1A3UA

Staphylococcal nuclease, cyclohexane thiol disulfide to v23c variant
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
135
structure length
134
Chain Sequence
LHKEPATLIKAIDGDTKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparison of straight chain and cyclic unnatural amino acids embedded in the core of staphylococcal nuclease.
pubmed rcsb
source organism Staphylococcus aureus
molecule tags Nuclease
molecule keywords STAPHYLOCOCCAL NUCLEASE
total genus 32
structure length 134
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1998-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1a3uA00
3SR1A 3NXWA 2QDBA 2F0MA 1TQOA 2EXZA 4ZQ3A 5C3XA 1SNCA 2F0OA 4HMIA 4EVOA 1SYFA 4K2LA 1EY6A 4K8JA 4NP5A 1KDBA 2F0LA 5HGTA 1SYGA 1TR5A 3BDCA 1EZ8A 2EYHA 4KTAA 3OMGA 3TP6A 1SNOA 3D4DA 5C5LA 1EY5A 4K5XA 1STBA 4KD4A 1A3VA 5J39A 2OXPA 2PQEA 4OL7A 2EY5A 3DMUA 3TP7A 2EYFA 2EYPA 5CV5A 4EQOA 2PW7A 1KDCA 1SNMA 2F0PA 3H6MA 4K14A 2EYMA 1EZ6A 3SK8A 4ZUIA 5IGGA 5J1ZA 4RKLA 2F3VA 5E3FA 4J1MA 1EYDA 4KHVA 5KIXA 5IGFA 3ERQA 4LAAA 5CV7A 1SNDA 5CV8A 4DFAA 4DU9A 3P75A 2NUCA 2F0KA 2RBMA 5EGTA 5J22A 1SYCA 4HTHA 1KABA 2F0UA 5C5MA 5NUCA 1NUCA 4S3SA 4ZUJA 3U9OA 1STYA 3V2TA 3R3OA 2PYKA 3C1EA 5IGEA 2PZTA 3LX0A 4HMJA 2OF1A 4ID6A 4PNYA 1EYCA 1EY8A 1SNPA 2F0FA 3NP8A 5I6YA 2SOBA 3T13A 5KEEA 1STGA 2HQEA 3NK9A 4I65A 2KQ3A 3SK4A 1IHZA 3C1FA 3ITPA 4K2KA 4KY5A 1EQVA 4QF4A 3D4WA 5JOBA 1II3A 2KHSA 1AEXA 3EVQA 3QB3A 3NHHA 4K5WA 1JOOA 3MHBA 1ENCA 4DF7A 2PW5A 2WACA 4N9TA 3VA5A 4QMGA 4RKBA 4QB4A 4YIJA 3TMEA 5KYLA 2EY2A 3MZ5A 1U9RA 3SHLA 5ISRA 4PMCA 4K6DA 1JOQA 5C4ZA 1KDAA 2PZUA 5IGCA 5JAVA 1A3TA 1SYEA 2F0QA 2EY6A 1F2MA 4ME5A 4B9XA 1NSNS 4MIUA 3NQTA 5KRUA 1RKNA 2LKVA 4E6IA 5IIFA 4IZ8A 5DAUA 4KJNA 1EYAA 2F0WA 5C4HA 5HURA 1A2TA 2O4XA 2SNSA 5IGDA 1A2UA 5IODA 2RKSA 4J6HA 5KYIA 1JOKA 3TP8A 3QOLA 1F2YA 2SNMA 3RUZA 2F0IA 3DHQA 1KAAA 3MVVA 5M9OA 1SYDA 1STNA 4F8MA 2PZWA 5F2DA 4IUNA 5CC4A 3S9WA 3PMFA 1SNQA 4EQPA 2F0DA 3SK5A 1EY0A 2F0HA 4WRDA 5IOCA 3HZXA 4IALA 4K8IA 5CR3A 4WORA 1A3UA 2F0SA 2EY1A 5C3WA 1STHA 2EYLA 2F0EA 5I9PA 4KD3A 5I9OA 5CV6A 3TP5A 4KV6A 1F2ZA 3EROA 3SXHA 2M00A 2ENBA 3P1HA 3QOJA 2F0TA 2F0NA 1JORA 1STAA 3D8GA 3OWFA 4H7BA 4KY7A 1EY7A 4R8NA 3HEJA 4EQNA 3EJIA 5CV4A 4NMZA 2EYJA 3E5SA 3MEHA 4F7XA 4PMBA 4NDXA 5DEHA 5C6AA 5I6WA 1EY9A 2EYOA 1EY4A 3OMCA 4ODGA 5EKLA 2RDFA 3T16A 2F3WA 3D6CA 3BDLA 3SK6A 5CGKA 3OSOA 2F0VA 5E1FA 4TRDA 5KGUA 4G57A 4K5VA 2OEOA 4KY6A 1ENAA 5CV9A 5K5PA 2F0JA 3MXPA 4KJOA 4B9WA 3NUCA 4NKLA 1TT2A 4DGZA 5IGBA 5EKKA 2F0GA 1SYBA 4N9PA
chains in the Genus database with same CATH superfamily
4ZKCB 1YI2A 1PRTB 1EYGA 4A3DG 4OX9Q 1I4RA 1K8MA 1KDBA 1WTPA 1SYGA 3M7NA 3OYYA 3FMCA 1D1KA 1Y8NB 1RIPA 4C3HH 5E4WC 1YNJD 3CRKC 2F4VQ 5IYCG 2E2DC 2ID0A 4O42A 1C8CA 2F3VA 3L9AX 2JA5B 2MUYA 4Y52H 1LTBD 1A63A 2VUMB 4JK1C 4YY3L 3S2HB 4ZUJA 3HFZB 4V0BA 3V2TA 5KYIA 2QA4A 2PZTA 3RUZA 4Z9CB 3MAQA 1Y69U 2G9DA 4AYBE 3CKIB 1WTHA 5E4XA 1GOZA 2MNAA 4PV1C 2AQ3B 3PF4A 2C9OA 5IY0A 2WACA 2LY7A 4YIJA 4C3JG 1K0SA 4M8AA 5ISRA 1YBYA 3WOFA 5LMUQ 1GUGA 4BBSH 1EQTA 4KKSA 5C44B 2NVQH 2E74C 1SN8A 4AQYQ 1S72A 3A0JA 2LKVA 1KTKA 4DR2Q 1IBLQ 4UP8A 1CA5A 3C3LA 4OIKA 2B63H 4QQBX 2I07B 1EWHA 1TY0A 4DR2L 1FGBD 1NE3A 1YZ6A 4WRDA 5KNDA 4K8IA 2O2LD 3K57A 2F0SA 1BO0A 1VDZA 5I9OA 2Z4IA 3TP5A 1D5ZC 2LFNA 3QR8A 4POGA 3WDNA 1KNEA 4LF7L 1TXYA 4QJFA 1N34Q 5CORA 5JEAJ 5EPKA 4JV5L 5KEEA 3LGJA 4JI0Q 1JICA 3M9BA 3T16A 4B3RL 3CCSA 2JEAI 2EDGA 3EN2A 4X65Q 2OQKA 1AZQA 1VMPA 2XWBB 2PMZB 2HDLA 4X6AH 3SR1A 3UI2A 3KJOA 1NCVA 4CJ0B 3TRZA 2K75A 1ILPA 4PQXA 2Z9HA 1UE5A 1FNUA 1K83B 4L5QA 3HRZC 2K33A 1JC7A 1MJCA 1Q81C 1PZID 2VQFL 3NWSA 3CCJA 4P74A 5IYBH 4I7ZC 3I4NG 5J1ZA 3HOUG 5JJLA 1JQYD 1O78A 4BY1H 3OW2A 3E0JA 5JPMC 3FPPA 1HHVA 1IBKQ 1VQ6A 5NUCA 4UDUC 4FF1A 1VQOA 2HUGA 3I91A 3PUWA 1WCMG 3M3YB 1GHKA 4QF4A 3AU7A 3AFPA 3HOXB 1II3A 2KHSA 5M3FB 2M2LA 3TMEA 3H0GH 5FK9C 2JSOA 1RHPA 3O13A 4PMCA 5ELBA 1TS4A 3DLLA 2A1AA 3R2TA 4RHRA 3OTOQ 4KN4C 1PZKD 2RVLA 3ND9A 4CDFC 1F2MA 1NSNS 1SROA 3HOVB 1TWCH 1HQMC 1LO5D 1BBUA 1BCPB 1NTGA 2EOTA 3NBHA 5IIFA 1EYAA 1X3FA 1DONA 2F0WA 5M3MG 4L5SA 2XIWA 2R6GA 2IX1A 1F77A 3CU7A 2SNSA 3KJPA 3TEHB 2SNMA 4HAEA 2UXBQ 3CQZB 2RQXA 3J81j 2CH4A 3PIP3 5CC4A 1GJXA 4JOIC 2F0DA 4LFBQ 3SK5A 5C4XB 1XNRL 1JT8A 1NJIC 1YEZA 2UXDL 4JI6Q 4GLAC 4A3IG 2CQAA 3FEWX 2IWHA 2NTSA 1ONLA 1IYUA 2XN9C 4WFN3 5M3FH 1H95A 1EEFD 4EQNA 5HY6A 3MFGA 4NDXA 3S1MH 4LJZC 1KNAA 4MTNA 3KBGA 3PO2G 2F4IA 1P8LA 1QZGA 4G57A 4KY6A 5FOBB 1ET6A 1B3AA 1LTGD 2IT1A 4DV4L 3OWEB 4NPSA 5D65A 1EIHA 1TWHH 2Q8IB 1XPUA 1B70B 4OO1H 1PH7A 1I6HH 4HMIA 1HNZQ 4O2DA 2PQAB 4OWXB 3STBD 3A55A 1EZ8A 1G8ZD 4KI0A 1B2TA 1EQRA 3K59A 2K5DA 3RZDB 2EY5A 4EQOA 4YWKA 1TY2A 4DAPA 2F0PA 3SK8A 4X3TA 1FJGL 3G48A 3PSIA 4G4KA 1PFMA 1CHQD 1JE4A 1I4HA 3BVZA 3A8IE 3U9OA 2O5JC 1N8RC 1JCKB 1XMOQ 2K04A 4DUZQ 1LT3D 3TZDA 2R7DA 4LF4Q 1I50H 4JI1L 3HOXG 1EWCA 1Y8PB 3J80c 1QE6A 3GTQB 1YHAA 4CGYB 4JBKA 1P16A 1DJRD 1K3BC 3X3NA 4KKTA 1B8AA 1R4QB 5EAYA 5JAVA 1XYIA 4B3TQ 4DR4Q 1N32L 2DNEA 3RZDH 2N49A 3J7YW 1X9NA 3CF5A 4XYOA 4A3GH 2E76C 3DWPA 4KJNA 2DGYA 2PMZE 1KD1C 5C4HA 2MQHA 1F2LA 3HKSA 2B63B 4IQZA 1DOKA 2ATWA 3FP9A 3IAYA 1GUOA 2EJMA 2ZTDA 1PTOD 2A69D 3MTSA 3R8BA 1BUVT 2A19A 4ZK9B 2F0EA 3D4RA 4JBWA 5IP9G 2WV6D 1XTDA 1R9TH 2AQ1B 5EPLA 5M3MH 4A93B 3UDXA 2ENBA 1CK1A 3T1HQ 3S1QB 3D8GA 4R8NA 4DXGA 4HIMA 4NXNQ 1GUNA 2TMPA 1TKWB 3N52A 5ELOA 4C3JH 2IY5B 4ODGA 2I46A 4DK3C 3Q0AA 3SK6A 1M8AA 4FYDA 5CGKA 4C1NK 1DXMA 1ZXTA 4TRDA 2B8GA 2XTIA 5KGUA 2NVTB 2OEOA 1BOSA 1I6VC 5LHY1 5LMUL 1K28A 2RSNA 4DV2L 3D6WA 5EKKA 4YHHL 1ICFB 2Z0SA 2AKWB 2QILA 5EBDA 1WI5A 4A3JB 4H0LC 3LNNA 3MWYW 2B2WC 3D4DA 4K5XA 1BNZA 1PYSB 4DA2A 2NN6G 1I4XA 1XXGA 2ZTCA 2EYMA 4XQNA 2B2YA 4WJWA 3CAMA 3DWAA 1I5FA 3KF8B 2CCZA 2VQEL 2JA5G 3R2IA 2L9HA 3Q6SA 4P71A 4R1JA 4PZ8A 4IFDJ 3TS0A 1B53A 1LTRD 2K5QA 1KAWA 3LX0A 4ID6A 3K80C 3WWVA 1RDPD 5EQ0A 2HQEA 1LT4D 3A56A 4YCVA 1QZHA 1R9TB 3C1FA 1FR3A 4TKOB 1Y1VB 4IPDA 2PPBC 3GTPH 2UUCQ 4N9TA 2D9UA 4Q0FA 2H5XA 4DK1A 4TQUS 1HH2P 1D2BA 5IGCA 3CPWA 2Z6BA 3HOYB 4X3UA 4CDEC 3FKIH 1Q12A 4DUZL 1L2FA 2WKCA 4HJ8A 1G291 4LUOA 5J3BA 2I5MX 4JW0A 5IT9E 5IODA 4A3FH 3K7UC 1PA6A 2R93H 1HR0Q 1X65A 1MI2A 5M9OA 1STNA 2K52A 4A3EG 3HOZB 2R92B 1XMQL 3T51B 4EQPA 1OO9B 5IOCA 1VQKA 1MBYA 2UU9L 2JA6B 1J9OA 5CR3A 5FLMH 3A5ZB 1SBBB 4DV3Q 5FO8B 1F9QA 5M5WB 1ML0D 1QCBD 2F0TA 1OXSC 2F0NA 3JAMi 5JJIA 2A73B 4DXFA 2H1EA 1JJ2A 1ZYRC 4JI2L 2PI2A 1B9NA 4QUFA 2BOSA 3H91A 3OSOA 3BJUA 4LFAQ 3A8KE 5K5PA 4B9WA 5COYA 1CKOA 1Q7YC 3GTMH 1TT2A 2G5DA 1Y1VH 4TSSA 2Q8RE 1S5ED 1TWFB 1RD9D 4IUVA 1EFWA 3TN2A 4ZQ3A 5BN5A 4A3JG 4K2LA 4NP5A 2D5DA 2F0LA 2Z6KC 4KKUA 1A3VA 4R9WA 1ENFA 4LF9L 4X62L 4R8IA 3FRPB 4EX5A 4KN7C 4LFBL 1EZ6A 4IPGA 2NZ1D 3RZOH 3S2DB 2ASBA 1BCPC 2JN4A 1GUTA 4LUZA 2OT2A 3F1ZA 2CH4W 2K01A 4IFDH 1PRTD 1Y14B 1AP0A 1UE7A 4DU9A 3MFYA 4OIJA 3TS2A 3CCLA 2KA7A 3S1RH 1LTLA 5BN4A 1U5KA 2E2JH 2EZVA 1I3QH 1EYCA 1HXYD 2AHOB 2A5HA 2PNRC 2EE1A 4MNOA 3J7AF 2JE6I 3SK4A 3HOVG 1YNNC 2KCNA 4LFCL 4LF4L 4DF7A 4JC0A 4GN4B 1YNJC 3VA5A 1Y8OB 4AYBB 2KBNA 2XRQD 3VR5A 1KDAA 2PZUA 3J80L 1HUNA 3NTIA 1L0YB 4YWMA 4BBSB 5C3EB 3S17H 1HQRD 1IXRA 1H9RA 4QL5A 1WYDA 5JVG3 3S16H 3KF8A 2R61A 3IL8A 3UDFA 1OTCA 1IYJB 3K0XA 3M4QA 1UWVA 2B2UC 3BVGA 5JJZA 5LL6S 2J4XA 2Q2UA 1LT5D 4DR6L 1AN8A 2L4NA 1KQSA 4DNIA 2JYOA 1TS3A 5IWAL 4XQQA 2K5WA 1GO3E 3FKIG 5GAGC 2X6GA 1VQIA 1W3SA 4C2MH 4Q5VA 3K6OA 3U9SA 4JVZA 5CV6A 4L8JA 1JMCA 3EROA 3E0EA 2SEBD 1DOLA 3P7JA 3H3VH 3Q24A 5DM63 2L15A 1EY7A 1YJWA 2E2IH 1T5EA 5CV4A 1EIGA 1NY4A 4A3EH 1PFNA 1PHJA 3QJYA 3I7FA 3BDLA 5ELNA 1I3QB 1OXTA 2A6ED 5FLMG 4A3IB 1ENAA 3HKZE 4UHVA 3L0OA 4GN5A 3NBIA 2KJXA 2ZXOA 4DGZA 4IJHA 5JEAH 1NR2A 2CWPA 1TQOA 2B2UA 1SNCA 2LXKA 3V05A 3I70A 3TZUA 1TR5A 4NB3A 3PUXA 1HZCA 1CZGA 2YU9B 4OL7A 2V4DA 2EQSA 2VXWA 5CV5A 4GS3A 3KDFA 1X3EA 3I4MH 1ZEQX 1Y1VG 1GKHA 1GM5A 1QUQA 1VQGA 1IKMA 5IGFA 4A3LG 2AQ2B 1B1ZA 2K5HA 5ELDA 4OWTB 3F8TA 4A3EB 2A68D 2E8GA 2L55A 2ZXRA 2OTLA 2B29A 1A8VA 2N3SA 4HSPA 3VYSA 1NUCA 3SGIA 2ZTEA 3R3OA 1RF2D 2PYKA 3C1EA 1AZPA 2WB1G 1SNPA 3H15A 1A15A 1D5MC 1E2VA 3I8ZA 3HP3A 2HIXA 1PH1A 1U4RA 2DUDA 2Y0SE 3EVQA 5LL6X 4JOIA 1JOOA 2PW5A 3CCMA 1TWHB 4QMGA 4RKBA 4CDCC 1JWMD 2R3ZA 2A74C 3OOCA 3HOYH 2BA0A 1G91A 1JE5A 3PO2B 2F0QA 1PTOC 3IRBA 3PIPA 1NBWA 3LWUA 2E75C 1CA6A 3HOVH 1CUKA 1O7LA 1K3RA 3EA6A 2JA8G 2AUKA 1EOTA 3FHWA 4RH6A 2JA5H 2WP8J 2K05A 3NTKA 2IHEA 2PI2E 3M7GA 3PMFA 4RG1A 1SDFA 5FLXL 4DV4Q 4HJ5A 5IYDH 3RLFA 3PUZA 2N8NA 3NENA 4C3IG 2UUAQ 