2Q8IB

Pyruvate dehydrogenase kinase isoform 3 in complex with antitumor drug radicicol
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
93
structure length
93
Chain Sequence
SYPPHMQVLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKEADISAFADY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Distinct Structural Mechanisms for Inhibition of Pyruvate Dehydrogenase Kinase Isoforms by AZD7545, Dichloroacetate, and Radicicol.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 3
total genus 15
structure length 93
sequence length 93
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 2007-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2q8iB00
2BE5C 5BN3A 2D5DA 3PUVA 1E2VA 3VR6A 2E76C 2DN8A 2AUJD 3I4LA 4GZYC 2LMCB 3W3AA 2EJFC 5KNCA 2YYZA 3M4YA 5JEAG 2BA0A 4G7ZC 1HCZA 1VDZA 2E74C 3D4RA 3RLFA 1GJXA 3IFTA 2BE5D 3SDZA 4KN7C 4H13C 2PPBC 1H9MA 1VF7A 3FMCA 4IFDG 2O5JC 1BDOA 3T53B 1B9NA 3PUWA 3VR4A 2EDGA 2NN6H 5C0XG 3BDOA 1GUOA 1YNNC 2B8GA 2JXMB 2K32A 2V4DA 4TKOB 2PCFB 3OW7A 1OXVA 1OXUA 1Y8NB 4XTCS 4L8JA 1V8QA 1IW7C 4KI0A 4IQZA 2R6GA 1DD2A 1ZKOA 1HQMC 2K33A 4JBWA 4BA1I 2O5IC 1TKWB 3BG3A 4OGQC 2CW0C 4KKSA 1H9SA 5JEAH 1GUSA 5A35A 3VR3A 1IW7D 2NN6I 3FPPA 1K8OA 1Z6HA 2A69C 4RCNA 2DNEA 3A7AB 1I6VC 2KA7A 3VR2A 2A6HD 5C0XH 5K36G 3L7ZC 3MFYA 3M7NA 3P20A 1TU2B 3CRKC 3OOCA 4XIGS 1CI3M 2A69D 3I73A 3PV0A 2IT1A 2L5TA 5K36H 1CTMA 1B9MA 3QJYA 3CRLC 1A6XA 1E2ZA 1Z7TA 2JEBI 1CFMA 4H44C 1VCIA 3GD7A 2A6HC 1OXSC 4DNRB 1ONLA 3HGBA 1Q1BA 4LK1C 3AB9A 3N6RA 3H94A 3NE5B 2D62A 3T56B 4DK0A 5KNDA 1Y69U 3TZUA 4I7ZC 1IYUA 1OXTA 2EJMA 2K7VA 3DXJC 3SE0A 3T51B 3A8IE 3MXUA 1SMYC 4TQUS 2D2CC 4KHZA 1DXMA 4LJZC 3QIAA 2E75C 4BA2I 1H9RA 4OO1H 3PUXA 1PMRA 1ZYRC 1HTPA 2AUKA 1FYCA 1HPCA 2B8FA 3WDNA 4G7HC 1Q12A 2JEAI 2JE6I 1OXXK 3A8JE 1H9KA 2BDOA 2KCCA 4KMUC 4OO1G 1IYVA 1GUTA 2F1MA 5KNBA 2NN6G 1DCZA 1LABA 2A6ED 1GUGA 4DK1A 2PNRC 3I72A 3LNNA 5BN4A 3IKJA 2A68C 3OPOA 4KKUA 3D31A 4KN4C 2EJGC 2DNCA 3M85A 1Q90A 1VF5C 1K8MA 3ND9A 3EQLC 3KLRA 1LACA 1Q1EA 3A7LA 1Y8PB 4PV1C 1G291 3PUYA 2A68D 2BA1A 1H9JA 3LWUA 4KKTA 1GUNA 4JK1C 2ZT9C 3ND8A 3VR5A 1O7LA 3GQBA 3VA7A 3QG1A 4IFDH 1Y8OB 4H0LC 3A8KE 1H9SB 1FR3A 3U9SA 1GHJA 3PUZA 1YNJC 4HR7B 2Q8IB 4DNTB 1EWHA 1E2WA 1QJOA 1T5EA 2AWOA 4G7OC 2EVBA 1GHKA 5BN5A 2A6EC 1V43A 2QF7A 1O78A
chains in the Genus database with same CATH superfamily
2CVRA 4GS3A 3Q24A 4C3IB 2DN8A 4GOPA 4GZYC 2LMCB 3M4YA 5CV6A 1VQAA 1S5CD 4NP5A 3HOWH 3SDZA 3MXNB 1NY4A 1LTGD 4QB4A 1HZCA 4R4CA 2KBNA 4QCLA 1WCMH 1RTNA 3BVZA 5I2XA 3RZOH 4XTCS 2PQAB 1IW7C 2D0OA 5J39A 2ES2A 2K5WA 1DD2A 3I8ZA 5CV8A 5M3MB 3D8GA 3PIPA 5JEAH 2LFNA 1Y1VG 4IOAA 1HZ9A 3IAYA 4A3KB 5C3EG 4ZRZA 5C4ZA 1VQGA 2A6HD 1FGBD 4C3JH 3MFYA 4A3EG 5DM73 4MTNA 4FVMA 4B3SL 4ME3A 3C2PA 5E4XA 4L6TB 5K36H 1B9MA 1A6XA 1HNZL 1K83H 3VYUA 1VCIA 5C3EB 4A3GH 4EVOA 3J7ZC 1D5ZC 1CKMA 1HZAA 1PZID 1JCKB 3DEOA 1TWFH 2JA9A 4B3RQ 4X3UA 3T56B 4DK0A 2F0MA 2Z8LA 4IPHA 4DV1L 3WWVA 4JI6L 5DNFA 5C3WA 3HOZG 3FVQA 1X3PA 3S2DB 1SAPA 4BBSB 2DJGC 5E3FA 3F1ZA 1CKNA 4JBMA 3DWAA 4A4IA 3BDCA 2I5HA 5BN4A 5FLMH 5CGKA 1SNOA 4GKKL 1D6EC 1O7IA 2WB1E 3K8AA 1XJVA 2MO1A 4HJ8A 5CMDA 2K4KA 5C5LA 2Q2HA 2FFKB 1LTTD 3HKZB 4JI6Q 1XMQL 2A68D 1EY9A 1QNUA 2K01A 1GUNA 4OHJA 2VUMG 5EJWA 3EN2A 1BCPC 1IL2A 2F4VQ 4DPGA 4A3JB 3OIQA 2MHVA 1WCMG 2RSNA 1JWMD 3EROA 2DY7A 4G7OC 1SNQA 1BBWA 4RKLA 2WKDA 2OXPA 4X62L 1EOTA 4HTHA 4J1MA 1JJCB 1K83B 1XTDA 1HUNA 2L55A 5KNCA 5JEAG 1EQRA 3IFTA 4HJ9A 2B2VC 4R8NA 4DV3Q 1VQ4A 1BDOA 4C1NI 3F2DA 4NXMQ 1SYCA 1EY8A 1NR2A 1STNA 1VQFA 5CV7A 5M3FH 2EYLA 3DUZA 4DAYB 2ENBA 4J8QA 4ZQ3A 4YIJA 3OYYA 5FLXE 1S5DD 1J9OA 4CHTB 3M4OB 3SK8A 1X3EA 2A19A 4A3DB 5LMNW 4YWMA 2EQSA 1SYGA 1Y1VB 4JI8L 1I5FA 3J7AV 3L7ZC 2MGSA 3K58A 3J80i 1YJNA 1N8RC 4UP9A 2R92G 1YI2A 2LY7A 2PMZE 1EYGA 4O1NA 1ONLA 3HGBA 4IFDI 3RNUA 2CQOA 3BDLA 3AMUA 3NE5B 3EVQA 2PO4A 2HIVA 1TY0A 1EZ8A 5GQOA 1QB5D 5ELFA 2R7ZH 1TVXA 2O2LD 3I4OA 2VS1A 4K8IA 2UU9L 1QZGA 4G7HC 1EQTA 2EPBA 4YWKA 4CDEC 1AZQA 4UP7A 2B63B 3CCUA 4JYAL 2M9VA 2JA8B 3CAMA 1YHQA 4LF4Q 1JWUD 1Z9FA 1UWVA 4X6AH 2F52A 2KCTA 5EPLA 2XNAC 1EEFD 2ZTDA 2F0WA 4FF1A 3PUYA 1EIHA 1H9JA 3A54A 1EWCA 1G6ZA 2SNSA 2E5LL 1KIXA 4JI5L 1J6QA 4C1NK 1H9SB 4F88A 1Y1WG 1W2BA 1CA6A 1I4XA 5HY6A 5EPKA 4TVAB 2A6EC 4DUZQ 2F0VA 1K28A 1VQ6A 5BN3A 1NJIC 3TZDA 3UE1A 3K5OA 1YBYA 4HN7A 2EIFA 2EJFC 3W1BA 5KGUA 1HR0L 3H3VC 2VW9A 2CCZA 4KJNA 4DR4L 1AE2A 2KHSA 4YY3Q 4A3JH 1EFWA 1H9MA 2H1EA 4LF7Q 3PO2H 3PO2B 5IT9E 3BDOA 1GUOA 2K32A 2F0DA 4XQJA 4A3IH 1M4VA 2RCFA 1ET6A 1EQVA 3CMAA 2MQHA 1V1OA 1WVLA 4A3FH 4DUYL 4DAMA 3HOVH 1M1KC 1XTCD 4R4OA 1BVSA 4B9XA 1EY7A 4UPAA 2WP8J 3S2HB 1RCVD 1HZBA 3A5ZB 3OHXC 3CRLC 4DF7A 2UUAQ 2OQKA 5TSSA 2NVTB 4DNIA 4JI3Q 2NVQH 5CBAE 1HQRD 5G3LF 2WB1G 3K0YA 4K0KQ 1WFQA 1ASZA 4X65L 2BCOA 1IBMQ 4ZCKA 5BR8Q 3CPFA 1PH1A 1HPCA 3AYHB 1EIFA 4APVA 2BDOA 3GTOB 1EWIA 3NTHA 4GN3B 1YEZA 3W2DA 1GVPA 3OPOA 2EY2A 3U4ZA 2RA4A 2FINB 3DM1A 4JI2Q 3S1RB 1BXTA 5D14A 1CSPA 1W6JA 1G291 3ER0A 1PTOH 1SYFA 4KLKA 3C1EA 4X65Q 1MSHA 1O7ZA 4L5RC 4A3JG 1SJED 1LTAD 4U673 1KTKA 5IWAL 2PYKA 3U9SA 4DV2L 1ZYRD 3CC4A 1EY5A 4RFBA 1D5MC 3GTLB 5BN5A 1VQCA 5M9OA 2AQ3B 2A73B 3CCLA 2A5HA 1L0YB 1V43A 3TZUA 1V9PA 4C2MH 3STBC 3NQIA 3K0XA 2D9UA 4OXPA 1PTOF 1PDQA 1YNND 1NBWA 3S14B 2F0UA 1PRTB 1PH3A 1SR3A 1N32Q 2O5JC 3D4DA 2Q8RE 2MP1A 2L4NA 3I7FA 5EQ0A 4DKAC 4CDCC 5IE8A 1U4LA 4OEMB 1KC8C 1PRTF 3JC66 3MA2B 3G7LA 4GKKQ 5M3MG 5CV4A 1I50B 2XWBB 4K6DA 4A3DG 4OO1I 1MHWC 2HDMA 4C3HH 2C5CA 4CJ2C 3O13A 1X54A 3S1NH 2HUGA 2F03A 3VYRA 4HSVA 2L1BA 3ERSX 1PRTD 4GLXA 1Q86C 1KD1C 3OOCA 3J7YW 1PFBA 4WRDA 3PSIA 3I73A 5FLXc 4JI3L 5IGFA 1JORA 1A3TA 4X64Q 1Y14B 1C48A 4DV7L 3HOVB 4K6LA 5JJLA 1B4OA 1UE5A 3M4PA 3J81L 4P71A 2B2YC 5C0XI 4BBRH 1DOMA 4MTKA 4B3SQ 1PYBA 1SJHD 1IYUA 4XDXA 3T51B 3SE0A 1PV4A 2N55A 2Z0SA 2Y0SG 3KF6A 4DV0L 3CKIB 2UXCQ 1EYAA 3OW2A 2Q2TA 3AFPA 4PMCA 1E1OA 1SSOA 3A5UA 1EOVA 2NN6G 1S40A 5IYCH 1EUJA 3CQZH 4IPGA 2R92H 2IWHA 4DR6Q 1A2UA 3KLRA 3WOEA 1LLRD 3KK7A 2LS01 1DONA 5GROA 5IP7G 4TSSA 1B7YB 4Y7NB 4QQBX 3KLWA 4H0LC 4DR2L 3PUZA 1A8VA 1KABA 4NW2A 3S1NB 4C3IG 1EQQA 1QJOA 1X3GA 2AWOA 2WAQG 4IZ8A 1FJGL 4A3BG 1LT6D 3K6OA 4IUTA 2EY1A 4UAIA 3QB3A 2CW0D 5EKIA 5CR3A 2RHQB 2QEXA 2KCNA 2RHSB 5CYUA 1RTOA 3L0OA 2YYZA 2BOSA 2K50A 1G91A 4LMQD 4RHSA 3EBEA 4CDFC 1JE4A 3ZYYX 1K8AC 1B70B 1DZ1A 1YNNC 2UXDQ 3SVMA 2JSOA 4JI0Q 1Y1WH 4WORA 4UP8A 4KV6A 2MNAA 2H4OA 3CMEA 1QUQB 4L5SA 5C44B 1L0WA 4OWTB 1HXYD 3TDQA 2PI2E 3CHBD 1IYJB 4AIMA 3S24A 1EYCA 1M8AA 4BBRG 4BY1B 5A35A 1I4PA 2FJ2A 1IW7D 3H0GB 4X3KA 1RODA 2TSSA 2BH8A 3DMUA 3D4WA 1HRJA 2AWNA 5IY0A 1KLGD 3NTIA 1TT2A 4DUYQ 1CI3M 3GP7A 4RAUC 4A3BB 2K14A 4RMFA 3K5MA 4A3IG 1I6HB 1QG7A 4WJWA 5C3XA 4P2CB 2A6HC 2B2YA 3AU7A 2MPMA 2RVLA 5IWAQ 1WTPA 1K3BC 3S15H 2F4VL 3H91A 4LF9L 4YY3L 3QO2A 3A8IE 1BBXC 2K5HA 1G6PA 4JI2L 1GD7A 1FVIA 4KMUC 2KCMA 3M3YH 1AW7A 3BYTB 4DK1A 1WD0A 1LUZA 1EEID 4DV7Q 1JE5A 4BY7B 1I4HA 1KNAA 1U9RA 4JI7Q 4X3SA 3H15A 1XYIA 1Q1EA 3I4NH 2KHIA 4L63B 2BA1A 4POFA 2QILA 2YTYA 3R93A 5EGTA 2JA6B 4FF4A 3H6MA 4DXFA 4R1JA 1F2LA 5A2QE 2RQXA 2V1CC 1FR3A 3I4MB 4XT1B 1T5XD 4NXNL 2R93G 1EWHA 4IN3A 4OIJA 2L0CA 2N3SA 1AH9A 3CCEA 2K52A 4C3JB 1PA6A 1WTHA 2XRSD 1ENFA 3GV3A 1PZKD 2CQAA 5C4JH 4G7ZC 2BA0A 3HOZB 4R9WA 1M90C 4ZKCB 2OCEA 4ZK9B 1LM0A 1L1OA 3J7AF 2F0GA 3V05A 5FO8B 1V1PB 2IX1A 3AEVA 4YHHL 4X64L 1PVOA 4GNXC 1IBKL 3OWFA 1SE8A 1TS4A 1C0AA 2MO0A 1KLUD 5T1IA 5FOBB 1A15A 1L1OB 3I90A 3KLSA 4WJ4A 3H09A 4FO2A 4A93H 1KRTA 1D1IA 4BS9A 2KA7A 1VQ7A 4KHPQ 3PO3B 4LUOA 1PFSA 4LF5L 1VQPA 2XN9C 2UUCL 3NHHA 3GTOH 1WTQA 5M5WH 5IGGA 1A3VA 3LGJA 4K8JA 3NQTA 5LMNL 5M3MH 2ZTEA 3H94A 2BH2A 1Q81C 4Z9CB 1WTXA 4A3DH 1SN8A 1HA6A 2EJMA 3KBGA 3SHLA 2K6AA 1SMYC 2ZXRA 1KL9A 4LJZC 4K0KL 1YJWA 2E75C 4I65A 1K3RA 1L2FA 1N34Q 3IFDA 1X32A 1JC7A 2I07B 2K75A 5CC4A 3U50C 1DCZA 2R93H 1J8IA 4DR3L 1B3AA 2EJGC 4FNFA 3TS2A 1K8MA 2Z6KC 3QOJA 2F0KA 3SK5A 4PV1C 2BDNA 1HH2P 4XT3B 3PIP3 4LUZA 1U4RA 2NUCA 2XTIA 1CHQD 3VR5A 1OTCA 5C5MA 3MEHA 4HMIA 4CJ0B 2NVTH 2DGYA 3EFXD 1E0BA 1RD9D 2K1BA 1YNJC 3SK6A 4MN3A 1AE3A 1S5ED 3HOYG 1SBBB 1RL2A 4A3LH 2PW7A 1MIUA 1VQNA 2ATWA 2O4XA 1E2VA 3AFQA 2P5ZX 4RA8A 4AYBB 3MVVA 1PZJD 2CKZB 3D6WA 3KDFA 3I4LA 3VYTA 5BR8L 5M5WB 3SXHA 1GOZA 1N36L 3C3LA 5LHY1 5LMUQ 1TWFB 4XYQA 3GTPB 4KN7C 1BBUA 1CKNB 1SYEA 2PPBC 1SLJA 2WAQE 4RG1A 4K2LA 1YNXA 2EE1A 4A93B 3ZJYC 4OX9Q 1PH2A 3GTGH 1FL0A 1DGSA 4BBSH 5IYBG 2R6GA 4AQYL 4WFN3 4OWXB 4F8MA 