5J22A

Crystal structure of staphylococcal nuclease variant delta+phs l103d at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEADVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L103D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5j22A00
4K8JA 2EYPA 3MZ5A 2F0TA 1TQOA 4KY7A 3T13A 3P1HA 4NDXA 5E1FA 1A3VA 5I6WA 5KGUA 3DHQA 4K2KA 5KRUA 2RKSA 1EY8A 1SYEA 2F0NA 1SYGA 4HMJA 4TRDA 1SYBA 4EQOA 2PZUA 2EYFA 2EXZA 4KY6A 4YIJA 2SNMA 4ID6A 1A2TA 2LKVA 1IHZA 2PQEA 1TR5A 5CV6A 4EVOA 2F3VA 1ENCA 2F0HA 3OMGA 5CC4A 4B9XA 2O4XA 2OXPA 4DU9A 4PMBA 4KJNA 1EYDA 4NKLA 2EYMA 5CR3A 4K5XA 5JOBA 4EQPA 4F8MA 5I6YA 5IGFA 4KD4A 2F0JA 3MVVA 3NUCA 5DEHA 4K5WA 1SNQA 3D4DA 2EYJA 5C3XA 1NSNS 4K8IA 4KHVA 2F0IA 4PNYA 2KQ3A 5EKLA 2EY2A 3D6CA 5C3WA 1KABA 2PZTA 4NMZA 3SXHA 2RBMA 3OWFA 1F2MA 4B9WA 3PMFA 4S3SA 1EZ8A 1ENAA 1STAA 4G57A 2HQEA 3QOJA 3E5SA 3EROA 2EYLA 1STBA 2QDBA 5E3FA 1EY0A 1SNMA 4J1MA 4ME5A 4ZUJA 4E6IA 1SNOA 2KHSA 1SYFA 4RKBA 5C6AA 5EGTA 2F0MA 1JOOA 5IODA 1SYDA 2EY5A 3D4WA 2EY1A 3MEHA 4I65A 2PYKA 2F0SA 3DMUA 5J1ZA 4DGZA 2F0QA 3NXWA 4QF4A 1KDBA 3V2TA 2EYOA 2PW5A 3QOLA 5CV8A 3SK5A 3TP7A 3HZXA 4IUNA 4QMGA 1KDCA 5CV7A 1TT2A 5C4ZA 5IIFA 3HEJA 2F0DA 5C5MA 2SNSA 1AEXA 3ERQA 2F0EA 4K5VA 3SR1A 3TP8A 5IGEA 1EYAA 5EKKA 1II3A 4K14A 1EQVA 2F0UA 2F0VA 3SK4A 3C1FA 2OEOA 2PW7A 4KTAA 3TP5A 1SNDA 5KIXA 1A3TA 2WACA 5CGKA 5KYLA 3R3OA 1RKNA 3NP8A 3LX0A 5CV5A 1A2UA 1EY9A 5C5LA 4DFAA 3QB3A 2EY6A 4KD3A 5J22A 3EVQA 5IGCA 2F0LA 3MXPA 1NUCA 1KAAA 5C4HA 5IGGA 2M00A 4K6DA 5IGBA 1EZ6A 5CV9A 3ITPA 4R8NA 2OF1A 4F7XA 4HMIA 4KV6A 4OL7A 3P75A 4WRDA 2F3WA 4KY5A 4WORA 2F0GA 4EQNA 1EY6A 5DAUA 1STNA 3SK6A 3BDLA 1SYCA 2EYHA 5CV4A 4ZUIA 1STHA 3OMCA 2F0KA 2PZWA 1SNPA 3SHLA 2NUCA 5HURA 3NHHA 2RDFA 3S9WA 1JOQA 3MHBA 2F0FA 5I9PA 5K5PA 4IZ8A 4IALA 1EY4A 1F2ZA 1EY5A 1A3UA 2F0OA 5HGTA 5I9OA 5IGDA 3RUZA 3VA5A 1U9RA 1STGA 4QB4A 3NQTA 4KJOA 5IOCA 4HTHA 4MIUA 3D8GA 4N9TA 4ZQ3A 1SNCA 4LAAA 4RKLA 4DF7A 5ISRA 4J6HA 4N9PA 5KEEA 2F0WA 1F2YA 1JORA 3EJIA 3C1EA 3U9OA 3BDCA 3NK9A 4K2LA 2F0PA 4H7BA 5KYIA 5J39A 3SK8A 5F2DA 5M9OA 3T16A 3OSOA 4PMCA 3H6MA 1JOKA 1EYCA 3TP6A 5JAVA 2ENBA 1STYA 2SOBA 4ODGA 1EY7A 5NUCA 1KDAA 3TMEA 4NP5A
chains in the Genus database with same CATH superfamily
3I4MB 4X3TA 1UE1A 4DN4M 3KYHC 1SYBA 4DA2A 2JXMB 3ND8A 2NVXH 1VQ9A 4UHVA 5L37A 5M3FH 2PQEA 1MJEA 2QF7A 3A7AB 2RCFA 5ISRA 1PRTC 5JOBA 5FK9C 3U50C 3NUCA 3MXGA 1YI2A 3AYHB 3M7GA 1AN8A 2RQXA 4BA2I 1RCVD 4QJFA 4C56C 3J7YW 1U5KA 1NY4A 4J1MA 5D3IB 3VR4A 4U68A 1WJJA 2JQOA 1I6HB 2Q8RE 2BE5C 1BCPB 1SYDA 2HT1A 3SDZA 1XXGA 2YTVA 1YNJD 4X65L 1S5CD 1NBWA 1LTSD 2EYOA 1T9HA 3E9IA 1BKBA 4X3UA 3CKIB 1S72A 2DJGC 1YBYA 1TWAB 1LTBD 2F4IA 4LNQA 4CHTB 2WACA 3HRZC 3HFZB 4FNFA 1PLFA 5LMUQ 2ZXPA 2A6HC 5C4HA 2Z4HA 1I4PA 2E2IB 4J8QA 4BY1G 4IOCA 2AKWB 2AUJD 3VYRA 4GNXA 4EQNA 3ULLA 2R93B 1EY6A 1VQDA 1I50B 3SK6A 4CJ0B 2D0PA 3RN5A 1SNPA 2UXDQ 2HHHL 1Z7TA 3WDNA 4IALA 3KOJA 5I9OA 2UUAL 1UE6A 1BR9A 1STGA 4DR6Q 4KJOA 1S5BD 1Z9FA 4DXFA 4C3IH 2N8NA 4DF7A 2MFIA 2B2WA 4IURA 4N9PA 1X32A 4X64Q 1F2YA 1KAWA 1VQEA 3EJIA 4B3SL 3RD4A 4IUPA 3RZOH 4K2LA 3D6WA 4KHPQ 4RA8A 1XNRL 4OELB 3FMCA 2J4XA 2WINB 5JVG3 2EQSA 1X3FA 4HN7A 1G2SA 1UEAB 4X3SA 5I6WA 3PF5A 1F9SA 1B8AA 5T1GA 4A3FB 3HOWG 3GP7A 4FF1A 2N49A 4XDXA 3PIP3 2UU9Q 4ZYSA 2LY7A 3S1MB 4C2MH 4MNOA 4A3MG 4DAPA 1L1OB 3KDFB 2R92B 3MEFA 2NN6I 5KNDA 3UDFA 1YNND 4DV7L 2LXJA 3MVVA 2OTLA 5E7NA 2NVYB 4X62L 1PH2A 4XIGS 4JI5Q 1XPOA 1G6PA 3NWSA 4PNYA 4P71A 1NJIC 2CH4W 4YWKA 1R9TH 2FFKB 4IPHA 4JI8L 5DM63 4OX9Q 5IYDG 3V05A 2K33A 3A56A 3W5OA 3EROA 2RHSB 1QZHA 1JCKB 1SJED 1VQ4A 5I2XA 5C6AA 2E76C 4Y52H 2K03A 4EQ5A 5EPJA 2Y0SG 4F7XA 2HQLA 1TWCH 3TDQA 5C4JH 1TT2A 3ULJA 3LWEA 1PHJA 4A3JH 2VB2X 5JJIA 4ILWA 4FO2A 1A62A 1FYCA 5KYLA 1EWIA 3W1GA 5IP9H 1FR3A 1J8IA 2EY6A 3C3LA 1IKMA 5IGCA 1S40A 2JA6G 2UUCQ 1YITA 1K8AC 2ZXRA 1B50A 3S2HH 2OF1A 3QWNA 4OL7A 3HOUH 1CKNA 2PCFB 3WWVA 1WTOA 3D0FA 1N32Q 3PO3B 5FO7B 2RDGA 4ZLTF 3H0GB 1LTID 3S17B 3TN2A 4XQJA 1HQMC 5CORA 4DR4Q 3OOCA 1L2FA 3BJUA 5IGDA 3S2DH 2EVBA 2YTYA 5M3FG 1I94L 3A74A 1PYWD 4GKJQ 2F0WA 2NYZD 1H9JA 3OTOL 2B29A 1P8LA 4ZK9B 2HDMA 3K58A 2E2IH 1SFOB 4IPCA 4DR3L 1DGSA 1I6VC 5ELBA 2UXBL 3HOXH 4P75A 1MKHA 1WCMH 1BOSA 1TY0A 1I50H 1KDAA 1NR4A 1PTOF 1I4QA 2IL8A 3S14H 1E1TA 2MPMA 3E0EA 1WTHA 5I4DA 2Q2UA 1AE3A 3GTMB 5A35A 4TRDA 4DK0A 3GTPH 2SNMA 4QGUA 4F87A 4BXXH 1Q86C 4GZYC 5CMDA 1NMFA 3VDYA 1TR5A 1O78A 4KJNA 4F8MA 4J15A 4GOPA 3HOVB 1WFQA 4K5WA 3GO5A 3CAMA 3S1RH 4A3BB 1CA6A 4FXKC 1HRJA 4JYAQ 2CQOA 4Y7NB 1D5ZC 3QOJA 2QDBA 2JJQA 3K6OA 2FMMA 3CPWA 3CP0A 1WTRA 3TZUA 1D1IA 4JG2A 3V2TA 4YHHL 2K50A 5C4ZA 3A0JA 1YNJC 1I3QB 1EQQA 1GD7A 1XNQQ 3FRPB 2K6AA 2NVYH 3U9SA 2F0UA 4DV3Q 4IPGA 2XWBB 3ZYYX 4C3IG 3GTLB 3NP8A 1YZ6A 4OO1G 2B8FA 1SMYD 5EAYA 1LTGD 1PFNA 4BS9A 4GLXA 3DWAA 3P75A 2F3WA 4XT3B 1EWCA 3LNNA 3OIPA 4LF5L 3J81L 1EIFA 4A75A 1K3BC 3VR3A 2F0KA 1PDQA 2AQ3B 4NXNL 2B2TC 3R8BA 4TSSA 4HJ5A 4DUZQ 3MWYW 1BCPF 2VW9A 4DAYB 1X9NA 1Y1WB 3J81i 3M4YA 3I3CA 4O0AA 2A73B 4JI0Q 4LF9L 1BQQT 5FLXE 2IX3A 4HSVA 4ME3A 4OWTB 3W1BA 1BXTA 3CCUA 1HTPA 4MN3A 4RCOA 1TY2A 2L1BA 4ZRZA 1MI2A 2EJFC 3TMEA 1HUMA 1FL0A 4GKKQ 1PFSA 1EFID 4CGYB 4KY7A 3T13A 3I4MG 1CZWA 3DHQA 3DXJC 2R7FA 1VQNA 4YCWA 3C2PA 1EOTA 2WAQB 4DK1A 3TREA 2B63H 2QW7A 4JI4Q 4ID6A 4PZ8A 2HIVA 5E4WC 3KK7A 1HR0L 3OMGA 2F0HA 3KJOA 3DLLA 3M7NA 3M4OB 1EU4A 2SDFA 1WVLA 4PV1C 1PTOD 3ND9A 3R93A 1NR2A 5CR3A 5M5WB 3TRZA 3EIVA 3Q8DA 4KD4A 4GN3B 2LSSA 4A3JG 4NXML 2ID0A 5IP9G 1VQPA 1GUOA 3RLNA 2VB3X 3H15A 1RJTA 1V8QA 1X55A 3JAMc 3NSWA 1HR0W 2EYLA 3NBHB 1VQ8A 1SNMA 3HOWB 3PUWA 3BZKA 2XTIA 2CKZB 2F0MA 3S15B 1JJ2A 1BF4A 4P73A 3OWEB 3S1QB 4DV5Q 2DN8A 1GUNA 4A3MB 4L6TB 5JPNC 3R2TA 1MSHA 1M8AA 3OYYA 1CUKA 2WB1B 4JW0A 4OHJA 1KD1C 2JE6I 3HOVH 4NW2A 2NZOA 3K8AA 1X6OA 4RMFA 1C8CA 1EIGA 1L1OA 3KDFA 5IP7G 2DNCA 2RDHA 1LO5D 2K5NA 1FD7D 3BVMA 1I4XA 1QG7A 3I8ZA 1HHVA 1N34Q 1EQTA 1ENFA 4FF2A 1QB5D 3HOXG 1WCMG 4PMWA 2ZXOA 5TSSA 3BYYB 4LUVA 5CV4A 1GUGA 1STHA 4CDDC 2PZWA 1SAPA 4HJ7A 1AH9A 2RDFA 1I3QH 3CMEA 1M90C 3IFDA 1JJGA 2CW0D 3C46A 1EY5A 2I0QA 1A3UA 2L4NA 5IOCA 4BXXG 1KLUD 4R8IA 1LT5D 1T5XD 4HIOA 2E5LQ 4LWCA 5CBEE 2JA6B 2K5WA 5JPMC 1ZEQX 3TS0A 3NK9A 1LTLA 2X6LA 1N36L 1H95A 2R7DA 4YCUA 1B3QA 4KY6A 4YIJA 4NP5A 2VQFQ 4BWGB 4LF6Q 2J7ZA 5M5YB 2PNRC 3BZCA 4RGOS 1QE6A 1B9NA 1QUQB 2F0NA 3HG9A 4HMJA 3TS2A 4GN4B 3CQZB 1JC7A 1Y1WH 3PIPA 1A2TA 1VMCA 4ALPA 4AH6A 1KHIA 3I91A 5LMUL 4EQPA 5C44B 4OO1I 1W6JA 2N3SA 2UXCQ 3NWTA 2UUBQ 4I7AA 2WV6D 3D6CA 2GA4B 3SXHA 2RBMA 1F2MA 4H02A 4RG1A 4OIJA 1JQYD 4LFCQ 1ENAA 3I4LA 1IBLQ 4UAIA 3QIAA 2R7ZB 2UXDL 4DV0Q 2CHBD 2Y0SE 4A3IB 2F52A 3EA6A 5ELEA 2EY5A 3MEHA 2I5LX 2PMZB 3CCRA 1EIYB 2ZJQA 3UI2A 3M4OH 4DR6L 1SSOA 5IE8A 3K81C 1VMPA 3EBEA 3Q22A 2F0DA 5C5MA 2SNSA 4X64L 1NAPA 1VQKA 2F0VA 2E2JB 3RLOA 1E7ZA 2QILA 4KHPL 3PIO3 2TSSA 1CT1D 1OO9B 3S24A 2RSOA 3OW2A 4XT1B 3MXPA 1HNXQ 1EZ6A 3PUYA 1SMYC 1JJCB 1E24A 4ZAIA 3S1QH 5IT9c 3IRBA 5EKIA 3A8IE 2JYOA 5EJWA 2UU9L 3PGZA 3SHLA 1CQFA 2C5CA 2HCIA 5GADC 2QGQA 5I9PA 1HZ9A 2EDGA 1MBYA 4TVAB 1IKLA 1F2ZA 5C0XH 4GLVB 4DAMA 4A3KH 1VQJA 1TS3A 4AYBB 2IHEA 2MHVA 1JWMD 1IBKQ 4J6HA 4P72A 4JI5L 4DAVA 3RZOB 2EJGC 2F3IA 4U673 1VQGA 2F0PA 3K0XA 3KUPA 3UE0A 1V9PA 2EIFA 1Q1BA 5J39A 3I2ZA 5M9OA 4OX9L 1S5ED 1DOLA 1EEID 5EPLA 1EFWA 3G48A 5LL6S 3CCLA 1OXTA 1I4RA 2KBNA 3MC0B 5IYBG 1K83B 3I4NH 3FKIH 4CJ2C 4DKAC 2XNAC 4OIKA 4A3GB 2B2UC 4B3RQ 5JEAJ 1TXYA 2MQHA 4JBMA 5FO8B 1JB7A 1UEBA 2EXZA 3AU7A 4JI2Q 3T4AC 2JN4A 1SEBD 2PMZE 2E2DC 1ENCA 3J80E 1HTLD 1PH4A 1MGSA 1U4PA 3FPPA 4OGQC 1CSQA 3HOVG 2IT1A 4DAYA 3IKJA 5G3LD 5C3XA 1PTOC 1R9TB 5EQ0A 1OTCA 4JOIA 5EBCA 1PRTB 3STBD 5M5YH 3QO2A 3Q23A 3PUXA 1N32L 3RR5A 4RGTA 2PI2E 4XTCS 2A68D 4BY7H 3BU2A 2MJ8A 2LS01 1KIXA 1PA6A 1SNOA 2KHSA 1NNXA 4PQXA 4JI3Q 5EGTA 4MZ9A 3CQZH 4DR4L 2ATWA 2E75C 3H09A 3CU7A 4O42A 1TWCB 2C35B 1G91A 2K01A 5C4JB 3L2PA 3H3VC 3TEHB 5CV8A 1F9RA 2H5XA 2ZTCA 2MO1A 4QMGA 4A3JB 4GKJL 5IGEA 5C44H 3J81E 4A4IA 3FPUB 4K14A 1C48A 2PW7A 1LTTD 1V1OA 3O13A 4HCSA 3MXNA 1CQVA 3QB3A 4KD3A 2K5DA 1XTCD 2G9HD 2AUKA 3JAMi 5IGGA 3S2HB 2CH4A 1PZKD 4NPSA 4M1UB 3HOUB 2CCZA 1YHQA 2R7ZH 4EGVA 2F0GA 4A3IH 4N8FA 1D5MC 3OW7A 3HKZB 4JBJA 1O7YA 1AP0A 4V0BA 4RGMA 3NBHA 1DZ1A 4LFAQ 3EQLC 3S2DB 1XYIA 4IUQA 2IX0A 3KJPA 1Y1WG 1LYLA 2E2JH 2K05A 2QCPX 1FGBD 2CW0C 4F88A 4B3TQ 2FMCA 4CJ1B 1B2TA 2AQ1B 1ONLA 4WFN3 4JYAL 1D8LA 2X69A 4A3CG 1ICFB 4K0KQ 1RTNA 3HOXB 5DNFA 4PMCA 1WCMB 1SMXA 5JAVA 4L8JA 3S14B 3P1HA 4XXEA 5CBAE 