2JP1A

Solution structure of the alternative conformation of xcl1/lymphotactin
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
60
structure length
60
Chain Sequence
VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords Lymphotactin
publication title Interconversion between two unrelated protein folds in the lymphotactin native state
pubmed doi rcsb
source organism Homo sapiens
total genus 5
structure length 60
sequence length 60
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2jp1A00
2K1BA 4XDXA 2FFKB 1MSHA 4R9WA 2FMMA 1J9OA 1X32A 2MJ8A 1ILPA 1ML0D 1IL8A 1F2LA 2L11A 3GV3A 5D65A 1CA6A 2RA4A 4DN4M 3FDTA 1IKMA 2J7ZA 2K28A 4IUPA 4RWSC 1Q3LA 2VXWA 1B3AA 1G6ZA 1HRJA 4XT1B 1F9SA 3D6WA 3LWEA 4HCSA 1HHVA 5EPLA 1M8AA 2DY7A 2Q8TA 1WTRA 1XYIA 1BF4A 4LMQD 4QUFA 2IL8A 2HDMA 4HAEA 1EIHA 1WTOA 2MP1A 2HCCA 2K01A 1JE4A 2Q8RE 3DEPA 5JJZA 1B53A 1IKLA 1DOLA 1JICA 1RODA 2L1BA 2B2YC 4RA8A 4CJ2C 2SDFA 1CM9A 1U4MA 3MWYW 2BDNA 4ZLTF 1PFBA 4QUCA 3TN2A 1WTWA 2KUMA 2NWGA 3KBXA 3KUPA 3P7JA 1WD1A 1F9QA 2X69A 3FPUB 1PLFA 1DOKA 3F2UA 1WVLA 1RJTA 1RTOA 5EPJA 1HFNA 1PDQA 2NYZD 4ZKBB 1CA5A 3G7LA 1DZ1A 2B2YA 3IFDA 2X6LA 1O80A 1SAPA 4X3TA 5CBEE 2RVLA 3MTSA 4CJ0B 3SVMA 1U4LA 1VMCA 1E0BA 3I91A 5EPKA 1A15A 4IUVA 1AP0A 1MGSA 2CVRA 1BO0A 4NW2A 1ZXTA 4ZK9B 3I8ZA 3I3CA 1XX8A 1RTNA 4ZAIA 4X3SA 1SSOA 1G2TA 2KOLA 2N88A 1O7YA 1BNZA 1TVXA 2JYOA 2EPBA 3QO2A 4HEDA 4ZKCB 1KNAA 2K05A 2HCIA 1BBXC 1HFGA 1MI2A 3DM1A 2MGSA 1MSGA 4UAIA 2B2VA 3DEOA 4X3UA 5COYA 4XT3B 5DNFA 1J8IA 1ILQA 1KNEA 1PFMA 1QG7A 1LV9A 2H1EA 2JP1A 2K03A 4MHEA 4OIKA 2N55A 2NZ1D 4R8IA 2B2WC 2R3ZA 5EKIA 2HUGA 4RAUC 2FJ2A 3IL8A 1WTVA 4U68A 1WTXA 1EL0A 3HP3A 4O42A 2B2UA 1S4ZA 2KEEA 5E4XA 1NR4A 4IUQA 2B2VC 2L4NA 1RHPA 2M2LA 2FHTA 2FINB 5AFWA 1WTQA 4IURA 1F9PA 1QE6A 1ESRA 1G2SA 4MN3A 5EQ0A 2KECA 2B2WA 1C8CA 1U4RA 3UI2A 2L12A 3R93A 3ONAB 3H91A 5T1IA 1EQTA 1B50A 1NAPA 1HA6A 2K04A 3GV6A 2RSOA 1ICWA 2RSNA 1DONA 5CBAE 1G91A 2MPMA 2XIWA 4X3KA 3I90A 1NCVA 1EIGA 2B2UC 1GUWA 2X6GA 1O7ZA 3TZDA 2HDLA 1X3PA 1X3QA 1HUNA 2DY8A 2KVMA 1PFNA 1U4PA 5T1GA 4IUTA 1VMPA 1AZQA 2B2TC 2KEDA 1B2TA 3N52A 1WTPA 1EOTA 1B4OA 4OIJA 4IUUA 1WD0A 5E4WC 4CJ1B 5D14A 1NR2A 4HSVA 2D9UA 5EJWA 1QNKA 1DOMA 1F9RA 5CMDA 3Q6SA 5CORA 1SDFA 1HUMA 2L9HA 1AZPA 2EOTA 2B2TA 2EE1A
chains in the Genus database with same CATH superfamily
4XDXA 3EFXD 4R9WA 3KF6A 2EY6A 3EBEA 3S1MB 4PZ6A 5ELCA 3NSWA 4KD4A 2DN8A 4HSPA 4UHVA 2AKWB 1WTRA 1D5MC 1YNJC 2MP1A 2KCTA 2O4XA 3PV0A 4X64L 2Z4IA 5FO9B 4CJ2C 4EQOA 4NXNQ 4QIWB 3W5OA 1JR0D 2E5LQ 1S3OA 1K8OA 2X69A 1II3A 3FP9A 4DFAA 1M4VA 3KLSX 3S1MH 3PMFA 3MTSA 3TQYA 1U4LA 1DM0B 2ZT9C 3EA6A 3I91A 4P2CB 3G71A 1A15A 4DV7Q 1X9NA 2RCFA 1BO0A 3GQBA 1ZXTA 1STNA 3M85A 2N49A 3M4QA 4X3SA 2EY5A 1G2TA 1U5KA 2WKCA 4HJ8A 4YCVA 1NNXA 4NXNL 2SEBD 1IBMQ 1EY9A 2E5LL 2R7FA 3BU2A 4UAIA 5C4ZA 2K5QA 2K5NA 3L2PA 2NZHA 3QWNA 1DCZA 3JAMc 2KJXA 3J81E 2UUAL 3IRBA 4HJ5A 2NZ1D 3GTKH 3K5LA 1O7IA 3CW2C 5G3LD 3HP3A 4JI2Q 4A3KG 2B2UA 2VL6A 2E2JH 1EIYB 1QE6A 4A3LH 2NTTA 1HXYD 3UI2A 1P8LA 1I94Q 3ONAB 1N9WA 2MQHA 4XYQA 2F0PA 5CBAE 1IBML 1RIPA 1FD7D 2YTYA 1PVOA 1NY4A 1EU3A 2RF4A 4GN3B 1PTOC 2BOSA 1ZKOA 1MJEA 3UDFA 4JI6Q 2Z6BA 2UUCL 3I55A 3SR1A 1EWCA 3S17B 1KLUD 1WJJA 5KYLA 2I0QA 5IYCH 4G4KA 4IFDI 2LY7A 1N34Q 1JWSD 1WD0A 4JI2L 4A3BB 1W6JA 5BR8Q 2O2LD 3CCUA 4O1NA 5CORA 5JPNC 1AZPA 1HUMA 1SFOH 1I94L 1D6EC 5GAGC 3E9HA 5FLXc 1GOZA 4RFBA 1NBWA 2IHEA 4XQNA 3K7UC 2RA4A 4DN4M 1Y8NB 1X3EA 3O13A 4QMGA 4R4CA 4JI8Q 2PW5A 4JI6L 1E1OA 3S17H 2Q8TA 1EY6A 2MO1A 1J5EL 1W2BA 2RQXA 4QUFA 2GN5A 4ULLA 5IWAQ 1TT2A 4V190 3KDFB 4A3BH 1A0IA 1Y69U 1N34L 1PHJA 3A8JE 4RA8A 5M5XH 3I4NG 4GN4B 1HNZQ 2NB0A 3BDLA 1K9MC 4H0LC 1D8LA 1X54A 2CCZA 1Y14B 4JBMA 4POGA 2IJ0A 4GKJQ 5C4JB 2NN6H 2AWOA 5IYDG 4MNOA 3M4PA 3KLWA 3SK6A 1PTOF 3HFZB 2B2YA 4DNRB 1TS2A 4DV5Q 3J7AV 4WJ3M 1FNVA 4JI8L 4I7AA 2UUBQ 4IUVA 2AHOB 3W3AA 1PH3A 3I8ZA 4JOIC 5M3MB 1TS3A 1RTNA 3LGJA 3EQLC 1TVXA 2XNAC 1HNZL 1ENFA 4A3IB 4GKJL 3WOFA 3J7YW 2IPKD 1Q46A 2F0VA 1B9NA 1EZ6A 3FMCA 1ENAA 5LMNQ 4G7HC 1PH7A 3QIAA 2QGQA 2WFWA 4KKSA 4A3JB 4KN4C 1BBUA 1SR3A 1QG7A 3NWTA 5ISRA 3OW7A 4DV5L 1EY5A 4ALPA 3I4MG 4DUZQ 2D0OA 2EYFA 1W3SA 1I4PA 3K5MA 5C3EB 3HOVG 5C0XJ 1B9MA 1QCBD 3QOLA 3SK5A 1VQ8A 5EQ0A 1OXVA 5JAVA 4KLKA 4A3IH 1VQCA 2A6EC 4NP5A 4BBSG 5DLQE 1YNND 3S1RB 2OTJA 5JJLA 4IPGA 1C9OA 4HJAA 2EY1A 4QB4A 1STYA 5IT9L 2F52A 1VMPA 1QVGA 1B2TA 4DUZL 4JI1Q 5C3EH 1CT1D 2VQFQ 4IFDG 4CBVA 2P5ZX 3S2HB 3D4WA 1YBYA 2YTVA 2PQAB 3PF4A 3QR8A 1FNUA 4K6DA 4DR1Q 1EWHA 2EY2A 1L1OB 1QB5D 4JI0L 1QJOA 3S1RH 3P75A 4DF7A 4HR7B 4OX9Q 2L11A 5GAEC 1R9TB 2A74C 2MNAA 2VW9A 3ER0A 5DM63 3E3XA 3A8IE 5FKAC 3C1FA 1RL2A 5IP9G 1STGA 3GTQB 5E3FA 2EJMA 4JI1L 4B3RQ 2E2HB 3RNUA 3S2HH 3DEPA 2VQFL 1B53A 4A75A 3K57A 4ODGA 3KF8B 5E1FA 3J80L 1YJWA 4Y7NH 4J8QA 1S5CD 1SBBB 3CCRA 5CGKA 2NYZD 1LTLA 4AQYQ 4OX9L 1D5XC 3VA7A 1V9PA 1V8QA 4AIMA 5CBEE 2EVBA 3TBIB 3ERSX 3UDXA 1HTPA 4OL7A 2ATWA 4ZK9B 4IPCA 1U9RA 2CH4W 3V2TA 5FO7B 2JEAI 1JE5A 3GTQH 2E2HH 1QUQA 3NPPA 4X62Q 4B3RL 2HIVA 2N88A 3A5ZB 1YHQA 1N8RC 1BBXC 3I7FA 1A3TA 4IJLA 2R92H 2C9OA 4A3LG 4X3UA 1YZ6A 5IODA 3CP0A 3CXCA 1TQOA 4K2LA 2R93B 5G3LF 4P75A 1TWFH 3KOJA 4ZCKA 3K81C 2BA0A 5EKIA 4G7ZC 1QILA 1WTXA 4K8JA 3MFYA 5FOBB 5FO8B 1VQLA 2RKSA 2O5JC 2L4NA 2NBFA 2FHTA 1Q82C 5IYCG 4X62L 2L12A 2E76C 5T1IA 4RH6A 4JI5L 1BR9A 5C4XB 5C4HA 4CDFC 4LNQA 1CZWA 3AMUA 4ZYSA 2R93H 1PH8A 4C3JB 3CAMA 1F2ZA 2F0NA 2R7ZB 1U4PA 5BN5A 2R61A 1Q90A 1PZJD 4A3GG 5HGQA 2EIFA 5IT9c 3OTOQ 1E7ZA 3E6ZX 1K8MA 5I6WA 1HZAA 2I07B 4K6LA 1KABA 1H9SB 3OIPA 4DAPA 2PNHA 5ELFA 3OPOA 3CCLA 3RLOA 1OXXK 4F8MA 2DGYA 5C4XH 2H5XA 2EE1A 1VQ7A 4DR5Q 1G91A 4UP8A 1STAA 2NVTH 4C3JH 2K28A 1YIJA 1GJXA 1LT6D 2R7ZH 3S15B 1F9SA 1GHKA 4C2MB 4G57A 2WB1B 1S5DD 1I6HH 1XYIA 3Q0AA 1EEFD 4YCUA 2OTLA 5IIFA 4XIGS 2F0TA 4DU9A 2YU9H 1TY2A 2SNSA 2WAQG 4EQNA 2VQEQ 1L0XB 3BDCA 4JW0A 3HOZB 1YNNC 3KBXA 3F2CA 4JV5Q 4OELB 1DOKA 2BCOA 5CC4A 2ZJQA 4B3TQ 1PDQA 4M1UB 4EX5A 5A2QE 4I7ZC 2KQ3A 3S16B 4MZ9A 4DR5L 4B3MQ 1E2ZA 4C2MH 1QWYA 4CJ0B 1E24A 1R4QB 1WCMB 4KTAA 1EOVA 3K8AA 5DM73 4A3DB 1MBYA 4C3HB 3EROA 1VQ6A 4LF7Q 4C1NK 4PQXA 1B44D 4KKUA 4TKOB 4M8AA 3HOZH 2RHQB 5IGCA 2SNMA 3I2ZA 1SNCA 4JV5L 4LWCA 4LAAA 3S16H 3MXNB 1S5FD 1NMGA 3MXUA 2N55A 4B3ML 3BVGA 1L0WA 1WCMH 2QW7A 2FJ2A 2JE6I 1Q8IA 3CCVA 3NP8A 4FXDA 3M7GA 1NR4A 1BDOA 4JBJA 3PO2H 2LSSA 1G2SA 4MN3A 1L1OC 1AN8A 2I5LX 4LF7L 3H91A 2FMCA 1HJPA 1UEBA 4ILWA 4GZYC 3CPWA 1XNQQ 2Z6KC 4MIUA 3BS1A 2ASBA 1RD9D 3URYA 1V1PA 2CWAA 4PZ7A 3T1YQ 1AZQA 2E75C 3ULLA 1BOSA 1BCPB 1EOTA 3MA2B 4J15A 2K7VA 3H0GB 2VB2X 1UNSA 1I3QB 4XTCS 3PQIA 4DGZA 1FGUA 1H9JA 3K0XA 1TXYA 3MEFA 5I9OA 3H09A 5CR3A 4K5WA 5NUCA 3PSIA 1FGBD 1IL8A 1ML0D 1VF7A 1FJGQ 1XNQL 1B1ZA 2EJFC 1GO3E 3W2DA 1D5ZC 3CC4A 2XVSA 3J81L 1BCPD 1A62A 3J7A5 2BDOA 2F4VQ 2IL8A 1SE3A 2PZTA 3E0JA 4L5RC 2VY3A 3H0GH 2K01A 2CKZB 1X55A 4R1JA 1HNWQ 1PZID 4UPAA 4APVA 3PO3H 1I50B 2OWOA 3GTJH 2JJQA 4N8X1 2K50A 1CA5A 2XTIA 4JBKA 1SE2A 2BE5C 1A2UA 1I4GA 4DV4L 4A3CH 2E2DC 2TSSA 2A19A 3NTIA 3J80i 2C35B 1O80A 1GVPA 3D3RA 2YTXA 1SN8A 2F0LA 2RVLA 4DV3Q 3ZJYC 2R92G 1K8AC 4LF6L 1SXTA 1ZEQX 4LUOA 1DJRD 1VQBA 1AH9A 1CZGA 1VQPA 3CRKC 4DR4Q 2EYPA 2D0PA 1GUGA 5K36H 1TWAH 3HOWH 3WDNA 1KC8C 4KY5A 2EYMA 2A6HC 5GROA 1KAAA 1HNWL 1I50H 1MSGA 4YIJA 1PXUA 3FKIG 4BY1B 2PZWA 3KLRA 1FNWA 2RCNA 4KMUC 2F1MA 2B2WC 2ICIA 4DV3L 2K5DA 1IBLL 2ALYB 3TMEA 1KRSA 3A8KE 2F3IA 4GNXC 3C46A 1JMCA 4GLXA 4DR4L 2Z9HA 3I70A 4L5TA 1FR3A 1TWGB 4LW1A 3QG1A 1HZBA 2NVYH 5CV6A 1EY0A 4RGMA 2OXPA 5D3DA 1Y8PB 3G6JB 1LTID 4BY1H 2Y0SG 1JJCB 3MFGA 4DAYB 5JVH3 4YCWA 1VQNA 3RLFA 2AUKA 4DV6Q 3GTMB 4RGTA 1LTRD 1SRUA 1V43A 1TWGH 2XSCA 2Y0SE 1SDFA 1PH4A 3R8BA 3SGIA 1R4PB 2K4KA 2K1BA 1AFPA 4X66L 3Q22A 2MJ8A 3DWAA 1JC7A 1XJVA 5EBDA 4ME3A 3FDTA 2J7ZA 2XRQD 4RWSC 2BA1A 3KJPA 5FLMG 1SYGA 3GTMH 4EGVA 3J81c 5M3FB 4PG3A 1U0LA 1Y1WB 4CHTB 2K32A 3MWYW 4DR2L 5FLXL 4A3MB 1WD1A 1IZ6A 5LL6S 4A3FG 4OEMB 1Z7TA 1DZ1A 3HKZG 5C0XI 2ZXRA 3QJYA 1KDBA 1LT3D 1SYFA 1SNOA 1KDAA 3GTPH 1IXRA 4F87A 1QZHA 5M3FH 1CKNB 4JBWA 2K75A 1C48A 2EYJA 1JOQA 2WKDA 4DV2Q 3MVVA 4GLVB 2JA5H 2WACA 3TS2A 2EYHA 1E1TA 3DM1A 3DWQA 3HEJA 4A3MH 1VQKA 3OW2A 3PO2G 2Z8LA 2B63B 2TMPA 2A6ED 4KHVA 1IYUA 2UUAQ 1T5EA 2K6AA 2CW0D 3PIOA 4E6IA 1OO9B 5C44G 3M3YB 1BCPC 5ELDA 1PRTC 2RDGA 3A56A 4R4OA 4ZUJA 4C1NI 1KXLA 4OO1H 1QVFA 5A35A 1HTLD 4A93G 2L55A 4DV2L 2KCNA 2K33A 4GKKL 2V4DA 3V96A 3VYSA 3GDEA 1HA6A 1LTSD 3GV6A 4BA1I 1ICWA 4LJZC 5GQOA 