4N8FA 5FK9C 4MHEA 5IYDG 3TQYA 4KTAA 2F4VQ 2NVXB 1CZWA 3F2BA 4NXNQ 3V2TA 1CKNB 2BDOA 3G71A 5IP9G 2A19A 1PHJA 3E0JA 1JJCB 3BS1A 5LMNL 2CW0D 1QOHA 1S5ED 3OWFA 4IPDA 4MZ9A 3R8BA 4DR4L 2JXMB 5ELCA 3QOJA 3CCMA 2PQEA 2ALYB 2M00A 4G4KA 4JC0A 2E2JB 4AYBG 2DJFC 1IYUA 4ZQ3A 5GAEC 4X6AH 4LF7L 1MD2D 1X65A 2I07B 4DV6L 5IGFA 3DLLA 4IZ8A 2M9VA 1CA6A 5IE8A 2GVBA 3UE0A 1PA6A 2HHHQ 3OHXC 4G7HC 5C4JH 2IL8A 3GTPH 1YJ9A 3D31A 1I4QA 4FDBA 4B3SQ 3PV0A 1Q3LA 3KF8A 4B3TQ 1MSGA 3R93A 4K0KQ 4CDFC 4WJWA 4CKEA 4DGZA 3S1RB 4JCVE 3NTKA 2JA7B 2EVBA 1EY6A 5KIXA 3HOYB 2EJGC 4N8X1 1R9TH 4P74A 2L12A 1U4RA 4OWTB 4YIJA 4DV0L 1Y1VH 1VMCA 3PMFA 1KXLA 1A3VA 3TP6A 1SYEA 2WACA 5EBDA 3K5MA 1Q81C 2IX1A 4MNOA 1D8LA 3PO3G 1HTPA 2QW7A 1IZ6A 2J7ZA 1DYQA 4CDCC 4BBRH 1XMQL 3OW2A 1SFOB 4QJFA 2WFWA 2RDHA 5I9OA 1XMOL 3I73A 2D62A 2XWBB 1EIYB 2UUAL 4DR1L 1A3TA 4LJZC 2LFNA 3CC2A 1X3PA 1LT6D 2N55A 1F9RA 1YI2A 4A3BH 1UE6A 4BWGB 4QIWE 3NEMA 3SEBA 5BR8L 2MUYA 3A7AB 1CSPA 4HIMA 2NUCA 3DHQA 3H91A 5D3IB 1XXGA 2BA0A 4NDXA 2KECA 4LF8Q 4MN3A 1PVOA 1PH6A 1GM5A 2KCTA 1PFMA 2XGTA 1AH9A 1D2BA 2K6AA 4BXXH 4A3LH 4QL5A 4UP7A 2F0EA 2K04A 4KMUC 2O5IC 3CCVA 4IFDG 3D0FA 3TEHB 3Q23A 3E9HA 3STBD 4PZ8A 1WOCA 5I6WA 4L8JA 1MIUA 3M4PA 2PZTA 4KJNA 3WOFA 1N8RC 2VUMG 2JSOA 4CKCA 1IBLL 2K14A 1R4PB 4DUYL 2KCNA 2BDNA 1VS0A 2MGSA 2NN6G 4E6IA 4LNQA 3CC4A 3J7AV 3CRLC 1BCPC 1VQAA 2FFKB 3A54A 2Z0SA 1GOZA 2DNEA 4OWXB 4HIKA 4DAVA 2A69C 3HOZG 2VQFQ 1WFQA 4HIOA 4FF4A 3PQIA 4QGUA 2N8NA 5EPJA 2G5DA 5IGEA 1X9NA 1N33Q 3I4MB 3K7UC 4QF4A 2K5QA 2HCCA 1JJ2A 1OO9B 5EAYA 5E4XA 2GVAA 1D5MC 3J81E 3T51B 5IT9E 3QOLA 3S15H 5J22A 3KLRA 1Q8IA 3IRBA 3GTMH 5M3MH 1YNJC 2PW5A 2YYZA 4ODGA 5C44H 2I46A 5JVG3 3PO2H 4DXGA 2CKZB 3MXGA 3VR3A 4DK1A 4CBVA 3G7LA 2CWAA 1CI3M 4H13C 3C2PA 4O42A 4GOPA 1HRJA 2LXJA 5GQOA 2F3VA 5I2XA 1RCVD 2F0NA 4K8IA 1YHBA 1CA5A 3N52A 2AUJD 1LTGD 4GN5A 5CORA 4NXMQ 5JPNC 4DV4L 1LV9A 1YNNC 4LFAL 4JI5L 3A8JE 3BU2A 1X54A 2SNMA 4OL7A 4A3EG 2GN5A 1LTRD 4X62Q 2CQAA 2HIXA 3SE0A 5DEHA 1WTPA 3CCUA 1NMFA 4IUNA 2IX3A 2MNAA 3VYRA 4A3FH 2R7ZG 2PI2A 2MO0A 1YZ6A 4KKSA 4CHTB 3LWEA 5C5MA 3QJYA 2AWNA 2CWPA 1WVLA 5IYCG 2L11A 3SGIA 2YTVA 2P5ZX 3ZYYX 1XNRQ 4JYAL 3HFZB 2A73B 4PG3A 5KNDA 2MO1A 1TWFH 2E75C 3VR4A 4AQYQ 2JA7G 4ZAIA 3HOYG 4O0AA 1EFID 3TP7A 3J81L 1G51A 3HOVH 5IT9L 1VCIA 1B7YB 1R9TB 2CW0C 1NR4A 2ICEC 4XQQA 3RZDB 2ZJQA 1SMYC 4K14A 1EWCA 1DOMA 4I65A 4B3RL 1SYCA 1Y1VB 3CCSA 2EY2A 4GN4B 4QUFA 3DWQA 1GUTA 1U5KA 4IN3A 2PI2E 2R93H 4G7ZC 3C1FA 2I5LX 3A0JA 4EX5A 4DV1L 2NYZD 1EUJA 3JAMc 2ICIA 3R2TA 1G91A 2LS01 1C8CA 3EBEA 3NQIA 3ERQA 1EQVA 3KBXA 1KQSA 1H9RA 1EWHA 5EBCA 4A93H 1A2TA 1ZXTA 4BBSH 1P8LA 1X3GA 2I5MX 1GD7A 1YJNA 2E2DC 1SBBB 3U9SA 3HZXA 1UWVA 1K83H 1TQOA 4DR3L 1D6EC 1STBA 4I7AA 4JI2Q 1H95A 3NENA 2K7VA 1D5XC 1JWMD 4XIGS 3ER0A 2EYOA 4KY5A 2UU9Q 3RZOH 4GKJQ 2I5HA 2IPKD 1SYGA 3WDNA 4BA2I 3I91A 4X64Q 5KRUA 2VY3A 1SYBA 2JEBI 3S1NB 1EQRA 2EPBA 2DJGC 4BY1B 2JK8A 3U50C 4JV5Q 3X3MA 1D1KA 4A3DH 1EEFD 1SNPA 1PV4A 1Z47A 2CH4A 1HXYD 1B50A 3RLNA 1FYCA 4UHVA 5CV9A 2Q2IA 1STEA 4OO1I 1V9PA 2A6HD 2A8VA 3NSWA 4R8NA 2IWHA 2B8GA 1PRTB 3DMUA 2OQ0A 4DAYA 3I4MG 3EA6A 1K28A 3OMCA 1PH3A 1KDAA 4RFBA 1PYSB 3PIO3 2E76C 1PTOD 5KEEA 3L7ZC 3RNUA 1CKNA 3J80c 1PFBA 2UUBL 3CXCA 1NR2A 1TWHB 4JI7L 3FRPB 1ILQA 1RIPA 1BNZA 1VQMA 1F9PA 3I8ZA 3GTMB 1FJGL 5CGKA 1JWUD 5M3MB 1TWCH 1A8VA 1K3BC 1N36Q 5C44B 2E2IH 4RCOA 2AQ1B 4V190 1U4PA 4RAUC 3RUZA 1CFMA 1XPOA 1HZ9A 1W6KA 2B63B 2J0TD 2NVXH 1F77A 3CKIB 1HNXL 4DR5Q 1ESRA 1V1OA 3I56A 3OYYA 1VQHA 1CZGA 4NMZA 4DV2L 1NTGA 3K59A 2H1EA 2K28A 1L2FA 2PNHA 2EYFA 2RCFA 5M5WH 4NPSA 1SYDA 1HFNA 4X3KA 2B2WA 3ND9A 4Q0FA 4ME5A 4LFBL 1SN8A 1EU4A 1PYBA 1E2ZA 2VZAA 5LMUQ 4KLKA 2ZJRA 2O5JC 3OPOA 4GKKQ 2AMCB 3QG1A 4OELB 4A3FB 4DR6L 4DR2L 1SDFA 2RDGA 2E2HH 2MFIA 1WTXA 1S40A 3I4OA 1K9MC 3KLSX 3QWNA 1I50H 1ICWA 1BO0A 1RD9D 3R3OA 3M4YA 2OTLA 2JN4A 4U68A 4YWMA 1V1QA 5FO9B 2B2VC 2D5DA 5CC4A 3GD7A 4MTNA 1TWFB 1AE3A 4CKBA 1J9OA 3A8IE 4IJHA 5LL6S 2H5XA 3F2CA 3HOVB 1I4RA 2BA1A 4ZLTF 1EOTA 2K52A 1B3AA 5DM73 4GNXC 1Y1VG 3C1EA 1EOVA 4ZCKA 4B9XA 4C2MB 4JOIC 1STYA 1B8AA 1EY5A 4GLXA 2RSNA 1HJPA 3TS2A 2R93B 4EQPA 1I4HA 1F2YA 2K5NA 2AQ3B 2F52A 5I6YA 4ZKBB 4QMGA 2F4VL 3CCQA 4A3IH 2Z9HA 1GJXA 2RVLA 2A1AA 3HKZE 4LUZA 5DAUA 1ET9A 4HJ7A 3AB9A 2D2CC 1GUOA 2HCIA 3M7GA 1BBWA 4A93B 5JOBA 4A3BG 1EQTA 1NAPA 3G6JB 4LF6Q 4KHVA 4JI8Q 1K83B 3W1GA 2F0LA 4RH6A 3JAML 1YIJA 2A5HA 2F0DA 4BXXG 4A3LG 2HHHL 1O7YA 1M90C 1I3QH 5CV8A 4JI4Q 2K32A 3SK6A 5E7NA 3SHLA 2X69A 3EFXD 4PZ7A 3PF5A 1I4XA 3BDOA 1HNWQ 4B3SL 4KY6A 5BN4A 3J80E 2K4KA 1I4GA 2MP1A 2R92H 5DLQE 1EL0A 2XRSD 4TVAB 4B3MQ 1E0BA 4YY3Q 5C6AA 4IO9A 1QVCA 2ZXPA 2OEOA 2L5TA 3OIPA 3BDLA 4A3DB 3K0XA 3A7LA 4NP5A 1J5EL 1LYLA 1A3UA 1MBYA 3WWVA 3S2HH 4X65Q 3GP7A 2QDBA 5CV5A 2LMCB 3ND8A 2UXDL 1XJVA 1DCZA 4ZUJA 3SR1A 1MJCA 1B70B 3S14H 4WJ4A 3I3CA 5EPKA 4P72A 4R4IA 3I4MH 3T53B 1Q1EA 4N9PA 3PF4A 1TVXA 2SDFA 4JI0Q 2FINB 1MI2A 2PCFB 2XRQD 4KK7A 3S16B 2PZUA 3GTOB 2HQEA 4LF5L 1TR5A 3TZUA 5M3MG 2MHVA 5C44G 3TS0A 1N32L 2KA7A 5A2QE 1ICFB 1YBYA 1TWCB 2UXBQ 2A74C 4K5XA 3A56A 3HEJA 1HZAA 2PO4A 3U9OA 3OTOL 4B08A 1CHPD 4X66Q 4R8IA 2A6HC 1VQDA 1BDOA 2B2YA 2NZOA 3J80L 1HNZL 1LT3D 3SDZA 2QILA 3FKIH 1IBMQ 3M4QA 5JPMC 1MJEA 1O7ZA 1SMYD 4YHHL 1PZID 3SVMA 1FD7D 5M5WB 4JI6Q 1AE2A 4JBKA 1PTOC 3D4DA 1JOKA 3VR6A 1LTID 3GDEA 1A2UA 3HS0C 4J1MA 5ELEA 4AIMA 4WFN3 4ALPA 4POGA 5LMNW 4G7OC 1JE5A 4A3FG 4KJOA 5M9OA 4OX9Q 4I7ZC 2JA8B 4QY7A 2E2HB 3HG9A 1I50B 1WD1A 4YCUA 2ZT9C 4KI0A 3KJPA 4J8QA 1SR3A 1DZ1A 1XTCD 2B2UC 1RKNA 1JMCA 1Z9FA 3HOVG 2YV5A 1LTTD 5IYBH 2DY8A 2FHTA 1DM0B 4ZRZA 5AJ3L 1PRTF 2F0VA 1XNQQ 3RZDH 3K80C 1IYVA 1FVIA 5A2QL 1CK1A 2TSSA 4EQ5A 1R4QB 3MWYW 1ZKOA 3URYA 1KIXA 3SK5A 2R93G 4JPBW 1II3A 3H3VC 2RBMA 1STGA 2WKDA 3MXUA 1RODA 3HKZB 1I6VC 1PH2A 1KAWA 2NVTH 4A3JH 4JBMA 1K8MA 4RA8A 4G57A 4IQZA 1C9OA 4A3IB 4JVZA 2HT1A 1W3SA 3QO2A 2X6LA 1Q82C 2VL6A 3H09A 1FGUA 5C4XH 2ZXRA 3FHWA 4A93G 3KF6B 4BBSG 3T56B 1PH4A 2RKSA 2NB0A 1BKBA 1Q12A 5E3FA 1EIGA 2EOTA 4XDXA 3T1YQ 2F0SA 3FEWX 1H9JA 2R3ZA 1PDQA 2ATWA 4JG2A 2OXPA 3EVQA
chains in the Genus database with same CATH topology
