2Q8IB

Pyruvate dehydrogenase kinase isoform 3 in complex with antitumor drug radicicol
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
93
structure length
93
Chain Sequence
SYPPHMQVLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKEADISAFADY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 3
publication title Distinct Structural Mechanisms for Inhibition of Pyruvate Dehydrogenase Kinase Isoforms by AZD7545, Dichloroacetate, and Radicicol.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 15
structure length 93
sequence length 93
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 2007-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2q8iB00
4IFDH 2O5JC 3A8KE 4GZYC 3ND9A 4DK1A 1H9JA 1TU2B 1HCZA 1O78A 5JEAG 4KN7C 4G7OC 1VF5C 1VF7A 1GHKA 3HGBA 3M4YA 2NN6G 2BDOA 5KNDA 3H94A 4BA1I 5JEAH 1OXXK 1B9NA 1I6VC 1Q12A 2CW0C 3I72A 2D5DA 4H44C 4KI0A 2NN6H 1DCZA 4KKSA 4KKTA 1Q90A 4H13C 4LJZC 2JE6I 2BA1A 1Y8PB 3OW7A 3T56B 3VR5A 1GJXA 2AUJD 2Q8IB 3CRLC 1Y8OB 3VR3A 2E74C 2BE5D 4BA2I 3A7LA 3U9SA 5KNBA 1B9MA 1IW7D 2K32A 1DD2A 1LABA 3D4RA 3SDZA 1V43A 2L5TA 3GQBA 4L8JA 3PUXA 2NN6I 1ONLA 2EJGC 1ZYRC 2JEAI 1QJOA 3ND8A 1VDZA 5KNCA 1K8MA 2A6HD 2A6ED 1ZKOA 2BE5C 3VA7A 2EDGA 3RLFA 3QG1A 1E2WA 1BDOA 1IW7C 1LACA 5A35A 1TKWB 3CRKC 4PV1C 3BDOA 2PPBC 2JEBI 3MFYA 1H9SA 1H9MA 2A69D 1OXUA 3A8JE 4DNRB 1DXMA 1E2ZA 3WDNA 2ZT9C 2DNEA 4JBWA 2D2CC 3TZUA 2A6HC 1GUTA 3T51B 2JXMB 2A6EC 3T53B 2PNRC 3OOCA 1V8QA 4LK1C 4DK0A 2EVBA 3D31A 1Y8NB 2K7VA 3EQLC 5K36H 3P20A 3OPOA 1Q1EA 1G291 4XIGS 2E76C 4DNTB 5BN5A 1SMYC 5BN3A 2A69C 2KCCA 3VR6A 1T5EA 1OXSC 1E2VA 4H0LC 1Y69U 2A68D 4XTCS 3PUVA 3W3AA 2B8GA 1GHJA 1A6XA 2EJMA 2QF7A 1HTPA 1YNJC 1EWHA 1GUGA 3DXJC 3LWUA 1OXTA 4I7ZC 4JK1C 4TQUS 1H9RA 2EJFC 3MXUA 2LMCB 2KA7A 2B8FA 2DN8A 2E75C 1FYCA 3N6RA 4KKUA 4KMUC 2AUKA 5K36G 1GUSA 3QJYA 2BA0A 3A7AB 2A68C 4OO1G 3A8IE 3QIAA 4RCNA 1CI3M 1H9SB 4G7HC 4G7ZC 3PV0A 4OO1H 3M7NA 1H9KA 1Z7TA 1IYVA 4HR7B 1HQMC 3PUYA 1K8OA 3LNNA 1O7LA 2D62A 3PUZA 3I73A 2AWOA 1GUNA 2F1MA 2O5IC 1Z6HA 2R6GA 4KHZA 1OXVA 4TKOB 3VR4A 1HPCA 2YYZA 2DNCA 3PUWA 1CTMA 3BG3A 1VCIA 3I4LA 3KLRA 2IT1A 5BN4A 5C0XG 2V4DA 3L7ZC 3NE5B 4IQZA 3SE0A 3FPPA 2K33A 1IYUA 2PCFB 1CFMA 3IKJA 4IFDG 3GD7A 4OGQC 1YNNC 1PMRA 3IFTA 4KN4C 5C0XH 1GUOA 3M85A 1FR3A 3AB9A 1Q1BA 3FMCA 3VR2A
chains in the Genus database with same CATH superfamily
4J1MA 1HJPA 4CDFC 5FLXE 2FJ2A 4YWMA 3PO2G 1HCZA 2VL6A 3RN2A 3AEVA 4B9XA 4AYBB 4K5VA 5KGUA 1EYAA 4K6DA 1Q90A 3R3OA 1RODA 1BNZA 1DONA 4HJ8A 1HUNA 2XGTA 4A75A 1K8AC 1PZKD 1Y8OB 3DWQA 3OIPA 5GAEC 4JBJA 1H95A 1Y14B 2UUCQ 1B9MA 4DF7A 5IYBH 1LABA 1YJ9A 3D4RA 3ULJA 2UXDL 1PH1A 1EY7A 3V2TA 4YIJA 1K8MA 1IL8A 1KRTA 4QY7A 4BY1G 3VA7A 3S15H 3G7LA 4GKKL 3G71A 1WTRA 1TKWB 1HNWQ 2C9OA 3GV6A 2JA5B 4R4TA 2C5CA 3C1FA 4RFBA 3CCQA 3MXPA 3TBIB 4X3SA 4DXFA 2Q8TA 3E9IA 1JC7A 4ZUJA 3J7ZC 2R7DA 2SEBD 1X3GA 4JBKA 5G3LF 2M9VA 4XT3B 4MN3A 4F7XA 3CPFA 3VYUA 4LF5Q 5I4DA 3ICEA 1JR0D 1QZGA 4TVAB 1SXTA 5JPNC 1HHVA 4EGVA 1HA6A 1U9RA 3ULLA 3K5MA 3E6ZX 3S14H 3DEPA 1ASYA 4EQOA 2KCMA 4QMGA 4JOIC 4KMUC 2MFIA 3PQIA 1GUSA 1UUPA 2BA0A 4ZKBB 1PH4A 1IBMQ 3A8IE 3P7JA 3QIAA 4DR2Q 4AYBE 1BBXC 4JBMA 1IBLL 2DUDA 5GQOA 1WTWA 3MVVA 1KDBA 1SBBB 3CCRA 5JJZA 4Y52H 1KIXA 1SNCA 5M5YH 2QDLA 1EWCA 3NP8A 1TY2A 2FHTA 1A0IA 3PF5A 3TRZA 2MP1A 2R92B 3KDFA 5JVG3 3AFQA 1BVSA 2F0EA 1X6OA 4LF5L 3HRZC 4LF9Q 3M85A 3GD7A 1EEID 2Z6KA 3CCJA 2HQEA 1W2BA 4IFDH 4M8AA 3Q8DA 3Q6SA 1O78A 5FJ8H 4U68A 4K5XA 4DV3Q 2ALYB 4WJ3M 4IURA 4UPAA 4U673 2IHFA 4HJAA 5I2YA 1TS3A 1MHWC 3RNUA 3X3MA 1CHQD 2ZTDA 2HHHL 3J7A5 5FOBB 2JN4A 5C0XI 4DR2L 2VUMB 2AMCB 4WJWA 1JJGA 2Z8LA 1XXGA 1IKMA 2F0PA 3CC2A 4C2MB 1NAPA 3MTSA 3M3YH 2Y0SB 2AWNA 3G4SA 3FEWX 3LX0A 4X66L 4FF3A 1IKLA 1ZYRC 1QJOA 4TRDA 1LYLA 1HFNA 1VQ8A 1VQFA 2WAQB 4DR5Q 2UUAQ 4KK7A 3QG1A 3CXCA 1C9OA 4A93G 2QA4A 1S40A 5L37A 1BBWA 4JI2Q 2WB1E 1FJGQ 4LF9L 1F2LA 1SYCA 3HOYB 1HXYD 1E2ZA 3S1MB 4DV4Q 3HKZG 1W6JA 3HZXA 1V8QA 4R4QA 4KD4A 4P75A 5I6YA 5GAGC 4N8X1 4MHEA 1UWVA 2ZXRA 1U5KA 3J7AF 3D6CA 2KCCA 3H3VC 2JA7B 5A2QL 2N78A 1PH9A 1N32L 1NBWA 5IGGA 1GHJA 1EWHA 4JK1C 5E4XA 3GTQB 1H9RA 4IJLA 3Q0AA 1KAWA 4LF6L 3KJPA 4PZ8A 4ZUIA 2E2JB 4OIJA 1BQQT 2UUAL 1YNJD 4CDDC 3GTGH 4IPGA 4K0KL 2PQAA 2NBFA 1JQYD 2Q2HA 1EY8A 1PYWD 2L0CA 4YY3L 3PIO3 4A3JB 3GTGB 1HZBA 1FJGL 5J3BA 4A3EH 1TIID 2UXBL 2AWOA 4GN4B 1RJTA 2PZUA 4A3EB 3HOWB 2NB0A 3M4OB 1VQAA 2WAQE 1LT5D 4A3FH 5IODA 5H1SE 2B3GA 4BWGB 5CV8A 4DAYA 3ND9A 4DAPA 3J81c 2K4KA 3RMHA 1VF5C 3T16A 4L6TB 3GTOB 2MUYA 4BA1I 4X6AH 4DV7L 4RA8A 4A3DH 4O1NA 2XVSA 1Y1WB 3RZDH 4K2LA 1SE2A 1KXLA 1EY4A 4IUTA 2Q8IB 1EY6A 2VQEQ 4DV2L 2OTJA 4BA2I 1PTOH 2VS1A 3J81j 2K32A 5C4JB 5KRUA 3GTJH 5EKLA 3GTLH 4RH6A 1PFMA 4HIMA 5I6WA 3F2CA 2ENBA 3GTLB 4XDXA 2F0KA 2Z1CA 1GD7A 2YTYA 4ZKCB 3E0JA 3K0YA 2EPBA 3GTKB 1LTGD 1SE4A 1SLJA 3PO2B 3STBC 3BDLA 1WD0A 3GTMH 4X3TA 3S1RB 3T51B 3IAYA 2JXMB 1VS0A 1RTNA 2CWAA 1A3VA 1G291 4N9PA 3U9OA 1KABA 2XWBB 3NBHA 3EA6A 3NK9A 4HIKA 3NTIA 1BR9A 4N8FA 2VQEL 4C56C 4TQUS 3DM3A 1LM0A 1A2UA 4GS3A 4DV1Q 4A3CH 4RHRA 2AUKA 3KLSA 2JJQA 3J80E 1TY0A 3N52A 1A3TA 1DOKA 3KUPA 1CI3M 4POFA 2LS01 3BJUA 2J0TD 1N34L 2Q2UA 2K6AA 2X6LA 1HNZQ 1NUCA 2E2DC 1K0SA 2M00A 3HG9A 1VQKA 4TSSA 4DR1L 2I07B 3VR4A 4PG3A 1LTTD 4LWCA 3I4LA 3I55A 1JT8A 1QVFA 1TS5A 1WJJA 4IZ8A 4AYBG 1KDAA 1SFOB 2NVXH 5IGFA 4Q5VA 2VB3X 4G7OC 1GHKA 5C6AA 2QW7A 1PDQA 2ZTCA 4HCSA 1PRTD 1C0AA 3OWEB 3RR5A 4P73A 5FO7B 2B2UA 2L1BA 4H13C 1XPRA 3SK5A 4DA2A 4R4CA 5CORA 3G6EA 5IYBG 1SJED 1D5XC 4K5WA 4L5QA 4AQYL 5C3XA 2BDNA 1HFGA 3I4OA 1HNZL 1ENAA 1PH3A 3SDZA 1KDCA 2N55A 1YVCA 3CU7A 1NCVA 1NMFA 1BBUA 5C4XB 5ELCA 1IW7C 3T13A 5JJIA 1I94L 3OHXC 2JK8A 4RKLA 3DWAA 1F2YA 2QKIC 2F3VA 2MGSA 1EY5A 1SYBA 4DFAA 1KC8C 4OX9L 4FF2A 1VQPA 1R4PB 1CT1D 4HMJA 1KL9A 1PXUA 2EYPA 2P5ZX 2Q8RE 2WV6D 4IPCA 4KJOA 3KBGA 4YCWA 5BN5A 5IP9G 2RSOA 3OYYA 1FVIA 1D5MC 4DK3C 1RKNA 1MJEA 1E2VA 2EQSA 1NTGA 2G9DA 4XTCS 1L0WA 2R7ZH 2LSSA 1VQGA 1IBKQ 1PRTF 5KYLA 2EJFC 4JI5Q 2WB1G 4OIKA 1EOVA 1XYIA 2GVAA 1W6KA 3EVQA 1PFBA 4JI3Q 1PYSB 1DZ1A 3D4DA 4JI6Q 1SYDA 3KF8A 1IYVA 2KCNA 5E1FA 4JYAQ 2N3SA 1K8OA 1JE4A 2EYOA 3GV3A 3CW2C 2DJGC 5ELFA 5CBEE 2O5IC 1PZJD 2LXJA 4Z9CB 3PUWA 3BG3A 3KLRA 2V1CC 3E5SA 2MNAA 5DLQE 4IFDG 2QDBA 3ER0A 4OGQC 2GA4B 4NXMQ 2B39A 5FLXL 5FJ8G 2K14A 4DAMA 3FMCA 2WKDA 4A3GH 1ILPA 1G91A 4RCOA 1FNVA 5IGCA 1GM5A 4A3GB 4A3MH 1SYFA 1GO3E 3HGBA 1S5ED 2EY5A 2JA6H 1AZPA 4NPSA 4FNFA 4NW2A 1Q46A 2PYKA 3CAMA 1PH5A 2JA6B 1DOMA 3JAMc 1JOQA 4JI3L 1X9NA 4P71A 1R9TB 3SR1A 4R8NA 4ULLA 1UNSA 2EOTA 2OF1A 3TREA 3I4NH 2WAQG 4HEDA 4CJ2C 1HZAA 2HIXA 1K8GA 2F0IA 3I4NB 1XJVA 4G4KA 4L8JA 1BCPD 1Y1VH 2UUBL 3SK4A 1Q8IA 4DV5L 5FLMH 2BE5C 3NPPA 4X65Q 1X55A 3BZDB 5K5PA 3RZOB 4V0BA 2PPBC 1EYDA 1SMYD 2JEBI 2JSOA 1H9SA 4P2CB 4NXML 1F2MA 3A8JE 4NB3A 1DXMA 2KOLA 5EKIA 4CHTB 1TWHB 2DNEA 3M9BA 1GUTA 1QG7A 1YI2A 4FDBA 1X3FA 5M5WH 3EQLC 1W3SA 4Q0FA 2R93H 4DV0L 1PRTB 1TWGH 2F0LA 2KCTA 4X64L 2R93B 4JI4Q 4F8MA 4OELB 5DNFA 4GOPC 2I5LX 2FXQA 3MEFA 3RLOA 5IYCH 3K81C 1F9RA 1YNJC 1I4GA 4XQJA 2K03A 1EZ8A 1M8AA 2EE1A 3ERSX 3VR2A 2B8FA 5M5XH 2M2LA 4C3HH 4L5RC 5TSSA 3KK7A 3U4VA 1HUMA 1TWFH 1QWYA 2L15A 4GLXA 5FK9C 1LO5D 1DGSA 3CCVA 4A3EG 3HOWG 1SN8A 3RLNA 5CYUA 1SNPA 5IGBA 1ICFB 4ZYSA 2E2IB 3T1HQ 1J5EQ 2K05A 2F0FA 3ONAB 5HGTA 5J22A 3P75A 4A3FG 4B3RL 3SE0A 4UDUC 4RMFA 4MZ9A 5M3MB 1I4QA 3G6JB 2O5JC 3A8KE 1Z47A 4RWSC 1CZGA 4B08A 1ESRA 4A3DG 4PZ6A 1X32A 2SOBA 1HNXL 2FFKB 2XIWA 3OTOL 1LTRD 4DN4M 1VQNA 3M4PA 3I90A 1Q12A 3Q23A 5C0XJ 4KKSA 1K73C 2RSNA 4DV6L 3K7AH 2BH2A 1HZCA 1KNAA 3K0XA 4C3JB 3NWSA 1L0XB 3W2DA 3K7AB 2LKVA 4DGZA 4DR7Q 2KHSA 2Q2IA 1V43A 3I91A 5JVH3 2R7FA 3A55A 5E4WC 4ZRZA 4Y7NH 4LFCL 3DHQA 1KLUD 3U58A 1S4ZA 2EDGA 4B3TQ 4Y7NB 2K5DA 5IP7H 4K14A 2GN5A 4DAYB 4MIUA 1II3A 3F2BA 2K01A 3HOXH 4UP7A 1EYGA 2D2CC 2FINB 2A6HC 3TEHB 2H4OA 2PNRC 3BVZA 1OO9B 5JEAJ 3OPOA 4X62Q 1SNOA 5M3FH 3H3VH 1TWAH 2F0HA 2N88A 4GN3B 5ELNA 1TWAB 2B8GA 2RF4A 1PZID 3HS0C 1J9OA 3F2DA 4A3CG 1OXTA 3F1ZA 3S15B 4DR7L 4B3SQ 1JORA 2E75C 5BR8Q 1XPOA 5K36G 4I65A 1BCPB 2K28A 4FVMA 3U50C 4UP9A 3SHLA 4JW0A 2ZXPA 1RD9D 2RKSA 2XWJB 3NQTA 4ILWA 2NTSA 1HQMC 4JG2A 3CCSA 4DXGA 5I9OA 1YNND 4JI7Q 1K83H 1QE6A 1CQFA 5IGDA 2B2VA 2B63H 1OXVA 4GNXA 5GADC 2UUCL 4A3IH 1PYBA 3F8TA 3HOUH 1TT2A 2NZHA 1IZ6A 3NE5B 4O2DA 2IW3A 3E3XA 1IXRA 1IYUA 3S14B 3HOUB 1MKHA 4I7AA 4IUVA 5IWAQ 5T1IA 1CZWA 2F0JA 1Q1BA 4C3IH 1O7YA 2WB1B 4LW1A 1XNRQ 4QIWE 4DUYQ 