1IZ6A 1ET9A 1SYEA 1Y1VB 3GTPB 2WAQG 1GUWA 1SYGA 1H9KA 2H4OA 2QA4A 4JI6Q 3UDIA 1XNQL 1HXYD 2LKVA 1S4ZA 1IW7D 2K14A 5IYCG 2E8GA 4DV3L 2L5TA 5KGUA 1VCIA 3K5LA 3BVZA 4CKBA 2OWOA 3DWQA 4X3KA 3S1RB 3FDTA 3U58A 2AMCB 4AIMA 1PH8A 3V96A 3BYTB 2BH2A 3B6YA 1E1OA 4NMZA 2M9VA 1L0WA 2EXDA 2FJ2A 2K75A 1K83H 2RA4A 4G57A 5FKAC 1KLGD 4JV5Q 5GQOA 2KEDA 2KEEA 4A3GH 1J5EQ 4FYDA 4IOAA 1X3PA 2IW3A 5JVH3 1XPRA 4DUZL 2I07B 3T56B 4QF4A 2WB1G 2XVSA 4YWLA 4GLAC 1KDCA 4IJLA 3TP8A 5M5XH 1RD9D 2VQEQ 4JI0L 2EOTA 3E3XA 2VUMH 5C0XG 4BBRH 1M4VA 3DWPA 4C3JB 3VA7A 4DFAA 4N8X1 3H3VH 1AZQA 2QEJC 4JI1Q 3CCSA 5GAEC 4JBKA 2O5IC 3CMAA 5CV9A 4GKKL 3NTIA 1WTPA 4KV6A 3J7ZC 1VQFA 5BN4A 4C1NI 5D14A 1OXUA 2VY3A 1MJCA 1HFGA 3I4NG 3FKIG 3BDLA 1SYCA 2EYHA 1LV9A 4JI4L 2DJFC 4H13C 1V1QA 2JP1A 1XJVA 2R3ZA 1R4PB 5K5PA 1ZKOA 3DEPA 2KUMA 4KLKA 4L63B 4LUZA 4A3DB 4LF4Q 1P16A 4IUVA 1PV4A 1JORA 2D0OA 4DR2Q 1ESRA 2JSOA 3RN2A 3NEMA 4DNIA 3T16A 4KKTA 1JOKA 4KN4C 1HFNA 1CZGA 2ENBA 1HNWQ 3I73A 1VF7A 2V4DA 1LT6D 5ELFA 3CPFA 4DV5L 2OCEA 4NDXA 4BY7G 2PI2A 4K2KA 4R4IA 3U4VA 2B63B 4RHSA 4FDBA 3KF8B 1VQMA 2A1AA 1XMOQ 1A0IA 1Q90A 5H1SE 3PO2H 3KBGA 2B2YC 4EVOA 1O7IA 2NVQH 3WOEA 2MNAA 1E2VA 3A5UA 1XPUA 5C44G 4RCNA 3IFTA 3BG3A 1KNAA 1SR3A 5GAHC 3H94A 1ILPA 4KKSA 3RMHA 1N34L 1S3OA 2Z6KA 4LFBQ 5BR8Q 3DUZA 1PZJD 2AWNA 3MA2B 4S3SA 1L0XB 3L3OC 2J0TD 2A8VA 1STBA 3RZDB 1Y1VH 3M3YH 2R7ZG 3STBC 1W3SA 2JA8H 4A3IG 3A7LA 2A68C 3J7AV 3D4WA 5J1ZA 1X3EA 4PG3A 4DGZA 2F0QA 2PW5A 1CFMA 3MXUA 3N6RA 1G291 3ZJYC 3VYTA 1CI3M 4NB3A 4I7ZC 2E5LL 1VQHA 1MIUA 1V1PB 4DV2Q 3HKSA 2FINB 1VQ6A 3CRLC 3D4RA 5C5LA 1DOKA 4HIKA 3PIOA 5M3MB 4QL5A 3A8JE 3G71A 2R61A 2D2CC 4K6DA 2RF4A 3F1ZA 2VQFL 4LF6L 3G6JB 5GAGC 4C3HH 2MO0A 4R4TA 4WRDA 1O80A 1CKOA 2ASBA 1PRTF 5DAUA 3LGJA 1STNA 1ASZA 4AQYQ 3OMCA 1U0LA 3E6ZX 1JE4A 4IFDH 1AZPA 3S9WA 2F0FA 2IPKD 5AFWA 2A6ED 3NPPA 4OWXB 5D65A 4AYBG 5JJZA 4C3JH 2A5HA 4N9TA 1GXDC 1YNXA 3EFXD 2UXCL 4DK6C 2HHHQ 2UUBL 1CHQD 5C4XH 2UUAQ 3SGIA 4LFCL 4RFBA 2H1EA 1IBLL 1TKWB 4IN3A 1STYA 3DM1A 1EY7A 4DV0L 4FP5D 3AQQA 4A3EB 1Y8PB 1PH3A 2CWAA 3GTQH 4A3GG 1Q8KA 2RKSA 1UWVA 2ZM6L 4DR7Q 4A3DH 5C0XI 1M1KC 1BBUA 2B8GA 1CSPA 2F3VA 2IJ0A 1LM0A 2K5VA 3CCMA 3KLRA 1SDFA 2KCNA 1D7QA 1K0RA 4HSPA 2VUMG 3KF6B 1U4RA 2F4VQ 1HNXL 5LL6X 1B1ZA 1C0AA 2R6GA 2F0IA 1K28A 3Q24A 4Q0FA 3GTJB 1T5EA 2X6GA 2LXKA 2CFMA 3CC2A 3J81j 4ME5A 1B4OA 1WD1A 4G7OC 1TS2A 1GUTA 3NTKA 2KVMA 3TBIB 1YJ9A 2D9UA 2ZTEA 5CV7A 4QUCA 5JEAH 4DUYQ 1IBKL 4K5VA 3ERQA 4DXGA 1SXTA 1YNNC 2WIIB 5HY6A 4POFA 2A19A 2K5HA 5J3BA 1BVSA 3KLSX 4APVA 1RKNA 2GVAA 3ONAB 2NN6H 3HOYB 2VZAA 5JJLA 1VQCA 1HNZQ 3HOUG 1MD2D 3RZDH 4QIWB 3QG1A 2Q8TA 1BBWA 4KY5A 2L15A 5FLXc 1E22A 2Q2IA 4B3RL 1A8VA 2HIXA 1UUPA 4JI2L 3HKZG 2NVTH 1XMQL 5LHY1 4L5QA 5HURA 2OQKA 3GV6A 3I7FA 3CF5A 4A3KB 1QVCA 1IL8A 2DY7A 1ML0D 3PO2G 1K0SA 1YHAA 3D8GA 3KFUA 3A8KE 4G7HC 1PRTD 3GTKH 5M3MH 3VR2A 3Q0AA 4IUUA 4C1NK 3K7UC 4POGA 1HA6A 1VQ7A 1H9SB 2M2LA 5ELOA 1RIPA 3OSOA 1Q81C 3FP9A 5FJ8H 3I4NB 4LF7Q 3FKIB 4JI3L 1CHPD 1NE3A 2K7VA 3J7AF 2WAQE 2SEBD 1RODA 3S16B 1Y1VG 1EY8A 2BE5D 3BS1A 2AWOA 1AW7A 2NB0A 4UP7A 1TVXA 3I72A 4Q5VA 2NWGA 1SE2A 3BVGA 2YV5A 3K5OA 3NTHA 2XRSD 1NCVA 4GNXC 3NELA 4UP9A 3S1NB 5IGFA 2A69D 5DEHA 5A2QL 1BCPD 2XN9C 1PH1A 4K8IA 4R1JA 1TS4A 4RWSC 2MUYA 4R4CA 4A3EH 1TIID 4O1NA 4BY7B 3R2IA 2B2WC 4CKEA 1HH2P 3PSIA 4ZCKA 5IY0A 4LFAL 1JOOA 2I5HA 4DV1Q 1PMRA 2KHIA 1L0YB 2EY1A 1G8ZD 2WB1E 1ZYRD 4I65A 1VQ5A 3X3MA 5KYIA 1X54A 2F1MA 4IFDG 1ESFA 1AEXA 2OT2A 1V43A 4B3TL 3L9AX 1E0BA 3KF8A 4UPAA 1SE3A 3QR8A 1B7YB 3T1YQ 4C3JG 1OXXK 1GO3E 1EU3A 4K0KL 4OXPA 1EY9A 3GTJH 2F0LA 2KECA 1KAAA 1LTRD 2BH8A 1X56A 4KN7C 5CYUA 3CCVA 1EWHA 2RVLA 2P5ZX 4JI7Q 3VR6A 4HIMA 4BY1H 4JI6L 1X65A 2K28A 3PUVA 1LACA 3NHHA 1Y8OB 4YY3Q 1GM5A 2EPBA 4IZ8A 4RGNA 1W2BA 4A3DG 3NQTA 3RNUA 1J6QA 1Y8NB 4ZQ3A 3I90A 2A6EC 2Q8IB 3A5ZB 3HOYH 1Q3LA 1WTQA 1I4HA 3H3VI 2DNEA 3SVMA 1V1PA 1VQOA 4H0LC 1VS0A 1SN8A 4JV5L 3H6MA 1B53A 1HZCA 2SOBA 2QKIC 2JA5B 3M85A 2WFWA 4HAEA 4HR7B 5E1FA 1SE8A 2B63G 2L11A 1IYVA 1Z6HA 2V1CC 3BDOA 1K73C 2VQEL 3F2UA 3TZDA 1N33Q 1IHZA 1Z47A 3A54A 5CV6A 5CC4A 5JEAG 3MAQA 4JI1L 4GS3A 2YU9H 1SNQA 4X66Q 2B2TA 2VL6A 4DK3C 4DR1Q 2XWJB 1O7LA 1EZ8A 2EE1A 3T51B 1F9QA 3A55A 4JPBW 1PTOB 3S16H 4HEDA 1WYDA 3CRKC 3T1HQ 1HJPA 4IUTA 4RKBA 1STEA 2WP8J 1RHPA 1U4MA 4XQNA 2D5DA 1TWHB 2B3GA 1UNSA 4TQUS 1E2ZA 2DY8A 2I5MX 3QOLA 4LF4L 5M5XB 4IUNA 3G4SA 4OWWB 3S1NH 2VUMB 1QVGA 2UUCL 1HUNA 4BBRB 3K7AB 1GHJA 1II3A 3TQYA 4DR5Q 2VNUD 4DR2L 1WTXA 2Q2TA 5KIXA 2QDLA 3L7ZC 4BA1I 1K8GA 5M3MG 5J22A 4BBSB 2B2VA 1HNWL 2M00A 2YYZA 2WKCA 3I4OA 4HMIA 3G6EA 1HA5A 3M9BA 5FJ8G 3MFYA 4GOPC 1YEZA 1G6ZA 1XMOL 5LMNQ 4Z9CB 3JAML 2ES2A 3P20A 1JICA 2L12A 1BDOA 1D1KA 4AYBE 1Q1EA 3PQIA 5HGTA 1IBMQ 2IX1A 1XTDA 3GTGH 2RHQB 2VXWA 5FLXL 1VQLA 1JWSD 1TWFB 2HD3A 4LAAA 4IO9A 2ICIA 2G9DA 3PCOB 1EUJA 4LFBL 1D6EC 5BR8L 2G5DA 1HCZA 4JCVE 1WTVA 2XSCA 3J80c 1R4QB 1PH5A 2JA9A 1BO0A 4L5TA 1HZAA 5KNCA 4A3EG 3I70A 3MZ5A 2F0TA 3J7A5 3M4QA 3AEVA 1N36Q 5KRUA 2KA7A 1FJGQ 1SLJA 1B9MA 4IFDI 2PZUA 1VF5C 3F2CA 3AFQA 2KJXA 4JBWA 3K80C 2KCCA 3PO2B 3CHBD 2AQ2B 2MP1A 2NVQB 4B3MQ 4DV2L 2OTJA 4X6AH 4EX5A 1KNEA 2O4XA 4DU9A 2AHOB 2Z0SA 4NKLA 5I6YA 4K5XA 1LT4D 5ELNA 1VQAA 4P74A 3D4DA 4KHZA 1Q8IA 2A69C 1LT3D 3J81c 2JA5H 1XX8A 1BCPC 2L9HA 2MGSA 1GVPA 3M3YB 1H9SA 2TMPA 1TWGH 2ZT9C 3TP6A 3KLWA 4AQYL 2C9OA 1EY0A 2Z8LA 2EZVA 4ZUJA 2JA8B 2IHFA 1JMCA 1LABA 1CA5A 3CC4A 1G51A 2JA7H 3DMUA 2KENA 1KL9A 2NTSA 1WTWA 3OHXC 1NTGA 1K9MC 5IWAQ 1ZYRC 2PPBC 1PVOA 1EYAA 4V190 1JWUD 4P2CB 4DPGA 3SK4A 1VDZA 3C1FA 2Z1CA 4KTAA 3TP5A 4HJ9A 5CGKA 3KLSA 5CV5A 4CDCC 3HOYG 3TSSA 1FNVA 1TS5A 3CW2C 5C3EH 2ZTDA 4PZ7A 1BBXC 4C3HB 4OO1H 1PTOH 3ITPA 1QOHA 1VQIA 4LF8Q 3E9HA 1LTAD 3F8TA 1C7YA 3HKZE 1TWHH 4DR7L 2F03A 1PYBA 4ULLA 1QUQA 2KCTA 1O7ZA 4A3KG 4KK7A 1EY4A 3K7AH 4B08A 4QY7A 1U9RA 2JK8A 1GJXA 2F4VL 5AJ3Q 2K52A 1PFBA 4BBSH 5C4XB 5KEEA 3NQIA 4A93B 2E2HB 3C1EA 1GOZA 2HCCA 1X3GA 5COYA 1KRTA 1C4QA 4LJZC 2LFNA 1KC8C 3IL8A 1OXVA 3F2BA 4ODGA 2Z6BA 5FLMH 1A15A 3GTQB 5A2QE 4TKOB 1A3VA 4DV6Q 3AMUA 4L5SA 5K36H 3UE1A 1L1OC 1KXLA 4ZKBB 3I4MH 4LUOA 2DUDA 2PQAB 4DUYL 4R4QA 4CBVA 5IT9L 5C0XJ 3X3NA 1BNZA 1TWFH 3H91A 3K59A 1QILA 3K0YA 4UDUC 4CDFC 4DV4Q 4GN5A 5DM73 1NMGA 2EYJA 2K32A 3I55A 1HNZL 1RF2D 1PH9A 3T53B 1KABA 1BUVT 2BOSA 3D31A 3OWFA 4B9WA 1RL2A 1XWEA 1GHKA 1Q12A 3M4PA 2FXQA 2KCMA 1KTKA 1RDPD 3SR1A 2BA0A 1WOCA 3HOZB 5ELDA 1IYUA 3JC66 4MTNA 1SYFA 2FHTA 1I6HH 4YWMA 1SRUA 3BZDB 2XGTA 2F0SA 1KDBA 2IY5B 4XYQA 3TP7A 3DM3A 5IIFA 1A6XA 1YJWA 4DNTB 1EL0A 1YHBA 2F0EA 2NTTA 1K3RA 2N55A 3K5MA 4WJ3M 3CXCA 4LK1C 1TWAH 1SNDA 1JR0D 1PYSB 2VS1A 2B2UA 3PV0A 3NENA 4HCEA 5IP7H 1NUCA 4LF7L 1DYQA 1JB3A 4R8NA 3FVQA 1PH7A 4PZ6A 3CCQA 3IAYA 1WD0A 2Z4IA 1DCZA 2NVTB 2R93H 1JE5A 3UDXA 4ZUIA 4ABNA 1JOQA 2PO4A 2JEBI 3MHBA 1YVCA 1IL2A 1ICWA 4X65Q 2F0OA 3RUZA 1H9MA 4IPDA 4MTKA 3GTKB 4RKLA 1SJHD 3K5NA 2K4KA 1KRSA 1ILQA 2XRQD 3HGBA 1K8MA 5HGQA 4H7BA 4FF3A 1I5FA 3FEWX 1X3QA 3ERSX 3D3RA 3HP3A 2JA5G 3Q6SA 4IQZA 5NUCA 1K8OA 4A3LH 4DV1L 1TQOA 2I46A 2KHJA 1IYJB 5T1IA 1EQRA 2L55A 1UE7A 3J80L 4A3FH 2QEXA 4KI0A 2JA7G 4IJHA 1ET6A 3T1YL 3S1MH 4B9XA 2BCOA 2R92H 4YCVA 4PMBA 1RTOA 2E2HH 4A93H 3GTOB 4CKCA 1E3PA 1F2LA 3J80i 4JVZA 5C3WA 2Z9HA 2PZTA 4B3SQ 4JI7L 3MFGA 5C3EG 3PMFA 1Q46A 1STAA 3GD7A 1LUZA 1XNRQ 1G2TA 1DOMA 3NE5B 4LMQD 4YY3L 1GUSA 2PYKA 4FXGC 2Q2HA 3I56A 1QNUA 1MHWC 1DM0B 1A63A 3OIQA 5D3DA 2GVBA 1IW7C 4BBRG 2K5QA 4MHEA 3F2DA 1EQVA 2OEOA 3JAME 1N8RC 1A3TA 1DXMA 4DV7Q 4BBSG 3KBXA 2ZJPA 4WJ4A 1D2BA 2E74C 4X62Q 3HOZH 2KOLA 4BY1B 4JI8Q 5FLMG 1UAPA 4O2DA 3PO3H 5K36G 2CQAA 1N33L 5FO9B 3H0GH 3L0OA 3S17H 4JOIC 3QJYA 3U4ZA 4QB4A 2B2VC 1AE2A 4MIUA 3UDGA 1SNCA 3VYUA 1MSGA 4X66L 3URYA 1PH6A 1FNWA 3MXNB 4DR1L 1B3AA 1EIHA 3SK8A 3SE0A 1SFOH 3ULPA 1EYCA 3T1HL 4HJAA 1E2WA 4UP8A 4K8JA 4HJ8A 3PF4A 3GQBA 3CD6A 5IYBH 3W2DA 2D62A 5DLQE 4EQOA 2EYFA 3GTMH 1PXUA 1DONA 4DR5L 5E4XA 1SE4A 1ASYA 4M8AA 2NBFA 4JC0A 4CDEC 2EYMA 1S5DD 2K04A 2YU9B 1I94Q 4K6LA 4G7ZC 4UY8C 4R9WA 2KQ3A 2N88A 2EY2A 4GNXB 4H44C 3OTOQ 4A3BH 1FGUA 4FVMA 2O5JC 4DR3Q 2JEAI 1N9WA 1QCBD 1OXSC 1QJOA 3E5SA 4Y7NH 2UXBQ 2JA8G 5LMNL 1DD2A 4XQQA 1VQBA 5IODA 3PUZA 2R93G 4WJWA 1IBML 2Y0SB 5FOBB 3NXWA 4RH6A 3ER0A 5KNBA 1Y69U 3HZXA 3GTOH 1AFPA 2PQAA 1EEFD 5LMNW 4R4OA 2EJMA 3WOFA 1QVFA 1B70B 2A6HD 1C9OA 2DGYA 3R3OA 2YTXA 3LX0A 1A2UA 3GTLH 4ZKCB 1H9RA 4OEMB 4QIWE 4C3HG 2B2YA 3EN2A 5ELCA 1Q7YC 1QWYA 1YIJA 2ALYB 3G7LA 1FJGL 1KQSA 4A3LG 2L0CA 2RSNA 1I4GA 2NZHA 1GKHA 4B3ML 1CK1A 3GTGB 5G3LF 4A3FG 2NVXB 4YHHQ 1TU2B 3ICEA 5M3FB 3MTSA 1LLRD 4G4KA 5C4XG 1IXRA 2XIWA 2R92G 3FHWA 3K57A 4A93G 1EYGA 4QCLA 3DEOA 3U9OA 5IT9E 4DNRB 3VYSA 3CCJA 4A3CH 5JJKA 3SEBA 1Y14B 1HPCA 2EYPA 2PNHA 1CKMA 1CTMA 1YJNA 3AFPA 3E0JA 4LF5Q 1HZBA 4IFDJ 1FVIA 5IWAL 4HIDA 1SBBB 4NXNQ 4LW1A 2A74C 4JK1C 2K1BA 2OXPA 3GDEA 1EYDA 4KKUA 5IYCH 2ZM6Q 2F0JA 5M5WH 4QUFA 2NZ1D 1J5EL 2BA1A 1NSNS 4KHVA 4LF9Q 5EKLA 1CKNB 3RLFA 4LF8L 1JT8A 1TWGB 2CWPA 3HOZG 2BDOA 2HQEA 2OQ0A 4XYOA 4A76A 5E3FA 5GROA 3LWUA 3CC7A 4E6IA 3HOWH 4L5RC 2JA7B 1FNUA 1DJRD 1SROA 2BDNA 3S15H 4OONA 2ZJRA 1S5FD 5IGBA 4A3MH 3PO3G 3SK5A 1WI5A 3H0GG 5AJ3L 3HEJA 3HS0C 4QQBX 5EKKA 1HR0Q 5I2YA 1QNKA 2NN6G 1QZGA 1CM9A 1PFMA 4C3IB 4RHRA 5C3EB 3GV3A 1HQRD 3EVQA 4KMUC 3NBIA 2HDLA 4NXMQ 1F77A 5IYDH 4FF4A 3P7JA 2GN5A 4DV6L 4WORA 3AB9A 1B44D 1U4LA 4FXDA 2IWHA 1UE5A 4RAUC 2NUCA 5EBDA 1D5XC 2RCNA 2Z6KC 1W6KA 4GOPB 3VA5A 4HTHA 4DV4L 2LMCB 5BN3A 2HUGA 3W3AA 4C2MB 1XMQQ 2CVRA 3KF6A 1ZXTA 2JA6H 2N78A 1J9OA 2WKDA 3BDCA 2O2LD 3CCEA 5F2DA 2ICEC 1F9PA 1PZID 5BN5A 3VR5A 1Q82C 1EOVA 2B39A 3OPOA 5EPKA 4A3BG 3N52A
