4GN5A

Obody am3l15 bound to hen egg-white lysozyme
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
113
structure length
113
Chain Sequence
VSPKKTHWTAEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERGKTPDHLFKVFAELSREDVVVIKGIVEAGWPVALDTGVEIFPSEIWILNKAKPLPID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein/hydrolase
molecule keywords OBody AM3L15
publication title Tracking Molecular Recognition at the Atomic Level with a New Protein Scaffold Based on the OB-Fold.
pubmed doi rcsb
source organism Pyrobaculum aerophilum
total genus 22
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4gn5A00
1E1OA 1HH2P 2OQKA 2HQLA 1VQEA 1VQIA 1Y1VG 1A63A 4DR6Q 4LNQA 4OX9Q 1CKNB 1HNZQ 1RL2A 3DM3A 4GLXA 1IBML 4UY8C 4AQYL 3TS2A 4A3FH 4YWMA 5LMNW 2YTYA 1T9HA 4JYAL 5C3EG 4HJ7A 4OX9L 2UXCQ 2H5XA 2VQFQ 2WAQE 4A76A 5C4XH 4DR1L 4JI6Q 1U0LA 1HNXQ 4POGA 4DR7Q 4Y52H 2B29A 2PNHA 1N36Q 1L1OC 2OQ0A 3BU2A 5IWAQ 1VQNA 1JJCB 4A3JH 1XNRQ 4A4IA 3F2BA 4DR5Q 3PF4A 2UXCL 1NMGA 4LUZA 2IY5B 1AE2A 1M90C 1L1OB 3KF6B 1N34Q 4LF5Q 5IWAL 4PZ6A 2PMZE 2Q2UA 2LXKA 4A3KH 5GROA 2EQSA 1YJWA 3HFZB 1K8GA 5IP9H 5M3MG 1SN8A 1UEBA 5IYDH 3CXCA 2KCMA 2JA6H 3GTQH 4LF6Q 1Q8KA 2WB1E 2B63G 1X9NA 4DV6Q 4DV7L 4LFBL 4BY1G 3G48A 1B8AA 1VQHA 4BY7G 3PUWA 1J5EQ 4H02A 3M85A 3PIOA 3CW2C 4C3IH 2ATWA 5EAYA 1FGUA 4A3EG 1FVIA 1XTDA 4JCVE 2GN5A 1J5EL 2HT1A 3FKIH 4DV4L 4GNXC 3GTMH 2K52A 1YHAA 1FJGL 1NTGA 3KDFA 5AJ3L 3CF5A 1C9OA 4GNXB 2UUAL 5IP7H 1VQ7A 3HOVH 2IX1A 2QA4A 3M9BA 3UE0A 4X64L 1Y1WH 2JE6I 2GVAA 3PO3H 4DK3C 4J15A 3HOUG 5C0XI 4JI3Q 4TVAB 1IBKQ 4GKJQ 4QJFA 3CC2A 5GAGC 3GTOH 3PV0A 4JG2A 2PI2A 4DUZL 2I0QA 3DLLA 2AKWB 2AMCB 1EIYB 2CFMA 2UXBQ 5JJLA 4JBJA 1LM0A 3D0FA 4APVA 1NY4A 1BKBA 3S1MH 3NBHB 2CWPA 2L15A 1IZ6A 3HOYG 4JI1Q 2K75A 1TXYA 3K7AH 1I94Q 2MO0A 3J7ZC 5M3FH 5BR8Q 4YY3L 2UXBL 2QEXA 4L5QA 4A75A 1KL9A 2ZJQA 4BBRH 3CP0A 4A93H 5IY0A 4JI8Q 1TWAH 1WCMH 4JI1L 4LF4L 2JJQA 2JA5H 1PHJA 3T1HL 3H3VI 3M7NA 4OWXB 4A3IH 3TQYA 4KHPQ 3JC66 3RZDH 4JI8L 4LFCQ 2F3IA 1VQKA 4L5TA 2F52A 4JI5L 1CSQA 2C35B 3PO2H 3MEFA 2RHQB 3KJOA 2R92G 2E5LQ 4PZ8A 5C4XG 4P73A 2F4VQ 2JQOA 2VS1A 1P16A 4IOAA 3F8TA 4A3JG 3I4OA 3HOXG 4IFDJ 4JBMA 1X56A 2ZM6Q 1YBYA 2F4VL 4GLAC 4OXPA 1VQ6A 5JJKA 1H95A 4YCVA 3UDIA 4TQUS 5GQOA 2PQAA 1KRSA 1Q82C 3T1YL 2ZM6L 1IL2A 2BH2A 5IP9G 5IYDG 1B70B 1SLJA 3NELA 1CKMA 4X62L 2JA6G 3ZJYC 4JC0A 1CKNA 4XIGS 4DV3Q 4GOPA 3BJUA 3S17H 1UE1A 1XJVA 4JI7Q 3E0EA 1W2BA 1R9TH 3KLWA 1EWIA 3W1BA 4DV3L 3G4SA 1HNWQ 2MFIA 1HR0L 2UXDQ 2N3SA 1L0WA 3RLFA 3PIPA 2UU9L 1I6HH 3Q8DA 5GAEC 2RHSB 1FL0A 4DNIA 4A3LG 1BBWA 1TWCH 3FKIG 3LGJA 3KFUA 1VQBA 1HZ9A 2HIXA 3A5ZB 2OTLA 3S24A 1CSPA 4K0KL 4JOIA 4LFAQ 1X3FA 1U5KA 5IP7G 1YI2A 3HOVG 4A3DH 3PUYA 2A8VA 4A3MH 3E9HA 2R6GA 1Y1WG 1VQ5A 2EIFA 1JT8A 3PO3G 2N8NA 3CQZH 3CCRA 2LXJA 4LWCA 3CCMA 4DR2Q 4QQBX 1BBUA 1E22A 4BBSH 3B6YA 4AQYQ 2MO1A 3CMAA 3PF5A 3W1GA 4IO9A 4JI0Q 1XNQQ 4FDBA 5FLMH 1V1QA 2PQAB 1IXRA 3S2DH 4DAMA 4UP7A 2WFWA 5J3BA 3RLOA 1IBMQ 5IE8A 1ASYA 3ERSX 1PH1A 4JI0L 5GAHC 1Z9FA 4B3TL 1XNQL 2HIVA 3RR5A 4JYAQ 4AIMA 4OWTB 2DUDA 4GOPB 2WAQG 4BBRG 3L2PA 5M5YH 1QZGA 1PH6A 1MJEA 4DR1Q 4JI4L 4A93G 1WCMG 2OTJA 4YCWA 4GN5A 4KI0A 2JA5G 4GNXA 1XMQQ 3HOZH 4A3IG 1VQ8A 2VQEQ 3CAMA 3S15H 5C4JH 2B3GA 3KF8B 4WJ4A 3NEMA 3AQQA 3J81i 5H1SE 1VS0A 1YEZA 4NPSA 4QL5A 3HKZE 4JOIC 3KOJA 1XMQL 3PO2G 2VQEL 3GTKH 2BA0A 2VUMG 4LW1A 2CWAA 3CCVA 2ID0A 1N32L 4BA1I 3ICEA 4R4OA 1N8RC 1TWGH 4YWLA 1W3SA 4HIDA 1PFSA 2JEBI 2WB1G 3K80C 2NN6I 2K14A 1YHBA 4LFBQ 4DV7Q 1KD1C 2IHEA 1G291 3H0GH 4UPAA 2E2HH 4NXMQ 2BH8A 1WOCA 4R4QA 3K0XA 4PZ7A 4MTNA 5FLXc 1NJIC 1VQJA 4HJ5A 2OWOA 4YCUA 4DUYL 3S1NH 1QVCA 3I2ZA 3CMEA 4NXML 4DV4Q 3AFQA 1YJNA 2AHOB 1TWFH 1FJGQ 5AJ3Q 5C0XG 1MKHA 5K36G 2UUAQ 3ULLA 4X64Q 3OTOL 1WI5A 1J6QA 1YNXA 4AYBG 3I7FA 2VW9A 3G71A 1YITA 1SMXA 2NVXH 4DUZQ 4YHHL 1SE8A 1GD7A 1YHQA 4AH6A 4GKKQ 1MJCA 2QGQA 4RG1A 2YYZA 2RF4A 2ZJRA 1EUJA 4R4IA 4OO1G 2E8GA 4X6AH 1GVPA 4LUVA 4HJ8A 4GKKL 1EOVA 4A3MG 3I55A 1Q86C 1KHIA 3UDFA 1A0IA 4YY3Q 2KENA 2ZTDA 1I3QH 1VQAA 2ZTEA 5IYBH 3TEHB 1PV4A 3HOZG 4BBSG 3PUVA 4DPGA 4LF4Q 4WJ3M 2KBNA 3KYHC 3T1HQ 4QIWE 1JMCA 1OTCA 2VY3A 5HY6A 3K7UC 2JA7H 1SRUA 3CPWA 5FLMG 4DR3L 1QZHA 1A8VA 2A19A 3SGIA 3MXNB 2R93G 2ES2A 4NXNQ 1OXSC 4GOPC 4DV0Q 4JI5Q 1OXUA 1TWHH 4JI2L 4LF9L 4X65L 1KC8C 1RIPA 4NXNL 2NVYH 4A3FG 4IPDA 4DV0L 1K9MC 4R1JA 1E1TA 4MNOA 4O0AA 1HZBA 4IPCA 3RLNA 1AH9A 4DV2Q 3TS0A 3I4MH 4Y7NH 3HOWH 1PH2A 2XTIA 2GVBA 1X3EA 4X66L 1MIUA 2UUCL 4LF8Q 1GO3E 1N33L 3AFPA 1Q1EA 3T1YQ 3GTPH 4DV2L 4LF7L 4X62Q 1Q7YC 4LF8L 2R7ZH 1X3GA 1D7QA 1DGSA 4ME3A 4A3KG 4KLKA 3CC7A 1XMOL 1K0RA 2MQHA 4C3JH 1KQSA 1NBWA 1Q46A 2PI2E 1VCIA 2VL6A 3H0GG 1K3RA 1SROA 1V43A 1CUKA 1HR0Q 1IBLQ 4A3GH 2Z6KA 1VQ4A 2UU9Q 3L0OA 3UE1A 2R7FA 3F1ZA 3EBEA 1VQFA 3IRBA 1PH4A 4GS3A 2I5MX 1IBLL 2XGTA 2CCZA 4HIOA 1B7YB 4K0KQ 3STBC 2VZAA 1K73C 5LMUL 3K8AA 3CPFA 1QUQA 3RN5A 3GO5A 3A0JA 1HZCA 5DLQE 1JJ2A 4A3BH 1QVGA 3H3VH 2K5HA 3S16H 3KJPA 2IT1A 2ZJPA 2ZTCA 3F2CA 2Q2TA 1AE3A 1YJ9A 2ASBA 1CKOA 4EQ5A 4B3TQ 3PUZA 3RNUA 1X6OA 4JI4Q 5JJIA 4P74A 2Z6KC 1QVFA 2RCNA 5M3FG 3HOUH 2JA7G 3D31A 4JBKA 4JV5Q 4B3RL 5C44H 1P8LA 1UE6A 3UDXA 1YIJA 3I4NH 2ALYB 2NN6G 2CKZB 2NZOA 2N78A 4IPGA 5JEAG 4IFDI 1VQMA 4JV5L 4DAYB 3H15A 1N32Q 1LYLA 1E3PA 2K5NA 3CD6A 3HOYH 2K50A 3J81j 2R7DA 3PCOB 4B3SL 4DV1L 2YV5A 5ELOA 1QUQB 5C0XJ 3PUXA 2Y0SE 3TREA 1K8AC 2JEAI 3UDGA 4YWKA 4DK6C 1UE5A 3A5UA 4BA2I 2D0PA 3TRZA 3OW2A 1D8LA 1OXXK 1C7YA 3I4MG 4BXXH 2I5LX 1WFQA 2FXQA 3HOWG 1G6PA 3AYHB 1WYDA 4IJHA 4DUYQ 4DKAC 1Q12A 2R7ZG 1KAWA 1VQGA 4O2DA 2R92H 4DR6L 5FJ8H 1HNZL 1XPRA 4HJ9A 4IOCA 3E9IA 4JBWA 1ASZA 1E7ZA 1GM5A 3JAMi 5M5XH 5IYCH 1PH8A 4R4TA 3VDYA 3OTOQ 1V9PA 2VQFL 3HOXH 1E24A 1EFWA 1Z47A 1LTLA 4A3GG 4DR7L 3J81c 1EYGA 1HNXL 4JI6L 3J80i 3G6EA 4DR4Q 1N36L 4YHHQ 3S1QH 1XNRL 4DR5L 2E2IH 1PH5A 1I50H 1VQOA 1EQRA 4IJLA 4DR4L 1N34L 1VQDA 4LF5L 3CCSA 4L5SA 4P75A 4A3CH 2IHFA 2JK8A 2AWOA 1IYJB 2D0OA 2Q2IA 2V1CC 4P72A 4A3DG 3EIVA 1KXLA 3BZKA 4LF6L 4A3BG 1WJJA 4UP9A 1L2FA 4DV6L 4POFA 1Q81C 2HHHQ 4A3LH 5M5WH 3JAMc 4DR3Q 1HR0W 3BZCA 4ALPA 1PH7A 2VNUD 5E7NA 1VQ9A 2HHHL 1YVCA 4JI2Q 5LMNQ 3J80c 2EXDA 4LF9Q 2JA9A 4X65Q 2JA8H 4R4CA 2YTXA 1G51A 1XPOA 4XTCS 3M4QA 4RMFA 5LMNL 5GADC 4AYBE 2YTVA 2IX0A 5C44G 3PGZA 1K83H 3A74A 4JI3L 4X66Q 1IBKL 1I5FA 1SFOH 2UUCQ 1N33Q 5ELNA 3WWVA 4HJAA 3I4NG 4GKJL 3PSIA 3CCEA 4OWWB 4LUOA 1PH9A 4LF7Q 4IPHA 1X54A 3NENA 4OONA 1NE3A 1Y1VH 4GN4B 4L5RC 4PG3A 2NVTH 4OO1I 1XMOQ 3CCLA 1I94L 4BXXG 5BR8L 2D62A 5C3EH 2Q2HA 2NVQH 2LSSA 1Y14B 3GTJH 1M1KC 3GTLH 1PA6A 1GKHA 3S14H 4KHPL 2VUMH 1PYSB 5FJ8G 5HGQA 4LFCL 3M4OH 3KDFB 3U4ZA 3S1RH 1EQQA 4QGUA 5LMUQ 4GLVB 4UP8A 4QY7A 5IYCG 2UUBQ 2YU9H 2Z0SA 1JB7A 2E5LL 1C0AA 5M3MH 3FP9A 1SR3A 2KCTA 3OYYA 4KHZA 2E2JH 3HKSA 3ER0A 1LUZA 3M3YH 2UUBL 1JE5A 1OXVA 3I56A 3K81C 3S2HH 2B63H 1KRTA 1XPUA 3L7ZC 3STBD 4MZ9A 4P71A 1EIFA 3U50C 3U4VA 4BY1H 4BY7H 1X55A 4GN3B 3M4PA 3GTGH 2BA1A 1YZ6A 1OXTA 2NZHA 3EN2A 2MNAA 4A3EH 4A3CG 2KHIA 5JEAJ 3CCUA 4DV5Q 3CC4A 3U58A 2OCEA 1HJPA 4EX5A 1N9WA 3RZOH 3J7A5 2DGYA 3F2DA 2WP8J 4C2MH 4DV5L 1Q1BA 5IT9c 1BVSA 4JI7L 4HIKA 4IFDG 5IYBG 1PVOA 3FHWA 3ULPA 2K5VA 4B3RQ 1HNWL 2UXDL 1S40A 1VQLA 2A1AA 3W5OA 3CCJA 1L1OA 3KF6A 4B3MQ 1UE7A 2K4KA 1X65A 1VQPA 1PH3A 2JA8G 1VQCA 1PYBA 3AEVA 3HKZG 1KIXA 2N49A 1NMFA 3GD7A 4C3HH 4B3SQ 4DV1Q 1S72A 4B3ML 4LFAL 2Y0SG 3RN2A 1O7IA 1UWVA 1HZAA 1A62A 4PMWA 3ULJA 4NB3A 2KHJA 4DR2L 1JJGA 3CCQA 2R93H 2AWNA 4HIMA 1S3OA 3GDEA 2CQOA 2I5HA
chains in the Genus database with same CATH superfamily
1E1OA 1Y1VG 1VQIA 4OX9Q 1I4PA 1CKNB 1Q3LA 5HGTA 4GLXA 3H09A 2X6LA 3NP8A 5LMNW 2JA8B 4HJ7A 4OX9L 2JSOA 2WAQE 1SAPA 2Q8TA 4JI6Q 2A68C 2PNHA 1L1OC 4JVZA 1JJCB 1XNRQ 3F2BA 4LUZA 5LL6S 1M90C 1M4VA 3KF6B 2OXPA 2B39A 1IHZA 3A7LA 1B1ZA 1G6ZA 1RTNA 5CMDA 2LXKA 4A3KH 1YJWA 2EQSA 3HFZB 1WTWA 1FR3A 3GTQH 3J81L 5IGDA 1Y8NB 1D1KA 2TSSA 1Q8KA 2K05A 1H9KA 1LACA 4ZKBB 4DV6Q 5C3EB 4LFBL 3G48A 3AMUA 1PTOB 1WTQA 1U4MA 3DM1A 1F9SA 4OIJA 3T51B 2ATWA 5J1ZA 4I7AA 3VR5A 3S14B 4C1NI 2VUMB 4GNXC 3D4DA 3P7JA 5IIFA 4ZQ3A 5G3LF 1YHAA 1IYUA 1NTGA 2F0SA 1LTGD 1I4GA 3HGBA 2QA4A 1NNXA 5M3MB 3M9BA 2CW0D 3PO3H 4J15A 4EQPA 4JI3Q 4TVAB 3MC0B 2B63B 2PI2A 4CKBA 1PZJD 2AMCB 1I4XA 2CFMA 4XDXA 1LM0A 4APVA 1D5MC 5IOCA 1TXYA 4YY3L 3RZOB 3ND9A 2EY2A 1FYCA 1J9OA 2L1BA 4JI8Q 3LX0A 3OIQA 2EYMA 4XQNA 3M7NA 3TQYA 4QUFA 3RZDH 2PNRC 4JI8L 4KY7A 4LFCQ 1KDCA 4JI5L 3MEFA 5ELCA 3QO2A 4PZ8A 2K5QA 4P73A 2VS1A 3N6RA 2KECA 2KVMA 3I4OA 4A3JG 1PLFA 5CV7A 1MHWC 2ZM6Q 1QNKA 1CFMA 4GLAC 4F87A 4H13C 4YCVA 5C5LA 5GQOA 2Z4IA 2F0TA 1Q82C 5CV9A 2ZM6L 4RA8A 3T1YL 2WKDA 1SNPA 2BH2A 4FF4A 1SLJA 3NELA 4X62L 1EEID 1LT4D 4OHJA 2ICEC 3U9SA 5CV8A 2O4XA 3E0EA 3QR8A 3W1BA 2J0TD 2N3SA 1L0WA 4C3IG 2PCFB 3Q8DA 1NR4A 4RKBA 4DNIA 4YIJA 3FKIG 3LGJA 1TS2A 3KFUA 1LTAD 1HZ9A 3A5ZB 3S24A 1CSPA 3T16A 5IP7G 3HOVG 2A8VA 3E9HA 4OEMB 2JA6B 1DOKA 1JOOA 3NPPA 4LWCA 1IKLA 4BBSH 2MO1A 4RWSC 3PF5A 4IO9A 4JI0Q 3PQIA 1V1QA 1IXRA 1JICA 2F0FA 1WTPA 1IBMQ 1ASYA 4JI0L 4AIMA 4OWTB 4GOPB 4MIUA 2F0EA 5M5YH 4DR1Q 3KUPA 3NWSA 1ICWA 1Z6HA 1Y1WB 3S15H 2VQEQ 3CAMA 1BR9A 3KF8B 4DN4M 1SNOA 1JC7A 5H1SE 5IGCA 4LMQD 2VQEL 5IT9E 4LW1A 2ID0A 1EY8A 3BYYB 3ICEA 4R4OA 3S1MB 4KJNA 1TWGH 4ILWA 1HPCA 3VR3A 1E2VA 2M00A 1DM0B 5M3FB 4BBRB 4NXMQ 2BH8A 3PIO3 1GUOA 2R3ZA 4PZ7A 5FLXc 4V190 4HJ5A 4A3IB 2HUGA 1EIGA 