4K8IA

Crystal structure of staphylococcal nuclease mutant i92v/v99l
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYVYADGKMLNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 36
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4k8iA00
4K5VA 1JOQA 2F0PA 5CV5A 5J39A 4K2LA 2F0MA 4QB4A 1NUCA 5JAVA 3ERQA 1SNMA 3P75A 4RKLA 4R8NA 3MZ5A 3T13A 1A3UA 2SNSA 4G57A 4I65A 1A2TA 4NKLA 1STNA 5JOBA 3TP8A 4E6IA 2F0VA 2F0NA 3E5SA 3VA5A 2RBMA 2EYLA 1STAA 1KDAA 3D4WA 1AEXA 3NK9A 5IODA 5EGTA 1KDCA 5C5LA 4KTAA 5J1ZA 5IGEA 1STHA 5CV7A 3RUZA 4QF4A 1U9RA 3SK4A 1A2UA 2F0JA 1EY5A 2EY2A 3MVVA 5NUCA 4MIUA 2OF1A 3SK6A 4KJOA 4ME5A 5C6AA 2F0DA 2F3VA 3NUCA 3OMCA 4RKBA 4ZUIA 5I6WA 1SYEA 1EY8A 2PYKA 2PZWA 3H6MA 2F0QA 5DEHA 1JOOA 1EY7A 2KQ3A 3EROA 4OL7A 3D4DA 5K5PA 1STGA 4WRDA 1TQOA 4K8JA 4QMGA 3BDLA 1SYCA 2SNMA 1KAAA 1EZ6A 5E1FA 4H7BA 5J22A 3EVQA 2EY5A 2EYHA 3C1FA 3D6CA 5C4HA 4WORA 1SNPA 4ODGA 3QB3A 2QDBA 4DGZA 1ENAA 3EJIA 3DHQA 2EY1A 2PQEA 2EYMA 3HEJA 4DU9A 1NSNS 2HQEA 4EQNA 4IZ8A 4ZUJA 2F3WA 4KD3A 4HTHA 3TP6A 4KV6A 1F2MA 2F0LA 4K5XA 3TMEA 2PZUA 4PNYA 4K8IA 5E3FA 3C1EA 4NDXA 1KABA 1SNQA 2M00A 1EY9A 5C4ZA 2NUCA 2F0WA 5I9PA 5IOCA 3T16A 1A3TA 1TR5A 3D8GA 1II3A 5HGTA 1JORA 4KY7A 3TP5A 2F0IA 3NP8A 4KHVA 4KD4A 5CGKA 5IGFA 5M9OA 2WACA 4NP5A 4TRDA 4N9TA 5DAUA 5HURA 2EXZA 1F2YA 1SNCA 4J1MA 1SNOA 4F8MA 3ITPA 2EYJA 5F2DA 2KHSA 2EYPA 3SHLA 1EY0A 4HMJA 2F0KA 2PW5A 1IHZA 3NHHA 3QOJA 2F0UA 5IGCA 2SOBA 5KYIA 4KJNA 4EQPA 1SYGA 2PZTA 5CV6A 2F0SA 1F2ZA 5KGUA 3OWFA 2RDFA 1JOKA 1EYCA 3U9OA 3OSOA 2O4XA 3HZXA 1SYBA 2F0OA 3OMGA 3S9WA 1KDBA 3SXHA 4HMIA 5CR3A 4B9XA 5C5MA 1EY4A 1EY6A 1ENCA 1SNDA 2F0GA 4IUNA 4YIJA 5EKKA 1EYDA 2F0TA 3V2TA 2OEOA 4S3SA 3SK5A 3SK8A 1EZ8A 2LKVA 5CV9A 5KRUA 2EYOA 2ENBA 2OXPA 2PW7A 4NMZA 4DF7A 1EYAA 1RKNA 3MEHA 5KEEA 3PMFA 1STBA 5EKLA 3QOLA 4F7XA 3MHBA 5IIFA 3P1HA 4IALA 4PMCA 4J6HA 3BDCA 4K14A 4ZQ3A 2F0EA 1SYFA 2EYFA 5C3WA 4LAAA 1TT2A 4EVOA 4DFAA 4KY5A 5ISRA 4ID6A 4N9PA 5CV8A 2F0HA 3SR1A 1EQVA 4PMBA 4K5WA 3LX0A 5IGDA 3NQTA 5IGGA 4K6DA 1SYDA 2F0FA 3TP7A 1A3VA 5C3XA 5KIXA 5KYLA 2EY6A 4KY6A 3R3OA 4B9WA 3MXPA 2RKSA 5I6YA 5CV4A 5CC4A 4EQOA 3DMUA 3NXWA 5I9OA 5IGBA 4K2KA 1STYA
chains in the Genus database with same CATH superfamily
4K2LA 2Z9HA 3GTPH 1O7IA 1A3UA 3J80E 1MJEA 3CW2C 5FO9B 1QB5D 3HKZE 5L37A 2D0PA 4BS9A 1VF7A 3HS0C 1Z6HA 4GNXA 2JA9A 3EFXD 3GTGH 2HUGA 2KBNA 2NWGA 1PTOC 3O13A 2K28A 3S1QH 1O78A 1EYGA 1EY8A 5K5PA 1EY7A 1O80A 3H91A 3PUXA 1W6KA 4HJ7A 2IL8A 4QIWE 2SNMA 1KAAA 2K5VA 3A0JA 2K4KA 1QNUA 2JQOA 4KMUC 4HCSA 3QB3A 2J0TD 4Q0FA 4CBVA 4FXGC 3RN2A 1EFWA 1KRTA 2QA4A 1BNZA 1R9TH 2EY1A 1S5ED 2HQEA 1OXTA 1TWGH 1K8OA 1M4VA 2CWAA 3I4NG 1IBMQ 1VQKA 1ZXTA 4UP8A 1UE6A 2V4DA 1A3TA 2G9DA 3D8GA 4PV1C 2XWBB 3U9SA 4B3SQ 1Q8IA 4G4KA 4A3MB 3K6OA 1K83H 4A3EH 3TREA 1B50A 3ERSX 1TXYA 2EYJA 1K0RA 3A74A 2UXCL 1Q8KA 2Z6KA 3ULJA 5KNCA 1EIYB 3I4MB 2Q2UA 3M9BA 3QIAA 4U673 4L5TA 3S16H 4CJ0B 2F0OA 3K57A 1Q3LA 4LFAL 1IKLA 4H44C 5D3DA 1A15A 3CCSA 1EY6A 4RGTA 5IYCH 1FL0A 3W3AA 3FKIB 2F0TA 2CQAA 1IBLQ 4M8AA 3KDFB 4NMZA 4BWGB 4CJ1B 3H3VH 4IPCA 5IWAL 1S5FD 3U4ZA 1IBML 4A3FG 2OTJA 1S5CD 3BZDB 3CCLA 4K6DA 2F0FA 1SROA 1U0LA 3S17B 1HA6A 2BH8A 1KNEA 1N34Q 4DXFA 4CKBA 1A63A 4DAYA 1LYLA 2HD3A 2F0MA 4KN7C 2VZAA 4DUZQ 1SNMA 4G57A 4I65A 4A76A 3PUVA 2IJ0A 5JEAJ 2A68C 2UXDL 2Z1CA 1HZ9A 3PIO3 5BR8L 3FVQA 3PSIA 2ALYB 2B2WC 1L0WA 4C3IB 4JI7L 4A3JG 3PUYA 4KJOA 2F3VA 5I9OA 3C2PA 3EROA 2A69D 3D4DA 5JJZA 2TSSA 4WRDA 5LMUL 3DM1A 1EZ6A 1NNXA 5EQ0A 1AZQA 1X6OA 4BA2I 2NVXB 2X69A 1XJVA 1RD9D 1HXYD 4K6LA 3CMEA 2H4OA 3K0XA 3MAQA 5I4DA 2WAQB 5KNBA 2KCNA 1V1QA 3K7AH 3ZYYX 5M3MB 2M00A 2E2HB 4JI3Q 3DUZA 4LF9L 3BVZA 2R6GA 1X32A 1B44D 4GKKQ 3HOWG 1VQFA 4X65L 5DAUA 3HOVG 5ELDA 1QVGA 5H1SE 1PVOA 5KYIA 4DV5L 1Z47A 1EYCA 2UUCQ 3HOVB 3PIOA 1MHWC 4BY7H 1OXUA 1XMOL 3T1HQ 4A3BH 2UUAQ 4IOAA 3HOYB 1TWCH 1QUQA 5DM63 4BY7B 1ZYRC 4JCVE 4L63B 3AMUA 5IYDG 4BY1H 5C3EB 5BN3A 1STBA 2NB0A 4U68A 3X3NA 1W2BA 2R3ZA 4PQXA 2K50A 3A56A 4UAIA 1IL8A 5CBEE 1LABA 3R8BA 5TSSA 5C4JB 1PH9A 2KCMA 1K8MA 1HHVA 4LWCA 1XNQQ 1PFNA 1SLJA 5IP9H 1TS4A 3K5OA 5E4XA 2IW3A 4B9WA 5JVH3 2B2YC 3FP9A 3ND8A 5FLXE 1STYA 1T5XD 3FHWA 3OW2A 5J39A 2B8FA 1E2VA 4B3ML 4DR5L 1B9NA 1A2TA 4R4IA 4ZLTF 1VQOA 2UUBL 2EYLA 3K81C 4BBRG 4IJLA 3L3OC 1FNWA 1I94L 4Z9CB 4CKEA 3I73A 1A2UA 3MVVA 4N8FA 2EDGA 3I4NH 1KAWA 3H6MA 3MFYA 4C3HH 1S5DD 3P20A 2ZM6Q 3R93A 1V9PA 1YZ6A 4J15A 3SE0A 4BA1I 1XTCD 4PG3A 3KLSX 3EA6A 3KLSA 4A3JH 2HDLA 1L2FA 3C3LA 3MXNB 1NSNS 3I2ZA 1DYQA 3BS1A 3Q23A 3H3VC 4JC0A 1YJWA 1F77A 4GKJQ 3M7GA 1HR0L 3C1EA 3CRKC 5CYUA 4KHPQ 2VNUD 4DV6Q 3HOZB 2ID0A 1XPRA 4B3SL 4DR7Q 4IUTA 2XGTA 4KLKA 2QCPX 4GS3A 2EXZA 1IBKQ 1ZKOA 1WD1A 3SHLA 3NTHA 1IHZA 2K75A 5ELOA 1QE6A 4A3GB 4A3JB 3A55A 4DNTB 2A8VA 3PQIA 1DOKA 2IPKD 4UP9A 2RQXA 5CR3A 5FKAC 4HJAA 1AP0A 2K6AA 3SK5A 5JJKA 3DEOA 1CSPA 3A7LA 3BJUA 4JI1Q 4DF7A 1Y1WH 1Y69U 1YEZA 4UPAA 3WOFA 4CJ2C 1HR0W 2R93B 1SMYC 2R93G 1PRTF 3I8ZA 1EIGA 2E2IB 4DAVA 4OIJA 1TU2B 4LAAA 1WOCA 2ZXPA 4A3EB 1X3PA 4DR4L 3E6ZX 4QUFA 4K5WA 3LX0A 3RD4A 3MEFA 3R3OA 2GA4B 1LTRD 2QDLA 1NJIC 4OWTB 2K7VA 4CHTB 1JB3A 1Z7TA 1PH7A 4A4IA 3T13A 4R8NA 4JYAL 5K36G 4HR7B 4E6IA 1FNUA 4AYBB 2KEEA 2F0NA 2BH2A 3GV3A 3NTIA 1STAA 5DNFA 5T1GA 4OIKA 1AEXA 1KNAA 4V0BA 2NVXH 2YYZA 2XNAC 1JICA 4GNXB 2WB1G 4QF4A 1TS3A 4JI8Q 2EZVA 2F0DA 4ZUIA 4X66Q 5EPLA 2VW9A 2B2TC 2KQ3A 1HNZL 3IFTA 1STGA 2CFMA 4QMGA 5A2QL 2KECA 1WTWA 1Q81C 4DV6L 2WINB 2L15A 3NEMA 4IN3A 4YWLA 4TQUS 4FXDA 2QDBA 3W1GA 3EJIA 3WWVA 1JJCB 4YWKA 4EGVA 4X6AH 1XTDA 2KHIA 1X3FA 2PMZB 2JYOA 1Q86C 4JI2L 1NCVA 2JK8A 1CKOA 1D8LA 4IFDH 1F9QA 2EJFC 4JYAQ 4IQZA 4KD4A 4JI7Q 5M9OA 4OX9L 1Q1BA 4YY3L 1LO5D 1UUPA 3HG9A 2JEAI 4J8QA 5LMNQ 1ENFA 3CPWA 5IYDH 5BN5A 2B29A 2B3GA 2PW5A 2E76C 3VR2A 2F0UA 3DWQA 1BCPB 3PUZA 3OWFA 3D31A 3VYSA 3MC0B 1R9TB 2FHTA 3KF8B 3UI2A 1I3QH 2BCOA 3EIVA 3NBIA 4KK7A 4RG1A 2YTYA 1EYDA 4BBRB 1CFMA 1CKMA 3OYYA 1EYAA 3D0FA 1PLFA 4DV0L 3QOLA 5M5WB 2E2IH 4JI5Q 4ZQ3A 3MTSA 4OHJA 3K0YA 1RF2D 4HAEA 4XT1B 3N6RA 3PGZA 4DA2A 5IGGA 1VQ4A 4RGOS 5A35A 2GVBA 4HIOA 1ET6A 3QJYA 1HA5A 3HOZG 1PZKD 1XMQQ 2JA7H 2OWOA 1RDPD 5LL6X 1JJ2A 2VUMB 4OEMB 4O2DA 1TWGB 1B3QA 4LK1C 1BUVT 4BBSH 3I7FA 4NXNL 2PPBC 1KDCA 2BA0A 2HHHQ 3CKIB 2JJQA 4WJ3M 1PZID 1EY5A 4MIUA 1H9KA 5IY0A 1H9RA 1SMYD 1E2ZA 2A6HD 3BZKA 4JI0L 4JI4L 1BBWA 4C3JH 3TSSA 4R4CA 4C1NK 4A3LG 2JEBI 4JW0A 1SN8A 3NTKA 4XYQA 1I50B 1PFSA 4DK3C 1VQBA 1YVCA 2EYMA 2HQLA 2LSSA 3STBD 4DPGA 5EBDA 4EQNA 2R92H 3KDFA 4XQNA 3GTKB 1CHQD 3S14B 2GN5A 1G291 2R7ZH 3A5ZB 1O7ZA 1TS5A 1YJ9A 3TZDA 2AUJD 3SDZA 5EPJA 2NZOA 3ND9A 3TRZA 2EVBA 2HT1A 4L8JA 4MTKA 1SE4A 2E2JH 4B3RQ 4LFCL 4X62L 1CA6A 4LF4Q 2F0KA 3FEWX 3NHHA 2D0OA 2Z6KC 3UDGA 1MJCA 2F0SA 2R93H 3NENA 2B63G 4BXXH 5CBAE 3U9OA 4LF9Q 4L5QA 2WB1E 2UXDQ 1F9SA 3QG1A 1HJPA 1KDBA 3SXHA 2I5HA 4P71A 2BE5D 2ZJPA 3V2TA 1K0SA 4CKCA 2MPMA 3SK8A 1N32L 1C48A 5CV9A 2JA6G 2G9HD 1N9WA 2RDGA 4A3GG 4C3JG 2ZJQA 1X3EA 4A75A 4K14A 1BDOA 5C3WA 2PNRC 1HNXL 2KEDA 2WAQG 1NY4A 4KY5A 1PH1A 3GTOH 2F0HA 3SR1A 1TWCB 2PO4A 2B39A 3TDQA 2A19A 4QJFA 4OELB 5I2YA 2EY6A 1U5KA 2KCCA 3KBGA 2K03A 3LGJA 3Q0AA 1Y1VH 5EKIA 4IOCA 1ESRA 1V1PB 4LJZC 4XT3B 3J7AV 1JOQA 1F9RA 2K32A 1VQ6A 1BQQT 4QIWB 2J7ZA 1CSQA 2FINB 5JOBA 2V1CC 1U4RA 2AQ2B 5IODA 2MGSA 2C5CA 4XQJA 1SRUA 4A3KH 2PQAA 2I0QA 2H1EA 1GUWA 3HKZB 3NUCA 1VQHA 2BDNA 2NN6H 1CA5A 2CVRA 3W2DA 5IYCG 2DY7A 1C4QA 1I5FA 1PYSB 1QVFA 1ZYRD 3E0EA 4B3TL 2NVTB 4HSPA 3WOEA 1ILQA 2JA5G 1SE3A 3OTOL 3BYYB 4DR3Q 2AWOA 4RCOA 1YNJC 4IZ8A 1N8RC 4DV4Q 3TP6A 1EEID 4DAPA 4DV1Q 3K80C 5D14A 4DV7L 2ZM6L 1NBWA 2VL6A 4QCLA 3MWYW 1E2WA 4X3KA 3A8IE 1X65A 4HJ5A 4QUCA 1XNQL 3NP8A 2N3SA 5IGFA 3FKIG 3KJOA 3AYHB 4DV2Q 3S2DB 2R92G 2CKZB 4ZRZA 2KHSA 1RIPA 2LMCB 1ONLA 3D3RA 2KUMA 3F2UA 3KK7A 3ZJYC 3KLWA 4CGYB 3OSOA 4X3SA 3OIPA 3M85A 1E3PA 4RCNA 1I4GA 5LMUQ 1N33Q 4X64Q 4L5SA 2N78A 1EQRA 5JVG3 3NELA 4LUVA 5KRUA 1YHAA 3URYA 1K3BC 2IX1A 3K5LA 2K5WA 1SR3A 3H0GH 1SFOB 3KFUA 1DZ1A 3IAYA 4J6HA 3BDCA 1XNRQ 1LTID 1TY0A 4YCUA 3PO3B 2LXJA 5ISRA 4ID6A 4OO1H 1B2TA 3HGBA 2FFKB 3MXUA 4OO1I 5C4XG 4GKKL 4FF3A 1EEFD 1GUGA 4IJHA 4JI1L 1FYCA 2EOTA 1QILA 3P7JA 4IPHA 4A3DB 3CMAA 2ES2A 4A3EG 3K7AB 4K5VA 5I2XA 5JPNC 2C9OA 2ZXOA 1E1OA 1MD2D 1C0AA 4UY8C 2D62A 1PTOH 4A3KB 4NXNQ 4GLVB 3OTOQ 1YJNA 3I72A 5CV7A 5KYLA 4A3DG 4UDUC 1H9SA 5GAGC 4JI0Q 4JI4Q 4B3RL 2PYKA 1TY2A 1VQ9A 2IHEA 2UXCQ 3M4PA 1SMXA 1UNSA 1K8GA 3BDLA 2PQAB 4QY7A 4R8IA 3TZUA 2EY5A 4TVAB 3VA7A 3IL8A 3K5MA 4HIKA 1WTVA 4NXMQ 