1A3UA

Staphylococcal nuclease, cyclohexane thiol disulfide to v23c variant
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
135
structure length
134
Chain Sequence
LHKEPATLIKAIDGDTKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nuclease
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Comparison of straight chain and cyclic unnatural amino acids embedded in the core of staphylococcal nuclease.
pubmed rcsb
source organism Staphylococcus aureus
total genus 32
structure length 134
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1998-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1a3uA00
4K14A 4ZUJA 1EYAA 2RKSA 1A2UA 3P75A 4KHVA 3E5SA 2KQ3A 4K5XA 4KTAA 3T13A 4B9WA 4EQPA 4TRDA 1SNQA 4ID6A 5I6WA 5IGEA 5KGUA 5IGFA 5IOCA 3TMEA 5J22A 1SYCA 4RKLA 5I6YA 5IGCA 2F0LA 3MHBA 3OSOA 1KDCA 4KY7A 3EROA 2F0UA 5CV9A 3SK8A 5KRUA 1NUCA 1A3UA 5E3FA 1SYEA 4QMGA 5DEHA 1EY7A 3ITPA 3VA5A 4HMJA 2EYMA 4J1MA 4G57A 5NUCA 2LKVA 2F0OA 2EYPA 3D4WA 4J6HA 1F2ZA 2EYFA 5KYIA 1NSNS 4H7BA 2EYOA 4PMCA 2NUCA 1SYFA 4ZQ3A 4EVOA 3QOJA 3NK9A 5IIFA 1SNPA 4KD3A 1JOOA 1U9RA 4ME5A 1KDBA 2EY6A 1TT2A 2F0WA 2F3WA 3MZ5A 3TP6A 4N9TA 4F8MA 2F0VA 3TP5A 1EYDA 1EY6A 3MVVA 4K8IA 5I9PA 4RKBA 2F0EA 3PMFA 2HQEA 3MXPA 4K5VA 5CGKA 3D8GA 4NMZA 5C4ZA 4K5WA 1EY4A 4IZ8A 1EQVA 1KAAA 2WACA 4KJOA 5J1ZA 3RUZA 3BDCA 3C1FA 3S9WA 4HTHA 3OMGA 3R3OA 2OF1A 3HZXA 3NUCA 3OWFA 5E1FA 3V2TA 5KEEA 5HGTA 2EYLA 3ERQA 2F0IA 2EYHA 2EXZA 3SK4A 3QB3A 1SNMA 3H6MA 5C4HA 5IGBA 1ENAA 1IHZA 2SNMA 4ODGA 1SNDA 2O4XA 3BDLA 5EKKA 4EQOA 5HURA 1EY0A 1II3A 4K6DA 3EJIA 4I65A 4E6IA 3P1HA 2RDFA 1A3VA 5C5MA 4PMBA 5DAUA 3NXWA 4IALA 4KY5A 5K5PA 2EY2A 5J39A 3NQTA 3HEJA 3EVQA 3NHHA 5C3XA 5EGTA 1F2YA 2F0SA 3MEHA 4KD4A 4KJNA 4N9PA 5ISRA 3QOLA 5F2DA 2EYJA 2F0DA 4WORA 2F0JA 2F0TA 4LAAA 4K2LA 1A3TA 1STNA 2EY1A 4NDXA 4S3SA 5CV5A 5C3WA 1STHA 4DU9A 4R8NA 3DHQA 5IODA 2RBMA 4IUNA 5CV7A 2KHSA 2F0GA 2PZUA 2SNSA 5EKLA 3SR1A 3U9OA 5IGGA 2PQEA 3C1EA 4HMIA 1STGA 4NKLA 2EY5A 1TQOA 2PW5A 5CV4A 2F0QA 1JOQA 5JOBA 2PYKA 3D4DA 4K8JA 4YIJA 5C6AA 1SNCA 1STBA 3TP8A 2F0PA 5IGDA 1KDAA 5CV8A 5I9OA 1EZ8A 4DF7A 3SK5A 5M9OA 2PW7A 5JAVA 1STAA 4OL7A 3SK6A 4WRDA 2F0KA 3OMCA 4ZUIA 1EY5A 2F3VA 5CC4A 2F0HA 4KY6A 1ENCA 1TR5A 1AEXA 1SYDA 1EY8A 2OEOA 2QDBA 4K2KA 1STYA 5C5LA 1F2MA 1JOKA 3DMUA 2M00A 1KABA 3NP8A 1EZ6A 1EY9A 1SYGA 4QF4A 5CV6A 3SHLA 3T16A 2PZWA 4DGZA 5KIXA 1JORA 1SNOA 4NP5A 1EYCA 2F0FA 2SOBA 1SYBA 4EQNA 4DFAA 4B9XA 4MIUA 5CR3A 4PNYA 2PZTA 1RKNA 3SXHA 3TP7A 4KV6A 2ENBA 2F0NA 2F0MA 2OXPA 1A2TA 4QB4A 3LX0A 4F7XA 3D6CA 5KYLA
chains in the Genus database with same CATH superfamily
1OXXK 2R7FA 3DLLA 1HNXL 5K36H 1VQ9A 1L0YB 5KGUA 3BZKA 3VDYA 3GTQB 5M3MG 3M4OH 4TSSA 4B3RQ 3EN2A 4DV5Q 3OSOA 4KY7A 3GTOB 1AZQA 5D3DA 2ZTDA 5DEHA 2RQXA 2B2TC 2IHEA 3CHBD 1X56A 1PH5A 4H7BA 2QEXA 1TWGH 2TSSA 3BG3A 1KL9A 1PH4A 3EFXD 2PCFB 2F0WA 1QG7A 1VQOA 4KN4C 1S4ZA 3TP5A 3CPWA 1SE8A 4OELB 4CJ2C 4IZ8A 2JYOA 3BDCA 1HR0W 2OTLA 4DV5L 4KHPQ 1KRSA 4GS3A 1JWSD 4OWWB 2H1EA 2VUMH 1BKBA 1IKMA 5EKIA 2K33A 3J80E 1A3VA 3ER0A 3W5OA 3GV6A 1BR9A 4PMBA 4XTCS 3UDIA 4IALA 3M85A 5J3BA 3I70A 1LT4D 1QILA 1WCMH 2F0TA 4H13C 3T4AC 2QGQA 4EX5A 3IFDA 2UUBQ 3HOYG 4KHPL 2VNUD 2CH4A 2D9UA 2DNEA 3CCMA 1JOQA 1S40A 2K7VA 1RTNA 4OWXB 4G7ZC 3PUWA 1STAA 4JOIC 4A3MB 1EYGA 5ELDA 1BCPB 1ENCA 3GD7A 4YY3Q 1BBXC 5EPLA 1CTMA 2B63G 2M00A 1Z47A 3A7LA 4IURA 5KIXA 3QJYA 2B8FA 4DXFA 3OPOA 5ELNA 1TWCB 1EYCA 2H4OA 3A7AB 5EBDA 4A3GB 1TS2A 2XSCA 4PV1C 3H15A 3A54A 2E2IH 2YTYA 2R61A 5KYLA 4L6TB 4ZUJA 4RMFA 4IFDH 1Q90A 3OHXC 3UDXA 2JA7H 4HSPA 2YV5A 4DR2Q 4J8QA 4C1NI 4YY3L 3CF5A 4ULLA 4GN3B 4ZYSA 4A3JG 1K8GA 1KDCA 1ESRA 2C35B 3R2TA 3KFUA 4DNIA 1C7YA 4QCLA 1EOVA 2PMZE 4OHJA 2WV6D 4XDXA 1JJCB 2NWGA 4QQBX 1VS0A 1JOOA 1A8VA 1VQLA 1TWAH 4LF8Q 3TP6A 1WTXA 3Q0AA 1VQCA 4RKBA 3KOJA 4AIMA 2BH2A 4BY7B 5C4ZA 4DR2L 4LMQD 2JA8H 1A62A 1E2ZA 1VQPA 3NSWA 2VB2X 1GUOA 2R93H 4OIKA 1I3QH 1YITA 3T56B 1ENAA 1ICFB 5HURA 3HFZB 1Q1BA 3N52A 4IO9A 4GLXA 2HCIA 2EE1A 3P1HA 2L4NA 5FJ8G 2QW7A 4LF8L 4HJ5A 4A3IH 4BBSB 3F2UA 3MXNB 4A3LH 2O5JC 1PDQA 1PH8A 3EVQA 4JBWA 3VR4A 1IBMQ 1F2YA 1EOTA 2EXDA 4IFDI 2VZAA 3BYYB 5IY0A 2B2UC 1I6HH 1PH2A 5I2YA 2PI2E 4DU9A 1WD0A 4IQZA 1EIYB 3U58A 3I4MG 2CWPA 3RZOB 1GO3E 1QZHA 3S1QB 4OO1H 1PFBA 1A63A 1F9QA 2VY3A 2KCTA 2K5WA 3NPPA 2E76C 2NVXB 2WP8J 3FPUB 4K2KA 2K04A 4JI1Q 1QVFA 1AFPA 3NP8A 3VR3A 4LJZC 2D62A 4GKKQ 1VCIA 3I91A 5FO7B 1RKNA 2A73B 1SXTA 4MN3A 3ND9A 2FHTA 1BF4A 1KAWA 3RLOA 3T1YQ 4UDUC 3C3LA 1V9PA 1N34Q 4DV2Q 3SVMA 1OTCA 5IGEA 2K01A 2WFWA 4QY7A 4GNXC 4DR6Q 4JI1L 1VDZA 1I5FA 1ILQA 1J8IA 3UDGA 1DOKA 4GKKL 4C3JG 1X3QA 3H3VI 2ZXRA 2BH8A 4DR7Q 1S5ED 1F9PA 1NJIC 1F2ZA 1EWHA 4RCOA 3P20A 5KYIA 4X3KA 3T1YL 4HIDA 3NQIA 1EIFA 1TT2A 3MZ5A 1N34L 4DV2L 4IUVA 1GUNA 1BCPF 1CI3M 4OO1I 2BA1A 4JI7L 3E9IA 4GOPC 2RF4A 2WACA 1HTLD 4DAPA 5IP7H 3DWQA 3PUZA 4DR6L 3K58A 1CM9A 5IYBH 2EYHA 3J81E 1Y1WB 4DR7L 1X3FA 2V4DA 1D1IA 1WFQA 4GN4B 4IPHA 4OONA 3QG1A 2DY7A 1TWFH 2E75C 5LMNQ 4C2MH 4FP5D 2NVYB 1KQSA 2YYZA 3HOUG 4JI2Q 1WTVA 4OWTB 3RN2A 1J6QA 4NDXA 4S3SA 1NMGA 3FEWX 4FXKC 2PPBC 2XVSA 2RBMA 1DYQA 2R3ZA 2F0GA 5C4JB 1PZID 1I6VC 5IYDG 4IOCA 1TQOA 5CV4A 1EEFD 2Q2HA 2OQ0A 4A3CH 1DXMA 2ASBA 1FD7D 4BBRH 5I9OA 1VQ6A 5JAVA 2IY5B 3N6RA 1SAPA 3CKIB 3SEBA 4JI2L 3KF8B 3I4LA 1EY9A 4ZAIA 1N9WA 2PZWA 1Y14B 1CSQA 3FKIB 4DFAA 2KHIA 1XJVA 5M5YB 2PZTA 2Z1CA 3I72A 1PH7A 3J80c 1DGSA 5FOBB 2K5VA 1A2TA 3D6CA 1HNZQ 2AQ2B 4M1UB 4LFCQ 3URYA 4A93G 2IHFA 1HUMA 1JWUD 1Q3LA 2HCCA 1PLFA 3TMEA 1H9MA 4CKCA 5EJWA 3G4SA 5IWAL 2KJXA 2M2LA 2D0PA 3HOWB 1PYWD 3VA5A 1NTGA 2MHVA 3G6EA 1LTSD 5DM63 5T1IA 1PRTB 2E2JH 1PTOC 2A6HC 1HNZL 4C3HB 4B3TQ 2YU9B 4X3SA 1EQRA 4K8IA 1FYCA 1G6ZA 1HZBA 1X55A 1U4PA 2C9OA 4K5WA 4A3BB 3I4NG 1KRTA 1EWCA 1K73C 2QEJC 1TVXA 3ZJYC 4HAEA 2NZHA 1GM5A 4LK1C 4C3IH 4RAUC 3W2DA 1SE4A 5A35A 3EIVA 3VYRA 4XYOA 3HOZH 3A55A 1WTRA 1N33Q 1K83B 4E6IA 2LXKA 2RDFA 4QJFA 4YWLA 3CCEA 1EUJA 4HJ8A 1XYIA 4BS9A 5C44B 3L0OA 4LFAL 1Y1VH 3A5UA 1HHVA 4DAMA 1Z7TA 4X62Q 1FR3A 2NVQH 2BA0A 5M3FG 1K3BC 2FJ2A 5IODA 3KLWA 2A6EC 3NENA 4IUUA 1G6PA 4KKUA 5JEAJ 3HOXH 4A3EH 3CCRA 1N33L 1XMOL 3K5LA 3H3VC 1H9SB 1SEBD 4R9WA 3H0GG 3J7AF 1KNEA 1UUPA 3HOXG 2RCNA 3SK6A 4WRDA 2F3VA 1HR0Q 4RWSC 1NE3A 2OEOA 3T1HQ 1HQRD 1X32A 5C5LA 1JOKA 5CV6A 4X62L 3TS0A 3RLFA 2Q8IB 4UP9A 3GTMH 2UXDQ 1IYUA 3MAQA 5HGQA 2V1CC 3M4PA 2Z0SA 3FPPA 3GQBA 3S16B 1KLGD 3TZDA 1SNQA 2F4IA 3PO2G 5IOCA 1HR0L 4A76A 5I6YA 3EROA 3KBGA 3IRBA 2B2TA 3KLSX 1YIJA 5NUCA 1IYVA 2JA6H 3T53B 1I94Q 3EQLC 2UXDL 4HN7A 3X3MA 4DK3C 1DM0B 2Q2UA 1BVSA 3TSSA 4WJWA 2KVMA 2L15A 4RG1A 1SMXA 5C3EG 1YJ9A 1E0BA 4O1NA 2MPMA 3ND8A 1LTTD 1T5EA 3BVGA 5JVG3 1GD7A 5A2QL 2KCMA 1JE5A 2HT1A 3ERQA 2R7ZG 1K8MA 4U673 5M5XH 4FXGC 2VW9A 3H91A 1L0XB 1PTOD 2A6HD 1HZ9A 1I94L 3HP3A 5TSSA 1O7YA 5C4XB 2L0CA 1GHJA 3GP7A 4L63B 5DAUA 3PUYA 1VQ8A 2RDGA 3CRKC 1RD9D 1Q81C 2KENA 5DLQE 3NHHA 5FLXL 4OXPA 3S17H 1D7QA 5CORA 2BDNA 2HDMA 4BY1B 5C0XJ 5H1SE 3V96A 2E2HH 3FMCA 2B2YC 4JCVE 1PRTF 2KHSA 4PZ7A 1I4RA 1WD1A 3I4OA 1JCKB 1W2BA 3S2DH 3TP8A 3UE1A 4JOIA 2XNAC 2JA5B 1Y8NB 5T1GA 2Y0SB 2VQFQ 1VQKA 2B2VC 1AEXA 3OIQA 4DK0A 4FF3A 2KUMA 2X69A 2A6ED 1SBBB 1S5BD 1JORA 3J81c 4ZK9B 5CBAE 1SYBA 4MIUA 2E2DC 1XNQL 4R4OA 3HOVB 3S1NB 1L2FA 3F8TA 4YWMA 4X66Q 1M8AA 3T13A 1VQBA 4TRDA 3S15B 3K6OA 3W1BA 3M7GA 4A3FB 2IX1A 1HA6A 3PO3B 1SYCA 1EFID 2NN6G 3L2PA 3GTPH 4U68A 1BUVT 3J7YW 4A3DH 1JWMD 1SYEA 1TY2A 1BQQT 2SEBD 3U9SA 3S14H 3D4WA 4B08A 1OXSC 1C4QA 3GTKH 3H09A 4A4IA 5ELEA 3PUVA 4LF5Q 4KD3A 1OXTA 1LO5D 1YHAA 5LL6X 2ZJRA 2L11A 4N9TA 5M3MH 4TKOB 4X66L 1LTBD 2I07B 4A3MG 2F0EA 2A69C 5BN4A 1CHQD 1ZEQX 3E0EA 1L1OA 4A3KB 2ZT9C 3IKJA 2Z8LA 3CCSA 1O7ZA 2KEEA 3BZDB 1HA5A 1SFOH 4FYDA 5GQOA 4A3GG 1TXYA 4IPGA 1YNJC 2F0IA 1U4LA 3SK4A 1B1ZA 2R92B 5EKKA 1CUKA 3JAML 4FF2A 5L37A 2F4VQ 4BXXG 4QGUA 2JJQA 4JG2A 3S1MB 4IPDA 1B9MA 4AQYQ 5K5PA 5J39A 1ASZA 2EPBA 1Y69U 2B2UA 3VR6A 2JA9A 4LAAA 1QJOA 4B3RL 5CV5A 2JQOA 3K7UC 1ASYA 4RHRA 1DONA 1HJPA 4NXMQ 1RODA 3CQZB 3RR5A 4XIGS 2A1AA 2XWJB 2HUGA 5C6AA 2F1MA 2CFMA 4LNQA 1E2VA 1W3SA 3GTLB 2PNRC 5GAGC 4DF7A 1U5KA 4XQJA 4AQYL 1BBWA 4BY7G 3EA6A 1R9TB 3HOYH 1KHIA 2FMCA 2QCPX 1N36Q 4QUCA 2ATWA 2I5MX 3RZDH 1I4XA 3K5NA 3S2HH 3CW2C 3J7AV 1BCPC 1PVOA 1B70B 2ENBA 2N3SA 1BNZA 1VQGA 3QWNA 4BBSG 2Z9HA 4EQPA 2JEBI 1FNUA 3RD4A 2I0QA 4JK1C 4JBKA 2JE6I 4GNXA 2B63H 2Q8RE 1YJWA 3K5OA 3VR5A 1LTRD 1PH6A 3A8JE 1IL2A 1VF5C 1N36L 2HDLA 3BU2A 3GO5A 4UAIA 2NZOA 1NUCA 2LS01 3CXCA 3GTJB 4J1MA 2UUBL 4A3DB 1HZCA 2MP1A 2KCNA 4MHEA 2DGYA 