4JYAQ 1KRTA 4HN7A 4DNRB 2GA4B 4NMZA 2DJGC 2JJQA 1D6EC 1QG7A 4N8FA 2FMCA 1SSOA 4CJ1B 1S5CD 2FXQA 4K5VA 1ESFA 4OWWB 2MFIA 1TWFH 2XNAC 5GADC 1J8IA 1Z7TA 3PCOB 3A54A 3M4OH 1TWAB 4EVOA 1DOMA 2R92G 4CKEA 3S1RB 4CHTB 2DN8A 2PCFB 5C44H 2NVQB 3K81C 2JXMB 5CBAE 2EYFA 2EYPA 2B2WA 3AFQA 4DV7Q 2XRSD 4LFCQ 1KDCA 2Y0SG 1CKMA 4DV5L 3M4PA 4RKLA 2BCOA 2B63G 5E3FA 4JBMA 2NB0A 4FXGC 4LAAA 5D3DA 5CV8A 3K7AH 3T53B 3CD6A 5BR8Q 3NEMA 3GV6A 4HEDA 4XIGS 5J22A 4F88A 4OEMB 4MN3A 1XPOA 1I4GA 1SMYC 1EL0A 3KYHC 2F0FA 1E2WA 1F9SA 1G2TA 1E1OA 2Z1CA 5FO9B 3U4VA 1GUWA 3NHHA 3MHBA 2RHQB 3I72A 3KLSX 2HD3A 4LF8L 1B7YB 1QNUA 3K0YA 1PYWD 1DD2A 4JI8L 3VYTA 1HFGA 5DM73 4IUTA 3TQYA 4FXDA 3Q22A 1K8GA 5JJKA 3MC0B 4X65L 2HCCA 4A3BH 3KFUA 4L5RC 5ELFA 2JA8B 1HZ9A 3RLOA 4FF4A 2DJFC 4K0KQ 4C3IB 2M9VA 1KAAA 4BY1B 4IFDG 3HOZG 1SLJA 4J8QA 2VL6A 3JC66 1E3PA 2IL8A 2K5VA 2KUMA 5C0XH 4DV6L 5IYBG 3W2DA 2P5ZX 4P2CB 3RMHA 3K5NA 2HCIA 3M3YH 4LF6Q 2NVXB 2MO0A 5LMNL 2JA8H 4A3DH 3GV3A 2JQOA 1M4VA 1EY9A 3OMCA 5C4XG 3GDEA 1SAPA 1ZYRD 1A6XA 4A4IA 1PH5A 1N34L 2K4KA 2WAQG 1E7ZA 3T4AC 4IOCA 1Y1WG 1XPRA 1N33Q 1E2ZA 3H0GG 3S1QH 1QVFA 2I5HA 4A3DB 1K83H 5D3IB 1KXLA 4OGQC 2YU9H 3I3CA 2EYHA 2QW7A 4RGOS 4HIDA 3AB9A 5C5LA 1STBA 4KD4A 1LTAD 5CBEE 2R7ZB 3RR5A 1HZAA 1NR4A 4DKAC 1E22A 1B4OA 4ME3A 4B3ML 5IT9c 2Q8TA 1PFBA 2F03A 1DZ1A 5CV7A 4DFAA 4UPAA 4FNFA 1MSGA 2HDMA 3A8JE 4KK7A 2NUCA 4P73A 4X62Q 4L6TB 2RBMA 1WOCA 5CMDA 2LMCB 3NP8A 3U58A 1IYVA 2KEEA 1SXTA 1KRSA 4HCEA 3PIO3 2K7VA 2FHTA 5ELEA 1PH4A 2D0OA 1IW7D 4LF8Q 4NXMQ 3CC4A 3UE1A 3VA7A 3L3OC 1SYEA 2F3IA 4OHJA 3JAML 1HNZL 2G9HD 4QIWB 1W6KA 4R4IA 2CHBD 4IZ8A 4HSVA 3DXJC 2ICEC 3I4MG 3HOUB 1WTOA 4FF2A 1BBXC 2KENA 4LNQA 5D14A 4GZYC 3PV0A 4XDXA 4IUNA 1IBMQ 4OXPA 2E2HH 2NVYH 3K8AA 4A76A 1Q86C 5C3EG 2ZT9C 1S40A 3H3VC 1Q3LA 3FKIB 1T9HA 1MIUA 4A3BG 4GKKQ 2EY1A 3W3AA 5AFWA 1STHA 1KL9A 3S24A 4RHSA 4BBRB 3SEBA 3P1HA 5EBCA 3GTPB 3ERSX 1BF4A 1LUZA 3M4OB 3HKZB 3FDTA 1ZKOA 2UXDQ 1VMCA 4BXXG 5EKLA 3D3RA 5E1FA 1TWGH 4QY7A 3S17B 2QF7A 1QVGA 3HOXH 1PH2A 2F0GA 1CI3M 4HJ9A 1B50A 3PQIA 1H9KA 4A3MG 1VQCA 3M85A 2EXZA 5JPNC 1LACA 1XMQQ 1PV4A 5J39A 5K36G 1VQ4A 1X55A 2ICIA 1J5EQ 1G51A 2OXPA 3PO3G 3DMUA 1CSPA 3J80i 5AJ3Q 1PDQA 1UUPA 3T56B 3S15B 1SNMA 1NNXA 1I50B 2BA1A 5IYDG 1JWSD 3DEOA 1SE2A 4KHVA 2VQEQ 5M5XB 3GTGH 1SE3A 4ZCKA 4J15A 2E2HB 2F0KA 3PGZA 4BY7B 1YITA 3GTKB 5I6YA 1FL0A 4HR7B 3T13A 3I4NB 1G2SA 1Q46A 5M5YH 1O7YA 4JV5Q 3FVQA 2OWOA 2VB3X 3ZYYX 2MO1A 1ICWA 5I2YA 1IBML 4LF5L 2VW9A 3J81c 1UNSA 2YTXA 2RDGA 2EXDA 2JA7B 1HZBA 2E5LL 5H1SE 4R4OA 4V190 1MHWC 4PG3A 4AIMA 1AE3A 4JPBW 1WTXA 3BYYB 1A62A 1KLUD 3QWNA 1PRTF 1CSQA 2F0IA 3BZCA 3MVVA 1C9OA 2VUMG 1ILQA 1EWIA 1XNQQ 2EPBA 2NN6H 1I4QA 1HR0W 4RGMA 3S1NB 4C2MB 5JVH3 4WJ3M 2EIFA 2KEDA 4JI5L 3QOJA 3UE0A 1HJPA 5I6WA 2EYJA 4F7XA 1J5EL 5C6AA 2A69C 1S5DD 4X64Q 4DUYL 1SRUA 1Q8IA 1QILA 2B2YC 1PRTC 2R7ZG 4DNTB 3T1YL 1NMFA 1STEA 3MA2B 1V1PB 1VCIA 1F9RA 3CXCA 2B2TC 4EQ5A 1IBLL 1V1PA 1B44D 3A74A 2D62A 1OXUA 2K1BA 5KRUA 5DNFA 3HOZH 2MHVA 2ALYB 2NYZD 5HGTA 3TP6A 1XNRQ 3OMGA 2D0PA 4JI4L 2CFMA 5I2XA 4DV0L 1YJNA 3G71A 3E9HA 3CC2A 4A3GB 3H6MA 1LM0A 3IFTA 4ZLTF 4ZUIA 2R93G 5M5WH 2R7FA 1XNQL 3HOWB 4DAYB 4G7OC 2B8FA 3NQIA 3P75A 2AWNA 2NTTA 1SYCA 3NWTA 1VQMA 1LLRD 2HQLA 4HMJA 3I90A 4C3HG 1QJOA 4GN3B 4U68A 3KUPA 4A3GG 4LFAL 1CQVA 3OHXC 1EQQA 4U673 4LF5Q 1PLFA 2EY2A 2OCEA 3SHLA 3GTJH 4DAVA 4YWLA 4PZ7A 4YCUA 2B39A 2L0CA 1O7ZA 1HUMA 3STBC 2NVTH 5KNCA 3CMEA 3VR3A 3W5OA 3A7LA 1MD2D 3F2DA 3SE0A 1AFPA 5IP9H 1TWCB 4JYAL 1HA6A 4A3FB 2O4XA 2IW3A 3B6YA 1MGSA 4AYBG 1PVOA 1JOKA 4A3JH 3QOLA 2HIVA 3CCRA 4DUYQ 3J7A5 2N78A 2PZWA 1TU2B 3S9WA 1SNQA 1G6ZA 2JA6H 1PYBA 4X66L 1EY0A 2F0HA 2K50A 3ULJA 1VQDA 1XMOL 3KF6B 1TIID 3G7LA 1F2ZA 1S4ZA 1U4PA 5A35A 3RN5A 5IP7G 4B3MQ 4OX9L 1L1OC 3OWFA 1JB3A 3KDFB 2UUBL 4GLVB 2UXBL 2VUMH 4PMBA 5DEHA 4H13C 2EYOA 1FVIA 1VQAA 1CHPD 5C0XJ 2PO4A 3R93A 1RTNA 1S3OA 3EIVA 4A93G 2JK8A 1SYBA 1KLGD 3CRLC 3J81L 2BE5D 4JI5Q 1X3PA 1I6HB 3U50C 2LSSA 5C3XA 2JA7G 1QUQB 1SYFA 1CTMA 1EY6A 4K8JA 4ULLA 2HHHQ 1G6PA 3BDCA 1PH9A 1SNOA 2QCPX 4LUVA 4FF3A 3GO5A 5C3EH 2K14A 2NN6I 4YCWA 2KHJA 5GQOA 2K03A 4AH6A 4K14A 3CHBD 5IGGA 1WJJA 3UDGA 2NVXH 3C2PA 1VQHA 4GKKL 3A7AB 4OELB 4KHPL 1RJTA 1HFNA 3DEPA 4RWSC 1YIJA 3RLNA 1SMYD 3K7AB 1UEBA 1L1OA 4DV0Q 4BY7H 4POFA 3F2BA 4S3SA 1O7IA 1STYA 1EEID 3G6EA 4IUQA 4JI4Q 3KLWA 4C3HB 4IPCA 1STGA 4JI6L 1QB5D 1LT6D 2EJGC 2WFWA 1WTVA 1CQFA 1EIYB 1H9MA 2X69A 4A3FG 1W2BA 1QNKA 1TWAH 2ZM6Q 1W6JA 2LS01 1UAPA 4DK6C 4ME5A 1GXDC 4B9XA 1WTQA 5C0XI 1SFOH 1WCMH 5GAEC 5JEAG 4LWCA 5KYLA 2E2IB 4CBVA 1F2YA 2Q2HA 4P72A 2BDNA 2CW0D 5F2DA 4CKCA 1NAPA 3V96A 2B2TA 1JB7A 2K5NA 2C35B 2KCTA 3HZXA 2GVAA 1H9JA 1FGUA 1SMXA 1VF5C 1C48A 3G6JB 1Z9FA 5IWAQ 2A8VA 4A3LH 3T1YQ 2X6LA 4C56C 4M1UB 4A3CH 1X3QA 3EJIA 2AUJD 2C5CA 3GP7A 2WINB 2IPKD 1C7YA 2KVMA 3Q23A 2LXJA 3QO2A 5KNBA 4QUCA 2F0VA 1V9PA 3CPFA 4BBSG 1PZJD 3CC7A 3MXPA 2JP1A 4KJOA 3C46A 3MXNA 1XX8A 2K6AA 4XTCS 4DV2Q 3P20A 2QKIC 4N9PA 1RTOA 3I4LA 2BDOA 1PFSA 5M3FG 3HOWH 2AMCB 1VQPA 1J6QA 3I73A 3JAMc 4ILWA 3PO2H 3BZKA 1EY5A 2KHIA 4RCNA 2L12A 4LF6L 4DR3L 2Y0SB 4XQJA 3VR2A 3BS1A 1BDOA 4RGTA 2VNUD 4KHZA 3BVMA 4A75A 1EFID 2HHHL 5BN3A 4OO1G 3KLSA 1YNXA 3NELA 3CW2C 1AE2A 3HS0C 5FJ8G 4DK0A 2KCMA 5IGEA 2J0TD 4RGNA 2OF1A 2R7ZH 1ASZA 5HGQA 4KHPQ 2GN5A 2VY3A 1EQVA 3D4WA 3RNUA 2MP1A 1ENCA 5T1IA 2WB1E 4QB4A 2F52A 3MZ5A 1JJGA 2RHSB 4BY7G 4GKJL 2OQ0A 1AW7A 1V8QA 4IUPA 1UE6A 5I4DA 3GD7A 4DR5L 4ZKBB 2ZJPA 4E6IA 4GNXC 3J81E 4XXEA 2MGSA 4RMFA 5IGDA 1PXUA 1A2UA 2E5LQ 4J6HA 3TP8A 3HOUH 3DHQA 1PMRA 1SYDA 2EVBA 1X54A 4BY1G 3CCQA 5A2QL 5FLXc 3AYHB 5C44G 2RDHA 4GOPA 2UU9Q 4IALA 4JBJA 2Q2TA 3TREA 1OXVA 2BH2A 1LYLA 2Z8LA 1BKBA 1VS0A 2IX3A 1M90C 1I4PA 3CQZH 1M1KC 3MEHA 1EU3A 4JI2Q 1U4LA 1N36Q 2DY7A 3S2HH 2QEJC 4JCVE 4GOPB 3E9IA 4A3BB 3NUCA 1Q8KA 1X56A 3BU2A 4NKLA 1SJHD 3HEJA 1SJED 1DM0B 2KECA 3KLRA 1PH8A 5G3LD 3H0GB 4A3CG 5LMNW 1QVCA 4IPHA 4DR1Q 2CW0C 5EPJA 4B3SQ 2JA6G 2JEBI 3X3MA 3RZOB 1HRJA 2PW7A 4X66Q 4JI3L 4F87A 1HNWQ 3HG9A 2MPMA 1HCZA 2CKZB 4FO2A 4ZRZA 4BBRH 2QEXA 4B3SL 3OPOA 1FNWA 2N55A 3BDOA 4A3KB 2F0UA 3MXNB 4R4QA 4P75A 1V1OA 5C5MA 2TSSA 5T1GA 4DR7Q 2UXCQ 3I55A 2B3GA 1WCMB 3F2CA 2MJ8A 3NK9A 3ZJYC 1N9WA 2KQ3A 4A93H 4JG2A 3J7AV 1IKLA 3RD4A 3NBHB 1Z6HA 1SE8A 4QGUA 4LF7Q 5EKIA 3DWQA 1C4QA 1UEAB 2AWOA 1N33L 3H3VI 2IJ0A 3G4SA 1JOQA 1L0WA 2RCNA 2JA7H 1C0AA 2L1BA 2RA4A 3TDQA 1WVLA 2CWAA 3BYTB 2YTVA 1Y1WH 1RCVD 3GTKH 1VQNA 3S16B 2FINB 5M5YB 2VB2X 2B2VC 1I94Q 4N8X1 1GUSA 4C3IH 3MXGA 1JWUD 5M5XH 4DR6Q 3J7ZC 3F2UA 4ALPA 2DY8A 1WTRA 4H44C 1BQQT 4UP9A 2B2VA 2UUCL 3AQQA 1GD7A 1VQBA 4KLKA 4JI0L 3IKJA 2UUAL 1HR0L 3S14H 1Y1WB 3D31A 2EYLA 2VQFQ 1B3QA 1LTSD 4KV6A 4HIOA 4CJ2C 2M00A 5E7NA 2O5IC 2ZXPA 5GROA 1XJVA 1KC8C 4IFDI 3KOJA 3OIPA 5FLXE 4OO1I 2YYZA 4A3KH 2WKDA 1CKNA 4B3TL 4DR4L 1N32Q 3QIAA 1HPCA 4DN4M 3I2ZA 1S5FD 4DR3Q 5LMNQ 3VR6A 1PH3A 4H02A 1KIXA 4B3RQ 5IE8A 1K9MC 2QDLA 4MZ9A 2OTJA 1HTPA 3W1GA 4LW1A 3GTQH 3NXWA 1VQLA 1K8AC 2WAQE 3ONAB 2FFKB 3JAME 2F0OA 1PTOF 3NPPA 4KTAA 1JJCB 3VYRA 1PTOH 3MEFA 1N36L 5IT9L 1CKNB 4JI7Q 1Z47A 2Z6KA 3TP7A 4GNXA 1VQ8A 2H4OA 5BR8L 3SDZA 2KOLA 4R4CA 4FP5D 3DM1A 4GNXB 3W1BA 4J1MA 4XT1B 4NXNL 2I5LX 2WIIB 1SNDA 4QIWE 3KK7A 5DLQE 2J7ZA 4CKBA 4WJ4A 4X3SA 1LTID 1X32A 4C3JB 1Q82C 1D7QA 4HTHA 1KABA 4DR7L 2UXCL 1BXTA 4PNYA 4ZYSA 4IO9A 4ZAIA 4OONA 1I94L 2QGQA 3ICEA 4YHHQ 1HNXL 2JA9A 4UP7A 4B08A 2PNHA 4BBRG 1AEXA 3KBXA 2PQAA 4AQYL 1HNWL 5ELCA 3CCEA 3FPUB 3HKZG 3HOWG 1H9SB 4BXXH 3RN2A 4PZ6A 3NSWA 4O1NA 3K58A 4GKJQ 2FMMA 1JR0D 1H9SA 2EY6A 1EUJA 3Q8DA 4MIUA 5C0XG 4DPGA 4GOPC 1YJ9A 4IOAA 4DV5Q 1RL2A 2KCCA 4L5TA 1Q90A 1A2TA 4MHEA 1KHIA 3N6RA 1B9MA 4XT3B 1EU4A 1SR3A 5K36H 2YV5A 2ZJQA 3LWEA 4YY3Q 1VQ7A 4JI7L 4X64L 3GTJB 3AMUA 3ND8A 5C4XH 4BWGB 3HGBA 4GLXA 2F4VL 5FJ8H 4BA2I 3WOEA 4WORA 1VQ5A 5C3WA 1HTLD 2GVBA 5C4JB 5IYCH 2XSCA 1OXXK 1IL2A 3SVMA 2RF4A 1GVPA 1EIFA 4FDBA 1STAA 4KY7A 3E3XA 1TS2A 4LK1C 4DR1L 4BA1I 5CYUA 1X6OA 4UAIA 3GTLB 4DAMA 3URYA 1V43A 3K5OA 2A6HD 5CV9A 1Q1EA 4DV7L 3A5UA 3GQBA 1LV9A 1SFOB 4O0AA 5IGBA 1CZWA 1IHZA 1BCPD 1A0IA 2F0MA 1UE1A 1MJEA 2NBFA 3UDIA 1K8OA 4BS9A 2Z4HA 1CM9A 3U4ZA 2IHFA 4DAYA 1TS5A 3GTLH 4K6LA 1QOHA 2PQEA 2VZAA 4DV3L 4X3KA 3BG3A 4FXKC 2FJ2A 1ESRA 3AEVA 4HJAA 1IBKL 3GTGB 3S2DH 2UUBQ 1EYDA 1HA5A 4PMWA 2R93B 1VQ9A 1NMGA 1IZ6A 1VQJA 3K5MA 1WD1A 4R4TA 5EGTA 1SE4A 3DUZA 3GTOB 1TWGB 1EY8A 2L5TA 2CVRA 2WB1B 3I56A 4I65A 4HJ7A 1HNXQ 4HIKA 4KY5A 4NXML 5JOBA 3QB3A 5AJ3L 1ET9A 3OIQA 4IUUA 1BVSA 4TVAB 3T1HL 1L0XB 3TBIB 1T5XD 1E0BA 3S1MB 4RCOA 