1YVCA

Solution structure of the conserved protein from the gene locus mmp0076 of methanococcus maripaludis. northeast structural genomics target mrr5.
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
70
structure length
70
Chain Sequence
MAFGKPAMKNVPVEAGKEYEVTIEDMGKGGDGIARIDGFVVFVPNAEKGSVINVKVTAVKEKFAFAERVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords MrR5
source organism Methanococcus maripaludis
total genus 10
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2005-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01938 TRAM TRAM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1yvcA00
1B8AA 3M4PA 1XNQL 4JI6Q 2EXDA 4IFDG 4DKAC 4BBSH 2AWOA 4L5SA 1LTLA 5C44H 2HIVA 3HOVH 1P8LA 4BA2I 4BBRG 1CSQA 1YEZA 2Z0SA 3OTOL 2EQSA 1N34L 1YJNA 2I5MX 4DV6L 2UU9Q 1A0IA 1K0RA 3K7AH 1PH5A 1LUZA 1EYGA 2A8VA 1YHAA 4OXPA 4DK6C 4DUYQ 2HT1A 3EBEA 4YWKA 3S16H 4LFBQ 3PUVA 4GLAC 4A3KG 2AKWB 2Q2IA 3PV0A 1EFWA 4BBRH 1TWCH 4YWLA 4L5RC 4XTCS 3I4NG 1Q8KA 1BBUA 4JI7Q 2CCZA 1IZ6A 3UDFA 4A3LG 2CWPA 1EUJA 3UDIA 1VQBA 4LFAQ 3CCEA 1K3RA 1FJGL 5GAHC 1VCIA 3L7ZC 2UUBL 1MKHA 5IP9H 2H5XA 4QGUA 1VS0A 3GTMH 4HJAA 2F4VL 3I55A 5LMNW 2YV5A 1M1KC 2PI2A 1CSPA 1VQKA 2R7DA 1XMQL 1TXYA 1OTCA 3TS0A 3M3YH 3RZOH 4IPCA 1V43A 4NXNQ 1TWFH 4BY7H 3T1HQ 1KAWA 2PQAA 2BA0A 3AQQA 4DV7L 3ER0A 3NBHB 3CCSA 4R1JA 2ASBA 5LMUL 1VQ6A 4JYAL 2Q2TA 1XNRQ 1IYJB 5GAGC 3CCRA 3S1QH 4JI2Q 2R7ZG 1VQOA 1E1OA 4JBKA 1SE8A 4MZ9A 4LUZA 2K52A 4PZ6A 4UP8A 4R4CA 4DR1L 1YJWA 3PO2G 1HNWQ 4LFCQ 2HQLA 2VQEQ 4GNXB 1GVPA 2IHFA 1YI2A 4A93H 4C2MH 2YYZA 4KHZA 4X64Q 1E22A 3A5ZB 3PUXA 4UP9A 1GM5A 4DR7Q 4JBMA 2Y0SE 1PA6A 3HKZE 2NVQH 3KF8B 2NZOA 3I4MG 4GKKQ 5J3BA 4LF8Q 3UE1A 3U4VA 5M3FH 1L1OA 1N33L 2JA7G 1OXUA 1UE6A 1I94L 3PF5A 3RLOA 2OCEA 1XMOL 5BR8Q 2IX1A 1EWIA 2IHEA 4DV2Q 4OWWB 1G291 1NMFA 2NZHA 1HR0Q 1UE7A 1KRTA 2K14A 1FGUA 1Y1VG 2B29A 3GD7A 5AJ3Q 3CC7A 4JI1Q 3GTKH 5IP7G 2N49A 4DR4L 3S2DH 4YCVA 2OTJA 2K4KA 3ULJA 2R92G 3GTGH 3M4OH 4B3ML 4IOAA 1L0WA 3FKIH 4IPGA 2V1CC 2K75A 5LMNL 4DV1Q 2VQFQ 4X65Q 3AEVA 3TEHB 1C7YA 1EQQA 4H02A 3KYHC 1A62A 4A3FH 3M7NA 5IP7H 4KHPL 4A3IH 4DR3Q 4HIKA 1ASZA 1ASYA 1WCMG 4C3JH 4GOPA 4OO1I 2JE6I 2BH8A 1Q1EA 4IPHA 1XPRA 3U50C 4LF6Q 5K36G 5JEAJ 1AE2A 2JA8H 2R7FA 5JJLA 3LGJA 4OX9Q 1WFQA 1PH7A 1I3QH 3UDXA 4DR5L 4A3CH 2JA8G 5IE8A 2WFWA 4P71A 1CKNB 4GNXC 2FXQA 1X55A 3CAMA 4YY3Q 3L0OA 2JA5H 1PYBA 2BH2A 4BY1H 2WAQG 4JI6L 1VQIA 4Y52H 3G48A 4IPDA 3CMAA 2UUAQ 1CKOA 3M4QA 5IYBH 4B3TQ 4DV0Q 1KHIA 5C0XJ 1JT8A 2ZTCA 3J81i 1TWHH 3JAMi 1VQCA 1HZCA 3BU2A 2UU9L 3S1MH 1Q46A 1Q81C 4DUYL 2RHQB 4BBSG 2AMCB 5C44G 4K0KQ 3HOVG 5FJ8H 4FDBA 3ERSX 4LUVA 3J81c 3CMEA 3JAMc 1CKMA 2QGQA 4PZ8A 2CFMA 3AFPA 2LSSA 4JI7L 3H3VH 4HIDA 3M85A 4PZ7A 1DGSA 1G6PA 5C4JH 4QIWE 2JA6H 5M3MH 3F2DA 1JJCB 1YHQA 1YBYA 4DAYB 3KLWA 2A19A 3TQYA 1JJ2A 4A3DH 2IY5B 4OWTB 3KF6A 1FVIA 3WWVA 1KL9A 4JG2A 4A3GG 1S40A 4POGA 4JBWA 4NXNL 1D8LA 1K83H 1EOVA 1VQAA 2OQKA 4A76A 4TVAB 3T1HL 3GTPH 1OXSC 2ID0A 4IJLA 2L15A 5IP9G 5IYCH 4IFDI 2E5LL 4QQBX 1XNRL 5M5XH 3S15H 2R6GA 2YTYA 3UDGA 4A3GH 2ZJRA 2UXBQ 4BY7G 1X54A 1HNWL 2PQAB 4LFCL 1E7ZA 3J7ZC 2VQEL 4WJ3M 3G6EA 1PH1A 3PCOB 2YTXA 4X64L 3HOWH 1SN8A 1Y1WH 4C3HH 2IX0A 4A3EH 4R4IA 1Q7YC 1YVCA 4DR7L 3DM3A 3STBC 4X66Q 1J5EQ 4GKKL 3HFZB 1WI5A 4X62L 3KDFA 4LF8L 4LF4Q 1K73C 3AFQA 2UXDL 3E9HA 1GD7A 1GO3E 2KCMA 4DR2Q 2E2IH 1N32Q 2MQHA 4A93G 3E9IA 4QY7A 5BR8L 3CF5A 4GKJQ 5C3EH 1Q12A 3KJPA 3K80C 4DV5L 5IYDH 3W5OA 1HR0L 1XNQQ 5M3FG 1UE5A 2MNAA 1KQSA 4A3JH 5AJ3L 1IXRA 4JI1L 2WAQE 3KOJA 5C4XH 4AYBG 4JI8L 1K8GA 3NELA 2ATWA 1IBMQ 5FLMH 2R93H 4JI3Q 4DV6Q 1V1QA 3JC66 3H15A 1IBKQ 4JI4Q 3F2CA 4DV1L 1VQPA 4LNQA 3Q8DA 2VQFL 4JOIC 1NJIC 4X65L 1HNZQ 2JQOA 3RN2A 4B3RQ 4IJHA 3K0XA 3U4ZA 2AHOB 4DR3L 3MEFA 5GAEC 1J6QA 1VQMA 2NVXH 3FKIG 3RLFA 1YJ9A 2NVYH 1HNXL 1OXXK 1XPUA 3J81j 1XPOA 4OX9L 2VS1A 1SLJA 4POFA 2WP8J 2DGYA 2MO0A 4A3FG 1E3PA 4A3IG 5FLXc 2Q2UA 5GADC 3NEMA 4JCVE 4GOPB 3PUWA 3W1BA 4JV5Q 5EAYA 5IWAQ 4DAMA 4LW1A 1JE5A 4LF5Q 4YCWA 2VUMH 3OW2A 2ZTEA 3PIOA 4GNXA 3F1ZA 2UUAL 4A3CG 2EIFA 1VQ5A 4A75A 1XJVA 4B3TL 3IRBA 2PMZE 4HIMA 3ZJYC 4GN5A 2ZM6Q 2JA5G 4JBJA 5JEAG 4JI5Q 4L5TA 4LWCA 4BY1G 1QVCA 4ALPA 2ZTDA 1YZ6A 4A3BH 4LF7Q 3J80i 4DR6Q 4DV4Q 4AQYQ 1PVOA 1KD1C 1JJGA 2Z6KC 2GVAA 2WB1G 3HOUH 1RL2A 3STBD 2N3SA 3D0FA 2KENA 5M5WH 5IYBG 1Q1BA 1IBLQ 4B3SL 3ICEA 4YHHQ 2UUCQ 3RZDH 3GDEA 1X56A 2OWOA 5GQOA 4DV3L 3J80c 1PH2A 3KJOA 1PH9A 3GTJH 2OQ0A 1OXTA 2KHJA 3F8TA 1NE3A 2D0PA 1VQEA 5FJ8G 5C0XG 1YIJA 1JMCA 4A3MH 1XMOQ 4UP7A 1VQJA 2RCNA 3RN5A 2F3IA 1NY4A 1SMXA 2F52A 2PI2E 1UE1A 4JI0Q 2K5NA 4WJ4A 3OYYA 2HHHQ 2JA6G 5M3MG 2E2HH 2VL6A 4GN3B 4LFBL 3T1YQ 1N36Q 2CQOA 5C0XI 4GLXA 1YHBA 4A3DG 1MJEA 2NN6G 2BA1A 1M90C 1HR0W 3HOZH 2UXCQ 4B3MQ 4DPGA 3H3VI 5LMNQ 4AYBE 3MXNB 4HJ7A 2UXBL 4X6AH 3TREA 4LFAL 2ZJQA 3PO3H 3F2BA 3HOXH 2ZJPA 1HZ9A 5M5YH 5IYCG 3KFUA 1TWGH 1QUQA 3S1RH 1I5FA 4BXXH 5JJIA 2KHIA 3GTQH 4LUOA 1SROA 3S1NH 3ULLA 1W2BA 1HZBA 4PMWA 4X66L 3J7A5 3CCVA 3BJUA 3PF4A 1HH2P 2VY3A 4LF4L 1QZHA 1VQHA 2HIXA 4DR5Q 4TQUS 4MTNA 2XGTA 4AH6A 3FHWA 4HIOA 3VDYA 1VQLA 1N32L 4GKJL 1Z47A 3HOWG 1H95A 1Y1WG 3GTLH 3A0JA 4A3EG 1Q82C 4NXMQ 1EQRA 4BA1I 4JI2L 2K5VA 4JC0A 3CCJA 5HY6A 3H0GH 2KCTA 3KDFB 4P74A 1RIPA 4IOCA 4P73A 2E8GA 3CW2C 1XTDA 4LF9Q 4IFDJ 5IY0A 3W1GA 1C0AA 1KXLA 3CCUA 1IBML 5C3EG 3U58A 2VNUD 4RMFA 5JJKA 5DLQE 4JI3L 1IBKL 4R4TA 4JI4L 4PG3A 3CD6A 1O7IA 5IYDG 1A63A 1AH9A 3BZCA 3PSIA 5ELOA 4A3JG 1HNZL 3L2PA 1VQ4A 1VQFA 1X3EA 4B3RL 1PHJA 2N78A 2GVBA 1N9WA 1WJJA 1NMGA 1NTGA 4DNIA 5C4XG 4DUZQ 2D0OA 2JK8A 4O0AA 1B70B 5FLMG 4IO9A 2R93G 3GTOH 2XTIA 3CCLA 2WB1E 4JOIA 1U5KA 1VQNA 1KC8C 4Y7NH 4DV2L 1YNXA 3E0EA 1PYSB 3D31A 4NPSA 4A3KH 1L1OB 4KI0A 1MIUA 2CKZB 4AIMA 4QL5A 3S14H 3I4NH 3OTOQ 4JV5L 1N34Q 5IWAL 4A3LH 1G51A 1K9MC 1LM0A 2RHSB 2JEBI 3M9BA 1VQ9A 3SGIA 1R9TH 4LF5L 1K8AC 4J15A 3HOYG 1VQGA 3CPFA 2E5LQ 1Y14B 3S2HH 3G4SA 1PV4A 3B6YA 1PH8A 1FL0A 4XIGS 1S3OA 3PIPA 1C9OA 1BKBA 4ME3A 4GS3A 4APVA 2VW9A 2ZM6L 1HJPA 1HZAA 2AWNA 3I4OA 4MNOA 3DLLA 1VQ8A 4JI5L 1N8RC 5H1SE 4LF6L 1FJGQ 4DR6L 2UUBQ 4LF7L 2I0QA 5HGQA 2VUMG 1X3FA 1B7YB 3BZKA 4DV4L 4AQYL 1W3SA 2GN5A 3RR5A 2F4VQ 1IBLL 3CC4A 3CCQA 4YHHL 1WOCA 4YY3L 1XMQQ 4KLKA 2UUCL 2R7ZH 3NENA 4X62Q 3A5UA 4A3BG 2Z6KA 3HOYH 2OTLA 1I6HH 3PO2H 2UXDQ 4DV7Q 3K81C 1GKHA 3S24A 4EX5A 3G71A 2ES2A 2NVTH 3HOUG 2CWAA 5LMUQ 4JYAQ 1D7QA 3CCMA 4DV0L 3CQZH 1T9HA 2B3GA 2JEAI 2MO1A 1SR3A 4DV5Q 4JI0L 3I4MH 4YWMA 2HHHL 2K5HA 4DR1Q 1E1TA 3ULPA 1EIYB 2JA7H 3T1YL 3CC2A 2QA4A 1N36L 4K0KL 3EN2A 4A3MG 4JI8Q 1L1OC 5IT9c 5E7NA 4OO1G 2A1AA 2UXCL 1AE3A 3EIVA 3AYHB 4EQ5A 3CXCA 2YTVA 4O2DA 4UPAA 3K7UC 2I5LX 3S17H 3PGZA 2C35B 1V9PA 5GROA 1LYLA 2K50A 1YITA 1I50H 4GN4B 1CUKA 2IT1A 1N33Q 1L2FA 1P16A 1Y1VH 3CP0A 1I94Q 3I7FA 4P72A 1PH4A 2E2JH 3PUZA 3UE0A 2VZAA 1X9NA 1BBWA 2MFIA 2YU9H 3HOZG 1KIXA 1VQ7A 1UWVA 2R92H 2B63G 2QEXA 2D62A 1SFOH 1E24A 1X6OA 4UY8C 1IL2A 1MJCA 1HNXQ 1EIFA 4QJFA 4HJ8A 3I2ZA 3HOXG 3PO3G 3A74A 2PNHA 3TS2A 4BXXG 1OXVA 3PUYA 1QUQB 1Z9FA 1VQDA 4DR4Q 2JA9A 1X3GA 3K8AA 1U0LA 4OONA 3KF6B 4RG1A 1WCMH 3I56A 2I5HA 3HKSA 1S72A 4NXML 2RF4A 2B63H 2ALYB 4L5QA 2Q2HA 4R4OA 4C3IH 1Q86C 4GOPC 4GLVB 1PH6A 3GO5A 4HJ5A 2N8NA 4HJ9A 1NBWA 1JB7A 4LF9L 1PFSA 1CKNA 1A8VA 1KRSA 2Y0SG 3HKZG 1WYDA 5ELNA 4DK3C 2KBNA 3CPWA 2JJQA 2NN6I 4KHPQ 4OWXB 1BVSA 1TWAH 1J5EL 3TRZA 4A4IA 4P75A 3RNUA 3FP9A 3H0GG 1SRUA 4R4QA 4YCUA 2DUDA 1X65A 2LXJA 3RLNA 4DR2L 1UEBA 4B3SQ 4DUZL 1QVGA 2LXKA 1QVFA 1QZGA 1PH3A 4NB3A 4DV3Q
chains in the Genus database with same CATH superfamily
5CBAE 3M4PA 1UAPA 2OF1A 3NSWA 2AWOA 2QEJC 5ELEA 3HOVH 4B9XA 4OEMB 3S2HB 4EQNA 1K8OA 3DXJC 3VA5A 5JOBA 1N34L 2I5MX 4DV6L 3MWYW 4DK6C 4V0BA 1F9RA 1DONA 2PZTA 3I4NG 4K5XA 1BBUA 5IIFA 4JI7Q 2NUCA 4ZCKA 1JCKB 3UDIA 3CCEA 2RSOA 1MKHA 1SE2A 2H5XA 1SYBA 3I55A 1R4PB 2NVTB 1M1KC 2PI2A 1CSPA 3DWAA 1XMQL 1LO5D 3TS0A 1GOZA 1V43A 3VR4A 3T1HQ 3ER0A 1QJOA 5A2QE 4A3BB 1S5BD 4JYAL 1EIGA 2Q2TA 1XNRQ 3MC0B 1MD2D 2MPMA 1YNJC 1KLGD 1JE4A 1H9KA 1SE8A 4JBKA 4UP8A 2L5TA 4R4CA 2R61A 1HNWQ 4ILWA 2AQ3B 4GNXB 4C2MH 5KIXA 3ZYYX 3PUXA 4KD4A 2K03A 2NVQH 4LF8Q 2RKSA 1N33L 2J4XA 2OXPA 2BOSA 5BR8Q 4K5WA 5J1ZA 3VR2A 5I9PA 1BO0A 1WTXA 4OWWB 4I65A 1EYDA 3BDLA 2IWHA 3GD7A 5AJ3Q 5JPMC 3D4DA 3S2DH 2OTJA 1V1PA 4IOAA 4JK1C 4IPGA 2V1CC 4JW0A 1SNMA 5CORA 1C7YA 2QDBA 2A5HA 1A62A 4A3IH 3E0JA 3NWSA 4HIKA 3URYA 4C3JH 4C3IG 4IPHA 2B2WA 3U50C 4WRDA 4PNYA 1XWEA 3LGJA 1I3QH 5D14A 2O4XA 2B2TA 3CAMA 3D6CA 4YY3Q 1LT5D 2JA5H 2BH2A 2CQAA 4BY1H 4FXDA 2F0JA 4RA8A 3WOEA 2CHBD 1EY6A 3FEWX 1VMPA 3S16B 4DV0Q 2EOTA 2ZTCA 4X3SA 1HZCA 4BBRB 3N6RA 1FYCA 2RHQB 2AMCB 2PMZB 3J81c 3RUZA 3JAMc 3A55A 4JI7L 3ONAB 1GJXA 1ZKOA 2JA6H 3F2DA 1JJCB 2F0NA 1W6KA 4DAYB 1JJ2A 4V190 2IY5B 2NN6H 3NQTA 4KKSA 4A3GG 1J9OA 2NWGA 1K83H 4A76A 1VQAA 3T1HL 4TVAB 4IJLA 1B2TA 4PV1C 1IKLA 1XNRL 1S5DD 4IZ8A 5T1IA 1ML0D 1VF7A 3A56A 4BY7G 4UDUC 4K6LA 5T1GA 1HNWL 2R7ZB 4WJ3M 3G6EA 1PH1A 3J7YW 3HOWH 4KY7A 1MGSA 3DM3A 1F9QA 1J5EQ 3KDFA 4LF8L 4LF4Q 5KNDA 1B1ZA 4QY7A 5BR8L 1ICFB 2LFNA 2K28A 1Q12A 3QO2A 4A3JH 5AJ3L 2F0VA 1IXRA 1O7YA 2ATWA 5FLMH 4QF4A 4JI3Q 1TS5A 1IBKQ 3H15A 2R92B 3Q8DA 4HMJA 4JOIC 2Z1CA 4MIUA 1SFOB 1HNZQ 4IJHA 1SNOA 1TIID 5ISRA 3CRLC 1U4RA 1I4HA 4ZRZA 3RLFA 4DNRB 1YJ9A 1QG7A 3J81j 1XPOA 3BS1A 1SLJA 2XNAC 3ITPA 4POFA 2DGYA 2MO0A 4CHTB 1IW7C 1B44D 2Q2UA 2B2VC 5LL6S 