2NVTH 1WVLA 1U9RA 1E24A 2F3WA 4F8MA 4GOPA 3KJOA 4A3JH 5CGKA 5BN3A 1RCVD 1Q82C 2WAQB 4HTHA 2B3GA 3KLRA 4FO2A 1K0SA 3OWEB 1SMYC 3OWFA 3PUXA 5KEEA 3M4OB 2EYLA 3RN5A 2QKIC 2PQAA 3D6WA 4R4QA 1ML0D 3LGJA 1O80A 3GTGH 1CA5A 4DR1Q 2KA7A 4OGQC 4PQXA 2EIFA 4K0KQ 1T5XD 1GKHA 3Q6SA 4IFDJ 2A69D 2AHOB 1GUWA 2A19A 2VXWA 4ZLTF 1TWGB 2EY2A 3HEJA 3KK7A 1PFNA 3A0JA 2ID0A 1V43A 5ISRA 1G91A 2NZ1D 2F0JA 1YNJD 2AQ1B 3M3YH 1LTLA 4LFBQ 1OO9B 4DA2A 1A0IA 4R8NA 4Y7NH 2PQEA 1JB7A 1VF7A 3AEVA 5FJ8H 2F0QA 3VYSA 1UNSA 1X65A 2UUAQ 1M4VA 1UEAB 1I50H 2RDHA 3BVZA 3E3XA 5KRUA 2VUMB 5CC4A 2I5LX 1MJCA 2PI2A 5FLMG 1EY8A 3K81C 4L5QA 1HZAA 5ELCA 4R8IA 1OXUA 1B2TA 2N49A 4LF4Q 1IW7C 3I4MH 4LFBL 1WCMB 4G4KA 1Y1WG 2Z4IA 4B9XA 1TWHH 5COYA 3LWUA 1SDFA 2OXPA 3PQIA 1H9JA 1PH3A 1L1OB 4LUZA 1KXLA 2UUAL 3IAYA 2K5DA 2G9HD 2G9DA 3QIAA 1YJNA 1VQNA 2A5HA 4HR7B 2JK8A 2XWBB 3HG9A 1D2BA 3OTOQ 1LV9A 1YVCA 1IBML 3OOCA 5M5WH 1A3UA 1BCPD 4CJ1B 1QB5D 4QMGA 3F2BA 5IT9E 4LF4L 2E8GA 1XPRA 2HQLA 4YHHQ 1OXVA 2EYOA 4ZQ3A 3WOFA 2EY6A 2OQKA 3K7AH 1E7ZA 5I9PA 1VQ7A 3NELA 4HJ7A 2E2IB 2E74C 5EQ0A 4R4CA 4DNRB 1YNNC 2DUDA 3KF6A 4C3JH 3OTOL 1V1PA 4P71A 1LTAD 3MC0B 4XYQA 2JA7B 5I2XA 2ZTCA 1D5ZC 1TIID 1BDOA 1JQYD 2GN5A 2N88A 3FKIG 2R6GA 3D4RA 1I4HA 4XT1B 1SNMA 3CAMA 1SNDA 2O4XA 4YHHL 3P7JA 3AB9A 3D31A 1GUGA 3CCQA 3NBHA 1UE5A 3W3AA 3I90A 2K6AA 1YHQA 2MGSA 3V05A 1EIHA 2UXBQ 3NXWA 1DZ1A 2B2WC 3PIO3 4ME3A 1SJHD 1R4PB 1CKOA 3JC66 1TWAB 5C3XA 3MEHA 2XIWA 5F2DA 1UWVA 4WORA 1SMYD 3HOWG 3AMUA 4JI5Q 1AE2A 4OIJA 1STNA 2F03A 3M4YA 2RA4A 1CKNA 1ESFA 2JA8B 2SNSA 5EKLA 4CJ0B 3AU7A 5IGGA 3A8IE 4HMIA 1KC8C 1ENFA 2R93B 3I55A 2OTJA 1H9KA 1I3QB 4F88A 2F0PA 5JPNC 4C3HG 3HOUH 3U4VA 2UXBL 4OL7A 4G7OC 4A3BG 3CCUA 1PTOH 2BCOA 1M90C 4A3IB 1JC7A 2MUYA 3M4QA 3AFQA 1SYGA 3QR8A 5IYDH 4JI5L 2FMMA 4JI0Q 1I6HB 4OX9Q 1W6KA 1QNKA 2RSOA 3TZUA 4I7AA 4K14A 1EL0A 5C44G 1BXTA 2UXCQ 5LMNL 2L1BA 5GAHC 2EJFC 1SN8A 1IW7D 1A6XA 1H9RA 5IGCA 2OT2A 2N8NA 4B3SQ 4KKTA 5CV9A 2J7ZA 5E3FA 1HUNA 1NR4A 3FDTA 4DK6C 1KLUD 4JI0L 1K9MC 2LKVA 2EYPA 4J6HA 2NTTA 1NSNS 3ONAB 3FHWA 4OX9L 2K32A 3QOJA 4DV7Q 4A93H 4JYAQ 1MJEA 4APVA 3ICEA 4LUVA 5I6WA 2F0VA 4LWCA 1PHJA 1PRTC 3H3VH 1O7IA 2H5XA 4NPSA 4FXDA 3S9WA 2CKZB 4HSVA 3JAMi 1PXUA 4AH6A 1LUZA 5JPMC 4B3SL 1VQMA 2IL8A 2C5CA 5IGFA 1WTWA 1F9RA 1U4MA 2K1BA 2RHQB 4K6DA 4OEMB 4RFBA 4I65A 3KDFA 1LT3D 4CKBA 3VYTA 4DV7L 3G7LA 4P75A 4JYAL 3PF5A 2N55A 1PZJD 3J80L 2AWOA 2LFNA 3I4NH 1P8LA 1EIGA 2HIVA 1MSHA 1YNND 1B4OA 4LFCL 4ILWA 5EGTA 1CQVA 3D3RA 5LHY1 4NB3A 2VB3X 1IKLA 1QUQA 2I5HA 1VMCA 4N8FA 3PIP3 5LL6S 3ZYYX 2RVLA 4DUYQ 4PG3A 4R4IA 2JN4A 3HKSA 1SR3A 1EEID 1MI2A 1TU2B 2Y0SE 2ZJQA 1Q8IA 1LM0A 2PYKA 4K8JA 1F9SA 4PZ6A 4UP7A 3R2IA 3PCOB 4B3TL 2B2VA 1S3OA 3DWAA 2DN8A 2K75A 2X6LA 4KY6A 1SE2A 1VQHA 5M3FH 1TWFB 3UI2A 1XPUA 4JPBW 4RGOS 3OW7A 3T16A 4C2MB 1NCVA 1Q12A 4DUYL 1QE6A 4DUZQ 4Y52H 1B50A 3S1RH 3H0GH 4Z9CB 5E7NA 4POGA 4DR3Q 1UE6A 3WWVA 2CCZA 5C4XG 1R4QB 1AN8A 4L8JA 4EQ5A 3PIOA 3G71A 4DV1Q 5JEAG 4KTAA 4XXEA 4CKEA 4BBRB 2K5HA 2YTVA 2BOSA 1HRJA 4BY1G 2K5NA 1PYBA 3R93A 3HKZB 5G3LF 1EY7A 4JI6Q 4O0AA 4HMJA 4ZRZA 5FKAC 3NTHA 1LACA 4MTKA 2K52A 3CRLC 1K0RA 4H0LC 2UUCQ 1I4PA 1QNUA 3NK9A 1SRUA 3OYYA 3IFTA 1JR0D 3PO2H 2NTSA 3UDFA 4GZYC 1B3AA 1RF2D 2P5ZX 3I3CA 2JA5G 1LLRD 4DV1L 2HQEA 2ZM6Q 1HXYD 4EGVA 3D8GA 4NMZA 2Y0SG 1CKNB 1X9NA 2DNCA 1F2LA 1E3PA 4P73A 4V0BA 3T1HL 2Z4HA 3K0XA 4NXNQ 1Q8KA 4JI6L 2K28A 1RJTA 1C48A 4AYBB 5FK9C 4FF1A 3MXUA 2UUCL 3HOVG 4HIOA 2EDGA 5C3EH 1X3EA 2ALYB 3TS2A 1PRTD 4DK1A 1G291 1ZXTA 3NQTA 2ZM6L 2E2JB 2BDOA 4A3FG 1EU4A 3PO3G 3I4NB 1B44D 1YEZA 5GROA 2OWOA 3MA2B 2Z6KC 1FL0A 1UE7A 5IT9c 2R7ZH 1A3TA 1G2SA 1A15A 4V190 5AFWA 4NXNL 4GLAC 5KNBA 1JJGA 4CDCC 1RDPD 5JOBA 3L3OC 4C3IB 3HS0C 4GN5A 4MTNA 4QUFA 3GTQH 3HOZB 4I7ZC 4IJHA 3TRZA 4J15A 5BN5A 2A74C 2M9VA 1EY5A 3GTOH 4A3KG 3G48A 2CQOA 4P72A 4LF6Q 4HIKA 5DM73 5CYUA 2EZVA 1Y1VB 1SNOA 2SOBA 4CHTB 5D3IB 2R92G 4KLKA 3SXHA 2NVQB 5C0XG 3B6YA 3Q8DA 2XRQD 4K6LA 4QB4A 3X3NA 4A3EB 3HOXB 4NW2A 1V1OA 1EYAA 4HJ9A 1SLJA 2RHSB 2ZTEA 5KNDA 1PV4A 4ABNA 1HNWQ 2K5QA 3WDNA 2F0UA 2CQAA 3PIPA 1I4QA 1G8ZD 3BDOA 2RSNA 3MEFA 4G57A 1L0WA 2OCEA 3CC7A 4IUTA 4JV5Q 3D0FA 2L55A 2NUCA 3GTMB 2WAQE 4ME5A 4CDFC 4GLVB 5J22A 2ES2A 1XNRQ 2NN6H 1CZGA 1VQJA 2DY8A 2VQEQ 1H95A 4KHZA 1KAAA 5J1ZA 3RUZA 1PTOF 1Q7YC 3C1FA 4BA2I 1HNWL 2VQFL 1G2TA 2OF1A 3HZXA 5E1FA 1SSOA 4IUPA 3TDQA 4JV5L 3J81L 3CC4A 5JJKA 5ELBA 3ULJA 3I73A 1VQ4A 4A3MH 1GVPA 2UU9Q 1NMFA 3BVMA 3PGZA 5C5MA 2CH4W 4HEDA 2JA6B 4P2CB 4TQUS 3I2ZA 1XNRL 4N8X1 1Z6HA 2VQEL 4A3GH 4DAYA 1TWCH 4ZKCB 1VQEA 3E6ZX 2LXJA 3MXNA 1N32Q 1V1QA 4K2LA 3I7FA 1I4GA 3J81j 2ZJPA 1IBKQ 3U9OA 4BXXH 1HFNA 2ICEC 3CPFA 3TEHB 1B53A 2CHBD 2FXQA 2WKCA 2UU9L 5M5XB 4LF5L 2WB1B 3U4ZA 1FJGQ 1ILPA 3MFYA 2F0HA 1GUSA 2KCCA 1SROA 1N8RC 3CCJA 2NN6I 5IYCH 2WAQG 5K36G 1E22A 1N32L 4QF4A 3SHLA 1D6EC 4DGZA 5D14A 3S17B 2F0FA 1IBKL 5IYCG 3TP7A 2QA4A 2E2HB 4LUOA 1LYLA 1CT1D 4XQNA 1XX8A 4F7XA 3LX0A 4BY7H 3OIPA 1CQFA 2F4VL 1X3GA 1HCZA 2RKSA 2GVBA 3S2DB 2AMCB 1FJGL 4ID6A 1EU3A 4KKSA 4JVZA 1QVGA 1YBYA 2WINB 1CA6A 1O78A 4DV0Q 1SE3A 2GVAA 3FP9A 4PMCA 1QCBD 4BBSH 4B3MQ 1IL8A 4QL5A 1D5XC 1KDBA 4X65Q 1PFSA 1M1KC 3I56A 2VUMG 1EY6A 4YCUA 4K5VA 4KJOA 2QF7A 1DOLA 3F1ZA 3OMGA 1S5CD 5KNCA 1DOMA 1WCMG 3RZOH 2KBNA 3GTPB 3S1QH 4DV0L 3J80i 3NWSA 4CGYB 4ODGA 2JP1A 4EQOA 3TN2A 3EJIA 4C1NK 4B3ML 1B8AA 3NBIA 3S14B 4HCSA 1PFMA 2B2WA 2NVXH 2JSOA 4XQQA 4HJAA 3GTKB 4X65L 1MD2D 4JW0A 4KY5A 2MNAA 5JVH3 1B7YB 3GV3A 1BBUA 3DWPA 2F0SA 5M3MB 4O2DA 1D8LA 1VQFA 3U50C 4UP8A 3NWTA 1B3QA 2EY1A 3WOEA 5AJ3Q 1S5DD 3DHQA 4IUNA 1UE1A 1WOCA 1SFOB 3ULLA 3E0JA 4DAVA 1X54A 2WKDA 1WTHA 3NE5B 1EZ8A 4M8AA 1K3RA 4ZUIA 3DM3A 2B29A 1XPOA 1CZWA 4IFDG 2EVBA 3OW2A 3K57A 2JA7G 1EZ6A 3RLNA 4QIWB 4KN7C 5AJ3L 3KF8A 5CR3A 4KI0A 2K05A 1HFGA 2F0NA 3MTSA 4DR1L 1KD1C 3W1GA 5EPJA 4K0KL 3AFPA 5FLMH 5EBCA 5M9OA 3E5SA 4K5XA 4B9WA 1JE4A 4CDDC 4ALPA 2DJGC 3TBIB 5JJIA 4FF4A 1CKMA 1JJ2A 1Q86C 1L1OC 1Y1WH 2IJ0A 3SE0A 3A56A 4RA8A 3HOYB 3PV0A 1JT8A 3ITPA 4UPAA 2JA8G 1MKHA 4YWKA 2F0OA 4L5TA 3RZDB 4KK7A 2R93G 3S2HB 5IIFA 1SNPA 2A68C 1GOZA 2MQHA 2NVYH 4DAYB 2AWNA 3STBC 1TS4A 3NTIA 1JICA 2IW3A 1EFWA 4A3IG 3MWYW 4A3LG 5C4JH 4P74A 5A2QE 2B63B 2HIXA 3J7ZC 3NUCA 1TY0A 4BWGB 1Y8PB 2IT1A 2EXZA 4IPCA 3QB3A 1CK1A 2SNMA 2MFIA 4FNFA 3G6JB 5EPKA 3S24A 1J5EQ 2Z6BA 3FVQA 4OO1G 1Q46A 2NVTB 5FLXE 1AP0A 1KNAA 4KJNA 1GUTA 3FKIH 3LNNA 2F0DA 2K4KA 4A3JB 1LABA 5M5YH 3A5ZB 1FGUA 1DJRD 5C3WA 2Q2IA 1VQAA 1S5FD 5CV7A 2PZUA 2J0TD 4RGNA 3C1EA 3HRZC 1STGA 2EY5A 3T51B 2KHJA 1AE3A 1SNCA 3A74A 3NEMA 5IGDA 3E9HA 1QWYA 1X6OA 5CV8A 3GTGB 2XRSD 4JI7Q 1J5EL 3FRPB 3HOWH 1H9SA 4RCNA 2B8GA 1QZGA 4FVMA 2N78A 1CFMA 3AYHB 2KOLA 3DMUA 1KABA 4Q0FA 1XTCD 2A8VA 4IOAA 3VR2A 3M3YB 4C3HH 2YU9H 4KV6A 3EBEA 1CHPD 4Y7NB 2NBFA 1LTID 4GNXB 3L7ZC 4A3BH 3HKZE 1C8CA 4L5RC 1YHBA 4RH6A 3TREA 4RGMA 2IX0A 1I50B 5IE8A 1AH9A 2D5DA 1F77A 1K83H 4CDEC 5IP7G 1KTKA 4POFA 1HTPA 4PMWA 1TS5A 3VA7A 2XN9C 3SDZA 3I4MB 4GOPB 1IYJB 5IYBG 2FINB 4EVOA 5C44H 2IPKD 2AKWB 3NTKA 4IUQA 1Y8OB 3IL8A 3KUPA 1P16A 1TWHB 2PMZB 1XMQQ 3BYTB 1WTQA 2B39A 3PMFA 2NYZD 1DD2A 4AYBE 1EQVA 4X3TA 4X64Q 5GADC 2PQAB 3J81i 1AW7A 2EJMA 5D65A 4WJ4A 1Z9FA 1RHPA 2Q8TA 2BE5C 3KYHC 2CW0C 3UE0A 3JAME 1PA6A 5C4HA 5M5WB 3H6MA 3CCVA 2A68D 3ERSX 3C2PA 1EY0A 3STBD 1HQMC 1K28A 3DXJC 3F2DA 1BOSA 1TS3A 1JB3A 2PNHA 4DR5Q 2K14A 1XMQL 1IBLQ 2G5DA 3C46A 4A3CG 1VQDA 2Z6KA 5IWAQ 3CCLA 4BBRG 5FO9B 4JBMA 3K7AB 2UXCL 3Q22A 4FDBA 4X64L 4TVAB 2L9HA 3CMAA 3HKZG 1VQ5A 4WJ3M 1FNVA 4C3JB 2MO1A 5LMUQ 4C56C 4ZKBB 4X6AH 1E1OA 3S16H 4UY8C 1J9OA 1STBA 2SDFA 5GAEC 1GJXA 1KDAA 2AQ3B 1VMPA 2PW7A 4DR5L 1IBLL 4L5SA 4WFN3 1TR5A 1SYDA 1STYA 2AUKA 1F2MA 4UHVA 4DXGA 2B2YA 2X6GA 3PF4A 2ICIA 2AUJD 1GXDC 3GDEA 4AYBG 4HCEA 4G7HC 5LMUL 2MO0A 2CVRA 5G3LD 3RMHA 4H44C 1S72A 4DN4M 4LFAQ 2ZXPA 3DEOA 2DJFC 2KQ3A 4LW1A 1T9HA 1U0LA 3HOUB 4RKLA 3DUZA 3MHBA 1EWIA 4JI3Q 1RL2A 3SK8A 1XXGA 1HPCA 4JI8Q 1ONLA 1PTOB 4RGTA 2O2LD 1LT5D 1MHWC 2VL6A 3AQQA 4DKAC 4LF7Q 3TQYA 1NNXA 1K8AC 1QVCA 3BS1A 2D2CC 5C4XH 1XMOQ 4R4TA 1ET9A 2D0OA 5JEAH 1LTGD 4C3IG 5ELFA 3HOZG 5DNFA 2JEAI 2XGTA 3KF6B 1EYDA 1V1PB 1SJED 4BY1H 3CU7A 3CMEA 1EY4A 2WIIB 1WTOA 1FNWA 2KEDA 3LWEA 1GHKA 1NY4A 1YZ6A 3M9BA 4JI3L 4YCWA 3Q23A 1Y1VG 2ZXOA 3V2TA 3NBHB 4JI8L 3QO2A 1C0AA 4NXML 4LF7L 1RTOA 4XT3B 5IGBA 1BO0A 5E4WC 4DUZL 2JA5H 3MFGA 2E5LQ 1NR2A 1XTDA 1ZYRC 4DR3L 2EQSA 4A3EG 2O5IC 1MIUA 1NAPA 3BJUA 1MSGA 1PH9A 4A93B 1ET6A 2Q2TA 3H94A 4A75A 5IP9H 3QOLA 5CBEE 2BE5D 2CW0D 4LF9Q 5JJLA 3VYUA 1TKWB 1STHA 3HOVH 2WB1E 