2JP1A

Solution structure of the alternative conformation of xcl1/lymphotactin
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
60
structure length
60
Chain Sequence
VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lymphotactin
publication title Interconversion between two unrelated protein folds in the lymphotactin native state
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 5
structure length 60
sequence length 60
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2jp1A00
4HSVA 1PDQA 2SDFA 3FPUB 1B4OA 1HUMA 1XX8A 1ILPA 1X3PA 1ML0D 1PFMA 2CVRA 2EPBA 4HAEA 1AZPA 2MJ8A 2R3ZA 1WTRA 1Q3LA 2B2WA 3Q6SA 4IURA 4RWSC 1BF4A 1G6ZA 1U4PA 2L12A 1WD0A 1HHVA 1IL8A 2HCIA 2RSOA 4NW2A 2B2VC 2MGSA 2XIWA 4IUVA 1MGSA 4X3KA 1XYIA 1S4ZA 4U68A 2KOLA 1WTOA 2VXWA 2X69A 2B2YA 1WTPA 1O7ZA 4RAUC 1CM9A 1NAPA 1QNKA 2RVLA 3HP3A 4QUCA 2FHTA 4ZK9B 1WTVA 1X32A 2B2UC 3LWEA 4UAIA 4CJ0B 4HCSA 2HUGA 3I8ZA 5EPKA 2L4NA 1A15A 4XDXA 3ONAB 5EKIA 1JE4A 1G91A 1CA6A 1VMPA 2FFKB 5CMDA 5E4WC 3MWYW 2B2TC 5AFWA 1U4RA 1PLFA 3G7LA 1SAPA 2K05A 1DOMA 1NCVA 2X6GA 2MPMA 3I3CA 1O7YA 2B2VA 1RJTA 4ZKCB 2D9UA 3TZDA 1U4LA 2BDNA 5CBEE 1WTQA 1SDFA 1RODA 4IUUA 1KNAA 4MN3A 1B53A 2N88A 3IL8A 2B2UA 3IFDA 4R9WA 1MI2A 1E0BA 1DOKA 1RHPA 2KVMA 4IUPA 4OIKA 1LV9A 2JYOA 1B2TA 1DZ1A 5E4XA 2Q8RE 2FMMA 5D65A 1U4MA 1ESRA 3F2UA 3GV3A 2K03A 3KBXA 1VMCA 2B2TA 1CA5A 2EOTA 1EIHA 2FINB 1G2SA 1F2LA 2L1BA 2FJ2A 4X3SA 4XT1B 1G2TA 4X3UA 5DNFA 1BO0A 1RTNA 2DY8A 2L9HA 4ZKBB 3FDTA 1NR2A 3I90A 4MHEA 2RSNA 4IUQA 1B50A 2NYZD 2X6LA 3P7JA 5T1IA 2J7ZA 2NWGA 4ZLTF 1J8IA 3SVMA 5JJZA 2JP1A 4HEDA 1NR4A 1F9RA 5T1GA 1IKMA 1HFNA 2K01A 1WD1A 1BBXC 2DY7A 5COYA 5CORA 1DONA 3DEOA 2EE1A 1F9SA 1PFBA 1ILQA 1IKLA 2RA4A 4CJ1B 1WVLA 1BNZA 5EJWA 2N55A 3N52A 4ZAIA 3DM1A 1ZXTA 1QE6A 2K1BA 2L11A 1F9QA 4R8IA 1B3AA 1X3QA 3TN2A 5CBAE 1HA6A 2KEDA 4LMQD 1C8CA 1ICWA 1SSOA 3KUPA 4RA8A 4QUFA 2HCCA 3GV6A 4IUTA 4CJ2C 2M2LA 1WTWA 1AZQA 1GUWA 2B2WC 1TVXA 5EQ0A 3QO2A 1HFGA 1PFNA 5EPJA 2K28A 1EL0A 1EIGA 1F9PA 1J9OA 1EQTA 1RTOA 4XT3B 1M8AA 2IL8A 3DEPA 5D14A 4X3TA 1DOLA 1KNEA 1QG7A 3R93A 2HDLA 4O42A 2KUMA 3D6WA 3I91A 5EPLA 2K04A 2Q8TA 3UI2A 2B2YC 4DN4M 1HRJA 2KEEA 2KECA 4OIJA 1EOTA 3MTSA 1MSHA 2HDMA 1O80A 2NZ1D 1HUNA 1MSGA 1JICA 2H1EA 2MP1A 1WTXA 1AP0A 3H91A
chains in the Genus database with same CATH superfamily
1RIPA 5ELBA 1STBA 4HSPA 3M85A 4B3RL 3F2BA 2RSOA 5ELOA 1LO5D 2XIWA 5ELNA 3ICEA 4A3MH 3U58A 1XYIA 2UUBQ 2B2YA 3J80i 1IBKL 3CD6A 1AW7A 2VQFQ 4R1JA 1SMYD 2KENA 3ITPA 4GNXC 1WTVA 4DR5Q 4N8FA 2PMZB 3Q24A 2L4NA 5DM63 4IFDJ 1A15A 1STNA 3A8IE 5JPMC 1X3GA 1WFQA 1G51A 4L5QA 2ENBA 1TWCB 1U9RA 1EY7A 4IPGA 2SEBD 4B9WA 1U5KA 4UDUC 3CF5A 4RCOA 4O0AA 5FO7B 3SDZA 3M4PA 2QCPX 1QILA 1DCZA 2JK8A 4MN3A 1B53A 1JR0D 1OO9B 2UUAL 5KGUA 4QCLA 2K5QA 3BG3A 3LWUA 1B2TA 4L5TA 3JAME 1HR0W 5IP7H 4APVA 4A76A 2F0DA 2N78A 3M3YH 1X55A 3K6OA 1H9SA 5KYLA 3TP5A 2OXPA 1G8ZD 2IY5B 4KHPQ 1Y14B 1PYBA 4KJOA 1SNCA 2K5NA 3NHHA 3CC7A 2HQEA 5L37A 3OMCA 1I3QB 5FO8B 3VYSA 1J8IA 2K14A 1BBUA 4GNXA 1GKHA 4C3HH 4U673 4LUZA 1KXLA 1WVLA 5DLQE 2I0QA 4XXEA 2GVBA 4A3IB 2F0TA 5BN4A 4A3IG 1TWAH 3IKJA 4OL7A 2PPBC 2KQ3A 4FF1A 4XQJA 2NVTH 1XMQQ 1VQJA 3I7FA 4AQYL 2FXQA 3CRLC 1PTOB 2TMPA 4DV6L 1TS3A 4G57A 4B3RQ 3DM3A 4BBRB 4C56C 4H44C 4JPBW 4BBRG 5GQOA 3E5SA 1LM0A 5JVG3 4OXPA 3GTQB 1PRTB 4Y7NH 1MGSA 4U68A 4LAAA 4N9PA 1CKNB 4LWCA 2VXWA 3GTOB 3HOUB 2BE5C 1NAPA 2F52A 2B8FA 1SYFA 3HOUG 1IYJB 4K5WA 4UP8A 1T5EA 3NWTA 3EVQA 5EPKA 3H0GB 3J81i 3H0GG 4JW0A 3K81C 1LTBD 4A3JB 1PZKD 1HNWQ 2EIFA 3RZOB 2ICIA 4A3JG 3VR2A 1B3QA 1ENFA 1EWHA 2UUAQ 3NK9A 1W6KA 3R8BA 1EY9A 3S1QB 4A3BH 5JAVA 1D8LA 4QGUA 2A19A 4K14A 4F87A 4R8NA 1I4PA 2CW0D 2K5WA 5IODA 2KCNA 1F2MA 4IO9A 1KRSA 3SEBA 3HRZC 2Q8RE 2FMMA 1V1PB 1X9NA 2MNAA 3P75A 3I2ZA 4DF7A 4L8JA 4X3SA 3NBIA 4DR7L 4X3UA 4KHVA 2MO0A 3T4AC 2VUMB 2IT1A 4BXXG 1WI5A 1EU3A 1SNQA 2VUMG 5T1IA 4RHRA 4XTCS 5C3EB 4RFBA 4EQOA 1VQ4A 1EEFD 2Z8LA 4FVMA 4BS9A 1Q86C 1SXTA 1A63A 1EYGA 1QUQB 4JI7L 1Z7TA 3PCOB 1UE6A 1BNZA 4HIOA 4OGQC 5KNBA 1LTRD 2PZWA 1S5FD 1E1TA 5CBAE 2Q8IB 2XTIA 1R9TH 3I4MB 5IYCH 2M2LA 2YTVA 3H94A 4PZ7A 4AH6A 1K8MA 3BYTB 3I4MG 1ZEQX 2R93H 3VA5A 5M5XH 4X65Q 2PO4A 3VA7A 4JOIC 3GTLH 4TKOB 1GM5A 1IL2A 4OIJA 1D1KA 3GTMH 2E76C 2QKIC 2MP1A 3F2DA 3TP8A 1AP0A 2PYKA 1S5ED 1X56A 3FPUB 3NUCA 1FL0A 4ZCKA 1Y8PB 1M4VA 2RCNA 1Y1WB 5ELCA 2ZXRA 4RWSC 2R6GA 1Y1WG 1YNXA 1U4PA 2L12A 4QY7A 4NW2A 2JEBI 5LMNL 1QOHA 1ET9A 5H1SE 1EY6A 1CM9A 2K5HA 3HP3A 1FNWA 4EVOA 2ID0A 2CH4A 3PO3B 1IZ6A 3OWEB 3I4NH 5J39A 4NB3A 1K8GA 3S15B 3S14B 2UXBL 3PO3G 4EQPA 2R7ZB 2A6HC 1SFOB 2R7ZG 3MWYW 1R4QB 3G7LA 4R4CA 2R7DA 1JB7A 3F8TA 1MD2D 2B2VA 5E7NA 2LFNA 3RNUA 4LF9L 1VQAA 2F0OA 3LGJA 4YY3Q 4KD4A 1XNQQ 1TWHB 1HH2P 2R7FA 4B3ML 3PIPA 1KDBA 1YHBA 4B3SQ 4WRDA 1BOSA 4CKCA 3CQZB 5ELDA 2B2TA 3W1GA 5C4HA 1Q1BA 1D5XC 3K5OA 1IW7C 1UNSA 2HT1A 1BO0A 1Y69U 3CP0A 3C1FA 2RSNA 3P20A 1QNUA 3L9AX 4JV5L 4GN4B 1LTTD 3J80L 2MO1A 2XVSA 2XNAC 5LMUL 2NUCA 3TDQA 4PQXA 4JBKA 1N32L 2M9VA 4CJ1B 4J6HA 4P2CB 2VQEL 3CCMA 4ZUJA 4DV3L 2K1BA 1NE3A 1GJXA 4FDBA 1LT6D 3M4YA 2AWOA 4IUTA 1GUWA 1EUJA 1H9SB 3T1HL 4IALA 3EN2A 2NZHA 4JVZA 1JORA 2G9HD 1M8AA 4AIMA 4DNIA 1B44D 4AYBB 3R93A 2Q8TA 4DN4M 4AYBG 2WKDA 1JB3A 1BCPD 1EOTA 1PMRA 4OO1G 2UXDL 2F0HA 5IGCA 2YV5A 4DV4L 4OO1I 2CQAA 5M3FB 4GNXB 5LMNQ 1JQYD 4DV7L 5IYDG 5HGQA 2SDFA 1KRTA 5M3FG 4EGVA 3IFTA 2NZOA 1TWCH 1Q82C 3L0OA 3D6CA 2B2WA 3I70A 3A7AB 2UXBQ 1OXTA 1LTSD 1E2WA 2I07B 3S17B 1HCZA 1PFSA 3H3VI 5C5LA 1O7ZA 3CC2A 1EY4A 1QNKA 1K0RA 5ISRA 1PHJA 2EY1A 3VR3A 3Q23A 3S1NB 3ONAB 1UE1A 1ENAA 1VMPA 1YNJC 4ODGA 5G3LF 2O5JC 3PIP3 3MXGA 2C35B 4DR2Q 2EYMA 2K05A 4FF2A 4NMZA 3PMFA 4PMBA 4DUZL 1I4GA 1OXXK 1SYCA 4RKLA 3PF4A 3OTOQ 3K58A 2E2IB 1I3QH 1XPRA 4JI5Q 1FJGQ 4YCVA 5GAGC 4CHTB 5FLXE 3VR6A 2IX3A 4BBSH 1MIUA 3G6JB 4A3CG 3FRPB 1TY0A 5GADC 1WJJA 4DNRB 1G291 1JT8A 1HNZQ 4A3IH 2QEJC 3KF8A 1W3SA 2DY8A 2JA7B 4RKBA 2JA7G 2VQEQ 1YZ6A 4GKKL 2CKZB 2D0OA 2NYZD 2X6LA 2J7ZA 4KKSA 4B08A 1SYBA 5IYBH 3JAMi 3M9BA 4MTNA 4JBMA 4HCEA 4OWTB 2ZTCA 1UWVA 4X66L 1PTOH 3T1HQ 4BBRH 1STYA 1IKLA 1PH3A 3KLSX 1D5MC 1SE3A 2EYJA 4YCUA 4DXFA 2A74C 1N36L 2KEDA 2KHIA 2BOSA 2L55A 4ME3A 1N33L 1GUGA 2K32A 3MEHA 2UXDQ 4GLVB 4L5RC 2GA4B 3PUXA 2EJFC 1I4RA 1WYDA 2OWOA 5C44B 3KK7A 1EQTA 2C9OA 1TWFB 1QCBD 1SYDA 2F0MA 5C44G 3GTOH 1NBWA 2MFIA 4DAPA 4TVAB 2YU9B 1JOKA 3M4OB 1PTOF 1SMYC 2ICEC 2OF1A 1JWMD 3MTSA 2ATWA 3H0GH 1BDOA 2NN6I 1QVCA 1PYWD 1CZGA 1PDQA 1X65A 4A3JH 1LTGD 4YWKA 1ILPA 1HZAA 2MJ8A 4LF4Q 2SNMA 3QOLA 1JJCB 1TR5A 3EFXD 4V0BA 1LT3D 4LFBQ 1TKWB 4Q5VA 4DV1L 2CWAA 1PRTF 3S1QH 3HOZB 3HOZG 2HHHL 1QVFA 3NENA 2KCCA 1W2BA 4BY7B 3LWEA 2B2UC 3G4SA 4LFAL 4BY7G 4QL5A 3SXHA 5EKIA 3D3RA 5CR3A 1KLUD 5AFWA 4NXML 4X62L 4BXXH 2VUMH 1EZ6A 4R4OA 4CKEA 2BDNA 3AMUA 2BDOA 3BZDB 3DWQA 1VF7A 1VQMA 3GTLB 1JOOA 3DLLA 1QZHA 3SK6A 2XWBB 2ZTDA 2KVMA 3WDNA 5JJIA 4IFDG 1C4QA 2K03A 2DN8A 3FEWX 4KKUA 3SK4A 2UUBL 2NVQB 1VQKA 2EOTA 3NP8A 1F2LA 4BA1I 3AB9A 5DNFA 3MC0B 1BKBA 3I4MH 4J1MA 4ZKBB 3Q8DA 4DR5L 4PG3A 1F2YA 5JJZA 5IGGA 1N36Q 4RGTA 2UUCQ 3OYYA 4IJHA 3UE0A 1FD7D 3NQTA 1SRUA 4LF6L 1DGSA 3HFZB 3KYHC 3ZJYC 1QE6A 3J7AV 4WORA 2C5CA 4QJFA 3FPPA 1Y1WH 3HOWB 1ICWA 3HOWG 4GN5A 1EWIA 2K28A 3QIAA 4UPAA 4HJ7A 2B2YC 4JCVE 1I4XA 4KHPL 1CHQD 1NNXA 4DV1Q 3VYUA 3S15H 3S14H 1KDAA 5IT9E 3RR5A 3BVZA 3TMEA 2R7ZH 1UAPA 4LF7Q 2N49A 1DJRD 2M00A 1HUMA 1H9RA 4KHZA 1SFOH 4FYDA 4CDEC 2CVRA 1HQMC 1PH5A 4IOCA 1WTRA 1A3VA 3HKZE 4LFAQ 1VQLA 3X3MA 4JYAQ 1HTLD 2G5DA 1A6XA 3A56A 5M5WB 4RAUC 5C5MA 1RKNA 5FKAC 1SJED 4DA2A 4DK0A 5I9PA 4X62Q 1LYLA 3J7ZC 3NTKA 3C46A 3GD7A 3CQZH 1H95A 2EYHA 3GTPB 2RHQB 1XMQL 3KJOA 2WAQB 4DV5Q 1QJOA 2B3GA 1GUSA 1VQ9A 2WAQG 4JI8Q 4KN4C 2E8GA 3I4LA 4LW1A 2F0VA 4IOAA 5FO9B 2K75A 3A5UA 2B39A 2PZUA 1XPOA 1JE5A 1AN8A 1XPUA 1X3FA 4A3GH 3DWPA 4CGYB 2OT2A 1Y1VB 2WKCA 1U4MA 3C1EA 3S1MH 1Y1VG 3QOJA 1N34L 3S1RB 2CFMA 1RF2D 3OSOA 3H3VC 3CHBD 5C4ZA 2YYZA 4K6DA 4LF6Q 4DR3L 1VQOA 3J7AF 4A93B 2Q2UA 1XNRL 4A93G 2JA6B 1HNWL 1HFNA 1IKMA 1WD1A 4OO1H 3F1ZA 2E74C 2JA6G 1PYSB 1O78A 2EE1A 1II3A 1EQQA 4CDCC 5IYDH 1YITA 1E2ZA 3N52A 3KDFA 5M3FH 2RDFA 3DM1A 4A3DB 3BVGA 2RDGA 4G4KA 3UDIA 1X3QA 4C1NI 4A3DG 4A3EB 2LSSA 3W3AA 2XN9C 3KF6A 4QB4A 1NY4A 4A3EG 2HCCA 1AZQA 3R3OA 2WACA 2WB1E 4ILWA 1HFGA 3H3VH 3OW2A 3KF8B 1SBBB 4X3TA 4DV2Q 1L0YB 2AQ3B 3NQIA 3S17H 1WCMB 2NVXB 4RMFA 4DKAC 4XQNA 1WCMG 2LXJA 4BBSB 3S1NH 3FHWA 2NZ1D 3ERQA 2H1EA 2ZJRA 4BBSG 3KFUA 4KMUC 1C0AA 2EPBA 3TP6A 5FLXc 