1JB3A 1TKWB 1TS2A 3KJOA 4DR1Q 2YU9B 1STHA 1XMOL 3GTMH 1FNUA 1VQKA 4KD3A 2F0NA 5I4DA 1STAA 1R4PB 1A3UA 2F0HA 3MFGA 4IPCA 2Q2IA 3GV6A 1UNSA 4GKJL 4CDDC 3OTOQ 1F2MA 1D5XC 1XNQQ 3M9BA 2UXBL 1EY4A 3E9HA 5FJ8G 2B3GA 1ASYA 2LXKA 4ODGA 4XQNA 4JYAQ 3NXWA 3BVMA 4R4IA 1ENAA 3TS0A 3G48A 5FK9C 5ELBA 4X66Q 1KAAA 2K7VA 1DJRD 4A3MB 5FO9B 4QGUA 1I50H 1EU3A 3DWQA 3PUXA 4DXGA 2DJFC 2F0QA 3S9WA 1CZGA 1LABA 2EXDA 1YIJA 3M4QA 4IUPA 3D31A 3T13A 4FF3A 2CHBD 3S17H 2B2WA 1YITA 3UDXA 4MZ9A 3CPWA 3GTGB 1EL0A 1GUWA 3UE0A 4J6HA 5DAUA 3ND8A 2B39A 3GQBA 1BCPB 1TWCB 2F0EA 3A8KE 3OMGA 4RH6A 5M5YH 2R93B 3CC2A 1FNVA 4C3HB 2KENA 1E1TA 1I4RA 2C9OA 1AFPA 1BCPF 5EBDA 3HOYB 3TBIB 1YNJD 1T9HA 2JQOA 2EYMA 2ID0A 3KBXA 3TRZA 1QNKA 3TP5A 1CQFA 1JOKA 1SE4A 2G9HD 4RCOA 1HNXL 3B6YA 3TP8A 3RLFA 3M3YB 4DA2A 3KUPA 4JW0A 4LNQA 3FP9A 2E2DC 1XX8A 1W6KA 1D2BA 1EY0A 1HNXQ 4IUUA 2G9DA 3CXCA 4LF8L 3PUWA 2X69A 2J0TD 2M2LA 3HOWB 4PMWA 1SDFA 3K7UC 4GLVB 1ESRA 1B44D 3VDYA 2IX0A 4U68A 3SR1A 4IQZA 1JOOA 1EZ6A 3GTKH 1ZKOA 5KYLA 2PZTA 3MHBA 3TN2A 1PH6A 3EJIA 3UI2A 2UUCQ 3R3OA 1VQEA 2IX3A 4PQXA 5EPJA 1GUSA 3I55A 4JOIA 1G8ZD 3ULJA 2PW5A 2NVYH 3UDIA 1IKLA 4TRDA 4DV6Q 5E1FA 4QMGA 2F0IA 1N9WA 2NTSA 3VR2A 2JA7G 5K36G 5IGBA 3M7NA 4UY8C 2KOLA 1TIID 5GAHC 4GOPC 4KY5A 2JEBI 3JAML 3FKIH 5JAVA 3HKZE 4G57A 4JBJA 3CCSA 2R7DA 1SNDA 2WINB 1Y1WB 4A93G 3MXUA 4TQUS 3IRBA 4BWGB 4DV1Q 1U4PA 4QUCA 2QEJC 4BXXH 4HCEA 4RGNA 3RZDB 2E2IH 4B3RL 4OO1G 4RHRA 2Y0SE 3ULLA 3MXNA 2A6ED 1GUGA 1PH8A 4AQYQ 2CH4W 2PQEA 4MNOA 1G2TA 3S17B 1ICWA 2UXBQ 2FMMA 3G71A 2Y0SB 4JI1L 1I3QH 2ZM6Q 2JA5G 3RR5A 1ICFB 1JT8A 5JJZA 1X55A 5C3EH 4Y7NH 1Q7YC 4PMBA 2Q8IB 4DNTB 1T5EA 4A3EH 2QKIC 5GAGC 2J4XA 1MKHA 1IBLQ 2D5DA 4DGZA 5IT9c 4FF2A 2QA4A 3HOUB 1NTGA 1F9RA 4H13C 5D3IB 1VF7A 3RN2A 2OT2A 4X3TA 4A3MH 1MJEA 4HJAA 2JJQA 4KI0A 4EX5A 1QCBD 4BY7G 4NXNQ 2O5IC 4ALPA 3M4OH 2DNEA 2XRQD 3K81C 2CH4A 3I4MG 4DR1L 1L0XB 3H0GG 1ZXTA 2EZVA 4IUQA 1TXYA 2A74C 1CFMA 4H44C 2YU9H 3NEMA 3OIPA 1S3OA 2L12A 1D8LA 4LK1C 3F2CA 5C4HA 1SFOB 4I7ZC 3HOWG 2VL6A 4PZ7A 4DV6L 4ZUIA 1HHVA 1N36Q 3J7A5 4LF9Q 1F2ZA 3KLSX 3QIAA 4BA2I 1U4MA 3I3CA 1DM0B 1ZYRC 5AJ3L 5IGEA 2AUKA 2JEAI 3WDNA 3G6JB 3CD6A 5KNBA 3PIO3 2IPKD 2JA6G 4L5TA 3H3VH 4R4QA 3HKZG 1X6OA 2EOTA 1JWSD 4KN4C 2OQ0A 5FJ8H 3PO3H 1K0SA 3NSWA 3S1QH 4NB3A 3FRPB 5K5PA 2EXZA 2IHEA 2WIIB 4NDXA 1QILA 2RDFA 4KHVA 4PZ8A 1J5EQ 4B3ML 1TWHB 3UDFA 3V96A 3GTJB 3K7AH 2XIWA 4YCVA 4B3TL 1GHJA 3Q8DA 3SK4A 2DUDA 4HAEA 2AQ2B 3NK9A 4A3MG 3RN5A 3D3RA 1F9PA 4OWWB 3T1YQ 4YHHQ 3PQIA 3PUVA 3GTQB 4KTAA 4GNXB 2AUJD 3NP8A 3W3AA 3T16A 2QDLA 2K05A 2B2TA 4DAPA 1B3QA 3CU7A 4K5XA 5M5YB 2CWAA 3I70A 3PF5A 4QJFA 5FKAC 2R7ZG 5E4WC 3X3MA 4P75A 1TWAH 2VXWA 2F4IA 5LMNQ 4JC0A 5AFWA 2ALYB 2C35B 1CQVA 1LYLA 3A56A 4OX9L 1ML0D 2R61A 2UUBL 1CT1D 1KDCA 1C9OA 4KKSA 2R92B 1XXGA 1X65A 5COYA 4OELB 4X66L 2SEBD 2A8VA 1O7YA 1X3FA 3CCMA 4NKLA 3CRKC 3MC0B 3RZOB 2JA8H 4O0AA 4C3JG 4JI7L 3QJYA 5ELOA 1YJ9A 1HA5A 1SYDA 2GVAA 1NCVA 3ONAB 5CBEE 3GTJH 4DU9A 2JP1A 3PO3G 1D7QA 4A3GG 3EA6A 4LFCQ 2D62A 4HIOA 2K5DA 2M00A 2ZXPA 4LFBQ 2N88A 3DXJC 1N32L 1E7ZA 2CWPA 1HNWL 4ME5A 1PH7A 4G4KA 1XMOQ 1PMRA 3P1HA 1HTPA 4MHEA 3OSOA 4J15A 5HURA 1X3QA 1I6HH 3HOZH 1XWEA 2KCCA 5JVG3 1IYVA 1A0IA 1D1KA 5DLQE 3LNNA 4YWLA 2E2HH 3IKJA 4FYDA 1XNRQ 2SDFA 4DAYA 4DR3Q 5FLMG 1FD7D 3M85A 1VF5C 1RIPA 4JI0L 3EQLC 5JPNC 3A7LA 3MTSA 1JB7A 3CCVA 3DHQA 5ELEA 3S1RH 3HOVG 4GN4B 4QF4A 1SE2A 4KKTA 4JK1C 1ET9A 1O7LA 2QGQA 1IL8A 1TQOA 2VUMH 3S16H 3JAME 2WFWA 4KY7A 1ILPA 4EQ5A 2HHHQ 2BE5C 1CSQA 4IJLA 3PGZA 4LF5Q 2UXDL 3S1MB 3OWEB 2WV6D 1WJJA 4JI4L 1CM9A 3J81i 4JV5Q 1VDZA 1GJXA 1AN8A 3NWSA 2NWGA 3J80c 2EDGA 5I2YA 1S72A 2R7ZB 2E2JH 4H7BA 1IHZA 1PTOB 3K5NA 1RJTA 2JA8G 3OMCA 2IY5B 5L37A 4S3SA 2UUAL 4FDBA 3M7GA 1HQMC 2HCCA 5M3FG 1EU4A 1N34L 1II3A 2MJ8A 3GTKB 2D0PA 4LF8Q 4HMJA 4R4TA 1K9MC 2A69C 4JBKA 2L9HA 4RGMA 1IZ6A 4V0BA 3BZCA 1SXTA 5EAYA 4IJHA 2ICIA 2L5TA 2XVSA 1QE6A 1VMCA 4DR6L 3NBHA 2VQEL 4A3CH 1PTOD 4I7AA 3K57A 2F0JA 1EIGA 2KECA 1EIYB 1HFNA 3RLOA 1VQHA 2SNMA 4JCVE 3J80L 4LAAA 1IBML 3D0FA 2NBFA 3F8TA 2HIXA 5KIXA 4DR5L 1SROA 4HSPA 4UHVA 2NYZD 3E5SA 4XQQA 1LTSD 1PH4A 1N33L 2JK8A 1YHAA 2VQFL 1HR0Q 4K5WA 5IYCG 3G4SA 3PF4A 1PRTC 1YZ6A 1IBKQ 1STEA 4KKUA 3W5OA 1CUKA 4JOIC 3K5LA 1NSNS 1I4GA 4A3FG 1K8GA 1FJGQ 5IYDH 4DN4M 1VQ9A 1KXLA 2B2WC 4DR2Q 3ND9A 1VQMA 1QVCA 2OF1A 3Q6SA 2E5LQ 1N33Q 3WOFA 3LWUA 3TP7A 2N49A 3VYSA 1SRUA 5LL6X 1Y8OB 2L15A 1RF2D 3MXGA 3BJUA 4LFAL 5JPMC 4DK3C 4N9PA 1E2WA 2YTVA 2QDBA 1JMCA 2N8NA 5A2QL 3E9IA 3T4AC 3NBHB 1K0RA 2K04A 4HIKA 1O78A 3OTOL 4GKJQ 3Q0AA 1LT4D 1S4ZA 1VQLA 4ZKBB 3BS1A 3QOLA 2IW3A 5JJKA 3HRZC 3HZXA 1AP0A 3KFUA 4DR7Q 1MI2A 1VQ5A 1B53A 2VB3X 3FMCA 2NVXH 1MJCA 4LWCA 4HIDA 1G2SA 3KDFB 1VQ8A 2B8GA 4CBVA 3PO2G 1BCPD 4P73A 3OW7A 1OXVA 3PCOB 2PZWA 1V8QA 1I3QB 5FO7B 4EQPA 3TQYA 3I4NB 2X6LA 1FNWA 2H5XA 4A3CG 4BA1I 4RKBA 5HGTA 2Z4IA 2CW0C 3H3VI 5CV5A 4L5QA 1AEXA 4ABNA 5ELCA 3L9AX 5LMUL 3HP3A 1TWAB 2RDHA 5C44H 5EKLA 4HIMA 1NNXA 4JV5L 1Q8IA 4DFAA 5GADC 3C1FA 1TU2B 1KAWA 1PH5A 2A69D 4M1UB 1CTMA 1LV9A 1I94Q 3HOXB 4A3KH 2VNUD 4ZUJA 4RGTA 1HJPA 3BZKA 2HQEA 2B2VA 1HR0W 2R7FA 4NXML 3FEWX 3HG9A 4JPBW 5KNDA 1L1OC 3I91A 4FXKC 1LT5D 3W1GA 4C56C 1PTOC 3P7JA 4KHZA 1BQQT 3G6EA 1LTLA 3IL8A 2AHOB 1TWHH 4XYOA 1OXXK 4P72A 5KEEA 2KUMA 4PG3A 3I72A 1QUQA 1IKMA 1PYSB 3TREA 1E24A 2NVXB 4CJ1B 4EQNA 2DY8A 3I4NG 2AKWB 3HKSA 3QWNA 3SGIA 4DV2Q 4LFAQ 4E6IA 5IODA 1PFMA 2B2UA 2KJXA 1MD2D 1YHBA 1BNZA 3GTLH 2EY5A 3ULPA 4OL7A 1WD1A 4EGVA 4ZYSA 1JJGA 4V190 1EYDA 1XMQQ 4K5VA 4PNYA 3U9OA 5E7NA 2NZOA 4HR7B 2ZJRA 3KYHC 3NENA 2YV5A 1K73C 4LW1A 1V1PA 1DOLA 2E76C 4GLAC 4JI5Q 1SE3A 4PZ6A 1HCZA 2FXQA 5T1GA 2KEDA 4KD4A 3A0JA 3V2TA 3L2PA 1S5BD 5IGDA 3A74A 4Q0FA 3N52A 2MUYA 4A76A 1TS3A 3VR4A 2NN6H 4X62Q 3R8BA 2V4DA 3DWPA 1JICA 5EKKA 4L8JA 4A3KG 2K33A 5EBCA 5FLXL 5GAEC 4Q5VA 2NVQB 3S14H 1IXRA 3NTKA 3CQZB 1X9NA 4A3EB 2UU9Q 4O42A 4R8IA 4DR7L 5C4XB 1A2TA 5DEHA 1QWYA 2WACA 4A3IB 4C3HG 4KY6A 2Q8TA 4LFCL 1Q3LA 3P20A 2F0PA 2HDLA 4XIGS 2IJ0A 4A3BH 3PV0A 2B63H 5C6AA 5JJIA 2RCNA 4BY1G 1WTVA 5C4JB 2Z1CA 4IFDJ 1Q1BA 1SNMA 2NVYB 1JJ2A 2ZJPA 2ZXOA 2F0TA 1Y69U 4CKBA 1OXTA 2PI2A 2PQAA 3JAMi 5ELNA 4DR4Q 4EQOA 3URYA 1BKBA 2F0SA 2LSSA 5I6YA 1UE7A 3HOXH 2JE6I 4F7XA 2F3VA 1TR5A 3RLNA 1BR9A 3E0EA 3GTMB 1UEAB 2B2UC 1I94L 1LT3D 1RDPD 3MEFA 1B50A 4UDUC 4XXEA 1KQSA 3S1MH 1QOHA 4DR5Q 1KDBA 1NE3A 2AMCB 2E2IB 1NUCA 3E6ZX 1SYBA 1G51A 2FHTA 1SMYD 4ILWA 1LO5D 5IP7H 1KDAA 2EYHA 2Z6BA 3HFZB 4N8FA 3C46A 4YCUA 4A3LG 2ZTCA 1H95A 2VQEQ 2PMZB 2VUMB 1GHKA 4A75A 1F77A 3L3OC 4C3IH 2J7ZA 2Z4HA 2VY3A 5IYDG 2EYJA 1GM5A 2F3WA 2KHJA 4B3MQ 4N8X1 1JOQA 2KVMA 2E74C 1CKOA 4DV3L 3TSSA 4ID6A 3HEJA 3KF8B 4IFDG 4IUNA 4GN5A 4LUVA 3T53B 5F2DA 1B9NA 2E2HB 2IL8A 2PZUA 4GOPB 3ERQA 4BBSG 4TKOB 1ILQA 2PCFB 4GNXA 1OO9B 1OXUA 2B63G 4P74A 4LF6L 3F2UA 3S2HH 3K59A 2OTJA 1Q46A 2VB2X 2NZHA 1DOKA 4JBWA 1F9QA 1LTBD 4QY7A 3BG3A 3LX0A 4ULLA 1K8OA 3P75A 4Y52H 4BBRB 4A3FB 1Z47A 3S16B 1C8CA 2KEEA 1GKHA 1NMGA 3A7AB 1UE1A 4MIUA 1VQDA 4JI4Q 3CCQA 4QL5A 1VQOA 3FHWA 1C7YA 4OONA 3F2BA 2KQ3A 2E8GA 3HOXG 1Z7TA 4DV5Q 2Z9HA 2XGTA 3GD7A 2EYFA 1EFID 4POGA 4F87A 1XNQL 3AB9A 2QCPX 5IGCA 3BU2A 5KRUA 3TEHB 4AYBE 5C4XH 1VQJA 2YTXA 4HJ7A 3KF6B 5JVH3 2CFMA 4LFBL 1VS0A 3UDGA 4JG2A 4ZAIA 5C44G 1JQYD 3CC7A 1FYCA 3NPPA 2ZM6L 4JI1Q 3AQQA 5DM63 4NPSA 4YCWA 1H9KA 3CP0A 5LL6S 1PYWD 5JEAJ 2Z6KA 3K7AB 3I2ZA 2DNCA 4LF4L 5IYBH 3ICEA 1CZWA 1STYA 3R2TA 2UXCL 1XPUA 4DV0Q 1B2TA 1S5FD 1DYQA 2I5MX 2X6GA 4HEDA 4O2DA 4LF7L 3S15B 3GO5A 2JA5B 2LKVA 4C2MB 3X3NA 4HCSA 2ASBA 4FXGC 3VA7A 2RBMA 3S2DH 5C0XJ 4IFDH 4OIKA 1PHJA 1GXDC 5CORA 2FMCA 3HOUH 3QR8A 2A1AA 2E2JB 4DUZL 2ICEC 3A55A 2IHFA 1WCMB 2EVBA 5IOCA 1XPRA 1V1QA 3RUZA 2NB0A 1HFGA 1YVCA 5G3LD 2HQLA 5IP9G 4IUVA 3D6CA 1F9SA 3BVGA 4H02A 2K5VA 4A3GB 2VQFQ 2B2TC 1C4QA 3KOJA 1KNEA 4IALA 4AH6A 1A62A 1B8AA 3U58A 3RZDH 2BE5D 1WYDA 3GDEA 4KK7A 1W3SA 3TMEA 1HTLD 5M3FB 2JXMB 2RKSA 1Y8NB 1R9TB 1O80A 2HHHL 4CKCA 1UE6A 1GO3E 2AQ1B 1CHPD 3GTQH 4DK6C 5D3DA 5ISRA 2N78A 1SNPA 3FKIB 4IPDA 1H9SA 5C4XG 1HUMA 1KRSA 1J5EL 5KYIA 4FP5D 1SNCA 2JA7H 2K03A 2G5DA 3LWEA 5HGQA 1SMXA 5C0XH 4IURA 1XPOA 1VQIA 2QW7A 3FKIG 2IT1A 4CKEA 1QVFA 4QIWB 1OXSC 4NMZA 5ELDA 4DNRB 3RMHA 3J81E 3CW2C 4N9TA 1ESFA 1SEBD 2HCIA 3TP6A 3DEPA 3U4VA 2K28A 4AYBG 1U0LA 1BUVT 3PMFA 4K2KA 4DAVA 1HNWQ 4KHPL 4JI8Q 3NBIA 3ITPA 2OTLA 2RDGA 2D2CC 3CF5A 4IO9A 4DV4L 1H9RA 1I4QA 4HJ5A 4OO1H 3KJPA 1RKNA 1TWGB 5J3BA 3A8JE 3T1HL 1P16A 