5IP9G 3SR1A 3S1NH 4O42A 4JBJA 5ELOA 2IX3A 1HH2P 2PW5A 3D4DA 1ZKOA 4CBVA 3S15H 2E5LL 4JC0A 4A3FH 3PO3H 3R8BA 4MZ9A 1XWEA 1D5MC 2F0KA 3L9AX 3OMCA 1G51A 3SGIA 4HIMA 3KJPA 1MGSA 2IWHA 2QDBA 1IXRA 1WI5A 1PYSB 4LF9L 4NP5A 4IN3A 1K8OA 2I46A 2VS1A 2FFKB 5JJZA 2L5TA 1X3PA 1AZPA 3F2CA 4A3KH 2JA6G 1WJJA 1YI2A 5FLXc 2NB0A 2HHHQ 3P75A 4KHVA 1A2UA 5LMNW 1MBYA 1C9OA 3DM1A 4DNTB 1W6JA 2F0LA 1JMCA 2J4XA 1UEBA 4X3UA 1B9NA 2R92H 2F3IA 1LT6D 5C0XH 2EJGC 5M3FB 1O7LA 2EYMA 2YTXA 5IT9L 3S1MH 3K0YA 2EYFA 1SYFA 1NBWA 4RHSA 3I8ZA 3S1RB 3H0GB 2WB1G 4DPGA 3MVVA 1QOHA 3ULPA 2HHHL 1EQTA 1U4RA 4F87A 3MXPA 3MXGA 4DV6Q 1ICWA 5EAYA 3CQZH 3R3OA 5BR8Q 2XTIA 4LF6L 4R1JA 3KLSA 2GA4B 2K03A 3K8AA 5HGTA 3KDFB 3K5MA 1XNQQ 3J7A5 4H02A 2LY7A 4IJLA 4JI4Q 1IHZA 2LSSA 3GTLH 3BDLA 4YCVA 4GKJQ 1VQIA 1II3A 1CSPA 1UAPA 1DCZA 1D1KA 1YNXA 3K80C 2CWAA 4BA1I 3KBXA 1STEA 1R9TH 4DR4Q 3A8KE 4PZ8A 3HGBA 2KECA 3K59A 2F52A 4ZCKA 3Q24A 3PO2B 1QUQB 4KD4A 4DV6L 4N9PA 1PZKD 2EYJA 3DEPA 5HY6A 1E2WA 2MJ8A 5BR8L 1RIPA 2JXMB 4DV4Q 2QDLA 1KIXA 2K50A 2HD3A 4NKLA 1WTPA 1PH1A 4JI4L 3O13A 1E1TA 1FVIA 5C0XI 1ZYRD 4DV3Q 3M7NA 4GKJL 4YIJA 1V8QA 3BZCA 4MNOA 2RCFA 3CP0A 1HNXQ 4DR4L 3SK5A 4QIWE 1WYDA 3CD6A 5C3EB 3PSIA 2TMPA 4KMUC 2PO4A 3GTJH 1FGBD 5E4XA 1Q1EA 5CMDA 3RNUA 1PMRA 2QILA 3JAMc 5FO8B 4EQNA 4DV4L 2R7ZB 2L12A 2R7DA 4PNYA 4A3DG 2EOTA 4DV3L 1IZ6A 4Q5VA 2F0MA 5I4DA 2LMCB 1EQQA 3CC2A
chains in the Genus database with same CATH topology
1OXXK 5K36H 1L0YB 5KGUA 3GTQB 4TSSA 3OSOA 4KY7A 3GTOB 1AZQA 5D3DA 5DEHA 2RQXA 2B2TC 3CHBD 4H7BA 2TSSA 3BG3A 3EFXD 2PCFB 2F0WA 1QG7A 4KN4C 1S4ZA 3TP5A 4CJ2C 4IZ8A 2JYOA 3BDCA 1JWSD 2H1EA 1IKMA 5EKIA 2K33A 3J80E 1A3VA 3GV6A 1BR9A 4PMBA 4XTCS 4IALA 3M85A 3I70A 1LT4D 1QILA 2F0TA 4H13C 3T4AC 3IFDA 2VNUD 2D9UA 2DNEA 1JOQA 2K7VA 1RTNA 4G7ZC 3PUWA 1STAA 4A3MB 5ELDA 1BCPB 1ENCA 3GD7A 1BBXC 5EPLA 1CTMA 2M00A 4IURA 1Z47A 3A7LA 5KIXA 3QJYA 2B8FA 4DXFA 3OPOA 4A3GB 1TWCB 1EYCA 2H4OA 3A7AB 5EBDA 1TS2A 2XSCA 4PV1C 3A54A 2R61A 5KYLA 4L6TB 4ZUJA 4IFDH 1Q90A 3OHXC 4HSPA 4J8QA 4C1NI 4ULLA 4ZYSA 1KDCA 1ESRA 3R2TA 4QCLA 4OHJA 2WV6D 4XDXA 2NWGA 1JOOA 3TP6A 1WTXA 3Q0AA 4RKBA 4BY7B 5C4ZA 4LMQD 1E2ZA 3NSWA 2VB2X 1GUOA 4OIKA 3T56B 1ENAA 5HURA 1Q1BA 3N52A 2HCIA 2EE1A 3P1HA 2L4NA 4BBSB 3F2UA 2O5JC 1PDQA 3EVQA 4JBWA 3VR4A 1F2YA 1EOTA 4IFDI 3BYYB 2B2UC 5I2YA 4DU9A 1WD0A 4IQZA 3RZOB 4OO1H 3S1QB 1PFBA 1F9QA 2K5WA 3NPPA 2E76C 2NVXB 2WP8J 3FPUB 4K2KA 2K04A 1AFPA 3NP8A 3VR3A 4LJZC 2D62A 1VCIA 3I91A 5FO7B 1RKNA 2A73B 1SXTA 4MN3A 3ND9A 2FHTA 1BF4A 4UDUC 3C3LA 3SVMA 5IGEA 2K01A 1VDZA 1ILQA 1J8IA 1DOKA 4C3JG 1X3QA 2ZXRA 1S5ED 1F9PA 1F2ZA 1EWHA 4RCOA 3P20A 5KYIA 4X3KA 3NQIA 1TT2A 3MZ5A 4IUVA 1GUNA 1BCPF 1CI3M 4OO1I 2BA1A 2WACA 1HTLD 4DAPA 3DWQA 3PUZA 3K58A 1CM9A 2EYHA 3J81E 1Y1WB 2V4DA 1D1IA 3QG1A 2DY7A 2E75C 4FP5D 2NVYB 2YYZA 1WTVA 4NDXA 4S3SA 4FXKC 3FEWX 2PPBC 2XVSA 2RBMA 1DYQA 2R3ZA 2F0GA 5C4JB 1PZID 1I6VC 1TQOA 5CV4A 1EEFD 1DXMA 1FD7D 5I9OA 5JAVA 3N6RA 1SAPA 3CKIB 3SEBA 3I4LA 1EY9A 4ZAIA 2PZWA 3FKIB 4DFAA 5M5YB 2PZTA 2Z1CA 3I72A 5FOBB 1A2TA 3D6CA 2AQ2B 4M1UB 3URYA 1HUMA 1JWUD 1Q3LA 2HCCA 1PLFA 3TMEA 1H9MA 4CKCA 5EJWA 2KJXA 2M2LA 3HOWB 1PYWD 3VA5A 2MHVA 1LTSD 5DM63 5T1IA 1PRTB 1PTOC 2A6HC 4C3HB 2YU9B 4X3SA 4K8IA 1FYCA 1G6ZA 1U4PA 2C9OA 4K5WA 4A3BB 1EWCA 2QEJC 1TVXA 4HAEA 4LK1C 4RAUC 3W2DA 1SE4A 5A35A 3VYRA 4XYOA 3A55A 1WTRA 1K83B 4E6IA 2RDFA 1XYIA 4BS9A 5C44B 1HHVA 1Z7TA 1FR3A 2BA0A 2FJ2A 5IODA 2A6EC 4IUUA 4KKUA 5JEAJ 3K5LA 3H3VC 1H9SB 1SEBD 4R9WA 3J7AF 1KNEA 1UUPA 3SK6A 4WRDA 2F3VA 4RWSC 2OEOA 1HQRD 1X32A 5C5LA 1JOKA 5CV6A 3RLFA 2Q8IB 2LMCB 1IYUA 3MAQA 3FPPA 3GQBA 3S16B 1KLGD 3TZDA 1SNQA 2F4IA 5IOCA 5I6YA 3EROA 3KBGA 3KLSX 2B2TA 5NUCA 1IYVA 3T53B 3EQLC 4HN7A 3X3MA 1DM0B 3TSSA 4WJWA 2KVMA 1E0BA 4O1NA 2MPMA 3ND8A 1LTTD 1T5EA 3BVGA 5JVG3 5A2QL 3ERQA 1K8MA 4U673 4FXGC 3H91A 1L0XB 1PTOD 2A6HD 3HP3A 5TSSA 1O7YA 5C4XB 2L0CA 1GHJA 3GP7A 4L63B 5DAUA 3PUYA 2RDGA 3CRKC 1RD9D 3NHHA 5FLXL 5CORA 2BDNA 2HDMA 4BY1B 5C0XJ 3V96A 3FMCA 2B2YC 1PRTF 2KHSA 1I4RA 1WD1A 1JCKB 3TP8A 2XNAC 2JA5B 1Y8NB 5T1GA 2Y0SB 2B2VC 1AEXA 3OIQA 4DK0A 4FF3A 2KUMA 2X69A 2A6ED 1SBBB 1S5BD 1JORA 4ZK9B 5CBAE 1SYBA 4MIUA 2E2DC 3HOVB 3S1NB 1M8AA 3T13A 4TRDA 3S15B 3K6OA 3M7GA 4A3FB 2IX1A 1HA6A 3PO3B 1SYCA 1EFID 2NN6G 4U68A 1BUVT 3J7YW 1JWMD 1SYEA 1TY2A 1BQQT 2SEBD 3U9SA 3D4WA 4B08A 1OXSC 1C4QA 3H09A 5ELEA 3PUVA 4KD3A 1OXTA 1LO5D 5LL6X 2L11A 4N9TA 4TKOB 1LTBD 2I07B 2F0EA 2A69C 5BN4A 1CHQD 1ZEQX 4A3KB 2ZT9C 3IKJA 2Z8LA 1O7ZA 2KEEA 3BZDB 1HA5A 4FYDA 1YNJC 2F0IA 1U4LA 3SK4A 1B1ZA 2R92B 5EKKA 3JAML 4FF2A 3S1MB 1B9MA 5K5PA 5J39A 2EPBA 1Y69U 2B2UA 3VR6A 4LAAA 1QJOA 5CV5A 4RHRA 1DONA 1RODA 3CQZB 4XIGS 2XWJB 2HUGA 5C6AA 2F1MA 1E2VA 3GTLB 2PNRC 4DF7A 4XQJA 3EA6A 1R9TB 2FMCA 2QCPX 4QUCA 1I4XA 3K5NA 3J7AV 1BCPC 2ENBA 1BNZA 3QWNA 4EQPA 2JEBI 1FNUA 3RD4A 4JK1C 2JE6I 2Q8RE 3K5OA 3VR5A 1LTRD 3A8JE 1VF5C 2HDLA 3GO5A 4UAIA 1NUCA 2LS01 3GTJB 4J1MA 4A3DB 2MP1A 2KCNA 4MHEA 1WVLA 1U9RA 2F3WA 4F8MA 5CGKA 5BN3A 1RCVD 2WAQB 4HTHA 3KLRA 4FO2A 3OWEB 1SMYC 3OWFA 3PUXA 5KEEA 3M4OB 2EYLA 2QKIC 3D6WA 1ML0D 1O80A 1CA5A 2KA7A 4OGQC 4PQXA 1T5XD 3Q6SA 4IFDJ 2A69D 1GUWA 2VXWA 4ZLTF 1TWGB 2EY2A 3HEJA 3KK7A 1PFNA 2ID0A 1V43A 5ISRA 1G91A 2NZ1D 2F0JA 1YNJD 2AQ1B 1OO9B 4DA2A 4R8NA 2PQEA 1VF7A 2F0QA 3VYSA 1UNSA 1M4VA 1UEAB 2RDHA 3BVZA 2VUMB 5KRUA 5CC4A 1EY8A 5ELCA 4R8IA 1OXUA 1B2TA 1IW7C 1WCMB 4G4KA 2Z4IA 4B9XA 5COYA 3LWUA 1SDFA 2OXPA 1H9JA 3IAYA 2K5DA 2G9HD 2G9DA 3QIAA 2A5HA 4HR7B 2XWBB 3HG9A 1D2BA 1LV9A 3OOCA 1A3UA 1BCPD 4CJ1B 1QB5D 4QMGA 5IT9E 1OXVA 2EYOA 4ZQ3A 3WOFA 2EY6A 5I9PA 2E2IB 2E74C 5EQ0A 4DNRB 1YNNC 1V1PA 1LTAD 3MC0B 4XYQA 2JA7B 5I2XA 1D5ZC 1TIID 1BDOA 1JQYD 2N88A 2R6GA 3D4RA 1I4HA 4XT1B 1SNMA 1SNDA 2O4XA 3P7JA 3AB9A 3D31A 1GUGA 3NBHA 3W3AA 3I90A 2K6AA 2MGSA 3V05A 1EIHA 3NXWA 1DZ1A 2B2WC 3PIO3 1SJHD 1R4PB 5C3XA 1TWAB 3MEHA 2XIWA 5F2DA 4WORA 1SMYD 3AMUA 4OIJA 1STNA 2F03A 3M4YA 2RA4A 1ESFA 2JA8B 2SNSA 5EKLA 4CJ0B 3AU7A 5IGGA 3A8IE 4HMIA 1ENFA 2R93B 1H9KA 1I3QB 4F88A 2F0PA 5JPNC 4C3HG 4OL7A 4G7OC 1PTOH 2BCOA 4A3IB 1JC7A 2MUYA 1SYGA 2FMMA 1I6HB 1W6KA 1QNKA 2RSOA 3TZUA 4K14A 1EL0A 1BXTA 2L1BA 2EJFC 1IW7D 1A6XA 1H9RA 5IGCA 2OT2A 4KKTA 5CV9A 2J7ZA 5E3FA 1HUNA 1NR4A 3FDTA 1KLUD 2LKVA 2EYPA 4J6HA 2NTTA 1NSNS 3ONAB 2K32A 3QOJA 5I6WA 2F0VA 1PRTC 4FXDA 3S9WA 4HSVA 1PXUA 5JPMC 2IL8A 2C5CA 5IGFA 1WTWA 1F9RA 1U4MA 2K1BA 4K6DA 4RFBA 4I65A 1LT3D 4CKBA 3VYTA 3G7LA 2N55A 1PZJD 3J80L 2AWOA 2LFNA 1EIGA 1MSHA 1YNND 1B4OA 4ILWA 5EGTA 1CQVA 3D3RA 5LHY1 2VB3X 1IKLA 1VMCA 3PIP3 5LL6S 3ZYYX 2RVLA 1EEID 1MI2A 1TU2B 1Q8IA 2PYKA 4K8JA 1F9SA 3R2IA 2B2VA 3DWAA 2DN8A 2X6LA 4KY6A 1SE2A 1TWFB 3UI2A 4RGOS 3OW7A 3T16A 4C2MB 1NCVA 1Q12A 1QE6A 1B50A 1R4QB 1AN8A 4L8JA 5JEAG 4KTAA 4XXEA 4CKEA 4BBRB 2BOSA 1HRJA 3R93A 3HKZB 5G3LF 1EY7A 5FKAC 4HMJA 4ZRZA 3NTHA 1LACA 3CRLC 4H0LC 1I4PA 1QNUA 3NK9A 3IFTA 1JR0D 4GZYC 2NTSA 1B3AA 1RF2D 3I3CA 1LLRD 2HQEA 1HXYD 4EGVA 3D8GA 4NMZA 2DNCA 1F2LA 4V0BA 2Z4HA 2K28A 1RJTA 1C48A 4AYBB 5FK9C 4FF1A 3MXUA 2EDGA 1PRTD 4DK1A 1G291 1ZXTA 3NQTA 2E2JB 2BDOA 1EU4A 3I4NB 1B44D 3MA2B 1A3TA 1G2SA 1A15A 4V190 5AFWA 5KNBA 1RDPD 5JOBA 3L3OC 4C3IB 3HS0C 4QUFA 3HOZB 4I7ZC 5BN5A 2A74C 2M9VA 1EY5A 5DM73 5CYUA 2EZVA 1Y1VB 1SNOA 2SOBA 4CHTB 5D3IB 3SXHA 2NVQB 5C0XG 2XRQD 4K6LA 4QB4A 3X3NA 4A3EB 3HOXB 4NW2A 1V1OA 1EYAA 5KNDA 4ABNA 2K5QA 3WDNA 2F0UA 2CQAA 1I4QA 1G8ZD 2RSNA 3BDOA 4G57A 4IUTA 2L55A 2NUCA 3GTMB 4ME5A 5J22A 2NN6H 1CZGA 2DY8A 4KHZA 1KAAA 5J1ZA 3RUZA 1PTOF 3C1FA 4BA2I 1G2TA 2OF1A 3HZXA 5E1FA 1SSOA 4IUPA 3TDQA 3J81L 5ELBA 3I73A 3BVMA 5C5MA 4HEDA 2JA6B 4P2CB 4TQUS 1Z6HA 4DAYA 4ZKCB 3E6ZX 3MXNA 4K2LA 1I4GA 3U9OA 1HFNA 2ICEC 1B53A 2CHBD 2WKCA 5M5XB 2WB1B 1ILPA 3MFYA 2F0HA 1GUSA 2KCCA 2NN6I 5K36G 4QF4A 3SHLA 1D6EC 4DGZA 5D14A 3S17B 2F0FA 3TP7A 2E2HB 4XQNA 1CT1D 1XX8A 4F7XA 3LX0A 3OIPA 1CQFA 1HCZA 2RKSA 3S2DB 4ID6A 1EU3A 4KKSA 2WINB 1CA6A 1O78A 1SE3A 4PMCA 1QCBD 1IL8A 1D5XC 1KDBA 1EY6A 4K5VA 4KJOA 2QF7A 1DOLA 3OMGA 1S5CD 5KNCA 1DOMA 3GTPB 3NWSA 4CGYB 4ODGA 2JP1A 4EQOA 3TN2A 3EJIA 4C1NK 3NBIA 3S14B 4HCSA 1PFMA 2B2WA 2JSOA 4XQQA 3GTKB 1MD2D 4KY5A 5JVH3 3GV3A 3DWPA 2F0SA 5M3MB 3NWTA 2EY1A 3WOEA 1S5DD 3DHQA 4IUNA 1SFOB 3E0JA 4DAVA 2WKDA 3NE5B 1EZ8A 4M8AA 4ZUIA 1CZWA 4IFDG 2EVBA 3K57A 1EZ6A 4QIWB 4KN7C 3KF8A 5CR3A 4KI0A 2K05A 1HFGA 2F0NA 3MTSA 5EPJA 5EBCA 5M9OA 3E5SA 4K5XA 4B9WA 1JE4A 3TBIB 4FF4A 2IJ0A 3SE0A 3A56A 4RA8A 3HOYB 3PV0A 3ITPA 2F0OA 3RZDB 4KK7A 3S2HB 5IIFA 1SNPA 2A68C 1GOZA 2AWNA 1TS4A 3NTIA 1JICA 2IW3A 3MWYW 5A2QE 