4K8IA

Crystal structure of staphylococcal nuclease mutant i92v/v99l
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYVYADGKMLNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
total genus 36
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4k8iA00
3D4DA 1EY6A 1EY9A 1KDCA 4K6DA 4PNYA 4R8NA 5CV6A 5C4HA 5KEEA 1JORA 2SOBA 4QMGA 3NHHA 2EYJA 5E1FA 5I6YA 5HURA 1A2UA 4YIJA 3HZXA 3MEHA 1EY7A 4NDXA 4K14A 4J6HA 4WRDA 1IHZA 2F0GA 4KHVA 5JAVA 1KABA 5DEHA 3SK6A 2F0DA 1KAAA 4J1MA 2F3VA 3MVVA 2PZWA 4KJNA 2LKVA 5I9PA 4K8JA 1SYBA 3NUCA 5I6WA 5CV8A 4EQOA 1STHA 2OEOA 2F0KA 5C3WA 5IGBA 2F0OA 1EYDA 2F0MA 4HMIA 1SNMA 1RKNA 2O4XA 1AEXA 2EY2A 3TP8A 4RKBA 4KJOA 1EY8A 4NMZA 2F0TA 5K5PA 5J22A 2PQEA 4K8IA 3NP8A 4KV6A 4N9TA 3NK9A 3D4WA 5C3XA 2F0EA 4IALA 2KHSA 4PMCA 1SNOA 3EVQA 3QOLA 1KDAA 3SR1A 3MHBA 1JOOA 3C1EA 1F2YA 2OF1A 3C1FA 1TQOA 5JOBA 5CV9A 4F7XA 4LAAA 2F0VA 1A3TA 1EZ8A 4B9XA 1F2ZA 3SK8A 3TP6A 3SXHA 1A3UA 1TT2A 5C5MA 5ISRA 3OWFA 2F0JA 3TP5A 4K5VA 4ZUJA 2F0PA 1EYAA 4NP5A 1STAA 4I65A 5CR3A 3U9OA 5KRUA 3SHLA 2EYLA 2PYKA 2SNSA 5J39A 2EYOA 2PW5A 5E3FA 1EY0A 4HTHA 3SK5A 5C4ZA 5IGGA 3DMUA 4S3SA 3BDLA 1EQVA 2QDBA 4K2KA 3BDCA 5J1ZA 3D8GA 3MZ5A 4IUNA 3R3OA 4TRDA 1ENCA 4IZ8A 4KY6A 1ENAA 1SYEA 1KDBA 1SNCA 3ERQA 3P1HA 3ITPA 3DHQA 3LX0A 4RKLA 1SYCA 4KTAA 2F0QA 2EYFA 2SNMA 4K2LA 2EYHA 2F0SA 5C5LA 2PW7A 3OMCA 3QB3A 3H6MA 4QB4A 5F2DA 4ZUIA 4DFAA 4KY5A 5CGKA 1TR5A 2M00A 5EGTA 2F0IA 4B9WA 4DF7A 1JOQA 4MIUA 1F2MA 3E5SA 4NKLA 1U9RA 3TMEA 2F0UA 4G57A 4KD3A 2F0NA 5IODA 2F3WA 5DAUA 2EXZA 4K5XA 2RBMA 1II3A 3EROA 4K5WA 3HEJA 3P75A 2NUCA 1SYFA 3V2TA 2EY5A 2EYMA 2ENBA 4QF4A 4HMJA 3MXPA 3SK4A 4ZQ3A 5C6AA 5M9OA 1SYGA 1JOKA 1SNPA 2RDFA 2EY1A 2WACA 4EQNA 4F8MA 2HQEA 3OSOA 1STGA 5IOCA 3QOJA 5CV4A 3PMFA 5HGTA 3VA5A 1A3VA 4N9PA 1EZ6A 4WORA 3S9WA 4ME5A 1STYA 4KD4A 1SNQA 3D6CA 5KYIA 1EY4A 5CV5A 5CC4A 1A2TA 3OMGA 4ODGA 4EQPA 1SNDA 1SYDA 3NQTA 2PZUA 2F0WA 4PMBA 3T13A 5EKKA 2EY6A 2RKSA 3T16A 4DGZA 1STBA 5KGUA 5KIXA 1EYCA 3NXWA 3RUZA 3TP7A 4KY7A 2F0LA 4DU9A 5KYLA 5NUCA 5IGDA 5IIFA 4EVOA 5CV7A 1NSNS 1STNA 2F0FA 2OXPA 2PZTA 1EY5A 4H7BA 5I9OA 3EJIA 4OL7A 5EKLA 5IGCA 4ID6A 2KQ3A 1NUCA 4E6IA 2EYPA 5IGFA 5IGEA 2F0HA
chains in the Genus database with same CATH superfamily
1BXTA 5C4HA 1YVCA 1W2BA 4ZKCB 3HOWH 1Q46A 1DOLA 3CCJA 4R4IA 1I5FA 1EIYB 1HZBA 5C4XG 1Q90A 1F9QA 5LMUL 2KCTA 3CCMA 1I4GA 1D2BA 2NB0A 1N36L 1C4QA 4B08A 1AEXA 5CBEE 2R93H 4RKBA 4KJOA 1SAPA 4QUCA 4IJHA 2RHSB 3ULJA 5C3XA 3CP0A 4C3HH 3EVQA 4JI1L 3QOLA 4GLXA 2BA0A 3U58A 5C0XI 3NTIA 1NJIC 3AB9A 5E4XA 4L6TB 4LW1A 5GAEC 1OXTA 5ISRA 3TDQA 4LF7L 3CCLA 4ZK9B 2N88A 3S2HH 4H44C 5EBCA 4JI7Q 1CZWA 1R9TB 3BDCA 4A3EG 5CYUA 3N6RA 4UY8C 2Y0SB 3J80c 2A6ED 1KDBA 1QVCA 1TS2A 4OGQC 3I70A 2IHEA 4QJFA 2D62A 1WTPA 1VQLA 4Q0FA 1EFID 4DR6L 2EJFC 2ZXRA 4CJ2C 5EGTA 5C0XH 5BN4A 4R8IA 2I07B 3HOZH 3S1QB 1YIJA 4DAVA 1XNRL 1IBLQ 1WTHA 5IYBG 3E9IA 3MXPA 3MEFA 4A3KG 4X3TA 3P20A 1SNPA 4EQNA 1HNZL 1STGA 1RODA 1SRUA 2Z8LA 4DR1Q 2VB2X 2K14A 1STYA 4AYBG 3D6CA 3ZJYC 3DM3A 3RMHA 4B3RL 5CV5A 2WFWA 4JI4Q 4B3SQ 3HOUB 3RN5A 4ODGA 3P7JA 1VCIA 3G4SA 1HNWL 3HG9A 1F77A 3PUXA 2Q8RE 4A3MH 2KJXA 3OYYA 1X3PA 4K0KQ 1QILA 3DWPA 3CPFA 5FJ8H 1YEZA 3I55A 4ZYSA 2SOBA 3JC66 3HZXA 1ILQA 4UAIA 3CF5A 1M90C 4OIKA 1PDQA 3MFGA 2F4VQ 2ZTEA 5I9PA 5FLXE 2XTIA 4RCNA 2ALYB 3AEVA 3Q23A 3OOCA 4IURA 3UDXA 5JJKA 1RKNA 3TP8A 2BDNA 1FJGQ 1KAWA 4K8IA 1AN8A 3I4MG 1BCPF 1W3SA 3TZDA 4A3CG 3D0FA 1JR0D 3S1MB 4ULLA 1VQ8A 1TXYA 1WTWA 1TQOA 3DWQA 1GUTA 2PCFB 1EQRA 3AU7A 2XWJB 3ERSX 1BR9A 3TP6A 3CKIB 2CFMA 4DUYL 3WOFA 1UE1A 4LUVA 2CQOA 4JI2Q 2JE6I 2EYLA 1E22A 3K58A 5M3FH 1Y8PB 3RZOB 4XQJA 1XTDA 1WCMG 2NVQB 1TWCH 1NMGA 1PLFA 4ZCKA 1XPOA 4DXGA 2VS1A 1VS0A 2MP1A 3G71A 2UXBL 1PA6A 2F0QA 2SNMA 4K2LA 2EYHA 5FLMG 4LF6L 1ILPA 1V1OA 3PQIA 1SJED 3H6MA 4ZUIA 3KF8B 1CA6A 1TR5A 5M5WH 1LM0A 1U9RA 4B3ML 3C46A 2Z4HA 1C9OA 1M4VA 3EROA 3A7AB 2KENA 4FXKC 1JICA 4LF9L 3CHBD 1N32Q 3A5ZB 3F8TA 4LF5Q 3MXNA 2AWNA 4RGOS 3GP7A 2JP1A 3FKIH 1EZ6A 1ASZA 4P73A 3J81i 2NVTB 3PO2G 2Z0SA 2B2UC 4A3GB 1QNKA 1SYDA 5K5PA 2PZUA 4PMBA 3T16A 4BBSH 2F4IA 4KY7A 4YY3Q 1IW7D 3NELA 1D5MC 5CV7A 2QEXA 1JB3A 1B8AA 1AZQA 3V96A 3PIOA 1H9SB 2KQ3A 4A3DH 2L5TA 2K4KA 3GTLH 1KDCA 4NXNQ 1MGSA 2M2LA 4GOPA 1GHJA 1GKHA 4YIJA 1BCPB 4A3JH 4J6HA 4KHVA 2E75C 4IO9A 1B3AA 1PYBA 4KJNA 2HUGA 2OEOA 3CXCA 1AE2A 3CCSA 3S16H 5EPKA 2E8GA 1C7YA 1Y1WH 5IWAL 1IYVA 5J22A 3J81E 1I50B 3F1ZA 4BBRG 4BY1H 1JJ2A 3D4WA 1HCZA 1HUNA 2GA4B 1MHWC 2KHSA 4O42A 5IYCH 5LMNQ 4IN3A 2UUAQ 1V1PB 4KI0A 3CQZH 1C48A 2J4XA 4B9XA 2EQSA 4A3BH 1A3UA 4DR3Q 3OWFA 1FR3A 3TP5A 2D0PA 4Y7NB 3S1RH 1UAPA 1WTQA 1QVGA 2G9HD 2Q2HA 3FPPA 3M4OB 3GTMB 2FJ2A 1Y69U 4K2KA 3RD4A 5BN5A 3R3OA 4TRDA 3FEWX 3LGJA 1SMYD 3RLNA 1WOCA 4DKAC 4YHHL 3GTPB 1SYEA 4Z9CB 5EPLA 1PHJA 4P74A 1F2LA 1UUPA 1I6HB 1TWAH 2F0SA 4IOCA 4A75A 3OMCA 3HKSA 4QB4A 1TY2A 1TWFH 4B9WA 4IPHA 1HZAA 4JPBW 4MTKA 1B9NA 3HOXH 4FXDA 3NE5B 1VQDA 1DZ1A 1XPUA 4QF4A 3W3AA 1SE8A 5D65A 1JMCA 1BBWA 3NTHA 1YJNA 1G2TA 1N36Q 1EFWA 3A8KE 4JV5L 5LMNW 4U68A 3K0XA 5A2QL 1LTAD 3NXWA 1GD7A 4QCLA 1PTOF 3CU7A 4OO1H 1SE2A 4JI1Q 1SLJA 2K5HA 3K5MA 1LACA 4HIOA 1EY5A 4ILWA 1U5KA 2OQKA 4ID6A 4IUQA 5C0XG 1MSHA 5IGFA 3HOZG 1LT3D 4R8NA 1JJGA 2CH4A 4NB3A 1S4ZA 3BU2A 4JW0A 4JBWA 1X3QA 3GTGB 1G6PA 3NUCA 2KHJA 3RR5A 5IP9H 2O4XA 4A3IG 1LLRD 4DR6Q 4NMZA 2YTXA 3BYTB 3CRLC 1K3BC 1P8LA 1Q7YC 4DR2L 3EFXD 4WFN3 2EPBA 4PMCA 4A3MG 3I4OA 2A6HC 3MHBA 1YITA 1RCVD 1XNRQ 1CKOA 2WKDA 1HNZQ 2N3SA 1JC7A 4DV4L 1HA6A 3T1HL 1LTLA 3HOYG 1STAA 4B3RQ 3KLSA 2KCCA 1FD7D 2Q2IA 1DD2A 1G6ZA 3SK5A 1UE5A 1Y1VB 3K0YA 5IGGA 2CH4W 1HNWQ 1PRTF 1R9TH 4G7ZC 2H4OA 1XJVA 4DR7L 4C3IG 3CW2C 1T5EA 4EGVA 1DONA 1K8AC 1KD1C 1GUNA 1O7YA 3KLRA 3H3VH 4X62L 1JE5A 1Q12A 4KY5A 3HKZE 2YV5A 1EWCA 2K7VA 2R7FA 4AIMA 3S1QH 1PFBA 1M1KC 4JI0L 4DNRB 3DUZA 4ZQ3A 3R93A 1PTOB 1SDFA 3K5OA 4IQZA 4WORA 2AUJD 1UWVA 1WI5A 3K80C 1VQNA 1Q82C 3U50C 1A2TA 4K6LA 5EJWA 3H15A 1JCKB 3HOUH 4RMFA 4BXXH 3S17B 4CDCC 4OEMB 4XTCS 1NR2A 2IW3A 2PI2A 4DA2A 2BDOA 1JWUD 4DU9A 1CQFA 1NMFA 1PH2A 3CMAA 3KDFB 1I6VC 4C3JB 1W6KA 1F9PA 1YNNC 5I9OA 4RA8A 1GUGA 3GD7A 1VMCA 5I4DA 1CHPD 5D3IB 2NVYH 1KRSA 1EY6A 4DUYQ 2EOTA 2CWAA 2Q8TA 5E1FA 4HCEA 5HURA 1E2WA 1X54A 2HHHL 2YYZA 2GVAA 1VQFA 4OIJA 1TWHB 2L4NA 4H02A 2JA7B 2PZWA 3CCUA 1SYBA 2B63G 3M7NA 2WB1B 2UXBQ 1GJXA 2JA8B 1G8ZD 4CDDC 4LF6Q 1EL0A 4RHSA 1GXDC 4RHRA 2IJ0A 3J7A5 2K5NA 1B3QA 2I5MX 4B3MQ 1D5XC 3SR1A 1ICWA 1JOOA 3C1EA 4L5QA 3CAMA 3ER0A 2JA5B 1F9SA 2VY3A 4XYQA 1PRTB 3D3RA 4LF9Q 1B7YB 4YCWA 4A3DG 2KA7A 4X3KA 2J7ZA 1B2TA 5KNDA 1Q81C 1VF7A 3G48A 4XYOA 2JA9A 4K5VA 1ENFA 4RGTA 1E1OA 1V9PA 1EYAA 3K5NA 1WTVA 1LTID 4ZKBB 1UNSA 3PO3B 2AQ1B 5M3MG 5JEAH 1PV4A 4LF8L 3EIVA 1O7IA 3RZOH 4Y52H 4JYAL 1EQVA 1QUQA 4IUNA 2NVQH 2Q2UA 3P1HA 5GADC 4QIWE 3IKJA 1WVLA 1KNEA 1XYIA 3OW7A 5A35A 4BY1G 2RSOA 2R92B 2BH2A 2EJGC 1R4PB 1AW7A 2F0UA 1Q86C 2F0NA 5IYCG 4K5XA 4OHJA 4X64L 2RHQB 5IYDH 2YTYA 2EYMA 4N8X1 2ASBA 2HQEA 4A3BG 2B2UA 3DLLA 4N9PA 4LF4L 1G291 1N8RC 1ZKOA 4DXFA 4GN3B 2NVTH 1X3EA 1WD0A 4A3GH 5IWAQ 4EQ5A 3VDYA 3TBIB 4FYDA 1SROA 3HS0C 2KUMA 3TP7A 1J9OA 3A55A 1PVOA 1MD2D 3BJUA 2BA1A 3CCVA 4DV3Q 2PZTA 4UP8A 3TREA 3SE0A 1XMQL 3A56A 3OPOA 2ZTDA 4X3SA 1SXTA 2JYOA 1KRTA 3HOXG 3CC7A 1OTCA 1B44D 2E2JB 1A2UA 2A74C 1I4QA 2A19A 1RL2A 4NDXA 1UEBA 1CI3M 1XNQL 4YHHQ 3BVZA 2I46A 2B8FA 1B4OA 5ELEA 1AE3A 3OWEB 1EWIA 5LL6S 2RQXA 1Z9FA 3J80i 3IFTA 1LV9A 4PZ7A 2BH8A 1I94L 4DV2L 4ALPA 4FF3A 4G7HC 1KDAA 2QF7A 4BY7B 1TS4A 4IPDA 3VR3A 4LAAA 1XMOL 2X6LA 1F2ZA 4DAYB 2D2CC 1J8IA 3T56B 2R7ZB 3X3MA 3TS0A 2B39A 3CD6A 4Y7NH 2QGQA 2DN8A 4I65A 3D4RA 4UPAA 1L0YB 1U0LA 3S1NH 3M4OH 4JV5Q 3GTMH 1VQBA 2OTLA 5C4XB 1E1TA 2L11A 1Q8IA 2AHOB 2EXDA 4O0AA 5COYA 5TSSA 4O1NA 4ABNA 4A3LH 4ME3A 4LMQD 3GTPH 1S5CD 1R4QB 1BCPC 1OO9B 1I6HH 1TWGB 3S15B 1FNVA 3B6YA 2WAQE 2AKWB 5CBAE 4DK0A 3I73A 4IUTA 2ICEC 5T1IA 3J80E 1MKHA 2F3WA 1PH4A 1S3OA 2EXZA 4LFCL 3PF5A 3P75A 2R3ZA 1JOKA 3AYHB 2WACA 2CW0C 1EU4A 1L0WA 5JVG3 2K1BA 1YNJC 4AYBE 1A63A 3G7LA 1WJJA 4CDFC 3FRPB 4A3EB 2WAQG 3CRKC 4MTNA 1HNXL 4DR2Q 2Y0SG 4HJ9A 1PH1A 2NN6G 4I7ZC 3AFQA 3PSIA 1STNA 4CJ0B 4AQYL 3I91A 1N33L 2KEDA 4DV4Q 4JI6L 3T1HQ 2ICIA 4PNYA 3JAML 5CV6A 1JORA 1TKWB 2K04A 4LJZC 4DK1A 2HIXA 3I4NG 1NNXA 4A3KB 4FNFA 4OXPA 4PG3A 3SK6A 2RCFA 2HDMA 2XNAC 4J1MA 3GTGH 1LABA 4DR7Q 1LTTD 2LKVA 3NENA 4AYBB 1SE4A 2VQEL 4B3TL 3FPUB 3NWSA 1YI2A 4ZRZA 1CKNA 1NBWA 2L0CA 4X62Q 3QWNA 2N55A 3CCRA 4BXXG 3WWVA 1M8AA 2ES2A 3QJYA 1SNOA 4JI0Q 