1CK1A 2F1MA 3HOUG 3NWTA 2PNRC 4BY1H 1BO0A 5I6WA 4KJOA 2F0OA 1Q90A 5IP9H 3NUCA 3J81c 5AJ3Q 2JA5H 2Q2UA 5J1ZA 1Y8PB 1WTOA 1MSGA 1EY6A 5M5XB 2OWOA 3Q23A 3R2IA 1ENCA 2EY6A 4M8AA 1FGUA 3QG1A 5IIFA 1TWCH 2JYOA 3MXPA 2I5LX 4RGOS 2HD3A 1NMFA 2JA7B 3STBD 3RD4A 1XNRL 1TY2A 3J81j 1HNZQ 1BOSA 2QF7A 2EYPA 3HOYH 2JN4A 3VR6A 1MBYA 1NR4A 2WB1B 3CCRA 1R9TH 2RSOA 3D4RA 5NUCA 3JAMc 2I46A 3MZ5A 1LTRD 5J22A 5C0XG 4WJ3M 2NZ1D 1KHIA 1BF4A 1P8LA 4BXXG 1QZHA 1WTWA 2GVBA 3CCJA 1A63A 1TS5A 3PIOA 3Q22A 2RF4A 5I9OA 3NELA 3T1HQ 4OGQC 4RWSC 1F2YA 4B3TQ 4ZLTF 3VR3A 2NTTA 2NN6I 3J80E 2GN5A 3FPPA 1Z6HA 4RCNA 1I6VC 3I4MH 1JR0D 3BZDB 3HS0C 1UAPA 1CA5A 3E0JA 1PXUA 2UUBQ 2R3ZA 1IBLL 3E3XA 4IOCA 1MGSA 4FXDA 1QVGA 3KF8A 2MFIA 1E2ZA 4K14A 2HT1A 3N6RA 2SOBA 1Y1VH 3MAQA 2B29A 1SFOH 1LTID 1AZPA 1R4QB 3DM3A 1U5KA 4DV4Q 2XSCA 1E3PA 3DLLA 3S1QB 3K80C 1VQBA 1DXMA 3VA5A 1UEBA 1B1ZA 3EIVA 5H1SE 1PLFA 2B8FA 3SEBA 2F3IA 1Q12A 2JA6H 2K5NA 3T1YL 2TMPA 1GUTA 2EYOA 4CGYB 3BYYB 5M5XH 1STGA 5IT9L 4DV5L 2A68C 3FPUB 2XWJB 1Q82C 2L11A 1VMPA 4BY7H 2F0FA 1LACA 1ZEQX 4JVZA 2WAQB 4QIWE 1WTRA 2K5QA 1RHPA 2ZJQA 5D65A 2GA4B 2OEOA 4B08A 1PH9A 2ZT9C 2PNHA 2VZAA 2WKCA 1WOCA 1TWGH 5CV9A 3FDTA 5I9PA 1UUPA 1PFNA 1NAPA 3GTPH 1X56A 2I0QA 1WI5A 4QUFA 1E22A 1Q8KA 3MWYW 4B9WA 3H0GH 1STBA 5JOBA 4LF6Q 3I56A 2F0LA 2LXJA
chains in the Genus database with same CATH topology
2CVRA 3Q24A 4C3IB 2DN8A 4GZYC 2LMCB 3M4YA 5CV6A 1S5CD 4NP5A 3SDZA 1LTGD 4QB4A 4QCLA 1RTNA 3BVZA 5I2XA 4XTCS 1IW7C 5J39A 2K5WA 1DD2A 3I8ZA 5CV8A 5M3MB 3D8GA 5JEAH 2LFNA 3IAYA 4A3KB 4ZRZA 5C4ZA 2A6HD 1FGBD 3MFYA 5DM73 4FVMA 3C2PA 5E4XA 4L6TB 5K36H 1B9MA 1A6XA 3VYUA 1VCIA 5C3EB 4EVOA 1D5ZC 1PZID 1JCKB 3DEOA 4X3UA 3T56B 4DK0A 2F0MA 2Z8LA 5DNFA 5C3WA 3FVQA 1X3PA 3S2DB 1SAPA 4BBSB 5E3FA 3DWAA 3BDCA 5BN4A 5CGKA 1SNOA 1D6EC 5CMDA 5C5LA 2FFKB 1LTTD 3HKZB 2A68D 1EY9A 1QNUA 2K01A 1GUNA 4OHJA 5EJWA 1BCPC 4A3JB 3OIQA 2MHVA 2RSNA 1JWMD 3EROA 2DY7A 4G7OC 1SNQA 4RKLA 2WKDA 2OXPA 1EOTA 4HTHA 4J1MA 1K83B 1HUNA 2L55A 5KNCA 5JEAG 3IFTA 2B2VC 4R8NA 1BDOA 4C1NI 1SYCA 1EY8A 1NR2A 1STNA 5CV7A 2EYLA 3DUZA 2ENBA 4J8QA 4ZQ3A 4YIJA 5FLXE 1S5DD 1J9OA 4CHTB 3M4OB 3SK8A 4A3DB 1SYGA 1Y1VB 3J7AV 3L7ZC 2MGSA 3K58A 2LY7A 4O1NA 1ONLA 3HGBA 4IFDI 3AMUA 3BDLA 3NE5B 3EVQA 2PO4A 1TY0A 1EZ8A 1QB5D 5ELFA 1TVXA 2O2LD 4K8IA 4G7HC 1EQTA 2EPBA 1AZQA 2B63B 2M9VA 2JA8B 1JWUD 5EPLA 2XNAC 1EEFD 2F0WA 4FF1A 3PUYA 1EIHA 1H9JA 3A54A 1EWCA 1G6ZA 2SNSA 4C1NK 1H9SB 4F88A 1CA6A 1I4XA 5EPKA 2A6EC 2F0VA 5BN3A 3TZDA 3K5OA 4HN7A 2EJFC 5KGUA 3H3VC 4KJNA 2KHSA 1H9MA 2H1EA 3PO2B 5IT9E 3BDOA 1GUOA 2K32A 2F0DA 4XQJA 1M4VA 1ET6A 1EQVA 1V1OA 1WVLA 1XTCD 4B9XA 1EY7A 2WP8J 3S2HB 1RCVD 3OHXC 3CRLC 4DF7A 2NVTB 5TSSA 5CBAE 1HQRD 5G3LF 3K0YA 2BCOA 1HPCA 2BDOA 3GTOB 3NTHA 3W2DA 3OPOA 2EY2A 2RA4A 2FINB 3DM1A 3S1RB 1BXTA 5D14A 1W6JA 1G291 1PTOH 1SYFA 3C1EA 1MSHA 1O7ZA 1SJED 1LTAD 4U673 1KTKA 2PYKA 3U9SA 1ZYRD 1EY5A 4RFBA 1D5MC 3GTLB 5BN5A 5M9OA 2AQ3B 2A73B 2A5HA 1L0YB 1V43A 3TZUA 3NQIA 2D9UA 1PTOF 1PDQA 1YNND 3S14B 2F0UA 1PRTB 2O5JC 3D4DA 2Q8RE 2MP1A 2L4NA 5EQ0A 1U4LA 1PRTF 3MA2B 3G7LA 5CV4A 1I50B 2XWBB 4K6DA 4OO1I 2HDMA 4CJ2C 2C5CA 3O13A 2HUGA 2F03A 3VYRA 4HSVA 2L1BA 1PRTD 3OOCA 3J7YW 1PFBA 4WRDA 3I73A 5IGFA 1JORA 1A3TA 1C48A 3HOVB 4K6LA 1B4OA 3J81L 2B2YC 5C0XI 1DOMA 1SJHD 1IYUA 4XDXA 3T51B 3SE0A 2N55A 3CKIB 1EYAA 4PMCA 1SSOA 2NN6G 2IWHA 1A2UA 3KLRA 3WOEA 1LLRD 3KK7A 2LS01 1DONA 4TSSA 4Y7NB 4H0LC 3PUZA 1KABA 4NW2A 3S1NB 4C3IG 1QJOA 2AWOA 4IZ8A 1LT6D 3K6OA 4IUTA 4UAIA 2EY1A 3QB3A 2CW0D 5EKIA 5CR3A 2KCNA 5CYUA 1RTOA 2YYZA 2BOSA 1G91A 4LMQD 4RHSA 1JE4A 3ZYYX 1DZ1A 1YNNC 3SVMA 2JSOA 4WORA 4KV6A 2H4OA 5C44B 1HXYD 3TDQA 3CHBD 1EYCA 1M8AA 4BY1B 5A35A 1I4PA 2FJ2A 1IW7D 3H0GB 4X3KA 1RODA 2TSSA 3DMUA 3D4WA 1HRJA 2AWNA 1KLGD 3NTIA 1TT2A 1CI3M 3GP7A 4RAUC 4A3BB 3K5MA 1I6HB 1QG7A 4WJWA 5C3XA 4P2CB 2A6HC 2B2YA 3AU7A 2MPMA 2RVLA 1WTPA 3H91A 3QO2A 3A8IE 1BBXC 4KMUC 1AW7A 3BYTB 4DK1A 1WD0A 1EEID 4BY7B 1I4HA 1KNAA 1U9RA 4X3SA 1XYIA 1Q1EA 4L63B 2BA1A 2QILA 3R93A 5EGTA 2JA6B 4FF4A 3H6MA 4DXFA 1F2LA 5A2QE 2RQXA 1FR3A 3I4MB 4XT1B 1T5XD 1EWHA 4IN3A 4OIJA 2L0CA 4C3JB 2XRSD 1ENFA 3GV3A 1PZKD 2CQAA 4G7ZC 2BA0A 3HOZB 4R9WA 4ZKCB 4ZK9B 3J7AF 2F0GA 3V05A 5FO8B 1V1PB 2IX1A 3OWFA 1TS4A 1KLUD 5T1IA 5FOBB 1A15A 3I90A 3KLSA 3H09A 4FO2A 1D1IA 4BS9A 2KA7A 3PO3B 2XN9C 3NHHA 1WTQA 5IGGA 1A3VA 4K8JA 3NQTA 3H94A 4Z9CB 1WTXA 1HA6A 2EJMA 3KBGA 3SHLA 2K6AA 1SMYC 2ZXRA 4LJZC 2E75C 4I65A 3IFDA 1X32A 1JC7A 2I07B 5CC4A 1DCZA 1J8IA 1B3AA 2EJGC 4FNFA 1K8MA 3QOJA 2F0KA 3SK5A 4PV1C 2BDNA 4XT3B 3PIP3 1U4RA 2NUCA 1CHQD 3VR5A 5C5MA 3MEHA 4HMIA 4CJ0B 3EFXD 1E0BA 1RD9D 2K1BA 1YNJC 3SK6A 4MN3A 1S5ED 1SBBB 2PW7A 2O4XA 1E2VA 4RA8A 4AYBB 3MVVA 1PZJD 3D6WA 3VYTA 3I4LA 5M5WB 3SXHA 1GOZA 3C3LA 5LHY1 1TWFB 4XYQA 3GTPB 4KN7C 1SYEA 2PPBC 4K2LA 2EE1A 4A93B 2R6GA 4WFN3 4F8MA 1JB3A 1TKWB 1TS2A 2YU9B 1STHA 1FNUA 4KD3A 2F0NA 5I4DA 1STAA 1R4PB 1A3UA 2F0HA 3MFGA 3GV6A 1UNSA 1F2MA 1D5XC 1EY4A 4ODGA 4XQNA 3NXWA 3BVMA 1ENAA 5FK9C 5ELBA 1KAAA 2K7VA 1DJRD 4A3MB 5FO9B 1EU3A 3DWQA 3PUXA 4DXGA 2F0QA 3S9WA 1CZGA 1LABA 4IUPA 3D31A 3T13A 4FF3A 2CHBD 2B2WA 3GTGB 1EL0A 1GUWA 4J6HA 5DAUA 3ND8A 2B39A 3GQBA 1BCPB 1TWCB 2F0EA 3A8KE 3OMGA 4RH6A 2R93B 1FNVA 4C3HB 1I4RA 2C9OA 1AFPA 1BCPF 5EBDA 3HOYB 3TBIB 1YNJD 2EYMA 2ID0A 3KBXA 1QNKA 3TP5A 1CQFA 1JOKA 1SE4A 2G9HD 4RCOA 3TP8A 3RLFA 3M3YB 4DA2A 3KUPA 2E2DC 1XX8A 1W6KA 1D2BA 1EY0A 4IUUA 2G9DA 3PUWA 2X69A 2J0TD 2M2LA 3HOWB 4PMWA 1SDFA 1ESRA 1B44D 2IX0A 4U68A 3SR1A 4IQZA 1JOOA 1EZ6A 1ZKOA 5KYLA 2PZTA 3MHBA 3TN2A 3EJIA 3UI2A 3R3OA 2IX3A 4PQXA 5EPJA 1GUSA 1G8ZD 2PW5A 1IKLA 4TRDA 5E1FA 4QMGA 2F0IA 3VR2A 2NTSA 5K36G 5IGBA 3M7NA 2KOLA 1TIID 4KY5A 2JEBI 3JAML 5JAVA 4G57A 1SNDA 2WINB 1Y1WB 3MXUA 4TQUS 4BWGB 1U4PA 4QUCA 2QEJC 4HCEA 4RGNA 3RZDB 4OO1G 4RHRA 3MXNA 2A6ED 1GUGA 2PQEA 1G2TA 3S17B 1ICWA 2FMMA 2Y0SB 5JJZA 4PMBA 2Q8IB 4DNTB 1T5EA 2QKIC 2J4XA 2D5DA 4DGZA 4FF2A 3HOUB 1F9RA 4H13C 5D3IB 1VF7A 2OT2A 4X3TA 4KI0A 1QCBD 2O5IC 2DNEA 2XRQD 1L0XB 1ZXTA 2EZVA 4IUQA 2A74C 1CFMA 4H44C 3OIPA 2L12A 4LK1C 5C4HA 1SFOB 4I7ZC 4ZUIA 1HHVA 1F2ZA 3KLSX 3QIAA 4BA2I 1U4MA 3I3CA 1DM0B 1ZYRC 5IGEA 2AUKA 2JEAI 3WDNA 3G6JB 5KNBA 3PIO3 2IPKD 2EOTA 1JWSD 4KN4C 3NSWA 3FRPB 5K5PA 2EXZA 2WIIB 4NDXA 1QILA 2RDFA 4KHVA 1TWHB 3V96A 3GTJB 2XIWA 1GHJA 3SK4A 4HAEA 2AQ2B 3NK9A 3D3RA 1F9PA 3PUVA 3GTQB 4KTAA 2AUJD 3NP8A 3W3AA 3T16A 2K05A 2B2TA 4DAPA 3CU7A 4K5XA 5M5YB 3I70A 5FKAC 5E4WC 3X3MA 2VXWA 2F4IA 5AFWA 1CQVA 3A56A 1ML0D 2R61A 1CT1D 1KDCA 4KKSA 2R92B 1XXGA 5COYA 2SEBD 1O7YA 4NKLA 3CRKC 3MC0B 3RZOB 4C3JG 3QJYA 1HA5A 1SYDA 1NCVA 3ONAB 5CBEE 4DU9A 2JP1A 3EA6A 2D62A 2K5DA 2M00A 2ZXPA 2N88A 3DXJC 4ME5A 4G4KA 1PMRA 3P1HA 1HTPA 4MHEA 3OSOA 5HURA 1X3QA 1XWEA 2KCCA 5JVG3 1IYVA 1D1KA 3LNNA 3IKJA 4FYDA 2SDFA 4DAYA 1FD7D 3M85A 1VF5C 3EQLC 5JPNC 3A7LA 3MTSA 3DHQA 5ELEA 4QF4A 1SE2A 4KKTA 4JK1C 1ET9A 1O7LA 1IL8A 1TQOA 3JAME 4KY7A 1ILPA 2BE5C 3S1MB 3OWEB 2WV6D 1CM9A 1VDZA 1GJXA 1AN8A 3NWSA 2NWGA 2EDGA 5I2YA 2R7ZB 4H7BA 1IHZA 1PTOB 3K5NA 1RJTA 3OMCA 4S3SA 3M7GA 1HQMC 2HCCA 1EU4A 1II3A 2MJ8A 3GTKB 4HMJA 2A69C 2L9HA 4RGMA 4V0BA 1SXTA 2ICIA 2L5TA 2XVSA 1QE6A 1VMCA 3NBHA 1PTOD 3K57A 2F0JA 1EIGA 2KECA 1HFNA 2SNMA 3J80L 4LAAA 2NBFA 5KIXA 4HSPA 2NYZD 3E5SA 4XQQA 1LTSD 4K5WA 1PRTC 1STEA 4KKUA 3K5LA 1NSNS 1I4GA 4DN4M 2B2WC 3ND9A 2OF1A 3Q6SA 3WOFA 3LWUA 3TP7A 3VYSA 5LL6X 1Y8OB 1RF2D 3MXGA 5JPMC 4N9PA 1E2WA 2QDBA 5A2QL 3T4AC 2K04A 1O78A 3Q0AA 1LT4D 1S4ZA 4ZKBB 3BS1A 3QOLA 2IW3A 3HRZC 3HZXA 1AP0A 1MI2A 1B53A 2VB3X 3FMCA 1G2SA 2B8GA 4CBVA 1BCPD 3OW7A 1OXVA 2PZWA 1V8QA 1I3QB 5FO7B 4EQPA 3I4NB 2X6LA 1FNWA 4BA1I 4RKBA 5HGTA 2Z4IA 2CW0C 5CV5A 1AEXA 4ABNA 5ELCA 3L9AX 3HP3A 1TWAB 2RDHA 5EKLA 1Q8IA 4DFAA 3C1FA 1TU2B 2A69D 4M1UB 1CTMA 1LV9A 3HOXB 2VNUD 4ZUJA 4RGTA 2HQEA 2B2VA 3FEWX 3HG9A 5KNDA 3I91A 4FXKC 1LT5D 4C56C 1PTOC 3P7JA 4KHZA 1BQQT 3IL8A 4XYOA 1OXXK 5KEEA 2KUMA 3I72A 1IKMA 2NVXB 4CJ1B 4EQNA 2DY8A 3QWNA 4E6IA 5IODA 1PFMA 2B2UA 2KJXA 1MD2D 1BNZA 2EY5A 4OL7A 1WD1A 4EGVA 4ZYSA 4V190 1EYDA 4K5VA 4PNYA 3U9OA 4HR7B 1V1PA 1DOLA 2E76C 1SE3A 1HCZA 5T1GA 2KEDA 4KD4A 3V2TA 1S5BD 5IGDA 4Q0FA 3N52A 2MUYA 1TS3A 3VR4A 2NN6H 3R8BA 2V4DA 3DWPA 1JICA 5EKKA 4L8JA 2K33A 5EBCA 5FLXL 4Q5VA 2NVQB 3NTKA 3CQZB 4A3EB 4O42A 4R8IA 5C4XB 1A2TA 5DEHA 1QWYA 2WACA 4A3IB 4C3HG 4KY6A 2Q8TA 1Q3LA 3P20A 2F0PA 2HDLA 4XIGS 2IJ0A 3PV0A 5C6AA 1WTVA 5C4JB 2Z1CA 4IFDJ 1Q1BA 1SNMA 2NVYB 2ZXOA 2F0TA 