2VS1A 2B63H 2F0WA 1NCVA 2GVAA 3MAQA 2F0HA 4BS9A 2UUCQ 3M3YH 5H1SE 2KVMA 2F0MA 1BUVT 4A3EB 1EYGA 3NTHA 1K8GA 3UDIA 3M7NA 4C3IG 3D31A 4DR6Q 1EY8A 1KIXA 4BY7B 1QVCA 2Z0SA 2OT2A 3CMEA 3EJIA 3H6MA 4ID6A 2IX1A 3PO3G 2VXWA 2CQOA 1BCPF 1VQEA 4A3EH 1BF4A 1J5EQ 4A3CG 3PF5A 4LMQD 1C4QA 1O7LA 2JA7B 1VQJA 1DOLA 1RODA 3KF6B 1STBA 2B3GA 1WTWA 4BY7H 1WVLA 4DR6L 4GOPB 4BXXH 3HOWG 3D8GA 3L3OC 3MXPA 3L0OA 2DJFC 2VNUD 5C0XG 5IP7H 4KY7A 1HPCA 3NHHA 1MGSA 2GVBA 4Z9CB 1A63A 1GUTA 1WOCA 4IUNA 1XX8A 4HIDA 1Y1VB 2LXJA 1NSNS 4RKBA 1O7YA 2VB3X 3M4OB 3NBHB 2E74C 3GTGB 1IL2A 4XQJA 2MO0A 1IYJB 4UDUC 2I46A 1CSPA 1L1OA 3PIPA 2D2CC 1KNEA 3HOXB 1KRTA 1VQFA 4KN7C 1LYLA 1YHAA 1YVCA 2Z6KA 4DV1Q 1CI3M 1S4ZA 3HOYG 1RHPA 2M2LA 5AFWA 1Y1VH 3HOUB 1AW7A 3M4OH 4RGOS 1A3UA 1JORA 4BBRG 4H7BA 5C4JH 3E9IA 4HIKA 1SMXA 1JCKB 3D0FA 3KF8A 3TREA 2QA4A 3AQQA 5ELNA 3I90A 4DV0Q 3HRZC 4IO9A 2JA8B 3S9WA 3HOXH 2HDLA 5IGBA 4LF8Q 2LS01 2KCCA 2IT1A 4YWMA 2B2TC 2J0TD 4UP7A 3N52A 2F0FA 5EAYA 5KIXA 3JAMi 4DV1L 2AQ3B 2B29A 4KY6A 3HOUH 4K2KA 1SYDA 5D14A 5M3MH 5JJIA 3CKIB 5CMDA 2HHHQ 4JI0Q 4F88A 2F0GA 3G6EA 2FMMA 1X32A 2CW0C 1CA6A 4A3JH 4DV0L 1KLGD 3GTLB 1HRJA 2PO4A 1YITA 1YJ9A 1I4RA 4LF8L 3AYHB 4R8NA 2EXZA 1BQQT 3A74A 1ET9A 5FJ8H 2QILA 3E0EA 5JJZA 1JICA 2L1BA 2BH8A 3OHXC 2VUMB 1SE8A 1CM9A 2EYOA 4FXGC 1MHWC 5EKKA 3VYTA 3JC66 4AYBG 2HHHL 2KHJA 2XGTA 1A3VA 2JA5G 2XWBB 2NN6I 3K59A 4I65A 4QL5A 4X3TA 3OSOA 2UXCQ 1I4HA 1LT5D 3CCSA 1LTTD 1K28A 4S3SA 4GLAC 1G8ZD 2VUMH 4B9WA 2ES2A 4HJ7A 2HCIA 2EZVA 1LABA 1H9SA 2E8GA 4ZRZA 2RHSB 3IFTA 1UEAB 4B3SQ 4WFN3 4XT3B 1Q1BA 2LFNA 4RGNA 3QB3A 1R9TH 2L0CA 2UXCL 3CF5A 1C7YA 1WTVA 4RMFA 1EY4A 2JXMB 1CFMA 4O42A 3U58A 2Q2IA 1K0RA 3WOEA 2UU9Q 4L6TB 1BBWA 1KHIA 1F9PA 1UWVA 1RDPD 2AMCB 3W1GA 3KFUA 4N9PA 2PCFB 3R93A 3HKSA 4KI0A 4JI5Q 2IHFA 1V1QA 1DONA 2ID0A 3TP6A 3WWVA 1J6QA 4B3SL 3CHBD 4NXML 1O7ZA 1X3PA 2DY8A 5T1GA 2R6GA 4A4IA 3R2TA 1Q1EA 3EN2A 2QEXA 1B4OA 4CDCC 1EFWA 2UU9L 4LF4Q 2D9UA 2IWHA 3F2BA 5I4DA 4GOPC 1LTGD 1SYCA 4OHJA 3T1HQ 3T4AC 4HMJA 1SLJA 3F2DA 2BE5D 2YYZA 4XT1B 1ASYA 4HCSA 3MXNA 1M8AA 3MC0B 2XRSD 4FYDA 2C5CA 1Z9FA 4L63B 1ASZA 3K5OA 2JA6B 5IP7G 2Y0SB 4LF4L 3RZDB 4GNXB 1VQ5A 5TSSA 4ZQ3A 2IW3A 4A3BG 2B39A 1IYVA 2EXDA 4LK1C 2AQ1B 2B8GA 5EPJA 3T1HL 2A6HD 4ZKBB 3A5UA 3HS0C 3CCQA 1E3PA 1HH2P 4ZUIA 5IYBH 3DMUA 2NN6G 1CTMA 2LXKA 1D7QA 4LF5L 4DK1A 1PH2A 3RLNA 1DXMA 2OCEA 3PUWA 3BZCA 2OQ0A 3I3CA 2JA6H 4R4QA 5J39A 5M5WB 3RZDH 2EPBA 1LACA 4KHZA 2PI2A 1A6XA 4R4IA 3ND8A 4DK6C 2MGSA 4QQBX 3S2DB 1K83B 3PIO3 2DNEA 1D1KA 1B7YB 4OWWB 2HD3A 5DNFA 2F0JA 1G51A 3S15H 3VR4A 1QUQB 4U68A 3DWPA 5BN3A 2WAQE 4N8FA 3BVZA 5E4XA 2B2VC 4JPBW 3VDYA 1DGSA 3KBGA 3A7AB 3K80C 1B70B 1I5FA 1GHJA 1NAPA 2EYLA 5M3MG 1K83H 4RG1A 2RSNA 3X3NA 3CC2A 1IHZA 2PMZE 1EQQA 2X6GA 4IN3A 4A3IG 2CQAA 1UAPA 4POFA 1X3QA 2PW7A 1HUNA 2G9HD 3CQZB 4K0KQ 5I2XA 4O0AA 4IOCA 1Q81C 3R2IA 4A3JG 2F0DA 4B08A 1STHA 4OIJA 4IUUA 4A3DH 1A8VA 4C3HH 4KKTA 4MTNA 1NJIC 1DOMA 1DYQA 2ICEC 4FF4A 2L9HA 5C3EG 5JPMC 5FJ8G 2F0OA 4K8IA 4A76A 1LLRD 2QDLA 4IUPA 2G5DA 4TQUS 2AQ2B 3BZKA 2CH4A 4PNYA 3CQZH 3RR5A 1SMYD 3MXGA 4K0KL 1K3BC 1TIID 1JE4A 1PRTB 2B2YC 3CCMA 1U4MA 1EIFA 4FNFA 2F0EA 2ZXPA 3KUPA 3P7JA 1TY0A 3F2UA 2J4XA 4C56C 4DV4Q 4A3KB 3G48A 4FF3A 4RCOA 4LF6Q 4H13C 5EPKA 2RDFA 4DAYA 4OXPA 5FK9C 4NW2A 2PPBC 3J80E 1TU2B 1PRTD 4WJ4A 1I3QH 2GA4B 1FVIA 2JYOA 4HEDA 4CDDC 3U50C 3PIP3 4XYOA 4H02A 2O5IC 4JOIA 5M5YB 4JC0A 4HIOA 3BG3A 5IY0A 3N6RA 4DKAC 4A3KH 5EBCA 4OIKA 1YNXA 2A69D 4MTKA 5J1ZA 2Z4HA 4P72A 1IBLQ 2KA7A 2KEEA 1HQRD 1SEBD 3A0JA 4DR7L 3CPFA 5JJKA 2WV6D 2WIIB 1LTBD 1ESRA 1C8CA 4KK7A 1U4RA 4KD3A 1NMFA 3PUYA 5CYUA 4WORA 1CHPD 3MEHA 3NTKA 5CV9A 5IE8A 3NENA 5JVG3 3STBD 1NUCA 3RN2A 4DNIA 1D2BA 4R4TA 3TZDA 1F2YA 4PV1C 4JI4L 2PNRC 5DEHA 3I4NB 4IUTA 5JOBA 2R93G 2H4OA 2M9VA 3NQTA 1CKNA 1KD1C 3ULPA 1Z6HA 1E2WA 1XPUA 3DM3A 2ZJPA 2PZUA 4X66Q 2BH2A 3I4OA 2FFKB 1KAWA 3TP8A 1F2LA 2MFIA 1TWCB 1I4QA 1Q3LA 3T51B 5C4XG 4RHSA 3D6WA 3BYTB 1VQDA 4JVZA 1LUZA 5IGFA 5IYBG 1S40A 4C3JG 2R7ZG 2UXDQ 4KHPQ 2QEJC 1XPOA 5C3XA 5IYDH 5M9OA 4DR2Q 1HZCA 2PQEA 2NWGA 1RCVD 3VR3A 1F9QA 2A5HA 4TSSA 1LT4D 4FP5D 3I4MB 1PA6A 1GKHA 3X3MA 3HOVB 3P20A 3MHBA 4OONA 5I6YA 4BBSB 1KQSA 2WB1G 5CV4A 4KHPL 1CUKA 2UXDL 1T9HA 1SNDA 3FPPA 1VS0A 3EVQA 4K5VA 1AEXA 1IBKQ 3I4MH 2XWJB 1J8IA 3HOZG 1NE3A 1EQVA 5I2YA 3HOVH 4FXKC 4P74A 1SMYC 5ELEA 3KK7A 1OXTA 1YJNA 3GP7A 3K5NA 5HURA 1OXSC 1GD7A 1XWEA 4BBSH 2FINB 4IURA 1WCMG 1YI2A 1Y1WH 3D4DA 3IAYA 1HA5A 1PH1A 4GKKQ 4J6HA 4A3DG 3HKZE 4C3HG 1BKBA 1SE4A 2NUCA 5EGTA 1IBKL 4X3KA 2PYKA 1EIGA 4GOPA 4JI3Q 1MIUA 3NQIA 4IFDH 1PFNA 1TKWB 3QOJA 4ABNA 2NTSA 1B3QA 1PH6A 2HIXA 1PYBA 1VQIA 3ERQA 1AE3A 4CJ1B 4JI7Q 4L5QA 4K14A 3KDFA 1EZ8A 2NVXB 1EU4A 4PMWA 1K73C 1UE7A 1X3FA 1A2TA 1S5BD 1P16A 3NBHA 1MSHA 5CV7A 1VQHA 2UXBQ 4TRDA 1T5XD 4UP9A 3T53B 5IP9H 2A69C 3K7AB 1B3AA 4L8JA 2JEBI 4JI3L 3GTKB 4QCLA 3C3LA 4WJWA 2CHBD 1HHVA 3H3VC 2EJGC 1C0AA 5LMUQ 2RBMA 2E2JB 1KL9A 4RKLA 2HQLA 1G291 2KCMA 2Q8RE 1CHQD 1JJGA 4JI7L 4G7OC 1I4XA 2BDNA 3CC7A 2NVXH 3VYUA 1BVSA 3STBC 3H0GG 5JEAJ 3FPUB 1WYDA 3GTOB 2UXBL 1N32Q 5KRUA 1STEA 4U673 3CD6A 3K7AH 4P71A 3J81j 2MHVA 2KHIA 3SVMA 3VR5A 3SEBA 4DV7L 1ZYRC 1EWIA 1PRTF 1X3GA 1VDZA 5KNBA 3VR2A 3W1BA 5LMUL 3DXJC 1Q8KA 2PI2E 3C2PA 4CKEA 1SFOB 2K05A 1S72A 3J81i 1MI2A 1VF5C 2B2VA 3GTOH 5K36G 4A3GB 5IGGA 4YWKA 2L15A 1ILQA 1N32L 3PUZA 2D5DA 2R3ZA 3U4VA 3K6OA 4Q5VA 1YEZA 1H95A 4CKCA 1WI5A 4TVAB 3LX0A 2JA7H 2CFMA 5M5XB 1GUSA 2WP8J 5K5PA 2A1AA 1JWMD 4IZ8A 3UE0A 5BN4A 4OO1I 4LFBQ 2K04A 2PQAA 2ENBA 2AWNA 3TEHB 4A3GH 1SYBA 4DK0A 1L2FA 2K5VA 1GUWA 2IY5B 3K0YA 5IGEA 1XPRA 1PFSA 4YHHQ 4DAMA 4BY1G 3A7LA 1X56A 2WAQB 5KEEA 2KEDA 3BZDB 1JOKA 4DPGA 3TDQA 5BR8L 5IGDA 5ELOA 4DK3C 4PMCA 3JAME 4LFBL 3GTGH 3S1QB 3H94A 1GUOA 2PMZB 4X65Q 3GV3A 3I72A 3AFQA 4PMBA 4FF2A 1HCZA 3RMHA 1EY7A 2JSOA 3LWEA 2DNCA 1I6VC 2F4IA 5EPLA 2DY7A 5A2QL 1H9KA 5ELBA 3NWSA 4YHHL 3D4RA 1RKNA 5IWAL 2YV5A 1SNQA 1EYCA 3SHLA 2HCCA 3PUXA 4GS3A 1IKLA 4X6AH 4CGYB 2QKIC 1YHBA 1XTCD 4HCEA 4ZLTF 4QUCA 1JJ2A 2NVQB 2KUMA 1TWHB 5KGUA 3S1QH 2KBNA 3NEMA 1RTOA 1G6PA 4X65L 3P1HA 2JA8H 1HR0W 1VMCA 4JG2A 2UUBL 4DXFA 2ZXOA 3SE0A 1OXUA 5C5LA 4N9TA 2NZOA 2Z1CA 4HTHA 5FLXE 2AUJD 4JK1C 5M3FG 3I73A 2NVQH 1TWHH 1HFGA 2R7DA 1HZ9A 1LTAD 1SJHD 3RD4A 1Y1WG 4IJHA 4XXEA 5LMNL 4FDBA 5KNCA 1JWUD 1VQOA 2K03A 4NDXA 4FVMA 4A3MG 3GTLH 1PYSB 1TR5A 1PH9A 4WRDA 4DA2A 5GAHC 4AYBE 3AEVA 4IUQA 1CQVA 2G9DA 2A8VA 2B2WA 4Q0FA 3EIVA 3MZ5A 4HMIA 5F2DA 4Y7NB 1VCIA 2EDGA 1B50A 3G4SA 4OO1G 2K5HA 4GNXA 2QDBA 4JCVE 1LM0A 4NXMQ 5LHY1 1UUPA 3ITPA 1D1IA 2B63G 3PCOB 3OMCA 3CU7A 3Q8DA 3I4LA 2F03A 4DR3Q 1KDCA 4FF1A 3TS0A 1EUJA 3PUVA 4QJFA 3DLLA 1PZKD 2ZTEA 4QIWE 2EOTA 4DR1L 2SOBA 4L5SA 2R92B 3LNNA 3OWEB 4KV6A 2M00A 1EL0A 5HGTA 4LFAQ 1IKMA 3GO5A 4DNTB 4NPSA 2F0KA 1EQRA 2HQEA 1G6ZA 1TWFB 3SK4A 1N33Q 1UE5A 2DUDA 2D62A 3OMGA 2FXQA 2LMCB 1RF2D 4HAEA 4LUZA 1AE2A 4OWTB 2JA9A 4IPHA 4NMZA 4DR3L 4IOAA 2K14A 1X65A 2IX0A 3FKIB 4A3EG 4KJNA 4Y52H 3GD7A 1HNXQ 5I9PA 4IFDJ 3BJUA 4O2DA 2JK8A 1PLFA 3PGZA 3TP5A 3SDZA 1GXDC 1E2VA 3VR6A 3G7LA 3A55A 1MD2D 3TP7A 4AQYL 2X6LA 5J22A 1SAPA 1IW7D 1V1OA 4LFAL 4CDEC 4BY7G 3BYYB 4BXXG 2Q2TA 3I56A 4LF5Q 1N33L 4IALA 1M1KC 3U9OA 1PH5A 2KOLA 3FKIH 1VQ9A 1BNZA 1EFID 1Q7YC 4XQQA 4K5XA 2OEOA 2Q8IB 1HNXL 2JA7G 3KYHC 1UE1A 2NVTB 1LV9A 2F3WA 1EYAA 1VQMA 1ENCA 2F0SA 1I6HB 4RAUC 5CV8A 1L0YB 3TZUA 4ME5A 4LUVA 1XNRQ 1JB7A 1WFQA 4IPDA 2F0IA 2Q2HA 2ZTDA 1HQMC 4HN7A 2YU9B 1QNUA 2KECA 1ESFA 5E7NA 4IQZA 2WINB 3VA5A 2RSOA 1Y1VG 2QF7A 3RZOB 2MPMA 2N8NA 1QOHA 2B2UC 1Y8OB 3DUZA 2QCPX 3T16A 2HT1A 1H9MA 4P73A 3K58A 2ZJRA 1PV4A 1BXTA 5J3BA 1XMQQ 3CCEA 4JYAQ 1MKHA 1Z47A 3FEWX 3OTOL 3HOXG 1XNRL 4A3FB 2EQSA 2Q2UA 1E22A 1F9RA 5M5WH 3Q6SA 3J80c 4PZ8A 3DHQA 3HKZB 5FLMH 4J1MA 4RCNA 3RN5A 3HOUG 3RZOH 3AU7A 3S2DH 5D65A 4UY8C 3A54A 2V1CC 3L7ZC 3ULJA 3J7AF 3FVQA 5IOCA 5JEAH 1XMQL 2A68D 1S5ED 4JYAL 2JA8G 1EIHA 1FL0A 1M90C 4A3FH 1SNPA 3PO2B 1KTKA 3BDOA 2SDFA 5GADC 4QGUA 5KYIA 2VQEL 3HG9A 1PFBA 4LF9Q 2I5MX 3NE5B 5C44B 4BA2I 1RJTA 1HFNA 3NXWA 2E2IB 4B3TL 3NK9A 3VYRA 1SYEA 5IT9E 3FHWA 1FYCA 1PMRA 4NKLA 1Q12A 2A73B 1PYWD 1E0BA 4A93B 2CWPA 3SXHA 2CVRA 4HIMA 4EVOA 2DJGC 5EKLA 4CKBA 3F1ZA 1CKOA 3C1EA 3KLSA 3QO2A 5D3IB 4ZKCB 3S1NB 1F2MA 4OGQC 3U4ZA 3OOCA 2IX3A 2JQOA 5C44H 1HR0Q 4LF9L 3Q24A 3DEOA 1XXGA 2E2IH 3NUCA 2XN9C 5COYA 2F3VA 2VUMG 4GN5A 2H1EA 2JP1A 4R8IA 1W6KA 2K52A 4H44C 4NB3A 1VQ4A 4A93H 4AH6A 4YWLA 3ZYYX 4C3IB 1YNJD 4DR7Q 1Q86C 3LWUA 3NELA 3TRZA 1ICFB 2F0UA 1JQYD 3S1NH 1EQTA 4DXGA 3HZXA 3D6CA 3J7ZC 3PO3B 2F0QA 3GTJB 3E5SA 2LKVA 1HR0L 1CK1A 1IW7C 2KENA 5L37A 4JI4Q 3R3OA 4C3IH 3T1YL 4EQ5A 1WTPA 1EEID 3OYYA 1N36Q 1JT8A 3FRPB 5AJ3Q 3M9BA 3H3VH 5E4WC 1TWAB 4HSVA 1GUNA 3HOWB 1SROA 1LO5D 4OWXB 5KNDA 1QNKA 3Q23A 1JOOA 5DAUA 5LL6X 1F77A 1K3RA 3M4YA 4QY7A 2B2TA 3AFPA 3HGBA 1TS4A 1DD2A 3CCJA 1J9OA 1ILPA 1X6OA 5M5YH 1FJGL 5C6AA 3TSSA 5CV5A 3H15A 3ICEA 1XTDA 1PTOB 3BVMA 1JB3A 2HDMA 2F4VL 4LFCQ 3B6YA 1ZYRD 1WTOA 1N36L 4BWGB 5AJ3L 4DUYQ 4HJ9A 1UE6A 2OQKA 2NVYB 3TN2A 1CQFA 2JN4A 1EYDA 5C0XH 5C5MA 4FO2A 1B8AA 3OWFA 1K0SA 1V1PB 3AB9A 3IFDA 3T56B 3HOYB 1PTOD 3CMAA 5HY6A 1O78A 5LMNW 1PTOH 1SJED 3ND9A 1AP0A 3I4NH 3S14B 3SK8A 1XMOQ 4BBRB 3RUZA 3V05A 4V0BA 4B9XA 4LFCL 1MJCA 4RHRA 4KJOA 4ZAIA 1TS5A 1SNMA 1SSOA 4DAVA 4DUYL 1QZGA 1KNAA 2ZM6Q 1WTHA 2JA6G 1ONLA 4EQPA 3T13A 3JAML 4YY3Q 1TWCH 1PFMA 4MHEA 3HOYH 1H9RA 2A68C 2HUGA 3IL8A 3S14H 3L9AX 3CRLC 4BBRH 3IKJA 1GM5A 1XMOL 2B8FA 4QF4A 1VQGA 3UE1A 2RDHA 1WTQA 2K5WA 2I5HA 2N3SA 2N78A 3KJOA 3H3VI 3F8TA 3S24A 1CSQA 2ZM6L 3OIQA 1NTGA 3NBIA 1ET6A 2XIWA 4YY3L 2OF1A 1OTCA 3GTPB 2KHSA 2WB1E 4DV6L 1VQAA 2ZTCA 2L5TA 4AYBB 1CKMA 4X64Q 3U9SA 1NR2A 5EJWA 2JA5B 2VZAA 5C3WA 5JEAG 3UDGA 2MUYA 4F7XA
