4K8IA

Crystal structure of staphylococcal nuclease mutant i92v/v99l
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYVYADGKMLNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4k8iA00
4KHVA 3EROA 1SYBA 5IOCA 4J1MA 2EYFA 3HZXA 1EZ6A 3TP6A 5ISRA 2EYLA 5EKLA 5DAUA 1SNDA 4NKLA 3QOJA 5I6WA 5I6YA 2HQEA 4KY7A 4K2LA 5CV4A 3RUZA 1JORA 1SNPA 2EYPA 5IGDA 5M9OA 2O4XA 2F0JA 2SNSA 5IODA 1KDBA 1II3A 3NUCA 4TRDA 2F3VA 5IIFA 3D4DA 1A3TA 3C1FA 3S9WA 1TR5A 5IGFA 5KGUA 5JAVA 1SYDA 1SNOA 2F0OA 3ITPA 3D6CA 2PYKA 3DMUA 3VA5A 1A2UA 3MHBA 4MIUA 5HGTA 2SOBA 3QOLA 1ENCA 5IGEA 2PZWA 1STNA 2NUCA 5CV6A 4EQNA 5CR3A 2OEOA 5CV5A 5F2DA 5EKKA 5HURA 4KY6A 4B9XA 4DFAA 1EY0A 3OSOA 3D4WA 4HTHA 1EY4A 2ENBA 4N9TA 1AEXA 3BDCA 3C1EA 4K2KA 1JOOA 1KDAA 4EVOA 4ZUIA 5IGGA 3NK9A 4RKLA 1SYEA 2QDBA 5C6AA 3V2TA 3E5SA 3TP5A 3D8GA 3H6MA 3R3OA 4G57A 2F0SA 3MEHA 2WACA 3P1HA 3NQTA 1STBA 2F0HA 1EY6A 2EXZA 1EYCA 1SYGA 2F0VA 2PW7A 2F0QA 4IALA 4YIJA 1STHA 4K5WA 5KIXA 5J22A 5C3WA 3U9OA 2EYHA 4J6HA 5C5LA 4PMBA 4QF4A 1EYDA 2EY1A 4QB4A 4KJNA 3MXPA 3SK4A 4PNYA 4K8IA 1STGA 3ERQA 1NSNS 1SNCA 1TQOA 4IUNA 4KJOA 5IGBA 1F2ZA 3SHLA 4DU9A 3SK6A 2F0DA 2EY2A 1F2YA 2F0NA 1KAAA 1SNMA 5EGTA 4OL7A 1KDCA 2RBMA 4K8JA 4EQOA 1U9RA 4N9PA 1ENAA 2SNMA 4WRDA 4DF7A 2PQEA 1SNQA 2F0EA 3NP8A 4LAAA 5CV8A 4RKBA 5C3XA 2F0GA 3SXHA 1EQVA 2F0FA 2RDFA 3LX0A 4DGZA 1EY9A 4F7XA 1JOKA 4ME5A 3SK5A 5C5MA 2EY5A 1JOQA 1KABA 2PW5A 2PZTA 4K6DA 4ZQ3A 3DHQA 2F0KA 2F0WA 2OXPA 3MVVA 5I9PA 1A3VA 2EY6A 5NUCA 4KTAA 4F8MA 5CGKA 1EZ8A 3NXWA 3P75A 4HMJA 5J39A 2F0MA 1NUCA 2F0IA 1A3UA 1SYCA 2M00A 5KRUA 1IHZA 2F0PA 4ZUJA 2EYOA 2EYJA 4NMZA 3HEJA 3EVQA 1TT2A 3QB3A 2F0LA 4EQPA 5JOBA 4K5XA 5KEEA 3NHHA 5E1FA 3T16A 1EY8A 3PMFA 5CV7A 3OWFA 5CC4A 1STAA 4KY5A 1SYFA 4NP5A 3EJIA 3TP7A 4E6IA 3MZ5A 3OMCA 3SK8A 4PMCA 2F0TA 4HMIA 5C4HA 4QMGA 1EY7A 1RKNA 4KD3A 5J1ZA 2F0UA 5E3FA 2PZUA 3TMEA 5KYIA 2RKSA 5KYLA 1EYAA 5IGCA 2F3WA 2EYMA 5I9OA 2KHSA 2LKVA 4H7BA 4R8NA 2KQ3A 2OF1A 1STYA 3SR1A 3BDLA 4NDXA 5CV9A 5DEHA 1F2MA 4ID6A 1EY5A 4K14A 4ODGA 4WORA 4K5VA 3TP8A 4B9WA 4KD4A 1A2TA 3OMGA 4I65A 5C4ZA 5K5PA 4KV6A 3T13A 4IZ8A 4S3SA
chains in the Genus database with same CATH superfamily
4A4IA 5C3EH 3I4NG 4LWCA 5EKLA 1H9SA 1RCVD 4ZCKA 2HQEA 2RHSB 3T53B 3G71A 4V190 3WWVA 4OWXB 4J15A 4R4CA 2QCPX 4ZKBB 2F3VA 4CKEA 1PFSA 1A63A 2UXBQ 1HXYD 1YIJA 4DV7Q 4ABNA 2B2YA 1QNKA 3D6CA 2VZAA 3K8AA 1A2UA 3VA5A 4MIUA 3UDIA 1GO3E 4CJ1B 4JI6L 4K0KQ 1WCMH 1QCBD 3JAMi 1BNZA 2Q8TA 1STNA 2ZJQA 1KD1C 4H0LC 1H9MA 1NAPA 5L37A 2F4IA 5CBEE 4HTHA 2B8GA 2ENBA 5TSSA 1GJXA 2JEAI 2IT1A 4A3FG 5IGGA 1VF5C 2Q2UA 5FO9B 4NXNL 3S15B 4H02A 3UDFA 1CQFA 4B3ML 4C3HH 4DPGA 4DR6L 4BXXH 2N8NA 4ALPA 2F0VA 2N49A 4Q0FA 4DAMA 1HR0Q 5C5LA 4PMBA 4BBSH 3MXPA 5M3FG 1I3QH 2E2JB 2MP1A 3DM3A 1CHQD 1D5XC 4GNXB 3S1MB 1SDFA 1SE2A 4NXML 1WOCA 3M9BA 4EQOA 2QILA 3UI2A 4A3MG 1U9RA 2PMZB 2R7DA 4JI3L 1B1ZA 3R2IA 3SXHA 3I2ZA 1BCPF 1Y1WG 1K8GA 2HHHQ 3PO3B 5IWAL 1KLUD 3K0YA 2UU9L 3DHQA 3MVVA 1UE5A 5FOBB 3J80E 2K5VA 3UDGA 4JBKA 1AZPA 3S16B 1K3RA 2R93G 3GTPB 2NVXB 2QDLA 5KEEA 2L4NA 2JXMB 4XQNA 2C9OA 4WJ4A 1CA6A 1PTOB 4P74A 1BVSA 1LABA 2IY5B 2NVTH 1TWAH 2QEXA 1F9QA 4ULLA 4JW0A 1UNSA 1H9RA 2UXCL 3BDOA 3STBC 1CSQA 2ZXOA 1G6ZA 4RAUC 5FLMG 1GM5A 2H4OA 4KD4A 4P2CB 5FKAC 1UE6A 2WFWA 3CRKC 3W5OA 3M3YH 3G48A 1Z47A 1U4LA 1B44D 1Y69U 1ET9A 2L11A 4L8JA 5JEAG 5A2QE 2V1CC 2ZXPA 2LFNA 3NUCA 4DXGA 1JE5A 2AHOB 4OIJA 1VQHA 3GTQH 1T5XD 3H0GG 4IPCA 5E4XA 4DUZQ 1D1IA 1XTDA 4EX5A 2EIFA 1X3QA 1RDPD 2N3SA 3S17H 4JI1L 2ZJPA 3H15A 4MTNA 1VQLA 1IL8A 2ZXRA 2DY7A 2R61A 3T51B 1MGSA 1EY4A 1SMYD 1Q82C 1AEXA 1GVPA 3H94A 2Z4HA 3P20A 3HOZB 2A69D 3F2DA 2QA4A 3QWNA 1Y1VG 3L0OA 2B2VA 5E4WC 3U58A 2MJ8A 3S2HB 4HCEA 4IALA 2EJGC 2B2WC 1TWHB 1STHA 3U9OA 2EYHA 4J6HA 4FF4A 1JJ2A 4AYBB 3I4NH 4KJNA 4P71A 2L12A 4FXKC 1AE3A 1IYVA 2I5MX 1B3QA 3SHLA 4K6LA 4DV1L 1RTNA 2PQAB 4G7ZC 1EOTA 3J81j 1F2YA 5IP9G 3RZOH 1YJWA 2EPBA 2ALYB 4N9PA 4OELB 2KUMA 4B3TQ 1ZYRC 3X3NA 1WD1A 2B63G 3FVQA 3VYTA 4IUTA 2PW5A 2M9VA 2NVYB 1XMOL 4GKJL 1RIPA 2PNRC 4DR1Q 1VQPA 4X62Q 1WTWA 1HNXL 1MSHA 4HIMA 1NUCA 1O80A 3MXUA 4X64Q 4X66L 4A3FH 1KIXA 1NNXA 1ILQA 2LS01 3NPPA 5M5YB 4UPAA 3CCJA 1EY8A 2A19A 3EJIA 1W6JA 2ZTEA 1Q81C 3DM1A 1L1OA 4QL5A 5J1ZA 3CMAA 1X54A 4UHVA 2VQEL 3G6EA 5A2QL 5M3FH 2LKVA 3KBXA 4K14A 4PZ8A 1AP0A 3S2DH 2F4VL 2A6EC 4A3MH 1QILA 3CC2A 2HIVA 1N36L 2VUMG 4JOIC 3KF8A 2XN9C 3HZXA 3UE0A 3CF5A 1A6XA 1QZHA 4XYOA 1JICA 3MXNA 5IGDA 1Y1WH 4LF9L 2K33A 1KDBA 2NVQH 4JPBW 2RCNA 3HKZB 1TR5A 1C0AA 5JVG3 4A3BG 3KFUA 1QZGA 2R93H 1WTRA 3QOLA 2K03A 3H09A 5CV6A 1B50A 3TSSA 1QNUA 1XXGA 2Z6KC 1DOKA 3C1EA 4JV5L 2WAQE 4JC0A 3K5MA 1EIHA 1HHVA 5I4DA 3MEHA 4DK0A 5ELEA 3DEOA 4C3IB 5IP7H 5FLMH 1SYGA 2PW7A 3S14H 2K01A 2IHFA 2VW9A 2BE5C 4IUUA 3SK4A 1E2WA 3JAMc 3K5LA 1VQGA 5JEAH 2E76C 1QVCA 2EQSA 3HS0C 1TS5A 1A8VA 3H0GH 1CFMA 5CV8A 3RLOA 2FINB 2XWBB 1QE6A 3T1YL 1X56A 2JA8H 3E0EA 4KKTA 2JA6B 2Q8IB 2CVRA 1QVGA 5JJZA 5IYCG 1N34Q 1A62A 1A3VA 1DOMA 1TS2A 1IKMA 1H9SB 4GOPC 1XNRL 2M00A 4LUVA 3VA7A 4APVA 1ESFA 3OIQA 1Y1VH 1O7IA 1PTOD 5BN3A 4A3GH 1VQCA 3I55A 1GHKA 2B8FA 4LJZC 5IE8A 4B08A 5JJKA 3TMEA 2OQKA 2JSOA 5FO7B 2A74C 3RZDB 4A3IB 2O5IC 1VQ9A 4DR7L 4V0BA 5IP9H 4DV6Q 2YYZA 2EOTA 4BBRB 1V1OA 1EYGA 1B3AA 4TQUS 4S3SA 5IODA 2E75C 1NCVA 3QOJA 2VQFQ 1B7YB 2B63H 1ZXTA 3RUZA 5LL6X 4PV1C 4DR2L 5C0XI 4IPGA 4KLKA 4BY1G 4GN4B 2IL8A 4DK6C 4H13C 3OTOL 4NPSA 2R7FA 4DR3Q 2E2IH 2A6HD 2GVBA 5DM73 1A0IA 1VCIA 2IWHA 2K32A 1CA5A 1PV4A 4OX9L 4B3SL 4DR5L 5IGEA 1CZWA 3K7AH 4FYDA 1XPUA 3EIVA 2E5LL 3V05A 3OSOA 1O78A 1KL9A 1JR0D 1W3SA 1W6KA 3HOWG 5BR8L 3PIOA 5LL6S 1TS3A 5I2XA 1Q46A 1Y8NB 3TP5A 3H6MA 4JYAL 1S5FD 1GUGA 2OQ0A 2ICEC 4JI4Q 2EXZA 2F0QA 3BZKA 1J8IA 5C44B 1K0RA 2VUMH 1DXMA 2CFMA 4PZ7A 1BOSA 2R6GA 3EN2A 3EFXD 4L63B 4RCOA 2VNUD 3QG1A 1QVFA 1KRTA 3MC0B 1KAAA 4YCUA 2YTVA 4QUCA 2RBMA 1OXUA 3G6JB 3KF6B 4UAIA 2I5LX 3URYA 1YEZA 4QCLA 3FPUB 5D3IB 3BYYB 1I5FA 1AFPA 2EY5A 4L5QA 3AU7A 5C0XG 4ZQ3A 3TZUA 1DM0B 5NUCA 3SEBA 2PMZE 2OT2A 3PSIA 3GTLB 2UXBL 1UE1A 1EWIA 1GHJA 3M7GA 4ZUJA 4DV7L 1JCKB 3EVQA 4K0KL 1ESRA 2ICIA 3OWFA 2LY7A 1F9RA 2K04A 4Y7NH 2Y0SE 4QMGA 1EY7A 3IKJA 4POFA 4DV3Q 2RKSA 1E7ZA 2F3WA 2AQ3B 3C2PA 5C4JB 3GTKH 3PQIA 4HCSA 1FYCA 4ZK9B 1BBUA 1UAPA 2FXQA 1WD0A 4UP7A 4YY3Q 3Q22A 2R92G 1I4PA 1HR0L 1CQVA 4L6TB 2CWPA 1EZ6A 5DM63 4I7AA 3HOZH 2B2UC 2JEBI 1SNPA 4L5TA 4C2MB 2PQAA 5FO8B 4YWKA 3PUWA 2WIIB 5IYCH 2AWNA 5GADC 1LUZA 4QGUA 2OWOA 2F0OA 1SSOA 1P16A 3D3RA 1X3GA 3V96A 2Q2IA 4QIWB 4C1NK 1I4RA 2VXWA 1YNJD 3FEWX 1WVLA 2HHHL 1E1OA 3A55A 3OW7A 4DNIA 5JPNC 1I94Q 3GTOB 1KQSA 4EVOA 1JT8A 3NK9A 1FGUA 3M85A 3O13A 3D8GA 5D14A 2E2DC 2IX1A 1STBA 2E8GA 4YIJA 3CQZB 1RL2A 3MWYW 1I6HB 3GQBA 2GN5A 3RN2A 1BF4A 2WB1B 2PO4A 1JWSD 4JK1C 3CPFA 2KECA 3DEPA 1L1OB 2Q2HA 1EQTA 4K8JA 4BY1H 3HOVB 4XYQA 1YNXA 2SNMA 1PZJD 3CCRA 3CRLC 2K52A 4AYBE 1PH9A 2QW7A 1FR3A 1GKHA 3Q6SA 1BO0A 1GOZA 4A76A 3S1QH 1EY9A 4GS3A 4RA8A 3KF8B 2R7ZG 4XQQA 4HJ9A 2J7ZA 3HOWH 1A3UA 3TBIB 2YU9H 2K6AA 1MSGA 4DUZL 2IJ0A 4XTCS 4HJ7A 2XTIA 2Z6BA 3A7LA 3IL8A 1TWFH 4DAPA 1G291 2RDGA 1LO5D 4MN3A 5CC4A 1STAA 3TP7A 3MZ5A 4JI8Q 2JJQA 3K58A 3M4OH 1IYUA 2CHBD 2RF4A 2PZUA 2DNCA 4NB3A 3CCMA 3UDXA 2XVSA 3J81i 2RDHA 1DCZA 1SFOB 1KXLA 4LNQA 4K5VA 5ELNA 5IYBG 3KLRA 4LMQD 4IUVA 4M8AA 1CHPD 4RGTA 4KHVA 1XNQQ 5IOCA 2UUBQ 4O1NA 5I6WA 4JI2Q 1V1PA 1MI2A 2K5DA 1EIGA 4OXPA 3VYSA 1PRTC 1WTOA 2O4XA 2NZOA 2R3ZA 4MTKA 5C0XH 2BA0A 1A3TA 4ZLTF 2KHIA 4UY8C 5JAVA 4B3TL 4DK3C 2ZTCA 3HFZB 1U5KA 3S1NB 2A68C 3GP7A 3HKZE 3D4WA 1S5ED 3BDCA 4DR1L 4GN5A 4X62L 3TEHB 2E74C 4X64L 3W3AA 4OEMB 5M5XB 4DV4Q 4G4KA 5GAGC 1BCPB 1CT1D 3C3LA 3KBGA 2R92H 1Z7TA 1JJGA 2LXKA 1EU4A 4PNYA 1SNCA 5LHY1 3AEVA 5JJIA 1PH8A 4BY7G 1K0SA 4JI5Q 3K57A 2ZTDA 1YHQA 1KDCA 5CBAE 2PPBC 3GTMH 2NTTA 1MJCA 1MD2D 4WRDA 4FXDA 2A5HA 1EWCA 4RKBA 3KYHC 4MHEA 1YNND 4H44C 4AH6A 4DGZA 5ELDA 2JA5B 2B2WA 3QR8A 3F8TA 5CGKA 2EY6A 3AFQA 3LWUA 2XRQD 4IPHA 5ELBA 3P75A 4A3JB 2WAQG 5EKIA 1I50B 1PZKD 1PMRA 1CTMA 5FLXE 3VYRA 4A3KG 3CP0A 3CCEA 3GTJB 3HOXG 3SK8A 1DZ1A 2RA4A 1LV9A 1CI3M 1PH6A 4KD3A 5EBCA 3BS1A 3WDNA 1H9JA 3DWAA 1EQQA 3Q8DA 1GUSA 5AJ3Q 4ODGA 1RODA 1PLFA 2Q8RE 4I65A 3N52A 4RFBA 4HJ5A 1C7YA 3T13A 1U4RA 2IX3A 4KKSA 3H91A 3CCQA 2EYLA 2ID0A 2MPMA 5I6YA 2VS1A 1SEBD 4I7ZC 3J7AV 3BVZA 1Q90A 1HUMA 1PYBA 3F1ZA 2R7ZH 3H3VC 5M5WH 4C3JG 3S9WA 3DUZA 1NMFA 3AB9A 1L0WA 2B29A 3KF6A 4J8QA 3ITPA 3MHBA 3CKIB 2SOBA 5IP7G 2CQOA 2Z8LA 2BDNA 3NE5B 5EKKA 1W2BA 2HDLA 1N34L 4RGMA 2I46A 