3CMEA 4NXML 1PTOD 3P1HA 1ZKOA 5E3FA 1YJNA 2PMZB 3PO2B 1MKHA 1O7YA 4KY6A 2UUAQ 5KIXA 5K36G 1ZYRC 3OTOL 1WI5A 4FF3A 3Q6SA 1SMXA 2NVXH 1V1PA 4DUZQ 5J39A 4AH6A 2QGQA 4FF1A 3HG9A 5EBDA 3V96A 4X6AH 1SBBB 1IL8A 3I55A 4CDEC 1Y8OB 5IYBH 3TEHB 4DPGA 1BF4A 1GHJA 5HY6A 3CPWA 2R93G 1OXSC 4DV0Q 1TWCB 1OXUA 2EYFA 1J8IA 2PW7A 4JI2L 4LF9L 3H3VC 1GUGA 1RIPA 2CH4A 3TZUA 4DV0L 4A3DB 2NB0A 4XQQA 2D9UA 1EY6A 4MNOA 5C3XA 2HDMA 4C1NK 2A69C 4Y7NH 2XTIA 2GVBA 1X3EA 2AQ1B 1GHKA 3R3OA 4ABNA 1DOMA 3S2DB 3R93A 5JJZA 1U4PA 4OGQC 1D7QA 4A3KG 3T56B 4KLKA 1NCVA 4UAIA 1NBWA 1Q46A 2PI2E 4P2CB 2EVBA 1K3RA 1SROA 1HR0Q 1QILA 2BE5C 4K2LA 2Z6KA 3HOZB 1GUTA 3UE1A 2R7FA 3F1ZA 2RKSA 4HCSA 2NZ1D 3GP7A 1B7YB 1CHQD 4FVMA 3NQTA 1JE4A 2MP1A 1TS5A 3CPFA 1SNQA 2K6AA 1HZCA 4K8JA 3KJPA 4DAVA 1JWSD 3H0GB 2E2HB 1HHVA 2ZTCA 2EYJA 1JOQA 4EQ5A 1G2TA 1HFNA 3T4AC 4JI4Q 5JJIA 2Z6KC 1QVFA 2RCNA 1RKNA 3HOUH 2JA7G 2DN8A 4HN7A 2F0MA 1P8LA 4KY5A 2ALYB 4IFDI 2EE1A 1STGA 2FJ2A 3CD6A 2K50A 3D6CA 4B3SL 1DJRD 2YV5A 5C0XJ 2Y0SE 3UDGA 1UE5A 3OW2A 1D8LA 1OXXK 5JOBA 1C7YA 3I4MG 2I5LX 1WFQA 3CU7A 1EOTA 1PRTB 3A56A 4IJHA 4DUYQ 2BDNA 2XRQD 2Q8RE 1Q12A 1LLRD 2B2VA 5DNFA 5FJ8H 1ASZA 1E7ZA 5M5XH 5M9OA 2L9HA 1QJOA 1XTCD 3VDYA 1PH8A 1K0SA 1H9SB 1STYA 4A3GG 1LTLA 3TSSA 1EYGA 3J80i 1KNAA 3J7YW 1N36L 4EQNA 4YHHQ 1SYEA 1I50H 2BCOA 3TP7A 3D4WA 1N34L 4LF5L 3CCSA 1AZPA 2R7ZB 2SEBD 1IYJB 2V1CC 3SE0A 2F1MA 4P72A 3EIVA 1KXLA 2ZXRA 4C56C 5M5WH 2WIIB 4F7XA 1PH7A 1TY2A 3I70A 5E7NA 1U4LA 1S5FD 2CW0C 2EXDA 2XWJB 4X65Q 5FK9C 1G51A 4RMFA 3BZDB 4AYBE 5CORA 2YTVA 5C44G 3PGZA 1K83H 3IL8A 1N33Q 1H9MA 1SFOH 1IBKL 4K2KA 2UUCQ 1CZWA 3PSIA 1STAA 3H6MA 1PH9A 1NE3A 1EFID 1Y1VH 4KMUC 2RVLA 5BR8L 1GOZA 2Q2HA 5C4HA 4RHSA 4IURA 1Y14B 1M1KC 2I07B 3EROA 4KJOA 1HA6A 1QOHA 3SK4A 1JQYD 1XYIA 1V8QA 2RQXA 4QGUA 1TS4A 2F0VA 4GLVB 1EWHA 4QY7A 1GJXA 2Z0SA 1JB7A 3FP9A 1LUZA 1OXVA 3FRPB 3L7ZC 4P71A 1ZXTA 4GN3B 3EN2A 4A3CG 4OIKA 1HJPA 2J7ZA 1N9WA 2WV6D 3J7A5 1B9MA 5IT9c 5IYBG 2WKCA 1CQVA 3FHWA 4B3RQ 1HNWL 2UXDL 2TMPA 3S1QB 3KF6A 2O5JC 1VQCA 3GD7A 2EXZA 4IUNA 1VF5C 1LT5D 3LNNA 1STEA 2MHVA 4PMWA 3VYRA 1F9QA 2K28A 1HQRD 5A2QL 1VMCA 2AWNA 4AQYL 1S3OA 1WD0A 2CQOA 1JE5A 3I56A 1HH2P 1SYDA 5EKKA 5I9OA 4DR6Q 1PRTD 2CHBD 4CJ2C 4FF2A 1TR5A 4UY8C 1ICFB 2YTYA 2IL8A 5JPNC 5IGGA 3NWTA 2UXCQ 1HNXQ 4POGA 3TMEA 2OQ0A 1WTXA 3BU2A 5JJLA 2UXCL 4A3JH 4A4IA 4DR5Q 2IY5B 1AE2A 1VF7A 2Z6BA 4PZ6A 3DUZA 2Q2UA 1CK1A 2R61A 1SN8A 1X3PA 5E4WC 1K8OA 1S5ED 1PTOF 5CC4A 1PTOC 1RD9D 3OWEB 1EY0A 4BY1G 1VQHA 4BY7G 2ENBA 4H02A 2F0WA 3M85A 2ZXOA 3GTJB 4C3IH 2EPBA 4M1UB 3BVZA 5CV4A 2Z9HA 2HT1A 3FKIH 1FJGL 5IP7H 3HOVH 4CDCC 2F0QA 3JAML 4R8NA 4DK3C 3HOUG 2E2JB 4LJZC 1Y8PB 3M3YB 3S2HB 3AB9A 3GTOH 4JG2A 1HXYD 1WTHA 4C3HG 1EIYB 3OOCA 4QIWB 3J81E 2IX3A 4A3EB 1NY4A 3NBHB 2L15A 3K7AH 1WTRA 1I94Q 2MO0A 1EU4A 2A69D 4DGZA 1TWAH 4LF4L 2JJQA 3T1HL 1WD1A 1LTID 4KHPQ 3JC66 1A3TA 1VMPA 1CSQA 3KJOA 1RJTA 2FFKB 5C4XG 2KEDA 1EY7A 5KEEA 2JQOA 2BE5D 1P16A 4IOAA 3K58A 3C1EA 2MUYA 1H9JA 1XWEA 3QOJA 1BNZA 4JBMA 2R93B 2EJMA 4TQUS 1IL2A 4ZKCB 1B70B 2EYLA 1CKMA 4DFAA 3W3AA 3ZJYC 1CM9A 4DV3Q 1ET6A 1W6JA 4GOPA 3BJUA 5K36H 3S17H 1XJVA 4JI7Q 2B2TC 3ONAB 3HZXA 4DV3L 3KF8A 2UU9L 1I6HH 1ET9A 2LMCB 4JOIA 4RFBA 4A3KB 1STHA 3PUYA 4CBVA 2L4NA 2R6GA 2EIFA 2JN4A 3GTQB 3CQZH 2EDGA 3PMFA 1WTVA 3K0YA 3B6YA 4XQJA 3J7AF 2F4IA 1C48A 4RH6A 4FDBA 2PQAB 4DAMA 3RLOA 3KK7A 1PH1A 5GAHC 1Z9FA 3RR5A 1BO0A 1A3UA 1NAPA 5EPKA 3L2PA 4A93G 1ILPA 1WCMG 2OTJA 4YCWA 2JA5G 3NUCA 4GNXA 1XMQQ 4L8JA 2B3GA 3PO3B 1D2BA 2K7VA 5T1GA 3NEMA 2O2LD 3AQQA 1XMQL 4QL5A 4JOIC 4KD3A 3GTKH 5FO7B 1F9PA 3VYSA 1N8RC 3MA2B 4YWLA 2WB1G 5I2YA 3NTHA 2KOLA 4LFBQ 1KD1C 2IHEA 5I6WA 2WAQB 1WOCA 4MTNA 1NJIC 3FDTA 3S1NH 1I4QA 2XNAC 3RZDB 2CVRA 5ELFA 2AHOB 1TWFH 2PQEA 3H94A 3E6ZX 4X3SA 5C0XG 3ULLA 3NSWA 1Y69U 4G7OC 4KKUA 3A7AB 1J6QA 1YNXA 4AYBG 1LTSD 5CYUA 1YHQA 3H91A 2K1BA 4IUPA 1B9NA 2YYZA 4LUVA 3J80L 4A3MG 4I65A 5EBCA 4YY3Q 4DK0A 1SXTA 1TQOA 4A3GB 2L12A 1R4PB 2KBNA 5DAUA 1OTCA 2JA7H 1QWYA 4B9XA 4DR3L 2JXMB 1QZHA 3M4YA 2ES2A 4JI5Q 4RKLA 1TWHH 2DJGC 2SNSA 1KC8C 2NVYH 1ML0D 2LKVA 1K9MC 4L63B 1ONLA 1QB5D 2IJ0A 3RLNA 1AH9A 1CI3M 3I4MH 1PH2A 1SEBD 4ZAIA 4BBSB 1ENAA 1SJHD 5F2DA 2HCCA 3T1YQ 3MXUA 4X62Q 4N9PA 2SNMA 3IAYA 2Z8LA 3OPOA 3CC7A 4WORA 1XMOL 1K0RA 2C5CA 1VCIA 4IZ8A 5M5YB 5C44B 1IBLQ 4A3GH 1VQ4A 3S15B 2JYOA 1O78A 3IRBA 1IBLL 2I5MX 4QMGA 4HIOA 3E0JA 3VA7A 3SK8A 1BCPB 2EYPA 4TSSA 1K73C 5LMUL 1W6KA 3K8AA 4EVOA 2FHTA 3I8ZA 3RN5A 1C8CA 3A0JA 1TWGB 2HQEA 2RSOA 2B8GA 4ODGA 1QVGA 2VB3X 1DXMA 3S16H 5EGTA 1CA6A 3OMCA 4G4KA 5D14A 4K14A 4FNFA 1Q90A 1X6OA 1UAPA 1BDOA 5BN4A 1H9SA 3DEPA 5TSSA 4B08A 4NW2A 4JV5Q 2F0UA 5C44H 2KCCA 4MN3A 2NVXB 2EY6A 2XRSD 3D6WA 2NZOA 2NN6G 1S4ZA 2CKZB 2N78A 2IW3A 2QKIC 4JV5L 1K28A 4DAYB 3HOYH 1MSHA 3Q23A 4FO2A 5ELOA 4DV1L 1KDBA 1QUQB 4DA2A 3TREA 4HEDA 4QF4A 5CGKA 3A5UA 1PRTF 4TRDA 1PRTC 4K5XA 5I9PA 3TRZA 3HOWG 2FXQA 2OEOA 4IUQA 4XXEA 2R92H 3DWAA 1HNZL 1HFGA 1PFNA 3BVGA 3EVQA 1UUPA 3JAMi 2LFNA 3OTOQ 2ICIA 2VQFL 3E5SA 3HOXH 3HRZC 4DR7L 3J81c 2NYZD 1TKWB 3OW7A 1LTBD 4N8FA 4Y7NB 1G2SA 5T1IA 4KK7A 1VQOA 5KNCA 1LT3D 1S5DD 1U9RA 1KNEA 2F3WA 4A3CH 2IHFA 1CQFA 2JK8A 4DU9A 4LF6L 4A3BG 3VYTA 4POFA 1F77A 1HR0W 3HP3A 3OWFA 4ALPA 1SNMA 1STNA 3V05A 3WOEA 4JI2Q 4LF9Q 3J80c 3C46A 5FKAC 2KQ3A 3I4LA 5EQ0A 4XTCS 3M4QA 4R8IA 3R2TA 3A74A 4GZYC 1I5FA 4GKJL 1KLGD 5ELNA 4HJAA 3I4NG 3MWYW 1PDQA 4OONA 2IWHA 4GN4B 4L5RC 1HA5A 4PG3A 2NVTH 3P20A 4FXDA 4RAUC 1AEXA 4BXXG 3SK6A 1YNNC 5JPMC 3W2DA 3Q22A 3HOUB 2NVQH 3NTKA 1FNVA 3GTLH 2PO4A 1JWMD 1SE2A 5HGQA 3M4OH 3S1RH 4ZUIA 4KN7C 4UP8A 5IYCG 1EY5A 2YU9H 1BOSA 2E5LL 1JR0D 3IFTA 1C0AA 1O80A 1BCPD 4KHZA 1B53A 1RCVD 1KRTA 1XPUA 3STBD 1U4RA 4BY1H 4BY7H 3GTGH 1YZ6A 5D65A 4KKSA 5JEAJ 3CCUA 4EX5A 4HAEA 1T5XD 4C2MH 5M5XB 1Q1BA 4MTKA 1PVOA 2K5VA 2L55A 1S40A 1VQLA 2A1AA 3FVQA 4B3MQ 1DONA 4OO1H 4DAPA 1I50B 1PH3A 2JA8G 1FD7D 1JORA 2N49A 1NMFA 4C3HH 4X3TA 4CJ0B 4B3SQ 1S72A 4B3ML 4LFAL 3RN2A 3NXWA 3TBIB 4BS9A 1UWVA 1HZAA 1A62A 1CTMA 3ULJA 4NB3A 3TZDA 1EEFD 2KHJA 4DR2L 1JJGA 4K5VA 4JW0A 5M5WB 2OQKA 2HQLA 2KA7A 1A63A 4LNQA 5D3DA 3DM3A 5EPLA 2BDOA 3X3MA 4A3FH 4YWMA 4JYAL 1T5EA 5C3EG 2H5XA 2B2WA 2Y0SB 5C4XH 1F2YA 2B29A 1N36Q 2H1EA 3PF4A 1NMGA 1K83B 2E75C 1SFOB 1N34Q 4LF5Q 3K5NA 3MVVA 3EA6A 3NBHA 1Y1VB 5M3MG 1TT2A 1UEBA 2L5TA 1RTOA 5A2QE 1SSOA 2WB1E 2B63G 3K5OA 1X9NA 4DV7L 5J22A 1B8AA 4DNTB 1J5EQ 3CW2C 3MXPA 5EAYA 1FGUA 1FVIA 4JCVE 2GN5A 1MI2A 1J5EL 2RDHA 4DV4L 5FO9B 1JB3A 3GTMH 2B2WC 5DM63 3KDFA 5AJ3L 1NSNS 1IW7D 2IX1A 4X64L 1RF2D 4IUUA 4LK1C 1Z7TA 2GVAA 1IBKQ 3MZ5A 5ELDA 4QJFA 3CC2A 1EL0A 1FNWA 3PV0A 5I4DA 4CKEA 3DLLA 1EY9A 4X3UA 3D0FA 1BKBA 4CDDC 2CWPA 5ELEA 2QEJC 5KNDA 2QDBA 4JI1Q 3HOYG 2XIWA 1OO9B 5BR8Q 2BOSA 4A75A 5NUCA 1KL9A 2ZJQA 3CP0A 4A93H 4AYBB 1WCMH 4JI1L 2JA5H 1PHJA 3FMCA 2QW7A 4K8IA 5JEAH 5IGFA 1L0YB 1VQKA 2R92G 2HDLA 3SEBA 5IGBA 3JAME 1BQQT 3C2PA 1SYGA 4XT3B 2F0NA 4ZCKA 2F0OA 3F8TA 3DMUA 2SDFA 3HOXG 4IFDJ 2RDFA 1CA5A 5JJKA 3BDLA 4OXPA 3HS0C 4ZK9B 1WVLA 2PQAA 1KRSA 1X32A 1JCKB 2WACA 5CR3A 5IP9G 4RGOS 5IYDG 2JA6G 4JC0A 1CKNA 4G57A 4XIGS 4XYQA 5C0XH 1SNCA 2AUKA 2A6ED 1UE1A 1R9TH 1EWIA 1HNWQ 2UXDQ 2MFIA 2GA4B 3PIPA 4G7HC 2JP1A 4R9WA 4A3JB 1FL0A 1BBWA 2HIXA 4K0KL 4Z9CB 4OELB 1X3FA 1U5KA 1XXGA 2H4OA 1YI2A 4A3MH 1Y1WG 4IUVA 1JT8A 2N8NA 3CCRA 2LXJA 1IYVA 2Q8IB 3CCMA 4QQBX 1BBUA 3SVMA 4AQYQ 3CMAA 1II3A 2XSCA 4C3IB 2G9DA 3D4RA 1STBA 5IE8A 3FKIB 3RD4A 4B3TL 4BBRG 1PH6A 1MJEA 2MGSA 3HOVB 4GN5A 1I4HA 4A3IG 5C4JH 2K32A 1I4RA 1VS0A 3K6OA 3GTOB 3HKZE 3KOJA 3PO2G 2BA0A 1SNDA 3LWEA 2B2UA 3CCVA 1N32L 4BA1I 5E1FA 2CH4W 1C4QA 2JEBI 4J1MA 3K7AB 1E2WA 1YHBA 2HD3A 3GQBA 4UPAA 3KLRA 3QIAA 1TWAB 3MHBA 4R4QA 4CHTB 3ZYYX 1VQJA 4YCUA 1BXTA 1QVCA 5KYLA 1FJGQ 5I2XA 1RDPD 1EZ6A 2PZUA 1KAAA 3MEHA 1QE6A 3G71A 3I7FA 1MGSA 1SE8A 2A5HA 1AW7A 4GKKQ 1F2LA 2B2UC 4RG1A 5LL6X 2ZJRA 4NP5A 1EUJA 4R4IA 4OO1G 2E8GA 1SMYD 1GVPA 4GKKL 2QCPX 1LT6D 1Q86C 2QDLA 1KHIA 3MFYA 3UDFA 1FGBD 2KENA 2ZTEA 1I3QH 1VQAA 3DWPA 3S17B 4LF4Q 3NQIA 4KD4A 4XT1B 4WJ3M 4IALA 4QIWE 3T1HQ 2VY3A 3K7UC 4CDFC 1SRUA 5FLMG 1I6HB 4X3KA 3SGIA 3MXNB 2B2TA 3I3CA 2NN6H 2N88A 3A54A 3NBIA 1YNND 4A3FG 2XN9C 1B50A 4DXFA 2J4XA 2G9HD 4KKTA 4O0AA 2M2LA 1HZBA 3CQZB 1XX8A 4DV2Q 3TS0A 3HOWH 4LF8Q 3NK9A 4X66L 1GO3E 3J80E 2X6GA 1UNSA 1Q1EA 3GTPH 4DV2L 4LF7L 1Q7YC 4LF8L 3SR1A 4C3JH 3H0GG 3N52A 1F2MA 2A6HD 2UU9Q 3L0OA 1ENCA 4HSVA 1BCPF 1BCPC 3EBEA 3I91A 5K5PA 1VQFA 4QUCA 1PH4A 2XGTA 2QILA 4DAYA 3GTKB 3STBC 1TU2B 1B3QA 4DXGA 1QUQA 3GO5A 3BDCA 5IGEA 2K04A 5DLQE 1JJ2A 4A3BH 3Q24A 4KHVA 1CT1D 2IT1A 2ZJPA 3F2CA 3DWQA 1GXDC 2ASBA 4K5WA 1YJ9A 3S1NB 1NR2A 1CKOA 1B3AA 3P75A 3PUZA 1EYAA 1TWFB 4RGTA 2PPBC 4HSPA 5KYIA 1LTRD 4P74A 4DNRB 1SYCA 4ZRZA 2NWGA 2F3VA 2K5WA 2E2DC 1VDZA 1MD2D 1UE6A 1I6VC 1DOLA 3UDXA 3I4NH 5JEAG 4IPGA 1DZ1A 4RGNA 1LYLA 1E3PA 2K5NA 4CGYB 3BVMA 2R7DA 3PCOB 2PYKA 2Z4HA 3PUXA 2B2YC 4BA2I 1X3QA 2D0PA 5EKLA 1G6PA 4QB4A 4BXXH 2K03A 1WYDA 1F9RA 1E2ZA 2JA7B 2NUCA 3TP6A 2KEEA 4KN4C 3GV3A 2R7ZG 1KAWA 1VQGA 4O2DA 3CRKC 4HJ9A 4IOCA 1TWHB 3E9IA 4JBWA 5IYCH 5JAVA 4J6HA 2NVYB 1EFWA 1Z47A 2NTTA 5FLXL 4JI6L 5AFWA 3G6EA 4DR4Q 4NDXA 1XNRL 3I4MB 2E2IH 2VXWA 4IJLA 1UEAB 4DR4L 3VR2A 4PV1C 4P75A 5ISRA 1A6XA 1WJJA 2KUMA 1Q8IA 4DV6L 1S5CD 1B44D 2HHHQ 4A3LH 3I72A 3JAMc 1IW7C 4DR3Q 3BZCA 1HTLD 1IKMA 2F03A 1VQ9A 2PW5A 