chains in the Genus database with same CATH topology
4XDXA 3EFXD 4R9WA 2EY6A 3S1MB 5ELCA 3NSWA 4KD4A 2DN8A 4HSPA 1WTRA 1D5MC 1YNJC 2MP1A 3PV0A 2O4XA 2Z4IA 5FO9B 4CJ2C 4EQOA 4QIWB 1JR0D 1K8OA 2X69A 1II3A 4DFAA 1M4VA 3KLSX 3PMFA 3MTSA 1U4LA 1DM0B 2ZT9C 3EA6A 3I91A 4P2CB 1A15A 1BO0A 3GQBA 1ZXTA 1STNA 3M85A 4X3SA 2EY5A 1G2TA 2WKCA 2SEBD 1EY9A 4UAIA 5C4ZA 2K5QA 3QWNA 1DCZA 2KJXA 3J81E 2NZ1D 3K5LA 5G3LD 3HP3A 2B2UA 1QE6A 2NTTA 1HXYD 3UI2A 3ONAB 4XYQA 2F0PA 5CBAE 1FD7D 1EU3A 1PTOC 2BOSA 1ZKOA 3SR1A 1EWCA 3S17B 1KLUD 5KYLA 4G4KA 4IFDI 2LY7A 1JWSD 1WD0A 4A3BB 1W6JA 2O2LD 4O1NA 5CORA 5JPNC 1AZPA 1HUMA 1D6EC 1GOZA 4RFBA 4XQNA 2RA4A 4DN4M 1Y8NB 3O13A 4QMGA 2PW5A 2Q8TA 1EY6A 2RQXA 4QUFA 4ULLA 1TT2A 4V190 1Y69U 3A8JE 4RA8A 2NB0A 3BDLA 4H0LC 2IJ0A 5C4JB 2NN6H 2AWOA 3SK6A 1PTOF 2B2YA 4DNRB 1TS2A 3J7AV 1FNVA 4IUVA 3W3AA 3I8ZA 5M3MB 1TS3A 1RTNA 3EQLC 1TVXA 2XNAC 1ENFA 4A3IB 3WOFA 3J7YW 2IPKD 2F0VA 1B9NA 1EZ6A 3FMCA 1ENAA 4G7HC 3QIAA 4KKSA 4A3JB 4KN4C 3NWTA 1QG7A 5ISRA 3OW7A 1EY5A 2EYFA 1I4PA 3K5MA 5C3EB 5C0XJ 1B9MA 1QCBD 3QOLA 3SK5A 5EQ0A 1OXVA 5JAVA 2A6EC 4NP5A 1YNND 3S1RB 2EY1A 4QB4A 1STYA 5IT9L 1VMPA 1B2TA 1CT1D 4IFDG 4CBVA 3S2HB 3D4WA 1FNUA 4K6DA 1EWHA 2EY2A 1QB5D 1QJOA 3P75A 4DF7A 4HR7B 2L11A 1R9TB 2A74C 5DM63 3A8IE 5FKAC 3C1FA 1STGA 3GTQB 5E3FA 2EJMA 2E2HB 3DEPA 1B53A 3K57A 4ODGA 3J80L 5E1FA 4J8QA 1S5CD 1SBBB 5CGKA 2NYZD 1D5XC 3VA7A 1V8QA 5CBEE 2EVBA 3TBIB 1HTPA 4OL7A 4ZK9B 1U9RA 2JEAI 3V2TA 5FO7B 3NPPA 2N88A 1BBXC 1A3TA 2C9OA 4X3UA 5IODA 1TQOA 4K2LA 2R93B 5G3LF 2BA0A 5EKIA 4G7ZC 1QILA 1WTXA 4K8JA 3MFYA 5FOBB 5FO8B 2RKSA 2O5JC 2L4NA 2NBFA 2FHTA 2L12A 2E76C 5T1IA 4RH6A 5C4XB 1BR9A 5C4HA 1CZWA 3AMUA 4ZYSA 4C3JB 1F2ZA 2F0NA 2R7ZB 1U4PA 5BN5A 2R61A 1Q90A 1PZJD 3E6ZX 1K8MA 5I6WA 2I07B 4K6LA 1KABA 1H9SB 3OIPA 4DAPA 5ELFA 3OPOA 1OXXK 4F8MA 2EE1A 1G91A 1STAA 2K28A 1GJXA 1LT6D 3S15B 1F9SA 1GHKA 4C2MB 4G57A 2WB1B 1S5DD 1XYIA 3Q0AA 1EEFD 5IIFA 4XIGS 2F0TA 4DU9A 1TY2A 2SNSA 4EQNA 1L0XB 3BDCA 3HOZB 1YNNC 3KBXA 1DOKA 2BCOA 5CC4A 1PDQA 4M1UB 5A2QE 4I7ZC 2KQ3A 3S16B 1E2ZA 1QWYA 4CJ0B 1R4QB 1WCMB 4KTAA 5DM73 4A3DB 1MBYA 4C3HB 3EROA 4C1NK 4PQXA 1B44D 4KKUA 4TKOB 4M8AA 5IGCA 2SNMA 1SNCA 4LAAA 1S5FD 3MXUA 2N55A 3BVGA 2FJ2A 2JE6I 1Q8IA 3NP8A 4FXDA 3M7GA 1NR4A 1BDOA 1G2SA 4MN3A 1AN8A 3H91A 2FMCA 4ILWA 4GZYC 4MIUA 3BS1A 1RD9D 3URYA 1V1PA 1AZQA 2E75C 1BOSA 1BCPB 1EOTA 3MA2B 2K7VA 3H0GB 2VB2X 1UNSA 1I3QB 4XTCS 4DGZA 1H9JA 5I9OA 3H09A 5CR3A 4K5WA 5NUCA 1FGBD 1IL8A 1ML0D 1VF7A 1B1ZA 2EJFC 3W2DA 1D5ZC 2XVSA 3J81L 1BCPD 2BDOA 2IL8A 1SE3A 2PZTA 3E0JA 2K01A 1PZID 1I50B 1CA5A 1SE2A 2BE5C 1A2UA 1I4GA 2E2DC 2TSSA 3NTIA 1O80A 3D3RA 2F0LA 2RVLA 1SXTA 1ZEQX 1DJRD 1CZGA 3CRKC 2EYPA 1GUGA 5K36H 3WDNA 4KY5A 2EYMA 2A6HC 1KAAA 1MSGA 4YIJA 1PXUA 4BY1B 2PZWA 3KLRA 1FNWA 4KMUC 2F1MA 2B2WC 2ICIA 2K5DA 3TMEA 3A8KE 3C46A 3I70A 1FR3A 1TWGB 3QG1A 5CV6A 1EY0A 4RGMA 2OXPA 5D3DA 1Y8PB 3G6JB 1LTID 3MFGA 5JVH3 3RLFA 2AUKA 3GTMB 4RGTA 1LTRD 1V43A 2XSCA 1SDFA 3R8BA 1R4PB 2K1BA 1AFPA 3Q22A 2MJ8A 3DWAA 1JC7A 5EBDA 3FDTA 2J7ZA 2XRQD 4RWSC 2BA1A 1SYGA 4EGVA 5M3FB 1Y1WB 4CHTB 2K32A 3MWYW 5FLXL 4A3MB 1WD1A 5LL6S 1Z7TA 1DZ1A 5C0XI 2ZXRA 3QJYA 1KDBA 1LT3D 1SYFA 1SNOA 1KDAA 4F87A 4JBWA 1C48A 2EYJA 1JOQA 2WKDA 3MVVA 2WACA 2EYHA 3DM1A 3DWQA 3HEJA 2Z8LA 2B63B 2TMPA 2A6ED 4KHVA 1IYUA 1T5EA 2K6AA 2CW0D 4E6IA 1OO9B 3M3YB 1BCPC 5ELDA 1PRTC 2RDGA 3A56A 4ZUJA 4C1NI 4OO1H 5A35A 1HTLD 2L55A 2KCNA 2K33A 2V4DA 3V96A 3VYSA 1HA6A 1LTSD 3GV6A 4BA1I 1ICWA 4LJZC 2F0WA 1NCVA 3MAQA 2F0HA 4BS9A 2KVMA 2F0MA 1BUVT 4A3EB 3NTHA 3M7NA 4C3IG 3D31A 1EY8A 4BY7B 2OT2A 3EJIA 3H6MA 4ID6A 2IX1A 2VXWA 1BCPF 1BF4A 4LMQD 1C4QA 1O7LA 2JA7B 1DOLA 1RODA 1STBA 1WTWA 1WVLA 3D8GA 3L3OC 3MXPA 2VNUD 5C0XG 4KY7A 1HPCA 3NHHA 1MGSA 4Z9CB 1GUTA 4IUNA 1XX8A 1Y1VB 1NSNS 4RKBA 1O7YA 2VB3X 3M4OB 2E74C 3GTGB 4XQJA 4UDUC 2I46A 2D2CC 1KNEA 3HOXB 4KN7C 1CI3M 1S4ZA 1RHPA 2M2LA 5AFWA 3HOUB 1AW7A 4RGOS 1A3UA 1JORA 4H7BA 1JCKB 3KF8A 3I90A 3HRZC 2JA8B 3S9WA 2HDLA 5IGBA 2LS01 2KCCA 2IT1A 2B2TC 2J0TD 3N52A 2F0FA 5KIXA 2AQ3B 4KY6A 4K2KA 1SYDA 5D14A 3CKIB 5CMDA 4F88A 2F0GA 2FMMA 1X32A 2CW0C 1CA6A 1KLGD 3GTLB 1HRJA 2PO4A 1I4RA 4R8NA 2EXZA 1BQQT 1ET9A 2QILA 5JJZA 1JICA 2L1BA 3OHXC 2VUMB 1CM9A 2EYOA 4FXGC 5EKKA 3VYTA 1A3VA 2XWBB 2NN6I 3K59A 4I65A 4X3TA 3OSOA 1I4HA 1LT5D 1LTTD 4S3SA 1G8ZD 4B9WA 2HCIA 2EZVA 1LABA 1H9SA 4ZRZA 3IFTA 1UEAB 4WFN3 4XT3B 1Q1BA 2LFNA 4RGNA 3QB3A 2L0CA 1WTVA 1EY4A 2JXMB 1CFMA 4O42A 3WOEA 4L6TB 1F9PA 1RDPD 4N9PA 2PCFB 3R93A 4KI0A 1DONA 2ID0A 3TP6A 3CHBD 1O7ZA 1X3PA 2DY8A 5T1GA 2R6GA 3R2TA 1Q1EA 1B4OA 2D9UA 2IWHA 5I4DA 1LTGD 1SYCA 4OHJA 3T4AC 4HMJA 2BE5D 2YYZA 4XT1B 4HCSA 3MXNA 1M8AA 3MC0B 2XRSD 4FYDA 2C5CA 4L63B 3K5OA 2JA6B 2Y0SB 3RZDB 5TSSA 4ZQ3A 2IW3A 2B39A 1IYVA 4LK1C 2AQ1B 2B8GA 5EPJA 2A6HD 4ZKBB 3HS0C 4ZUIA 3DMUA 2NN6G 1CTMA 4DK1A 1DXMA 3PUWA 3I3CA 5J39A 5M5WB 2EPBA 1LACA 4KHZA 1A6XA 3ND8A 2MGSA 3S2DB 1K83B 3PIO3 2DNEA 1D1KA 5DNFA 2F0JA 3VR4A 4U68A 3DWPA 5BN3A 3BVZA 5E4XA 2B2VC 3KBGA 3A7AB 1GHJA 1NAPA 2EYLA 2RSNA 3X3NA 1IHZA 2X6GA 4IN3A 2CQAA 1UAPA 1X3QA 2PW7A 1HUNA 2G9HD 3CQZB 5I2XA 3R2IA 2F0DA 4B08A 1STHA 4OIJA 4IUUA 4KKTA 1DOMA 1DYQA 2ICEC 4FF4A 2L9HA 5JPMC 2F0OA 4K8IA 1LLRD 4TQUS 4IUPA 2AQ2B 4PNYA 1SMYD 3MXGA 1TIID 1JE4A 1PRTB 2B2YC 1U4MA 4FNFA 2F0EA 2ZXPA 3KUPA 3P7JA 1TY0A 3F2UA 2J4XA 4C56C 4A3KB 4FF3A 4RCOA 4H13C 5EPKA 2RDFA 4DAYA 5FK9C 4NW2A 2PPBC 3J80E 1TU2B 1PRTD 2GA4B 2JYOA 4HEDA 3PIP3 4XYOA 2O5IC 5M5YB 3BG3A 3N6RA 5EBCA 4OIKA 2A69D 5J1ZA 2Z4HA 2KA7A 2KEEA 1HQRD 1SEBD 2WV6D 2WIIB 1LTBD 1ESRA 1C8CA 4KK7A 1U4RA 4KD3A 3PUYA 5CYUA 4WORA 1CHPD 3MEHA 3NTKA 5CV9A 5JVG3 1NUCA 1D2BA 3TZDA 1F2YA 4PV1C 2PNRC 5DEHA 3I4NB 4IUTA 5JOBA 2H4OA 2M9VA 3NQTA 1Z6HA 1E2WA 2PZUA 2FFKB 3TP8A 1F2LA 1TWCB 1I4QA 1Q3LA 3T51B 4RHSA 3D6WA 3BYTB 5IGFA 4C3JG 2QEJC 5C3XA 5M9OA 2PQEA 2NWGA 1RCVD 3VR3A 1F9QA 2A5HA 4TSSA 1LT4D 4FP5D 3I4MB 3X3MA 3HOVB 3P20A 3MHBA 5I6YA 4BBSB 5CV4A 1SNDA 3FPPA 3EVQA 4K5VA 1AEXA 2XWJB 1J8IA 1EQVA 5I2YA 4FXKC 1SMYC 5ELEA 3KK7A 1OXTA 3GP7A 3K5NA 5HURA 1OXSC 1XWEA 2FINB 4IURA 3D4DA 3IAYA 1HA5A 4J6HA 4C3HG 1SE4A 2NUCA 5EGTA 4X3KA 2PYKA 1EIGA 3NQIA 4IFDH 1PFNA 1TKWB 3QOJA 4ABNA 2NTSA 3ERQA 4CJ1B 4K14A 1EZ8A 2NVXB 1EU4A 4PMWA 1A2TA 1S5BD 3NBHA 5CV7A 1MSHA 4TRDA 1T5XD 3T53B 2A69C 3K7AB 1B3AA 4L8JA 2JEBI 3GTKB 4QCLA 3C3LA 4WJWA 2CHBD 1HHVA 3H3VC 2EJGC 2RBMA 2E2JB 4RKLA 1G291 2Q8RE 1CHQD 4G7OC 1I4XA 2BDNA 3VYUA 5JEAJ 3FPUB 3GTOB 5KRUA 1STEA 4U673 2MHVA 3SVMA 3VR5A 3SEBA 1ZYRC 1PRTF 1VDZA 5KNBA 3VR2A 3DXJC 3C2PA 4CKEA 1SFOB 2K05A 1MI2A 1VF5C 2B2VA 5K36G 4A3GB 5IGGA 1ILQA 3PUZA 2D5DA 2R3ZA 3K6OA 4Q5VA 4CKCA 3LX0A 5M5XB 1GUSA 2WP8J 5K5PA 1JWMD 4IZ8A 5BN4A 4OO1I 2K04A 2ENBA 2AWNA 1SYBA 4DK0A 1GUWA 3K0YA 5IGEA 3A7LA 2WAQB 5KEEA 2KEDA 3BZDB 1JOKA 3TDQA 5IGDA 4PMCA 3JAME 3S1QB 3H94A 1GUOA 2PMZB 3GV3A 3I72A 4PMBA 4FF2A 1HCZA 3RMHA 1EY7A 2JSOA 3LWEA 2DNCA 1I6VC 2F4IA 5EPLA 2DY7A 5A2QL 1H9KA 5ELBA 3NWSA 3D4RA 1RKNA 1SNQA 1EYCA 3SHLA 2HCCA 3PUXA 1IKLA 4CGYB 2QKIC 1XTCD 4HCEA 4ZLTF 4QUCA 2NVQB 2KUMA 1TWHB 5KGUA 1RTOA 3P1HA 1VMCA 4DXFA 2ZXOA 3SE0A 1OXUA 5C5LA 4N9TA 2Z1CA 4HTHA 5FLXE 2AUJD 4JK1C 3I73A 1HFGA 1LTAD 1SJHD 3RD4A 4XXEA 5KNCA 1JWUD 