1GKHA 4P2CB 3DHQA 1I50H 4PZ6A 2WAQE 2XVSA 2HIXA 1H95A 1P16A 2AMCB 4X66L 2QF7A 1HFGA 1DCZA 4NW2A 2QGQA 3FDTA 3KF6B 1GUNA 2UUCL 1CK1A 1VQMA 1D2BA 1QCBD 1YI2A 4ALPA 2JP1A 2K5NA 5CGKA 4DAMA 4NP5A 1Y1WG 4F8MA 3HOVH 1VQIA 3Q6SA 4A3IB 1Q12A 2IY5B 4FYDA 1F9PA 2Z8LA 3T56B 3VR5A 1AN8A 4A3IH 1SYBA 1M1KC 5JEAH 1PV4A 2F0GA 5AFWA 2XRQD 4YY3Q 5M5YH 4C2MH 2E8GA 2OEOA 1BKBA 5DLQE 4GN3B 1D1KA 4OWXB 1S5BD 4AH6A 5FLMH 4I7ZC 4TSSA 3M4OH 2EYFA 4EVOA 1B8AA 2B63H 1HNXQ 3H09A 3OIQA 4A3MG 3J81j 2NTSA 4RFBA 3S1NH 1LTAD 3VDYA 4B3TQ 2B8GA 2L0CA 2E5LQ 1IKMA 3M4QA 2YV5A 4BY1B 1U4PA 2K5DA 3E3XA 5CV5A 2B2VC 4AQYQ 3VR4A 2GVAA 4QGUA 2G5DA 3EQLC 3CCVA 2O5JC 5C5LA 1C9OA 1BF4A 4O0AA 2ZXRA 1U9RA 3SK6A 2OF1A 1ET9A 3NSWA 4DK6C 1HTPA 1J5EQ 4OL7A 1LT6D 3S1NB 2RSOA 1EUJA 4GZYC 3F8TA 2I46A 3JAMi 2MHVA 1SBBB 4DGZA 5CORA 1HRJA 2PQEA 1DOMA 4ZUJA 2F3WA 3GTPB 1EU3A 4DUZL 1I4QA 3GTMB 1PRTC 1G6PA 4K8IA 4NDXA 1SNQA 4K2KA 4DR2Q 2EQSA 4WFN3 3TP5A 1B9MA 1LTLA 2Y0SB 5CMDA 4HIDA 3GTLH 2WIIB 1FGBD 3I4MH 2EYPA 1EY0A 3QOJA 1EWCA 3FMCA 3U58A 2AWNA 2PZTA 5AJ3L 3CAMA 1E1TA 1JOKA 1T5EA 2RDFA 1AW7A 2B2UC 1ESFA 4A3MH 1EY4A 1CUKA 4YIJA 1VF5C 2MO1A 2YTXA 4K0KL 4A93B 3KUPA 1WCMH 1U4LA 3NWSA 4A93G 4HJ9A 2XWJB 1I94Q 1PYBA 3QWNA 1DM0B 4AIMA 3ICEA 3HKSA 4P74A 1WVLA 2CW0C 3PUWA 4DR2L 4DV2L 1LT5D 3GV6A 2IX3A 5C0XI 2TMPA 2B63B 5C3XA 2R7DA 3KF6A 1PH5A 2MFIA 5KNDA 2K1BA 2RCFA 3U50C 4IFDG 3HOUB 1UWVA 5IWAQ 2YTVA 1X54A 5JAVA 3K8AA 5M3FB 1STNA 1GO3E 3TP8A 3C46A 3KYHC 1C8CA 3VA5A 1R4PB 4HJ8A 3NK9A 2F03A 2UUBQ 3HOXB 1VQDA 5NUCA 1M8AA 1N34L 1S4ZA 4RKBA 3TS2A 5I6WA 2N55A 1PDQA 1ZEQX 1B3AA 3RLNA 1JOOA 1IBKL 4RWSC 2M2LA 4JV5L 5M5XH 4LFAQ 1U4MA 1CT1D 1KD1C 1EFID 4JBJA 1BO0A 3EVQA 4LW1A 2VXWA 1SNPA 2F52A 3D4RA 3B6YA 1PYWD 3OWEB 1L1OC 4RMFA 5IT9E 3HOWB 3J7A5 4JVZA 2AHOB 5D65A 3R2TA 4BXXG 1PRTB 1PH3A 1UEBA 5C4ZA 3F1ZA 4WJ4A 1JWMD 1LUZA 1Y1WB 2MQHA 1II3A 2IX0A 3G48A 5C0XG 1QVCA 3JAML 4Y7NB 1G2TA 1VDZA 1B7YB 4POFA 3S24A 3CP0A 2OTLA 4KJNA 1BCPC 3CCEA 2K14A 1PHJA 2A6EC 4ULLA 2K04A 1V8QA 1CHPD 1SJHD 5JJLA 1OTCA 5EKKA 3GTQH 4S3SA 1K8AC 1O7LA 3KLRA 2Z4HA 2EYOA 2SDFA 5J3BA 2E2HH 1SEBD 1SSOA 4G7HC 1XX8A 5EAYA 4JPBW 2EJMA 3HOXH 2JE6I 3MXNA 2F0EA 4XTCS 1L1OA 1J9OA 1TT2A 1GHJA 4Y7NH 3J7ZC 3GD7A 4MZ9A 1EQVA 2B2WA 3WDNA 2M9VA 1WTRA 2X6GA 3S1MH 3L0OA 3J80c 5E4WC 4ZAIA 1JMCA 4DXGA 2D9UA 5CC4A 4DR6Q 4DK1A 3NXWA 3NE5B 2MP1A 4V190 4DR1L 1GM5A 3UE1A 1IYVA 2O2LD 4AQYL 1WFQA 3HOWH 4RKLA 1GXDC 3HOYH 2B2YA 3PCOB 4EQ5A 5C4JH 1EU4A 3CCQA 5IYBH 2KHJA 1NTGA 1DXMA 1HCZA 1NR4A 1NAPA 3ULPA 1CQFA 1YBYA 1J5EL 2NVQB 1VCIA 1SE8A 1LACA 2A5HA 2JA8B 1DGSA 2OT2A 3PO2H 4K8JA 4ZCKA 3Q24A 2UUAL 1XXGA 5IE8A 4ODGA 4ABNA 2KA7A 1PH8A 3AQQA 1JT8A 4O42A 1VQPA 2H5XA 1MSHA 5C0XJ 2XTIA 2A73B 3K5NA 2KJXA 4KV6A 1F2MA 1NR2A 1XNRL 2FMCA 2LY7A 1HH2P 3BVMA 2Q8TA 5IOCA 3A7AB 1RTOA 1I6HH 2Q2HA 2OQ0A 4AYBG 1K73C 2F0IA 4KHVA 2WACA 2JA5H 1NMGA 5ELEA 2EJGC 1F2YA 1SNCA 2F4VL 3CQZB 3AU7A 1DONA 2LFNA 4GN4B 5IT9L 2XIWA 3DM3A 1Q1EA 2SOBA 3HRZC 4GOPA 1HR0Q 3UDXA 2I5MX 2O4XA 3PIP3 4GNXC 4DUYL 1ENCA 2I07B 1HNWL 1LT4D 4K0KQ 2RDHA 2K52A 2PW7A 5C3EG 2A1AA 3MEHA 3AB9A 2N49A 1Y1VB 4F7XA 4ZKBB 3HOYG 3G4SA 3MA2B 4C3IG 4KN4C 4IUPA 3I90A 2F4IA 1PH4A 3CQZH 2R61A 4NXML 1LTTD 4N9PA 3J80L 3S1RB 1UE1A 3CXCA 1NMFA 1AE3A 3FKIH 1IW7C 1TWAH 1UE7A 3DLLA 5E7NA 5EBCA 5EJWA 3DWAA 2DNEA 4M1UB 4APVA 4CDFC 4LFBL 5IP7H 1CM9A 1BXTA 3P75A 1D5MC 3BZCA 4PZ8A 1JJGA 2ZTDA 5G3LD 2BDOA 2RBMA 2EPBA 3RZOH 1K83B 1KDAA 3TBIB 5FO8B 5EGTA 4NB3A 3T1HL 3M4OB 4LF6Q 3RUZA 3IRBA 1C7YA 2EY2A 2F0JA 1BBUA 3OMCA 3DXJC 2QW7A 1KQSA 5M5WH 3JC66 1B70B 1AH9A 1CKNA 2NVQH 2C35B 1SYCA 2DJGC 4A3CG 1BOSA 3DEPA 3I91A 3L9AX 4QL5A 2DUDA 4ME3A 4UP7A 1PXUA 4P72A 2L1BA 5GROA 3HEJA 4H13C 4DAYB 3IKJA 4GOPC 2D5DA 4POGA 1N32Q 3L7ZC 2CQOA 1HNZQ 1RL2A 4C3HB 4HCEA 2NUCA 2ZTCA 3SGIA 2MUYA 4XXEA 2IHFA 4DR4Q 1JORA 3F2CA 4KY7A 1LTSD 2Q2TA 1I3QB 1WTPA 1LM0A 3H94A 4OONA 4DNRB 4P73A 4J1MA 1PTOB 5FLMG 3S1RH 1RODA 2A68D 3S14H 4KKTA 5FJ8G 4X62Q 4LFCQ 3GTKH 5JJIA 1ILPA 4O1NA 4H02A 4XDXA 1WTXA 1E24A 1W3SA 1KLGD 2WP8J 3CU7A 3QR8A 5ELCA 5C5MA 3KF8A 4R4OA 3RZDB 5FOBB 5JPMC 2A69C 1JQYD 1KHIA 1V1PA 3GDEA 3H15A 3NBHA 1XWEA 2VB2X 1VQ5A 2B2UA 2BE5C 4RGMA 4IALA 4C3HG 3I3CA 2NZ1D 2L12A 1S40A 1EOVA 2Q2IA 3OPOA 1KIXA 1SJED 2ICEC 1EIHA 3TN2A 4DFAA 3OW7A 4PMBA 3VR3A 4KKSA 1SYDA 4ZYSA 3JAME 1A3VA 1KLUD 2QEXA 4KY6A 4C56C 4DR6L 3LWUA 2RF4A 4AYBE 1CZWA 4QQBX 1HUNA 3DMUA 3PF4A 5IGBA 1YNXA 1PTOF 1V43A 2EIFA 3V05A 4DV4L 1VS0A 1LV9A 4OX9Q 3FRPB 1IBLL 4ZK9B 1J6QA 4I7AA 3S2DH 1PMRA 1X3QA 2LXKA 1RHPA 2CH4W 4TKOB 4X65Q 1JE5A 2B2TA 5C6AA 1Y8NB 1TKWB 1TWHH 1EQTA 4LF5Q 2KOLA 5DEHA 5M3MH 3H0GG 4MHEA 4A3FH 3X3MA 3HOXG 3CC2A 3STBC 1AE2A 3S2HH 2VB3X 2AKWB 4OXPA 1PFMA 5J22A 3C1FA 5C4HA 5ELNA 4WORA 5A2QE 3CHBD 1ASZA 3NWTA 3TS0A 4KI0A 3I4LA 3F2DA 5FJ8H 5M3FG 4DU9A 5GAEC 4LF8Q 2B2VA 3J81L 2K5HA 5ELBA 2F0LA 4IPDA 1J8IA 2PZUA 4PNYA 2WKCA 3I56A 1QZGA 4L5RC 5K36H 2A74C 4C3IH 4YHHL 1TIID 2Q8RE 3GTJH 2F4VQ 4B08A 1TWFB 3HOZH 4F88A 2RHSB 2JA8H 3RR5A 4A3GH 4HMJA 3GTOB 2CCZA 1I4HA 1PTOD 4G7ZC 1FGUA 1H9JA 1VQLA 1H9MA 1SAPA 4DUYQ 3HZXA 4L6TB 1XMOQ 4A3CH 4RA8A 3OMGA 2FJ2A 4B3MQ 1S3OA 4FF4A 1VQGA 3E9HA 4DV3L 3GTJB 4N8X1 3SVMA 2L55A 3SEBA 4LUOA 1I4PA 4LF4L 2SEBD 3G6JB 2AQ3B 2CHBD 5DM73 1HZBA 1LLRD 2VQEQ 2I5LX 2ICIA 4EX5A 1JR0D 1T9HA 4PZ7A 2HCCA 4YWMA 2F3IA 1RJTA 2BOSA 1MIUA 1P8LA 2UXBL 2OQKA 4A3KG 3NQTA 4JK1C 2QILA 3I4MG 5M5XB 3AFQA 2RKSA 2VY3A 1VQAA 2UU9Q 2A6HC 1XPOA 4RGNA 4QB4A 3UDIA 3ERQA 3CC4A 3GTQB 4MTNA 1CZGA 2R92B 2RSNA 3D4WA 5M3FH 1I6VC 5J1ZA 4HEDA 4LF7Q 1D5XC 1B1ZA 4DN4M 4JI6L 2Z0SA 3HOUH 2Z6BA 1DJRD 1GUSA 1Q90A 1QWYA 3T53B 1O7YA 5C3EH 1EQQA 4IFDI 1LTGD 1WCMB 1QOHA 3CRLC 1D6EC 4H7BA 4YHHQ 2EYHA 1YNND 1WCMG 1X56A 1ENAA 2EE1A 1DD2A 2K01A 2VQFQ 3I70A 3CCMA 5LHY1 3FPPA 1WJJA 3PO3G 3E9IA 1MGSA 3T1YQ 2JA7G 5T1IA 2JA7B 3T16A 3S1QB 2MO0A 2NYZD 3M3YH 4UHVA 1IYUA 4RAUC 2QEJC 4R1JA 4N9TA 1FD7D 1XPUA 3RZOB 5F2DA 1E22A 1KC8C 1JWUD 4LF7L 3PV0A 5IGCA 2K05A 4DV0Q 1TS2A 2VUMH 2ZTEA 2Y0SE 1HZAA 2LS01 5ELFA 2WV6D 1SYGA 3R2IA 5CV6A 3UE0A 1V1OA 1VQCA 3J7AF 1A6XA 1TVXA 3CD6A 2WB1B 1EIFA 2ZT9C 5BR8Q 5C4XH 4C2MB 1XYIA 4BBRH 3ONAB 1TWAB 3Q8DA 3TEHB 1EZ8A 1GD7A 2CH4A 2LKVA 3GP7A 2OXPA 2JSOA 2RVLA 4FO2A 3PMFA 2VQFL 1WI5A 4BY1G 1STEA 4DR7L 1HQMC 1SYFA 4YCVA 5FLXL 3GTMH 2AQ1B 1AFPA 1HUMA 1A62A 2BA1A 2FMMA 2RA4A 1K28A 5IYBG 4BY7G 5CV8A 1QZHA 1QNKA 2R7ZG 3RNUA 1YNJD 2RHQB 2YU9H 2JA5B 3J81c 3G6EA 5IP9G 3UDFA 1BR9A 4JI6Q 2R7ZB 1MKHA 1TWHB 1Y1VG 1FNVA 2KVMA 1BCPF 3S17H 1HQRD 4IFDJ 3MZ5A 3I55A 3S15B 2RCNA 1MBYA 3DWPA 4HIMA 3AFPA 2PMZE 2CWPA 3T51B 5D3IB 3J81i 3J80i 1OO9B 5IGEA 1VMPA 1STHA 1R4QB 2AUKA 3G71A 1D7QA 1LT3D 2X6LA 3KOJA 4FP5D 4A3BG 2Q8IB 1I6HB 4GN5A 4C3JB 1KL9A 1WYDA 5LMNL 5M3MG 4FXKC 4JI8L 1WD0A 4A93H 4LFBQ 4LNQA 1GOZA 1EWHA 1HTLD 4A3BB 3U4VA 2NZHA 5AJ3Q 1Z9FA 3AEVA 1VQEA 1X9NA 1Q7YC 1BBXC 4OGQC 1SXTA 4LUZA 4R4TA 1KXLA 2HIVA 2XRSD 3NPPA 2N88A 1HFNA 1WTQA 4P75A 5FO7B 3NBHB 3S15H 4K5XA 3EN2A 4X3TA 3PO2B 1EY9A 4X3UA 2F0WA 1YIJA 3RZDH 1GHKA 1DOLA 3G7LA 5C4XB 4IUQA 5IT9c 3BG3A 2K33A 3W5OA 1SNOA 3PO3H 1JWSD 1FVIA 3ER0A 1IL2A 3PO2G 1K3RA 3J7YW 1SFOH 4R9WA 1SE2A 1BCPD 1F2ZA 4DR5Q 3BU2A 3HP3A 4KHPL 3GO5A 1NE3A 3M3YB 3LNNA 4IO9A 1N36L 3KBXA 1B4OA 4LF8L 2PNHA 3KJPA 3S1MB 1EL0A 1PFBA 1A0IA 2VS1A 1OXXK 2KCTA 4JI2Q 3GQBA 2ATWA 3MHBA 3BYTB 4YCWA 1FR3A 4RHRA 4PMCA 3GTGB 5HY6A 1ML0D 4IURA 3A54A 4XIGS 4FF2A 2L4NA 3CCJA 1AZPA 4CDDC 4FF1A 5COYA 3RN5A 1VQNA 4IUUA 1YNNC 1IZ6A 5KIXA 2Z4IA 2CW0D 2VUMG 3MXPA 4GKJL 1I4XA 1YHBA 2WKDA 3T4AC 4MNOA 2JN4A 4Y52H 1XMQL 4IPGA 5M5YB 2SNSA 1MSGA 1CI3M 2F0VA 3E5SA 4IUVA 4GLXA 2Y0SG 3RLOA 2HHHL 3OHXC 5G3LF 1N36Q 4KTAA 4HSVA 3A8JE 1E0BA 2VQEL 1G2SA 2E74C 2NVYB 4ME5A 1PH2A 2K5QA 4A3DH 2PZWA 1G51A 2F0QA 1D5ZC 3VYTA 4OWWB 5C44H 1TQOA 3TQYA 4G7OC 1UEAB 1UAPA 4C1NI 1FJGQ 1PA6A 3I4OA 2DGYA 2JXMB 2R7FA 1PZJD 1JB7A 2DN8A 2UU9L 3L2PA 4KD3A 1Y8OB 4HTHA 3EBEA 2MNAA 1VQ8A 5FK9C 3HOUG 4JBKA 3K59A 2N8NA 1ICWA 1B53A 1HPCA 1JC7A 4PMWA 1GUTA 3VR6A 1TR5A 1F2LA 1QUQB 3BVGA 1JE4A 4X64L 2PCFB 3A8KE 1UE5A 2J4XA 2L5TA 1LTBD 1G91A 3ITPA 3HFZB 3J81E 4JV5Q 3HKZG 3LWEA 5KGUA 4DNIA 3CF5A 4A3LH 2WFWA 3H0GB 4KHZA 4JOIA 4DR1Q 2JA6B 3S9WA 2XSCA 3RLFA 5GAHC 4A3IG 3E0JA 1SNDA 1G8ZD 4RHSA 4ZKCB 1FJGL 2QKIC 4XQQA 1X3GA 2HCIA 1MI2A 1L0YB 2ENBA 1VQ7A 4HN7A 3I4NB 1RKNA 5KEEA 2DNCA 3CC7A 2HDMA 3K58A 1G6ZA 5C44G 1L0XB 3P1HA 5IIFA 3IFDA 1SDFA 1GJXA 3ULLA 5LMNW 2DJFC 2E2JB 2NVTH 3PF5A 1S72A 1KTKA 3CCUA 3TP7A 4MN3A 1IW7D 1W6JA 1H9SB 1Y14B 4A3FB 5I6YA 3CPFA 4LMQD 5CV4A 2PI2A 2E2DC 4EQOA 4CDEC 5IP7G 1CTMA 2F0PA 3BDOA 1NUCA 4F87A 4DV7Q 1IXRA 4NKLA 4JBMA 5GQOA 2OCEA 2UXBQ 3N52A 4OO1G 1KRSA 4FNFA 5EPKA 4JOIC 3MXGA 1EOTA 4R4QA 3SK4A 5C44B 1ICFB 1SYEA 4XYOA 4NPSA 2FXQA 1OXSC 2KENA 2NN6I 3M7NA 1CKNB 1IYJB 3K7UC 2NVYH 2ASBA 1TWFH 1I4RA 2XN9C 4KKUA 1Q82C 5LL6S 5E1FA 2P5ZX 3CCRA 5JEAG 3F2BA 2EXDA 1VQJA 4RH6A 3D6CA 4DV3Q 3PIPA 4ILWA 1RTNA 4DK0A 4BBSB 2L11A 2JA8G 4BBSG 1ASYA 2JA6H 1L1OB 4DR3L 5BN4A 4GLAC 3S2HB 4H0LC 1N33L 4JI5L 4WJWA 4DV1L 1YHQA 1X55A 4JG2A 1HNWQ 3TMEA 1JCKB 2PI2E 2E5LL 4FVMA 5E3FA 1YITA 2O5IC 1KABA 1QG7A 3Q22A 1GUOA 3VYUA 5I9PA 2NTTA 3FPUB 2DY8A 5HGTA 4Q5VA 3M4YA 3JAMc 1WTOA 4DKAC 2F1MA 2ZJRA 1Y8PB 4TRDA 5HURA 1WTHA 3H3VI 1E7ZA 2L9HA 3W1BA 2A6ED 4JBWA 4DV5Q 2E75C 5GADC 1BVSA 1K9MC 1PRTD 1D1IA 4EQPA 3A5UA 3T1YL 3V96A 1PH6A 1HZCA 3QO2A 4HMIA 4B9XA 4IUNA 2NBFA 1VMCA 2IWHA 2YU9B 2IT1A 1QJOA 4JI3L 3OOCA 5EKLA 4LF6L 1CQVA 1Q46A 2NN6G 3VYRA 1OXVA 1GVPA 4GOPB 4CDCC 3NQIA 3GTLB 1M90C 5C0XH 2MJ8A 5IGDA 5FLXc 3RMHA 1EWIA 2D2CC 5HGQA 3D6WA 3S16B 3MFGA 1A8VA 4LF5L 4FDBA 1RCVD