1DOLA 2G9HD 5I9PA 4MIUA 4IFDI 3NE5B 3T13A 1JOQA 1I3QB 4RHRA 2F0IA 1FNVA 1BOSA 1EZ8A 5CYUA 3HRZC 1TY2A 3VR2A 2L0CA 3GTQB 1B9MA 1RTOA 3K5OA 5A35A 2R92B 1B9NA 2K01A 1Y1WB 1FNWA 4C3HB 1QCBD 2EYLA 3GTGB 3DM1A 1QNKA 3S2HB 5FO8B 3X3NA 2D9UA 3S14B 2WIIB 1SEBD 1SNMA 3IL8A 1XWEA 2M2LA 1H9MA 3MC0B 3P1HA 1BQQT 5ISRA 1IHZA 2EE1A 1IKMA 2AWOA 3DEPA 1JR0D 1PYWD 4IURA 1AZQA 1UUPA 1TS5A 3NTIA 4KN4C 3HOXB 5KYLA 1BUVT 5T1GA 1LTAD 2HDMA 2VNUD 5LL6X 3FKIB 1KLGD 3VA5A 1Z6HA 1U9RA 2FMCA 4DNRB 3W2DA 3GO5A 4C3JB 2IX0A 4K2LA 1TWGB 3M85A 1CQFA 3DEOA 4BY7B 4QB4A 1QE6A 3MA2B 1EU3A 3L3OC 4ULLA 4O1NA 3V05A 3D4RA 1ZYRD 4IUVA 2V4DA 5EQ0A 1SNCA 5LHY1 1DXMA 4OGQC 2F0QA 5K5PA 5KGUA 1L0YB 1JE4A 1NUCA 1S4ZA 1D1IA 4FXDA 3LNNA 4LMQD 1A15A 1TT2A 5M3FB 3TP5A 2NVTB 3T16A 4A3JB 2EZVA 3Q0AA 4S3SA 2VB3X 2JA5B 3D6CA 4HCEA 4NW2A 3HP3A 5C4XB 1VMPA 5D65A 4HAEA 5C4ZA 4XXEA 4V0BA 1QILA 4XQJA 5D14A 1VF7A 3FMCA 2F0MA 1ESFA 1TU2B 3I70A 1ENAA 2NTTA 4HCSA 1TKWB 3AU7A 4XQNA 2WB1B 4F87A 4C1NI 3GQBA 2NZ1D 4TQUS 4KN7C 2JEAI 3E5SA 5JVH3 2NWGA 2K03A 2QF7A 2B39A 2A6ED 1JWSD 2IW3A 5IGDA 1WD0A 1SJED 5TSSA 5D3DA 2FJ2A 5KNBA 2EJFC 1WTQA 1TS2A 4ID6A 1HCZA 2KUMA 3TDQA 3GTLB 4GZYC 4PNYA 3OWEB 1QG7A 1FR3A 2OF1A 3GV3A 4CJ2C 1HQMC 4H7BA 1HHVA 4RKBA 3NWTA 2XN9C 3BYYB 3EJIA 4HSPA 1CQVA 4HN7A 3S2DB 1A6XA 1XX8A 3D3RA 1C48A 4OO1G 3WOEA 3MFYA 1B2TA 1L0XB 2O2LD 5EKIA 4WRDA 4HMIA 1MSHA 4EGVA 5EKKA 1Y69U 1OXVA 2XVSA 2Y0SB 1O7LA 1SE2A 2DNCA 1MGSA 2MPMA 5IIFA 5I2YA 5JAVA 4C3JG 4J6HA 4C3IB 1QWYA 1AW7A 3FPPA 2H4OA 2K05A 2NTSA 2BE5D 1WTRA 4DNTB 1AFPA 4K6DA 3S1QB 1BR9A 3JAME 3EQLC 2YU9B 1W6JA 1HFGA 1HUMA 5C0XI 5BN3A 1K8OA 1M4VA 1S5CD 5FOBB 4AYBB 1GUWA 2RA4A 3R2IA 1GUNA 4RGMA 2B2TC 4R9WA 4ILWA 3I4NB 1G291 1PLFA 1Q90A 1SE4A 2PYKA 2XNAC 1EYAA 4L6TB 4M1UB 4KHZA 3HOUB 2EYPA 1F9QA 3K0YA 2WV6D 1PTOH 3I90A 2PW7A 1S5FD 2KJXA 5IGGA 3Q24A 5BN5A 1VDZA 1ZYRC 4IUUA 1DOKA 1ENFA 2CVRA 3KLSA 1ZEQX 2Q8IB 2O4XA 1HA6A 1M8AA 1V1PB 2HUGA 2JP1A 2DN8A 4DK0A 4X3SA 1AN8A 4EQNA 4B9WA 3IFDA 3M3YB 3SK4A 4H0LC 3HGBA 2IJ0A 1S5DD 2E74C 1G2SA 1SYFA 1GHKA 1PZKD 1KNEA 5HURA 3P7JA 5C0XJ 3CHBD 1BF4A 2QCPX 4TRDA 3BVMA 3NK9A 2F0WA 1SNOA 5JEAJ 2A68D 4JK1C 1G8ZD 5M5YB 2Z4IA 4U673 2Q8RE 5K36H 1KLUD 4F88A 1SNDA 1OXUA 5IGBA 1RHPA 2LKVA 5KYIA 4DF7A 3N6RA 4XYOA 3VYTA 2L55A 5EPLA 3C46A 2BOSA 4XT3B 4DXFA 5CV4A 2EYHA 4DN4M 1TWAB 5FO7B 1I6HB 2A6EC 4ZK9B 1IW7D 3LWUA 3T4AC 2JYOA 5M5XB 3PUYA 1U4MA 3HOZB 3SXHA 3BYTB 4OO1H 1PFNA 1ONLA 2R61A 1KDBA 1WTOA 5G3LF 1B4OA 4X3TA 2R6GA 3J7YW 2XSCA 3OOCA 2B2WC 2Z1CA 1CHQD 1Y8PB 3NTHA 2PPBC 2L4NA 4IUPA 1WCMB 3DXJC 4C3IG 3TP8A 5ELDA 2SEBD 3MTSA 2XWJB 4FF2A 1UAPA 4PMBA 3IAYA 1BXTA 5C3EB 2FMMA 4FXKC 4FP5D 4RCNA 4HMJA 2F0JA 5DNFA 2KHSA 3SK8A 2TMPA 2G9DA 2B8FA 2AQ2B 2KVMA 4KKTA 1IKLA 1LLRD 2F0OA 4A3EB 5CMDA 1AP0A 4Z9CB 1EY9A 4LK1C 4OHJA 4RGOS 2SOBA 3M7NA 2R7ZB 1OXTA 2IT1A 5C0XH 1PRTD 4RHSA 2BE5C 1JORA 5JEAH 5E4WC 4C56C 4QUCA 3ONAB 3MVVA 5T1IA 1PTOB 4Y7NB 3FPUB 2C9OA 1LTBD 2L1BA 4ABNA 3H94A 1IL8A 3MFGA 3KUPA 1EY4A 1G6ZA 1HQRD 1STHA 5CV7A 5CV6A 4K5VA 3H0GB 3HOWB 5I4DA 5AFWA 5JJZA 3OIQA 2K5WA 1PXUA 2ZXOA 1AZPA 3P75A 1B1ZA 2PMZB 4N9TA 4HR7B 1EY7A 2NN6I 3RMHA 2QEJC 4OIJA 3K5LA 3MEHA 4HTHA 1CTMA 1LTSD 3GTKB 4CJ1B 2KQ3A 1SXTA 4IUTA 2KOLA 4DU9A 4HEDA 2F0PA 4H44C 1CT1D 1FNUA 2F0TA 4F7XA 3C3LA 3MXNA 5ELFA 2NBFA 4ZYSA 2F0KA 1GXDC 3F2UA 4K6LA 1JCKB 1KDCA 2NVYB 3NHHA 1WTWA 4RKLA 4A3MB 1OXSC 3D6WA 4RGTA 2KCCA 1TY0A 2B2YC 1LABA 2A68C 3GTJB 3NPPA 2VXWA 4L63B 3NP8A 1HUNA 1STNA 3S1MB 2WP8J 1JQYD 4UDUC 3NWSA 1LACA 2NVQB 5C5LA 1BCPB 4IFDJ 3VYUA 1I4PA 2XIWA 2PZWA 1DONA 5DM63 4ZUIA 2Q8TA 1QJOA 3BVGA 3PUVA 3I4LA 1IW7C 3Q6SA 2F0GA 1JC7A 2F3WA 4BA1I 1UNSA 3D8GA 3K58A 3OSOA 2QKIC 4FF3A 1H9SA 3W3AA 1SE3A 2EY1A 1TS3A 1D5ZC 1QNUA 4Q5VA 2BCOA 3O13A 3TSSA 4K2KA 1F2LA 2SNSA 2EY6A 1JOOA 1ILPA 1ET6A 2PNRC 3TMEA 5C4JB 5KNCA 3GTPB 1V43A 3MHBA 1UEAB 5F2DA 3J7AF 3VA7A 2JE6I 1F2ZA 3RD4A 1V1PA 1U4LA 1HPCA 1HA5A 5IGCA 1LT5D 1EYCA 2X6GA 2RSOA 2B2VA 1Y8NB 1RF2D 1PZJD 3P20A 4X3UA 4FYDA 3A55A 2OT2A 1RTNA 3KK7A 2B2TA 3UI2A 5EGTA 3CRKC 2WKCA 5C3XA 3TBIB 1TIID 4LAAA 4BBRB 2ENBA 3BZDB 5C4HA 2F4IA 3ITPA 1JICA 1QB5D 5FLXE 4NKLA 3CQZB 3NXWA 2WAQB 4QIWB 3E6ZX 5HGTA 4PQXA 1PRTC 4BS9A 1Z7TA 4A3GB 4A3BB 4TKOB 2EJMA 1TS4A 1X32A 4KD3A 4CJ0B 4C3HG 4A3KB 2J4XA 4PMWA 1KNAA 3NBIA 2RDFA 5CR3A 3LX0A 5ELBA 5K36G 1O80A 4IFDH 1EYDA 5E1FA 2C5CA 2Z8LA 5NUCA 4TSSA 3K6OA 1C4QA 3OW7A 1F9SA 1SJHD 1FGBD 2NN6H 3TN2A 1RJTA 4FO2A 2F03A 4XTCS 4F8MA 2L9HA 1RDPD 2EDGA 1E2VA 3BDCA 4KD4A 2JA6B 5FLXL 1PTOF 3FVQA 4K5WA 3S17B 4KKUA 1LO5D 4EQOA 3DWPA 1OXXK 1B44D 4XT1B 2HDLA 1KAAA 4KY7A 1NSNS 3S15B 1F2MA 1Q1BA 3PO2B 1ENCA 1LT4D 1SNQA 4CGYB 3FDTA 1NCVA 1EZ6A 3QB3A 4K8JA 3A8KE 1V8QA 3PUWA 1KABA 2LY7A 4IALA 3NBHA 1DD2A 4C1NK 1X3QA 4M8AA 3K7AB 2K1BA 1T5EA 4FF1A 5FKAC 5J1ZA 4FNFA 3H6MA 2VB2X 4FVMA 4IUQA 4JBWA 2EXZA 1GUGA 1EEID 3OMGA 3M4OB 5IOCA 4RGNA 5COYA 1EIHA 3V96A 5EJWA 4UAIA 1H9SB 4XYQA 5C0XG 3RLFA 1Y8OB 1WTVA 2EYMA 2KEEA 3GV6A 4WORA 5JEAG 2EY5A 3AMUA 2F0HA 3IFTA 2RQXA 1DJRD 2B2UA 1H9KA 1SSOA 1STAA 3NQTA 3DUZA 1EY0A 1S5BD 4DFAA 3K57A 4PMCA 3QIAA 2DY7A 1JB3A 1HTLD 3Q22A 2EYJA 3PO3B 2WINB 1B53A 1ML0D 3VR5A 1SAPA 3NUCA 1BCPF 5CBAE 1G2TA 1O78A 3PUZA 4PV1C 4BBSB 3MAQA 3KBGA 5J39A 1BCPD 2MJ8A 2A69D 1KTKA 1AEXA 1EY8A 4P2CB 3DWAA 4QCLA 2K33A 3RZOB 2F0FA 3CU7A 3K5NA 2ID0A 4FXGC 1XYIA 2K5DA 3BVZA 1YNJD 3I72A 3BG3A 3D4WA 2VUMB 3TZDA 4DAPA 3PIP3 4HSVA 4OIKA 5IODA 3MXPA 1CM9A 4KV6A 2Z4HA 1GUSA 3IKJA 3S9WA 2F0UA 1BBXC 3EROA 2N88A 4RWSC 5C3WA 1J8IA 2F1MA 2AUKA 5EKLA 1YNND 2CHBD 1VF5C 5CBEE 4DA2A 2GA4B 1PMRA 3MZ5A 1T5XD 3VYSA 2KEDA 3L9AX 5G3LD 1E2WA 4EVOA 4ZKCB 2E2IB 3PUXA 1GHJA 5FK9C 4MHEA 2NVXB 4KTAA 1CZWA 3V2TA 2BDOA 3E0JA 3BS1A 2CW0D 1QOHA 1S5ED 3OWFA 3R8BA 5ELCA 2JXMB 3QOJA 2PQEA 2E2JB 2M00A 4G4KA 1IYUA 4ZQ3A 1MD2D 2I07B 5IGFA 4IZ8A 2M9VA 1CA6A 3OHXC 4G7HC 2IL8A 3D31A 1I4QA 3PV0A 1Q3LA 3KF8A 1MSGA 3R93A 4WJWA 4CKEA 4DGZA 3S1RB 3NTKA 2JA7B 2EVBA 1EY6A 5KIXA 3HOYB 2EJGC 2L12A 1U4RA 4YIJA 1VMCA 3PMFA 1A3VA 3TP6A 1SYEA 2WACA 5EBDA 3K5MA 2IX1A 1HTPA 2J7ZA 1DYQA 1SFOB 2RDHA 5I9OA 3I73A 2D62A 2XWBB 1A3TA 4LJZC 2LFNA 1X3PA 1LT6D 2N55A 1F9RA 4BWGB 3SEBA 2MUYA 3A7AB 2NUCA 3DHQA 3H91A 5D3IB 1XXGA 4NDXA 2BA0A 2KECA 4MN3A 1PFMA 1D2BA 2K6AA 2F0EA 2K04A 4KMUC 2O5IC 4IFDG 3Q23A 5I6WA 4L8JA 2PZTA 4KJNA 3WOFA 2JSOA 4CKCA 1R4PB 2KCNA 2BDNA 2MGSA 2NN6G 4E6IA 3J7AV 3CRLC 1BCPC 2FFKB 3A54A 1GOZA 2DNEA 4DAVA 2A69C 4FF4A 5EPJA 5IGEA 3I4MB 4QF4A 2K5QA 2HCCA 1OO9B 5E4XA 1D5MC 3J81E 3T51B 5IT9E 3QOLA 5J22A 3KLRA 1Q8IA 1YNJC 2PW5A 2YYZA 4ODGA 2I46A 5JVG3 4DXGA 3MXGA 3VR3A 4DK1A 4CBVA 3G7LA 1CI3M 4H13C 3C2PA 4O42A 1HRJA 2F3VA 5I2XA 1RCVD 2F0NA 4K8IA 1CA5A 3N52A 2AUJD 1LTGD 5CORA 5JPNC 1LV9A 1YNNC 3A8JE 2SNMA 4OL7A 1LTRD 2CQAA 3SE0A 5DEHA 1WTPA 4IUNA 2IX3A 3VYRA 4KKSA 4CHTB 3LWEA 5C5MA 3QJYA 2AWNA 1WVLA 2L11A 3ZYYX 2A73B 5KNDA 2E75C 3VR4A 4ZAIA 3TP7A 1EFID 3J81L 5IT9L 1VCIA 1R9TB 2CW0C 1NR4A 2ICEC 4XQQA 3RZDB 1SMYC 4K14A 1EWCA 1DOMA 4I65A 1SYCA 1Y1VB 2EY2A 4QUFA 3DWQA 1GUTA 4IN3A 4G7ZC 3C1FA 2NYZD 2ICIA 3R2TA 1G91A 2LS01 1C8CA 3NQIA 3ERQA 1EQVA 3KBXA 1H9RA 1EWHA 5EBCA 1A2TA 1ZXTA 2E2DC 1SBBB 3U9SA 3HZXA 1TQOA 1D6EC 1STBA 2K7VA 1D5XC 1JWMD 4XIGS 2EYOA 4KY5A 2IPKD 1SYGA 3WDNA 4BA2I 3I91A 5KRUA 1SYBA 2JEBI 3S1NB 2EPBA 4BY1B 3X3MA 1D1KA 1EEFD 1SNPA 1Z47A 1HXYD 1B50A 1FYCA 5CV9A 1STEA 4OO1I 2A6HD 3NSWA 4R8NA 2IWHA 2B8GA 1PRTB 3DMUA 4DAYA 3EA6A 3OMCA 1KDAA 4RFBA 3PIO3 2E76C 1PTOD 5KEEA 3L7ZC 1PFBA 1NR2A 1TWHB 3FRPB 1ILQA 1BNZA 1F9PA 3I8ZA 3GTMB 5CGKA 1JWUD 5M3MB 5C44B 4RCOA 2AQ1B 4V190 1U4PA 4RAUC 3RUZA 1CFMA 1W6KA 2B63B 2J0TD 1F77A 3CKIB 1ESRA 1V1OA 1CZGA 4NMZA 3K59A 2H1EA 2K28A 2EYFA 1SYDA 1HFNA 4X3KA 2B2WA 3ND9A 4Q0FA 4ME5A 1EU4A 1E2ZA 2O5JC 3OPOA 3QG1A 4A3FB 1SDFA 2RDGA 1WTXA 3KLSX 3QWNA 3R3OA 1ICWA 1BO0A 1RD9D 3M4YA 4U68A 