2K03A 4NDXA 4FVMA 1TR5A 4WRDA 4DA2A 4IUQA 1CQVA 2G9DA 2B2WA 4Q0FA 4HMIA 3MZ5A 5F2DA 4Y7NB 1VCIA 2EDGA 1B50A 4OO1G 2QDBA 5LHY1 1UUPA 3ITPA 1D1IA 3OMCA 3CU7A 3I4LA 2F03A 1KDCA 4FF1A 3PUVA 1PZKD 2EOTA 2SOBA 2R92B 3LNNA 3OWEB 4KV6A 2M00A 1EL0A 5HGTA 1IKMA 3GO5A 4DNTB 2F0KA 2HQEA 1G6ZA 1TWFB 3SK4A 2D62A 3OMGA 2LMCB 1RF2D 4HAEA 4NMZA 2IX0A 3FKIB 4KJNA 3GD7A 5I9PA 4IFDJ 1PLFA 3TP5A 3SDZA 1GXDC 1E2VA 3VR6A 3G7LA 3A55A 1MD2D 3TP7A 2X6LA 5J22A 1SAPA 1IW7D 1V1OA 3BYYB 4IALA 3U9OA 2KOLA 1BNZA 1EFID 4XQQA 4K5XA 2OEOA 2Q8IB 2NVTB 1LV9A 2F3WA 1EYAA 1ENCA 2F0SA 1I6HB 4RAUC 5CV8A 1L0YB 3TZUA 4ME5A 2F0IA 1HQMC 4HN7A 2YU9B 1QNUA 2KECA 1ESFA 4IQZA 2WINB 3VA5A 2RSOA 2QF7A 3RZOB 2MPMA 1QOHA 2B2UC 1Y8OB 3DUZA 2QCPX 3T16A 1H9MA 3K58A 1BXTA 1Z47A 3FEWX 4A3FB 1F9RA 3Q6SA 3DHQA 3HKZB 4J1MA 4RCNA 3AU7A 5D65A 3A54A 3L7ZC 3J7AF 3FVQA 5IOCA 5JEAH 2A68D 1S5ED 1EIHA 3PO2B 1SNPA 1KTKA 3BDOA 2SDFA 5KYIA 3HG9A 1PFBA 3NE5B 5C44B 4BA2I 1RJTA 1HFNA 3NXWA 2E2IB 3NK9A 3VYRA 1SYEA 5IT9E 1FYCA 1PMRA 4NKLA 1Q12A 2A73B 1PYWD 1E0BA 4A93B 3SXHA 2CVRA 4EVOA 5EKLA 4CKBA 3C1EA 3KLSA 3QO2A 5D3IB 4ZKCB 3S1NB 1F2MA 4OGQC 3OOCA 2IX3A 3Q24A 3DEOA 1XXGA 3NUCA 2XN9C 5COYA 2F3VA 2H1EA 2JP1A 4R8IA 1W6KA 4H44C 3ZYYX 4C3IB 1YNJD 3LWUA 2F0UA 1JQYD 1EQTA 4DXGA 3HZXA 3D6CA 3PO3B 2F0QA 3GTJB 3E5SA 2LKVA 1CK1A 1IW7C 3R3OA 1WTPA 1EEID 3FRPB 5E4WC 1TWAB 4HSVA 1GUNA 3HOWB 1LO5D 5KNDA 1QNKA 3Q23A 1JOOA 5DAUA 5LL6X 1F77A 3M4YA 2B2TA 3HGBA 1TS4A 1DD2A 1J9OA 1ILPA 5C6AA 3TSSA 5CV5A 1PTOB 3BVMA 1JB3A 2HDMA 1ZYRD 1WTOA 4BWGB 2NVYB 3TN2A 1CQFA 1EYDA 5C0XH 5C5MA 4FO2A 3OWFA 1V1PB 3AB9A 3IFDA 3T56B 3HOYB 1PTOD 1O78A 1PTOH 1SJED 3ND9A 1AP0A 3S14B 3SK8A 4BBRB 3RUZA 3V05A 4V0BA 4B9XA 4RHRA 4KJOA 4ZAIA 1TS5A 1SNMA 1SSOA 4DAVA 1KNAA 1ONLA 4EQPA 3T13A 3JAML 1PFMA 4MHEA 1H9RA 2A68C 2HUGA 3IL8A 3L9AX 3CRLC 3IKJA 2B8FA 4QF4A 2RDHA 1WTQA 2K5WA 3OIQA 3NBIA 1ET6A 2XIWA 2OF1A 3GTPB 2KHSA 2L5TA 4AYBB 3U9SA 1NR2A 5EJWA 2JA5B 5C3WA 5JEAG 2MUYA 4F7XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K1B A;  4XDX A;  2FFK B;  1MSH A;  4R9W A;  2FMM A;  1J9O A;  1X32 A;  2MJ8 A;  1ILP A;  1ML0 D;  1IL8 A;  1F2L A;  2L11 A;  3GV3 A;  5D65 A;  1CA6 A;  2RA4 A;  4DN4 M;  3FDT A;  1IKM A;  2J7Z A;  2K28 A;  4IUP A;  4RWS C;  1Q3L A;  2VXW A;  1B3A A;  1G6Z A;  1HRJ A;  4XT1 B;  1F9S A;  3D6W A;  3LWE A;  4HCS A;  1HHV A;  5EPL A;  1M8A A;  2DY7 A;  2Q8T A;  1WTR A;  1XYI A;  1BF4 A;  4LMQ D;  4QUF A;  2IL8 A;  2HDM A;  4HAE A;  1EIH A;  1WTO A;  2MP1 A;  2HCC A;  2K01 A;  1JE4 A;  2Q8R E;  3DEP A;  5JJZ A;  1B53 A;  1IKL A;  1DOL A;  1JIC A;  1ROD A;  2L1B A;  2B2Y C;  4RA8 A;  4CJ2 C;  2SDF A;  1CM9 A;  1U4M A;  3MWY W;  2BDN A;  4ZLT F;  1PFB A;  4QUC A;  3TN2 A;  1WTW A;  2KUM A;  2NWG A;  3KBX A;  3KUP A;  3P7J A;  1WD1 A;  1F9Q A;  2X69 A;  3FPU B;  1PLF A;  1DOK A;  3F2U A;  1WVL A;  1RJT A;  1RTO A;  5EPJ A;  1HFN A;  1PDQ A;  2NYZ D;  4ZKB B;  1CA5 A;  3G7L A;  1DZ1 A;  2B2Y A;  3IFD A;  2X6L A;  1O80 A;  1SAP A;  4X3T A;  5CBE E;  2RVL A;  3MTS A;  4CJ0 B;  3SVM A;  1U4L A;  1VMC A;  1E0B A;  3I91 A;  5EPK A;  1A15 A;  4IUV A;  1AP0 A;  1MGS A;  2CVR A;  1BO0 A;  4NW2 A;  1ZXT A;  4ZK9 B;  3I8Z A;  3I3C A;  1XX8 A;  1RTN A;  4ZAI A;  4X3S A;  1SSO A;  1G2T A;  2KOL A;  2N88 A;  1O7Y A;  1BNZ A;  1TVX A;  2JYO A;  2EPB A;  3QO2 A;  4HED A;  4ZKC B;  1KNA A;  2K05 A;  2HCI A;  1BBX C;  1HFG A;  1MI2 A;  3DM1 A;  2MGS A;  1MSG A;  4UAI A;  2B2V A;  3DEO A;  4X3U A;  5COY A;  4XT3 B;  5DNF A;  1J8I A;  1ILQ A;  1KNE A;  1PFM A;  1QG7 A;  1LV9 A;  2H1E A;  2JP1 A;  2K03 A;  4MHE A;  4OIK A;  2N55 A;  2NZ1 D;  4R8I A;  2B2W C;  2R3Z A;  5EKI A;  2HUG A;  4RAU C;  2FJ2 A;  3IL8 A;  1WTV A;  4U68 A;  1WTX A;  1EL0 A;  3HP3 A;  4O42 A;  2B2U A;  1S4Z A;  2KEE A;  5E4X A;  1NR4 A;  4IUQ A;  2B2V C;  2L4N A;  1RHP A;  2M2L A;  2FHT A;  2FIN B;  5AFW A;  1WTQ A;  4IUR A;  1F9P A;  1QE6 A;  1ESR A;  1G2S A;  4MN3 A;  5EQ0 A;  2KEC A;  2B2W A;  1C8C A;  1U4R A;  3UI2 A;  2L12 A;  3R93 A;  3ONA B;  3H91 A;  5T1I A;  1EQT A;  1B50 A;  1NAP A;  1HA6 A;  2K04 A;  3GV6 A;  2RSO A;  1ICW A;  2RSN A;  1DON A;  5CBA E;  1G91 A;  2MPM A;  2XIW A;  4X3K A;  3I90 A;  1NCV A;  1EIG A;  2B2U C;  1GUW A;  2X6G A;  1O7Z A;  3TZD A;  2HDL A;  1X3P A;  1X3Q A;  1HUN A;  2DY8 A;  2KVM A;  1PFN A;  1U4P A;  5T1G A;  4IUT A;  1VMP A;  1AZQ A;  2B2T C;  2KED A;  1B2T A;  3N52 A;  1WTP A;  1EOT A;  1B4O A;  4OIJ A;  4IUU A;  1WD0 A;  5E4W C;  4CJ1 B;  5D14 A;  1NR2 A;  4HSV A;  2D9U A;  5EJW A;  1QNK A;  1DOM A;  1F9R A;  5CMD A;  3Q6S A;  5COR A;  1SDF A;  1HUM A;  2L9H A;  1AZP A;  2EOT A;  2B2T A;  2EE1 A; 
#chains in the Genus database with same CATH topology
 4XDX A;  3EFX D;  4R9W A;  3KF6 A;  2EY6 A;  3EBE A;  3S1M B;  4PZ6 A;  5ELC A;  3NSW A;  4KD4 A;  2DN8 A;  4HSP A;  4UHV A;  2AKW B;  1WTR A;  1D5M C;  1YNJ C;  2MP1 A;  2KCT A;  2O4X A;  3PV0 A;  4X64 L;  2Z4I A;  5FO9 B;  4CJ2 C;  4EQO A;  4NXN Q;  4QIW B;  3W5O A;  1JR0 D;  2E5L Q;  1S3O A;  1K8O A;  2X69 A;  1II3 A;  3FP9 A;  4DFA A;  1M4V A;  3KLS X;  3S1M H;  3PMF A;  3MTS A;  3TQY A;  1U4L A;  1DM0 B;  2ZT9 C;  3EA6 A;  3I91 A;  4P2C B;  3G71 A;  1A15 A;  4DV7 Q;  1X9N A;  2RCF A;  1BO0 A;  3GQB A;  1ZXT A;  1STN A;  3M85 A;  2N49 A;  3M4Q A;  4X3S A;  2EY5 A;  1G2T A;  1U5K A;  2WKC A;  4HJ8 A;  4YCV A;  1NNX A;  4NXN L;  2SEB D;  1IBM Q;  1EY9 A;  2E5L L;  2R7F A;  3BU2 A;  4UAI A;  5C4Z A;  2K5Q A;  2K5N A;  3L2P A;  2NZH A;  3QWN A;  1DCZ A;  3JAM c;  2KJX A;  3J81 E;  2UUA L;  3IRB A;  4HJ5 A;  2NZ1 D;  3GTK H;  3K5L A;  1O7I A;  3CW2 C;  5G3L D;  3HP3 A;  4JI2 Q;  4A3K G;  2B2U A;  2VL6 A;  2E2J H;  1EIY B;  1QE6 A;  4A3L H;  2NTT A;  1HXY D;  3UI2 A;  1P8L A;  1I94 Q;  3ONA B;  1N9W A;  2MQH A;  4XYQ A;  2F0P A;  5CBA E;  1IBM L;  1RIP A;  1FD7 D;  2YTY A;  1PVO A;  1NY4 A;  1EU3 A;  2RF4 A;  4GN3 B;  1PTO C;  2BOS A;  1ZKO A;  1MJE A;  3UDF A;  4JI6 Q;  2Z6B A;  2UUC L;  3I55 A;  3SR1 A;  1EWC A;  3S17 B;  1KLU D;  1WJJ A;  5KYL A;  2I0Q A;  5IYC H;  4G4K A;  4IFD I;  2LY7 A;  1N34 Q;  1JWS D;  1WD0 A;  4JI2 L;  4A3B B;  1W6J A;  5BR8 Q;  2O2L D;  3CCU A;  4O1N A;  5COR A;  5JPN C;  1AZP A;  1HUM A;  1SFO H;  1I94 L;  1D6E C;  5GAG C;  3E9H A;  5FLX c;  1GOZ A;  4RFB A;  1NBW A;  2IHE A;  4XQN A;  3K7U C;  2RA4 A;  4DN4 M;  1Y8N B;  1X3E A;  3O13 A;  4QMG A;  4R4C A;  4JI8 Q;  2PW5 A;  4JI6 L;  1E1O A;  3S17 H;  2Q8T A;  1EY6 A;  2MO1 A;  1J5E L;  1W2B A;  2RQX A;  4QUF A;  2GN5 A;  4ULL A;  5IWA Q;  1TT2 A;  4V19 0;  3KDF B;  4A3B H;  1A0I A;  1Y69 U;  1N34 L;  1PHJ A;  3A8J E;  4RA8 A;  5M5X H;  3I4N G;  4GN4 B;  1HNZ Q;  2NB0 A;  3BDL A;  1K9M C;  4H0L C;  1D8L A;  1X54 A;  2CCZ A;  1Y14 B;  4JBM A;  4POG A;  2IJ0 A;  4GKJ Q;  5C4J B;  2NN6 H;  2AWO A;  5IYD G;  4MNO A;  3M4P A;  3KLW A;  3SK6 A;  1PTO F;  3HFZ B;  2B2Y A;  4DNR B;  1TS2 A;  4DV5 Q;  3J7A V;  4WJ3 M;  1FNV A;  4JI8 L;  4I7A A;  2UUB Q;  4IUV A;  2AHO B;  3W3A A;  1PH3 A;  3I8Z A;  4JOI C;  5M3M B;  1TS3 A;  1RTN A;  3LGJ A;  3EQL C;  1TVX A;  2XNA C;  1HNZ L;  1ENF A;  4A3I B;  4GKJ L;  3WOF A;  3J7Y W;  2IPK D;  1Q46 A;  2F0V A;  1B9N A;  1EZ6 A;  3FMC A;  1ENA A;  5LMN Q;  4G7H C;  1PH7 A;  3QIA A;  2QGQ A;  2WFW A;  4KKS A;  4A3J B;  4KN4 C;  1BBU A;  1SR3 A;  1QG7 A;  3NWT A;  5ISR A;  3OW7 A;  4DV5 L;  1EY5 A;  4ALP A;  3I4M G;  4DUZ Q;  2D0O A;  2EYF A;  1W3S A;  1I4P A;  3K5M A;  5C3E B;  3HOV G;  5C0X J;  1B9M A;  1QCB D;  3QOL A;  3SK5 A;  1VQ8 A;  5EQ0 A;  1OXV A;  5JAV A;  4KLK A;  4A3I H;  1VQC A;  2A6E C;  4NP5 A;  4BBS G;  5DLQ E;  1YNN D;  3S1R B;  2OTJ A;  5JJL A;  4IPG A;  1C9O A;  4HJA A;  2EY1 A;  4QB4 A;  1STY A;  5IT9 L;  2F52 A;  1VMP A;  1QVG A;  1B2T A;  4DUZ L;  4JI1 Q;  5C3E H;  1CT1 D;  2VQF Q;  4IFD G;  4CBV A;  2P5Z X;  3S2H B;  3D4W A;  1YBY A;  2YTV A;  2PQA B;  3PF4 A;  3QR8 A;  1FNU A;  4K6D A;  4DR1 Q;  1EWH A;  2EY2 A;  1L1O B;  1QB5 D;  4JI0 L;  1QJO A;  3S1R H;  3P75 A;  4DF7 A;  4HR7 B;  4OX9 Q;  2L11 A;  5GAE C;  1R9T B;  2A74 C;  2MNA A;  2VW9 A;  3ER0 A;  5DM6 3;  3E3X A;  3A8I E;  5FKA C;  3C1F A;  1RL2 A;  5IP9 G;  1STG A;  3GTQ B;  5E3F A;  2EJM A;  4JI1 L;  4B3R Q;  2E2H B;  3RNU A;  3S2H H;  3DEP A;  2VQF L;  1B53 A;  4A75 A;  3K57 A;  4ODG A;  3KF8 B;  5E1F A;  3J80 L;  1YJW A;  4Y7N H;  4J8Q A;  1S5C D;  1SBB