1YVCA

Solution structure of the conserved protein from the gene locus mmp0076 of methanococcus maripaludis. northeast structural genomics target mrr5.
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
70
structure length
70
Chain Sequence
b'MAFGKPAMKNVPVEAGKEYEVTIEDMGKGGDGIARIDGFVVFVPNAEKGSVINVKVTAVKEKFAFAERVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MrR5
source organism Methanococcus maripaludis
molecule tags Structural genomics, unknown function
total genus 10
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2005-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01938 TRAM TRAM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1yvcA00
4PG3A 3F1ZA 1IBMQ 4OO1G 4BY1G 1SE8A 5IYCH 1X6OA 1Y1VH 5M3FG 1XPOA 3J80c 4LF7L 5FLMG 3E0EA 4GKJQ 2QA4A 5C44H 4DV3Q 1KIXA 3S1QH 2N3SA 4BBSG 2AKWB 2WAQG 1V43A 1B7YB 4JCVE 3KF6A 3HOXH 1HZAA 3RNUA 5LMNQ 1PYSB 1IBML 3PO3G 1VQNA 2OQKA 4JI0Q 1VQFA 4GOPC 1XTDA 1I6HH 1YBYA 3GTJH 1VQOA 4LUOA 1HZCA 1JMCA 1VQ5A 4UY8C 4GKJL 1Q7YC 3TEHB 5BR8Q 4DV3L 4A3KG 4JI5Q 4PZ6A 4OWWB 2PI2E 4A76A 3CCLA 4A3BG 1A8VA 2NZHA 1N34Q 1OTCA 3KDFB 4LUVA 4LFAQ 1VQPA 1S40A 1YHAA 3HFZB 4AIMA 5LMNL 3CW2C 4R4QA 2VS1A 4JI0L 2K14A 1CUKA 4NB3A 1DGSA 3I7FA 3H15A 3H0GH 2WB1G 2NN6I 5J3BA 1P8LA 3FHWA 3CPFA 5BR8L 2Q2HA 1I94L 1UE5A 1PH1A 2UUBQ 2OTJA 1YHQA 1N34L 4LFCQ 1XMOQ 4LFAL 4X64Q 2OQ0A 2ZJRA 2ZM6Q 3HOYG 2PNHA 2KBNA 4TQUS 1BKBA 2YTXA 4B3RL 5C4JH 1SROA 1I3QH 1CSPA 5IYBG 4HJ9A 3CP0A 3CMEA 1VQ8A 3HOWH 1L2FA 2VY3A 2E5LQ 4MNOA 1WCMH 1XJVA 3GTMH 3K7AH 4IPHA 3HOZH 1BBWA 3DM3A 3W1BA 5ELNA 4AH6A 2YTYA 4LFCL 1PH8A 4IPCA 4DR2Q 4X64L 4PZ8A 3G71A 2Z6KC 4KHPQ 2ZM6L 3T1YQ 2GVAA 4A3CH 1Y14B 1L1OA 4EX5A 1XPRA 1KAWA 4YWMA 4J15A 4BXXG 1HJPA 4JI2Q 1P16A 1X65A 3K8AA 1U0LA 1BBUA 3F2BA 3L0OA 4JI6Q 2E2IH 1TWAH 2QGQA 1QUQA 4YCWA 3NEMA 4A3EH 1QZGA 5LMUL 3HOVG 3I4MG 1U5KA 4P74A 3GTKH 4KHPL 4DR2L 4BY7G 1Q8KA 1A0IA 3T1YL 3HKSA 5C3EH 1UWVA 2CQOA 2CWAA 1NJIC 4JI4L 2R7ZG 4OXPA 3NENA 4DV7Q 4A3IH 2CWPA 1WJJA 1PV4A 4JI2L 1W3SA 1H95A 2ID0A 4LF9Q 2UXDQ 3FKIG 1S3OA 4HJ7A 3G4SA 1VQMA 1CSQA 3OYYA 3M85A 3CCRA 4LF5L 2DGYA 1ASYA 1XNRQ 1PHJA 2IX1A 4A3GH 3NBHB 5ELOA 5LMNW 1X54A 1SLJA 2RF4A 3F2CA 2VNUD 2GN5A 1HNXQ 1J5EQ 4X66L 3I56A 1Y1VG 4DV7L 2PI2A 4WJ3M 3I4NH 5C0XI 3CCUA 3ICEA 2UXCQ 1NBWA 5C44G 4GKKQ 2B29A 4BBRH 4ALPA 5IWAQ 1A63A 3A0JA 2UXDL 2IT1A 3CCMA 1X3GA 1GM5A 1E1TA 1OXXK 3TQYA 4IJHA 3HOXG 1XNRL 3K0XA 4X62Q 4A3MH 3LGJA 3B6YA 1EOVA 5C4XH 4K0KQ 1PH6A 1N36Q 1J5EL 4DK6C 3STBC 3J7ZC 4A75A 4UP7A 1CKNA 2UXCL 2OWOA 3PCOB 4GKKL 1AE2A 1LM0A 4YY3Q 5IWAL 1A62A 1K73C 2JJQA 1X56A 4JI3Q 2N49A 3S1NH 4L5QA 2NZOA 4DK3C 3CCVA 3J81c 4X62L 2EIFA 2ZTDA 4A3FG 1YIJA 1N36L 4LF7Q 4TVAB 3AEVA 3H0GG 4R1JA 5IY0A 2CCZA 4YY3L 5GQOA 2B63H 2WFWA 3WWVA 3M4OH 1Q1BA 4JI3L 3CC2A 4H02A 2Y0SE 2D62A 1L0WA 1EQRA 4L5SA 4IO9A 3S24A 3PIPA 3M9BA 4C3IH 4IFDJ 4OX9L 3GTPH 3KLWA 1HZ9A 4GLVB 1LUZA 1KRTA 1TWHH 2EQSA 4O2DA 2MQHA 2BH2A 3L2PA 3GTGH 3HOWG 1NTGA 1YNXA 3UDFA 2LXJA 1R9TH 1WCMG 3BZKA 1VQKA 4JC0A 1WI5A 3OW2A 4JI8Q 3W5OA 4UP9A 2MNAA 5IP9H 3TRZA 1G6PA 4YWLA 3S17H 2JA5G 4EQ5A 4A3JH 1Q1EA 2Z6KA 2ZTCA 4DR4L 1IXRA 2MFIA 2I5MX 1HZBA 4JBMA 3PUVA 1I94Q 4GN3B 1N8RC 1NY4A 1PH4A 3A5ZB 5C0XG 4DV6Q 3CCEA 1XMQQ 2A19A 4A3EG 2R93H 3J80i 2NVTH 1Q12A 1NMFA 4JI8L 3S15H 4GN5A 5GADC 3PUZA 1FGUA 3CCQA 3I4OA 2BA0A 1YJWA 4B3RQ 4O0AA 5GAGC 4LFBL 3HKZE 2JQOA 5FJ8G 2ASBA 2GVBA 4HIKA 4C3HH 4X65L 1Q82C 3W1GA 2I0QA 2Q2TA 4A3LG 4YHHQ 2JEAI 2WP8J 4QQBX 5IYDH 2IY5B 4DV6L 1XMQL 4DAMA 2K50A 1S72A 2NVYH 5IE8A 3S14H 1K8GA 3S2DH 3ERSX 3PF4A 2AMCB 4QIWE 4A3GG 2E2HH 2I5LX 4PZ7A 1YJNA 2JK8A 3U50C 1GO3E 1K9MC 3KDFA 3PO2H 2A8VA 1VQIA 1X3EA 3OTOQ 3UE1A 1SR3A 2JE6I 1UE1A 2VZAA 3JC66 1W2BA 1VQ9A 5JJKA 2LSSA 3I4NG 1SRUA 4UP8A 4XTCS 1PYBA 4YHHL 4HIMA 4BBRG 3BZCA 1YJ9A 5LMUQ 1N9WA 1YITA 1VCIA 3IRBA 1JJ2A 4JI7L 4DR7L 2XTIA 4C3JH 2VUMH 5M3MH 3STBD 4JI4Q 2KENA 5C4XG 4IPDA 1L1OB 1YZ6A 3OTOL 3PUWA 4BY1H 3M3YH 2BH8A 1PFSA 3U58A 1VQLA 3G6EA 3GTQH 1I5FA 4B3TQ 2ZJPA 3TREA 1EUJA 4R4IA 4DV1Q 1M90C 4A93G 1D8LA 2A1AA 2VL6A 1QUQB 4LF5Q 2YU9H 2B3GA 1G51A 2FXQA 2UUCQ 1GD7A 2PQAA 2AHOB 4DNIA 4DR3L 1C7YA 4AYBG 3RR5A 4X66Q 2JA9A 1B8AA 2OCEA 1KRSA 3H3VH 3S2HH 3KF8B 1XNQQ 2VQFL 4DAYB 3UE0A 1SMXA 3PO3H 3KFUA 1E24A 3U4VA 1QVCA 1XPUA 4P75A 4QGUA 2WAQE 4JOIA 4B3TL 1C9OA 3AFPA 4QJFA 4DV1L 4LF6Q 2JA7H 1YHBA 5M5XH 2B63G 1Y1WG 1OXUA 4A3DG 4B3MQ 4DR5Q 4DR6L 1TXYA 1V1QA 3M4QA 4R4CA 3CPWA 2UUCL 3ER0A 3CF5A 5IYCG 4OO1I 2PMZE 2QEXA 5K36G 1I50H 4KI0A 1XNQL 1QZHA 2N8NA 4POFA 2C35B 2KHIA 5E7NA 2NN6G 2RHSB 1KL9A 1VQCA 3L7ZC 4LF6L 1ASZA 4LNQA 5GROA 1X9NA 3AFQA 2Z0SA 4B3ML 4DR5L 1AE3A 2LXKA 1CKMA 3M7NA 2R7FA 5IP9G 2HIVA 1IBKL 3CQZH 3H3VI 2K5NA 2WB1E 3PUYA 2K5VA 5JEAJ 3J81j 3RN2A 3CC4A 3HOYH 3F8TA 2RHQB 4GOPA 1CKNB 1HR0Q 2ZTEA 3A5UA 4POGA 2N78A 3JAMc 1TWFH 1VQEA 1EWIA 4L5RC 1RL2A 2R93G 3SGIA 2YV5A 2ZJQA 1MJCA 1IL2A 3HOUH 4OX9Q 2UU9L 4AQYQ 1L1OC 4NXNQ 3GD7A 2IX0A 3MEFA 3KYHC 2MO0A 2MO1A 4LWCA 1HR0L 4JBKA 3MXNB 3EBEA 2UXBQ 3RZDH 4BXXH 1E7ZA 1HH2P 4GNXB 4WJ4A 2CKZB 3TS2A 4RG1A 5JJIA 2R92H 4Y7NH 2ES2A 4UPAA 1FJGQ 3Q8DA 4YCUA 2E8GA 4AQYL 1VQ4A 4IPGA 2KCTA 4NXNL 4BY7H 4IOCA 4DR4Q 4FDBA 3ULPA 3EIVA 3J81i 1PH3A 2R7ZH 2CFMA 3HOZG 4HJ5A 5GAEC 2UXBL 3RLNA 4LF4Q 3KF6B 1LYLA 1KHIA 4AYBE 3E9IA 1E1OA 2BA1A 3PSIA 4JBWA 1EIFA 5M3MG 2VW9A 1EIYB 4BA2I 1KD1C 1FJGL 4A3CG 1VQAA 1EYGA 4LFBQ 1D7QA 2R6GA 3BJUA 1IBLQ 1LTLA 2HT1A 1SFOH 4X65Q 2JA8H 2NVQH 3S1MH 1PH9A 1HNWQ 1IYJB 1VQBA 3S16H 3CMAA 2ALYB 1PA6A 4LF4L 1WFQA 1G291 3BU2A 1Q86C 2KCMA 2DUDA 4B3SQ 1SN8A 5C3EG 4YWKA 3CD6A 4Y52H 1E22A 4RMFA 5M5YH 4P72A 4A3IG 4HIOA 1PH2A 1IBLL 1T9HA 4A4IA 4R4OA 1JJCB 4YCVA 1HNWL 4IJLA 3D0FA 1PH5A 4DV0Q 2JA7G 3NELA 4X6AH 1KC8C 4JI7Q 1QVGA 1TWCH 1N33Q 5IP7H 4DR7Q 4JI1Q 4B3SL 1K8AC 4IFDI 1E3PA 2HQLA 4OWTB 4PMWA 4DV2Q 1JJGA 2HHHQ 1QVFA 4DUYQ 1VQHA 4A3FH 2D0PA 1TWGH 4MZ9A 2H5XA 1GVPA 5HY6A 4DV0L 4HJ8A 1HNZQ 1HR0W 1KXLA 2JA6H 4GNXC 1VQJA 2AWNA 4JI5L 1N33L 2KHJA 4JI1L 4C2MH 4DKAC 4DR3Q 4A3MG 3J7A5 3CCSA 2K75A 3PF5A 4DV2L 2VQFQ 2HHHL 2D0OA 1V9PA 4DUYL 1NMGA 2VQEQ 5M3FH 1HNZL 5FLMH 1K83H 5C0XJ 4DR6Q 4P71A 4HIDA 4QY7A 3CXCA 4BBSH 3HOUG 2UUBL 2V1CC 2PQAB 4BA1I 2F52A 2XGTA 1JE5A 4R4TA 2Q2UA 5HGQA 1X55A 1JT8A 3CCJA 4OONA 1XMOL 4MTNA 2Y0SG 3RN5A 2JA5H 2VQEL 5JEAG 1GKHA 3GDEA 5AJ3Q 2L15A 4JV5Q 2F3IA 3E9HA 2R7DA 4A3KH 2E5LL 4A3BH 1FL0A 3RLOA 1O7IA 1IBKQ 2F4VQ 3RLFA 1IZ6A 2R92G 1FVIA 2IHFA 1VQGA 3PIOA 1K3RA 3PUXA 4LF8Q 3FP9A 2Q2IA 4NPSA 3AQQA 4P73A 3ZJYC 1EFWA 1OXTA 5AJ3L 5EAYA 1MJEA 1VS0A 5FJ8H 2E2JH 4NXMQ 3K7UC 4JV5L 3G48A 3CAMA 4ME3A 3CC7A 3T1HQ 4A3LH 1OXSC 4JI6L 4GN4B 2F4VL 1Z9FA 2UU9Q 3TS0A 1Q81C 4A3JG 1KQSA 3GO5A 1BVSA 4GLXA 4LF8L 4JBJA 3EN2A 1Q46A 3UDXA 1VQDA 4IFDG 3ULLA 2JA8G 3PV0A 4DV5Q 5H1SE 2JEBI 4GOPB 5IYBH 4DV4Q 2K5HA 3K81C 4KLKA 2NVXH 4NXML 3VDYA 3T1HL 3HKZG 1UE6A 3A74A 5FLXc 1J6QA 4IOAA 5IT9c 3M4PA 4LF9L 3DLLA 1RIPA 2ATWA 5GAHC 1MKHA 1WOCA 4LUZA 3KJOA 1N32Q 1YEZA 2HIXA 3U4ZA 1VQ6A 4DUZQ 3UDIA 1UE7A 2YYZA 4LW1A 5IYDG 2OTLA 1PVOA 1C0AA 4DV5L 1NE3A 1X3FA 4APVA 3PGZA 3I2ZA 4DV4L 1OXVA 1HNXL 2UUAQ 1AH9A 1PH7A 3I55A 1EQQA 2IHEA 4KHZA 3K80C 4XIGS 3KOJA 2EXDA 2K4KA 5IP7G 3AYHB 4JG2A 3GTLH 4JYAQ 2I5HA 4GS3A 4A93H 3I4MH 3HOVH 3PO2G 2K52A 5M5WH 1N32L 3JAMi 1VQ7A 4DR1Q 1YI2A 4HJAA 4DUZL 1YVCA 3ULJA 5DLQE 2RCNA 3F2DA 1MIUA 1JB7A 1CKOA 3GTOH 4K0KL 1Z47A 3RZOH 4L5TA 3S1RH 2UUAL 4JOIC 3UDGA 1K0RA 1WYDA 2JA6G 3KJPA 1M1KC 4DPGA 2AWOA 4JYAL 1B70B 2YTVA 2VUMG 3FKIH 4QL5A 3D31A 4GLAC 4GNXA 1Y1WH 4A3DH 5JJLA 1UEBA 4OWXB 4DR1L
chains in the Genus database with same CATH superfamily
4OO1G 1X6OA 4RCOA 3J80c 2JA5B 5C44H 3S1QH 1GOZA 4A3KB 1B7YB 4FF1A 2F1MA 1VQNA 3MXPA 1Y8OB 2H4OA 4UDUC 1VQFA 3HS0C 1XTDA 1I6HH 1PRTC 4LUOA 1Q7YC 1JWMD 4HCSA 1SE4A 4OWWB 2PI2E 4A76A 3CCLA 2E2JB 3C46A 4LJZC 2NZHA 3KDFB 4LFAQ 1VQPA 3HFZB 4AIMA 4R4QA 4CDEC 2EYPA 4DN4M 4NB3A 3I7FA 1Y8NB 1DOKA 4YIJA 3SK4A 2NN6I 2AQ3B 3CPFA 1I94L 1PH1A 2JP1A 4DXFA 5CV5A 1EY9A 4ODGA 1YHQA 3DWPA 2B2UA 4LFAL 1E2ZA 2B39A 5G3LF 3HOYG 2KBNA 4ZK9B 1SYCA 4HJ9A 3CMEA 1VQ8A 2VY3A 5D14A 1XJVA 1BBWA 3DM3A 3I70A 1VDZA 1PH8A 4KHPQ 3AMUA 4A93B 1L1OA 1SJED 4EX5A 2Z8LA 1BO0A 2K7VA 4BXXG 4Q0FA 1CA6A 2E2IH 2QGQA 4PMBA 5FKAC 4ZRZA 4KHPL 3J80L 3FKIB 2QF7A 1DXMA 1FNWA 3CHBD 2CQOA 4CKEA 2R7ZG 2D5DA 4DV7Q 2CWPA 4KJOA 1ENAA 1XTCD 5I9OA 1Y1VB 1H95A 1EOTA 2ID0A 1PZKD 5A2QL 1BCPF 3G4SA 3OYYA 5IGCA 2IX1A 1CK1A 3D4DA 4N8X1 1SLJA 3PQIA 4L6TB 3HOXB 3I56A 4DV7L 2PI2A 2K1BA 3C1FA 3ICEA 1NBWA 5E1FA 5C44G 1Q8IA 1LV9A 3OOCA 4IN3A 2NWGA 4K14A 4A3MH 4K0KQ 1ZYRC 5C4XH 1PH6A 4DNTB 4DK6C 3STBC 2E75C 2OWOA 1HTLD 3X3NA 2DNEA 2EYJA 2JJQA 1X56A 4MHEA 3S1NH 2NZOA 4DK3C 3J7AF 2F3VA 3J81c 1QE6A 2ZXRA 1TS4A 3UI2A 3G6JB 4TVAB 1TVXA 1G8ZD 5GQOA 4K2LA 1Q1BA 3K7AB 1EQRA 4OEMB 3J80E 3MXUA 4C3IH 1HZ9A 1Q3LA 1LUZA 2A6ED 1TWHH 4KKTA 4O2DA 1KRTA 2BH2A 3GTGH 1NTGA 1YNXA 5I2YA 1R9TH 3ITPA 1DM0B 1CM9A 5KGUA 5A2QE 2A69C 5C5MA 1WI5A 1TWAB 2MNAA 1WTOA 2F0GA 3S17H 2JA5G 4RAUC 4A3JH 3GTKB 5LL6S 4DR4L 2EYMA 3PUVA 4DV6Q 4I7AA 2L1BA 3J80i 4M8AA 3OSOA 3SHLA 2XIWA 1YJWA 4A3GB 3K59A 4QB4A 5FJ8G 5IT9L 5EBCA 4CGYB 4HIKA 1JB3A 4X65L 1Q82C 3W1GA 2F0OA 2WP8J 2RKSA 4DV6L 4K5WA 4DAMA 3I4NB 2K50A 3IKJA 4BBRB 2A68C 3I73A 2JK8A 1K9MC 3KDFA 1MSGA 2A8VA 3OTOQ 3TDQA 3NTHA 1KNEA 4NKLA 2NUCA 3QO2A 2VZAA 4NP5A 4EQPA 2O4XA 3SVMA 2MGSA 3BVZA 4JI7L 