5FO9B 2B2VC 2D5DA 5CC4A 3GD7A 1TWFB 4CKBA 1J9OA 3A8IE 5LL6S 3HOVB 1I4RA 2BA1A 4ZLTF 1EOTA 1B3AA 5DM73 3C1EA 4B9XA 4C2MB 1STYA 1EY5A 2RSNA 2R93B 4EQPA 1I4HA 1F2YA 2AQ3B 5I6YA 4ZKBB 4QMGA 1GJXA 2RVLA 5DAUA 1ET9A 3AB9A 2D2CC 1GUOA 2HCIA 3M7GA 4A93B 5JOBA 1EQTA 1NAPA 3G6JB 4KHVA 1K83B 2F0LA 4RH6A 3JAML 2A5HA 2F0DA 1O7YA 5CV8A 2K32A 3SK6A 3SHLA 2X69A 3EFXD 1I4XA 3BDOA 4KY6A 5BN4A 3J80E 1I4GA 2MP1A 1EL0A 2XRSD 1E0BA 5C6AA 2ZXPA 2OEOA 2L5TA 3OIPA 3BDLA 4A3DB 3A7LA 4NP5A 1A3UA 1MBYA 3GP7A 2QDBA 5CV5A 2LMCB 3ND8A 1DCZA 4ZUJA 3SR1A 3I3CA 5EPKA 3T53B 1Q1EA 4N9PA 1TVXA 2SDFA 2FINB 1MI2A 2PCFB 2XRQD 4KK7A 3S16B 2PZUA 3GTOB 2HQEA 1TR5A 3TZUA 2MHVA 2KA7A 5A2QE 1TWCB 2A74C 4K5XA 3A56A 3HEJA 2PO4A 3U9OA 4B08A 1CHPD 4R8IA 2A6HC 1BDOA 2B2YA 3J80L 1LT3D 3SDZA 2QILA 5JPMC 1O7ZA 1SMYD 1PZID 3SVMA 1FD7D 5M5WB 1PTOC 3D4DA 1JOKA 3VR6A 1LTID 4J1MA 1A2UA 3HS0C 5ELEA 4WFN3 4G7OC 4KJOA 5M9OA 4I7ZC 2JA8B 2E2HB 3HG9A 1I50B 1WD1A 2ZT9C 4KI0A 4J8QA 1DZ1A 1XTCD 2B2UC 1RKNA 1LTTD 2DY8A 2FHTA 1DM0B 4ZRZA 1PRTF 2F0VA 1IYVA 5A2QL 1CK1A 2TSSA 1R4QB 3MWYW 1ZKOA 3URYA 3SK5A 1II3A 3H3VC 2RBMA 1STGA 2WKDA 3MXUA 1RODA 3HKZB 1I6VC 1K8MA 4RA8A 4G57A 4IQZA 4A3IB 2X6LA 3QO2A 3H09A 2ZXRA 3T56B 2RKSA 2NB0A 1Q12A 5E3FA 1EIGA 2EOTA 4XDXA 2F0SA 3FEWX 1H9JA 2R3ZA 1PDQA 2OXPA 3EVQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QB3 A;  4K8J A;  1STN A;  5I9P A;  4QB4 A;  4MIU A;  3MVV A;  1KAB A;  5DAU A;  5KEE A;  4K14 A;  2EYH A;  5CV4 A;  4I65 A;  3T13 A;  4IAL A;  5HGT A;  4ID6 A;  1JOQ A;  1SYC A;  2F0F A;  2EY2 A;  5JOB A;  2F0I A;  2PYK A;  1EZ8 A;  4PNY A;  1EYA A;  5C5L A;  5CGK A;  2OF1 A;  3C1F A;  4KHV A;  3SXH A;  1EY4 A;  4H7B A;  5IIF A;  2PZW A;  4DGZ A;  3D4D A;  4RKB A;  5J1Z A;  1JOK A;  1KDB A;  1STH A;  2EYP A;  3H6M A;  4ZUI A;  3RUZ A;  4KD3 A;  5IGE A;  2F0L A;  1EY6 A;  1A2U A;  3EJI A;  4J1M A;  3D4W A;  5CV7 A;  2F0D A;  5CV6 A;  5KIX A;  4QF4 A;  1SNC A;  2EYL A;  4K5V A;  2RDF A;  4KJO A;  5CR3 A;  2EXZ A;  3ERQ A;  3LX0 A;  1EQV A;  2F0G A;  4YIJ A;  2PW7 A;  5M9O A;  5IOD A;  2F0Q A;  5CV8 A;  3MXP A;  2F3W A;  3PMF A;  5IGG A;  5K5P A;  3OMG A;  3SK6 A;  5IOC A;  1A2T A;  1A3V A;  3D8G A;  3SHL A;  3TP6 A;  3OSO A;  3QOL A;  4KV6 A;  1NUC A;  5KGU A;  5J22 A;  4NMZ A;  5JAV A;  1EYD A;  1SYE A;  2WAC A;  2EY1 A;  4KY6 A;  5E1F A;  3HZX A;  2PW5 A;  3S9W A;  2F0U A;  4ODG A;  3ERO A;  3U9O A;  2EYF A;  1SYD A;  5NUC A;  2EYM A;  2O4X A;  1TQO A;  3TP8 A;  1STB A;  3P75 A;  5C3W A;  1RKN A;  4ME5 A;  4WOR A;  4N9T A;  5EKL A;  1TT2 A;  2EY5 A;  4PMB A;  3TP5 A;  3T16 A;  2F0H A;  1EY7 A;  4K2K A;  2SNS A;  5I9O A;  4EQN A;  1SNM A;  4B9W A;  5C6A A;  4S3S A;  2EY6 A;  4WRD A;  3D6C A;  1JOO A;  4HMJ A;  2F0J A;  2F0V A;  2OEO A;  4HMI A;  2F3V A;  3MEH A;  2EYO A;  4HTH A;  4KY5 A;  1A3T A;  3SK4 A;  3BDL A;  3TME A;  2F0N A;  2KHS A;  4K8I A;  5EKK A;  3MZ5 A;  3SK8 A;  4NP5 A;  3P1H A;  1STA A;  1A3U A;  5ISR A;  4F8M A;  1IHZ A;  3MHB A;  2KQ3 A;  3NQT A;  3BDC A;  3R3O A;  2QDB A;  4KD4 A;  5F2D A;  4EVO A;  5CV5 A;  3SK5 A;  1SYF A;  1SYG A;  1EY0 A;  5C4Z A;  4DU9 A;  4DFA A;  2SNM A;  1II3 A;  2RBM A;  1STG A;  4OL7 A;  1F2Z A;  3NP8 A;  4PMC A;  2NUC A;  2F0O A;  3DHQ A;  4ZUJ A;  4J6H A;  3SR1 A;  5HUR A;  2F0P A;  4K5W A;  1SYB A;  3NXW A;  2F0M A;  2EYJ A;  5CC4 A;  5KRU A;  4NDX A;  5IGC A;  1ENA A;  1EYC A;  4EQO A;  4G57 A;  2F0T A;  3NUC A;  4KTA A;  4N9P A;  5DEH A;  4TRD A;  4F7X A;  1EY9 A;  3NK9 A;  4IUN A;  5KYL A;  2F0W A;  2SOB A;  1SNO A;  3V2T A;  1SNP A;  2PZU A;  4K6D A;  2F0E A;  2F0K A;  3C1E A;  1KAA A;  2HQE A;  5C5M A;  4B9X A;  5CV9 A;  4KY7 A;  1NSN S;  1KDC A;  2RKS A;  1TR5 A;  3NHH A;  5J39 A;  1STY A;  4RKL A;  1SND A;  1F2M A;  5EGT A;  3VA5 A;  5E3F A;  3E5S A;  1EY5 A;  3OWF A;  5I6W A;  5C3X A;  1U9R A;  5IGB A;  3QOJ A;  4R8N A;  2PQE A;  2PZT A;  2LKV A;  2M00 A;  3DMU A;  4EQP A;  5KYI A;  1F2Y A;  4KJN A;  4LAA A;  1ENC A;  1SNQ A;  2F0S A;  4K5X A;  4ZQ3 A;  2ENB A;  4DF7 A;  5I6Y A;  5IGD A;  1AEX A;  5C4H A;  1JOR A;  1EY8 A;  4K2L A;  2OXP A;  3TP7 A;  3HEJ A;  3ITP A;  4IZ8 A;  3OMC A;  4QMG A;  5IGF A;  4NKL A;  1KDA A;  1EZ6 A;  3EVQ A;  4E6I A; 
#chains in the Genus database with same CATH topology
 1DOL A;  2G9H D;  5I9P A;  4MIU A;  4IFD I;  3NE5 B;  3T13 A;  1JOQ A;  4J15 A;  1I3Q B;  1HR0 L;  4RHR A;  2F0I A;  1VQ6 A;  1FNV A;  3BZC A;  1BOS A;  1EZ8 A;  5CYU A;  3HRZ C;  2OCE A;  1XNR L;  1TY2 A;  3VR2 A;  2L0C A;  3GTQ B;  1B9M A;  1RTO A;  3JC6 6;  1N34 Q;  3K5O A;  5A35 A;  2R92 B;  1B9N A;  3S1N H;  2K01 A;  2L15 A;  1Y1W B;  1FNW A;  4BY1 H;  4C3H B;  1QCB D;  5J3B A;  2EYL A;  3UDI A;  4A3D G;  3J81 i;  1KHI A;  3GTG B;  3DM1 A;  3GTL H;  1QNK A;  5LMN Q;  3S2H B;  5FO8 B;  1E24 A;  1WYD A;  4DR4 Q;  2R7F A;  1Q7Y C;  3X3N A;  2N49 A;  4DV3 L;  2D9U A;  4LF7 Q;  4DV6 Q;  3S14 B;  3CP0 A;  2WII B;  2E8G A;  3S2D H;  1SEB D;  1SNM A;  1SRO A;  3IL8 A;  1XWE A;  1QZG A;  4H02 A;  2M2L A;  1H9M A;  1MHW C;  3MC0 B;  3P1H A;  1BQQ T;  5ISR A;  1TWH H;  1IHZ A;  4NB3 A;  3J81 j;  2EE1 A;  1IKM A;  2K50 A;  2AWO A;  3DEP A;  1VQ7 A;  1JR0 D;  1PYW D;  4JI2 L;  4IUR A;  1A63 A;  4KHP Q;  1AZQ A;  2B63 H;  3KDF A;  1X3F A;  1UUP A;  1TS5 A;  1PH7 A;  2RHS B;  1XPR A;  1MKH A;  3L0O A;  3NTI A;  4KN4 C;  3HOX B;  5KYL A;  1BUV T;  4DV0 Q;  5T1G A;  1LTA D;  2VQE L;  2HDM A;  2VNU D;  3ZJY C;  4DAM A;  5LL6 X;  3FKI B;  1KLG D;  3VA5 A;  1JB7 A;  1Z6H A;  1U9R A;  2UXC L;  1K3R A;  2FMC A;  2Y0S E;  4A4I A;  4DNR B;  4Y52 H;  3W2D A;  3GO5 A;  1XMQ Q;  4C3J B;  2IX0 A;  4K2L A;  1TWG B;  3M85 A;  1XMO Q;  1L0W A;  3CD6 A;  2KBN A;  1E1O A;  1CQF A;  1XTD A;  3DEO A;  2UUA Q;  4BY7 B;  4QB4 A;  3KFU A;  1VQ8 A;  4DR1 Q;  2JA8 G;  2ASB A;  4A3C H;  2YU9 H;  4R1J A;  1QE6 A;  3MA2 B;  1EU3 A;  3L3O C;  5BR8 Q;  4ULL A;  4O1N A;  3V05 A;  3D4R A;  1ZYR D;  1FL0 A;  3E9I A;  4IUV A;  1E3P A;  2AHO B;  2V4D A;  5EQ0 A;  1SNC A;  4P73 A;  5LHY 1;  3I4N H;  1DXM A;  4GN3 B;  1TXY A;  3Q8D A;  4OGQ C;  2F0Q A;  2XTI A;  5K5P A;  1W2B A;  4C2M H;  5KGU A;  1L0Y B;  1JE4 A;  1NUC A;  1S4Z A;  3RN5 A;  1D1I A;  2K5H A;  4FXD A;  3HKZ G;  3HOU H;  3LNN A;  4LMQ D;  1A15 A;  1TT2 A;  5M3F B;  3TP5 A;  1IBL Q;  2NVT B;  3T16 A;  4A3J B;  4DUY Q;  3T1H Q;  4A3I G;  2EZV A;  4GLV B;  3Q0A A;  4S3S A;  3CPW A;  2VB3 X;  2JA5 B;  4JI3 L;  3D6C A;  5L37 A;  4HCE A;  2KHI A;  4NW2 A;  4R4O A;  4HJ5 A;  3HP3 A;  5C4X B;  1VMP A;  2CQO A;  3BZK A;  3A5U A;  5D65 A;  4HAE A;  5C4Z A;  4XXE A;  3G6E A;  1QUQ B;  4V0B A;  1QIL A;  4LW1 A;  4XQJ A;  4DV7 L;  5D14 A;  1VF7 A;  4QQB X;  3FMC A;  2F0M A;  1ESF A;  3PIO A;  1TU2 B;  3I70 A;  1ENA A;  2NTT A;  4HCS A;  1CKO A;  2Q2H A;  3F8T A;  1UEB A;  1TKW B;  1QVG A;  3AU7 A;  4XQN A;  2WB1 B;  4F87 A;  4C1N I;  3GQB A;  1VQJ A;  2NZ1 D;  4TQU