2Q8IB

Pyruvate dehydrogenase kinase isoform 3 in complex with antitumor drug radicicol
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
93
structure length
93
Chain Sequence
SYPPHMQVLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKEADISAFADY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 3
publication title Distinct Structural Mechanisms for Inhibition of Pyruvate Dehydrogenase Kinase Isoforms by AZD7545, Dichloroacetate, and Radicicol.
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 93
sequence length 93
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 2007-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2q8iB00
1OXSC 2BDOA 3NE5B 2LMCB 3HGBA 3U9SA 3MXUA 1ZKOA 3SE0A 1DXMA 2L5TA 3GQBA 2NN6G 3P20A 3PUVA 4KN7C 4RCNA 1B9NA 3L7ZC 1ONLA 2A6HC 5C0XH 4DNTB 2A69C 2QF7A 1Y8OB 3DXJC 1CTMA 1IW7D 2A68C 1VF5C 1Z6HA 1K8MA 2B8GA 4TKOB 3D31A 2JEBI 1HPCA 1Y8PB 4JBWA 1TKWB 2Q8IB 4G7HC 1K8OA 2KCCA 3VA7A 3I72A 4GZYC 1VF7A 2E75C 4OO1G 3A7LA 4L8JA 4H0LC 3VR4A 1GUGA 2BA0A 5BN4A 1ZYRC 1TU2B 1GJXA 3W3AA 1GUSA 1QJOA 1Q12A 3A8KE 3I4LA 3PUWA 2F1MA 4DK1A 3I73A 2BA1A 1VDZA 4IFDG 4BA2I 5KNDA 2A6ED 1Q1EA 1H9KA 3EQLC 3VR3A 1LACA 3D4RA 3OOCA 2NN6I 5BN5A 4IFDH 4PV1C 1Y8NB 4KHZA 3VR6A 5C0XG 2D2CC 3PUXA 2AUKA 3M85A 5KNCA 2E74C 3VR5A 2PNRC 3FPPA 2A6HD 3IFTA 3QG1A 4KI0A 1HCZA 2O5JC 2A69D 2EVBA 3T51B 4H44C 1LABA 3OPOA 2R6GA 3SDZA 2PPBC 4KN4C 1H9MA 1CFMA 2A68D 3PUZA 3ND9A 2V4DA 3QJYA 4IQZA 3A8IE 1GHJA 3TZUA 2JE6I 1FR3A 2DN8A 2EJMA 1OXXK 2KA7A 1OXUA 4OGQC 5K36H 3T56B 4LJZC 4BA1I 5A35A 4JK1C 4DK0A 1IYUA 5BN3A 1CI3M 3H94A 4G7OC 2E76C 4XIGS 3T53B 1H9SA 2DNEA 2JXMB 3LNNA 5KNBA 2IT1A 2K33A 2BE5C 2D5DA 2AWOA 1Q1BA 3ND8A 4G7ZC 1GUNA 1O78A 3MFYA 1GHKA 1V8QA 1FYCA 1HQMC 1OXTA 1Q90A 2DNCA 2ZT9C 4KKTA 4DNRB 2O5IC 3PV0A 1V43A 4XTCS 4H13C 4HR7B 1Z7TA 3BDOA 3VR2A 3IKJA 4TQUS 1OXVA 1GUOA 3PUYA 5K36G 3FMCA 1H9JA 3GD7A 4I7ZC 1B9MA 1EWHA 4KKUA 2CW0C 2K7VA 3M4YA 1E2VA 3KLRA 3A8JE 1SMYC 1HTPA 1O7LA 3LWUA 1BDOA 1YNJC 1DD2A 1Y69U 2AUJD 3CRLC 3BG3A 2EJFC 4KMUC 4KKSA 1YNNC 2NN6H 2B8FA 1IYVA 1I6VC 1H9SB 1E2ZA 1IW7C 1PMRA 3A7AB 1DCZA 2PCFB 3OW7A 1A6XA 1E2WA 1G291 1GUTA 2K32A 3RLFA 3QIAA 2EDGA 1T5EA 2BE5D 4LK1C 1H9RA 3WDNA 2YYZA 5JEAG 2JEAI 2D62A 5JEAH 2EJGC 3CRKC 3M7NA 4OO1H 3AB9A 3N6RA 2A6EC 1VCIA
chains in the Genus database with same CATH superfamily
1OXSC 3HG9A 3JAMc 3EVQA 1SMYD 3M7GA 3SK8A 2JA6H 1T5XD 1K3RA 3I7FA 5ELNA 4R4CA 3I4MB 3KF6A 1D7QA 4JI7Q 1F2MA 2WV6D 3SEBA 5EJWA 4IUPA 4DNIA 3K0YA 1F9RA 1KRTA 4B3SQ 2Z4HA 3I91A 3ICEA 4GZYC 2DGYA 4C3HG 4RGNA 1BKBA 2E2IB 3DM3A 5G3LF 1GUSA 2R7ZB 4AQYQ 4HIMA 3MWYW 4TVAB 3AMUA 4L6TB 3K5LA 4X66Q 3E6ZX 3PIO3 5J3BA 4JI3Q 3SK6A 1A3UA 3PUXA 3A56A 3VR5A 4BBSB 4A3IB 2IHFA 2YU9B 1UE5A 2C5CA 1KAAA 1SE4A 3KK7A 4TRDA 3S24A 4ODGA 1PA6A 2JA5G 4XQJA 4UHVA 4R4IA 2R93B 4KTAA 2AHOB 3HOXB 3HOZG 3V96A 3T56B 1S72A 3CCMA 5C4HA 4ZUJA 3E0EA 2K14A 1PH4A 4FXDA 3J81E 3ERSX 3BS1A 4C3JG 4L5RC 1JQYD 1EIGA 1WVLA 3BVMA 3GTKB 4O1NA 2D5DA 1X3EA 2NVYB 5C0XJ 3ND8A 1S5FD 3VDYA 3D4DA 4EQNA 4RGMA 1F9QA 5C44H 1Q90A 2LFNA 4Q5VA 2I0QA 1A2UA 4IO9A 1X3FA 2N8NA 3BZCA 1HHVA 1PRTB 4JI6L 2KHJA 5CBAE 4N9PA 2LS01 1L0XB 3K57A 2B2TC 3OIPA 1STYA 4A3DH 4CKBA 4IPDA 4QQBX 1JWMD 2ZTCA 2NN6H 5C4JH 3STBD 3HKZE 4AIMA 1JJGA 1DCZA 2NYZD 2QKIC 4FXKC 4WFN3 3V05A 2F4IA 4DV3L 4KJOA 4C2MB 5FO9B 1TY2A 1FVIA 4K5WA 3NTIA 3OW2A 3CQZB 1SNMA 4OIKA 1P8LA 1TWAB 1YBYA 4JI6Q 2RSOA 2A6EC 3FDTA 3I56A 2JYOA 2F0DA 2L9HA 1NR2A 4ZCKA 1FL0A 3RZDB 3SE0A 3G7LA 2NZHA 4HEDA 1EL0A 1SNCA 1CQFA 2NVXB 2F3IA 4BY7H 3I4MG 4H7BA 4PG3A 1HNWQ 1C4QA 1K8MA 3RD4A 2N88A 4TKOB 3J7ZC 4ULLA 2KVMA 5CMDA 1MIUA 3LX0A 2KCCA 2QDLA 3AYHB 1QZHA 1VF7A 2MGSA 4DV3Q 1BUVT 3C2PA 4L8JA 3J80i 3I90A 1Q12A 1PYSB 5IGEA 3HOVB 5E4WC 1VDZA 3OTOL 3K5MA 2F0TA 2Z6KA 2R7ZG 2WAQB 4CHTB 5JJKA 3S9WA 1Y8NB 1EWCA 1JOOA 2OWOA 5JVG3 3GTJH 1K8AC 1KD1C 2PW5A 2L12A 5FOBB 4BBSG 2L55A 4A3IG 4ZKCB 4A3FB 1SMXA 2BH8A 1SYCA 2F0PA 3QJYA 4DV7Q 5K36H 1TXYA 3OWEB 1WJJA 2PW7A 2UXDL 4HMIA 2R93G 1L0YB 3HOXG 2AWNA 4X6AH 3K80C 4Z9CB 3V2TA 2ZXPA 3LNNA 4LF4L 4BXXG 1RTOA 3SVMA 4DV4L 4FF2A 3PIP3 2VUMB 3BDOA 4ZUIA 1YIJA 3S1NH 2OF1A 3PSIA 3RN5A 2CW0C 3A8JE 3LWUA 1HTPA 1D5ZC 1EU4A 1HUNA 1B8AA 2JP1A 2N55A 2EJFC 1BCPB 4IPCA 2PQEA 4A3EH 4DUZQ 2NVQH 1Z9FA 4LF4Q 2PZTA 1SROA 5KIXA 2HD3A 3NTKA 3CCRA 1EQRA 3QWNA 4DA2A 1WTPA 1KL9A 3DWPA 4DR3L 1VQBA 4WJ4A 3BVGA 4LF5L 2KQ3A 2F0IA 1RL2A 1KTKA 1PDQA 3I4NB 3ONAB 3BYYB 3OIQA 2EY1A 2H4OA 1YNND 3TRZA 4K8IA 1MSGA 2B8GA 4P72A 2IWHA 3PIOA 1PH8A 5FO7B 1CKNA 1Q8KA 3OHXC 4BY1H 1XNRL 2UXCL 5CV7A 4DV1L 5JEAJ 2EYJA 2BA0A 1ZYRC 3PUWA 5I6WA 2Z8LA 4UP9A 4DK1A 4DR3Q 2BA1A 4LF5Q 3J7AF 4K14A 2DY8A 3FPUB 5F2DA 1EY7A 5BN5A 4K5XA 4K6LA 2WAQG 3KBGA 2EYOA 5C0XG 1F2YA 2F0LA 2MJ8A 1CA6A 2PZWA 4UY8C 2F0WA 4PMWA 3ND9A 5CORA 1F9PA 4A3FG 3GTOB 1CKNB 2IW3A 1U4MA 1XNRQ 2UXCQ 2WFWA 4BA1I 4DF7A 3CCSA 2R93H 5IODA 4OX9Q 1IYUA 4KD4A 4A3GB 5CV5A 1HQRD 3KOJA 2XGTA 5ELFA 5G3LD 2GA4B 1PLFA 3SR1A 3NWSA 1JJ2A 2B2VA 2EY6A 1O78A 2XTIA 1F9SA 1XPOA 3PV0A 4TQUS 2JA8B 2B39A 1A0IA 1KHIA 2E2HH 1MBYA 3R8BA 3UDXA 1B9MA 5C5LA 3P75A 2FFKB 3K81C 3SGIA 1B44D 1SYGA 1F2ZA 2PI2A 4A75A 1B7YB 1VQ5A 1U5KA 3A0JA 1RODA 3VYUA 1QZGA 4IUVA 1JE5A 4JCVE 1LYLA 3TQYA 4EQPA 1A6XA 2K32A 1RIPA 2JN4A 1X3GA 4DR4Q 2F0VA 1I4RA 4LUZA 3S15B 1EFID 4HIKA 3X3MA 3CCEA 1K8GA 2CVRA 4C2MH 1U4PA 2XWBB 1A3VA 1STEA 2K28A 4FP5D 4V190 2L11A 3NK9A 5KYLA 2IX0A 4QJFA 3I4NG 1WTOA 4X3UA 1EEFD 1RHPA 1K83B 1KC8C 2M2LA 3H0GH 4ME3A 2ZM6L 1V1PA 1I4GA 3URYA 2D0PA 1Q3LA 1TVXA 1YVCA 5FJ8G 3GTPH 1PH9A 3CCVA 4H0LC 1BO0A 4GOPC 4GN3B 1QJOA 1HJPA 4XXEA 4QMGA 3HFZB 2JA6B 4A3BH 3EQLC 4PV1C 1PH2A 3M85A 2AUKA 2CCZA 3X3NA 4X3TA 1LTLA 1TR5A 4EVOA 1HCZA 4DR2L 3TMEA 1XX8A 2EVBA 2R6GA 2DJGC 2NWGA 5IT9c 3S2DH 2AMCB 4F88A 2K5HA 1V1PB 4UP8A 1FGUA 1W6KA 2ZM6Q 1C48A 4Q0FA 3RLOA 2HUGA 3Q22A 1JR0D 2NVTH 3H91A 1JB3A 3PIPA 1SDFA 1HFGA 1XWEA 4GS3A 1PXUA 1KNAA 1SNOA 1TS2A 1Q1BA 1MHWC 3MXGA 1GUNA 1AZQA 2IY5B 1FYCA 2PQAB 4UP7A 2F0HA 3Q24A 1D1IA 3QO2A 1KDCA 3E9HA 5GROA 2JA8G 1TIID 1VQKA 3MXNA 3KLRA 3UI2A 1NNXA 1SMYC 5JOBA 1VQGA 1AW7A 1DD2A 4OHJA 4HJ5A 1Y1WG 3S14H 1D1KA 1L2FA 2KCMA 4F8MA 1SYBA 3H3VC 1WYDA 1KLUD 2LXJA 4LWCA 5C44B 3R3OA 2F0JA 4CDCC 1U4LA 1JOQA 3A5ZB 5J22A 3LGJA 5JEAG 1A63A 5IGFA 4PMCA 5KRUA 4AH6A 1WTVA 4A3DB 3HOYB 4TSSA 3MXNB 5C4JB 1WTXA 2XNAC 4DAMA 4JC0A 4HSPA 4FVMA 4X3SA 2QCPX 4DR7Q 3EN2A 5EQ0A 2B2VC 5KYIA 4A3CG 3U50C 2VQFQ 1GM5A 1FD7D 1NBWA 3HZXA 1STHA 2YTYA 2VZAA 3HOWH 3K0XA 2K05A 2VXWA 2F3WA 5IE8A 2OQ0A 3SK5A 4DR1L 3Q8DA 2ICEC 1XMQL 1D5MC 1X56A 2JA6G 4DK6C 1S5ED 2Q2IA 1UE1A 4QL5A 3GTMH 4QCLA 2AQ1B 3S16H 4BY7B 4O2DA 1BBUA 2A6HD 1LABA 3SDZA 1FJGL 1LM0A 1CT1D 1M4VA 1PTOF 2IL8A 1HXYD 1CA5A 4OGQC 1OXUA 1HZBA 2RQXA 1RJTA 1LTTD 4IALA 2A74C 1V9PA 3NQTA 3STBC 1I6HH 1NSNS 3GTJB 5D65A 1WI5A 4R4TA 1XMQQ 2NB0A 2Q2UA 1AN8A 4RG1A 1RCVD 1EY5A 3BJUA 1R9TH 4G7ZC 2DNCA 1YJ9A 4KY7A 2O5IC 1T9HA 1STGA 1Z7TA 1VQ8A 2DUDA 1S3OA 2PI2E 5FLXE 2I5LX 4PZ7A 3CPWA 2K7VA 1SBBB 1SR3A 1VQ7A 2TMPA 3BG3A 1V1OA 2WP8J 2OQKA 3HS0C 3JC66 5FLXL 1Y1WH 1VQAA 1PMRA 1GUWA 1WTQA 2A5HA 1HNXL 2K5WA 5C44G 3AEVA 4B3RL 1TWCH 3W1BA 4J1MA 3WDNA 3UE1A 3S1NB 4KV6A 5JEAH 2QDBA 2RVLA 5CV4A 1DONA 4XDXA 1LT6D 2FMCA 2B2YC 2PNHA 3CKIB 1F77A 2EYLA 4A3DG 2RBMA 2CHBD 3GTLH 3HOYG 4A3EB 4LFAL 1K73C 2NN6G 2NVQB 2F0SA 3DWQA 4YWMA 1W6JA 2R7FA 3CU7A 4MNOA 3PF5A 4A3CH 3MTSA 3LWEA 2VL6A 4B3SL 1JCKB 3CCJA 1HNXQ 1HPCA 4JI1L 1RKNA 4B3RQ 2L4NA 3W3AA 2RDHA 1D8LA 1STAA 2F0FA 2XRQD 1K0SA 1Q86C 2MP1A 1BR9A 2OCEA 4JI3L 3WOEA 1C0AA 1Q1EA 4RHSA 2QW7A 2F3VA 2WINB 1SYDA 3NBHA 4G4KA 2E2DC 4R4QA 4LFAQ 4F7XA 4ZK9B 2CH4W 4BY7G 2K50A 4NP5A 2IX3A 1UE7A 3F2BA 1YITA 5J1ZA 3R2IA 4BY1B 3PO2H 2CQAA 5DNFA 4WJWA 1O7ZA 2V4DA 2P5ZX 4IQZA 1NUCA 3SXHA 3CCQA 1I4HA 2JE6I 2F0EA 1CHQD 4JI1Q 2JSOA 3WOFA 1VQEA 4R9WA 3J80E 4HJ9A 2NTSA 1BBWA 2KHSA 1LT5D 4GKKQ 1EY6A 4OELB 4JG2A 1H9SA 1YHQA 2XWJB 5EKLA 1EY9A 2WB1G 3J80L 2CH4A 1E24A 1A8VA 3NBHB 1JWSD 4CDFC 1ENCA 3KF6B 5IGBA 3I4OA 1AH9A 3S1QH 2CWAA 3FRPB 3MXPA 1UEBA 4KHPL 1XYIA 1EYCA 1A2TA 1FNWA 5K36G 1HA6A 1W3SA 1TWHH 2ZTEA 2KCNA 1PH7A 3AU7A 1O7LA 1YI2A 1CZWA 1E0BA 1AE2A 4KKSA 1YNNC 5C6AA 2LSSA 3UDGA 2RHSB 1H9SB 1PH6A 4JI8Q 4ZAIA 2R7DA 3D3RA 4IPGA 3A5UA 2ENBA 2HT1A 3NBIA 4DV0Q 4LK1C 1SLJA 1VMPA 3ULPA 4A3MG 2E2HB 1VQHA 1Y1VH 2EJGC 4K2KA 1A3TA 3J81L 3NTHA 4AYBG 5C4XH 2Y0SB 1DM0B 4EGVA 4KHPQ 1HFNA 4UDUC 1CSPA 2BDOA 2RA4A 1BXTA 1STBA 2YV5A 3HGBA 1X65A 4A3JH 3HOYH 2K4KA 4A3EG 1ONLA 3HKSA 3I8ZA 3L9AX 4LMQD 1PTOH 4U673 1CHPD 1KDBA 4KY6A 4N9TA 1HNWL 1KXLA 1PH1A 3M3YH 1LUZA 1O7YA 1ASYA 3JAME 4QB4A 2VB2X 4KY5A 3TBIB 2Q8IB 4K0KL 2EY2A 3CF5A 2F03A 1KIXA 1GUGA 4WJ3M 1N8RC 1VQ9A 2EE1A 2F1MA 3E0JA 1HA5A 1EQQA 2Q8TA 1HZCA 2F0GA 3JAML 2JK8A 3CP0A 2PMZB 2J7ZA 4KHZA 1I50H 2IHEA 4F87A 2MPMA 1NR4A 3H0GB 3A74A 3QG1A 4KI0A 4JPBW 1I4PA 3P1HA 1H9MA 3GTPB 4DV7L 2A68D 2NBFA 4U68A 4BY1G 4A3KH 2I46A 4L63B 4APVA 2SOBA 4K0KQ 3TP7A 4P73A 4A3BB 2QA4A 1SNPA 4NDXA 1EZ8A 4JK1C 2G9HD 2E76C 3K5NA 3HOUG 4K2LA 2ATWA 3RLNA 2K75A 1QG7A 4HIDA 1JC7A 4R8IA 3CXCA 3S2DB 4EQOA 4I65A 2CKZB 2RKSA 1NTGA 4MZ9A 1ESFA 3DLLA 2NVTB 5JAVA 3EROA 2BCOA 1N36L 1MSHA 1KQSA 1QUQA 1K28A 2N3SA 1PTOD 4DUZL 1BVSA 2M9VA 2O2LD 1EUJA 2FXQA 4LF7L 1HZ9A 1LTRD 1E2WA 4MIUA 1ILQA 5M3MH 3T1HL 5C3XA 2WKDA 4J6HA 4HTHA 1XTDA 2J4XA 2AQ3B 4A3MH 4NW2A 3BDLA 3K8AA 4L5QA 1YJNA 4K8JA 4OWXB 4JOIC 2LKVA 3AB9A 1X54A 1VCIA 2DY7A 2KJXA 2Y0SG 3F8TA 4GOPA 1N36Q 1Q7YC 3C46A 3S14B 1QUQB 3GTQH 3U9OA 1UE6A 2AKWB 2EYFA 3J7A5 4GLVB 4X65L 1Q82C 2RDFA 3ZYYX 3P7JA 1KLGD 4LF7Q 1NMGA 3NSWA 3PF4A 1CUKA 2ALYB 3HP3A 5ELDA 5C5MA 5I9PA 3T1HQ 1MJEA 1JOKA 1PZKD 4PZ6A 4HJ8A 5EKIA 5IP9H 3W1GA 5BN4A 4POGA 2K6AA 4S3SA 5M5YH 3I73A 4C3IH 4FNFA 4B08A 5KNDA 1XPRA 2K5QA 4GOPB 3D4RA 3OOCA 3QOLA 5IOCA 1LTSD 1R4PB 3U58A 4ID6A 1AE3A 1YHAA 4CDDC 4X65Q 3H0GG 1UWVA 1EY4A 1S5CD 3W5OA 3HOWB 2K01A 3HRZC 2NUCA 4OO1I 1FR3A 2DN8A 4UPAA 3BZKA 5D14A 4OX9L 1DGSA 3Q6SA 3MA2B 1QWYA 2BOSA 4DK0A 5BN3A 3GTMB 4A3BG 3S16B 1ESRA 2KENA 1EQTA 5T1GA 3HOUH 1YZ6A 2V1CC 3TREA 3TS0A 1M90C 3OMGA 1CKMA 2Y0SE 5KGUA 5M3FH 5IYCG 1GHKA 1EWIA 5LMNW 2ZT9C 1VQOA 1EY8A 3TDQA 1SNDA 2H5XA 4BWGB 1BCPF 1OXVA 4L5SA 1IL2A 3L0OA 2FHTA 4RKLA 1HRJA 4Y7NH 1HUMA 1CKOA 1WTWA 1ASZA 1I6HB 4HSVA 3FHWA 3CRLC 4NXNL 4KMUC 2EPBA 1I6VC 1ZXTA 4N8X1 1R9TB 2ZXRA 4XT1B 4N8FA 4DR4L 3I70A 3RLFA 2GVAA 2EY5A 3F2DA 2RCFA 2PMZE 3M7NA 1SEBD 1VS0A 2YTXA 4X64L 4CKCA 3B6YA 3DHQA 1UEAB 2C9OA 1SNQA 1SYFA 1VQPA 1Y1WB 1YNJD 3DEPA 4NXNQ 2A6HC 4DNTB 4HN7A 1TWCB 3G4SA 1G2TA 5IY0A 5GADC 1FNUA 1SJHD 4PQXA 2KEDA 3D31A 1ICFB 1B1ZA 3RN2A 3GO5A 2F0MA 3PMFA 2WAQE 5IYDH 1ICWA 5K5PA 1PFNA 1S5DD 2NZOA 1GJXA 1KAWA 3FKIG 1BNZA 3KLSX 3GTLB 2R92H 3R2TA 1EYAA 3BVZA 2QILA 5IIFA 4BS9A 4X64Q 4RH6A 4R4OA 1IXRA 1II3A 3MFGA 2R61A 5KNCA 4P2CB 2A19A 