4K8IA

Crystal structure of staphylococcal nuclease mutant i92v/v99l
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYVYADGKMLNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 36
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4k8iA00
4N9PA 2EYMA 4F8MA 2EY2A 4ZUIA 1SNMA 2EY1A 2O4XA 3SHLA 4WORA 5ISRA 4EQNA 4OL7A 3EJIA 2F0PA 3EROA 3SK6A 3P75A 1A3TA 2EY6A 3RUZA 2KHSA 4KD3A 5C5MA 2F0EA 4IZ8A 5KEEA 2RKSA 3U9OA 4E6IA 2PYKA 3OMGA 1F2MA 2F0HA 3HEJA 1RKNA 3SK8A 5NUCA 3QB3A 1KAAA 2PZWA 4B9XA 2OXPA 5IGCA 3SR1A 1A2TA 5HURA 5C3XA 2PW5A 5KYLA 5M9OA 1STAA 1SNPA 2ENBA 4IALA 2SNMA 4KD4A 3NHHA 5JAVA 3T16A 2F0DA 3T13A 4ZUJA 2PZUA 1NUCA 3DHQA 2F0WA 5CC4A 3OSOA 1KDCA 1F2ZA 2F0OA 3H6MA 1SNOA 2F0JA 3D8GA 4N9TA 4S3SA 5CV8A 1SYCA 2EYPA 1TR5A 5JOBA 1EY4A 5CV6A 4K2KA 4NKLA 1NSNS 5C3WA 2M00A 1SYDA 2RDFA 1EY0A 4KY5A 1JOKA 2F0NA 2OEOA 4I65A 1SYBA 4ME5A 5DEHA 3SK5A 4DF7A 4PMCA 4DU9A 4K8JA 3NK9A 1KDAA 2EYHA 3NP8A 1U9RA 3DMUA 1EY8A 1F2YA 1AEXA 4ODGA 3LX0A 3D4DA 4HMJA 4KJNA 4TRDA 5CR3A 1ENCA 2EY5A 4K5WA 3V2TA 5C4HA 4HMIA 3NXWA 5CV4A 3VA5A 3C1FA 4EQPA 5IGGA 2QDBA 5CV9A 5IGFA 2KQ3A 4B9WA 3S9WA 4EVOA 2SOBA 4K8IA 2PW7A 1SYFA 5EKKA 1EY7A 3TP5A 5I9PA 4KY7A 1SNDA 2F0FA 3NQTA 1JOOA 3HZXA 3E5SA 1A3UA 1IHZA 2EYJA 4QB4A 4RKBA 5EKLA 3TP7A 5KGUA 4G57A 3ITPA 2OF1A 3MVVA 3OWFA 5IODA 4K5XA 4DFAA 1EY6A 1EYAA 2F0SA 2PZTA 5I9OA 4K5VA 5KRUA 4NDXA 2F0VA 3C1EA 4EQOA 4J6HA 4PNYA 1SYGA 2F0QA 2NUCA 4QF4A 5DAUA 3NUCA 4KTAA 5IGEA 2EYFA 4K14A 3SXHA 3D6CA 5KIXA 5E1FA 5EGTA 1A3VA 4R8NA 5E3FA 2F3VA 3MEHA 2F0MA 3QOLA 4LAAA 4QMGA 3BDCA 1EYCA 5I6WA 4KHVA 4KY6A 5IIFA 1EZ8A 4RKLA 5IGBA 3MXPA 4KJOA 1STBA 2HQEA 3MZ5A 1STGA 1EQVA 3R3OA 1SNCA 4H7BA 4K2LA 4K6DA 5F2DA 5K5PA 2WACA 1STNA 4WRDA 1II3A 2F0TA 4IUNA 2SNSA 5C4ZA 5CV7A 2RBMA 5C5LA 2EXZA 4ZQ3A 3P1HA 1STYA 5J39A 1EYDA 2F0UA 1ENAA 1STHA 3QOJA 3TP6A 1SNQA 4ID6A 1EY9A 4HTHA 2EYLA 1EZ6A 5J22A 3ERQA 4YIJA 2F0LA 3TMEA 5CGKA 5IOCA 1EY5A 2F0KA 3EVQA 4NMZA 2LKVA 5CV5A 3TP8A 4J1MA 5KYIA 4KV6A 1TT2A 5HGTA 5I6YA 3MHBA 2EYOA 3D4WA 1KABA 2F0IA 4MIUA 1SYEA 3OMCA 1JORA 2F0GA 2F3WA 3BDLA 2PQEA 5C6AA 4PMBA 3SK4A 4F7XA 1TQOA 1A2UA 5J1ZA 3PMFA 1JOQA 1KDBA 4NP5A 4DGZA 5IGDA
chains in the Genus database with same CATH superfamily
1LABA 1BUVT 5E4XA 5C3EB 1IBML 3CCUA 5C44G 1A3TA 2AWNA 2UUBQ 4JI0Q 2WB1G 3SDZA 2UUCQ 4GKKL 3H0GH 4J8QA 1SMYC 2A6ED 1G91A 3QB3A 1BCPD 5DNFA 3S17B 4X65Q 3T16A 3A74A 3CCRA 1EIFA 1VQJA 3CCMA 1DXMA 2BOSA 3E9IA 1UNSA 4OXPA 2BH2A 1OXUA 2OEOA 5IP7G 3KJPA 1EU3A 4FF2A 1EL0A 3H3VH 4HIMA 1TWCB 2I07B 1ENCA 2E2IH 1B50A 4HMIA 2B39A 1SFOB 2R93B 4RGMA 3UI2A 1LTGD 4EVOA 4WJ3M 1I4QA 3NSWA 1WTHA 2EJGC 1EYGA 1ZEQX 3E5SA 4GN4B 5EPLA 2DJFC 4LJZC 3MVVA 3GTJB 2UXBL 4DK6C 3NEMA 4K5XA 2TSSA 3CC2A 1XTCD 1EFID 1SDFA 1SYGA 2F0QA 3URYA 1KQSA 2L55A 1V1QA 1J8IA 3E0EA 1FJGQ 3HRZC 1RTOA 3ERSX 1UE1A 1HR0Q 1STNA 2KEEA 4IUNA 1II3A 1E3PA 2KOLA 2AWOA 1N33Q 3CF5A 2NVXH 1G51A 4NXNQ 3S2DB 3HGBA 4DV3Q 1D5XC 2B2YA 2JA5H 4KN4C 3DUZA 5L37A 3L2PA 4HJ8A 1S40A 4L63B 1VQLA 5CV5A 4J1MA 1GUOA 4A93B 3HOVH 1PH9A 3TEHB 2L12A 3BDOA 2EE1A 3BZDB 4P2CB 2UXBQ 1ESFA 3I55A 5K36G 1E24A 4QGUA 2DJGC 4JBKA 1HXYD 4F8MA 3K7AH 3EFXD 3NQIA 2NVQB 3CQZH 4LF6Q 2BE5D 1TWGB 1L0XB 3I8ZA 4GKJL 4BY1G 2XTIA 1F9SA 1Q90A 4XYQA 4GLXA 1JQYD 4DK3C 2K14A 5M9OA 5KYLA 4K0KL 3CD6A 4UP8A 3CMEA 2XIWA 1WTVA 5CC4A 3W5OA 4OWWB 2B2YC 5JOBA 4ILWA 4Y7NH 3G48A 4IFDG 1TU2B 1HJPA 4L8JA 2N8NA 5JJZA 1RHPA 1VQCA 3KUPA 1UE7A 2JA8B 1MIUA 4JV5L 3U4ZA 1Z7TA 5C4XB 2PI2E 3CW2C 1MD2D 2I0QA 4JC0A 2D9UA 5CV4A 1AN8A 3HOZB 3G71A 3VA5A 4OX9L 2K33A 2KQ3A 1VQIA 2HUGA 2VB3X 1VQOA 2YTVA 1Q46A 1HUNA 2IY5B 5FK9C 2FHTA 1NBWA 3T4AC 1J6QA 1B4OA 3ND8A 1EY6A 4LFAL 5EBDA 3K0XA 4K5VA 1LTID 2F0VA 3N52A 3C2PA 2QGQA 1MKHA 1SMYD 1NNXA 5IGEA 5FLXc 3PUVA 3I4MG 1Q86C 1Y8OB 3I4NB 1Q1EA 2IX0A 3BDCA 1S3OA 1Y1VB 1VQDA 1SN8A 3AMUA 1D8LA 3E9HA 5K5PA 2NWGA 1S5BD 3KBGA 2F0TA 2E5LQ 1WD0A 4KKTA 2CW0C 4L5RC 5FO8B 4FF1A 2MUYA 3BU2A 1C4QA 4OWXB 3TMEA 3PO2B 3OIQA 4A76A 4KV6A 4XT3B 3C3LA 1KHIA 3CU7A 1N32Q 1KXLA 1KABA 2JEBI 3K81C 1HQMC 2RQXA 5ELEA 1KL9A 4B3TL 5C4JB 1A0IA 4GZYC 2EY2A 4HR7B 4A3GB 1V1OA 4IURA 1X3QA 1YHAA 2NN6I 1X54A 1NY4A 3FKIG 1HNXL 4H0LC 1JJ2A 1HFNA 1PH1A 2EJFC 1Y8NB 5KNBA 4IALA 2SNMA 1B53A 2QEXA 1C7YA 2Q8TA 3X3MA 3FEWX 1QUQB 4HJ9A 1KRSA 4JI5L 5LMUL 3KLSA 4JVZA 1J9OA 1SYDA 4DR7L 2VQEL 2F0NA 1ASZA 3SK5A 3HOYG 3VR4A 3NP8A 2R61A 3GTKH 1I50H 4HMJA 1JJCB 5I2YA 3TBIB 1QCBD 4IOCA 3S9WA 4DKAC 1D5ZC 1FL0A 3OTOL 2E2JB 3NTHA 3KF6B 1EIYB 4JI5Q 1Q82C 3H0GG 4QB4A 4RKBA 1XMQQ 3M4YA 4P75A 4R1JA 2MNAA 3DXJC 1Q8IA 3VA7A 3I7FA 3HOUH 2VZAA 3CRKC 5M5YH 3AEVA 1WCMH 4FF3A 1LTRD 3SXHA 3GTLB 3KLSX 2B63G 5E3FA 2RF4A 3MA2B 2F0MA 2WAQB 2NZ1D 2X6GA 3STBC 5LMUQ 1N32L 4HJAA 4DV5L 2XSCA 5HURA 1IKLA 3BJUA 2WACA 2L5TA 3GTQB 1I5FA 1JT8A 3CQZB 3GTOH 4ZQ3A 3P1HA 4LUVA 4YWMA 1K9MC 3QOJA 4TSSA 2NYZD 4C3JH 3U50C 1EQQA 4YIJA 4G4KA 1KAWA 4Y52H 2LKVA 3I4NH 1EQTA 2N3SA 1WFQA 2WIIB 3HOXB 2F0IA 5IYBG 2M2LA 1X32A 4X66Q 3HOXG 2F3WA 4A3FB 1Q81C 1UEAB 4DV4Q 1BQQT 4LF8Q 2EYMA 2KBNA 2RCNA 1QE6A 2MPMA 3D0FA 4Z9CB 3KDFB 1LTTD 4KKSA 3TS0A 2B8FA 2KEDA 4EQNA 1QZGA 1VF5C 4NPSA 1WD1A 4DR7Q 3K57A 2L11A 1X56A 1VQKA 1K0SA 1SEBD 1HRJA 1VQ8A 3M7GA 1QOHA 3QJYA 1E2ZA 1H9RA 1F2MA 3NPPA 1KLGD 2LFNA 4K6LA 4DPGA 5FLMH 5C4XG 3SR1A 3PUZA 1TWAB 3H94A 1QILA 3OW2A 1VS0A 3AYHB 3K0YA 3IRBA 3GTPH 4X3TA 2WP8J 2E2HB 1FD7D 4DV1L 1PRTB 2EYPA 4LFBQ 2R7FA 1NSNS 4DAYA 3J7YW 4XQNA 3M3YH 2EVBA 3SE0A 1B3AA 1EU4A 2FJ2A 1IL8A 2CQOA 3C46A 1E1OA 2CCZA 1B70B 2JA6G 1D7QA 2GVBA 3NXWA 2NZHA 3ZYYX 2B2TA 5GAGC 1C0AA 1O7IA 1LTLA 4QUFA 1CZGA 4B9WA 4EX5A 2CWAA 1IBMQ 4J15A 1JJGA 1WTWA 2E2HH 1JOOA 3I2ZA 3KYHC 3DLLA 2K04A 1ESRA 1FJGL 3S1NB 1LTBD 4YY3L 2PPBC 5KRUA 3RZDH 3PO3B 1B9MA 3F2CA 1DCZA 2B29A 5JEAJ 2XWJB 2YTXA 5IT9c 1PH5A 4H44C 3HOVB 1X3EA 2R7ZG 5AJ3L 5J3BA 3KOJA 4DV0L 4KMUC 2WAQG 2E2DC 1CI3M 4YHHL 4UP9A 4A3JB 4C3HG 5I6WA 4KHVA 4A3KH 1X3PA 3BVZA 1RODA 3QG1A 1YNND 4RKLA 3CAMA 4DXGA 2ASBA 1STGA 5COYA 1YNXA 2N55A 4GLVB 3CRLC 3HKSA 1CT1D 4YCUA 4RGOS 3TRZA 1H9SA 3HOYB 1NMGA 1LT5D 1UAPA 2GN5A 3TP6A 4PZ7A 4A3EH 3KBXA 4JI4L 1PTOC 2F0LA 5IOCA 1XYIA 4FNFA 2LS01 1XMQL 5BR8Q 1GD7A 3D4WA 1JCKB 1NTGA 4DR1Q 1JORA 1MBYA 2F0GA 1PH2A 4PMBA 2FMMA 4XYOA 1A2UA 1PH4A 3GTQH 2K75A 1VQHA 3CPFA 2BH8A 2JA9A 4C2MH 1M1KC 1R4QB 5ELNA 4ZLTF 3SHLA 2VB2X 1E0BA 4IPCA 2JA7B 5AJ3Q 2I5MX 5C44H 4V190 2F0PA 4LF4Q 1I3QH 3PIP3 3J81L 3H91A 4KHZA 4BY1H 1AFPA 2F0HA 1I94L 5IGCA 1XJVA 1E7ZA 1UEBA 1PH6A 1YBYA 3VYUA 3H6MA 4CJ2C 4KHPQ 1V8QA 3OW7A 1XPUA 1CA5A 4ZCKA 1FGUA 4I65A 2YU9H 4A3KG 1CKMA 2PO4A 2GVAA 1JWSD 1U9RA 4A3BH 4TRDA 1K8MA 4K5WA 1DOKA 1S5CD 2IWHA 1TIID 4I7ZC 2B2WA 4DR5L 1XNQL 4XTCS 4LFAQ 4JI1L 5IGGA 1XXGA 1VQFA 1CQVA 4HIDA 3VR6A 1AP0A 5EKLA 1IW7C 3PV0A 3H0GB 3M3YB 4O0AA 2D5DA 5M3MH 5ELDA 3KLWA 4CKBA 4NDXA 3DWPA 3A5ZB 2XWBB 3M7NA 2IX1A 5M3FH 1PFBA 4DN4M 1B44D 4KHPL 3TZUA 5CYUA 4A3LH 5D3DA 1GKHA 3BZCA 4PZ6A 1RD9D 1H9JA 1GUWA 2NTTA 2BDOA 3MXPA 2A6EC 4JPBW 1FGBD 1RIPA 2Q8IB 3NWSA 3NELA 1L0WA 1QUQA 1AZPA 3RNUA 2KCCA 4RG1A 1W6KA 3OYYA 2A68D 1C8CA 3STBD 2XRSD 4DAMA 4H13C 3A8IE 4LF4L 1EUJA 5GAHC 4LNQA 1Q1BA 4QUCA 4NMZA 2H1EA 2A69D 1YJNA 1TT2A 5LMNW 2R92G 3CCVA 2FFKB 3HOVG 2NTSA 1FNVA 1LTAD 2K7VA 2AQ3B 4C1NI 3CPWA 5C6AA 3MXNB 2JXMB 3TREA 2K01A 3H15A 2CQAA 1VQ7A 4QJFA 1G8ZD 1L1OC 4A3BG 1JOQA 2E5LL 2D0OA 1YNJC 2MFIA 2OQ0A 5ISRA 4A3MB 3TQYA 2HIXA 4XDXA 3GTJH 3Q24A 3PUYA 2WB1B 4PQXA 2VS1A 3KK7A 2PYKA 1K0RA 1O80A 4A3JG 3TZDA 1CQFA 1OXXK 1X3FA 1VQBA 2PZWA 1XMOQ 1IL2A 1IYJB 5LHY1 1D1KA 1LT3D 1SNPA 1CUKA 5JAVA 4NXNL 4Q0FA 4X6AH 2F0WA 2YU9B 2RHQB 2F0JA 5LL6X 5A2QE 1SYCA 1PH8A 2E74C 3S1NH 3AB9A 1ONLA 3U58A 1Y1WB 3KJOA 3DM1A 4O2DA 2MHVA 1G2TA 1CHQD 2KVMA 1U5KA 1CKNA 3LX0A 4MHEA 1Z47A 2EY5A 3S15B 3DWQA 1ML0D 1GOZA 3PUXA 3RLFA 4GOPC 1VQNA 4IUPA 4IOAA 5LL6S 2PW7A 1DOMA 5H1SE 3IFDA 1B3QA 2GA4B 3B6YA 3HZXA 3WDNA 2FINB 2VW9A 1U4RA 2VQFQ 1Y1WH 1B7YB 3ITPA 4IUVA 4R4TA 3S17H 1I6VC 3UDGA 3OWFA 2IPKD 1IXRA 1I4HA 4YCWA 2ZJPA 4PNYA 2UUBL 4JI0L 1F77A 2EYFA 4B08A 3D6CA 3J7AF 2B63H 2R93G 3J7A5 2F1MA 5BN5A 4KY6A 2OTLA 4N8X1 2E75C 5IGBA 4H7BA 4A3EB 2ZTCA 4A93H 4BXXG 4WRDA 2JJQA 3D31A 3EA6A 3K7UC 1A6XA 1I6HH 1LACA 1L0YB 1EZ6A 1SLJA 5CGKA 4U673 2OWOA 2KHIA 3D6WA 1PFSA 3EVQA 1QVGA 3I4NG 1JE5A 5M3FB 5CMDA 4TQUS 2CVRA 4DUZL 5JVH3 2NZOA 1BCPB 1IBLQ 1SE4A 3Q23A 1H9KA 1SSOA 2NB0A 2BCOA 2K6AA 3LGJA 2V1CC 3F2DA 2QEJC 2N88A 1BO0A 2ALYB 1KDBA 4NW2A 3DEPA 2HDMA 4ZRZA 2ZTEA 4JI8Q 1IYUA 1QZHA 2E8GA 5KNCA 3P75A 