3NUCA 1TWHB 1VMCA 2VUMH 3PIOA 4GNXA 1O7LA 3DEPA 3FMCA 1XJVA 4WJWA 2XRSD 4UHVA 2ZM6Q 2B2YA 2O5IC 4JI5Q 3OMCA 5KGUA 1QVCA 1UNSA 1Q90A 4LF7Q 2F0QA 3MHBA 4DV4Q 1JJGA 4IALA 2HQEA 2GVAA 4S3SA 1RL2A 3STBD 1E2VA 2N3SA 3A8JE 5M3MB 2I46A 5FLXE 3KBXA 3ICEA 3OHXC 4RHSA 1A3UA 3J80c 3KJOA 1PH9A 1I6VC 3BDCA 2A6ED 1VQEA 1YIJA 3BVGA 4A3MH 5C4HA 1LTID 1Y8OB 4OO1H 1C8CA 2PI2E 4JI0Q 4WJ4A 4CJ1B 5M3MG 2E2HH 1N36Q 4GLXA 4A3DG 2BDNA 4R9WA 1M90C 1PRTF 4DPGA 1CFMA 1GXDC 3PQIA 1CM9A 4AYBE 5LMNQ 1HA5A 1HZ9A 3IL8A 5IYCG 3KFUA 4OIKA 3S1RH 1I5FA 4OELB 5C3XA 1SROA 4KN4C 3J7A5 3CCVA 3BJUA 3PF4A 4LF4L 1HTLD 1VQHA 4AH6A 4HIOA 2HDLA 3H09A 3A0JA 1Q82C 1EQRA 3FPUB 2V4DA 1BDOA 2K5VA 3MVVA 2KCTA 4P74A 4IOCA 4K8JA 1XTDA 1R4QB 2NVQB 4LF9Q 5IY0A 2VNUD 3OMGA 1HTPA 4JI3L 1IBKL 4R4TA 1A63A 5IYDG 3T13A 5I6WA 2DNCA 3H94A 5ELOA 1HNZL 2PCFB 4DAYA 2F3VA 3K5NA 2N78A 1N9WA 4DN4M 4DNIA 2D0OA 2JK8A 4O0AA 5J39A 4DF7A 1MBYA 3S2DB 3OWEB 3DM1A 2VB2X 1PYSB 1L1OB 1BCPD 1MIUA 2IL8A 4QL5A 3S14H 3I4NH 3OTOQ 1U4PA 1G51A 2K32A 4C3JB 3SEBA 4LAAA 5IGFA 2E5LQ 3S2HH 3B6YA 3PIPA 5IGDA 1AFPA 5ELFA 4GS3A 3HOUB 2ZM6L 4DK0A 4JI5L 1FJGQ 4LF6L 4LF7L 2JA5B 3ND8A 3VR3A 5HGQA 1JOQA 3DEOA 4DV4L 3BZKA 2DJGC 4Z9CB 5J22A 3W3AA 4TSSA 3CCQA 2WB1B 2BCOA 3RD4A 3NENA 1H9SB 2Z6KA 5AFWA 3K81C 2ES2A 2NVTH 3HOUG 5LMUQ 3CCMA 2B3GA 2B39A 4JI0L 1SJHD 2F0KA 1JC7A 4DR1Q 3ULPA 2Q8RE 4O1NA 1N36L 3PO3B 2JA6B 5M5YB 2NYZD 3C3LA 1Y69U 4XQQA 2PQEA 1UUPA 3GTQB 4CKCA 1B9MA 2C35B 1F2YA 5GROA 4GN4B 1L2FA 1NCVA 3CP0A 1G8ZD 3PUZA 2VZAA 1BBWA 2D5DA 1UWVA 2LKVA 4K2LA 2D62A 1MJCA 1HNXQ 3PO3G 4LMQD 4PQXA 3PUYA 1LLRD 2FMCA 1ONLA 1VQDA 4DR4Q 3K8AA 1SSOA 4C3IH 4GOPC 3HOWB 4KV6A 4GLVB 5L37A 1PH6A 3GO5A 1EU4A 4HJ9A 3NXWA 1JB7A 4LF9L 1W6JA 2J7ZA 1KRSA 1A8VA 2Y0SG 3HKZG 4DK3C 3P7JA 3CPWA 2JJQA 3VYSA 1WVLA 1F77A 1RD9D 3FP9A 5E3FA 5FO8B 3V96A 3H3VC 3RLNA 1CHPD 4B3SQ 1M4VA 2DJFC 4A3KB 2RVLA 2G9HD 2A68D 1B8AA 3HZXA 1XNQL 4JI6Q 2AUKA 4DKAC 4L5SA 2AUJD 2HIVA 2F0FA 4BA2I 1YEZA 1AEXA 3OTOL 2M9VA 2UU9Q 1K0RA 2A8VA 1GHKA 2I07B 5ELDA 3S16H 4A3KG 3T51B 2SOBA 2AKWB 3PV0A 1LT3D 2EZVA 1EFWA 1EEFD 2RDFA 3KLSX 4BBRH 3Q24A 1JWSD 3SHLA 2CCZA 3S9WA 5LHY1 1HPCA 1FJGL 1K3RA 3L7ZC 5D3IB 4X3UA 4HJAA 2L4NA 2K04A 2VUMB 3TP5A 2YV5A 1H9JA 2NZ1D 1NUCA 4NXNQ 1TWFH 1SNDA 4BY7H 3E5SA 1KAWA 2BA0A 3GV3A 2ZXRA 5FO7B 5LMUL 1PRTB 1VQ6A 1YNND 1IYJB 1B53A 1II3A 1ET6A 5GAGC 3HEJA 2EYMA 4JI2Q 2F0UA 3S1QH 5E4XA 4PZ6A 1YJWA 4DR1L 2VXWA 3S17B 3QR8A 3SVMA 1GVPA 1AN8A 2YYZA 4X64Q 1E22A 3A5ZB 2YU9B 5CR3A 2NZOA 3MAQA 3UE1A 3U4VA 1PFNA 1L1OA 1OXUA 1UE6A 3RLOA 2OCEA 5ELBA 2E2HB 2IX3A 2IX1A 4DV2Q 3HG9A 2NZHA 1HR0Q 1UE7A 2B63B 2TMPA 3QB3A 1RODA 4DR4L 2QILA 4YCVA 3ULJA 2JA8B 5C5MA 1L0WA 5IT9L 4ZUIA 3K5OA 1S5CD 4X65Q 3QWNA 5EKKA 5C4ZA 3FRPB 2RCFA 4XYOA 5IP7H 3M4YA 2XSCA 4J6HA 2QDLA 1ILQA 1Q1EA 5IOCA 4MN3A 5BN5A 1PZKD 2O5JC 3PIP3 3GV6A 1TKWB 2JA8G 4P71A 2EXZA 5C44B 2G9DA 3NE5B 1K28A 3L0OA 4NP5A 3H91A 2WAQG 1RHPA 3IFTA 3QOLA 4JI6L 1SYDA 2A74C 4ZKBB 1KDBA 1HQRD 3K7AB 2DN8A 2E76C 1NR4A 1KHIA 2FFKB 3J81i 1TWHH 3JAMi 1XYIA 1FR3A 3TBIB 2UU9L 1B3AA 5C44G 2JYOA 1QE6A 3ERSX 4FYDA 2QGQA 3D3RA 4PZ8A 2LSSA 4K14A 3S14B 3M85A 4G57A 5CYUA 3X3NA 1RJTA 1TY2A 3I4NB 5M3MH 2KCCA 1WTHA 3KLWA 1I4QA 1HFNA 3BZDB 4A3DH 1WTVA 2H1EA 2M00A 1FVIA 3WWVA 4JG2A 4NXNL 1D8LA 4KTAA 2RDHA 3K58A 1X32A 4IFDI 5IYCH 2L15A 4N9PA 4QQBX 3NHHA 2R6GA 2YTYA 5A2QL 1IYVA 1SYCA 2PQAB 3J7ZC 5M3FB 2SNSA 2BE5C 2YTXA 5CMDA 5JVH3 4X64L 1RCVD 1SN8A 1Q7YC 3G7LA 1X3QA 4X66Q 3HFZB 4N8FA 3KK7A 4X62L 1K73C 4QIWB 3AFQA 2E2IH 2KCMA 1I4GA 2EYLA 4DR2Q 2MQHA 3E9IA 3GTKB 4GKJQ 3J7AV 2KVMA 4ODGA 3W2DA 2B2UC 5IYDH 1HR0L 5M3FG 2MNAA 3FKIB 1GUOA 1MSHA 1EZ6A 4FO2A 4JI8L 4HCEA 2SDFA 3QJYA 4KK7A 3WDNA 1K8MA 3EJIA 4LNQA 4X65L 1WTQA 4B3RQ 1V1OA 3K0XA 2RA4A 3U4ZA 5DM73 2EYHA 1SNPA 4ZLTF 1J6QA 1VQMA 4HTHA 2HDMA 3FKIG 3NTHA 5DNFA 1E2ZA 4HN7A 1XPUA 1JR0D 4C3IB 4DV3Q 4G7ZC 2KCNA 2GA4B 3H6MA 4K5VA 1EY0A 4GOPB 5EBCA 5EAYA 3DWPA 4B08A 5CBEE 2K5DA 2F1MA 4LF5Q 2F0HA 3OW2A 2QW7A 2HCCA 1KABA 3F1ZA 4A3CG 3I90A 4KD3A 4GN5A 1HUNA 2D9UA 4L5TA 4LWCA 1E2WA 1WD1A 3J80i 1PVOA 4MHEA 2WIIB 3HOUH 5E1FA 5IYBG 2KENA 1Q1BA 4RKLA 1XXGA 2B8FA 4KY5A 1RTNA 4QB4A 3RZDH 4DV3L 2F0TA 1AW7A 3LWUA 5DAUA 4UAIA 1OXTA 2KHJA 4WORA 5FJ8G 5C0XG 3K6OA 4K6DA 1ZYRD 1XMOQ 2KUMA 1VQJA 1EY7A 1TU2B 1NY4A 2F52A 3LWEA 4IUQA 2K5NA 4H44C 3OYYA 4DGZA 4A3GB 2VL6A 2BA1A 1PTOB 4B3MQ 3LX0A 3CHBD 3MXNB 4X6AH 3TREA 2A6HC 1IKMA 3I91A 3F2BA 3PO3H 2DNEA 2ZJPA 5M5YH 2K33A 1J8IA 1TWFB 1T5EA 2SEBD 1CI3M 3NQIA 5EQ0A 4BY7B 3GTQH 3D4RA 4KJNA 4LUOA 1STNA 4X66L 3C1EA 5EPKA 4QUFA 1HH2P 3KLRA 1Z6HA 2L1BA 1QZHA 3BVMA 1SNCA 3S1QB 2HIXA 2KOLA 4TQUS 4DR5Q 1EEID 3SK8A 4GKJL 1Z47A 1VF5C 4NXMQ 1I4PA 1DD2A 4JC0A 3CCJA 5HY6A 1U4LA 1RIPA 5IODA 4DAPA 1U4MA 4QCLA 1QNUA 4KJOA 4PG3A 1AH9A 2L55A 3BZCA 1AZPA 3G6JB 4RGNA 1LACA 3L2PA 1VQFA 1X3EA 4B3RL 2NVYB 2GVBA 4FF1A 1NMGA 2CW0C 1B70B 4RGTA 2R93G 1Q8IA 2XTIA 2WB1E 3MXUA 1EYCA 2HD3A 4F8MA 4A3KH 2CKZB 3VR6A 4RGOS 1RF2D 5I2YA 1Y8NB 1F2ZA 3AU7A 1LM0A 2JEBI 4LF5L 4IUUA 4J15A 1VQGA 2MJ8A 1PH8A 1PV4A 4XIGS 1S3OA 3EVQA 4ME3A 1HJPA 3I4OA 1HZAA 1CZWA 1JWUD 5M5WB 5H1SE 2I0QA 2KECA 3RR5A 2F4VQ 1QNKA 2QKIC 1TVXA 4ZQ3A 4YY3L 4KLKA 3SR1A 5FLXL 2ICEC 2UXDQ 3A8IE 1GKHA 3S24A 2CWAA 3MA2B 4DV0L 3CQZH 2JEAI 4M1UB 4N8X1 4RH6A 1MHWC 4DV5Q 3HGBA 2EYFA 4YWMA 4I7AA 3R93A 2K5HA 2FJ2A 1G6ZA 1EWHA 1SDFA 5IT9c 5E7NA 3EIVA 2F0DA 2PZUA 2K7VA 4IUNA 4A3DB 3K7UC 2I5LX 3S1NB 3S17H 3PGZA 1V9PA 2K50A 1CUKA 4IUPA 4K2KA 2E2JH 3I7FA 4P72A 2C9OA 1CHQD 2YU9H 2MFIA 4IUTA 1NNXA 1VQ7A 2QEXA 1IL2A 4UY8C 1EIFA 4QJFA 4HJ8A 3I2ZA 3HOXG 4BXXG 2ZT9C 3H0GB 1QUQB 5CC4A 1X3GA 4OONA 4NXML 3HKSA 3V2TA 2B63H 4MTKA 4X3TA 2LS01 2B2WC 1NBWA 4CGYB 1ILPA 1PFSA 1SE4A 2JA8H 1HHVA 5ELNA 2E2IB 1BVSA 2B2TC 1J5EL 4P75A 3GTOB 3H0GG 1EIHA 2PNRC 4JVZA 4YCUA 3SXHA 1UEBA 2LXKA 1EY9A 3DLLA 1QZGA 1QVFA 3P20A 2NB0A 3I73A 1TY0A 2EXDA 4IFDG 1JORA 1LTLA 5C44H 1F2LA 1R9TB 1L0YB 1ENFA 2Z0SA 1B3QA 2EQSA 1YJNA 1IHZA 3K7AH 5IGCA 1LUZA 1PH5A 2HT1A 4OXPA 1PDQA 3J7AF 4YWKA 4LFBQ 1D1IA 3PUVA 4GLAC 1LTAD 2Q2IA 4YWLA 4L5RC 4XTCS 1Q8KA 1ICWA 1IZ6A 3UDFA 4A3LG 2CWPA 2FHTA 1VQBA 4LFAQ 2MGSA 3R3OA 2EYOA 2OEOA 3GTMH 2F4VL 1TS3A 3NTIA 2R7DA 1D5XC 1PXUA 1STEA 3MXPA 4IPCA 4G4KA 3AQQA 3I4MB 3NBHB 4R1JA 3D6WA 2WKDA 2JA7B 2XWJB 2F3WA 4H7BA 1C48A 4ZKCB 2KEEA 1VQOA 1E1OA 3HOYG 2K52A 3HP3A 3RZDB 3OW7A 3VYRA 1GUSA 2HQLA 4KHZA 1PZID 1AZQA 5KNBA 4DR7Q 5KRUA 1DOMA 1GM5A 1CQVA 1PA6A 4JBMA 2A69D 3I4MG 3BG3A 5J3BA 1SE3A 5M3FH 1WTPA 2JA7G 1ET9A 1HQMC 4ABNA 4HAEA 2O2LD 2EY1A 3I3CA 2IHEA 4TRDA 3A7AB 1NMFA 3BYTB 1KRTA 3GTKH 1FGUA 3GP7A 1FNUA 3GTGH 3M4OH 3FKIH 3GQBA 2K75A 5LMNL 1TS4A 3AEVA 1GUTA 3KYHC 4RCNA 4DU9A 1CTMA 2H4OA 1DOLA 4DR3Q 4DXGA 1ASZA 4NMZA 2JE6I 2Y0SB 3HKZB 2L9HA 1Q3LA 5DEHA 1AE2A 1FNVA 2R7FA 5JJLA 4OX9Q 1WFQA 1PH7A 4XYQA 3UDXA 4A3CH 1ENCA 2WFWA 1CKNB 2F0IA 4GNXC 1FGBD 2FXQA 3NBIA 2PZWA 1PYBA 2QCPX 2ICIA 2RBMA 3Q23A 3P1HA 2B2YC 1SYFA 5C5LA 3G48A 4IPDA 3CMAA 2UUAQ 5IYBH 1KTKA 5C0XJ 1JT8A 1HCZA 3BU2A 2J0TD 4BBSG 1H9MA 4K0KQ 1STBA 1LTGD 5FJ8H 5C0XH 1EL0A 4FDBA 4CDDC 3CMEA 2CH4W 1CKMA 2CFMA 3AFPA 3H3VH 3J81L 3DWQA 3JAML 1DGSA 1QCBD 4QIWE 3RZOB 4J1MA 1YHQA 1YBYA 3CU7A 2CH4A 2A19A 1WTOA 3SK4A 3TQYA 4OWTB 1KL9A 1S40A 4POGA 1S5FD 2OQKA 3GTPH 1H9RA 2E2DC 5CV6A 1OXSC 5IP9G 2E5LL 3J81E 3JAME 1LABA 3UDGA 4A3GH 4A93B 1EQTA 2EJFC 2ZJRA 1STHA 3PMFA 1X54A 2Q8TA 4QMGA 4H0LC 1E7ZA 2LMCB 4HSVA 2L11A 1PTOH 1WTRA 3IFDA 1ESRA 4DR7L 4AYBB 3STBC 3CQZB 2Z4IA 4KN7C 3DHQA 5EPLA 1GD7A 1GO3E 5C3WA 4A93G 2A6EC 3VA7A 4P2CB 1EY8A 2BDOA 1KQSA 1DZ1A 3MTSA 1B9NA 4C1NK 1LTSD 3QOJA 2CVRA 4AYBG 3NELA 2E2JB 2R93H 3LNNA 4A3FB 4DV6Q 1V1QA 4JI4Q 1PTOF 1O78A 5NUCA 1VQPA 4LJZC 3RN2A 2AHOB 1STYA 5EGTA 5COYA 4DR3L 5JPNC 1V1PB 4NW2A 2NVYH 3A54A 5M9OA 1HNXL 1D5ZC 3SK5A 1CQFA 2VS1A 4OX9L 3T53B 1B50A 4RHRA 2WP8J 5JAVA 4A3FG 1E3PA 3WOFA 5FLXc 5GADC 2F0LA 1OO9B 3PUWA 3W1BA 4JV5Q 4DAMA 4FXKC 3OOCA 4LW1A 4YCWA 2ZTEA 2OT2A 2WAQB 2UUAL 2NBFA 2EIFA 1VQ5A 4A75A 3IRBA 2PMZE 3ZJYC 5JEAG 1D5MC 1H9SA 1STAA 3I70A 3KLSA 4ALPA 1YZ6A 1DOKA 3P75A 2EDGA 2Z6KC 5IGEA 5C4JB 5M5WH 1WD0A 1IBLQ 4B3SL 1KDCA 1HXYD 4YHHQ 2UUCQ 4QUCA 1X56A 2OWOA 1GUNA 3GTJH 2OQ0A 2E75C 3K57A 5I2XA 2D0PA 2RQXA 1JMCA 1MSGA 2RCNA 3RN5A 2F3IA 1BCPC 3AB9A 3D8GA 4I7ZC 4GN3B 3T1YQ 2CQOA 5CV5A 1YHBA 2K05A 1O7ZA 2K6AA 2UXCQ 3GTMB 3J80E 4XXEA 1Y1WB 4C3HB 4A3EB 2ZJQA 3HOXH 2IPKD 5D65A 4EGVA 4BXXH 5JJIA 2KHIA 1DJRD 5JVG3 3L9AX 3T56B 2KQ3A 2TSSA 3S1NH 1DYQA 1HZBA 1W2BA 4FF4A 1HUMA 5C3EB 1CA6A 2KHSA 1JOKA 1KNAA 4R8NA 2XGTA 1VQLA 4YIJA 4F88A 1Y1WG 1CK1A 3GTLH 4C3HG 4A3EG 1EZ8A 4BA1I 1ZEQX 4JI2L 3QG1A 3O13A 3TMEA 3H0GH 3KDFB 5CV4A 2PPBC 4P73A 2E8GA 2F0OA 3CW2C 1PRTD 4IFDJ 1C0AA 3W1GA 1KXLA 3MZ5A 5C3EG 3U58A 5JJKA 4RMFA 1MI2A 3FVQA 5JJZA 4JI4L 2FMMA 1O7IA 2NVXB 3PSIA 4IFDH 1NTGA 3E6ZX 5C4XG 4FP5D 4DUZQ 4IO9A 3GTOH 1VQNA 4JOIA 1ESFA 1U5KA 1KC8C 4DV2L 3GTGB 3M4OB 4OGQC 1HFGA 5FOBB 4KI0A 4AIMA 3HS0C 2F0EA 2HUGA 4JV5L 4A3LH 2G5DA 1K9MC 3SGIA 1I4XA 1R9TH 4HEDA 1K8AC 1BOSA 1Y14B 3G4SA 2B2VA 1QWYA 1FL0A 3TZUA 3SK6A 4GZYC 1C9OA 4APVA 2VW9A 1VQ8A 2AWNA 1QB5D 1Z7TA 1NR2A 1E0BA 1PFMA 2F0MA 4L8JA 2XRQD 2UUBQ 1X3FA 1W3SA 2GN5A 4ZAIA 1JWMD 3MEHA 3VR5A 1IBLL 3CC4A 2WACA 3NTKA 4YHHL 2UUCL 4RAUC 5I4DA 1LTRD 3A5UA 2JSOA 3HOYH 4A3BG 2OTLA 2A68C 4DV7Q 3T16A 4EX5A 3G71A 3UI2A 3MXGA 2F0PA 1D7QA 