2D5DA 4PMWA 1I4QA 3HG9A 2R61A 5NUCA 1IBML 3KOJA 1E24A 4IUVA 2E2IH 1ICFB 1U0LA 3JAML 2VS1A 5IYBG 1I4HA 3BYYB 3D4DA 2FHTA 3GTJB 4A3CH 4CJ0B 3HKSA 4RH6A 1K0SA 3V05A 2Z9HA 2PMZE 1G91A 2F0GA 3QR8A 1K73C 4FXGC 5E4WC 4PMCA 4X65L 1U4RA 3BS1A 1A8VA 1EQRA 3LNNA 2JA7H 2PI2E 1Q7YC 4K6LA 4FXDA 1PZJD 3U50C 3OIPA 3V96A 1N34Q 4I65A 2E75C 3R2TA 4JI3Q 1A0IA 4A3KB 1E1OA 4LF5Q 4A3KG 1M90C 4DR3Q 1MBYA 1CI3M 5A35A 4HJ5A 3H09A 1XNRQ 1BBWA 1X54A 1FNUA 2FJ2A 1PH6A 2JN4A 4HTHA 4DV0L 3TRZA 2F0EA 3FDTA 3T56B 3G48A 1NR2A 2LKVA 5CC4A 1OTCA 1A3UA 2A5HA 2PQAA 5C44H 4DAYA 1S5DD 4ZRZA 5I6WA 1TWFH 2ZTEA 3GP7A 1TIID 2QA4A 1HR0L 4FO2A 1KTKA 2AMCB 3GTGB 2YU9H 3M4OH 4R4QA 5COYA 1BCPC 2Z6KA 3W5OA 1VQGA 2RA4A 2E2DC 1IXRA 1SJHD 2F0QA 4JC0A 1EY5A 4YY3L 3JC66 5CYUA 1XNQL 2H4OA 1C8CA 1HZ9A 3EBEA 3KUPA 4QUFA 3GV6A 4CJ2C 5A2QL 1H9MA 4UP9A 4R4IA 2YTYA 3TS0A 3CMAA 2DJGC 1CKMA 3D31A 4RG1A 1EIGA 1J9OA 1EIYB 1L0WA 3HOZH 4B3SL 2F0FA 3ND9A 1KNEA 1QG7A 5BN5A 1PZID 3CW2C 4JI2Q 4G7ZC 2LS01 2QDLA 4BY7H 1HJPA 4FXKC 1IBMQ 3KLSA 2TSSA 1PH2A 2GVAA 2N3SA 3PO2B 3PO2G 1B4OA 5F2DA 1ML0D 4JI4Q 1Q3LA 1BF4A 3TZUA 2DJFC 3A8JE 3B6YA 2B2VC 2MGSA 4ME5A 3RMHA 1MHWC 1SNMA 3U9OA 2A6EC 3PV0A 2IPKD 1MJEA 2XRQD 4LUVA 2IX1A 5CV5A 2RHSB 1Q8KA 3SHLA 1A2UA 4IFDH 5DAUA 3AQQA 5CV4A 2NVQH 1VQPA 2B2TC 1CQVA 3T1YQ 4C3JB 4UP7A 5C0XI 1C48A 1SMXA 2F3WA 4C3JG 5EBCA 2EXZA 1GVPA 3EQLC 4P75A 4DR1Q 3HOVB 1P16A 2F4VL 3WOFA 1RL2A 1S5BD 3HOVG 3S2HB 4HMIA 4J15A 3K0YA 4DV0Q 4PNYA 1CTMA 5LL6X 5D3DA 4GOPA 2A69D 2KCMA 3SK8A 1HR0Q 5I2YA 3ULLA 3PQIA 2CHBD 1LT4D 1YEZA 1G2TA 3HOWH 5C4JB 4FF4A 3X3NA 1RTNA 2MHVA 4OWXB 5DEHA 1YNNC 1PH1A 3STBC 5IT9c 2MQHA 3I73A 5CV9A 2NVYB 2K01A 5IGFA 4RCNA 3DEOA 4DR2L 4EQNA 4ZAIA 1AEXA 3J80E 3OTOL 2PW7A 3GTKB 3TN2A 3CCSA 1E7ZA 3K7UC 4JI5L 3PSIA 1FJGL 1UE5A 3BJUA 4KTAA 1SN8A 2B2WC 1TVXA 1B7YB 4WFN3 4FP5D 3DEPA 2JA8B 4O42A 5M5WH 2JA8G 4JI0L 3GDEA 2KECA 1HNZL 4A3GB 3MFYA 3PIOA 1PXUA 1V8QA 2G9DA 4A3GG 1KAAA 2O4XA 3CRKC 3J7A5 1T9HA 3S1MB 2E2JB 3QJYA 1BR9A 3GTPH 3CCVA 3MFGA 5IGBA 2R3ZA 1GHJA 1IL8A 2PW5A 4IN3A 4DAMA 3CCQA 3E6ZX 3ND8A 1X6OA 2IWHA 3RN2A 2BE5D 1B8AA 3K5MA 4IPDA 1BUVT 1CT1D 4J8QA 1JC7A 3BVMA 1X32A 4A4IA 2QEXA 4DXGA 2F0WA 3M7GA 1Z6HA 1Y1VH 1JE4A 3OPOA 2F4VQ 2QDBA 1LACA 2NTSA 4GN3B 2EY6A 4XYQA 1AE2A 3S1RH 4H13C 3AFQA 3S24A 1L1OC 1NJIC 1XWEA 3I3CA 2I5HA 5FK9C 4HIKA 5IOCA 4A93H 1EOVA 2OEOA 2HIVA 4WJ4A 1YVCA 1TS5A 2JA6H 3A55A 4K8JA 4LF4L 4DUYQ 4LFBL 4A3DH 5D65A 1DXMA 4M8AA 4RGOS 4DR4Q 3KLRA 5CV6A 4A3EH 1EIHA 3KBGA 2L1BA 2Q2IA 1K3RA 4ZQ3A 3T13A 2AQ2B 4WJWA 2XRSD 1GUNA 4LUOA 4NPSA 3PF5A 5E3FA 1S40A 4I7ZC 1GHKA 4ZUIA 1K28A 3QG1A 1JJ2A 1ZYRD 4DK6C 1WCMH 5EBDA 2NVXH 4UY8C 1L0XB 1ZKOA 2ALYB 5CORA 4NXNQ 4G7HC 5FJ8G 3H15A 2DGYA 2ZM6Q 2B63B 1VQCA 3BDLA 1JWUD 1TS2A 4S3SA 1P8LA 2B63G 1KIXA 3FMCA 4ZYSA 4JI0Q 1L1OA 3C3LA 1TY2A 5EKKA 3J81E 3R2IA 2N8NA 4X64L 1RTOA 3K0XA 3L2PA 1DOLA 1CHPD 3KLWA 2F0SA 3FKIH 2PQAB 1K8AC 4DK1A 3DMUA 4DAYB 1JMCA 4AYBE 1WTHA 4X6AH 3GTJH 3UE1A 2JA5B 1YJWA 1YHAA 2HDMA 4LFCQ 2JA5G 1G6PA 1N9WA 2AUJD 4HAEA 1AZPA 1ET6A 5I2XA 1EFID 3NSWA 2UUCL 1K8OA 1S5CD 1C7YA 3AYHB 1D2BA 2KOLA 1KC8C 3U9SA 1EEID 5C6AA 3TQYA 3DHQA 1KD1C 3Q22A 4A3KH 2RBMA 1HQRD 3HEJA 4LK1C 4O2DA 3G71A 1D1IA 3BU2A 2NN6G 2FMCA 2Z6BA 1FR3A 1XXGA 5JEAG 2FFKB 2ZT9C 4K5VA 2Y0SB 5CMDA 1EWCA 1D7QA 5KNDA 1LABA 3SE0A 2Y0SG 2IX0A 1TWGB 2X6GA 4MTKA 3J81j 4FF3A 5IP9G 4JI1Q 1U4LA 4CBVA 2PNHA 3N6RA 4ULLA 3D8GA 4LF7L 1DD2A 1SNOA 4HIDA 1Y8OB 2GN5A 3V2TA 3GTGH 1I6HB 1E0BA 3RLOA 1AH9A 4JYAL 4KY7A 5JPNC 1BCPB 5FOBB 1IW7D 4HIMA 2EY2A 1MKHA 1NMFA 1IBLQ 2QILA 3A5ZB 4B3TQ 1EFWA 4N8X1 3UDGA 4BY1B 2V1CC 5BR8L 2OQKA 1CSPA 4BY1G 1W6JA 4GLAC 2KHJA 4DV5L 1DONA 1TT2A 1F9SA 1VF5C 5G3LD 4JI8L 4X64Q 3PO2H 3E9HA 2L11A 1A3TA 3MZ5A 1N8RC 1HA6A 4NKLA 2F0IA 4DNTB 2RKSA 1J5EQ 3NEMA 2ZXPA 1SNDA 4MZ9A 1SLJA 4F8MA 1V1PA 1DYQA 3OW7A 4JI6Q 3GQBA 1LLRD 4UHVA 5KNCA 2QF7A 3VYRA 3NPPA 1XX8A 2CH4W 3HZXA 4H7BA 3URYA 4C3JH 3CCUA 1WD0A 1VCIA 3HOVH 3BZCA 4FNFA 1LTID 1GUTA 3S2HH 4L63B 4QUCA 3D4WA 4WJ3M 1O7IA 4IJLA 1SYEA 3MA2B 1YNJD 5ELEA 2BCOA 4OHJA 5JEAJ 1HXYD 3CU7A 2SNSA 4DV2L 4OONA 4K8IA 5M5YB 4EQ5A 2K6AA 5C4JH 5JVH3 3WWVA 2AUKA 3MHBA 1PTOD 3J80c 1UEAB 2LY7A 3OMGA 1RODA 4IUUA 3T16A 1PH4A 3RD4A 2OQ0A 3QB3A 2NVYH 2PQEA 2CW0C 2F0LA 2K5DA 5C4XB 3CPFA 4YWMA 4C2MB 3MXPA 1YHQA 3GO5A 2VNUD 3L3OC 5C4XG 3FVQA 3RLNA 5BR8Q 3CCLA 2I5MX 2Z1CA 3F2UA 3GTKH 1PRTD 2FINB 3VDYA 1KABA 4GZYC 3CKIB 5IIFA 3I90A 4Q0FA 1XTCD 2VY3A 1CUKA 1LUZA 3WOEA 3SVMA 5K36G 5IT9L 2JA8H 5I4DA 4YHHL 4OWWB 3NE5B 1CZWA 2J0TD 1I5FA 1O7LA 3J7YW 1CQFA 4LNQA 2WFWA 3KJPA 1ZXTA 4QIWB 4H02A 2OTJA 1ONLA 1TXYA 5LL6S 2IW3A 1JJGA 2E2JH 1TU2B 3IAYA 3AFPA 4RA8A 4EX5A 1WTWA 4JI3L 2J4XA 5I9OA 4GS3A 4YWLA 4LF5L 4C1NK 2IL8A 1ENCA 4A3FB 1YI2A 1FYCA 2HDLA 3S16B 4A3FG 5KIXA 2JEAI 2QGQA 5IE8A 4V190 3PUZA 2DUDA 2A68D 1Q46A 3MXNA 1D5ZC 1BVSA 1HZCA 4BWGB 1PH7A 1BXTA 2PNRC 1RD9D 4IURA 3VYTA 1YJ9A 5DM73 2HCIA 1L1OB 1XMOQ 4L6TB 2K4KA 3PUYA 4IPCA 3ZYYX 4Y52H 1V1OA 2X69A 1EYDA 1SE8A 1BQQT 1X3EA 1RDPD 2UU9L 4HCSA 5CV7A 3OHXC 1EY8A 3S9WA 1QB5D 1L2FA 4KK7A 2A69C 2KHSA 4JI2L 1PLFA 3P1HA 2MPMA 1E3PA 2WAQE 4R4TA 3Q0AA 2K50A 4TSSA 1Q8IA 2LXKA 1NSNS 5GAHC 5CV8A 1KNAA 3NBHA 3FKIB 3IFDA 4XQQA 4JI4L 2UXCL 3FKIG 5FJ8H 3J81c 3E0EA 1LV9A 2L15A 2RQXA 2Z6KC 3BDOA 2ZJQA 2E2HB 3GV3A 2B63H 2EVBA 4QIWE 1CA5A 5E1FA 4YHHQ 4F7XA 2Z4IA 1CKOA 3FP9A 2EYLA 3SR1A 1GOZA 3BZKA 5CGKA 1VQ7A 2PCFB 3K80C 1SE4A 4K2LA 3UDFA 1IYVA 5C3WA 3T1YL 3DUZA 2JA5H 1AE3A 1ILQA 3MEFA 1FGBD 5KYIA 1F9QA 4ALPA 4DR1L 1B3AA 1IBKQ 4RHSA 1NUCA 4KI0A 3T51B 2IHEA 1XTDA 2P5ZX 5EAYA 3OIQA 1JCKB 3I56A 1PFNA 2WV6D 3RZDB 3L7ZC 5A2QE 2I46A 3ERSX 3UI2A 1YBYA 2KJXA 5LMNW 2NN6H 3K7AB 2NB0A 5FLMH 2XWJB 5JEAH 1VQNA 2ZJPA 1LTLA 3W1BA 1PFMA 2VL6A 3A7LA 2UU9Q 5IP9H 1G6ZA 1TWGH 3HOYB 1R4PB 5TSSA 3HOYG 4X3KA 3ULJA 1SE2A 2BH2A 5LHY1 2AQ1B 2L5TA 1WTPA 1EU4A 4POFA 3QWNA 2Z4HA 3O13A 2IJ0A 1I6HH 3IRBA 4P72A 3CPWA 3PUVA 2EZVA 1EY0A 1UE7A 3NTIA 1VQDA 1KQSA 4GOPC 1ASYA 1UUPA 2NBFA 1T5XD 3K8AA 2EYFA 2UXCQ 1SAPA 1HZBA 3DXJC 4P74A 1DOMA 4OX9L 1AFPA 4BY1H 4YIJA 5ELFA 1Q1EA 5C3EG 3A0JA 1D6EC 1ZYRC 2JE6I 4QQBX 2N88A 1I6VC 2A73B 5C3XA 3A54A 4MNOA 4L5SA 1RHPA 4IUPA 2JYOA 2EJGC 5E4XA 4A3LG 3H6MA 2DNEA 2RCFA 5EKLA 4AQYQ 1BCPF 2CCZA 2O5IC 1G2SA 1IHZA 3EJIA 4XT1B 5C0XG 4DV6Q 1SROA 2EXDA 1KL9A 4DFAA 3CCRA 2ZXOA 1WOCA 4IQZA 2JA9A 2NWGA 1VQ6A 2E5LL 3HS0C 2JP1A 1GO3E 5JOBA 3S2DB 2WINB 1FVIA 2DY7A 3NXWA 5I6YA 1TQOA 3I55A 1PVOA 3TBIB 4R8IA 1K83B 2RF4A 1NTGA 1J6QA 5BN3A 2KA7A 3A8KE 3QO2A 4DUYL 3HOXB 5EPJA 4F88A 4K2KA 3K57A 1KAWA 3D0FA 4XT3B 3HOXG 5D14A 5AJ3L 2EYOA 4Z9CB 2K7VA 4RGNA 1OXVA 3CCJA 1PH8A 4DR4L 1CSQA 3EROA 1RCVD 3TS2A 4TQUS 1A2TA 5K5PA 2R92B 2ASBA 1X3PA 4K0KL 2R92G 1SR3A 5M5YH 3MVVA 4CDFC 4DPGA 3ULPA 1YJNA 1QZGA 2K5VA 3NELA 3E9IA 2F0UA 4NXNL 1VQBA 3G6EA 4JOIA 4OEMB 1VQFA 3AEVA 4DR6L 1C9OA 2ZM6L 4DR7Q 2RVLA 4HJ9A 4C3IB 2KCTA 5C4XH 2F0JA 4OX9Q 2QW7A 1FNVA 4C2MH 2F3IA 4C3IG 4XDXA 5M3MB 4YCWA 2F0NA 2Z0SA 3TREA 5M3MG 3M7NA 1SYGA 3TEHB 4BA2I 4JI7Q 3KDFB 3MXNB 1O7YA 2D9UA 2F3VA 4LFCL 4ABNA 2D0PA 5HGTA 5K36H 5HY6A 1I50H 4A3MB 3KF6B 5CBEE 4A3MG 3TP7A 1SEBD 1GUOA 3IL8A 4R9WA 2F4IA 1NMGA 2VB2X 1ASZA 2EJMA 5IGEA 1KHIA 1DOKA 1DM0B 4OIKA 4HJ8A 1JOQA 3D4RA 2V4DA 5D3IB 4PZ8A 2E5LQ 1ESRA 5C0XJ 2JXMB 1STAA 3CC4A 4IZ8A 2CWPA 4MHEA 4TRDA 4IUQA 1B50A 1KLGD 2AHOB 4A3FH 4CKBA 1NR4A 4DU9A 1VQ5A 3S16H 5J1ZA 3U4VA 1BBXC 1STEA 2WIIB 1GD7A 3EA6A 3AU7A 1PFBA 2BH8A 3NBHB 1HPCA 1K9MC 1JWSD 1B9NA 4JI1L 5AJ3Q 4LF8L 2K52A 5IP7G 3M3YB 5GROA 2F0KA 3UDXA 3E3XA 3K5NA 5IGDA 4ID6A 4LMQD 2VB3X 1Q12A 1EQVA 2HIXA 4JBJA 1EZ8A 4HJAA 3JAMc 3U4ZA 1F9PA 1PA6A 2MUYA 3SGIA 2XGTA 4K0KQ 1EYCA 3K5LA 1IBLL 2KEEA 4C3HB 3SK5A 4LF9Q 4C3HG 4G7OC 1MSGA 4B3TL 1JICA 4IUNA 1HUNA 3VR4A 1Z47A 1VQIA 2O2LD 1OXUA 1CFMA 2PI2A 4DR6Q 4HSVA 1LT5D 4KY5A 3NTHA 4IPHA 4HMJA 3PIO3 4B3MQ 5EGTA 1TWAB 2Q2TA 1Q90A 2A6ED 3BDCA 2Q2HA 1PTOC 4P73A 2NVTB 2B29A 1PH9A 2B8GA 3MAQA 2HUGA 3I8ZA 2D2CC 1J5EL 5GAEC 4JV5Q 1MJCA 3A74A 2E2HH 1SNPA 1CA6A 1F77A 1HNXL 4I7AA 2CQOA 1I94L 1PRTC 5LMUQ 2AKWB 4HN7A 1N32Q 2KBNA 4KLKA 4JI6L 2EYPA 5IY0A 4ZKCB 5FLXL 3TZDA 4DV3Q 4KKTA 4Y7NB 5IWAL 1SDFA 2HQLA 4JBWA 3C2PA 3J81L 1KDCA 4KD3A 2A6HD 4CDDC 3CMEA 4GKJL 3LX0A 3KBXA 1PV4A 5FLMG 4LJZC 1HA5A 4QMGA 3GTQH 2NTTA 1YNND 4DV4Q 4GLXA 1STGA 4JG2A 4KN7C 3STBD 4DV7Q 1GXDC 4ZLTF 2JQOA 4A3BB 4LF8Q 4A3BG 3RZDH 3HOUH 4MIUA 5T1GA 2AWNA 2VZAA 4K5XA 4OELB 4PZ6A 2F0PA 3OOCA 4QF4A 2A68C 1S72A 3K7AH 4HR7B 4P71A 2VW9A 3RZOH 4N9TA 3MXUA 1A62A 1SSOA 1DZ1A 2BA1A 2BA0A 3HOYH 1CKNA 2EDGA 3W2DA 4KJNA 3PUWA 1IYUA 1Y8NB 1Z9FA 3I91A 1M1KC 2A8VA 2OCEA 4DUZQ 4RGMA 4DGZA 1MSHA 3TSSA 1OXSC 2HD3A 2LMCB 4XIGS 3PGZA 2IHFA 3HKZB 4GOPB 3HKZG 1V9PA 1R9TB 2A1AA 3Q6SA 1UEBA 2L0CA 1E2VA 1HHVA 5IYCG 2R93B 3I4OA 3F2CA 5C3EH 2R93G 5M5XB 5J3BA 1S4ZA 4A75A 1FGUA 1HNXQ 1WTOA 1TS4A 1I94Q 3T53B 5KRUA 3OWFA 1VS0A 1QWYA 1VQHA 4ZK9B 3NWSA 4UAIA 4A3LH 3GTMB 3CXCA 3VR5A 4GKKQ 4PV1C 1YIJA 4KV6A 4POGA 5IWAQ 4IFDI 3RN5A 1LTAD 3E0JA 4B9XA 2F1MA 5C0XH 4DAVA 4X66Q 4O1NA 2WP8J 2VQFL 1S3OA 3CCEA 2Y0SE 1F2ZA 1NCVA 2DNCA 1RJTA 4NP5A 4M1UB 3RLFA 2SOBA 1VQ8A 1V43A 4GKJQ 4NDXA 2JJQA 3RUZA 1QUQA 1WTQA 2H5XA 3DWAA 5J22A 1N33Q 3S2DH 2B2UA 2F03A 1ESFA 3EIVA 1MI2A 1B1ZA 3I4NB 1B9MA 1VDZA 5JJLA 2PZTA 3I4NG 4XYOA 2JSOA 1XMOL 1VMCA 1K83H 3HGBA 4JK1C 1H9JA 2YTXA 2L9HA 3I72A 2ES2A 2EQSA 2RDHA 2I5LX 5KEEA 3HOXH 3M4QA 1B70B 3P7JA 3CAMA 4HEDA 1STHA 5HURA 1XJVA 1Q81C 1F9RA 2EY5A 2D62A 3PO3H 5JJKA 5M9OA 3ER0A 1CK1A 5EJWA 2OTLA 2N55A 1EIFA 2HHHQ 1QVGA 3K59A 2R92H 2WB1B 1WTXA 4H0LC 1HTPA 2WB1G 4DK3C 4KY6A 5EQ0A 4E6IA 1EL0A 1H9KA 1E22A 1I50B 1VQEA 2K33A 2KUMA 1TWHH 3D6WA 5EPLA 2K04A 1K3BC 4NXMQ 1HRJA 1V1QA 1EYAA 4C3IH 1O80A 5M3MH 2XSCA 3H91A