2R7DA 1T5EA 4YWKA 4GKJQ 1CK1A 5KEEA 5JJLA 4RGNA 4R4OA 1SROA 3CCEA 2Q2TA 4ABNA 1SR3A 1A2TA 1CHPD 1YZ6A 2ENBA 3T1HL 4DV4L 4ZUJA 3S2HH 2EZVA 3OSOA 5EBCA 1PZKD 2A19A 1TS5A 5CV8A 3G6EA 4KI0A 3CCJA 1A62A 1X65A 1TR5A 4A3BB 3GTGH 1A15A 4ZKBB 2R93H 3QO2A 3OTOQ 1CZWA 4QCLA 3G4SA 2E2JH 1HUMA 2UXCL 1TWCH 2HD3A 5T1GA 4HSPA 3S2HB 4BBSH 2OTJA 2A6HD 2E2IB 2Q2UA 5FO7B 1I4XA 1PLFA 1S72A 1N36L 1PRTD 2RDHA 4HCEA 2K5WA 3TP5A 1Y8PB 3GTMH 2CFMA 2Z4IA 2DGYA 1XMOL 3GTGB 2OF1A 1ZYRC 4UP7A 4IFDJ 4DFAA 3TS2A 2H4OA 1VDZA 4QF4A 1RL2A 5DAUA 3NUCA 1D5MC 5FJ8G 2JSOA 3CKIB 4G7ZC 2R92B 4JK1C 4DV3L 4RH6A 1JWMD 1C9OA 3MXNA 4K0KQ 3CHBD 1BKBA 1HTPA 1RTNA 1W6JA 3DWAA 4IJLA 4AQYL 3E6ZX 2RDGA 3RZOH 2DY7A 1U4PA 1TWFB 4FP5D 4JI3L 3HOWB 3ULLA 4JI7Q 3M85A 5C4JH 2EYLA 2NVXB 4JCVE 2MP1A 3ERQA 4AIMA 2VUMB 2HQLA 1K83H 4YWLA 2AKWB 1N34L 3MHBA 2EYOA 1F9RA 4JI6L 2BE5C 2AQ1B 4CBVA 3RN2A 2BDNA 3G7LA 4OX9Q 1VQ5A 1TWFH 3S24A 2BA0A 3KF8A 4JBJA 3A7LA 1IYVA 2PMZE 2LSSA 3A7AB 2A69C 1VQGA 2Z8LA 2B3GA 4IFDI 3L7ZC 3ZJYC 2K52A 4JI4Q 3SK6A 1K8OA 2ZXOA 2F3IA 1AH9A 4C56C 1VQ4A 1NR4A 1HNXQ 1VQMA 2RKSA 1NE3A 4LFBL 1WCMB 3MEFA 5NUCA 4CKEA 4N8FA 2PW5A 4H02A 1STAA 5FO9B 1ET9A 1VMCA 3T13A 4LFCQ 1SJED 3K6OA 3A56A 2O5JC 2K5QA 1EWHA 3PSIA 1HZCA 4AH6A 1CA6A 2YV5A 1A63A 1EY4A 4NB3A 1EWIA 3Q8DA 5F2DA 4ME5A 4EQ5A 4IPGA 4K8JA 5GROA 1FR3A 4ULLA 3K5LA 2K1BA 1EY8A 1AEXA 3FVQA 5C4HA 4LF8L 4YY3Q 1SE3A 3J81j 4EQPA 2L0CA 4U68A 1WVLA 2VL6A 1XPOA 4R4IA 4MNOA 1SE2A 1YIJA 5C3EG 1OTCA 1UE5A 3Q6SA 1WJJA 2EJMA 5HY6A 1NR2A 1C48A 1O7YA 2Y0SB 4POFA 4JI7L 3LWUA 2G9DA 3GTPB 2NVYB 5DM63 4PMWA 2YTYA 2XRQD 3HG9A 2MO1A 5EGTA 2K03A 4DV7L 5I2XA 1LLRD 4WJ4A 5IIFA 4EGVA 4KJOA 2AUKA 4GN5A 1CM9A 2ICIA 1V1PA 1IBKL 5GQOA 1HFGA 5C5LA 3BVMA 2VUMH 5HGQA 1STYA 2F0UA 1PTOD 4A3FH 3FP9A 1SNQA 4A3IG 1LV9A 4JI1Q 1BCPC 3D3RA 4HAEA 3AFQA 3GV3A 4LF7L 1GXDC 1QNKA 2MO0A 1R9TB 2HT1A 5C0XJ 3E3XA 3CCLA 4LF6L 3R2TA 2ATWA 1K73C 4BY7H 4B3ML 3S1MB 4ZK9B 3WOEA 1QWYA 1HQRD 5ELBA 4AYBE 5M3MB 1FNWA 2NN6H 3A5UA 4N9PA 1HA6A 2O4XA 5IY0A 2RA4A 4A4IA 3K5NA 2B2VA 3T1YQ 3U9OA 4RHRA 1UUPA 3V05A 3OMGA 3CP0A 3HEJA 1K8GA 2NVTB 1DJRD 4POGA 3X3NA 4L5TA 4APVA 1HR0L 2IL8A 1STEA 3F2BA 4DV5Q 4S3SA 4IFDH 5LMNL 4K2KA 1N34Q 1TXYA 2J4XA 2RDFA 4KY5A 5DEHA 4CHTB 4A3IB 3ER0A 3VYSA 4GOPB 1BF4A 3D4DA 4KJNA 1H9SB 4B3SQ 2VUMG 3V2TA 1PYBA 4GN3B 4DNIA 5FLXL 2UXDQ 2L1BA 2AUJD 3BZKA 5EKKA 1EY7A 3M4QA 3CMAA 3T1YL 2JA7G 4B3RQ 2PQAB 4M8AA 1EEFD 1G291 2KENA 4CDFC 3F2UA 2A6HC 1EYAA 2JN4A 1D1IA 3C1EA 1ILQA 1H9MA 3H09A 4OWTB 1MSGA 1O78A 4BY7B 2F52A 1T9HA 3S1RB 1VQ9A 1Y14B 2D0PA 1I6HB 2HQEA 1SNCA 3ND9A 1WI5A 4UHVA 4HIOA 3DEOA 2OT2A 2VNUD 1DONA 1TS4A 1B1ZA 1L1OB 1Z6HA 3NBHB 2SDFA 1TWHH 2WKCA 1HNZQ 2ZJRA 4ID6A 3UDFA 3MFGA 1EY9A 5JJKA 2Z6KA 3JC66 1DYQA 1LT4D 3PO2H 2R92H 5TSSA 5I6YA 3VYRA 3J81c 1BVSA 5IYBH 3HOXH 4DR4L 3IFTA 4QIWB 3S14H 1WTXA 2XN9C 2QKIC 2X6LA 3BG3A 1JC7A 1TWHB 4YCVA 4R9WA 1PYSB 1QVCA 3Q0AA 1NAPA 3R8BA 4HIKA 2R3ZA 4C3HH 1FVIA 2Z6BA 1QB5D 2LXKA 3K8AA 3OPOA 3M4OB 1PFMA 1MI2A 3KDFA 4RCOA 2L15A 4JOIA 2IT1A 3KF6A 1EEID 1AE3A 3RR5A 2KCMA 4OIKA 2PZUA 3DHQA 5D65A 3JAME 1F2ZA 1SRUA 4LW1A 3VDYA 1KRTA 1HHVA 5C3WA 1V9PA 3GP7A 4A3DB 4DR4Q 2CH4W 4HEDA 3FRPB 5G3LF 5CR3A 3CCSA 2F03A 1M4VA 4PZ8A 3JAML 3QIAA 3HOZH 4CDEC 1GVPA 4JI8L 3GV6A 2ZT9C 3TSSA 2HDLA 1YITA 2AQ2B 1XNRL 5BN3A 3A0JA 2FMCA 1M90C 4DR6L 1SNDA 5C4ZA 4FVMA 2EYJA 1LM0A 3K7AB 4LUZA 1F2LA 4DV0Q 1DGSA 1IZ6A 3FKIB 1X9NA 5I9OA 1HR0W 4BBRB 4GOPA 1G6PA 1I4PA 2ICEC 5AFWA 1LTSD 4K14A 4BY1B 2HHHL 3I56A 5E1FA 4IUUA 2EXDA 2F3VA 2RCFA 3S14B 3PIOA 1EYCA 2RVLA 4XQJA 1WTQA 3CC4A 3MAQA 1XNRQ 1ASYA 2D62A 4DUZQ 3GTOB 4IUQA 1PRTF 2JA5B 4AYBB 1E2WA 3A55A 4DNTB 3NE5B 2DY8A 2F0KA 5KYIA 5A2QL 1UWVA 1D2BA 1B8AA 3GDEA 1VF7A 3S16H 1PTOB 2JK8A 2PQEA 4F7XA 2LMCB 2LY7A 1BXTA 3G6JB 3KF8B 4R4CA 1SBBB 1S5ED 4MTKA 3W1GA 2UUAL 4A3KB 2WV6D 2KHJA 3EJIA 2C5CA 3QR8A 4GS3A 3GD7A 1VQ6A 1HPCA 4E6IA 3RLOA 3M4PA 2YYZA 2L4NA 4X3UA 3EQLC 3NHHA 5EPKA 3OHXC 3R2IA 4N9TA 2K05A 2ZJQA 2R6GA 2EPBA 4KK7A 2HCIA 3TN2A 2VQEQ 2JA8H 1SJHD 5IP7H 5IT9E 1KDAA 5EAYA 3F1ZA 4IJHA 5EJWA 1VQAA 3GTKB 1IW7D 4X64L 3UDXA 4FDBA 1TY2A 2IW3A 4BWGB 4MTNA 3GO5A 1KTKA 1JR0D 4LMQD 4RWSC 2K5HA 4L5QA 4XQQA 1GHJA 2A74C 4KY7A 2TMPA 1HZ9A 1PRTC 4A3GH 4DV7Q 1S4ZA 1ZXTA 4C3IG 5DLQE 4DV6Q 4BBRG 5C44B 4A3MH 4HJ7A 1HNWL 1UE6A 4J6HA 4QQBX 2ZXRA 1MJCA 3J80L 5KIXA 4CKCA 1SXTA 3L3OC 2A68C 3VR3A 2MGSA 4QMGA 4XT1B 2A8VA 1HZBA 3NTKA 5EPJA 5KNDA 1G6ZA 3GQBA 4KN7C 1PTOF 1BCPF 3BVGA 4JI6Q 3P7JA 2L9HA 2JP1A 2VXWA 4HTHA 2PNRC 5J22A 1EY5A 4OO1G 5JEAG 3T51B 1IKMA 1E2VA 3VR5A 2ES2A 3M9BA 3CC7A 3BDLA 1VMPA 3SK4A 1TQOA 3J80c 3J80E 4F88A 2I46A 4BA2I 4QY7A 5IGDA 1XX8A 3I4LA 5IYDG 3J80i 4ZUIA 1SNMA 5GAEC 4KLKA 4OL7A 3HOUB 3S1RH 1PZID 3KLRA 5IWAQ 4LF7Q 1DM0B 1PDQA 1OXSC 3MFYA 2WAQE 3SK8A 1RKNA 4GNXB 4B9XA 3LWEA 5JPNC 1HTLD 3OIPA 4JYAQ 2A1AA 2JQOA 4BA1I 1P8LA 3HKZG 3U4VA 2ID0A 4RFBA 5A35A 3K5MA 5M5XB 2G5DA 1ENFA 1Z9FA 3RD4A 4P73A 4WFN3 1X55A 2B2VC 1NJIC 1CSPA 4FF4A 4DK1A 1GO3E 1BNZA 4LF5L 3S1QH 1EY0A 4BBSB 1JOKA 5JJIA 1PVOA 1SYBA 1B2TA 1BDOA 1OXVA 4V0BA 1Q3LA 4UY8C 3DMUA 4B3RL 2K4KA 4DR2L 1I50B 3RMHA 2JYOA 4G7HC 4DAVA 2QW7A 1CKOA 2O2LD 2KA7A 3RN5A 2B8GA 4K8IA 3PIPA 4JBWA 1ET6A 1V43A 1F9QA 1G2SA 5C3EH 1A3UA 1IHZA 1TKWB 1AE2A 1MHWC 2G9HD 3D4RA 4CGYB 3S1QB 3K80C 4G57A 1JB3A 4P71A 5IP9H 1YHQA 1OO9B 4CJ0B 3HOUG 3SEBA 3WWVA 3A8KE 5C0XI 5K36H 2K5DA 4LWCA 4AYBG 3ICEA 4B3SL 5IYDH 5CBAE 3FPPA 4LK1C 1HNZL 1A3VA 1V1PB 1OXTA 3MEHA 2ZM6Q 3UDIA 3ULPA 1SE8A 1BBWA 3R3OA 4K2LA 4ZYSA 5D14A 3EIVA 3SGIA 3UE1A 4B3MQ 5CV7A 2QCPX 5J39A 3NBHA 4X65L 2IHEA 1PXUA 1NCVA 3S16B 4C3JB 2Q2HA 1ZKOA 2UXDL 5GADC 3TP8A 2C35B 1VQEA 3PO2G 2J7ZA 4BY7G 5FKAC 4MIUA 1SYEA 3OWEB 2CW0D 1VQPA 1CSQA 4DR1L 2Y0SE 3T56B 1W3SA 1LT6D 3Q22A 3K58A 1RCVD 2EY1A 3GTMB 4A75A 3P20A 1RJTA 3EROA 5ELCA 4M1UB 1ICWA 1ILPA 4P72A 4O42A 4QIWE 1FYCA 4IO9A 1I94Q 4LF9Q 1YHBA 1L2FA 1E22A 3VYTA 4DV2L 4DR3L 5CORA 5M3MG 2O5IC 1NUCA 1M8AA 3F8TA 2UXCQ 2X69A 1KDCA 2WFWA 3IL8A 5CV6A 2M00A 1J5EL 1EOTA 4DF7A 1N36Q 2EOTA 4HSVA 3LNNA 4ALPA 2M9VA 2AHOB 1FNUA 2EIFA 3MWYW 2P5ZX 4UPAA 1N33L 2JA6H 2B2UC 4DR3Q 1AZQA 4A3CH 1MSHA 3PF5A 1R4PB 4X3KA 4GNXC 4DK0A 1HZAA 2ZTDA 4C3HB 3H3VI 5M5XH 1S5DD 2NVQH 3TP7A 2Q8RE 4HN7A 1Y1WG 1KC8C 2K5NA 3NWTA 2PNHA 4L5SA 1WTRA 4UDUC 1I3QB 3EN2A 5BN4A 2HIVA 2QA4A 2A73B 3A8JE 4DUYQ 4XIGS 5FJ8H 1VCIA 2R7ZH 3PGZA 2DNEA 1YNNC 5LMNQ 1GM5A 2WB1E 3AFPA 3FHWA 4OELB 2QF7A 1LYLA 4C1NK 2J0TD 4IUTA 1PA6A 1L1OA 1EYDA 2KJXA 5CBEE 1STHA 2H5XA 3HKZE 4O1NA 3K59A 1DZ1A 2JA5G 1EOVA 3R93A 5E4WC 4ZKCB 2RSOA 1WTOA 2UUAQ 2R7ZB 1ICFB 3S2DH 2EDGA 3OMCA 1U4LA 4OIJA 3HOYH 3NENA 4BBRH 2K50A 4Q5VA 3I3CA 4RGTA 1W2BA 5I4DA 4ZAIA 2F4VL 4DGZA 4KKUA 4G7OC 1DD2A 4DA2A 1LUZA 2I5LX 3FPUB 2KUMA 5BR8L 3RZDB 1YI2A 3BYYB 1J5EQ 4X66L 2EY6A 2ZM6L 4IPHA 4KD3A 4IZ8A 3QWNA 2JA6B 1TS3A 4IPDA 3N6RA 2OXPA 3NTIA 1PZJD 3BYTB 5IT9L 1N8RC 1TY0A 3PUWA 4A3IH 3JAMi 5M5YB 1SNOA 3PO3H 4X62L 2MQHA 1KD1C 2OCEA 4OO1H 1KNAA 4JW0A 4NKLA 1QG7A 3H3VC 3WOFA 2CH4A 2F4IA 5IWAL 1Q12A 2KECA 2QILA 1XWEA 2K28A 3RLNA 2NN6G 3HFZB 1EWCA 1LO5D 4DV6L 3C1FA 3I73A 4RA8A 4TKOB 2HCCA 1YJWA 4DAYB 2QDLA 1GUGA 3NQTA 5HGTA 1I4GA 5ELOA 3DM3A 4DAPA 3L0OA 5IODA 2F0SA 1ZYRD 4A3MG 2B2WC 3VR2A 4DR2Q 1JMCA 2NUCA 1BBUA 2K5VA 4OEMB 4QL5A 1IBKQ 4KTAA 1P16A 1SMXA 4JI3Q 1HH2P 4FXKC 4CDDC 5JVG3 1TWAH 4X62Q 5M3FG 1QJOA 5M5WB 2B2TC 2NVTH 3FDTA 1EZ8A 1STBA 3AU7A 1PFNA 3I70A 2PCFB 3T53B 3BS1A 2SNSA 5FLMG 2RBMA 1AW7A 4RCNA 2AMCB 2OQKA 4IQZA 5FLXE 3L9AX 2RSNA 1HNWQ 1Y1VH 1GUTA 2E76C 4F87A 5C0XG 1PV4A 3U9SA 2RHSB 1CFMA 3PO3G 4DR6Q 5M5WH 2D2CC 5JEAH 2UUCL 4GKKQ 3I4MB 2PI2A 1JB7A 4L6TB 2WKDA 2Q2IA 5EKIA 1PMRA 5J1ZA 4R4QA 3A54A 2UU9L 2JE6I 5FOBB 3KFUA 4WORA 2HHHQ 4JBMA 1CKNB 1TS2A 4GNXA 1EIGA 2PMZB 3IAYA 2I5HA 1D6EC 4RMFA 3FKIH 3GTLH 5C5MA 1HCZA 2MJ8A 4A93G 1MJEA 4BXXH 1TVXA 1X6OA 3I4OA 5C3XA 2Z9HA 1GJXA 2LXJA 4AQYQ 3JAMc 1SFOH 4A3DH 3T1HQ 3O13A 4DV1Q 4OGQC 4P74A 3D8GA 4I7AA 1PH7A 2Z1CA 4C3IB 3V96A 4MN3A 3PIO3 3ONAB 2BA1A 2IX3A 2JA8G 4XXEA 4DU9A 3NK9A 2EYHA 2WINB 2F4VQ 1YEZA 2N49A 2IJ0A 1JICA 1S5FD 4DV2Q 2JEAI 1O7ZA 4A3EG 2QDBA 3M4OH 1EQRA 1Y1VG 5C0XH 1DOLA 1IBLL 2Z0SA 3ULJA 4UAIA 3W2DA 1GUNA 4BS9A 4NXML 2JA7H 4A3GG 3J81E 5D3IB 4FO2A 1GUSA 4C3IH 3UE0A 5IYCH 4DR5Q 1XNQQ 3OOCA 1E1TA 1KNEA 4X3SA 3K5OA 1WCMG 4HCSA 1YNJD 4FYDA 1MGSA 2ZXPA 4CDCC 1U4MA 3SVMA 3I4MH 2XVSA 1TWGH 4R8NA 3IKJA 2VQFL 1WTPA 3QOLA 4LAAA 1WYDA 4LF5Q 3J81i 4FXDA 3MZ5A 3PF4A 1EQVA 2V4DA 4HJ5A 4MZ9A 3W1BA 4RAUC 3I91A 2UU9Q 1BR9A 5G3LD 4X64Q 1ENAA 1PTOH 4A3CG 4GLAC 1X3GA 3MTSA 4BBSG 2N78A 3PQIA 4A3DG 2C9OA 1BOSA 3PCOB 1K28A 1K3BC 4PG3A 2A5HA 3CCQA 1YVCA 3W3AA 1K3RA 1PYWD 3PMFA 2XNAC 3I90A 1QVFA 4JI2L 1HA5A 2Y0SG 1B9NA 4OONA 5T1IA 3RUZA 1JWUD 2KHSA 4DNRB 4R8IA 2F0EA 4RHSA 1F9PA 4JV5Q 1EIHA 2NVYH 4B3TQ 2NBFA 3FMCA 4A3JH 1KAAA 1XTDA 3I72A 2FXQA 5C4XH 1U0LA 2B63B 5IYCG 4KD4A 4LFCL 2F0DA 1QNUA 1XPRA 1K8AC 2F0OA 2CWPA 1YJ9A 1BBXC 3MXGA 4YHHQ 1JE4A 1WOCA 2SEBD 4A3LG 3TDQA 3HOWG 4PMCA 4IN3A 3S15H 1SAPA 4ODGA 1F2YA 2CKZB 4LF9L 2Z4HA 3NBIA 3E0JA 4JI2Q 1Y69U 3HOZG 1EFWA 4A3FG 1PH3A 1KIXA 3J7AV 4TVAB 5CV9A 3HP3A 5IGFA 2DN8A 2SOBA 4ME3A 3EBEA 1SYFA 5I9PA 2F0FA 3HKZB 4FXGC 2PQAA 2DNCA 3HS0C 5IP9G 5KGUA 2XGTA 5DM73 2K32A 1PHJA 4Y7NB 1Q8KA 1O7LA 3J7ZC 4LUOA 2PZTA 4OO1I 4JYAL 2CHBD 3MXUA 2B2UA 4DXFA 4EQOA 1CTMA 2VY3A 4OHJA 1RF2D 4C2MB 4JG2A 1T5XD 2Z6KC 1RDPD 2DUDA 1NMFA 5E7NA 4CJ1B 2IHFA 4K6DA 2KCNA 1H95A 3MC0B 2EXZA 1N9WA 2EQSA 4C3JG 1Q7YC 5IE8A 5EQ0A 4DUYL 1K83B 5JPMC 1R9TH 1GHKA 3AQQA 5ELFA 2KCTA 3RZOB 4NXMQ 3S1MH 3CXCA 4PV1C 3HOWH 4JOIC 1KLUD 1A8VA 1I4RA 4NP5A 4WJWA
