1YVCA

Solution structure of the conserved protein from the gene locus mmp0076 of methanococcus maripaludis. northeast structural genomics target mrr5.
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
70
structure length
70
Chain Sequence
MAFGKPAMKNVPVEAGKEYEVTIEDMGKGGDGIARIDGFVVFVPNAEKGSVINVKVTAVKEKFAFAERVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
source organism Methanococcus maripaludis
molecule tags Structural genomics, unknown function
molecule keywords MrR5
total genus 10
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2005-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01938 TRAM TRAM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1yvcA00
2Q2UA 2VY3A 2DUDA 4P74A 4LFAQ 2IT1A 3GD7A 4GN3B 3I4NH 1E1TA 4P75A 1MIUA 1SRUA 3W1GA 4DPGA 3HOZG 2ZJRA 4LUZA 1KAWA 5BR8L 2JEBI 3HFZB 4DV2Q 4KLKA 3STBD 4A93H 3HOXH 4XTCS 4P73A 4PZ6A 4DR5Q 1Q8KA 3MEFA 1IBKL 2H5XA 1X9NA 1O7IA 1WOCA 4LF7Q 1TXYA 1QVGA 1KC8C 3S16H 4GLVB 3Q8DA 4YWMA 4ME3A 1A62A 3KDFA 3HOWH 3ULPA 4BXXG 1KXLA 3E0EA 4UP9A 2E5LL 3HOYH 2YTXA 3OYYA 1VQ5A 2R92H 4L5SA 3HOYG 4LF6L 4NXML 3M85A 3HOWG 4BXXH 1UWVA 4POFA 2NVTH 1Z9FA 4B3RL 1AE2A 1HJPA 4GN5A 4DV6Q 4AQYL 2PQAB 3UDGA 4KHPQ 2R93H 1GO3E 3OTOQ 1OXSC 5C4JH 1CUKA 2YTYA 1ASYA 5C4XG 1U5KA 4LF4Q 3GTKH 4R4IA 2I5HA 3HOXG 2BA0A 4JI2Q 1N9WA 4R4CA 1K73C 4JG2A 3CW2C 3GTGH 1KIXA 4A3GH 5GAEC 3M7NA 3JAMc 1J5EL 4HIOA 1T9HA 4YCVA 3S15H 1CKMA 1JE5A 3D31A 5JEAJ 4GNXC 4DR7L 4RG1A 4IFDJ 1SMXA 1HZBA 2HIXA 3RN5A 4UP7A 3NELA 5E7NA 1YJNA 3OTOL 2UXCL 1WFQA 1X3GA 3CCQA 2JA8G 1EOVA 1QVCA 4BBSG 3HKSA 1EUJA 1BBWA 3UDXA 2WB1E 5IYCH 5C0XI 2OTLA 3UE1A 3M4OH 2N49A 1XNQQ 3PUXA 4X65L 3B6YA 4R4OA 3T1YQ 1PH7A 3AFPA 1I6HH 3CCJA 1PHJA 1JB7A 2LXJA 3GTPH 4YHHQ 2KCTA 1HNWQ 1G291 3CP0A 4DR2Q 2WP8J 4BA1I 2JA5G 1PV4A 1K8AC 1XMOL 1CSQA 1KL9A 4NXNQ 3CD6A 2IHEA 2K52A 1WJJA 5LMNW 2VNUD 4A75A 2A1AA 3S1MH 2KBNA 1CKNB 2CKZB 2AWOA 2CFMA 4Y7NH 3PUWA 4AYBE 4JI0L 4LF8L 3UDFA 3KF8B 1GKHA 2NVYH 4LF4L 2F4VL 2N78A 5IYDH 4A3GG 5EAYA 3G71A 2YYZA 3PUYA 3CCMA 4OWWB 3CPWA 5IP7G 4DV5Q 2Y0SG 3K7UC 2ES2A 2HQLA 1VQOA 2E2IH 3GTQH 1NTGA 4J15A 2K4KA 1A8VA 2RF4A 1VQ8A 4L5RC 2NVQH 3FKIG 4GNXB 3T1HL 4JI0Q 2PNHA 2ZTEA 4A3MG 1N33Q 4YY3Q 1Y1VH 1UE6A 5GROA 3RLOA 5IYBH 4DV7Q 4DR4L 3A5UA 3PCOB 2IY5B 4Y52H 4HIKA 4DR1L 3CQZH 4X66L 3PGZA 1HNZQ 4EQ5A 3EN2A 1PH6A 5IP7H 3HOUH 1EIYB 4JBKA 4K0KL 4DR7Q 3MXNB 4JI3Q 3IRBA 1Q46A 5GAHC 3ULJA 3UDIA 4DV4L 5GADC 4BY7H 3D0FA 1S3OA 2RHQB 2KCMA 4IO9A 4EX5A 2VZAA 3KF6A 3KJPA 1YIJA 1VQLA 2VS1A 2BH2A 3G6EA 1H95A 5IY0A 5IP9H 2EQSA 2N8NA 1PH3A 2D0PA 3U4VA 1Q86C 1IBLL 4LNQA 1PYBA 4POGA 4R4TA 2PI2E 2MQHA 4MNOA 2HIVA 4L5TA 4LFAL 4IPGA 1JT8A 3LGJA 1K83H 4JV5Q 3KJOA 2JK8A 2HT1A 2F3IA 2WFWA 3GTMH 3PO3H 2UUCL 3J81j 4LF9Q 3BU2A 3U50C 1UEBA 1VQHA 4X62Q 1IXRA 1N36Q 1SROA 5IYCG 1PH8A 1QZGA 4JV5L 4UPAA 1YI2A 3NEMA 1I50H 1KRTA 1X6OA 3NENA 1VQCA 3K8AA 2YV5A 4DV0Q 2UUAQ 5C3EG 4JI8L 3CMAA 1M90C 1VQIA 2LXKA 3BZKA 4ALPA 4LF5L 4DUYQ 2MO0A 4DR4Q 4A3EG 4JI1Q 4BBRH 3CCRA 4DV2L 4LF6Q 3K81C 4C3JH 4NXMQ 5IT9c 4GLXA 1K8GA 2B63H 1HNWL 1Q81C 1N32L 1Y1WG 1DGSA 1TWGH 1W3SA 4LF7L 4WJ4A 2KHJA 3RR5A 2QGQA 4DUZQ 4X62L 3PUZA 3A5ZB 3G48A 2JA6H 1L1OC 2Q2IA 2N3SA 1TWAH 4DKAC 4OX9L 5C4XH 1TWHH 5M5XH 2MFIA 2JE6I 4UP8A 4IOAA 4JI5L 1X56A 2I5LX 1HR0Q 1TWCH 2ZTCA 2Y0SE 3EBEA 3KOJA 2R92G 3PO2H 4A3FH 1VQNA 1RIPA 2LSSA 4A3CH 1PVOA 1CKOA 2A8VA 2V1CC 3M4PA 1BKBA 1EWIA 4QJFA 4AYBG 3J80c 4A3JH 1VQKA 4B3SQ 3ICEA 4A3DG 2K50A 4JOIC 3ULLA 4DV3L 3TRZA 1B7YB 4YWLA 3CPFA 2OCEA 1A0IA 2PMZE 2E2HH 4A93G 5M3FG 4PG3A 1X54A 3DLLA 1NMGA 1IBML 4X6AH 1X55A 1XPRA 4H02A 1YVCA 4LW1A 4P71A 4DAYB 2PI2A 5FLMH 4DR1Q 3UE0A 1YEZA 4LUOA 4LF5Q 4A3LG 1L2FA 1GVPA 2GN5A 2KHIA 5FJ8H 2UXCQ 2YTVA 5JJKA 2JA7H 4TQUS 1PH9A 4DV1Q 2YU9H 4A76A 1KQSA 3HOVH 4JYAQ 3M3YH 2JEAI 1SE8A 1BVSA 4JI7L 1NY4A 4DV5L 1SFOH 2ID0A 3S1NH 3BJUA 4IFDG 3GO5A 2NZHA 4BY1G 1D7QA 4DUYL 2CQOA 5LMUL 1W2BA 4L5QA 2Q2TA 1UE7A 1XPOA 1VQAA 3K0XA 1N8RC 4QL5A 2D0OA 4KHZA 4GN4B 3CCUA 3S24A 3BZCA 3I56A 4A3KG 2K5HA 4B3RQ 2D62A 1VQ9A 1VQ7A 3I2ZA 1TWFH 1AH9A 4B3TQ 3PIPA 3I4OA 1EYGA 3GDEA 3CCVA 3KF6B 1U0LA 4JI3L 3RLFA 5M3MG 1WCMH 2IX0A 3ER0A 1GM5A 2R7ZH 3J7A5 4LFCQ 3S1RH 4A4IA 1P8LA 2RCNA 2HHHL 4WJ3M 5FLXc 1OXUA 1MJEA 3STBC 4DK6C 2CCZA 1QVFA 1KRSA 2NN6G 3F1ZA 4LFBL 1LM0A 4JI4L 4HJAA 1KD1C 5JJIA 1OXTA 1YITA 1E7ZA 5IWAQ 4YHHL 1Y14B 3U4ZA 4GOPB 3I4MH 2E2JH 3CCSA 4JI6Q 3H3VI 4B3TL 4QIWE 3M4QA 5DLQE 4LF9L 1PA6A 4PMWA 1FVIA 3PV0A 4X64Q 1V43A 1QUQB 3CAMA 3E9IA 3H3VH 2R7FA 4GKJL 4JI6L 3J7ZC 5C44G 4QQBX 2EXDA 2HHHQ 2ATWA 4DR6Q 1WYDA 2F52A 2F4VQ 4GOPC 2JQOA 3GTJH 4JOIA 2R6GA 4P72A 1C9OA 5FJ8G 4O0AA 2VUMG 4HJ8A 3CXCA 3CC2A 1FJGL 1WI5A 3FP9A 4GKJQ 4A3IH 1Q82C 1D8LA 4GKKL 2K5VA 1J6QA 3RNUA 2XGTA 2VL6A 2JJQA 1VQPA 2I0QA 1QUQA 1Z47A 2AMCB 5M3FH 2E5LQ 4B3MQ 3AEVA 2AKWB 3PF5A 4DAMA 5IWAL 1OXXK 3S2DH 1B8AA 1IBLQ 4NB3A 3TREA 1S72A 1IBKQ 4A3JG 1IZ6A 4A3DH 2A19A 1LUZA 2ZJPA 3ERSX 1HZCA 1UE5A 5M5YH 2QEXA 4GNXA 1HNXL 1YHBA 3KDFB 2NVXH 3S1QH 1M1KC 4A3CG 1I94L 1B70B 4YCUA 3A0JA 1FJGQ 2GVBA 4IOCA 2IX1A 4JBMA 1V9PA 1UE1A 3K80C 1FGUA 1XNQL 1VQJA 2NN6I 5ELOA 4NPSA 1VS0A 4A3BG 2RHSB 3JC66 4X64L 5AJ3L 3ZJYC 4OO1G 4JBJA 3KLWA 1E24A 1JMCA 2Z6KA 3TEHB 4AH6A 4A3BH 4PZ8A 4A3EH 1HR0L 1IBMQ 3G4SA 3PUVA 1XMQQ 1K9MC 2ZJQA 3W5OA 5LMUQ 3H0GG 2ZM6L 2ASBA 3FHWA 1HNXQ 2VQFQ 1XNRQ 1J5EQ 2K14A 1NE3A 1VQDA 1VQEA 2VQEL 3U58A 4B3SL 3S17H 4DR2L 1ASZA 5M5WH 1XMQL 1EFWA 1N34L 1YBYA 4JYAL 3VDYA 5ELNA 1G51A 1HNZL 1VCIA 2UUBL 4JI1L 1Q1EA 1GD7A 3EIVA 4C3HH 3H15A 1RL2A 1X65A 1Q7YC 1OXVA 5LMNQ 4MZ9A 4DR3Q 3S2HH 1C7YA 1HZAA 3WWVA 5H1SE 2KENA 4DV1L 2E8GA 5FLMG 4A3IG 1S40A 3J81i 1CKNA 2CWPA 1R9TH 4JI4Q 2VUMH 3AFQA 4JBWA 4IPCA 2UUCQ 2VQFL 1PFSA 4R1JA 3DM3A 3W1BA 2QA4A 4JI7Q 1XNRL 3I55A 3JAMi 1LYLA 1PYSB 1JJCB 1SLJA 3T1HQ 3HOUG 4AIMA 3TS0A 3GTOH 1PH5A 2Z0SA 2MNAA 2OQKA 3RN2A 1YHAA 2IHFA 1LTLA 2I5MX 1Y1VG 4LUVA 2ZTDA 4XIGS 4R4QA 5IYBG 3L2PA 4AQYQ 4A3MH 3PF4A 4KHPL 4DV3Q 3FKIH 3PO2G 4OXPA 3RZOH 3F8TA 1XTDA 2NZOA 4QY7A 4JC0A 4GOPA 4O2DA 1HH2P 3HKZE 3H0GH 2WAQE 4DR3L 1YJ9A 2WB1G 3KFUA 4C3IH 1PH4A 4MTNA 1HZ9A 2JA6G 1MKHA 4X66Q 1I94Q 3RLNA 4DR5L 5GQOA 2B29A 4C2MH 4DV7L 1WCMG 2UUBQ 1EQRA 1SN8A 1V1QA 2ZM6Q 1IYJB 3L0OA 1IL2A 2R7ZG 4JI8Q 5IE8A 3I7FA 4DV4Q 2B63G 3CMEA 4BBRG 4K0KQ 1KHIA 3J80i 4A3KH 1E22A 3CCLA 2CWAA 2UXDQ 5HY6A 2PQAA 4IPHA 5C3EH 2JA5H 1I3QH 4UY8C 4HJ5A 1E1OA 4GKKQ 4HJ9A 3GTLH 5C0XG 1EQQA 4RMFA 1G6PA 1AE3A 4JI2L 3OW2A 1K3RA 4BY1H 2ALYB 1X3FA 4HJ7A 3J81c 4DR6L 4BBSH 3KYHC 1MJCA 4IJHA 1YZ6A 1N36L 4LF8Q 2R7DA 1PH2A 4GLAC 1PH1A 4YY3L 3PSIA 1EIFA 4DUZL 3S14H 5IP9G 2OWOA 1NMFA 1FL0A 4IPDA 1NBWA 4A3LH 1C0AA 1VQFA 4BY7G 2UXBQ 4JI5Q 3F2CA 1P16A 2BH8A 1OTCA 4LFBQ 4KI0A 2DGYA 5C0XJ 2EIFA 5C44H 1L1OB 1XJVA 2UXBL 2OQ0A 1CSPA 3A74A 4LFCL 4PZ7A 4APVA 2R93G 4FDBA 1Q12A 3T1YL 2K75A 3CC4A 1JJGA 4B3ML 3E9HA 3I4MG 2AWNA 4A3FG 2VQEQ 1XPUA 1VQBA 2WAQG 4YCWA 4OX9Q 3SGIA 1L0WA 3CC7A 5JJLA 1VQ6A 1YNXA 5HGQA 2K5NA 1L1OA 2AHOB 3F2DA 5K36G 2FXQA 1N32Q 4HIDA 2C35B 1K0RA 3F2BA 1A63A 2UU9L 1YJWA 1BBUA 3K7AH 2MO1A 3M9BA 1JJ2A 5IYDG 4DV6L 5M3MH 1QZHA 3HOZH 1Y1WH 2L15A 4OO1I 1XMOQ 2OTJA 4NXNL 3I4NG 2VW9A 5GAGC 4OWTB 3L7ZC 1NJIC 1E3PA 5LMNL 4X65Q 2UXDL 2Q2HA 4TVAB 4HIMA 4QGUA 4OONA 3AQQA 4BA2I 2XTIA 3HKZG 4OWXB 2Z6KC 1N33L 1Q1BA 5BR8Q 2B3GA 1X3EA 2UU9Q 1SR3A 4GS3A 4DV0L 2UUAL 3PO3G 5JEAG 3CF5A 4IJLA 2BA1A 4DNIA 1VQMA 2JA9A 4LWCA 1N34Q 2JA8H 3CCEA 4IFDI 3HOVG 3RZDH 5J3BA 3TQYA 1HR0W 1YHQA 1I5FA 4YWKA 4DK3C 1VQGA 5AJ3Q 3AYHB 3NBHB 4JCVE 3PIOA 1VQ4A 2GVAA 2JA7G 3TS2A
chains in the Genus database with same CATH superfamily
1FNUA 3W2DA 5IIFA 3E5SA 2B2UC 2EOTA 4K6LA 1RTNA 4P75A 2A74C 3HOWB 4ZCKA 1ZYRC 3MWYW 4KLKA 3STBD 3K5LA 1RDPD 4XTCS 5ELEA 5IGFA 1X9NA 4A3IB 3S16H 4YWMA 1A62A 3HOWH 3ULPA 4ZYSA 5D3DA 3HOYH 2YTXA 1V1PA 2EY2A 2R92H 4NXML 1UWVA 4POFA 1AE2A 4DV6Q 3C2PA 2R93H 1STBA 3OTOQ 1I6VC 2FJ2A 4IZ8A 5C4XG 4KKTA 4U68A 4LF4Q 1UNSA 5L37A 4R4IA 1PYWD 5DEHA 1EY5A 1N9WA 4JG2A 3CW2C 2E74C 5GAEC 4A3GH 2HCIA 3JAMc 3S15H 2F3VA 4YCVA 1CKMA 1JE5A 2R93B 2SNMA 4AYBB 3DXJC 4IFDJ 3BVGA 2F0NA 1GHKA 3CRLC 2EYOA 5E7NA 1SE3A 3OTOL 1SJED 2UXCL 2JA8G 4BBSG 4N9PA 1BBWA 3UDXA 2WB1E 5IYCH 2PZWA 5C0XI 3UE1A 1EQVA 1XNQQ 4X65L 5IGGA 1DOMA 5CGKA 1G291 4DR2Q 4BA1I 3S17B 3TSSA 1KL9A 5FLXE 4NXNQ 2K52A 4EQNA 5EGTA 1U4LA 1KDBA 3OHXC 3PUWA 4ILWA 3H94A 3NPPA 1GKHA 2N78A 4A3GG 5EAYA 3G71A 4OWWB 5IP7G 4BBRB 2KEDA 2Y0SG 2A69C 5T1IA 3GTKB 1VQ8A 5LHY1 3PQIA 1MBYA 2FMCA 4JI0Q 5HGTA 1Y1VH 5IYBH 5GROA 4DV7Q 3HZXA 3LX0A 3PGZA 1HNZQ 3EN2A 1AEXA 4DR7Q 3MXNB 3OPOA 3ULJA 4IN3A 1LLRD 3D0FA 2RHQB 1VQLA 2BH2A 1H95A 2DNCA 3VR6A 2D0PA 1Q86C 3TP5A 1PDQA 1PYBA 1JT8A 2F0IA 2JSOA 3TZDA 4C3HB 4JV5Q 2F3IA 4JPBW 2DY7A 3J81j 3BU2A 4H0LC 1VQHA 1IXRA 1GXDC 1N36Q 2KQ3A 4JV5L 1LV9A 3RUZA 1G91A 1B1ZA 2GA4B 5JOBA 4DF7A 4ME5A 1T5XD 2BE5C 1M90C 3A7AB 1VQIA 2LXKA 1JR0D 4ZLTF 3S1NB 2AUKA 4DR4Q 3R3OA 4XQJA 3K81C 5IT9c 1K8GA 1TWGH 2QGQA 1WTOA 3KF8A 2LKVA 4G57A 3PUZA 2JA6H 4DKAC 2N3SA 4WORA 2MFIA 5I2YA 1DONA 3WDNA 1C48A 1EFID 2Y0SE 3EBEA 3KOJA 4NW2A 1RIPA 4A3CH 1PVOA 1Y8PB 3ICEA 5HURA 1BCPF 4DV3L 2OCEA 2A73B 2E2HH 5LL6S 4PG3A 1LTID 5M3FG 1NMGA 5EPLA 1X55A 1XPRA 2E2JB 1VDZA 4IUVA 3UE0A 3JAML 1FGBD 3N6RA 4QF4A 2GN5A 2H1EA 5JJKA 2JA7H 1PH9A 2YU9H 5M9OA 3HS0C 2RSNA 1LT6D 4JI7L 3KUPA 5JEAH 2ID0A 3T53B 3BJUA 2NZHA 1X32A 