5J22A

Crystal structure of staphylococcal nuclease variant delta+phs l103d at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEADVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L103D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5j22A00
2RDFA 4DFAA 3OSOA 4K5VA 5IGDA 4N9PA 2F0PA 4K5WA 5C5LA 5KRUA 3ERQA 3NUCA 1SNPA 3SK8A 5J39A 4KY7A 3PMFA 4F7XA 2KQ3A 3VA5A 1AEXA 3D4DA 5CV4A 5ISRA 5HGTA 2ENBA 2HQEA 4PMBA 3SK6A 5I9PA 2SNMA 1A2UA 1SYBA 1F2YA 1SNDA 4ID6A 4RKBA 4K5XA 2PQEA 1F2MA 1EY9A 3TP8A 5HURA 1JOOA 1STAA 2PZWA 4PMCA 4LAAA 4KY6A 4KTAA 3V2TA 1EY8A 4K2KA 3P75A 1JOKA 5CV8A 2KHSA 4KV6A 4MIUA 3BDLA 2F0FA 3HZXA 4R8NA 5IODA 4EQOA 5C3WA 1EY5A 1EY0A 1ENCA 2EYPA 4EQPA 1EY7A 5CGKA 1KAAA 1EZ8A 1STGA 2F0QA 3D6CA 3NQTA 3P1HA 4NKLA 4QMGA 1TQOA 3SK4A 4DF7A 4H7BA 5IIFA 5IGGA 4KD3A 2RKSA 3NP8A 2F0TA 2F0EA 3TP5A 5IGBA 1STYA 3MEHA 2SOBA 1STBA 4DGZA 5IGCA 4K8IA 1SYDA 1SYCA 3TMEA 2F3WA 1A3UA 3MXPA 2F0UA 4KJOA 2PW7A 1EYCA 1SYEA 1JORA 2F3VA 5KIXA 1IHZA 2F0SA 2SNSA 3T16A 2EXZA 4HMJA 1NUCA 4I65A 5NUCA 4E6IA 2EY5A 2F0OA 3OMCA 2F0VA 4ODGA 2EYHA 3QB3A 5CR3A 3OMGA 4IALA 3EVQA 4G57A 2PW5A 5CV7A 2EYFA 4EVOA 2O4XA 1JOQA 3ITPA 4N9TA 1NSNS 2WACA 3QOJA 2F0WA 4ZQ3A 1KDAA 1STNA 3E5SA 4F8MA 4PNYA 1A2TA 1ENAA 3HEJA 3TP6A 5C6AA 4TRDA 3SK5A 4HTHA 1SNQA 3MZ5A 5CV6A 5IOCA 4ZUJA 5EKLA 5CV5A 3SXHA 5I6YA 5C3XA 4K2LA 5I9OA 2QDBA 5F2DA 5KYLA 3MVVA 3D8GA 4ZUIA 5J1ZA 3T13A 5IGEA 5J22A 1U9RA 5E3FA 5M9OA 2F0NA 2F0DA 2F0JA 1A3VA 1KABA 2EY6A 2EYMA 1A3TA 1TT2A 2F0IA 3EROA 3SR1A 1EQVA 4NP5A 5DAUA 4WORA 1SNCA 2PZUA 3R3OA 5IGFA 4QB4A 4DU9A 3D4WA 5KGUA 2LKVA 2F0MA 2OEOA 4B9XA 4EQNA 3BDCA 2F0GA 1KDBA 2M00A 2PZTA 5K5PA 5I6WA 3RUZA 1EY6A 4B9WA 4KY5A 3S9WA 4K8JA 2PYKA 1II3A 3C1FA 3C1EA 4IZ8A 3TP7A 4J1MA 1F2ZA 1TR5A 5E1FA 5C4ZA 5JAVA 3NXWA 2EYOA 2EYJA 5DEHA 3H6MA 4WRDA 5EGTA 5KEEA 4OL7A 2OXPA 3LX0A 4K6DA 4KJNA 5CV9A 3EJIA 4K14A 5KYIA 2F0HA 4NDXA 3DMUA 1STHA 4S3SA 3NK9A 1SYFA 4HMIA 1SNMA 2F0LA 3NHHA 2RBMA 5JOBA 2OF1A 1SYGA 5EKKA 5CC4A 2EY2A 3QOLA 5C4HA 1EY4A 3MHBA 2NUCA 4NMZA 4J6HA 4KD4A 4QF4A 1SNOA 1EYDA 3DHQA 3U9OA 1KDCA 1EYAA 2F0KA 4IUNA 1RKNA 5C5MA 4KHVA 4ME5A 1EZ6A 4RKLA 3SHLA 2EY1A 3OWFA 4YIJA 2EYLA
chains in the Genus database with same CATH superfamily
2D5DA 1G6ZA 3OSOA 2D2CC 4K5VA 3W1GA 1YITA 2GVBA 3QIAA 2PMZE 4JW0A 2NVXB 3H15A 2MQHA 4LFBL 5I2XA 3S17H 1B70B 4GLAC 3UE1A 4QCLA 3LGJA 1DCZA 3P7JA 3TN2A 1NCVA 2PZWA 2R7DA 2VUMG 4KLKA 5IWAQ 1GUWA 1OXSC 1HUMA 4R8IA 2Q8TA 4B3ML 1H9KA 5IODA 4I7ZC 1P8LA 1R4PB 3OW2A 3NWTA 4QMGA 4R4QA 1I3QH 1S5CD 2VQFL 1LO5D 4LUZA 3H0GB 1NBWA 1SYDA 1VQDA 4YHHQ 1F2LA 5ELBA 4A3FB 3S24A 1Q7YC 1X54A 2O2LD 5LMNL 1V8QA 5FOBB 1VQ6A 2NVQB 4YCUA 1T9HA 2IY5B 4A3IH 1JT8A 1PRTF 4K0KQ 3HOXH 2JQOA 3S2HH 2N55A 2Y0SB 1X32A 4NXNL 2EYFA 2JA8G 1XNQQ 1B7YB 2EPBA 1SE2A 1KDAA 3K7AB 4F8MA 4LF5L 1LT5D 2ZTEA 1JWSD 4MHEA 3A7LA 3E0EA 4XIGS 2K5NA 5GADC 2GA4B 3KLWA 3SXHA 4X66Q 4BBRB 1MD2D 3VR4A 2CH4A 5M9OA 1JC7A 5T1IA 2JYOA 2EIFA 2A68C 4IPCA 4JK1C 5M5XB 1OXTA 1RTOA 5FO8B 4B3TQ 1SSOA 4DU9A 3K5OA 4YWKA 1KNEA 5M3MH 2QKIC 2PZTA 1J5EQ 1EWCA 1UE5A 3C1EA 2B2VC 1XPUA 1ML0D 4JV5L 1WI5A 1HTLD 5IWAL 2QW7A 2I0QA 3RD4A 2F0HA 3H0GG 4HMIA 1B3AA 4DR5Q 1SEBD 1IL2A 4A3FG 2YTXA 4QF4A 5I2YA 4L5TA 4LUOA 1MBYA 2IL8A 4QIWE 1JWUD 5GAGC 2NWGA 2WKDA 2EYLA 2QEXA 4FP5D 5IGDA 4R4OA 2K05A 4K5WA 4U673 4GNXB 4K0KL 3I91A 5JJZA 4BY7B 1VQIA 1XNQL 2ICEC 4HJ8A 3H3VI 4BXXH 4FF3A 1STAA 4LWCA 4BBRG 1IBLQ 4X66L 1LTID 3CXCA 1KQSA 2K01A 1EY0A 4RA8A 2JA7H 3D6CA 2F0QA 3TRZA 4B3TL 2F0EA 1V43A 1PH8A 1YEZA 1I4QA 3WOEA 1K9MC 2A69D 1JJCB 3OIPA 2KCNA 1ZXTA 2CW0D 3GTKB 3CCVA 4R1JA 4A76A 3F2UA 4ODGA 1T5EA 4UAIA 3I90A 2A5HA 4BWGB 4DV6Q 5A2QE 4L5QA 4X3UA 4A3BB 3NE5B 2NVYH 4L5SA 5FO9B 5C3XA 2ATWA 5D14A 4C1NK 4GOPA 1U9RA 1X6OA 4A93B 3PO2B 4BY7G 1WFQA 4DAPA 2L0CA 4WORA 2E76C 5C44B 4LFAL 1LTGD 3NELA 5C0XG 3HOUB 5K5PA 2YTVA 3Q22A 3QG1A 4O1NA 1TWAB 3HOWB 1IBLL 1QZHA 1IYUA 4K6DA 3FKIB 4LFCQ 2Z6KC 1I4XA 1S5ED 4FO2A 2JA6B 3PSIA 3I4LA 3BU2A 3ICEA 2CVRA 2B2WC 5E4WC 4JBKA 4J6HA 4LF8Q 3E9HA 1LACA 1VQJA 4IUNA 1RKNA 1W3SA 2QEJC 2B2TC 5IT9L 5CYUA 2RDFA 5FO7B 1JCKB 1WJJA 4MN3A 4KKUA 4WJ4A 3SK8A 3GTGH 2V1CC 2A68D 2PNHA 1RF2D 1X3FA 4A3DH 3QWNA 3S14H 4A3BG 4ID6A 4IQZA 3F2DA 1F2MA 4A3JH 1TWGB 4KY6A 5EAYA 4DK1A 4A93G 3PO2G 4KV6A 5EKIA 5C44G 3PO3H 4OO1G 1KAAA 3MXNB 4Z9CB 3BYYB 3K57A 1HNZL 1HCZA 2EVBA 3S15H 2R7FA 2HDMA 3VR3A 3IAYA 3HOUG 2VB3X 3GTJB 1NY4A 4J8QA 4OHJA 1HPCA 1CFMA 3GTQB 3GDEA 1PH1A 3TMEA 3HOWG 1OO9B 2NZ1D 3M4OH 2PW7A 2F3VA 3PCOB 5KIXA 3KLRA 3N52A 2H4OA 3FKIG 3PUXA 1I6VC 1RIPA 3STBC 3S16H 2A6EC 5CV7A 4DR4Q 1NE3A 4G57A 1HZ9A 3KDFA 3ULJA 2WACA 1S3OA 3X3MA 2L15A 3HOYH 5COYA 1RDPD 1VQNA 3WWVA 4MNOA 3SK5A 5FJ8G 1HH2P 4LF8L 3CCJA 1QUQA 1YIJA 5DM73 3BDOA 2MNAA 5J39A 3KF6A 1EYGA 1JMCA 2XWBB 2F0NA 1A3VA 4AIMA 1B9MA 1A8VA 3J80E 3CCQA 4DAYA 4FF1A 1PFMA 4C3JB 4NW2A 4JI2Q 5C4JH 4U68A 2VY3A 4PMWA 1BXTA 1Y8OB 4H02A 1XMOQ 2A6HC 3SDZA 5IP9H 3FHWA 2RSOA 3D4RA 3F1ZA 3H6MA 1EFID 5KEEA 5EPKA 4CHTB 1B9NA 1BF4A 2R7ZB 4PV1C 1F9SA 3FMCA 1WD1A 2UUBL 1YBYA 2KHJA 2OF1A 1ET6A 1LT3D 2N49A 3SGIA 1Q1BA 4QL5A 5C4XG 5FLXc 4YIJA 1CZGA 2VUMH 2LS01 1G2TA 2J7ZA 5KNBA 1SLJA 2KBNA 4DPGA 1QCBD 1LTSD 2MGSA 2PO4A 3P20A 1CZWA 4DR4L 1M4VA 3GTOB 5C3EH 2ZTCA 5ISRA 1BQQT 1PYSB 1VQGA 2PQEA 5HURA 2BDOA 3WDNA 4JBWA 2L5TA 3SE0A 3J81j 4A3EB 4P73A 3KBGA 3RMHA 1EEID 4QUCA 1JOKA 4C56C 1QJOA 4GZYC 1GUSA 4AH6A 4R8NA 1HNXL 3KBXA 2M2LA 3LWEA 2JA8H 3FRPB 1KLUD 4C3JG 3ONAB 1JQYD 3I73A 1J6QA 2K1BA 4QY7A 4FXDA 3BVGA 3KF8A 2F4VQ 2LFNA 1CKNB 4JI2L 1DJRD 1K8MA 3VYRA 1S5FD 1VF5C 3J7YW 4JC0A 1RD9D 1BUVT 4N8FA 1Y1VB 2R7ZG 1MSGA 2EY5A 5FLMG 3K59A 5JVH3 1PV4A 1HUNA 3MXGA 5D3IB 1VQ9A 3JAML 3VYTA 1EIFA 1WCMB 5CV5A 3UI2A 1Q1EA 3T13A 4GNXC 3J7A5 1K8OA 1SE3A 1VCIA 4RAUC 4PQXA 1E2ZA 1GD7A 2N88A 2YTYA 3U50C 1KHIA 3H91A 1DOMA 2HCIA 2QDLA 2HHHQ 5JJLA 2R61A 3H0GH 4ULLA 1K28A 3VDYA 2NTTA 2A8VA 1KDBA 2G9DA 4A3FH 1D5ZC 2VQEQ 4A3EG 4GKKQ 4GKJQ 2NVQH 2OT2A 4IZ8A 2MPMA 4JOIA 4J15A 2SDFA 1C0AA 1H95A 2XN9C 3MA2B 5JPMC 1EIYB 3W5OA 1I5FA 3HFZB 3STBD 1JJ2A 2A6ED 4QQBX 2A73B 3K7AH 3OPOA 4LMQD 1S72A 3HKSA 1PXUA 1IBMQ 2LSSA 3U9OA 2F4VL 4KN7C 4BBRH 3CCSA 4RKLA 2DNCA 3T1YQ 1Y1VG 3PIPA 4IUPA 3EBEA 2XIWA 3E9IA 4TSSA 4FVMA 3PV0A 2UXCQ 1B4OA 4LF4Q 3D4DA 1IW7C 1EWIA 1C4QA 3D31A 3OHXC 4L5RC 4B3RL 4A3MB 1A0IA 5GAHC 1WCMG 1EY9A 1K83B 3PIOA 2K4KA 2EOTA 1MKHA 2KA7A 3NQIA 2KHSA 3RLFA 1O7ZA 1PTOB 1Q90A 2Z4HA 3BDLA 3UDGA 1VMCA 1ENCA 1J8IA 1STGA 4YCVA 1XMQQ 1LUZA 4A3CG 3MEHA 5JPNC 4JVZA 3NBHB 3I4NB 1B53A 4YWMA 4KMUC 5IYBG 1WTXA 3W1BA 2VQEL 4GKKL 1E0BA 2R93B 1Z7TA 1K8AC 1ESFA 1VS0A 2F0SA 4WJ3M 1TS5A 5ELFA 2Z1CA 3G6EA 3OMGA 3CMAA 1QNKA 4HSPA 3AB9A 2D62A 1H9MA 3DWAA 4G7HC 4A3GB 1AZQA 5C0XH 3HEJA 4DR2Q 1UEAB 1IBML 4IPDA 4CDEC 4JI7Q 3VR6A 1RTNA 2EQSA 3A8JE 2K32A 3T1YL 1B50A 4POGA 4BY1B 3RN5A 2NYZD 4A3LG 4R4TA 3A5UA 3UDFA 4V190 4IFDH 4JPBW 1EQVA 1L2FA 2AKWB 3F8TA 2PZUA 3R3OA 1TWHB 3RR5A 2KCCA 3I8ZA 4A3MG 1V1PA 5KGUA 4LF4L 2UXBL 2I07B 3CCRA 2B2VA 2WKCA 3CW2C 3C3LA 1II3A 3U4ZA 3GTKH 4OEMB 1L1OB 2N3SA 3D3RA 3I7FA 2VW9A 1LABA 1LTBD 4OXPA 2ALYB 1I4PA 1TY0A 4B3MQ 3DMUA 1STHA 5DLQE 4M1UB 5JOBA 5HY6A 1X3PA 2NTSA 3CD6A 3I4NG 5C4HA 4LF7L 2FHTA 4A3BH 2R93G 1SNOA 1F9QA 2E2JH 5CORA 4RH6A 3R2IA 3VA5A 1K3BC 5JEAJ 3PO2H 4A93H 2KOLA 2LY7A 1YVCA 4P74A 2ASBA 1EL0A 3DLLA 2KVMA 5C44H 2Y0SE 2B3GA 4OO1H 1X3GA 4A3GG 3M9BA 1N9WA 5IYDG 4JI0L 3K5NA 1A6XA 5G3LD 5HGTA 3HOUH 1GUGA 3SK6A 1Y1WB 4NXNQ 2RCFA 1CKMA 1RODA 3M4PA 1TWAH 3HOWH 1G2SA 1MJCA 1TY2A 4LF5Q 2Q2HA 3L7ZC 4BY1G 1UUPA 3MFGA 5CV8A 4M8AA 2NN6I 4L8JA 2JA6H 4Q5VA 3F2CA 3B6YA 1PH4A 2JE6I 1IYVA 1QZGA 3HKZB 5IGBA 2PPBC 4YCWA 4DNIA 2JK8A 1TXYA 5FJ8H 4FXKC 5GQOA 4BA1I 4X64L 1DYQA 1IHZA 1HHVA 1ET9A 5M5WH 4HIKA 3T16A 4HMJA 3TZUA 4JV5Q 4E6IA 2O5IC 2QGQA 1BKBA 4XYOA 1I6HB 2FFKB 5FLXL 1LYLA 2C9OA 1FNVA 2XRQD 1STNA 1W2BA 4DR6Q 1TWGH 4IUUA 1Y14B 1WD0A 3PUZA 2KECA 1X65A 5I6YA 3QO2A 5J22A 2CQAA 3ER0A 5IGEA 5K36G 1Q46A 4JI4Q 3I56A 4JBJA 2F0IA 1YJWA 3K5LA 2JJQA 5M3FB 3GTJH 1Y1WG 4QUFA 3GTQH 1TS3A 3J81c 4H0LC 4LF6Q 4K8JA 5CBAE 2KJXA 2MO0A 4HR7B 4BA2I 2Z6KA 3I4MB 2ZJQA 4YY3L 1FGUA 1D7QA 3CQZB 3HKZG 3QJYA 1MSHA 2B2WA 1SYFA 5ELNA 3W2DA 1RJTA 1EIGA 1TU2B 4KD4A 3RZOB 3Q8DA 2B2TA 1EQQA 4MZ9A 4HIOA 4TKOB 3CCMA 1NTGA 5C5MA 3SHLA 1H9SA 1KIXA 3OWFA 3EN2A 1L0XB 2IX0A 4DFAA 4QJFA 2AQ3B 3DEOA 5E4XA 3NUCA 4KY7A 4CDFC 4C3JH 2KEEA 2HQEA 2NB0A 3LNNA 3S1RB 2BDNA 5BN4A 3KUPA 4DR6L 2BE5C 2IT1A 3I70A 1SJED 4EQOA 2R7ZH 4JI4L 5FLMH 