2B63B 3NUCA 1TY0A 4BWGB 1Y8PB 2IT1A 2EXZA 3QB3A 1CK1A 2SNMA 4FNFA 3G6JB 5EPKA 3FVQA 4OO1G 2NVTB 5FLXE 1AP0A 1KNAA 4KJNA 1GUTA 3LNNA 2F0DA 4A3JB 1LABA 1DJRD 5C3WA 1S5FD 5CV7A 2PZUA 2J0TD 4RGNA 3C1EA 3HRZC 1STGA 2EY5A 3T51B 1SNCA 5IGDA 1QWYA 5CV8A 3GTGB 2XRSD 3FRPB 1H9SA 4RCNA 2B8GA 4FVMA 1CFMA 2KOLA 3DMUA 1KABA 4Q0FA 1XTCD 3VR2A 3M3YB 4KV6A 1CHPD 4Y7NB 2NBFA 1LTID 3L7ZC 1C8CA 4RH6A 4RGMA 2IX0A 1I50B 2D5DA 1F77A 1KTKA 1HTPA 4PMWA 1TS5A 3VA7A 2XN9C 3SDZA 3I4MB 2FINB 4EVOA 2IPKD 3NTKA 4IUQA 1Y8OB 3IL8A 3KUPA 1TWHB 2PMZB 3BYTB 1WTQA 2B39A 3PMFA 2NYZD 1DD2A 1EQVA 4X3TA 1AW7A 2EJMA 5D65A 1RHPA 2Q8TA 2BE5C 2CW0C 3JAME 5C4HA 5M5WB 3H6MA 2A68D 3C2PA 1EY0A 1HQMC 3DXJC 1BOSA 1TS3A 1JB3A 3C46A 5FO9B 3K7AB 3Q22A 2L9HA 1FNVA 4C3JB 4C56C 4ZKBB 1J9OA 1STBA 2SDFA 1GJXA 1KDAA 2AQ3B 1VMPA 2PW7A 4WFN3 1TR5A 1SYDA 1STYA 2AUKA 1F2MA 4DXGA 2B2YA 2X6GA 2ICIA 2AUJD 1GXDC 4HCEA 4G7HC 2CVRA 5G3LD 3RMHA 4H44C 4DN4M 2ZXPA 3DEOA 2KQ3A 3HOUB 4RKLA 3DUZA 3MHBA 3SK8A 1XXGA 1HPCA 1ONLA 1PTOB 4RGTA 2O2LD 1LT5D 3BS1A 2D2CC 1ET9A 5JEAH 1LTGD 4C3IG 5ELFA 5DNFA 2JEAI 1EYDA 1V1PB 1SJED 3CU7A 1EY4A 2WIIB 1WTOA 1FNWA 2KEDA 3LWEA 1GHKA 3Q23A 2ZXOA 3V2TA 3QO2A 1RTOA 4XT3B 5IGBA 1BO0A 5E4WC 3MFGA 1NR2A 1ZYRC 2O5IC 1NAPA 1MSGA 4A93B 1ET6A 3H94A 3QOLA 5CBEE 2BE5D 2CW0D 3VYUA 1TKWB 1STHA 3SR1A 4O42A 2IX3A 2PW5A 3D4DA 1ZKOA 4CBVA 3R8BA 1XWEA 1D5MC 2F0KA 3L9AX 3OMCA 1MGSA 2IWHA 2QDBA 4NP5A 4IN3A 1K8OA 2I46A 2FFKB 5JJZA 2L5TA 1X3PA 1AZPA 2NB0A 3P75A 4KHVA 1A2UA 1MBYA 3DM1A 4DNTB 1W6JA 2F0LA 2J4XA 4X3UA 1B9NA 1LT6D 5C0XH 2EJGC 5M3FB 1O7LA 2EYMA 5IT9L 3K0YA 2EYFA 1SYFA 4RHSA 3I8ZA 3S1RB 3H0GB 3MVVA 1QOHA 1EQTA 1U4RA 4F87A 3MXPA 3MXGA 1ICWA 3R3OA 3KLSA 2GA4B 2K03A 5HGTA 3K5MA 2LY7A 1IHZA 3BDLA 1II3A 1UAPA 1DCZA 1D1KA 4BA1I 3KBXA 1STEA 3A8KE 3HGBA 2KECA 3K59A 3Q24A 3PO2B 4KD4A 4N9PA 1PZKD 2EYJA 3DEPA 1E2WA 2MJ8A 2JXMB 4NKLA 1WTPA 3O13A 5C0XI 1ZYRD 3M7NA 4YIJA 1V8QA 3SK5A 5C3EB 2TMPA 4KMUC 2PO4A 1FGBD 5E4XA 1Q1EA 5CMDA 1PMRA 2QILA 5FO8B 4EQNA 2R7ZB 2L12A 4PNYA 2EOTA 4Q5VA 2F0MA 5I4DA 4Z9CB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K14 A;  4ZUJ A;  1EYA A;  2RKS A;  1A2U A;  3P75 A;  4KHV A;  3E5S A;  2KQ3 A;  4K5X A;  4KTA A;  3T13 A;  4B9W A;  4EQP A;  4TRD A;  1SNQ A;  4ID6 A;  5I6W A;  5IGE A;  5KGU A;  5IGF A;  5IOC A;  3TME A;  5J22 A;  1SYC A;  4RKL A;  5I6Y A;  5IGC A;  2F0L A;  3MHB A;  3OSO A;  1KDC A;  4KY7 A;  3ERO A;  2F0U A;  5CV9 A;  3SK8 A;  5KRU A;  1NUC A;  1A3U A;  5E3F A;  1SYE A;  4QMG A;  5DEH A;  1EY7 A;  3ITP A;  3VA5 A;  4HMJ A;  2EYM A;  4J1M A;  4G57 A;  5NUC A;  2LKV A;  2F0O A;  2EYP A;  3D4W A;  4J6H A;  1F2Z A;  2EYF A;  5KYI A;  1NSN S;  4H7B A;  2EYO A;  4PMC A;  2NUC A;  1SYF A;  4ZQ3 A;  4EVO A;  3QOJ A;  3NK9 A;  5IIF A;  1SNP A;  4KD3 A;  1JOO A;  1U9R A;  4ME5 A;  1KDB A;  2EY6 A;  1TT2 A;  2F0W A;  2F3W A;  3MZ5 A;  3TP6 A;  4N9T A;  4F8M A;  2F0V A;  3TP5 A;  1EYD A;  1EY6 A;  3MVV A;  4K8I A;  5I9P A;  4RKB A;  2F0E A;  3PMF A;  2HQE A;  3MXP A;  4K5V A;  5CGK A;  3D8G A;  4NMZ A;  5C4Z A;  4K5W A;  1EY4 A;  4IZ8 A;  1EQV A;  1KAA A;  2WAC A;  4KJO A;  5J1Z A;  3RUZ A;  3BDC A;  3C1F A;  3S9W A;  4HTH A;  3OMG A;  3R3O A;  2OF1 A;  3HZX A;  3NUC A;  3OWF A;  5E1F A;  3V2T A;  5KEE A;  5HGT A;  2EYL A;  3ERQ A;  2F0I A;  2EYH A;  2EXZ A;  3SK4 A;  3QB3 A;  1SNM A;  3H6M A;  5C4H A;  5IGB A;  1ENA A;  1IHZ A;  2SNM A;  4ODG A;  1SND A;  2O4X A;  3BDL A;  5EKK A;  4EQO A;  5HUR A;  1EY0 A;  1II3 A;  4K6D A;  3EJI A;  4I65 A;  4E6I A;  3P1H A;  2RDF A;  1A3V A;  5C5M A;  4PMB A;  5DAU A;  3NXW A;  4IAL A;  4KY5 A;  5K5P A;  2EY2 A;  5J39 A;  3NQT A;  3HEJ A;  3EVQ A;  3NHH A;  5C3X A;  5EGT A;  1F2Y A;  2F0S A;  3MEH A;  4KD4 A;  4KJN A;  4N9P A;  5ISR A;  3QOL A;  5F2D A;  2EYJ A;  2F0D A;  4WOR A;  2F0J A;  2F0T A;  4LAA A;  4K2L A;  1A3T A;  1STN A;  2EY1 A;  4NDX A;  4S3S A;  5CV5 A;  5C3W A;  1STH A;  4DU9 A;  4R8N A;  3DHQ A;  5IOD A;  2RBM A;  4IUN A;  5CV7 A;  2KHS A;  2F0G A;  2PZU A;  2SNS A;  5EKL A;  3SR1 A;  3U9O A;  5IGG A;  2PQE A;  3C1E A;  4HMI A;  1STG A;  4NKL A;  2EY5 A;  1TQO A;  2PW5 A;  5CV4 A;  2F0Q A;  1JOQ A;  5JOB A;  2PYK A;  3D4D A;  4K8J A;  4YIJ A;  5C6A A;  1SNC A;  1STB A;  3TP8 A;  2F0P A;  5IGD A;  1KDA A;  5CV8 A;  5I9O A;  1EZ8 A;  4DF7 A;  3SK5 A;  5M9O A;  2PW7 A;  5JAV A;  1STA A;  4OL7 A;  3SK6 A;  4WRD A;  2F0K A;  3OMC A;  4ZUI A;  1EY5 A;  2F3V A;  5CC4 A;  2F0H A;  4KY6 A;  1ENC A;  1TR5 A;  1AEX A;  1SYD A;  1EY8 A;  2OEO A;  2QDB A;  4K2K A;  1STY A;  5C5L A;  1F2M A;  1JOK A;  3DMU A;  2M00 A;  1KAB A;  3NP8 A;  1EZ6 A;  1EY9 A;  1SYG A;  4QF4 A;  5CV6 A;  3SHL A;  3T16 A;  2PZW A;  4DGZ A;  5KIX A;  1JOR A;  1SNO A;  4NP5 A;  1EYC A;  2F0F A;  2SOB A;  1SYB A;  4EQN A;  4DFA A;  4B9X A;  4MIU A;  5CR3 A;  4PNY A;  2PZT A;  1RKN A;  3SXH A;  3TP7 A;  4KV6 A;  2ENB A;  2F0N A;  2F0M A;  2OXP A;  1A2T A;  4QB4 A;  3LX0 A;  4F7X A;  3D6C A;  5KYL A; 
#chains in the Genus database with same CATH topology
 1OXX K;  2R7F A;  3DLL A;  1HNX L;  5K36 H;  1VQ9 A;  1L0Y B;  5KGU A;  3BZK A;  3VDY A;  3GTQ B;  5M3M G;  3M4O H;  4TSS A;  4B3R Q;  3EN2 A;  4DV5 Q;  3OSO A;  4KY7 A;  3GTO B;  1AZQ A;  5D3D A;  2ZTD A;  5DEH A;  2RQX A;  2B2T C;  2IHE A;  3CHB D;  1X56 A;  1PH5 A;  4H7B A;  2QEX A;  1TWG H;  2TSS A;  3BG3 A;  1KL9 A;  1PH4 A;  3EFX D;  2PCF B;  2F0W A;  1QG7 A;  1VQO A;  4KN4 C;  1S4Z A;  3TP5 A;  3CPW A;  1SE8 A;  4OEL B;  4CJ2 C;  4IZ8 A;  2JYO A;  3BDC A;  1HR0 W;  2OTL A;  4DV5 L;  4KHP Q;  1KRS A;  4GS3 A;  1JWS D;  4OWW B;  2H1E A;  2VUM H;  1BKB A;  1IKM A;  5EKI A;  2K33 A;  3J80 E;  1A3V A;  3ER0 A;  3W5O A;  3GV6 A;  1BR9 A;  4PMB A;  4XTC S;  3UDI A;  4IAL A;  3M85 A;  5J3B A;  3I70 A;  1LT4 D;  1QIL A;  1WCM H;  2F0T A;  4H13 C;  3T4A C;  2QGQ A;  4EX5 A;  3IFD A;  2UUB Q;  3HOY G;  4KHP L;  2VNU D;  2CH4 A;  2D9U A;  2DNE A;  3CCM A;  1JOQ A;  1S40 A;  2K7V A;  1RTN A;  4OWX B;  4G7Z C;  3PUW A;  1STA A;  4JOI C;  4A3M B;  1EYG A;  5ELD A;  1BCP B;  1ENC A;  3GD7 A;  4YY3 Q;  1BBX C;  5EPL A;  1CTM A;  2B63 G;  2M00 A;  1Z47 A;  3A7L A;  4IUR A;  5KIX A;  3QJY A;  2B8F A;  4DXF A;  3OPO A;  5ELN A;  1TWC B;  1EYC A;  2H4O A;  3A7A B;  5EBD A;  4A3G B;  1TS2 A;  2XSC A;  4PV1 C;  3H15 A;  3A54 A;  2E2I H;  2YTY A;  2R61 A;  5KYL A;  4L6T B;  4ZUJ A;  4RMF A;  4IFD H;  1Q90 A;  3OHX C;  3UDX A;  2JA7 H;  4HSP A;  2YV5 A;  4DR2 Q;  4J8Q A;  4C1N I;  4YY3 L;  3CF5 A;  4ULL A;  4GN3 B;  4ZYS A;  4A3J G;  1K8G A;  1KDC A;  1ESR A;  2C35 B;  3R2T A;  3KFU A;  4DNI A;  1C7Y A;  4QCL A;  1EOV A;  2PMZ E;  4OHJ A;  2WV6 D;  4XDX A;  1JJC B;  2NWG A;  4QQB X;  1VS0 A;  1JOO A;  1A8V A;  1VQL A;  1TWA H;  4LF8 Q;  3TP6 A;  1WTX A;  3Q0A A;  1VQC A;  4RKB A;  3KOJ A;  4AIM A;  2BH2 A;  4BY7 B;  5C4Z A;  4DR2 L;  4LMQ D;  2JA8 H;  1A62 A;  1E2Z A;  1VQP A;  3NSW A;  2VB2 X;  1GUO A;  2R93 H;  4OIK A;  1I3Q H;  1YIT A;  3T56 B;  1ENA A;  1ICF B;  5HUR A;  3HFZ B;  1Q1B A;  3N52 A;  4IO9 A;  4GLX A;  2HCI A;  2EE1 A;  3P1H A;  2L4N A;  5FJ8 G;  2QW7 A;  4LF8 L;  4HJ5 A;  4A3I H;  4BBS B;  3F2U A;  3MXN B;  4A3L H;  2O5J C;  1PDQ A;  1PH8 A;  3EVQ A;  4JBW A;  3VR4 A;  1IBM Q;  1F2Y A;  1EOT A;  2EXD A;  4IFD I;  2VZA A;  3BYY B;  5IY0 A;  2B2U C;  1I6H H;  1PH2 A;  5I2Y A;  2PI2 E;  4DU9 A;  1WD0 A;  4IQZ A;  1EIY B;  3U58 A;  3I4M G;  2CWP A;  3RZO B;  1GO3 E;  1QZH A;  3S1Q B;  4OO1 H;  1PFB A;  1A63 A;  1F9Q A;  2VY3 A;  2KCT A;  2K5W A;  3NPP A;  2E76 C;  2NVX B;  2WP8 J;  3FPU B;  4K2K A;  2K04 A;  4JI1 Q;  1QVF A;  1AFP A;  3NP8 A;  3VR3 A;  4LJZ C;  2D62 A;  4GKK Q;  1VCI A;  3I91 A;  5FO7 B;  1RKN A;  2A73 B;  1SXT A;  4MN3 A;  3ND9 A;  2FHT A;  1BF4 A;  1KAW A;  3RLO A;  3T1Y Q;  4UDU C;  3C3L A;  1V9P A;  1N34 Q;  4DV2 Q;  3SVM A;  1OTC A;  5IGE A;  2K01 A;  2WFW A;  4QY7 A;  4GNX C;  4DR6 Q;  4JI1 L;  1VDZ A;  1I5F A;  1ILQ A;  1J8I A;  3UDG A;  1DOK A;  4GKK L;  4C3J G;  1X3Q A;  3H3V I;  2ZXR A;  2BH8 A;  4DR7 Q;  1S5E D;  1F9P A;  1NJI C;  1F2Z A;  1EWH A;  4RCO A;  3P20 A;  5KYI A;  4X3K A;  3T1Y L;  4HID A;  3NQI A;  1EIF A;  1TT2 A;  3MZ5 A;  1N34 L;  4DV2 L;  4IUV A;  1GUN A;  1BCP F;  1CI3 M;  4OO1 I;  2BA1 A;  4JI7 L;  3E9I A;  4GOP C;  2RF4 A;  2WAC A;  1HTL D;  4DAP A;  5IP7 H;  3DWQ A;  3PUZ A;  4DR6 L;  3K58 A;  1CM9 A;  5IYB H;  2EYH A;  3J81 E;  1Y1W B;  4DR7 L;  1X3F A;  2V4D