2A69D 4DUYL 4CJ0B 2A68C 4KHZA 3QOLA 4GN4B 5FOBB 3S24A 3ONAB 3I56A 4B3RQ 1EYGA 4OO1H 4XQQA 3I91A 2F0KA 3ER0A 2IX0A 1EYDA 4LFCQ 1P8LA 1RKNA 5C4JB 5FLXc 2EJFC 5CV4A 1E2VA 1TY0A 4DAVA 1ENFA 1KRSA 3TZUA 1PFBA 4X3SA 1K8MA 3V05A 2K5DA 5TSSA 3CRKC 1CZGA 4YHHL 1RHPA 5KIXA 3CCSA 1PA6A 4PMWA 3PV0A 3A8IE 2I07B 2O5JC 2B2TC 4EGVA 2KA7A 4QQBX 4JI6L 2EXDA 1O7LA 3BYYB 2HHHQ 4DR6Q 4JOIA 4P72A 5JJZA 2F0DA 2VUMG 3O13A 3CXCA 1WI5A 3R2TA 3P7JA 2A68D 3IKJA 1PTOC 1VQPA 1QUQA 2KOLA 3S1MB 2EXZA 1EY6A 3GTGB 2OT2A 4B3MQ 3PF5A 5IWAL 1OXXK 3S2DH 2NYZD 4B9XA 5DM73 3KLSX 4GNXA 3S1QH 1D1KA 1HNXL 1YHBA 1TQOA 1M1KC 1W6JA 1JE4A 1FJGQ 2ICIA 3PIP3 3S1RB 1VQJA 2NN6I 2WKCA 3JC66 2Z4HA 5FLXL 3TEHB 1B9NA 2EY1A 5C5LA 4A3BH 4MTKA 1A2TA 1GOZA 3DWQA 1GUTA 2ZJQA 2ZM6L 4RHSA 4DK0A 2VQFQ 1NE3A 1VQDA 2VQEL 4B3SL 4DR2L 1EFWA 5E1FA 1YBYA 4JYAL 4J6HA 4RFBA 2Q8RE 4A3KB 5KGUA 1G51A 2L11A 4ZUIA 4DA2A 1KLGD 3GV3A 4K5WA 4FNFA 4Z9CB 1SXTA 4RGNA 4OGQC 4MZ9A 5E3FA 2IX3A 3S2HH 5CV7A 1QNKA 4N9TA 4A3IG 1HA6A 5FO8B 1CI3M 1CKNA 3HEJA 1R9TH 5I2XA 1D2BA 1EL0A 3RZOB 3DUZA 4M1UB 4X3UA 3W1BA 3NP8A 3JAMi 2XN9C 3D3RA 1PYSB 3TS0A 1PH5A 2Z0SA 2OQKA 3MFYA 1YHAA 4CHTB 3RN2A 4LUVA 4R4QA 3PF4A 3MA2B 5ELDA 1WTPA 2B2WC 3ND8A 1XTDA 4GOPA 1HH2P 3HKZE 3H0GH 1ET6A 3I72A 4DR3L 4HCSA 2MP1A 2WB1G 3KFUA 4C3IH 5IT9L 4HN7A 4HCEA 1IYVA 2R3ZA 4X66Q 5D3IB 3TP6A 3URYA 5IODA 4C2MH 1IL2A 3GTLB 1IYJB 3L0OA 5IE8A 1PZID 4ZKBB 3R2IA 1JB3A 1E22A 2CWAA 4K8JA 3K6OA 5HY6A 1EWHA 1S5DD 2OEOA 2PQAA 1ZYRD 2JA5H 1I3QH 1I4XA 2Z8LA 4OHJA 4PMBA 4GKKQ 3VR3A 4HJ9A 1EQQA 1A3UA 3OW2A 1SE2A 2K04A 1O78A 4LF8Q 1A2UA 1PH2A 2VUMB 2JP1A 4YY3L 1O7YA 2F0QA 3WOFA 1FL0A 1NBWA 1TS4A 1NAPA 4IUPA 2EYFA 2PW5A 4BY7G 1BUVT 4LFBQ 4KI0A 4V0BA 1IW7C 2XSCA 1XJVA 2UXBL 3MXNA 1CSPA 5FO7B 4FDBA 1O7ZA 3E9HA 4B3ML 1WTXA 5NUCA 1XPUA 1VQBA 2WAQG 4YCWA 4OX9Q 4RA8A 1Z6HA 2G5DA 4HEDA 4F87A 2XRQD 2H4OA 2C35B 4HMIA 1K0RA 1HCZA 2HDLA 3RD4A 3F2BA 1BBUA 3K7AH 2MO1A 5C5MA 1HFGA 1A3TA 2Q8TA 2G9HD 3K5NA 1XMOQ 3I4MB 4NXNL 1CHQD 1PRTD 1E3PA 2A6EC 1PZJD 4X65Q 4TVAB 1QB5D 4HIMA 3K7AB 4BA2I 2XTIA 4NMZA 4N8X1 2WACA 3HKZG 4OWXB 3D6WA 1Y1WB 1Q1BA 2K33A 1X3EA 2UU9Q 4DV0L 2UUAL 1F9RA 4IJLA 2BA1A 3RZDH 5J3BA 3TQYA 4YWKA 4DK3C 1VQGA 4OIKA 1EY8A 1FNWA 2MPMA 4LFAQ 2DUDA 5M5YB 1E1TA 3C1FA 1SRUA 3HOZG 1LTBD 1KAWA 4LUZA 3K59A 1K8OA 4IQZA 4A93H 3HOXH 1M4VA 4RKLA 3MEFA 1IBKL 2H5XA 2MUYA 1EYCA 4GLVB 3Q8DA 1VMCA 1KXLA 4BXXG 3KDFA 3E0EA 2NTTA 5M3FB 3C3LA 3OYYA 3HOYG 1DZ1A 4L5SA 4LF6L 3AMUA 3M85A 3HOWG 4CKCA 5M3MB 1Z9FA 1HJPA 1K28A 4KHPQ 2PQAB 1PMRA 1GO3E 4KJNA 2YTYA 1ASYA 4KMUC 1E2WA 1ESFA 2BA0A 1K73C 4KHVA 3VYTA 1STGA 3M7NA 4A3DB 1T5EA 1WTWA 1MI2A 2DJFC 4GNXC 4DR7L 4RG1A 4TKOB 3GTPB 1SMXA 1D5XC 3EJIA 4KKUA 2QILA 3LWUA 2CW0C 1Y8NB 1X3GA 3NBHA 1I6HH 2UXDQ 3OWFA 4R4OA 4MHEA 3J81L 2LXJA 3GTPH 5ELCA 5I9PA 2JA5G 1XMOL 1E2ZA 1WJJA 1CKNB 4Y7NH 4LF8L 3AU7A 1BBXC 2RDHA 2E75C 2HDMA 5IYDH 2PZTA 5CBAE 2EYPA 4ABNA 2A5HA 4DV5Q 4I65A 3HP3A 2ES2A 2HQLA 1A6XA 1NTGA 4V190 3BS1A 4CJ2C 2RF4A 2NVQH 4DGZA 3FKIG 4GNXB 2A6HC 3J7AV 1BCPD 1CA6A 5C4XB 4RGTA 5JVG3 3A5UA 1S5CD 3PCOB 5K5PA 4Y52H 1PFMA 4DR1L 2WV6D 4X66L 3G7LA 5COYA 1PH6A 5IP7H 3A8KE 4K0KL 4LK1C 2MGSA 1EIHA 1EIGA 3G6JB 1Q46A 4C1NK 1S3OA 2VZAA 3KF6A 1JORA 1STHA 3G6EA 4CKEA 5IY0A 2EQSA 1PH3A 5KNCA 3VR2A 1IHZA 3U4VA 4LNQA 4MNOA 3LGJA 1K83H 3F2UA 1G6ZA 2K1BA 3I90A 1UEAB 5C0XH 4UPAA 2NVYB 3P20A 2O5IC 2YV5A 5C3EG 4JI8L 3CMAA 4NP5A 2F0PA 4HSPA 4K2KA 5ISRA 3PO3B 1BCPC 5D65A 2O4XA 3I3CA 3CCRA 4LF6Q 2B63H 3H09A 1F77A 4IUUA 2A6ED 1BO0A 1H9SA 4KK7A 4LF7L 2KHJA 2F0VA 5CORA 1TWAH 4OX9L 3EQLC 1C8CA 4IOAA 1CQVA 1CHPD 1TWCH 1SNQA 1MD2D 5BN3A 2R92G 1EY0A 3C1EA 3A56A 2A8VA 1BR9A 2IY5B 4QJFA 1BKBA 3J80c 3EROA 4RGOS 3MFGA 3ULLA 3TRZA 1RD9D 1JICA 5DNFA 2PMZE 5C3EB 2YU9B 1SYBA 1IBML 3DLLA 1D7QA 3VR5A 3PO2B 4DR1Q 4LUOA 1CQFA 3GTMB 2B2VC 1FYCA 2YTVA 1LT3D 1ESRA 1QILA 4C3HG 1EOTA 2IJ0A 4JYAQ 2B2WA 2X69A 1S5BD 1FNVA 4DV5L 3FMCA 2CQOA 1XTCD 5LMUL 2DY8A 1QWYA 4L5QA 3RMHA 1VQAA 4QUFA 5C44B 1N8RC 1EY4A 4QL5A 4XYOA 5EJWA 3S1QB 3IFDA 2K5HA 1PTOF 2IWHA 4MIUA 4WFN3 3GV6A 2JA8B 1KDCA 3GDEA 4B9WA 1IL8A 3RLFA 2K01A 1LABA 2L9HA 3H91A 1F9SA 4A4IA 4R9WA 2RCNA 2QF7A 1ML0D 1PRTB 1Y8OB 4XXEA 3STBC 2KVMA 1QVFA 4HJAA 3U9SA 5JJIA 1XXGA 1YITA 2FHTA 2R7ZB 5IWAQ 4GOPB 4KD4A 3I4MH 4ZRZA 1LTGD 2F0LA 4QIWE 3M4QA 5EKKA 3MC0B 4LF9L 3I4NB 1D5ZC 1V43A 1PXUA 1E0BA 2Z1CA 4WRDA 3J7ZC 5C44G 4UDUC 2K32A 3GTJH 1DYQA 4K5VA 5DAUA 5JVH3 3FP9A 4A3IH 4GKKL 1ILQA 1Z47A 3OMCA 1GUWA 5JAVA 1HA5A 2K5WA 3GTJB 2P5ZX 1B8AA 3SK8A 3Q22A 1ENCA 1IBKQ 4A3JG 1PTOB 2A19A 1Z7TA 5M5YH 2SOBA 1KAAA 2GVBA 2IX1A 4ZK9B 2D2CC 1JWUD 1UE1A 1V9PA 3K80C 3GTQB 1VS0A 4A3BG 2CW0D 2EDGA 4JBJA 3KLWA 1E24A 4HMJA 1EEID 2EZVA 1SNOA 2JN4A 4U673 3PUVA 3HOUB 3FHWA 1HNXQ 4KV6A 1VQEA 3U58A 1QNUA 2M2LA 3S17H 1ASZA 1XMQL 2LMCB 3VDYA 5ELNA 1NR2A 3NE5B 3A7LA 1VCIA 4LJZC 1AW7A 1R4PB 1GD7A 3EIVA 5EPKA 1D1IA 1X65A 1Q7YC 4DR3Q 4HAEA 2IPKD 3WWVA 2KENA 2N88A 5FLMG 3MEHA 2VUMH 3AFQA 2A6HD 2RKSA 4JBWA 3DMUA 2VQFL 2NVXB 3T1HQ 3HOUG 3GTOH 2DJGC 2IHFA 1LTLA 1Y1VG 5IYBG 2ZTDA 3L2PA 4A3MH 4AQYQ 1KABA 4F88A 4QY7A 1EU4A 3C46A 3NTHA 3TN2A 1SNMA 3GTOB 1PH4A 1JQYD 1HZ9A 2KCNA 1K3BC 4DR5L 5GQOA 4Q5VA 2B29A 1WCMG 5D14A 1WD1A 3I7FA 4DV4Q 4C3JG 1SNDA 4QCLA 2KCCA 3NUCA 1GUNA 2Z9HA 1I50B 2RBMA 2RDGA 4TSSA 2MJ8A 1E1OA 2PMZB 1B44D 3UI2A 1TY2A 1KDAA 3TP7A 4IFDH 2ALYB 2B2YA 4DXFA 4BBSH 4IJHA 3GP7A 2R7DA 3VA7A 4GLAC 4IUTA 1PH1A 2ENBA 4FYDA 1H9MA 3PSIA 2C9OA 1EYAA 4DUZL 1K83B 5IP9G 1QG7A 1LACA 4IPDA 3SVMA 3VYUA 1F2LA 1CTMA 4PMCA 3NXWA 2UXBQ 2BH8A 4K2LA 3SR1A 2WIIB 2WKDA 3ND9A 4CBVA 5C0XJ 3FKIB 4KY6A 3T51B 1L1OB 4FF4A 2K03A 2OQ0A 2CQAA 2FFKB 3JAME 3A74A 4LFCL 4APVA 2ICEC 2R93G 1Q12A 3T1YL 2K75A 3CC4A 2X6GA 5BN4A 2B63B 5CV8A 1GHJA 3I4LA 4XT1B 4IUQA 1L0WA 2PPBC 3HOVB 1YNXA 5HGQA 3PMFA 2K5NA 2AHOB 2AQ2B 1JC7A 1A63A 3BDOA 1UAPA 2UU9L 1B2TA 4NDXA 4DV6L 1CK1A 1Y1WH 2L15A 3R8BA 4RCNA 2LFNA 2VW9A 1SFOB 3NQTA 1NJIC 2EJMA 2KHSA 4L63B 1SYFA 4QGUA 4OONA 4RH6A 3S15B 2Z6KC 1N33L 2B3GA 3CU7A 4ZUJA 4HR7B 3PO3G 1TU2B 3QR8A 3HRZC 2JA9A 1EEFD 3HOVG 1GUGA 2L0CA 1YHQA 1I5FA 3HOXB 3BZDB 3J7AF 1SMYC 4JCVE 3NHHA 2F1MA 1TIID 5J22A 3NSWA 2Q2UA 4GN3B 4LMQD 4DPGA 4KTAA 4ZKCB 3HFZB 1MHWC 4DV2Q 1I4HA 2EY5A 4P73A 4PZ6A 5I6WA 1Q8KA 2F0WA 4OEMB 1O7IA 4LF7Q 2PCFB 1F2ZA 1TXYA 1QVGA 4DFAA 1KC8C 2NZ1D 1UUPA 1FR3A 1RF2D 4ME3A 4UP9A 1VQ5A 4PNYA 4BXXH 2K28A 3HOZB 4GZYC 4I7ZC 3UDGA 5C4JH 3SXHA 1U5KA 4I7AA 3GTKH 3HOXG 1QJOA 1YNJD 5IOCA 5M5WB 1G2SA 3GTGH 1KIXA 1HTLD 1T9HA 3D31A 5JEAJ 3QWNA 3X3NA 4IUNA 4F7XA 1HZBA 2HIXA 3HKZB 4UP7A 1YJNA 3SHLA 3CCQA 2DN8A 1EOVA 1QVCA 1LO5D 1U4RA 2ZT9C 3AB9A 3FPPA 3HKSA 1EUJA 1BF4A 2OTLA 5IGCA 3M4OH 2N49A 3PUXA 3T1YQ 1SSOA 1NCVA 1PHJA 3Q6SA 2E2DC 1PV4A 3S1MH 2IHEA 5LMNW 1CA5A 2VNUD 2A1AA 4ULLA 2CKZB 2AWOA 4AYBE 4CDCC 1MSHA 3UDFA 3MTSA 5F2DA 2FINB 4LF4L 2F0JA 2YYZA 3PUYA 4H13C 3OWEB 3CPWA 1AP0A 3NTIA 1STYA 1VQOA 2E2IH 5IGEA 4J15A 2K4KA 1LTTD 2ZXPA 1A8VA 4L5RC 1RJTA 2FMMA 3J80E 2PNHA 2ZTEA 1HFNA 4A3MG 1UE6A 3RLOA 1BCPB 3IL8A 3HOUH 3I8ZA 3TBIB 3QG1A 4DNTB 4PV1C 3IRBA 4R8IA 5GAHC 3UDIA 4DV4L 5GADC 4BY7H 4EX5A 1YIJA 3KJPA 3N52A 3OOCA 2G9DA 2EE1A 2VB3X 2K7VA 4POGA 1MSGA 2MQHA 1HXYD 3L9AX 2HT1A 2WFWA 2F03A 3GTMH 3PO3H 1HTPA 1QZGA 1YI2A 4KY5A 2F0FA 3NEMA 1KRTA 2JA5B 2EYJA 1VQCA 3H6MA 1RTOA 4DV0Q 2UUAQ 1ET9A 3BZKA 4ALPA 1O80A 4LF5L 4DUYQ 1KTKA 4A3EG 2BE5D 5DM63 4NXMQ 1C4QA 2Z4IA 1JCKB 2NBFA 1N32L 1Y1WG 1DGSA 3IAYA 4HSVA 4WJ4A 3RR5A 2L12A 4MN3A 1PRTC 1TWHH 5M5XH 4C3IB 2I5LX 1CZWA 1F9QA 3DHQA 1STEA 3PO2H 4A3FH 1VQNA 2LSSA 4O1NA 3FEWX 2V1CC 3M4PA 4AYBG 4A3JH 4BS9A 4FF3A 2K50A 4JOIC 1B7YB 3OW7A 4A93G 3NQIA 1X54A 4X6AH 4LAAA 4C56C 4EQOA 2AUJD 4LW1A 4P71A 3Q24A 1YEZA 1RODA 4A3LG 3P1HA 1L2FA 5FJ8H 2KHIA 5CV5A 1V8QA 1SYDA 4TQUS 2M9VA 4A76A 3SK4A 3MZ5A 1KQSA 2NTSA 2JEAI 1DCZA 1SE8A 1NY4A 2KEEA 3S1NH 4IFDG 4BY1G 4KJOA 1BDOA 3BYTB 1WCMB 1UE7A 1XPOA 3DWPA 1Q8IA 2EYMA 3S2DB 5BN5A 2N55A 3K0XA 1OO9B 1WTQA 2D0OA 2CH4A 3CCUA 3I73A 4A3KG 2PYKA 2D62A 2C5CA 1VQ7A 3I2ZA 1TWFH 1B9MA 4DAYA 3HOYB 3I4OA 4DU9A 4JI3L 1U0LA 5M3MG 2R7ZH 1WCMH 4G7ZC 4QUCA 2VXWA 2LS01 3S1RH 3BG3A 1I4RA 4WJ3M 1OXUA 3K58A 4DK6C 2CCZA 2CHBD 4NKLA 2NN6G 3F1ZA 4LFBL 1LM0A 1TWFB 4JI4L 1OXTA 3U9OA 1KNAA 3U4ZA 2E2JH 1NSNS 3H3VI 5DLQE 1FVIA 1QUQB 3CAMA 1KNEA 2NB0A 3H3VH 4DK1A 1XX8A 4RHRA 1Q90A 2R7FA 4GKJL 2ATWA 2F4VQ 2JQOA 2R6GA 1C9OA 4RCOA 4HJ8A 3CC2A 1FJGL 1I4PA 1Q82C 1D8LA 4FVMA 1J6QA 3RNUA 2XGTA 2VL6A 2JJQA 2I0QA 2AMCB 3RZDB 3AEVA 4DAMA 4CDEC 4KD3A 1IBLQ 3TREA 4P2CB 4A3DH 3ERQA 2HCCA 3ERSX 1UE5A 2RVLA 2QEXA 5KEEA 4G7HC 4YCUA 4IOCA 4B08A 1XNQL 3EFXD 2L1BA 4NPSA 2F0SA 2RHSB 1EWCA 2IL8A 5AJ3L 3OIQA 2ZXOA 4RKBA 4OO1G 1S5FD 3T4AC 4AH6A 4PZ8A 3CQZB 5JPNC 1IBMQ 1B3AA 3D4RA 3H0GG 2ASBA 1XNRQ 1IKMA 1D6EC 5M5WH 1WD0A 4JVZA 2UUBL 4JI1L 1Q1EA 2NVQB 1W6KA 1PTOD 1JOQA 1RL2A 1DOKA 2EJGC 1I4GA 2JYOA 1OXVA 4IURA 1C7YA 2R61A 4BBSB 1HZAA 3K5MA 1S40A 3J81i 2CWPA 1I4QA 1I6HB 5IGDA 2UUCQ 1PFSA 4JI7Q 4WJWA 1DXMA 1CM9A 1LYLA 2K5QA 3KBGA 1JJCB 4DNRB 3LNNA 2MNAA 2QCPX 4XIGS 5CR3A 1WVLA 4DV3Q 1EY9A 1S4ZA 3FKIH 3PO2G 3F8TA 3T56B 1DJRD 3MVVA 4JC0A 4O2DA 4EVOA 2WAQE 4A3BB 2OF1A 4A3EB 4MTNA 2JA6G 4EQPA 1ZXTA 1MKHA 2E2IB 1QOHA 1TKWB 4DV7L 5G3LD 1V1QA 5E4WC 1VF7A 4C1NI 5T1GA 4K0KQ 1KHIA 3J80i 3CCLA 1AZQA 5FO9B 4RAUC 4QIWB 1ICWA 3V2TA 4CJ1B 3H3VC 4ZQ3A 1SYEA 1IKLA 4RMFA 