5IYDH 4CDEC 1EZ6A 4CJ1B 1HNWL 1QB5D 1TQOA 1CKNA 5C3EH 1G2SA 1PTOD 1VMPA 1D8LA 5C4HA 1EFID 5BR8L 3L2PA 2NN6H 4RGNA 4LJZC 3M4QA 2RHQB 5M5YB 1K28A 4EQPA 1U4PA 4IFDI 2B2TC 4DR6Q 3NHHA 3V96A 3OW2A 5C4XG 2B29A 3B6YA 2IWHA 2EY6A 2EJGC 3NTHA 3CCMA 4JI0Q 2A6ED 3J80i 2KENA 3MXNA 4FXDA 1JWSD 3S16H 1BDOA 1LACA 1TXYA 1XNQQ 1I4PA 3R8BA 3D0FA 4CDCC 4XXEA 5IWAL 1G2TA 1IBML 1G6PA 1LTSD 4E6IA 1ZXTA 2CHBD 1XNRL 1Q7YC 2L9HA 3FPUB 4DUYL 1G6ZA 3QOJA 1O80A 3D31A 1YHAA 1AZQA 1V1PA 1K9MC 4IPDA 4KY5A 2R7ZG 2A69C 4KJNA 3M3YB 2I46A 3GP7A 1XMOQ 1QCBD 1L1OC 2WKCA 5KYIA 2MO1A 2DY7A 1PTOF 3DXJC 3M7NA 4JOIA 2JA8H 2RDFA 1HH2P 5I9PA 4DUZQ 3J80L 4KKUA 1C4QA 1C48A 2VB2X 5EGTA 4UY8C 1QNKA 4HSPA 3FKIH 4BY7H 4DV3L 1ZEQX 1BF4A 4IUUA 1QVGA 3FKIB 4PMWA 1XNQL 1B3QA 3S17H 1NR2A 3CD6A 3NQIA 2XRSD 4B3MQ 1YJWA 4JV5Q 1E1TA 2B2TA 2G5DA 4V190 1YBYA 3QO2A 4TKOB 1TWCH 1MD2D 1SRUA 2IT1A 1K0RA 4EQ5A 4NP5A 4A3GG 1HR0Q 2QEXA 1TWCB 1F2ZA 1GUOA 4A3MG 1WTPA 4DR5L 1TS4A 4LFAQ 2JA6G 4OL7A 1I6HH 3KLWA 3UDXA 3S1QH 4BXXH 4JI2L 3NXWA 5GROA 1WTXA 3ITPA 5JEAH 4DV4L 3S1QB 4PMCA 3KF8B 2VZAA 2HDMA 2PI2E 2XTIA 3I4NG 3K7UC 1E7ZA 2ZJRA 3S2HH 4B3ML 3TMEA 4IALA 1EIHA 5FLMG 3SGIA 3S2HB 1L1OA 1UAPA 2QCPX 4A3FB 1DOLA 1I4RA 3NENA 1KTKA 3WDNA 4A3DB 5IT9c 1S5FD 2R93G 3MHBA 3RZDB 4LFAL 5AJ3Q 1XTDA 4BBRH 2AQ2B 4GKJQ 1PFSA 1TR5A 3P20A 4FYDA 3F2UA 4BBRB 1PTOB 2KJXA 1X3EA 2CKZB 5J39A 5D65A 1I3QH 3GTJB 1YZ6A 4QUFA 2A68D 3PUVA 4X3KA 2K5QA 2RBMA 1VQ4A 5EPLA 1N8RC 2B2WC 4LF7Q 1AEXA 2PQEA 3QJYA 1L2FA 1LTLA 2ES2A 1B53A 5C44H 4HJ9A 3GTMB 2YTXA 1H9SB 2KECA 2I5MX 3C1EA 2F52A 1S3OA 1AP0A 1XTCD 3DM1A 2A73B 1CQVA 1YHBA 1PLFA 5CV9A 1F9QA 4ZLTF 1S5CD 3EROA 2KVMA 4RAUC 1Z6HA 1WCMH 2F0OA 1CUKA 5AJ3L 2J7ZA 5M3MG 2EY1A 4GKJL 3X3NA 1HPCA 1XWEA 3OIQA 1EU4A 1VCIA 3W5OA 1VQOA 3CPWA 4DR4Q 4IQZA 2DY8A 3FPPA 3EBEA 1UEAB 1V9PA 4RGMA 4ME5A 3J7YW 2EIFA 3J7AV 1B2TA 1I5FA 2I5HA 1HTLD 4WFN3 4C3JG 1N9WA 3KFUA 1EWIA 1EIYB 4LF7L 1I6VC 1D6EC 3C3LA 2CW0C 3VDYA 3NBIA 1S72A 3H0GH 1NNXA 2JE6I 3OW7A 1Y8PB 4LNQA 2AUJD 3H0GB 4PQXA 4WJ4A 3VR3A 2E74C 4DR3Q 3A7LA 2CQOA 3ERQA 4PNYA 2D0OA 3DEOA 5IP7G 3TN2A 2NVXB 2RVLA 2WINB 2FMMA 2L12A 3HOXG 4DV1L 1I50H 1GVPA 3HP3A 1FD7D 2ZJQA 2EZVA 3K5OA 4JI8Q 5JPMC 2PI2A 4S3SA 5EKKA 4NDXA 2ZXOA 1M90C 3DLLA 5EPJA 3D3RA 3I2ZA 1Y8NB 4JCVE 4QB4A 2XRQD 3D6WA 1XX8A 1PHJA 5HY6A 2PZWA 5GAHC 1X65A 3QOLA 2PZTA 3TP7A 4YWKA 3K8AA 4R4OA 2PNHA 4IN3A 3KF6B 1HQRD 4I7ZC 3UDIA 3TP8A 2VQFQ 1LTAD 2WIIB 4EQNA 1EL0A 3T1YQ 3MAQA 1FYCA 1EIFA 5EPKA 1GKHA 3LGJA 4QCLA 3J81i 1AH9A 4MTKA 1HRJA 1B3AA 5EBCA 1STHA 3GO5A 4H7BA 1Q86C 2B63G 4BBSH 4LFBQ 1CK1A 4XQQA 5JJLA 3HOUG 4RKBA 2B2YC 2R7ZB 3K80C 4LF4Q 4C3IG 4JVZA 2PCFB 1X3QA 5D3DA 3A5ZB 3PIPA 1STYA 3CHBD 1EQTA 5CR3A 1VF7A 3M4YA 2NN6G 2BDOA 3J81L 4YHHQ 2VQFL 5CV5A 2VNUD 1B9NA 4KKTA 4DAVA 3T56B 4FF4A 1ZYRD 1ENCA 3MZ5A 2CVRA 3WOEA 5LMNQ 2E2HH 3SK8A 4ODGA 4QGUA 3PUXA 1E24A 1IBKL 2JEAI 1JWUD 3ND8A 3UE0A 2E8GA 2ICIA 4CBVA 1LT6D 4JI5L 1RCVD 1SEBD 4A3MB 1RDPD 1SMXA 4GLVB 4KV6A 1E0BA 2OQKA 1CKNB 4LF8Q 5AFWA 4JI6L 4LK1C 2UXCQ 5CV4A 2OTLA 1EIGA 4JYAL 1QVCA 1UE6A 4FO2A 1XMQQ 1VQCA 4KHPQ 3K5LA 3KDFB 4A3BH 1JJCB 3ZYYX 3CMEA 2IHEA 1JMCA 3OWFA 1Y1VB 5CV7A 5JJKA 3FHWA 5J1ZA 5LMUQ 2J4XA 5IIFA 1NR4A 2SNMA 3MWYW 2WP8J 2F3WA 5M9OA 3FKIG 3MXNB 3H15A 2E5LQ 2ZM6Q 1N36Q 4IOAA 1A62A 1ILQA 3VYTA 2BOSA 4XYQA 4FP5D 1H9KA 1MGSA 3KYHC 4P74A 5M5WB 3TS2A 2EXZA 3W1BA 1TWGB 4J8QA 3PUZA 2NVQH 1E3PA 1V1PB 4JC0A 5F2DA 1AE2A 1IL2A 1EUJA 1PH7A 2IX1A 2NUCA 4KHZA 3HKZE 2PMZE 5BN4A 4XQNA 5EQ0A 3D8GA 1CA6A 4WRDA 4A3KH 3BYYB 2SDFA 1FR3A 5M5XB 4C3HB 1QZHA 1QNUA 4BXXG 4PZ7A 4X65L 1WD1A 1TWFB 2NVTH 3BU2A 2R61A 4RG1A 3DUZA 3BVGA 5JEAG 1PH2A 1YNXA 3CCEA 2IPKD 3QR8A 4R9WA 3HOZH 4A76A 2NVTB 1BCPF 3OSOA 4N9TA 4H44C 1DCZA 2ZM6L 2VXWA 2F0WA 3O13A 3Q22A 1WTQA 1VQLA 3HOZB 5E3FA 5I2XA 3AQQA 1S5BD 3I70A 3BZCA 3VR5A 1K3RA 3QWNA 4B9WA 1STEA 1FGUA 2NVYH 3A56A 3MEHA 4JI4L 1JWMD 2A1AA 1VQEA 2L5TA 2NVYB 3VYRA 3BDCA 4QJFA 3STBD 3P1HA 3I4MH 3CQZH 3AFPA 4LMQD 2K5VA 3J81E 3CQZB 2PQAB 3A74A 3J80c 2WFWA 4O0AA 4DNRB 5CC4A 4BBRG 2JYOA 3KJOA 1CKOA 5FKAC 2L4NA 2K1BA 3OMGA 3UE1A 2KEDA 1EQRA 4GOPA 2JP1A 4QF4A 3TS0A 2JA9A 1SNDA 3T1HL 1J5EL 2EYHA 2UXDQ 3C46A 5ELBA 5NUCA 3S24A 3K59A 1OTCA 5IY0A 3R2IA 4R1JA 1MIUA 4QIWB 1JICA 2NZOA 4GKKQ 4UP8A 2HD3A 5C44G 1VQIA 1B70B 3UDFA 1PA6A 2MO0A 3H3VI 4CKEA 1CHPD 1LT4D 4IUNA 3HOXB 4QQBX 1D1IA 3PIOA 3MFGA 3VYSA 4OO1H 4NXNQ 2LFNA 1JB7A 3PIP3 2L11A 1JB3A 1WCMG 3LNNA 3JAMi 5M3FB 3FVQA 4HMIA 1I4XA 1RHPA 4K8IA 1DYQA 4IO9A 1X3PA 4KLKA 2F0DA 1HZ9A 2XNAC 3EJIA 4RHSA 3L7ZC 1QUQA 3NEMA 2HDLA 1CM9A 4CKBA 3UI2A 3IFTA 1S5DD 3AB9A 1JCKB 4KY6A 1PH8A 4B3TL 1H9JA 2F0MA 1F9PA 3MXGA 1M1KC 1IBLQ 2Z6KC 3A5UA 3H0GG 2JA5H 1HR0W 5KNDA 1FNUA 1T9HA 1OXXK 3TZDA 4KI0A 3EN2A 4AIMA 5IGEA 3I56A 3NTKA 4ID6A 1LUZA 3NBHB 1K83B 1K3BC 1D1KA 3JAML 1VQDA 2B63B 5E7NA 2H5XA 4NXNL 1X54A 4X62L 3C2PA 1PRTC 4IUQA 4A3IB 1IW7D 2ICEC 3BZKA 3U4ZA 4DU9A 4RGOS 4CGYB 1G8ZD 3EIVA 4APVA 2KQ3A 5ISRA 2NN6I 5IP9H 1SE3A 3SXHA 1EYCA 4YCUA 4C3IB 1V1OA 2K5WA 2RCFA 2Z9HA 2AQ3B 2X69A 2MJ8A 4B3SL 3ULPA 5C3EB 2A5HA 1H9MA 3FDTA 1A15A 1NY4A 1ML0D 1OXUA 3SVMA 3CCLA 2ZT9C 2HHHQ 1IHZA 5HGQA 3OMCA 1DJRD 4MTNA 5D14A 3PO3H 1Q1EA 4C1NK 1B4OA 4P72A 2AHOB 3PO3B 4JI7L 3VR6A 3DMUA 1T5EA 4POGA 2HT1A 4H0LC 4X66Q 1RF2D 4HTHA 1LTBD 2R92H 2QF7A 1NE3A 2PW7A 1STBA 1B50A 3BS1A 3S16B 4KTAA 1SJHD 3A7AB 5IE8A 1NSNS 3A0JA 1QOHA 1NMGA 4L63B 4G7HC 3JC66 2KHJA 4BBSG 1D7QA 2IX0A 1VQ5A 1JOKA 1PVOA 3PUYA 3IRBA 2VUMH 2D62A 3I73A 3TSSA 4LUZA 1KAAA 3CP0A 2AQ1B 2A74C 2Z4IA 2ZTEA 3NWTA 3RN5A 3G48A 4JI1Q 2YYZA 4C2MH 1N32Q 4ZAIA 4DR6L 4J15A 2K52A 2HUGA 2JA8B 3CCUA 1CFMA 1WI5A 2A8VA 1CKMA 5C0XH 2RDHA 1PV4A 4LF6Q 4JI0L 2MQHA 5ELEA 1TU2B 4YWLA 4BY7B 2F0GA 3PCOB 4KN7C 2IJ0A 3K57A 4K0KQ 3H94A 4YY3Q 3HOYH 3S17B 2ZJPA 3S1MH 3I72A 4CKCA 1EFWA 4OHJA 2MHVA 4FXGC 3NSWA 2UXBQ 1ET9A 1J8IA 2OWOA 3CRLC 1DM0B 2BE5D 1F77A 3TQYA 1TS2A 3HOVH 2JA7H 2NYZD 1PFNA 1LTID 1F9SA 1ASZA 3GQBA 1XMOL 3HOVB 2RQXA 1Q82C 1R4QB 3T4AC 5KNCA 3AYHB 5JAVA 1RTOA 4HIDA 4JI1L 2ASBA 3GTQH 1A8VA 3RLFA 1PH6A 4DUZL 1E2WA 1I6HB 2EXDA 2EYFA 4ALPA 1WTOA 3FRPB 4K2KA 2E2JH 2RCNA 4DV7Q 4J6HA 4F88A 1BCPC 1MBYA 1MSGA 3TZUA 4F87A 2LY7A 4DKAC 4KD3A 1T5XD 4DK0A 2EVBA 3H09A 5ELDA 3JAME 3UDGA 4A3JH 4A3BG 4DV2Q 1WVLA 1Y1VG 4JV5L 2EYLA 1SMYC 1VQ9A 5BN3A 1YIJA 2KEEA 3HOWH 1A6XA 2EJMA 2Y0SE 2TSSA 3M4OH 2F0QA 2R3ZA 1HR0L 1U4RA 4QUCA 1STGA 4A3LH 2EYJA 2VY3A 4ABNA 2ID0A 3L3OC 2QEJC 2BH8A 3WWVA 3GTOH 4M1UB 5DEHA 3KOJA 1Z7TA 5JOBA 5C3WA 2IY5B 5IYCG 3I8ZA 1Y1WH 1N33Q 3KBXA 2KBNA 1I3QB 3RUZA 4OWWB 2HCIA 1U4LA 4DK6C 1GUWA 4C3HG 2CH4A 2DNCA 2K04A 4A3KG 2F0NA 2Z6BA 5C4JH 2V4DA 1VQJA 2CWPA 2X6GA 5KEEA 5FLXc 1HA5A 4BS9A 2VW9A 3I3CA 3PF4A 2OXPA 3BVMA 2OT2A 3HOZG 1LT3D 2TMPA 4OWTB 5C44B 3HEJA 2K50A 1MI2A 2QILA 3GTKH 3L9AX 2SNSA 1N34Q 3PO2H 2UU9Q 1E1OA 1VQBA 5D3IB 4CJ0B 3S1RH 5LHY1 2DGYA 2MPMA 2FMCA 1EY9A 2O2LD 1GJXA 2EYMA 3GTPH 1WFQA 3H91A 3TDQA 4DR1Q 1TVXA 1WCMB 2B2UC 1U0LA 5KNBA 3GTPB 1D2BA 2OCEA 1N33L 1Q81C 3I4MG 1VMCA 1B44D 4LAAA 5DAUA 4XYOA 2A6HD 4GN5A 4OONA 1ENFA 1UE1A 4DNIA 1BO0A 3E9HA 2PW5A 5LMNW 4BY1H 1M4VA 5LL6X 1FGBD 1C8CA 4BY1B 1FNWA 1AW7A 4AH6A 1QILA 3V05A 2K7VA 5K36H 4X3UA 2F0SA 2F0VA 2E76C 4AQYQ 2UU9L 1Z9FA 1SR3A 4QL5A 2EY2A 1BOSA 1JOOA 1ET6A 1G51A 1STAA 2PO4A 3W3AA 5A2QE 2KUMA 4DR4L 5EBDA 2B2WA 1HTPA 1GUGA 5CGKA 3FP9A 3MXUA 2HQLA 4ZK9B 4DPGA 5DM63 1I50B 4G57A 3N6RA 1SFOH 2NTTA 4OO1G 1I94Q 4R4IA 2HIVA 5M3FG 2H1EA 3NUCA 4G7ZC 2YU9H 5DM73 1STNA 2XN9C 4OX9Q 1O7IA 3WOFA 1LLRD 2YU9B 4R8IA 2BCOA 4IUPA 4C1NI 1RL2A 4GOPB 2F1MA 2R6GA 1JJ2A 4UHVA 4DR3L 2OQ0A 4ZQ3A 1B8AA 1ESFA 1CSQA 1SAPA 4FF1A 2K33A 3IKJA 3TP6A 1YNNC 1PMRA 4KN4C 1A2TA 2CFMA 4K6LA 4FXKC 2JA5G 4DK1A 5FO8B 5C4XH 2QGQA 2CH4W 1SROA 4PMBA 3L0OA 4JI8L 3KLSX 4A3IG 4XT1B 1B7YB 3IL8A 4BBSB 5IOCA 2BA1A 4HJ7A 1UE5A 4OWXB 2N49A 3SK6A 1MSHA 2JQOA 1MJCA 2D0PA 3CF5A 3S2DH 1D5ZC 1E22A 1YHQA 1PTOC 4IPHA 5IYDG 1O7ZA 1VQ6A 3S2DB 3M7GA 4LUOA 3E0EA 2I0QA 1ONLA 1QUQB 5C3EG 1VDZA 2CQAA 3CMAA 4MNOA 1ZKOA 3CC4A 1SYGA 1XPUA 4EX5A 3T1YL 2F3IA 5A35A 4YCVA 3I7FA 3BYTB 3CC7A 2K5NA 4OXPA 4IOCA 2A69D 1SE8A 5C5MA 3PO3G 4A93H 1FL0A 1VQ7A 2D9UA 3K6OA 5IT9L 2A6EC 2F4VQ 3R93A 4A93B 1GXDC 5T1GA 1A3UA 3K5NA 1Q3LA 1EU3A 4DNTB 4GNXB 4LFBL 3TP5A 5HURA 3HKZB 3PMFA 2PMZB 2YV5A 4OEMB 2R92G 2E2HB 3MC0B 1OXSC 4EVOA 1Y69U 1WTVA 2UUBQ 3HFZB 4DV5Q 4LF4L 5CBAE 1L0YB 3PGZA 1RIPA 2ATWA 3H6MA 4WORA 4L5TA 2F4IA 2LMCB 2DN8A 2Z4HA 4HIOA 