chains in the Genus database with same CATH topology
5ELBA 1STBA 4HSPA 3M85A 2RSOA 1LO5D 2XIWA 1XYIA 2B2YA 1AW7A 1SMYD 3ITPA 1WTVA 2PMZB 3Q24A 2L4NA 5DM63 4IFDJ 1A15A 1STNA 3A8IE 5JPMC 2ENBA 1TWCB 1U9RA 1EY7A 2SEBD 4B9WA 4UDUC 4RCOA 5FO7B 3SDZA 2QCPX 1QILA 1DCZA 4MN3A 1B53A 1JR0D 1OO9B 5KGUA 4QCLA 2K5QA 3BG3A 3LWUA 1B2TA 3JAME 2F0DA 3K6OA 1H9SA 5KYLA 3TP5A 2OXPA 1G8ZD 4KJOA 1SNCA 3NHHA 2HQEA 3OMCA 1I3QB 5FO8B 3VYSA 1J8IA 4U673 1WVLA 4XXEA 4A3IB 2F0TA 5BN4A 3IKJA 4OL7A 2PPBC 2KQ3A 4FF1A 4XQJA 3CRLC 1PTOB 2TMPA 1TS3A 4G57A 4BBRB 4C56C 4H44C 3E5SA 5JVG3 3GTQB 1PRTB 1MGSA 4U68A 4LAAA 4N9PA 2VXWA 3GTOB 3HOUB 2BE5C 1NAPA 2B8FA 1SYFA 4K5WA 1T5EA 3NWTA 3EVQA 5EPKA 3H0GB 1LTBD 4A3JB 1PZKD 3RZOB 2ICIA 3VR2A 1ENFA 1EWHA 3NK9A 1W6KA 3R8BA 1EY9A 3S1QB 5JAVA 4K14A 4F87A 4R8NA 1I4PA 2CW0D 2K5WA 5IODA 2KCNA 1F2MA 3SEBA 3HRZC 2Q8RE 2FMMA 1V1PB 3P75A 4DF7A 4L8JA 4X3SA 3NBIA 4X3UA 4KHVA 3T4AC 2VUMB 2IT1A 1EU3A 1SNQA 5T1IA 4RHRA 4XTCS 5C3EB 4RFBA 4EQOA 1EEFD 2Z8LA 4FVMA 4BS9A 1SXTA 1Z7TA 1BNZA 4OGQC 5KNBA 1LTRD 2PZWA 1S5FD 5CBAE 2Q8IB 3I4MB 2M2LA 3H94A 1K8MA 3BYTB 1ZEQX 3VA5A 2PO4A 3VA7A 4TKOB 4OIJA 1D1KA 2E76C 2QKIC 2MP1A 3TP8A 1AP0A 2PYKA 1S5ED 3FPUB 3NUCA 1Y8PB 1M4VA 1Y1WB 5ELCA 2ZXRA 4RWSC 2R6GA 1U4PA 2L12A 4NW2A 2JEBI 1QOHA 1ET9A 1EY6A 1CM9A 3HP3A 1FNWA 4EVOA 2ID0A 3PO3B 3OWEB 5J39A 3S15B 3S14B 4EQPA 2R7ZB 2A6HC 1SFOB 3MWYW 1R4QB 3G7LA 1MD2D 2B2VA 2LFNA 2F0OA 4KD4A 1TWHB 1KDBA 4WRDA 1BOSA 4CKCA 3CQZB 5ELDA 2B2TA 5C4HA 1Q1BA 1D5XC 3K5OA 1IW7C 1UNSA 1BO0A 1Y69U 3C1FA 2RSNA 3P20A 1QNUA 3L9AX 1LTTD 3J80L 2XVSA 2XNAC 2NUCA 3TDQA 4PQXA 2M9VA 4CJ1B 4J6HA 4P2CB 4ZUJA 2K1BA 1GJXA 1LT6D 3M4YA 2AWOA 4IUTA 1GUWA 1H9SB 4IALA 1JORA 2G9HD 1M8AA 1B44D 4AYBB 3R93A 2Q8TA 4DN4M 2WKDA 1JB3A 1BCPD 1EOTA 1PMRA 4OO1G 2F0HA 5IGCA 4OO1I 2CQAA 5M3FB 1JQYD 2SDFA 4EGVA 3IFTA 3D6CA 2B2WA 3I70A 3A7AB 1OXTA 1LTSD 1E2WA 2I07B 3S17B 1HCZA 5C5LA 1O7ZA 1EY4A 1QNKA 5ISRA 2EY1A 3VR3A 3Q23A 3S1NB 3ONAB 1ENAA 1VMPA 1YNJC 4ODGA 5G3LF 2O5JC 3PIP3 3MXGA 2EYMA 2K05A 4FF2A 4NMZA 3PMFA 4PMBA 1I4GA 1OXXK 1SYCA 4RKLA 3K58A 2E2IB 4CHTB 5FLXE 3VR6A 2IX3A 3G6JB 3FRPB 1TY0A 4DNRB 1G291 2QEJC 3KF8A 2DY8A 2JA7B 4RKBA 2NYZD 2X6LA 4KKSA 4B08A 2J7ZA 1SYBA 4HCEA 1PTOH 1STYA 1IKLA 3KLSX 1D5MC 1SE3A 2EYJA 4DXFA 2A74C 2KEDA 2L55A 2BOSA 1GUGA 2K32A 3MEHA 2GA4B 3PUXA 2EJFC 1I4RA 5C44B 3KK7A 1EQTA 2C9OA 1TWFB 1QCBD 1SYDA 2F0MA 4DAPA 2YU9B 1JOKA 3M4OB 1PTOF 1SMYC 2ICEC 2OF1A 1JWMD 3MTSA 1BDOA 2NN6I 1PYWD 1CZGA 1PDQA 1LTGD 1ILPA 2MJ8A 2SNMA 3QOLA 1TR5A 3EFXD 4V0BA 1LT3D 1TKWB 4Q5VA 1PRTF 3HOZB 2KCCA 4BY7B 3LWEA 2B2UC 3SXHA 5EKIA 3D3RA 5CR3A 1KLUD 5AFWA 1EZ6A 4CKEA 2BDNA 3AMUA 2BDOA 3BZDB 3DWQA 1VF7A 3GTLB 1JOOA 3SK6A 2XWBB 3WDNA 2KVMA 4IFDG 1C4QA 2K03A 2DN8A 3FEWX 4KKUA 3SK4A 2NVQB 2EOTA 3NP8A 1F2LA 4BA1I 3AB9A 5DNFA 3MC0B 4J1MA 4ZKBB 1F2YA 5JJZA 5IGGA 4RGTA 1FD7D 3NQTA 1QE6A 3J7AV 4WORA 2C5CA 3FPPA 3HOWB 1ICWA 2K28A 3QIAA 2B2YC 1I4XA 1CHQD 3VYUA 1KDAA 5IT9E 3TMEA 3BVZA 1UAPA 1DJRD 2M00A 1HUMA 1H9RA 4KHZA 4FYDA 2CVRA 1HQMC 1WTRA 1A3VA 3X3MA 1HTLD 1A6XA 3A56A 5M5WB 4RAUC 5C5MA 1RKNA 5FKAC 1SJED 4DA2A 4DK0A 5I9PA 3NTKA 3C46A 3GD7A 2EYHA 3GTPB 2WAQB 1QJOA 1GUSA 4KN4C 3I4LA 2F0VA 5FO9B 2B39A 2PZUA 1AN8A 3DWPA 4CGYB 2OT2A 1Y1VB 2WKCA 1U4MA 3C1EA 3QOJA 3S1RB 1RF2D 3OSOA 3H3VC 3CHBD 5C4ZA 2YYZA 4K6DA 3J7AF 4A93B 2JA6B 1HFNA 1IKMA 1WD1A 4OO1H 2E74C 1O78A 2EE1A 1II3A 1E2ZA 3N52A 4A3DB 2RDFA 3DM1A 3BVGA 2RDGA 4G4KA 4C1NI 1X3QA 4A3EB 3W3AA 2XN9C 4QB4A 2HCCA 1AZQA 3R3OA 2WACA 4ILWA 1HFGA 1SBBB 4X3TA 1L0YB 2AQ3B 3NQIA 1WCMB 2NVXB 4XQNA 4BBSB 2NZ1D 3ERQA 2H1EA 4KMUC 2EPBA 3TP6A 2D5DA 4PMWA 1I4QA 3HG9A 2R61A 5NUCA 4IUVA 3JAML 1I4HA 3BYYB 3D4DA 2FHTA 3GTJB 4CJ0B 4RH6A 3V05A 1G91A 2F0GA 4FXGC 5E4WC 4PMCA 1U4RA 3BS1A 3LNNA 4K6LA 4FXDA 1PZJD 3OIPA 3V96A 4I65A 2E75C 3R2TA 4A3KB 1MBYA 1CI3M 5A35A 3H09A 1FNUA 2FJ2A 4HTHA 2F0EA 3FDTA 3T56B 5CC4A 1NR2A 2LKVA 1A3UA 2A5HA 4DAYA 1S5DD 4ZRZA 5I6WA 3GP7A 1TIID 4FO2A 1KTKA 3GTGB 5COYA 1BCPC 2RA4A 2E2DC 1SJHD 2F0QA 1EY5A 5CYUA 2H4OA 1C8CA 3KUPA 4QUFA 3GV6A 4CJ2C 5A2QL 1H9MA 3D31A 1EIGA 1J9OA 2F0FA 3ND9A 1KNEA 1QG7A 5BN5A 1PZID 4G7ZC 2LS01 4FXKC 3KLSA 2TSSA 3PO2B 1B4OA 5F2DA 1ML0D 1Q3LA 1BF4A 3TZUA 3A8JE 2B2VC 2MGSA 4ME5A 3RMHA 1SNMA 3U9OA 2A6EC 3PV0A 2IPKD 2XRQD 2IX1A 5CV5A 3SHLA 1A2UA 4IFDH 5DAUA 5CV4A 2B2TC 1CQVA 4C3JB 5C0XI 1C48A 2F3WA 4C3JG 5EBCA 2EXZA 3EQLC 3HOVB 3WOFA 1S5BD 3S2HB 4HMIA 3K0YA 4PNYA 1CTMA 5LL6X 5D3DA 2A69D 3SK8A 5I2YA 2CHBD 1LT4D 1G2TA 5C4JB 4FF4A 3X3NA 1RTNA 2MHVA 5DEHA 1YNNC 3I73A 5CV9A 2NVYB 2K01A 5IGFA 4RCNA 3DEOA 4EQNA 4ZAIA 1AEXA 3J80E 2PW7A 3GTKB 3TN2A 4KTAA 2B2WC 1TVXA 4WFN3 4FP5D 3DEPA 2JA8B 4O42A 2KECA 4A3GB 3MFYA 1PXUA 1V8QA 2G9DA 1KAAA 2O4XA 3CRKC 3S1MB 2E2JB 3QJYA 1BR9A 3MFGA 5IGBA 2R3ZA 1GHJA 1IL8A 2PW5A 4IN3A 3E6ZX 3ND8A 2IWHA 2BE5D 3K5MA 1BUVT 1CT1D 4J8QA 1JC7A 3BVMA 1X32A 4DXGA 2F0WA 3M7GA 1Z6HA 1JE4A 3OPOA 2QDBA 1LACA 2NTSA 2EY6A 4XYQA 4H13C 1XWEA 3I3CA 5FK9C 5IOCA 2OEOA 1TS5A 3A55A 4K8JA 5D65A 1DXMA 4M8AA 4RGOS 3KLRA 5CV6A 1EIHA 3KBGA 2L1BA 4ZQ3A 3T13A 2AQ2B 4WJWA 2XRSD 1GUNA 5E3FA 4I7ZC 1GHKA 4ZUIA 3QG1A 1ZYRD 5EBDA 1L0XB 1ZKOA 5CORA 4G7HC 2B63B 3BDLA 1JWUD 1TS2A 4S3SA 3FMCA 4ZYSA 3C3LA 1TY2A 5EKKA 3J81E 3R2IA 1RTOA 1DOLA 1CHPD 2F0SA 4DK1A 3DMUA 2JA5B 2HDMA 2AUJD 4HAEA 1AZPA 1ET6A 5I2XA 1EFID 3NSWA 1K8OA 1S5CD 1D2BA 2KOLA 3U9SA 1EEID 5C6AA 3DHQA 3Q22A 2RBMA 1HQRD 3HEJA 4LK1C 1D1IA 2NN6G 2FMCA 1FR3A 1XXGA 5JEAG 2FFKB 2ZT9C 4K5VA 2Y0SB 5CMDA 1EWCA 5KNDA 1LABA 3SE0A 2IX0A 1TWGB 2X6GA 4FF3A 1U4LA 4CBVA 3N6RA 4ULLA 3D8GA 1DD2A 1SNOA 1Y8OB 3V2TA 1I6HB 1E0BA 4KY7A 5JPNC 1BCPB 5FOBB 1IW7D 2EY2A 2QILA 4BY1B 1W6JA 1DONA 1TT2A 1F9SA 1VF5C 5G3LD 2L11A 1A3TA 3MZ5A 1HA6A 4NKLA 2F0IA 4DNTB 2RKSA 2ZXPA 1SNDA 4F8MA 1V1PA 1DYQA 3OW7A 3GQBA 1LLRD 5KNCA 2QF7A 3VYRA 3NPPA 1XX8A 3HZXA 4H7BA 3URYA 1WD0A 1VCIA 4FNFA 1LTID 1GUTA 4L63B 4QUCA 3D4WA 1SYEA 3MA2B 1YNJD 5ELEA 2BCOA 4OHJA 5JEAJ 1HXYD 3CU7A 2SNSA 4K8IA 5M5YB 2K6AA 5JVH3 2AUKA 3MHBA 1PTOD 1UEAB 2LY7A 3OMGA 1RODA 4IUUA 3T16A 3RD4A 3QB3A 2PQEA 2CW0C 2F0LA 2K5DA 5C4XB 4C2MB 3MXPA 3GO5A 2VNUD 3L3OC 3FVQA 2Z1CA 3F2UA 1PRTD 2FINB 1KABA 4GZYC 3CKIB 5IIFA 3I90A 4Q0FA 1XTCD 3WOEA 3SVMA 5K36G 5IT9L 5I4DA 3NE5B 1CZWA 2J0TD 1O7LA 3J7YW 1CQFA 1ZXTA 4QIWB 1ONLA 5LL6S 2IW3A 1TU2B 3IAYA 4RA8A 1WTWA 2J4XA 5I9OA 4C1NK 2IL8A 1ENCA 4A3FB 1FYCA 2HDLA 3S16B 5KIXA 2JEAI 4V190 3PUZA 2A68D 3MXNA 1D5ZC 4BWGB 1BXTA 2PNRC 1RD9D 4IURA 3VYTA 5DM73 2HCIA 4L6TB 3PUYA 3ZYYX 1V1OA 2X69A 1EYDA 1BQQT 1RDPD 4HCSA 5CV7A 3OHXC 1EY8A 3S9WA 1QB5D 4KK7A 2A69C 2KHSA 1PLFA 3P1HA 2MPMA 3Q0AA 4TSSA 1Q8IA 1NSNS 5CV8A 1KNAA 3NBHA 3FKIB 3IFDA 4XQQA 1LV9A 2RQXA 3BDOA 2E2HB 3GV3A 2EVBA 1CA5A 5E1FA 4F7XA 2Z4IA 5CGKA 2EYLA 1GOZA 3SR1A 2PCFB 1SE4A 4K2LA 1IYVA 5C3WA 3DUZA 1ILQA 1FGBD 5KYIA 1F9QA 1B3AA 4RHSA 1NUCA 4KI0A 3T51B 3OIQA 1JCKB 1PFNA 2WV6D 3RZDB 3L7ZC 5A2QE 2I46A 3UI2A 2KJXA 2NN6H 3K7AB 2NB0A 2XWJB 5JEAH 1PFMA 3A7LA 1G6ZA 3HOYB 1R4PB 5TSSA 4X3KA 1SE2A 5LHY1 2AQ1B 2L5TA 1WTPA 1EU4A 3QWNA 2Z4HA 3O13A 2IJ0A 3PUVA 2EZVA 1EY0A 3NTIA 1UUPA 2NBFA 1T5XD 2EYFA 1SAPA 3DXJC 1DOMA 1AFPA 4YIJA 5ELFA 1Q1EA 1D6EC 1ZYRC 2JE6I 2N88A 1I6VC 2A73B 5C3XA 3A54A 1RHPA 