1YVCA

Solution structure of the conserved protein from the gene locus mmp0076 of methanococcus maripaludis. northeast structural genomics target mrr5.
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
70
structure length
70
Chain Sequence
MAFGKPAMKNVPVEAGKEYEVTIEDMGKGGDGIARIDGFVVFVPNAEKGSVINVKVTAVKEKFAFAERVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
source organism Methanococcus maripaludis
molecule tags Structural genomics, unknown function
molecule keywords MrR5
total genus 10
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2005-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01938 TRAM TRAM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1yvcA00
1FJGL 2HIXA 5IT9c 5IE8A 3BJUA 1L0WA 3S24A 4QGUA 2R92H 1JJGA 4NXNL 1IL2A 2AWOA 4QY7A 4O0AA 1PH3A 1PYSB 2YTYA 4PG3A 4GNXB 4GNXC 4DR7Q 1YHAA 4FDBA 4APVA 3ULJA 2E2IH 5GAGC 3UE1A 4X66L 1S72A 1I94Q 1IBLL 4MTNA 2UUBQ 2A8VA 3GTPH 3RZDH 1QVCA 4X6AH 4R4OA 5M3MG 5C0XI 2BH2A 2AKWB 4J15A 4A3DH 2Z0SA 1X56A 3RLOA 4BY1H 4NXNQ 4DR2Q 3PCOB 4OXPA 1MKHA 2OCEA 2WP8J 4DV6L 4QQBX 2UUAL 4X62L 4NXML 4IO9A 4A3CH 1WYDA 3D31A 5C44G 2K14A 3BU2A 4YWLA 4X66Q 4R1JA 1CSQA 1J5EL 1KXLA 2Q2UA 3RNUA 2E2JH 4IFDI 2K5HA 1NY4A 1K3RA 3I4MH 3HOWG 3M4QA 2VW9A 5J3BA 4B3MQ 4DV0Q 3HKSA 2V1CC 2MO0A 3KF8B 3NEMA 1Q46A 3I4NG 2F3IA 4A3DG 3KF6A 2B29A 3KDFB 3GTMH 5BR8L 1IXRA 2YV5A 4YWKA 4L5QA 2JA9A 2VQEL 4OX9Q 1X9NA 1YI2A 5LMNL 3PIOA 1HZ9A 2ZJPA 1N34L 3CCRA 2OQ0A 3MXNB 2NVXH 1SROA 2K50A 5HGQA 1X3FA 3RLFA 5FLMH 4P74A 2JA5G 1HR0L 2NN6I 4JI4L 2WB1G 3CPFA 4IPHA 1V43A 1YJNA 2IT1A 1PA6A 5C3EG 2JA6G 4A3BH 4WJ3M 3OYYA 3CCVA 1VQMA 1UE1A 4K0KL 3PUVA 3Q8DA 3F2CA 4DV4Q 2E5LQ 3IRBA 4GN4B 3GTKH 2MNAA 4A3EH 4A3CG 2ASBA 2Y0SE 1MJEA 2EQSA 2ZM6L 2E8GA 1RIPA 3H3VH 5C3EH 5IYCH 4UP8A 1OXVA 3KJOA 3M85A 2ATWA 2Y0SG 5EAYA 1XPRA 4X62Q 1KQSA 4JBMA 1HZAA 3HOVG 3H3VI 3PIPA 4IJLA 4HIOA 1SRUA 3PUZA 3HOUG 1SE8A 2YYZA 4B3RL 1UE6A 5M3FG 4AQYL 4YCUA 1PH9A 4A3LH 4JI2L 2ZJQA 5E7NA 1AE3A 1Q86C 5DLQE 3F2DA 3RN5A 2PNHA 4HIMA 1KD1C 2VUMG 2N3SA 1VQGA 2MQHA 4IJHA 3AQQA 1NJIC 3ULPA 3H0GG 2YU9H 4B3SL 4JI1Q 4GS3A 1N33Q 3S1NH 1N8RC 3T1YQ 1EOVA 3CMEA 1V1QA 4QIWE 1CKMA 2UUAQ 3S1RH 4A3BG 1PH5A 4GNXA 4DR1Q 1XNQQ 4GKKQ 4LWCA 4OWTB 1Q7YC 1PFSA 3S14H 5JJIA 1Y1WH 4IOAA 3DM3A 4A3EG 1XMOL 5M5YH 2OQKA 2JA8G 1YEZA 2HHHQ 1VQ5A 3K80C 2I5LX 4JV5Q 3G4SA 4DR3L 1GO3E 5FJ8G 2IHFA 5M3MH 2A19A 3ZJYC 2VNUD 2NVYH 1PH8A 3RN2A 2N49A 4JI3Q 1FJGQ 1GM5A 2HT1A 1XNQL 3I4NH 2ZM6Q 1Q1EA 4BBSG 5IP9G 4NPSA 4HJ5A 5BR8Q 4R4QA 2C35B 4IFDG 1CKOA 3AFPA 4B3TQ 1KC8C 1VQBA 2D0PA 1IBMQ 4QJFA 4DAMA 2RCNA 3U50C 1YNXA 1XJVA 1N9WA 1XMQL 4PZ6A 4DR3Q 3GD7A 4DV2L 4L5SA 2RF4A 4JI4Q 4LUZA 1WCMG 5HY6A 3LGJA 3A5ZB 3I55A 4DUZQ 4JI2Q 2R7ZH 2R93G 3HKZG 1WI5A 3TREA 5C0XJ 3KYHC 4DV6Q 1JJCB 1Z9FA 4OX9L 1YHQA 3NENA 4BA1I 2H5XA 4DPGA 4HJ8A 3RZOH 2EIFA 4JI1L 1XMQQ 4LF7Q 4A3FH 1X55A 1PH1A 2UXDQ 4DV1Q 1Q12A 4POFA 2DUDA 2LSSA 4O2DA 4BXXG 3CCSA 2N78A 4X64L 1XPUA 3U4VA 5FLMG 4LFBL 1LYLA 4R4IA 4LUOA 1PH4A 2PQAB 4LF4L 1OXTA 1PH7A 1D7QA 2K4KA 4DV4L 1K0RA 1Y14B 4H02A 1C9OA 4AQYQ 4UP9A 1V9PA 4DUYL 3GTQH 5IP9H 2OWOA 3PO2G 4A3GG 4DR4Q 1VCIA 4DV5Q 2ZTCA 3I7FA 4DK3C 2VQFQ 4DV1L 1Z47A 4GN3B 1C0AA 3K7UC 4YWMA 1LUZA 3RLNA 5IWAL 1Q81C 1YITA 2A1AA 1JJ2A 3BZKA 2KENA 5JJKA 3U4ZA 4OWWB 1JB7A 2NZHA 4RMFA 4KI0A 5GADC 3HOXH 1VQ7A 4HJ9A 5IYBH 3I4MG 3T1HQ 4WJ4A 4LF8Q 3OTOQ 1VQFA 1HNZL 2R92G 3PUYA 1VQCA 1B70B 5M3FH 4DR4L 1UWVA 4A93G 1QZGA 2R7ZG 1X3EA 4B3TL 2R93H 2B3GA 2I5MX 1PHJA 2AMCB 2Q2IA 2NN6G 2K75A 3AFQA 4RG1A 4PMWA 3VDYA 1AH9A 1L2FA 3SGIA 1CSPA 3HOZH 1VQAA 5M5XH 3F8TA 1KAWA 1BKBA 4C2MH 4Y7NH 4DV7L 3F1ZA 2Z6KA 4BY7H 2NZOA 1L1OA 3PUXA 2QEXA 1S40A 4C3IH 3HOXG 4OO1I 5K36G 2DGYA 3GDEA 1NTGA 4DR6L 2JEBI 1VQNA 1EIYB 1QZHA 3FHWA 1EIFA 2CKZB 3PSIA 4JYAQ 4C3JH 4LFBQ 3PF5A 2VZAA 1UE5A 3WWVA 1TWGH 1P16A 1E1TA 5AJ3Q 1N36Q 1EWIA 3PV0A 1VQ4A 4JBJA 1A63A 1VQ8A 2Q2HA 1HJPA 2OTJA 3HKZE 4YHHQ 4P72A 2ZTEA 4AIMA 1CKNA 3T1YL 4IPDA 4Y52H 4JI6L 2GVAA 2UUCL 3PO2H 3TRZA 4A3GH 2MO1A 4PZ7A 4DUYQ 1E1OA 4JI8L 3CC2A 4UP7A 4IPGA 5C44H 4HIKA 3UDGA 3KF6B 4C3HH 5IP7H 1L1OB 1KHIA 1L1OC 1X3GA 1U5KA 3BZCA 4JI5L 4A3KG 1I94L 1K83H 3K7AH 2UUBL 3GTLH 3JAMi 1R9TH 3OTOL 4TVAB 3GO5A 3CAMA 3A0JA 1ASZA 3A5UA 5IYDG 4JI0L 3GTOH 2HIVA 3K81C 5ELNA 3T1HL 2YTVA 1VQKA 2JA5H 3EN2A 5LMNW 3U58A 1HNZQ 4NXMQ 1VQEA 4JI8Q 2KHJA 3FKIG 1OXSC 4HJAA 1TWAH 5GAEC 1BBUA 2IHEA 4YCWA 1KIXA 1FGUA 3HOVH 1IBLQ 1HR0W 4X65L 2CWPA 3J80i 4X64Q 2XGTA 4JCVE 4JOIC 4A3JG 4DAYB 4JBKA 1XNRQ 4A3IG 1EFWA 1WOCA 4GKJL 2R7DA 1FL0A 2GVBA 3W1BA 4JI0Q 3TS2A 2PMZE 4EQ5A 4GN5A 1ASYA 3S1MH 4LF9Q 1A8VA 1HH2P 1DGSA 1YIJA 1GVPA 1VQJA 1CKNB 1G291 1M90C 1J5EQ 3RR5A 4BXXH 1YBYA 2BA1A 4XTCS 3CCLA 1CUKA 5LMUQ 2ES2A 1GD7A 1HZCA 5GQOA 3CPWA 5LMNQ 1PH6A 4AYBG 1IYJB 1M1KC 4R4CA 3NBHB 4QL5A 5IP7G 1VQ9A 4ME3A 3CF5A 2R6GA 2NVTH 1HR0Q 2UUCQ 4LFCL 4A75A 1AE2A 2WFWA 1K9MC 4JG2A 2QA4A 1H95A 1JT8A 1BBWA 3J7ZC 3JAMc 1XPOA 4JI7L 4ALPA 3L2PA 2ZJRA 1E3PA 3ICEA 3CC7A 2E5LL 4K0KQ 3I2ZA 2Z6KC 1Y1VH 1E22A 3DLLA 3UDFA 3W5OA 2IY5B 1T9HA 3I4OA 3STBC 1HZBA 4OO1G 3CCEA 3TS0A 1TWHH 1E7ZA 1VQIA 3M4PA 4DV7Q 3HOYH 2RHSB 3KJPA 1S3OA 2KCMA 5IY0A 1VQDA 1N32L 2UXCQ 5ELOA 4YCVA 2KHIA 3L0OA 2GN5A 1MJCA 3E9IA 3M4OH 4B3RQ 3FKIH 2B63H 3HOWH 1GKHA 3GTJH 1XNRL 4AH6A 4KLKA 1JE5A 4GKJQ 4JBWA 2CFMA 2JK8A 1Y1VG 1Q1BA 5C4JH 4R4TA 1Y1WG 1YJ9A 2UU9L 4LF6Q 1I50H 4MZ9A 5AJ3L 3A74A 3KDFA 1N34Q 2D62A 2JJQA 1N32Q 1HNXL 5FLXc 3G48A 2BH8A 3M7NA 1X54A 2N8NA 4GLXA 4A4IA 2VY3A 2IX0A 2F52A 3H15A 2JA7G 3HOZG 3PGZA 5M5WH 5H1SE 2K52A 4DV3L 5IYBG 1I6HH 4A3LG 1I5FA 1NE3A 4LUVA 4IPCA 4JI5Q 2B63G 5JJLA 1PYBA 1O7IA 4GLVB 4KHZA 4LW1A 4X65Q 1W2BA 1X6OA 3S15H 1PVOA 2FXQA 1Q8KA 4A93H 2R7FA 3CCQA 4DUZL 1B8AA 4AYBE 4LF5Q 4OWXB 4A3IH 3M9BA 3AEVA 4POGA 4TQUS 4JOIA 3HOYG 1TXYA 3UDIA 3PF4A 1G51A 3CMAA 4IOCA 2F4VQ 4P71A 1XTDA 1OTCA 4JI7Q 1KRSA 1RL2A 2CCZA 4LF7L 4LFAQ 4KHPQ 2IX1A 2E2HH 1HNWL 3E9HA 1XMOQ 1NMFA 4BY7G 3G71A 1IBML 3CXCA 1SN8A 2UXBQ 1EYGA 2MFIA 2PI2E 1LM0A 2D0OA 5GAHC 2I5HA 2YTXA 2Q2TA 4OONA 3CCUA 3KOJA 3FP9A 3CD6A 3GTGH 3M3YH 3PO3G 1YZ6A 4A3FG 3CP0A 1PV4A 4DV2Q 2PQAA 4B3SQ 1VQLA 4A3KH 1N33L 5IYCG 2ALYB 1HNWQ 3S17H 2EXDA 3D0FA 3NELA 2VUMH 1LTLA 2LXJA 5LMUL 4NB3A 3EIVA 3ERSX 4DR1L 2JQOA 4A3JH 5IWAQ 3J81i 2LXKA 1PH2A 4DR5L 4GKKL 1Q82C 2UXBL 1KL9A 2OTLA 1A62A 4DV0L 2UXDL 3JC66 3UE0A 1YJWA 1WJJA 3AYHB 1NMGA 3PUWA 4YY3Q 4LFCQ 4GOPA 4LNQA 1C7YA 3CCMA 4A76A 4JC0A 1J6QA 1EUJA 1WCMH 4A3MG 4DV3Q 2WAQE 2QGQA 3CQZH 1VQ6A 1W3SA 4DR7L 4P73A 4JI3L 1VQPA 1YVCA 4LF9L 1BVSA 3J7A5 3B6YA 3J80c 2PI2A 1SR3A 1TWCH 3K0XA 3W1GA 4BA2I 2WAQG 3J81j 2XTIA 4P75A 5FJ8H 2VQFL 4UY8C 5C4XG 2HQLA 4BBRG 3I56A 5JEAG 3ER0A 5GROA 4BY1G 4BBSH 4LF5L 1QUQB 3CW2C 4B3ML 2ID0A 3UDXA 3STBD 4DR2L 3E0EA 3ULLA 3EBEA 4HJ7A 3S16H 3PO3H 3KFUA 1K8GA 4LF8L 3KLWA 3L7ZC 3CC4A 1SLJA 2BA0A 1QVGA 3CCJA 4GOPB 4GOPC 2JA7H 4JYAL 2L15A 4A3MH 1FVIA 1EQQA 4IFDJ 1SMXA 1JMCA 4XIGS 2KBNA 2UU9Q 4LF6L 1NBWA 3HFZB 3S2HH 1IZ6A 1N36L 2ZTDA 4L5TA 4DNIA 4MNOA 4L5RC 4YHHL 2JA6H 2K5VA 3J81c 1K8AC 3S1QH 1P8LA 2JEAI 2AHOB 1YHBA 4LF4Q 2UXCL 2JA8H 2CQOA 1B7YB 5C0XG 4DR5Q 5JEAJ 3HOUH 1KRTA 2VQEQ 2VS1A 2NVQH 4LFAL 1X65A 2AWNA 5IYDH 4HIDA 1UE7A 1TWFH 3K8AA 1VS0A 4YY3L 1IBKQ 4DV5L 3TEHB 1OXUA 1A0IA 2KCTA 2JE6I 4PZ8A 4EX5A 4BBRH 1UEBA 2CWAA 1VQOA 4DR6Q 2F4VL 1QUQA 2WB1E 1EQRA 1D8LA 1OXXK 3OW2A 3TQYA 1HNXQ 1WFQA 3S2DH 1VQHA 4KHPL 2K5NA 1G6PA 4JI6Q 3F2BA 2RHQB 1I3QH 1U0LA 1SFOH 1E24A 2VL6A 2HHHL 1K73C 1IBKL 3G6EA 4JV5L 5C4XH 1MIUA 4UPAA 1QVFA 4DK6C 3MEFA 3H0GH 4DKAC 2I0QA 4GLAC
chains in the Genus database with same CATH superfamily
5EKIA 1FJGL 2HIXA 3AB9A 5C4XB 4F88A 5IE8A 2A6HC 1BBXC 1IL2A 4QY7A 5KNDA 1PH3A 1PYSB 2NVXB 2E2IH 5GAGC 3UE1A 1S72A 1I94Q 1PFMA 4MTNA 2A8VA 1G2SA 2ICEC 5M3MG 1IW7C 4J15A 2Z0SA 1S5DD 4B9XA 4DR2Q 1L0YB 2Z4IA 3KBXA 3M3YB 5C44G 1EYDA 1H9KA 4X66Q 2KOLA 1J5EL 2Q2UA 3RNUA 2IWHA 1NY4A 2VW9A 5J3BA 4UAIA 2V1CC 1LT4D 2RCFA 3NEMA 3EFXD 5CV6A 5BR8L 2LMCB 4YWKA 4OX9Q 4J8QA 4DN4M 2EY6A 2FFKB 2ZJPA 2NTTA 3CCRA 3MXNB 2NVXH 1SROA 4KK7A 5HGQA 3RLFA 2Z4HA 2BDNA 1HR0L 1SNDA 2WB1G 4IPHA 1B2TA 4R8NA 3NXWA 2ZXOA 5C3EG 1TS2A 2WV6D 3SEBA 4K0KL 4DV4Q 2F0SA 3F2CA 2E5LQ 3IRBA 2ZM6L 1VF7A 1RIPA 1R9TB 5C3EH 5IYCH 1OXVA 3TZDA 1V1OA 2Y0SG 5EAYA 1XPRA 1KQSA 4JBMA 3HOVG 5CV8A 4ZUJA 3H3VI 4HIOA 1SRUA 1VDZA 3PUZA 5C0XH 2YYZA 4EGVA 1UE6A 5M3FG 4JI2L 2L5TA 1STHA 5DLQE 5EKKA 3TSSA 1VQGA 4IJHA 3J80E 2YU9H 2X6LA 2K33A 2QCPX 3TP5A 1T5EA 2NVYB 3DUZA 3NUCA 2UUAQ 4HAEA 1SYGA 1PH5A 4A3BG 2RA4A 4DR1Q 4BWGB 4IOAA 1NR2A 1PFBA 4OIKA 5IT9L 3K80C 5FJ8G 2IHFA 5M3MH 3P20A 2F0NA 2DNCA 2N49A 2HT1A 3NP8A 2ZM6Q 5IP9G 4NPSA 4IFDG 1DONA 3E5SA 2D0PA 4QJFA 4DAMA 2RCNA 3OSOA 2Y0SB 3R2TA 5DNFA 4PZ6A 5JPMC 1QJOA 3IFTA 4DV2L 3NQTA 1EQVA 4A3FB 1Y69U 1TR5A 5HY6A 2A68C 3I55A 4JI2Q 4NDXA 3KYHC 1XWEA 3FKIB 5FLXL 1ZYRD 4OX9L 5C3EB 1PZID 4HJ8A 2F3WA 3RZOH 2DY7A 2EIFA 2ENBA 5EPJA 4A3FH 1W6KA 2UXDQ 1Q12A 2DUDA 2K01A 1LTBD 4BXXG 2N78A 3QR8A 1Z6HA 3U4VA 2B2YA 4A3KB 4LUOA 4B08A 1PH7A 1Y8OB 4PMBA 4DV4L 1QNUA 1B53A 4IUNA 4UP9A 4DUYL 2OWOA 4DR4Q 1G2TA 1GUWA 3I7FA 1SE3A 1ENCA 4DK0A 1U4MA 5I9PA 1C8CA 5JJKA 3BZKA 2KENA 3CHBD 4OWWB 2Z9HA 5GADC 1VQ7A 5IYBH 4LF8Q 4CKCA 3D4WA 3J81L 1QZGA 2R93H 4B3TL 5AFWA 1SNQA 2I5MX 2AMCB 2NN6G 3DHQA 5M3MB 3AFQA 3H09A 5C6AA 4ABNA 1AH9A 1LTTD 3T53B 1UUPA 2L4NA 3HOZH 1ILPA 3MVVA 