5C4ZA 1XTCD 4JI8Q 2L11A 3M4YA 2HT1A 4DV6Q 1EOVA 3QG1A 3GTOH 1MSHA 3PO3B 3EFXD 1BBWA 1DGSA 3TSSA 2DNCA 3ULPA 5M3MB 4LMQD 1E24A 1E1TA 4KMUC 3PUYA 2XGTA 3CMAA 1GHJA 4ABNA 4LF9Q 3HOYG 2EJFC 3D0FA 3S14B 3J81i 3S1NH 2K32A 1PH6A 3S15H 3I4NH 1S5BD 1MKHA 2RSOA 2D2CC 4Y7NH 4RFBA 3I4OA 4H7BA 1DYQA 4A3MH 1VF7A 1Q1BA 2NWGA 3OTOL 1EY4A 2ZJRA 1PTOB 2RDFA 2F3WA 3D6CA 3KF6A 4FVMA 2E2JB 3J80E 1DCZA 3H09A 3OW7A 2RCFA 3PO3H 1L1OB 1R4PB 4G7HC 3H94A 2NZHA 2YTYA 1LABA 3EQLC 1WFQA 4DV1Q 2BH8A 2QDBA 1D8LA 3NTHA 4A3MB 5FKAC 3CCUA 3MXUA 1JORA 2XVSA 3VR4A 5TSSA 3DM3A 1TVXA 4HCSA 4L63B 3I4MB 5GAHC 1YNND 2A6HC 1QWYA 1RODA 4C1NI 3ERQA 5KIXA 4K0KL 2CQOA 1LTTD 2VS1A 1K0RA 2R92H 1BCPF 2IX0A 3PIOA 4A3KG 1FD7D 4JI3Q 4QCLA 5FO7B 4MTKA 4A3IH 4XYQA 2SOBA 3K5LA 3VDYA 3CP0A 5IP7H 3PUVA 4Y7NB 3ITPA 4K2KA 2SDFA 4K5WA 1K73C 1BR9A 1ASYA 2ZM6L 1IL8A 1U9RA 2V1CC 4IURA 4K6DA 3CCVA 2NZOA 1YVCA 4G7ZC 4UY8C 2A68C 1A3TA 1IW7C 5L37A 2I0QA 4JI1Q 3NQTA 4DV1L 4CDDC 1RKNA 1SEBD 4IN3A 1FYCA 5DAUA 1D5XC 4NW2A 1AH9A 5HURA 1XWEA 2F1MA 2XWJB 1WD0A 3L2PA 2RKSA 3VYUA 1O80A 2A6EC 3L7ZC 5G3LF 1FNVA 1YHBA 2Q2IA 4F8MA 4EGVA 5A2QE 2NVYB 3ULLA 1WTWA 4RAUC 3PF5A 5C4JH 1FJGQ 1A3UA 5EJWA 3GTMB 5I9PA 2WAQB 4KD3A 1U0LA 3NE5B 2BE5C 1CT1D 1F9PA 1YHQA 3SXHA 2N88A 3E6ZX 2ES2A 1D1IA 4RA8A 1V1QA 3E5SA 1VQEA 3EBEA 4IJLA 1CFMA 1VQFA 4DR5Q 1U4MA 3ER0A 3IFDA 4I7AA 2F0JA 4APVA 2K28A 3BZDB 1X3GA
chains in the Genus database with same CATH topology
4ZKCB 1PRTB 1I4RA 1K8MA 1KDBA 1WTPA 1SYGA 3M7NA 3FMCA 1D1KA 1Y8NB 5E4WC 1YNJD 3CRKC 2E2DC 2ID0A 4O42A 1C8CA 2F3VA 3L9AX 2JA5B 2MUYA 1LTBD 2VUMB 4JK1C 3S2HB 4ZUJA 4V0BA 3V2TA 5KYIA 2PZTA 3RUZA 4Z9CB 3MAQA 1Y69U 2G9DA 3CKIB 5E4XA 1GOZA 4PV1C 2AQ3B 2C9OA 2WACA 2LY7A 4YIJA 4C3JG 4M8AA 5ISRA 3WOFA 1GUGA 1EQTA 4KKSA 5C44B 2E74C 2LKVA 1KTKA 1CA5A 3C3LA 4OIKA 2I07B 1EWHA 1TY0A 1FGBD 4WRDA 5KNDA 4K8IA 2O2LD 3K57A 2F0SA 1BO0A 1VDZA 5I9OA 2Z4IA 3TP5A 1D5ZC 2LFNA 3WDNA 1KNEA 5CORA 5JEAJ 5EPKA 5KEEA 1JICA 3T16A 2JEAI 2EDGA 1AZQA 1VMPA 2XWBB 2PMZB 2HDLA 3SR1A 3UI2A 1NCVA 4CJ0B 1ILPA 4PQXA 1FNUA 1K83B 3HRZC 2K33A 1JC7A 1PZID 3NWSA 4I7ZC 5J1ZA 1JQYD 1O78A 3E0JA 5JPMC 3FPPA 1HHVA 5NUCA 4UDUC 4FF1A 2HUGA 3I91A 3PUWA 3M3YB 1GHKA 4QF4A 3AU7A 3HOXB 1II3A 2KHSA 5M3FB 2M2LA 3TMEA 5FK9C 2JSOA 1RHPA 3O13A 4PMCA 5ELBA 1TS4A 3R2TA 4RHRA 4KN4C 1PZKD 2RVLA 3ND9A 1F2MA 1NSNS 3HOVB 5IIFA 1HQMC 1LO5D 2EOTA 1BCPB 3NBHA 1EYAA 1DONA 2F0WA 2XIWA 2IX1A 2R6GA 1F77A 3CU7A 2SNSA 2SNMA 4HAEA 3CQZB 2RQXA 3PIP3 5CC4A 1GJXA 2F0DA 3SK5A 5C4XB 2CQAA 3FEWX 2IWHA 2NTSA 1ONLA 1IYUA 2XN9C 4WFN3 1EEFD 4EQNA 3MFGA 4NDXA 4LJZC 1KNAA 3KBGA 2F4IA 5FOBB 4G57A 4KY6A 1ET6A 1B3AA 1LTGD 2IT1A 3OWEB 5D65A 1EIHA 2Q8IB 4OO1H 4HMIA 3A55A 1EZ8A 1G8ZD 4KI0A 1B2TA 3K59A 2K5DA 3RZDB 2EY5A 4EQOA 1TY2A 4DAPA 2F0PA 3SK8A 4X3TA 4G4KA 1PFMA 1CHQD 1JE4A 1I4HA 3BVZA 3A8IE 3U9OA 2O5JC 1JCKB 2K04A 1LT3D 3TZDA 1EWCA 1Y8PB 1QE6A 3GTQB 4CGYB 1DJRD 3X3NA 4KKTA 1R4QB 5JAVA 1XYIA 2DNEA 3J7YW 4XYOA 2E76C 3DWPA 4KJNA 5C4HA 1F2LA 2B63B 4IQZA 1DOKA 3IAYA 1GUOA 2EJMA 1PTOD 2A69D 3MTSA 3R8BA 1BUVT 4ZK9B 2F0EA 3D4RA 4JBWA 2WV6D 2AQ1B 5EPLA 4A93B 2ENBA 1CK1A 3S1QB 3D8GA 4R8NA 4DXGA 1GUNA 2TMPA 1TKWB 3N52A 4ODGA 2I46A 3Q0AA 3SK6A 1M8AA 4FYDA 5CGKA 4C1NK 1DXMA 1ZXTA 4TRDA 2B8GA 5KGUA 2NVTB 2OEOA 1BOSA 1I6VC 5LHY1 2RSNA 3D6WA 5EKKA 2QILA 5EBDA 4A3JB 4H0LC 3LNNA 3MWYW 2B2WC 3D4DA 4K5XA 1BNZA 4DA2A 2NN6G 1I4XA 1XXGA 2EYMA 4XQNA 2B2YA 4WJWA 3DWAA 3R2IA 2L9HA 3Q6SA 4IFDJ 1B53A 1LTRD 2K5QA 3LX0A 4ID6A 1RDPD 5EQ0A 2HQEA 1LT4D 3A56A 1R9TB 3C1FA 1FR3A 4TKOB 1Y1VB 2PPBC 4N9TA 2D9UA 4Q0FA 4DK1A 4TQUS 1D2BA 5IGCA 3HOYB 4X3UA 1Q12A 2WKCA 1G291 5IT9E 5IODA 1MI2A 5M9OA 1STNA 3HOZB 2R92B 3T51B 4EQPA 1OO9B 5IOCA 1MBYA 2JA6B 1J9OA 5CR3A 1SBBB 5FO8B 1F9QA 5M5WB 1ML0D 1QCBD 2F0TA 1OXSC 2F0NA 2A73B 4DXFA 2H1EA 1ZYRC 1B9NA 4QUFA 2BOSA 3H91A 3OSOA 3A8KE 5K5PA 4B9WA 5COYA 1TT2A 4TSSA 2Q8RE 1S5ED 1TWFB 1RD9D 4IUVA 3TN2A 4ZQ3A 5BN5A 4K2LA 4NP5A 2D5DA 2F0LA 4KKUA 1A3VA 4R9WA 1ENFA 4R8IA 3FRPB 4KN7C 1EZ6A 3S2DB 2NZ1D 1BCPC 1GUTA 2OT2A 2K01A 4IFDH 1PRTD 1AP0A 4DU9A 3MFYA 4OIJA 2KA7A 5BN4A 2EZVA 1HXYD 1EYCA 2PNRC 2A5HA 2EE1A 3J7AF 2JE6I 3SK4A 1YNNC 2KCNA 4DF7A 1YNJC 3VA5A 1Y8OB 4AYBB 2XRQD 3VR5A 1KDAA 2PZUA 3J80L 1HUNA 3NTIA 1L0YB 4BBSB 5C3EB 1HQRD 1H9RA 5JVG3 3KF8A 2R61A 3IL8A 2B2UC 3BVGA 5JJZA 5LL6S 2J4XA 1LT5D 1AN8A 2L4NA 2JYOA 1TS3A 4XQQA 2K5WA 2X6GA 4Q5VA 3K6OA 3U9SA 5CV6A 4L8JA 3EROA 2SEBD 1DOLA 3P7JA 3Q24A 5DM63 1EY7A 1T5EA 5CV4A 1EIGA 1PFNA 3QJYA 3BDLA 1I3QB 1OXTA 2A6ED 4A3IB 1ENAA 3NBIA 2KJXA 2ZXOA 4DGZA 5JEAH 1NR2A 1TQOA 2B2UA 1SNCA 3V05A 3I70A 3TZUA 1TR5A 3PUXA 2YU9B 1CZGA 4OL7A 2V4DA 2VXWA 5CV5A 1ZEQX 1IKMA 5IGFA 2AQ2B 1B1ZA 5ELDA 4A3EB 2A68D 2L55A 2ZXRA 4HSPA 3VYSA 1NUCA 3R3OA 1RF2D 2PYKA 3C1EA 1AZPA 1SNPA 1A15A 1D5MC 1E2VA 3I8ZA 3HP3A 1U4RA 3EVQA 5LL6X 1JOOA 2PW5A 1TWHB 4QMGA 4RKBA 1JWMD 2R3ZA 2A74C 3OOCA 2BA0A 1G91A 3PO2B 2F0QA 1PTOC 3LWUA 2E75C 1CA6A 1O7LA 3EA6A 2AUKA 1EOTA 4RH6A 2WP8J 2K05A 3NTKA 3M7GA 3PMFA 1SDFA 5FLXL 3RLFA 3PUZA 4C3IG 4HN7A 4DNRB 2GA4B 4NMZA 1D6EC 1QG7A 2FMCA 1SSOA 4CJ1B 1S5CD 4K5VA 1ESFA 2XNAC 1J8IA 1Z7TA 3A54A 1TWAB 4EVOA 1DOMA 4CKEA 3S1RB 4CHTB 2DN8A 2PCFB 2NVQB 2JXMB 5CBAE 2EYFA 2EYPA 2B2WA 2XRSD 1KDCA 4RKLA 2BCOA 5E3FA 2NB0A 4FXGC 4LAAA 5D3DA 5CV8A 3T53B 3GV6A 4HEDA 4XIGS 5J22A 4F88A 4MN3A 1I4GA 1SMYC 1EL0A 2F0FA 1E2WA 1F9SA 1G2TA 2Z1CA 5FO9B 1GUWA 3NHHA 3MHBA 3I72A 3KLSX 1QNUA 3K0YA 1PYWD 1DD2A 3VYTA 1HFGA 5DM73 4IUTA 4FXDA 3Q22A 3MC0B 2HCCA 5ELFA 2JA8B 4FF4A 4C3IB 2M9VA 1KAAA 4BY1B 4IFDG 4J8QA 2IL8A 2KUMA 5C0XH 3W2DA 4P2CB 3RMHA 3K5NA 2HCIA 2NVXB 3GV3A 1M4VA 1EY9A 3OMCA 1SAPA 1ZYRD 1A6XA 3T4AC 1E2ZA 4A3DB 5D3IB 4OGQC 3I3CA 2EYHA 4RGOS 3AB9A 5C5LA 1STBA 4KD4A 1LTAD 5CBEE 2R7ZB 1NR4A 1B4OA 2Q8TA 1PFBA 2F03A 1DZ1A 5CV7A 4DFAA 4FNFA 1MSGA 2HDMA 3A8JE 4KK7A 2NUCA 4L6TB 2RBMA 5CMDA 2LMCB 3NP8A 1IYVA 2KEEA 1SXTA 4HCEA 3PIO3 2K7VA 2FHTA 5ELEA 1IW7D 3VA7A 3L3OC 1SYEA 4OHJA 3JAML 2G9HD 4QIWB 1W6KA 2CHBD 4IZ8A 4HSVA 3DXJC 2ICEC 3HOUB 1WTOA 4FF2A 1BBXC 5D14A 4GZYC 3PV0A 4XDXA 4IUNA 2ZT9C 3H3VC 1Q3LA 3FKIB 2EY1A 3W3AA 5AFWA 1STHA 4RHSA 4BBRB 3SEBA 3P1HA 5EBCA 3GTPB 1BF4A 3M4OB 3HKZB 3FDTA 1ZKOA 1VMCA 5EKLA 3D3RA 5E1FA 3S17B 2QF7A 2F0GA 1CI3M 1B50A 1H9KA 3M85A 2EXZA 5JPNC 1LACA 5J39A 5K36G 2ICIA 2OXPA 3DMUA 1PDQA 1UUPA 3T56B 3S15B 1SNMA 1I50B 2BA1A 1JWSD 3DEOA 1SE2A 4KHVA 5M5XB 1SE3A 2E2HB 2F0KA 4BY7B 3GTKB 5I6YA 4HR7B 3T13A 3I4NB 1G2SA 1O7YA 3FVQA 2VB3X 3ZYYX 1ICWA 5I2YA 1UNSA 2RDGA 2JA7B 4V190 1WTXA 3BYYB 1KLUD 3QWNA 1PRTF 2F0IA 3MVVA 1ILQA 2EPBA 2NN6H 1I4QA 4RGMA 3S1NB 4C2MB 5JVH3 2KEDA 3QOJA 5I6WA 2EYJA 4F7XA 5C6AA 2A69C 1S5DD 1Q8IA 1QILA 2B2YC 1PRTC 4DNTB 1STEA 3MA2B 1V1PB 1VCIA 1F9RA 2B2TC 1V1PA 1B44D 2D62A 1OXUA 2K1BA 5KRUA 5DNFA 2MHVA 5HGTA 2NYZD 3TP6A 3OMGA 5I2XA 4A3GB 3H6MA 3IFTA 4ZLTF 4ZUIA 3HOWB 4G7OC 2B8FA 3NQIA 3P75A 2AWNA 2NTTA 1SYCA 3NWTA 1LLRD 4HMJA 3I90A 4C3HG 1QJOA 4U68A 3KUPA 1CQVA 3OHXC 4U673 1PLFA 2EY2A 3SHLA 4DAVA 2B39A 2L0CA 1O7ZA 1HUMA 5KNCA 3VR3A 3A7LA 1MD2D 3SE0A 1AFPA 1TWCB 1HA6A 4A3FB 2O4XA 2IW3A 1MGSA 1JOKA 3QOLA 2PZWA 1TU2B 3S9WA 1SNQA 1G6ZA 1EY0A 2F0HA 1TIID 3G7LA 1F2ZA 1S4ZA 1U4PA 5A35A 3OWFA 1JB3A 4PMBA 5DEHA 4H13C 2EYOA 1CHPD 5C0XJ 2PO4A 3R93A 1RTNA 1SYBA 1KLGD 3CRLC 3J81L 2BE5D 1X3PA 1I6HB 5C3XA 1SYFA 1CTMA 1EY6A 4K8JA 4ULLA 3BDCA 1SNOA 2QCPX 4FF3A 3GO5A 2NN6I 2K03A 4K14A 3CHBD 5IGGA 3C2PA 3A7AB 1RJTA 1HFNA 3DEPA 4RWSC 1SMYD 3K7AB 4S3SA 1STYA 1EEID 4IUQA 4C3HB 1STGA 1QB5D 1LT6D 2EJGC 1WTVA 1CQFA 1H9MA 2X69A 1QNKA 1W6JA 2LS01 1UAPA 4ME5A 1GXDC 4B9XA 1WTQA 5C0XI 5JEAG 5KYLA 2E2IB 4CBVA 1F2YA 2BDNA 2CW0D 5F2DA 4CKCA 1NAPA 3V96A 2B2TA 3HZXA 1H9JA 1VF5C 1C48A 3G6JB 2X6LA 4C56C 4M1UB 1X3QA 3EJIA 2AUJD 2C5CA 2WINB 2IPKD 3GP7A 2KVMA 3Q23A 3QO2A 5KNBA 4QUCA 2F0VA 1PZJD 3MXPA 2JP1A 4KJOA 3C46A 3MXNA 1XX8A 2K6AA 4XTCS 3P20A 2QKIC 4N9PA 1RTOA 3I4LA 2BDOA 3I73A 4ILWA 1EY5A 4RCNA 2L12A 2Y0SB 4XQJA 3VR2A 3BS1A 1BDOA 4RGTA 2VNUD 4KHZA 3BVMA 1EFID 5BN3A 4OO1G 3KLSA 3HS0C 4DK0A 5IGEA 2J0TD 4RGNA 2OF1A 1EQVA 3D4WA 2MP1A 1ENCA 5T1IA 4QB4A 3MZ5A 1AW7A 1V8QA 4IUPA 5I4DA 3GD7A 4ZKBB 4E6IA 3J81E 4XXEA 2MGSA 5IGDA 1PXUA 1A2UA 4J6HA 3TP8A 3DHQA 1PMRA 1SYDA 2EVBA 5A2QL 2RDHA 4IALA 1OXVA 2IX3A 2Z8LA 1I4PA 3MEHA 1EU3A 1U4LA 2DY7A 2QEJC 4A3BB 3NUCA 4NKLA 1SJHD 3HEJA 1SJED 1DM0B 2KECA 3KLRA 5G3LD 3H0GB 2CW0C 5EPJA 2JEBI 3X3MA 3RZOB 1HRJA 2PW7A 4F87A 3HG9A 2MPMA 1HCZA 4FO2A 4ZRZA 3OPOA 1FNWA 2N55A 3BDOA 4A3KB 2F0UA 5T1GA 5C5MA 1V1OA 2TSSA 1WCMB 2MJ8A 3NK9A 2KQ3A 3J7AV 