4IUPA 2JYOA 2EJGC 5E4XA 3H6MA 2DNEA 5EKLA 1BCPF 2O5IC 1G2SA 1IHZA 3EJIA 4XT1B 5C0XG 4DFAA 2ZXOA 4IQZA 2NWGA 3HS0C 2JP1A 5JOBA 3S2DB 2WINB 2DY7A 3NXWA 5I6YA 1TQOA 3TBIB 4R8IA 1K83B 5BN3A 2KA7A 3A8KE 3QO2A 3HOXB 5EPJA 4F88A 4K2KA 3K57A 4XT3B 5D14A 2EYOA 4Z9CB 2K7VA 4RGNA 1OXVA 3EROA 1RCVD 4TQUS 5K5PA 1A2TA 2R92B 1X3PA 3MVVA 2F0UA 2RVLA 4C3IB 2F0JA 1FNVA 4C3IG 4XDXA 5M3MB 2F0NA 3M7NA 1SYGA 4BA2I 1O7YA 2D9UA 2F3VA 5HGTA 4ABNA 5K36H 4A3MB 5CBEE 3TP7A 1SEBD 1GUOA 3IL8A 4R9WA 2F4IA 2VB2X 2EJMA 5IGEA 1DOKA 1DM0B 4OIKA 1JOQA 3D4RA 2V4DA 5D3IB 1ESRA 5C0XJ 2JXMB 1STAA 4IZ8A 4MHEA 4TRDA 4IUQA 1B50A 1KLGD 4CKBA 1NR4A 4DU9A 5J1ZA 1BBXC 1STEA 2WIIB 3EA6A 3AU7A 1PFBA 1HPCA 1JWSD 1B9NA 3M3YB 2F0KA 3K5NA 5IGDA 4ID6A 4LMQD 2VB3X 1Q12A 1EQVA 1EZ8A 1F9PA 2MUYA 1EYCA 3K5LA 2KEEA 4C3HB 3SK5A 4C3HG 4G7OC 1MSGA 1HUNA 1JICA 4IUNA 3VR4A 1Z47A 2O2LD 1OXUA 1CFMA 4HSVA 1LT5D 4KY5A 3NTHA 4HMJA 3PIO3 5EGTA 1TWAB 1Q90A 2A6ED 3BDCA 2NVTB 1PTOC 2B8GA 3MAQA 2HUGA 3I8ZA 2D2CC 1SNPA 1CA6A 1F77A 1PRTC 4HN7A 2EYPA 5FLXL 4ZKCB 3TZDA 4KKTA 4Y7NB 1SDFA 4JBWA 3C2PA 3J81L 1KDCA 4KD3A 2A6HD 3LX0A 3KBXA 4LJZC 1HA5A 4QMGA 2NTTA 1YNND 1STGA 4KN7C 1GXDC 4ZLTF 4A3BB 4MIUA 5T1GA 2AWNA 4K5XA 2F0PA 3OOCA 4QF4A 2A68C 4HR7B 4N9TA 3MXUA 1SSOA 1DZ1A 2BA1A 2BA0A 2EDGA 3W2DA 4KJNA 3PUWA 1IYUA 1Y8NB 3I91A 4RGMA 4DGZA 1MSHA 3TSSA 1OXSC 2LMCB 4XIGS 3HKZB 1R9TB 3Q6SA 2L0CA 1E2VA 1HHVA 2R93B 5M5XB 1S4ZA 1WTOA 1TS4A 3T53B 5KRUA 3OWFA 1QWYA 4ZK9B 3NWSA 4UAIA 3GTMB 3VR5A 4PV1C 4KV6A 4IFDI 1LTAD 3E0JA 4B9XA 2F1MA 5C0XH 4DAVA 4O1NA 2WP8J 1F2ZA 1NCVA 2DNCA 3RLFA 1RJTA 4M1UB 4NP5A 2SOBA 1V43A 4NDXA 3RUZA 1WTQA 3DWAA 5J22A 2B2UA 2F03A 1ESFA 1MI2A 1B1ZA 3I4NB 1B9MA 1VDZA 2PZTA 4XYOA 2JSOA 1VMCA 3HGBA 4JK1C 1H9JA 2L9HA 3I72A 2RDHA 5KEEA 3P7JA 4HEDA 1STHA 5HURA 1F9RA 2EY5A 2D62A 5M9OA 1CK1A 5EJWA 2N55A 3K59A 2WB1B 1WTXA 4H0LC 1HTPA 4KY6A 5EQ0A 4E6IA 1EL0A 1H9KA 1I50B 2K33A 2KUMA 3D6WA 5EPLA 2K04A 1HRJA 1EYAA 1O80A 2XSCA 3H91A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HSV A;  1PDQ A;  2SDF A;  3FPU B;  1B4O A;  1HUM A;  1XX8 A;  1ILP A;  1X3P A;  1ML0 D;  1PFM A;  2CVR A;  2EPB A;  4HAE A;  1AZP A;  2MJ8 A;  2R3Z A;  1WTR A;  1Q3L A;  2B2W A;  3Q6S A;  4IUR A;  4RWS C;  1BF4 A;  1G6Z A;  1U4P A;  2L12 A;  1WD0 A;  1HHV A;  1IL8 A;  2HCI A;  2RSO A;  4NW2 A;  2B2V C;  2MGS A;  2XIW A;  4IUV A;  1MGS A;  4X3K A;  1XYI A;  1S4Z A;  4U68 A;  2KOL A;  1WTO A;  2VXW A;  2X69 A;  2B2Y A;  1WTP A;  1O7Z A;  4RAU C;  1CM9 A;  1NAP A;  1QNK A;  2RVL A;  3HP3 A;  4QUC A;  2FHT A;  4ZK9 B;  1WTV A;  1X32 A;  2B2U C;  3LWE A;  4UAI A;  4CJ0 B;  4HCS A;  2HUG A;  3I8Z A;  5EPK A;  2L4N A;  1A15 A;  4XDX A;  3ONA B;  5EKI A;  1JE4 A;  1G91 A;  1CA6 A;  1VMP A;  2FFK B;  5CMD A;  5E4W C;  3MWY W;  2B2T C;  5AFW A;  1U4R A;  1PLF A;  3G7L A;  1SAP A;  2K05 A;  1DOM A;  1NCV A;  2X6G A;  2MPM A;  3I3C A;  1O7Y A;  2B2V A;  1RJT A;  4ZKC B;  2D9U A;  3TZD A;  1U4L A;  2BDN A;  5CBE E;  1WTQ A;  1SDF A;  1ROD A;  4IUU A;  1KNA A;  4MN3 A;  1B53 A;  2N88 A;  3IL8 A;  2B2U A;  3IFD A;  4R9W A;  1MI2 A;  1E0B A;  1DOK A;  1RHP A;  2KVM A;  4IUP A;  4OIK A;  1LV9 A;  2JYO A;  1B2T A;  1DZ1 A;  5E4X A;  2Q8R E;  2FMM A;  5D65 A;  1U4M A;  1ESR A;  3F2U A;  3GV3 A;  2K03 A;  3KBX A;  1VMC A;  2B2T A;  1CA5 A;  2EOT A;  1EIH A;  2FIN B;  1G2S A;  1F2L A;  2L1B A;  2FJ2 A;  4X3S A;  4XT1 B;  1G2T A;  4X3U A;  5DNF A;  1BO0 A;  1RTN A;  2DY8 A;  2L9H A;  4ZKB B;  3FDT A;  1NR2 A;  3I90 A;  4MHE A;  2RSN A;  4IUQ A;  1B50 A;  2NYZ D;  2X6L A;  3P7J A;  5T1I A;  2J7Z A;  2NWG A;  4ZLT F;  1J8I A;  3SVM A;  5JJZ A;  2JP1 A;  4HED A;  1NR4 A;  1F9R A;  5T1G A;  1IKM A;  1HFN A;  2K01 A;  1WD1 A;  1BBX C;  2DY7 A;  5COY A;  5COR A;  1DON A;  3DEO A;  2EE1 A;  1F9S A;  1PFB A;  1ILQ A;  1IKL A;  2RA4 A;  4CJ1 B;  1WVL A;  1BNZ A;  5EJW A;  2N55 A;  3N52 A;  4ZAI A;  3DM1 A;  1ZXT A;  1QE6 A;  2K1B A;  2L11 A;  1F9Q A;  4R8I A;  1B3A A;  1X3Q A;  3TN2 A;  5CBA E;  1HA6 A;  2KED A;  4LMQ D;  1C8C A;  1ICW A;  1SSO A;  3KUP A;  4RA8 A;  4QUF A;  2HCC A;  3GV6 A;  4IUT A;  4CJ2 C;  2M2L A;  1WTW A;  1AZQ A;  1GUW A;  2B2W C;  1TVX A;  5EQ0 A;  3QO2 A;  1HFG A;  1PFN A;  5EPJ A;  2K28 A;  1EL0 A;  1EIG A;  1F9P A;  1J9O A;  1EQT A;  1RTO A;  4XT3 B;  1M8A A;  2IL8 A;  3DEP A;  5D14 A;  4X3T A;  1DOL A;  1KNE A;  1QG7 A;  3R93 A;  2HDL A;  4O42 A;  2KUM A;  3D6W A;  3I91 A;  5EPL A;  2K04 A;  2Q8T A;  3UI2 A;  2B2Y C;  4DN4 M;  1HRJ A;  2KEE A;  2KEC A;  4OIJ A;  1EOT A;  3MTS A;  1MSH A;  2HDM A;  1O80 A;  2NZ1 D;  1HUN A;  1MSG A;  1JIC A;  2H1E A;  2MP1 A;  1WTX A;  1AP0 A;  3H91 A; 
#chains in the Genus database with same CATH topology
 1RIP A;  5ELB A;  1STB A;  4HSP A;  3M85 A;  4B3R L;  3F2B A;  2RSO A;  5ELO A;  1LO5 D;  2XIW A;  5ELN A;  3ICE A;  4A3M H;  3U58 A;  1XYI A;  2UUB Q;  2B2Y A;  3J80 i;  1IBK L;  3CD6 A;  1AW7 A;  2VQF Q;  4R1J A;  1SMY D;  2KEN A;  3ITP A;  4GNX C;  1WTV A;  4DR5 Q;  4N8F A;  2PMZ B;  3Q24 A;  2L4N A;  5DM6 3;  4IFD J;  1A15 A;  1STN A;  3A8I E;  5JPM C;  1X3G A;  1WFQ A;  1G51 A;  4L5Q A;  2ENB A;  1TWC B;  1U9R A;  1EY7 A;  4IPG A;  2SEB D;  4B9W A;  1U5K A;  4UDU C;  3CF5 A;  4RCO A;  4O0A A;  5FO7 B;  3SDZ A;  3M4P A;  2QCP X;  1QIL A;  1DCZ A;  2JK8 A;  4MN3 A;  1B53 A;  1JR0 D;  1OO9 B;  2UUA L;  5KGU A;  4QCL A;  2K5Q A;  3BG3 A;  3LWU A;  1B2T A;  4L5T A;  3JAM E;  1HR0 W;  5IP7 H;  4APV A;  4A76 A;  2F0D A;  2N78 A;  3M3Y H;  1X55 A;  3K6O A;  1H9S A;  5KYL A;  3TP5 A;  2OXP A;  1G8Z D;  2IY5 B;  4KHP Q;  1Y14 B;  1PYB A;  4KJO A;  1SNC A;  2K5N A;  3NHH A;  3CC7 A;  2HQE A;  5L37 A;  3OMC A;  1I3Q B;  5FO8 B;  3VYS A;  1J8I A;  2K14 A;  1BBU A;  4GNX A;  1GKH A;  4C3H H;  4U67 3;  4LUZ A;  1KXL A;  1WVL A;  5DLQ E;  2I0Q A;  4XXE A;  2GVB A;  4A3I B;  2F0T A;  5BN4 A;  4A3I G;  1TWA H;  3IKJ A;  4OL7 A;  2PPB C;  2KQ3 A;  4FF1 A;  4XQJ A;  2NVT H;  1XMQ Q;  1VQJ A;  3I7F A;  4AQY L;  2FXQ A;  3CRL C;  1PTO B;  2TMP A;  4DV6 L;  1TS3 A;  4G57 A;  4B3R Q;  3DM3 A;  4BBR B;  4C56 C;  4H44 C;  4JPB W;  4BBR G;  5GQO A;  3E5S A;  1LM0 A;  5JVG 3;  4OXP A;  3GTQ B;  1PRT B;  4Y7N H;  1MGS A;  4U68 A;  4LAA A;  4N9P A;  1CKN B;  4LWC A;  2VXW A;  3GTO B;  3HOU B;  2BE5 C;  1NAP A;  2F52 A;  2B8F A;  1SYF A;  3HOU G;  1IYJ B;  4K5W A;  4UP8 A;  1T5E A;  3NWT A;  3EVQ A;  5EPK A;  3H0G B;  3J81 i;  3H0G G;  4JW0 A;  3K81 C;  1LTB D;  4A3J B;  1PZK D;  1HNW Q;  2EIF A;  3RZO B;  2ICI A;  4A3J G;  3VR2 A;  1B3Q A;  1ENF A;  1EWH A;  2UUA Q;  3NK9 A;  1W6K A;  3R8B A;  1EY9 A;  3S1Q B;  4A3B H;  5JAV A;  1D8L A;  4QGU A;  2A19 A;  4K14 A;  4F87 A;  4R8N A;  1I4P A;  2CW0 D;  2K5W A;  5IOD A;  2KCN A;  1F2M A;  4IO9 A;  1KRS A;  3SEB A;  3HRZ C;  2Q8R E;  2FMM A;  1V1P B;  1X9N A;  2MNA A;  3P75 A;  3I2Z A;  4DF7 A;  4L8J A;  4X3S A;  3NBI A;  4DR7 L;  4X3U A;  4KHV A;  2MO0 A;  3T4A C;  2VUM B;  2IT1 A;  4BXX G;  1WI5 A;  1EU3 A;  1SNQ A;  2VUM G;  5T1I A;  4RHR A;  4XTC S;  5C3E B;  4RFB A;  4EQO A;  1VQ4 A;  1EEF D;  2Z8L A;  4FVM A;  4BS9 A;  1Q86 C;  1SXT A;  1A63 A;  1EYG A;  1QUQ B;  4JI7 L;  1Z7T A;  3PCO B;  1UE6 A;  1BNZ A;  4HIO A;  4OGQ C;  5KNB A;  1LTR D;  2PZW A;  1S5F D;  1E1T A;  5CBA E;  2Q8I B;  2XTI A;  1R9T H;  3I4M B;  5IYC H;  2M2L A;  2YTV A;  3H94 A;  4PZ7 A;  4AH6 A;  1K8M A;  3BYT B;  3I4M G;  1ZEQ X;  2R93 H;  3VA5 A;  5M5X H;  4X65 Q;  2PO4 A;  3VA7 A;  4JOI C;  3GTL H;  4TKO B;  1GM5 A;  1IL2 A;  4OIJ A;  1D1K A;  3GTM H;  2E76 C;  2QKI C;  2MP1 A;  3F2D A;  3TP8 A;  1AP0 A;  2PYK A;  1S5E D;  1X56 A;  3FPU B;  3NUC A;  1FL0 A;  4ZCK A;  1Y8P B;  1M4V A;  2RCN A;  1Y1W B;  5ELC A;  2ZXR A;  4RWS C;  2R6G A;  1Y1W G;  1YNX A;  1U4P A;  2L12 A;  4QY7 A;  4NW2 A;  2JEB I;  5LMN L;  1QOH A;  1ET9 A;  5H1S E;  1EY6 A;  1CM9 A;  2K5H A;  3HP3 A;  1FNW A;  4EVO A;  2ID0 A;  2CH4 A;  3PO3 B;  1IZ6 A;  3OWE B;  3I4N H;  5J39 A;  4NB3 A;  1K8G A;  3S15 B;  3S14 B;  2UXB L;  3PO3 G;  4EQP A;  2R7Z B;  2A6H C;  1SFO B;  2R7Z G;  3MWY W;  1R4Q B;  3G7L A;  4R4C A;  2R7D A;  1JB7 A;  3F8T A;  1MD2 D;  2B2V A;  5E7N A;  2LFN A;  3RNU A;  4LF9 L;  1VQA A;  2F0O A;  3LGJ A;  4YY3 Q;  4KD4 A;  1XNQ Q;  1TWH B;  1HH2 P;  2R7F A;  4B3M L;  3PIP A;  1KDB A;  1YHB A;  4B3S Q;  4WRD A;  1BOS A;  4CKC A;  3CQZ B;  5ELD A;  2B2T A;  3W1G A;  