5CV6A 1AE3A 3EVQA 5C3XA 1EZ8A 4HJ7A 1F9PA 4L6TB 3J81c 4DR6L 3E0JA 5EQ0A 3KYHC 4CKBA 1N36L 3Q0AA 5I6YA 2RQXA 3M3YB 4RWSC 4ID6A 2TSSA 2JA6B 1NMFA 4JK1C 1C0AA 4S3SA 1JOOA 4OL7A 1VQFA 1F2YA 4JI5Q 1TT2A 1P16A 1IW7D 4KN4C 2DGYA 1H9RA 3W3AA 3ZYYX 2F3WA 1U4MA 4PZ7A 4FXKC 1L0YB 2B2VA 2AWNA 2LY7A 1TS3A 4C2MB 2JXMB 3CC7A 3NBIA 4O42A 5JJLA 1B4OA 1SAPA 5KYLA 1VQ6A 4M8AA 4R8NA 3SK6A 3F2DA 5K36G 4HIDA 3NTKA 1SBBB 2TMPA 1XYIA 1YJWA 3M9BA 1QZHA 5M3MH 3HOZH 4OO1I 2OTJA 1QE6A 5ELBA 3BDCA 3I4NG 4OWTB 1TS2A 3L7ZC 1BQQT 3D6CA 2B8GA 1TR5A 4N8FA 2Q2HA 1X3QA 5CBEE 2Q8IB 2XWJB 1SR3A 4GS3A 5JEAG 3CF5A 4DNIA 2DNEA 1II3A 2JA8H 1DOLA 4IFDI 3CCEA 4G4KA 5IGBA 1H9SB 2L4NA 1Y69U 1HR0W 3GQBA 3AYHB 3PIOA 2JA7G 3TS2A 3E3XA 3E6ZX 1ILPA 2QEJC 2HQEA 4OELB 2VY3A 4P74A 3I4NH 2IT1A 3GD7A 1EZ6A 3EA6A 1MIUA 3W1GA 1SNPA 2ZJRA 2AQ3B 3S9WA 5BR8L 2JEBI 1AZPA 3DEOA 3A54A 3CKIB 3V96A 2SEBD 4DR5Q 2QDBA 1ENAA 1J8IA 1WOCA 1SYCA 5C6AA 2E5LL 2NWGA 4QMGA 5EKIA 2NVTH 4B3RL 3BVZA 4GN5A 4AQYL 1BXTA 1OXSC 3KBXA 1CUKA 3M4YA 4FP5D 5A35A 3S16B 2I5HA 2KJXA 4JI2Q 4R4CA 1DM0B 2WINB 5EBDA 5CC4A 2R92B 3PIO3 1J5EL 3BDLA 4HIOA 2NVTB 2V4DA 3A8JE 4K14A 1HHVA 1HUNA 4K5XA 3RN5A 4UHVA 3NELA 1ZEQX 1SDFA 1WFQA 3R93A 3J81E 2IW3A 5KRUA 2J7ZA 2I46A 2F0UA 3B6YA 1PH7A 3AFPA 1AFPA 2XRSD 3CCJA 1JB7A 4DAPA 4YHHQ 2KCTA 1HNWQ 3CP0A 4DXGA 2CH4W 2WP8J 3L3OC 1K8AC 3CD6A 1CSQA 4A75A 5A2QE 4A93B 1WTHA 2B2YC 2KBNA 2CFMA 3SK5A 1STNA 4JI0L 3P75A 1HPCA 3KF8B 2NVYH 2F4VL 2AQ1B 4Q0FA 2XIWA 1TVXA 3CCMA 3TDQA 3K7UC 2RA4A 2KECA 3GTQH 2MHVA 3FDTA 3HGBA 3T1HL 1N33Q 1TWAB 4YY3Q 4DR4L 1TWHB 5M5XB 1LT4D 3DEPA 4HIKA 1NUCA 3CQZH 3FPUB 4EQ5A 1TWCB 1EIYB 4JBKA 3QIAA 4A3FB 4JI3Q 1PLFA 1V1OA 2SDFA 4IO9A 2KCMA 2ZXRA 1CFMA 2VS1A 2EYHA 2PO4A 4A3MB 5IP9H 2N8NA 4H7BA 1SMYD 2D9UA 3FRPB 1IBLL 5EKLA 4R4TA 2PI2E 4LFAL 4L5TA 1BOSA 2HIVA 1D5MC 4IPGA 3S14B 3KJOA 2JK8A 1PRTF 2BDOA 2UUCL 4LF9Q 3U50C 4L8JA 1UEBA 4X62Q 5IT9E 2XWBB 1SROA 5IYCG 5FKAC 1PH8A 3TP8A 1I50H 4XQNA 1Q3LA 1X6OA 1B53A 3NENA 1GUSA 3K8AA 1SE4A 5CMDA 1EY7A 2MO0A 3D4DA 4JI1Q 4BBRH 4DV2L 3IFTA 4C3JH 4GLXA 1HNWL 1LTRD 1Q81C 1W3SA 1SNCA 1NR4A 4DUZQ 4X62L 3A5ZB 1VF5C 3G48A 1L1OC 2Q2IA 1G8ZD 3MHBA 5K36H 5C4XH 1LT5D 2JE6I 3MAQA 1GJXA 4UP8A 4JI5L 3NWSA 1X56A 1YNND 1HR0Q 2ZTCA 3DWAA 2BOSA 5EBCA 4FF1A 1CKOA 4FF2A 1G2TA 1VQKA 1EWIA 4A3DG 4B3SQ 5I4DA 2EPBA 1FD7D 5E4XA 2J4XA 4YWLA 3CPFA 3D4WA 1A0IA 1YNNC 3OMGA 4RGMA 4H02A 1U4PA 1YVCA 1PZKD 1JWMD 4DAYB 2PI2A 5FLMH 3SEBA 3K0YA 4LF5Q 4PQXA 1GVPA 2UXCQ 4CDDC 4DV1Q 2D5DA 1HQRD 1PFNA 3Q23A 1SEBD 2E2HB 3HOVH 4KY7A 3M3YH 4G7OC 1BVSA 1EQTA 1SFOH 3GO5A 3KK7A 1W2BA 2Q2TA 1A15A 2K6AA 5EPJA 1TWGB 2NN6H 3VYRA 3BZCA 5LL6X 4X3KA 1VQ9A 1KLUD 1AH9A 4B3TQ 3PIPA 3CCVA 3KF6B 3MXUA 1GM5A 3J7A5 2WAQB 3MXGA 2HHHL 5J1ZA 1HRJA 1MJEA 4C3IG 1J9OA 2PNRC 1KD1C 4A3GB 1H9JA 3VYSA 3X3MA 2CVRA 3QOJA 1E7ZA 1Y14B 1V1PB 2J0TD 2SNSA 4J8QA 4JI6Q 4B3TL 5KNBA 4X64Q 3FVQA 3E9IA 5CYUA 3SE0A 4X3TA 2K05A 1WYDA 2F52A 4GOPC 4FO2A 5FJ8G 4O0AA 2F0GA 1YNJC 4GKJQ 2NUCA 2XVSA 2K5VA 2EVBA 2EY6A 3J7YW 1S5ED 5G3LF 5M3FH 2E5LQ 3KLSA 2AKWB 1ICFB 2B8FA 4XYQA 4Y7NB 4NB3A 1S72A 1IZ6A 1LUZA 2ZJPA 1HZCA 3M7GA 2NVXH 4A3CG 3KDFB 1I94L 2L55A 1B70B 1JWSD 3A0JA 3J80L 3LWEA 4JBMA 1SYGA 3VA5A 1FGUA 1A3VA 5ELOA 2Z6BA 3MXPA 2M00A 5C4ZA 2WB1B 1H9KA 4X64L 1MGSA 3ZJYC 2F0TA 4XT3B 4ODGA 1Y1VB 1JMCA 2Z6KA 2XNAC 4KN7C 4A3EH 1HR0L 3G4SA 3M4OB 5JPMC 1AN8A 1XMQQ 1K9MC 2F0MA 3DM1A 3W5OA 5LMUQ 2QW7A 1J5EQ 2K14A 4K8IA 1N34L 5A2QL 1STAA 4XDXA 1L0XB 1QCBD 4ZAIA 1HNZL 2BCOA 2X6LA 3ITPA 1HQMC 3TMEA 2L5TA 4C3HH 3H15A 5C3WA 2RSOA 5KNDA 5LMNQ 5KYIA 1CT1D 1JOKA 5H1SE 4DV1L 2E8GA 2F0HA 2PQEA 1DD2A 4JI4Q 4J1MA 3I70A 4IPCA 1ONLA 1XNRL 2QA4A 4R1JA 3DM3A 2QKIC 3NWTA 3I55A 3QB3A 1SLJA 4K6DA 3CHBD 3T16A 4AIMA 2Y0SB 4TRDA 1ZKOA 3S2HB 2I5MX 4KHPL 3HG9A 5I9OA 4OIJA 4IALA 4OXPA 3RZOH 1XWEA 2NZOA 2HUGA 1VMPA 1U9RA 1GUOA 1YJ9A 4CGYB 3D8GA 1WTVA 1I94Q 1HUMA 3RLNA 2PW7A 5C4HA 2UUBQ 1EQRA 1SN8A 2ZM6Q 2R7ZG 1RCVD 1EU3A 4JI8Q 2B63G 2O2LD 3OIPA 3CMEA 4BBRG 4BY1B 3H0GB 2VB2X 4A3KH 1K0SA 4IPHA 5C3EH 1NNXA 4H44C 4UY8C 4HJ5A 1F2MA 3SDZA 2EYLA 3WOEA 3GTLH 5C0XG 1G6PA 4BY7B 4JI2L 1K3RA 2BDNA 4BY1H 1X3FA 2QDLA 2F0OA 2JA7B 1MJCA 3A55A 1YZ6A 4FXDA 1R9TB 2F0EA 1I3QB 4HTHA 1EIFA 3S14H 1IYUA 2OWOA 4A3JB 4A3LH 3BVMA 3QO2A 4JW0A 5AFWA 3F2CA 1OTCA 2RDFA 2F4IA 3K5OA 4DN4M 2RCFA 2EIFA 5C44H 2B39A 4UAIA 2E76C 5CV9A 4QB4A 3KLRA 1JJGA 3I4MG 4C3JB 3QJYA 4A3FG 2VQEQ 1SJHD 3SGIA 5FK9C 1L1OA 2FXQA 1N32Q 1BNZA 4E6IA 3VR4A 1JJ2A 1R4QB 5IYDG 2PZUA 5GAGC 1WTRA 1LTAD 1TS5A 2B2TA 4CDFC 4F8MA 5LMNL 2UXDL 2OXPA 3NK9A 3AQQA 4FXGC 4KKSA 3T13A 3OSOA 5BR8Q 4YIJA 1LTSD 2B2UA 1B3QA 5ELFA 1VQMA 2HD3A 4LWCA 1N34Q 1B50A 5AJ3Q 3K57A 2KUMA 5J39A 3NBHB 1VQ4A 2GVAA 4BWGB 1X3PA 1PTOH 1M8AA
chains in the Genus database with same CATH topology
2Q2UA 2VY3A 2DUDA 4P74A 4LFAQ 2IT1A 3GD7A 4GN3B 3I4NH 1E1TA 4P75A 1MIUA 1SRUA 3W1GA 4DPGA 3HOZG 2ZJRA 4LUZA 1KAWA 5BR8L 2JEBI 3HFZB 4DV2Q 4KLKA 3STBD 4A93H 3HOXH 4XTCS 4P73A 4PZ6A 4DR5Q 1Q8KA 3MEFA 1IBKL 2H5XA 1X9NA 1O7IA 1WOCA 4LF7Q 1TXYA 1QVGA 1KC8C 3S16H 4GLVB 3Q8DA 4YWMA 4ME3A 1A62A 3KDFA 3HOWH 3ULPA 4BXXG 1KXLA 3E0EA 4UP9A 2E5LL 3HOYH 2YTXA 3OYYA 1VQ5A 2R92H 4L5SA 3HOYG 4LF6L 4NXML 3M85A 3HOWG 4BXXH 1UWVA 4POFA 2NVTH 1Z9FA 4B3RL 1AE2A 1HJPA 4GN5A 4DV6Q 4AQYL 2PQAB 3UDGA 4KHPQ 2R93H 1GO3E 3OTOQ 1OXSC 5C4JH 1CUKA 2YTYA 1ASYA 5C4XG 1U5KA 4LF4Q 3GTKH 4R4IA 2I5HA 3HOXG 2BA0A 4JI2Q 1N9WA 4R4CA 1K73C 4JG2A 3CW2C 3GTGH 1KIXA 4A3GH 5GAEC 3M7NA 3JAMc 1J5EL 4HIOA 1T9HA 4YCVA 3S15H 1CKMA 1JE5A 3D31A 5JEAJ 4GNXC 4DR7L 4RG1A 4IFDJ 1SMXA 1HZBA 2HIXA 3RN5A 4UP7A 3NELA 5E7NA 1YJNA 3OTOL 2UXCL 1WFQA 1X3GA 3CCQA 2JA8G 1EOVA 1QVCA 4BBSG 3HKSA 1EUJA 1BBWA 3UDXA 2WB1E 5IYCH 5C0XI 2OTLA 3UE1A 3M4OH 2N49A 1XNQQ 3PUXA 4X65L 3B6YA 4R4OA 3T1YQ 1PH7A 3AFPA 1I6HH 3CCJA 1PHJA 1JB7A 2LXJA 3GTPH 4YHHQ 2KCTA 1HNWQ 1G291 3CP0A 4DR2Q 2WP8J 4BA1I 2JA5G 1PV4A 1K8AC 1XMOL 1CSQA 1KL9A 4NXNQ 3CD6A 2IHEA 2K52A 1WJJA 5LMNW 2VNUD 4A75A 2A1AA 3S1MH 2KBNA 1CKNB 2CKZB 2AWOA 2CFMA 4Y7NH 3PUWA 4AYBE 4JI0L 4LF8L 3UDFA 3KF8B 1GKHA 2NVYH 4LF4L 2F4VL 2N78A 5IYDH 4A3GG 5EAYA 3G71A 2YYZA 3PUYA 3CCMA 4OWWB 3CPWA 5IP7G 4DV5Q 2Y0SG 3K7UC 2ES2A 2HQLA 1VQOA 2E2IH 3GTQH 1NTGA 4J15A 2K4KA 1A8VA 2RF4A 1VQ8A 4L5RC 2NVQH 3FKIG 4GNXB 3T1HL 4JI0Q 2PNHA 2ZTEA 4A3MG 1N33Q 4YY3Q 1Y1VH 1UE6A 5GROA 3RLOA 5IYBH 4DV7Q 4DR4L 3A5UA 3PCOB 2IY5B 4Y52H 4HIKA 4DR1L 3CQZH 4X66L 3PGZA 1HNZQ 4EQ5A 3EN2A 1PH6A 5IP7H 3HOUH 1EIYB 4JBKA 4K0KL 4DR7Q 3MXNB 4JI3Q 3IRBA 1Q46A 5GAHC 3ULJA 3UDIA 4DV4L 5GADC 4BY7H 3D0FA 1S3OA 2RHQB 2KCMA 4IO9A 4EX5A 2VZAA 3KF6A 3KJPA 1YIJA 1VQLA 2VS1A 2BH2A 3G6EA 1H95A 5IY0A 5IP9H 2EQSA 2N8NA 1PH3A 2D0PA 3U4VA 1Q86C 1IBLL 4LNQA 1PYBA 4POGA 4R4TA 2PI2E 2MQHA 4MNOA 2HIVA 4L5TA 4LFAL 4IPGA 1JT8A 3LGJA 1K83H 4JV5Q 3KJOA 2JK8A 2HT1A 2F3IA 2WFWA 3GTMH 3PO3H 2UUCL 3J81j 4LF9Q 3BU2A 3U50C 1UEBA 1VQHA 4X62Q 1IXRA 1N36Q 1SROA 5IYCG 1PH8A 1QZGA 4JV5L 4UPAA 1YI2A 3NEMA 1I50H 1KRTA 1X6OA 3NENA 1VQCA 3K8AA 2YV5A 4DV0Q 2UUAQ 5C3EG 4JI8L 3CMAA 1M90C 1VQIA 2LXKA 3BZKA 4ALPA 4LF5L 4DUYQ 2MO0A 4DR4Q 4A3EG 4JI1Q 4BBRH 3CCRA 4DV2L 4LF6Q 3K81C 4C3JH 4NXMQ 5IT9c 4GLXA 1K8GA 2B63H 1HNWL 1Q81C 1N32L 1Y1WG 1DGSA 1TWGH 1W3SA 4LF7L 4WJ4A 2KHJA 3RR5A 2QGQA 4DUZQ 4X62L 3PUZA 3A5ZB 3G48A 2JA6H 1L1OC 2Q2IA 2N3SA 1TWAH 4DKAC 4OX9L 5C4XH 1TWHH 5M5XH 2MFIA 2JE6I 4UP8A 4IOAA 4JI5L 1X56A 2I5LX 1HR0Q 1TWCH 2ZTCA 2Y0SE 3EBEA 3KOJA 2R92G 3PO2H 4A3FH 1VQNA 1RIPA 2LSSA 4A3CH 1PVOA 1CKOA 2A8VA 2V1CC 3M4PA 1BKBA 1EWIA 4QJFA 4AYBG 3J80c 4A3JH 1VQKA 4B3SQ 3ICEA 4A3DG 2K50A 4JOIC 3ULLA 4DV3L 3TRZA 1B7YB 4YWLA 3CPFA 2OCEA 1A0IA 2PMZE 2E2HH 4A93G 5M3FG 4PG3A 1X54A 3DLLA 1NMGA 1IBML 4X6AH 1X55A 1XPRA 4H02A 1YVCA 4LW1A 4P71A 4DAYB 2PI2A 5FLMH 4DR1Q 3UE0A 1YEZA 4LUOA 4LF5Q 4A3LG 1L2FA 1GVPA 2GN5A 2KHIA 5FJ8H 2UXCQ 2YTVA 5JJKA 2JA7H 4TQUS 1PH9A 4DV1Q 2YU9H 4A76A 1KQSA 3HOVH 4JYAQ 3M3YH 2JEAI 1SE8A 1BVSA 4JI7L 1NY4A 4DV5L 1SFOH 2ID0A 3S1NH 3BJUA 4IFDG 3GO5A 2NZHA 4BY1G 1D7QA 4DUYL 2CQOA 5LMUL 1W2BA 4L5QA 2Q2TA 1UE7A 1XPOA 1VQAA 3K0XA 1N8RC 4QL5A 2D0OA 4KHZA 4GN4B 3CCUA 3S24A 3BZCA 3I56A 4A3KG 2K5HA 4B3RQ 2D62A 1VQ9A 1VQ7A 3I2ZA 1TWFH 1AH9A 4B3TQ 3PIPA 3I4OA 1EYGA 3GDEA 3CCVA 3KF6B 1U0LA 4JI3L 3RLFA 5M3MG 1WCMH 2IX0A 3ER0A 1GM5A 2R7ZH 3J7A5 4LFCQ 3S1RH 4A4IA 1P8LA 2RCNA 2HHHL 4WJ3M 5FLXc 1OXUA 1MJEA 3STBC 4DK6C 2CCZA 1QVFA 1KRSA 2NN6G 3F1ZA 4LFBL 1LM0A 4JI4L 4HJAA 1KD1C 5JJIA 1OXTA 1YITA 1E7ZA 5IWAQ 4YHHL 1Y14B 3U4ZA 4GOPB 3I4MH 2E2JH 3CCSA 4JI6Q 3H3VI 4B3TL 4QIWE 3M4QA 5DLQE 4LF9L 1PA6A 4PMWA 1FVIA 3PV0A 4X64Q 1V43A 1QUQB 3CAMA 3E9IA 3H3VH 2R7FA 4GKJL 4JI6L 3J7ZC 5C44G 4QQBX 2EXDA 2HHHQ 2ATWA 4DR6Q 1WYDA 2F52A 2F4VQ 4GOPC 2JQOA 3GTJH 4JOIA 2R6GA 4P72A 1C9OA 5FJ8G 4O0AA 2VUMG 4HJ8A 3CXCA 3CC2A 1FJGL 1WI5A 3FP9A 4GKJQ 4A3IH 1Q82C 1D8LA 4GKKL 2K5VA 1J6QA 3RNUA 2XGTA 2VL6A 2JJQA 1VQPA 2I0QA 1QUQA 1Z47A 2AMCB 5M3FH 2E5LQ 4B3MQ 3AEVA 2AKWB 3PF5A 4DAMA 5IWAL 1OXXK 3S2DH 1B8AA 1IBLQ 4NB3A 3TREA 1S72A 1IBKQ 4A3JG 1IZ6A 4A3DH 2A19A 1LUZA 2ZJPA 3ERSX 1HZCA 1UE5A 5M5YH 2QEXA 4GNXA 1HNXL 1YHBA 3KDFB 2NVXH 3S1QH 1M1KC 4A3CG 1I94L 1B70B 4YCUA 3A0JA 1FJGQ 2GVBA 4IOCA 2IX1A 4JBMA 1V9PA 1UE1A 3K80C 1FGUA 1XNQL 1VQJA 2NN6I 5ELOA 4NPSA 1VS0A 4A3BG 2RHSB 3JC66 4X64L 5AJ3L 3ZJYC 4OO1G 4JBJA 3KLWA 1E24A 1JMCA 2Z6KA 3TEHB 4AH6A 4A3BH 4PZ8A 4A3EH 1HR0L 