4H44C 1BOSA 4XYOA 1MD2D 4KN4C 1CFMA 3S1MH 4MN3A 1S4ZA 1D6EC 4DR5Q 3HOWG 4QUCA 4QIWB 1CZGA 2EJMA 2IJ0A 4CJ2C 1HTLD 3KYHC 5DLQE 3E9IA 4IFDJ 5ELCA 4B3TL 4IZ8A 3DUZA 3TP6A 2B63H 3KBXA 4ZLTF 1QOHA 1J8IA 5C3EH 3PO2B 3GV6A 3PO3H 4M1UB 4NXMQ 2XIWA 5IYCH 4A93H 3R93A 4HAEA 1LT4D 1QE6A 1UNSA 2JQOA 4L5TA 3DMUA 3M4YA 4KD3A 1SJED 1LLRD 4ME5A 3Q23A 4IFDI 2B2YA 4FXGC 2B8FA 5IGDA 1JMCA 2G9DA 1X55A 3S1QB 1GUTA 4QF4A 4B3TQ 2RDGA 1E1OA 4Y52H 2GN5A 2XSCA 3RR5A 1NJIC 3QOJA 5ELBA 1PRTD 2D62A 1TWHB 4DAVA 2KEEA 2IPKD 3TEHB 5FLMH 1U4RA 3NP8A 4DXGA 3AFPA 5IP7G 1A62A 2MUYA 3U9SA 5HURA 1IHZA 4NMZA 3IFDA 4DR7L 5EGTA 1B9NA 3OWFA 4FO2A 2UUAL 5LL6S 2Z1CA 2VQFL 1Y1VB 1Y8PB 1I94L 1SYEA 4G7HC 1X3QA 5I9OA 5C4XB 1VQFA 2VW9A 5GAHC 2E75C 1Z47A 4MTKA 4GKJL 4O42A 1TU2B 2X6GA 5EBDA 2A1AA 3A8KE 4CGYB 3FKIH 2HQLA 4A3JB 4GLXA 2K5NA 2N78A 1WD1A 4B3ML 4OIJA 2XRSD 1VQDA 1PTOB 1VQ4A 4B9XA 4LAAA 3TP5A 2D2CC 1I4QA 3QB3A 3M3YB 4HCSA 4J15A 2JA7H 1ENAA 2PNRC 4P71A 2UUAQ 5CBEE 3EBEA 2G5DA 3SHLA 4YY3L 2PPBC 3EJIA 5JPNC 4UAIA 5FK9C 1XPUA 5IYBH 2KA7A 1B3AA 1I94Q 1IBML 3IL8A 1B50A 3PQIA 1TQOA 3A54A 4GKJQ 1MI2A 5LHY1 5IT9E 3H94A 3T53B 1I50B 2ID0A 1DOLA 3K5OA 4B3MQ 1E22A 1RTNA 3U4ZA 5E7NA 3T4AC 2AWOA 2CWPA 4KKTA 4A3KB 1OXTA 3PO2G 5IT9L 4DNRB 3ULJA 5L37A 1KABA 3IKJA 2OTLA 4YY3Q 2MFIA 3FVQA 2UUBQ 1Q46A 2LXKA 3FMCA 3BU2A 1X3PA 2LY7A 1AP0A 2MHVA 3DM1A 1GVPA 1IBMQ 1QCBD 1IYJB 5NUCA 3AQQA 1C8CA 5IGCA 2GVBA 1IZ6A 2WB1B 4G57A 4RA8A 4ZQ3A 2MO1A 4C1NI 4PNYA 4JV5L 1PYWD 4DV2L 1T5EA 2BE5D 3H09A 3MHBA 4HMJA 4CDEC 5HGQA 3HKZB 5LMNL 3F2CA 4C56C 3D6WA 4OO1H 3D4WA 4IUNA 4ZYSA 5GAEC 1CQVA 4BBRH 1BCPD 5M5XH 3MXUA 4YWKA 5IP7H 3VA5A 5GAGC 1O80A 5ELEA 1EIYB 4RAUC 1MJCA 2MO0A 1G2SA 5M3MB 3GTGH 2Z4IA 2VY3A 2A68C 4PZ8A 4J8QA 4A3MB 1ILPA 4IOAA 4JV5Q 5CR3A 1NY4A 1XXGA 1Y1VG 3CCUA 1J9OA 3M4PA 1YNXA 4IURA 4DV2Q 1K8OA 1TS3A 2TSSA 4DR6L 4AYBB 1CK1A 1PFMA 5LMNQ 2YTVA 5C4XG 5JJZA 1EQVA 3GTQB 4HJ7A 1FNVA 4IFDG 1N33L 5CYUA 1TT2A 1H9KA 2B2WC 4A3JG 3IAYA 1B4OA 4R1JA 3VYTA 4IPHA 2EXZA 2JJQA 1X32A 1WCMH 2ES2A 2NZ1D 2BDNA 2O5JC 1EY0A 1WTRA 3PUZA 1V1QA 3CMAA 1SXTA 3J81c 4OL7A 5M5YB 4GKKL 4KLKA 4C3IB 4RGTA 1LV9A 4LUOA 4DR6Q 1PTOC 3S17H 3NENA 2HDLA 3AFQA 4PMBA 1YJWA 4A3LH 1VMCA 2PZUA 4YCWA 1N33Q 1IL8A 3H6MA 4V0BA 3F1ZA 4JBKA 2UUCL 5AJ3L 4A76A 5EPJA 2KOLA 4H02A 1PH5A 2HIXA 5CV9A 4E6IA 4A3KG 1BQQT 1EU3A 2K03A 2QGQA 4WORA 3CPFA 5TSSA 1EWHA 3EFXD 4KKUA 1G51A 4JOIA 3MC0B 5FKAC 2K1BA 1EEID 3HOUB 3I2ZA 1EFWA 1GD7A 3VYSA 4JI8L 1X9NA 2ASBA 5M3FB 4DV6Q 1D2BA 4RHRA 1G291 4DV0L 3CAMA 4JI5Q 2K04A 3QIAA 4FYDA 2UUCQ 1R4QB 1WFQA 5AJ3Q 2JEAI 4Y7NB 2UXBL 1DOMA 3H15A 3HKZG 4RCOA 5E1FA 3KJPA 2RSNA 2LMCB 1J5EQ 1QILA 4A4IA 1DXMA 2L5TA 3K7AH 4YHHL 2PO4A 1XTCD 4GNXA 2QF7A 5M3MG 2Q8RE 1A15A 5M5WB 4JYAL 1PH3A 3A7LA 2KHIA 1LTBD 3CCLA 4I7AA 2UXBQ 2Z6BA 4RKBA 1B70B 4GN5A 4FF4A 4R8NA 4IJLA 5IGGA 1L1OC 4IFDH 1HR0W 1VQCA 2Q2TA 4DXFA 1EOVA 1E1TA 1N9WA 3L2PA 3FP9A 3IFTA 1GOZA 2A69D 4QUFA 4YHHQ 4GNXB 4IN3A 1U9RA 3HEJA 4NPSA 3J7AV 2WB1E 1TWGH 5IP9G 4JYAQ 1OXXK 3T16A 2R92B 1H95A 4C3IG 3J81j 1CM9A 1I4XA 1CI3M 3J7YW 4G7OC 1EIHA 4XT3B 5KNBA 1L0WA 5C0XI 1DZ1A 5JVH3 3QR8A 3S1MB 1M8AA 3KLSA 3FEWX 1V43A 2ZTDA 1LO5D 3PUYA 3K59A 1H9JA 1PZID 3I3CA 4EQ5A 2HCIA 4FF1A 2OT2A 1YNJC 1JWUD 1Y69U 3NHHA 2B63B 1SRUA 3C1FA 1NMFA 5C3EB 1PRTF 5J39A 4X3KA 2VQEL 2F0KA 4AYBE 5DM73 4OONA 3PO3B 1BBXC 4QGUA 1TWFH 3E5SA 5M3FG 2SEBD 1RDPD 4A93B 1H9RA 2ZJRA 1STNA 3RMHA 4MHEA 1PZJD 2EQSA 1QVGA 4C3HH 4RGOS 1SE2A 1OTCA 2L1BA 3IRBA 2WIIB 1LTGD 2X6LA 3P20A 1D5XC 1UUPA 4YWLA 2B2UC 1JORA 4HJAA 3L7ZC 1Y14B 1JJCB 3T13A 2HCCA 5DEHA 1Y8OB 1IW7D 2FINB 2VQEQ 1VF5C 2ZJQA 3S1RH 2BH2A 4JBWA 3UE0A 1SFOH 3VA7A 3I72A 2OTJA 2JA5H 5JJIA 3KF8A 3OYYA 1ZEQX 3VR4A 3HOZH 2KCTA 5H1SE 2PYKA 2D0OA 4IUUA 2SDFA 4O0AA 3OTOQ 3KJOA 4LF9L 2A73B 4C3JH 1K0RA 3J81i 3MEFA 3S2HH 1U0LA 2E74C 1HZAA 2VNUD 4DAPA 3OPOA 5EKKA 3RZOB 3M4OH 5IYDG 3CC2A 4LUVA 3TZUA 1J6QA 2OXPA 4LW1A 1AEXA 1XMOL 3FKIB 4KHVA 4QY7A 3MEHA 3KF8B 4LJZC 3O13A 5A35A 5T1IA 1AZPA 2K5VA 2R92G 2UXDQ 2JXMB 2E2JH 3K6OA 1GXDC 2JA7B 2X69A 4GNXC 4LF9Q 1I5FA 2K33A 1PRTC 1V8QA 1IBKL 3JAMi 2MQHA 1B53A 4XTCS 4HR7B 1G91A 4DV5L 1VQMA 4DV4Q 3G6EA 3F2UA 3GD7A 1VQIA 4I7ZC 3C3LA 1XMOQ 1I3QH 3BYTB 3CD6A 1BDOA 2XVSA 5DAUA 2B29A 1JICA 3U4VA 2QEXA 1E2ZA 2B63G 3A7AB 3OW7A 5C3EG 5JPMC 2HIVA 3I4MH 3PO3G 1N32L 1HH2P 1RF2D 4LNQA 5I6YA 3H3VI 2YYZA 2B3GA 2EYHA 3CC4A 4A93G 4ABNA 3E3XA 1IBKQ 4X62L 2JA9A 4JW0A 1P16A 2J0TD 1SSOA 4DV5Q 1VQNA 2F4VL 1CSQA 3HOVG 2E8GA 2E2IH 4WRDA 2EZVA 1S5BD 2R7ZH 1EZ6A 1ZKOA 4JI4L 3NEMA 3PUVA 4LFBL 2RCNA 3TS2A 1JB7A 5EPLA 1QNKA 1NAPA 3A55A 2WACA 5COYA 5LL6X 5AFWA 3TN2A 4BBSH 3CC7A 4A3IH 2RF4A 2SNSA 2YU9H 4FDBA 1TKWB 1N32Q 4JI0L 3GDEA 2K52A 2H1EA 5M5WH 5FLMG 4DV1Q 2HDMA 3NWTA 4X62Q 2E5LL 3KFUA 3EA6A 4BBRB 5M5XB 3HOXH 4BA2I 2F4VQ 4POFA 1DJRD 2A6ED 2VB3X 2EYMA 3NUCA 3GTGB 1G6PA 5E3FA 4JI4Q 4BXXH 4LFBQ 3D6CA 1E7ZA 3GTKH 3DWAA 2NVYH 4DR5L 1F2LA 2FJ2A 2F0NA 3G48A 4MTNA 2VUMG 2CFMA 2Z6KC 3NXWA 4JI0Q 3Q0AA 1YHBA 4XQQA 3DEOA 1S40A 1K3BC 2E5LQ 4XIGS 4ALPA 1MGSA 3TP8A 1WCMB 1HR0L 2IT1A 2JA7G 1C7YA 2BE5C 4NXML 2KECA 4DN4M 4ZRZA 3MFYA 1X6OA 4LF6L 2CQOA 1DYQA 5IYBG 4GLAC 3S17B 3CQZH 2FMMA 4JI2L 1BCPC 4YIJA 3PCOB 4DK3C 1TWAH 2AUJD 1NE3A 4IJHA 1MKHA 4DAYA 1QVFA 3RZDH 4CBVA 3RUZA 2PCFB 1QVCA 5DM63 3NELA 2NVXH 1HR0Q 2L15A 1E3PA 4CJ0B 5I4DA 1Q8IA 3ER0A 2EYPA 1QB5D 1YEZA 4GN4B 4LF6Q 3KUPA 