3H94A 2HCIA 1SMYC 1AN8A 4G4KA 3ERQA 2KENA 1I6VC 1SNQA 5C4XG 5D65A 3OTOL 2JXMB 3OMCA 2BH8A 1PFSA 2B2TA 4B3TQ 2ZJPA 1SE3A 1M90C 4A93G 2Y0SB 1CZGA 4KK7A 2B3GA 3SR1A 2UUCQ 1BDOA 2PQAA 2B63B 3M4OB 4X66Q 2DY7A 1B8AA 4IUNA 2K6AA 5ISRA 1HCZA 3KFUA 3U4VA 1QVCA 3GTPB 3P7JA 4P75A 2WAQE 4B3TL 2JA7H 4QJFA 2M2LA 1OXUA 5C4ZA 2XN9C 1TXYA 3KK7A 2UUCL 2KEDA 3ER0A 3CF5A 5IYCG 1JWSD 4C3IG 1HFGA 3DMUA 4OO1I 5J22A 2PZTA 3P1HA 4KI0A 5IT9E 3A54A 3R2TA 2RBMA 1RKNA 2KHIA 1PRTF 2RHSB 1KL9A 1PFNA 1VQCA 3QIAA 1HXYD 3AFQA 1XXGA 2Z0SA 5CMDA 4CJ1B 1CKMA 2HIVA 2O5IC 1V1OA 1ZKOA 4K8IA 3QOJA 5E4WC 4N9TA 3RN2A 1PXUA 3CC4A 2RHQB 3C3LA 1CKNB 4V190 2RDHA 3A7AB 4C3HB 4L5RC 2FJ2A 1MJCA 4KY6A 2KCNA 3N52A 1NAPA 4OX9Q 3S14B 4U673 3S2DB 1B2TA 1DYQA 4AQYQ 4NXNQ 2E2HB 1PTOH 3KLSX 2MO1A 1FYCA 4ID6A 3MXNB 2NZ1D 4XQQA 4CDFC 2PZWA 1HH2P 2BDNA 2CKZB 2ZT9C 1J8IA 3M7GA 4AQYL 5E4XA 3I4LA 4NXNL 3MFGA 5I2XA 5M3MB 4FDBA 5L37A 3EIVA 3J81i 3Q0AA 4BY1B 5ELFA 3M3YB 2B2WC 5ELDA 1GUWA 4LF4Q 4UHVA 4AYBE 4JBWA 3PSIA 1EIYB 4BA2I 2XRQD 4H44C 1D7QA 2QILA 1EYGA 3S1MH 1LTLA 4RGOS 3KUPA 2NVQH 1F9PA 4A3IB 1HHVA 3CMAA 3PO3B 3H09A 1S5CD 1FNUA 1Z7TA 4LF4L 3S16B 3W3AA 2DUDA 4B3SQ 1HFNA 4YWKA 1E22A 4IUPA 5D3IB 5M5YH 4P72A 4C1NI 2H1EA 1F2MA 4R4OA 5C3WA 4YCVA 5EKLA 1PH5A 2JA7G 3NELA 2LMCB 1IKMA 1E2WA 4B3SL 5JJZA 1E3PA 1H9SB 4JW0A 1QVFA 3Q24A 4A3FH 1F2YA 4NDXA 1ML0D 1GHKA 3F2UA 1S5FD 3AB9A 4JI5L 3VR6A 5FK9C 2EVBA 3J7A5 1CA5A 3MZ5A 4K6LA 3HOUB 2D0OA 3VR3A 3CRLC 3WOEA 4CHTB 1SEBD 5JAVA 5C0XJ 5JVG3 4R8IA 2A6EC 3CXCA 1BNZA 4BBSH 2V1CC 4OIKA 2HDLA 4BA1I 2F52A 4R4TA 1JE5A 3CCJA 4OONA 1XMOL 5EJWA 4MTNA 5IGEA 2Y0SG 2I46A 3TMEA 1GKHA 3GDEA 2L15A 2NTSA 3SDZA 3E9HA 3OWFA 2E5LL 3HP3A 3NXWA 1STEA 5C4HA 1IBKQ 4A3BH 2F4VQ 2HDMA 2IHFA 3PIOA 5ELBA 4N8FA 2Q2IA 3ZJYC 3MA2B 2MP1A 3T56B 1WTXA 4NXMQ 3G48A 1SBBB 4A3LH 1K8MA 2F4VL 3A8JE 4PMCA 1S5BD 1KQSA 3Q23A 4XT1B 4JBJA 3EN2A 1VQDA 3TBIB 3ULLA 3MVVA 4GOPB 3K81C 4NXML 3VDYA 1JWUD 1G6ZA 3R8BA 1A3VA 3HKZG 5FLXc 1NNXA 1J6QA 2XSCA 3M4PA 1MKHA 1IYVA 4DUZQ 4C3HG 1PVOA 1C0AA 5IYDG 1NE3A 1JOOA 3PGZA 1AH9A 1L0YB 4KHZA 4CDDC 1HA5A 3KOJA 4JG2A 3TP8A 4KY7A 1IW7D 3I4MH 3HOVH 2Z6BA 5M5WH 3BDLA 2O5JC 1AFPA 1VQ7A 1ONLA 1B3AA 4C3JB 1YI2A 4U68A 4DUZL 1YVCA 3F2DA 5DLQE 1GUTA 5CBAE 3S1RH 4JOIC 3UDGA 1ESRA 4K6DA 3KJPA 3MXNA 2F0MA 1K83B 5JJLA 4QL5A 4NMZA 5CV7A 4OWXB 4BY1G 1DCZA 4G7ZC 1XPOA 4LF7L 4GKJQ 3E0EA 3EJIA 2QA4A 1F2ZA 1SYDA 4DV3Q 1KIXA 1ET9A 4BBSG 2N3SA 1NR2A 3GV6A 2BE5C 1D5ZC 1HZAA 3RNUA 3PO3G 1RODA 2OQKA 4JI0Q 2KJXA 2IWHA 3V2TA 4GOPC 1YBYA 3GTJH 1VQOA 4HTHA 4GKJL 3TEHB 4DV3L 5EPJA 4A3BG 1TU2B 4CJ0B 1OTCA 2K01A 1DZ1A 5CGKA 3CW2C 2CW0C 1EIGA 1OO9B 2VS1A 4JI0L 2K14A 1II3A 5FLXL 3H15A 5LL6X 1AZQA 3MAQA 5J3BA 4IUUA 3FHWA 2Q2HA 3BS1A 2NVXB 2OTJA 4IUQA 2OQ0A 2ZM6Q 3HRZC 3I3CA 1SROA 3CP0A 1HUNA 3S9WA 3HOWH 1WCMH 3GTMH 3W1BA 4IPCA 4DR2Q 1I4PA 4KD3A 3URYA 2ZM6L 1BR9A 5EQ0A 1HJPA 3K8AA 4JI6Q 4YCWA 3FEWX 1QUQA 3NEMA 1NSNS 1QZGA 3I4MG 3HOVG 3NQTA 4DR2L 5IGDA 1D1IA 1EY8A 5C3EH 1UWVA 1W6KA 4JI4L 3KF8A 1O7LA 3NENA 4DAYA 3A7LA 3ND8A 2KHSA 4GZYC 2F0HA 2UXDQ 5C44B 1VQMA 3M85A 2PNRC 3IFTA 1ASYA 3S1QB 5ELOA 5LMNW 2RF4A 1LT6D 3RMHA 1HNXQ 3BDOA 5FLXE 5C0XI 2UXCQ 4GKKQ 2B29A 1I6HB 4ALPA 1A63A 1WTVA 2UXDL 2IT1A 1X3GA 4ZQ3A 1SSOA 4X62Q 2L12A 3B6YA 4A75A 1TS3A 3RD4A 2UXCL 4EQNA 4GKKL 1AE2A 1LM0A 4G57A 3VYTA 4JI3Q 3DWQA 1TS5A 4X62L 1YIJA 3I90A 1SYFA 3VA7A 1S5ED 3MXGA 3AEVA 2B8FA 2CCZA 2KOLA 1NCVA 2WFWA 3WWVA 2ICEC 5CV8A 4JI3L 4H02A 2D62A 1EYCA 4HSVA 3S24A 1Z6HA 4IFDJ 3KLWA 2JN4A 1UAPA 2G9DA 3HOWG 5EPLA 3UDFA 1PFMA 1WCMG 2DNCA 2E74C 2RA4A 2ENBA 4MN3A 1WTWA 1TQOA 5HURA 3OW2A 1V8QA 2EDGA 2WIIB 4UP9A 2E2IB 1QNUA 1Q1EA 3QB3A 4CKBA 1HZBA 1PLFA 3K5LA 1I94Q 5IOCA 1Y69U 1N8RC 1NY4A 2SOBA 5KYLA 1GXDC 4B9XA 1EU3A 2R93H 5JPNC 2WV6D 4GN5A 1S4ZA 5GADC 1LABA 2L9HA 4CDCC 1SNMA 1LT5D 2JQOA 3NBIA 1SXTA 5EPKA 1FR3A 3ONAB 4OL7A 4YHHQ 2JEAI 2IY5B 1S72A 2IX3A 3PF4A 2AMCB 4QIWE 2EYHA 2I5LX 3MTSA 2IL8A 4PZ7A 3U50C 1SYEA 1EIHA 3PO2H 4OIJA 2F0PA 1B9MA 1CT1D 1SR3A 1IW7C 1H9KA 1UE1A 3JC66 4XQNA 4A3MB 1W2BA 5T1GA 5C4XB 1RTNA 1SRUA 4YHHL 4HIMA 5DAUA 1TIID 4DU9A 1YITA 1VCIA 3IRBA 4M1UB 1B44D 2J0TD 5ELCA 1PTOD 4MIUA 3S1NB 2L55A 4ULLA 3W2DA 3U58A 3QOLA 1I4HA 3NE5B 4DV1Q 3TREA 2B2VA 2A1AA 2VXWA 1WTRA 2YU9H 2TMPA 1G51A 1QILA 1UNSA 4K5XA 1C7YA 1B1ZA 3H3VH 4G7HC 1KRSA 3S2HH 1XNQQ 4C3IB 1XPUA 1EY0A 4QGUA 3AFPA 4DV1L 1CHQD 1TWHB 1YHBA 3GTGB 1ENFA 1ENCA 2EOTA 1R9TB 3DEOA 2Q8RE 3M4QA 3OPOA 1XNQL 3S17B 1LTTD 1QZHA 2N8NA 1CZWA 4A3JB 4KD4A 5E7NA 1TKWB 3L7ZC 4QCLA 1ASZA 4RHRA 5BN5A 1AE3A 2R7FA 3CQZH 2RSNA 2K5NA 2WB1E 1RHPA 2K5VA 3E0JA 2A5HA 1HQMC 3A5UA 4POGA 3VYRA 5IGGA 1VQEA 1EWIA 1I4QA 1RL2A 1O78A 2R93G 4RGMA 2BDOA 2F0SA 2IX0A 1LTAD 4LWCA 2SNMA 3EBEA 3FVQA 3RZDH 1SE2A 1VMCA 1E7ZA 4WJ4A 4RG1A 3TP5A 4RFBA 4Y7NH 3Q8DA 4YCUA 5DM63 3SK5A 4DR4Q 4BY7H 4IOCA 3Q6SA 5BN4A 1V1PB 2CFMA 1YNND 1A15A 4WORA 3KF6B 1KHIA 4TRDA 3SK6A 1IKLA 1D5XC 2OEOA 4IQZA 1VQAA 2JA8H 2J4XA 3A55A 4X65Q 1SFOH 1QOHA 2WAQB 1PH9A 3GQBA 2K5DA 1VQBA 4XYQA 2ALYB 2WKDA 4DGZA 3OIPA 1CTMA 1G291 2JA7B 2KCMA 1SN8A 3CD6A 4Y52H 2V4DA 4A4IA 3NTIA 4X6AH 3DUZA 1BUVT 1FD7D 4JI7Q 1O7YA 1QVGA 5IP7H 5CV9A 4IFDI 1LT4D 1JJGA 2HHHQ 1JQYD 4RKBA 3GP7A 3A8IE 1TWGH 1GVPA 1HR0W 4HJ8A 3J81L 1EU4A 1VQJA 2AWNA 4PV1C 2CHBD 2D2CC 5CYUA 1VF7A 4A3MG 2Z1CA 4LMQD 2K75A 2PZUA 2D9UA 3I8ZA 2HHHL 2K5WA 5E3FA 5HGTA 1NMGA 5M3FH 2CH4W 2QCPX 1PTOB 4P71A 3TP6A 2KVMA 3Q22A 2UUBL 5CV4A 5HGQA 5CC4A 2E76C 2MHVA 5KNCA 3D6CA 1WD1A 1JORA 4Z9CB 1FL0A 1BQQT 1A2TA 3C2PA 1IZ6A 1KTKA 1VQGA 2A6HD 1K3RA 4LF8Q 1M8AA 2EJGC 1LTGD 4P73A 1EFWA 5EAYA 1MJEA 3S1MB 2NVQB 1OXSC 1SYBA 1Z9FA 3HKZB 4A3JG 1H9JA 1BVSA 1TR5A 3CRKC 3E6ZX 4LF8L 2M00A 3S15B 4XT3B 5IGFA 2JA8G 3AU7A 4DV5Q 5H1SE 5M5YB 5IYBH 5M9OA 1G2TA 3A56A 3J81E 2OF1A 1R4QB 4KHVA 3OIQA 4DAPA 3VYSA 4LF9L 1RIPA 5GAHC 3KJOA 1WOCA 2TSSA 1N32Q 2HIXA 5DEHA 3U4ZA 3GV3A 1UE7A 4LW1A 1LT3D 5C3XA 1LTRD 4DV5L 1OXVA 1PTOC 4A3FB 2IHEA 1MBYA 1MGSA 4UAIA 1LACA 5IP7G 3GTLH 2XRSD 1R4PB 2WINB 1N32L 2QEJC 4HJAA 3D3RA 3ULJA 3GTOH 1CKOA 1G2SA 3TSSA 2XWBB 1K0RA 2XNAC 5C5LA 2NBFA 5C6AA 2YTVA 1Y1WH 4A3DH 1EYAA 4BBSB 3F1ZA 1IBMQ 1HA6A 1SE8A 1JICA 4H0LC 4ZCKA 5K36H 5M3FG 1SNPA 2NN6H 3OW7A 4FVMA 2WAQG 4JCVE 3KF6A 4A3BB 2EYLA 1IBML 4JK1C 4X3TA 2A73B 2F0TA 1JMCA 4UY8C 1RCVD 4JI5Q 3FDTA 2NTTA 1UUPA 3MC0B 3EA6A 1A8VA 5KNDA 4LUVA 1S40A 1YHAA 5JPMC 2EE1A 1DGSA 4DK1A 1IHZA 3H0GH 2RSOA 4IUVA 1JR0D 2EYFA 3E5SA 5ELEA 4X3KA 3IL8A 1XMOQ 3IAYA 2MPMA 4FNFA 2ZJRA 4I7ZC 2PNHA 3IFDA 2K5QA 4TQUS 2YTXA 1MI2A 4B3RL 5C4JH 1I3QH 3EFXD 5IYBG 1L2FA 2E5LQ 4MNOA 4Q5VA 4IPHA 3HOZH 1HRJA 5ELNA 2RCFA 3L9AX 3G71A 2Z6KC 2GVAA 3I4MB 3HOVB 4A3CH 1Y14B 5M5WB 1I4XA 2KEEA 1XPRA 2KECA 1CI3M 5COYA 4JI2Q 4WFN3 1P16A 1X65A 1U0LA 3L0OA 3S1RB 4A3EH 2K32A 5LMUL 5JOBA 1A0IA 3HKSA 2CWAA 4A3IH 1WJJA 4JI2L 5JVH3 3TZDA 2B2WA 1KDAA 1CSQA 3CCRA 4LF5L 2DGYA 1XNRQ 3NBHB 1X54A 3H6MA 2VNUD 1J5EQ 1U4RA 4DNRB 1ZEQX 3CCUA 1DONA 3R2IA 3GTJB 3A0JA 1XNRL 3QWNA 3BDCA 3T13A 3K58A 1EOVA 1WTHA 1J5EL 1EFID 3C1EA 1CKNA 3PCOB 3BVMA 1NR4A 4P2CB 4L5QA 2F03A 4RGNA 3CCVA 1MSHA 4A3FG 2ZTDA 4QUFA 4LF7Q 4WJWA 3H0GG 4R1JA 1ET6A 4FXKC 3HOWB 1JCKB 2G9HD 3NUCA 5DM73 3CC2A 1WCMB 2IJ0A 4RKLA 3PIPA 4DA2A 3TN2A 1STAA 2EQSA 2MQHA 1K3BC 1EY5A 4JC0A 3R93A 4YWLA 1E2VA 4PNYA 2L0CA 3EQLC 4EQ5A 2Z6KA 2ZTCA 5IODA 1CQFA 2SDFA 2MFIA 4IFDH 3LX0A 5C3EB 4OGQC 4JVZA 2DJGC 4EVOA 1PH4A 1SAPA 4BWGB 3D4WA 4A3EG 1ICFB 2NVTH 1Q12A 1NMFA 2K28A 4B9WA 1T5XD 3CCQA 1FGUA 1EQVA 3I4OA 4LFBL 2N88A 2ASBA 4QMGA 4KY5A 2Q2TA 2F0KA 4A3LG 4QQBX 4KN7C 2X6LA 2PCFB 2NVYH 5IE8A 1XWEA 3PMFA 2QKIC 3O13A 1YJNA 2B2YC 1H9SA 1SNOA 3OMGA 1VQIA 1X3EA 1HTPA 2LS01 2LSSA 3NPPA 3DM1A 3BZCA 1O7ZA 1PTOF 1N9WA 1YNJD 1ZYRD 4DR7L 2XTIA 4C3JH 2VUMH 3STBD 4JI4Q 1EZ8A 1L1OB 1YZ6A 2DY8A 4HSPA 4OO1H 1SDFA 3BZDB 3RZOB 3G6EA 3GTQH 1XYIA 1EUJA 4R4IA 2K04A 1D8LA 2VL6A 1B9NA 2RVLA 3U9OA 1RJTA 1XX8A 4DR3L 4RA8A 1LTSD 5KIXA 3RR5A 3SXHA 2VQFL 2PPBC 3NWTA 4JOIA 4LF6Q 5I6YA 1I4GA 5M5XH 1U9RA 2EY5A 4B3MQ 4DR6L 4R4CA 3CPWA 4HAEA 2BCOA 2ZXPA 2PMZE 2QEXA 4X3UA 5CV6A 1WTPA 1I50H 4ZUIA 2C35B 2A69D 4LF6L 4LNQA 3J7AV 4F8MA 4B3ML 3J7YW 1L0XB 2LXKA 3KBXA 2B2UC 4EQOA 1F9RA 2R93B 1BXTA 3PUYA 5JEAJ 3J81j 4FF3A 4K2KA 3HOYH 3F8TA 4DK0A 4GOPA 2ZTEA 3HG9A 2N78A 2DN8A 1TWFH 3JAMc 2Q8TA 2GA4B 3SGIA 1PYWD 1EEFD 1X3QA 4CKCA 2UU9L 2QW7A 1L1OC 3GD7A 5IIFA 3PO2B 5EKIA 4JBKA 4FYDA 4O42A 3HZXA 4BXXH 4GNXB 1CQVA 4KJNA 2EJFC 4L63B 2R92H 2KUMA 2EYOA 3CKIB 3VR5A 1FJGQ 1VQ4A 4IPGA 2KCTA 2CH4A 4N9PA 4ZLTF 1PH3A 2R7ZH 4DF7A 5GAEC 5EBDA 4HJ5A 3RLNA 3VYUA 3A8KE 3MEHA 1LYLA 1E1OA 2BA1A 2XVSA 1EIFA 3K57A 3NTKA 1KD1C 2YU9B 1FJGL 1RDPD 3KBGA 2R6GA 3BJUA 1LTBD 1HNWQ 1IYJB 5FO8B 3S2HB 3KLRA 1JOKA 1SNCA 5CR3A 1Q86C 5C3EG 1DD2A 4RMFA 1PH2A 2K33A 3EVQA 1JJCB 1U4PA 1HNWL 4IJLA 3D0FA 1LTID 1EWCA 2XWJB 1KC8C 1TWCH 2RDFA 2WB1B 3E3XA 4OWTB 1D5MC 2LY7A 1GUOA 4DV2Q 3CQZB 5LHY1 1MHWC 2D0PA 4MZ9A 3JAML 2HUGA 4HN7A 2N55A 4NW2A 1RD9D 2JA6H 1RTOA 4GNXC 4F87A 2JSOA 4RH6A 2KHJA 4C2MH 3CCSA 4KKUA 4TKOB 4KKSA 2P5ZX 1STBA 4DV2L 5EGTA 1QWYA 1V9PA 4BS9A 2PQEA 2VQEQ 5FLMH 3PIO3 3RZDB 2LFNA 2EY2A 2PQAB 1I4RA 1X55A 5CBEE 1F9SA 2CQAA 4Y7NB 3RN5A 2JA5H 4ILWA 3BYYB 2VQEL 3H3VC 2E2DC 4BY7B 4JV5Q 3K0YA 2O2LD 2R7DA 2SNSA 4A3KH 1GUNA 3RLOA 1WVLA 1O7IA 2EPBA 3EROA 2R92G 1FVIA 2PYKA 2F0VA 1J9OA 3FP9A 3QG1A 3FPPA 1OXTA 