1IKLA 3RD4A 1Z6HA 5EKIA 3DWQA 1C4QA 1UEAB 2AWOA 2IJ0A 1JOQA 2L1BA 2RA4A 3TDQA 1WVLA 3BYTB 1RCVD 3S16B 2FINB 5M5YB 2VB2X 2B2VC 1GUSA 3MXGA 1JWUD 3F2UA 2DY8A 1WTRA 4H44C 1BQQT 2B2VA 3IKJA 1Y1WB 3D31A 2EYLA 1LTSD 4KV6A 4CJ2C 2M00A 2O5IC 2ZXPA 4IFDI 3OIPA 5FLXE 4OO1I 2YYZA 2WKDA 3QIAA 1HPCA 4DN4M 1S5FD 3VR6A 1HTPA 3NXWA 3ONAB 2FFKB 3JAME 2F0OA 1PTOF 3NPPA 4KTAA 3VYRA 1PTOH 5IT9L 1Z47A 3TP7A 2H4OA 3SDZA 2KOLA 4FP5D 3DM1A 4J1MA 4XT1B 2WIIB 1SNDA 3KK7A 2J7ZA 4CKBA 4X3SA 1LTID 1X32A 4C3JB 4HTHA 1KABA 1BXTA 4PNYA 4ZYSA 4ZAIA 4B08A 1AEXA 3KBXA 5ELCA 3FPUB 1H9SB 3NSWA 4O1NA 3K58A 2FMMA 1JR0D 1H9SA 2EY6A 4MIUA 5C0XG 2KCCA 1A2TA 1Q90A 4MHEA 3N6RA 1B9MA 4XT3B 1EU4A 5K36H 3LWEA 3GTJB 3AMUA 3ND8A 4BWGB 3HGBA 4BA2I 3WOEA 4WORA 5C3WA 1HTLD 5C4JB 2XSCA 1OXXK 3SVMA 1STAA 4KY7A 1TS2A 4LK1C 4BA1I 5CYUA 4UAIA 3GTLB 3URYA 1V43A 3K5OA 2A6HD 5CV9A 1Q1EA 3GQBA 1LV9A 1SFOB 5IGBA 1CZWA 1IHZA 1BCPD 2F0MA 2NBFA 1K8OA 4BS9A 2Z4HA 1CM9A 4DAYA 1TS5A 4K6LA 1QOHA 2PQEA 4X3KA 3BG3A 4FXKC 2FJ2A 1ESRA 3GTGB 2R93B 1EYDA 1HA5A 4PMWA 3K5MA 1WD1A 5EGTA 1SE4A 3DUZA 3GTOB 1TWGB 1EY8A 2L5TA 2CVRA 2WB1B 4I65A 4KY5A 5JOBA 3QB3A 1ET9A 3OIQA 4IUUA 1L0XB 3TBIB 1T5XD 1E0BA 3S1MB 4RCOA 5C4ZA 1XTCD 2L11A 3M4YA 3QG1A 1MSHA 3PO3B 3EFXD 3TSSA 2DNCA 5M3MB 4LMQD 4KMUC 3PUYA 1GHJA 4ABNA 2EJFC 3S14B 2K32A 1S5BD 2RSOA 2D2CC 4RFBA 4H7BA 1DYQA 1VF7A 1Q1BA 2NWGA 1EY4A 1PTOB 2RDFA 2F3WA 3D6CA 4FVMA 2E2JB 3J80E 1DCZA 3H09A 3OW7A 1R4PB 4G7HC 3H94A 3EQLC 1LABA 2QDBA 3NTHA 4A3MB 5FKAC 3MXUA 1JORA 2XVSA 3VR4A 5TSSA 1TVXA 4HCSA 4L63B 3I4MB 1YNND 2A6HC 1QWYA 1RODA 4C1NI 3ERQA 5KIXA 1LTTD 1BCPF 2IX0A 1FD7D 4QCLA 5FO7B 4XYQA 2SOBA 3K5LA 3PUVA 4Y7NB 3ITPA 4K2KA 2SDFA 4K5WA 1BR9A 1IL8A 1U9RA 4IURA 4K6DA 4G7ZC 2A68C 1A3TA 1IW7C 3NQTA 1RKNA 1SEBD 4IN3A 1FYCA 5DAUA 1D5XC 4NW2A 5HURA 1XWEA 2F1MA 2XWJB 1WD0A 2RKSA 3VYUA 1O80A 2A6EC 3L7ZC 5G3LF 1FNVA 4F8MA 4EGVA 5A2QE 2NVYB 1WTWA 4RAUC 1A3UA 5EJWA 3GTMB 5I9PA 2WAQB 4KD3A 3NE5B 2BE5C 1CT1D 1F9PA 3SXHA 2N88A 3E6ZX 1D1IA 4RA8A 3E5SA 1CFMA 1U4MA 3IFDA 2F0JA 2K28A 3BZDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SR1 A;  3NXW A;  2QDB A;  2F0M A;  1TQO A;  2EXZ A;  4ZQ3 A;  5C3X A;  1SNC A;  2F0O A;  4HMI A;  4EVO A;  1SYF A;  4K2L A;  1EY6 A;  4K8J A;  4NP5 A;  1KDB A;  2F0L A;  5HGT A;  1SYG A;  1TR5 A;  3BDC A;  1EZ8 A;  2EYH A;  4KTA A;  3OMG A;  3TP6 A;  1SNO A;  3D4D A;  5C5L A;  1EY5 A;  4K5X A;  1STB A;  4KD4 A;  1A3V A;  5J39 A;  2OXP A;  2PQE A;  4OL7 A;  2EY5 A;  3DMU A;  3TP7 A;  2EYF A;  2EYP A;  5CV5 A;  4EQO A;  2PW7 A;  1KDC A;  1SNM A;  2F0P A;  3H6M A;  4K14 A;  2EYM A;  1EZ6 A;  3SK8 A;  4ZUI A;  5IGG A;  5J1Z A;  4RKL A;  2F3V A;  5E3F A;  4J1M A;  1EYD A;  4KHV A;  5KIX A;  5IGF A;  3ERQ A;  4LAA A;  5CV7 A;  1SND A;  5CV8 A;  4DFA A;  4DU9 A;  3P75 A;  2NUC A;  2F0K A;  2RBM A;  5EGT A;  5J22 A;  1SYC A;  4HTH A;  1KAB A;  2F0U A;  5C5M A;  5NUC A;  1NUC A;  4S3S A;  4ZUJ A;  3U9O A;  1STY A;  3V2T A;  3R3O A;  2PYK A;  3C1E A;  5IGE A;  2PZT A;  3LX0 A;  4HMJ A;  2OF1 A;  4ID6 A;  4PNY A;  1EYC A;  1EY8 A;  1SNP A;  2F0F A;  3NP8 A;  5I6Y A;  2SOB A;  3T13 A;  5KEE A;  1STG A;  2HQE A;  3NK9 A;  4I65 A;  2KQ3 A;  3SK4 A;  1IHZ A;  3C1F A;  3ITP A;  4K2K A;  4KY5 A;  1EQV A;  4QF4 A;  3D4W A;  5JOB A;  1II3 A;  2KHS A;  1AEX A;  3EVQ A;  3QB3 A;  3NHH A;  4K5W A;  1JOO A;  3MHB A;  1ENC A;  4DF7 A;  2PW5 A;  2WAC A;  4N9T A;  3VA5 A;  4QMG A;  4RKB A;  4QB4 A;  4YIJ A;  3TME A;  5KYL A;  2EY2 A;  3MZ5 A;  1U9R A;  3SHL A;  5ISR A;  4PMC A;  4K6D A;  1JOQ A;  5C4Z A;  1KDA A;  2PZU A;  5IGC A;  5JAV A;  1A3T A;  1SYE A;  2F0Q A;  2EY6 A;  1F2M A;  4ME5 A;  4B9X A;  1NSN S;  4MIU A;  3NQT A;  5KRU A;  1RKN A;  2LKV A;  4E6I A;  5IIF A;  4IZ8 A;  5DAU A;  4KJN A;  1EYA A;  2F0W A;  5C4H A;  5HUR A;  1A2T A;  2O4X A;  2SNS A;  5IGD A;  1A2U A;  5IOD A;  2RKS A;  4J6H A;  5KYI A;  1JOK A;  3TP8 A;  3QOL A;  1F2Y A;  2SNM A;  3RUZ A;  2F0I A;  3DHQ A;  1KAA A;  3MVV A;  5M9O A;  1SYD A;  1STN A;  4F8M A;  2PZW A;  5F2D A;  4IUN A;  5CC4 A;  3S9W A;  3PMF A;  1SNQ A;  4EQP A;  2F0D A;  3SK5 A;  1EY0 A;  2F0H A;  4WRD A;  5IOC A;  3HZX A;  4IAL A;  4K8I A;  5CR3 A;  4WOR A;  1A3U A;  2F0S A;  2EY1 A;  5C3W A;  1STH A;  2EYL A;  2F0E A;  5I9P A;  4KD3 A;  5I9O A;  5CV6 A;  3TP5 A;  4KV6 A;  1F2Z A;  3ERO A;  3SXH A;  2M00 A;  2ENB A;  3P1H A;  3QOJ A;  2F0T A;  2F0N A;  1JOR A;  1STA A;  3D8G A;  3OWF A;  4H7B A;  4KY7 A;  1EY7 A;  4R8N A;  3HEJ A;  4EQN A;  3EJI A;  5CV4 A;  4NMZ A;  2EYJ A;  3E5S A;  3MEH A;  4F7X A;  4PMB A;  4NDX A;  5DEH A;  5C6A A;  5I6W A;  1EY9 A;  2EYO A;  1EY4 A;  3OMC A;  4ODG A;  5EKL A;  2RDF A;  3T16 A;  2F3W A;  3D6C A;  3BDL A;  3SK6 A;  5CGK A;  3OSO A;  2F0V A;  5E1F A;  4TRD A;  5KGU A;  4G57 A;  4K5V A;  2OEO A;  4KY6 A;  1ENA A;  5CV9 A;  5K5P A;  2F0J A;  3MXP A;  4KJO A;  4B9W A;  3NUC A;  4NKL A;  1TT2 A;  4DGZ A;  5IGB A;  5EKK A;  2F0G A;  1SYB A;  4N9P A; 
#chains in the Genus database with same CATH topology
 4ZKC B;  1YI2 A;  1PRT B;  1EYG A;  4A3D G;  4OX9 Q;  1I4R A;  1K8M A;  1KDB A;  1WTP A;  1SYG A;  3M7N A;  3OYY A;  3FMC A;  1D1K A;  1Y8N B;  1RIP A;  4C3H H;  5E4W C;  1YNJ D;  3CRK C;  2F4V Q;  5IYC G;  2E2D C;  2ID0 A;  4O42 A;  1C8C A;  2F3V A;  3L9A X;  2JA5 B;  2MUY A;  4Y52 H;  1LTB D;  1A63 A;  2VUM B;  4JK1 C;  4YY3 L;  3S2H B;  4ZUJ A;  3HFZ B;  4V0B A;  3V2T A;  5KYI A;  2QA4 A;  2PZT A;  3RUZ A;  4Z9C B;  3MAQ A;  1Y69 U;  2G9D A;  4AYB E;  3CKI B;  1WTH A;  5E4X A;  1GOZ A;  2MNA A;  4PV1 C;  2AQ3 B;  3PF4 A;  2C9O A;  5IY0 A;  2WAC A;  2LY7 A;  4YIJ A;  4C3J G;  1K0S A;  4M8A A;  5ISR A;  1YBY A;  3WOF A;  5LMU Q;  1GUG A;  4BBS H;  1EQT A;  4KKS A;  5C44 B;  2NVQ H;  2E74 C;  1SN8 A;  4AQY Q;  1S72 A;  3A0J A;  2LKV A;  1KTK A;  4DR2 Q;  1IBL Q;  4UP8 A;  1CA5 A;  3C3L A;  4OIK A;  2B63 H;  4QQB X;  2I07 B;  1EWH A;  1TY0 A;  4DR2 L;  1FGB D;  1NE3 A;  1YZ6 A;  4WRD A;  5KND A;  4K8I A;  2O2L D;  3K57 A;  2F0S A;  1BO0 A;  1VDZ A;  5I9O A;  2Z4I A;  3TP5 A;  1D5Z C;  2LFN A;  3QR8 A;  4POG A;  3WDN A;  1KNE A;  4LF7 L;  1TXY A;  4QJF A;  1N34 Q;  5COR A;  5JEA J;  5EPK A;  4JV5 L;  5KEE A;  3LGJ A;  4JI0 Q;  1JIC A;  3M9B A;  3T16 A;  4B3R L;  3CCS A;  2JEA I;  2EDG A;  3EN2 A;  4X65 Q;  2OQK A;  1AZQ A;  1VMP A;  2XWB B;  2PMZ B;  2HDL A;  4X6A H;  3SR1 A;  3UI2 A;  3KJO A;  1NCV A;  4CJ0 B;  3TRZ A;  2K75 A;  1ILP A;  4PQX A;  2Z9H A;  1UE5 A;  1FNU A;  1K83 B;  4L5Q A;  3HRZ C;  2K33 A;  1JC7 A;  1MJC A;  1Q81 C;  1PZI D;  2VQF L;  3NWS A;  3CCJ A;  4P74 A;  5IYB H;  4I7Z C;  3I4N G;  5J1Z A;  3HOU G;  5JJL A;  1JQY D;  1O78 A;  4BY1 H;  3OW2 A;  3E0J A;  5JPM C;  3FPP A;  1HHV A;  1IBK Q;  1VQ6 A;  5NUC A;  4UDU C;  4FF1 A;  1VQO A;  2HUG A;  3I91 A;  3PUW A;  1WCM G;  3M3Y B;  1GHK A;  4QF4 A;  3AU7 A;  3AFP A;  3HOX B;  1II3 A;  2KHS A;  5M3F B;  2M2L A;  3TME A;  3H0G H;  5FK9 C;  2JSO A;  1RHP A;  3O13 A;  4PMC A;  5ELB A;  1TS4 A;  3DLL A;  2A1A A;  3R2T A;  4RHR A;  3OTO Q;  4KN4 C;  1PZK D;  2RVL A;  3ND9 A;  4CDF C;  1F2M A;  1NSN S;  1SRO A;  3HOV B;  1TWC H;  1HQM C;  1LO5 D;  1BBU A;  1BCP B;  1NTG A;  2EOT A;  3NBH A;  5IIF A;  1EYA A;  1X3F A;  1DON A;  2F0W A;  5M3M G;  4L5S A;  2XIW A;  2R6G A;  2IX1 A;  1F77 A;  3CU7 A;  2SNS A;  3KJP A;  3TEH B;  2SNM A;  4HAE A;  2UXB Q;  3CQZ B;  2RQX A;  3J81 j;  2CH4 A;  3PIP 3;  5CC4 A;  1GJX A;  4JOI C;  2F0D A;  4LFB Q;  3SK5 A;  5C4X B;  1XNR L;  1JT8 A;  1NJI C;  1YEZ A;  2UXD L;  4JI6 Q;  4GLA C;  4A3I G;  2CQA A;  3FEW X;  2IWH A;  2NTS A;  1ONL A;  1IYU A;  2XN9 C;  4WFN 3;  5M3F H;  1H95 A;  1EEF D;  4EQN A;  5HY6 A;  3MFG A;  4NDX A;  3S1M H;  4LJZ C;  1KNA A;  4MTN A;  3KBG A;  3PO2 G;  2F4I A;  1P8L A;  1QZG A;  4G57 A;  4KY6 A;  5FOB B;  1ET6 A;  1B3A A;  1LTG D;  2IT1 A;  4DV4 L;  3OWE B;  4NPS A;  5D65 A;  1EIH A;  1TWH H;  2Q8I B;  1XPU A;  1B70 B;  4OO1 H;  1PH7 A;  1I6H H;  4HMI A;  1HNZ Q;  4O2D A;  2PQA B;  4OWX B;  3STB D;  3A55 A;  1EZ8 A;  1G8Z D;  4KI0 A;  1B2T A;  1EQR A;  3K59 A;  2K5D A;  3RZD B;  2EY5 A;  4EQO A;  4YWK A;  1TY2 A;  4DAP A;  2F0P A;  3SK8 A;  4X3T A;  1FJG L;  3G48 A;  3PSI A;  4G4K A;  1PFM A;  1CHQ D;  1JE4 A;  1I4H A;  3BVZ A;  3A8I E;  3U9O A;  2O5J C;  1N8R C;  1JCK B;  1XMO Q;  2K04 A;  4DUZ Q;  1LT3 D;  3TZD A;  2R7D A;  4LF4 Q;  1I50 H;  4JI1 L;  3HOX G;  1EWC A;  1Y8P B;  3J80 