4JG2A 3PO2G 1X3FA 3HOUG 1BR9A 1V9PA 3AMUA 2UUCQ 1YI2A 1TS4A 2EE1A 2RCFA 2FMCA 3K5NA 1HUNA 4RH6A 1VQDA 2F0HA 5IYBH 1EYCA 5KIXA 1DOLA 1T5EA 1YJNA 4R4QA 3A7AB 4XIGS 5IGBA 2JA8G 2I0QA 4IUNA 1PYSB 2JA7B 2BH8A 4DV5Q 3J80i 3SK6A 1PVOA 3GTGB 4UDUC 4DV6L 5FLXL 5GAHC 2Z6KA 5EPJA 2F0GA 2X6LA 3PUVA 1WTQA 3DLLA 4DKAC 4RMFA 2MO1A 2VQFL 2K5QA 3M7NA 4A3GG 5LMUQ 2F0WA 3CD6A 1L0YB 4A3LG 4DR3L 2F0IA 2GA4B 5KRUA 3TZDA 4DV2Q 1IBLQ 1G51A 3I3CA 4P72A 3BU2A 4A93B 2KEDA 2E2HH 1QJOA 2XIWA 5E1FA 3J80L 5CYUA 2KA7A 1WI5A 4RGNA 3M4QA 4A3DB 2X69A 4LK1C 1PFMA 3I72A 5FJ8G 4CDEC 1CM9A 5KYIA 1VQNA 1PFBA 4HEDA 1PDQA 3DWQA 1ZEQX 2K5HA 4H7BA 5IT9c 4BY7H 4O42A 1E1TA 4HJAA 4A3EB 3SE0A 1MBYA 5LMNQ 2YV5A 3W1BA 4JI4L 2ZM6Q 1K83H 4DR4Q 4GZYC 4YCVA 5A35A 5BN4A 4MNOA 5ELCA 2NBFA 2D9UA 3IRBA 3OYYA 3HOYB 2UUAQ 1SE4A 4IFDI 4DAVA 5HY6A 1SN8A 1VQFA 4HSPA 4KI0A 4A3CG 4A3KH 1PH2A 4R1JA 1IBKQ 1F2LA 1DGSA 1F9PA 3PO3G 1KAWA 2B39A 1CKMA 3HOXH 1EY0A 2A1AA 1PA6A 2KJXA 2Y0SG 1BDOA 1ML0D 5JPMC 5COYA 2ES2A 3ND9A 1KDAA 1GUWA 3K59A 3I4LA 1Q12A 1AH9A 4QIWE 1BCPD 4CJ0B 1RJTA 1KHIA 4DK1A 1EY6A 1ONLA 1U0LA 2XRSD 1SXTA 3M4PA 2RSNA 4XXEA 3KLSX 1NR2A 4DV3L 1N9WA 2C5CA 4DU9A 1R9TB 4GN3B 2VL6A 3I91A 5M3MB 4YCWA 2B2TA 2DJGC 2P5ZX 1N32Q 4C3JH 4YY3L 1TXYA 2PQEA 2EZVA 2KCCA 2D0OA 1FGBD 2WB1E 3U4ZA 3KLSA 1PH4A 4CKCA 4F7XA 3GV6A 5HGQA 1SE3A 2N55A 2CQAA 1TWGH 4IOCA 4IFDG 2DN8A 4HN7A 1V1PB 3PO2H 1C4QA 3HOUH 4KHPQ 1B9NA 1JJCB 1TT2A 3I4MB 1TWCH 3NHHA 3S1RH 1HR0W 3LGJA 4BWGB 3D4RA 3HRZC 4CDDC 4PMCA 2C35B 3FKIB 1WTXA 1UEBA 2F0UA 3BVGA 1EIYB 1JB3A 5KYLA 1I94L 3HOZG 5C4XB 2KHSA 1S72A 2AUJD 1V8QA 3SR1A 1K28A 2BCOA 3BDLA 1VF7A 1S5BD 3VR6A 1EY5A 1XX8A 1TKWB 1YHAA 3E9IA 4KHZA 1OXSC 4AYBG 2OCEA 1LTID 3N6RA 1J5EQ 4YHHQ 4R4IA 3TP6A 2O5JC 5C3EB 1H9KA 4FP5D 3GV3A 1J6QA 2EDGA 5M9OA 3PGZA 4DA2A 1E2ZA 1R4PB 1RD9D 1O7ZA 3PV0A 3L7ZC 2KOLA 3IAYA 3TQYA 4LUZA 2L55A 4GKKQ 5IGFA 4A3LH 2I5HA 2DGYA 4LF7Q 1TU2B 4DNTB 2G9HD 1WCMB 3CCUA 1TY2A 3KDFB 3BYTB 1HQRD 1K8AC 1CKOA 1VQIA 5FJ8H 1L1OC 1JOOA 3NEMA 4ZUIA 2H5XA 4JI7Q 3H3VI 3S15H 2CW0D 1SMYC 5KNBA 1GUOA 2A69C 4C3HB 1CSPA 4JI8L 4QF4A 2EY1A 1K73C 4BBSB 1NSNS 2E2JH 3J7AF 2NZHA 2JE6I 4B3RQ 1ASYA 1I3QB 1DJRD 4LF4Q 1VQAA 3S1MH 4DXFA 4LF6Q 1SNMA 1ET6A 1X3PA 4GLXA 2L5TA 3PIO3 1UWVA 1SBBB 1ENAA 4QUFA 3K81C 2K28A 4LAAA 2RQXA 1Q3LA 2OTJA 1LTLA 2LSSA 2UUBL 4FVMA 1XNQL 1VS0A 2MGSA 2HT1A 4A3CH 3G4SA 3C46A 4JI2L 4IN3A 5EJWA 1EIFA 1BBXC 3PO3H 3HKZG 1HPCA 1YHBA 5JEAJ 1EZ8A 5J39A 4HMJA 3S16H 3GTPH 2NVXH 1IHZA 2WKCA 2EYOA 3T16A 2MHVA 2K1BA 1PTOH 4E6IA 3HGBA 1HA6A 2KENA 1LT5D 2NVTB 1TWAB 5E3FA 1YITA 5IGCA 1B9MA 1LTTD 2VY3A 2KQ3A 4C3IG 4KN7C 4N8X1 4DV4L 4FO2A 5IYDG 3I70A 2HD3A 4UP9A 3M3YB 3EROA 1SYBA 4J1MA 4OONA 4U68A 3J7ZC 1NR4A 1Z6HA 3BJUA 2F0JA 2HIXA 4LF8Q 4O0AA 3EQLC 4JI5L 1EL0A 5IIFA 4IFDH 3C1FA 1LT6D 3GTQB 2Z9HA 1FD7D 1V43A 1D2BA 1G2TA 4IJHA 2JA6G 3S17B 4CDFC 3L9AX 4QY7A 1OXTA 1Y14B 1BXTA 1YZ6A 3V2TA 4YWMA 5KNCA 2F0SA 3S2HH 2BDOA 2AUKA 3PUZA 1TWHH 4F87A 4K5WA 1S40A 1NY4A 4UP8A 1OXXK 5C3WA 5K36H 3ONAB 4Q5VA 3I4NB 1TQOA 3L3OC 1MJEA 2FMMA 2Z0SA 4L5RC 4A3IG 1AW7A 2K5NA 2F0NA 1Q7YC 2OTLA 1D1KA 5AJ3L 3A8JE 4BBRG 4DAYB 4GNXC 2DY8A 2KHJA 1Q86C 3KJOA 1CUKA 1M8AA 1NTGA 3Q23A 3WOFA 4BA1I 3T1HQ 5IT9E 4A75A 1EFID 4P75A 1JOKA 4R9WA 2ZJRA 2NVYH 3A56A 1X6OA 2AQ2B 1JOQA 2PZTA 4GOPB 1IBMQ 3J7YW 2K5WA 2SDFA 1C8CA 1LYLA 4LFBQ 3NBHA 3OW2A 1SYCA 1XMQQ 1ASZA 4A3FB 1IZ6A 5M5YH 1B2TA 4GLVB 3HEJA 4NW2A 1Q8KA 4YWLA 3RMHA 3X3MA 1D7QA 2Z4IA 1O7YA 3HOYH 2HUGA 4ME3A 4U673 1VQJA 2K05A 1RKNA 3A8IE 4GLAC 1PTOC 3STBD 1E24A 3SGIA 5M3FB 2UUCL 4NDXA 1F77A 5CV9A 5DEHA 1SRUA 1EQRA 4R4OA 5C44G 3S2DB 1FL0A 4KV6A 4A3MB 3K6OA 3K5OA 3MTSA 4DV5L 1VQKA 3I4OA 1Y1WB 4PZ6A 1IW7D 4IPDA 4CKBA 3RN5A 2J0TD 1II3A 4TRDA 1VQ7A 1ILPA 3OWEB 2NVQB 2JP1A 2AKWB 1PYWD 1QOHA 1XWEA 4N8FA 2R93B 2A6HC 5EQ0A 2WP8J 3PIP3 4X3TA 4KY6A 1UE7A 3PIPA 5LMUL 1HTLD 1SE8A 1M1KC 2L0CA 1R4QB 1TY0A 2QDBA 3OPOA 4DV2L 3H3VH 1IBLL 3E5SA 2ZT9C 4G57A 1WTPA 4C3IH 2WACA 5T1GA 1KNAA 5IYDH 3JAME 3OHXC 3S14B 5IT9L 1JWMD 1LTGD 1LT4D 1EWHA 4KJOA 1STGA 1ZKOA 1F2ZA 4HIKA 1JB7A 2ATWA 4BA2I 2RHQB 2TMPA 2UXDQ 3CPWA 2BA1A 3ERSX 2HDMA 2F1MA 5LMNL 2ZM6L 4FXGC 4DR4L 3LNNA 3H0GB 3NP8A 1U4MA 3OOCA 4DUYQ 1LM0A 1S4ZA 2HQLA 1X3EA 3EBEA 2JA6H 5C5MA 3RNUA 1DYQA 2FJ2A 4K6DA 1N33Q 2UUAL 1CK1A 2JA9A 2MNAA 1AN8A 3NTIA 4KMUC 1KLGD 3T56B 1VQOA 5JOBA 4JBMA 1IBKL 3TS0A 5KNDA 1Y1VB 1DD2A 3OMCA 1S3OA 3KDFA 3VR3A 4A3GB 3E3XA 2F0TA 5C4HA 2RVLA 4IQZA 3NELA 4DN4M 4HIOA 1HNWQ 4JBJA 2PNHA 2EYMA 1HRJA 3RZDH 1NMGA 2A6ED 4A3IH 1B8AA 3BZCA 3NBIA 1F2MA 4P73A 1IYJB 3AQQA 3TP8A 1I4XA 4BBRH 4IO9A 3GD7A 3I73A 4FF2A 1OO9B 2WB1G 1VQ6A 3FPPA 2B63B 2CH4W 1YVCA 3NTKA 1VQ4A 1D8LA 4IUQA 3HOVG 2QF7A 3D4DA 3FP9A 1N32L 2L15A 1LTSD 2E2IB 2RSOA 1SYDA 2B3GA 4MZ9A 3ZJYC 3CCSA 1CKNA 1GUTA 3PCOB 1K8MA 3K7AB 3RR5A 3JAML 3RD4A 2L1BA 1ENFA 5C0XJ 2F03A 1YNJC 2JQOA 4X3UA 5GROA 2YTXA 3WOEA 5C6AA 4LFCQ 4KHPL 1G6PA 1S5CD 2NZ1D 3P1HA 3HKSA 3VDYA 4RHSA 2KCNA 2CH4A 1D5MC 1FVIA 2BE5D 5C44H 2KCTA 3TN2A 2K50A 1JC7A 2VUMB 4CGYB 2Y0SB 4K8IA 1LTAD 5CMDA 2G5DA 5H1SE 2EXDA 2DJFC 1Q1BA 4ZRZA 3M4YA 4QQBX 3ZYYX 3RLNA 4DNRB 4XT1B 3E0JA 1UEAB 3CU7A 4JOIA 2F0EA 1J5EL 2NN6I 5C3XA 4YHHL 4DV0L 4A3BB 3E6ZX 4EQ5A 4CDCC 1XPOA 2XSCA 3SK5A 1KABA 2CKZB 3FRPB 3VYUA 1M4VA 2F0KA 2NB0A 3GTLH 5D65A 4GKKL 4ZKCB 3S24A 4WJ3M 3FHWA 4LF7L 4HSVA 2TSSA 3QJYA 4WJWA 4O2DA 1SLJA 4KY5A 1SYFA 3D0FA 4ILWA 4OWWB 2A73B 1PH5A 3PUXA 3R8BA 4Y7NB 3JC66 4JI0Q 1IW7C 2B2YC 3ULLA 2KEEA 5C4JH 4JI7L 1E3PA 2FFKB 4EGVA 2M2LA 2Z1CA 1S5DD 1SJED 3GTKB 4B9WA 1EU3A 4WORA 4LF5Q 3NTHA 3OMGA 3ND8A 5JVH3 3F2UA 3CW2C 3HP3A 1JMCA 3TS2A 3A5UA 1TVXA 4X65Q 3A5ZB 1MHWC 1PRTB 1CZGA 3SDZA 4C2MH 4B3RL 1HA5A 4LF4L 4OGQC 1PTOF 2K14A 1Q1EA 2N78A 1EFWA 4LF6L 4DAYA 3TREA 1GUNA 1SNOA 2PYKA 2NN6G 2AWOA 1TIID 1X55A 1ENCA 2JN4A 2NUCA 2L9HA 4EQNA 2G9DA 5CV5A 2OEOA 2JA5G 3NQIA 5HURA 4DFAA 1HNZQ 4JVZA 3NWTA 4GOPA 4A3JG 3GTOH 3FMCA 4XQJA 5BN5A 1B4OA 1LTBD 3QIAA 2EVBA 2J4XA 3CQZH 3NBHB 2ASBA 2AMCB 1HFGA 1I6HH 2O2LD 1EYDA 4QB4A 3J81c 3F2CA 1PHJA 2XGTA 3ERQA 1HZAA 2H1EA 1VDZA 5EGTA 3MFGA 1J9OA 3HOVH 1I6VC 4BY1B 1I4GA 1PRTF 3TDQA 2JYOA 1G91A 3U50C 4JI6Q 4PMWA 4FF3A 5EAYA 1VQ5A 3ICEA 3D6WA 3S1QB 3BG3A 1YNNC 3Q24A 4LF8L 4OIKA 2IHEA 4F8MA 2F0MA 4FNFA 1M90C 1E22A 4NXNQ 3HOWB 1PXUA 2F0PA 2EYJA 2YU9B 4CJ2C 3QB3A 4B3MQ 4DR6Q 1TWFB 3PMFA 1BKBA 3PF5A 5GAEC 3RLFA 2EJMA 1X9NA 1VQBA 2KVMA 3M4OB 1Z9FA 2NWGA 2GVAA 5ELOA 4R8NA 1SFOH 3MXGA 2KBNA 4HR7B 4NXMQ 4X6AH 1KRSA 4TKOB 1SAPA 1EEID 3NSWA 4JI3Q 2A8VA 3R2TA 2MFIA 2JA7G 4HJ8A 2EJFC 3A8KE 5DAUA 2VB3X 4K2LA 5CV4A 3W1GA 2MUYA 2B2VC 2BH2A 5IWAQ 4RWSC 2K7VA 2SNSA 2UU9Q 1DONA 1Y8OB 1JWUD 3P7JA 1PH1A 1QUQA 1VMCA 4JCVE 3T1HL 3S1NH 1HJPA 3UE1A 4JBWA 2PZWA 2LMCB 1T9HA 1HTPA 2V4DA 1A15A 5GQOA 3ULJA 3AFPA 3Q0AA 2DNEA 5F2DA 4AQYL 5K36G 1IBML 3CCLA 3DXJC 4N9TA 4DV0Q 3GDEA 5FK9C 3A0JA 4LFBL 1XTCD 4K2KA 5E7NA 1XMQL 4RKLA 4A93G 1ICFB 2UXCQ 5M5XH 1NJIC 1FJGL 3PUYA 4TVAB 3L2PA 4AIMA 1RHPA 4A3DG 1VMPA 5I2YA 2R92B 2PI2A 4L5SA 2PCFB 3CXCA 4A3EG 4LFAL 2VB2X 3GTMB 4RGOS 1XYIA 1AE2A 2HCCA 1SNQA 1GD7A 4F88A 4Y52H 1NE3A 2B2UA 1G2SA 2NN6H 4IUPA 5EPKA 3CC4A 3DWPA 2F0FA 3SVMA 4JI1Q 3HOYG 2K75A 3BVMA 3VR2A 2JA5H 4PG3A 5IY0A 2F3IA 4OO1I 1LLRD 4A3JH 1I50H 4ZYSA 4BS9A 3MA2B 4EQPA 1K9MC 2SEBD 4K5XA 1I4HA 3A54A 3B6YA 3GTJH 1MIUA 5FLXc 4GNXA 1B70B 2D62A 1IXRA 1QB5D 4HMIA 2BOSA 2CCZA 1WTHA 2WINB 1F9SA 2AQ1B 1KTKA 1CKNB 4DV1Q 3K80C 3K7UC 2OF1A 3U4VA 4IURA 1STYA 4HIDA 2YTYA 1O7LA 3R93A 3AYHB 2B2TC 5D3DA 3PF4A 4FDBA 2PI2E 5CORA 5EPLA 4ZAIA 2EYFA 1PRTD 3J80c 5ISRA 1RTOA 1SNDA 4KY7A 1ICWA 3VR4A 5M3MG 1XMOQ 4GKJQ 3NWSA 3KK7A 2MO0A 1SMXA 2UXDL 1HNXQ 2R7ZB 2N88A 1SR3A 5M5WB 4X66Q 5KGUA 3F2BA 1VQEA 3DMUA 2A68D 4DUYL 1RF2D 2IPKD 2IX0A 2XNAC 4X3SA 5CR3A 3KLWA 4B9XA 2F52A 4CBVA 1N33L 4OWTB 1JE4A 4OO1G 1K8OA 5G3LF 2VQEQ 3D31A 2WV6D 4LUOA 4CHTB 3E9HA 1SYEA 4POGA 3I4MG 4A3BH 3R3OA 5LMNW 4C56C 1V1QA 1IL2A 1YBYA 3NQTA 3W2DA 3CC7A 2F4VQ 3LWEA 1HFNA 1D5ZC 1BCPC 3FKIG 1N36Q 1YJ9A 2IW3A 4G7OC 4RCNA 3CHBD 5C4XG 2JA7H 3HG9A 1HNWL 1STEA 1HCZA 4LF9Q 4HAEA 1WYDA 2F0DA 1HZ9A 2EY2A 3MEFA 3GTGH 2D2CC 3MFYA 2Q2TA 3A74A 1QG7A 4X3KA 1L0XB 4DF7A 2KCMA 5C3EG 2K4KA 3EA6A 1EQVA 2QGQA 2RDFA 1E0BA 3MAQA 1X65A 3I8ZA 1I4QA 1KNEA 1WJJA 4KTAA 4XT3B 4FF1A 1LACA 3I7FA 4TSSA 2D5DA 4JV5Q 1JQYD 4OHJA 4A93H 1BBWA 3KUPA 4NMZA 3NENA 3IFTA 1WCMG 2E2HB 1PH7A 1FNVA 2JK8A 2NYZD 1LTRD 5CV7A 1H95A 3RZOB 4NP5A 4A3DH 4G7HC 3K0XA 1OTCA 4C1NI 1VQMA 1BQQT 4M1UB 3T4AC 1UUPA 1HZBA 4PQXA 2HCIA 4AQYQ 1SROA 4LFCL 1EOVA 4A3EH 1NBWA 4BY7B 4C3HG 4BXXG 5DLQE 3FDTA 1K83B 1D6EC 4IZ8A 1FJGQ 4R8IA 1MKHA 1FNWA 4BBSG 3T1YQ 4NKLA 1Y8PB 4KK7A 4IOAA 1PZID 2EYPA 1JORA 1C9OA 2CWAA 1GXDC 3J81E 1XNRQ 1PH3A 5DNFA 5J3BA 1HZCA 2WAQB 1WFQA 4XDXA 1HH2P 2NTSA 4LFAQ 5HGTA 4A3KB 3VR5A 4RHRA 1Q8IA 3HOXB 3CCVA 1C48A 5ELFA 4R4TA 2QEJC 1E2VA 4IFDJ 4LW1A 1KC8C 3I56A 3GO5A 4IJLA 1B53A 4KKUA 4DR7Q 3CMEA 2CW0C 2DUDA 1G8ZD 5J22A 1EUJA 3U9SA 2FHTA 4WFN3 1LT3D 4JI0L 3MXNB 1R9TH 4DR2Q 3IFDA 5M3MH 1U4PA 3ER0A 1HQMC 4OL7A 1XPRA 1K3BC 3BZDB 3I90A 1P8LA 3OTOQ 1WTVA 1IKLA 4LF5L 1L2FA 4C3JB 3OIPA 4OX9Q 4B3SQ 4X65L 3J7A5 4DR5Q 3G7LA 3LX0A 1OXVA 4ME5A 2E5LQ 1PFNA 3CAMA 2OXPA 5I9PA 1TWGB 3NXWA 4OO1H 2QKIC 5BR8Q 1XJVA 2MQHA 1EEFD 3PO2B 1QWYA 3HOUB 5G3LD 4JYAQ 3I4MH 3QO2A 2F0LA 1SJHD 1ZYRD 1TWCB 3S1RB 5EBDA 2D0PA 5T1IA 4QJFA 3FKIH 5AFWA 1QUQB 1HNZL 1N8RC 1FNUA 3KOJA 1AZQA 5C4XH 1VQ8A 1EYAA 2I07B 4Z9CB 5I9OA 2JA8B 2XWJB 2X6GA 3ULPA 2WKDA 1BUVT 4ID6A 3J81L 1X32A 5JJLA 2LXJA 1A2TA 3KJPA 4KN4C 4RG1A 5C4ZA 5K5PA 3TRZA