B;  3CCR A;  5CGK A;  2NYZ D;  1LTL A;  4AQY Q;  4OX9 L;  1D5X C;  3VA7 A;  1V9P A;  1V8Q A;  4AIM A;  5CBE E;  2EVB A;  3TBI B;  3ERS X;  3UDX A;  1HTP A;  4OL7 A;  2ATW A;  4ZK9 B;  4IPC A;  1U9R A;  2CH4 W;  3V2T A;  5FO7 B;  2JEA I;  1JE5 A;  3GTQ H;  2E2H H;  1QUQ A;  3NPP A;  4X62 Q;  4B3R L;  2HIV A;  2N88 A;  3A5Z B;  1YHQ A;  1N8R C;  1BBX C;  3I7F A;  1A3T A;  4IJL A;  2R92 H;  2C9O A;  4A3L G;  4X3U A;  1YZ6 A;  5IOD A;  3CP0 A;  3CXC A;  1TQO A;  4K2L A;  2R93 B;  5G3L F;  4P75 A;  1TWF H;  3KOJ A;  4ZCK A;  3K81 C;  2BA0 A;  5EKI A;  4G7Z C;  1QIL A;  1WTX A;  4K8J A;  3MFY A;  5FOB B;  5FO8 B;  1VQL A;  2RKS A;  2O5J C;  2L4N A;  2NBF A;  2FHT A;  1Q82 C;  5IYC G;  4X62 L;  2L12 A;  2E76 C;  5T1I A;  4RH6 A;  4JI5 L;  1BR9 A;  5C4X B;  5C4H A;  4CDF C;  4LNQ A;  1CZW A;  3AMU A;  4ZYS A;  2R93 H;  1PH8 A;  4C3J B;  3CAM A;  1F2Z A;  2F0N A;  2R7Z B;  1U4P A;  5BN5 A;  2R61 A;  1Q90 A;  1PZJ D;  4A3G G;  5HGQ A;  2EIF A;  5IT9 c;  3OTO Q;  1E7Z A;  3E6Z X;  1K8M A;  5I6W A;  1HZA A;  2I07 B;  4K6L A;  1KAB A;  1H9S B;  3OIP A;  4DAP A;  2PNH A;  5ELF A;  3OPO A;  3CCL A;  3RLO A;  1OXX K;  4F8M A;  2DGY A;  5C4X H;  2H5X A;  2EE1 A;  1VQ7 A;  4DR5 Q;  1G91 A;  4UP8 A;  1STA A;  2NVT H;  4C3J H;  2K28 A;  1YIJ A;  1GJX A;  1LT6 D;  2R7Z H;  3S15 B;  1F9S A;  1GHK A;  4C2M B;  4G57 A;  2WB1 B;  1S5D D;  1I6H H;  1XYI A;  3Q0A A;  1EEF D;  4YCU A;  2OTL A;  5IIF A;  4XIG S;  2F0T A;  4DU9 A;  2YU9 H;  1TY2 A;  2SNS A;  2WAQ G;  4EQN A;  2VQE Q;  1L0X B;  3BDC A;  4JW0 A;  3HOZ B;  1YNN C;  3KBX A;  3F2C A;  4JV5 Q;  4OEL B;  1DOK A;  2BCO A;  5CC4 A;  2ZJQ A;  4B3T Q;  1PDQ A;  4M1U B;  4EX5 A;  5A2Q E;  4I7Z C;  2KQ3 A;  3S16 B;  4MZ9 A;  4DR5 L;  4B3M Q;  1E2Z A;  4C2M H;  1QWY A;  4CJ0 B;  1E24 A;  1R4Q B;  1WCM B;  4KTA A;  1EOV A;  3K8A A;  5DM7 3;  4A3D B;  1MBY A;  4C3H B;  3ERO A;  1VQ6 A;  4LF7 Q;  4C1N K;  4PQX A;  1B44 D;  4KKU A;  4TKO B;  4M8A A;  3HOZ H;  2RHQ B;  5IGC A;  2SNM A;  3I2Z A;  1SNC A;  4JV5 L;  4LWC A;  4LAA A;  3S16 H;  3MXN B;  1S5F D;  1NMG A;  3MXU A;  2N55 A;  4B3M L;  3BVG A;  1L0W A;  1WCM H;  2QW7 A;  2FJ2 A;  2JE6 I;  1Q8I A;  3CCV A;  3NP8 A;  4FXD A;  3M7G A;  1NR4 A;  1BDO A;  4JBJ A;  3PO2 H;  2LSS A;  1G2S A;  4MN3 A;  1L1O C;  1AN8 A;  2I5L X;  4LF7 L;  3H91 A;  2FMC A;  1HJP A;  1UEB A;  4ILW A;  4GZY C;  3CPW A;  1XNQ Q;  2Z6K C;  4MIU A;  3BS1 A;  2ASB A;  1RD9 D;  3URY A;  1V1P A;  2CWA A;  4PZ7 A;  3T1Y Q;  1AZQ A;  2E75 C;  3ULL A;  1BOS A;  1BCP B;  1EOT A;  3MA2 B;  4J15 A;  2K7V A;  3H0G B;  2VB2 X;  1UNS A;  1I3Q B;  4XTC S;  3PQI A;  4DGZ A;  1FGU A;  1H9J A;  3K0X A;  1TXY A;  3MEF A;  5I9O A;  3H09 A;  5CR3 A;  4K5W A;  5NUC A;  3PSI A;  1FGB D;  1IL8 A;  1ML0 D;  1VF7 A;  1FJG Q;  1XNQ L;  1B1Z A;  2EJF C;  1GO3 E;  3W2D A;  1D5Z C;  3CC4 A;  2XVS A;  3J81 L;  1BCP D;  1A62 A;  3J7A 5;  2BDO A;  2F4V Q;  2IL8 A;  1SE3 A;  2PZT A;  3E0J A;  4L5R C;  2VY3 A;  3H0G H;  2K01 A;  2CKZ B;  1X55 A;  4R1J A;  1HNW Q;  1PZI D;  4UPA A;  4APV A;  3PO3 H;  1I50 B;  2OWO A;  3GTJ H;  2JJQ A;  4N8X 1;  2K50 A;  1CA5 A;  2XTI A;  4JBK A;  1SE2 A;  2BE5 C;  1A2U A;  1I4G A;  4DV4 L;  4A3C H;  2E2D C;  2TSS A;  2A19 A;  3NTI A;  3J80 i;  2C35 B;  1O80 A;  1GVP A;  3D3R A;  2YTX A;  1SN8 A;  2F0L A;  2RVL A;  4DV3 Q;  3ZJY C;  2R92 G;  1K8A C;  4LF6 L;  1SXT A;  1ZEQ X;  4LUO A;  1DJR D;  1VQB A;  1AH9 A;  1CZG A;  1VQP A;  3CRK C;  4DR4 Q;  2EYP A;  2D0P A;  1GUG A;  5K36 H;  1TWA H;  3HOW H;  3WDN A;  1KC8 C;  4KY5 A;  2EYM A;  2A6H C;  5GRO A;  1KAA A;  1HNW L;  1I50 H;  1MSG A;  4YIJ A;  1PXU A;  3FKI G;  4BY1 B;  2PZW A;  3KLR A;  1FNW A;  2RCN A;  4KMU C;  2F1M A;  2B2W C;  2ICI A;  4DV3 L;  2K5D A;  1IBL L;  2ALY B;  3TME A;  1KRS A;  3A8K E;  2F3I A;  4GNX C;  3C46 A;  1JMC A;  4GLX A;  4DR4 L;  2Z9H A;  3I70 A;  4L5T A;  1FR3 A;  1TWG B;  4LW1 A;  3QG1 A;  1HZB A;  2NVY H;  5CV6 A;  1EY0 A;  4RGM A;  2OXP A;  5D3D A;  1Y8P B;  3G6J B;  1LTI D;  4BY1 H;  2Y0S G;  1JJC B;  3MFG A;  4DAY B;  5JVH 3;  4YCW A;  1VQN A;  3RLF A;  2AUK A;  4DV6 Q;  3GTM B;  4RGT A;  1LTR D;  1SRU A;  1V43 A;  1TWG H;  2XSC A;  2Y0S E;  1SDF A;  1PH4 A;  3R8B A;  3SGI A;  1R4P B;  2K4K A;  2K1B A;  1AFP A;  4X66 L;  3Q22 A;  2MJ8 A;  3DWA A;  1JC7 A;  1XJV A;  5EBD A;  4ME3 A;  3FDT A;  2J7Z A;  2XRQ D;  4RWS C;  2BA1 A;  3KJP A;  5FLM G;  1SYG A;  3GTM H;  4EGV A;  3J81 c;  5M3F B;  4PG3 A;  1U0L A;  1Y1W B;  4CHT B;  2K32 A;  3MWY W;  4DR2 L;  5FLX L;  4A3M B;  1WD1 A;  1IZ6 A;  5LL6 S;  4A3F G;  4OEM B;  1Z7T A;  1DZ1 A;  3HKZ G;  5C0X I;  2ZXR A;  3QJY A;  1KDB A;  1LT3 D;  1SYF A;  1SNO A;  1KDA A;  3GTP H;  1IXR A;  4F87 A;  1QZH A;  5M3F H;  1CKN B;  4JBW A;  2K75 A;  1C48 A;  2EYJ A;  1JOQ A;  2WKD A;  4DV2 Q;  3MVV A;  4GLV B;  2JA5 H;  2WAC A;  3TS2 A;  2EYH A;  1E1T A;  3DM1 A;  3DWQ A;  3HEJ A;  4A3M H;  1VQK A;  3OW2 A;  3PO2 G;  2Z8L A;  2B63 B;  2TMP A;  2A6E D;  4KHV A;  1IYU A;  2UUA Q;  1T5E A;  2K6A A;  2CW0 D;  3PIO A;  4E6I A;  1OO9 B;  5C44 G;  3M3Y B;  1BCP C;  5ELD A;  1PRT C;  2RDG A;  3A56 A;  4R4O A;  4ZUJ A;  4C1N I;  1KXL A;  4OO1 H;  1QVF A;  5A35 A;  1HTL D;  4A93 G;  2L55 A;  4DV2 L;  2KCN A;  2K33 A;  4GKK L;  2V4D A;  3V96 A;  3VYS A;  3GDE A;  1HA6 A;  1LTS D;  3GV6 A;  4BA1 I;  1ICW A;  4LJZ C;  5GQO A;  2VS1 A;  2B63 H;  2F0W A;  1NCV A;  2GVA A;  3MAQ A;  2F0H A;  4BS9 A;  2UUC Q;  3M3Y H;  5H1S E;  2KVM A;  2F0M A;  1BUV T;  4A3E B;  1EYG A;  3NTH A;  1K8G A;  3UDI A;  3M7N A;  4C3I G;  3D31 A;  4DR6 Q;  1EY8 A;  1KIX A;  4BY7 B;  1QVC A;  2Z0S A;  2OT2 A;  3CME A;  3EJI A;  3H6M A;  4ID6 A;  2IX1 A;  3PO3 G;  2VXW A;  2CQO A;  1BCP F;  1VQE A;  4A3E H;  1BF4 A;  1J5E Q;  4A3C G;  3PF5 A;  4LMQ D;  1C4Q A;  1O7L A;  2JA7 B;  1VQJ A;  1DOL A;  1ROD A;  3KF6 B;  1STB A;  2B3G A;  1WTW A;  4BY7 H;  1WVL A;  4DR6 L;  4GOP B;  4BXX H;  3HOW G;  3D8G A;  3L3O C;  3MXP A;  3L0O A;  2DJF C;  2VNU D;  5C0X G;  5IP7 H;  4KY7 A;  1HPC A;  3NHH A;  1MGS A;  2GVB A;  4Z9C B;  1A63 A;  1GUT A;  1WOC A;  4IUN A;  1XX8 A;  4HID A;  1Y1V B;  2LXJ A;  1NSN S;  4RKB A;  1O7Y A;  2VB3 X;  3M4O B;  3NBH B;  2E74 C;  3GTG B;  1IL2 A;  4XQJ A;  2MO0 A;  1IYJ B;  4UDU C;  2I46 A;  1CSP A;  1L1O A;  3PIP A;  2D2C C;  1KNE A;  3HOX B;  1KRT A;  1VQF A;  4KN7 C;  1LYL A;  1YHA A;  1YVC A;  2Z6K A;  4DV1 Q;  1CI3 M;  1S4Z A;  3HOY G;  1RHP A;  2M2L A;  5AFW A;  1Y1V H;  3HOU B;  1AW7 A;  3M4O H;  4RGO S;  1A3U A;  1JOR A;  4BBR G;  4H7B A;  5C4J H;  3E9I A;  4HIK A;  1SMX A;  1JCK B;  3D0F A;  3KF8 A;  3TRE A;  2QA4 A;  3AQQ A;  5ELN A;  3I90 A;  4DV0 Q;  3HRZ C;  4IO9 A;  2JA8 B;  3S9W A;  3HOX H;  2HDL A;  5IGB A;  4LF8 Q;  2LS0 1;  2KCC A;  2IT1 A;  4YWM A;  2B2T C;  2J0T D;  4UP7 A;  3N52 A;  2F0F A;  5EAY A;  5KIX A;  3JAM i;  4DV1 L;  2AQ3 B;  2B29 A;  4KY6 A;  3HOU H;  4K2K A;  1SYD A;  5D14 A;  5M3M H;  5JJI A;  3CKI B;  5CMD A;  2HHH Q;  4JI0 Q;  4F88 A;  2F0G A;  3G6E A;  2FMM A;  1X32 A;  2CW0 C;  1CA6 A;  4A3J H;  4DV0 L;  1KLG D;  3GTL B;  1HRJ A;  2PO4 A;  1YIT A;  1YJ9 A;  1I4R A;  4LF8 L;  3AYH B;  4R8N A;  2EXZ A;  1BQQ T;  3A74 A;  1ET9 A;  5FJ8 H;  2QIL A;  3E0E A;  5JJZ A;  1JIC A;  2L1B A;  2BH8 A;  3OHX C;  2VUM B;  1SE8 A;  1CM9 A;  2EYO A;  4FXG C;  1MHW C;  5EKK A;  3VYT A;  3JC6 6;  4AYB G;  2HHH L;  2KHJ A;  2XGT A;  1A3V A;  2JA5 G;  2XWB B;  2NN6 I;  3K59 A;  4I65 A;  4QL5 A;  4X3T A;  3OSO A;  2UXC Q;  1I4H A;  1LT5 D;  3CCS A;  1LTT D;  1K28 A;  4S3S A;  4GLA C;  1G8Z D;  2VUM H;  4B9W A;  2ES2 A;  4HJ7 A;  2HCI A;  2EZV A;  1LAB A;  1H9S A;  2E8G A;  4ZRZ A;  2RHS B;  3IFT A;  1UEA B;  4B3S Q;  4WFN 3;  4XT3 B;  1Q1B A;  2LFN A;  4RGN A;  3QB3 A;  1R9T H;  2L0C A;  2UXC L;  3CF5 A;  1C7Y A;  1WTV A;  4RMF A;  1EY4 A;  2JXM B;  1CFM A;  4O42 A;  3U58 A;  2Q2I A;  1K0R A;  3WOE A;  2UU9 Q;  4L6T B;  1BBW A;  1KHI A;  1F9P A;  1UWV A;  1RDP D;  2AMC B;  3W1G A;  3KFU A;  4N9P A;  2PCF B;  3R93 A;  3HKS A;  4KI0 A;  4JI5 Q;  2IHF A;  1V1Q A;  1DON A;  2ID0 A;  3TP6 A;  3WWV A;  1J6Q A;  4B3S L;  3CHB D;  4NXM L;  1O7Z A;  1X3P A;  2DY8 A;  5T1G A;  2R6G A;  4A4I A;  3R2T A;  1Q1E A;  3EN2 A;  2QEX A;  1B4O A;  4CDC C;  1EFW A;  2UU9 L;  4LF4 Q;  2D9U A;  2IWH A;  3F2B A;  5I4D A;  4GOP C;  1LTG D;  1SYC A;  