S;  4KN7 C;  3TRE A;  2JEA I;  2Z6K C;  1YNX A;  2UUC L;  3E5S A;  5JVH 3;  2NWG A;  3A5Z B;  3NEL A;  2JJQ A;  2K03 A;  2QF7 A;  2B39 A;  2R92 G;  2A6E D;  1JWS D;  2IW3 A;  1Y1W G;  5IGD A;  1WD0 A;  1SJE D;  5TSS A;  2VW9 A;  2JQO A;  5D3D A;  2FJ2 A;  5KNB A;  3J7A 5;  2EJF C;  5M5Y H;  2C35 B;  1WTQ A;  1TS2 A;  4ID6 A;  1YHQ A;  3ERS X;  1HCZ A;  2KUM A;  3TDQ A;  4DV4 Q;  3GTL B;  4GZY C;  1UE1 A;  4PNY A;  1IBK L;  3OWE B;  1QG7 A;  4JI5 Q;  2D0O A;  1FR3 A;  1VQB A;  2OF1 A;  3GV3 A;  1SE8 A;  4CJ2 C;  1HQM C;  4H7B A;  2QDL A;  1HHV A;  4RKB A;  3NWT A;  3AYH B;  2XN9 C;  3BYY B;  3EJI A;  4HSP A;  3U4V A;  4DR7 Q;  1CQV A;  4HN7 A;  3S2D B;  1A6X A;  1XX8 A;  1TWA H;  3S16 H;  1I6H H;  3D3R A;  3FP9 A;  1C48 A;  3GTO H;  1Q8K A;  1VQG A;  4JI1 L;  4GOP C;  4OO1 G;  3WOE A;  4YCV A;  3MFY A;  4JYA Q;  1B2T A;  1L0X B;  2O2L D;  1L1O A;  3CCR A;  5EKI A;  4DUZ L;  3MXN B;  4WRD A;  1LTL A;  4HMI A;  1MSH A;  4EGV A;  5EKK A;  1Y69 U;  1OXV A;  2XVS A;  2Y0S B;  3FKI G;  1O7L A;  1SE2 A;  2DNC A;  2LXK A;  1MGS A;  1WJJ A;  2MPM A;  5IIF A;  2N3S A;  1WCM H;  5I2Y A;  2KHJ A;  1I94 L;  5JAV A;  4DV5 Q;  4C3J G;  4J6H A;  4C3I B;  1QWY A;  1AW7 A;  3FPP A;  5C3E H;  2H4O A;  2K05 A;  2NTS A;  3KDF B;  4BY7 G;  2BE5 D;  1WTR A;  2MQH A;  4DNT B;  1AFP A;  4K6D A;  3S1Q B;  1BR9 A;  2ZTE A;  2JA8 H;  3JAM E;  3EQL C;  2YU9 B;  1W6J A;  5IP7 H;  1HFG A;  3E0E A;  1HUM A;  5C0X I;  5BN3 A;  5ELO A;  1K8O A;  1M4V A;  4DR3 Q;  1S5C D;  1KC8 C;  5FOB B;  3UDX A;  4AYB B;  1GUW A;  2RA4 A;  3R2I A;  4LF4 Q;  5IYB G;  1GUN A;  4RGM A;  3RR5 A;  2ES2 A;  2B2T C;  2JA9 A;  4R9W A;  4ILW A;  3I4N B;  2D0P A;  1G29 1;  3KF6 A;  1PLF A;  1Q90 A;  1SE4 A;  3AFQ A;  3RN2 A;  2PYK A;  2XNA C;  4R4Q A;  3AQQ A;  1EYA A;  1S72 A;  2ZM6 L;  4O2D A;  4L6T B;  4M1U B;  4KHZ A;  4LFC Q;  5M3F G;  5IWA L;  4A3J G;  3HOU B;  2EYP A;  2ZTC A;  3CW2 C;  1F9Q A;  2CH4 W;  3K0Y A;  1IXR A;  2WV6 D;  4NXN L;  1PTO H;  3I90 A;  4Y7N H;  5C4X G;  4YWK A;  3UDF A;  2PW7 A;  1S5F D;  2KJX A;  5IGG A;  3Q24 A;  5BN5 A;  4P71 A;  1VDZ A;  1ZYR C;  4IUU A;  1DOK A;  1ENF A;  2CVR A;  4JBJ A;  3KLS A;  1ZEQ X;  2Q8I B;  2O4X A;  1HA6 A;  1M8A A;  1NJI C;  1V1P B;  2HUG A;  2JP1 A;  2DN8 A;  4DK0 A;  2AKW B;  4X3S A;  1AN8 A;  4EQN A;  4B9W A;  4UY8 C;  3IFD A;  3M3Y B;  2WB1 G;  3SK4 A;  1K0S A;  4OX9 L;  4H0L C;  1UE5 A;  3HGB A;  2IJ0 A;  4MTK A;  1C7Y A;  3HOW H;  1S3O A;  1S5D D;  1X55 A;  2UUB Q;  1Q46 A;  3TRZ A;  4JI7 Q;  2E74 C;  5FLM H;  1G2S A;  1SYF A;  3GTQ H;  1FJG Q;  1GHK A;  4GNX B;  1PZK D;  4B3T L;  1KNE A;  4K0K L;  5HUR A;  3U58 A;  3W1B A;  3P7J A;  5C0X J;  1NBW A;  3CHB D;  1C0A A;  1LUZ A;  4BY1 G;  1Y1W H;  1BF4 A;  4C3H H;  2QCP X;  4TRD A;  3EIV A;  1XNQ L;  3BVM A;  2PMZ E;  3NK9 A;  2FXQ A;  2F0W A;  2HD3 A;  1SNO A;  5JEA J;  2A68 D;  4GLA C;  3QR8 A;  4JK1 C;  1G8Z D;  5M5Y B;  3GTG H;  2Z4I A;  4U67 3;  1OTC A;  2Q8R E;  5K36 H;  3F2D A;  1I5F A;  1KLU D;  4F88 A;  4DV2 Q;  1SND A;  1IL2 A;  3CPF A;  1OXU A;  4RMF A;  1E7Z A;  1Y14 B;  5IGB A;  1RHP A;  2LKV A;  5KYI A;  1CUK A;  2RCN A;  4LF9 Q;  3U4Z A;  4DF7 A;  3N6R A;  4OON A;  4XYO A;  2L55 A;  3VYT A;  1QVF A;  4LFB Q;  5EPL A;  3C46 A;  4ME3 A;  2BOS A;  4R4C A;  4XT3 B;  4DXF A;  4DK3 C;  5CV4 A;  2EYH A;  4DN4 M;  1TWA B;  5FO7 B;  4DR6 Q;  2IY5 B;  1I6H B;  1YJW A;  2NVY H;  2A6E C;  4ZK9 B;  1IW7 D;  3LWU A;  3T4A C;  2JYO A;  4A3M H;  5M5X B;  1YVC A;  3PUY A;  1U4M A;  1RL2 A;  3HOZ B;  3T1Y L;  3SXH A;  3BYT B;  4OO1 H;  1PFN A;  5GAH C;  1ONL A;  2R61 A;  3GTJ H;  2B63 G;  1KDB A;  1WTO A;  4LF8 L;  4UPA A;  5G3L F;  1B4O A;  3HOX H;  1P16 A;  4X3T A;  3S1M H;  2R6G A;  2Y0S G;  3J7Y W;  1JJG A;  2XSC A;  3OOC A;  2B2W C;  2Z1C A;  1CHQ D;  1YHA A;  5HY6 A;  1Y8P B;  2NVQ H;  3NTH A;  3E3X A;  2PPB C;  2L4N A;  4IUP A;  1GKH A;  1WCM B;  5FJ8 G;  3DXJ C;  1EWI A;  4C3I G;  3TP8 A;  5ELD A;  1L1O B;  2SEB D;  3MTS A;  2XWJ B;  4C3J H;  4FF2 A;  1UAP A;  1TWG H;  2YTX A;  4PMB A;  3IAY A;  1BXT A;  5C3E B;  1VQ9 A;  2FMM A;  4FXK C;  4FP5 D;  4RCN A;  4BY7 H;  4HMJ A;  2F0J A;  4A3C G;  5DNF A;  2KHS A;  3SK8 A;  2TMP A;  2G9D A;  1NMG A;  2B8F A;  3CCJ A;  2AQ2 B;  1VQF A;  2KVM A;  2VQF L;  4KKT A;  1IKL A;  1LLR D;  2F0O A;  3I7F A;  4A3E B;  1J6Q A;  5CMD A;  3A74 A;  1AP0 A;  4Z9C B;  5JJK A;  4DK6 C;  3J81 c;  1KRS A;  3K81 C;  1N33 L;  5IT9 c;  1SRU A;  1EY9 A;  3I4N G;  2HQL A;  4LK1 C;  4OHJ A;  4RGO S;  2SOB A;  3M7N A;  2R7Z B;  4APV A;  1OXT A;  3NBH B;  2IT1 A;  2VS1 A;  1QUQ A;  5C0X H;  1PRT D;  1T9H A;  2ZTD A;  4RHS A;  3HOU G;  4YWL A;  2BE5 C;  3J7Z C;  4KHP L;  1JOR A;  5M3F H;  5ELN A;  1CKM A;  5JEA H;  3AFP A;  2HIV A;  5E4W C;  4C56 C;  4QUC A;  3ONA B;  2JA5 H;  1DGS A;  3MVV A;  5T1I A;  1PTO B;  4Y7N B;  3FPU B;  2C9O A;  1J5E Q;  1LTB D;  2L1B A;  4ABN A;  3H94 A;  4NXM L;  2N78 A;  1YIT A;  1IL8 A;  3MFG A;  3KUP A;  3HKS A;  1G6P A;  2UXD Q;  1EY4 A;  1G6Z A;  2B29 A;  5GAD C;  1HQR D;  4X62 L;  1STH A;  3CQZ H;  5CV7 A;  5CV6 A;  3ULP A;  4L5R C;  4K5V A;  2Q2U A;  1JT8 A;  3KJO A;  1EFW A;  3H0G B;  2E5L Q;  1VQ4 A;  4A3G H;  2DUD A;  2YTY A;  3HOW B;  5I4D A;  5AFW A;  5JJZ A;  4LF5 Q;  1PFS A;  2WAQ E;  3OIQ A;  2K5W A;  3DM3 A;  2WB1 E;  1PXU A;  3K8A A;  1O7I A;  1N32 Q;  2ZXO A;  3G48 A;  1AZP A;  5HGQ A;  1K0R A;  3P75 A;  1B1Z A;  4A76 A;  2PMZ B;  4N9T A;  3KLW A;  4HR7 B;  4A3K H;  1HR0 W;  1EY7 A;  2NN6 I;  1EIF A;  3RMH A;  2QEJ C;  4OIJ A;  3OTO Q;  1NE3 A;  3K5L A;  3MEH A;  4HTH A;  1CTM A;  3S24 A;  1HNZ Q;  2IHF A;  1LTS D;  1IYJ B;  3GTK B;  3KOJ A;  4CJ1 B;  2KQ3 A;  1SXT A;  4IUT A;  3VDY A;  2KOL A;  4DU9 A;  1VQK A;  5FLX c;  4YHH Q;  3KYH C;  1SMX A;  4HED A;  2F0P A;  4CDE C;  4H44 C;  1EYG A;  1CT1 D;  2Z6K A;  3T1H L;  1FNU A;  3F1Z A;  2F0T A;  4F7X A;  3C3L A;  3MXN A;  4HJ8 A;  5ELF A;  2NBF A;  4ZYS A;  2F0K A;  1GXD C;  3F2U A;  4K6L A;  1JCK B;  1KDC A;  2NVY B;  3NHH A;  4JW0 A;  2Q2T A;  1WTW A;  4RKL A;  2JA6 H;  4A3M B;  5JJI A;  2RHQ B;  1OXS C;  3D6W A;  2PQA B;  3S17 H;  4RGT A;  2KCC A;  1TY0 A;  2B2Y C;  1LAB A;  2A68 C;  3GTJ B;  3NPP A;  2VXW A;  2QA4 A;  4L63 B;  3NP8 A;  1HUN A;  5AJ3 Q;  1STN A;  3S1M B;  2WP8 J;  1JQY D;  2UU9 L;  4UDU C;  3CCL A;  3NWS A;  4GKJ L;  1VQE A;  1LAC A;  2QGQ A;  3PCO B;  1XPU A;  2NVQ B;  1WCM G;  4CDD C;  5C5L A;  1BCP B;  4IFD J;  3VYU A;  1I4P A;  2XIW A;  5FJ8 H;  4X64 L;  2PZW A;  4C3I H;  4L5Q A;  5C3E G;  5DM6 3;  4ZUI A;  1DON A;  2Q8T A;  1QJO A;  2EXD A;  3BVG A;  1EQQ A;  3PUV A;  4JV5 L;  5IYD H;  3I4L A;  1IW7 C;  3Q6S A;  1NY4 A;  3BJU A;  2F0G A;  1WTH A;  1JC7 A;  3S1Q H;  2F3W A;  4BA1 I;  1UNS A;  3D8G A;  5IP7 G;  3K58 A;  3OSO A;  2QKI C;  5IP9 H;  4FF3 A;  1H9S A;  3W3A A;  1SE3 A;  2EY1 A;  3K7A H;  