c;  1QE6 A;  3GTQ B;  1YHA A;  4CGY B;  4JBK A;  1P16 A;  1DJR D;  1K3B C;  3X3N A;  4KKT A;  1B8A A;  1R4Q B;  5EAY A;  5JAV A;  1XYI A;  4B3T Q;  4DR4 Q;  1N32 L;  2DNE A;  3RZD H;  2N49 A;  3J7Y W;  1X9N A;  3CF5 A;  4XYO A;  4A3G H;  2E76 C;  3DWP A;  4KJN A;  2DGY A;  2PMZ E;  1KD1 C;  5C4H A;  2MQH A;  1F2L A;  3HKS A;  2B63 B;  4IQZ A;  1DOK A;  2ATW A;  3FP9 A;  3IAY A;  1GUO A;  2EJM A;  2ZTD A;  1PTO D;  2A69 D;  3MTS A;  3R8B A;  1BUV T;  2A19 A;  4ZK9 B;  2F0E A;  3D4R A;  4JBW A;  5IP9 G;  2WV6 D;  1XTD A;  1R9T H;  2AQ1 B;  5EPL A;  5M3M H;  4A93 B;  3UDX A;  2ENB A;  1CK1 A;  3T1H Q;  3S1Q B;  3D8G A;  4R8N A;  4DXG A;  4HIM A;  4NXN Q;  1GUN A;  2TMP A;  1TKW B;  3N52 A;  5ELO A;  4C3J H;  2IY5 B;  4ODG A;  2I46 A;  4DK3 C;  3Q0A A;  3SK6 A;  1M8A A;  4FYD A;  5CGK A;  4C1N K;  1DXM A;  1ZXT A;  4TRD A;  2B8G A;  2XTI A;  5KGU A;  2NVT B;  2OEO A;  1BOS A;  1I6V C;  5LHY 1;  5LMU L;  1K28 A;  2RSN A;  4DV2 L;  3D6W A;  5EKK A;  4YHH L;  1ICF B;  2Z0S A;  2AKW B;  2QIL A;  5EBD A;  1WI5 A;  4A3J B;  4H0L C;  3LNN A;  3MWY W;  2B2W C;  3D4D A;  4K5X A;  1BNZ A;  1PYS B;  4DA2 A;  2NN6 G;  1I4X A;  1XXG A;  2ZTC A;  2EYM A;  4XQN A;  2B2Y A;  4WJW A;  3CAM A;  3DWA A;  1I5F A;  3KF8 B;  2CCZ A;  2VQE L;  2JA5 G;  3R2I A;  2L9H A;  3Q6S A;  4P71 A;  4R1J A;  4PZ8 A;  4IFD J;  3TS0 A;  1B53 A;  1LTR D;  2K5Q A;  1KAW A;  3LX0 A;  4ID6 A;  3K80 C;  3WWV A;  1RDP D;  5EQ0 A;  2HQE A;  1LT4 D;  3A56 A;  4YCV A;  1QZH A;  1R9T B;  3C1F A;  1FR3 A;  4TKO B;  1Y1V B;  4IPD A;  2PPB C;  3GTP H;  2UUC Q;  4N9T A;  2D9U A;  4Q0F A;  2H5X A;  4DK1 A;  4TQU S;  1HH2 P;  1D2B A;  5IGC A;  3CPW A;  2Z6B A;  3HOY B;  4X3U A;  4CDE C;  3FKI H;  1Q12 A;  4DUZ L;  1L2F A;  2WKC A;  4HJ8 A;  1G29 1;  4LUO A;  5J3B A;  2I5M X;  4JW0 A;  5IT9 E;  5IOD A;  4A3F H;  3K7U C;  1PA6 A;  2R93 H;  1HR0 Q;  1X65 A;  1MI2 A;  5M9O A;  1STN A;  2K52 A;  4A3E G;  3HOZ B;  2R92 B;  1XMQ L;  3T51 B;  4EQP A;  1OO9 B;  5IOC A;  1VQK A;  1MBY A;  2UU9 L;  2JA6 B;  1J9O A;  5CR3 A;  5FLM H;  3A5Z B;  1SBB B;  4DV3 Q;  5FO8 B;  1F9Q A;  5M5W B;  1ML0 D;  1QCB D;  2F0T A;  1OXS C;  2F0N A;  3JAM i;  5JJI A;  2A73 B;  4DXF A;  2H1E A;  1JJ2 A;  1ZYR C;  4JI2 L;  2PI2 A;  1B9N A;  4QUF A;  2BOS A;  3H91 A;  3OSO A;  3BJU A;  4LFA Q;  3A8K E;  5K5P A;  4B9W A;  5COY A;  1CKO A;  1Q7Y C;  3GTM H;  1TT2 A;  2G5D A;  1Y1V H;  4TSS A;  2Q8R E;  1S5E D;  1TWF B;  1RD9 D;  4IUV A;  1EFW A;  3TN2 A;  4ZQ3 A;  5BN5 A;  4A3J G;  4K2L A;  4NP5 A;  2D5D A;  2F0L A;  2Z6K C;  4KKU A;  1A3V A;  4R9W A;  1ENF A;  4LF9 L;  4X62 L;  4R8I A;  3FRP B;  4EX5 A;  4KN7 C;  4LFB L;  1EZ6 A;  4IPG A;  2NZ1 D;  3RZO H;  3S2D B;  2ASB A;  1BCP C;  2JN4 A;  1GUT A;  4LUZ A;  2OT2 A;  3F1Z A;  2CH4 W;  2K01 A;  4IFD H;  1PRT D;  1Y14 B;  1AP0 A;  1UE7 A;  4DU9 A;  3MFY A;  4OIJ A;  3TS2 A;  3CCL A;  2KA7 A;  3S1R H;  1LTL A;  5BN4 A;  1U5K A;  2E2J H;  2EZV A;  1I3Q H;  1EYC A;  1HXY D;  2AHO B;  2A5H A;  2PNR C;  2EE1 A;  4MNO A;  3J7A F;  2JE6 I;  3SK4 A;  3HOV G;  1YNN C;  2KCN A;  4LFC L;  4LF4 L;  4DF7 A;  4JC0 A;  4GN4 B;  1YNJ C;  3VA5 A;  1Y8O B;  4AYB B;  2KBN A;  2XRQ D;  3VR5 A;  1KDA A;  2PZU A;  3J80 L;  1HUN A;  3NTI A;  1L0Y B;  4YWM A;  4BBS B;  5C3E B;  3S17 H;  1HQR D;  1IXR A;  1H9R A;  4QL5 A;  1WYD A;  5JVG 3;  3S16 H;  3KF8 A;  2R61 A;  3IL8 A;  3UDF A;  1OTC A;  1IYJ B;  3K0X A;  3M4Q A;  1UWV A;  2B2U C;  3BVG A;  5JJZ A;  5LL6 S;  2J4X A;  2Q2U A;  1LT5 D;  4DR6 L;  1AN8 A;  2L4N A;  1KQS A;  4DNI A;  2JYO A;  1TS3 A;  5IWA L;  4XQQ A;  2K5W A;  1GO3 E;  3FKI G;  5GAG C;  2X6G A;  1VQI A;  1W3S A;  4C2M H;  4Q5V A;  3K6O A;  3U9S A;  4JVZ A;  5CV6 A;  4L8J A;  1JMC A;  3ERO A;  3E0E A;  2SEB D;  1DOL A;  3P7J A;  3H3V H;  3Q24 A;  5DM6 3;  2L15 A;  1EY7 A;  1YJW A;  2E2I H;  1T5E A;  5CV4 A;  1EIG A;  1NY4 A;  4A3E H;  1PFN A;  1PHJ A;  3QJY A;  3I7F A;  3BDL A;  5ELN A;  1I3Q B;  1OXT A;  2A6E D;  5FLM G;  4A3I B;  1ENA A;  3HKZ E;  4UHV A;  3L0O A;  4GN5 A;  3NBI A;  2KJX A;  2ZXO A;  4DGZ A;  4IJH A;  5JEA H;  1NR2 A;  2CWP A;  1TQO A;  2B2U A;  1SNC A;  2LXK A;  3V05 A;  3I70 A;  3TZU A;  1TR5 A;  4NB3 A;  3PUX A;  1HZC A;  1CZG A;  2YU9 B;  4OL7 A;  2V4D A;  2EQS A;  2VXW A;  5CV5 A;  4GS3 A;  3KDF A;  1X3E A;  3I4M H;  1ZEQ X;  1Y1V G;  1GKH A;  1GM5 A;  1QUQ A;  1VQG A;  1IKM A;  5IGF A;  4A3L G;  2AQ2 B;  1B1Z A;  2K5H A;  5ELD A;  4OWT B;  3F8T A;  4A3E B;  2A68 D;  2E8G A;  2L55 A;  2ZXR A;  2OTL A;  2B29 A;  1A8V A;  2N3S A;  4HSP A;  3VYS A;  1NUC A;  3SGI A;  2ZTE A;  3R3O A;  1RF2 D;  2PYK A;  3C1E A;  1AZP A;  2WB1 G;  1SNP A;  3H15 A;  1A15 A;  1D5M C;  1E2V A;  3I8Z A;  3HP3 A;  2HIX A;  1PH1 A;  1U4R A;  2DUD A;  2Y0S E;  3EVQ A;  5LL6 X;  4JOI A;  1JOO A;  2PW5 A;  3CCM A;  1TWH B;  4QMG A;  4RKB A;  4CDC C;  1JWM D;  2R3Z A;  2A74 C;  3OOC A;  3HOY H;  2BA0 A;  1G91 A;  1JE5 A;  3PO2 B;  2F0Q A;  1PTO C;  3IRB A;  3PIP A;  1NBW A;  3LWU A;  2E75 C;  1CA6 A;  3HOV H;  1CUK A;  1O7L A;  1K3R A;  3EA6 A;  2JA8 G;  2AUK A;  1EOT A;  3FHW A;  4RH6 A;  2JA5 H;  2WP8 J;  2K05 A;  3NTK A;  2IHE A;  2PI2 E;  3M7G A;  3PMF A;  4RG1 A;  1SDF A;  5FLX L;  4DV4 Q;  4HJ5 A;  5IYD H;  3RLF A;  3PUZ A;  2N8N A;  3NEN A;  4C3I G;  2UUA Q;  4JYA Q;  1KRT A;  4HN7 A;  4DNR B;  2GA4 B;  4NMZ A;  2DJG C;  2JJQ A;  1D6E C;  1QG7 A;  4N8F A;  2FMC A;  1SSO A;  4CJ1 B;  1S5C D;  2FXQ A;  4K5V A;  1ESF A;  4OWW B;  2MFI A;  1TWF H;  2XNA C;  5GAD C;  1J8I A;  1Z7T A;  3PCO B;  3A54 A;  3M4O H;  1TWA B;  4EVO A;  1DOM A;  2R92 G;  4CKE A;  3S1R B;  4CHT B;  2DN8 A;  2PCF B;  5C44 H;  2NVQ B;  3K81 C;  2JXM B;  5CBA E;  2EYF A;  2EYP A;  2B2W A;  3AFQ A;  4DV7 Q;  2XRS D;  4LFC Q;  1KDC A;  2Y0S G;  1CKM A;  4DV5 L;  3M4P A;  4RKL A;  2BCO A;  2B63 G;  5E3F A;  4JBM A;  2NB0 A;  4FXG C;  4LAA A;  5D3D A;  5CV8 A;  3K7A H;  3T53 B;  3CD6 A;  5BR8 Q;  3NEM A;  3GV6 A;  4HED A;  4XIG S;  5J22 A;  4F88 A;  4OEM B;  4MN3 A;  1XPO A;  1I4G A;  1SMY C;  1EL0 A;  3KYH C;  2F0F A;  1E2W A;  1F9S A;  1G2T A;  1E1O A;  2Z1C A;  5FO9 B;  3U4V A;  1GUW A;  3NHH A;  3MHB A;  2RHQ B;  3I72 A;  3KLS X;  2HD3 A;  4LF8 L;  1B7Y B;  1QNU A;  3K0Y A;  1PYW D;  1DD2 A;  4JI8 L;  3VYT A;  1HFG A;  5DM7 3;  4IUT A;  3TQY A;  4FXD A;  3Q22 A;  1K8G A;  5JJK A;  3MC0 B;  4X65 L;  2HCC A;  4A3B H;  3KFU A;  4L5R C;  5ELF A;  2JA8 B;  1HZ9 A;  3RLO A;  4FF4 A;  2DJF C;  4K0K Q;  4C3I B;  2M9V A;  1KAA A;  4BY1 B;  4IFD G;  3HOZ G;  1SLJ A;  4J8Q A;  2VL6 A;  3JC6 6;  1E3P A;  2IL8 A;  2K5V A;  2KUM A;  5C0X H;  4DV6 L;  5IYB G;  3W2D A;  2P5Z X;  4P2C B;  3RMH A;  3K5N A;  2HCI A;  3M3Y H;  4LF6 Q;  2NVX B;  2MO0 A;  5LMN L;  2JA8 H;  4A3D H;  3GV3 A;  2JQO A;  1M4V A;  1EY9 A;  3OMC A;  5C4X G;  3GDE A;  1SAP A;  1ZYR D;  1A6X A;  4A4I A;  1PH5 A;  1N34 L;  2K4K A;  2WAQ G;  1E7Z A;  3T4A C;  4IOC A;  1Y1W G;  1XPR A;  1N33 Q;  1E2Z A;  3H0G G;  3S1Q H;  1QVF A;  2I5H A;  4A3D B;  1K83 H;  5D3I B;  1KXL A;  4OGQ C;  2YU9 H;  3I3C A;  2EYH A;  2QW7 A;  4RGO S;  4HID A;  3AB9 A;  5C5L A;  1STB A;  4KD4 A;  1LTA D;  5CBE E;  2R7Z B;  3RR5 A;  1HZA A;  1NR4 A;  4DKA C;  1E22 A;  1B4O A;  4ME3 A;  4B3M L;  5IT9 c;  2Q8T A;  1PFB A;  2F03 A;  1DZ1 A;  5CV7 A;  4DFA A;  4UPA A;  4FNF A;  1MSG A;  2HDM A;  3A8J E;  4KK7 A;  2NUC A;  4P73 A;  4X62 Q;  4L6T B;  2RBM A;  1WOC A;  5CMD A;  2LMC B;  3NP8 A;  3U58 A;  1IYV A;  2KEE A;  1SXT A;  1KRS A;  4HCE A;  3PIO 3;  2K7V A;  2FHT A;  5ELE A;  1PH4 A;  2D0O A;  1IW7 D;  4LF8 Q;  4NXM Q;  3CC4 A;  3UE1 A;  3VA7 A;  3L3O C;  1SYE A;  2F3I A;  4OHJ A;  3JAM L;  1HNZ L;  2G9H D;  4QIW B;  1W6K A;  4R4I A;  2CHB D;  4IZ8 A;  4HSV A;  3DXJ C;  2ICE C;  3I4M G;  3HOU B;  1WTO A;  4FF2 A;  1BBX C;  2KEN A;  4LNQ A;  5D14 A;  4GZY C;  3PV0 A;  4XDX A;  4IUN A;  1IBM Q;  4OXP A;  2E2H H;  2NVY H;  3K8A A;  4A76 A;  1Q86 C;  5C3E G;  2ZT9 C;  1S40 A;  3H3V C;  1Q3L A;  3FKI B;  1T9H A;  1MIU A;  4A3B G;  4GKK Q;  2EY1 A;  3W3A A;  5AFW A;  1STH A;  1KL9 A;  3S24 A;  4RHS A;  4BBR B;  3SEB A;  3P1H A;  5EBC A;  3GTP B;  3ERS X;  1BF4 A;  1LUZ A;  3M4O B;  3HKZ B;  3FDT A;  1ZKO A;  2UXD Q;  1VMC A;  4BXX G;  5EKL A;  3D3R A;  5E1F A;  1TWG H;  4QY7 A;  3S17 B;  2QF7 A;  1QVG A;  3HOX H;  1PH2 A;  2F0G A;  1CI3 M;  4HJ9 A;  1B50 A;  3PQI A;  1H9K A;  4A3M G;  1VQC A;  3M85 