A;  1D1I A;  1WFQ A;  4GN4 B;  4IPH A;  4OON A;  3QG1 A;  2DY7 A;  1TWF H;  2E75 C;  5LMN Q;  4C2M H;  4FP5 D;  2NVY B;  1KQS A;  2YYZ A;  3HOU G;  4JI2 Q;  1WTV A;  4OWT B;  3RN2 A;  1J6Q A;  4NDX A;  4S3S A;  1NMG A;  3FEW X;  4FXK C;  2PPB C;  2XVS A;  2RBM A;  1DYQ A;  2R3Z A;  2F0G A;  5C4J B;  1PZI D;  1I6V C;  5IYD G;  4IOC A;  1TQO A;  5CV4 A;  1EEF D;  2Q2H A;  2OQ0 A;  4A3C H;  1DXM A;  2ASB A;  1FD7 D;  4BBR H;  5I9O A;  1VQ6 A;  5JAV A;  2IY5 B;  3N6R A;  1SAP A;  3CKI B;  3SEB A;  4JI2 L;  3KF8 B;  3I4L A;  1EY9 A;  4ZAI A;  1N9W A;  2PZW A;  1Y14 B;  1CSQ A;  3FKI B;  4DFA A;  2KHI A;  1XJV A;  5M5Y B;  2PZT A;  2Z1C A;  3I72 A;  1PH7 A;  3J80 c;  1DGS A;  5FOB B;  2K5V A;  1A2T A;  3D6C A;  1HNZ Q;  2AQ2 B;  4M1U B;  4LFC Q;  3URY A;  4A93 G;  2IHF A;  1HUM A;  1JWU D;  1Q3L A;  2HCC A;  1PLF A;  3TME A;  1H9M A;  4CKC A;  5EJW A;  3G4S A;  5IWA L;  2KJX A;  2M2L A;  2D0P A;  3HOW B;  1PYW D;  3VA5 A;  1NTG A;  2MHV A;  3G6E A;  1LTS D;  5DM6 3;  5T1I A;  1PRT B;  2E2J H;  1PTO C;  2A6H C;  1HNZ L;  4C3H B;  4B3T Q;  2YU9 B;  4X3S A;  1EQR A;  4K8I A;  1FYC A;  1G6Z A;  1HZB A;  1X55 A;  1U4P A;  2C9O A;  4K5W A;  4A3B B;  3I4N G;  1KRT A;  1EWC A;  1K73 C;  2QEJ C;  1TVX A;  3ZJY C;  4HAE A;  2NZH A;  1GM5 A;  4LK1 C;  4C3I H;  4RAU C;  3W2D A;  1SE4 A;  5A35 A;  3EIV A;  3VYR A;  4XYO A;  3HOZ H;  3A55 A;  1WTR A;  1N33 Q;  1K83 B;  4E6I A;  2LXK A;  2RDF A;  4QJF A;  4YWL A;  3CCE A;  1EUJ A;  4HJ8 A;  1XYI A;  4BS9 A;  5C44 B;  3L0O A;  4LFA L;  1Y1V H;  3A5U A;  1HHV A;  4DAM A;  1Z7T A;  4X62 Q;  1FR3 A;  2NVQ H;  2BA0 A;  5M3F G;  1K3B C;  2FJ2 A;  5IOD A;  3KLW A;  2A6E C;  3NEN A;  4IUU A;  1G6P A;  4KKU A;  5JEA J;  3HOX H;  4A3E H;  3CCR A;  1N33 L;  1XMO L;  3K5L A;  3H3V C;  1H9S B;  1SEB D;  4R9W A;  3H0G G;  3J7A F;  1KNE A;  1UUP A;  3HOX G;  2RCN A;  3SK6 A;  4WRD A;  2F3V A;  1HR0 Q;  4RWS C;  1NE3 A;  2OEO A;  3T1H Q;  1HQR D;  1X32 A;  5C5L A;  1JOK A;  5CV6 A;  4X62 L;  3TS0 A;  3RLF A;  2Q8I B;  4UP9 A;  3GTM H;  2UXD Q;  1IYU A;  3MAQ A;  5HGQ A;  2V1C C;  3M4P A;  2Z0S A;  3FPP A;  3GQB A;  3S16 B;  1KLG D;  3TZD A;  1SNQ A;  2F4I A;  3PO2 G;  5IOC A;  1HR0 L;  4A76 A;  5I6Y A;  3ERO A;  3KBG A;  3IRB A;  2B2T A;  3KLS X;  1YIJ A;  5NUC A;  1IYV A;  2JA6 H;  3T53 B;  1I94 Q;  3EQL C;  2UXD L;  4HN7 A;  3X3M A;  4DK3 C;  1DM0 B;  2Q2U A;  1BVS A;  3TSS A;  4WJW A;  2KVM A;  2L15 A;  4RG1 A;  1SMX A;  5C3E G;  1YJ9 A;  1E0B A;  4O1N A;  2MPM A;  3ND8 A;  1LTT D;  1T5E A;  3BVG A;  5JVG 3;  1GD7 A;  5A2Q L;  2KCM A;  1JE5 A;  2HT1 A;  3ERQ A;  2R7Z G;  1K8M A;  4U67 3;  5M5X H;  4FXG C;  2VW9 A;  3H91 A;  1L0X B;  1PTO D;  2A6H D;  1HZ9 A;  1I94 L;  3HP3 A;  5TSS A;  1O7Y A;  5C4X B;  2L0C A;  1GHJ A;  3GP7 A;  4L63 B;  5DAU A;  3PUY A;  1VQ8 A;  2RDG A;  3CRK C;  1RD9 D;  1Q81 C;  2KEN A;  5DLQ E;  3NHH A;  5FLX L;  4OXP A;  3S17 H;  1D7Q A;  5COR A;  2BDN A;  2HDM A;  4BY1 B;  5C0X J;  5H1S E;  3V96 A;  2E2H H;  3FMC A;  2B2Y C;  4JCV E;  1PRT F;  2KHS A;  4PZ7 A;  1I4R A;  1WD1 A;  3I4O A;  1JCK B;  1W2B A;  3S2D H;  3TP8 A;  3UE1 A;  4JOI A;  2XNA C;  2JA5 B;  1Y8N B;  5T1G A;  2Y0S B;  2VQF Q;  1VQK A;  2B2V C;  1AEX A;  3OIQ A;  4DK0 A;  4FF3 A;  2KUM A;  2X69 A;  2A6E D;  1SBB B;  1S5B D;  1JOR A;  3J81 c;  4ZK9 B;  5CBA E;  1SYB A;  4MIU A;  2E2D C;  1XNQ L;  4R4O A;  3HOV B;  3S1N B;  1L2F A;  3F8T A;  4YWM A;  4X66 Q;  1M8A A;  3T13 A;  1VQB A;  4TRD A;  3S15 B;  3K6O A;  3W1B A;  3M7G A;  4A3F B;  2IX1 A;  1HA6 A;  3PO3 B;  1SYC A;  1EFI D;  2NN6 G;  3L2P A;  3GTP H;  4U68 A;  1BUV T;  3J7Y W;  4A3D H;  1JWM D;  1SYE A;  1TY2 A;  1BQQ T;  2SEB D;  3U9S A;  3S14 H;  3D4W A;  4B08 A;  1OXS C;  1C4Q A;  3GTK H;  3H09 A;  4A4I A;  5ELE A;  3PUV A;  4LF5 Q;  4KD3 A;  1OXT A;  1LO5 D;  1YHA A;  5LL6 X;  2ZJR A;  2L11 A;  4N9T A;  5M3M H;  4TKO B;  4X66 L;  1LTB D;  2I07 B;  4A3M G;  2F0E A;  2A69 C;  5BN4 A;  1CHQ D;  1ZEQ X;  3E0E A;  1L1O A;  4A3K B;  2ZT9 C;  3IKJ A;  2Z8L A;  3CCS A;  1O7Z A;  2KEE A;  3BZD B;  1HA5 A;  1SFO H;  4FYD A;  5GQO A;  4A3G G;  1TXY A;  4IPG A;  1YNJ C;  2F0I A;  1U4L A;  3SK4 A;  1B1Z A;  2R92 B;  5EKK A;  1CUK A;  3JAM L;  4FF2 A;  5L37 A;  2F4V Q;  4BXX G;  4QGU A;  2JJQ A;  4JG2 A;  3S1M B;  4IPD A;  1B9M A;  4AQY Q;  5K5P A;  5J39 A;  1ASZ A;  2EPB A;  1Y69 U;  2B2U A;  3VR6 A;  2JA9 A;  4LAA A;  1QJO A;  4B3R L;  5CV5 A;  2JQO A;  3K7U C;  1ASY A;  4RHR A;  1DON A;  1HJP A;  4NXM Q;  1ROD A;  3CQZ B;  3RR5 A;  4XIG S;  2A1A A;  2XWJ B;  2HUG A;  5C6A A;  2F1M A;  2CFM A;  4LNQ A;  1E2V A;  1W3S A;  3GTL B;  2PNR C;  5GAG C;  4DF7 A;  1U5K A;  4XQJ A;  4AQY L;  1BBW A;  4BY7 G;  3EA6 A;  1R9T B;  3HOY H;  1KHI A;  2FMC A;  2QCP X;  1N36 Q;  4QUC A;  2ATW A;  2I5M X;  3RZD H;  1I4X A;  3K5N A;  3S2H H;  3CW2 C;  3J7A V;  1BCP C;  1PVO A;  1B70 B;  2ENB A;  2N3S A;  1BNZ A;  1VQG A;  3QWN A;  4BBS G;  2Z9H A;  4EQP A;  2JEB I;  1FNU A;  3RD4 A;  2I0Q A;  4JK1 C;  4JBK A;  2JE6 I;  4GNX A;  2B63 H;  2Q8R E;  1YJW A;  3K5O A;  3VR5 A;  1LTR D;  1PH6 A;  3A8J E;  1IL2 A;  1VF5 C;  1N36 L;  2HDL A;  3BU2 A;  3GO5 A;  4UAI A;  2NZO A;  1NUC A;  2LS0 1;  3CXC A;  3GTJ B;  4J1M A;  2UUB L;  4A3D B;  1HZC A;  2MP1 A;  2KCN A;  4MHE A;  2DGY A;  2NVT H;  1WVL A;  1U9R A;  1E24 A;  2F3W A;  4F8M A;  4GOP A;  3KJO A;  4A3J H;  5CGK A;  5BN3 A;  1RCV D;  1Q82 C;  2WAQ B;  4HTH A;  2B3G A;  3KLR A;  4FO2 A;  1K0S A;  3OWE B;  1SMY C;  3OWF A;  3PUX A;  5KEE A;  3M4O B;  2EYL A;  3RN5 A;  2QKI C;  2PQA A;  3D6W A;  4R4Q A;  1ML0 D;  3LGJ A;  1O80 A;  3GTG H;  1CA5 A;  4DR1 Q;  2KA7 A;  4OGQ C;  4PQX A;  2EIF A;  4K0K Q;  1T5X D;  1GKH A;  3Q6S A;  4IFD J;  2A69 D;  2AHO B;  1GUW A;  2A19 A;  2VXW A;  4ZLT F;  1TWG B;  2EY2 A;  3HEJ A;  3KK7 A;  1PFN A;  3A0J A;  2ID0 A;  1V43 A;  5ISR A;  1G91 A;  2NZ1 D;  2F0J A;  1YNJ D;  2AQ1 B;  3M3Y H;  1LTL A;  4LFB Q;  1OO9 B;  4DA2 A;  1A0I A;  4R8N A;  4Y7N H;  2PQE A;  1JB7 A;  1VF7 A;  3AEV A;  5FJ8 H;  2F0Q A;  3VYS A;  1UNS A;  1X65 A;  2UUA Q;  1M4V A;  1UEA B;  1I50 H;  2RDH A;  3BVZ A;  3E3X A;  5KRU A;  2VUM B;  5CC4 A;  2I5L X;  1MJC A;  2PI2 A;  5FLM G;  1EY8 A;  3K81 C;  4L5Q A;  1HZA A;  5ELC A;  4R8I A;  1OXU A;  1B2T A;  2N49 A;  4LF4 Q;  1IW7 C;  3I4M H;  4LFB L;  1WCM B;  4G4K A;  1Y1W G;  2Z4I A;  4B9X A;  1TWH H;  5COY A;  3LWU A;  1SDF A;  2OXP A;  3PQI A;  1H9J A;  1PH3 A;  1L1O B;  4LUZ A;  1KXL A;  2UUA L;  3IAY A;  2K5D A;  2G9H D;  2G9D A;  3QIA A;  1YJN A;  1VQN A;  2A5H A;  4HR7 B;  2JK8 A;  2XWB B;  3HG9 A;  1D2B A;  3OTO Q;  1LV9 A;  1YVC A;  1IBM L;  3OOC A;  5M5W H;  1A3U A;  1BCP D;  4CJ1 B;  1QB5 D;  4QMG A;  3F2B A;  5IT9 E;  4LF4 L;  2E8G A;  1XPR A;  2HQL A;  4YHH Q;  1OXV A;  2EYO A;  4ZQ3 A;  3WOF A;  2EY6 A;  2OQK A;  3K7A H;  1E7Z A;  5I9P A;  1VQ7 A;  3NEL A;  4HJ7 A;  2E2I B;  2E74 C;  5EQ0 A;  4R4C A;  4DNR B;  1YNN C;  2DUD A;  3KF6 A;  4C3J H;  3OTO L;  1V1P A;  4P71 A;  1LTA D;  3MC0 B;  4XYQ A;  2JA7 B;  5I2X A;  2ZTC A;  1D5Z C;  1TII D;  1BDO A;  1JQY D;  2GN5 A;  2N88 A;  3FKI G;  2R6G A;  3D4R A;  1I4H A;  4XT1 B;  1SNM A;  3CAM A;  1SND A;  2O4X A;  4YHH L;  3P7J A;  3AB9 A;  3D31 A;  1GUG A;  3CCQ A;  3NBH A;  1UE5 A;  3W3A A;  3I90 A;  2K6A A;  1YHQ A;  2MGS A;  3V05 A;  1EIH A;  2UXB Q;  3NXW A;  1DZ1 A;  2B2W C;  3PIO 3;  4ME3 A;  1SJH D;  1R4P B;  1CKO A;  3JC6 6;  1TWA B;  5C3X A;  3MEH A;  2XIW A;  5F2D A;  1UWV A;  4WOR A;  1SMY D;  3HOW G;  3AMU A;  4JI5 Q;  1AE2 A;  4OIJ A;  1STN A;  2F03 A;  3M4Y A;  2RA4 A;  1CKN A;  1ESF A;  2JA8 B;  2SNS A;  5EKL A;  4CJ0 B;  3AU7 A;  5IGG A;  3A8I E;  4HMI A;  1KC8 C;  1ENF A;  2R93 B;  3I55 A;  2OTJ A;  1H9K A;  1I3Q B;  4F88 A;  2F0P A;  5JPN C;  4C3H G;  3HOU H;  3U4V A;  2UXB L;  4OL7 A;  4G7O C;  4A3B G;  3CCU A;  1PTO H;  2BCO A;  1M90 C;  4A3I B;  1JC7 A;  2MUY A;  3M4Q A;  3AFQ A;  1SYG A;  3QR8 A;  5IYD H;  4JI5 L;  2FMM A;  4JI0 Q;  1I6H B;  4OX9 Q;  1W6K A;  1QNK A;  2RSO A;  3TZU A;  4I7A A;  4K14 A;  1EL0 A;  5C44 G;  1BXT A;  2UXC Q;  5LMN L;  2L1B A;  5GAH C;  2EJF C;  1SN8 A;  1IW7 D;  1A6X A;  1H9R A;  5IGC A;  2OT2 A;  2N8N A;  4B3S Q;  4KKT A;  5CV9 A;  2J7Z A;  5E3F A;  1HUN A;  1NR4 A;  3FDT A;  4DK6 C;  1KLU D;  4JI0 L;  1K9M C;  2LKV A;  2EYP A;  4J6H A;  2NTT A;  1NSN S;  3ONA B;  3FHW A;  4OX9 L;  2K32 A;  3QOJ A;  4DV7 Q;  4A93 H;  4JYA Q;  1MJE A;  4APV A;  3ICE A;  4LUV A;  5I6W A;  2F0V A;  4LWC A;  1PHJ A;  1PRT C;  3H3V H;  1O7I A;  2H5X A;  4NPS A;  4FXD A;  3S9W A;  2CKZ B;  4HSV A;  3JAM i;  1PXU A;  4AH6 A;  1LUZ A;  5JPM C;  4B3S L;  1VQM A;  2IL8 A;  2C5C A;  5IGF A;  1WTW A;  1F9R A;  1U4M A;  2K1B A;  2RHQ B;  4K6D A;  4OEM B;  4RFB A;  4I65 A;  3KDF A;  1LT3 D;  4CKB A;  3VYT A;  4DV7 L;  3G7L A;  4P75 A;  4JYA L;  3PF5 A;  2N55 A;  1PZJ D;  3J80 L;  2AWO A;  2LFN A;  3I4N H;  1P8L A;  1EIG A;  2HIV A;  1MSH A;  1YNN D;  1B4O A;  4LFC L;  4ILW A;  5EGT A;  1CQV A;  3D3R A;  5LHY 1;  4NB3 A;  2VB3 X;  1IKL A;  1QUQ A;  2I5H A;  1VMC A;  4N8F A;  3PIP 3;  5LL6 S;  3ZYY X;  2RVL A;  4DUY Q;  4PG3 A;  4R4I A;  2JN4 A;  3HKS A;  1SR3 A;  1EEI D;  1MI2 A;  1TU2 B;  2Y0S E;  2ZJQ A;  1Q8I A;  1LM0 A;  2PYK A;  4K8J A;  1F9S A;  4PZ6 A;  4UP7 A;  3R2I A;  3PCO B;  4B3T L;  2B2V A;  1S3O A;  3DWA A;  2DN8 A;  2K75 A;  2X6L A;  4KY6 A;  1SE2 A;  1VQH A;  5M3F H;  1TWF B;  3UI2 A;  1XPU A;  4JPB W;  4RGO S;  3OW7 A;  3T16 A;  4C2M B;  1NCV A;  1Q12 A;  4DUY L;  1QE6 A;  4DUZ Q;  4Y52 H;  1B50 A;  3S1R H;  3H0G H;  4Z9C B;  5E7N A;  4POG A;  4DR3 Q;  1UE6 A;  3WWV A;  2CCZ A;  5C4X G;  1R4Q B;  1AN8 A;  4L8J A;  4EQ5 A;  3PIO A;  3G71 A;  4DV1 Q;  5JEA G;  4KTA A;  4XXE A;  4CKE A;  4BBR B;  2K5H A;  2YTV A;  2BOS A;  1HRJ A;  4BY1 G;  2K5N A;  1PYB A;  3R93 A;  3HKZ B;  5G3L F;  1EY7 A;  4JI6 Q;  4O0A A;  4HMJ A;  4ZRZ A;  5FKA C;  3NTH A;  1LAC A;  4MTK A;  2K52 A;  3CRL C;  1K0R A;  4H0L C;  2UUC Q;  1I4P A;  1QNU A;  3NK9 A;  1SRU A;  3OYY A;  3IFT A;  1JR0 D;  3PO2 H;  2NTS A;  3UDF A;  4GZY C;  1B3A A;  1RF2 D;  2P5Z X;  3I3C A;  2JA5 G;  1LLR D;  4DV1 L;  2HQE A;  2ZM6 Q;  1HXY D;  4EGV A;  3D8G A;  4NMZ A;  2Y0S G;  1CKN B;  1X9N A;  2DNC A;  1F2L A;  1E3P A;  4P73 A;  4V0B A;  3T1H L;  2Z4H A;  3K0X A;  4NXN Q;  1Q8K A;  4JI6 L;  2K28 A;  1RJT A;  1C48 A;  4AYB B;  5FK9 C;  4FF1 A;  3MXU A;  2UUC L;  3HOV G;  4HIO A;  2EDG A;  5C3E H;  1X3E A;  2ALY B;  3TS2 A;  1PRT D;  4DK1 A;  1G29 1;  1ZXT A;  3NQT A;  2ZM6 L;  2E2J B;  2BDO A;  4A3F G;  1EU4 A;  3PO3 G;  3I4N B;  1B44 D;  1YEZ A;  5GRO A;  2OWO A;  3MA2 B;  2Z6K C;  1FL0 A;  1UE7 A;  5IT9 c;  2R7Z H;  1A3T A;  1G2S A;  1A15 A;  4V19 0;  5AFW A;  4NXN L;  4GLA C;  5KNB A;  1JJG A;  4CDC C;  1RDP D;  5JOB A;  3L3O C;  4C3I B;  3HS0 C;  4GN5 A;  4MTN A;  4QUF A;  3GTQ H;  3HOZ B;  4I7Z C;  4IJH A;  3TRZ A;  4J15 A;  5BN5 A;  2A74 C;  2M9V A;  1EY5 A;  3GTO H;  4A3K G;  3G48 A;  2CQO A;  4P72 A;  4LF6 Q;  4HIK A;  5DM7 3;  5CYU A;  2EZV A;  1Y1V B;  1SNO A;  2SOB A;  4CHT B;  5D3I B;  2R92 G;  4KLK A;  3SXH A;  2NVQ B;  5C0X G;  3B6Y A;  3Q8D A;  2XRQ D;  4K6L A;  4QB4 A;  3X3N A;  4A3E B;  3HOX B;  4NW2 A;  1V1O A;  1EYA A;  4HJ9 A;  1SLJ A;  2RHS B;  2ZTE A;  5KND A;  1PV4 A;  4ABN A;  1HNW Q;  2K5Q A;  3WDN A;  2F0U A;  2CQA A;  3PIP A;  1I4Q A;  1G8Z D;  3BDO A;  2RSN A;  3MEF A;  4G57 A;  1L0W A;  2OCE A;  3CC7 A;  4IUT A;  4JV5 Q;  3D0F A;  2L55 A;  2NUC A;  3GTM B;  2WAQ E;  4ME5 A;  4CDF C;  4GLV B;  5J22 A;  2ES2 A;  1XNR Q;  2NN6 H;  1CZG A;  1VQJ A;  2DY8 A;  2VQE Q;  1H95 A;  4KHZ A;  1KAA A;  5J1Z A;  3RUZ A;  1PTO F;  1Q7Y C;  3C1F A;  4BA2 I;  1HNW L;  2VQF L;  1G2T A;  2OF1 A;  3HZX A;  5E1F A;  1SSO A;  4IUP A;  3TDQ A;  4JV5 L;  3J81 L;  3CC4 A;  5JJK A;  5ELB A;  3ULJ A;  3I73 A;  1VQ4 A;  4A3M H;  1GVP A;  2UU9 Q;  1NMF A;  3BVM A;  3PGZ A;  5C5M A;  2CH4 W;  4HED A;  2JA6 B;  4P2C B;  4TQU S;  3I2Z A;  1XNR L;  4N8X 1;  1Z6H A;  2VQE L;  4A3G H;  4DAY A;  1TWC H;  4ZKC B;  1VQE A;  3E6Z X;  2LXJ A;  3MXN A;  1N32 Q;  1V1Q A;  4K2L A;  3I7F A;  1I4G A;  3J81 j;  2ZJP A;  1IBK Q;  3U9O A;  4BXX H;  1HFN A;  2ICE C;  3CPF A;  3TEH B;  1B53 A;  2CHB D;  2FXQ A;  2WKC A;  2UU9 L;  5M5X B;  4LF5 L;  2WB1 B;  3U4Z A;  1FJG Q;  1ILP A;  3MFY A;  2F0H A;  1GUS A;  2KCC A;  1SRO A;  1N8R C;  3CCJ A;  2NN6 I;  5IYC H;  2WAQ G;  5K36 G;  1E22 A;  1N32 L;  4QF4 A;  3SHL A;  1D6E C;  4DGZ A;  5D14 A;  3S17 B;  2F0F A;  1IBK L;  5IYC G;  3TP7 A;  2QA4 A;  2E2H B;  4LUO A;  1LYL A;  1CT1 D;  4XQN A;  1XX8 A;  4F7X A;  3LX0 A;  4BY7 H;  3OIP A;  1CQF A;  2F4V L;  1X3G A;  1HCZ A;  2RKS A;  2GVB A;  3S2D B;  2AMC B;  1FJG L;  4ID6 A;  1EU3 A;  4KKS A;  4JVZ A;  1QVG A;  1YBY A;  2WIN B;  1CA6 A;  1O78 A;  4DV0 Q;  1SE3 A;  2GVA A;  3FP9 A;  4PMC A;  1QCB D;  4BBS H;  4B3M Q;  1IL8 A;  4QL5 A;  1D5X C;  1KDB A;  4X65 Q;  1PFS A;  1M1K C;  3I56 A;  2VUM G;  1EY6 A;  4YCU A;  4K5V A;  4KJO A;  2QF7 A;  1DOL A;  3F1Z A;  3OMG A;  1S5C D;  5KNC A;  1DOM A;  1WCM G;  3RZO H;  2KBN A;  3GTP B;  3S1Q H;  4DV0 L;  3J80 i;  3NWS A;  4CGY B;  4ODG A;  2JP1 A;  4EQO A;  3TN2 A;  3EJI A;  4C1N K;  4B3M L;  1B8A A;  3NBI A;  3S14 B;  4HCS A;  1PFM A;  2B2W A;  2NVX H;  2JSO A;  4XQQ A;  4HJA A;  3GTK B;  4X65 L;  1MD2 D;  4JW0 A;  4KY5 A;  2MNA A;  5JVH 3;  1B7Y B;  3GV3 A;  1BBU A;  3DWP A;  2F0S A;  5M3M B;  4O2D A;  1D8L A;  1VQF A;  3U50 C;  4UP8 A;  3NWT A;  1B3Q A;  2EY1 A;  3WOE A;  5AJ3 Q;  1S5D D;  3DHQ A;  4IUN A;  1UE1 A;  1WOC A;  1SFO B;  3ULL A;  3E0J A;  4DAV A;  1X54 A;  2WKD A;  1WTH A;  3NE5 B;  1EZ8 A;  4M8A A;  1K3R A;  4ZUI A;  3DM3 A;  2B29 A;  1XPO A;  1CZW A;  4IFD G;  2EVB A;  3OW2 A;  3K57 A;  2JA7 G;  1EZ6 A;  3RLN A;  4QIW B;  4KN7 C;  5AJ3 L;  3KF8 A;  5CR3 A;  4KI0 A;  2K05 A;  1HFG A;  2F0N A;  3MTS A;  4DR1 L;  1KD1 C;  3W1G A;  5EPJ A;  4K0K L;  3AFP A;  5FLM H;  5EBC A;  5M9O A;  3E5S A;  4K5X A;  4B9W A;  1JE4 A;  4CDD C;  4ALP A;  2DJG C;  3TBI B;  5JJI A;  4FF4 A;  1CKM A;  1JJ2 A;  1Q86 C;  1L1O C;  1Y1W H;  2IJ0 A;  3SE0 A;  3A56 A;  4RA8 A;  3HOY B;  3PV0 A;  1JT8 A;  3ITP A;  4UPA A;  2JA8 G;  1MKH A;  4YWK A;  2F0O A;  4L5T A;  3RZD B;  4KK7 A;  2R93 G;  3S2H B;  5IIF A;  1SNP A;  2A68 C;  1GOZ A;  2MQH A;  2NVY H;  4DAY B;  2AWN A;  3STB C;  1TS4 A;  3NTI A;  1JIC A;  2IW3 A;  1EFW A;  4A3I G;  3MWY W;  4A3L G;  5C4J H;  4P74 A;  5A2Q E;  2B63 B;  2HIX A;  3J7Z C;  3NUC A;  1TY0 A;  4BWG B;  1Y8P B;  2IT1 A;  2EXZ A;  4IPC A;  3QB3 A;  1CK1 A;  2SNM A;  2MFI A;  4FNF A;  3G6J B;  5EPK A;  3S24 A;  1J5E Q;  2Z6B A;  3FVQ A;  4OO1 G;  1Q46 A;  2NVT B;  5FLX E;  1AP0 A;  1KNA A;  4KJN A;  1GUT A;  3FKI H;  3LNN A;  2F0D A;  2K4K A;  4A3J B;  1LAB A;  5M5Y H;  3A5Z B;  1FGU A;  1DJR D;  5C3W A;  2Q2I A;  1VQA A;  1S5F D;  5CV7 A;  2PZU A;  2J0T D;  4RGN A;  3C1E A;  3HRZ C;  1STG A;  2EY5 A;  3T51 B;  2KHJ A;  1AE3 A;  1SNC A;  3A74 A;  3NEM A;  5IGD A;  3E9H A;  1QWY A;  1X6O A;  5CV8 A;  3GTG B;  2XRS D;  4JI7 Q;  1J5E L;  3FRP B;  3HOW H;  1H9S A;  4RCN A;  2B8G A;  1QZG A;  4FVM A;  2N78 A;  1CFM A;  3AYH B;  2KOL A;  3DMU A;  1KAB A;  4Q0F A;  1XTC D;  2A8V A;  4IOA A;  3VR2 A;  3M3Y B;  4C3H H;  2YU9 H;  4KV6 A;  3EBE A;  1CHP D;  4Y7N B;  2NBF A;  1LTI D;  4GNX B;  3L7Z C;  4A3B H;  3HKZ E;  1C8C A;  4L5R C;  1YHB A;  4RH6 A;  3TRE A;  4RGM A;  2IX0 A;  1I50 B;  5IE8 A;  1AH9 A;  2D5D A;  1F77 A;  1K83 H;  4CDE C;  5IP7 G;  1KTK A;  4POF A;  1HTP A;  4PMW A;  1TS5 A;  3VA7 A;  2XN9 C;  3SDZ A;  3I4M B;  4GOP B;  1IYJ B;  5IYB G;  2FIN B;  4EVO A;  5C44 H;  2IPK D;  2AKW B;  3NTK A;  4IUQ A;  1Y8O B;  3IL8 A;  3KUP A;  1P16 A;  1TWH B;  2PMZ B;  1XMQ Q;  3BYT B;  1WTQ A;  2B39 A;  3PMF A;  2NYZ D;  1DD2 A;  4AYB E;  1EQV A;  4X3T A;  4X64 Q;  5GAD C;  2PQA B;  3J81 i;  1AW7 A;  2EJM A;  5D65 A;  4WJ4 A;  1Z9F A;  1RHP A;  2Q8T A;  2BE5 C;  3KYH C;  2CW0 C;  3UE0 A;  3JAM E;  1PA6 A;  5C4H A;  5M5W B;  3H6M A;  3CCV A;  2A68 D;  3ERS X;  3C2P A;  1EY0 A;  3STB D;  1HQM C;  1K28 A;  3DXJ C;  3F2D A;  1BOS A;  1TS3 A;  1JB3 A;  2PNH A;  4DR5 Q;  2K14 A;  1XMQ L;  1IBL Q;  2G5D A;  3C46 A;  4A3C G;  1VQD A;  2Z6K A;  5IWA Q;  3CCL A;  4BBR G;  5FO9 B;  4JBM A;  3K7A B;  2UXC L;  3Q22 A;  4FDB A;  4X64 L;  4TVA B;  2L9H A;  3CMA A;  3HKZ G;  1VQ5 A;  4WJ3 M;  1FNV A;  4C3J B;  2MO1 A;  5LMU Q;  4C56 C;  4ZKB B;  4X6A H;  1E1O A;  3S16 H;  4UY8 C;  1J9O A;  1STB A;  2SDF A;  5GAE C;  1GJX A;  1KDA A;  2AQ3 B;  1VMP A;  2PW7 A;  4DR5 L;  1IBL L;  4L5S A;  4WFN 3;  1TR5 A;  1SYD A;  1STY A;  2AUK A;  1F2M A;  4UHV A;  4DXG A;  2B2Y A;  2X6G A;  3PF4 A;  2ICI A;  2AUJ D;  1GXD C;  3GDE A;  4AYB G;  4HCE A;  4G7H C;  5LMU L;  2MO0 A;  2CVR A;  5G3L D;  3RMH