chains in the Genus database with same CATH topology
5EKLA 1H9SA 1RCVD 2HQEA 3T53B 4V190 2QCPX 4ZKBB 2F3VA 4CKEA 1HXYD 4ABNA 2B2YA 1QNKA 3D6CA 3VA5A 1A2UA 4MIUA 4CJ1B 1QCBD 1BNZA 2Q8TA 1STNA 4H0LC 1H9MA 1NAPA 2F4IA 5CBEE 4HTHA 2B8GA 2ENBA 5TSSA 1GJXA 2JEAI 2IT1A 5IGGA 1VF5C 5FO9B 3S15B 1CQFA 2F0VA 4Q0FA 5C5LA 4PMBA 3MXPA 2E2JB 2MP1A 1CHQD 1D5XC 3S1MB 1SDFA 1SE2A 4EQOA 2QILA 3UI2A 1U9RA 2PMZB 1B1ZA 3R2IA 3SXHA 1BCPF 3PO3B 1KLUD 3K0YA 3DHQA 3MVVA 3J80E 5FOBB 1AZPA 3S16B 3GTPB 2NVXB 5KEEA 2L4NA 2JXMB 4XQNA 2C9OA 1CA6A 1PTOB 1LABA 1F9QA 4ULLA 1UNSA 1H9RA 3BDOA 2ZXOA 1G6ZA 4RAUC 2H4OA 4KD4A 4P2CB 5FKAC 3CRKC 1Z47A 1U4LA 1B44D 1Y69U 1ET9A 2L11A 4L8JA 5JEAG 5A2QE 2ZXPA 2LFNA 3NUCA 4DXGA 4OIJA 1T5XD 5E4XA 1D1IA 1X3QA 1RDPD 1IL8A 2ZXRA 2DY7A 2R61A 3T51B 1MGSA 1EY4A 1SMYD 1AEXA 3H94A 2Z4HA 3P20A 3HOZB 2A69D 3QWNA 5E4WC 2B2VA 2MJ8A 3S2HB 4HCEA 4IALA 2EJGC 2B2WC 1TWHB 1STHA 3U9OA 2EYHA 4J6HA 4FF4A 4AYBB 4KJNA 2L12A 4FXKC 1IYVA 3SHLA 4K6LA 1RTNA 4G7ZC 1EOTA 1F2YA 2EPBA 4N9PA 2KUMA 1ZYRC 3X3NA 1WD1A 3FVQA 3VYTA 4IUTA 2PW5A 2M9VA 2NVYB 2PNRC 1WTWA 1MSHA 1NUCA 1O80A 3MXUA 1ILQA 2LS01 3NPPA 5M5YB 1EY8A 3EJIA 1W6JA 3DM1A 5J1ZA 5A2QL 2LKVA 3KBXA 4K14A 1AP0A 2A6EC 1QILA 3KF8A 2XN9C 3HZXA 1A6XA 4XYOA 1JICA 3MXNA 5IGDA 2K33A 1KDBA 3HKZB 1TR5A 5JVG3 1WTRA 3QOLA 2K03A 3H09A 5CV6A 1B50A 3TSSA 1QNUA 1XXGA 1DOKA 3C1EA 3K5MA 1EIHA 1HHVA 5I4DA 3MEHA 4DK0A 5ELEA 3DEOA 4C3IB 1SYGA 2PW7A 2K01A 2BE5C 4IUUA 3SK4A 1E2WA 3K5LA 5JEAH 2E76C 3HS0C 1TS5A 1CFMA 5CV8A 2FINB 2XWBB 1QE6A 4KKTA 2JA6B 2Q8IB 2CVRA 5JJZA 1IKMA 1A3VA 1DOMA 1TS2A 1H9SB 2M00A 3VA7A 1ESFA 3OIQA 1PTOD 5BN3A 1GHKA 2B8FA 4LJZC 4B08A 3TMEA 2JSOA 5FO7B 2A74C 3RZDB 4A3IB 2O5IC 4V0BA 2YYZA 2EOTA 4BBRB 1V1OA 1B3AA 4TQUS 4S3SA 5IODA 2E75C 1NCVA 3QOJA 1ZXTA 3RUZA 5LL6X 4PV1C 5C0XI 2IL8A 4H13C 2A6HD 5DM73 1VCIA 2IWHA 2K32A 1CA5A 5IGEA 1CZWA 4FYDA 3V05A 3OSOA 1O78A 1JR0D 1W6KA 5LL6S 1TS3A 5I2XA 1Y8NB 3TP5A 3H6MA 1S5FD 1GUGA 2ICEC 2EXZA 2F0QA 1J8IA 5C44B 1DXMA 1BOSA 2R6GA 3EFXD 4L63B 4RCOA 2VNUD 3QG1A 3MC0B 1KAAA 4QUCA 2RBMA 1OXUA 3G6JB 4UAIA 3URYA 4QCLA 3FPUB 5D3IB 3BYYB 1AFPA 2EY5A 3AU7A 5C0XG 4ZQ3A 3TZUA 1DM0B 5NUCA 3SEBA 2OT2A 3GTLB 1GHJA 3M7GA 4ZUJA 1JCKB 3EVQA 1ESRA 2ICIA 3OWFA 2LY7A 1F9RA 2K04A 4QMGA 1EY7A 3IKJA 2RKSA 2F3WA 2AQ3B 3C2PA 5C4JB 4HCSA 1FYCA 4ZK9B 1UAPA 1WD0A 3Q22A 1I4PA 1CQVA 4L6TB 1EZ6A 5DM63 2B2UC 2JEBI 1SNPA 4C2MB 5FO8B 3PUWA 2WIIB 2AWNA 2F0OA 1SSOA 3D3RA 3V96A 4QIWB 4C1NK 1I4RA 2VXWA 1YNJD 3FEWX 1WVLA 3A55A 3OW7A 5JPNC 3GTOB 4EVOA 3NK9A 3M85A 3O13A 3D8GA 5D14A 2E2DC 2IX1A 1STBA 4YIJA 3CQZB 3MWYW 1I6HB 3GQBA 1BF4A 2WB1B 2PO4A 1JWSD 4JK1C 2KECA 3DEPA 1EQTA 4K8JA 3HOVB 4XYQA 2SNMA 1PZJD 3CRLC 1FR3A 3Q6SA 1BO0A 1GOZA 1EY9A 4RA8A 4XQQA 2J7ZA 1A3UA 3TBIB 2K6AA 1MSGA 2IJ0A 4XTCS 3A7LA 3IL8A 4DAPA 1G291 2RDGA 1LO5D 4MN3A 5CC4A 1STAA 3TP7A 3MZ5A 3K58A 1IYUA 2CHBD 2PZUA 2DNCA 2XVSA 2RDHA 1DCZA 1SFOB 4K5VA 3KLRA 4LMQD 4IUVA 4M8AA 1CHPD 4RGTA 4KHVA 5IOCA 4O1NA 5I6WA 1V1PA 1MI2A 2K5DA 1EIGA 3VYSA 1PRTC 1WTOA 2O4XA 2R3ZA 5C0XH 2BA0A 1A3TA 4ZLTF 5JAVA 3S1NB 2A68C 3GP7A 3D4WA 1S5ED 3BDCA 2E74C 3W3AA 5M5XB 4G4KA 1BCPB 1CT1D 3C3LA 3KBGA 1Z7TA 1EU4A 4PNYA 1SNCA 5LHY1 3K57A 1KDCA 5CBAE 2PPBC 2NTTA 1MD2D 4WRDA 4FXDA 2A5HA 1EWCA 4RKBA 4MHEA 1YNND 4H44C 4DGZA 5ELDA 2JA5B 2B2WA 5CGKA 2EY6A 3LWUA 2XRQD 5ELBA 3P75A 4A3JB 5EKIA 1I50B 1PZKD 1PMRA 1CTMA 5FLXE 3VYRA 3GTJB 3SK8A 1DZ1A 2RA4A 1LV9A 1CI3M 4KD3A 5EBCA 3BS1A 3WDNA 1H9JA 3DWAA 1GUSA 4ODGA 1RODA 1PLFA 2Q8RE 4I65A 3N52A 4RFBA 3T13A 1U4RA 2IX3A 4KKSA 3H91A 2EYLA 2ID0A 2MPMA 5I6YA 1SEBD 4I7ZC 3J7AV 3BVZA 1Q90A 1HUMA 3H3VC 4C3JG 3S9WA 3DUZA 3AB9A 4J8QA 3ITPA 3MHBA 3CKIB 2SOBA 2Z8LA 2BDNA 3NE5B 5EKKA 2HDLA 4RGMA 2I46A 1BR9A 3AMUA 1TS4A 2EE1A 2FMCA 3K5NA 1HUNA 4RH6A 2F0HA 1EYCA 5KIXA 1DOLA 1T5EA 3A7AB 4XIGS 5IGBA 4IUNA 2JA7B 3SK6A 3GTGB 4UDUC 5FLXL 5EPJA 2F0GA 2X6LA 3PUVA 1WTQA 2K5QA 3M7NA 2F0WA 1L0YB 2F0IA 2GA4B 5KRUA 3TZDA 3I3CA 4A93B 2KEDA 1QJOA 2XIWA 5E1FA 3J80L 5CYUA 2KA7A 4RGNA 4A3DB 2X69A 4LK1C 1PFMA 3I72A 1CM9A 5KYIA 1PFBA 4HEDA 1PDQA 3DWQA 1ZEQX 4H7BA 4O42A 4A3EB 3SE0A 1MBYA 4GZYC 5A35A 5BN4A 5ELCA 2NBFA 2D9UA 3HOYB 1SE4A 4IFDI 4DAVA 4HSPA 4KI0A 1F2LA 1F9PA 2B39A 1EY0A 2KJXA 1BDOA 1ML0D 5JPMC 5COYA 3ND9A 1KDAA 1GUWA 3K59A 3I4LA 1Q12A 1BCPD 4CJ0B 1RJTA 4DK1A 1EY6A 1ONLA 2XRSD 1SXTA 2RSNA 4XXEA 3KLSX 1NR2A 2C5CA 4DU9A 1R9TB 3I91A 5M3MB 2B2TA 2PQEA 2EZVA 2KCCA 1FGBD 3KLSA 4CKCA 4F7XA 3GV6A 1SE3A 2N55A 2CQAA 4IFDG 2DN8A 4HN7A 1V1PB 1C4QA 1B9NA 1TT2A 3I4MB 3NHHA 4BWGB 3D4RA 3HRZC 4PMCA 3FKIB 1WTXA 2F0UA 3BVGA 1JB3A 5KYLA 5C4XB 2KHSA 2AUJD 1V8QA 3SR1A 2BCOA 3BDLA 1VF7A 1S5BD 3VR6A 1EY5A 1XX8A 1TKWB 4KHZA 1OXSC 1LTID 3N6RA 3TP6A 2O5JC 5C3EB 1H9KA 4FP5D 3GV3A 2EDGA 5M9OA 4DA2A 1E2ZA 1R4PB 1RD9D 1O7ZA 3PV0A 3L7ZC 2KOLA 3IAYA 2L55A 5IGFA 1TU2B 4DNTB 2G9HD 1WCMB 1TY2A 3BYTB 1HQRD 1JOOA 4ZUIA 2CW0D 1SMYC 5KNBA 1GUOA 2A69C 4C3HB 4QF4A 2EY1A 4BBSB 1NSNS 3J7AF 2JE6I 1I3QB 1DJRD 4DXFA 1SNMA 1ET6A 1X3PA 2L5TA 3PIO3 1SBBB 1ENAA 4QUFA 2K28A 4LAAA 2RQXA 1Q3LA 4FVMA 2MGSA 3C46A 4IN3A 5EJWA 1BBXC 1HPCA 5JEAJ 1EZ8A 5J39A 4HMJA 1IHZA 2WKCA 2EYOA 3T16A 2MHVA 2K1BA 1PTOH 4E6IA 3HGBA 1HA6A 1LT5D 2NVTB 1TWAB 5E3FA 5IGCA 1B9MA 1LTTD 2KQ3A 4C3IG 4KN7C 4FO2A 3I70A 3M3YB 3EROA 1SYBA 4J1MA 4U68A 1NR4A 1Z6HA 2F0JA 3EQLC 1EL0A 5IIFA 4IFDH 3C1FA 1LT6D 3GTQB 1FD7D 1V43A 1D2BA 1G2TA 3S17B 3L9AX 1OXTA 1BXTA 3V2TA 5KNCA 2F0SA 2BDOA 2AUKA 3PUZA 4F87A 4K5WA 1OXXK 5C3WA 5K36H 3ONAB 4Q5VA 3I4NB 1TQOA 3L3OC 2FMMA 1AW7A 2F0NA 1D1KA 3A8JE 2DY8A 1M8AA 3Q23A 3WOFA 4BA1I 5IT9E 1EFID 1JOKA 4R9WA 3A56A 2AQ2B 1JOQA 2PZTA 3J7YW 2K5WA 2SDFA 1C8CA 3NBHA 1SYCA 4A3FB 1B2TA 3HEJA 4NW2A 3RMHA 3X3MA 2Z4IA 1O7YA 2HUGA 4U673 2K05A 1RKNA 3A8IE 1PTOC 5M3FB 4NDXA 1F77A 5CV9A 5DEHA 3S2DB 4KV6A 4A3MB 3K6OA 3K5OA 3MTSA 1Y1WB 1IW7D 4CKBA 2J0TD 1II3A 4TRDA 1ILPA 3OWEB 2NVQB 2JP1A 1PYWD 1QOHA 1XWEA 2R93B 2A6HC 5EQ0A 2WP8J 3PIP3 4X3TA 4KY6A 1HTLD 2L0CA 1R4QB 1TY0A 2QDBA 3OPOA 3E5SA 2ZT9C 4G57A 1WTPA 2WACA 5T1GA 1KNAA 3JAME 3OHXC 3S14B 5IT9L 1JWMD 1LTGD 1LT4D 1EWHA 4KJOA 1STGA 1ZKOA 1F2ZA 4BA2I 2TMPA 2BA1A 2HDMA 2F1MA 4FXGC 3LNNA 3H0GB 3NP8A 1U4MA 3OOCA 1S4ZA 5C5MA 1DYQA 2FJ2A 4K6DA 1CK1A 1AN8A 3NTIA 4KMUC 1KLGD 3T56B 5JOBA 5KNDA 1Y1VB 1DD2A 3OMCA 3VR3A 4A3GB 2F0TA 5C4HA 2RVLA 4IQZA 4DN4M 2EYMA 1HRJA 2A6ED 3NBIA 1F2MA 3TP8A 1I4XA 3GD7A 3I73A 4FF2A 1OO9B 3FPPA 2B63B 3NTKA 4IUQA 2QF7A 3D4DA 1LTSD 2E2IB 2RSOA 1SYDA 1GUTA 1K8MA 3K7AB 3JAML 3RD4A 2L1BA 1ENFA 5C0XJ 2F03A 1YNJC 4X3UA 3WOEA 5C6AA 1S5CD 2NZ1D 3P1HA 4RHSA 2KCNA 1D5MC 2BE5D 3TN2A 1JC7A 2VUMB 4CGYB 2Y0SB 4K8IA 1LTAD 5CMDA 1Q1BA 4ZRZA 3M4YA 3ZYYX 4DNRB 4XT1B 3E0JA 1UEAB 3CU7A 2F0EA 2NN6I 5C3XA 4A3BB 3E6ZX 2XSCA 3SK5A 1KABA 3FRPB 3VYUA 1M4VA 2F0KA 2NB0A 5D65A 4ZKCB 4HSVA 2TSSA 3QJYA 4WJWA 4KY5A 1SYFA 4ILWA 2A73B 3PUXA 3R8BA 4Y7NB 1IW7C 2B2YC 2KEEA 2FFKB 4EGVA 2M2LA 2Z1CA 1S5DD 1SJED 3GTKB 4B9WA 1EU3A 4WORA 3NTHA 3OMGA 3ND8A 5JVH3 3F2UA 3HP3A 1TVXA 1PRTB 1CZGA 3SDZA 1HA5A 4OGQC 1PTOF 1Q1EA 4DAYA 1GUNA 1SNOA 2PYKA 2NN6G 2AWOA 1TIID 1ENCA 2NUCA 2L9HA 4EQNA 2G9DA 5CV5A 2OEOA 3NQIA 5HURA 4DFAA 3NWTA 3FMCA 4XQJA 5BN5A 1B4OA 1LTBD 3QIAA 2EVBA 2J4XA 1HFGA 2O2LD 1EYDA 4QB4A 3ERQA 2H1EA 1VDZA 5EGTA 3MFGA 1J9OA 1I6VC 4BY1B 1I4GA 1PRTF 3TDQA 2JYOA 1G91A 4PMWA 4FF3A 3D6WA 3S1QB 3BG3A 1YNNC 3Q24A 4OIKA 4F8MA 2F0MA 4FNFA 3HOWB 1PXUA 2F0PA 2EYJA 2YU9B 