chains in the Genus database with same CATH topology
3I4MB 4X3TA 4DN4M 1SYBA 4DA2A 2JXMB 3ND8A 2PQEA 2QF7A 3A7AB 5ISRA 1PRTC 5JOBA 5FK9C 3NUCA 3MXGA 3M7GA 1AN8A 2RQXA 4BA2I 1RCVD 4C56C 3J7YW 4J1MA 5D3IB 3VR4A 4U68A 1I6HB 2Q8RE 2BE5C 1BCPB 1SYDA 3SDZA 1XXGA 1YNJD 1S5CD 1LTSD 2EYOA 4X3UA 3CKIB 1TWAB 1LTBD 2F4IA 4CHTB 2WACA 3HRZC 4FNFA 1PLFA 2ZXPA 2A6HC 5C4HA 2Z4HA 1I4PA 2E2IB 4J8QA 3VYRA 2AUJD 4EQNA 2R93B 1EY6A 1I50B 3SK6A 4CJ0B 1SNPA 1Z7TA 3WDNA 4IALA 5I9OA 1BR9A 1STGA 4KJOA 1S5BD 4DXFA 4DF7A 2B2WA 4IURA 4N9PA 1X32A 1F2YA 3EJIA 3RD4A 4IUPA 4K2LA 3D6WA 4RA8A 3FMCA 2J4XA 2WINB 5JVG3 4HN7A 1G2SA 1UEAB 4X3SA 5I6WA 1F9SA 5T1GA 4A3FB 3GP7A 4FF1A 3PIP3 4XDXA 4ZYSA 2LY7A 3S1MB 2R92B 4DAPA 2NN6I 5KNDA 1YNND 3MVVA 2NVYB 4XIGS 3NWSA 4PNYA 2FFKB 5DM63 3V05A 2K33A 3A56A 3EROA 1JCKB 1SJED 5I2XA 5C6AA 2E76C 2K03A 5EPJA 4F7XA 3TDQA 1TT2A 3LWEA 2VB2X 4ILWA 4FO2A 1FYCA 5KYLA 1J8IA 1FR3A 2EY6A 3C3LA 1IKMA 5IGCA 2ZXRA 1B50A 2OF1A 3QWNA 4OL7A 2PCFB 1WTOA 3PO3B 5FO7B 2RDGA 4ZLTF 3H0GB 1LTID 3S17B 3TN2A 4XQJA 1HQMC 5CORA 3OOCA 5IGDA 2EVBA 1PYWD 2F0WA 2NYZD 1H9JA 4ZK9B 2HDMA 3K58A 1SFOB 1I6VC 5ELBA 1BOSA 1TY0A 1KDAA 1NR4A 1PTOF 1I4QA 2IL8A 2MPMA 5I4DA 3GTMB 5A35A 4TRDA 4DK0A 2SNMA 4F87A 4GZYC 5CMDA 1TR5A 1O78A 4KJNA 4F8MA 3HOVB 4K5WA 3GO5A 4A3BB 1CA6A 4FXKC 1HRJA 4Y7NB 1D5ZC 3QOJA 2QDBA 3K6OA 2FMMA 1WTRA 3TZUA 1D1IA 3V2TA 5C4ZA 1YNJC 1I3QB 3FRPB 2K6AA 3U9SA 2F0UA 2XWBB 3ZYYX 4C3IG 3GTLB 3NP8A 4OO1G 2B8FA 1SMYD 1LTGD 1PFNA 4BS9A 3DWAA 3P75A 2F3WA 4XT3B 1EWCA 3LNNA 3OIPA 3J81L 3VR3A 2F0KA 1PDQA 2AQ3B 2B2TC 3R8BA 4TSSA 3MWYW 1BCPF 1Y1WB 3M4YA 3I3CA 2A73B 1BQQT 5FLXE 2IX3A 4HSVA 1BXTA 1HTPA 4MN3A 4RCOA 1TY2A 2L1BA 4ZRZA 1MI2A 2EJFC 3TMEA 1HUMA 1EFID 4CGYB 4KY7A 3T13A 1CZWA 3DHQA 3DXJC 3C2PA 1EOTA 2WAQB 4DK1A 4ID6A 5E4WC 3KK7A 3OMGA 2F0HA 3M4OB 3M7NA 1EU4A 2SDFA 1WVLA 4PV1C 1PTOD 3ND9A 3R93A 1NR2A 5CR3A 5M5WB 4KD4A 2ID0A 1GUOA 2VB3X 1RJTA 1V8QA 3NSWA 2EYLA 1SNMA 3HOWB 3PUWA 2F0MA 3S15B 1BF4A 3OWEB 3S1QB 2DN8A 1GUNA 4A3MB 4L6TB 5JPNC 3R2TA 1MSHA 1M8AA 2WB1B 4OHJA 2JE6I 4NW2A 1C8CA 1EIGA 2DNCA 2RDHA 1LO5D 1FD7D 3BVMA 1I4XA 1QG7A 3I8ZA 1HHVA 1EQTA 1ENFA 4FF2A 1QB5D 4PMWA 2ZXOA 5TSSA 3BYYB 5CV4A 1GUGA 1STHA 2PZWA 1SAPA 2RDFA 3IFDA 2CW0D 3C46A 1EY5A 1A3UA 2L4NA 5IOCA 1KLUD 4R8IA 1LT5D 1T5XD 5CBEE 2JA6B 2K5WA 5JPMC 1ZEQX 3NK9A 2X6LA 4YIJA 4KY6A 4NP5A 5M5YB 4BWGB 2J7ZA 2PNRC 4RGOS 1QE6A 1B9NA 2F0NA 3HG9A 4HMJA 3CQZB 1JC7A 1A2TA 1VMCA 3I91A 4EQPA 5C44B 4OO1I 1W6JA 3NWTA 2WV6D 3D6CA 2GA4B 3SXHA 2RBMA 1F2MA 4OIJA 1JQYD 1ENAA 3I4LA 4UAIA 3QIAA 2R7ZB 2CHBD 4A3IB 3EA6A 5ELEA 2EY5A 3MEHA 2PMZB 3UI2A 1SSOA 1VMPA 3Q22A 2F0DA 5C5MA 2SNSA 1NAPA 2F0VA 2E2JB 2QILA 3PIO3 2TSSA 1CT1D 1OO9B 2RSOA 4XT1B 3MXPA 1EZ6A 3PUYA 1SMYC 4ZAIA 5EKIA 3A8IE 2JYOA 5EJWA 3SHLA 1CQFA 2C5CA 2HCIA 5I9PA 2EDGA 1MBYA 1IKLA 1F2ZA 5C0XH 1TS3A 4AYBB 2MHVA 1JWMD 4J6HA 4DAVA 3RZOB 2EJGC 4U673 3KUPA 2F0PA 5J39A 1Q1BA 5M9OA 1S5ED 1DOLA 1EEID 5EPLA 5LL6S 1OXTA 1I4RA 3MC0B 1K83B 4CJ2C 2XNAC 4OIKA 4A3GB 2B2UC 5JEAJ 5FO8B 2EXZA 3AU7A 3T4AC 1SEBD 2E2DC 1ENCA 3J80E 1HTLD 1MGSA 1U4PA 3FPPA 4OGQC 2IT1A 4DAYA 3IKJA 5G3LD 5C3XA 1PTOC 1R9TB 5EQ0A 5EBCA 1PRTB 3Q23A 3QO2A 3PUXA 4RGTA 4XTCS 2A68D 2MJ8A 2LS01 1SNOA 2KHSA 4PQXA 5EGTA 2E75C 3CU7A 3H09A 4O42A 1TWCB 1G91A 2K01A 5C4JB 3H3VC 5CV8A 1F9RA 4QMGA 4A3JB 5IGEA 3J81E 3FPUB 4K14A 1C48A 2PW7A 1LTTD 1V1OA 3O13A 4HCSA 3MXNA 1CQVA 3QB3A 4KD3A 2K5DA 1XTCD 2G9HD 2AUKA 5IGGA 3S2HB 1PZKD 4M1UB 3HOUB 4EGVA 2F0GA 1D5MC 3OW7A 3HKZB 1O7YA 1AP0A 4V0BA 4RGMA 3NBHA 1DZ1A 3EQLC 3S2DB 1XYIA 4IUQA 2IX0A 2K05A 2QCPX 1FGBD 2CW0C 4F88A 2FMCA 4CJ1B 1B2TA 2AQ1B 1ONLA 4WFN3 2X69A 1RTNA 3HOXB 5DNFA 4PMCA 1WCMB 5JAVA 4L8JA 3S14B 3P1HA 4XXEA 5CBAE 1ET9A 1SYEA 1GUWA 1Y1VB 3GTPB 1SYGA 1H9KA 2H4OA 1HXYD 2LKVA 1S4ZA 1IW7D 2L5TA 5KGUA 1VCIA 3K5LA 3BVZA 4CKBA 3DWQA 4X3KA 3S1RB 3FDTA 3V96A 3BYTB 4NMZA 2M9VA 2FJ2A 2RA4A 4G57A 5FKAC 1KLGD 2KEDA 2KEEA 4FYDA 1X3PA 2IW3A 5JVH3 2I07B 3T56B 4QF4A 2XVSA 1KDCA 3TP8A 1RD9D 2EOTA 5C0XG 1M4VA 3DWPA 4C3JB 3VA7A 4DFAA 1AZQA 2QEJC 2O5IC 5CV9A 3NTIA 1WTPA 4KV6A 5BN4A 4C1NI 5D14A 1OXUA 1HFGA 3BDLA 1SYCA 2EYHA 1LV9A 4H13C 2JP1A 2R3ZA 1R4PB 5K5PA 1ZKOA 3DEPA 2KUMA 4L63B 4A3DB 4IUVA 1JORA 1ESRA 2JSOA 3T16A 4KKTA 1JOKA 4KN4C 1HFNA 1CZGA 2ENBA 3I73A 1VF7A 2V4DA 1LT6D 5ELFA 4NDXA 4K2KA 2B63B 4RHSA 1Q90A 3KBGA 2B2YC 4EVOA 3WOEA 1E2VA 4RCNA 3IFTA 3BG3A 1KNAA 3H94A 1ILPA 4KKSA 3RMHA 3DUZA 1PZJD 2AWNA 3MA2B 4S3SA 1L0XB 2J0TD 3L3OC 1STBA 3RZDB 3A7LA 2A68C 3J7AV 3D4WA 5J1ZA 4DGZA 2F0QA 2PW5A 1CFMA 3MXUA 3N6RA 1G291 3VYTA 1CI3M 4I7ZC 1V1PB 2FINB 3CRLC 3D4RA 5C5LA 1DOKA 5M3MB 3A8JE 2R61A 2D2CC 4K6DA 3G6JB 4WRDA 1O80A 1PRTF 5DAUA 1STNA 3OMCA 3E6ZX 1JE4A 4IFDH 1AZPA 3S9WA 2F0FA 2IPKD 5AFWA 2A6ED 3NPPA 5D65A 5JJZA 2A5HA 4N9TA 1GXDC 3EFXD 1CHQD 4RFBA 2H1EA 1TKWB 4IN3A 1STYA 3DM1A 1EY7A 4FP5D 4A3EB 1Y8PB 2RKSA 5C0XI 2B8GA 2IJ0A 2F3VA 3KLRA 1SDFA 2KCNA 4HSPA 1U4RA 5LL6X 1B1ZA 2R6GA 2F0IA 3Q24A 4Q0FA 3GTJB 1T5EA 2X6GA 4ME5A 1B4OA 1WD1A 4G7OC 1TS2A 1GUTA 3NTKA 2KVMA 3TBIB 2D9UA 5CV7A 4QUCA 5JEAH 4K5VA 3ERQA 4DXGA 1SXTA 1YNNC 2WIIB 3KLSX 1RKNA 3ONAB 2NN6H 3HOYB 1MD2D 4QIWB 3QG1A 2Q8TA 4KY5A 1UUPA 5LHY1 5HURA 3GV6A 4A3KB 1IL8A 2DY7A 1ML0D 3D8GA 3A8KE 4G7HC 1PRTD 3VR2A 3Q0AA 4IUUA 4C1NK 1HA6A 1H9SB 2M2LA 3OSOA 3I4NB 3FKIB 1CHPD 2K7VA 3J7AF 2SEBD 1RODA 3S16B 1EY8A 2BE5D 3BS1A 2AWOA 1AW7A 2NB0A 1TVXA 3I72A 4Q5VA 2NWGA 1SE2A 3BVGA 3K5OA 3NTHA 2XRSD 1NCVA 3S1NB 5IGFA 2A69D 5DEHA 5A2QL 1BCPD 2XN9C 4K8IA 1TS4A 4RWSC 2MUYA 1TIID 4O1NA 4BY7B 3R2IA 2B2WC 4CKEA 1JOOA 1PMRA 1L0YB 2EY1A 1G8ZD 1ZYRD 4I65A 3X3MA 5KYIA 2F1MA 4IFDG 1ESFA 1AEXA 2OT2A 1V43A 3L9AX 1E0BA 3KF8A 1SE3A 4C3JG 1OXXK 1EU3A 1EY9A 2F0LA 2KECA 1KAAA 1LTRD 4KN7C 5CYUA 1EWHA 2RVLA 3VR6A 2K28A 3PUVA 1LACA 3NHHA 1Y8OB 2EPBA 4IZ8A 4RGNA 3NQTA 1Y8NB 4ZQ3A 3I90A 2A6EC 2Q8IB 1Q3LA 1WTQA 1I4HA 2DNEA 3SVMA 1V1PA 4H0LC 3H6MA 1B53A 2SOBA 2QKIC 2JA5B 3M85A 4HAEA 4HR7B 5E1FA 2L11A 1IYVA 1Z6HA 3BDOA 3F2UA 3TZDA 1IHZA 1Z47A 3A54A 5CV6A 5CC4A 5JEAG 3MAQA 1SNQA 2B2TA 2XWJB 1O7LA 1EZ8A 2EE1A 3T51B 1F9QA 3A55A 1PTOB 4HEDA 3CRKC 4IUTA 4RKBA 1STEA 2WP8J 1RHPA 1U4MA 4XQNA 2D5DA 1TWHB 1UNSA 4TQUS 1E2ZA 2DY8A 3QOLA 5M5XB 4IUNA 2VUMB 1HUNA 4BBRB 3K7AB 1GHJA 1II3A 2VNUD 1WTXA 5KIXA 3L7ZC 4BA1I 4BBSB 5J22A 2B2VA 2M00A 2YYZA 2WKCA 4HMIA 1HA5A 3MFYA 1G6ZA 4Z9CB 3JAML 3P20A 1JICA 2L12A 1BDOA 1D1KA 1Q1EA 5HGTA 2IX1A 2VXWA 5FLXL 1JWSD 1TWFB 4LAAA 2ICIA 2G9DA 1D6EC 1HCZA 1WTVA 2XSCA 1R4QB 1BO0A 5KNCA 3I70A 3MZ5A 2F0TA 5KRUA 2KA7A 1B9MA 4IFDI 2PZUA 1VF5C 2KJXA 4JBWA 2KCCA 3PO2B 3CHBD 2AQ2B 2MP1A 2NVQB 1KNEA 2O4XA 4DU9A 4NKLA 5I6YA 4K5XA 1LT4D 3D4DA 4KHZA 1Q8IA 2A69C 1LT3D 1XX8A 1BCPC 2L9HA 2MGSA 3M3YB 1H9SA 2TMPA 3TP6A 2ZT9C 2EZVA 2C9OA 1EY0A 2Z8LA 4ZUJA 2JA8B 1LABA 1CA5A 3DMUA 2NTSA 1WTWA 3OHXC 1ZYRC 2PPBC 1EYAA 4V190 1JWUD 4P2CB 3SK4A 1VDZA 3C1FA 2Z1CA 4KTAA 3TP5A 5CGKA 3KLSA 5CV5A 3TSSA 1FNVA 1TS5A 1BBXC 4C3HB 4OO1H 1PTOH 3ITPA 1QOHA 1LTAD 2F03A 4ULLA 1O7ZA 4KK7A 1EY4A 4B08A 1U9RA 1GJXA 1PFBA 5C4XB 5KEEA 3NQIA 4A93B 2E2HB 3C1EA 1GOZA 2HCCA 5COYA 1C4QA 4LJZC 2LFNA 3IL8A 1OXVA 4ODGA 1A15A 3GTQB 5A2QE 4TKOB 1A3VA 3AMUA 5K36H 4ZKBB 4CBVA 5IT9L 5C0XJ 3X3NA 1BNZA 3H91A 3K59A 1QILA 3K0YA 4UDUC 5DM73 2EYJA 2K32A 1RF2D 3T53B 1KABA 1BUVT 2BOSA 3D31A 3OWFA 4B9WA 1XWEA 1GHKA 1Q12A 3SR1A 3HOZB 1KTKA 1RDPD 2BA0A 