A;  4H44 C;  1S72 A;  4DN4 M;  4LFA Q;  2ZXP A;  3DEO A;  2DJF C;  2KQ3 A;  4LW1 A;  1T9H A;  1U0L A;  3HOU B;  4RKL A;  3DUZ A;  3MHB A;  1EWI A;  4JI3 Q;  1RL2 A;  3SK8 A;  1XXG A;  1HPC A;  4JI8 Q;  1ONL A;  1PTO B;  4RGT A;  2O2L D;  1LT5 D;  1MHW C;  2VL6 A;  3AQQ A;  4DKA C;  4LF7 Q;  3TQY A;  1NNX A;  1K8A C;  1QVC A;  3BS1 A;  2D2C C;  5C4X H;  1XMO Q;  4R4T A;  1ET9 A;  2D0O A;  5JEA H;  1LTG D;  4C3I G;  5ELF A;  3HOZ G;  5DNF A;  2JEA I;  2XGT A;  3KF6 B;  1EYD A;  1V1P B;  1SJE D;  4BY1 H;  3CU7 A;  3CME A;  1EY4 A;  2WII B;  1WTO A;  1FNW A;  2KED A;  3LWE A;  1GHK A;  1NY4 A;  1YZ6 A;  3M9B A;  4JI3 L;  4YCW A;  3Q23 A;  1Y1V G;  2ZXO A;  3V2T A;  3NBH B;  4JI8 L;  3QO2 A;  1C0A A;  4NXM L;  4LF7 L;  1RTO A;  4XT3 B;  5IGB A;  1BO0 A;  5E4W C;  4DUZ L;  2JA5 H;  3MFG A;  2E5L Q;  1NR2 A;  1XTD A;  1ZYR C;  4DR3 L;  2EQS A;  4A3E G;  2O5I C;  1MIU A;  1NAP A;  3BJU A;  1MSG A;  1PH9 A;  4A93 B;  1ET6 A;  2Q2T A;  3H94 A;  4A75 A;  5IP9 H;  3QOL A;  5CBE E;  2BE5 D;  2CW0 D;  4LF9 Q;  5JJL A;  3VYU A;  1TKW B;  1STH A;  3HOV H;  2WB1 E;  5IP9 G;  3SR1 A;  3S1N H;  4O42 A;  4JBJ A;  5ELO A;  2IX3 A;  1HH2 P;  2PW5 A;  3D4D A;  1ZKO A;  4CBV A;  3S15 H;  2E5L L;  4JC0 A;  4A3F H;  3PO3 H;  3R8B A;  4MZ9 A;  1XWE A;  1D5M C;  2F0K A;  3L9A X;  3OMC A;  1G51 A;  3SGI A;  4HIM A;  3KJP A;  1MGS A;  2IWH A;  2QDB A;  1IXR A;  1WI5 A;  1PYS B;  4LF9 L;  4NP5 A;  4IN3 A;  1K8O A;  2I46 A;  2VS1 A;  2FFK B;  5JJZ A;  2L5T A;  1X3P A;  1AZP A;  3F2C A;  4A3K H;  2JA6 G;  1WJJ A;  1YI2 A;  5FLX c;  2NB0 A;  2HHH Q;  3P75 A;  4KHV A;  1A2U A;  5LMN W;  1MBY A;  1C9O A;  3DM1 A;  4DNT B;  1W6J A;  2F0L A;  1JMC A;  2J4X A;  1UEB A;  4X3U A;  1B9N A;  2R92 H;  2F3I A;  1LT6 D;  5C0X H;  2EJG C;  5M3F B;  1O7L A;  2EYM A;  2YTX A;  5IT9 L;  3S1M H;  3K0Y A;  2EYF A;  1SYF A;  1NBW A;  4RHS A;  3I8Z A;  3S1R B;  3H0G B;  2WB1 G;  4DPG A;  3MVV A;  1QOH A;  3ULP A;  2HHH L;  1EQT A;  1U4R A;  4F87 A;  3MXP A;  3MXG A;  4DV6 Q;  1ICW A;  5EAY A;  3CQZ H;  3R3O A;  5BR8 Q;  2XTI A;  4LF6 L;  4R1J A;  3KLS A;  2GA4 B;  2K03 A;  3K8A A;  5HGT A;  3KDF B;  3K5M A;  1XNQ Q;  3J7A 5;  4H02 A;  2LY7 A;  4IJL A;  4JI4 Q;  1IHZ A;  2LSS A;  3GTL H;  3BDL A;  4YCV A;  4GKJ Q;  1VQI A;  1II3 A;  1CSP A;  1UAP A;  1DCZ A;  1D1K A;  1YNX A;  3K80 C;  2CWA A;  4BA1 I;  3KBX A;  1STE A;  1R9T H;  4DR4 Q;  3A8K E;  4PZ8 A;  3HGB A;  2KEC A;  3K59 A;  2F52 A;  4ZCK A;  3Q24 A;  3PO2 B;  1QUQ B;  4KD4 A;  4DV6 L;  4N9P A;  1PZK D;  2EYJ A;  3DEP A;  5HY6 A;  1E2W A;  2MJ8 A;  5BR8 L;  1RIP A;  2JXM B;  4DV4 Q;  2QDL A;  1KIX A;  2K50 A;  2HD3 A;  4NKL A;  1WTP A;  1PH1 A;  4JI4 L;  3O13 A;  1E1T A;  1FVI A;  5C0X I;  1ZYR D;  4DV3 Q;  3M7N A;  4GKJ L;  4YIJ A;  1V8Q A;  3BZC A;  4MNO A;  2RCF A;  3CP0 A;  1HNX Q;  4DR4 L;  3SK5 A;  4QIW E;  1WYD A;  3CD6 A;  5C3E B;  3PSI A;  2TMP A;  4KMU C;  2PO4 A;  3GTJ H;  1FGB D;  5E4X A;  1Q1E A;  5CMD A;  3RNU A;  1PMR A;  2QIL A;  3JAM c;  5FO8 B;  4EQN A;  4DV4 L;  2R7Z B;  2L12 A;  2R7D A;  4PNY A;  4A3D G;  2EOT A;  4DV3 L;  1IZ6 A;  4Q5V A;  2F0M A;  5I4D A;  2LMC B;  1EQQ A;  3CC2 A; 
#chains in the Genus database with same CATH homology
 1OXX K;  5K36 H;  1L0Y B;  5KGU A;  3GTQ B;  4TSS A;  3OSO A;  4KY7 A;  3GTO B;  1AZQ A;  5D3D A;  5DEH A;  2RQX A;  2B2T C;  3CHB D;  4H7B A;  2TSS A;  3BG3 A;  3EFX D;  2PCF B;  2F0W A;  1QG7 A;  4KN4 C;  1S4Z A;  3TP5 A;  4CJ2 C;  4IZ8 A;  2JYO A;  3BDC A;  1JWS D;  2H1E A;  1IKM A;  5EKI A;  2K33 A;  3J80 E;  1A3V A;  3GV6 A;  1BR9 A;  4PMB A;  4XTC S;  4IAL A;  3M85 A;  3I70 A;  1LT4 D;  1QIL A;  2F0T A;  4H13 C;  3T4A C;  3IFD A;  2VNU D;  2D9U A;  2DNE A;  1JOQ A;  2K7V A;  1RTN A;  4G7Z C;  3PUW A;  1STA A;  4A3M B;  5ELD A;  1BCP B;  1ENC A;  3GD7 A;  1BBX C;  5EPL A;  1CTM A;  2M00 A;  4IUR A;  1Z47 A;  3A7L A;  5KIX A;  3QJY A;  2B8F A;  4DXF A;  3OPO A;  4A3G B;  1TWC B;  1EYC A;  2H4O A;  3A7A B;  5EBD A;  1TS2 A;  2XSC A;  4PV1 C;  3A54 A;  2R61 A;  5KYL A;  4L6T B;  4ZUJ A;  4IFD H;  1Q90 A;  3OHX C;  4HSP A;  4J8Q A;  4C1N I;  4ULL A;  4ZYS A;  1KDC A;  1ESR A;  3R2T A;  4QCL A;  4OHJ A;  2WV6 D;  4XDX A;  2NWG A;  1JOO A;  3TP6 A;  1WTX A;  3Q0A A;  4RKB A;  4BY7 B;  5C4Z A;  4LMQ D;  1E2Z A;  3NSW A;  2VB2 X;  1GUO A;  4OIK A;  3T56 B;  1ENA A;  5HUR A;  1Q1B A;  3N52 A;  2HCI A;  2EE1 A;  3P1H A;  2L4N A;  4BBS B;  3F2U A;  2O5J C;  1PDQ A;  3EVQ A;  4JBW A;  3VR4 A;  1F2Y A;  1EOT A;  4IFD I;  3BYY B;  2B2U C;  5I2Y A;  4DU9 A;  1WD0 A;  4IQZ A;  3RZO B;  4OO1 H;  3S1Q B;  1PFB A;  1F9Q A;  2K5W A;  3NPP A;  2E76 C;  2NVX B;  2WP8 J;  3FPU B;  4K2K A;  2K04 A;  1AFP A;  3NP8 A;  3VR3 A;  4LJZ C;  2D62 A;  1VCI A;  3I91 A;  5FO7 B;  1RKN A;  2A73 B;  1SXT A;  4MN3 A;  3ND9 A;  2FHT A;  1BF4 A;  4UDU C;  3C3L A;  3SVM A;  5IGE A;  2K01 A;  1VDZ A;  1ILQ A;  1J8I A;  1DOK A;  4C3J G;  1X3Q A;  2ZXR A;  1S5E D;  1F9P A;  1F2Z A;  1EWH A;  4RCO A;  3P20 A;  5KYI A;  4X3K A;  3NQI A;  1TT2 A;  3MZ5 A;  4IUV A;  1GUN A;  1BCP F;  1CI3 M;  4OO1 I;  2BA1 A;  2WAC A;  1HTL D;  4DAP A;  3DWQ A;  3PUZ A;  3K58 A;  1CM9 A;  2EYH A;  3J81 E;  1Y1W B;  2V4D A;  1D1I A;  3QG1 A;  2DY7 A;  2E75 C;  4FP5 D;  2NVY B;  2YYZ A;  1WTV A;  4NDX A;  4S3S A;  4FXK C;  3FEW X;  2PPB C;  2XVS A;  2RBM A;  1DYQ A;  2R3Z A;  2F0G A;  5C4J B;  1PZI D;  1I6V C;  1TQO A;  5CV4 A;  1EEF D;  1DXM A;  1FD7 D;  5I9O A;  5JAV A;  3N6R A;  1SAP A;  3CKI B;  3SEB A;  3I4L A;  1EY9 A;  4ZAI A;  2PZW A;  3FKI B;  4DFA A;  5M5Y B;  2PZT A;  2Z1C A;  3I72 A;  5FOB B;  1A2T A;  3D6C A;  2AQ2 B;  4M1U B;  3URY A;  1HUM A;  1JWU D;  1Q3L A;  2HCC A;  1PLF A;  3TME A;  1H9M A;  4CKC A;  5EJW A;  2KJX A;  2M2L A;  3HOW B;  1PYW D;  3VA5 A;  2MHV A;  1LTS D;  5DM6 3;  5T1I A;  1PRT B;  1PTO C;  2A6H C;  4C3H B;  2YU9 B;  4X3S A;  4K8I A;  1FYC A;  1G6Z A;  1U4P A;  2C9O A;  4K5W A;  4A3B B;  1EWC A;  2QEJ C;  1TVX A;  4HAE A;  4LK1 C;  4RAU C;  3W2D A;  1SE4 A;  5A35 A;  3VYR A;  4XYO A;  3A55 A;  1WTR A;  1K83 B;  4E6I A;  2RDF A;  1XYI A;  4BS9 A;  5C44 B;  1HHV A;  1Z7T A;  1FR3 A;  2BA0 A;  2FJ2 A;  5IOD A;  2A6E C;  4IUU A;  4KKU A;  5JEA J;  3K5L A;  3H3V C;  1H9S B;  1SEB D;  4R9W A;  3J7A F;  1KNE A;  1UUP A;  3SK6 A;  4WRD A;  2F3V A;  4RWS C;  2OEO A;  1HQR D;  1X32 A;  5C5L A;  1JOK A;  5CV6 A;  3RLF A;  2Q8I B;  2LMC B;  1IYU A;  3MAQ A;  3FPP A;  3GQB A;  3S16 B;  1KLG D;  3TZD A;  1SNQ A;  2F4I A;  5IOC A;  5I6Y A;  3ERO A;  3KBG A;  3KLS X;  2B2T A;  5NUC A;  1IYV A;  3T53 B;  3EQL C;  4HN7 A;  3X3M A;  1DM0 B;  3TSS A;  4WJW A;  2KVM A;  1E0B A;  4O1N A;  2MPM A;  3ND8 A;  1LTT D;  1T5E A;  3BVG A;  5JVG 3;  5A2Q L;  3ERQ A;  1K8M A;  4U67 3;  4FXG C;  3H91 A;  1L0X B;  1PTO D;  2A6H D;  3HP3 A;  5TSS A;  1O7Y A;  5C4X B;  2L0C A;  1GHJ A;  3GP7 A;  4L63 B;  5DAU A;  3PUY A;  2RDG A;  3CRK C;  1RD9 D;  3NHH A;  5FLX L;  5COR A;  2BDN A;  2HDM A;  4BY1 B;  5C0X J;  3V96 A;  3FMC A;  2B2Y C;  1PRT F;  2KHS A;  1I4R A;  1WD1 A;  1JCK B;  3TP8 A;  2XNA C;  2JA5 B;  1Y8N B;  5T1G A;  2Y0S B;  2B2V C;  1AEX A;  3OIQ A;  4DK0 A;  4FF3 A;  2KUM A;  2X69 A;  2A6E D;  1SBB B;  1S5B D;  1JOR A;  4ZK9 B;  5CBA E;  1SYB A;  4MIU A;  2E2D C;  3HOV B;  3S1N B;  1M8A A;  3T13 A;  4TRD A;  3S15 B;  3K6O A;  3M7G A;  4A3F B;  2IX1 A;  1HA6 A;  3PO3 B;  1SYC A;  1EFI D;  2NN6 G;  4U68 A;  1BUV T;  3J7Y W;  1JWM D;  1SYE A;  1TY2 A;  1BQQ T;  2SEB D;  3U9S A;  3D4W A;  4B08 A;  1OXS C;  1C4Q A;  3H09 A;  5ELE A;  3PUV A;  4KD3 A;  1OXT A;  1LO5 D;  5LL6 X;  2L11 A;  4N9T A;  4TKO B;  1LTB D;  2I07 B;  2F0E A;  2A69 C;  5BN4 A;  1CHQ D;  1ZEQ X;  4A3K B;  2ZT9 C;  3IKJ A;  2Z8L A;  1O7Z A;  2KEE A;  3BZD B;  1HA5 A;  4FYD A;  1YNJ C;  2F0I A;  1U4L A;  3SK4 A;  1B1Z A;  2R92 B;  5EKK A;  3JAM L;  4FF2 A;  3S1M B;  1B9M A;  5K5P A;  5J39 A;  2EPB A;  1Y69 U;  2B2U A;  3VR6 A;  4LAA A;  1QJO A;  5CV5 A;  4RHR A;  1DON A;  1ROD A;  3CQZ B;  4XIG S;  2XWJ B;  2HUG A;  5C6A A;  2F1M A;  1E2V A;  3GTL B;  2PNR C;  4DF7 A;  4XQJ A;  3EA6 A;  1R9T B;  2FMC A;  2QCP X;  4QUC A;  1I4X A;  3K5N A;  3J7A V;  1BCP C;  2ENB A;  1BNZ A;  3QWN A;  4EQP A;  2JEB I;  1FNU A;  3RD4 A;  4JK1 C;  2JE6 I;  2Q8R E;  3K5O A;  3VR5 A;  1LTR D;  3A8J E;  1VF5 C;  2HDL A;  3GO5 A;  4UAI A;  1NUC A;  2LS0 1;  3GTJ B;  4J1M A;  4A3D B;  2MP1 