4K8IA

Crystal structure of staphylococcal nuclease mutant i92v/v99l
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
135
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYVYADGKMLNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4k8iA00
5EKKA 5I9OA 5KGUA 5C6AA 2RDFA 3HEJA 5CV7A 1SYFA 4HTHA 1STYA 2RBMA 2LKVA 2O4XA 2PZUA 2NUCA 5HGTA 1TT2A 2OEOA 2RKSA 2SNSA 3P75A 4PMBA 5E1FA 4KV6A 3EVQA 1SNCA 5NUCA 5E3FA 1EY5A 2EY5A 2WACA 4QF4A 2EYHA 1STAA 4IZ8A 4KY6A 4N9TA 3SXHA 1KDBA 4NMZA 5HURA 5KYLA 5KRUA 4NDXA 3D4DA 1A2TA 1EY9A 4K2KA 5CR3A 3U9OA 1NUCA 2F0LA 3OSOA 5I6YA 4J6HA 4K2LA 5F2DA 2F0MA 4I65A 3LX0A 2F0OA 3T13A 5JAVA 2F0VA 5C5LA 3NUCA 4K5VA 4KJOA 2SOBA 1A3VA 5K5PA 2PQEA 1SNOA 3QOLA 2PYKA 4TRDA 5KIXA 1SNMA 5KYIA 4KJNA 3MHBA 3NHHA 3PMFA 1F2YA 2F0DA 3MZ5A 4J1MA 2PW7A 1EY8A 4K14A 2F0KA 4EQOA 2EXZA 1IHZA 2QDBA 3V2TA 1KABA 3SK8A 5CV4A 5C3WA 4DU9A 3E5SA 4S3SA 3R3OA 2F0PA 4ODGA 2EYFA 5J1ZA 4WORA 5ISRA 3OWFA 1STBA 1ENAA 1EYAA 2PZTA 5I6WA 2EY6A 2F3VA 2SNMA 4YIJA 4DGZA 3VA5A 3ITPA 2F0TA 5CV6A 1SNDA 5IGEA 3D4WA 2EY2A 1NSNS 3BDCA 3H6MA 5JOBA 1TR5A 4EQPA 5CGKA 5IGFA 2EYOA 5M9OA 4IUNA 1JORA 4H7BA 2F0GA 4B9XA 3DMUA 4QMGA 1F2ZA 1SYGA 4DF7A 5J39A 3D6CA 4KTAA 3TMEA 1KAAA 3P1HA 3QOJA 3DHQA 2F0EA 4N9PA 4KY7A 5CV5A 2OF1A 1KDCA 3C1FA 2M00A 3MVVA 4KD4A 4ZUIA 1EYDA 1EY0A 1SYBA 4K5WA 5C3XA 1STNA 3NQTA 5IIFA 5IODA 2OXPA 3HZXA 5IOCA 4ZQ3A 2F0WA 4ZUJA 2KQ3A 1EY6A 4HMIA 3SHLA 3MEHA 4K5XA 5DAUA 3SK6A 4LAAA 5IGCA 2F0JA 2HQEA 2EYMA 3C1EA 4KY5A 4OL7A 4PNYA 5IGDA 5I9PA 2F0SA 4EQNA 3EJIA 2EYPA 1AEXA 1A3TA 1II3A 1STGA 4KHVA 4PMCA 4EVOA 2F0NA 4RKBA 4RKLA 3OMCA 1U9RA 3TP5A 2EYJA 2F0HA 4B9WA 2F3WA 4IALA 4K8JA 2PW5A 1KDAA 3NXWA 3MXPA 1SYCA 4ID6A 1JOKA 4ME5A 5EGTA 4K8IA 1ENCA 1EY4A 2EYLA 3SK5A 1JOQA 3TP8A 5KEEA 5C4ZA 1EYCA 1F2MA 1A2UA 5CC4A 3D8GA 2ENBA 3NP8A 3SR1A 2KHSA 3RUZA 1EY7A 4QB4A 4HMJA 5C5MA 1RKNA 1JOOA 5C4HA 1TQOA 3S9WA 4R8NA 4NP5A 1EZ8A 4KD3A 3T16A 5CV9A 5J22A 1SYDA 4F7XA 1SNQA 5IGBA 4MIUA 3SK4A 4F8MA 1EQVA 1A3UA 4G57A 3QB3A 2EY1A 5EKLA 2F0UA 3BDLA 5DEHA 5IGGA 2F0FA 2F0QA 4NKLA 2F0IA 1SNPA 3TP6A 1EZ6A 3NK9A 4WRDA 4DFAA 5CV8A 3EROA 4E6IA 3ERQA 4K6DA 2PZWA 3TP7A 1STHA 1SYEA 3OMGA
chains in the Genus database with same CATH superfamily
4DR5Q 4NXNQ 1JICA 3FHWA 3G4SA 3SVMA 1I4RA 5IYCG 3FKIH 3HOVB 3BG3A 3PCOB 3SXHA 5HURA 5KYLA 4A3CG 3E0EA 1XPUA 1O7LA 3K5LA 4IOAA 5I6YA 3M4YA 2OTJA 2RSOA 3BJUA 5EAYA 2K32A 2AUKA 5KIXA 1A3VA 5K5PA 3K5NA 1K9MC 1MBYA 2IX1A 3PUYA 1UUPA 3RD4A 1TY2A 3B6YA 1C48A 5ELEA 2F0DA 3Q6SA 2RQXA 3STBC 5BR8L 1H9MA 5M3MG 5COYA 3EA6A 4DAYA 1MKHA 4BBSG 1ILPA 3QG1A 3G7LA 4S3SA 5DM73 1XPRA 4WORA 3OWFA 3D4WA 4LF8Q 2AQ1B 2SDFA 1K83B 2NN6I 4LF6Q 2F0GA 2HQLA 3TS2A 2F3IA 3NTHA 4OONA 4A3FH 1G8ZD 5IP9H 4LF9L 1DZ1A 1X56A 2B63H 1VQIA 2B39A 1E24A 2KQ3A 2UU9Q 1B50A 1P8LA 1QWYA 3U58A 5IGCA 4BXXG 1R9TB 3CPFA 3OW2A 4QCLA 1N36Q 2VUMB 2NYZD 3DLLA 1SMXA 3HFZB 2PW5A 3I90A 1BR9A 4HSPA 1VQFA 4ME5A 4LWCA 1EY4A 4A3EG 3CP0A 3Q8DA 1FR3A 5JEAG 1PFNA 3S16B 2K05A 1YHAA 3SEBA 4JI4Q 4CHTB 5C4HA 3TN2A 1CUKA 1CK1A 4NP5A 1FGBD 1HZCA 3PUWA 2E76C 2ZXPA 2KOLA 3L0OA 4MIUA 5DEHA 3S14B 2UUBQ 1C9OA 2EPBA 5KNDA 4DUYL 4TSSA 3TZDA 4JI8L 2PZWA 1Q12A 3C46A 4IFDI 1PH5A 5KGUA 1H9SA 2N78A 2KVMA 3NENA 3K59A 3GTLH 1VQOA 2LKVA 2N3SA 5GAGC 2VB2X 1VF7A 5IYDG 1TY0A 3LWUA 1JC7A 5NUCA 2A68D 1HUMA 5CBEE 2AQ3B 1B44D 2QW7A 3I4MH 1LT3D 3UI2A 5I2YA 1QILA 2NWGA 2MUYA 2NTSA 1XNRQ 3SDZA 1ZEQX 3QOLA 1SNOA 2O5JC 1SNMA 3IKJA 1PRTD 3NHHA 2R7DA 2QILA 3NPPA 1E1TA 4C3IH 2AMCB 1EY8A 1K3RA 2UXCQ 2EXZA 4XXEA 1R4QB 5LMNQ 2F0PA 4EX5A 3D0FA 2DUDA 3HKZG 1IBLL 2A6HC 3HG9A 3HOZG 3MEFA 4C1NI 3A54A 3BDCA 2A6ED 1CZWA 3PO2G 4M8AA 4HJ9A 3QJYA 3VDYA 5C4XG 2L15A 3TDQA 1LTRD 2NVXB 2R92G 1PMRA 4ZCKA 2LXKA 5ELOA 3GD7A 4JW0A 2UUAL 4PV1C 2RVLA 3HOVG 3DWAA 1VQKA 3S1NB 2EYMA 2E2JH 4FF2A 1AEXA 4RFBA 1V1QA 2Y0SE 3MXUA 4WFN3 3TP5A 3I7FA 1I3QB 1CQVA 2E74C 4MN3A 3MTSA 4DR4L 1T9HA 4HJ7A 1AZPA 4K8IA 4CDDC 5GADC 4FF4A 1HR0Q 2E2DC 5IYBH 2JSOA 1EWHA 1EIFA 1KIXA 2ENBA 1BBUA 4DR7Q 5IE8A 4X64Q 1Y1WG 1BCPD 3PO3B 1TQOA 4HJ8A 4KD3A 2A73B 1E3PA 3TRZA 2M2LA 3NWSA 4JV5Q 4A3GB 4JYAL 1HXYD 1JJGA 3BDLA 4DV4Q 4C3HB 3I4NB 1EZ6A 2I5MX 2K5NA 3ERQA 4IN3A 2QCPX 2EOTA 2C35B 1SYEA 2TSSA 3FMCA 5JJZA 1AFPA 2PMZB 3J7ZC 4KKSA 1JWUD 3FP9A 4HCEA 4Y7NB 3K7AB 2RBMA 3GTOB 4JI2L 4DV0Q 4OWXB 5LMNW 2MQHA 2NVTB 2JYOA 4KY6A 3A5UA 4NMZA 1J6QA 4JI0L 3CRLC 1BOSA 2VUMG 2F0LA 1E7ZA 4CKBA 4J6HA 5F2DA 3S15H 2CFMA 2R93H 3T13A 2VQEL 5KRUA 2PQEA 2HT1A 4GN4B 4A3JG 1F9SA 3E9HA 3H91A 3H0GB 1PH9A 5C3EB 1PRTF 1GUNA 2D0PA 4KLKA 1CSPA 1DONA 1LTSD 4DU9A 3MXNB 2EYFA 3J80E 4X3SA 4UP9A 4A76A 4R8IA 4HIOA 2WB1B 2EY6A 2SNMA 5C44B 4A93G 2VXWA 5JOBA 4EQPA 4K0KQ 2EYOA 2ATWA 5M5YB 4NW2A 4V0BA 4KTAA 4IOCA 2KJXA 2E5LL 5ELDA 1I94Q 3HOXG 4DR6L 1H9KA 5FK9C 1SFOB 1SJHD 1EY0A 1SYBA 3K0YA 2I5HA 1MSHA 3W5OA 1LM0A 1STNA 2FINB 3S2DH 2OXPA 1PTOH 3HOUH 5LL6X 4A3MB 1PVOA 1GUTA 5D3DA 5DAUA 1U0LA 2LS01 1GHKA 2EYPA 1YNXA 5IGFA 2EYJA 2YTXA 1SYCA 5IWAQ 3TREA 1PTOC 1EYGA 3ND9A 2VQFQ 2WFWA 5L37A 4G7ZC 4LFBQ 4NPSA 3X3NA 3A74A 2J7ZA 3GTPH 1IBKL 5C5MA 1WOCA 1RKNA 4ILWA 2JJQA 1U5KA 3S9WA 1KXLA 4JI1Q 1BCPF 1HNXL 3A8JE 5FKAC 2K5DA 4DK6C 5C4JH 1U4PA 2F03A 2ZJPA 4FVMA 4LUZA 4A3DH 2L9HA 3NBHA 1DCZA 1U4LA 3AEVA 1VQEA 1ASYA 1BO0A 1IW7C 1V1PA 2WAQE 3VR2A 4RHSA 2EJFC 1STYA 4H13C 4RH6A 1ENFA 4YWLA 5C0XG 2EY5A 3GTLB 3I8ZA 4LFAQ 4C56C 2NZOA 4BY7B 3W3AA 2JA7B 2B2VA 3MC0B 4OWTB 3HOYH 4QQBX 4QJFA 2RSNA 1PFBA 1A62A 2BCOA 3CRKC 4H02A 4TQUS 4KN7C 3RNUA 2CHBD 4J15A 3WDNA 3PO3G 5K36H 5FLXE 2BOSA 1WTWA 4C3IB 1M8AA 1QNUA 3KF8A 3NWTA 4C1NK 3HOWB 4NXML 2A69C 2F3VA 4A3IB 4AQYQ 4A3GG 3T1YL 1EOVA 5CGKA 3CW2C 1RTNA 2KBNA 4UHVA 4C3HG 3I4NG 1YJNA 1ESFA 4H7BA 3F1ZA 4LF5L 4KHPL 4A3LG 1CKMA 2KENA 2UXBQ 1I6VC 1EQTA 4OIKA 5CV5A 3C1FA 2WKCA 4KD4A 4XQJA 5FO9B 2LSSA 3NTKA 1D5XC 1STEA 3DWPA 3RR5A 2DGYA 4ZQ3A 3K5MA 4JI6Q 4B3RQ 5AFWA 4LUVA 3SHLA 3RZDH 2IL8A 2CW0D 3VR5A 1WCMH 3CCVA 3FKIG 1YJ9A 1II3A 2L11A 3ZYYX 2F0HA 2LXJA 3KLWA 4UAIA 1QB5D 3V05A 3NXWA 4HIKA 1C0AA 3P20A 1BF4A 1I4PA 1WFQA 2F52A 1D1KA 1Y1VH 5AJ3L 2EVBA 1A2UA 2AWOA 3PSIA 3I2ZA 2KHSA 4XDXA 4LF7Q 1F9RA 1K0RA 1XTCD 1I6HH 2WB1G 4JI3Q 1XMQL 2XN9C 4O0AA 1OTCA 5CV9A 5J22A 5IY0A 3H15A 4LFCQ 1SNQA 1L0WA 2Q8RE 1TWHH 1AW7A 3HGBA 2MPMA 4WRDA 1CKNB 3J81i 3CMEA 1IXRA 2AHOB 1TXYA 2EZVA 4JBWA 5EKKA 4L63B 4DR5L 4P75A 3ER0A 5EPJA 1IBKQ 3T4AC 5M3MB 4A3FG 4A3MG 5IP9G 2ZTCA 4BBSB 2B63G 1D5ZC 5CMDA 1ZYRD 1GUWA 5LL6S 4DV6Q 2KUMA 4BWGB 3PF5A 3LX0A 4R1JA 5C0XI 3BYTB 3K80C 5C5LA 1VQGA 2XSCA 1ML0D 1GXDC 3NQIA 1NAPA 4KI0A 2ID0A 4J1MA 3M9BA 1QUQA 1J8IA 1KL9A 2VB3X 4GN3B 2PQAB 4OO1H 1X3EA 2K50A 1PH2A 1L1OC 1PYWD 4Q0FA 4OEMB 3ITPA 4Y52H 2Z0SA 4JOIA 4LF8L 1NY4A 1LUZA 3VA7A 2KCCA 4LF6L 1J5EL 1Q46A 1NR2A 2K28A 4WJ3M 1HRJA 1TWFH 1RCVD 1TWCH 4FP5D 4A3EB 4GNXC 2H1EA 3BZKA 2XVSA 2KHJA 4A3BH 1D7QA 1PH1A 3J81j 2UU9L 4FXDA 2EDGA 4X65Q 3L9AX 3AMUA 4PNYA 1PTOB 1BKBA 1PZKD 4BY7G 3M3YH 3KDFA 1LT5D 1X3FA 4DR2Q 1N36L 2BE5D 4LF5Q 4WJWA 2GVAA 1WTPA 1DM0B 3I4MG 2Q2IA 2E2IH 3U50C 2EYLA 1M90C 1X6OA 2CCZA 2E2HB 1XNQL 4CKEA 1CZGA 5FOBB 5M5WH 3V96A 5JPMC 5GQOA 4C3IG 4MTKA 3U4VA 1UAPA 2R3ZA 5FLXc 3GTMB 2KHIA 1N34Q 4DV5Q 1RJTA 2PI2A 1YITA 4AYBB 3I70A 4FO2A 5LHY1 1MIUA 5ELBA 1OO9B 2AUJD 3CHBD 2YV5A 1TWAH 4DK3C 3I56A 2UUBL 1LLRD 2F0IA 3J7A5 4IPCA 3KYHC 1DGSA 2JA8H 1N8RC 4QGUA 5C6AA 1HTPA 3ULJA 3AU7A 3DEPA 3L3OC 1I50B 2C9OA 1XMQQ 4QF4A 4MNOA 4CDCC 1WVLA 3F8TA 4NDXA 3GTGH 4K2KA 1KHIA 2B2TA 3PIPA 3HOZB 3VR6A 1EU3A 5DM63 3E0JA 1PZID 2ZXRA 2F0VA 4K5VA 1XNRL 1PH8A 3S1MH 1I5FA 3GO5A 3I55A 4ZLTF 2K4KA 3IFDA 3HOYB 1Z47A 5DNFA 2R92B 2UXCL 3U9SA 5IYBG 4YY3Q 4C2MB 1YHQA 2B2UA 3TBIB 3F2BA 5LMNL 2XRQD 1Q90A 3J80L 4RGMA 1HQRD 5FO8B 4ZKBB 1JORA 2K14A 4UY8C 1PXUA 1X32A 3S2HH 1SJED 2K6AA 1K0SA 2ZTDA 2IT1A 2Q8TA 1SE2A 4AH6A 1V8QA 4WJ4A 1Y1WB 3JC66 5D14A 2MFIA 2VNUD 5M5XH 4KHVA 1NBWA 1PZJD 2CWAA 4KN4C 3OMCA 2ZJRA 4DNRB 1KLUD 1JT8A 1J5EQ 5FJ8H 1FJGQ 3VYUA 1CTMA 1CHQD 2R93G 2PCFB 5C4ZA 3GTJH 1HR0L 3KBGA 2CH4A 1X54A 1ET9A 3R2IA 1B8AA 1Y1VB 2B3GA 3CC2A 5FO7B 2NVQH 3EN2A 4DR7L 4G7OC 4X64L 1QZHA 4C3JH 1EZ8A 4RGOS 3UDGA 2WIIB 1IYUA 4UP8A 3A56A 4YHHL 1EQVA 1A3UA 3QB3A 2EY1A 5EKLA 4JV5L 3RZOB 1ICWA 3BS1A 1IKMA 1HHVA 3W1GA 1IL2A 4DV4L 4DFAA 3FDTA 3RLOA 4A3JB 4JI7Q 4LMQD 1XNQQ 1GOZA 3BVZA 4F88A 3OPOA 1EU4A 1QG7A 4DV0L 3WOFA 3CCEA 1EY5A 1UNSA 3N6RA 5GAEC 2K52A 2YU9H 3HOUG 2A19A 4ZAIA 1EY9A 4M1UB 1YHBA 1NUCA 1G91A 4A93B 2DJFC 4OX9Q 2B2YA 2I07B 5H1SE 2ES2A 4TRDA 2M9VA 1KQSA 2H5XA 3S17H 2V1CC 2WINB 3D6WA 3E6ZX 3HOXB 3NE5B 5BN3A 1KRSA 3SK8A 1L1OB 2JEBI 4XYQA 5BN5A 2QDLA 5FLXL 1RHPA 3CQZB 4POGA 3DEOA 2PZTA 4AYBG 4YIJA 3A7AB 4JI5Q 4XQQA 4K0KL 2QKIC 3KLRA 4B9XA 1SYGA 1NMFA 1BBXC 4IPHA 4GNXB 1BQQT 5EBDA 2Z4IA 4OHJA 3GTKH 1PFSA 2A6HD 4A3DG 1I94L 2WP8J 1M1KC 4QIWE 2HDMA 3ICEA 3I4OA 2HD3A 2AKWB 1TWGB 2I5LX 1EY6A 1JMCA 1C8CA 4A3BB 3NBIA 2K1BA 2N8NA 2B8GA 5A35A 2BDNA 2Z4HA 1YNNC 2EQSA 2ASBA 4ZRZA 1SE4A 1PH7A 5ELCA 2F0NA 3BU2A 2Z6KA 4RKLA 1U9RA 2K7VA 3M7GA 2K01A 1NNXA 2UXDQ 2N49A 5IWAL 3ULPA 2A68C 4OXPA 2VQFL 3DUZA 5KEEA 3HOYG 4BBRH 4HIDA 1X3PA 4LFBL 1HZBA 1HTLD 1KRTA 1EQRA 2MHVA 1WTXA 4HCSA 3RLNA 4RA8A 1F9QA 5TSSA 5K36G 1PRTC 2D0OA 4JI1L 2VY3A 2JA9A 1G2SA 3PIOA 2FFKB 3Q23A 2MP1A 4F8MA 3R8BA 1PYBA 1VQCA 4X66Q 1QNKA 1VQJA 2L12A 1JE4A 4UDUC 4BA2I 1SDFA 4K6DA 2N55A 1SN8A 4K6LA 4FNFA 1KLGD 5I2XA 4RGTA 3MXNA 5I9OA 2PZUA 2SNSA 1Q8KA 1NCVA 3Q24A 2EYHA 1STAA 1KDBA 1P16A 4YHHQ 4LFAL 3GTQH 1UE6A 1HA5A 2NBFA 3G6EA 4OIJA 2F1MA 3TEHB 4H44C 5KYIA 3J7AF 4R4OA 2BA1A 1A0IA 1Y1VG 3VYTA 2OWOA 1LACA 2R61A 5E4WC 2XIWA 3GQBA 1STBA 4IUPA 1WTQA 1L0YB 4AQYL 3H6MA 1EIGA 3FKIB 1C4QA 1EIHA 1HFNA 1E2VA 1BCPC 1W6JA 1HFGA 4FDBA 3IAYA 1QVFA 4FXKC 3DHQA 2UXBL 3CXCA 3MVVA 4ZUIA 4YCWA 4XQNA 3S2HB 1TU2B 5IODA 5M3FH 1JR0D 4ULLA 4B3RL 4HJAA 1UE7A 4JI6L 3M4OH 3KJOA 3VYSA 1W3SA 1VS0A 4HR7B 1E22A 3FPPA 2JA6H 1XX8A 4GS3A 4IUTA 3QWNA 3S1RH 4XT3B 3RMHA 1YI2A 5CC4A 1SAPA 3D8GA 3EBEA 4GKKQ 4DV2Q 2KCMA 4BXXH 4LF4Q 1EY7A 2DY7A 1YNJD 1PTOD 4LF7L 4RGNA 3VYRA 1K8AC 1WJJA 4KHZA 4A3FB 4JI3L 2B63B 3D3RA 4LFCL 4OO1G 3K8AA 2EJMA 3JAMi 5IGGA 2EE1A 2F0FA 3MFGA 4RCOA 3TP6A 2NB0A 4Q5VA 1LTAD 3AFQA 4P72A 2PNHA 1CQFA 1IBMQ 2JXMB 1TKWB 3IL8A 4CDEC 4BY1H 1GUSA 2VS1A 4DK0A 4GOPC 4A3BG 1OXVA 4RHRA 3ONAB 2K03A 2FHTA 4GKJQ 1NTGA 2HIVA 1LTTD 4DV6L 3PUXA 1YBYA 2F0MA 2HCCA 2IX0A 3SGIA 1EIYB 4KJOA 5JPNC 4DR3Q 1F2YA 3HKZE 2PW7A 4NB3A 1M4VA 4EQOA 2BDOA 4JBJA 4PZ8A 1DYQA 2WV6D 1F2LA 1KC8C 1FGUA 1KTKA 4MHEA 1A6XA 4ODGA 5ISRA 1EYAA 1YJWA 1LTBD 2K5HA 3KJPA 1PH4A 2QA4A 4XTCS 3CCLA 1LT6D 3A0JA 3I4MB 1JB7A 1LV9A 2EIFA 1FD7D 3NTIA 5KNCA 2JA8G 1LTGD 1EYDA 2NVYH 3OTOQ 1VQ6A 2PI2E 4K5WA 4JPBW 4DV7Q 3NQTA 2KCTA 3CCJA 4ZUJA 2ZJQA 4X3UA 3MEHA 2K5WA 2F0JA 2HQEA 4UP7A 3Q22A 4ALPA 1D8LA 4X65L 4A4IA 3S1QH 4G7HC 1CKNA 2BA0A 4R4QA 2F3WA 1KDAA 4DR2L 3KLSX 1AE3A 1ENCA 2F4IA 1TS3A 3BVGA 2IWHA 1H9JA 1MGSA 1TS2A 2K33A 1EFWA 4A75A 1S4ZA 1FNUA 2QEXA 1Z9FA 3BDOA 1JE5A 5FLMH 1XMOL 1PTOF 1VQBA 5J3BA 5LMUQ 4DV5L 1N34L 3AYHB 2XGTA 5GROA 4UPAA 1X3GA 1ZKOA 1YZ6A 2DNCA 2E2JB 2IJ0A 1DOKA 4QY7A 3CCSA 4OO1I 4GZYC 2IPKD 2PQAA 4HTHA 4KV6A 1FNVA 1XJVA 1K83H 4IJLA 5JJIA 1GJXA 3J80c 4Z9CB 3F2CA 2D2CC 3K0XA 1PA6A 1E2WA 5IT9E 1G2TA 2SOBA 3D4RA 3GTQB 2CW0C 4KKTA 3PMFA 2B2TC 5FJ8G 2CH4W 4JCVE 3CCQA 2Y0SB 5JJKA 2GA4B 4JC0A 3RN5A 1R9TH 5CV4A 1V1OA 4YY3L 3R3OA 1SXTA 5J1ZA 2R6GA 1NJIC 3A55A 1W2BA 5JJLA 1KD1C 4C3JG 2OTLA 3CKIB 1CSQA 1OXSC 4DUZQ 4PQXA 1X9NA 4FF1A 4JK1C 3D6CA 3S16H 3QR8A 2H4OA 4DN4M 2M00A 1QOHA 3S15B 3W2DA 4HJ5A 1XWEA 2R93B 3FEWX 1NR4A 1LTID 2HCIA 1CM9A 5C3XA 3M7NA 3GV6A 4TKOB 3S14H 1B4OA 2LFNA 5D65A 3K58A 1H95A 3SK6A 4LAAA 3C1EA 2L5TA 2IY5B 2KEDA 4CBVA 1X3QA 2D62A 4O2DA 5M3FB 1DOMA 4PMCA 4A3KH 2CQOA 3MFYA 1EFID 4IALA 4K8JA 3MXPA 4L5QA 2ZM6Q 1FJGL 3PGZA 2QEJC 3RLFA 1JOQA 1ZYRC 1PYSB 3I73A 1EYCA 2ICIA 1UWVA 1ONLA 2OQ0A 3M4PA 5ELNA 1LABA 4R8NA 1ESRA 4AIMA 4RWSC 3WWVA 5I4DA 3NEMA 3S2DB 4HEDA 1VQMA 3HOUB 2L55A 4XIGS 4NKLA 5HGTA 2KCNA 3FRPB 2RA4A 3KUPA 5EKIA 2Q2UA 4IPDA 1RDPD 1DOLA 4JI7L 2UUCL 5EQ0A 5CV7A 4DAPA 2NUCA 3F2UA 3C3LA 3FVQA 3P75A 1XMOQ 2WACA 3AFPA 3GTPB 4RG1A 4JBKA 1JWSD 3D4DA 3OHXC 3RN2A 3GV3A 4CJ0B 2NVXH 1PH3A 2R7ZH 4X3KA 1EWCA 3X3MA 2Q2TA 1DD2A 4IJHA 5E7NA 3PIP3 4B3TQ 3BZDB 4OX9L 4LK1C 5C4JB 1ZXTA 1WYDA 1SMYD 1MD2D 2NZHA 1HUNA 1B3QA 4A3DB 3S1NH 2K04A 1SR3A 3J7AV 1SRUA 2YTVA 2B2YC 2BE5C 4X3TA 1G6ZA 2YYZA 5E4XA 4BBRG 4LNQA 1I3QH 2MGSA 4OELB 4LJZC 2Q8IB 1K8GA 2CWPA 4HIMA 3NSWA 1T5EA 5EJWA 1N33Q 1IYJB 5GAHC 2PMZE 2EY2A 3CD6A 3T1HQ 1VMPA 4JI5L 4QMGA 5J39A 3UDXA 2GVBA 3S24A 5G3LD 3BVMA 4KY7A 1AN8A 2CKZB 1RIPA 3CC4A 2HUGA 1LYLA 2MJ8A 1KNAA 4B3MQ 4A3GH 3HZXA 2J0TD 2Z6BA 4K5XA 2WAQB 2KECA 3T51B 2FMMA 3STBD 1B9MA 1HZ9A 3N52A 1B70B 2DY8A 2JA5H 3H3VH 3KK7A 2UXDL 2ZT9C 5KNBA 3ERSX 3K7AH 4U68A 5IT9c 3GTOH 3TP8A 2L1BA 4DR1Q 2WB1E 1UE5A 2Y0SG 4DKAC 2HHHQ 2NVTH 2OT2A 2Z6KC 4EGVA 4R4TA 3SR1A 1SROA 4KMUC 4GLVB 1SBBB 4DK1A 1CKOA 2K75A 3H3VC 4L5SA 1EOTA 3T16A 1HNWQ 4XYOA 4G57A 3BZCA 3H0GH 3RZDB 5C3EH 3URYA 1WCMB 3A8IE 4X66L 3C2PA 3T53B 1JOOA 1L1OA 5BN4A 3E9IA 2Z1CA 4DNTB 1MJCA 4OGQC 3KF6B 2VW9A 2O2LD 2X69A 5C44H 1CA5A 2O5IC 4PMBA 4APVA 4IUUA 4LUOA 5M5YH 4N9TA 2J4XA 5M3FG 1KNEA 4ZYSA 4PZ7A 1VQLA 4GNXA 1I6HB 4K2LA 2IHEA 4I65A 3IRBA 1XPOA 1SFOH 3AQQA 3NUCA 4CGYB 4F87A 2JA6G 1IZ6A 1GHJA 1TWHB 3M4QA 3NELA 3UDIA 3JAME 4B3SQ 4A3MH 3QIAA 2F0KA 2UUCQ 4DV1Q 1VF5C 2K5VA 3ND8A 1DJRD 1GKHA 1HCZA 1JJ2A 4PG3A 3UDFA 1ENAA 1WD0A 5CV6A 4I7ZC 2F4VQ 1AP0A 5M9OA 3CPWA 4B08A 4XT1B 2L4NA 1YVCA 4IUQA 2LY7A 1JQYD 3CMAA 3P1HA 2JQOA 1K8OA 1VQ8A 2CQAA 3MA2B 5G3LF 2OF1A 5EPKA 1O78A 3KOJA 1QE6A 3K5OA 5IOCA 4YWKA 2B2WA 2EXDA 4BY1G 5A2QE 3PF4A 4DAYB 1PLFA 1H9RA 4R4IA 5I9PA 1S5DD 4EVOA 4RKBA 4P2CB 3CF5A 1HA6A 2R7FA 1JOKA 5EGTA 2A1AA 4KKUA 4A3KB 3OIPA 5CYUA 1YNND 4X6AH 1S5ED 2NN6H 4GKKL 4DV2L 2D9UA 4QB4A 3M85A 4HMJA 4LF4L 1TWFB 1A8VA 1TWCB 4BY7H 2JA7H 4ZKCB 3ULLA 2MNAA 3DM3A 1OXTA 1SYDA 4F7XA 1EL0A 1UEAB 2B29A 1X65A 3PIO3 2XWJB 1Y14B 4HSVA 2X6LA 3DM1A 4GN5A 4IPGA 2A74C 2JP1A 3K81C 3EROA 4DV3Q 1B2TA 3ZJYC 1SSOA 3M3YB 3KBXA 1Y8OB 1IBML 2RDFA 3GP7A 4OWWB 2D5DA 3HOWH 3HEJA 5T1GA 2CVRA 2E2IB 1S5BD 1U4MA 4A3IH 1FYCA 1TT2A 2ZXOA 2C5CA 1A15A 1JWMD 5M5WB 1Q3LA 2WAQG 1EQQA 4P73A 1I4HA 3E3XA 2IW3A 3TQYA 3U9OA 4GKJL 4CJ1B 2G5DA 2BH8A 5JAVA 1GUGA 4DAVA 2AQ2B 2KA7A 4KJNA 1GO3E 5IT9L 5IP7H 2R7ZB 1TWAB 4BS9A 4DR3L 5BR8Q 1VCIA 4GLAC 1VMCA 2JA8B 1H9SB 2A6EC 3VR3A 5C3WA 4PMWA 1CT1D 3E5SA 1AZQA 1IKLA 3D31A 4IFDH 1K3BC 1WTRA 3CCMA 4LW1A 1SNDA 5FLMG 1NSNS 4DV3L 2X6GA 4JVZA 1WCMG 4DF7A 3VR4A 3MXGA 3TMEA 3GTGB 1KAAA 5JVG3 3W1BA 3AB9A 2F0EA 4YWMA 1QZGA 1CA6A 1KDCA 1E0BA 5IYCH 4QUFA 4LF9Q 3J81E 4IFDJ 1V43A 2B2VC 3R2TA 5IIFA 3OTOL 3Q0AA 4DV7L 1Y69U 3S1MB 4A3CH 3G6JB 1JB3A 3MWYW 4OL7A 2F0SA 1VDZA 4EQNA 1MJEA 1AH9A 3U4ZA 1N32L 4L6TB 3LNNA 1HJPA 5M3MH 1DXMA 1UEBA 1S40A 2E75C 2MO1A 4V190 1F2MA 4BBSH 2JA5B 1VQ5A 3JAMc 3PQIA 3NP8A 4QL5A 3RUZA 1IYVA 2LMCB 1L2FA 1GUOA 2NTTA 2JN4A 2FMCA 5IGBA 5LMUL 4MZ9A 1VQ4A 2F0UA 5T1IA 4DUYQ 1Z6HA 4FXGC 4ME3A 4JI8Q 1SNPA 1Y8PB 5CV8A 4E6IA 5M5XB 3CC7A 1D1IA 3FPUB 3I91A 1MHWC 1STHA 1GM5A 3HKSA 1SE8A 1HNZL 1K28A 3TZUA 3OOCA 2PO4A 3TS0A 4TVAB 2JEAI 3GTJB 4L5TA 1B1ZA 4L5RC 5E3FA 1HQMC 2G9DA 1PFMA 1GVPA 3K57A 4FF3A 2NVQB 1RODA 1A2TA 4JG2A 1AE2A 4C3JB 1QJOA 1S72A 3K7UC 4A3EH 4FYDA 2E8GA 1WTVA 4A3KG 4H0LC 1ASZA 3P7JA 5DLQE 5JEAH 3MHBA 3F2DA 1HR0W 1I4GA 4AYBE 1IHZA 2QDBA 3V2TA 5HGQA 1RL2A 2ALYB 1U4RA 2DJGC 2JE6I 3UE0A 3DWQA 1IBLQ 1SLJA 1BUVT 1RD9D 4DGZA 4DPGA 1B53A 1IW7D 1WD1A 2ICEC 2F0TA 5IGEA 4DA2A 1W6KA 2DNEA 2XRSD 1TR5A 1HZAA 1YNJC 3PUZA 2E2HH 3DMUA 2I0QA 5JEAJ 2YU9B 1F2ZA 4DUZL 3I3CA 2RDGA 1NMGA 1O7IA 4ABNA 4IQZA 1B7YB 4POFA 3GTMH 2Z9HA 5EPLA 5IYDH 1LO5D 2UUAQ 3S17B 3HS0C 1PDQA 2RF4A 1I4QA 4KK7A 1GD7A 5IGDA 1D2BA 1STGA 3DXJC 5JVH3 4DR4Q 1FVIA 1TVXA 1HH2P 2VL6A 2A8VA 3PV0A 2ZM6L 2R7ZG 2FJ2A 2A69D 1J9OA 4J8QA 4GLXA 1I50H 1X55A 4R4CA 4JOIC 4L8JA 2OQKA 2TMPA 3GTKB 2NZ1D 3H09A 1WTOA 3HOZH 2OCEA 1NE3A 1VQHA 2V4DA 3KLSA 2Z8LA 4N8FA 3L2PA 4CJ2C 1FL0A 2AWNA 1BXTA 3PO2H 4JYAQ 1N9WA 5C4XH 4I7AA 1SE3A 2N88A 1N32Q 2R92H 4DXFA 3G48A 1D5MC 4C2MH 3OMGA 4IUNA 1K8MA 4QUCA 1Q1EA 1Y8NB 3L7ZC 3HOVH 1PRTB 1SYFA 4JI2Q 2O4XA 3J81c 5E1FA 3EVQA 3I4LA 1SNCA 1R4PB 2RCFA 4BBRB 4IZ8A 1Q7YC 4JI0Q 4P71A 4QIWB 5CR3A 3OSOA 4O1NA 4X62L 3A5ZB 5EBCA 3LGJA 2VQEQ 2F0OA 4B3TL 1OXUA 3CCUA 4RMFA 1UE1A 3MZ5A 1Y1WH 2JA5G 3GDEA 3J7YW 3NBHB 3I72A 3JAML 1HNZQ 1KABA 1G6PA 1V1PB 3CCRA 4O42A 3A8KE 3KFUA 2GN5A 4HN7A 1WI5A 3EFXD 3VA5A 1LT4D 3PUVA 1N33L 1OXXK 2EJGC 1RF2D 1MI2A 3T1HL 3R93A 2E5LQ 3H0GG 4G4KA 5C3EG 4N9PA 4DR6Q 1G51A 4IO9A 3OWEB 4JBMA 2XTIA 5D3IB 1V9PA 1O7ZA 2VZAA 4B3ML 1TS4A 2F0WA 2I46A 3RZOH 2RHQB 1C7YA 2VUMH 2MO0A 4BA1I 5C44G 2RDHA 1QVGA 1BCPB 3KF8B 5A2QL 1ICFB 3EJIA 4EQ5A 1A3TA 1HPCA 2DN8A 3UE1A 2K5QA 3HP3A 4IURA 4B9WA 4A3JH 5CBAE 2B2UC 4ID6A 1EEID 4N8X1 1Z7TA 4GOPA 4ZK9B 3SK5A 1F77A 4NXNL 4DR1L 2HHHL 2Q2HA 4RCNA 1VQDA 4HAEA 4MTNA 1BBWA 3OIQA 1HNXQ 4A93H 4R9WA 2WKDA 3SE0A 4IUVA 1XYIA 1WTHA 1HNWL 2RHSB 4DXGA 1BNZA 4DNIA 3M4OB 2PPBC 3HOXH 3NK9A 1YEZA 1LTLA 1XTDA 4CDFC 1D6EC 5CORA 1K73C 2JA6B 1RTOA 3J80i 3CQZH 4DAMA 1CFMA 3S1RB 2IX3A 2RKSA 2OEOA 1JCKB 3LWEA 1YIJA 1PHJA 1O7YA 1EUJA 1O80A 1PH6A 2HDLA 3CU7A 3HRZC 2FXQA 2QGQA 2PYKA 1TWGH 2JK8A 1B9NA 4RAUC 1QVCA 1EWIA 2PNRC 1VQNA 4K14A 4GOPB 4B3SL 1VQAA 4DV1L 4U673 1G291 2NN6G 3H94A 2QF7A 2HIXA 4NXMQ 1JJCB 5I6WA 1I4XA 3H3VI 5HY6A 1VQPA 4BY1B 3T1YQ 1Q81C 3WOEA 2JA7G 1S5CD 4X62Q 4YCUA 2F4VL 1EEFD 4KHPQ 2L0CA 1B3AA 1T5XD 3OYYA 1SEBD 3QO2A 1E2ZA 1L0XB 2BH2A 4YCVA 1XXGA 3QOJA 3OW7A 1FNWA 2A5HA 2KEEA 4CKCA 5ELFA 1S3OA 5C0XH 1BVSA 2XWBB 1QCBD 2XNAC 3IFTA 4JI4L 1QUQB 3J81L 3HOWG 3BYYB 4HMIA 4A3IG 1F9PA 4KY5A 1Q1BA 1Q82C 1VQ7A 2P5ZX 3K6OA 1PV4A 3G71A 2RCNA 2B2WC 3O13A 2IHFA 3TSSA 1ET6A 1KAWA 1MSGA 5AJ3Q 3PO3H 2ZTEA 5C0XJ 3KF6A 1ILQA 1Q8IA 3EQLC 1IL8A 1A63A 5IP7G 4P74A 3MAQA 1CI3M 1Q86C 4PZ6A 3A7LA 1VQ9A 2SEBD 1BDOA 2G9HD 2NVYB 3HKZB 4C3HH 3I4NH 1CHPD 1SMYC 3EIVA 4IFDG 3SK4A 3CAMA 4A3LH 2B8FA 1TIID 2F0QA 3T56B 3PO2B 1E1OA 2YTYA 3KDFB 5C4XB 1S5FD 1TS5A 3S1QB 4Y7NH 3TP7A