1Y69U 4CKBA 1OXTA 4EQOA 3URYA 2F0SA 5I6YA 2JE6I 4F7XA 2F3VA 1TR5A 1BR9A 3GTMB 1UEAB 2B2UC 1LT3D 1RDPD 1B50A 4UDUC 4XXEA 1QOHA 1KDBA 2E2IB 1NUCA 3E6ZX 1SYBA 2FHTA 1SMYD 4ILWA 1LO5D 1KDAA 2EYHA 3C46A 2VUMB 2PMZB 1GHKA 1F77A 3L3OC 2J7ZA 2Z4HA 2EYJA 2F3WA 1JOQA 2KVMA 2E74C 3TSSA 4ID6A 3HEJA 4IFDG 4IUNA 3T53B 5F2DA 1B9NA 2E2HB 2IL8A 2PZUA 3ERQA 4TKOB 1ILQA 2PCFB 1OO9B 1OXUA 3F2UA 3K59A 2VB2X 1DOKA 4JBWA 1F9QA 1LTBD 3BG3A 3LX0A 4ULLA 1K8OA 3P75A 4BBRB 4A3FB 1Z47A 3S16B 1C8CA 2KEEA 3A7AB 4MIUA 2KQ3A 1Z7TA 3GD7A 2EYFA 1EFID 4F87A 3AB9A 2QCPX 5IGCA 5KRUA 5JVH3 4ZAIA 1JQYD 1FYCA 3NPPA 5DM63 1H9KA 5LL6S 1PYWD 5JEAJ 3K7AB 2DNCA 1CZWA 1STYA 3R2TA 1B2TA 1S5FD 1DYQA 2X6GA 3S15B 4HEDA 3GO5A 2JA5B 2LKVA 4C2MB 3X3NA 4HCSA 4FXGC 3VA7A 2RBMA 5C0XJ 4IFDH 4OIKA 1GXDC 5CORA 2FMCA 2E2JB 2ICEC 3A55A 1WCMB 2EVBA 5IOCA 3RUZA 2NB0A 1HFGA 5G3LD 4IUVA 3D6CA 1F9SA 3BVGA 4A3GB 2B2TC 1C4QA 1KNEA 4IALA 2BE5D 4KK7A 3TMEA 1HTLD 5M3FB 2JXMB 2RKSA 1Y8NB 1R9TB 1O80A 4CKCA 2AQ1B 1CHPD 5D3DA 5ISRA 1SNPA 3FKIB 1H9SA 1HUMA 5KYIA 4FP5D 1SNCA 2K03A 3LWEA 5C0XH 4IURA 2IT1A 4CKEA 4QIWB 1OXSC 4NMZA 5ELDA 4DNRB 3RMHA 3J81E 4N9TA 1ESFA 1SEBD 2HCIA 3TP6A 3DEPA 2K28A 1BUVT 3PMFA 4K2KA 4DAVA 3NBIA 3ITPA 2RDGA 2D2CC 1H9RA 1I4QA 4OO1H 1RKNA 1TWGB 3A8JE 1CK1A 2F1MA 3NWTA 2PNRC 1BO0A 5I6WA 4KJOA 2F0OA 1Q90A 3NUCA 5J1ZA 1Y8PB 1WTOA 1MSGA 1EY6A 5M5XB 3Q23A 3R2IA 1ENCA 2EY6A 4M8AA 3QG1A 5IIFA 2JYOA 3MXPA 4RGOS 2JA7B 3RD4A 1TY2A 1BOSA 2QF7A 2EYPA 3VR6A 1MBYA 1NR4A 2WB1B 2RSOA 3D4RA 5NUCA 2I46A 3MZ5A 1LTRD 5J22A 5C0XG 2NZ1D 1BF4A 1WTWA 3Q22A 1TS5A 5I9OA 4OGQC 4RWSC 1F2YA 4ZLTF 3VR3A 2NTTA 2NN6I 3J80E 3FPPA 1Z6HA 4RCNA 1I6VC 1JR0D 3BZDB 3HS0C 1UAPA 1CA5A 3E0JA 1PXUA 2R3ZA 1MGSA 4FXDA 3KF8A 1E2ZA 4K14A 3N6RA 2SOBA 3MAQA 1AZPA 1LTID 1R4QB 2XSCA 3S1QB 1DXMA 3VA5A 1B1ZA 1PLFA 2B8FA 3SEBA 1Q12A 2TMPA 1GUTA 2EYOA 4CGYB 3BYYB 1STGA 5IT9L 2A68C 3FPUB 2XWJB 2L11A 1VMPA 2F0FA 1LACA 1ZEQX 2WAQB 1WTRA 2K5QA 1RHPA 5D65A 2GA4B 2OEOA 4B08A 2ZT9C 2WKCA 5CV9A 3FDTA 5I9PA 1UUPA 1PFNA 1NAPA 4QUFA 3MWYW 4B9WA 1STBA 5JOBA 2F0LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BE5 C;  5BN3 A;  2D5D A;  3PUV A;  1E2V A;  3VR6 A;  2E76 C;  2DN8 A;  2AUJ D;  3I4L A;  4GZY C;  2LMC B;  3W3A A;  2EJF C;  5KNC A;  2YYZ A;  3M4Y A;  5JEA G;  2BA0 A;  4G7Z C;  1HCZ A;  1VDZ A;  2E74 C;  3D4R A;  3RLF A;  1GJX A;  3IFT A;  2BE5 D;  3SDZ A;  4KN7 C;  4H13 C;  2PPB C;  1H9M A;  1VF7 A;  3FMC A;  4IFD G;  2O5J C;  1BDO A;  3T53 B;  1B9N A;  3PUW A;  3VR4 A;  2EDG A;  2NN6 H;  5C0X G;  3BDO A;  1GUO A;  1YNN C;  2B8G A;  2JXM B;  2K32 A;  2V4D A;  4TKO B;  2PCF B;  3OW7 A;  1OXV A;  1OXU A;  1Y8N B;  4XTC S;  4L8J A;  1V8Q A;  1IW7 C;  4KI0 A;  4IQZ A;  2R6G A;  1DD2 A;  1ZKO A;  1HQM C;  2K33 A;  4JBW A;  4BA1 I;  2O5I C;  1TKW B;  3BG3 A;  4OGQ C;  2CW0 C;  4KKS A;  1H9S A;  5JEA H;  1GUS A;  5A35 A;  3VR3 A;  1IW7 D;  2NN6 I;  3FPP A;  1K8O A;  1Z6H A;  2A69 C;  4RCN A;  2DNE A;  3A7A B;  1I6V C;  2KA7 A;  3VR2 A;  2A6H D;  5C0X H;  5K36 G;  3L7Z C;  3MFY A;  3M7N A;  3P20 A;  1TU2 B;  3CRK C;  3OOC A;  4XIG S;  1CI3 M;  2A69 D;  3I73 A;  3PV0 A;  2IT1 A;  2L5T A;  5K36 H;  1CTM A;  1B9M A;  3QJY A;  3CRL C;  1A6X A;  1E2Z A;  1Z7T A;  2JEB I;  1CFM A;  4H44 C;  1VCI A;  3GD7 A;  2A6H C;  1OXS C;  4DNR B;  1ONL A;  3HGB A;  1Q1B A;  4LK1 C;  3AB9 A;  3N6R A;  3H94 A;  3NE5 B;  2D62 A;  3T56 B;  4DK0 A;  5KND A;  1Y69 U;  3TZU A;  4I7Z C;  1IYU A;  1OXT A;  2EJM A;  2K7V A;  3DXJ C;  3SE0 A;  3T51 B;  3A8I E;  3MXU A;  1SMY C;  4TQU S;  2D2C C;  4KHZ A;  1DXM A;  4LJZ C;  3QIA A;  2E75 C;  4BA2 I;  1H9R A;  4OO1 H;  3PUX A;  1PMR A;  1ZYR C;  1HTP A;  2AUK A;  1FYC A;  1HPC A;  2B8F A;  3WDN A;  4G7H C;  1Q12 A;  2JEA I;  2JE6 I;  1OXX K;  3A8J E;  1H9K A;  2BDO A;  2KCC A;  4KMU C;  4OO1 G;  1IYV A;  1GUT A;  2F1M A;  5KNB A;  2NN6 G;  1DCZ A;  1LAB A;  2A6E D;  1GUG A;  4DK1 A;  2PNR C;  3I72 A;  3LNN A;  5BN4 A;  3IKJ A;  2A68 C;  3OPO A;  4KKU A;  3D31 A;  4KN4 C;  2EJG C;  2DNC A;  3M85 A;  1Q90 A;  1VF5 C;  1K8M A;  3ND9 A;  3EQL C;  3KLR A;  1LAC A;  1Q1E A;  3A7L A;  1Y8P B;  4PV1 C;  1G29 1;  3PUY A;  2A68 D;  2BA1 A;  1H9J A;  3LWU A;  4KKT A;  1GUN A;  4JK1 C;  2ZT9 C;  3ND8 A;  3VR5 A;  1O7L A;  3GQB A;  3VA7 A;  3QG1 A;  4IFD H;  1Y8O B;  4H0L C;  3A8K E;  1H9S B;  1FR3 A;  3U9S A;  1GHJ A;  3PUZ A;  1YNJ C;  4HR7 B;  2Q8I B;  4DNT B;  1EWH A;  1E2W A;  1QJO A;  1T5E A;  2AWO A;  4G7O C;  2EVB A;  1GHK A;  5BN5 A;  2A6E C;  1V43 A;  2QF7 A;  1O78 A; 
#chains in the Genus database with same CATH topology
 2CVR A;  4GS3 A;  3Q24 A;  4C3I B;  2DN8 A;  4GOP A;  4GZY C;  2LMC B;  3M4Y A;  5CV6 A;  1VQA A;  1S5C D;  4NP5 A;  3HOW H;  3SDZ A;  3MXN B;  1NY4 A;  1LTG D;  4QB4 A;  1HZC A;  4R4C A;  2KBN A;  4QCL A;  1WCM H;  1RTN A;  3BVZ A;  5I2X A;  3RZO H;  4XTC S;  2PQA B;  1IW7 C;  2D0O A;  5J39 A;  2ES2 A;  2K5W A;  1DD2 A;  3I8Z A;  5CV8 A;  5M3M B;  3D8G A;  3PIP A;  5JEA H;  2LFN A;  1Y1V G;  4IOA A;  1HZ9 A;  3IAY A;  4A3K B;  5C3E G;  4ZRZ A;  5C4Z A;  1VQG A;  2A6H D;  1FGB D;  4C3J H;  3MFY A;  4A3E G;  5DM7 3;  4MTN A;  4FVM A;  4B3S L;  4ME3 A;  3C2P A;  5E4X A;  4L6T B;  5K36 H;  1B9M A;  1A6X A;  1HNZ L;  1K83 H;  3VYU A;  1VCI A;  5C3E B;  4A3G H;  4EVO A;  3J7Z C;  1D5Z C;  1CKM A;  1HZA A;  1PZI D;  1JCK B;  3DEO A;  1TWF H;  2JA9 A;  4B3R Q;  4X3U A;  3T56 B;  4DK0 A;  2F0M A;  2Z8L A;  4IPH A;  4DV1 L;  3WWV A;  4JI6 L;  5DNF A;  5C3W A;  3HOZ G;  3FVQ A;  1X3P A;  3S2D B;  1SAP A;  4BBS B;  2DJG C;  5E3F A;  3F1Z A;  1CKN A;  4JBM A;  3DWA A;  4A4I A;  3BDC A;  2I5H A;  5BN4 A;  5FLM H;  5CGK A;  1SNO A;  4GKK L;  1D6E C;  1O7I A;  2WB1 E;  3K8A A;  1XJV A;  2MO1 A;  4HJ8 A;  5CMD A;  2K4K A;  5C5L A;  2Q2H A;  2FFK B;  1LTT D;  3HKZ B;  4JI6 Q;  1XMQ L;  2A68 D;  1EY9 A;  1QNU A;  2K01 A;  1GUN A;  4OHJ A;  2VUM G;  5EJW A;  3EN2 A;  1BCP C;  1IL2 A;  2F4V Q;  4DPG A;  4A3J B;  3OIQ A;  2MHV A;  1WCM G;  2RSN A;  1JWM D;  3ERO A;  2DY7 A;  4G7O C;  1SNQ A;  1BBW A;  4RKL A;  2WKD A;  2OXP A;  4X62 L;  1EOT A;  4HTH A;  4J1M A;  1JJC B;  1K83 B;  1XTD A;  1HUN A;  2L55 A;  5KNC A;  5JEA G;  1EQR A;  3IFT A;  4HJ9 A;  2B2V C;  4R8N A;  4DV3 Q;  1VQ4 A;  1BDO A;  4C1N I;  3F2D A;  4NXM Q;  1SYC A;  1EY8 A;  1NR2 A;  1STN A;  1VQF A;  5CV7 A;  5M3F H;  2EYL A;  3DUZ A;  4DAY B;  2ENB A;  4J8Q A;  4ZQ3 A;  4YIJ A;  3OYY A;  5FLX E;  1S5D D;  1J9O A;  4CHT B;  3M4O B;  3SK8 A;  1X3E A;  2A19 A;  4A3D B;  5LMN W;  4YWM A;  2EQS A;  1SYG A;  1Y1V B;  4JI8 L;  1I5F A;  3J7A V;  3L7Z C;  2MGS A;  3K58 A;  3J80 i;  1YJN A;  1N8R C;  4UP9 A;  2R92 G;  1YI2 A;  2LY7 A;  2PMZ E;  1EYG A;  4O1N A;  1ONL A;  3HGB A;  4IFD I;  3RNU A;  2CQO A;  3BDL A;  3AMU A;  3NE5 B;  3EVQ A;  2PO4 A;  2HIV A;  1TY0 A;  1EZ8 A;  5GQO A;  1QB5 D;  5ELF A;  2R7Z H;  1TVX A;  2O2L D;  3I4O A;  2VS1 A;  4K8I A;  2UU9 L;  1QZG A;  4G7H C;  1EQT A;  2EPB A;  4YWK A;  4CDE C;  1AZQ A;  4UP7 A;  2B63 B;  3CCU A;  4JYA L;  2M9V A;  2JA8 B;  3CAM A;  1YHQ A;  4LF4 Q;  1JWU D;  1Z9F A;  1UWV A;  4X6A H;  2F52 A;  2KCT A;  5EPL A;  2XNA C;  1EEF D;  2ZTD A;  2F0W A;  4FF1 A;  3PUY A;  1EIH A;  1H9J A;  3A54 A;  1EWC A;  1G6Z A;  2SNS A;  2E5L L;  1KIX A;  4JI5 L;  1J6Q A;  4C1N K;  1H9S B;  4F88 A;  1Y1W G;  1W2B A;  1CA6 A;  1I4X A;  5HY6 A;  5EPK A;  4TVA B;  2A6E C;  4DUZ Q;  2F0V A;  1K28 A;  1VQ6 A;  5BN3 A;  1NJI C;  3TZD A;  3UE1 A;  3K5O A;  1YBY A;  4HN7 A;  2EIF A;  2EJF C;  3W1B A;  5KGU A;  1HR0 L;  3H3V C;  2VW9 A;  2CCZ A;  4KJN A;  4DR4 L;  1AE2 A;  2KHS A;  4YY3 Q;  4A3J H;  1EFW A;  1H9M A;  2H1E A;  4LF7 Q;  3PO2 H;  3PO2 B;  5IT9 E;  3BDO A;  1GUO A;  2K32 A;  2F0D A;  4XQJ A;  4A3I H;  1M4V A;  2RCF A;  1ET6 A;  1EQV A;  3CMA A;  2MQH A;  1V1O A;  1WVL A;  4A3F H;  4DUY L;  4DAM A;  3HOV H;  1M1K C;  1XTC D;  4R4O A;  1BVS A;  4B9X A;  1EY7 A;  4UPA A;  2WP8 J;  3S2H B;  1RCV D;  1HZB A;  3A5Z B;  3OHX C;  3CRL C;  4DF7 A;  2UUA Q;  2OQK A;  5TSS A;  2NVT B;  4DNI A;  4JI3 Q;  2NVQ H;  5CBA E;  1HQR D;  5G3L F;  2WB1 G;  3K0Y A;  4K0K Q;  1WFQ A;  1ASZ A;  4X65 L;  2BCO A;  1IBM Q;  4ZCK A;  5BR8 Q;  3CPF A;  1PH1 A;  1HPC A;  3AYH B;  1EIF A;  4APV A;  2BDO A;  3GTO B;  1EWI A;  3NTH A;  4GN3 B;  1YEZ A;  3W2D A;  1GVP A;  3OPO A;  2EY2 