2HHHL 1YVCA 4H0LC 5LMNQ 2JA9A 2JA8H 4R4CA 1KDAA 4JK1C 4ULLA 3MAQA 5GADC 5LMNL 3A55A 3RMHA 1JOKA 4JI3L 3S16B 3WWVA 3CCEA 4LUOA 4IPHA 3NENA 2KJXA 3EJIA 4OO1I 4DF7A 1XMOQ 3CCLA 2D62A 5C3EH 1O7ZA 1PTOH 2LSSA 4UDUC 2NTSA 1GKHA 3S14H 2VUMH 1PYSB 1RHPA 4K6LA 2NBFA 4LFCL 4DK1A 1EIHA 1ESRA 1EQQA 1D6EC 5LMUQ 2QF7A 5HURA 4PMBA 3HOYB 3R8BA 2SOBA 5M3MH 2EYHA 2KCTA 4N8X1 2B63H 3U4VA 1X55A 3M4PA 2A6EC 3SHLA 2MNAA 3EQLC 3HEJA 2R92B 3U58A 2OCEA 2LY7A 2EZVA 3RZOH 2DGYA 2WP8J 4PNYA 1BVSA 4H7BA 4HIKA 4IFDG 3HOXB 3VR4A 3ULPA 5BN3A 2F0IA 3W5OA 4U68A 3OMGA 4HMJA 1X65A 1VQPA 3WDNA 3Q0AA 1PYBA 3HKZG 1KIXA 1MSGA 1KTKA 4DV1Q 2AQ2B 1K3BC 2RDGA 4CKCA 2N55A 3CCQA 4HIMA 2MJ8A 1VQEA 1HNZQ 1RL2A 3ITPA 1IBML 3TS2A 1T9HA 2D5DA 2K33A 3C1FA 4PMCA 1SE3A 2VQFQ 4A76A 4DR1L 4DR7Q 4Y52H 1U0LA 1TVXA 4C3JG 5FOBB 5IWAQ 1VQNA 1L1OB 1EWCA 2EY5A 4I7ZC 5IWAL 2K01A 2PMZE 1LV9A 2FINB 1K8GA 5GROA 3KLSA 3VA5A 5IP9H 5IYDH 3CXCA 2KCMA 2JA6H 2NVTB 4HMIA 4LF6Q 2IPKD 1HQMC 3F2UA 3PUWA 4TKOB 3PIOA 2NVQB 4CJ1B 3GTLB 1E0BA 2MPMA 4L6TB 4A3EG 1XTDA 1D5ZC 2AQ3B 3M4OB 3S1RB 4IUTA 1EYCA 2K52A 1HUNA 3CF5A 1C9OA 4GNXB 2UUAL 1VQ7A 2YU9B 3A8KE 3UE0A 1A2UA 1AN8A 1KLUD 5C4ZA 1Y1WH 1SMYC 4E6IA 2JE6I 1EZ8A 3K57A 4RGMA 5C0XI 3U9OA 4GKJQ 5GAGC 4DUZL 4BY1B 2KCNA 2I0QA 4BY7B 3A8JE 2AKWB 5KGUA 3GTGB 2UXBQ 4JBJA 3S1MH 1IZ6A 2K75A 4HCEA 3J7ZC 5M3FH 1ZEQX 2UXBL 2QEXA 2I46A 4L5QA 2DY7A 4BBRH 4C2MB 5IY0A 2DY8A 2XVSA 3MTSA 3T13A 3H3VI 4RHRA 4OWXB 4A3IH 3MFGA 2RCFA 2F0KA 3UI2A 1MBYA 2F3IA 4L5TA 2F52A 2C35B 3PO2H 5CV5A 2F0LA 2F0PA 3FPUB 4HTHA 2RHQB 4C3HB 2E5LQ 1DCZA 2A73B 1H9RA 1SYBA 2F4VQ 1AP0A 4RCNA 1QNUA 4NMZA 1EQVA 2A74C 1YNJD 3L3OC 1EYDA 1X56A 2F4VL 1YBYA 1VQ6A 1G8ZD 4WRDA 1H95A 3BG3A 2P5ZX 3UDIA 2EJFC 4Q0FA 3QB3A 2A6HC 1K8MA 3D3RA 4A3FB 1RODA 5D3IB 3FEWX 4S3SA 1W2BA 3KLWA 5C4XB 3G4SA 2LS01 1HR0L 5LHY1 1D5XC 5EKIA 3RLFA 1EY4A 5GAEC 2RHSB 4A3LG 2C9OA 3L9AX 1TWCH 4ZYSA 1VQBA 2OTLA 4LFAQ 3D8GA 4QCLA 4A3DH 5IT9L 2OT2A 1VQ5A 3PO3G 4DR2Q 3G6JB 1E22A 2PZWA 1QG7A 3RUZA 3W1GA 1GUSA 1XNQQ 5FLMH 2EYOA 3S2DH 4UP7A 2WFWA 1HUMA 5J3BA 2RBMA 3NE5B 5KNBA 3K59A 3ERSX 3SXHA 1XNQL 4JYAQ 4FP5D 2HIVA 3GTMB 2DUDA 2WAQG 1BBXC 1D1IA 3I73A 1F2ZA 1QZGA 4JI4L 4KI0A 3HOZH 1VQ8A 4WJ4A 2HCIA 3KLSX 3J81i 1YEZA 4NPSA 5C3WA 1CZGA 2VUMG 1GUNA 2E76C 3DHQA 2CWAA 1AZQA 3K5MA 2A68D 3G7LA 5E4XA 1W3SA 4HIDA 1G91A 1PFSA 3K80C 2NN6I 2K14A 2F0GA 4DV7Q 2FMMA 3KBXA 1G291 5BN5A 3H0GH 4A93B 2E2HH 1LTTD 1WCMB 3K0XA 2JA5B 2OWOA 4DUYL 3MXNA 1CHPD 2M9VA 3I2ZA 4NKLA 4DV4Q 5FO8B 3AFQA 3TN2A 3T53B 5AJ3Q 3OIPA 2V4DA 4X64Q 3TP8A 1LABA 2XWBB 2WB1B 4M8AA 2VW9A 1SDFA 2F0DA 1YITA 1A3VA 4YHHL 1R4QB 1GD7A 5G3LD 5JVH3 2G5DA 1MJCA 3GV6A 2RF4A 1PFBA 1TY0A 4EGVA 4HJ8A 1EOVA 2E74C 1EQTA 1B2TA 1A0IA 2ZTDA 1PV4A 3IFDA 4BBSG 3PUVA 4Q5VA 2B2VC 3CRLC 1SE4A 3KYHC 1JMCA 1R9TB 4WJWA 1A8VA 2A19A 3QG1A 4O42A 4NXNQ 4XYOA 3OHXC 3V2TA 4X65L 1FNUA 4NXNL 4IPDA 3WOFA 4R1JA 4A3MB 1E1TA 4IPCA 3O13A 1V1PB 4MHEA 1N33L 1MIUA 2UUCL 4O1NA 4ZLTF 2CQAA 3AFPA 4HR7B 1HRJA 3SDZA 1AFPA 2R7ZH 3QOLA 1NUCA 1X3GA 2WINB 4JPBW 1DGSA 3QJYA 4ME3A 1ILQA 4FXGC 2MQHA 2PZTA 1KQSA 2VL6A 3TDQA 4PQXA 1V43A 1CUKA 3PIP3 1GUWA 3FPPA 1S5BD 5I6YA 1A2TA 1L0XB 5A35A 5C4JB 5DM73 1ENFA 4GS3A 1LO5D 2CCZA 4K0KQ 1TS3A 4V0BA 4U673 2VZAA 4BWGB 3DEOA 5DEHA 3VR6A 2OF1A 5CBEE 3MXGA 3ND8A 3H3VH 2K5HA 3IKJA 4H44C 1V1OA 2AUJD 2L11A 1AE3A 2Q2TA 1PZID 4B3TQ 3RNUA 3LWUA 3K5LA 5M3FG 3BDOA 2EJGC 3D31A 1PMRA 4JBKA 4B3RL 1YIJA 3URYA 4KTAA 1VQMA 3H15A 1N32Q 2L0CA 3J81j 4F88A 2F0HA 1K8AC 2JEAI 4YWKA 4DK6C 5COYA 1I3QB 3NHHA 4FYDA 3AYHB 1DYQA 4DKAC 2ZT9C 3M7GA 5KRUA 4DR6L 3HKZB 5C6AA 1XPRA 1GM5A 2ZXPA 1KABA 4R4TA 2DJFC 1V9PA 1E24A 3ERQA 3TP5A 1HNXL 2KHSA 3S1QH 5IODA 3A8IE 2B8FA 4DR5L 3HOWB 4K6DA 1PH5A 1EQRA 1ZYRD 1VQDA 3GTPB 4EQOA 4L5SA 4ME5A 5ELBA 5JVG3 2AWOA 2D0OA 2Q2IA 4A3DG 3BZKA 3BS1A 4C3JB 4UP9A 2EY1A 1L2FA 1Q81C 4KV6A 2DNCA 4IFDH 3S9WA 2VNUD 3E3XA 3VYUA 1BUVT 3SK5A 1B4OA 2YTXA 3EFXD 4LAAA 2Z1CA 1XPOA 5EPJA 5FLXE 3AU7A 2IX0A 4F8MA 4A3BB 3HOZG 4X66Q 4OWWB 4IQZA 4LF7Q 3QWNA 1X54A 4FXKC 3J7AV 1PXUA 5EJWA 1M8AA 3OSOA 1HCZA 2RA4A 1I94L 4G7ZC 3DXJC 1O7LA 3KBGA 1DD2A 3GTJH 1PA6A 4KHPL 3CKIB 4WFN3 4OL7A 5FJ8G 1EU3A 1YNJC 3KDFB 3U4ZA 3I4NB 2RSNA 3R2IA 1ESFA 2UUBQ 4ID6A 2O5IC 1SR3A 3OYYA 2E2JH 3HKSA 3ER0A 2FMCA 3M3YH 2UUBL 3S2HH 3K81C 5C5MA 3CHBD 4MZ9A 1EIFA 1HTPA 3U50C 2B2YA 2BA1A 4RCOA 1OXTA 2NZHA 4A3EH 3I90A 2K5DA 2KHIA 4DV5Q 3CC4A 1QCBD 1PFMA 5L37A 5CV6A 3F2DA 4DV5L 5CBAE 4B9WA 3NTIA 4JI7L 1TIID 2DNEA 2EOTA 3CCJA 1PYWD 1SJED 1L1OA 4IN3A 2E2IB 4ZUJA 1UE7A 2K4KA 3AEVA 3X3NA 4J8QA 1PZKD 1A15A 2Y0SG 1JWUD 1O7IA 3BYTB 3C3LA 1SYFA 2F0JA 2VB2X 4N9TA 2X69A 4UHVA 1WTOA 2R93H 4GOPC 2D2CC 3GDEA 2I5HA
chains in the Genus database with same CATH topology
1E1OA 1HH2P 2OQKA 2HQLA 1VQEA 1VQIA 1Y1VG 1A63A 4DR6Q 4LNQA 4OX9Q 1CKNB 1HNZQ 1RL2A 3DM3A 4GLXA 1IBML 4UY8C 4AQYL 3TS2A 4A3FH 4YWMA 5LMNW 2YTYA 1T9HA 4JYAL 5C3EG 4HJ7A 4OX9L 2UXCQ 2H5XA 2VQFQ 2WAQE 4A76A 5C4XH 4DR1L 4JI6Q 1U0LA 1HNXQ 4POGA 4DR7Q 4Y52H 2B29A 2PNHA 1N36Q 1L1OC 2OQ0A 3BU2A 5IWAQ 1VQNA 1JJCB 4A3JH 1XNRQ 4A4IA 3F2BA 4DR5Q 3PF4A 2UXCL 1NMGA 4LUZA 2IY5B 1AE2A 1M90C 1L1OB 3KF6B 1N34Q 4LF5Q 5IWAL 4PZ6A 2PMZE 2Q2UA 2LXKA 4A3KH 5GROA 2EQSA 1YJWA 3HFZB 1K8GA 5IP9H 5M3MG 1SN8A 1UEBA 5IYDH 3CXCA 2KCMA 2JA6H 3GTQH 4LF6Q 1Q8KA 2WB1E 2B63G 1X9NA 4DV6Q 4DV7L 4LFBL 4BY1G 3G48A 1B8AA 1VQHA 4BY7G 3PUWA 1J5EQ 4H02A 3M85A 3PIOA 3CW2C 4C3IH 2ATWA 5EAYA 1FGUA 4A3EG 1FVIA 1XTDA 4JCVE 2GN5A 1J5EL 2HT1A 3FKIH 4DV4L 4GNXC 3GTMH 2K52A 1YHAA 1FJGL 1NTGA 3KDFA 5AJ3L 3CF5A 1C9OA 4GNXB 2UUAL 5IP7H 1VQ7A 3HOVH 2IX1A 2QA4A 3M9BA 3UE0A 4X64L 1Y1WH 2JE6I 2GVAA 3PO3H 4DK3C 4J15A 3HOUG 5C0XI 4JI3Q 4TVAB 1IBKQ 4GKJQ 4QJFA 3CC2A 5GAGC 3GTOH 3PV0A 4JG2A 2PI2A 4DUZL 2I0QA 3DLLA 2AKWB 2AMCB 1EIYB 2CFMA 2UXBQ 5JJLA 4JBJA 1LM0A 3D0FA 4APVA 1NY4A 1BKBA 3S1MH 3NBHB 2CWPA 2L15A 1IZ6A 3HOYG 4JI1Q 2K75A 1TXYA 3K7AH 1I94Q 2MO0A 3J7ZC 5M3FH 5BR8Q 4YY3L 2UXBL 2QEXA 4L5QA 4A75A 1KL9A 2ZJQA 4BBRH 3CP0A 4A93H 5IY0A 4JI8Q 1TWAH 1WCMH 4JI1L 4LF4L 2JJQA 2JA5H 1PHJA 3T1HL 3H3VI 3M7NA 4OWXB 4A3IH 3TQYA 4KHPQ 3JC66 3RZDH 4JI8L 4LFCQ 2F3IA 1VQKA 4L5TA 2F52A 4JI5L 1CSQA 2C35B 3PO2H 3MEFA 2RHQB 3KJOA 2R92G 2E5LQ 4PZ8A 5C4XG 4P73A 2F4VQ 2JQOA 2VS1A 1P16A 4IOAA 3F8TA 4A3JG 3I4OA 3HOXG 4IFDJ 4JBMA 1X56A 2ZM6Q 1YBYA 2F4VL 4GLAC 4OXPA 1VQ6A 5JJKA 1H95A 4YCVA 3UDIA 4TQUS 5GQOA 2PQAA 1KRSA 1Q82C 3T1YL 2ZM6L 1IL2A 2BH2A 5IP9G 5IYDG 1B70B 1SLJA 3NELA 1CKMA 4X62L 2JA6G 3ZJYC 4JC0A 1CKNA 4XIGS 4DV3Q 4GOPA 3BJUA 3S17H 1UE1A 1XJVA 4JI7Q 3E0EA 1W2BA 1R9TH 3KLWA 1EWIA 3W1BA 4DV3L 3G4SA 1HNWQ 2MFIA 1HR0L 2UXDQ 2N3SA 1L0WA 3RLFA 3PIPA 2UU9L 1I6HH 3Q8DA 5GAEC 2RHSB 1FL0A 4DNIA 4A3LG 1BBWA 1TWCH 3FKIG 3LGJA 3KFUA 1VQBA 1HZ9A 2HIXA 3A5ZB 2OTLA 3S24A 1CSPA 4K0KL 4JOIA 4LFAQ 1X3FA 1U5KA 5IP7G 1YI2A 3HOVG 4A3DH 3PUYA 2A8VA 4A3MH 3E9HA 2R6GA 1Y1WG 1VQ5A 2EIFA 1JT8A 3PO3G 2N8NA 3CQZH 3CCRA 2LXJA 4LWCA 3CCMA 4DR2Q 4QQBX 1BBUA 1E22A 4BBSH 3B6YA 4AQYQ 2MO1A 3CMAA 3PF5A 3W1GA 4IO9A 4JI0Q 1XNQQ 4FDBA 5FLMH 1V1QA 2PQAB 1IXRA 3S2DH 4DAMA 4UP7A 2WFWA 5J3BA 3RLOA 1IBMQ 5IE8A 1ASYA 3ERSX 1PH1A 4JI0L 5GAHC 1Z9FA 4B3TL 1XNQL 2HIVA 3RR5A 4JYAQ 4AIMA 4OWTB 2DUDA 4GOPB 2WAQG 4BBRG 3L2PA 5M5YH 1QZGA 1PH6A 1MJEA 4DR1Q 4JI4L 4A93G 1WCMG 2OTJA 4YCWA 4GN5A 4KI0A 2JA5G 4GNXA 1XMQQ 3HOZH 4A3IG 1VQ8A 2VQEQ 3CAMA 3S15H 5C4JH 2B3GA 3KF8B 4WJ4A 3NEMA 3AQQA 3J81i 5H1SE 1VS0A 1YEZA 4NPSA 4QL5A 3HKZE 4JOIC 3KOJA 1XMQL 3PO2G 2VQEL 3GTKH 2BA0A 2VUMG 4LW1A 2CWAA 3CCVA 2ID0A 1N32L 4BA1I 3ICEA 4R4OA 1N8RC 1TWGH 4YWLA 1W3SA 4HIDA 1PFSA 2JEBI 2WB1G 3K80C 2NN6I 2K14A 1YHBA 4LFBQ 4DV7Q 1KD1C 2IHEA 1G291 3H0GH 4UPAA 2E2HH 4NXMQ 2BH8A 1WOCA 4R4QA 3K0XA 4PZ7A 4MTNA 5FLXc 1NJIC 1VQJA 4HJ5A 2OWOA 4YCUA 4DUYL 3S1NH 1QVCA 3I2ZA 3CMEA 4NXML 4DV4Q 3AFQA 1YJNA 2AHOB 1TWFH 1FJGQ 5AJ3Q 5C0XG 1MKHA 5K36G 2UUAQ 3ULLA 4X64Q 3OTOL 1WI5A 1J6QA 1YNXA 4AYBG 3I7FA 2VW9A 3G71A 1YITA 1SMXA 2NVXH 4DUZQ 4YHHL 1SE8A 1GD7A 1YHQA 4AH6A 4GKKQ 1MJCA 2QGQA 4RG1A 2YYZA 2RF4A 2ZJRA 1EUJA 4R4IA 4OO1G 2E8GA 4X6AH 1GVPA 4LUVA 4HJ8A 4GKKL 1EOVA 4A3MG 3I55A 1Q86C 1KHIA 3UDFA 1A0IA 4YY3Q 2KENA 2ZTDA 1I3QH 1VQAA 2ZTEA 5IYBH 3TEHB 1PV4A 3HOZG 4BBSG 3PUVA 4DPGA 4LF4Q 4WJ3M 2KBNA 3KYHC 3T1HQ 4QIWE 1JMCA 1OTCA 2VY3A 5HY6A 3K7UC 2JA7H 1SRUA 3CPWA 5FLMG 4DR3L 1QZHA 1A8VA 2A19A 3SGIA 3MXNB 2R93G 2ES2A 4NXNQ 1OXSC 4GOPC 4DV0Q 4JI5Q 1OXUA 1TWHH 4JI2L 4LF9L 4X65L 1KC8C 1RIPA 4NXNL 2NVYH 4A3FG 4IPDA 4DV0L 1K9MC 4R1JA 1E1TA 4MNOA 4O0AA 1HZBA 4IPCA 3RLNA 1AH9A 4DV2Q 3TS0A 3I4MH 4Y7NH 3HOWH 1PH2A 2XTIA 2GVBA 1X3EA 4X66L 1MIUA 2UUCL 4LF8Q 1GO3E 1N33L 3AFPA 1Q1EA 3T1YQ 3GTPH 4DV2L 4LF7L 4X62Q 1Q7YC 4LF8L 2R7ZH 1X3GA 1D7QA 1DGSA 4ME3A 4A3KG 4KLKA 3CC7A 1XMOL 1K0RA 2MQHA 4C3JH 1KQSA 1NBWA 1Q46A 2PI2E 1VCIA 2VL6A 3H0GG 1K3RA 1SROA 1V43A 1CUKA 1HR0Q 1IBLQ 4A3GH 2Z6KA 1VQ4A 2UU9Q 3L0OA 3UE1A 2R7FA 3F1ZA 3EBEA 1VQFA 3IRBA 1PH4A 4GS3A 2I5MX 1IBLL 2XGTA 2CCZA 4HIOA 1B7YB 4K0KQ 3STBC 2VZAA 1K73C 5LMUL 3K8AA 3CPFA 1QUQA 3RN5A 3GO5A 3A0JA 1HZCA 5DLQE 1JJ2A 4A3BH 1QVGA 3H3VH 2K5HA 3S16H 3KJPA 2IT1A 2ZJPA 2ZTCA 3F2CA 2Q2TA 1AE3A 1YJ9A 2ASBA 1CKOA 4EQ5A 4B3TQ 3PUZA 3RNUA 1X6OA 4JI4Q 5JJIA 4P74A 2Z6KC 1QVFA 2RCNA 5M3FG 3HOUH 2JA7G 3D31A 4JBKA 4JV5Q 4B3RL 5C44H 1P8LA 1UE6A 3UDXA 1YIJA 3I4NH 2ALYB 2NN6G 2CKZB 2NZOA 2N78A 4IPGA 5JEAG 4IFDI 1VQMA 