chains in the Genus database with same CATH topology
1JICA 3SVMA 1I4RA 3HOVB 3BG3A 3SXHA 5HURA 5KYLA 1O7LA 3K5LA 5I6YA 3M4YA 2RSOA 2K32A 2AUKA 5KIXA 1A3VA 5K5PA 3K5NA 2IX1A 1MBYA 3PUYA 1UUPA 3RD4A 1TY2A 1C48A 5ELEA 2F0DA 3Q6SA 2RQXA 1H9MA 5COYA 3EA6A 4DAYA 1ILPA 3QG1A 3G7LA 4S3SA 5DM73 4WORA 3OWFA 3D4WA 2AQ1B 2SDFA 1K83B 2NN6I 2F0GA 3NTHA 1G8ZD 1DZ1A 2B39A 2KQ3A 1B50A 1QWYA 5IGCA 1R9TB 4QCLA 2VUMB 2NYZD 2PW5A 3I90A 1BR9A 4HSPA 4ME5A 1EY4A 1FR3A 5JEAG 1PFNA 3S16B 2K05A 3SEBA 4CHTB 5C4HA 3TN2A 1CK1A 4NP5A 1FGBD 3PUWA 2E76C 2ZXPA 2KOLA 4MIUA 5DEHA 3S14B 2EPBA 5KNDA 4TSSA 3TZDA 2PZWA 1Q12A 3C46A 4IFDI 5KGUA 1H9SA 2KVMA 3K59A 2LKVA 2VB2X 1VF7A 1TY0A 3LWUA 1JC7A 5NUCA 2A68D 1HUMA 5CBEE 2AQ3B 1B44D 1LT3D 3UI2A 5I2YA 1QILA 2NWGA 2MUYA 2NTSA 3SDZA 1ZEQX 3QOLA 1SNOA 2O5JC 1SNMA 3IKJA 1PRTD 3NHHA 2QILA 3NPPA 1EY8A 2EXZA 4XXEA 1R4QB 2F0PA 2A6HC 3HG9A 4C1NI 3A54A 3BDCA 2A6ED 1CZWA 4M8AA 3QJYA 3TDQA 1LTRD 2NVXB 1PMRA 3GD7A 4PV1C 2RVLA 3DWAA 3S1NB 2EYMA 4FF2A 1AEXA 4RFBA 3MXUA 4WFN3 3TP5A 1I3QB 1CQVA 2E74C 4MN3A 3MTSA 1AZPA 4K8IA 4FF4A 2E2DC 2JSOA 1EWHA 2ENBA 3PO3B 1BCPD 1TQOA 4KD3A 2A73B 2M2LA 3NWSA 4A3GB 1HXYD 3BDLA 4C3HB 3I4NB 1EZ6A 3ERQA 4IN3A 2QCPX 2EOTA 3FMCA 1SYEA 2TSSA 5JJZA 1AFPA 2PMZB 4KKSA 1JWUD 4HCEA 4Y7NB 3K7AB 2RBMA 3GTOB 2NVTB 2JYOA 4KY6A 4NMZA 3CRLC 1BOSA 2F0LA 4CKBA 4J6HA 5F2DA 3T13A 5KRUA 2PQEA 1F9SA 3H0GB 3H91A 5C3EB 1PRTF 1GUNA 1DONA 1LTSD 4DU9A 2EYFA 3J80E 4X3SA 4R8IA 2WB1B 2EY6A 2SNMA 5C44B 2VXWA 5JOBA 4EQPA 2EYOA 5M5YB 4NW2A 4V0BA 4KTAA 2KJXA 5ELDA 1H9KA 5FK9C 1SFOB 1SJHD 1EY0A 1SYBA 3K0YA 1MSHA 1STNA 2FINB 2OXPA 1PTOH 5LL6X 4A3MB 1GUTA 5D3DA 5DAUA 2LS01 1GHKA 2EYPA 5IGFA 2EYJA 1SYCA 1PTOC 3ND9A 4G7ZC 3X3NA 2J7ZA 5C5MA 4ILWA 1RKNA 3S9WA 1BCPF 3A8JE 5FKAC 2K5DA 1U4PA 2F03A 4FVMA 2L9HA 3NBHA 1DCZA 1U4LA 1BO0A 1IW7C 1V1PA 3VR2A 4RHSA 2EJFC 1STYA 4H13C 4RH6A 1ENFA 5C0XG 2EY5A 3GTLB 3I8ZA 4C56C 4BY7B 3W3AA 2JA7B 2B2VA 3MC0B 2RSNA 1PFBA 2BCOA 3CRKC 4TQUS 4KN7C 2CHBD 3WDNA 5K36H 5FLXE 2BOSA 1WTWA 4C3IB 1M8AA 1QNUA 3KF8A 3NWTA 4C1NK 3HOWB 2A69C 2F3VA 4A3IB 5CGKA 1RTNA 4C3HG 1ESFA 4H7BA 1I6VC 1EQTA 4OIKA 5CV5A 3C1FA 2WKCA 4KD4A 4XQJA 5FO9B 3NTKA 1D5XC 1STEA 3DWPA 3K5MA 4ZQ3A 5AFWA 3SHLA 2IL8A 2CW0D 3VR5A 1II3A 2L11A 3ZYYX 2F0HA 4UAIA 1QB5D 3V05A 3NXWA 3P20A 1BF4A 1I4PA 1D1KA 2EVBA 1A2UA 2AWOA 2KHSA 4XDXA 1F9RA 1XTCD 2XN9C 5CV9A 5J22A 1SNQA 2Q8RE 1AW7A 3HGBA 2MPMA 4WRDA 2EZVA 4JBWA 5EKKA 4L63B 5EPJA 3T4AC 5M3MB 4BBSB 1D5ZC 5CMDA 1ZYRD 1GUWA 5LL6S 2KUMA 4BWGB 3LX0A 5C0XI 3BYTB 5C5LA 2XSCA 1ML0D 1GXDC 3NQIA 1NAPA 4KI0A 2ID0A 4J1MA 1J8IA 2VB3X 4OO1H 1PYWD 4Q0FA 3ITPA 3VA7A 2KCCA 1NR2A 2K28A 1HRJA 1RCVD 4FP5D 4A3EB 2H1EA 2XVSA 4FXDA 2EDGA 3AMUA 3L9AX 4PNYA 1PTOB 1PZKD 1LT5D 2BE5D 4WJWA 1WTPA 1DM0B 2EYLA 2E2HB 4CKEA 1CZGA 5FOBB 3V96A 5JPMC 4C3IG 1UAPA 2R3ZA 3GTMB 1RJTA 4AYBB 3I70A 4FO2A 5LHY1 5ELBA 1OO9B 2AUJD 3CHBD 1LLRD 2F0IA 5C6AA 1HTPA 3AU7A 3DEPA 3L3OC 1I50B 2C9OA 4QF4A 1WVLA 4NDXA 4K2KA 2B2TA 3HOZB 3VR6A 1EU3A 5DM63 3E0JA 1PZID 2ZXRA 2F0VA 4K5VA 3GO5A 4ZLTF 3IFDA 3HOYB 1Z47A 5DNFA 2R92B 3U9SA 4C2MB 2B2UA 3TBIB 2XRQD 1Q90A 3J80L 4RGMA 1HQRD 5FO8B 4ZKBB 1JORA 1PXUA 1X32A 1SJED 2K6AA 2IT1A 2Q8TA 1SE2A 1V8QA 1Y1WB 5D14A 2VNUD 4KHVA 1PZJD 4KN4C 3OMCA 4DNRB 1KLUD 3VYUA 1CTMA 1CHQD 2PCFB 5C4ZA 3KBGA 1ET9A 3R2IA 1Y1VB 4G7OC 5FO7B 1EZ8A 4RGOS 2WIIB 1IYUA 3A56A 1EQVA 1A3UA 3QB3A 2EY1A 5EKLA 3RZOB 1ICWA 3BS1A 1IKMA 1HHVA 4DFAA 3FDTA 4A3JB 4LMQD 1GOZA 3BVZA 4F88A 3OPOA 1EU4A 1QG7A 3WOFA 1EY5A 1UNSA 3N6RA 4ZAIA 1EY9A 4M1UB 1NUCA 1G91A 4A93B 2B2YA 2I07B 4TRDA 2M9VA 2WINB 3D6WA 3E6ZX 3HOXB 3NE5B 5BN3A 3SK8A 2JEBI 4XYQA 5BN5A 5FLXL 1RHPA 3CQZB 3DEOA 2PZTA 4YIJA 3A7AB 4XQQA 2QKIC 3KLRA 4B9XA 1SYGA 1BBXC 1BQQT 5EBDA 2Z4IA 4OHJA 2A6HD 2WP8J 2HDMA 1TWGB 1EY6A 1C8CA 4A3BB 3NBIA 2K1BA 2B8GA 5A35A 2BDNA 2Z4HA 1YNNC 4ZRZA 1SE4A 5ELCA 2F0NA 4RKLA 1U9RA 2K7VA 3M7GA 2K01A 2A68C 3DUZA 5KEEA 1X3PA 1HTLD 2MHVA 1WTXA 4HCSA 4RA8A 1F9QA 5TSSA 5K36G 1PRTC 1G2SA 2FFKB 3Q23A 2MP1A 4F8MA 3R8BA 1QNKA 2L12A 1JE4A 4UDUC 4BA2I 1SDFA 4K6DA 2N55A 4K6LA 4FNFA 1KLGD 5I2XA 4RGTA 3MXNA 5I9OA 2PZUA 2SNSA 1NCVA 3Q24A 2EYHA 1STAA 1KDBA 1HA5A 2NBFA 4OIJA 2F1MA 4H44C 5KYIA 3J7AF 2BA1A 3VYTA 1LACA 2R61A 5E4WC 2XIWA 3GQBA 1STBA 4IUPA 1WTQA 1L0YB 3H6MA 1EIGA 3FKIB 1C4QA 1EIHA 1HFNA 1E2VA 1BCPC 1W6JA 1HFGA 3IAYA 4FXKC 3DHQA 3MVVA 4ZUIA 4XQNA 3S2HB 1TU2B 5IODA 1JR0D 4ULLA 3VYSA 4HR7B 3FPPA 1XX8A 4IUTA 3QWNA 4XT3B 3RMHA 5CC4A 1SAPA 3D8GA 1EY7A 2DY7A 1YNJD 1PTOD 4RGNA 3VYRA 4KHZA 4A3FB 2B63B 3D3RA 4OO1G 2EJMA 5IGGA 2EE1A 2F0FA 3MFGA 4RCOA 3TP6A 2NB0A 4Q5VA 1LTAD 1CQFA 2JXMB 1TKWB 3IL8A 1GUSA 4DK0A 1OXVA 4RHRA 3ONAB 2K03A 2FHTA 1LTTD 3PUXA 2F0MA 2HCCA 2IX0A 4KJOA 5JPNC 1F2YA 2PW7A 1M4VA 4EQOA 2BDOA 1DYQA 2WV6D 1F2LA 1KTKA 4MHEA 1A6XA 4ODGA 5ISRA 1EYAA 1LTBD 4XTCS 1LT6D 3I4MB 1LV9A 1FD7D 3NTIA 5KNCA 1LTGD 1EYDA 4K5WA 3NQTA 4ZUJA 4X3UA 3MEHA 2K5WA 2F0JA 2HQEA 3Q22A 4G7HC 2BA0A 2F3WA 1KDAA 3KLSX 1ENCA 2F4IA 1TS3A 3BVGA 2IWHA 1H9JA 1MGSA 1TS2A 2K33A 1S4ZA 1FNUA 3BDOA 1PTOF 1ZKOA 2DNCA 2E2JB 2IJ0A 1DOKA 4OO1I 4GZYC 2IPKD 4HTHA 4KV6A 1FNVA 1GJXA 4Z9CB 2D2CC 1E2WA 5IT9E 1G2TA 2SOBA 3D4RA 3GTQB 2CW0C 4KKTA 3PMFA 2B2TC 2Y0SB 2GA4B 5CV4A 1V1OA 3R3OA 1SXTA 5J1ZA 2R6GA 3A55A 4C3JG 3CKIB 1OXSC 4PQXA 4FF1A 4JK1C 3D6CA 2H4OA 4DN4M 2M00A 1QOHA 3S15B 3W2DA 2R93B 1XWEA 3FEWX 1NR4A 1LTID 2HCIA 1CM9A 5C3XA 3M7NA 3GV6A 4TKOB 1B4OA 2LFNA 5D65A 3K58A 3SK6A 4LAAA 3C1EA 2L5TA 2KEDA 4CBVA 1X3QA 2D62A 5M3FB 1DOMA 4PMCA 3MFYA 4K8JA 1EFID 4IALA 3MXPA 2QEJC 3RLFA 1JOQA 1ZYRC 3I73A 1EYCA 2ICIA 1ONLA 1LABA 4R8NA 1ESRA 4RWSC 5I4DA 3S2DB 4HEDA 3HOUB 2L55A 4XIGS 4NKLA 5HGTA 2KCNA 3FRPB 2RA4A 3KUPA 5EKIA 1RDPD 1DOLA 5EQ0A 5CV7A 4DAPA 2NUCA 3F2UA 3C3LA 3FVQA 3P75A 2WACA 3GTPB 1JWSD 3D4DA 3OHXC 3GV3A 4CJ0B 4X3KA 1EWCA 3X3MA 1DD2A 3PIP3 3BZDB 4LK1C 5C4JB 1ZXTA 1SMYD 1MD2D 1HUNA 4A3DB 2K04A 3J7AV 2B2YC 2BE5C 4X3TA 1G6ZA 2YYZA 5E4XA 4LJZC 2MGSA 2Q8IB 3NSWA 1T5EA 5EJWA 2EY2A 1VMPA 4QMGA 5J39A 5G3LD 3BVMA 4KY7A 1AN8A 2HUGA 2MJ8A 1KNAA 3HZXA 2J0TD 4K5XA 2WAQB 2KECA 3T51B 2FMMA 1B9MA 3N52A 2DY8A 3KK7A 2ZT9C 5KNBA 4U68A 3TP8A 2L1BA 2OT2A 4EGVA 3SR1A 4KMUC 1SBBB 4DK1A 3H3VC 1EOTA 3T16A 4XYOA 4G57A 3RZDB 3URYA 1WCMB 3A8IE 3C2PA 3T53B 1JOOA 5BN4A 2Z1CA 4DNTB 4OGQC 2O2LD 2X69A 1CA5A 2O5IC 4PMBA 4IUUA 4N9TA 2J4XA 1KNEA 4ZYSA 1I6HB 4K2LA 4I65A 3NUCA 4CGYB 4F87A 1TWHB 1GHJA 3JAME 3QIAA 2F0KA 1VF5C 3ND8A 1DJRD 1HCZA 1ENAA 1WD0A 5CV6A 4I7ZC 1AP0A 5M9OA 4B08A 4XT1B 2L4NA 4IUQA 2LY7A 1JQYD 3P1HA 1K8OA 2CQAA 3MA2B 5G3LF 2OF1A 5EPKA 1O78A 1QE6A 3K5OA 5IOCA 2B2WA 5A2QE 1PLFA 1H9RA 5I9PA 1S5DD 4EVOA 4RKBA 4P2CB 1HA6A 1JOKA 5EGTA 4KKUA 4A3KB 3OIPA 5CYUA 1YNND 1S5ED 2NN6H 2D9UA 4QB4A 3M85A 4HMJA 1TWFB 1TWCB 4ZKCB 1OXTA 1SYDA 4F7XA 1EL0A 1UEAB 3PIO3 2XWJB 4HSVA 2X6LA 3DM1A 2A74C 2JP1A 3EROA 1B2TA 1SSOA 3M3YB 3KBXA 1Y8OB 2RDFA 3GP7A 2D5DA 3HEJA 5T1GA 2CVRA 2E2IB 1S5BD 1U4MA 1FYCA 1TT2A 2ZXOA 2C5CA 1A15A 1JWMD 5M5WB 1Q3LA 1I4HA 2IW3A 3U9OA 4CJ1B 5JAVA 1GUGA 4DAVA 2AQ2B 2KA7A 4KJNA 5IT9L 2R7ZB 1TWAB 4BS9A 1VCIA 1VMCA 2JA8B 1H9SB 2A6EC 3VR3A 5C3WA 4PMWA 1CT1D 3E5SA 1AZQA 1IKLA 3D31A 4IFDH 1WTRA 1SNDA 1NSNS 2X6GA 4DF7A 3VR4A 3MXGA 3TMEA 3GTGB 1KAAA 5JVG3 3AB9A 2F0EA 1CA6A 1KDCA 1E0BA 4QUFA 3J81E 4IFDJ 1V43A 2B2VC 3R2TA 5IIFA 3Q0AA 1Y69U 3S1MB 3G6JB 1JB3A 3MWYW 4OL7A 2F0SA 1VDZA 4EQNA 