4OHJ A;  3T1H Q;  3T4A C;  4HMJ A;  1SLJ A;  3F2D A;  2BE5 D;  2YYZ A;  4XT1 B;  1ASY A;  4HCS A;  3MXN A;  1M8A A;  3MC0 B;  2XRS D;  4FYD A;  2C5C A;  1Z9F A;  4L63 B;  1ASZ A;  3K5O A;  2JA6 B;  5IP7 G;  2Y0S B;  4LF4 L;  3RZD B;  4GNX B;  1VQ5 A;  5TSS A;  4ZQ3 A;  2IW3 A;  4A3B G;  2B39 A;  1IYV A;  2EXD A;  4LK1 C;  2AQ1 B;  2B8G A;  5EPJ A;  3T1H L;  2A6H D;  4ZKB B;  3A5U A;  3HS0 C;  3CCQ A;  1E3P A;  1HH2 P;  4ZUI A;  5IYB H;  3DMU A;  2NN6 G;  1CTM A;  2LXK A;  1D7Q A;  4LF5 L;  4DK1 A;  1PH2 A;  3RLN A;  1DXM A;  2OCE A;  3PUW A;  3BZC A;  2OQ0 A;  3I3C A;  2JA6 H;  4R4Q A;  5J39 A;  5M5W B;  3RZD H;  2EPB A;  1LAC A;  4KHZ A;  2PI2 A;  1A6X A;  4R4I A;  3ND8 A;  4DK6 C;  2MGS A;  4QQB X;  3S2D B;  1K83 B;  3PIO 3;  2DNE A;  1D1K A;  1B7Y B;  4OWW B;  2HD3 A;  5DNF A;  2F0J A;  1G51 A;  3S15 H;  3VR4 A;  1QUQ B;  4U68 A;  3DWP A;  5BN3 A;  2WAQ E;  4N8F A;  3BVZ A;  5E4X A;  2B2V C;  4JPB W;  3VDY A;  1DGS A;  3KBG A;  3A7A B;  3K80 C;  1B70 B;  1I5F A;  1GHJ A;  1NAP A;  2EYL A;  5M3M G;  1K83 H;  4RG1 A;  2RSN A;  3X3N A;  3CC2 A;  1IHZ A;  2PMZ E;  1EQQ A;  2X6G A;  4IN3 A;  4A3I G;  2CQA A;  1UAP A;  4POF A;  1X3Q A;  2PW7 A;  1HUN A;  2G9H D;  3CQZ B;  4K0K Q;  5I2X A;  4O0A A;  4IOC A;  1Q81 C;  3R2I A;  4A3J G;  2F0D A;  4B08 A;  1STH A;  4OIJ A;  4IUU A;  4A3D H;  1A8V A;  4C3H H;  4KKT A;  4MTN A;  1NJI C;  1DOM A;  1DYQ A;  2ICE C;  4FF4 A;  2L9H A;  5C3E G;  5JPM C;  5FJ8 G;  2F0O A;  4K8I A;  4A76 A;  1LLR D;  2QDL A;  4IUP A;  2G5D A;  4TQU S;  2AQ2 B;  3BZK A;  2CH4 A;  4PNY A;  3CQZ H;  3RR5 A;  1SMY D;  3MXG A;  4K0K L;  1K3B C;  1TII D;  1JE4 A;  1PRT B;  2B2Y C;  3CCM A;  1U4M A;  1EIF A;  4FNF A;  2F0E A;  2ZXP A;  3KUP A;  3P7J A;  1TY0 A;  3F2U A;  2J4X A;  4C56 C;  4DV4 Q;  4A3K B;  3G48 A;  4FF3 A;  4RCO A;  4LF6 Q;  4H13 C;  5EPK A;  2RDF A;  4DAY A;  4OXP A;  5FK9 C;  4NW2 A;  2PPB C;  3J80 E;  1TU2 B;  1PRT D;  4WJ4 A;  1I3Q H;  2GA4 B;  1FVI A;  2JYO A;  4HED A;  4CDD C;  3U50 C;  3PIP 3;  4XYO A;  4H02 A;  2O5I C;  4JOI A;  5M5Y B;  4JC0 A;  4HIO A;  3BG3 A;  5IY0 A;  3N6R A;  4DKA C;  4A3K H;  5EBC A;  4OIK A;  1YNX A;  2A69 D;  4MTK A;  5J1Z A;  2Z4H A;  4P72 A;  1IBL Q;  2KA7 A;  2KEE A;  1HQR D;  1SEB D;  3A0J A;  4DR7 L;  3CPF A;  5JJK A;  2WV6 D;  2WII B;  1LTB D;  1ESR A;  1C8C A;  4KK7 A;  1U4R A;  4KD3 A;  1NMF A;  3PUY A;  5CYU A;  4WOR A;  1CHP D;  3MEH A;  3NTK A;  5CV9 A;  5IE8 A;  3NEN A;  5JVG 3;  3STB D;  1NUC A;  3RN2 A;  4DNI A;  1D2B A;  4R4T A;  3TZD A;  1F2Y A;  4PV1 C;  4JI4 L;  2PNR C;  5DEH A;  3I4N B;  4IUT A;  5JOB A;  2R93 G;  2H4O A;  2M9V A;  3NQT A;  1CKN A;  1KD1 C;  3ULP A;  1Z6H A;  1E2W A;  1XPU A;  3DM3 A;  2ZJP A;  2PZU A;  4X66 Q;  2BH2 A;  3I4O A;  2FFK B;  1KAW A;  3TP8 A;  1F2L A;  2MFI A;  1TWC B;  1I4Q A;  1Q3L A;  3T51 B;  5C4X G;  4RHS A;  3D6W A;  3BYT B;  1VQD A;  4JVZ A;  1LUZ A;  5IGF A;  5IYB G;  1S40 A;  4C3J G;  2R7Z G;  2UXD Q;  4KHP Q;  2QEJ C;  1XPO A;  5C3X A;  5IYD H;  5M9O A;  4DR2 Q;  1HZC A;  2PQE A;  2NWG A;  1RCV D;  3VR3 A;  1F9Q A;  2A5H A;  4TSS A;  1LT4 D;  4FP5 D;  3I4M B;  1PA6 A;  1GKH A;  3X3M A;  3HOV B;  3P20 A;  3MHB A;  4OON A;  5I6Y A;  4BBS B;  1KQS A;  2WB1 G;  5CV4 A;  4KHP L;  1CUK A;  2UXD L;  1T9H A;  1SND A;  3FPP A;  1VS0 A;  3EVQ A;  4K5V A;  1AEX A;  1IBK Q;  3I4M H;  2XWJ B;  1J8I A;  3HOZ G;  1NE3 A;  1EQV A;  5I2Y A;  3HOV H;  4FXK C;  4P74 A;  1SMY C;  5ELE A;  3KK7 A;  1OXT A;  1YJN A;  3GP7 A;  3K5N A;  5HUR A;  1OXS C;  1GD7 A;  1XWE A;  4BBS H;  2FIN B;  4IUR A;  1WCM G;  1YI2 A;  1Y1W H;  3D4D A;  3IAY A;  1HA5 A;  1PH1 A;  4GKK Q;  4J6H A;  4A3D G;  3HKZ E;  4C3H G;  1BKB A;  1SE4 A;  2NUC A;  5EGT A;  1IBK L;  4X3K A;  2PYK A;  1EIG A;  4GOP A;  4JI3 Q;  1MIU A;  3NQI A;  4IFD H;  1PFN A;  1TKW B;  3QOJ A;  4ABN A;  2NTS A;  1B3Q A;  1PH6 A;  2HIX A;  1PYB A;  1VQI A;  3ERQ A;  1AE3 A;  4CJ1 B;  4JI7 Q;  4L5Q A;  4K14 A;  3KDF A;  1EZ8 A;  2NVX B;  1EU4 A;  4PMW A;  1K73 C;  1UE7 A;  1X3F A;  1A2T A;  1S5B D;  1P16 A;  3NBH A;  1MSH A;  5CV7 A;  1VQH A;  2UXB Q;  4TRD A;  1T5X D;  4UP9 A;  3T53 B;  5IP9 H;  2A69 C;  3K7A B;  1B3A A;  4L8J A;  2JEB I;  4JI3 L;  3GTK B;  4QCL A;  3C3L A;  4WJW A;  2CHB D;  1HHV A;  3H3V C;  2EJG C;  1C0A A;  5LMU Q;  2RBM A;  2E2J B;  1KL9 A;  4RKL A;  2HQL A;  1G29 1;  2KCM A;  2Q8R E;  1CHQ D;  1JJG A;  4JI7 L;  4G7O C;  1I4X A;  2BDN A;  3CC7 A;  2NVX H;  3VYU A;  1BVS A;  3STB C;  3H0G G;  5JEA J;  3FPU B;  1WYD A;  3GTO B;  2UXB L;  1N32 Q;  5KRU A;  1STE A;  4U67 3;  3CD6 A;  3K7A H;  4P71 A;  3J81 j;  2MHV A;  2KHI A;  3SVM A;  3VR5 A;  3SEB A;  4DV7 L;  1ZYR C;  1EWI A;  1PRT F;  1X3G A;  1VDZ A;  5KNB A;  3VR2 A;  3W1B A;  5LMU L;  3DXJ C;  1Q8K A;  2PI2 E;  3C2P A;  4CKE A;  1SFO B;  2K05 A;  1S72 A;  3J81 i;  1MI2 A;  1VF5 C;  2B2V A;  3GTO H;  5K36 G;  4A3G B;  5IGG A;  4YWK A;  2L15 A;  1ILQ A;  1N32 L;  3PUZ A;  2D5D A;  2R3Z A;  3U4V A;  3K6O A;  4Q5V A;  1YEZ A;  1H95 A;  4CKC A;  1WI5 A;  4TVA B;  3LX0 A;  2JA7 H;  2CFM A;  5M5X B;  1GUS A;  2WP8 J;  5K5P A;  2A1A A;  1JWM D;  4IZ8 A;  3UE0 A;  5BN4 A;  4OO1 I;  4LFB Q;  2K04 A;  2PQA A;  2ENB A;  2AWN A;  3TEH B;  4A3G H;  1SYB A;  4DK0 A;  1L2F A;  2K5V A;  1GUW A;  2IY5 B;  3K0Y A;  5IGE A;  1XPR A;  1PFS A;  4YHH Q;  4DAM A;  4BY1 G;  3A7L A;  1X56 A;  2WAQ B;  5KEE A;  2KED A;  3BZD B;  1JOK A;  4DPG A;  3TDQ A;  5BR8 L;  5IGD A;  5ELO A;  4DK3 C;  4PMC A;  3JAM E;  4LFB L;  3GTG H;  3S1Q B;  3H94 A;  1GUO A;  2PMZ B;  4X65 Q;  3GV3 A;  3I72 A;  3AFQ A;  4PMB A;  4FF2 A;  1HCZ A;  3RMH A;  1EY7 A;  2JSO A;  3LWE A;  2DNC A;  1I6V C;  2F4I A;  5EPL A;  2DY7 A;  5A2Q L;  1H9K A;  5ELB A;  3NWS A;  4YHH L;  3D4R A;  1RKN A;  5IWA L;  2YV5 A;  1SNQ A;  1EYC A;  3SHL A;  2HCC A;  3PUX A;  4GS3 A;  1IKL A;  4X6A H;  4CGY B;  2QKI C;  1YHB A;  1XTC D;  4HCE A;  4ZLT F;  4QUC A;  1JJ2 A;  2NVQ B;  2KUM A;  1TWH B;  5KGU A;  3S1Q H;  2KBN A;  3NEM A;  1RTO A;  1G6P A;  4X65 L;  3P1H A;  2JA8 H;  1HR0 W;  1VMC A;  4JG2 A;  2UUB L;  4DXF A;  2ZXO A;  3SE0 A;  1OXU A;  5C5L A;  4N9T A;  2NZO A;  2Z1C A;  4HTH A;  5FLX E;  2AUJ D;  4JK1 C;  5M3F G;  3I73 A;  2NVQ H;  1TWH H;  1HFG A;  2R7D A;  1HZ9 A;  1LTA D;  1SJH D;  3RD4 A;  1Y1W G;  4IJH A;  4XXE A;  5LMN L;  4FDB A;  5KNC A;  1JWU D;  1VQO A;  2K03 A;  4NDX A;  4FVM A;  4A3M G;  3GTL H;  1PYS B;  1TR5 A;  1PH9 A;  4WRD A;  4DA2 A;  5GAH C;  4AYB E;  3AEV A;  4IUQ A;  1CQV A;  2G9D A;  2A8V A;  2B2W A;  4Q0F A;  3EIV A;  3MZ5 A;  4HMI A;  5F2D A;  4Y7N B;  1VCI A;  2EDG A;  1B50 A;  3G4S A;  4OO1 G;  2K5H A;  4GNX A;  2QDB A;  4JCV E;  1LM0 A;  4NXM Q;  5LHY 1;  1UUP A;  3ITP A;  1D1I A;  2B63 G;  3PCO B;  3OMC A;  3CU7 A;  3Q8D A;  3I4L A;  2F03 A;  4DR3 Q;  1KDC A;  4FF1 A;  3TS0 A;  1EUJ A;  3PUV A;  4QJF A;  3DLL A;  1PZK D;  2ZTE A;  4QIW E;  2EOT A;  4DR1 L;  2SOB A;  4L5S A;  2R92 B;  3LNN A;  3OWE B;  4KV6 A;  2M00 A;  1EL0 A;  5HGT A;  4LFA Q;  1IKM A;  3GO5 A;  4DNT B;  4NPS A;  2F0K A;  1EQR A;  2HQE A;  1G6Z A;  1TWF B;  3SK4 A;  1N33 Q;  1UE5 A;  2DUD A;  2D62 A;  3OMG A;  2FXQ A;  2LMC B;  1RF2 D;  4HAE A;  4LUZ A;  1AE2 A;  4OWT B;  2JA9 A;  4IPH A;  4NMZ A;  4DR3 L;  4IOA A;  2K14 A;  1X65 A;  2IX0 A;  3FKI B;  4A3E G;  4KJN A;  4Y52 H;  3GD7 A;  1HNX Q;  5I9P A;  4IFD J;  3BJU A;  4O2D A;  2JK8 A;  1PLF A;  3PGZ A;  3TP5 A;  3SDZ A;  1GXD C;  1E2V A;  3VR6 A;  3G7L A;  3A55 A;  1MD2 D;  3TP7 A;  4AQY L;  2X6L A;  5J22 A;  1SAP A;  1IW7 D;  1V1O A;  4LFA L;  4CDE C;  4BY7 G;  3BYY B;  4BXX G;  2Q2T A;  3I56 A;  4LF5 Q;  1N33 L;  4IAL A;  1M1K C;  3U9O A;  1PH5 A;  2KOL A;  3FKI H;  1VQ9 A;  1BNZ A;  1EFI D;  1Q7Y C;  4XQQ A;  4K5X A;  2OEO A;  2Q8I B;  1HNX L;  2JA7 G;  3KYH C;  1UE1 A;  2NVT B;  1LV9 A;  2F3W A;  1EYA A;  1VQM A;  1ENC A;  2F0S A;  1I6H B;  4RAU C;  5CV8 A;  1L0Y B;  3TZU A;  4ME5 A;  4LUV A;  1XNR Q;  1JB7 A;  1WFQ A;  4IPD A;  2F0I A;  2Q2H A;  2ZTD A;  1HQM C;  4HN7 A;  2YU9 B;  1QNU A;  2KEC A;  1ESF A;  5E7N A;  4IQZ A;  2WIN B;  3VA5 A;  2RSO A;  1Y1V G;  2QF7 A;  3RZO B;  2MPM A;  2N8N A;  1QOH A;  2B2U C;  1Y8O B;  3DUZ A;  2QCP X;  3T16 A;  2HT1 A;  1H9M A;  4P73 A;  3K58 A;  2ZJR A;  1PV4 A;  1BXT A;  5J3B A;  1XMQ Q;  3CCE A;  4JYA Q;  1MKH A;  1Z47 A;  