3S1NH 4KY7A 1KQSA 3S1NB 4RCNA 1Q8KA 4YHHL 4NMZA 2XSCA 2AKWB 5C5LA 2VUMG 2Z0SA 5C4ZA 4HR7B 4A4IA 2A19A 4DV0Q 3IFDA 4RGTA 2B2YA 4X64Q 2JA8G 1SNMA 1R9TH 4A3BB 4LUVA 1V1QA 1EOTA 3MA2B 2Y0SG 2F4VL 3SEBA 1SNQA 1GOZA 1CTMA 4K8JA 5LMNL 1IYJB 5C0XG 2NZ1D 2IL8A 4BY7G 1AE3A 1SDFA 1KD1C 5FO9B 1JE5A 3HKSA 3MFYA 1EQQA 5LL6S 3QB3A 1A63A 3Q24A 4GZYC 1AN8A 1KRSA 2OEOA 3HOYG 2L55A 4JPBW 3AMUA 3RZOH 4O42A 5CV6A 5ELOA 1I4HA 4ME3A 2RDGA 4L5SA 1TWHH 2D5DA 4UAIA 1VQHA 4LF8L 1CA5A 2NVQB 2WACA 2UXCL 1UE7A 3HOVG 2JA7G 1XMQL 5EAYA 3U9SA 1YEZA 4KHPL 3LWEA 3NELA 1DD2A 2O4XA 4B3RQ 4KHVA 2RHSB 3W1GA 1VQMA 1BUVT 4A3KB 1KLGD 1WOCA 2K75A 2CCZA 1EY0A 5LMUL 4HCEA 2DJFC 3S9WA 3D4WA 2F03A 3CRKC 4PV1C 3BDOA 1HNXQ 2E5LL 1N36L 3OTOQ 2C35B 4IFDJ 4A3JG 1LV9A 1B1ZA 4JBWA 3T53B 4DV6Q 3DWPA 3OOCA 2KHIA 5KIXA 2F0UA 4XIGS 1U4MA 3RD4A 2LXKA 3AU7A 3CKIB 3K58A 1YJNA 3GDEA 2E2IH 4HAEA 2N8NA 1AFPA 1ICWA 2G9HD 2GVBA 1P16A 3VA5A 4LFCQ 3I4MB 2HCCA 3LWUA 2IX3A 4GLAC 1BXTA 4A3LG 4NKLA 1WTHA 5EJWA 2K5HA 1SSOA 1SYEA 1X56A 2KA7A 5M3MH 2RA4A 2A68C 3EFXD 1KNEA 1KHIA 3URYA 5CMDA 5IT9E 2YTVA 3PV0A 1Y1WG 1CSPA 1C7YA 2Q2TA 3A54A 1P8LA 4ZCKA 1NJIC 1O7LA 4HN7A 1BKBA 1YITA 1GUNA 4C3JH 3R2TA 4HSVA 1L1OB 2F0TA 1EQVA 3PSIA 4HJ5A 4OO1I 1UEBA 2B2VC 4H02A 1WYDA 1J6QA 3ZJYC 4GNXC 2NWGA 5G3LD 2CW0D 5COYA 4IJHA 3KF6A 1EEFD
chains in the Genus database with same CATH topology
4J1MA 5FLXE 2FJ2A 1HCZA 4B9XA 4AYBB 4K5VA 5KGUA 1EYAA 4K6DA 1Q90A 3R3OA 1RODA 1BNZA 1DONA 1HUNA 1PZKD 1Y8OB 3DWQA 3OIPA 1B9MA 4DF7A 1LABA 3D4RA 1EY7A 3V2TA 4YIJA 1K8MA 1IL8A 3VA7A 3G7LA 1WTRA 1TKWB 2C9OA 3GV6A 2JA5B 2C5CA 3C1FA 4RFBA 3MXPA 3TBIB 4X3SA 4DXFA 2Q8TA 1JC7A 4ZUJA 2SEBD 5G3LF 2M9VA 4XT3B 4MN3A 4F7XA 3VYUA 5I4DA 1JR0D 1SXTA 5JPNC 1HHVA 4EGVA 1HA6A 1U9RA 3K5MA 3E6ZX 3DEPA 4EQOA 4QMGA 4KMUC 1GUSA 1UUPA 2BA0A 4ZKBB 3A8IE 3P7JA 3QIAA 1BBXC 1WTWA 3MVVA 1KDBA 1SBBB 5JJZA 1SNCA 1EWCA 3NP8A 1TY2A 2FHTA 2MP1A 2R92B 5JVG3 2F0EA 3HRZC 3M85A 3GD7A 1EEID 2HQEA 4IFDH 4M8AA 3Q6SA 1O78A 4U68A 4K5XA 4IURA 4U673 5I2YA 1TS3A 3X3MA 1CHQD 5FOBB 5C0XI 2VUMB 4WJWA 2Z8LA 1XXGA 1IKMA 2F0PA 4C2MB 1NAPA 3MTSA 2Y0SB 2AWNA 3FEWX 3LX0A 4FF3A 1IKLA 1ZYRC 1QJOA 4TRDA 1HFNA 2WAQB 4KK7A 3QG1A 1F2LA 1SYCA 3HOYB 1HXYD 1E2ZA 3S1MB 1W6JA 3HZXA 1V8QA 4KD4A 5I6YA 4MHEA 2ZXRA 3J7AF 3D6CA 2KCCA 3H3VC 2JA7B 5A2QL 5IGGA 1GHJA 1EWHA 4JK1C 5E4XA 3GTQB 1H9RA 3Q0AA 4ZUIA 2E2JB 4OIJA 1BQQT 1YNJD 2NBFA 1JQYD 1EY8A 1PYWD 2L0CA 3PIO3 4A3JB 3GTGB 1TIID 2AWOA 1RJTA 2PZUA 4A3EB 3HOWB 2NB0A 3M4OB 1LT5D 5IODA 4BWGB 5CV8A 4DAYA 3ND9A 4DAPA 3RMHA 1VF5C 3T16A 4L6TB 3GTOB 2MUYA 4BA1I 4RA8A 4O1NA 2XVSA 1Y1WB 4K2LA 1SE2A 1EY4A 4IUTA 2Q8IB 1EY6A 4BA2I 1PTOH 2K32A 5C4JB 5KRUA 5EKLA 4RH6A 1PFMA 5I6WA 2ENBA 3GTLB 4XDXA 2F0KA 2Z1CA 4ZKCB 3E0JA 3K0YA 2EPBA 3GTKB 1LTGD 1SE4A 3PO2B 3BDLA 1WD0A 4X3TA 3S1RB 3T51B 3IAYA 2JXMB 1RTNA 1A3VA 1G291 4N9PA 3U9OA 1KABA 2XWBB 3NBHA 3EA6A 3NK9A 3NTIA 1BR9A 4C56C 4TQUS 1A2UA 4RHRA 2AUKA 3KLSA 3J80E 1TY0A 3N52A 1A3TA 1DOKA 3KUPA 1CI3M 2LS01 2J0TD 2K6AA 2X6LA 1NUCA 2E2DC 2M00A 3HG9A 4TSSA 2I07B 3VR4A 1LTTD 3I4LA 1TS5A 4IZ8A 1KDAA 1SFOB 5IGFA 4Q5VA 2VB3X 4G7OC 1GHKA 5C6AA 1PDQA 4HCSA 1PRTD 3OWEB 5FO7B 2B2UA 2L1BA 4H13C 3SK5A 4DA2A 5CORA 1SJED 1D5XC 4K5WA 5C3XA 2BDNA 1HFGA 1ENAA 3SDZA 1KDCA 2N55A 3CU7A 1NCVA 5C4XB 5ELCA 1IW7C 3T13A 3OHXC 4RKLA 3DWAA 1F2YA 2QKIC 2F3VA 2MGSA 1EY5A 1SYBA 4DFAA 4FF2A 1R4PB 1CT1D 4HMJA 1PXUA 4KJOA 2WV6D 2EYPA 2Q8RE 3Q24A 3KBGA 5BN5A 2RSOA 1D5MC 1RKNA 1E2VA 2G9DA 4XTCS 1PRTF 5KYLA 2EJFC 4OIKA 1XYIA 1W6KA 3EVQA 1PFBA 1DZ1A 3D4DA 1SYDA 3KF8A 1IYVA 2KCNA 5E1FA 1K8OA 1JE4A 2EYOA 3GV3A 5ELFA 5CBEE 2O5IC 1PZJD 4Z9CB 3PUWA 3BG3A 3KLRA 3E5SA 4IFDG 2QDBA 4OGQC 2GA4B 2B39A 5FLXL 1ILPA 3FMCA 2WKDA 1G91A 4RCOA 1FNVA 5IGCA 4A3GB 1SYFA 3HGBA 1S5ED 2EY5A 1AZPA 4FNFA 4NW2A 2PYKA 2JA6B 1DOMA 1JOQA 1R9TB 3SR1A 4R8NA 4ULLA 1UNSA 2EOTA 2OF1A 4HEDA 4CJ2C 2F0IA 3I4NB 4G4KA 4L8JA 1BCPD 3SK4A 1Q8IA 2BE5C 3NPPA 3BZDB 5K5PA 3RZOB 4V0BA 2PPBC 1EYDA 1SMYD 2JEBI 2JSOA 1H9SA 4P2CB 1F2MA 5EKIA 3A8JE 1DXMA 2KOLA 4CHTB 1TWHB 2DNEA 1GUTA 1QG7A 3EQLC 4Q0FA 1PRTB 2F0LA 2R93B 4F8MA 5DNFA 1F9RA 1YNJC 1I4GA 4XQJA 2K03A 1EZ8A 1M8AA 2EE1A 3VR2A 2B8FA 2M2LA 5TSSA 3KK7A 1HUMA 1QWYA 5FK9C 1LO5D 5CYUA 1SNPA 5IGBA 4ZYSA 2E2IB 2K05A 2F0FA 3ONAB 5HGTA 5J22A 3P75A 3SE0A 4UDUC 5M3MB 1I4QA 3G6JB 2O5JC 3A8KE 1Z47A 4B08A 1CZGA 4RWSC 1ESRA 1X32A 2SOBA 2FFKB 2XIWA 1LTRD 4DN4M 3I90A 1Q12A 3Q23A 5C0XJ 4KKSA 2RSNA 1KNAA 4C3JB 3NWSA 1L0XB 3W2DA 3K7AB 2LKVA 4DGZA 2KHSA 1V43A 3I91A 5JVH3 3A55A 5E4WC 4ZRZA 3DHQA 1KLUD 1S4ZA 2EDGA 4Y7NB 2K5DA 4K14A 4MIUA 1II3A 2K01A 2D2CC 2FINB 2A6HC 2H4OA 2PNRC 3BVZA 1OO9B 5JEAJ 3OPOA 1SNOA 2F0HA 2N88A 1TWAB 2B8GA 1PZID 3HS0C 1J9OA 1OXTA 3S15B 1JORA 2E75C 5K36G 4I65A 1BCPB 2K28A 4FVMA 3SHLA 2ZXPA 1RD9D 2RKSA 2XWJB 3NQTA 4ILWA 2NTSA 1HQMC 4DXGA 5I9OA 1YNND 1QE6A 1CQFA 5IGDA 2B2VA 1OXVA 1TT2A 3NE5B 2IW3A 1IYUA 3S14B 3HOUB 4IUVA 5T1IA 1CZWA 2F0JA 1Q1BA 1O7YA 2WB1B 1EZ6A 4CJ1B 1QB5D 1TQOA 1G2SA 1PTOD 1VMPA 5C4HA 1EFID 2NN6H 4RGNA 4LJZC 5M5YB 4EQPA 1U4PA 4IFDI 2B2TC 3NHHA 3V96A 2IWHA 2EY6A 2EJGC 3NTHA 2A6ED 3MXNA 4FXDA 1JWSD 1BDOA 1LACA 1I4PA 3R8BA 4XXEA 1G2TA 1LTSD 4E6IA 1ZXTA 2CHBD 1G6ZA 2L9HA 3FPUB 3QOJA 1O80A 3D31A 1AZQA 1V1PA 4KY5A 2A69C 4KJNA 3M3YB 2I46A 3GP7A 1QCBD 2WKCA 5KYIA 2DY7A 1PTOF 3DXJC 3M7NA 2RDFA 5I9PA 3J80L 4KKUA 1C4QA 1C48A 2VB2X 5EGTA 1QNKA 4HSPA 1ZEQX 1BF4A 4IUUA 3FKIB 4PMWA 1NR2A 3NQIA 2XRSD 2B2TA 4V190 3QO2A 4TKOB 1MD2D 2IT1A 4NP5A 1TWCB 1F2ZA 1GUOA 1WTPA 1TS4A 4OL7A 3NXWA 1WTXA 3ITPA 5JEAH 3S1QB 4PMCA 2HDMA 3TMEA 4IALA 1EIHA 3S2HB 1UAPA 2QCPX 4A3FB 1DOLA 1I4RA 1KTKA 3WDNA 4A3DB 1S5FD 3MHBA 3RZDB 2AQ2B 1TR5A 3P20A 4FYDA 3F2UA 4BBRB 1PTOB 2KJXA 5J39A 5D65A 3GTJB 4QUFA 2A68D 3PUVA 4X3KA 2K5QA 2RBMA 5EPLA 2B2WC 1AEXA 2PQEA 3QJYA 1B53A 3GTMB 1H9SB 2KECA 3C1EA 1AP0A 1XTCD 3DM1A 2A73B 1CQVA 1PLFA 5CV9A 1F9QA 4ZLTF 1S5CD 3EROA 2KVMA 4RAUC 1Z6HA 2F0OA 2J7ZA 2EY1A 3X3NA 1HPCA 1XWEA 3OIQA 1EU4A 1VCIA 4IQZA 2DY8A 3FPPA 1UEAB 4RGMA 4ME5A 3J7YW 3J7AV 1B2TA 1HTLD 4WFN3 4C3JG 1I6VC 1D6EC 3C3LA 2CW0C 3NBIA 2JE6I 3OW7A 1Y8PB 2AUJD 3H0GB 4PQXA 3VR3A 2E74C 3A7LA 3ERQA 4PNYA 3DEOA 3TN2A 2NVXB 2RVLA 2WINB 2FMMA 2L12A 3HP3A 1FD7D 2EZVA 3K5OA 5JPMC 4S3SA 5EKKA 4NDXA 2ZXOA 5EPJA 3D3RA 1Y8NB 4QB4A 2XRQD 3D6WA 1XX8A 2PZWA 3QOLA 2PZTA 3TP7A 4IN3A 1HQRD 4I7ZC 3TP8A 1LTAD 2WIIB 4EQNA 1EL0A 3MAQA 1FYCA 5EPKA 4QCLA 1HRJA 1B3AA 5EBCA 1STHA 3GO5A 4H7BA 1CK1A 4XQQA 4RKBA 2B2YC 2R7ZB 4C3IG 2PCFB 1X3QA 5D3DA 1STYA 3CHBD 1EQTA 5CR3A 1VF7A 3M4YA 2NN6G 2BDOA 3J81L 5CV5A 2VNUD 1B9NA 4KKTA 4DAVA 3T56B 4FF4A 1ZYRD 1ENCA 3MZ5A 2CVRA 3WOEA 3SK8A 4ODGA 3PUXA 2JEAI 1JWUD 3ND8A 2ICIA 4CBVA 1LT6D 1RCVD 1SEBD 4A3MB 1RDPD 4KV6A 1E0BA 5AFWA 4LK1C 5CV4A 1EIGA 4FO2A 3K5LA 3ZYYX 3OWFA 5CV7A 1Y1VB 5J1ZA 2J4XA 5IIFA 1NR4A 2SNMA 3MWYW 2WP8J 2F3WA 5M9OA 1ILQA 3VYTA 2BOSA 4XYQA 4FP5D 1H9KA 1MGSA 5M5WB 2EXZA 1TWGB 4J8QA 3PUZA 5F2DA 1V1PB 2IX1A 2NUCA 4KHZA 5BN4A 4XQNA 5EQ0A 3D8GA 1CA6A 3BYYB 2SDFA 1FR3A 5M5XB 4C3HB 1QNUA 1WD1A 1TWFB 5JEAG 2R61A 3DUZA 3BVGA 2IPKD 4R9WA 2NVTB 1BCPF 3OSOA 4N9TA 4H44C 1DCZA 2VXWA 2F0WA 3O13A 3Q22A 1WTQA 3HOZB 5E3FA 5I2XA 1S5BD 3I70A 3VR5A 3QWNA 4B9WA 1STEA 3A56A 3MEHA 1JWMD 2L5TA 2NVYB 3VYRA 3BDCA 3P1HA 4LMQD 3J81E 3CQZB 4DNRB 5CC4A 2JYOA 5FKAC 2L4NA 2K1BA 3OMGA 2KEDA 2JP1A 4QF4A 1SNDA 2EYHA 3C46A 5ELBA 5NUCA 3K59A 3R2IA 4QIWB 1JICA 4CKEA 1CHPD 1LT4D 4IUNA 3HOXB 1D1IA 3MFGA 3VYSA 4OO1H 2LFNA 3PIP3 2L11A 1JB3A 3LNNA 5M3FB 3FVQA 4HMIA 1I4XA 1RHPA 4K8IA 1DYQA 1X3PA 2F0DA 2XNAC 3EJIA 4RHSA 3L7ZC 2HDLA 1CM9A 4CKBA 3UI2A 3IFTA 1S5DD 3AB9A 1JCKB 4KY6A 1H9JA 2F0MA 1F9PA 3MXGA 5KNDA 1FNUA 1OXXK 3TZDA 4KI0A 5IGEA 3NTKA 4ID6A 1K83B 1D1KA 3JAML 2B63B 3C2PA 1PRTC 4IUQA 4A3IB 1IW7D 2ICEC 4DU9A 4RGOS 4CGYB 1G8ZD 2KQ3A 5ISRA 2NN6I 1SE3A 3SXHA 1EYCA 4C3IB 1V1OA 2K5WA 2AQ3B 2X69A 2MJ8A 5C3EB 2A5HA 1H9MA 3FDTA 1A15A 1ML0D 1OXUA 3SVMA 2ZT9C 1IHZA 3OMCA 1DJRD 5D14A 1Q1EA 4C1NK 1B4OA 3PO3B 3VR6A 3DMUA 1T5EA 4H0LC 1RF2D 4HTHA 1LTBD 2QF7A 2PW7A 1STBA 1B50A 3BS1A 3S16B 4KTAA 1SJHD 3A7AB 1NSNS 1QOHA 4L63B 4G7HC 2IX0A 1JOKA 3PUYA 2D62A 3I73A 3TSSA 1KAAA 2AQ1B 2A74C 2Z4IA 3NWTA 2YYZA 4ZAIA 2HUGA 2JA8B 1CFMA 5C0XH 2RDHA 5ELEA 1TU2B 4BY7B 2F0GA 4KN7C 2IJ0A 3K57A 3H94A 3S17B 3I72A 4CKCA 4OHJA 2MHVA 4FXGC 3NSWA 1ET9A 1J8IA 3CRLC 1DM0B 2BE5D 1F77A 1TS2A 2NYZD 1PFNA 1LTID 1F9SA 3GQBA 3HOVB 2RQXA 1R4QB 3T4AC 5KNCA 5JAVA 1RTOA 3RLFA 1I6HB 