1EUJA 2OQ0A 4HIMA 2BCOA 3E3XA 2IPKD 2A68C 1L2FA 1J6QA 1U4PA 4ZUJA 5JPMC 1EIGA 3QIAA 3DEOA 1IL8A 3U9OA 1GVPA 4KN7C 4FXGC 2EYOA 2PW5A 1YHQA 1ET6A 4PV1C 5EPJA 4C2MB 4GLVB 3MXGA 1Y1VH 1VQHA 5C4ZA 1K83B 2EJMA 1K3RA 5HGQA 1TS3A 4F87A 4CJ1B 3J81j 4KTAA 2EVBA 3IFDA 3IL8A 3LNNA 1G51A 2KCNA 2B2YC 4GLAC 4OELB 5CMDA 3I4MB 3VA7A 1JJCB 1OXUA 2JXMB 1ZEQX 4G57A 3ZYYX 1HZCA 5I2YA 4IPCA 4K5WA 5E7NA 3UDGA 2HHHQ 5GQOA 3M4YA 1BF4A 1PTOH 3I4LA 2F1MA 3VA5A 5IT9L 2A6HD 1VQMA 1I4HA 1NTGA 3A54A 3CPWA 1SNQA 1VQGA 5JEAG 1LTSD 2VUMB 3PIO3 1WCMB 3SVMA 4XT3B 1V1QA 4DGZA 2VW9A 3Q0AA 3S17H 1VQ9A 5KYLA 2XN9C 1WFQA 3CC4A 3I2ZA 3R8BA 2F0FA 1RF2D 3IAYA 4C3JH 2EZVA 2VXWA 2N78A 1KQSA 2Z9HA 5IE8A 4OX9L 3EA6A 2DNCA 3U4VA 1SE3A 3MAQA 2K5DA 5IYDG 4JK1C 5I6YA 2ZT9C 4LF8Q 3TEHB 5JEAJ 2FMCA 1G91A 2I0QA 4JYAQ 3T1YL 1PZKD 3X3NA 5JAVA 2F0DA 1KNAA 1TWHH 3MVVA 2JA7H 2P5ZX 2NTTA 3PO2B 4EQOA 1I3QB 1STHA 4A3GG 3TRZA 1VQEA 2ID0A 4GS3A 2JA8H 5M5XB 1SFOH 4FO2A 1AZPA 4R4QA 1EY8A 4BA1I 2KVMA 1HR0L 4KV6A 1TVXA 4L63B 2UU9L 4I7AA 2MO0A 2IWHA 3PIP3 2O5IC 4X64Q 1MI2A 3C1FA 4Q5VA 2JA5H 4JI5L 5JOBA 3Q24A 1HTPA 1PXUA 1VF5C 1E2VA 4LF4Q 3FP9A 1JWMD 1YBYA 1YNND 4DPGA 5AFWA 5C44B 4G7OC 3HOVB 1LYLA 1E24A 4GNXB 3PO3H 1VQAA 1Q1BA 2E2HB 1Z7TA 2B2VC 1CA5A 3DMUA 1HA5A 3CCEA 2JA6B 2JK8A 1ENCA 3VR2A 4KY6A 3OTOL 3UDFA 1SNCA 1G2SA 2E2DC 2ZJPA 1FGBD 3JAMc 3UE1A 4DAPA 4BBRB 5CGKA 3FDTA 3ICEA 1HRJA 1XMQQ 2F0IA 2R92H 3S14B 1NY4A 3E5SA 3R2IA 1Q1EA 3K7AB 3C3LA 4A3FB 3UE0A 3PIPA 4HJ5A 1SYFA 3HOWG 2O2LD 2E2IB 1I4RA 4FF4A 4LFBQ 3G6JB 5HGTA 1XNQQ 1B50A 3S9WA 1CKMA 4ME5A 4HIDA 2CKZB 2EDGA 3MC0B 1PRTC 4DV6L 1ASYA 1SNDA 2R93G 2PI2E 2RKSA 3OW2A 3A5UA 2F03A 1A8VA 4OO1I 1I94Q 4DV2Q 4L5SA 1DYQA 2JEAI 5NUCA 3U9SA 4FF2A 4C3HG 4DR4L 4LFAL 2WIIB 4DV0L 1A0IA 1L1OB 5IGCA 1XMOQ 3GTOB 1VQCA 4A4IA 2EYPA 2V4DA 1XWEA 5LMUQ 1B70B 2E2JH 1RJTA 2XSCA 3CC2A 2K03A 3H0GH 4X65L 3R2TA 1D5ZC 4KN4C 5EKIA 5DEHA 4GKKL 2HCIA 3MXUA 2E74C 1HQMC 3GTQH 5IGBA 3M3YB 1Y14B 2F0OA 1Y8NB 2F0MA 4IFDI 1KTKA 4N9TA 1GO3E 4EX5A 2LY7A 5D14A 4CHTB 3ULPA 2OWOA 4LF7Q 2VL6A 5IT9c 4LFCQ 3J7ZC 3A0JA 4BY7H 5CV9A 1QB5D 3LWEA 5FO9B 2YTVA 3CCQA 4DUZL 3HOZB 5M5XH 2R7ZH 4R4CA 3A8JE 2F0JA 3Q6SA 1CUKA 1SMXA 4KKUA 1EEID 4NP5A 2CQAA 3QR8A 1A62A 1EY0A 1STEA 2UXCL 4BWGB 1EYGA 5C4XH 1XPRA 3D8GA 3EQLC 4IFDH 5C0XJ 4X6AH 2DUDA 5JJIA 3H3VI 5C3EB 4A3IB 2A1AA 1N33Q 4AQYQ 2K52A 4RH6A 1TWGH 3S15H 2KOLA 3N52A 4JI6Q 4NKLA 1IKLA 5FJ8G 3KJPA 2K28A 1II3A 3VYRA 1EOTA 4WJWA 2HIVA 3QOJA 1K0RA 1OXXK 4OWWB 3HOYB 2VQEQ 4B3TQ 2NZHA 1KHIA 1N9WA 3BZCA 4TVAB 4QY7A 1QCBD 1QUQB 4N8FA 1K73C 3T13A 3J7AF 2F0WA 3LWUA 1STBA 4A3EH 1X56A 4C3IB 4JOIC 1DJRD 1CQVA 5JPNC 1S5FD 5ELDA 1K0SA 4IUVA 3W1GA 1VQJA 4YCUA 1KLUD 1BBXC 1X55A 1S5ED 4U673 4GN4B 1A15A 1SR3A 3KBGA 3T51B 2F0HA 5D3DA 3D4DA 1BCPD 3M4PA 5KEEA 5KNBA 1IBKL 4KHPL 2RVLA 2L9HA 4QGUA 5IYBH 2DGYA 5M3FG 4A3KH 1EY7A 1ESRA 4K14A 5FO8B 1IHZA 4JI3L 3F2CA 3PF4A 1UE6A 1FNUA 3KF6A 3SGIA 3HRZC 3OHXC 1B1ZA 3RZDB 4R4OA 3NSWA 2CW0D 3PCOB 1YNJD 3HKZB 4L5TA 1BNZA 2Q2TA 1GUSA 1VQ7A 3GTKB 1ET9A 2F3IA 3H3VC 4X66L 3D31A 4M8AA 4L8JA 4LUOA 4FP5D 4UDUC 1E3PA 2IT1A 2CWPA 2QW7A 4P72A 2Z6KC 2CCZA 3FKIG 1BDOA 2G9DA 1U4RA 3V05A 2EE1A 4L5RC 3A7LA 1FVIA 4C2MH 3KLWA 2L12A 5BR8L 4BBSG 2B63B 5KNCA 2B2YA 1SN8A 5A2QE 1I4PA 2B29A 3ITPA 2WB1G 3ERQA 5J3BA 3S1MH 3M9BA 2ZTCA 2A73B 5CORA 1IYUA 3F2UA 3I4MH 2BE5C 4DF7A 1KC8C 1JOQA 4OX9Q 3NBHA 2AQ2B 2N8NA 1ONLA 3PUZA 1PZID 2SDFA 1Z47A 1O7LA 3HEJA 1E7ZA 3S24A 5C6AA 4RCOA 1RHPA 5M9OA 1SYGA 2LFNA 4A3JG 3T1YQ 1EOVA 3K7UC 3CMEA 2QKIC 4RGMA 1IL2A 1B9MA 2K6AA 2A69C 2A68D 3DXJC 5M3MB 2QILA 3OMGA 3H91A 1Y1WG 2IX1A 2VUMH 1IKMA 4G4KA 2B2WC 1HR0Q 2GVBA 1PH7A 4R9WA 1ICFB 1XX8A 2UU9Q 2NVXB 4UP7A 2D9UA 1PH3A 2Z6BA 4RFBA 2EIFA 1HHVA 1FL0A 4JI5Q 2UXDL 5FLMH 4TKOB 2RDGA 2MQHA 1KXLA 4IPGA 5IGEA 4A93B 3MA2B 3NHHA 1ZYRC 2XRSD 1RTNA 1PH6A 2H1EA 3GTJB 1WD1A 3BYYB 1VQOA 1NAPA 4TQUS 3OTOQ 3PUYA 2WKCA 4HN7A 4QIWB 4YCVA 1IXRA 1I3QH 3O13A 3DWAA 2JN4A 2PPBC 1CFMA 2EY2A 4MZ9A 1LT5D 5ELOA 3ONAB 2PMZE 2F0TA 3BVGA 2DNEA 2HQLA 2ZXPA 4XT1B 5FOBB 1MSGA 1AH9A 1PH9A 3L7ZC 3NEMA 4TSSA 4LK1C 1EQTA 3L9AX 1F2YA 2UUBL 4CBVA 4F7XA 1BQQT 3SK8A 3K57A 2DJGC 1HR0W 2B2VA 3D6WA 3KBXA 5CR3A 5C44H 2KBNA 3HOVH 3H0GG 2FHTA 4XIGS 4JBMA 4DV6Q 3NPPA 1J5EL 2PQAA 3TZUA 5FLXL 2E2HH 2HCCA 3MWYW 5K36H 2C9OA 5J1ZA 3MZ5A 1I50H 2JA6H 2L1BA 4FDBA 4J8QA 5AJ3L 4OO1G 4DR4Q 3MTSA 2K32A 3ND8A 4LFAQ 3STBC 4DV0Q 5LL6X 2PW7A 5FKAC 2DY7A 3A74A 2BOSA 4RGNA 3S14H 1S5DD 1PFSA 1FGUA 3K7AH 3TS2A 2RBMA 4A3FH 2NUCA 4PZ8A 1HQRD 1ZXTA 2EY5A 5GAGC 1TY0A 1PFMA 4X65Q 1YHAA 2FXQA 4XXEA 4F88A 2E2IH 2RDFA 4F8MA 1I4XA 2R7ZG 2E5LL 3I90A 1K28A 5G3LD 4KD4A 2OCEA 4HEDA 1X3GA 5IP9G 1VQIA 4CKBA 3NBIA 2NYZD 1GUOA 3NQTA 2FINB 2EY6A 4GN5A 4IFDG 2Y0SE 4C1NK 4GNXC 1H9KA 5JVH3 2K01A 1UE7A 4IUUA 2FMMA 1PFNA 4DUZQ 3GTOH 2QA4A 3HGBA 3H09A 5ELFA 4JG2A 1UEAB 1GHKA 4QMGA 2EYJA 3DEPA 2C35B 2CVRA 2UXCQ 4PQXA 3S2DB 3NTKA 1GM5A 4R1JA 1QOHA 3VYSA 2D5DA 3WDNA 4IFDJ 4HR7B 1EU3A 3M3YH 2K50A 1LO5D 2IX3A 2KECA 2PQEA 2WAQB 3NK9A 5HY6A 1PRTD 4JVZA 2IL8A 2XGTA 3TSSA 5EAYA 5DLQE 2ZM6L 5I2XA 2NZ1D 3MXNB 1H9JA 4JBJA 4DV1L 4RAUC 2PO4A 3M85A 1TT2A 5C5MA 1JWSD 2YU9B 4POFA 3I4NB 1TIID 2SNSA 1L1OC 1VMPA 4APVA 1QJOA 3K59A 3HOUG 2O5JC 1QVFA 3A8IE 3GDEA 3BDLA 2QDBA 2VB3X 2MGSA 2R6GA 3RLOA 1ENAA 2IHFA 1X6OA 1EQQA 1X9NA 3J81L 5C4JB 1V43A 1SYCA 5C3EH 4A3IH 2LXKA 3VYTA 4DR5L 3QB3A 1GUWA 1O7ZA 4MIUA 1F2MA 5ELBA 2TMPA 4GOPB 2WP8J 4KHPQ 1IBKQ 3RNUA 1VQ4A 5DAUA 1S72A 2R61A 3W1BA 4A76A 1A6XA 5ELCA 4KK7A 4P2CB 2NVYB 4JI3Q 2VQFL 4DAYA 1LTGD 3AQQA 3DM1A 3HOYH 2UUCL 1CSPA 5KYIA 3RLFA 4JOIA 1IBML 1SEBD 4EQPA 1DM0B 5EKKA 1WTXA 1SSOA 4C3IH 1HZ9A 1HTLD 1FYCA 4GZYC 2X6GA 3VYUA 4EVOA 4DV5L 1MJEA 4X66Q 2PNRC 2OXPA 1EWHA 2XVSA 3EJIA 5EKLA 1BVSA 2VZAA 3VR6A 4KKTA 5IP7H 2GN5A 5FLXc 4K6DA 1LTRD 3PUVA 5BN3A 4GKJL 1EEFD 3RN2A 3FVQA 1H95A 2RF4A 1BO0A 2AQ3B 2WINB 4PMWA 1MIUA 5BR8Q 3OIQA 1KAAA 2I5LX 3FHWA 3T53B 4K8JA 4X3UA 4V190 1CTMA 2F0KA 2K05A 3RZDH 4HMIA 2VUMG 3J7AV 3E0JA 1H9RA 4NW2A 3EN2A 1CM9A 1ESFA 3JAMi 3GTKH 1C0AA 4OWXB 3C2PA 1SJHD 2Z6KA 4CGYB 1O80A 5FK9C 4BS9A 3BZKA 2ATWA 1TS5A 3K5LA 3BS1A 3L2PA 3KUPA 4HIKA 2AWOA 2JSOA 2PYKA 5E3FA 4DNTB 3G6EA 1PTOC 4XQQA 1BUVT 2VNUD 4JI8L 2F52A 1EIHA 4IZ8A 2B63H 1BOSA 1RD9D 4DN4M 4HSPA 1VDZA 2UXDQ 5F2DA 2M00A 1K8MA 3HFZB 4DV7L 2B2TC 4FVMA 4QL5A 1V8QA 1PH8A 5M5YB 1PZJD 5GAHC 2KCMA 2B8GA 5H1SE 4YWLA 2ENBA 3K6OA 3JAME 4AH6A 3OSOA 2QDLA 2R7DA 1A3VA 4KLKA 2B2WA 5C44G 1Q3LA 1EY4A 3HOVG 1QE6A 2TSSA 5DNFA 5M3MH 5K36G 3BG3A 1Z6HA 3KOJA 1EIFA 1CT1D 2Z1CA 2AMCB 2JA6G 2F0LA 4FF1A 2NVXH 1JQYD 2UUBQ 2L55A 3AMUA 2NTSA 1MJCA 4A93H 2HDLA 4A3FG 4DV3L 3HOWB 1VQ5A 1DGSA 2A6EC 2BE5D 3OIPA 4RWSC 2D0OA 1J5EQ 1AFPA 1C8CA 3IRBA 3J81c 1KABA 4NXML 3GTJH 1VQKA 4HAEA 2A5HA 3L3OC 4A3LG 5AJ3Q 5I6WA 2V1CC 3S1NB 5C3WA 1WYDA 3MFYA 2QEJC 2NBFA 2R93B 1N34L 1PYSB 1B53A 3KJOA 2A69D 4O2DA 2F0EA 2JJQA 3KF8A 4KKSA 3I3CA 3SDZA 4C3HB 4HJ7A 3L0OA 1QZHA 2OF1A 5JJZA 5EQ0A 2F0VA 1IYJB 3W2DA 4WJ4A 1LT4D 1F9RA 2IY5B 2E5LQ 4JCVE 5DM63 1YJ9A 3E9HA 3QO2A 3TN2A 2RSNA 5IT9E 3U4ZA 2DJFC 3S2HB 1HPCA 2K33A 4LUZA 4RG1A 3KF6B 2MJ8A 1ZYRD 5JJLA 4RKLA 3LX0A 3DHQA 2L15A 4DK3C 4LWCA 5C5LA 1D8LA 3BVMA 4OONA 4DFAA 3I56A 2K75A 3TMEA 1H9SA 2OT2A 4H0LC 1HXYD 1LTBD 4P71A 1D6EC 4XDXA 2K5QA 1S40A 4YWKA 2EY1A 5G3LF 5LHY1 3GQBA 2G5DA 1NE3A 5E4WC 1HNXQ 2ZJRA 2K5WA 3WOEA 1U4LA 4JC0A 2CHBD 5CC4A 2MUYA 3F2DA 3E6ZX 4GNXA 1T9HA 3KYHC 1CZGA 1HJPA 4JI7L 5KIXA 4QQBX 1U4MA 3GO5A 2WV6D 1CSQA 1ML0D 2QCPX 5IIFA 1D7QA 2LMCB 4A3MB 5C3EG 1L0XB 2ZM6Q 3NBHB 4OL7A 4POGA 4DV1Q 2NN6I 1V1PA 1NUCA 4IJLA 4QUFA 1QNUA 1K9MC 4MN3A 1EY9A 3STBD 1YHBA 3QG1A 4P75A 5GROA 1IBLL 4OWTB 3GV3A 1VQ6A 3MEHA 4DNIA 2F0GA 1Y1VG 3S2DH 3J7YW 1S5BD 2MFIA 2DY8A 4DR1L 1WTOA 1T5XD 5CV8A 4KHZA 2Q8IB 4JI4L 1RDPD 4B3SL 1SNMA 3W5OA 4DR5Q 3VR5A 1DXMA 3KLSX 3M7GA 2E76C 3KK7A 2RA4A 4WJ3M 1MBYA 2NN6H 2LSSA 4DAMA 5EBDA 1HUMA 1QG7A 1H9MA 1X3FA 1JB7A 2XWBB 5FO7B 1HH2P 1EZ8A 4K0KL 1KLGD 3BZDB 3BDOA 5IP7G 3SXHA 1L1OA 2VQFQ 2XRQD 2I5HA 2X69A 4YWMA 4HJ8A 2F0PA 4DK6C 2SEBD 2UUCQ 2YU9H 2JEBI 3SHLA 1K8OA 1IZ6A 5M3FB 5J39A 3I4NH 1IW7C 4HTHA 1IBMQ 1JT8A 4UP9A 3T4AC 1VQPA 1TWCB 2F4VL 1DOKA 2HD3A 2IX0A 4DV5Q 2WB1E 3K8AA 3FMCA 2N49A 4J15A 4M1UB 5C4JH 2EYFA 4IUPA 4C3JG 1FJGL 5M5WB 1D1KA 3HKZG 1K8GA 4HCSA 3NWTA 2K5VA 4JBKA 5IODA 4GKJQ 1RTOA 3V2TA 4HMJA 1WTRA 4NPSA 1OXSC 1CK1A 3TQYA 3FKIB 1K83H 2JA7G 1Q8KA 3E0EA 2C5CA 2PQAB 4JI2L 1KIXA 1BBUA 2NZOA 2M9VA 2JA8G 1Y8OB 1YZ6A 2NWGA 4BBSB 1EYCA 3UI2A 3UDIA 3RUZA 1E0BA 3EBEA 3ND9A 3K81C 4A3CH 4MHEA 4ZLTF 2Z4IA 4C1NI 1NSNS 4CKCA 1SFOB 4H7BA 2JA5G 2JQOA 4A3DB 4HSVA 3J80L 1W6JA 4HJAA 1QWYA 3I7FA 1QZGA 3GTLB 2PNHA 1XTCD 2MNAA 1YJWA 2H5XA 4V0BA 1PMRA 3URYA 2LS01 3PUWA 1SBBB 1SMYC 3VR4A 3I72A 3PO3G 4A3JB 1N32L 4WRDA 4KMUC 1KL9A 1WCMH 4LF5L 1D1IA 1CHQD 4JI8Q 4GOPC 2MPMA 2F3VA 1JE4A 1RIPA 1YNXA 3S16B 1EYDA 1FNWA 1Y1WB 3PV0A 2KHIA 4R4TA 4BY1B 5L37A 3NP8A 1DCZA 4DV7Q 4MNOA 2R92G 2ZJQA 3GV6A 1HFGA 4YY3L 4IALA 2LXJA 1PYWD 4UHVA 3CQZB 3SEBA 3KFUA 1A3TA 3ULLA 4A3BB 1LUZA 3S1RB 4C56C 4A93G 1NR4A 4NXNL 5KRUA 2MHVA 4PZ6A 4ZAIA 5IY0A 3PO2H 2ZXOA 3H94A 3M4QA 1O78A 3F2BA 3Q8DA 1XXGA 4S3SA 1HFNA 2J0TD 2RDHA 2B2TA 1TWAB 3NQIA 3KDFA 1TWFB 3HOXB 4LNQA 4KD3A 5M5YH 5LMNL 2A8VA 1GOZA 2UUAL 1E2ZA 2OTJA 3PGZA 3SK4A 3Q22A 1OXVA 1P16A 1X65A 2RCNA 2MO1A 2HT1A 4NXMQ 1TU2B 5IOCA 5CV4A 3PMFA 5DM73 4DR3L 1BKBA 4IOAA 1LT6D 1CKNB 1AP0A 3H0GB 2KEEA 1X32A 5ELNA 1N34Q 2PMZB 5T1GA 4LFBL 4BA2I 4H13C 5KGUA 2FFKB 1NCVA 4BBRH 2XIWA 3GTQB 5IGDA 4CKEA 2B3GA 1PTOD 3HP3A 1DOMA 2AUKA 1PH5A 4XQNA 4BY7G 3AFPA 4E6IA 4CDEC 3I8ZA 4GKKQ