5I9OA 3I72A 2MO1A 1SR3A 3HOZB 1M8AA 3I4MH 1CZGA 3C1FA 1RKNA 3ND9A 1BUVT 1EIYB 2JA7H 2EVBA 3T1YL 3EN2A 1LTBD 1L1OC 1KLUD 1TWGB 4JPBW 2UXCL 1AE3A 4EQ5A 3AYHB 3TDQA 2YTVA 4UPAA 1G2SA 4XDXA 1K3BC 1A6XA 2Z6BA 1LYLA 1TQOA 1L0XB 1P16A 1U9RA 1I94Q 1PH4A 3GTPB 4IN3A 3MFGA 3UE0A 1X9NA 3HOZG 4WFN3 1KIXA 2AQ1B 1F2MA 1E24A 1DCZA 2R3ZA 3A74A 2PNHA 5EBDA 1F9PA 4RKBA 4FXGC 5CV9A 2JA9A 4RG1A 2EYPA 1U0LA 3KF6B 1S72A 3I56A 2I5HA 2F03A 3OIQA 5KNCA 1Q86C 4RCOA 1YNNC 4HJ5A 2N8NA 1SAPA 2K5WA 5HURA 3VYTA 2SNMA 5KYLA 5EKIA 3KBGA 3OPOA 4KHPQ 2KBNA 2NN6I 4OWXB 2XIWA 2AQ2B 3TRZA 3OWFA 4A4IA 1RDPD 2IW3A 4R4QA 3MFYA 2X6LA 4Y7NB 1DXMA 2DUDA 2LXJA 4DR2L 4CJ0B 2HCIA 4DUZL 1EY4A 4NB3A 1PH3A 3OIPA 2R93B 2EPBA 1BBXC 2ENBA 5ELCA 4BBSH 3I4LA 3I8ZA 2ZXPA 1P8LA 3ERQA 4BBRG 3Q0AA 2L12A 1BR9A 1CSQA 4RGMA 5IGGA 1RTOA 5FKAC 1SMYD 1A0IA 1EYGA 1YHAA 1EOTA 4DUYQ 2KA7A 3EBEA 2JXMB 5CV7A 3K5MA 4HR7B 3HRZC 1I4RA 1JB3A 1X3PA 1TWCH 5CV8A 4ULLA 1A15A 1EUJA 1SJED 5G3LF 5GAHC 1VCIA 2UUBL 1WTWA 3E3XA 1C4QA 1QILA 5IP9H 3C2PA 4QGUA 2EY5A 1VS0A 3SE0A 5BN4A 1I6HB 3PO2B 2L0CA 5LMNW 1VQKA 4CBVA 1TXYA 1OTCA 3M3YH 3EA6A 3RZOH 4IQZA 4J8QA 1SYGA 4CKBA 2EY6A 2Z8LA 2PQAA 4DV7L 5FK9C 3CCSA 2ASBA 2E74C 3DUZA 2F4IA 3TP8A 4C56C 3BVZA 2N55A 5EJWA 3CCRA 1GHJA 1O80A 2R7ZG 4MZ9A 4LUZA 3IAYA 3PO2G 3SDZA 4LFCQ 2DY7A 1SXTA 1KAAA 2VQEQ 3GTJB 1I50B 2IHFA 1YI2A 4A93H 1Y1VB 2F0SA 3L3OC 4UP9A 1NSNS 2Y0SE 3HKZE 4GKKQ 3KF8B 1GUGA 1I94L 3PF5A 1XMOL 1BCPB 4R8IA 1A3TA 1TS2A 4NKLA 1EWIA 3BDOA 1G291 1WCMB 3TZDA 4RFBA 2K5QA 2K14A 3CC7A 1Y1VG 2B29A 4JI1Q 4M8AA 1CT1D 5IP7G 2N49A 4K8IA 3HOXB 2K4KA 2R92G 4B3ML 4DV1Q 2VQFQ 3TEHB 1TWAB 1EQQA 4H02A 4A3FH 1PTOD 3M7NA 4KHPL 1LT4D 3OSOA 3R2IA 4FNFA 1PRTC 1DM0B 1WCMG 4E6IA 4O42A 3TN2A 4GOPA 1ASYA 4OO1I 2BH8A 1XPRA 4LF6Q 5K36G 3GTLB 5JEAJ 4U673 2C5CA 5EKLA 3IKJA 4DR5L 2Z9HA 5IE8A 1X55A 2D2CC 2XWBB 3HOVB 4LK1C 5JEAH 3DMUA 4C1NI 1VQIA 1QOHA 1S5ED 2XVSA 4Y52H 1EU3A 4Q0FA 3K59A 2MUYA 1CKOA 3T4AC 3M4QA 4B3TQ 3R2TA 1AP0A 1VQCA 3FPPA 4L63B 4B9WA 4ZK9B 3S1MH 5I6YA 2WINB 3QIAA 1Q46A 1Q81C 4DUYL 5HGTA 3HOVG 1A3VA 4LUVA 1XX8A 4EVOA 4HIDA 4PZ7A 1HRJA 1G6PA 5C4JH 4H13C 3TSSA 3VYUA 1JQYD 2B8GA 2RSNA 4HSPA 3KF6A 1G91A 3M7GA 2WV6D 3X3MA 2EJGC 4JBWA 3MXNA 1EOVA 4KMUC 3C46A 1PFBA 2ID0A 4CDCC 2F0WA 5M5XH 3S15H 1F9SA 1NAPA 4C2MB 1EY5A 2UXBQ 5A35A 3TP6A 4LFCL 2VQEL 2K1BA 3HOYB 1KNEA 4ME5A 4DXFA 3PCOB 1Y1WH 4PMCA 1SYEA 4C3HH 2IX0A 3Q22A 3D4WA 4R4IA 1YVCA 4A3EH 4GKKL 2EY2A 1WI5A 2N88A 4BS9A 2UXDL 3E9HA 1N32Q 3CF5A 5C3EH 1PYWD 1ZYRC 5F2DA 3KJPA 3K80C 4DV5L 3W5OA 1XNQQ 1UE5A 3NWTA 1V8QA 1ENAA 4JI1L 2WAQE 4CDEC 3KOJA 5C4XH 1K8GA 1IBMQ 2WKCA 1FD7D 1ZXTA 2Q8IB 3JC66 4A3IB 3F2CA 3EFXD 4DV1L 2VQFL 1NJIC 2EJMA 2JQOA 5KEEA 2Z4HA 3EQLC 4RWSC 4DNTB 1I3QB 3MEFA 5GAEC 2NVXH 2PYKA 2XN9C 4F7XA 1OXXK 5BN3A 4BY1B 2LY7A 5CGKA 1IL8A 4PMBA 2K01A 4A3IG 3NEMA 4C3JG 4JCVE 3CRKC 3F2UA 5IWAQ 4EQPA 4ZUJA 1GUWA 1JE5A 1A2TA 1EFID 4B3TL 5D3DA 4HIMA 2FINB 2JA5G 4JBJA 3KF8A 4BY1G 4BWGB 2ZTDA 1SMYC 4FF3A 4A3BH 4DR6Q 2BE5D 2F0GA 2X69A 4AQYQ 1KD1C 2WB1G 1BNZA 3NP8A 3D0FA 2MP1A 4BBSB 2QF7A 1Y8PB 3GDEA 3KUPA 1EQVA 5GQOA 1A2UA 1PH2A 3CKIB 1SNQA 3EROA 3F8TA 1NE3A 1K83B 4KY6A 1PMRA 1EWCA 4UP7A 1YNJD 4IUVA 4OL7A 1SMXA 4OIJA 1UE1A 4FF2A 1TWCB 3K0YA 2HHHQ 2JA6G 4LFBL 5C0XI 1MJEA 2NN6G 3HOZH 1HR0W 3H3VI 2X6GA 4HJ7A 2UXBL 4LFAL 1SEBD 2PO4A 3M3YB 1TWGH 1QUQA 4XT1B 3ULLA 4PMWA 3PIO3 4G7OC 2VY3A 1TR5A 3TP7A 4MTNA 1N32L 3FHWA 3VDYA 4A3JB 4OHJA 4CKEA 3HOWG 1H95A 2EYJA 1HA6A 3K5LA 4TKOB 4L6TB 4XQNA 4HCSA 4DK1A 5IGBA 2P5ZX 4KHVA 3CCUA 2B2UA 1IBML 3U9OA 5DLQE 4IURA 3CD6A 5C6AA 2A73B 4A3JG 1XTCD 5EPJA 1VQ4A 1LT6D 1EYAA 1PHJA 1WJJA 5KYIA 4EQOA 5FLMG 3CCLA 1PTOC 4Y7NH 4XQJA 1YNXA 3E0EA 3D31A 3A8KE 4NPSA 1BF4A 4F87A 4XT3B 2IJ0A 1N34Q 1PZJD 5IWAL 2RHSB 5E4WC 1VQ9A 3M9BA 1UEAB 1KDAA 2KEDA 1FNWA 2ZXOA 3BYYB 1D2BA 3CPFA 2DY8A 4DFAA 1JICA 1BQQT 4HMIA 2A6HD 1BKBA 3RMHA 4MNOA 1N8RC 4G7HC 4DR6L 2VUMG 1B7YB 4AQYL 3NBHA 5FO9B 2NTSA 4KKUA 1LTTD 5G3LD 4CJ2C 1WOCA 4A3MB 4N9TA 1XMQQ 3AMUA 1G2TA 2R7ZH 4X62Q 1BXTA 1JOOA 2EE1A 1I6HH 3PO2H 3S1MB 3U9SA 4FVMA 4DA2A 1PLFA 4JYAQ 1T9HA 3NK9A 3Q6SA 2PW5A 4ZYSA 4Q5VA 4CDFC 1STGA 2KJXA 2HHHL 1E1TA 2JP1A 3CC2A 2QA4A 4K0KL 4A3MG 4JI8Q 3S1RB 4OO1G 2A1AA 2MHVA 3NPPA 5LL6X 3CXCA 4O2DA 1S4ZA 1D1KA 2CW0D 2M2LA 1YITA 1I50H 2IT1A 5DM63 1Y1VH 1B4OA 1N33Q 3J80L 2JN4A 4NDXA 2R92H 4KKTA 2B63G 3V05A 1SFOH 1X6OA 5M5XB 3S15B 3A7LA 3TS2A 4ID6A 1OXVA 1T5XD 1Z9FA 5IT9E 4X3KA 1WCMH 5K5PA 2RF4A 5TSSA 2ALYB 4L5QA 3R8BA 2Q2HA 2NTTA 2PW7A 4R4OA 1IYUA 5K36H 4DAVA 2VB3X 1CA5A 1K0SA 2RDGA 1CKNA 1WYDA 1LV9A 1TWAH 1D6EC 3RNUA 1TT2A 1SRUA 1IW7D 2A69C 1X65A 3FDTA 4U68A 3N52A 1QVGA 1BCPF 1VDZA 5C4XB 1SBBB
chains in the Genus database with same CATH topology
1B8AA 3M4PA 1XNQL 4JI6Q 2EXDA 4IFDG 4DKAC 4BBSH 2AWOA 4L5SA 1LTLA 5C44H 2HIVA 3HOVH 1P8LA 4BA2I 4BBRG 1CSQA 1YEZA 2Z0SA 3OTOL 2EQSA 1N34L 1YJNA 2I5MX 4DV6L 2UU9Q 1A0IA 1K0RA 3K7AH 1PH5A 1LUZA 1EYGA 2A8VA 1YHAA 4OXPA 4DK6C 4DUYQ 2HT1A 3EBEA 4YWKA 3S16H 4LFBQ 3PUVA 4GLAC 4A3KG 2AKWB 2Q2IA 3PV0A 1EFWA 4BBRH 1TWCH 4YWLA 4L5RC 4XTCS 3I4NG 1Q8KA 1BBUA 4JI7Q 2CCZA 1IZ6A 3UDFA 4A3LG 2CWPA 1EUJA 3UDIA 1VQBA 4LFAQ 3CCEA 1K3RA 1FJGL 5GAHC 1VCIA 3L7ZC 2UUBL 1MKHA 5IP9H 2H5XA 4QGUA 1VS0A 3GTMH 4HJAA 2F4VL 3I55A 5LMNW 2YV5A 1M1KC 2PI2A 1CSPA 1VQKA 2R7DA 1XMQL 1TXYA 1OTCA 3TS0A 3M3YH 3RZOH 4IPCA 1V43A 4NXNQ 1TWFH 4BY7H 3T1HQ 1KAWA 2PQAA 2BA0A 3AQQA 4DV7L 3ER0A 3NBHB 3CCSA 4R1JA 2ASBA 5LMUL 1VQ6A 4JYAL 2Q2TA 1XNRQ 1IYJB 5GAGC 3CCRA 3S1QH 4JI2Q 2R7ZG 1VQOA 1E1OA 4JBKA 1SE8A 4MZ9A 4LUZA 2K52A 4PZ6A 4UP8A 4R4CA 4DR1L 1YJWA 3PO2G 1HNWQ 4LFCQ 2HQLA 2VQEQ 4GNXB 1GVPA 2IHFA 1YI2A 4A93H 4C2MH 2YYZA 4KHZA 4X64Q 1E22A 3A5ZB 3PUXA 4UP9A 1GM5A 4DR7Q 4JBMA 2Y0SE 1PA6A 3HKZE 2NVQH 3KF8B 2NZOA 3I4MG 4GKKQ 5J3BA 4LF8Q 3UE1A 3U4VA 5M3FH 1L1OA 1N33L 2JA7G 1OXUA 1UE6A 1I94L 3PF5A 3RLOA 2OCEA 1XMOL 5BR8Q 2IX1A 1EWIA 2IHEA 4DV2Q 4OWWB 1G291 1NMFA 2NZHA 1HR0Q 1UE7A 1KRTA 2K14A 1FGUA 1Y1VG 2B29A 3GD7A 5AJ3Q 3CC7A 4JI1Q 3GTKH 5IP7G 2N49A 4DR4L 3S2DH 4YCVA 2OTJA 2K4KA 3ULJA 2R92G 3GTGH 3M4OH 4B3ML 4IOAA 1L0WA 3FKIH 4IPGA 2V1CC 2K75A 5LMNL 4DV1Q 2VQFQ 4X65Q 3AEVA 3TEHB 1C7YA 1EQQA 4H02A 3KYHC 1A62A 4A3FH 3M7NA 5IP7H 4KHPL 4A3IH 4DR3Q 4HIKA 1ASZA 1ASYA 1WCMG 4C3JH 4GOPA 4OO1I 2JE6I 2BH8A 1Q1EA 4IPHA 1XPRA 3U50C 4LF6Q 5K36G 5JEAJ 1AE2A 2JA8H 2R7FA 5JJLA 3LGJA 4OX9Q 1WFQA 1PH7A 1I3QH 3UDXA 4DR5L 4A3CH 2JA8G 5IE8A 2WFWA 4P71A 1CKNB 4GNXC 2FXQA 1X55A 3CAMA 4YY3Q 3L0OA 2JA5H 1PYBA 2BH2A 4BY1H 2WAQG 4JI6L 1VQIA 4Y52H 3G48A 4IPDA 3CMAA 2UUAQ 1CKOA 3M4QA 5IYBH 4B3TQ 4DV0Q 1KHIA 5C0XJ 1JT8A 2ZTCA 3J81i 1TWHH 3JAMi 1VQCA 1HZCA 3BU2A 2UU9L 3S1MH 1Q46A 1Q81C 4DUYL 2RHQB 4BBSG 2AMCB 5C44G 4K0KQ 3HOVG 5FJ8H 4FDBA 3ERSX 4LUVA 3J81c 3CMEA 3JAMc 1CKMA 2QGQA 4PZ8A 2CFMA 3AFPA 2LSSA 4JI7L 3H3VH 4HIDA 3M85A 4PZ7A 1DGSA 1G6PA 5C4JH 4QIWE 2JA6H 5M3MH 3F2DA 1JJCB 1YHQA 1YBYA 4DAYB 3KLWA 2A19A 3TQYA 1JJ2A 4A3DH 2IY5B 4OWTB 3KF6A 1FVIA 3WWVA 1KL9A 4JG2A 4A3GG 1S40A 4POGA 4JBWA 4NXNL 1D8LA 1K83H 1EOVA 1VQAA 2OQKA 4A76A 4TVAB 3T1HL 3GTPH 1OXSC 2ID0A 4IJLA 2L15A 5IP9G 5IYCH 4IFDI 2E5LL 4QQBX 1XNRL 5M5XH 3S15H 2R6GA 2YTYA 3UDGA 4A3GH 2ZJRA 2UXBQ 4BY7G 1X54A 1HNWL 2PQAB 4LFCL 1E7ZA 3J7ZC 2VQEL 4WJ3M 3G6EA 1PH1A 3PCOB 2YTXA 4X64L 3HOWH 1SN8A 1Y1WH 4C3HH 2IX0A 4A3EH 4R4IA 1Q7YC 1YVCA 4DR7L 3DM3A 3STBC 4X66Q 1J5EQ 4GKKL 3HFZB 1WI5A 4X62L 3KDFA 4LF8L 4LF4Q 1K73C 3AFQA 2UXDL 3E9HA 1GD7A 1GO3E 2KCMA 4DR2Q 2E2IH 1N32Q 2MQHA 4A93G 3E9IA 4QY7A 5BR8L 3CF5A 4GKJQ 5C3EH 1Q12A 3KJPA 3K80C 4DV5L 5IYDH 3W5OA 1HR0L 1XNQQ 5M3FG 1UE5A 2MNAA 1KQSA 4A3JH 5AJ3L 1IXRA 4JI1L 2WAQE 3KOJA 5C4XH 4AYBG 4JI8L 1K8GA 3NELA 2ATWA 1IBMQ 5FLMH 2R93H 4JI3Q 4DV6Q 1V1QA 3JC66 3H15A 1IBKQ 4JI4Q 3F2CA 4DV1L 1VQPA 4LNQA 3Q8DA 2VQFL 4JOIC 1NJIC 4X65L 1HNZQ 2JQOA 3RN2A 4B3RQ 4IJHA 3K0XA 3U4ZA 2AHOB 4DR3L 3MEFA 5GAEC 1J6QA 1VQMA 2NVXH 3FKIG 3RLFA 1YJ9A 2NVYH 1HNXL 1OXXK 1XPUA 3J81j 1XPOA 4OX9L 2VS1A 1SLJA 4POFA 2WP8J 2DGYA 2MO0A 4A3FG 1E3PA 4A3IG 5FLXc 2Q2UA 5GADC 3NEMA 4JCVE 4GOPB 3PUWA 3W1BA 4JV5Q 5EAYA 5IWAQ 4DAMA 4LW1A 1JE5A 4LF5Q 4YCWA 2VUMH 3OW2A 2ZTEA 3PIOA 4GNXA 3F1ZA 2UUAL 4A3CG 2EIFA 1VQ5A 4A75A 1XJVA 4B3TL 3IRBA 2PMZE 4HIMA 3ZJYC 4GN5A 2ZM6Q 2JA5G 4JBJA 5JEAG 4JI5Q 4L5TA 4LWCA 4BY1G 1QVCA 4ALPA 2ZTDA 1YZ6A 4A3BH 4LF7Q 3J80i 4DR6Q 4DV4Q 4AQYQ 1PVOA 1KD1C 1JJGA 2Z6KC 2GVAA 2WB1G 3HOUH 1RL2A 3STBD 2N3SA 3D0FA 2KENA 5M5WH 5IYBG 1Q1BA 1IBLQ 4B3SL 3ICEA 4YHHQ 2UUCQ 3RZDH 3GDEA 1X56A 2OWOA 5GQOA 4DV3L 3J80c 1PH2A 3KJOA 1PH9A 3GTJH 2OQ0A 1OXTA 2KHJA 3F8TA 1NE3A 2D0PA 1VQEA 5FJ8G 5C0XG 1YIJA 1JMCA 4A3MH 1XMOQ 4UP7A 1VQJA 2RCNA 3RN5A 2F3IA 1NY4A 1SMXA 2F52A 2PI2E 1UE1A 4JI0Q 2K5NA 4WJ4A 3OYYA 2HHHQ 2JA6G 5M3MG 2E2HH 2VL6A 4GN3B 4LFBL 3T1YQ 1N36Q 2CQOA 5C0XI 4GLXA 1YHBA 4A3DG 1MJEA 2NN6G 2BA1A 1M90C 1HR0W 3HOZH 2UXCQ 4B3MQ 4DPGA 3H3VI 5LMNQ 4AYBE 3MXNB 4HJ7A 2UXBL 4X6AH 3TREA 4LFAL 2ZJQA 3PO3H 3F2BA 3HOXH 2ZJPA 1HZ9A 5M5YH 5IYCG 3KFUA 1TWGH 1QUQA 3S1RH 1I5FA 4BXXH 5JJIA 2KHIA 3GTQH 4LUOA 1SROA 3S1NH 3ULLA 1W2BA 1HZBA 4PMWA 4X66L 3J7A5 3CCVA 3BJUA 3PF4A 1HH2P 2VY3A 4LF4L 1QZHA 1VQHA 2HIXA 4DR5Q 4TQUS 4MTNA 2XGTA 4AH6A 3FHWA 4HIOA 3VDYA 1VQLA 1N32L 4GKJL 1Z47A 3HOWG 1H95A 1Y1WG 3GTLH 3A0JA 4A3EG 1Q82C 4NXMQ 1EQRA 4BA1I 4JI2L 2K5VA 4JC0A 3CCJA 5HY6A 3H0GH 2KCTA 3KDFB 4P74A 1RIPA 