A;  2EXZ A;  5JPN C;  1LAC A;  1XMQ Q;  1PV4 A;  5J39 A;  5K36 G;  1VQ4 A;  1X55 A;  2ICI A;  1J5E Q;  1G51 A;  2OXP A;  3PO3 G;  3DMU A;  1CSP A;  3J80 i;  5AJ3 Q;  1PDQ A;  1UUP A;  3T56 B;  3S15 B;  1SNM A;  1NNX A;  1I50 B;  2BA1 A;  5IYD G;  1JWS D;  3DEO A;  1SE2 A;  4KHV A;  2VQE Q;  5M5X B;  3GTG H;  1SE3 A;  4ZCK A;  4J15 A;  2E2H B;  2F0K A;  3PGZ A;  4BY7 B;  1YIT A;  3GTK B;  5I6Y A;  1FL0 A;  4HR7 B;  3T13 A;  3I4N B;  1G2S A;  1Q46 A;  5M5Y H;  1O7Y A;  4JV5 Q;  3FVQ A;  2OWO A;  2VB3 X;  3ZYY X;  2MO1 A;  1ICW A;  5I2Y A;  1IBM L;  4LF5 L;  2VW9 A;  3J81 c;  1UNS A;  2YTX A;  2RDG A;  2EXD A;  2JA7 B;  1HZB A;  2E5L L;  5H1S E;  4R4O A;  4V19 0;  1MHW C;  4PG3 A;  4AIM A;  1AE3 A;  4JPB W;  1WTX A;  3BYY B;  1A62 A;  1KLU D;  3QWN A;  1PRT F;  1CSQ A;  2F0I A;  3BZC A;  3MVV A;  1C9O A;  2VUM G;  1ILQ A;  1EWI A;  1XNQ Q;  2EPB A;  2NN6 H;  1I4Q A;  1HR0 W;  4RGM A;  3S1N B;  4C2M B;  5JVH 3;  4WJ3 M;  2EIF A;  2KED A;  4JI5 L;  3QOJ A;  3UE0 A;  1HJP A;  5I6W A;  2EYJ A;  4F7X A;  1J5E L;  5C6A A;  2A69 C;  1S5D D;  4X64 Q;  4DUY L;  1SRU A;  1Q8I A;  1QIL A;  2B2Y C;  1PRT C;  2R7Z G;  4DNT B;  3T1Y L;  1NMF A;  1STE A;  3MA2 B;  1V1P B;  1VCI A;  1F9R A;  3CXC A;  2B2T C;  4EQ5 A;  1IBL L;  1V1P A;  1B44 D;  3A74 A;  2D62 A;  1OXU A;  2K1B A;  5KRU A;  5DNF A;  3HOZ H;  2MHV A;  2ALY B;  2NYZ D;  5HGT A;  3TP6 A;  1XNR Q;  3OMG A;  2D0P A;  4JI4 L;  2CFM A;  5I2X A;  4DV0 L;  1YJN A;  3G71 A;  3E9H A;  3CC2 A;  4A3G B;  3H6M A;  1LM0 A;  3IFT A;  4ZLT F;  4ZUI A;  2R93 G;  5M5W H;  2R7F A;  1XNQ L;  3HOW B;  4DAY B;  4G7O C;  2B8F A;  3NQI A;  3P75 A;  2AWN A;  2NTT A;  1SYC A;  3NWT A;  1VQM A;  1LLR D;  2HQL A;  4HMJ A;  3I90 A;  4C3H G;  1QJO A;  4GN3 B;  4U68 A;  3KUP A;  4A3G G;  4LFA L;  1CQV A;  3OHX C;  1EQQ A;  4U67 3;  4LF5 Q;  1PLF A;  2EY2 A;  2OCE A;  3SHL A;  3GTJ H;  4DAV A;  4YWL A;  4PZ7 A;  4YCU A;  2B39 A;  2L0C A;  1O7Z A;  1HUM A;  3STB C;  2NVT H;  5KNC A;  3CME A;  3VR3 A;  3W5O A;  3A7L A;  1MD2 D;  3F2D A;  3SE0 A;  1AFP A;  5IP9 H;  1TWC B;  4JYA L;  1HA6 A;  4A3F B;  2O4X A;  2IW3 A;  3B6Y A;  1MGS A;  4AYB G;  1PVO A;  1JOK A;  4A3J H;  3QOL A;  2HIV A;  3CCR A;  4DUY Q;  3J7A 5;  2N78 A;  2PZW A;  1TU2 B;  3S9W A;  1SNQ A;  1G6Z A;  2JA6 H;  1PYB A;  4X66 L;  1EY0 A;  2F0H A;  2K50 A;  3ULJ A;  1VQD A;  1XMO L;  3KF6 B;  1TII D;  3G7L A;  1F2Z A;  1S4Z A;  1U4P A;  5A35 A;  3RN5 A;  5IP7 G;  4B3M Q;  4OX9 L;  1L1O C;  3OWF A;  1JB3 A;  3KDF B;  2UUB L;  4GLV B;  2UXB L;  2VUM H;  4PMB A;  5DEH A;  4H13 C;  2EYO A;  1FVI A;  1VQA A;  1CHP D;  5C0X J;  2PO4 A;  3R93 A;  1RTN A;  1S3O A;  3EIV A;  4A93 G;  2JK8 A;  1SYB A;  1KLG D;  3CRL C;  3J81 L;  2BE5 D;  4JI5 Q;  1X3P A;  1I6H B;  3U50 C;  2LSS A;  5C3X A;  2JA7 G;  1QUQ B;  1SYF A;  1CTM A;  1EY6 A;  4K8J A;  4ULL A;  2HHH Q;  1G6P A;  3BDC A;  1PH9 A;  1SNO A;  2QCP X;  4LUV A;  4FF3 A;  3GO5 A;  5C3E H;  2K14 A;  2NN6 I;  4YCW A;  2KHJ A;  5GQO A;  2K03 A;  4AH6 A;  4K14 A;  3CHB D;  5IGG A;  1WJJ A;  3UDG A;  2NVX H;  3C2P A;  1VQH A;  4GKK L;  3A7A B;  4OEL B;  4KHP L;  1RJT A;  1HFN A;  3DEP A;  4RWS C;  1YIJ A;  3RLN A;  1SMY D;  3K7A B;  1UEB A;  1L1O A;  4DV0 Q;  4BY7 H;  4POF A;  3F2B A;  4S3S A;  1O7I A;  1STY A;  1EEI D;  3G6E A;  4IUQ A;  4JI4 Q;  3KLW A;  4C3H B;  4IPC A;  1STG A;  4JI6 L;  1QB5 D;  1LT6 D;  2EJG C;  2WFW A;  1WTV A;  1CQF A;  1EIY B;  1H9M A;  2X69 A;  4A3F G;  1W2B A;  1QNK A;  1TWA H;  2ZM6 Q;  1W6J A;  2LS0 1;  1UAP A;  4DK6 C;  4ME5 A;  1GXD C;  4B9X A;  1WTQ A;  5C0X I;  1SFO H;  1WCM H;  5GAE C;  5JEA G;  4LWC A;  5KYL A;  2E2I B;  4CBV A;  1F2Y A;  2Q2H A;  4P72 A;  2BDN A;  2CW0 D;  5F2D A;  4CKC A;  1NAP A;  3V96 A;  2B2T A;  1JB7 A;  2K5N A;  2C35 B;  2KCT A;  3HZX A;  2GVA A;  1H9J A;  1FGU A;  1SMX A;  1VF5 C;  1C48 A;  3G6J B;  1Z9F A;  5IWA Q;  2A8V A;  4A3L H;  3T1Y Q;  2X6L A;  4C56 C;  4M1U B;  4A3C H;  1X3Q A;  3EJI A;  2AUJ D;  2C5C A;  3GP7 A;  2WIN B;  2IPK D;  1C7Y A;  2KVM A;  3Q23 A;  2LXJ A;  3QO2 A;  5KNB A;  4QUC A;  2F0V A;  1V9P A;  3CPF A;  4BBS G;  1PZJ D;  3CC7 A;  3MXP A;  2JP1 A;  4KJO A;  3C46 A;  3MXN A;  1XX8 A;  2K6A A;  4XTC S;  4DV2 Q;  3P20 A;  2QKI C;  4N9P A;  1RTO A;  3I4L A;  2BDO A;  1PFS A;  5M3F G;  3HOW H;  2AMC B;  1VQP A;  1J6Q A;  3I73 A;  3JAM c;  4ILW A;  3PO2 H;  3BZK A;  1EY5 A;  2KHI A;  4RCN A;  2L12 A;  4LF6 L;  4DR3 L;  2Y0S B;  4XQJ A;  3VR2 A;  3BS1 A;  1BDO A;  4RGT A;  2VNU D;  4KHZ A;  3BVM A;  4A75 A;  1EFI D;  2HHH L;  5BN3 A;  4OO1 G;  3KLS A;  1YNX A;  3NEL A;  3CW2 C;  1AE2 A;  3HS0 C;  5FJ8 G;  4DK0 A;  2KCM A;  5IGE A;  2J0T D;  4RGN A;  2OF1 A;  2R7Z H;  1ASZ A;  5HGQ A;  4KHP Q;  2GN5 A;  2VY3 A;  1EQV A;  3D4W A;  3RNU A;  2MP1 A;  1ENC A;  5T1I A;  2WB1 E;  4QB4 A;  2F52 A;  3MZ5 A;  1JJG A;  2RHS B;  4BY7 G;  4GKJ L;  2OQ0 A;  1AW7 A;  1V8Q A;  4IUP A;  1UE6 A;  5I4D A;  3GD7 A;  4DR5 L;  4ZKB B;  2ZJP A;  4E6I A;  4GNX C;  3J81 E;  4XXE A;  2MGS A;  4RMF A;  5IGD A;  1PXU A;  1A2U A;  2E5L Q;  4J6H A;  3TP8 A;  3HOU H;  3DHQ A;  1PMR A;  1SYD A;  2EVB A;  1X54 A;  4BY1 G;  3CCQ A;  5A2Q L;  5FLX c;  3AYH B;  5C44 G;  2RDH A;  4GOP A;  2UU9 Q;  4IAL A;  4JBJ A;  2Q2T A;  3TRE A;  1OXV A;  2BH2 A;  1LYL A;  2Z8L A;  1BKB A;  1VS0 A;  2IX3 A;  1M90 C;  1I4P A;  3CQZ H;  1M1K C;  3MEH A;  1EU3 A;  4JI2 Q;  1U4L A;  1N36 Q;  2DY7 A;  3S2H H;  2QEJ C;  4JCV E;  4GOP B;  3E9I A;  4A3B B;  3NUC A;  1Q8K A;  1X56 A;  3BU2 A;  4NKL A;  1SJH D;  3HEJ A;  1SJE D;  1DM0 B;  2KEC A;  3KLR A;  1PH8 A;  5G3L D;  3H0G B;  4A3C G;  5LMN W;  1QVC A;  4IPH A;  4DR1 Q;  2CW0 C;  5EPJ A;  4B3S Q;  2JA6 G;  2JEB I;  3X3M A;  3RZO B;  1HRJ A;  2PW7 A;  4X66 Q;  4JI3 L;  4F87 A;  1HNW Q;  3HG9 A;  2MPM A;  1HCZ A;  2CKZ B;  4FO2 A;  4ZRZ A;  4BBR H;  2QEX A;  4B3S L;  3OPO A;  1FNW A;  2N55 A;  3BDO A;  4A3K B;  2F0U A;  3MXN B;  4R4Q A;  4P75 A;  1V1O A;  5C5M A;  2TSS A;  5T1G A;  4DR7 Q;  2UXC Q;  3I55 A;  2B3G A;  1WCM B;  3F2C A;  2MJ8 A;  3NK9 A;  3ZJY C;  1N9W A;  2KQ3 A;  4A93 H;  4JG2 A;  3J7A V;  1IKL A;  3RD4 A;  3NBH B;  1Z6H A;  1SE8 A;  4QGU A;  4LF7 Q;  5EKI A;  3DWQ A;  1C4Q A;  1UEA B;  2AWO A;  1N33 L;  3H3V I;  2IJ0 A;  3G4S A;  1JOQ A;  1L0W A;  2RCN A;  2JA7 H;  1C0A A;  2L1B A;  2RA4 A;  3TDQ A;  1WVL A;  2CWA A;  3BYT B;  2YTV A;  1Y1W H;  1RCV D;  3GTK H;  1VQN A;  3S16 B;  2FIN B;  5M5Y B;  2VB2 X;  2B2V C;  1I94 Q;  4N8X 1;  1GUS A;  4C3I H;  3MXG A;  1JWU D;  5M5X H;  4DR6 Q;  3J7Z C;  3F2U A;  4ALP A;  2DY8 A;  1WTR A;  4H44 C;  1BQQ T;  4UP9 A;  2B2V A;  2UUC L;  3AQQ A;  1GD7 A;  1VQB A;  4KLK A;  4JI0 L;  3IKJ A;  2UUA L;  1HR0 L;  3S14 H;  1Y1W B;  3D31 A;  2EYL A;  2VQF Q;  1B3Q A;  1LTS D;  4KV6 A;  4HIO A;  4CJ2 C;  2M00 A;  5E7N A;  2O5I C;  2ZXP A;  5GRO A;  1XJV A;  1KC8 C;  4IFD I;  3KOJ A;  3OIP A;  5FLX E;  4OO1 I;  2YYZ A;  4A3K H;  2WKD A;  1CKN A;  4B3T L;  4DR4 L;  1N32 Q;  3QIA A;  1HPC A;  4DN4 M;  3I2Z A;  1S5F D;  4DR3 Q;  5LMN Q;  3VR6 A;  1PH3 A;  4H02 A;  1KIX A;  4B3R Q;  5IE8 A;  1K9M C;  2QDL A;  4MZ9 A;  2OTJ A;  1HTP A;  3W1G A;  4LW1 A;  3GTQ H;  3NXW A;  1VQL A;  1K8A C;  2WAQ E;  3ONA B;  2FFK B;  3JAM E;  2F0O A;  1PTO F;  3NPP A;  4KTA A;  1JJC B;  3VYR A;  1PTO H;  3MEF A;  1N36 L;  5IT9 L;  1CKN B;  4JI7 Q;  1Z47 A;  2Z6K A;  3TP7 A;  4GNX A;  1VQ8 A;  2H4O A;  5BR8 L;  3SDZ A;  2KOL A;  4R4C A;  4FP5 D;  3DM1 A;  4GNX B;  3W1B A;  4J1M A;  4XT1 B;  4NXN L;  2I5L X;  2WII B;  1SND A;  4QIW E;  3KK7 A;  5DLQ E;  2J7Z A;  4CKB A;  4WJ4 A;  4X3S A;  1LTI D;  1X32 A;  4C3J B;  1Q82 C;  1D7Q A;  4HTH A;  1KAB A;  4DR7 L;  2UXC L;  1BXT A;  4PNY A;  4ZYS A;  4IO9 A;  4ZAI A;  4OON A;  1I94 L;  2QGQ A;  3ICE A;  4YHH Q;  1HNX L;  2JA9 A;  4UP7 A;  4B08 A;  2PNH A;  4BBR G;  1AEX A;  3KBX A;  2PQA A;  4AQY L;  1HNW L;  5ELC A;  3CCE A;  3FPU B;  3HKZ G;  3HOW G;  1H9S B;  4BXX H;  3RN2 A;  4PZ6 A;  3NSW A;  4O1N A;  3K58 A;  4GKJ Q;  2FMM A;  1JR0 D;  1H9S A;  2EY6 A;  1EUJ A;  3Q8D A;  4MIU A;  5C0X G;  4DPG A;  4GOP C;  1YJ9 A;  4IOA A;  4DV5 Q;  1RL2 A;  2KCC A;  4L5T A;  1Q90 A;  1A2T A;  4MHE A;  1KHI A;  3N6R A;  1B9M A;  4XT3 B;  1EU4 A;  1SR3 A;  5K36 H;  2YV5 A;  2ZJQ A;  3LWE A;  4YY3 Q;  1VQ7 A;  4JI7 L;  4X64 L;  3GTJ B;  3AMU A;  3ND8 A;  5C4X H;  4BWG B;  3HGB A;  4GLX A;  2F4V L;  5FJ8 