chains in the Genus database with same CATH topology
1BXTA 5C4HA 4ZKCB 1DOLA 1Q90A 1F9QA 1I4GA 1D2BA 2NB0A 1C4QA 4B08A 1AEXA 5CBEE 4RKBA 4KJOA 1SAPA 4QUCA 5C3XA 3EVQA 3QOLA 2BA0A 5C0XI 3NTIA 3AB9A 5E4XA 4L6TB 1OXTA 5ISRA 3TDQA 4ZK9B 2N88A 4H44C 5EBCA 1CZWA 1R9TB 3BDCA 5CYUA 3N6RA 2Y0SB 2A6ED 1KDBA 1TS2A 4OGQC 3I70A 2D62A 1WTPA 4Q0FA 1EFID 2EJFC 2ZXRA 4CJ2C 5EGTA 5C0XH 5BN4A 4R8IA 2I07B 3S1QB 4DAVA 3MXPA 4X3TA 3P20A 1SNPA 4EQNA 1STGA 1RODA 2Z8LA 2VB2X 1STYA 3D6CA 3RMHA 5CV5A 3HOUB 4ODGA 3P7JA 1VCIA 3HG9A 1F77A 3PUXA 2Q8RE 2KJXA 1X3PA 1QILA 3DWPA 4ZYSA 2SOBA 3HZXA 1ILQA 4UAIA 4OIKA 1PDQA 3MFGA 5I9PA 5FLXE 4RCNA 3Q23A 3OOCA 4IURA 1RKNA 3TP8A 2BDNA 4K8IA 1AN8A 1BCPF 3TZDA 1JR0D 3S1MB 4ULLA 1WTWA 1TQOA 3DWQA 1GUTA 2PCFB 3AU7A 2XWJB 1BR9A 3TP6A 3CKIB 3WOFA 2JE6I 2EYLA 3K58A 1Y8PB 3RZOB 4XQJA 2NVQB 1PLFA 4DXGA 2MP1A 2F0QA 2SNMA 4K2LA 2EYHA 1ILPA 1V1OA 4ZUIA 1SJED 3H6MA 1CA6A 1TR5A 1U9RA 3C46A 2Z4HA 1M4VA 3EROA 3A7AB 4FXKC 1JICA 3CHBD 3MXNA 2AWNA 4RGOS 3GP7A 2JP1A 1EZ6A 2NVTB 2B2UC 4A3GB 1QNKA 1SYDA 5K5PA 2PZUA 4PMBA 3T16A 2F4IA 4KY7A 1IW7D 1D5MC 5CV7A 1JB3A 1AZQA 3V96A 1H9SB 2KQ3A 2L5TA 1KDCA 1MGSA 2M2LA 1GHJA 4YIJA 1BCPB 4J6HA 4KHVA 2E75C 1B3AA 4KJNA 2HUGA 2OEOA 5EPKA 1IYVA 5J22A 3J81E 1I50B 3D4WA 1HCZA 1HUNA 2GA4B 2KHSA 4O42A 4IN3A 1V1PB 4KI0A 1C48A 2J4XA 4B9XA 1A3UA 3OWFA 1FR3A 3TP5A 4Y7NB 1UAPA 1WTQA 2G9HD 3FPPA 3M4OB 3GTMB 2FJ2A 1Y69U 4K2KA 3RD4A 5BN5A 3R3OA 4TRDA 3FEWX 1SMYD 3GTPB 1SYEA 4Z9CB 5EPLA 1F2LA 1UUPA 1I6HB 2F0SA 3OMCA 4QB4A 1TY2A 4B9WA 1B9NA 4FXDA 3NE5B 1DZ1A 4QF4A 3W3AA 5D65A 3NTHA 1G2TA 3A8KE 4U68A 5A2QL 1LTAD 3NXWA 4QCLA 1PTOF 3CU7A 4OO1H 1SE2A 3K5MA 1LACA 1EY5A 4ILWA 4ID6A 4IUQA 5C0XG 1MSHA 5IGFA 1LT3D 4R8NA 1S4ZA 4JBWA 1X3QA 3GTGB 3NUCA 2O4XA 1LLRD 4NMZA 3BYTB 3CRLC 3EFXD 4WFN3 2EPBA 4PMCA 2A6HC 3MHBA 1RCVD 2WKDA 1JC7A 1HA6A 1STAA 3KLSA 2KCCA 1FD7D 1DD2A 1G6ZA 3SK5A 1Y1VB 3K0YA 5IGGA 1PRTF 4G7ZC 2H4OA 4C3IG 1T5EA 4EGVA 1DONA 1GUNA 1O7YA 3KLRA 1Q12A 4KY5A 1EWCA 2K7VA 1PFBA 4DNRB 3DUZA 4ZQ3A 3R93A 1PTOB 1SDFA 3K5OA 4IQZA 4WORA 2AUJD 1A2TA 4K6LA 5EJWA 1JCKB 3S17B 4XTCS 1NR2A 2IW3A 4DA2A 2BDOA 1JWUD 4DU9A 1CQFA 1I6VC 4C3JB 1W6KA 1F9PA 1YNNC 5I9OA 4RA8A 1GUGA 3GD7A 1VMCA 5I4DA 1CHPD 5D3IB 1EY6A 2EOTA 2Q8TA 5E1FA 4HCEA 5HURA 1E2WA 2YYZA 4OIJA 1TWHB 2L4NA 2JA7B 2PZWA 1SYBA 3M7NA 2WB1B 1GJXA 2JA8B 1G8ZD 1EL0A 4RHSA 1GXDC 4RHRA 2IJ0A 1D5XC 3SR1A 1ICWA 1JOOA 3C1EA 2JA5B 1F9SA 4XYQA 1PRTB 3D3RA 2KA7A 4X3KA 2J7ZA 1B2TA 5KNDA 1VF7A 4XYOA 4K5VA 1ENFA 4RGTA 1EYAA 3K5NA 1WTVA 1LTID 4ZKBB 1UNSA 3PO3B 2AQ1B 5JEAH 1EQVA 4IUNA 3P1HA 3IKJA 1WVLA 1KNEA 1XYIA 3OW7A 5A35A 2RSOA 2R92B 2EJGC 1R4PB 1AW7A 2F0UA 2F0NA 4K5XA 4OHJA 2EYMA 2HQEA 2B2UA 4N9PA 1G291 1ZKOA 4DXFA 1WD0A 3TBIB 4FYDA 3HS0C 2KUMA 3TP7A 1J9OA 3A55A 1MD2D 2BA1A 2PZTA 3SE0A 3A56A 3OPOA 4X3SA 1SXTA 2JYOA 1B44D 2E2JB 1A2UA 2A74C 1I4QA 4NDXA 1CI3M 3BVZA 2I46A 2B8FA 1B4OA 5ELEA 3OWEB 5LL6S 2RQXA 3IFTA 1LV9A 4FF3A 4G7HC 1KDAA 2QF7A 4BY7B 1TS4A 3VR3A 4LAAA 2X6LA 1F2ZA 2D2CC 1J8IA 3T56B 2R7ZB 3X3MA 2B39A 2DN8A 4I65A 3D4RA 1L0YB 5C4XB 2L11A 1Q8IA 5COYA 5TSSA 4O1NA 4ABNA 4LMQD 1S5CD 1R4QB 1BCPC 1OO9B 1TWGB 3S15B 1FNVA 5CBAE 4DK0A 3I73A 4IUTA 2ICEC 5T1IA 3J80E 2F3WA 2EXZA 3P75A 2R3ZA 1JOKA 2WACA 2CW0C 1EU4A 5JVG3 2K1BA 1YNJC 3G7LA 3FRPB 4A3EB 3CRKC 2NN6G 4I7ZC 1STNA 4CJ0B 3I91A 2KEDA 2ICIA 4PNYA 3JAML 5CV6A 1JORA 1TKWB 2K04A 4LJZC 4DK1A 4A3KB 4FNFA 3SK6A 2HDMA 2XNAC 4J1MA 1LABA 1LTTD 2LKVA 4AYBB 1SE4A 3FPUB 3NWSA 4ZRZA 2L0CA 3QWNA 2N55A 1M8AA 3QJYA 1SNOA 2BCOA 2IPKD 2A68C 1U4PA 4ZUJA 5JPMC 1EIGA 3DEOA 3QIAA 1IL8A 3U9OA 4KN7C 4FXGC 2EYOA 2PW5A 1ET6A 4PV1C 5EPJA 4C2MB 3MXGA 5C4ZA 1K83B 2EJMA 1TS3A 4F87A 4CJ1B 4KTAA 2EVBA 3IFDA 3IL8A 3LNNA 2KCNA 2B2YC 3I4MB 5CMDA 3VA7A 1OXUA 2JXMB 1ZEQX 4G57A 3ZYYX 5I2YA 4K5WA 3M4YA 1BF4A 1PTOH 3I4LA 2F1MA 3VA5A 5IT9L 2A6HD 1I4HA 3A54A 1SNQA 5JEAG 1LTSD 2VUMB 3PIO3 1WCMB 3SVMA 4XT3B 4DGZA 3Q0AA 5KYLA 2XN9C 3R8BA 2F0FA 1RF2D 3IAYA 2EZVA 2VXWA 3EA6A 2DNCA 1SE3A 3MAQA 2K5DA 4JK1C 5I6YA 2ZT9C 5JEAJ 2FMCA 1G91A 1PZKD 3X3NA 5JAVA 2F0DA 1KNAA 3MVVA 2NTTA 3PO2B 4EQOA 1I3QB 1STHA 2ID0A 5M5XB 4FO2A 1AZPA 1EY8A 4BA1I 2KVMA 4KV6A 1TVXA 4L63B 2IWHA 3PIP3 2O5IC 1MI2A 3C1FA 4Q5VA 5JOBA 3Q24A 1HTPA 1PXUA 1VF5C 1E2VA 1JWMD 1YNND 5AFWA 5C44B 4G7OC 3HOVB 1Q1BA 2E2HB 1Z7TA 2B2VC 1CA5A 3DMUA 1HA5A 2JA6B 1ENCA 3VR2A 4KY6A 1SNCA 1G2SA 2E2DC 1FGBD 4DAPA 4BBRB 5CGKA 3FDTA 1HRJA 2F0IA 3S14B 3E5SA 3R2IA 1Q1EA 3K7AB 3C3LA 4A3FB 1SYFA 2O2LD 2E2IB 1I4RA 4FF4A 3G6JB 5HGTA 1B50A 3S9WA 4ME5A 2EDGA 3MC0B 1PRTC 1SNDA 2RKSA 2F03A 4OO1I 1DYQA 2JEAI 5NUCA 3U9SA 4FF2A 4C3HG 2WIIB 5IGCA 3GTOB 2EYPA 2V4DA 1XWEA 1RJTA 2XSCA 2K03A 3R2TA 1D5ZC 4KN4C 5EKIA 5DEHA 2HCIA 3MXUA 2E74C 1HQMC 5IGBA 3M3YB 2F0OA 1Y8NB 2F0MA 4IFDI 1KTKA 4N9TA 2LY7A 5D14A 4CHTB 5CV9A 1QB5D 3LWEA 5FO9B 3HOZB 3A8JE 2F0JA 3Q6SA 4KKUA 1EEID 4NP5A 2CQAA 1STEA 1EY0A 4BWGB 3D8GA 3EQLC 4IFDH 5C0XJ 5C3EB 4A3IB 4RH6A 2KOLA 3N52A 4NKLA 1IKLA 2K28A 1II3A 3VYRA 1EOTA 4WJWA 3QOJA 1OXXK 3HOYB 1QCBD 3T13A 3J7AF 2F0WA 3LWUA 1STBA 4C3IB 1DJRD 1CQVA 5JPNC 1S5FD 5ELDA 4IUVA 1KLUD 1BBXC 1S5ED 4U673 1A15A 3KBGA 3T51B 2F0HA 5D3DA 3D4DA 1BCPD 5KNBA 5KEEA 2RVLA 2L9HA 1EY7A 1ESRA 4K14A 5FO8B 1IHZA 1FNUA 3HRZC 3OHXC 1B1ZA 3RZDB 3NSWA 2CW0D 1YNJD 3HKZB 1BNZA 1GUSA 3GTKB 1ET9A 3H3VC 3D31A 4M8AA 4L8JA 4FP5D 4UDUC 2IT1A 1BDOA 2G9DA 1U4RA 3V05A 2EE1A 3A7LA 2L12A 2B63B 5KNCA 2B2YA 5A2QE 1I4PA 3ERQA 3ITPA 2A73B 5CORA 1IYUA 3F2UA 2BE5C 4DF7A 1JOQA 3NBHA 2AQ2B 1ONLA 1PZID 3PUZA 2SDFA 1Z47A 1O7LA 3HEJA 5C6AA 4RCOA 1RHPA 5M9OA 1SYGA 2LFNA 2QKIC 4RGMA 1B9MA 2K6AA 2A69C 2A68D 3DXJC 5M3MB 2QILA 3OMGA 3H91A 2IX1A 1IKMA 4G4KA 2B2WC 4R9WA 1XX8A 2NVXB 2D9UA 4RFBA 1HHVA 4TKOB 2RDGA 5IGEA 4A93B 3MA2B 3NHHA 1ZYRC 2XRSD 1RTNA 2H1EA 3GTJB 1WD1A 3BYYB 1NAPA 4TQUS 3PUYA 2WKCA 4HN7A 4QIWB 3O13A 3DWAA 2PPBC 1CFMA 2EY2A 1LT5D 5FOBB 3ONAB 4XT1B 2F0TA 3BVGA 2DNEA 2ZXPA 1MSGA 3L7ZC 4TSSA 4LK1C 1EQTA 3L9AX 1F2YA 4CBVA 4F7XA 1BQQT 3SK8A 3K57A 2B2VA 3D6WA 3KBXA 5CR3A 2FHTA 4XIGS 3NPPA 3TZUA 5FLXL 2HCCA 3MWYW 5K36H 2C9OA 5J1ZA 3MZ5A 2L1BA 4J8QA 4OO1G 3MTSA 2K32A 3ND8A 5LL6X 2PW7A 5FKAC 2DY7A 2BOSA 4RGNA 1S5DD 2RBMA 2NUCA 1HQRD 1ZXTA 2EY5A 1TY0A 1PFMA 4XXEA 4F88A 2RDFA 4F8MA 1I4XA 3I90A 5G3LD 4KD4A 4HEDA 4CKBA 3NBIA 2NYZD 1GUOA 3NQTA 2FINB 2EY6A 4IFDG 4C1NK 1H9KA 5JVH3 2K01A 4IUUA 2FMMA 1PFNA 3HGBA 3H09A 5ELFA 1UEAB 1GHKA 4QMGA 2EYJA 3DEPA 2CVRA 4PQXA 3S2DB 3NTKA 3VYSA 1QOHA 2D5DA 3WDNA 4IFDJ 4HR7B 1EU3A 1LO5D 2IX3A 2KECA 2PQEA 2WAQB 3NK9A 1PRTD 2IL8A 3TSSA 5I2XA 2NZ1D 1H9JA 4RAUC 2PO4A 3M85A 1TT2A 5C5MA 1JWSD 2YU9B 3I4NB 1TIID 2SNSA 1VMPA 3K59A 1QJOA 2O5JC 3A8IE 3BDLA 2QDBA 2VB3X 2MGSA 2R6GA 1ENAA 3J81L 5C4JB 1V43A 1SYCA 3VYTA 3QB3A 1GUWA 1O7ZA 4MIUA 1F2MA 5ELBA 2TMPA 2WP8J 5DAUA 2R61A 1A6XA 5ELCA 4KK7A 4P2CB 2NVYB 4DAYA 1LTGD 3DM1A 5KYIA 3RLFA 1SEBD 4EQPA 1DM0B 5EKKA 1WTXA 1SSOA 4GZYC 1HTLD 1FYCA 2X6GA 3VYUA 4EVOA 2PNRC 2OXPA 1EWHA 2XVSA 3EJIA 5EKLA 3VR6A 4KKTA 4K6DA 1LTRD 3PUVA 5BN3A 1EEFD 3FVQA 1BO0A 2AQ3B 2WINB 4PMWA 3OIQA 1KAAA 3T53B 4K8JA 4X3UA 4V190 1CTMA 2F0KA 2K05A 4HMIA 3J7AV 3E0JA 1H9RA 4NW2A 1CM9A 1ESFA 3C2PA 1SJHD 4CGYB 1O80A 5FK9C 4BS9A 1TS5A 3K5LA 3BS1A 3KUPA 2AWOA 2JSOA 2PYKA 5E3FA 4DNTB 1PTOC 4XQQA 1BUVT 2VNUD 1EIHA 4IZ8A 1BOSA 1RD9D 4DN4M 4HSPA 1VDZA 5F2DA 2M00A 1K8MA 2B2TC 4FVMA 1V8QA 5M5YB 