4IOCA 4P73A 2E8GA 3CW2C 1XTDA 4LF9Q 4IFDJ 5IY0A 3W1GA 1C0AA 1KXLA 3CCUA 1IBML 5C3EG 3U58A 2VNUD 4RMFA 5JJKA 5DLQE 4JI3L 1IBKL 4R4TA 4JI4L 4PG3A 3CD6A 1O7IA 5IYDG 1A63A 1AH9A 3BZCA 3PSIA 5ELOA 4A3JG 1HNZL 3L2PA 1VQ4A 1VQFA 1X3EA 4B3RL 1PHJA 2N78A 2GVBA 1N9WA 1WJJA 1NMGA 1NTGA 4DNIA 5C4XG 4DUZQ 2D0OA 2JK8A 4O0AA 1B70B 5FLMG 4IO9A 2R93G 3GTOH 2XTIA 3CCLA 2WB1E 4JOIA 1U5KA 1VQNA 1KC8C 4Y7NH 4DV2L 1YNXA 3E0EA 1PYSB 3D31A 4NPSA 4A3KH 1L1OB 4KI0A 1MIUA 2CKZB 4AIMA 4QL5A 3S14H 3I4NH 3OTOQ 4JV5L 1N34Q 5IWAL 4A3LH 1G51A 1K9MC 1LM0A 2RHSB 2JEBI 3M9BA 1VQ9A 3SGIA 1R9TH 4LF5L 1K8AC 4J15A 3HOYG 1VQGA 3CPFA 2E5LQ 1Y14B 3S2HH 3G4SA 1PV4A 3B6YA 1PH8A 1FL0A 4XIGS 1S3OA 3PIPA 1C9OA 1BKBA 4ME3A 4GS3A 4APVA 2VW9A 2ZM6L 1HJPA 1HZAA 2AWNA 3I4OA 4MNOA 3DLLA 1VQ8A 4JI5L 1N8RC 5H1SE 4LF6L 1FJGQ 4DR6L 2UUBQ 4LF7L 2I0QA 5HGQA 2VUMG 1X3FA 1B7YB 3BZKA 4DV4L 4AQYL 1W3SA 2GN5A 3RR5A 2F4VQ 1IBLL 3CC4A 3CCQA 4YHHL 1WOCA 4YY3L 1XMQQ 4KLKA 2UUCL 2R7ZH 3NENA 4X62Q 3A5UA 4A3BG 2Z6KA 3HOYH 2OTLA 1I6HH 3PO2H 2UXDQ 4DV7Q 3K81C 1GKHA 3S24A 4EX5A 3G71A 2ES2A 2NVTH 3HOUG 2CWAA 5LMUQ 4JYAQ 1D7QA 3CCMA 4DV0L 3CQZH 1T9HA 2B3GA 2JEAI 2MO1A 1SR3A 4DV5Q 4JI0L 3I4MH 4YWMA 2HHHL 2K5HA 4DR1Q 1E1TA 3ULPA 1EIYB 2JA7H 3T1YL 3CC2A 2QA4A 1N36L 4K0KL 3EN2A 4A3MG 4JI8Q 1L1OC 5IT9c 5E7NA 4OO1G 2A1AA 2UXCL 1AE3A 3EIVA 3AYHB 4EQ5A 3CXCA 2YTVA 4O2DA 4UPAA 3K7UC 2I5LX 3S17H 3PGZA 2C35B 1V9PA 5GROA 1LYLA 2K50A 1YITA 1I50H 4GN4B 1CUKA 2IT1A 1N33Q 1L2FA 1P16A 1Y1VH 3CP0A 1I94Q 3I7FA 4P72A 1PH4A 2E2JH 3PUZA 3UE0A 2VZAA 1X9NA 1BBWA 2MFIA 2YU9H 3HOZG 1KIXA 1VQ7A 1UWVA 2R92H 2B63G 2QEXA 2D62A 1SFOH 1E24A 1X6OA 4UY8C 1IL2A 1MJCA 1HNXQ 1EIFA 4QJFA 4HJ8A 3I2ZA 3HOXG 3PO3G 3A74A 2PNHA 3TS2A 4BXXG 1OXVA 3PUYA 1QUQB 1Z9FA 1VQDA 4DR4Q 2JA9A 1X3GA 3K8AA 1U0LA 4OONA 3KF6B 4RG1A 1WCMH 3I56A 2I5HA 3HKSA 1S72A 4NXML 2RF4A 2B63H 2ALYB 4L5QA 2Q2HA 4R4OA 4C3IH 1Q86C 4GOPC 4GLVB 1PH6A 3GO5A 4HJ5A 2N8NA 4HJ9A 1NBWA 1JB7A 4LF9L 1PFSA 1CKNA 1A8VA 1KRSA 2Y0SG 3HKZG 1WYDA 5ELNA 4DK3C 2KBNA 3CPWA 2JJQA 2NN6I 4KHPQ 4OWXB 1BVSA 1TWAH 1J5EL 3TRZA 4A4IA 4P75A 3RNUA 3FP9A 3H0GG 1SRUA 4R4QA 4YCUA 2DUDA 1X65A 2LXJA 3RLNA 4DR2L 1UEBA 4B3SQ 4DUZL 1QVGA 2LXKA 1QVFA 1QZGA 1PH3A 4NB3A 4DV3Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B8A A;  3M4P A;  1XNQ L;  4JI6 Q;  2EXD A;  4IFD G;  4DKA C;  4BBS H;  2AWO A;  4L5S A;  1LTL A;  5C44 H;  2HIV A;  3HOV H;  1P8L A;  4BA2 I;  4BBR G;  1CSQ A;  1YEZ A;  2Z0S A;  3OTO L;  2EQS A;  1N34 L;  1YJN A;  2I5M X;  4DV6 L;  2UU9 Q;  1A0I A;  1K0R A;  3K7A H;  1PH5 A;  1LUZ A;  1EYG A;  2A8V A;  1YHA A;  4OXP A;  4DK6 C;  4DUY Q;  2HT1 A;  3EBE A;  4YWK A;  3S16 H;  4LFB Q;  3PUV A;  4GLA C;  4A3K G;  2AKW B;  2Q2I A;  3PV0 A;  1EFW A;  4BBR H;  1TWC H;  4YWL A;  4L5R C;  4XTC S;  3I4N G;  1Q8K A;  1BBU A;  4JI7 Q;  2CCZ A;  1IZ6 A;  3UDF A;  4A3L G;  2CWP A;  1EUJ A;  3UDI A;  1VQB A;  4LFA Q;  3CCE A;  1K3R A;  1FJG L;  5GAH C;  1VCI A;  3L7Z C;  2UUB L;  1MKH A;  5IP9 H;  2H5X A;  4QGU A;  1VS0 A;  3GTM H;  4HJA A;  2F4V L;  3I55 A;  5LMN W;  2YV5 A;  1M1K C;  2PI2 A;  1CSP A;  1VQK A;  2R7D A;  1XMQ L;  1TXY A;  1OTC A;  3TS0 A;  3M3Y H;  3RZO H;  4IPC A;  1V43 A;  4NXN Q;  1TWF H;  4BY7 H;  3T1H Q;  1KAW A;  2PQA A;  2BA0 A;  3AQQ A;  4DV7 L;  3ER0 A;  3NBH B;  3CCS A;  4R1J A;  2ASB A;  5LMU L;  1VQ6 A;  4JYA L;  2Q2T A;  1XNR Q;  1IYJ B;  5GAG C;  3CCR A;  3S1Q H;  4JI2 Q;  2R7Z G;  1VQO A;  1E1O A;  4JBK A;  1SE8 A;  4MZ9 A;  4LUZ A;  2K52 A;  4PZ6 A;  4UP8 A;  4R4C A;  4DR1 L;  1YJW A;  3PO2 G;  1HNW Q;  4LFC Q;  2HQL A;  2VQE Q;  4GNX B;  1GVP A;  2IHF A;  1YI2 A;  4A93 H;  4C2M H;  2YYZ A;  4KHZ A;  4X64 Q;  1E22 A;  3A5Z B;  3PUX A;  4UP9 A;  1GM5 A;  4DR7 Q;  4JBM A;  2Y0S E;  1PA6 A;  3HKZ E;  2NVQ H;  3KF8 B;  2NZO A;  3I4M G;  4GKK Q;  5J3B A;  4LF8 Q;  3UE1 A;  3U4V A;  5M3F H;  1L1O A;  1N33 L;  2JA7 G;  1OXU A;  1UE6 A;  1I94 L;  3PF5 A;  3RLO A;  2OCE A;  1XMO L;  5BR8 Q;  2IX1 A;  1EWI A;  2IHE A;  4DV2 Q;  4OWW B;  1G29 1;  1NMF A;  2NZH A;  1HR0 Q;  1UE7 A;  1KRT A;  2K14 A;  1FGU A;  1Y1V G;  2B29 A;  3GD7 A;  5AJ3 Q;  3CC7 A;  4JI1 Q;  3GTK H;  5IP7 G;  2N49 A;  4DR4 L;  3S2D H;  4YCV A;  2OTJ A;  2K4K A;  3ULJ A;  2R92 G;  3GTG H;  3M4O H;  4B3M L;  4IOA A;  1L0W A;  3FKI H;  4IPG A;  2V1C C;  2K75 A;  5LMN L;  4DV1 Q;  2VQF Q;  4X65 Q;  3AEV A;  3TEH B;  1C7Y A;  1EQQ A;  4H02 A;  3KYH C;  1A62 A;  4A3F H;  3M7N A;  5IP7 H;  4KHP L;  4A3I H;  4DR3 Q;  4HIK A;  1ASZ A;  1ASY A;  1WCM G;  4C3J H;  4GOP A;  4OO1 I;  2JE6 I;  2BH8 A;  1Q1E A;  4IPH A;  1XPR A;  3U50 C;  4LF6 Q;  5K36 G;  5JEA J;  1AE2 A;  2JA8 H;  2R7F A;  5JJL A;  3LGJ A;  4OX9 Q;  1WFQ A;  1PH7 A;  1I3Q H;  3UDX A;  4DR5 L;  4A3C H;  2JA8 G;  5IE8 A;  2WFW A;  4P71 A;  1CKN B;  4GNX C;  2FXQ A;  1X55 A;  3CAM A;  4YY3 Q;  3L0O A;  2JA5 H;  1PYB A;  2BH2 A;  4BY1 H;  2WAQ G;  4JI6 L;  1VQI A;  4Y52 H;  3G48 A;  4IPD A;  3CMA A;  2UUA Q;  1CKO A;  3M4Q A;  5IYB H;  4B3T Q;  4DV0 Q;  1KHI A;  5C0X J;  1JT8 A;  2ZTC A;  3J81 i;  1TWH H;  3JAM i;  1VQC A;  1HZC A;  3BU2 A;  2UU9 L;  3S1M H;  1Q46 A;  1Q81 C;  4DUY L;  2RHQ B;  4BBS G;  2AMC B;  5C44 G;  4K0K Q;  3HOV G;  5FJ8 H;  4FDB A;  3ERS X;  4LUV A;  3J81 c;  3CME A;  3JAM c;  1CKM A;  2QGQ A;  4PZ8 A;  2CFM A;  3AFP A;  2LSS A;  4JI7 L;  3H3V H;  4HID A;  3M85 A;  4PZ7 A;  1DGS A;  1G6P A;  5C4J H;  4QIW E;  2JA6 H;  5M3M H;  3F2D A;  1JJC B;  1YHQ A;  1YBY A;  4DAY B;  3KLW A;  2A19 A;  3TQY A;  1JJ2 A;  4A3D H;  2IY5 B;  4OWT B;  3KF6 A;  1FVI A;  3WWV A;  1KL9 A;  4JG2 A;  4A3G G;  1S40 A;  4POG A;  4JBW A;  4NXN L;  1D8L A;  1K83 H;  1EOV A;  1VQA A;  2OQK A;  4A76 A;  4TVA B;  3T1H L;  3GTP H;  1OXS C;  2ID0 A;  4IJL A;  2L15 A;  5IP9 G;  5IYC H;  4IFD I;  2E5L L;  4QQB X;  1XNR L;  5M5X H;  3S15 H;  2R6G A;  2YTY A;  3UDG A;  4A3G H;  2ZJR A;  2UXB Q;  4BY7 G;  1X54 A;  1HNW L;  2PQA B;  4LFC L;  1E7Z A;  3J7Z C;  2VQE L;  4WJ3 M;  3G6E A;  1PH1 A;  3PCO B;  2YTX A;  4X64 L;  3HOW H;  1SN8 A;  1Y1W H;  4C3H H;  2IX0 A;  4A3E H;  4R4I A;  1Q7Y C;  1YVC A;  4DR7 L;  3DM3 A;  3STB C;  4X66 Q;  1J5E Q;  4GKK L;  3HFZ B;  1WI5 A;  4X62 L;  3KDF A;  4LF8 L;  4LF4 Q;  1K73 C;  3AFQ A;  2UXD L;  3E9H A;  1GD7 A;  1GO3 E;  2KCM A;  4DR2 Q;  2E2I H;  1N32 Q;  2MQH A;  4A93 G;  3E9I A;  4QY7 A;  5BR8 L;  3CF5 A;  4GKJ Q;  5C3E H;  1Q12 A;  3KJP A;  3K80 C;  4DV5 L;  5IYD H;  3W5O A;  1HR0 L;  1XNQ Q;  5M3F G;  1UE5 A;  2MNA A;  1KQS A;  4A3J H;  5AJ3 L;  1IXR A;  4JI1 L;  2WAQ E;  3KOJ A;  5C4X H;  4AYB G;  4JI8 L;  1K8G A;  3NEL A;  2ATW A;  1IBM Q;  5FLM H;  2R93 H;  4JI3 Q;  4DV6 Q;  1V1Q A;  3JC6 6;  3H15 A;  1IBK Q;  4JI4 Q;  3F2C A;  4DV1 L;  1VQP A;  4LNQ A;  3Q8D A;  2VQF L;  4JOI C;  1NJI C;  4X65 L;  1HNZ Q;  2JQO A;  3RN2 A;  4B3R Q;  4IJH A;  3K0X A;  3U4Z A;  2AHO B;  4DR3 L;  3MEF A;  5GAE C;  1J6Q A;  1VQM A;  2NVX H;  3FKI G;  3RLF A;  1YJ9 A;  2NVY H;  1HNX L;  1OXX K;  1XPU A;  3J81 j;  1XPO A;  4OX9 L;  2VS1 A;  1SLJ A;  4POF A;  2WP8 J;  2DGY A;  2MO0 A;  4A3F G;  1E3P A;  4A3I G;  5FLX c;  2Q2U A;  5GAD C;  3NEM A;  4JCV E;  4GOP B;  3PUW A;  3W1B A;  4JV5 Q;  5EAY A;  5IWA Q;  4DAM A;  4LW1 A;  1JE5 A;  4LF5 Q;  4YCW A;  2VUM H;  3OW2 A;  2ZTE A;  3PIO A;  4GNX A;  3F1Z A;  2UUA L;  4A3C G;  2EIF A;  1VQ5 A;  4A75 A;  1XJV A;  4B3T L;  3IRB A;  2PMZ E;  4HIM A;  3ZJY C;  4GN5 A;  2ZM6 Q;  2JA5 G;  4JBJ A;  5JEA G;  4JI5 Q;  4L5T A;  4LWC A;  4BY1 G;  1QVC A;  4ALP A;  2ZTD A;  1YZ6 A;  4A3B H;  4LF7 Q;  3J80 i;  4DR6 Q;  4DV4 Q;  4AQY Q;  1PVO A;  1KD1 C;  1JJG A;  2Z6K C;  2GVA A;  2WB1 G;  3HOU H;  1RL2 A;  3STB D;  2N3S A;  3D0F A;  2KEN A;  5M5W H;  5IYB G;  1Q1B A;  1IBL Q;  4B3S L;  3ICE A;  4YHH Q;  2UUC Q;  3RZD H;  3GDE A;  1X56 A;  2OWO A;  5GQO A;  4DV3 L;  3J80 c;  1PH2 A;  3KJO A;  1PH9 A;  3GTJ H;  2OQ0 A;  1OXT A;  2KHJ A;  3F8T A;  1NE3 A;  2D0P A;  1VQE A;  5FJ8 G;  5C0X G;  1YIJ A;  1JMC A;  4A3M H;  1XMO Q;  4UP7 A;  1VQJ A;  2RCN A;  3RN5 A;  2F3I A;  1NY4 A;  1SMX A;  2F52 A;  2PI2 E;  1UE1 A;  4JI0 Q;  2K5N A;  4WJ4 A;  3OYY A;  2HHH Q;  2JA6 G;  5M3M G;  2E2H H;  2VL6 A;  4GN3 B;  4LFB L;  3T1Y Q;  1N36 Q;  2CQO A;  5C0X I;  4GLX A;  1YHB A;  4A3D G;  1MJE A;  2NN6 G;  2BA1 A;  1M90 C;  1HR0 W;  3HOZ H;  2UXC Q;  4B3M Q;  4DPG A;  3H3V I;  5LMN Q;  4AYB E;  3MXN B;  4HJ7 A;  2UXB L;  4X6A H;  3TRE A;  4LFA L;  2ZJQ A;  3PO3 H;  3F2B A;  3HOX H;  2ZJP A;  1HZ9 A;  5M5Y H;  5IYC G;  3KFU A;  1TWG H;  1QUQ A;  3S1R H;  1I5F A;  4BXX H;  5JJI A;  2KHI A;  3GTQ H;  4LUO A;  1SRO A;  3S1N H;  3ULL A;  1W2B A;  1HZB A;  4PMW A;  4X66 L;  3J7A 5;  3CCV A;  3BJU A;  3PF4 A;  1HH2 P;  2VY3 A;  4LF4 L;  1QZH A;  1VQH A;  2HIX A;  4DR5 Q;  4TQU S;  4MTN A;  2XGT A;  4AH6 A;  3FHW A;  4HIO A;  3VDY A;  1VQL A;  1N32 L;  4GKJ L;  1Z47 A;  3HOW G;  1H95 A;  1Y1W G;  3GTL H;  3A0J A;  4A3E G;  1Q82 C;  4NXM Q;  1EQR A;  4BA1 I;  4JI2 L;  2K5V A;  4JC0 A;  3CCJ A;  5HY6 A;  3H0G H;  2KCT A;  3KDF B;  4P74 A;  1RIP A;  4IOC A;  4P73 A;  2E8G A;  3CW2 C;  1XTD A;  4LF9 Q;  4IFD J;  5IY0 A;  3W1G A;  1C0A A;  1KXL A;  3CCU A;  1IBM L;  5C3E G;  3U58 A;  2VNU D;  4RMF A;  5JJK A;  