1IBMQ 3G4SA 3PUVA 1XMQQ 1K9MC 2ZJQA 3W5OA 5LMUQ 3H0GG 2ZM6L 2ASBA 3FHWA 1HNXQ 2VQFQ 1XNRQ 1J5EQ 2K14A 1NE3A 1VQDA 1VQEA 2VQEL 3U58A 4B3SL 3S17H 4DR2L 1ASZA 5M5WH 1XMQL 1EFWA 1N34L 1YBYA 4JYAL 3VDYA 5ELNA 1G51A 1HNZL 1VCIA 2UUBL 4JI1L 1Q1EA 1GD7A 3EIVA 4C3HH 3H15A 1RL2A 1X65A 1Q7YC 1OXVA 5LMNQ 4MZ9A 4DR3Q 3S2HH 1C7YA 1HZAA 3WWVA 5H1SE 2KENA 4DV1L 2E8GA 5FLMG 4A3IG 1S40A 3J81i 1CKNA 2CWPA 1R9TH 4JI4Q 2VUMH 3AFQA 4JBWA 4IPCA 2UUCQ 2VQFL 1PFSA 4R1JA 3DM3A 3W1BA 2QA4A 4JI7Q 1XNRL 3I55A 3JAMi 1LYLA 1PYSB 1JJCB 1SLJA 3T1HQ 3HOUG 4AIMA 3TS0A 3GTOH 1PH5A 2Z0SA 2MNAA 2OQKA 3RN2A 1YHAA 2IHFA 1LTLA 2I5MX 1Y1VG 4LUVA 2ZTDA 4XIGS 4R4QA 5IYBG 3L2PA 4AQYQ 4A3MH 3PF4A 4KHPL 4DV3Q 3FKIH 3PO2G 4OXPA 3RZOH 3F8TA 1XTDA 2NZOA 4QY7A 4JC0A 4GOPA 4O2DA 1HH2P 3HKZE 3H0GH 2WAQE 4DR3L 1YJ9A 2WB1G 3KFUA 4C3IH 1PH4A 4MTNA 1HZ9A 2JA6G 1MKHA 4X66Q 1I94Q 3RLNA 4DR5L 5GQOA 2B29A 4C2MH 4DV7L 1WCMG 2UUBQ 1EQRA 1SN8A 1V1QA 2ZM6Q 1IYJB 3L0OA 1IL2A 2R7ZG 4JI8Q 5IE8A 3I7FA 4DV4Q 2B63G 3CMEA 4BBRG 4K0KQ 1KHIA 3J80i 4A3KH 1E22A 3CCLA 2CWAA 2UXDQ 5HY6A 2PQAA 4IPHA 5C3EH 2JA5H 1I3QH 4UY8C 4HJ5A 1E1OA 4GKKQ 4HJ9A 3GTLH 5C0XG 1EQQA 4RMFA 1G6PA 1AE3A 4JI2L 3OW2A 1K3RA 4BY1H 2ALYB 1X3FA 4HJ7A 3J81c 4DR6L 4BBSH 3KYHC 1MJCA 4IJHA 1YZ6A 1N36L 4LF8Q 2R7DA 1PH2A 4GLAC 1PH1A 4YY3L 3PSIA 1EIFA 4DUZL 3S14H 5IP9G 2OWOA 1NMFA 1FL0A 4IPDA 1NBWA 4A3LH 1C0AA 1VQFA 4BY7G 2UXBQ 4JI5Q 3F2CA 1P16A 2BH8A 1OTCA 4LFBQ 4KI0A 2DGYA 5C0XJ 2EIFA 5C44H 1L1OB 1XJVA 2UXBL 2OQ0A 1CSPA 3A74A 4LFCL 4PZ7A 4APVA 2R93G 4FDBA 1Q12A 3T1YL 2K75A 3CC4A 1JJGA 4B3ML 3E9HA 3I4MG 2AWNA 4A3FG 2VQEQ 1XPUA 1VQBA 2WAQG 4YCWA 4OX9Q 3SGIA 1L0WA 3CC7A 5JJLA 1VQ6A 1YNXA 5HGQA 2K5NA 1L1OA 2AHOB 3F2DA 5K36G 2FXQA 1N32Q 4HIDA 2C35B 1K0RA 3F2BA 1A63A 2UU9L 1YJWA 1BBUA 3K7AH 2MO1A 3M9BA 1JJ2A 5IYDG 4DV6L 5M3MH 1QZHA 3HOZH 1Y1WH 2L15A 4OO1I 1XMOQ 2OTJA 4NXNL 3I4NG 2VW9A 5GAGC 4OWTB 3L7ZC 1NJIC 1E3PA 5LMNL 4X65Q 2UXDL 2Q2HA 4TVAB 4HIMA 4QGUA 4OONA 3AQQA 4BA2I 2XTIA 3HKZG 4OWXB 2Z6KC 1N33L 1Q1BA 5BR8Q 2B3GA 1X3EA 2UU9Q 1SR3A 4GS3A 4DV0L 2UUAL 3PO3G 5JEAG 3CF5A 4IJLA 2BA1A 4DNIA 1VQMA 2JA9A 4LWCA 1N34Q 2JA8H 3CCEA 4IFDI 3HOVG 3RZDH 5J3BA 3TQYA 1HR0W 1YHQA 1I5FA 4YWKA 4DK3C 1VQGA 5AJ3Q 3AYHB 3NBHB 4JCVE 3PIOA 1VQ4A 2GVAA 2JA7G 3TS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q2U A;  2VY3 A;  2DUD A;  4P74 A;  4LFA Q;  2IT1 A;  3GD7 A;  4GN3 B;  3I4N H;  1E1T A;  4P75 A;  1MIU A;  1SRU A;  3W1G A;  4DPG A;  3HOZ G;  2ZJR A;  4LUZ A;  1KAW A;  5BR8 L;  2JEB I;  3HFZ B;  4DV2 Q;  4KLK A;  3STB D;  4A93 H;  3HOX H;  4XTC S;  4P73 A;  4PZ6 A;  4DR5 Q;  1Q8K A;  3MEF A;  1IBK L;  2H5X A;  1X9N A;  1O7I A;  1WOC A;  4LF7 Q;  1TXY A;  1QVG A;  1KC8 C;  3S16 H;  4GLV B;  3Q8D A;  4YWM A;  4ME3 A;  1A62 A;  3KDF A;  3HOW H;  3ULP A;  4BXX G;  1KXL A;  3E0E A;  4UP9 A;  2E5L L;  3HOY H;  2YTX A;  3OYY A;  1VQ5 A;  2R92 H;  4L5S A;  3HOY G;  4LF6 L;  4NXM L;  3M85 A;  3HOW G;  4BXX H;  1UWV A;  4POF A;  2NVT H;  1Z9F A;  4B3R L;  1AE2 A;  1HJP A;  4GN5 A;  4DV6 Q;  4AQY L;  2PQA B;  3UDG A;  4KHP Q;  2R93 H;  1GO3 E;  3OTO Q;  1OXS C;  5C4J H;  1CUK A;  2YTY A;  1ASY A;  5C4X G;  1U5K A;  4LF4 Q;  3GTK H;  4R4I A;  2I5H A;  3HOX G;  2BA0 A;  4JI2 Q;  1N9W A;  4R4C A;  1K73 C;  4JG2 A;  3CW2 C;  3GTG H;  1KIX A;  4A3G H;  5GAE C;  3M7N A;  3JAM c;  1J5E L;  4HIO A;  1T9H A;  4YCV A;  3S15 H;  1CKM A;  1JE5 A;  3D31 A;  5JEA J;  4GNX C;  4DR7 L;  4RG1 A;  4IFD J;  1SMX A;  1HZB A;  2HIX A;  3RN5 A;  4UP7 A;  3NEL A;  5E7N A;  1YJN A;  3OTO L;  2UXC L;  1WFQ A;  1X3G A;  3CCQ A;  2JA8 G;  1EOV A;  1QVC A;  4BBS G;  3HKS A;  1EUJ A;  1BBW A;  3UDX A;  2WB1 E;  5IYC H;  5C0X I;  2OTL A;  3UE1 A;  3M4O H;  2N49 A;  1XNQ Q;  3PUX A;  4X65 L;  3B6Y A;  4R4O A;  3T1Y Q;  1PH7 A;  3AFP A;  1I6H H;  3CCJ A;  1PHJ A;  1JB7 A;  2LXJ A;  3GTP H;  4YHH Q;  2KCT A;  1HNW Q;  1G29 1;  3CP0 A;  4DR2 Q;  2WP8 J;  4BA1 I;  2JA5 G;  1PV4 A;  1K8A C;  1XMO L;  1CSQ A;  1KL9 A;  4NXN Q;  3CD6 A;  2IHE A;  2K52 A;  1WJJ A;  5LMN W;  2VNU D;  4A75 A;  2A1A A;  3S1M H;  2KBN A;  1CKN B;  2CKZ B;  2AWO A;  2CFM A;  4Y7N H;  3PUW A;  4AYB E;  4JI0 L;  4LF8 L;  3UDF A;  3KF8 B;  1GKH A;  2NVY H;  4LF4 L;  2F4V L;  2N78 A;  5IYD H;  4A3G G;  5EAY A;  3G71 A;  2YYZ A;  3PUY A;  3CCM A;  4OWW B;  3CPW A;  5IP7 G;  4DV5 Q;  2Y0S G;  3K7U C;  2ES2 A;  2HQL A;  1VQO A;  2E2I H;  3GTQ H;  1NTG A;  4J15 A;  2K4K A;  1A8V A;  2RF4 A;  1VQ8 A;  4L5R C;  2NVQ H;  3FKI G;  4GNX B;  3T1H L;  4JI0 Q;  2PNH A;  2ZTE A;  4A3M G;  1N33 Q;  4YY3 Q;  1Y1V H;  1UE6 A;  5GRO A;  3RLO A;  5IYB H;  4DV7 Q;  4DR4 L;  3A5U A;  3PCO B;  2IY5 B;  4Y52 H;  4HIK A;  4DR1 L;  3CQZ H;  4X66 L;  3PGZ A;  1HNZ Q;  4EQ5 A;  3EN2 A;  1PH6 A;  5IP7 H;  3HOU H;  1EIY B;  4JBK A;  4K0K L;  4DR7 Q;  3MXN B;  4JI3 Q;  3IRB A;  1Q46 A;  5GAH C;  3ULJ A;  3UDI A;  4DV4 L;  5GAD C;  4BY7 H;  3D0F A;  1S3O A;  2RHQ B;  2KCM A;  4IO9 A;  4EX5 A;  2VZA A;  3KF6 A;  3KJP A;  1YIJ A;  1VQL A;  2VS1 A;  2BH2 A;  3G6E A;  1H95 A;  5IY0 A;  5IP9 H;  2EQS A;  2N8N A;  1PH3 A;  2D0P A;  3U4V A;  1Q86 C;  1IBL L;  4LNQ A;  1PYB A;  4POG A;  4R4T A;  2PI2 E;  2MQH A;  4MNO A;  2HIV A;  4L5T A;  4LFA L;  4IPG A;  1JT8 A;  3LGJ A;  1K83 H;  4JV5 Q;  3KJO A;  2JK8 A;  2HT1 A;  2F3I A;  2WFW A;  3GTM H;  3PO3 H;  2UUC L;  3J81 j;  4LF9 Q;  3BU2 A;  3U50 C;  1UEB A;  1VQH A;  4X62 Q;  1IXR A;  1N36 Q;  1SRO A;  5IYC G;  1PH8 A;  1QZG A;  4JV5 L;  4UPA A;  1YI2 A;  3NEM A;  1I50 H;  1KRT A;  1X6O A;  3NEN A;  1VQC A;  3K8A A;  2YV5 A;  4DV0 Q;  2UUA Q;  5C3E G;  4JI8 L;  3CMA A;  1M90 C;  1VQI A;  2LXK A;  3BZK A;  4ALP A;  4LF5 L;  4DUY Q;  2MO0 A;  4DR4 Q;  4A3E G;  4JI1 Q;  4BBR H;  3CCR A;  4DV2 L;  4LF6 Q;  3K81 C;  4C3J H;  4NXM Q;  5IT9 c;  4GLX A;  1K8G A;  2B63 H;  1HNW L;  1Q81 C;  1N32 L;  1Y1W G;  1DGS A;  1TWG H;  1W3S A;  4LF7 L;  4WJ4 A;  2KHJ A;  3RR5 A;  2QGQ A;  4DUZ Q;  4X62 L;  3PUZ A;  3A5Z B;  3G48 A;  2JA6 H;  1L1O C;  2Q2I A;  2N3S A;  1TWA H;  4DKA C;  4OX9 L;  5C4X H;  1TWH H;  5M5X H;  2MFI A;  2JE6 I;  4UP8 A;  4IOA A;  4JI5 L;  1X56 A;  2I5L X;  1HR0 Q;  1TWC H;  2ZTC A;  2Y0S E;  3EBE A;  3KOJ A;  2R92 G;  3PO2 H;  4A3F H;  1VQN A;  1RIP A;  2LSS A;  4A3C H;  1PVO A;  1CKO A;  2A8V A;  2V1C C;  3M4P A;  1BKB A;  1EWI A;  4QJF A;  4AYB G;  3J80 c;  4A3J H;  1VQK A;  4B3S Q;  3ICE A;  4A3D G;  2K50 A;  4JOI C;  3ULL A;  4DV3 L;  3TRZ A;  1B7Y B;  4YWL A;  3CPF A;  2OCE A;  1A0I A;  2PMZ E;  2E2H H;  4A93 G;  5M3F G;  4PG3 A;  1X54 A;  3DLL A;  1NMG A;  1IBM L;  4X6A H;  1X55 A;  1XPR A;  4H02 A;  1YVC A;  4LW1 A;  4P71 A;  4DAY B;  2PI2 A;  5FLM H;  4DR1 Q;  3UE0 A;  1YEZ A;  4LUO A;  4LF5 Q;  4A3L G;  1L2F A;  1GVP A;  2GN5 A;  2KHI A;  5FJ8 H;  2UXC Q;  2YTV A;  5JJK A;  2JA7 H;  4TQU S;  1PH9 A;  4DV1 Q;  2YU9 H;  4A76 A;  1KQS A;  3HOV H;  4JYA Q;  3M3Y H;  2JEA I;  1SE8 A;  1BVS A;  4JI7 L;  1NY4 A;  4DV5 L;  1SFO H;  2ID0 A;  3S1N H;  3BJU A;  4IFD G;  3GO5 A;  2NZH A;  4BY1 G;  1D7Q A;  4DUY L;  2CQO A;  5LMU L;  1W2B A;  4L5Q A;  2Q2T A;  1UE7 A;  1XPO A;  1VQA A;  3K0X A;  1N8R C;  4QL5 A;  2D0O A;  4KHZ A;  4GN4 B;  3CCU A;  3S24 A;  3BZC A;  3I56 A;  4A3K G;  2K5H A;  4B3R Q;  2D62 A;  1VQ9 A;  1VQ7 A;  3I2Z A;  1TWF H;  1AH9 A;  4B3T Q;  3PIP A;  3I4O A;  1EYG A;  3GDE A;  3CCV A;  3KF6 B;  1U0L A;  4JI3 L;  3RLF A;  5M3M G;  1WCM H;  2IX0 A;  3ER0 A;  1GM5 A;  2R7Z H;  3J7A 5;  4LFC Q;  3S1R H;  4A4I A;  1P8L A;  2RCN A;  2HHH L;  4WJ3 M;  5FLX c;  1OXU A;  1MJE A;  3STB C;  4DK6 C;  2CCZ A;  1QVF A;  1KRS A;  2NN6 G;  3F1Z A;  4LFB L;  1LM0 A;  4JI4 L;  4HJA A;  1KD1 C;  5JJI A;  1OXT A;  1YIT A;  1E7Z A;  5IWA Q;  4YHH L;  1Y14 B;  3U4Z A;  4GOP B;  3I4M H;  2E2J H;  3CCS A;  4JI6 Q;  3H3V I;  4B3T L;  4QIW E;  3M4Q A;  5DLQ E;  4LF9 L;  1PA6 A;  4PMW A;  1FVI A;  3PV0 A;  4X64 Q;  1V43 A;  1QUQ B;  3CAM A;  3E9I A;  3H3V H;  2R7F A;  4GKJ L;  4JI6 L;  3J7Z C;  5C44 G;  4QQB X;  2EXD A;  2HHH Q;  2ATW A;  4DR6 Q;  1WYD A;  2F52 A;  2F4V Q;  4GOP C;  2JQO A;  3GTJ H;  4JOI A;  2R6G A;  4P72 A;  1C9O A;  5FJ8 G;  4O0A A;  2VUM G;  4HJ8 A;  3CXC A;  3CC2 A;  1FJG L;  1WI5 A;  3FP9 A;  4GKJ Q;  4A3I H;  1Q82 C;  1D8L A;  4GKK L;  2K5V A;  1J6Q A;  3RNU A;  2XGT A;  2VL6 A;  2JJQ A;  1VQP A;  2I0Q A;  1QUQ A;  1Z47 A;  2AMC B;  5M3F H;  2E5L Q;  4B3M Q;  3AEV A;  2AKW B;  3PF5 A;  4DAM A;  5IWA L;  1OXX K;  3S2D H;  1B8A A;  1IBL Q;  4NB3 A;  3TRE A;  1S72 A;  1IBK Q;  4A3J G;  1IZ6 A;  4A3D H;  2A19 A;  1LUZ A;  2ZJP A;  3ERS X;  1HZC A;  1UE5 A;  5M5Y H;  2QEX A;  4GNX A;  1HNX L;  1YHB A;  3KDF B;  2NVX H;  3S1Q H;  1M1K C;  4A3C G;  1I94 L;  1B70 B;  4YCU A;  3A0J A;  1FJG Q;  2GVB A;  4IOC A;  2IX1 A;  4JBM A;  1V9P A;  1UE1 A;  3K80 C;  1FGU A;  1XNQ L;  1VQJ A;  2NN6 I;  5ELO A;  4NPS A;  1VS0 A;  4A3B G;  2RHS B;  3JC6 6;  4X64 L;  5AJ3 L;  3ZJY C;  4OO1 G;  4JBJ A;  3KLW A;  1E24 A;  1JMC A;  2Z6K A;  3TEH B;  4AH6 A;  4A3B H;  4PZ8 A;  4A3E H;  1HR0 L;  1IBM Q;  3G4S A;  3PUV A;  1XMQ Q;  1K9M C;  2ZJQ A;  3W5O A;  5LMU Q;  3H0G G;  2ZM6 L;  2ASB A;  3FHW A;  1HNX Q;  2VQF Q;  1XNR Q;  1J5E Q;  2K14 A;  1NE3 A;  1VQD A;  1VQE A;  2VQE L;  