3PGZ A;  1TS3 A;  4GS3 A;  3LGJ A;  1D5Z C;  4DPG A;  1Q86 C;  1D7Q A;  1QNU A;  4Q5V A;  2BCO A;  1KL9 A;  3O13 A;  3TSS A;  4K2K A;  1F2L A;  2SNS A;  4DR7 L;  2F3I A;  2EY6 A;  1JOO A;  3PSI A;  1ILP A;  1ET6 A;  4AYB E;  2PNR C;  3TME A;  2CFM A;  3M4O H;  4L5S A;  5C4J B;  5KNC A;  1HR0 Q;  3GTP B;  1V43 A;  3MHB A;  1UEA B;  5F2D A;  4A75 A;  3J7A F;  1BBU A;  3VA7 A;  2CCZ A;  1GO3 E;  2JE6 I;  1F2Z A;  1N36 L;  4HJA A;  3RD4 A;  1V1P A;  1U4L A;  1HPC A;  1HA5 A;  5IGC A;  1LT5 D;  1EYC A;  1PH9 A;  2X6G A;  1GVP A;  1BVS A;  2QEX A;  2RSO A;  4DR5 L;  2B2V A;  1Y8N B;  1RF2 D;  1PZJ D;  2K75 A;  3P20 A;  4X3U A;  4FYD A;  3A55 A;  2OT2 A;  1RTN A;  3KK7 A;  2B2T A;  1K8G A;  2BH8 A;  3UI2 A;  5EGT A;  3CRK C;  2WKC A;  5C3X A;  3TBI B;  4GNX A;  4DV5 L;  1TII D;  3KF8 B;  3PO3 H;  4LAA A;  4BBR B;  2ENB A;  3BZD B;  5C4H A;  4DV3 Q;  2F4I A;  4JOI A;  3ITP A;  5LMU L;  1JIC A;  1QB5 D;  5FLX E;  3H3V I;  4NKL A;  1X3E A;  1K73 C;  3CQZ B;  3NXW A;  1VQI A;  3H0G G;  3M3Y H;  4GKK L;  1ASY A;  1E22 A;  2WAQ B;  4QIW B;  3E6Z X;  5HGT A;  3UDG A;  4PQX A;  1PRT C;  3HOW G;  4BS9 A;  1Z7T A;  1A0I A;  4A3G B;  5FLM G;  4L5T A;  4A3B B;  4TKO B;  2EJM A;  4LF4 L;  4LUV A;  1TS4 A;  1X32 A;  4KD3 A;  4CJ0 B;  4C3H G;  4A3K B;  2J4X A;  4PMW A;  1VQP A;  1KNA A;  3NBI A;  5H1S E;  2RDF A;  5CR3 A;  3LX0 A;  5GAG C;  5ELB A;  2VQE Q;  5K36 G;  4IJL A;  4OEM B;  1O80 A;  4IFD H;  4HJ9 A;  1EYD A;  5E1F A;  2C5C A;  2Z8L A;  4LFA Q;  2UXC Q;  4LFC L;  5NUC A;  4TSS A;  1WI5 A;  3OW7 A;  1C4Q A;  3K6O A;  1KD1 C;  2VUM H;  1F9S A;  1SJH D;  1K8A C;  1FGB D;  2NN6 H;  1PH8 A;  2DGY A;  3TN2 A;  1VQO A;  1RJT A;  4FO2 A;  2F03 A;  3M9B A;  4XTC S;  4F8M A;  4A3M G;  2L9H A;  1RDP D;  2EDG A;  5M5X H;  1E2V A;  3BDC A;  1UE7 A;  4KD4 A;  5IY0 A;  3CC7 A;  2JA6 B;  2B3G A;  3HOZ H;  5FLX L;  4LF6 L;  1PTO F;  4JI8 L;  3FVQ A;  4K5W A;  3S17 B;  4KKU A;  1LO5 D;  2K5V A;  4EQO A;  3HOX G;  4HID A;  3DWP A;  3STB C;  1OXX K;  1X56 A;  1A62 A;  1B44 D;  4OWW B;  4UP9 A;  4XT1 B;  3JAM i;  4JI4 L;  2HDL A;  4WJ3 M;  1KAA A;  3I2Z A;  4B3R Q;  2LSS A;  4KY7 A;  1NSN S;  3S15 B;  4YCW A;  3W5O A;  1HNW L;  1F2M A;  1Q1B A;  3PO2 B;  4DV1 Q;  1ASZ A;  1ENC A;  1LT4 D;  3CME A;  1SNQ A;  4CGY B;  3FDT A;  4B3M L;  1U0L A;  4YY3 L;  1NCV A;  1EZ6 A;  1M1K C;  3QB3 A;  4K8J A;  2ZJP A;  4JI3 Q;  3A8K E;  1V8Q A;  3PUW A;  1KAB A;  2LY7 A;  1SLJ A;  4IAL A;  3NBH A;  1DD2 A;  4C1N K;  3H15 A;  5JJL A;  1X3Q A;  4DKA C;  4M8A A;  3RLO A;  4X65 L;  1PH5 A;  1X6O A;  2E2J H;  3K7A B;  2K1B A;  4DV7 Q;  4LF9 L;  4A3E H;  1T5E A;  3CCE A;  4FF1 A;  5FKA C;  5J1Z A;  4FNF A;  3H6M A;  2VB2 X;  4PZ6 A;  4GOP B;  4POF A;  4JI0 L;  4FVM A;  4IUQ A;  4JBW A;  1YEZ A;  2EXZ A;  3MEF A;  2R7Z H;  1GUG A;  2V1C C;  1EEI D;  3OMG A;  3M4O B;  5IOC A;  1VQN A;  4RGN A;  5COY A;  1EIH A;  3V96 A;  5EJW A;  5IYC H;  4UAI A;  1H9S B;  4XYQ A;  5C0X G;  2UUC Q;  3RLF A;  1Y8O B;  3L2P A;  1WTV A;  2EYM A;  3S1R H;  2UXB L;  2KEE A;  3GV6 A;  4WOR A;  2JA7 H;  5JEA G;  3CAM A;  3HOY H;  2EY5 A;  3AMU A;  2F0H A;  3IFT A;  2JA5 G;  2RQX A;  1DJR D;  4X66 L;  1NNX A;  2EQS A;  2B2U A;  2NZH A;  1H9K A;  3B6Y A;  1SSO A;  1STA A;  4DNI A;  4UP8 A;  1IBM L;  3NQT A;  3J80 i;  3DUZ A;  1IBK Q;  1EY0 A;  1S5B D;  4DFA A;  3K57 A;  4BBR G;  4PMC A;  3QIA A;  2DY7 A;  1JB3 A;  4JI6 L;  1SFO H;  1HTL D;  3Q22 A;  2EYJ A;  3PO3 B;  3PIP A;  4IPG A;  2BH2 A;  2WIN B;  1B53 A;  1ML0 D;  3VR5 A;  1SAP A;  3NUC A;  2WAQ G;  1BCP F;  4P75 A;  5CBA E;  1G2T A;  3H0G H;  1O78 A;  4A3G G;  3PUZ A;  1QZH A;  4RG1 A;  4PV1 C;  4BBS B;  3MAQ A;  3KBG A;  5J39 A;  1BCP D;  4JI1 Q;  1E1T A;  2MJ8 A;  2RF4 A;  1VQC A;  3AEV A;  2OTJ A;  1VQL A;  2A69 D;  1KTK A;  1AEX A;  4A3K G;  1EY8 A;  4R4T A;  4P2C B;  3DWA A;  4QCL A;  4DUZ Q;  3CF5 A;  3H3V H;  2K33 A;  4LWC A;  1HNX Q;  1KRT A;  1B3Q A;  3RZO B;  2KCM A;  2R7D A;  2F0F A;  1CSQ A;  3GTK H;  2Z6B A;  3CMA A;  2KEN A;  3I55 A;  1HZB A;  3CU7 A;  3K5N A;  2ID0 A;  4FXG C;  1I94 Q;  1HH2 P;  2PQA A;  1XYI A;  5GRO A;  2IHE A;  3ULJ A;  2OWO A;  2K5D A;  3BVZ A;  1YNJ D;  3I72 A;  1VQ5 A;  3BG3 A;  3D4W A;  2VUM B;  1N9W A;  3TZD A;  4DAP A;  3PIP 3;  2EIF A;  1LM0 A;  3ICE A;  4HSV A;  4OIK A;  5IOD A;  3MXP A;  1L1O C;  4IOC A;  1CM9 A;  2OQK A;  4DR2 Q;  4KV6 A;  2JA6 G;  2Z4H A;  2I0Q A;  1GUS A;  3IKJ A;  3S9W A;  2F0U A;  1BBX C;  3ERO A;  2N88 A;  4RWS C;  4IPH A;  4LUO A;  5C3W A;  1J8I A;  2F1M A;  2AUK A;  5EKL A;  3EN2 A;  1YNN D;  4OXP A;  2CHB D;  3G4S A;  1VF5 C;  3UE1 A;  4AQY L;  5CBE E;  1HZC A;  2E5L L;  4DA2 A;  2GA4 B;  1PMR A;  3MZ5 A;  1T5X D;  3VYS A;  2KED A;  4AH6 A;  3L9A X;  5G3L D;  3ULL A;  1E2W A;  4EVO A;  4IPC A;  3PO2 G;  2ZM6 Q;  4ZKC B;  1N34 L;  3PUX A;  1PH1 A;  2E2I B;  1GHJ A;  5IWA Q;  4IOA A;  4DAY B;  4N8F A;  5FK9 C;  4MHE A;  5IYD G;  3TQY A;  4KTA A;  2F4V Q;  2NVX B;  1CZW A;  3F2B A;  4NXN Q;  3V2T A;  1CKN B;  2BDO A;  3G71 A;  5IP9 G;  2A19 A;  1PHJ A;  3E0J A;  1JJC B;  3BS1 A;  5LMN L;  2CW0 D;  1QOH A;  1S5E D;  3OWF A;  4IPD A;  4MZ9 A;  3R8B A;  4DR4 L;  2JXM B;  5ELC A;  3QOJ A;  3CCM A;  2PQE A;  2ALY B;  2M00 A;  4G4K A;  4JC0 A;  2E2J B;  4AYB G;  2DJF C;  1IYU A;  4ZQ3 A;  5GAE C;  4X6A H;  4LF7 L;  1MD2 D;  1X65 A;  2I07 B;  4DV6 L;  5IGF A;  3DLL A;  4IZ8 A;  2M9V A;  1CA6 A;  5IE8 A;  2GVB A;  3UE0 A;  1PA6 A;  2HHH Q;  3OHX C;  4G7H C;  5C4J H;  2IL8 A;  3GTP H;  1YJ9 A;  3D31 A;  1I4Q A;  4FDB A;  4B3S Q;  3PV0 A;  1Q3L A;  3KF8 A;  4B3T Q;  1MSG A;  3R93 A;  4K0K Q;  4CDF C;  4WJW A;  4CKE A;  4DGZ A;  3S1R B;  4JCV E;  3NTK A;  2JA7 B;  2EVB A;  1EY6 A;  5KIX A;  3HOY B;  2EJG C;  4N8X 1;  1R9T H;  4P74 A;  2L12 A;  1U4R A;  4OWT B;  4YIJ A;  4DV0 L;  1Y1V H;  1VMC A;  3PMF A;  1KXL A;  1A3V A;  3TP6 A;  1SYE A;  2WAC A;  5EBD A;  3K5M A;  1Q81 C;  2IX1 A;  4MNO A;  1D8L A;  3PO3 G;  1HTP A;  2QW7 A;  1IZ6 A;  2J7Z A;  1DYQ A;  4CDC C;  4BBR H;  1XMQ L;  3OW2 A;  1SFO B;  4QJF A;  2WFW A;  2RDH A;  5I9O A;  1XMO L;  3I73 A;  2D62 A;  2XWB B;  1EIY B;  2UUA L;  4DR1 L;  1A3T A;  4LJZ C;  2LFN A;  3CC2 A;  1X3P A;  1LT6 D;  2N55 A;  1F9R A;  1YI2 A;  4A3B H;  1UE6 A;  4BWG B;  4QIW E;  3NEM A;  3SEB A;  5BR8 L;  2MUY A;  3A7A B;  1CSP A;  4HIM A;  2NUC A;  3DHQ A;  3H91 A;  5D3I B;  1XXG A;  2BA0 A;  4NDX A;  2KEC A;  4LF8 Q;  4MN3 A;  1PVO A;  1PH6 A;  1GM5 A;  2KCT A;  1PFM A;  2XGT A;  1AH9 A;  1D2B A;  2K6A A;  4BXX H;  4A3L H;  4QL5 A;  4UP7 A;  2F0E A;  2K04 A;  4KMU C;  2O5I C;  3CCV A;  4IFD G;  3D0F A;  3TEH B;  3Q23 A;  3E9H A;  3STB D;  4PZ8 A;  1WOC A;  5I6W A;  4L8J A;  1MIU A;  3M4P A;  2PZT A;  4KJN A;  3WOF A;  1N8R C;  2VUM G;  2JSO A;  4CKC A;  1IBL L;  2K14 A;  1R4P B;  4DUY L;  2KCN A;  2BDN A;  1VS0 A;  2MGS A;  2NN6 G;  