chains in the Genus database with same CATH topology
1LABA 1BUVT 5E4XA 5C3EB 1A3TA 2AWNA 3SDZA 4J8QA 1SMYC 2A6ED 1G91A 3QB3A 1BCPD 5DNFA 3S17B 3T16A 1DXMA 2BOSA 1UNSA 1OXUA 2OEOA 1EU3A 4FF2A 1EL0A 1TWCB 2I07B 1ENCA 1B50A 4HMIA 2B39A 1SFOB 2R93B 4RGMA 3UI2A 1LTGD 4EVOA 1I4QA 3NSWA 2EJGC 1ZEQX 3E5SA 5EPLA 4LJZC 3MVVA 3GTJB 4K5XA 2TSSA 1XTCD 1EFID 1SDFA 1SYGA 2F0QA 3URYA 2L55A 1J8IA 3HRZC 1RTOA 1STNA 2KEEA 1II3A 4IUNA 2KOLA 2AWOA 3S2DB 3HGBA 1D5XC 2B2YA 4KN4C 3DUZA 4L63B 5CV5A 4J1MA 1GUOA 4A93B 2L12A 3BDOA 2EE1A 3BZDB 4P2CB 1ESFA 5K36G 1HXYD 4F8MA 3EFXD 3NQIA 2NVQB 2BE5D 1TWGB 1L0XB 3I8ZA 1F9SA 1Q90A 4XYQA 1JQYD 5M9OA 5KYLA 2XIWA 1WTVA 5CC4A 2B2YC 5JOBA 4ILWA 4IFDG 1TU2B 4L8JA 5JJZA 1RHPA 3KUPA 2JA8B 1Z7TA 5C4XB 1MD2D 2D9UA 5CV4A 1AN8A 3HOZB 3VA5A 2K33A 2KQ3A 2HUGA 2VB3X 1HUNA 5FK9C 2FHTA 3T4AC 3ND8A 1B4OA 1EY6A 5EBDA 4K5VA 1LTID 2F0VA 3N52A 3C2PA 1SMYD 5IGEA 3PUVA 1Y8OB 3I4NB 1Q1EA 2IX0A 3BDCA 1Y1VB 3AMUA 5K5PA 2NWGA 1S5BD 3KBGA 2F0TA 1WD0A 4KKTA 2CW0C 5FO8B 4FF1A 2MUYA 1C4QA 3TMEA 3PO2B 3OIQA 4KV6A 4XT3B 3C3LA 3CU7A 1KABA 2JEBI 1HQMC 2RQXA 5ELEA 5C4JB 4GZYC 2EY2A 4HR7B 4A3GB 1V1OA 4IURA 1X3QA 2NN6I 4H0LC 1HFNA 2EJFC 1Y8NB 5KNBA 4IALA 2SNMA 1B53A 2Q8TA 3X3MA 3FEWX 3KLSA 1J9OA 1SYDA 2F0NA 3SK5A 3VR4A 3NP8A 2R61A 4HMJA 5I2YA 3TBIB 1QCBD 3S9WA 1D5ZC 2E2JB 3NTHA 4RKBA 4QB4A 3M4YA 3DXJC 1Q8IA 3VA7A 3CRKC 4FF3A 1LTRD 3SXHA 3GTLB 3KLSX 5E3FA 3MA2B 2F0MA 2WAQB 2NZ1D 2X6GA 2XSCA 5HURA 1IKLA 2WACA 2L5TA 3GTQB 3CQZB 4ZQ3A 3P1HA 3QOJA 4TSSA 2NYZD 4YIJA 4G4KA 2LKVA 1EQTA 2WIIB 3HOXB 2F0IA 2M2LA 1X32A 4A3FB 2F3WA 1UEAB 1BQQT 2EYMA 1QE6A 2MPMA 4Z9CB 1LTTD 4KKSA 2B8FA 2KEDA 4EQNA 1VF5C 1WD1A 3K57A 2L11A 1SEBD 1HRJA 3M7GA 1QOHA 3QJYA 1E2ZA 1H9RA 1F2MA 3NPPA 1KLGD 2LFNA 4K6LA 3SR1A 3PUZA 1TWAB 3H94A 1QILA 3K0YA 4X3TA 2WP8J 2E2HB 1FD7D 1PRTB 2EYPA 1NSNS 4DAYA 3J7YW 4XQNA 2EVBA 3SE0A 1B3AA 1EU4A 2FJ2A 1IL8A 3C46A 3NXWA 3ZYYX 2B2TA 4QUFA 1CZGA 4B9WA 1WTWA 1JOOA 2K04A 1ESRA 3S1NB 1LTBD 2PPBC 5KRUA 3PO3B 1B9MA 1DCZA 5JEAJ 2XWJB 4H44C 3HOVB 4KMUC 2E2DC 1CI3M 4A3JB 4C3HG 5I6WA 4KHVA 1X3PA 3BVZA 1RODA 3QG1A 1YNND 4RKLA 4DXGA 1STGA 5COYA 2N55A 3CRLC 1CT1D 4RGOS 1H9SA 3HOYB 1LT5D 1UAPA 3TP6A 3KBXA 1PTOC 2F0LA 5IOCA 1XYIA 4FNFA 2LS01 3D4WA 1JCKB 1JORA 1MBYA 2F0GA 4PMBA 2FMMA 4XYOA 1A2UA 1R4QB 4ZLTF 3SHLA 2VB2X 1E0BA 2JA7B 4V190 2F0PA 3PIP3 3J81L 3H91A 4KHZA 1AFPA 2F0HA 5IGCA 3VYUA 3H6MA 4CJ2C 1V8QA 3OW7A 1CA5A 4I65A 2PO4A 1JWSD 1U9RA 4TRDA 1K8MA 4K5WA 1DOKA 1S5CD 2IWHA 1TIID 4I7ZC 2B2WA 4XTCS 5IGGA 1XXGA 1CQVA 3VR6A 1AP0A 5EKLA 1IW7C 3PV0A 3H0GB 3M3YB 2D5DA 5ELDA 4CKBA 4NDXA 3DWPA 2XWBB 3M7NA 2IX1A 1PFBA 4DN4M 1B44D 3TZUA 5CYUA 5D3DA 1RD9D 1H9JA 1GUWA 2NTTA 2BDOA 3MXPA 2A6EC 1FGBD 2Q8IB 3NWSA 1AZPA 2KCCA 1W6KA 2A68D 1C8CA 2XRSD 4H13C 3A8IE 1Q1BA 4QUCA 4NMZA 2H1EA 2A69D 1TT2A 2FFKB 2NTSA 1FNVA 1LTAD 2K7VA 2AQ3B 4C1NI 5C6AA 2JXMB 2K01A 2CQAA 1G8ZD 1JOQA 1YNJC 5ISRA 4A3MB 4XDXA 3Q24A 3PUYA 2WB1B 4PQXA 3KK7A 2PYKA 1O80A 3TZDA 1CQFA 1OXXK 2PZWA 5LHY1 1D1KA 1LT3D 1SNPA 5JAVA 4Q0FA 2F0WA 2YU9B 2F0JA 5LL6X 5A2QE 1SYCA 2E74C 3AB9A 1ONLA 1Y1WB 3DM1A 1G2TA 2MHVA 1CHQD 2KVMA 3LX0A 4MHEA 1Z47A 2EY5A 3S15B 3DWQA 1ML0D 1GOZA 3PUXA 3RLFA 4IUPA 5LL6S 2PW7A 1DOMA 3IFDA 2GA4B 3HZXA 3WDNA 2FINB 1U4RA 3ITPA 4IUVA 1I6VC 3OWFA 2IPKD 1I4HA 4PNYA 1F77A 2EYFA 4B08A 3D6CA 3J7AF 2F1MA 5BN5A 4KY6A 2E75C 5IGBA 4H7BA 4A3EB 4WRDA 3D31A 3EA6A 1A6XA 1LACA 1L0YB 1EZ6A 5CGKA 4U673 3EVQA 3D6WA 5M3FB 5CMDA 4TQUS 2CVRA 5JVH3 1BCPB 1SE4A 3Q23A 1H9KA 1SSOA 2NB0A 2BCOA 2K6AA 2QEJC 2N88A 1BO0A 1KDBA 4NW2A 3DEPA 2HDMA 4ZRZA 1IYUA 5KNCA 3P75A 1T5EA 1CK1A 5KEEA 4RGNA 4ABNA 1A2TA 1CHPD 2ENBA 4ZUJA 2EZVA 3OSOA 5EBCA 1PZKD 1TS5A 5CV8A 4KI0A 1TR5A 4A3BB 1A15A 4ZKBB 3QO2A 1CZWA 4QCLA 1HUMA 5T1GA 4HSPA 3S2HB 2E2IB 2A6HD 5FO7B 1I4XA 1PLFA 1PRTD 2RDHA 4HCEA 2K5WA 3TP5A 1Y8PB 2Z4IA 3GTGB 2OF1A 1ZYRC 4IFDJ 4DFAA 2H4OA 1VDZA 4QF4A 5DAUA 3NUCA 1D5MC 2JSOA 3CKIB 4G7ZC 2R92B 4JK1C 4RH6A 1JWMD 3MXNA 3CHBD 1HTPA 1RTNA 1W6JA 3DWAA 3E6ZX 2RDGA 2DY7A 1U4PA 1TWFB 4FP5D 3HOWB 3M85A 2EYLA 2NVXB 2MP1A 3ERQA 2VUMB 3MHBA 2EYOA 1F9RA 2BE5C 2AQ1B 4CBVA 2BDNA 3G7LA 2BA0A 3KF8A 3A7LA 1IYVA 3A7AB 2A69C 2Z8LA 4IFDI 3L7ZC 3SK6A 1K8OA 2ZXOA 4C56C 1NR4A 2RKSA 1WCMB 5NUCA 4CKEA 2PW5A 1STAA 5FO9B 1ET9A 1VMCA 3T13A 1SJED 3K6OA 3A56A 2O5JC 2K5QA 1EWHA 1CA6A 1EY4A 5F2DA 4ME5A 4K8JA 1FR3A 4ULLA 3K5LA 2K1BA 1EY8A 1AEXA 3FVQA 5C4HA 1SE3A 4EQPA 2L0CA 4U68A 1WVLA 1SE2A 3Q6SA 2EJMA 1NR2A 1C48A 1O7YA 2Y0SB 3LWUA 2G9DA 3GTPB 2NVYB 5DM63 4PMWA 2XRQD 3HG9A 5EGTA 2K03A 5I2XA 1LLRD 5IIFA 4EGVA 4KJOA 2AUKA 1CM9A 2ICIA 1V1PA 1HFGA 5C5LA 3BVMA 1STYA 2F0UA 1PTOD 1SNQA 1LV9A 1BCPC 3D3RA 4HAEA 3GV3A 1GXDC 1QNKA 1R9TB 5C0XJ 3R2TA 3S1MB 4ZK9B 3WOEA 1QWYA 1HQRD 5ELBA 5M3MB 1FNWA 2NN6H 4N9PA 1HA6A 2O4XA 2RA4A 3K5NA 2B2VA 3U9OA 4RHRA 1UUPA 3V05A 3OMGA 3HEJA 2NVTB 1DJRD 3X3NA 2IL8A 1STEA 4S3SA 4IFDH 4K2KA 2J4XA 2RDFA 4KY5A 5DEHA 4CHTB 4A3IB 3VYSA 1BF4A 3D4DA 4KJNA 1H9SB 3V2TA 5FLXL 2L1BA 2AUJD 5EKKA 1EY7A 4M8AA 1EEFD 1G291 3F2UA 2A6HC 1EYAA 1D1IA 3C1EA 1ILQA 1H9MA 3H09A 1MSGA 1O78A 4BY7B 3S1RB 1I6HB 2HQEA 1SNCA 3ND9A 3DEOA 2OT2A 2VNUD 1DONA 1TS4A 1B1ZA 2SDFA 1Z6HA 2WKCA 4ID6A 3MFGA 1EY9A 1DYQA 1LT4D 5TSSA 5I6YA 3VYRA 3IFTA 4QIWB 1WTXA 2XN9C 2QKIC 2X6LA 3BG3A 1JC7A 1TWHB 4R9WA 3Q0AA 1NAPA 3R8BA 2R3ZA 1QB5D 3OPOA 3M4OB 1PFMA 1MI2A 4RCOA 2IT1A 1EEID 4OIKA 2PZUA 3DHQA 5D65A 3JAME 1F2ZA 1HHVA 5C3WA 3GP7A 4A3DB 4HEDA 3FRPB 5G3LF 5CR3A 2F03A 1M4VA 3JAML 3QIAA 3GV6A 2ZT9C 3TSSA 2HDLA 2AQ2B 5BN3A 2FMCA 1SNDA 5C4ZA 4FVMA 2EYJA 3K7AB 1F2LA 3FKIB 5I9OA 4BBRB 1I4PA 2ICEC 5AFWA 1LTSD 4K14A 4BY1B 5E1FA 4IUUA 2F3VA 3S14B 1EYCA 2RVLA 4XQJA 1WTQA 3MAQA 2D62A 3GTOB 4IUQA 1PRTF 2JA5B 4AYBB 1E2WA 3A55A 4DNTB 3NE5B 2DY8A 2F0KA 5KYIA 5A2QL 1D2BA 1VF7A 1PTOB 2PQEA 4F7XA 2LMCB 2LY7A 1BXTA 3G6JB 1SBBB 1S5ED 4A3KB 2WV6D 3EJIA 2C5CA 3GD7A 1HPCA 4E6IA 2YYZA 2L4NA 4X3UA 3EQLC 3NHHA 5EPKA 3OHXC 3R2IA 4N9TA 2K05A 2R6GA 2EPBA 4KK7A 2HCIA 3TN2A 1SJHD 5IT9E 1KDAA 5EJWA 3GTKB 1IW7D 1TY2A 2IW3A 4BWGB 3GO5A 1KTKA 1JR0D 4LMQD 4RWSC 4XQQA 1GHJA 2A74C 4KY7A 2TMPA 1PRTC 1S4ZA 1ZXTA 4C3IG 5C44B 4J6HA 2ZXRA 3J80L 5KIXA 4CKCA 1SXTA 3L3OC 2A68C 3VR3A 4XT1B 2MGSA 4QMGA 3NTKA 5EPJA 5KNDA 1G6ZA 3GQBA 4KN7C 1PTOF 1BCPF 3BVGA 3P7JA 2L9HA 2JP1A 2VXWA 4HTHA 2PNRC 5J22A 1EY5A 4OO1G 5JEAG 3T51B 1IKMA 1E2VA 3VR5A 3BDLA 1VMPA 3SK4A 1TQOA 3J80E 4F88A 2I46A 4BA2I 5IGDA 1XX8A 3I4LA 4ZUIA 1SNMA 4OL7A 3HOUB 1PZID 3KLRA 1DM0B 1PDQA 1OXSC 3MFYA 3SK8A 1RKNA 4B9XA 3LWEA 5JPNC 1HTLD 3OIPA 4BA1I 2ID0A 4RFBA 5A35A 3K5MA 5M5XB 1ENFA 3RD4A 4WFN3 2B2VC 4FF4A 4DK1A 1BNZA 4BBSB 1EY0A 1JOKA 1SYBA 1B2TA 1BDOA 1OXVA 4V0BA 1Q3LA 3DMUA 1I50B 3RMHA 2JYOA 4G7HC 4DAVA 2O2LD 2KA7A 2B8GA 4K8IA 4JBWA 1ET6A 1V43A 1F9QA 1G2SA 1A3UA 1IHZA 1TKWB 3D4RA 2G9HD 4CGYB 3S1QB 4G57A 1JB3A 1OO9B 4CJ0B 3SEBA 5K36H 3A8KE 5C0XI 2K5DA 5CBAE 3FPPA 4LK1C 1A3VA 1V1PB 1OXTA 3MEHA 3R3OA 4K2LA 4ZYSA 5D14A 5CV7A 2QCPX 5J39A 3NBHA 1PXUA 1NCVA 3S16B 4C3JB 1ZKOA 3TP8A 2J7ZA 5FKAC 4MIUA 1SYEA 3OWEB 2CW0D 3T56B 1LT6D 3Q22A 3K58A 1RCVD 2EY1A 3GTMB 3P20A 1RJTA 3EROA 5ELCA 4M1UB 1ICWA 1ILPA 4O42A 1FYCA 3VYTA 5CORA 2O5IC 1NUCA 1M8AA 2X69A 1KDCA 3IL8A 5CV6A 2M00A 1EOTA 4DF7A 2EOTA 4HSVA 3LNNA 2M9VA 1FNUA 3MWYW 2B2UC 1AZQA 1MSHA 1R4PB 4X3KA 4DK0A 4C3HB 1S5DD 3TP7A 2Q8RE 4HN7A 3NWTA 1WTRA 4UDUC 1I3QB 5BN4A 2A73B 