A;  2KCN A;  4MHE A;  1WVL A;  1U9R A;  2F3W A;  4F8M A;  5CGK A;  5BN3 A;  1RCV D;  2WAQ B;  4HTH A;  3KLR A;  4FO2 A;  3OWE B;  1SMY C;  3OWF A;  3PUX A;  5KEE A;  3M4O B;  2EYL A;  2QKI C;  3D6W A;  1ML0 D;  1O80 A;  1CA5 A;  2KA7 A;  4OGQ C;  4PQX A;  1T5X D;  3Q6S A;  4IFD J;  2A69 D;  1GUW A;  2VXW A;  4ZLT F;  1TWG B;  2EY2 A;  3HEJ A;  3KK7 A;  1PFN A;  2ID0 A;  1V43 A;  5ISR A;  1G91 A;  2NZ1 D;  2F0J A;  1YNJ D;  2AQ1 B;  1OO9 B;  4DA2 A;  4R8N A;  2PQE A;  1VF7 A;  2F0Q A;  3VYS A;  1UNS A;  1M4V A;  1UEA B;  2RDH A;  3BVZ A;  2VUM B;  5KRU A;  5CC4 A;  1EY8 A;  5ELC A;  4R8I A;  1OXU A;  1B2T A;  1IW7 C;  1WCM B;  4G4K A;  2Z4I A;  4B9X A;  5COY A;  3LWU A;  1SDF A;  2OXP A;  1H9J A;  3IAY A;  2K5D A;  2G9H D;  2G9D A;  3QIA A;  2A5H A;  4HR7 B;  2XWB B;  3HG9 A;  1D2B A;  1LV9 A;  3OOC A;  1A3U A;  1BCP D;  4CJ1 B;  1QB5 D;  4QMG A;  5IT9 E;  1OXV A;  2EYO A;  4ZQ3 A;  3WOF A;  2EY6 A;  5I9P A;  2E2I B;  2E74 C;  5EQ0 A;  4DNR B;  1YNN C;  1V1P A;  1LTA D;  3MC0 B;  4XYQ A;  2JA7 B;  5I2X A;  1D5Z C;  1TII D;  1BDO A;  1JQY D;  2N88 A;  2R6G A;  3D4R A;  1I4H A;  4XT1 B;  1SNM A;  1SND A;  2O4X A;  3P7J A;  3AB9 A;  3D31 A;  1GUG A;  3NBH A;  3W3A A;  3I90 A;  2K6A A;  2MGS A;  3V05 A;  1EIH A;  3NXW A;  1DZ1 A;  2B2W C;  3PIO 3;  1SJH D;  1R4P B;  5C3X A;  1TWA B;  3MEH A;  2XIW A;  5F2D A;  4WOR A;  1SMY D;  3AMU A;  4OIJ A;  1STN A;  2F03 A;  3M4Y A;  2RA4 A;  1ESF A;  2JA8 B;  2SNS A;  5EKL A;  4CJ0 B;  3AU7 A;  5IGG A;  3A8I E;  4HMI A;  1ENF A;  2R93 B;  1H9K A;  1I3Q B;  4F88 A;  2F0P A;  5JPN C;  4C3H G;  4OL7 A;  4G7O C;  1PTO H;  2BCO A;  4A3I B;  1JC7 A;  2MUY A;  1SYG A;  2FMM A;  1I6H B;  1W6K A;  1QNK A;  2RSO A;  3TZU A;  4K14 A;  1EL0 A;  1BXT A;  2L1B A;  2EJF C;  1IW7 D;  1A6X A;  1H9R A;  5IGC A;  2OT2 A;  4KKT A;  5CV9 A;  2J7Z A;  5E3F A;  1HUN A;  1NR4 A;  3FDT A;  1KLU D;  2LKV A;  2EYP A;  4J6H A;  2NTT A;  1NSN S;  3ONA B;  2K32 A;  3QOJ A;  5I6W A;  2F0V A;  1PRT C;  4FXD A;  3S9W A;  4HSV A;  1PXU A;  5JPM C;  2IL8 A;  2C5C A;  5IGF A;  1WTW A;  1F9R A;  1U4M A;  2K1B A;  4K6D A;  4RFB A;  4I65 A;  1LT3 D;  4CKB A;  3VYT A;  3G7L A;  2N55 A;  1PZJ D;  3J80 L;  2AWO A;  2LFN A;  1EIG A;  1MSH A;  1YNN D;  1B4O A;  4ILW A;  5EGT A;  1CQV A;  3D3R A;  5LHY 1;  2VB3 X;  1IKL A;  1VMC A;  3PIP 3;  5LL6 S;  3ZYY X;  2RVL A;  1EEI D;  1MI2 A;  1TU2 B;  1Q8I A;  2PYK A;  4K8J A;  1F9S A;  3R2I A;  2B2V A;  3DWA A;  2DN8 A;  2X6L A;  4KY6 A;  1SE2 A;  1TWF B;  3UI2 A;  4RGO S;  3OW7 A;  3T16 A;  4C2M B;  1NCV A;  1Q12 A;  1QE6 A;  1B50 A;  1R4Q B;  1AN8 A;  4L8J A;  5JEA G;  4KTA A;  4XXE A;  4CKE A;  4BBR B;  2BOS A;  1HRJ A;  3R93 A;  3HKZ B;  5G3L F;  1EY7 A;  5FKA C;  4HMJ A;  4ZRZ A;  3NTH A;  1LAC A;  3CRL C;  4H0L C;  1I4P A;  1QNU A;  3NK9 A;  3IFT A;  1JR0 D;  4GZY C;  2NTS A;  1B3A A;  1RF2 D;  3I3C A;  1LLR D;  2HQE A;  1HXY D;  4EGV A;  3D8G A;  4NMZ A;  2DNC A;  1F2L A;  4V0B A;  2Z4H A;  2K28 A;  1RJT A;  1C48 A;  4AYB B;  5FK9 C;  4FF1 A;  3MXU A;  2EDG A;  1PRT D;  4DK1 A;  1G29 1;  1ZXT A;  3NQT A;  2E2J B;  2BDO A;  1EU4 A;  3I4N B;  1B44 D;  3MA2 B;  1A3T A;  1G2S A;  1A15 A;  4V19 0;  5AFW A;  5KNB A;  1RDP D;  5JOB A;  3L3O C;  4C3I B;  3HS0 C;  4QUF A;  3HOZ B;  4I7Z C;  5BN5 A;  2A74 C;  2M9V A;  1EY5 A;  5DM7 3;  5CYU A;  2EZV A;  1Y1V B;  1SNO A;  2SOB A;  4CHT B;  5D3I B;  3SXH A;  2NVQ B;  5C0X G;  2XRQ D;  4K6L A;  4QB4 A;  3X3N A;  4A3E B;  3HOX B;  4NW2 A;  1V1O A;  1EYA A;  5KND A;  4ABN A;  2K5Q A;  3WDN A;  2F0U A;  2CQA A;  1I4Q A;  1G8Z D;  2RSN A;  3BDO A;  4G57 A;  4IUT A;  2L55 A;  2NUC A;  3GTM B;  4ME5 A;  5J22 A;  2NN6 H;  1CZG A;  2DY8 A;  4KHZ A;  1KAA A;  5J1Z A;  3RUZ A;  1PTO F;  3C1F A;  4BA2 I;  1G2T A;  2OF1 A;  3HZX A;  5E1F A;  1SSO A;  4IUP A;  3TDQ A;  3J81 L;  5ELB A;  3I73 A;  3BVM A;  5C5M A;  4HED A;  2JA6 B;  4P2C B;  4TQU S;  1Z6H A;  4DAY A;  4ZKC B;  3E6Z X;  3MXN A;  4K2L A;  1I4G A;  3U9O A;  1HFN A;  2ICE C;  1B53 A;  2CHB D;  2WKC A;  5M5X B;  2WB1 B;  1ILP A;  3MFY A;  2F0H A;  1GUS A;  2KCC A;  2NN6 I;  5K36 G;  4QF4 A;  3SHL A;  1D6E C;  4DGZ A;  5D14 A;  3S17 B;  2F0F A;  3TP7 A;  2E2H B;  4XQN A;  1CT1 D;  1XX8 A;  4F7X A;  3LX0 A;  3OIP A;  1CQF A;  1HCZ A;  2RKS A;  3S2D B;  4ID6 A;  1EU3 A;  4KKS A;  2WIN B;  1CA6 A;  1O78 A;  1SE3 A;  4PMC A;  1QCB D;  1IL8 A;  1D5X C;  1KDB A;  1EY6 A;  4K5V A;  4KJO A;  2QF7 A;  1DOL A;  3OMG A;  1S5C D;  5KNC A;  1DOM A;  3GTP B;  3NWS A;  4CGY B;  4ODG A;  2JP1 A;  4EQO A;  3TN2 A;  3EJI A;  4C1N K;  3NBI A;  3S14 B;  4HCS A;  1PFM A;  2B2W A;  2JSO A;  4XQQ A;  3GTK B;  1MD2 D;  4KY5 A;  5JVH 3;  3GV3 A;  3DWP A;  2F0S A;  5M3M B;  3NWT A;  2EY1 A;  3WOE A;  1S5D D;  3DHQ A;  4IUN A;  1SFO B;  3E0J A;  4DAV A;  2WKD A;  3NE5 B;  1EZ8 A;  4M8A A;  4ZUI A;  1CZW A;  4IFD G;  2EVB A;  3K57 A;  1EZ6 A;  4QIW B;  4KN7 C;  3KF8 A;  5CR3 A;  4KI0 A;  2K05 A;  1HFG A;  2F0N A;  3MTS A;  5EPJ A;  5EBC A;  5M9O A;  3E5S A;  4K5X A;  4B9W A;  1JE4 A;  3TBI B;  4FF4 A;  2IJ0 A;  3SE0 A;  3A56 A;  4RA8 A;  3HOY B;  3PV0 A;  3ITP A;  2F0O A;  3RZD B;  4KK7 A;  3S2H B;  5IIF A;  1SNP A;  2A68 C;  1GOZ A;  2AWN A;  1TS4 A;  3NTI A;  1JIC A;  2IW3 A;  3MWY W;  5A2Q E;  2B63 B;  3NUC A;  1TY0 A;  4BWG B;  1Y8P B;  2IT1 A;  2EXZ A;  3QB3 A;  1CK1 A;  2SNM A;  4FNF A;  3G6J B;  5EPK A;  3FVQ A;  4OO1 G;  2NVT B;  5FLX E;  1AP0 A;  1KNA A;  4KJN A;  1GUT A;  3LNN A;  2F0D A;  4A3J B;  1LAB A;  1DJR D;  5C3W A;  1S5F D;  5CV7 A;  2PZU A;  2J0T D;  4RGN A;  3C1E A;  3HRZ C;  1STG A;  2EY5 A;  3T51 B;  1SNC A;  5IGD A;  1QWY A;  5CV8 A;  3GTG B;  2XRS D;  3FRP B;  1H9S A;  4RCN A;  2B8G A;  4FVM A;  1CFM A;  2KOL A;  3DMU A;  1KAB A;  4Q0F A;  1XTC D;  3VR2 A;  3M3Y B;  4KV6 A;  1CHP D;  4Y7N B;  2NBF A;  1LTI D;  3L7Z C;  1C8C A;  4RH6 A;  4RGM A;  2IX0 A;  1I50 B;  2D5D A;  1F77 A;  1KTK A;  1HTP A;  4PMW A;  1TS5 A;  3VA7 A;  2XN9 C;  3SDZ A;  3I4M B;  2FIN B;  4EVO A;  2IPK D;  3NTK A;  4IUQ A;  1Y8O B;  3IL8 A;  3KUP A;  1TWH B;  2PMZ B;  3BYT B;  1WTQ A;  2B39 A;  3PMF A;  2NYZ D;  1DD2 A;  1EQV A;  4X3T A;  1AW7 A;  2EJM A;  5D65 A;  1RHP A;  2Q8T A;  2BE5 C;  2CW0 C;  3JAM E;  5C4H A;  5M5W B;  3H6M A;  2A68 D;  3C2P A;  1EY0 A;  1HQM C;  3DXJ C;  1BOS A;  1TS3 A;  1JB3 A;  3C46 A;  5FO9 B;  3K7A B;  3Q22 A;  2L9H A;  1FNV A;  4C3J B;  4C56 C;  4ZKB B;  1J9O A;  1STB A;  2SDF A;  1GJX A;  1KDA A;  2AQ3 B;  1VMP A;  2PW7 A;  4WFN 3;  1TR5 A;  1SYD A;  1STY A;  2AUK A;  1F2M A;  4DXG A;  2B2Y A;  2X6G A;  2ICI A;  2AUJ D;  1GXD C;  4HCE A;  4G7H C;  2CVR A;  5G3L D;  3RMH A;  4H44 C;  4DN4 M;  2ZXP A;  3DEO A;  2KQ3 A;  3HOU B;  4RKL A;  3DUZ A;  3MHB A;  3SK8 A;  1XXG A;  1HPC A;  1ONL A;  1PTO B;  4RGT A;  2O2L D;  1LT5 D;  3BS1 A;  2D2C C;  1ET9 A;  5JEA H;  1LTG D;  4C3I G;  5ELF A;  5DNF A;  2JEA I;  1EYD A;  1V1P B;  1SJE D;  3CU7 A;  1EY4 A;  2WII B;  1WTO A;  1FNW A;  2KED A;  3LWE A;  1GHK A;  3Q23 A;  2ZXO A;  3V2T A;  3QO2 A;  1RTO A;  4XT3 B;  5IGB A;  1BO0 A;  5E4W C;  3MFG A;  1NR2 A;  1ZYR C;  2O5I C;  1NAP A;  1MSG A;  4A93 B;  1ET6 A;  3H94 A;  3QOL A;  5CBE E;  2BE5 D;  2CW0 D;  3VYU A;  1TKW B;  1STH A;  3SR1 A;  4O42 A;  2IX3 A;  2PW5 A;  3D4D A;  1ZKO A;  4CBV A;  3R8B A;  1XWE A;  1D5M C;  2F0K A;  3L9A X;  3OMC A;  1MGS A;  2IWH A;  2QDB A;  4NP5 A;  4IN3 A;  1K8O A;  2I46 A;  2FFK B;  5JJZ A;  2L5T A;  1X3P A;  1AZP A;  2NB0 A;  3P75 A;  4KHV A;  1A2U A;  1MBY A;  3DM1 A;  4DNT B;  1W6J A;  2F0L A;  2J4X A;  4X3U A;  1B9N A;  1LT6 D;  5C0X H;  2EJG C;  5M3F B;  1O7L A;  2EYM A;  5IT9 L;  3K0Y A;  2EYF A;  1SYF A;  4RHS A;  3I8Z A;  3S1R B;  3H0G B;  3MVV A;  1QOH A;  1EQT A;  1U4R A;  4F87 A;  3MXP A;  3MXG A;  1ICW A;  3R3O A;  3KLS A;  2GA4 B;  2K03 A;  5HGT A;  3K5M A;  2LY7 A;  1IHZ A;  3BDL A;  1II3 A;  1UAP A;  1DCZ A;  1D1K A;  4BA1 I;  3KBX A;  1STE A;  3A8K E;  3HGB A;  2KEC A;  3K59 A;  3Q24 A;  3PO2 B;  4KD4 A;  4N9P A;  1PZK D;  2EYJ A;  3DEP A;  1E2W A;  2MJ8 A;  2JXM B;  4NKL A;  1WTP A;  3O13 A;  5C0X I;  1ZYR D;  3M7N A;  4YIJ A;  1V8Q A;  3SK5 A;  5C3E B;  2TMP A;  4KMU C;  2PO4 A;  1FGB D;  5E4X A;  1Q1E A;  5CMD A;  1PMR A;  2QIL A;  5FO8 B;  4EQN A;  2R7Z B;  2L12 A;  4PNY A;  2EOT A;  4Q5V A;  2F0M A;  5I4D A;  4Z9C B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...