A;  3U4Z A;  2RA4 A;  2FIN B;  3DM1 A;  4JI2 Q;  3S1R B;  1BXT A;  5D14 A;  1CSP A;  1W6J A;  1G29 1;  3ER0 A;  1PTO H;  1SYF A;  4KLK A;  3C1E A;  4X65 Q;  1MSH A;  1O7Z A;  4L5R C;  4A3J G;  1SJE D;  1LTA D;  4U67 3;  1KTK A;  5IWA L;  2PYK A;  3U9S A;  4DV2 L;  1ZYR D;  3CC4 A;  1EY5 A;  4RFB A;  1D5M C;  3GTL B;  5BN5 A;  1VQC A;  5M9O A;  2AQ3 B;  2A73 B;  3CCL A;  2A5H A;  1L0Y B;  1V43 A;  3TZU A;  1V9P A;  4C2M H;  3STB C;  3NQI A;  3K0X A;  2D9U A;  4OXP A;  1PTO F;  1PDQ A;  1YNN D;  1NBW A;  3S14 B;  2F0U A;  1PRT B;  1PH3 A;  1SR3 A;  1N32 Q;  2O5J C;  3D4D A;  2Q8R E;  2MP1 A;  2L4N A;  3I7F A;  5EQ0 A;  4DKA C;  4CDC C;  5IE8 A;  1U4L A;  4OEM B;  1KC8 C;  1PRT F;  3JC6 6;  3MA2 B;  3G7L A;  4GKK Q;  5M3M G;  5CV4 A;  1I50 B;  2XWB B;  4K6D A;  4A3D G;  4OO1 I;  1MHW C;  2HDM A;  4C3H H;  2C5C A;  4CJ2 C;  3O13 A;  1X54 A;  3S1N H;  2HUG A;  2F03 A;  3VYR A;  4HSV A;  2L1B A;  3ERS X;  1PRT D;  4GLX A;  1Q86 C;  1KD1 C;  3OOC A;  3J7Y W;  1PFB A;  4WRD A;  3PSI A;  3I73 A;  5FLX c;  4JI3 L;  5IGF A;  1JOR A;  1A3T A;  4X64 Q;  1Y14 B;  1C48 A;  4DV7 L;  3HOV B;  4K6L A;  5JJL A;  1B4O A;  1UE5 A;  3M4P A;  3J81 L;  4P71 A;  2B2Y C;  5C0X I;  4BBR H;  1DOM A;  4MTK A;  4B3S Q;  1PYB A;  1SJH D;  1IYU A;  4XDX A;  3T51 B;  3SE0 A;  1PV4 A;  2N55 A;  2Z0S A;  2Y0S G;  3KF6 A;  4DV0 L;  3CKI B;  2UXC Q;  1EYA A;  3OW2 A;  2Q2T A;  3AFP A;  4PMC A;  1E1O A;  1SSO A;  3A5U A;  1EOV A;  2NN6 G;  1S40 A;  5IYC H;  1EUJ A;  3CQZ H;  4IPG A;  2R92 H;  2IWH A;  4DR6 Q;  1A2U A;  3KLR A;  3WOE A;  1LLR D;  3KK7 A;  2LS0 1;  1DON A;  5GRO A;  5IP7 G;  4TSS A;  1B7Y B;  4Y7N B;  4QQB X;  3KLW A;  4H0L C;  4DR2 L;  3PUZ A;  1A8V A;  1KAB A;  4NW2 A;  3S1N B;  4C3I G;  1EQQ A;  1QJO A;  1X3G A;  2AWO A;  2WAQ G;  4IZ8 A;  1FJG L;  4A3B G;  1LT6 D;  3K6O A;  4IUT A;  2EY1 A;  4UAI A;  3QB3 A;  2CW0 D;  5EKI A;  5CR3 A;  2RHQ B;  2QEX A;  2KCN A;  2RHS B;  5CYU A;  1RTO A;  3L0O A;  2YYZ A;  2BOS A;  2K50 A;  1G91 A;  4LMQ D;  4RHS A;  3EBE A;  4CDF C;  1JE4 A;  3ZYY X;  1K8A C;  1B70 B;  1DZ1 A;  1YNN C;  2UXD Q;  3SVM A;  2JSO A;  4JI0 Q;  1Y1W H;  4WOR A;  4UP8 A;  4KV6 A;  2MNA A;  2H4O A;  3CME A;  1QUQ B;  4L5S A;  5C44 B;  1L0W A;  4OWT B;  1HXY D;  3TDQ A;  2PI2 E;  3CHB D;  1IYJ B;  4AIM A;  3S24 A;  1EYC A;  1M8A A;  4BBR G;  4BY1 B;  5A35 A;  1I4P A;  2FJ2 A;  1IW7 D;  3H0G B;  4X3K A;  1ROD A;  2TSS A;  2BH8 A;  3DMU A;  3D4W A;  1HRJ A;  2AWN A;  5IY0 A;  1KLG D;  3NTI A;  1TT2 A;  4DUY Q;  1CI3 M;  3GP7 A;  4RAU C;  4A3B B;  2K14 A;  4RMF A;  3K5M A;  4A3I G;  1I6H B;  1QG7 A;  4WJW A;  5C3X A;  4P2C B;  2A6H C;  2B2Y A;  3AU7 A;  2MPM A;  2RVL A;  5IWA Q;  1WTP A;  1K3B C;  3S15 H;  2F4V L;  3H91 A;  4LF9 L;  4YY3 L;  3QO2 A;  3A8I E;  1BBX C;  2K5H A;  1G6P A;  4JI2 L;  1GD7 A;  1FVI A;  4KMU C;  2KCM A;  3M3Y H;  1AW7 A;  3BYT B;  4DK1 A;  1WD0 A;  1LUZ A;  1EEI D;  4DV7 Q;  1JE5 A;  4BY7 B;  1I4H A;  1KNA A;  1U9R A;  4JI7 Q;  4X3S A;  3H15 A;  1XYI A;  1Q1E A;  3I4N H;  2KHI A;  4L63 B;  2BA1 A;  4POF A;  2QIL A;  2YTY A;  3R93 A;  5EGT A;  2JA6 B;  4FF4 A;  3H6M A;  4DXF A;  4R1J A;  1F2L A;  5A2Q E;  2RQX A;  2V1C C;  1FR3 A;  3I4M B;  4XT1 B;  1T5X D;  4NXN L;  2R93 G;  1EWH A;  4IN3 A;  4OIJ A;  2L0C A;  2N3S A;  1AH9 A;  3CCE A;  2K52 A;  4C3J B;  1PA6 A;  1WTH A;  2XRS D;  1ENF A;  3GV3 A;  1PZK D;  2CQA A;  5C4J H;  4G7Z C;  2BA0 A;  3HOZ B;  4R9W A;  1M90 C;  4ZKC B;  2OCE A;  4ZK9 B;  1LM0 A;  1L1O A;  3J7A F;  2F0G A;  3V05 A;  5FO8 B;  1V1P B;  2IX1 A;  3AEV A;  4YHH L;  4X64 L;  1PVO A;  4GNX C;  1IBK L;  3OWF A;  1SE8 A;  1TS4 A;  1C0A A;  2MO0 A;  1KLU D;  5T1I A;  5FOB B;  1A15 A;  1L1O B;  3I90 A;  3KLS A;  4WJ4 A;  3H09 A;  4FO2 A;  4A93 H;  1KRT A;  1D1I A;  4BS9 A;  2KA7 A;  1VQ7 A;  4KHP Q;  3PO3 B;  4LUO A;  1PFS A;  4LF5 L;  1VQP A;  2XN9 C;  2UUC L;  3NHH A;  3GTO H;  1WTQ A;  5M5W H;  5IGG A;  1A3V A;  3LGJ A;  4K8J A;  3NQT A;  5LMN L;  5M3M H;  2ZTE A;  3H94 A;  2BH2 A;  1Q81 C;  4Z9C B;  1WTX A;  4A3D H;  1SN8 A;  1HA6 A;  2EJM A;  3KBG A;  3SHL A;  2K6A A;  1SMY C;  2ZXR A;  1KL9 A;  4LJZ C;  4K0K L;  1YJW A;  2E75 C;  4I65 A;  1K3R A;  1L2F A;  1N34 Q;  3IFD A;  1X32 A;  1JC7 A;  2I07 B;  2K75 A;  5CC4 A;  3U50 C;  1DCZ A;  2R93 H;  1J8I A;  4DR3 L;  1B3A A;  2EJG C;  4FNF A;  3TS2 A;  1K8M A;  2Z6K C;  3QOJ A;  2F0K A;  3SK5 A;  4PV1 C;  2BDN A;  1HH2 P;  4XT3 B;  3PIP 3;  4LUZ A;  1U4R A;  2NUC A;  2XTI A;  1CHQ D;  3VR5 A;  1OTC A;  5C5M A;  3MEH A;  4HMI A;  4CJ0 B;  2NVT H;  2DGY A;  3EFX D;  1E0B A;  1RD9 D;  2K1B A;  1YNJ C;  3SK6 A;  4MN3 A;  1AE3 A;  1S5E D;  3HOY G;  1SBB B;  1RL2 A;  4A3L H;  2PW7 A;  1MIU A;  1VQN A;  2ATW A;  2O4X A;  1E2V A;  3AFQ A;  2P5Z X;  4RA8 A;  4AYB B;  3MVV A;  1PZJ D;  2CKZ B;  3D6W A;  3KDF A;  3I4L A;  3VYT A;  5BR8 L;  5M5W B;  3SXH A;  1GOZ A;  1N36 L;  3C3L A;  5LHY 1;  5LMU Q;  1TWF B;  4XYQ A;  3GTP B;  4KN7 C;  1BBU A;  1CKN B;  1SYE A;  2PPB C;  1SLJ A;  2WAQ E;  4RG1 A;  4K2L A;  1YNX A;  2EE1 A;  4A93 B;  3ZJY C;  4OX9 Q;  1PH2 A;  3GTG H;  1FL0 A;  1DGS A;  4BBS H;  5IYB G;  2R6G A;  4AQY L;  4WFN 3;  4OWX B;  4F8M A;  1JB3 A;  1TKW B;  1TS2 A;  3KJO A;  4DR1 Q;  2YU9 B;  1STH A;  1XMO L;  3GTM H;  1FNU A;  1VQK A;  4KD3 A;  2F0N A;  5I4D A;  1STA A;  1R4P B;  1A3U A;  2F0H A;  3MFG A;  4IPC A;  2Q2I A;  3GV6 A;  1UNS A;  4GKJ L;  4CDD C;  3OTO Q;  1F2M A;  1D5X C;  1XNQ Q;  3M9B A;  2UXB L;  1EY4 A;  3E9H A;  5FJ8 G;  2B3G A;  1ASY A;  2LXK A;  4ODG A;  4XQN A;  4JYA Q;  3NXW A;  3BVM A;  4R4I A;  1ENA A;  3TS0 A;  3G48 A;  5FK9 C;  5ELB A;  4X66 Q;  1KAA A;  2K7V A;  1DJR D;  4A3M B;  5FO9 B;  4QGU A;  1I50 H;  1EU3 A;  3DWQ A;  3PUX A;  4DXG A;  2DJF C;  2F0Q A;  3S9W A;  1CZG A;  1LAB A;  2EXD A;  1YIJ A;  3M4Q A;  4IUP A;  3D31 A;  3T13 A;  4FF3 A;  2CHB D;  3S17 H;  2B2W A;  1YIT A;  3UDX A;  4MZ9 A;  3CPW A;  3GTG B;  1EL0 A;  1GUW A;  3UE0 A;  4J6H A;  5DAU A;  3ND8 A;  2B39 A;  3GQB A;  1BCP B;  1TWC B;  2F0E A;  3A8K E;  3OMG A;  4RH6 A;  5M5Y H;  2R93 B;  3CC2 A;  1FNV A;  4C3H B;  2KEN A;  1E1T A;  1I4R A;  2C9O A;  1AFP A;  1BCP F;  5EBD A;  3HOY B;  3TBI B;  1YNJ D;  1T9H A;  2JQO A;  2EYM A;  2ID0 A;  3KBX A;  3TRZ A;  1QNK A;  3TP5 A;  1CQF A;  1JOK A;  1SE4 A;  2G9H D;  4RCO A;  1HNX L;  3B6Y A;  3TP8 A;  3RLF A;  3M3Y B;  4DA2 A;  3KUP A;  4JW0 A;  4LNQ A;  3FP9 A;  2E2D C;  1XX8 A;  1W6K A;  1D2B A;  1EY0 A;  1HNX Q;  4IUU A;  2G9D A;  3CXC A;  4LF8 L;  3PUW A;  2X69 A;  2J0T D;  2M2L A;  3HOW B;  4PMW A;  1SDF A;  3K7U C;  4GLV B;  1ESR A;  1B44 D;  3VDY A;  2IX0 A;  4U68 A;  3SR1 A;  4IQZ A;  1JOO A;  1EZ6 A;  3GTK H;  1ZKO A;  5KYL A;  2PZT A;  3MHB A;  3TN2 A;  1PH6 A;  3EJI A;  3UI2 A;  2UUC Q;  3R3O A;  1VQE A;  2IX3 A;  4PQX A;  5EPJ A;  1GUS A;  3I55 A;  4JOI A;  1G8Z D;  3ULJ A;  2PW5 A;  2NVY H;  3UDI A;  1IKL A;  4TRD A;  4DV6 Q;  5E1F A;  4QMG A;  2F0I A;  1N9W A;  2NTS A;  3VR2 A;  2JA7 G;  5K36 G;  5IGB A;  3M7N A;  4UY8 C;  2KOL A;  1TII D;  5GAH C;  4GOP C;  4KY5 A;  2JEB I;  3JAM L;  3FKI H;  5JAV A;  3HKZ E;  4G57 A;  4JBJ A;  3CCS A;  2R7D A;  1SND A;  2WIN B;  1Y1W B;  4A93 G;  3MXU A;  4TQU S;  3IRB A;  4BWG B;  4DV1 Q;  1U4P A;  4QUC A;  2QEJ C;  4BXX H;  4HCE A;  4RGN A;  3RZD B;  2E2I H;  4B3R L;  4OO1 G;  4RHR A;  2Y0S E;  3ULL A;  3MXN A;  2A6E D;  1GUG A;  1PH8 A;  4AQY Q;  2CH4 W;  2PQE A;  4MNO A;  1G2T A;  3S17 B;  1ICW A;  2UXB Q;  2FMM A;  3G71 A;  2Y0S B;  4JI1 L;  1I3Q H;  2ZM6 Q;  2JA5 G;  3RR5 A;  1ICF B;  1JT8 A;  5JJZ A;  1X55 A;  5C3E H;  4Y7N H;  1Q7Y C;  4PMB A;  2Q8I B;  4DNT B;  1T5E A;  4A3E H;  2QKI C;  5GAG C;  2J4X A;  1MKH A;  1IBL Q;  2D5D A;  4DGZ A;  5IT9 c;  4FF2 A;  2QA4 A;  3HOU B;  1NTG A;  1F9R A;  4H13 C;  5D3I B;  1VF7 A;  3RN2 A;  2OT2 A;  4X3T A;  4A3M H;  1MJE A;  4HJA A;  2JJQ A;  4KI0 A;  4EX5 A;  1QCB D;  4BY7 G;  4NXN Q;  2O5I C;  4ALP A;  3M4O H;  2DNE A;  2XRQ D;  3K81 C;  2CH4 A;  3I4M G;  4DR1 L;  1L0X B;  3H0G G;  1ZXT A;  2EZV A;  4IUQ A;  1TXY A;  2A74 C;  1CFM A;  4H44 C;  2YU9 H;  3NEM A;  3OIP A;  1S3O A;  2L12 A;  1D8L A;  4LK1 C;  3F2C A;  5C4H A;  1SFO B;  4I7Z C;  3HOW G;  2VL6 A;  4PZ7 A;  4DV6 L;  4ZUI A;  1HHV A;  1N36 Q;  3J7A 5;  4LF9 Q;  1F2Z A;  3KLS X;  3QIA