4E6I A;  4LNQ A;  3CC4 A;  3J7A V;  3CRL C;  1BCP C;  1VQA A;  2FFK B;  3A54 A;  2Z0S A;  1GOZ A;  2DNE A;  4OWX B;  4HIK A;  4DAV A;  2A69 C;  3HOZ G;  2VQF Q;  1WFQ A;  4HIO A;  4FF4 A;  3PQI A;  4QGU A;  2N8N A;  5EPJ A;  2G5D A;  5IGE A;  1X9N A;  1N33 Q;  3I4M B;  3K7U C;  4QF4 A;  2K5Q A;  2HCC A;  1JJ2 A;  1OO9 B;  5EAY A;  5E4X A;  2GVA A;  1D5M C;  3J81 E;  3T51 B;  5IT9 E;  3QOL A;  3S15 H;  5J22 A;  3KLR A;  1Q8I A;  3IRB A;  3GTM H;  5M3M H;  1YNJ C;  2PW5 A;  2YYZ A;  4ODG A;  5C44 H;  2I46 A;  5JVG 3;  3PO2 H;  4DXG A;  2CKZ B;  3MXG A;  3VR3 A;  4DK1 A;  4CBV A;  3G7L A;  2CWA A;  1CI3 M;  4H13 C;  3C2P A;  4O42 A;  4GOP A;  1HRJ A;  2LXJ A;  5GQO A;  2F3V A;  5I2X A;  1RCV D;  2F0N A;  4K8I A;  1YHB A;  1CA5 A;  3N52 A;  2AUJ D;  1LTG D;  4GN5 A;  5COR A;  4NXM Q;  5JPN C;  4DV4 L;  1LV9 A;  1YNN C;  4LFA L;  4JI5 L;  3A8J E;  3BU2 A;  1X54 A;  2SNM A;  4OL7 A;  4A3E G;  2GN5 A;  1LTR D;  4X62 Q;  2CQA A;  2HIX A;  3SE0 A;  5DEH A;  1WTP A;  3CCU A;  1NMF A;  4IUN A;  2IX3 A;  2MNA A;  3VYR A;  4A3F H;  2R7Z G;  2PI2 A;  2MO0 A;  1YZ6 A;  4KKS A;  4CHT B;  3LWE A;  5C5M A;  3QJY A;  2AWN A;  2CWP A;  1WVL A;  5IYC G;  2L11 A;  3SGI A;  2YTV A;  2P5Z X;  3ZYY X;  1XNR Q;  4JYA L;  3HFZ B;  2A73 B;  4PG3 A;  5KND A;  2MO1 A;  1TWF H;  2E75 C;  3VR4 A;  4AQY Q;  2JA7 G;  4ZAI A;  3HOY G;  4O0A A;  1EFI D;  3TP7 A;  3J81 L;  1G51 A;  3HOV H;  5IT9 L;  1VCI A;  1B7Y B;  1R9T B;  2CW0 C;  1NR4 A;  2ICE C;  4XQQ A;  3RZD B;  2ZJQ A;  1SMY C;  4K14 A;  1EWC A;  1DOM A;  4I65 A;  4B3R L;  1SYC A;  1Y1V B;  3CCS A;  2EY2 A;  4GN4 B;  4QUF A;  3DWQ A;  1GUT A;  1U5K A;  4IN3 A;  2PI2 E;  2R93 H;  4G7Z C;  3C1F A;  2I5L X;  3A0J A;  4EX5 A;  4DV1 L;  2NYZ D;  1EUJ A;  3JAM c;  2ICI A;  3R2T A;  1G91 A;  2LS0 1;  1C8C A;  3EBE A;  3NQI A;  3ERQ A;  1EQV A;  3KBX A;  1KQS A;  1H9R A;  1EWH A;  5EBC A;  4A93 H;  1A2T A;  1ZXT A;  4BBS H;  1P8L A;  1X3G A;  2I5M X;  1GD7 A;  1YJN A;  2E2D C;  1SBB B;  3U9S A;  3HZX A;  1UWV A;  1K83 H;  1TQO A;  4DR3 L;  1D6E C;  1STB A;  4I7A A;  4JI2 Q;  1H95 A;  3NEN A;  2K7V A;  1D5X C;  1JWM D;  4XIG S;  3ER0 A;  2EYO A;  4KY5 A;  2UU9 Q;  3RZO H;  4GKJ Q;  2I5H A;  2IPK D;  1SYG A;  3WDN A;  4BA2 I;  3I91 A;  4X64 Q;  5KRU A;  2VY3 A;  1SYB A;  2JEB I;  3S1N B;  1EQR A;  2EPB A;  2DJG C;  4BY1 B;  2JK8 A;  3U50 C;  4JV5 Q;  3X3M A;  1D1K A;  4A3D H;  1EEF D;  1SNP A;  1PV4 A;  1Z47 A;  2CH4 A;  1HXY D;  1B50 A;  3RLN A;  1FYC A;  4UHV A;  5CV9 A;  2Q2I A;  1STE A;  4OO1 I;  1V9P A;  2A6H D;  2A8V A;  3NSW A;  4R8N A;  2IWH A;  2B8G A;  1PRT B;  3DMU A;  2OQ0 A;  4DAY A;  3I4M G;  3EA6 A;  1K28 A;  3OMC A;  1PH3 A;  1KDA A;  4RFB A;  1PYS B;  3PIO 3;  2E76 C;  1PTO D;  5KEE A;  3L7Z C;  3RNU A;  1CKN A;  3J80 c;  1PFB A;  2UUB L;  3CXC A;  1NR2 A;  1TWH B;  4JI7 L;  3FRP B;  1ILQ A;  1RIP A;  1BNZ A;  1VQM A;  1F9P A;  3I8Z A;  3GTM B;  1FJG L;  5CGK A;  1JWU D;  5M3M B;  1TWC H;  1A8V A;  1K3B C;  1N36 Q;  5C44 B;  2E2I H;  4RCO A;  2AQ1 B;  4V19 0;  1U4P A;  4RAU C;  3RUZ A;  1CFM A;  1XPO A;  1HZ9 A;  1W6K A;  2B63 B;  2J0T D;  2NVX H;  1F77 A;  3CKI B;  1HNX L;  4DR5 Q;  1ESR A;  1V1O A;  3I56 A;  3OYY A;  1VQH A;  1CZG A;  4NMZ A;  4DV2 L;  1NTG A;  3K59 A;  2H1E A;  2K28 A;  1L2F A;  2PNH A;  2EYF A;  2RCF A;  5M5W H;  4NPS A;  1SYD A;  1HFN A;  4X3K A;  2B2W A;  3ND9 A;  4Q0F A;  4ME5 A;  4LFB L;  1SN8 A;  1EU4 A;  1PYB A;  1E2Z A;  2VZA A;  5LMU Q;  4KLK A;  2ZJR A;  2O5J C;  3OPO A;  4GKK Q;  2AMC B;  3QG1 A;  4OEL B;  4A3F B;  4DR6 L;  4DR2 L;  1SDF A;  2RDG A;  2E2H H;  2MFI A;  1WTX A;  1S40 A;  3I4O A;  1K9M C;  3KLS X;  3QWN A;  1I50 H;  1ICW A;  1BO0 A;  1RD9 D;  3R3O A;  3M4Y A;  2OTL A;  2JN4 A;  4U68 A;  4YWM A;  1V1Q A;  5FO9 B;  2B2V C;  2D5D A;  5CC4 A;  3GD7 A;  4MTN A;  1TWF B;  1AE3 A;  4CKB A;  1J9O A;  3A8I E;  4IJH A;  5LL6 S;  2H5X A;  3F2C A;  3HOV B;  1I4R A;  2BA1 A;  4ZLT F;  1EOT A;  2K52 A;  1B3A A;  5DM7 3;  4GNX C;  1Y1V G;  3C1E A;  1EOV A;  4ZCK A;  4B9X A;  4C2M B;  4JOI C;  1STY A;  1B8A A;  1EY5 A;  4GLX A;  2RSN A;  1HJP A;  3TS2 A;  2R93 B;  4EQP A;  1I4H A;  1F2Y A;  2K5N A;  2AQ3 B;  2F52 A;  5I6Y A;  4ZKB B;  4QMG A;  2F4V L;  3CCQ A;  4A3I H;  2Z9H A;  1GJX A;  2RVL A;  2A1A A;  3HKZ E;  4LUZ A;  5DAU A;  1ET9 A;  4HJ7 A;  3AB9 A;  2D2C C;  1GUO A;  2HCI A;  3M7G A;  1BBW A;  4A93 B;  5JOB A;  4A3B G;  1EQT A;  1NAP A;  3G6J B;  4LF6 Q;  4KHV A;  4JI8 Q;  1K83 B;  3W1G A;  2F0L A;  4RH6 A;  3JAM L;  1YIJ A;  2A5H A;  2F0D A;  4BXX G;  4A3L G;  2HHH L;  1O7Y A;  1M90 C;  1I3Q H;  5CV8 A;  4JI4 Q;  2K32 A;  3SK6 A;  5E7N A;  3SHL A;  2X69 A;  3EFX D;  4PZ7 A;  3PF5 A;  1I4X A;  3BDO A;  1HNW Q;  4B3S L;  4KY6 A;  5BN4 A;  3J80 E;  2K4K A;  1I4G A;  2MP1 A;  2R92 H;  5DLQ E;  1EL0 A;  2XRS D;  4TVA B;  4B3M Q;  1E0B A;  4YY3 Q;  5C6A A;  4IO9 A;  1QVC A;  2ZXP A;  2OEO A;  2L5T A;  3OIP A;  3BDL A;  4A3D B;  3K0X A;  3A7L A;  4NP5 A;  1J5E L;  1LYL A;  1A3U A;  1MBY A;  3WWV A;  3S2H H;  4X65 Q;  3GP7 A;  2QDB A;  5CV5 A;  2LMC B;  3ND8 A;  2UXD L;  1XJV A;  1DCZ A;  4ZUJ A;  3SR1 A;  1MJC A;  1B70 B;  3S14 H;  4WJ4 A;  3I3C A;  5EPK A;  4P72 A;  4R4I A;  3I4M H;  3T53 B;  1Q1E A;  4N9P A;  3PF4 A;  1TVX A;  2SDF A;  4JI0 Q;  2FIN B;  1MI2 A;  2PCF B;  2XRQ D;  4KK7 A;  3S16 B;  2PZU A;  3GTO B;  2HQE A;  4LF5 L;  1TR5 A;  3TZU A;  5M3M G;  2MHV A;  5C44 G;  3TS0 A;  1N32 L;  2KA7 A;  5A2Q E;  1ICF B;  1YBY A;  1TWC B;  2UXB Q;  2A74 C;  4K5X A;  3A56 A;  3HEJ A;  1HZA A;  2PO4 A;  3U9O A;  3OTO L;  4B08 A;  1CHP D;  4X66 Q;  4R8I A;  2A6H C;  1VQD A;  1BDO A;  2B2Y A;  2NZO A;  3J80 L;  1HNZ L;  1LT3 D;  3SDZ A;  2QIL A;  3FKI H;  1IBM Q;  3M4Q A;  5JPM C;  1MJE A;  1O7Z A;  1SMY D;  4YHH L;  1PZI D;  3SVM A;  1FD7 D;  5M5W B;  4JI6 Q;  1AE2 A;  4JBK A;  1PTO C;  3D4D A;  1JOK A;  3VR6 A;  1LTI D;  3GDE A;  1A2U A;  3HS0 C;  4J1M A;  5ELE A;  4AIM A;  4WFN 3;  4ALP A;  4POG A;  5LMN W;  4G7O C;  1JE5 A;  4A3F G;  4KJO A;  5M9O A;  4OX9 Q;  4I7Z C;  2JA8 B;  4QY7 A;  2E2H B;  3HG9 A;  1I50 B;  1WD1 A;  4YCU A;  2ZT9 C;  4KI0 A;  3KJP A;  4J8Q A;  1SR3 A;  1DZ1 A;  1XTC D;  2B2U C;  1RKN A;  1JMC A;  1Z9F A;  3HOV G;  2YV5 A;  1LTT D;  5IYB H;  2DY8 A;  2FHT A;  1DM0 B;  4ZRZ A;  5AJ3 L;  1PRT F;  2F0V A;  1XNQ Q;  3RZD H;  3K80 C;  1IYV A;  1FVI A;  5A2Q L;  1CK1 A;  2TSS A;  4EQ5 A;  1R4Q B;  3MWY W;  1ZKO A;  3URY A;  1KIX A;  3SK5 A;  2R93 G;  4JPB W;  1II3 A;  3H3V C;  2RBM A;  1STG A;  2WKD A;  3MXU A;  1ROD A;  3HKZ B;  1I6V C;  1PH2 A;  1KAW A;  2NVT H;  4A3J H;  4JBM A;  1K8M A;  4RA8 A;  4G57 A;  4IQZ A;  1C9O A;  4A3I B;  4JVZ A;  2HT1 A;  1W3S A;  3QO2 A;  2X6L A;  1Q82 C;  2VL6 A;  3H09 A;  1FGU A;  5C4X H;  2ZXR A;  3FHW A;  4A93 G;  3KF6 B;  4BBS G;  3T56 B;  1PH4 A;  2RKS A;  2NB0 A;  1BKB A;  1Q12 A;  5E3F A;  1EIG A;  2EOT A;  4XDX A;  3T1Y Q;  2F0S A;  3FEW X;  1H9J A;  2R3Z A;  1PDQ A;  2ATW A;  4JG2 A;  2OXP A;  3EVQ A; 