3KF8A 1VMCA 4C2MH 4DV7L 3F1ZA 1CI3M 2KVMA 4C3IH 4EQOA 3HOXG 5K36G 2DGYA 2PZWA 3GDEA 1Y8NB 2JEBI 1JC7A 2A69C 2EYJA 1EIFA 1EIGA 3PSIA 3EVQA 1ZXTA 4MN3A 5G3LD 5AJ3Q 1N36Q 1EWIA 3PV0A 4N8X1 2F0EA 2OTJA 2ZTEA 1CKNA 3HOYB 4IPDA 4JI6L 2J4XA 2GVAA 4A3GH 4RFBA 5C4JB 2MO1A 4PZ7A 1EY0A 4UP7A 5C44H 1LT3D 2EYPA 3UDGA 3KF6B 4C3HH 5IP7H 1L1OB 4A3KG 3BZCA 3M7NA 4DR6L 3K7AH 3GTLH 5EPKA 3N6RA 3OTOL 4TVAB 5M9OA 1JORA 3QO2A 1LT5D 1O78A 1S5BD 2HIVA 2XN9C 3K81C 1JOOA 2WINB 3U58A 4ZRZA 1HNZQ 5JVG3 1VQEA 4JI8Q 2KHJA 3FKIG 4QUFA 1OXSC 1BBUA 4X3UA 1HR0W 3C1EA 4G7OC 4QF4A 2CWPA 2B8GA 1XNRQ 4DAYB 1EFWA 1V1PB 3FVQA 2F0KA 4LF9Q 2FMMA 3HZXA 2O4XA 3QOJA 3RR5A 2AUJD 3G6JB 2G9HD 2Z6BA 5GQOA 4L8JA 5EBCA 3K5NA 4OEMB 2NTSA 4QL5A 1VQ9A 4ME3A 1EU3A 2R6GA 3QIAA 2UUCQ 2WFWA 4JG2A 4ZCKA 2F0HA 1JT8A 3FPUB 3L2PA 2Z6KC 3UDFA 2IY5B 3VYRA 1XX8A 2OT2A 4OO1G 2CH4A 3M4PA 4DV7Q 2RHSB 1PTOH 3GTOB 3RUZA 1S3OA 2O5IC 4KKSA 5ELOA 2KHIA 3M4OH 1FD7D 2EVBA 3D6CA 2SNMA 1GKHA 1ESFA 4AH6A 1JE5A 1RODA 4GKJQ 1GUOA 4DR6Q 5C4JH 1DCZA 1Y1WG 4M1UB 1X3QA 5AJ3L 1WTVA 2L9HA 5IODA 4YIJA 3A74A 3HEJA 3KDFA 4U673 3Q0AA 3D4DA 1U4LA 5FLXc 3G48A 4Y7NB 1PXUA 1KDAA 1X54A 3OMGA 4A4IA 2NVQB 1HRJA 4LMQD 2F52A 1TVXA 5M5WH 2F0IA 1EZ8A 1STEA 3AU7A 5CR3A 1I5FA 2EJGC 4RCOA 4JI5Q 4IPCA 5KGUA 2PMZB 1PYBA 1WTWA 4GZYC 2EYFA 5I4DA 2FXQA 4A93H 1GJXA 3CCQA 1F9RA 1XXGA 1QE6A 1B8AA 2R61A 4A3IH 4POGA 4JOIA 3HOYG 4IZ8A 3PF4A 3HOZB 4IOCA 4HTHA 1RL2A 4LF7L 4LFAQ 2E2HH 1XMOQ 3SXHA 4BY7G 3TDQA 1TS5A 1M8AA 1IBML 3OIPA 3CXCA 2UXBQ 1EYGA 3IAYA 3K57A 2YTXA 2Q2TA 3M3YH 3FP9A 1YZ6A 1DD2A 3I70A 3HOXB 4ME5A 1VQLA 4S3SA 2ALYB 5LHY1 4FVMA 4KTAA 2LXJA 1KNEA 3J81i 2E2DC 5IGDA 2RBMA 2K5DA 2PW7A 1NMGA 4LFCQ 4GOPA 2PYKA 1EUJA 2F0FA 4Q0FA 1WCMH 4CHTB 4A3MG 4DV3Q 2QGQA 2MGSA 4DR7L 2B2WA 4XQQA 2KECA 3J80c 1R4QB 1SR3A 3BYYB 3K0XA 3W1GA 2HQLA 4N9TA 4HSPA 4ID6A 4LF5L 1IL8A 3CW2C 5CC4A 4TKOB 2I07B 2K6AA 3PO3H 1CTMA 1K8GA 1F2ZA 4K5WA 3L7ZC 1SLJA 2G9DA 3CCJA 1WTHA 4GOPB 4WJWA 4JYAL 1FVIA 5JEAH 1EQQA 2HDMA 5M5YB 1EY5A 2AQ3B 1NBWA 4A3IB 3S2HH 1Z7TA 3ONAB 2XIWA 1KAAA 4YHHL 3J81c 1HQMC 1ICFB 1LO5D 2JEAI 2AHOB 2UXCL 4OHJA 2B39A 5JEAJ 2AWNA 5ELCA 1II3A 1TWFH 3K59A 4YY3L 1IBKQ 3TEHB 2KCTA 2ICIA 3S15B 5KNBA 2JE6I 1A3TA 3NE5B 4X3KA 2JA5B 1VQOA 2F4VL 5CV9A 1EQRA 1PZKD 4ZK9B 3OW7A 5C5MA 1ZKOA 2QKIC 1KNAA 1RKNA 2F0MA 2RHQB 1I3QH 2ZXRA 2VL6A 2HHHL 1K73C 4NP5A 4JV5L 3DWAA 1DXMA 1L0XB 3MEFA 1I6VC 4H7BA 3A55A 3K5OA 5IT9c 3J80L 2R92H 5IGCA 4A3BB 3K5LA 4NXNL 1I3QB 2AWOA 4FP5D 5HURA 4PG3A 4DR7Q 4GNXB 1TS3A 4FDBA 1GUSA 1A3VA 1CFMA 2C5CA 4XYQA 4X66L 1AN8A 1MGSA 3RZDH 1M4VA 4X6AH 4R4OA 3GTMB 1G6ZA 5C0XI 2BH2A 4NXNQ 3RLOA 1TWFB 4OXPA 1MKHA 2OCEA 3TMEA 3K58A 2UUAL 2XRSD 2Z8LA 4IO9A 4DF7A 1SNOA 3MXNA 2RSNA 2TMPA 1SYFA 4CDCC 4HMIA 2HUGA 4G7ZC 1CSQA 3V05A 1K3RA 3I4MH 3HOWG 1ZEQX 5CV4A 3M4QA 5EGTA 4B3MQ 3EROA 4KMUC 4R8IA 3I4NG 1Q46A 4A3DG 3NTIA 1IXRA 2YV5A 4KKTA 1YI2A 3A7AB 5LMNL 1BCPD 5COYA 3PIOA 2ZXPA 1N34L 1IYUA 4P74A 5KEEA 2H4OA 1QILA 5KYLA 5FLMH 2EYLA 2JA5G 3CPFA 4EVOA 1QWYA 4ILWA 4K5XA 1UE1A 3Q8DA 1UAPA 2MNAA 4A3EH 1GUNA 1WCMB 1WD1A 1FNVA 1BCPC 2E8GA 4JVZA 1SJED 4IUPA 4KY6A 4P2CB 1KABA 3KJOA 3M85A 3L9AX 1HZAA 1XYIA 3PIPA 4IJLA 2N55A 3PMFA 1CHQD 3VYSA 1KLGD 3HOUG 4ULLA 1LTAD 2B2TA 4A3LH 4DA2A 2ZJQA 3P1HA 3Q22A 1AE3A 3D6WA 1Q86C 3J7AF 3CRLC 2VUMG 4X3SA 1NUCA 2PZUA 3ULPA 2JA8B 1AEXA 4JI1Q 1N33Q 1FYCA 3K6OA 2Q8RE 3A56A 3SHLA 3T1YQ 3CMEA 5FOBB 3S1RH 2K5WA 1RD9D 1SDFA 4RAUC 1Q7YC 4F87A 1PFSA 1Y1WH 2E75C 1QB5D 5M5XB 2EYHA 4A3MB 1VQ5A 2I5LX 4FNFA 5L37A 2B2YC 4DR3L 2A19A 3ZJYC 2VNUD 5KIXA 3DM1A 1PH8A 3RN2A 4DFAA 1GM5A 1Q1EA 4HJ5A 2F3VA 1C4QA 3AFPA 1KC8C 1LTSD 5BN4A 1CA5A 2GA4B 2L11A 3LNNA 4IUVA 1TWCB 1F2MA 1TKWB 1XMQL 2EDGA 4DR3Q 2EY2A 2TSSA 1FR3A 3E6ZX 2KHSA 3MZ5A 4LUZA 2SDFA 3RMHA 3P75A 4DV6Q 1Z9FA 2HDLA 4N9PA 5FO9B 3NENA 1SXTA 2AQ2B 1XMQQ 3A7LA 1AW7A 2LSSA 3HRZC 4O2DA 3GTKB 1DJRD 4X64L 1LYLA 1YNND 1PH4A 2PQAB 5ELFA 3GV6A 4NMZA 3SDZA 1K0RA 5KRUA 1Y14B 2EJMA 4XT3B 2XRQD 3PO2G 1SEBD 1VCIA 4DV5Q 2ZTCA 4BBRB 3WOEA 4DK3C 2B2TC 1C0AA 2K32A 1LUZA 3RLNA 1JJ2A 2A1AA 3U4ZA 2EYOA 4KI0A 4C3IG 3HOXH 4HJ9A 4ODGA 1VQFA 1HNZL 1HTLD 5ISRA 3QOLA 1VQCA 2I46A 3NHHA 3KLSA 4PMCA 1PHJA 2E2JB 2F0GA 3DWQA 2K75A 2A6EC 3BDCA 3VDYA 1BO0A 4FXKC 5DEHA 3JAME 3MTSA 4KJNA 1KAWA 1GHKA 4IALA 1I4GA 1S40A 1SYEA 4A93B 1PLFA 3TP7A 4OO1I 1A2TA 1ML0D 1EIYB 2AQ1B 4NW2A 3FHWA 4OO1H 1R4PB 3TP8A 3D4RA 3J7YW 3ND8A 3GTLB 1TWGH 5K36H 1FNWA 1A63A 1RJTA 4RHSA 3T56B 2DN8A 4P72A 4Y52H 1EWCA 2L0CA 3PO2B 1QG7A 3PO2H 3QB3A 1E1OA 4JI8L 4CBVA 4IPGA 3OIQA 4HN7A 1KHIA 1X3GA 1EFID 5CV7A 4JI5L 1TQOA 1I94L 2B63B 3A5UA 1F77A 1PMRA 1PTOB 2K28A 3GTOH 3T1HL 5EJWA 2B8FA 4PQXA 1B1ZA 1TWAH 5HGTA 4YCWA 1KIXA 1IBLQ 1I4RA 5T1GA 3J80i 4IUQA 4V190 4X64Q 4A3JG 1WOCA 1Y8PB 4HEDA 1MD2D 2R7DA 3TS2A 4EQ5A 4GN5A 1ASYA 3S1MH 1A8VA 1DGSA 1VQJA 4JW0A 3KLSX 1J5EQ 4BXXH 1ZYRC 3EQLC 3CCLA 1CUKA 2ES2A 1STAA 1PH6A 4KD4A 1SJHD 1LTGD 2ZT9C 3ERQA 1IYJB 4AYBG 1M1KC 4LFCL 1I6HB 1JB3A 3BS1A 5M5WB 1H95A 1CM9A 4DAYA 2K04A 1XPOA 4JI7L 2E5LL 3WOFA 1Y1VH 4HSVA 1S5FD 3MAQA 2E76C 3CU7A 1T9HA 3I4OA 1HZBA 5EBDA 1E7ZA 1VQIA 3X3MA 2X6GA 2PO4A 4E6IA 4YCVA 3RZOB 3E0JA 3MC0B 3L0OA 3HOWH 4KY7A 1XNRL 3GTJH 5CMDA 1WTOA 4A3JB 4H44C 2CFMA 2JK8A 1Q1BA 2PW5A 4R4TA 4XDXA 1N34Q 4BY7B 1HNXL 1PRTF 1WTPA 2BH8A 3G7LA 2N8NA 2IX3A 5JOBA 2SEBD 2VY3A 1PRTB 4KY5A 3N52A 4ZKCB 1CHPD 4C3JG 5H1SE 2XNAC 1I6HH 4RKLA 2QILA 1BF4A 3S1QB 1KXLA 4GLVB 1W2BA 1PVOA 4DUZL 3D3RA 4O1NA 4LF5Q 3AEVA 5C3XA 1TY2A 3R93A 3BVZA 4I7AA 2F4VQ 2G5DA 1KTKA 4KHPQ 2X69A 1PTOD 4DNTB 3URYA 2AUKA 1DOKA 2KEDA 1I4HA 2MFIA 1LM0A 2OF1A 3FDTA 3GTGH 4OONA 3CCUA 2MHVA 2A74C 1STGA 2NZ1D 1WVLA 2PQAA 4LK1C 5IGGA 1N33L 2J7ZA 5IYCG 2VB2X 1HNWQ 1K28A 2F0TA 3I91A 3D0FA 3NELA 1LTLA 2D5DA 4BA2I 4FF3A 4DR1L 4A3JH 5IWAQ 2LXKA 3GTJB 4BBSB 2OTLA 3VR4A 1U4PA 1JR0D 2UXDL 2RQXA 3BDOA 3K7AB 3AYHB 3PUWA 4C1NI 2N88A 2DNEA 3SK4A 4LNQA 3VR5A 1J6QA 2RSOA 5CYUA 1VQ6A 1D1IA 1HQRD 1EEFD 3NPPA 3J7A5 1A6XA 2WKCA 2B2VC 1TWCH 5I6WA 5J22A 5FO7B 1UNSA 3ER0A 5GROA 4BY1G 2XSCA 4BBSH 4L6TB 4B3ML 3MFGA 3UDXA 3STBD 2QEJC 5DM63 3E0EA 3EBEA 1HA6A 2A6ED 3KFUA 1EYAA 2BA0A 3R2IA 4JPBW 1QVGA 4A3MH 2PZTA 1JMCA 1LT6D 1IZ6A 2ZTDA 5I9OA 3GTGB 2JA6H 1D5MC 2K5VA 2XVSA 4J1MA 3UI2A 1YHBA 2EY1A 2JA8H 5C0XG 2F0QA 1CK1A 1X65A 4PNYA 3K8AA 3E3XA 1TWAB 4H0LC 1A0IA 2CW0D 4TSSA 1WTQA 5I2XA 4EX5A 4I65A 5KNCA 2HQEA 4BBRH 2CWAA 2K5QA 1QUQA 2WB1E 3QJYA 4K2LA 3TQYA 2E2IB 1U4RA 2NBFA 1A3UA 4KHPL 1PYWD 2K5NA 5D3IB 1B9MA 3VA7A 3F2BA 1EY4A 1JE4A 3A8JE 2MP1A 1EOTA 3J81E 4UPAA 1QVFA 2HD3A 1TWHB 3H0GH 2L55A 4GLAC 1RTNA 1WD0A 1NSNS 1B3AA 5D14A 1TWGB 1KLUD 2YTYA 1MI2A 1LTRD 2M9VA 3TZUA 2VUMB 2UUBQ 3TBIB 3GTPH 2NYZD 4OL7A 1F2YA 3ZYYX 4CKEA 2AKWB 1X56A 3PCOB 3PQIA 2XWBB 4K2KA 4NXML 1WYDA 1X3PA 1LV9A 2K14A 3BU2A 4YWLA 3I4MB 4R1JA 4ZYSA 3VR6A 2K5HA 4DV0Q 3HKSA 1IW7D 2EYMA 2F3IA 5TSSA 2B29A 3KDFB 5IGBA 3GTMH 3J7AV 3K5MA 4C1NK 1NNXA 3I73A 3TP6A 2M2LA 1RDPD 5CBEE 2K50A 1X3FA 2NN6I 1WTRA 4JI4L 2PCFB 1V43A 1HUMA 2IT1A 1TT2A 4A3DB 4WJ3M 3MXPA 3OYYA 2F0PA 3HKZB 3PUVA 3GTKH 4A3CG 2PPBC 3NWTA 3OPOA 3M7GA 2R3ZA 3F2UA 4QUCA 1SSOA 4XQNA 1Q3LA 3EJIA 5DAUA 4DNRB 5JVH3 1QNKA 5JPNC 4IFDH 2JP1A 4FYDA 4MHEA 4B3RL 4QB4A 5E7NA 2F03A 3F2DA 3RN5A 2N3SA 3NK9A 2F0WA 1EU4A 3SK5A 4B3SL 2F0OA 3T16A 4FF1A 2WKDA 3S1NH 1EOVA 3JAML 1CKMA 4BS9A 4GKKQ 4CKBA 4LWCA 1D1KA 3S14H 5JJIA 4XYOA 4CDEC 5C3WA 2DJGC 4K6LA 4A3EG 1XMOL 2FMCA 1YEZA 1GO3E 5FLXE 1GUTA 4JI3Q 4RKBA 3I4NH 2A6HD 5M3FB 4BBSG 2JXMB 1CKOA 3W2DA 4B3TQ 3HOVB 1JOQA 1YNXA 1XJVA 1K0SA 1HTPA 4XXEA 3GD7A 3S16B 2RF4A 4DK1A 4JI4Q 3A5ZB 4DUZQ 4RCNA 2R93G 1VF5C 4WRDA 3GTQB 3HKZG 4DU9A 1S4ZA 1JJCB 1YHQA 4ZKBB 2H5XA 2MUYA 4DPGA 4WORA 4UHVA 4JI1L 3LWEA 4LF7Q 2SOBA 1X55A 3CCSA 1XPUA 5FLMG 4MTKA 2A68D 3VYTA 4LF4L 1D7QA 2K4KA 3HP3A 3T13A 1B4OA 1K8OA 1C9OA 1O7YA 3GTQH 4A3GG 2OXPA 3PIP3 5BN5A 2VQFQ 1V1PA 3CRKC 3V96A 4K8JA 3S17B 1Q81C 3U9SA 5FKAC 1BNZA 1PZJD 1JB7A 4RMFA 4WJ4A 3I4MG 3S14B 2B2WC 1JWSD 2CW0C 5M3FH 1B70B 5EKLA 2B2VA 3IL8A 2B3GA 2F1MA 3TN2A 4RGOS 2Q2IA 2A69D 2F0LA 3P7JA 5I2YA 4RG1A 4PMWA 3I90A 3SGIA 5J39A 4UDUC 1CSPA 3F8TA 3GV3A 4Y7NH 1PRTD 1UEAB 2Z6KA 3T4AC 2NZOA 4BY7H 2VXWA 3BYTB 3RZDB 3PO3B 1SNCA 5A2QE 1QZHA 1F9SA 3V2TA 4JYAQ 2JN4A 2VZAA 2KCCA 3SK8A 2Z1CA 3M4OB 1UE5A 3WWVA 3ND9A 4C3HB 1EZ6A 1VQ8A 2Q2HA 1HJPA 4AYBB 4HMJA 4YHHQ 4AIMA 5C4ZA 4A3GB 3TRZA 2DY8A 1SMYC 5IGEA 3CC2A 4HIKA 1J9OA 4FXDA 1L1OC 2RKSA 5F2DA 1K83H 3JAMi 4KV6A 5D3DA 3GO5A 1ASZA 4RHRA 4HCSA 4JI0L 1AZPA 2JA5H 1D5ZC 1VQKA 2YTVA 3NWSA 3EA6A 3EN2A 4LJZC 1BUVT 5GAEC 2IHEA 3BVGA 1FGUA 3HOVH 3BVMA 2XGTA 4JOIC 1JJGA 2IPKD 2GVBA 3W1BA 4JI0Q 5IGFA 3MA2B 1RCVD 1KDCA 1D6EC 3NTHA 1E2VA 3T51B 1G291 2KCNA 3S2HB 4XTCS 4BY1B 1HZCA 3CPWA 3NBHB 3S9WA 1IKLA 1HR0Q 2O5JC 1PTOF 1AE2A 1K9MC 1EL0A 1SYBA 1YNNC 1BBWA 3J7ZC 3JAMc 4K0KQ 1E3PA 1K8MA 3I2ZA 1OO9B 2EY5A 1O80A 3W5OA 1EWHA 5CBAE 3CCEA 3GTPB 5DM73 3HOYH 1STYA 4ZUIA 3KJPA 2A5HA 2L1BA 2KCMA 5IY0A 1VQDA 3SR1A 2UXCQ 1JICA 1RF2D 1TY0A 4K5VA 3FKIH 4XQJA 3Q24A 1DYQA 3VA5A 2R7ZB 1D2BA 1JWMD 3SE0A 4JBWA 4I7ZC 1F2LA 1YJ9A 4LF6Q 1I50H 4MZ9A 4C3IB 4L63B 2XWJB 1HA5A 2D62A 2MJ8A 4IUUA 4OELB 4GLXA 5G3LF 3H15A 2K52A 3H94A 1MSGA 1NE3A 1LABA 5JJLA 1SYDA 1O7IA 4LW1A 2QDLA 4DAVA 3LX0A 1Q8KA 1HUNA 2EZVA 4AYBE 4OWXB 3M9BA 4TQUS 3A54A 3I3CA 1G51A 1O7LA 3CMAA 4KJOA 2JA7B 1XTDA 3KBGA 