1E2WA 2EYFA 1WTOA 3FRPB 4K2KA 4J6HA 4F88A 1BCPC 1MBYA 1MSGA 3TZUA 4F87A 2LY7A 4KD3A 1T5XD 4DK0A 2EVBA 3H09A 5ELDA 3JAME 1WVLA 2EYLA 1SMYC 5BN3A 2KEEA 1A6XA 2EJMA 2TSSA 2F0QA 2R3ZA 1U4RA 4QUCA 1STGA 2EYJA 4ABNA 2ID0A 3L3OC 2QEJC 4M1UB 5DEHA 5C3WA 1Z7TA 5JOBA 3I8ZA 3KBXA 1I3QB 3RUZA 2HCIA 1U4LA 1GUWA 4C3HG 2DNCA 2K04A 2F0NA 2V4DA 2X6GA 5KEEA 1HA5A 4BS9A 3I3CA 2OXPA 3BVMA 2OT2A 1LT3D 2TMPA 5C44B 3HEJA 1MI2A 2QILA 3L9AX 2SNSA 5D3IB 4CJ0B 5LHY1 2MPMA 2FMCA 1EY9A 2O2LD 1GJXA 2EYMA 3H91A 3TDQA 1TVXA 1WCMB 2B2UC 5KNBA 3GTPB 1D2BA 1VMCA 1B44D 4LAAA 5DAUA 4XYOA 2A6HD 1ENFA 1BO0A 2PW5A 1M4VA 5LL6X 1FGBD 1C8CA 4BY1B 1FNWA 1AW7A 1QILA 3V05A 2K7VA 5K36H 4X3UA 2F0SA 2F0VA 2E76C 2EY2A 1BOSA 1JOOA 1ET6A 1STAA 2PO4A 3W3AA 5A2QE 2KUMA 5EBDA 2B2WA 1HTPA 1GUGA 5CGKA 3MXUA 4ZK9B 5DM63 1I50B 4G57A 3N6RA 2NTTA 4OO1G 2H1EA 3NUCA 4G7ZC 5DM73 1STNA 2XN9C 3WOFA 1LLRD 2YU9B 4R8IA 2BCOA 4IUPA 4C1NI 2F1MA 2R6GA 4ZQ3A 1ESFA 1SAPA 4FF1A 2K33A 3IKJA 3TP6A 1YNNC 1PMRA 4KN4C 1A2TA 4K6LA 4FXKC 4DK1A 5FO8B 4PMBA 3KLSX 4XT1B 3IL8A 4BBSB 5IOCA 2BA1A 3SK6A 1MSHA 1D5ZC 1PTOC 1O7ZA 3S2DB 3M7GA 1ONLA 1VDZA 2CQAA 1ZKOA 1SYGA 5A35A 3BYTB 2A69D 5C5MA 2D9UA 3K6OA 5IT9L 2A6EC 3R93A 4A93B 1GXDC 5T1GA 1A3UA 3K5NA 1Q3LA 1EU3A 4DNTB 3TP5A 5HURA 3HKZB 3PMFA 2PMZB 2E2HB 3MC0B 1OXSC 4EVOA 1Y69U 1WTVA 5CBAE 1L0YB 3H6MA 4WORA 2F4IA 2LMCB 2DN8A 2Z4HA 4KY7A 3S1NB 4RCNA 4NMZA 2XSCA 5C5LA 5C4ZA 4HR7B 3IFDA 4RGTA 2B2YA 1SNMA 4A3BB 1EOTA 3MA2B 3SEBA 1SNQA 1GOZA 1CTMA 4K8JA 5C0XG 2NZ1D 2IL8A 1SDFA 5FO9B 3MFYA 5LL6S 3QB3A 4GZYC 1AN8A 2OEOA 2L55A 3AMUA 4O42A 5CV6A 1I4HA 2RDGA 2D5DA 4UAIA 1CA5A 2NVQB 2WACA 3U9SA 3LWEA 1DD2A 2O4XA 4KHVA 1BUVT 4A3KB 1KLGD 1EY0A 4HCEA 3S9WA 3D4WA 2F03A 3CRKC 4PV1C 3BDOA 4IFDJ 1LV9A 1B1ZA 4JBWA 3T53B 3DWPA 3OOCA 5KIXA 2F0UA 4XIGS 1U4MA 3RD4A 3AU7A 3CKIB 3K58A 4HAEA 1AFPA 1ICWA 2G9HD 3VA5A 3I4MB 2HCCA 3LWUA 2IX3A 1BXTA 4NKLA 5EJWA 1SSOA 1SYEA 2KA7A 2RA4A 2A68C 3EFXD 1KNEA 3URYA 5CMDA 5IT9E 3PV0A 3A54A 1O7LA 4HN7A 1GUNA 3R2TA 4HSVA 2F0TA 1EQVA 4OO1I 2B2VC 2NWGA 5G3LD 2CW0D 5COYA 4WRDA 1EEFD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IFD H;  2O5J C;  3A8K E;  4GZY C;  3ND9 A;  4DK1 A;  1H9J A;  1TU2 B;  1HCZ A;  1O78 A;  5JEA G;  4KN7 C;  4G7O C;  1VF5 C;  1VF7 A;  1GHK A;  3HGB A;  3M4Y A;  2NN6 G;  2BDO A;  5KND A;  3H94 A;  4BA1 I;  5JEA H;  1OXX K;  1B9N A;  1I6V C;  1Q12 A;  2CW0 C;  3I72 A;  2D5D A;  4H44 C;  4KI0 A;  2NN6 H;  1DCZ A;  4KKS A;  4KKT A;  1Q90 A;  4H13 C;  4LJZ C;  2JE6 I;  2BA1 A;  1Y8P B;  3OW7 A;  3T56 B;  3VR5 A;  1GJX A;  2AUJ D;  2Q8I B;  3CRL C;  1Y8O B;  3VR3 A;  2E74 C;  2BE5 D;  4BA2 I;  3A7L A;  3U9S A;  5KNB A;  1B9M A;  1IW7 D;  2K32 A;  1DD2 A;  1LAB A;  3D4R A;  3SDZ A;  1V43 A;  2L5T A;  3GQB A;  4L8J A;  3PUX A;  2NN6 I;  1ONL A;  2EJG C;  1ZYR C;  2JEA I;  1QJO A;  3ND8 A;  1VDZ A;  5KNC A;  1K8M A;  2A6H D;  2A6E D;  1ZKO A;  2BE5 C;  3VA7 A;  2EDG A;  3RLF A;  3QG1 A;  1E2W A;  1BDO A;  1IW7 C;  1LAC A;  5A35 A;  1TKW B;  3CRK C;  4PV1 C;  3BDO A;  2PPB C;  2JEB I;  3MFY A;  1H9S A;  1H9M A;  2A69 D;  1OXU A;  3A8J E;  4DNR B;  1DXM A;  1E2Z A;  3WDN A;  2ZT9 C;  2DNE A;  4JBW A;  2D2C C;  3TZU A;  2A6H C;  1GUT A;  3T51 B;  2JXM B;  2A6E C;  3T53 B;  2PNR C;  3OOC A;  1V8Q A;  4LK1 C;  4DK0 A;  2EVB A;  3D31 A;  1Y8N B;  2K7V A;  3EQL C;  5K36 H;  3P20 A;  3OPO A;  1Q1E A;  1G29 1;  4XIG S;  2E76 C;  4DNT B;  5BN5 A;  1SMY C;  5BN3 A;  2A69 C;  2KCC A;  3VR6 A;  1T5E A;  1OXS C;  1E2V A;  4H0L C;  1Y69 U;  2A68 D;  4XTC S;  3PUV A;  3W3A A;  2B8G A;  1GHJ A;  1A6X A;  2EJM A;  2QF7 A;  1HTP A;  1YNJ C;  1EWH A;  1GUG A;  3DXJ C;  3LWU A;  1OXT A;  4I7Z C;  4JK1 C;  4TQU S;  1H9R A;  2EJF C;  3MXU A;  2LMC B;  2KA7 A;  2B8F A;  2DN8 A;  2E75 C;  1FYC A;  3N6R A;  4KKU A;  4KMU C;  2AUK A;  5K36 G;  1GUS A;  3QJY A;  2BA0 A;  3A7A B;  2A68 C;  4OO1 G;  3A8I E;  3QIA A;  4RCN A;  1CI3 M;  1H9S B;  4G7H C;  4G7Z C;  3PV0 A;  4OO1 H;  3M7N A;  1H9K A;  1Z7T A;  1IYV A;  4HR7 B;  1HQM C;  3PUY A;  1K8O A;  3LNN A;  1O7L A;  2D62 A;  3PUZ A;  3I73 A;  2AWO A;  1GUN A;  2F1M A;  2O5I C;  1Z6H A;  2R6G A;  4KHZ A;  1OXV A;  4TKO B;  3VR4 A;  1HPC A;  2YYZ A;  2DNC A;  3PUW A;  1CTM A;  3BG3 A;  1VCI A;  3I4L A;  3KLR A;  2IT1 A;  5BN4 A;  5C0X G;  2V4D A;  3L7Z C;  3NE5 B;  4IQZ A;  3SE0 A;  3FPP A;  2K33 A;  1IYU A;  2PCF B;  1CFM A;  3IKJ A;  4IFD G;  3GD7 A;  4OGQ C;  1YNN C;  1PMR A;  3IFT A;  4KN4 C;  5C0X H;  1GUO A;  3M85 A;  1FR3 A;  3AB9 A;  1Q1B A;  3FMC A;  3VR2 A; 
#chains in the Genus database with same CATH topology
 4J1M A;  1HJP A;  4CDF C;  5FLX E;  2FJ2 A;  4YWM A;  3PO2 G;  1HCZ A;  2VL6 A;  3RN2 A;  3AEV A;  4B9X A;  4AYB B;  4K5V A;  5KGU A;  1EYA A;  4K6D A;  1Q90 A;  3R3O A;  1ROD A;  1BNZ A;  1DON A;  4HJ8 A;  1HUN A;  2XGT A;  4A75 A;  1K8A C;  1PZK D;  1Y8O B;  3DWQ A;  3OIP A;  5GAE C;  4JBJ A;  1H95 A;  1Y14 B;  2UUC Q;  1B9M A;  4DF7 A;  5IYB H;  1LAB A;  1YJ9 A;  3D4R A;  3ULJ A;  2UXD L;  1PH1 A;  1EY7 A;  3V2T A;  4YIJ A;  1K8M A;  1IL8 A;  1KRT A;  4QY7 A;  4BY1 G;  3VA7 A;  3S15 H;  3G7L A;  4GKK L;  3G71 A;  1WTR A;  1TKW B;  1HNW Q;  2C9O A;  3GV6 A;  2JA5 B;  4R4T A;  2C5C A;  3C1F A;  4RFB A;  3CCQ A;  3MXP A;  3TBI B;  4X3S A;  4DXF A;  2Q8T A;  3E9I A;  1JC7 A;  4ZUJ A;  3J7Z C;  2R7D A;  2SEB D;  1X3G A;  4JBK A;  5G3L F;  2M9V A;  4XT3 B;  4MN3 A;  4F7X A;  3CPF A;  3VYU A;  4LF5 Q;  5I4D A;  3ICE A;  1JR0 D;  1QZG A;  4TVA B;  1SXT A;  5JPN C;  1HHV A;  4EGV A;  1HA6 A;  1U9R A;  3ULL A;  3K5M A;  3E6Z X;  3S14 H;  3DEP A;  1ASY A;  4EQO A;  2KCM A;  4QMG A;  4JOI C;  4KMU C;  2MFI A;  3PQI A;  1GUS A;  1UUP A;  2BA0 A;  4ZKB B;  1PH4 A;  1IBM Q;  3A8I E;  3P7J A;  3QIA A;  4DR2 Q;  4AYB E;  1BBX C;  4JBM A;  1IBL L;  2DUD A;  5GQO A;  1WTW A;  3MVV A;  1KDB A;  1SBB B;  3CCR A;  5JJZ A;  4Y52 H;  1KIX A;  1SNC A;  5M5Y H;  2QDL A;  1EWC A;  3NP8 A;  1TY2 A;  2FHT A;  1A0I A;  3PF5 A;  3TRZ A;  2MP1 A;  2R92 B;  3KDF A;  5JVG 3;  3AFQ A;  1BVS A;  2F0E A;  1X6O A;  4LF5 L;  3HRZ C;  4LF9 Q;  3M85 A;  3GD7 A;  1EEI D;  2Z6K A;  3CCJ A;  2HQE A;  1W2B A;  4IFD H;  4M8A A;  3Q8D A;  3Q6S A;  1O78 A;  5FJ8 H;  4U68 A;  4K5X A;  4DV3 Q;  2ALY B;  4WJ3 M;  4IUR A;  4UPA A;  4U67 3;  2IHF A;  4HJA A;  5I2Y A;  1TS3 A;  1MHW C;  3RNU A;  3X3M A;  1CHQ D;  2ZTD A;  2HHH L;  3J7A 5;  5FOB B;  2JN4 A;  5C0X I;  4DR2 L;  2VUM B;  2AMC B;  4WJW A;  1JJG A;  2Z8L A;  1XXG A;  1IKM A;  2F0P A;  3CC2 A;  4C2M B;  1NAP A;  3MTS A;  3M3Y H;  2Y0S B;  2AWN A;  3G4S A;  3FEW X;  3LX0 A;  4X66 L;  4FF3 A;  1IKL A;  1ZYR C;  1QJO A;  4TRD A;  1LYL A;  1HFN A;  1VQ8 A;  1VQF A;  2WAQ B;  4DR5 Q;  2UUA Q;  4KK7 A;  3QG1 A;  3CXC A;  1C9O A;  4A93 G;  2QA4 A;  1S40 A;  5L37 A;  1BBW A;  4JI2 Q;  2WB1 E;  1FJG Q;  4LF9 L;  1F2L A;  1SYC A;  3HOY B;  1HXY D;  1E2Z A;  3S1M B;  4DV4 Q;  3HKZ G;  1W6J A;  3HZX A;  1V8Q A;  4R4Q A;  4KD4 A;  4P75 A;  5I6Y A;  5GAG C;  4N8X 1;  4MHE A;  1UWV A;  2ZXR A;  1U5K A;  3J7A F;  3D6C A;  2KCC A;  3H3V C;  2JA7 B;  5A2Q L;  2N78 A;  1PH9 A;  1N32 L;  1NBW A;  5IGG A;  1GHJ A;  1EWH A;  4JK1 C;  5E4X A;  3GTQ B;  1H9R A;  4IJL A;  3Q0A A;  1KAW A;  4LF6 L;  3KJP A;  4PZ8 A;  4ZUI A;  2E2J B;  4OIJ A;  1BQQ T;  2UUA L;  1YNJ D;  4CDD C;  3GTG H;  4IPG A;  4K0K L;  2PQA A;  2NBF A;  1JQY D;  2Q2H A;  1EY8 A;  1PYW D;  2L0C A;  4YY3 L;  3PIO 3;  4A3J B;  3GTG B;  1HZB A;  1FJG L;  5J3B A;  4A3E H;  1TII D;  2UXB L;  2AWO A;  4GN4 B;  1RJT A;  2PZU A;  4A3E B;  3HOW B;  2NB0 A;  3M4O B;  1VQA A;  2WAQ E;  1LT5 D;  4A3F H;  5IOD A;  5H1S E;  2B3G A;  4BWG B;  5CV8 A;  4DAY A;  3ND9 A;  4DAP A;  3J81 c;  2K4K A;  3RMH A;  1VF5 C;  3T16 A;  4L6T B;  3GTO B;  2MUY A;  4BA1 I;  4X6A H;  4DV7 L;  4RA8 A;  4A3D H;  4O1N A;  2XVS A;  1Y1W B;  3RZD H;  4K2L A;  1SE2 A;  1KXL A;  1EY4 A;  4IUT A;  2Q8I B;  1EY6 A;  2VQE Q;  4DV2 L;  2OTJ A;  4BA2 I;  1PTO H;  2VS1 A;  3J81 j;  2K32 A;  5C4J B;  5KRU A;  3GTJ H;  5EKL A;  3GTL H;  4RH6 A;  1PFM A;  4HIM A;  5I6W A;  3F2C A;  2ENB A;  3GTL B;  4XDX A;  2F0K A;  2Z1C A;  1GD7 A;  2YTY A;  4ZKC B;  3E0J A;  3K0Y A;  2EPB A;  3GTK B;  1LTG D;  1SE4 A;  1SLJ A;  3PO2 B;  3STB C;  3BDL A;  1WD0 A;  3GTM H;  4X3T A;  3S1R B;  3T51 B;  3IAY A;  2JXM B;  1VS0 A;  1RTN A;  2CWA A;  1A3V A;  1G29 1;  4N9P A;  3U9O A;  1KAB A;  2XWB B;  3NBH A;  3EA6 A;  3NK9 A;  4HIK A;  3NTI A;  1BR9 A;  4N8F A;  2VQE L;  4C56 C;  4TQU S;  3DM3 A;  1LM0 A;  1A2U A;  4GS3 A;  4DV1 Q;  4A3C H;  4RHR A;  2AUK A;  3KLS A;  2JJQ A;  3J80 E;  1TY0 A;  3N52 A;  1A3T A;  1DOK A;  3KUP A;  1CI3 M;  4POF A;  2LS0 1;  3BJU A;  2J0T D;  1N34 L;  2Q2U A;  2K6A A;  2X6L A;  1HNZ Q;  1NUC A;  2E2D C;  1K0S A;  2M00 A;  3HG9 A;  1VQK A;  4TSS A;  4DR1 L;  2I07 B;  3VR4 A;  4PG3 A;  1LTT D;  4LWC A;  3I4L A;  3I55 A;  1JT8 A;  1QVF A;  1TS5 A;  1WJJ A;  4IZ8 A;  4AYB G;  1KDA A;  1SFO B;  2NVX H;  5IGF A;  4Q5V A;  2VB3 X;  4G7O C;  1GHK A;  5C6A A;  2QW7 A;  1PDQ A;  2ZTC A;  4HCS A;  1PRT D;  1C0A A;  3OWE B;  3RR5 A;  4P73 A;  5FO7 B;  2B2U A;  2L1B A;  4H13 C;  1XPR A;  3SK5 A;  4DA2 A;  4R4C A;  5COR A;  3G6E A;  5IYB G;  1SJE D;  1D5X C;  4K5W A;  4L5Q A;  4AQY L;  5C3X A;  2BDN A;  1HFG A;  3I4O A;  1HNZ L;  1ENA A;  1PH3 A;  3SDZ A;  1KDC A;  2N55 A;  1YVC A;  3CU7 A;  1NCV A;  1NMF A;  1BBU A;  5C4X B;  5ELC A;  1IW7 C;  3T13 A;  5JJI A;  1I94 L;  3OHX C;  2JK8 A;  4RKL A;  3DWA A;  1F2Y A;  2QKI C;  2F3V A;  2MGS A;  1EY5 A;  1SYB A;  4DFA A;  1KC8 C;  4OX9 L;  4FF2 A;  1VQP A;  1R4P B;  1CT1 D;  4HMJ A;  1KL9 A;  1PXU A;  2EYP A;  2P5Z X;  2Q8R E;  2WV6 D;  4IPC A;  4KJO A;  3KBG A;  4YCW A;  5BN5 A;  5IP9 G;  2RSO A;  3OYY A;  1FVI A;  1D5M C;  4DK3 C;  1RKN A;  1MJE A;  1E2V A;  2EQS A;  1NTG A;  2G9D A;  4XTC S;  1L0W A;  2R7Z H;  2LSS A;  1VQG A;  1IBK Q;  1PRT F;  5KYL A;  2EJF C;  4JI5 Q;  2WB1 G;  4OIK A;  1EOV A;  1XYI A;  2GVA A;  1W6K A;  3EVQ A;  1PFB A;  4JI3 Q;  1PYS B;  1DZ1 A;  3D4D A;  4JI6 Q;  1SYD A;  3KF8 A;  1IYV A;  2KCN A;  5E1F A;  4JYA Q;  2N3S A;  1K8O A;  1JE4 A;  2EYO A;  3GV3 A;  3CW2 C;  2DJG C;  5ELF A;  5CBE E;  2O5I C;  1PZJ D;  2LXJ A;  4Z9C B;  3PUW A;  3BG3 A;  3KLR A;  2V1C C;  3E5S A;  2MNA A;  5DLQ E;  4IFD G;  2QDB A;  3ER0 A;  4OGQ C;  2GA4 B;  4NXM Q;  2B39 A;  5FLX L;  5FJ8 G;  2K14 A;  4DAM A;  3FMC A;  2WKD A;  4A3G H;  1ILP A;  1G91 A;  4RCO A;  1FNV A;  5IGC A;  1GM5 A;  4A3G B;  4A3M H;  1SYF A;  1GO3 E;  3HGB A;  1S5E D;  2EY5 A;  2JA6 H;  1AZP A;  4NPS A;  4FNF A;  4NW2 A;  1Q46 A;  2PYK A;  3CAM A;  1PH5 A;  2JA6 B;  1DOM A;  3JAM c;  1JOQ A;  4JI3 L;  1X9N A;  4P71 A;  1R9T B;  3SR1 A;  4R8N A;  4ULL A;  1UNS A;  2EOT A;  2OF1 A;  3TRE A;  3I4N H;  2WAQ G;  4HED A;  4CJ2 C;  1HZA A;  2HIX A;  1K8G A;  2F0I A;  3I4N B;  1XJV A;  4G4K A;  4L8J A;  1BCP D;  1Y1V H;  2UUB L;  3SK4 A;  1Q8I A;  4DV5 L;  5FLM H;  2BE5 C;  3NPP A;  4X65 Q;  1X55 A;  3BZD B;  5K5P A;  3RZO B;  4V0B A;  2PPB C;  1EYD A;  1SMY D;  2JEB I;  2JSO A;  1H9S A;  4P2C B;  4NXM L;  1F2M A;  3A8J E;  4NB3 A;  1DXM A;  2KOL A;  5EKI A;  4CHT B;  1TWH B;  2DNE A;  3M9B A;  1GUT A;  1QG7 A;  1YI2 A;  4FDB A;  1X3F A;  5M5W H;  3EQL C;  1W3S A;  4Q0F A;  2R93 H;  4DV0 L;  1PRT B;  1TWG H;  2F0L A;  2KCT A;  4X64 L;  2R93 B;  4JI4 Q;  4F8M A;  4OEL B;  5DNF A;  4GOP C;  2I5L X;  2FXQ A;  3MEF A;  3RLO A;  5IYC H;  3K81 C;  1F9R A;  1YNJ C;  1I4G A;  4XQJ A;  2K03 A;  1EZ8 A;  1M8A A;  2EE1 A;  3ERS X;  3VR2 A;  2B8F A;  5M5X H;  2M2L A;  4C3H H;  4L5R C;  5TSS A;  3KK7 A;  3U4V A;  1HUM A;  1TWF H;  1QWY A;  2L15 A;  4GLX A;  5FK9 C;  1LO5 D;  1DGS A;  3CCV A;  4A3E G;  3HOW G;  1SN8 A;  3RLN A;  5CYU A;  1SNP A;  5IGB A;  1ICF B;  4ZYS A;  2E2I B;  3T1H Q;  1J5E Q;  2K05 A;  2F0F A;  3ONA B;  5HGT A;  5J22 A;  3P75 A;  4A3F G;  4B3R L;  3SE0 A;  4UDU C;  4RMF A;  4MZ9 A;  5M3M B;  1I4Q A;  3G6J B;  2O5J C;  3A8K E;  1Z47 A;  4RWS C;  1CZG A;  4B08 A;  1ESR A;  4A3D G;  4PZ6 A;  1X32 A;  2SOB A;  1HNX L;  2FFK B;  2XIW A;  3OTO L;  1LTR D;  4DN4 M;  1VQN A;  3M4P A;  3I90 A;  1Q12 A;  3Q23 A;  5C0X J;  4KKS A;  1K73 C;  2RSN A;  4DV6 L;  3K7A H;  2BH2 A;  1HZC A;  1KNA A;  3K0X A;  4C3J B;  3NWS A;  1L0X B;  3W2D A;  3K7A B;  2LKV A;  4DGZ A;  4DR7 Q;  2KHS A;  2Q2I A;  1V43 A;  3I91 A;  5JVH 3;  2R7F A;  3A55 A;  5E4W C;  4ZRZ A;  4Y7N H;  4LFC L;  3DHQ A;  1KLU D;  3U58 A;  1S4Z A;  2EDG A;  4B3T Q;  4Y7N B;  2K5D A;  5IP7 H;  4K14 A;  2GN5 A;  4DAY B;  4MIU A;  1II3 A;  3F2B A;  2K01 A;  3HOX H;  4UP7 A;  1EYG A;  2D2C C;  2FIN B;  2A6H C;  3TEH B;  2H4O A;  2PNR C;  3BVZ A;  1OO9 B;  5JEA J;  3OPO A;  4X62 Q;  1SNO A;  5M3F H;  3H3V H;  1TWA H;  2F0H A;  2N88 A;  4GN3 B;  5ELN A;  1TWA B;  2B8G A;  2RF4 A;  1PZI D;  3HS0 C;  1J9O A;  3F2D A;  4A3C G;  1OXT A;  3F1Z A;  3S15 B;  4DR7 L;  4B3S Q;  1JOR A;  2E75 C;  5BR8 Q;  1XPO A;  5K36 G;  4I65 A;  1BCP B;  2K28 A;  4FVM A;  3U50 C;  4UP9 A;  3SHL A;  4JW0 A;  2ZXP A;  1RD9 D;  2RKS A;  2XWJ B;  3NQT A;  4ILW A;  2NTS A;  1HQM C;  4JG2 A;  3CCS A;  4DXG A;  5I9O A;  1YNN D;  4JI7 Q;  1K83 H;  1QE6 A;  1CQF A;  5IGD A;  2B2V A;  2B63 H;  1OXV A;  4GNX A;  5GAD C;  2UUC L;  4A3I H;  1PYB A;  3F8T A;  3HOU H;  1TT2 A;  2NZH A;  1IZ6 A;  3NE5 B;  4O2D A;  2IW3 A;  3E3X A;  1IXR A;  1IYU A;  3S14 B;  3HOU B;  1MKH A;  4I7A A;  4IUV A;  5IWA Q;  5T1I A;  1CZW A;  2F0J A;  1Q1B A;  4C3I H;  1O7Y A;  2WB1 B;  4LW1 A;  1XNR Q;  4QIW E;  4DUY Q;  5IYD H;  4CDE C;  1EZ6 A;  4CJ1 B;  1HNW L;  1QB5 D;  1TQO A;  1CKN A;  5C3E H;  1G2S A;  1PTO D;  1VMP A;  1D8L A;  5C4H A;  1EFI D;  5BR8 L;  3L2P A;  2NN6 H;  4RGN A;  4LJZ C;  3M4Q A;  2RHQ B;  5M5Y B;  1K28 A;  4EQP A;  1U4P A;  4IFD I;  2B2T C;  4DR6 Q;  3NHH A;  3V96 A;  3OW2 A;  5C4X G;  2B29 A;  3B6Y A;  2IWH A;  2EY6 A;  2EJG C;  3NTH A;  3CCM A;  4JI0 Q;  2A6E D;  3J80 i;  2KEN A;  3MXN A;  4FXD A;  1JWS D;  3S16 H;  1BDO A;  1LAC A;  1TXY A;  1XNQ Q;  1I4P A;  3R8B A;  3D0F A;  4CDC C;  4XXE A;  5IWA L;  1G2T A;  1IBM L;  1G6P A;  1LTS D;  4E6I A;  1ZXT A;  2CHB D;  1XNR L;  1Q7Y C;  2L9H A;  3FPU B;  4DUY L;  1G6Z A;  3QOJ A;  1O80 A;  3D31 A;  1YHA A;  1AZQ A;  1V1P A;  1K9M C;  4IPD A;  4KY5 A;  2R7Z G;  2A69 C;  4KJN A;  3M3Y B;  2I46 A;  3GP7 A;  1XMO Q;  1QCB D;  1L1O C;  2WKC A;  5KYI A;  2MO1 A;  2DY7 A;  1PTO F;  3DXJ C;  3M7N A;  4JOI A;  2JA8 H;  2RDF A;  1HH2 P;  5I9P A;  4DUZ Q;  3J80 L;  4KKU A;  1C4Q A;  1C48 A;  2VB2 X;  5EGT A;  4UY8 C;  1QNK A;  4HSP A;  3FKI H;  4BY7 H;  4DV3 L;  1ZEQ X;  1BF4 A;  4IUU A;  1QVG A;  3FKI B;  4PMW A;  1XNQ L;  1B3Q A;  3S17 H;  1NR2 A;  3CD6 A;  3NQI A;  2XRS D;  4B3M Q;  1YJW A;  4JV5 Q;  1E1T A;  2B2T A;  2G5D A;  4V19 0;  1YBY A;  3QO2 A;  4TKO B;  1TWC H;  1MD2 D;  1SRU A;  2IT1 A;  1K0R A;  4EQ5 A;  4NP5 A;  4A3G G;  1HR0 Q;  2QEX A;  1TWC B;  1F2Z A;  1GUO A;  4A3M G;  1WTP A;  4DR5 L;  1TS4 A;  4LFA Q;  2JA6 G;  4OL7 A;  1I6H H;  3KLW A;  3UDX A;  3S1Q H;  4BXX H;  4JI2 L;  3NXW A;  5GRO A;  1WTX A;  3ITP A;  5JEA H;  4DV4 L;  3S1Q B;  4PMC A;  3KF8 B;  2VZA A;  2HDM A;  2PI2 E;  2XTI A;  3I4N G;  3K7U C;  1E7Z A;  2ZJR A;  3S2H H;  4B3M L;  3TME A;  4IAL A;  1EIH A;  5FLM G;  3SGI A;  3S2H B;  1L1O A;  1UAP A;  2QCP X;  4A3F B;  1DOL A;  1I4R A;  3NEN A;  1KTK A;  3WDN A;  4A3D B;  5IT9 c;  1S5F D;  2R93 G;  3MHB A;  3RZD B;  4LFA L;  5AJ3 Q;  1XTD A;  4BBR H;  2AQ2 B;  4GKJ Q;  1PFS A;  1TR5 A;  3P20 A;  4FYD A;  3F2U A;  4BBR B;  1PTO B;  2KJX A;  1X3E A;  2CKZ B;  5J39 A;  5D65 A;  1I3Q H;  3GTJ B;  1YZ6 A;  4QUF A;  2A68 D;  3PUV A;  4X3K A;  2K5Q A;  2RBM A;  1VQ4 A;  5EPL A;  1N8R C;  2B2W C;  4LF7 Q;  1AEX A;  2PQE A;  3QJY A;  1L2F A;  1LTL A;  2ES2 A;  1B53 A;  5C44 H;  4HJ9 A;  3GTM B;  2YTX A;  1H9S B;  2KEC A;  2I5M X;  3C1E A;  2F52 A;  1S3O A;  1AP0 A;  1XTC D;  3DM1 A;  2A73 B;  1CQV A;  1YHB A;  1PLF A;  5CV9 A;  1F9Q A;  4ZLT F;  1S5C D;  3ERO A;  2KVM A;  4RAU C;  1Z6H A;  1WCM H;  2F0O A;  1CUK A;  5AJ3 L;  2J7Z A;  5M3M G;  2EY1 A;  4GKJ L;  3X3N A;  1HPC A;  1XWE A;  3OIQ A;  1EU4 A;  1VCI A;  3W5O A;  1VQO A;  3CPW A;  4DR4 Q;  4IQZ A;  2DY8 A;  3FPP A;  3EBE A;  1UEA B;  1V9P A;  4RGM A;  4ME5 A;  3J7Y W;  2EIF A;  3J7A V;  1B2T A;  1I5F A;  2I5H A;  1HTL D;  4WFN 3;  4C3J G;  1N9W A;  3KFU A;  1EWI A;  1EIY B;  4LF7 L;  1I6V C;  1D6E C;  3C3L A;  2CW0 C;  3VDY A;  3NBI A;  1S72 A;  3H0G H;  1NNX A;  2JE6 I;  3OW7 A;  1Y8P B;  4LNQ A;  2AUJ D;  3H0G B;  4PQX A;  4WJ4 A;  3VR3 A;  2E74 C;  4DR3 Q;  3A7L A;  2CQO A;  3ERQ A;  4PNY A;  2D0O A;  3DEO A;  5IP7 G;  3TN2 