4CJ2C 3QB3A 1TWFB 3PMFA 3RLFA 2EJMA 2KVMA 3M4OB 2NWGA 4R8NA 3MXGA 4HR7B 4TKOB 1SAPA 1EEID 3NSWA 3R2TA 2EJFC 3A8KE 5DAUA 2VB3X 4K2LA 5CV4A 2MUYA 2B2VC 4RWSC 2K7VA 2SNSA 1DONA 1Y8OB 1JWUD 3P7JA 1VMCA 4JBWA 2PZWA 2LMCB 2V4DA 1HTPA 1A15A 3Q0AA 2DNEA 5F2DA 5K36G 3DXJC 4N9TA 5FK9C 1XTCD 4K2KA 4RKLA 3PUYA 1RHPA 1VMPA 5I2YA 2R92B 2PCFB 2VB2X 3GTMB 4RGOS 1XYIA 2HCCA 1SNQA 4F88A 2B2UA 1G2SA 2NN6H 4IUPA 5EPKA 3DWPA 2F0FA 3SVMA 3BVMA 3VR2A 4OO1I 1LLRD 4ZYSA 4BS9A 3MA2B 4EQPA 2SEBD 4K5XA 1I4HA 3A54A 2D62A 1QB5D 4HMIA 2BOSA 2WINB 1F9SA 2AQ1B 1KTKA 2OF1A 4IURA 1STYA 1O7LA 3R93A 2B2TC 5D3DA 4ZAIA 5CORA 5EPLA 2EYFA 1PRTD 5ISRA 1RTOA 1SNDA 4KY7A 1ICWA 3VR4A 3NWSA 3KK7A 2R7ZB 2N88A 5M5WB 5KGUA 3DMUA 2A68D 1RF2D 2IPKD 2IX0A 2XNAC 4X3SA 5CR3A 4B9XA 4CBVA 1JE4A 4OO1G 1K8OA 5G3LF 3D31A 2WV6D 4CHTB 1SYEA 3R3OA 4C56C 3W2DA 3NQTA 3LWEA 1HFNA 1D5ZC 1BCPC 2IW3A 4G7OC 4RCNA 3CHBD 3HG9A 1STEA 1HCZA 4HAEA 2F0DA 2EY2A 2D2CC 3MFYA 1QG7A 4X3KA 1L0XB 4DF7A 3EA6A 1EQVA 2RDFA 1E0BA 3MAQA 3I8ZA 1I4QA 1KNEA 4KTAA 4XT3B 4FF1A 1LACA 4TSSA 2D5DA 1JQYD 4OHJA 3KUPA 4NMZA 3IFTA 2E2HB 1FNVA 2NYZD 5CV7A 1LTRD 3RZOB 4NP5A 4G7HC 4C1NI 1BQQT 4M1UB 3T4AC 1UUPA 4PQXA 2HCIA 4BY7B 4C3HG 3FDTA 1K83B 1D6EC 4IZ8A 4R8IA 1FNWA 4NKLA 1Y8PB 4KK7A 1JORA 1PZID 2EYPA 1GXDC 3J81E 5DNFA 2WAQB 4XDXA 2NTSA 5HGTA 4A3KB 3VR5A 4RHRA 1Q8IA 3HOXB 1C48A 5ELFA 2QEJC 1E2VA 4IFDJ 3GO5A 1B53A 4KKUA 2CW0C 1G8ZD 5J22A 3U9SA 2FHTA 4WFN3 1LT3D 3IFDA 1U4PA 1HQMC 4OL7A 3BZDB 3I90A 1WTVA 1IKLA 4C3JB 3OIPA 3G7LA 3LX0A 1OXVA 4ME5A 1PFNA 5I9PA 2OXPA 1TWGB 3NXWA 4OO1H 2QKIC 1EEFD 3PO2B 1QWYA 3HOUB 5G3LD 3QO2A 2F0LA 1SJHD 1ZYRD 1TWCB 3S1RB 5EBDA 5T1IA 5AFWA 1FNUA 1AZQA 1EYAA 2I07B 4Z9CB 5I9OA 2JA8B 2XWJB 2X6GA 2WKDA 1BUVT 4ID6A 3J81L 1X32A 1A2TA 4KN4C 5C4ZA 5K5PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHV A;  3ERO A;  1SYB A;  5IOC A;  4J1M A;  2EYF A;  3HZX A;  1EZ6 A;  3TP6 A;  5ISR A;  2EYL A;  5EKL A;  5DAU A;  1SND A;  4NKL A;  3QOJ A;  5I6W A;  5I6Y A;  2HQE A;  4KY7 A;  4K2L A;  5CV4 A;  3RUZ A;  1JOR A;  1SNP A;  2EYP A;  5IGD A;  5M9O A;  2O4X A;  2F0J A;  2SNS A;  5IOD A;  1KDB A;  1II3 A;  3NUC A;  4TRD A;  2F3V A;  5IIF A;  3D4D A;  1A3T A;  3C1F A;  3S9W A;  1TR5 A;  5IGF A;  5KGU A;  5JAV A;  1SYD A;  1SNO A;  2F0O A;  3ITP A;  3D6C A;  2PYK A;  3DMU A;  3VA5 A;  1A2U A;  3MHB A;  4MIU A;  5HGT A;  2SOB A;  3QOL A;  1ENC A;  5IGE A;  2PZW A;  1STN A;  2NUC A;  5CV6 A;  4EQN A;  5CR3 A;  2OEO A;  5CV5 A;  5F2D A;  5EKK A;  5HUR A;  4KY6 A;  4B9X A;  4DFA A;  1EY0 A;  3OSO A;  3D4W A;  4HTH A;  1EY4 A;  2ENB A;  4N9T A;  1AEX A;  3BDC A;  3C1E A;  4K2K A;  1JOO A;  1KDA A;  4EVO A;  4ZUI A;  5IGG A;  3NK9 A;  4RKL A;  1SYE A;  2QDB A;  5C6A A;  3V2T A;  3E5S A;  3TP5 A;  3D8G A;  3H6M A;  3R3O A;  4G57 A;  2F0S A;  3MEH A;  2WAC A;  3P1H A;  3NQT A;  1STB A;  2F0H A;  1EY6 A;  2EXZ A;  1EYC A;  1SYG A;  2F0V A;  2PW7 A;  2F0Q A;  4IAL A;  4YIJ A;  1STH A;  4K5W A;  5KIX A;  5J22 A;  5C3W A;  3U9O A;  2EYH A;  4J6H A;  5C5L A;  4PMB A;  4QF4 A;  1EYD A;  2EY1 A;  4QB4 A;  4KJN A;  3MXP A;  3SK4 A;  4PNY A;  4K8I A;  1STG A;  3ERQ A;  1NSN S;  1SNC A;  1TQO A;  4IUN A;  4KJO A;  5IGB A;  1F2Z A;  3SHL A;  4DU9 A;  3SK6 A;  2F0D A;  2EY2 A;  1F2Y A;  2F0N A;  1KAA A;  1SNM A;  5EGT A;  4OL7 A;  1KDC A;  2RBM A;  4K8J A;  4EQO A;  1U9R A;  4N9P A;  1ENA A;  2SNM A;  4WRD A;  4DF7 A;  2PQE A;  1SNQ A;  2F0E A;  3NP8 A;  4LAA A;  5CV8 A;  4RKB A;  5C3X A;  2F0G A;  3SXH A;  1EQV A;  2F0F A;  2RDF A;  3LX0 A;  4DGZ A;  1EY9 A;  4F7X A;  1JOK A;  4ME5 A;  3SK5 A;  5C5M A;  2EY5 A;  1JOQ A;  1KAB A;  2PW5 A;  2PZT A;  4K6D A;  4ZQ3 A;  3DHQ A;  2F0K A;  2F0W A;  2OXP A;  3MVV A;  5I9P A;  1A3V A;  2EY6 A;  5NUC A;  4KTA A;  4F8M A;  5CGK A;  1EZ8 A;  3NXW A;  3P75 A;  4HMJ A;  5J39 A;  2F0M A;  1NUC A;  2F0I A;  1A3U A;  1SYC A;  2M00 A;  5KRU A;  1IHZ A;  2F0P A;  4ZUJ A;  2EYO A;  2EYJ A;  4NMZ A;  3HEJ A;  3EVQ A;  1TT2 A;  3QB3 A;  2F0L A;  4EQP A;  5JOB A;  4K5X A;  5KEE A;  3NHH A;  5E1F A;  3T16 A;  1EY8 A;  3PMF A;  5CV7 A;  3OWF A;  5CC4 A;  1STA A;  4KY5 A;  1SYF A;  4NP5 A;  3EJI A;  3TP7 A;  4E6I A;  3MZ5 A;  3OMC A;  3SK8 A;  4PMC A;  2F0T A;  4HMI A;  5C4H A;  4QMG A;  1EY7 A;  1RKN A;  4KD3 A;  5J1Z A;  2F0U A;  5E3F A;  2PZU A;  3TME A;  5KYI A;  2RKS A;  5KYL A;  1EYA A;  5IGC A;  2F3W A;  2EYM A;  5I9O A;  2KHS A;  2LKV A;  4H7B A;  4R8N A;  2KQ3 A;  2OF1 A;  1STY A;  3SR1 A;  3BDL A;  4NDX A;  5CV9 A;  5DEH A;  1F2M A;  4ID6 A;  1EY5 A;  4K14 A;  4ODG A;  4WOR A;  4K5V A;  3TP8 A;  4B9W A;  4KD4 A;  1A2T A;  3OMG A;  4I65 A;  5C4Z A;  5K5P A;  4KV6 A;  3T13 A;  4IZ8 A;  4S3S A; 
#chains in the Genus database with same CATH topology
 4A4I A;  5C3E H;  3I4N G;  4LWC A;  5EKL A;  1H9S A;  1RCV D;  4ZCK A;  2HQE A;  2RHS B;  3T53 B;  3G71 A;  4V19 0;  3WWV A;  4OWX B;  4J15 A;  4R4C A;  2QCP X;  4ZKB B;  2F3V A;  4CKE A;  1PFS A;  1A63 A;  2UXB Q;  1HXY D;  1YIJ A;  4DV7 Q;  4ABN A;  2B2Y A;  1QNK A;  3D6C A;  2VZA A;  3K8A A;  1A2U A;  3VA5 A;  4MIU A;  3UDI A;  1GO3 E;  4CJ1 B;  4JI6 L;  4K0K Q;  1WCM H;  1QCB D;  3JAM i;  1BNZ A;  2Q8T A;  1STN A;  2ZJQ A;  1KD1 C;  4H0L C;  1H9M A;  1NAP A;  5L37 A;  2F4I A;  5CBE E;  4HTH A;  2B8G A;  2ENB A;  5TSS A;  1GJX A;  2JEA I;  2IT1 A;  4A3F G;  5IGG A;  1VF5 C;  2Q2U A;  5FO9 B;  4NXN L;  3S15 B;  4H02 A;  3UDF A;  1CQF A;  4B3M L;  4C3H H;  4DPG A;  4DR6 L;  4BXX H;  2N8N A;  4ALP A;  2F0V A;  2N49 A;  4Q0F A;  4DAM A;  1HR0 Q;  5C5L A;  4PMB A;  4BBS H;  3MXP A;  5M3F G;  1I3Q H;  2E2J B;  2MP1 A;  3DM3 A;  1CHQ D;  1D5X C;  4GNX B;  3S1M B;  1SDF A;  1SE2 A;  4NXM L;  1WOC A;  3M9B A;  4EQO A;  2QIL A;  3UI2 A;  4A3M G;  1U9R A;  2PMZ B;  2R7D A;  4JI3 L;  1B1Z A;  3R2I A;  3SXH A;  3I2Z A;  1BCP F;  1Y1W G;  1K8G A;  2HHH Q;  3PO3 B;  5IWA L;  1KLU D;  3K0Y A;  2UU9 L;  3DHQ A;  3MVV A;  1UE5 A;  5FOB B;  3J80 E;  2K5V A;  3UDG A;  4JBK A;  1AZP A;  3S16 B;  1K3R A;  2R93 G;  3GTP B;  2NVX B;  2QDL A;  5KEE A;  2L4N A;  2JXM B;  4XQN A;  2C9O A;  4WJ4 A;  1CA6 A;  1PTO B;  4P74 A;  1BVS A;  1LAB A;  2IY5 B;  2NVT H;  1TWA H;  2QEX A;  1F9Q A;  4ULL A;  4JW0 A;  1UNS A;  1H9R A;  2UXC L;  3BDO A;  3STB C;  1CSQ A;  2ZXO A;  1G6Z A;  4RAU C;  5FLM G;  1GM5 A;  2H4O A;  4KD4 A;  4P2C B;  5FKA C;  1UE6 A;  2WFW A;  3CRK C;  3W5O A;  3M3Y H;  3G48 A;  1Z47 A;  1U4L A;  1B44 D;  1Y69 U;  1ET9 A;  2L11 A;  4L8J A;  5JEA G;  5A2Q E;  2V1C C;  2ZXP A;  2LFN A;  3NUC A;  4DXG A;  1JE5 A;  2AHO B;  4OIJ A;  1VQH A;  3GTQ H;  1T5X D;  3H0G G;  4IPC A;  5E4X A;  4DUZ Q;  1D1I A;  1XTD A;  4EX5 A;  2EIF A;  1X3Q A;  1RDP D;  2N3S A;  3S17 H;  4JI1 L;  2ZJP A;  3H15 A;  4MTN A;  1VQL A;  1IL8 A;  2ZXR A;  2DY7 A;  2R61 A;  3T51 B;  1MGS A;  1EY4 A;  1SMY D;  1Q82 C;  1AEX A;  1GVP A;  3H94 A;  2Z4H A;  3P20 A;  3HOZ B;  2A69 D;  3F2D A;  2QA4 A;  3QWN A;  1Y1V G;  3L0O A;  2B2V A;  5E4W C;  3U58 A;  2MJ8 A;  3S2H B;  4HCE A;  4IAL A;  2EJG C;  2B2W C;  1TWH B;  1STH A;  3U9O A;  2EYH A;  4J6H A;  4FF4 A;  1JJ2 A;  4AYB B;  3I4N H;  4KJN A;  4P71 A;  2L12 A;  4FXK C;  1AE3 A;  1IYV A;  2I5M X;  1B3Q A;  3SHL A;  4K6L A;  4DV1 L;  1RTN A;  2PQA B;  4G7Z C;  1EOT A;  3J81 j;  1F2Y A;  5IP9 G;  3RZO H;  1YJW A;  2EPB A;  2ALY B;  4N9P A;  4OEL B;  2KUM A;  4B3T Q;  1ZYR C;  3X3N A;  1WD1 A;  2B63 G;  3FVQ A;  3VYT A;  4IUT A;  2PW5 A;  2M9V A;  2NVY B;  1XMO L;  4GKJ L;  1RIP A;  2PNR C;  4DR1 Q;  1VQP A;  4X62 Q;  1WTW A;  1HNX L;  1MSH A;  4HIM A;  1NUC A;  1O80 A;  3MXU A;  4X64 Q;  4X66 L;  4A3F H;  1KIX A;  1NNX A;  1ILQ A;  2LS0 1;  3NPP A;  5M5Y B;  4UPA A;  3CCJ A;  1EY8 A;  2A19 A;  3EJI A;  1W6J A;  2ZTE A;  1Q81 C;  3DM1 A;  1L1O A;  4QL5 A;  5J1Z A;  3CMA A;  1X54 A;  4UHV A;  2VQE L;  3G6E A;  5A2Q L;  5M3F H;  2LKV A;  3KBX A;  4K14 A;  4PZ8 A;  1AP0 A;  3S2D H;  2F4V L;  2A6E C;  4A3M H;  1QIL A;  3CC2 A;  2HIV A;  1N36 L;  2VUM G;  4JOI C;  3KF8 A;  2XN9 C;  3HZX A;  3UE0 A;  3CF5 A;  1A6X A;  1QZH A;  4XYO A;  1JIC A;  3MXN A;  5IGD A;  1Y1W H;  4LF9 L;  2K33 A;  1KDB A;  2NVQ H;  4JPB W;  2RCN A;  3HKZ B;  1TR5 A;  1C0A A;  5JVG 3;  4A3B G;  3KFU A;  1QZG A;  2R93 H;  1WTR A;  3QOL A;  2K03 A;  3H09 A;  5CV6 A;  1B50 A;  3TSS A;  1QNU A;  1XXG A;  2Z6K C;  1DOK A;  3C1E A;  4JV5 L;  2WAQ E;  