1EL0A 4IALA 1VS0A 5FJ8H 1SFOB 2E2JH 3K7UC 2JA8B 4JV5L 3CAMA 3T1HQ 3VR4A 4GN4B 1ILPA 4FXDA 3T53B 3T16A 1STYA 1Q46A 1BOSA 3VA5A 2HCCA 3JAME 3PV0A 4ABNA 4C1NK 4DV4Q 4KLKA 2HD3A 1LLRD 2F0QA 3T1HL 3A74A 4IOAA 5IT9c 3DLLA 2QDLA 4LUZA 1EZ6A 1YEZA 4J8QA 1WD0A 4J6HA 1D6EC 1YNJC 3UDIA 2YYZA 1EQTA 2OTLA 1X3FA 2B2TC 3I2ZA 4DV4L 2UUAQ 4HMJA 1PH7A 1TWGB 3K80C 4B08A 4O1NA 1FGBD 2EXDA 2K4KA 1BF4A 3BVGA 2I5HA 4GS3A 4A93H 4FF2A 3PO2G 2K52A 4HCEA 4XXEA 3PIP3 3JAMi 1ILQA 1MIUA 4K0KL 1Z47A 2UUAL 1KLUD 3MFYA 4S3SA 2JA6G 1M1KC 5M3FB 5NUCA 3R3OA 1JOQA 1HQRD 3FKIH 4GNXA 4GLAC 4DAVA 1G91A 3SEBA 4IURA 4V0BA 4PG3A 2IW3A 4ZAIA 5IYCH 1Y1VH 3CU7A 2KCCA 3QJYA 1TY0A 5FLMG 1HUMA 4F88A 2AKWB 1V43A 3HOXH 5LMNQ 1PYSB 1EEID 3I72A 1VF5C 1VQ5A 1EYDA 4KMUC 1HZCA 1G6PA 5BR8Q 4A3KG 4PZ6A 2CVRA 4F7XA 1N34Q 4XDXA 2MUYA 5LMNL 3HGBA 2WKCA 2ZXOA 1CUKA 4R8NA 2WB1G 2KQ3A 1P8LA 5BR8L 2KA7A 1UE5A 2UUBQ 2PW7A 2Z4IA 1N34L 4LFCQ 4X64Q 1BBXC 1F9QA 1K28A 1BKBA 4WRDA 5F2DA 3FPUB 3D6WA 2AQ2B 1CSPA 5K5PA 3NSWA 2EJMA 2PW5A 5G3LD 2FINB 1TT2A 3K7AH 4AH6A 2YTYA 4LFCL 4X64L 4PZ8A 1STGA 2F0IA 3GTLB 3T1YQ 1M4VA 3T4AC 1KAWA 1SJHD 4YWMA 4J15A 3GTOB 2EY6A 4AYBB 4DFAA 5DNFA 1BBUA 1W6JA 5C0XH 3F2BA 1TWAH 1U5KA 4P74A 3GTKH 4PQXA 4BY7G 1Q8KA 3T1YL 4LK1C 1Y1WB 4A3DB 4QF4A 1NJIC 4OXPA 2JYOA 1KDCA 2I07B 1PV4A 1W3SA 4LF9Q 1A6XA 3FKIG 1S3OA 4HJ7A 4A3GH 1PHJA 1Q90A 4XQJA 1EWHA 3F2CA 2GN5A 1BCPD 1A3UA 4X66L 5CORA 1Y1VG 1QB5D 4WJ3M 3I4NH 2F0NA 1AP0A 2BE5D 3D8GA 4BBRH 1SYGA 2L5TA 2VB3X 5IWAQ 1A2UA 2WACA 3CCMA 1GM5A 1E1TA 1STHA 1OXXK 3TQYA 4IJHA 4L8JA 3HOXG 3K0XA 3LGJA 1U4MA 1N36Q 3J7ZC 3FRPB 2VB2X 4OELB 1S5DD 4UP7A 1UEAB 1AZPA 3DHQA 4KTAA 4YY3Q 5IWAL 1A62A 3H0GB 3NHHA 4HEDA 1K73C 2N49A 2CW0D 5KYIA 4HMIA 3BG3A 2EIFA 4IUTA 1DOLA 1N36L 2Z4HA 1EY7A 3LNNA 4E6IA 5IY0A 5C4JB 1I3QB 2Z9HA 4YY3L 3SK8A 4OHJA 2B63H 1EY6A 3M4OH 1C8CA 2Y0SE 1L0WA 3HOZB 4L5SA 2F4IA 4IO9A 3M9BA 4DXGA 4OX9L 3GTPH 1PFBA 4GLVB 1Y8PB 1KABA 4CJ2C 3L2PA 1V1PA 2FMMA 2LXJA 3BZKA 1VQKA 1K8OA 3BYTB 4JI8Q 3W5OA 3TRZA 5IP9H 4A3EB 3P20A 1MD2D 2F0JA 1IXRA 2MJ8A 2I5MX 2EXZA 4JBMA 4GN3B 5I6WA 4CBVA 3A5ZB 5C0XG 1XMQQ 3CCEA 2Q8IB 4G7OC 2A19A 3S15H 4JI8L 1C48A 1TS2A 1ICWA 1B53A 3PUZA 2BA0A 4B3RQ 4O0AA 5GAGC 4RHSA 3HKZE 2GVBA 4C3HH 4KN4C 5IYDH 4R9WA 2I0QA 1XMQL 3K6OA 3D4RA 3H91A 3NQIA 3S14H 1K8GA 3S2DH 3ERSX 4A3GG 2E2HH 1D2BA 1GO3E 2OXPA 3UE1A 3I91A 5JJKA 2JE6I 1VQ9A 3I4NG 2F0EA 4UP8A 4XTCS 1PYBA 1C4QA 4BBRG 1YJ9A 5LMUQ 3HEJA 1JJ2A 1YNNC 3N6RA 3L3OC 5M3MH 1PZJD 3NP8A 4IPDA 3PUWA 4BY1H 3M3YH 1QCBD 1X32A 1VQLA 1I5FA 1O80A 2F0DA 3U9SA 1QUQB 2F3WA 2C5CA 4LF5Q 2FXQA 1GD7A 2AUJD 2AHOB 2EZVA 4DNIA 1ZXTA 1HPCA 4AYBG 1AW7A 5J1ZA 2JA9A 2OCEA 1QG7A 3KF8B 4C56C 3PO3H 4DAYB 3UE0A 1SMXA 1E24A 1JE4A 1K0SA 3S16H 1C9OA 4RCNA 1RF2D 2B63G 2F0UA 1Y1WG 4A3DG 4DR5Q 5J39A 5AFWA 1V1QA 1LO5D 2AUKA 5K36G 3X3MA 4KV6A 3G7LA 1KAAA 4EGVA 2X6GA 4POFA 2FMCA 3SE0A 1STNA 2NN6G 2HQEA 1U4LA 5GROA 1X9NA 2A74C 1BCPB 3VR2A 1FNVA 4DR5L 3M7NA 1F77A 1IBKL 1PRTD 5IP9G 3H3VI 3LWEA 5A35A 2NVTB 1B50A 4MTKA 1HR0Q 4FP5D 2IPKD 1DOMA 4LAAA 3WDNA 4H13C 1KNAA 3OWEB 2YV5A 2ZJQA 1IL2A 3HOUH 2NVYB 1X3PA 4TSSA 3MEFA 3KYHC 3V96A 2MO0A 2F0FA 2AQ1B 1GHJA 5JEAH 1HR0L 1IL8A 1H9RA 3P75A 2UXBQ 4ZYSA 3GTMB 3TS2A 4K5VA 5JJIA 4QUCA 2ES2A 4UPAA 4I65A 1T5EA 3LWUA 2E8GA 2PO4A 4ZUJA 5FO7B 2VUMB 2A6HC 5FO9B 2X69A 3ULPA 2M9VA 1KLGD 2DJFC 3HOZG 2UXBL 1A3TA 2L4NA 1PMRA 3GTQB 3E9IA 2VW9A 5M3MG 4A3CG 1GUSA 1EY4A 4LFBQ 1IBLQ 2HT1A 3NK9A 2NB0A 1PA6A 1BCPC 2G5DA 2EY1A 2LKVA 1WFQA 3BU2A 3K5OA 5M5XB 2PMZB 5I9PA 1GJXA 1JC7A 1WTQA 4A3IG 4HIOA 1AEXA 1IBLL 1T9HA 4FF4A 1I50B 4DV0Q 5IGBA 4DR7Q 1N33Q 5T1IA 4JI1Q 1K8AC 2HQLA 4PMWA 1PDQA 2RDGA 4DUYQ 1VQHA 1SNDA 2L11A 2H5XA 1QJOA 2R3ZA 5HY6A 4DV0L 1HNZQ 3HOYB 1KXLA 4IZ8A 2NYZD 2K05A 3K5NA 4ME5A 1N33L 4H7BA 4JI1L 4DKAC 4DR3Q 1TWFB 5I4DA 1GUGA 3PF5A 2VQFQ 1B3QA 4DUYL 1H9MA 1HNZL 4XYOA 1K83H 1NUCA 4DR6Q 1IYUA 4HIDA 4QY7A 4JPBW 3HOUG 2XGTA 1B4OA 2Q2UA 2F0WA 1JT8A 2R92B 2K03A 1TY2A 4HR7B 5TSSA 5JEAG 5AJ3Q 2F3IA 4ZKBB 2R7ZB 3ND9A 3ZYYX 2B8GA 4ZKCB 2F0LA 3RLFA 5D3DA 3V05A 3DWAA 3PUXA 2BOSA 3RUZA 2SEBD 3DXJC 4NPSA 3AQQA 3FMCA 5AJ3L 5EKKA 4RGTA 3CC7A 2R61A 4ME3A 3TP7A 4JI6L 3WOFA 4X3SA 3QR8A 2UU9Q 3TS0A 1DJRD 1Q81C 3GO5A 4GLXA 1PZID 3UDXA 3NBHA 5BN3A 5KEEA 4IFDG 4J1MA 2RQXA 3KLSA 2JEBI 1PRTB 2K5HA 2NVXH 2OT2A 4QIWB 1UE6A 5KNBA 2ATWA 1VMPA 4FXGC 1E0BA 2FFKB 1TWCB 1VQ6A 4FO2A 3K5MA 3DEPA 1CFMA 5KRUA 4APVA 1HNXL 1F2LA 3TZUA 2A68D 3I55A 1EQQA 2B2VC 2C9OA 4XIGS 2FHTA 3AYHB 4JYAQ 2JA6B 2QDBA 4C2MB 2B2YA 4DR1Q 3MWYW 3MHBA 3T51B 1JB7A 2RCNA 3RZOH 2J7ZA 4L5TA 1QNKA 1KDBA 1SMYD 1WYDA 1UEBA 3OHXC 4DPGA 1ESFA 2AWOA 4JYAL 1B70B 3M4YA 4C3JG 2VUMG 1D1KA 3D31A 2ICIA 4RWSC 5FOBB 3NWSA 4K8JA 1CHPD 4DR1L
chains in the Genus database with same CATH topology
4PG3A 3F1ZA 1IBMQ 4OO1G 4BY1G 1SE8A 5IYCH 1X6OA 1Y1VH 5M3FG 1XPOA 3J80c 4LF7L 5FLMG 3E0EA 4GKJQ 2QA4A 5C44H 4DV3Q 1KIXA 3S1QH 2N3SA 4BBSG 2AKWB 2WAQG 1V43A 1B7YB 4JCVE 3KF6A 3HOXH 1HZAA 3RNUA 5LMNQ 1PYSB 1IBML 3PO3G 1VQNA 2OQKA 4JI0Q 1VQFA 4GOPC 1XTDA 1I6HH 1YBYA 3GTJH 1VQOA 4LUOA 1HZCA 1JMCA 1VQ5A 4UY8C 4GKJL 1Q7YC 3TEHB 5BR8Q 4DV3L 4A3KG 4JI5Q 4PZ6A 4OWWB 2PI2E 4A76A 3CCLA 4A3BG 1A8VA 2NZHA 1N34Q 1OTCA 3KDFB 4LUVA 4LFAQ 1VQPA 1S40A 1YHAA 3HFZB 4AIMA 5LMNL 3CW2C 4R4QA 2VS1A 4JI0L 2K14A 1CUKA 4NB3A 1DGSA 3I7FA 3H15A 3H0GH 2WB1G 2NN6I 5J3BA 1P8LA 3FHWA 3CPFA 5BR8L 2Q2HA 1I94L 1UE5A 1PH1A 2UUBQ 2OTJA 1YHQA 1N34L 4LFCQ 1XMOQ 4LFAL 4X64Q 2OQ0A 2ZJRA 2ZM6Q 3HOYG 2PNHA 2KBNA 4TQUS 1BKBA 2YTXA 4B3RL 5C4JH 1SROA 1I3QH 1CSPA 5IYBG 4HJ9A 3CP0A 3CMEA 1VQ8A 3HOWH 1L2FA 2VY3A 2E5LQ 4MNOA 1WCMH 1XJVA 3GTMH 3K7AH 4IPHA 3HOZH 1BBWA 3DM3A 3W1BA 5ELNA 4AH6A 2YTYA 4LFCL 1PH8A 4IPCA 4DR2Q 4X64L 4PZ8A 3G71A 2Z6KC 4KHPQ 2ZM6L 3T1YQ 2GVAA 4A3CH 1Y14B 1L1OA 4EX5A 1XPRA 1KAWA 4YWMA 4J15A 4BXXG 1HJPA 4JI2Q 1P16A 1X65A 3K8AA 1U0LA 1BBUA 3F2BA 3L0OA 4JI6Q 2E2IH 1TWAH 2QGQA 1QUQA 4YCWA 3NEMA 4A3EH 1QZGA 5LMUL 3HOVG 3I4MG 1U5KA 4P74A 3GTKH 4KHPL 4DR2L 4BY7G 1Q8KA 1A0IA 3T1YL 3HKSA 5C3EH 1UWVA 2CQOA 2CWAA 1NJIC 4JI4L 2R7ZG 4OXPA 3NENA 4DV7Q 4A3IH 2CWPA 1WJJA 1PV4A 4JI2L 1W3SA 1H95A 2ID0A 4LF9Q 2UXDQ 3FKIG 1S3OA 4HJ7A 3G4SA 1VQMA 1CSQA 3OYYA 3M85A 3CCRA 4LF5L 2DGYA 1ASYA 1XNRQ 1PHJA 2IX1A 4A3GH 3NBHB 5ELOA 5LMNW 1X54A 1SLJA 2RF4A 3F2CA 2VNUD 2GN5A 1HNXQ 1J5EQ 4X66L 3I56A 1Y1VG 4DV7L 2PI2A 4WJ3M 3I4NH 5C0XI 3CCUA 3ICEA 2UXCQ 1NBWA 5C44G 4GKKQ 2B29A 4BBRH 4ALPA 5IWAQ 1A63A 3A0JA 2UXDL 2IT1A 3CCMA 1X3GA 1GM5A 1E1TA 1OXXK 3TQYA 4IJHA 3HOXG 1XNRL 3K0XA 4X62Q 4A3MH 3LGJA 3B6YA 1EOVA 5C4XH 4K0KQ 1PH6A 1N36Q 1J5EL 4DK6C 3STBC 3J7ZC 4A75A 4UP7A 1CKNA 2UXCL 2OWOA 3PCOB 4GKKL 1AE2A 1LM0A 4YY3Q 5IWAL 1A62A 1K73C 2JJQA 1X56A 4JI3Q 2N49A 3S1NH 4L5QA 2NZOA 4DK3C 3CCVA 3J81c 4X62L 2EIFA 2ZTDA 4A3FG 1YIJA 1N36L 4LF7Q 4TVAB 3AEVA 3H0GG 4R1JA 5IY0A 2CCZA 4YY3L 5GQOA 2B63H 2WFWA 3WWVA 3M4OH 1Q1BA 4JI3L 3CC2A 4H02A 2Y0SE 2D62A 1L0WA 1EQRA 4L5SA 4IO9A 3S24A 3PIPA 3M9BA 4C3IH 4IFDJ 4OX9L 3GTPH 3KLWA 1HZ9A 4GLVB 1LUZA 1KRTA 1TWHH 2EQSA 4O2DA 2MQHA 2BH2A 3L2PA 3GTGH 3HOWG 1NTGA 1YNXA 3UDFA 2LXJA 1R9TH 1WCMG 3BZKA 1VQKA 4JC0A 1WI5A 3OW2A 4JI8Q 3W5OA 4UP9A 2MNAA 5IP9H 3TRZA 1G6PA 4YWLA 3S17H 2JA5G 4EQ5A 4A3JH 1Q1EA 2Z6KA 2ZTCA 4DR4L 1IXRA 2MFIA 2I5MX 1HZBA 4JBMA 3PUVA 1I94Q 4GN3B 1N8RC 1NY4A 1PH4A 3A5ZB 5C0XG 4DV6Q 3CCEA 1XMQQ 2A19A 4A3EG 2R93H 3J80i 2NVTH 1Q12A 1NMFA 4JI8L 3S15H 4GN5A 5GADC 3PUZA 1FGUA 3CCQA 3I4OA 2BA0A 1YJWA 4B3RQ 4O0AA 5GAGC 4LFBL 3HKZE 2JQOA 5FJ8G 2ASBA 2GVBA 4HIKA 4C3HH 4X65L 1Q82C 3W1GA 2I0QA 2Q2TA 4A3LG 4YHHQ 2JEAI 2WP8J 4QQBX 5IYDH 2IY5B 4DV6L 1XMQL 4DAMA 2K50A 1S72A 2NVYH 5IE8A 3S14H 1K8GA 3S2DH 3ERSX 3PF4A 2AMCB 4QIWE 4A3GG 2E2HH 2I5LX 4PZ7A 1YJNA 2JK8A 3U50C 1GO3E 1K9MC 3KDFA 3PO2H 2A8VA 1VQIA 1X3EA 3OTOQ 3UE1A 1SR3A 2JE6I 1UE1A 2VZAA 3JC66 1W2BA 1VQ9A 5JJKA 2LSSA 3I4NG 1SRUA 4UP8A 4XTCS 1PYBA 4YHHL 4HIMA 4BBRG 3BZCA 1YJ9A 5LMUQ 1N9WA 1YITA 1VCIA 3IRBA 1JJ2A 4JI7L 4DR7L 2XTIA 4C3JH 2VUMH 5M3MH 3STBD 4JI4Q 2KENA 5C4XG 4IPDA 1L1OB 1YZ6A 3OTOL 3PUWA 4BY1H 3M3YH 2BH8A 1PFSA 3U58A 1VQLA 3G6EA 3GTQH 1I5FA 4B3TQ 2ZJPA 3TREA 1EUJA 4R4IA 4DV1Q 1M90C 4A93G 1D8LA 2A1AA 2VL6A 1QUQB 4LF5Q 2YU9H 2B3GA 1G51A 2FXQA 2UUCQ 1GD7A 2PQAA 2AHOB 4DNIA 4DR3L 1C7YA 4AYBG 3RR5A 4X66Q 2JA9A 1B8AA 2OCEA 1KRSA 3H3VH 3S2HH 3KF8B 1XNQQ 2VQFL 4DAYB 3UE0A 1SMXA 3PO3H 3KFUA 1E24A 3U4VA 1QVCA 1XPUA 4P75A 4QGUA 2WAQE 4JOIA 4B3TL 1C9OA 3AFPA 4QJFA 4DV1L 4LF6Q 2JA7H 1YHBA 5M5XH 2B63G 1Y1WG 1OXUA 4A3DG 4B3MQ 4DR5Q 4DR6L 1TXYA 1V1QA 3M4QA 4R4CA 3CPWA 2UUCL 3ER0A 3CF5A 5IYCG 4OO1I 2PMZE 2QEXA 5K36G 1I50H 4KI0A 1XNQL 1QZHA 2N8NA 4POFA 2C35B 2KHIA 5E7NA 2NN6G 2RHSB 1KL9A 1VQCA 3L7ZC 4LF6L 1ASZA 4LNQA 5GROA 1X9NA 3AFQA 2Z0SA 4B3ML 4DR5L 1AE3A 2LXKA 1CKMA 3M7NA 2R7FA 5IP9G 2HIVA 1IBKL 3CQZH 3H3VI 2K5NA 2WB1E 3PUYA 2K5VA 5JEAJ 3J81j 3RN2A 3CC4A 3HOYH 3F8TA 2RHQB 4GOPA 1CKNB 1HR0Q 2ZTEA 3A5UA 4POGA 2N78A 3JAMc 1TWFH 1VQEA 1EWIA 4L5RC 1RL2A 2R93G 3SGIA 2YV5A 2ZJQA 1MJCA 1IL2A 3HOUH 4OX9Q 2UU9L 4AQYQ 1L1OC 4NXNQ 3GD7A 2IX0A 3MEFA 3KYHC 2MO0A 2MO1A 4LWCA 1HR0L 4JBKA 3MXNB 3EBEA 2UXBQ 3RZDH 4BXXH 1E7ZA 1HH2P 4GNXB 4WJ4A 2CKZB 3TS2A 4RG1A 5JJIA 2R92H 4Y7NH 2ES2A 4UPAA 1FJGQ 3Q8DA 4YCUA 2E8GA 4AQYL 1VQ4A 4IPGA 2KCTA 4NXNL 4BY7H 4IOCA 4DR4Q 4FDBA 3ULPA 3EIVA 3J81i 1PH3A 2R7ZH 2CFMA 3HOZG 4HJ5A 5GAEC 2UXBL 3RLNA 4LF4Q 