3A8JE 4XIGS 1VCIA 2DNEA 1YNNC 2QF7A 4C1NK 2J0TD 4IUTA 1EYDA 2KJXA 5CBEE 1STHA 4O1NA 3K59A 1DZ1A 3R93A 5E4WC 4ZKCB 2RSOA 1WTOA 2R7ZB 2EDGA 3OMCA 1U4LA 4OIJA 4Q5VA 3I3CA 4RGTA 5I4DA 4ZAIA 4DGZA 4KKUA 4G7OC 1DD2A 4DA2A 3FPUB 2KUMA 3RZDB 3BYYB 2EY6A 4KD3A 4IZ8A 3QWNA 2JA6B 1TS3A 3N6RA 2OXPA 3NTIA 1PZJD 3BYTB 5IT9L 1TY0A 3PUWA 5M5YB 1SNOA 4OO1H 1KNAA 4NKLA 1QG7A 3H3VC 3WOFA 2F4IA 1Q12A 2KECA 2QILA 1XWEA 2K28A 2NN6G 1EWCA 1LO5D 3C1FA 3I73A 4RA8A 4TKOB 2HCCA 1GUGA 3NQTA 5HGTA 1I4GA 4DAPA 5IODA 2F0SA 1ZYRD 2B2WC 3VR2A 2NUCA 4KTAA 4FXKC 5JVG3 1QJOA 5M5WB 2B2TC 3FDTA 1EZ8A 1STBA 3AU7A 1PFNA 3I70A 2PCFB 3T53B 3BS1A 2SNSA 2RBMA 1AW7A 4RCNA 4IQZA 5FLXE 3L9AX 2RSNA 4F87A 5C0XG 1GUTA 2E76C 3U9SA 1CFMA 5JEAH 2D2CC 3I4MB 4L6TB 2WKDA 5EKIA 1PMRA 5J1ZA 3A54A 2JE6I 5FOBB 4WORA 1TS2A 1EIGA 2PMZB 3IAYA 1D6EC 5C5MA 1HCZA 2MJ8A 1TVXA 5C3XA 1GJXA 3O13A 4OGQC 3D8GA 2Z1CA 4C3IB 3V96A 4MN3A 3PIO3 3ONAB 2BA1A 2IX3A 4XXEA 4DU9A 3NK9A 2EYHA 2WINB 2IJ0A 1JICA 1S5FD 2JEAI 1O7ZA 2QDBA 5C0XH 1DOLA 4UAIA 3W2DA 1GUNA 4BS9A 3J81E 5D3IB 4FO2A 1GUSA 3OOCA 1KNEA 4X3SA 3K5OA 4HCSA 1YNJD 4FYDA 1MGSA 2ZXPA 1U4MA 3SVMA 2XVSA 4R8NA 3IKJA 1WTPA 3QOLA 4LAAA 4FXDA 3MZ5A 1EQVA 2V4DA 4RAUC 3I91A 1BR9A 5G3LD 1ENAA 1PTOH 3MTSA 2C9OA 1BOSA 2A5HA 3W3AA 1PYWD 3PMFA 2XNAC 3I90A 1HA5A 1B9NA 5T1IA 4DNRB 3RUZA 1JWUD 2KHSA 4R8IA 2F0EA 4RHSA 1F9PA 1EIHA 2NBFA 3FMCA 1KAAA 2B63B 3I72A 4KD4A 2F0DA 1QNUA 2F0OA 1BBXC 3MXGA 1JE4A 2SEBD 3TDQA 4PMCA 4IN3A 1SAPA 1F2YA 4ODGA 2Z4HA 3NBIA 3E0JA 1Y69U 3J7AV 5CV9A 3HP3A 5IGFA 2DN8A 2SOBA 1SYFA 5I9PA 2F0FA 3HKZB 4FXGC 2DNCA 3HS0C 5KGUA 5DM73 2K32A 4Y7NB 1O7LA 4OO1I 2PZTA 2CHBD 3MXUA 2B2UA 4DXFA 4EQOA 1CTMA 4OHJA 1RF2D 4C2MB 1T5XD 1RDPD 4CJ1B 4K6DA 2KCNA 3MC0B 2EXZA 4C3JG 5EQ0A 1K83B 5JPMC 1GHKA 5ELFA 3RZOB 4PV1C 1KLUD 1I4RA 4NP5A 4WJWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N9P A;  2EYM A;  4F8M A;  2EY2 A;  4ZUI A;  1SNM A;  2EY1 A;  2O4X A;  3SHL A;  4WOR A;  5ISR A;  4EQN A;  4OL7 A;  3EJI A;  2F0P A;  3ERO A;  3SK6 A;  3P75 A;  1A3T A;  2EY6 A;  3RUZ A;  2KHS A;  4KD3 A;  5C5M A;  2F0E A;  4IZ8 A;  5KEE A;  2RKS A;  3U9O A;  4E6I A;  2PYK A;  3OMG A;  1F2M A;  2F0H A;  3HEJ A;  1RKN A;  3SK8 A;  5NUC A;  3QB3 A;  1KAA A;  2PZW A;  4B9X A;  2OXP A;  5IGC A;  3SR1 A;  1A2T A;  5HUR A;  5C3X A;  2PW5 A;  5KYL A;  5M9O A;  1STA A;  1SNP A;  2ENB A;  4IAL A;  2SNM A;  4KD4 A;  3NHH A;  5JAV A;  3T16 A;  2F0D A;  3T13 A;  4ZUJ A;  2PZU A;  1NUC A;  3DHQ A;  2F0W A;  5CC4 A;  3OSO A;  1KDC A;  1F2Z A;  2F0O A;  3H6M A;  1SNO A;  2F0J A;  3D8G A;  4N9T A;  4S3S A;  5CV8 A;  1SYC A;  2EYP A;  1TR5 A;  5JOB A;  1EY4 A;  5CV6 A;  4K2K A;  4NKL A;  1NSN S;  5C3W A;  2M00 A;  1SYD A;  2RDF A;  1EY0 A;  4KY5 A;  1JOK A;  2F0N A;  2OEO A;  4I65 A;  1SYB A;  4ME5 A;  5DEH A;  3SK5 A;  4DF7 A;  4PMC A;  4DU9 A;  4K8J A;  3NK9 A;  1KDA A;  2EYH A;  3NP8 A;  1U9R A;  3DMU A;  1EY8 A;  1F2Y A;  1AEX A;  4ODG A;  3LX0 A;  3D4D A;  4HMJ A;  4KJN A;  4TRD A;  5CR3 A;  1ENC A;  2EY5 A;  4K5W A;  3V2T A;  5C4H A;  4HMI A;  3NXW A;  5CV4 A;  3VA5 A;  3C1F A;  4EQP A;  5IGG A;  2QDB A;  5CV9 A;  5IGF A;  2KQ3 A;  4B9W A;  3S9W A;  4EVO A;  2SOB A;  4K8I A;  2PW7 A;  1SYF A;  5EKK A;  1EY7 A;  3TP5 A;  5I9P A;  4KY7 A;  1SND A;  2F0F A;  3NQT A;  1JOO A;  3HZX A;  3E5S A;  1A3U A;  1IHZ A;  2EYJ A;  4QB4 A;  4RKB A;  5EKL A;  3TP7 A;  5KGU A;  4G57 A;  3ITP A;  2OF1 A;  3MVV A;  3OWF A;  5IOD A;  4K5X A;  4DFA A;  1EY6 A;  1EYA A;  2F0S A;  2PZT A;  5I9O A;  4K5V A;  5KRU A;  4NDX A;  2F0V A;  3C1E A;  4EQO A;  4J6H A;  4PNY A;  1SYG A;  2F0Q A;  2NUC A;  4QF4 A;  5DAU A;  3NUC A;  4KTA A;  5IGE A;  2EYF A;  4K14 A;  3SXH A;  3D6C A;  5KIX A;  5E1F A;  5EGT A;  1A3V A;  4R8N A;  5E3F A;  2F3V A;  3MEH A;  2F0M A;  3QOL A;  4LAA A;  4QMG A;  3BDC A;  1EYC A;  5I6W A;  4KHV A;  4KY6 A;  5IIF A;  1EZ8 A;  4RKL A;  5IGB A;  3MXP A;  4KJO A;  1STB A;  2HQE A;  3MZ5 A;  1STG A;  1EQV A;  3R3O A;  1SNC A;  4H7B A;  4K2L A;  4K6D A;  5F2D A;  5K5P A;  2WAC A;  1STN A;  4WRD A;  1II3 A;  2F0T A;  4IUN A;  2SNS A;  5C4Z A;  5CV7 A;  2RBM A;  5C5L A;  2EXZ A;  4ZQ3 A;  3P1H A;  1STY A;  5J39 A;  1EYD A;  2F0U A;  1ENA A;  1STH A;  3QOJ A;  3TP6 A;  1SNQ A;  4ID6 A;  1EY9 A;  4HTH A;  2EYL A;  1EZ6 A;  5J22 A;  3ERQ A;  4YIJ A;  2F0L A;  3TME A;  5CGK A;  5IOC A;  1EY5 A;  2F0K A;  3EVQ A;  4NMZ A;  2LKV A;  5CV5 A;  3TP8 A;  4J1M A;  5KYI A;  4KV6 A;  1TT2 A;  5HGT A;  5I6Y A;  3MHB A;  2EYO A;  3D4W A;  1KAB A;  2F0I A;  4MIU A;  1SYE A;  3OMC A;  1JOR A;  2F0G A;  2F3W A;  3BDL A;  2PQE A;  5C6A A;  4PMB A;  3SK4 A;  4F7X A;  1TQO A;  1A2U A;  5J1Z A;  3PMF A;  1JOQ A;  1KDB A;  4NP5 A;  4DGZ A;  5IGD A; 
#chains in the Genus database with same CATH topology
 1LAB A;  1BUV T;  5E4X A;  5C3E B;  1IBM L;  3CCU A;  5C44 G;  1A3T A;  2AWN A;  2UUB Q;  4JI0 Q;  2WB1 G;  3SDZ A;  2UUC Q;  4GKK L;  3H0G H;  4J8Q A;  1SMY C;  2A6E D;  1G91 A;  3QB3 A;  1BCP D;  5DNF A;  3S17 B;  4X65 Q;  3T16 A;  3A74 A;  3CCR A;  1EIF A;  1VQJ A;  3CCM A;  1DXM A;  2BOS A;  3E9I A;  1UNS A;  4OXP A;  2BH2 A;  1OXU A;  2OEO A;  5IP7 G;  3KJP A;  1EU3 A;  4FF2 A;  1EL0 A;  3H3V H;  4HIM A;  1TWC B;  2I07 B;  1ENC A;  2E2I H;  1B50 A;  4HMI A;  2B39 A;  1SFO B;  2R93 B;  4RGM A;  3UI2 A;  1LTG D;  4EVO A;  4WJ3 M;  1I4Q A;  3NSW A;  1WTH A;  2EJG C;  1EYG A;  1ZEQ X;  3E5S A;  4GN4 B;  5EPL A;  2DJF C;  4LJZ C;  3MVV A;  3GTJ B;  2UXB L;  4DK6 C;  3NEM A;  4K5X A;  2TSS A;  3CC2 A;  1XTC D;  1EFI D;  1SDF A;  1SYG A;  2F0Q A;  3URY A;  1KQS A;  2L55 A;  1V1Q A;  1J8I A;  3E0E A;  1FJG Q;  3HRZ C;  1RTO A;  3ERS X;  1UE1 A;  1HR0 Q;  1STN A;  2KEE A;  4IUN A;  1II3 A;  1E3P A;  2KOL A;  2AWO A;  1N33 Q;  3CF5 A;  2NVX H;  1G51 A;  4NXN Q;  3S2D B;  3HGB A;  4DV3 Q;  1D5X C;  2B2Y A;  2JA5 H;  4KN4 C;  3DUZ A;  5L37 A;  3L2P A;  4HJ8 A;  1S40 A;  4L63 B;  1VQL A;  5CV5 A;  4J1M A;  1GUO A;  4A93 B;  3HOV H;  1PH9 A;  3TEH B;  2L12 A;  3BDO A;  2EE1 A;  3BZD B;  4P2C B;  2UXB Q;  1ESF A;  3I55 A;  5K36 G;  1E24 A;  4QGU A;  2DJG C;  4JBK A;  1HXY D;  4F8M A;  3K7A H;  3EFX D;  3NQI A;  2NVQ B;  3CQZ H;  4LF6 Q;  2BE5 D;  1TWG B;  1L0X B;  3I8Z A;  4GKJ L;  4BY1 G;  2XTI A;  1F9S A;  1Q90 A;  4XYQ A;  4GLX A;  1JQY D;  4DK3 C;  2K14 A;  5M9O A;  5KYL A;  4K0K L;  3CD6 A;  4UP8 A;  3CME A;  2XIW A;  1WTV A;  5CC4 A;  3W5O A;  4OWW B;  2B2Y C;  5JOB A;  4ILW A;  4Y7N H;  3G48 A;  4IFD G;  1TU2 B;  1HJP A;  4L8J A;  2N8N A;  5JJZ A;  1RHP A;  1VQC A;  3KUP A;  1UE7 A;  2JA8 B;  1MIU A;  4JV5 L;  3U4Z A;  1Z7T A;  5C4X B;  2PI2 E;  3CW2 C;  1MD2 D;  2I0Q A;  4JC0 A;  2D9U A;  5CV4 A;  1AN8 A;  3HOZ B;  3G71 A;  3VA5 A;  4OX9 L;  2K33 A;  2KQ3 A;  1VQI A;  2HUG A;  2VB3 X;  1VQO A;  2YTV A;  1Q46 A;  1HUN A;  2IY5 B;  5FK9 C;  2FHT A;  1NBW A;  3T4A C;  1J6Q A;  1B4O A;  3ND8 A;  1EY6 A;  4LFA L;  5EBD A;  3K0X A;  4K5V A;  1LTI D;  2F0V A;  3N52 A;  3C2P A;  2QGQ A;  1MKH A;  1SMY D;  1NNX A;  5IGE A;  5FLX c;  3PUV A;  3I4M G;  1Q86 C;  1Y8O B;  3I4N B;  1Q1E A;  2IX0 A;  3BDC A;  1S3O A;  1Y1V B;  1VQD A;  1SN8 A;  3AMU A;  1D8L A;  3E9H A;  5K5P A;  2NWG A;  1S5B D;  3KBG A;  2F0T A;  2E5L Q;  1WD0 A;  4KKT A;  2CW0 C;  4L5R C;  5FO8 B;  4FF1 A;  2MUY A;  3BU2 A;  1C4Q A;  4OWX B;  3TME A;  3PO2 B;  3OIQ A;  4A76 A;  4KV6 A;  4XT3 B;  3C3L A;  1KHI A;  3CU7 A;  1N32 Q;  1KXL A;  1KAB A;  2JEB I;  3K81 C;  1HQM C;  2RQX A;  5ELE A;  1KL9 A;  4B3T L;  5C4J B;  1A0I A;  4GZY C;  2EY2 A;  4HR7 B;  4A3G B;  1V1O A;  4IUR A;  1X3Q A;  1YHA A;  2NN6 I;  1X54 A;  1NY4 A;  3FKI G;  1HNX L;  4H0L C;  1JJ2 A;  1HFN A;  1PH1 A;  2EJF C;  1Y8N B;  5KNB A;  4IAL A;  2SNM A;  1B53 A;  2QEX A;  1C7Y A;  2Q8T A;  3X3M A;  3FEW X;  1QUQ B;  4HJ9 A;  1KRS A;  4JI5 L;  5LMU L;  3KLS A;  4JVZ A;  1J9O A;  1SYD A;  4DR7 L;  2VQE L;  2F0N A;  1ASZ A;  3SK5 A;  3HOY G;  3VR4 A;  3NP8 A;  2R61 A;  3GTK H;  1I50 H;  4HMJ A;  1JJC B;  5I2Y A;  3TBI B;  1QCB D;  4IOC A;  3S9W A;  4DKA C;  1D5Z C;  1FL0 A;  3OTO L;  2E2J B;  3NTH A;  3KF6 B;  1EIY B;  4JI5 Q;  1Q82 C;  3H0G G;  4QB4 A;  4RKB A;  1XMQ Q;  3M4Y A;  4P75 A;  4R1J A;  2MNA A;  3DXJ C;  1Q8I A;  3VA7 A;  3I7F A;  3HOU H;  2VZA A;  3CRK C;  5M5Y H;  3AEV A;  1WCM H;  4FF3 A;  1LTR D;  3SXH A;  3GTL B;  3KLS X;  2B63 G;  5E3F A;  2RF4 A;  