A;  4BA2 I;  1U4M A;  3I3C A;  1DM0 B;  1ZYR C;  5AJ3 L;  5IGE A;  2AUK A;  2JEA I;  3WDN A;  3G6J B;  3CD6 A;  5KNB A;  3PIO 3;  2IPK D;  2JA6 G;  4L5T A;  3H3V H;  4R4Q A;  3HKZ G;  1X6O A;  2EOT A;  1JWS D;  4KN4 C;  2OQ0 A;  5FJ8 H;  3PO3 H;  1K0S A;  3NSW A;  3S1Q H;  4NB3 A;  3FRP B;  5K5P A;  2EXZ A;  2IHE A;  2WII B;  4NDX A;  1QIL A;  2RDF A;  4KHV A;  4PZ8 A;  1J5E Q;  4B3M L;  1TWH B;  3UDF A;  3V96 A;  3GTJ B;  3K7A H;  2XIW A;  4YCV A;  4B3T L;  1GHJ A;  3Q8D A;  3SK4 A;  2DUD A;  4HAE A;  2AQ2 B;  3NK9 A;  4A3M G;  3RN5 A;  3D3R A;  1F9P A;  4OWW B;  3T1Y Q;  4YHH Q;  3PQI A;  3PUV A;  3GTQ B;  4KTA A;  4GNX B;  2AUJ D;  3NP8 A;  3W3A A;  3T16 A;  2QDL A;  2K05 A;  2B2T A;  4DAP A;  1B3Q A;  3CU7 A;  4K5X A;  5M5Y B;  2CWA A;  3I70 A;  3PF5 A;  4QJF A;  5FKA C;  2R7Z G;  5E4W C;  3X3M A;  4P75 A;  1TWA H;  2VXW A;  2F4I A;  5LMN Q;  4JC0 A;  5AFW A;  2ALY B;  2C35 B;  1CQV A;  1LYL A;  3A56 A;  4OX9 L;  1ML0 D;  2R61 A;  2UUB L;  1CT1 D;  1KDC A;  1C9O A;  4KKS A;  2R92 B;  1XXG A;  1X65 A;  5COY A;  4OEL B;  4X66 L;  2SEB D;  2A8V A;  1O7Y A;  1X3F A;  3CCM A;  4NKL A;  3CRK C;  3MC0 B;  3RZO B;  2JA8 H;  4O0A A;  4C3J G;  4JI7 L;  3QJY A;  5ELO A;  1YJ9 A;  1HA5 A;  1SYD A;  2GVA A;  1NCV A;  3ONA B;  5CBE E;  3GTJ H;  4DU9 A;  2JP1 A;  3PO3 G;  1D7Q A;  4A3G G;  3EA6 A;  4LFC Q;  2D62 A;  4HIO A;  2K5D A;  2M00 A;  2ZXP A;  4LFB Q;  2N88 A;  3DXJ C;  1N32 L;  1E7Z A;  2CWP A;  1HNW L;  4ME5 A;  1PH7 A;  4G4K A;  1XMO Q;  1PMR A;  3P1H A;  1HTP A;  4MHE A;  3OSO A;  4J15 A;  5HUR A;  1X3Q A;  1I6H H;  3HOZ H;  1XWE A;  2KCC A;  5JVG 3;  1IYV A;  1A0I A;  1D1K A;  5DLQ E;  3LNN A;  4YWL A;  2E2H H;  3IKJ A;  4FYD A;  1XNR Q;  2SDF A;  4DAY A;  4DR3 Q;  5FLM G;  1FD7 D;  3M85 A;  1VF5 C;  1RIP A;  4JI0 L;  3EQL C;  5JPN C;  3A7L A;  3MTS A;  1JB7 A;  3CCV A;  3DHQ A;  5ELE A;  3S1R H;  3HOV G;  4GN4 B;  4QF4 A;  1SE2 A;  4KKT A;  4JK1 C;  1ET9 A;  1O7L A;  2QGQ A;  1IL8 A;  1TQO A;  2VUM H;  3S16 H;  3JAM E;  2WFW A;  4KY7 A;  1ILP A;  4EQ5 A;  2HHH Q;  2BE5 C;  1CSQ A;  4IJL A;  3PGZ A;  4LF5 Q;  2UXD L;  3S1M B;  3OWE B;  2WV6 D;  1WJJ A;  4JI4 L;  1CM9 A;  3J81 i;  4JV5 Q;  1VDZ A;  1GJX A;  1AN8 A;  3NWS A;  2NWG A;  3J80 c;  2EDG A;  5I2Y A;  1S72 A;  2R7Z B;  2E2J H;  4H7B A;  1IHZ A;  1PTO B;  3K5N A;  1RJT A;  2JA8 G;  3OMC A;  2IY5 B;  5L37 A;  4S3S A;  2UUA L;  4FDB A;  3M7G A;  1HQM C;  2HCC A;  5M3F G;  1EU4 A;  1N34 L;  1II3 A;  2MJ8 A;  3GTK B;  2D0P A;  4LF8 Q;  4HMJ A;  4R4T A;  1K9M C;  2A69 C;  4JBK A;  2L9H A;  4RGM A;  1IZ6 A;  4V0B A;  3BZC A;  1SXT A;  5EAY A;  4IJH A;  2ICI A;  2L5T A;  2XVS A;  1QE6 A;  1VMC A;  4DR6 L;  3NBH A;  2VQE L;  4A3C H;  1PTO D;  4I7A A;  3K57 A;  2F0J A;  1EIG A;  2KEC A;  1EIY B;  1HFN A;  3RLO A;  1VQH A;  2SNM A;  4JCV E;  3J80 L;  4LAA A;  1IBM L;  3D0F A;  2NBF A;  3F8T A;  2HIX A;  5KIX A;  4DR5 L;  1SRO A;  4HSP A;  4UHV A;  2NYZ D;  3E5S A;  4XQQ A;  1LTS D;  1PH4 A;  1N33 L;  2JK8 A;  1YHA A;  2VQF L;  1HR0 Q;  4K5W A;  5IYC G;  3G4S A;  3PF4 A;  1PRT C;  1YZ6 A;  1IBK Q;  1STE A;  4KKU A;  3W5O A;  1CUK A;  4JOI C;  3K5L A;  1NSN S;  1I4G A;  4A3F G;  1K8G A;  1FJG Q;  5IYD H;  4DN4 M;  1VQ9 A;  1KXL A;  2B2W C;  4DR2 Q;  3ND9 A;  1VQM A;  1QVC A;  2OF1 A;  3Q6S A;  2E5L Q;  1N33 Q;  3WOF A;  3LWU A;  3TP7 A;  2N49 A;  3VYS A;  1SRU A;  5LL6 X;  1Y8O B;  2L15 A;  1RF2 D;  3MXG A;  3BJU A;  4LFA L;  5JPM C;  4DK3 C;  4N9P A;  1E2W A;  2YTV A;  2QDB A;  1JMC A;  2N8N A;  5A2Q L;  3E9I A;  3T4A C;  3NBH B;  1K0R A;  2K04 A;  4HIK A;  1O78 A;  3OTO L;  4GKJ Q;  3Q0A A;  1LT4 D;  1S4Z A;  1VQL A;  4ZKB B;  3BS1 A;  3QOL A;  2IW3 A;  5JJK A;  3HRZ C;  3HZX A;  1AP0 A;  3KFU A;  4DR7 Q;  1MI2 A;  1VQ5 A;  1B53 A;  2VB3 X;  3FMC A;  2NVX H;  1MJC A;  4LWC A;  4HID A;  1G2S A;  3KDF B;  1VQ8 A;  2B8G A;  4CBV A;  3PO2 G;  1BCP D;  4P73 A;  3OW7 A;  1OXV A;  3PCO B;  2PZW A;  1V8Q A;  1I3Q B;  5FO7 B;  4EQP A;  3TQY A;  3I4N B;  2X6L A;  1FNW A;  2H5X A;  4A3C G;  4BA1 I;  4RKB A;  5HGT A;  2Z4I A;  2CW0 C;  3H3V I;  5CV5 A;  4L5Q A;  1AEX A;  4ABN A;  5ELC A;  3L9A X;  5LMU L;  3HP3 A;  1TWA B;  2RDH A;  5C44 H;  5EKL A;  4HIM A;  1NNX A;  4JV5 L;  1Q8I A;  4DFA A;  5GAD C;  3C1F A;  1TU2 B;  1KAW A;  1PH5 A;  2A69 D;  4M1U B;  1CTM A;  1LV9 A;  1I94 Q;  3HOX B;  4A3K H;  2VNU D;  4ZUJ A;  4RGT A;  1HJP A;  3BZK A;  2HQE A;  2B2V A;  1HR0 W;  2R7F A;  4NXM L;  3FEW X;  3HG9 A;  4JPB W;  5KND A;  1L1O C;  3I91 A;  4FXK C;  1LT5 D;  3W1G A;  4C56 C;  1PTO C;  3P7J A;  4KHZ A;  1BQQ T;  3G6E A;  1LTL A;  3IL8 A;  2AHO B;  1TWH H;  4XYO A;  1OXX K;  4P72 A;  5KEE A;  2KUM A;  4PG3 A;  3I72 A;  1QUQ A;  1IKM A;  1PYS B;  3TRE A;  1E24 A;  2NVX B;  4CJ1 B;  4EQN A;  2DY8 A;  3I4N G;  2AKW B;  3HKS A;  3QWN A;  3SGI A;  4DV2 Q;  4LFA Q;  4E6I A;  5IOD A;  1PFM A;  2B2U A;  2KJX A;  1MD2 D;  1YHB A;  1BNZ A;  3GTL H;  2EY5 A;  3ULP A;  4OL7 A;  1WD1 A;  4EGV A;  4ZYS A;  1JJG A;  4V19 0;  1EYD A;  1XMQ Q;  4K5V A;  4PNY A;  3U9O A;  5E7N A;  2NZO A;  4HR7 B;  2ZJR A;  3KYH C;  3NEN A;  2YV5 A;  1K73 C;  4LW1 A;  1V1P A;  1DOL A;  2E76 C;  4GLA C;  4JI5 Q;  1SE3 A;  4PZ6 A;  1HCZ A;  2FXQ A;  5T1G A;  2KED A;  4KD4 A;  3A0J A;  3V2T A;  3L2P A;  1S5B D;  5IGD A;  3A74 A;  4Q0F A;  3N52 A;  2MUY A;  4A76 A;  1TS3 A;  3VR4 A;  2NN6 H;  4X62 Q;  3R8B A;  2V4D A;  3DWP A;  1JIC A;  5EKK A;  4L8J A;  4A3K G;  2K33 A;  5EBC A;  5FLX L;  5GAE C;  4Q5V A;  2NVQ B;  3S14 H;  1IXR A;  3NTK A;  3CQZ B;  1X9N A;  4A3E B;  2UU9 Q;  4O42 A;  4R8I A;  4DR7 L;  5C4X B;  1A2T A;  5DEH A;  1QWY A;  2WAC A;  4A3I B;  4C3H G;  4KY6 A;  2Q8T A;  4LFC L;  1Q3L A;  3P20 A;  2F0P A;  2HDL A;  4XIG S;  2IJ0 A;  4A3B H;  3PV0 A;  2B63 H;  5C6A A;  5JJI A;  2RCN A;  4BY1 G;  1WTV A;  5C4J B;  2Z1C A;  4IFD J;  1Q1B A;  1SNM A;  2NVY B;  1JJ2 A;  2ZJP A;  2ZXO A;  2F0T A;  1Y69 U;  4CKB A;  1OXT A;  2PI2 A;  2PQA A;  3JAM i;  5ELN A;  4DR4 Q;  4EQO A;  3URY A;  1BKB A;  2F0S A;  2LSS A;  5I6Y A;  1UE7 A;  3HOX H;  2JE6 I;  4F7X A;  2F3V A;  1TR5 A;  3RLN A;  1BR9 A;  3E0E A;  3GTM B;  1UEA B;  2B2U C;  1I94 L;  1LT3 D;  1RDP D;  3MEF A;  1B50 A;  4UDU C;  4XXE A;  1KQS A;  3S1M H;  1QOH A;  4DR5 Q;  1KDB A;  1NE3 A;  2AMC B;  2E2I B;  1NUC A;  3E6Z X;  1SYB A;  1G51 A;  2FHT A;  1SMY D;  4ILW A;  1LO5 D;  5IP7 H;  1KDA A;  2EYH A;  2Z6B A;  3HFZ B;  4N8F A;  3C46 A;  4YCU A;  4A3L G;  2ZTC A;  1H95 A;  2VQE Q;  2PMZ B;  2VUM B;  1GHK A;  4A75 A;  1F77 A;  3L3O C;  4C3I H;  2J7Z A;  2Z4H A;  2VY3 A;  5IYD G;  2EYJ A;  1GM5 A;  2F3W A;  2KHJ A;  4B3M Q;  4N8X 1;  1JOQ A;  2KVM A;  2E74 C;  1CKO A;  4DV3 L;  3TSS A;  4ID6 A;  3HEJ A;  3KF8 B;  4IFD G;  4IUN A;  4GN5 A;  4LUV A;  3T53 B;  5F2D A;  1B9N A;  2E2H B;  2IL8 A;  2PZU A;  4GOP B;  3ERQ A;  4BBS G;  4TKO B;  1ILQ A;  2PCF B;  4GNX A;  1OO9 B;  1OXU A;  2B63 G;  4P74 A;  4LF6 L;  3F2U A;  3S2H H;  3K59 A;  2OTJ A;  1Q46 A;  2VB2 X;  2NZH A;  1DOK A;  4JBW A;  1F9Q A;  1LTB D;  4QY7 A;  3BG3 A;  3LX0 A;  4ULL A;  1K8O A;  3P75 A;  4Y52 H;  4BBR B;  4A3F B;  1Z47 A;  3S16 B;  1C8C A;  2KEE A;  1GKH A;  1NMG A;  3A7A B;  1UE1 A;  4MIU A;  1VQD A;  4JI4 Q;  3CCQ A;  4QL5 A;  1VQO A;  3FHW A;  1C7Y A;  4OON A;  3F2B A;  2KQ3 A;  2E8G A;  3HOX G;  1Z7T A;  4DV5 Q;  2Z9H A;  2XGT A;  3GD7 A;  2EYF A;  1EFI D;  4POG A;  4F87 A;  1XNQ L;  3AB9 A;  2QCP X;  5IGC A;  3BU2 A;  5KRU A;  3TEH B;  4AYB E;  5C4X H;  1VQJ A;  2YTX A;  4HJ7 A;  3KF6 B;  5JVH 3;  2CFM A;  4LFB L;  1VS0 A;  3UDG A;  4JG2 A;  4ZAI A;  5C44 G;  1JQY D;  3CC7 A;  1FYC A;  3NPP A;  2ZM6 L;  4JI1 Q;  3AQQ A;  5DM6 3;  4NPS A;  4YCW A;  1H9K A;  3CP0 A;  5LL6 S;  1PYW D;  5JEA J;  2Z6K A;  3K7A B;  3I2Z A;  2DNC A;  4LF4 L;  5IYB H;  3ICE A;  1CZW A;  1STY A;  3R2T A;  2UXC L;  1XPU A;  4DV0 Q;  1B2T A;  1S5F D;  1DYQ A;  2I5M X;  2X6G A;  4HED A;  4O2D A;  4LF7 L;  3S15 B;  3GO5 A;  2JA5 B;  2LKV A;  4C2M B;  3X3N A;  4HCS A;  2ASB A;  4FXG C;  3VA7 A;  2RBM A;  3S2D H;  5C0X J;  4IFD H;  4OIK A;  1PHJ A;  1GXD C;  5COR A;  2FMC A;  3HOU H;  3QR8 A;  2A1A A;  2E2J B;  4DUZ L;  2ICE C;  3A55 A;  2IHF A;  1WCM B;  2EVB A;  5IOC A;  1XPR A;  1V1Q A;  3RUZ A;  2NB0 A;  1HFG A;  1YVC A;  5G3L D;  2HQL A;  5IP9 G;  