3KF6B 1LYLA 1KHIA 4AYBE 3E9IA 1E1OA 2BA1A 3PSIA 4JBWA 1EIFA 5M3MG 2VW9A 1EIYB 4BA2I 1KD1C 1FJGL 4A3CG 1VQAA 1EYGA 4LFBQ 1D7QA 2R6GA 3BJUA 1IBLQ 1LTLA 2HT1A 1SFOH 4X65Q 2JA8H 2NVQH 3S1MH 1PH9A 1HNWQ 1IYJB 1VQBA 3S16H 3CMAA 2ALYB 1PA6A 4LF4L 1WFQA 1G291 3BU2A 1Q86C 2KCMA 2DUDA 4B3SQ 1SN8A 5C3EG 4YWKA 3CD6A 4Y52H 1E22A 4RMFA 5M5YH 4P72A 4A3IG 4HIOA 1PH2A 1IBLL 1T9HA 4A4IA 4R4OA 1JJCB 4YCVA 1HNWL 4IJLA 3D0FA 1PH5A 4DV0Q 2JA7G 3NELA 4X6AH 1KC8C 4JI7Q 1QVGA 1TWCH 1N33Q 5IP7H 4DR7Q 4JI1Q 4B3SL 1K8AC 4IFDI 1E3PA 2HQLA 4OWTB 4PMWA 4DV2Q 1JJGA 2HHHQ 1QVFA 4DUYQ 1VQHA 4A3FH 2D0PA 1TWGH 4MZ9A 2H5XA 1GVPA 5HY6A 4DV0L 4HJ8A 1HNZQ 1HR0W 1KXLA 2JA6H 4GNXC 1VQJA 2AWNA 4JI5L 1N33L 2KHJA 4JI1L 4C2MH 4DKAC 4DR3Q 4A3MG 3J7A5 3CCSA 2K75A 3PF5A 4DV2L 2VQFQ 2HHHL 2D0OA 1V9PA 4DUYL 1NMGA 2VQEQ 5M3FH 1HNZL 5FLMH 1K83H 5C0XJ 4DR6Q 4P71A 4HIDA 4QY7A 3CXCA 4BBSH 3HOUG 2UUBL 2V1CC 2PQAB 4BA1I 2F52A 2XGTA 1JE5A 4R4TA 2Q2UA 5HGQA 1X55A 1JT8A 3CCJA 4OONA 1XMOL 4MTNA 2Y0SG 3RN5A 2JA5H 2VQEL 5JEAG 1GKHA 3GDEA 5AJ3Q 2L15A 4JV5Q 2F3IA 3E9HA 2R7DA 4A3KH 2E5LL 4A3BH 1FL0A 3RLOA 1O7IA 1IBKQ 2F4VQ 3RLFA 1IZ6A 2R92G 1FVIA 2IHFA 1VQGA 3PIOA 1K3RA 3PUXA 4LF8Q 3FP9A 2Q2IA 4NPSA 3AQQA 4P73A 3ZJYC 1EFWA 1OXTA 5AJ3L 5EAYA 1MJEA 1VS0A 5FJ8H 2E2JH 4NXMQ 3K7UC 4JV5L 3G48A 3CAMA 4ME3A 3CC7A 3T1HQ 4A3LH 1OXSC 4JI6L 4GN4B 2F4VL 1Z9FA 2UU9Q 3TS0A 1Q81C 4A3JG 1KQSA 3GO5A 1BVSA 4GLXA 4LF8L 4JBJA 3EN2A 1Q46A 3UDXA 1VQDA 4IFDG 3ULLA 2JA8G 3PV0A 4DV5Q 5H1SE 2JEBI 4GOPB 5IYBH 4DV4Q 2K5HA 3K81C 4KLKA 2NVXH 4NXML 3VDYA 3T1HL 3HKZG 1UE6A 3A74A 5FLXc 1J6QA 4IOAA 5IT9c 3M4PA 4LF9L 3DLLA 1RIPA 2ATWA 5GAHC 1MKHA 1WOCA 4LUZA 3KJOA 1N32Q 1YEZA 2HIXA 3U4ZA 1VQ6A 4DUZQ 3UDIA 1UE7A 2YYZA 4LW1A 5IYDG 2OTLA 1PVOA 1C0AA 4DV5L 1NE3A 1X3FA 4APVA 3PGZA 3I2ZA 4DV4L 1OXVA 1HNXL 2UUAQ 1AH9A 1PH7A 3I55A 1EQQA 2IHEA 4KHZA 3K80C 4XIGS 3KOJA 2EXDA 2K4KA 5IP7G 3AYHB 4JG2A 3GTLH 4JYAQ 2I5HA 4GS3A 4A93H 3I4MH 3HOVH 3PO2G 2K52A 5M5WH 1N32L 3JAMi 1VQ7A 4DR1Q 1YI2A 4HJAA 4DUZL 1YVCA 3ULJA 5DLQE 2RCNA 3F2DA 1MIUA 1JB7A 1CKOA 3GTOH 4K0KL 1Z47A 3RZOH 4L5TA 3S1RH 2UUAL 4JOIC 3UDGA 1K0RA 1WYDA 2JA6G 3KJPA 1M1KC 4DPGA 2AWOA 4JYAL 1B70B 2YTVA 2VUMG 3FKIH 4QL5A 3D31A 4GLAC 4GNXA 1Y1WH 4A3DH 5JJLA 1UEBA 4OWXB 4DR1L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PG3 A;  3F1Z A;  1IBM Q;  4OO1 G;  4BY1 G;  1SE8 A;  5IYC H;  1X6O A;  1Y1V H;  5M3F G;  1XPO A;  3J80 c;  4LF7 L;  5FLM G;  3E0E A;  4GKJ Q;  2QA4 A;  5C44 H;  4DV3 Q;  1KIX A;  3S1Q H;  2N3S A;  4BBS G;  2AKW B;  2WAQ G;  1V43 A;  1B7Y B;  4JCV E;  3KF6 A;  3HOX H;  1HZA A;  3RNU A;  5LMN Q;  1PYS B;  1IBM L;  3PO3 G;  1VQN A;  2OQK A;  4JI0 Q;  1VQF A;  4GOP C;  1XTD A;  1I6H H;  1YBY A;  3GTJ H;  1VQO A;  4LUO A;  1HZC A;  1JMC A;  1VQ5 A;  4UY8 C;  4GKJ L;  1Q7Y C;  3TEH B;  5BR8 Q;  4DV3 L;  4A3K G;  4JI5 Q;  4PZ6 A;  4OWW B;  2PI2 E;  4A76 A;  3CCL A;  4A3B G;  1A8V A;  2NZH A;  1N34 Q;  1OTC A;  3KDF B;  4LUV A;  4LFA Q;  1VQP A;  1S40 A;  1YHA A;  3HFZ B;  4AIM A;  5LMN L;  3CW2 C;  4R4Q A;  2VS1 A;  4JI0 L;  2K14 A;  1CUK A;  4NB3 A;  1DGS A;  3I7F A;  3H15 A;  3H0G H;  2WB1 G;  2NN6 I;  5J3B A;  1P8L A;  3FHW A;  3CPF A;  5BR8 L;  2Q2H A;  1I94 L;  1UE5 A;  1PH1 A;  2UUB Q;  2OTJ A;  1YHQ A;  1N34 L;  4LFC Q;  1XMO Q;  4LFA L;  4X64 Q;  2OQ0 A;  2ZJR A;  2ZM6 Q;  3HOY G;  2PNH A;  2KBN A;  4TQU S;  1BKB A;  2YTX A;  4B3R L;  5C4J H;  1SRO A;  1I3Q H;  1CSP A;  5IYB G;  4HJ9 A;  3CP0 A;  3CME A;  1VQ8 A;  3HOW H;  1L2F A;  2VY3 A;  2E5L Q;  4MNO A;  1WCM H;  1XJV A;  3GTM H;  3K7A H;  4IPH A;  3HOZ H;  1BBW A;  3DM3 A;  3W1B A;  5ELN A;  4AH6 A;  2YTY A;  4LFC L;  1PH8 A;  4IPC A;  4DR2 Q;  4X64 L;  4PZ8 A;  3G71 A;  2Z6K C;  4KHP Q;  2ZM6 L;  3T1Y Q;  2GVA A;  4A3C H;  1Y14 B;  1L1O A;  4EX5 A;  1XPR A;  1KAW A;  4YWM A;  4J15 A;  4BXX G;  1HJP A;  4JI2 Q;  1P16 A;  1X65 A;  3K8A A;  1U0L A;  1BBU A;  3F2B A;  3L0O A;  4JI6 Q;  2E2I H;  1TWA H;  2QGQ A;  1QUQ A;  4YCW A;  3NEM A;  4A3E H;  1QZG A;  5LMU L;  3HOV G;  3I4M G;  1U5K A;  4P74 A;  3GTK H;  4KHP L;  4DR2 L;  4BY7 G;  1Q8K A;  1A0I A;  3T1Y L;  3HKS A;  5C3E H;  1UWV A;  2CQO A;  2CWA A;  1NJI C;  4JI4 L;  2R7Z G;  4OXP A;  3NEN A;  4DV7 Q;  4A3I H;  2CWP A;  1WJJ A;  1PV4 A;  4JI2 L;  1W3S A;  1H95 A;  2ID0 A;  4LF9 Q;  2UXD Q;  3FKI G;  1S3O A;  4HJ7 A;  3G4S A;  1VQM A;  1CSQ A;  3OYY A;  3M85 A;  3CCR A;  4LF5 L;  2DGY A;  1ASY A;  1XNR Q;  1PHJ A;  2IX1 A;  4A3G H;  3NBH B;  5ELO A;  5LMN W;  1X54 A;  1SLJ A;  2RF4 A;  3F2C A;  2VNU D;  2GN5 A;  1HNX Q;  1J5E Q;  4X66 L;  3I56 A;  1Y1V G;  4DV7 L;  2PI2 A;  4WJ3 M;  3I4N H;  5C0X I;  3CCU A;  3ICE A;  2UXC Q;  1NBW A;  5C44 G;  4GKK Q;  2B29 A;  4BBR H;  4ALP A;  5IWA Q;  1A63 A;  3A0J A;  2UXD L;  2IT1 A;  3CCM A;  1X3G A;  1GM5 A;  1E1T A;  1OXX K;  3TQY A;  4IJH A;  3HOX G;  1XNR L;  3K0X A;  4X62 Q;  4A3M H;  3LGJ A;  3B6Y A;  1EOV A;  5C4X H;  4K0K Q;  1PH6 A;  1N36 Q;  1J5E L;  4DK6 C;  3STB C;  3J7Z C;  4A75 A;  4UP7 A;  1CKN A;  2UXC L;  2OWO A;  3PCO B;  4GKK L;  1AE2 A;  1LM0 A;  4YY3 Q;  5IWA L;  1A62 A;  1K73 C;  2JJQ A;  1X56 A;  4JI3 Q;  2N49 A;  3S1N H;  4L5Q A;  2NZO A;  4DK3 C;  3CCV A;  3J81 c;  4X62 L;  2EIF A;  2ZTD A;  4A3F G;  1YIJ A;  1N36 L;  4LF7 Q;  4TVA B;  3AEV A;  3H0G G;  4R1J A;  5IY0 A;  2CCZ A;  4YY3 L;  5GQO A;  2B63 H;  2WFW A;  3WWV A;  3M4O H;  1Q1B A;  4JI3 L;  3CC2 A;  4H02 A;  2Y0S E;  2D62 A;  1L0W A;  1EQR A;  4L5S A;  4IO9 A;  3S24 A;  3PIP A;  3M9B A;  4C3I H;  4IFD J;  4OX9 L;  3GTP H;  3KLW A;  1HZ9 A;  4GLV B;  1LUZ A;  1KRT A;  1TWH H;  2EQS A;  4O2D A;  2MQH A;  2BH2 A;  3L2P A;  3GTG H;  3HOW G;  1NTG A;  1YNX A;  3UDF A;  2LXJ A;  1R9T H;  1WCM G;  3BZK A;  1VQK A;  4JC0 A;  1WI5 A;  3OW2 A;  4JI8 Q;  3W5O A;  4UP9 A;  2MNA A;  5IP9 H;  3TRZ A;  1G6P A;  4YWL A;  3S17 H;  2JA5 G;  4EQ5 A;  4A3J H;  1Q1E A;  2Z6K A;  2ZTC A;  4DR4 L;  1IXR A;  2MFI A;  2I5M X;  1HZB A;  4JBM A;  3PUV A;  1I94 Q;  4GN3 B;  1N8R C;  1NY4 A;  1PH4 A;  3A5Z B;  5C0X G;  4DV6 Q;  3CCE A;  1XMQ Q;  2A19 A;  4A3E G;  2R93 H;  3J80 i;  2NVT H;  1Q12 A;  1NMF A;  4JI8 L;  3S15 H;  4GN5 A;  5GAD C;  3PUZ A;  1FGU A;  3CCQ A;  3I4O A;  2BA0 A;  1YJW A;  4B3R Q;  4O0A A;  5GAG C;  4LFB L;  3HKZ E;  2JQO A;  5FJ8 G;  2ASB A;  2GVB A;  4HIK A;  4C3H H;  4X65 L;  1Q82 C;  3W1G A;  2I0Q A;  2Q2T A;  4A3L G;  4YHH Q;  2JEA I;  2WP8 J;  4QQB X;  5IYD H;  2IY5 B;  4DV6 L;  1XMQ L;  4DAM A;  2K50 A;  1S72 A;  2NVY H;  5IE8 A;  3S14 H;  1K8G A;  3S2D H;  3ERS X;  3PF4 A;  2AMC B;  4QIW E;  4A3G G;  2E2H H;  2I5L X;  4PZ7 A;  1YJN A;  2JK8 A;  3U50 C;  1GO3 E;  1K9M C;  3KDF A;  3PO2 H;  2A8V A;  1VQI A;  1X3E A;  3OTO Q;  3UE1 A;  1SR3 A;  2JE6 I;  1UE1 A;  2VZA A;  3JC6 6;  1W2B A;  1VQ9 A;  5JJK A;  2LSS A;  3I4N G;  1SRU A;  4UP8 A;  4XTC S;  1PYB A;  4YHH L;  4HIM A;  4BBR G;  3BZC A;  1YJ9 A;  5LMU Q;  1N9W A;  1YIT A;  1VCI A;  3IRB A;  1JJ2 A;  4JI7 L;  4DR7 L;  2XTI A;  4C3J H;  2VUM H;  5M3M H;  3STB D;  4JI4 Q;  2KEN A;  5C4X G;  4IPD A;  1L1O B;  1YZ6 A;  3OTO L;  3PUW A;  4BY1 H;  3M3Y H;  2BH8 A;  1PFS A;  3U58 A;  1VQL A;  3G6E A;  3GTQ H;  1I5F A;  4B3T Q;  2ZJP A;  3TRE A;  1EUJ A;  4R4I A;  4DV1 Q;  1M90 C;  4A93 G;  1D8L A;  2A1A A;  2VL6 A;  1QUQ B;  4LF5 Q;  2YU9 H;  2B3G A;  1G51 A;  2FXQ A;  2UUC Q;  1GD7 A;  2PQA A;  2AHO B;  4DNI A;  4DR3 L;  1C7Y A;  4AYB G;  3RR5 A;  4X66 Q;  2JA9 A;  1B8A A;  2OCE A;  1KRS A;  3H3V H;  3S2H H;  3KF8 B;  1XNQ Q;  2VQF L;  4DAY B;  3UE0 A;  1SMX A;  3PO3 H;  3KFU A;  1E24 A;  3U4V A;  1QVC A;  1XPU A;  4P75 A;  4QGU A;  2WAQ E;  4JOI A;  4B3T L;  1C9O A;  3AFP A;  4QJF A;  4DV1 L;  4LF6 Q;  2JA7 H;  1YHB A;  5M5X H;  2B63 G;  1Y1W G;  1OXU A;  4A3D G;  4B3M Q;  4DR5 Q;  4DR6 L;  1TXY A;  1V1Q A;  3M4Q A;  4R4C A;  3CPW A;  2UUC L;  3ER0 A;  3CF5 A;  5IYC G;  4OO1 I;  2PMZ E;  2QEX A;  5K36 G;  1I50 H;  4KI0 A;  1XNQ L;  1QZH A;  2N8N A;  4POF A;  2C35 B;  2KHI A;  5E7N A;  2NN6 G;  2RHS B;  1KL9 A;  1VQC A;  3L7Z C;  4LF6 L;  1ASZ A;  4LNQ A;  5GRO A;  1X9N A;  3AFQ A;  2Z0S A;  4B3M L;  4DR5 L;  1AE3 A;  2LXK A;  1CKM A;  3M7N A;  2R7F A;  5IP9 G;  2HIV A;  1IBK L;  3CQZ H;  3H3V I;  2K5N A;  2WB1 E;  3PUY A;  2K5V A;  5JEA J;  3J81 j;  3RN2 A;  3CC4 A;  3HOY H;  3F8T A;  2RHQ B;  4GOP A;  1CKN B;  1HR0 Q;  2ZTE A;  3A5U A;  4POG A;  2N78 A;  3JAM c;  1TWF H;  1VQE A;  1EWI A;  4L5R C;  1RL2 A;  2R93 G;  3SGI A;  2YV5 A;  2ZJQ A;  1MJC A;  1IL2 A;  3HOU H;  4OX9 Q;  2UU9 L;  4AQY Q;  1L1O C;  4NXN Q;  3GD7 A;  2IX0 A;  3MEF A;  3KYH C;  2MO0 A;  2MO1 A;  4LWC A;  1HR0 L;  4JBK A;  3MXN B;  3EBE A;  2UXB Q;  3RZD H;  4BXX H;  1E7Z A;  1HH2 P;  4GNX B;  4WJ4 A;  2CKZ B;  3TS2 A;  4RG1 A;  5JJI A;  2R92 H;  4Y7N H;  2ES2 A;  4UPA A;  1FJG Q;  3Q8D A;  4YCU A;  2E8G A;  4AQY L;  1VQ4 A;  4IPG A;  2KCT A;  4NXN L;  4BY7 H;  4IOC A;  4DR4 Q;  4FDB A;  3ULP A;  3EIV A;  3J81 i;  1PH3 A;  2R7Z H;  2CFM A;  3HOZ G;  4HJ5 A;  5GAE C;  2UXB L;  3RLN A;  4LF4 Q;  3KF6 B;  1LYL A;  1KHI A;  4AYB E;  3E9I A;  1E1O A;  2BA1 A;  3PSI A;  4JBW A;  1EIF A;  5M3M G;  2VW9 A;  1EIY B;  4BA2 I;  1KD1 C;  1FJG L;  4A3C G;  1VQA A;  1EYG A;  4LFB Q;  