5ELDA 1KRSA 5FO8B 2CCZA 1HNWL 1E2ZA 3NBHA 1NMFA 3G71A 1SN8A 2O2LD 3OOCA 2WACA 2PI2E 2D0OA 3SK6A 3CD6A 1O7ZA 3KLRA 3PO3G 4DV2Q 1X32A 1STNA 4B3SQ 1XTCD 2EOTA 2F0JA 2VUMH 2RDHA 3IFDA 3EIVA 5C5LA 1PH2A 1CZGA 1YNJC 5CGKA 4DR5L 3QG1A 1Q82C 4CGYB 1A62A 4DV0L 1I4PA 3UE0A 5IIFA 1WJJA 4JK1C 2EE1A 5CORA 1HPCA 3CCMA 4A76A 3K0YA 4JC0A 2WAQE 4QIWB 1W3SA 4P73A 1YVCA 1BVSA 1EY7A 2PQEA 4F7XA 4ZAIA 5C4XG 3MXGA 2KUMA 3I56A 1V8QA 3LWUA 4KHVA 5ELBA 1QUQB 5E4XA 1EY8A 2ID0A 4K14A 4KKUA 4HJ7A 1HHVA 4LF8L 4GOPC 2JA7H 4IFDJ 4XIGS 4LF6L 3HOUB 1N36L 4OGQC 4L5TA 4DNIA 1Q8IA 4MNOA 1SYCA 4L5RC 4CDFC 4G57A 1CQVA 1K8AC 3KUPA 3S1QH 2E2HB 2FINB 2RDGA 4O42A 2R93B 1P8LA 4LF4Q 2YU9B 1B7YB 3HOUH 1KRTA 1S5ED 5CV5A 2VQEQ 5IYDH 1HFGA 1D5XC 1UE7A 5A35A 4J6HA 5E1FA 4DV5L 1SNPA 2KEEA 1BR9A 1D8LA 1OXXK 2SNSA 4DXGA 3MHBA 3S2DH 2BOSA 1H9JA 4JI6Q 1U0LA 4LAAA 1SFOH 3Q23A 1E2WA 5ELEA 5C4XH 1IYVA 4A3EB 2I0QA 2JSOA 3BJUA 1L0WA 3S24A 4QGUA 3HOWB 2NWGA 4O0AA 4TRDA 1RTOA 4GNXC 1J8IA 3HGBA 5C4HA 1YHAA 4APVA 3ULJA 3MWYW 3QWNA 4CJ2C 4RGTA 1IBLL 1QVCA 2F0UA 1SMYD 1ENFA 1W6JA 2EXZA 2HCCA 3Q6SA 4DAPA 2M00A 4A3DH 4BY1H 1AFPA 4DV6L 4C2MB 2WP8J 4QQBX 1I4XA 4X62L 4A3CH 3D31A 1TIID 3C2PA 3S1MB 2E2JH 4IFDI 4G4KA 1YNJD 3OMCA 2BDOA 3C3LA 4K8IA 2MO0A 1H9RA 3KF8B 3BDLA 3KF6A 2WB1B 4IUTA 2FHTA 4L5QA 2JA9A 4B9WA 2VQEL 1X9NA 1EEID 1HZ9A 2DJFC 3I72A 2OQ0A 1PDQA 4IQZA 1BDOA 3R3OA 1PA6A 1YJNA 2JA6G 2F4IA 4A3BH 3CCVA 1VQMA 1CQFA 4RH6A 3KK7A 1SAPA 4GN4B 2K03A 1FNUA 4ZQ3A 2ASBA 1C48A 2WIIB 2Y0SE 3FPPA 1MJEA 2EQSA 2OEOA 1BCPB 3H3VH 2E74C 3MFYA 3GQBA 4UP8A 4HCEA 2ATWA 4X62Q 3X3NA 5C44B 3OWFA 1EYCA 1SE8A 4CJ0B 4AQYL 4YCUA 1PH9A 2KQ3A 1A15A 2RVLA 3DEOA 1KD1C 2PNHA 4HIMA 3O13A 1EY6A 2MQHA 1MBYA 3AQQA 1NJIC 3S2DB 3H0GG 4GS3A 4X3TA 2BE5D 1N8RC 1V1QA 4QIWE 4GNXA 2QF7A 1XNQQ 4OWTB 2NN6H 3DM3A 5M5YH 3C46A 3R8BA 4R9WA 2OQKA 2JA8G 1LACA 1H9MA 2CQAA 5A2QL 2HHHQ 5T1IA 4JV5Q 4CJ1B 3G4SA 3S1RB 3IKJA 2NVYH 4EQPA 1FJGQ 5JJZA 1XNQL 3WDNA 5BR8Q 4R4QA 2C35B 1VQBA 1IBMQ 3NBIA 3A8KE 4MIUA 3U50C 1CZWA 1N9WA 2D2CC 4Q5VA 4RGMA 4L5SA 4RWSC 1WCMG 2K7VA 3LGJA 1QOHA 2R7ZH 2RDFA 2KA7A 5C0XJ 1WI5A 3TREA 3AMUA 3DEPA 4BA1I 3U9OA 3W3AA 4EQNA 2H1EA 2F0VA 1PH1A 4DV1Q 4POFA 3PIO3 1LLRD 1EQTA 4LFBL 4R4IA 1EIHA 1OXTA 4Z9CB 1SFOB 4KN4C 3OHXC 4H02A 4AQYQ 1V9PA 2NB0A 3I4NB 1BOSA 1LTID 4DV1L 3VR3A 4QCLA 3BZDB 4GN3B 1GUGA 1Z47A 2CHBD 2WAQB 3K7UC 2B2UA 4YWMA 5IWAL 1YITA 2IL8A 3I4LA 1SE4A 2NZHA 2J0TD 2IW3A 3T1HQ 1AZQA 1Y1WB 1GOZA 3OTOQ 2R92G 3PUYA 4FXGC 1GHJA 4DR4L 1UWVA 4A93G 2R7ZG 1X3EA 2LY7A 5IT9E 4FF2A 1L2FA 1ONLA 1VQAA 1Q90A 2QW7A 5M5XH 4U68A 1JWUD 1BKBA 4H13C 2QEXA 1L1OA 3PUXA 4NKLA 1NTGA 1IHZA 1ENAA 1VQNA 2CKZB 4C3JH 4LFBQ 2JYOA 3PF5A 1TS4A 1QCBD 1BCPF 1P16A 1E1TA 1DM0B 3H3VC 1VQ4A 4JBJA 3HKZE 1I4QA 2HCIA 3T1YL 1I50B 1E0BA 2L12A 2UUCL 4DUYQ 1MHWC 3D8GA 3I8ZA 4RA8A 4F8MA 1SNMA 1U5KA 2UUBL 1GXDC 1R9TH 4C3JB 3CAMA 3A0JA 3NTKA 3NQIA 5IYDG 1JOKA 1PTOC 5ELNA 2NVTB 5LMNW 4NXMQ 1G8ZD 1A2UA 2BCOA 4HJAA 4RGNA 2PNRC 1Y1VB 4X65L 2Q8TA 4JCVE 4JBKA 1CT1D 3L3OC 4A3IG 4GKJL 1FL0A 1FGBD 5LL6S 2PMZE 3A8IE 1STBA 1HH2P 1MSHA 1YIJA 1ESRA 1GVPA 4C56C 1CKNB 1M90C 4G7HC 1YBYA 2BA1A 5LMUQ 1GD7A 5LMNQ 5D65A 1NCVA 4ZLTF 1DOLA 4IN3A 4R4CA 4C3HG 5JAVA 5LL6X 5IP7G 3CF5A 2NVTH 4A75A 2KJXA 1VMPA 2QA4A 3VR2A 4ALPA 2ZJRA 3ICEA 3CC7A 1E22A 1JCKB 3H91A 5E4WC 3DLLA 1G91A 2EPBA 4XT1B 3STBC 1KDBA 3TS0A 1TWHH 3H0GB 3MXUA 3CQZB 1N32L 2D9UA 4QMGA 1SBBB 3NSWA 1F9PA 1MJCA 2GN5A 3E9IA 3H6MA 4B3RQ 2B63H 4KLKA 1AP0A 5FK9C 1Y1VG 2UU9L 4FO2A 3OWEB 2MPMA 2JJQA 1N32Q 3C1FA 5NUCA 1BXTA 1WTXA 2JA7G 1PRTC 2IX0A 1SE2A 3PGZA 3SVMA 2A73B 1B9NA 4WFN3 3HOZG 4DV3L 5IYBG 2V4DA 1JQYD 4A3LG 4LUVA 1H9SA 2LS01 2B63G 4X65Q 2VB3X 4KHZA 2JA6B 3S15H 1X6OA 2QDBA 2R7FA 1ICWA 1NR4A 1TXYA 3UDIA 4DGZA 1NAPA 4P71A 3FRPB 1OTCA 4JI7Q 1PFNA 2IX1A 3E9HA 3M4YA 3FMCA 3S1NB 1RHPA 1HCZA 5GAHC 2FJ2A 2I5HA 3KOJA 3DXJC 2K05A 4A3FG 1PV4A 3CP0A 3BG3A 1DZ1A 4A3KH 3VYUA 3HG9A 4DXFA 5I6YA 1CA6A 3S17H 2EXDA 3GP7A 5LMUL 1ILQA 3ERSX 4NB3A 1ET6A 2JQOA 2UXBL 4GKKL 1KL9A 1EY9A 1K3BC 4N8FA 3JC66 1YJWA 1K83B 4KD3A 4YY3Q 1C7YA 2R92B 4V0BA 3CQZH 1S5CD 4JI3L 1T5XD 1VQPA 4LF9L 3B6YA 3HS0C 2PI2A 2WAQG 3J81j 2XTIA 4P75A 5FJ8H 2VQFL 4UY8C 2Q8IB 4BBRG 2CH4W 1HXYD 4FF4A 5JEAG 2P5ZX 4DR2L 2EJFC 3ULLA 1TU2B 3S16H 3KLWA 3CC4A 1IKMA 5K5PA 2L15A 2LFNA 4IURA 2CVRA 1SMXA 3CKIB 2IJ0A 5E3FA 3RD4A 2KBNA 2UU9Q 3HFZB 1B50A 4K6DA 1H9SB 1U9RA 5IOCA 4KN7C 5BN3A 5J1ZA 2CQOA 4DR5Q 2NVQH 2C9OA 2VS1A 4LFAL 4HIDA 3DWPA 1BQQT 1ET9A 1VS0A 1HFNA 2B2UC 4CDDC 1OXUA 4HR7B 1DOMA 2BE5C 3ITPA 4PZ8A 1B3QA 2LKVA 3FEWX 1UEBA 4OIJA 3OW2A 5EQ0A 2F0DA 1HNXQ 1B44D 1WFQA 3DMUA 1VQHA 2K1BA 1G6PA 2NUCA 4M8AA 5EPLA 1F9QA 1IBKL 3MEHA 3G6EA 1MIUA 4DK6C 4PV1C 5KYIA 1E24A 4DKAC 5IP9H
chains in the Genus database with same CATH topology
1FJGL 2HIXA 5IT9c 5IE8A 3BJUA 1L0WA 3S24A 4QGUA 2R92H 1JJGA 4NXNL 1IL2A 2AWOA 4QY7A 4O0AA 1PH3A 1PYSB 2YTYA 4PG3A 4GNXB 4GNXC 4DR7Q 1YHAA 4FDBA 4APVA 3ULJA 2E2IH 5GAGC 3UE1A 4X66L 1S72A 1I94Q 1IBLL 4MTNA 2UUBQ 2A8VA 3GTPH 3RZDH 1QVCA 4X6AH 4R4OA 5M3MG 5C0XI 2BH2A 2AKWB 4J15A 4A3DH 2Z0SA 1X56A 3RLOA 4BY1H 4NXNQ 4DR2Q 3PCOB 4OXPA 1MKHA 2OCEA 2WP8J 4DV6L 4QQBX 2UUAL 4X62L 4NXML 4IO9A 4A3CH 1WYDA 3D31A 5C44G 2K14A 3BU2A 4YWLA 4X66Q 4R1JA 1CSQA 1J5EL 1KXLA 2Q2UA 3RNUA 2E2JH 4IFDI 2K5HA 1NY4A 1K3RA 3I4MH 3HOWG 3M4QA 2VW9A 5J3BA 4B3MQ 4DV0Q 3HKSA 2V1CC 2MO0A 3KF8B 3NEMA 1Q46A 3I4NG 2F3IA 4A3DG 3KF6A 2B29A 3KDFB 3GTMH 5BR8L 1IXRA 2YV5A 4YWKA 4L5QA 2JA9A 2VQEL 4OX9Q 1X9NA 1YI2A 5LMNL 3PIOA 1HZ9A 2ZJPA 1N34L 3CCRA 2OQ0A 3MXNB 2NVXH 1SROA 2K50A 5HGQA 1X3FA 3RLFA 5FLMH 4P74A 2JA5G 1HR0L 2NN6I 4JI4L 2WB1G 3CPFA 4IPHA 1V43A 1YJNA 2IT1A 1PA6A 5C3EG 2JA6G 4A3BH 4WJ3M 3OYYA 3CCVA 1VQMA 1UE1A 4K0KL 3PUVA 3Q8DA 3F2CA 4DV4Q 2E5LQ 3IRBA 4GN4B 3GTKH 2MNAA 4A3EH 4A3CG 2ASBA 2Y0SE 1MJEA 2EQSA 2ZM6L 2E8GA 1RIPA 3H3VH 5C3EH 5IYCH 4UP8A 1OXVA 3KJOA 3M85A 2ATWA 2Y0SG 5EAYA 1XPRA 4X62Q 1KQSA 4JBMA 1HZAA 3HOVG 3H3VI 3PIPA 4IJLA 4HIOA 1SRUA 3PUZA 3HOUG 1SE8A 2YYZA 4B3RL 1UE6A 5M3FG 4AQYL 4YCUA 1PH9A 4A3LH 4JI2L 2ZJQA 5E7NA 1AE3A 1Q86C 5DLQE 3F2DA 3RN5A 2PNHA 4HIMA 1KD1C 2VUMG 2N3SA 1VQGA 2MQHA 4IJHA 3AQQA 1NJIC 3ULPA 3H0GG 2YU9H 4B3SL 4JI1Q 4GS3A 1N33Q 3S1NH 1N8RC 3T1YQ 1EOVA 3CMEA 1V1QA 4QIWE 1CKMA 2UUAQ 3S1RH 4A3BG 1PH5A 4GNXA 4DR1Q 1XNQQ 4GKKQ 4LWCA 4OWTB 1Q7YC 1PFSA 3S14H 5JJIA 1Y1WH 4IOAA 3DM3A 4A3EG 1XMOL 5M5YH 2OQKA 2JA8G 1YEZA 2HHHQ 1VQ5A 3K80C 2I5LX 4JV5Q 3G4SA 4DR3L 1GO3E 5FJ8G 2IHFA 5M3MH 2A19A 3ZJYC 2VNUD 2NVYH 1PH8A 3RN2A 2N49A 4JI3Q 1FJGQ 1GM5A 2HT1A 1XNQL 3I4NH 2ZM6Q 1Q1EA 4BBSG 5IP9G 4NPSA 4HJ5A 5BR8Q 4R4QA 2C35B 4IFDG 1CKOA 3AFPA 4B3TQ 1KC8C 1VQBA 2D0PA 1IBMQ 4QJFA 4DAMA 2RCNA 3U50C 1YNXA 1XJVA 1N9WA 1XMQL 4PZ6A 4DR3Q 3GD7A 4DV2L 4L5SA 2RF4A 4JI4Q 4LUZA 1WCMG 5HY6A 3LGJA 3A5ZB 3I55A 4DUZQ 4JI2Q 2R7ZH 2R93G 3HKZG 1WI5A 3TREA 5C0XJ 3KYHC 4DV6Q 1JJCB 1Z9FA 4OX9L 1YHQA 3NENA 4BA1I 2H5XA 4DPGA 4HJ8A 3RZOH 2EIFA 4JI1L 1XMQQ 4LF7Q 4A3FH 1X55A 1PH1A 2UXDQ 4DV1Q 1Q12A 4POFA 2DUDA 2LSSA 4O2DA 4BXXG 3CCSA 2N78A 4X64L 1XPUA 3U4VA 5FLMG 4LFBL 1LYLA 4R4IA 4LUOA 1PH4A 2PQAB 4LF4L 1OXTA 1PH7A 1D7QA 2K4KA 4DV4L 1K0RA 1Y14B 4H02A 1C9OA 4AQYQ 4UP9A 1V9PA 4DUYL 3GTQH 5IP9H 2OWOA 3PO2G 4A3GG 4DR4Q 1VCIA 4DV5Q 2ZTCA 3I7FA 4DK3C 2VQFQ 4DV1L 1Z47A 4GN3B 1C0AA 3K7UC 4YWMA 1LUZA 3RLNA 5IWAL 1Q81C 1YITA 2A1AA 1JJ2A 3BZKA 2KENA 5JJKA 3U4ZA 4OWWB 1JB7A 2NZHA 4RMFA 4KI0A 5GADC 3HOXH 1VQ7A 4HJ9A 5IYBH 3I4MG 3T1HQ 4WJ4A 4LF8Q 3OTOQ 1VQFA 1HNZL 2R92G 3PUYA 1VQCA 1B70B 5M3FH 4DR4L 1UWVA 4A93G 1QZGA 2R7ZG 1X3EA 4B3TL 2R93H 2B3GA 2I5MX 1PHJA 2AMCB 2Q2IA 2NN6G 2K75A 3AFQA 4RG1A 4PMWA 3VDYA 1AH9A 1L2FA 3SGIA 1CSPA 3HOZH 1VQAA 5M5XH 3F8TA 1KAWA 1BKBA 4C2MH 4Y7NH 4DV7L 3F1ZA 2Z6KA 4BY7H 2NZOA 1L1OA 3PUXA 2QEXA 1S40A 4C3IH 3HOXG 4OO1I 5K36G 2DGYA 3GDEA 1NTGA 4DR6L 2JEBI 1VQNA 1EIYB 1QZHA 3FHWA 1EIFA 2CKZB 3PSIA 4JYAQ 4C3JH 4LFBQ 3PF5A 2VZAA 1UE5A 3WWVA 1TWGH 1P16A 1E1TA 5AJ3Q 1N36Q 1EWIA 3PV0A 1VQ4A 4JBJA 1A63A 1VQ8A 2Q2HA 1HJPA 2OTJA 3HKZE 4YHHQ 4P72A 2ZTEA 4AIMA 1CKNA 3T1YL 4IPDA 4Y52H 4JI6L 2GVAA 2UUCL 3PO2H 3TRZA 4A3GH 2MO1A 4PZ7A 4DUYQ 1E1OA 4JI8L 3CC2A 4UP7A 4IPGA 5C44H 4HIKA 3UDGA 3KF6B 4C3HH 5IP7H 1L1OB 1KHIA 1L1OC 1X3GA 1U5KA 3BZCA 4JI5L 4A3KG 1I94L 1K83H 3K7AH 2UUBL 3GTLH 3JAMi 1R9TH 3OTOL 4TVAB 3GO5A 3CAMA 3A0JA 1ASZA 3A5UA 5IYDG 4JI0L 3GTOH 2HIVA 3K81C 5ELNA 3T1HL 2YTVA 1VQKA 2JA5H 3EN2A 5LMNW 3U58A 1HNZQ 4NXMQ 1VQEA 4JI8Q 2KHJA 3FKIG 1OXSC 4HJAA 1TWAH 5GAEC 1BBUA 2IHEA 4YCWA 1KIXA 1FGUA 3HOVH 1IBLQ 1HR0W 4X65L 2CWPA 3J80i 4X64Q 2XGTA 4JCVE 4JOIC 4A3JG 4DAYB 4JBKA 1XNRQ 4A3IG 1EFWA 1WOCA 4GKJL 2R7DA 1FL0A 2GVBA 3W1BA 4JI0Q 3TS2A 2PMZE 4EQ5A 4GN5A 1ASYA 3S1MH 4LF9Q 1A8VA 1HH2P 1DGSA 1YIJA 1GVPA 1VQJA 1CKNB 1G291 1M90C 1J5EQ 3RR5A 4BXXH 1YBYA 2BA1A 4XTCS 3CCLA 1CUKA 5LMUQ 2ES2A 1GD7A 1HZCA 5GQOA 3CPWA 5LMNQ 1PH6A 4AYBG 1IYJB 1M1KC 4R4CA 3NBHB 4QL5A 5IP7G 1VQ9A 4ME3A 3CF5A 2R6GA 2NVTH 1HR0Q 2UUCQ 4LFCL 4A75A 1AE2A 2WFWA 1K9MC 4JG2A 2QA4A 1H95A 1JT8A 1BBWA 3J7ZC 3JAMc 1XPOA 4JI7L 4ALPA 3L2PA 2ZJRA 1E3PA 3ICEA 3CC7A 2E5LL 4K0KQ 3I2ZA 2Z6KC 1Y1VH 1E22A 3DLLA 3UDFA 3W5OA 2IY5B 1T9HA 3I4OA 3STBC 1HZBA 4OO1G 3CCEA 3TS0A 1TWHH 1E7ZA 1VQIA 3M4PA 4DV7Q 3HOYH 2RHSB 3KJPA 1S3OA 2KCMA 5IY0A 1VQDA 1N32L 2UXCQ 5ELOA 4YCVA 2KHIA 3L0OA 2GN5A 1MJCA 3E9IA 3M4OH 4B3RQ 3FKIH 2B63H 3HOWH 