5M3FG 1Q81C 3JAMc 4RHRA 1SROA 3ND9A 1AFPA 4G7ZC 4JI1Q 5D3DA 2SOBA 2JEBI 4R4CA 4LFAQ 5G3LF 1J9OA 2F3WA 4LF6L 2FMCA 1EYCA 1GUNA 1W6KA 3I4MG 3J81i 1KRSA 2B63B 2K7VA 1NR4A 2F0OA 4ZAIA 4X3KA 1XPOA 3TEHB 1UEBA 4O0AA 3GTOH 1JOQA 2B2UC 4XQJA 1CQFA 4Q0FA 3K58A 3S1MB 5DM63 3TDQA 1MIUA 4AYBB 1GKHA 4A3EH 4RGTA 4DNTB 1PH5A 3HS0C 1TWCB 5F2DA 3UDXA 5LMNW 3J7AF 1HFNA 3DM1A 3CKIB 4A3KB 3PUYA 1LT6D 1JB7A 3EROA 1GO3E 4DK6C 2JSOA 2F0MA 2KCTA 3CU7A 4JG2A 3FDTA 1A62A 1LV9A 3MTSA 1SAPA 3GTPH 2AQ2B 3C1FA 1PTOC 3VR2A 1Y1VH 1Y8NB 4WRDA 3KF6B 1EUJA 5BN3A 1O7IA 2RDGA 1MJEA 2AUKA 2UUCL 4L63B 2RBMA 5IY0A 2EY2A 1HNZQ 1BVSA 3MHBA 4HEDA 4JI1L 3MFYA 3JAMi 3BG3A 2ZXRA 3FPPA 4C2MB 1WTHA 3DHQA 4L6TB 1WCMH 2WP8J 1QVCA 4PG3A 2B63G 3UDIA 5ELOA 2L55A 3OW7A 1DXMA 1N32Q 2C5CA 3CC4A 2F0PA 1K3RA 2X6GA 3OYYA 1JE4A 2L4NA 4DA2A 5IYCG 2ENBA 4AYBG 4A3CH 1SYBA 3VR5A 5IYBH 1SXTA 4LAAA 1SDFA 1EY8A 4A3KG 4NPSA 4H44C 1VQEA 4RFBA 1K0RA 4WJWA 3RN2A 1ICFB 1E22A 2ICIA 3K0YA 1LM0A 1KD1C 1OXVA 1STYA 4DGZA 4XDXA 3I3CA 4IOCA 1L1OC 5GAEC 4KJOA 4CKCA 4HCEA 3BVZA 3J7AV 1GXDC 1G291 4C3HH 1G91A 1HR0L 2EYHA 2B29A 4DUYL 3CRKC 4EGVA 4O2DA 2EJGC 4A3MH 3QOJA 2F0WA 4QGUA 1R9TB 1F77A 1M90C 2UUBQ 1K83H 5C6AA 4GNXA 1CM9A 3PQIA 5EKLA 2R92H 4K2LA 2BE5D 5I9OA 1PTOH 3CMEA 3D8GA 5J1ZA 3A5ZB 4Y7NH 1N32L 1U4PA 5C4XB 1TS4A 1Y8PB 2N78A 1QVGA 2IHEA 2J4XA 1K8GA 2DGYA 4X62Q 1T5XD 1FJGQ 3I4NH 5CMDA 3HGBA 1EU4A 4MTKA 2R93H 3GQBA 2PYKA 4GN4B 4UP8A 2E5LL 1KAWA 4DV4L 1WVLA 2OCEA 3HOXB 4GN3B 1QNUA 1EFWA 2MUYA 1PFBA 4DNRB 2F52A 3DEPA 2D0OA 4OONA 4A3GH 1HNXQ 5IYDH 2WFWA 3NBIA 4DR7Q 1EY4A 4OWXB 2WB1B 4R4IA 3HRZC 1KDCA 2F3IA 2RDHA 3EFXD 2EY1A 4KTAA 4LK1C 1EOTA 1YNJC 3AU7A 1SN8A 2ZTDA 1TWFB 3PMFA 2KQ3A 1AEXA 1D2BA 1KC8C 5ELDA 1JWMD 2ES2A 2WIIB 3HP3A 2Z6BA 3ULLA 4KKSA 1I50B 1JOOA 1IBKQ 3T1HL 2K33A 3CP0A 4FYDA 1SJHD 2KHIA 3MEFA 2EE1A 4K2KA 2E75C 1ZEQX 3CF5A 3EQLC 1PH2A 3HZXA 5EBCA 3J81L 2TSSA 4FXGC 1VQBA 3A54A 2ZJRA 3I55A 1EEFD 1TQOA 1W6JA 5EQ0A 3K5MA 5LMUL 3OOCA 2PNRC 4X62L 1L0YB 5IGCA 1FJGL 4CKEA 1SYCA 3KLSA 1Z9FA 3HOXG 1HA6A 3BYTB 1TKWB 2JA9A 2YU9B 3KK7A 1E24A 3BZKA 2UXDL 2CH4W 1TS2A 5K36H 5CBEE 2RVLA 2XSCA 1ICWA 4ILWA 3G71A 5BR8L 1BNZA 3KYHC 2PW5A 4DN4M 1Y1WH 2WB1G 1SRUA 2PQAB 3GV6A 4DR7L 1ENAA 4HJ7A 2HUGA 2WAQB 4DXFA 1N33L 3R93A 2CFMA 2ZXPA 2B2YC 4ZUIA 1FGBD 1PH3A 1B44D 2CQOA 1O78A 1D8LA 3TREA 5DAUA 1E3PA 2FMMA 3D4WA 2NVXH 2VL6A 3M3YB 4RGOS 2IX3A 1E1TA 1O7YA 2BOSA 2PI2E 5DNFA 1WTVA 1O80A 3A55A 1EY6A 4G4KA 3BZDB 3M4YA 3RUZA 4B3RQ 2FXQA 3IFDA 1F9RA 3MXNA 1IBKL 1IYJB 3NTKA 3G48A 3S1QB 3A7AB 2X69A 1AW7A 1I6HH 5KYIA 1PDQA 1N36L 3NK9A 1LTAD 4IN3A 3CCUA 2KEDA 3NHHA 5IE8A 4JBMA 3ERSX 4FDBA 1QOHA 3ZJYC 3J80c 2L9HA 1VQLA 3U4VA 3HOZB 3CPWA 3E0JA 4DV5Q 1BBXC 4PZ8A 4XTCS 5M3FH 3KFUA 4BXXG 1KTKA 2KUMA 1HJPA 4IPHA 1NR2A 1GM5A 2R6GA 1F2YA 2WAQG 3CCLA 1PMRA 5M5YB 2VXWA 3I4MH 3AFQA 2OTLA 2JEAI 3DM3A 5IT9E 2M9VA 4MIUA 3GV3A 3CQZH 1VQ4A 4POFA 2F4IA 2K28A 1HFGA 1UNSA 4IPGA 4IURA 1F9PA 3K0XA 5M5XH 1XXGA 3TP5A 4GS3A 1G6PA 1EU3A 3RZOH 1STBA 1I4RA 2UXBQ 4K8IA 2QF7A 1A3UA 1GHKA 4IUTA 1H9RA 2SNSA 2R3ZA 2Z4IA 1WOCA 5HGQA 2E2IB 2JXMB 1TIID 2EJFC 4X3TA 2G5DA 1O7LA 2F0VA 1CHQD 1PTOF 1YNJD 1YNXA 3HOVB 1WYDA 2KCMA 2A6HD 1YHQA 3O13A 1B8AA 2Q2TA 1LTRD 4LF7Q 1CTMA 2G9HD 4ABNA 4HIMA 1K73C 3HOZG 2YV5A 4CBVA 1SBBB 4P2CB 1AH9A 2F0DA 1HZCA 4DV5L 1PH7A 2HQLA 4H13C 3NTHA 4CJ2C 2JA5B 1X3EA 3CHBD 1IL8A 4BY7H 3GTLB 4JI0Q 4HJAA 3M4OB 1PH9A 2BH8A 1U4LA 4KY5A 4OWWB 4JCVE 1BOSA 2B63H 1F2ZA 5C4ZA 1MI2A 2EYOA 3A0JA 1BR9A 4RG1A 5CV9A 1JB3A 1WTQA 3RNUA 1CKNA 2SEBD 4X6AH 2QCPX 1JE5A 3HKZE 1LLRD 2L1BA 3FVQA 3QOLA 5IYCH 4PZ6A 1H9JA 1LTTD 4OWTB 2RHSB 4PZ7A 5C0XJ 1XNRL 1EYAA 1Z6HA 1NNXA 3PIP3 3SEBA 4A3KH 4X64Q 2K04A 2EDGA 4N9PA 3HOVG 4AQYQ 2DJFC 3S1NB 2IJ0A 4IFDJ 1Q82C 4GLVB 4KHPQ 4RKBA 4DK3C 2VZAA 4K5XA 3TZDA 4CDDC 4ZLTF 3TQYA 4HIDA 4IUVA 5BN5A 1SR3A 2ZM6Q 1UWVA 3MAQA 3AYHB 2FINB 4HCSA 1EQTA 1CUKA 2JA5G 2Z8LA 4ME3A 4DK0A 4N8X1 5IIFA 1BBWA 4EQ5A 4OIKA 5A2QL 3GD7A 4C2MH 1NMFA 4RHSA 1E2WA 4RCNA 4XYQA 2I5HA 3NPPA 1GJXA 2XGTA 1N8RC 3H3VC 2B2UA 4JI6Q 3V05A 1BCPB 3OMCA 4CGYB 5C3EB 3QB3A 4LJZC 4IALA 2HCCA 2ZT9C 4YY3Q 4NXML 3TS2A 3FKIH 3EIVA 1DZ1A 1XPRA 1U0LA 4N9TA 4ZKCB 3VYSA 4DV3L 2DY8A 1TVXA 1A2TA 3T4AC 2HIXA 4IFDI 1E2VA 3K80C 4ZUJA 1L0WA 4DR1Q 5KYLA 2ZJPA 1C7YA 1SE8A 3M7GA 2AMCB 2AUJD 2F0JA 2IW3A 2PI2A 2RF4A 1SFOB 1KLGD 4OX9L 4JI3L 4AQYL 2A69C 1QG7A 1OTCA 2LKVA 1RCVD 2UU9L 1X56A 1VQPA 1I4HA 2M00A 4P72A 2H1EA 4KHPL 3MC0B 3Q6SA 1G8ZD 1IKLA 3JAME 2RQXA 1IXRA 3M4QA 1IW7D 4GN5A 4J1MA 1XTDA 3TP7A 1JR0D 2ZM6L 3E3XA 4HJ9A 3NBHA 1NMGA 4LUVA 3PGZA 1FVIA 4NDXA 4CDCC 3GTMB 4KKTA 2F0LA 3TS0A 1R9TH 3X3NA 2A74C 4X3SA 1XTCD 2NUCA 1VQOA 3IRBA 4OO1I 4BBSB 4JYAL 4C1NI 1DOLA 4P75A 1VQCA 1CA6A 1VQFA 5C3EG 5EPJA 2D9UA 5KRUA 5C4XH 3DWPA 2E2HB 2AHOB 1ILPA 4RCOA 4JI6L 2K5WA 1I94Q 4F7XA 4UPAA 1X3QA 3VA7A 4GOPB 2QA4A 2FJ2A 2CWPA 2HIVA 1MHWC 4AYBE 4DUZL 1NAPA 3OTOQ 4V0BA 1ASYA 3D0FA 1PRTB 3P75A 5LL6X 4DR1L 1WTRA 1HZAA 3H3VH 1EY5A 1EIHA 4EQPA 1S5BD 1ZYRC 4NKLA 1JICA 1BBUA 3A8IE 4H7BA 3NP8A 2F0TA 1L1OA 2HD3A 3CC7A 2MP1A 3RLNA 5AJ3L 2EXDA 3BS1A 5AFWA 1SYEA 1ILQA 1QE6A 2X6LA 2TMPA 4F88A 2GVAA 2MO1A 2IWHA 1TWFH 2PMZB 3J80L 4B3SQ 1GUOA 3S2DB 4BBSG 1E7ZA 2UUCQ 1M1KC 1CSPA 1I50H 1RL2A 4K6LA 1FD7D 3MZ5A 1U4MA 1TT2A 2OWOA 1K0SA 1SNCA 1I94L 1DM0B 4YHHL 4B9XA 2WV6D 5I6WA 4XQQA 3A56A 1B1ZA 2YU9H 2Y0SG 3OTOL 4UP7A 1TR5A 2F03A 4LW1A 3ZYYX 1DD2A 2MJ8A 3Q24A 2OXPA 3LX0A 4HJ5A 4K14A 3NWSA 2OQKA 2N8NA 2Z9HA 4EX5A 5I4DA 4C3IB 1SNMA 2AQ1B 1DONA 1KRTA 2NZHA 3ND8A 5LL6S 3H94A 5GROA 1EYDA 3KDFB 2F0KA 1EZ6A 3DUZA 2A19A 3IFTA 2BH2A 1KNAA 5H1SE 1PA6A 1S40A 1QUQB 1WTOA 1CT1D 1LTLA 2BCOA 3M3YH 1EQRA 1KXLA 4B3SL 1HR0Q 1PZID 1HZBA 3DWQA 1J5EL 4PMBA 3FP9A 4DUYQ 2L11A 2NZOA 4R9WA 3AFPA 3TP8A 3L9AX 4ZYSA 4DAYB 1OXUA 5J3BA 4NB3A 4XXEA 2WINB 3S1QH 1Q8IA 1P16A 2CCZA 2B8GA 4IJLA 1B2TA 5C3WA 1VF7A 1EY7A 3TBIB 4DR5L 1EZ8A 2DNEA 2YYZA 3NQTA 4DF7A 1ESRA 2H5XA 2E74C 2Q8IB 2E2JB 2K50A 4HN7A 2NVTB 3M85A 1YJ9A 1VMPA 2RCNA 1QVFA 4QIWB 3CAMA 3RZDB 3GP7A 3HOZH 4RGMA 1S5DD 2CHBD 4DAMA 4DAVA 2E5LQ 5JVG3 4DV4Q 1D5MC 5E7NA 1NUCA 5LHY1 5L37A 1RHPA 4C3IG 2L12A 1PZJD 3H09A 1NSNS 3A8KE 1STEA 2B8FA 4XT1B 4OELB 3E5SA 2WB1E 2NN6G 5M5YH 2B2YA 4HTHA 2E8GA 3A74A 2Q2UA 5IOCA 3KJPA 3V96A 5ELCA 1KL9A 4IFDG 4FNFA 2QDBA 3MVVA 1IKMA 4X65Q 2MFIA 5E3FA 1CA5A 4UY8C 3T56B 3NENA 2K52A 2EYMA 3SR1A 2LXKA 4I7AA 1JJGA 1FYCA 3L0OA 1X55A 4QB4A 5IGFA 4KK7A 1ZYRD 1EOVA 1AE2A 1HXYD 4A3LH 2RHQB 5FLXE 3S17B 2F0GA 3R2TA 1FR3A 2NBFA 5M5WB 1XX8A 5JEAG 4HAEA 5E1FA 3NXWA 2BA0A 2Z0SA 5DEHA 2EYJA 2E2IH 3T1HQ 2JN4A 3KF8B 5EGTA 4OL7A 3C2PA 1FNUA 3HOVH 1AZPA 4DV6L 1A15A 2B39A 4UP9A 1HRJA 4DV0Q 1I3QB 1B3QA 4DV2Q 3BVMA 1PFNA 5ELEA 3MWYW 2Q2IA 3KJOA 5JJIA 2LXJA 5LMUQ 2UUAQ 3G4SA 1VQ7A 1I4GA 1FL0A 1YNNC 3EA6A 4KHVA 4F87A 1BCPC 3AEVA 4TVAB 2OQ0A 4UHVA 4A3IB 2HT1A 1SNPA 3FPUB 1XYIA 2UXDQ 3I4OA 2DJGC 1QB5D 1YZ6A 2JA5H 1AP0A 3S2HB 5IP7G 5BR8Q 1ASZA 1Q12A 3GTLH 2SNMA 4DV7Q 1ZKOA 2XWJB 3PF4A 4P71A 2E2DC 2WAQE 4PMCA 2K03A 2JA6G 4LFCL 3V2TA 1OXXK 2I5LX 2PCFB 3BJUA 3NTIA 4RGNA 1N33Q 2F0FA 4X65L 3CC2A 1PVOA 1V1QA 3P1HA 4BY1H 3SK4A 4KD3A 4HSVA 1TWHH 4IOAA 5M3MB 4OGQC 3J7ZC 3MXPA 2F0UA 1VDZA 2EJMA 2IHFA 2K5DA 1M8AA 2RSNA 1PHJA 5A35A 3S1NH 5CR3A 1Q8KA 4EVOA 4B08A 4WFN3 1PTOD 3ITPA 1C9OA 1N36Q 1HNWQ 3OIQA 4ZQ3A 4DV0L 2XRSD 4DV2L 3D6WA 1GUTA 2K14A 5CV6A 1PYBA 3ULPA 2UUAL 3L3OC 5T1GA 4A3IG 2P5ZX 3NEMA 4KN4C 1YHAA 3MXUA 4RMFA 4GOPC 1HR0W 2F1MA 1ONLA 4UDUC 2OTJA 2K5HA 3K81C 1UE7A 5D65A 4ZRZA 4DV7L 1ENFA 1PRTC 3G6JB 5EBDA 1HA5A 5JAVA 3LWUA 3N6RA 4FF2A 2IX1A 3NSWA 4DXGA 1UE1A 4XT3B 3UE0A 2JA7B 2HDLA 1YJNA 3Q23A 5EKKA 5M3MG 2VS1A 1Y69U 2BA1A 3K6OA 2K5QA 1NJIC 1CI3M 3I72A 2DN8A 1SFOH 5C5LA 3ERQA 1HTPA 1VQKA 1U5KA 3U58A 5CV4A 3GTPB 5I9PA 4BS9A 1Q3LA 1HNWL 1A2UA 1SNDA 1PLFA 1XMOL 4FF4A 4ZK9B 1V1PB 3I2ZA 1XWEA 2NVYB 1CSQA 1VQAA 2JP1A 1WTWA 2DUDA 2EYPA 3VYUA 1AN8A 1SMYC 3GTMH 1BO0A 5IGGA 2RKSA 3E6ZX 1VQ8A 3QR8A 4BBSH 1FNWA 4ZKBB 1QILA 2QILA 2DY7A 1YNND 1X9NA 2EXZA 1Z47A 5NUCA 2E2HH 1PZKD 1BCPD 2JA7G 1Q86C 2XTIA 3FEWX 2O4XA 1UAPA 1DOKA 1VQHA 2ZXOA 1EWHA 4JI5Q 4G7OC 1HQRD 1V1OA 4TRDA 5KNDA 1XNRQ 1VQ5A 3W3AA 1CK1A 2C35B 1LT4D 4IO9A 1CQVA 4DR3Q 1KABA 2EY6A 1A3TA 4JI8Q 1PFSA 4XQNA 1VQMA 3GTGB 2VNUD 4ALPA 2OEOA 3T51B 2O5JC 4A3DB 2J0TD 3K7UC 5KNCA 3S14B 3S1RH 2CKZB 4A3JB 2GN5A 4C3HB 3U9SA 2K75A 4IUQA 1HQMC 3URYA 1V9PA 3J80i 3S2DH 3PO3B 1A63A 3S15B 1SE4A 3PUWA 5CC4A 1SYGA 1UE6A 2AWOA 2IPKD 2Q8RE 1N34Q 2R92B 1DGSA 2CWAA 1WTPA 1GOZA 2I5MX 1SMXA 4ME5A 4Y7NB 5TSSA 2RA4A 2HHHL 4LF9Q 2PQAA 3HG9A 1D1KA 3S16B 3SVMA 3AQQA 3M7NA 1PH6A 2V4DA 4NXMQ 4GKJL 4ZCKA 4JI5L 3HOYB 3S1MH 4CJ1B 2K5VA 1XJVA 4DV1Q 4DV3Q 1PRTD 4CKBA 1TWCH 3JC66 5CGKA 5EJWA 4C3IH 4DR3L 4JI8L 3IKJA 4A3DG 5FKAC 4OX9Q 4JI3Q 2XVSA 5EPLA 2LMCB 3K8AA 2XNAC 2NN6H 4RWSC 4A3JG 4KHZA 2UU9Q 4CJ0B 3C46A 4C3HG 5C4JB 1JORA 1QWYA 3IL8A 2ID0A 4I65A 3PIO3 4KI0A 2UXCL 3DXJC 3GO5A 3CRLC 3PO3G 1AE3A 5JJKA 4GLXA 4A75A 3TSSA 4LFBQ 1PYWD 3EVQA 5IT9c 1H9SB 3J81E 3L2PA 1C8CA 1YHBA 4LNQA 1GHJA 1MGSA 2R92G 4PNYA 4APVA 3TP6A 2MHVA 1IZ6A 1N34L 1SNQA 3OWEB 1GVPA 2KENA 5JEAH 2AWNA 3R8BA 4JYAQ 2D0PA 1U4RA 1D6EC 3PF5A 2VUMB 1CHPD 3BZCA 1XMQL 1S4ZA 1C48A 3CCEA 3WOFA 4LF9L 5C0XI 3PUVA 1CKOA 4NP5A 2VQFQ 1BCPF 1SMYD 3HOYG 2NVTH 4Y52H 3CPFA 3BDCA 4EQNA 4DKAC 4B9WA 3T53B 2I46A 4TQUS 3S9WA 1R4QB 3RZDH 3KLSX 2VB2X 5LMNQ 4DV1L 3G7LA 4YWLA 4DUZQ 1G51A 2EZVA 4A4IA 1YI2A 4JOIC 4KJNA 3EJIA 2A1AA 4IJHA 1D1IA 5FK9C 4OIJA 4S3SA 3KOJA 3RLOA 5IP7H 1BDOA 1E1OA 4DR2L 3AMUA 2JA8B 4O42A 4MTNA 4JI7L 4NMZA 3F2BA 1D5XC 2CW0C 3Q0AA 5AJ3Q 2K6AA 5IP9G