5EPKA 3OSOA 2I5MX 5JJLA 5ISRA 3NE5B 2CW0D 2WKCA 4KK7A 3HOVH 3KLWA 1EYGA 3K7UC 4JI2Q 1DOKA 1EOTA 2IX1A 4DAYB 2F52A 2B2WA 1B3QA 5C0XH 1IKMA 3M9BA 2PQAA 3DXJC 1XNQL 1Z6HA 3TZDA 5KEEA 2EOTA 1GKHA 4JBMA 4K6DA 1VQ6A 4YCUA 2C35B 4A3FH 3G6JB 4OO1G 4B9WA 3KDFA 5C3WA 3K7AB 4BBRG 3ERQA 5FO8B 3VR3A 1ET9A 4A3GG 1PHJA 2NN6I 5I2YA 3PGZA 1G8ZD 4IUQA 2N49A 5CV6A 4CKEA 1IBLL 3FPPA 2VS1A 1OO9B 3T51B 2O4XA 4DR2Q 1K9MC 1XNQQ 3A8IE 1GHJA 2Q2HA 2HHHL 2VUMH 3RNUA 3RZOH 3L3OC 2F0UA 1LTID 1ZYRD 4XYQA 2QEJC 1GO3E 3KDFB 3TSSA 2DNEA 4RMFA 4DFAA 4OWTB 4DGZA 5FLXc 3MVVA 1BF4A 1WCMG 2M00A 3ZJYC 1VQLA 4M8AA 1ML0D 1HQMC 5D3IB 1WD0A 4DKAC 1VQJA 1IBLQ 1PFBA 3WWVA 2UUBL 1TWGB 4H13C 4HCEA 4JBJA 3VR2A 1Q81C 3CHBD 2I07B 2D9UA 3D0FA 2HHHQ 1LTAD 3N52A 5E4XA 1HNZL 3BDCA 1FGBD 4A3LG 2AQ2B 3I4NH 2KBNA 3SK4A 1KNEA 4CJ1B 3C1EA 2XN9C 5D3DA 1JE4A 1B2TA 1QNUA 2EDGA 1N34L 2MNAA 2R3ZA 4NKLA 3MAQA 5CV8A 2F0QA 3CRKC 5FJ8H 5HGTA 2KUMA 2I5HA 5BR8L 5EBCA 5LMUL 5M9OA 5EAYA 4DUYL 4C1NK 1XJVA 1PYBA 1WOCA 3GQBA 4RFBA 4KN7C 4RCNA 1SE3A 1M1KC 3ULLA 4HIOA 1L1OA 1TWFB 1HNZQ 5CGKA 1SE8A 1JT8A 2K5DA 4OEMB 2A69C 2OEOA 4P75A 1LT3D 1CTMA 5HY6A 4DPGA 4LFCL 4IUTA 1KDAA 2JEBI 1IKLA 4NB3A 1PV4A 4C3HB 3T1YL 2Z9HA 1N34Q 4LF8L 1C9OA 1TS4A 4KJNA 1G6ZA 3GTOH 4YCVA 3I4LA 4EX5A 3CMEA 4DR1Q 5BR8Q 3NQIA 2B2TA 5LMUQ 2L0CA 4K5VA 3NPPA 1LACA 5A2QE 3W2DA 5ELOA 4DUYQ 4A3GH 1AFPA 1WTHA 3VYRA 4XQNA 5IWAL 3VR6A 4FF3A 2NTTA 3J80c 1L1OB 4QIWE 3BZDB 1TS5A 1TY0A 3S1RB 1SFOB 1EIFA 3D8GA 3UDFA 1O7IA 3H3VH 2JA5B 3ITPA 4ILWA 5A2QL 1FJGQ 4LFCQ 1PVOA 1ENFA 3HOZB 1UAPA 4IOCA 2JA8H 3T1YQ 4LF8Q 2EIFA 3MZ5A 3K58A 1RD9D 4C3JB 3CW2C 4OWWB 3S2HB 2SNMA 1W2BA 4JVZA 2UU9L 5IWAQ 4OXPA 2ZJPA 3M4OB 2ICIA 1SN8A 1GUOA 3S15H 2A8VA 4ZKBB 2Z0SA 3G71A 1E2VA 3GV3A 2E2JB 3I55A 2DJFC 4P74A 1EYDA 1IYVA 4DV6L 4JI7L 4JI5L 1IW7C 2B2UA 3UDIA 5I2XA 5C4ZA 1NCVA 3GP7A 2ZXOA 1ET6A 1PFSA 1K83H 2UU9Q 1SAPA 4RWSC 2F0OA 3EIVA 2RHQB 5GQOA 4DU9A 4AQYL 3OMCA 1I3QB 2HQEA 1KRSA 2EXDA 3M4QA 1J5EL 3N6RA 4X66L 5CC4A
chains in the Genus database with same CATH topology
1OXSC 3HG9A 3EVQA 1SMYD 3M7GA 3SK8A 1T5XD 3I4MB 1F2MA 2WV6D 3SEBA 5EJWA 4IUPA 3K0YA 1F9RA 2Z4HA 3I91A 4GZYC 4C3HG 4RGNA 2E2IB 5G3LF 1GUSA 2R7ZB 3MWYW 3AMUA 4L6TB 3K5LA 3E6ZX 3PIO3 3SK6A 1A3UA 3PUXA 3A56A 3VR5A 4BBSB 4A3IB 2YU9B 2C5CA 1KAAA 1SE4A 3KK7A 4TRDA 4ODGA 4XQJA 2R93B 4KTAA 3HOXB 3V96A 3T56B 5C4HA 4ZUJA 4FXDA 3J81E 3BS1A 4C3JG 1JQYD 1EIGA 1WVLA 3BVMA 3GTKB 4O1NA 2D5DA 2NVYB 5C0XJ 3ND8A 1S5FD 3D4DA 4EQNA 4RGMA 1F9QA 1Q90A 2LFNA 4Q5VA 1A2UA 1HHVA 1PRTB 5CBAE 4N9PA 2LS01 1L0XB 3K57A 2B2TC 3OIPA 1STYA 4CKBA 1JWMD 2NN6H 1DCZA 2NYZD 2QKIC 4FXKC 4WFN3 3V05A 2F4IA 4KJOA 4C2MB 5FO9B 1TY2A 4K5WA 3NTIA 3CQZB 1SNMA 4OIKA 1TWAB 2RSOA 2A6EC 3FDTA 2JYOA 2F0DA 2L9HA 1NR2A 3RZDB 3SE0A 3G7LA 4HEDA 1EL0A 1SNCA 1CQFA 2NVXB 4H7BA 1C4QA 1K8MA 3RD4A 2N88A 4TKOB 4ULLA 2KVMA 5CMDA 3LX0A 2KCCA 1VF7A 2MGSA 3C2PA 1BUVT 4L8JA 3I90A 1Q12A 5IGEA 3HOVB 5E4WC 1VDZA 3K5MA 2F0TA 2WAQB 4CHTB 3S9WA 1Y8NB 1EWCA 1JOOA 5JVG3 2PW5A 2L12A 5FOBB 2L55A 4ZKCB 4A3FB 1SYCA 2F0PA 3QJYA 5K36H 3OWEB 2PW7A 4HMIA 1L0YB 2AWNA 4Z9CB 3V2TA 2ZXPA 3LNNA 1RTOA 3SVMA 4FF2A 3PIP3 2VUMB 3BDOA 4ZUIA 2OF1A 2CW0C 3A8JE 3LWUA 1HTPA 1D5ZC 1EU4A 1HUNA 2JP1A 2N55A 2EJFC 1BCPB 2PQEA 2PZTA 5KIXA 3NTKA 3QWNA 4DA2A 1WTPA 3DWPA 3BVGA 2KQ3A 2F0IA 1KTKA 1PDQA 3I4NB 3ONAB 3BYYB 3OIQA 2EY1A 2H4OA 1YNND 4K8IA 1MSGA 2B8GA 2IWHA 5FO7B 3OHXC 5CV7A 5JEAJ 2EYJA 2BA0A 1ZYRC 3PUWA 5I6WA 2Z8LA 4DK1A 2BA1A 3J7AF 4K14A 2DY8A 3FPUB 5F2DA 1EY7A 5BN5A 4K5XA 4K6LA 3KBGA 2EYOA 5C0XG 1F2YA 2F0LA 2MJ8A 1CA6A 2PZWA 2F0WA 4PMWA 3ND9A 5CORA 1F9PA 3GTOB 2IW3A 1U4MA 4BA1I 4DF7A 5IODA 1IYUA 4KD4A 4A3GB 5CV5A 1HQRD 5ELFA 5G3LD 2GA4B 1PLFA 3SR1A 3NWSA 2B2VA 2EY6A 1O78A 1F9SA 3PV0A 4TQUS 2JA8B 2B39A 1MBYA 3R8BA 1B9MA 5C5LA 3P75A 2FFKB 1B44D 1SYGA 1F2ZA 1RODA 3VYUA 4IUVA 4EQPA 1A6XA 2K32A 2F0VA 1I4RA 3S15B 1EFID 3X3MA 2CVRA 1U4PA 2XWBB 1A3VA 1STEA 2K28A 4FP5D 4V190 2L11A 3NK9A 5KYLA 2IX0A 1WTOA 4X3UA 1EEFD 1RHPA 1K83B 2M2LA 1V1PA 1I4GA 3URYA 1Q3LA 1TVXA 4H0LC 1BO0A 1QJOA 4XXEA 4QMGA 2JA6B 3EQLC 4PV1C 3M85A 2AUKA 3X3NA 4X3TA 1TR5A 4EVOA 1HCZA 3TMEA 1XX8A 2EVBA 2R6GA 2NWGA 4F88A 1V1PB 1W6KA 1C48A 4Q0FA 2HUGA 3Q22A 1JR0D 3H91A 1JB3A 1SDFA 1HFGA 1XWEA 1PXUA 1KNAA 1SNOA 1TS2A 1Q1BA 3MXGA 1GUNA 1AZQA 1FYCA 2F0HA 3Q24A 1D1IA 3QO2A 1KDCA 1TIID 3MXNA 3KLRA 3UI2A 1SMYC 5JOBA 1DD2A 1AW7A 4OHJA 1D1KA 4F8MA 1SYBA 3H3VC 1KLUD 5C44B 3R3OA 2F0JA 1U4LA 1JOQA 5J22A 5JEAG 5IGFA 4PMCA 5KRUA 1WTVA 4A3DB 3HOYB 4TSSA 5C4JB 1WTXA 2XNAC 4HSPA 4FVMA 4X3SA 2QCPX 5EQ0A 2B2VC 5KYIA 1FD7D 3HZXA 1STHA 2K05A 2VXWA 2F3WA 3SK5A 2ICEC 1D5MC 1S5ED 4QCLA 2AQ1B 4BY7B 2A6HD 1LABA 3SDZA 1CT1D 1M4VA 1PTOF 2IL8A 1HXYD 1CA5A 4OGQC 1OXUA 2RQXA 1RJTA 1LTTD 4IALA 2A74C 3NQTA 1NSNS 3GTJB 5D65A 2NB0A 1AN8A 1RCVD 1EY5A 4G7ZC 2DNCA 4KY7A 2O5IC 1STGA 1Z7TA 5FLXE 2K7VA 1SBBB 2TMPA 3BG3A 1V1OA 2WP8J 3HS0C 5FLXL 1PMRA 1GUWA 1WTQA 2A5HA 2K5WA 4J1MA 3WDNA 3S1NB 4KV6A 5JEAH 2QDBA 2RVLA 5CV4A 1DONA 4XDXA 1LT6D 2FMCA 2B2YC 3CKIB 1F77A 2EYLA 2RBMA 2CHBD 4A3EB 2NN6G 2NVQB 2F0SA 3DWQA 1W6JA 3CU7A 3MTSA 3LWEA 1JCKB 1HPCA 1RKNA 2L4NA 3W3AA 2RDHA 2XRQD 1STAA 2F0FA 2MP1A 1BR9A 3WOEA 1Q1EA 4RHSA 2F3VA 2WINB 1SYDA 3NBHA 4ZK9B 2E2DC 4G4KA 4F7XA 4NP5A 2IX3A 5J1ZA 3R2IA 4BY1B 2CQAA 5DNFA 4WJWA 1O7ZA 2V4DA 4IQZA 1NUCA 3SXHA 1I4HA 2JE6I 2F0EA 1CHQD 3J80E 2JSOA 3WOFA 