3MA2 B;  2F0M A;  2WAQ B;  2NZ1 D;  2X6G A;  3STB C;  5LMU Q;  1N32 L;  4HJA A;  4DV5 L;  2XSC A;  5HUR A;  1IKL A;  3BJU A;  2WAC A;  2L5T A;  3GTQ B;  1I5F A;  1JT8 A;  3CQZ B;  3GTO H;  4ZQ3 A;  3P1H A;  4LUV A;  4YWM A;  1K9M C;  3QOJ A;  4TSS A;  2NYZ D;  4C3J H;  3U50 C;  1EQQ A;  4YIJ A;  4G4K A;  1KAW A;  4Y52 H;  2LKV A;  3I4N H;  1EQT A;  2N3S A;  1WFQ A;  2WII B;  3HOX B;  2F0I A;  5IYB G;  2M2L A;  1X32 A;  4X66 Q;  3HOX G;  2F3W A;  4A3F B;  1Q81 C;  1UEA B;  4DV4 Q;  1BQQ T;  4LF8 Q;  2EYM A;  2KBN A;  2RCN A;  1QE6 A;  2MPM A;  3D0F A;  4Z9C B;  3KDF B;  1LTT D;  4KKS A;  3TS0 A;  2B8F A;  2KED A;  4EQN A;  1QZG A;  1VF5 C;  4NPS A;  1WD1 A;  4DR7 Q;  3K57 A;  2L11 A;  1X56 A;  1VQK A;  1K0S A;  1SEB D;  1HRJ A;  1VQ8 A;  3M7G A;  1QOH A;  3QJY A;  1E2Z A;  1H9R A;  1F2M A;  3NPP A;  1KLG D;  2LFN A;  4K6L A;  4DPG A;  5FLM H;  5C4X G;  3SR1 A;  3PUZ A;  1TWA B;  3H94 A;  1QIL A;  3OW2 A;  1VS0 A;  3AYH B;  3K0Y A;  3IRB A;  3GTP H;  4X3T A;  2WP8 J;  2E2H B;  1FD7 D;  4DV1 L;  1PRT B;  2EYP A;  4LFB Q;  2R7F A;  1NSN S;  4DAY A;  3J7Y W;  4XQN A;  3M3Y H;  2EVB A;  3SE0 A;  1B3A A;  1EU4 A;  2FJ2 A;  1IL8 A;  2CQO A;  3C46 A;  1E1O A;  2CCZ A;  1B70 B;  2JA6 G;  1D7Q A;  2GVB A;  3NXW A;  2NZH A;  3ZYY X;  2B2T A;  5GAG C;  1C0A A;  1O7I A;  1LTL A;  4QUF A;  1CZG A;  4B9W A;  4EX5 A;  2CWA A;  1IBM Q;  4J15 A;  1JJG A;  1WTW A;  2E2H H;  1JOO A;  3I2Z A;  3KYH C;  3DLL A;  2K04 A;  1ESR A;  1FJG L;  3S1N B;  1LTB D;  4YY3 L;  2PPB C;  5KRU A;  3RZD H;  3PO3 B;  1B9M A;  3F2C A;  1DCZ A;  2B29 A;  5JEA J;  2XWJ B;  2YTX A;  5IT9 c;  1PH5 A;  4H44 C;  3HOV B;  1X3E A;  2R7Z G;  5AJ3 L;  5J3B A;  3KOJ A;  4DV0 L;  4KMU C;  2WAQ G;  2E2D C;  1CI3 M;  4YHH L;  4UP9 A;  4A3J B;  4C3H G;  5I6W A;  4KHV A;  4A3K H;  1X3P A;  3BVZ A;  1ROD A;  3QG1 A;  1YNN D;  4RKL A;  3CAM A;  4DXG A;  2ASB A;  1STG A;  5COY A;  1YNX A;  2N55 A;  4GLV B;  3CRL C;  3HKS A;  1CT1 D;  4YCU A;  4RGO S;  3TRZ A;  1H9S A;  3HOY B;  1NMG A;  1LT5 D;  1UAP A;  2GN5 A;  3TP6 A;  4PZ7 A;  4A3E H;  3KBX A;  4JI4 L;  1PTO C;  2F0L A;  5IOC A;  1XYI A;  4FNF A;  2LS0 1;  1XMQ L;  5BR8 Q;  1GD7 A;  3D4W A;  1JCK B;  1NTG A;  4DR1 Q;  1JOR A;  1MBY A;  2F0G A;  1PH2 A;  4PMB A;  2FMM A;  4XYO A;  1A2U A;  1PH4 A;  3GTQ H;  2K75 A;  1VQH A;  3CPF A;  2BH8 A;  2JA9 A;  4C2M H;  1M1K C;  1R4Q B;  5ELN A;  4ZLT F;  3SHL A;  2VB2 X;  1E0B A;  4IPC A;  2JA7 B;  5AJ3 Q;  2I5M X;  5C44 H;  4V19 0;  2F0P A;  4LF4 Q;  1I3Q H;  3PIP 3;  3J81 L;  3H91 A;  4KHZ A;  4BY1 H;  1AFP A;  2F0H A;  1I94 L;  5IGC A;  1XJV A;  1E7Z A;  1UEB A;  1PH6 A;  1YBY A;  3VYU A;  3H6M A;  4CJ2 C;  4KHP Q;  1V8Q A;  3OW7 A;  1XPU A;  1CA5 A;  4ZCK A;  1FGU A;  4I65 A;  2YU9 H;  4A3K G;  1CKM A;  2PO4 A;  2GVA A;  1JWS D;  1U9R A;  4A3B H;  4TRD A;  1K8M A;  4K5W A;  1DOK A;  1S5C D;  2IWH A;  1TII D;  4I7Z C;  2B2W A;  4DR5 L;  1XNQ L;  4XTC S;  4LFA Q;  4JI1 L;  5IGG A;  1XXG A;  1VQF A;  1CQV A;  4HID A;  3VR6 A;  1AP0 A;  5EKL A;  1IW7 C;  3PV0 A;  3H0G B;  3M3Y B;  4O0A A;  2D5D A;  5M3M H;  5ELD A;  3KLW A;  4CKB A;  4NDX A;  3DWP A;  3A5Z B;  2XWB B;  3M7N A;  2IX1 A;  5M3F H;  1PFB A;  4DN4 M;  1B44 D;  4KHP L;  3TZU A;  5CYU A;  4A3L H;  5D3D A;  1GKH A;  3BZC A;  4PZ6 A;  1RD9 D;  1H9J A;  1GUW A;  2NTT A;  2BDO A;  3MXP A;  2A6E C;  4JPB W;  1FGB D;  1RIP A;  2Q8I B;  3NWS A;  3NEL A;  1L0W A;  1QUQ A;  1AZP A;  3RNU A;  2KCC A;  4RG1 A;  1W6K A;  3OYY A;  2A68 D;  1C8C A;  3STB D;  2XRS D;  4DAM A;  4H13 C;  3A8I E;  4LF4 L;  1EUJ A;  5GAH C;  4LNQ A;  1Q1B A;  4QUC A;  4NMZ A;  2H1E A;  2A69 D;  1YJN A;  1TT2 A;  5LMN W;  2R92 G;  3CCV A;  2FFK B;  3HOV G;  2NTS A;  1FNV A;  1LTA D;  2K7V A;  2AQ3 B;  4C1N I;  3CPW A;  5C6A A;  3MXN B;  2JXM B;  3TRE A;  2K01 A;  3H15 A;  2CQA A;  1VQ7 A;  4QJF A;  1G8Z D;  1L1O C;  4A3B G;  1JOQ A;  2E5L L;  2D0O A;  1YNJ C;  2MFI A;  2OQ0 A;  5ISR A;  4A3M B;  3TQY A;  2HIX A;  4XDX A;  3GTJ H;  3Q24 A;  3PUY A;  2WB1 B;  4PQX A;  2VS1 A;  3KK7 A;  2PYK A;  1K0R A;  1O80 A;  4A3J G;  3TZD A;  1CQF A;  1OXX K;  1X3F A;  1VQB A;  2PZW A;  1XMO Q;  1IL2 A;  1IYJ B;  5LHY 1;  1D1K A;  1LT3 D;  1SNP A;  1CUK A;  5JAV A;  4NXN L;  4Q0F A;  4X6A H;  2F0W A;  2YU9 B;  2RHQ B;  2F0J A;  5LL6 X;  5A2Q E;  1SYC A;  1PH8 A;  2E74 C;  3S1N H;  3AB9 A;  1ONL A;  3U58 A;  1Y1W B;  3KJO A;  3DM1 A;  4O2D A;  2MHV A;  1G2T A;  1CHQ D;  2KVM A;  1U5K A;  1CKN A;  3LX0 A;  4MHE A;  1Z47 A;  2EY5 A;  3S15 B;  3DWQ A;  1ML0 D;  1GOZ A;  3PUX A;  3RLF A;  4GOP C;  1VQN A;  4IUP A;  4IOA A;  5LL6 S;  2PW7 A;  1DOM A;  5H1S E;  3IFD A;  1B3Q A;  2GA4 B;  3B6Y A;  3HZX A;  3WDN A;  2FIN B;  2VW9 A;  1U4R A;  2VQF Q;  1Y1W H;  1B7Y B;  3ITP A;  4IUV A;  4R4T A;  3S17 H;  1I6V C;  3UDG A;  3OWF A;  2IPK D;  1IXR A;  1I4H A;  4YCW A;  2ZJP A;  4PNY A;  2UUB L;  4JI0 L;  1F77 A;  2EYF A;  4B08 A;  3D6C A;  3J7A F;  2B63 H;  2R93 G;  3J7A 5;  2F1M A;  5BN5 A;  4KY6 A;  2OTL A;  4N8X 1;  2E75 C;  5IGB A;  4H7B A;  4A3E B;  2ZTC A;  4A93 H;  4BXX G;  4WRD A;  2JJQ A;  3D31 A;  3EA6 A;  3K7U C;  1A6X A;  1I6H H;  1LAC A;  1L0Y B;  1EZ6 A;  1SLJ A;  5CGK A;  4U67 3;  2OWO A;  2KHI A;  3D6W A;  1PFS A;  3EVQ A;  1QVG A;  3I4N G;  1JE5 A;  5M3F B;  5CMD A;  4TQU S;  2CVR A;  4DUZ L;  5JVH 3;  2NZO A;  1BCP B;  1IBL Q;  1SE4 A;  3Q23 A;  1H9K A;  1SSO A;  2NB0 A;  2BCO A;  2K6A A;  3LGJ A;  2V1C C;  3F2D A;  2QEJ C;  2N88 A;  1BO0 A;  2ALY B;  1KDB A;  4NW2 A;  3DEP A;  2HDM A;  4ZRZ A;  2ZTE A;  4JI8 Q;  1IYU A;  1QZH A;  2E8G A;  5KNC A;  3P75 A;  2R7D A;  1T5E A;  4YWK A;  4GKJ Q;  1CK1 A;  5KEE A;  5JJL A;  4RGN A;  4R4O A;  1SRO A;  3CCE A;  2Q2T A;  4ABN A;  1SR3 A;  1A2T A;  1CHP D;  1YZ6 A;  2ENB A;  3T1H L;  4DV4 L;  4ZUJ A;  3S2H H;  2EZV A;  3OSO A;  5EBC A;  1PZK D;  2A19 A;  1TS5 A;  5CV8 A;  3G6E A;  4KI0 A;  3CCJ A;  1A62 A;  1X65 A;  1TR5 A;  4A3B B;  3GTG H;  1A15 A;  4ZKB B;  2R93 H;  3QO2 A;  3OTO Q;  1CZW A;  4QCL A;  3G4S A;  2E2J H;  1HUM A;  2UXC L;  1TWC H;  2HD3 A;  5T1G A;  4HSP A;  3S2H B;  4BBS H;  2OTJ A;  2A6H D;  2E2I B;  2Q2U A;  5FO7 B;  1I4X A;  1PLF A;  1S72 A;  1N36 L;  1PRT D;  2RDH A;  4HCE A;  2K5W A;  3TP5 A;  1Y8P B;  3GTM H;  2CFM A;  2Z4I A;  2DGY A;  1XMO L;  3GTG B;  2OF1 A;  1ZYR C;  4UP7 A;  4IFD J;  4DFA A;  3TS2 A;  2H4O A;  1VDZ A;  4QF4 A;  1RL2 A;  5DAU A;  3NUC A;  1D5M C;  5FJ8 G;  2JSO A;  3CKI B;  4G7Z C;  2R92 B;  4JK1 C;  4DV3 L;  4RH6 A;  1JWM D;  1C9O A;  3MXN A;  4K0K Q;  3CHB D;  1BKB A;  1HTP A;  1RTN A;  1W6J A;  3DWA A;  4IJL A;  4AQY L;  3E6Z X;  2RDG A;  3RZO H;  2DY7 A;  1U4P A;  1TWF B;  4FP5 D;  4JI3 L;  3HOW B;  3ULL A;  4JI7 Q;  3M85 A;  5C4J H;  2EYL A;  2NVX B;  4JCV E;  2MP1 A;  3ERQ A;  4AIM A;  2VUM B;  2HQL A;  1K83 H;  4YWL A;  2AKW B;  1N34 L;  3MHB A;  2EYO A;  1F9R A;  4JI6 L;  2BE5 C;  2AQ1 B;  4CBV A;  3RN2 A;  2BDN A;  3G7L A;  4OX9 Q;  1VQ5 A;  1TWF H;  3S24 A;  2BA0 A;  3KF8 A;  4JBJ A;  3A7L A;  1IYV A;  2PMZ E;  2LSS A;  3A7A B;  2A69 C;  1VQG A;  2Z8L A;  2B3G A;  4IFD I;  3L7Z C;  3ZJY C;  2K52 A;  4JI4 Q;  3SK6 A;  1K8O A;  2ZXO A;  2F3I A;  1AH9 A;  4C56 C;  1VQ4 A;  1NR4 A;  1HNX Q;  1VQM A;  2RKS A;  1NE3 A;  4LFB L;  1WCM B;  3MEF A;  5NUC A;  4CKE A;  4N8F A;  2PW5 A;  4H02 A;  1STA A;  5FO9 B;  1ET9 A;  1VMC A;  3T13 A;  4LFC Q;  1SJE D;  3K6O A;  3A56 A;  2O5J C;  2K5Q A;  1EWH A;  3PSI A;  1HZC A;  4AH6 A;  1CA6 A;  2YV5 A;  1A63 A;  1EY4 A;  4NB3 A;  1EWI A;  3Q8D A;  5F2D A;  4ME5 A;  4EQ5 A;  4IPG A;  4K8J A;  5GRO A;  1FR3 A;  4ULL A;  3K5L A;  2K1B A;  1EY8 A;  1AEX A;  3FVQ A;  5C4H A;  4LF8 L;  4YY3 Q;  1SE3 A;  3J81 j;  4EQP A;  2L0C A;  4U68 A;  1WVL A;  2VL6 A;  1XPO A;  4R4I A;  4MNO A;  1SE2 A;  1YIJ A;  5C3E G;  1OTC A;  1UE5 A;  3Q6S A;  1WJJ A;  2EJM A;  5HY6 A;  1NR2 A;  1C48 A;  1O7Y A;  2Y0S B;  4POF A;  4JI7 L;  3LWU A;  2G9D A;  3GTP B;  2NVY B;  5DM6 3;  4PMW A;  2YTY A;  2XRQ D;  3HG9 A;  2MO1 A;  5EGT A;  2K03 A;  4DV7 L;  5I2X A;  1LLR D;  4WJ4 A;  5IIF A;  4EGV A;  4KJO A;  2AUK A;  4GN5 A;  1CM9 A;  2ICI A;  1V1P A;  1IBK L;  5GQO A;  1HFG A;  5C5L A;  3BVM A;  2VUM H;  5HGQ A;  1STY A;  2F0U A;  1PTO D;  4A3F H;  3FP9 A;  1SNQ A;  4A3I G;  1LV9 A;  4JI1 Q;  1BCP C;  3D3R A;  4HAE A;  3AFQ A;  3GV3 A;  4LF7 L;  