1D7Q A;  2R6G A;  3BJU A;  1IBL Q;  1LTL A;  2HT1 A;  1SFO H;  4X65 Q;  2JA8 H;  2NVQ H;  3S1M H;  1PH9 A;  1HNW Q;  1IYJ B;  1VQB A;  3S16 H;  3CMA A;  2ALY B;  1PA6 A;  4LF4 L;  1WFQ A;  1G29 1;  3BU2 A;  1Q86 C;  2KCM A;  2DUD A;  4B3S Q;  1SN8 A;  5C3E G;  4YWK A;  3CD6 A;  4Y52 H;  1E22 A;  4RMF A;  5M5Y H;  4P72 A;  4A3I G;  4HIO A;  1PH2 A;  1IBL L;  1T9H A;  4A4I A;  4R4O A;  1JJC B;  4YCV A;  1HNW L;  4IJL A;  3D0F A;  1PH5 A;  4DV0 Q;  2JA7 G;  3NEL A;  4X6A H;  1KC8 C;  4JI7 Q;  1QVG A;  1TWC H;  1N33 Q;  5IP7 H;  4DR7 Q;  4JI1 Q;  4B3S L;  1K8A C;  4IFD I;  1E3P A;  2HQL A;  4OWT B;  4PMW A;  4DV2 Q;  1JJG A;  2HHH Q;  1QVF A;  4DUY Q;  1VQH A;  4A3F H;  2D0P A;  1TWG H;  4MZ9 A;  2H5X A;  1GVP A;  5HY6 A;  4DV0 L;  4HJ8 A;  1HNZ Q;  1HR0 W;  1KXL A;  2JA6 H;  4GNX C;  1VQJ A;  2AWN A;  4JI5 L;  1N33 L;  2KHJ A;  4JI1 L;  4C2M H;  4DKA C;  4DR3 Q;  4A3M G;  3J7A 5;  3CCS A;  2K75 A;  3PF5 A;  4DV2 L;  2VQF Q;  2HHH L;  2D0O A;  1V9P A;  4DUY L;  1NMG A;  2VQE Q;  5M3F H;  1HNZ L;  5FLM H;  1K83 H;  5C0X J;  4DR6 Q;  4P71 A;  4HID A;  4QY7 A;  3CXC A;  4BBS H;  3HOU G;  2UUB L;  2V1C C;  2PQA B;  4BA1 I;  2F52 A;  2XGT A;  1JE5 A;  4R4T A;  2Q2U A;  5HGQ A;  1X55 A;  1JT8 A;  3CCJ A;  4OON A;  1XMO L;  4MTN A;  2Y0S G;  3RN5 A;  2JA5 H;  2VQE L;  5JEA G;  1GKH A;  3GDE A;  5AJ3 Q;  2L15 A;  4JV5 Q;  2F3I A;  3E9H A;  2R7D A;  4A3K H;  2E5L L;  4A3B H;  1FL0 A;  3RLO A;  1O7I A;  1IBK Q;  2F4V Q;  3RLF A;  1IZ6 A;  2R92 G;  1FVI A;  2IHF A;  1VQG A;  3PIO A;  1K3R A;  3PUX A;  4LF8 Q;  3FP9 A;  2Q2I A;  4NPS A;  3AQQ A;  4P73 A;  3ZJY C;  1EFW A;  1OXT A;  5AJ3 L;  5EAY A;  1MJE A;  1VS0 A;  5FJ8 H;  2E2J H;  4NXM Q;  3K7U C;  4JV5 L;  3G48 A;  3CAM A;  4ME3 A;  3CC7 A;  3T1H Q;  4A3L H;  1OXS C;  4JI6 L;  4GN4 B;  2F4V L;  1Z9F A;  2UU9 Q;  3TS0 A;  1Q81 C;  4A3J G;  1KQS A;  3GO5 A;  1BVS A;  4GLX A;  4LF8 L;  4JBJ A;  3EN2 A;  1Q46 A;  3UDX A;  1VQD A;  4IFD G;  3ULL A;  2JA8 G;  3PV0 A;  4DV5 Q;  5H1S E;  2JEB I;  4GOP B;  5IYB H;  4DV4 Q;  2K5H A;  3K81 C;  4KLK A;  2NVX H;  4NXM L;  3VDY A;  3T1H L;  3HKZ G;  1UE6 A;  3A74 A;  5FLX c;  1J6Q A;  4IOA A;  5IT9 c;  3M4P A;  4LF9 L;  3DLL A;  1RIP A;  2ATW A;  5GAH C;  1MKH A;  1WOC A;  4LUZ A;  3KJO A;  1N32 Q;  1YEZ A;  2HIX A;  3U4Z A;  1VQ6 A;  4DUZ Q;  3UDI A;  1UE7 A;  2YYZ A;  4LW1 A;  5IYD G;  2OTL A;  1PVO A;  1C0A A;  4DV5 L;  1NE3 A;  1X3F A;  4APV A;  3PGZ A;  3I2Z A;  4DV4 L;  1OXV A;  1HNX L;  2UUA Q;  1AH9 A;  1PH7 A;  3I55 A;  1EQQ A;  2IHE A;  4KHZ A;  3K80 C;  4XIG S;  3KOJ A;  2EXD A;  2K4K A;  5IP7 G;  3AYH B;  4JG2 A;  3GTL H;  4JYA Q;  2I5H A;  4GS3 A;  4A93 H;  3I4M H;  3HOV H;  3PO2 G;  2K52 A;  5M5W H;  1N32 L;  3JAM i;  1VQ7 A;  4DR1 Q;  1YI2 A;  4HJA A;  4DUZ L;  1YVC A;  3ULJ A;  5DLQ E;  2RCN A;  3F2D A;  1MIU A;  1JB7 A;  1CKO A;  3GTO H;  4K0K L;  1Z47 A;  3RZO H;  4L5T A;  3S1R H;  2UUA L;  4JOI C;  3UDG A;  1K0R A;  1WYD A;  2JA6 G;  3KJP A;  1M1K C;  4DPG A;  2AWO A;  4JYA L;  1B70 B;  2YTV A;  2VUM G;  3FKI H;  4QL5 A;  3D31 A;  4GLA C;  4GNX A;  1Y1W H;  4A3D H;  5JJL A;  1UEB A;  4OWX B;  4DR1 L; 
#chains in the Genus database with same CATH topology
 4OO1 G;  1X6O A;  4RCO A;  3J80 c;  2JA5 B;  5C44 H;  3S1Q H;  1GOZ A;  4A3K B;  1B7Y B;  4FF1 A;  2F1M A;  1VQN A;  3MXP A;  1Y8O B;  2H4O A;  4UDU C;  1VQF A;  3HS0 C;  1XTD A;  1I6H H;  1PRT C;  4LUO A;  1Q7Y C;  1JWM D;  4HCS A;  1SE4 A;  4OWW B;  2PI2 E;  4A76 A;  3CCL A;  2E2J B;  3C46 A;  4LJZ C;  2NZH A;  3KDF B;  4LFA Q;  1VQP A;  3HFZ B;  4AIM A;  4R4Q A;  4CDE C;  2EYP A;  4DN4 M;  4NB3 A;  3I7F A;  1Y8N B;  1DOK A;  4YIJ A;  3SK4 A;  2NN6 I;  2AQ3 B;  3CPF A;  1I94 L;  1PH1 A;  2JP1 A;  4DXF A;  5CV5 A;  1EY9 A;  4ODG A;  1YHQ A;  3DWP A;  2B2U A;  4LFA L;  1E2Z A;  2B39 A;  5G3L F;  3HOY G;  2KBN A;  4ZK9 B;  1SYC A;  4HJ9 A;  3CME A;  1VQ8 A;  2VY3 A;  5D14 A;  1XJV A;  1BBW A;  3DM3 A;  3I70 A;  1VDZ A;  1PH8 A;  4KHP Q;  3AMU A;  4A93 B;  1L1O A;  1SJE D;  4EX5 A;  2Z8L A;  1BO0 A;  2K7V A;  4BXX G;  4Q0F A;  1CA6 A;  2E2I H;  2QGQ A;  4PMB A;  5FKA C;  4ZRZ A;  4KHP L;  3J80 L;  3FKI B;  2QF7 A;  1DXM A;  1FNW A;  3CHB D;  2CQO A;  4CKE A;  2R7Z G;  2D5D A;  4DV7 Q;  2CWP A;  4KJO A;  1ENA A;  1XTC D;  5I9O A;  1Y1V B;  1H95 A;  1EOT A;  2ID0 A;  1PZK D;  5A2Q L;  1BCP F;  3G4S A;  3OYY A;  5IGC A;  2IX1 A;  1CK1 A;  3D4D A;  4N8X 1;  1SLJ A;  3PQI A;  4L6T B;  3HOX B;  3I56 A;  4DV7 L;  2PI2 A;  2K1B A;  3C1F A;  3ICE A;  1NBW A;  5E1F A;  5C44 G;  1Q8I A;  1LV9 A;  3OOC A;  4IN3 A;  2NWG A;  4K14 A;  4A3M H;  4K0K Q;  1ZYR C;  5C4X H;  1PH6 A;  4DNT B;  4DK6 C;  3STB C;  2E75 C;  2OWO A;  1HTL D;  3X3N A;  2DNE A;  2EYJ A;  2JJQ A;  1X56 A;  4MHE A;  3S1N H;  2NZO A;  4DK3 C;  3J7A F;  2F3V A;  3J81 c;  1QE6 A;  2ZXR A;  1TS4 A;  3UI2 A;  3G6J B;  4TVA B;  1TVX A;  1G8Z D;  5GQO A;  4K2L A;  1Q1B A;  3K7A B;  1EQR A;  4OEM B;  3J80 E;  3MXU A;  4C3I H;  1HZ9 A;  1Q3L A;  1LUZ A;  2A6E D;  1TWH H;  4KKT A;  4O2D A;  1KRT A;  2BH2 A;  3GTG H;  1NTG A;  1YNX A;  5I2Y A;  1R9T H;  3ITP A;  1DM0 B;  1CM9 A;  5KGU A;  5A2Q E;  2A69 C;  5C5M A;  1WI5 A;  1TWA B;  2MNA A;  1WTO A;  2F0G A;  3S17 H;  2JA5 G;  4RAU C;  4A3J H;  3GTK B;  5LL6 S;  4DR4 L;  2EYM A;  3PUV A;  4DV6 Q;  4I7A A;  2L1B A;  3J80 i;  4M8A A;  3OSO A;  3SHL A;  2XIW A;  1YJW A;  4A3G B;  3K59 A;  4QB4 A;  5FJ8 G;  5IT9 L;  5EBC A;  4CGY B;  4HIK A;  1JB3 A;  4X65 L;  1Q82 C;  3W1G A;  2F0O A;  2WP8 J;  2RKS A;  4DV6 L;  4K5W A;  4DAM A;  3I4N B;  2K50 A;  3IKJ A;  4BBR B;  2A68 C;  3I73 A;  2JK8 A;  1K9M C;  3KDF A;  1MSG A;  2A8V A;  3OTO Q;  3TDQ A;  3NTH A;  1KNE A;  4NKL A;  2NUC A;  3QO2 A;  2VZA A;  4NP5 A;  4EQP A;  2O4X A;  3SVM A;  2MGS A;  3BVZ A;  4JI7 L;  3H94 A;  2HCI A;  1SMY C;  1AN8 A;  4G4K A;  3ERQ A;  2KEN A;  1I6V C;  1SNQ A;  5C4X G;  5D65 A;  3OTO L;  2JXM B;  3OMC A;  2BH8 A;  1PFS A;  2B2T A;  4B3T Q;  2ZJP A;  1SE3 A;  1M90 C;  4A93 G;  2Y0S B;  1CZG A;  4KK7 A;  2B3G A;  3SR1 A;  2UUC Q;  1BDO A;  2PQA A;  2B63 B;  3M4O B;  4X66 Q;  2DY7 A;  1B8A A;  4IUN A;  2K6A A;  5ISR A;  1HCZ A;  3KFU A;  3U4V A;  1QVC A;  3GTP B;  3P7J A;  4P75 A;  2WAQ E;  4B3T L;  2JA7 H;  4QJF A;  2M2L A;  1OXU A;  5C4Z A;  2XN9 C;  1TXY A;  3KK7 A;  2UUC L;  2KED A;  3ER0 A;  3CF5 A;  5IYC G;  1JWS D;  4C3I G;  1HFG A;  3DMU A;  4OO1 I;  5J22 A;  2PZT A;  3P1H A;  4KI0 A;  5IT9 E;  3A54 A;  3R2T A;  2RBM A;  1RKN A;  2KHI A;  1PRT F;  2RHS B;  1KL9 A;  1PFN A;  1VQC A;  3QIA A;  1HXY D;  3AFQ A;  1XXG A;  2Z0S A;  5CMD A;  4CJ1 B;  1CKM A;  2HIV A;  2O5I C;  1V1O A;  1ZKO A;  4K8I A;  3QOJ A;  5E4W C;  4N9T A;  3RN2 A;  1PXU A;  3CC4 A;  2RHQ B;  3C3L A;  1CKN B;  4V19 0;  2RDH A;  3A7A B;  4C3H B;  4L5R C;  2FJ2 A;  1MJC A;  4KY6 A;  2KCN A;  3N52 A;  1NAP A;  4OX9 Q;  3S14 B;  4U67 3;  3S2D B;  1B2T A;  1DYQ A;  4AQY Q;  4NXN Q;  2E2H B;  1PTO H;  3KLS X;  2MO1 A;  1FYC A;  4ID6 A;  3MXN B;  2NZ1 D;  4XQQ A;  4CDF C;  2PZW A;  1HH2 P;  2BDN A;  2CKZ B;  2ZT9 C;  1J8I A;  3M7G A;  4AQY L;  5E4X A;  3I4L A;  4NXN L;  3MFG A;  5I2X A;  5M3M B;  4FDB A;  5L37 A;  3EIV A;  3J81 i;  3Q0A A;  4BY1 B;  5ELF A;  3M3Y B;  2B2W C;  5ELD A;  1GUW A;  4LF4 Q;  4UHV A;  4AYB E;  4JBW A;  3PSI A;  1EIY B;  4BA2 I;  2XRQ D;  4H44 C;  1D7Q A;  2QIL A;  1EYG A;  3S1M H;  1LTL A;  4RGO S;  3KUP A;  2NVQ H;  1F9P A;  4A3I B;  1HHV A;  3CMA A;  3PO3 B;  3H09 A;  1S5C D;  1FNU A;  1Z7T A;  4LF4 L;  3S16 B;  3W3A A;  2DUD A;  4B3S Q;  1HFN A;  4YWK A;  1E22 A;  4IUP A;  5D3I B;  5M5Y H;  4P72 A;  4C1N I;  2H1E A;  1F2M A;  4R4O A;  5C3W A;  4YCV A;  5EKL A;  1PH5 A;  2JA7 G;  3NEL A;  2LMC B;  1IKM A;  1E2W A;  4B3S L;  5JJZ A;  1E3P A;  1H9S B;  4JW0 A;  1QVF A;  3Q24 A;  4A3F H;  1F2Y A;  4NDX A;  1ML0 D;  1GHK A;  3F2U A;  1S5F D;  3AB9 A;  4JI5 L;  3VR6 A;  5FK9 C;  2EVB A;  3J7A 5;  1CA5 A;  3MZ5 A;  4K6L A;  3HOU B;  2D0O A;  3VR3 A;  3CRL C;  3WOE A;  4CHT B;  1SEB D;  5JAV A;  5C0X J;  5JVG 3;  4R8I A;  2A6E C;  3CXC A;  1BNZ A;  4BBS H;  2V1C C;  4OIK A;  2HDL A;  4BA1 I;  2F52 A;  4R4T A;  1JE5 A;  3CCJ A;  4OON A;  1XMO L;  5EJW A;  4MTN A;  5IGE A;  2Y0S G;  2I46 A;  3TME A;  1GKH A;  3GDE A;  2L15 A;  2NTS A;  3SDZ A;  3E9H A;  3OWF A;  2E5L L;  3HP3 A;  3NXW A;  1STE A;  5C4H A;  1IBK Q;  4A3B H;  2F4V Q;  2HDM A;  2IHF A;  3PIO A;  5ELB A;  4N8F A;  2Q2I A;  3ZJY C;  3MA2 B;  2MP1 A;  3T56 B;  1WTX A;  4NXM Q;  3G48 A;  1SBB B;  4A3L H;  1K8M A;  2F4V L;  3A8J E;  4PMC A;  1S5B D;  1KQS A;  3Q23 A;  4XT1 B;  4JBJ A;  3EN2 A;  1VQD A;  3TBI B;  3ULL A;  3MVV A;  4GOP B;  3K81 C;  4NXM L;  3VDY A;  1JWU D;  1G6Z A;  3R8B A;  1A3V A;  3HKZ G;  5FLX c;  1NNX A;  1J6Q A;  2XSC A;  3M4P A;  1MKH A;  1IYV A;  4DUZ Q;  4C3H G;  1PVO A;  1C0A A;  5IYD G;  1NE3 A;  1JOO A;  3PGZ A;  1AH9 A;  1L0Y B;  4KHZ A;  4CDD C;  1HA5 A;  3KOJ A;  4JG2 A;  3TP8 A;  4KY7 A;  1IW7 D;  3I4M H;  3HOV H;  2Z6B A;  5M5W H;  3BDL A;  2O5J C;  1AFP A;  1VQ7 A;  1ONL A;  1B3A A;  4C3J B;  1YI2 A;  4U68 A;  4DUZ L;  1YVC A;  3F2D A;  5DLQ E;  1GUT A;  5CBA E;  3S1R H;  4JOI C;  3UDG A;  1ESR A;  