A;  2NVX B;  2RVL A;  2WIN B;  2FMM A;  2L12 A;  3HOX G;  4DV1 L;  1I50 H;  1GVP A;  3HP3 A;  1FD7 D;  2ZJQ A;  2EZV A;  3K5O A;  4JI8 Q;  5JPM C;  2PI2 A;  4S3S A;  5EKK A;  4NDX A;  2ZXO A;  1M90 C;  3DLL A;  5EPJ A;  3D3R A;  3I2Z A;  1Y8N B;  4JCV E;  4QB4 A;  2XRQ D;  3D6W A;  1XX8 A;  1PHJ A;  5HY6 A;  2PZW A;  5GAH C;  1X65 A;  3QOL A;  2PZT A;  3TP7 A;  4YWK A;  3K8A A;  4R4O A;  2PNH A;  4IN3 A;  3KF6 B;  1HQR D;  4I7Z C;  3UDI A;  3TP8 A;  2VQF Q;  1LTA D;  2WII B;  4EQN A;  1EL0 A;  3T1Y Q;  3MAQ A;  1FYC A;  1EIF A;  5EPK A;  1GKH A;  3LGJ A;  4QCL A;  3J81 i;  1AH9 A;  4MTK A;  1HRJ A;  1B3A A;  5EBC A;  1STH A;  3GO5 A;  4H7B A;  1Q86 C;  2B63 G;  4BBS H;  4LFB Q;  1CK1 A;  4XQQ A;  5JJL A;  3HOU G;  4RKB A;  2B2Y C;  2R7Z B;  3K80 C;  4LF4 Q;  4C3I G;  4JVZ A;  2PCF B;  1X3Q A;  5D3D A;  3A5Z B;  3PIP A;  1STY A;  3CHB D;  1EQT A;  5CR3 A;  1VF7 A;  3M4Y A;  2NN6 G;  2BDO A;  3J81 L;  4YHH Q;  2VQF L;  5CV5 A;  2VNU D;  1B9N A;  4KKT A;  4DAV A;  3T56 B;  4FF4 A;  1ZYR D;  1ENC A;  3MZ5 A;  2CVR A;  3WOE A;  5LMN Q;  2E2H H;  3SK8 A;  4ODG A;  4QGU A;  3PUX A;  1E24 A;  1IBK L;  2JEA I;  1JWU D;  3ND8 A;  3UE0 A;  2E8G A;  2ICI A;  4CBV A;  1LT6 D;  4JI5 L;  1RCV D;  1SEB D;  4A3M B;  1RDP D;  1SMX A;  4GLV B;  4KV6 A;  1E0B A;  2OQK A;  1CKN B;  4LF8 Q;  5AFW A;  4JI6 L;  4LK1 C;  2UXC Q;  5CV4 A;  2OTL A;  1EIG A;  4JYA L;  1QVC A;  1UE6 A;  4FO2 A;  1XMQ Q;  1VQC A;  4KHP Q;  3K5L A;  3KDF B;  4A3B H;  1JJC B;  3ZYY X;  3CME A;  2IHE A;  1JMC A;  3OWF A;  1Y1V B;  5CV7 A;  5JJK A;  3FHW A;  5J1Z A;  5LMU Q;  2J4X A;  5IIF A;  1NR4 A;  2SNM A;  3MWY W;  2WP8 J;  2F3W A;  5M9O A;  3FKI G;  3MXN B;  3H15 A;  2E5L Q;  2ZM6 Q;  1N36 Q;  4IOA A;  1A62 A;  1ILQ A;  3VYT A;  2BOS A;  4XYQ A;  4FP5 D;  1H9K A;  1MGS A;  3KYH C;  4P74 A;  5M5W B;  3TS2 A;  2EXZ A;  3W1B A;  1TWG B;  4J8Q A;  3PUZ A;  2NVQ H;  1E3P A;  1V1P B;  4JC0 A;  5F2D A;  1AE2 A;  1IL2 A;  1EUJ A;  1PH7 A;  2IX1 A;  2NUC A;  4KHZ A;  3HKZ E;  2PMZ E;  5BN4 A;  4XQN A;  5EQ0 A;  3D8G A;  1CA6 A;  4WRD A;  4A3K H;  3BYY B;  2SDF A;  1FR3 A;  5M5X B;  4C3H B;  1QZH A;  1QNU A;  4BXX G;  4PZ7 A;  4X65 L;  1WD1 A;  1TWF B;  2NVT H;  3BU2 A;  2R61 A;  4RG1 A;  3DUZ A;  3BVG A;  5JEA G;  1PH2 A;  1YNX A;  3CCE A;  2IPK D;  3QR8 A;  4R9W A;  3HOZ H;  4A76 A;  2NVT B;  1BCP F;  3OSO A;  4N9T A;  4H44 C;  1DCZ A;  2ZM6 L;  2VXW A;  2F0W A;  3O13 A;  3Q22 A;  1WTQ A;  1VQL A;  3HOZ B;  5E3F A;  5I2X A;  3AQQ A;  1S5B D;  3I70 A;  3BZC A;  3VR5 A;  1K3R A;  3QWN A;  4B9W A;  1STE A;  1FGU A;  2NVY H;  3A56 A;  3MEH A;  4JI4 L;  1JWM D;  2A1A A;  1VQE A;  2L5T A;  2NVY B;  3VYR A;  3BDC A;  4QJF A;  3STB D;  3P1H A;  3I4M H;  3CQZ H;  3AFP A;  4LMQ D;  2K5V A;  3J81 E;  3CQZ B;  2PQA B;  3A74 A;  3J80 c;  2WFW A;  4O0A A;  4DNR B;  5CC4 A;  4BBR G;  2JYO A;  3KJO A;  1CKO A;  5FKA C;  2L4N A;  2K1B A;  3OMG A;  3UE1 A;  2KED A;  1EQR A;  4GOP A;  2JP1 A;  4QF4 A;  3TS0 A;  2JA9 A;  1SND A;  3T1H L;  1J5E L;  2EYH A;  2UXD Q;  3C46 A;  5ELB A;  5NUC A;  3S24 A;  3K59 A;  1OTC A;  5IY0 A;  3R2I A;  4R1J A;  1MIU A;  4QIW B;  1JIC A;  2NZO A;  4GKK Q;  4UP8 A;  2HD3 A;  5C44 G;  1VQI A;  1B70 B;  3UDF A;  1PA6 A;  2MO0 A;  3H3V I;  4CKE A;  1CHP D;  1LT4 D;  4IUN A;  3HOX B;  4QQB X;  1D1I A;  3PIO A;  3MFG A;  3VYS A;  4OO1 H;  4NXN Q;  2LFN A;  1JB7 A;  3PIP 3;  2L11 A;  1JB3 A;  1WCM G;  3LNN A;  3JAM i;  5M3F B;  3FVQ A;  4HMI A;  1I4X A;  1RHP A;  4K8I A;  1DYQ A;  4IO9 A;  1X3P A;  4KLK A;  2F0D A;  1HZ9 A;  2XNA C;  3EJI A;  4RHS A;  3L7Z C;  1QUQ A;  3NEM A;  2HDL A;  1CM9 A;  4CKB A;  3UI2 A;  3IFT A;  1S5D D;  3AB9 A;  1JCK B;  4KY6 A;  1PH8 A;  4B3T L;  1H9J A;  2F0M A;  1F9P A;  3MXG A;  1M1K C;  1IBL Q;  2Z6K C;  3A5U A;  3H0G G;  2JA5 H;  1HR0 W;  5KND A;  1FNU A;  1T9H A;  1OXX K;  3TZD A;  4KI0 A;  3EN2 A;  4AIM A;  5IGE A;  3I56 A;  3NTK A;  4ID6 A;  1LUZ A;  3NBH B;  1K83 B;  1K3B C;  1D1K A;  3JAM L;  1VQD A;  2B63 B;  5E7N A;  2H5X A;  4NXN L;  1X54 A;  4X62 L;  3C2P A;  1PRT C;  4IUQ A;  4A3I B;  1IW7 D;  2ICE C;  3BZK A;  3U4Z A;  4DU9 A;  4RGO S;  4CGY B;  1G8Z D;  3EIV A;  4APV A;  2KQ3 A;  5ISR A;  2NN6 I;  5IP9 H;  1SE3 A;  3SXH A;  1EYC A;  4YCU A;  4C3I B;  1V1O A;  2K5W A;  2RCF A;  2Z9H A;  2AQ3 B;  2X69 A;  2MJ8 A;  4B3S L;  3ULP A;  5C3E B;  2A5H A;  1H9M A;  3FDT A;  1A15 A;  1NY4 A;  1ML0 D;  1OXU A;  3SVM A;  3CCL A;  2ZT9 C;  2HHH Q;  1IHZ A;  5HGQ A;  3OMC A;  1DJR D;  4MTN A;  5D14 A;  3PO3 H;  1Q1E A;  4C1N K;  1B4O A;  4P72 A;  2AHO B;  3PO3 B;  4JI7 L;  3VR6 A;  3DMU A;  1T5E A;  4POG A;  2HT1 A;  4H0L C;  4X66 Q;  1RF2 D;  4HTH A;  1LTB D;  2R92 H;  2QF7 A;  1NE3 A;  2PW7 A;  1STB A;  1B50 A;  3BS1 A;  3S16 B;  4KTA A;  1SJH D;  3A7A B;  5IE8 A;  1NSN S;  3A0J A;  1QOH A;  1NMG A;  4L63 B;  4G7H C;  3JC6 6;  2KHJ A;  4BBS G;  1D7Q A;  2IX0 A;  1VQ5 A;  1JOK A;  1PVO A;  3PUY A;  3IRB A;  2VUM H;  2D62 A;  3I73 A;  3TSS A;  4LUZ A;  1KAA A;  3CP0 A;  2AQ1 B;  2A74 C;  2Z4I A;  2ZTE A;  3NWT A;  3RN5 A;  3G48 A;  4JI1 Q;  2YYZ A;  4C2M H;  1N32 Q;  4ZAI A;  4DR6 L;  4J15 A;  2K52 A;  2HUG A;  2JA8 B;  3CCU A;  1CFM A;  1WI5 A;  2A8V A;  1CKM A;  5C0X H;  2RDH A;  1PV4 A;  4LF6 Q;  4JI0 L;  2MQH A;  5ELE A;  1TU2 B;  4YWL A;  4BY7 B;  2F0G A;  3PCO B;  4KN7 C;  2IJ0 A;  3K57 A;  4K0K Q;  3H94 A;  4YY3 Q;  3HOY H;  3S17 B;  2ZJP A;  3S1M H;  3I72 A;  4CKC A;  1EFW A;  4OHJ A;  2MHV A;  4FXG C;  3NSW A;  2UXB Q;  1ET9 A;  1J8I A;  2OWO A;  3CRL C;  1DM0 B;  2BE5 D;  1F77 A;  3TQY A;  1TS2 A;  3HOV H;  2JA7 H;  2NYZ D;  1PFN A;  1LTI D;  1F9S A;  1ASZ A;  3GQB A;  1XMO L;  3HOV B;  2RQX A;  1Q82 C;  1R4Q B;  3T4A C;  5KNC A;  3AYH B;  5JAV A;  1RTO A;  4HID A;  4JI1 L;  2ASB A;  3GTQ H;  1A8V A;  3RLF A;  1PH6 A;  4DUZ L;  1E2W A;  1I6H B;  2EXD A;  2EYF A;  4ALP A;  1WTO A;  3FRP B;  4K2K A;  2E2J H;  2RCN A;  4DV7 Q;  4J6H A;  4F88 A;  1BCP C;  1MBY A;  1MSG A;  3TZU A;  4F87 A;  2LY7 A;  4DKA C;  4KD3 A;  1T5X D;  4DK0 A;  2EVB A;  3H09 A;  5ELD A;  3JAM E;  3UDG A;  4A3J H;  4A3B G;  4DV2 Q;  1WVL A;  1Y1V G;  4JV5 L;  2EYL A;  1SMY C;  1VQ9 A;  5BN3 A;  1YIJ A;  2KEE A;  3HOW H;  1A6X A;  2EJM A;  2Y0S E;  2TSS A;  3M4O H;  2F0Q A;  2R3Z A;  1HR0 L;  1U4R A;  4QUC A;  1STG A;  4A3L H;  2EYJ A;  2VY3 A;  4ABN A;  2ID0 A;  3L3O C;  2QEJ C;  2BH8 A;  3WWV A;  3GTO H;  4M1U B;  5DEH A;  3KOJ A;  1Z7T A;  5JOB A;  5C3W A;  2IY5 B;  5IYC G;  3I8Z A;  1Y1W H;  1N33 Q;  3KBX A;  2KBN A;  1I3Q B;  3RUZ A;  4OWW B;  2HCI A;  1U4L A;  4DK6 C;  1GUW A;  4C3H G;  2CH4 A;  2DNC A;  2K04 A;  4A3K G;  2F0N A;  2Z6B A;  5C4J H;  2V4D A;  1VQJ A;  2CWP A;  2X6G A;  5KEE A;  5FLX c;  1HA5 A;  4BS9 A;  2VW9 A;  3I3C A;  3PF4 A;  2OXP A;  3BVM A;  2OT2 A;  3HOZ G;  1LT3 D;  2TMP A;  4OWT B;  5C44 B;  3HEJ A;  2K50 A;  1MI2 A;  2QIL A;  3GTK H;  3L9A X;  2SNS A;  1N34 Q;  3PO2 H;  2UU9 Q;  1E1O A;  1VQB A;  5D3I B;  4CJ0 B;  3S1R H;  5LHY 1;  2DGY A;  2MPM A;  2FMC A;  1EY9 A;  2O2L D;  1GJX A;  2EYM A;  3GTP H;  1WFQ A;  3H91 A;  3TDQ A;  4DR1 Q;  1TVX A;  1WCM B;  2B2U C;  1U0L A;  5KNB A;  3GTP B;  1D2B A;  2OCE A;  1N33 L;  1Q81 C;  3I4M G;  1VMC A;  1B44 D;  4LAA A;  5DAU A;  4XYO A;  2A6H D;  4GN5 A;  4OON A;  1ENF A;  1UE1 A;  4DNI A;  1BO0 A;  3E9H A;  2PW5 A;  5LMN W;  4BY1 H;  1M4V A;  5LL6 X;  1FGB D;  1C8C A;  4BY1 B;  1FNW A;  1AW7 A;  4AH6 A;  1QIL A;  3V05 A;  2K7V A;  5K36 H;  4X3U A;  2F0S A;  2F0V A;  2E76 C;  4AQY Q;  2UU9 L;  1Z9F A;  1SR3 A;  4QL5 A;  2EY2 A;  1BOS A;  1JOO A;  1ET6 A;  1G51 A;  1STA A;  2PO4 A;  3W3A A;  5A2Q E;  2KUM A;  4DR4 L;  5EBD A;  2B2W A;  1HTP A;  1GUG A;  5CGK A;  3FP9 A;  3MXU A;  2HQL A;  4ZK9 B;  4DPG A;  5DM6 3;  1I50 B;  4G57 A;  3N6R A;  1SFO H;  2NTT A;  4OO1 G;  1I94 Q;  4R4I A;  2HIV A;  5M3F G;  2H1E A;  3NUC A;  4G7Z C;  2YU9 H;  5DM7 3;  1STN A;  2XN9 C;  4OX9 Q;  1O7I A;  3WOF A;  1LLR D;  2YU9 B;  4R8I A;  2BCO A;  4IUP A;  4C1N I;  1RL2 A;  4GOP B;  2F1M A;  2R6G A;  1JJ2 A;  4UHV A;  4DR3 L;  2OQ0 A;  4ZQ3 A;  1B8A A;  1ESF A;  1CSQ A;  1SAP A;  4FF1 A;  2K33 A;  3IKJ A;  3TP6 A;  1YNN C;  1PMR A;  4KN4 C;  1A2T A;  2CFM A;  4K6L A;  4FXK C;  2JA5 G;  4DK1 A;  5FO8 B;  5C4X H;  2QGQ A;  2CH4 W;  1SRO A;  