4L6TB 3LNNA 1DXMA 2E75C 4V190 1F2MA 2JA5B 3NP8A 3RUZA 1IYVA 2LMCB 1GUOA 2NTTA 2FMCA 5IGBA 2F0UA 5T1IA 1Z6HA 4FXGC 1SNPA 1Y8PB 5CV8A 4E6IA 5M5XB 1D1IA 3FPUB 3I91A 1STHA 3TZUA 3OOCA 2PO4A 2JEAI 3GTJB 1B1ZA 5E3FA 1HQMC 2G9DA 1PFMA 3K57A 4FF3A 2NVQB 1RODA 1A2TA 4C3JB 1QJOA 4FYDA 1WTVA 4H0LC 3P7JA 5JEAH 3MHBA 1I4GA 1IHZA 2QDBA 3V2TA 1U4RA 2JE6I 3DWQA 1BUVT 1RD9D 4DGZA 1B53A 1IW7D 1WD1A 2ICEC 2F0TA 5IGEA 4DA2A 1W6KA 2DNEA 2XRSD 1TR5A 1YNJC 3PUZA 3DMUA 5JEAJ 2YU9B 1F2ZA 3I3CA 2RDGA 4ABNA 4IQZA 5EPLA 1LO5D 3S17B 3HS0C 1PDQA 1I4QA 4KK7A 5IGDA 1D2BA 1STGA 3DXJC 5JVH3 1TVXA 3PV0A 2FJ2A 2A69D 1J9OA 4J8QA 4L8JA 2TMPA 3GTKB 2NZ1D 3H09A 1WTOA 2V4DA 3KLSA 2Z8LA 4CJ2C 2AWNA 1BXTA 1SE3A 2N88A 4DXFA 1D5MC 3OMGA 4IUNA 1K8MA 4QUCA 1Q1EA 1Y8NB 3L7ZC 1PRTB 1SYFA 2O4XA 5E1FA 3EVQA 3I4LA 1SNCA 1R4PB 4BBRB 4IZ8A 4QIWB 5CR3A 3OSOA 4O1NA 5EBCA 2F0OA 1OXUA 3MZ5A 3J7YW 3I72A 3JAML 1KABA 1V1PB 4O42A 3A8KE 4HN7A 3EFXD 3VA5A 1LT4D 3PUVA 1OXXK 2EJGC 1RF2D 1MI2A 3R93A 4G4KA 4N9PA 3OWEB 5D3IB 1O7ZA 1TS4A 2F0WA 2I46A 4BA1I 2RDHA 1BCPB 5A2QL 3EJIA 1A3TA 1HPCA 2DN8A 2K5QA 3HP3A 4IURA 4B9WA 5CBAE 2B2UC 4ID6A 1EEID 1Z7TA 4ZK9B 3SK5A 1F77A 4RCNA 4HAEA 3OIQA 4R9WA 2WKDA 3SE0A 4IUVA 1XYIA 4DXGA 1BNZA 3M4OB 2PPBC 3NK9A 1D6EC 5CORA 2JA6B 1RTOA 1CFMA 3S1RB 2IX3A 2RKSA 2OEOA 1JCKB 3LWEA 1O7YA 1O80A 2HDLA 3CU7A 3HRZC 2PYKA 1B9NA 4RAUC 2PNRC 4K14A 4U673 1G291 2NN6G 3H94A 2QF7A 5I6WA 1I4XA 4BY1B 3WOEA 1S5CD 1EEFD 2L0CA 1B3AA 1T5XD 1SEBD 3QO2A 1E2ZA 1L0XB 1XXGA 3QOJA 3OW7A 1FNWA 2A5HA 2KEEA 4CKCA 5ELFA 5C0XH 2XWBB 1QCBD 2XNAC 3IFTA 3J81L 3BYYB 4HMIA 1F9PA 4KY5A 1Q1BA 3K6OA 2B2WC 3O13A 3TSSA 1ET6A 1MSGA 5C0XJ 1ILQA 1Q8IA 3EQLC 1IL8A 3MAQA 1CI3M 3A7LA 2SEBD 1BDOA 2G9HD 2NVYB 3HKZB 1CHPD 1SMYC 4IFDG 3SK4A 2B8FA 1TIID 2F0QA 3T56B 3PO2B 5C4XB 1S5FD 1TS5A 3S1QB 3TP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EKK A;  5I9O A;  5KGU A;  5C6A A;  2RDF A;  3HEJ A;  5CV7 A;  1SYF A;  4HTH A;  1STY A;  2RBM A;  2LKV A;  2O4X A;  2PZU A;  2NUC A;  5HGT A;  1TT2 A;  2OEO A;  2RKS A;  2SNS A;  3P75 A;  4PMB A;  5E1F A;  4KV6 A;  3EVQ A;  1SNC A;  5NUC A;  5E3F A;  1EY5 A;  2EY5 A;  2WAC A;  4QF4 A;  2EYH A;  1STA A;  4IZ8 A;  4KY6 A;  4N9T A;  3SXH A;  1KDB A;  4NMZ A;  5HUR A;  5KYL A;  5KRU A;  4NDX A;  3D4D A;  1A2T A;  1EY9 A;  4K2K A;  5CR3 A;  3U9O A;  1NUC A;  2F0L A;  3OSO A;  5I6Y A;  4J6H A;  4K2L A;  5F2D A;  2F0M A;  4I65 A;  3LX0 A;  2F0O A;  3T13 A;  5JAV A;  2F0V A;  5C5L A;  3NUC A;  4K5V A;  4KJO A;  2SOB A;  1A3V A;  5K5P A;  2PQE A;  1SNO A;  3QOL A;  2PYK A;  4TRD A;  5KIX A;  1SNM A;  5KYI A;  4KJN A;  3MHB A;  3NHH A;  3PMF A;  1F2Y A;  2F0D A;  3MZ5 A;  4J1M A;  2PW7 A;  1EY8 A;  4K14 A;  2F0K A;  4EQO A;  2EXZ A;  1IHZ A;  2QDB A;  3V2T A;  1KAB A;  3SK8 A;  5CV4 A;  5C3W A;  4DU9 A;  3E5S A;  4S3S A;  3R3O A;  2F0P A;  4ODG A;  2EYF A;  5J1Z A;  4WOR A;  5ISR A;  3OWF A;  1STB A;  1ENA A;  1EYA A;  2PZT A;  5I6W A;  2EY6 A;  2F3V A;  2SNM A;  4YIJ A;  4DGZ A;  3VA5 A;  3ITP A;  2F0T A;  5CV6 A;  1SND A;  5IGE A;  3D4W A;  2EY2 A;  1NSN S;  3BDC A;  3H6M A;  5JOB A;  1TR5 A;  4EQP A;  5CGK A;  5IGF A;  2EYO A;  5M9O A;  4IUN A;  1JOR A;  4H7B A;  2F0G A;  4B9X A;  3DMU A;  4QMG A;  1F2Z A;  1SYG A;  4DF7 A;  5J39 A;  3D6C A;  4KTA A;  3TME A;  1KAA A;  3P1H A;  3QOJ A;  3DHQ A;  2F0E A;  4N9P A;  4KY7 A;  5CV5 A;  2OF1 A;  1KDC A;  3C1F A;  2M00 A;  3MVV A;  4KD4 A;  4ZUI A;  1EYD A;  1EY0 A;  1SYB A;  4K5W A;  5C3X A;  1STN A;  3NQT A;  5IIF A;  5IOD A;  2OXP A;  3HZX A;  5IOC A;  4ZQ3 A;  2F0W A;  4ZUJ A;  2KQ3 A;  1EY6 A;  4HMI A;  3SHL A;  3MEH A;  4K5X A;  5DAU A;  3SK6 A;  4LAA A;  5IGC A;  2F0J A;  2HQE A;  2EYM A;  3C1E A;  4KY5 A;  4OL7 A;  4PNY A;  5IGD A;  5I9P A;  2F0S A;  4EQN A;  3EJI A;  2EYP A;  1AEX A;  1A3T A;  1II3 A;  1STG A;  4KHV A;  4PMC A;  4EVO A;  2F0N A;  4RKB A;  4RKL A;  3OMC A;  1U9R A;  3TP5 A;  2EYJ A;  2F0H A;  4B9W A;  2F3W A;  4IAL A;  4K8J A;  2PW5 A;  1KDA A;  3NXW A;  3MXP A;  1SYC A;  4ID6 A;  1JOK A;  4ME5 A;  5EGT A;  4K8I A;  1ENC A;  1EY4 A;  2EYL A;  3SK5 A;  1JOQ A;  3TP8 A;  5KEE A;  5C4Z A;  1EYC A;  1F2M A;  1A2U A;  5CC4 A;  3D8G A;  2ENB A;  3NP8 A;  3SR1 A;  2KHS A;  3RUZ A;  1EY7 A;  4QB4 A;  4HMJ A;  5C5M A;  1RKN A;  1JOO A;  5C4H A;  1TQO A;  3S9W A;  4R8N A;  4NP5 A;  1EZ8 A;  4KD3 A;  3T16 A;  5CV9 A;  5J22 A;  1SYD A;  4F7X A;  1SNQ A;  5IGB A;  4MIU A;  3SK4 A;  4F8M A;  1EQV A;  1A3U A;  4G57 A;  3QB3 A;  2EY1 A;  5EKL A;  2F0U A;  3BDL A;  5DEH A;  5IGG A;  2F0F A;  2F0Q A;  4NKL A;  2F0I A;  1SNP A;  3TP6 A;  1EZ6 A;  3NK9 A;  4WRD A;  4DFA A;  5CV8 A;  3ERO A;  4E6I A;  3ERQ A;  4K6D A;  2PZW A;  3TP7 A;  1STH A;  1SYE A;  3OMG A; 
#chains in the Genus database with same CATH topology
 4DR5 Q;  4NXN Q;  1JIC A;  3FHW A;  3G4S A;  3SVM A;  1I4R A;  5IYC G;  3FKI H;  3HOV B;  3BG3 A;  3PCO B;  3SXH A;  5HUR A;  5KYL A;  4A3C G;  3E0E A;  1XPU A;  1O7L A;  3K5L A;  4IOA A;  5I6Y A;  3M4Y A;  2OTJ A;  2RSO A;  3BJU A;  5EAY A;  2K32 A;  2AUK A;  5KIX A;  1A3V A;  5K5P A;  3K5N A;  1K9M C;  1MBY A;  2IX1 A;  3PUY A;  1UUP A;  3RD4 A;  1TY2 A;  3B6Y A;  1C48 A;  5ELE A;  2F0D A;  3Q6S A;  2RQX A;  3STB C;  5BR8 L;  1H9M A;  5M3M G;  5COY A;  3EA6 A;  4DAY A;  1MKH A;  4BBS G;  1ILP A;  3QG1 A;  3G7L A;  4S3S A;  5DM7 3;  1XPR A;  4WOR A;  3OWF A;  3D4W A;  4LF8 Q;  2AQ1 B;  2SDF A;  1K83 B;  2NN6 I;  4LF6 Q;  2F0G A;  2HQL A;  3TS2 A;  2F3I A;  3NTH A;  4OON A;  4A3F H;  1G8Z D;  5IP9 H;  4LF9 L;  1DZ1 A;  1X56 A;  2B63 H;  1VQI A;  2B39 A;  1E24 A;  2KQ3 A;  2UU9 Q;  1B50 A;  1P8L A;  1QWY A;  3U58 A;  5IGC A;  4BXX G;  1R9T B;  3CPF A;  3OW2 A;  4QCL A;  1N36 Q;  2VUM B;  2NYZ D;  3DLL A;  1SMX A;  3HFZ B;  2PW5 A;  3I90 A;  1BR9 A;  4HSP A;  1VQF A;  4ME5 A;  4LWC A;  1EY4 A;  4A3E G;  3CP0 A;  3Q8D A;  1FR3 A;  5JEA G;  1PFN A;  3S16 B;  2K05 A;  1YHA A;  3SEB A;  4JI4 Q;  4CHT B;  5C4H A;  3TN2 A;  1CUK A;  1CK1 A;  4NP5 A;  1FGB D;  1HZC A;  3PUW A;  2E76 C;  2ZXP A;  2KOL A;  3L0O A;  4MIU A;  5DEH A;  3S14 B;  2UUB Q;  1C9O A;  2EPB A;  5KND A;  4DUY L;  4TSS A;  3TZD A;  4JI8 L;  2PZW A;  1Q12 A;  3C46 A;  4IFD I;  1PH5 A;  5KGU A;  1H9S A;  2N78 A;  2KVM A;  3NEN A;  3K59 A;  3GTL H;  1VQO A;  2LKV A;  2N3S A;  5GAG C;  2VB2 X;  1VF7 A;  5IYD G;  1TY0 A;  3LWU A;  1JC7 A;  5NUC A;  2A68 D;  1HUM A;  5CBE E;  2AQ3 B;  1B44 D;  2QW7 A;  3I4M H;  1LT3 D;  3UI2 A;  5I2Y A;  1QIL A;  2NWG A;  2MUY A;  2NTS A;  1XNR Q;  3SDZ A;  1ZEQ X;  3QOL A;  1SNO A;  2O5J C;  1SNM A;  3IKJ A;  1PRT D;  3NHH A;  2R7D A;  2QIL A;  3NPP A;  1E1T A;  4C3I H;  2AMC B;  1EY8 A;  1K3R A;  2UXC Q;  2EXZ A;  4XXE A;  1R4Q B;  5LMN Q;  2F0P A;  4EX5 A;  3D0F A;  2DUD A;  3HKZ G;  1IBL L;  2A6H C;  3HG9 A;  3HOZ G;  3MEF A;  4C1N I;  3A54 A;  3BDC A;  2A6E D;  1CZW A;  3PO2 G;  4M8A A;  4HJ9 A;  3QJY A;  3VDY A;  5C4X G;  2L15 A;  3TDQ A;  1LTR D;  2NVX B;  2R92 G;  1PMR A;  4ZCK A;  2LXK A;  5ELO A;  3GD7 A;  4JW0 A;  2UUA L;  4PV1 C;  2RVL A;  3HOV G;  3DWA A;  1VQK A;  3S1N B;  2EYM A;  2E2J H;  4FF2 A;  1AEX A;  4RFB A;  1V1Q A;  2Y0S E;  3MXU A;  4WFN 3;  3TP5 A;  3I7F A;  1I3Q B;  1CQV A;  2E74 C;  4MN3 A;  3MTS A;  4DR4 L;  1T9H A;  4HJ7 A;  1AZP A;  4K8I A;  4CDD C;  5GAD C;  4FF4 A;  1HR0 Q;  2E2D C;  5IYB H;  2JSO A;  1EWH A;  1EIF A;  1KIX A;  2ENB A;  1BBU A;  4DR7 Q;  5IE8 A;  4X64 Q;  1Y1W G;  1BCP D;  3PO3 B;  1TQO A;  4HJ8 A;  4KD3 A;  2A73 B;  1E3P A;  3TRZ A;  2M2L A;  3NWS A;  4JV5 Q;  4A3G B;  4JYA L;  1HXY D;  1JJG A;  3BDL A;  4DV4 Q;  4C3H B;  3I4N B;  1EZ6 A;  2I5M X;  2K5N A;  3ERQ A;  4IN3 A;  2QCP X;  2EOT A;  2C35 B;  1SYE A;  2TSS A;  3FMC A;  5JJZ A;  1AFP A;  2PMZ B;  3J7Z C;  4KKS A;  1JWU D;  3FP9 A;  4HCE A;  4Y7N B;  3K7A B;  2RBM A;  3GTO B;  4JI2 L;  4DV0 Q;  4OWX B;  5LMN W;  2MQH A;  2NVT B;  2JYO A;  4KY6 A;  3A5U A;  4NMZ A;  1J6Q A;  4JI0 L;  3CRL C;  1BOS A;  2VUM G;  2F0L A;  1E7Z A;  4CKB A;  4J6H A;  5F2D A;  3S15 H;  2CFM A;  2R93 H;  3T13 A;  2VQE L;  5KRU A;  2PQE A;  2HT1 A;  4GN4 B;  4A3J G;  1F9S A;  3E9H A;  3H91 A;  3H0G B;  1PH9 A;  5C3E B;  1PRT F;  1GUN A;  2D0P A;  4KLK A;  1CSP A;  1DON A;  1LTS D;  4DU9 A;  3MXN B;  2EYF A;  3J80 E;  4X3S A;  4UP9 A;  4A76 A;  4R8I A;  4HIO A;  2WB1 B;  2EY6 A;  2SNM A;  5C44 B;  4A93 G;  2VXW A;  