3U58 A;  4B3S L;  3S17 H;  4DR2 L;  1ASZ A;  5M5W H;  1XMQ L;  1EFW A;  1N34 L;  1YBY A;  4JYA L;  3VDY A;  5ELN A;  1G51 A;  1HNZ L;  1VCI A;  2UUB L;  4JI1 L;  1Q1E A;  1GD7 A;  3EIV A;  4C3H H;  3H15 A;  1RL2 A;  1X65 A;  1Q7Y C;  1OXV A;  5LMN Q;  4MZ9 A;  4DR3 Q;  3S2H H;  1C7Y A;  1HZA A;  3WWV A;  5H1S E;  2KEN A;  4DV1 L;  2E8G A;  5FLM G;  4A3I G;  1S40 A;  3J81 i;  1CKN A;  2CWP A;  1R9T H;  4JI4 Q;  2VUM H;  3AFQ A;  4JBW A;  4IPC A;  2UUC Q;  2VQF L;  1PFS A;  4R1J A;  3DM3 A;  3W1B A;  2QA4 A;  4JI7 Q;  1XNR L;  3I55 A;  3JAM i;  1LYL A;  1PYS B;  1JJC B;  1SLJ A;  3T1H Q;  3HOU G;  4AIM A;  3TS0 A;  3GTO H;  1PH5 A;  2Z0S A;  2MNA A;  2OQK A;  3RN2 A;  1YHA A;  2IHF A;  1LTL A;  2I5M X;  1Y1V G;  4LUV A;  2ZTD A;  4XIG S;  4R4Q A;  5IYB G;  3L2P A;  4AQY Q;  4A3M H;  3PF4 A;  4KHP L;  4DV3 Q;  3FKI H;  3PO2 G;  4OXP A;  3RZO H;  3F8T A;  1XTD A;  2NZO A;  4QY7 A;  4JC0 A;  4GOP A;  4O2D A;  1HH2 P;  3HKZ E;  3H0G H;  2WAQ E;  4DR3 L;  1YJ9 A;  2WB1 G;  3KFU A;  4C3I H;  1PH4 A;  4MTN A;  1HZ9 A;  2JA6 G;  1MKH A;  4X66 Q;  1I94 Q;  3RLN A;  4DR5 L;  5GQO A;  2B29 A;  4C2M H;  4DV7 L;  1WCM G;  2UUB Q;  1EQR A;  1SN8 A;  1V1Q A;  2ZM6 Q;  1IYJ B;  3L0O A;  1IL2 A;  2R7Z G;  4JI8 Q;  5IE8 A;  3I7F A;  4DV4 Q;  2B63 G;  3CME A;  4BBR G;  4K0K Q;  1KHI A;  3J80 i;  4A3K H;  1E22 A;  3CCL A;  2CWA A;  2UXD Q;  5HY6 A;  2PQA A;  4IPH A;  5C3E H;  2JA5 H;  1I3Q H;  4UY8 C;  4HJ5 A;  1E1O A;  4GKK Q;  4HJ9 A;  3GTL H;  5C0X G;  1EQQ A;  4RMF A;  1G6P A;  1AE3 A;  4JI2 L;  3OW2 A;  1K3R A;  4BY1 H;  2ALY B;  1X3F A;  4HJ7 A;  3J81 c;  4DR6 L;  4BBS H;  3KYH C;  1MJC A;  4IJH A;  1YZ6 A;  1N36 L;  4LF8 Q;  2R7D A;  1PH2 A;  4GLA C;  1PH1 A;  4YY3 L;  3PSI A;  1EIF A;  4DUZ L;  3S14 H;  5IP9 G;  2OWO A;  1NMF A;  1FL0 A;  4IPD A;  1NBW A;  4A3L H;  1C0A A;  1VQF A;  4BY7 G;  2UXB Q;  4JI5 Q;  3F2C A;  1P16 A;  2BH8 A;  1OTC A;  4LFB Q;  4KI0 A;  2DGY A;  5C0X J;  2EIF A;  5C44 H;  1L1O B;  1XJV A;  2UXB L;  2OQ0 A;  1CSP A;  3A74 A;  4LFC L;  4PZ7 A;  4APV A;  2R93 G;  4FDB A;  1Q12 A;  3T1Y L;  2K75 A;  3CC4 A;  1JJG A;  4B3M L;  3E9H A;  3I4M G;  2AWN A;  4A3F G;  2VQE Q;  1XPU A;  1VQB A;  2WAQ G;  4YCW A;  4OX9 Q;  3SGI A;  1L0W A;  3CC7 A;  5JJL A;  1VQ6 A;  1YNX A;  5HGQ A;  2K5N A;  1L1O A;  2AHO B;  3F2D A;  5K36 G;  2FXQ A;  1N32 Q;  4HID A;  2C35 B;  1K0R A;  3F2B A;  1A63 A;  2UU9 L;  1YJW A;  1BBU A;  3K7A H;  2MO1 A;  3M9B A;  1JJ2 A;  5IYD G;  4DV6 L;  5M3M H;  1QZH A;  3HOZ H;  1Y1W H;  2L15 A;  4OO1 I;  1XMO Q;  2OTJ A;  4NXN L;  3I4N G;  2VW9 A;  5GAG C;  4OWT B;  3L7Z C;  1NJI C;  1E3P A;  5LMN L;  4X65 Q;  2UXD L;  2Q2H A;  4TVA B;  4HIM A;  4QGU A;  4OON A;  3AQQ A;  4BA2 I;  2XTI A;  3HKZ G;  4OWX B;  2Z6K C;  1N33 L;  1Q1B A;  5BR8 Q;  2B3G A;  1X3E A;  2UU9 Q;  1SR3 A;  4GS3 A;  4DV0 L;  2UUA L;  3PO3 G;  5JEA G;  3CF5 A;  4IJL A;  2BA1 A;  4DNI A;  1VQM A;  2JA9 A;  4LWC A;  1N34 Q;  2JA8 H;  3CCE A;  4IFD I;  3HOV G;  3RZD H;  5J3B A;  3TQY A;  1HR0 W;  1YHQ A;  1I5F A;  4YWK A;  4DK3 C;  1VQG A;  5AJ3 Q;  3AYH B;  3NBH B;  4JCV E;  3PIO A;  1VQ4 A;  2GVA A;  2JA7 G;  3TS2 A; 
#chains in the Genus database with same CATH topology
 1FNU A;  3W2D A;  5IIF A;  3E5S A;  2B2U C;  2EOT A;  4K6L A;  1RTN A;  4P75 A;  2A74 C;  3HOW B;  4ZCK A;  1ZYR C;  3MWY W;  4KLK A;  3STB D;  3K5L A;  1RDP D;  4XTC S;  5ELE A;  5IGF A;  1X9N A;  4A3I B;  3S16 H;  4YWM A;  1A62 A;  3HOW H;  3ULP A;  4ZYS A;  5D3D A;  3HOY H;  2YTX A;  1V1P A;  2EY2 A;  2R92 H;  4NXM L;  1UWV A;  4POF A;  1AE2 A;  4DV6 Q;  3C2P A;  2R93 H;  1STB A;  3OTO Q;  1I6V C;  2FJ2 A;  4IZ8 A;  5C4X G;  4KKT A;  4U68 A;  4LF4 Q;  1UNS A;  5L37 A;  4R4I A;  1PYW D;  5DEH A;  1EY5 A;  1N9W A;  4JG2 A;  3CW2 C;  2E74 C;  5GAE C;  4A3G H;  2HCI A;  3JAM c;  3S15 H;  2F3V A;  4YCV A;  1CKM A;  1JE5 A;  2R93 B;  2SNM A;  4AYB B;  3DXJ C;  4IFD J;  3BVG A;  2F0N A;  1GHK A;  3CRL C;  2EYO A;  5E7N A;  1SE3 A;  3OTO L;  1SJE D;  2UXC L;  2JA8 G;  4BBS G;  4N9P A;  1BBW A;  3UDX A;  2WB1 E;  5IYC H;  2PZW A;  5C0X I;  3UE1 A;  1EQV A;  1XNQ Q;  4X65 L;  5IGG A;  1DOM A;  5CGK A;  1G29 1;  4DR2 Q;  4BA1 I;  3S17 B;  3TSS A;  1KL9 A;  5FLX E;  4NXN Q;  2K52 A;  4EQN A;  5EGT A;  1U4L A;  1KDB A;  3OHX C;  3PUW A;  4ILW A;  3H94 A;  3NPP A;  1GKH A;  2N78 A;  4A3G G;  5EAY A;  3G71 A;  4OWW B;  5IP7 G;  4BBR B;  2KED A;  2Y0S G;  2A69 C;  5T1I A;  3GTK B;  1VQ8 A;  5LHY 1;  3PQI A;  1MBY A;  2FMC A;  4JI0 Q;  5HGT A;  1Y1V H;  5IYB H;  5GRO A;  4DV7 Q;  3HZX A;  3LX0 A;  3PGZ A;  1HNZ Q;  3EN2 A;  1AEX A;  4DR7 Q;  3MXN B;  3OPO A;  3ULJ A;  4IN3 A;  1LLR D;  3D0F A;  2RHQ B;  1VQL A;  2BH2 A;  1H95 A;  2DNC A;  3VR6 A;  2D0P A;  1Q86 C;  3TP5 A;  1PDQ A;  1PYB A;  1JT8 A;  2F0I A;  2JSO A;  3TZD A;  4C3H B;  4JV5 Q;  2F3I A;  4JPB W;  2DY7 A;  3J81 j;  3BU2 A;  4H0L C;  1VQH A;  1IXR A;  1GXD C;  1N36 Q;  2KQ3 A;  4JV5 L;  1LV9 A;  3RUZ A;  1G91 A;  1B1Z A;  2GA4 B;  5JOB A;  4DF7 A;  4ME5 A;  1T5X D;  2BE5 C;  1M90 C;  3A7A B;  1VQI A;  2LXK A;  1JR0 D;  4ZLT F;  3S1N B;  2AUK A;  4DR4 Q;  3R3O A;  4XQJ A;  3K81 C;  5IT9 c;  1K8G A;  1TWG H;  2QGQ A;  1WTO A;  3KF8 A;  2LKV A;  4G57 A;  3PUZ A;  2JA6 H;  4DKA C;  2N3S A;  4WOR A;  2MFI A;  5I2Y A;  1DON A;  3WDN A;  1C48 A;  1EFI D;  2Y0S E;  3EBE A;  3KOJ A;  4NW2 A;  1RIP A;  4A3C H;  1PVO A;  1Y8P B;  3ICE A;  5HUR A;  1BCP F;  4DV3 L;  2OCE A;  2A73 B;  2E2H H;  5LL6 S;  4PG3 A;  1LTI D;  5M3F G;  1NMG A;  5EPL A;  1X55 A;  1XPR A;  2E2J B;  1VDZ A;  4IUV A;  3UE0 A;  3JAM L;  1FGB D;  3N6R A;  4QF4 A;  2GN5 A;  2H1E A;  5JJK A;  2JA7 H;  1PH9 A;  2YU9 H;  5M9O A;  3HS0 C;  2RSN A;  1LT6 D;  4JI7 L;  3KUP A;  5JEA H;  2ID0 A;  3T53 B;  3BJU A;  2NZH A;  1X32 A;  2A69 D;  4DUY L;  4CJ0 B;  2A68 C;  4KHZ A;  3QOL A;  4GN4 B;  5FOB B;  3S24 A;  3ONA B;  3I56 A;  4B3R Q;  1EYG A;  4OO1 H;  4XQQ A;  3I91 A;  2F0K A;  3ER0 A;  2IX0 A;  1EYD A;  4LFC Q;  1P8L A;  1RKN A;  5C4J B;  5FLX c;  2EJF C;  5CV4 A;  1E2V A;  1TY0 A;  4DAV A;  1ENF A;  1KRS A;  3TZU A;  1PFB A;  4X3S A;  1K8M A;  3V05 A;  2K5D A;  5TSS A;  3CRK C;  1CZG A;  4YHH L;  1RHP A;  5KIX A;  3CCS A;  1PA6 A;  4PMW A;  3PV0 A;  3A8I E;  2I07 B;  2O5J C;  2B2T C;  4EGV A;  2KA7 A;  4QQB X;  4JI6 L;  2EXD A;  1O7L A;  3BYY B;  2HHH Q;  4DR6 Q;  4JOI A;  4P72 A;  5JJZ A;  2F0D A;  2VUM G;  3O13 A;  3CXC A;  1WI5 A;  3R2T A;  3P7J A;  2A68 D;  3IKJ A;  1PTO C;  1VQP A;  1QUQ A;  2KOL A;  3S1M B;  2EXZ A;  1EY6 A;  3GTG B;  2OT2 A;  4B3M Q;  3PF5 A;  5IWA L;  1OXX K;  3S2D H;  2NYZ D;  4B9X A;  5DM7 3;  3KLS X;  4GNX A;  3S1Q H;  1D1K A;  1HNX L;  1YHB A;  1TQO A;  1M1K C;  1W6J A;  1JE4 A;  1FJG Q;  2ICI A;  3PIP 3;  3S1R B;  1VQJ A;  2NN6 I;  2WKC A;  3JC6 6;  2Z4H A;  5FLX L;  3TEH B;  1B9N A;  2EY1 A;  5C5L A;  4A3B H;  4MTK A;  1A2T A;  1GOZ A;  3DWQ A;  1GUT A;  2ZJQ A;  2ZM6 L;  4RHS A;  4DK0 A;  2VQF Q;  1NE3 A;  1VQD A;  2VQE L;  4B3S L;  4DR2 L;  1EFW A;  5E1F A;  1YBY A;  4JYA L;  4J6H A;  4RFB A;  2Q8R E;  4A3K B;  5KGU A;  1G51 A;  2L11 A;  4ZUI A;  4DA2 A;  1KLG D;  3GV3 A;  4K5W A;  4FNF A;  4Z9C B;  1SXT A;  4RGN A;  4OGQ C;  4MZ9 A;  5E3F A;  2IX3 A;  3S2H H;  5CV7 A;  1QNK A;  4N9T A;  4A3I G;  1HA6 A;  5FO8 B;  1CI3 M;  1CKN A;  3HEJ A;  1R9T H;  5I2X A;  1D2B A;  1EL0 A;  3RZO B;  3DUZ A;  4M1U B;  4X3U A;  3W1B A;  3NP8 A;  3JAM i;  2XN9 C;  3D3R A;  1PYS B;  3TS0 A;  1PH5 A;  2Z0S A;  2OQK A;  3MFY A;  1YHA A;  4CHT B;  3RN2 A;  4LUV A;  4R4Q A;  3PF4 A;  3MA2 B;  5ELD A;  1WTP A;  2B2W C;  3ND8 A;  1XTD A;  4GOP A;  1HH2 P;  3HKZ E;  3H0G H;  1ET6 A;  3I72 A;  4DR3 L;  4HCS A;  2MP1 A;  2WB1 G;  3KFU A;  4C3I H;  5IT9 L;  4HN7 A;  4HCE A;  1IYV A;  2R3Z A;  4X66 Q;  5D3I B;  3TP6 A;  3URY A;  5IOD A;  4C2M H;  1IL2 A;  3GTL B;  1IYJ B;  3L0O A;  5IE8 A;  1PZI D;  4ZKB B;  3R2I A;  1JB3 A;  1E22 A;  2CWA A;  4K8J A;  3K6O A;  5HY6 A;  1EWH A;  1S5D D;  2OEO A;  2PQA A;  1ZYR D;  2JA5 H;  1I3Q H;  1I4X A;  2Z8L A;  4OHJ A;  4PMB A;  4GKK Q;  3VR3 A;  4HJ9 A;  1EQQ A;  1A3U A;  3OW2 A;  1SE2 A;  2K04 A;  1O78 A;  4LF8 Q;  1A2U A;  1PH2 A;  2VUM B;  2JP1 A;  4YY3 L;  1O7Y A;  2F0Q A;  3WOF A;  1FL0 A;  1NBW A;  1TS4 A;  1NAP A;  4IUP A;  2EYF A;  2PW5 A;  4BY7 G;  1BUV T;  4LFB Q;  4KI0 A;  4V0B A;  1IW7 C;  2XSC A;  1XJV A;  2UXB L;  3MXN A;  1CSP A;  5FO7 B;  4FDB A;  1O7Z A;  3E9H A;  4B3M L;  1WTX A;  5NUC A;  1XPU A;  1VQB A;  2WAQ G;  4YCW A;  4OX9 Q;  4RA8 A;  1Z6H A;  2G5D A;  4HED A;  4F87 A;  2XRQ D;  2H4O A;  2C35 B;  4HMI A;  1K0R A;  1HCZ A;  2HDL A;  3RD4 A;  3F2B A;  1BBU A;  3K7A H;  2MO1 A;  5C5M A;  1HFG A;  1A3T A;  2Q8T A;  2G9H D;  3K5N A;  1XMO Q;  3I4M B;  4NXN L;  1CHQ D;  1PRT D;  1E3P A;  2A6E C;  1PZJ D;  4X65 Q;  4TVA B;  1QB5 D;  4HIM A;  3K7A B;  4BA2 I;  2XTI A;  4NMZ A;  4N8X 1;  2WAC A;  3HKZ G;  4OWX B;  3D6W A;  1Y1W B;  1Q1B A;  2K33 A;  1X3E A;  2UU9 Q;  4DV0 L;  2UUA L;  1F9R A;  4IJL A;  2BA1 A;  3RZD H;  5J3B A;  3TQY A;  4YWK A;  4DK3 C;  1VQG A;  4OIK A;  1EY8 A;  1FNW A;  2MPM A;  4LFA Q;  2DUD A;  5M5Y B;  1E1T A;  3C1F A;  1SRU A;  3HOZ G;  1LTB D;  