4JV5L 4DAYB 3H15A 1N32Q 1LYLA 1E3PA 2K5NA 3CD6A 3HOYH 2K50A 3J81j 2R7DA 3PCOB 4B3SL 4DV1L 2YV5A 5ELOA 1QUQB 5C0XJ 3PUXA 2Y0SE 3TREA 1K8AC 2JEAI 3UDGA 4YWKA 4DK6C 1UE5A 3A5UA 4BA2I 2D0PA 3TRZA 3OW2A 1D8LA 1OXXK 1C7YA 3I4MG 4BXXH 2I5LX 1WFQA 2FXQA 3HOWG 1G6PA 3AYHB 1WYDA 4IJHA 4DUYQ 4DKAC 1Q12A 2R7ZG 1KAWA 1VQGA 4O2DA 2R92H 4DR6L 5FJ8H 1HNZL 1XPRA 4HJ9A 4IOCA 3E9IA 4JBWA 1ASZA 1E7ZA 1GM5A 3JAMi 5M5XH 5IYCH 1PH8A 4R4TA 3VDYA 3OTOQ 1V9PA 2VQFL 3HOXH 1E24A 1EFWA 1Z47A 1LTLA 4A3GG 4DR7L 3J81c 1EYGA 1HNXL 4JI6L 3J80i 3G6EA 4DR4Q 1N36L 4YHHQ 3S1QH 1XNRL 4DR5L 2E2IH 1PH5A 1I50H 1VQOA 1EQRA 4IJLA 4DR4L 1N34L 1VQDA 4LF5L 3CCSA 4L5SA 4P75A 4A3CH 2IHFA 2JK8A 2AWOA 1IYJB 2D0OA 2Q2IA 2V1CC 4P72A 4A3DG 3EIVA 1KXLA 3BZKA 4LF6L 4A3BG 1WJJA 4UP9A 1L2FA 4DV6L 4POFA 1Q81C 2HHHQ 4A3LH 5M5WH 3JAMc 4DR3Q 1HR0W 3BZCA 4ALPA 1PH7A 2VNUD 5E7NA 1VQ9A 2HHHL 1YVCA 4JI2Q 5LMNQ 3J80c 2EXDA 4LF9Q 2JA9A 4X65Q 2JA8H 4R4CA 2YTXA 1G51A 1XPOA 4XTCS 3M4QA 4RMFA 5LMNL 5GADC 4AYBE 2YTVA 2IX0A 5C44G 3PGZA 1K83H 3A74A 4JI3L 4X66Q 1IBKL 1I5FA 1SFOH 2UUCQ 1N33Q 5ELNA 3WWVA 4HJAA 3I4NG 4GKJL 3PSIA 3CCEA 4OWWB 4LUOA 1PH9A 4LF7Q 4IPHA 1X54A 3NENA 4OONA 1NE3A 1Y1VH 4GN4B 4L5RC 4PG3A 2NVTH 4OO1I 1XMOQ 3CCLA 1I94L 4BXXG 5BR8L 2D62A 5C3EH 2Q2HA 2NVQH 2LSSA 1Y14B 3GTJH 1M1KC 3GTLH 1PA6A 1GKHA 3S14H 4KHPL 2VUMH 1PYSB 5FJ8G 5HGQA 4LFCL 3M4OH 3KDFB 3U4ZA 3S1RH 1EQQA 4QGUA 5LMUQ 4GLVB 4UP8A 4QY7A 5IYCG 2UUBQ 2YU9H 2Z0SA 1JB7A 2E5LL 1C0AA 5M3MH 3FP9A 1SR3A 2KCTA 3OYYA 4KHZA 2E2JH 3HKSA 3ER0A 1LUZA 3M3YH 2UUBL 1JE5A 1OXVA 3I56A 3K81C 3S2HH 2B63H 1KRTA 1XPUA 3L7ZC 3STBD 4MZ9A 4P71A 1EIFA 3U50C 3U4VA 4BY1H 4BY7H 1X55A 4GN3B 3M4PA 3GTGH 2BA1A 1YZ6A 1OXTA 2NZHA 3EN2A 2MNAA 4A3EH 4A3CG 2KHIA 5JEAJ 3CCUA 4DV5Q 3CC4A 3U58A 2OCEA 1HJPA 4EX5A 1N9WA 3RZOH 3J7A5 2DGYA 3F2DA 2WP8J 4C2MH 4DV5L 1Q1BA 5IT9c 1BVSA 4JI7L 4HIKA 4IFDG 5IYBG 1PVOA 3FHWA 3ULPA 2K5VA 4B3RQ 1HNWL 2UXDL 1S40A 1VQLA 2A1AA 3W5OA 3CCJA 1L1OA 3KF6A 4B3MQ 1UE7A 2K4KA 1X65A 1VQPA 1PH3A 2JA8G 1VQCA 1PYBA 3AEVA 3HKZG 1KIXA 2N49A 1NMFA 3GD7A 4C3HH 4B3SQ 4DV1Q 1S72A 4B3ML 4LFAL 2Y0SG 3RN2A 1O7IA 1UWVA 1HZAA 1A62A 4PMWA 3ULJA 4NB3A 2KHJA 4DR2L 1JJGA 3CCQA 2R93H 2AWNA 4HIMA 1S3OA 3GDEA 2CQOA 2I5HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E1O A;  1HH2 P;  2OQK A;  2HQL A;  1VQE A;  1VQI A;  1Y1V G;  1A63 A;  4DR6 Q;  4LNQ A;  4OX9 Q;  1CKN B;  1HNZ Q;  1RL2 A;  3DM3 A;  4GLX A;  1IBM L;  4UY8 C;  4AQY L;  3TS2 A;  4A3F H;  4YWM A;  5LMN W;  2YTY A;  1T9H A;  4JYA L;  5C3E G;  4HJ7 A;  4OX9 L;  2UXC Q;  2H5X A;  2VQF Q;  2WAQ E;  4A76 A;  5C4X H;  4DR1 L;  4JI6 Q;  1U0L A;  1HNX Q;  4POG A;  4DR7 Q;  4Y52 H;  2B29 A;  2PNH A;  1N36 Q;  1L1O C;  2OQ0 A;  3BU2 A;  5IWA Q;  1VQN A;  1JJC B;  4A3J H;  1XNR Q;  4A4I A;  3F2B A;  4DR5 Q;  3PF4 A;  2UXC L;  1NMG A;  4LUZ A;  2IY5 B;  1AE2 A;  1M90 C;  1L1O B;  3KF6 B;  1N34 Q;  4LF5 Q;  5IWA L;  4PZ6 A;  2PMZ E;  2Q2U A;  2LXK A;  4A3K H;  5GRO A;  2EQS A;  1YJW A;  3HFZ B;  1K8G A;  5IP9 H;  5M3M G;  1SN8 A;  1UEB A;  5IYD H;  3CXC A;  2KCM A;  2JA6 H;  3GTQ H;  4LF6 Q;  1Q8K A;  2WB1 E;  2B63 G;  1X9N A;  4DV6 Q;  4DV7 L;  4LFB L;  4BY1 G;  3G48 A;  1B8A A;  1VQH A;  4BY7 G;  3PUW A;  1J5E Q;  4H02 A;  3M85 A;  3PIO A;  3CW2 C;  4C3I H;  2ATW A;  5EAY A;  1FGU A;  4A3E G;  1FVI A;  1XTD A;  4JCV E;  2GN5 A;  1J5E L;  2HT1 A;  3FKI H;  4DV4 L;  4GNX C;  3GTM H;  2K52 A;  1YHA A;  1FJG L;  1NTG A;  3KDF A;  5AJ3 L;  3CF5 A;  1C9O A;  4GNX B;  2UUA L;  5IP7 H;  1VQ7 A;  3HOV H;  2IX1 A;  2QA4 A;  3M9B A;  3UE0 A;  4X64 L;  1Y1W H;  2JE6 I;  2GVA A;  3PO3 H;  4DK3 C;  4J15 A;  3HOU G;  5C0X I;  4JI3 Q;  4TVA B;  1IBK Q;  4GKJ Q;  4QJF A;  3CC2 A;  5GAG C;  3GTO H;  3PV0 A;  4JG2 A;  2PI2 A;  4DUZ L;  2I0Q A;  3DLL A;  2AKW B;  2AMC B;  1EIY B;  2CFM A;  2UXB Q;  5JJL A;  4JBJ A;  1LM0 A;  3D0F A;  4APV A;  1NY4 A;  1BKB A;  3S1M H;  3NBH B;  2CWP A;  2L15 A;  1IZ6 A;  3HOY G;  4JI1 Q;  2K75 A;  1TXY A;  3K7A H;  1I94 Q;  2MO0 A;  3J7Z C;  5M3F H;  5BR8 Q;  4YY3 L;  2UXB L;  2QEX A;  4L5Q A;  4A75 A;  1KL9 A;  2ZJQ A;  4BBR H;  3CP0 A;  4A93 H;  5IY0 A;  4JI8 Q;  1TWA H;  1WCM H;  4JI1 L;  4LF4 L;  2JJQ A;  2JA5 H;  1PHJ A;  3T1H L;  3H3V I;  3M7N A;  4OWX B;  4A3I H;  3TQY A;  4KHP Q;  3JC6 6;  3RZD H;  4JI8 L;  4LFC Q;  2F3I A;  1VQK A;  4L5T A;  2F52 A;  4JI5 L;  1CSQ A;  2C35 B;  3PO2 H;  3MEF A;  2RHQ B;  3KJO A;  2R92 G;  2E5L Q;  4PZ8 A;  5C4X G;  4P73 A;  2F4V Q;  2JQO A;  2VS1 A;  1P16 A;  4IOA A;  3F8T A;  4A3J G;  3I4O A;  3HOX G;  4IFD J;  4JBM A;  1X56 A;  2ZM6 Q;  1YBY A;  2F4V L;  4GLA C;  4OXP A;  1VQ6 A;  5JJK A;  1H95 A;  4YCV A;  3UDI A;  4TQU S;  5GQO A;  2PQA A;  1KRS A;  1Q82 C;  3T1Y L;  2ZM6 L;  1IL2 A;  2BH2 A;  5IP9 G;  5IYD G;  1B70 B;  1SLJ A;  3NEL A;  1CKM A;  4X62 L;  2JA6 G;  3ZJY C;  4JC0 A;  1CKN A;  4XIG S;  4DV3 Q;  4GOP A;  3BJU A;  3S17 H;  1UE1 A;  1XJV A;  4JI7 Q;  3E0E A;  1W2B A;  1R9T H;  3KLW A;  1EWI A;  3W1B A;  4DV3 L;  3G4S A;  1HNW Q;  2MFI A;  1HR0 L;  2UXD Q;  2N3S A;  1L0W A;  3RLF A;  3PIP A;  2UU9 L;  1I6H H;  3Q8D A;  5GAE C;  2RHS B;  1FL0 A;  4DNI A;  4A3L G;  1BBW A;  1TWC H;  3FKI G;  3LGJ A;  3KFU A;  1VQB A;  1HZ9 A;  2HIX A;  3A5Z B;  2OTL A;  3S24 A;  1CSP A;  4K0K L;  4JOI A;  4LFA Q;  1X3F A;  1U5K A;  5IP7 G;  1YI2 A;  3HOV G;  4A3D H;  3PUY A;  2A8V A;  4A3M H;  3E9H A;  2R6G A;  1Y1W G;  1VQ5 A;  2EIF A;  1JT8 A;  3PO3 G;  2N8N A;  3CQZ H;  3CCR A;  2LXJ A;  4LWC A;  3CCM A;  4DR2 Q;  4QQB X;  1BBU A;  1E22 A;  4BBS H;  3B6Y A;  4AQY Q;  2MO1 A;  3CMA A;  3PF5 A;  3W1G A;  4IO9 A;  4JI0 Q;  1XNQ Q;  4FDB A;  5FLM H;  1V1Q A;  2PQA B;  1IXR A;  3S2D H;  4DAM A;  4UP7 A;  2WFW A;  5J3B A;  3RLO A;  1IBM Q;  5IE8 A;  1ASY A;  3ERS X;  1PH1 A;  4JI0 L;  5GAH C;  1Z9F A;  4B3T L;  1XNQ L;  2HIV A;  3RR5 A;  4JYA Q;  4AIM A;  4OWT B;  2DUD A;  4GOP B;  2WAQ G;  4BBR G;  3L2P A;  5M5Y H;  1QZG A;  1PH6 A;  1MJE A;  4DR1 Q;  4JI4 L;  4A93 G;  1WCM G;  2OTJ A;  4YCW A;  4GN5 A;  4KI0 A;  2JA5 G;  4GNX A;  1XMQ Q;  3HOZ H;  4A3I G;  1VQ8 A;  2VQE Q;  3CAM A;  3S15 H;  5C4J H;  2B3G A;  3KF8 B;  4WJ4 A;  3NEM A;  3AQQ A;  3J81 i;  5H1S E;  1VS0 A;  1YEZ A;  4NPS A;  4QL5 A;  3HKZ E;  4JOI C;  3KOJ A;  1XMQ L;  3PO2 G;  2VQE L;  3GTK H;  2BA0 A;  2VUM G;  4LW1 A;  2CWA A;  3CCV A;  2ID0 A;  1N32 L;  4BA1 I;  3ICE A;  4R4O A;  1N8R C;  1TWG H;  4YWL A;  1W3S A;  4HID A;  1PFS A;  2JEB I;  2WB1 G;  3K80 C;  2NN6 I;  2K14 A;  1YHB A;  4LFB Q;  4DV7 Q;  1KD1 C;  2IHE A;  1G29 1;  3H0G H;  4UPA A;  2E2H H;  4NXM Q;  2BH8 A;  1WOC A;  4R4Q A;  3K0X A;  4PZ7 A;  4MTN A;  5FLX c;  1NJI C;  1VQJ A;  4HJ5 A;  2OWO A;  4YCU A;  4DUY L;  3S1N H;  1QVC A;  3I2Z A;  3CME A;  4NXM L;  4DV4 Q;  3AFQ A;  1YJN A;  2AHO B;  1TWF H;  1FJG Q;  5AJ3 Q;  5C0X G;  1MKH A;  5K36 G;  2UUA Q;  3ULL A;  4X64 Q;  3OTO L;  1WI5 A;  1J6Q A;  1YNX A;  4AYB G;  3I7F A;  2VW9 A;  3G71 A;  1YIT A;  1SMX A;  2NVX H;  4DUZ Q;  4YHH L;  1SE8 A;  1GD7 A;  1YHQ A;  4AH6 A;  4GKK Q;  1MJC A;  2QGQ A;  4RG1 A;  2YYZ A;  2RF4 A;  2ZJR A;  1EUJ A;  4R4I A;  4OO1 G;  2E8G A;  4X6A H;  1GVP A;  4LUV A;  4HJ8 A;  4GKK L;  1EOV A;  4A3M G;  3I55 A;  1Q86 C;  1KHI A;  3UDF A;  1A0I A;  4YY3 Q;  2KEN A;  2ZTD A;  1I3Q H;  1VQA A;  2ZTE A;  5IYB H;  3TEH B;  1PV4 A;  3HOZ G;  4BBS G;  3PUV A;  4DPG A;  4LF4 Q;  4WJ3 M;  2KBN A;  3KYH C;  3T1H Q;  4QIW E;  1JMC A;  1OTC A;  2VY3 A;  5HY6 A;  3K7U C;  2JA7 H;  1SRU A;  3CPW A;  5FLM G;  4DR3 L;  1QZH A;  1A8V A;  2A19 A;  3SGI A;  3MXN B;  2R93 G;  2ES2 A;  4NXN Q;  1OXS C;  4GOP C;  4DV0 Q;  4JI5 Q;  1OXU A;  1TWH H;  4JI2 L;  4LF9 L;  4X65 L;  1KC8 C;  1RIP A;  4NXN L;  2NVY H;  4A3F G;  4IPD A;  4DV0 L;  1K9M C;  4R1J A;  1E1T A;  4MNO A;  4O0A A;  1HZB A;  4IPC A;  3RLN A;  1AH9 A;  4DV2 Q;  3TS0 A;  3I4M H;  4Y7N H;  3HOW H;  1PH2 A;  2XTI A;  2GVB A;  1X3E A;  4X66 L;  1MIU A;  2UUC L;  4LF8 Q;  1GO3 E;  1N33 L;  3AFP A;  1Q1E A;  3T1Y Q;  3GTP H;  4DV2 L;  4LF7 L;  4X62 Q;  1Q7Y C;  4LF8 L;  2R7Z H;  1X3G A;  1D7Q A;  1DGS A;  4ME3 A;  4A3K G;  4KLK A;  3CC7 A;  1XMO L;  1K0R A;  2MQH A;  4C3J H;  1KQS A;  1NBW A;  1Q46 A;  2PI2 E;  1VCI A;  2VL6 A;  3H0G G;  1K3R A;  1SRO A;  1V43 A;  1CUK A;  1HR0 Q;  1IBL Q;  4A3G H;  2Z6K A;  1VQ4 A;  2UU9 Q;  3L0O A;  3UE1 A;  2R7F A;  3F1Z A;  3EBE A;  1VQF A;  3IRB A;  1PH4 A;  4GS3 A;  2I5M X;  1IBL L;  2XGT A;  2CCZ A;  4HIO A;  1B7Y B;  4K0K Q;  3STB C;  2VZA A;  1K73 C;  5LMU L;  3K8A A;  3CPF A;  1QUQ A;  3RN5 A;  3GO5 A;  3A0J A;  1HZC A;  5DLQ E;  1JJ2 A;  4A3B H;  1QVG A;  3H3V H;  2K5H A;  3S16 H;  3KJP A;  2IT1 A;  2ZJP A;  2ZTC A;  3F2C A;  2Q2T A;  1AE3 A;  1YJ9 A;  2ASB A;  1CKO A;  4EQ5 A;  4B3T Q;  3PUZ A;  3RNU A;  1X6O A;  4JI4 Q;  5JJI A;  4P74 A;  2Z6K C;  1QVF A;  2RCN A;  5M3F G;  3HOU H;  2JA7 G;  3D31 A;  4JBK A;  4JV5 Q;  4B3R L;  5C44 H;  1P8L A;  1UE6 A;  3UDX A;  1YIJ A;  3I4N H;  2ALY B;  2NN6 G;  2CKZ B;  2NZO A;  2N78 A;  4IPG A;  5JEA G;  4IFD I;  1VQM A;  4JV5 L;  4DAY B;  3H15 A;  1N32 Q;  1LYL A;  1E3P A;  2K5N A;  3CD6 A;  3HOY H;  2K50 A;  3J81 j;  2R7D A;  3PCO B;  4B3S L;  4DV1 L;  2YV5 A;  5ELO A;  1QUQ B;  