3FEW X;  3OTO L;  3HOX G;  1XNR L;  4A3F B;  2EQS A;  2Q2U A;  1E22 A;  1F9R A;  5M5W H;  3Q6S A;  3J80 c;  4PZ8 A;  3DHQ A;  3HKZ B;  5FLM H;  4J1M A;  4RCN A;  3RN5 A;  3HOU G;  3RZO H;  3AU7 A;  3S2D H;  5D65 A;  4UY8 C;  3A54 A;  2V1C C;  3L7Z C;  3ULJ A;  3J7A F;  3FVQ A;  5IOC A;  5JEA H;  1XMQ L;  2A68 D;  1S5E D;  4JYA L;  2JA8 G;  1EIH A;  1FL0 A;  1M90 C;  4A3F H;  1SNP A;  3PO2 B;  1KTK A;  3BDO A;  2SDF A;  5GAD C;  4QGU A;  5KYI A;  2VQE L;  3HG9 A;  1PFB A;  4LF9 Q;  2I5M X;  3NE5 B;  5C44 B;  4BA2 I;  1RJT A;  1HFN A;  3NXW A;  2E2I B;  4B3T L;  3NK9 A;  3VYR A;  1SYE A;  5IT9 E;  3FHW A;  1FYC A;  1PMR A;  4NKL A;  1Q12 A;  2A73 B;  1PYW D;  1E0B A;  4A93 B;  2CWP A;  3SXH A;  2CVR A;  4HIM A;  4EVO A;  2DJG C;  5EKL A;  4CKB A;  3F1Z A;  1CKO A;  3C1E A;  3KLS A;  3QO2 A;  5D3I B;  4ZKC B;  3S1N B;  1F2M A;  4OGQ C;  3U4Z A;  3OOC A;  2IX3 A;  2JQO A;  5C44 H;  1HR0 Q;  4LF9 L;  3Q24 A;  3DEO A;  1XXG A;  2E2I H;  3NUC A;  2XN9 C;  5COY A;  2F3V A;  2VUM G;  4GN5 A;  2H1E A;  2JP1 A;  4R8I A;  1W6K A;  2K52 A;  4H44 C;  4NB3 A;  1VQ4 A;  4A93 H;  4AH6 A;  4YWL A;  3ZYY X;  4C3I B;  1YNJ D;  4DR7 Q;  1Q86 C;  3LWU A;  3NEL A;  3TRZ A;  1ICF B;  2F0U A;  1JQY D;  3S1N H;  1EQT A;  4DXG A;  3HZX A;  3D6C A;  3J7Z C;  3PO3 B;  2F0Q A;  3GTJ B;  3E5S A;  2LKV A;  1HR0 L;  1CK1 A;  1IW7 C;  2KEN A;  5L37 A;  4JI4 Q;  3R3O A;  4C3I H;  3T1Y L;  4EQ5 A;  1WTP A;  1EEI D;  3OYY A;  1N36 Q;  1JT8 A;  3FRP B;  5AJ3 Q;  3M9B A;  3H3V H;  5E4W C;  1TWA B;  4HSV A;  1GUN A;  3HOW B;  1SRO A;  1LO5 D;  4OWX B;  5KND A;  1QNK A;  3Q23 A;  1JOO A;  5DAU A;  5LL6 X;  1F77 A;  1K3R A;  3M4Y A;  4QY7 A;  2B2T A;  3AFP A;  3HGB A;  1TS4 A;  1DD2 A;  3CCJ A;  1J9O A;  1ILP A;  1X6O A;  5M5Y H;  1FJG L;  5C6A A;  3TSS A;  5CV5 A;  3H15 A;  3ICE A;  1XTD A;  1PTO B;  3BVM A;  1JB3 A;  2HDM A;  2F4V L;  4LFC Q;  3B6Y A;  1ZYR D;  1WTO A;  1N36 L;  4BWG B;  5AJ3 L;  4DUY Q;  4HJ9 A;  1UE6 A;  2OQK A;  2NVY B;  3TN2 A;  1CQF A;  2JN4 A;  1EYD A;  5C0X H;  5C5M A;  4FO2 A;  1B8A A;  3OWF A;  1K0S A;  1V1P B;  3AB9 A;  3IFD A;  3T56 B;  3HOY B;  1PTO D;  3CMA A;  5HY6 A;  1O78 A;  5LMN W;  1PTO H;  1SJE D;  3ND9 A;  1AP0 A;  3I4N H;  3S14 B;  3SK8 A;  1XMO Q;  4BBR B;  3RUZ A;  3V05 A;  4V0B A;  4B9X A;  4LFC L;  1MJC A;  4RHR A;  4KJO A;  4ZAI A;  1TS5 A;  1SNM A;  1SSO A;  4DAV A;  4DUY L;  1QZG A;  1KNA A;  2ZM6 Q;  1WTH A;  2JA6 G;  1ONL A;  4EQP A;  3T13 A;  3JAM L;  4YY3 Q;  1TWC H;  1PFM A;  4MHE A;  3HOY H;  1H9R A;  2A68 C;  2HUG A;  3IL8 A;  3S14 H;  3L9A X;  3CRL C;  4BBR H;  3IKJ A;  1GM5 A;  1XMO L;  2B8F A;  4QF4 A;  1VQG A;  3UE1 A;  2RDH A;  1WTQ A;  2K5W A;  2I5H A;  2N3S A;  2N78 A;  3KJO A;  3H3V I;  3F8T A;  3S24 A;  1CSQ A;  2ZM6 L;  3OIQ A;  1NTG A;  3NBI A;  1ET6 A;  2XIW A;  4YY3 L;  2OF1 A;  1OTC A;  3GTP B;  2KHS A;  2WB1 E;  4DV6 L;  1VQA A;  2ZTC A;  2L5T A;  4AYB B;  1CKM A;  4X64 Q;  3U9S A;  1NR2 A;  5EJW A;  2JA5 B;  2VZA A;  5C3W A;  5JEA G;  3UDG A;  2MUY A;  4F7X A; 
#chains in the Genus database with same CATH homology
 4XDX A;  3EFX D;  4R9W A;  2EY6 A;  3S1M B;  5ELC A;  3NSW A;  4KD4 A;  2DN8 A;  4HSP A;  1WTR A;  1D5M C;  1YNJ C;  2MP1 A;  3PV0 A;  2O4X A;  2Z4I A;  5FO9 B;  4CJ2 C;  4EQO A;  4QIW B;  1JR0 D;  1K8O A;  2X69 A;  1II3 A;  4DFA A;  1M4V A;  3KLS X;  3PMF A;  3MTS A;  1U4L A;  1DM0 B;  2ZT9 C;  3EA6 A;  3I91 A;  4P2C B;  1A15 A;  1BO0 A;  3GQB A;  1ZXT A;  1STN A;  3M85 A;  4X3S A;  2EY5 A;  1G2T A;  2WKC A;  2SEB D;  1EY9 A;  4UAI A;  5C4Z A;  2K5Q A;  3QWN A;  1DCZ A;  2KJX A;  3J81 E;  2NZ1 D;  3K5L A;  5G3L D;  3HP3 A;  2B2U A;  1QE6 A;  2NTT A;  1HXY D;  3UI2 A;  3ONA B;  4XYQ A;  2F0P A;  5CBA E;  1FD7 D;  1EU3 A;  1PTO C;  2BOS A;  1ZKO A;  3SR1 A;  1EWC A;  3S17 B;  1KLU D;  5KYL A;  4G4K A;  4IFD I;  2LY7 A;  1JWS D;  1WD0 A;  4A3B B;  1W6J A;  2O2L D;  4O1N A;  5COR A;  5JPN C;  1AZP A;  1HUM A;  1D6E C;  1GOZ A;  4RFB A;  4XQN A;  2RA4 A;  4DN4 M;  1Y8N B;  3O13 A;  4QMG A;  2PW5 A;  2Q8T A;  1EY6 A;  2RQX A;  4QUF A;  4ULL A;  1TT2 A;  4V19 0;  1Y69 U;  3A8J E;  4RA8 A;  2NB0 A;  3BDL A;  4H0L C;  2IJ0 A;  5C4J B;  2NN6 H;  2AWO A;  3SK6 A;  1PTO F;  2B2Y A;  4DNR B;  1TS2 A;  3J7A V;  1FNV A;  4IUV A;  3W3A A;  3I8Z A;  5M3M B;  1TS3 A;  1RTN A;  3EQL C;  1TVX A;  2XNA C;  1ENF A;  4A3I B;  3WOF A;  3J7Y W;  2IPK D;  2F0V A;  1B9N A;  1EZ6 A;  3FMC A;  1ENA A;  4G7H C;  3QIA A;  4KKS A;  4A3J B;  4KN4 C;  3NWT A;  1QG7 A;  5ISR A;  3OW7 A;  1EY5 A;  2EYF A;  1I4P A;  3K5M A;  5C3E B;  5C0X J;  1B9M A;  1QCB D;  3QOL A;  3SK5 A;  5EQ0 A;  1OXV A;  5JAV A;  2A6E C;  4NP5 A;  1YNN D;  3S1R B;  2EY1 A;  4QB4 A;  1STY A;  5IT9 L;  1VMP A;  1B2T A;  1CT1 D;  4IFD G;  4CBV A;  3S2H B;  3D4W A;  1FNU A;  4K6D A;  1EWH A;  2EY2 A;  1QB5 D;  1QJO A;  3P75 A;  4DF7 A;  4HR7 B;  2L11 A;  1R9T B;  2A74 C;  5DM6 3;  3A8I E;  5FKA C;  3C1F A;  1STG A;  3GTQ B;  5E3F A;  2EJM A;  2E2H B;  3DEP A;  1B53 A;  3K57 A;  4ODG A;  3J80 L;  5E1F A;  4J8Q A;  1S5C D;  1SBB B;  5CGK A;  2NYZ D;  1D5X C;  3VA7 A;  1V8Q A;  5CBE E;  2EVB A;  3TBI B;  1HTP A;  4OL7 A;  4ZK9 B;  1U9R A;  2JEA I;  3V2T A;  5FO7 B;  3NPP A;  2N88 A;  1BBX C;  1A3T A;  2C9O A;  4X3U A;  5IOD A;  1TQO A;  4K2L A;  2R93 B;  5G3L F;  2BA0 A;  5EKI A;  4G7Z C;  1QIL A;  1WTX A;  4K8J A;  3MFY A;  5FOB B;  5FO8 B;  2RKS A;  2O5J C;  2L4N A;  2NBF A;  2FHT A;  2L12 A;  2E76 C;  5T1I A;  4RH6 A;  5C4X B;  1BR9 A;  5C4H A;  1CZW A;  3AMU A;  4ZYS A;  4C3J B;  1F2Z A;  2F0N A;  2R7Z B;  1U4P A;  5BN5 A;  2R61 A;  1Q90 A;  1PZJ D;  3E6Z X;  1K8M A;  5I6W A;  2I07 B;  4K6L A;  1KAB A;  1H9S B;  3OIP A;  4DAP A;  5ELF A;  3OPO A;  1OXX K;  4F8M A;  2EE1 A;  1G91 A;  1STA A;  2K28 A;  1GJX A;  1LT6 D;  3S15 B;  1F9S A;  1GHK A;  4C2M B;  4G57 A;  2WB1 B;  1S5D D;  1XYI A;  3Q0A A;  1EEF D;  5IIF A;  4XIG S;  2F0T A;  4DU9 A;  1TY2 A;  2SNS A;  4EQN A;  1L0X B;  3BDC A;  3HOZ B;  1YNN C;  3KBX A;  1DOK A;  2BCO A;  5CC4 A;  1PDQ A;  4M1U B;  5A2Q E;  4I7Z C;  2KQ3 A;  3S16 B;  1E2Z A;  1QWY A;  4CJ0 B;  1R4Q B;  1WCM B;  4KTA A;  5DM7 3;  4A3D B;  1MBY A;  4C3H B;  3ERO A;  4C1N K;  4PQX A;  1B44 D;  4KKU A;  4TKO B;  4M8A A;  5IGC A;  2SNM A;  1SNC A;  4LAA A;  1S5F D;  3MXU A;  2N55 A;  3BVG A;  2FJ2 A;  2JE6 I;  1Q8I A;  3NP8 A;  4FXD A;  3M7G A;  1NR4 A;  1BDO A;  1G2S A;  4MN3 A;  1AN8 A;  3H91 A;  2FMC A;  4ILW A;  4GZY C;  4MIU A;  3BS1 A;  1RD9 D;  3URY A;  1V1P A;  1AZQ A;  2E75 C;  1BOS A;  1BCP B;  1EOT A;  3MA2 B;  2K7V A;  3H0G B;  2VB2 X;  1UNS A;  1I3Q B;  4XTC S;  4DGZ A;  1H9J A;  5I9O A;  3H09 A;  5CR3 A;  4K5W A;  5NUC A;  1FGB D;  1IL8 A;  1ML0 D;  1VF7 A;  1B1Z A;  2EJF C;  3W2D A;  1D5Z C;  2XVS A;  3J81 L;  1BCP D;  2BDO A;  2IL8 A;  1SE3 A;  2PZT A;  3E0J A;  2K01 A;  1PZI D;  1I50 B;  1CA5 A;  1SE2 A;  2BE5 C;  1A2U A;  1I4G A;  2E2D C;  2TSS A;  3NTI A;  1O80 A;  3D3R A;  2F0L A;  2RVL A;  1SXT A;  1ZEQ X;  1DJR D;  1CZG A;  3CRK C;  2EYP A;  1GUG A;  5K36 H;  3WDN A;  4KY5 A;  2EYM A;  2A6H C;  1KAA A;  1MSG A;  4YIJ A;  1PXU A;  4BY1 B;  2PZW A;  3KLR A;  1FNW A;  4KMU C;  2F1M A;  2B2W C;  2ICI A;  2K5D A;  3TME A;  3A8K E;  3C46 A;  3I70 A;  1FR3 A;  1TWG B;  3QG1 A;  5CV6 A;  1EY0 A;  4RGM A;  2OXP A;  5D3D A;  1Y8P B;  3G6J B;  1LTI D;  3MFG A;  5JVH 3;  3RLF A;  2AUK A;  3GTM B;  4RGT A;  1LTR D;  1V43 A;  2XSC A;  1SDF A;  3R8B A;  1R4P B;  2K1B A;  1AFP A;  3Q22 A;  2MJ8 A;  3DWA A;  1JC7 A;  5EBD A;  3FDT A;  2J7Z A;  2XRQ D;  4RWS C;  2BA1 A;  1SYG A;  4EGV A;  5M3F B;  1Y1W B;  4CHT B;  2K32 A;  3MWY W;  5FLX L;  4A3M B;  1WD1 A;  5LL6 S;  1Z7T A;  1DZ1 A;  5C0X I;  2ZXR A;  3QJY A;  1KDB A;  1LT3 D;  1SYF A;  1SNO A;  1KDA A;  4F87 A;  4JBW A;  1C48 A;  2EYJ A;  1JOQ A;  2WKD A;  3MVV A;  2WAC A;  2EYH A;  3DM1 A;  3DWQ A;  3HEJ A;  2Z8L A;  2B63 B;  2TMP A;  2A6E D;  4KHV A;  1IYU A;  1T5E A;  2K6A A;  2CW0 D;  4E6I A;  1OO9 B;  3M3Y B;  1BCP C;  5ELD A;  1PRT C;  2RDG A;  3A56 A;  4ZUJ A;  4C1N I;  4OO1 H;  5A35 A;  1HTL D;  2L55 A;  2KCN A;  2K33 A;  2V4D A;  3V96 A;  3VYS A;  1HA6 A;  1LTS D;  3GV6 A;  4BA1 I;  1ICW A;  4LJZ C;  2F0W A;  1NCV A;  3MAQ A;  2F0H A;  4BS9 A;  2KVM A;  2F0M A;  1BUV T;  4A3E B;  3NTH A;  3M7N A;  4C3I G;  3D31 A;  1EY8 