5DLQ E;  4JI3 L;  1IBK L;  4R4T A;  4JI4 L;  4PG3 A;  3CD6 A;  1O7I A;  5IYD G;  1A63 A;  1AH9 A;  3BZC A;  3PSI A;  5ELO A;  4A3J G;  1HNZ L;  3L2P A;  1VQ4 A;  1VQF A;  1X3E A;  4B3R L;  1PHJ A;  2N78 A;  2GVB A;  1N9W A;  1WJJ A;  1NMG A;  1NTG A;  4DNI A;  5C4X G;  4DUZ Q;  2D0O A;  2JK8 A;  4O0A A;  1B70 B;  5FLM G;  4IO9 A;  2R93 G;  3GTO H;  2XTI A;  3CCL A;  2WB1 E;  4JOI A;  1U5K A;  1VQN A;  1KC8 C;  4Y7N H;  4DV2 L;  1YNX A;  3E0E A;  1PYS B;  3D31 A;  4NPS A;  4A3K H;  1L1O B;  4KI0 A;  1MIU A;  2CKZ B;  4AIM A;  4QL5 A;  3S14 H;  3I4N H;  3OTO Q;  4JV5 L;  1N34 Q;  5IWA L;  4A3L H;  1G51 A;  1K9M C;  1LM0 A;  2RHS B;  2JEB I;  3M9B A;  1VQ9 A;  3SGI A;  1R9T H;  4LF5 L;  1K8A C;  4J15 A;  3HOY G;  1VQG A;  3CPF A;  2E5L Q;  1Y14 B;  3S2H H;  3G4S A;  1PV4 A;  3B6Y A;  1PH8 A;  1FL0 A;  4XIG S;  1S3O A;  3PIP A;  1C9O A;  1BKB A;  4ME3 A;  4GS3 A;  4APV A;  2VW9 A;  2ZM6 L;  1HJP A;  1HZA A;  2AWN A;  3I4O A;  4MNO A;  3DLL A;  1VQ8 A;  4JI5 L;  1N8R C;  5H1S E;  4LF6 L;  1FJG Q;  4DR6 L;  2UUB Q;  4LF7 L;  2I0Q A;  5HGQ A;  2VUM G;  1X3F A;  1B7Y B;  3BZK A;  4DV4 L;  4AQY L;  1W3S A;  2GN5 A;  3RR5 A;  2F4V Q;  1IBL L;  3CC4 A;  3CCQ A;  4YHH L;  1WOC A;  4YY3 L;  1XMQ Q;  4KLK A;  2UUC L;  2R7Z H;  3NEN A;  4X62 Q;  3A5U A;  4A3B G;  2Z6K A;  3HOY H;  2OTL A;  1I6H H;  3PO2 H;  2UXD Q;  4DV7 Q;  3K81 C;  1GKH A;  3S24 A;  4EX5 A;  3G71 A;  2ES2 A;  2NVT H;  3HOU G;  2CWA A;  5LMU Q;  4JYA Q;  1D7Q A;  3CCM A;  4DV0 L;  3CQZ H;  1T9H A;  2B3G A;  2JEA I;  2MO1 A;  1SR3 A;  4DV5 Q;  4JI0 L;  3I4M H;  4YWM A;  2HHH L;  2K5H A;  4DR1 Q;  1E1T A;  3ULP A;  1EIY B;  2JA7 H;  3T1Y L;  3CC2 A;  2QA4 A;  1N36 L;  4K0K L;  3EN2 A;  4A3M G;  4JI8 Q;  1L1O C;  5IT9 c;  5E7N A;  4OO1 G;  2A1A A;  2UXC L;  1AE3 A;  3EIV A;  3AYH B;  4EQ5 A;  3CXC A;  2YTV A;  4O2D A;  4UPA A;  3K7U C;  2I5L X;  3S17 H;  3PGZ A;  2C35 B;  1V9P A;  5GRO A;  1LYL A;  2K50 A;  1YIT A;  1I50 H;  4GN4 B;  1CUK A;  2IT1 A;  1N33 Q;  1L2F A;  1P16 A;  1Y1V H;  3CP0 A;  1I94 Q;  3I7F A;  4P72 A;  1PH4 A;  2E2J H;  3PUZ A;  3UE0 A;  2VZA A;  1X9N A;  1BBW A;  2MFI A;  2YU9 H;  3HOZ G;  1KIX A;  1VQ7 A;  1UWV A;  2R92 H;  2B63 G;  2QEX A;  2D62 A;  1SFO H;  1E24 A;  1X6O A;  4UY8 C;  1IL2 A;  1MJC A;  1HNX Q;  1EIF A;  4QJF A;  4HJ8 A;  3I2Z A;  3HOX G;  3PO3 G;  3A74 A;  2PNH A;  3TS2 A;  4BXX G;  1OXV A;  3PUY A;  1QUQ B;  1Z9F A;  1VQD A;  4DR4 Q;  2JA9 A;  1X3G A;  3K8A A;  1U0L A;  4OON A;  3KF6 B;  4RG1 A;  1WCM H;  3I56 A;  2I5H A;  3HKS A;  1S72 A;  4NXM L;  2RF4 A;  2B63 H;  2ALY B;  4L5Q A;  2Q2H A;  4R4O A;  4C3I H;  1Q86 C;  4GOP C;  4GLV B;  1PH6 A;  3GO5 A;  4HJ5 A;  2N8N A;  4HJ9 A;  1NBW A;  1JB7 A;  4LF9 L;  1PFS A;  1CKN A;  1A8V A;  1KRS A;  2Y0S G;  3HKZ G;  1WYD A;  5ELN A;  4DK3 C;  2KBN A;  3CPW A;  2JJQ A;  2NN6 I;  4KHP Q;  4OWX B;  1BVS A;  1TWA H;  1J5E L;  3TRZ A;  4A4I A;  4P75 A;  3RNU A;  3FP9 A;  3H0G G;  1SRU A;  4R4Q A;  4YCU A;  2DUD A;  1X65 A;  2LXJ A;  3RLN A;  4DR2 L;  1UEB A;  4B3S Q;  4DUZ L;  1QVG A;  2LXK A;  1QVF A;  1QZG A;  1PH3 A;  4NB3 A;  4DV3 Q; 
#chains in the Genus database with same CATH topology
 5CBA E;  3M4P A;  1UAP A;  2OF1 A;  3NSW A;  2AWO A;  2QEJ C;  5ELE A;  3HOV H;  4B9X A;  4OEM B;  3S2H B;  4EQN A;  1K8O A;  3DXJ C;  3VA5 A;  5JOB A;  1N34 L;  2I5M X;  4DV6 L;  3MWY W;  4DK6 C;  4V0B A;  1F9R A;  1DON A;  2PZT A;  3I4N G;  4K5X A;  1BBU A;  5IIF A;  4JI7 Q;  2NUC A;  4ZCK A;  1JCK B;  3UDI A;  3CCE A;  2RSO A;  1MKH A;  1SE2 A;  2H5X A;  1SYB A;  3I55 A;  1R4P B;  2NVT B;  1M1K C;  2PI2 A;  1CSP A;  3DWA A;  1XMQ L;  1LO5 D;  3TS0 A;  1GOZ A;  1V43 A;  3VR4 A;  3T1H Q;  3ER0 A;  1QJO A;  5A2Q E;  4A3B B;  1S5B D;  4JYA L;  1EIG A;  2Q2T A;  1XNR Q;  3MC0 B;  1MD2 D;  2MPM A;  1YNJ C;  1KLG D;  1JE4 A;  1H9K A;  1SE8 A;  4JBK A;  4UP8 A;  2L5T A;  4R4C A;  2R61 A;  1HNW Q;  4ILW A;  2AQ3 B;  4GNX B;  4C2M H;  5KIX A;  3ZYY X;  3PUX A;  4KD4 A;  2K03 A;  2NVQ H;  4LF8 Q;  2RKS A;  1N33 L;  2J4X A;  2OXP A;  2BOS A;  5BR8 Q;  4K5W A;  5J1Z A;  3VR2 A;  5I9P A;  1BO0 A;  1WTX A;  4OWW B;  4I65 A;  1EYD A;  3BDL A;  2IWH A;  3GD7 A;  5AJ3 Q;  5JPM C;  3D4D A;  3S2D H;  2OTJ A;  1V1P A;  4IOA A;  4JK1 C;  4IPG A;  2V1C C;  4JW0 A;  1SNM A;  5COR A;  1C7Y A;  2QDB A;  2A5H A;  1A62 A;  4A3I H;  3E0J A;  3NWS A;  4HIK A;  3URY A;  4C3J H;  4C3I G;  4IPH A;  2B2W A;  3U50 C;  4WRD A;  4PNY A;  1XWE A;  3LGJ A;  1I3Q H;  5D14 A;  2O4X A;  2B2T A;  3CAM A;  3D6C A;  4YY3 Q;  1LT5 D;  2JA5 H;  2BH2 A;  2CQA A;  4BY1 H;  4FXD A;  2F0J A;  4RA8 A;  3WOE A;  2CHB D;  1EY6 A;  3FEW X;  1VMP A;  3S16 B;  4DV0 Q;  2EOT A;  2ZTC A;  4X3S A;  1HZC A;  4BBR B;  3N6R A;  1FYC A;  2RHQ B;  2AMC B;  2PMZ B;  3J81 c;  3RUZ A;  3JAM c;  3A55 A;  4JI7 L;  3ONA B;  1GJX A;  1ZKO A;  2JA6 H;  3F2D A;  1JJC B;  2F0N A;  1W6K A;  4DAY B;  1JJ2 A;  4V19 0;  2IY5 B;  2NN6 H;  3NQT A;  4KKS A;  4A3G G;  1J9O A;  2NWG A;  1K83 H;  4A76 A;  1VQA A;  3T1H L;  4TVA B;  4IJL A;  1B2T A;  4PV1 C;  1IKL A;  1XNR L;  1S5D D;  4IZ8 A;  5T1I A;  1ML0 D;  1VF7 A;  3A56 A;  4BY7 G;  4UDU C;  4K6L A;  5T1G A;  1HNW L;  2R7Z B;  4WJ3 M;  3G6E A;  1PH1 A;  3J7Y W;  3HOW H;  4KY7 A;  1MGS A;  3DM3 A;  1F9Q A;  1J5E Q;  3KDF A;  4LF8 L;  4LF4 Q;  5KND A;  1B1Z A;  4QY7 A;  5BR8 L;  1ICF B;  2LFN A;  2K28 A;  1Q12 A;  3QO2 A;  4A3J H;  5AJ3 L;  2F0V A;  1IXR A;  1O7Y A;  2ATW A;  5FLM H;  4QF4 A;  4JI3 Q;  1TS5 A;  1IBK Q;  3H15 A;  2R92 B;  3Q8D A;  4HMJ A;  4JOI C;  2Z1C A;  4MIU A;  1SFO B;  1HNZ Q;  4IJH A;  1SNO A;  1TII D;  5ISR A;  3CRL C;  1U4R A;  1I4H A;  4ZRZ A;  3RLF A;  4DNR B;  1YJ9 A;  1QG7 A;  3J81 j;  1XPO A;  3BS1 A;  1SLJ A;  2XNA C;  3ITP A;  4POF A;  2DGY A;  2MO0 A;  4CHT B;  1IW7 C;  1B44 D;  2Q2U A;  2B2V C;  5LL6 S;  3NUC A;  1TWH B;  1VMC A;  2VUM H;  3PIO A;  4GNX A;  1O7L A;  3DEP A;  3FMC A;  1XJV A;  4WJW A;  2XRS D;  4UHV A;  2ZM6 Q;  2B2Y A;  2O5I C;  4JI5 Q;  3OMC A;  5KGU A;  1QVC A;  1UNS A;  1Q90 A;  4LF7 Q;  2F0Q A;  3MHB A;  4DV4 Q;  1JJG A;  4IAL A;  2HQE A;  2GVA A;  4S3S A;  1RL2 A;  3STB D;  1E2V A;  2N3S A;  3A8J E;  5M3M B;  2I46 A;  5FLX E;  3KBX A;  3ICE A;  3OHX C;  4RHS A;  1A3U A;  3J80 c;  3KJO A;  1PH9 A;  1I6V C;  3BDC A;  2A6E D;  1VQE A;  1YIJ A;  3BVG A;  4A3M H;  5C4H A;  1LTI D;  1Y8O B;  4OO1 H;  1C8C A;  2PI2 E;  4JI0 Q;  4WJ4 A;  4CJ1 B;  5M3M G;  2E2H H;  1N36 Q;  4GLX A;  4A3D G;  2BDN A;  4R9W A;  1M90 C;  1PRT F;  4DPG A;  1CFM A;  1GXD C;  3PQI A;  1CM9 A;  4AYB E;  5LMN Q;  1HA5 A;  1HZ9 A;  3IL8 A;  5IYC G;  3KFU A;  4OIK A;  3S1R H;  1I5F A;  4OEL B;  5C3X A;  1SRO A;  4KN4 C;  3J7A 5;  3CCV A;  3BJU A;  3PF4 A;  4LF4 L;  1HTL D;  1VQH A;  4AH6 A;  4HIO A;  2HDL A;  3H09 A;  3A0J A;  1Q82 C;  1EQR A;  3FPU B;  2V4D A;  1BDO A;  2K5V A;  3MVV A;  2KCT A;  4P74 A;  4IOC A;  4K8J A;  1XTD A;  1R4Q B;  2NVQ B;  4LF9 Q;  5IY0 A;  2VNU D;  3OMG A;  1HTP A;  4JI3 L;  1IBK L;  4R4T A;  1A63 A;  5IYD G;  3T13 A;  5I6W A;  2DNC A;  3H94 A;  5ELO A;  1HNZ L;  2PCF B;  4DAY A;  2F3V A;  3K5N A;  2N78 A;  1N9W A;  4DN4 M;  4DNI A;  2D0O A;  2JK8 A;  4O0A A;  5J39 A;  4DF7 A;  1MBY A;  3S2D B;  3OWE B;  3DM1 A;  2VB2 X;  1PYS B;  1L1O B;  1BCP D;  1MIU A;  2IL8 A;  4QL5 A;  3S14 H;  3I4N H;  3OTO Q;  1U4P A;  1G51 A;  2K32 A;  4C3J B;  3SEB A;  4LAA A;  5IGF A;  2E5L Q;  3S2H H;  3B6Y A;  3PIP A;  5IGD A;  1AFP A;  5ELF A;  4GS3 A;  3HOU B;  2ZM6 L;  4DK0 A;  4JI5 L;  1FJG Q;  4LF6 L;  4LF7 L;  2JA5 B;  3ND8 A;  3VR3 A;  5HGQ A;  1JOQ A;  3DEO A;  4DV4 L;  3BZK A;  2DJG C;  4Z9C B;  5J22 A;  3W3A A;  4TSS A;  3CCQ A;  2WB1 B;  2BCO A;  3RD4 A;  3NEN A;  1H9S B;  2Z6K A;  5AFW A;  3K81 C;  2ES2 A;  2NVT H;  3HOU G;  5LMU Q;  3CCM A;  2B3G A;  2B39 A;  4JI0 L;  1SJH D;  2F0K A;  1JC7 A;  4DR1 Q;  3ULP A;  2Q8R E;  4O1N A;  1N36 L;  3PO3 B;  2JA6 B;  5M5Y B;  2NYZ D;  3C3L A;  1Y69 U;  4XQQ A;  2PQE A;  1UUP A;  3GTQ B;  4CKC A;  1B9M A;  2C35 B;  1F2Y A;  5GRO A;  4GN4 B;  1L2F A;  1NCV A;  3CP0 A;  1G8Z D;  3PUZ A;  2VZA A;  1BBW A;  2D5D A;  1UWV A;  2LKV A;  4K2L A;  2D62 A;  1MJC A;  1HNX Q;  3PO3 G;  4LMQ D;  4PQX A;  3PUY A;  1LLR D;  2FMC A;  1ONL A;  1VQD A;  4DR4 Q;  3K8A A;  1SSO A;  4C3I H;  4GOP C;  3HOW B;  4KV6 A;  4GLV B;  5L37 A;  1PH6 A;  3GO5 A;  1EU4 A;  4HJ9 A;  3NXW A;  1JB7 A;  4LF9 L;  1W6J A;  2J7Z A;  1KRS A;  1A8V A;  2Y0S G;  3HKZ G;  4DK3 C;  3P7J A;  3CPW A;  2JJQ A;  3VYS A;  1WVL A;  1F77 A;  1RD9 D;  3FP9 A;  5E3F A;  5FO8 B;  3V96 A;  3H3V C;  3RLN A;  1CHP D;  4B3S Q;  1M4V A;  2DJF C;  4A3K B;  2RVL A;  2G9H D;  2A68 D;  1B8A A;  3HZX A;  1XNQ L;  4JI6 Q;  2AUK A;  4DKA C;  4L5S A;  2AUJ D;  2HIV A;  2F0F A;  4BA2 I;  1YEZ A;  1AEX A;  3OTO L;  2M9V A;  2UU9 Q;  1K0R A;  2A8V A;  1GHK A;  2I07 B;  5ELD A;  3S16 H;  4A3K G;  3T51 B;  2SOB A;  2AKW B;  3PV0 A;  1LT3 D;  2EZV A;  1EFW A;  1EEF D;  2RDF A;  3KLS X;  4BBR H;  3Q24 A;  1JWS D;  3SHL A;  2CCZ A;  3S9W A;  5LHY 1;  1HPC A;  1FJG L;  1K3R A;  3L7Z C;  5D3I B;  4X3U A;  4HJA A;  2L4N A;  2K04 A;  2VUM B;  3TP5 A;  2YV5 A;  1H9J A;  2NZ1 D;  1NUC A;  