4K6D A;  3KJP A;  3MXN A;  2F0M A;  1K83 B;  5JJL A;  4QL5 A;  4NMZ A;  5CV7 A;  4OWX B;  4BY1 G;  1DCZ A;  4G7Z C;  1XPO A;  4LF7 L;  4GKJ Q;  3E0E A;  3EJI A;  2QA4 A;  1F2Z A;  1SYD A;  4DV3 Q;  1KIX A;  1ET9 A;  4BBS G;  2N3S A;  1NR2 A;  3GV6 A;  2BE5 C;  1D5Z C;  1HZA A;  3RNU A;  3PO3 G;  1ROD A;  2OQK A;  4JI0 Q;  2KJX A;  2IWH A;  3V2T A;  4GOP C;  1YBY A;  3GTJ H;  1VQO A;  4HTH A;  4GKJ L;  3TEH B;  4DV3 L;  5EPJ A;  4A3B G;  1TU2 B;  4CJ0 B;  1OTC A;  2K01 A;  1DZ1 A;  5CGK A;  3CW2 C;  2CW0 C;  1EIG A;  1OO9 B;  2VS1 A;  4JI0 L;  2K14 A;  1II3 A;  5FLX L;  3H15 A;  5LL6 X;  1AZQ A;  3MAQ A;  5J3B A;  4IUU A;  3FHW A;  2Q2H A;  3BS1 A;  2NVX B;  2OTJ A;  4IUQ A;  2OQ0 A;  2ZM6 Q;  3HRZ C;  3I3C A;  1SRO A;  3CP0 A;  1HUN A;  3S9W A;  3HOW H;  1WCM H;  3GTM H;  3W1B A;  4IPC A;  4DR2 Q;  1I4P A;  4KD3 A;  3URY A;  2ZM6 L;  1BR9 A;  5EQ0 A;  1HJP A;  3K8A A;  4JI6 Q;  4YCW A;  3FEW X;  1QUQ A;  3NEM A;  1NSN S;  1QZG A;  3I4M G;  3HOV G;  3NQT A;  4DR2 L;  5IGD A;  1D1I A;  1EY8 A;  5C3E H;  1UWV A;  1W6K A;  4JI4 L;  3KF8 A;  1O7L A;  3NEN A;  4DAY A;  3A7L A;  3ND8 A;  2KHS A;  4GZY C;  2F0H A;  2UXD Q;  5C44 B;  1VQM A;  3M85 A;  2PNR C;  3IFT A;  1ASY A;  3S1Q B;  5ELO A;  5LMN W;  2RF4 A;  1LT6 D;  3RMH A;  1HNX Q;  3BDO A;  5FLX E;  5C0X I;  2UXC Q;  4GKK Q;  2B29 A;  1I6H B;  4ALP A;  1A63 A;  1WTV A;  2UXD L;  2IT1 A;  1X3G A;  4ZQ3 A;  1SSO A;  4X62 Q;  2L12 A;  3B6Y A;  4A75 A;  1TS3 A;  3RD4 A;  2UXC L;  4EQN A;  4GKK L;  1AE2 A;  1LM0 A;  4G57 A;  3VYT A;  4JI3 Q;  3DWQ A;  1TS5 A;  4X62 L;  1YIJ A;  3I90 A;  1SYF A;  3VA7 A;  1S5E D;  3MXG A;  3AEV A;  2B8F A;  2CCZ A;  2KOL A;  1NCV A;  2WFW A;  3WWV A;  2ICE C;  5CV8 A;  4JI3 L;  4H02 A;  2D62 A;  1EYC A;  4HSV A;  3S24 A;  1Z6H A;  4IFD J;  3KLW A;  2JN4 A;  1UAP A;  2G9D A;  3HOW G;  5EPL A;  3UDF A;  1PFM A;  1WCM G;  2DNC A;  2E74 C;  2RA4 A;  2ENB A;  4MN3 A;  1WTW A;  1TQO A;  5HUR A;  3OW2 A;  1V8Q A;  2EDG A;  2WII B;  4UP9 A;  2E2I B;  1QNU A;  1Q1E A;  3QB3 A;  4CKB A;  1HZB A;  1PLF A;  3K5L A;  1I94 Q;  5IOC A;  1Y69 U;  1N8R C;  1NY4 A;  2SOB A;  5KYL A;  1GXD C;  4B9X A;  1EU3 A;  2R93 H;  5JPN C;  2WV6 D;  4GN5 A;  1S4Z A;  5GAD C;  1LAB A;  2L9H A;  4CDC C;  1SNM A;  1LT5 D;  2JQO A;  3NBI A;  1SXT A;  5EPK A;  1FR3 A;  3ONA B;  4OL7 A;  4YHH Q;  2JEA I;  2IY5 B;  1S72 A;  2IX3 A;  3PF4 A;  2AMC B;  4QIW E;  2EYH A;  2I5L X;  3MTS A;  2IL8 A;  4PZ7 A;  3U50 C;  1SYE A;  1EIH A;  3PO2 H;  4OIJ A;  2F0P A;  1B9M A;  1CT1 D;  1SR3 A;  1IW7 C;  1H9K A;  1UE1 A;  3JC6 6;  4XQN A;  4A3M B;  1W2B A;  5T1G A;  5C4X B;  1RTN A;  1SRU A;  4YHH L;  4HIM A;  5DAU A;  1TII D;  4DU9 A;  1YIT A;  1VCI A;  3IRB A;  4M1U B;  1B44 D;  2J0T D;  5ELC A;  1PTO D;  4MIU A;  3S1N B;  2L55 A;  4ULL A;  3W2D A;  3U58 A;  3QOL A;  1I4H A;  3NE5 B;  4DV1 Q;  3TRE A;  2B2V A;  2A1A A;  2VXW A;  1WTR A;  2YU9 H;  2TMP A;  1G51 A;  1QIL A;  1UNS A;  4K5X A;  1C7Y A;  1B1Z A;  3H3V H;  4G7H C;  1KRS A;  3S2H H;  1XNQ Q;  4C3I B;  1XPU A;  1EY0 A;  4QGU A;  3AFP A;  4DV1 L;  1CHQ D;  1TWH B;  1YHB A;  3GTG B;  1ENF A;  1ENC A;  2EOT A;  1R9T B;  3DEO A;  2Q8R E;  3M4Q A;  3OPO A;  1XNQ L;  3S17 B;  1LTT D;  1QZH A;  2N8N A;  1CZW A;  4A3J B;  4KD4 A;  5E7N A;  1TKW B;  3L7Z C;  4QCL A;  1ASZ A;  4RHR A;  5BN5 A;  1AE3 A;  2R7F A;  3CQZ H;  2RSN A;  2K5N A;  2WB1 E;  1RHP A;  2K5V A;  3E0J A;  2A5H A;  1HQM C;  3A5U A;  4POG A;  3VYR A;  5IGG A;  1VQE A;  1EWI A;  1I4Q A;  1RL2 A;  1O78 A;  2R93 G;  4RGM A;  2BDO A;  2F0S A;  2IX0 A;  1LTA D;  4LWC A;  2SNM A;  3EBE A;  3FVQ A;  3RZD H;  1SE2 A;  1VMC A;  1E7Z A;  4WJ4 A;  4RG1 A;  3TP5 A;  4RFB A;  4Y7N H;  3Q8D A;  4YCU A;  5DM6 3;  3SK5 A;  4DR4 Q;  4BY7 H;  4IOC A;  3Q6S A;  5BN4 A;  1V1P B;  2CFM A;  1YNN D;  1A15 A;  4WOR A;  3KF6 B;  1KHI A;  4TRD A;  3SK6 A;  1IKL A;  1D5X C;  2OEO A;  4IQZ A;  1VQA A;  2JA8 H;  2J4X A;  3A55 A;  4X65 Q;  1SFO H;  1QOH A;  2WAQ B;  1PH9 A;  3GQB A;  2K5D A;  1VQB A;  4XYQ A;  2ALY B;  2WKD A;  4DGZ A;  3OIP A;  1CTM A;  1G29 1;  2JA7 B;  2KCM A;  1SN8 A;  3CD6 A;  4Y52 H;  2V4D A;  4A4I A;  3NTI A;  4X6A H;  3DUZ A;  1BUV T;  1FD7 D;  4JI7 Q;  1O7Y A;  1QVG A;  5IP7 H;  5CV9 A;  4IFD I;  1LT4 D;  1JJG A;  2HHH Q;  1JQY D;  4RKB A;  3GP7 A;  3A8I E;  1TWG H;  1GVP A;  1HR0 W;  4HJ8 A;  3J81 L;  1EU4 A;  1VQJ A;  2AWN A;  4PV1 C;  2CHB D;  2D2C C;  5CYU A;  1VF7 A;  4A3M G;  2Z1C A;  4LMQ D;  2K75 A;  2PZU A;  2D9U A;  3I8Z A;  2HHH L;  2K5W A;  5E3F A;  5HGT A;  1NMG A;  5M3F H;  2CH4 W;  2QCP X;  1PTO B;  4P71 A;  3TP6 A;  2KVM A;  3Q22 A;  2UUB L;  5CV4 A;  5HGQ A;  5CC4 A;  2E76 C;  2MHV A;  5KNC A;  3D6C A;  1WD1 A;  1JOR A;  4Z9C B;  1FL0 A;  1BQQ T;  1A2T A;  3C2P A;  1IZ6 A;  1KTK A;  1VQG A;  2A6H D;  1K3R A;  4LF8 Q;  1M8A A;  2EJG C;  1LTG D;  4P73 A;  1EFW A;  5EAY A;  1MJE A;  3S1M B;  2NVQ B;  1OXS C;  1SYB A;  1Z9F A;  3HKZ B;  4A3J G;  1H9J A;  1BVS A;  1TR5 A;  3CRK C;  3E6Z X;  4LF8 L;  2M00 A;  3S15 B;  4XT3 B;  5IGF A;  2JA8 G;  3AU7 A;  4DV5 Q;  5H1S E;  5M5Y B;  5IYB H;  5M9O A;  1G2T A;  3A56 A;  3J81 E;  2OF1 A;  1R4Q B;  4KHV A;  3OIQ A;  4DAP A;  3VYS A;  4LF9 L;  1RIP A;  5GAH C;  3KJO A;  1WOC A;  2TSS A;  1N32 Q;  2HIX A;  5DEH A;  3U4Z A;  3GV3 A;  1UE7 A;  4LW1 A;  1LT3 D;  5C3X A;  1LTR D;  4DV5 L;  1OXV A;  1PTO C;  4A3F B;  2IHE A;  1MBY A;  1MGS A;  4UAI A;  1LAC A;  5IP7 G;  3GTL H;  2XRS D;  1R4P B;  2WIN B;  1N32 L;  2QEJ C;  4HJA A;  3D3R A;  3ULJ A;  3GTO H;  1CKO A;  1G2S A;  3TSS A;  2XWB B;  1K0R A;  2XNA C;  5C5L A;  2NBF A;  5C6A A;  2YTV A;  1Y1W H;  4A3D H;  1EYA A;  4BBS B;  3F1Z A;  1IBM Q;  1HA6 A;  1SE8 A;  1JIC A;  4H0L C;  4ZCK A;  5K36 H;  5M3F G;  1SNP A;  2NN6 H;  3OW7 A;  4FVM A;  2WAQ G;  4JCV E;  3KF6 A;  4A3B B;  2EYL A;  1IBM L;  4JK1 C;  4X3T A;  2A73 B;  2F0T A;  1JMC A;  4UY8 C;  1RCV D;  4JI5 Q;  3FDT A;  2NTT A;  1UUP A;  3MC0 B;  3EA6 A;  1A8V A;  5KND A;  4LUV A;  1S40 A;  1YHA A;  5JPM C;  2EE1 A;  1DGS A;  4DK1 A;  1IHZ A;  3H0G H;  2RSO A;  4IUV A;  1JR0 D;  2EYF A;  3E5S A;  5ELE A;  4X3K A;  3IL8 A;  1XMO Q;  3IAY A;  2MPM A;  4FNF A;  2ZJR A;  4I7Z C;  2PNH A;  3IFD A;  2K5Q A;  4TQU S;  2YTX A;  1MI2 A;  4B3R L;  5C4J H;  1I3Q H;  3EFX D;  5IYB G;  1L2F A;  2E5L Q;  4MNO A;  4Q5V A;  4IPH A;  3HOZ H;  1HRJ A;  5ELN A;  2RCF A;  3L9A X;  3G71 A;  2Z6K C;  2GVA A;  3I4M B;  3HOV B;  4A3C H;  1Y14 B;  5M5W B;  1I4X A;  2KEE A;  1XPR A;  2KEC A;  1CI3 M;  5COY A;  4JI2 Q;  4WFN 3;  1P16 A;  1X65 A;  1U0L A;  3L0O A;  3S1R B;  4A3E H;  2K32 A;  5LMU L;  5JOB A;  1A0I A;  3HKS A;  2CWA A;  4A3I H;  1WJJ A;  4JI2 L;  5JVH 3;  3TZD A;  2B2W A;  1KDA A;  1CSQ A;  3CCR A;  4LF5 L;  2DGY A;  1XNR Q;  3NBH B;  1X54 A;  3H6M A;  2VNU D;  1J5E Q;  1U4R A;  4DNR B;  1ZEQ X;  3CCU A;  1DON A;  3R2I A;  3GTJ B;  3A0J A;  1XNR L;  3QWN A;  3BDC A;  3T13 A;  3K58 A;  1EOV A;  1WTH A;  1J5E L;  1EFI D;  3C1E A;  1CKN A;  3PCO B;  3BVM A;  1NR4 A;  4P2C B;  4L5Q A;  2F03 A;  4RGN A;  3CCV A;  1MSH A;  4A3F G;  2ZTD A;  4QUF A;  4LF7 Q;  4WJW A;  3H0G G;  4R1J A;  1ET6 A;  4FXK C;  3HOW B;  1JCK B;  2G9H D;  3NUC A;  5DM7 3;  3CC2 A;  1WCM B;  2IJ0 A;  4RKL A;  3PIP A;  4DA2 A;  3TN2 A;  1STA A;  2EQS A;  2MQH A;  1K3B C;  1EY5 A;  4JC0 A;  3R93 A;  4YWL A;  1E2V A;  4PNY A;  2L0C A;  3EQL C;  4EQ5 A;  2Z6K A;  2ZTC A;  5IOD A;  1CQF A;  2SDF A;  2MFI A;  4IFD H;  3LX0 A;  5C3E B;  4OGQ C;  4JVZ A;  2DJG C;  4EVO A;  1PH4 A;  1SAP A;  4BWG B;  3D4W A;  4A3E G;  1ICF B;  2NVT H;  1Q12 A;  1NMF A;  2K28 A;  4B9W A;  1T5X D;  3CCQ A;  1FGU A;  1EQV A;  3I4O A;  4LFB L;  2N88 A;  2ASB A;  4QMG A;  4KY5 A;  2Q2T A;  2F0K A;  4A3L G;  4QQB X;  4KN7 C;  2X6L A;  2PCF B;  2NVY H;  5IE8 A;  1XWE A;  3PMF A;  2QKI C;  3O13 A;  1YJN A;  2B2Y C;  1H9S A;  1SNO A;  3OMG A;  1VQI A;  1X3E A;  1HTP A;  2LS0 1;  2LSS A;  3NPP A;  3DM1 A;  3BZC A;  1O7Z A;  1PTO F;  1N9W A;  1YNJ D;  1ZYR D;  4DR7 L;  2XTI A;  4C3J H;  2VUM H;  3STB D;  4JI4 Q;  1EZ8 A;  1L1O B;  1YZ6 A;  2DY8 A;  4HSP A;  4OO1 H;  1SDF A;  3BZD B;  3RZO B;  3G6E A;  3GTQ H;  1XYI A;  1EUJ A;  4R4I A;  2K04 A;  1D8L A;  2VL6 A;  1B9N A;  2RVL A;  3U9O A;  1RJT A;  1XX8 A;  4DR3 L;  4RA8 A;  1LTS D;  5KIX A;  3RR5 A;  3SXH A;  2VQF L;  2PPB C;  3NWT A;  4JOI A;  4LF6 Q;  5I6Y A;  1I4G A;  5M5X H;  1U9R A;  2EY5 A;  4B3M Q;  4DR6 L;  4R4C A;  3CPW A;  4HAE A;  2BCO A;  2ZXP A;  2PMZ E;  2QEX A;  4X3U A;  5CV6 A;  1WTP A;  1I50 H;  4ZUI A;  2C35 B;  2A69 D;  4LF6 L;  4LNQ A;  3J7A V;  4F8M A;  4B3M L;  3J7Y W;  1L0X B;  2LXK A;  3KBX A;  2B2U C;  4EQO A;  1F9R A;  2R93 B;  1BXT A;  3PUY A;  5JEA J;  3J81 j;  4FF3 A;  4K2K A;  3HOY H;  3F8T A;  4DK0 A;  4GOP A;  2ZTE A;  3HG9 A;  2N78 A;  2DN8 A;  1TWF H;  3JAM c;  2Q8T A;  2GA4 B;  3SGI A;  1PYW D;  1EEF D;  1X3Q A;  4CKC A;  2UU9 L;  2QW7 A;  1L1O C;  3GD7 A;  5IIF A;  3PO2 B;  5EKI A;  4JBK A;  4FYD A;  4O42 A;  3HZX A;  4BXX H;  4GNX B;  1CQV A;  4KJN A;  2EJF C;  4L63 B;  2R92 H;  2KUM A;  2EYO A;  3CKI B;  3VR5 A;  1FJG Q;  1VQ4 A;  4IPG A;  2KCT A;  2CH4 A;  4N9P A;  4ZLT F;  1PH3 A;  