5ELDA 1IYUA 1SYFA 2FHTA 3BZDB 2F0SA 1KDBA 4XYQA 3TP7A 5IIFA 1A6XA 4DNTB 1EL0A 2F0EA 2NTTA 2N55A 3K5MA 4LK1C 1SNDA 1JR0D 2B2UA 3PV0A 4HCEA 1NUCA 1DYQA 1JB3A 4R8NA 3FVQA 3IAYA 1WD0A 2Z4IA 1DCZA 2NVTB 4ZUIA 4ABNA 1JOQA 2PO4A 2JEBI 3MHBA 1ICWA 2F0OA 3RUZA 1H9MA 3GTKB 4RKLA 1SJHD 3K5NA 1ILQA 2XRQD 3HGBA 1K8MA 4H7BA 4FF3A 3FEWX 1X3QA 3D3RA 3HP3A 3Q6SA 4IQZA 5NUCA 1K8OA 1TQOA 2I46A 5T1IA 2L55A 3J80L 4KI0A 1ET6A 4B9XA 2BCOA 4PMBA 1RTOA 3GTOB 4CKCA 1F2LA 5C3WA 2PZTA 3MFGA 3PMFA 1STAA 3GD7A 1G2TA 1DOMA 3NE5B 4LMQD 1GUSA 2PYKA 4FXGC 1QNUA 1DM0B 3OIQA 5D3DA 1IW7C 2K5QA 4MHEA 1EQVA 2OEOA 3JAME 1A3TA 1DXMA 3KBXA 1D2BA 2E74C 2KOLA 4BY1B 1UAPA 5K36G 2CQAA 5FO9B 3QJYA 4QB4A 2B2VC 4MIUA 1SNCA 3VYUA 1MSGA 3URYA 1FNWA 1B3AA 1EIHA 3SK8A 3SE0A 1EYCA 1E2WA 4K8JA 3GQBA 3W2DA 2D62A 4EQOA 2EYFA 1PXUA 1DONA 5E4XA 1SE4A 4M8AA 2NBFA 2EYMA 1S5DD 2K04A 2YU9B 4K6LA 4G7ZC 4R9WA 2KQ3A 2N88A 2EY2A 4H44C 2O5JC 4FVMA 2JEAI 1QCBD 1OXSC 1QJOA 3E5SA 1DD2A 4XQQA 5IODA 3PUZA 4WJWA 2Y0SB 5FOBB 3NXWA 4RH6A 5KNBA 1Y69U 3HZXA 1AFPA 1EEFD 2EJMA 3WOFA 2A6HD 3R3OA 3LX0A 1A2UA 4ZKCB 1H9RA 4C3HG 2B2YA 5ELCA 1QWYA 3G7LA 2L0CA 2RSNA 1I4GA 1CK1A 3GTGB 5G3LF 2NVXB 1TU2B 5M3FB 3MTSA 1LLRD 4G4KA 2XIWA 3K57A 4QCLA 3DEOA 3U9OA 5IT9E 4DNRB 3VYSA 3SEBA 1HPCA 2EYPA 1CTMA 3E0JA 4IFDJ 1SBBB 2A74C 4JK1C 2K1BA 2OXPA 1EYDA 4KKUA 2F0JA 4QUFA 2NZ1D 2BA1A 1NSNS 4KHVA 5EKLA 3RLFA 1TWGB 4XYOA 2BDOA 2HQEA 5E3FA 3LWUA 4E6IA 2JA7B 1FNUA 1DJRD 2BDNA 1S5FD 5IGBA 3SK5A 3HEJA 3HS0C 5EKKA 5I2YA 1QNKA 2NN6G 1CM9A 1PFMA 4C3IB 4RHRA 5C3EB 3GV3A 1HQRD 3EVQA 4KMUC 3NBIA 2HDLA 1F77A 4FF4A 3P7JA 4WORA 3AB9A 1B44D 1U4LA 4FXDA 2IWHA 4RAUC 2NUCA 5EBDA 1D5XC 1W6KA 3VA5A 4HTHA 2LMCB 5BN3A 2HUGA 3W3AA 4C2MB 2CVRA 1ZXTA 1J9OA 2WKDA 3BDCA 2O2LD 5F2DA 2ICEC 1F9PA 1PZID 5BN5A 3VR5A 3OPOA 2B39A 5EPKA 3N52A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K8J A;  2EYP A;  3MZ5 A;  2F0T A;  1TQO A;  4KY7 A;  3T13 A;  3P1H A;  4NDX A;  5E1F A;  1A3V A;  5I6W A;  5KGU A;  3DHQ A;  4K2K A;  5KRU A;  2RKS A;  1EY8 A;  1SYE A;  2F0N A;  1SYG A;  4HMJ A;  4TRD A;  1SYB A;  4EQO A;  2PZU A;  2EYF A;  2EXZ A;  4KY6 A;  4YIJ A;  2SNM A;  4ID6 A;  1A2T A;  2LKV A;  1IHZ A;  2PQE A;  1TR5 A;  5CV6 A;  4EVO A;  2F3V A;  1ENC A;  2F0H A;  3OMG A;  5CC4 A;  4B9X A;  2O4X A;  2OXP A;  4DU9 A;  4PMB A;  4KJN A;  1EYD A;  4NKL A;  2EYM A;  5CR3 A;  4K5X A;  5JOB A;  4EQP A;  4F8M A;  5I6Y A;  5IGF A;  4KD4 A;  2F0J A;  3MVV A;  3NUC A;  5DEH A;  4K5W A;  1SNQ A;  3D4D A;  2EYJ A;  5C3X A;  1NSN S;  4K8I A;  4KHV A;  2F0I A;  4PNY A;  2KQ3 A;  5EKL A;  2EY2 A;  3D6C A;  5C3W A;  1KAB A;  2PZT A;  4NMZ A;  3SXH A;  2RBM A;  3OWF A;  1F2M A;  4B9W A;  3PMF A;  4S3S A;  1EZ8 A;  1ENA A;  1STA A;  4G57 A;  2HQE A;  3QOJ A;  3E5S A;  3ERO A;  2EYL A;  1STB A;  2QDB A;  5E3F A;  1EY0 A;  1SNM A;  4J1M A;  4ME5 A;  4ZUJ A;  4E6I A;  1SNO A;  2KHS A;  1SYF A;  4RKB A;  5C6A A;  5EGT A;  2F0M A;  1JOO A;  5IOD A;  1SYD A;  2EY5 A;  3D4W A;  2EY1 A;  3MEH A;  4I65 A;  2PYK A;  2F0S A;  3DMU A;  5J1Z A;  4DGZ A;  2F0Q A;  3NXW A;  4QF4 A;  1KDB A;  3V2T A;  2EYO A;  2PW5 A;  3QOL A;  5CV8 A;  3SK5 A;  3TP7 A;  3HZX A;  4IUN A;  4QMG A;  1KDC A;  5CV7 A;  1TT2 A;  5C4Z A;  5IIF A;  3HEJ A;  2F0D A;  5C5M A;  2SNS A;  1AEX A;  3ERQ A;  2F0E A;  4K5V A;  3SR1 A;  3TP8 A;  5IGE A;  1EYA A;  5EKK A;  1II3 A;  4K14 A;  1EQV A;  2F0U A;  2F0V A;  3SK4 A;  3C1F A;  2OEO A;  2PW7 A;  4KTA A;  3TP5 A;  1SND A;  5KIX A;  1A3T A;  2WAC A;  5CGK A;  5KYL A;  3R3O A;  1RKN A;  3NP8 A;  3LX0 A;  5CV5 A;  1A2U A;  1EY9 A;  5C5L A;  4DFA A;  3QB3 A;  2EY6 A;  4KD3 A;  5J22 A;  3EVQ A;  5IGC A;  2F0L A;  3MXP A;  1NUC A;  1KAA A;  5C4H A;  5IGG A;  2M00 A;  4K6D A;  5IGB A;  1EZ6 A;  5CV9 A;  3ITP A;  4R8N A;  2OF1 A;  4F7X A;  4HMI A;  4KV6 A;  4OL7 A;  3P75 A;  4WRD A;  2F3W A;  4KY5 A;  4WOR A;  2F0G A;  4EQN A;  1EY6 A;  5DAU A;  1STN A;  3SK6 A;  3BDL A;  1SYC A;  2EYH A;  5CV4 A;  4ZUI A;  1STH A;  3OMC A;  2F0K A;  2PZW A;  1SNP A;  3SHL A;  2NUC A;  5HUR A;  3NHH A;  2RDF A;  3S9W A;  1JOQ A;  3MHB A;  2F0F A;  5I9P A;  5K5P A;  4IZ8 A;  4IAL A;  1EY4 A;  1F2Z A;  1EY5 A;  1A3U A;  2F0O A;  5HGT A;  5I9O A;  5IGD A;  3RUZ A;  3VA5 A;  1U9R A;  1STG A;  4QB4 A;  3NQT A;  4KJO A;  5IOC A;  4HTH A;  4MIU A;  3D8G A;  4N9T A;  4ZQ3 A;  1SNC A;  4LAA A;  4RKL A;  4DF7 A;  5ISR A;  4J6H A;  4N9P A;  5KEE A;  2F0W A;  1F2Y A;  1JOR A;  3EJI A;  3C1E A;  3U9O A;  3BDC A;  3NK9 A;  4K2L A;  2F0P A;  4H7B A;  5KYI A;  5J39 A;  3SK8 A;  5F2D A;  5M9O A;  3T16 A;  3OSO A;  4PMC A;  3H6M A;  1JOK A;  1EYC A;  3TP6 A;  5JAV A;  2ENB A;  1STY A;  2SOB A;  4ODG A;  1EY7 A;  5NUC A;  1KDA A;  3TME A;  4NP5 A; 
#chains in the Genus database with same CATH topology
 3I4M B;  4X3T A;  1UE1 A;  4DN4 M;  3KYH C;  1SYB A;  4DA2 A;  2JXM B;  3ND8 A;  2NVX H;  1VQ9 A;  4UHV A;  5L37 A;  5M3F H;  2PQE A;  1MJE A;  2QF7 A;  3A7A B;  2RCF A;  5ISR A;  1PRT C;  5JOB A;  5FK9 C;  3U50 C;  3NUC A;  3MXG A;  1YI2 A;  3AYH B;  3M7G A;  1AN8 A;  2RQX A;  4BA2 I;  1RCV D;  4QJF A;  4C56 C;  3J7Y W;  1U5K A;  1NY4 A;  4J1M A;  5D3I B;  3VR4 A;  4U68 A;  1WJJ A;  2JQO A;  1I6H B;  2Q8R E;  2BE5 C;  1BCP B;  1SYD A;  2HT1 A;  3SDZ A;  1XXG A;  2YTV A;  1YNJ D;  4X65 L;  1S5C D;  1NBW A;  1LTS D;  2EYO A;  1T9H A;  3E9I A;  1BKB A;  4X3U A;  3CKI B;  1S72 A;  2DJG C;  1YBY A;  1TWA B;  1LTB D;  2F4I A;  4LNQ A;  4CHT B;  2WAC A;  3HRZ C;  3HFZ B;  4FNF A;  1PLF A;  5LMU Q;  2ZXP A;  2A6H C;  5C4H A;  2Z4H A;  1I4P A;  2E2I B;  4J8Q A;  4BY1 G;  4IOC A;  2AKW B;  2AUJ D;  3VYR A;  4GNX A;  4EQN A;  3ULL A;  2R93 B;  1EY6 A;  1VQD A;  1I50 B;  3SK6 A;  4CJ0 B;  2D0P A;  3RN5 A;  1SNP A;  2UXD Q;  2HHH L;  1Z7T A;  3WDN A;  4IAL A;  3KOJ A;  5I9O A;  2UUA L;  1UE6 A;  1BR9 A;  1STG A;  4DR6 Q;  4KJO A;  1S5B D;  1Z9F A;  4DXF A;  4C3I H;  2N8N A;  4DF7 A;  2MFI A;  2B2W A;  4IUR A;  4N9P A;  1X32 A;  4X64 Q;  1F2Y A;  1KAW A;  1VQE A;  3EJI A;  4B3S L;  3RD4 A;  4IUP A;  3RZO H;  4K2L A;  3D6W A;  4KHP Q;  4RA8 A;  1XNR L;  4OEL B;  3FMC A;  2J4X A;  2WIN B;  5JVG 3;  2EQS A;  1X3F A;  4HN7 A;  1G2S A;  1UEA B;  4X3S A;  5I6W A;  3PF5 A;  1F9S A;  1B8A A;  5T1G A;  4A3F B;  3HOW G;  3GP7 A;  4FF1 A;  2N49 A;  4XDX A;  3PIP 3;  2UU9 Q;  4ZYS A;  2LY7 A;  3S1M B;  4C2M H;  4MNO A;  4A3M G;  4DAP A;  1L1O B;  3KDF B;  2R92 B;  3MEF A;  2NN6 I;  5KND A;  3UDF A;  1YNN D;  4DV7 L;  2LXJ A;  3MVV A;  2OTL A;  5E7N A;  2NVY B;  4X62 L;  1PH2 A;  4XIG S;  4JI5 Q;  1XPO A;  1G6P A;  3NWS A;  4PNY A;  4P71 A;  1NJI C;  2CH4 W;  4YWK A;  1R9T H;  2FFK B;  4IPH A;  4JI8 L;  5DM6 3;  4OX9 Q;  5IYD G;  3V05 A;  2K33 A;  3A56 A;  3W5O A;  3ERO A;  2RHS B;  1QZH A;  1JCK B;  1SJE D;  1VQ4 A;  5I2X A;  5C6A A;  2E76 C;  4Y52 H;  2K03 A;  4EQ5 A;  5EPJ A;  2Y0S G;  4F7X A;  2HQL A;  1TWC H;  3TDQ A;  5C4J H;  1TT2 A;  3ULJ A;  3LWE A;  1PHJ A;  4A3J H;  2VB2 X;  5JJI A;  4ILW A;  4FO2 A;  1A62 A;  1FYC A;  5KYL A;  1EWI A;  3W1G A;  5IP9 H;  1FR3 A;  1J8I A;  2EY6 A;  3C3L A;  1IKM A;  5IGC A;  1S40 A;  2JA6 G;  2UUC Q;  1YIT A;  1K8A C;  2ZXR A;  1B50 A;  3S2H H;  2OF1 A;  3QWN A;  4OL7 A;  3HOU H;  1CKN A;  2PCF B;  3WWV A;  1WTO A;  3D0F A;  1N32 Q;  3PO3 B;  5FO7 B;  2RDG A;  4ZLT F;  3H0G B;  1LTI D;  3S17 B;  3TN2 A;  4XQJ A;  1HQM C;  5COR A;  4DR4 Q;  3OOC A;  1L2F A;  3BJU A;  5IGD A;  3S2D H;  2EVB A;  2YTY A;  5M3F G;  1I94 L;  3A74 A;  1PYW D;  4GKJ Q;  2F0W A;  2NYZ D;  1H9J A;  3OTO L;  2B29 A;  1P8L A;  4ZK9 B;  2HDM A;  3K58 A;  2E2I H;  1SFO B;  4IPC A;  4DR3 L;  1DGS A;  1I6V C;  5ELB A;  2UXB L;  3HOX H;  4P75 A;  1MKH A;  1WCM H;  1BOS A;  1TY0 A;  1I50 H;  1KDA A;  1NR4 A;  1PTO F;  1I4Q A;  2IL8 A;  3S14 H;  1E1T A;  2MPM A;  3E0E A;  1WTH A;  5I4D A;  2Q2U A;  1AE3 A;  3GTM B;  5A35 A;  4TRD A;  4DK0 A;  3GTP H;  2SNM A;  4QGU A;  4F87 A;  4BXX H;  1Q86 C;  4GZY C;  5CMD A;  1NMF A;  3VDY A;  1TR5 A;  1O78 A;  4KJN A;  4F8M A;  4J15 A;  4GOP A;  3HOV B;  1WFQ A;  4K5W A;  3GO5 A;  3CAM A;  3S1R H;  4A3B B;  1CA6 A;  4FXK C;  1HRJ A;  4JYA Q;  2CQO A;  4Y7N B;  1D5Z C;  3QOJ A;  2QDB A;  2JJQ A;  3K6O A;  2FMM A;  3CPW A;  3CP0 A;  1WTR A;  3TZU A;  1D1I A;  4JG2 A;  3V2T A;  4YHH L;  2K50 A;  5C4Z A;  3A0J A;  1YNJ C;  1I3Q B;  1EQQ A;  1GD7 A;  1XNQ Q;  3FRP