4NXN Q;  1TWF H;  1SND A;  4BY7 H;  3E5S A;  1KAW A;  2BA0 A;  3GV3 A;  2ZXR A;  5FO7 B;  5LMU L;  1PRT B;  1VQ6 A;  1YNN D;  1IYJ B;  1B53 A;  1II3 A;  1ET6 A;  5GAG C;  3HEJ A;  2EYM A;  4JI2 Q;  2F0U A;  3S1Q H;  5E4X A;  4PZ6 A;  1YJW A;  4DR1 L;  2VXW A;  3S17 B;  3QR8 A;  3SVM A;  1GVP A;  1AN8 A;  2YYZ A;  4X64 Q;  1E22 A;  3A5Z B;  2YU9 B;  5CR3 A;  2NZO A;  3MAQ A;  3UE1 A;  3U4V A;  1PFN A;  1L1O A;  1OXU A;  1UE6 A;  3RLO A;  2OCE A;  5ELB A;  2E2H B;  2IX3 A;  2IX1 A;  4DV2 Q;  3HG9 A;  2NZH A;  1HR0 Q;  1UE7 A;  2B63 B;  2TMP A;  3QB3 A;  1ROD A;  4DR4 L;  2QIL A;  4YCV A;  3ULJ A;  2JA8 B;  5C5M A;  1L0W A;  5IT9 L;  4ZUI A;  3K5O A;  1S5C D;  4X65 Q;  3QWN A;  5EKK A;  5C4Z A;  3FRP B;  2RCF A;  4XYO A;  5IP7 H;  3M4Y A;  2XSC A;  4J6H A;  2QDL A;  1ILQ A;  1Q1E A;  5IOC A;  4MN3 A;  5BN5 A;  1PZK D;  2O5J C;  3PIP 3;  3GV6 A;  1TKW B;  2JA8 G;  4P71 A;  2EXZ A;  5C44 B;  2G9D A;  3NE5 B;  1K28 A;  3L0O A;  4NP5 A;  3H91 A;  2WAQ G;  1RHP A;  3IFT A;  3QOL A;  4JI6 L;  1SYD A;  2A74 C;  4ZKB B;  1KDB A;  1HQR D;  3K7A B;  2DN8 A;  2E76 C;  1NR4 A;  1KHI A;  2FFK B;  3J81 i;  1TWH H;  3JAM i;  1XYI A;  1FR3 A;  3TBI B;  2UU9 L;  1B3A A;  5C44 G;  2JYO A;  1QE6 A;  3ERS X;  4FYD A;  2QGQ A;  3D3R A;  4PZ8 A;  2LSS A;  4K14 A;  3S14 B;  3M85 A;  4G57 A;  5CYU A;  3X3N A;  1RJT A;  1TY2 A;  3I4N B;  5M3M H;  2KCC A;  1WTH A;  3KLW A;  1I4Q A;  1HFN A;  3BZD B;  4A3D H;  1WTV A;  2H1E A;  2M00 A;  1FVI A;  3WWV A;  4JG2 A;  4NXN L;  1D8L A;  4KTA A;  2RDH A;  3K58 A;  1X32 A;  4IFD I;  5IYC H;  2L15 A;  4N9P A;  4QQB X;  3NHH A;  2R6G A;  2YTY A;  5A2Q L;  1IYV A;  1SYC A;  2PQA B;  3J7Z C;  5M3F B;  2SNS A;  2BE5 C;  2YTX A;  5CMD A;  5JVH 3;  4X64 L;  1RCV D;  1SN8 A;  1Q7Y C;  3G7L A;  1X3Q A;  4X66 Q;  3HFZ B;  4N8F A;  3KK7 A;  4X62 L;  1K73 C;  4QIW B;  3AFQ A;  2E2I H;  2KCM A;  1I4G A;  2EYL A;  4DR2 Q;  2MQH A;  3E9I A;  3GTK B;  4GKJ Q;  3J7A V;  2KVM A;  4ODG A;  3W2D A;  2B2U C;  5IYD H;  1HR0 L;  5M3F G;  2MNA A;  3FKI B;  1GUO A;  1MSH A;  1EZ6 A;  4FO2 A;  4JI8 L;  4HCE A;  2SDF A;  3QJY A;  4KK7 A;  3WDN A;  1K8M A;  3EJI A;  4LNQ A;  4X65 L;  1WTQ A;  4B3R Q;  1V1O A;  3K0X A;  2RA4 A;  3U4Z A;  5DM7 3;  2EYH A;  1SNP A;  4ZLT F;  1J6Q A;  1VQM A;  4HTH A;  2HDM A;  3FKI G;  3NTH A;  5DNF A;  1E2Z A;  4HN7 A;  1XPU A;  1JR0 D;  4C3I B;  4DV3 Q;  4G7Z C;  2KCN A;  2GA4 B;  3H6M A;  4K5V A;  1EY0 A;  4GOP B;  5EBC A;  5EAY A;  3DWP A;  4B08 A;  5CBE E;  2K5D A;  2F1M A;  4LF5 Q;  2F0H A;  3OW2 A;  2QW7 A;  2HCC A;  1KAB A;  3F1Z A;  4A3C G;  3I90 A;  4KD3 A;  4GN5 A;  1HUN A;  2D9U A;  4L5T A;  4LWC A;  1E2W A;  1WD1 A;  3J80 i;  1PVO A;  4MHE A;  2WII B;  3HOU H;  5E1F A;  5IYB G;  2KEN A;  1Q1B A;  4RKL A;  1XXG A;  2B8F A;  4KY5 A;  1RTN A;  4QB4 A;  3RZD H;  4DV3 L;  2F0T A;  1AW7 A;  3LWU A;  5DAU A;  4UAI A;  1OXT A;  2KHJ A;  4WOR A;  5FJ8 G;  5C0X G;  3K6O A;  4K6D A;  1ZYR D;  1XMO Q;  2KUM A;  1VQJ A;  1EY7 A;  1TU2 B;  1NY4 A;  2F52 A;  3LWE A;  4IUQ A;  2K5N A;  4H44 C;  3OYY A;  4DGZ A;  4A3G B;  2VL6 A;  2BA1 A;  1PTO B;  4B3M Q;  3LX0 A;  3CHB D;  3MXN B;  4X6A H;  3TRE A;  2A6H C;  1IKM A;  3I91 A;  3F2B A;  3PO3 H;  2DNE A;  2ZJP A;  5M5Y H;  2K33 A;  1J8I A;  1TWF B;  1T5E A;  2SEB D;  1CI3 M;  3NQI A;  5EQ0 A;  4BY7 B;  3GTQ H;  3D4R A;  4KJN A;  4LUO A;  1STN A;  4X66 L;  3C1E A;  5EPK A;  4QUF A;  1HH2 P;  3KLR A;  1Z6H A;  2L1B A;  1QZH A;  3BVM A;  1SNC A;  3S1Q B;  2HIX A;  2KOL A;  4TQU S;  4DR5 Q;  1EEI D;  3SK8 A;  4GKJ L;  1Z47 A;  1VF5 C;  4NXM Q;  1I4P A;  1DD2 A;  4JC0 A;  3CCJ A;  5HY6 A;  1U4L A;  1RIP A;  5IOD A;  4DAP A;  1U4M A;  4QCL A;  1QNU A;  4KJO A;  4PG3 A;  1AH9 A;  2L55 A;  3BZC A;  1AZP A;  3G6J B;  4RGN A;  1LAC A;  3L2P A;  1VQF A;  1X3E A;  4B3R L;  2NVY B;  2GVB A;  4FF1 A;  1NMG A;  2CW0 C;  1B70 B;  4RGT A;  2R93 G;  1Q8I A;  2XTI A;  2WB1 E;  3MXU A;  1EYC A;  2HD3 A;  4F8M A;  4A3K H;  2CKZ B;  3VR6 A;  4RGO S;  1RF2 D;  5I2Y A;  1Y8N B;  1F2Z A;  3AU7 A;  1LM0 A;  2JEB I;  4LF5 L;  4IUU A;  4J15 A;  1VQG A;  2MJ8 A;  1PH8 A;  1PV4 A;  4XIG S;  1S3O A;  3EVQ A;  4ME3 A;  1HJP A;  3I4O A;  1HZA A;  1CZW A;  1JWU D;  5M5W B;  5H1S E;  2I0Q A;  2KEC A;  3RR5 A;  2F4V Q;  1QNK A;  2QKI C;  1TVX A;  4ZQ3 A;  4YY3 L;  4KLK A;  3SR1 A;  5FLX L;  2ICE C;  2UXD Q;  3A8I E;  1GKH A;  3S24 A;  2CWA A;  3MA2 B;  4DV0 L;  3CQZ H;  2JEA I;  4M1U B;  4N8X 1;  4RH6 A;  1MHW C;  4DV5 Q;  3HGB A;  2EYF A;  4YWM A;  4I7A A;  3R93 A;  2K5H A;  2FJ2 A;  1G6Z A;  1EWH A;  1SDF A;  5IT9 c;  5E7N A;  3EIV A;  2F0D A;  2PZU A;  2K7V A;  4IUN A;  4A3D B;  3K7U C;  2I5L X;  3S1N B;  3S17 H;  3PGZ A;  1V9P A;  2K50 A;  1CUK A;  4IUP A;  4K2K A;  2E2J H;  3I7F A;  4P72 A;  2C9O A;  1CHQ D;  2YU9 H;  2MFI A;  4IUT A;  1NNX A;  1VQ7 A;  2QEX A;  1IL2 A;  4UY8 C;  1EIF A;  4QJF A;  4HJ8 A;  3I2Z A;  3HOX G;  4BXX G;  2ZT9 C;  3H0G B;  1QUQ B;  5CC4 A;  1X3G A;  4OON A;  4NXM L;  3HKS A;  3V2T A;  2B63 H;  4MTK A;  4X3T A;  2LS0 1;  2B2W C;  1NBW A;  4CGY B;  1ILP A;  1PFS A;  1SE4 A;  2JA8 H;  1HHV A;  5ELN A;  2E2I B;  1BVS A;  2B2T C;  1J5E L;  4P75 A;  3GTO B;  3H0G G;  1EIH A;  2PNR C;  4JVZ A;  4YCU A;  3SXH A;  1UEB A;  2LXK A;  1EY9 A;  3DLL A;  1QZG A;  1QVF A;  3P20 A;  2NB0 A;  3I73 A;  1TY0 A;  2EXD A;  4IFD G;  1JOR A;  1LTL A;  5C44 H;  1F2L A;  1R9T B;  1L0Y B;  1ENF A;  2Z0S A;  1B3Q A;  2EQS A;  1YJN A;  1IHZ A;  3K7A H;  5IGC A;  1LUZ A;  1PH5 A;  2HT1 A;  4OXP A;  1PDQ A;  3J7A F;  4YWK A;  4LFB Q;  1D1I A;  3PUV A;  4GLA C;  1LTA D;  2Q2I A;  4YWL A;  4L5R C;  4XTC S;  1Q8K A;  1ICW A;  1IZ6 A;  3UDF A;  4A3L G;  2CWP A;  2FHT A;  1VQB A;  4LFA Q;  2MGS A;  3R3O A;  2EYO A;  2OEO A;  3GTM H;  2F4V L;  1TS3 A;  3NTI A;  2R7D A;  1D5X C;  1PXU A;  1STE A;  3MXP A;  4IPC A;  4G4K A;  3AQQ A;  3I4M B;  3NBH B;  4R1J A;  3D6W A;  2WKD A;  2JA7 B;  2XWJ B;  2F3W A;  4H7B A;  1C48 A;  4ZKC B;  2KEE A;  1VQO A;  1E1O A;  3HOY G;  2K52 A;  3HP3 A;  3RZD B;  3OW7 A;  3VYR A;  1GUS A;  2HQL A;  4KHZ A;  1PZI D;  1AZQ A;  5KNB A;  4DR7 Q;  5KRU A;  1DOM A;  1GM5 A;  1CQV A;  1PA6 A;  4JBM A;  2A69 D;  3I4M G;  3BG3 A;  5J3B A;  1SE3 A;  5M3F H;  1WTP A;  2JA7 G;  1ET9 A;  1HQM C;  4ABN A;  4HAE A;  2O2L D;  2EY1 A;  3I3C A;  2IHE A;  4TRD A;  3A7A B;  1NMF A;  3BYT B;  1KRT A;  3GTK H;  1FGU A;  3GP7 A;  1FNU A;  3GTG H;  3M4O H;  3FKI H;  3GQB A;  2K75 A;  5LMN L;  1TS4 A;  3AEV A;  1GUT A;  3KYH C;  4RCN A;  4DU9 A;  1CTM A;  2H4O A;  1DOL A;  4DR3 Q;  4DXG A;  1ASZ A;  4NMZ A;  2JE6 I;  2Y0S B;  3HKZ B;  2L9H A;  1Q3L A;  5DEH A;  1AE2 A;  1FNV A;  2R7F A;  5JJL A;  4OX9 Q;  1WFQ A;  1PH7 A;  4XYQ A;  3UDX A;  4A3C H;  1ENC A;  2WFW A;  1CKN B;  2F0I A;  4GNX C;  1FGB D;  2FXQ A;  3NBI A;  2PZW A;  1PYB A;  2QCP X;  2ICI A;  2RBM A;  3Q23 A;  3P1H A;  2B2Y C;  1SYF A;  5C5L A;  3G48 A;  4IPD A;  3CMA A;  2UUA Q;  5IYB H;  1KTK A;  5C0X J;  1JT8 A;  1HCZ A;  3BU2 A;  2J0T D;  4BBS G;  1H9M A;  4K0K Q;  1STB A;  1LTG D;  5FJ8 H;  5C0X H;  1EL0 A;  4FDB A;  4CDD C;  3CME A;  2CH4 W;  1CKM A;  2CFM A;  3AFP A;  3H3V H;  3J81 L;  3DWQ A;  3JAM L;  1DGS A;  1QCB D;  4QIW E;  3RZO B;  4J1M A;  1YHQ A;  1YBY A;  3CU7 A;  2CH4 A;  2A19 A;  1WTO A;  3SK4 A;  3TQY A;  4OWT B;  1KL9 A;  1S40 A;  4POG A;  1S5F D;  2OQK A;  3GTP H;  1H9R A;  2E2D C;  5CV6 A;  1OXS C;  5IP9 G;  2E5L L;  3J81 E;  3JAM E;  1LAB A;  3UDG A;  4A3G H;  4A93 B;  1EQT A;  2EJF C;  2ZJR A;  1STH A;  3PMF A;  1X54 A;  2Q8T A;  4QMG A;  4H0L C;  1E7Z A;  2LMC B;  4HSV A;  2L11 A;  1PTO H;  1WTR A;  3IFD A;  1ESR A;  4DR7 L;  4AYB B;  3STB C;  3CQZ B;  2Z4I A;  4KN7 C;  3DHQ A;  5EPL A;  1GD7 A;  1GO3 E;  5C3W A;  4A93 G;  2A6E C;  3VA7 A;  4P2C B;  1EY8 A;  2BDO A;  1KQS A;  1DZ1 A;  3MTS A;  1B9N A;  4C1N K;  1LTS D;  3QOJ A;  2CVR A;  4AYB G;  3NEL A;  2E2J B;  2R93 H;  3LNN A;  4A3F B;  4DV6 Q;  1V1Q A;  4JI4 Q;  1PTO F;  1O78 A;  5NUC A;  1VQP A;  4LJZ C;  3RN2 A;  2AHO B;  1STY A;  5EGT A;  5COY A;  4DR3 L;  5JPN C;  1V1P B;  4NW2 A;  2NVY H;  3A54 A;  5M9O A;  1HNX L;  1D5Z C;  3SK5 A;  1CQF A;  2VS1 A;  4OX9 L;  3T53 B;  1B50 A;  4RHR A;  2WP8 J;  5JAV A;  4A3F G;  1E3P A;  3WOF A;  5FLX c;  5GAD C;  2F0L A;  1OO9 B;  3PUW A;  3W1B A;  4JV5 Q;  4DAM A;  4FXK C;  3OOC A;  4LW1 A;  4YCW A;  2ZTE A;  2OT2 A;  2WAQ B;  2UUA L;  2NBF A;  2EIF A;  1VQ5 A;  4A75 A;  3IRB A;  2PMZ E;  3ZJY C;  5JEA G;  1D5M C;  1H9S A;  1STA A;  3I70 A;  3KLS A;  4ALP A;  1YZ6 A;  1DOK A;  3P75 A;  2EDG A;  2Z6K C;  5IGE A;  5C4J B;  5M5W H;  1WD0 A;  1IBL Q;  4B3S L;  1KDC A;  1HXY D;  4YHH Q;  2UUC Q;  4QUC A;  1X56 A;  2OWO A;  1GUN A;  3GTJ H;  2OQ0 A;  2E75 C;  3K57 A;  5I2X A;  2D0P A;  2RQX A;  1JMC A;  1MSG A;  2RCN A;  3RN5 A;  2F3I A;  1BCP C;  3AB9 A;  3D8G A;  4I7Z C;  4GN3 B;  3T1Y Q;  2CQO A;  5CV5 A;  1YHB A;  2K05 A;  1O7Z A;  2K6A A;  2UXC Q;  3GTM B;  3J80 E;  4XXE A;  1Y1W B;  4C3H B;  4A3E B;  2ZJQ A;  3HOX H;  2IPK D;  5D65 A;  4EGV A;  4BXX H;  5JJI A;  2KHI A;  1DJR D;  5JVG 3;  3L9A X;  3T56 B;  2KQ3 A;  2TSS A;  3S1N H;  1DYQ A;  1HZB A;  1W2B A;  4FF4 A;  1HUM