5C4H A;  1Q1B A;  1D5X C;  3K5O A;  1IW7 C;  1UNS A;  2HT1 A;  1BO0 A;  1Y69 U;  3CP0 A;  3C1F A;  2RSN A;  3P20 A;  1QNU A;  3L9A X;  4JV5 L;  4GN4 B;  1LTT D;  3J80 L;  2MO1 A;  2XVS A;  2XNA C;  5LMU L;  2NUC A;  3TDQ A;  4PQX A;  4JBK A;  1N32 L;  2M9V A;  4CJ1 B;  4J6H A;  4P2C B;  2VQE L;  3CCM A;  4ZUJ A;  4DV3 L;  2K1B A;  1NE3 A;  1GJX A;  4FDB A;  1LT6 D;  3M4Y A;  2AWO A;  4IUT A;  1GUW A;  1EUJ A;  1H9S B;  3T1H L;  4IAL A;  3EN2 A;  2NZH A;  4JVZ A;  1JOR A;  2G9H D;  1M8A A;  4AIM A;  4DNI A;  1B44 D;  4AYB B;  3R93 A;  2Q8T A;  4DN4 M;  4AYB G;  2WKD A;  1JB3 A;  1BCP D;  1EOT A;  1PMR A;  4OO1 G;  2UXD L;  2F0H A;  5IGC A;  2YV5 A;  4DV4 L;  4OO1 I;  2CQA A;  5M3F B;  4GNX B;  5LMN Q;  1JQY D;  4DV7 L;  5IYD G;  5HGQ A;  2SDF A;  1KRT A;  5M3F G;  4EGV A;  3IFT A;  2NZO A;  1TWC H;  1Q82 C;  3L0O A;  3D6C A;  2B2W A;  3I70 A;  3A7A B;  2UXB Q;  1OXT A;  1LTS D;  1E2W A;  2I07 B;  3S17 B;  1HCZ A;  1PFS A;  3H3V I;  5C5L A;  1O7Z A;  3CC2 A;  1EY4 A;  1QNK A;  1K0R A;  5ISR A;  1PHJ A;  2EY1 A;  3VR3 A;  3Q23 A;  3S1N B;  3ONA B;  1UE1 A;  1ENA A;  1VMP A;  1YNJ C;  4ODG A;  5G3L F;  2O5J C;  3PIP 3;  3MXG A;  2C35 B;  4DR2 Q;  2EYM A;  2K05 A;  4FF2 A;  4NMZ A;  3PMF A;  4PMB A;  4DUZ L;  1I4G A;  1OXX K;  1SYC A;  4RKL A;  3PF4 A;  3OTO Q;  3K58 A;  2E2I B;  1I3Q H;  1XPR A;  4JI5 Q;  1FJG Q;  4YCV A;  5GAG C;  4CHT B;  5FLX E;  3VR6 A;  2IX3 A;  4BBS H;  1MIU A;  3G6J B;  4A3C G;  3FRP B;  1TY0 A;  5GAD C;  1WJJ A;  4DNR B;  1G29 1;  1JT8 A;  1HNZ Q;  4A3I H;  2QEJ C;  3KF8 A;  1W3S A;  2DY8 A;  2JA7 B;  4RKB A;  2JA7 G;  2VQE Q;  1YZ6 A;  4GKK L;  2CKZ B;  2D0O A;  2NYZ D;  2X6L A;  2J7Z A;  4KKS A;  4B08 A;  1SYB A;  5IYB H;  3JAM i;  3M9B A;  4MTN A;  4JBM A;  4HCE A;  4OWT B;  2ZTC A;  1UWV A;  4X66 L;  1PTO H;  3T1H Q;  4BBR H;  1STY A;  1IKL A;  1PH3 A;  3KLS X;  1D5M C;  1SE3 A;  2EYJ A;  4YCU A;  4DXF A;  2A74 C;  1N36 L;  2KED A;  2KHI A;  2BOS A;  2L55 A;  4ME3 A;  1N33 L;  1GUG A;  2K32 A;  3MEH A;  2UXD Q;  4GLV B;  4L5R C;  2GA4 B;  3PUX A;  2EJF C;  1I4R A;  1WYD A;  2OWO A;  5C44 B;  3KK7 A;  1EQT A;  2C9O A;  1TWF B;  1QCB D;  1SYD A;  2F0M A;  5C44 G;  3GTO H;  1NBW A;  2MFI A;  4DAP A;  4TVA B;  2YU9 B;  1JOK A;  3M4O B;  1PTO F;  1SMY C;  2ICE C;  2OF1 A;  1JWM D;  3MTS A;  2ATW A;  3H0G H;  1BDO A;  2NN6 I;  1QVC A;  1PYW D;  1CZG A;  1PDQ A;  1X65 A;  4A3J H;  1LTG D;  4YWK A;  1ILP A;  1HZA A;  2MJ8 A;  4LF4 Q;  2SNM A;  3QOL A;  1JJC B;  1TR5 A;  3EFX D;  4V0B A;  1LT3 D;  4LFB Q;  1TKW B;  4Q5V A;  4DV1 L;  2CWA A;  1PRT F;  3S1Q H;  3HOZ B;  3HOZ G;  2HHH L;  1QVF A;  3NEN A;  2KCC A;  1W2B A;  4BY7 B;  3LWE A;  2B2U C;  3G4S A;  4LFA L;  4BY7 G;  4QL5 A;  3SXH A;  5EKI A;  3D3R A;  5CR3 A;  1KLU D;  5AFW A;  4NXM L;  4X62 L;  4BXX H;  2VUM H;  1EZ6 A;  4R4O A;  4CKE A;  2BDN A;  3AMU A;  2BDO A;  3BZD B;  3DWQ A;  1VF7 A;  1VQM A;  3GTL B;  1JOO A;  3DLL A;  1QZH A;  3SK6 A;  2XWB B;  2ZTD A;  2KVM A;  3WDN A;  5JJI A;  4IFD G;  1C4Q A;  2K03 A;  2DN8 A;  3FEW X;  4KKU A;  3SK4 A;  2UUB L;  2NVQ B;  1VQK A;  2EOT A;  3NP8 A;  1F2L A;  4BA1 I;  3AB9 A;  5DNF A;  3MC0 B;  1BKB A;  3I4M H;  4J1M A;  4ZKB B;  3Q8D A;  4DR5 L;  4PG3 A;  1F2Y A;  5JJZ A;  5IGG A;  1N36 Q;  4RGT A;  2UUC Q;  3OYY A;  4IJH A;  3UE0 A;  1FD7 D;  3NQT A;  1SRU A;  4LF6 L;  1DGS A;  3HFZ B;  3KYH C;  3ZJY C;  1QE6 A;  3J7A V;  4WOR A;  2C5C A;  4QJF A;  3FPP A;  1Y1W H;  3HOW B;  1ICW A;  3HOW G;  4GN5 A;  1EWI A;  2K28 A;  3QIA A;  4UPA A;  4HJ7 A;  2B2Y C;  4JCV E;  1I4X A;  4KHP L;  1CHQ D;  1NNX A;  4DV1 Q;  3VYU A;  3S15 H;  3S14 H;  1KDA A;  5IT9 E;  3RR5 A;  3BVZ A;  3TME A;  2R7Z H;  1UAP A;  4LF7 Q;  2N49 A;  1DJR D;  2M00 A;  1HUM A;  1H9R A;  4KHZ A;  1SFO H;  4FYD A;  4CDE C;  2CVR A;  1HQM C;  1PH5 A;  4IOC A;  1WTR A;  1A3V A;  3HKZ E;  4LFA Q;  1VQL A;  3X3M A;  4JYA Q;  1HTL D;  2G5D A;  1A6X A;  3A56 A;  5M5W B;  4RAU C;  5C5M A;  1RKN A;  5FKA C;  1SJE D;  4DA2 A;  4DK0 A;  5I9P A;  4X62 Q;  1LYL A;  3J7Z C;  3NTK A;  3C46 A;  3GD7 A;  3CQZ H;  1H95 A;  2EYH A;  3GTP B;  2RHQ B;  1XMQ L;  3KJO A;  2WAQ B;  4DV5 Q;  1QJO A;  2B3G A;  1GUS A;  1VQ9 A;  2WAQ G;  4JI8 Q;  4KN4 C;  2E8G A;  3I4L A;  4LW1 A;  2F0V A;  4IOA A;  5FO9 B;  2K75 A;  3A5U A;  2B39 A;  2PZU A;  1XPO A;  1JE5 A;  1AN8 A;  1XPU A;  1X3F A;  4A3G H;  3DWP A;  4CGY B;  2OT2 A;  1Y1V B;  2WKC A;  1U4M A;  3C1E A;  3S1M H;  1Y1V G;  3QOJ A;  1N34 L;  3S1R B;  2CFM A;  1RF2 D;  3OSO A;  3H3V C;  3CHB D;  5C4Z A;  2YYZ A;  4K6D A;  4LF6 Q;  4DR3 L;  1VQO A;  3J7A F;  4A93 B;  2Q2U A;  1XNR L;  4A93 G;  2JA6 B;  1HNW L;  1HFN A;  1IKM A;  1WD1 A;  4OO1 H;  3F1Z A;  2E74 C;  2JA6 G;  1PYS B;  1O78 A;  2EE1 A;  1II3 A;  1EQQ A;  4CDC C;  5IYD H;  1YIT A;  1E2Z A;  3N52 A;  3KDF A;  5M3F H;  2RDF A;  3DM1 A;  4A3D B;  3BVG A;  2RDG A;  4G4K A;  3UDI A;  1X3Q A;  4C1N I;  4A3D G;  4A3E B;  2LSS A;  3W3A A;  2XN9 C;  3KF6 A;  4QB4 A;  1NY4 A;  4A3E G;  2HCC A;  1AZQ A;  3R3O A;  2WAC A;  2WB1 E;  4ILW A;  1HFG A;  3H3V H;  3OW2 A;  3KF8 B;  1SBB B;  4X3T A;  4DV2 Q;  1L0Y B;  2AQ3 B;  3NQI A;  3S17 H;  1WCM B;  2NVX B;  4RMF A;  4DKA C;  4XQN A;  1WCM G;  2LXJ A;  4BBS B;  3S1N H;  3FHW A;  2NZ1 D;  3ERQ A;  2H1E A;  2ZJR A;  4BBS G;  3KFU A;  4KMU C;  1C0A A;  2EPB A;  3TP6 A;  5FLX c;  2D5D A;  4PMW A;  1I4Q A;  3HG9 A;  2R61 A;  5NUC A;  1IBM L;  3KOJ A;  1E24 A;  4IUV A;  2E2I H;  1ICF B;  1U0L A;  3JAM L;  2VS1 A;  5IYB G;  1I4H A;  3BYY B;  3D4D A;  2FHT A;  3GTJ B;  4A3C H;  4CJ0 B;  3HKS A;  4RH6 A;  1K0S A;  3V05 A;  2Z9H A;  2PMZ E;  1G91 A;  2F0G A;  3QR8 A;  1K73 C;  4FXG C;  5E4W C;  4PMC A;  4X65 L;  1U4R A;  3BS1 A;  1A8V A;  1EQR A;  3LNN A;  2JA7 H;  2PI2 E;  1Q7Y C;  4K6L A;  4FXD A;  1PZJ D;  3U50 C;  3OIP A;  3V96 A;  1N34 Q;  4I65 A;  2E75 C;  3R2T A;  4JI3 Q;  1A0I A;  4A3K B;  1E1O A;  4LF5 Q;  4A3K G;  1M90 C;  4DR3 Q;  1MBY A;  1CI3 M;  5A35 A;  4HJ5 A;  3H09 A;  1XNR Q;  1BBW A;  1X54 A;  1FNU A;  2FJ2 A;  1PH6 A;  2JN4 A;  4HTH A;  4DV0 L;  3TRZ A;  2F0E A;  3FDT A;  3T56 B;  3G48 A;  1NR2 A;  2LKV A;  5CC4 A;  1OTC A;  1A3U A;  2A5H A;  2PQA A;  5C44 H;  4DAY A;  1S5D D;  4ZRZ A;  5I6W A;  1TWF H;  2ZTE A;  3GP7 A;  1TII D;  2QA4 A;  1HR0 L;  4FO2 A;  1KTK A;  2AMC B;  3GTG B;  2YU9 H;  3M4O H;  4R4Q A;  5COY A;  1BCP C;  2Z6K A;  3W5O A;  1VQG A;  2RA4 A;  2E2D C;  1IXR A;  1SJH D;  2F0Q A;  4JC0 A;  1EY5 A;  4YY3 L;  3JC6 6;  5CYU A;  1XNQ L;  2H4O A;  1C8C A;  1HZ9 A;  3EBE A;  3KUP A;  4QUF A;  3GV6 A;  4CJ2 C;  5A2Q L;  1H9M A;  4UP9 A;  4R4I A;  2YTY A;  3TS0 A;  3CMA A;  2DJG C;  1CKM A;  3D31 A;  4RG1 A;  1EIG A;  1J9O A;  1EIY B;  1L0W A;  3HOZ H;  4B3S L;  2F0F A;  3ND9 A;  1KNE A;  1QG7 A;  5BN5 A;  1PZI D;  3CW2 C;  4JI2 Q;  4G7Z C;  2LS0 1;  2QDL A;  4BY7 H;  1HJP A;  4FXK C;  1IBM Q;  3KLS A;  2TSS A;  1PH2 A;  2GVA A;  2N3S A;  3PO2 B;  3PO2 G;  1B4O A;  5F2D A;  1ML0 D;  4JI4 Q;  1Q3L A;  1BF4 A;  3TZU A;  2DJF C;  3A8J E;  3B6Y A;  2B2V C;  2MGS A;  4ME5 A;  3RMH A;  1MHW C;  1SNM A;  3U9O A;  2A6E C;  3PV0 A;  2IPK D;  1MJE A;  2XRQ D;  4LUV A;  2IX1 A;  5CV5 A;  2RHS B;  1Q8K A;  3SHL A;  1A2U A;  4IFD H;  5DAU A;  3AQQ A;  5CV4 A;  2NVQ H;  1VQP A;  2B2T C;  1CQV A;  3T1Y Q;  4C3J B;  4UP7 A;  5C0X I;  1C48 A;  1SMX A;  2F3W A;  4C3J G;  5EBC A;  2EXZ A;  1GVP A;  3EQL C;  4P75 A;  4DR1 Q;  3HOV B;  1P16 A;  2F4V L;  3WOF A;  1RL2 A;  1S5B D;  3HOV G;  3S2H B;  4HMI A;  4J15 A;  3K0Y A;  4DV0 Q;  4PNY A;  1CTM A;  5LL6 X;  5D3D A;  4GOP A;  2A69 D;  2KCM A;  3SK8 A;  1HR0 Q;  5I2Y A;  3ULL A;  3PQI A;  2CHB D;  1LT4 D;  1YEZ A;  1G2T A;  3HOW H;  5C4J B;  4FF4 A;  3X3N A;  1RTN A;  2MHV A;  4OWX B;  5DEH A;  1YNN C;  1PH1 A;  3STB C;  5IT9 c;  2MQH A;  3I73 A;  5CV9 A;  2NVY B;  2K01 A;  5IGF A;  4RCN A;  3DEO A;  4DR2 L;  4EQN A;  4ZAI A;  1AEX A;  3J80 E;  3OTO L;  2PW7 A;  3GTK B;  3TN2 A;  3CCS A;  1E7Z A;  3K7U C;  4JI5 L;  3PSI A;  1FJG L;  1UE5 A;  3BJU A;  4KTA A;  1SN8 A;  2B2W C;  1TVX A;  1B7Y B;  4WFN 3;  4FP5 D;  3DEP A;  2JA8 B;  4O42 A;  5M5W H;  2JA8 G;  4JI0 L;  3GDE A;  2KEC A;  1HNZ L;  4A3G B;  3MFY A;  3PIO A;  1PXU A;  1V8Q A;  2G9D A;  4A3G G;  1KAA A;  2O4X A;  3CRK C;  3J7A 5;  1T9H A;  3S1M B;  2E2J B;  3QJY A;  