1PZJD 2B8GA 2ENBA 3K6OA 3JAME 3OSOA 1A3VA 2B2WA 1Q3LA 1EY4A 1QE6A 2TSSA 5DNFA 5K36G 3BG3A 1Z6HA 1CT1D 2Z1CA 2F0LA 4FF1A 1JQYD 2L55A 3AMUA 2NTSA 2HDLA 3HOWB 2A6EC 2BE5D 3OIPA 4RWSC 1AFPA 1C8CA 1KABA 4HAEA 2A5HA 3L3OC 5I6WA 3S1NB 5C3WA 3MFYA 2QEJC 2NBFA 2R93B 1B53A 2A69D 2F0EA 3KF8A 4KKSA 3I3CA 3SDZA 4C3HB 2OF1A 5JJZA 5EQ0A 2F0VA 3W2DA 1LT4D 1F9RA 5DM63 3TN2A 3QO2A 2RSNA 5IT9E 3S2HB 1HPCA 2K33A 2MJ8A 1ZYRD 4RKLA 3LX0A 3DHQA 5C5LA 3BVMA 4DFAA 3TMEA 1H9SA 2OT2A 4H0LC 1HXYD 1LTBD 1D6EC 4XDXA 2K5QA 2EY1A 5G3LF 5LHY1 3GQBA 5E4WC 2K5WA 3WOEA 1U4LA 2CHBD 5CC4A 2MUYA 3E6ZX 1CZGA 5KIXA 1U4MA 2WV6D 1ML0D 5IIFA 2QCPX 3GO5A 2LMCB 4A3MB 1L0XB 4OL7A 2NN6I 1V1PA 1NUCA 4QUFA 1QNUA 4MN3A 1EY9A 3QG1A 3GV3A 3MEHA 2F0GA 3J7YW 1S5BD 2DY8A 1WTOA 1T5XD 5CV8A 4KHZA 2Q8IB 1RDPD 1SNMA 3VR5A 1DXMA 3KLSX 3M7GA 2E76C 3KK7A 2RA4A 1MBYA 2NN6H 5EBDA 1HUMA 1QG7A 1H9MA 2XWBB 5FO7B 1EZ8A 1KLGD 3BZDB 3BDOA 3SXHA 2XRQD 2X69A 2F0PA 2SEBD 2JEBI 3SHLA 1K8OA 5M3FB 5J39A 1IW7C 4HTHA 3T4AC 1TWCB 1DOKA 2IX0A 3FMCA 4M1UB 2EYFA 4IUPA 4C3JG 5M5WB 1D1KA 4HCSA 3NWTA 5IODA 1RTOA 3V2TA 4HMJA 1WTRA 1OXSC 1CK1A 3FKIB 2C5CA 2M9VA 1Y8OB 2NWGA 4BBSB 1EYCA 3UI2A 3RUZA 1E0BA 3ND9A 4MHEA 4ZLTF 2Z4IA 4C1NI 1NSNS 4CKCA 1SFOB 4H7BA 4A3DB 4HSVA 3J80L 1W6JA 1QWYA 3GTLB 1XTCD 4V0BA 1PMRA 3URYA 2LS01 3PUWA 1SBBB 1SMYC 3VR4A 3I72A 4A3JB 4WRDA 4KMUC 1D1IA 1CHQD 2MPMA 2F3VA 1JE4A 3S16B 1EYDA 1FNWA 1Y1WB 3PV0A 4BY1B 3NP8A 1DCZA 3GV6A 1HFGA 4IALA 1PYWD 3CQZB 3SEBA 1A3TA 4A3BB 3S1RB 4C56C 1NR4A 5KRUA 2MHVA 4ZAIA 2ZXOA 3H94A 1O78A 1XXGA 4S3SA 1HFNA 2J0TD 2RDHA 2B2TA 1TWAB 3NQIA 1TWFB 3HOXB 4KD3A 1GOZA 1E2ZA 3SK4A 3Q22A 1OXVA 5IOCA 1TU2B 5CV4A 3PMFA 5DM73 1LT6D 1AP0A 3H0GB 2KEEA 1X32A 2PMZB 5T1GA 4BA2I 4H13C 5KGUA 2FFKB 1NCVA 2XIWA 3GTQB 5IGDA 4CKEA 1PTOD 3HP3A 1DOMA 2AUKA 4XQNA 4E6IA 3I8ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D4D A;  1EY6 A;  1EY9 A;  1KDC A;  4K6D A;  4PNY A;  4R8N A;  5CV6 A;  5C4H A;  5KEE A;  1JOR A;  2SOB A;  4QMG A;  3NHH A;  2EYJ A;  5E1F A;  5I6Y A;  5HUR A;  1A2U A;  4YIJ A;  3HZX A;  3MEH A;  1EY7 A;  4NDX A;  4K14 A;  4J6H A;  4WRD A;  1IHZ A;  2F0G A;  4KHV A;  5JAV A;  1KAB A;  5DEH A;  3SK6 A;  2F0D A;  1KAA A;  4J1M A;  2F3V A;  3MVV A;  2PZW A;  4KJN A;  2LKV A;  5I9P A;  4K8J A;  1SYB A;  3NUC A;  5I6W A;  5CV8 A;  4EQO A;  1STH A;  2OEO A;  2F0K A;  5C3W A;  5IGB A;  2F0O A;  1EYD A;  2F0M A;  4HMI A;  1SNM A;  1RKN A;  2O4X A;  1AEX A;  2EY2 A;  3TP8 A;  4RKB A;  4KJO A;  1EY8 A;  4NMZ A;  2F0T A;  5K5P A;  5J22 A;  2PQE A;  4K8I A;  3NP8 A;  4KV6 A;  4N9T A;  3NK9 A;  3D4W A;  5C3X A;  2F0E A;  4IAL A;  2KHS A;  4PMC A;  1SNO A;  3EVQ A;  3QOL A;  1KDA A;  3SR1 A;  3MHB A;  1JOO A;  3C1E A;  1F2Y A;  2OF1 A;  3C1F A;  1TQO A;  5JOB A;  5CV9 A;  4F7X A;  4LAA A;  2F0V A;  1A3T A;  1EZ8 A;  4B9X A;  1F2Z A;  3SK8 A;  3TP6 A;  3SXH A;  1A3U A;  1TT2 A;  5C5M A;  5ISR A;  3OWF A;  2F0J A;  3TP5 A;  4K5V A;  4ZUJ A;  2F0P A;  1EYA A;  4NP5 A;  1STA A;  4I65 A;  5CR3 A;  3U9O A;  5KRU A;  3SHL A;  2EYL A;  2PYK A;  2SNS A;  5J39 A;  2EYO A;  2PW5 A;  5E3F A;  1EY0 A;  4HTH A;  3SK5 A;  5C4Z A;  5IGG A;  3DMU A;  4S3S A;  3BDL A;  1EQV A;  2QDB A;  4K2K A;  3BDC A;  5J1Z A;  3D8G A;  3MZ5 A;  4IUN A;  3R3O A;  4TRD A;  1ENC A;  4IZ8 A;  4KY6 A;  1ENA A;  1SYE A;  1KDB A;  1SNC A;  3ERQ A;  3P1H A;  3ITP A;  3DHQ A;  3LX0 A;  4RKL A;  1SYC A;  4KTA A;  2F0Q A;  2EYF A;  2SNM A;  4K2L A;  2EYH A;  2F0S A;  5C5L A;  2PW7 A;  3OMC A;  3QB3 A;  3H6M A;  4QB4 A;  5F2D A;  4ZUI A;  4DFA A;  4KY5 A;  5CGK A;  1TR5 A;  2M00 A;  5EGT A;  2F0I A;  4B9W A;  4DF7 A;  1JOQ A;  4MIU A;  1F2M A;  3E5S A;  4NKL A;  1U9R A;  3TME A;  2F0U A;  4G57 A;  4KD3 A;  2F0N A;  5IOD A;  2F3W A;  5DAU A;  2EXZ A;  4K5X A;  2RBM A;  1II3 A;  3ERO A;  4K5W A;  3HEJ A;  3P75 A;  2NUC A;  1SYF A;  3V2T A;  2EY5 A;  2EYM A;  2ENB A;  4QF4 A;  4HMJ A;  3MXP A;  3SK4 A;  4ZQ3 A;  5C6A A;  5M9O A;  1SYG A;  1JOK A;  1SNP A;  2RDF A;  2EY1 A;  2WAC A;  4EQN A;  4F8M A;  2HQE A;  3OSO A;  1STG A;  5IOC A;  3QOJ A;  5CV4 A;  3PMF A;  5HGT A;  3VA5 A;  1A3V A;  4N9P A;  1EZ6 A;  4WOR A;  3S9W A;  4ME5 A;  1STY A;  4KD4 A;  1SNQ A;  3D6C A;  5KYI A;  1EY4 A;  5CV5 A;  5CC4 A;  1A2T A;  3OMG A;  4ODG A;  4EQP A;  1SND A;  1SYD A;  3NQT A;  2PZU A;  2F0W A;  4PMB A;  3T13 A;  5EKK A;  2EY6 A;  2RKS A;  3T16 A;  4DGZ A;  1STB A;  5KGU A;  5KIX A;  1EYC A;  3NXW A;  3RUZ A;  3TP7 A;  4KY7 A;  2F0L A;  4DU9 A;  5KYL A;  5NUC A;  5IGD A;  5IIF A;  4EVO A;  5CV7 A;  1NSN S;  1STN A;  2F0F A;  2OXP A;  2PZT A;  1EY5 A;  4H7B A;  5I9O A;  3EJI A;  4OL7 A;  5EKL A;  5IGC A;  4ID6 A;  2KQ3 A;  1NUC A;  4E6I A;  2EYP A;  5IGF A;  5IGE A;  2F0H A; 
#chains in the Genus database with same CATH topology
 1BXT A;  5C4H A;  1YVC A;  1W2B A;  4ZKC B;  3HOW H;  1Q46 A;  1DOL A;  3CCJ A;  4R4I A;  1I5F A;  1EIY B;  1HZB A;  5C4X G;  1Q90 A;  1F9Q A;  5LMU L;  2KCT A;  3CCM A;  1I4G A;  1D2B A;  2NB0 A;  1N36 L;  1C4Q A;  4B08 A;  1AEX A;  5CBE E;  2R93 H;  4RKB A;  4KJO A;  1SAP A;  4QUC A;  4IJH A;  2RHS B;  3ULJ A;  5C3X A;  3CP0 A;  4C3H H;  3EVQ A;  4JI1 L;  3QOL A;  4GLX A;  2BA0 A;  3U58 A;  5C0X I;  3NTI A;  1NJI C;  3AB9 A;  5E4X A;  4L6T B;  4LW1 A;  5GAE C;  1OXT A;  5ISR A;  3TDQ A;  4LF7 L;  3CCL A;  4ZK9 B;  2N88 A;  3S2H H;  4H44 C;  5EBC A;  4JI7 Q;  1CZW A;  1R9T B;  3BDC A;  4A3E G;  5CYU A;  3N6R A;  4UY8 C;  2Y0S B;  3J80 c;  2A6E D;  1KDB A;  1QVC A;  1TS2 A;  4OGQ C;  3I70 A;  2IHE A;  4QJF A;  2D62 A;  1WTP A;  1VQL A;  4Q0F A;  1EFI D;  4DR6 L;  2EJF C;  2ZXR A;  4CJ2 C;  5EGT A;  5C0X H;  5BN4 A;  4R8I A;  2I07 B;  3HOZ H;  3S1Q B;  1YIJ A;  4DAV A;  1XNR L;  1IBL Q;  1WTH A;  5IYB G;  3E9I A;  3MXP A;  3MEF A;  4A3K G;  4X3T A;  3P20 A;  1SNP A;  4EQN A;  1HNZ L;  1STG A;  1ROD A;  1SRU A;  2Z8L A;  4DR1 Q;  2VB2 X;  2K14 A;  1STY A;  4AYB G;  3D6C A;  3ZJY C;  3DM3 A;  3RMH A;  4B3R L;  5CV5 A;  2WFW A;  4JI4 Q;  4B3S Q;  3HOU B;  3RN5 A;  4ODG A;  3P7J A;  1VCI A;  3G4S A;  1HNW L;  3HG9 A;  1F77 A;  3PUX A;  2Q8R E;  4A3M H;  2KJX A;  3OYY A;  1X3P A;  4K0K Q;  1QIL A;  3DWP A;  3CPF A;  5FJ8 H;  1YEZ A;  3I55 A;  4ZYS A;  2SOB A;  3JC6 6;  3HZX A;  1ILQ A;  4UAI A;  3CF5 A;  1M90 C;  4OIK A;  1PDQ A;  3MFG A;  2F4V Q;  2ZTE A;  5I9P A;  5FLX E;  2XTI A;  4RCN A;  2ALY B;  3AEV A;  3Q23 A;  3OOC A;  4IUR A;  3UDX A;  5JJK A;  1RKN A;  3TP8 A;  2BDN A;  1FJG Q;  1KAW A;  4K8I A;  1AN8 A;  3I4M G;  1BCP F;  1W3S A;  3TZD A;  4A3C G;  3D0F A;  1JR0 D;  3S1M B;  4ULL A;  1VQ8 A;  1TXY A;  1WTW A;  1TQO A;  3DWQ A;  1GUT A;  2PCF B;  1EQR A;  3AU7 A;  2XWJ B;  3ERS X;  1BR9 A;  3TP6 A;  3CKI B;  2CFM A;  4DUY L;  3WOF A;  1UE1 A;  4LUV A;  2CQO A;  4JI2 Q;  2JE6 I;  2EYL A;  1E22 A;  3K58 A;  5M3F H;  1Y8P B;  3RZO B;  4XQJ A;  1XTD A;  1WCM G;  2NVQ B;  1TWC H;  1NMG A;  1PLF A;  4ZCK A;  1XPO A;  4DXG A;  2VS1 A;  1VS0 A;  2MP1 A;  3G71 A;  2UXB L;  1PA6 A;  2F0Q A;  2SNM A;  4K2L A;  2EYH A;  5FLM G;  4LF6 L;  1ILP A;  1V1O A;  3PQI A;  1SJE D;  3H6M A;  4ZUI A;  3KF8 B;  1CA6 A;  1TR5 A;  5M5W H;  1LM0 A;  1U9R A;  4B3M L;  3C46 A;  2Z4H A;  1C9O A;  1M4V A;  3ERO A;  3A7A B;  2KEN A;  4FXK C;  1JIC A;  4LF9 L;  3CHB D;  1N32 Q;  3A5Z B;  3F8T A;  4LF5 Q;  3MXN A;  2AWN A;  4RGO S;  3GP7 A;  2JP1 A;  3FKI H;  1EZ6 A;  1ASZ A;  4P73 A;  3J81 i;  2NVT B;  3PO2 G;  2Z0S A;  2B2U C;  4A3G B;  1QNK A;  1SYD A;  5K5P A;  2PZU A;  4PMB A;  3T16 A;  4BBS H;  2F4I A;  4KY7 A;  4YY3 Q;  1IW7 D;  3NEL A;  1D5M C;  5CV7 A;  2QEX A;  1JB3 A;  1B8A A;  1AZQ A;  3V96 A;  3PIO A;  1H9S B;  2KQ3 A;  4A3D H;  2L5T A;  2K4K A;  3GTL H;  1KDC A;  4NXN Q;  1MGS A;  2M2L A;  4GOP A;  1GHJ A;  1GKH A;  4YIJ A;  1BCP B;  4A3J H;  4J6H A;  4KHV A;  2E75 C;  4IO9 A;  1B3A A;  1PYB A;  4KJN A;  2HUG A;  2OEO A;  3CXC A;  1AE2 A;  3CCS A;  3S16 H;  5EPK A;  2E8G A;  1C7Y A;  1Y1W H;  5IWA L;  1IYV A;  5J22 A;  3J81 E;  1I50 B;  3F1Z A;  4BBR G;  4BY1 H;  1JJ2 A;  3D4W A;  1HCZ A;  1HUN A;  2GA4 B;  1MHW C;  2KHS A;  4O42 A;  5IYC H;  5LMN Q;  4IN3 A;  2UUA Q;  1V1P B;  4KI0 A;  3CQZ H;  1C48 A;  2J4X A;  4B9X A;  2EQS A;  4A3B H;  1A3U A;  4DR3 Q;  3OWF A;  1FR3 A;  3TP5 A;  2D0P A;  4Y7N B;  3S1R H;  1UAP A;  1WTQ A;  1QVG A;  2G9H D;  2Q2H A;  3FPP A;  3M4O B;  3GTM B;  2FJ2 A;  