5JOB A;  4EQP A;  4K0K Q;  2EYO A;  2ATW A;  5M5Y B;  4NW2 A;  4V0B A;  4KTA A;  4IOC A;  2KJX A;  2E5L L;  5ELD A;  1I94 Q;  3HOX G;  4DR6 L;  1H9K A;  5FK9 C;  1SFO B;  1SJH D;  1EY0 A;  1SYB A;  3K0Y A;  2I5H A;  1MSH A;  3W5O A;  1LM0 A;  1STN A;  2FIN B;  3S2D H;  2OXP A;  1PTO H;  3HOU H;  5LL6 X;  4A3M B;  1PVO A;  1GUT A;  5D3D A;  5DAU A;  1U0L A;  2LS0 1;  1GHK A;  2EYP A;  1YNX A;  5IGF A;  2EYJ A;  2YTX A;  1SYC A;  5IWA Q;  3TRE A;  1PTO C;  1EYG A;  3ND9 A;  2VQF Q;  2WFW A;  5L37 A;  4G7Z C;  4LFB Q;  4NPS A;  3X3N A;  3A74 A;  2J7Z A;  3GTP H;  1IBK L;  5C5M A;  1WOC A;  1RKN A;  4ILW A;  2JJQ A;  1U5K A;  3S9W A;  1KXL A;  4JI1 Q;  1BCP F;  1HNX L;  3A8J E;  5FKA C;  2K5D A;  4DK6 C;  5C4J H;  1U4P A;  2F03 A;  2ZJP A;  4FVM A;  4LUZ A;  4A3D H;  2L9H A;  3NBH A;  1DCZ A;  1U4L A;  3AEV A;  1VQE A;  1ASY A;  1BO0 A;  1IW7 C;  1V1P A;  2WAQ E;  3VR2 A;  4RHS A;  2EJF C;  1STY A;  4H13 C;  4RH6 A;  1ENF A;  4YWL A;  5C0X G;  2EY5 A;  3GTL B;  3I8Z A;  4LFA Q;  4C56 C;  2NZO A;  4BY7 B;  3W3A A;  2JA7 B;  2B2V A;  3MC0 B;  4OWT B;  3HOY H;  4QQB X;  4QJF A;  2RSN A;  1PFB A;  1A62 A;  2BCO A;  3CRK C;  4H02 A;  4TQU S;  4KN7 C;  3RNU A;  2CHB D;  4J15 A;  3WDN A;  3PO3 G;  5K36 H;  5FLX E;  2BOS A;  1WTW A;  4C3I B;  1M8A A;  1QNU A;  3KF8 A;  3NWT A;  4C1N K;  3HOW B;  4NXM L;  2A69 C;  2F3V A;  4A3I B;  4AQY Q;  4A3G G;  3T1Y L;  1EOV A;  5CGK A;  3CW2 C;  1RTN A;  2KBN A;  4UHV A;  4C3H G;  3I4N G;  1YJN A;  1ESF A;  4H7B A;  3F1Z A;  4LF5 L;  4KHP L;  4A3L G;  1CKM A;  2KEN A;  2UXB Q;  1I6V C;  1EQT A;  4OIK A;  5CV5 A;  3C1F A;  2WKC A;  4KD4 A;  4XQJ A;  5FO9 B;  2LSS A;  3NTK A;  1D5X C;  1STE A;  3DWP A;  3RR5 A;  2DGY A;  4ZQ3 A;  3K5M A;  4JI6 Q;  4B3R Q;  5AFW A;  4LUV A;  3SHL A;  3RZD H;  2IL8 A;  2CW0 D;  3VR5 A;  1WCM H;  3CCV A;  3FKI G;  1YJ9 A;  1II3 A;  2L11 A;  3ZYY X;  2F0H A;  2LXJ A;  3KLW A;  4UAI A;  1QB5 D;  3V05 A;  3NXW A;  4HIK A;  1C0A A;  3P20 A;  1BF4 A;  1I4P A;  1WFQ A;  2F52 A;  1D1K A;  1Y1V H;  5AJ3 L;  2EVB A;  1A2U A;  2AWO A;  3PSI A;  3I2Z A;  2KHS A;  4XDX A;  4LF7 Q;  1F9R A;  1K0R A;  1XTC D;  1I6H H;  2WB1 G;  4JI3 Q;  1XMQ L;  2XN9 C;  4O0A A;  1OTC A;  5CV9 A;  5J22 A;  5IY0 A;  3H15 A;  4LFC Q;  1SNQ A;  1L0W A;  2Q8R E;  1TWH H;  1AW7 A;  3HGB A;  2MPM A;  4WRD A;  1CKN B;  3J81 i;  3CME A;  1IXR A;  2AHO B;  1TXY A;  2EZV A;  4JBW A;  5EKK A;  4L63 B;  4DR5 L;  4P75 A;  3ER0 A;  5EPJ A;  1IBK Q;  3T4A C;  5M3M B;  4A3F G;  4A3M G;  5IP9 G;  2ZTC A;  4BBS B;  2B63 G;  1D5Z C;  5CMD A;  1ZYR D;  1GUW A;  5LL6 S;  4DV6 Q;  2KUM A;  4BWG B;  3PF5 A;  3LX0 A;  4R1J A;  5C0X I;  3BYT B;  3K80 C;  5C5L A;  1VQG A;  2XSC A;  1ML0 D;  1GXD C;  3NQI A;  1NAP A;  4KI0 A;  2ID0 A;  4J1M A;  3M9B A;  1QUQ A;  1J8I A;  1KL9 A;  2VB3 X;  4GN3 B;  2PQA B;  4OO1 H;  1X3E A;  2K50 A;  1PH2 A;  1L1O C;  1PYW D;  4Q0F A;  4OEM B;  3ITP A;  4Y52 H;  2Z0S A;  4JOI A;  4LF8 L;  1NY4 A;  1LUZ A;  3VA7 A;  2KCC A;  4LF6 L;  1J5E L;  1Q46 A;  1NR2 A;  2K28 A;  4WJ3 M;  1HRJ A;  1TWF H;  1RCV D;  1TWC H;  4FP5 D;  4A3E B;  4GNX C;  2H1E A;  3BZK A;  2XVS A;  2KHJ A;  4A3B H;  1D7Q A;  1PH1 A;  3J81 j;  2UU9 L;  4FXD A;  2EDG A;  4X65 Q;  3L9A X;  3AMU A;  4PNY A;  1PTO B;  1BKB A;  1PZK D;  4BY7 G;  3M3Y H;  3KDF A;  1LT5 D;  1X3F A;  4DR2 Q;  1N36 L;  2BE5 D;  4LF5 Q;  4WJW A;  2GVA A;  1WTP A;  1DM0 B;  3I4M G;  2Q2I A;  2E2I H;  3U50 C;  2EYL A;  1M90 C;  1X6O A;  2CCZ A;  2E2H B;  1XNQ L;  4CKE A;  1CZG A;  5FOB B;  5M5W H;  3V96 A;  5JPM C;  5GQO A;  4C3I G;  4MTK A;  3U4V A;  1UAP A;  2R3Z A;  5FLX c;  3GTM B;  2KHI A;  1N34 Q;  4DV5 Q;  1RJT A;  2PI2 A;  1YIT A;  4AYB B;  3I70 A;  4FO2 A;  5LHY 1;  1MIU A;  5ELB A;  1OO9 B;  2AUJ D;  3CHB D;  2YV5 A;  1TWA H;  4DK3 C;  3I56 A;  2UUB L;  1LLR D;  2F0I A;  3J7A 5;  4IPC A;  3KYH C;  1DGS A;  2JA8 H;  1N8R C;  4QGU A;  5C6A A;  1HTP A;  3ULJ A;  3AU7 A;  3DEP A;  3L3O C;  1I50 B;  2C9O A;  1XMQ Q;  4QF4 A;  4MNO A;  4CDC C;  1WVL A;  3F8T A;  4NDX A;  3GTG H;  4K2K A;  1KHI A;  2B2T A;  3PIP A;  3HOZ B;  3VR6 A;  1EU3 A;  5DM6 3;  3E0J A;  1PZI D;  2ZXR A;  2F0V A;  4K5V A;  1XNR L;  1PH8 A;  3S1M H;  1I5F A;  3GO5 A;  3I55 A;  4ZLT F;  2K4K A;  3IFD A;  3HOY B;  1Z47 A;  5DNF A;  2R92 B;  2UXC L;  3U9S A;  5IYB G;  4YY3 Q;  4C2M B;  1YHQ A;  2B2U A;  3TBI B;  3F2B A;  5LMN L;  2XRQ D;  1Q90 A;  3J80 L;  4RGM A;  1HQR D;  5FO8 B;  4ZKB B;  1JOR A;  2K14 A;  4UY8 C;  1PXU A;  1X32 A;  3S2H H;  1SJE D;  2K6A A;  1K0S A;  2ZTD A;  2IT1 A;  2Q8T A;  1SE2 A;  4AH6 A;  1V8Q A;  4WJ4 A;  1Y1W B;  3JC6 6;  5D14 A;  2MFI A;  2VNU D;  5M5X H;  4KHV A;  1NBW A;  1PZJ D;  2CWA A;  4KN4 C;  3OMC A;  2ZJR A;  4DNR B;  1KLU D;  1JT8 A;  1J5E Q;  5FJ8 H;  1FJG Q;  3VYU A;  1CTM A;  1CHQ D;  2R93 G;  2PCF B;  5C4Z A;  3GTJ H;  1HR0 L;  3KBG A;  2CH4 A;  1X54 A;  1ET9 A;  3R2I A;  1B8A A;  1Y1V B;  2B3G A;  3CC2 A;  5FO7 B;  2NVQ H;  3EN2 A;  4DR7 L;  4G7O C;  4X64 L;  1QZH A;  4C3J H;  1EZ8 A;  4RGO S;  3UDG A;  2WII B;  1IYU A;  4UP8 A;  3A56 A;  4YHH L;  1EQV A;  1A3U A;  3QB3 A;  2EY1 A;  5EKL A;  4JV5 L;  3RZO B;  1ICW A;  3BS1 A;  1IKM A;  1HHV A;  3W1G A;  1IL2 A;  4DV4 L;  4DFA A;  3FDT A;  3RLO A;  4A3J B;  4JI7 Q;  4LMQ D;  1XNQ Q;  1GOZ A;  3BVZ A;  4F88 A;  3OPO A;  1EU4 A;  1QG7 A;  4DV0 L;  3WOF A;  3CCE A;  1EY5 A;  1UNS A;  3N6R A;  5GAE C;  2K52 A;  2YU9 H;  3HOU G;  2A19 A;  4ZAI A;  1EY9 A;  4M1U B;  1YHB A;  1NUC A;  1G91 A;  4A93 B;  2DJF C;  4OX9 Q;  2B2Y A;  2I07 B;  5H1S E;  2ES2 A;  4TRD A;  2M9V A;  1KQS A;  2H5X A;  3S17 H;  2V1C C;  2WIN B;  3D6W A;  3E6Z X;  3HOX B;  3NE5 B;  5BN3 A;  1KRS A;  3SK8 A;  1L1O B;  2JEB I;  4XYQ A;  5BN5 A;  2QDL A;  5FLX L;  1RHP A;  3CQZ B;  4POG A;  3DEO A;  2PZT A;  4AYB G;  4YIJ A;  3A7A B;  4JI5 Q;  4XQQ A;  4K0K L;  2QKI C;  3KLR A;  4B9X A;  1SYG A;  1NMF A;  1BBX C;  4IPH A;  4GNX B;  1BQQ T;  5EBD A;  2Z4I A;  4OHJ A;  3GTK H;  1PFS A;  2A6H D;  4A3D G;  1I94 L;  2WP8 J;  1M1K C;  4QIW E;  2HDM A;  3ICE A;  3I4O A;  2HD3 A;  2AKW B;  1TWG B;  2I5L X;  1EY6 A;  1JMC A;  1C8C A;  4A3B B;  3NBI A;  2K1B A;  2N8N A;  2B8G A;  5A35 A;  2BDN A;  2Z4H A;  1YNN C;  2EQS A;  2ASB A;  4ZRZ A;  1SE4 A;  1PH7 A;  5ELC A;  2F0N A;  3BU2 A;  2Z6K A;  4RKL A;  1U9R A;  2K7V A;  3M7G A;  2K01 A;  1NNX A;  2UXD Q;  2N49 A;  5IWA L;  3ULP A;  2A68 C;  4OXP A;  2VQF L;  3DUZ A;  5KEE A;  3HOY G;  4BBR H;  4HID A;  1X3P A;  4LFB L;  1HZB A;  1HTL D;  1KRT A;  1EQR A;  2MHV A;  1WTX A;  4HCS A;  3RLN A;  4RA8 A;  1F9Q A;  5TSS A;  5K36 G;  1PRT C;  2D0O A;  4JI1 L;  2VY3 A;  2JA9 A;  1G2S A;  3PIO A;  2FFK B;  3Q23 A;  2MP1 A;  4F8M A;  3R8B A;  1PYB A;  1VQC A;  4X66 Q;  1QNK A;  1VQJ A;  2L12 A;  1JE4 A;  4UDU C;  4BA2 I;  1SDF A;  4K6D A;  2N55 A;  1SN8 A;  4K6L A;  4FNF A;  1KLG D;  5I2X A;  4RGT A;  3MXN A;  5I9O A;  2PZU A;  2SNS A;  1Q8K A;  1NCV A;  3Q24 A;  2EYH A;  1STA A;  1KDB A;  1P16 A;  4YHH Q;  4LFA L;  3GTQ H;  1UE6 A;  1HA5 A;  2NBF A;  3G6E A;  4OIJ A;  2F1M A;  3TEH B;  4H44 C;  5KYI A;  3J7A F;  4R4O A;  2BA1 A;  1A0I A;  1Y1V G;  3VYT A;  2OWO A;  1LAC A;  2R61 A;  5E4W C;  2XIW A;  3GQB A;  1STB A;  4IUP A;  1WTQ A;  1L0Y B;  4AQY L;  3H6M A;  1EIG A;  3FKI B;  1C4Q A;  1EIH A;  1HFN A;  1E2V A;  1BCP C;  1W6J A;  1HFG A;  4FDB A;  3IAY A;  1QVF A;  4FXK C;  3DHQ A;  2UXB L;  3CXC A;  3MVV A;  4ZUI A;  4YCW A;  4XQN A;  3S2H B;  1TU2 B;  5IOD A;  5M3F H;  1JR0 D;  4ULL A;  4B3R L;  4HJA A;  1UE7 A;  4JI6 L;  3M4O H;  3KJO A;  3VYS A;  1W3S A;  1VS0 A;  4HR7 B;  1E22 A;  3FPP A;  2JA6 H;  1XX8 A;  4GS3 A;  4IUT A;  3QWN A;  3S1R H;  4XT3 B;  3RMH A;  1YI2 A;  5CC4 A;  1SAP A;  3D8G A;  3EBE A;  4GKK Q;  4DV2 Q;  2KCM A;  4BXX H;  4LF4 Q;  1EY7 A;  2DY7 A;  1YNJ D;  1PTO D;  4LF7 L;  4RGN A;  3VYR A;  1K8A C;  1WJJ A;  4KHZ A;  4A3F B;  4JI3 L;  2B63 B;  3D3R A;  4LFC L;  4OO1 G;  3K8A A;  2EJM A;  3JAM i;  5IGG A;  2EE1 A;  2F0F A;  3MFG A;  4RCO A;  3TP6 A;  2NB0 A;  4Q5V A;  1LTA D;  3AFQ A;  4P72 A;  2PNH A;  1CQF A;  1IBM Q;  2JXM B;  1TKW B;  3IL8 A;  4CDE C;  4BY1 H;  1GUS A;  2VS1 A;  4DK0 A;  4GOP C;  4A3B G;  1OXV A;  4RHR A;  3ONA B;  2K03 A;  2FHT A;  4GKJ Q;  1NTG A;  2HIV A;  1LTT D;  4DV6 L;  3PUX A;  1YBY A;  2F0M A;  2HCC A;  2IX0 A;  