#chains in the Genus database with same CATH homology
 1DOL A;  2G9H D;  5I9P A;  4MIU A;  4IFD I;  3NE5 B;  3T13 A;  1JOQ A;  1I3Q B;  4RHR A;  2F0I A;  1FNV A;  1BOS A;  1EZ8 A;  5CYU A;  3HRZ C;  1TY2 A;  3VR2 A;  2L0C A;  3GTQ B;  1B9M A;  1RTO A;  3K5O A;  5A35 A;  2R92 B;  1B9N A;  2K01 A;  1Y1W B;  1FNW A;  4C3H B;  1QCB D;  2EYL A;  3GTG B;  3DM1 A;  1QNK A;  3S2H B;  5FO8 B;  3X3N A;  2D9U A;  3S14 B;  2WII B;  1SEB D;  1SNM A;  3IL8 A;  1XWE A;  2M2L A;  1H9M A;  3MC0 B;  3P1H A;  1BQQ T;  5ISR A;  1IHZ A;  2EE1 A;  1IKM A;  2AWO A;  3DEP A;  1JR0 D;  1PYW D;  4IUR A;  1AZQ A;  1UUP A;  1TS5 A;  3NTI A;  4KN4 C;  3HOX B;  5KYL A;  1BUV T;  5T1G A;  1LTA D;  2HDM A;  2VNU D;  5LL6 X;  3FKI B;  1KLG D;  3VA5 A;  1Z6H A;  1U9R A;  2FMC A;  4DNR B;  3W2D A;  3GO5 A;  4C3J B;  2IX0 A;  4K2L A;  1TWG B;  3M85 A;  1CQF A;  3DEO A;  4BY7 B;  4QB4 A;  1QE6 A;  3MA2 B;  1EU3 A;  3L3O C;  4ULL A;  4O1N A;  3V05 A;  3D4R A;  1ZYR D;  4IUV A;  2V4D A;  5EQ0 A;  1SNC A;  5LHY 1;  1DXM A;  4OGQ C;  2F0Q A;  5K5P A;  5KGU A;  1L0Y B;  1JE4 A;  1NUC A;  1S4Z A;  1D1I A;  4FXD A;  3LNN A;  4LMQ D;  1A15 A;  1TT2 A;  5M3F B;  3TP5 A;  2NVT B;  3T16 A;  4A3J B;  2EZV A;  3Q0A A;  4S3S A;  2VB3 X;  2JA5 B;  3D6C A;  4HCE A;  4NW2 A;  3HP3 A;  5C4X B;  1VMP A;  5D65 A;  4HAE A;  5C4Z A;  4XXE A;  4V0B A;  1QIL A;  4XQJ A;  5D14 A;  1VF7 A;  3FMC A;  2F0M A;  1ESF A;  1TU2 B;  3I70 A;  1ENA A;  2NTT A;  4HCS A;  1TKW B;  3AU7 A;  4XQN A;  2WB1 B;  4F87 A;  4C1N I;  3GQB A;  2NZ1 D;  4TQU S;  4KN7 C;  2JEA I;  3E5S A;  5JVH 3;  2NWG A;  2K03 A;  2QF7 A;  2B39 A;  2A6E D;  1JWS D;  2IW3 A;  5IGD A;  1WD0 A;  1SJE D;  5TSS A;  5D3D A;  2FJ2 A;  5KNB A;  2EJF C;  1WTQ A;  1TS2 A;  4ID6 A;  1HCZ A;  2KUM A;  3TDQ A;  3GTL B;  4GZY C;  4PNY A;  3OWE B;  1QG7 A;  1FR3 A;  2OF1 A;  3GV3 A;  4CJ2 C;  1HQM C;  4H7B A;  1HHV A;  4RKB A;  3NWT A;  2XN9 C;  3BYY B;  3EJI A;  4HSP A;  1CQV A;  4HN7 A;  3S2D B;  1A6X A;  1XX8 A;  3D3R A;  1C48 A;  4OO1 G;  3WOE A;  3MFY A;  1B2T A;  1L0X B;  2O2L D;  5EKI A;  4WRD A;  4HMI A;  1MSH A;  4EGV A;  5EKK A;  1Y69 U;  1OXV A;  2XVS A;  2Y0S B;  1O7L A;  1SE2 A;  2DNC A;  1MGS A;  2MPM A;  5IIF A;  5I2Y A;  5JAV A;  4C3J G;  4J6H A;  4C3I B;  1QWY A;  1AW7 A;  3FPP A;  2H4O A;  2K05 A;  2NTS A;  2BE5 D;  1WTR A;  4DNT B;  1AFP A;  4K6D A;  3S1Q B;  1BR9 A;  3JAM E;  3EQL C;  2YU9 B;  1W6J A;  1HFG A;  1HUM A;  5C0X I;  5BN3 A;  1K8O A;  1M4V A;  1S5C D;  5FOB B;  4AYB B;  1GUW A;  2RA4 A;  3R2I A;  1GUN A;  4RGM A;  2B2T C;  4R9W A;  4ILW A;  3I4N B;  1G29 1;  1PLF A;  1Q90 A;  1SE4 A;  2PYK A;  2XNA C;  1EYA A;  4L6T B;  4M1U B;  4KHZ A;  3HOU B;  2EYP A;  1F9Q A;  3K0Y A;  2WV6 D;  1PTO H;  3I90 A;  2PW7 A;  1S5F D;  2KJX A;  5IGG A;  3Q24 A;  5BN5 A;  1VDZ A;  1ZYR C;  4IUU A;  1DOK A;  1ENF A;  2CVR A;  3KLS A;  1ZEQ X;  2Q8I B;  2O4X A;  1HA6 A;  1M8A A;  1V1P B;  2HUG A;  2JP1 A;  2DN8 A;  4DK0 A;  4X3S A;  1AN8 A;  4EQN A;  4B9W A;  3IFD A;  3M3Y B;  3SK4 A;  4H0L C;  3HGB A;  2IJ0 A;  1S5D D;  2E74 C;  1G2S A;  1SYF A;  1GHK A;  1PZK D;  1KNE A;  5HUR A;  3P7J A;  5C0X J;  3CHB D;  1BF4 A;  2QCP X;  4TRD A;  3BVM A;  3NK9 A;  2F0W A;  1SNO A;  5JEA J;  2A68 D;  4JK1 C;  1G8Z D;  5M5Y B;  2Z4I A;  4U67 3;  2Q8R E;  5K36 H;  1KLU D;  4F88 A;  1SND A;  1OXU A;  5IGB A;  1RHP A;  2LKV A;  5KYI A;  4DF7 A;  3N6R A;  4XYO A;  3VYT A;  2L55 A;  5EPL A;  3C46 A;  2BOS A;  4XT3 B;  4DXF A;  5CV4 A;  2EYH A;  4DN4 M;  1TWA B;  5FO7 B;  1I6H B;  2A6E C;  4ZK9 B;  1IW7 D;  3LWU A;  3T4A C;  2JYO A;  5M5X B;  3PUY A;  1U4M A;  3HOZ B;  3SXH A;  3BYT B;  4OO1 H;  1PFN A;  1ONL A;  2R61 A;  1KDB A;  1WTO A;  5G3L F;  1B4O A;  4X3T A;  2R6G A;  3J7Y W;  2XSC A;  3OOC A;  2B2W C;  2Z1C A;  1CHQ D;  1Y8P B;  3NTH A;  2PPB C;  2L4N A;  4IUP A;  1WCM B;  3DXJ C;  4C3I G;  3TP8 A;  5ELD A;  2SEB D;  3MTS A;  2XWJ B;  4FF2 A;  1UAP A;  4PMB A;  3IAY A;  1BXT A;  5C3E B;  2FMM A;  4FXK C;  4FP5 D;  4RCN A;  4HMJ A;  2F0J A;  5DNF A;  2KHS A;  3SK8 A;  2TMP A;  2G9D A;  2B8F A;  2AQ2 B;  2KVM A;  4KKT A;  1IKL A;  1LLR D;  2F0O A;  4A3E B;  5CMD A;  1AP0 A;  4Z9C B;  1EY9 A;  4LK1 C;  4OHJ A;  4RGO S;  2SOB A;  3M7N A;  2R7Z B;  1OXT A;  2IT1 A;  5C0X H;  1PRT D;  4RHS A;  2BE5 C;  1JOR A;  5JEA H;  5E4W C;  4C56 C;  4QUC A;  3ONA B;  3MVV A;  5T1I A;  1PTO B;  4Y7N B;  3FPU B;  2C9O A;  1LTB D;  2L1B A;  4ABN A;  3H94 A;  1IL8 A;  3MFG A;  3KUP A;  1EY4 A;  1G6Z A;  1HQR D;  1STH A;  5CV7 A;  5CV6 A;  4K5V A;  3H0G B;  3HOW B;  5I4D A;  5AFW A;  5JJZ A;  3OIQ A;  2K5W A;  1PXU A;  2ZXO A;  1AZP A;  3P75 A;  1B1Z A;  2PMZ B;  4N9T A;  4HR7 B;  1EY7 A;  2NN6 I;  3RMH A;  2QEJ C;  4OIJ A;  3K5L A;  3MEH A;  4HTH A;  1CTM A;  1LTS D;  3GTK B;  4CJ1 B;  2KQ3 A;  1SXT A;  4IUT A;  2KOL A;  4DU9 A;  4HED A;  2F0P A;  4H44 C;  1CT1 D;  1FNU A;  2F0T A;  4F7X A;  3C3L A;  3MXN A;  5ELF A;  2NBF A;  4ZYS A;  2F0K A;  1GXD C;  3F2U A;  4K6L A;  1JCK B;  1KDC A;  2NVY B;  3NHH A;  1WTW A;  4RKL A;  4A3M B;  1OXS C;  3D6W A;  4RGT A;  2KCC A;  1TY0 A;  2B2Y C;  1LAB A;  2A68 C;  3GTJ B;  3NPP A;  2VXW A;  4L63 B;  3NP8 A;  1HUN A;  1STN A;  3S1M B;  2WP8 J;  1JQY D;  4UDU C;  3NWS A;  1LAC A;  2NVQ B;  5C5L A;  1BCP B;  4IFD J;  3VYU A;  1I4P A;  2XIW A;  2PZW A;  1DON A;  5DM6 3;  4ZUI A;  2Q8T A;  1QJO A;  3BVG A;  3PUV A;  3I4L A;  1IW7 C;  3Q6S A;  2F0G A;  1JC7 A;  2F3W A;  4BA1 I;  1UNS A;  3D8G A;  3K58 A;  3OSO A;  2QKI C;  4FF3 A;  1H9S A;  3W3A A;  1SE3 A;  2EY1 A;  1TS3 A;  1D5Z C;  1QNU A;  4Q5V A;  2BCO A;  3O13 A;  3TSS A;  4K2K A;  1F2L A;  2SNS A;  2EY6 A;  1JOO A;  1ILP A;  1ET6 A;  2PNR C;  3TME A;  5C4J B;  5KNC A;  3GTP B;  1V43 A;  3MHB A;  1UEA B;  5F2D A;  3J7A F;  3VA7 A;  2JE6 I;  1F2Z A;  3RD4 A;  1V1P A;  1U4L A;  1HPC A;  1HA5 A;  5IGC A;  1LT5 D;  1EYC A;  2X6G A;  2RSO A;  2B2V A;  1Y8N B;  1RF2 D;  1PZJ D;  3P20 A;  4X3U A;  4FYD A;  3A55 A;  2OT2 A;  1RTN A;  3KK7 A;  2B2T A;  3UI2 A;  5EGT A;  3CRK C;  2WKC A;  5C3X A;  3TBI B;  1TII D;  4LAA A;  4BBR B;  2ENB A;  3BZD B;  5C4H A;  2F4I A;  3ITP A;  1JIC A;  1QB5 D;  5FLX E;  4NKL A;  3CQZ B;  3NXW A;  2WAQ B;  4QIW B;  3E6Z X;  5HGT A;  4PQX A;  1PRT C;  4BS9 A;  1Z7T A;  4A3G B;  4A3B B;  4TKO B;  2EJM A;  1TS4 A;  1X32 A;  4KD3 A;  4CJ0 B;  4C3H G;  4A3K B;  2J4X A;  4PMW A;  1KNA A;  3NBI A;  2RDF A;  5CR3 A;  3LX0 A;  5ELB A;  5K36 G;  1O80 A;  4IFD H;  1EYD A;  5E1F A;  2C5C A;  2Z8L A;  5NUC A;  4TSS A;  3K6O A;  1C4Q A;  3OW7 A;  1F9S A;  1SJH D;  1FGB D;  2NN6 H;  3TN2 A;  1RJT A;  4FO2 A;  2F03 A;  4XTC S;  4F8M A;  2L9H A;  1RDP D;  2EDG A;  1E2V A;  3BDC A;  4KD4 A;  2JA6 B;  5FLX L;  1PTO F;  