1Y69 U;  4K2K A;  3RD4 A;  5BN5 A;  3R3O A;  4TRD A;  3FEW X;  3LGJ A;  1SMY D;  3RLN A;  1WOC A;  4DKA C;  4YHH L;  3GTP B;  1SYE A;  4Z9C B;  5EPL A;  1PHJ A;  4P74 A;  1F2L A;  1UUP A;  1I6H B;  1TWA H;  2F0S A;  4IOC A;  4A75 A;  3OMC A;  3HKS A;  4QB4 A;  1TY2 A;  1TWF H;  4B9W A;  4IPH A;  1HZA A;  4JPB W;  4MTK A;  1B9N A;  3HOX H;  4FXD A;  3NE5 B;  1VQD A;  1DZ1 A;  1XPU A;  4QF4 A;  3W3A A;  1SE8 A;  5D65 A;  1JMC A;  1BBW A;  3NTH A;  1YJN A;  1G2T A;  1N36 Q;  1EFW A;  3A8K E;  4JV5 L;  5LMN W;  4U68 A;  3K0X A;  5A2Q L;  1LTA D;  3NXW A;  1GD7 A;  4QCL A;  1PTO F;  3CU7 A;  4OO1 H;  1SE2 A;  4JI1 Q;  1SLJ A;  2K5H A;  3K5M A;  1LAC A;  4HIO A;  1EY5 A;  4ILW A;  1U5K A;  2OQK A;  4ID6 A;  4IUQ A;  5C0X G;  1MSH A;  5IGF A;  3HOZ G;  1LT3 D;  4R8N A;  1JJG A;  2CH4 A;  4NB3 A;  1S4Z A;  3BU2 A;  4JW0 A;  4JBW A;  1X3Q A;  3GTG B;  1G6P A;  3NUC A;  2KHJ A;  3RR5 A;  5IP9 H;  2O4X A;  4A3I G;  1LLR D;  4DR6 Q;  4NMZ A;  2YTX A;  3BYT B;  3CRL C;  1K3B C;  1P8L A;  1Q7Y C;  4DR2 L;  3EFX D;  4WFN 3;  2EPB A;  4PMC A;  4A3M G;  3I4O A;  2A6H C;  3MHB A;  1YIT A;  1RCV D;  1XNR Q;  1CKO A;  2WKD A;  1HNZ Q;  2N3S A;  1JC7 A;  4DV4 L;  1HA6 A;  3T1H L;  1LTL A;  3HOY G;  1STA A;  4B3R Q;  3KLS A;  2KCC A;  1FD7 D;  2Q2I A;  1DD2 A;  1G6Z A;  3SK5 A;  1UE5 A;  1Y1V B;  3K0Y A;  5IGG A;  2CH4 W;  1HNW Q;  1PRT F;  1R9T H;  4G7Z C;  2H4O A;  1XJV A;  4DR7 L;  4C3I G;  3CW2 C;  1T5E A;  4EGV A;  1DON A;  1K8A C;  1KD1 C;  1GUN A;  1O7Y A;  3KLR A;  3H3V H;  4X62 L;  1JE5 A;  1Q12 A;  4KY5 A;  3HKZ E;  2YV5 A;  1EWC A;  2K7V A;  2R7F A;  4AIM A;  3S1Q H;  1PFB A;  1M1K C;  4JI0 L;  4DNR B;  3DUZ A;  4ZQ3 A;  3R93 A;  1PTO B;  1SDF A;  3K5O A;  4IQZ A;  4WOR A;  2AUJ D;  1UWV A;  1WI5 A;  3K80 C;  1VQN A;  1Q82 C;  3U50 C;  1A2T A;  4K6L A;  5EJW A;  3H15 A;  1JCK B;  3HOU H;  4RMF A;  4BXX H;  3S17 B;  4CDC C;  4OEM B;  4XTC S;  1NR2 A;  2IW3 A;  2PI2 A;  4DA2 A;  2BDO A;  1JWU D;  4DU9 A;  1CQF A;  1NMF A;  1PH2 A;  3CMA A;  3KDF B;  1I6V C;  4C3J B;  1W6K A;  1F9P A;  1YNN C;  5I9O A;  4RA8 A;  1GUG A;  3GD7 A;  1VMC A;  5I4D A;  1CHP D;  5D3I B;  2NVY H;  1KRS A;  1EY6 A;  4DUY Q;  2EOT A;  2CWA A;  2Q8T A;  5E1F A;  4HCE A;  5HUR A;  1E2W A;  1X54 A;  2HHH L;  2YYZ A;  2GVA A;  1VQF A;  4OIJ A;  1TWH B;  2L4N A;  4H02 A;  2JA7 B;  2PZW A;  3CCU A;  1SYB A;  2B63 G;  3M7N A;  2WB1 B;  2UXB Q;  1GJX A;  2JA8 B;  1G8Z D;  4CDD C;  4LF6 Q;  1EL0 A;  4RHS A;  1GXD C;  4RHR A;  2IJ0 A;  3J7A 5;  2K5N A;  1B3Q A;  2I5M X;  4B3M Q;  1D5X C;  3SR1 A;  1ICW A;  1JOO A;  3C1E A;  4L5Q A;  3CAM A;  3ER0 A;  2JA5 B;  1F9S A;  2VY3 A;  4XYQ A;  1PRT B;  3D3R A;  4LF9 Q;  1B7Y B;  4YCW A;  4A3D G;  2KA7 A;  4X3K A;  2J7Z A;  1B2T A;  5KND A;  1Q81 C;  1VF7 A;  3G48 A;  4XYO A;  2JA9 A;  4K5V A;  1ENF A;  4RGT A;  1E1O A;  1V9P A;  1EYA A;  3K5N A;  1WTV A;  1LTI D;  4ZKB B;  1UNS A;  3PO3 B;  2AQ1 B;  5M3M G;  5JEA H;  1PV4 A;  4LF8 L;  3EIV A;  1O7I A;  3RZO H;  4Y52 H;  4JYA L;  1EQV A;  1QUQ A;  4IUN A;  2NVQ H;  2Q2U A;  3P1H A;  5GAD C;  4QIW E;  3IKJ A;  1WVL A;  1KNE A;  1XYI A;  3OW7 A;  5A35 A;  4BY1 G;  2RSO A;  2R92 B;  2BH2 A;  2EJG C;  1R4P B;  1AW7 A;  2F0U A;  1Q86 C;  2F0N A;  5IYC G;  4K5X A;  4OHJ A;  4X64 L;  2RHQ B;  5IYD H;  2YTY A;  2EYM A;  4N8X 1;  2ASB A;  2HQE A;  4A3B G;  2B2U A;  3DLL A;  4N9P A;  4LF4 L;  1G29 1;  1N8R C;  1ZKO A;  4DXF A;  4GN3 B;  2NVT H;  1X3E A;  1WD0 A;  4A3G H;  5IWA Q;  4EQ5 A;  3VDY A;  3TBI B;  4FYD A;  1SRO A;  3HS0 C;  2KUM A;  3TP7 A;  1J9O A;  3A55 A;  1PVO A;  1MD2 D;  3BJU A;  2BA1 A;  3CCV A;  4DV3 Q;  2PZT A;  4UP8 A;  3TRE A;  3SE0 A;  1XMQ L;  3A56 A;  3OPO A;  2ZTD A;  4X3S A;  1SXT A;  2JYO A;  1KRT A;  3HOX G;  3CC7 A;  1OTC A;  1B44 D;  2E2J B;  1A2U A;  2A74 C;  1I4Q A;  2A19 A;  1RL2 A;  4NDX A;  1UEB A;  1CI3 M;  1XNQ L;  4YHH Q;  3BVZ A;  2I46 A;  2B8F A;  1B4O A;  5ELE A;  1AE3 A;  3OWE B;  1EWI A;  5LL6 S;  2RQX A;  1Z9F A;  3J80 i;  3IFT A;  1LV9 A;  4PZ7 A;  2BH8 A;  1I94 L;  4DV2 L;  4ALP A;  4FF3 A;  4G7H C;  1KDA A;  2QF7 A;  4BY7 B;  1TS4 A;  4IPD A;  3VR3 A;  4LAA A;  1XMO L;  2X6L A;  1F2Z A;  4DAY B;  2D2C C;  1J8I A;  3T56 B;  2R7Z B;  3X3M A;  3TS0 A;  2B39 A;  3CD6 A;  4Y7N H;  2QGQ A;  2DN8 A;  4I65 A;  3D4R A;  4UPA A;  1L0Y B;  1U0L A;  3S1N H;  3M4O H;  4JV5 Q;  3GTM H;  1VQB A;  2OTL A;  5C4X B;  1E1T A;  2L11 A;  1Q8I A;  2AHO B;  2EXD A;  4O0A A;  5COY A;  5TSS A;  4O1N A;  4ABN A;  4A3L H;  4ME3 A;  4LMQ D;  3GTP H;  1S5C D;  1R4Q B;  1BCP C;  1OO9 B;  1I6H H;  1TWG B;  3S15 B;  1FNV A;  3B6Y A;  2WAQ E;  2AKW B;  5CBA E;  4DK0 A;  3I73 A;  4IUT A;  2ICE C;  5T1I A;  3J80 E;  1MKH A;  2F3W A;  1PH4 A;  1S3O A;  2EXZ A;  4LFC L;  3PF5 A;  3P75 A;  2R3Z A;  1JOK A;  3AYH B;  2WAC A;  2CW0 C;  1EU4 A;  1L0W A;  5JVG 3;  2K1B A;  1YNJ C;  4AYB E;  1A63 A;  3G7L A;  1WJJ A;  4CDF C;  3FRP B;  4A3E B;  2WAQ G;  3CRK C;  4MTN A;  1HNX L;  4DR2 Q;  2Y0S G;  4HJ9 A;  1PH1 A;  2NN6 G;  4I7Z C;  3AFQ A;  3PSI A;  1STN A;  4CJ0 B;  4AQY L;  3I91 A;  1N33 L;  2KED A;  4DV4 Q;  4JI6 L;  3T1H Q;  2ICI A;  4PNY A;  3JAM L;  5CV6 A;  1JOR A;  1TKW B;  2K04 A;  4LJZ C;  4DK1 A;  2HIX A;  3I4N G;  1NNX A;  4A3K B;  4FNF A;  4OXP A;  4PG3 A;  3SK6 A;  2RCF A;  2HDM A;  2XNA C;  4J1M A;  3GTG H;  1LAB A;  4DR7 Q;  1LTT D;  2LKV A;  3NEN A;  4AYB B;  1SE4 A;  2VQE L;  4B3T L;  3FPU B;  3NWS A;  1YI2 A;  4ZRZ A;  1CKN A;  1NBW A;  2L0C A;  4X62 Q;  3QWN A;  2N55 A;  3CCR A;  4BXX G;  3WWV A;  1M8A A;  2ES2 A;  3QJY A;  1SNO A;  4JI0 Q;  1EUJ A;  2OQ0 A;  4HIM A;  2BCO A;  3E3X A;  2IPK D;  2A68 C;  1L2F A;  1J6Q A;  1U4P A;  4ZUJ A;  5JPM C;  1EIG A;  3QIA A;  3DEO A;  1IL8 A;  3U9O A;  1GVP A;  4KN7 C;  4FXG C;  2EYO A;  2PW5 A;  1YHQ A;  1ET6 A;  4PV1 C;  5EPJ A;  4C2M B;  4GLV B;  3MXG A;  1Y1V H;  1VQH A;  5C4Z A;  1K83 B;  2EJM A;  1K3R A;  5HGQ A;  1TS3 A;  4F87 A;  4CJ1 B;  3J81 j;  4KTA A;  2EVB A;  3IFD A;  3IL8 A;  3LNN A;  1G51 A;  2KCN A;  2B2Y C;  4GLA C;  4OEL B;  5CMD A;  3I4M B;  3VA7 A;  1JJC B;  1OXU A;  2JXM B;  1ZEQ X;  4G57 A;  3ZYY X;  1HZC A;  5I2Y A;  4IPC A;  4K5W A;  5E7N A;  3UDG A;  2HHH Q;  5GQO A;  3M4Y A;  1BF4 A;  1PTO H;  3I4L A;  2F1M A;  3VA5 A;  5IT9 L;  2A6H D;  1VQM A;  1I4H A;  1NTG A;  3A54 A;  3CPW A;  1SNQ A;  1VQG A;  5JEA G;  1LTS D;  2VUM B;  3PIO 3;  1WCM B;  3SVM A;  4XT3 B;  1V1Q A;  4DGZ A;  2VW9 A;  3Q0A A;  3S17 H;  1VQ9 A;  5KYL A;  2XN9 C;  1WFQ A;  3CC4 A;  3I2Z A;  3R8B A;  2F0F A;  1RF2 D;  3IAY A;  4C3J H;  2EZV A;  2VXW A;  2N78 A;  1KQS A;  2Z9H A;  5IE8 A;  4OX9 L;  3EA6 A;  2DNC A;  3U4V A;  1SE3 A;  3MAQ A;  2K5D A;  5IYD G;  4JK1 C;  5I6Y A;  2ZT9 C;  4LF8 Q;  3TEH B;  5JEA J;  2FMC A;  1G91 A;  2I0Q A;  4JYA Q;  3T1Y L;  1PZK D;  3X3N A;  5JAV A;  2F0D A;  1KNA A;  1TWH H;  3MVV A;  2JA7 H;  2P5Z X;  2NTT A;  3PO2 B;  4EQO A;  1I3Q B;  1STH A;  4A3G G;  3TRZ A;  1VQE A;  2ID0 A;  4GS3 A;  2JA8 H;  5M5X B;  1SFO H;  4FO2 A;  1AZP A;  4R4Q A;  1EY8 A;  4BA1 I;  2KVM A;  1HR0 L;  4KV6 A;  1TVX A;  4L63 B;  2UU9 L;  4I7A A;  2MO0 A;  2IWH A;  3PIP 3;  2O5I C;  4X64 Q;  1MI2 A;  3C1F A;  4Q5V A;  2JA5 H;  4JI5 L;  5JOB A;  3Q24 A;  1HTP A;  1PXU A;  1VF5 C;  1E2V A;  4LF4 Q;  3FP9 A;  1JWM D;  1YBY A;  1YNN D;  4DPG A;  5AFW A;  5C44 B;  4G7O C;  3HOV B;  1LYL A;  1E24 A;  4GNX B;  3PO3 H;  1VQA A;  1Q1B A;  2E2H B;  1Z7T A;  2B2V C;  1CA5 A;  3DMU A;  1HA5 A;  3CCE A;  2JA6 B;  2JK8 A;  1ENC A;  3VR2 A;  4KY6 A;  3OTO L;  3UDF A;  1SNC A;  1G2S A;  2E2D C;  2ZJP A;  1FGB D;  3JAM c;  3UE1 A;  4DAP A;  4BBR B;  5CGK A;  3FDT A;  3ICE A;  1HRJ A;  1XMQ Q;  2F0I A;  2R92 H;  3S14 B;  1NY4 A;  3E5S A;  3R2I A;  1Q1E A;  3K7A B;  3C3L A;  4A3F B;  3UE0 A;  3PIP A;  4HJ5 A;  1SYF A;  3HOW G;  2O2L D;  2E2I B;  1I4R A;  4FF4 A;  4LFB Q;  3G6J B;  5HGT A;  1XNQ Q;  1B50 A;  3S9W A;  1CKM A;  4ME5 A;  4HID A;  2CKZ B;  2EDG A;  3MC0 B;  1PRT C;  4DV6 L;  1ASY A;  1SND A;  2R93 G;  2PI2 E;  2RKS A;  3OW2 A;  3A5U A;  2F03 A;  1A8V A;  4OO1 I;  1I94 Q;  4DV2 Q;  4L5S A;  1DYQ A;  2JEA I;  5NUC A;  3U9S A;  4FF2 A;  4C3H G;  4DR4 L;  4LFA L;  2WII B;  4DV0 L;  1A0I A;  1L1O B;  5IGC A;  1XMO Q;  3GTO B;  1VQC A;  4A4I A;  2EYP A;  2V4D A;  1XWE A;  5LMU Q;  1B70 B;  2E2J H;  1RJT A;  2XSC