1BR9 A;  3GTP H;  3CCV A;  3MFG A;  5IGB A;  2R3Z A;  1GHJ A;  1IL8 A;  2PW5 A;  4IN3 A;  4DAM A;  3CCQ A;  3E6Z X;  3ND8 A;  1X6O A;  2IWH A;  3RN2 A;  2BE5 D;  1B8A A;  3K5M A;  4IPD A;  1BUV T;  1CT1 D;  4J8Q A;  1JC7 A;  3BVM A;  1X32 A;  4A4I A;  2QEX A;  4DXG A;  2F0W A;  3M7G A;  1Z6H A;  1Y1V H;  1JE4 A;  3OPO A;  2F4V Q;  2QDB A;  1LAC A;  2NTS A;  4GN3 B;  2EY6 A;  4XYQ A;  1AE2 A;  3S1R H;  4H13 C;  3AFQ A;  3S24 A;  1L1O C;  1NJI C;  1XWE A;  3I3C A;  2I5H A;  5FK9 C;  4HIK A;  5IOC A;  4A93 H;  1EOV A;  2OEO A;  2HIV A;  4WJ4 A;  1YVC A;  1TS5 A;  2JA6 H;  3A55 A;  4K8J A;  4LF4 L;  4DUY Q;  4LFB L;  4A3D H;  5D65 A;  1DXM A;  4M8A A;  4RGO S;  4DR4 Q;  3KLR A;  5CV6 A;  4A3E H;  1EIH A;  3KBG A;  2L1B A;  2Q2I A;  1K3R A;  4ZQ3 A;  3T13 A;  2AQ2 B;  4WJW A;  2XRS D;  1GUN A;  4LUO A;  4NPS A;  3PF5 A;  5E3F A;  1S40 A;  4I7Z C;  1GHK A;  4ZUI A;  1K28 A;  3QG1 A;  1JJ2 A;  1ZYR D;  4DK6 C;  1WCM H;  5EBD A;  2NVX H;  4UY8 C;  1L0X B;  1ZKO A;  2ALY B;  5COR A;  4NXN Q;  4G7H C;  5FJ8 G;  3H15 A;  2DGY A;  2ZM6 Q;  2B63 B;  1VQC A;  3BDL A;  1JWU D;  1TS2 A;  4S3S A;  1P8L A;  2B63 G;  1KIX A;  3FMC A;  4ZYS A;  4JI0 Q;  1L1O A;  3C3L A;  1TY2 A;  5EKK A;  3J81 E;  3R2I A;  2N8N A;  4X64 L;  1RTO A;  3K0X A;  3L2P A;  1DOL A;  1CHP D;  3KLW A;  2F0S A;  3FKI H;  2PQA B;  1K8A C;  4DK1 A;  3DMU A;  4DAY B;  1JMC A;  4AYB E;  1WTH A;  4X6A H;  3GTJ H;  3UE1 A;  2JA5 B;  1YJW A;  1YHA A;  2HDM A;  4LFC Q;  2JA5 G;  1G6P A;  1N9W A;  2AUJ D;  4HAE A;  1AZP A;  1ET6 A;  5I2X A;  1EFI D;  3NSW A;  2UUC L;  1K8O A;  1S5C D;  1C7Y A;  3AYH B;  1D2B A;  2KOL A;  1KC8 C;  3U9S A;  1EEI D;  5C6A A;  3TQY A;  3DHQ A;  1KD1 C;  3Q22 A;  4A3K H;  2RBM A;  1HQR D;  3HEJ A;  4LK1 C;  4O2D A;  3G71 A;  1D1I A;  3BU2 A;  2NN6 G;  2FMC A;  2Z6B A;  1FR3 A;  1XXG A;  5JEA G;  2FFK B;  2ZT9 C;  4K5V A;  2Y0S B;  5CMD A;  1EWC A;  1D7Q A;  5KND A;  1LAB A;  3SE0 A;  2Y0S G;  2IX0 A;  1TWG B;  2X6G A;  4MTK A;  3J81 j;  4FF3 A;  5IP9 G;  4JI1 Q;  1U4L A;  4CBV A;  2PNH A;  3N6R A;  4ULL A;  3D8G A;  4LF7 L;  1DD2 A;  1SNO A;  4HID A;  1Y8O B;  2GN5 A;  3V2T A;  3GTG H;  1I6H B;  1E0B A;  3RLO A;  1AH9 A;  4JYA L;  4KY7 A;  5JPN C;  1BCP B;  5FOB B;  1IW7 D;  4HIM A;  2EY2 A;  1MKH A;  1NMF A;  1IBL Q;  2QIL A;  3A5Z B;  4B3T Q;  1EFW A;  4N8X 1;  3UDG A;  4BY1 B;  2V1C C;  5BR8 L;  2OQK A;  1CSP A;  4BY1 G;  1W6J A;  4GLA C;  2KHJ A;  4DV5 L;  1DON A;  1TT2 A;  1F9S A;  1VF5 C;  5G3L D;  4JI8 L;  4X64 Q;  3PO2 H;  3E9H A;  2L11 A;  1A3T A;  3MZ5 A;  1N8R C;  1HA6 A;  4NKL A;  2F0I A;  4DNT B;  2RKS A;  1J5E Q;  3NEM A;  2ZXP A;  1SND A;  4MZ9 A;  1SLJ A;  4F8M A;  1V1P A;  1DYQ A;  3OW7 A;  4JI6 Q;  3GQB A;  1LLR D;  4UHV A;  5KNC A;  2QF7 A;  3VYR A;  3NPP A;  1XX8 A;  2CH4 W;  3HZX A;  4H7B A;  3URY A;  4C3J H;  3CCU A;  1WD0 A;  1VCI A;  3HOV H;  3BZC A;  4FNF A;  1LTI D;  1GUT A;  3S2H H;  4L63 B;  4QUC A;  3D4W A;  4WJ3 M;  1O7I A;  4IJL A;  1SYE A;  3MA2 B;  1YNJ D;  5ELE A;  2BCO A;  4OHJ A;  5JEA J;  1HXY D;  3CU7 A;  2SNS A;  4DV2 L;  4OON A;  4K8I A;  5M5Y B;  4EQ5 A;  2K6A A;  5C4J H;  5JVH 3;  3WWV A;  2AUK A;  3MHB A;  1PTO D;  3J80 c;  1UEA B;  2LY7 A;  3OMG A;  1ROD A;  4IUU A;  3T16 A;  1PH4 A;  3RD4 A;  2OQ0 A;  3QB3 A;  2NVY H;  2PQE A;  2CW0 C;  2F0L A;  2K5D A;  5C4X B;  3CPF A;  4YWM A;  4C2M B;  3MXP A;  1YHQ A;  3GO5 A;  2VNU D;  3L3O C;  5C4X G;  3FVQ A;  3RLN A;  5BR8 Q;  3CCL A;  2I5M X;  2Z1C A;  3F2U A;  3GTK H;  1PRT D;  2FIN B;  3VDY A;  1KAB A;  4GZY C;  3CKI B;  5IIF A;  3I90 A;  4Q0F A;  1XTC D;  2VY3 A;  1CUK A;  1LUZ A;  3WOE A;  3SVM A;  5K36 G;  5IT9 L;  2JA8 H;  5I4D A;  4YHH L;  4OWW B;  3NE5 B;  1CZW A;  2J0T D;  1I5F A;  1O7L A;  3J7Y W;  1CQF A;  4LNQ A;  2WFW A;  3KJP A;  1ZXT A;  4QIW B;  4H02 A;  2OTJ A;  1ONL A;  1TXY A;  5LL6 S;  2IW3 A;  1JJG A;  2E2J H;  1TU2 B;  3IAY A;  3AFP A;  4RA8 A;  4EX5 A;  1WTW A;  4JI3 L;  2J4X A;  5I9O A;  4GS3 A;  4YWL A;  4LF5 L;  4C1N K;  2IL8 A;  1ENC A;  4A3F B;  1YI2 A;  1FYC A;  2HDL A;  3S16 B;  4A3F G;  5KIX A;  2JEA I;  2QGQ A;  5IE8 A;  4V19 0;  3PUZ A;  2DUD A;  2A68 D;  1Q46 A;  3MXN A;  1D5Z C;  1BVS A;  1HZC A;  4BWG B;  1PH7 A;  1BXT A;  2PNR C;  1RD9 D;  4IUR A;  3VYT A;  1YJ9 A;  5DM7 3;  2HCI A;  1L1O B;  1XMO Q;  4L6T B;  2K4K A;  3PUY A;  4IPC A;  3ZYY X;  4Y52 H;  1V1O A;  2X69 A;  1EYD A;  1SE8 A;  1BQQ T;  1X3E A;  1RDP D;  2UU9 L;  4HCS A;  5CV7 A;  3OHX C;  1EY8 A;  3S9W A;  1QB5 D;  1L2F A;  4KK7 A;  2A69 C;  2KHS A;  4JI2 L;  1PLF A;  3P1H A;  2MPM A;  1E3P A;  2WAQ E;  4R4T A;  3Q0A A;  2K50 A;  4TSS A;  1Q8I A;  2LXK A;  1NSN S;  5GAH C;  5CV8 A;  1KNA A;  3NBH A;  3FKI B;  3IFD A;  4XQQ A;  4JI4 L;  2UXC L;  3FKI G;  5FJ8 H;  3J81 c;  3E0E A;  1LV9 A;  2L15 A;  2RQX A;  2Z6K C;  3BDO A;  2ZJQ A;  2E2H B;  3GV3 A;  2B63 H;  2EVB A;  4QIW E;  1CA5 A;  5E1F A;  4YHH Q;  4F7X A;  2Z4I A;  1CKO A;  3FP9 A;  2EYL A;  3SR1 A;  1GOZ A;  3BZK A;  5CGK A;  1VQ7 A;  2PCF B;  3K80 C;  1SE4 A;  4K2L A;  3UDF A;  1IYV A;  5C3W A;  3T1Y L;  3DUZ A;  2JA5 H;  1AE3 A;  1ILQ A;  3MEF A;  1FGB D;  5KYI A;  1F9Q A;  4ALP A;  4DR1 L;  1B3A A;  1IBK Q;  4RHS A;  1NUC A;  4KI0 A;  3T51 B;  2IHE A;  1XTD A;  2P5Z X;  5EAY A;  3OIQ A;  1JCK B;  3I56 A;  1PFN A;  2WV6 D;  3RZD B;  3L7Z C;  5A2Q E;  2I46 A;  3ERS X;  3UI2 A;  1YBY A;  2KJX A;  5LMN W;  2NN6 H;  3K7A B;  2NB0 A;  5FLM H;  2XWJ B;  5JEA H;  1VQN A;  2ZJP A;  1LTL A;  3W1B A;  1PFM A;  2VL6 A;  3A7L A;  2UU9 Q;  5IP9 H;  1G6Z A;  1TWG H;  3HOY B;  1R4P B;  5TSS A;  3HOY G;  4X3K A;  3ULJ A;  1SE2 A;  2BH2 A;  5LHY 1;  2AQ1 B;  2L5T A;  1WTP A;  1EU4 A;  4POF A;  3QWN A;  2Z4H A;  3O13 A;  2IJ0 A;  1I6H H;  3IRB A;  4P72 A;  3CPW A;  3PUV A;  2EZV A;  1EY0 A;  1UE7 A;  3NTI A;  1VQD A;  1KQS A;  4GOP C;  1ASY A;  1UUP A;  2NBF A;  1T5X D;  3K8A A;  2EYF A;  2UXC Q;  1SAP A;  1HZB A;  3DXJ C;  4P74 A;  1DOM A;  4OX9 L;  1AFP A;  4BY1 H;  4YIJ A;  5ELF A;  1Q1E A;  5C3E G;  3A0J A;  1D6E C;  1ZYR C;  2JE6 I;  4QQB X;  2N88 A;  1I6V C;  2A73 B;  5C3X A;  3A54 A;  4MNO A;  4L5S A;  1RHP A;  4IUP A;  2JYO A;  2EJG C;  5E4X A;  4A3L G;  3H6M A;  2DNE A;  2RCF A;  5EKL A;  4AQY Q;  1BCP F;  2CCZ A;  2O5I C;  1G2S A;  1IHZ A;  3EJI A;  4XT1 B;  5C0X G;  4DV6 Q;  1SRO A;  2EXD A;  1KL9 A;  4DFA A;  3CCR A;  2ZXO A;  1WOC A;  4IQZ A;  2JA9 A;  2NWG A;  1VQ6 A;  2E5L L;  3HS0 C;  2JP1 A;  1GO3 E;  5JOB A;  3S2D B;  2WIN B;  1FVI A;  2DY7 A;  3NXW A;  5I6Y A;  1TQO A;  3I55 A;  1PVO A;  3TBI B;  4R8I A;  1K83 B;  2RF4 A;  1NTG A;  1J6Q A;  5BN3 A;  2KA7 A;  3A8K E;  3QO2 A;  4DUY L;  3HOX B;  5EPJ A;  4F88 A;  4K2K A;  3K57 A;  1KAW A;  3D0F A;  4XT3 B;  3HOX G;  5D14 A;  5AJ3 L;  2EYO A;  4Z9C B;  2K7V A;  4RGN A;  1OXV A;  3CCJ A;  1PH8 A;  4DR4 L;  1CSQ A;  3ERO A;  1RCV D;  3TS2 A;  4TQU S;  1A2T A;  5K5P A;  2R92 B;  2ASB A;  1X3P A;  4K0K L;  2R92 G;  1SR3 A;  5M5Y H;  3MVV A;  4CDF C;  4DPG A;  3ULP A;  1YJN A;  1QZG A;  2K5V A;  3NEL A;  3E9I A;  2F0U A;  4NXN L;  1VQB A;  3G6E A;  4JOI A;  4OEM B;  1VQF A;  3AEV A;  4DR6 L;  1C9O A;  2ZM6 L;  4DR7 Q;  2RVL A;  4HJ9 A;  4C3I B;  2KCT A;  5C4X H;  2F0J A;  4OX9 Q;  2QW7 A;  1FNV A;  4C2M H;  2F3I A;  4C3I G;  4XDX A;  5M3M B;  4YCW A;  2F0N A;  2Z0S A;  3TRE A;  5M3M G;  3M7N A;  1SYG A;  3TEH B;  4BA2 I;  4JI7 Q;  3KDF B;  3MXN B;  1O7Y A;  2D9U A;  2F3V A;  4LFC L;  4ABN A;  2D0P A;  5HGT A;  5K36 H;  5HY6 A;  1I50 H;  4A3M B;  3KF6 B;  5CBE E;  4A3M G;  3TP7 A;  1SEB D;  1GUO A;  3IL8 A;  4R9W A;  2F4I A;  1NMG A;  2VB2 X;  1ASZ A;  2EJM A;  5IGE A;  1KHI A;  1DOK A;  1DM0 B;  4OIK A;  4HJ8 A;  1JOQ A;  3D4R A;  2V4D A;  5D3I B;  4PZ8 A;  2E5L Q;  1ESR A;  5C0X J;  2JXM B;  1STA A;  3CC4 A;  4IZ8 A;  2CWP A;  4MHE A;  4TRD A;  4IUQ A;  1B50 A;  1KLG D;  2AHO B;  4A3F H;  4CKB A;  1NR4 A;  4DU9 A;  1VQ5 A;  3S16 H;  5J1Z A;  3U4V A;  1BBX C;  1STE A;  2WII B;  1GD7 A;  3EA6 A;  3AU7 A;  1PFB A;  2BH8 A;  3NBH B;  1HPC A;  1K9M C;  1JWS D;  1B9N A;  4JI1 L;  5AJ3 Q;  4LF8 L;  2K52 A;  5IP7 G;  3M3Y B;  5GRO A;  2F0K A;  3UDX A;  3E3X A;  3K5N A;  5IGD A;  4ID6 A;  4LMQ D;  2VB3 X;  1Q12 A;  1EQV A;  2HIX A;  4JBJ A;  1EZ8 A;  4HJA A;  3JAM c;  3U4Z A;  1F9P A;  1PA6 A;  2MUY A;  3SGI A;  2XGT A;  4K0K