1KAW A;  4LUZ A;  3K59 A;  1K8O A;  4IQZ A;  4A93 H;  3HOX H;  1M4V A;  4RKL A;  3MEF A;  1IBK L;  2H5X A;  2MUY A;  1EYC A;  4GLV B;  3Q8D A;  1VMC A;  1KXL A;  4BXX G;  3KDF A;  3E0E A;  2NTT A;  5M3F B;  3C3L A;  3OYY A;  3HOY G;  1DZ1 A;  4L5S A;  4LF6 L;  3AMU A;  3M85 A;  3HOW G;  4CKC A;  5M3M B;  1Z9F A;  1HJP A;  1K28 A;  4KHP Q;  2PQA B;  1PMR A;  1GO3 E;  4KJN A;  2YTY A;  1ASY A;  4KMU C;  1E2W A;  1ESF A;  2BA0 A;  1K73 C;  4KHV A;  3VYT A;  1STG A;  3M7N A;  4A3D B;  1T5E A;  1WTW A;  1MI2 A;  2DJF C;  4GNX C;  4DR7 L;  4RG1 A;  4TKO B;  3GTP B;  1SMX A;  1D5X C;  3EJI A;  4KKU A;  2QIL A;  3LWU A;  2CW0 C;  1Y8N B;  1X3G A;  3NBH A;  1I6H H;  2UXD Q;  3OWF A;  4R4O A;  4MHE A;  3J81 L;  2LXJ A;  3GTP H;  5ELC A;  5I9P A;  2JA5 G;  1XMO L;  1E2Z A;  1WJJ A;  1CKN B;  4Y7N H;  4LF8 L;  3AU7 A;  1BBX C;  2RDH A;  2E75 C;  2HDM A;  5IYD H;  2PZT A;  5CBA E;  2EYP A;  4ABN A;  2A5H A;  4DV5 Q;  4I65 A;  3HP3 A;  2ES2 A;  2HQL A;  1A6X A;  1NTG A;  4V19 0;  3BS1 A;  4CJ2 C;  2RF4 A;  2NVQ H;  4DGZ A;  3FKI G;  4GNX B;  2A6H C;  3J7A V;  1BCP D;  1CA6 A;  5C4X B;  4RGT A;  5JVG 3;  3A5U A;  1S5C D;  3PCO B;  5K5P A;  4Y52 H;  1PFM A;  4DR1 L;  2WV6 D;  4X66 L;  3G7L A;  5COY A;  1PH6 A;  5IP7 H;  3A8K E;  4K0K L;  4LK1 C;  2MGS A;  1EIH A;  1EIG A;  3G6J B;  1Q46 A;  4C1N K;  1S3O A;  2VZA A;  3KF6 A;  1JOR A;  1STH A;  3G6E A;  4CKE A;  5IY0 A;  2EQS A;  1PH3 A;  5KNC A;  3VR2 A;  1IHZ A;  3U4V A;  4LNQ A;  4MNO A;  3LGJ A;  1K83 H;  3F2U A;  1G6Z A;  2K1B A;  3I90 A;  1UEA B;  5C0X H;  4UPA A;  2NVY B;  3P20 A;  2O5I C;  2YV5 A;  5C3E G;  4JI8 L;  3CMA A;  4NP5 A;  2F0P A;  4HSP A;  4K2K A;  5ISR A;  3PO3 B;  1BCP C;  5D65 A;  2O4X A;  3I3C A;  3CCR A;  4LF6 Q;  2B63 H;  3H09 A;  1F77 A;  4IUU A;  2A6E D;  1BO0 A;  1H9S A;  4KK7 A;  4LF7 L;  2KHJ A;  2F0V A;  5COR A;  1TWA H;  4OX9 L;  3EQL C;  1C8C A;  4IOA A;  1CQV A;  1CHP D;  1TWC H;  1SNQ A;  1MD2 D;  5BN3 A;  2R92 G;  1EY0 A;  3C1E A;  3A56 A;  2A8V A;  1BR9 A;  2IY5 B;  4QJF A;  1BKB A;  3J80 c;  3ERO A;  4RGO S;  3MFG A;  3ULL A;  3TRZ A;  1RD9 D;  1JIC A;  5DNF A;  2PMZ E;  5C3E B;  2YU9 B;  1SYB A;  1IBM L;  3DLL A;  1D7Q A;  3VR5 A;  3PO2 B;  4DR1 Q;  4LUO A;  1CQF A;  3GTM B;  2B2V C;  1FYC A;  2YTV A;  1LT3 D;  1ESR A;  1QIL A;  4C3H G;  1EOT A;  2IJ0 A;  4JYA Q;  2B2W A;  2X69 A;  1S5B D;  1FNV A;  4DV5 L;  3FMC A;  2CQO A;  1XTC D;  5LMU L;  2DY8 A;  1QWY A;  4L5Q A;  3RMH A;  1VQA A;  4QUF A;  5C44 B;  1N8R C;  1EY4 A;  4QL5 A;  4XYO A;  5EJW A;  3S1Q B;  3IFD A;  2K5H A;  1PTO F;  2IWH A;  4MIU A;  4WFN 3;  3GV6 A;  2JA8 B;  1KDC A;  3GDE A;  4B9W A;  1IL8 A;  3RLF A;  2K01 A;  1LAB A;  2L9H A;  3H91 A;  1F9S A;  4A4I A;  4R9W A;  2RCN A;  2QF7 A;  1ML0 D;  1PRT B;  1Y8O B;  4XXE A;  3STB C;  2KVM A;  1QVF A;  4HJA A;  3U9S A;  5JJI A;  1XXG A;  1YIT A;  2FHT A;  2R7Z B;  5IWA Q;  4GOP B;  4KD4 A;  3I4M H;  4ZRZ A;  1LTG D;  2F0L A;  4QIW E;  3M4Q A;  5EKK A;  3MC0 B;  4LF9 L;  3I4N B;  1D5Z C;  1V43 A;  1PXU A;  1E0B A;  2Z1C A;  4WRD A;  3J7Z C;  5C44 G;  4UDU C;  2K32 A;  3GTJ H;  1DYQ A;  4K5V A;  5DAU A;  5JVH 3;  3FP9 A;  4A3I H;  4GKK L;  1ILQ A;  1Z47 A;  3OMC A;  1GUW A;  5JAV A;  1HA5 A;  2K5W A;  3GTJ B;  2P5Z X;  1B8A A;  3SK8 A;  3Q22 A;  1ENC A;  1IBK Q;  4A3J G;  1PTO B;  2A19 A;  1Z7T A;  5M5Y H;  2SOB A;  1KAA A;  2GVB A;  2IX1 A;  4ZK9 B;  2D2C C;  1JWU D;  1UE1 A;  1V9P A;  3K80 C;  3GTQ B;  1VS0 A;  4A3B G;  2CW0 D;  2EDG A;  4JBJ A;  3KLW A;  1E24 A;  4HMJ A;  1EEI D;  2EZV A;  1SNO A;  2JN4 A;  4U67 3;  3PUV A;  3HOU B;  3FHW A;  1HNX Q;  4KV6 A;  1VQE A;  3U58 A;  1QNU A;  2M2L A;  3S17 H;  1ASZ A;  1XMQ L;  2LMC B;  3VDY A;  5ELN A;  1NR2 A;  3NE5 B;  3A7L A;  1VCI A;  4LJZ C;  1AW7 A;  1R4P B;  1GD7 A;  3EIV A;  5EPK A;  1D1I A;  1X65 A;  1Q7Y C;  4DR3 Q;  4HAE A;  2IPK D;  3WWV A;  2KEN A;  2N88 A;  5FLM G;  3MEH A;  2VUM H;  3AFQ A;  2A6H D;  2RKS A;  4JBW A;  3DMU A;  2VQF L;  2NVX B;  3T1H Q;  3HOU G;  3GTO H;  2DJG C;  2IHF A;  1LTL A;  1Y1V G;  5IYB G;  2ZTD A;  3L2P A;  4A3M H;  4AQY Q;  1KAB A;  4F88 A;  4QY7 A;  1EU4 A;  3C46 A;  3NTH A;  3TN2 A;  1SNM A;  3GTO B;  1PH4 A;  1JQY D;  1HZ9 A;  2KCN A;  1K3B C;  4DR5 L;  5GQO A;  4Q5V A;  2B29 A;  1WCM G;  5D14 A;  1WD1 A;  3I7F A;  4DV4 Q;  4C3J G;  1SND A;  4QCL A;  2KCC A;  3NUC A;  1GUN A;  2Z9H A;  1I50 B;  2RBM A;  2RDG A;  4TSS A;  2MJ8 A;  1E1O A;  2PMZ B;  1B44 D;  3UI2 A;  1TY2 A;  1KDA A;  3TP7 A;  4IFD H;  2ALY B;  2B2Y A;  4DXF A;  4BBS H;  4IJH A;  3GP7 A;  2R7D A;  3VA7 A;  4GLA C;  4IUT A;  1PH1 A;  2ENB A;  4FYD A;  1H9M A;  3PSI A;  2C9O A;  1EYA A;  4DUZ L;  1K83 B;  5IP9 G;  1QG7 A;  1LAC A;  4IPD A;  3SVM A;  3VYU A;  1F2L A;  1CTM A;  4PMC A;  3NXW A;  2UXB Q;  2BH8 A;  4K2L A;  3SR1 A;  2WII B;  2WKD A;  3ND9 A;  4CBV A;  5C0X J;  3FKI B;  4KY6 A;  3T51 B;  1L1O B;  4FF4 A;  2K03 A;  2OQ0 A;  2CQA A;  2FFK B;  3JAM E;  3A74 A;  4LFC L;  4APV A;  2ICE C;  2R93 G;  1Q12 A;  3T1Y L;  2K75 A;  3CC4 A;  2X6G A;  5BN4 A;  2B63 B;  5CV8 A;  1GHJ A;  3I4L A;  4XT1 B;  4IUQ A;  1L0W A;  2PPB C;  3HOV B;  1YNX A;  5HGQ A;  3PMF A;  2K5N A;  2AHO B;  2AQ2 B;  1JC7 A;  1A63 A;  3BDO A;  1UAP A;  2UU9 L;  1B2T A;  4NDX A;  4DV6 L;  1CK1 A;  1Y1W H;  2L15 A;  3R8B A;  4RCN A;  2LFN A;  2VW9 A;  1SFO B;  3NQT A;  1NJI C;  2EJM A;  2KHS A;  4L63 B;  1SYF A;  4QGU A;  4OON A;  4RH6 A;  3S15 B;  2Z6K C;  1N33 L;  2B3G A;  3CU7 A;  4ZUJ A;  4HR7 B;  3PO3 G;  1TU2 B;  3QR8 A;  3HRZ C;  2JA9 A;  1EEF D;  3HOV G;  1GUG A;  2L0C A;  1YHQ A;  1I5F A;  3HOX B;  3BZD B;  3J7A F;  1SMY C;  4JCV E;  3NHH A;  2F1M A;  1TII D;  5J22 A;  3NSW A;  2Q2U A;  4GN3 B;  4LMQ D;  4DPG A;  4KTA A;  4ZKC B;  3HFZ B;  1MHW C;  4DV2 Q;  1I4H A;  2EY5 A;  4P73 A;  4PZ6 A;  5I6W A;  1Q8K A;  2F0W A;  4OEM B;  1O7I A;  4LF7 Q;  2PCF B;  1F2Z A;  1TXY A;  1QVG A;  4DFA A;  1KC8 C;  2NZ1 D;  1UUP A;  1FR3 A;  1RF2 D;  4ME3 A;  4UP9 A;  1VQ5 A;  4PNY A;  4BXX H;  2K28 A;  3HOZ B;  4GZY C;  4I7Z C;  3UDG A;  5C4J H;  3SXH A;  1U5K A;  4I7A A;  3GTK H;  3HOX G;  1QJO A;  1YNJ D;  5IOC A;  5M5W B;  1G2S A;  3GTG H;  1KIX A;  1HTL D;  1T9H A;  3D31 A;  5JEA J;  3QWN A;  3X3N A;  4IUN A;  4F7X A;  1HZB A;  2HIX A;  3HKZ B;  4UP7 A;  1YJN A;  3SHL A;  3CCQ A;  2DN8 A;  1EOV A;  1QVC A;  1LO5 D;  1U4R A;  2ZT9 C;  3AB9 A;  3FPP A;  3HKS A;  1EUJ A;  1BF4 A;  2OTL A;  5IGC A;  3M4O H;  2N49 A;  3PUX A;  3T1Y Q;  1SSO A;  1NCV A;  1PHJ A;  3Q6S A;  2E2D C;  1PV4 A;  3S1M H;  2IHE A;  5LMN W;  1CA5 A;  2VNU D;  2A1A A;  4ULL A;  2CKZ B;  2AWO A;  4AYB E;  4CDC C;  1MSH A;  3UDF A;  3MTS A;  5F2D A;  2FIN B;  4LF4 L;  2F0J A;  2YYZ A;  3PUY A;  4H13 C;  3OWE B;  3CPW A;  1AP0 A;  3NTI A;  1STY A;  1VQO A;  2E2I H;  5IGE A;  4J15 A;  2K4K A;  1LTT D;  2ZXP A;  1A8V A;  4L5R C;  1RJT A;  2FMM A;  3J80 E;  2PNH A;  2ZTE A;  1HFN A;  4A3M G;  1UE6 A;  3RLO A;  1BCP B;  3IL8 A;  3HOU H;  3I8Z A;  3TBI B;  3QG1 A;  4DNT B;  4PV1 C;  3IRB A;  4R8I A;  5GAH C;  3UDI A;  4DV4 L;  5GAD C;  4BY7 H;  4EX5 A;  1YIJ A;  3KJP A;  3N52 A;  3OOC A;  2G9D A;  2EE1 A;  2VB3 X;  2K7V A;  4POG A;  1MSG A;  2MQH A;  1HXY D;  3L9A X;  2HT1 A;  2WFW A;  2F03 A;  3GTM H;  3PO3 H;  1HTP A;  1QZG A;  1YI2 A;  4KY5 A;  2F0F A;  3NEM A;  1KRT A;  2JA5 B;  2EYJ A;  1VQC A;  3H6M A;  1RTO A;  4DV0 Q;  2UUA Q;  1ET9 A;  3BZK A;  4ALP A;  1O80 A;  4LF5 L;  4DUY Q;  1KTK A;  4A3E G;  2BE5 D;  5DM6 3;  4NXM Q;  1C4Q A;  2Z4I A;  1JCK B;  2NBF A;  1N32 L;  1Y1W G;  1DGS A;  3IAY A;  4HSV A;  4WJ4 A;  3RR5 A;  2L12 A;  4MN3 A;  1PRT C;  1TWH H;  5M5X H;  4C3I B;  2I5L X;  1CZW A;  1F9Q A;  3DHQ A;  1STE A;  3PO2 H;  4A3F H;  1VQN A;  2LSS A;  4O1N A;  3FEW X;  2V1C C;  3M4P A;  4AYB G;  4A3J H;  4BS9 A;  4FF3 A;  2K50 A;  4JOI C;  1B7Y B;  3OW7 A;  4A93 G;  3NQI A;  1X54 A;  4X6A H;  4LAA A;  4C56 C;  4EQO A;  2AUJ D;  4LW1 A;  4P71 A;  3Q24 A;  1YEZ A;  1ROD A;  4A3L G;  3P1H A;  1L2F A;  5FJ8 H;  2KHI A;  5CV5 A;  1V8Q A;  1SYD A;  4TQU S;  2M9V A;  4A76 A;  3SK4 A;  3MZ5 A;  1KQS A;  2NTS A;  2JEA I;  1DCZ A;  1SE8 A;  1NY4 A;  2KEE A;  3S1N H;  4IFD G;  4BY1 G;  4KJO A;  1BDO A;  3BYT B;  1WCM B;  1UE7 A;  1XPO A;  3DWP A;  1Q8I A;  2EYM A;  3S2D B;  5BN5 A;  2N55 A;  3K0X A;  1OO9 B;  1WTQ A;  2D0O A;  2CH4 A;  3CCU A;  3I73 A;  4A3K G;  2PYK A;  2D62 A;  2C5C A;  1VQ7 A;  3I2Z A;  1TWF H;  1B9M A;  4DAY A;  3HOY B;  3I4O A;  4DU9 A;  4JI3 L;  1U0L A;  5M3M G;  2R7Z H;  1WCM H;  4G7Z C;  4QUC A;  2VXW A;  2LS0 1;  3S1R H;  3BG3 A;  1I4R A;  4WJ3 M;  1OXU A;  3K58 A;  4DK6 C;  2CCZ A;  2CHB D;  4NKL A;  2NN6 G;  3F1Z A;  4LFB L;  1LM0 A;  1TWF B;  4JI4 L;  1OXT A;  3U9O A;  1KNA A;  3U4Z A;  2E2J H;  1NSN S;  3H3V I;  5DLQ E;  1FVI A;  1QUQ B;  3CAM A;  1KNE A;  2NB0 A;  3H3V H;  4DK1 A;  1XX8 A;  4RHR A;  1Q90 A;  2R7F A;  4GKJ L;  2ATW A;  2F4V Q;  2JQO A;  2R6G A;  1C9O A;  4RCO A;  4HJ8 A;  3CC2 A;  1FJG L;  1I4P A;  1Q82 C;  1D8L A;  4FVM A;  1J6Q A;  3RNU A;  2XGT A;  2VL6 A;  2JJQ A;  2I0Q A;  2AMC B;  3RZD B;  3AEV A;  4DAM A;  4CDE C;  4KD3 A;  1IBL Q;  3TRE A;  4P2C B;  4A3D H;  3ERQ A;  2HCC