1GXD C;  1QNK A;  2MO0 A;  1R9T B;  2HT1 A;  5C0X J;  3E3X A;  3CCL A;  4LF6 L;  3R2T A;  2ATW A;  1K73 C;  4BY7 H;  4B3M L;  3S1M B;  4ZK9 B;  3WOE A;  1QWY A;  1HQR D;  5ELB A;  4AYB E;  5M3M B;  1FNW A;  2NN6 H;  3A5U A;  4N9P A;  1HA6 A;  2O4X A;  5IY0 A;  2RA4 A;  4A4I A;  3K5N A;  2B2V A;  3T1Y Q;  3U9O A;  4RHR A;  1UUP A;  3V05 A;  3OMG A;  3CP0 A;  3HEJ A;  1K8G A;  2NVT B;  1DJR D;  4POG A;  3X3N A;  4L5T A;  4APV A;  1HR0 L;  2IL8 A;  1STE A;  3F2B A;  4DV5 Q;  4S3S A;  4IFD H;  5LMN L;  4K2K A;  1N34 Q;  1TXY A;  2J4X A;  2RDF A;  4KY5 A;  5DEH A;  4CHT B;  4A3I B;  3ER0 A;  3VYS A;  4GOP B;  1BF4 A;  3D4D A;  4KJN A;  1H9S B;  4B3S Q;  2VUM G;  3V2T A;  1PYB A;  4GN3 B;  4DNI A;  5FLX L;  2UXD Q;  2L1B A;  2AUJ D;  3BZK A;  5EKK A;  1EY7 A;  3M4Q A;  3CMA A;  3T1Y L;  2JA7 G;  4B3R Q;  2PQA B;  4M8A A;  1EEF D;  1G29 1;  2KEN A;  4CDF C;  3F2U A;  2A6H C;  1EYA A;  2JN4 A;  1D1I A;  3C1E A;  1ILQ A;  1H9M A;  3H09 A;  4OWT B;  1MSG A;  1O78 A;  4BY7 B;  2F52 A;  1T9H A;  3S1R B;  1VQ9 A;  1Y14 B;  2D0P A;  1I6H B;  2HQE A;  1SNC A;  3ND9 A;  1WI5 A;  4UHV A;  4HIO A;  3DEO A;  2OT2 A;  2VNU D;  1DON A;  1TS4 A;  1B1Z A;  1L1O B;  1Z6H A;  3NBH B;  2SDF A;  1TWH H;  2WKC A;  1HNZ Q;  2ZJR A;  4ID6 A;  3UDF A;  3MFG A;  1EY9 A;  5JJK A;  2Z6K A;  3JC6 6;  1DYQ A;  1LT4 D;  3PO2 H;  2R92 H;  5TSS A;  5I6Y A;  3VYR A;  3J81 c;  1BVS A;  5IYB H;  3HOX H;  4DR4 L;  3IFT A;  4QIW B;  3S14 H;  1WTX A;  2XN9 C;  2QKI C;  2X6L A;  3BG3 A;  1JC7 A;  1TWH B;  4YCV A;  4R9W A;  1PYS B;  1QVC A;  3Q0A A;  1NAP A;  3R8B A;  4HIK A;  2R3Z A;  4C3H H;  1FVI A;  2Z6B A;  1QB5 D;  2LXK A;  3K8A A;  3OPO A;  3M4O B;  1PFM A;  1MI2 A;  3KDF A;  4RCO A;  2L15 A;  4JOI A;  2IT1 A;  3KF6 A;  1EEI D;  1AE3 A;  3RR5 A;  2KCM A;  4OIK A;  2PZU A;  3DHQ A;  5D65 A;  3JAM E;  1F2Z A;  1SRU A;  4LW1 A;  3VDY A;  1KRT A;  1HHV A;  5C3W A;  1V9P A;  3GP7 A;  4A3D B;  4DR4 Q;  2CH4 W;  4HED A;  3FRP B;  5G3L F;  5CR3 A;  3CCS A;  2F03 A;  1M4V A;  4PZ8 A;  3JAM L;  3QIA A;  3HOZ H;  4CDE C;  1GVP A;  4JI8 L;  3GV6 A;  2ZT9 C;  3TSS A;  2HDL A;  1YIT A;  2AQ2 B;  1XNR L;  5BN3 A;  3A0J A;  2FMC A;  1M90 C;  4DR6 L;  1SND A;  5C4Z A;  4FVM A;  2EYJ A;  1LM0 A;  3K7A B;  4LUZ A;  1F2L A;  4DV0 Q;  1DGS A;  1IZ6 A;  3FKI B;  1X9N A;  5I9O A;  1HR0 W;  4BBR B;  4GOP A;  1G6P A;  1I4P A;  2ICE C;  5AFW A;  1LTS D;  4K14 A;  4BY1 B;  2HHH L;  3I56 A;  5E1F A;  4IUU A;  2EXD A;  2F3V A;  2RCF A;  3S14 B;  3PIO A;  1EYC A;  2RVL A;  4XQJ A;  1WTQ A;  3CC4 A;  3MAQ A;  1XNR Q;  1ASY A;  2D62 A;  4DUZ Q;  3GTO B;  4IUQ A;  1PRT F;  2JA5 B;  4AYB B;  1E2W A;  3A55 A;  4DNT B;  3NE5 B;  2DY8 A;  2F0K A;  5KYI A;  5A2Q L;  1UWV A;  1D2B A;  1B8A A;  3GDE A;  1VF7 A;  3S16 H;  1PTO B;  2JK8 A;  2PQE A;  4F7X A;  2LMC B;  2LY7 A;  1BXT A;  3G6J B;  3KF8 B;  4R4C A;  1SBB B;  1S5E D;  4MTK A;  3W1G A;  2UUA L;  4A3K B;  2WV6 D;  2KHJ A;  3EJI A;  2C5C A;  3QR8 A;  4GS3 A;  3GD7 A;  1VQ6 A;  1HPC A;  4E6I A;  3RLO A;  3M4P A;  2YYZ A;  2L4N A;  4X3U A;  3EQL C;  3NHH A;  5EPK A;  3OHX C;  3R2I A;  4N9T A;  2K05 A;  2ZJQ A;  2R6G A;  2EPB A;  4KK7 A;  2HCI A;  3TN2 A;  2VQE Q;  2JA8 H;  1SJH D;  5IP7 H;  5IT9 E;  1KDA A;  5EAY A;  3F1Z A;  4IJH A;  5EJW A;  1VQA A;  3GTK B;  1IW7 D;  4X64 L;  3UDX A;  4FDB A;  1TY2 A;  2IW3 A;  4BWG B;  4MTN A;  3GO5 A;  1KTK A;  1JR0 D;  4LMQ D;  4RWS C;  2K5H A;  4L5Q A;  4XQQ A;  1GHJ A;  2A74 C;  4KY7 A;  2TMP A;  1HZ9 A;  1PRT C;  4A3G H;  4DV7 Q;  1S4Z A;  1ZXT A;  4C3I G;  5DLQ E;  4DV6 Q;  4BBR G;  5C44 B;  4A3M H;  4HJ7 A;  1HNW L;  1UE6 A;  4J6H A;  4QQB X;  2ZXR A;  1MJC A;  3J80 L;  5KIX A;  4CKC A;  1SXT A;  3L3O C;  2A68 C;  3VR3 A;  2MGS A;  4QMG A;  4XT1 B;  2A8V A;  1HZB A;  3NTK A;  5EPJ A;  5KND A;  1G6Z A;  3GQB A;  4KN7 C;  1PTO F;  1BCP F;  3BVG A;  4JI6 Q;  3P7J A;  2L9H A;  2JP1 A;  2VXW A;  4HTH A;  2PNR C;  5J22 A;  1EY5 A;  4OO1 G;  5JEA G;  3T51 B;  1IKM A;  1E2V A;  3VR5 A;  2ES2 A;  3M9B A;  3CC7 A;  3BDL A;  1VMP A;  3SK4 A;  1TQO A;  3J80 c;  3J80 E;  4F88 A;  2I46 A;  4BA2 I;  4QY7 A;  5IGD A;  1XX8 A;  3I4L A;  5IYD G;  3J80 i;  4ZUI A;  1SNM A;  5GAE C;  4KLK A;  4OL7 A;  3HOU B;  3S1R H;  1PZI D;  3KLR A;  5IWA Q;  4LF7 Q;  1DM0 B;  1PDQ A;  1OXS C;  3MFY A;  2WAQ E;  3SK8 A;  1RKN A;  4GNX B;  4B9X A;  3LWE A;  5JPN C;  1HTL D;  3OIP A;  4JYA Q;  2A1A A;  2JQO A;  4BA1 I;  1P8L A;  3HKZ G;  3U4V A;  2ID0 A;  4RFB A;  5A35 A;  3K5M A;  5M5X B;  2G5D A;  1ENF A;  1Z9F A;  3RD4 A;  4P73 A;  4WFN 3;  1X55 A;  2B2V C;  1NJI C;  1CSP A;  4FF4 A;  4DK1 A;  1GO3 E;  1BNZ A;  4LF5 L;  3S1Q H;  1EY0 A;  4BBS B;  1JOK A;  5JJI A;  1PVO A;  1SYB A;  1B2T A;  1BDO A;  1OXV A;  4V0B A;  1Q3L A;  4UY8 C;  3DMU A;  4B3R L;  2K4K A;  4DR2 L;  1I50 B;  3RMH A;  2JYO A;  4G7H C;  4DAV A;  2QW7 A;  1CKO A;  2O2L D;  2KA7 A;  3RN5 A;  2B8G A;  4K8I A;  3PIP A;  4JBW A;  1ET6 A;  1V43 A;  1F9Q A;  1G2S A;  5C3E H;  1A3U A;  1IHZ A;  1TKW B;  1AE2 A;  1MHW C;  2G9H D;  3D4R A;  4CGY B;  3S1Q B;  3K80 C;  4G57 A;  1JB3 A;  4P71 A;  5IP9 H;  1YHQ A;  1OO9 B;  4CJ0 B;  3HOU G;  3SEB A;  3WWV A;  3A8K E;  5C0X I;  5K36 H;  2K5D A;  4LWC A;  4AYB G;  3ICE A;  4B3S L;  5IYD H;  5CBA E;  3FPP A;  4LK1 C;  1HNZ L;  1A3V A;  1V1P B;  1OXT A;  3MEH A;  2ZM6 Q;  3UDI A;  3ULP A;  1SE8 A;  1BBW A;  3R3O A;  4K2L A;  4ZYS A;  5D14 A;  3EIV A;  3SGI A;  3UE1 A;  4B3M Q;  5CV7 A;  2QCP X;  5J39 A;  3NBH A;  4X65 L;  2IHE A;  1PXU A;  1NCV A;  3S16 B;  4C3J B;  2Q2H A;  1ZKO A;  2UXD L;  5GAD C;  3TP8 A;  2C35 B;  1VQE A;  3PO2 G;  2J7Z A;  4BY7 G;  5FKA C;  4MIU A;  1SYE A;  3OWE B;  2CW0 D;  1VQP A;  1CSQ A;  4DR1 L;  2Y0S E;  3T56 B;  1W3S A;  1LT6 D;  3Q22 A;  3K58 A;  1RCV D;  2EY1 A;  3GTM B;  4A75 A;  3P20 A;  1RJT A;  3ERO A;  5ELC A;  4M1U B;  1ICW A;  1ILP A;  4P72 A;  4O42 A;  4QIW E;  1FYC A;  4IO9 A;  1I94 Q;  4LF9 Q;  1YHB A;  1L2F A;  1E22 A;  3VYT A;  4DV2 L;  4DR3 L;  5COR A;  5M3M G;  2O5I C;  1NUC A;  1M8A A;  3F8T A;  2UXC Q;  2X69 A;  1KDC A;  2WFW A;  3IL8 A;  5CV6 A;  2M00 A;  1J5E L;  1EOT A;  4DF7 A;  1N36 Q;  2EOT A;  4HSV A;  3LNN A;  4ALP A;  2M9V A;  2AHO B;  1FNU A;  2EIF A;  3MWY W;  2P5Z X;  4UPA A;  1N33 L;  2JA6 H;  2B2U C;  4DR3 Q;  1AZQ A;  4A3C H;  1MSH A;  3PF5 A;  1R4P B;  4X3K A;  4GNX C;  4DK0 A;  1HZA A;  2ZTD A;  4C3H B;  3H3V I;  5M5X H;  1S5D D;  2NVQ H;  3TP7 A;  2Q8R E;  4HN7 A;  1Y1W G;  1KC8 C;  2K5N A;  3NWT A;  2PNH A;  4L5S A;  1WTR A;  4UDU C;  1I3Q B;  3EN2 A;  5BN4 A;  2HIV A;  2QA4 A;  2A73 B;  3A8J E;  4DUY Q;  4XIG S;  5FJ8 H;  1VCI A;  2R7Z H;  3PGZ A;  2DNE A;  1YNN C;  5LMN Q;  1GM5 A;  2WB1 E;  3AFP A;  3FHW A;  4OEL B;  2QF7 A;  1LYL A;  4C1N K;  2J0T D;  4IUT A;  1PA6 A;  1L1O A;  1EYD A;  2KJX A;  5CBE E;  1STH A;  2H5X A;  3HKZ E;  4O1N A;  3K59 A;  1DZ1 A;  2JA5 G;  1EOV A;  3R93 A;  5E4W C;  4ZKC B;  2RSO A;  1WTO A;  2UUA Q;  2R7Z B;  1ICF B;  3S2D H;  2EDG A;  3OMC A;  1U4L A;  4OIJ A;  3HOY H;  3NEN A;  4BBR H;  2K50 A;  4Q5V A;  3I3C A;  4RGT A;  1W2B A;  5I4D A;  4ZAI A;  2F4V L;  4DGZ A;  4KKU A;  4G7O C;  1DD2 A;  4DA2 A;  1LUZ A;  2I5L X;  3FPU B;  2KUM A;  5BR8 L;  3RZD B;  1YI2 A;  3BYY B;  1J5E Q;  4X66 L;  2EY6 A;  2ZM6 L;  4IPH A;  4KD3 A;  4IZ8 A;  3QWN A;  2JA6 B;  1TS3 A;  4IPD A;  3N6R A;  2OXP A;  3NTI A;  1PZJ D;  3BYT B;  5IT9 L;  1N8R C;  1TY0 A;  3PUW A;  4A3I H;  3JAM i;  5M5Y B;  1SNO A;  3PO3 H;  4X62 L;  2MQH A;  1KD1 C;  2OCE A;  4OO1 H;  1KNA A;  4JW0 A;  4NKL A;  1QG7 A;  3H3V C;  3WOF A;  2CH4 A;  2F4I A;  5IWA L;  1Q12 A;  2KEC A;  2QIL A;  1XWE A;  2K28 A;  3RLN A;  2NN6 G;  3HFZ B;  1EWC A;  1LO5 D;  4DV6 L;  3C1F A;  3I73 A;  4RA8 A;  4TKO B;  2HCC A;  1YJW A;  4DAY B;  2QDL A;  1GUG A;  3NQT A;  5HGT A;  1I4G A;  5ELO A;  3DM3 A;  4DAP A;  3L0O A;  5IOD A;  2F0S A;  1ZYR D;  4A3M G;  2B2W C;  3VR2 A;  4DR2 Q;  1JMC A;  2NUC A;  1BBU A;  2K5V A;  4OEM B;  4QL5 A;  1IBK Q;  4KTA A;  1P16 A;  1SMX A;  4JI3 Q;  1HH2 P;  4FXK C;  4CDD C;  5JVG 3;  1TWA H;  4X62 Q;  5M3F G;  1QJO A;  5M5W B;  2B2T C;  2NVT H;  3FDT A;  1EZ8 A;  1STB A;  3AU7 A;  1PFN A;  3I70 A;  2PCF B;  3T53 B;  3BS1 A;  2SNS A;  5FLM G;  2RBM A;  1AW7 A;  4RCN A;  2AMC B;  2OQK A;  4IQZ A;  5FLX E;  3L9A X;  2RSN A;  1HNW Q;  1Y1V H;  