1GKHA 3GTJH 1XNRL 4AH6A 4KLKA 1JE5A 4GKJQ 4JBWA 2CFMA 2JK8A 1Y1VG 1Q1BA 5C4JH 4R4TA 1Y1WG 1YJ9A 2UU9L 4LF6Q 1I50H 4MZ9A 5AJ3L 3A74A 3KDFA 1N34Q 2D62A 2JJQA 1N32Q 1HNXL 5FLXc 3G48A 2BH8A 3M7NA 1X54A 2N8NA 4GLXA 4A4IA 2VY3A 2IX0A 2F52A 3H15A 2JA7G 3HOZG 3PGZA 5M5WH 5H1SE 2K52A 4DV3L 5IYBG 1I6HH 4A3LG 1I5FA 1NE3A 4LUVA 4IPCA 4JI5Q 2B63G 5JJLA 1PYBA 1O7IA 4GLVB 4KHZA 4LW1A 4X65Q 1W2BA 1X6OA 3S15H 1PVOA 2FXQA 1Q8KA 4A93H 2R7FA 3CCQA 4DUZL 1B8AA 4AYBE 4LF5Q 4OWXB 4A3IH 3M9BA 3AEVA 4POGA 4TQUS 4JOIA 3HOYG 1TXYA 3UDIA 3PF4A 1G51A 3CMAA 4IOCA 2F4VQ 4P71A 1XTDA 1OTCA 4JI7Q 1KRSA 1RL2A 2CCZA 4LF7L 4LFAQ 4KHPQ 2IX1A 2E2HH 1HNWL 3E9HA 1XMOQ 1NMFA 4BY7G 3G71A 1IBML 3CXCA 1SN8A 2UXBQ 1EYGA 2MFIA 2PI2E 1LM0A 2D0OA 5GAHC 2I5HA 2YTXA 2Q2TA 4OONA 3CCUA 3KOJA 3FP9A 3CD6A 3GTGH 3M3YH 3PO3G 1YZ6A 4A3FG 3CP0A 1PV4A 4DV2Q 2PQAA 4B3SQ 1VQLA 4A3KH 1N33L 5IYCG 2ALYB 1HNWQ 3S17H 2EXDA 3D0FA 3NELA 2VUMH 1LTLA 2LXJA 5LMUL 4NB3A 3EIVA 3ERSX 4DR1L 2JQOA 4A3JH 5IWAQ 3J81i 2LXKA 1PH2A 4DR5L 4GKKL 1Q82C 2UXBL 1KL9A 2OTLA 1A62A 4DV0L 2UXDL 3JC66 3UE0A 1YJWA 1WJJA 3AYHB 1NMGA 3PUWA 4YY3Q 4LFCQ 4GOPA 4LNQA 1C7YA 3CCMA 4A76A 4JC0A 1J6QA 1EUJA 1WCMH 4A3MG 4DV3Q 2WAQE 2QGQA 3CQZH 1VQ6A 1W3SA 4DR7L 4P73A 4JI3L 1VQPA 1YVCA 4LF9L 1BVSA 3J7A5 3B6YA 3J80c 2PI2A 1SR3A 1TWCH 3K0XA 3W1GA 4BA2I 2WAQG 3J81j 2XTIA 4P75A 5FJ8H 2VQFL 4UY8C 5C4XG 2HQLA 4BBRG 3I56A 5JEAG 3ER0A 5GROA 4BY1G 4BBSH 4LF5L 1QUQB 3CW2C 4B3ML 2ID0A 3UDXA 3STBD 4DR2L 3E0EA 3ULLA 3EBEA 4HJ7A 3S16H 3PO3H 3KFUA 1K8GA 4LF8L 3KLWA 3L7ZC 3CC4A 1SLJA 2BA0A 1QVGA 3CCJA 4GOPB 4GOPC 2JA7H 4JYAL 2L15A 4A3MH 1FVIA 1EQQA 4IFDJ 1SMXA 1JMCA 4XIGS 2KBNA 2UU9Q 4LF6L 1NBWA 3HFZB 3S2HH 1IZ6A 1N36L 2ZTDA 4L5TA 4DNIA 4MNOA 4L5RC 4YHHL 2JA6H 2K5VA 3J81c 1K8AC 3S1QH 1P8LA 2JEAI 2AHOB 1YHBA 4LF4Q 2UXCL 2JA8H 2CQOA 1B7YB 5C0XG 4DR5Q 5JEAJ 3HOUH 1KRTA 2VQEQ 2VS1A 2NVQH 4LFAL 1X65A 2AWNA 5IYDH 4HIDA 1UE7A 1TWFH 3K8AA 1VS0A 4YY3L 1IBKQ 4DV5L 3TEHB 1OXUA 1A0IA 2KCTA 2JE6I 4PZ8A 4EX5A 4BBRH 1UEBA 2CWAA 1VQOA 4DR6Q 2F4VL 1QUQA 2WB1E 1EQRA 1D8LA 1OXXK 3OW2A 3TQYA 1HNXQ 1WFQA 3S2DH 1VQHA 4KHPL 2K5NA 1G6PA 4JI6Q 3F2BA 2RHQB 1I3QH 1U0LA 1SFOH 1E24A 2VL6A 2HHHL 1K73C 1IBKL 3G6EA 4JV5L 5C4XH 1MIUA 4UPAA 1QVFA 4DK6C 3MEFA 3H0GH 4DKAC 2I0QA 4GLAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FJG L;  2HIX A;  5IT9 c;  5IE8 A;  3BJU A;  1L0W A;  3S24 A;  4QGU A;  2R92 H;  1JJG A;  4NXN L;  1IL2 A;  2AWO A;  4QY7 A;  4O0A A;  1PH3 A;  1PYS B;  2YTY A;  4PG3 A;  4GNX B;  4GNX C;  4DR7 Q;  1YHA A;  4FDB A;  4APV A;  3ULJ A;  2E2I H;  5GAG C;  3UE1 A;  4X66 L;  1S72 A;  1I94 Q;  1IBL L;  4MTN A;  2UUB Q;  2A8V A;  3GTP H;  3RZD H;  1QVC A;  4X6A H;  4R4O A;  5M3M G;  5C0X I;  2BH2 A;  2AKW B;  4J15 A;  4A3D H;  2Z0S A;  1X56 A;  3RLO A;  4BY1 H;  4NXN Q;  4DR2 Q;  3PCO B;  4OXP A;  1MKH A;  2OCE A;  2WP8 J;  4DV6 L;  4QQB X;  2UUA L;  4X62 L;  4NXM L;  4IO9 A;  4A3C H;  1WYD A;  3D31 A;  5C44 G;  2K14 A;  3BU2 A;  4YWL A;  4X66 Q;  4R1J A;  1CSQ A;  1J5E L;  1KXL A;  2Q2U A;  3RNU A;  2E2J H;  4IFD I;  2K5H A;  1NY4 A;  1K3R A;  3I4M H;  3HOW G;  3M4Q A;  2VW9 A;  5J3B A;  4B3M Q;  4DV0 Q;  3HKS A;  2V1C C;  2MO0 A;  3KF8 B;  3NEM A;  1Q46 A;  3I4N G;  2F3I A;  4A3D G;  3KF6 A;  2B29 A;  3KDF B;  3GTM H;  5BR8 L;  1IXR A;  2YV5 A;  4YWK A;  4L5Q A;  2JA9 A;  2VQE L;  4OX9 Q;  1X9N A;  1YI2 A;  5LMN L;  3PIO A;  1HZ9 A;  2ZJP A;  1N34 L;  3CCR A;  2OQ0 A;  3MXN B;  2NVX H;  1SRO A;  2K50 A;  5HGQ A;  1X3F A;  3RLF A;  5FLM H;  4P74 A;  2JA5 G;  1HR0 L;  2NN6 I;  4JI4 L;  2WB1 G;  3CPF A;  4IPH A;  1V43 A;  1YJN A;  2IT1 A;  1PA6 A;  5C3E G;  2JA6 G;  4A3B H;  4WJ3 M;  3OYY A;  3CCV A;  1VQM A;  1UE1 A;  4K0K L;  3PUV A;  3Q8D A;  3F2C A;  4DV4 Q;  2E5L Q;  3IRB A;  4GN4 B;  3GTK H;  2MNA A;  4A3E H;  4A3C G;  2ASB A;  2Y0S E;  1MJE A;  2EQS A;  2ZM6 L;  2E8G A;  1RIP A;  3H3V H;  5C3E H;  5IYC H;  4UP8 A;  1OXV A;  3KJO A;  3M85 A;  2ATW A;  2Y0S G;  5EAY A;  1XPR A;  4X62 Q;  1KQS A;  4JBM A;  1HZA A;  3HOV G;  3H3V I;  3PIP A;  4IJL A;  4HIO A;  1SRU A;  3PUZ A;  3HOU G;  1SE8 A;  2YYZ A;  4B3R L;  1UE6 A;  5M3F G;  4AQY L;  4YCU A;  1PH9 A;  4A3L H;  4JI2 L;  2ZJQ A;  5E7N A;  1AE3 A;  1Q86 C;  5DLQ E;  3F2D A;  3RN5 A;  2PNH A;  4HIM A;  1KD1 C;  2VUM G;  2N3S A;  1VQG A;  2MQH A;  4IJH A;  3AQQ A;  1NJI C;  3ULP A;  3H0G G;  2YU9 H;  4B3S L;  4JI1 Q;  4GS3 A;  1N33 Q;  3S1N H;  1N8R C;  3T1Y Q;  1EOV A;  3CME A;  1V1Q A;  4QIW E;  1CKM A;  2UUA Q;  3S1R H;  4A3B G;  1PH5 A;  4GNX A;  4DR1 Q;  1XNQ Q;  4GKK Q;  4LWC A;  4OWT B;  1Q7Y C;  1PFS A;  3S14 H;  5JJI A;  1Y1W H;  4IOA A;  3DM3 A;  4A3E G;  1XMO L;  5M5Y H;  2OQK A;  2JA8 G;  1YEZ A;  2HHH Q;  1VQ5 A;  3K80 C;  2I5L X;  4JV5 Q;  3G4S A;  4DR3 L;  1GO3 E;  5FJ8 G;  2IHF A;  5M3M H;  2A19 A;  3ZJY C;  2VNU D;  2NVY H;  1PH8 A;  3RN2 A;  2N49 A;  4JI3 Q;  1FJG Q;  1GM5 A;  2HT1 A;  1XNQ L;  3I4N H;  2ZM6 Q;  1Q1E A;  4BBS G;  5IP9 G;  4NPS A;  4HJ5 A;  5BR8 Q;  4R4Q A;  2C35 B;  4IFD G;  1CKO A;  3AFP A;  4B3T Q;  1KC8 C;  1VQB A;  2D0P A;  1IBM Q;  4QJF A;  4DAM A;  2RCN A;  3U50 C;  1YNX A;  1XJV A;  1N9W A;  1XMQ L;  4PZ6 A;  4DR3 Q;  3GD7 A;  4DV2 L;  4L5S A;  2RF4 A;  4JI4 Q;  4LUZ A;  1WCM G;  5HY6 A;  3LGJ A;  3A5Z B;  3I55 A;  4DUZ Q;  4JI2 Q;  2R7Z H;  2R93 G;  3HKZ G;  1WI5 A;  3TRE A;  5C0X J;  3KYH C;  4DV6 Q;  1JJC B;  1Z9F A;  4OX9 L;  1YHQ A;  3NEN A;  4BA1 I;  2H5X A;  4DPG A;  4HJ8 A;  3RZO H;  2EIF A;  4JI1 L;  1XMQ Q;  4LF7 Q;  4A3F H;  1X55 A;  1PH1 A;  2UXD Q;  4DV1 Q;  1Q12 A;  4POF A;  2DUD A;  2LSS A;  4O2D A;  4BXX G;  3CCS A;  2N78 A;  4X64 L;  1XPU A;  3U4V A;  5FLM G;  4LFB L;  1LYL A;  4R4I A;  4LUO A;  1PH4 A;  2PQA B;  4LF4 L;  1OXT A;  1PH7 A;  1D7Q A;  2K4K A;  4DV4 L;  1K0R A;  1Y14 B;  4H02 A;  1C9O A;  4AQY Q;  4UP9 A;  1V9P A;  4DUY L;  3GTQ H;  5IP9 H;  2OWO A;  3PO2 G;  4A3G G;  4DR4 Q;  1VCI A;  4DV5 Q;  2ZTC A;  3I7F A;  4DK3 C;  2VQF Q;  4DV1 L;  1Z47 A;  4GN3 B;  1C0A A;  3K7U C;  4YWM A;  1LUZ A;  3RLN A;  5IWA L;  1Q81 C;  1YIT A;  2A1A A;  1JJ2 A;  3BZK A;  2KEN A;  5JJK A;  3U4Z A;  4OWW B;  1JB7 A;  2NZH A;  4RMF A;  4KI0 A;  5GAD C;  3HOX H;  1VQ7 A;  4HJ9 A;  5IYB H;  3I4M G;  3T1H Q;  4WJ4 A;  4LF8 Q;  3OTO Q;  1VQF A;  1HNZ L;  2R92 G;  3PUY A;  1VQC A;  1B70 B;  5M3F H;  4DR4 L;  1UWV A;  4A93 G;  1QZG A;  2R7Z G;  1X3E A;  4B3T L;  2R93 H;  2B3G A;  2I5M X;  1PHJ A;  2AMC B;  2Q2I A;  2NN6 G;  2K75 A;  3AFQ A;  4RG1 A;  4PMW A;  3VDY A;  1AH9 A;  1L2F A;  3SGI A;  1CSP A;  3HOZ H;  1VQA A;  5M5X H;  3F8T A;  1KAW A;  1BKB A;  4C2M H;  4Y7N H;  4DV7 L;  3F1Z A;  2Z6K A;  4BY7 H;  2NZO A;  1L1O A;  3PUX A;  2QEX A;  1S40 A;  4C3I H;  3HOX G;  4OO1 I;  5K36 G;  2DGY A;  3GDE A;  1NTG A;  4DR6 L;  2JEB I;  1VQN A;  1EIY B;  1QZH A;  3FHW A;  1EIF A;  2CKZ B;  3PSI A;  4JYA Q;  4C3J H;  4LFB Q;  3PF5 A;  2VZA A;  1UE5 A;  3WWV A;  1TWG H;  1P16 A;  1E1T A;  5AJ3 Q;  1N36 Q;  1EWI A;  3PV0 A;  1VQ4 A;  4JBJ A;  1A63 A;  1VQ8 A;  2Q2H A;  1HJP A;  2OTJ A;  3HKZ E;  4YHH Q;  4P72 A;  2ZTE A;  4AIM A;  1CKN A;  3T1Y L;  4IPD A;  4Y52 H;  4JI6 L;  2GVA A;  2UUC L;  3PO2 H;  3TRZ A;  4A3G H;  2MO1 A;  4PZ7 A;  4DUY Q;  1E1O A;  4JI8 L;  3CC2 A;  4UP7 A;  4IPG A;  5C44 H;  4HIK A;  3UDG A;  3KF6 B;  4C3H H;  5IP7 H;  1L1O B;  1KHI A;  1L1O C;  1X3G A;  1U5K A;  3BZC A;  4JI5 L;  4A3K G;  1I94 L;  1K83 H;  3K7A H;  2UUB L;  3GTL H;  3JAM i;  1R9T H;  3OTO L;  4TVA B;  3GO5 A;  3CAM A;  3A0J A;  1ASZ A;  3A5U A;  5IYD G;  4JI0 L;  3GTO H;  2HIV A;  3K81 C;  5ELN A;  3T1H L;  2YTV A;  1VQK A;  2JA5 H;  3EN2 A;  5LMN W;  3U58 A;  1HNZ Q;  4NXM Q;  1VQE A;  4JI8 Q;  2KHJ A;  3FKI G;  1OXS C;  4HJA A;  1TWA H;  5GAE C;  1BBU A;  2IHE A;  4YCW A;  1KIX A;  1FGU A;  3HOV H;  1IBL Q;  1HR0 W;  4X65 L;  2CWP A;  3J80 i;  4X64 Q;  2XGT A;  4JCV E;  4JOI C;  4A3J G;  4DAY B;  4JBK A;  1XNR Q;  4A3I G;  1EFW A;  1WOC A;  4GKJ L;  2R7D A;  1FL0 A;  2GVB A;  3W1B A;  4JI0 Q;  3TS2 A;  2PMZ E;  4EQ5 A;  4GN5 A;  1ASY A;  3S1M H;  4LF9 Q;  1A8V A;  1HH2 P;  1DGS A;  1YIJ A;  1GVP A;  1VQJ A;  1CKN B;  1G29 1;  1M90 C;  1J5E Q;  3RR5 A;  4BXX H;  1YBY A;  2BA1 A;  4XTC S;  3CCL A;  1CUK A;  5LMU Q;  2ES2 A;  1GD7 A;  1HZC A;  5GQO A;  3CPW A;  5LMN Q;  1PH6 A;  4AYB G;  1IYJ B;  1M1K C;  4R4C A;  3NBH B;  4QL5 A;  5IP7 G;  1VQ9 A;  4ME3 A;  3CF5 A;  2R6G A;  2NVT H;  1HR0 Q;  2UUC Q;  4LFC L;  4A75 A;  1AE2 A;  2WFW A;  1K9M C;  4JG2 A;  2QA4 A;  1H95 A;  1JT8 A;  1BBW A;  3J7Z C;  3JAM c;  1XPO A;  4JI7 L;  4ALP A;  3L2P A;  2ZJR A;  1E3P A;  3ICE A;  3CC7 A;  2E5L L;  4K0K Q;  3I2Z A;  2Z6K C;  1Y1V H;  1E22 A;  3DLL A;  3UDF A;  3W5O A;  2IY5 B;  1T9H A;  3I4O A;  3STB C;  1HZB A;  4OO1 G;  3CCE A;  3TS0 A;  1TWH H;  1E7Z A;  1VQI A;  3M4P A;  4DV7 Q;  3HOY H;  2RHS B;  3KJP A;  1S3O A;  2KCM A;  5IY0 A;  1VQD A;  1N32 L;  2UXC Q;  5ELO A;  4YCV A;  2KHI A;  3L0O A;  2GN5 A;  1MJC A;  3E9I A;  3M4O H;  4B3R Q;  3FKI H;  2B63 H;  3HOW H;  1GKH A;  3GTJ H;  1XNR L;  4AH6 A;  4KLK A;  1JE5 A;  4GKJ Q;  4JBW A;  2CFM A;  2JK8 A;  1Y1V G;  1Q1B A;  5C4J H;  4R4T A;  1Y1W G;  1YJ9 A;  2UU9 L;  4LF6 Q;  1I50 H;  4MZ9 A;  5AJ3 L;  