chains in the Genus database with same CATH topology
4K2LA 1A3UA 3J80E 5FO9B 1QB5D 4BS9A 1VF7A 3HS0C 1Z6HA 3EFXD 2HUGA 2NWGA 3O13A 1PTOC 2K28A 1O78A 1EY8A 5K5PA 1EY7A 1O80A 3H91A 3PUXA 1W6KA 2IL8A 2SNMA 1KAAA 1QNUA 4HCSA 4KMUC 4CBVA 3QB3A 2J0TD 4Q0FA 4FXGC 1BNZA 2EY1A 1S5ED 2HQEA 1OXTA 1K8OA 1M4VA 1ZXTA 2V4DA 1A3TA 2G9DA 3D8GA 4PV1C 2XWBB 3U9SA 1Q8IA 4G4KA 4A3MB 3K6OA 1B50A 2EYJA 5KNCA 3I4MB 3QIAA 4U673 4CJ0B 2F0OA 3K57A 1Q3LA 1IKLA 4H44C 5D3DA 1A15A 1EY6A 4RGTA 3W3AA 3FKIB 2F0TA 2CQAA 4M8AA 4NMZA 4BWGB 4CJ1B 1S5FD 1S5CD 3BZDB 4K6DA 2F0FA 3S17B 1HA6A 1KNEA 4DXFA 4CKBA 4DAYA 2F0MA 4KN7C 1SNMA 4G57A 4I65A 3PUVA 2IJ0A 5JEAJ 2A68C 2Z1CA 3PIO3 3FVQA 2B2WC 4C3IB 3PUYA 4KJOA 2F3VA 5I9OA 3C2PA 3EROA 2A69D 3D4DA 5JJZA 2TSSA 4WRDA 3DM1A 1EZ6A 5EQ0A 1AZQA 4BA2I 2NVXB 2X69A 1RD9D 1HXYD 4K6LA 2H4OA 3MAQA 5I4DA 2WAQB 5KNBA 2KCNA 3ZYYX 5M3MB 2M00A 2E2HB 3DUZA 3BVZA 2R6GA 1X32A 1B44D 5DAUA 5ELDA 5KYIA 1Z47A 1EYCA 3HOVB 1OXUA 3HOYB 5DM63 4BY7B 1ZYRC 4L63B 3AMUA 5C3EB 5BN3A 1STBA 2NB0A 4U68A 3X3NA 2R3ZA 4PQXA 3A56A 4UAIA 1IL8A 5CBEE 1LABA 3R8BA 5TSSA 5C4JB 1K8MA 1HHVA 1PFNA 1TS4A 3K5OA 5E4XA 2IW3A 4B9WA 5JVH3 2B2YC 3ND8A 5FLXE 1T5XD 1STYA 5J39A 2B8FA 1E2VA 1B9NA 1A2TA 4ZLTF 2EYLA 3L3OC 1FNWA 4Z9CB 4CKEA 3I73A 1A2UA 3MVVA 2EDGA 3H6MA 3MFYA 1S5DD 3P20A 3R93A 3SE0A 4BA1I 1XTCD 3KLSX 3EA6A 3KLSA 2HDLA 3C3LA 1NSNS 1DYQA 3BS1A 3Q23A 3H3VC 1F77A 3M7GA 3C1EA 3CRKC 5CYUA 2VNUD 3HOZB 2ID0A 4IUTA 2QCPX 2EXZA 1ZKOA 1WD1A 3SHLA 3NTHA 1IHZA 1QE6A 4A3GB 4A3JB 3A55A 4DNTB 1DOKA 2IPKD 5CR3A 2RQXA 5FKAC 1AP0A 2K6AA 3SK5A 3DEOA 3A7LA 4DF7A 1Y69U 3WOFA 4CJ2C 2R93B 1SMYC 1PRTF 3I8ZA 1EIGA 2E2IB 4DAVA 4OIJA 1TU2B 4LAAA 2ZXPA 4A3EB 1X3PA 3E6ZX 4QUFA 4K5WA 3LX0A 3RD4A 3R3OA 2GA4B 1LTRD 2K7VA 4CHTB 1JB3A 1Z7TA 3T13A 4R8NA 5K36G 4HR7B 4E6IA 1FNUA 4AYBB 2KEEA 2F0NA 3GV3A 3NTIA 1STAA 5DNFA 5T1GA 4OIKA 1AEXA 1KNAA 4V0BA 2YYZA 2XNAC 1JICA 4QF4A 1TS3A 2EZVA 2F0DA 4ZUIA 5EPLA 2B2TC 2KQ3A 3IFTA 1STGA 4QMGA 5A2QL 2KECA 1WTWA 2WINB 4IN3A 4TQUS 4FXDA 2QDBA 3EJIA 4EGVA 2PMZB 2JYOA 1NCVA 4IFDH 1F9QA 2EJFC 4IQZA 4KD4A 5M9OA 1Q1BA 1LO5D 1UUPA 3HG9A 2JEAI 4J8QA 1ENFA 5BN5A 2PW5A 2E76C 3VR2A 2F0UA 3DWQA 1BCPB 3OWFA 3PUZA 3D31A 3VYSA 3MC0B 1R9TB 2FHTA 3UI2A 2BCOA 3NBIA 4KK7A 1EYDA 4BBRB 1CFMA 1EYAA 5M5WB 1PLFA 3QOLA 4ZQ3A 3MTSA 4OHJA 3K0YA 1RF2D 4HAEA 4XT1B 3N6RA 4DA2A 5IGGA 4RGOS 5A35A 1ET6A 3QJYA 1HA5A 1PZKD 1RDPD 5LL6X 2VUMB 1TWGB 4LK1C 1BUVT 2PPBC 1KDCA 2BA0A 3CKIB 1PZID 1EY5A 4MIUA 1H9KA 1H9RA 1SMYD 1E2ZA 2A6HD 3TSSA 4C1NK 2JEBI 3NTKA 4XYQA 1I50B 2EYMA 4EQNA 5EBDA 4XQNA 3GTKB 1CHQD 3S14B 1G291 1O7ZA 1TS5A 3TZDA 2AUJD 3SDZA 5EPJA 3ND9A 2EVBA 4L8JA 1SE4A 1CA6A 2F0KA 3FEWX 3NHHA 2F0SA 5CBAE 3U9OA 1F9SA 3QG1A 1KDBA 3SXHA 2BE5D 3V2TA 4CKCA 2MPMA 3SK8A 1C48A 5CV9A 2G9HD 2RDGA 4C3JG 4K14A 1BDOA 5C3WA 2PNRC 2KEDA 4KY5A 2F0HA 3SR1A 1TWCB 2PO4A 2B39A 3TDQA 5I2YA 2EY6A 2KCCA 3KBGA 2K03A 3Q0AA 5EKIA 1ESRA 1V1PB 4LJZC 4XT3B 3J7AV 1JOQA 1F9RA 2K32A 1BQQT 4QIWB 2J7ZA 2FINB 5JOBA 1U4RA 2AQ2B 5IODA 2MGSA 2C5CA 4XQJA 2H1EA 1GUWA 3HKZB 3NUCA 2BDNA 2NN6H 1CA5A 2CVRA 3W2DA 2DY7A 1C4QA 1ZYRD 2NVTB 4HSPA 3WOEA 1ILQA 1SE3A 3BYYB 2AWOA 4RCOA 1YNJC 4IZ8A 3TP6A 1EEID 4DAPA 5D14A 4QCLA 3MWYW 1E2WA 4X3KA 3A8IE 4QUCA 3NP8A 5IGFA 3S2DB 4ZRZA 2KHSA 2LMCB 1ONLA 3D3RA 2KUMA 3F2UA 3KK7A 4CGYB 3OSOA 4X3SA 3OIPA 3M85A 4RCNA 1I4GA 5JVG3 5KRUA 3URYA 2IX1A 3K5LA 2K5WA 1SFOB 1DZ1A 3IAYA 4J6HA 3BDCA 1LTID 1TY0A 3PO3B 5ISRA 4ID6A 4OO1H 1B2TA 3HGBA 2FFKB 3MXUA 4OO1I 4FF3A 1EEFD 1GUGA 1FYCA 2EOTA 1QILA 3P7JA 4A3DB 3K7AB 4K5VA 5I2XA 5JPNC 2C9OA 2ZXOA 1MD2D 2D62A 1PTOH 4A3KB 3I72A 5CV7A 5KYLA 4UDUC 1H9SA 2PYKA 1TY2A 1UNSA 3BDLA 4R8IA 3TZUA 2EY5A 3VA7A 3K5MA 3IL8A 1WTVA 4P2CB 3DHQA 2XVSA 2QF7A 1HFGA 1DCZA 4NW2A 3FDTA 1GUNA 1CK1A 1D2BA 1QCBD 2JP1A 5CGKA 4NP5A 4F8MA 3Q6SA 4A3IB 1Q12A 4FYDA 1F9PA 2Z8LA 3T56B 3VR5A 1AN8A 1SYBA 5JEAH 2F0GA 5AFWA 2XRQD 2OEOA 1D1KA 1S5BD 4I7ZC 4TSSA 2EYFA 4EVOA 3H09A 3OIQA 2NTSA 4RFBA 1LTAD 2B8GA 2L0CA 1IKMA 4BY1B 1U4PA 2K5DA 5CV5A 2B2VC 3VR4A 3EQLC 2O5JC 5C5LA 1BF4A 2ZXRA 1U9RA 3SK6A 2OF1A 1ET9A 3NSWA 1HTPA 4OL7A 1LT6D 3S1NB 2RSOA 4GZYC 2I46A 2MHVA 1SBBB 4DGZA 5CORA 1HRJA 2PQEA 1DOMA 4ZUJA 2F3WA 3GTPB 1EU3A 3GTMB 1I4QA 1PRTC 4K8IA 4NDXA 1SNQA 4WFN3 3TP5A 1B9MA 2Y0SB 5CMDA 2WIIB 1FGBD 2EYPA 1EY0A 3QOJA 1EWCA 3FMCA 2AWNA 2PZTA 2RDFA 1JOKA 1T5EA 1AW7A 2B2UC 1ESFA 1EY4A 4YIJA 1VF5C 4A93B 3KUPA 1U4LA 3NWSA 2XWJB 3QWNA 1DM0B 1WVLA 2CW0C 3PUWA 1LT5D 3GV6A 2IX3A 5C0XI 2TMPA 2B63B 5C3XA 5KNDA 2K1BA 4IFDG 3HOUB 5JAVA 5M3FB 1STNA 3TP8A 3C46A 1C8CA 3VA5A 1R4PB 3NK9A 2F03A 3HOXB 5NUCA 1M8AA 1S4ZA 4RKBA 5I6WA 2N55A 1PDQA 1ZEQX 1B3AA 1JOOA 4RWSC 2M2LA 1U4MA 1CT1D 1EFID 1BO0A 3EVQA 2VXWA 1SNPA 3D4RA 1PYWD 3OWEB 5IT9E 3HOWB 5D65A 3R2TA 1PRTB 5C4ZA 1JWMD 1Y1WB 1II3A 2IX0A 5C0XG 3JAML 4Y7NB 1G2TA 1VDZA 4KJNA 1BCPC 2A6EC 4ULLA 2K04A 1V8QA 1CHPD 1SJHD 5EKKA 4S3SA 1O7LA 3KLRA 2Z4HA 2EYOA 2SDFA 1SEBD 1SSOA 4G7HC 1XX8A 2EJMA 2JE6I 3MXNA 2F0EA 4XTCS 1J9OA 1TT2A 1GHJA 3GD7A 1EQVA 2B2WA 3WDNA 2M9VA 1WTRA 2X6GA 5E4WC 4ZAIA 4DXGA 2D9UA 5CC4A 4DK1A 3NXWA 3NE5B 2MP1A 4V190 1IYVA 2O2LD 4RKLA 1GXDC 2B2YA 1EU4A 1DXMA 1HCZA 1NR4A 1NAPA 1CQFA 2NVQB 1VCIA 1LACA 2A5HA 2JA8B 2OT2A 4K8JA 3Q24A 1XXGA 4ODGA 4ABNA 2KA7A 4O42A 1MSHA 5C0XJ 2A73B 3K5NA 2KJXA 4KV6A 1F2MA 1NR2A 2FMCA 2LY7A 3BVMA 2Q8TA 5IOCA 3A7AB 1RTOA 2F0IA 4KHVA 2WACA 5ELEA 2EJGC 1F2YA 1SNCA 3CQZB 3AU7A 1DONA 2LFNA 5IT9L 2XIWA 1Q1EA 2SOBA 3HRZC 2O4XA 3PIP3 1ENCA 2I07B 1LT4D 2RDHA 2PW7A 3MEHA 3AB9A 1Y1VB 4F7XA 4ZKBB 3MA2B 4C3IG 4KN4C 4IUPA 3I90A 2F4IA 2R61A 1LTTD 4N9PA 3J80L 3S1RB 1IW7C 5EBCA 5EJWA 3DWAA 2DNEA 4M1UB 1CM9A 1BXTA 3P75A 1D5MC 5G3LD 2BDOA 2RBMA 2EPBA 1K83B 1KDAA 3TBIB 5FO8B 5EGTA 3M4OB 3RUZA 2EY2A 2F0JA 3OMCA 3DXJC 1SYCA 1BOSA 3DEPA 3I91A 3L9AX 1PXUA 2L1BA 3HEJA 4H13C 3IKJA 2D5DA 3L7ZC 4C3HB 4HCEA 2NUCA 2MUYA 4XXEA 1JORA 4KY7A 1LTSD 1I3QB 1WTPA 3H94A 4DNRB 4J1MA 1PTOB 1RODA 2A68D 4KKTA 1ILPA 4O1NA 1WTXA 4XDXA 1KLGD 2WP8J 3CU7A 5ELCA 5C5MA 3KF8A 3RZDB 5FOBB 5JPMC 2A69C 1JQYD 1V1PA 3NBHA 1XWEA 2VB2X 2B2UA 2BE5C 4RGMA 4IALA 4C3HG 3I3CA 2NZ1D 2L12A 3OPOA 1SJED 2ICEC 1EIHA 3TN2A 4DFAA 3OW7A 4PMBA 3VR3A 4KKSA 1SYDA 4ZYSA 3JAME 1A3VA 1KLUD 4KY6A 4C56C 3LWUA 1CZWA 1HUNA 3DMUA 5IGBA 1PTOF 1V43A 3V05A 1LV9A 3FRPB 4ZK9B 1PMRA 1X3QA 1RHPA 4TKOB 2B2TA 5C6AA 1Y8NB 1TKWB 1EQTA 2KOLA 5DEHA 4MHEA 3X3MA 2VB3X 5J22A 1PFMA 3C1FA 5C4HA 4WORA 5A2QE 3CHBD 3NWTA 4KI0A 3I4LA 4DU9A 2B2VA 3J81L 5ELBA 2F0LA 1J8IA 2PZUA 4PNYA 2WKCA 5K36H 2A74C 1TIID 2Q8RE 4B08A 1TWFB 4F88A 4HMJA 3GTOB 1I4HA 1PTOD 4G7ZC 1H9JA 1H9MA 1SAPA 3HZXA 4L6TB 4RA8A 3OMGA 2FJ2A 4FF4A 3GTJB 3SVMA 2L55A 3SEBA 1I4PA 2SEBD 3G6JB 2AQ3B 2CHBD 5DM73 1LLRD 2ICIA 1JR0D 2HCCA 1RJTA 2BOSA 3NQTA 4JK1C 2QILA 5M5XB 2RKSA 2A6HC 4RGNA 4QB4A 3ERQA 3GTQB 1CZGA 2R92B 2RSNA 3D4WA 1I6VC 5J1ZA 4HEDA 1D5XC 1B1ZA 4DN4M 1DJRD 1GUSA 1Q90A 1QWYA 3T53B 1O7YA 4IFDI 1LTGD 1WCMB 1QOHA 3CRLC 1D6EC 4H7BA 2EYHA 1YNND 1ENAA 2EE1A 1DD2A 2K01A 3I70A 5LHY1 3FPPA 1MGSA 5T1IA 2JA7B 3T16A 3S1QB 2NYZD 1IYUA 4RAUC 2QEJC 4N9TA 1FD7D 3RZOB 5F2DA 1JWUD 3PV0A 5IGCA 2K05A 1TS2A 5ELFA 2LS01 2WV6D 1SYGA 3R2IA 5CV6A 1V1OA 3J7AF 1A6XA 1TVXA 2WB1B 2ZT9C 4C2MB 1XYIA 3ONAB 1TWAB 1EZ8A 2LKVA 3GP7A 2OXPA 2JSOA 2RVLA 4FO2A 3PMFA 1STEA 1SYFA 5FLXL 1HQMC 2AQ1B 1AFPA 1HUMA 2BA1A 2FMMA 2RA4A 5CV8A 1QNKA 1YNJD 2JA5B 