Q;  1EYC A;  3K5L A;  1IBL L;  2KEE A;  4C3H B;  3SK5 A;  4LF9 Q;  4C3H G;  4G7O C;  1MSG A;  4B3T L;  1JIC A;  4IUN A;  1HUN A;  3VR4 A;  1Z47 A;  1VQI A;  2O2L D;  1OXU A;  1CFM A;  2PI2 A;  4DR6 Q;  4HSV A;  1LT5 D;  4KY5 A;  3NTH A;  4IPH A;  4HMJ A;  3PIO 3;  4B3M Q;  5EGT A;  1TWA B;  2Q2T A;  1Q90 A;  2A6E D;  3BDC A;  2Q2H A;  1PTO C;  4P73 A;  2NVT B;  2B29 A;  1PH9 A;  2B8G A;  3MAQ A;  2HUG A;  3I8Z A;  2D2C C;  1J5E L;  5GAE C;  4JV5 Q;  1MJC A;  3A74 A;  2E2H H;  1SNP A;  1CA6 A;  1F77 A;  1HNX L;  4I7A A;  2CQO A;  1I94 L;  1PRT C;  5LMU Q;  2AKW B;  4HN7 A;  1N32 Q;  2KBN A;  4KLK A;  4JI6 L;  2EYP A;  5IY0 A;  4ZKC B;  5FLX L;  3TZD A;  4DV3 Q;  4KKT A;  4Y7N B;  5IWA L;  1SDF A;  2HQL A;  4JBW A;  3C2P A;  3J81 L;  1KDC A;  4KD3 A;  2A6H D;  4CDD C;  3CME A;  4GKJ L;  3LX0 A;  3KBX A;  1PV4 A;  5FLM G;  4LJZ C;  1HA5 A;  4QMG A;  3GTQ H;  2NTT A;  1YNN D;  4DV4 Q;  4GLX A;  1STG A;  4JG2 A;  4KN7 C;  3STB D;  4DV7 Q;  1GXD C;  4ZLT F;  2JQO A;  4A3B B;  4LF8 Q;  4A3B G;  3RZD H;  3HOU H;  4MIU A;  5T1G A;  2AWN A;  2VZA A;  4K5X A;  4OEL B;  4PZ6 A;  2F0P A;  3OOC A;  4QF4 A;  2A68 C;  1S72 A;  3K7A H;  4HR7 B;  4P71 A;  2VW9 A;  3RZO H;  4N9T A;  3MXU A;  1A62 A;  1SSO A;  1DZ1 A;  2BA1 A;  2BA0 A;  3HOY H;  1CKN A;  2EDG A;  3W2D A;  4KJN A;  3PUW A;  1IYU A;  1Y8N B;  1Z9F A;  3I91 A;  1M1K C;  2A8V A;  2OCE A;  4DUZ Q;  4RGM A;  4DGZ A;  1MSH A;  3TSS A;  1OXS C;  2HD3 A;  2LMC B;  4XIG S;  3PGZ A;  2IHF A;  3HKZ B;  4GOP B;  3HKZ G;  1V9P A;  1R9T B;  2A1A A;  3Q6S A;  1UEB A;  2L0C A;  1E2V A;  1HHV A;  5IYC G;  2R93 B;  3I4O A;  3F2C A;  5C3E H;  2R93 G;  5M5X B;  5J3B A;  1S4Z A;  4A75 A;  1FGU A;  1HNX Q;  1WTO A;  1TS4 A;  1I94 Q;  3T53 B;  5KRU A;  3OWF A;  1VS0 A;  1QWY A;  1VQH A;  4ZK9 B;  3NWS A;  4UAI A;  4A3L H;  3GTM B;  3CXC A;  3VR5 A;  4GKK Q;  4PV1 C;  1YIJ A;  4KV6 A;  4POG A;  5IWA Q;  4IFD I;  3RN5 A;  1LTA D;  3E0J A;  4B9X A;  2F1M A;  5C0X H;  4DAV A;  4X66 Q;  4O1N A;  2WP8 J;  2VQF L;  1S3O A;  3CCE A;  2Y0S E;  1F2Z A;  1NCV A;  2DNC A;  1RJT A;  4NP5 A;  4M1U B;  3RLF A;  2SOB A;  1VQ8 A;  1V43 A;  4GKJ Q;  4NDX A;  2JJQ A;  3RUZ A;  1QUQ A;  1WTQ A;  2H5X A;  3DWA A;  5J22 A;  1N33 Q;  3S2D H;  2B2U A;  2F03 A;  1ESF A;  3EIV A;  1MI2 A;  1B1Z A;  3I4N B;  1B9M A;  1VDZ A;  5JJL A;  2PZT A;  3I4N G;  4XYO A;  2JSO A;  1XMO L;  1VMC A;  1K83 H;  3HGB A;  4JK1 C;  1H9J A;  2YTX A;  2L9H A;  3I72 A;  2ES2 A;  2EQS A;  2RDH A;  2I5L X;  5KEE A;  3HOX H;  3M4Q A;  1B70 B;  3P7J A;  3CAM A;  4HED A;  1STH A;  5HUR A;  1XJV A;  1Q81 C;  1F9R A;  2EY5 A;  2D62 A;  3PO3 H;  5JJK A;  5M9O A;  3ER0 A;  1CK1 A;  5EJW A;  2OTL A;  2N55 A;  1EIF A;  2HHH Q;  1QVG A;  3K59 A;  2R92 H;  2WB1 B;  1WTX A;  4H0L C;  1HTP A;  2WB1 G;  4DK3 C;  4KY6 A;  5EQ0 A;  4E6I A;  1EL0 A;  1H9K A;  1E22 A;  1I50 B;  1VQE A;  2K33 A;  2KUM A;  1TWH H;  3D6W A;  5EPL A;  2K04 A;  1K3B C;  4NXM Q;  1HRJ A;  1V1Q A;  1EYA A;  4C3I H;  1O80 A;  5M3M H;  2XSC A;  3H91 A; 
#chains in the Genus database with same CATH homology
 5ELB A;  1STB A;  4HSP A;  3M85 A;  2RSO A;  1LO5 D;  2XIW A;  1XYI A;  2B2Y A;  1AW7 A;  1SMY D;  3ITP A;  1WTV A;  2PMZ B;  3Q24 A;  2L4N A;  5DM6 3;  4IFD J;  1A15 A;  1STN A;  3A8I E;  5JPM C;  2ENB A;  1TWC B;  1U9R A;  1EY7 A;  2SEB D;  4B9W A;  4UDU C;  4RCO A;  5FO7 B;  3SDZ A;  2QCP X;  1QIL A;  1DCZ A;  4MN3 A;  1B53 A;  1JR0 D;  1OO9 B;  5KGU A;  4QCL A;  2K5Q A;  3BG3 A;  3LWU A;  1B2T A;  3JAM E;  2F0D A;  3K6O A;  1H9S A;  5KYL A;  3TP5 A;  2OXP A;  1G8Z D;  4KJO A;  1SNC A;  3NHH A;  2HQE A;  3OMC A;  1I3Q B;  5FO8 B;  3VYS A;  1J8I A;  4U67 3;  1WVL A;  4XXE A;  4A3I B;  2F0T A;  5BN4 A;  3IKJ A;  4OL7 A;  2PPB C;  2KQ3 A;  4FF1 A;  4XQJ A;  3CRL C;  1PTO B;  2TMP A;  1TS3 A;  4G57 A;  4BBR B;  4C56 C;  4H44 C;  3E5S A;  5JVG 3;  3GTQ B;  1PRT B;  1MGS A;  4U68 A;  4LAA A;  4N9P A;  2VXW A;  3GTO B;  3HOU B;  2BE5 C;  1NAP A;  2B8F A;  1SYF A;  4K5W A;  1T5E A;  3NWT A;  3EVQ A;  5EPK A;  3H0G B;  1LTB D;  4A3J B;  1PZK D;  3RZO B;  2ICI A;  3VR2 A;  1ENF A;  1EWH A;  3NK9 A;  1W6K A;  3R8B A;  1EY9 A;  3S1Q B;  5JAV A;  4K14 A;  4F87 A;  4R8N A;  1I4P A;  2CW0 D;  2K5W A;  5IOD A;  2KCN A;  1F2M A;  3SEB A;  3HRZ C;  2Q8R E;  2FMM A;  1V1P B;  3P75 A;  4DF7 A;  4L8J A;  4X3S A;  3NBI A;  4X3U A;  4KHV A;  3T4A C;  2VUM B;  2IT1 A;  1EU3 A;  1SNQ A;  5T1I A;  4RHR A;  4XTC S;  5C3E B;  4RFB A;  4EQO A;  1EEF D;  2Z8L A;  4FVM A;  4BS9 A;  1SXT A;  1Z7T A;  1BNZ A;  4OGQ C;  5KNB A;  1LTR D;  2PZW A;  1S5F D;  5CBA E;  2Q8I B;  3I4M B;  2M2L A;  3H94 A;  1K8M A;  3BYT B;  1ZEQ X;  3VA5 A;  2PO4 A;  3VA7 A;  4TKO B;  4OIJ A;  1D1K A;  2E76 C;  2QKI C;  2MP1 A;  3TP8 A;  1AP0 A;  2PYK A;  1S5E D;  3FPU B;  3NUC A;  1Y8P B;  1M4V A;  1Y1W B;  5ELC A;  2ZXR A;  4RWS C;  2R6G A;  1U4P A;  2L12 A;  4NW2 A;  2JEB I;  1QOH A;  1ET9 A;  1EY6 A;  1CM9 A;  3HP3 A;  1FNW A;  4EVO A;  2ID0 A;  3PO3 B;  3OWE B;  5J39 A;  3S15 B;  3S14 B;  4EQP A;  2R7Z B;  2A6H C;  1SFO B;  3MWY W;  1R4Q B;  3G7L A;  1MD2 D;  2B2V A;  2LFN A;  2F0O A;  4KD4 A;  1TWH B;  1KDB A;  4WRD A;  1BOS A;  4CKC A;  3CQZ B;  5ELD A;  2B2T A;  5C4H A;  1Q1B A;  1D5X C;  3K5O A;  1IW7 C;  1UNS A;  1BO0 A;  1Y69 U;  3C1F A;  2RSN A;  3P20 A;  1QNU A;  3L9A X;  1LTT D;  3J80 L;  2XVS A;  2XNA C;  2NUC A;  3TDQ A;  4PQX A;  2M9V A;  4CJ1 B;  4J6H A;  4P2C B;  4ZUJ A;  2K1B A;  1GJX A;  1LT6 D;  3M4Y A;  2AWO A;  4IUT A;  1GUW A;  1H9S B;  4IAL A;  1JOR A;  2G9H D;  1M8A A;  1B44 D;  4AYB B;  3R93 A;  2Q8T A;  4DN4 M;  2WKD A;  1JB3 A;  1BCP D;  1EOT A;  1PMR A;  4OO1 G;  2F0H A;  5IGC A;  4OO1 I;  2CQA A;  5M3F B;  1JQY D;  2SDF A;  4EGV A;  3IFT A;  3D6C A;  2B2W A;  3I70 A;  3A7A B;  1OXT A;  1LTS D;  1E2W A;  2I07 B;  3S17 B;  1HCZ A;  5C5L A;  1O7Z A;  1EY4 A;  1QNK A;  5ISR A;  2EY1 A;  3VR3 A;  3Q23 A;  3S1N B;  3ONA B;  1ENA A;  1VMP A;  1YNJ C;  4ODG A;  5G3L F;  2O5J C;  3PIP 3;  3MXG A;  2EYM A;  2K05 A;  4FF2 A;  4NMZ A;  3PMF A;  4PMB A;  1I4G A;  1OXX K;  1SYC A;  4RKL A;  3K58 A;  2E2I B;  4CHT B;  5FLX E;  3VR6 A;  2IX3 A;  3G6J B;  3FRP B;  1TY0 A;  4DNR B;  1G29 1;  2QEJ C;  3KF8 A;  2DY8 A;  2JA7 B;  4RKB A;  2NYZ D;  2X6L A;  4KKS A;  4B08 A;  2J7Z A;  1SYB A;  4HCE A;  1PTO H;  1STY A;  1IKL A;  3KLS X;  1D5M C;  1SE3 A;  2EYJ A;  4DXF A;  2A74 C;  2KED A;  2L55 A;  2BOS A;  1GUG A;  2K32 A;  3MEH A;  2GA4 B;  3PUX A;  2EJF C;  1I4R A;  5C44 B;  3KK7 A;  1EQT A;  2C9O A;  1TWF B;  1QCB D;  1SYD A;  2F0M A;  4DAP A;  2YU9 B;  1JOK A;  3M4O B;  1PTO F;  1SMY C;  2ICE C;  2OF1 A;  1JWM D;  3MTS A;  1BDO A;  2NN6 I;  1PYW D;  1CZG A;  1PDQ A;  1LTG D;  1ILP A;  2MJ8 A;  2SNM A;  3QOL A;  1TR5 A;  3EFX D;  4V0B A;  1LT3 D;  1TKW B;  4Q5V A;  1PRT F;  3HOZ B;  2KCC A;  4BY7 B;  3LWE A;  2B2U C;  3SXH A;  5EKI A;  3D3R A;  5CR3 A;  1KLU D;  5AFW A;  1EZ6 A;  4CKE A;  2BDN A;  3AMU A;  2BDO A;  3BZD B;  3DWQ A;  1VF7 A;  3GTL B;  1JOO A;  3SK6 A;  2XWB B;  3WDN A;  2KVM A;  4IFD G;  1C4Q A;  2K03 A;  2DN8 A;  3FEW X;  4KKU A;  3SK4 A;  2NVQ B;  2EOT A;  3NP8 A;  1F2L A;  4BA1 I;  3AB9 A;  5DNF A;  3MC0 B;  4J1M A;  4ZKB B;  1F2Y A;  5JJZ A;  5IGG A;  4RGT A;  1FD7 D;  3NQT A;  1QE6 A;  3J7A V;  4WOR A;  2C5C A;  3FPP A;  3HOW B;  1ICW A;  2K28 A;  3QIA A;  2B2Y C;  1I4X A;  1CHQ D;  3VYU A;  1KDA A;  5IT9 E;  3TME A;  3BVZ A;  1UAP A;  1DJR D;  2M00 A;  1HUM A;  1H9R A;  4KHZ A;  4FYD A;  2CVR A;  1HQM C;  1WTR A;  1A3V A;  3X3M A;  1HTL D;  1A6X A;  3A56 A;  5M5W B;  4RAU C;  5C5M A;  1RKN A;  5FKA C;  1SJE D;  4DA2 A;  4DK0 A;  5I9P A;  3NTK A;  3C46 A;  3GD7 A;  2EYH A;  3GTP B;  2WAQ B;  1QJO A;  1GUS A;  4KN4 C;  3I4L A;  2F0V A;  5FO9 B;  2B39 A;  2PZU A;  1AN8 A;  3DWP A;  4CGY B;  2OT2 A;  1Y1V B;  2WKC A;  1U4M A;  3C1E A;  3QOJ A;  3S1R B;  1RF2 D;  3OSO A;  3H3V C;  3CHB D;  5C4Z A;  2YYZ A;  4K6D A;  3J7A F;  4A93 B;  2JA6 B;  1HFN A;  1IKM A;  1WD1 A;  4OO1 H;  2E74 C;  1O78 A;  2EE1 A;  1II3 A;  1E2Z A;  3N52 A;  4A3D B;  2RDF A;  3DM1 A;  3BVG A;  2RDG A;  4G4K A;  4C1N I;  1X3Q A;  4A3E B;  3W3A A;  2XN9 C;  4QB4 A;  2HCC A;  1AZQ A;  3R3O A;  2WAC A;  4ILW A;  1HFG A;  1SBB B;  4X3T A;  1L0Y B;  2AQ3 B;  3NQI A;  1WCM B;  2NVX B;  4XQN A;  4BBS