3A74 A;  3KDF A;  1N34 Q;  2D62 A;  2JJQ A;  1N32 Q;  1HNX L;  5FLX c;  3G48 A;  2BH8 A;  3M7N A;  1X54 A;  2N8N A;  4GLX A;  4A4I A;  2VY3 A;  2IX0 A;  2F52 A;  3H15 A;  2JA7 G;  3HOZ G;  3PGZ A;  5M5W H;  5H1S E;  2K52 A;  4DV3 L;  5IYB G;  1I6H H;  4A3L G;  1I5F A;  1NE3 A;  4LUV A;  4IPC A;  4JI5 Q;  2B63 G;  5JJL A;  1PYB A;  1O7I A;  4GLV B;  4KHZ A;  4LW1 A;  4X65 Q;  1W2B A;  1X6O A;  3S15 H;  1PVO A;  2FXQ A;  1Q8K A;  4A93 H;  2R7F A;  3CCQ A;  4DUZ L;  1B8A A;  4AYB E;  4LF5 Q;  4OWX B;  4A3I H;  3M9B A;  3AEV A;  4POG A;  4TQU S;  4JOI A;  3HOY G;  1TXY A;  3UDI A;  3PF4 A;  1G51 A;  3CMA A;  4IOC A;  2F4V Q;  4P71 A;  1XTD A;  1OTC A;  4JI7 Q;  1KRS A;  1RL2 A;  2CCZ A;  4LF7 L;  4LFA Q;  4KHP Q;  2IX1 A;  2E2H H;  1HNW L;  3E9H A;  1XMO Q;  1NMF A;  4BY7 G;  3G71 A;  1IBM L;  3CXC A;  1SN8 A;  2UXB Q;  1EYG A;  2MFI A;  2PI2 E;  1LM0 A;  2D0O A;  5GAH C;  2I5H A;  2YTX A;  2Q2T A;  4OON A;  3CCU A;  3KOJ A;  3FP9 A;  3CD6 A;  3GTG H;  3M3Y H;  3PO3 G;  1YZ6 A;  4A3F G;  3CP0 A;  1PV4 A;  4DV2 Q;  2PQA A;  4B3S Q;  1VQL A;  4A3K H;  1N33 L;  5IYC G;  2ALY B;  1HNW Q;  3S17 H;  2EXD A;  3D0F A;  3NEL A;  2VUM H;  1LTL A;  2LXJ A;  5LMU L;  4NB3 A;  3EIV A;  3ERS X;  4DR1 L;  2JQO A;  4A3J H;  5IWA Q;  3J81 i;  2LXK A;  1PH2 A;  4DR5 L;  4GKK L;  1Q82 C;  2UXB L;  1KL9 A;  2OTL A;  1A62 A;  4DV0 L;  2UXD L;  3JC6 6;  3UE0 A;  1YJW A;  1WJJ A;  3AYH B;  1NMG A;  3PUW A;  4YY3 Q;  4LFC Q;  4GOP A;  4LNQ A;  1C7Y A;  3CCM A;  4A76 A;  4JC0 A;  1J6Q A;  1EUJ A;  1WCM H;  4A3M G;  4DV3 Q;  2WAQ E;  2QGQ A;  3CQZ H;  1VQ6 A;  1W3S A;  4DR7 L;  4P73 A;  4JI3 L;  1VQP A;  1YVC A;  4LF9 L;  1BVS A;  3J7A 5;  3B6Y A;  3J80 c;  2PI2 A;  1SR3 A;  1TWC H;  3K0X A;  3W1G A;  4BA2 I;  2WAQ G;  3J81 j;  2XTI A;  4P75 A;  5FJ8 H;  2VQF L;  4UY8 C;  5C4X G;  2HQL A;  4BBR G;  3I56 A;  5JEA G;  3ER0 A;  5GRO A;  4BY1 G;  4BBS H;  4LF5 L;  1QUQ B;  3CW2 C;  4B3M L;  2ID0 A;  3UDX A;  3STB D;  4DR2 L;  3E0E A;  3ULL A;  3EBE A;  4HJ7 A;  3S16 H;  3PO3 H;  3KFU A;  1K8G A;  4LF8 L;  3KLW A;  3L7Z C;  3CC4 A;  1SLJ A;  2BA0 A;  1QVG A;  3CCJ A;  4GOP B;  4GOP C;  2JA7 H;  4JYA L;  2L15 A;  4A3M H;  1FVI A;  1EQQ A;  4IFD J;  1SMX A;  1JMC A;  4XIG S;  2KBN A;  2UU9 Q;  4LF6 L;  1NBW A;  3HFZ B;  3S2H H;  1IZ6 A;  1N36 L;  2ZTD A;  4L5T A;  4DNI A;  4MNO A;  4L5R C;  4YHH L;  2JA6 H;  2K5V A;  3J81 c;  1K8A C;  3S1Q H;  1P8L A;  2JEA I;  2AHO B;  1YHB A;  4LF4 Q;  2UXC L;  2JA8 H;  2CQO A;  1B7Y B;  5C0X G;  4DR5 Q;  5JEA J;  3HOU H;  1KRT A;  2VQE Q;  2VS1 A;  2NVQ H;  4LFA L;  1X65 A;  2AWN A;  5IYD H;  4HID A;  1UE7 A;  1TWF H;  3K8A A;  1VS0 A;  4YY3 L;  1IBK Q;  4DV5 L;  3TEH B;  1OXU A;  1A0I A;  2KCT A;  2JE6 I;  4PZ8 A;  4EX5 A;  4BBR H;  1UEB A;  2CWA A;  1VQO A;  4DR6 Q;  2F4V L;  1QUQ A;  2WB1 E;  1EQR A;  1D8L A;  1OXX K;  3OW2 A;  3TQY A;  1HNX Q;  1WFQ A;  3S2D H;  1VQH A;  4KHP L;  2K5N A;  1G6P A;  4JI6 Q;  3F2B A;  2RHQ B;  1I3Q H;  1U0L A;  1SFO H;  1E24 A;  2VL6 A;  2HHH L;  1K73 C;  1IBK L;  3G6E A;  4JV5 L;  5C4X H;  1MIU A;  4UPA A;  1QVF A;  4DK6 C;  3MEF A;  3H0G H;  4DKA C;  2I0Q A;  4GLA C; 
#chains in the Genus database with same CATH topology
 5EKI A;  1FJG L;  2HIX A;  3AB9 A;  5C4X B;  4F88 A;  5IE8 A;  2A6H C;  1BBX C;  1IL2 A;  4QY7 A;  5KND A;  1PH3 A;  1PYS B;  2NVX B;  2E2I H;  5GAG C;  3UE1 A;  1S72 A;  1I94 Q;  1PFM A;  4MTN A;  2A8V A;  1G2S A;  2ICE C;  5M3M G;  1IW7 C;  4J15 A;  2Z0S A;  1S5D D;  4B9X A;  4DR2 Q;  1L0Y B;  2Z4I A;  3KBX A;  3M3Y B;  5C44 G;  1EYD A;  1H9K A;  4X66 Q;  2KOL A;  1J5E L;  2Q2U A;  3RNU A;  2IWH A;  1NY4 A;  2VW9 A;  5J3B A;  4UAI A;  2V1C C;  1LT4 D;  2RCF A;  3NEM A;  3EFX D;  5CV6 A;  5BR8 L;  2LMC B;  4YWK A;  4OX9 Q;  4J8Q A;  4DN4 M;  2EY6 A;  2FFK B;  2ZJP A;  2NTT A;  3CCR A;  3MXN B;  2NVX H;  1SRO A;  4KK7 A;  5HGQ A;  3RLF A;  2Z4H A;  2BDN A;  1HR0 L;  1SND A;  2WB1 G;  4IPH A;  1B2T A;  4R8N A;  3NXW A;  2ZXO A;  5C3E G;  1TS2 A;  2WV6 D;  3SEB A;  4K0K L;  4DV4 Q;  2F0S A;  3F2C A;  2E5L Q;  3IRB A;  2ZM6 L;  1VF7 A;  1RIP A;  1R9T B;  5C3E H;  5IYC H;  1OXV A;  3TZD A;  1V1O A;  2Y0S G;  5EAY A;  1XPR A;  1KQS A;  4JBM A;  3HOV G;  5CV8 A;  4ZUJ A;  3H3V I;  4HIO A;  1SRU A;  1VDZ A;  3PUZ A;  5C0X H;  2YYZ A;  4EGV A;  1UE6 A;  5M3F G;  4JI2 L;  2L5T A;  1STH A;  5DLQ E;  5EKK A;  3TSS A;  1VQG A;  4IJH A;  3J80 E;  2YU9 H;  2X6L A;  2K33 A;  2QCP X;  3TP5 A;  1T5E A;  2NVY B;  3DUZ A;  3NUC A;  2UUA Q;  4HAE A;  1SYG A;  1PH5 A;  4A3B G;  2RA4 A;  4DR1 Q;  4BWG B;  4IOA A;  1NR2 A;  1PFB A;  4OIK A;  5IT9 L;  3K80 C;  5FJ8 G;  2IHF A;  5M3M H;  3P20 A;  2F0N A;  2DNC A;  2N49 A;  2HT1 A;  3NP8 A;  2ZM6 Q;  5IP9 G;  4NPS A;  4IFD G;  1DON A;  3E5S A;  2D0P A;  4QJF A;  4DAM A;  2RCN A;  3OSO A;  2Y0S B;  3R2T A;  5DNF A;  4PZ6 A;  5JPM C;  1QJO A;  3IFT A;  4DV2 L;  3NQT A;  1EQV A;  4A3F B;  1Y69 U;  1TR5 A;  5HY6 A;  2A68 C;  3I55 A;  4JI2 Q;  4NDX A;  3KYH C;  1XWE A;  3FKI B;  5FLX L;  1ZYR D;  4OX9 L;  5C3E B;  1PZI D;  4HJ8 A;  2F3W A;  3RZO H;  2DY7 A;  2EIF A;  2ENB A;  5EPJ A;  4A3F H;  1W6K A;  2UXD Q;  1Q12 A;  2DUD A;  2K01 A;  1LTB D;  4BXX G;  2N78 A;  3QR8 A;  1Z6H A;  3U4V A;  2B2Y A;  4A3K B;  4LUO A;  4B08 A;  1PH7 A;  1Y8O B;  4PMB A;  4DV4 L;  1QNU A;  1B53 A;  4IUN A;  4UP9 A;  4DUY L;  2OWO A;  4DR4 Q;  1G2T A;  1GUW A;  3I7F A;  1SE3 A;  1ENC A;  4DK0 A;  1U4M A;  5I9P A;  1C8C A;  5JJK A;  3BZK A;  2KEN A;  3CHB D;  4OWW B;  2Z9H A;  5GAD C;  1VQ7 A;  5IYB H;  4LF8 Q;  4CKC A;  3D4W A;  3J81 L;  1QZG A;  2R93 H;  4B3T L;  5AFW A;  1SNQ A;  2I5M X;  2AMC B;  2NN6 G;  3DHQ A;  5M3M B;  3AFQ A;  3H09 A;  5C6A A;  4ABN A;  1AH9 A;  1LTT D;  3T53 B;  1UUP A;  2L4N A;  3HOZ H;  1ILP A;  3MVV A;  3KF8 A;  1VMC A;  4C2M H;  4DV7 L;  3F1Z A;  1CI3 M;  2KVM A;  4C3I H;  4EQO A;  3HOX G;  5K36 G;  2DGY A;  2PZW A;  3GDE A;  1Y8N B;  2JEB I;  1JC7 A;  2A69 C;  2EYJ A;  1EIF A;  1EIG A;  3PSI A;  3EVQ A;  1ZXT A;  4MN3 A;  5G3L D;  5AJ3 Q;  1N36 Q;  1EWI A;  3PV0 A;  4N8X 1;  2F0E A;  2OTJ A;  2ZTE A;  1CKN A;  3HOY B;  4IPD A;  4JI6 L;  2J4X A;  2GVA A;  4A3G H;  4RFB A;  5C4J B;  2MO1 A;  4PZ7 A;  1EY0 A;  4UP7 A;  5C44 H;  1LT3 D;  2EYP A;  3UDG A;  3KF6 B;  4C3H H;  5IP7 H;  1L1O B;  4A3K G;  3BZC A;  3M7N A;  4DR6 L;  3K7A H;  3GTL H;  5EPK A;  3N6R A;  3OTO L;  4TVA B;  5M9O A;  1JOR A;  3QO2 A;  1LT5 D;  1O78 A;  1S5B D;  2HIV A;  2XN9 C;  3K81 C;  1JOO A;  2WIN B;  3U58 A;  4ZRZ A;  1HNZ Q;  5JVG 3;  1VQE A;  4JI8 Q;  2KHJ A;  3FKI G;  4QUF A;  1OXS C;  1BBU A;  4X3U A;  1HR0 W;  3C1E A;  4G7O C;  4QF4 A;  2CWP A;  2B8G A;  1XNR Q;  4DAY B;  1EFW A;  1V1P B;  3FVQ A;  2F0K A;  4LF9 Q;  2FMM A;  3HZX A;  2O4X A;  3QOJ A;  3RR5 A;  2AUJ D;  3G6J B;  2G9H D;  2Z6B A;  5GQO A;  4L8J A;  5EBC A;  3K5N A;  4OEM B;  2NTS A;  4QL5 A;  1VQ9 A;  4ME3 A;  1EU3 A;  2R6G A;  3QIA A;  2UUC Q;  2WFW A;  4JG2 A;  4ZCK A;  2F0H A;  1JT8 A;  3FPU B;  3L2P A;  2Z6K C;  3UDF A;  2IY5 B;  3VYR A;  1XX8 A;  2OT2 A;  4OO1 G;  2CH4 A;  3M4P A;  4DV7 Q;  2RHS B;  1PTO H;  3GTO B;  3RUZ A;  1S3O A;  2O5I C;  4KKS A;  5ELO A;  2KHI A;  3M4O H;  1FD7 D;  2EVB A;  3D6C A;  2SNM A;  1GKH A;  1ESF A;  4AH6 A;  1JE5 A;  1ROD A;  4GKJ Q;  1GUO A;  4DR6 Q;  5C4J H;  1DCZ A;  1Y1W G;  4M1U B;  1X3Q A;  5AJ3 L;  1WTV A;  2L9H A;  5IOD A;  4YIJ A;  3A74 A;  3HEJ A;  3KDF A;  4U67 3;  3Q0A A;  3D4D A;  1U4L A;  5FLX c;  3G48 A;  4Y7N B;  1PXU A;  1KDA A;  1X54 A;  3OMG A;  4A4I A;  2NVQ B;  1HRJ A;  4LMQ D;  2F52 A;  1TVX A;  5M5W H;  2F0I A;  1EZ8 A;  1STE A;  3AU7 A;  5CR3 A;  1I5F A;  2EJG C;  4RCO A;  4JI5 Q;  4IPC A;  5KGU A;  2PMZ B;  1PYB A;  1WTW A;  4GZY C;  2EYF A;  5I4D A;  2FXQ A;  4A93 H;  1GJX A;  3CCQ A;  1F9R A;  1XXG A;  1QE6 A;  1B8A A;  2R61 A;  4A3I H;  4POG A;  4JOI A;  3HOY G;  4IZ8 A;  3PF4 A;  3HOZ B;  4IOC A;  4HTH A;  1RL2 A;  4LF7 L;  4LFA Q;  2E2H H;  1XMO Q;  3SXH A;  4BY7 G;  3TDQ A;  1TS5 A;  1M8A A;  1IBM L;  3OIP A;  3CXC A;  2UXB Q;  1EYG A;  3IAY A;  3K57 A;  2YTX A;  2Q2T A;  3M3Y H;  3FP9 A;  1YZ6 A;  1DD2 A;  3I70 A;  3HOX B;  4ME5 A;  1VQL A;  4S3S A;  2ALY B;  5LHY 1;  4FVM A;  4KTA A;  2LXJ A;  1KNE A;  3J81 i;  2E2D C;  5IGD A;  2RBM A;  2K5D A;  2PW7 A;  1NMG A;  4LFC Q;  4GOP A;  2PYK A;  1EUJ A;  2F0F A;  4Q0F A;  1WCM H;  4CHT B;  4A3M G;  4DV3 Q;  2QGQ A;  2MGS A;  4DR7 L;  2B2W A;  4XQQ A;  2KEC A;  3J80 c;  1R4Q B;  1SR3 A;  3BYY B;  3K0X A;  3W1G A;  2HQL A;  4N9T A;  4HSP A;  4ID6 A;  4LF5 L;  1IL8 A;  3CW2 C;  5CC4 A;  4TKO B;  2I07 B;  2K6A A;  3PO3 H;  1CTM A;  1K8G A;  1F2Z A;  4K5W A;  3L7Z C;  1SLJ A;  2G9D A;  3CCJ A;  1WTH A;  4GOP B;  4WJW A;  4JYA L;  1FVI A;  5JEA H;  1EQQ A;  2HDM A;  5M5Y B;  1EY5 A;  2AQ3 B;  1NBW A;  4A3I B;  3S2H H;  1Z7T A;  3ONA B;  2XIW A;  1KAA A;  4YHH L;  3J81 c;  1HQM C;  1ICF B;  1LO5 D;  2JEA I;  2AHO B;  2UXC L;  4OHJ A;  2B39 A;  5JEA J;  2AWN A;  5ELC A;  1II3 A;  1TWF H;  3K59 A;  4YY3 L;  1IBK Q;  3TEH B;  2KCT A;  2ICI A;  3S15 B;  5KNB A;  2JE6 I;  1A3T A;  3NE5 B;  4X3K A;  2JA5 B;  1VQO A;  2F4V L;  5CV9 A;  1EQR A;  1PZK D;  4ZK9 B;  