3FVQ A;  4K5W A;  3S17 B;  4KKU A;  1LO5 D;  4EQO A;  3DWP A;  1OXX K;  1B44 D;  4XT1 B;  2HDL A;  1KAA A;  4KY7 A;  1NSN S;  3S15 B;  1F2M A;  1Q1B A;  3PO2 B;  1ENC A;  1LT4 D;  1SNQ A;  4CGY B;  3FDT A;  1NCV A;  1EZ6 A;  3QB3 A;  4K8J A;  3A8K E;  1V8Q A;  3PUW A;  1KAB A;  2LY7 A;  4IAL A;  3NBH A;  1DD2 A;  4C1N K;  1X3Q A;  4M8A A;  3K7A B;  2K1B A;  1T5E A;  4FF1 A;  5FKA C;  5J1Z A;  4FNF A;  3H6M A;  2VB2 X;  4FVM A;  4IUQ A;  4JBW A;  2EXZ A;  1GUG A;  1EEI D;  3OMG A;  3M4O B;  5IOC A;  4RGN A;  5COY A;  1EIH A;  3V96 A;  5EJW A;  4UAI A;  1H9S B;  4XYQ A;  5C0X G;  3RLF A;  1Y8O B;  1WTV A;  2EYM A;  2KEE A;  3GV6 A;  4WOR A;  5JEA G;  2EY5 A;  3AMU A;  2F0H A;  3IFT A;  2RQX A;  1DJR D;  2B2U A;  1H9K A;  1SSO A;  1STA A;  3NQT A;  3DUZ A;  1EY0 A;  1S5B D;  4DFA A;  3K57 A;  4PMC A;  3QIA A;  2DY7 A;  1JB3 A;  1HTL D;  3Q22 A;  2EYJ A;  3PO3 B;  2WIN B;  1B53 A;  1ML0 D;  3VR5 A;  1SAP A;  3NUC A;  1BCP F;  5CBA E;  1G2T A;  1O78 A;  3PUZ A;  4PV1 C;  4BBS B;  3MAQ A;  3KBG A;  5J39 A;  1BCP D;  2MJ8 A;  2A69 D;  1KTK A;  1AEX A;  1EY8 A;  4P2C B;  3DWA A;  4QCL A;  2K33 A;  3RZO B;  2F0F A;  3CU7 A;  3K5N A;  2ID0 A;  4FXG C;  1XYI A;  2K5D A;  3BVZ A;  1YNJ D;  3I72 A;  3BG3 A;  3D4W A;  2VUM B;  3TZD A;  4DAP A;  3PIP 3;  4HSV A;  4OIK A;  5IOD A;  3MXP A;  1CM9 A;  4KV6 A;  2Z4H A;  1GUS A;  3IKJ A;  3S9W A;  2F0U A;  1BBX C;  3ERO A;  2N88 A;  4RWS C;  5C3W A;  1J8I A;  2F1M A;  2AUK A;  5EKL A;  1YNN D;  2CHB D;  1VF5 C;  5CBE E;  4DA2 A;  2GA4 B;  1PMR A;  3MZ5 A;  1T5X D;  3VYS A;  2KED A;  3L9A X;  5G3L D;  1E2W A;  4EVO A;  4ZKC B;  2E2I B;  3PUX A;  1GHJ A;  5FK9 C;  4MHE A;  2NVX B;  4KTA A;  1CZW A;  3V2T A;  2BDO A;  3E0J A;  3BS1 A;  2CW0 D;  1QOH A;  1S5E D;  3OWF A;  3R8B A;  5ELC A;  2JXM B;  3QOJ A;  2PQE A;  2E2J B;  2M00 A;  4G4K A;  1IYU A;  4ZQ3 A;  1MD2 D;  2I07 B;  5IGF A;  4IZ8 A;  2M9V A;  1CA6 A;  3OHX C;  4G7H C;  2IL8 A;  3D31 A;  1I4Q A;  3PV0 A;  1Q3L A;  3KF8 A;  1MSG A;  3R93 A;  4WJW A;  4CKE A;  4DGZ A;  3S1R B;  3NTK A;  2JA7 B;  2EVB A;  1EY6 A;  5KIX A;  3HOY B;  2EJG C;  2L12 A;  1U4R A;  4YIJ A;  1VMC A;  3PMF A;  1A3V A;  3TP6 A;  1SYE A;  2WAC A;  5EBD A;  3K5M A;  2IX1 A;  1HTP A;  2J7Z A;  1DYQ A;  1SFO B;  2RDH A;  5I9O A;  3I73 A;  2D62 A;  2XWB B;  1A3T A;  4LJZ C;  2LFN A;  1X3P A;  1LT6 D;  2N55 A;  1F9R A;  4BWG B;  3SEB A;  2MUY A;  3A7A B;  2NUC A;  3DHQ A;  3H91 A;  5D3I B;  1XXG A;  4NDX A;  2BA0 A;  2KEC A;  4MN3 A;  1PFM A;  1D2B A;  2K6A A;  2F0E A;  2K04 A;  4KMU C;  2O5I C;  4IFD G;  3Q23 A;  5I6W A;  4L8J A;  2PZT A;  4KJN A;  3WOF A;  2JSO A;  4CKC A;  1R4P B;  2KCN A;  2BDN A;  2MGS A;  2NN6 G;  4E6I A;  3J7A V;  3CRL C;  1BCP C;  2FFK B;  3A54 A;  1GOZ A;  2DNE A;  4DAV A;  2A69 C;  4FF4 A;  5EPJ A;  5IGE A;  3I4M B;  4QF4 A;  2K5Q A;  2HCC A;  1OO9 B;  5E4X A;  1D5M C;  3J81 E;  3T51 B;  5IT9 E;  3QOL A;  5J22 A;  3KLR A;  1Q8I A;  1YNJ C;  2PW5 A;  2YYZ A;  4ODG A;  2I46 A;  5JVG 3;  4DXG A;  3MXG A;  3VR3 A;  4DK1 A;  4CBV A;  3G7L A;  1CI3 M;  4H13 C;  3C2P A;  4O42 A;  1HRJ A;  2F3V A;  5I2X A;  1RCV D;  2F0N A;  4K8I A;  1CA5 A;  3N52 A;  2AUJ D;  1LTG D;  5COR A;  5JPN C;  1LV9 A;  1YNN C;  3A8J E;  2SNM A;  4OL7 A;  1LTR D;  2CQA A;  3SE0 A;  5DEH A;  1WTP A;  4IUN A;  2IX3 A;  3VYR A;  4KKS A;  4CHT B;  3LWE A;  5C5M A;  3QJY A;  2AWN A;  1WVL A;  2L11 A;  3ZYY X;  2A73 B;  5KND A;  2E75 C;  3VR4 A;  4ZAI A;  3TP7 A;  1EFI D;  3J81 L;  5IT9 L;  1VCI A;  1R9T B;  2CW0 C;  1NR4 A;  2ICE C;  4XQQ A;  3RZD B;  1SMY C;  4K14 A;  1EWC A;  1DOM A;  4I65 A;  1SYC A;  1Y1V B;  2EY2 A;  4QUF A;  3DWQ A;  1GUT A;  4IN3 A;  4G7Z C;  3C1F A;  2NYZ D;  2ICI A;  3R2T A;  1G91 A;  2LS0 1;  1C8C A;  3NQI A;  3ERQ A;  1EQV A;  3KBX A;  1H9R A;  1EWH A;  5EBC A;  1A2T A;  1ZXT A;  2E2D C;  1SBB B;  3U9S A;  3HZX A;  1TQO A;  1D6E C;  1STB A;  2K7V A;  1D5X C;  1JWM D;  4XIG S;  2EYO A;  4KY5 A;  2IPK D;  1SYG A;  3WDN A;  4BA2 I;  3I91 A;  5KRU A;  1SYB A;  2JEB I;  3S1N B;  2EPB A;  4BY1 B;  3X3M A;  1D1K A;  1EEF D;  1SNP A;  1Z47 A;  1HXY D;  1B50 A;  1FYC A;  5CV9 A;  1STE A;  4OO1 I;  2A6H D;  3NSW A;  4R8N A;  2IWH A;  2B8G A;  1PRT B;  3DMU A;  4DAY A;  3EA6 A;  3OMC A;  1KDA A;  4RFB A;  3PIO 3;  2E76 C;  1PTO D;  5KEE A;  3L7Z C;  1PFB A;  1NR2 A;  1TWH B;  3FRP B;  1ILQ A;  1BNZ A;  1F9P A;  3I8Z A;  3GTM B;  5CGK A;  1JWU D;  5M3M B;  5C44 B;  4RCO A;  2AQ1 B;  4V19 0;  1U4P A;  4RAU C;  3RUZ A;  1CFM A;  1W6K A;  2B63 B;  2J0T D;  1F77 A;  3CKI B;  1ESR A;  1V1O A;  1CZG A;  4NMZ A;  3K59 A;  2H1E A;  2K28 A;  2EYF A;  1SYD A;  1HFN A;  4X3K A;  2B2W A;  3ND9 A;  4Q0F A;  4ME5 A;  1EU4 A;  1E2Z A;  2O5J C;  3OPO A;  3QG1 A;  4A3F B;  1SDF A;  2RDG A;  1WTX A;  3KLS X;  3QWN A;  3R3O A;  1ICW A;  1BO0 A;  1RD9 D;  3M4Y A;  4U68 A;  5FO9 B;  2B2V C;  2D5D A;  5CC4 A;  3GD7 A;  1TWF B;  4CKB A;  1J9O A;  3A8I E;  5LL6 S;  3HOV B;  1I4R A;  2BA1 A;  4ZLT F;  1EOT A;  1B3A A;  5DM7 3;  3C1E A;  4B9X A;  4C2M B;  1STY A;  1EY5 A;  2RSN A;  2R93 B;  4EQP A;  1I4H A;  1F2Y A;  2AQ3 B;  5I6Y A;  4ZKB B;  4QMG A;  1GJX A;  2RVL A;  5DAU A;  1ET9 A;  3AB9 A;  2D2C C;  1GUO A;  2HCI A;  3M7G A;  4A93 B;  5JOB A;  1EQT A;  1NAP A;  3G6J B;  4KHV A;  1K83 B;  2F0L A;  4RH6 A;  3JAM L;  2A5H A;  2F0D A;  1O7Y A;  5CV8 A;  2K32 A;  3SK6 A;  3SHL A;  2X69 A;  3EFX D;  1I4X A;  3BDO A;  4KY6 A;  5BN4 A;  3J80 E;  1I4G A;  2MP1 A;  1EL0 A;  2XRS D;  1E0B A;  5C6A A;  2ZXP A;  2OEO A;  2L5T A;  3OIP A;  3BDL A;  4A3D B;  3A7L A;  4NP5 A;  1A3U A;  1MBY A;  3GP7 A;  2QDB A;  5CV5 A;  2LMC B;  3ND8 A;  1DCZ A;  4ZUJ A;  3SR1 A;  3I3C A;  5EPK A;  3T53 B;  1Q1E A;  4N9P A;  1TVX A;  2SDF A;  2FIN B;  1MI2 A;  2PCF B;  2XRQ D;  4KK7 A;  3S16 B;  2PZU A;  3GTO B;  2HQE A;  1TR5 A;  3TZU A;  2MHV A;  2KA7 A;  5A2Q E;  1TWC B;  2A74 C;  4K5X A;  3A56 A;  3HEJ A;  2PO4 A;  3U9O A;  4B08 A;  1CHP D;  4R8I A;  2A6H C;  1BDO A;  2B2Y A;  3J80 L;  1LT3 D;  3SDZ A;  2QIL A;  5JPM C;  1O7Z A;  1SMY D;  1PZI D;  3SVM A;  1FD7 D;  5M5W B;  1PTO C;  3D4D A;  1JOK A;  3VR6 A;  1LTI D;  4J1M A;  1A2U A;  3HS0 C;  5ELE A;  4WFN 3;  4G7O C;  4KJO A;  5M9O A;  4I7Z C;  2JA8 B;  2E2H B;  3HG9 A;  1I50 B;  1WD1 A;  2ZT9 C;  4KI0 A;  4J8Q A;  1DZ1 A;  1XTC D;  2B2U C;  1RKN A;  1LTT D;  2DY8 A;  2FHT A;  1DM0 B;  4ZRZ A;  1PRT F;  2F0V A;  1IYV A;  5A2Q L;  1CK1 A;  2TSS A;  1R4Q B;  3MWY W;  1ZKO A;  3URY A;  3SK5 A;  1II3 A;  3H3V C;  2RBM A;  1STG A;  2WKD A;  3MXU A;  1ROD A;  3HKZ B;  1I6V C;  1K8M A;  4RA8 A;  4G57 A;  4IQZ A;  4A3I B;  2X6L A;  3QO2 A;  3H09 A;  2ZXR A;  3T56 B;  2RKS A;  2NB0 A;  1Q12 A;  5E3F A;  1EIG A;  2EOT A;  4XDX A;  2F0S A;  3FEW X;  1H9J A;  2R3Z A;  1PDQ A;  2OXP A;  3EVQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...