A;  3CC2 A;  2K03 A;  3H0G H;  4X65 L;  3R2T A;  1D5Z C;  4KN4 C;  5EKI A;  5DEH A;  4GKK L;  2HCI A;  3MXU A;  2E74 C;  1HQM C;  3GTQ H;  5IGB A;  3M3Y B;  1Y14 B;  2F0O A;  1Y8N B;  2F0M A;  4IFD I;  1KTK A;  4N9T A;  1GO3 E;  4EX5 A;  2LY7 A;  5D14 A;  4CHT B;  3ULP A;  2OWO A;  4LF7 Q;  2VL6 A;  5IT9 c;  4LFC Q;  3J7Z C;  3A0J A;  4BY7 H;  5CV9 A;  1QB5 D;  3LWE A;  5FO9 B;  2YTV A;  3CCQ A;  4DUZ L;  3HOZ B;  5M5X H;  2R7Z H;  4R4C A;  3A8J E;  2F0J A;  3Q6S A;  1CUK A;  1SMX A;  4KKU A;  1EEI D;  4NP5 A;  2CQA A;  3QR8 A;  1A62 A;  1EY0 A;  1STE A;  2UXC L;  4BWG B;  1EYG A;  5C4X H;  1XPR A;  3D8G A;  3EQL C;  4IFD H;  5C0X J;  4X6A H;  2DUD A;  5JJI A;  3H3V I;  5C3E B;  4A3I B;  2A1A A;  1N33 Q;  4AQY Q;  2K52 A;  4RH6 A;  1TWG H;  3S15 H;  2KOL A;  3N52 A;  4JI6 Q;  4NKL A;  1IKL A;  5FJ8 G;  3KJP A;  2K28 A;  1II3 A;  3VYR A;  1EOT A;  4WJW A;  2HIV A;  3QOJ A;  1K0R A;  1OXX K;  4OWW B;  3HOY B;  2VQE Q;  4B3T Q;  2NZH A;  1KHI A;  1N9W A;  3BZC A;  4TVA B;  4QY7 A;  1QCB D;  1QUQ B;  4N8F A;  1K73 C;  3T13 A;  3J7A F;  2F0W A;  3LWU A;  1STB A;  4A3E H;  1X56 A;  4C3I B;  4JOI C;  1DJR D;  1CQV A;  5JPN C;  1S5F D;  5ELD A;  1K0S A;  4IUV A;  3W1G A;  1VQJ A;  4YCU A;  1KLU D;  1BBX C;  1X55 A;  1S5E D;  4U67 3;  4GN4 B;  1A15 A;  1SR3 A;  3KBG A;  3T51 B;  2F0H A;  5D3D A;  3D4D A;  1BCP D;  3M4P A;  5KEE A;  5KNB A;  1IBK L;  4KHP L;  2RVL A;  2L9H A;  4QGU A;  5IYB H;  2DGY A;  5M3F G;  4A3K H;  1EY7 A;  1ESR A;  4K14 A;  5FO8 B;  1IHZ A;  4JI3 L;  3F2C A;  3PF4 A;  1UE6 A;  1FNU A;  3KF6 A;  3SGI A;  3HRZ C;  3OHX C;  1B1Z A;  3RZD B;  4R4O A;  3NSW A;  2CW0 D;  3PCO B;  1YNJ D;  3HKZ B;  4L5T A;  1BNZ A;  2Q2T A;  1GUS A;  1VQ7 A;  3GTK B;  1ET9 A;  2F3I A;  3H3V C;  4X66 L;  3D31 A;  4M8A A;  4L8J A;  4LUO A;  4FP5 D;  4UDU C;  1E3P A;  2IT1 A;  2CWP A;  2QW7 A;  4P72 A;  2Z6K C;  2CCZ A;  3FKI G;  1BDO A;  2G9D A;  1U4R A;  3V05 A;  2EE1 A;  4L5R C;  3A7L A;  1FVI A;  4C2M H;  3KLW A;  2L12 A;  5BR8 L;  4BBS G;  2B63 B;  5KNC A;  2B2Y A;  1SN8 A;  5A2Q E;  1I4P A;  2B29 A;  3ITP A;  2WB1 G;  3ERQ A;  5J3B A;  3S1M H;  3M9B A;  2ZTC A;  2A73 B;  5COR A;  1IYU A;  3F2U A;  3I4M H;  2BE5 C;  4DF7 A;  1KC8 C;  1JOQ A;  4OX9 Q;  3NBH A;  2AQ2 B;  2N8N A;  1ONL A;  3PUZ A;  1PZI D;  2SDF A;  1Z47 A;  1O7L A;  3HEJ A;  1E7Z A;  3S24 A;  5C6A A;  4RCO A;  1RHP A;  5M9O A;  1SYG A;  2LFN A;  4A3J G;  3T1Y Q;  1EOV A;  3K7U C;  3CME A;  2QKI C;  4RGM A;  1IL2 A;  1B9M A;  2K6A A;  2A69 C;  2A68 D;  3DXJ C;  5M3M B;  2QIL A;  3OMG A;  3H91 A;  1Y1W G;  2IX1 A;  2VUM H;  1IKM A;  4G4K A;  2B2W C;  1HR0 Q;  2GVB A;  1PH7 A;  4R9W A;  1ICF B;  1XX8 A;  2UU9 Q;  2NVX B;  4UP7 A;  2D9U A;  1PH3 A;  2Z6B A;  4RFB A;  2EIF A;  1HHV A;  1FL0 A;  4JI5 Q;  2UXD L;  5FLM H;  4TKO B;  2RDG A;  2MQH A;  1KXL A;  4IPG A;  5IGE A;  4A93 B;  3MA2 B;  3NHH A;  1ZYR C;  2XRS D;  1RTN A;  1PH6 A;  2H1E A;  3GTJ B;  1WD1 A;  3BYY B;  1VQO A;  1NAP A;  4TQU S;  3OTO Q;  3PUY A;  2WKC A;  4HN7 A;  4QIW B;  4YCV A;  1IXR A;  1I3Q H;  3O13 A;  3DWA A;  2JN4 A;  2PPB C;  1CFM A;  2EY2 A;  4MZ9 A;  1LT5 D;  5ELO A;  3ONA B;  2PMZ E;  2F0T A;  3BVG A;  2DNE A;  2HQL A;  2ZXP A;  4XT1 B;  5FOB B;  1MSG A;  1AH9 A;  1PH9 A;  3L7Z C;  3NEM A;  4TSS A;  4LK1 C;  1EQT A;  3L9A X;  1F2Y A;  2UUB L;  4CBV A;  4F7X A;  1BQQ T;  3SK8 A;  3K57 A;  2DJG C;  1HR0 W;  2B2V A;  3D6W A;  3KBX A;  5CR3 A;  5C44 H;  2KBN A;  3HOV H;  3H0G G;  2FHT A;  4XIG S;  4JBM A;  4DV6 Q;  3NPP A;  1J5E L;  2PQA A;  3TZU A;  5FLX L;  2E2H H;  2HCC A;  3MWY W;  5K36 H;  2C9O A;  5J1Z A;  3MZ5 A;  1I50 H;  2JA6 H;  2L1B A;  4FDB A;  4J8Q A;  5AJ3 L;  4OO1 G;  4DR4 Q;  3MTS A;  2K32 A;  3ND8 A;  4LFA Q;  3STB C;  4DV0 Q;  5LL6 X;  2PW7 A;  5FKA C;  2DY7 A;  3A74 A;  2BOS A;  4RGN A;  3S14 H;  1S5D D;  1PFS A;  1FGU A;  3K7A H;  3TS2 A;  2RBM A;  4A3F H;  2NUC A;  4PZ8 A;  1HQR D;  1ZXT A;  2EY5 A;  5GAG C;  1TY0 A;  1PFM A;  4X65 Q;  1YHA A;  2FXQ A;  4XXE A;  4F88 A;  2E2I H;  2RDF A;  4F8M A;  1I4X A;  2R7Z G;  2E5L L;  3I90 A;  1K28 A;  5G3L D;  4KD4 A;  2OCE A;  4HED A;  1X3G A;  5IP9 G;  1VQI A;  4CKB A;  3NBI A;  2NYZ D;  1GUO A;  3NQT A;  2FIN B;  2EY6 A;  4GN5 A;  4IFD G;  2Y0S E;  4C1N K;  4GNX C;  1H9K A;  5JVH 3;  2K01 A;  1UE7 A;  4IUU A;  2FMM A;  1PFN A;  4DUZ Q;  3GTO H;  2QA4 A;  3HGB A;  3H09 A;  5ELF A;  4JG2 A;  1UEA B;  1GHK A;  4QMG A;  2EYJ A;  3DEP A;  2C35 B;  2CVR A;  2UXC Q;  4PQX A;  3S2D B;  3NTK A;  1GM5 A;  4R1J A;  1QOH A;  3VYS A;  2D5D A;  3WDN A;  4IFD J;  4HR7 B;  1EU3 A;  3M3Y H;  2K50 A;  1LO5 D;  2IX3 A;  2KEC A;  2PQE A;  2WAQ B;  3NK9 A;  5HY6 A;  1PRT D;  4JVZ A;  2IL8 A;  2XGT A;  3TSS A;  5EAY A;  5DLQ E;  2ZM6 L;  5I2X A;  2NZ1 D;  3MXN B;  1H9J A;  4JBJ A;  4DV1 L;  4RAU C;  2PO4 A;  3M85 A;  1TT2 A;  5C5M A;  1JWS D;  2YU9 B;  4POF A;  3I4N B;  1TII D;  2SNS A;  1L1O C;  1VMP A;  4APV A;  1QJO A;  3K59 A;  3HOU G;  2O5J C;  1QVF A;  3A8I E;  3GDE A;  3BDL A;  2QDB A;  2VB3 X;  2MGS A;  2R6G A;  3RLO A;  1ENA A;  2IHF A;  1X6O A;  1EQQ A;  1X9N A;  3J81 L;  5C4J B;  1V43 A;  1SYC A;  5C3E H;  4A3I H;  2LXK A;  3VYT A;  4DR5 L;  3QB3 A;  1GUW A;  1O7Z A;  4MIU A;  1F2M A;  5ELB A;  2TMP A;  4GOP B;  2WP8 J;  4KHP Q;  1IBK Q;  3RNU A;  1VQ4 A;  5DAU A;  1S72 A;  2R61 A;  3W1B A;  4A76 A;  1A6X A;  5ELC A;  4KK7 A;  4P2C B;  2NVY B;  4JI3 Q;  2VQF L;  4DAY A;  1LTG D;  3AQQ A;  3DM1 A;  3HOY H;  2UUC L;  1CSP A;  5KYI A;  3RLF A;  4JOI A;  1IBM L;  1SEB D;  4EQP A;  1DM0 B;  5EKK A;  1WTX A;  1SSO A;  4C3I H;  1HZ9 A;  1HTL D;  1FYC A;  4GZY C;  2X6G A;  3VYU A;  4EVO A;  4DV5 L;  1MJE A;  4X66 Q;  2PNR C;  2OXP A;  1EWH A;  2XVS A;  3EJI A;  5EKL A;  1BVS A;  2VZA A;  3VR6 A;  4KKT A;  5IP7 H;  2GN5 A;  5FLX c;  4K6D A;  1LTR D;  3PUV A;  5BN3 A;  4GKJ L;  1EEF D;  3RN2 A;  3FVQ A;  1H95 A;  2RF4 A;  1BO0 A;  2AQ3 B;  2WIN B;  4PMW A;  1MIU A;  5BR8 Q;  3OIQ A;  1KAA A;  2I5L X;  3FHW A;  3T53 B;  4K8J A;  4X3U A;  4V19 0;  1CTM A;  2F0K A;  2K05 A;  3RZD H;  4HMI A;  2VUM G;  3J7A V;  3E0J A;  1H9R A;  4NW2 A;  3EN2 A;  1CM9 A;  1ESF A;  3JAM i;  3GTK H;  1C0A A;  4OWX B;  3C2P A;  1SJH D;  2Z6K A;  4CGY B;  1O80 A;  5FK9 C;  4BS9 A;  3BZK A;  2ATW A;  1TS5 A;  3K5L A;  3BS1 A;  3L2P A;  3KUP A;  4HIK A;  2AWO A;  2JSO A;  2PYK A;  5E3F A;  4DNT B;  3G6E A;  1PTO C;  4XQQ A;  1BUV T;  2VNU D;  4JI8 L;  2F52 A;  1EIH A;  4IZ8 A;  2B63 H;  1BOS A;  1RD9 D;  4DN4 M;  4HSP A;  1VDZ A;  2UXD Q;  5F2D A;  2M00 A;  1K8M A;  3HFZ B;  4DV7 L;  2B2T C;  4FVM A;  4QL5 A;  1V8Q A;  1PH8 A;  5M5Y B;  1PZJ D;  5GAH C;  2KCM A;  2B8G A;  5H1S E;  4YWL A;  2ENB A;  3K6O A;  3JAM E;  4AH6 A;  3OSO A;  2QDL A;  2R7D A;  1A3V A;  4KLK A;  2B2W A;  5C44 G;  1Q3L A;  1EY4 A;  3HOV G;  1QE6 A;  2TSS A;  5DNF A;  5M3M H;  5K36 G;  3BG3 A;  1Z6H A;  3KOJ A;  1EIF A;  1CT1 D;  2Z1C A;  2AMC B;  2JA6 G;  2F0L A;  4FF1 A;  2NVX H;  1JQY D;  2UUB Q;  2L55 A;  3AMU A;  2NTS A;  1MJC A;  4A93 H;  2HDL A;  4A3F G;  4DV3 L;  3HOW B;  1VQ5 A;  1DGS A;  2A6E C;  2BE5 D;  3OIP A;  4RWS C;  2D0O A;  1J5E Q;  1AFP A;  1C8C A;  3IRB A;  3J81 c;  1KAB A;  4NXM L;  3GTJ H;  1VQK A;  4HAE A;  2A5H A;  3L3O C;  4A3L G;  5AJ3 Q;  5I6W A;  2V1C C;  3S1N B;  5C3W A;  1WYD A;  3MFY A;  2QEJ C;  2NBF A;  2R93 B;  1N34 L;  1PYS B;  1B53 A;  3KJO A;  2A69 D;  4O2D A;  2F0E A;  2JJQ A;  3KF8 A;  4KKS A;  3I3C A;  3SDZ A;  4C3H B;  4HJ7 A;  3L0O A;  1QZH A;  2OF1 A;  5JJZ A;  5EQ0 A;  2F0V A;  1IYJ B;  3W2D A;  4WJ4 A;  1LT4 D;  1F9R A;  2IY5 B;  2E5L Q;  4JCV E;  5DM6 3;  1YJ9 A;  3E9H A;  3QO2 A;  3TN2 A;  2RSN A;  5IT9 E;  3U4Z A;  2DJF C;  3S2H B;  1HPC A;  2K33 A;  4LUZ A;  4RG1 A;  3KF6 B;  2MJ8 A;  1ZYR D;  5JJL A;  4RKL A;  3LX0 A;  3DHQ A;  2L15 A;  4DK3 C;  4LWC A;  5C5L A;  1D8L A;  3BVM A;  4OON A;  4DFA A;  3I56 A;  2K75 A;  3TME A;  1H9S A;  2OT2 A;  4H0L C;  1HXY D;  1LTB D;  4P71 A;  1D6E C;  4XDX A;  2K5Q A;  1S40 A;  4YWK A;  2EY1 A;  5G3L F;  5LHY 1;  3GQB A;  2G5D A;  1NE3 A;  5E4W C;  1HNX Q;  2ZJR A;  2K5W A;  3WOE A;  1U4L A;  4JC0 A;  2CHB D;  5CC4 A;  2MUY A;  3F2D A;  3E6Z X;  4GNX A;  1T9H A;  3KYH C;  1CZG A;  1HJP A;  4JI7 L;  5KIX A;  4QQB X;  1U4M A;  3GO5 A;  2WV6 D;  1CSQ A;  1ML0 D;  2QCP X;  5IIF A;  1D7Q A;  2LMC