4JC0 A;  3K5M A;  1EIH A;  1HHV A;  5I4D A;  3MEH A;  4DK0 A;  5ELE A;  3DEO A;  4C3I B;  5IP7 H;  5FLM H;  1SYG A;  2PW7 A;  3S14 H;  2K01 A;  2IHF A;  2VW9 A;  2BE5 C;  4IUU A;  3SK4 A;  1E2W A;  3JAM c;  3K5L A;  1VQG A;  5JEA H;  2E76 C;  1QVC A;  2EQS A;  3HS0 C;  1TS5 A;  1A8V A;  3H0G H;  1CFM A;  5CV8 A;  3RLO A;  2FIN B;  2XWB B;  1QE6 A;  3T1Y L;  1X56 A;  2JA8 H;  3E0E A;  4KKT A;  2JA6 B;  2Q8I B;  2CVR A;  1QVG A;  5JJZ A;  5IYC G;  1N34 Q;  1A62 A;  1A3V A;  1DOM A;  1TS2 A;  1IKM A;  1H9S B;  4GOP C;  1XNR L;  2M00 A;  4LUV A;  3VA7 A;  4APV A;  1ESF A;  3OIQ A;  1Y1V H;  1O7I A;  1PTO D;  5BN3 A;  4A3G H;  1VQC A;  3I55 A;  1GHK A;  2B8F A;  4LJZ C;  5IE8 A;  4B08 A;  5JJK A;  3TME A;  2OQK A;  2JSO A;  5FO7 B;  2A74 C;  3RZD B;  4A3I B;  2O5I C;  1VQ9 A;  4DR7 L;  4V0B A;  5IP9 H;  4DV6 Q;  2YYZ A;  2EOT A;  4BBR B;  1V1O A;  1EYG A;  1B3A A;  4TQU S;  4S3S A;  5IOD A;  2E75 C;  1NCV A;  3QOJ A;  2VQF Q;  1B7Y B;  2B63 H;  1ZXT A;  3RUZ A;  5LL6 X;  4PV1 C;  4DR2 L;  5C0X I;  4IPG A;  4KLK A;  4BY1 G;  4GN4 B;  2IL8 A;  4DK6 C;  4H13 C;  3OTO L;  4NPS A;  2R7F A;  4DR3 Q;  2E2I H;  2A6H D;  2GVB A;  5DM7 3;  1A0I A;  1VCI A;  2IWH A;  2K32 A;  1CA5 A;  1PV4 A;  4OX9 L;  4B3S L;  4DR5 L;  5IGE A;  1CZW A;  3K7A H;  4FYD A;  1XPU A;  3EIV A;  2E5L L;  3V05 A;  3OSO A;  1O78 A;  1KL9 A;  1JR0 D;  1W3S A;  1W6K A;  3HOW G;  5BR8 L;  3PIO A;  5LL6 S;  1TS3 A;  5I2X A;  1Q46 A;  1Y8N B;  3TP5 A;  3H6M A;  4JYA L;  1S5F D;  1GUG A;  2OQ0 A;  2ICE C;  4JI4 Q;  2EXZ A;  2F0Q A;  3BZK A;  1J8I A;  5C44 B;  1K0R A;  2VUM H;  1DXM A;  2CFM A;  4PZ7 A;  1BOS A;  2R6G A;  3EN2 A;  3EFX D;  4L63 B;  4RCO A;  2VNU D;  3QG1 A;  1QVF A;  1KRT A;  3MC0 B;  1KAA A;  4YCU A;  2YTV A;  4QUC A;  2RBM A;  1OXU A;  3G6J B;  3KF6 B;  4UAI A;  2I5L X;  3URY A;  1YEZ A;  4QCL A;  3FPU B;  5D3I B;  3BYY B;  1I5F A;  1AFP A;  2EY5 A;  4L5Q A;  3AU7 A;  5C0X G;  4ZQ3 A;  3TZU A;  1DM0 B;  5NUC A;  3SEB A;  2PMZ E;  2OT2 A;  3PSI A;  3GTL B;  2UXB L;  1UE1 A;  1EWI A;  1GHJ A;  3M7G A;  4ZUJ A;  4DV7 L;  1JCK B;  3EVQ A;  4K0K L;  1ESR A;  2ICI A;  3OWF A;  2LY7 A;  1F9R A;  2K04 A;  4Y7N H;  2Y0S E;  4QMG A;  1EY7 A;  3IKJ A;  4POF A;  4DV3 Q;  2RKS A;  1E7Z A;  2F3W A;  2AQ3 B;  3C2P A;  5C4J B;  3GTK H;  3PQI A;  4HCS A;  1FYC A;  4ZK9 B;  1BBU A;  1UAP A;  2FXQ A;  1WD0 A;  4UP7 A;  4YY3 Q;  3Q22 A;  2R92 G;  1I4P A;  1HR0 L;  1CQV A;  4L6T B;  2CWP A;  1EZ6 A;  5DM6 3;  4I7A A;  3HOZ H;  2B2U C;  2JEB I;  1SNP A;  4L5T A;  4C2M B;  2PQA A;  5FO8 B;  4YWK A;  3PUW A;  2WII B;  5IYC H;  2AWN A;  5GAD C;  1LUZ A;  4QGU A;  2OWO A;  2F0O A;  1SSO A;  1P16 A;  3D3R A;  1X3G A;  3V96 A;  2Q2I A;  4QIW B;  4C1N K;  1I4R A;  2VXW A;  1YNJ D;  3FEW X;  1WVL A;  2HHH L;  1E1O A;  3A55 A;  3OW7 A;  4DNI A;  5JPN C;  1I94 Q;  3GTO B;  1KQS A;  4EVO A;  1JT8 A;  3NK9 A;  1FGU A;  3M85 A;  3O13 A;  3D8G A;  5D14 A;  2E2D C;  2IX1 A;  1STB A;  2E8G A;  4YIJ A;  3CQZ B;  1RL2 A;  3MWY W;  1I6H B;  3GQB A;  2GN5 A;  3RN2 A;  1BF4 A;  2WB1 B;  2PO4 A;  1JWS D;  4JK1 C;  3CPF A;  2KEC A;  3DEP A;  1L1O B;  2Q2H A;  1EQT A;  4K8J A;  4BY1 H;  3HOV B;  4XYQ A;  1YNX A;  2SNM A;  1PZJ D;  3CCR A;  3CRL C;  2K52 A;  4AYB E;  1PH9 A;  2QW7 A;  1FR3 A;  1GKH A;  3Q6S A;  1BO0 A;  1GOZ A;  4A76 A;  3S1Q H;  1EY9 A;  4GS3 A;  4RA8 A;  3KF8 B;  2R7Z G;  4XQQ A;  4HJ9 A;  2J7Z A;  3HOW H;  1A3U A;  3TBI B;  2YU9 H;  2K6A A;  1MSG A;  4DUZ L;  2IJ0 A;  4XTC S;  4HJ7 A;  2XTI A;  2Z6B A;  3A7L A;  3IL8 A;  1TWF H;  4DAP A;  1G29 1;  2RDG A;  1LO5 D;  4MN3 A;  5CC4 A;  1STA A;  3TP7 A;  3MZ5 A;  4JI8 Q;  2JJQ A;  3K58 A;  3M4O H;  1IYU A;  2CHB D;  2RF4 A;  2PZU A;  2DNC A;  4NB3 A;  3CCM A;  3UDX A;  2XVS A;  3J81 i;  2RDH A;  1DCZ A;  1SFO B;  1KXL A;  4LNQ A;  4K5V A;  5ELN A;  5IYB G;  3KLR A;  4LMQ D;  4IUV A;  4M8A A;  1CHP D;  4RGT A;  4KHV A;  1XNQ Q;  5IOC A;  2UUB Q;  4O1N A;  5I6W A;  4JI2 Q;  1V1P A;  1MI2 A;  2K5D A;  1EIG A;  4OXP A;  3VYS A;  1PRT C;  1WTO A;  2O4X A;  2NZO A;  2R3Z A;  4MTK A;  5C0X H;  2BA0 A;  1A3T A;  4ZLT F;  2KHI A;  4UY8 C;  5JAV A;  4B3T L;  4DK3 C;  2ZTC A;  3HFZ B;  1U5K A;  3S1N B;  2A68 C;  3GP7 A;  3HKZ E;  3D4W A;  1S5E D;  3BDC A;  4DR1 L;  4GN5 A;  4X62 L;  3TEH B;  2E74 C;  4X64 L;  3W3A A;  4OEM B;  5M5X B;  4DV4 Q;  4G4K A;  5GAG C;  1BCP B;  1CT1 D;  3C3L A;  3KBG A;  2R92 H;  1Z7T A;  1JJG A;  2LXK A;  1EU4 A;  4PNY A;  1SNC A;  5LHY 1;  3AEV A;  5JJI A;  1PH8 A;  4BY7 G;  1K0S A;  4JI5 Q;  3K57 A;  2ZTD A;  1YHQ A;  1KDC A;  5CBA E;  2PPB C;  3GTM H;  2NTT A;  1MJC A;  1MD2 D;  4WRD A;  4FXD A;  2A5H A;  1EWC A;  4RKB A;  3KYH C;  4MHE A;  1YNN D;  4H44 C;  4AH6 A;  4DGZ A;  5ELD A;  2JA5 B;  2B2W A;  3QR8 A;  3F8T A;  5CGK A;  2EY6 A;  3AFQ A;  3LWU A;  2XRQ D;  4IPH A;  5ELB A;  3P75 A;  4A3J B;  2WAQ G;  5EKI A;  1I50 B;  1PZK D;  1PMR A;  1CTM A;  5FLX E;  3VYR A;  4A3K G;  3CP0 A;  3CCE A;  3GTJ B;  3HOX G;  3SK8 A;  1DZ1 A;  2RA4 A;  1LV9 A;  1CI3 M;  1PH6 A;  4KD3 A;  5EBC A;  3BS1 A;  3WDN A;  1H9J A;  3DWA A;  1EQQ A;  3Q8D A;  1GUS A;  5AJ3 Q;  4ODG A;  1ROD A;  1PLF A;  2Q8R E;  4I65 A;  3N52 A;  4RFB A;  4HJ5 A;  1C7Y A;  3T13 A;  1U4R A;  2IX3 A;  4KKS A;  3H91 A;  3CCQ A;  2EYL A;  2ID0 A;  2MPM A;  5I6Y A;  2VS1 A;  1SEB D;  4I7Z C;  3J7A V;  3BVZ A;  1Q90 A;  1HUM A;  1PYB A;  3F1Z A;  2R7Z H;  3H3V C;  5M5W H;  4C3J G;  3S9W A;  3DUZ A;  1NMF A;  3AB9 A;  1L0W A;  2B29 A;  3KF6 A;  4J8Q A;  3ITP A;  3MHB A;  3CKI B;  2SOB A;  5IP7 G;  2CQO A;  2Z8L A;  2BDN A;  3NE5 B;  5EKK A;  1W2B A;  2HDL A;  1N34 L;  4RGM A;  2I46 A;  4JG2 A;  3PO2 G;  1X3F A;  3HOU G;  1BR9 A;  1V9P A;  3AMU A;  2UUC Q;  1YI2 A;  1TS4 A;  2EE1 A;  2RCF A;  2FMC A;  3K5N A;  1HUN A;  4RH6 A;  1VQD A;  2F0H A;  5IYB H;  1EYC A;  5KIX A;  1DOL A;  1T5E A;  1YJN A;  4R4Q A;  3A7A B;  4XIG S;  5IGB A;  2JA8 G;  2I0Q A;  4IUN A;  1PYS B;  2JA7 B;  2BH8 A;  4DV5 Q;  3J80 i;  3SK6 A;  1PVO A;  3GTG B;  4UDU C;  4DV6 L;  5FLX L;  5GAH C;  2Z6K A;  5EPJ A;  2F0G A;  2X6L A;  3PUV A;  1WTQ A;  3DLL A;  4DKA C;  4RMF A;  2MO1 A;  2VQF L;  2K5Q A;  3M7N A;  4A3G G;  5LMU Q;  2F0W A;  3CD6 A;  1L0Y B;  4A3L G;  4DR3 L;  2F0I A;  2GA4 B;  5KRU A;  3TZD A;  4DV2 Q;  1IBL Q;  1G51 A;  3I3C A;  4P72 A;  3BU2 A;  4A93 B;  2KED A;  2E2H H;  1QJO A;  2XIW A;  5E1F A;  3J80 L;  5CYU A;  2KA7 A;  1WI5 A;  4RGN A;  3M4Q A;  4A3D B;  2X69 A;  4LK1 C;  1PFM A;  3I72 A;  5FJ8 G;  4CDE C;  1CM9 A;  5KYI A;  1VQN A;  1PFB A;  4HED A;  1PDQ A;  3DWQ A;  1ZEQ X;  2K5H A;  4H7B A;  5IT9 c;  4BY7 H;  4O42 A;  1E1T A;  4HJA A;  4A3E B;  3SE0 A;  1MBY A;  5LMN Q;  2YV5 A;  3W1B A;  4JI4 L;  2ZM6 Q;  1K83 H;  4DR4 Q;  4GZY C;  4YCV A;  5A35 A;  5BN4 A;  4MNO A;  5ELC A;  2NBF A;  2D9U A;  3IRB A;  3OYY A;  3HOY B;  2UUA Q;  1SE4 A;  4IFD I;  4DAV A;  5HY6 A;  1SN8 A;  1VQF A;  4HSP A;  4KI0 A;  4A3C G;  4A3K H;  1PH2 A;  4R1J A;  1IBK Q;  1F2L A;  1DGS A;  1F9P A;  3PO3 G;  1KAW A;  2B39 A;  1CKM A;  3HOX H;  1EY0 A;  2A1A A;  1PA6 A;  2KJX A;  2Y0S G;  1BDO A;  1ML0 D;  5JPM C;  5COY A;  2ES2 A;  3ND9 A;  1KDA A;  1GUW A;  3K59 A;  3I4L A;  1Q12 A;  1AH9 A;  4QIW E;  1BCP D;  4CJ0 B;  1RJT A;  1KHI A;  4DK1 A;  1EY6 A;  1ONL A;  1U0L A;  2XRS D;  1SXT A;  3M4P A;  2RSN A;  4XXE A;  3KLS X;  1NR2 A;  4DV3 L;  1N9W A;  2C5C A;  4DU9 A;  1R9T B;  4GN3 B;  2VL6 A;  3I91 A;  5M3M B;  4YCW A;  2B2T A;  2DJG C;  2P5Z X;  1N32 Q;  4C3J H;  4YY3 L;  1TXY A;  2PQE A;  2EZV A;  2KCC A;  2D0O A;  1FGB D;  2WB1 E;  3U4Z A;  3KLS A;  1PH4 A;  4CKC A;  4F7X A;  3GV6 A;  5HGQ A;  1SE3 A;  2N55 A;  2CQA A;  1TWG H;  4IOC A;  4IFD G;  2DN8 A;  4HN7 A;  1V1P B;  3PO2 H;  1C4Q A;  3HOU H;  4KHP Q;  1B9N A;  1JJC B;  1TT2 A;  3I4M B;  1TWC H;  3NHH A;  3S1R H;  1HR0 W;  3LGJ A;  4BWG B;  3D4R A;  3HRZ C;  4CDD C;  4PMC A;  2C35 B;  3FKI B;  1WTX A;  1UEB A;  2F0U A;  3BVG A;  1EIY B;  1JB3 A;  5KYL A;  1I94 L;  3HOZ G;  5C4X B;  2KHS A;  1S72 A;  2AUJ D;  1V8Q A;  3SR1 A;  1K28 A;  2BCO A;  3BDL A;  1VF7 A;  1S5B D;  3VR6 A;  1EY5 A;  1XX8 A;  1TKW B;  1YHA A;  3E9I A;  4KHZ A;  1OXS C;  4AYB G;  2OCE A;  1LTI D;  3N6R A;  1J5E Q;  4YHH Q;  4R4I A;  3TP6 A;  2O5J C;  5C3E B;  1H9K A;  4FP5 D;  3GV3 A;  1J6Q A;  2EDG A;  5M9O A;  3PGZ A;  4DA2 