B;  2K6A A;  2NVY H;  3U9S A;  2F0U A;  4DV3 Q;  4IPG A;  2XWB B;  3ZYY X;  4C3I G;  3GTL B;  3NP8 A;  1YZ6 A;  4OO1 G;  2B8F A;  1SMY D;  5EAY A;  1LTG D;  1PFN A;  4BS9 A;  4GLX A;  3DWA A;  3P75 A;  2F3W A;  4XT3 B;  1EWC A;  3LNN A;  3OIP A;  4LF5 L;  3J81 L;  1EIF A;  4A75 A;  1K3B C;  3VR3 A;  2F0K A;  1PDQ A;  2AQ3 B;  4NXN L;  2B2T C;  3R8B A;  4TSS A;  4HJ5 A;  4DUZ Q;  3MWY W;  1BCP F;  2VW9 A;  4DAY B;  1X9N A;  1Y1W B;  3J81 i;  3M4Y A;  3I3C A;  4O0A A;  2A73 B;  4JI0 Q;  4LF9 L;  1BQQ T;  5FLX E;  2IX3 A;  4HSV A;  4ME3 A;  4OWT B;  3W1B A;  1BXT A;  3CCU A;  1HTP A;  4MN3 A;  4RCO A;  1TY2 A;  2L1B A;  4ZRZ A;  1MI2 A;  2EJF C;  3TME A;  1HUM A;  1FL0 A;  4GKK Q;  1PFS A;  1EFI D;  4CGY B;  4KY7 A;  3T13 A;  3I4M G;  1CZW A;  3DHQ A;  3DXJ C;  2R7F A;  1VQN A;  4YCW A;  3C2P A;  1EOT A;  2WAQ B;  4DK1 A;  3TRE A;  2B63 H;  2QW7 A;  4JI4 Q;  4ID6 A;  4PZ8 A;  2HIV A;  5E4W C;  3KK7 A;  1HR0 L;  3OMG A;  2F0H A;  3KJO A;  3DLL A;  3M7N A;  3M4O B;  1EU4 A;  2SDF A;  1WVL A;  4PV1 C;  1PTO D;  3ND9 A;  3R93 A;  1NR2 A;  5CR3 A;  5M5W B;  3TRZ A;  3EIV A;  3Q8D A;  4KD4 A;  4GN3 B;  2LSS A;  4A3J G;  4NXM L;  2ID0 A;  5IP9 G;  1VQP A;  1GUO A;  3RLN A;  2VB3 X;  3H15 A;  1RJT A;  1V8Q A;  1X55 A;  3JAM c;  3NSW A;  1HR0 W;  2EYL A;  3NBH B;  1VQ8 A;  1SNM A;  3HOW B;  3PUW A;  3BZK A;  2XTI A;  2CKZ B;  2F0M A;  3S15 B;  1JJ2 A;  1BF4 A;  4P73 A;  3OWE B;  3S1Q B;  4DV5 Q;  2DN8 A;  1GUN A;  4A3M B;  4L6T B;  5JPN C;  3R2T A;  1MSH A;  1M8A A;  3OYY A;  1CUK A;  2WB1 B;  4JW0 A;  4OHJ A;  1KD1 C;  2JE6 I;  3HOV H;  4NW2 A;  2NZO A;  3K8A A;  1X6O A;  4RMF A;  1C8C A;  1EIG A;  1L1O A;  3KDF A;  5IP7 G;  2DNC A;  2RDH A;  1LO5 D;  2K5N A;  1FD7 D;  3BVM A;  1I4X A;  1QG7 A;  3I8Z A;  1HHV A;  1N34 Q;  1EQT A;  1ENF A;  4FF2 A;  1QB5 D;  3HOX G;  1WCM G;  4PMW A;  2ZXO A;  5TSS A;  3BYY B;  4LUV A;  5CV4 A;  1GUG A;  1STH A;  4CDD C;  2PZW A;  1SAP A;  4HJ7 A;  1AH9 A;  2RDF A;  1I3Q H;  3CME A;  1M90 C;  3IFD A;  1JJG A;  2CW0 D;  3C46 A;  1EY5 A;  2I0Q A;  1A3U A;  2L4N A;  5IOC A;  4BXX G;  1KLU D;  4R8I A;  1LT5 D;  1T5X D;  4HIO A;  2E5L Q;  4LWC A;  5CBE E;  2JA6 B;  2K5W A;  5JPM C;  1ZEQ X;  3TS0 A;  3NK9 A;  1LTL A;  2X6L A;  1N36 L;  1H95 A;  2R7D A;  4YCU A;  1B3Q A;  4KY6 A;  4YIJ A;  4NP5 A;  2VQF Q;  4BWG B;  4LF6 Q;  2J7Z A;  5M5Y B;  2PNR C;  3BZC A;  4RGO S;  1QE6 A;  1B9N A;  1QUQ B;  2F0N A;  3HG9 A;  4HMJ A;  3TS2 A;  4GN4 B;  3CQZ B;  1JC7 A;  1Y1W H;  3PIP A;  1A2T A;  1VMC A;  4ALP A;  4AH6 A;  1KHI A;  3I91 A;  5LMU L;  4EQP A;  5C44 B;  4OO1 I;  1W6J A;  2N3S A;  2UXC Q;  3NWT A;  2UUB Q;  4I7A A;  2WV6 D;  3D6C A;  2GA4 B;  3SXH A;  2RBM A;  1F2M A;  4H02 A;  4RG1 A;  4OIJ A;  1JQY D;  4LFC Q;  1ENA A;  3I4L A;  1IBL Q;  4UAI A;  3QIA A;  2R7Z B;  2UXD L;  4DV0 Q;  2CHB D;  2Y0S E;  4A3I B;  2F52 A;  3EA6 A;  5ELE A;  2EY5 A;  3MEH A;  2I5L X;  2PMZ B;  3CCR A;  1EIY B;  2ZJQ A;  3UI2 A;  3M4O H;  4DR6 L;  1SSO A;  5IE8 A;  3K81 C;  1VMP A;  3EBE A;  3Q22 A;  2F0D A;  5C5M A;  2SNS A;  4X64 L;  1NAP A;  1VQK A;  2F0V A;  2E2J B;  3RLO A;  1E7Z A;  2QIL A;  4KHP L;  3PIO 3;  2TSS A;  1CT1 D;  1OO9 B;  3S24 A;  2RSO A;  3OW2 A;  4XT1 B;  3MXP A;  1HNX Q;  1EZ6 A;  3PUY A;  1SMY C;  1JJC B;  1E24 A;  4ZAI A;  3S1Q H;  5IT9 c;  3IRB A;  5EKI A;  3A8I E;  2JYO A;  5EJW A;  2UU9 L;  3PGZ A;  3SHL A;  1CQF A;  2C5C A;  2HCI A;  5GAD C;  2QGQ A;  5I9P A;  1HZ9 A;  2EDG A;  1MBY A;  4TVA B;  1IKL A;  1F2Z A;  5C0X H;  4GLV B;  4DAM A;  4A3K H;  1VQJ A;  1TS3 A;  4AYB B;  2IHE A;  2MHV A;  1JWM D;  1IBK Q;  4J6H A;  4P72 A;  4JI5 L;  4DAV A;  3RZO B;  2EJG C;  2F3I A;  4U67 3;  1VQG A;  2F0P A;  3K0X A;  3KUP A;  3UE0 A;  1V9P A;  2EIF A;  1Q1B A;  5J39 A;  3I2Z A;  5M9O A;  4OX9 L;  1S5E D;  1DOL A;  1EEI D;  5EPL A;  1EFW A;  3G48 A;  5LL6 S;  3CCL A;  1OXT A;  1I4R A;  2KBN A;  3MC0 B;  5IYB G;  1K83 B;  3I4N H;  3FKI H;  4CJ2 C;  4DKA C;  2XNA C;  4OIK A;  4A3G B;  2B2U C;  4B3R Q;  5JEA J;  1TXY A;  2MQH A;  4JBM A;  5FO8 B;  1JB7 A;  1UEB A;  2EXZ A;  3AU7 A;  4JI2 Q;  3T4A C;  2JN4 A;  1SEB D;  2PMZ E;  2E2D C;  1ENC A;  3J80 E;  1HTL D;  1PH4 A;  1MGS A;  1U4P A;  3FPP A;  4OGQ C;  1CSQ A;  3HOV G;  2IT1 A;  4DAY A;  3IKJ A;  5G3L D;  5C3X A;  1PTO C;  1R9T B;  5EQ0 A;  1OTC A;  4JOI A;  5EBC A;  1PRT B;  3STB D;  5M5Y H;  3QO2 A;  3Q23 A;  3PUX A;  1N32 L;  3RR5 A;  4RGT A;  2PI2 E;  4XTC S;  2A68 D;  4BY7 H;  3BU2 A;  2MJ8 A;  2LS0 1;  1KIX A;  1PA6 A;  1SNO A;  2KHS A;  1NNX A;  4PQX A;  4JI3 Q;  5EGT A;  4MZ9 A;  3CQZ H;  4DR4 L;  2ATW A;  2E75 C;  3H09 A;  3CU7 A;  4O42 A;  1TWC B;  2C35 B;  1G91 A;  2K01 A;  5C4J B;  3L2P A;  3H3V C;  3TEH B;  5CV8 A;  1F9R A;  2H5X A;  2ZTC A;  2MO1 A;  4QMG A;  4A3J B;  4GKJ L;  5IGE A;  5C44 H;  3J81 E;  4A4I A;  3FPU B;  4K14 A;  1C48 A;  2PW7 A;  1LTT D;  1V1O A;  3O13 A;  4HCS A;  3MXN A;  1CQV A;  3QB3 A;  4KD3 A;  2K5D A;  1XTC D;  2G9H D;  2AUK A;  3JAM i;  5IGG A;  3S2H B;  2CH4 A;  1PZK D;  4NPS A;  4M1U B;  3HOU B;  2CCZ A;  1YHQ A;  2R7Z H;  4EGV A;  2F0G A;  4A3I H;  4N8F A;  1D5M C;  3OW7 A;  3HKZ B;  4JBJ A;  1O7Y A;  1AP0 A;  4V0B A;  4RGM A;  3NBH A;  1DZ1 A;  4LFA Q;  3EQL C;  3S2D B;  1XYI A;  4IUQ A;  2IX0 A;  3KJP A;  1Y1W G;  1LYL A;  2E2J H;  2K05 A;  2QCP X;  1FGB D;  2CW0 C;  4F88 A;  4B3T Q;  2FMC A;  4CJ1 B;  1B2T A;  2AQ1 B;  1ONL A;  4WFN 3;  4JYA L;  1D8L A;  2X69 A;  4A3C G;  1ICF B;  4K0K Q;  1RTN A;  3HOX B;  5DNF A;  4PMC A;  1WCM B;  1SMX A;  5JAV A;  4L8J A;  3S14 B;  3P1H A;  4XXE A;  5CBA E;  1IZ6 A;  1ET9 A;  1SYE A;  1Y1V B;  3GTP B;  2WAQ G;  1GUW A;  1SYG A;  1H9K A;  2H4O A;  2QA4 A;  4JI6 Q;  3UDI A;  1XNQ L;  1HXY D;  2LKV A;  1S4Z A;  1IW7 D;  2K14 A;  5IYC G;  2E8G A;  4DV3 L;  2L5T A;  5KGU A;  1VCI A;  3K5L A;  3BVZ A;  4CKB A;  2OWO A;  3DWQ A;  4X3K A;  3S1R B;  3FDT A;  3U58 A;  2AMC B;  4AIM A;  1PH8 A;  3V96 A;  3BYT B;  2BH2 A;  3B6Y A;  1E1O A;  4NMZ A;  2M9V A;  1L0W A;  2EXD A;  2FJ2 A;  2K75 A;  1K83 H;  2RA4 A;  4G57 A;  5FKA C;  1KLG D;  4JV5 Q;  5GQO A;  2KED A;  2KEE A;  4A3G H;  1J5E Q;  4FYD A;  4IOA A;  1X3P A;  2IW3 A;  5JVH 3;  1XPR A;  4DUZ L;  2I07 B;  3T56 B;  4QF4 A;  2WB1 G;  2XVS A;  4YWL A;  4GLA C;  1KDC A;  4IJL A;  3TP8 A;  5M5X H;  1RD9 D;  2VQE Q;  4JI0 L;  2EOT A;  3E3X A;  2VUM H;  5C0X G;  4BBR H;  1M4V A;  3DWP A;  4C3J B;  3VA7 A;  4DFA A;  4N8X 1;  3H3V H;  1AZQ A;  2QEJ C;  4JI1 Q;  3CCS A;  5GAE C;  4JBK A;  2O5I C;  3CMA A;  5CV9 A;  4GKK L;  3NTI A;  1WTP A;  4KV6 A;  3J7Z C;  1VQF A;  5BN4 A;  4C1N I;  5D14 A;  1OXU A;  2VY3 A;  1MJC A;  1HFG A;  3I4N G;  3FKI G;  3BDL A;  1SYC A;  2EYH A;  1LV9 A;  4JI4 L;  2DJF C;  4H13 C;  1V1Q A;  2JP1 A;  1XJV A;  2R3Z A;  1R4P B;  5K5P A;  1ZKO A;  3DEP A;  2KUM A;  4KLK A;  4L63 B;  4LUZ A;  4A3D B;  4LF4 Q;  1P16 A;  4IUV A;  1PV4 A;  1JOR A;  2D0O A;  4DR2 Q;  1ESR A;  2JSO A;  3RN2 A;  3NEM A;  4DNI A;  3T16 A;  4KKT A;  1JOK A;  4KN4 C;  1HFN A;  1CZG A;  2ENB A;  1HNW Q;  3I73 A;  1VF7 A;  2V4D A;  1LT6 D;  5ELF A;  3CPF A;  4DV5 L;  2OCE A;  4NDX A;  4BY7 G;  2PI2 A;  4K2K A;  4R4I A;  3U4V A;  2B63 B;  4RHS A;  4FDB A;  3KF8 B;  1VQM A;  2A1A A;  1XMO Q;  1A0I A;  1Q90 A;  5H1S E;  3PO2 H;  3KBG A;  2B2Y C;  4EVO A;  1O7I A;  2NVQ H;  3WOE A;  2MNA A;  1E2V A;  3A5U A;  1XPU A;  5C44 G;  4RCN A;  3IFT A;  3BG3 A;  1KNA A;  1SR3 A;  5GAH C;  3H94 A;  1ILP A;  4KKS A;  3RMH A;  1N34 L;  1S3O A;  2Z6K A;  4LFB Q;  5BR8 Q;  3DUZ A;  1PZJ D;  2AWN A;  3MA2 B;  4S3S A;  1L0X B;  3L3O C;  2J0T D;  2A8V A;  1STB A;  3RZD B;  1Y1V H;  3M3Y H;  2R7Z G;  3STB C;  1W3S A;  2JA8 H;  4A3I G;  3A7L A;  2A68 C;  3J7A V;  3D4W A;  5J1Z A;  1X3E A;  4PG3 A;  4DGZ A;  2F0Q A;  2PW5 A;  1CFM A;  3MXU A;  3N6R A;  1G29 1;  3ZJY C;  3VYT A;  1CI3 M;  4NB3 A;  4I7Z C;  2E5L L;  1VQH A;  1MIU A;  1V1P B;  4DV2 Q;  3HKS A;  2FIN B;  1VQ6 A;  3CRL C;  3D4R A;  5C5L A;  1DOK A;  4HIK A;  3PIO A;  5M3M B;  4QL5 A;  3A8J E;  3G71 A;  2R61 A;  2D2C C;  4K6D A;  2RF4 A;  3F1Z A;  2VQF L;  4LF6 L;  3G6J B;  5GAG C;  4C3H H;  2MO0 A;  4R4T A;  4WRD A;  1O80 A;  1CKO A;  2ASB A;  1PRT F;  5DAU A;  3LGJ A;  1STN A;  1ASZ A;  4AQY Q;  3OMC A;  1U0L A;  3E6Z X;  1JE4 A;  4IFD H;  1AZP A;  3S9W A;  2F0F A;  2IPK D;  5AFW