chains in the Genus database with same CATH topology
2D5DA 1G6ZA 3OSOA 2D2CC 4K5VA 3QIAA 2NVXB 5I2XA 4QCLA 1DCZA 3P7JA 3TN2A 1NCVA 2PZWA 1GUWA 1OXSC 1HUMA 4R8IA 2Q8TA 1H9KA 5IODA 4I7ZC 1R4PB 3NWTA 4QMGA 1S5CD 1LO5D 3H0GB 1SYDA 1F2LA 5ELBA 4A3FB 2O2LD 1V8QA 5FOBB 2NVQB 1PRTF 2N55A 2Y0SB 1X32A 2EYFA 2EPBA 1SE2A 1KDAA 3K7AB 4F8MA 1LT5D 1JWSD 4MHEA 3A7LA 4XIGS 2GA4B 3SXHA 4BBRB 1MD2D 3VR4A 5M9OA 1JC7A 5T1IA 2JYOA 2A68C 4JK1C 5M5XB 1OXTA 1RTOA 5FO8B 4DU9A 1SSOA 3K5OA 1KNEA 2QKIC 2PZTA 1EWCA 3C1EA 2B2VC 1ML0D 1HTLD 3RD4A 2F0HA 4HMIA 1B3AA 1SEBD 4QF4A 5I2YA 1MBYA 2IL8A 1JWUD 2NWGA 2WKDA 2EYLA 4FP5D 5IGDA 2K05A 4K5WA 4U673 3I91A 5JJZA 4BY7B 2ICEC 4FF3A 1STAA 1LTID 2K01A 1EY0A 4RA8A 3D6CA 2F0QA 2F0EA 1V43A 1I4QA 3WOEA 2A69D 3OIPA 2KCNA 1ZXTA 2CW0D 3GTKB 3F2UA 4ODGA 1T5EA 4UAIA 3I90A 2A5HA 4BWGB 5A2QE 4X3UA 4A3BB 3NE5B 5FO9B 5C3XA 5D14A 4C1NK 1U9RA 4A93B 3PO2B 4DAPA 2L0CA 4WORA 2E76C 5C44B 1LTGD 5C0XG 3HOUB 5K5PA 3Q22A 3QG1A 4O1NA 1TWAB 3HOWB 1IYUA 4K6DA 3FKIB 1I4XA 1S5ED 4FO2A 2JA6B 3I4LA 2CVRA 2B2WC 5E4WC 4J6HA 1LACA 4IUNA 1RKNA 2QEJC 2B2TC 5IT9L 5CYUA 2RDFA 5FO7B 1JCKB 4MN3A 4KKUA 3SK8A 2A68D 1RF2D 3QWNA 4ID6A 4IQZA 1F2MA 1TWGB 4KY6A 4DK1A 4KV6A 5EKIA 4OO1G 1KAAA 4Z9CB 3K57A 3BYYB 1HCZA 2EVBA 2HDMA 3VR3A 3IAYA 2VB3X 3GTJB 4J8QA 4OHJA 1HPCA 1CFMA 3GTQB 3TMEA 1OO9B 2NZ1D 2PW7A 2F3VA 5KIXA 3KLRA 3N52A 2H4OA 3PUXA 1I6VC 2A6EC 5CV7A 4G57A 3X3MA 2WACA 5COYA 1RDPD 3SK5A 5DM73 3BDOA 5J39A 2XWBB 2F0NA 1A3VA 1B9MA 3J80E 4DAYA 4FF1A 1PFMA 4C3JB 4NW2A 4U68A 4PMWA 1BXTA 1Y8OB 2A6HC 3SDZA 2RSOA 3D4RA 3H6MA 1EFID 5KEEA 5EPKA 4CHTB 1B9NA 1BF4A 2R7ZB 4PV1C 1F9SA 3FMCA 1WD1A 2OF1A 1ET6A 1LT3D 1Q1BA 4YIJA 1CZGA 2LS01 1G2TA 2J7ZA 5KNBA 1QCBD 1LTSD 2MGSA 2PO4A 3P20A 1CZWA 1M4VA 3GTOB 5ISRA 1BQQT 2PQEA 5HURA 2BDOA 3WDNA 4JBWA 2L5TA 3SE0A 4A3EB 3KBGA 3RMHA 1EEID 4QUCA 1JOKA 4C56C 1QJOA 4GZYC 1GUSA 4R8NA 3KBXA 2M2LA 3LWEA 3FRPB 1KLUD 4C3JG 1JQYD 3I73A 3ONAB 2K1BA 4FXDA 3BVGA 3KF8A 2LFNA 1DJRD 1K8MA 3VYRA 1S5FD 1VF5C 3J7YW 1RD9D 1BUVT 1Y1VB 1MSGA 2EY5A 3K59A 5JVH3 1HUNA 3MXGA 5D3IB 3JAML 3VYTA 1WCMB 5CV5A 3UI2A 1Q1EA 3T13A 1K8OA 1SE3A 1VCIA 4RAUC 4PQXA 1E2ZA 2N88A 3H91A 1DOMA 2HCIA 2R61A 4ULLA 2NTTA 1KDBA 2G9DA 1D5ZC 2OT2A 4IZ8A 2MPMA 2SDFA 2XN9C 3MA2B 5JPMC 2A6ED 2A73B 3OPOA 4LMQD 1PXUA 3U9OA 4KN7C 4RKLA 2DNCA 4IUPA 2XIWA 4TSSA 4FVMA 3PV0A 1B4OA 3D4DA 1IW7C 1C4QA 3D31A 3OHXC 4A3MB 1EY9A 1K83B 2EOTA 2KA7A 3NQIA 2KHSA 3RLFA 1O7ZA 1PTOB 1Q90A 2Z4HA 3BDLA 1VMCA 1ENCA 1J8IA 1STGA 3MEHA 5JPNC 3I4NB 1B53A 4KMUC 1WTXA 1E0BA 2R93B 1Z7TA 1ESFA 2F0SA 1TS5A 5ELFA 2Z1CA 3OMGA 1QNKA 4HSPA 3AB9A 2D62A 1H9MA 3DWAA 4G7HC 4A3GB 1AZQA 5C0XH 3HEJA 1UEAB 3VR6A 1RTNA 3A8JE 2K32A 1B50A 4BY1B 2NYZD 4V190 4IFDH 1EQVA 2PZUA 3R3OA 1TWHB 2KCCA 3I8ZA 1V1PA 5KGUA 2I07B 2B2VA 2WKCA 3C3LA 1II3A 3D3RA 1LABA 1LTBD 1I4PA 1TY0A 3DMUA 1STHA 4M1UB 5JOBA 1X3PA 2NTSA 5C4HA 2FHTA 1SNOA 1F9QA 5CORA 4RH6A 3R2IA 3VA5A 5JEAJ 2KOLA 2LY7A 1EL0A 2KVMA 4OO1H 1A6XA 3K5NA 5G3LD 5HGTA 1GUGA 3SK6A 1Y1WB 1RODA 1G2SA 1TY2A 3L7ZC 5CV8A 1UUPA 3MFGA 4M8AA 2NN6I 4L8JA 4Q5VA 2JE6I 1IYVA 3HKZB 5IGBA 2PPBC 4FXKC 4BA1I 1DYQA 1IHZA 1HHVA 1ET9A 3T16A 4HMJA 3TZUA 4E6IA 2O5IC 4XYOA 1I6HB 2FFKB 5FLXL 2C9OA 1FNVA 2XRQD 1STNA 4IUUA 1WD0A 3PUZA 2KECA 5I6YA 3QO2A 5J22A 2CQAA 5IGEA 5K36G 2F0IA 3K5LA 5M3FB 4QUFA 1TS3A 4H0LC 4K8JA 5CBAE 2KJXA 4HR7B 4BA2I 3I4MB 3CQZB 3QJYA 1MSHA 2B2WA 1SYFA 3W2DA 1RJTA 1EIGA 1TU2B 4KD4A 3RZOB 2B2TA 4TKOB 5C5MA 3SHLA 1H9SA 3OWFA 1L0XB 2IX0A 4DFAA 2AQ3B 3DEOA 5E4XA 3NUCA 4KY7A 2KEEA 2HQEA 2NB0A 3LNNA 3S1RB 2BDNA 5BN4A 3KUPA 2BE5C 2IT1A 3I70A 1SJED 4EQOA 4RHRA 3ND9A 1AFPA 4G7ZC 5D3DA 2SOBA 2JEBI 5G3LF 1J9OA 2F3WA 2FMCA 1EYCA 1GUNA 1W6KA 2B63B 2K7VA 1NR4A 2F0OA 4ZAIA 4X3KA 1JOQA 2B2UC 4XQJA 1CQFA 4Q0FA 3K58A 3S1MB 5DM63 3TDQA 4AYBB 4RGTA 4DNTB 3HS0C 1TWCB 5F2DA 3J7AF 1HFNA 3DM1A 3CKIB 4A3KB 3PUYA 1LT6D 3EROA 2JSOA 2F0MA 3CU7A 3FDTA 1LV9A 3MTSA 1SAPA 2AQ2B 3C1FA 1PTOC 3VR2A 1Y8NB 4WRDA 5BN3A 2RDGA 2AUKA 4L63B 2RBMA 2EY2A 3MHBA 4HEDA 3MFYA 3BG3A 2ZXRA 3FPPA 4C2MB 3DHQA 4L6TB 2WP8J 2L55A 3OW7A 1DXMA 2C5CA 2F0PA 2X6GA 1JE4A 2L4NA 4DA2A 2ENBA 1SYBA 3VR5A 1SXTA 4LAAA 1SDFA 1EY8A 4H44C 4RFBA 4WJWA 2ICIA 3K0YA 1OXVA 1STYA 4DGZA 4XDXA 3I3CA 4KJOA 4CKCA 4HCEA 3BVZA 3J7AV 1GXDC 1G291 1G91A 2EYHA 3CRKC 4EGVA 2EJGC 3QOJA 2F0WA 1R9TB 1F77A 5C6AA 1CM9A 5EKLA 4K2LA 2BE5D 5I9OA 1PTOH 3D8GA 5J1ZA 1U4PA 5C4XB 1TS4A 1Y8PB 2J4XA 1T5XD 5CMDA 3HGBA 1EU4A 3GQBA 2PYKA 1WVLA 3HOXB 1QNUA 2MUYA 1PFBA 4DNRB 3DEPA 3NBIA 1EY4A 2WB1B 3HRZC 1KDCA 2RDHA 3EFXD 2EY1A 4KTAA 4LK1C 1EOTA 1YNJC 3AU7A 1TWFB 3PMFA 2KQ3A 1AEXA 1D2BA 5ELDA 1JWMD 2WIIB 3HP3A 4KKSA 1I50B 1JOOA 2K33A 4FYDA 1SJHD 2EE1A 4K2KA 2E75C 1ZEQX 3EQLC 3HZXA 5EBCA 3J81L 2TSSA 4FXGC 3A54A 1EEFD 1TQOA 1W6JA 5EQ0A 3K5MA 3OOCA 2PNRC 1L0YB 5IGCA 4CKEA 1SYCA 3KLSA 1HA6A 3BYTB 1TKWB 2YU9B 3KK7A 1TS2A 5K36H 5CBEE 2RVLA 2XSCA 1ICWA 4ILWA 1BNZA 2PW5A 4DN4M 3GV6A 1ENAA 2HUGA 2WAQB 4DXFA 3R93A 2ZXPA 2B2YC 4ZUIA 1FGBD 1B44D 1O78A 5DAUA 2FMMA 3D4WA 3M3YB 4RGOS 2IX3A 1O7YA 2BOSA 5DNFA 1WTVA 1O80A 3A55A 1EY6A 4G4KA 3BZDB 3M4YA 3RUZA 3IFDA 1F9RA 3MXNA 3NTKA 3S1QB 3A7AB 2X69A 1AW7A 5KYIA 1PDQA 3NK9A 1LTAD 4IN3A 2KEDA 3NHHA 1QOHA 2L9HA 3HOZB 3E0JA 1BBXC 4XTCS 1KTKA 2KUMA 1NR2A 2R6GA 1F2YA 1PMRA 5M5YB 2VXWA 2JEAI 5IT9E 2M9VA 4MIUA 3GV3A 2F4IA 2K28A 1HFGA 1UNSA 4IURA 1F9PA 1XXGA 3TP5A 1EU3A 1STBA 1I4RA 4K8IA 2QF7A 1A3UA 1GHKA 4IUTA 1H9RA 2SNSA 2R3ZA 2Z4IA 2E2IB 2JXMB 1TIID 2EJFC 4X3TA 1O7LA 2F0VA 1CHQD 1PTOF 1YNJD 3HOVB 2A6HD 3O13A 1LTRD 1CTMA 2G9HD 4ABNA 4CBVA 1SBBB 4P2CB 2F0DA 4H13C 3NTHA 4CJ2C 2JA5B 3CHBD 1IL8A 3GTLB 3M4OB 1U4LA 4KY5A 1BOSA 1F2ZA 5C4ZA 1MI2A 2EYOA 1BR9A 5CV9A 1JB3A 1WTQA 2SEBD 2QCPX 1LLRD 2L1BA 3FVQA 3QOLA 1H9JA 1LTTD 5C0XJ 1EYAA 1Z6HA 3PIP3 3SEBA 2K04A 2EDGA 4N9PA 3S1NB 2IJ0A 4IFDJ 4RKBA 4K5XA 3TZDA 4ZLTF 4IUVA 5BN5A 3MAQA 2FINB 4HCSA 1EQTA 2Z8LA 4DK0A 5IIFA 4OIKA 5A2QL 3GD7A 4RHSA 1E2WA 4RCNA 4XYQA 3NPPA 1GJXA 3H3VC 2B2UA 3V05A 1BCPB 3OMCA 4CGYB 5C3EB 3QB3A 4LJZC 4IALA 2HCCA 2ZT9C 1DZ1A 4N9TA 4ZKCB 3VYSA 2DY8A 1TVXA 1A2TA 3T4AC 4IFDI 1E2VA 4ZUJA 5KYLA 3M7GA 2IW3A 2AUJD 2F0JA 1SFOB 1KLGD 2A69C 1QG7A 2LKVA 1RCVD 1I4HA 2M00A 2H1EA 3MC0B 3Q6SA 1G8ZD 1IKLA 3JAME 2RQXA 1IW7D 3TP7A 4J1MA 1JR0D 3NBHA 4NDXA 3GTMB 4KKTA 2F0LA 3X3NA 2A74C 4X3SA 1XTCD 2NUCA 4OO1I 4BBSB 4C1NI 1DOLA 1CA6A 5EPJA 2D9UA 5KRUA 3DWPA 2E2HB 1ILPA 4RCOA 2K5WA 4F7XA 1X3QA 3VA7A 2FJ2A 1NAPA 4V0BA 1PRTB 3P75A 5LL6X 1WTRA 1EY5A 1EIHA 4EQPA 1S5BD 1ZYRC 4NKLA 1JICA 4H7BA 3A8IE 3NP8A 2F0TA 2MP1A 3BS1A 5AFWA 1SYEA 1ILQA 1QE6A 2X6LA 2TMPA 4F88A 2IWHA 2PMZB 3J80L 1GUOA 3S2DB 4K6LA 1FD7D 3MZ5A 1U4MA 1TT2A 1SNCA 1DM0B 4B9XA 2WV6D 5I6WA 4XQQA 3A56A 1B1ZA 1TR5A 2F03A 3ZYYX 1DD2A 2MJ8A 3Q24A 2OXPA 3LX0A 4K14A 3NWSA 5I4DA 4C3IB 1SNMA 2AQ1B 1DONA 3ND8A 5LL6S 3H94A 1EYDA 2F0KA 1EZ6A 3DUZA 3IFTA 1KNAA 1WTOA 1CT1D 2BCOA 1PZID 3DWQA 4PMBA 2L11A 4R9WA 3TP8A 3L9AX 4ZYSA 1OXUA 4XXEA 2WINB 1Q8IA 2B8GA 1B2TA 5C3WA 1VF7A 1EY7A 3TBIB 1EZ8A 2DNEA 2YYZA 3NQTA 4DF7A 1ESRA 2E74C 2Q8IB 2E2JB 4HN7A 2NVTB 3M85A 1VMPA 4QIWB 3RZDB 3GP7A 4RGMA 1S5DD 2CHBD 4DAVA 5JVG3 1D5MC 1NUCA 5LHY1 1RHPA 4C3IG 2L12A 1PZJD 3H09A 1NSNS 3A8KE 1STEA 2B8FA 4XT1B 3E5SA 2NN6G 2B2YA 4HTHA 5IOCA 3V96A 5ELCA 4IFDG 4FNFA 2QDBA 3MVVA 1IKMA 5E3FA 1CA5A 3T56B 2EYMA 3SR1A 1FYCA 5IGFA 4QB4A 4KK7A 1ZYRD 