5C0X J;  3PUX A;  2Y0S E;  3TRE A;  1K8A C;  2JEA I;  3UDG A;  4YWK A;  4DK6 C;  1UE5 A;  3A5U A;  4BA2 I;  2D0P A;  3TRZ A;  3OW2 A;  1D8L A;  1OXX K;  1C7Y A;  3I4M G;  4BXX H;  2I5L X;  1WFQ A;  2FXQ A;  3HOW G;  1G6P A;  3AYH B;  1WYD A;  4IJH A;  4DUY Q;  4DKA C;  1Q12 A;  2R7Z G;  1KAW A;  1VQG A;  4O2D A;  2R92 H;  4DR6 L;  5FJ8 H;  1HNZ L;  1XPR A;  4HJ9 A;  4IOC A;  3E9I A;  4JBW A;  1ASZ A;  1E7Z A;  1GM5 A;  3JAM i;  5M5X H;  5IYC H;  1PH8 A;  4R4T A;  3VDY A;  3OTO Q;  1V9P A;  2VQF L;  3HOX H;  1E24 A;  1EFW A;  1Z47 A;  1LTL A;  4A3G G;  4DR7 L;  3J81 c;  1EYG A;  1HNX L;  4JI6 L;  3J80 i;  3G6E A;  4DR4 Q;  1N36 L;  4YHH Q;  3S1Q H;  1XNR L;  4DR5 L;  2E2I H;  1PH5 A;  1I50 H;  1VQO A;  1EQR A;  4IJL A;  4DR4 L;  1N34 L;  1VQD A;  4LF5 L;  3CCS A;  4L5S A;  4P75 A;  4A3C H;  2IHF A;  2JK8 A;  2AWO A;  1IYJ B;  2D0O A;  2Q2I A;  2V1C C;  4P72 A;  4A3D G;  3EIV A;  1KXL A;  3BZK A;  4LF6 L;  4A3B G;  1WJJ A;  4UP9 A;  1L2F A;  4DV6 L;  4POF A;  1Q81 C;  2HHH Q;  4A3L H;  5M5W H;  3JAM c;  4DR3 Q;  1HR0 W;  3BZC A;  4ALP A;  1PH7 A;  2VNU D;  5E7N A;  1VQ9 A;  2HHH L;  1YVC A;  4JI2 Q;  5LMN Q;  3J80 c;  2EXD A;  4LF9 Q;  2JA9 A;  4X65 Q;  2JA8 H;  4R4C A;  2YTX A;  1G51 A;  1XPO A;  4XTC S;  3M4Q A;  4RMF A;  5LMN L;  5GAD C;  4AYB E;  2YTV A;  2IX0 A;  5C44 G;  3PGZ A;  1K83 H;  3A74 A;  4JI3 L;  4X66 Q;  1IBK L;  1I5F A;  1SFO H;  2UUC Q;  1N33 Q;  5ELN A;  3WWV A;  4HJA A;  3I4N G;  4GKJ L;  3PSI A;  3CCE A;  4OWW B;  4LUO A;  1PH9 A;  4LF7 Q;  4IPH A;  1X54 A;  3NEN A;  4OON A;  1NE3 A;  1Y1V H;  4GN4 B;  4L5R C;  4PG3 A;  2NVT H;  4OO1 I;  1XMO Q;  3CCL A;  1I94 L;  4BXX G;  5BR8 L;  2D62 A;  5C3E H;  2Q2H A;  2NVQ H;  2LSS A;  1Y14 B;  3GTJ H;  1M1K C;  3GTL H;  1PA6 A;  1GKH A;  3S14 H;  4KHP L;  2VUM H;  1PYS B;  5FJ8 G;  5HGQ A;  4LFC L;  3M4O H;  3KDF B;  3U4Z A;  3S1R H;  1EQQ A;  4QGU A;  5LMU Q;  4GLV B;  4UP8 A;  4QY7 A;  5IYC G;  2UUB Q;  2YU9 H;  2Z0S A;  1JB7 A;  2E5L L;  1C0A A;  5M3M H;  3FP9 A;  1SR3 A;  2KCT A;  3OYY A;  4KHZ A;  2E2J H;  3HKS A;  3ER0 A;  1LUZ A;  3M3Y H;  2UUB L;  1JE5 A;  1OXV A;  3I56 A;  3K81 C;  3S2H H;  2B63 H;  1KRT A;  1XPU A;  3L7Z C;  3STB D;  4MZ9 A;  4P71 A;  1EIF A;  3U50 C;  3U4V A;  4BY1 H;  4BY7 H;  1X55 A;  4GN3 B;  3M4P A;  3GTG H;  2BA1 A;  1YZ6 A;  1OXT A;  2NZH A;  3EN2 A;  2MNA A;  4A3E H;  4A3C G;  2KHI A;  5JEA J;  3CCU A;  4DV5 Q;  3CC4 A;  3U58 A;  2OCE A;  1HJP A;  4EX5 A;  1N9W A;  3RZO H;  3J7A 5;  2DGY A;  3F2D A;  2WP8 J;  4C2M H;  4DV5 L;  1Q1B A;  5IT9 c;  1BVS A;  4JI7 L;  4HIK A;  4IFD G;  5IYB G;  1PVO A;  3FHW A;  3ULP A;  2K5V A;  4B3R Q;  1HNW L;  2UXD L;  1S40 A;  1VQL A;  2A1A A;  3W5O A;  3CCJ A;  1L1O A;  3KF6 A;  4B3M Q;  1UE7 A;  2K4K A;  1X65 A;  1VQP A;  1PH3 A;  2JA8 G;  1VQC A;  1PYB A;  3AEV A;  3HKZ G;  1KIX A;  2N49 A;  1NMF A;  3GD7 A;  4C3H H;  4B3S Q;  4DV1 Q;  1S72 A;  4B3M L;  4LFA L;  2Y0S G;  3RN2 A;  1O7I A;  1UWV A;  1HZA A;  1A62 A;  4PMW A;  3ULJ A;  4NB3 A;  2KHJ A;  4DR2 L;  1JJG A;  3CCQ A;  2R93 H;  2AWN A;  4HIM A;  1S3O A;  3GDE A;  2CQO A;  2I5H A; 
#chains in the Genus database with same CATH topology
 1E1O A;  1Y1V G;  1VQI A;  4OX9 Q;  1I4P A;  1CKN B;  1Q3L A;  5HGT A;  4GLX A;  3H09 A;  2X6L A;  3NP8 A;  5LMN W;  2JA8 B;  4HJ7 A;  4OX9 L;  2JSO A;  2WAQ E;  1SAP A;  2Q8T A;  4JI6 Q;  2A68 C;  2PNH A;  1L1O C;  4JVZ A;  1JJC B;  1XNR Q;  3F2B A;  4LUZ A;  5LL6 S;  1M90 C;  1M4V A;  3KF6 B;  2OXP A;  2B39 A;  1IHZ A;  3A7L A;  1B1Z A;  1G6Z A;  1RTN A;  5CMD A;  2LXK A;  4A3K H;  1YJW A;  2EQS A;  3HFZ B;  1WTW A;  1FR3 A;  3GTQ H;  3J81 L;  5IGD A;  1Y8N B;  1D1K A;  2TSS A;  1Q8K A;  2K05 A;  1H9K A;  1LAC A;  4ZKB B;  4DV6 Q;  5C3E B;  4LFB L;  3G48 A;  3AMU A;  1PTO B;  1WTQ A;  1U4M A;  3DM1 A;  1F9S A;  4OIJ A;  3T51 B;  2ATW A;  5J1Z A;  4I7A A;  3VR5 A;  3S14 B;  4C1N I;  2VUM B;  4GNX C;  3D4D A;  3P7J A;  5IIF A;  4ZQ3 A;  5G3L F;  1YHA A;  1IYU A;  1NTG A;  2F0S A;  1LTG D;  1I4G A;  3HGB A;  2QA4 A;  1NNX A;  5M3M B;  3M9B A;  2CW0 D;  3PO3 H;  4J15 A;  4EQP A;  4JI3 Q;  4TVA B;  3MC0 B;  2B63 B;  2PI2 A;  4CKB A;  1PZJ D;  2AMC B;  1I4X A;  2CFM A;  4XDX A;  1LM0 A;  4APV A;  1D5M C;  5IOC A;  1TXY A;  4YY3 L;  3RZO B;  3ND9 A;  2EY2 A;  1FYC A;  1J9O A;  2L1B A;  4JI8 Q;  3LX0 A;  3OIQ A;  2EYM A;  4XQN A;  3M7N A;  3TQY A;  4QUF A;  3RZD H;  2PNR C;  4JI8 L;  4KY7 A;  4LFC Q;  1KDC A;  4JI5 L;  3MEF A;  5ELC A;  3QO2 A;  4PZ8 A;  2K5Q A;  4P73 A;  2VS1 A;  3N6R A;  2KEC A;  2KVM A;  3I4O A;  4A3J G;  1PLF A;  5CV7 A;  1MHW C;  2ZM6 Q;  1QNK A;  1CFM A;  4GLA C;  4F87 A;  4H13 C;  4YCV A;  5C5L A;  5GQO A;  2Z4I A;  2F0T A;  1Q82 C;  5CV9 A;  2ZM6 L;  4RA8 A;  3T1Y L;  2WKD A;  1SNP A;  2BH2 A;  4FF4 A;  1SLJ A;  3NEL A;  4X62 L;  1EEI D;  1LT4 D;  4OHJ A;  2ICE C;  3U9S A;  5CV8 A;  2O4X A;  3E0E A;  3QR8 A;  3W1B A;  2J0T D;  2N3S A;  1L0W A;  4C3I G;  2PCF B;  3Q8D A;  1NR4 A;  4RKB A;  4DNI A;  4YIJ A;  3FKI G;  3LGJ A;  1TS2 A;  3KFU A;  1LTA D;  1HZ9 A;  3A5Z B;  3S24 A;  1CSP A;  3T16 A;  5IP7 G;  3HOV G;  2A8V A;  3E9H A;  4OEM B;  2JA6 B;  1DOK A;  1JOO A;  3NPP A;  4LWC A;  1IKL A;  4BBS H;  2MO1 A;  4RWS C;  3PF5 A;  4IO9 A;  4JI0 Q;  3PQI A;  1V1Q A;  1IXR A;  1JIC A;  2F0F A;  1WTP A;  1IBM Q;  1ASY A;  4JI0 L;  4AIM A;  4OWT B;  4GOP B;  4MIU A;  2F0E A;  5M5Y H;  4DR1 Q;  3KUP A;  3NWS A;  1ICW A;  1Z6H A;  1Y1W B;  3S15 H;  2VQE Q;  3CAM A;  1BR9 A;  3KF8 B;  4DN4 M;  1SNO A;  1JC7 A;  5H1S E;  5IGC A;  4LMQ D;  2VQE L;  5IT9 E;  4LW1 A;  2ID0 A;  1EY8 A;  3BYY B;  3ICE A;  4R4O A;  3S1M B;  4KJN A;  1TWG H;  4ILW A;  1HPC A;  3VR3 A;  1E2V A;  2M00 A;  1DM0 B;  5M3F B;  4BBR B;  4NXM Q;  2BH8 A;  3PIO 3;  1GUO A;  2R3Z A;  4PZ7 A;  5FLX c;  4V19 0;  4HJ5 A;  4A3I B;  2HUG A;  1EIG A;  3CME A;  4NXM L;  1PTO D;  3P1H A;  1ZKO A;  5E3F A;  1YJN A;  2PMZ B;  3PO2 B;  1MKH A;  1O7Y A;  4KY6 A;  2UUA Q;  5KIX A;  5K36 G;  1ZYR C;  3OTO L;  1WI5 A;  4FF3 A;  3Q6S A;  1SMX A;  2NVX H;  1V1P A;  4DUZ Q;  5J39 A;  4AH6 A;  2QGQ A;  4FF1 A;  3HG9 A;  5EBD A;  3V96 A;  4X6A H;  1SBB B;  1IL8 A;  3I55 A;  4CDE C;  1Y8O B;  5IYB H;  3TEH B;  4DPG A;  1BF4 A;  1GHJ A;  5HY6 A;  3CPW A;  2R93 G;  1OXS C;  4DV0 Q;  1TWC B;  1OXU A;  2EYF A;  1J8I A;  2PW7 A;  4JI2 L;  4LF9 L;  3H3V C;  1GUG A;  1RIP A;  2CH4 A;  3TZU A;  4DV0 L;  4A3D B;  2NB0 A;  4XQQ A;  2D9U A;  1EY6 A;  4MNO A;  5C3X A;  2HDM A;  4C1N K;  2A69 C;  4Y7N H;  2XTI A;  2GVB A;  1X3E A;  2AQ1 B;  1GHK A;  3R3O A;  4ABN A;  1DOM A;  3S2D B;  3R93 A;  5JJZ A;  1U4P A;  4OGQ C;  1D7Q A;  4A3K G;  3T56 B;  4KLK A;  1NCV A;  4UAI A;  1NBW A;  1Q46 A;  2PI2 E;  4P2C B;  2EVB A;  1K3R A;  1SRO A;  1HR0 Q;  1QIL A;  2BE5 C;  4K2L A;  2Z6K A;  3HOZ B;  1GUT A;  3UE1 A;  2R7F A;  3F1Z A;  2RKS A;  4HCS A;  2NZ1 D;  3GP7 A;  1B7Y B;  1CHQ D;  4FVM A;  3NQT A;  1JE4 A;  2MP1 A;  1TS5 A;  3CPF A;  1SNQ A;  2K6A A;  1HZC A;  4K8J A;  3KJP A;  4DAV A;  1JWS D;  3H0G B;  2E2H B;  1HHV A;  2ZTC A;  2EYJ A;  1JOQ A;  4EQ5 A;  1G2T A;  1HFN A;  3T4A C;  4JI4 Q;  5JJI A;  2Z6K C;  1QVF A;  2RCN A;  1RKN A;  3HOU H;  2JA7 G;  2DN8 A;  4HN7 A;  2F0M A;  1P8L A;  4KY5 A;  2ALY B;  4IFD I;  2EE1 A;  1STG A;  2FJ2 A;  3CD6 A;  2K50 A;  3D6C A;  4B3S L;  1DJR D;  2YV5 A;  5C0X J;  2Y0S E;  3UDG A;  1UE5 A;  3OW2 A;  1D8L A;  1OXX K;  5JOB A;  1C7Y A;  3I4M G;  2I5L X;  1WFQ A;  3CU7 A;  1EOT A;  1PRT B;  3A56 A;  4IJH A;  4DUY Q;  2BDN A;  2XRQ D;  2Q8R E;  1Q12 A;  1LLR D;  2B2V A;  5DNF A;  5FJ8 H;  1ASZ A;  1E7Z A;  5M5X H;  5M9O A;  2L9H A;  1QJO A;  1XTC D;  3VDY A;  1PH8 A;  1K0S A;  1H9S B;  1STY A;  4A3G G;  1LTL A;  3TSS A;  1EYG A;  3J80 i;  1KNA A;  3J7Y W;  1N36 L;  4EQN A;  4YHH Q;  1SYE A;  1I50 H;  2BCO A;  3TP7 A;  3D4W A;  1N34 L;  4LF5 L;  3CCS A;  1AZP A;  2R7Z B;  2SEB D;  1IYJ B;  2V1C C;  3SE0 A;  2F1M A;  4P72 A;  3EIV A;  1KXL A;  2ZXR A;  4C56 C;  5M5W H;  2WII B;  4F7X A;  1PH7 A;  1TY2 A;  3I70 A;  5E7N A;  1U4L A;  1S5F D;  2CW0 C;  2EXD A;  2XWJ B;  4X65 Q;  5FK9 C;  1G51 A;  4RMF A;  3BZD B;  4AYB E;  5COR A;  2YTV A;  5C44 G;  3PGZ A;  1K83 H;  3IL8 A;  1N33 Q;  1H9M A;  1SFO H;  1IBK L;  4K2K A;  2UUC Q;  1CZW A;  3PSI A;  1STA A;  3H6M A;  1PH9 A;  1NE3 A;  1EFI D;  1Y1V H;  4KMU C;  2RVL A;  5BR8 L;  1GOZ A;  2Q2H A;  5C4H A;  4RHS A;  4IUR A;  1Y14 B;  1M1K C;  2I07 B;  3ERO A;  4KJO A;  1HA6 A;  1QOH A;  3SK4 A;  1JQY D;  1XYI A;  1V8Q A;  2RQX A;  4QGU A;  1TS4 A;  2F0V A;  4GLV B;  1EWH A;  4QY7 A;  1GJX A;  2Z0S A;  1JB7 A;  3FP9 A;  1LUZ A;  1OXV A;  3FRP B;  3L7Z C;  4P71 A;  1ZXT A;  4GN3 B;  3EN2 A;  4A3C G;  4OIK A;  1HJP A;  2J7Z A;  1N9W A;  2WV6 D;  3J7A 5;  1B9M A;  5IT9 c;  5IYB G;  2WKC A;  1CQV A;  3FHW A;  4B3R Q;  1HNW L;  2UXD L;  2TMP A;  3S1Q B;  3KF6 A;  2O5J C;  1VQC A;  3GD7 A;  2EXZ A;  4IUN A;  1VF5 C;  1LT5 D;  3LNN A;  1STE A;  2MHV A;  4PMW A;  3VYR A;  1F9Q A;  2K28 A;  1HQR D;  5A2Q L;  1VMC A;  2AWN A;  4AQY L;  1S3O A;  1WD0 A;  2CQO A;  1JE5 A;  3I56 A;  1HH2 P;  1SYD A;  5EKK A;  5I9O A;  4DR6 Q;  1PRT D;  2CHB D;  4CJ2 C;  4FF2 A;  