A;  2A6E D;  3NPP A;  4OWX B;  5D65 A;  4AYB G;  5JJZ A;  4C3J H;  2A5H A;  4N9T A;  1GXD C;  1YNX A;  3EFX D;  2UXC L;  4DK6 C;  2HHH Q;  2UUB L;  1CHQ D;  5C4X H;  2UUA Q;  3SGI A;  4LFC L;  4RFB A;  2H1E A;  1IBL L;  1TKW B;  4IN3 A;  1STY A;  3DM1 A;  1EY7 A;  4DV0 L;  4FP5 D;  3AQQ A;  4A3E B;  1Y8P B;  1PH3 A;  2CWA A;  3GTQ H;  4A3G G;  1Q8K A;  2RKS A;  1UWV A;  2ZM6 L;  4DR7 Q;  4A3D H;  5C0X I;  1M1K C;  1BBU A;  2B8G A;  1CSP A;  2F3V A;  2IJ0 A;  1LM0 A;  2K5V A;  3CCM A;  3KLR A;  1SDF A;  2KCN A;  1D7Q A;  1K0R A;  4HSP A;  2VUM G;  3KF6 B;  1U4R A;  2F4V Q;  1HNX L;  5LL6 X;  1B1Z A;  1C0A A;  2R6G A;  2F0I A;  1K28 A;  3Q24 A;  4Q0F A;  3GTJ B;  1T5E A;  2X6G A;  2LXK A;  2CFM A;  3CC2 A;  3J81 j;  4ME5 A;  1B4O A;  1WD1 A;  4G7O C;  1TS2 A;  1GUT A;  3NTK A;  2KVM A;  3TBI B;  1YJ9 A;  2D9U A;  2ZTE A;  5CV7 A;  4QUC A;  5JEA H;  4DUY Q;  1IBK L;  4K5V A;  3ERQ A;  4DXG A;  1SXT A;  1YNN C;  2WII B;  5HY6 A;  4POF A;  2A19 A;  2K5H A;  5J3B A;  1BVS A;  3KLS X;  4APV A;  1RKN A;  2GVA A;  3ONA B;  2NN6 H;  3HOY B;  2VZA A;  5JJL A;  1VQC A;  1HNZ Q;  3HOU G;  1MD2 D;  3RZD H;  4QIW B;  3QG1 A;  2Q8T A;  1BBW A;  4KY5 A;  2L15 A;  5FLX c;  1E22 A;  2Q2I A;  4B3R L;  1A8V A;  2HIX A;  1UUP A;  4JI2 L;  3HKZ G;  2NVT H;  1XMQ L;  5LHY 1;  4L5Q A;  5HUR A;  2OQK A;  3GV6 A;  3I7F A;  3CF5 A;  4A3K B;  1QVC A;  1IL8 A;  2DY7 A;  1ML0 D;  3PO2 G;  1K0S A;  1YHA A;  3D8G A;  3KFU A;  3A8K E;  4G7H C;  1PRT D;  3GTK H;  5M3M H;  3VR2 A;  3Q0A A;  4IUU A;  4C1N K;  3K7U C;  4POG A;  1HA6 A;  1VQ7 A;  1H9S B;  2M2L A;  5ELO A;  1RIP A;  3OSO A;  1Q81 C;  3FP9 A;  5FJ8 H;  3I4N B;  4LF7 Q;  3FKI B;  4JI3 L;  1CHP D;  1NE3 A;  2K7V A;  3J7A F;  2WAQ E;  2SEB D;  1ROD A;  3S16 B;  1Y1V G;  1EY8 A;  2BE5 D;  3BS1 A;  2AWO A;  1AW7 A;  2NB0 A;  4UP7 A;  1TVX A;  3I72 A;  4Q5V A;  2NWG A;  1SE2 A;  3BVG A;  2YV5 A;  3K5O A;  3NTH A;  2XRS D;  1NCV A;  4GNX C;  3NEL A;  4UP9 A;  3S1N B;  5IGF A;  2A69 D;  5DEH A;  5A2Q L;  1BCP D;  2XN9 C;  1PH1 A;  4K8I A;  4R1J A;  1TS4 A;  4RWS C;  2MUY A;  4R4C A;  4A3E H;  1TII D;  4O1N A;  4BY7 B;  3R2I A;  2B2W C;  4CKE A;  1HH2 P;  3PSI A;  4ZCK A;  5IY0 A;  4LFA L;  1JOO A;  2I5H A;  4DV1 Q;  1PMR A;  2KHI A;  1L0Y B;  2EY1 A;  1G8Z D;  2WB1 E;  1ZYR D;  4I65 A;  1VQ5 A;  3X3M A;  5KYI A;  1X54 A;  2F1M A;  4IFD G;  1ESF A;  1AEX A;  2OT2 A;  1V43 A;  4B3T L;  3L9A X;  1E0B A;  3KF8 A;  4UPA A;  1SE3 A;  3QR8 A;  1B7Y B;  3T1Y Q;  4C3J G;  1OXX K;  1GO3 E;  1EU3 A;  4K0K L;  4OXP A;  1EY9 A;  3GTJ H;  2F0L A;  2KEC A;  1KAA A;  1LTR D;  2BH8 A;  1X56 A;  4KN7 C;  5CYU A;  3CCV A;  1EWH A;  2RVL A;  2P5Z X;  4JI7 Q;  3VR6 A;  4HIM A;  4BY1 H;  4JI6 L;  1X65 A;  2K28 A;  3PUV A;  1LAC A;  3NHH A;  1Y8O B;  4YY3 Q;  1GM5 A;  2EPB A;  4IZ8 A;  4RGN A;  1W2B A;  4A3D G;  3NQT A;  3RNU A;  1J6Q A;  1Y8N B;  4ZQ3 A;  3I90 A;  2A6E C;  2Q8I B;  3A5Z B;  3HOY H;  1Q3L A;  1WTQ A;  1I4H A;  3H3V I;  2DNE A;  3SVM A;  1V1P A;  1VQO A;  4H0L C;  1VS0 A;  1SN8 A;  4JV5 L;  3H6M A;  1B53 A;  1HZC A;  2SOB A;  2QKI C;  2JA5 B;  3M85 A;  2WFW A;  4HAE A;  4HR7 B;  5E1F A;  1SE8 A;  2B63 G;  2L11 A;  1IYV A;  1Z6H A;  2V1C C;  3BDO A;  1K73 C;  2VQE L;  3F2U A;  3TZD A;  1N33 Q;  1IHZ A;  1Z47 A;  3A54 A;  5CV6 A;  5CC4 A;  5JEA G;  3MAQ A;  4JI1 L;  4GS3 A;  2YU9 H;  1SNQ A;  4X66 Q;  2B2T A;  2VL6 A;  4DK3 C;  4DR1 Q;  2XWJ B;  1O7L A;  1EZ8 A;  2EE1 A;  3T51 B;  1F9Q A;  3A55 A;  4JPB W;  1PTO B;  3S16 H;  4HED A;  1WYD A;  3CRK C;  3T1H Q;  1HJP A;  4IUT A;  4RKB A;  1STE A;  2WP8 J;  1RHP A;  1U4M A;  4XQN A;  2D5D A;  1TWH B;  2B3G A;  1UNS A;  4TQU S;  1E2Z A;  2DY8 A;  2I5M X;  3QOL A;  4LF4 L;  5M5X B;  4IUN A;  3G4S A;  4OWW B;  3S1N H;  2VUM B;  1QVG A;  2UUC L;  1HUN A;  4BBR B;  3K7A B;  1GHJ A;  1II3 A;  3TQY A;  4DR5 Q;  2VNU D;  4DR2 L;  1WTX A;  2Q2T A;  5KIX A;  2QDL A;  3L7Z C;  4BA1 I;  1K8G A;  5M3M G;  5J22 A;  4BBS B;  2B2V A;  1HNW L;  2M00 A;  2YYZ A;  2WKC A;  3I4O A;  4HMI A;  3G6E A;  1HA5 A;  3M9B A;  5FJ8 G;  3MFY A;  4GOP C;  1YEZ A;  1G6Z A;  1XMO L;  5LMN Q;  4Z9C B;  3JAM L;  2ES2 A;  3P20 A;  1JIC A;  2L12 A;  1BDO A;  1D1K A;  4AYB E;  1Q1E A;  3PQI A;  5HGT A;  1IBM Q;  2IX1 A;  1XTD A;  3GTG H;  2RHQ B;  2VXW A;  5FLX L;  1VQL A;  1JWS D;  1TWF B;  2HD3 A;  4LAA A;  4IO9 A;  2ICI A;  2G9D A;  3PCO B;  1EUJ A;  4LFB L;  1D6E C;  5BR8 L;  2G5D A;  1HCZ A;  4JCV E;  1WTV A;  2XSC A;  3J80 c;  1R4Q B;  1PH5 A;  2JA9 A;  1BO0 A;  4L5T A;  1HZA A;  5KNC A;  4A3E G;  3I70 A;  3MZ5 A;  2F0T A;  3J7A 5;  3M4Q A;  3AEV A;  1N36 Q;  5KRU A;  2KA7 A;  1FJG Q;  1SLJ A;  1B9M A;  4IFD I;  2PZU A;  1VF5 C;  3F2C A;  3AFQ A;  2KJX A;  4JBW A;  3K80 C;  2KCC A;  3PO2 B;  3CHB D;  2AQ2 B;  2MP1 A;  2NVQ B;  4B3M Q;  4DV2 L;  2OTJ A;  4X6A H;  4EX5 A;  1KNE A;  2O4X A;  4DU9 A;  2AHO B;  2Z0S A;  4NKL A;  5I6Y A;  4K5X A;  1LT4 D;  5ELN A;  1VQA A;  4P74 A;  3D4D A;  4KHZ A;  1Q8I A;  2A69 C;  1LT3 D;  3J81 c;  2JA5 H;  1XX8 A;  1BCP C;  2L9H A;  2MGS A;  1GVP A;  3M3Y B;  1H9S A;  2TMP A;  1TWG H;  2ZT9 C;  3TP6 A;  3KLW A;  4AQY L;  2C9O A;  1EY0 A;  2Z8L A;  2EZV A;  4ZUJ A;  2JA8 B;  2IHF A;  1JMC A;  1LAB A;  1CA5 A;  3CC4 A;  1G51 A;  2JA7 H;  3DMU A;  2KEN A;  1KL9 A;  2NTS A;  1WTW A;  3OHX C;  1NTG A;  1K9M C;  5IWA Q;  1ZYR C;  2PPB C;  1PVO A;  1EYA A;  4V19 0;  1JWU D;  4P2C B;  4DPG A;  3SK4 A;  1VDZ A;  3C1F A;  2Z1C A;  4KTA A;  3TP5 A;  4HJ9 A;  5CGK A;  3KLS A;  5CV5 A;  4CDC C;  3HOY G;  3TSS A;  1FNV A;  1TS5 A;  3CW2 C;  5C3E H;  2ZTD A;  4PZ7 A;  1BBX C;  4C3H B;  4OO1 H;  1PTO H;  3ITP A;  1QOH A;  1VQI A;  4LF8 Q;  3E9H A;  1LTA D;  3F8T A;  1C7Y A;  3HKZ E;  1TWH H;  4DR7 L;  2F03 A;  1PYB A;  4ULL A;  1QUQ A;  2KCT A;  1O7Z A;  4A3K G;  4KK7 A;  1EY4 A;  3K7A H;  4B08 A;  4QY7 A;  1U9R A;  2JK8 A;  1GJX A;  2F4V L;  5AJ3 Q;  2K52 A;  1PFB A;  4BBS H;  5C4X B;  5KEE A;  3NQI A;  4A93 B;  2E2H B;  3C1E A;  1GOZ A;  2HCC A;  1X3G A;  5COY A;  1KRT A;  1C4Q A;  4LJZ C;  2LFN A;  1KC8 C;  3IL8 A;  1OXV A;  3F2B A;  4ODG A;  2Z6B A;  5FLM H;  1A15 A;  3GTQ B;  5A2Q E;  4TKO B;  1A3V A;  4DV6 Q;  3AMU A;  4L5S A;  5K36 H;  3UE1 A;  1L1O C;  1KXL A;  4ZKB B;  3I4M H;  4LUO A;  2DUD A;  2PQA B;  4DUY L;  4R4Q A;  4CBV A;  5IT9 L;  5C0X J;  3X3N A;  1BNZ A;  1TWF H;  3H91 A;  3K59 A;  1QIL A;  3K0Y A;  4UDU C;  4CDF C;  4DV4 Q;  4GN5 A;  5DM7 3;  1NMG A;  2EYJ A;  2K32 A;  3I55 A;  1HNZ L;  1RF2 D;  1PH9 A;  3T53 B;  1KAB A;  1BUV T;  2BOS A;  3D31 A;  3OWF A;  4B9W A;  1RL2 A;  1XWE A;  1GHK A;  1Q12 A;  3M4P A;  2FXQ A;  2KCM A;  1KTK A;  1RDP D;  3SR1 A;  2BA0 A;  1WOC A;  3HOZ B;  5ELD A;  1IYU A;  3JC6 6;  4MTN A;  1SYF A;  2FHT A;  1I6H H;  4YWM A;  1SRU A;  3BZD B;  2XGT A;  2F0S A;  1KDB A;  2IY5 B;  4XYQ A;  3TP7 A;  3DM3 A;  5IIF A;  1A6X A;  1YJW A;  4DNT B;  1EL0 A;  1YHB A;  2F0E A;  2NTT A;  1K3R A;  2N55 A;  3K5M A;  4WJ3 M;  3CXC A;  4LK1 C;  1TWA H;  1SND A;  1JR0 D;  1PYS B;  2VS1 A;  2B2U A;  3PV0 A;  3NEN A;  4HCE A;  5IP7 H;  1NUC A;  4LF7 L;  1DYQ A;  1JB3 A;  4R8N A;  3FVQ A;  1PH7 A;  4PZ6 A;  3CCQ A;  3IAY A;  1WD0 A;  2Z4I A;  1DCZ A;  2NVT B;  2R93 H;  1JE5 A;  3UDX A;  4ZUI A;  4ABN A;  1JOQ A;  2PO4 A;  2JEB I;  3MHB A;  1YVC A;  1IL2 A;  1ICW A;  4X65 Q;  2F0O A;  3RUZ A;  1H9M A;  4IPD A;  4MTK A;  3GTK B;  4RKL A;  1SJH D;  3K5N A;  2K4K A;  1KRS A;  1ILQ A;  2XRQ D;  3HGB A;  1K8M A;  5HGQ A;  4H7B A;  4FF3 A;  1I5F A;  3FEW X;  1X3Q A;  3ERS X;  3D3R A;  3HP3 A;  2JA5 G;  3Q6S A;  4IQZ A;  5NUC A;  1K8O A;  4A3L H;  4DV1 L;  1TQO A;  2I46 A;  2KHJ A;  1IYJ B;  5T1I A;  1EQR A;  2L55 A;  1UE7 A;  3J80 L;  4A3F H;  2QEX A;  4KI0 A;  2JA7 G;  4IJH A;  1ET6 A;  3T1Y L;  3S1M H;  4B9X A;  2BCO A;  2R92 H;  4YCV A;  4PMB A;  1RTO A;  2E2H H;  4A93 H;  3GTO B;  4CKC A;  1E3P A;  1F2L A;  3J80 i;  4JVZ A;  5C3W A;  2Z9H A;  2PZT A;  4B3S Q;  4JI7 L;  3MFG A;  5C3E G;  3PMF A;  1Q46 A;  1STA A;  3GD7 A;  1LUZ A;  1XNR Q;  1G2T A;  1DOM A;  3NE5 B;  4LMQ D;  4YY3 L;  1GUS A;  2PYK A;  4FXG C;  2Q2H A;  3I56 A;  1QNU A;  1MHW C;  1DM0 B;  1A63 A;  3OIQ A;  5D3D A;  2GVB A;  1IW7 C;  4BBR G;  2K5Q A;  4MHE A;  3F2D A;  1EQV A;  2OEO A;  3JAM E;  1N8R C;  1A3T A;  1DXM A;  4DV7 Q;  4BBS G;  3KBX A;  2ZJP A;  4WJ4 A;  