1HXYD 5FLXE 3S17B 2F0GA 3R2TA 1FR3A 2NBFA 5M5WB 1XX8A 5JEAG 4HAEA 5E1FA 3NXWA 2BA0A 5DEHA 2EYJA 5EGTA 4OL7A 3C2PA 1FNUA 1AZPA 1A15A 2B39A 1HRJA 1I3QB 3BVMA 1PFNA 5ELEA 3MWYW 1I4GA 1YNNC 3EA6A 4KHVA 4F87A 1BCPC 4A3IB 1SNPA 3FPUB 1XYIA 1QB5D 1AP0A 3S2HB 1Q12A 2SNMA 1ZKOA 2XWJB 2E2DC 4PMCA 2K03A 3V2TA 1OXXK 2PCFB 3NTIA 4RGNA 2F0FA 3P1HA 3SK4A 4KD3A 4HSVA 5M3MB 4OGQC 3MXPA 2F0UA 1VDZA 2EJMA 2K5DA 1M8AA 2RSNA 5A35A 5CR3A 4EVOA 4B08A 4WFN3 1PTOD 3ITPA 3OIQA 4ZQ3A 2XRSD 3D6WA 1GUTA 5CV6A 3L3OC 5T1GA 4KN4C 3MXUA 2F1MA 1ONLA 4UDUC 5D65A 4ZRZA 1ENFA 1PRTC 3G6JB 5EBDA 1HA5A 5JAVA 3LWUA 3N6RA 4FF2A 2IX1A 3NSWA 4DXGA 4XT3B 2JA7B 2HDLA 3Q23A 5EKKA 1Y69U 2BA1A 3K6OA 2K5QA 1CI3M 3I72A 2DN8A 5C5LA 3ERQA 1HTPA 5CV4A 3GTPB 5I9PA 4BS9A 1Q3LA 1A2UA 1SNDA 1PLFA 4FF4A 4ZK9B 1V1PB 1XWEA 2NVYB 2JP1A 1WTWA 2EYPA 3VYUA 1AN8A 1SMYC 1BO0A 5IGGA 2RKSA 3E6ZX 1FNWA 4ZKBB 1QILA 2QILA 2DY7A 1YNND 2EXZA 1Z47A 5NUCA 1PZKD 1BCPD 3FEWX 2O4XA 1UAPA 1DOKA 2ZXOA 1EWHA 4G7OC 1HQRD 1V1OA 4TRDA 5KNDA 3W3AA 1CK1A 1LT4D 1CQVA 1KABA 2EY6A 1A3TA 4XQNA 3GTGB 2VNUD 2OEOA 3T51B 2O5JC 4A3DB 2J0TD 5KNCA 3S14B 4A3JB 4C3HB 3U9SA 4IUQA 1HQMC 3URYA 3PO3B 3S15B 1SE4A 3PUWA 5CC4A 1SYGA 2AWOA 2IPKD 2Q8RE 2R92B 1WTPA 1GOZA 4ME5A 4Y7NB 5TSSA 2RA4A 3HG9A 1D1KA 3S16B 3SVMA 3M7NA 2V4DA 3HOYB 4CJ1B 1PRTD 4CKBA 5CGKA 5EJWA 3IKJA 5FKAC 2XVSA 5EPLA 2LMCB 2XNAC 2NN6H 4RWSC 4KHZA 4CJ0B 3C46A 4C3HG 5C4JB 1JORA 1QWYA 3IL8A 2ID0A 4I65A 3PIO3 4KI0A 3DXJC 3GO5A 3CRLC 3TSSA 1PYWD 3EVQA 3J81E 1H9SB 1C8CA 1GHJA 1MGSA 4PNYA 3TP6A 2MHVA 1SNQA 3OWEB 5JEAH 2AWNA 3R8BA 1U4RA 1D6EC 2VUMB 1CHPD 1S4ZA 1C48A 3WOFA 5C0XI 3PUVA 4NP5A 1BCPF 1SMYD 4EQNA 3BDCA 4B9WA 3T53B 2I46A 4TQUS 3S9WA 1R4QB 3KLSX 2VB2X 3G7LA 2EZVA 4KJNA 3EJIA 1D1IA 5FK9C 4OIJA 4S3SA 1BDOA 2JA8B 3AMUA 4O42A 4NMZA 1D5XC 2CW0C 3Q0AA 2K6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RDF A;  4DFA A;  3OSO A;  4K5V A;  5IGD A;  4N9P A;  2F0P A;  4K5W A;  5C5L A;  5KRU A;  3ERQ A;  3NUC A;  1SNP A;  3SK8 A;  5J39 A;  4KY7 A;  3PMF A;  4F7X A;  2KQ3 A;  3VA5 A;  1AEX A;  3D4D A;  5CV4 A;  5ISR A;  5HGT A;  2ENB A;  2HQE A;  4PMB A;  3SK6 A;  5I9P A;  2SNM A;  1A2U A;  1SYB A;  1F2Y A;  1SND A;  4ID6 A;  4RKB A;  4K5X A;  2PQE A;  1F2M A;  1EY9 A;  3TP8 A;  5HUR A;  1JOO A;  1STA A;  2PZW A;  4PMC A;  4LAA A;  4KY6 A;  4KTA A;  3V2T A;  1EY8 A;  4K2K A;  3P75 A;  1JOK A;  5CV8 A;  2KHS A;  4KV6 A;  4MIU A;  3BDL A;  2F0F A;  3HZX A;  4R8N A;  5IOD A;  4EQO A;  5C3W A;  1EY5 A;  1EY0 A;  1ENC A;  2EYP A;  4EQP A;  1EY7 A;  5CGK A;  1KAA A;  1EZ8 A;  1STG A;  2F0Q A;  3D6C A;  3NQT A;  3P1H A;  4NKL A;  4QMG A;  1TQO A;  3SK4 A;  4DF7 A;  4H7B A;  5IIF A;  5IGG A;  4KD3 A;  2RKS A;  3NP8 A;  2F0T A;  2F0E A;  3TP5 A;  5IGB A;  1STY A;  3MEH A;  2SOB A;  1STB A;  4DGZ A;  5IGC A;  4K8I A;  1SYD A;  1SYC A;  3TME A;  2F3W A;  1A3U A;  3MXP A;  2F0U A;  4KJO A;  2PW7 A;  1EYC A;  1SYE A;  1JOR A;  2F3V A;  5KIX A;  1IHZ A;  2F0S A;  2SNS A;  3T16 A;  2EXZ A;  4HMJ A;  1NUC A;  4I65 A;  5NUC A;  4E6I A;  2EY5 A;  2F0O A;  3OMC A;  2F0V A;  4ODG A;  2EYH A;  3QB3 A;  5CR3 A;  3OMG A;  4IAL A;  3EVQ A;  4G57 A;  2PW5 A;  5CV7 A;  2EYF A;  4EVO A;  2O4X A;  1JOQ A;  3ITP A;  4N9T A;  1NSN S;  2WAC A;  3QOJ A;  2F0W A;  4ZQ3 A;  1KDA A;  1STN A;  3E5S A;  4F8M A;  4PNY A;  1A2T A;  1ENA A;  3HEJ A;  3TP6 A;  5C6A A;  4TRD A;  3SK5 A;  4HTH A;  1SNQ A;  3MZ5 A;  5CV6 A;  5IOC A;  4ZUJ A;  5EKL A;  5CV5 A;  3SXH A;  5I6Y A;  5C3X A;  4K2L A;  5I9O A;  2QDB A;  5F2D A;  5KYL A;  3MVV A;  3D8G A;  4ZUI A;  5J1Z A;  3T13 A;  5IGE A;  5J22 A;  1U9R A;  5E3F A;  5M9O A;  2F0N A;  2F0D A;  2F0J A;  1A3V A;  1KAB A;  2EY6 A;  2EYM A;  1A3T A;  1TT2 A;  2F0I A;  3ERO A;  3SR1 A;  1EQV A;  4NP5 A;  5DAU A;  4WOR A;  1SNC A;  2PZU A;  3R3O A;  5IGF A;  4QB4 A;  4DU9 A;  3D4W A;  5KGU A;  2LKV A;  2F0M A;  2OEO A;  4B9X A;  4EQN A;  3BDC A;  2F0G A;  1KDB A;  2M00 A;  2PZT A;  5K5P A;  5I6W A;  3RUZ A;  1EY6 A;  4B9W A;  4KY5 A;  3S9W A;  4K8J A;  2PYK A;  1II3 A;  3C1F A;  3C1E A;  4IZ8 A;  3TP7 A;  4J1M A;  1F2Z A;  1TR5 A;  5E1F A;  5C4Z A;  5JAV A;  3NXW A;  2EYO A;  2EYJ A;  5DEH A;  3H6M A;  4WRD A;  5EGT A;  5KEE A;  4OL7 A;  2OXP A;  3LX0 A;  4K6D A;  4KJN A;  5CV9 A;  3EJI A;  4K14 A;  5KYI A;  2F0H A;  4NDX A;  3DMU A;  1STH A;  4S3S A;  3NK9 A;  1SYF A;  4HMI A;  1SNM A;  2F0L A;  3NHH A;  2RBM A;  5JOB A;  2OF1 A;  1SYG A;  5EKK A;  5CC4 A;  2EY2 A;  3QOL A;  5C4H A;  1EY4 A;  3MHB A;  2NUC A;  4NMZ A;  4J6H A;  4KD4 A;  4QF4 A;  1SNO A;  1EYD A;  3DHQ A;  3U9O A;  1KDC A;  1EYA A;  2F0K A;  4IUN A;  1RKN A;  5C5M A;  4KHV A;  4ME5 A;  1EZ6 A;  4RKL A;  3SHL A;  2EY1 A;  3OWF A;  4YIJ A;  2EYL A; 
#chains in the Genus database with same CATH topology
 2D5D A;  1G6Z A;  3OSO A;  2D2C C;  4K5V A;  3W1G A;  1YIT A;  2GVB A;  3QIA A;  2PMZ E;  4JW0 A;  2NVX B;  3H15 A;  2MQH A;  4LFB L;  5I2X A;  3S17 H;  1B70 B;  4GLA C;  3UE1 A;  4QCL A;  3LGJ A;  1DCZ A;  3P7J A;  3TN2 A;  1NCV A;  2PZW A;  2R7D A;  2VUM G;  4KLK A;  5IWA Q;  1GUW A;  1OXS C;  1HUM A;  4R8I A;  2Q8T A;  4B3M L;  1H9K A;  5IOD A;  4I7Z C;  1P8L A;  1R4P B;  3OW2 A;  3NWT A;  4QMG A;  4R4Q A;  1I3Q H;  1S5C D;  2VQF L;  1LO5 D;  4LUZ A;  3H0G B;  1NBW A;  1SYD A;  1VQD A;  4YHH Q;  1F2L A;  5ELB A;  4A3F B;  3S24 A;  1Q7Y C;  1X54 A;  2O2L D;  5LMN L;  1V8Q A;  5FOB B;  1VQ6 A;  2NVQ B;  4YCU A;  1T9H A;  2IY5 B;  4A3I H;  1JT8 A;  1PRT F;  4K0K Q;  3HOX H;  2JQO A;  3S2H H;  2N55 A;  2Y0S B;  1X32 A;  4NXN L;  2EYF A;  2JA8 G;  1XNQ Q;  1B7Y B;  2EPB A;  1SE2 A;  1KDA A;  3K7A B;  4F8M A;  4LF5 L;  1LT5 D;  2ZTE A;  1JWS D;  4MHE A;  3A7L A;  3E0E A;  4XIG S;  2K5N A;  5GAD C;  2GA4 B;  3KLW A;  3SXH A;  4X66 Q;  4BBR B;  1MD2 D;  3VR4 A;  2CH4 A;  5M9O A;  1JC7 A;  5T1I A;  2JYO A;  2EIF A;  2A68 C;  4IPC A;  4JK1 C;  5M5X B;  1OXT A;  1RTO A;  5FO8 B;  4B3T Q;  1SSO A;  4DU9 A;  3K5O A;  4YWK A;  1KNE A;  5M3M H;  2QKI C;  2PZT A;  1J5E Q;  1EWC A;  1UE5 A;  3C1E A;  2B2V C;  1XPU A;  1ML0 D;  4JV5 L;  1WI5 A;  1HTL D;  5IWA L;  2QW7 A;  2I0Q A;  3RD4 A;  2F0H A;  3H0G G;  4HMI A;  1B3A A;  4DR5 Q;  1SEB D;  1IL2 A;  4A3F G;  2YTX A;  4QF4 A;  5I2Y A;  4L5T A;  4LUO A;  1MBY A;  2IL8 A;  4QIW E;  1JWU D;  5GAG C;  2NWG A;  2WKD A;  2EYL A;  2QEX A;  4FP5 D;  5IGD A;  4R4O A;  2K05 A;  4K5W A;  4U67 3;  4GNX B;  4K0K L;  3I91 A;  5JJZ A;  4BY7 B;  1VQI A;  1XNQ L;  2ICE C;  4HJ8 A;  3H3V I;  4BXX H;  4FF3 A;  1STA A;  4LWC A;  4BBR G;  1IBL Q;  4X66 L;  1LTI D;  3CXC A;  1KQS A;  2K01 A;  1EY0 A;  4RA8 A;  2JA7 H;  3D6C A;  2F0Q A;  3TRZ A;  4B3T L;  2F0E A;  1V43 A;  1PH8 A;  1YEZ A;  1I4Q A;  3WOE A;  1K9M C;  2A69 D;  1JJC B;  3OIP A;  2KCN A;  1ZXT A;  2CW0 D;  3GTK B;  3CCV A;  4R1J A;  4A76 A;  3F2U A;  4ODG A;  1T5E A;  4UAI A;  3I90 A;  2A5H A;  4BWG B;  4DV6 Q;  5A2Q E;  4L5Q A;  4X3U A;  4A3B B;  3NE5 B;  2NVY H;  4L5S A;  5FO9 B;  5C3X A;  2ATW A;  5D14 A;  4C1N K;  4GOP A;  1U9R A;  1X6O A;  4A93 B;  3PO2 B;  4BY7 G;  1WFQ A;  4DAP A;  2L0C A;  4WOR A;  2E76 C;  5C44 B;  4LFA L;  1LTG D;  3NEL A;  5C0X G;  3HOU B;  5K5P A;  2YTV A;  3Q22 A;  3QG1 A;  4O1N A;  1TWA B;  3HOW B;  1IBL L;  1QZH A;  1IYU A;  4K6D A;  3FKI B;  4LFC Q;  2Z6K C;  1I4X A;  1S5E D;  4FO2 A;  2JA6 B;  3PSI A;  3I4L A;  3BU2 A;  3ICE A;  2CVR A;  2B2W C;  5E4W C;  4JBK A;  4J6H A;  4LF8 Q;  3E9H A;  1LAC A;  1VQJ A;  4IUN A;  1RKN A;  1W3S A;  2QEJ C;  2B2T C;  5IT9 L;  5CYU A;  2RDF A;  5FO7 B;  1JCK B;  1WJJ A;  4MN3 A;  4KKU A;  4WJ4 A;  3SK8 A;  3GTG H;  2V1C C;  2A68 D;  2PNH A;  1RF2 D;  1X3F A;  4A3D H;  3QWN A;  3S14 H;  4A3B G;  4ID6 A;  4IQZ A;  3F2D A;  1F2M A;  4A3J H;  1TWG B;  4KY6 A;  5EAY A;  4DK1 A;  4A93 G;  3PO2 G;  4KV6 A;  5EKI A;  5C44 G;  3PO3 H;  4OO1 G;  1KAA A;  3MXN B;  4Z9C B;  3BYY B;  3K57 A;  1HNZ L;  1HCZ A;  2EVB A;  3S15 H;  2R7F A;  2HDM A;  3VR3 A;  3IAY A;  3HOU G;  2VB3 X;  3GTJ B;  1NY4 A;  4J8Q A;  4OHJ A;  1HPC A;  1CFM A;  3GTQ B;  3GDE A;  1PH1 A;  3TME A;  3HOW G;  1OO9 B;  2NZ1 D;  3M4O H;  2PW7 A;  2F3V A;  3PCO B;  5KIX A;  3KLR A;  3N52 A;  2H4O A;  3FKI G;  3PUX A;  1I6V C;  1RIP A;  3STB C;  3S16 H;  2A6E C;  5CV7 A;  4DR4 Q;  1NE3 A;  4G57 A;  1HZ9 A;  3KDF A;  3ULJ A;  2WAC A;  1S3O A;  3X3M A;  2L15 A;  3HOY H;  5COY A;  1RDP