1TR5 A;  4UY8 C;  1ICF B;  2YTY A;  2IL8 A;  5JPN C;  5IGG A;  3NWT A;  2UXC Q;  1HNX Q;  4POG A;  3TME A;  2OQ0 A;  1WTX A;  3BU2 A;  5JJL A;  2UXC L;  4A3J H;  4A4I A;  4DR5 Q;  2IY5 B;  1AE2 A;  1VF7 A;  2Z6B A;  4PZ6 A;  3DUZ A;  2Q2U A;  1CK1 A;  2R61 A;  1SN8 A;  1X3P A;  5E4W C;  1K8O A;  1S5E D;  1PTO F;  5CC4 A;  1PTO C;  1RD9 D;  3OWE B;  1EY0 A;  4BY1 G;  1VQH A;  4BY7 G;  2ENB A;  4H02 A;  2F0W A;  3M85 A;  2ZXO A;  3GTJ B;  4C3I H;  2EPB A;  4M1U B;  3BVZ A;  5CV4 A;  2Z9H A;  2HT1 A;  3FKI H;  1FJG L;  5IP7 H;  3HOV H;  4CDC C;  2F0Q A;  3JAM L;  4R8N A;  4DK3 C;  3HOU G;  2E2J B;  4LJZ C;  1Y8P B;  3M3Y B;  3S2H B;  3AB9 A;  3GTO H;  4JG2 A;  1HXY D;  1WTH A;  4C3H G;  1EIY B;  3OOC A;  4QIW B;  3J81 E;  2IX3 A;  4A3E B;  1NY4 A;  3NBH B;  2L15 A;  3K7A H;  1WTR A;  1I94 Q;  2MO0 A;  1EU4 A;  2A69 D;  4DGZ A;  1TWA H;  4LF4 L;  2JJQ A;  3T1H L;  1WD1 A;  1LTI D;  4KHP Q;  3JC6 6;  1A3T A;  1VMP A;  1CSQ A;  3KJO A;  1RJT A;  2FFK B;  5C4X G;  2KED A;  1EY7 A;  5KEE A;  2JQO A;  2BE5 D;  1P16 A;  4IOA A;  3K58 A;  3C1E A;  2MUY A;  1H9J A;  1XWE A;  3QOJ A;  1BNZ A;  4JBM A;  2R93 B;  2EJM A;  4TQU S;  1IL2 A;  4ZKC B;  1B70 B;  2EYL A;  1CKM A;  4DFA A;  3W3A A;  3ZJY C;  1CM9 A;  4DV3 Q;  1ET6 A;  1W6J A;  4GOP A;  3BJU A;  5K36 H;  3S17 H;  1XJV A;  4JI7 Q;  2B2T C;  3ONA B;  3HZX A;  4DV3 L;  3KF8 A;  2UU9 L;  1I6H H;  1ET9 A;  2LMC B;  4JOI A;  4RFB A;  4A3K B;  1STH A;  3PUY A;  4CBV A;  2L4N A;  2R6G A;  2EIF A;  2JN4 A;  3GTQ B;  3CQZ H;  2EDG A;  3PMF A;  1WTV A;  3K0Y A;  3B6Y A;  4XQJ A;  3J7A F;  2F4I A;  1C48 A;  4RH6 A;  4FDB A;  2PQA B;  4DAM A;  3RLO A;  3KK7 A;  1PH1 A;  5GAH C;  1Z9F A;  3RR5 A;  1BO0 A;  1A3U A;  1NAP A;  5EPK A;  3L2P A;  4A93 G;  1ILP A;  1WCM G;  2OTJ A;  4YCW A;  2JA5 G;  3NUC A;  4GNX A;  1XMQ Q;  4L8J A;  2B3G A;  3PO3 B;  1D2B A;  2K7V A;  5T1G A;  3NEM A;  2O2L D;  3AQQ A;  1XMQ L;  4QL5 A;  4JOI C;  4KD3 A;  3GTK H;  5FO7 B;  1F9P A;  3VYS A;  1N8R C;  3MA2 B;  4YWL A;  2WB1 G;  5I2Y A;  3NTH A;  2KOL A;  4LFB Q;  1KD1 C;  2IHE A;  5I6W A;  2WAQ B;  1WOC A;  4MTN A;  1NJI C;  3FDT A;  3S1N H;  1I4Q A;  2XNA C;  3RZD B;  2CVR A;  5ELF A;  2AHO B;  1TWF H;  2PQE A;  3H94 A;  3E6Z X;  4X3S A;  5C0X G;  3ULL A;  3NSW A;  1Y69 U;  4G7O C;  4KKU A;  3A7A B;  1J6Q A;  1YNX A;  4AYB G;  1LTS D;  5CYU A;  1YHQ A;  3H91 A;  2K1B A;  4IUP A;  1B9N A;  2YYZ A;  4LUV A;  3J80 L;  4A3M G;  4I65 A;  5EBC A;  4YY3 Q;  4DK0 A;  1SXT A;  1TQO A;  4A3G B;  2L12 A;  1R4P B;  2KBN A;  5DAU A;  1OTC A;  2JA7 H;  1QWY A;  4B9X A;  4DR3 L;  2JXM B;  1QZH A;  3M4Y A;  2ES2 A;  4JI5 Q;  4RKL A;  1TWH H;  2DJG C;  2SNS A;  1KC8 C;  2NVY H;  1ML0 D;  2LKV A;  1K9M C;  4L63 B;  1ONL A;  1QB5 D;  2IJ0 A;  3RLN A;  1AH9 A;  1CI3 M;  3I4M H;  1PH2 A;  1SEB D;  4ZAI A;  4BBS B;  1ENA A;  1SJH D;  5F2D A;  2HCC A;  3T1Y Q;  3MXU A;  4X62 Q;  4N9P A;  2SNM A;  3IAY A;  2Z8L A;  3OPO A;  3CC7 A;  4WOR A;  1XMO L;  1K0R A;  2C5C A;  1VCI A;  4IZ8 A;  5M5Y B;  5C44 B;  1IBL Q;  4A3G H;  1VQ4 A;  3S15 B;  2JYO A;  1O78 A;  3IRB A;  1IBL L;  2I5M X;  4QMG A;  4HIO A;  3E0J A;  3VA7 A;  3SK8 A;  1BCP B;  2EYP A;  4TSS A;  1K73 C;  5LMU L;  1W6K A;  3K8A A;  4EVO A;  2FHT A;  3I8Z A;  3RN5 A;  1C8C A;  3A0J A;  1TWG B;  2HQE A;  2RSO A;  2B8G A;  4ODG A;  1QVG A;  2VB3 X;  1DXM A;  3S16 H;  5EGT A;  1CA6 A;  3OMC A;  4G4K A;  5D14 A;  4K14 A;  4FNF A;  1Q90 A;  1X6O A;  1UAP A;  1BDO A;  5BN4 A;  1H9S A;  3DEP A;  5TSS A;  4B08 A;  4NW2 A;  4JV5 Q;  2F0U A;  5C44 H;  2KCC A;  4MN3 A;  2NVX B;  2EY6 A;  2XRS D;  3D6W A;  2NZO A;  2NN6 G;  1S4Z A;  2CKZ B;  2N78 A;  2IW3 A;  2QKI C;  4JV5 L;  1K28 A;  4DAY B;  3HOY H;  1MSH A;  3Q23 A;  4FO2 A;  5ELO A;  4DV1 L;  1KDB A;  1QUQ B;  4DA2 A;  3TRE A;  4HED A;  4QF4 A;  5CGK A;  3A5U A;  1PRT F;  4TRD A;  1PRT C;  4K5X A;  5I9P A;  3TRZ A;  3HOW G;  2FXQ A;  2OEO A;  4IUQ A;  4XXE A;  2R92 H;  3DWA A;  1HNZ L;  1HFG A;  1PFN A;  3BVG A;  3EVQ A;  1UUP A;  3JAM i;  2LFN A;  3OTO Q;  2ICI A;  2VQF L;  3E5S A;  3HOX H;  3HRZ C;  4DR7 L;  3J81 c;  2NYZ D;  1TKW B;  3OW7 A;  1LTB D;  4N8F A;  4Y7N B;  1G2S A;  5T1I A;  4KK7 A;  1VQO A;  5KNC A;  1LT3 D;  1S5D D;  1U9R A;  1KNE A;  2F3W A;  4A3C H;  2IHF A;  1CQF A;  2JK8 A;  4DU9 A;  4LF6 L;  4A3B G;  3VYT A;  4POF A;  1F77 A;  1HR0 W;  3HP3 A;  3OWF A;  4ALP A;  1SNM A;  1STN A;  3V05 A;  3WOE A;  4JI2 Q;  4LF9 Q;  3J80 c;  3C46 A;  5FKA C;  2KQ3 A;  3I4L A;  5EQ0 A;  4XTC S;  3M4Q A;  4R8I A;  3R2T A;  3A74 A;  4GZY C;  1I5F A;  4GKJ L;  1KLG D;  5ELN A;  4HJA A;  3I4N G;  3MWY W;  1PDQ A;  4OON A;  2IWH A;  4GN4 B;  4L5R C;  1HA5 A;  4PG3 A;  2NVT H;  3P20 A;  4FXD A;  4RAU C;  1AEX A;  4BXX G;  3SK6 A;  1YNN C;  5JPM C;  3W2D A;  3Q22 A;  3HOU B;  2NVQ H;  3NTK A;  1FNV A;  3GTL H;  2PO4 A;  1JWM D;  1SE2 A;  5HGQ A;  3M4O H;  3S1R H;  4ZUI A;  4KN7 C;  4UP8 A;  5IYC G;  1EY5 A;  2YU9 H;  1BOS A;  2E5L L;  1JR0 D;  3IFT A;  1C0A A;  1O80 A;  1BCP D;  4KHZ A;  1B53 A;  1RCV D;  1KRT A;  1XPU A;  3STB D;  1U4R A;  4BY1 H;  4BY7 H;  3GTG H;  1YZ6 A;  5D65 A;  4KKS A;  5JEA J;  3CCU A;  4EX5 A;  4HAE A;  1T5X D;  4C2M H;  5M5X B;  1Q1B A;  4MTK A;  1PVO A;  2K5V A;  2L55 A;  1S40 A;  1VQL A;  2A1A A;  3FVQ A;  4B3M Q;  1DON A;  4OO1 H;  4DAP A;  1I50 B;  1PH3 A;  2JA8 G;  1FD7 D;  1JOR A;  2N49 A;  1NMF A;  4C3H H;  4X3T A;  4CJ0 B;  4B3S Q;  1S72 A;  4B3M L;  4LFA L;  3RN2 A;  3NXW A;  3TBI B;  4BS9 A;  1UWV A;  1HZA A;  1A62 A;  1CTM A;  3ULJ A;  4NB3 A;  3TZD A;  1EEF D;  2KHJ A;  4DR2 L;  1JJG A;  4K5V A;  4JW0 A;  5M5W B;  2OQK A;  2HQL A;  2KA7 A;  1A63 A;  4LNQ A;  5D3D A;  3DM3 A;  5EPL A;  2BDO A;  3X3M A;  4A3F H;  4YWM A;  4JYA L;  1T5E A;  5C3E G;  2H5X A;  2B2W A;  2Y0S B;  5C4X H;  1F2Y A;  2B29 A;  1N36 Q;  2H1E A;  3PF4 A;  1NMG A;  1K83 B;  2E75 C;  1SFO B;  1N34 Q;  4LF5 Q;  3K5N A;  3MVV A;  3EA6 A;  3NBH A;  1Y1V B;  5M3M G;  1TT2 A;  1UEB A;  2L5T A;  1RTO A;  5A2Q E;  1SSO A;  2WB1 E;  2B63 G;  3K5O A;  1X9N A;  4DV7 L;  5J22 A;  1B8A A;  4DNT B;  1J5E Q;  3CW2 C;  3MXP A;  5EAY A;  1FGU A;  1FVI A;  4JCV E;  2GN5 A;  1MI2 A;  1J5E L;  2RDH A;  4DV4 L;  5FO9 B;  1JB3 A;  3GTM H;  2B2W C;  5DM6 3;  3KDF A;  5AJ3 L;  1NSN S;  1IW7 D;  2IX1 A;  4X64 L;  1RF2 D;  4IUU A;  4LK1 C;  1Z7T A;  2GVA A;  1IBK Q;  3MZ5 A;  5ELD A;  4QJF A;  3CC2 A;  1EL0 A;  1FNW A;  3PV0 A;  5I4D A;  4CKE A;  3DLL A;  1EY9 A;  4X3U A;  3D0F A;  1BKB A;  4CDD C;  2CWP A;  5ELE A;  2QEJ C;  5KND A;  2QDB A;  4JI1 Q;  3HOY G;  2XIW A;  1OO9 B;  5BR8 Q;  2BOS A;  4A75 A;  5NUC A;  1KL9 A;  2ZJQ A;  3CP0 A;  4A93 H;  4AYB B;  1WCM H;  4JI1 L;  2JA5 H;  1PHJ A;  3FMC A;  2QW7 A;  4K8I A;  5JEA H;  5IGF A;  1L0Y B;  1VQK A;  2R92 G;  2HDL A;  3SEB A;  5IGB A;  3JAM E;  1BQQ T;  3C2P A;  1SYG A;  4XT3 B;  2F0N A;  4ZCK A;  2F0O A;  3F8T A;  3DMU A;  2SDF A;  3HOX G;  4IFD J;  2RDF A;  1CA5 A;  5JJK A;  3BDL A;  4OXP A;  3HS0 C;  4ZK9 B;  1WVL A;  2PQA A;  1KRS A;  1X32 A;  1JCK B;  2WAC A;  5CR3 A;  5IP9 G;  4RGO S;  5IYD G;  2JA6 G;  4JC0 A;  1CKN A;  4G57 A;  4XIG S;  4XYQ A;  5C0X H;  1SNC A;  2AUK A;  2A6E D;  1UE1 A;  1R9T H;  1EWI A;  1HNW Q;  2UXD Q;  2MFI A;  2GA4 B;  3PIP A;  4G7H C;  2JP1 A;  4R9W A;  4A3J B;  1FL0 A;  1BBW A;  2HIX A;  4K0K L;  4Z9C B;  4OEL B;  1X3F A;  1U5K A;  1XXG A;  2H4O A;  1YI2 A;  4A3M H;  1Y1W G;  4IUV A;  1JT8 A;  2N8N A;  3CCR A;  2LXJ A;  1IYV A;  2Q8I B;  3CCM A;  4QQB X;  1BBU A;  3SVM A;  4AQY Q;  3CMA A;  1II3 A;  2XSC A;  4C3I B;  2G9D A;  3D4R A;  1STB A;  5IE8 A;  3FKI B;  3RD4 A;  4B3T L;  4BBR G;  1PH6 A;  1MJE A;  2MGS A;  3HOV B;  4GN5 A;  1I4H A;  4A3I G;  5C4J H;  2K32 A;  1I4R A;  1VS0 A;  3K6O A;  3GTO B;  3HKZ E;  3KOJ A;  3PO2 G;  2BA0 A;  1SND A;  3LWE A;  2B2U A;  3CCV A;  1N32 L;  4BA1 I;  5E1F A;  2CH4 W;  1C4Q A;  2JEB I;  4J1M A;  3K7A B;  1E2W A;  1YHB A;  2HD3 A;  3GQB A;  4UPA A;  3KLR A;  3QIA A;  1TWA B;  3MHB A;  4R4Q A;  4CHT B;  3ZYY X;  1VQJ A;  4YCU A;  1BXT A;  1QVC A;  5KYL A;  1FJG Q;  5I2X A;  1RDP D;  1EZ6 A;  2PZU A;  1KAA A;  3MEH A;  1QE6 A;  3G71 A;  3I7F A;  1MGS A;  1SE8 A;  2A5H A;  1AW7 A;  4GKK Q;  1F2L A;  2B2U C;  4RG1 A;  5LL6 X;  2ZJR A;  4NP5 A;  1EUJ A;  4R4I A;  4OO1 G;  2E8G A;  1SMY D;  1GVP A;  4GKK L;  2QCP X;  1LT6 D;  1Q86 C;  2QDL A;  1KHI A;  3MFY A;  3UDF A;  1FGB D;  2KEN A;  2ZTE A;  1I3Q H;  1VQA A;  3DWP A;  3S17 B;  4LF4 Q;  3NQI A;  4KD4 A;  4XT1 B;  4WJ3 M;  4IAL A;  4QIW E;  3T1H Q;  2VY3 A;  3K7U C;  4CDF C;  1SRU A;  5FLM G;  1I6H B;  4X3K A;  3SGI A;  3MXN B;  2B2T A;  3I3C A;  2NN6 H;  2N88 A;  3A54 A;  3NBI A;  1YNN D;  4A3F G;  2XN9 C;  1B50 A;  4DXF A;  2J4X A;  2G9H D;  4KKT A;  4O0A A;  2M2L A;  1HZB A;  3CQZ B;  1XX8 A;  4DV2 Q;  3TS0 A;  3HOW H;  4LF8 Q;  3NK9 A;  4X66 L;  1GO3 E;  3J80 E;  2X6G A;  1UNS A;  1Q1E A;  3GTP H;  4DV2 L;  4LF7 L;  1Q7Y C;  4LF8 L;  3SR1 A;  4C3J H;  3H0G G;  3N52 A;  1F2M A;  2A6H D;  2UU9 Q;  3L0O A;  1ENC A;  4HSV A;  1BCP F;  1BCP C;  3EBE A;  3I91 A;  5K5P A;  1VQF A;  4QUC A;  1PH4 A;  2XGT A;  2QIL A;  4DAY A;  3GTK B;  3STB C;  1TU2 