A;  1E2Z A;  1R4P B;  1RD9 D;  1O7Z A;  3PV0 A;  3L7Z C;  2KOL A;  3IAY A;  3TQY A;  4LUZ A;  2L55 A;  4GKK Q;  5IGF A;  4A3L H;  2I5H A;  2DGY A;  4LF7 Q;  1TU2 B;  4DNT B;  2G9H D;  1WCM B;  3CCU A;  1TY2 A;  3KDF B;  3BYT B;  1HQR D;  1K8A C;  1CKO A;  1VQI A;  5FJ8 H;  1L1O C;  1JOO A;  3NEM A;  4ZUI A;  2H5X A;  4JI7 Q;  3H3V I;  3S15 H;  2CW0 D;  1SMY C;  5KNB A;  1GUO A;  2A69 C;  4C3H B;  1CSP A;  4JI8 L;  4QF4 A;  2EY1 A;  1K73 C;  4BBS B;  1NSN S;  2E2J H;  3J7A F;  2NZH A;  2JE6 I;  4B3R Q;  1ASY A;  1I3Q B;  1DJR D;  4LF4 Q;  1VQA A;  3S1M H;  4DXF A;  4LF6 Q;  1SNM A;  1ET6 A;  1X3P A;  4GLX A;  2L5T A;  3PIO 3;  1UWV A;  1SBB B;  1ENA A;  4QUF A;  3K81 C;  2K28 A;  4LAA A;  2RQX A;  1Q3L A;  2OTJ A;  1LTL A;  2LSS A;  2UUB L;  4FVM A;  1XNQ L;  1VS0 A;  2MGS A;  2HT1 A;  4A3C H;  3G4S A;  3C46 A;  4JI2 L;  4IN3 A;  5EJW A;  1EIF A;  1BBX C;  3PO3 H;  3HKZ G;  1HPC A;  1YHB A;  5JEA J;  1EZ8 A;  5J39 A;  4HMJ A;  3S16 H;  3GTP H;  2NVX H;  1IHZ A;  2WKC A;  2EYO A;  3T16 A;  2MHV A;  2K1B A;  1PTO H;  4E6I A;  3HGB A;  1HA6 A;  2KEN A;  1LT5 D;  2NVT B;  1TWA B;  5E3F A;  1YIT A;  5IGC A;  1B9M A;  1LTT D;  2VY3 A;  2KQ3 A;  4C3I G;  4KN7 C;  4N8X 1;  4DV4 L;  4FO2 A;  5IYD G;  3I70 A;  2HD3 A;  4UP9 A;  3M3Y B;  3ERO A;  1SYB A;  4J1M A;  4OON A;  4U68 A;  3J7Z C;  1NR4 A;  1Z6H A;  3BJU A;  2F0J A;  2HIX A;  4LF8 Q;  4O0A A;  3EQL C;  4JI5 L;  1EL0 A;  5IIF A;  4IFD H;  3C1F A;  1LT6 D;  3GTQ B;  2Z9H A;  1FD7 D;  1V43 A;  1D2B A;  1G2T A;  4IJH A;  2JA6 G;  3S17 B;  4CDF C;  3L9A X;  4QY7 A;  1OXT A;  1Y14 B;  1BXT A;  1YZ6 A;  3V2T A;  4YWM A;  5KNC A;  2F0S A;  3S2H H;  2BDO A;  2AUK A;  3PUZ A;  1TWH H;  4F87 A;  4K5W A;  1S40 A;  1NY4 A;  4UP8 A;  1OXX K;  5C3W A;  5K36 H;  3ONA B;  4Q5V A;  3I4N B;  1TQO A;  3L3O C;  1MJE A;  2FMM A;  2Z0S A;  4L5R C;  4A3I G;  1AW7 A;  2K5N A;  2F0N A;  1Q7Y C;  2OTL A;  1D1K A;  5AJ3 L;  3A8J E;  4BBR G;  4DAY B;  4GNX C;  2DY8 A;  2KHJ A;  1Q86 C;  3KJO A;  1CUK A;  1M8A A;  1NTG A;  3Q23 A;  3WOF A;  4BA1 I;  3T1H Q;  5IT9 E;  4A75 A;  1EFI D;  4P75 A;  1JOK A;  4R9W A;  2ZJR A;  2NVY H;  3A56 A;  1X6O A;  2AQ2 B;  1JOQ A;  2PZT A;  4GOP B;  1IBM Q;  3J7Y W;  2K5W A;  2SDF A;  1C8C A;  1LYL A;  4LFB Q;  3NBH A;  3OW2 A;  1SYC A;  1XMQ Q;  1ASZ A;  4A3F B;  1IZ6 A;  5M5Y H;  1B2T A;  4GLV B;  3HEJ A;  4NW2 A;  1Q8K A;  4YWL A;  3RMH A;  3X3M A;  1D7Q A;  2Z4I A;  1O7Y A;  3HOY H;  2HUG A;  4ME3 A;  4U67 3;  1VQJ A;  2K05 A;  1RKN A;  3A8I E;  4GLA C;  1PTO C;  3STB D;  1E24 A;  3SGI A;  5M3F B;  2UUC L;  4NDX A;  1F77 A;  5CV9 A;  5DEH A;  1SRU A;  1EQR A;  4R4O A;  5C44 G;  3S2D B;  1FL0 A;  4KV6 A;  4A3M B;  3K6O A;  3K5O A;  3MTS A;  4DV5 L;  1VQK A;  3I4O A;  1Y1W B;  4PZ6 A;  1IW7 D;  4IPD A;  4CKB A;  3RN5 A;  2J0T D;  1II3 A;  4TRD A;  1VQ7 A;  1ILP A;  3OWE B;  2NVQ B;  2JP1 A;  2AKW B;  1PYW D;  1QOH A;  1XWE A;  4N8F A;  2R93 B;  2A6H C;  5EQ0 A;  2WP8 J;  3PIP 3;  4X3T A;  4KY6 A;  1UE7 A;  3PIP A;  5LMU L;  1HTL D;  1SE8 A;  1M1K C;  2L0C A;  1R4Q B;  1TY0 A;  2QDB A;  3OPO A;  4DV2 L;  3H3V H;  1IBL L;  3E5S A;  2ZT9 C;  4G57 A;  1WTP A;  4C3I H;  2WAC A;  5T1G A;  1KNA A;  5IYD H;  3JAM E;  3OHX C;  3S14 B;  5IT9 L;  1JWM D;  1LTG D;  1LT4 D;  1EWH A;  4KJO A;  1STG A;  1ZKO A;  1F2Z A;  4HIK A;  1JB7 A;  2ATW A;  4BA2 I;  2RHQ B;  2TMP A;  2UXD Q;  3CPW A;  2BA1 A;  3ERS X;  2HDM A;  2F1M A;  5LMN L;  2ZM6 L;  4FXG C;  4DR4 L;  3LNN A;  3H0G B;  3NP8 A;  1U4M A;  3OOC A;  4DUY Q;  1LM0 A;  1S4Z A;  2HQL A;  1X3E A;  3EBE A;  2JA6 H;  5C5M A;  3RNU A;  1DYQ A;  2FJ2 A;  4K6D A;  1N33 Q;  2UUA L;  1CK1 A;  2JA9 A;  2MNA A;  1AN8 A;  3NTI A;  4KMU C;  1KLG D;  3T56 B;  1VQO A;  5JOB A;  4JBM A;  1IBK L;  3TS0 A;  5KND A;  1Y1V B;  1DD2 A;  3OMC A;  1S3O A;  3KDF A;  3VR3 A;  4A3G B;  3E3X A;  2F0T A;  5C4H A;  2RVL A;  4IQZ A;  3NEL A;  4DN4 M;  4HIO A;  1HNW Q;  4JBJ A;  2PNH A;  2EYM A;  1HRJ A;  3RZD H;  1NMG A;  2A6E D;  4A3I H;  1B8A A;  3BZC A;  3NBI A;  1F2M A;  4P73 A;  1IYJ B;  3AQQ A;  3TP8 A;  1I4X A;  4BBR H;  4IO9 A;  3GD7 A;  3I73 A;  4FF2 A;  1OO9 B;  2WB1 G;  1VQ6 A;  3FPP A;  2B63 B;  2CH4 W;  1YVC A;  3NTK A;  1VQ4 A;  1D8L A;  4IUQ A;  3HOV G;  2QF7 A;  3D4D A;  3FP9 A;  1N32 L;  2L15 A;  1LTS D;  2E2I B;  2RSO A;  1SYD A;  2B3G A;  4MZ9 A;  3ZJY C;  3CCS A;  1CKN A;  1GUT A;  3PCO B;  1K8M A;  3K7A B;  3RR5 A;  3JAM L;  3RD4 A;  2L1B A;  1ENF A;  5C0X J;  2F03 A;  1YNJ C;  2JQO A;  4X3U A;  5GRO A;  2YTX A;  3WOE A;  5C6A A;  4LFC Q;  4KHP L;  1G6P A;  1S5C D;  2NZ1 D;  3P1H A;  3HKS A;  3VDY A;  4RHS A;  2KCN A;  2CH4 A;  1D5M C;  1FVI A;  2BE5 D;  5C44 H;  2KCT A;  3TN2 A;  2K50 A;  1JC7 A;  2VUM B;  4CGY B;  2Y0S B;  4K8I A;  1LTA D;  5CMD A;  2G5D A;  5H1S E;  2EXD A;  2DJF C;  1Q1B A;  4ZRZ A;  3M4Y A;  4QQB X;  3ZYY X;  3RLN A;  4DNR B;  4XT1 B;  3E0J A;  1UEA B;  3CU7 A;  4JOI A;  2F0E A;  1J5E L;  2NN6 I;  5C3X A;  4YHH L;  4DV0 L;  4A3B B;  3E6Z X;  4EQ5 A;  4CDC C;  1XPO A;  2XSC A;  3SK5 A;  1KAB A;  2CKZ B;  3FRP B;  3VYU A;  1M4V A;  2F0K A;  2NB0 A;  3GTL H;  5D65 A;  4GKK L;  4ZKC B;  3S24 A;  4WJ3 M;  3FHW A;  4LF7 L;  4HSV A;  2TSS A;  3QJY A;  4WJW A;  4O2D A;  1SLJ A;  4KY5 A;  1SYF A;  3D0F A;  4ILW A;  4OWW B;  2A73 B;  1PH5 A;  3PUX A;  3R8B A;  4Y7N B;  3JC6 6;  4JI0 Q;  1IW7 C;  2B2Y C;  3ULL A;  2KEE A;  5C4J H;  4JI7 L;  1E3P A;  2FFK B;  4EGV A;  2M2L A;  2Z1C A;  1S5D D;  1SJE D;  3GTK B;  4B9W A;  1EU3 A;  4WOR A;  4LF5 Q;  3NTH A;  3OMG A;  3ND8 A;  5JVH 3;  3F2U A;  3CW2 C;  3HP3 A;  1JMC A;  3TS2 A;  3A5U A;  1TVX A;  4X65 Q;  3A5Z B;  1MHW C;  1PRT B;  1CZG A;  3SDZ A;  4C2M H;  4B3R L;  1HA5 A;  4LF4 L;  4OGQ C;  1PTO F;  2K14 A;  1Q1E A;  2N78 A;  1EFW A;  4LF6 L;  4DAY A;  3TRE A;  1GUN A;  1SNO A;  2PYK A;  2NN6 G;  2AWO A;  1TII D;  1X55 A;  1ENC A;  2JN4 A;  2NUC A;  2L9H A;  4EQN A;  2G9D A;  5CV5 A;  2OEO A;  2JA5 G;  3NQI A;  5HUR A;  4DFA A;  1HNZ Q;  4JVZ A;  3NWT A;  4GOP A;  4A3J G;  3GTO H;  3FMC A;  4XQJ A;  5BN5 A;  1B4O A;  1LTB D;  3QIA A;  2EVB A;  2J4X A;  3CQZ H;  3NBH B;  2ASB A;  2AMC B;  1HFG A;  1I6H H;  2O2L D;  1EYD A;  4QB4 A;  3J81 c;  3F2C A;  1PHJ A;  2XGT A;  3ERQ A;  1HZA A;  2H1E A;  1VDZ A;  5EGT A;  3MFG A;  1J9O A;  3HOV H;  1I6V C;  4BY1 B;  1I4G A;  1PRT F;  3TDQ A;  2JYO A;  1G91 A;  3U50 C;  4JI6 Q;  4PMW A;  4FF3 A;  5EAY A;  1VQ5 A;  3ICE A;  3D6W A;  3S1Q B;  3BG3 A;  1YNN C;  3Q24 A;  4LF8 L;  4OIK A;  2IHE A;  4F8M A;  2F0M A;  4FNF A;  1M90 C;  1E22 A;  4NXN Q;  3HOW B;  1PXU A;  2F0P A;  2EYJ A;  2YU9 B;  4CJ2 C;  3QB3 A;  4B3M Q;  4DR6 Q;  1TWF B;  3PMF A;  1BKB A;  3PF5 A;  5GAE C;  3RLF A;  2EJM A;  1X9N A;  1VQB A;  2KVM A;  3M4O B;  1Z9F A;  2NWG A;  2GVA A;  5ELO A;  4R8N A;  1SFO H;  3MXG A;  2KBN A;  4HR7 B;  4NXM Q;  4X6A H;  1KRS A;  4TKO B;  1SAP A;  1EEI D;  3NSW A;  4JI3 Q;  2A8V A;  3R2T A;  2MFI A;  2JA7 G;  4HJ8 A;  2EJF C;  3A8K E;  5DAU A;  2VB3 X;  4K2L A;  5CV4 A;  3W1G A;  2MUY A;  2B2V C;  2BH2 A;  5IWA Q;  4RWS C;  2K7V A;  2SNS A;  2UU9 Q;  1DON A;  1Y8O B;  1JWU D;  3P7J A;  1PH1 A;  1QUQ A;  1VMC A;  4JCV E;  3T1H L;  3S1N H;  1HJP A;  3UE1 A;  4JBW A;  2PZW A;  2LMC B;  1T9H A;  1HTP A;  2V4D A;  1A15 A;  5GQO A;  3ULJ A;  3AFP A;  3Q0A A;  2DNE A;  5F2D A;  4AQY L;  5K36 G;  1IBM L;  3CCL A;  3DXJ C;  4N9T A;  4DV0 Q;  3GDE A;  5FK9 C;  3A0J A;  4LFB L;  1XTC D;  4K2K A;  5E7N A;  1XMQ L;  4RKL A;  4A93 G;  1ICF B;  2UXC Q;  5M5X H;  1NJI C;  1FJG L;  3PUY A;  4TVA B;  3L2P A;  4AIM A;  1RHP A;  4A3D G;  1VMP A;  5I2Y A;  2R92 B;  2PI2 A;  4L5S A;  2PCF B;  3CXC A;  4A3E G;  4LFA L;  2VB2 X;  3GTM B;  4RGO S;  1XYI A;  1AE2 A;  2HCC A;  1SNQ A;  1GD7 A;  4F88 A;  4Y52 H;  1NE3 A;  2B2U A;  1G2S A;  2NN6 H;  4IUP A;  5EPK A;  3CC4 A;  3DWP A;  2F0F A;  3SVM A;  4JI1 Q;  3HOY G;  2K75 A;  3BVM A;  3VR2 A;  2JA5 H;  4PG3 A;  5IY0 A;  2F3I A;  4OO1 I;  1LLR D;  4A3J H;  1I50 H;  4ZYS A;  4BS9 A;  3MA2 B;  4EQP A;  1K9M C;  2SEB D;  4K5X A;  1I4H A;  3A54 A;  3B6Y A;  3GTJ H;  1MIU A;  5FLX c;  4GNX A;  1B70 B;  2D62 A;  1IXR A;  1QB5 D;  4HMI A;  2BOS A;  2CCZ A;  1WTH A;  2WIN B;  1F9S A;  2AQ1 B;  1KTK A;  1CKN B;  4DV1 Q;  3K80 C;  3K7U C;  2OF1 A;  3U4V A;  4IUR A;  1STY A;  4HID A;  2YTY