D;  1VQN A;  3WWV A;  4MNO A;  3SK5 A;  5FJ8 G;  1HH2 P;  4LF8 L;  3CCJ A;  1QUQ A;  1YIJ A;  5DM7 3;  3BDO A;  2MNA A;  5J39 A;  3KF6 A;  1EYG A;  1JMC A;  2XWB B;  2F0N A;  1A3V A;  4AIM A;  1B9M A;  1A8V A;  3J80 E;  3CCQ A;  4DAY A;  4FF1 A;  1PFM A;  4C3J B;  4NW2 A;  4JI2 Q;  5C4J H;  4U68 A;  2VY3 A;  4PMW A;  1BXT A;  1Y8O B;  4H02 A;  1XMO Q;  2A6H C;  3SDZ A;  5IP9 H;  3FHW A;  2RSO A;  3D4R A;  3F1Z A;  3H6M A;  1EFI D;  5KEE A;  5EPK A;  4CHT B;  1B9N A;  1BF4 A;  2R7Z B;  4PV1 C;  1F9S A;  3FMC A;  1WD1 A;  2UUB L;  1YBY A;  2KHJ A;  2OF1 A;  1ET6 A;  1LT3 D;  2N49 A;  3SGI A;  1Q1B A;  4QL5 A;  5C4X G;  5FLX c;  4YIJ A;  1CZG A;  2VUM H;  2LS0 1;  1G2T A;  2J7Z A;  5KNB A;  1SLJ A;  2KBN A;  4DPG A;  1QCB D;  1LTS D;  2MGS A;  2PO4 A;  3P20 A;  1CZW A;  4DR4 L;  1M4V A;  3GTO B;  5C3E H;  2ZTC A;  5ISR A;  1BQQ T;  1PYS B;  1VQG A;  2PQE A;  5HUR A;  2BDO A;  3WDN A;  4JBW A;  2L5T A;  3SE0 A;  3J81 j;  4A3E B;  4P73 A;  3KBG A;  3RMH A;  1EEI D;  4QUC A;  1JOK A;  4C56 C;  1QJO A;  4GZY C;  1GUS A;  4AH6 A;  4R8N A;  1HNX L;  3KBX A;  2M2L A;  3LWE A;  2JA8 H;  3FRP B;  1KLU D;  4C3J G;  3ONA B;  1JQY D;  3I73 A;  1J6Q A;  2K1B A;  4QY7 A;  4FXD A;  3BVG A;  3KF8 A;  2F4V Q;  2LFN A;  1CKN B;  4JI2 L;  1DJR D;  1K8M A;  3VYR A;  1S5F D;  1VF5 C;  3J7Y W;  4JC0 A;  1RD9 D;  1BUV T;  4N8F A;  1Y1V B;  2R7Z G;  1MSG A;  2EY5 A;  5FLM G;  3K59 A;  5JVH 3;  1PV4 A;  1HUN A;  3MXG A;  5D3I B;  1VQ9 A;  3JAM L;  3VYT A;  1EIF A;  1WCM B;  5CV5 A;  3UI2 A;  1Q1E A;  3T13 A;  4GNX C;  3J7A 5;  1K8O A;  1SE3 A;  1VCI A;  4RAU C;  4PQX A;  1E2Z A;  1GD7 A;  2N88 A;  2YTY A;  3U50 C;  1KHI A;  3H91 A;  1DOM A;  2HCI A;  2QDL A;  2HHH Q;  5JJL A;  2R61 A;  3H0G H;  4ULL A;  1K28 A;  3VDY A;  2NTT A;  2A8V A;  1KDB A;  2G9D A;  4A3F H;  1D5Z C;  2VQE Q;  4A3E G;  4GKK Q;  4GKJ Q;  2NVQ H;  2OT2 A;  4IZ8 A;  2MPM A;  4JOI A;  4J15 A;  2SDF A;  1C0A A;  1H95 A;  2XN9 C;  3MA2 B;  5JPM C;  1EIY B;  3W5O A;  1I5F A;  3HFZ B;  3STB D;  1JJ2 A;  2A6E D;  4QQB X;  2A73 B;  3K7A H;  3OPO A;  4LMQ D;  1S72 A;  3HKS A;  1PXU A;  1IBM Q;  2LSS A;  3U9O A;  2F4V L;  4KN7 C;  4BBR H;  3CCS A;  4RKL A;  2DNC A;  3T1Y Q;  1Y1V G;  3PIP A;  4IUP A;  3EBE A;  2XIW A;  3E9I A;  4TSS A;  4FVM A;  3PV0 A;  2UXC Q;  1B4O A;  4LF4 Q;  3D4D A;  1IW7 C;  1EWI A;  1C4Q A;  3D31 A;  3OHX C;  4L5R C;  4B3R L;  4A3M B;  1A0I A;  5GAH C;  1WCM G;  1EY9 A;  1K83 B;  3PIO A;  2K4K A;  2EOT A;  1MKH A;  2KA7 A;  3NQI A;  2KHS A;  3RLF A;  1O7Z A;  1PTO B;  1Q90 A;  2Z4H A;  3BDL A;  3UDG A;  1VMC A;  1ENC A;  1J8I A;  1STG A;  4YCV A;  1XMQ Q;  1LUZ A;  4A3C G;  3MEH A;  5JPN C;  4JVZ A;  3NBH B;  3I4N B;  1B53 A;  4YWM A;  4KMU C;  5IYB G;  1WTX A;  3W1B A;  2VQE L;  4GKK L;  1E0B A;  2R93 B;  1Z7T A;  1K8A C;  1ESF A;  1VS0 A;  2F0S A;  4WJ3 M;  1TS5 A;  5ELF A;  2Z1C A;  3G6E A;  3OMG A;  3CMA A;  1QNK A;  4HSP A;  3AB9 A;  2D62 A;  1H9M A;  3DWA A;  4G7H C;  4A3G B;  1AZQ A;  5C0X H;  3HEJ A;  4DR2 Q;  1UEA B;  1IBM L;  4IPD A;  4CDE C;  4JI7 Q;  3VR6 A;  1RTN A;  2EQS A;  3A8J E;  2K32 A;  3T1Y L;  1B50 A;  4POG A;  4BY1 B;  3RN5 A;  2NYZ D;  4A3L G;  4R4T A;  3A5U A;  3UDF A;  4V19 0;  4IFD H;  4JPB W;  1EQV A;  1L2F A;  2AKW B;  3F8T A;  2PZU A;  3R3O A;  1TWH B;  3RR5 A;  2KCC A;  3I8Z A;  4A3M G;  1V1P A;  5KGU A;  4LF4 L;  2UXB L;  2I07 B;  3CCR A;  2B2V A;  2WKC A;  3CW2 C;  3C3L A;  1II3 A;  3U4Z A;  3GTK H;  4OEM B;  1L1O B;  2N3S A;  3D3R A;  3I7F A;  2VW9 A;  1LAB A;  1LTB D;  4OXP A;  2ALY B;  1I4P A;  1TY0 A;  4B3M Q;  3DMU A;  1STH A;  5DLQ E;  4M1U B;  5JOB A;  5HY6 A;  1X3P A;  2NTS A;  3CD6 A;  3I4N G;  5C4H A;  4LF7 L;  2FHT A;  4A3B H;  2R93 G;  1SNO A;  1F9Q A;  2E2J H;  5COR A;  4RH6 A;  3R2I A;  3VA5 A;  1K3B C;  5JEA J;  3PO2 H;  4A93 H;  2KOL A;  2LY7 A;  1YVC A;  4P74 A;  2ASB A;  1EL0 A;  3DLL A;  2KVM A;  5C44 H;  2Y0S E;  2B3G A;  4OO1 H;  1X3G A;  4A3G G;  3M9B A;  1N9W A;  5IYD G;  4JI0 L;  3K5N A;  1A6X A;  5G3L D;  5HGT A;  3HOU H;  1GUG A;  3SK6 A;  1Y1W B;  4NXN Q;  2RCF A;  1CKM A;  1ROD A;  3M4P A;  1TWA H;  3HOW H;  1G2S A;  1MJC A;  1TY2 A;  4LF5 Q;  2Q2H A;  3L7Z C;  4BY1 G;  1UUP A;  3MFG A;  5CV8 A;  4M8A A;  2NN6 I;  4L8J A;  2JA6 H;  4Q5V A;  3F2C A;  3B6Y A;  1PH4 A;  2JE6 I;  1IYV A;  1QZG A;  3HKZ B;  5IGB A;  2PPB C;  4YCW A;  4DNI A;  2JK8 A;  1TXY A;  5FJ8 H;  4FXK C;  5GQO A;  4BA1 I;  4X64 L;  1DYQ A;  1IHZ A;  1HHV A;  1ET9 A;  5M5W H;  4HIK A;  3T16 A;  4HMJ A;  3TZU A;  4JV5 Q;  4E6I A;  2O5I C;  2QGQ A;  1BKB A;  4XYO A;  1I6H B;  2FFK B;  5FLX L;  1LYL A;  2C9O A;  1FNV A;  2XRQ D;  1STN A;  1W2B A;  4DR6 Q;  1TWG H;  4IUU A;  1Y14 B;  1WD0 A;  3PUZ A;  2KEC A;  1X65 A;  5I6Y A;  3QO2 A;  5J22 A;  2CQA A;  3ER0 A;  5IGE A;  5K36 G;  1Q46 A;  4JI4 Q;  3I56 A;  4JBJ A;  2F0I A;  1YJW A;  3K5L A;  2JJQ A;  5M3F B;  3GTJ H;  1Y1W G;  4QUF A;  3GTQ H;  1TS3 A;  3J81 c;  4H0L C;  4LF6 Q;  4K8J A;  5CBA E;  2KJX A;  2MO0 A;  4HR7 B;  4BA2 I;  2Z6K A;  3I4M B;  2ZJQ A;  4YY3 L;  1FGU A;  1D7Q A;  3CQZ B;  3HKZ G;  3QJY A;  1MSH A;  2B2W A;  1SYF A;  5ELN A;  3W2D A;  1RJT A;  1EIG A;  1TU2 B;  4KD4 A;  3RZO B;  3Q8D A;  2B2T A;  1EQQ A;  4MZ9 A;  4HIO A;  4TKO B;  3CCM A;  1NTG A;  5C5M A;  3SHL A;  1H9S A;  1KIX A;  3OWF A;  3EN2 A;  1L0X B;  2IX0 A;  4DFA A;  4QJF A;  2AQ3 B;  3DEO A;  5E4X A;  3NUC A;  4KY7 A;  4CDF C;  4C3J H;  2KEE A;  2HQE A;  2NB0 A;  3LNN A;  3S1R B;  2BDN A;  5BN4 A;  3KUP A;  4DR6 L;  2BE5 C;  2IT1 A;  3I70 A;  1SJE D;  4EQO A;  2R7Z H;  4JI4 L;  5FLM H;  5M3F G;  1Q81 C;  3JAM c;  4RHR A;  1SRO A;  3ND9 A;  1AFP A;  4G7Z C;  4JI1 Q;  5D3D A;  2SOB A;  2JEB I;  4R4C A;  4LFA Q;  5G3L F;  1J9O A;  2F3W A;  4LF6 L;  2FMC A;  1EYC A;  1GUN A;  1W6K A;  3I4M G;  3J81 i;  1KRS A;  2B63 B;  2K7V A;  1NR4 A;  2F0O A;  4ZAI A;  4X3K A;  1XPO A;  3TEH B;  1UEB A;  4O0A A;  3GTO H;  1JOQ A;  2B2U C;  4XQJ A;  1CQF A;  4Q0F A;  3K58 A;  3S1M B;  5DM6 3;  3TDQ A;  1MIU A;  4AYB B;  1GKH A;  4A3E H;  4RGT A;  4DNT B;  1PH5 A;  3HS0 C;  1TWC B;  5F2D A;  3UDX A;  5LMN W;  3J7A F;  1HFN A;  3DM1 A;  3CKI B;  4A3K B;  3PUY A;  1LT6 D;  1JB7 A;  3ERO A;  1GO3 E;  4DK6 C;  2JSO A;  2F0M A;  2KCT A;  3CU7 A;  4JG2 A;  3FDT A;  1A62 A;  1LV9 A;  3MTS A;  1SAP A;  3GTP H;  2AQ2 B;  3C1F A;  1PTO C;  3VR2 A;  1Y1V H;  1Y8N B;  4WRD A;  3KF6 B;  1EUJ A;  5BN3 A;  1O7I A;  2RDG A;  1MJE A;  2AUK A;  2UUC L;  4L63 B;  2RBM A;  5IY0 A;  2EY2 A;  1HNZ Q;  1BVS A;  3MHB A;  4HED A;  4JI1 L;  3MFY A;  3JAM i;  3BG3 A;  2ZXR A;  3FPP A;  4C2M B;  1WTH A;  3DHQ A;  4L6T B;  1WCM H;  2WP8 J;  1QVC A;  4PG3 A;  2B63 G;  3UDI A;  5ELO A;  2L55 A;  3OW7 A;  1DXM A;  1N32 Q;  2C5C A;  3CC4 A;  2F0P A;  1K3R A;  2X6G A;  3OYY A;  1JE4 A;  2L4N A;  4DA2 A;  5IYC G;  2ENB A;  4AYB G;  4A3C H;  1SYB A;  3VR5 A;  5IYB H;  1SXT A;  4LAA A;  1SDF A;  1EY8 A;  4A3K G;  4NPS A;  4H44 C;  1VQE A;  4RFB A;  1K0R A;  4WJW A;  3RN2 A;  1ICF B;  1E22 A;  2ICI A;  3K0Y A;  1LM0 A;  1KD1 C;  1OXV A;  1STY A;  4DGZ A;  4XDX A;  3I3C A;  4IOC A;  1L1O C;  5GAE C;  4KJO A;  4CKC A;  4HCE A;  3BVZ A;  3J7A V;  1GXD C;  1G29 1;  4C3H H;  1G91 A;  1HR0 L;  2EYH A;  2B29 A;  4DUY L;  3CRK C;  4EGV A;  4O2D A;  2EJG C;  4A3M H;  3QOJ A;  2F0W A;  4QGU A;  1R9T B;  1F77 A;  1M90 C;  2UUB Q;  1K83 H;  5C6A A;  4GNX A;  1CM9 A;  3PQI A;  5EKL A;  2R92 H;  4K2L A;  2BE5 D;  5I9O A;  1PTO H;  3CME A;  3D8G A;  5J1Z A;  3A5Z B;  4Y7N H;  1N32 L;  1U4P A;  5C4X B;  1TS4 A;  1Y8P B;  2N78 A;  1QVG A;  2IHE A;  2J4X A;  1K8G A;  2DGY A;  4X62 Q;  1T5X D;  1FJG Q;  3I4N H;  5CMD A;  3HGB A;  1EU4 A;  4MTK A;  2R93 H;  3GQB A;  2PYK A;  4GN4 B;  4UP8 A;  2E5L L;  1KAW A;  4DV4 L;  1WVL A;  2OCE A;  3HOX B;  4GN3 B;  1QNU A;  1EFW A;  2MUY A;  1PFB A;  4DNR B;  2F52 A;  3DEP A;  2D0O A;  4OON A;  4A3G H;  1HNX Q;  5IYD H;  2WFW A;  3NBI A;  4DR7 Q;  1EY4 A;  4OWX B;  2WB1 B;  4R4I A;  3HRZ C;  1KDC A;  2F3I A;  2RDH A;  3EFX D;  2EY1 A;  4KTA A;  4LK1 C;  1EOT A;  1YNJ C;  3AU7 A;  1SN8 A;  2ZTD A;  1TWF B;  3PMF A;  2KQ3 A;  1AEX A;  1D2B A;  1KC8 C;  5ELD A;  1JWM D;  2ES2 A;  2WII B;  3HP3 A;  2Z6B A;  3ULL A;  4KKS A;  1I50 B;  1JOO A;  1IBK Q;  3T1H L;  2K33 A;  3CP0 A;  4FYD A;  1SJH D;  2KHI A;  3MEF A;  2EE1 