B;  1B3Q A;  4DXG A;  1QUQ A;  3GO5 A;  3BDC A;  5IGE A;  2K04 A;  5DLQ E;  1JJ2 A;  4A3B H;  3Q24 A;  4KHV A;  1CT1 D;  2IT1 A;  2ZJP A;  3F2C A;  3DWQ A;  1GXD C;  2ASB A;  4K5W A;  1YJ9 A;  3S1N B;  1NR2 A;  1CKO A;  1B3A A;  3P75 A;  3PUZ A;  1EYA A;  1TWF B;  4RGT A;  2PPB C;  4HSP A;  5KYI A;  1LTR D;  4P74 A;  4DNR B;  1SYC A;  4ZRZ A;  2NWG A;  2F3V A;  2K5W A;  2E2D C;  1VDZ A;  1MD2 D;  1UE6 A;  1I6V C;  1DOL A;  3UDX A;  3I4N H;  5JEA G;  4IPG A;  1DZ1 A;  4RGN A;  1LYL A;  1E3P A;  2K5N A;  4CGY B;  3BVM A;  2R7D A;  3PCO B;  2PYK A;  2Z4H A;  3PUX A;  2B2Y C;  4BA2 I;  1X3Q A;  2D0P A;  5EKL A;  1G6P A;  4QB4 A;  4BXX H;  2K03 A;  1WYD A;  1F9R A;  1E2Z A;  2JA7 B;  2NUC A;  3TP6 A;  2KEE A;  4KN4 C;  3GV3 A;  2R7Z G;  1KAW A;  1VQG A;  4O2D A;  3CRK C;  4HJ9 A;  4IOC A;  1TWH B;  3E9I A;  4JBW A;  5IYC H;  5JAV A;  4J6H A;  2NVY B;  1EFW A;  1Z47 A;  2NTT A;  5FLX L;  4JI6 L;  5AFW A;  3G6E A;  4DR4 Q;  4NDX A;  1XNR L;  3I4M B;  2E2I H;  2VXW A;  4IJL A;  1UEA B;  4DR4 L;  3VR2 A;  4PV1 C;  4P75 A;  5ISR A;  1A6X A;  1WJJ A;  2KUM A;  1Q8I A;  4DV6 L;  1S5C D;  1B44 D;  2HHH Q;  4A3L H;  3I72 A;  3JAM c;  1IW7 C;  4DR3 Q;  3BZC A;  1HTL D;  1IKM A;  2F03 A;  1VQ9 A;  2PW5 A;  2HHH L;  1YVC A;  4H0L C;  5LMN Q;  2JA9 A;  2JA8 H;  4R4C A;  1KDA A;  4JK1 C;  4ULL A;  3MAQ A;  5GAD C;  5LMN L;  3A55 A;  3RMH A;  1JOK A;  4JI3 L;  3S16 B;  3WWV A;  3CCE A;  4LUO A;  4IPH A;  3NEN A;  2KJX A;  3EJI A;  4OO1 I;  4DF7 A;  1XMO Q;  3CCL A;  2D62 A;  5C3E H;  1O7Z A;  1PTO H;  2LSS A;  4UDU C;  2NTS A;  1GKH A;  3S14 H;  2VUM H;  1PYS B;  1RHP A;  4K6L A;  2NBF A;  4LFC L;  4DK1 A;  1EIH A;  1ESR A;  1EQQ A;  1D6E C;  5LMU Q;  2QF7 A;  5HUR A;  4PMB A;  3HOY B;  3R8B A;  2SOB A;  5M3M H;  2EYH A;  2KCT A;  4N8X 1;  2B63 H;  3U4V A;  1X55 A;  3M4P A;  2A6E C;  3SHL A;  2MNA A;  3EQL C;  3HEJ A;  2R92 B;  3U58 A;  2OCE A;  2LY7 A;  2EZV A;  3RZO H;  2DGY A;  2WP8 J;  4PNY A;  1BVS A;  4H7B A;  4HIK A;  4IFD G;  3HOX B;  3VR4 A;  3ULP A;  5BN3 A;  2F0I A;  3W5O A;  4U68 A;  3OMG A;  4HMJ A;  1X65 A;  1VQP A;  3WDN A;  3Q0A A;  1PYB A;  3HKZ G;  1KIX A;  1MSG A;  1KTK A;  4DV1 Q;  2AQ2 B;  1K3B C;  2RDG A;  4CKC A;  2N55 A;  3CCQ A;  4HIM A;  2MJ8 A;  1VQE A;  1HNZ Q;  1RL2 A;  3ITP A;  1IBM L;  3TS2 A;  1T9H A;  2D5D A;  2K33 A;  3C1F A;  4PMC A;  1SE3 A;  2VQF Q;  4A76 A;  4DR1 L;  4DR7 Q;  4Y52 H;  1U0L A;  1TVX A;  4C3J G;  5FOB B;  5IWA Q;  1VQN A;  1L1O B;  1EWC A;  2EY5 A;  4I7Z C;  5IWA L;  2K01 A;  2PMZ E;  1LV9 A;  2FIN B;  1K8G A;  5GRO A;  3KLS A;  3VA5 A;  5IP9 H;  5IYD H;  3CXC A;  2KCM A;  2JA6 H;  2NVT B;  4HMI A;  4LF6 Q;  2IPK D;  1HQM C;  3F2U A;  3PUW A;  4TKO B;  3PIO A;  2NVQ B;  4CJ1 B;  3GTL B;  1E0B A;  2MPM A;  4L6T B;  4A3E G;  1XTD A;  1D5Z C;  2AQ3 B;  3M4O B;  3S1R B;  4IUT A;  1EYC A;  2K52 A;  1HUN A;  3CF5 A;  1C9O A;  4GNX B;  2UUA L;  1VQ7 A;  2YU9 B;  3A8K E;  3UE0 A;  1A2U A;  1AN8 A;  1KLU D;  5C4Z A;  1Y1W H;  1SMY C;  4E6I A;  2JE6 I;  1EZ8 A;  3K57 A;  4RGM A;  5C0X I;  3U9O A;  4GKJ Q;  5GAG C;  4DUZ L;  4BY1 B;  2KCN A;  2I0Q A;  4BY7 B;  3A8J E;  2AKW B;  5KGU A;  3GTG B;  2UXB Q;  4JBJ A;  3S1M H;  1IZ6 A;  2K75 A;  4HCE A;  3J7Z C;  5M3F H;  1ZEQ X;  2UXB L;  2QEX A;  2I46 A;  4L5Q A;  2DY7 A;  4BBR H;  4C2M B;  5IY0 A;  2DY8 A;  2XVS A;  3MTS A;  3T13 A;  3H3V I;  4RHR A;  4OWX B;  4A3I H;  3MFG A;  2RCF A;  2F0K A;  3UI2 A;  1MBY A;  2F3I A;  4L5T A;  2F52 A;  2C35 B;  3PO2 H;  5CV5 A;  2F0L A;  2F0P A;  3FPU B;  4HTH A;  2RHQ B;  4C3H B;  2E5L Q;  1DCZ A;  2A73 B;  1H9R A;  1SYB A;  2F4V Q;  1AP0 A;  4RCN A;  1QNU A;  4NMZ A;  1EQV A;  2A74 C;  1YNJ D;  3L3O C;  1EYD A;  1X56 A;  2F4V L;  1YBY A;  1VQ6 A;  1G8Z D;  4WRD A;  1H95 A;  3BG3 A;  2P5Z X;  3UDI A;  2EJF C;  4Q0F A;  3QB3 A;  2A6H C;  1K8M A;  3D3R A;  4A3F B;  1ROD A;  5D3I B;  3FEW X;  4S3S A;  1W2B A;  3KLW A;  5C4X B;  3G4S A;  2LS0 1;  1HR0 L;  5LHY 1;  1D5X C;  5EKI A;  3RLF A;  1EY4 A;  5GAE C;  2RHS B;  4A3L G;  2C9O A;  3L9A X;  1TWC H;  4ZYS A;  1VQB A;  2OTL A;  4LFA Q;  3D8G A;  4QCL A;  4A3D H;  5IT9 L;  2OT2 A;  1VQ5 A;  3PO3 G;  4DR2 Q;  3G6J B;  1E22 A;  2PZW A;  1QG7 A;  3RUZ A;  3W1G A;  1GUS A;  1XNQ Q;  5FLM H;  2EYO A;  3S2D H;  4UP7 A;  2WFW A;  1HUM A;  5J3B A;  2RBM A;  3NE5 B;  5KNB A;  3K59 A;  3ERS X;  3SXH A;  1XNQ L;  4JYA Q;  4FP5 D;  2HIV A;  3GTM B;  2DUD A;  2WAQ G;  1BBX C;  1D1I A;  3I73 A;  1F2Z A;  1QZG A;  4JI4 L;  4KI0 A;  3HOZ H;  1VQ8 A;  4WJ4 A;  2HCI A;  3KLS X;  3J81 i;  1YEZ A;  4NPS A;  5C3W A;  1CZG A;  2VUM G;  1GUN A;  2E76 C;  3DHQ A;  2CWA A;  1AZQ A;  3K5M A;  2A68 D;  3G7L A;  5E4X A;  1W3S A;  4HID A;  1G91 A;  1PFS A;  3K80 C;  2NN6 I;  2K14 A;  2F0G A;  4DV7 Q;  2FMM A;  3KBX A;  1G29 1;  5BN5 A;  3H0G H;  4A93 B;  2E2H H;  1LTT D;  1WCM B;  3K0X A;  2JA5 B;  2OWO A;  4DUY L;  3MXN A;  1CHP D;  2M9V A;  3I2Z A;  4NKL A;  4DV4 Q;  5FO8 B;  3AFQ A;  3TN2 A;  3T53 B;  5AJ3 Q;  3OIP A;  2V4D A;  4X64 Q;  3TP8 A;  1LAB A;  2XWB B;  2WB1 B;  4M8A A;  2VW9 A;  1SDF A;  2F0D A;  1YIT A;  1A3V A;  4YHH L;  1R4Q B;  1GD7 A;  5G3L D;  5JVH 3;  2G5D A;  1MJC A;  3GV6 A;  2RF4 A;  1PFB A;  1TY0 A;  4EGV A;  4HJ8 A;  1EOV A;  2E74 C;  1EQT A;  1B2T A;  1A0I A;  2ZTD A;  1PV4 A;  3IFD A;  4BBS G;  3PUV A;  4Q5V A;  2B2V C;  3CRL C;  1SE4 A;  3KYH C;  1JMC A;  1R9T B;  4WJW A;  1A8V A;  2A19 A;  3QG1 A;  4O42 A;  4NXN Q;  4XYO A;  3OHX C;  3V2T A;  4X65 L;  1FNU A;  4NXN L;  4IPD A;  3WOF A;  4R1J A;  4A3M B;  1E1T A;  4IPC A;  3O13 A;  1V1P B;  4MHE A;  1N33 L;  1MIU A;  2UUC L;  4O1N A;  4ZLT F;  2CQA A;  3AFP A;  4HR7 B;  1HRJ A;  3SDZ A;  1AFP A;  2R7Z H;  3QOL A;  1NUC A;  1X3G A;  2WIN B;  4JPB W;  1DGS A;  3QJY A;  4ME3 A;  1ILQ A;  4FXG C;  2MQH A;  2PZT A;  1KQS A;  2VL6 A;  3TDQ A;  4PQX A;  1V43 A;  1CUK A;  3PIP 3;  1GUW A;  3FPP A;  1S5B D;  5I6Y A;  1A2T A;  1L0X B;  5A35 A;  5C4J B;  5DM7 3;  1ENF A;  4GS3 A;  1LO5 D;  2CCZ A;  4K0K Q;  1TS3 A;  4V0B A;  4U67 3;  2VZA A;  4BWG B;  3DEO A;  5DEH A;  3VR6 A;  2OF1 A;  5CBE E;  3MXG A;  3ND8 A;  3H3V H;  2K5H A;  3IKJ A;  4H44 C;  1V1O A;  2AUJ D;  2L11 A;  1AE3 A;  2Q2T A;  1PZI D;  4B3T Q;  3RNU A;  3LWU A;  3K5L A;  5M3F G;  3BDO A;  2EJG C;  3D31 A;  1PMR A;  4JBK A;  4B3R L;  1YIJ A;  3URY A;  4KTA A;  1VQM A;  3H15 A;  1N32 Q;  2L0C A;  3J81 j;  4F88 A;  2F0H A;  1K8A C;  2JEA I;  4YWK A;  4DK6 C;  5COY A;  1I3Q B;  3NHH A;  4FYD A;  3AYH B;  1DYQ A;  4DKA C;  2ZT9 C;  3M7G A;  5KRU A;  4DR6 L;  3HKZ B;  5C6A A;  1XPR A;  1GM5 A;  2ZXP A;  1KAB A;  4R4T A;  2DJF C;  1V9P A;  1E24 A;  3ERQ A;  3TP5 A;  1HNX L;  2KHS A;  3S1Q H;  5IOD A;  3A8I E;  2B8F A;  4DR5 L;  3HOW B;  4K6D A;  1PH5 A;  1EQR A;  1ZYR D;  1VQD A;  3GTP B;  4EQO A;  4L5S A;  4ME5 A;  5ELB A;  5JVG 3;  2AWO A;  2D0O A;  2Q2I A;  4A3D G;  3BZK A;  3BS1 A;  4C3J B;  4UP9 A;  2EY1 A;  1L2F A;  1Q81 C;  4KV6 A;  2DNC A;  4IFD H;  3S9W A;  2VNU D;  3E3X A;  3VYU A;  1BUV T;  3SK5 A;  1B4O A;  2YTX A;  3EFX D;  4LAA A;  2Z1C A;  1XPO A;  5EPJ A;  5FLX E;  3AU7 A;  2IX0 A;  4F8M A;  4A3B B;  3HOZ G;  4X66 Q;  4OWW B;  4IQZ A;  4LF7 Q;  3QWN A;  1X54 A;  4FXK C;  3J7A V;  1PXU A;  5EJW A;  1M8A A;  3OSO A;  1HCZ A;  2RA4 A;  1I94 L;  4G7Z C;  3DXJ C;  1O7L A;  3KBG A;  1DD2 A;  3GTJ H;  1PA6 A;  4KHP L;  3CKI B;  4WFN 3;  4OL7 A;  5FJ8 G;  1EU3 A;  1YNJ C;  3KDF B;  3U4Z A;  3I4N B;  2RSN A;  3R2I A;  1ESF A;  2UUB Q;  4ID6 A;  2O5I C;  1SR3 A;  3OYY A;  2E2J H;  3HKS A;  3ER0 A;  2FMC A;  3M3Y H;  2UUB L;  3S2H H;  3K81 C;  5C5M A;  3CHB D;  4MZ9 A;  1EIF A;  1HTP A;  3U50 C;  2B2Y A;  2BA1 A;  4RCO A;  1OXT A;  2NZH A;  4A3E H;  3I90 A;  2K5D A;  2KHI A;  4DV5 Q;  3CC4 A;  1QCB D;  1PFM A;  5L37 A;  5CV6 A;  3F2D A;  4DV5 L;  5CBA E;  4B9W A;  3NTI A;  4JI7 L;  1TII D;  2DNE A;  2EOT A;  3CCJ A;  1PYW D;  1SJE D;  1L1O A;  4IN3 A;  2E2I B;  4ZUJ A;  1UE7 A;  2K4K A;  3AEV A;  3X3N A;  4J8Q A;  1PZK D;  1A15 A;  2Y0S G;  1JWU D;  1O7I A;  3BYT B;  3C3L A;  1SYF A;  2F0J A;  2VB2 X;  4N9T A;  2X69 A;  4UHV A;  1WTO A;  2R93 H;  4GOP C;  2D2C C;  3GDE A;  2I5H A; 
#chains in the Genus database with same CATH homology