3OW7 A;  5C5M A;  1ZKO A;  2QKI C;  1KNA A;  1RKN A;  2F0M A;  2RHQ B;  1I3Q H;  2ZXR A;  2VL6 A;  2HHH L;  1K73 C;  4NP5 A;  4JV5 L;  3DWA A;  1DXM A;  1L0X B;  3MEF A;  1I6V C;  4H7B A;  3A55 A;  3K5O A;  5IT9 c;  3J80 L;  2R92 H;  5IGC A;  4A3B B;  3K5L A;  4NXN L;  1I3Q B;  2AWO A;  4FP5 D;  5HUR A;  4PG3 A;  4DR7 Q;  4GNX B;  1TS3 A;  4FDB A;  1GUS A;  1A3V A;  1CFM A;  2C5C A;  4XYQ A;  4X66 L;  1AN8 A;  1MGS A;  3RZD H;  1M4V A;  4X6A H;  4R4O A;  3GTM B;  1G6Z A;  5C0X I;  2BH2 A;  4NXN Q;  3RLO A;  1TWF B;  4OXP A;  1MKH A;  2OCE A;  3TME A;  3K58 A;  2UUA L;  2XRS D;  2Z8L A;  4IO9 A;  4DF7 A;  1SNO A;  3MXN A;  2RSN A;  2TMP A;  1SYF A;  4CDC C;  4HMI A;  2HUG A;  4G7Z C;  1CSQ A;  3V05 A;  1K3R A;  3I4M H;  3HOW G;  1ZEQ X;  5CV4 A;  3M4Q A;  5EGT A;  4B3M Q;  3ERO A;  4KMU C;  4R8I A;  3I4N G;  1Q46 A;  4A3D G;  3NTI A;  1IXR A;  2YV5 A;  4KKT A;  1YI2 A;  3A7A B;  5LMN L;  1BCP D;  5COY A;  3PIO A;  2ZXP A;  1N34 L;  1IYU A;  4P74 A;  5KEE A;  2H4O A;  1QIL A;  5KYL A;  5FLM H;  2EYL A;  2JA5 G;  3CPF A;  4EVO A;  1QWY A;  4ILW A;  4K5X A;  1UE1 A;  3Q8D A;  1UAP A;  2MNA A;  4A3E H;  1GUN A;  1WCM B;  1WD1 A;  1FNV A;  1BCP C;  2E8G A;  4JVZ A;  1SJE D;  4IUP A;  4KY6 A;  4P2C B;  1KAB A;  3KJO A;  3M85 A;  3L9A X;  1HZA A;  1XYI A;  3PIP A;  4IJL A;  2N55 A;  3PMF A;  1CHQ D;  3VYS A;  1KLG D;  3HOU G;  4ULL A;  1LTA D;  2B2T A;  4A3L H;  4DA2 A;  2ZJQ A;  3P1H A;  3Q22 A;  1AE3 A;  3D6W A;  1Q86 C;  3J7A F;  3CRL C;  2VUM G;  4X3S A;  1NUC A;  2PZU A;  3ULP A;  2JA8 B;  1AEX A;  4JI1 Q;  1N33 Q;  1FYC A;  3K6O A;  2Q8R E;  3A56 A;  3SHL A;  3T1Y Q;  3CME A;  5FOB B;  3S1R H;  2K5W A;  1RD9 D;  1SDF A;  4RAU C;  1Q7Y C;  4F87 A;  1PFS A;  1Y1W H;  2E75 C;  1QB5 D;  5M5X B;  2EYH A;  4A3M B;  1VQ5 A;  2I5L X;  4FNF A;  5L37 A;  2B2Y C;  4DR3 L;  2A19 A;  3ZJY C;  2VNU D;  5KIX A;  3DM1 A;  1PH8 A;  3RN2 A;  4DFA A;  1GM5 A;  1Q1E A;  4HJ5 A;  2F3V A;  1C4Q A;  3AFP A;  1KC8 C;  1LTS D;  5BN4 A;  1CA5 A;  2GA4 B;  2L11 A;  3LNN A;  4IUV A;  1TWC B;  1F2M A;  1TKW B;  1XMQ L;  2EDG A;  4DR3 Q;  2EY2 A;  2TSS A;  1FR3 A;  3E6Z X;  2KHS A;  3MZ5 A;  4LUZ A;  2SDF A;  3RMH A;  3P75 A;  4DV6 Q;  1Z9F A;  2HDL A;  4N9P A;  5FO9 B;  3NEN A;  1SXT A;  2AQ2 B;  1XMQ Q;  3A7L A;  1AW7 A;  2LSS A;  3HRZ C;  4O2D A;  3GTK B;  1DJR D;  4X64 L;  1LYL A;  1YNN D;  1PH4 A;  2PQA B;  5ELF A;  3GV6 A;  4NMZ A;  3SDZ A;  1K0R A;  5KRU A;  1Y14 B;  2EJM A;  4XT3 B;  2XRQ D;  3PO2 G;  1SEB D;  1VCI A;  4DV5 Q;  2ZTC A;  4BBR B;  3WOE A;  4DK3 C;  2B2T C;  1C0A A;  2K32 A;  1LUZ A;  3RLN A;  1JJ2 A;  2A1A A;  3U4Z A;  2EYO A;  4KI0 A;  4C3I G;  3HOX H;  4HJ9 A;  4ODG A;  1VQF A;  1HNZ L;  1HTL D;  5ISR A;  3QOL A;  1VQC A;  2I46 A;  3NHH A;  3KLS A;  4PMC A;  1PHJ A;  2E2J B;  2F0G A;  3DWQ A;  2K75 A;  2A6E C;  3BDC A;  3VDY A;  1BO0 A;  4FXK C;  5DEH A;  3JAM E;  3MTS A;  4KJN A;  1KAW A;  1GHK A;  4IAL A;  1I4G A;  1S40 A;  1SYE A;  4A93 B;  1PLF A;  3TP7 A;  4OO1 I;  1A2T A;  1ML0 D;  1EIY B;  2AQ1 B;  4NW2 A;  3FHW A;  4OO1 H;  1R4P B;  3TP8 A;  3D4R A;  3J7Y W;  3ND8 A;  3GTL B;  1TWG H;  5K36 H;  1FNW A;  1A63 A;  1RJT A;  4RHS A;  3T56 B;  2DN8 A;  4P72 A;  4Y52 H;  1EWC A;  2L0C A;  3PO2 B;  1QG7 A;  3PO2 H;  3QB3 A;  1E1O A;  4JI8 L;  4CBV A;  4IPG A;  3OIQ A;  4HN7 A;  1KHI A;  1X3G A;  1EFI D;  5CV7 A;  4JI5 L;  1TQO A;  1I94 L;  2B63 B;  3A5U A;  1F77 A;  1PMR A;  1PTO B;  2K28 A;  3GTO H;  3T1H L;  5EJW A;  2B8F A;  4PQX A;  1B1Z A;  1TWA H;  5HGT A;  4YCW A;  1KIX A;  1IBL Q;  1I4R A;  5T1G A;  3J80 i;  4IUQ A;  4V19 0;  4X64 Q;  4A3J G;  1WOC A;  1Y8P B;  4HED A;  1MD2 D;  2R7D A;  3TS2 A;  4EQ5 A;  4GN5 A;  1ASY A;  3S1M H;  1A8V A;  1DGS A;  1VQJ A;  4JW0 A;  3KLS X;  1J5E Q;  4BXX H;  1ZYR C;  3EQL C;  3CCL A;  1CUK A;  2ES2 A;  1STA A;  1PH6 A;  4KD4 A;  1SJH D;  1LTG D;  2ZT9 C;  3ERQ A;  1IYJ B;  4AYB G;  1M1K C;  4LFC L;  1I6H B;  1JB3 A;  3BS1 A;  5M5W B;  1H95 A;  1CM9 A;  4DAY A;  2K04 A;  1XPO A;  4JI7 L;  2E5L L;  3WOF A;  1Y1V H;  4HSV A;  1S5F D;  3MAQ A;  2E76 C;  3CU7 A;  1T9H A;  3I4O A;  1HZB A;  5EBD A;  1E7Z A;  1VQI A;  3X3M A;  2X6G A;  2PO4 A;  4E6I A;  4YCV A;  3RZO B;  3E0J A;  3MC0 B;  3L0O A;  3HOW H;  4KY7 A;  1XNR L;  3GTJ H;  5CMD A;  1WTO A;  4A3J B;  4H44 C;  2CFM A;  2JK8 A;  1Q1B A;  2PW5 A;  4R4T A;  4XDX A;  1N34 Q;  4BY7 B;  1HNX L;  1PRT F;  1WTP A;  2BH8 A;  3G7L A;  2N8N A;  2IX3 A;  5JOB A;  2SEB D;  2VY3 A;  1PRT B;  4KY5 A;  3N52 A;  4ZKC B;  1CHP D;  4C3J G;  5H1S E;  2XNA C;  1I6H H;  4RKL A;  2QIL A;  1BF4 A;  3S1Q B;  1KXL A;  4GLV B;  1W2B A;  1PVO A;  4DUZ L;  3D3R A;  4O1N A;  4LF5 Q;  3AEV A;  5C3X A;  1TY2 A;  3R93 A;  3BVZ A;  4I7A A;  2F4V Q;  2G5D A;  1KTK A;  4KHP Q;  2X69 A;  1PTO D;  4DNT B;  3URY A;  2AUK A;  1DOK A;  2KED A;  1I4H A;  2MFI A;  1LM0 A;  2OF1 A;  3FDT A;  3GTG H;  4OON A;  3CCU A;  2MHV A;  2A74 C;  1STG A;  2NZ1 D;  1WVL A;  2PQA A;  4LK1 C;  5IGG A;  1N33 L;  2J7Z A;  5IYC G;  2VB2 X;  1HNW Q;  1K28 A;  2F0T A;  3I91 A;  3D0F A;  3NEL A;  1LTL A;  2D5D A;  4BA2 I;  4FF3 A;  4DR1 L;  4A3J H;  5IWA Q;  2LXK A;  3GTJ B;  4BBS B;  2OTL A;  3VR4 A;  1U4P A;  1JR0 D;  2UXD L;  2RQX A;  3BDO A;  3K7A B;  3AYH B;  3PUW A;  4C1N I;  2N88 A;  2DNE A;  3SK4 A;  4LNQ A;  3VR5 A;  1J6Q A;  2RSO A;  5CYU A;  1VQ6 A;  1D1I A;  1HQR D;  1EEF D;  3NPP A;  3J7A 5;  1A6X A;  2WKC A;  2B2V C;  1TWC H;  5I6W A;  5J22 A;  5FO7 B;  1UNS A;  3ER0 A;  5GRO A;  4BY1 G;  2XSC A;  4BBS H;  4L6T B;  4B3M L;  3MFG A;  3UDX A;  3STB D;  2QEJ C;  5DM6 3;  3E0E A;  3EBE A;  1HA6 A;  2A6E D;  3KFU A;  1EYA A;  2BA0 A;  3R2I A;  4JPB W;  1QVG A;  4A3M H;  2PZT A;  1JMC A;  1LT6 D;  1IZ6 A;  2ZTD A;  5I9O A;  3GTG B;  2JA6 H;  1D5M C;  2K5V A;  2XVS A;  4J1M A;  3UI2 A;  1YHB A;  2EY1 A;  2JA8 H;  5C0X G;  2F0Q A;  1CK1 A;  1X65 A;  4PNY A;  3K8A A;  3E3X A;  1TWA B;  4H0L C;  1A0I A;  2CW0 D;  4TSS A;  1WTQ A;  5I2X A;  4EX5 A;  4I65 A;  5KNC A;  2HQE A;  4BBR H;  2CWA A;  2K5Q A;  1QUQ A;  2WB1 E;  3QJY A;  4K2L A;  3TQY A;  2E2I B;  1U4R A;  2NBF A;  1A3U A;  4KHP L;  1PYW D;  2K5N A;  5D3I B;  1B9M A;  3VA7 A;  3F2B A;  1EY4 A;  1JE4 A;  3A8J E;  2MP1 A;  1EOT A;  3J81 E;  4UPA A;  1QVF A;  2HD3 A;  1TWH B;  3H0G H;  2L55 A;  4GLA C;  1RTN A;  1WD0 A;  1NSN S;  1B3A A;  5D14 A;  1TWG B;  1KLU D;  2YTY A;  1MI2 A;  1LTR D;  2M9V A;  3TZU A;  2VUM B;  2UUB Q;  3TBI B;  3GTP H;  2NYZ D;  4OL7 A;  1F2Y A;  3ZYY X;  4CKE A;  2AKW B;  1X56 A;  3PCO B;  3PQI A;  2XWB B;  4K2K A;  4NXM L;  1WYD A;  1X3P A;  1LV9 A;  2K14 A;  3BU2 A;  4YWL A;  3I4M B;  4R1J A;  4ZYS A;  3VR6 A;  2K5H A;  4DV0 Q;  3HKS A;  1IW7 D;  2EYM A;  2F3I A;  5TSS A;  2B29 A;  3KDF B;  5IGB A;  3GTM H;  3J7A V;  3K5M A;  4C1N K;  1NNX A;  3I73 A;  3TP6 A;  2M2L A;  1RDP D;  5CBE E;  2K50 A;  1X3F A;  2NN6 I;  1WTR A;  4JI4 L;  2PCF B;  1V43 A;  1HUM A;  2IT1 A;  1TT2 A;  4A3D B;  4WJ3 M;  3MXP A;  3OYY A;  2F0P A;  3HKZ B;  3PUV A;  3GTK H;  4A3C G;  2PPB C;  3NWT A;  3OPO A;  3M7G A;  2R3Z A;  3F2U A;  4QUC A;  1SSO A;  4XQN A;  1Q3L A;  3EJI A;  5DAU A;  4DNR B;  5JVH 3;  1QNK A;  5JPN C;  4IFD H;  2JP1 A;  4FYD A;  4MHE A;  4B3R L;  4QB4 A;  5E7N A;  2F03 A;  3F2D A;  3RN5 A;  2N3S A;  3NK9 A;  2F0W A;  1EU4 A;  3SK5 A;  4B3S L;  2F0O A;  3T16 A;  4FF1 A;  2WKD A;  3S1N H;  1EOV A;  3JAM L;  1CKM A;  4BS9 A;  4GKK Q;  4CKB A;  4LWC A;  1D1K A;  3S14 H;  5JJI A;  4XYO A;  4CDE C;  5C3W A;  2DJG C;  4K6L A;  4A3E G;  1XMO L;  2FMC A;  1YEZ A;  1GO3 E;  5FLX E;  1GUT A;  4JI3 Q;  4RKB A;  3I4N H;  2A6H D;  5M3F B;  4BBS G;  2JXM B;  1CKO A;  3W2D A;  4B3T Q;  3HOV B;  1JOQ A;  1YNX A;  1XJV A;  1K0S A;  1HTP A;  4XXE A;  3GD7 A;  3S16 B;  2RF4 A;  4DK1 A;  4JI4 Q;  3A5Z B;  4DUZ Q;  4RCN A;  2R93 G;  1VF5 C;  4WRD A;  3GTQ B;  3HKZ G;  4DU9 A;  1S4Z A;  1JJC B;  1YHQ A;  4ZKB B;  2H5X A;  2MUY A;  4DPG A;  4WOR A;  4UHV A;  4JI1 L;  3LWE A;  4LF7 Q;  2SOB A;  1X55 A;  3CCS A;  1XPU A;  5FLM G;  4MTK A;  2A68 D;  3VYT A;  4LF4 L;  1D7Q A;  2K4K A;  3HP3 A;  3T13 A;  1B4O A;  1K8O A;  1C9O A;  1O7Y A;  3GTQ H;  4A3G G;  2OXP A;  3PIP 3;  5BN5 A;  2VQF Q;  1V1P A;  3CRK C;  3V96 A;  4K8J A;  3S17 B;  1Q81 C;  3U9S A;  5FKA C;  1BNZ A;  1PZJ D;  1JB7 A;  4RMF A;  4WJ4 A;  3I4M G;  3S14 B;  2B2W C;  1JWS D;  2CW0 C;  5M3F H;  1B70 B;  5EKL A;  2B2V A;  3IL8 A;  2B3G A;  2F1M A;  3TN2 A;  4RGO S;  2Q2I A;  2A69 D;  2F0L A;  3P7J A;  5I2Y A;  4RG1 A;  4PMW A;  3I90 A;  3SGI A;  5J39 A;  4UDU C;  1CSP A;  3F8T A;  3GV3 A;  4Y7N H;  1PRT D;  1UEA B;  2Z6K A;  3T4A C;  2NZO A;  4BY7 H;  2VXW A;  3BYT B;  3RZD B;  3PO3 B;  1SNC A;  5A2Q E;  1QZH A;  1F9S A;  3V2T A;  4JYA Q;  2JN4 A;  2VZA A;  2KCC A;  3SK8 A;  2Z1C A;  3M4O B;  1UE5 A;  3WWV A;  3ND9 A;  4C3H B;  1EZ6 A;  1VQ8 A;  2Q2H A;  1HJP A;  4AYB B;  4HMJ A;  4YHH Q;  4AIM A;  5C4Z A;  4A3G B;  3TRZ A;  2DY8 A;  1SMY C;  5IGE A;  3CC2 A;  4HIK A;  1J9O A;  4FXD A;  1L1O C;  2RKS A;  5F2D A;  1K83 H;  3JAM i;  4KV6 A;  5D3D A;  3GO5 A;  1ASZ A;  4RHR A;  4HCS A;  4JI0 L;  1AZP A;  2JA5 H;  1D5Z C;  1VQK A;  2YTV A;  3NWS A;  3EA6 