A;  4K2K A;  2E75 C;  1ZEQ X;  3CF5 A;  3EQL C;  1PH2 A;  3HZX A;  5EBC A;  3J81 L;  2TSS A;  4FXG C;  1VQB A;  3A54 A;  2ZJR A;  3I55 A;  1EEF D;  1TQO A;  1W6J A;  5EQ0 A;  3K5M A;  5LMU L;  3OOC A;  2PNR C;  4X62 L;  1L0Y B;  5IGC A;  1FJG L;  4CKE A;  1SYC A;  3KLS A;  1Z9F A;  3HOX G;  1HA6 A;  3BYT B;  1TKW B;  2JA9 A;  2YU9 B;  3KK7 A;  1E24 A;  3BZK A;  2UXD L;  2CH4 W;  1TS2 A;  5K36 H;  5CBE E;  2RVL A;  2XSC A;  1ICW A;  4ILW A;  3G71 A;  5BR8 L;  1BNZ A;  3KYH C;  2PW5 A;  4DN4 M;  1Y1W H;  2WB1 G;  1SRU A;  2PQA B;  3GV6 A;  4DR7 L;  1ENA A;  4HJ7 A;  2HUG A;  2WAQ B;  4DXF A;  1N33 L;  3R93 A;  2CFM A;  2ZXP A;  2B2Y C;  4ZUI A;  1FGB D;  1PH3 A;  1B44 D;  2CQO A;  1O78 A;  1D8L A;  3TRE A;  5DAU A;  1E3P A;  2FMM A;  3D4W A;  2NVX H;  2VL6 A;  3M3Y B;  4RGO S;  2IX3 A;  1E1T A;  1O7Y A;  2BOS A;  2PI2 E;  5DNF A;  1WTV A;  1O80 A;  3A55 A;  1EY6 A;  4G4K A;  3BZD B;  3M4Y A;  3RUZ A;  4B3R Q;  2FXQ A;  3IFD A;  1F9R A;  3MXN A;  1IBK L;  1IYJ B;  3NTK A;  3G48 A;  3S1Q B;  3A7A B;  2X69 A;  1AW7 A;  1I6H H;  5KYI A;  1PDQ A;  1N36 L;  3NK9 A;  1LTA D;  4IN3 A;  3CCU A;  2KED A;  3NHH A;  5IE8 A;  4JBM A;  3ERS X;  4FDB A;  1QOH A;  3ZJY C;  3J80 c;  2L9H A;  1VQL A;  3U4V A;  3HOZ B;  3CPW A;  3E0J A;  4DV5 Q;  1BBX C;  4PZ8 A;  4XTC S;  5M3F H;  3KFU A;  4BXX G;  1KTK A;  2KUM A;  1HJP A;  4IPH A;  1NR2 A;  1GM5 A;  2R6G A;  1F2Y A;  2WAQ G;  3CCL A;  1PMR A;  5M5Y B;  2VXW A;  3I4M H;  3AFQ A;  2OTL A;  2JEA I;  3DM3 A;  5IT9 E;  2M9V A;  4MIU A;  3GV3 A;  3CQZ H;  1VQ4 A;  4POF A;  2F4I A;  2K28 A;  1HFG A;  1UNS A;  4IPG A;  4IUR A;  1F9P A;  3K0X A;  5M5X H;  1XXG A;  3TP5 A;  4GS3 A;  1G6P A;  1EU3 A;  3RZO H;  1STB A;  1I4R A;  2UXB Q;  4K8I A;  2QF7 A;  1A3U A;  1GHK A;  4IUT A;  1H9R A;  2SNS A;  2R3Z A;  2Z4I A;  1WOC A;  5HGQ A;  2E2I B;  2JXM B;  1TII D;  2EJF C;  4X3T A;  2G5D A;  1O7L A;  2F0V A;  1CHQ D;  1PTO F;  1YNJ D;  1YNX A;  3HOV B;  1WYD A;  2KCM A;  2A6H D;  1YHQ A;  3O13 A;  1B8A A;  2Q2T A;  1LTR D;  4LF7 Q;  1CTM A;  2G9H D;  4ABN A;  4HIM A;  1K73 C;  3HOZ G;  2YV5 A;  4CBV A;  1SBB B;  4P2C B;  1AH9 A;  2F0D A;  1HZC A;  4DV5 L;  1PH7 A;  2HQL A;  4H13 C;  3NTH A;  4CJ2 C;  2JA5 B;  1X3E A;  3CHB D;  1IL8 A;  4BY7 H;  3GTL B;  4JI0 Q;  4HJA A;  3M4O B;  1PH9 A;  2BH8 A;  1U4L A;  4KY5 A;  4OWW B;  4JCV E;  1BOS A;  2B63 H;  1F2Z A;  5C4Z A;  1MI2 A;  2EYO A;  3A0J A;  1BR9 A;  4RG1 A;  5CV9 A;  1JB3 A;  1WTQ A;  3RNU A;  1CKN A;  2SEB D;  4X6A H;  2QCP X;  1JE5 A;  3HKZ E;  1LLR D;  2L1B A;  3FVQ A;  3QOL A;  5IYC H;  4PZ6 A;  1H9J A;  1LTT D;  4OWT B;  2RHS B;  4PZ7 A;  5C0X J;  1XNR L;  1EYA A;  1Z6H A;  1NNX A;  3PIP 3;  3SEB A;  4A3K H;  4X64 Q;  2K04 A;  2EDG A;  4N9P A;  3HOV G;  4AQY Q;  2DJF C;  3S1N B;  2IJ0 A;  4IFD J;  1Q82 C;  4GLV B;  4KHP Q;  4RKB A;  4DK3 C;  2VZA A;  4K5X A;  3TZD A;  4CDD C;  4ZLT F;  3TQY A;  4HID A;  4IUV A;  5BN5 A;  1SR3 A;  2ZM6 Q;  1UWV A;  3MAQ A;  3AYH B;  2FIN B;  4HCS A;  1EQT A;  1CUK A;  2JA5 G;  2Z8L A;  4ME3 A;  4DK0 A;  4N8X 1;  5IIF A;  1BBW A;  4EQ5 A;  4OIK A;  5A2Q L;  3GD7 A;  4C2M H;  1NMF A;  4RHS A;  1E2W A;  4RCN A;  4XYQ A;  2I5H A;  3NPP A;  1GJX A;  2XGT A;  1N8R C;  3H3V C;  2B2U A;  4JI6 Q;  3V05 A;  1BCP B;  3OMC A;  4CGY B;  5C3E B;  3QB3 A;  4LJZ C;  4IAL A;  2HCC A;  2ZT9 C;  4YY3 Q;  4NXM L;  3TS2 A;  3FKI H;  3EIV A;  1DZ1 A;  1XPR A;  1U0L A;  4N9T A;  4ZKC B;  3VYS A;  4DV3 L;  2DY8 A;  1TVX A;  1A2T A;  3T4A C;  2HIX A;  4IFD I;  1E2V A;  3K80 C;  4ZUJ A;  1L0W A;  4DR1 Q;  5KYL A;  2ZJP A;  1C7Y A;  1SE8 A;  3M7G A;  2AMC B;  2AUJ D;  2F0J A;  2IW3 A;  2PI2 A;  2RF4 A;  1SFO B;  1KLG D;  4OX9 L;  4JI3 L;  4AQY L;  2A69 C;  1QG7 A;  1OTC A;  2LKV A;  1RCV D;  2UU9 L;  1X56 A;  1VQP A;  1I4H A;  2M00 A;  4P72 A;  2H1E A;  4KHP L;  3MC0 B;  3Q6S A;  1G8Z D;  1IKL A;  3JAM E;  2RQX A;  1IXR A;  3M4Q A;  1IW7 D;  4GN5 A;  4J1M A;  1XTD A;  3TP7 A;  1JR0 D;  2ZM6 L;  3E3X A;  4HJ9 A;  3NBH A;  1NMG A;  4LUV A;  3PGZ A;  1FVI A;  4NDX A;  4CDC C;  3GTM B;  4KKT A;  2F0L A;  3TS0 A;  1R9T H;  3X3N A;  2A74 C;  4X3S A;  1XTC D;  2NUC A;  1VQO A;  3IRB A;  4OO1 I;  4BBS B;  4JYA L;  4C1N I;  1DOL A;  4P75 A;  1VQC A;  1CA6 A;  1VQF A;  5C3E G;  5EPJ A;  2D9U A;  5KRU A;  5C4X H;  3DWP A;  2E2H B;  2AHO B;  1ILP A;  4RCO A;  4JI6 L;  2K5W A;  1I94 Q;  4F7X A;  4UPA A;  1X3Q A;  3VA7 A;  4GOP B;  2QA4 A;  2FJ2 A;  2CWP A;  2HIV A;  1MHW C;  4AYB E;  4DUZ L;  1NAP A;  3OTO Q;  4V0B A;  1ASY A;  3D0F A;  1PRT B;  3P75 A;  5LL6 X;  4DR1 L;  1WTR A;  1HZA A;  3H3V H;  1EY5 A;  1EIH A;  4EQP A;  1S5B D;  1ZYR C;  4NKL A;  1JIC A;  1BBU A;  3A8I E;  4H7B A;  3NP8 A;  2F0T A;  1L1O A;  2HD3 A;  3CC7 A;  2MP1 A;  3RLN A;  5AJ3 L;  2EXD A;  3BS1 A;  5AFW A;  1SYE A;  1ILQ A;  1QE6 A;  2X6L A;  2TMP A;  4F88 A;  2GVA A;  2MO1 A;  2IWH A;  1TWF H;  2PMZ B;  3J80 L;  4B3S Q;  1GUO A;  3S2D B;  4BBS G;  1E7Z A;  2UUC Q;  1M1K C;  1CSP A;  1I50 H;  1RL2 A;  4K6L A;  1FD7 D;  3MZ5 A;  1U4M A;  1TT2 A;  2OWO A;  1K0S A;  1SNC A;  1I94 L;  1DM0 B;  4YHH L;  4B9X A;  2WV6 D;  5I6W A;  4XQQ A;  3A56 A;  1B1Z A;  2YU9 H;  2Y0S G;  3OTO L;  4UP7 A;  1TR5 A;  2F03 A;  4LW1 A;  3ZYY X;  1DD2 A;  2MJ8 A;  3Q24 A;  2OXP A;  3LX0 A;  4HJ5 A;  4K14 A;  3NWS A;  2OQK A;  2N8N A;  2Z9H A;  4EX5 A;  5I4D A;  4C3I B;  1SNM A;  2AQ1 B;  1DON A;  1KRT A;  2NZH A;  3ND8 A;  5LL6 S;  3H94 A;  5GRO A;  1EYD A;  3KDF B;  2F0K A;  1EZ6 A;  3DUZ A;  2A19 A;  3IFT A;  2BH2 A;  1KNA A;  5H1S E;  1PA6 A;  1S40 A;  1QUQ B;  1WTO A;  1CT1 D;  1LTL A;  2BCO A;  3M3Y H;  1EQR A;  1KXL A;  4B3S L;  1HR0 Q;  1PZI D;  1HZB A;  3DWQ A;  1J5E L;  4PMB A;  3FP9 A;  4DUY Q;  2L11 A;  2NZO A;  4R9W A;  3AFP A;  3TP8 A;  3L9A X;  4ZYS A;  4DAY B;  1OXU A;  5J3B A;  4NB3 A;  4XXE A;  2WIN B;  3S1Q H;  1Q8I A;  1P16 A;  2CCZ A;  2B8G A;  4IJL A;  1B2T A;  5C3W A;  1VF7 A;  1EY7 A;  3TBI B;  4DR5 L;  1EZ8 A;  2DNE A;  2YYZ A;  3NQT A;  4DF7 A;  1ESR A;  2H5X A;  2E74 C;  2Q8I B;  2E2J B;  2K50 A;  4HN7 A;  2NVT B;  3M85 A;  1YJ9 A;  1VMP A;  2RCN A;  1QVF A;  4QIW B;  3CAM A;  3RZD B;  3GP7 A;  3HOZ H;  4RGM A;  1S5D D;  2CHB D;  4DAM A;  4DAV A;  2E5L Q;  5JVG 3;  4DV4 Q;  1D5M C;  5E7N A;  1NUC A;  5LHY 1;  5L37 A;  1RHP A;  4C3I G;  2L12 A;  1PZJ D;  3H09 A;  1NSN S;  3A8K E;  1STE A;  2B8F A;  4XT1 B;  4OEL B;  3E5S A;  2WB1 E;  2NN6 G;  5M5Y H;  2B2Y A;  4HTH A;  2E8G A;  3A74 A;  2Q2U A;  5IOC A;  3KJP A;  3V96 A;  5ELC A;  1KL9 A;  4IFD G;  4FNF A;  2QDB A;  3MVV A;  1IKM A;  4X65 Q;  2MFI A;  5E3F A;  1CA5 A;  4UY8 C;  3T56 B;  3NEN A;  2K52 A;  2EYM A;  3SR1 A;  2LXK A;  4I7A A;  1JJG A;  1FYC A;  3L0O A;  1X55 A;  4QB4 A;  5IGF A;  4KK7 A;  1ZYR D;  1EOV A;  1AE2 A;  1HXY D;  4A3L H;  2RHQ B;  5FLX E;  3S17 B;  2F0G A;  3R2T A;  1FR3 A;  2NBF A;  5M5W B;  1XX8 A;  5JEA G;  4HAE A;  5E1F A;  3NXW A;  2BA0 A;  2Z0S A;  5DEH A;  2EYJ A;  2E2I H;  3T1H Q;  2JN4 A;  3KF8 B;  5EGT A;  4OL7 A;  3C2P A;  1FNU A;  3HOV H;  1AZP A;  4DV6 L;  1A15 A;  2B39 A;  4UP9 A;  1HRJ A;  4DV0 Q;  1I3Q B;  1B3Q A;  4DV2 Q;  3BVM A;  1PFN A;  5ELE A;  3MWY W;  2Q2I A;  3KJO A;  5JJI A;  2LXJ A;  5LMU Q;  2UUA Q;  3G4S A;  1VQ7 A;  1I4G A;  1FL0 A;  1YNN C;  3EA6 A;  4KHV A;  4F87 A;  1BCP C;  3AEV A;  4TVA B;  2OQ0 A;  4UHV A;  4A3I B;  2HT1 A;  1SNP A;  3FPU B;  1XYI A;  2UXD Q;  3I4O A;  2DJG C;  1QB5 D;  1YZ6 A;  2JA5 H;  1AP0 A;  3S2H B;  5IP7 G;  5BR8 Q;  1ASZ A;  1Q12 A;  3GTL H;  2SNM A;  4DV7 Q;  1ZKO A;  2XWJ B;  3PF4 A;  4P71 A;  2E2D C;  2WAQ E;  4PMC A;  2K03 A;  2JA6 G;  4LFC L;  3V2T A;  1OXX K;  2I5L X;  2PCF B;  3BJU A;  3NTI A;  4RGN A;  1N33 Q;  2F0F A;  4X65 L;  3CC2 A;  1PVO A;  1V1Q A;  3P1H A;  4BY1 H;  3SK4 A;  4KD3 A;  4HSV A;  1TWH H;  4IOA A;  5M3M B;  4OGQ C;  3J7Z C;  3MXP A;  2F0U A;  1VDZ A;  2EJM A;  2IHF A;  2K5D A;  1M8A A;  2RSN A;  1PHJ A;  5A35 A;  3S1N H;  5CR3 A;  1Q8K A;  4EVO A;  4B08 A;  4WFN 3;  1PTO D;  3ITP A;  1C9O A;  1N36 Q;  1HNW Q;  3OIQ A;  4ZQ3 A;  4DV0 L;  2XRS D;  4DV2 L;  3D6W A;  1GUT A;  2K14 A;  5CV6 A;  1PYB A;  3ULP A;  2UUA L;  3L3O C;  5T1G A;  4A3I G;  2P5Z X;  3NEM A;  4KN4 C;  1YHA A;  3MXU A;  4RMF A;  4GOP C;  1HR0 W;  2F1M A;  1ONL A;  4UDU C;  2OTJ A;  2K5H A;  3K81 C;  1UE7 A;  5D65 A;  4ZRZ A;  4DV7 L;  1ENF A;  1PRT C;  3G6J B;  5EBD A;  1HA5 A;  5JAV A;  3LWU A;  3N6R A;  4FF2 A;  2IX1 A;  3NSW A;  4DXG A;  1UE1 A;  4XT3 B;  3UE0 A;  2JA7 B;  2HDL A;  1YJN A;  3Q23 A;  5EKK A;  5M3M G;  2VS1 A;  1Y69 U;  2BA1 A;  3K6O A;  2K5Q A;  1NJI C;  1CI3 M;  3I72 A;  2DN8 A;  1SFO H;  5C5L A;  3ERQ A;  1HTP A;  1VQK A;  1U5K A;  3U58 A;  5CV4 A;  3GTP B;  5I9P A;  4BS9 A;  1Q3L A;  1HNW L;  1A2U A;  1SND A;  1PLF A;  1XMO L;  4FF4 A;  4ZK9 B;  1V1P B;  3I2Z A;  1XWE A;  2NVY B;  1CSQ A;  1VQA A;  2JP1 A;  1WTW A;  2DUD A;  2EYP A;  3VYU A;  1AN8 A;  1SMY C;  3GTM H;  1BO0 A;  5IGG A;  2RKS A;  3E6Z X;  1VQ8 A;  3QR8 A;  4BBS H;  1FNW A;  4ZKB B;  1QIL A;  2QIL A;  2DY7 A;  1YNN D;  1X9N A;  2EXZ A;  1Z47 A;  5NUC A;  2E2H H;  1PZK D;  1BCP D;  2JA7 G;  1Q86 C;  2XTI A;  3FEW X;  2O4X A;  1UAP A;  1DOK A;  1VQH A;  2ZXO A;  1EWH A;  4JI5 Q;  4G7O C;  1HQR D;  1V1O A;  4TRD A;  5KND A;  1XNR Q;  1VQ5 A;  3W3A A;  1CK1 A;  2C35 B;  1LT4 D;  4IO9 A;  1CQV A;  4DR3 Q;  1KAB A;  2EY6 A;  1A3T A;  4JI8 Q;  1PFS A;  4XQN A;  1VQM A;  3GTG B;  2VNU D;  4ALP A;  2OEO A;  3T51 B;  2O5J C;  4A3D B;  2J0T D;  3K7U C;  5KNC A;  3S14 B;  3S1R H;  2CKZ B;  4A3J B;  2GN5 A;  4C3H B;  3U9S A;  2K75 A;  4IUQ A;  1HQM C;  3URY A;  1V9P A;  3J80 i;  3S2D H;  3PO3 B;  1A63 A;  3S15 B;  1SE4 A;  3PUW A;  5CC4 A;  1SYG A;  1UE6 A;  2AWO A;  2IPK D;  2Q8R E;  1N34 Q;  2R92 B;  1DGS A;  2CWA A;  1WTP A;  1GOZ A;  2I5M X;  1SMX A;  4ME5 A;  4Y7N B;  5TSS A;  2RA4 A;  2HHH L;  4LF9 Q;  2PQA A;  3HG9 A;  1D1K A;  3S16 B;  3SVM A;  3AQQ A;  3M7N A;  1PH6 A;  2V4D A;  4NXM Q;  4GKJ L;  4ZCK A;  4JI5 L;  3HOY B;  3S1M H;  4CJ1 B;  2K5V A;  1XJV A;  4DV1 Q;  4DV3 Q;  1PRT D;  4CKB A;  1TWC H;  3JC6 6;  5CGK A;  5EJW A;  4C3I H;  4DR3 L;  4JI8 L;  3IKJ A;  4A3D G;  5FKA C;  4OX9 Q;  4JI3 Q;  2XVS A;  5EPL A;  2LMC B;  3K8A A;  2XNA C;  2NN6 H;  4RWS C;  4A3J G;  4KHZ A;  2UU9 Q;  4CJ0 B;  3C46 A;  4C3H G;  5C4J B;  1JOR A;  1QWY A;  3IL8 A;  2ID0 A;  4I65 A;  3PIO 3;  4KI0 A;  2UXC L;  3DXJ C;  3GO5 A;  3CRL C;  3PO3 G;  1AE3 A;  5JJK A;  4GLX A;  4A75 A;  3TSS A;  4LFB Q;  1PYW D;  3EVQ A;  5IT9 c;  1H9S B;  3J81 E;  3L2P A;  1C8C A;  1YHB A;  4LNQ A;  1GHJ A;  1MGS A;  2R92 G;  4PNY A;  4APV A;  3TP6 A;  2MHV A;  1IZ6 A;  1N34 L;  1SNQ A;  3OWE B;  1GVP A;  2KEN A;  5JEA H;  2AWN A;  3R8B A;  4JYA Q;  2D0P A;  1U4R A;  1D6E C;  3PF5 A;  2VUM B;  1CHP D;  3BZC A;  1XMQ L;  1S4Z A;  1C48 A;  3CCE A;  3WOF A;  4LF9 L;  5C0X I;  3PUV A;  1CKO A;  4NP5 A;  2VQF Q;  1BCP F;  1SMY D;  3HOY G;  2NVT H;  4Y52 H;  3CPF A;  3BDC A;  4EQN A;  4DKA C;  4B9W A;  3T53 B;  2I46 A;  4TQU S;  3S9W A;  1R4Q B;  3RZD H;  3KLS X;  2VB2 X;  5LMN Q;  4DV1 L;  3G7L A;  4YWL A;  4DUZ Q;  1G51 A;  2EZV A;  4A4I A;  1YI2 A;  4JOI C;  4KJN A;  3EJI A;  2A1A A;  4IJH A;  1D1I A;  5FK9 C;  4OIJ A;  4S3S A;  3KOJ A;  3RLO A;  5IP7 H;  1BDO A;  1E1O A;  4DR2 L;  3AMU A;  2JA8 B;  4O42 A;  4MTN A;  4JI7 L;  4NMZ A;  3F2B A;  1D5X C;  2CW0 C;  3Q0A A;  5AJ3 Q;  2K6A A;  5IP9 G; 
#chains in the Genus database with same CATH homology
 2D5D A;  1G6Z A;  3OSO A;  2D2C C;  4K5V A;  3QIA A;  2NVX B;  5I2X A;  4QCL A;  1DCZ A;  3P7J A;  3TN2 A;  1NCV A;  2PZW A;  1GUW A;  1OXS C;  1HUM A;  4R8I A;  2Q8T A;  1H9K A;  5IOD A;  4I7Z C;  1R4P B;  3NWT A;  4QMG A;  1S5C D;  1LO5 D;  3H0G B;  1SYD A;  1F2L A;  5ELB A;  4A3F B;  2O2L D;  1V8Q A;  5FOB B;  2NVQ B;  1PRT F;  2N55 A;  2Y0S B;  1X32 A;  2EYF A;  2EPB A;  1SE2 A;  1KDA A;  3K7A B;  4F8M A;  1LT5 D;  1JWS D;  4MHE A;  3A7L A;  4XIG S;  2GA4 B;  3SXH A;  4BBR B;  1MD2 D;  3VR4 A;  5M9O A;  1JC7 A;  5T1I A;  2JYO A;  2A68 C;  4JK1 C;  5M5X B;  1OXT A;  1RTO A;  5FO8 B;  4DU9 A;  1SSO A;  3K5O A;  1KNE A;  2QKI C;  2PZT A;  1EWC A;  3C1E A;  2B2V C;  1ML0 D;  1HTL D;  3RD4 A;  2F0H A;  4HMI A;  1B3A A;  1SEB D;  4QF4 A;  5I2Y A;  1MBY A;  2IL8 A;  1JWU D;  2NWG A;  2WKD A;  2EYL A;  4FP5 D;  5IGD A;  2K05 A;  4K5W A;  4U67 3;  3I91 A;  5JJZ A;  4BY7 B;  2ICE C;  4FF3 A;  1STA A;  1LTI D;  2K01 A;  1EY0 A;  4RA8 A;  3D6C A;  2F0Q A;  2F0E A;  1V43 A;  1I4Q A;  3WOE A;  2A69 D;  3OIP A;  2KCN A;  1ZXT A;  2CW0 D;  3GTK B;  3F2U A;  4ODG A;  1T5E A;  4UAI A;  3I90 A;  2A5H A;  4BWG B;  5A2Q E;  4X3U A;  4A3B B;  3NE5 B;  5FO9 B;  5C3X A;  5D14 A;  4C1N K;  1U9R A;  4A93 B;  3PO2 B;  4DAP A;  2L0C A;  4WOR A;  2E76 C;  5C44 B;  1LTG D;  5C0X G;  3HOU B;  5K5P A;  3Q22 A;  3QG1 A;  4O1N A;  1TWA B;  3HOW B;  1IYU A;  4K6D A;  3FKI B;  1I4X A;  1S5E D;  4FO2 A;  2JA6 B;  3I4L A;  2CVR A;  2B2W C;  5E4W C;  4J6H A;  1LAC A;  4IUN A;  1RKN A;  2QEJ C;  2B2T C;  5IT9 L;  5CYU A;  2RDF A;  5FO7 B;  1JCK B;  4MN3 A;  4KKU A;  3SK8 A;  2A68 D;  1RF2 D;  3QWN A;  4ID6 A;  4IQZ A;  1F2M A;  1TWG B;  4KY6 A;  4DK1 A;  4KV6 A;  5EKI A;  4OO1 G;  1KAA A;  4Z9C B;  3K57 A;  3BYY B;  1HCZ A;  2EVB A;  2HDM A;  3VR3 A;  3IAY A;  2VB3 X;  3GTJ B;  4J8Q A;  4OHJ A;  1HPC A;  1CFM A;  3GTQ B;  3TME A;  1OO9 B;  2NZ1 D;  2PW7 A;  2F3V A;  5KIX A;  3KLR A;  3N52 A;  2H4O A;  3PUX A;  1I6V C;  2A6E C;  5CV7 A;  4G57 A;  3X3M A;  2WAC A;  5COY A;  1RDP D;  3SK5 A;  5DM7 3;  3BDO A;  5J39 A;  2XWB B;  2F0N A;  1A3V A;  1B9M A;  3J80 E;  4DAY A;  4FF1 A;  1PFM A;  4C3J B;  4NW2 A;  4U68 A;  4PMW A;  1BXT A;  1Y8O B;  2A6H C;  3SDZ A;  2RSO A;  3D4R A;  3H6M A;  1EFI D;  5KEE A;  5EPK A;  4CHT B;  1B9N A;  1BF4 A;  2R7Z B;  4PV1 C;  1F9S A;  3FMC A;  1WD1 A;  2OF1 A;  1ET6 A;  1LT3 D;  1Q1B A;  4YIJ A;  1CZG A;  2LS0 1;  1G2T A;  2J7Z A;  5KNB A;  1QCB D;  1LTS D;  2MGS A;  2PO4 A;  3P20 A;  1CZW A;  1M4V A;  3GTO B;  5ISR A;  1BQQ T;  2PQE A;  5HUR A;  2BDO A;  3WDN A;  4JBW A;  2L5T A;  3SE0 A;  4A3E B;  3KBG A;  3RMH A;  1EEI D;  4QUC A;  1JOK A;  4C56 C;  1QJO A;  4GZY C;  1GUS A;  4R8N A;  3KBX A;  2M2L A;  3LWE A;  3FRP B;  1KLU D;  4C3J G;  1JQY D;  3I73 A;  3ONA B;  2K1B A;  4FXD A;  3BVG A;  3KF8 A;  2LFN A;  1DJR D;  1K8M A;  3VYR A;  1S5F D;  1VF5 C;  3J7Y W;  1RD9 D;  1BUV T;  1Y1V B;  1MSG A;  2EY5 A;  3K59 A;  5JVH 3;  1HUN A;  3MXG A;  5D3I B;  3JAM L;  3VYT A;  1WCM B;  5CV5 A;  3UI2 A;  1Q1E A;  3T13 A;  1K8O A;  1SE3 A;  1VCI A;  4RAU C;  4PQX A;  1E2Z A;  2N88 A;  3H91 A;  1DOM A;  2HCI A;  2R61 A;  4ULL A;  2NTT A;  1KDB A;  2G9D A;  1D5Z C;  2OT2 A;  4IZ8 A;  2MPM A;  2SDF A;  2XN9 C;  3MA2 B;  5JPM C;  2A6E D;  2A73 B;  3OPO A;  4LMQ D;  1PXU A;  3U9O A;  4KN7 C;  4RKL A;  2DNC A;  4IUP A;  2XIW A;  4TSS A;  4FVM A;  3PV0 A;  1B4O A;  3D4D A;  1IW7 C;  1C4Q A;  3D31 A;  3OHX C;  4A3M B;  1EY9 A;  1K83 B;  2EOT A;  2KA7 A;  3NQI A;  2KHS A;  3RLF A;  1O7Z A;  1PTO B;  1Q90 A;  2Z4H A;  3BDL A;  1VMC A;  1ENC A;  1J8I A;  1STG A;  3MEH A;  5JPN C;  3I4N B;  1B53 A;  4KMU C;  1WTX A;  1E0B A;  2R93 B;  1Z7T A;  1ESF A;  2F0S A;  1TS5 A;  5ELF A;  2Z1C A;  3OMG A;  1QNK A;  4HSP A;  3AB9 A;  2D62 A;  1H9M A;  3DWA A;  4G7H C;  4A3G B;  1AZQ A;  5C0X H;  3HEJ A;  1UEA B;  3VR6 A;  1RTN A;  3A8J E;  2K32 A;  1B50 A;  4BY1 B;  2NYZ D;  4V19 0;  4IFD H;  1EQV A;  2PZU A;  3R3O A;  1TWH B;  2KCC A;  3I8Z A;  1V1P A;  5KGU A;  2I07 B;  2B2V A;  2WKC A;  3C3L A;  1II3 A;  3D3R A;  1LAB A;  1LTB D;  1I4P A;  1TY0 A;  3DMU A;  1STH A;  4M1U B;  5JOB A;  1X3P A;  2NTS A;  5C4H A;  2FHT A;  1SNO A;  1F9Q A;  5COR A;  4RH6 A;  3R2I A;  3VA5 A;  5JEA J;  2KOL A;  2LY7 A;  1EL0 A;  2KVM A;  4OO1 H;  1A6X A;  3K5N A;  5G3L D;  5HGT A;  1GUG A;  3SK6 A;  1Y1W B;  1ROD A;  1G2S A;  1TY2 A;  3L7Z C;  5CV8 A;  1UUP A;  3MFG A;  4M8A A;  2NN6 I;  4L8J A;  4Q5V A;  2JE6 I;  1IYV A;  3HKZ B;  5IGB A;  2PPB C;  4FXK C;  4BA1 I;  1DYQ A;  1IHZ A;  1HHV A;  1ET9 A;  3T16 A;  4HMJ A;  3TZU A;  4E6I A;  2O5I C;  4XYO A;  1I6H B;  2FFK B;  5FLX L;  2C9O A;  1FNV A;  2XRQ D;  1STN A;  4IUU A;  1WD0 A;  3PUZ A;  2KEC A;  5I6Y A;  3QO2 A;  5J22 A;  2CQA A;  5IGE A;  5K36 G;  2F0I A;  3K5L A;  5M3F B;  4QUF A;  1TS3 A;  4H0L C;  4K8J A;  5CBA E;  2KJX A;  4HR7 B;  4BA2 I;  3I4M B;  3CQZ B;  3QJY A;  1MSH A;  2B2W A;  1SYF A;  3W2D A;  1RJT A;  1EIG A;  1TU2 B;  4KD4 A;  3RZO B;  2B2T A;  4TKO B;  5C5M A;  3SHL A;  1H9S A;  3OWF A;  1L0X B;  2IX0 A;  4DFA A;  2AQ3 B;  3DEO A;  5E4X A;  3NUC A;  4KY7 A;  2KEE A;  2HQE A;  2NB0 A;  3LNN A;  3S1R B;  2BDN