B;  4A3M B;  5C3E G;  1L0X B;  2ZM6 Q;  3NBH B;  4OL7 A;  4POG A;  4DV1 Q;  2NN6 I;  1V1P A;  1NUC A;  4IJL A;  4QUF A;  1QNU A;  1K9M C;  4MN3 A;  1EY9 A;  3STB D;  1YHB A;  3QG1 A;  4P75 A;  5GRO A;  1IBL L;  4OWT B;  3GV3 A;  1VQ6 A;  3MEH A;  4DNI A;  2F0G A;  1Y1V G;  3S2D H;  3J7Y W;  1S5B D;  2MFI A;  2DY8 A;  4DR1 L;  1WTO A;  1T5X D;  5CV8 A;  4KHZ A;  2Q8I B;  4JI4 L;  1RDP D;  4B3S L;  1SNM A;  3W5O A;  4DR5 Q;  3VR5 A;  1DXM A;  3KLS X;  3M7G A;  2E76 C;  3KK7 A;  2RA4 A;  4WJ3 M;  1MBY A;  2NN6 H;  2LSS A;  4DAM A;  5EBD A;  1HUM A;  1QG7 A;  1H9M A;  1X3F A;  1JB7 A;  2XWB B;  5FO7 B;  1HH2 P;  1EZ8 A;  4K0K L;  1KLG D;  3BZD B;  3BDO A;  5IP7 G;  3SXH A;  1L1O A;  2VQF Q;  2XRQ D;  2I5H A;  2X69 A;  4YWM A;  4HJ8 A;  2F0P A;  4DK6 C;  2SEB D;  2UUC Q;  2YU9 H;  2JEB I;  3SHL A;  1K8O A;  1IZ6 A;  5M3F B;  5J39 A;  3I4N H;  1IW7 C;  4HTH A;  1IBM Q;  1JT8 A;  4UP9 A;  3T4A C;  1VQP A;  1TWC B;  2F4V L;  1DOK A;  2HD3 A;  2IX0 A;  4DV5 Q;  2WB1 E;  3K8A A;  3FMC A;  2N49 A;  4J15 A;  4M1U B;  5C4J H;  2EYF A;  4IUP A;  4C3J G;  1FJG L;  5M5W B;  1D1K A;  3HKZ G;  1K8G A;  4HCS A;  3NWT A;  2K5V A;  4JBK A;  5IOD A;  4GKJ Q;  1RTO A;  3V2T A;  4HMJ A;  1WTR A;  4NPS A;  1OXS C;  1CK1 A;  3TQY A;  3FKI B;  1K83 H;  2JA7 G;  1Q8K A;  3E0E A;  2C5C A;  2PQA B;  4JI2 L;  1KIX A;  1BBU A;  2NZO A;  2M9V A;  2JA8 G;  1Y8O B;  1YZ6 A;  2NWG A;  4BBS B;  1EYC A;  3UI2 A;  3UDI A;  3RUZ A;  1E0B A;  3EBE A;  3ND9 A;  3K81 C;  4A3C H;  4MHE A;  4ZLT F;  2Z4I A;  4C1N I;  1NSN S;  4CKC A;  1SFO B;  4H7B A;  2JA5 G;  2JQO A;  4A3D B;  4HSV A;  3J80 L;  1W6J A;  4HJA A;  1QWY A;  3I7F A;  1QZG A;  3GTL B;  2PNH A;  1XTC D;  2MNA A;  1YJW A;  2H5X A;  4V0B A;  1PMR A;  3URY A;  2LS0 1;  3PUW A;  1SBB B;  1SMY C;  3VR4 A;  3I72 A;  3PO3 G;  4A3J B;  1N32 L;  4WRD A;  4KMU C;  1KL9 A;  1WCM H;  4LF5 L;  1D1I A;  1CHQ D;  4JI8 Q;  4GOP C;  2MPM A;  2F3V A;  1JE4 A;  1RIP A;  1YNX A;  3S16 B;  1EYD A;  1FNW A;  1Y1W B;  3PV0 A;  2KHI A;  4R4T A;  4BY1 B;  5L37 A;  3NP8 A;  1DCZ A;  4DV7 Q;  4MNO A;  2R92 G;  2ZJQ A;  3GV6 A;  1HFG A;  4YY3 L;  4IAL A;  2LXJ A;  1PYW D;  4UHV A;  3CQZ B;  3SEB A;  3KFU A;  1A3T A;  3ULL A;  4A3B B;  1LUZ A;  3S1R B;  4C56 C;  4A93 G;  1NR4 A;  4NXN L;  5KRU A;  2MHV A;  4PZ6 A;  4ZAI A;  5IY0 A;  3PO2 H;  2ZXO A;  3H94 A;  3M4Q A;  1O78 A;  3F2B A;  3Q8D A;  1XXG A;  4S3S A;  1HFN A;  2J0T D;  2RDH A;  2B2T A;  1TWA B;  3NQI A;  3KDF A;  1TWF B;  3HOX B;  4LNQ A;  4KD3 A;  5M5Y H;  5LMN L;  2A8V A;  1GOZ A;  2UUA L;  1E2Z A;  2OTJ A;  3PGZ A;  3SK4 A;  3Q22 A;  1OXV A;  1P16 A;  1X65 A;  2RCN A;  2MO1 A;  2HT1 A;  4NXM Q;  1TU2 B;  5IOC A;  5CV4 A;  3PMF A;  5DM7 3;  4DR3 L;  1BKB A;  4IOA A;  1LT6 D;  1CKN B;  1AP0 A;  3H0G B;  2KEE A;  1X32 A;  5ELN A;  1N34 Q;  2PMZ B;  5T1G A;  4LFB L;  4BA2 I;  4H13 C;  5KGU A;  2FFK B;  1NCV A;  4BBR H;  2XIW A;  3GTQ B;  5IGD A;  4CKE A;  2B3G A;  1PTO D;  3HP3 A;  1DOM A;  2AUK A;  1PH5 A;  4XQN A;  4BY7 G;  3AFP A;  4E6I A;  4CDE C;  3I8Z A;  4GKK Q; 
#chains in the Genus database with same CATH homology
 1BXT A;  5C4H A;  4ZKC B;  1DOL A;  1Q90 A;  1F9Q A;  1I4G A;  1D2B A;  2NB0 A;  1C4Q A;  4B08 A;  1AEX A;  5CBE E;  4RKB A;  4KJO A;  1SAP A;  4QUC A;  5C3X A;  3EVQ A;  3QOL A;  2BA0 A;  5C0X I;  3NTI A;  3AB9 A;  5E4X A;  4L6T B;  1OXT A;  5ISR A;  3TDQ A;  4ZK9 B;  2N88 A;  4H44 C;  5EBC A;  1CZW A;  1R9T B;  3BDC A;  5CYU A;  3N6R A;  2Y0S B;  2A6E D;  1KDB A;  1TS2 A;  4OGQ C;  3I70 A;  2D62 A;  1WTP A;  4Q0F A;  1EFI D;  2EJF C;  2ZXR A;  4CJ2 C;  5EGT A;  5C0X H;  5BN4 A;  4R8I A;  2I07 B;  3S1Q B;  4DAV A;  3MXP A;  4X3T A;  3P20 A;  1SNP A;  4EQN A;  1STG A;  1ROD A;  2Z8L A;  2VB2 X;  1STY A;  3D6C A;  3RMH A;  5CV5 A;  3HOU B;  4ODG A;  3P7J A;  1VCI A;  3HG9 A;  1F77 A;  3PUX A;  2Q8R E;  2KJX A;  1X3P A;  1QIL A;  3DWP A;  4ZYS A;  2SOB A;  3HZX A;  1ILQ A;  4UAI A;  4OIK A;  1PDQ A;  3MFG A;  5I9P A;  5FLX E;  4RCN A;  3Q23 A;  3OOC A;  4IUR A;  1RKN A;  3TP8 A;  2BDN A;  4K8I A;  1AN8 A;  1BCP F;  3TZD A;  1JR0 D;  3S1M B;  4ULL A;  1WTW A;  1TQO A;  3DWQ A;  1GUT A;  2PCF B;  3AU7 A;  2XWJ B;  1BR9 A;  3TP6 A;  3CKI B;  3WOF A;  2JE6 I;  2EYL A;  3K58 A;  1Y8P B;  3RZO B;  4XQJ A;  2NVQ B;  1PLF A;  4DXG A;  2MP1 A;  2F0Q A;  2SNM A;  4K2L A;  2EYH A;  1ILP A;  1V1O A;  4ZUI A;  1SJE D;  3H6M A;  1CA6 A;  1TR5 A;  1U9R A;  3C46 A;  2Z4H A;  1M4V A;  3ERO A;  3A7A B;  4FXK C;  1JIC A;  3CHB D;  3MXN A;  2AWN A;  4RGO S;  3GP7 A;  2JP1 A;  1EZ6 A;  2NVT B;  2B2U C;  4A3G B;  1QNK A;  1SYD A;  5K5P A;  2PZU A;  4PMB A;  3T16 A;  2F4I A;  4KY7 A;  1IW7 D;  1D5M C;  5CV7 A;  1JB3 A;  1AZQ A;  3V96 A;  1H9S B;  2KQ3 A;  2L5T A;  1KDC A;  1MGS A;  2M2L A;  1GHJ A;  4YIJ A;  1BCP B;  4J6H A;  4KHV A;  2E75 C;  1B3A A;  4KJN A;  2HUG A;  2OEO A;  5EPK A;  1IYV A;  5J22 A;  3J81 E;  1I50 B;  3D4W A;  1HCZ A;  1HUN A;  2GA4 B;  2KHS A;  4O42 A;  4IN3 A;  1V1P B;  4KI0 A;  1C48 A;  2J4X A;  4B9X A;  1A3U A;  3OWF A;  1FR3 A;  3TP5 A;  4Y7N B;  1UAP A;  1WTQ A;  2G9H D;  3FPP A;  3M4O B;  3GTM B;  2FJ2 A;  1Y69 U;  4K2K A;  3RD4 A;  5BN5 A;  3R3O A;  4TRD A;  3FEW X;  1SMY D;  3GTP B;  1SYE A;  4Z9C B;  5EPL A;  1F2L A;  1UUP A;  1I6H B;  2F0S A;  3OMC A;  4QB4 A;  1TY2 A;  4B9W A;  1B9N A;  4FXD A;  3NE5 B;  1DZ1 A;  4QF4 A;  3W3A A;  5D65 A;  3NTH A;  1G2T A;  3A8K E;  4U68 A;  5A2Q L;  1LTA D;  3NXW A;  4QCL A;  1PTO F;  3CU7 A;  4OO1 H;  1SE2 A;  3K5M A;  1LAC A;  1EY5 A;  4ILW A;  4ID6 A;  4IUQ A;  5C0X G;  1MSH A;  5IGF A;  1LT3 D;  4R8N A;  1S4Z A;  4JBW A;  1X3Q A;  3GTG B;  3NUC A;  2O4X A;  1LLR D;  4NMZ A;  3BYT B;  3CRL C;  3EFX D;  4WFN 3;  2EPB A;  4PMC A;  2A6H C;  3MHB A;  1RCV D;  2WKD A;  1JC7 A;  1HA6 A;  1STA A;  3KLS A;  2KCC A;  1FD7 D;  1DD2 A;  1G6Z A;  3SK5 A;  1Y1V B;  3K0Y A;  5IGG A;  1PRT F;  4G7Z C;  2H4O A;  4C3I G;  1T5E A;  4EGV A;  1DON A;  1GUN A;  1O7Y A;  3KLR A;  1Q12 A;  4KY5 A;  1EWC A;  2K7V A;  1PFB A;  4DNR B;  3DUZ A;  4ZQ3 A;  3R93 A;  1PTO B;  1SDF A;  3K5O A;  4IQZ A;  4WOR A;  2AUJ D;  1A2T A;  4K6L A;  5EJW A;  1JCK B;  3S17 B;  4XTC S;  1NR2 A;  2IW3 A;  4DA2 A;  2BDO A;  1JWU D;  4DU9 A;  1CQF A;  1I6V C;  4C3J B;  1W6K A;  1F9P A;  1YNN C;  5I9O A;  4RA8 A;  1GUG A;  3GD7 A;  1VMC A;  5I4D A;  1CHP D;  5D3I B;  1EY6 A;  2EOT A;  2Q8T A;  5E1F A;  4HCE A;  5HUR A;  1E2W A;  2YYZ A;  4OIJ A;  1TWH B;  2L4N A;  2JA7 B;  2PZW A;  1SYB A;  3M7N A;  2WB1 B;  1GJX A;  2JA8 B;  1G8Z D;  1EL0 A;  4RHS A;  1GXD C;  4RHR A;  2IJ0 A;  1D5X C;  3SR1 A;  1ICW A;  1JOO A;  3C1E A;  2JA5 B;  1F9S A;  4XYQ A;  1PRT B;  3D3R A;  2KA7 A;  4X3K A;  2J7Z A;  1B2T A;  5KND A;  1VF7 A;  4XYO A;  4K5V A;  1ENF A;  4RGT A;  1EYA A;  3K5N A;  1WTV A;  1LTI D;  4ZKB B;  1UNS A;  3PO3 B;  2AQ1 B;  5JEA H;  1EQV A;  4IUN A;  3P1H A;  3IKJ A;  1WVL A;  1KNE A;  1XYI A;  3OW7 A;  5A35 A;  2RSO A;  2R92 B;  2EJG C;  1R4P B;  1AW7 A;  2F0U A;  2F0N A;  4K5X A;  4OHJ A;  2EYM A;  2HQE A;  2B2U A;  4N9P A;  1G29 1;  1ZKO A;  4DXF A;  1WD0 A;  3TBI B;  4FYD A;  3HS0 C;  2KUM A;  3TP7 A;  1J9O A;  3A55 A;  1MD2 D;  2BA1 A;  2PZT A;  3SE0 A;  3A56 A;  3OPO A;  4X3S A;  1SXT A;  2JYO A;  1B44 D;  2E2J B;  1A2U A;  2A74 C;  1I4Q A;  4NDX A;  1CI3 M;  3BVZ A;  2I46 A;  2B8F A;  1B4O A;  5ELE A;  3OWE B;  5LL6 S;  2RQX A;  3IFT A;  1LV9 A;  4FF3 A;  4G7H C;  1KDA A;  2QF7 A;  4BY7 B;  1TS4 A;  3VR3 A;  4LAA A;  2X6L A;  1F2Z A;  2D2C C;  1J8I A;  3T56 B;  2R7Z B;  3X3M A;  2B39 A;  2DN8 A;  4I65 A;  3D4R A;  1L0Y B;  5C4X B;  2L11 A;  1Q8I A;  5COY A;  5TSS A;  4O1N A;  4ABN A;  4LMQ D;  1S5C D;  1R4Q B;  1BCP C;  1OO9 B;  1TWG B;  3S15 B;  1FNV A;  5CBA E;  4DK0 A;  3I73 A;  4IUT A;  2ICE C;  5T1I A;  3J80 E;  2F3W A;  2EXZ A;  3P75 A;  2R3Z A;  1JOK A;  2WAC A;  2CW0 C;  1EU4 A;  5JVG 3;  2K1B A;  1YNJ C;  3G7L A;  3FRP B;  4A3E B;  3CRK C;  2NN6 G;  4I7Z C;  1STN A;  4CJ0 B;  3I91 A;  2KED A;  2ICI A;  4PNY A;  3JAM L;  5CV6 A;  1JOR A;  1TKW B;  2K04 A;  4LJZ C;  4DK1 A;  4A3K B;  4FNF A;  3SK6 A;  2HDM A;  2XNA C;  4J1M A;  1LAB A;  1LTT D;  2LKV A;  4AYB B;  1SE4 A;  3FPU B;  3NWS A;  4ZRZ A;  2L0C A;  3QWN A;  2N55 A;  1M8A A;  3QJY A;  1SNO A;  2BCO A;  2IPK D;  2A68 C;  1U4P A;  4ZUJ A;  5JPM C;  1EIG