A;  1O7L A;  3R93 A;  3AYH B;  2B2T C;  5D3D A;  3PF4 A;  4FDB A;  2PI2 E;  5COR A;  5EPL A;  4ZAI A;  2EYF A;  1PRT D;  3J80 c;  5ISR A;  1RTO A;  1SND A;  4KY7 A;  1ICW A;  3VR4 A;  5M3M G;  1XMO Q;  4GKJ Q;  3NWS A;  3KK7 A;  2MO0 A;  1SMX A;  2UXD L;  1HNX Q;  2R7Z B;  2N88 A;  1SR3 A;  5M5W B;  4X66 Q;  5KGU A;  3F2B A;  1VQE A;  3DMU A;  2A68 D;  4DUY L;  1RF2 D;  2IPK D;  2IX0 A;  2XNA C;  4X3S A;  5CR3 A;  3KLW A;  4B9X A;  2F52 A;  4CBV A;  1N33 L;  4OWT B;  1JE4 A;  4OO1 G;  1K8O A;  5G3L F;  2VQE Q;  3D31 A;  2WV6 D;  4LUO A;  4CHT B;  3E9H A;  1SYE A;  4POG A;  3I4M G;  4A3B H;  3R3O A;  5LMN W;  4C56 C;  1V1Q A;  1IL2 A;  1YBY A;  3NQT A;  3W2D A;  3CC7 A;  2F4V Q;  3LWE A;  1HFN A;  1D5Z C;  1BCP C;  3FKI G;  1N36 Q;  1YJ9 A;  2IW3 A;  4G7O C;  4RCN A;  3CHB D;  5C4X G;  2JA7 H;  3HG9 A;  1HNW L;  1STE A;  1HCZ A;  4LF9 Q;  4HAE A;  1WYD A;  2F0D A;  1HZ9 A;  2EY2 A;  3MEF A;  3GTG H;  2D2C C;  3MFY A;  2Q2T A;  3A74 A;  1QG7 A;  4X3K A;  1L0X B;  4DF7 A;  2KCM A;  5C3E G;  2K4K A;  3EA6 A;  1EQV A;  2QGQ A;  2RDF A;  1E0B A;  3MAQ A;  1X65 A;  3I8Z A;  1I4Q A;  1KNE A;  1WJJ A;  4KTA A;  4XT3 B;  4FF1 A;  1LAC A;  3I7F A;  4TSS A;  2D5D A;  4JV5 Q;  1JQY D;  4OHJ A;  4A93 H;  1BBW A;  3KUP A;  4NMZ A;  3NEN A;  3IFT A;  1WCM G;  2E2H B;  1PH7 A;  1FNV A;  2JK8 A;  2NYZ D;  1LTR D;  5CV7 A;  1H95 A;  3RZO B;  4NP5 A;  4A3D H;  4G7H C;  3K0X A;  1OTC A;  4C1N I;  1VQM A;  1BQQ T;  4M1U B;  3T4A C;  1UUP A;  1HZB A;  4PQX A;  2HCI A;  4AQY Q;  1SRO A;  4LFC L;  1EOV A;  4A3E H;  1NBW A;  4BY7 B;  4C3H G;  4BXX G;  5DLQ E;  3FDT A;  1K83 B;  1D6E C;  4IZ8 A;  1FJG Q;  4R8I A;  1MKH A;  1FNW A;  4BBS G;  3T1Y Q;  4NKL A;  1Y8P B;  4KK7 A;  4IOA A;  1PZI D;  2EYP A;  1JOR A;  1C9O A;  2CWA A;  1GXD C;  3J81 E;  1XNR Q;  1PH3 A;  5DNF A;  5J3B A;  1HZC A;  2WAQ B;  1WFQ A;  4XDX A;  1HH2 P;  2NTS A;  4LFA Q;  5HGT A;  4A3K B;  3VR5 A;  4RHR A;  1Q8I A;  3HOX B;  3CCV A;  1C48 A;  5ELF A;  4R4T A;  2QEJ C;  1E2V A;  4IFD J;  4LW1 A;  1KC8 C;  3I56 A;  3GO5 A;  4IJL A;  1B53 A;  4KKU A;  4DR7 Q;  3CME A;  2CW0 C;  2DUD A;  1G8Z D;  5J22 A;  1EUJ A;  3U9S A;  2FHT A;  4WFN 3;  1LT3 D;  4JI0 L;  3MXN B;  1R9T H;  4DR2 Q;  3IFD A;  5M3M H;  1U4P A;  3ER0 A;  1HQM C;  4OL7 A;  1XPR A;  1K3B C;  3BZD B;  3I90 A;  1P8L A;  3OTO Q;  1WTV A;  1IKL A;  4LF5 L;  1L2F A;  4C3J B;  3OIP A;  4OX9 Q;  4B3S Q;  4X65 L;  3J7A 5;  4DR5 Q;  3G7L A;  3LX0 A;  1OXV A;  4ME5 A;  2E5L Q;  1PFN A;  3CAM A;  2OXP A;  5I9P A;  1TWG B;  3NXW A;  4OO1 H;  2QKI C;  5BR8 Q;  1XJV A;  2MQH A;  1EEF D;  3PO2 B;  1QWY A;  3HOU B;  5G3L D;  4JYA Q;  3I4M H;  3QO2 A;  2F0L A;  1SJH D;  1ZYR D;  1TWC B;  3S1R B;  5EBD A;  2D0P A;  5T1I A;  4QJF A;  3FKI H;  5AFW A;  1QUQ B;  1HNZ L;  1N8R C;  1FNU A;  3KOJ A;  1AZQ A;  5C4X H;  1VQ8 A;  1EYA A;  2I07 B;  4Z9C B;  5I9O A;  2JA8 B;  2XWJ B;  2X6G A;  3ULP A;  2WKD A;  1BUV T;  4ID6 A;  3J81 L;  1X32 A;  5JJL A;  2LXJ A;  1A2T A;  3KJP A;  4KN4 C;  4RG1 A;  5C4Z A;  5K5P A;  3TRZ A; 
#chains in the Genus database with same CATH homology
 5EKL A;  1H9S A;  1RCV D;  2HQE A;  3T53 B;  4V19 0;  2QCP X;  4ZKB B;  2F3V A;  4CKE A;  1HXY D;  4ABN A;  2B2Y A;  1QNK A;  3D6C A;  3VA5 A;  1A2U A;  4MIU A;  4CJ1 B;  1QCB D;  1BNZ A;  2Q8T A;  1STN A;  4H0L C;  1H9M A;  1NAP A;  2F4I A;  5CBE E;  4HTH A;  2B8G A;  2ENB A;  5TSS A;  1GJX A;  2JEA I;  2IT1 A;  5IGG A;  1VF5 C;  5FO9 B;  3S15 B;  1CQF A;  2F0V A;  4Q0F A;  5C5L A;  4PMB A;  3MXP A;  2E2J B;  2MP1 A;  1CHQ D;  1D5X C;  3S1M B;  1SDF A;  1SE2 A;  4EQO A;  2QIL A;  3UI2 A;  1U9R A;  2PMZ B;  1B1Z A;  3R2I A;  3SXH A;  1BCP F;  3PO3 B;  1KLU D;  3K0Y A;  3DHQ A;  3MVV A;  3J80 E;  5FOB B;  1AZP A;  3S16 B;  3GTP B;  2NVX B;  5KEE A;  2L4N A;  2JXM B;  4XQN A;  2C9O A;  1CA6 A;  1PTO B;  1LAB A;  1F9Q A;  4ULL A;  1UNS A;  1H9R A;  3BDO A;  2ZXO A;  1G6Z A;  4RAU C;  2H4O A;  4KD4 A;  4P2C B;  5FKA C;  3CRK C;  1Z47 A;  1U4L A;  1B44 D;  1Y69 U;  1ET9 A;  2L11 A;  4L8J A;  5JEA G;  5A2Q E;  2ZXP A;  2LFN A;  3NUC A;  4DXG A;  4OIJ A;  1T5X D;  5E4X A;  1D1I A;  1X3Q A;  1RDP D;  1IL8 A;  2ZXR A;  2DY7 A;  2R61 A;  3T51 B;  1MGS A;  1EY4 A;  1SMY D;  1AEX A;  3H94 A;  2Z4H A;  3P20 A;  3HOZ B;  2A69 D;  3QWN A;  5E4W C;  2B2V A;  2MJ8 A;  3S2H B;  4HCE A;  4IAL A;  2EJG C;  2B2W C;  1TWH B;  1STH A;  3U9O A;  2EYH A;  4J6H A;  4FF4 A;  4AYB B;  4KJN A;  2L12 A;  4FXK C;  1IYV A;  3SHL A;  4K6L A;  1RTN A;  4G7Z C;  1EOT A;  1F2Y A;  2EPB A;  4N9P A;  2KUM A;  1ZYR C;  3X3N A;  1WD1 A;  3FVQ A;  3VYT A;  4IUT A;  2PW5 A;  2M9V A;  2NVY B;  2PNR C;  1WTW A;  1MSH A;  1NUC A;  1O80 A;  3MXU A;  1ILQ A;  2LS0 1;  3NPP A;  5M5Y B;  1EY8 A;  3EJI A;  1W6J A;  3DM1 A;  5J1Z A;  5A2Q L;  2LKV A;  3KBX A;  4K14 A;  1AP0 A;  2A6E C;  1QIL A;  3KF8 A;  2XN9 C;  3HZX A;  1A6X A;  4XYO A;  1JIC A;  3MXN A;  5IGD A;  2K33 A;  1KDB A;  3HKZ B;  1TR5 A;  5JVG 3;  1WTR A;  3QOL A;  2K03 A;  3H09 A;  5CV6 A;  1B50 A;  3TSS A;  1QNU A;  1XXG A;  1DOK A;  3C1E A;  3K5M A;  1EIH A;  1HHV A;  5I4D A;  3MEH A;  4DK0 A;  5ELE A;  3DEO A;  4C3I B;  1SYG A;  2PW7 A;  2K01 A;  2BE5 C;  4IUU A;  3SK4 A;  1E2W A;  3K5L A;  5JEA H;  2E76 C;  3HS0 C;  1TS5 A;  1CFM A;  5CV8 A;  2FIN B;  2XWB B;  1QE6 A;  4KKT A;  2JA6 B;  2Q8I B;  2CVR A;  5JJZ A;  1IKM A;  1A3V A;  1DOM A;  1TS2 A;  1H9S B;  2M00 A;  3VA7 A;  1ESF A;  3OIQ A;  1PTO D;  5BN3 A;  1GHK A;  2B8F A;  4LJZ C;  4B08 A;  3TME A;  2JSO A;  5FO7 B;  2A74 C;  3RZD B;  4A3I B;  2O5I C;  4V0B A;  2YYZ A;  2EOT A;  4BBR B;  1V1O A;  1B3A A;  4TQU S;  4S3S A;  5IOD A;  2E75 C;  1NCV A;  3QOJ A;  1ZXT A;  3RUZ A;  5LL6 X;  4PV1 C;  5C0X I;  2IL8 A;  4H13 C;  2A6H D;  5DM7 3;  1VCI A;  2IWH A;  2K32 A;  1CA5 A;  5IGE A;  1CZW A;  4FYD A;  3V05 A;  3OSO A;  1O78 A;  1JR0 D;  1W6K A;  5LL6 S;  1TS3 A;  5I2X A;  1Y8N B;  3TP5 A;  3H6M A;  1S5F D;  1GUG A;  2ICE C;  2EXZ A;  2F0Q A;  1J8I A;  5C44 B;  1DXM A;  1BOS A;  2R6G A;  3EFX D;  4L63 B;  4RCO A;  2VNU D;  3QG1 A;  3MC0 B;  1KAA A;  4QUC A;  2RBM A;  1OXU A;  3G6J B;  4UAI A;  3URY A;  4QCL A;  3FPU B;  5D3I B;  3BYY B;  1AFP A;  2EY5 A;  3AU7 A;  5C0X G;  4ZQ3 A;  3TZU A;  1DM0 B;  5NUC A;  3SEB A;  2OT2 A;  3GTL B;  1GHJ A;  3M7G A;  4ZUJ A;  1JCK B;  3EVQ A;  1ESR A;  2ICI A;  3OWF A;  2LY7 A;  1F9R A;  2K04 A;  4QMG A;  1EY7 A;  3IKJ A;  2RKS A;  2F3W A;  2AQ3 B;  3C2P A;  5C4J B;  4HCS A;  1FYC A;  4ZK9 B;  1UAP A;  1WD0 A;  3Q22 A;  1I4P A;  1CQV A;  4L6T B;  1EZ6 A;  5DM6 3;  2B2U C;  2JEB I;  1SNP A;  4C2M B;  5FO8 B;  3PUW A;  2WII B;  2AWN A;  2F0O A;  1SSO A;  3D3R A;  3V96 A;  4QIW B;  4C1N K;  1I4R A;  2VXW A;  1YNJ D;  3FEW X;  1WVL A;  3A55 A;  3OW7 A;  5JPN C;  3GTO B;  4EVO A;  3NK9 A;  3M85 A;  3O13 A;  3D8G A;  5D14 A;  2E2D C;  2IX1 A;  1STB A;  4YIJ A;  3CQZ B;  3MWY W;  1I6H B;  3GQB A;  1BF4 A;  2WB1 B;  2PO4 A;  1JWS D;  4JK1 C;  2KEC A;  3DEP A;  1EQT A;  4K8J A;  3HOV B;  4XYQ A;  2SNM A;  1PZJ D;  3CRL C;  1FR3 A;  3Q6S A;  1BO0 A;  1GOZ A;  1EY9 A;  4RA8 A;  4XQQ A;  2J7Z A;  1A3U A;  3TBI B;  2K6A A;  1MSG A;  2IJ0 A;  4XTC S;  3A7L A;  3IL8 A;  4DAP A;  1G29 1;  2RDG A;  1LO5 D;  4MN3 A;  5CC4 A;  1STA A;  3TP7 A;  3MZ5 A;  3K58 A;  1IYU A;  2CHB D;  2PZU A;  2DNC A;  2XVS A;  2RDH A;  1DCZ A;  1SFO B;  4K5V A;  3KLR A;  4LMQ D;  4IUV A;  4M8A A;  1CHP D;  4RGT A;  4KHV A;  5IOC A;  4O1N A;  5I6W A;  1V1P A;  1MI2 A;  2K5D A;  1EIG A;  3VYS A;  1PRT C;  1WTO A;  2O4X A;  2R3Z A;  5C0X H;  2BA0 A;  1A3T A;  4ZLT F;  5JAV A;  3S1N B;  2A68 C;  3GP7 A;  3D4W A;  1S5E D;  3BDC A;  2E74 C;  3W3A A;  5M5X B;  4G4K A;  1BCP B;  1CT1 D;  3C3L A;  3KBG A;  1Z7T A;  1EU4 A;  4PNY A;  1SNC A;  5LHY 1;  3K57 A;  1KDC A;  5CBA E;  2PPB C;  2NTT A;  1MD2 D;  4WRD A;  4FXD A;  2A5H A;  1EWC A;  4RKB A;  4MHE A;  1YNN D;  4H44 C;  4DGZ A;  5ELD A;  2JA5 B;  2B2W A;  5CGK A;  2EY6 A;  3LWU A;  2XRQ D;  5ELB A;  3P75 A;  4A3J B;  5EKI A;  1I50 B;  1PZK D;  1PMR A;  1CTM A;  5FLX E;  3VYR A;  3GTJ B;  3SK8 A;  1DZ1 A;  2RA4 A;  1LV9 A;  1CI3 M;  4KD3 A;  5EBC A;  3BS1 A;  3WDN A;  1H9J A;  3DWA A;  1GUS A;  4ODG A;  1ROD A;  1PLF A;  2Q8R E;  4I65 A;  3N52 A;  4RFB A;  3T13 A;  1U4R A;  2IX3 A;  4KKS A;  3H91 A;  2EYL A;  2ID0 A;  2MPM