2R7Z H;  4DF7 A;  5GAE C;  5EBD A;  4HJ5 A;  3RLN A;  3VYU A;  3A8K E;  3MEH A;  1LYL A;  1E1O A;  2BA1 A;  2XVS A;  1EIF A;  3K57 A;  3NTK A;  1KD1 C;  2YU9 B;  1FJG L;  1RDP D;  3KBG A;  2R6G A;  3BJU A;  1LTB D;  1HNW Q;  1IYJ B;  5FO8 B;  3S2H B;  3KLR A;  1JOK A;  1SNC A;  5CR3 A;  1Q86 C;  5C3E G;  1DD2 A;  4RMF A;  1PH2 A;  2K33 A;  3EVQ A;  1JJC B;  1U4P A;  1HNW L;  4IJL A;  3D0F A;  1LTI D;  1EWC A;  2XWJ B;  1KC8 C;  1TWC H;  2RDF A;  2WB1 B;  3E3X A;  4OWT B;  1D5M C;  2LY7 A;  1GUO A;  4DV2 Q;  3CQZ B;  5LHY 1;  1MHW C;  2D0P A;  4MZ9 A;  3JAM L;  2HUG A;  4HN7 A;  2N55 A;  4NW2 A;  1RD9 D;  2JA6 H;  1RTO A;  4GNX C;  4F87 A;  2JSO A;  4RH6 A;  2KHJ A;  4C2M H;  3CCS A;  4KKU A;  4TKO B;  4KKS A;  2P5Z X;  1STB A;  4DV2 L;  5EGT A;  1QWY A;  1V9P A;  4BS9 A;  2PQE A;  2VQE Q;  5FLM H;  3PIO 3;  3RZD B;  2LFN A;  2EY2 A;  2PQA B;  1I4R A;  1X55 A;  5CBE E;  1F9S A;  2CQA A;  4Y7N B;  3RN5 A;  2JA5 H;  4ILW A;  3BYY B;  2VQE L;  3H3V C;  2E2D C;  4BY7 B;  4JV5 Q;  3K0Y A;  2O2L D;  2R7D A;  2SNS A;  4A3K H;  1GUN A;  3RLO A;  1WVL A;  1O7I A;  2EPB A;  3ERO A;  2R92 G;  1FVI A;  2PYK A;  2F0V A;  1J9O A;  3FP9 A;  3QG1 A;  3FPP A;  1OXT A;  1EL0 A;  4IAL A;  1VS0 A;  5FJ8 H;  1SFO B;  2E2J H;  3K7U C;  2JA8 B;  4JV5 L;  3CAM A;  3T1H Q;  3VR4 A;  4GN4 B;  1ILP A;  4FXD A;  3T53 B;  3T16 A;  1STY A;  1Q46 A;  1BOS A;  3VA5 A;  2HCC A;  3JAM E;  3PV0 A;  4ABN A;  4C1N K;  4DV4 Q;  4KLK A;  2HD3 A;  1LLR D;  2F0Q A;  3T1H L;  3A74 A;  4IOA A;  5IT9 c;  3DLL A;  2QDL A;  4LUZ A;  1EZ6 A;  1YEZ A;  4J8Q A;  1WD0 A;  4J6H A;  1D6E C;  1YNJ C;  3UDI A;  2YYZ A;  1EQT A;  2OTL A;  1X3F A;  2B2T C;  3I2Z A;  4DV4 L;  2UUA Q;  4HMJ A;  1PH7 A;  1TWG B;  3K80 C;  4B08 A;  4O1N A;  1FGB D;  2EXD A;  2K4K A;  1BF4 A;  3BVG A;  2I5H A;  4GS3 A;  4A93 H;  4FF2 A;  3PO2 G;  2K52 A;  4HCE A;  4XXE A;  3PIP 3;  3JAM i;  1ILQ A;  1MIU A;  4K0K L;  1Z47 A;  2UUA L;  1KLU D;  3MFY A;  4S3S A;  2JA6 G;  1M1K C;  5M3F B;  5NUC A;  3R3O A;  1JOQ A;  1HQR D;  3FKI H;  4GNX A;  4GLA C;  4DAV A;  1G91 A;  3SEB A;  4IUR A;  4V0B A;  4PG3 A;  2IW3 A;  4ZAI A;  5IYC H;  1Y1V H;  3CU7 A;  2KCC A;  3QJY A;  1TY0 A;  5FLM G;  1HUM A;  4F88 A;  2AKW B;  1V43 A;  3HOX H;  5LMN Q;  1PYS B;  1EEI D;  3I72 A;  1VF5 C;  1VQ5 A;  1EYD A;  4KMU C;  1HZC A;  1G6P A;  5BR8 Q;  4A3K G;  4PZ6 A;  2CVR A;  4F7X A;  1N34 Q;  4XDX A;  2MUY A;  5LMN L;  3HGB A;  2WKC A;  2ZXO A;  1CUK A;  4R8N A;  2WB1 G;  2KQ3 A;  1P8L A;  5BR8 L;  2KA7 A;  1UE5 A;  2UUB Q;  2PW7 A;  2Z4I A;  1N34 L;  4LFC Q;  4X64 Q;  1BBX C;  1F9Q A;  1K28 A;  1BKB A;  4WRD A;  5F2D A;  3FPU B;  3D6W A;  2AQ2 B;  1CSP A;  5K5P A;  3NSW A;  2EJM A;  2PW5 A;  5G3L D;  2FIN B;  1TT2 A;  3K7A H;  4AH6 A;  2YTY A;  4LFC L;  4X64 L;  4PZ8 A;  1STG A;  2F0I A;  3GTL B;  3T1Y Q;  1M4V A;  3T4A C;  1KAW A;  1SJH D;  4YWM A;  4J15 A;  3GTO B;  2EY6 A;  4AYB B;  4DFA A;  5DNF A;  1BBU A;  1W6J A;  5C0X H;  3F2B A;  1TWA H;  1U5K A;  4P74 A;  3GTK H;  4PQX A;  4BY7 G;  1Q8K A;  3T1Y L;  4LK1 C;  1Y1W B;  4A3D B;  4QF4 A;  1NJI C;  4OXP A;  2JYO A;  1KDC A;  2I07 B;  1PV4 A;  1W3S A;  4LF9 Q;  1A6X A;  3FKI G;  1S3O A;  4HJ7 A;  4A3G H;  1PHJ A;  1Q90 A;  4XQJ A;  1EWH A;  3F2C A;  2GN5 A;  1BCP D;  1A3U A;  4X66 L;  5COR A;  1Y1V G;  1QB5 D;  4WJ3 M;  3I4N H;  2F0N A;  1AP0 A;  2BE5 D;  3D8G A;  4BBR H;  1SYG A;  2L5T A;  2VB3 X;  5IWA Q;  1A2U A;  2WAC A;  3CCM A;  1GM5 A;  1E1T A;  1STH A;  1OXX K;  3TQY A;  4IJH A;  4L8J A;  3HOX G;  3K0X A;  3LGJ A;  1U4M A;  1N36 Q;  3J7Z C;  3FRP B;  2VB2 X;  4OEL B;  1S5D D;  4UP7 A;  1UEA B;  1AZP A;  3DHQ A;  4KTA A;  4YY3 Q;  5IWA L;  1A62 A;  3H0G B;  3NHH A;  4HED A;  1K73 C;  2N49 A;  2CW0 D;  5KYI A;  4HMI A;  3BG3 A;  2EIF A;  4IUT A;  1DOL A;  1N36 L;  2Z4H A;  1EY7 A;  3LNN A;  4E6I A;  5IY0 A;  5C4J B;  1I3Q B;  2Z9H A;  4YY3 L;  3SK8 A;  4OHJ A;  2B63 H;  1EY6 A;  3M4O H;  1C8C A;  2Y0S E;  1L0W A;  3HOZ B;  4L5S A;  2F4I A;  4IO9 A;  3M9B A;  4DXG A;  4OX9 L;  3GTP H;  1PFB A;  4GLV B;  1Y8P B;  1KAB A;  4CJ2 C;  3L2P A;  1V1P A;  2FMM A;  2LXJ A;  3BZK A;  1VQK A;  1K8O A;  3BYT B;  4JI8 Q;  3W5O A;  3TRZ A;  5IP9 H;  4A3E B;  3P20 A;  1MD2 D;  2F0J A;  1IXR A;  2MJ8 A;  2I5M X;  2EXZ A;  4JBM A;  4GN3 B;  5I6W A;  4CBV A;  3A5Z B;  5C0X G;  1XMQ Q;  3CCE A;  2Q8I B;  4G7O C;  2A19 A;  3S15 H;  4JI8 L;  1C48 A;  1TS2 A;  1ICW A;  1B53 A;  3PUZ A;  2BA0 A;  4B3R Q;  4O0A A;  5GAG C;  4RHS A;  3HKZ E;  2GVB A;  4C3H H;  4KN4 C;  5IYD H;  4R9W A;  2I0Q A;  1XMQ L;  3K6O A;  3D4R A;  3H91 A;  3NQI A;  3S14 H;  1K8G A;  3S2D H;  3ERS X;  4A3G G;  2E2H H;  1D2B A;  1GO3 E;  2OXP A;  3UE1 A;  3I91 A;  5JJK A;  2JE6 I;  1VQ9 A;  3I4N G;  2F0E A;  4UP8 A;  4XTC S;  1PYB A;  1C4Q A;  4BBR G;  1YJ9 A;  5LMU Q;  3HEJ A;  1JJ2 A;  1YNN C;  3N6R A;  3L3O C;  5M3M H;  1PZJ D;  3NP8 A;  4IPD A;  3PUW A;  4BY1 H;  3M3Y H;  1QCB D;  1X32 A;  1VQL A;  1I5F A;  1O80 A;  2F0D A;  3U9S A;  1QUQ B;  2F3W A;  2C5C A;  4LF5 Q;  2FXQ A;  1GD7 A;  2AUJ D;  2AHO B;  2EZV A;  4DNI A;  1ZXT A;  1HPC A;  4AYB G;  1AW7 A;  5J1Z A;  2JA9 A;  2OCE A;  1QG7 A;  3KF8 B;  4C56 C;  3PO3 H;  4DAY B;  3UE0 A;  1SMX A;  1E24 A;  1JE4 A;  1K0S A;  3S16 H;  1C9O A;  4RCN A;  1RF2 D;  2B63 G;  2F0U A;  1Y1W G;  4A3D G;  4DR5 Q;  5J39 A;  5AFW A;  1V1Q A;  1LO5 D;  2AUK A;  5K36 G;  3X3M A;  4KV6 A;  3G7L A;  1KAA A;  4EGV A;  2X6G A;  4POF A;  2FMC A;  3SE0 A;  1STN A;  2NN6 G;  2HQE A;  1U4L A;  5GRO A;  1X9N A;  2A74 C;  1BCP B;  3VR2 A;  1FNV A;  4DR5 L;  3M7N A;  1F77 A;  1IBK L;  1PRT D;  5IP9 G;  3H3V I;  3LWE A;  5A35 A;  2NVT B;  1B50 A;  4MTK A;  1HR0 Q;  4FP5 D;  2IPK D;  1DOM A;  4LAA A;  3WDN A;  4H13 C;  1KNA A;  3OWE B;  2YV5 A;  2ZJQ A;  1IL2 A;  3HOU H;  2NVY B;  1X3P A;  4TSS A;  3MEF A;  3KYH C;  3V96 A;  2MO0 A;  2F0F A;  2AQ1 B;  1GHJ A;  5JEA H;  1HR0 L;  1IL8 A;  1H9R A;  3P75 A;  2UXB Q;  4ZYS A;  3GTM B;  3TS2 A;  4K5V A;  5JJI A;  4QUC A;  2ES2 A;  4UPA A;  4I65 A;  1T5E A;  3LWU A;  2E8G A;  2PO4 A;  4ZUJ A;  5FO7 B;  2VUM B;  2A6H C;  5FO9 B;  2X69 A;  3ULP A;  2M9V A;  1KLG D;  2DJF C;  3HOZ G;  2UXB L;  1A3T A;  2L4N A;  1PMR A;  3GTQ B;  3E9I A;  2VW9 A;  5M3M G;  4A3C G;  1GUS A;  1EY4 A;  4LFB Q;  1IBL Q;  2HT1 A;  3NK9 A;  2NB0 A;  1PA6 A;  1BCP C;  2G5D A;  2EY1 A;  2LKV A;  1WFQ A;  3BU2 A;  3K5O A;  5M5X B;  2PMZ B;  5I9P A;  1GJX A;  1JC7 A;  1WTQ A;  4A3I G;  4HIO A;  1AEX A;  1IBL L;  1T9H A;  4FF4 A;  1I50 B;  4DV0 Q;  5IGB A;  4DR7 Q;  1N33 Q;  5T1I A;  4JI1 Q;  1K8A C;  2HQL A;  4PMW A;  1PDQ A;  2RDG A;  4DUY Q;  1VQH A;  1SND A;  2L11 A;  2H5X A;  1QJO A;  2R3Z A;  5HY6 A;  4DV0 L;  1HNZ Q;  3HOY B;  1KXL A;  4IZ8 A;  2NYZ D;  2K05 A;  3K5N A;  4ME5 A;  1N33 L;  4H7B A;  4JI1 L;  4DKA C;  4DR3 Q;  1TWF B;  5I4D A;  1GUG A;  3PF5 A;  2VQF Q;  1B3Q A;  4DUY L;  1H9M A;  1HNZ L;  4XYO A;  1K83 H;  1NUC A;  4DR6 Q;  1IYU A;  4HID A;  4QY7 A;  4JPB W;  3HOU G;  2XGT A;  1B4O A;  2Q2U A;  2F0W A;  1JT8 A;  2R92 B;  2K03 A;  1TY2 A;  4HR7 B;  5TSS A;  5JEA G;  5AJ3 Q;  2F3I A;  4ZKB B;  2R7Z B;  3ND9 A;  3ZYY X;  2B8G A;  4ZKC B;  2F0L A;  3RLF A;  5D3D A;  3V05 A;  3DWA A;  3PUX A;  2BOS A;  3RUZ A;  2SEB D;  3DXJ C;  4NPS A;  3AQQ A;  3FMC A;  5AJ3 L;  5EKK A;  4RGT A;  3CC7 A;  2R61 A;  4ME3 A;  3TP7 A;  4JI6 L;  3WOF A;  4X3S A;  3QR8 A;  2UU9 Q;  3TS0 A;  1DJR D;  1Q81 C;  3GO5 A;  4GLX A;  1PZI D;  3UDX A;  3NBH A;  5BN3 A;  5KEE A;  4IFD G;  4J1M A;  2RQX A;  3KLS A;  2JEB I;  1PRT B;  2K5H A;  2NVX H;  2OT2 A;  4QIW B;  1UE6 A;  5KNB A;  2ATW A;  1VMP A;  4FXG C;  1E0B A;  2FFK B;  1TWC B;  1VQ6 A;  4FO2 A;  3K5M A;  3DEP A;  1CFM A;  5KRU A;  4APV A;  1HNX L;  1F2L A;  3TZU A;  2A68 D;  3I55 A;  1EQQ A;  2B2V C;  2C9O A;  4XIG S;  2FHT A;  3AYH B;  4JYA Q;  2JA6 B;  2QDB A;  4C2M B;  2B2Y A;  4DR1 Q;  3MWY W;  3MHB A;  3T51 B;  1JB7 A;  2RCN A;  3RZO H;  2J7Z A;  4L5T A;  1QNK A;  1KDB A;  1SMY D;  1WYD A;  1UEB A;  3OHX C;  4DPG A;  1ESF A;  2AWO A;  4JYA L;  1B70 B;  3M4Y A;  4C3J G;  2VUM G;  1D1K A;  3D31 A;  2ICI A;  4RWS C;  5FOB B;  3NWS A;  4K8J A;  1CHP D;  4DR1 L; 
#chains in the Genus database with same CATH homology