A;  3EN2 A;  4LJZ C;  1BUV T;  5GAE C;  2IHE A;  3BVG A;  1FGU A;  3HOV H;  3BVM A;  2XGT A;  4JOI C;  1JJG A;  2IPK D;  2GVB A;  3W1B A;  4JI0 Q;  5IGF A;  3MA2 B;  1RCV D;  1KDC A;  1D6E C;  3NTH A;  1E2V A;  3T51 B;  1G29 1;  2KCN A;  3S2H B;  4XTC S;  4BY1 B;  1HZC A;  3CPW A;  3NBH B;  3S9W A;  1IKL A;  1HR0 Q;  2O5J C;  1PTO F;  1AE2 A;  1K9M C;  1EL0 A;  1SYB A;  1YNN C;  1BBW A;  3J7Z C;  3JAM c;  4K0K Q;  1E3P A;  1K8M A;  3I2Z A;  1OO9 B;  2EY5 A;  1O80 A;  3W5O A;  1EWH A;  5CBA E;  3CCE A;  3GTP B;  5DM7 3;  3HOY H;  1STY A;  4ZUI A;  3KJP A;  2A5H A;  2L1B A;  2KCM A;  5IY0 A;  1VQD A;  3SR1 A;  2UXC Q;  1JIC A;  1RF2 D;  1TY0 A;  4K5V A;  3FKI H;  4XQJ A;  3Q24 A;  1DYQ A;  3VA5 A;  2R7Z B;  1D2B A;  1JWM D;  3SE0 A;  4JBW A;  4I7Z C;  1F2L A;  1YJ9 A;  4LF6 Q;  1I50 H;  4MZ9 A;  4C3I B;  4L63 B;  2XWJ B;  1HA5 A;  2D62 A;  2MJ8 A;  4IUU A;  4OEL B;  4GLX A;  5G3L F;  3H15 A;  2K52 A;  3H94 A;  1MSG A;  1NE3 A;  1LAB A;  5JJL A;  1SYD A;  1O7I A;  4LW1 A;  2QDL A;  4DAV A;  3LX0 A;  1Q8K A;  1HUN A;  2EZV A;  4AYB E;  4OWX B;  3M9B A;  4TQU S;  3A54 A;  3I3C A;  1G51 A;  1O7L A;  3CMA A;  4KJO A;  2JA7 B;  1XTD A;  3KBG A;  5ELD A;  1KRS A;  5FO8 B;  2CCZ A;  1HNW L;  1E2Z A;  3NBH A;  1NMF A;  3G71 A;  1SN8 A;  2O2L D;  3OOC A;  2WAC A;  2PI2 E;  2D0O A;  3SK6 A;  3CD6 A;  1O7Z A;  3KLR A;  3PO3 G;  4DV2 Q;  1X32 A;  1STN A;  4B3S Q;  1XTC D;  2EOT A;  2F0J A;  2VUM H;  2RDH A;  3IFD A;  3EIV A;  5C5L A;  1PH2 A;  1CZG A;  1YNJ C;  5CGK A;  4DR5 L;  3QG1 A;  1Q82 C;  4CGY B;  1A62 A;  4DV0 L;  1I4P A;  3UE0 A;  5IIF A;  1WJJ A;  4JK1 C;  2EE1 A;  5COR A;  1HPC A;  3CCM A;  4A76 A;  3K0Y A;  4JC0 A;  2WAQ E;  4QIW B;  1W3S A;  4P73 A;  1YVC A;  1BVS A;  1EY7 A;  2PQE A;  4F7X A;  4ZAI A;  5C4X G;  3MXG A;  2KUM A;  3I56 A;  1V8Q A;  3LWU A;  4KHV A;  5ELB A;  1QUQ B;  5E4X A;  1EY8 A;  2ID0 A;  4K14 A;  4KKU A;  4HJ7 A;  1HHV A;  4LF8 L;  4GOP C;  2JA7 H;  4IFD J;  4XIG S;  4LF6 L;  3HOU B;  1N36 L;  4OGQ C;  4L5T A;  4DNI A;  1Q8I A;  4MNO A;  1SYC A;  4L5R C;  4CDF C;  4G57 A;  1CQV A;  1K8A C;  3KUP A;  3S1Q H;  2E2H B;  2FIN B;  2RDG A;  4O42 A;  2R93 B;  1P8L A;  4LF4 Q;  2YU9 B;  1B7Y B;  3HOU H;  1KRT A;  1S5E D;  5CV5 A;  2VQE Q;  5IYD H;  1HFG A;  1D5X C;  1UE7 A;  5A35 A;  4J6H A;  5E1F A;  4DV5 L;  1SNP A;  2KEE A;  1BR9 A;  1D8L A;  1OXX K;  2SNS A;  4DXG A;  3MHB A;  3S2D H;  2BOS A;  1H9J A;  4JI6 Q;  1U0L A;  4LAA A;  1SFO H;  3Q23 A;  1E2W A;  5ELE A;  5C4X H;  1IYV A;  4A3E B;  2I0Q A;  2JSO A;  3BJU A;  1L0W A;  3S24 A;  4QGU A;  3HOW B;  2NWG A;  4O0A A;  4TRD A;  1RTO A;  4GNX C;  1J8I A;  3HGB A;  5C4H A;  1YHA A;  4APV A;  3ULJ A;  3MWY W;  3QWN A;  4CJ2 C;  4RGT A;  1IBL L;  1QVC A;  2F0U A;  1SMY D;  1ENF A;  1W6J A;  2EXZ A;  2HCC A;  3Q6S A;  4DAP A;  2M00 A;  4A3D H;  4BY1 H;  1AFP A;  4DV6 L;  4C2M B;  2WP8 J;  4QQB X;  1I4X A;  4X62 L;  4A3C H;  3D31 A;  1TII D;  3C2P A;  3S1M B;  2E2J H;  4IFD I;  4G4K A;  1YNJ D;  3OMC A;  2BDO A;  3C3L A;  4K8I A;  2MO0 A;  1H9R A;  3KF8 B;  3BDL A;  3KF6 A;  2WB1 B;  4IUT A;  2FHT A;  4L5Q A;  2JA9 A;  4B9W A;  2VQE L;  1X9N A;  1EEI D;  1HZ9 A;  2DJF C;  3I72 A;  2OQ0 A;  1PDQ A;  4IQZ A;  1BDO A;  3R3O A;  1PA6 A;  1YJN A;  2JA6 G;  2F4I A;  4A3B H;  3CCV A;  1VQM A;  1CQF A;  4RH6 A;  3KK7 A;  1SAP A;  4GN4 B;  2K03 A;  1FNU A;  4ZQ3 A;  2ASB A;  1C48 A;  2WII B;  2Y0S E;  3FPP A;  1MJE A;  2EQS A;  2OEO A;  1BCP B;  3H3V H;  2E74 C;  3MFY A;  3GQB A;  4UP8 A;  4HCE A;  2ATW A;  4X62 Q;  3X3N A;  5C44 B;  3OWF A;  1EYC A;  1SE8 A;  4CJ0 B;  4AQY L;  4YCU A;  1PH9 A;  2KQ3 A;  1A15 A;  2RVL A;  3DEO A;  1KD1 C;  2PNH A;  4HIM A;  3O13 A;  1EY6 A;  2MQH A;  1MBY A;  3AQQ A;  1NJI C;  3S2D B;  3H0G G;  4GS3 A;  4X3T A;  2BE5 D;  1N8R C;  1V1Q A;  4QIW E;  4GNX A;  2QF7 A;  1XNQ Q;  4OWT B;  2NN6 H;  3DM3 A;  5M5Y H;  3C46 A;  3R8B A;  4R9W A;  2OQK A;  2JA8 G;  1LAC A;  1H9M A;  2CQA A;  5A2Q L;  2HHH Q;  5T1I A;  4JV5 Q;  4CJ1 B;  3G4S A;  3S1R B;  3IKJ A;  2NVY H;  4EQP A;  1FJG Q;  5JJZ A;  1XNQ L;  3WDN A;  5BR8 Q;  4R4Q A;  2C35 B;  1VQB A;  1IBM Q;  3NBI A;  3A8K E;  4MIU A;  3U50 C;  1CZW A;  1N9W A;  2D2C C;  4Q5V A;  4RGM A;  4L5S A;  4RWS C;  1WCM G;  2K7V A;  3LGJ A;  1QOH A;  2R7Z H;  2RDF A;  2KA7 A;  5C0X J;  1WI5 A;  3TRE A;  3AMU A;  3DEP A;  4BA1 I;  3U9O A;  3W3A A;  4EQN A;  2H1E A;  2F0V A;  1PH1 A;  4DV1 Q;  4POF A;  3PIO 3;  1LLR D;  1EQT A;  4LFB L;  4R4I A;  1EIH A;  1OXT A;  4Z9C B;  1SFO B;  4KN4 C;  3OHX C;  4H02 A;  4AQY Q;  1V9P A;  2NB0 A;  3I4N B;  1BOS A;  1LTI D;  4DV1 L;  3VR3 A;  4QCL A;  3BZD B;  4GN3 B;  1GUG A;  1Z47 A;  2CHB D;  2WAQ B;  3K7U C;  2B2U A;  4YWM A;  5IWA L;  1YIT A;  2IL8 A;  3I4L A;  1SE4 A;  2NZH A;  2J0T D;  2IW3 A;  3T1H Q;  1AZQ A;  1Y1W B;  1GOZ A;  3OTO Q;  2R92 G;  3PUY A;  4FXG C;  1GHJ A;  4DR4 L;  1UWV A;  4A93 G;  2R7Z G;  1X3E A;  2LY7 A;  5IT9 E;  4FF2 A;  1L2F A;  1ONL A;  1VQA A;  1Q90 A;  2QW7 A;  5M5X H;  4U68 A;  1JWU D;  1BKB A;  4H13 C;  2QEX A;  1L1O A;  3PUX A;  4NKL A;  1NTG A;  1IHZ A;  1ENA A;  1VQN A;  2CKZ B;  4C3J H;  4LFB Q;  2JYO A;  3PF5 A;  1TS4 A;  1QCB D;  1BCP F;  1P16 A;  1E1T A;  1DM0 B;  3H3V C;  1VQ4 A;  4JBJ A;  3HKZ E;  1I4Q A;  2HCI A;  3T1Y L;  1I50 B;  1E0B A;  2L12 A;  2UUC L;  4DUY Q;  1MHW C;  3D8G A;  3I8Z A;  4RA8 A;  4F8M A;  1SNM A;  1U5K A;  2UUB L;  1GXD C;  1R9T H;  4C3J B;  3CAM A;  3A0J A;  3NTK A;  3NQI A;  5IYD G;  1JOK A;  1PTO C;  5ELN A;  2NVT B;  5LMN W;  4NXM Q;  1G8Z D;  1A2U A;  2BCO A;  4HJA A;  4RGN A;  2PNR C;  1Y1V B;  4X65 L;  2Q8T A;  4JCV E;  4JBK A;  1CT1 D;  3L3O C;  4A3I G;  4GKJ L;  1FL0 A;  1FGB D;  5LL6 S;  2PMZ E;  3A8I E;  1STB A;  1HH2 P;  1MSH A;  1YIJ A;  1ESR A;  1GVP A;  4C56 C;  1CKN B;  1M90 C;  4G7H C;  1YBY A;  2BA1 A;  5LMU Q;  1GD7 A;  5LMN Q;  5D65 A;  1NCV A;  4ZLT F;  1DOL A;  4IN3 A;  4R4C A;  4C3H G;  5JAV A;  5LL6 X;  5IP7 G;  3CF5 A;  2NVT H;  4A75 A;  2KJX A;  1VMP A;  2QA4 A;  3VR2 A;  4ALP A;  2ZJR A;  3ICE A;  3CC7 A;  1E22 A;  1JCK B;  3H91 A;  5E4W C;  3DLL A;  1G91 A;  2EPB A;  4XT1 B;  3STB C;  1KDB A;  3TS0 A;  1TWH H;  3H0G B;  3MXU A;  3CQZ B;  1N32 L;  2D9U A;  4QMG A;  1SBB B;  3NSW A;  1F9P A;  1MJC A;  2GN5 A;  3E9I A;  3H6M A;  4B3R Q;  2B63 H;  4KLK A;  1AP0 A;  5FK9 C;  1Y1V G;  2UU9 L;  4FO2 A;  3OWE B;  2MPM A;  2JJQ A;  1N32 Q;  3C1F A;  5NUC A;  1BXT A;  1WTX A;  2JA7 G;  1PRT C;  2IX0 A;  1SE2 A;  3PGZ A;  3SVM A;  2A73 B;  1B9N A;  4WFN 3;  3HOZ G;  4DV3 L;  5IYB G;  2V4D A;  1JQY D;  4A3L G;  4LUV A;  1H9S A;  2LS0 1;  2B63 G;  4X65 Q;  2VB3 X;  4KHZ A;  2JA6 B;  3S15 H;  1X6O A;  2QDB A;  2R7F A;  1ICW A;  1NR4 A;  1TXY A;  3UDI A;  4DGZ A;  1NAP A;  4P71 A;  3FRP B;  1OTC A;  4JI7 Q;  1PFN A;  2IX1 A;  3E9H A;  3M4Y A;  3FMC A;  3S1N B;  1RHP A;  1HCZ A;  5GAH C;  2FJ2 A;  2I5H A;  3KOJ A;  3DXJ C;  2K05 A;  4A3F G;  1PV4 A;  3CP0 A;  3BG3 A;  1DZ1 A;  4A3K H;  3VYU A;  3HG9 A;  4DXF A;  5I6Y A;  1CA6 A;  3S17 H;  2EXD A;  3GP7 A;  5LMU L;  1ILQ A;  3ERS X;  4NB3 A;  1ET6 A;  2JQO A;  2UXB L;  4GKK L;  1KL9 A;  1EY9 A;  1K3B C;  4N8F A;  3JC6 6;  1YJW A;  1K83 B;  4KD3 A;  4YY3 Q;  1C7Y A;  2R92 B;  4V0B A;  3CQZ H;  1S5C D;  4JI3 L;  1T5X D;  1VQP A;  4LF9 L;  3B6Y A;  3HS0 C;  2PI2 A;  2WAQ G;  3J81 j;  2XTI A;  4P75 A;  5FJ8 H;  2VQF L;  4UY8 C;  2Q8I B;  4BBR G;  2CH4 W;  1HXY D;  4FF4 A;  5JEA G;  2P5Z X;  4DR2 L;  2EJF C;  3ULL A;  1TU2 B;  3S16 H;  3KLW A;  3CC4 A;  1IKM A;  5K5P A;  2L15 A;  2LFN A;  4IUR A;  2CVR A;  1SMX A;  3CKI B;  2IJ0 A;  5E3F A;  3RD4 A;  2KBN A;  2UU9 Q;  3HFZ B;  1B50 A;  4K6D A;  1H9S B;  1U9R A;  5IOC A;  4KN7 C;  5BN3 A;  5J1Z A;  2CQO A;  4DR5 Q;  2NVQ H;  2C9O A;  2VS1 A;  4LFA L;  4HID A;  3DWP A;  1BQQ T;  1ET9 A;  1VS0 A;  1HFN A;  2B2U C;  4CDD C;  1OXU A;  4HR7 B;  1DOM A;  2BE5 C;  3ITP A;  4PZ8 A;  1B3Q A;  2LKV A;  3FEW X;  1UEB A;  4OIJ A;  3OW2 A;  5EQ0 A;  2F0D A;  1HNX Q;  1B44 D;  1WFQ A;  3DMU A;  1VQH A;  2K1B A;  1G6P A;  2NUC A;  4M8A A;  5EPL A;  1F9Q A;  1IBK L;  3MEH A;  3G6E A;  1MIU A;  4DK6 C;  4PV1 C;  5KYI A;  1E24 A;  4DKA C;  5IP9 H; 
#chains in the Genus database with same CATH homology