3SGI A;  1EIY B;  4KJO A;  5JPN C;  4DR3 Q;  1F2Y A;  3HKZ E;  2PW7 A;  4NB3 A;  1M4V A;  4EQO A;  2BDO A;  4JBJ A;  4PZ8 A;  1DYQ A;  2WV6 D;  1F2L A;  1KC8 C;  1FGU A;  1KTK A;  4MHE A;  1A6X A;  4ODG A;  5ISR A;  1EYA A;  1YJW A;  1LTB D;  2K5H A;  3KJP A;  1PH4 A;  2QA4 A;  4XTC S;  3CCL A;  1LT6 D;  3A0J A;  3I4M B;  1JB7 A;  1LV9 A;  2EIF A;  1FD7 D;  3NTI A;  5KNC A;  2JA8 G;  1LTG D;  1EYD A;  2NVY H;  3OTO Q;  1VQ6 A;  2PI2 E;  4K5W A;  4JPB W;  4DV7 Q;  3NQT A;  2KCT A;  3CCJ A;  4ZUJ A;  2ZJQ A;  4X3U A;  3MEH A;  2K5W A;  2F0J A;  2HQE A;  4UP7 A;  3Q22 A;  4ALP A;  1D8L A;  4X65 L;  4A4I A;  3S1Q H;  4G7H C;  1CKN A;  2BA0 A;  4R4Q A;  2F3W A;  1KDA A;  4DR2 L;  3KLS X;  1AE3 A;  1ENC A;  2F4I A;  1TS3 A;  3BVG A;  2IWH A;  1H9J A;  1MGS A;  1TS2 A;  2K33 A;  1EFW A;  4A75 A;  1S4Z A;  1FNU A;  2QEX A;  1Z9F A;  3BDO A;  1JE5 A;  5FLM H;  1XMO L;  1PTO F;  1VQB A;  5J3B A;  5LMU Q;  4DV5 L;  1N34 L;  3AYH B;  2XGT A;  5GRO A;  4UPA A;  1X3G A;  1ZKO A;  1YZ6 A;  2DNC A;  2E2J B;  2IJ0 A;  1DOK A;  4QY7 A;  3CCS A;  4OO1 I;  4GZY C;  2IPK D;  2PQA A;  4HTH A;  4KV6 A;  1FNV A;  1XJV A;  1K83 H;  4IJL A;  5JJI A;  1GJX A;  3J80 c;  4Z9C B;  3F2C A;  2D2C C;  3K0X A;  1PA6 A;  1E2W A;  5IT9 E;  1G2T A;  2SOB A;  3D4R A;  3GTQ B;  2CW0 C;  4KKT A;  3PMF A;  2B2T C;  5FJ8 G;  2CH4 W;  4JCV E;  3CCQ A;  2Y0S B;  5JJK A;  2GA4 B;  4JC0 A;  3RN5 A;  1R9T H;  5CV4 A;  1V1O A;  4YY3 L;  3R3O A;  1SXT A;  5J1Z A;  2R6G A;  1NJI C;  3A55 A;  1W2B A;  5JJL A;  1KD1 C;  4C3J G;  2OTL A;  3CKI B;  1CSQ A;  1OXS C;  4DUZ Q;  4PQX A;  1X9N A;  4FF1 A;  4JK1 C;  3D6C A;  3S16 H;  3QR8 A;  2H4O A;  4DN4 M;  2M00 A;  1QOH A;  3S15 B;  3W2D A;  4HJ5 A;  1XWE A;  2R93 B;  3FEW X;  1NR4 A;  1LTI D;  2HCI A;  1CM9 A;  5C3X A;  3M7N A;  3GV6 A;  4TKO B;  3S14 H;  1B4O A;  2LFN A;  5D65 A;  3K58 A;  1H95 A;  3SK6 A;  4LAA A;  3C1E A;  2L5T A;  2IY5 B;  2KED A;  4CBV A;  1X3Q A;  2D62 A;  4O2D A;  5M3F B;  1DOM A;  4PMC A;  4A3K H;  2CQO A;  3MFY A;  1EFI D;  4IAL A;  4K8J A;  3MXP A;  4L5Q A;  2ZM6 Q;  1FJG L;  3PGZ A;  2QEJ C;  3RLF A;  1JOQ A;  1ZYR C;  1PYS B;  3I73 A;  1EYC A;  2ICI A;  1UWV A;  1ONL A;  2OQ0 A;  3M4P A;  5ELN A;  1LAB A;  4R8N A;  1ESR A;  4AIM A;  4RWS C;  3WWV A;  5I4D A;  3NEM A;  3S2D B;  4HED A;  1VQM A;  3HOU B;  2L55 A;  4XIG S;  4NKL A;  5HGT A;  2KCN A;  3FRP B;  2RA4 A;  3KUP A;  5EKI A;  2Q2U A;  4IPD A;  1RDP D;  1DOL A;  4JI7 L;  2UUC L;  5EQ0 A;  5CV7 A;  4DAP A;  2NUC A;  3F2U A;  3C3L A;  3FVQ A;  3P75 A;  1XMO Q;  2WAC A;  3AFP A;  3GTP B;  4RG1 A;  4JBK A;  1JWS D;  3D4D A;  3OHX C;  3RN2 A;  3GV3 A;  4CJ0 B;  2NVX H;  1PH3 A;  2R7Z H;  4X3K A;  1EWC A;  3X3M A;  2Q2T A;  1DD2 A;  4IJH A;  5E7N A;  3PIP 3;  4B3T Q;  3BZD B;  4OX9 L;  4LK1 C;  5C4J B;  1ZXT A;  1WYD A;  1SMY D;  1MD2 D;  2NZH A;  1HUN A;  1B3Q A;  4A3D B;  3S1N H;  2K04 A;  1SR3 A;  3J7A V;  1SRU A;  2YTV A;  2B2Y C;  2BE5 C;  4X3T A;  1G6Z A;  2YYZ A;  5E4X A;  4BBR G;  4LNQ A;  1I3Q H;  2MGS A;  4OEL B;  4LJZ C;  2Q8I B;  1K8G A;  2CWP A;  4HIM A;  3NSW A;  1T5E A;  5EJW A;  1N33 Q;  1IYJ B;  5GAH C;  2PMZ E;  2EY2 A;  3CD6 A;  3T1H Q;  1VMP A;  4JI5 L;  4QMG A;  5J39 A;  3UDX A;  2GVB A;  3S24 A;  5G3L D;  3BVM A;  4KY7 A;  1AN8 A;  2CKZ B;  1RIP A;  3CC4 A;  2HUG A;  1LYL A;  2MJ8 A;  1KNA A;  4B3M Q;  4A3G H;  3HZX A;  2J0T D;  2Z6B A;  4K5X A;  2WAQ B;  2KEC A;  3T51 B;  2FMM A;  3STB D;  1B9M A;  1HZ9 A;  3N52 A;  1B70 B;  2DY8 A;  2JA5 H;  3H3V H;  3KK7 A;  2UXD L;  2ZT9 C;  5KNB A;  3ERS X;  3K7A H;  4U68 A;  5IT9 c;  3GTO H;  3TP8 A;  2L1B A;  4DR1 Q;  2WB1 E;  1UE5 A;  2Y0S G;  4DKA C;  2HHH Q;  2NVT H;  2OT2 A;  2Z6K C;  4EGV A;  4R4T A;  3SR1 A;  1SRO A;  4KMU C;  4GLV B;  1SBB B;  4DK1 A;  1CKO A;  2K75 A;  3H3V C;  4L5S A;  1EOT A;  3T16 A;  1HNW Q;  4XYO A;  4G57 A;  3BZC A;  3H0G H;  3RZD B;  5C3E H;  3URY A;  1WCM B;  3A8I E;  4X66 L;  3C2P A;  3T53 B;  1JOO A;  1L1O A;  5BN4 A;  3E9I A;  2Z1C A;  4DNT B;  1MJC A;  4OGQ C;  3KF6 B;  2VW9 A;  2O2L D;  2X69 A;  5C44 H;  1CA5 A;  2O5I C;  4PMB A;  4APV A;  4IUU A;  4LUO A;  5M5Y H;  4N9T A;  2J4X A;  5M3F G;  1KNE A;  4ZYS A;  4PZ7 A;  1VQL A;  4GNX A;  1I6H B;  4K2L A;  2IHE A;  4I65 A;  3IRB A;  1XPO A;  1SFO H;  3AQQ A;  3NUC A;  4CGY B;  4F87 A;  2JA6 G;  1IZ6 A;  1GHJ A;  1TWH B;  3M4Q A;  3NEL A;  3UDI A;  3JAM E;  4B3S Q;  4A3M H;  3QIA A;  2F0K A;  2UUC Q;  4DV1 Q;  1VF5 C;  2K5V A;  3ND8 A;  1DJR D;  1GKH A;  1HCZ A;  1JJ2 A;  4PG3 A;  3UDF A;  1ENA A;  1WD0 A;  5CV6 A;  4I7Z C;  2F4V Q;  1AP0 A;  5M9O A;  3CPW A;  4B08 A;  4XT1 B;  2L4N A;  1YVC A;  4IUQ A;  2LY7 A;  1JQY D;  3CMA A;  3P1H A;  2JQO A;  1K8O A;  1VQ8 A;  2CQA A;  3MA2 B;  5G3L F;  2OF1 A;  5EPK A;  1O78 A;  3KOJ A;  1QE6 A;  3K5O A;  5IOC A;  4YWK A;  2B2W A;  2EXD A;  4BY1 G;  5A2Q E;  3PF4 A;  4DAY B;  1PLF A;  1H9R A;  4R4I A;  5I9P A;  1S5D D;  4EVO A;  4RKB A;  4P2C B;  3CF5 A;  1HA6 A;  2R7F A;  1JOK A;  5EGT A;  2A1A A;  4KKU A;  4A3K B;  3OIP A;  5CYU A;  1YNN D;  4X6A H;  1S5E D;  2NN6 H;  4GKK L;  4DV2 L;  2D9U A;  4QB4 A;  3M85 A;  4HMJ A;  4LF4 L;  1TWF B;  1A8V A;  1TWC B;  4BY7 H;  2JA7 H;  4ZKC B;  3ULL A;  2MNA A;  3DM3 A;  1OXT A;  1SYD A;  4F7X A;  1EL0 A;  1UEA B;  2B29 A;  1X65 A;  3PIO 3;  2XWJ B;  1Y14 B;  4HSV A;  2X6L A;  3DM1 A;  4GN5 A;  4IPG A;  2A74 C;  2JP1 A;  3K81 C;  3ERO A;  4DV3 Q;  1B2T A;  3ZJY C;  1SSO A;  3M3Y B;  3KBX A;  1Y8O B;  1IBM L;  2RDF A;  3GP7 A;  4OWW B;  2D5D A;  3HOW H;  3HEJ A;  5T1G A;  2CVR A;  2E2I B;  1S5B D;  1U4M A;  4A3I H;  1FYC A;  1TT2 A;  2ZXO A;  2C5C A;  1A15 A;  1JWM D;  5M5W B;  1Q3L A;  2WAQ G;  1EQQ A;  4P73 A;  1I4H A;  3E3X A;  2IW3 A;  3TQY A;  3U9O A;  4GKJ L;  4CJ1 B;  2G5D A;  2BH8 A;  5JAV A;  1GUG A;  4DAV A;  2AQ2 B;  2KA7 A;  4KJN A;  1GO3 E;  5IT9 L;  5IP7 H;  2R7Z B;  1TWA B;  4BS9 A;  4DR3 L;  5BR8 Q;  1VCI A;  4GLA C;  1VMC A;  2JA8 B;  1H9S B;  2A6E C;  3VR3 A;  5C3W A;  4PMW A;  1CT1 D;  3E5S A;  1AZQ A;  1IKL A;  3D31 A;  4IFD H;  1K3B C;  1WTR A;  3CCM A;  4LW1 A;  1SND A;  5FLM G;  1NSN S;  4DV3 L;  2X6G A;  4JVZ A;  1WCM G;  4DF7 A;  3VR4 A;  3MXG A;  3TME A;  3GTG B;  1KAA A;  5JVG 3;  3W1B A;  3AB9 A;  2F0E A;  4YWM A;  1QZG A;  1CA6 A;  1KDC A;  1E0B A;  5IYC H;  4QUF A;  4LF9 Q;  3J81 E;  4IFD J;  1V43 A;  2B2V C;  3R2T A;  5IIF A;  3OTO L;  3Q0A A;  4DV7 L;  1Y69 U;  3S1M B;  4A3C H;  3G6J B;  1JB3 A;  3MWY W;  4OL7 A;  2F0S A;  1VDZ A;  4EQN A;  1MJE A;  1AH9 A;  3U4Z A;  1N32 L;  4L6T B;  3LNN A;  1HJP A;  5M3M H;  1DXM A;  1UEB A;  1S40 A;  2E75 C;  2MO1 A;  4V19 0;  1F2M A;  4BBS H;  2JA5 B;  1VQ5 A;  3JAM c;  3PQI A;  3NP8 A;  4QL5 A;  3RUZ A;  1IYV A;  2LMC B;  1L2F A;  1GUO A;  2NTT A;  2JN4 A;  2FMC A;  5IGB A;  5LMU L;  4MZ9 A;  1VQ4 A;  2F0U A;  5T1I A;  4DUY Q;  1Z6H A;  4FXG C;  4ME3 A;  4JI8 Q;  1SNP A;  1Y8P B;  5CV8 A;  4E6I A;  5M5X B;  3CC7 A;  1D1I A;  3FPU B;  3I91 A;  1MHW C;  1STH A;  1GM5 A;  3HKS A;  1SE8 A;  1HNZ L;  1K28 A;  3TZU A;  3OOC A;  2PO4 A;  3TS0 A;  4TVA B;  2JEA I;  3GTJ B;  4L5T A;  1B1Z A;  4L5R C;  5E3F A;  1HQM C;  2G9D A;  1PFM A;  1GVP A;  3K57 A;  4FF3 A;  2NVQ B;  1ROD A;  1A2T A;  4JG2 A;  1AE2 A;  4C3J B;  1QJO A;  1S72 A;  3K7U C;  4A3E H;  4FYD A;  2E8G A;  1WTV A;  4A3K G;  4H0L C;  1ASZ A;  3P7J A;  5DLQ E;  5JEA H;  3MHB A;  3F2D A;  1HR0 W;  1I4G A;  4AYB E;  1IHZ A;  2QDB A;  3V2T A;  5HGQ A;  1RL2 A;  2ALY B;  1U4R A;  2DJG C;  2JE6 I;  3UE0 A;  3DWQ A;  1IBL Q;  1SLJ A;  1BUV T;  1RD9 D;  4DGZ A;  4DPG A;  1B53 A;  1IW7 D;  1WD1 A;  2ICE C;  2F0T A;  5IGE A;  4DA2 A;  1W6K A;  2DNE A;  2XRS D;  1TR5 A;  1HZA A;  1YNJ C;  3PUZ A;  2E2H H;  3DMU A;  2I0Q A;  5JEA J;  2YU9 B;  1F2Z A;  4DUZ L;  3I3C A;  2RDG A;  1NMG A;  1O7I A;  4ABN A;  4IQZ A;  1B7Y B;  4POF A;  3GTM H;  2Z9H A;  5EPL A;  5IYD H;  1LO5 D;  2UUA Q;  3S17 B;  3HS0 C;  1PDQ A;  2RF4 A;  1I4Q A;  4KK7 A;  1GD7 A;  5IGD A;  1D2B A;  1STG A;  3DXJ C;  5JVH 3;  4DR4 Q;  1FVI A;  1TVX A;  1HH2 P;  2VL6 A;  2A8V A;  3PV0 A;  2ZM6 L;  2R7Z G;  2FJ2 A;  2A69 D;  1J9O A;  4J8Q A;  4GLX A;  1I50 H;  1X55 A;  4R4C A;  4JOI C;  4L8J A;  2OQK A;  2TMP A;  3GTK B;  2NZ1 D;  3H09 A;  1WTO A;  3HOZ H;  2OCE A;  1NE3 A;  1VQH A;  2V4D A;  3KLS A;  2Z8L A;  4N8F