A;  5BN4 A;  3KUP A;  2BE5 C;  2IT1 A;  3I70 A;  1SJE D;  4EQO A;  4RHR A;  3ND9 A;  1AFP A;  4G7Z C;  5D3D A;  2SOB A;  2JEB I;  5G3L F;  1J9O A;  2F3W A;  2FMC A;  1EYC A;  1GUN A;  1W6K A;  2B63 B;  2K7V A;  1NR4 A;  2F0O A;  4ZAI A;  4X3K A;  1JOQ A;  2B2U C;  4XQJ A;  1CQF A;  4Q0F A;  3K58 A;  3S1M B;  5DM6 3;  3TDQ A;  4AYB B;  4RGT A;  4DNT B;  3HS0 C;  1TWC B;  5F2D A;  3J7A F;  1HFN A;  3DM1 A;  3CKI B;  4A3K B;  3PUY A;  1LT6 D;  3ERO A;  2JSO A;  2F0M A;  3CU7 A;  3FDT A;  1LV9 A;  3MTS A;  1SAP A;  2AQ2 B;  3C1F A;  1PTO C;  3VR2 A;  1Y8N B;  4WRD A;  5BN3 A;  2RDG A;  2AUK A;  4L63 B;  2RBM A;  2EY2 A;  3MHB A;  4HED A;  3MFY A;  3BG3 A;  2ZXR A;  3FPP A;  4C2M B;  3DHQ A;  4L6T B;  2WP8 J;  2L55 A;  3OW7 A;  1DXM A;  2C5C A;  2F0P A;  2X6G A;  1JE4 A;  2L4N A;  4DA2 A;  2ENB A;  1SYB A;  3VR5 A;  1SXT A;  4LAA A;  1SDF A;  1EY8 A;  4H44 C;  4RFB A;  4WJW A;  2ICI A;  3K0Y A;  1OXV A;  1STY A;  4DGZ A;  4XDX A;  3I3C A;  4KJO A;  4CKC A;  4HCE A;  3BVZ A;  3J7A V;  1GXD C;  1G29 1;  1G91 A;  2EYH A;  3CRK C;  4EGV A;  2EJG C;  3QOJ A;  2F0W A;  1R9T B;  1F77 A;  5C6A A;  1CM9 A;  5EKL A;  4K2L A;  2BE5 D;  5I9O A;  1PTO H;  3D8G A;  5J1Z A;  1U4P A;  5C4X B;  1TS4 A;  1Y8P B;  2J4X A;  1T5X D;  5CMD A;  3HGB A;  1EU4 A;  3GQB A;  2PYK A;  1WVL A;  3HOX B;  1QNU A;  2MUY A;  1PFB A;  4DNR B;  3DEP A;  3NBI A;  1EY4 A;  2WB1 B;  3HRZ C;  1KDC A;  2RDH A;  3EFX D;  2EY1 A;  4KTA A;  4LK1 C;  1EOT A;  1YNJ C;  3AU7 A;  1TWF B;  3PMF A;  2KQ3 A;  1AEX A;  1D2B A;  5ELD A;  1JWM D;  2WII B;  3HP3 A;  4KKS A;  1I50 B;  1JOO A;  2K33 A;  4FYD A;  1SJH D;  2EE1 A;  4K2K A;  2E75 C;  1ZEQ X;  3EQL C;  3HZX A;  5EBC A;  3J81 L;  2TSS A;  4FXG C;  3A54 A;  1EEF D;  1TQO A;  1W6J A;  5EQ0 A;  3K5M A;  3OOC A;  2PNR C;  1L0Y B;  5IGC A;  4CKE A;  1SYC A;  3KLS A;  1HA6 A;  3BYT B;  1TKW B;  2YU9 B;  3KK7 A;  1TS2 A;  5K36 H;  5CBE E;  2RVL A;  2XSC A;  1ICW A;  4ILW A;  1BNZ A;  2PW5 A;  4DN4 M;  3GV6 A;  1ENA A;  2HUG A;  2WAQ B;  4DXF A;  3R93 A;  2ZXP A;  2B2Y C;  4ZUI A;  1FGB D;  1B44 D;  1O78 A;  5DAU A;  2FMM A;  3D4W A;  3M3Y B;  4RGO S;  2IX3 A;  1O7Y A;  2BOS A;  5DNF A;  1WTV A;  1O80 A;  3A55 A;  1EY6 A;  4G4K A;  3BZD B;  3M4Y A;  3RUZ A;  3IFD A;  1F9R A;  3MXN A;  3NTK A;  3S1Q B;  3A7A B;  2X69 A;  1AW7 A;  5KYI A;  1PDQ A;  3NK9 A;  1LTA D;  4IN3 A;  2KED A;  3NHH A;  1QOH A;  2L9H A;  3HOZ B;  3E0J A;  1BBX C;  4XTC S;  1KTK A;  2KUM A;  1NR2 A;  2R6G A;  1F2Y A;  1PMR A;  5M5Y B;  2VXW A;  2JEA I;  5IT9 E;  2M9V A;  4MIU A;  3GV3 A;  2F4I A;  2K28 A;  1HFG A;  1UNS A;  4IUR A;  1F9P A;  1XXG A;  3TP5 A;  1EU3 A;  1STB A;  1I4R A;  4K8I A;  2QF7 A;  1A3U A;  1GHK A;  4IUT A;  1H9R A;  2SNS A;  2R3Z A;  2Z4I A;  2E2I B;  2JXM B;  1TII D;  2EJF C;  4X3T A;  1O7L A;  2F0V A;  1CHQ D;  1PTO F;  1YNJ D;  3HOV B;  2A6H D;  3O13 A;  1LTR D;  1CTM A;  2G9H D;  4ABN A;  4CBV A;  1SBB B;  4P2C B;  2F0D A;  4H13 C;  3NTH A;  4CJ2 C;  2JA5 B;  3CHB D;  1IL8 A;  3GTL B;  3M4O B;  1U4L A;  4KY5 A;  1BOS A;  1F2Z A;  5C4Z A;  1MI2 A;  2EYO A;  1BR9 A;  5CV9 A;  1JB3 A;  1WTQ A;  2SEB D;  2QCP X;  1LLR D;  2L1B A;  3FVQ A;  3QOL A;  1H9J A;  1LTT D;  5C0X J;  1EYA A;  1Z6H A;  3PIP 3;  3SEB A;  2K04 A;  2EDG A;  4N9P A;  3S1N B;  2IJ0 A;  4IFD J;  4RKB A;  4K5X A;  3TZD A;  4ZLT F;  4IUV A;  5BN5 A;  3MAQ A;  2FIN B;  4HCS A;  1EQT A;  2Z8L A;  4DK0 A;  5IIF A;  4OIK A;  5A2Q L;  3GD7 A;  4RHS A;  1E2W A;  4RCN A;  4XYQ A;  3NPP A;  1GJX A;  3H3V C;  2B2U A;  3V05 A;  1BCP B;  3OMC A;  4CGY B;  5C3E B;  3QB3 A;  4LJZ C;  4IAL A;  2HCC A;  2ZT9 C;  1DZ1 A;  4N9T A;  4ZKC B;  3VYS A;  2DY8 A;  1TVX A;  1A2T A;  3T4A C;  4IFD I;  1E2V A;  4ZUJ A;  5KYL A;  3M7G A;  2IW3 A;  2AUJ D;  2F0J A;  1SFO B;  1KLG D;  2A69 C;  1QG7 A;  2LKV A;  1RCV D;  1I4H A;  2M00 A;  2H1E A;  3MC0 B;  3Q6S A;  1G8Z D;  1IKL A;  3JAM E;  2RQX A;  1IW7 D;  3TP7 A;  4J1M A;  1JR0 D;  3NBH A;  4NDX A;  3GTM B;  4KKT A;  2F0L A;  3X3N A;  2A74 C;  4X3S A;  1XTC D;  2NUC A;  4OO1 I;  4BBS B;  4C1N I;  1DOL A;  1CA6 A;  5EPJ A;  2D9U A;  5KRU A;  3DWP A;  2E2H B;  1ILP A;  4RCO A;  2K5W A;  4F7X A;  1X3Q A;  3VA7 A;  2FJ2 A;  1NAP A;  4V0B A;  1PRT B;  3P75 A;  5LL6 X;  1WTR A;  1EY5 A;  1EIH A;  4EQP A;  1S5B D;  1ZYR C;  4NKL A;  1JIC A;  4H7B A;  3A8I E;  3NP8 A;  2F0T A;  2MP1 A;  3BS1 A;  5AFW A;  1SYE A;  1ILQ A;  1QE6 A;  2X6L A;  2TMP A;  4F88 A;  2IWH A;  2PMZ B;  3J80 L;  1GUO A;  3S2D B;  4K6L A;  1FD7 D;  3MZ5 A;  1U4M A;  1TT2 A;  1SNC A;  1DM0 B;  4B9X A;  2WV6 D;  5I6W A;  4XQQ A;  3A56 A;  1B1Z A;  1TR5 A;  2F03 A;  3ZYY X;  1DD2 A;  2MJ8 A;  3Q24 A;  2OXP A;  3LX0 A;  4K14 A;  3NWS A;  5I4D A;  4C3I B;  1SNM A;  2AQ1 B;  1DON A;  3ND8 A;  5LL6 S;  3H94 A;  1EYD A;  2F0K A;  1EZ6 A;  3DUZ A;  3IFT A;  1KNA A;  1WTO A;  1CT1 D;  2BCO A;  1PZI D;  3DWQ A;  4PMB A;  2L11 A;  4R9W A;  3TP8 A;  3L9A X;  4ZYS A;  1OXU A;  4XXE A;  2WIN B;  1Q8I A;  2B8G A;  1B2T A;  5C3W A;  1VF7 A;  1EY7 A;  3TBI B;  1EZ8 A;  2DNE A;  2YYZ A;  3NQT A;  4DF7 A;  1ESR A;  2E74 C;  2Q8I B;  2E2J B;  4HN7 A;  2NVT B;  3M85 A;  1VMP A;  4QIW B;  3RZD B;  3GP7 A;  4RGM A;  1S5D D;  2CHB D;  4DAV A;  5JVG 3;  1D5M C;  1NUC A;  5LHY 1;  1RHP A;  4C3I G;  2L12 A;  1PZJ D;  3H09 A;  1NSN S;  3A8K E;  1STE A;  2B8F A;  4XT1 B;  3E5S A;  2NN6 G;  2B2Y A;  4HTH A;  5IOC A;  3V96 A;  5ELC A;  4IFD G;  4FNF A;  2QDB A;  3MVV A;  1IKM A;  5E3F A;  1CA5 A;  3T56 B;  2EYM A;  3SR1 A;  1FYC A;  5IGF A;  4QB4 A;  4KK7 A;  1ZYR D;  1HXY D;  5FLX E;  3S17 B;  2F0G A;  3R2T A;  1FR3 A;  2NBF A;  5M5W B;  1XX8 A;  5JEA G;  4HAE A;  5E1F A;  3NXW A;  2BA0 A;  5DEH A;  2EYJ A;  5EGT A;  4OL7 A;  3C2P A;  1FNU A;  1AZP A;  1A15 A;  2B39 A;  1HRJ A;  1I3Q B;  3BVM A;  1PFN A;  5ELE A;  3MWY W;  1I4G A;  1YNN C;  3EA6 A;  4KHV A;  4F87 A;  1BCP C;  4A3I B;  1SNP A;  3FPU B;  1XYI A;  1QB5 D;  1AP0 A;  3S2H B;  1Q12 A;  2SNM A;  1ZKO A;  2XWJ B;  2E2D C;  4PMC A;  2K03 A;  3V2T A;  1OXX K;  2PCF B;  3NTI A;  4RGN A;  2F0F A;  3P1H A;  3SK4 A;  4KD3 A;  4HSV A;  5M3M B;  4OGQ C;  3MXP A;  2F0U A;  1VDZ A;  2EJM A;  2K5D A;  1M8A A;  2RSN A;  5A35 A;  5CR3 A;  4EVO A;  4B08 A;  4WFN 3;  1PTO D;  3ITP A;  3OIQ A;  4ZQ3 A;  2XRS D;  3D6W A;  1GUT A;  5CV6 A;  3L3O C;  5T1G A;  4KN4 C;  3MXU A;  2F1M A;  1ONL A;  4UDU C;  5D65 A;  4ZRZ A;  1ENF A;  1PRT C;  3G6J B;  5EBD A;  1HA5 A;  5JAV A;  3LWU A;  3N6R A;  4FF2 A;  2IX1 A;  3NSW A;  4DXG A;  4XT3 B;  2JA7 B;  2HDL A;  3Q23 A;  5EKK A;  1Y69 U;  2BA1 A;  3K6O A;  2K5Q A;  1CI3 M;  3I72 A;  2DN8 A;  5C5L A;  3ERQ A;  1HTP A;  5CV4 A;  3GTP B;  5I9P A;  4BS9 A;  1Q3L A;  1A2U A;  1SND A;  1PLF A;  4FF4 A;  4ZK9 B;  1V1P B;  1XWE A;  2NVY B;  2JP1 A;  1WTW A;  2EYP A;  3VYU A;  1AN8 A;  1SMY C;  1BO0 A;  5IGG A;  2RKS A;  3E6Z X;  1FNW A;  4ZKB B;  1QIL A;  2QIL A;  2DY7 A;  1YNN D;  2EXZ A;  1Z47 A;  5NUC A;  1PZK D;  1BCP D;  3FEW X;  2O4X A;  1UAP A;  1DOK A;  2ZXO A;  1EWH A;  4G7O C;  1HQR D;  1V1O A;  4TRD A;  5KND A;  3W3A A;  1CK1 A;  1LT4 D;  1CQV A;  1KAB A;  2EY6 A;  1A3T A;  4XQN A;  3GTG B;  2VNU D;  2OEO A;  3T51 B;  2O5J C;  4A3D B;  2J0T D;  5KNC A;  3S14 B;  4A3J B;  4C3H B;  3U9S A;  4IUQ A;  1HQM C;  3URY A;  3PO3 B;  3S15 B;  1SE4 A;  3PUW A;  5CC4 A;  1SYG A;  2AWO A;  2IPK D;  2Q8R E;  2R92 B;  1WTP A;  1GOZ A;  4ME5 A;  4Y7N B;  5TSS A;  2RA4 A;  3HG9 A;  1D1K A;  3S16 B;  3SVM A;  3M7N A;  2V4D A;  3HOY B;  4CJ1 B;  1PRT D;  4CKB A;  5CGK A;  5EJW A;  3IKJ A;  5FKA C;  2XVS A;  5EPL A;  2LMC B;  2XNA C;  2NN6 H;  4RWS C;  4KHZ A;  4CJ0 B;  3C46 A;  4C3H G;  5C4J B;  1JOR A;  1QWY A;  3IL8 A;  2ID0 A;  4I65 A;  3PIO 3;  4KI0 A;  3DXJ C;  3GO5 A;  3CRL C;  3TSS A;  1PYW D;  3EVQ A;  3J81 E;  1H9S B;  1C8C A;  1GHJ A;  1MGS A;  4PNY A;  3TP6 A;  2MHV A;  1SNQ A;  3OWE B;  5JEA H;  2AWN A;  3R8B A;  1U4R A;  1D6E C;  2VUM B;  1CHP D;  1S4Z A;  1C48 A;  3WOF A;  5C0X I;  3PUV A;  4NP5 A;  1BCP F;  1SMY D;  4EQN A;  3BDC A;  4B9W A;  3T53 B;  2I46 A;  4TQU S;  3S9W A;  1R4Q B;  3KLS X;  2VB2 X;  3G7L A;  2EZV A;  4KJN A;  3EJI A;  1D1I A;  5FK9 C;  4OIJ A;  4S3S A;  1BDO A;  2JA8 B;  3AMU A;  4O42 A;  4NMZ A;  1D5X C;  2CW0 C;  3Q0A A;  2K6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...