1GUT A;  2E76 C;  4F87 A;  5C0X G;  1PV4 A;  3U9S A;  2RHS B;  1CFM A;  3PO3 G;  4DR6 Q;  5M5W H;  2D2C C;  5JEA H;  2UUC L;  4GKK Q;  3I4M B;  2PI2 A;  1JB7 A;  4L6T B;  2WKD A;  2Q2I A;  5EKI A;  1PMR A;  5J1Z A;  4R4Q A;  3A54 A;  2UU9 L;  2JE6 I;  5FOB B;  3KFU A;  4WOR A;  2HHH Q;  4JBM A;  1CKN B;  1TS2 A;  4GNX A;  1EIG A;  2PMZ B;  3IAY A;  2I5H A;  1D6E C;  4RMF A;  3FKI H;  3GTL H;  5C5M A;  1HCZ A;  2MJ8 A;  4A93 G;  1MJE A;  4BXX H;  1TVX A;  1X6O A;  3I4O A;  5C3X A;  2Z9H A;  1GJX A;  2LXJ A;  4AQY Q;  3JAM c;  1SFO H;  4A3D H;  3T1H Q;  3O13 A;  4DV1 Q;  4OGQ C;  4P74 A;  3D8G A;  4I7A A;  1PH7 A;  2Z1C A;  4C3I B;  3V96 A;  4MN3 A;  3PIO 3;  3ONA B;  2BA1 A;  2IX3 A;  2JA8 G;  4XXE A;  4DU9 A;  3NK9 A;  2EYH A;  2WIN B;  2F4V Q;  1YEZ A;  2N49 A;  2IJ0 A;  1JIC A;  1S5F D;  4DV2 Q;  2JEA I;  1O7Z A;  4A3E G;  2QDB A;  3M4O H;  1EQR A;  1Y1V G;  5C0X H;  1DOL A;  1IBL L;  2Z0S A;  3ULJ A;  4UAI A;  3W2D A;  1GUN A;  4BS9 A;  4NXM L;  2JA7 H;  4A3G G;  3J81 E;  5D3I B;  4FO2 A;  1GUS A;  4C3I H;  3UE0 A;  5IYC H;  4DR5 Q;  1XNQ Q;  3OOC A;  1E1T A;  1KNE A;  4X3S A;  3K5O A;  1WCM G;  4HCS A;  1YNJ D;  4FYD A;  1MGS A;  2ZXP A;  4CDC C;  1U4M A;  3SVM A;  3I4M H;  2XVS A;  1TWG H;  4R8N A;  3IKJ A;  2VQF L;  1WTP A;  3QOL A;  4LAA A;  1WYD A;  4LF5 Q;  3J81 i;  4FXD A;  3MZ5 A;  3PF4 A;  1EQV A;  2V4D A;  4HJ5 A;  4MZ9 A;  3W1B A;  4RAU C;  3I91 A;  2UU9 Q;  1BR9 A;  5G3L D;  4X64 Q;  1ENA A;  1PTO H;  4A3C G;  4GLA C;  1X3G A;  3MTS A;  4BBS G;  2N78 A;  3PQI A;  4A3D G;  2C9O A;  1BOS A;  3PCO B;  1K28 A;  1K3B C;  4PG3 A;  2A5H A;  3CCQ A;  1YVC A;  3W3A A;  1K3R A;  1PYW D;  3PMF A;  2XNA C;  3I90 A;  1QVF A;  4JI2 L;  1HA5 A;  2Y0S G;  1B9N A;  4OON A;  5T1I A;  3RUZ A;  1JWU D;  2KHS A;  4DNR B;  4R8I A;  2F0E A;  4RHS A;  1F9P A;  4JV5 Q;  1EIH A;  2NVY H;  4B3T Q;  2NBF A;  3FMC A;  4A3J H;  1KAA A;  1XTD A;  3I72 A;  2FXQ A;  5C4X H;  1U0L A;  2B63 B;  5IYC G;  4KD4 A;  4LFC L;  2F0D A;  1QNU A;  1XPR A;  1K8A C;  2F0O A;  2CWP A;  1YJ9 A;  1BBX C;  3MXG A;  4YHH Q;  1JE4 A;  1WOC A;  2SEB D;  4A3L G;  3TDQ A;  3HOW G;  4PMC A;  4IN3 A;  3S15 H;  1SAP A;  4ODG A;  1F2Y A;  2CKZ B;  4LF9 L;  2Z4H A;  3NBI A;  3E0J A;  4JI2 Q;  1Y69 U;  3HOZ G;  1EFW A;  4A3F G;  1PH3 A;  1KIX A;  3J7A V;  4TVA B;  5CV9 A;  3HP3 A;  5IGF A;  2DN8 A;  2SOB A;  4ME3 A;  3EBE A;  1SYF A;  5I9P A;  2F0F A;  3HKZ B;  4FXG C;  2PQA A;  2DNC A;  3HS0 C;  5IP9 G;  5KGU A;  2XGT A;  5DM7 3;  2K32 A;  1PHJ A;  4Y7N B;  1Q8K A;  1O7L A;  3J7Z C;  4LUO A;  2PZT A;  4OO1 I;  4JYA L;  2CHB D;  3MXU A;  2B2U A;  4DXF A;  4EQO A;  1CTM A;  2VY3 A;  4OHJ A;  1RF2 D;  4C2M B;  4JG2 A;  1T5X D;  2Z6K C;  1RDP D;  2DUD A;  1NMF A;  5E7N A;  4CJ1 B;  2IHF A;  4K6D A;  2KCN A;  1H95 A;  3MC0 B;  2EXZ A;  1N9W A;  2EQS A;  4C3J G;  1Q7Y C;  5IE8 A;  5EQ0 A;  4DUY L;  1K83 B;  5JPM C;  1R9T H;  1GHK A;  3AQQ A;  5ELF A;  2KCT A;  3RZO B;  4NXM Q;  3S1M H;  3CXC A;  4PV1 C;  3HOW H;  4JOI C;  1KLU D;  1A8V A;  1I4R A;  4NP5 A;  4WJW A; 
#chains in the Genus database with same CATH homology
 1LAB A;  1BUV T;  5E4X A;  5C3E B;  1A3T A;  2AWN A;  3SDZ A;  4J8Q A;  1SMY C;  2A6E D;  1G91 A;  3QB3 A;  1BCP D;  5DNF A;  3S17 B;  3T16 A;  1DXM A;  2BOS A;  1UNS A;  1OXU A;  2OEO A;  1EU3 A;  4FF2 A;  1EL0 A;  1TWC B;  2I07 B;  1ENC A;  1B50 A;  4HMI A;  2B39 A;  1SFO B;  2R93 B;  4RGM A;  3UI2 A;  1LTG D;  4EVO A;  1I4Q A;  3NSW A;  2EJG C;  1ZEQ X;  3E5S A;  5EPL A;  4LJZ C;  3MVV A;  3GTJ B;  4K5X A;  2TSS A;  1XTC D;  1EFI D;  1SDF A;  1SYG A;  2F0Q A;  3URY A;  2L55 A;  1J8I A;  3HRZ C;  1RTO A;  1STN A;  2KEE A;  1II3 A;  4IUN A;  2KOL A;  2AWO A;  3S2D B;  3HGB A;  1D5X C;  2B2Y A;  4KN4 C;  3DUZ A;  4L63 B;  5CV5 A;  4J1M A;  1GUO A;  4A93 B;  2L12 A;  3BDO A;  2EE1 A;  3BZD B;  4P2C B;  1ESF A;  5K36 G;  1HXY D;  4F8M A;  3EFX D;  3NQI A;  2NVQ B;  2BE5 D;  1TWG B;  1L0X B;  3I8Z A;  1F9S A;  1Q90 A;  4XYQ A;  1JQY D;  5M9O A;  5KYL A;  2XIW A;  1WTV A;  5CC4 A;  2B2Y C;  5JOB A;  4ILW A;  4IFD G;  1TU2 B;  4L8J A;  5JJZ A;  1RHP A;  3KUP A;  2JA8 B;  1Z7T A;  5C4X B;  1MD2 D;  2D9U A;  5CV4 A;  1AN8 A;  3HOZ B;  3VA5 A;  2K33 A;  2KQ3 A;  2HUG A;  2VB3 X;  1HUN A;  5FK9 C;  2FHT A;  3T4A C;  3ND8 A;  1B4O A;  1EY6 A;  5EBD A;  4K5V A;  1LTI D;  2F0V A;  3N52 A;  3C2P A;  1SMY D;  5IGE A;  3PUV A;  1Y8O B;  3I4N B;  1Q1E A;  2IX0 A;  3BDC A;  1Y1V B;  3AMU A;  5K5P A;  2NWG A;  1S5B D;  3KBG A;  2F0T A;  1WD0 A;  4KKT A;  2CW0 C;  5FO8 B;  4FF1 A;  2MUY A;  1C4Q A;  3TME A;  3PO2 B;  3OIQ A;  4KV6 A;  4XT3 B;  3C3L A;  3CU7 A;  1KAB A;  2JEB I;  1HQM C;  2RQX A;  5ELE A;  5C4J B;  4GZY C;  2EY2 A;  4HR7 B;  4A3G B;  1V1O A;  4IUR A;  1X3Q A;  2NN6 I;  4H0L C;  1HFN A;  2EJF C;  1Y8N B;  5KNB A;  4IAL A;  2SNM A;  1B53 A;  2Q8T A;  3X3M A;  3FEW X;  3KLS A;  1J9O A;  1SYD A;  2F0N A;  3SK5 A;  3VR4 A;  3NP8 A;  2R61 A;  4HMJ A;  5I2Y A;  3TBI B;  1QCB D;  3S9W A;  1D5Z C;  2E2J B;  3NTH A;  4RKB A;  4QB4 A;  3M4Y A;  3DXJ C;  1Q8I A;  3VA7 A;  3CRK C;  4FF3 A;  1LTR D;  3SXH A;  3GTL B;  3KLS X;  5E3F A;  3MA2 B;  2F0M A;  2WAQ B;  2NZ1 D;  2X6G A;  2XSC A;  5HUR A;  1IKL A;  2WAC A;  2L5T A;  3GTQ B;  3CQZ B;  4ZQ3 A;  3P1H A;  3QOJ A;  4TSS A;  2NYZ D;  4YIJ A;  4G4K A;  2LKV A;  1EQT A;  2WII B;  3HOX B;  2F0I A;  2M2L A;  1X32 A;  4A3F B;  2F3W A;  1UEA B;  1BQQ T;  2EYM A;  1QE6 A;  2MPM A;  4Z9C B;  1LTT D;  4KKS A;  2B8F A;  2KED A;  4EQN A;  1VF5 C;  1WD1 A;  3K57 A;  2L11 A;  1SEB D;  1HRJ A;  3M7G A;  1QOH A;  3QJY A;  1E2Z A;  1H9R A;  1F2M A;  3NPP A;  1KLG D;  2LFN A;  4K6L A;  3SR1 A;  3PUZ A;  1TWA B;  3H94 A;  1QIL A;  3K0Y A;  4X3T A;  2WP8 J;  2E2H B;  1FD7 D;  1PRT B;  2EYP A;  1NSN S;  4DAY A;  3J7Y W;  4XQN A;  2EVB A;  3SE0 A;  1B3A A;  1EU4 A;  2FJ2 A;  1IL8 A;  3C46 A;  3NXW A;  3ZYY X;  2B2T A;  4QUF A;  1CZG A;  4B9W A;  1WTW A;  1JOO A;  2K04 A;  1ESR A;  3S1N B;  1LTB D;  2PPB C;  5KRU A;  3PO3 B;  1B9M A;  1DCZ A;  5JEA J;  2XWJ B;  4H44 C;  3HOV B;  4KMU C;  2E2D C;  1CI3 M;  4A3J B;  4C3H G;  5I6W A;  4KHV A;  1X3P A;  3BVZ A;  1ROD A;  3QG1 A;  1YNN D;  4RKL A;  4DXG A;  1STG A;  5COY A;  2N55 A;  3CRL C;  1CT1 D;  4RGO S;  1H9S A;  3HOY B;  1LT5 D;  1UAP A;  3TP6 A;  3KBX A;  1PTO C;  2F0L A;  5IOC A;  1XYI A;  4FNF A;  2LS0 1;  3D4W A;  1JCK B;  1JOR A;  1MBY A;  2F0G A;  4PMB A;  2FMM A;  4XYO A;  1A2U A;  1R4Q B;  4ZLT F;  3SHL A;  2VB2 X;  1E0B A;  2JA7 B;  4V19 0;  2F0P A;  3PIP 3;  3J81 L;  3H91 A;  4KHZ A;  1AFP A;  2F0H A;  5IGC A;  3VYU A;  3H6M A;  4CJ2 C;  1V8Q A;  3OW7 A;  1CA5 A;  4I65 A;  2PO4 A;  1JWS D;  1U9R A;  4TRD A;  1K8M A;  4K5W A;  1DOK A;  1S5C D;  2IWH A;  1TII D;  4I7Z C;  2B2W A;  4XTC S;  5IGG A;  1XXG A;  1CQV A;  3VR6 A;  1AP0 A;  5EKL A;  1IW7 C;  3PV0 A;  3H0G B;  3M3Y B;  2D5D A;  5ELD A;  4CKB A;  4NDX A;  3DWP A;  2XWB B;  3M7N A;  2IX1 A;  1PFB A;  4DN4 M;  1B44 D;  3TZU A;  5CYU A;  5D3D A;  1RD9 D;  1H9J A;  1GUW A;  2NTT A;  2BDO A;  3MXP A;  2A6E C;  1FGB D;  2Q8I B;  3NWS A;  1AZP A;  2KCC A;  1W6K A;  2A68 D;  1C8C A;  2XRS D;  4H13 C;  3A8I E;  1Q1B A;  4QUC A;  4NMZ A;  2H1E A;  2A69 D;  1TT2 A;  2FFK B;  2NTS A;  1FNV A;  1LTA D;  2K7V A;  2AQ3 B;  4C1N I;  5C6A A;  2JXM B;  2K01 A;  2CQA A;  1G8Z D;  1JOQ A;  1YNJ C;  5ISR A;  4A3M B;  4XDX A;  3Q24 A;  3PUY A;  2WB1 B;  4PQX A;  3KK7 A;  2PYK A;  1O80 A;  3TZD A;  1CQF A;  1OXX K;  2PZW A;  5LHY 1;  1D1K A;  1LT3 D;  1SNP A;  5JAV A;  4Q0F A;  2F0W A;  2YU9 B;  2F0J A;  5LL6 X;  5A2Q E;  1SYC A;  2E74 C;  3AB9 A;  1ONL A;  1Y1W B;  3DM1 A;  1G2T A;  2MHV A;  1CHQ D;  2KVM A;  3LX0 A;  4MHE A;  1Z47 A;  2EY5 A;  3S15 B;  3DWQ A;  1ML0 D;  1GOZ A;  3PUX A;  3RLF A;  4IUP A;  5LL6 S;  2PW7 A;  1DOM A;  3IFD A;  2GA4 B;  3HZX A;  3WDN A;  2FIN B;  1U4R A;  3ITP A;  4IUV A;  1I6V C;  3OWF A;  2IPK D;  1I4H A;  4PNY A;  1F77 A;  2EYF A;  4B08 A;  3D6C A;  3J7A F;  2F1M A;  5BN5 A;  4KY6 A;  2E75 C;  5IGB A;  4H7B A;  4A3E B;  4WRD A;  3D31 A;  3EA6 A;  1A6X A;  1LAC A;  1L0Y B;  1EZ6 A;  5CGK A;  4U67 3;  3EVQ A;  3D6W A;  5M3F B;  5CMD A;  4TQU S;  2CVR A;  5JVH 3;  1BCP B;  1SE4 A;  3Q23 A;  1H9K A;  1SSO A;  2NB0 A;  2BCO A;  2K6A A;  2QEJ C;  2N88 A;  1BO0 A;  1KDB A;  4NW2 A;  3DEP