4PMB A;  3L0O A;  4JI8 L;  3KLS X;  4A3I G;  4XT1 B;  1B7Y B;  3IL8 A;  4BBS B;  5IOC A;  2BA1 A;  4HJ7 A;  1UE5 A;  4OWX B;  2N49 A;  3SK6 A;  1MSH A;  2JQO A;  1MJC A;  2D0P A;  3CF5 A;  3S2D H;  1D5Z C;  1E22 A;  1YHQ A;  1PTO C;  4IPH A;  5IYD G;  1O7Z A;  1VQ6 A;  3S2D B;  3M7G A;  4LUO A;  3E0E A;  2I0Q A;  1ONL A;  1QUQ B;  5C3E G;  1VDZ A;  2CQA A;  3CMA A;  4MNO A;  1ZKO A;  3CC4 A;  1SYG A;  1XPU A;  4EX5 A;  3T1Y L;  2F3I A;  5A35 A;  4YCV A;  3I7F A;  3BYT B;  3CC7 A;  2K5N A;  4OXP A;  4IOC A;  2A69 D;  1SE8 A;  5C5M A;  3PO3 G;  4A93 H;  1FL0 A;  1VQ7 A;  2D9U A;  3K6O A;  5IT9 L;  2A6E C;  2F4V Q;  3R93 A;  4A93 B;  1GXD C;  5T1G A;  1A3U A;  3K5N A;  1Q3L A;  1EU3 A;  4DNT B;  4GNX B;  4LFB L;  3TP5 A;  5HUR A;  3HKZ B;  3PMF A;  2PMZ B;  2YV5 A;  4OEM B;  2R92 G;  2E2H B;  3MC0 B;  1OXS C;  4EVO A;  1Y69 U;  1WTV A;  2UUB Q;  3HFZ B;  4DV5 Q;  4LF4 L;  5CBA E;  1L0Y B;  3PGZ A;  1RIP A;  2ATW A;  3H6M A;  4WOR A;  4L5T A;  2F4I A;  2LMC B;  2DN8 A;  2Z4H A;  4HIO A;  3S1N H;  4KY7 A;  1KQS A;  3S1N B;  4RCN A;  1Q8K A;  4YHH L;  4NMZ A;  2XSC A;  2AKW B;  5C5L A;  2VUM G;  2Z0S A;  5C4Z A;  4HR7 B;  4A4I A;  2A19 A;  4DV0 Q;  3IFD A;  4RGT A;  2B2Y A;  4X64 Q;  2JA8 G;  1SNM A;  1R9T H;  4A3B B;  4LUV A;  1V1Q A;  1EOT A;  3MA2 B;  2Y0S G;  2F4V L;  3SEB A;  1SNQ A;  1GOZ A;  1CTM A;  4K8J A;  5LMN L;  1IYJ B;  5C0X G;  2NZ1 D;  2IL8 A;  4BY7 G;  1AE3 A;  1SDF A;  1KD1 C;  5FO9 B;  1JE5 A;  3HKS A;  3MFY A;  1EQQ A;  5LL6 S;  3QB3 A;  1A63 A;  3Q24 A;  4GZY C;  1AN8 A;  1KRS A;  2OEO A;  3HOY G;  2L55 A;  4JPB W;  3AMU A;  3RZO H;  4O42 A;  5CV6 A;  5ELO A;  1I4H A;  4ME3 A;  2RDG A;  4L5S A;  1TWH H;  2D5D A;  4UAI A;  1VQH A;  4LF8 L;  1CA5 A;  2NVQ B;  2WAC A;  2UXC L;  1UE7 A;  3HOV G;  2JA7 G;  1XMQ L;  5EAY A;  3U9S A;  1YEZ A;  4KHP L;  3LWE A;  3NEL A;  1DD2 A;  2O4X A;  4B3R Q;  4KHV A;  2RHS B;  3W1G A;  1VQM A;  1BUV T;  4A3K B;  1KLG D;  1WOC A;  2K75 A;  2CCZ A;  1EY0 A;  5LMU L;  4HCE A;  2DJF C;  3S9W A;  3D4W A;  2F03 A;  3CRK C;  4PV1 C;  3BDO A;  1HNX Q;  2E5L L;  1N36 L;  3OTO Q;  2C35 B;  4IFD J;  4A3J G;  1LV9 A;  1B1Z A;  4JBW A;  3T53 B;  4DV6 Q;  3DWP A;  3OOC A;  2KHI A;  5KIX A;  2F0U A;  4XIG S;  1U4M A;  3RD4 A;  2LXK A;  3AU7 A;  3CKI B;  3K58 A;  1YJN A;  3GDE A;  2E2I H;  4HAE A;  2N8N A;  1AFP A;  1ICW A;  2G9H D;  2GVB A;  1P16 A;  3VA5 A;  4LFC Q;  3I4M B;  2HCC A;  3LWU A;  2IX3 A;  4GLA C;  1BXT A;  4A3L G;  4NKL A;  1WTH A;  5EJW A;  2K5H A;  1SSO A;  1SYE A;  1X56 A;  2KA7 A;  5M3M H;  2RA4 A;  2A68 C;  3EFX D;  1KNE A;  1KHI A;  3URY A;  5CMD A;  5IT9 E;  2YTV A;  3PV0 A;  1Y1W G;  1CSP A;  1C7Y A;  2Q2T A;  3A54 A;  1P8L A;  4ZCK A;  1NJI C;  1O7L A;  4HN7 A;  1BKB A;  1YIT A;  1GUN A;  4C3J H;  3R2T A;  4HSV A;  1L1O B;  2F0T A;  1EQV A;  3PSI A;  4HJ5 A;  4OO1 I;  1UEB A;  2B2V C;  4H02 A;  1WYD A;  1J6Q A;  3ZJY C;  4GNX C;  2NWG A;  5G3L D;  2CW0 D;  5COY A;  4IJH A;  3KF6 A;  1EEF D; 
#chains in the Genus database with same CATH homology
 4J1M A;  5FLX E;  2FJ2 A;  1HCZ A;  4B9X A;  4AYB B;  4K5V A;  5KGU A;  1EYA A;  4K6D A;  1Q90 A;  3R3O A;  1ROD A;  1BNZ A;  1DON A;  1HUN A;  1PZK D;  1Y8O B;  3DWQ A;  3OIP A;  1B9M A;  4DF7 A;  1LAB A;  3D4R A;  1EY7 A;  3V2T A;  4YIJ A;  1K8M A;  1IL8 A;  3VA7 A;  3G7L A;  1WTR A;  1TKW B;  2C9O A;  3GV6 A;  2JA5 B;  2C5C A;  3C1F A;  4RFB A;  3MXP A;  3TBI B;  4X3S A;  4DXF A;  2Q8T A;  1JC7 A;  4ZUJ A;  2SEB D;  5G3L F;  2M9V A;  4XT3 B;  4MN3 A;  4F7X A;  3VYU A;  5I4D A;  1JR0 D;  1SXT A;  5JPN C;  1HHV A;  4EGV A;  1HA6 A;  1U9R A;  3K5M A;  3E6Z X;  3DEP A;  4EQO A;  4QMG A;  4KMU C;  1GUS A;  1UUP A;  2BA0 A;  4ZKB B;  3A8I E;  3P7J A;  3QIA A;  1BBX C;  1WTW A;  3MVV A;  1KDB A;  1SBB B;  5JJZ A;  1SNC A;  1EWC A;  3NP8 A;  1TY2 A;  2FHT A;  2MP1 A;  2R92 B;  5JVG 3;  2F0E A;  3HRZ C;  3M85 A;  3GD7 A;  1EEI D;  2HQE A;  4IFD H;  4M8A A;  3Q6S A;  1O78 A;  4U68 A;  4K5X A;  4IUR A;  4U67 3;  5I2Y A;  1TS3 A;  3X3M A;  1CHQ D;  5FOB B;  5C0X I;  2VUM B;  4WJW A;  2Z8L A;  1XXG A;  1IKM A;  2F0P A;  4C2M B;  1NAP A;  3MTS A;  2Y0S B;  2AWN A;  3FEW X;  3LX0 A;  4FF3 A;  1IKL A;  1ZYR C;  1QJO A;  4TRD A;  1HFN A;  2WAQ B;  4KK7 A;  3QG1 A;  1F2L A;  1SYC A;  3HOY B;  1HXY D;  1E2Z A;  3S1M B;  1W6J A;  3HZX A;  1V8Q A;  4KD4 A;  5I6Y A;  4MHE A;  2ZXR A;  3J7A F;  3D6C A;  2KCC A;  3H3V C;  2JA7 B;  5A2Q L;  5IGG A;  1GHJ A;  1EWH A;  4JK1 C;  5E4X A;  3GTQ B;  1H9R A;  3Q0A A;  4ZUI A;  2E2J B;  4OIJ A;  1BQQ T;  1YNJ D;  2NBF A;  1JQY D;  1EY8 A;  1PYW D;  2L0C A;  3PIO 3;  4A3J B;  3GTG B;  1TII D;  2AWO A;  1RJT A;  2PZU A;  4A3E B;  3HOW B;  2NB0 A;  3M4O B;  1LT5 D;  5IOD A;  4BWG B;  5CV8 A;  4DAY A;  3ND9 A;  4DAP A;  3RMH A;  1VF5 C;  3T16 A;  4L6T B;  3GTO B;  2MUY A;  4BA1 I;  4RA8 A;  4O1N A;  2XVS A;  1Y1W B;  4K2L A;  1SE2 A;  1EY4 A;  4IUT A;  2Q8I B;  1EY6 A;  4BA2 I;  1PTO H;  2K32 A;  5C4J B;  5KRU A;  5EKL A;  4RH6 A;  1PFM A;  5I6W A;  2ENB A;  3GTL B;  4XDX A;  2F0K A;  2Z1C A;  4ZKC B;  3E0J A;  3K0Y A;  2EPB A;  3GTK B;  1LTG D;  1SE4 A;  3PO2 B;  3BDL A;  1WD0 A;  4X3T A;  3S1R B;  3T51 B;  3IAY A;  2JXM B;  1RTN A;  1A3V A;  1G29 1;  4N9P A;  3U9O A;  1KAB A;  2XWB B;  3NBH A;  3EA6 A;  3NK9 A;  3NTI A;  1BR9 A;  4C56 C;  4TQU S;  1A2U A;  4RHR A;  2AUK A;  3KLS A;  3J80 E;  1TY0 A;  3N52 A;  1A3T A;  1DOK A;  3KUP A;  1CI3 M;  2LS0 1;  2J0T D;  2K6A A;  2X6L A;  1NUC A;  2E2D C;  2M00 A;  3HG9 A;  4TSS A;  2I07 B;  3VR4 A;  1LTT D;  3I4L A;  1TS5 A;  4IZ8 A;  1KDA A;  1SFO B;  5IGF A;  4Q5V A;  2VB3 X;  4G7O C;  1GHK A;  5C6A A;  1PDQ A;  4HCS A;  1PRT D;  3OWE B;  5FO7 B;  2B2U A;  2L1B A;  4H13 C;  3SK5 A;  4DA2 A;  5COR A;  1SJE D;  1D5X C;  4K5W A;  5C3X A;  2BDN A;  1HFG A;  1ENA A;  3SDZ A;  1KDC A;  2N55 A;  3CU7 A;  1NCV A;  5C4X B;  5ELC A;  1IW7 C;  3T13 A;  3OHX C;  4RKL A;  3DWA A;  1F2Y A;  2QKI C;  2F3V A;  2MGS A;  1EY5 A;  1SYB A;  4DFA A;  4FF2 A;  1R4P B;  1CT1 D;  4HMJ A;  1PXU A;  4KJO A;  2WV6 D;  2EYP A;  2Q8R E;  3Q24 A;  3KBG A;  5BN5 A;  2RSO A;  1D5M C;  1RKN A;  1E2V A;  2G9D A;  4XTC S;  1PRT F;  5KYL A;  2EJF C;  4OIK A;  1XYI A;  1W6K A;  3EVQ A;  1PFB A;  1DZ1 A;  3D4D A;  1SYD A;  3KF8 A;  1IYV A;  2KCN A;  5E1F A;  1K8O A;  1JE4 A;  2EYO A;  3GV3 A;  5ELF A;  5CBE E;  2O5I C;  1PZJ D;  4Z9C B;  3PUW A;  3BG3 A;  3KLR A;  3E5S A;  4IFD G;  2QDB A;  4OGQ C;  2GA4 B;  2B39 A;  5FLX L;  1ILP A;  3FMC A;  2WKD A;  1G91 A;  4RCO A;  1FNV A;  5IGC A;  4A3G B;  1SYF A;  3HGB A;  1S5E D;  2EY5 A;  1AZP A;  4FNF A;  4NW2 A;  2PYK A;  2JA6 B;  1DOM A;  1JOQ A;  1R9T B;  3SR1 A;  4R8N A;  4ULL A;  1UNS A;  2EOT A;  2OF1 A;  4HED A;  4CJ2 C;  2F0I A;  3I4N B;  4G4K A;  4L8J A;  1BCP D;  3SK4 A;  1Q8I A;  2BE5 C;  3NPP A;  3BZD B;  5K5P A;  3RZO B;  4V0B A;  2PPB C;  1EYD A;  1SMY D;  2JEB I;  2JSO A;  1H9S A;  4P2C B;  1F2M A;  5EKI A;  3A8J E;  1DXM A;  2KOL A;  4CHT B;  1TWH B;  2DNE A;  1GUT A;  1QG7 A;  3EQL C;  4Q0F A;  1PRT B;  2F0L A;  2R93 B;  4F8M A;  5DNF A;  1F9R A;  1YNJ C;  1I4G A;  4XQJ A;  2K03 A;  1EZ8 A;  1M8A A;  2EE1 A;  3VR2 A;  2B8F A;  2M2L A;  5TSS A;  3KK7 A;  1HUM A;  1QWY A;  5FK9 C;  1LO5 D;  5CYU A;  1SNP A;  5IGB A;  4ZYS A;  2E2I B;  2K05 A;  2F0F A;  3ONA B;  5HGT A;  5J22 A;  3P75 A;  3SE0 A;  4UDU C;  5M3M B;  1I4Q A;  3G6J B;  2O5J C;  3A8K E;  1Z47 A;  4B08 A;  1CZG A;  4RWS C;  1ESR A;  1X32 A;  2SOB A;  2FFK B;  2XIW A;  1LTR D;  4DN4 M;  3I90 A;  1Q12 A;  3Q23 A;  5C0X J;  4KKS A;  2RSN A;  1KNA A;  4C3J B;  3NWS A;  1L0X B;  3W2D A;  3K7A B;  2LKV A;  4DGZ A;  2KHS A;  1V43 A;  3I91 A;  5JVH 3;  3A55 A;  5E4W C;  4ZRZ A;  3DHQ A;  1KLU D;  1S4Z A;  2EDG A;  4Y7N B;  2K5D A;  4K14 A;  4MIU A;  1II3 A;  2K01 A;  2D2C C;  2FIN B;  2A6H C;  2H4O A;  2PNR C;  3BVZ A;  1OO9 B;  5JEA J;  3OPO A;  1SNO A;  2F0H A;  2N88 A;  1TWA B;  2B8G A;  1PZI D;  3HS0 C;  1J9O A;  1OXT A;  3S15 B;  1JOR A;  2E75 C;  5K36 G;  4I65 A;  1BCP B;  2K28 A;  4FVM A;  3SHL A;  2ZXP A;  1RD9 D;  2RKS A;  2XWJ B;  3NQT A;  4ILW A;  2NTS A;  1HQM C;  4DXG A;  5I9O A;  1YNN D;  1QE6 A;  1CQF A;  5IGD A;  2B2V A;  1OXV A;  1TT2 A;  3NE5 B;  2IW3 A;  1IYU A;  3S14 B;  3HOU B;  4IUV A;  5T1I A;  1CZW A;  