1D2B A;  2E74 C;  4X62 Q;  3HOZ H;  2KOL A;  4BY1 B;  4JI8 Q;  5FLM G;  1UAP A;  4O2D A;  3PO3 H;  5K36 G;  2CQA A;  1N33 L;  5FO9 B;  3H0G H;  3L0O A;  3S17 H;  4JOI C;  3QJY A;  3U4Z A;  4QB4 A;  2B2V C;  1AE2 A;  4MIU A;  3UDG A;  1SNC A;  3VYU A;  1MSG A;  4X66 L;  3URY A;  1PH6 A;  1FNW A;  3MXN B;  4DR1 L;  1B3A A;  1EIH A;  3SK8 A;  3SE0 A;  1SFO H;  3ULP A;  1EYC A;  3T1H L;  4HJA A;  1E2W A;  4UP8 A;  4K8J A;  4HJ8 A;  3PF4 A;  3GQB A;  3CD6 A;  5IYB H;  3W2D A;  2D62 A;  5DLQ E;  4EQO A;  2EYF A;  3GTM H;  1PXU A;  1DON A;  4DR5 L;  5E4X A;  1SE4 A;  1ASY A;  4M8A A;  2NBF A;  4JC0 A;  4CDE C;  2EYM A;  1S5D D;  2K04 A;  2YU9 B;  1I94 Q;  4K6L A;  4G7Z C;  4UY8 C;  4R9W A;  2KQ3 A;  2N88 A;  2EY2 A;  4GNX B;  4H44 C;  3OTO Q;  4A3B H;  1FGU A;  4FVM A;  2O5J C;  4DR3 Q;  2JEA I;  1N9W A;  1QCB D;  1OXS C;  1QJO A;  3E5S A;  4Y7N H;  2UXB Q;  2JA8 G;  5LMN L;  1DD2 A;  4XQQ A;  1VQB A;  5IOD A;  3PUZ A;  2R93 G;  4WJW A;  1IBM L;  2Y0S B;  5FOB B;  3NXW A;  4RH6 A;  3ER0 A;  5KNB A;  1Y69 U;  3HZX A;  3GTO H;  1AFP A;  2PQA A;  1EEF D;  5LMN W;  4R4O A;  2EJM A;  3WOF A;  1QVF A;  1B70 B;  2A6H D;  1C9O A;  2DGY A;  3R3O A;  2YTX A;  3LX0 A;  1A2U A;  3GTL H;  4ZKC B;  1H9R A;  4OEM B;  4QIW E;  4C3H G;  2B2Y A;  3EN2 A;  5ELC A;  1Q7Y C;  1QWY A;  1YIJ A;  2ALY B;  3G7L A;  1FJG L;  1KQS A;  4A3L G;  2L0C A;  2RSN A;  1I4G A;  2NZH A;  1GKH A;  4B3M L;  1CK1 A;  3GTG B;  5G3L F;  4A3F G;  2NVX B;  4YHH Q;  1TU2 B;  3ICE A;  5M3F B;  3MTS A;  1LLR D;  4G4K A;  5C4X G;  1IXR A;  2XIW A;  2R92 G;  3FHW A;  3K57 A;  4A93 G;  1EYG A;  4QCL A;  3DEO A;  3U9O A;  5IT9 E;  4DNR B;  3VYS A;  3CCJ A;  4A3C H;  5JJK A;  3SEB A;  1Y14 B;  1HPC A;  2EYP A;  2PNH A;  1CKM A;  1CTM A;  1YJN A;  3AFP A;  3E0J A;  4LF5 Q;  1HZB A;  4IFD J;  1FVI A;  5IWA L;  4HID A;  1SBB B;  4NXN Q;  4LW1 A;  2A74 C;  4JK1 C;  2K1B A;  2OXP A;  3GDE A;  1EYD A;  4KKU A;  5IYC H;  2ZM6 Q;  2F0J A;  5M5W H;  4QUF A;  2NZ1 D;  1J5E L;  2BA1 A;  1NSN S;  4KHV A;  4LF9 Q;  5EKL A;  1CKN B;  3RLF A;  4LF8 L;  1JT8 A;  1TWG B;  2CWP A;  3HOZ G;  2BDO A;  2HQE A;  2OQ0 A;  4XYO A;  4A76 A;  5E3F A;  5GRO A;  3LWU A;  3CC7 A;  4E6I A;  3HOW H;  4L5R C;  2JA7 B;  1FNU A;  1DJR D;  1SRO A;  2BDN A;  3S15 H;  4OON A;  2ZJR A;  1S5F D;  5IGB A;  4A3M H;  3PO3 G;  3SK5 A;  1WI5 A;  3H0G G;  5AJ3 L;  3HEJ A;  3HS0 C;  4QQB X;  5EKK A;  1HR0 Q;  5I2Y A;  1QNK A;  2NN6 G;  1QZG A;  1CM9 A;  1PFM A;  4C3I B;  4RHR A;  5C3E B;  3GV3 A;  1HQR D;  3EVQ A;  4KMU C;  3NBI A;  2HDL A;  4NXM Q;  1F77 A;  5IYD H;  4FF4 A;  3P7J A;  2GN5 A;  4DV6 L;  4WOR A;  3AB9 A;  1B44 D;  1U4L A;  4FXD A;  2IWH A;  1UE5 A;  4RAU C;  2NUC A;  5EBD A;  1D5X C;  2RCN A;  2Z6K C;  1W6K A;  4GOP B;  3VA5 A;  4HTH A;  4DV4 L;  2LMC B;  5BN3 A;  2HUG A;  3W3A A;  4C2M B;  1XMQ Q;  2CVR A;  3KF6 A;  1ZXT A;  2JA6 H;  2N78 A;  1J9O A;  2WKD A;  3BDC A;  2O2L D;  3CCE A;  5F2D A;  2ICE C;  1F9P A;  1PZI D;  5BN5 A;  3VR5 A;  1Q82 C;  1EOV A;  2B39 A;  3OPO A;  5EPK A;  4A3B G;  3N52 A; 
#chains in the Genus database with same CATH homology
 3I4M B;  4X3T A;  4DN4 M;  1SYB A;  4DA2 A;  2JXM B;  3ND8 A;  2PQE A;  2QF7 A;  3A7A B;  5ISR A;  1PRT C;  5JOB A;  5FK9 C;  3NUC A;  3MXG A;  3M7G A;  1AN8 A;  2RQX A;  4BA2 I;  1RCV D;  4C56 C;  3J7Y W;  4J1M A;  5D3I B;  3VR4 A;  4U68 A;  1I6H B;  2Q8R E;  2BE5 C;  1BCP B;  1SYD A;  3SDZ A;  1XXG A;  1YNJ D;  1S5C D;  1LTS D;  2EYO A;  4X3U A;  3CKI B;  1TWA B;  1LTB D;  2F4I A;  4CHT B;  2WAC A;  3HRZ C;  4FNF A;  1PLF A;  2ZXP A;  2A6H C;  5C4H A;  2Z4H A;  1I4P A;  2E2I B;  4J8Q A;  3VYR A;  2AUJ D;  4EQN A;  2R93 B;  1EY6 A;  1I50 B;  3SK6 A;  4CJ0 B;  1SNP A;  1Z7T A;  3WDN A;  4IAL A;  5I9O A;  1BR9 A;  1STG A;  4KJO A;  1S5B D;  4DXF A;  4DF7 A;  2B2W A;  4IUR A;  4N9P A;  1X32 A;  1F2Y A;  3EJI A;  3RD4 A;  4IUP A;  4K2L A;  3D6W A;  4RA8 A;  3FMC A;  2J4X A;  2WIN B;  5JVG 3;  4HN7 A;  1G2S A;  1UEA B;  4X3S A;  5I6W A;  1F9S A;  5T1G A;  4A3F B;  3GP7 A;  4FF1 A;  3PIP 3;  4XDX A;  4ZYS A;  2LY7 A;  3S1M B;  2R92 B;  4DAP A;  2NN6 I;  5KND A;  1YNN D;  3MVV A;  2NVY B;  4XIG S;  3NWS A;  4PNY A;  2FFK B;  5DM6 3;  3V05 A;  2K33 A;  3A56 A;  3ERO A;  1JCK B;  1SJE D;  5I2X A;  5C6A A;  2E76 C;  2K03 A;  5EPJ A;  4F7X A;  3TDQ A;  1TT2 A;  3LWE A;  2VB2 X;  4ILW A;  4FO2 A;  1FYC A;  5KYL A;  1J8I A;  1FR3 A;  2EY6 A;  3C3L A;  1IKM A;  5IGC A;  2ZXR A;  1B50 A;  2OF1 A;  3QWN A;  4OL7 A;  2PCF B;  1WTO A;  3PO3 B;  5FO7 B;  2RDG A;  4ZLT F;  3H0G B;  1LTI D;  3S17 B;  3TN2 A;  4XQJ A;  1HQM C;  5COR A;  3OOC A;  5IGD A;  2EVB A;  1PYW D;  2F0W A;  2NYZ D;  1H9J A;  4ZK9 B;  2HDM A;  3K58 A;  1SFO B;  1I6V C;  5ELB A;  1BOS A;  1TY0 A;  1KDA A;  1NR4 A;  1PTO F;  1I4Q A;  2IL8 A;  2MPM A;  5I4D A;  3GTM B;  5A35 A;  4TRD A;  4DK0 A;  2SNM A;  4F87 A;  4GZY C;  5CMD A;  1TR5 A;  1O78 A;  4KJN A;  4F8M A;  3HOV B;  4K5W A;  3GO5 A;  4A3B B;  1CA6 A;  4FXK C;  1HRJ A;  4Y7N B;  1D5Z C;  3QOJ A;  2QDB A;  3K6O A;  2FMM A;  1WTR A;  3TZU A;  1D1I A;  3V2T A;  5C4Z A;  1YNJ C;  1I3Q B;  3FRP B;  2K6A A;  3U9S A;  2F0U A;  2XWB B;  3ZYY X;  4C3I G;  3GTL B;  3NP8 A;  4OO1 G;  2B8F A;  1SMY D;  1LTG D;  1PFN A;  4BS9 A;  3DWA A;  3P75 A;  2F3W A;  4XT3 B;  1EWC A;  3LNN A;  3OIP A;  3J81 L;  3VR3 A;  2F0K A;  1PDQ A;  2AQ3 B;  2B2T C;  3R8B A;  4TSS A;  3MWY W;  1BCP F;  1Y1W B;  3M4Y A;  3I3C A;  2A73 B;  1BQQ T;  5FLX E;  2IX3 A;  4HSV A;  1BXT A;  1HTP A;  4MN3 A;  4RCO A;  1TY2 A;  2L1B A;  4ZRZ A;  1MI2 A;  2EJF C;  3TME A;  1HUM A;  1EFI D;  4CGY B;  4KY7 A;  3T13 A;  1CZW A;  3DHQ A;  3DXJ C;  3C2P A;  1EOT A;  2WAQ B;  4DK1 A;  4ID6 A;  5E4W C;  3KK7 A;  3OMG A;  2F0H A;  3M4O B;  3M7N A;  1EU4 A;  2SDF A;  1WVL A;  4PV1 C;  1PTO D;  3ND9 A;  3R93 A;  1NR2 A;  5CR3 A;  5M5W B;  4KD4 A;  2ID0 A;  1GUO A;  2VB3 X;  1RJT A;  1V8Q A;  3NSW A;  2EYL A;  1SNM A;  3HOW B;  3PUW A;  2F0M A;  3S15 B;  1BF4 A;  3OWE B;  3S1Q B;  2DN8 A;  1GUN A;  4A3M B;  4L6T B;  5JPN C;  3R2T A;  1MSH A;  1M8A A;  2WB1 B;  4OHJ A;  2JE6 I;  4NW2 A;  1C8C A;  1EIG A;  2DNC A;  2RDH A;  1LO5 D;  1FD7 D;  3BVM A;  1I4X A;  1QG7 A;  3I8Z A;  1HHV A;  1EQT A;  1ENF A;  4FF2 A;  1QB5 D;  4PMW A;  2ZXO A;  5TSS A;  3BYY B;  5CV4 A;  1GUG A;  1STH A;  2PZW A;  1SAP A;  2RDF A;  3IFD A;  2CW0 D;  3C46 A;  1EY5 A;  1A3U A;  2L4N A;  5IOC A;  1KLU D;  4R8I A;  1LT5 D;  1T5X D;  5CBE E;  2JA6 B;  2K5W A;  5JPM C;  1ZEQ X;  3NK9 A;  2X6L A;  4YIJ A;  4KY6 A;  4NP5 A;  5M5Y B;  4BWG B;  2J7Z A;  2PNR C;  4RGO S;  1QE6 A;  1B9N A;  2F0N A;  3HG9 A;  4HMJ A;  3CQZ B;  1JC7 A;  1A2T A;  1VMC A;  3I91 A;  4EQP A;  5C44 B;  4OO1 I;  1W6J A;  3NWT A;  2WV6 D;  3D6C A;  2GA4 B;  3SXH A;  2RBM A;  1F2M A;  4OIJ A;  1JQY D;  1ENA A;  3I4L A;  4UAI A;  3QIA A;  2R7Z B;  2CHB D;  4A3I B;  3EA6 A;  5ELE A;  2EY5 A;  3MEH A;  2PMZ B;  3UI2 A;  1SSO A;  1VMP A;  3Q22 A;  2F0D A;  5C5M A;  2SNS A;  1NAP A;  2F0V A;  2E2J B;  2QIL A;  3PIO 3;  2TSS A;  1CT1 D;  1OO9 B;  2RSO A;  4XT1 B;  3MXP A;  1EZ6 A;  3PUY A;  1SMY C;  4ZAI A;  5EKI A;  3A8I E;  2JYO A;  5EJW A;  3SHL A;  1CQF A;  2C5C A;  2HCI A;  5I9P A;  2EDG A;  1MBY A;  1IKL A;  1F2Z A;  5C0X H;  1TS3 A;  4AYB B;  2MHV A;  1JWM D;  4J6H A;  4DAV A;  3RZO B;  2EJG C;  4U67 3;  3KUP A;  2F0P A;  5J39 A;  1Q1B A;  5M9O A;  1S5E D;  1DOL A;  1EEI D;  5EPL A;  5LL6 S;  1OXT A;  1I4R A;  3MC0 B;  1K83 B;  4CJ2 C;  2XNA C;  4OIK A;  4A3G B;  2B2U C;  5JEA J;  5FO8 B;  2EXZ A;  3AU7 A;  3T4A C;  1SEB D;  2E2D C;  1ENC A;  3J80 E;  1HTL D;  1MGS A;  1U4P A;  3FPP A;  4OGQ C;  2IT1 A;  4DAY A;  3IKJ A;  5G3L D;  5C3X A;  1PTO C;  1R9T B;  5EQ0 A;  5EBC A;  1PRT B;  3Q23 A;  3QO2 A;  3PUX A;  4RGT A;  4XTC S;  2A68 D;  2MJ8 A;  2LS0 1;  1SNO A;  2KHS A;  4PQX A;  5EGT A;  2E75 C;  3CU7 A;  3H09 A;  4O42 A;  1TWC B;  1G91 A;  2K01 A;  5C4J B;  3H3V C;  5CV8 A;  1F9R A;  4QMG A;  4A3J B;  5IGE A;  3J81 E;  3FPU B;  4K14 A;  1C48 A;  2PW7 A;  1LTT D;  1V1O A;  3O13 A;  4HCS A;  3MXN A;  1CQV A;  3QB3 A;  4KD3 A;  2K5D A;  1XTC D;  2G9H D;  2AUK A;  5IGG A;  3S2H B;  1PZK D;  4M1U B;  3HOU B;  4EGV A;  2F0G A;  1D5M C;  3OW7 A;  3HKZ B;  1O7Y A;  1AP0 A;  4V0B A;  4RGM A;  3NBH A;  1DZ1 A;  3EQL C;  3S2D B;  1XYI A;  4IUQ A;  2IX0 A;  2K05 A;  2QCP X;  1FGB D;  2CW0 C;  4F88 A;  2FMC A;  4CJ1 B;  1B2T A;  2AQ1 B;  1ONL A;  4WFN 3;  2X69 A;  1RTN A;  3HOX B;  5DNF A;  4PMC A;  1WCM B;  5JAV A;  4L8J A;  3S14 B;  3P1H A;  4XXE A;  5CBA E;  1ET9 A;  1SYE A;  1GUW A;  1Y1V B;  3GTP B;  1SYG A;  1H9K A;  2H4O A;  1HXY D;  2LKV A;  1S4Z A;  1IW7 D;  2L5T A;  5KGU A;  1VCI A;  3K5L A;  3BVZ A;  4CKB A;  3DWQ A;  4X3K A;  3S1R B;  3FDT A;  3V96 A;  3BYT B;  4NMZ A;  2M9V A;  2FJ2 A;  2RA4 A;  4G57 A;  5FKA C;  1KLG D;  2KED A;  2KEE A;  4FYD A;  1X3P A;  2IW3 A;  5JVH 3;  2I07 B;  3T56 B;  4QF4 A;  2XVS A;  1KDC A;  3TP8 A;  1RD9 D;  2EOT A;  5C0X G;  1M4V A;  3DWP A;  4C3J B;  3VA7 A;  4DFA A;  1AZQ A;  2QEJ C;  2O5I C;  5CV9 A;  3NTI A;  1WTP A;  4KV6 A;  5BN4 A;  4C1N I;  5D14 A;  1OXU A;  1HFG A;  3BDL A;  1SYC A;  2EYH A;  1LV9 A;  4H13 C;  2JP1 A;  2R3Z A;  1R4P B;  5K5P A;  1ZKO A;  3DEP A;  2KUM A;  4L63 B;  4A3D B;  4IUV A;  1JOR A;  1ESR A;  2JSO A;  3T16 A;  4KKT A;  1JOK A;  4KN4 C;  1HFN A;  1CZG A;  2ENB A;  3I73 A;  1VF7 A;  2V4D A;  1LT6 D;  5ELF A;  4NDX A;  4K2K A;  2B63 B;  4RHS A;  1Q90 A;  3KBG A;  2B2Y C;  4EVO A;  3WOE A;  1E2V A;  4RCN A;  3IFT A;  3BG3 A;  1KNA A;  3H94 A;  1ILP A;  4KKS A;  3RMH A;  3DUZ A;  1PZJ D;  2AWN A;  3MA2 B;  4S3S A;  1L0X B;  2J0T D;  3L3O C;  1STB A;  3RZD B;  3A7L A;  2A68 C;  3J7A V;  3D4W A;  5J1Z A;  4DGZ A;  2F0Q A;  2PW5 A;  1CFM A;  3MXU A;  3N6R A;  1G29 1;  3VYT A;  1CI3 M;  4I7Z C;  1V1P B;  2FIN B;  3CRL C;  3D4R A;  5C5L A;  1DOK A;  5M3M B;  3A8J E;  2R61 A;  2D2C C;  4K6D A;  3G6J B;  4WRD A;  1O80 A;  1PRT F;  5DAU A;  1STN A;  3OMC A;  3E6Z X;  1JE4 A;  4IFD H;  1AZP A;  3S9W A;  2F0F A;  2IPK D;  5AFW A;  2A6E D;  3NPP A;  5D65 A;  5JJZ A;  2A5H A;  4N9T A;  1GXD C;  3EFX D;  1CHQ D;  4RFB A;  2H1E A;  1TKW B;  4IN3 A;  1STY A;  3DM1 A;  1EY7 A;  4FP5 D;  4A3E B;  1Y8P B;  2RKS A;  5C0X I;  2B8G A;  2IJ0 A;  2F3V A;  3KLR A;  1SDF A;  2KCN A;  4HSP A;  1U4R A;  5LL6 X;  1B1Z A;  2R6G A;  2F0I A;  3Q24 A;  4Q0F A;  3GTJ B;  1T5E A;  2X6G A;  4ME5 A;  1B4O A;  1WD1 A;  4G7O C;  1TS2 A;  1GUT A;  3NTK A;  2KVM A;  3TBI B;  2D9U A;  5CV7 A;  4QUC A;  5JEA H;  4K5V A;  3ERQ A;  4DXG A;  1SXT A;  1YNN C;  2WII B;  3KLS X;  1RKN A;  3ONA B;  2NN6 H;  3HOY B;  1MD2 D;  4QIW B;  3QG1 A;  2Q8T A;  4KY5 A;  1UUP A;  5LHY 1;  5HUR A;  3GV6 A;  4A3K B;  1IL8 A;  2DY7 A;  1ML0 D;  3D8G A;  3A8K E;  4G7H C;  1PRT D;  3VR2 A;  3Q0A A;  4IUU A;  4C1N K;  1HA6 A;  1H9S B;  2M2L A;  3OSO A;  3I4N B;  3FKI B;  1CHP D;  2K7V A;  3J7A F;  2SEB D;  1ROD A;  3S16 B;  1EY8 A;  2BE5 D;  3BS1 A;  2AWO A;  1AW7 A;  2NB0 A;  1TVX A;  3I72 A;  4Q5V A;  2NWG A;  1SE2 A;  3BVG A;  3K5O A;  3NTH A;  2XRS D;  1NCV A;  3S1N B;  5IGF A;  2A69 D;  5DEH A;  5A2Q L;  1BCP D;  2XN9 C;  4K8I A;  1TS4 A;  4RWS C;  2MUY A;  1TII D;  4O1N A;  4BY7 B;  3R2I A;  2B2W C;  4CKE A;  1JOO A;  1PMR A;  1L0Y B;  2EY1 A;  1G8Z D;  1ZYR D;  4I65 A;  3X3M A;  5KYI A;  2F1M A;  4IFD G;  1ESF A;  1AEX A;  2OT2 A;  1V43 A;  3L9A X;  1E0B A;  3KF8 A;  1SE3 A;  4C3J G;  1OXX K;  1EU3 A;  1EY9 A;  2F0L A;  2KEC A;  1KAA A;  1LTR D;  4KN7 C;  5CYU A;  1EWH A;  2RVL A;  3VR6 A;  2K28 A;  3PUV A;  1LAC A;  3NHH A;  1Y8O B;  2EPB A;  4IZ8 A;  4RGN A;  3NQT A;  1Y8N B;  4ZQ3 A;  3I90 A;  2A6E C;  2Q8I B;  1Q3L A;  1WTQ A;  1I4H A;  2DNE A;  3SVM A;  1V1P A;  4H0L C;  3H6M A;  1B53 A;  2SOB A;  2QKI C;  2JA5 B;  3M85 A;  4HAE A;  4HR7 B;  5E1F A;  2L11 A;  1IYV A;  1Z6H A;  3BDO A;  3F2U A;  3TZD A;  1IHZ A;  1Z47 A;  3A54 A;  5CV6 A;  5CC4 A;  5JEA G;  3MAQ A;  1SNQ A;  2B2T A;  2XWJ B;  1O7L A;  1EZ8 A;  2EE1 A;  3T51 B;  1F9Q A;  3A55 A;  1PTO B;  4HED A;  3CRK C;  4IUT A;  4RKB A;  1STE A;  2WP8 J;  1RHP A;  1U4M A;  4XQN A;  2D5D A;  1TWH B;  1UNS A;  4TQU S;  1E2Z A;  2DY8 A;  3QOL A;  5M5X B;  4IUN A;  2VUM B;  1HUN A;  4BBR B;  3K7A B;  1GHJ A;  1II3 A;  2VNU D;  1WTX A;  5KIX A;  3L7Z C;  4BA1 I;  4BBS B;  5J22 A;  2B2V A;  2M00 A;  2YYZ A;  2WKC A;  4HMI A;  1HA5 A;  3MFY A;  1G6Z A;  4Z9C B;  3JAM L;  3P20 A;  1JIC A;  2L12 A;  1BDO A;  1D1K A;  1Q1E A;  5HGT A;  2IX1 A;  2VXW A;  5FLX L;  1JWS D;  1TWF B;  4LAA A;  2ICI A;  2G9D A;  1D6E C;  1HCZ A;  1WTV A;  2XSC A;  1R4Q B;  1BO0 A;  5KNC A;  3I70 A;  3MZ5 A;  2F0T A;  5KRU A;  2KA7 A;  1B9M A;  4IFD I;  2PZU A;  1VF5 C;  2KJX A;  4JBW A;  2KCC A;  3PO2 B;  3CHB D;  2AQ2 B;  2MP1 A;  2NVQ B;  1KNE A;  2O4X A;  4DU9 A;  4NKL A;  5I6Y A;  4K5X A;  1LT4 D;  3D4D A;  4KHZ A;  1Q8I A;  2A69 C;  1LT3 D;  1XX8 A;  1BCP C;  2L9H A;  2MGS A;  3M3Y B;  1H9S A;  2TMP A;  3TP6 A;  2ZT9 C;  2EZV A;  2C9O A;  1EY0 A;  2Z8L A;  4ZUJ A;  2JA8 B;  1LAB A;  1CA5 A;  3DMU A;  2NTS A;  1WTW A;  3OHX C;  1ZYR C;  2PPB C;  1EYA A;  4V19 0;  1JWU D;  4P2C B;  3SK4 A;  1VDZ A;  3C1F A;  2Z1C A;  4KTA A;  3TP5 A;  5CGK A;  3KLS A;  5CV5 A;  3TSS A;  1FNV A;  1TS5 A;  1BBX C;  4C3H B;  4OO1 H;  1PTO H;  3ITP A;  1QOH A;  1LTA D;  2F03 A;  4ULL A;  1O7Z A;  4KK7 A;  1EY4 A;  4B08 A;  1U9R A;  1GJX A;  1PFB A;  5C4X B;  5KEE A;  3NQI A;  4A93 B;  2E2H B;  3C1E A;  1GOZ A;  2HCC A;  5COY A;  1C4Q A;  4LJZ C;  2LFN A;  3IL8 A;  1OXV A;  4ODG A;  1A15 A;  3GTQ B;  5A2Q E;  4TKO B;  1A3V A;  3AMU A;  5K36 H;  4ZKB B;  4CBV A;  5IT9 L;  5C0X J;  3X3N A;  1BNZ A;  3H91 A;  3K59 A;  1QIL A;  3K0Y A;  4UDU C;  5DM7 3;  2EYJ A;  2K32 A;  1RF2 D;  3T53 B;  1KAB A;  1BUV T;  2BOS A;  3D31 A;  3OWF A;  4B9W A;  1XWE A;  1GHK A;  1Q12 A;  3SR1 A;  3HOZ B;  1KTK A;  1RDP D;  2BA0 A;  5ELD A;  1IYU A;  1SYF A;  2FHT A;  3BZD B;  2F0S A;  1KDB A;  4XYQ A;  3TP7 A;  5IIF A;  1A6X A;  4DNT B;  1EL0 A;  2F0E A;  2NTT A;  2N55 A;  3K5M A;  4LK1 C;  1SND A;  1JR0 D;  2B2U A;  3PV0 A;  4HCE A;  1NUC A;  1DYQ A;  1JB3 A;  4R8N A;  3FVQ A;  3IAY A;  1WD0 A;  2Z4I A;  1DCZ A;  2NVT B;  4ZUI A;  4ABN A;  1JOQ A;  2PO4 A;  2JEB I;  3MHB A;  1ICW A;  2F0O A;  3RUZ A;  1H9M A;  3GTK B;  4RKL A;  1SJH D;  3K5N A;  1ILQ A;  2XRQ D;  3HGB A;  1K8M A;  4H7B A;  4FF3 A;  3FEW X;  1X3Q A;  3D3R A;  3HP3 A;  3Q6S A;  4IQZ A;  5NUC A;  1K8O A;  1TQO A;  2I46 A;  5T1I A;  2L55 A;  3J80 L;  4KI0 A;  1ET6 A;  4B9X A;  2BCO A;  4PMB A;  1RTO A;  3GTO B;  4CKC A;  1F2L A;  5C3W A;  2PZT A;  3MFG A;  3PMF A;  1STA A;  3GD7 A;  1G2T A;  1DOM A;  3NE5 B;  4LMQ D;  1GUS A;  2PYK A;  4FXG C;  1QNU A;  1DM0 B;  3OIQ A;  5D3D A;  1IW7 C;  2K5Q A;  4MHE A;  1EQV A;  2OEO A;  3JAM E;  1A3T A;  1DXM A;  3KBX A;  1D2B A;  2E74 C;  2KOL A;  4BY1 B;  1UAP A;  5K36 G;  2CQA A;  5FO9 B;  3QJY A;  4QB4 A;  2B2V C;  4MIU A;  1SNC A;  3VYU A;  1MSG A;  3URY A;  1FNW A;  1B3A A;  1EIH A;  3SK8 A;  3SE0 A;  1EYC A;  1E2W A;  4K8J A;  3GQB A;  3W2D A;  2D62 A;  4EQO A;  2EYF A;  1PXU A;  1DON A;  5E4X A;  1SE4 A;  4M8A A;  2NBF A;  2EYM A;  1S5D D;  2K04 A;  2YU9 B;  4K6L A;  4G7Z C;  4R9W A;  2KQ3 A;  2N88 A;  2EY2 A;  4H44 C;  2O5J C;  4FVM A;  2JEA I;  1QCB D;  1OXS C;  1QJO A;  3E5S A;  1DD2 A;  4XQQ A;  5IOD A;  3PUZ A;  4WJW A;  2Y0S B;  5FOB B;  3NXW A;  4RH6 A;  5KNB A;  1Y69 U;  3HZX A;  1AFP A;  1EEF D;  2EJM A;  3WOF A;  2A6H D;  3R3O A;  3LX0 A;  1A2U A;  4ZKC B;  1H9R A;  4C3H G;  2B2Y A;  5ELC A;  1QWY A;  3G7L A;  2L0C A;  2RSN A;  1I4G A;  1CK1 A;  3GTG B;  5G3L F;  2NVX B;  1TU2 B;  5M3F B;  3MTS A;  1LLR D;  4G4K A;  2XIW A;  3K57 A;  4QCL A;  3DEO A;  3U9O A;  5IT9 E;  4DNR B;  3VYS A;  3SEB A;  1HPC A;  2EYP A;  1CTM A;  3E0J A;  4IFD J;  1SBB B;  2A74 C;  4JK1 C;  2K1B A;  2OXP A;  1EYD A;  4KKU A;  2F0J A;  4QUF A;  2NZ1 D;  2BA1 A;  1NSN S;  4KHV A;  5EKL A;  3RLF A;  1TWG B;  4XYO A;  2BDO A;  2HQE A;  5E3F A;  3LWU A;  4E6I A;  2JA7 B;  1FNU A;  1DJR D;  2BDN A;  1S5F D;  5IGB A;  3SK5 A;  3HEJ A;  3HS0 C;  5EKK A;  5I2Y A;  1QNK A;  2NN6 G;  1CM9 A;  1PFM A;  4C3I B;  4RHR A;  5C3E B;  3GV3 A;  1HQR D;  3EVQ A;  4KMU C;  3NBI A;  2HDL A;  1F77 A;  4FF4 A;  3P7J A;  4WOR A;  3AB9 A;  1B44 D;  1U4L A;  4FXD A;  2IWH A;  4RAU C;  2NUC A;  5EBD A;  1D5X C;  1W6K A;  3VA5 A;  4HTH A;  2LMC B;  5BN3 A;  2HUG A;  3W3A A;  4C2M B;  2CVR A;  1ZXT A;  1J9O A;  2WKD A;  3BDC A;  2O2L D;  5F2D A;  2ICE C;  1F9P A;  1PZI D;  5BN5 A;  3VR5 A;  3OPO A;  2B39 A;  5EPK A;  3N52 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...