A;  5C3E B;  1CA6 A;  2KHS A;  1JOK A;  1KNA A;  4R8N A;  2XGT A;  1VQL A;  4YIJ A;  4F88 A;  1Y1W G;  1CK1 A;  3GTL H;  4C3H G;  4A3E G;  1EZ8 A;  4BA1 I;  1ZEQ X;  4JI2 L;  3QG1 A;  3O13 A;  3TME A;  3H0G H;  3KDF B;  5CV4 A;  2PPB C;  4P73 A;  2E8G A;  2F0O A;  3CW2 C;  1PRT D;  4IFD J;  1C0A A;  3W1G A;  1KXL A;  3MZ5 A;  5C3E G;  3U58 A;  5JJK A;  4RMF A;  1MI2 A;  3FVQ A;  5JJZ A;  4JI4 L;  2FMM A;  1O7I A;  2NVX B;  3PSI A;  4IFD H;  1NTG A;  3E6Z X;  5C4X G;  4FP5 D;  4DUZ Q;  4IO9 A;  3GTO H;  1VQN A;  4JOI A;  1ESF A;  1U5K A;  1KC8 C;  4DV2 L;  3GTG B;  3M4O B;  4OGQ C;  1HFG A;  5FOB B;  4KI0 A;  4AIM A;  3HS0 C;  2F0E A;  2HUG A;  4JV5 L;  4A3L H;  2G5D A;  1K9M C;  3SGI A;  1I4X A;  1R9T H;  4HED A;  1K8A C;  1BOS A;  1Y14 B;  3G4S A;  2B2V A;  1QWY A;  1FL0 A;  3TZU A;  3SK6 A;  4GZY C;  1C9O A;  4APV A;  2VW9 A;  1VQ8 A;  2AWN A;  1QB5 D;  1Z7T A;  1NR2 A;  1E0B A;  1PFM A;  2F0M A;  4L8J A;  2XRQ D;  2UUB Q;  1X3F A;  1W3S A;  2GN5 A;  4ZAI A;  1JWM D;  3MEH A;  3VR5 A;  1IBL L;  3CC4 A;  2WAC A;  3NTK A;  4YHH L;  2UUC L;  4RAU C;  5I4D A;  1LTR D;  3A5U A;  2JSO A;  3HOY H;  4A3B G;  2OTL A;  2A68 C;  4DV7 Q;  3T16 A;  4EX5 A;  3G71 A;  3UI2 A;  3MXG A;  2F0P A;  1D7Q A;  5I9O A;  3I72 A;  2MO1 A;  1SR3 A;  3HOZ B;  1M8A A;  3I4M H;  1CZG A;  3C1F A;  1RKN A;  3ND9 A;  1BUV T;  1EIY B;  2JA7 H;  2EVB A;  3T1Y L;  3EN2 A;  1LTB D;  1L1O C;  1KLU D;  1TWG B;  4JPB W;  2UXC L;  1AE3 A;  4EQ5 A;  3AYH B;  3TDQ A;  2YTV A;  4UPA A;  1G2S A;  4XDX A;  1K3B C;  1A6X A;  2Z6B A;  1LYL A;  1TQO A;  1L0X B;  1P16 A;  1U9R A;  1I94 Q;  1PH4 A;  3GTP B;  4IN3 A;  3MFG A;  3UE0 A;  1X9N A;  3HOZ G;  4WFN 3;  1KIX A;  2AQ1 B;  1F2M A;  1E24 A;  1DCZ A;  2R3Z A;  3A74 A;  2PNH A;  5EBD A;  1F9P A;  4RKB A;  4FXG C;  5CV9 A;  2JA9 A;  4RG1 A;  2EYP A;  1U0L A;  3KF6 B;  1S72 A;  3I56 A;  2I5H A;  2F03 A;  3OIQ A;  5KNC A;  1Q86 C;  4RCO A;  1YNN C;  4HJ5 A;  2N8N A;  1SAP A;  2K5W A;  5HUR A;  3VYT A;  2SNM A;  5KYL A;  5EKI A;  3KBG A;  3OPO A;  4KHP Q;  2KBN A;  2NN6 I;  4OWX B;  2XIW A;  2AQ2 B;  3TRZ A;  3OWF A;  4A4I A;  1RDP D;  2IW3 A;  4R4Q A;  3MFY A;  2X6L A;  4Y7N B;  1DXM A;  2DUD A;  2LXJ A;  4DR2 L;  4CJ0 B;  2HCI A;  4DUZ L;  1EY4 A;  4NB3 A;  1PH3 A;  3OIP A;  2R93 B;  2EPB A;  1BBX C;  2ENB A;  5ELC A;  4BBS H;  3I4L A;  3I8Z A;  2ZXP A;  1P8L A;  3ERQ A;  4BBR G;  3Q0A A;  2L12 A;  1BR9 A;  1CSQ A;  4RGM A;  5IGG A;  1RTO A;  5FKA C;  1SMY D;  1A0I A;  1EYG A;  1YHA A;  1EOT A;  4DUY Q;  2KA7 A;  3EBE A;  2JXM B;  5CV7 A;  3K5M A;  4HR7 B;  3HRZ C;  1I4R A;  1JB3 A;  1X3P A;  1TWC H;  5CV8 A;  4ULL A;  1A15 A;  1EUJ A;  1SJE D;  5G3L F;  5GAH C;  1VCI A;  2UUB L;  1WTW A;  3E3X A;  1C4Q A;  1QIL A;  5IP9 H;  3C2P A;  4QGU A;  2EY5 A;  1VS0 A;  3SE0 A;  5BN4 A;  1I6H B;  3PO2 B;  2L0C A;  5LMN W;  1VQK A;  4CBV A;  1TXY A;  1OTC A;  3M3Y H;  3EA6 A;  3RZO H;  4IQZ A;  4J8Q A;  1SYG A;  4CKB A;  2EY6 A;  2Z8L A;  2PQA A;  4DV7 L;  5FK9 C;  3CCS A;  2ASB A;  2E74 C;  3DUZ A;  2F4I A;  3TP8 A;  4C56 C;  3BVZ A;  2N55 A;  5EJW A;  3CCR A;  1GHJ A;  1O80 A;  2R7Z G;  4MZ9 A;  4LUZ A;  3IAY A;  3PO2 G;  3SDZ A;  4LFC Q;  2DY7 A;  1SXT A;  1KAA A;  2VQE Q;  3GTJ B;  1I50 B;  2IHF A;  1YI2 A;  4A93 H;  1Y1V B;  2F0S A;  3L3O C;  4UP9 A;  1NSN S;  2Y0S E;  3HKZ E;  4GKK Q;  3KF8 B;  1GUG A;  1I94 L;  3PF5 A;  1XMO L;  1BCP B;  4R8I A;  1A3T A;  1TS2 A;  4NKL A;  1EWI A;  3BDO A;  1G29 1;  1WCM B;  3TZD A;  4RFB A;  2K5Q A;  2K14 A;  3CC7 A;  1Y1V G;  2B29 A;  4JI1 Q;  4M8A A;  1CT1 D;  5IP7 G;  2N49 A;  4K8I A;  3HOX B;  2K4K A;  2R92 G;  4B3M L;  4DV1 Q;  2VQF Q;  3TEH B;  1TWA B;  1EQQ A;  4H02 A;  4A3F H;  1PTO D;  3M7N A;  4KHP L;  1LT4 D;  3OSO A;  3R2I A;  4FNF A;  1PRT C;  1DM0 B;  1WCM G;  4E6I A;  4O42 A;  3TN2 A;  4GOP A;  1ASY A;  4OO1 I;  2BH8 A;  1XPR A;  4LF6 Q;  5K36 G;  3GTL B;  5JEA J;  4U67 3;  2C5C A;  5EKL A;  3IKJ A;  4DR5 L;  2Z9H A;  5IE8 A;  1X55 A;  2D2C C;  2XWB B;  3HOV B;  4LK1 C;  5JEA H;  3DMU A;  4C1N I;  1VQI A;  1QOH A;  1S5E D;  2XVS A;  4Y52 H;  1EU3 A;  4Q0F A;  3K59 A;  2MUY A;  1CKO A;  3T4A C;  3M4Q A;  4B3T Q;  3R2T A;  1AP0 A;  1VQC A;  3FPP A;  4L63 B;  4B9W A;  4ZK9 B;  3S1M H;  5I6Y A;  2WIN B;  3QIA A;  1Q46 A;  1Q81 C;  4DUY L;  5HGT A;  3HOV G;  1A3V A;  4LUV A;  1XX8 A;  4EVO A;  4HID A;  4PZ7 A;  1HRJ A;  1G6P A;  5C4J H;  4H13 C;  3TSS A;  3VYU A;  1JQY D;  2B8G A;  2RSN A;  4HSP A;  3KF6 A;  1G91 A;  3M7G A;  2WV6 D;  3X3M A;  2EJG C;  4JBW A;  3MXN A;  1EOV A;  4KMU C;  3C46 A;  1PFB A;  2ID0 A;  4CDC C;  2F0W A;  5M5X H;  3S15 H;  1F9S A;  1NAP A;  4C2M B;  1EY5 A;  2UXB Q;  5A35 A;  3TP6 A;  4LFC L;  2VQE L;  2K1B A;  3HOY B;  1KNE A;  4ME5 A;  4DXF A;  3PCO B;  1Y1W H;  4PMC A;  1SYE A;  4C3H H;  2IX0 A;  3Q22 A;  3D4W A;  4R4I A;  1YVC A;  4A3E H;  4GKK L;  2EY2 A;  1WI5 A;  2N88 A;  4BS9 A;  2UXD L;  3E9H A;  1N32 Q;  3CF5 A;  5C3E H;  1PYW D;  1ZYR C;  5F2D A;  3KJP A;  3K80 C;  4DV5 L;  3W5O A;  1XNQ Q;  1UE5 A;  3NWT A;  1V8Q A;  1ENA A;  4JI1 L;  2WAQ E;  4CDE C;  3KOJ A;  5C4X H;  1K8G A;  1IBM Q;  2WKC A;  1FD7 D;  1ZXT A;  2Q8I B;  3JC6 6;  4A3I B;  3F2C A;  3EFX D;  4DV1 L;  2VQF L;  1NJI C;  2EJM A;  2JQO A;  5KEE A;  2Z4H A;  3EQL C;  4RWS C;  4DNT B;  1I3Q B;  3MEF A;  5GAE C;  2NVX H;  2PYK A;  2XN9 C;  4F7X A;  1OXX K;  5BN3 A;  4BY1 B;  2LY7 A;  5CGK A;  1IL8 A;  4PMB A;  2K01 A;  4A3I G;  3NEM A;  4C3J G;  4JCV E;  3CRK C;  3F2U A;  5IWA Q;  4EQP A;  4ZUJ A;  1GUW A;  1JE5 A;  1A2T A;  1EFI D;  4B3T L;  5D3D A;  4HIM A;  2FIN B;  2JA5 G;  4JBJ A;  3KF8 A;  4BY1 G;  4BWG B;  2ZTD A;  1SMY C;  4FF3 A;  4A3B H;  4DR6 Q;  2BE5 D;  2F0G A;  2X69 A;  4AQY Q;  1KD1 C;  2WB1 G;  1BNZ A;  3NP8 A;  3D0F A;  2MP1 A;  4BBS B;  2QF7 A;  1Y8P B;  3GDE A;  3KUP A;  1EQV A;  5GQO A;  1A2U A;  1PH2 A;  3CKI B;  1SNQ A;  3ERO A;  3F8T A;  1NE3 A;  1K83 B;  4KY6 A;  1PMR A;  1EWC A;  4UP7 A;  1YNJ D;  4IUV A;  4OL7 A;  1SMX A;  4OIJ A;  1UE1 A;  4FF2 A;  1TWC B;  3K0Y A;  2HHH Q;  2JA6 G;  4LFB L;  5C0X I;  1MJE A;  2NN6 G;  3HOZ H;  1HR0 W;  3H3V I;  2X6G A;  4HJ7 A;  2UXB L;  4LFA L;  1SEB D;  2PO4 A;  3M3Y B;  1TWG H;  1QUQ A;  4XT1 B;  3ULL A;  4PMW A;  3PIO 3;  4G7O C;  2VY3 A;  1TR5 A;  3TP7 A;  4MTN A;  1N32 L;  3FHW A;  3VDY A;  4A3J B;  4OHJ A;  4CKE A;  3HOW G;  1H95 A;  2EYJ A;  1HA6 A;  3K5L A;  4TKO B;  4L6T B;  4XQN A;  4HCS A;  4DK1 A;  5IGB A;  2P5Z X;  4KHV A;  3CCU A;  2B2U A;  1IBM L;  3U9O A;  5DLQ E;  4IUR A;  3CD6 A;  5C6A A;  2A73 B;  4A3J G;  1XTC D;  5EPJ A;  1VQ4 A;  1LT6 D;  1EYA A;  1PHJ A;  1WJJ A;  5KYI A;  4EQO A;  5FLM G;  3CCL A;  1PTO C;  4Y7N H;  4XQJ A;  1YNX A;  3E0E A;  3D31 A;  3A8K E;  4NPS A;  1BF4 A;  4F87 A;  4XT3 B;  2IJ0 A;  1N34 Q;  1PZJ D;  5IWA L;  2RHS B;  5E4W C;  1VQ9 A;  3M9B A;  1UEA B;  1KDA A;  2KED A;  1FNW A;  2ZXO A;  3BYY B;  1D2B A;  3CPF A;  2DY8 A;  4DFA A;  1JIC A;  1BQQ T;  4HMI A;  2A6H D;  1BKB A;  3RMH A;  4MNO A;  1N8R C;  4G7H C;  4DR6 L;  2VUM G;  1B7Y B;  4AQY L;  3NBH A;  5FO9 B;  2NTS A;  4KKU A;  1LTT D;  5G3L D;  4CJ2 C;  1WOC A;  4A3M B;  4N9T A;  1XMQ Q;  3AMU A;  1G2T A;  2R7Z H;  4X62 Q;  1BXT A;  1JOO A;  2EE1 A;  1I6H H;  3PO2 H;  3S1M B;  3U9S A;  4FVM A;  4DA2 A;  1PLF A;  4JYA Q;  1T9H A;  3NK9 A;  3Q6S A;  2PW5 A;  4ZYS A;  4Q5V A;  4CDF C;  1STG A;  2KJX A;  2HHH L;  1E1T A;  2JP1 A;  3CC2 A;  2QA4 A;  4K0K L;  4A3M G;  4JI8 Q;  3S1R B;  4OO1 G;  2A1A A;  2MHV A;  3NPP A;  5LL6 X;  3CXC A;  4O2D A;  1S4Z A;  1D1K A;  2CW0 D;  2M2L A;  1YIT A;  1I50 H;  2IT1 A;  5DM6 3;  1Y1V H;  1B4O A;  1N33 Q;  3J80 L;  2JN4 A;  4NDX A;  2R92 H;  4KKT A;  2B63 G;  3V05 A;  1SFO H;  1X6O A;  5M5X B;  3S15 B;  3A7L A;  3TS2 A;  4ID6 A;  1OXV A;  1T5X D;  1Z9F A;  5IT9 E;  4X3K A;  1WCM H;  5K5P A;  2RF4 A;  5TSS A;  2ALY B;  4L5Q A;  3R8B A;  2Q2H A;  2NTT A;  2PW7 A;  4R4O A;  1IYU A;  5K36 H;  4DAV A;  2VB3 X;  1CA5 A;  1K0S A;  2RDG A;  1CKN A;  1WYD A;  1LV9 A;  1TWA H;  1D6E C;  3RNU A;  1TT2 A;  1SRU A;  1IW7 D;  2A69 C;  1X65 A;  3FDT A;  4U68 A;  3N52 A;  1QVG A;  1BCP F;  1VDZ A;  5C4X B;  1SBB B; 
#chains in the Genus database with same CATH homology