A;  3ERS X;  1UE5 A;  2RVL A;  2QEX A;  5KEE A;  4G7H C;  4YCU A;  4IOC A;  4B08 A;  1XNQ L;  3EFX D;  2L1B A;  4NPS A;  2F0S A;  2RHS B;  1EWC A;  2IL8 A;  5AJ3 L;  3OIQ A;  2ZXO A;  4RKB A;  4OO1 G;  1S5F D;  3T4A C;  4AH6 A;  4PZ8 A;  3CQZ B;  5JPN C;  1IBM Q;  1B3A A;  3D4R A;  3H0G G;  2ASB A;  1XNR Q;  1IKM A;  1D6E C;  5M5W H;  1WD0 A;  4JVZ A;  2UUB L;  4JI1 L;  1Q1E A;  2NVQ B;  1W6K A;  1PTO D;  1JOQ A;  1RL2 A;  1DOK A;  2EJG C;  1I4G A;  2JYO A;  1OXV A;  4IUR A;  1C7Y A;  2R61 A;  4BBS B;  1HZA A;  3K5M A;  1S40 A;  3J81 i;  2CWP A;  1I4Q A;  1I6H B;  5IGD A;  2UUC Q;  1PFS A;  4JI7 Q;  4WJW A;  1DXM A;  1CM9 A;  1LYL A;  2K5Q A;  3KBG A;  1JJC B;  4DNR B;  3LNN A;  2MNA A;  2QCP X;  4XIG S;  5CR3 A;  1WVL A;  4DV3 Q;  1EY9 A;  1S4Z A;  3FKI H;  3PO2 G;  3F8T A;  3T56 B;  1DJR D;  3MVV A;  4JC0 A;  4O2D A;  4EVO A;  2WAQ E;  4A3B B;  2OF1 A;  4A3E B;  4MTN A;  2JA6 G;  4EQP A;  1ZXT A;  1MKH A;  2E2I B;  1QOH A;  1TKW B;  4DV7 L;  5G3L D;  1V1Q A;  5E4W C;  1VF7 A;  4C1N I;  5T1G A;  4K0K Q;  1KHI A;  3J80 i;  3CCL A;  1AZQ A;  5FO9 B;  4RAU C;  4QIW B;  1ICW A;  3V2T A;  4CJ1 B;  3H3V C;  4ZQ3 A;  1SYE A;  1IKL A;  4RMF A;  5CV6 A;  1AE3 A;  3EVQ A;  5C3X A;  1EZ8 A;  4HJ7 A;  1F9P A;  4L6T B;  3J81 c;  4DR6 L;  3E0J A;  5EQ0 A;  3KYH C;  4CKB A;  1N36 L;  3Q0A A;  5I6Y A;  2RQX A;  3M3Y B;  4RWS C;  4ID6 A;  2TSS A;  2JA6 B;  1NMF A;  4JK1 C;  1C0A A;  4S3S A;  1JOO A;  4OL7 A;  1VQF A;  1F2Y A;  4JI5 Q;  1TT2 A;  1P16 A;  1IW7 D;  4KN4 C;  2DGY A;  1H9R A;  3W3A A;  3ZYY X;  2F3W A;  1U4M A;  4PZ7 A;  4FXK C;  1L0Y B;  2B2V A;  2AWN A;  2LY7 A;  1TS3 A;  4C2M B;  2JXM B;  3CC7 A;  3NBI A;  4O42 A;  5JJL A;  1B4O A;  1SAP A;  5KYL A;  1VQ6 A;  4M8A A;  4R8N A;  3SK6 A;  3F2D A;  5K36 G;  4HID A;  3NTK A;  1SBB B;  2TMP A;  1XYI A;  1YJW A;  3M9B A;  1QZH A;  5M3M H;  3HOZ H;  4OO1 I;  2OTJ A;  1QE6 A;  5ELB A;  3BDC A;  3I4N G;  4OWT B;  1TS2 A;  3L7Z C;  1BQQ T;  3D6C A;  2B8G A;  1TR5 A;  4N8F A;  2Q2H A;  1X3Q A;  5CBE E;  2Q8I B;  2XWJ B;  1SR3 A;  4GS3 A;  5JEA G;  3CF5 A;  4DNI A;  2DNE A;  1II3 A;  2JA8 H;  1DOL A;  4IFD I;  3CCE A;  4G4K A;  5IGB A;  1H9S B;  2L4N A;  1Y69 U;  1HR0 W;  3GQB A;  3AYH B;  3PIO A;  2JA7 G;  3TS2 A;  3E3X A;  3E6Z X;  1ILP A;  2QEJ C;  2HQE A;  4OEL B;  2VY3 A;  4P74 A;  3I4N H;  2IT1 A;  3GD7 A;  1EZ6 A;  3EA6 A;  1MIU A;  3W1G A;  1SNP A;  2ZJR A;  2AQ3 B;  3S9W A;  5BR8 L;  2JEB I;  1AZP A;  3DEO A;  3A54 A;  3CKI B;  3V96 A;  2SEB D;  4DR5 Q;  2QDB A;  1ENA A;  1J8I A;  1WOC A;  1SYC A;  5C6A A;  2E5L L;  2NWG A;  4QMG A;  5EKI A;  2NVT H;  4B3R L;  3BVZ A;  4GN5 A;  4AQY L;  1BXT A;  1OXS C;  3KBX A;  1CUK A;  3M4Y A;  4FP5 D;  5A35 A;  3S16 B;  2I5H A;  2KJX A;  4JI2 Q;  4R4C A;  1DM0 B;  2WIN B;  5EBD A;  5CC4 A;  2R92 B;  3PIO 3;  1J5E L;  3BDL A;  4HIO A;  2NVT B;  2V4D A;  3A8J E;  4K14 A;  1HHV A;  1HUN A;  4K5X A;  3RN5 A;  4UHV A;  3NEL A;  1ZEQ X;  1SDF A;  1WFQ A;  3R93 A;  3J81 E;  2IW3 A;  5KRU A;  2J7Z A;  2I46 A;  2F0U A;  3B6Y A;  1PH7 A;  3AFP A;  1AFP A;  2XRS D;  3CCJ A;  1JB7 A;  4DAP A;  4YHH Q;  2KCT A;  1HNW Q;  3CP0 A;  4DXG A;  2CH4 W;  2WP8 J;  3L3O C;  1K8A C;  3CD6 A;  1CSQ A;  4A75 A;  5A2Q E;  4A93 B;  1WTH A;  2B2Y C;  2KBN A;  2CFM A;  3SK5 A;  1STN A;  4JI0 L;  3P75 A;  1HPC A;  3KF8 B;  2NVY H;  2F4V L;  2AQ1 B;  4Q0F A;  2XIW A;  1TVX A;  3CCM A;  3TDQ A;  3K7U C;  2RA4 A;  2KEC A;  3GTQ H;  2MHV A;  3FDT A;  3HGB A;  3T1H L;  1N33 Q;  1TWA B;  4YY3 Q;  4DR4 L;  1TWH B;  5M5X B;  1LT4 D;  3DEP A;  4HIK A;  1NUC A;  3CQZ H;  3FPU B;  4EQ5 A;  1TWC B;  1EIY B;  4JBK A;  3QIA A;  4A3F B;  4JI3 Q;  1PLF A;  1V1O A;  2SDF A;  4IO9 A;  2KCM A;  2ZXR A;  1CFM A;  2VS1 A;  2EYH A;  2PO4 A;  4A3M B;  5IP9 H;  2N8N A;  4H7B A;  1SMY D;  2D9U A;  3FRP B;  1IBL L;  5EKL A;  4R4T A;  2PI2 E;  4LFA L;  4L5T A;  1BOS A;  2HIV A;  1D5M C;  4IPG A;  3S14 B;  3KJO A;  2JK8 A;  1PRT F;  2BDO A;  2UUC L;  4LF9 Q;  3U50 C;  4L8J A;  1UEB A;  4X62 Q;  5IT9 E;  2XWB B;  1SRO A;  5IYC G;  5FKA C;  1PH8 A;  3TP8 A;  1I50 H;  4XQN A;  1Q3L A;  1X6O A;  1B53 A;  3NEN A;  1GUS A;  3K8A A;  1SE4 A;  5CMD A;  1EY7 A;  2MO0 A;  3D4D A;  4JI1 Q;  4BBR H;  4DV2 L;  3IFT A;  4C3J H;  4GLX A;  1HNW L;  1LTR D;  1Q81 C;  1W3S A;  1SNC A;  1NR4 A;  4DUZ Q;  4X62 L;  3A5Z B;  1VF5 C;  3G48 A;  1L1O C;  2Q2I A;  1G8Z D;  3MHB A;  5K36 H;  5C4X H;  1LT5 D;  2JE6 I;  3MAQ A;  1GJX A;  4UP8 A;  4JI5 L;  3NWS A;  1X56 A;  1YNN D;  1HR0 Q;  2ZTC A;  3DWA A;  2BOS A;  5EBC A;  4FF1 A;  1CKO A;  4FF2 A;  1G2T A;  1VQK A;  1EWI A;  4A3D G;  4B3S Q;  5I4D A;  2EPB A;  1FD7 D;  5E4X A;  2J4X A;  4YWL A;  3CPF A;  3D4W A;  1A0I A;  1YNN C;  3OMG A;  4RGM A;  4H02 A;  1U4P A;  1YVC A;  1PZK D;  1JWM D;  4DAY B;  2PI2 A;  5FLM H;  3SEB A;  3K0Y A;  4LF5 Q;  4PQX A;  1GVP A;  2UXC Q;  4CDD C;  4DV1 Q;  2D5D A;  1HQR D;  1PFN A;  3Q23 A;  1SEB D;  2E2H B;  3HOV H;  4KY7 A;  3M3Y H;  4G7O C;  1BVS A;  1EQT A;  1SFO H;  3GO5 A;  3KK7 A;  1W2B A;  2Q2T A;  1A15 A;  2K6A A;  5EPJ A;  1TWG B;  2NN6 H;  3VYR A;  3BZC A;  5LL6 X;  4X3K A;  1VQ9 A;  1KLU D;  1AH9 A;  4B3T Q;  3PIP A;  3CCV A;  3KF6 B;  3MXU A;  1GM5 A;  3J7A 5;  2WAQ B;  3MXG A;  2HHH L;  5J1Z A;  1HRJ A;  1MJE A;  4C3I G;  1J9O A;  2PNR C;  1KD1 C;  4A3G B;  1H9J A;  3VYS A;  3X3M A;  2CVR A;  3QOJ A;  1E7Z A;  1Y14 B;  1V1P B;  2J0T D;  2SNS A;  4J8Q A;  4JI6 Q;  4B3T L;  5KNB A;  4X64 Q;  3FVQ A;  3E9I A;  5CYU A;  3SE0 A;  4X3T A;  2K05 A;  1WYD A;  2F52 A;  4GOP C;  4FO2 A;  5FJ8 G;  4O0A A;  2F0G A;  1YNJ C;  4GKJ Q;  2NUC A;  2XVS A;  2K5V A;  2EVB A;  2EY6 A;  3J7Y W;  1S5E D;  5G3L F;  5M3F H;  2E5L Q;  3KLS A;  2AKW B;  1ICF B;  2B8F A;  4XYQ A;  4Y7N B;  4NB3 A;  1S72 A;  1IZ6 A;  1LUZ A;  2ZJP A;  1HZC A;  3M7G A;  2NVX H;  4A3C G;  3KDF B;  1I94 L;  2L55 A;  1B70 B;  1JWS D;  3A0J A;  3J80 L;  3LWE A;  4JBM A;  1SYG A;  3VA5 A;  1FGU A;  1A3V A;  5ELO A;  2Z6B A;  3MXP A;  2M00 A;  5C4Z A;  2WB1 B;  1H9K A;  4X64 L;  1MGS A;  3ZJY C;  2F0T A;  4XT3 B;  4ODG A;  1Y1V B;  1JMC A;  2Z6K A;  2XNA C;  4KN7 C;  4A3E H;  1HR0 L;  3G4S A;  3M4O B;  5JPM C;  1AN8 A;  1XMQ Q;  1K9M C;  2F0M A;  3DM1 A;  3W5O A;  5LMU Q;  2QW7 A;  1J5E Q;  2K14 A;  4K8I A;  1N34 L;  5A2Q L;  1STA A;  4XDX A;  1L0X B;  1QCB D;  4ZAI A;  1HNZ L;  2BCO A;  2X6L A;  3ITP A;  1HQM C;  3TME A;  2L5T A;  4C3H H;  3H15 A;  5C3W A;  2RSO A;  5KND A;  5LMN Q;  5KYI A;  1CT1 D;  1JOK A;  5H1S E;  4DV1 L;  2E8G A;  2F0H A;  2PQE A;  1DD2 A;  4JI4 Q;  4J1M A;  3I70 A;  4IPC A;  1ONL A;  1XNR L;  2QA4 A;  4R1J A;  3DM3 A;  2QKI C;  3NWT A;  3I55 A;  3QB3 A;  1SLJ A;  4K6D A;  3CHB D;  3T16 A;  4AIM A;  2Y0S B;  4TRD A;  1ZKO A;  3S2H B;  2I5M X;  4KHP L;  3HG9 A;  5I9O A;  4OIJ A;  4IAL A;  4OXP A;  3RZO H;  1XWE A;  2NZO A;  2HUG A;  1VMP A;  1U9R A;  1GUO A;  1YJ9 A;  4CGY B;  3D8G A;  1WTV A;  1I94 Q;  1HUM A;  3RLN A;  2PW7 A;  5C4H A;  2UUB Q;  1EQR A;  1SN8 A;  2ZM6 Q;  2R7Z G;  1RCV D;  1EU3 A;  4JI8 Q;  2B63 G;  2O2L D;  3OIP A;  3CME A;  4BBR G;  4BY1 B;  3H0G B;  2VB2 X;  4A3K H;  1K0S A;  4IPH A;  5C3E H;  1NNX A;  4H44 C;  4UY8 C;  4HJ5 A;  1F2M A;  3SDZ A;  2EYL A;  3WOE A;  3GTL H;  5C0X G;  1G6P A;  4BY7 B;  4JI2 L;  1K3R A;  2BDN A;  4BY1 H;  1X3F A;  2QDL A;  2F0O A;  2JA7 B;  1MJC A;  3A55 A;  1YZ6 A;  4FXD A;  1R9T B;  2F0E A;  1I3Q B;  4HTH A;  1EIF A;  3S14 H;  1IYU A;  2OWO A;  4A3J B;  4A3L H;  3BVM A;  3QO2 A;  4JW0 A;  5AFW A;  3F2C A;  1OTC A;  2RDF A;  2F4I A;  3K5O A;  4DN4 M;  2RCF A;  2EIF A;  5C44 H;  2B39 A;  4UAI A;  2E76 C;  5CV9 A;  4QB4 A;  3KLR A;  1JJG A;  3I4M G;  4C3J B;  3QJY A;  4A3F G;  2VQE Q;  1SJH D;  3SGI A;  5FK9 C;  1L1O A;  2FXQ A;  1N32 Q;  1BNZ A;  4E6I A;  3VR4 A;  1JJ2 A;  1R4Q B;  5IYD G;  2PZU A;  5GAG C;  1WTR A;  1LTA D;  1TS5 A;  2B2T A;  4CDF C;  4F8M A;  5LMN L;  2UXD L;  2OXP A;  3NK9 A;  3AQQ A;  4FXG C;  4KKS A;  3T13 A;  3OSO A;  5BR8 Q;  4YIJ A;  1LTS D;  2B2U A;  1B3Q A;  5ELF A;  1VQM A;  2HD3 A;  4LWC A;  1N34 Q;  1B50 A;  5AJ3 Q;  3K57 A;  2KUM A;  5J39 A;  3NBH B;  1VQ4 A;  2GVA A;  4BWG B;  1X3P A;  1PTO H;  1M8A A; 
#chains in the Genus database with same CATH homology