1BR9A 2R7ZB 1TWHB 1FNVA 2KVMA 1BCPF 1HQRD 4IFDJ 3MZ5A 3S15B 1MBYA 3DWPA 3T51B 5D3IB 1OO9B 5IGEA 1VMPA 1STHA 1R4QB 2AUKA 1LT3D 2X6LA 4FP5D 2Q8IB 1I6HB 4C3JB 4FXKC 1WD0A 1GOZA 1EWHA 1HTLD 4A3BB 1BBXC 4OGQC 1SXTA 2XRSD 3NPPA 2N88A 1HFNA 1WTQA 5FO7B 4K5XA 4X3TA 3PO2B 1EY9A 4X3UA 2F0WA 1GHKA 1DOLA 3G7LA 5C4XB 4IUQA 3BG3A 2K33A 1SNOA 1JWSD 3J7YW 4R9WA 1SE2A 1BCPD 1F2ZA 3HP3A 3GO5A 3M3YB 3LNNA 3KBXA 1B4OA 3S1MB 1EL0A 1PFBA 1OXXK 3GQBA 3MHBA 3BYTB 1FR3A 4RHRA 4PMCA 3GTGB 1ML0D 4IURA 3A54A 4XIGS 4FF2A 2L4NA 1AZPA 4FF1A 5COYA 4IUUA 1YNNC 5KIXA 2Z4IA 2CW0D 3MXPA 1I4XA 2WKDA 3T4AC 5M5YB 2SNSA 1MSGA 1CI3M 2F0VA 3E5SA 4IUVA 3OHXC 5G3LF 4KTAA 4HSVA 3A8JE 1E0BA 1G2SA 2E74C 2NVYB 4ME5A 2K5QA 2PZWA 2F0QA 1D5ZC 3VYTA 1TQOA 4G7OC 1UEAB 1UAPA 4C1NI 2JXMB 1PZJD 2DN8A 4KD3A 1Y8OB 4HTHA 5FK9C 3K59A 1ICWA 1B53A 1HPCA 1JC7A 4PMWA 1GUTA 3VR6A 1TR5A 1F2LA 3BVGA 1JE4A 2PCFB 3A8KE 2J4XA 2L5TA 1LTBD 1G91A 3ITPA 3J81E 3LWEA 5KGUA 3H0GB 4KHZA 2JA6B 3S9WA 2XSCA 3RLFA 3E0JA 1SNDA 1G8ZD 4RHSA 4ZKCB 2QKIC 4XQQA 2HCIA 1MI2A 1L0YB 2ENBA 4HN7A 3I4NB 1RKNA 5KEEA 2DNCA 2HDMA 3K58A 1G6ZA 1L0XB 3P1HA 5IIFA 3IFDA 1SDFA 1GJXA 2E2JB 1KTKA 3TP7A 4MN3A 1IW7D 1W6JA 1H9SB 4A3FB 5I6YA 5CV4A 4LMQD 2E2DC 4EQOA 1CTMA 2F0PA 3BDOA 1NUCA 4F87A 4NKLA 3N52A 4OO1G 4FNFA 5EPKA 3MXGA 1EOTA 3SK4A 5C44B 1SYEA 4XYOA 1OXSC 2NN6I 3M7NA 1I4RA 2XN9C 4KKUA 5LL6S 5E1FA 5JEAG 4RH6A 3D6CA 4BBSB 4ILWA 1RTNA 4DK0A 2L11A 5BN4A 3S2HB 4H0LC 4WJWA 3TMEA 1JCKB 4FVMA 5E3FA 2O5IC 1KABA 1QG7A 3Q22A 1GUOA 3VYUA 5I9PA 2NTTA 3FPUB 2DY8A 5HGTA 4Q5VA 3M4YA 1WTOA 2F1MA 1Y8PB 4TRDA 5HURA 2L9HA 2A6ED 4JBWA 2E75C 1PRTD 1D1IA 4EQPA 3V96A 3QO2A 4HMIA 4B9XA 4IUNA 2NBFA 1VMCA 2IWHA 2YU9B 2IT1A 1QJOA 3OOCA 5EKLA 1CQVA 2NN6G 3VYRA 1OXVA 3NQIA 3GTLB 5C0XH 2MJ8A 5IGDA 3RMHA 2D2CC 3D6WA 3S16B 3MFGA 4K2KA 1RCVD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K5V A;  1JOQ A;  2F0P A;  5CV5 A;  5J39 A;  4K2L A;  2F0M A;  4QB4 A;  1NUC A;  5JAV A;  3ERQ A;  1SNM A;  3P75 A;  4RKL A;  4R8N A;  3MZ5 A;  3T13 A;  1A3U A;  2SNS A;  4G57 A;  4I65 A;  1A2T A;  4NKL A;  1STN A;  5JOB A;  3TP8 A;  4E6I A;  2F0V A;  2F0N A;  3E5S A;  3VA5 A;  2RBM A;  2EYL A;  1STA A;  1KDA A;  3D4W A;  1AEX A;  3NK9 A;  5IOD A;  5EGT A;  1KDC A;  5C5L A;  4KTA A;  5J1Z A;  5IGE A;  1STH A;  5CV7 A;  3RUZ A;  4QF4 A;  1U9R A;  3SK4 A;  1A2U A;  2F0J A;  1EY5 A;  2EY2 A;  3MVV A;  5NUC A;  4MIU A;  2OF1 A;  3SK6 A;  4KJO A;  4ME5 A;  5C6A A;  2F0D A;  2F3V A;  3NUC A;  3OMC A;  4RKB A;  4ZUI A;  5I6W A;  1SYE A;  1EY8 A;  2PYK A;  2PZW A;  3H6M A;  2F0Q A;  5DEH A;  1JOO A;  1EY7 A;  2KQ3 A;  3ERO A;  4OL7 A;  3D4D A;  5K5P A;  1STG A;  4WRD A;  1TQO A;  4K8J A;  4QMG A;  3BDL A;  1SYC A;  2SNM A;  1KAA A;  1EZ6 A;  5E1F A;  4H7B A;  5J22 A;  3EVQ A;  2EY5 A;  2EYH A;  3C1F A;  3D6C A;  5C4H A;  4WOR A;  1SNP A;  4ODG A;  3QB3 A;  2QDB A;  4DGZ A;  1ENA A;  3EJI A;  3DHQ A;  2EY1 A;  2PQE A;  2EYM A;  3HEJ A;  4DU9 A;  1NSN S;  2HQE A;  4EQN A;  4IZ8 A;  4ZUJ A;  2F3W A;  4KD3 A;  4HTH A;  3TP6 A;  4KV6 A;  1F2M A;  2F0L A;  4K5X A;  3TME A;  2PZU A;  4PNY A;  4K8I A;  5E3F A;  3C1E A;  4NDX A;  1KAB A;  1SNQ A;  2M00 A;  1EY9 A;  5C4Z A;  2NUC A;  2F0W A;  5I9P A;  5IOC A;  3T16 A;  1A3T A;  1TR5 A;  3D8G A;  1II3 A;  5HGT A;  1JOR A;  4KY7 A;  3TP5 A;  2F0I A;  3NP8 A;  4KHV A;  4KD4 A;  5CGK A;  5IGF A;  5M9O A;  2WAC A;  4NP5 A;  4TRD A;  4N9T A;  5DAU A;  5HUR A;  2EXZ A;  1F2Y A;  1SNC A;  4J1M A;  1SNO A;  4F8M A;  3ITP A;  2EYJ A;  5F2D A;  2KHS A;  2EYP A;  3SHL A;  1EY0 A;  4HMJ A;  2F0K A;  2PW5 A;  1IHZ A;  3NHH A;  3QOJ A;  2F0U A;  5IGC A;  2SOB A;  5KYI A;  4KJN A;  4EQP A;  1SYG A;  2PZT A;  5CV6 A;  2F0S A;  1F2Z A;  5KGU A;  3OWF A;  2RDF A;  1JOK A;  1EYC A;  3U9O A;  3OSO A;  2O4X A;  3HZX A;  1SYB A;  2F0O A;  3OMG A;  3S9W A;  1KDB A;  3SXH A;  4HMI A;  5CR3 A;  4B9X A;  5C5M A;  1EY4 A;  1EY6 A;  1ENC A;  1SND A;  2F0G A;  4IUN A;  4YIJ A;  5EKK A;  1EYD A;  2F0T A;  3V2T A;  2OEO A;  4S3S A;  3SK5 A;  3SK8 A;  1EZ8 A;  2LKV A;  5CV9 A;  5KRU A;  2EYO A;  2ENB A;  2OXP A;  2PW7 A;  4NMZ A;  4DF7 A;  1EYA A;  1RKN A;  3MEH A;  5KEE A;  3PMF A;  1STB A;  5EKL A;  3QOL A;  4F7X A;  3MHB A;  5IIF A;  3P1H A;  4IAL A;  4PMC A;  4J6H A;  3BDC A;  4K14 A;  4ZQ3 A;  2F0E A;  1SYF A;  2EYF A;  5C3W A;  4LAA A;  1TT2 A;  4EVO A;  4DFA A;  4KY5 A;  5ISR A;  4ID6 A;  4N9P A;  5CV8 A;  2F0H A;  3SR1 A;  1EQV A;  4PMB A;  4K5W A;  3LX0 A;  5IGD A;  3NQT A;  5IGG A;  4K6D A;  1SYD A;  2F0F A;  3TP7 A;  1A3V A;  5C3X A;  5KIX A;  5KYL A;  2EY6 A;  4KY6 A;  3R3O A;  4B9W A;  3MXP A;  2RKS A;  5I6Y A;  5CV4 A;  5CC4 A;  4EQO A;  3DMU A;  3NXW A;  5I9O A;  5IGB A;  4K2K A;  1STY A; 
#chains in the Genus database with same CATH topology
 4K2L A;  2Z9H A;  3GTP H;  1O7I A;  1A3U A;  3J80 E;  1MJE A;  3CW2 C;  5FO9 B;  1QB5 D;  3HKZ E;  5L37 A;  2D0P A;  4BS9 A;  1VF7 A;  3HS0 C;  1Z6H A;  4GNX A;  2JA9 A;  3EFX D;  3GTG H;  2HUG A;  2KBN A;  2NWG A;  1PTO C;  3O13 A;  2K28 A;  3S1Q H;  1O78 A;  1EYG A;  1EY8 A;  5K5P A;  1EY7 A;  1O80 A;  3H91 A;  3PUX A;  1W6K A;  4HJ7 A;  2IL8 A;  4QIW E;  2SNM A;  1KAA A;  2K5V A;  3A0J A;  2K4K A;  1QNU A;  2JQO A;  4KMU C;  4HCS A;  3QB3 A;  2J0T D;  4Q0F A;  4CBV A;  4FXG C;  3RN2 A;  1EFW A;  1KRT A;  2QA4 A;  1BNZ A;  1R9T H;  2EY1 A;  1S5E D;  2HQE A;  1OXT A;  1TWG H;  1K8O A;  1M4V A;  2CWA A;  3I4N G;  1IBM Q;  1VQK A;  1ZXT A;  4UP8 A;  1UE6 A;  2V4D A;  1A3T A;  2G9D A;  3D8G A;  4PV1 C;  2XWB B;  3U9S A;  4B3S Q;  1Q8I A;  4G4K A;  4A3M B;  3K6O A;  1K83 H;  4A3E H;  3TRE A;  1B50 A;  3ERS X;  1TXY A;  2EYJ A;  1K0R A;  3A74 A;  2UXC L;  1Q8K A;  2Z6K A;  3ULJ A;  5KNC A;  1EIY B;  3I4M B;  2Q2U A;  3M9B A;  3QIA A;  4U67 3;  4L5T A;  3S16 H;  4CJ0 B;  2F0O A;  3K57 A;  1Q3L A;  4LFA L;  1IKL A;  4H44 C;  5D3D A;  1A15 A;  3CCS A;  1EY6 A;  4RGT A;  5IYC H;  1FL0 A;  3W3A A;  3FKI B;  2F0T A;  2CQA A;  1IBL Q;  4M8A A;  3KDF B;  4NMZ A;  4BWG B;  4CJ1 B;  3H3V H;  4IPC A;  5IWA L;  1S5F D;  3U4Z A;  1IBM L;  4A3F G;  2OTJ A;  1S5C D;  3BZD B;  3CCL A;  4K6D A;  2F0F A;  1SRO A;  1U0L A;  3S17 B;  1HA6 A;  2BH8 A;  1KNE A;  1N34 Q;  4DXF A;  4CKB A;  1A63 A;  4DAY A;  1LYL A;  2HD3 A;  2F0M A;  4KN7 C;  2VZA A;  4DUZ Q;  1SNM A;  4G57 A;  4I65 A;  4A76 A;  3PUV A;  2IJ0 A;  5JEA J;  2A68 C;  2UXD L;  2Z1C A;  1HZ9 A;  3PIO 3;  5BR8 L;  3FVQ A;  3PSI A;  2ALY B;  2B2W C;  1L0W A;  4C3I B;  4JI7 L;  4A3J G;  3PUY A;  4KJO A;  2F3V A;  5I9O A;  3C2P A;  3ERO A;  2A69 D;  3D4D A;  5JJZ A;  2TSS A;  4WRD A;  5LMU L;  3DM1 A;  1EZ6 A;  1NNX A;  5EQ0 A;  1AZQ A;  1X6O A;  4BA2 I;  2NVX B;  2X69 A;  1XJV A;  1RD9 D;  1HXY D;  4K6L A;  3CME A;  2H4O A;  3K0X A;  3MAQ A;  5I4D A;  2WAQ B;  5KNB A;  2KCN A;  1V1Q A;  3K7A H;  3ZYY X;  5M3M B;  2M00 A;  2E2H B;  4JI3 Q;  3DUZ A;  4LF9 L;  3BVZ A;  2R6G A;  1X32 A;  1B44 D;  4GKK Q;  3HOW G;  1VQF A;  4X65 L;  5DAU A;  3HOV G;  5ELD A;  1QVG A;  5H1S E;  1PVO A;  5KYI A;  4DV5 L;  1Z47 A;  1EYC A;  2UUC Q;  3HOV B;  3PIO A;  1MHW C;  4BY7 H;  1OXU A;  1XMO L;  3T1H Q;  4A3B H;  2UUA Q;  4IOA A;  3HOY B;  1TWC H;  1QUQ A;  5DM6 3;  4BY7 B;  1ZYR C;  4JCV E;  4L63 B;  3AMU A;  5IYD G;  4BY1 H;  5C3E B;  5BN3 A;  1STB A;  2NB0 A;  4U68 A;  3X3N A;  1W2B A;  2R3Z A;  4PQX A;  2K50 A;  3A56 A;  4UAI A;  1IL8 A;  5CBE E;  1LAB A;  3R8B A;  5TSS A;  5C4J B;  1PH9 A;  2KCM A;  1K8M A;  1HHV A;  4LWC A;  1XNQ Q;  1PFN A;  1SLJ A;  5IP9 H;  1TS4 A;  3K5O A;  5E4X A;  2IW3 A;  4B9W A;  5JVH 3;  2B2Y C;  3FP9 A;  3ND8 A;  5FLX E;  1STY A;  1T5X D;  3FHW A;  3OW2 A;  5J39 A;  2B8F A;  1E2V A;  4B3M L;  4DR5 L;  1B9N A;  1A2T A;  4R4I A;  4ZLT F;  1VQO A;  2UUB L;  2EYL A;  3K81 C;  4BBR G;  4IJL A;  3L3O C;  1FNW A;  1I94 L;  4Z9C B;  4CKE A;  3I73 A;  1A2U A;  3MVV A;  4N8F A;  2EDG A;  3I4N H;  1KAW A;  3H6M A;  3MFY A;  4C3H H;  1S5D D;  3P20 A;  2ZM6 Q;  3R93 A;  1V9P A;  1YZ6 A;  4J15 A;  3SE0 A;  4BA1 I;  1XTC D;  4PG3 A;  3KLS X;  3EA6 A;  3KLS A;  4A3J H;  2HDL A;  1L2F A;  3C3L A;  3MXN B;  1NSN S;  3I2Z A;  1DYQ A;  3BS1 A;  3Q23 A;  3H3V C;  4JC0 A;  1YJW A;  1F77 A;  4GKJ Q;  3M7G A;  1HR0 L;  3C1E A;  3CRK C;  5CYU A;  4KHP Q;  2VNU D;  4DV6 Q;  3HOZ B;  2ID0 A;  1XPR A;  4B3S L;  4DR7 Q;  4IUT A;  2XGT A;  4KLK A;  2QCP X;  4GS3 A;  