4R9WA 2NTSA 2KHSA 1LT5D 1EY6A 1H9SA 2XWJB 5EKLA 1EY9A 3J80L 1JWSD 1ENCA 5IGBA 3FRPB 3MXPA 1XYIA 1EYCA 1A2TA 1FNWA 5K36G 1HA6A 2KCNA 3AU7A 1O7LA 1CZWA 1E0BA 4KKSA 1YNNC 5C6AA 1H9SB 4ZAIA 3D3RA 2ENBA 3NBIA 4LK1C 1VMPA 2E2HB 2EJGC 4K2KA 1A3TA 3J81L 3NTHA 2Y0SB 1DM0B 4EGVA 1HFNA 4UDUC 2BDOA 2RA4A 1BXTA 1STBA 3HGBA 1ONLA 3I8ZA 3L9AX 4LMQD 1PTOH 4U673 1CHPD 1KDBA 4KY6A 4N9TA 1O7YA 3JAME 4QB4A 2VB2X 4KY5A 3TBIB 2Q8IB 2EY2A 2F03A 1GUGA 2EE1A 2F1MA 3E0JA 1HA5A 2Q8TA 2F0GA 3JAML 2PMZB 2J7ZA 4KHZA 4F87A 2MPMA 1NR4A 3H0GB 3QG1A 4KI0A 1I4PA 3P1HA 1H9MA 3GTPB 2A68D 2NBFA 4U68A 2I46A 4L63B 2SOBA 3TP7A 4A3BB 1SNPA 4NDXA 1EZ8A 4JK1C 2G9HD 2E76C 3K5NA 4K2LA 1QG7A 1JC7A 4R8IA 3S2DB 4EQOA 4I65A 2RKSA 1ESFA 2NVTB 5JAVA 3EROA 2BCOA 1MSHA 1PTOD 2M9VA 2O2LD 1LTRD 1E2WA 4MIUA 1ILQA 5C3XA 2WKDA 4J6HA 4HTHA 2J4XA 2AQ3B 4NW2A 3BDLA 4K8JA 2LKVA 3AB9A 1VCIA 2DY7A 2KJXA 3C46A 3S14B 3U9OA 2EYFA 2RDFA 3ZYYX 3P7JA 1KLGD 3NSWA 3HP3A 5ELDA 5C5MA 5I9PA 1JOKA 1PZKD 5EKIA 5BN4A 2K6AA 4S3SA 3I73A 4FNFA 4B08A 5KNDA 2K5QA 3D4RA 3OOCA 3QOLA 5IOCA 1LTSD 1R4PB 4ID6A 1EY4A 1S5CD 3HOWB 2K01A 3HRZC 2NUCA 4OO1I 1FR3A 2DN8A 5D14A 3Q6SA 3MA2B 1QWYA 2BOSA 4DK0A 5BN3A 3GTMB 3S16B 1ESRA 1EQTA 5T1GA 3OMGA 5KGUA 1GHKA 2ZT9C 1EY8A 3TDQA 1SNDA 4BWGB 1BCPF 1OXVA 2FHTA 4RKLA 1HRJA 1HUMA 1WTWA 1I6HB 4HSVA 3CRLC 4KMUC 2EPBA 1I6VC 1ZXTA 1R9TB 2ZXRA 4XT1B 3I70A 3RLFA 2EY5A 3M7NA 1SEBD 4CKCA 3DHQA 1UEAB 2C9OA 1SNQA 1SYFA 1Y1WB 1YNJD 3DEPA 2A6HC 4DNTB 4HN7A 1TWCB 1G2TA 1FNUA 1SJHD 4PQXA 2KEDA 3D31A 1B1ZA 3GO5A 2F0MA 3PMFA 1ICWA 5K5PA 1PFNA 1S5DD 1GJXA 1BNZA 3KLSX 3GTLB 3R2TA 1EYAA 3BVZA 2QILA 5IIFA 4BS9A 4RH6A 1II3A 3MFGA 2R61A 5KNCA 4P2CB 4H44C 1BOSA 4XYOA 1MD2D 4KN4C 1CFMA 4MN3A 1S4ZA 1D6EC 4QUCA 4QIWB 1CZGA 2EJMA 2IJ0A 4CJ2C 1HTLD 4IFDJ 5ELCA 4IZ8A 3DUZA 3TP6A 3KBXA 4ZLTF 1QOHA 1J8IA 3PO2B 3GV6A 4M1UB 2XIWA 3R93A 4HAEA 1LT4D 1QE6A 1UNSA 3DMUA 3M4YA 4KD3A 1SJED 1LLRD 4ME5A 3Q23A 4IFDI 2B2YA 4FXGC 2B8FA 5IGDA 2G9DA 3S1QB 1GUTA 4QF4A 2RDGA 2XSCA 3QOJA 5ELBA 1PRTD 2D62A 1TWHB 4DAVA 2KEEA 2IPKD 1U4RA 3NP8A 4DXGA 2MUYA 3U9SA 5HURA 1IHZA 4NMZA 3IFDA 5EGTA 1B9NA 3OWFA 4FO2A 5LL6S 2Z1CA 1Y1VB 1Y8PB 1SYEA 4G7HC 1X3QA 5I9OA 5C4XB 2E75C 1Z47A 4O42A 5EBDA 1TU2B 2X6GA 3A8KE 4CGYB 4A3JB 1WD1A 4OIJA 2XRSD 1PTOB 4B9XA 4LAAA 3TP5A 2D2CC 1I4QA 3QB3A 3M3YB 4HCSA 1ENAA 2PNRC 5CBEE 3SHLA 2PPBC 3EJIA 5JPNC 4UAIA 5FK9C 2KA7A 1B3AA 3IL8A 1B50A 1TQOA 3A54A 1MI2A 5LHY1 5IT9E 3H94A 3T53B 1I50B 2ID0A 1DOLA 3K5OA 1RTNA 3T4AC 2AWOA 4KKTA 4A3KB 1OXTA 5IT9L 4DNRB 1KABA 3IKJA 3FVQA 3FMCA 1X3PA 2LY7A 1AP0A 2MHVA 3DM1A 1QCBD 5NUCA 1C8CA 5IGCA 2WB1B 4RA8A 4G57A 4ZQ3A 4C1NI 4PNYA 1PYWD 1T5EA 2BE5D 3H09A 3MHBA 4HMJA 3HKZB 4C56C 3D6WA 4OO1H 3D4WA 4IUNA 4ZYSA 1CQVA 1BCPD 3MXUA 3VA5A 1O80A 5ELEA 4RAUC 5M3MB 1G2SA 2Z4IA 2A68C 4J8QA 4A3MB 1ILPA 5CR3A 1XXGA 1K8OA 1J9OA 4IURA 1TS3A 2TSSA 4AYBB 1CK1A 1PFMA 5JJZA 1EQVA 3GTQB 1FNVA 4IFDG 5CYUA 1TT2A 1H9KA 2B2WC 3IAYA 1B4OA 3VYTA 2EXZA 1X32A 2NZ1D 2BDNA 2O5JC 1EY0A 1WTRA 3PUZA 1SXTA 4OL7A 5M5YB 4C3IB 4RGTA 1LV9A 1PTOC 2HDLA 4PMBA 1VMCA 2PZUA 1IL8A 3H6MA 4V0BA 5EPJA 2KOLA 5CV9A 4E6IA 1BQQT 1EU3A 2K03A 4WORA 5TSSA 1EWHA 3EFXD 4KKUA 5FKAC 3MC0B 2K1BA 1EEID 3HOUB 3VYSA 5M3FB 1D2BA 4RHRA 1G291 2K04A 3QIAA 4FYDA 1R4QB 2JEAI 4Y7NB 1DOMA 4RCOA 5E1FA 2RSNA 2LMCB 1QILA 1DXMA 2L5TA 2PO4A 1XTCD 2QF7A 2Q8RE 1A15A 5M5WB 3A7LA 1LTBD 4RKBA 4FF4A 4R8NA 5IGGA 4IFDH 4DXFA 3IFTA 1GOZA 2A69D 4QUFA 4IN3A 1U9RA 3HEJA 3J7AV 1OXXK 3T16A 2R92B 4C3IG 1CM9A 1I4XA 1CI3M 3J7YW 4G7OC 1EIHA 4XT3B 5KNBA 5C0XI 1DZ1A 5JVH3 3S1MB 1M8AA 3KLSA 3FEWX 1V43A 1LO5D 3PUYA 3K59A 1H9JA 1PZID 3I3CA 2HCIA 4FF1A 2OT2A 1YNJC 1JWUD 1Y69U 3NHHA 2B63B 3C1FA 5C3EB 1PRTF 5J39A 4X3KA 2F0KA 5DM73 3PO3B 1BBXC 3E5SA 2SEBD 1RDPD 4A93B 1H9RA 1STNA 3RMHA 4MHEA 1PZJD 4RGOS 1SE2A 2L1BA 2WIIB 1LTGD 2X6LA 3P20A 1D5XC 1UUPA 1JORA 2B2UC 3L7ZC 3T13A 2HCCA 5DEHA 1Y8OB 1IW7D 2FINB 1VF5C 4JBWA 3VA7A 3I72A 3KF8A 3VR4A 1ZEQX 2PYKA 4IUUA 2SDFA 2A73B 2E74C 2VNUD 4DAPA 3OPOA 5EKKA 3RZOB 3TZUA 2OXPA 1AEXA 3FKIB 4KHVA 3MEHA 4LJZC 3O13A 5A35A 5T1IA 1AZPA 2JXMB 3K6OA 1GXDC 2JA7B 2X69A 2K33A 1PRTC 1V8QA 1B53A 4XTCS 4HR7B 1G91A 3F2UA 3GD7A 4I7ZC 3C3LA 3BYTB 1BDOA 2XVSA 5DAUA 1JICA 1E2ZA 3A7AB 3OW7A 5JPMC 1RF2D 5I6YA 2YYZA 2EYHA 4ABNA 2J0TD 1SSOA 4WRDA 2EZVA 1S5BD 1EZ6A 1ZKOA 3PUVA 5EPLA 1QNKA 1NAPA 3A55A 2WACA 5COYA 5LL6X 5AFWA 3TN2A 2SNSA 1TKWB 2H1EA 2HDMA 3NWTA 3EA6A 4BBRB 5M5XB 4BA2I 1DJRD 2A6ED 2VB3X 2EYMA 3NUCA 3GTGB 5E3FA 3D6CA 3DWAA 1F2LA 2FJ2A 2F0NA 3NXWA 3Q0AA 4XQQA 3DEOA 4XIGS 1MGSA 3TP8A 1WCMB 2IT1A 2BE5C 2KECA 4DN4M 4ZRZA 3MFYA 1DYQA 3S17B 2FMMA 1BCPC 4YIJA 2AUJD 4DAYA 4CBVA 3RUZA 2PCFB 5DM63 4CJ0B 5I4DA 1Q8IA 2EYPA 1QB5D 3KUPA 5EPKA 3OSOA 5ISRA 3NE5B 2CW0D 2WKCA 4KK7A 1DOKA 1EOTA 2IX1A 2B2WA 5C0XH 1IKMA 3DXJC 1Z6HA 3TZDA 5KEEA 2EOTA 4K6DA 3G6JB 4OO1G 4B9WA 5C3WA 3K7AB 3ERQA 5FO8B 3VR3A 1ET9A 2NN6I 5I2YA 1G8ZD 4IUQA 5CV6A 4CKEA 3FPPA 1OO9B 3T51B 2O4XA 3A8IE 1GHJA 3L3OC 2F0UA 1LTID 1ZYRD 4XYQA 2QEJC 3TSSA 2DNEA 4DFAA 4DGZA 3MVVA 1BF4A 2M00A 4M8AA 1ML0D 1HQMC 5D3IB 1WD0A 1PFBA 1TWGB 4H13C 4HCEA 3VR2A 3CHBD 2I07B 2D9UA 1LTAD 3N52A 5E4XA 3BDCA 1FGBD 2AQ2B 3SK4A 1KNEA 4CJ1B 3C1EA 2XN9C 5D3DA 1JE4A 1B2TA 1QNUA 2EDGA 2R3ZA 4NKLA 3MAQA 5CV8A 2F0QA 3CRKC 5HGTA 2KUMA 5EBCA 5M9OA 4C1NK 3GQBA 4RFBA 4KN7C 4RCNA 1SE3A 1TWFB 5CGKA 2K5DA 2A69C 2OEOA 1LT3D 1CTMA 4IUTA 