 1E1O A;  1HH2 P;  2OQK A;  2HQL A;  1VQE A;  1VQI A;  1Y1V G;  1A63 A;  4DR6 Q;  4LNQ A;  4OX9 Q;  1CKN B;  1HNZ Q;  1RL2 A;  3DM3 A;  4GLX A;  1IBM L;  4UY8 C;  4AQY L;  3TS2 A;  4A3F H;  4YWM A;  5LMN W;  2YTY A;  1T9H A;  4JYA L;  5C3E G;  4HJ7 A;  4OX9 L;  2UXC Q;  2H5X A;  2VQF Q;  2WAQ E;  4A76 A;  5C4X H;  4DR1 L;  4JI6 Q;  1U0L A;  1HNX Q;  4POG A;  4DR7 Q;  4Y52 H;  2B29 A;  2PNH A;  1N36 Q;  1L1O C;  2OQ0 A;  3BU2 A;  5IWA Q;  1VQN A;  1JJC B;  4A3J H;  1XNR Q;  4A4I A;  3F2B A;  4DR5 Q;  3PF4 A;  2UXC L;  1NMG A;  4LUZ A;  2IY5 B;  1AE2 A;  1M90 C;  1L1O B;  3KF6 B;  1N34 Q;  4LF5 Q;  5IWA L;  4PZ6 A;  2PMZ E;  2Q2U A;  2LXK A;  4A3K H;  5GRO A;  2EQS A;  1YJW A;  3HFZ B;  1K8G A;  5IP9 H;  5M3M G;  1SN8 A;  1UEB A;  5IYD H;  3CXC A;  2KCM A;  2JA6 H;  3GTQ H;  4LF6 Q;  1Q8K A;  2WB1 E;  2B63 G;  1X9N A;  4DV6 Q;  4DV7 L;  4LFB L;  4BY1 G;  3G48 A;  1B8A A;  1VQH A;  4BY7 G;  3PUW A;  1J5E Q;  4H02 A;  3M85 A;  3PIO A;  3CW2 C;  4C3I H;  2ATW A;  5EAY A;  1FGU A;  4A3E G;  1FVI A;  1XTD A;  4JCV E;  2GN5 A;  1J5E L;  2HT1 A;  3FKI H;  4DV4 L;  4GNX C;  3GTM H;  2K52 A;  1YHA A;  1FJG L;  1NTG A;  3KDF A;  5AJ3 L;  3CF5 A;  1C9O A;  4GNX B;  2UUA L;  5IP7 H;  1VQ7 A;  3HOV H;  2IX1 A;  2QA4 A;  3M9B A;  3UE0 A;  4X64 L;  1Y1W H;  2JE6 I;  2GVA A;  3PO3 H;  4DK3 C;  4J15 A;  3HOU G;  5C0X I;  4JI3 Q;  4TVA B;  1IBK Q;  4GKJ Q;  4QJF A;  3CC2 A;  5GAG C;  3GTO H;  3PV0 A;  4JG2 A;  2PI2 A;  4DUZ L;  2I0Q A;  3DLL A;  2AKW B;  2AMC B;  1EIY B;  2CFM A;  2UXB Q;  5JJL A;  4JBJ A;  1LM0 A;  3D0F A;  4APV A;  1NY4 A;  1BKB A;  3S1M H;  3NBH B;  2CWP A;  2L15 A;  1IZ6 A;  3HOY G;  4JI1 Q;  2K75 A;  1TXY A;  3K7A H;  1I94 Q;  2MO0 A;  3J7Z C;  5M3F H;  5BR8 Q;  4YY3 L;  2UXB L;  2QEX A;  4L5Q A;  4A75 A;  1KL9 A;  2ZJQ A;  4BBR H;  3CP0 A;  4A93 H;  5IY0 A;  4JI8 Q;  1TWA H;  1WCM H;  4JI1 L;  4LF4 L;  2JJQ A;  2JA5 H;  1PHJ A;  3T1H L;  3H3V I;  3M7N A;  4OWX B;  4A3I H;  3TQY A;  4KHP Q;  3JC6 6;  3RZD H;  4JI8 L;  4LFC Q;  2F3I A;  1VQK A;  4L5T A;  2F52 A;  4JI5 L;  1CSQ A;  2C35 B;  3PO2 H;  3MEF A;  2RHQ B;  3KJO A;  2R92 G;  2E5L Q;  4PZ8 A;  5C4X G;  4P73 A;  2F4V Q;  2JQO A;  2VS1 A;  1P16 A;  4IOA A;  3F8T A;  4A3J G;  3I4O A;  3HOX G;  4IFD J;  4JBM A;  1X56 A;  2ZM6 Q;  1YBY A;  2F4V L;  4GLA C;  4OXP A;  1VQ6 A;  5JJK A;  1H95 A;  4YCV A;  3UDI A;  4TQU S;  5GQO A;  2PQA A;  1KRS A;  1Q82 C;  3T1Y L;  2ZM6 L;  1IL2 A;  2BH2 A;  5IP9 G;  5IYD G;  1B70 B;  1SLJ A;  3NEL A;  1CKM A;  4X62 L;  2JA6 G;  3ZJY C;  4JC0 A;  1CKN A;  4XIG S;  4DV3 Q;  4GOP A;  3BJU A;  3S17 H;  1UE1 A;  1XJV A;  4JI7 Q;  3E0E A;  1W2B A;  1R9T H;  3KLW A;  1EWI A;  3W1B A;  4DV3 L;  3G4S A;  1HNW Q;  2MFI A;  1HR0 L;  2UXD Q;  2N3S A;  1L0W A;  3RLF A;  3PIP A;  2UU9 L;  1I6H H;  3Q8D A;  5GAE C;  2RHS B;  1FL0 A;  4DNI A;  4A3L G;  1BBW A;  1TWC H;  3FKI G;  3LGJ A;  3KFU A;  1VQB A;  1HZ9 A;  2HIX A;  3A5Z B;  2OTL A;  3S24 A;  1CSP A;  4K0K L;  4JOI A;  4LFA Q;  1X3F A;  1U5K A;  5IP7 G;  1YI2 A;  3HOV G;  4A3D H;  3PUY A;  2A8V A;  4A3M H;  3E9H A;  2R6G A;  1Y1W G;  1VQ5 A;  2EIF A;  1JT8 A;  3PO3 G;  2N8N A;  3CQZ H;  3CCR A;  2LXJ A;  4LWC A;  3CCM A;  4DR2 Q;  4QQB X;  1BBU A;  1E22 A;  4BBS H;  3B6Y A;  4AQY Q;  2MO1 A;  3CMA A;  3PF5 A;  3W1G A;  4IO9 A;  4JI0 Q;  1XNQ Q;  4FDB A;  5FLM H;  1V1Q A;  2PQA B;  1IXR A;  3S2D H;  4DAM A;  4UP7 A;  2WFW A;  5J3B A;  3RLO A;  1IBM Q;  5IE8 A;  1ASY A;  3ERS X;  1PH1 A;  4JI0 L;  5GAH C;  1Z9F A;  4B3T L;  1XNQ L;  2HIV A;  3RR5 A;  4JYA Q;  4AIM A;  4OWT B;  2DUD A;  4GOP B;  2WAQ G;  4BBR G;  3L2P A;  5M5Y H;  1QZG A;  1PH6 A;  1MJE A;  4DR1 Q;  4JI4 L;  4A93 G;  1WCM G;  2OTJ A;  4YCW A;  4GN5 A;  4KI0 A;  2JA5 G;  4GNX A;  1XMQ Q;  3HOZ H;  4A3I G;  1VQ8 A;  2VQE Q;  3CAM A;  3S15 H;  5C4J H;  2B3G A;  3KF8 B;  4WJ4 A;  3NEM A;  3AQQ A;  3J81 i;  5H1S E;  1VS0 A;  1YEZ A;  4NPS A;  4QL5 A;  3HKZ E;  4JOI C;  3KOJ A;  1XMQ L;  3PO2 G;  2VQE L;  3GTK H;  2BA0 A;  2VUM G;  4LW1 A;  2CWA A;  3CCV A;  2ID0 A;  1N32 L;  4BA1 I;  3ICE A;  4R4O A;  1N8R C;  1TWG H;  4YWL A;  1W3S A;  4HID A;  1PFS A;  2JEB I;  2WB1 G;  3K80 C;  2NN6 I;  2K14 A;  1YHB A;  4LFB Q;  4DV7 Q;  1KD1 C;  2IHE A;  1G29 1;  3H0G H;  4UPA A;  2E2H H;  4NXM Q;  2BH8 A;  1WOC A;  4R4Q A;  3K0X A;  4PZ7 A;  4MTN A;  5FLX c;  1NJI C;  1VQJ A;  4HJ5 A;  2OWO A;  4YCU A;  4DUY L;  3S1N H;  1QVC A;  3I2Z A;  3CME A;  4NXM L;  4DV4 Q;  3AFQ A;  1YJN A;  2AHO B;  1TWF H;  1FJG Q;  5AJ3 Q;  5C0X G;  1MKH A;  5K36 G;  2UUA Q;  3ULL A;  4X64 Q;  3OTO L;  1WI5 A;  1J6Q A;  1YNX A;  4AYB G;  3I7F A;  2VW9 A;  3G71 A;  1YIT A;  1SMX A;  2NVX H;  4DUZ Q;  4YHH L;  1SE8 A;  1GD7 A;  1YHQ A;  4AH6 A;  4GKK Q;  1MJC A;  2QGQ A;  4RG1 A;  2YYZ A;  2RF4 A;  2ZJR A;  1EUJ A;  4R4I A;  4OO1 G;  2E8G A;  4X6A H;  1GVP A;  4LUV A;  4HJ8 A;  4GKK L;  1EOV A;  4A3M G;  3I55 A;  1Q86 C;  1KHI A;  3UDF A;  1A0I A;  4YY3 Q;  2KEN A;  2ZTD A;  1I3Q H;  1VQA A;  2ZTE A;  5IYB H;  3TEH B;  1PV4 A;  3HOZ G;  4BBS G;  3PUV A;  4DPG A;  4LF4 Q;  4WJ3 M;  2KBN A;  3KYH C;  3T1H Q;  4QIW E;  1JMC A;  1OTC A;  2VY3 A;  5HY6 A;  3K7U C;  2JA7 H;  1SRU A;  3CPW A;  5FLM G;  4DR3 L;  1QZH A;  1A8V A;  2A19 A;  3SGI A;  3MXN B;  2R93 G;  2ES2 A;  4NXN Q;  1OXS C;  4GOP C;  4DV0 Q;  4JI5 Q;  1OXU A;  1TWH H;  4JI2 L;  4LF9 L;  4X65 L;  1KC8 C;  1RIP A;  4NXN L;  2NVY H;  4A3F G;  4IPD A;  4DV0 L;  1K9M C;  4R1J A;  1E1T A;  4MNO A;  4O0A A;  1HZB A;  4IPC A;  3RLN A;  1AH9 A;  4DV2 Q;  3TS0 A;  3I4M H;  4Y7N H;  3HOW H;  1PH2 A;  2XTI A;  2GVB A;  1X3E A;  4X66 L;  1MIU A;  2UUC L;  4LF8 Q;  1GO3 E;  1N33 L;  3AFP A;  1Q1E A;  3T1Y Q;  3GTP H;  4DV2 L;  4LF7 L;  4X62 Q;  1Q7Y C;  4LF8 L;  2R7Z H;  1X3G A;  1D7Q A;  1DGS A;  4ME3 A;  4A3K G;  4KLK A;  3CC7 A;  1XMO L;  1K0R A;  2MQH A;  4C3J H;  1KQS A;  1NBW A;  1Q46 A;  2PI2 E;  1VCI A;  2VL6 A;  3H0G G;  1K3R A;  1SRO A;  1V43 A;  1CUK A;  1HR0 Q;  1IBL Q;  4A3G H;  2Z6K A;  1VQ4 A;  2UU9 Q;  3L0O A;  3UE1 A;  2R7F A;  3F1Z A;  3EBE A;  1VQF A;  3IRB A;  1PH4 A;  4GS3 A;  2I5M X;  1IBL L;  2XGT A;  2CCZ A;  4HIO A;  1B7Y B;  4K0K Q;  3STB C;  2VZA A;  1K73 C;  5LMU L;  3K8A A;  3CPF A;  1QUQ A;  3RN5 A;  3GO5 A;  3A0J A;  1HZC A;  5DLQ E;  1JJ2 A;  4A3B H;  1QVG A;  3H3V H;  2K5H A;  3S16 H;  3KJP A;  2IT1 A;  2ZJP A;  2ZTC A;  3F2C A;  2Q2T A;  1AE3 A;  1YJ9 A;  2ASB A;  1CKO A;  4EQ5 A;  4B3T Q;  3PUZ A;  3RNU A;  1X6O A;  4JI4 Q;  5JJI A;  4P74 A;  2Z6K C;  1QVF A;  2RCN A;  5M3F G;  3HOU H;  2JA7 G;  3D31 A;  4JBK A;  4JV5 Q;  4B3R L;  5C44 H;  1P8L A;  1UE6 A;  3UDX A;  1YIJ A;  3I4N H;  2ALY B;  2NN6 G;  2CKZ B;  2NZO A;  2N78 A;  4IPG A;  5JEA G;  4IFD I;  1VQM A;  4JV5 L;  4DAY B;  3H15 A;  1N32 Q;  1LYL A;  1E3P A;  2K5N A;  3CD6 A;  3HOY H;  2K50 A;  3J81 j;  2R7D A;  3PCO B;  4B3S L;  4DV1 L;  2YV5 A;  5ELO A;  1QUQ B;  5C0X J;  3PUX A;  2Y0S E;  3TRE A;  1K8A C;  2JEA I;  3UDG A;  4YWK A;  4DK6 C;  1UE5 A;  3A5U A;  4BA2 I;  2D0P A;  3TRZ A;  3OW2 A;  1D8L A;  1OXX K;  1C7Y A;  3I4M G;  4BXX H;  2I5L X;  1WFQ A;  2FXQ A;  3HOW G;  1G6P A;  3AYH B;  1WYD A;  4IJH A;  4DUY Q;  4DKA C;  1Q12 A;  2R7Z G;  1KAW A;  1VQG A;  4O2D A;  2R92 H;  4DR6 L;  5FJ8 H;  1HNZ L;  1XPR A;  4HJ9 A;  4IOC A;  3E9I A;  4JBW A;  1ASZ A;  1E7Z A;  1GM5 A;  3JAM i;  5M5X H;  5IYC H;  1PH8 A;  4R4T A;  3VDY A;  3OTO Q;  1V9P A;  2VQF L;  3HOX H;  1E24 A;  1EFW A;  1Z47 A;  1LTL A;  4A3G G;  4DR7 L;  3J81 c;  1EYG A;  1HNX L;  4JI6 L;  3J80 i;  3G6E A;  4DR4 Q;  1N36 L;  4YHH Q;  3S1Q H;  1XNR L;  4DR5 L;  2E2I H;  1PH5 A;  1I50 H;  1VQO A;  1EQR A;  4IJL A;  4DR4 L;  1N34 L;  1VQD A;  4LF5 L;  3CCS A;  4L5S A;  4P75 A;  4A3C H;  2IHF A;  2JK8 A;  2AWO A;  1IYJ B;  2D0O A;  2Q2I A;  2V1C C;  4P72 A;  4A3D G;  3EIV A;  1KXL A;  3BZK A;  4LF6 L;  4A3B G;  1WJJ A;  4UP9 A;  1L2F A;  4DV6 L;  4POF A;  1Q81 C;  2HHH Q;  4A3L H;  5M5W H;  3JAM c;  4DR3 Q;  1HR0 W;  3BZC A;  4ALP A;  1PH7 A;  2VNU D;  5E7N A;  1VQ9 A;  2HHH L;  1YVC A;  4JI2 Q;  5LMN Q;  3J80 c;  2EXD A;  4LF9 Q;  2JA9 A;  4X65 Q;  2JA8 H;  4R4C A;  2YTX A;  1G51 A;  1XPO A;  4XTC S;  3M4Q A;  4RMF A;  5LMN L;  5GAD C;  4AYB E;  2YTV A;  2IX0 A;  5C44 G;  3PGZ A;  1K83 H;  3A74 A;  4JI3 L;  4X66 Q;  1IBK L;  1I5F A;  1SFO H;  2UUC Q;  1N33 Q;  5ELN A;  3WWV A;  4HJA A;  3I4N G;  4GKJ L;  3PSI A;  3CCE A;  4OWW B;  4LUO A;  1PH9 A;  4LF7 Q;  4IPH A;  1X54 A;  3NEN A;  4OON A;  1NE3 A;  1Y1V H;  4GN4 B;  4L5R C;  4PG3 A;  2NVT H;  4OO1 I;  1XMO Q;  3CCL A;  1I94 L;  4BXX G;  5BR8 L;  2D62 A;  5C3E H;  2Q2H A;  2NVQ H;  2LSS A;  1Y14 B;  3GTJ H;  1M1K C;  3GTL H;  1PA6 A;  1GKH A;  3S14 H;  4KHP L;  2VUM H;  1PYS B;  5FJ8 G;  5HGQ A;  4LFC L;  3M4O H;  3KDF B;  3U4Z A;  3S1R H;  1EQQ A;  4QGU A;  5LMU Q;  4GLV B;  4UP8 A;  4QY7 A;  5IYC G;  2UUB Q;  2YU9 H;  2Z0S A;  1JB7 A;  2E5L L;  1C0A A;  5M3M H;  3FP9 A;  1SR3 A;  2KCT A;  3OYY A;  4KHZ A;  2E2J H;  3HKS A;  3ER0 A;  1LUZ A;  3M3Y H;  2UUB L;  1JE5 A;  1OXV A;  3I56 A;  3K81 C;  3S2H H;  2B63 H;  1KRT A;  1XPU A;  3L7Z C;  3STB D;  4MZ9 A;  4P71 A;  1EIF A;  3U50 C;  3U4V A;  4BY1 H;  4BY7 H;  1X55 A;  4GN3 B;  3M4P A;  3GTG H;  2BA1 A;  1YZ6 A;  1OXT A;  2NZH A;  3EN2 A;  2MNA A;  4A3E H;  4A3C G;  2KHI A;  5JEA J;  3CCU A;  4DV5 Q;  3CC4 A;  3U58 A;  2OCE A;  1HJP A;  4EX5 A;  1N9W A;  3RZO H;  3J7A 5;  2DGY A;  3F2D A;  2WP8 J;  4C2M H;  4DV5 L;  1Q1B A;  5IT9 c;  1BVS A;  4JI7 L;  4HIK A;  4IFD G;  5IYB G;  1PVO A;  3FHW A;  3ULP A;  2K5V A;  4B3R Q;  1HNW L;  2UXD L;  1S40 A;  1VQL A;  2A1A A;  3W5O A;  3CCJ A;  1L1O A;  3KF6 A;  4B3M Q;  1UE7 A;  2K4K A;  1X65 A;  1VQP A;  1PH3 A;  2JA8 G;  1VQC A;  1PYB A;  3AEV A;  3HKZ G;  1KIX A;  2N49 A;  1NMF A;  3GD7 A;  4C3H H;  4B3S Q;  4DV1 Q;  1S72 A;  4B3M L;  4LFA L;  2Y0S G;  3RN2 A;  1O7I A;  1UWV A;  1HZA A;  1A62 A;  4PMW A;  3ULJ A;  4NB3 A;  2KHJ A;  4DR2 L;  1JJG A;  3CCQ A;  2R93 H;  2AWN A;  4HIM A;  1S3O A;  3GDE A;  2CQO A;  2I5H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...