A;  3L2P A;  4CJ2 C;  1FL0 A;  2AWN A;  1BXT A;  3PO2 H;  4JYA Q;  1N9W A;  5C4X H;  4I7A A;  1SE3 A;  2N88 A;  1N32 Q;  2R92 H;  4DXF A;  3G48 A;  1D5M C;  4C2M H;  3OMG A;  4IUN A;  1K8M A;  4QUC A;  1Q1E A;  1Y8N B;  3L7Z C;  3HOV H;  1PRT B;  1SYF A;  4JI2 Q;  2O4X A;  3J81 c;  5E1F A;  3EVQ A;  3I4L A;  1SNC A;  1R4P B;  2RCF A;  4BBR B;  4IZ8 A;  1Q7Y C;  4JI0 Q;  4P71 A;  4QIW B;  5CR3 A;  3OSO A;  4O1N A;  4X62 L;  3A5Z B;  5EBC A;  3LGJ A;  2VQE Q;  2F0O A;  4B3T L;  1OXU A;  3CCU A;  4RMF A;  1UE1 A;  3MZ5 A;  1Y1W H;  2JA5 G;  3GDE A;  3J7Y W;  3NBH B;  3I72 A;  3JAM L;  1HNZ Q;  1KAB A;  1G6P A;  1V1P B;  3CCR A;  4O42 A;  3A8K E;  3KFU A;  2GN5 A;  4HN7 A;  1WI5 A;  3EFX D;  3VA5 A;  1LT4 D;  3PUV A;  1N33 L;  1OXX K;  2EJG C;  1RF2 D;  1MI2 A;  3T1H L;  3R93 A;  2E5L Q;  3H0G G;  4G4K A;  5C3E G;  4N9P A;  4DR6 Q;  1G51 A;  4IO9 A;  3OWE B;  4JBM A;  2XTI A;  5D3I B;  1V9P A;  1O7Z A;  2VZA A;  4B3M L;  1TS4 A;  2F0W A;  2I46 A;  3RZO H;  2RHQ B;  1C7Y A;  2VUM H;  2MO0 A;  4BA1 I;  5C44 G;  2RDH A;  1QVG A;  1BCP B;  3KF8 B;  5A2Q L;  1ICF B;  3EJI A;  4EQ5 A;  1A3T A;  1HPC A;  2DN8 A;  3UE1 A;  2K5Q A;  3HP3 A;  4IUR A;  4B9W A;  4A3J H;  5CBA E;  2B2U C;  4ID6 A;  1EEI D;  4N8X 1;  1Z7T A;  4GOP A;  4ZK9 B;  3SK5 A;  1F77 A;  4NXN L;  4DR1 L;  2HHH L;  2Q2H A;  4RCN A;  1VQD A;  4HAE A;  4MTN A;  1BBW A;  3OIQ A;  1HNX Q;  4A93 H;  4R9W A;  2WKD A;  3SE0 A;  4IUV A;  1XYI A;  1WTH A;  1HNW L;  2RHS B;  4DXG A;  1BNZ A;  4DNI A;  3M4O B;  2PPB C;  3HOX H;  3NK9 A;  1YEZ A;  1LTL A;  1XTD A;  4CDF C;  1D6E C;  5COR A;  1K73 C;  2JA6 B;  1RTO A;  3J80 i;  3CQZ H;  4DAM A;  1CFM A;  3S1R B;  2IX3 A;  2RKS A;  2OEO A;  1JCK B;  3LWE A;  1YIJ A;  1PHJ A;  1O7Y A;  1EUJ A;  1O80 A;  1PH6 A;  2HDL A;  3CU7 A;  3HRZ C;  2FXQ A;  2QGQ A;  2PYK A;  1TWG H;  2JK8 A;  1B9N A;  4RAU C;  1QVC A;  1EWI A;  2PNR C;  1VQN A;  4K14 A;  4GOP B;  4B3S L;  1VQA A;  4DV1 L;  4U67 3;  1G29 1;  2NN6 G;  3H94 A;  2QF7 A;  2HIX A;  4NXM Q;  1JJC B;  5I6W A;  1I4X A;  3H3V I;  5HY6 A;  1VQP A;  4BY1 B;  3T1Y Q;  1Q81 C;  3WOE A;  2JA7 G;  1S5C D;  4X62 Q;  4YCU A;  2F4V L;  1EEF D;  4KHP Q;  2L0C A;  1B3A A;  1T5X D;  3OYY A;  1SEB D;  3QO2 A;  1E2Z A;  1L0X B;  2BH2 A;  4YCV A;  1XXG A;  3QOJ A;  3OW7 A;  1FNW A;  2A5H A;  2KEE A;  4CKC A;  5ELF A;  1S3O A;  5C0X H;  1BVS A;  2XWB B;  1QCB D;  2XNA C;  3IFT A;  4JI4 L;  1QUQ B;  3J81 L;  3HOW G;  3BYY B;  4HMI A;  4A3I G;  1F9P A;  4KY5 A;  1Q1B A;  1Q82 C;  1VQ7 A;  2P5Z X;  3K6O A;  1PV4 A;  3G71 A;  2RCN A;  2B2W C;  3O13 A;  2IHF A;  3TSS A;  1ET6 A;  1KAW A;  1MSG A;  5AJ3 Q;  3PO3 H;  2ZTE A;  5C0X J;  3KF6 A;  1ILQ A;  1Q8I A;  3EQL C;  1IL8 A;  1A63 A;  5IP7 G;  4P74 A;  3MAQ A;  1CI3 M;  1Q86 C;  4PZ6 A;  3A7L A;  1VQ9 A;  2SEB D;  1BDO A;  2G9H D;  2NVY B;  3HKZ B;  4C3H H;  3I4N H;  1CHP D;  1SMY C;  3EIV A;  4IFD G;  3SK4 A;  3CAM A;  4A3L H;  2B8F A;  1TII D;  2F0Q A;  3T56 B;  3PO2 B;  1E1O A;  2YTY A;  3KDF B;  5C4X B;  1S5F D;  1TS5 A;  3S1Q B;  4Y7N H;  3TP7 A; 
#chains in the Genus database with same CATH homology
 1JIC A;  3SVM A;  1I4R A;  3HOV B;  3BG3 A;  3SXH A;  5HUR A;  5KYL A;  1O7L A;  3K5L A;  5I6Y A;  3M4Y A;  2RSO A;  2K32 A;  2AUK A;  5KIX A;  1A3V A;  5K5P A;  3K5N A;  2IX1 A;  1MBY A;  3PUY A;  1UUP A;  3RD4 A;  1TY2 A;  1C48 A;  5ELE A;  2F0D A;  3Q6S A;  2RQX A;  1H9M A;  5COY A;  3EA6 A;  4DAY A;  1ILP A;  3QG1 A;  3G7L A;  4S3S A;  5DM7 3;  4WOR A;  3OWF A;  3D4W A;  2AQ1 B;  2SDF A;  1K83 B;  2NN6 I;  2F0G A;  3NTH A;  1G8Z D;  1DZ1 A;  2B39 A;  2KQ3 A;  1B50 A;  1QWY A;  5IGC A;  1R9T B;  4QCL A;  2VUM B;  2NYZ D;  2PW5 A;  3I90 A;  1BR9 A;  4HSP A;  4ME5 A;  1EY4 A;  1FR3 A;  5JEA G;  1PFN A;  3S16 B;  2K05 A;  3SEB A;  4CHT B;  5C4H A;  3TN2 A;  1CK1 A;  4NP5 A;  1FGB D;  3PUW A;  2E76 C;  2ZXP A;  2KOL A;  4MIU A;  5DEH A;  3S14 B;  2EPB A;  5KND A;  4TSS A;  3TZD A;  2PZW A;  1Q12 A;  3C46 A;  4IFD I;  5KGU A;  1H9S A;  2KVM A;  3K59 A;  2LKV A;  2VB2 X;  1VF7 A;  1TY0 A;  3LWU A;  1JC7 A;  5NUC A;  2A68 D;  1HUM A;  5CBE E;  2AQ3 B;  1B44 D;  1LT3 D;  3UI2 A;  5I2Y A;  1QIL A;  2NWG A;  2MUY A;  2NTS A;  3SDZ A;  1ZEQ X;  3QOL A;  1SNO A;  2O5J C;  1SNM A;  3IKJ A;  1PRT D;  3NHH A;  2QIL A;  3NPP A;  1EY8 A;  2EXZ A;  4XXE A;  1R4Q B;  2F0P A;  2A6H C;  3HG9 A;  4C1N I;  3A54 A;  3BDC A;  2A6E D;  1CZW A;  4M8A A;  3QJY A;  3TDQ A;  1LTR D;  2NVX B;  1PMR A;  3GD7 A;  4PV1 C;  2RVL A;  3DWA A;  3S1N B;  2EYM A;  4FF2 A;  1AEX A;  4RFB A;  3MXU A;  4WFN 3;  3TP5 A;  1I3Q B;  1CQV A;  2E74 C;  4MN3 A;  3MTS A;  1AZP A;  4K8I A;  4FF4 A;  2E2D C;  2JSO A;  1EWH A;  2ENB A;  3PO3 B;  1BCP D;  1TQO A;  4KD3 A;  2A73 B;  2M2L A;  3NWS A;  4A3G B;  1HXY D;  3BDL A;  4C3H B;  3I4N B;  1EZ6 A;  3ERQ A;  4IN3 A;  2QCP X;  2EOT A;  3FMC A;  1SYE A;  2TSS A;  5JJZ A;  1AFP A;  2PMZ B;  4KKS A;  1JWU D;  4HCE A;  4Y7N B;  3K7A B;  2RBM A;  3GTO B;  2NVT B;  2JYO A;  4KY6 A;  4NMZ A;  3CRL C;  1BOS A;  2F0L A;  4CKB A;  4J6H A;  5F2D A;  3T13 A;  5KRU A;  2PQE A;  1F9S A;  3H0G B;  3H91 A;  5C3E B;  1PRT F;  1GUN A;  1DON A;  1LTS D;  4DU9 A;  2EYF A;  3J80 E;  4X3S A;  4R8I A;  2WB1 B;  2EY6 A;  2SNM A;  5C44 B;  2VXW A;  5JOB A;  4EQP A;  2EYO A;  5M5Y B;  4NW2 A;  4V0B A;  4KTA A;  2KJX A;  5ELD A;  1H9K A;  5FK9 C;  1SFO B;  1SJH D;  1EY0 A;  1SYB A;  3K0Y A;  1MSH A;  1STN A;  2FIN B;  2OXP A;  1PTO H;  5LL6 X;  4A3M B;  1GUT A;  5D3D A;  5DAU A;  2LS0 1;  1GHK A;  2EYP A;  5IGF A;  2EYJ A;  1SYC A;  1PTO C;  3ND9 A;  4G7Z C;  3X3N A;  2J7Z A;  5C5M A;  4ILW A;  1RKN A;  3S9W A;  1BCP F;  3A8J E;  5FKA C;  2K5D A;  1U4P A;  2F03 A;  4FVM A;  2L9H A;  3NBH A;  1DCZ A;  1U4L A;  1BO0 A;  1IW7 C;  1V1P A;  3VR2 A;  4RHS A;  2EJF C;  1STY A;  4H13 C;  4RH6 A;  1ENF A;  5C0X G;  2EY5 A;  3GTL B;  3I8Z A;  4C56 C;  4BY7 B;  3W3A A;  2JA7 B;  2B2V A;  3MC0 B;  2RSN A;  1PFB A;  2BCO A;  3CRK C;  4TQU S;  4KN7 C;  2CHB D;  3WDN A;  5K36 H;  5FLX E;  2BOS A;  1WTW A;  4C3I B;  1M8A A;  1QNU A;  3KF8 A;  3NWT A;  4C1N K;  3HOW B;  2A69 C;  2F3V A;  4A3I B;  5CGK A;  1RTN A;  4C3H G;  1ESF A;  4H7B A;  1I6V C;  1EQT A;  4OIK A;  5CV5 A;  3C1F A;  2WKC A;  4KD4 A;  4XQJ A;  5FO9 B;  3NTK A;  1D5X C;  1STE A;  3DWP A;  3K5M A;  4ZQ3 A;  5AFW A;  3SHL A;  2IL8 A;  2CW0 D;  3VR5 A;  1II3 A;  2L11 A;  3ZYY X;  2F0H A;  4UAI A;  1QB5 D;  3V05 A;  3NXW A;  3P20 A;  1BF4 A;  1I4P A;  1D1K A;  2EVB A;  1A2U A;  2AWO A;  2KHS A;  4XDX A;  1F9R A;  1XTC D;  2XN9 C;  5CV9 A;  5J22 A;  1SNQ A;  2Q8R E;  1AW7 A;  3HGB A;  2MPM A;  4WRD A;  2EZV A;  4JBW A;  5EKK A;  4L63 B;  5EPJ A;  3T4A C;  5M3M B;  4BBS B;  1D5Z C;  5CMD A;  1ZYR D;  1GUW A;  5LL6 S;  2KUM A;  4BWG B;  3LX0 A;  5C0X I;  3BYT B;  5C5L A;  2XSC A;  1ML0 D;  1GXD C;  3NQI A;  1NAP A;  4KI0 A;  2ID0 A;  4J1M A;  1J8I A;  2VB3 X;  4OO1 H;  1PYW D;  4Q0F A;  3ITP A;  3VA7 A;  2KCC A;  1NR2 A;  2K28 A;  1HRJ A;  1RCV D;  4FP5 D;  4A3E B;  2H1E A;  2XVS A;  4FXD A;  2EDG A;  3AMU A;  3L9A X;  4PNY A;  1PTO B;  1PZK D;  1LT5 D;  2BE5 D;  4WJW A;  1WTP A;  1DM0 B;  2EYL A;  2E2H B;  4CKE A;  1CZG A;  5FOB B;  3V96 A;  5JPM C;  4C3I G;  1UAP A;  2R3Z A;  3GTM B;  1RJT A;  4AYB B;  3I70 A;  4FO2 A;  5LHY 1;  5ELB A;  1OO9 B;  2AUJ D;  3CHB D;  1LLR D;  2F0I A;  5C6A A;  1HTP A;  3AU7 A;  3DEP A;  3L3O C;  1I50 B;  2C9O A;  4QF4 A;  1WVL A;  4NDX A;  4K2K A;  2B2T A;  3HOZ B;  3VR6 A;  1EU3 A;  5DM6 3;  3E0J A;  1PZI D;  2ZXR A;  2F0V A;  4K5V A;  3GO5 A;  4ZLT F;  3IFD A;  3HOY B;  1Z47 A;  5DNF A;  2R92 B;  3U9S A;  4C2M B;  2B2U A;  3TBI B;  2XRQ D;  1Q90 A;  3J80 L;  4RGM A;  1HQR D;  5FO8 B;  4ZKB B;  1JOR A;  1PXU A;  1X32 A;  1SJE D;  2K6A A;  2IT1 A;  2Q8T A;  1SE2 A;  1V8Q A;  1Y1W B;  5D14 A;  2VNU D;  4KHV A;  1PZJ D;  4KN4 C;  3OMC A;  4DNR B;  1KLU D;  3VYU A;  1CTM A;  1CHQ D;  2PCF B;  5C4Z A;  3KBG A;  1ET9 A;  3R2I A;  1Y1V B;  4G7O C;  5FO7 B;  1EZ8 A;  4RGO S;  2WII B;  1IYU A;  3A56 A;  1EQV A;  1A3U A;  3QB3 A;  2EY1 A;  5EKL A;  3RZO B;  1ICW A;  3BS1 A;  1IKM A;  1HHV A;  4DFA A;  3FDT A;  4A3J B;  4LMQ D;  1GOZ A;  3BVZ A;  4F88 A;  3OPO A;  1EU4 A;  1QG7 A;  3WOF A;  1EY5 A;  1UNS A;  3N6R A;  4ZAI A;  1EY9 A;  4M1U B;  1NUC A;  1G91 A;  4A93 B;  2B2Y A;  2I07 