2EXZ A;  1IBK Q;  1ZKO A;  1WD1 A;  3SHL A;  3NTH A;  1IHZ A;  2K75 A;  5ELO A;  1QE6 A;  4A3G B;  4A3J B;  3A55 A;  4DNT B;  2A8V A;  3PQI A;  1DOK A;  2IPK D;  4UP9 A;  2RQX A;  5CR3 A;  5FKA C;  4HJA A;  1AP0 A;  2K6A A;  3SK5 A;  5JJK A;  3DEO A;  1CSP A;  3A7L A;  3BJU A;  4JI1 Q;  4DF7 A;  1Y1W H;  1Y69 U;  1YEZ A;  4UPA A;  3WOF A;  4CJ2 C;  1HR0 W;  2R93 B;  1SMY C;  2R93 G;  1PRT F;  3I8Z A;  1EIG A;  2E2I B;  4DAV A;  4OIJ A;  1TU2 B;  4LAA A;  1WOC A;  2ZXP A;  4A3E B;  1X3P A;  4DR4 L;  3E6Z X;  4QUF A;  4K5W A;  3LX0 A;  3RD4 A;  3MEF A;  3R3O A;  2GA4 B;  1LTR D;  2QDL A;  1NJI C;  4OWT B;  2K7V A;  4CHT B;  1JB3 A;  1Z7T A;  1PH7 A;  4A4I A;  3T13 A;  4R8N A;  4JYA L;  5K36 G;  4HR7 B;  4E6I A;  1FNU A;  4AYB B;  2KEE A;  2F0N A;  2BH2 A;  3GV3 A;  3NTI A;  1STA A;  5DNF A;  5T1G A;  4OIK A;  1AEX A;  1KNA A;  4V0B A;  2NVX H;  2YYZ A;  2XNA C;  1JIC A;  4GNX B;  2WB1 G;  4QF4 A;  1TS3 A;  4JI8 Q;  2EZV A;  2F0D A;  4ZUI A;  4X66 Q;  5EPL A;  2VW9 A;  2B2T C;  2KQ3 A;  1HNZ L;  3IFT A;  1STG A;  2CFM A;  4QMG A;  5A2Q L;  2KEC A;  1WTW A;  1Q81 C;  4DV6 L;  2WIN B;  2L15 A;  3NEM A;  4IN3 A;  4YWL A;  4TQU S;  4FXD A;  2QDB A;  3W1G A;  3EJI A;  3WWV A;  1JJC B;  4YWK A;  4EGV A;  4X6A H;  1XTD A;  2KHI A;  1X3F A;  2PMZ B;  2JYO A;  1Q86 C;  4JI2 L;  1NCV A;  2JK8 A;  1CKO A;  1D8L A;  4IFD H;  1F9Q A;  2EJF C;  4JYA Q;  4IQZ A;  4KD4 A;  4JI7 Q;  5M9O A;  4OX9 L;  1Q1B A;  4YY3 L;  1LO5 D;  1UUP A;  3HG9 A;  2JEA I;  4J8Q A;  5LMN Q;  1ENF A;  3CPW A;  5IYD H;  5BN5 A;  2B29 A;  2B3G A;  2PW5 A;  2E76 C;  3VR2 A;  2F0U A;  3DWQ A;  1BCP B;  3PUZ A;  3OWF A;  3D31 A;  3VYS A;  3MC0 B;  1R9T B;  2FHT A;  3KF8 B;  3UI2 A;  1I3Q H;  2BCO A;  3EIV A;  3NBI A;  4KK7 A;  4RG1 A;  2YTY A;  1EYD A;  4BBR B;  1CFM A;  1CKM A;  3OYY A;  1EYA A;  3D0F A;  1PLF A;  4DV0 L;  3QOL A;  5M5W B;  2E2I H;  4JI5 Q;  4ZQ3 A;  3MTS A;  4OHJ A;  3K0Y A;  1RF2 D;  4HAE A;  4XT1 B;  3N6R A;  3PGZ A;  4DA2 A;  5IGG A;  1VQ4 A;  4RGO S;  5A35 A;  2GVB A;  4HIO A;  1ET6 A;  3QJY A;  1HA5 A;  3HOZ G;  1PZK D;  1XMQ Q;  2JA7 H;  2OWO A;  1RDP D;  5LL6 X;  1JJ2 A;  2VUM B;  4OEM B;  4O2D A;  1TWG B;  1B3Q A;  4LK1 C;  1BUV T;  4BBS H;  3I7F A;  4NXN L;  2PPB C;  1KDC A;  2BA0 A;  2HHH Q;  3CKI B;  2JJQ A;  4WJ3 M;  1PZI D;  1EY5 A;  4MIU A;  1H9K A;  5IY0 A;  1H9R A;  1SMY D;  1E2Z A;  2A6H D;  3BZK A;  4JI0 L;  4JI4 L;  1BBW A;  4C3J H;  3TSS A;  4R4C A;  4C1N K;  4A3L G;  2JEB I;  4JW0 A;  1SN8 A;  3NTK A;  4XYQ A;  1I50 B;  1PFS A;  4DK3 C;  1VQB A;  1YVC A;  2EYM A;  2HQL A;  2LSS A;  3STB D;  4DPG A;  5EBD A;  4EQN A;  2R92 H;  3KDF A;  4XQN A;  3GTK B;  1CHQ D;  3S14 B;  2GN5 A;  1G29 1;  2R7Z H;  3A5Z B;  1O7Z A;  1TS5 A;  1YJ9 A;  3TZD A;  2AUJ D;  3SDZ A;  5EPJ A;  2NZO A;  3ND9 A;  3TRZ A;  2EVB A;  2HT1 A;  4L8J A;  4MTK A;  1SE4 A;  2E2J H;  4B3R Q;  4LFC L;  4X62 L;  1CA6 A;  4LF4 Q;  2F0K A;  3FEW X;  3NHH A;  2D0O A;  2Z6K C;  3UDG A;  1MJC A;  2F0S A;  2R93 H;  3NEN A;  2B63 G;  4BXX H;  5CBA E;  3U9O A;  4LF9 Q;  4L5Q A;  2WB1 E;  2UXD Q;  1F9S A;  3QG1 A;  1HJP A;  1KDB A;  3SXH A;  2I5H A;  4P71 A;  2BE5 D;  2ZJP A;  3V2T A;  1K0S A;  4CKC A;  2MPM A;  3SK8 A;  1N32 L;  1C48 A;  5CV9 A;  2JA6 G;  2G9H D;  1N9W A;  2RDG A;  4A3G G;  4C3J G;  2ZJQ A;  1X3E A;  4A75 A;  4K14 A;  1BDO A;  5C3W A;  2PNR C;  1HNX L;  2KED A;  2WAQ G;  1NY4 A;  4KY5 A;  1PH1 A;  3GTO H;  2F0H A;  3SR1 A;  1TWC B;  2PO4 A;  2B39 A;  3TDQ A;  2A19 A;  4QJF A;  4OEL B;  5I2Y A;  2EY6 A;  1U5K A;  2KCC A;  3KBG A;  2K03 A;  3LGJ A;  3Q0A A;  1Y1V H;  5EKI A;  4IOC A;  1ESR A;  1V1P B;  4LJZ C;  4XT3 B;  3J7A V;  1JOQ A;  1F9R A;  2K32 A;  1VQ6 A;  1BQQ T;  4QIW B;  2J7Z A;  1CSQ A;  2FIN B;  5JOB A;  2V1C C;  1U4R A;  2AQ2 B;  5IOD A;  2MGS A;  2C5C A;  4XQJ A;  1SRU A;  4A3K H;  2PQA A;  2I0Q A;  2H1E A;  1GUW A;  3HKZ B;  3NUC A;  1VQH A;  2BDN A;  2NN6 H;  1CA5 A;  2CVR A;  3W2D A;  5IYC G;  2DY7 A;  1C4Q A;  1I5F A;  1PYS B;  1QVF A;  1ZYR D;  3E0E A;  4B3T L;  2NVT B;  4HSP A;  3WOE A;  1ILQ A;  2JA5 G;  1SE3 A;  3OTO L;  3BYY B;  4DR3 Q;  2AWO A;  4RCO A;  1YNJ C;  4IZ8 A;  1N8R C;  4DV4 Q;  3TP6 A;  1EEI D;  4DAP A;  4DV1 Q;  3K80 C;  5D14 A;  4DV7 L;  2ZM6 L;  1NBW A;  2VL6 A;  4QCL A;  3MWY W;  1E2W A;  4X3K A;  3A8I E;  1X65 A;  4HJ5 A;  4QUC A;  1XNQ L;  3NP8 A;  2N3S A;  5IGF A;  3FKI G;  3KJO A;  3AYH B;  4DV2 Q;  3S2D B;  2R92 G;  2CKZ B;  4ZRZ A;  2KHS A;  1RIP A;  2LMC B;  1ONL A;  3D3R A;  2KUM A;  3F2U A;  3KK7 A;  3ZJY C;  3KLW A;  4CGY B;  3OSO A;  4X3S A;  3OIP A;  3M85 A;  1E3P A;  4RCN A;  1I4G A;  5LMU Q;  1N33 Q;  4X64 Q;  4L5S A;  2N78 A;  1EQR A;  5JVG 3;  3NEL A;  4LUV A;  5KRU A;  1YHA A;  3URY A;  1K3B C;  2IX1 A;  3K5L A;  2K5W A;  1SR3 A;  3H0G H;  1SFO B;  3KFU A;  1DZ1 A;  3IAY A;  4J6H A;  3BDC A;  1XNR Q;  1LTI D;  1TY0 A;  4YCU A;  3PO3 B;  2LXJ A;  5ISR A;  4ID6 A;  4OO1 H;  1B2T A;  3HGB A;  2FFK B;  3MXU A;  4OO1 I;  5C4X G;  4GKK L;  4FF3 A;  1EEF D;  1GUG A;  4IJH A;  4JI1 L;  1FYC A;  2EOT A;  1QIL A;  3P7J A;  4IPH A;  4A3D B;  3CMA A;  2ES2 A;  4A3E G;  3K7A B;  4K5V A;  5I2X A;  5JPN C;  2C9O A;  2ZXO A;  1E1O A;  1MD2 D;  1C0A A;  4UY8 C;  2D62 A;  1PTO H;  4A3K B;  4NXN Q;  4GLV B;  3OTO Q;  1YJN A;  3I72 A;  5CV7 A;  5KYL A;  4A3D G;  4UDU C;  1H9S A;  5GAG C;  4JI0 Q;  4JI4 Q;  4B3R L;  2PYK A;  1TY2 A;  1VQ9 A;  2IHE A;  2UXC Q;  3M4P A;  1SMX A;  1UNS A;  1K8G A;  3BDL A;  2PQA B;  4QY7 A;  4R8I A;  3TZU A;  2EY5 A;  4TVA B;  3VA7 A;  3IL8 A;  3K5M A;  4HIK A;  1WTV A;  4NXM Q;  1GKH A;  4P2C B;  3DHQ A;  1I50 H;  4PZ6 A;  2WAQ E;  2XVS A;  2HIX A;  1H95 A;  1P16 A;  2AMC B;  4X66 L;  2QF7 A;  1HFG A;  1DCZ A;  4NW2 A;  2QGQ A;  3FDT A;  3KF6 B;  1GUN A;  2UUC L;  1CK1 A;  1VQM A;  1D2B A;  1QCB D;  1YI2 A;  4ALP A;  2JP1 A;  2K5N A;  5CGK A;  4DAM A;  4NP5 A;  1Y1W G;  4F8M A;  3HOV H;  1VQI A;  3Q6S A;  4A3I B;  1Q12 A;  2IY5 B;  4FYD A;  1F9P A;  2Z8L A;  3T56 B;  3VR5 A;  1AN8 A;  4A3I H;  1SYB A;  1M1K C;  5JEA H;  1PV4 A;  2F0G A;  5AFW A;  2XRQ D;  4YY3 Q;  5M5Y H;  4C2M H;  2E8G A;  2OEO A;  1BKB A;  5DLQ E;  4GN3 B;  1D1K A;  4OWX B;  1S5B D;  4AH6 A;  5FLM H;  4I7Z C;  4TSS A;  3M4O H;  2EYF A;  4EVO A;  1B8A A;  2B63 H;  1HNX Q;  3H09 A;  3OIQ A;  4A3M G;  3J81 j;  2NTS A;  4RFB A;  3S1N H;  1LTA D;  3VDY A;  4B3T Q;  2B8G A;  2L0C A;  2E5L Q;  1IKM A;  3M4Q A;  2YV5 A;  4BY1 B;  1U4P A;  2K5D A;  3E3X A;  5CV5 A;  2B2V C;  4AQY Q;  3VR4 A;  2GVA A;  4QGU A;  2G5D A;  3EQL C;  3CCV A;  2O5J C;  5C5L A;  1C9O A;  1BF4 A;  4O0A A;  2ZXR A;  1U9R A;  3SK6 A;  2OF1 A;  1ET9 A;  3NSW A;  4DK6 C;  1HTP A;  1J5E Q;  4OL7 A;  1LT6 D;  3S1N B;  2RSO A;  1EUJ A;  4GZY C;  3F8T A;  2I46 A;  3JAM i;  2MHV A;  1SBB B;  4DGZ A;  5COR A;  1HRJ A;  2PQE A;  1DOM A;  4ZUJ A;  2F3W A;  3GTP B;  1EU3 A;  4DUZ L;  1I4Q A;  3GTM B;  1PRT C;  1G6P A;  4K8I A;  4NDX A;  1SNQ A;  4K2K A;  4DR2 Q;  2EQS A;  4WFN 3;  3TP5 A;  1B9M A;  1LTL A;  2Y0S B;  5CMD A;  4HID A;  3GTL H;  2WII B;  1FGB D;  3I4M H;  2EYP A;  1EY0 A;  3QOJ A;  1EWC A;  3FMC A;  3U58 A;  2AWN A;  2PZT A;  5AJ3 L;  3CAM A;  1E1T A;  1JOK A;  1T5E A;  2RDF A;  1AW7 A;  2B2U C;  1ESF A;  4A3M H;  1EY4 A;  1CUK A;  4YIJ A;  1VF5 C;  2MO1 A;  2YTX A;  4K0K L;  4A93 B;  3KUP A;  1WCM H;  1U4L A;  3NWS A;  4A93 G;  4HJ9 A;  2XWJ B;  1I94 Q;  1PYB A;  3QWN A;  1DM0 B;  4AIM A;  3ICE A;  3HKS A;  4P74 A;  1WVL A;  2CW0 C;  3PUW A;  4DR2 L;  4DV2 L;  1LT5 D;  3GV6 A;  2IX3 A;  5C0X I;  2TMP A;  2B63 B;  5C3X A;  2R7D A;  3KF6 A;  1PH5 A;  2MFI A;  5KND A;  2K1B A;  2RCF A;  3U50 C;  4IFD G;  3HOU B;  1UWV A;  5IWA Q;  2YTV A;  1X54 A;  5JAV A;  3K8A A;  5M3F B;  1STN A;  1GO3 E;  3TP8 A;  3C46 A;  3KYH C;  1C8C A;  3VA5 A;  1R4P B;  4HJ8 A;  3NK9 A;  2F03 A;  2UUB Q;  3HOX B;  1VQD A;  5NUC A;  1M8A A;  1N34 L;  1S4Z A;  4RKB A;  3TS2 A;  5I6W A;  2N55 A;  1PDQ A;  1ZEQ X;  1B3A A;  3RLN A;  1JOO A;  1IBK L;  4RWS C;  2M2L A;  4JV5 L;  5M5X H;  4LFA Q;  1U4M A;  1CT1 D;  1KD1 C;  1EFI D;  4JBJ A;  1BO0 A;  3EVQ A;  4LW1 A;  2VXW A;  1SNP A;  2F52 A;  3D4R A;  3B6Y A;  1PYW D;  3OWE B;  1L1O C;  4RMF A;  5IT9 E;  3HOW B;  3J7A 5;  4JVZ A;  2AHO B;  5D65 A;  3R2T A;  4BXX G;  1PRT B;  1PH3 A;  1UEB A;  5C4Z A;  3F1Z A;  