H;  4BA2 I;  3WOE A;  4WOR A;  1VQ5 A;  5C3W A;  1HTL D;  2GVB A;  5C4J B;  5IYC H;  2XSC A;  1OXX K;  1IL2 A;  3SVM A;  2RF4 A;  1GVP A;  1EIF A;  4FDB A;  1STA A;  4KY7 A;  3E3X A;  1TS2 A;  4LK1 C;  4DR1 L;  4BA1 I;  5CYU A;  1X6O A;  4UAI A;  3GTL B;  4DAM A;  3URY A;  1V43 A;  3K5O A;  2A6H D;  5CV9 A;  1Q1E A;  4DV7 L;  3A5U A;  3GQB A;  1LV9 A;  1SFO B;  4O0A A;  5IGB A;  1CZW A;  1IHZ A;  1BCP D;  1A0I A;  2F0M A;  1UE1 A;  1MJE A;  2NBF A;  3UDI A;  1K8O A;  4BS9 A;  2Z4H A;  1CM9 A;  3U4Z A;  2IHF A;  4DAY A;  1TS5 A;  3GTL H;  4K6L A;  1QOH A;  2PQE A;  2VZA A;  4DV3 L;  4X3K A;  3BG3 A;  4FXK C;  2FJ2 A;  1ESR A;  3AEV A;  4HJA A;  1IBK L;  3GTG B;  3S2D H;  2UUB Q;  1EYD A;  1HA5 A;  4PMW A;  2R93 B;  1VQ9 A;  1NMG A;  1IZ6 A;  1VQJ A;  3K5M A;  1WD1 A;  4R4T A;  5EGT A;  1SE4 A;  3DUZ A;  3GTO B;  1TWG B;  1EY8 A;  2L5T A;  2CVR A;  2WB1 B;  3I56 A;  4I65 A;  4HJ7 A;  1HNX Q;  4HIK A;  4KY5 A;  4NXM L;  5JOB A;  3QB3 A;  5AJ3 L;  1ET9 A;  3OIQ A;  4IUU A;  1BVS A;  4TVA B;  3T1H L;  1L0X B;  3TBI B;  1T5X D;  1E0B A;  3S1M B;  4RCO A;  5C4Z A;  1XTC D;  4JI8 Q;  2L11 A;  3M4Y A;  2HT1 A;  4DV6 Q;  1EOV A;  3QG1 A;  3GTO H;  1MSH A;  3PO3 B;  3EFX D;  1BBW A;  1DGS A;  3TSS A;  2DNC A;  3ULP A;  5M3M B;  4LMQ D;  1E24 A;  1E1T A;  4KMU C;  3PUY A;  2XGT A;  3CMA A;  1GHJ A;  4ABN A;  4LF9 Q;  3HOY G;  2EJF C;  3D0F A;  3S14 B;  3J81 i;  3S1N H;  2K32 A;  1PH6 A;  3S15 H;  3I4N H;  1S5B D;  1MKH A;  2RSO A;  2D2C C;  4Y7N H;  4RFB A;  3I4O A;  4H7B A;  1DYQ A;  4A3M H;  1VF7 A;  1Q1B A;  2NWG A;  3OTO L;  1EY4 A;  2ZJR A;  1PTO B;  2RDF A;  2F3W A;  3D6C A;  3KF6 A;  4FVM A;  2E2J B;  3J80 E;  1DCZ A;  3H09 A;  3OW7 A;  2RCF A;  3PO3 H;  1L1O B;  1R4P B;  4G7H C;  3H94 A;  2NZH A;  2YTY A;  1LAB A;  3EQL C;  1WFQ A;  4DV1 Q;  2BH8 A;  2QDB A;  1D8L A;  3NTH A;  4A3M B;  5FKA C;  3CCU A;  3MXU A;  1JOR A;  2XVS A;  3VR4 A;  5TSS A;  3DM3 A;  1TVX A;  4HCS A;  4L63 B;  3I4M B;  5GAH C;  1YNN D;  2A6H C;  1QWY A;  1ROD A;  4C1N I;  3ERQ A;  5KIX A;  4K0K L;  2CQO A;  1LTT D;  2VS1 A;  1K0R A;  2R92 H;  1BCP F;  2IX0 A;  3PIO A;  4A3K G;  1FD7 D;  4JI3 Q;  4QCL A;  5FO7 B;  4MTK A;  4A3I H;  4XYQ A;  2SOB A;  3K5L A;  3VDY A;  3CP0 A;  5IP7 H;  3PUV A;  4Y7N B;  3ITP A;  4K2K A;  2SDF A;  4K5W A;  1K73 C;  1BR9 A;  1ASY A;  2ZM6 L;  1IL8 A;  1U9R A;  2V1C C;  4IUR A;  4K6D A;  3CCV A;  2NZO A;  1YVC A;  4G7Z C;  4UY8 C;  2A68 C;  1A3T A;  1IW7 C;  5L37 A;  2I0Q A;  4JI1 Q;  3NQT A;  4DV1 L;  4CDD C;  1RKN A;  1SEB D;  4IN3 A;  1FYC A;  5DAU A;  1D5X C;  4NW2 A;  1AH9 A;  5HUR A;  1XWE A;  2F1M A;  2XWJ B;  1WD0 A;  3L2P A;  2RKS A;  3VYU A;  1O80 A;  2A6E C;  3L7Z C;  5G3L F;  1FNV A;  1YHB A;  2Q2I A;  4F8M A;  4EGV A;  5A2Q E;  2NVY B;  3ULL A;  1WTW A;  4RAU C;  3PF5 A;  5C4J H;  1FJG Q;  1A3U A;  5EJW A;  3GTM B;  5I9P A;  2WAQ B;  4KD3 A;  1U0L A;  3NE5 B;  2BE5 C;  1CT1 D;  1F9P A;  1YHQ A;  3SXH A;  2N88 A;  3E6Z X;  2ES2 A;  1D1I A;  4RA8 A;  1V1Q A;  3E5S A;  1VQE A;  3EBE A;  4IJL A;  1CFM A;  1VQF A;  4DR5 Q;  1U4M A;  3ER0 A;  3IFD A;  4I7A A;  2F0J A;  4APV A;  2K28 A;  3BZD B;  1X3G A; 
#chains in the Genus database with same CATH homology
 4ZKC B;  1PRT B;  1I4R A;  1K8M A;  1KDB A;  1WTP A;  1SYG A;  3M7N A;  3FMC A;  1D1K A;  1Y8N B;  5E4W C;  1YNJ D;  3CRK C;  2E2D C;  2ID0 A;  4O42 A;  1C8C A;  2F3V A;  3L9A X;  2JA5 B;  2MUY A;  1LTB D;  2VUM B;  4JK1 C;  3S2H B;  4ZUJ A;  4V0B A;  3V2T A;  5KYI A;  2PZT A;  3RUZ A;  4Z9C B;  3MAQ A;  1Y69 U;  2G9D A;  3CKI B;  5E4X A;  1GOZ A;  4PV1 C;  2AQ3 B;  2C9O A;  2WAC A;  2LY7 A;  4YIJ A;  4C3J G;  4M8A A;  5ISR A;  3WOF A;  1GUG A;  1EQT A;  4KKS A;  5C44 B;  2E74 C;  2LKV A;  1KTK A;  1CA5 A;  3C3L A;  4OIK A;  2I07 B;  1EWH A;  1TY0 A;  1FGB D;  4WRD A;  5KND A;  4K8I A;  2O2L D;  3K57 A;  2F0S A;  1BO0 A;  1VDZ A;  5I9O A;  2Z4I A;  3TP5 A;  1D5Z C;  2LFN A;  3WDN A;  1KNE A;  5COR A;  5JEA J;  5EPK A;  5KEE A;  1JIC A;  3T16 A;  2JEA I;  2EDG A;  1AZQ A;  1VMP A;  2XWB B;  2PMZ B;  2HDL A;  3SR1 A;  3UI2 A;  1NCV A;  4CJ0 B;  1ILP A;  4PQX A;  1FNU A;  1K83 B;  3HRZ C;  2K33 A;  1JC7 A;  1PZI D;  3NWS A;  4I7Z C;  5J1Z A;  1JQY D;  1O78 A;  3E0J A;  5JPM C;  3FPP A;  1HHV A;  5NUC A;  4UDU C;  4FF1 A;  2HUG A;  3I91 A;  3PUW A;  3M3Y B;  1GHK A;  4QF4 A;  3AU7 A;  3HOX B;  1II3 A;  2KHS A;  5M3F B;  2M2L A;  3TME A;  5FK9 C;  2JSO A;  1RHP A;  3O13 A;  4PMC A;  5ELB A;  1TS4 A;  3R2T A;  4RHR A;  4KN4 C;  1PZK D;  2RVL A;  3ND9 A;  1F2M A;  1NSN S;  3HOV B;  5IIF A;  1HQM C;  1LO5 D;  2EOT A;  1BCP B;  3NBH A;  1EYA A;  1DON A;  2F0W A;  2XIW A;  2IX1 A;  2R6G A;  1F77 A;  3CU7 A;  2SNS A;  2SNM A;  4HAE A;  3CQZ B;  2RQX A;  3PIP 3;  5CC4 A;  1GJX A;  2F0D A;  3SK5 A;  5C4X B;  2CQA A;  3FEW X;  2IWH A;  2NTS A;  1ONL A;  1IYU A;  2XN9 C;  4WFN 3;  1EEF D;  4EQN A;  3MFG A;  4NDX A;  4LJZ C;  1KNA A;  3KBG A;  2F4I A;  5FOB B;  4G57 A;  4KY6 A;  1ET6 A;  1B3A A;  1LTG D;  2IT1 A;  3OWE B;  5D65 A;  1EIH A;  2Q8I B;  4OO1 H;  4HMI A;  3A55 A;  1EZ8 A;  1G8Z D;  4KI0 A;  1B2T A;  3K59 A;  2K5D A;  3RZD B;  2EY5 A;  4EQO A;  1TY2 A;  4DAP A;  2F0P A;  3SK8 A;  4X3T A;  4G4K A;  1PFM A;  1CHQ D;  1JE4 A;  1I4H A;  3BVZ A;  3A8I E;  3U9O A;  2O5J C;  1JCK B;  2K04 A;  1LT3 D;  3TZD A;  1EWC A;  1Y8P B;  1QE6 A;  3GTQ B;  4CGY B;  1DJR D;  3X3N A;  4KKT A;  1R4Q B;  5JAV A;  1XYI A;  2DNE A;  3J7Y W;  4XYO A;  2E76 C;  3DWP A;  4KJN A;  5C4H A;  1F2L A;  2B63 B;  4IQZ A;  1DOK A;  3IAY A;  1GUO A;  2EJM A;  1PTO D;  2A69 D;  3MTS A;  3R8B A;  1BUV T;  4ZK9 B;  2F0E A;  3D4R A;  4JBW A;  2WV6 D;  2AQ1 B;  5EPL A;  4A93 B;  2ENB A;  1CK1 A;  3S1Q B;  3D8G A;  4R8N A;  4DXG A;  1GUN A;  2TMP A;  1TKW B;  3N52 A;  4ODG A;  2I46 A;  3Q0A A;  3SK6 A;  1M8A A;  4FYD A;  5CGK A;  4C1N K;  1DXM A;  1ZXT A;  4TRD A;  2B8G A;  5KGU A;  2NVT B;  2OEO A;  1BOS A;  1I6V C;  5LHY 1;  2RSN A;  3D6W A;  5EKK A;  2QIL A;  5EBD A;  4A3J B;  4H0L C;  3LNN A;  3MWY W;  2B2W C;  3D4D A;  4K5X A;  1BNZ A;  4DA2 A;  2NN6 G;  1I4X A;  1XXG A;  2EYM A;  4XQN A;  2B2Y A;  4WJW A;  3DWA A;  3R2I A;  2L9H A;  3Q6S A;  4IFD J;  1B53 A;  1LTR D;  2K5Q A;  3LX0 A;  4ID6 A;  1RDP D;  5EQ0 A;  2HQE A;  1LT4 D;  3A56 A;  1R9T B;  3C1F A;  1FR3 A;  4TKO B;  1Y1V B;  2PPB C;  4N9T A;  2D9U A;  4Q0F A;  4DK1 A;  4TQU S;  1D2B A;  5IGC A;  3HOY B;  4X3U A;  1Q12 A;  2WKC A;  1G29 1;  5IT9 E;  5IOD A;  1MI2 A;  5M9O A;  1STN A;  3HOZ B;  2R92 B;  3T51 B;  4EQP A;  1OO9 B;  5IOC A;  1MBY A;  2JA6 B;  1J9O A;  5CR3 A;  1SBB B;  5FO8 B;  1F9Q A;  5M5W B;  1ML0 D;  1QCB D;  2F0T A;  1OXS C;  2F0N A;  2A73 B;  4DXF A;  2H1E A;  1ZYR C;  1B9N A;  4QUF A;  2BOS A;  3H91 A;  3OSO A;  3A8K E;  5K5P A;  4B9W A;  5COY A;  1TT2 A;  4TSS A;  2Q8R E;  1S5E D;  1TWF B;  1RD9 D;  4IUV A;  3TN2 A;  4ZQ3 A;  5BN5 A;  4K2L A;  4NP5 A;  2D5D A;  2F0L A;  4KKU A;  1A3V A;  4R9W A;  1ENF A;  4R8I A;  3FRP B;  4KN7 C;  1EZ6 A;  3S2D B;  2NZ1 D;  1BCP C;  1GUT A;  2OT2 A;  2K01 A;  4IFD H;  1PRT D;  1AP0 A;  4DU9 A;  3MFY A;  4OIJ A;  2KA7 A;  5BN4 A;  2EZV A;  1HXY D;  1EYC A;  2PNR C;  2A5H A;  2EE1 A;  3J7A F;  2JE6 I;  3SK4 A;  1YNN C;  2KCN A;  4DF7 A;  1YNJ C;  3VA5 A;  1Y8O B;  4AYB B;  2XRQ D;  3VR5 A;  1KDA A;  2PZU A;  3J80 L;  1HUN A;  3NTI A;  1L0Y B;  4BBS B;  5C3E B;  1HQR D;  1H9R A;  5JVG 3;  3KF8 A;  2R61 A;  3IL8 A;  2B2U C;  3BVG A;  5JJZ A;  5LL6 S;  2J4X A;  1LT5 D;  1AN8 A;  2L4N A;  2JYO A;  1TS3 A;  4XQQ A;  2K5W A;  2X6G A;  4Q5V A;  3K6O A;  3U9S A;  5CV6 A;  4L8J A;  3ERO A;  2SEB D;  1DOL A;  3P7J A;  3Q24 A;  5DM6 3;  1EY7 A;  1T5E A;  5CV4 A;  1EIG A;  1PFN A;  3QJY A;  3BDL A;  1I3Q B;  1OXT A;  2A6E D;  4A3I B;  1ENA A;  3NBI A;  2KJX A;  2ZXO A;  4DGZ A;  5JEA H;  1NR2 A;  1TQO A;  2B2U A;  1SNC A;  3V05 A;  3I70 A;  3TZU A;  1TR5 A;  3PUX A;  2YU9 B;  1CZG A;  4OL7 A;  2V4D A;  2VXW A;  5CV5 A;  1ZEQ X;  1IKM A;  5IGF A;  2AQ2 B;  1B1Z A;  5ELD A;  4A3E B;  2A68 D;  2L55 A;  2ZXR A;  4HSP A;  3VYS A;  1NUC A;  3R3O A;  1RF2 D;  2PYK A;  3C1E A;  1AZP A;  1SNP A;  1A15 A;  1D5M C;  1E2V A;  3I8Z A;  3HP3 A;  1U4R A;  3EVQ A;  5LL6 X;  1JOO A;  2PW5 A;  1TWH B;  4QMG A;  4RKB A;  1JWM D;  2R3Z A;  2A74 C;  3OOC A;  2BA0 A;  1G91 A;  3PO2 B;  2F0Q A;  1PTO C;  3LWU A;  2E75 C;  1CA6 A;  1O7L A;  3EA6 