 1B8A A;  3M4P A;  1XNQ L;  4JI6 Q;  2EXD A;  4IFD G;  4DKA C;  4BBS H;  2AWO A;  4L5S A;  1LTL A;  5C44 H;  2HIV A;  3HOV H;  1P8L A;  4BA2 I;  4BBR G;  1CSQ A;  1YEZ A;  2Z0S A;  3OTO L;  2EQS A;  1N34 L;  1YJN A;  2I5M X;  4DV6 L;  2UU9 Q;  1A0I A;  1K0R A;  3K7A H;  1PH5 A;  1LUZ A;  1EYG A;  2A8V A;  1YHA A;  4OXP A;  4DK6 C;  4DUY Q;  2HT1 A;  3EBE A;  4YWK A;  3S16 H;  4LFB Q;  3PUV A;  4GLA C;  4A3K G;  2AKW B;  2Q2I A;  3PV0 A;  1EFW A;  4BBR H;  1TWC H;  4YWL A;  4L5R C;  4XTC S;  3I4N G;  1Q8K A;  1BBU A;  4JI7 Q;  2CCZ A;  1IZ6 A;  3UDF A;  4A3L G;  2CWP A;  1EUJ A;  3UDI A;  1VQB A;  4LFA Q;  3CCE A;  1K3R A;  1FJG L;  5GAH C;  1VCI A;  3L7Z C;  2UUB L;  1MKH A;  5IP9 H;  2H5X A;  4QGU A;  1VS0 A;  3GTM H;  4HJA A;  2F4V L;  3I55 A;  5LMN W;  2YV5 A;  1M1K C;  2PI2 A;  1CSP A;  1VQK A;  2R7D A;  1XMQ L;  1TXY A;  1OTC A;  3TS0 A;  3M3Y H;  3RZO H;  4IPC A;  1V43 A;  4NXN Q;  1TWF H;  4BY7 H;  3T1H Q;  1KAW A;  2PQA A;  2BA0 A;  3AQQ A;  4DV7 L;  3ER0 A;  3NBH B;  3CCS A;  4R1J A;  2ASB A;  5LMU L;  1VQ6 A;  4JYA L;  2Q2T A;  1XNR Q;  1IYJ B;  5GAG C;  3CCR A;  3S1Q H;  4JI2 Q;  2R7Z G;  1VQO A;  1E1O A;  4JBK A;  1SE8 A;  4MZ9 A;  4LUZ A;  2K52 A;  4PZ6 A;  4UP8 A;  4R4C A;  4DR1 L;  1YJW A;  3PO2 G;  1HNW Q;  4LFC Q;  2HQL A;  2VQE Q;  4GNX B;  1GVP A;  2IHF A;  1YI2 A;  4A93 H;  4C2M H;  2YYZ A;  4KHZ A;  4X64 Q;  1E22 A;  3A5Z B;  3PUX A;  4UP9 A;  1GM5 A;  4DR7 Q;  4JBM A;  2Y0S E;  1PA6 A;  3HKZ E;  2NVQ H;  3KF8 B;  2NZO A;  3I4M G;  4GKK Q;  5J3B A;  4LF8 Q;  3UE1 A;  3U4V A;  5M3F H;  1L1O A;  1N33 L;  2JA7 G;  1OXU A;  1UE6 A;  1I94 L;  3PF5 A;  3RLO A;  2OCE A;  1XMO L;  5BR8 Q;  2IX1 A;  1EWI A;  2IHE A;  4DV2 Q;  4OWW B;  1G29 1;  1NMF A;  2NZH A;  1HR0 Q;  1UE7 A;  1KRT A;  2K14 A;  1FGU A;  1Y1V G;  2B29 A;  3GD7 A;  5AJ3 Q;  3CC7 A;  4JI1 Q;  3GTK H;  5IP7 G;  2N49 A;  4DR4 L;  3S2D H;  4YCV A;  2OTJ A;  2K4K A;  3ULJ A;  2R92 G;  3GTG H;  3M4O H;  4B3M L;  4IOA A;  1L0W A;  3FKI H;  4IPG A;  2V1C C;  2K75 A;  5LMN L;  4DV1 Q;  2VQF Q;  4X65 Q;  3AEV A;  3TEH B;  1C7Y A;  1EQQ A;  4H02 A;  3KYH C;  1A62 A;  4A3F H;  3M7N A;  5IP7 H;  4KHP L;  4A3I H;  4DR3 Q;  4HIK A;  1ASZ A;  1ASY A;  1WCM G;  4C3J H;  4GOP A;  4OO1 I;  2JE6 I;  2BH8 A;  1Q1E A;  4IPH A;  1XPR A;  3U50 C;  4LF6 Q;  5K36 G;  5JEA J;  1AE2 A;  2JA8 H;  2R7F A;  5JJL A;  3LGJ A;  4OX9 Q;  1WFQ A;  1PH7 A;  1I3Q H;  3UDX A;  4DR5 L;  4A3C H;  2JA8 G;  5IE8 A;  2WFW A;  4P71 A;  1CKN B;  4GNX C;  2FXQ A;  1X55 A;  3CAM A;  4YY3 Q;  3L0O A;  2JA5 H;  1PYB A;  2BH2 A;  4BY1 H;  2WAQ G;  4JI6 L;  1VQI A;  4Y52 H;  3G48 A;  4IPD A;  3CMA A;  2UUA Q;  1CKO A;  3M4Q A;  5IYB H;  4B3T Q;  4DV0 Q;  1KHI A;  5C0X J;  1JT8 A;  2ZTC A;  3J81 i;  1TWH H;  3JAM i;  1VQC A;  1HZC A;  3BU2 A;  2UU9 L;  3S1M H;  1Q46 A;  1Q81 C;  4DUY L;  2RHQ B;  4BBS G;  2AMC B;  5C44 G;  4K0K Q;  3HOV G;  5FJ8 H;  4FDB A;  3ERS X;  4LUV A;  3J81 c;  3CME A;  3JAM c;  1CKM A;  2QGQ A;  4PZ8 A;  2CFM A;  3AFP A;  2LSS A;  4JI7 L;  3H3V H;  4HID A;  3M85 A;  4PZ7 A;  1DGS A;  1G6P A;  5C4J H;  4QIW E;  2JA6 H;  5M3M H;  3F2D A;  1JJC B;  1YHQ A;  1YBY A;  4DAY B;  3KLW A;  2A19 A;  3TQY A;  1JJ2 A;  4A3D H;  2IY5 B;  4OWT B;  3KF6 A;  1FVI A;  3WWV A;  1KL9 A;  4JG2 A;  4A3G G;  1S40 A;  4POG A;  4JBW A;  4NXN L;  1D8L A;  1K83 H;  1EOV A;  1VQA A;  2OQK A;  4A76 A;  4TVA B;  3T1H L;  3GTP H;  1OXS C;  2ID0 A;  4IJL A;  2L15 A;  5IP9 G;  5IYC H;  4IFD I;  2E5L L;  4QQB X;  1XNR L;  5M5X H;  3S15 H;  2R6G A;  2YTY A;  3UDG A;  4A3G H;  2ZJR A;  2UXB Q;  4BY7 G;  1X54 A;  1HNW L;  2PQA B;  4LFC L;  1E7Z A;  3J7Z C;  2VQE L;  4WJ3 M;  3G6E A;  1PH1 A;  3PCO B;  2YTX A;  4X64 L;  3HOW H;  1SN8 A;  1Y1W H;  4C3H H;  2IX0 A;  4A3E H;  4R4I A;  1Q7Y C;  1YVC A;  4DR7 L;  3DM3 A;  3STB C;  4X66 Q;  1J5E Q;  4GKK L;  3HFZ B;  1WI5 A;  4X62 L;  3KDF A;  4LF8 L;  4LF4 Q;  1K73 C;  3AFQ A;  2UXD L;  3E9H A;  1GD7 A;  1GO3 E;  2KCM A;  4DR2 Q;  2E2I H;  1N32 Q;  2MQH A;  4A93 G;  3E9I A;  4QY7 A;  5BR8 L;  3CF5 A;  4GKJ Q;  5C3E H;  1Q12 A;  3KJP A;  3K80 C;  4DV5 L;  5IYD H;  3W5O A;  1HR0 L;  1XNQ Q;  5M3F G;  1UE5 A;  2MNA A;  1KQS A;  4A3J H;  5AJ3 L;  1IXR A;  4JI1 L;  2WAQ E;  3KOJ A;  5C4X H;  4AYB G;  4JI8 L;  1K8G A;  3NEL A;  2ATW A;  1IBM Q;  5FLM H;  2R93 H;  4JI3 Q;  4DV6 Q;  1V1Q A;  3JC6 6;  3H15 A;  1IBK Q;  4JI4 Q;  3F2C A;  4DV1 L;  1VQP A;  4LNQ A;  3Q8D A;  2VQF L;  4JOI C;  1NJI C;  4X65 L;  1HNZ Q;  2JQO A;  3RN2 A;  4B3R Q;  4IJH A;  3K0X A;  3U4Z A;  2AHO B;  4DR3 L;  3MEF A;  5GAE C;  1J6Q A;  1VQM A;  2NVX H;  3FKI G;  3RLF A;  1YJ9 A;  2NVY H;  1HNX L;  1OXX K;  1XPU A;  3J81 j;  1XPO A;  4OX9 L;  2VS1 A;  1SLJ A;  4POF A;  2WP8 J;  2DGY A;  2MO0 A;  4A3F G;  1E3P A;  4A3I G;  5FLX c;  2Q2U A;  5GAD C;  3NEM A;  4JCV E;  4GOP B;  3PUW A;  3W1B A;  4JV5 Q;  5EAY A;  5IWA Q;  4DAM A;  4LW1 A;  1JE5 A;  4LF5 Q;  4YCW A;  2VUM H;  3OW2 A;  2ZTE A;  3PIO A;  4GNX A;  3F1Z A;  2UUA L;  4A3C G;  2EIF A;  1VQ5 A;  4A75 A;  1XJV A;  4B3T L;  3IRB A;  2PMZ E;  4HIM A;  3ZJY C;  4GN5 A;  2ZM6 Q;  2JA5 G;  4JBJ A;  5JEA G;  4JI5 Q;  4L5T A;  4LWC A;  4BY1 G;  1QVC A;  4ALP A;  2ZTD A;  1YZ6 A;  4A3B H;  4LF7 Q;  3J80 i;  4DR6 Q;  4DV4 Q;  4AQY Q;  1PVO A;  1KD1 C;  1JJG A;  2Z6K C;  2GVA A;  2WB1 G;  3HOU H;  1RL2 A;  3STB D;  2N3S A;  3D0F A;  2KEN A;  5M5W H;  5IYB G;  1Q1B A;  1IBL Q;  4B3S L;  3ICE A;  4YHH Q;  2UUC Q;  3RZD H;  3GDE A;  1X56 A;  2OWO A;  5GQO A;  4DV3 L;  3J80 c;  1PH2 A;  3KJO A;  1PH9 A;  3GTJ H;  2OQ0 A;  1OXT A;  2KHJ A;  3F8T A;  1NE3 A;  2D0P A;  1VQE A;  5FJ8 G;  5C0X G;  1YIJ A;  1JMC A;  4A3M H;  1XMO Q;  4UP7 A;  1VQJ A;  2RCN A;  3RN5 A;  2F3I A;  1NY4 A;  1SMX A;  2F52 A;  2PI2 E;  1UE1 A;  4JI0 Q;  2K5N A;  4WJ4 A;  3OYY A;  2HHH Q;  2JA6 G;  5M3M G;  2E2H H;  2VL6 A;  4GN3 B;  4LFB L;  3T1Y Q;  1N36 Q;  2CQO A;  5C0X I;  4GLX A;  1YHB A;  4A3D G;  1MJE A;  2NN6 G;  2BA1 A;  1M90 C;  1HR0 W;  3HOZ H;  2UXC Q;  4B3M Q;  4DPG A;  3H3V I;  5LMN Q;  4AYB E;  3MXN B;  4HJ7 A;  2UXB L;  4X6A H;  3TRE A;  4LFA L;  2ZJQ A;  3PO3 H;  3F2B A;  3HOX H;  2ZJP A;  1HZ9 A;  5M5Y H;  5IYC G;  3KFU A;  1TWG H;  1QUQ A;  3S1R H;  1I5F A;  4BXX H;  5JJI A;  2KHI A;  3GTQ H;  4LUO A;  1SRO A;  3S1N H;  3ULL A;  1W2B A;  1HZB A;  4PMW A;  4X66 L;  3J7A 5;  3CCV A;  3BJU A;  3PF4 A;  1HH2 P;  2VY3 A;  4LF4 L;  1QZH A;  1VQH A;  2HIX A;  4DR5 Q;  4TQU S;  4MTN A;  2XGT A;  4AH6 A;  3FHW A;  4HIO A;  3VDY A;  1VQL A;  1N32 L;  4GKJ L;  1Z47 A;  3HOW G;  1H95 A;  1Y1W G;  3GTL H;  3A0J A;  4A3E G;  1Q82 C;  4NXM Q;  1EQR A;  4BA1 I;  4JI2 L;  2K5V A;  4JC0 A;  3CCJ A;  5HY6 A;  3H0G H;  2KCT A;  3KDF B;  4P74 A;  1RIP A;  4IOC A;  4P73 A;  2E8G A;  3CW2 C;  1XTD A;  4LF9 Q;  4IFD J;  5IY0 A;  3W1G A;  1C0A A;  1KXL A;  3CCU A;  1IBM L;  5C3E G;  3U58 A;  2VNU D;  4RMF A;  5JJK A;  5DLQ E;  4JI3 L;  1IBK L;  4R4T A;  4JI4 L;  4PG3 A;  3CD6 A;  1O7I A;  5IYD G;  1A63 A;  1AH9 A;  3BZC A;  3PSI A;  5ELO A;  4A3J G;  1HNZ L;  3L2P A;  1VQ4 A;  1VQF A;  1X3E A;  4B3R L;  1PHJ A;  2N78 A;  2GVB A;  1N9W A;  1WJJ A;  1NMG A;  1NTG A;  4DNI A;  5C4X G;  4DUZ Q;  2D0O A;  2JK8 A;  4O0A A;  1B70 B;  5FLM G;  4IO9 A;  2R93 G;  3GTO H;  2XTI A;  3CCL A;  2WB1 E;  4JOI A;  1U5K A;  1VQN A;  1KC8 C;  4Y7N H;  4DV2 L;  1YNX A;  3E0E A;  1PYS B;  3D31 A;  4NPS A;  4A3K H;  1L1O B;  4KI0 A;  1MIU A;  2CKZ B;  4AIM A;  4QL5 A;  3S14 H;  3I4N H;  3OTO Q;  4JV5 L;  1N34 Q;  5IWA L;  4A3L H;  1G51 A;  1K9M C;  1LM0 A;  2RHS B;  2JEB I;  3M9B A;  1VQ9 A;  3SGI A;  1R9T H;  4LF5 L;  1K8A C;  4J15 A;  3HOY G;  1VQG A;  3CPF A;  2E5L Q;  1Y14 B;  3S2H H;  3G4S A;  1PV4 A;  3B6Y A;  1PH8 A;  1FL0 A;  4XIG S;  1S3O A;  3PIP A;  1C9O A;  1BKB A;  4ME3 A;  4GS3 A;  4APV A;  2VW9 A;  2ZM6 L;  1HJP A;  1HZA A;  2AWN A;  3I4O A;  4MNO A;  3DLL A;  1VQ8 A;  4JI5 L;  1N8R C;  5H1S E;  4LF6 L;  1FJG Q;  4DR6 L;  2UUB Q;  4LF7 L;  2I0Q A;  5HGQ A;  2VUM G;  1X3F A;  1B7Y B;  3BZK A;  4DV4 L;  4AQY L;  1W3S A;  2GN5 A;  3RR5 A;  2F4V Q;  1IBL L;  3CC4 A;  3CCQ A;  4YHH L;  1WOC A;  4YY3 L;  1XMQ Q;  4KLK A;  2UUC L;  2R7Z H;  3NEN A;  4X62 Q;  3A5U A;  4A3B G;  2Z6K A;  3HOY H;  2OTL A;  1I6H H;  3PO2 H;  2UXD Q;  4DV7 Q;  3K81 C;  1GKH A;  3S24 A;  4EX5 A;  3G71 A;  2ES2 A;  2NVT H;  3HOU G;  2CWA A;  5LMU Q;  4JYA Q;  1D7Q A;  3CCM A;  4DV0 L;  3CQZ H;  1T9H A;  2B3G A;  2JEA I;  2MO1 A;  1SR3 A;  4DV5 Q;  4JI0 L;  3I4M H;  4YWM A;  2HHH L;  2K5H A;  4DR1 Q;  1E1T A;  3ULP A;  1EIY B;  2JA7 H;  3T1Y L;  3CC2 A;  2QA4 A;  1N36 L;  4K0K L;  3EN2 A;  4A3M G;  4JI8 Q;  1L1O C;  5IT9 c;  5E7N A;  4OO1 G;  2A1A A;  2UXC L;  1AE3 A;  3EIV A;  3AYH B;  4EQ5 A;  3CXC A;  2YTV A;  4O2D A;  4UPA A;  3K7U C;  2I5L X;  3S17 H;  3PGZ A;  2C35 B;  1V9P A;  5GRO A;  1LYL A;  2K50 A;  1YIT A;  1I50 H;  4GN4 B;  1CUK A;  2IT1 A;  1N33 Q;  1L2F A;  1P16 A;  1Y1V H;  3CP0 A;  1I94 Q;  3I7F A;  4P72 A;  1PH4 A;  2E2J H;  3PUZ A;  3UE0 A;  2VZA A;  1X9N A;  1BBW A;  2MFI A;  2YU9 H;  3HOZ G;  1KIX A;  1VQ7 A;  1UWV A;  2R92 H;  2B63 G;  2QEX A;  2D62 A;  1SFO H;  1E24 A;  1X6O A;  4UY8 C;  1IL2 A;  1MJC A;  1HNX Q;  1EIF A;  4QJF A;  4HJ8 A;  3I2Z A;  3HOX G;  3PO3 G;  3A74 A;  2PNH A;  3TS2 A;  4BXX G;  1OXV A;  3PUY A;  1QUQ B;  1Z9F A;  1VQD A;  4DR4 Q;  2JA9 A;  1X3G A;  3K8A A;  1U0L A;  4OON A;  3KF6 B;  4RG1 A;  1WCM H;  3I56 A;  2I5H A;  3HKS A;  1S72 A;  4NXM L;  2RF4 A;  2B63 H;  2ALY B;  4L5Q A;  2Q2H A;  4R4O A;  4C3I H;  1Q86 C;  4GOP C;  4GLV B;  1PH6 A;  3GO5 A;  4HJ5 A;  2N8N A;  4HJ9 A;  1NBW A;  1JB7 A;  4LF9 L;  1PFS A;  1CKN A;  1A8V A;  1KRS A;  2Y0S G;  3HKZ G;  1WYD A;  5ELN A;  4DK3 C;  2KBN A;  3CPW A;  2JJQ A;  2NN6 I;  4KHP Q;  4OWX B;  1BVS A;  1TWA H;  1J5E L;  3TRZ A;  4A4I A;  4P75 A;  3RNU A;  3FP9 A;  3H0G G;  1SRU A;  4R4Q A;  4YCU A;  2DUD A;  1X65 A;  2LXJ A;  3RLN A;  4DR2 L;  1UEB A;  4B3S Q;  4DUZ L;  1QVG A;  2LXK A;  1QVF A;  1QZG A;  1PH3 A;  4NB3 A;  4DV3 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...