 1FJG L;  2HIX A;  5IT9 c;  5IE8 A;  3BJU A;  1L0W A;  3S24 A;  4QGU A;  2R92 H;  1JJG A;  4NXN L;  1IL2 A;  2AWO A;  4QY7 A;  4O0A A;  1PH3 A;  1PYS B;  2YTY A;  4PG3 A;  4GNX B;  4GNX C;  4DR7 Q;  1YHA A;  4FDB A;  4APV A;  3ULJ A;  2E2I H;  5GAG C;  3UE1 A;  4X66 L;  1S72 A;  1I94 Q;  1IBL L;  4MTN A;  2UUB Q;  2A8V A;  3GTP H;  3RZD H;  1QVC A;  4X6A H;  4R4O A;  5M3M G;  5C0X I;  2BH2 A;  2AKW B;  4J15 A;  4A3D H;  2Z0S A;  1X56 A;  3RLO A;  4BY1 H;  4NXN Q;  4DR2 Q;  3PCO B;  4OXP A;  1MKH A;  2OCE A;  2WP8 J;  4DV6 L;  4QQB X;  2UUA L;  4X62 L;  4NXM L;  4IO9 A;  4A3C H;  1WYD A;  3D31 A;  5C44 G;  2K14 A;  3BU2 A;  4YWL A;  4X66 Q;  4R1J A;  1CSQ A;  1J5E L;  1KXL A;  2Q2U A;  3RNU A;  2E2J H;  4IFD I;  2K5H A;  1NY4 A;  1K3R A;  3I4M H;  3HOW G;  3M4Q A;  2VW9 A;  5J3B A;  4B3M Q;  4DV0 Q;  3HKS A;  2V1C C;  2MO0 A;  3KF8 B;  3NEM A;  1Q46 A;  3I4N G;  2F3I A;  4A3D G;  3KF6 A;  2B29 A;  3KDF B;  3GTM H;  5BR8 L;  1IXR A;  2YV5 A;  4YWK A;  4L5Q A;  2JA9 A;  2VQE L;  4OX9 Q;  1X9N A;  1YI2 A;  5LMN L;  3PIO A;  1HZ9 A;  2ZJP A;  1N34 L;  3CCR A;  2OQ0 A;  3MXN B;  2NVX H;  1SRO A;  2K50 A;  5HGQ A;  1X3F A;  3RLF A;  5FLM H;  4P74 A;  2JA5 G;  1HR0 L;  2NN6 I;  4JI4 L;  2WB1 G;  3CPF A;  4IPH A;  1V43 A;  1YJN A;  2IT1 A;  1PA6 A;  5C3E G;  2JA6 G;  4A3B H;  4WJ3 M;  3OYY A;  3CCV A;  1VQM A;  1UE1 A;  4K0K L;  3PUV A;  3Q8D A;  3F2C A;  4DV4 Q;  2E5L Q;  3IRB A;  4GN4 B;  3GTK H;  2MNA A;  4A3E H;  4A3C G;  2ASB A;  2Y0S E;  1MJE A;  2EQS A;  2ZM6 L;  2E8G A;  1RIP A;  3H3V H;  5C3E H;  5IYC H;  4UP8 A;  1OXV A;  3KJO A;  3M85 A;  2ATW A;  2Y0S G;  5EAY A;  1XPR A;  4X62 Q;  1KQS A;  4JBM A;  1HZA A;  3HOV G;  3H3V I;  3PIP A;  4IJL A;  4HIO A;  1SRU A;  3PUZ A;  3HOU G;  1SE8 A;  2YYZ A;  4B3R L;  1UE6 A;  5M3F G;  4AQY L;  4YCU A;  1PH9 A;  4A3L H;  4JI2 L;  2ZJQ A;  5E7N A;  1AE3 A;  1Q86 C;  5DLQ E;  3F2D A;  3RN5 A;  2PNH A;  4HIM A;  1KD1 C;  2VUM G;  2N3S A;  1VQG A;  2MQH A;  4IJH A;  3AQQ A;  1NJI C;  3ULP A;  3H0G G;  2YU9 H;  4B3S L;  4JI1 Q;  4GS3 A;  1N33 Q;  3S1N H;  1N8R C;  3T1Y Q;  1EOV A;  3CME A;  1V1Q A;  4QIW E;  1CKM A;  2UUA Q;  3S1R H;  4A3B G;  1PH5 A;  4GNX A;  4DR1 Q;  1XNQ Q;  4GKK Q;  4LWC A;  4OWT B;  1Q7Y C;  1PFS A;  3S14 H;  5JJI A;  1Y1W H;  4IOA A;  3DM3 A;  4A3E G;  1XMO L;  5M5Y H;  2OQK A;  2JA8 G;  1YEZ A;  2HHH Q;  1VQ5 A;  3K80 C;  2I5L X;  4JV5 Q;  3G4S A;  4DR3 L;  1GO3 E;  5FJ8 G;  2IHF A;  5M3M H;  2A19 A;  3ZJY C;  2VNU D;  2NVY H;  1PH8 A;  3RN2 A;  2N49 A;  4JI3 Q;  1FJG Q;  1GM5 A;  2HT1 A;  1XNQ L;  3I4N H;  2ZM6 Q;  1Q1E A;  4BBS G;  5IP9 G;  4NPS A;  4HJ5 A;  5BR8 Q;  4R4Q A;  2C35 B;  4IFD G;  1CKO A;  3AFP A;  4B3T Q;  1KC8 C;  1VQB A;  2D0P A;  1IBM Q;  4QJF A;  4DAM A;  2RCN A;  3U50 C;  1YNX A;  1XJV A;  1N9W A;  1XMQ L;  4PZ6 A;  4DR3 Q;  3GD7 A;  4DV2 L;  4L5S A;  2RF4 A;  4JI4 Q;  4LUZ A;  1WCM G;  5HY6 A;  3LGJ A;  3A5Z B;  3I55 A;  4DUZ Q;  4JI2 Q;  2R7Z H;  2R93 G;  3HKZ G;  1WI5 A;  3TRE A;  5C0X J;  3KYH C;  4DV6 Q;  1JJC B;  1Z9F A;  4OX9 L;  1YHQ A;  3NEN A;  4BA1 I;  2H5X A;  4DPG A;  4HJ8 A;  3RZO H;  2EIF A;  4JI1 L;  1XMQ Q;  4LF7 Q;  4A3F H;  1X55 A;  1PH1 A;  2UXD Q;  4DV1 Q;  1Q12 A;  4POF A;  2DUD A;  2LSS A;  4O2D A;  4BXX G;  3CCS A;  2N78 A;  4X64 L;  1XPU A;  3U4V A;  5FLM G;  4LFB L;  1LYL A;  4R4I A;  4LUO A;  1PH4 A;  2PQA B;  4LF4 L;  1OXT A;  1PH7 A;  1D7Q A;  2K4K A;  4DV4 L;  1K0R A;  1Y14 B;  4H02 A;  1C9O A;  4AQY Q;  4UP9 A;  1V9P A;  4DUY L;  3GTQ H;  5IP9 H;  2OWO A;  3PO2 G;  4A3G G;  4DR4 Q;  1VCI A;  4DV5 Q;  2ZTC A;  3I7F A;  4DK3 C;  2VQF Q;  4DV1 L;  1Z47 A;  4GN3 B;  1C0A A;  3K7U C;  4YWM A;  1LUZ A;  3RLN A;  5IWA L;  1Q81 C;  1YIT A;  2A1A A;  1JJ2 A;  3BZK A;  2KEN A;  5JJK A;  3U4Z A;  4OWW B;  1JB7 A;  2NZH A;  4RMF A;  4KI0 A;  5GAD C;  3HOX H;  1VQ7 A;  4HJ9 A;  5IYB H;  3I4M G;  3T1H Q;  4WJ4 A;  4LF8 Q;  3OTO Q;  1VQF A;  1HNZ L;  2R92 G;  3PUY A;  1VQC A;  1B70 B;  5M3F H;  4DR4 L;  1UWV A;  4A93 G;  1QZG A;  2R7Z G;  1X3E A;  4B3T L;  2R93 H;  2B3G A;  2I5M X;  1PHJ A;  2AMC B;  2Q2I A;  2NN6 G;  2K75 A;  3AFQ A;  4RG1 A;  4PMW A;  3VDY A;  1AH9 A;  1L2F A;  3SGI A;  1CSP A;  3HOZ H;  1VQA A;  5M5X H;  3F8T A;  1KAW A;  1BKB A;  4C2M H;  4Y7N H;  4DV7 L;  3F1Z A;  2Z6K A;  4BY7 H;  2NZO A;  1L1O A;  3PUX A;  2QEX A;  1S40 A;  4C3I H;  3HOX G;  4OO1 I;  5K36 G;  2DGY A;  3GDE A;  1NTG A;  4DR6 L;  2JEB I;  1VQN A;  1EIY B;  1QZH A;  3FHW A;  1EIF A;  2CKZ B;  3PSI A;  4JYA Q;  4C3J H;  4LFB Q;  3PF5 A;  2VZA A;  1UE5 A;  3WWV A;  1TWG H;  1P16 A;  1E1T A;  5AJ3 Q;  1N36 Q;  1EWI A;  3PV0 A;  1VQ4 A;  4JBJ A;  1A63 A;  1VQ8 A;  2Q2H A;  1HJP A;  2OTJ A;  3HKZ E;  4YHH Q;  4P72 A;  2ZTE A;  4AIM A;  1CKN A;  3T1Y L;  4IPD A;  4Y52 H;  4JI6 L;  2GVA A;  2UUC L;  3PO2 H;  3TRZ A;  4A3G H;  2MO1 A;  4PZ7 A;  4DUY Q;  1E1O A;  4JI8 L;  3CC2 A;  4UP7 A;  4IPG A;  5C44 H;  4HIK A;  3UDG A;  3KF6 B;  4C3H H;  5IP7 H;  1L1O B;  1KHI A;  1L1O C;  1X3G A;  1U5K A;  3BZC A;  4JI5 L;  4A3K G;  1I94 L;  1K83 H;  3K7A H;  2UUB L;  3GTL H;  3JAM i;  1R9T H;  3OTO L;  4TVA B;  3GO5 A;  3CAM A;  3A0J A;  1ASZ A;  3A5U A;  5IYD G;  4JI0 L;  3GTO H;  2HIV A;  3K81 C;  5ELN A;  3T1H L;  2YTV A;  1VQK A;  2JA5 H;  3EN2 A;  5LMN W;  3U58 A;  1HNZ Q;  4NXM Q;  1VQE A;  4JI8 Q;  2KHJ A;  3FKI G;  1OXS C;  4HJA A;  1TWA H;  5GAE C;  1BBU A;  2IHE A;  4YCW A;  1KIX A;  1FGU A;  3HOV H;  1IBL Q;  1HR0 W;  4X65 L;  2CWP A;  3J80 i;  4X64 Q;  2XGT A;  4JCV E;  4JOI C;  4A3J G;  4DAY B;  4JBK A;  1XNR Q;  4A3I G;  1EFW A;  1WOC A;  4GKJ L;  2R7D A;  1FL0 A;  2GVB A;  3W1B A;  4JI0 Q;  3TS2 A;  2PMZ E;  4EQ5 A;  4GN5 A;  1ASY A;  3S1M H;  4LF9 Q;  1A8V A;  1HH2 P;  1DGS A;  1YIJ A;  1GVP A;  1VQJ A;  1CKN B;  1G29 1;  1M90 C;  1J5E Q;  3RR5 A;  4BXX H;  1YBY A;  2BA1 A;  4XTC S;  3CCL A;  1CUK A;  5LMU Q;  2ES2 A;  1GD7 A;  1HZC A;  5GQO A;  3CPW A;  5LMN Q;  1PH6 A;  4AYB G;  1IYJ B;  1M1K C;  4R4C A;  3NBH B;  4QL5 A;  5IP7 G;  1VQ9 A;  4ME3 A;  3CF5 A;  2R6G A;  2NVT H;  1HR0 Q;  2UUC Q;  4LFC L;  4A75 A;  1AE2 A;  2WFW A;  1K9M C;  4JG2 A;  2QA4 A;  1H95 A;  1JT8 A;  1BBW A;  3J7Z C;  3JAM c;  1XPO A;  4JI7 L;  4ALP A;  3L2P A;  2ZJR A;  1E3P A;  3ICE A;  3CC7 A;  2E5L L;  4K0K Q;  3I2Z A;  2Z6K C;  1Y1V H;  1E22 A;  3DLL A;  3UDF A;  3W5O A;  2IY5 B;  1T9H A;  3I4O A;  3STB C;  1HZB A;  4OO1 G;  3CCE A;  3TS0 A;  1TWH H;  1E7Z A;  1VQI A;  3M4P A;  4DV7 Q;  3HOY H;  2RHS B;  3KJP A;  1S3O A;  2KCM A;  5IY0 A;  1VQD A;  1N32 L;  2UXC Q;  5ELO A;  4YCV A;  2KHI A;  3L0O A;  2GN5 A;  1MJC A;  3E9I A;  3M4O H;  4B3R Q;  3FKI H;  2B63 H;  3HOW H;  1GKH A;  3GTJ H;  1XNR L;  4AH6 A;  4KLK A;  1JE5 A;  4GKJ Q;  4JBW A;  2CFM A;  2JK8 A;  1Y1V G;  1Q1B A;  5C4J H;  4R4T A;  1Y1W G;  1YJ9 A;  2UU9 L;  4LF6 Q;  1I50 H;  4MZ9 A;  5AJ3 L;  3A74 A;  3KDF A;  1N34 Q;  2D62 A;  2JJQ A;  1N32 Q;  1HNX L;  5FLX c;  3G48 A;  2BH8 A;  3M7N A;  1X54 A;  2N8N A;  4GLX A;  4A4I A;  2VY3 A;  2IX0 A;  2F52 A;  3H15 A;  2JA7 G;  3HOZ G;  3PGZ A;  5M5W H;  5H1S E;  2K52 A;  4DV3 L;  5IYB G;  1I6H H;  4A3L G;  1I5F A;  1NE3 A;  4LUV A;  4IPC A;  4JI5 Q;  2B63 G;  5JJL A;  1PYB A;  1O7I A;  4GLV B;  4KHZ A;  4LW1 A;  4X65 Q;  1W2B A;  1X6O A;  3S15 H;  1PVO A;  2FXQ A;  1Q8K A;  4A93 H;  2R7F A;  3CCQ A;  4DUZ L;  1B8A A;  4AYB E;  4LF5 Q;  4OWX B;  4A3I H;  3M9B A;  3AEV A;  4POG A;  4TQU S;  4JOI A;  3HOY G;  1TXY A;  3UDI A;  3PF4 A;  1G51 A;  3CMA A;  4IOC A;  2F4V Q;  4P71 A;  1XTD A;  1OTC A;  4JI7 Q;  1KRS A;  1RL2 A;  2CCZ A;  4LF7 L;  4LFA Q;  4KHP Q;  2IX1 A;  2E2H H;  1HNW L;  3E9H A;  1XMO Q;  1NMF A;  4BY7 G;  3G71 A;  1IBM L;  3CXC A;  1SN8 A;  2UXB Q;  1EYG A;  2MFI A;  2PI2 E;  1LM0 A;  2D0O A;  5GAH C;  2I5H A;  2YTX A;  2Q2T A;  4OON A;  3CCU A;  3KOJ A;  3FP9 A;  3CD6 A;  3GTG H;  3M3Y H;  3PO3 G;  1YZ6 A;  4A3F G;  3CP0 A;  1PV4 A;  4DV2 Q;  2PQA A;  4B3S Q;  1VQL A;  4A3K H;  1N33 L;  5IYC G;  2ALY B;  1HNW Q;  3S17 H;  2EXD A;  3D0F A;  3NEL A;  2VUM H;  1LTL A;  2LXJ A;  5LMU L;  4NB3 A;  3EIV A;  3ERS X;  4DR1 L;  2JQO A;  4A3J H;  5IWA Q;  3J81 i;  2LXK A;  1PH2 A;  4DR5 L;  4GKK L;  1Q82 C;  2UXB L;  1KL9 A;  2OTL A;  1A62 A;  4DV0 L;  2UXD L;  3JC6 6;  3UE0 A;  1YJW A;  1WJJ A;  3AYH B;  1NMG A;  3PUW A;  4YY3 Q;  4LFC Q;  4GOP A;  4LNQ A;  1C7Y A;  3CCM A;  4A76 A;  4JC0 A;  1J6Q A;  1EUJ A;  1WCM H;  4A3M G;  4DV3 Q;  2WAQ E;  2QGQ A;  3CQZ H;  1VQ6 A;  1W3S A;  4DR7 L;  4P73 A;  4JI3 L;  1VQP A;  1YVC A;  4LF9 L;  1BVS A;  3J7A 5;  3B6Y A;  3J80 c;  2PI2 A;  1SR3 A;  1TWC H;  3K0X A;  3W1G A;  4BA2 I;  2WAQ G;  3J81 j;  2XTI A;  4P75 A;  5FJ8 H;  2VQF L;  4UY8 C;  5C4X G;  2HQL A;  4BBR G;  3I56 A;  5JEA G;  3ER0 A;  5GRO A;  4BY1 G;  4BBS H;  4LF5 L;  1QUQ B;  3CW2 C;  4B3M L;  2ID0 A;  3UDX A;  3STB D;  4DR2 L;  3E0E A;  3ULL A;  3EBE A;  4HJ7 A;  3S16 H;  3PO3 H;  3KFU A;  1K8G A;  4LF8 L;  3KLW A;  3L7Z C;  3CC4 A;  1SLJ A;  2BA0 A;  1QVG A;  3CCJ A;  4GOP B;  4GOP C;  2JA7 H;  4JYA L;  2L15 A;  4A3M H;  1FVI A;  1EQQ A;  4IFD J;  1SMX A;  1JMC A;  4XIG S;  2KBN A;  2UU9 Q;  4LF6 L;  1NBW A;  3HFZ B;  3S2H H;  1IZ6 A;  1N36 L;  2ZTD A;  4L5T A;  4DNI A;  4MNO A;  4L5R C;  4YHH L;  2JA6 H;  2K5V A;  3J81 c;  1K8A C;  3S1Q H;  1P8L A;  2JEA I;  2AHO B;  1YHB A;  4LF4 Q;  2UXC L;  2JA8 H;  2CQO A;  1B7Y B;  5C0X G;  4DR5 Q;  5JEA J;  3HOU H;  1KRT A;  2VQE Q;  2VS1 A;  2NVQ H;  4LFA L;  1X65 A;  2AWN A;  5IYD H;  4HID A;  1UE7 A;  1TWF H;  3K8A A;  1VS0 A;  4YY3 L;  1IBK Q;  4DV5 L;  3TEH B;  1OXU A;  1A0I A;  2KCT A;  2JE6 I;  4PZ8 A;  4EX5 A;  4BBR H;  1UEB A;  2CWA A;  1VQO A;  4DR6 Q;  2F4V L;  1QUQ A;  2WB1 E;  1EQR A;  1D8L A;  1OXX K;  3OW2 A;  3TQY A;  1HNX Q;  1WFQ A;  3S2D H;  1VQH A;  4KHP L;  2K5N A;  1G6P A;  4JI6 Q;  3F2B A;  2RHQ B;  1I3Q H;  1U0L A;  1SFO H;  1E24 A;  2VL6 A;  2HHH L;  1K73 C;  1IBK L;  3G6E A;  4JV5 L;  5C4X H;  1MIU A;  4UPA A;  1QVF A;  4DK6 C;  3MEF A;  3H0G H;  4DKA C;  2I0Q A;  4GLA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...