A;  3DEO A;  3QIA A;  1IL8 A;  3U9O A;  4KN7 C;  4FXG C;  2EYO A;  2PW5 A;  1ET6 A;  4PV1 C;  5EPJ A;  4C2M B;  3MXG A;  5C4Z A;  1K83 B;  2EJM A;  1TS3 A;  4F87 A;  4CJ1 B;  4KTA A;  2EVB A;  3IFD A;  3IL8 A;  3LNN A;  2KCN A;  2B2Y C;  3I4M B;  5CMD A;  3VA7 A;  1OXU A;  2JXM B;  1ZEQ X;  4G57 A;  3ZYY X;  5I2Y A;  4K5W A;  3M4Y A;  1BF4 A;  1PTO H;  3I4L A;  2F1M A;  3VA5 A;  5IT9 L;  2A6H D;  1I4H A;  3A54 A;  1SNQ A;  5JEA G;  1LTS D;  2VUM B;  3PIO 3;  1WCM B;  3SVM A;  4XT3 B;  4DGZ A;  3Q0A A;  5KYL A;  2XN9 C;  3R8B A;  2F0F A;  1RF2 D;  3IAY A;  2EZV A;  2VXW A;  3EA6 A;  2DNC A;  1SE3 A;  3MAQ A;  2K5D A;  4JK1 C;  5I6Y A;  2ZT9 C;  5JEA J;  2FMC A;  1G91 A;  1PZK D;  3X3N A;  5JAV A;  2F0D A;  1KNA A;  3MVV A;  2NTT A;  3PO2 B;  4EQO A;  1I3Q B;  1STH A;  2ID0 A;  5M5X B;  4FO2 A;  1AZP A;  1EY8 A;  4BA1 I;  2KVM A;  4KV6 A;  1TVX A;  4L63 B;  2IWH A;  3PIP 3;  2O5I C;  1MI2 A;  3C1F A;  4Q5V A;  5JOB A;  3Q24 A;  1HTP A;  1PXU A;  1VF5 C;  1E2V A;  1JWM D;  1YNN D;  5AFW A;  5C44 B;  4G7O C;  3HOV B;  1Q1B A;  2E2H B;  1Z7T A;  2B2V C;  1CA5 A;  3DMU A;  1HA5 A;  2JA6 B;  1ENC A;  3VR2 A;  4KY6 A;  1SNC A;  1G2S A;  2E2D C;  1FGB D;  4DAP A;  4BBR B;  5CGK A;  3FDT A;  1HRJ A;  2F0I A;  3S14 B;  3E5S A;  3R2I A;  1Q1E A;  3K7A B;  3C3L A;  4A3F B;  1SYF A;  2O2L D;  2E2I B;  1I4R A;  4FF4 A;  3G6J B;  5HGT A;  1B50 A;  3S9W A;  4ME5 A;  2EDG A;  3MC0 B;  1PRT C;  1SND A;  2RKS A;  2F03 A;  4OO1 I;  1DYQ A;  2JEA I;  5NUC A;  3U9S A;  4FF2 A;  4C3H G;  2WII B;  5IGC A;  3GTO B;  2EYP A;  2V4D A;  1XWE A;  1RJT A;  2XSC A;  2K03 A;  3R2T A;  1D5Z C;  4KN4 C;  5EKI A;  5DEH A;  2HCI A;  3MXU A;  2E74 C;  1HQM C;  5IGB A;  3M3Y B;  2F0O A;  1Y8N B;  2F0M A;  4IFD I;  1KTK A;  4N9T A;  2LY7 A;  5D14 A;  4CHT B;  5CV9 A;  1QB5 D;  3LWE A;  5FO9 B;  3HOZ B;  3A8J E;  2F0J A;  3Q6S A;  4KKU A;  1EEI D;  4NP5 A;  2CQA A;  1STE A;  1EY0 A;  4BWG B;  3D8G A;  3EQL C;  4IFD H;  5C0X J;  5C3E B;  4A3I B;  4RH6 A;  2KOL A;  3N52 A;  4NKL A;  1IKL A;  2K28 A;  1II3 A;  3VYR A;  1EOT A;  4WJW A;  3QOJ A;  1OXX K;  3HOY B;  1QCB D;  3T13 A;  3J7A F;  2F0W A;  3LWU A;  1STB A;  4C3I B;  1DJR D;  1CQV A;  5JPN C;  1S5F D;  5ELD A;  4IUV A;  1KLU D;  1BBX C;  1S5E D;  4U67 3;  1A15 A;  3KBG A;  3T51 B;  2F0H A;  5D3D A;  3D4D A;  1BCP D;  5KNB A;  5KEE A;  2RVL A;  2L9H A;  1EY7 A;  1ESR A;  4K14 A;  5FO8 B;  1IHZ A;  1FNU A;  3HRZ C;  3OHX C;  1B1Z A;  3RZD B;  3NSW A;  2CW0 D;  1YNJ D;  3HKZ B;  1BNZ A;  1GUS A;  3GTK B;  1ET9 A;  3H3V C;  3D31 A;  4M8A A;  4L8J A;  4FP5 D;  4UDU C;  2IT1 A;  1BDO A;  2G9D A;  1U4R A;  3V05 A;  2EE1 A;  3A7L A;  2L12 A;  2B63 B;  5KNC A;  2B2Y A;  5A2Q E;  1I4P A;  3ERQ A;  3ITP A;  2A73 B;  5COR A;  1IYU A;  3F2U A;  2BE5 C;  4DF7 A;  1JOQ A;  3NBH A;  2AQ2 B;  1ONL A;  1PZI D;  3PUZ A;  2SDF A;  1Z47 A;  1O7L A;  3HEJ A;  5C6A A;  4RCO A;  1RHP A;  5M9O A;  1SYG A;  2LFN A;  2QKI C;  4RGM A;  1B9M A;  2K6A A;  2A69 C;  2A68 D;  3DXJ C;  5M3M B;  2QIL A;  3OMG A;  3H91 A;  2IX1 A;  1IKM A;  4G4K A;  2B2W C;  4R9W A;  1XX8 A;  2NVX B;  2D9U A;  4RFB A;  1HHV A;  4TKO B;  2RDG A;  5IGE A;  4A93 B;  3MA2 B;  3NHH A;  1ZYR C;  2XRS D;  1RTN A;  2H1E A;  3GTJ B;  1WD1 A;  3BYY B;  1NAP A;  4TQU S;  3PUY A;  2WKC A;  4HN7 A;  4QIW B;  3O13 A;  3DWA A;  2PPB C;  1CFM A;  2EY2 A;  1LT5 D;  5FOB B;  3ONA B;  4XT1 B;  2F0T A;  3BVG A;  2DNE A;  2ZXP A;  1MSG A;  3L7Z C;  4TSS A;  4LK1 C;  1EQT A;  3L9A X;  1F2Y A;  4CBV A;  4F7X A;  1BQQ T;  3SK8 A;  3K57 A;  2B2V A;  3D6W A;  3KBX A;  5CR3 A;  2FHT A;  4XIG S;  3NPP A;  3TZU A;  5FLX L;  2HCC A;  3MWY W;  5K36 H;  2C9O A;  5J1Z A;  3MZ5 A;  2L1B A;  4J8Q A;  4OO1 G;  3MTS A;  2K32 A;  3ND8 A;  5LL6 X;  2PW7 A;  5FKA C;  2DY7 A;  2BOS A;  4RGN A;  1S5D D;  2RBM A;  2NUC A;  1HQR D;  1ZXT A;  2EY5 A;  1TY0 A;  1PFM A;  4XXE A;  4F88 A;  2RDF A;  4F8M A;  1I4X A;  3I90 A;  5G3L D;  4KD4 A;  4HED A;  4CKB A;  3NBI A;  2NYZ D;  1GUO A;  3NQT A;  2FIN B;  2EY6 A;  4IFD G;  4C1N K;  1H9K A;  5JVH 3;  2K01 A;  4IUU A;  2FMM A;  1PFN A;  3HGB A;  3H09 A;  5ELF A;  1UEA B;  1GHK A;  4QMG A;  2EYJ A;  3DEP A;  2CVR A;  4PQX A;  3S2D B;  3NTK A;  3VYS A;  1QOH A;  2D5D A;  3WDN A;  4IFD J;  4HR7 B;  1EU3 A;  1LO5 D;  2IX3 A;  2KEC A;  2PQE A;  2WAQ B;  3NK9 A;  1PRT D;  2IL8 A;  3TSS A;  5I2X A;  2NZ1 D;  1H9J A;  4RAU C;  2PO4 A;  3M85 A;  1TT2 A;  5C5M A;  1JWS D;  2YU9 B;  3I4N B;  1TII D;  2SNS A;  1VMP A;  3K59 A;  1QJO A;  2O5J C;  3A8I E;  3BDL A;  2QDB A;  2VB3 X;  2MGS A;  2R6G A;  1ENA A;  3J81 L;  5C4J B;  1V43 A;  1SYC A;  3VYT A;  3QB3 A;  1GUW A;  1O7Z A;  4MIU A;  1F2M A;  5ELB A;  2TMP A;  2WP8 J;  5DAU A;  2R61 A;  1A6X A;  5ELC A;  4KK7 A;  4P2C B;  2NVY B;  4DAY A;  1LTG D;  3DM1 A;  5KYI A;  3RLF A;  1SEB D;  4EQP A;  1DM0 B;  5EKK A;  1WTX A;  1SSO A;  4GZY C;  1HTL D;  1FYC A;  2X6G A;  3VYU A;  4EVO A;  2PNR C;  2OXP A;  1EWH A;  2XVS A;  3EJI A;  5EKL A;  3VR6 A;  4KKT A;  4K6D A;  1LTR D;  3PUV A;  5BN3 A;  1EEF D;  3FVQ A;  1BO0 A;  2AQ3 B;  2WIN B;  4PMW A;  3OIQ A;  1KAA A;  3T53 B;  4K8J A;  4X3U A;  4V19 0;  1CTM A;  2F0K A;  2K05 A;  4HMI A;  3J7A V;  3E0J A;  1H9R A;  4NW2 A;  1CM9 A;  1ESF A;  3C2P A;  1SJH D;  4CGY B;  1O80 A;  5FK9 C;  4BS9 A;  1TS5 A;  3K5L A;  3BS1 A;  3KUP A;  2AWO A;  2JSO A;  2PYK A;  5E3F A;  4DNT B;  1PTO C;  4XQQ A;  1BUV T;  2VNU D;  1EIH A;  4IZ8 A;  1BOS A;  1RD9 D;  4DN4 M;  4HSP A;  1VDZ A;  5F2D A;  2M00 A;  1K8M A;  2B2T C;  4FVM A;  1V8Q A;  5M5Y B;  1PZJ D;  2B8G A;  2ENB A;  3K6O A;  3JAM E;  3OSO A;  1A3V A;  2B2W A;  1Q3L A;  1EY4 A;  1QE6 A;  2TSS A;  5DNF A;  5K36 G;  3BG3 A;  1Z6H A;  1CT1 D;  2Z1C A;  2F0L A;  4FF1 A;  1JQY D;  2L55 A;  3AMU A;  2NTS A;  2HDL A;  3HOW B;  2A6E C;  2BE5 D;  3OIP A;  4RWS C;  1AFP A;  1C8C A;  1KAB A;  4HAE A;  2A5H A;  3L3O C;  5I6W A;  3S1N B;  5C3W A;  3MFY A;  2QEJ C;  2NBF A;  2R93 B;  1B53 A;  2A69 D;  2F0E A;  3KF8 A;  4KKS A;  3I3C A;  3SDZ A;  4C3H B;  2OF1 A;  5JJZ A;  5EQ0 A;  2F0V A;  3W2D A;  1LT4 D;  1F9R A;  5DM6 3;  3TN2 A;  3QO2 A;  2RSN A;  5IT9 E;  3S2H B;  1HPC A;  2K33 A;  2MJ8 A;  1ZYR D;  4RKL A;  3LX0 A;  3DHQ A;  5C5L A;  3BVM A;  4DFA A;  3TME A;  1H9S A;  2OT2 A;  4H0L C;  1HXY D;  1LTB D;  1D6E C;  4XDX A;  2K5Q A;  2EY1 A;  5G3L F;  5LHY 1;  3GQB A;  5E4W C;  2K5W A;  3WOE A;  1U4L A;  2CHB D;  5CC4 A;  2MUY A;  3E6Z X;  1CZG A;  5KIX A;  1U4M A;  2WV6 D;  1ML0 D;  5IIF A;  2QCP X;  3GO5 A;  2LMC B;  4A3M B;  1L0X B;  4OL7 A;  2NN6 I;  1V1P A;  1NUC A;  4QUF A;  1QNU A;  4MN3 A;  1EY9 A;  3QG1 A;  3GV3 A;  3MEH A;  2F0G A;  3J7Y W;  1S5B D;  2DY8 A;  1WTO A;  1T5X D;  5CV8 A;  4KHZ A;  2Q8I B;  1RDP D;  1SNM A;  3VR5 A;  1DXM A;  3KLS X;  3M7G A;  2E76 C;  3KK7 A;  2RA4 A;  1MBY A;  2NN6 H;  5EBD A;  1HUM A;  1QG7 A;  1H9M A;  2XWB B;  5FO7 B;  1EZ8 A;  1KLG D;  3BZD B;  3BDO A;  3SXH A;  2XRQ D;  2X69 A;  2F0P A;  2SEB D;  2JEB I;  3SHL A;  1K8O A;  5M3F B;  5J39 A;  1IW7 C;  4HTH A;  3T4A C;  1TWC B;  1DOK A;  2IX0 A;  3FMC A;  4M1U B;  2EYF A;  4IUP A;  4C3J G;  5M5W B;  1D1K A;  4HCS A;  3NWT A;  5IOD A;  1RTO A;  3V2T A;  4HMJ A;  1WTR A;  1OXS C;  1CK1 A;  3FKI B;  2C5C A;  2M9V A;  1Y8O B;  2NWG A;  4BBS B;  1EYC A;  3UI2 A;  3RUZ A;  1E0B A;  3ND9 A;  4MHE A;  4ZLT F;  2Z4I A;  4C1N I;  1NSN S;  4CKC A;  1SFO B;  4H7B A;  4A3D B;  4HSV A;  3J80 L;  1W6J A;  1QWY A;  3GTL B;  1XTC D;  4V0B A;  1PMR A;  3URY A;  2LS0 1;  3PUW A;  1SBB B;  1SMY C;  3VR4 A;  3I72 A;  4A3J B;  4WRD A;  4KMU C;  1D1I A;  1CHQ D;  2MPM A;  2F3V A;  1JE4 A;  3S16 B;  1EYD A;  1FNW A;  1Y1W B;  3PV0 A;  4BY1 B;  3NP8 A;  1DCZ A;  3GV6 A;  1HFG A;  4IAL A;  1PYW D;  3CQZ B;  3SEB A;  1A3T A;  4A3B B;  3S1R B;  4C56 C;  1NR4 A;  5KRU A;  2MHV A;  4ZAI A;  2ZXO A;  3H94 A;  1O78 A;  1XXG A;  4S3S A;  1HFN A;  2J0T D;  2RDH A;  2B2T A;  1TWA B;  3NQI A;  1TWF B;  3HOX B;  4KD3 A;  1GOZ A;  1E2Z A;  3SK4 A;  3Q22 A;  1OXV A;  5IOC A;  1TU2 B;  5CV4 A;  3PMF A;  5DM7 3;  1LT6 D;  1AP0 A;  3H0G B;  2KEE A;  1X32 A;  2PMZ B;  5T1G A;  4BA2 I;  4H13 C;  5KGU A;  2FFK B;  1NCV A;  2XIW A;  3GTQ B;  5IGD A;  4CKE A;  1PTO D;  3HP3 A;  1DOM A;  2AUK A;  4XQN A;  4E6I A;  3I8Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...