A;  2HDM A;  4ZRZ A;  1IYU A;  5KNC A;  3P75 A;  1T5E A;  1CK1 A;  5KEE A;  4RGN A;  4ABN A;  1A2T A;  1CHP D;  2ENB A;  4ZUJ A;  2EZV A;  3OSO A;  5EBC A;  1PZK D;  1TS5 A;  5CV8 A;  4KI0 A;  1TR5 A;  4A3B B;  1A15 A;  4ZKB B;  3QO2 A;  1CZW A;  4QCL A;  1HUM A;  5T1G A;  4HSP A;  3S2H B;  2E2I B;  2A6H D;  5FO7 B;  1I4X A;  1PLF A;  1PRT D;  2RDH A;  4HCE A;  2K5W A;  3TP5 A;  1Y8P B;  2Z4I A;  3GTG B;  2OF1 A;  1ZYR C;  4IFD J;  4DFA A;  2H4O A;  1VDZ A;  4QF4 A;  5DAU A;  3NUC A;  1D5M C;  2JSO A;  3CKI B;  4G7Z C;  2R92 B;  4JK1 C;  4RH6 A;  1JWM D;  3MXN A;  3CHB D;  1HTP A;  1RTN A;  1W6J A;  3DWA A;  3E6Z X;  2RDG A;  2DY7 A;  1U4P A;  1TWF B;  4FP5 D;  3HOW B;  3M85 A;  2EYL A;  2NVX B;  2MP1 A;  3ERQ A;  2VUM B;  3MHB A;  2EYO A;  1F9R A;  2BE5 C;  2AQ1 B;  4CBV A;  2BDN A;  3G7L A;  2BA0 A;  3KF8 A;  3A7L A;  1IYV A;  3A7A B;  2A69 C;  2Z8L A;  4IFD I;  3L7Z C;  3SK6 A;  1K8O A;  2ZXO A;  4C56 C;  1NR4 A;  2RKS A;  1WCM B;  5NUC A;  4CKE A;  2PW5 A;  1STA A;  5FO9 B;  1ET9 A;  1VMC A;  3T13 A;  1SJE D;  3K6O A;  3A56 A;  2O5J C;  2K5Q A;  1EWH A;  1CA6 A;  1EY4 A;  5F2D A;  4ME5 A;  4K8J A;  1FR3 A;  4ULL A;  3K5L A;  2K1B A;  1EY8 A;  1AEX A;  3FVQ A;  5C4H A;  1SE3 A;  4EQP A;  2L0C A;  4U68 A;  1WVL A;  1SE2 A;  3Q6S A;  2EJM A;  1NR2 A;  1C48 A;  1O7Y A;  2Y0S B;  3LWU A;  2G9D A;  3GTP B;  2NVY B;  5DM6 3;  4PMW A;  2XRQ D;  3HG9 A;  5EGT A;  2K03 A;  5I2X A;  1LLR D;  5IIF A;  4EGV A;  4KJO A;  2AUK A;  1CM9 A;  2ICI A;  1V1P A;  1HFG A;  5C5L A;  3BVM A;  1STY A;  2F0U A;  1PTO D;  1SNQ A;  1LV9 A;  1BCP C;  3D3R A;  4HAE A;  3GV3 A;  1GXD C;  1QNK A;  1R9T B;  5C0X J;  3R2T A;  3S1M B;  4ZK9 B;  3WOE A;  1QWY A;  1HQR D;  5ELB A;  5M3M B;  1FNW A;  2NN6 H;  4N9P A;  1HA6 A;  2O4X A;  2RA4 A;  3K5N A;  2B2V A;  3U9O A;  4RHR A;  1UUP A;  3V05 A;  3OMG A;  3HEJ A;  2NVT B;  1DJR D;  3X3N A;  2IL8 A;  1STE A;  4S3S A;  4IFD H;  4K2K A;  2J4X A;  2RDF A;  4KY5 A;  5DEH A;  4CHT B;  4A3I B;  3VYS A;  1BF4 A;  3D4D A;  4KJN A;  1H9S B;  3V2T A;  5FLX L;  2L1B A;  2AUJ D;  5EKK A;  1EY7 A;  4M8A A;  1EEF D;  1G29 1;  3F2U A;  2A6H C;  1EYA A;  1D1I A;  3C1E A;  1ILQ A;  1H9M A;  3H09 A;  1MSG A;  1O78 A;  4BY7 B;  3S1R B;  1I6H B;  2HQE A;  1SNC A;  3ND9 A;  3DEO A;  2OT2 A;  2VNU D;  1DON A;  1TS4 A;  1B1Z A;  2SDF A;  1Z6H A;  2WKC A;  4ID6 A;  3MFG A;  1EY9 A;  1DYQ A;  1LT4 D;  5TSS A;  5I6Y A;  3VYR A;  3IFT A;  4QIW B;  1WTX A;  2XN9 C;  2QKI C;  2X6L A;  3BG3 A;  1JC7 A;  1TWH B;  4R9W A;  3Q0A A;  1NAP A;  3R8B A;  2R3Z A;  1QB5 D;  3OPO A;  3M4O B;  1PFM A;  1MI2 A;  4RCO A;  2IT1 A;  1EEI D;  4OIK A;  2PZU A;  3DHQ A;  5D65 A;  3JAM E;  1F2Z A;  1HHV A;  5C3W A;  3GP7 A;  4A3D B;  4HED A;  3FRP B;  5G3L F;  5CR3 A;  2F03 A;  1M4V A;  3JAM L;  3QIA A;  3GV6 A;  2ZT9 C;  3TSS A;  2HDL A;  2AQ2 B;  5BN3 A;  2FMC A;  1SND A;  5C4Z A;  4FVM A;  2EYJ A;  3K7A B;  1F2L A;  3FKI B;  5I9O A;  4BBR B;  1I4P A;  2ICE C;  5AFW A;  1LTS D;  4K14 A;  4BY1 B;  5E1F A;  4IUU A;  2F3V A;  3S14 B;  1EYC A;  2RVL A;  4XQJ A;  1WTQ A;  3MAQ A;  2D62 A;  3GTO B;  4IUQ A;  1PRT F;  2JA5 B;  4AYB B;  1E2W A;  3A55 A;  4DNT B;  3NE5 B;  2DY8 A;  2F0K A;  5KYI A;  5A2Q L;  1D2B A;  1VF7 A;  1PTO B;  2PQE A;  4F7X A;  2LMC B;  2LY7 A;  1BXT A;  3G6J B;  1SBB B;  1S5E D;  4A3K B;  2WV6 D;  3EJI A;  2C5C A;  3GD7 A;  1HPC A;  4E6I A;  2YYZ A;  2L4N A;  4X3U A;  3EQL C;  3NHH A;  5EPK A;  3OHX C;  3R2I A;  4N9T A;  2K05 A;  2R6G A;  2EPB A;  4KK7 A;  2HCI A;  3TN2 A;  1SJH D;  5IT9 E;  1KDA A;  5EJW A;  3GTK B;  1IW7 D;  1TY2 A;  2IW3 A;  4BWG B;  3GO5 A;  1KTK A;  1JR0 D;  4LMQ D;  4RWS C;  4XQQ A;  1GHJ A;  2A74 C;  4KY7 A;  2TMP A;  1PRT C;  1S4Z A;  1ZXT A;  4C3I G;  5C44 B;  4J6H A;  2ZXR A;  3J80 L;  5KIX A;  4CKC A;  1SXT A;  3L3O C;  2A68 C;  3VR3 A;  4XT1 B;  2MGS A;  4QMG A;  3NTK A;  5EPJ A;  5KND A;  1G6Z A;  3GQB A;  4KN7 C;  1PTO F;  1BCP F;  3BVG A;  3P7J A;  2L9H A;  2JP1 A;  2VXW A;  4HTH A;  2PNR C;  5J22 A;  1EY5 A;  4OO1 G;  5JEA G;  3T51 B;  1IKM A;  1E2V A;  3VR5 A;  3BDL A;  1VMP A;  3SK4 A;  1TQO A;  3J80 E;  4F88 A;  2I46 A;  4BA2 I;  5IGD A;  1XX8 A;  3I4L A;  4ZUI A;  1SNM A;  4OL7 A;  3HOU B;  1PZI D;  3KLR A;  1DM0 B;  1PDQ A;  1OXS C;  3MFY A;  3SK8 A;  1RKN A;  4B9X A;  3LWE A;  5JPN C;  1HTL D;  3OIP A;  4BA1 I;  2ID0 A;  4RFB A;  5A35 A;  3K5M A;  5M5X B;  1ENF A;  3RD4 A;  4WFN 3;  2B2V C;  4FF4 A;  4DK1 A;  1BNZ A;  4BBS B;  1EY0 A;  1JOK A;  1SYB A;  1B2T A;  1BDO A;  1OXV A;  4V0B A;  1Q3L A;  3DMU A;  1I50 B;  3RMH A;  2JYO A;  4G7H C;  4DAV A;  2O2L D;  2KA7 A;  2B8G A;  4K8I A;  4JBW A;  1ET6 A;  1V43 A;  1F9Q A;  1G2S A;  1A3U A;  1IHZ A;  1TKW B;  3D4R A;  2G9H D;  4CGY B;  3S1Q B;  4G57 A;  1JB3 A;  1OO9 B;  4CJ0 B;  3SEB A;  5K36 H;  3A8K E;  5C0X I;  2K5D A;  5CBA E;  3FPP A;  4LK1 C;  1A3V A;  1V1P B;  1OXT A;  3MEH A;  3R3O A;  4K2L A;  4ZYS A;  5D14 A;  5CV7 A;  2QCP X;  5J39 A;  3NBH A;  1PXU A;  1NCV A;  3S16 B;  4C3J B;  1ZKO A;  3TP8 A;  2J7Z A;  5FKA C;  4MIU A;  1SYE A;  3OWE B;  2CW0 D;  3T56 B;  1LT6 D;  3Q22 A;  3K58 A;  1RCV D;  2EY1 A;  3GTM B;  3P20 A;  1RJT A;  3ERO A;  5ELC A;  4M1U B;  1ICW A;  1ILP A;  4O42 A;  1FYC A;  3VYT A;  5COR A;  2O5I C;  1NUC A;  1M8A A;  2X69 A;  1KDC A;  3IL8 A;  5CV6 A;  2M00 A;  1EOT A;  4DF7 A;  2EOT A;  4HSV A;  3LNN A;  2M9V A;  1FNU A;  3MWY W;  2B2U C;  1AZQ A;  1MSH A;  1R4P B;  4X3K A;  4DK0 A;  4C3H B;  1S5D D;  3TP7 A;  2Q8R E;  4HN7 A;  3NWT A;  1WTR A;  4UDU C;  1I3Q B;  5BN4 A;  2A73 B;  3A8J E;  4XIG S;  1VCI A;  2DNE A;  1YNN C;  2QF7 A;  4C1N K;  2J0T D;  4IUT A;  1EYD A;  2KJX A;  5CBE E;  1STH A;  4O1N A;  3K59 A;  1DZ1 A;  3R93 A;  5E4W C;  4ZKC B;  2RSO A;  1WTO A;  2R7Z B;  2EDG A;  3OMC A;  1U4L A;  4OIJ A;  4Q5V A;  3I3C A;  4RGT A;  5I4D A;  4ZAI A;  4DGZ A;  4KKU A;  4G7O C;  1DD2 A;  4DA2 A;  3FPU B;  2KUM A;  3RZD B;  3BYY B;  2EY6 A;  4KD3 A;  4IZ8 A;  3QWN A;  2JA6 B;  1TS3 A;  3N6R A;  2OXP A;  3NTI A;  1PZJ D;  3BYT B;  5IT9 L;  1TY0 A;  3PUW A;  5M5Y B;  1SNO A;  4OO1 H;  1KNA A;  4NKL A;  1QG7 A;  3H3V C;  3WOF A;  2F4I A;  1Q12 A;  2KEC A;  2QIL A;  1XWE A;  2K28 A;  2NN6 G;  1EWC A;  1LO5 D;  3C1F A;  3I73 A;  4RA8 A;  4TKO B;  2HCC A;  1GUG A;  3NQT A;  5HGT A;  1I4G A;  4DAP A;  5IOD A;  2F0S A;  1ZYR D;  2B2W C;  3VR2 A;  2NUC A;  4KTA A;  4FXK C;  5JVG 3;  1QJO A;  5M5W B;  2B2T C;  3FDT A;  1EZ8 A;  1STB A;  3AU7 A;  1PFN A;  3I70 A;  2PCF B;  3T53 B;  3BS1 A;  2SNS A;  2RBM A;  1AW7 A;  4RCN A;  4IQZ A;  5FLX E;  3L9A X;  2RSN A;  4F87 A;  5C0X G;  1GUT A;  2E76 C;  3U9S A;  1CFM A;  5JEA H;  2D2C C;  3I4M B;  4L6T B;  2WKD A;  5EKI A;  1PMR A;  5J1Z A;  3A54 A;  2JE6 I;  5FOB B;  4WOR A;  1TS2 A;  1EIG A;  2PMZ B;  3IAY A;  1D6E C;  5C5M A;  1HCZ A;  2MJ8 A;  1TVX A;  5C3X A;  1GJX A;  3O13 A;  4OGQ C;  3D8G A;  2Z1C A;  4C3I B;  3V96 A;  4MN3 A;  3PIO 3;  3ONA B;  2BA1 A;  2IX3 A;  4XXE A;  4DU9 A;  3NK9 A;  2EYH A;  2WIN B;  2IJ0 A;  1JIC A;  1S5F D;  2JEA I;  1O7Z A;  2QDB A;  5C0X H;  1DOL A;  4UAI A;  3W2D A;  1GUN A;  4BS9 A;  3J81 E;  5D3I B;  4FO2 A;  1GUS A;  3OOC A;  1KNE A;  4X3S A;  3K5O A;  4HCS A;  1YNJ D;  4FYD A;  1MGS A;  2ZXP A;  1U4M A;  3SVM A;  2XVS A;  4R8N A;  3IKJ A;  1WTP A;  3QOL A;  4LAA A;  4FXD A;  3MZ5 A;  1EQV A;  2V4D A;  4RAU C;  3I91 A;  1BR9 A;  5G3L D;  1ENA A;  1PTO H;  3MTS A;  2C9O A;  1BOS A;  2A5H A;  3W3A A;  1PYW D;  3PMF A;  2XNA C;  3I90 A;  1HA5 A;  1B9N A;  5T1I A;  4DNR B;  3RUZ A;  1JWU D;  2KHS A;  4R8I A;  2F0E A;  4RHS A;  1F9P A;  1EIH A;  2NBF A;  3FMC A;  1KAA A;  2B63 B;  3I72 A;  4KD4 A;  2F0D A;  1QNU A;  2F0O A;  1BBX C;  3MXG A;  1JE4 A;  2SEB D;  3TDQ A;  4PMC A;  4IN3 A;  1SAP A;  1F2Y A;  4ODG A;  2Z4H A;  3NBI A;  3E0J A;  1Y69 U;  3J7A V;  5CV9 A;  3HP3 A;  5IGF A;  2DN8 A;  2SOB A;  1SYF A;  5I9P A;  2F0F A;  3HKZ B;  4FXG C;  2DNC A;  3HS0 C;  5KGU A;  5DM7 3;  2K32 A;  4Y7N B;  1O7L A;  4OO1 I;  2PZT A;  2CHB D;  3MXU A;  2B2U A;  4DXF A;  4EQO A;  1CTM A;  4OHJ A;  1RF2 D;  4C2M B;  1T5X D;  1RDP D;  4CJ1 B;  4K6D A;  2KCN A;  3MC0 B;  2EXZ A;  4C3J G;  5EQ0 A;  1K83 B;  5JPM C;  1GHK A;  5ELF A;  3RZO B;  4PV1 C;  1KLU D;  1I4R A;  4NP5 A;  4WJW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...