1KDAA 2JEBI 1IKLA 4C3HB 1TS4A 4KJNA 1G6ZA 3I4LA 3NQIA 2B2TA 2L0CA 4K5VA 3NPPA 1LACA 5A2QE 3W2DA 1AFPA 3VYRA 4XQNA 3VR6A 4FF3A 2NTTA 3BZDB 1TS5A 1TY0A 3S1RB 1SFOB 3D8GA 2JA5B 3ITPA 4ILWA 5A2QL 1ENFA 3HOZB 1UAPA 3MZ5A 3K58A 1RD9D 4C3JB 3S2HB 2SNMA 3M4OB 2ICIA 1GUOA 4ZKBB 1E2VA 3GV3A 2E2JB 1EYDA 1IYVA 1IW7C 2B2UA 5I2XA 5C4ZA 1NCVA 3GP7A 2ZXOA 1ET6A 1SAPA 4RWSC 2F0OA 4DU9A 3OMCA 1I3QB 2HQEA 3N6RA 5CC4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OXS C;  2BDO A;  3NE5 B;  2LMC B;  3HGB A;  3U9S A;  3MXU A;  1ZKO A;  3SE0 A;  1DXM A;  2L5T A;  3GQB A;  2NN6 G;  3P20 A;  3PUV A;  4KN7 C;  4RCN A;  1B9N A;  3L7Z C;  1ONL A;  2A6H C;  5C0X H;  4DNT B;  2A69 C;  2QF7 A;  1Y8O B;  3DXJ C;  1CTM A;  1IW7 D;  2A68 C;  1VF5 C;  1Z6H A;  1K8M A;  2B8G A;  4TKO B;  3D31 A;  2JEB I;  1HPC A;  1Y8P B;  4JBW A;  1TKW B;  2Q8I B;  4G7H C;  1K8O A;  2KCC A;  3VA7 A;  3I72 A;  4GZY C;  1VF7 A;  2E75 C;  4OO1 G;  3A7L A;  4L8J A;  4H0L C;  3VR4 A;  1GUG A;  2BA0 A;  5BN4 A;  1ZYR C;  1TU2 B;  1GJX A;  3W3A A;  1GUS A;  1QJO A;  1Q12 A;  3A8K E;  3I4L A;  3PUW A;  2F1M A;  4DK1 A;  3I73 A;  2BA1 A;  1VDZ A;  4IFD G;  4BA2 I;  5KND A;  2A6E D;  1Q1E A;  1H9K A;  3EQL C;  3VR3 A;  1LAC A;  3D4R A;  3OOC A;  2NN6 I;  5BN5 A;  4IFD H;  4PV1 C;  1Y8N B;  4KHZ A;  3VR6 A;  5C0X G;  2D2C C;  3PUX A;  2AUK A;  3M85 A;  5KNC A;  2E74 C;  3VR5 A;  2PNR C;  3FPP A;  2A6H D;  3IFT A;  3QG1 A;  4KI0 A;  1HCZ A;  2O5J C;  2A69 D;  2EVB A;  3T51 B;  4H44 C;  1LAB A;  3OPO A;  2R6G A;  3SDZ A;  2PPB C;  4KN4 C;  1H9M A;  1CFM A;  2A68 D;  3PUZ A;  3ND9 A;  2V4D A;  3QJY A;  4IQZ A;  3A8I E;  1GHJ A;  3TZU A;  2JE6 I;  1FR3 A;  2DN8 A;  2EJM A;  1OXX K;  2KA7 A;  1OXU A;  4OGQ C;  5K36 H;  3T56 B;  4LJZ C;  4BA1 I;  5A35 A;  4JK1 C;  4DK0 A;  1IYU A;  5BN3 A;  1CI3 M;  3H94 A;  4G7O C;  2E76 C;  4XIG S;  3T53 B;  1H9S A;  2DNE A;  2JXM B;  3LNN A;  5KNB A;  2IT1 A;  2K33 A;  2BE5 C;  2D5D A;  2AWO A;  1Q1B A;  3ND8 A;  4G7Z C;  1GUN A;  1O78 A;  3MFY A;  1GHK A;  1V8Q A;  1FYC A;  1HQM C;  1OXT A;  1Q90 A;  2DNC A;  2ZT9 C;  4KKT A;  4DNR B;  2O5I C;  3PV0 A;  1V43 A;  4XTC S;  4H13 C;  4HR7 B;  1Z7T A;  3BDO A;  3VR2 A;  3IKJ A;  4TQU S;  1OXV A;  1GUO A;  3PUY A;  5K36 G;  3FMC A;  1H9J A;  3GD7 A;  4I7Z C;  1B9M A;  1EWH A;  4KKU A;  2CW0 C;  2K7V A;  3M4Y A;  1E2V A;  3KLR A;  3A8J E;  1SMY C;  1HTP A;  1O7L A;  3LWU A;  1BDO A;  1YNJ C;  1DD2 A;  1Y69 U;  2AUJ D;  3CRL C;  3BG3 A;  2EJF C;  4KMU C;  4KKS A;  1YNN C;  2NN6 H;  2B8F A;  1IYV A;  1I6V C;  1H9S B;  1E2Z A;  1IW7 C;  1PMR A;  3A7A B;  1DCZ A;  2PCF B;  3OW7 A;  1A6X A;  1E2W A;  1G29 1;  1GUT A;  2K32 A;  3RLF A;  3QIA A;  2EDG A;  1T5E A;  2BE5 D;  4LK1 C;  1H9R A;  3WDN A;  2YYZ A;  5JEA G;  2JEA I;  2D62 A;  5JEA H;  2EJG C;  3CRK C;  3M7N A;  4OO1 H;  3AB9 A;  3N6R A;  2A6E C;  1VCI A; 
#chains in the Genus database with same CATH topology
 1OXS C;  3HG9 A;  3JAM c;  3EVQ A;  1SMY D;  3M7G A;  3SK8 A;  2JA6 H;  1T5X D;  1K3R A;  3I7F A;  5ELN A;  4R4C A;  3I4M B;  3KF6 A;  1D7Q A;  4JI7 Q;  1F2M A;  2WV6 D;  3SEB A;  5EJW A;  4IUP A;  4DNI A;  3K0Y A;  1F9R A;  1KRT A;  4B3S Q;  2Z4H A;  3I91 A;  3ICE A;  4GZY C;  2DGY A;  4C3H G;  4RGN A;  1BKB A;  2E2I B;  3DM3 A;  5G3L F;  1GUS A;  2R7Z B;  4AQY Q;  4HIM A;  3MWY W;  4TVA B;  3AMU A;  4L6T B;  3K5L A;  4X66 Q;  3E6Z X;  3PIO 3;  5J3B A;  4JI3 Q;  3SK6 A;  1A3U A;  3PUX A;  3A56 A;  3VR5 A;  4BBS B;  4A3I B;  2IHF A;  2YU9 B;  1UE5 A;  2C5C A;  1KAA A;  1SE4 A;  3KK7 A;  4TRD A;  3S24 A;  4ODG A;  1PA6 A;  2JA5 G;  4XQJ A;  4UHV A;  4R4I A;  2R93 B;  4KTA A;  2AHO B;  3HOX B;  3HOZ G;  3V96 A;  3T56 B;  1S72 A;  3CCM A;  5C4H A;  4ZUJ A;  3E0E A;  2K14 A;  1PH4 A;  4FXD A;  3J81 E;  3ERS X;  3BS1 A;  4C3J G;  4L5R C;  1JQY D;  1EIG A;  1WVL A;  3BVM A;  3GTK B;  4O1N A;  2D5D A;  1X3E A;  2NVY B;  5C0X J;  3ND8 A;  1S5F D;  3VDY A;  3D4D A;  4EQN A;  4RGM A;  1F9Q A;  5C44 H;  1Q90 A;  2LFN A;  4Q5V A;  2I0Q A;  1A2U A;  4IO9 A;  1X3F A;  2N8N A;  3BZC A;  1HHV A;  1PRT B;  4JI6 L;  2KHJ A;  5CBA E;  4N9P A;  2LS0 1;  1L0X B;  3K57 A;  2B2T C;  3OIP A;  1STY A;  4A3D H;  4CKB A;  4IPD A;  4QQB X;  1JWM D;  2ZTC A;  2NN6 H;  5C4J H;  3STB D;  3HKZ E;  4AIM A;  1JJG A;  1DCZ A;  2NYZ D;  2QKI C;  4FXK C;  4WFN 3;  3V05 A;  2F4I A;  4DV3 L;  4KJO A;  4C2M B;  5FO9 B;  1TY2 A;  1FVI A;  4K5W A;  3NTI A;  3OW2 A;  3CQZ B;  1SNM A;  4OIK A;  1P8L A;  1TWA B;  1YBY A;  4JI6 Q;  2RSO A;  2A6E C;  3FDT A;  3I56 A;  2JYO A;  2F0D A;  2L9H A;  1NR2 A;  4ZCK A;  1FL0 A;  3RZD B;  3SE0 A;  3G7L A;  2NZH A;  4HED A;  1EL0 A;  1SNC A;  1CQF A;  2NVX B;  2F3I A;  4BY7 H;  3I4M G;  4H7B A;  4PG3 A;  1HNW Q;  1C4Q A;  1K8M A;  3RD4 A;  2N88 A;  4TKO B;  3J7Z C;  4ULL A;  2KVM A;  5CMD A;  1MIU A;  3LX0 A;  2KCC A;  2QDL A;  3AYH B;  1QZH A;  1VF7 A;  2MGS A;  4DV3 Q;  1BUV T;  3C2P A;  4L8J A;  3J80 i;  3I90 A;  1Q12 A;  1PYS B;  5IGE A;  3HOV B;  5E4W C;  1VDZ A;  3OTO L;  3K5M A;  2F0T A;  2Z6K A;  2R7Z G;  2WAQ B;  4CHT B;  5JJK A;  3S9W A;  1Y8N B;  1EWC A;  1JOO A;  2OWO A;  5JVG 3;  3GTJ H;  1K8A C;  1KD1 C;  2PW5 A;  2L12 A;  5FOB B;  4BBS G;  2L55 A;  4A3I G;  4ZKC B;  4A3F B;  1SMX A;  2BH8 A;  1SYC A;  2F0P A;  3QJY A;  4DV7 Q;  5K36 H;  1TXY