4IUV A;  3D6C A;  1F9S A;  3BVG A;  4H02 A;  2K5V A;  4A3G B;  2VQF Q;  2B2T C;  1C4Q A;  3KOJ A;  1KNE A;  4IAL A;  4AH6 A;  1A62 A;  1B8A A;  3U58 A;  3RZD H;  2BE5 D;  1WYD A;  3GDE A;  4KK7 A;  1W3S A;  3TME A;  1HTL D;  5M3F B;  2JXM B;  2RKS A;  1Y8N B;  1R9T B;  1O80 A;  2HHH L;  4CKC A;  1UE6 A;  1GO3 E;  2AQ1 B;  1CHP D;  3GTQ H;  4DK6 C;  5D3D A;  5ISR A;  2N78 A;  1SNP A;  3FKI B;  4IPD A;  1H9S A;  5C4X G;  1HUM A;  1KRS A;  1J5E L;  5KYI A;  4FP5 D;  1SNC A;  2JA7 H;  2K03 A;  2G5D A;  3LWE A;  5HGQ A;  1SMX A;  5C0X H;  4IUR A;  1XPO A;  1VQI A;  2QW7 A;  3FKI G;  2IT1 A;  4CKE A;  1QVF A;  4QIW B;  1OXS C;  4NMZ A;  5ELD A;  4DNR B;  3RMH A;  3J81 E;  3CW2 C;  4N9T A;  1ESF A;  1SEB D;  2HCI A;  3TP6 A;  3DEP A;  3U4V A;  2K28 A;  4AYB G;  1U0L A;  1BUV T;  3PMF A;  4K2K A;  4DAV A;  1HNW Q;  4KHP L;  4JI8 Q;  3NBI A;  3ITP A;  2OTL A;  2RDG A;  2D2C C;  3CF5 A;  4IO9 A;  4DV4 L;  1H9R A;  1I4Q A;  4HJ5 A;  4OO1 H;  3KJP A;  1RKN A;  1TWG B;  5J3B A;  3A8J E;  3T1H L;  1P16 A;  1CK1 A;  2F1M A;  3HOU G;  3NWT A;  2PNR C;  4BY1 H;  1BO0 A;  5I6W A;  4KJO A;  2F0O A;  1Q90 A;  5IP9 H;  3NUC A;  3J81 c;  5AJ3 Q;  2JA5 H;  2Q2U A;  5J1Z A;  1Y8P B;  1WTO A;  1MSG A;  1EY6 A;  5M5X B;  2OWO A;  3Q23 A;  3R2I A;  1ENC A;  2EY6 A;  4M8A A;  1FGU A;  3QG1 A;  5IIF A;  1TWC H;  2JYO A;  3MXP A;  2I5L X;  4RGO S;  2HD3 A;  1NMF A;  2JA7 B;  3STB D;  3RD4 A;  1XNR L;  1TY2 A;  3J81 j;  1HNZ Q;  1BOS A;  2QF7 A;  2EYP A;  3HOY H;  2JN4 A;  3VR6 A;  1MBY A;  1NR4 A;  2WB1 B;  3CCR A;  1R9T H;  2RSO A;  3D4R A;  5NUC A;  3JAM c;  2I46 A;  3MZ5 A;  1LTR D;  5J22 A;  5C0X G;  4WJ3 M;  2NZ1 D;  1KHI A;  1BF4 A;  1P8L A;  4BXX G;  1QZH A;  1WTW A;  2GVB A;  3CCJ A;  1A63 A;  1TS5 A;  3PIO A;  3Q22 A;  2RF4 A;  5I9O A;  3NEL A;  3T1H Q;  4OGQ C;  4RWS C;  1F2Y A;  4B3T Q;  4ZLT F;  3VR3 A;  2NTT A;  2NN6 I;  3J80 E;  2GN5 A;  3FPP A;  1Z6H A;  4RCN A;  1I6V C;  3I4M H;  1JR0 D;  3BZD B;  3HS0 C;  1UAP A;  1CA5 A;  3E0J A;  1PXU A;  2UUB Q;  2R3Z A;  1IBL L;  3E3X A;  4IOC A;  1MGS A;  4FXD A;  1QVG A;  3KF8 A;  2MFI A;  1E2Z A;  4K14 A;  2HT1 A;  3N6R A;  2SOB A;  1Y1V H;  3MAQ A;  2B29 A;  1SFO H;  1LTI D;  1AZP A;  1R4Q B;  3DM3 A;  1U5K A;  4DV4 Q;  2XSC A;  1E3P A;  3DLL A;  3S1Q B;  3K80 C;  1VQB A;  1DXM A;  3VA5 A;  1UEB A;  1B1Z A;  3EIV A;  5H1S E;  1PLF A;  2B8F A;  3SEB A;  2F3I A;  1Q12 A;  2JA6 H;  2K5N A;  3T1Y L;  2TMP A;  1GUT A;  2EYO A;  4CGY B;  3BYY B;  5M5X H;  1STG A;  5IT9 L;  4DV5 L;  2A68 C;  3FPU B;  2XWJ B;  1Q82 C;  2L11 A;  1VMP A;  4BY7 H;  2F0F A;  1LAC A;  1ZEQ X;  4JVZ A;  2WAQ B;  4QIW E;  1WTR A;  2K5Q A;  1RHP A;  2ZJQ A;  5D65 A;  2GA4 B;  2OEO A;  4B08 A;  1PH9 A;  2ZT9 C;  2PNH A;  2VZA A;  2WKC A;  1WOC A;  1TWG H;  5CV9 A;  3FDT A;  5I9P A;  1UUP A;  1PFN A;  1NAP A;  3GTP H;  1X56 A;  2I0Q A;  1WI5 A;  4QUF A;  1E22 A;  1Q8K A;  3MWY W;  4B9W A;  3H0G H;  1STB A;  5JOB A;  4LF6 Q;  3I56 A;  2F0L A;  2LXJ A; 
#chains in the Genus database with same CATH homology
 2CVR A;  3Q24 A;  4C3I B;  2DN8 A;  4GZY C;  2LMC B;  3M4Y A;  5CV6 A;  1S5C D;  4NP5 A;  3SDZ A;  1LTG D;  4QB4 A;  4QCL A;  1RTN A;  3BVZ A;  5I2X A;  4XTC S;  1IW7 C;  5J39 A;  2K5W A;  1DD2 A;  3I8Z A;  5CV8 A;  5M3M B;  3D8G A;  5JEA H;  2LFN A;  3IAY A;  4A3K B;  4ZRZ A;  5C4Z A;  2A6H D;  1FGB D;  3MFY A;  5DM7 3;  4FVM A;  3C2P A;  5E4X A;  4L6T B;  5K36 H;  1B9M A;  1A6X A;  3VYU A;  1VCI A;  5C3E B;  4EVO A;  1D5Z C;  1PZI D;  1JCK B;  3DEO A;  4X3U A;  3T56 B;  4DK0 A;  2F0M A;  2Z8L A;  5DNF A;  5C3W A;  3FVQ A;  1X3P A;  3S2D B;  1SAP A;  4BBS B;  5E3F A;  3DWA A;  3BDC A;  5BN4 A;  5CGK A;  1SNO A;  1D6E C;  5CMD A;  5C5L A;  2FFK B;  1LTT D;  3HKZ B;  2A68 D;  1EY9 A;  1QNU A;  2K01 A;  1GUN A;  4OHJ A;  5EJW A;  1BCP C;  4A3J B;  3OIQ A;  2MHV A;  2RSN A;  1JWM D;  3ERO A;  2DY7 A;  4G7O C;  1SNQ A;  4RKL A;  2WKD A;  2OXP A;  1EOT A;  4HTH A;  4J1M A;  1K83 B;  1HUN A;  2L55 A;  5KNC A;  5JEA G;  3IFT A;  2B2V C;  4R8N A;  1BDO A;  4C1N I;  1SYC A;  1EY8 A;  1NR2 A;  1STN A;  5CV7 A;  2EYL A;  3DUZ A;  2ENB A;  4J8Q A;  4ZQ3 A;  4YIJ A;  5FLX E;  1S5D D;  1J9O A;  4CHT B;  3M4O B;  3SK8 A;  4A3D B;  1SYG A;  1Y1V B;  3J7A V;  3L7Z C;  2MGS A;  3K58 A;  2LY7 A;  4O1N A;  1ONL A;  3HGB A;  4IFD I;  3AMU A;  3BDL A;  3NE5 B;  3EVQ A;  2PO4 A;  1TY0 A;  1EZ8 A;  1QB5 D;  5ELF A;  1TVX A;  2O2L D;  4K8I A;  4G7H C;  1EQT A;  2EPB A;  1AZQ A;  2B63 B;  2M9V A;  2JA8 B;  1JWU D;  5EPL A;  2XNA C;  1EEF D;  2F0W A;  4FF1 A;  3PUY A;  1EIH A;  1H9J A;  3A54 A;  1EWC A;  1G6Z A;  2SNS A;  4C1N K;  1H9S B;  4F88 A;  1CA6 A;  1I4X A;  5EPK A;  2A6E C;  2F0V A;  5BN3 A;  3TZD A;  3K5O A;  4HN7 A;  2EJF C;  5KGU A;  3H3V C;  4KJN A;  2KHS A;  1H9M A;  2H1E A;  3PO2 B;  5IT9 E;  3BDO A;  1GUO A;  2K32 A;  2F0D A;  4XQJ A;  1M4V A;  1ET6 A;  1EQV A;  1V1O A;  1WVL A;  1XTC D;  4B9X A;  1EY7 A;  2WP8 J;  3S2H B;  1RCV D;  3OHX C;  3CRL C;  4DF7 A;  2NVT B;  5TSS A;  5CBA E;  1HQR D;  5G3L F;  3K0Y A;  2BCO A;  1HPC A;  2BDO A;  3GTO B;  3NTH A;  3W2D A;  3OPO A;  2EY2 A;  2RA4 A;  2FIN B;  3DM1 A;  3S1R B;  1BXT A;  5D14 A;  1W6J A;  1G29 1;  1PTO H;  1SYF A;  3C1E A;  1MSH A;  1O7Z A;  1SJE D;  1LTA D;  4U67 3;  1KTK A;  2PYK A;  3U9S A;  1ZYR D;  1EY5 A;  4RFB A;  1D5M C;  3GTL B;  5BN5 A;  5M9O A;  2AQ3 B;  2A73 B;  2A5H A;  1L0Y B;  1V43 A;  3TZU A;  3NQI A;  2D9U A;  1PTO F;  1PDQ A;  1YNN D;  3S14 B;  2F0U A;  1PRT B;  2O5J C;  3D4D A;  2Q8R E;  2MP1 A;  2L4N A;  5EQ0 A;  1U4L A;  1PRT F;  3MA2 B;  3G7L A;  5CV4 A;  1I50 B;  2XWB B;  4K6D A;  4OO1 I;  2HDM A;  4CJ2 C;  2C5C A;  3O13 A;  2HUG A;  2F03 A;  3VYR A;  4HSV A;  2L1B A;  1PRT D;  3OOC A;  3J7Y W;  1PFB A;  4WRD A;  3I73 A;  5IGF A;  1JOR A;  1A3T A;  1C48 A;  3HOV B;  4K6L A;  1B4O A;  3J81 L;  2B2Y C;  5C0X I;  1DOM A;  1SJH D;  1IYU A;  4XDX A;  3T51 B;  3SE0 A;  2N55 A;  3CKI B;  1EYA A;  4PMC A;  1SSO A;  2NN6 G;  2IWH A;  1A2U A;  3KLR A;  3WOE A;  1LLR D;  3KK7 A;  2LS0 1;  1DON A;  4TSS A;  4Y7N B;  4H0L C;  3PUZ A;  1KAB A;  4NW2 A;  3S1N B;  4C3I G;  1QJO A;  2AWO A;  4IZ8 A;  1LT6 D;  3K6O A;  4IUT A;  4UAI A;  2EY1 A;  3QB3 A;  2CW0 D;  5EKI A;  5CR3 A;  2KCN A;  5CYU A;  1RTO A;  2YYZ A;  2BOS A;  1G91 A;  4LMQ D;  4RHS A;  1JE4 A;  3ZYY X;  1DZ1 A;  1YNN C;  3SVM A;  2JSO A;  4WOR A;  4KV6 A;  2H4O A;  5C44 B;  1HXY D;  3TDQ A;  3CHB D;  1EYC A;  1M8A A;  4BY1 B;  5A35 A;  1I4P A;  2FJ2 A;  1IW7 D;  3H0G B;  4X3K A;  1ROD A;  2TSS A;  3DMU A;  3D4W A;  1HRJ A;  2AWN A;  1KLG D;  3NTI A;  1TT2 A;  1CI3 M;  3GP7 A;  4RAU C;  4A3B B;  3K5M A;  1I6H B;  1QG7 A;  4WJW A;  5C3X A;  4P2C B;  2A6H C;  2B2Y A;  3AU7 A;  2MPM A;  2RVL A;  1WTP A;  3H91 A;  3QO2 A;  3A8I E;  1BBX C;  4KMU C;  1AW7 A;  3BYT B;  4DK1 A;  1WD0 A;  1EEI D;  4BY7 B;  1I4H A;  1KNA A;  1U9R A;  4X3S A;  1XYI A;  1Q1E A;  4L63 B;  2BA1 A;  2QIL A;  3R93 A;  5EGT A;  2JA6 B;  4FF4 A;  3H6M A;  4DXF A;  1F2L A;  5A2Q E;  2RQX A;  1FR3 A;  3I4M B;  4XT1 B;  1T5X D;  1EWH A;  4IN3 A;  4OIJ A;  2L0C A;  4C3J B;  2XRS D;  1ENF A;  3GV3 A;  1PZK D;  2CQA A;  4G7Z C;  2BA0 A;  3HOZ B;  4R9W A;  4ZKC B;  4ZK9 B;  3J7A F;  2F0G A;  3V05 A;  5FO8 B;  1V1P B;  2IX1 A;  3OWF A;  1TS4 A;  1KLU D;  5T1I A;  5FOB B;  1A15 A;  3I90 A;  3KLS A;  3H09 A;  4FO2 A;  1D1I A;  4BS9 A;  2KA7 A;  3PO3 B;  2XN9 C;  3NHH A;  1WTQ A;  5IGG A;  1A3V A;  4K8J A;  3NQT A;  3H94 A;  4Z9C B;  1WTX A;  1HA6 A;  2EJM A;  3KBG A;  3SHL A;  2K6A A;  1SMY C;  2ZXR A;  4LJZ C;  2E75 C;  4I65 A;  3IFD A;  1X32 A;  1JC7 A;  2I07 B;  5CC4 A;  1DCZ A;  1J8I A;  1B3A A;  2EJG C;  4FNF A;  1K8M A;  3QOJ A;  2F0K A;  3SK5 A;  4PV1 C;  2BDN A;  4XT3 B;  3PIP 3;  1U4R A;  2NUC A;  1CHQ D;  3VR5 A;  5C5M A;  3MEH A;  4HMI A;  4CJ0 B;  3EFX D;  1E0B A;  1RD9 D;  2K1B A;  1YNJ C;  3SK6 A;  4MN3 A;  1S5E D;  1SBB B;  2PW7 A;  2O4X A;  1E2V A;  4RA8 A;  4AYB B;  3MVV A;  1PZJ D;  3D6W A;  3VYT A;  3I4L A;  5M5W B;  3SXH A;  1GOZ A;  3C3L A;  5LHY 1;  1TWF B;  4XYQ A;  3GTP B;  4KN7 C;  1SYE A;  2PPB C;  4K2L A;  2EE1 A;  4A93 B;  2R6G A;  4WFN 3;  4F8M A;  1JB3 A;  1TKW B;  1TS2 A;  2YU9 B;  1STH A;  1FNU A;  4KD3 A;  2F0N A;  5I4D A;  1STA A;  1R4P B;  1A3U A;  2F0H A;  