4WJ4 A;  1JWM D;  1LUZ A;  1Y1W B;  2MQH A;  1II3 A;  2IX0 A;  3G48 A;  5C0X G;  1QVC A;  3JAM L;  4Y7N B;  1G2T A;  1VDZ A;  1B7Y B;  4POF A;  3S24 A;  3CP0 A;  2OTL A;  4KJN A;  1BCP C;  3CCE A;  2K14 A;  1PHJ A;  2A6E C;  4ULL A;  2K04 A;  1V8Q A;  1CHP D;  1SJH D;  5JJL A;  1OTC A;  5EKK A;  3GTQ H;  4S3S A;  1K8A C;  1O7L A;  3KLR A;  2Z4H A;  2EYO A;  2SDF A;  5J3B A;  2E2H H;  1SEB D;  1SSO A;  4G7H C;  1XX8 A;  5EAY A;  4JPB W;  2EJM A;  3HOX H;  2JE6 I;  3MXN A;  2F0E A;  4XTC S;  1L1O A;  1J9O A;  1TT2 A;  1GHJ A;  4Y7N H;  3J7Z C;  3GD7 A;  4MZ9 A;  1EQV A;  2B2W A;  3WDN A;  2M9V A;  1WTR A;  2X6G A;  3S1M H;  3L0O A;  3J80 c;  5E4W C;  4ZAI A;  1JMC A;  4DXG A;  2D9U A;  5CC4 A;  4DR6 Q;  4DK1 A;  3NXW A;  3NE5 B;  2MP1 A;  4V19 0;  4DR1 L;  1GM5 A;  3UE1 A;  1IYV A;  2O2L D;  4AQY L;  1WFQ A;  3HOW H;  4RKL A;  1GXD C;  3HOY H;  2B2Y A;  3PCO B;  4EQ5 A;  5C4J H;  1EU4 A;  3CCQ A;  5IYB H;  2KHJ A;  1NTG A;  1DXM A;  1HCZ A;  1NR4 A;  1NAP A;  3ULP A;  1CQF A;  1YBY A;  1J5E L;  2NVQ B;  1VCI A;  1SE8 A;  1LAC A;  2A5H A;  2JA8 B;  1DGS A;  2OT2 A;  3PO2 H;  4K8J A;  4ZCK A;  3Q24 A;  2UUA L;  1XXG A;  5IE8 A;  4ODG A;  4ABN A;  2KA7 A;  1PH8 A;  3AQQ A;  1JT8 A;  4O42 A;  1VQP A;  2H5X A;  1MSH A;  5C0X J;  2XTI A;  2A73 B;  3K5N A;  2KJX A;  4KV6 A;  1F2M A;  1NR2 A;  1XNR L;  2FMC A;  2LY7 A;  1HH2 P;  3BVM A;  2Q8T A;  5IOC A;  3A7A B;  1RTO A;  1I6H H;  2Q2H A;  2OQ0 A;  4AYB G;  1K73 C;  2F0I A;  4KHV A;  2WAC A;  2JA5 H;  1NMG A;  5ELE A;  2EJG C;  1F2Y A;  1SNC A;  2F4V L;  3CQZ B;  3AU7 A;  1DON A;  2LFN A;  4GN4 B;  5IT9 L;  2XIW A;  3DM3 A;  1Q1E A;  2SOB A;  3HRZ C;  4GOP A;  1HR0 Q;  3UDX A;  2I5M X;  2O4X A;  3PIP 3;  4GNX C;  4DUY L;  1ENC A;  2I07 B;  1HNW L;  1LT4 D;  4K0K Q;  2RDH A;  2K52 A;  2PW7 A;  5C3E G;  2A1A A;  3MEH A;  3AB9 A;  2N49 A;  1Y1V B;  4F7X A;  4ZKB B;  3HOY G;  3G4S A;  3MA2 B;  4C3I G;  4KN4 C;  4IUP A;  3I90 A;  2F4I A;  1PH4 A;  3CQZ H;  2R61 A;  4NXM L;  1LTT D;  4N9P A;  3J80 L;  3S1R B;  1UE1 A;  3CXC A;  1NMF A;  1AE3 A;  3FKI H;  1IW7 C;  1TWA H;  1UE7 A;  3DLL A;  5E7N A;  5EBC A;  5EJW A;  3DWA A;  2DNE A;  4M1U B;  4APV A;  4CDF C;  4LFB L;  5IP7 H;  1CM9 A;  1BXT A;  3P75 A;  1D5M C;  3BZC A;  4PZ8 A;  1JJG A;  2ZTD A;  5G3L D;  2BDO A;  2RBM A;  2EPB A;  3RZO H;  1K83 B;  1KDA A;  3TBI B;  5FO8 B;  5EGT A;  4NB3 A;  3T1H L;  3M4O B;  4LF6 Q;  3RUZ A;  3IRB A;  1C7Y A;  2EY2 A;  2F0J A;  1BBU A;  3OMC A;  3DXJ C;  2QW7 A;  1KQS A;  5M5W H;  3JC6 6;  1B70 B;  1AH9 A;  1CKN A;  2NVQ H;  2C35 B;  1SYC A;  2DJG C;  4A3C G;  1BOS A;  3DEP A;  3I91 A;  3L9A X;  4QL5 A;  2DUD A;  4ME3 A;  4UP7 A;  1PXU A;  4P72 A;  2L1B A;  5GRO A;  3HEJ A;  4H13 C;  4DAY B;  3IKJ A;  4GOP C;  2D5D A;  4POG A;  1N32 Q;  3L7Z C;  2CQO A;  1HNZ Q;  1RL2 A;  4C3H B;  4HCE A;  2NUC A;  2ZTC A;  3SGI A;  2MUY A;  4XXE A;  2IHF A;  4DR4 Q;  1JOR A;  3F2C A;  4KY7 A;  1LTS D;  2Q2T A;  1I3Q B;  1WTP A;  1LM0 A;  3H94 A;  4OON A;  4DNR B;  4P73 A;  4J1M A;  1PTO B;  5FLM G;  3S1R H;  1ROD A;  2A68 D;  3S14 H;  4KKT A;  5FJ8 G;  4X62 Q;  4LFC Q;  3GTK H;  5JJI A;  1ILP A;  4O1N A;  4H02 A;  4XDX A;  1WTX A;  1E24 A;  1W3S A;  1KLG D;  2WP8 J;  3CU7 A;  3QR8 A;  5ELC A;  5C5M A;  3KF8 A;  4R4O A;  3RZD B;  5FOB B;  5JPM C;  2A69 C;  1JQY D;  1KHI A;  1V1P A;  3GDE A;  3H15 A;  3NBH A;  1XWE A;  2VB2 X;  1VQ5 A;  2B2U A;  2BE5 C;  4RGM A;  4IAL A;  4C3H G;  3I3C A;  2NZ1 D;  2L12 A;  1S40 A;  1EOV A;  2Q2I A;  3OPO A;  1KIX A;  1SJE D;  2ICE C;  1EIH A;  3TN2 A;  4DFA A;  3OW7 A;  4PMB A;  3VR3 A;  4KKS A;  1SYD A;  4ZYS A;  3JAM E;  1A3V A;  1KLU D;  2QEX A;  4KY6 A;  4C56 C;  4DR6 L;  3LWU A;  2RF4 A;  4AYB E;  1CZW A;  4QQB X;  1HUN A;  3DMU A;  3PF4 A;  5IGB A;  1YNX A;  1PTO F;  1V43 A;  2EIF A;  3V05 A;  4DV4 L;  1VS0 A;  1LV9 A;  4OX9 Q;  3FRP B;  1IBL L;  4ZK9 B;  1J6Q A;  4I7A A;  3S2D H;  1PMR A;  1X3Q A;  2LXK A;  1RHP A;  2CH4 W;  4TKO B;  4X65 Q;  1JE5 A;  2B2T A;  5C6A A;  1Y8N B;  1TKW B;  1TWH H;  1EQT A;  4LF5 Q;  2KOL A;  5DEH A;  5M3M H;  3H0G G;  4MHE A;  4A3F H;  3X3M A;  3HOX G;  3CC2 A;  3STB C;  1AE2 A;  3S2H H;  2VB3 X;  2AKW B;  4OXP A;  1PFM A;  5J22 A;  3C1F A;  5C4H A;  5ELN A;  4WOR A;  5A2Q E;  3CHB D;  1ASZ A;  3NWT A;  3TS0 A;  4KI0 A;  3I4L A;  3F2D A;  5FJ8 H;  5M3F G;  4DU9 A;  5GAE C;  4LF8 Q;  2B2V A;  3J81 L;  2K5H A;  5ELB A;  2F0L A;  4IPD A;  1J8I A;  2PZU A;  4PNY A;  2WKC A;  3I56 A;  1QZG A;  4L5R C;  5K36 H;  2A74 C;  4C3I H;  4YHH L;  1TII D;  2Q8R E;  3GTJ H;  2F4V Q;  4B08 A;  1TWF B;  3HOZ H;  4F88 A;  2RHS B;  2JA8 H;  3RR5 A;  4A3G H;  4HMJ A;  3GTO B;  2CCZ A;  1I4H A;  1PTO D;  4G7Z C;  1FGU A;  1H9J A;  1VQL A;  1H9M A;  1SAP A;  4DUY Q;  3HZX A;  4L6T B;  1XMO Q;  4A3C H;  4RA8 A;  3OMG A;  2FJ2 A;  4B3M Q;  1S3O A;  4FF4 A;  1VQG A;  3E9H A;  4DV3 L;  3GTJ B;  4N8X 1;  3SVM A;  2L55 A;  3SEB A;  4LUO A;  1I4P A;  4LF4 L;  2SEB D;  3G6J B;  2AQ3 B;  2CHB D;  5DM7 3;  1HZB A;  1LLR D;  2VQE Q;  2I5L X;  2ICI A;  4EX5 A;  1JR0 D;  1T9H A;  4PZ7 A;  2HCC A;  4YWM A;  2F3I A;  1RJT A;  2BOS A;  1MIU A;  1P8L A;  2UXB L;  2OQK A;  4A3K G;  3NQT A;  4JK1 C;  2QIL A;  3I4M G;  5M5X B;  3AFQ A;  2RKS A;  2VY3 A;  1VQA A;  2UU9 Q;  2A6H C;  1XPO A;  4RGN A;  4QB4 A;  3UDI A;  3ERQ A;  3CC4 A;  3GTQ B;  4MTN A;  1CZG A;  2R92 B;  2RSN A;  3D4W A;  5M3F H;  1I6V C;  5J1Z A;  4HED A;  4LF7 Q;  1D5X C;  1B1Z A;  4DN4 M;  4JI6 L;  2Z0S A;  3HOU H;  2Z6B A;  1DJR D;  1GUS A;  1Q90 A;  1QWY A;  3T53 B;  1O7Y A;  5C3E H;  1EQQ A;  4IFD I;  1LTG D;  1WCM B;  1QOH A;  3CRL C;  1D6E C;  4H7B A;  4YHH Q;  2EYH A;  1YNN D;  1WCM G;  1X56 A;  1ENA A;  2EE1 A;  1DD2 A;  2K01 A;  2VQF Q;  3I70 A;  3CCM A;  5LHY 1;  3FPP A;  1WJJ A;  3PO3 G;  3E9I A;  1MGS A;  3T1Y Q;  2JA7 G;  5T1I A;  2JA7 B;  3T16 A;  3S1Q B;  2MO0 A;  2NYZ D;  3M3Y H;  4UHV A;  1IYU A;  4RAU C;  2QEJ C;  4R1J A;  4N9T A;  1FD7 D;  1XPU A;  3RZO B;  5F2D A;  1E22 A;  1KC8 C;  1JWU D;  4LF7 L;  3PV0 A;  5IGC A;  2K05 A;  4DV0 Q;  1TS2 A;  2VUM H;  2ZTE A;  2Y0S E;  1HZA A;  2LS0 1;  5ELF A;  2WV6 D;  1SYG A;  3R2I A;  5CV6 A;  3UE0 A;  1V1O A;  1VQC A;  3J7A F;  1A6X A;  1TVX A;  3CD6 A;  2WB1 B;  1EIF A;  2ZT9 C;  5BR8 Q;  5C4X H;  4C2M B;  1XYI A;  4BBR H;  3ONA B;  1TWA B;  3Q8D A;  3TEH B;  1EZ8 A;  1GD7 A;  2CH4 A;  2LKV A;  3GP7 A;  2OXP A;  2JSO A;  2RVL A;  4FO2 A;  3PMF A;  2VQF L;  1WI5 A;  4BY1 G;  1STE A;  4DR7 L;  1HQM C;  1SYF A;  4YCV A;  5FLX L;  3GTM H;  2AQ1 B;  1AFP A;  1HUM A;  1A62 A;  2BA1 A;  2FMM A;  2RA4 A;  1K28 A;  5IYB G;  4BY7 G;  5CV8 A;  1QZH A;  1QNK A;  2R7Z G;  3RNU A;  1YNJ D;  2RHQ B;  2YU9 H;  2JA5 B;  3J81 c;  3G6E A;  5IP9 G;  3UDF A;  1BR9 A;  4JI6 Q;  2R7Z B;  1MKH A;  1TWH B;  1Y1V G;  1FNV A;  2KVM A;  1BCP F;  3S17 H;  1HQR D;  4IFD J;  3MZ5 A;  3I55 A;  3S15 B;  2RCN A;  1MBY A;  3DWP A;  4HIM A;  3AFP A;  2PMZ E;  2CWP A;  3T51 B;  5D3I B;  3J81 i;  3J80 i;  1OO9 B;  5IGE A;  1VMP A;  1STH A;  1R4Q B;  2AUK A;  3G71 A;  1D7Q A;  1LT3 D;  2X6L A;  3KOJ A;  4FP5 D;  4A3B G;  2Q8I B;  1I6H B;  4GN5 A;  4C3J B;  1KL9 A;  1WYD A;  5LMN L;  5M3M G;  4FXK C;  4JI8 L;  1WD0 A;  4A93 H;  4LFB Q;  4LNQ A;  1GOZ A;  1EWH A;  1HTL D;  4A3B B;  3U4V A;  2NZH A;  5AJ3 Q;  1Z9F A;  3AEV A;  1VQE A;  1X9N A;  1Q7Y C;  1BBX C;  4OGQ C;  1SXT A;  4LUZ A;  4R4T A;  1KXL A;  2HIV A;  2XRS D;  3NPP A;  2N88 A;  1HFN A;  1WTQ A;  4P75 A;  5FO7 B;  3NBH B;  3S15 H;  4K5X A;  3EN2 A;  4X3T A;  3PO2 B;  1EY9 A;  4X3U A;  2F0W A;  1YIJ A;  3RZD H;  1GHK A;  1DOL A;  3G7L A;  5C4X B;  4IUQ A;  5IT9 c;  3BG3 A;  2K33 A;  3W5O A;  1SNO A;  3PO3 H;  1JWS D;  1FVI A;  3ER0 A;  1IL2 A;  3PO2 G;  1K3R A;  3J7Y W;  1SFO H;  4R9W A;  1SE2 A;  1BCP D;  1F2Z A;  4DR5 Q;  3BU2 A;  3HP3 A;  4KHP L;  3GO5 A;  1NE3 A;  3M3Y B;  3LNN A;  4IO9 A;  1N36 L;  3KBX A;  1B4O A;  4LF8 L;  2PNH A;  3KJP A;  3S1M B;  1EL0 A;  1PFB A;  1A0I A;  2VS1 A;  1OXX K;  2KCT A;  4JI2 Q;  3GQB A;  2ATW A;  3MHB A;  3BYT B;  4YCW A;  1FR3 A;  4RHR A;  4PMC A;  3GTG B;  5HY6 A;  1ML0 D;  4IUR A;  3A54 A;  4XIG S;  4FF2 A;  2L4N A;  3CCJ A;  1AZP A;  4CDD C;  4FF1 A;  5COY A;  3RN5 A;  1VQN A;  4IUU A;  1YNN C;  1IZ6 A;  5KIX A;  2Z4I A;  2CW0 D;  2VUM G;  3MXP A;  4GKJ L;  1I4X A;  