B;  4TRD A;  2M9V A;  2WIN B;  3D6W A;  3E6Z X;  3HOX B;  3NE5 B;  5BN3 A;  3SK8 A;  2JEB I;  4XYQ A;  5BN5 A;  5FLX L;  1RHP A;  3CQZ B;  3DEO A;  2PZT A;  4YIJ A;  3A7A B;  4XQQ A;  2QKI C;  3KLR A;  4B9X A;  1SYG A;  1BBX C;  1BQQ T;  5EBD A;  2Z4I A;  4OHJ A;  2A6H D;  2WP8 J;  2HDM A;  1TWG B;  1EY6 A;  1C8C A;  4A3B B;  3NBI A;  2K1B A;  2B8G A;  5A35 A;  2BDN A;  2Z4H A;  1YNN C;  4ZRZ A;  1SE4 A;  5ELC A;  2F0N A;  4RKL A;  1U9R A;  2K7V A;  3M7G A;  2K01 A;  2A68 C;  3DUZ A;  5KEE A;  1X3P A;  1HTL D;  2MHV A;  1WTX A;  4HCS A;  4RA8 A;  1F9Q A;  5TSS A;  5K36 G;  1PRT C;  1G2S A;  2FFK B;  3Q23 A;  2MP1 A;  4F8M A;  3R8B A;  1QNK A;  2L12 A;  1JE4 A;  4UDU C;  4BA2 I;  1SDF A;  4K6D A;  2N55 A;  4K6L A;  4FNF A;  1KLG D;  5I2X A;  4RGT A;  3MXN A;  5I9O A;  2PZU A;  2SNS A;  1NCV A;  3Q24 A;  2EYH A;  1STA A;  1KDB A;  1HA5 A;  2NBF A;  4OIJ A;  2F1M A;  4H44 C;  5KYI A;  3J7A F;  2BA1 A;  3VYT A;  1LAC A;  2R61 A;  5E4W C;  2XIW A;  3GQB A;  1STB A;  4IUP A;  1WTQ A;  1L0Y B;  3H6M A;  1EIG A;  3FKI B;  1C4Q A;  1EIH A;  1HFN A;  1E2V A;  1BCP C;  1W6J A;  1HFG A;  3IAY A;  4FXK C;  3DHQ A;  3MVV A;  4ZUI A;  4XQN A;  3S2H B;  1TU2 B;  5IOD A;  1JR0 D;  4ULL A;  3VYS A;  4HR7 B;  3FPP A;  1XX8 A;  4IUT A;  3QWN A;  4XT3 B;  3RMH A;  5CC4 A;  1SAP A;  3D8G A;  1EY7 A;  2DY7 A;  1YNJ D;  1PTO D;  4RGN A;  3VYR A;  4KHZ A;  4A3F B;  2B63 B;  3D3R A;  4OO1 G;  2EJM A;  5IGG A;  2EE1 A;  2F0F A;  3MFG A;  4RCO A;  3TP6 A;  2NB0 A;  4Q5V A;  1LTA D;  1CQF A;  2JXM B;  1TKW B;  3IL8 A;  1GUS A;  4DK0 A;  1OXV A;  4RHR A;  3ONA B;  2K03 A;  2FHT A;  1LTT D;  3PUX A;  2F0M A;  2HCC A;  2IX0 A;  4KJO A;  5JPN C;  1F2Y A;  2PW7 A;  1M4V A;  4EQO A;  2BDO A;  1DYQ A;  2WV6 D;  1F2L A;  1KTK A;  4MHE A;  1A6X A;  4ODG A;  5ISR A;  1EYA A;  1LTB D;  4XTC S;  1LT6 D;  3I4M B;  1LV9 A;  1FD7 D;  3NTI A;  5KNC A;  1LTG D;  1EYD A;  4K5W A;  3NQT A;  4ZUJ A;  4X3U A;  3MEH A;  2K5W A;  2F0J A;  2HQE A;  3Q22 A;  4G7H C;  2BA0 A;  2F3W A;  1KDA A;  3KLS X;  1ENC A;  2F4I A;  1TS3 A;  3BVG A;  2IWH A;  1H9J A;  1MGS A;  1TS2 A;  2K33 A;  1S4Z A;  1FNU A;  3BDO A;  1PTO F;  1ZKO A;  2DNC A;  2E2J B;  2IJ0 A;  1DOK A;  4OO1 I;  4GZY C;  2IPK D;  4HTH A;  4KV6 A;  1FNV A;  1GJX A;  4Z9C B;  2D2C C;  1E2W A;  5IT9 E;  1G2T A;  2SOB A;  3D4R A;  3GTQ B;  2CW0 C;  4KKT A;  3PMF A;  2B2T C;  2Y0S B;  2GA4 B;  5CV4 A;  1V1O A;  3R3O A;  1SXT A;  5J1Z A;  2R6G A;  3A55 A;  4C3J G;  3CKI B;  1OXS C;  4PQX A;  4FF1 A;  4JK1 C;  3D6C A;  2H4O A;  4DN4 M;  2M00 A;  1QOH A;  3S15 B;  3W2D A;  2R93 B;  1XWE A;  3FEW X;  1NR4 A;  1LTI D;  2HCI A;  1CM9 A;  5C3X A;  3M7N A;  3GV6 A;  4TKO B;  1B4O A;  2LFN A;  5D65 A;  3K58 A;  3SK6 A;  4LAA A;  3C1E A;  2L5T A;  2KED A;  4CBV A;  1X3Q A;  2D62 A;  5M3F B;  1DOM A;  4PMC A;  3MFY A;  4K8J A;  1EFI D;  4IAL A;  3MXP A;  2QEJ C;  3RLF A;  1JOQ A;  1ZYR C;  3I73 A;  1EYC A;  2ICI A;  1ONL A;  1LAB A;  4R8N A;  1ESR A;  4RWS C;  5I4D A;  3S2D B;  4HED A;  3HOU B;  2L55 A;  4XIG S;  4NKL A;  5HGT A;  2KCN A;  3FRP B;  2RA4 A;  3KUP A;  5EKI A;  1RDP D;  1DOL A;  5EQ0 A;  5CV7 A;  4DAP A;  2NUC A;  3F2U A;  3C3L A;  3FVQ A;  3P75 A;  2WAC A;  3GTP B;  1JWS D;  3D4D A;  3OHX C;  3GV3 A;  4CJ0 B;  4X3K A;  1EWC A;  3X3M A;  1DD2 A;  3PIP 3;  3BZD B;  4LK1 C;  5C4J B;  1ZXT A;  1SMY D;  1MD2 D;  1HUN A;  4A3D B;  2K04 A;  3J7A V;  2B2Y C;  2BE5 C;  4X3T A;  1G6Z A;  2YYZ A;  5E4X A;  4LJZ C;  2MGS A;  2Q8I B;  3NSW A;  1T5E A;  5EJW A;  2EY2 A;  1VMP A;  4QMG A;  5J39 A;  5G3L D;  3BVM A;  4KY7 A;  1AN8 A;  2HUG A;  2MJ8 A;  1KNA A;  3HZX A;  2J0T D;  4K5X A;  2WAQ B;  2KEC A;  3T51 B;  2FMM A;  1B9M A;  3N52 A;  2DY8 A;  3KK7 A;  2ZT9 C;  5KNB A;  4U68 A;  3TP8 A;  2L1B A;  2OT2 A;  4EGV A;  3SR1 A;  4KMU C;  1SBB B;  4DK1 A;  3H3V C;  1EOT A;  3T16 A;  4XYO A;  4G57 A;  3RZD B;  3URY A;  1WCM B;  3A8I E;  3C2P A;  3T53 B;  1JOO A;  5BN4 A;  2Z1C A;  4DNT B;  4OGQ C;  2O2L D;  2X69 A;  1CA5 A;  2O5I C;  4PMB A;  4IUU A;  4N9T A;  2J4X A;  1KNE A;  4ZYS A;  1I6H B;  4K2L A;  4I65 A;  3NUC A;  4CGY B;  4F87 A;  1TWH B;  1GHJ A;  3JAM E;  3QIA A;  2F0K A;  1VF5 C;  3ND8 A;  1DJR D;  1HCZ A;  1ENA A;  1WD0 A;  5CV6 A;  4I7Z C;  1AP0 A;  5M9O A;  4B08 A;  4XT1 B;  2L4N A;  4IUQ A;  2LY7 A;  1JQY D;  3P1H A;  1K8O A;  2CQA A;  3MA2 B;  5G3L F;  2OF1 A;  5EPK A;  1O78 A;  1QE6 A;  3K5O A;  5IOC A;  2B2W A;  5A2Q E;  1PLF A;  1H9R A;  5I9P A;  1S5D D;  4EVO A;  4RKB A;  4P2C B;  1HA6 A;  1JOK A;  5EGT A;  4KKU A;  4A3K B;  3OIP A;  5CYU A;  1YNN D;  1S5E D;  2NN6 H;  2D9U A;  4QB4 A;  3M85 A;  4HMJ A;  1TWF B;  1TWC B;  4ZKC B;  1OXT A;  1SYD A;  4F7X A;  1EL0 A;  1UEA B;  3PIO 3;  2XWJ B;  4HSV A;  2X6L A;  3DM1 A;  2A74 C;  2JP1 A;  3ERO A;  1B2T A;  1SSO A;  3M3Y B;  3KBX A;  1Y8O B;  2RDF A;  3GP7 A;  2D5D A;  3HEJ A;  5T1G A;  2CVR A;  2E2I B;  1S5B D;  1U4M A;  1FYC A;  1TT2 A;  2ZXO A;  2C5C A;  1A15 A;  1JWM D;  5M5W B;  1Q3L A;  1I4H A;  2IW3 A;  3U9O A;  4CJ1 B;  5JAV A;  1GUG A;  4DAV A;  2AQ2 B;  2KA7 A;  4KJN A;  5IT9 L;  2R7Z B;  1TWA B;  4BS9 A;  1VCI A;  1VMC A;  2JA8 B;  1H9S B;  2A6E C;  3VR3 A;  5C3W A;  4PMW A;  1CT1 D;  3E5S A;  1AZQ A;  1IKL A;  3D31 A;  4IFD H;  1WTR A;  1SND A;  1NSN S;  2X6G A;  4DF7 A;  3VR4 A;  3MXG A;  3TME A;  3GTG B;  1KAA A;  5JVG 3;  3AB9 A;  2F0E A;  1CA6 A;  1KDC A;  1E0B A;  4QUF A;  3J81 E;  4IFD J;  1V43 A;  2B2V C;  3R2T A;  5IIF A;  3Q0A A;  1Y69 U;  3S1M B;  3G6J B;  1JB3 A;  3MWY W;  4OL7 A;  2F0S A;  1VDZ A;  4EQN A;  4L6T B;  3LNN A;  1DXM A;  2E75 C;  4V19 0;  1F2M A;  2JA5 B;  3NP8 A;  3RUZ A;  1IYV A;  2LMC B;  1GUO A;  2NTT A;  2FMC A;  5IGB A;  2F0U A;  5T1I A;  1Z6H A;  4FXG C;  1SNP A;  1Y8P B;  5CV8 A;  4E6I A;  5M5X B;  1D1I A;  3FPU B;  3I91 A;  1STH A;  3TZU A;  3OOC A;  2PO4 A;  2JEA I;  3GTJ B;  1B1Z A;  5E3F A;  1HQM C;  2G9D A;  1PFM A;  3K57 A;  4FF3 A;  2NVQ B;  1ROD A;  1A2T A;  4C3J B;  1QJO A;  4FYD A;  1WTV A;  4H0L C;  3P7J A;  5JEA H;  3MHB A;  1I4G A;  1IHZ A;  2QDB A;  3V2T A;  1U4R A;  2JE6 I;  3DWQ A;  1BUV T;  1RD9 D;  4DGZ A;  1B53 A;  1IW7 D;  1WD1 A;  2ICE C;  2F0T A;  5IGE A;  4DA2 A;  1W6K A;  2DNE A;  2XRS D;  1TR5 A;  1YNJ C;  3PUZ A;  3DMU A;  5JEA J;  2YU9 B;  1F2Z A;  3I3C A;  2RDG A;  4ABN A;  4IQZ A;  5EPL A;  1LO5 D;  3S17 B;  3HS0 C;  1PDQ A;  1I4Q A;  4KK7 A;  5IGD A;  1D2B A;  1STG A;  3DXJ C;  5JVH 3;  1TVX A;  3PV0 A;  2FJ2 A;  2A69 D;  1J9O A;  4J8Q A;  4L8J A;  2TMP A;  3GTK B;  2NZ1 D;  3H09 A;  1WTO A;  2V4D A;  3KLS A;  2Z8L A;  4CJ2 C;  2AWN A;  1BXT A;  1SE3 A;  2N88 A;  4DXF A;  1D5M C;  3OMG A;  4IUN A;  1K8M A;  4QUC A;  1Q1E A;  1Y8N B;  3L7Z C;  1PRT B;  1SYF A;  2O4X A;  5E1F A;  3EVQ A;  3I4L A;  1SNC A;  1R4P B;  4BBR B;  4IZ8 A;  4QIW B;  5CR3 A;  3OSO A;  4O1N A;  5EBC A;  2F0O A;  1OXU A;  3MZ5 A;  3J7Y W;  3I72 A;  3JAM L;  1KAB A;  1V1P B;  4O42 A;  3A8K E;  4HN7 A;  3EFX D;  3VA5 A;  1LT4 D;  3PUV A;  1OXX K;  2EJG C;  1RF2 D;  1MI2 A;  3R93 A;  4G4K A;  4N9P A;  3OWE B;  5D3I B;  1O7Z A;  1TS4 A;  2F0W A;  2I46 A;  4BA1 I;  2RDH A;  1BCP B;  5A2Q L;  3EJI A;  1A3T A;  1HPC A;  2DN8 A;  2K5Q A;  3HP3 A;  4IUR A;  4B9W A;  5CBA E;  2B2U C;  4ID6 A;  1EEI D;  1Z7T A;  4ZK9 B;  3SK5 A;  1F77 A;  4RCN A;  4HAE A;  3OIQ A;  4R9W A;  2WKD A;  3SE0 A;  4IUV A;  1XYI A;  4DXG A;  1BNZ A;  3M4O B;  2PPB C;  3NK9 A;  1D6E C;  5COR A;  2JA6 B;  1RTO A;  1CFM A;  3S1R B;  2IX3 A;  2RKS A;  2OEO A;  1JCK B;  3LWE A;  1O7Y A;  1O80 A;  2HDL A;  3CU7 A;  3HRZ C;  2PYK A;  1B9N A;  4RAU C;  2PNR C;  4K14 A;  4U67 3;  1G29 1;  2NN6 G;  3H94 A;  2QF7 A;  5I6W A;  1I4X A;  4BY1 B;  3WOE A;  1S5C D;  1EEF D;  2L0C A;  1B3A A;  1T5X D;  1SEB D;  3QO2 A;  1E2Z A;  1L0X B;  1XXG A;  3QOJ A;  3OW7 A;  1FNW A;  2A5H A;  2KEE A;  4CKC A;  5ELF A;  5C0X H;  2XWB B;  1QCB D;  2XNA C;  3IFT A;  3J81 L;  3BYY B;  4HMI A;  1F9P A;  4KY5 A;  1Q1B A;  3K6O A;  2B2W C;  3O13 A;  3TSS A;  1ET6 A;  1MSG A;  5C0X J;  1ILQ A;  1Q8I A;  3EQL C;  1IL8 A;  3MAQ A;  1CI3 M;  3A7L A;  2SEB D;  1BDO A;  2G9H D;  2NVY B;  3HKZ B;  1CHP D;  1SMY C;  4IFD G;  3SK4 A;  2B8F A;  1TII D;  2F0Q A;  3T56 B;  3PO2 B;  5C4X B;  1S5F D;  1TS5 A;  3S1Q B;  3TP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...