A;  5I6Y A;  1SEB D;  4I7Z C;  3J7A V;  3BVZ A;  1Q90 A;  1HUM A;  3H3V C;  4C3J G;  3S9W A;  3DUZ A;  3AB9 A;  4J8Q A;  3ITP A;  3MHB A;  3CKI B;  2SOB A;  2Z8L A;  2BDN A;  3NE5 B;  5EKK A;  2HDL A;  4RGM A;  2I46 A;  1BR9 A;  3AMU A;  1TS4 A;  2EE1 A;  2FMC A;  3K5N A;  1HUN A;  4RH6 A;  2F0H A;  1EYC A;  5KIX A;  1DOL A;  1T5E A;  3A7A B;  4XIG S;  5IGB A;  4IUN A;  2JA7 B;  3SK6 A;  3GTG B;  4UDU C;  5FLX L;  5EPJ A;  2F0G A;  2X6L A;  3PUV A;  1WTQ A;  2K5Q A;  3M7N A;  2F0W A;  1L0Y B;  2F0I A;  2GA4 B;  5KRU A;  3TZD A;  3I3C A;  4A93 B;  2KED A;  1QJO A;  2XIW A;  5E1F A;  3J80 L;  5CYU A;  2KA7 A;  4RGN A;  4A3D B;  2X69 A;  4LK1 C;  1PFM A;  3I72 A;  1CM9 A;  5KYI A;  1PFB A;  4HED A;  1PDQ A;  3DWQ A;  1ZEQ X;  4H7B A;  4O42 A;  4A3E B;  3SE0 A;  1MBY A;  4GZY C;  5A35 A;  5BN4 A;  5ELC A;  2NBF A;  2D9U A;  3HOY B;  1SE4 A;  4IFD I;  4DAV A;  4HSP A;  4KI0 A;  1F2L A;  1F9P A;  2B39 A;  1EY0 A;  2KJX A;  1BDO A;  1ML0 D;  5JPM C;  5COY A;  3ND9 A;  1KDA A;  1GUW A;  3K59 A;  3I4L A;  1Q12 A;  1BCP D;  4CJ0 B;  1RJT A;  4DK1 A;  1EY6 A;  1ONL A;  2XRS D;  1SXT A;  2RSN A;  4XXE A;  3KLS X;  1NR2 A;  2C5C A;  4DU9 A;  1R9T B;  3I91 A;  5M3M B;  2B2T A;  2PQE A;  2EZV A;  2KCC A;  1FGB D;  3KLS A;  4CKC A;  4F7X A;  3GV6 A;  1SE3 A;  2N55 A;  2CQA A;  4IFD G;  2DN8 A;  4HN7 A;  1V1P B;  1C4Q A;  1B9N A;  1TT2 A;  3I4M B;  3NHH A;  4BWG B;  3D4R A;  3HRZ C;  4PMC A;  3FKI B;  1WTX A;  2F0U A;  3BVG A;  1JB3 A;  5KYL A;  5C4X B;  2KHS A;  2AUJ D;  1V8Q A;  3SR1 A;  2BCO A;  3BDL A;  1VF7 A;  1S5B D;  3VR6 A;  1EY5 A;  1XX8 A;  1TKW B;  4KHZ A;  1OXS C;  1LTI D;  3N6R A;  3TP6 A;  2O5J C;  5C3E B;  1H9K A;  4FP5 D;  3GV3 A;  2EDG A;  5M9O A;  4DA2 A;  1E2Z A;  1R4P B;  1RD9 D;  1O7Z A;  3PV0 A;  3L7Z C;  2KOL A;  3IAY A;  2L55 A;  5IGF A;  1TU2 B;  4DNT B;  2G9H D;  1WCM B;  1TY2 A;  3BYT B;  1HQR D;  1JOO A;  4ZUI A;  2CW0 D;  1SMY C;  5KNB A;  1GUO A;  2A69 C;  4C3H B;  4QF4 A;  2EY1 A;  4BBS B;  1NSN S;  3J7A F;  2JE6 I;  1I3Q B;  1DJR D;  4DXF A;  1SNM A;  1ET6 A;  1X3P A;  2L5T A;  3PIO 3;  1SBB B;  1ENA A;  4QUF A;  2K28 A;  4LAA A;  2RQX A;  1Q3L A;  4FVM A;  2MGS A;  3C46 A;  4IN3 A;  5EJW A;  1BBX C;  1HPC A;  5JEA J;  1EZ8 A;  5J39 A;  4HMJ A;  1IHZ A;  2WKC A;  2EYO A;  3T16 A;  2MHV A;  2K1B A;  1PTO H;  4E6I A;  3HGB A;  1HA6 A;  1LT5 D;  2NVT B;  1TWA B;  5E3F A;  5IGC A;  1B9M A;  1LTT D;  2KQ3 A;  4C3I G;  4KN7 C;  4FO2 A;  3I70 A;  3M3Y B;  3ERO A;  1SYB A;  4J1M A;  4U68 A;  1NR4 A;  1Z6H A;  2F0J A;  3EQL C;  1EL0 A;  5IIF A;  4IFD H;  3C1F A;  1LT6 D;  3GTQ B;  1FD7 D;  1V43 A;  1D2B A;  1G2T A;  3S17 B;  3L9A X;  1OXT A;  1BXT A;  3V2T A;  5KNC A;  2F0S A;  2BDO A;  2AUK A;  3PUZ A;  4F87 A;  4K5W A;  1OXX K;  5C3W A;  5K36 H;  3ONA B;  4Q5V A;  3I4N B;  1TQO A;  3L3O C;  2FMM A;  1AW7 A;  2F0N A;  1D1K A;  3A8J E;  2DY8 A;  1M8A A;  3Q23 A;  3WOF A;  4BA1 I;  5IT9 E;  1EFI D;  1JOK A;  4R9W A;  3A56 A;  2AQ2 B;  1JOQ A;  2PZT A;  3J7Y W;  2K5W A;  2SDF A;  1C8C A;  3NBH A;  1SYC A;  4A3F B;  1B2T A;  3HEJ A;  4NW2 A;  3RMH A;  3X3M A;  2Z4I A;  1O7Y A;  2HUG A;  4U67 3;  2K05 A;  1RKN A;  3A8I E;  1PTO C;  5M3F B;  4NDX A;  1F77 A;  5CV9 A;  5DEH A;  3S2D B;  4KV6 A;  4A3M B;  3K6O A;  3K5O A;  3MTS A;  1Y1W B;  1IW7 D;  4CKB A;  2J0T D;  1II3 A;  4TRD A;  1ILP A;  3OWE B;  2NVQ B;  2JP1 A;  1PYW D;  1QOH A;  1XWE A;  2R93 B;  2A6H C;  5EQ0 A;  2WP8 J;  3PIP 3;  4X3T A;  4KY6 A;  1HTL D;  2L0C A;  1R4Q B;  1TY0 A;  2QDB A;  3OPO A;  3E5S A;  2ZT9 C;  4G57 A;  1WTP A;  2WAC A;  5T1G A;  1KNA A;  3JAM E;  3OHX C;  3S14 B;  5IT9 L;  1JWM D;  1LTG D;  1LT4 D;  1EWH A;  4KJO A;  1STG A;  1ZKO A;  1F2Z A;  4BA2 I;  2TMP A;  2BA1 A;  2HDM A;  2F1M A;  4FXG C;  3LNN A;  3H0G B;  3NP8 A;  1U4M A;  3OOC A;  1S4Z A;  5C5M A;  1DYQ A;  2FJ2 A;  4K6D A;  1CK1 A;  1AN8 A;  3NTI A;  4KMU C;  1KLG D;  3T56 B;  5JOB A;  5KND A;  1Y1V B;  1DD2 A;  3OMC A;  3VR3 A;  4A3G B;  2F0T A;  5C4H A;  2RVL A;  4IQZ A;  4DN4 M;  2EYM A;  1HRJ A;  2A6E D;  3NBI A;  1F2M A;  3TP8 A;  1I4X A;  3GD7 A;  3I73 A;  4FF2 A;  1OO9 B;  3FPP A;  2B63 B;  3NTK A;  4IUQ A;  2QF7 A;  3D4D A;  1LTS D;  2E2I B;  2RSO A;  1SYD A;  1GUT A;  1K8M A;  3K7A B;  3JAM L;  3RD4 A;  2L1B A;  1ENF A;  5C0X J;  2F03 A;  1YNJ C;  4X3U A;  3WOE A;  5C6A A;  1S5C D;  2NZ1 D;  3P1H A;  4RHS A;  2KCN A;  1D5M C;  2BE5 D;  3TN2 A;  1JC7 A;  2VUM B;  4CGY B;  2Y0S B;  4K8I A;  1LTA D;  5CMD A;  1Q1B A;  4ZRZ A;  3M4Y A;  3ZYY X;  4DNR B;  4XT1 B;  3E0J A;  1UEA B;  3CU7 A;  2F0E A;  2NN6 I;  5C3X A;  4A3B B;  3E6Z X;  2XSC A;  3SK5 A;  1KAB A;  3FRP B;  3VYU A;  1M4V A;  2F0K A;  2NB0 A;  5D65 A;  4ZKC B;  4HSV A;  2TSS A;  3QJY A;  4WJW A;  4KY5 A;  1SYF A;  4ILW A;  2A73 B;  3PUX A;  3R8B A;  4Y7N B;  1IW7 C;  2B2Y C;  2KEE A;  2FFK B;  4EGV A;  2M2L A;  2Z1C A;  1S5D D;  1SJE D;  3GTK B;  4B9W A;  1EU3 A;  4WOR A;  3NTH A;  3OMG A;  3ND8 A;  5JVH 3;  3F2U A;  3HP3 A;  1TVX A;  1PRT B;  1CZG A;  3SDZ A;  1HA5 A;  4OGQ C;  1PTO F;  1Q1E A;  4DAY A;  1GUN A;  1SNO A;  2PYK A;  2NN6 G;  2AWO A;  1TII D;  1ENC A;  2NUC A;  2L9H A;  4EQN A;  2G9D A;  5CV5 A;  2OEO A;  3NQI A;  5HUR A;  4DFA A;  3NWT A;  3FMC A;  4XQJ A;  5BN5 A;  1B4O A;  1LTB D;  3QIA A;  2EVB A;  2J4X A;  1HFG A;  2O2L D;  1EYD A;  4QB4 A;  3ERQ A;  2H1E A;  1VDZ A;  5EGT A;  3MFG A;  1J9O A;  1I6V C;  4BY1 B;  1I4G A;  1PRT F;  3TDQ A;  2JYO A;  1G91 A;  4PMW A;  4FF3 A;  3D6W A;  3S1Q B;  3BG3 A;  1YNN C;  3Q24 A;  4OIK A;  4F8M A;  2F0M A;  4FNF A;  3HOW B;  1PXU A;  2F0P A;  2EYJ A;  2YU9 B;  4CJ2 C;  3QB3 A;  1TWF B;  3PMF A;  3RLF A;  2EJM A;  2KVM A;  3M4O B;  2NWG A;  4R8N A;  3MXG A;  4HR7 B;  4TKO B;  1SAP A;  1EEI D;  3NSW A;  3R2T A;  2EJF C;  3A8K E;  5DAU A;  2VB3 X;  4K2L A;  5CV4 A;  2MUY A;  2B2V C;  4RWS C;  2K7V A;  2SNS A;  1DON A;  1Y8O B;  1JWU D;  3P7J A;  1VMC A;  4JBW A;  2PZW A;  2LMC B;  2V4D A;  1HTP A;  1A15 A;  3Q0A A;  2DNE A;  5F2D A;  5K36 G;  3DXJ C;  4N9T A;  5FK9 C;  1XTC D;  4K2K A;  4RKL A;  3PUY A;  1RHP A;  1VMP A;  5I2Y A;  2R92 B;  2PCF B;  2VB2 X;  3GTM B;  4RGO S;  1XYI A;  2HCC A;  1SNQ A;  4F88 A;  2B2U A;  1G2S A;  2NN6 H;  4IUP A;  5EPK A;  3DWP A;  2F0F A;  3SVM A;  3BVM A;  3VR2 A;  4OO1 I;  1LLR D;  4ZYS A;  4BS9 A;  3MA2 B;  4EQP A;  2SEB D;  4K5X A;  1I4H A;  3A54 A;  2D62 A;  1QB5 D;  4HMI A;  2BOS A;  2WIN B;  1F9S A;  2AQ1 B;  1KTK A;  2OF1 A;  4IUR A;  1STY A;  1O7L A;  3R93 A;  2B2T C;  5D3D A;  4ZAI A;  5COR A;  5EPL A;  2EYF A;  1PRT D;  5ISR A;  1RTO A;  1SND A;  4KY7 A;  1ICW A;  3VR4 A;  3NWS A;  3KK7 A;  2R7Z B;  2N88 A;  5M5W B;  5KGU A;  3DMU A;  2A68 D;  1RF2 D;  2IPK D;  2IX0 A;  2XNA C;  4X3S A;  5CR3 A;  4B9X A;  4CBV A;  1JE4 A;  4OO1 G;  1K8O A;  5G3L F;  3D31 A;  2WV6 D;  4CHT B;  1SYE A;  3R3O A;  4C56 C;  3W2D A;  3NQT A;  3LWE A;  1HFN A;  1D5Z C;  1BCP C;  2IW3 A;  4G7O C;  4RCN A;  3CHB D;  3HG9 A;  1STE A;  1HCZ A;  4HAE A;  2F0D A;  2EY2 A;  2D2C C;  3MFY A;  1QG7 A;  4X3K A;  1L0X B;  4DF7 A;  3EA6 A;  1EQV A;  2RDF A;  1E0B A;  3MAQ A;  3I8Z A;  1I4Q A;  1KNE A;  4KTA A;  4XT3 B;  4FF1 A;  1LAC A;  4TSS A;  2D5D A;  1JQY D;  4OHJ A;  3KUP A;  4NMZ A;  3IFT A;  2E2H B;  1FNV A;  2NYZ D;  5CV7 A;  1LTR D;  3RZO B;  4NP5 A;  4G7H C;  4C1N I;  1BQQ T;  4M1U B;  3T4A C;  1UUP A;  4PQX A;  2HCI A;  4BY7 B;  4C3H G;  3FDT A;  1K83 B;  1D6E C;  4IZ8 A;  4R8I A;  1FNW A;  4NKL A;  1Y8P B;  4KK7 A;  1JOR A;  1PZI D;  2EYP A;  1GXD C;  3J81 E;  5DNF A;  2WAQ B;  4XDX A;  2NTS A;  5HGT A;  4A3K B;  3VR5 A;  4RHR A;  1Q8I A;  3HOX B;  1C48 A;  5ELF A;  2QEJ C;  1E2V A;  4IFD J;  3GO5 A;  1B53 A;  4KKU A;  2CW0 C;  1G8Z D;  5J22 A;  3U9S A;  2FHT A;  4WFN 3;  1LT3 D;  3IFD A;  1U4P A;  1HQM C;  4OL7 A;  3BZD B;  3I90 A;  1WTV A;  1IKL A;  4C3J B;  3OIP A;  3G7L A;  3LX0 A;  1OXV A;  4ME5 A;  1PFN A;  5I9P A;  2OXP A;  1TWG B;  3NXW A;  4OO1 H;  2QKI C;  1EEF D;  3PO2 B;  1QWY A;  3HOU B;  5G3L D;  3QO2 A;  2F0L A;  1SJH D;  1ZYR D;  1TWC B;  3S1R B;  5EBD A;  5T1I A;  5AFW A;  1FNU A;  1AZQ A;  1EYA A;  2I07 B;  4Z9C B;  5I9O A;  2JA8 B;  2XWJ B;  2X6G A;  2WKD A;  1BUV T;  4ID6 A;  3J81 L;  1X32 A;  1A2T A;  4KN4 C;  5C4Z A;  5K5P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...