B;  2NZ1 D;  3ERQ A;  2H1E A;  4KMU C;  2EPB A;  3TP6 A;  2D5D A;  4PMW A;  1I4Q A;  3HG9 A;  2R61 A;  5NUC A;  4IUV A;  3JAM L;  1I4H A;  3BYY B;  3D4D A;  2FHT A;  3GTJ B;  4CJ0 B;  4RH6 A;  3V05 A;  1G91 A;  2F0G A;  4FXG C;  5E4W C;  4PMC A;  1U4R A;  3BS1 A;  3LNN A;  4K6L A;  4FXD A;  1PZJ D;  3OIP A;  3V96 A;  4I65 A;  2E75 C;  3R2T A;  4A3K B;  1MBY A;  1CI3 M;  5A35 A;  3H09 A;  1FNU A;  2FJ2 A;  4HTH A;  2F0E A;  3FDT A;  3T56 B;  5CC4 A;  1NR2 A;  2LKV A;  1A3U A;  2A5H A;  4DAY A;  1S5D D;  4ZRZ A;  5I6W A;  3GP7 A;  1TII D;  4FO2 A;  1KTK A;  3GTG B;  5COY A;  1BCP C;  2RA4 A;  2E2D C;  1SJH D;  2F0Q A;  1EY5 A;  5CYU A;  2H4O A;  1C8C A;  3KUP A;  4QUF A;  3GV6 A;  4CJ2 C;  5A2Q L;  1H9M A;  3D31 A;  1EIG A;  1J9O A;  2F0F A;  3ND9 A;  1KNE A;  1QG7 A;  5BN5 A;  1PZI D;  4G7Z C;  2LS0 1;  4FXK C;  3KLS A;  2TSS A;  3PO2 B;  1B4O A;  5F2D A;  1ML0 D;  1Q3L A;  1BF4 A;  3TZU A;  3A8J E;  2B2V C;  2MGS A;  4ME5 A;  3RMH A;  1SNM A;  3U9O A;  2A6E C;  3PV0 A;  2IPK D;  2XRQ D;  2IX1 A;  5CV5 A;  3SHL A;  1A2U A;  4IFD H;  5DAU A;  5CV4 A;  2B2T C;  1CQV A;  4C3J B;  5C0X I;  1C48 A;  2F3W A;  4C3J G;  5EBC A;  2EXZ A;  3EQL C;  3HOV B;  3WOF A;  1S5B D;  3S2H B;  4HMI A;  3K0Y A;  4PNY A;  1CTM A;  5LL6 X;  5D3D A;  2A69 D;  3SK8 A;  5I2Y A;  2CHB D;  1LT4 D;  1G2T A;  5C4J B;  4FF4 A;  3X3N A;  1RTN A;  2MHV A;  5DEH A;  1YNN C;  3I73 A;  5CV9 A;  2NVY B;  2K01 A;  5IGF A;  4RCN A;  3DEO A;  4EQN A;  4ZAI A;  1AEX A;  3J80 E;  2PW7 A;  3GTK B;  3TN2 A;  4KTA A;  2B2W C;  1TVX A;  4WFN 3;  4FP5 D;  3DEP A;  2JA8 B;  4O42 A;  2KEC A;  4A3G B;  3MFY A;  1PXU A;  1V8Q A;  2G9D A;  1KAA A;  2O4X A;  3CRK C;  3S1M B;  2E2J B;  3QJY A;  1BR9 A;  3MFG A;  5IGB A;  2R3Z A;  1GHJ A;  1IL8 A;  2PW5 A;  4IN3 A;  3E6Z X;  3ND8 A;  2IWH A;  2BE5 D;  3K5M A;  1BUV T;  1CT1 D;  4J8Q A;  1JC7 A;  3BVM A;  1X32 A;  4DXG A;  2F0W A;  3M7G A;  1Z6H A;  1JE4 A;  3OPO A;  2QDB A;  1LAC A;  2NTS A;  2EY6 A;  4XYQ A;  4H13 C;  1XWE A;  3I3C A;  5FK9 C;  5IOC A;  2OEO A;  1TS5 A;  3A55 A;  4K8J A;  5D65 A;  1DXM A;  4M8A A;  4RGO S;  3KLR A;  5CV6 A;  1EIH A;  3KBG A;  2L1B A;  4ZQ3 A;  3T13 A;  2AQ2 B;  4WJW A;  2XRS D;  1GUN A;  5E3F A;  4I7Z C;  1GHK A;  4ZUI A;  3QG1 A;  1ZYR D;  5EBD A;  1L0X B;  1ZKO A;  5COR A;  4G7H C;  2B63 B;  3BDL A;  1JWU D;  1TS2 A;  4S3S A;  3FMC A;  4ZYS A;  3C3L A;  1TY2 A;  5EKK A;  3J81 E;  3R2I A;  1RTO A;  1DOL A;  1CHP D;  2F0S A;  4DK1 A;  3DMU A;  2JA5 B;  2HDM A;  2AUJ D;  4HAE A;  1AZP A;  1ET6 A;  5I2X A;  1EFI D;  3NSW A;  1K8O A;  1S5C D;  1D2B A;  2KOL A;  3U9S A;  1EEI D;  5C6A A;  3DHQ A;  3Q22 A;  2RBM A;  1HQR D;  3HEJ A;  4LK1 C;  1D1I A;  2NN6 G;  2FMC A;  1FR3 A;  1XXG A;  5JEA G;  2FFK B;  2ZT9 C;  4K5V A;  2Y0S B;  5CMD A;  1EWC A;  5KND A;  1LAB A;  3SE0 A;  2IX0 A;  1TWG B;  2X6G A;  4FF3 A;  1U4L A;  4CBV A;  3N6R A;  4ULL A;  3D8G A;  1DD2 A;  1SNO A;  1Y8O B;  3V2T A;  1I6H B;  1E0B A;  4KY7 A;  5JPN C;  1BCP B;  5FOB B;  1IW7 D;  2EY2 A;  2QIL A;  4BY1 B;  1W6J A;  1DON A;  1TT2 A;  1F9S A;  1VF5 C;  5G3L D;  2L11 A;  1A3T A;  3MZ5 A;  1HA6 A;  4NKL A;  2F0I A;  4DNT B;  2RKS A;  2ZXP A;  1SND A;  4F8M A;  1V1P A;  1DYQ A;  3OW7 A;  3GQB A;  1LLR D;  5KNC A;  2QF7 A;  3VYR A;  3NPP A;  1XX8 A;  3HZX A;  4H7B A;  3URY A;  1WD0 A;  1VCI A;  4FNF A;  1LTI D;  1GUT A;  4L63 B;  4QUC A;  3D4W A;  1SYE A;  3MA2 B;  1YNJ D;  5ELE A;  2BCO A;  4OHJ A;  5JEA J;  1HXY D;  3CU7 A;  2SNS A;  4K8I A;  5M5Y B;  2K6A A;  5JVH 3;  2AUK A;  3MHB A;  1PTO D;  1UEA B;  2LY7 A;  3OMG A;  1ROD A;  4IUU A;  3T16 A;  3RD4 A;  3QB3 A;  2PQE A;  2CW0 C;  2F0L A;  2K5D A;  5C4X B;  4C2M B;  3MXP A;  3GO5 A;  2VNU D;  3L3O C;  3FVQ A;  2Z1C A;  3F2U A;  1PRT D;  2FIN B;  1KAB A;  4GZY C;  3CKI B;  5IIF A;  3I90 A;  4Q0F A;  1XTC D;  3WOE A;  3SVM A;  5K36 G;  5IT9 L;  5I4D A;  3NE5 B;  1CZW A;  2J0T D;  1O7L A;  3J7Y W;  1CQF A;  1ZXT A;  4QIW B;  1ONL A;  5LL6 S;  2IW3 A;  1TU2 B;  3IAY A;  4RA8 A;  1WTW A;  2J4X A;  5I9O A;  4C1N K;  2IL8 A;  1ENC A;  4A3F B;  1FYC A;  2HDL A;  3S16 B;  5KIX A;  2JEA I;  4V19 0;  3PUZ A;  2A68 D;  3MXN A;  1D5Z C;  4BWG B;  1BXT A;  2PNR C;  1RD9 D;  4IUR A;  3VYT A;  5DM7 3;  2HCI A;  4L6T B;  3PUY A;  3ZYY X;  1V1O A;  2X69 A;  1EYD A;  1BQQ T;  1RDP D;  4HCS A;  5CV7 A;  3OHX C;  1EY8 A;  3S9W A;  1QB5 D;  4KK7 A;  2A69 C;  2KHS A;  1PLF A;  3P1H A;  2MPM A;  3Q0A A;  4TSS A;  1Q8I A;  1NSN S;  5CV8 A;  1KNA A;  3NBH A;  3FKI B;  3IFD A;  4XQQ A;  1LV9 A;  2RQX A;  3BDO A;  2E2H B;  3GV3 A;  2EVB A;  1CA5 A;  5E1F A;  4F7X A;  2Z4I A;  5CGK A;  2EYL A;  1GOZ A;  3SR1 A;  2PCF B;  1SE4 A;  4K2L A;  1IYV A;  5C3W A;  3DUZ A;  1ILQ A;  1FGB D;  5KYI A;  1F9Q A;  1B3A A;  4RHS A;  1NUC A;  4KI0 A;  3T51 B;  3OIQ A;  1JCK B;  1PFN A;  2WV6 D;  3RZD B;  3L7Z C;  5A2Q E;  2I46 A;  3UI2 A;  2KJX A;  2NN6 H;  3K7A B;  2NB0 A;  2XWJ B;  5JEA H;  1PFM A;  3A7L A;  1G6Z A;  3HOY B;  1R4P B;  5TSS A;  4X3K A;  1SE2 A;  5LHY 1;  2AQ1 B;  2L5T A;  1WTP A;  1EU4 A;  3QWN A;  2Z4H A;  3O13 A;  2IJ0 A;  3PUV A;  2EZV A;  1EY0 A;  3NTI A;  1UUP A;  2NBF A;  1T5X D;  2EYF A;  1SAP A;  3DXJ C;  1DOM A;  1AFP A;  4YIJ A;  5ELF A;  1Q1E A;  1D6E C;  1ZYR C;  2JE6 I;  2N88 A;  1I6V C;  2A73 B;  5C3X A;  3A54 A;  1RHP A;  4IUP A;  2JYO A;  2EJG C;  5E4X A;  3H6M A;  2DNE A;  5EKL A;  1BCP F;  2O5I C;  1G2S A;  1IHZ A;  3EJI A;  4XT1 B;  5C0X G;  4DFA A;  2ZXO A;  4IQZ A;  2NWG A;  3HS0 C;  2JP1 A;  5JOB A;  3S2D B;  2WIN B;  2DY7 A;  3NXW A;  5I6Y A;  1TQO A;  3TBI B;  4R8I A;  1K83 B;  5BN3 A;  2KA7 A;  3A8K E;  3QO2 A;  3HOX B;  5EPJ A;  4F88 A;  4K2K A;  3K57 A;  4XT3 B;  5D14 A;  2EYO A;  4Z9C B;  2K7V A;  4RGN A;  1OXV A;  3ERO A;  1RCV D;  4TQU S;  5K5P A;  1A2T A;  2R92 B;  1X3P A;  3MVV A;  2F0U A;  2RVL A;  4C3I B;  2F0J A;  1FNV A;  4C3I G;  4XDX A;  5M3M B;  2F0N A;  3M7N A;  1SYG A;  4BA2 I;  1O7Y A;  2D9U A;  2F3V A;  5HGT A;  4ABN A;  5K36 H;  4A3M B;  5CBE E;  3TP7 A;  1SEB D;  1GUO A;  3IL8 A;  4R9W A;  2F4I A;  2VB2 X;  2EJM A;  5IGE A;  1DOK A;  1DM0 B;  4OIK A;  1JOQ A;  3D4R A;  2V4D A;  5D3I B;  1ESR A;  5C0X J;  2JXM B;  1STA A;  4IZ8 A;  4MHE A;  4TRD A;  4IUQ A;  1B50 A;  1KLG D;  4CKB A;  1NR4 A;  4DU9 A;  5J1Z A;  1BBX C;  1STE A;  2WII B;  3EA6 A;  3AU7 A;  1PFB A;  1HPC A;  1JWS D;  1B9N A;  3M3Y B;  2F0K A;  3K5N A;  5IGD A;  4ID6 A;  4LMQ D;  2VB3 X;  1Q12 A;  1EQV A;  1EZ8 A;  1F9P A;  2MUY A;  1EYC A;  3K5L A;  2KEE A;  4C3H B;  3SK5 A;  4C3H G;  4G7O C;  1MSG A;  1HUN A;  1JIC A;  4IUN A;  3VR4 A;  1Z47 A;  2O2L D;  1OXU A;  1CFM A;  4HSV A;  1LT5 D;  4KY5 A;  3NTH A;  4HMJ A;  3PIO 3;  5EGT A;  1TWA B;  1Q90 A;  2A6E D;  3BDC A;  2NVT B;  1PTO C;  2B8G A;  3MAQ A;  2HUG A;  3I8Z A;  2D2C C;  1SNP A;  1CA6 A;  1F77 A;  1PRT C;  4HN7 A;  2EYP A;  5FLX L;  4ZKC B;  3TZD A;  4KKT A;  4Y7N B;  1SDF A;  4JBW A;  3C2P A;  3J81 L;  1KDC A;  4KD3 A;  2A6H D;  3LX0 A;  3KBX A;  4LJZ C;  1HA5 A;  4QMG A;  2NTT A;  1YNN D;  1STG A;  4KN7 C;  1GXD C;  4ZLT F;  4A3B B;  4MIU A;  5T1G A;  2AWN A;  4K5X A;  2F0P A;  3OOC A;  4QF4 A;  2A68 C;  4HR7 B;  4N9T A;  3MXU A;  1SSO A;  1DZ1 A;  2BA1 A;  2BA0 A;  2EDG A;  3W2D A;  4KJN A;  3PUW A;  1IYU A;  1Y8N B;  3I91 A;  4RGM A;  4DGZ A;  1MSH A;  3TSS A;  1OXS C;  2LMC B;  4XIG S;  3HKZ B;  1R9T B;  3Q6S A;  2L0C A;  1E2V A;  1HHV A;  2R93 B;  5M5X B;  1S4Z A;  1WTO A;  1TS4 A;  3T53 B;  5KRU A;  3OWF A;  1QWY A;  4ZK9 B;  3NWS A;  4UAI A;  3GTM B;  3VR5 A;  4PV1 C;  4KV6 A;  4IFD I;  1LTA D;  3E0J A;  4B9X A;  2F1M A;  5C0X H;  4DAV A;  4O1N A;  2WP8 J;  1F2Z A;  1NCV A;  2DNC A;  3RLF A;  1RJT A;  4M1U B;  4NP5 A;  2SOB A;  1V43 A;  4NDX A;  3RUZ A;  1WTQ A;  3DWA A;  5J22 A;  2B2U A;  2F03 A;  1ESF A;  1MI2 A;  1B1Z A;  3I4N B;  1B9M A;  1VDZ A;  2PZT A;  4XYO A;  2JSO A;  1VMC A;  3HGB A;  4JK1 C;  1H9J A;  2L9H A;  3I72 A;  2RDH A;  5KEE A;  3P7J A;  4HED A;  1STH A;  5HUR A;  1F9R A;  2EY5 A;  2D62 A;  5M9O A;  1CK1 A;  5EJW A;  2N55 A;  3K59 A;  2WB1 B;  1WTX A;  4H0L C;  1HTP A;  4KY6 A;  5EQ0 A;  4E6I A;  1EL0 A;  1H9K A;  1I50 B;  2K33 A;  2KUM A;  3D6W A;  5EPL A;  2K04 A;  1HRJ A;  1EYA A;  1O80 A;  2XSC A;  3H91 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...