1YHB A;  2WKD A;  3T4A C;  4MNO A;  2JN4 A;  4Y52 H;  1XMQ L;  4IPG A;  5M5Y B;  2SNS A;  1MSG A;  1CI3 M;  2F0V A;  3E5S A;  4IUV A;  4GLX A;  2Y0S G;  3RLO A;  2HHH L;  3OHX C;  5G3L F;  1N36 Q;  4KTA A;  4HSV A;  3A8J E;  1E0B A;  2VQE L;  1G2S A;  2E74 C;  2NVY B;  4ME5 A;  1PH2 A;  2K5Q A;  4A3D H;  2PZW A;  1G51 A;  2F0Q A;  1D5Z C;  3VYT A;  4OWW B;  5C44 H;  1TQO A;  3TQY A;  4G7O C;  1UEA B;  1UAP A;  4C1N I;  1FJG Q;  1PA6 A;  3I4O A;  2DGY A;  2JXM B;  2R7F A;  1PZJ D;  1JB7 A;  2DN8 A;  2UU9 L;  3L2P A;  4KD3 A;  1Y8O B;  4HTH A;  3EBE A;  2MNA A;  1VQ8 A;  5FK9 C;  3HOU G;  4JBK A;  3K59 A;  2N8N A;  1ICW A;  1B53 A;  1HPC A;  1JC7 A;  4PMW A;  1GUT A;  3VR6 A;  1TR5 A;  1F2L A;  1QUQ B;  3BVG A;  1JE4 A;  4X64 L;  2PCF B;  3A8K E;  1UE5 A;  2J4X A;  2L5T A;  1LTB D;  1G91 A;  3ITP A;  3HFZ B;  3J81 E;  4JV5 Q;  3HKZ G;  3LWE A;  5KGU A;  4DNI A;  3CF5 A;  4A3L H;  2WFW A;  3H0G B;  4KHZ A;  4JOI A;  4DR1 Q;  2JA6 B;  3S9W A;  2XSC A;  3RLF A;  5GAH C;  4A3I G;  3E0J A;  1SND A;  1G8Z D;  4RHS A;  4ZKC B;  1FJG L;  2QKI C;  4XQQ A;  1X3G A;  2HCI A;  1MI2 A;  1L0Y B;  2ENB A;  1VQ7 A;  4HN7 A;  3I4N B;  1RKN A;  5KEE A;  2DNC A;  3CC7 A;  2HDM A;  3K58 A;  1G6Z A;  5C44 G;  1L0X B;  3P1H A;  5IIF A;  3IFD A;  1SDF A;  1GJX A;  3ULL A;  5LMN W;  2DJF C;  2E2J B;  2NVT H;  3PF5 A;  1S72 A;  1KTK A;  3CCU A;  3TP7 A;  4MN3 A;  1IW7 D;  1W6J A;  1H9S B;  1Y14 B;  4A3F B;  5I6Y A;  3CPF A;  4LMQ D;  5CV4 A;  2PI2 A;  2E2D C;  4EQO A;  4CDE C;  5IP7 G;  1CTM A;  2F0P A;  3BDO A;  1NUC A;  4F87 A;  4DV7 Q;  1IXR A;  4NKL A;  4JBM A;  5GQO A;  2OCE A;  2UXB Q;  3N52 A;  4OO1 G;  1KRS A;  4FNF A;  5EPK A;  4JOI C;  3MXG A;  1EOT A;  4R4Q A;  3SK4 A;  5C44 B;  1ICF B;  1SYE A;  4XYO A;  4NPS A;  2FXQ A;  1OXS C;  2KEN A;  2NN6 I;  3M7N A;  1CKN B;  1IYJ B;  3K7U C;  2NVY H;  2ASB A;  1TWF H;  1I4R A;  2XN9 C;  4KKU A;  1Q82 C;  5LL6 S;  5E1F A;  2P5Z X;  3CCR A;  5JEA G;  3F2B A;  2EXD A;  1VQJ A;  4RH6 A;  3D6C A;  4DV3 Q;  3PIP A;  4ILW A;  1RTN A;  4DK0 A;  4BBS B;  2L11 A;  2JA8 G;  4BBS G;  1ASY A;  2JA6 H;  1L1O B;  4DR3 L;  5BN4 A;  4GLA C;  3S2H B;  4H0L C;  1N33 L;  4JI5 L;  4WJW A;  4DV1 L;  1YHQ A;  1X55 A;  4JG2 A;  1HNW Q;  3TME A;  1JCK B;  2PI2 E;  2E5L L;  4FVM A;  5E3F A;  1YIT A;  2O5I C;  1KAB A;  1QG7 A;  3Q22 A;  1GUO A;  3VYU A;  5I9P A;  2NTT A;  3FPU B;  2DY8 A;  5HGT A;  4Q5V A;  3M4Y A;  3JAM c;  1WTO A;  4DKA C;  2F1M A;  2ZJR A;  1Y8P B;  4TRD A;  5HUR A;  1WTH A;  3H3V I;  1E7Z A;  2L9H A;  3W1B A;  2A6E D;  4JBW A;  4DV5 Q;  2E75 C;  5GAD C;  1BVS A;  1K9M C;  1PRT D;  1D1I A;  4EQP A;  3A5U A;  3T1Y L;  3V96 A;  1PH6 A;  1HZC A;  3QO2 A;  4HMI A;  4B9X A;  4IUN A;  2NBF A;  1VMC A;  2IWH A;  2YU9 B;  2IT1 A;  1QJO A;  4JI3 L;  3OOC A;  5EKL A;  4LF6 L;  1CQV A;  1Q46 A;  2NN6 G;  3VYR A;  1OXV A;  1GVP A;  4GOP B;  4CDC C;  3NQI A;  3GTL B;  1M90 C;  5C0X H;  2MJ8 A;  5IGD A;  5FLX c;  3RMH A;  1EWI A;  2D2C C;  5HGQ A;  3D6W A;  3S16 B;  3MFG A;  1A8V A;  4LF5 L;  4FDB A;  1RCV D; 
#chains in the Genus database with same CATH homology
 4K2L A;  1A3U A;  3J80 E;  5FO9 B;  1QB5 D;  4BS9 A;  1VF7 A;  3HS0 C;  1Z6H A;  3EFX D;  2HUG A;  2NWG A;  3O13 A;  1PTO C;  2K28 A;  1O78 A;  1EY8 A;  5K5P A;  1EY7 A;  1O80 A;  3H91 A;  3PUX A;  1W6K A;  2IL8 A;  2SNM A;  1KAA A;  1QNU A;  4HCS A;  4KMU C;  4CBV A;  3QB3 A;  2J0T D;  4Q0F A;  4FXG C;  1BNZ A;  2EY1 A;  1S5E D;  2HQE A;  1OXT A;  1K8O A;  1M4V A;  1ZXT A;  2V4D A;  1A3T A;  2G9D A;  3D8G A;  4PV1 C;  2XWB B;  3U9S A;  1Q8I A;  4G4K A;  4A3M B;  3K6O A;  1B50 A;  2EYJ A;  5KNC A;  3I4M B;  3QIA A;  4U67 3;  4CJ0 B;  2F0O A;  3K57 A;  1Q3L A;  1IKL A;  4H44 C;  5D3D A;  1A15 A;  1EY6 A;  4RGT A;  3W3A A;  3FKI B;  2F0T A;  2CQA A;  4M8A A;  4NMZ A;  4BWG B;  4CJ1 B;  1S5F D;  1S5C D;  3BZD B;  4K6D A;  2F0F A;  3S17 B;  1HA6 A;  1KNE A;  4DXF A;  4CKB A;  4DAY A;  2F0M A;  4KN7 C;  1SNM A;  4G57 A;  4I65 A;  3PUV A;  2IJ0 A;  5JEA J;  2A68 C;  2Z1C A;  3PIO 3;  3FVQ A;  2B2W C;  4C3I B;  3PUY A;  4KJO A;  2F3V A;  5I9O A;  3C2P A;  3ERO A;  2A69 D;  3D4D A;  5JJZ A;  2TSS A;  4WRD A;  3DM1 A;  1EZ6 A;  5EQ0 A;  1AZQ A;  4BA2 I;  2NVX B;  2X69 A;  1RD9 D;  1HXY D;  4K6L A;  2H4O A;  3MAQ A;  5I4D A;  2WAQ B;  5KNB A;  2KCN A;  3ZYY X;  5M3M B;  2M00 A;  2E2H B;  3DUZ A;  3BVZ A;  2R6G A;  1X32 A;  1B44 D;  5DAU A;  5ELD A;  5KYI A;  1Z47 A;  1EYC A;  3HOV B;  1OXU A;  3HOY B;  5DM6 3;  4BY7 B;  1ZYR C;  4L63 B;  3AMU A;  5C3E B;  5BN3 A;  1STB A;  2NB0 A;  4U68 A;  3X3N A;  2R3Z A;  4PQX A;  3A56 A;  4UAI A;  1IL8 A;  5CBE E;  1LAB A;  3R8B A;  5TSS A;  5C4J B;  1K8M A;  1HHV A;  1PFN A;  1TS4 A;  3K5O A;  5E4X A;  2IW3 A;  4B9W A;  5JVH 3;  2B2Y C;  3ND8 A;  5FLX E;  1T5X D;  1STY A;  5J39 A;  2B8F A;  1E2V A;  1B9N A;  1A2T A;  4ZLT F;  2EYL A;  3L3O C;  1FNW A;  4Z9C B;  4CKE A;  3I73 A;  1A2U A;  3MVV A;  2EDG A;  3H6M A;  3MFY A;  1S5D D;  3P20 A;  3R93 A;  3SE0 A;  4BA1 I;  1XTC D;  3KLS X;  3EA6 A;  3KLS A;  2HDL A;  3C3L A;  1NSN S;  1DYQ A;  3BS1 A;  3Q23 A;  3H3V C;  1F77 A;  3M7G A;  3C1E A;  3CRK C;  5CYU A;  2VNU D;  3HOZ B;  2ID0 A;  4IUT A;  2QCP X;  2EXZ A;  1ZKO A;  1WD1 A;  3SHL A;  3NTH A;  1IHZ A;  1QE6 A;  4A3G B;  4A3J B;  3A55 A;  4DNT B;  1DOK A;  2IPK D;  5CR3 A;  2RQX A;  5FKA C;  1AP0 A;  2K6A A;  3SK5 A;  3DEO A;  3A7L A;  4DF7 A;  1Y69 U;  3WOF A;  4CJ2 C;  2R93 B;  1SMY C;  1PRT F;  3I8Z A;  1EIG A;  2E2I B;  4DAV A;  4OIJ A;  1TU2 B;  4LAA A;  2ZXP A;  4A3E B;  1X3P A;  3E6Z X;  4QUF A;  4K5W A;  3LX0 A;  3RD4 A;  3R3O A;  2GA4 B;  1LTR D;  2K7V A;  4CHT B;  1JB3 A;  1Z7T A;  3T13 A;  4R8N A;  5K36 G;  4HR7 B;  4E6I A;  1FNU A;  4AYB B;  2KEE A;  2F0N A;  3GV3 A;  3NTI A;  1STA A;  5DNF A;  5T1G A;  4OIK A;  1AEX A;  1KNA A;  4V0B A;  2YYZ A;  2XNA C;  1JIC A;  4QF4 A;  1TS3 A;  2EZV A;  2F0D A;  4ZUI A;  5EPL A;  2B2T C;  2KQ3 A;  3IFT A;  1STG A;  4QMG A;  5A2Q L;  2KEC A;  1WTW A;  2WIN B;  4IN3 A;  4TQU S;  4FXD A;  2QDB A;  3EJI A;  4EGV A;  2PMZ B;  2JYO A;  1NCV A;  4IFD H;  1F9Q A;  2EJF C;  4IQZ A;  4KD4 A;  5M9O A;  1Q1B A;  1LO5 D;  1UUP A;  3HG9 A;  2JEA I;  4J8Q A;  1ENF A;  5BN5 A;  2PW5 A;  2E76 C;  3VR2 A;  2F0U A;  3DWQ A;  1BCP B;  3OWF A;  3PUZ A;  3D31 A;  3VYS A;  3MC0 B;  1R9T B;  2FHT A;  3UI2 A;  2BCO A;  3NBI A;  4KK7 A;  1EYD A;  4BBR B;  1CFM A;  1EYA A;  5M5W B;  1PLF A;  3QOL A;  4ZQ3 A;  3MTS A;  4OHJ A;  3K0Y A;  1RF2 D;  4HAE A;  4XT1 B;  3N6R A;  4DA2 A;  5IGG A;  4RGO S;  5A35 A;  1ET6 A;  3QJY A;  1HA5 A;  1PZK D;  1RDP D;  5LL6 X;  2VUM B;  1TWG B;  4LK1 C;  1BUV T;  2PPB C;  1KDC A;  2BA0 A;  3CKI B;  1PZI D;  1EY5 A;  4MIU A;  1H9K A;  1H9R A;  1SMY D;  1E2Z A;  2A6H D;  3TSS A;  4C1N K;  2JEB I;  3NTK A;  4XYQ A;  1I50 B;  2EYM A;  4EQN A;  5EBD A;  4XQN A;  3GTK B;  1CHQ D;  3S14 B;  1G29 1;  1O7Z A;  1TS5 A;  3TZD A;  2AUJ D;  3SDZ A;  5EPJ A;  3ND9 A;  2EVB A;  4L8J A;  1SE4 A;  1CA6 A;  2F0K A;  3FEW X;  3NHH A;  2F0S A;  5CBA E;  3U9O A;  1F9S A;  3QG1 A;  1KDB A;  3SXH A;  2BE5 D;  3V2T A;  4CKC A;  2MPM A;  3SK8 A;  1C48 A;  5CV9 A;  2G9H D;  2RDG A;  4C3J G;  4K14 A;  1BDO A;  5C3W A;  2PNR C;  2KED A;  4KY5 A;  2F0H A;  3SR1 A;  1TWC B;  2PO4 A;  2B39 A;  3TDQ A;  5I2Y A;  2EY6 A;  2KCC A;  3KBG A;  2K03 A;  3Q0A A;  5EKI A;  1ESR A;  1V1P B;  4LJZ C;  4XT3 B;  3J7A V;  1JOQ A;  1F9R A;  2K32 A;  1BQQ T;  4QIW B;  2J7Z A;  2FIN B;  5JOB A;  1U4R A;  2AQ2 B;  5IOD A;  2MGS A;  2C5C A;  4XQJ A;  2H1E A;  1GUW A;  3HKZ B;  3NUC A;  2BDN A;  2NN6 H;  1CA5 A;  2CVR A;  3W2D A;  2DY7 A;  1C4Q A;  1ZYR D;  2NVT B;  4HSP A;  3WOE A;  1ILQ A;  1SE3 A;  3BYY B;  2AWO A;  4RCO A;  1YNJ C;  4IZ8 A;  3TP6 A;  1EEI D;  4DAP A;  5D14 A;  4QCL A;  3MWY W;  1E2W A;  4X3K A;  3A8I E;  4QUC A;  3NP8 A;  5IGF A;  3S2D B;  4ZRZ A;  2KHS A;  2LMC B;  1ONL A;  3D3R A;  2KUM A;  3F2U A;  3KK7 A;  4CGY B;  3OSO A;  4X3S A;  3OIP A;  3M85 A;  4RCN A;  1I4G A;  5JVG 3;  5KRU A;  3URY A;  2IX1 A;  3K5L A;  2K5W A;  1SFO B;  1DZ1 A;  3IAY A;  4J6H A;  3BDC A;  1LTI D;  1TY0 A;  3PO3 B;  5ISR A;  4ID6 A;  4OO1 H;  1B2T A;  3HGB A;  2FFK B;  3MXU A;  4OO1 I;  4FF3 A;  1EEF D;  1GUG A;  1FYC A;  2EOT A;  1QIL A;  3P7J A;  4A3D B;  3K7A B;  4K5V A;  5I2X A;  5JPN C;  