 2Q2U A;  2VY3 A;  2DUD A;  4P74 A;  4LFA Q;  2IT1 A;  3GD7 A;  4GN3 B;  3I4N H;  1E1T A;  4P75 A;  1MIU A;  1SRU A;  3W1G A;  4DPG A;  3HOZ G;  2ZJR A;  4LUZ A;  1KAW A;  5BR8 L;  2JEB I;  3HFZ B;  4DV2 Q;  4KLK A;  3STB D;  4A93 H;  3HOX H;  4XTC S;  4P73 A;  4PZ6 A;  4DR5 Q;  1Q8K A;  3MEF A;  1IBK L;  2H5X A;  1X9N A;  1O7I A;  1WOC A;  4LF7 Q;  1TXY A;  1QVG A;  1KC8 C;  3S16 H;  4GLV B;  3Q8D A;  4YWM A;  4ME3 A;  1A62 A;  3KDF A;  3HOW H;  3ULP A;  4BXX G;  1KXL A;  3E0E A;  4UP9 A;  2E5L L;  3HOY H;  2YTX A;  3OYY A;  1VQ5 A;  2R92 H;  4L5S A;  3HOY G;  4LF6 L;  4NXM L;  3M85 A;  3HOW G;  4BXX H;  1UWV A;  4POF A;  2NVT H;  1Z9F A;  4B3R L;  1AE2 A;  1HJP A;  4GN5 A;  4DV6 Q;  4AQY L;  2PQA B;  3UDG A;  4KHP Q;  2R93 H;  1GO3 E;  3OTO Q;  1OXS C;  5C4J H;  1CUK A;  2YTY A;  1ASY A;  5C4X G;  1U5K A;  4LF4 Q;  3GTK H;  4R4I A;  2I5H A;  3HOX G;  2BA0 A;  4JI2 Q;  1N9W A;  4R4C A;  1K73 C;  4JG2 A;  3CW2 C;  3GTG H;  1KIX A;  4A3G H;  5GAE C;  3M7N A;  3JAM c;  1J5E L;  4HIO A;  1T9H A;  4YCV A;  3S15 H;  1CKM A;  1JE5 A;  3D31 A;  5JEA J;  4GNX C;  4DR7 L;  4RG1 A;  4IFD J;  1SMX A;  1HZB A;  2HIX A;  3RN5 A;  4UP7 A;  3NEL A;  5E7N A;  1YJN A;  3OTO L;  2UXC L;  1WFQ A;  1X3G A;  3CCQ A;  2JA8 G;  1EOV A;  1QVC A;  4BBS G;  3HKS A;  1EUJ A;  1BBW A;  3UDX A;  2WB1 E;  5IYC H;  5C0X I;  2OTL A;  3UE1 A;  3M4O H;  2N49 A;  1XNQ Q;  3PUX A;  4X65 L;  3B6Y A;  4R4O A;  3T1Y Q;  1PH7 A;  3AFP A;  1I6H H;  3CCJ A;  1PHJ A;  1JB7 A;  2LXJ A;  3GTP H;  4YHH Q;  2KCT A;  1HNW Q;  1G29 1;  3CP0 A;  4DR2 Q;  2WP8 J;  4BA1 I;  2JA5 G;  1PV4 A;  1K8A C;  1XMO L;  1CSQ A;  1KL9 A;  4NXN Q;  3CD6 A;  2IHE A;  2K52 A;  1WJJ A;  5LMN W;  2VNU D;  4A75 A;  2A1A A;  3S1M H;  2KBN A;  1CKN B;  2CKZ B;  2AWO A;  2CFM A;  4Y7N H;  3PUW A;  4AYB E;  4JI0 L;  4LF8 L;  3UDF A;  3KF8 B;  1GKH A;  2NVY H;  4LF4 L;  2F4V L;  2N78 A;  5IYD H;  4A3G G;  5EAY A;  3G71 A;  2YYZ A;  3PUY A;  3CCM A;  4OWW B;  3CPW A;  5IP7 G;  4DV5 Q;  2Y0S G;  3K7U C;  2ES2 A;  2HQL A;  1VQO A;  2E2I H;  3GTQ H;  1NTG A;  4J15 A;  2K4K A;  1A8V A;  2RF4 A;  1VQ8 A;  4L5R C;  2NVQ H;  3FKI G;  4GNX B;  3T1H L;  4JI0 Q;  2PNH A;  2ZTE A;  4A3M G;  1N33 Q;  4YY3 Q;  1Y1V H;  1UE6 A;  5GRO A;  3RLO A;  5IYB H;  4DV7 Q;  4DR4 L;  3A5U A;  3PCO B;  2IY5 B;  4Y52 H;  4HIK A;  4DR1 L;  3CQZ H;  4X66 L;  3PGZ A;  1HNZ Q;  4EQ5 A;  3EN2 A;  1PH6 A;  5IP7 H;  3HOU H;  1EIY B;  4JBK A;  4K0K L;  4DR7 Q;  3MXN B;  4JI3 Q;  3IRB A;  1Q46 A;  5GAH C;  3ULJ A;  3UDI A;  4DV4 L;  5GAD C;  4BY7 H;  3D0F A;  1S3O A;  2RHQ B;  2KCM A;  4IO9 A;  4EX5 A;  2VZA A;  3KF6 A;  3KJP A;  1YIJ A;  1VQL A;  2VS1 A;  2BH2 A;  3G6E A;  1H95 A;  5IY0 A;  5IP9 H;  2EQS A;  2N8N A;  1PH3 A;  2D0P A;  3U4V A;  1Q86 C;  1IBL L;  4LNQ A;  1PYB A;  4POG A;  4R4T A;  2PI2 E;  2MQH A;  4MNO A;  2HIV A;  4L5T A;  4LFA L;  4IPG A;  1JT8 A;  3LGJ A;  1K83 H;  4JV5 Q;  3KJO A;  2JK8 A;  2HT1 A;  2F3I A;  2WFW A;  3GTM H;  3PO3 H;  2UUC L;  3J81 j;  4LF9 Q;  3BU2 A;  3U50 C;  1UEB A;  1VQH A;  4X62 Q;  1IXR A;  1N36 Q;  1SRO A;  5IYC G;  1PH8 A;  1QZG A;  4JV5 L;  4UPA A;  1YI2 A;  3NEM A;  1I50 H;  1KRT A;  1X6O A;  3NEN A;  1VQC A;  3K8A A;  2YV5 A;  4DV0 Q;  2UUA Q;  5C3E G;  4JI8 L;  3CMA A;  1M90 C;  1VQI A;  2LXK A;  3BZK A;  4ALP A;  4LF5 L;  4DUY Q;  2MO0 A;  4DR4 Q;  4A3E G;  4JI1 Q;  4BBR H;  3CCR A;  4DV2 L;  4LF6 Q;  3K81 C;  4C3J H;  4NXM Q;  5IT9 c;  4GLX A;  1K8G A;  2B63 H;  1HNW L;  1Q81 C;  1N32 L;  1Y1W G;  1DGS A;  1TWG H;  1W3S A;  4LF7 L;  4WJ4 A;  2KHJ A;  3RR5 A;  2QGQ A;  4DUZ Q;  4X62 L;  3PUZ A;  3A5Z B;  3G48 A;  2JA6 H;  1L1O C;  2Q2I A;  2N3S A;  1TWA H;  4DKA C;  4OX9 L;  5C4X H;  1TWH H;  5M5X H;  2MFI A;  2JE6 I;  4UP8 A;  4IOA A;  4JI5 L;  1X56 A;  2I5L X;  1HR0 Q;  1TWC H;  2ZTC A;  2Y0S E;  3EBE A;  3KOJ A;  2R92 G;  3PO2 H;  4A3F H;  1VQN A;  1RIP A;  2LSS A;  4A3C H;  1PVO A;  1CKO A;  2A8V A;  2V1C C;  3M4P A;  1BKB A;  1EWI A;  4QJF A;  4AYB G;  3J80 c;  4A3J H;  1VQK A;  4B3S Q;  3ICE A;  4A3D G;  2K50 A;  4JOI C;  3ULL A;  4DV3 L;  3TRZ A;  1B7Y B;  4YWL A;  3CPF A;  2OCE A;  1A0I A;  2PMZ E;  2E2H H;  4A93 G;  5M3F G;  4PG3 A;  1X54 A;  3DLL A;  1NMG A;  1IBM L;  4X6A H;  1X55 A;  1XPR A;  4H02 A;  1YVC A;  4LW1 A;  4P71 A;  4DAY B;  2PI2 A;  5FLM H;  4DR1 Q;  3UE0 A;  1YEZ A;  4LUO A;  4LF5 Q;  4A3L G;  1L2F A;  1GVP A;  2GN5 A;  2KHI A;  5FJ8 H;  2UXC Q;  2YTV A;  5JJK A;  2JA7 H;  4TQU S;  1PH9 A;  4DV1 Q;  2YU9 H;  4A76 A;  1KQS A;  3HOV H;  4JYA Q;  3M3Y H;  2JEA I;  1SE8 A;  1BVS A;  4JI7 L;  1NY4 A;  4DV5 L;  1SFO H;  2ID0 A;  3S1N H;  3BJU A;  4IFD G;  3GO5 A;  2NZH A;  4BY1 G;  1D7Q A;  4DUY L;  2CQO A;  5LMU L;  1W2B A;  4L5Q A;  2Q2T A;  1UE7 A;  1XPO A;  1VQA A;  3K0X A;  1N8R C;  4QL5 A;  2D0O A;  4KHZ A;  4GN4 B;  3CCU A;  3S24 A;  3BZC A;  3I56 A;  4A3K G;  2K5H A;  4B3R Q;  2D62 A;  1VQ9 A;  1VQ7 A;  3I2Z A;  1TWF H;  1AH9 A;  4B3T Q;  3PIP A;  3I4O A;  1EYG A;  3GDE A;  3CCV A;  3KF6 B;  1U0L A;  4JI3 L;  3RLF A;  5M3M G;  1WCM H;  2IX0 A;  3ER0 A;  1GM5 A;  2R7Z H;  3J7A 5;  4LFC Q;  3S1R H;  4A4I A;  1P8L A;  2RCN A;  2HHH L;  4WJ3 M;  5FLX c;  1OXU A;  1MJE A;  3STB C;  4DK6 C;  2CCZ A;  1QVF A;  1KRS A;  2NN6 G;  3F1Z A;  4LFB L;  1LM0 A;  4JI4 L;  4HJA A;  1KD1 C;  5JJI A;  1OXT A;  1YIT A;  1E7Z A;  5IWA Q;  4YHH L;  1Y14 B;  3U4Z A;  4GOP B;  3I4M H;  2E2J H;  3CCS A;  4JI6 Q;  3H3V I;  4B3T L;  4QIW E;  3M4Q A;  5DLQ E;  4LF9 L;  1PA6 A;  4PMW A;  1FVI A;  3PV0 A;  4X64 Q;  1V43 A;  1QUQ B;  3CAM A;  3E9I A;  3H3V H;  2R7F A;  4GKJ L;  4JI6 L;  3J7Z C;  5C44 G;  4QQB X;  2EXD A;  2HHH Q;  2ATW A;  4DR6 Q;  1WYD A;  2F52 A;  2F4V Q;  4GOP C;  2JQO A;  3GTJ H;  4JOI A;  2R6G A;  4P72 A;  1C9O A;  5FJ8 G;  4O0A A;  2VUM G;  4HJ8 A;  3CXC A;  3CC2 A;  1FJG L;  1WI5 A;  3FP9 A;  4GKJ Q;  4A3I H;  1Q82 C;  1D8L A;  4GKK L;  2K5V A;  1J6Q A;  3RNU A;  2XGT A;  2VL6 A;  2JJQ A;  1VQP A;  2I0Q A;  1QUQ A;  1Z47 A;  2AMC B;  5M3F H;  2E5L Q;  4B3M Q;  3AEV A;  2AKW B;  3PF5 A;  4DAM A;  5IWA L;  1OXX K;  3S2D H;  1B8A A;  1IBL Q;  4NB3 A;  3TRE A;  1S72 A;  1IBK Q;  4A3J G;  1IZ6 A;  4A3D H;  2A19 A;  1LUZ A;  2ZJP A;  3ERS X;  1HZC A;  1UE5 A;  5M5Y H;  2QEX A;  4GNX A;  1HNX L;  1YHB A;  3KDF B;  2NVX H;  3S1Q H;  1M1K C;  4A3C G;  1I94 L;  1B70 B;  4YCU A;  3A0J A;  1FJG Q;  2GVB A;  4IOC A;  2IX1 A;  4JBM A;  1V9P A;  1UE1 A;  3K80 C;  1FGU A;  1XNQ L;  1VQJ A;  2NN6 I;  5ELO A;  4NPS A;  1VS0 A;  4A3B G;  2RHS B;  3JC6 6;  4X64 L;  5AJ3 L;  3ZJY C;  4OO1 G;  4JBJ A;  3KLW A;  1E24 A;  1JMC A;  2Z6K A;  3TEH B;  4AH6 A;  4A3B H;  4PZ8 A;  4A3E H;  1HR0 L;  1IBM Q;  3G4S A;  3PUV A;  1XMQ Q;  1K9M C;  2ZJQ A;  3W5O A;  5LMU Q;  3H0G G;  2ZM6 L;  2ASB A;  3FHW A;  1HNX Q;  2VQF Q;  1XNR Q;  1J5E Q;  2K14 A;  1NE3 A;  1VQD A;  1VQE A;  2VQE L;  3U58 A;  4B3S L;  3S17 H;  4DR2 L;  1ASZ A;  5M5W H;  1XMQ L;  1EFW A;  1N34 L;  1YBY A;  4JYA L;  3VDY A;  5ELN A;  1G51 A;  1HNZ L;  1VCI A;  2UUB L;  4JI1 L;  1Q1E A;  1GD7 A;  3EIV A;  4C3H H;  3H15 A;  1RL2 A;  1X65 A;  1Q7Y C;  1OXV A;  5LMN Q;  4MZ9 A;  4DR3 Q;  3S2H H;  1C7Y A;  1HZA A;  3WWV A;  5H1S E;  2KEN A;  4DV1 L;  2E8G A;  5FLM G;  4A3I G;  1S40 A;  3J81 i;  1CKN A;  2CWP A;  1R9T H;  4JI4 Q;  2VUM H;  3AFQ A;  4JBW A;  4IPC A;  2UUC Q;  2VQF L;  1PFS A;  4R1J A;  3DM3 A;  3W1B A;  2QA4 A;  4JI7 Q;  1XNR L;  3I55 A;  3JAM i;  1LYL A;  1PYS B;  1JJC B;  1SLJ A;  3T1H Q;  3HOU G;  4AIM A;  3TS0 A;  3GTO H;  1PH5 A;  2Z0S A;  2MNA A;  2OQK A;  3RN2 A;  1YHA A;  2IHF A;  1LTL A;  2I5M X;  1Y1V G;  4LUV A;  2ZTD A;  4XIG S;  4R4Q A;  5IYB G;  3L2P A;  4AQY Q;  4A3M H;  3PF4 A;  4KHP L;  4DV3 Q;  3FKI H;  3PO2 G;  4OXP A;  3RZO H;  3F8T A;  1XTD A;  2NZO A;  4QY7 A;  4JC0 A;  4GOP A;  4O2D A;  1HH2 P;  3HKZ E;  3H0G H;  2WAQ E;  4DR3 L;  1YJ9 A;  2WB1 G;  3KFU A;  4C3I H;  1PH4 A;  4MTN A;  1HZ9 A;  2JA6 G;  1MKH A;  4X66 Q;  1I94 Q;  3RLN A;  4DR5 L;  5GQO A;  2B29 A;  4C2M H;  4DV7 L;  1WCM G;  2UUB Q;  1EQR A;  1SN8 A;  1V1Q A;  2ZM6 Q;  1IYJ B;  3L0O A;  1IL2 A;  2R7Z G;  4JI8 Q;  5IE8 A;  3I7F A;  4DV4 Q;  2B63 G;  3CME A;  4BBR G;  4K0K Q;  1KHI A;  3J80 i;  4A3K H;  1E22 A;  3CCL A;  2CWA A;  2UXD Q;  5HY6 A;  2PQA A;  4IPH A;  5C3E H;  2JA5 H;  1I3Q H;  4UY8 C;  4HJ5 A;  1E1O A;  4GKK Q;  4HJ9 A;  3GTL H;  5C0X G;  1EQQ A;  4RMF A;  1G6P A;  1AE3 A;  4JI2 L;  3OW2 A;  1K3R A;  4BY1 H;  2ALY B;  1X3F A;  4HJ7 A;  3J81 c;  4DR6 L;  4BBS H;  3KYH C;  1MJC A;  4IJH A;  1YZ6 A;  1N36 L;  4LF8 Q;  2R7D A;  1PH2 A;  4GLA C;  1PH1 A;  4YY3 L;  3PSI A;  1EIF A;  4DUZ L;  3S14 H;  5IP9 G;  2OWO A;  1NMF A;  1FL0 A;  4IPD A;  1NBW A;  4A3L H;  1C0A A;  1VQF A;  4BY7 G;  2UXB Q;  4JI5 Q;  3F2C A;  1P16 A;  2BH8 A;  1OTC A;  4LFB Q;  4KI0 A;  2DGY A;  5C0X J;  2EIF A;  5C44 H;  1L1O B;  1XJV A;  2UXB L;  2OQ0 A;  1CSP A;  3A74 A;  4LFC L;  4PZ7 A;  4APV A;  2R93 G;  4FDB A;  1Q12 A;  3T1Y L;  2K75 A;  3CC4 A;  1JJG A;  4B3M L;  3E9H A;  3I4M G;  2AWN A;  4A3F G;  2VQE Q;  1XPU A;  1VQB A;  2WAQ G;  4YCW A;  4OX9 Q;  3SGI A;  1L0W A;  3CC7 A;  5JJL A;  1VQ6 A;  1YNX A;  5HGQ A;  2K5N A;  1L1O A;  2AHO B;  3F2D A;  5K36 G;  2FXQ A;  1N32 Q;  4HID A;  2C35 B;  1K0R A;  3F2B A;  1A63 A;  2UU9 L;  1YJW A;  1BBU A;  3K7A H;  2MO1 A;  3M9B A;  1JJ2 A;  5IYD G;  4DV6 L;  5M3M H;  1QZH A;  3HOZ H;  1Y1W H;  2L15 A;  4OO1 I;  1XMO Q;  2OTJ A;  4NXN L;  3I4N G;  2VW9 A;  5GAG C;  4OWT B;  3L7Z C;  1NJI C;  1E3P A;  5LMN L;  4X65 Q;  2UXD L;  2Q2H A;  4TVA B;  4HIM A;  4QGU A;  4OON A;  3AQQ A;  4BA2 I;  2XTI A;  3HKZ G;  4OWX B;  2Z6K C;  1N33 L;  1Q1B A;  5BR8 Q;  2B3G A;  1X3E A;  2UU9 Q;  1SR3 A;  4GS3 A;  4DV0 L;  2UUA L;  3PO3 G;  5JEA G;  3CF5 A;  4IJL A;  2BA1 A;  4DNI A;  1VQM A;  2JA9 A;  4LWC A;  1N34 Q;  2JA8 H;  3CCE A;  4IFD I;  3HOV G;  3RZD H;  5J3B A;  3TQY A;  1HR0 W;  1YHQ A;  1I5F A;  4YWK A;  4DK3 C;  1VQG A;  5AJ3 Q;  3AYH B;  3NBH B;  4JCV E;  3PIO A;  1VQ4 A;  2GVA A;  2JA7 G;  3TS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...