A;  4BY7 B;  2OT2 A;  3EJI A;  3H6M A;  4ID6 A;  2IX1 A;  2VXW A;  1BCP F;  1BF4 A;  4LMQ D;  1C4Q A;  1O7L A;  2JA7 B;  1DOL A;  1ROD A;  1STB A;  1WTW A;  1WVL A;  3D8G A;  3L3O C;  3MXP A;  2VNU D;  5C0X G;  4KY7 A;  1HPC A;  3NHH A;  1MGS A;  4Z9C B;  1GUT A;  4IUN A;  1XX8 A;  1Y1V B;  1NSN S;  4RKB A;  1O7Y A;  2VB3 X;  3M4O B;  2E74 C;  3GTG B;  4XQJ A;  4UDU C;  2I46 A;  2D2C C;  1KNE A;  3HOX B;  4KN7 C;  1CI3 M;  1S4Z A;  1RHP A;  2M2L A;  5AFW A;  3HOU B;  1AW7 A;  4RGO S;  1A3U A;  1JOR A;  4H7B A;  1JCK B;  3KF8 A;  3I90 A;  3HRZ C;  2JA8 B;  3S9W A;  2HDL A;  5IGB A;  2LS0 1;  2KCC A;  2IT1 A;  2B2T C;  2J0T D;  3N52 A;  2F0F A;  5KIX A;  2AQ3 B;  4KY6 A;  4K2K A;  1SYD A;  5D14 A;  3CKI B;  5CMD A;  4F88 A;  2F0G A;  2FMM A;  1X32 A;  2CW0 C;  1CA6 A;  1KLG D;  3GTL B;  1HRJ A;  2PO4 A;  1I4R A;  4R8N A;  2EXZ A;  1BQQ T;  1ET9 A;  2QIL A;  5JJZ A;  1JIC A;  2L1B A;  3OHX C;  2VUM B;  1CM9 A;  2EYO A;  4FXG C;  5EKK A;  3VYT A;  1A3V A;  2XWB B;  2NN6 I;  3K59 A;  4I65 A;  4X3T A;  3OSO A;  1I4H A;  1LT5 D;  1LTT D;  4S3S A;  1G8Z D;  4B9W A;  2HCI A;  2EZV A;  1LAB A;  1H9S A;  4ZRZ A;  3IFT A;  1UEA B;  4WFN 3;  4XT3 B;  1Q1B A;  2LFN A;  4RGN A;  3QB3 A;  2L0C A;  1WTV A;  1EY4 A;  2JXM B;  1CFM A;  4O42 A;  3WOE A;  4L6T B;  1F9P A;  1RDP D;  4N9P A;  2PCF B;  3R93 A;  4KI0 A;  1DON A;  2ID0 A;  3TP6 A;  3CHB D;  1O7Z A;  1X3P A;  2DY8 A;  5T1G A;  2R6G A;  3R2T A;  1Q1E A;  1B4O A;  2D9U A;  2IWH A;  5I4D A;  1LTG D;  1SYC A;  4OHJ A;  3T4A C;  4HMJ A;  2BE5 D;  2YYZ A;  4XT1 B;  4HCS A;  3MXN A;  1M8A A;  3MC0 B;  2XRS D;  4FYD A;  2C5C A;  4L63 B;  3K5O A;  2JA6 B;  2Y0S B;  3RZD B;  5TSS A;  4ZQ3 A;  2IW3 A;  2B39 A;  1IYV A;  4LK1 C;  2AQ1 B;  2B8G A;  5EPJ A;  2A6H D;  4ZKB B;  3HS0 C;  4ZUI A;  3DMU A;  2NN6 G;  1CTM A;  4DK1 A;  1DXM A;  3PUW A;  3I3C A;  5J39 A;  5M5W B;  2EPB A;  1LAC A;  4KHZ A;  1A6X A;  3ND8 A;  2MGS A;  3S2D B;  1K83 B;  3PIO 3;  2DNE A;  1D1K A;  5DNF A;  2F0J A;  3VR4 A;  4U68 A;  3DWP A;  5BN3 A;  3BVZ A;  5E4X A;  2B2V C;  3KBG A;  3A7A B;  1GHJ A;  1NAP A;  2EYL A;  2RSN A;  3X3N A;  1IHZ A;  2X6G A;  4IN3 A;  2CQA A;  1UAP A;  1X3Q A;  2PW7 A;  1HUN A;  2G9H D;  3CQZ B;  5I2X A;  3R2I A;  2F0D A;  4B08 A;  1STH A;  4OIJ A;  4IUU A;  4KKT A;  1DOM A;  1DYQ A;  2ICE C;  4FF4 A;  2L9H A;  5JPM C;  2F0O A;  4K8I A;  1LLR D;  4TQU S;  4IUP A;  2AQ2 B;  4PNY A;  1SMY D;  3MXG A;  1TII D;  1JE4 A;  1PRT B;  2B2Y C;  1U4M A;  4FNF A;  2F0E A;  2ZXP A;  3KUP A;  3P7J A;  1TY0 A;  3F2U A;  2J4X A;  4C56 C;  4A3K B;  4FF3 A;  4RCO A;  4H13 C;  5EPK A;  2RDF A;  4DAY A;  5FK9 C;  4NW2 A;  2PPB C;  3J80 E;  1TU2 B;  1PRT D;  2GA4 B;  2JYO A;  4HED A;  3PIP 3;  4XYO A;  2O5I C;  5M5Y B;  3BG3 A;  3N6R A;  5EBC A;  4OIK A;  2A69 D;  5J1Z A;  2Z4H A;  2KA7 A;  2KEE A;  1HQR D;  1SEB D;  2WV6 D;  2WII B;  1LTB D;  1ESR A;  1C8C A;  4KK7 A;  1U4R A;  4KD3 A;  3PUY A;  5CYU A;  4WOR A;  1CHP D;  3MEH A;  3NTK A;  5CV9 A;  5JVG 3;  1NUC A;  1D2B A;  3TZD A;  1F2Y A;  4PV1 C;  2PNR C;  5DEH A;  3I4N B;  4IUT A;  5JOB A;  2H4O A;  2M9V A;  3NQT A;  1Z6H A;  1E2W A;  2PZU A;  2FFK B;  3TP8 A;  1F2L A;  1TWC B;  1I4Q A;  1Q3L A;  3T51 B;  4RHS A;  3D6W A;  3BYT B;  5IGF A;  4C3J G;  2QEJ C;  5C3X A;  5M9O A;  2PQE A;  2NWG A;  1RCV D;  3VR3 A;  1F9Q A;  2A5H A;  4TSS A;  1LT4 D;  4FP5 D;  3I4M B;  3X3M A;  3HOV B;  3P20 A;  3MHB A;  5I6Y A;  4BBS B;  5CV4 A;  1SND A;  3FPP A;  3EVQ A;  4K5V A;  1AEX A;  2XWJ B;  1J8I A;  1EQV A;  5I2Y A;  4FXK C;  1SMY C;  5ELE A;  3KK7 A;  1OXT A;  3GP7 A;  3K5N A;  5HUR A;  1OXS C;  1XWE A;  2FIN B;  4IUR A;  3D4D A;  3IAY A;  1HA5 A;  4J6H A;  4C3H G;  1SE4 A;  2NUC A;  5EGT A;  4X3K A;  2PYK A;  1EIG A;  3NQI A;  4IFD H;  1PFN A;  1TKW B;  3QOJ A;  4ABN A;  2NTS A;  3ERQ A;  4CJ1 B;  4K14 A;  1EZ8 A;  2NVX B;  1EU4 A;  4PMW A;  1A2T A;  1S5B D;  3NBH A;  5CV7 A;  1MSH A;  4TRD A;  1T5X D;  3T53 B;  2A69 C;  3K7A B;  1B3A A;  4L8J A;  2JEB I;  3GTK B;  4QCL A;  3C3L A;  4WJW A;  2CHB D;  1HHV A;  3H3V C;  2EJG C;  2RBM A;  2E2J B;  4RKL A;  1G29 1;  2Q8R E;  1CHQ D;  4G7O C;  1I4X A;  2BDN A;  3VYU A;  5JEA J;  3FPU B;  3GTO B;  5KRU A;  1STE A;  4U67 3;  2MHV A;  3SVM A;  3VR5 A;  3SEB A;  1ZYR C;  1PRT F;  1VDZ A;  5KNB A;  3VR2 A;  3DXJ C;  3C2P A;  4CKE A;  1SFO B;  2K05 A;  1MI2 A;  1VF5 C;  2B2V A;  5K36 G;  4A3G B;  5IGG A;  1ILQ A;  3PUZ A;  2D5D A;  2R3Z A;  3K6O A;  4Q5V A;  4CKC A;  3LX0 A;  5M5X B;  1GUS A;  2WP8 J;  5K5P A;  1JWM D;  4IZ8 A;  5BN4 A;  4OO1 I;  2K04 A;  2ENB A;  2AWN A;  1SYB A;  4DK0 A;  1GUW A;  3K0Y A;  5IGE A;  3A7L A;  2WAQ B;  5KEE A;  2KED A;  3BZD B;  1JOK A;  3TDQ A;  5IGD A;  4PMC A;  3JAM E;  3S1Q B;  3H94 A;  1GUO A;  2PMZ B;  3GV3 A;  3I72 A;  4PMB A;  4FF2 A;  1HCZ A;  3RMH A;  1EY7 A;  2JSO A;  3LWE A;  2DNC A;  1I6V C;  2F4I A;  5EPL A;  2DY7 A;  5A2Q L;  1H9K A;  5ELB A;  3NWS A;  3D4R A;  1RKN A;  1SNQ A;  1EYC A;  3SHL A;  2HCC A;  3PUX A;  1IKL A;  4CGY B;  2QKI C;  1XTC D;  4HCE A;  4ZLT F;  4QUC A;  2NVQ B;  2KUM A;  1TWH B;  5KGU A;  1RTO A;  3P1H A;  1VMC A;  4DXF A;  2ZXO A;  3SE0 A;  1OXU A;  5C5L A;  4N9T A;  2Z1C A;  4HTH A;  5FLX E;  2AUJ D;  4JK1 C;  3I73 A;  1HFG A;  1LTA D;  1SJH D;  3RD4 A;  4XXE A;  5KNC A;  1JWU D;  2K03 A;  4NDX A;  4FVM A;  1TR5 A;  4WRD A;  4DA2 A;  4IUQ A;  1CQV A;  2G9D A;  2B2W A;  4Q0F A;  4HMI A;  3MZ5 A;  5F2D A;  4Y7N B;  1VCI A;  2EDG A;  1B50 A;  4OO1 G;  2QDB A;  5LHY 1;  1UUP A;  3ITP A;  1D1I A;  3OMC A;  3CU7 A;  3I4L A;  2F03 A;  1KDC A;  4FF1 A;  3PUV A;  1PZK D;  2EOT A;  2SOB A;  2R92 B;  3LNN A;  3OWE B;  4KV6 A;  2M00 A;  1EL0 A;  5HGT A;  1IKM A;  3GO5 A;  4DNT B;  2F0K A;  2HQE A;  1G6Z A;  1TWF B;  3SK4 A;  2D62 A;  3OMG A;  2LMC B;  1RF2 D;  4HAE A;  4NMZ A;  2IX0 A;  3FKI B;  4KJN A;  3GD7 A;  5I9P A;  4IFD J;  1PLF A;  3TP5 A;  3SDZ A;  1GXD C;  1E2V A;  3VR6 A;  3G7L A;  3A55 A;  1MD2 D;  3TP7 A;  2X6L A;  5J22 A;  1SAP A;  1IW7 D;  1V1O A;  3BYY B;  4IAL A;  3U9O A;  2KOL A;  1BNZ A;  1EFI D;  4XQQ A;  4K5X A;  2OEO A;  2Q8I B;  2NVT B;  1LV9 A;  2F3W A;  1EYA A;  1ENC A;  2F0S A;  1I6H B;  4RAU C;  5CV8 A;  1L0Y B;  3TZU A;  4ME5 A;  2F0I A;  1HQM C;  4HN7 A;  2YU9 B;  1QNU A;  2KEC A;  1ESF A;  4IQZ A;  2WIN B;  3VA5 A;  2RSO A;  2QF7 A;  3RZO B;  2MPM A;  1QOH A;  2B2U C;  1Y8O B;  3DUZ A;  2QCP X;  3T16 A;  1H9M A;  3K58 A;  1BXT A;  1Z47 A;  3FEW X;  4A3F B;  1F9R A;  3Q6S A;  3DHQ A;  3HKZ B;  4J1M A;  4RCN A;  3AU7 A;  5D65 A;  3A54 A;  3L7Z C;  3J7A F;  3FVQ A;  5IOC A;  5JEA H;  2A68 D;  1S5E D;  1EIH A;  3PO2 B;  1SNP A;  1KTK A;  3BDO A;  2SDF A;  5KYI A;  3HG9 A;  1PFB A;  3NE5 B;  5C44 B;  4BA2 I;  1RJT A;  1HFN A;  3NXW A;  2E2I B;  3NK9 A;  3VYR A;  1SYE A;  5IT9 E;  1FYC A;  1PMR A;  4NKL A;  1Q12 A;  2A73 B;  1PYW D;  1E0B A;  4A93 B;  3SXH A;  2CVR A;  4EVO A;  5EKL A;  4CKB A;  3C1E A;  3KLS A;  3QO2 A;  5D3I B;  4ZKC B;  3S1N B;  1F2M A;  4OGQ C;  3OOC A;  2IX3 A;  3Q24 A;  3DEO A;  1XXG A;  3NUC A;  2XN9 C;  5COY A;  2F3V A;  2H1E A;  2JP1 A;  4R8I A;  1W6K A;  4H44 C;  3ZYY X;  4C3I B;  1YNJ D;  3LWU A;  2F0U A;  1JQY D;  1EQT A;  4DXG A;  3HZX A;  3D6C A;  3PO3 B;  2F0Q A;  3GTJ B;  3E5S A;  2LKV A;  1CK1 A;  1IW7 C;  3R3O A;  1WTP A;  1EEI D;  3FRP B;  5E4W C;  1TWA B;  4HSV A;  1GUN A;  3HOW B;  1LO5 D;  5KND A;  1QNK A;  3Q23 A;  1JOO A;  5DAU A;  5LL6 X;  1F77 A;  3M4Y A;  2B2T A;  3HGB A;  1TS4 A;  1DD2 A;  1J9O A;  1ILP A;  5C6A A;  3TSS A;  5CV5 A;  1PTO B;  3BVM A;  1JB3 A;  2HDM A;  1ZYR D;  1WTO A;  4BWG B;  2NVY B;  3TN2 A;  1CQF A;  1EYD A;  5C0X H;  5C5M A;  4FO2 A;  3OWF A;  1V1P B;  3AB9 A;  3IFD A;  3T56 B;  3HOY B;  1PTO D;  1O78 A;  1PTO H;  1SJE D;  3ND9 A;  1AP0 A;  3S14 B;  3SK8 A;  4BBR B;  3RUZ A;  3V05 A;  4V0B A;  4B9X A;  4RHR A;  4KJO A;  4ZAI A;  1TS5 A;  1SNM A;  1SSO A;  4DAV A;  1KNA A;  1ONL A;  4EQP A;  3T13 A;  3JAM L;  1PFM A;  4MHE A;  1H9R A;  2A68 C;  2HUG A;  3IL8 A;  3L9A X;  3CRL C;  3IKJ A;  2B8F A;  4QF4 A;  2RDH A;  1WTQ A;  2K5W A;  3OIQ A;  3NBI A;  1ET6 A;  2XIW A;  2OF1 A;  3GTP B;  2KHS A;  2L5T A;  4AYB B;  3U9S A;  1NR2 A;  5EJW A;  2JA5 B;  5C3W A;  5JEA G;  2MUY A;  4F7X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...