A;  2AUK A;  1EOT A;  4RH6 A;  2WP8 J;  2K05 A;  3NTK A;  3M7G A;  3PMF A;  1SDF A;  5FLX L;  3RLF A;  3PUZ A;  4C3I G;  4HN7 A;  4DNR B;  2GA4 B;  4NMZ A;  1D6E C;  1QG7 A;  2FMC A;  1SSO A;  4CJ1 B;  1S5C D;  4K5V A;  1ESF A;  2XNA C;  1J8I A;  1Z7T A;  3A54 A;  1TWA B;  4EVO A;  1DOM A;  4CKE A;  3S1R B;  4CHT B;  2DN8 A;  2PCF B;  2NVQ B;  2JXM B;  5CBA E;  2EYF A;  2EYP A;  2B2W A;  2XRS D;  1KDC A;  4RKL A;  2BCO A;  5E3F A;  2NB0 A;  4FXG C;  4LAA A;  5D3D A;  5CV8 A;  3T53 B;  3GV6 A;  4HED A;  4XIG S;  5J22 A;  4F88 A;  4MN3 A;  1I4G A;  1SMY C;  1EL0 A;  2F0F A;  1E2W A;  1F9S A;  1G2T A;  2Z1C A;  5FO9 B;  1GUW A;  3NHH A;  3MHB A;  3I72 A;  3KLS X;  1QNU A;  3K0Y A;  1PYW D;  1DD2 A;  3VYT A;  1HFG A;  5DM7 3;  4IUT A;  4FXD A;  3Q22 A;  3MC0 B;  2HCC A;  5ELF A;  2JA8 B;  4FF4 A;  4C3I B;  2M9V A;  1KAA A;  4BY1 B;  4IFD G;  4J8Q A;  2IL8 A;  2KUM A;  5C0X H;  3W2D A;  4P2C B;  3RMH A;  3K5N A;  2HCI A;  2NVX B;  3GV3 A;  1M4V A;  1EY9 A;  3OMC A;  1SAP A;  1ZYR D;  1A6X A;  3T4A C;  1E2Z A;  4A3D B;  5D3I B;  4OGQ C;  3I3C A;  2EYH A;  4RGO S;  3AB9 A;  5C5L A;  1STB A;  4KD4 A;  1LTA D;  5CBE E;  2R7Z B;  1NR4 A;  1B4O A;  2Q8T A;  1PFB A;  2F03 A;  1DZ1 A;  5CV7 A;  4DFA A;  4FNF A;  1MSG A;  2HDM A;  3A8J E;  4KK7 A;  2NUC A;  4L6T B;  2RBM A;  5CMD A;  2LMC B;  3NP8 A;  1IYV A;  2KEE A;  1SXT A;  4HCE A;  3PIO 3;  2K7V A;  2FHT A;  5ELE A;  1IW7 D;  3VA7 A;  3L3O C;  1SYE A;  4OHJ A;  3JAM L;  2G9H D;  4QIW B;  1W6K A;  2CHB D;  4IZ8 A;  4HSV A;  3DXJ C;  2ICE C;  3HOU B;  1WTO A;  4FF2 A;  1BBX C;  5D14 A;  4GZY C;  3PV0 A;  4XDX A;  4IUN A;  2ZT9 C;  3H3V C;  1Q3L A;  3FKI B;  2EY1 A;  3W3A A;  5AFW A;  1STH A;  4RHS A;  4BBR B;  3SEB A;  3P1H A;  5EBC A;  3GTP B;  1BF4 A;  3M4O B;  3HKZ B;  3FDT A;  1ZKO A;  1VMC A;  5EKL A;  3D3R A;  5E1F A;  3S17 B;  2QF7 A;  2F0G A;  1CI3 M;  1B50 A;  1H9K A;  3M85 A;  2EXZ A;  5JPN C;  1LAC A;  5J39 A;  5K36 G;  2ICI A;  2OXP A;  3DMU A;  1PDQ A;  1UUP A;  3T56 B;  3S15 B;  1SNM A;  1I50 B;  2BA1 A;  1JWS D;  3DEO A;  1SE2 A;  4KHV A;  5M5X B;  1SE3 A;  2E2H B;  2F0K A;  4BY7 B;  3GTK B;  5I6Y A;  4HR7 B;  3T13 A;  3I4N B;  1G2S A;  1O7Y A;  3FVQ A;  2VB3 X;  3ZYY X;  1ICW A;  5I2Y A;  1UNS A;  2RDG A;  2JA7 B;  4V19 0;  1WTX A;  3BYY B;  1KLU D;  3QWN A;  1PRT F;  2F0I A;  3MVV A;  1ILQ A;  2EPB A;  2NN6 H;  1I4Q A;  4RGM A;  3S1N B;  4C2M B;  5JVH 3;  2KED A;  3QOJ A;  5I6W A;  2EYJ A;  4F7X A;  5C6A A;  2A69 C;  1S5D D;  1Q8I A;  1QIL A;  2B2Y C;  1PRT C;  4DNT B;  1STE A;  3MA2 B;  1V1P B;  1VCI A;  1F9R A;  2B2T C;  1V1P A;  1B44 D;  2D62 A;  1OXU A;  2K1B A;  5KRU A;  5DNF A;  2MHV A;  5HGT A;  2NYZ D;  3TP6 A;  3OMG A;  5I2X A;  4A3G B;  3H6M A;  3IFT A;  4ZLT F;  4ZUI A;  3HOW B;  4G7O C;  2B8F A;  3NQI A;  3P75 A;  2AWN A;  2NTT A;  1SYC A;  3NWT A;  1LLR D;  4HMJ A;  3I90 A;  4C3H G;  1QJO A;  4U68 A;  3KUP A;  1CQV A;  3OHX C;  4U67 3;  1PLF A;  2EY2 A;  3SHL A;  4DAV A;  2B39 A;  2L0C A;  1O7Z A;  1HUM A;  5KNC A;  3VR3 A;  3A7L A;  1MD2 D;  3SE0 A;  1AFP A;  1TWC B;  1HA6 A;  4A3F B;  2O4X A;  2IW3 A;  1MGS A;  1JOK A;  3QOL A;  2PZW A;  1TU2 B;  3S9W A;  1SNQ A;  1G6Z A;  1EY0 A;  2F0H A;  1TII D;  3G7L A;  1F2Z A;  1S4Z A;  1U4P A;  5A35 A;  3OWF A;  1JB3 A;  4PMB A;  5DEH A;  4H13 C;  2EYO A;  1CHP D;  5C0X J;  2PO4 A;  3R93 A;  1RTN A;  1SYB A;  1KLG D;  3CRL C;  3J81 L;  2BE5 D;  1X3P A;  1I6H B;  5C3X A;  1SYF A;  1CTM A;  1EY6 A;  4K8J A;  4ULL A;  3BDC A;  1SNO A;  2QCP X;  4FF3 A;  3GO5 A;  2NN6 I;  2K03 A;  4K14 A;  3CHB D;  5IGG A;  3C2P A;  3A7A B;  1RJT A;  1HFN A;  3DEP A;  4RWS C;  1SMY D;  3K7A B;  4S3S A;  1STY A;  1EEI D;  4IUQ A;  4C3H B;  1STG A;  1QB5 D;  1LT6 D;  2EJG C;  1WTV A;  1CQF A;  1H9M A;  2X69 A;  1QNK A;  1W6J A;  2LS0 1;  1UAP A;  4ME5 A;  1GXD C;  4B9X A;  1WTQ A;  5C0X I;  5JEA G;  5KYL A;  2E2I B;  4CBV A;  1F2Y A;  2BDN A;  2CW0 D;  5F2D A;  4CKC A;  1NAP A;  3V96 A;  2B2T A;  3HZX A;  1H9J A;  1VF5 C;  1C48 A;  3G6J B;  2X6L A;  4C56 C;  4M1U B;  1X3Q A;  3EJI A;  2AUJ D;  2C5C A;  2WIN B;  2IPK D;  3GP7 A;  2KVM A;  3Q23 A;  3QO2 A;  5KNB A;  4QUC A;  2F0V A;  1PZJ D;  3MXP A;  2JP1 A;  4KJO A;  3C46 A;  3MXN A;  1XX8 A;  2K6A A;  4XTC S;  3P20 A;  2QKI C;  4N9P A;  1RTO A;  3I4L A;  2BDO A;  3I73 A;  4ILW A;  1EY5 A;  4RCN A;  2L12 A;  2Y0S B;  4XQJ A;  3VR2 A;  3BS1 A;  1BDO A;  4RGT A;  2VNU D;  4KHZ A;  3BVM A;  1EFI D;  5BN3 A;  4OO1 G;  3KLS A;  3HS0 C;  4DK0 A;  5IGE A;  2J0T D;  4RGN A;  2OF1 A;  1EQV A;  3D4W A;  2MP1 A;  1ENC A;  5T1I A;  4QB4 A;  3MZ5 A;  1AW7 A;  1V8Q A;  4IUP A;  5I4D A;  3GD7 A;  4ZKB B;  4E6I A;  3J81 E;  4XXE A;  2MGS A;  5IGD A;  1PXU A;  1A2U A;  4J6H A;  3TP8 A;  3DHQ A;  1PMR A;  1SYD A;  2EVB A;  5A2Q L;  2RDH A;  4IAL A;  1OXV A;  2IX3 A;  2Z8L A;  1I4P A;  3MEH A;  1EU3 A;  1U4L A;  2DY7 A;  2QEJ C;  4A3B B;  3NUC A;  4NKL A;  1SJH D;  3HEJ A;  1SJE D;  1DM0 B;  2KEC A;  3KLR A;  5G3L D;  3H0G B;  2CW0 C;  5EPJ A;  2JEB I;  3X3M A;  3RZO B;  1HRJ A;  2PW7 A;  4F87 A;  3HG9 A;  2MPM A;  1HCZ A;  4FO2 A;  4ZRZ A;  3OPO A;  1FNW A;  2N55 A;  3BDO A;  4A3K B;  2F0U A;  5T1G A;  5C5M A;  1V1O A;  2TSS A;  1WCM B;  2MJ8 A;  3NK9 A;  2KQ3 A;  3J7A V;  1IKL A;  3RD4 A;  1Z6H A;  5EKI A;  3DWQ A;  1C4Q A;  1UEA B;  2AWO A;  2IJ0 A;  1JOQ A;  2L1B A;  2RA4 A;  3TDQ A;  1WVL A;  3BYT B;  1RCV D;  3S16 B;  2FIN B;  5M5Y B;  2VB2 X;  2B2V C;  1GUS A;  3MXG A;  1JWU D;  3F2U A;  2DY8 A;  1WTR A;  4H44 C;  1BQQ T;  2B2V A;  3IKJ A;  1Y1W B;  3D31 A;  2EYL A;  1LTS D;  4KV6 A;  4CJ2 C;  2M00 A;  2O5I C;  2ZXP A;  4IFD I;  3OIP A;  5FLX E;  4OO1 I;  2YYZ A;  2WKD A;  3QIA A;  1HPC A;  4DN4 M;  1S5F D;  3VR6 A;  1HTP A;  3NXW A;  3ONA B;  2FFK B;  3JAM E;  2F0O A;  1PTO F;  3NPP A;  4KTA A;  3VYR A;  1PTO H;  5IT9 L;  1Z47 A;  3TP7 A;  2H4O A;  3SDZ A;  2KOL A;  4FP5 D;  3DM1 A;  4J1M A;  4XT1 B;  2WII B;  1SND A;  3KK7 A;  2J7Z A;  4CKB A;  4X3S A;  1LTI D;  1X32 A;  4C3J B;  4HTH A;  1KAB A;  1BXT A;  4PNY A;  4ZYS A;  4ZAI A;  4B08 A;  1AEX A;  3KBX A;  5ELC A;  3FPU B;  1H9S B;  3NSW A;  4O1N A;  3K58 A;  2FMM A;  1JR0 D;  1H9S A;  2EY6 A;  4MIU A;  5C0X G;  2KCC A;  1A2T A;  1Q90 A;  4MHE A;  3N6R A;  1B9M A;  4XT3 B;  1EU4 A;  5K36 H;  3LWE A;  3GTJ B;  3AMU A;  3ND8 A;  4BWG B;  3HGB A;  4BA2 I;  3WOE A;  4WOR A;  5C3W A;  1HTL D;  5C4J B;  2XSC A;  1OXX K;  3SVM A;  1STA A;  4KY7 A;  1TS2 A;  4LK1 C;  4BA1 I;  5CYU A;  4UAI A;  3GTL B;  3URY A;  1V43 A;  3K5O A;  2A6H D;  5CV9 A;  1Q1E A;  3GQB A;  1LV9 A;  1SFO B;  5IGB A;  1CZW A;  1IHZ A;  1BCP D;  2F0M A;  2NBF A;  1K8O A;  4BS9 A;  2Z4H A;  1CM9 A;  4DAY A;  1TS5 A;  4K6L A;  1QOH A;  2PQE A;  4X3K A;  3BG3 A;  4FXK C;  2FJ2 A;  1ESR A;  3GTG B;  2R93 B;  1EYD A;  1HA5 A;  4PMW A;  3K5M A;  1WD1 A;  5EGT A;  1SE4 A;  3DUZ A;  3GTO B;  1TWG B;  1EY8 A;  2L5T A;  2CVR A;  2WB1 B;  4I65 A;  4KY5 A;  5JOB A;  3QB3 A;  1ET9 A;  3OIQ A;  4IUU A;  1L0X B;  3TBI B;  1T5X D;  1E0B A;  3S1M B;  4RCO A;  5C4Z A;  1XTC D;  2L11 A;  3M4Y A;  3QG1 A;  1MSH A;  3PO3 B;  3EFX D;  3TSS A;  2DNC A;  5M3M B;  4LMQ D;  4KMU C;  3PUY A;  1GHJ A;  4ABN A;  2EJF C;  3S14 B;  2K32 A;  1S5B D;  2RSO A;  2D2C C;  4RFB A;  4H7B A;  1DYQ A;  1VF7 A;  1Q1B A;  2NWG A;  1EY4 A;  1PTO B;  2RDF A;  2F3W A;  3D6C A;  4FVM A;  2E2J B;  3J80 E;  1DCZ A;  3H09 A;  3OW7 A;  1R4P B;  4G7H C;  3H94 A;  3EQL C;  1LAB A;  2QDB A;  3NTH A;  4A3M B;  5FKA C;  3MXU A;  1JOR A;  2XVS A;  3VR4 A;  5TSS A;  1TVX A;  4HCS A;  4L63 B;  3I4M B;  1YNN D;  2A6H C;  1QWY A;  1ROD A;  4C1N I;  3ERQ A;  5KIX A;  1LTT D;  1BCP F;  2IX0 A;  1FD7 D;  4QCL A;  5FO7 B;  4XYQ A;  2SOB A;  3K5L A;  3PUV A;  4Y7N B;  3ITP A;  4K2K A;  2SDF A;  4K5W A;  1BR9 A;  1IL8 A;  1U9R A;  4IUR A;  4K6D A;  4G7Z C;  2A68 C;  1A3T A;  1IW7 C;  3NQT A;  1RKN A;  1SEB D;  4IN3 A;  1FYC A;  5DAU A;  1D5X C;  4NW2 A;  5HUR A;  1XWE A;  2F1M A;  2XWJ B;  1WD0 A;  2RKS A;  3VYU A;  1O80 A;  2A6E C;  3L7Z C;  5G3L F;  1FNV A;  4F8M A;  4EGV A;  5A2Q E;  2NVY B;  1WTW A;  4RAU C;  1A3U A;  5EJW A;  3GTM B;  5I9P A;  2WAQ B;  4KD3 A;  3NE5 B;  2BE5 C;  1CT1 D;  1F9P A;  3SXH A;  2N88 A;  3E6Z X;  1D1I A;  4RA8 A;  3E5S A;  1CFM A;  1U4M A;  3IFD A;  2F0J A;  2K28 A;  3BZD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...