2F0J A;  1Q1B A;  1O7Y A;  2WB1 B;  1EZ6 A;  4CJ1 B;  1QB5 D;  1TQO A;  1G2S A;  1PTO D;  1VMP A;  5C4H A;  1EFI D;  2NN6 H;  4RGN A;  4LJZ C;  5M5Y B;  4EQP A;  1U4P A;  4IFD I;  2B2T C;  3NHH A;  3V96 A;  2IWH A;  2EY6 A;  2EJG C;  3NTH A;  2A6E D;  3MXN A;  4FXD A;  1JWS D;  1BDO A;  1LAC A;  1I4P A;  3R8B A;  4XXE A;  1G2T A;  1LTS D;  4E6I A;  1ZXT A;  2CHB D;  1G6Z A;  2L9H A;  3FPU B;  3QOJ A;  1O80 A;  3D31 A;  1AZQ A;  1V1P A;  4KY5 A;  2A69 C;  4KJN A;  3M3Y B;  2I46 A;  3GP7 A;  1QCB D;  2WKC A;  5KYI A;  2DY7 A;  1PTO F;  3DXJ C;  3M7N A;  2RDF A;  5I9P A;  3J80 L;  4KKU A;  1C4Q A;  1C48 A;  2VB2 X;  5EGT A;  1QNK A;  4HSP A;  1ZEQ X;  1BF4 A;  4IUU A;  3FKI B;  4PMW A;  1NR2 A;  3NQI A;  2XRS D;  2B2T A;  4V19 0;  3QO2 A;  4TKO B;  1MD2 D;  2IT1 A;  4NP5 A;  1TWC B;  1F2Z A;  1GUO A;  1WTP A;  1TS4 A;  4OL7 A;  3NXW A;  1WTX A;  3ITP A;  5JEA H;  3S1Q B;  4PMC A;  2HDM A;  3TME A;  4IAL A;  1EIH A;  3S2H B;  1UAP A;  2QCP X;  4A3F B;  1DOL A;  1I4R A;  1KTK A;  3WDN A;  4A3D B;  1S5F D;  3MHB A;  3RZD B;  2AQ2 B;  1TR5 A;  3P20 A;  4FYD A;  3F2U A;  4BBR B;  1PTO B;  2KJX A;  5J39 A;  5D65 A;  3GTJ B;  4QUF A;  2A68 D;  3PUV A;  4X3K A;  2K5Q A;  2RBM A;  5EPL A;  2B2W C;  1AEX A;  2PQE A;  3QJY A;  1B53 A;  3GTM B;  1H9S B;  2KEC A;  3C1E A;  1AP0 A;  1XTC D;  3DM1 A;  2A73 B;  1CQV A;  1PLF A;  5CV9 A;  1F9Q A;  4ZLT F;  1S5C D;  3ERO A;  2KVM A;  4RAU C;  1Z6H A;  2F0O A;  2J7Z A;  2EY1 A;  3X3N A;  1HPC A;  1XWE A;  3OIQ A;  1EU4 A;  1VCI A;  4IQZ A;  2DY8 A;  3FPP A;  1UEA B;  4RGM A;  4ME5 A;  3J7Y W;  3J7A V;  1B2T A;  1HTL D;  4WFN 3;  4C3J G;  1I6V C;  1D6E C;  3C3L A;  2CW0 C;  3NBI A;  2JE6 I;  3OW7 A;  1Y8P B;  2AUJ D;  3H0G B;  4PQX A;  3VR3 A;  2E74 C;  3A7L A;  3ERQ A;  4PNY A;  3DEO A;  3TN2 A;  2NVX B;  2RVL A;  2WIN B;  2FMM A;  2L12 A;  3HP3 A;  1FD7 D;  2EZV A;  3K5O A;  5JPM C;  4S3S A;  5EKK A;  4NDX A;  2ZXO A;  5EPJ A;  3D3R A;  1Y8N B;  4QB4 A;  2XRQ D;  3D6W A;  1XX8 A;  2PZW A;  3QOL A;  2PZT A;  3TP7 A;  4IN3 A;  1HQR D;  4I7Z C;  3TP8 A;  1LTA D;  2WII B;  4EQN A;  1EL0 A;  3MAQ A;  1FYC A;  5EPK A;  4QCL A;  1HRJ A;  1B3A A;  5EBC A;  1STH A;  3GO5 A;  4H7B A;  1CK1 A;  4XQQ A;  4RKB A;  2B2Y C;  2R7Z B;  4C3I G;  2PCF B;  1X3Q A;  5D3D A;  1STY A;  3CHB D;  1EQT A;  5CR3 A;  1VF7 A;  3M4Y A;  2NN6 G;  2BDO A;  3J81 L;  5CV5 A;  2VNU D;  1B9N A;  4KKT A;  4DAV A;  3T56 B;  4FF4 A;  1ZYR D;  1ENC A;  3MZ5 A;  2CVR A;  3WOE A;  3SK8 A;  4ODG A;  3PUX A;  2JEA I;  1JWU D;  3ND8 A;  2ICI A;  4CBV A;  1LT6 D;  1RCV D;  1SEB D;  4A3M B;  1RDP D;  4KV6 A;  1E0B A;  5AFW A;  4LK1 C;  5CV4 A;  1EIG A;  4FO2 A;  3K5L A;  3ZYY X;  3OWF A;  5CV7 A;  1Y1V B;  5J1Z A;  2J4X A;  5IIF A;  1NR4 A;  2SNM A;  3MWY W;  2WP8 J;  2F3W A;  5M9O A;  1ILQ A;  3VYT A;  2BOS A;  4XYQ A;  4FP5 D;  1H9K A;  1MGS A;  5M5W B;  2EXZ A;  1TWG B;  4J8Q A;  3PUZ A;  5F2D A;  1V1P B;  2IX1 A;  2NUC A;  4KHZ A;  5BN4 A;  4XQN A;  5EQ0 A;  3D8G A;  1CA6 A;  3BYY B;  2SDF A;  1FR3 A;  5M5X B;  4C3H B;  1QNU A;  1WD1 A;  1TWF B;  5JEA G;  2R61 A;  3DUZ A;  3BVG A;  2IPK D;  4R9W A;  2NVT B;  1BCP F;  3OSO A;  4N9T A;  4H44 C;  1DCZ A;  2VXW A;  2F0W A;  3O13 A;  3Q22 A;  1WTQ A;  3HOZ B;  5E3F A;  5I2X A;  1S5B D;  3I70 A;  3VR5 A;  3QWN A;  4B9W A;  1STE A;  3A56 A;  3MEH A;  1JWM D;  2L5T A;  2NVY B;  3VYR A;  3BDC A;  3P1H A;  4LMQ D;  3J81 E;  3CQZ B;  4DNR B;  5CC4 A;  2JYO A;  5FKA C;  2L4N A;  2K1B A;  3OMG A;  2KED A;  2JP1 A;  4QF4 A;  1SND A;  2EYH A;  3C46 A;  5ELB A;  5NUC A;  3K59 A;  3R2I A;  4QIW B;  1JIC A;  4CKE A;  1CHP D;  1LT4 D;  4IUN A;  3HOX B;  1D1I A;  3MFG A;  3VYS A;  4OO1 H;  2LFN A;  3PIP 3;  2L11 A;  1JB3 A;  3LNN A;  5M3F B;  3FVQ A;  4HMI A;  1I4X A;  1RHP A;  4K8I A;  1DYQ A;  1X3P A;  2F0D A;  2XNA C;  3EJI A;  4RHS A;  3L7Z C;  2HDL A;  1CM9 A;  4CKB A;  3UI2 A;  3IFT A;  1S5D D;  3AB9 A;  1JCK B;  4KY6 A;  1H9J A;  2F0M A;  1F9P A;  3MXG A;  5KND A;  1FNU A;  1OXX K;  3TZD A;  4KI0 A;  5IGE A;  3NTK A;  4ID6 A;  1K83 B;  1D1K A;  3JAM L;  2B63 B;  3C2P A;  1PRT C;  4IUQ A;  4A3I B;  1IW7 D;  2ICE C;  4DU9 A;  4RGO S;  4CGY B;  1G8Z D;  2KQ3 A;  5ISR A;  2NN6 I;  1SE3 A;  3SXH A;  1EYC A;  4C3I B;  1V1O A;  2K5W A;  2AQ3 B;  2X69 A;  2MJ8 A;  5C3E B;  2A5H A;  1H9M A;  3FDT A;  1A15 A;  1ML0 D;  1OXU A;  3SVM A;  2ZT9 C;  1IHZ A;  3OMC A;  1DJR D;  5D14 A;  1Q1E A;  4C1N K;  1B4O A;  3PO3 B;  3VR6 A;  3DMU A;  1T5E A;  4H0L C;  1RF2 D;  4HTH A;  1LTB D;  2QF7 A;  2PW7 A;  1STB A;  1B50 A;  3BS1 A;  3S16 B;  4KTA A;  1SJH D;  3A7A B;  1NSN S;  1QOH A;  4L63 B;  4G7H C;  2IX0 A;  1JOK A;  3PUY A;  2D62 A;  3I73 A;  3TSS A;  1KAA A;  2AQ1 B;  2A74 C;  2Z4I A;  3NWT A;  2YYZ A;  4ZAI A;  2HUG A;  2JA8 B;  1CFM A;  5C0X H;  2RDH A;  5ELE A;  1TU2 B;  4BY7 B;  2F0G A;  4KN7 C;  2IJ0 A;  3K57 A;  3H94 A;  3S17 B;  3I72 A;  4CKC A;  4OHJ A;  2MHV A;  4FXG C;  3NSW A;  1ET9 A;  1J8I A;  3CRL C;  1DM0 B;  2BE5 D;  1F77 A;  1TS2 A;  2NYZ D;  1PFN A;  1LTI D;  1F9S A;  3GQB A;  3HOV B;  2RQX A;  1R4Q B;  3T4A C;  5KNC A;  5JAV A;  1RTO A;  3RLF A;  1I6H B;  1E2W A;  2EYF A;  1WTO A;  3FRP B;  4K2K A;  4J6H A;  4F88 A;  1BCP C;  1MBY A;  1MSG A;  3TZU A;  4F87 A;  2LY7 A;  4KD3 A;  1T5X D;  4DK0 A;  2EVB A;  3H09 A;  5ELD A;  3JAM E;  1WVL A;  2EYL A;  1SMY C;  5BN3 A;  2KEE A;  1A6X A;  2EJM A;  2TSS A;  2F0Q A;  2R3Z A;  1U4R A;  4QUC A;  1STG A;  2EYJ A;  4ABN A;  2ID0 A;  3L3O C;  2QEJ C;  4M1U B;  5DEH A;  5C3W A;  1Z7T A;  5JOB A;  3I8Z A;  3KBX A;  1I3Q B;  3RUZ A;  2HCI A;  1U4L A;  1GUW A;  4C3H G;  2DNC A;  2K04 A;  2F0N A;  2V4D A;  2X6G A;  5KEE A;  1HA5 A;  4BS9 A;  3I3C A;  2OXP A;  3BVM A;  2OT2 A;  1LT3 D;  2TMP A;  5C44 B;  3HEJ A;  1MI2 A;  2QIL A;  3L9A X;  2SNS A;  5D3I B;  4CJ0 B;  5LHY 1;  2MPM A;  2FMC A;  1EY9 A;  2O2L D;  1GJX A;  2EYM A;  3H91 A;  3TDQ A;  1TVX A;  1WCM B;  2B2U C;  5KNB A;  3GTP B;  1D2B A;  1VMC A;  1B44 D;  4LAA A;  5DAU A;  4XYO A;  2A6H D;  1ENF A;  1BO0 A;  2PW5 A;  1M4V A;  5LL6 X;  1FGB D;  1C8C A;  4BY1 B;  1FNW A;  1AW7 A;  1QIL A;  3V05 A;  2K7V A;  5K36 H;  4X3U A;  2F0S A;  2F0V A;  2E76 C;  2EY2 A;  1BOS A;  1JOO A;  1ET6 A;  1STA A;  2PO4 A;  3W3A A;  5A2Q E;  2KUM A;  5EBD A;  2B2W A;  1HTP A;  1GUG A;  5CGK A;  3MXU A;  4ZK9 B;  5DM6 3;  1I50 B;  4G57 A;  3N6R A;  2NTT A;  4OO1 G;  2H1E A;  3NUC A;  4G7Z C;  5DM7 3;  1STN A;  2XN9 C;  3WOF A;  1LLR D;  2YU9 B;  4R8I A;  2BCO A;  4IUP A;  4C1N I;  2F1M A;  2R6G A;  4ZQ3 A;  1ESF A;  1SAP A;  4FF1 A;  2K33 A;  3IKJ A;  3TP6 A;  1YNN C;  1PMR A;  4KN4 C;  1A2T A;  4K6L A;  4FXK C;  4DK1 A;  5FO8 B;  4PMB A;  3KLS X;  4XT1 B;  3IL8 A;  4BBS B;  5IOC A;  2BA1 A;  3SK6 A;  1MSH A;  1D5Z C;  1PTO C;  1O7Z A;  3S2D B;  3M7G A;  1ONL A;  1VDZ A;  2CQA A;  1ZKO A;  1SYG A;  5A35 A;  3BYT B;  2A69 D;  5C5M A;  2D9U A;  3K6O A;  5IT9 L;  2A6E C;  3R93 A;  4A93 B;  1GXD C;  5T1G A;  1A3U A;  3K5N A;  1Q3L A;  1EU3 A;  4DNT B;  3TP5 A;  5HUR A;  3HKZ B;  3PMF A;  2PMZ B;  2E2H B;  3MC0 B;  1OXS C;  4EVO A;  1Y69 U;  1WTV A;  5CBA E;  1L0Y B;  3H6M A;  4WOR A;  2F4I A;  2LMC B;  2DN8 A;  2Z4H A;  4KY7 A;  3S1N B;  4RCN A;  4NMZ A;  2XSC A;  5C5L A;  5C4Z A;  4HR7 B;  3IFD A;  4RGT A;  2B2Y A;  1SNM A;  4A3B B;  1EOT A;  3MA2 B;  3SEB A;  1SNQ A;  1GOZ A;  1CTM A;  4K8J A;  5C0X G;  2NZ1 D;  2IL8 A;  1SDF A;  5FO9 B;  3MFY A;  5LL6 S;  3QB3 A;  4GZY C;  1AN8 A;  2OEO A;  2L55 A;  3AMU A;  4O42 A;  5CV6 A;  1I4H A;  2RDG A;  2D5D A;  4UAI A;  1CA5 A;  2NVQ B;  2WAC A;  3U9S A;  3LWE A;  1DD2 A;  2O4X A;  4KHV A;  1BUV T;  4A3K B;  1KLG D;  1EY0 A;  4HCE A;  3S9W A;  3D4W A;  2F03 A;  3CRK C;  4PV1 C;  3BDO A;  4IFD J;  1LV9 A;  1B1Z A;  4JBW A;  3T53 B;  3DWP A;  3OOC A;  5KIX A;  2F0U A;  4XIG S;  1U4M A;  3RD4 A;  3AU7 A;  3CKI B;  3K58 A;  4HAE A;  1AFP A;  1ICW A;  2G9H D;  3VA5 A;  3I4M B;  2HCC A;  3LWU A;  2IX3 A;  1BXT A;  4NKL A;  5EJW A;  1SSO A;  1SYE A;  2KA7 A;  2RA4 A;  2A68 C;  3EFX D;  1KNE A;  3URY A;  5CMD A;  5IT9 E;  3PV0 A;  3A54 A;  1O7L A;  4HN7 A;  1GUN A;  3R2T A;  4HSV A;  2F0T A;  1EQV A;  4OO1 I;  2B2V C;  2NWG A;  5G3L D;  2CW0 D;  5COY A;  4WRD A;  1EEF D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...