A;  3OWE B;  1WJJ A;  2PW7 A;  2UXD L;  4HMI A;  2R93 G;  1L0Y B;  3HOX G;  2AWN A;  4X6A H;  3K80 C;  4Z9C B;  3V2T A;  2ZXP A;  3LNN A;  4LF4 L;  4BXX G;  1RTO A;  3SVM A;  4DV4 L;  4FF2 A;  3PIP 3;  2VUM B;  3BDO A;  4ZUI A;  1YIJ A;  3S1N H;  2OF1 A;  3PSI A;  3RN5 A;  2CW0 C;  3A8J E;  3LWU A;  1HTP A;  1D5Z C;  1EU4 A;  1HUN A;  1B8A A;  2JP1 A;  2N55 A;  2EJF C;  1BCP B;  4IPC A;  2PQE A;  4A3E H;  4DUZ Q;  2NVQ H;  1Z9F A;  4LF4 Q;  2PZT A;  1SRO A;  5KIX A;  2HD3 A;  3NTK A;  3CCR A;  1EQR A;  3QWN A;  4DA2 A;  1WTP A;  1KL9 A;  3DWP A;  4DR3 L;  1VQB A;  4WJ4 A;  3BVG A;  4LF5 L;  2KQ3 A;  2F0I A;  1RL2 A;  1KTK A;  1PDQ A;  3I4N B;  3ONA B;  3BYY B;  3OIQ A;  2EY1 A;  2H4O A;  1YNN D;  3TRZ A;  4K8I A;  1MSG A;  2B8G A;  4P72 A;  2IWH A;  3PIO A;  1PH8 A;  5FO7 B;  1CKN A;  1Q8K A;  3OHX C;  4BY1 H;  1XNR L;  2UXC L;  5CV7 A;  4DV1 L;  5JEA J;  2EYJ A;  2BA0 A;  1ZYR C;  3PUW A;  5I6W A;  2Z8L A;  4UP9 A;  4DK1 A;  4DR3 Q;  2BA1 A;  4LF5 Q;  3J7A F;  4K14 A;  2DY8 A;  3FPU B;  5F2D A;  1EY7 A;  5BN5 A;  4K5X A;  4K6L A;  2WAQ G;  3KBG A;  2EYO A;  5C0X G;  1F2Y A;  2F0L A;  2MJ8 A;  1CA6 A;  2PZW A;  4UY8 C;  2F0W A;  4PMW A;  3ND9 A;  5COR A;  1F9P A;  4A3F G;  3GTO B;  1CKN B;  2IW3 A;  1U4M A;  1XNR Q;  2UXC Q;  2WFW A;  4BA1 I;  4DF7 A;  3CCS A;  2R93 H;  5IOD A;  4OX9 Q;  1IYU A;  4KD4 A;  4A3G B;  5CV5 A;  1HQR D;  3KOJ A;  2XGT A;  5ELF A;  5G3L D;  2GA4 B;  1PLF A;  3SR1 A;  3NWS A;  1JJ2 A;  2B2V A;  2EY6 A;  1O78 A;  2XTI A;  1F9S A;  1XPO A;  3PV0 A;  4TQU S;  2JA8 B;  2B39 A;  1A0I A;  1KHI A;  2E2H H;  1MBY A;  3R8B A;  3UDX A;  1B9M A;  5C5L A;  3P75 A;  2FFK B;  3K81 C;  3SGI A;  1B44 D;  1SYG A;  1F2Z A;  2PI2 A;  4A75 A;  1B7Y B;  1VQ5 A;  1U5K A;  3A0J A;  1ROD A;  3VYU A;  1QZG A;  4IUV A;  1JE5 A;  4JCV E;  1LYL A;  3TQY A;  4EQP A;  1A6X A;  2K32 A;  1RIP A;  2JN4 A;  1X3G A;  4DR4 Q;  2F0V A;  1I4R A;  4LUZ A;  3S15 B;  1EFI D;  4HIK A;  3X3M A;  3CCE A;  1K8G A;  2CVR A;  4C2M H;  1U4P A;  2XWB B;  1A3V A;  1STE A;  2K28 A;  4FP5 D;  4V19 0;  2L11 A;  3NK9 A;  5KYL A;  2IX0 A;  4QJF A;  3I4N G;  1WTO A;  4X3U A;  1EEF D;  1RHP A;  1K83 B;  1KC8 C;  2M2L A;  3H0G H;  4ME3 A;  2ZM6 L;  1V1P A;  1I4G A;  3URY A;  2D0P A;  1Q3L A;  1TVX A;  1YVC A;  5FJ8 G;  3GTP H;  1PH9 A;  3CCV A;  4H0L C;  1BO0 A;  4GOP C;  4GN3 B;  1QJO A;  1HJP A;  4XXE A;  4QMG A;  3HFZ B;  2JA6 B;  4A3B H;  3EQL C;  4PV1 C;  1PH2 A;  3M85 A;  2AUK A;  2CCZ A;  3X3N A;  4X3T A;  1LTL A;  1TR5 A;  4EVO A;  1HCZ A;  4DR2 L;  3TME A;  1XX8 A;  2EVB A;  2R6G A;  2DJG C;  2NWG A;  5IT9 c;  3S2D H;  2AMC B;  4F88 A;  2K5H A;  1V1P B;  4UP8 A;  1FGU A;  1W6K A;  2ZM6 Q;  1C48 A;  4Q0F A;  3RLO A;  2HUG A;  3Q22 A;  1JR0 D;  2NVT H;  3H91 A;  1JB3 A;  3PIP A;  1SDF A;  1HFG A;  1XWE A;  4GS3 A;  1PXU A;  1KNA A;  1SNO A;  1TS2 A;  1Q1B A;  1MHW C;  3MXG A;  1GUN A;  1AZQ A;  2IY5 B;  1FYC A;  2PQA B;  4UP7 A;  2F0H A;  3Q24 A;  1D1I A;  3QO2 A;  1KDC A;  3E9H A;  5GRO A;  2JA8 G;  1TII D;  1VQK A;  3MXN A;  3KLR A;  3UI2 A;  1NNX A;  1SMY C;  5JOB A;  1VQG A;  1AW7 A;  1DD2 A;  4OHJ A;  4HJ5 A;  1Y1W G;  3S14 H;  1D1K A;  1L2F A;  2KCM A;  4F8M A;  1SYB A;  3H3V C;  1WYD A;  1KLU D;  2LXJ A;  4LWC A;  5C44 B;  3R3O A;  2F0J A;  4CDC C;  1U4L A;  1JOQ A;  3A5Z B;  5J22 A;  3LGJ A;  5JEA G;  1A63 A;  5IGF A;  4PMC A;  5KRU A;  4AH6 A;  1WTV A;  4A3D B;  3HOY B;  4TSS A;  3MXN B;  5C4J B;  1WTX A;  2XNA C;  4DAM A;  4JC0 A;  4HSP A;  4FVM A;  4X3S A;  2QCP X;  4DR7 Q;  3EN2 A;  5EQ0 A;  2B2V C;  5KYI A;  4A3C G;  3U50 C;  2VQF Q;  1GM5 A;  1FD7 D;  1NBW A;  3HZX A;  1STH A;  2YTY A;  2VZA A;  3HOW H;  3K0X A;  2K05 A;  2VXW A;  2F3W A;  5IE8 A;  2OQ0 A;  3SK5 A;  4DR1 L;  3Q8D A;  2ICE C;  1XMQ L;  1D5M C;  1X56 A;  2JA6 G;  4DK6 C;  1S5E D;  2Q2I A;  1UE1 A;  4QL5 A;  3GTM H;  4QCL A;  2AQ1 B;  3S16 H;  4BY7 B;  4O2D A;  1BBU A;  2A6H D;  1LAB A;  3SDZ A;  1FJG L;  1LM0 A;  1CT1 D;  1M4V A;  1PTO F;  2IL8 A;  1HXY D;  1CA5 A;  4OGQ C;  1OXU A;  1HZB A;  2RQX A;  1RJT A;  1LTT D;  4IAL A;  2A74 C;  1V9P A;  3NQT A;  3STB C;  1I6H H;  1NSN S;  3GTJ B;  5D65 A;  1WI5 A;  4R4T A;  1XMQ Q;  2NB0 A;  2Q2U A;  1AN8 A;  4RG1 A;  1RCV D;  1EY5 A;  3BJU A;  1R9T H;  4G7Z C;  2DNC A;  1YJ9 A;  4KY7 A;  2O5I C;  1T9H A;  1STG A;  1Z7T A;  1VQ8 A;  2DUD A;  1S3O A;  2PI2 E;  5FLX E;  2I5L X;  4PZ7 A;  3CPW A;  2K7V A;  1SBB B;  1SR3 A;  1VQ7 A;  2TMP A;  3BG3 A;  1V1O A;  2WP8 J;  2OQK A;  3HS0 C;  3JC6 6;  5FLX L;  1Y1W H;  1VQA A;  1PMR A;  1GUW A;  1WTQ A;  2A5H A;  1HNX L;  2K5W A;  5C44 G;  3AEV A;  4B3R L;  1TWC H;  3W1B A;  4J1M A;  3WDN A;  3UE1 A;  3S1N B;  4KV6 A;  5JEA H;  2QDB A;  2RVL A;  5CV4 A;  1DON A;  4XDX A;  1LT6 D;  2FMC A;  2B2Y C;  2PNH A;  3CKI B;  1F77 A;  2EYL A;  4A3D G;  2RBM A;  2CHB D;  3GTL H;  3HOY G;  4A3E B;  4LFA L;  1K73 C;  2NN6 G;  2NVQ B;  2F0S A;  3DWQ A;  4YWM A;  1W6J A;  2R7F A;  3CU7 A;  4MNO A;  3PF5 A;  4A3C H;  3MTS A;  3LWE A;  2VL6 A;  4B3S L;  1JCK B;  3CCJ A;  1HNX Q;  1HPC A;  4JI1 L;  1RKN A;  4B3R Q;  2L4N A;  3W3A A;  2RDH A;  1D8L A;  1STA A;  2F0F A;  2XRQ D;  1K0S A;  1Q86 C;  2MP1 A;  1BR9 A;  2OCE A;  4JI3 L;  3WOE A;  1C0A A;  1Q1E A;  4RHS A;  2QW7 A;  2F3V A;  2WIN B;  1SYD A;  3NBH