 4PG3 A;  3F1Z A;  1IBM Q;  4OO1 G;  4BY1 G;  1SE8 A;  5IYC H;  1X6O A;  1Y1V H;  5M3F G;  1XPO A;  3J80 c;  4LF7 L;  5FLM G;  3E0E A;  4GKJ Q;  2QA4 A;  5C44 H;  4DV3 Q;  1KIX A;  3S1Q H;  2N3S A;  4BBS G;  2AKW B;  2WAQ G;  1V43 A;  1B7Y B;  4JCV E;  3KF6 A;  3HOX H;  1HZA A;  3RNU A;  5LMN Q;  1PYS B;  1IBM L;  3PO3 G;  1VQN A;  2OQK A;  4JI0 Q;  1VQF A;  4GOP C;  1XTD A;  1I6H H;  1YBY A;  3GTJ H;  1VQO A;  4LUO A;  1HZC A;  1JMC A;  1VQ5 A;  4UY8 C;  4GKJ L;  1Q7Y C;  3TEH B;  5BR8 Q;  4DV3 L;  4A3K G;  4JI5 Q;  4PZ6 A;  4OWW B;  2PI2 E;  4A76 A;  3CCL A;  4A3B G;  1A8V A;  2NZH A;  1N34 Q;  1OTC A;  3KDF B;  4LUV A;  4LFA Q;  1VQP A;  1S40 A;  1YHA A;  3HFZ B;  4AIM A;  5LMN L;  3CW2 C;  4R4Q A;  2VS1 A;  4JI0 L;  2K14 A;  1CUK A;  4NB3 A;  1DGS A;  3I7F A;  3H15 A;  3H0G H;  2WB1 G;  2NN6 I;  5J3B A;  1P8L A;  3FHW A;  3CPF A;  5BR8 L;  2Q2H A;  1I94 L;  1UE5 A;  1PH1 A;  2UUB Q;  2OTJ A;  1YHQ A;  1N34 L;  4LFC Q;  1XMO Q;  4LFA L;  4X64 Q;  2OQ0 A;  2ZJR A;  2ZM6 Q;  3HOY G;  2PNH A;  2KBN A;  4TQU S;  1BKB A;  2YTX A;  4B3R L;  5C4J H;  1SRO A;  1I3Q H;  1CSP A;  5IYB G;  4HJ9 A;  3CP0 A;  3CME A;  1VQ8 A;  3HOW H;  1L2F A;  2VY3 A;  2E5L Q;  4MNO A;  1WCM H;  1XJV A;  3GTM H;  3K7A H;  4IPH A;  3HOZ H;  1BBW A;  3DM3 A;  3W1B A;  5ELN A;  4AH6 A;  2YTY A;  4LFC L;  1PH8 A;  4IPC A;  4DR2 Q;  4X64 L;  4PZ8 A;  3G71 A;  2Z6K C;  4KHP Q;  2ZM6 L;  3T1Y Q;  2GVA A;  4A3C H;  1Y14 B;  1L1O A;  4EX5 A;  1XPR A;  1KAW A;  4YWM A;  4J15 A;  4BXX G;  1HJP A;  4JI2 Q;  1P16 A;  1X65 A;  3K8A A;  1U0L A;  1BBU A;  3F2B A;  3L0O A;  4JI6 Q;  2E2I H;  1TWA H;  2QGQ A;  1QUQ A;  4YCW A;  3NEM A;  4A3E H;  1QZG A;  5LMU L;  3HOV G;  3I4M G;  1U5K A;  4P74 A;  3GTK H;  4KHP L;  4DR2 L;  4BY7 G;  1Q8K A;  1A0I A;  3T1Y L;  3HKS A;  5C3E H;  1UWV A;  2CQO A;  2CWA A;  1NJI C;  4JI4 L;  2R7Z G;  4OXP A;  3NEN A;  4DV7 Q;  4A3I H;  2CWP A;  1WJJ A;  1PV4 A;  4JI2 L;  1W3S A;  1H95 A;  2ID0 A;  4LF9 Q;  2UXD Q;  3FKI G;  1S3O A;  4HJ7 A;  3G4S A;  1VQM A;  1CSQ A;  3OYY A;  3M85 A;  3CCR A;  4LF5 L;  2DGY A;  1ASY A;  1XNR Q;  1PHJ A;  2IX1 A;  4A3G H;  3NBH B;  5ELO A;  5LMN W;  1X54 A;  1SLJ A;  2RF4 A;  3F2C A;  2VNU D;  2GN5 A;  1HNX Q;  1J5E Q;  4X66 L;  3I56 A;  1Y1V G;  4DV7 L;  2PI2 A;  4WJ3 M;  3I4N H;  5C0X I;  3CCU A;  3ICE A;  2UXC Q;  1NBW A;  5C44 G;  4GKK Q;  2B29 A;  4BBR H;  4ALP A;  5IWA Q;  1A63 A;  3A0J A;  2UXD L;  2IT1 A;  3CCM A;  1X3G A;  1GM5 A;  1E1T A;  1OXX K;  3TQY A;  4IJH A;  3HOX G;  1XNR L;  3K0X A;  4X62 Q;  4A3M H;  3LGJ A;  3B6Y A;  1EOV A;  5C4X H;  4K0K Q;  1PH6 A;  1N36 Q;  1J5E L;  4DK6 C;  3STB C;  3J7Z C;  4A75 A;  4UP7 A;  1CKN A;  2UXC L;  2OWO A;  3PCO B;  4GKK L;  1AE2 A;  1LM0 A;  4YY3 Q;  5IWA L;  1A62 A;  1K73 C;  2JJQ A;  1X56 A;  4JI3 Q;  2N49 A;  3S1N H;  4L5Q A;  2NZO A;  4DK3 C;  3CCV A;  3J81 c;  4X62 L;  2EIF A;  2ZTD A;  4A3F G;  1YIJ A;  1N36 L;  4LF7 Q;  4TVA B;  3AEV A;  3H0G G;  4R1J A;  5IY0 A;  2CCZ A;  4YY3 L;  5GQO A;  2B63 H;  2WFW A;  3WWV A;  3M4O H;  1Q1B A;  4JI3 L;  3CC2 A;  4H02 A;  2Y0S E;  2D62 A;  1L0W A;  1EQR A;  4L5S A;  4IO9 A;  3S24 A;  3PIP A;  3M9B A;  4C3I H;  4IFD J;  4OX9 L;  3GTP H;  3KLW A;  1HZ9 A;  4GLV B;  1LUZ A;  1KRT A;  1TWH H;  2EQS A;  4O2D A;  2MQH A;  2BH2 A;  3L2P A;  3GTG H;  3HOW G;  1NTG A;  1YNX A;  3UDF A;  2LXJ A;  1R9T H;  1WCM G;  3BZK A;  1VQK A;  4JC0 A;  1WI5 A;  3OW2 A;  4JI8 Q;  3W5O A;  4UP9 A;  2MNA A;  5IP9 H;  3TRZ A;  1G6P A;  4YWL A;  3S17 H;  2JA5 G;  4EQ5 A;  4A3J H;  1Q1E A;  2Z6K A;  2ZTC A;  4DR4 L;  1IXR A;  2MFI A;  2I5M X;  1HZB A;  4JBM A;  3PUV A;  1I94 Q;  4GN3 B;  1N8R C;  1NY4 A;  1PH4 A;  3A5Z B;  5C0X G;  4DV6 Q;  3CCE A;  1XMQ Q;  2A19 A;  4A3E G;  2R93 H;  3J80 i;  2NVT H;  1Q12 A;  1NMF A;  4JI8 L;  3S15 H;  4GN5 A;  5GAD C;  3PUZ A;  1FGU A;  3CCQ A;  3I4O A;  2BA0 A;  1YJW A;  4B3R Q;  4O0A A;  5GAG C;  4LFB L;  3HKZ E;  2JQO A;  5FJ8 G;  2ASB A;  2GVB A;  4HIK A;  4C3H H;  4X65 L;  1Q82 C;  3W1G A;  2I0Q A;  2Q2T A;  4A3L G;  4YHH Q;  2JEA I;  2WP8 J;  4QQB X;  5IYD H;  2IY5 B;  4DV6 L;  1XMQ L;  4DAM A;  2K50 A;  1S72 A;  2NVY H;  5IE8 A;  3S14 H;  1K8G A;  3S2D H;  3ERS X;  3PF4 A;  2AMC B;  4QIW E;  4A3G G;  2E2H H;  2I5L X;  4PZ7 A;  1YJN A;  2JK8 A;  3U50 C;  1GO3 E;  1K9M C;  3KDF A;  3PO2 H;  2A8V A;  1VQI A;  1X3E A;  3OTO Q;  3UE1 A;  1SR3 A;  2JE6 I;  1UE1 A;  2VZA A;  3JC6 6;  1W2B A;  1VQ9 A;  5JJK A;  2LSS A;  3I4N G;  1SRU A;  4UP8 A;  4XTC S;  1PYB A;  4YHH L;  4HIM A;  4BBR G;  3BZC A;  1YJ9 A;  5LMU Q;  1N9W A;  1YIT A;  1VCI A;  3IRB A;  1JJ2 A;  4JI7 L;  4DR7 L;  2XTI A;  4C3J H;  2VUM H;  5M3M H;  3STB D;  4JI4 Q;  2KEN A;  5C4X G;  4IPD A;  1L1O B;  1YZ6 A;  3OTO L;  3PUW A;  4BY1 H;  3M3Y H;  2BH8 A;  1PFS A;  3U58 A;  1VQL A;  3G6E A;  3GTQ H;  1I5F A;  4B3T Q;  2ZJP A;  3TRE A;  1EUJ A;  4R4I A;  4DV1 Q;  1M90 C;  4A93 G;  1D8L A;  2A1A A;  2VL6 A;  1QUQ B;  4LF5 Q;  2YU9 H;  2B3G A;  1G51 A;  2FXQ A;  2UUC Q;  1GD7 A;  2PQA A;  2AHO B;  4DNI A;  4DR3 L;  1C7Y A;  4AYB G;  3RR5 A;  4X66 Q;  2JA9 A;  1B8A A;  2OCE A;  1KRS A;  3H3V H;  3S2H H;  3KF8 B;  1XNQ Q;  2VQF L;  4DAY B;  3UE0 A;  1SMX A;  3PO3 H;  3KFU A;  1E24 A;  3U4V A;  1QVC A;  1XPU A;  4P75 A;  4QGU A;  2WAQ E;  4JOI A;  4B3T L;  1C9O A;  3AFP A;  4QJF A;  4DV1 L;  4LF6 Q;  2JA7 H;  1YHB A;  5M5X H;  2B63 G;  1Y1W G;  1OXU A;  4A3D G;  4B3M Q;  4DR5 Q;  4DR6 L;  1TXY A;  1V1Q A;  3M4Q A;  4R4C A;  3CPW A;  2UUC L;  3ER0 A;  3CF5 A;  5IYC G;  4OO1 I;  2PMZ E;  2QEX A;  5K36 G;  1I50 H;  4KI0 A;  1XNQ L;  1QZH A;  2N8N A;  4POF A;  2C35 B;  2KHI A;  5E7N A;  2NN6 G;  2RHS B;  1KL9 A;  1VQC A;  3L7Z C;  4LF6 L;  1ASZ A;  4LNQ A;  5GRO A;  1X9N A;  3AFQ A;  2Z0S A;  4B3M L;  4DR5 L;  1AE3 A;  2LXK A;  1CKM A;  3M7N A;  2R7F A;  5IP9 G;  2HIV A;  1IBK L;  3CQZ H;  3H3V I;  2K5N A;  2WB1 E;  3PUY A;  2K5V A;  5JEA J;  3J81 j;  3RN2 A;  3CC4 A;  3HOY H;  3F8T A;  2RHQ B;  4GOP A;  1CKN B;  1HR0 Q;  2ZTE A;  3A5U A;  4POG A;  2N78 A;  3JAM c;  1TWF H;  1VQE A;  1EWI A;  4L5R C;  1RL2 A;  2R93 G;  3SGI A;  2YV5 A;  2ZJQ A;  1MJC A;  1IL2 A;  3HOU H;  4OX9 Q;  2UU9 L;  4AQY Q;  1L1O C;  4NXN Q;  3GD7 A;  2IX0 A;  3MEF A;  3KYH C;  2MO0 A;  2MO1 A;  4LWC A;  1HR0 L;  4JBK A;  3MXN B;  3EBE A;  2UXB Q;  3RZD H;  4BXX H;  1E7Z A;  1HH2 P;  4GNX B;  4WJ4 A;  2CKZ B;  3TS2 A;  4RG1 A;  5JJI A;  2R92 H;  4Y7N H;  2ES2 A;  4UPA A;  1FJG Q;  3Q8D A;  4YCU A;  2E8G A;  4AQY L;  1VQ4 A;  4IPG A;  2KCT A;  4NXN L;  4BY7 H;  4IOC A;  4DR4 Q;  4FDB A;  3ULP A;  3EIV A;  3J81 i;  1PH3 A;  2R7Z H;  2CFM A;  3HOZ G;  4HJ5 A;  5GAE C;  2UXB L;  3RLN A;  4LF4 Q;  3KF6 B;  1LYL A;  1KHI A;  4AYB E;  3E9I A;  1E1O A;  2BA1 A;  3PSI A;  4JBW A;  1EIF A;  5M3M G;  2VW9 A;  1EIY B;  4BA2 I;  1KD1 C;  1FJG L;  4A3C G;  1VQA A;  1EYG A;  4LFB Q;  1D7Q A;  2R6G A;  3BJU A;  1IBL Q;  1LTL A;  2HT1 A;  1SFO H;  4X65 Q;  2JA8 H;  2NVQ H;  3S1M H;  1PH9 A;  1HNW Q;  1IYJ B;  1VQB A;  3S16 H;  3CMA A;  2ALY B;  1PA6 A;  4LF4 L;  1WFQ A;  1G29 1;  3BU2 A;  1Q86 C;  2KCM A;  2DUD A;  4B3S Q;  1SN8 A;  5C3E G;  4YWK A;  3CD6 A;  4Y52 H;  1E22 A;  4RMF A;  5M5Y H;  4P72 A;  4A3I G;  4HIO A;  1PH2 A;  1IBL L;  1T9H A;  4A4I A;  4R4O A;  1JJC B;  4YCV A;  1HNW L;  4IJL A;  3D0F A;  1PH5 A;  4DV0 Q;  2JA7 G;  3NEL A;  4X6A H;  1KC8 C;  4JI7 Q;  1QVG A;  1TWC H;  1N33 Q;  5IP7 H;  4DR7 Q;  4JI1 Q;  4B3S L;  1K8A C;  4IFD I;  1E3P A;  2HQL A;  4OWT B;  4PMW A;  4DV2 Q;  1JJG A;  2HHH Q;  1QVF A;  4DUY Q;  1VQH A;  4A3F H;  2D0P A;  1TWG H;  4MZ9 A;  2H5X A;  1GVP A;  5HY6 A;  4DV0 L;  4HJ8 A;  1HNZ Q;  1HR0 W;  1KXL A;  2JA6 H;  4GNX C;  1VQJ A;  2AWN A;  4JI5 L;  1N33 L;  2KHJ A;  4JI1 L;  4C2M H;  4DKA C;  4DR3 Q;  4A3M G;  3J7A 5;  3CCS A;  2K75 A;  3PF5 A;  4DV2 L;  2VQF Q;  2HHH L;  2D0O A;  1V9P A;  4DUY L;  1NMG A;  2VQE Q;  5M3F H;  1HNZ L;  5FLM H;  1K83 H;  5C0X J;  4DR6 Q;  4P71 A;  4HID A;  4QY7 A;  3CXC A;  4BBS H;  3HOU G;  2UUB L;  2V1C C;  2PQA B;  4BA1 I;  2F52 A;  2XGT A;  1JE5 A;  4R4T A;  2Q2U A;  5HGQ A;  1X55 A;  1JT8 A;  3CCJ A;  4OON A;  1XMO L;  4MTN A;  2Y0S G;  3RN5 A;  2JA5 H;  2VQE L;  5JEA G;  1GKH A;  3GDE A;  5AJ3 Q;  2L15 A;  4JV5 Q;  2F3I A;  3E9H A;  2R7D A;  4A3K H;  2E5L L;  4A3B H;  1FL0 A;  3RLO A;  1O7I A;  1IBK Q;  2F4V Q;  3RLF A;  1IZ6 A;  2R92 G;  1FVI A;  2IHF A;  1VQG A;  3PIO A;  1K3R A;  3PUX A;  4LF8 Q;  3FP9 A;  2Q2I A;  4NPS A;  3AQQ A;  4P73 A;  3ZJY C;  1EFW A;  1OXT A;  5AJ3 L;  5EAY A;  1MJE A;  1VS0 A;  5FJ8 H;  2E2J H;  4NXM Q;  3K7U C;  4JV5 L;  3G48 A;  3CAM A;  4ME3 A;  3CC7 A;  3T1H Q;  4A3L H;  1OXS C;  4JI6 L;  4GN4 B;  2F4V L;  1Z9F A;  2UU9 Q;  3TS0 A;  1Q81 C;  4A3J G;  1KQS A;  3GO5 A;  1BVS A;  4GLX A;  4LF8 L;  4JBJ A;  3EN2 A;  1Q46 A;  3UDX A;  1VQD A;  4IFD G;  3ULL A;  2JA8 G;  3PV0 A;  4DV5 Q;  5H1S E;  2JEB I;  4GOP B;  5IYB H;  4DV4 Q;  2K5H A;  3K81 C;  4KLK A;  2NVX H;  4NXM L;  3VDY A;  3T1H L;  3HKZ G;  1UE6 A;  3A74 A;  5FLX c;  1J6Q A;  4IOA A;  5IT9 c;  3M4P A;  4LF9 L;  3DLL A;  1RIP A;  2ATW A;  5GAH C;  1MKH A;  1WOC A;  4LUZ A;  3KJO A;  1N32 Q;  1YEZ A;  2HIX A;  3U4Z A;  1VQ6 A;  4DUZ Q;  3UDI A;  1UE7 A;  2YYZ A;  4LW1 A;  5IYD G;  2OTL A;  1PVO A;  1C0A A;  4DV5 L;  1NE3 A;  1X3F A;  4APV A;  3PGZ A;  3I2Z A;  4DV4 L;  1OXV A;  1HNX L;  2UUA Q;  1AH9 A;  1PH7 A;  3I55 A;  1EQQ A;  2IHE A;  4KHZ A;  3K80 C;  4XIG S;  3KOJ A;  2EXD A;  2K4K A;  5IP7 G;  3AYH B;  4JG2 A;  3GTL H;  4JYA Q;  2I5H A;  4GS3 A;  4A93 H;  3I4M H;  3HOV H;  3PO2 G;  2K52 A;  5M5W H;  1N32 L;  3JAM i;  1VQ7 A;  4DR1 Q;  1YI2 A;  4HJA A;  4DUZ L;  1YVC A;  3ULJ A;  5DLQ E;  2RCN A;  3F2D A;  1MIU A;  1JB7 A;  1CKO A;  3GTO H;  4K0K L;  1Z47 A;  3RZO H;  4L5T A;  3S1R H;  2UUA L;  4JOI C;  3UDG A;  1K0R A;  1WYD A;  2JA6 G;  3KJP A;  1M1K C;  4DPG A;  2AWO A;  4JYA L;  1B70 B;  2YTV A;  2VUM G;  3FKI H;  4QL5 A;  3D31 A;  4GLA C;  4GNX A;  1Y1W H;  4A3D H;  5JJL A;  1UEB A;  4OWX B;  4DR1 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...