3MFG A;  3GV6 A;  1UNS A;  1F2M A;  1D5X C;  1EY4 A;  4ODG A;  4XQN A;  3NXW A;  3BVM A;  1ENA A;  5FK9 C;  5ELB A;  1KAA A;  2K7V A;  1DJR D;  4A3M B;  5FO9 B;  1EU3 A;  3DWQ A;  3PUX A;  4DXG A;  2F0Q A;  3S9W A;  1CZG A;  1LAB A;  4IUP A;  3D31 A;  3T13 A;  4FF3 A;  2CHB D;  2B2W A;  3GTG B;  1EL0 A;  1GUW A;  4J6H A;  5DAU A;  3ND8 A;  2B39 A;  3GQB A;  1BCP B;  1TWC B;  2F0E A;  3A8K E;  3OMG A;  4RH6 A;  2R93 B;  1FNV A;  4C3H B;  1I4R A;  2C9O A;  1AFP A;  1BCP F;  5EBD A;  3HOY B;  3TBI B;  1YNJ D;  2EYM A;  2ID0 A;  3KBX A;  1QNK A;  3TP5 A;  1CQF A;  1JOK A;  1SE4 A;  2G9H D;  4RCO A;  3TP8 A;  3RLF A;  3M3Y B;  4DA2 A;  3KUP A;  2E2D C;  1XX8 A;  1W6K A;  1D2B A;  1EY0 A;  4IUU A;  2G9D A;  3PUW A;  2X69 A;  2J0T D;  2M2L A;  3HOW B;  4PMW A;  1SDF A;  1ESR A;  1B44 D;  2IX0 A;  4U68 A;  3SR1 A;  4IQZ A;  1JOO A;  1EZ6 A;  1ZKO A;  5KYL A;  2PZT A;  3MHB A;  3TN2 A;  3EJI A;  3UI2 A;  3R3O A;  2IX3 A;  4PQX A;  5EPJ A;  1GUS A;  1G8Z D;  2PW5 A;  1IKL A;  4TRD A;  5E1F A;  4QMG A;  2F0I A;  3VR2 A;  2NTS A;  5K36 G;  5IGB A;  3M7N A;  2KOL A;  1TII D;  4KY5 A;  2JEB I;  3JAM L;  5JAV A;  4G57 A;  1SND A;  2WIN B;  1Y1W B;  3MXU A;  4TQU S;  4BWG B;  1U4P A;  4QUC A;  2QEJ C;  4HCE A;  4RGN A;  3RZD B;  4OO1 G;  4RHR A;  3MXN A;  2A6E D;  1GUG A;  2PQE A;  1G2T A;  3S17 B;  1ICW A;  2FMM A;  2Y0S B;  5JJZ A;  4PMB A;  2Q8I B;  4DNT B;  1T5E A;  2QKI C;  2J4X A;  2D5D A;  4DGZ A;  4FF2 A;  3HOU B;  1F9R A;  4H13 C;  5D3I B;  1VF7 A;  2OT2 A;  4X3T A;  4KI0 A;  1QCB D;  2O5I C;  2DNE A;  2XRQ D;  1L0X B;  1ZXT A;  2EZV A;  4IUQ A;  2A74 C;  1CFM A;  4H44 C;  3OIP A;  2L12 A;  4LK1 C;  5C4H A;  1SFO B;  4I7Z C;  4ZUI A;  1HHV A;  1F2Z A;  3KLS X;  3QIA A;  4BA2 I;  1U4M A;  3I3C A;  1DM0 B;  1ZYR C;  5IGE A;  2AUK A;  2JEA I;  3WDN A;  3G6J B;  5KNB A;  3PIO 3;  2IPK D;  2EOT A;  1JWS D;  4KN4 C;  3NSW A;  3FRP B;  5K5P A;  2EXZ A;  2WII B;  4NDX A;  1QIL A;  2RDF A;  4KHV A;  1TWH B;  3V96 A;  3GTJ B;  2XIW A;  1GHJ A;  3SK4 A;  4HAE A;  2AQ2 B;  3NK9 A;  3D3R A;  1F9P A;  3PUV A;  3GTQ B;  4KTA A;  2AUJ D;  3NP8 A;  3W3A A;  3T16 A;  2K05 A;  2B2T A;  4DAP A;  3CU7 A;  4K5X A;  5M5Y B;  3I70 A;  5FKA C;  5E4W C;  3X3M A;  2VXW A;  2F4I A;  5AFW A;  1CQV A;  3A56 A;  1ML0 D;  2R61 A;  1CT1 D;  1KDC A;  4KKS A;  2R92 B;  1XXG A;  5COY A;  2SEB D;  1O7Y A;  4NKL A;  3CRK C;  3MC0 B;  3RZO B;  4C3J G;  3QJY A;  1HA5 A;  1SYD A;  1NCV A;  3ONA B;  5CBE E;  4DU9 A;  2JP1 A;  3EA6 A;  2D62 A;  2K5D A;  2M00 A;  2ZXP A;  2N88 A;  3DXJ C;  4ME5 A;  4G4K A;  1PMR A;  3P1H A;  1HTP A;  4MHE A;  3OSO A;  5HUR A;  1X3Q A;  1XWE A;  2KCC A;  5JVG 3;  1IYV A;  1D1K A;  3LNN A;  3IKJ A;  4FYD A;  2SDF A;  4DAY A;  1FD7 D;  3M85 A;  1VF5 C;  3EQL C;  5JPN C;  3A7L A;  3MTS A;  3DHQ A;  5ELE A;  4QF4 A;  1SE2 A;  4KKT A;  4JK1 C;  1ET9 A;  1O7L A;  1IL8 A;  1TQO A;  3JAM E;  4KY7 A;  1ILP A;  2BE5 C;  3S1M B;  3OWE B;  2WV6 D;  1CM9 A;  1VDZ A;  1GJX A;  1AN8 A;  3NWS A;  2NWG A;  2EDG A;  5I2Y A;  2R7Z B;  4H7B A;  1IHZ A;  1PTO B;  3K5N A;  1RJT A;  3OMC A;  4S3S A;  3M7G A;  1HQM C;  2HCC A;  1EU4 A;  1II3 A;  2MJ8 A;  3GTK B;  4HMJ A;  2A69 C;  2L9H A;  4RGM A;  4V0B A;  1SXT A;  2ICI A;  2L5T A;  2XVS A;  1QE6 A;  1VMC A;  3NBH A;  1PTO D;  3K57 A;  2F0J A;  1EIG A;  2KEC A;  1HFN A;  2SNM A;  3J80 L;  4LAA A;  2NBF A;  5KIX A;  4HSP A;  2NYZ D;  3E5S A;  4XQQ A;  1LTS D;  4K5W A;  1PRT C;  1STE A;  4KKU A;  3K5L A;  1NSN S;  1I4G A;  4DN4 M;  2B2W C;  3ND9 A;  2OF1 A;  3Q6S A;  3WOF A;  3LWU A;  3TP7 A;  3VYS A;  5LL6 X;  1Y8O B;  1RF2 D;  3MXG A;  5JPM C;  4N9P A;  1E2W A;  2QDB A;  5A2Q L;  3T4A C;  2K04 A;  1O78 A;  3Q0A A;  1LT4 D;  1S4Z A;  4ZKB B;  3BS1 A;  3QOL A;  2IW3 A;  3HRZ C;  3HZX A;  1AP0 A;  1MI2 A;  1B53 A;  2VB3 X;  3FMC A;  1G2S A;  2B8G A;  4CBV A;  1BCP D;  3OW7 A;  1OXV A;  2PZW A;  1V8Q A;  1I3Q B;  5FO7 B;  4EQP A;  3I4N B;  2X6L A;  1FNW A;  4BA1 I;  4RKB A;  5HGT A;  2Z4I A;  2CW0 C;  5CV5 A;  1AEX A;  4ABN A;  5ELC A;  3L9A X;  3HP3 A;  1TWA B;  2RDH A;  5EKL A;  1Q8I A;  4DFA A;  3C1F A;  1TU2 B;  2A69 D;  4M1U B;  1CTM A;  1LV9 A;  3HOX B;  2VNU D;  4ZUJ A;  4RGT A;  2HQE A;  2B2V A;  3FEW X;  3HG9 A;  5KND A;  3I91 A;  4FXK C;  1LT5 D;  4C56 C;  1PTO C;  3P7J A;  4KHZ A;  1BQQ T;  3IL8 A;  4XYO A;  1OXX K;  5KEE A;  2KUM A;  3I72 A;  1IKM A;  2NVX B;  4CJ1 B;  4EQN A;  2DY8 A;  3QWN A;  4E6I A;  5IOD A;  1PFM A;  2B2U A;  2KJX A;  1MD2 D;  1BNZ A;  2EY5 A;  4OL7 A;  1WD1 A;  4EGV A;  4ZYS A;  4V19 0;  1EYD A;  4K5V A;  4PNY A;  3U9O A;  4HR7 B;  1V1P A;  1DOL A;  2E76 C;  1SE3 A;  1HCZ A;  5T1G A;  2KED A;  4KD4 A;  3V2T A;  1S5B D;  5IGD A;  4Q0F A;  3N52 A;  2MUY A;  1TS3 A;  3VR4 A;  2NN6 H;  3R8B A;  2V4D A;  3DWP A;  1JIC A;  5EKK A;  4L8J A;  2K33 A;  5EBC A;  5FLX L;  4Q5V A;  2NVQ B;  3NTK A;  3CQZ B;  4A3E B;  4O42 A;  4R8I A;  5C4X B;  1A2T A;  5DEH A;  1QWY A;  2WAC A;  4A3I B;  4C3H G;  4KY6 A;  2Q8T A;  1Q3L A;  3P20 A;  2F0P A;  2HDL A;  4XIG S;  2IJ0 A;  3PV0 A;  5C6A A;  1WTV A;  5C4J B;  2Z1C A;  4IFD J;  1Q1B A;  1SNM A;  2NVY B;  2ZXO A;  2F0T A;  1Y69 U;  4CKB A;  1OXT A;  4EQO A;  3URY A;  2F0S A;  5I6Y A;  2JE6 I;  4F7X A;  2F3V A;  1TR5 A;  1BR9 A;  3GTM B;  1UEA B;  2B2U C;  1LT3 D;  1RDP D;  1B50 A;  4UDU C;  4XXE A;  1QOH A;  1KDB A;  2E2I B;  1NUC A;  3E6Z X;  1SYB A;  2FHT A;  1SMY D;  4ILW A;  1LO5 D;  1KDA A;  2EYH A;  3C46 A;  2VUM B;  2PMZ B;  1GHK A;  1F77 A;  3L3O C;  2J7Z A;  2Z4H A;  2EYJ A;  2F3W A;  1JOQ A;  2KVM A;  2E74 C;  3TSS A;  4ID6 A;  3HEJ A;  4IFD G;  4IUN A;  3T53 B;  5F2D A;  1B9N A;  2E2H B;  2IL8 A;  2PZU A;  3ERQ A;  4TKO B;  1ILQ A;  2PCF B;  1OO9 B;  1OXU A;  3F2U A;  3K59 A;  2VB2 X;  1DOK A;  4JBW A;  1F9Q A;  1LTB D;  3BG3 A;  3LX0 A;  4ULL A;  1K8O A;  3P75 A;  4BBR B;  4A3F B;  1Z47 A;  3S16 B;  1C8C A;  2KEE A;  3A7A B;  4MIU A;  2KQ3 A;  1Z7T A;  3GD7 A;  2EYF A;  1EFI D;  4F87 A;  3AB9 A;  2QCP X;  5IGC A;  5KRU A;  5JVH 3;  4ZAI A;  1JQY D;  1FYC A;  3NPP A;  5DM6 3;  1H9K A;  5LL6 S;  1PYW D;  5JEA J;  3K7A B;  2DNC A;  1CZW A;  1STY A;  3R2T A;  1B2T A;  1S5F D;  1DYQ A;  2X6G A;  3S15 B;  4HED A;  3GO5 A;  2JA5 B;  2LKV A;  4C2M B;  3X3N A;  4HCS A;  4FXG C;  3VA7 A;  2RBM A;  5C0X J;  4IFD H;  4OIK A;  1GXD C;  5COR A;  2FMC A;  2E2J B;  2ICE C;  3A55 A;  1WCM B;  2EVB A;  5IOC A;  3RUZ A;  2NB0 A;  1HFG A;  5G3L D;  4IUV A;  3D6C A;  1F9S A;  3BVG A;  4A3G B;  2B2T C;  1C4Q A;  1KNE A;  4IAL A;  2BE5 D;  4KK7 A;  3TME A;  1HTL D;  5M3F B;  2JXM B;  2RKS A;  1Y8N B;  1R9T B;  1O80 A;  4CKC A;  2AQ1 B;  1CHP D;  5D3D A;  5ISR A;  1SNP A;  3FKI B;  1H9S A;  1HUM A;  5KYI A;  4FP5 D;  1SNC A;  2K03 A;  3LWE A;  5C0X H;  4IUR A;  2IT1 A;  4CKE A;  4QIW B;  1OXS C;  4NMZ A;  5ELD A;  4DNR B;  3RMH A;  3J81 E;  4N9T A;  1ESF A;  1SEB D;  2HCI A;  3TP6 A;  3DEP A;  2K28 A;  1BUV T;  3PMF A;  4K2K A;  4DAV A;  3NBI A;  3ITP A;  2RDG A;  2D2C C;  1H9R A;  1I4Q A;  4OO1 H;  1RKN A;  1TWG B;  3A8J E;  1CK1 A;  2F1M A;  3NWT A;  2PNR C;  1BO0 A;  5I6W A;  4KJO A;  2F0O A;  1Q90 A;  3NUC A;  5J1Z A;  1Y8P B;  1WTO A;  1MSG A;  1EY6 A;  5M5X B;  3Q23 A;  3R2I A;  1ENC A;  2EY6 A;  4M8A A;  3QG1 A;  5IIF A;  2JYO A;  3MXP A;  4RGO S;  2JA7 B;  3RD4 A;  1TY2 A;  1BOS A;  2QF7 A;  2EYP A;  3VR6 A;  1MBY A;  1NR4 A;  2WB1 B;  2RSO A;  3D4R A;  5NUC A;  2I46 A;  3MZ5 A;  1LTR D;  5J22 A;  5C0X G;  2NZ1 D;  1BF4 A;  1WTW A;  3Q22 A;  1TS5 A;  5I9O A;  4OGQ C;  4RWS C;  1F2Y A;  4ZLT F;  3VR3 A;  2NTT A;  2NN6 I;  3J80 E;  3FPP A;  1Z6H A;  4RCN A;  1I6V C;  1JR0 D;  3BZD B;  3HS0 C;  1UAP A;  1CA5 A;  3E0J A;  1PXU A;  2R3Z A;  1MGS A;  4FXD A;  3KF8 A;  1E2Z A;  4K14 A;  3N6R A;  2SOB A;  3MAQ A;  1AZP A;  1LTI D;  1R4Q B;  2XSC A;  3S1Q B;  1DXM A;  3VA5 A;  1B1Z A;  1PLF A;  2B8F A;  3SEB A;  1Q12 A;  2TMP A;  1GUT A;  2EYO A;  4CGY B;  3BYY B;  1STG A;  5IT9 L;  2A68 C;  3FPU B;  2XWJ B;  2L11 A;  1VMP A;  2F0F A;  1LAC A;  1ZEQ X;  2WAQ B;  1WTR A;  2K5Q A;  1RHP A;  5D65 A;  2GA4 B;  2OEO A;  4B08 A;  2ZT9 C;  2WKC A;  5CV9 A;  3FDT A;  5I9P A;  1UUP A;  1PFN A;  1NAP A;  4QUF A;  3MWY W;  4B9W A;  1STB A;  5JOB A;  2F0L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...