2C9O A;  2ZXO A;  1MD2 D;  2D62 A;  1PTO H;  4A3K B;  3I72 A;  5CV7 A;  5KYL A;  4UDU C;  1H9S A;  2PYK A;  1TY2 A;  1UNS A;  3BDL A;  4R8I A;  3TZU A;  2EY5 A;  3VA7 A;  3K5M A;  3IL8 A;  1WTV A;  4P2C B;  3DHQ A;  2XVS A;  2QF7 A;  1HFG A;  1DCZ A;  4NW2 A;  3FDT A;  1GUN A;  1CK1 A;  1D2B A;  1QCB D;  2JP1 A;  5CGK A;  4NP5 A;  4F8M A;  3Q6S A;  4A3I B;  1Q12 A;  4FYD A;  1F9P A;  2Z8L A;  3T56 B;  3VR5 A;  1AN8 A;  1SYB A;  5JEA H;  2F0G A;  5AFW A;  2XRQ D;  2OEO A;  1D1K A;  1S5B D;  4I7Z C;  4TSS A;  2EYF A;  4EVO A;  3H09 A;  3OIQ A;  2NTS A;  4RFB A;  1LTA D;  2B8G A;  2L0C A;  1IKM A;  4BY1 B;  1U4P A;  2K5D A;  5CV5 A;  2B2V C;  3VR4 A;  3EQL C;  2O5J C;  5C5L A;  1BF4 A;  2ZXR A;  1U9R A;  3SK6 A;  2OF1 A;  1ET9 A;  3NSW A;  1HTP A;  4OL7 A;  1LT6 D;  3S1N B;  2RSO A;  4GZY C;  2I46 A;  2MHV A;  1SBB B;  4DGZ A;  5COR A;  1HRJ A;  2PQE A;  1DOM A;  4ZUJ A;  2F3W A;  3GTP B;  1EU3 A;  3GTM B;  1I4Q A;  1PRT C;  4K8I A;  4NDX A;  1SNQ A;  4WFN 3;  3TP5 A;  1B9M A;  2Y0S B;  5CMD A;  2WII B;  1FGB D;  2EYP A;  1EY0 A;  3QOJ A;  1EWC A;  3FMC A;  2AWN A;  2PZT A;  2RDF A;  1JOK A;  1T5E A;  1AW7 A;  2B2U C;  1ESF A;  1EY4 A;  4YIJ A;  1VF5 C;  4A93 B;  3KUP A;  1U4L A;  3NWS A;  2XWJ B;  3QWN A;  1DM0 B;  1WVL A;  2CW0 C;  3PUW A;  1LT5 D;  3GV6 A;  2IX3 A;  5C0X I;  2TMP A;  2B63 B;  5C3X A;  5KND A;  2K1B A;  4IFD G;  3HOU B;  5JAV A;  5M3F B;  1STN A;  3TP8 A;  3C46 A;  1C8C A;  3VA5 A;  1R4P B;  3NK9 A;  2F03 A;  3HOX B;  5NUC A;  1M8A A;  1S4Z A;  4RKB A;  5I6W A;  2N55 A;  1PDQ A;  1ZEQ X;  1B3A A;  1JOO A;  4RWS C;  2M2L A;  1U4M A;  1CT1 D;  1EFI D;  1BO0 A;  3EVQ A;  2VXW A;  1SNP A;  3D4R A;  1PYW D;  3OWE B;  5IT9 E;  3HOW B;  5D65 A;  3R2T A;  1PRT B;  5C4Z A;  1JWM D;  1Y1W B;  1II3 A;  2IX0 A;  5C0X G;  3JAM L;  4Y7N B;  1G2T A;  1VDZ A;  4KJN A;  1BCP C;  2A6E C;  4ULL A;  2K04 A;  1V8Q A;  1CHP D;  1SJH D;  5EKK A;  4S3S A;  1O7L A;  3KLR A;  2Z4H A;  2EYO A;  2SDF A;  1SEB D;  1SSO A;  4G7H C;  1XX8 A;  2EJM A;  2JE6 I;  3MXN A;  2F0E A;  4XTC S;  1J9O A;  1TT2 A;  1GHJ A;  3GD7 A;  1EQV A;  2B2W A;  3WDN A;  2M9V A;  1WTR A;  2X6G A;  5E4W C;  4ZAI A;  4DXG A;  2D9U A;  5CC4 A;  4DK1 A;  3NXW A;  3NE5 B;  2MP1 A;  4V19 0;  1IYV A;  2O2L D;  4RKL A;  1GXD C;  2B2Y A;  1EU4 A;  1DXM A;  1HCZ A;  1NR4 A;  1NAP A;  1CQF A;  2NVQ B;  1VCI A;  1LAC A;  2A5H A;  2JA8 B;  2OT2 A;  4K8J A;  3Q24 A;  1XXG A;  4ODG A;  4ABN A;  2KA7 A;  4O42 A;  1MSH A;  5C0X J;  2A73 B;  3K5N A;  2KJX A;  4KV6 A;  1F2M A;  1NR2 A;  2FMC A;  2LY7 A;  3BVM A;  2Q8T A;  5IOC A;  3A7A B;  1RTO A;  2F0I A;  4KHV A;  2WAC A;  5ELE A;  2EJG C;  1F2Y A;  1SNC A;  3CQZ B;  3AU7 A;  1DON A;  2LFN A;  5IT9 L;  2XIW A;  1Q1E A;  2SOB A;  3HRZ C;  2O4X A;  3PIP 3;  1ENC A;  2I07 B;  1LT4 D;  2RDH A;  2PW7 A;  3MEH A;  3AB9 A;  1Y1V B;  4F7X A;  4ZKB B;  3MA2 B;  4C3I G;  4KN4 C;  4IUP A;  3I90 A;  2F4I A;  2R61 A;  1LTT D;  4N9P A;  3J80 L;  3S1R B;  1IW7 C;  5EBC A;  5EJW A;  3DWA A;  2DNE A;  4M1U B;  1CM9 A;  1BXT A;  3P75 A;  1D5M C;  5G3L D;  2BDO A;  2RBM A;  2EPB A;  1K83 B;  1KDA A;  3TBI B;  5FO8 B;  5EGT A;  3M4O B;  3RUZ A;  2EY2 A;  2F0J A;  3OMC A;  3DXJ C;  1SYC A;  1BOS A;  3DEP A;  3I91 A;  3L9A X;  1PXU A;  2L1B A;  3HEJ A;  4H13 C;  3IKJ A;  2D5D A;  3L7Z C;  4C3H B;  4HCE A;  2NUC A;  2MUY A;  4XXE A;  1JOR A;  4KY7 A;  1LTS D;  1I3Q B;  1WTP A;  3H94 A;  4DNR B;  4J1M A;  1PTO B;  1ROD A;  2A68 D;  4KKT A;  1ILP A;  4O1N A;  1WTX A;  4XDX A;  1KLG D;  2WP8 J;  3CU7 A;  5ELC A;  5C5M A;  3KF8 A;  3RZD B;  5FOB B;  5JPM C;  2A69 C;  1JQY D;  1V1P A;  3NBH A;  1XWE A;  2VB2 X;  2B2U A;  2BE5 C;  4RGM A;  4IAL A;  4C3H G;  3I3C A;  2NZ1 D;  2L12 A;  3OPO A;  1SJE D;  2ICE C;  1EIH A;  3TN2 A;  4DFA A;  3OW7 A;  4PMB A;  3VR3 A;  4KKS A;  1SYD A;  4ZYS A;  3JAM E;  1A3V A;  1KLU D;  4KY6 A;  4C56 C;  3LWU A;  1CZW A;  1HUN A;  3DMU A;  5IGB A;  1PTO F;  1V43 A;  3V05 A;  1LV9 A;  3FRP B;  4ZK9 B;  1PMR A;  1X3Q A;  1RHP A;  4TKO B;  2B2T A;  5C6A A;  1Y8N B;  1TKW B;  1EQT A;  2KOL A;  5DEH A;  4MHE A;  3X3M A;  2VB3 X;  5J22 A;  1PFM A;  3C1F A;  5C4H A;  4WOR A;  5A2Q E;  3CHB D;  3NWT A;  4KI0 A;  3I4L A;  4DU9 A;  2B2V A;  3J81 L;  5ELB A;  2F0L A;  1J8I A;  2PZU A;  4PNY A;  2WKC A;  5K36 H;  2A74 C;  1TII D;  2Q8R E;  4B08 A;  1TWF B;  4F88 A;  4HMJ A;  3GTO B;  1I4H A;  1PTO D;  4G7Z C;  1H9J A;  1H9M A;  1SAP A;  3HZX A;  4L6T B;  4RA8 A;  3OMG A;  2FJ2 A;  4FF4 A;  3GTJ B;  3SVM A;  2L55 A;  3SEB A;  1I4P A;  2SEB D;  3G6J B;  2AQ3 B;  2CHB D;  5DM7 3;  1LLR D;  2ICI A;  1JR0 D;  2HCC A;  1RJT A;  2BOS A;  3NQT A;  4JK1 C;  2QIL A;  5M5X B;  2RKS A;  2A6H C;  4RGN A;  4QB4 A;  3ERQ A;  3GTQ B;  1CZG A;  2R92 B;  2RSN A;  3D4W A;  1I6V C;  5J1Z A;  4HED A;  1D5X C;  1B1Z A;  4DN4 M;  1DJR D;  1GUS A;  1Q90 A;  1QWY A;  3T53 B;  1O7Y A;  4IFD I;  1LTG D;  1WCM B;  1QOH A;  3CRL C;  1D6E C;  4H7B A;  2EYH A;  1YNN D;  1ENA A;  2EE1 A;  1DD2 A;  2K01 A;  3I70 A;  5LHY 1;  3FPP A;  1MGS A;  5T1I A;  2JA7 B;  3T16 A;  3S1Q B;  2NYZ D;  1IYU A;  4RAU C;  2QEJ C;  4N9T A;  1FD7 D;  3RZO B;  5F2D A;  1JWU D;  3PV0 A;  5IGC A;  2K05 A;  1TS2 A;  5ELF A;  2LS0 1;  2WV6 D;  1SYG A;  3R2I A;  5CV6 A;  1V1O A;  3J7A F;  1A6X A;  1TVX A;  2WB1 B;  2ZT9 C;  4C2M B;  1XYI A;  3ONA B;  1TWA B;  1EZ8 A;  2LKV A;  3GP7 A;  2OXP A;  2JSO A;  2RVL A;  4FO2 A;  3PMF A;  1STE A;  1SYF A;  5FLX L;  1HQM C;  2AQ1 B;  1AFP A;  1HUM A;  2BA1 A;  2FMM A;  2RA4 A;  5CV8 A;  1QNK A;  1YNJ D;  2JA5 B;  1BR9 A;  2R7Z B;  1TWH B;  1FNV A;  2KVM A;  1BCP F;  1HQR D;  4IFD J;  3MZ5 A;  3S15 B;  1MBY A;  3DWP A;  3T51 B;  5D3I B;  1OO9 B;  5IGE A;  1VMP A;  1STH A;  1R4Q B;  2AUK A;  1LT3 D;  2X6L A;  4FP5 D;  2Q8I B;  1I6H B;  4C3J B;  4FXK C;  1WD0 A;  1GOZ A;  1EWH A;  1HTL D;  4A3B B;  1BBX C;  4OGQ C;  1SXT A;  2XRS D;  3NPP A;  2N88 A;  1HFN A;  1WTQ A;  5FO7 B;  4K5X A;  4X3T A;  3PO2 B;  1EY9 A;  4X3U A;  2F0W A;  1GHK A;  1DOL A;  3G7L A;  5C4X B;  4IUQ A;  3BG3 A;  2K33 A;  1SNO A;  1JWS D;  3J7Y W;  4R9W A;  1SE2 A;  1BCP D;  1F2Z A;  3HP3 A;  3GO5 A;  3M3Y B;  3LNN A;  3KBX A;  1B4O A;  3S1M B;  1EL0 A;  1PFB A;  1OXX K;  3GQB A;  3MHB A;  3BYT B;  1FR3 A;  4RHR A;  4PMC A;  3GTG B;  1ML0 D;  4IUR A;  3A54 A;  4XIG S;  4FF2 A;  2L4N A;  1AZP A;  4FF1 A;  5COY A;  4IUU A;  1YNN C;  5KIX A;  2Z4I A;  2CW0 D;  3MXP A;  1I4X A;  2WKD A;  3T4A C;  5M5Y B;  2SNS A;  1MSG A;  1CI3 M;  2F0V A;  3E5S A;  4IUV A;  3OHX C;  5G3L F;  4KTA A;  4HSV A;  3A8J E;  1E0B A;  1G2S A;  2E74 C;  2NVY B;  4ME5 A;  2K5Q A;  2PZW A;  2F0Q A;  1D5Z C;  3VYT A;  1TQO A;  4G7O C;  1UEA B;  1UAP A;  4C1N I;  2JXM B;  1PZJ D;  2DN8 A;  4KD3 A;  1Y8O B;  4HTH A;  5FK9 C;  3K59 A;  1ICW A;  1B53 A;  1HPC A;  1JC7 A;  4PMW A;  1GUT A;  3VR6 A;  1TR5 A;  1F2L A;  3BVG A;  1JE4 A;  2PCF B;  3A8K E;  2J4X A;  2L5T A;  1LTB D;  1G91 A;  3ITP A;  3J81 E;  3LWE A;  5KGU A;  3H0G B;  4KHZ A;  2JA6 B;  3S9W A;  2XSC A;  3RLF A;  3E0J A;  1SND A;  1G8Z D;  4RHS A;  4ZKC B;  2QKI C;  4XQQ A;  2HCI A;  1MI2 A;  1L0Y B;  2ENB A;  4HN7 A;  3I4N B;  1RKN A;  5KEE A;  2DNC A;  2HDM A;  3K58 A;  1G6Z A;  1L0X B;  3P1H A;  5IIF A;  3IFD A;  1SDF A;  1GJX A;  2E2J B;  1KTK A;  3TP7 A;  4MN3 A;  1IW7 D;  1W6J A;  1H9S B;  4A3F B;  5I6Y A;  5CV4 A;  4LMQ D;  2E2D C;  4EQO A;  1CTM A;  2F0P A;  3BDO A;  1NUC A;  4F87 A;  4NKL A;  3N52 A;  4OO1 G;  4FNF A;  5EPK A;  3MXG A;  1EOT A;  3SK4 A;  5C44 B;  1SYE A;  4XYO A;  1OXS C;  2NN6 I;  3M7N A;  1I4R A;  2XN9 C;  4KKU A;  5LL6 S;  5E1F A;  5JEA G;  4RH6 A;  3D6C A;  4BBS B;  4ILW A;  1RTN A;  4DK0 A;  2L11 A;  5BN4 A;  3S2H B;  4H0L C;  4WJW A;  3TME A;  1JCK B;  4FVM A;  5E3F A;  2O5I C;  1KAB A;  1QG7 A;  3Q22 A;  1GUO A;  3VYU A;  5I9P A;  2NTT A;  3FPU B;  2DY8 A;  5HGT A;  4Q5V A;  3M4Y A;  1WTO A;  2F1M A;  1Y8P B;  4TRD A;  5HUR A;  2L9H A;  2A6E D;  4JBW A;  2E75 C;  1PRT D;  1D1I A;  4EQP A;  3V96 A;  3QO2 A;  4HMI A;  4B9X A;  4IUN A;  2NBF A;  1VMC A;  2IWH A;  2YU9 B;  2IT1 A;  1QJO A;  3OOC A;  5EKL A;  1CQV A;  2NN6 G;  3VYR A;  1OXV A;  3NQI A;  3GTL B;  5C0X H;  2MJ8 A;  5IGD A;  3RMH A;  2D2C C;  3D6W A;  3S16 B;  3MFG A;  4K2K A;  1RCV D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...