A;  4G4K A;  2E2D C;  4R4Q A;  4LFA Q;  4F7X A;  4ZK9 B;  2CH4 W;  4BY7 G;  2K50 A;  4NP5 A;  2IX3 A;  1UE7 A;  3F2B A;  1YIT A;  5J1Z A;  3R2I A;  4BY1 B;  3PO2 H;  2CQA A;  5DNF A;  4WJW A;  1O7Z A;  2V4D A;  2P5Z X;  4IQZ A;  1NUC A;  3SXH A;  3CCQ A;  1I4H A;  2JE6 I;  2F0E A;  1CHQ D;  4JI1 Q;  2JSO A;  3WOF A;  1VQE A;  4R9W A;  3J80 E;  4HJ9 A;  2NTS A;  1BBW A;  2KHS A;  1LT5 D;  4GKK Q;  1EY6 A;  4OEL B;  4JG2 A;  1H9S A;  1YHQ A;  2XWJ B;  5EKL A;  1EY9 A;  2WB1 G;  3J80 L;  2CH4 A;  1E24 A;  1A8V A;  3NBH B;  1JWS D;  4CDF C;  1ENC A;  3KF6 B;  5IGB A;  3I4O A;  1AH9 A;  3S1Q H;  2CWA A;  3FRP B;  3MXP A;  1UEB A;  4KHP L;  1XYI A;  1EYC A;  1A2T A;  1FNW A;  5K36 G;  1HA6 A;  1W3S A;  1TWH H;  2ZTE A;  2KCN A;  1PH7 A;  3AU7 A;  1O7L A;  1YI2 A;  1CZW A;  1E0B A;  1AE2 A;  4KKS A;  1YNN C;  5C6A A;  2LSS A;  3UDG A;  2RHS B;  1H9S B;  1PH6 A;  4JI8 Q;  4ZAI A;  2R7D A;  3D3R A;  4IPG A;  3A5U A;  2ENB A;  2HT1 A;  3NBI A;  4DV0 Q;  4LK1 C;  1SLJ A;  1VMP A;  3ULP A;  4A3M G;  2E2H B;  1VQH A;  1Y1V H;  2EJG C;  4K2K A;  1A3T A;  3J81 L;  3NTH A;  4AYB G;  5C4X H;  2Y0S B;  1DM0 B;  4EGV A;  4KHP Q;  1HFN A;  4UDU C;  1CSP A;  2BDO A;  2RA4 A;  1BXT A;  1STB A;  2YV5 A;  3HGB A;  1X65 A;  4A3J H;  3HOY H;  2K4K A;  4A3E G;  1ONL A;  3HKS A;  3I8Z A;  3L9A X;  4LMQ D;  1PTO H;  4U67 3;  1CHP D;  1KDB A;  4KY6 A;  4N9T A;  1HNW L;  1KXL A;  1PH1 A;  3M3Y H;  1LUZ A;  1O7Y A;  1ASY A;  3JAM E;  4QB4 A;  2VB2 X;  4KY5 A;  3TBI B;  2Q8I B;  4K0K L;  2EY2 A;  3CF5 A;  2F03 A;  1KIX A;  1GUG A;  4WJ3 M;  1N8R C;  1VQ9 A;  2EE1 A;  2F1M A;  3E0J A;  1HA5 A;  1EQQ A;  2Q8T A;  1HZC A;  2F0G A;  3JAM L;  2JK8 A;  3CP0 A;  2PMZ B;  2J7Z A;  4KHZ A;  1I50 H;  2IHE A;  4F87 A;  2MPM A;  1NR4 A;  3H0G B;  3A74 A;  3QG1 A;  4KI0 A;  4JPB W;  1I4P A;  3P1H A;  1H9M A;  3GTP B;  4DV7 L;  2A68 D;  2NBF A;  4U68 A;  4BY1 G;  4A3K H;  2I46 A;  4L63 B;  4APV A;  2SOB A;  4K0K Q;  3TP7 A;  4P73 A;  4A3B B;  2QA4 A;  1SNP A;  4NDX A;  1EZ8 A;  4JK1 C;  2G9H D;  2E76 C;  3K5N A;  3HOU G;  4K2L A;  2ATW A;  3RLN A;  2K75 A;  1QG7 A;  4HID A;  1JC7 A;  4R8I A;  3CXC A;  3S2D B;  4EQO A;  4I65 A;  2CKZ B;  2RKS A;  1NTG A;  4MZ9 A;  1ESF A;  3DLL A;  2NVT B;  5JAV A;  3ERO A;  2BCO A;  1N36 L;  1MSH A;  1KQS A;  1QUQ A;  1K28 A;  2N3S A;  1PTO D;  4DUZ L;  1BVS A;  2M9V A;  2O2L D;  1EUJ A;  2FXQ A;  4LF7 L;  1HZ9 A;  1LTR D;  1E2W A;  4MIU A;  1ILQ A;  5M3M H;  3T1H L;  5C3X A;  2WKD A;  4J6H A;  4HTH A;  1XTD A;  2J4X A;  2AQ3 B;  4A3M H;  4NW2 A;  3BDL A;  3K8A A;  4L5Q A;  1YJN A;  4K8J A;  4OWX B;  4JOI C;  2LKV A;  3AB9 A;  1X54 A;  1VCI A;  2DY7 A;  2KJX A;  2Y0S G;  3F8T A;  4GOP A;  1N36 Q;  1Q7Y C;  3C46 A;  3S14 B;  1QUQ B;  3GTQ H;  3U9O A;  1UE6 A;  2AKW B;  2EYF A;  3J7A 5;  4GLV B;  4X65 L;  1Q82 C;  2RDF A;  3ZYY X;  3P7J A;  1KLG D;  4LF7 Q;  1NMG A;  3NSW A;  3PF4 A;  1CUK A;  2ALY B;  3HP3 A;  5ELD A;  5C5M A;  5I9P A;  3T1H Q;  1MJE A;  1JOK A;  1PZK D;  4PZ6 A;  4HJ8 A;  5EKI A;  5IP9 H;  3W1G A;  5BN4 A;  4POG A;  2K6A A;  4S3S A;  5M5Y H;  3I73 A;  4C3I H;  4FNF A;  4B08 A;  5KND A;  1XPR A;  2K5Q A;  4GOP B;  3D4R A;  3OOC A;  3QOL A;  5IOC A;  1LTS D;  1R4P B;  3U58 A;  4ID6 A;  1AE3 A;  1YHA A;  4CDD C;  4X65 Q;  3H0G G;  1UWV A;  1EY4 A;  1S5C D;  3W5O A;  3HOW B;  2K01 A;  3HRZ C;  2NUC A;  4OO1 I;  1FR3 A;  2DN8 A;  4UPA A;  3BZK A;  5D14 A;  4OX9 L;  1DGS A;  3Q6S A;  3MA2 B;  1QWY A;  2BOS A;  4DK0 A;  5BN3 A;  3GTM B;  4A3B G;  3S16 B;  1ESR A;  2KEN A;  1EQT A;  5T1G A;  3HOU H;  1YZ6 A;  2V1C C;  3TRE A;  3TS0 A;  1M90 C;  3OMG A;  1CKM A;  2Y0S E;  5KGU A;  5M3F H;  5IYC G;  1GHK A;  1EWI A;  5LMN W;  2ZT9 C;  1VQO A;  1EY8 A;  3TDQ A;  1SND A;  2H5X A;  4BWG B;  1BCP F;  1OXV A;  4L5S A;  1IL2 A;  3L0O A;  2FHT A;  4RKL A;  1HRJ A;  4Y7N H;  1HUM A;  1CKO A;  1WTW A;  1ASZ A;  1I6H B;  4HSV A;  3FHW A;  3CRL C;  4NXN L;  4KMU C;  2EPB A;  1I6V C;  1ZXT A;  4N8X 1;  1R9T B;  2ZXR A;  4XT1 B;  4N8F A;  4DR4 L;  3I70 A;  3RLF A;  2GVA A;  2EY5 A;  3F2D A;  2RCF A;  2PMZ E;  3M7N A;  1SEB D;  1VS0 A;  2YTX A;  4X64 L;  4CKC A;  3B6Y A;  3DHQ A;  1UEA B;  2C9O A;  1SNQ A;  1SYF A;  1VQP A;  1Y1W B;  1YNJ D;  3DEP A;  4NXN Q;  2A6H C;  4DNT B;  4HN7 A;  1TWC B;  3G4S A;  1G2T A;  5IY0 A;  5GAD C;  1FNU A;  1SJH D;  4PQX A;  2KED A;  3D31 A;  1ICF B;  1B1Z A;  3RN2 A;  3GO5 A;  2F0M A;  3PMF A;  2WAQ E;  5IYD H;  1ICW A;  5K5P A;  1PFN A;  1S5D D;  2NZO A;  1GJX A;  1KAW A;  3FKI G;  1BNZ A;  3KLS X;  3GTL B;  2R92 H;  3R2T A;  1EYA A;  3BVZ A;  2QIL A;  5IIF A;  4BS9 A;  4X64 Q;  4RH6 A;  4R4O A;  1IXR A;  1II3 A;  3MFG A;  2R61 A;  5KNC A;  4P2C B;  2A19 A;  4H44 C;  1BOS A;  4XYO A;  1MD2 D;  4KN4 C;  1CFM A;  3S1M H;  4MN3 A;  1S4Z A;  1D6E C;  4DR5 Q;  3HOW G;  4QUC A;  4QIW B;  1CZG A;  2EJM A;  2IJ0 A;  4CJ2 C;  1HTL D;  3KYH C;  5DLQ E;  3E9I A;  4IFD J;  5ELC A;  4B3T L;  4IZ8 A;  3DUZ A;  3TP6 A;  2B63 H;  3KBX A;  4ZLT F;  1QOH A;  1J8I A;  5C3E H;  3PO2 B;  3GV6 A;  3PO3 H;  4M1U B;  4NXM Q;  2XIW A;  5IYC H;  4A93 H;  3R93 A;  4HAE A;  1LT4 D;  1QE6 A;  1UNS A;  2JQO A;  4L5T A;  3DMU A;  3M4Y A;  4KD3 A;  1SJE D;  1LLR D;  4ME5 A;  3Q23 A;  4IFD I;  2B2Y A;  4FXG C;  2B8F A;  5IGD A;  1JMC A;  2G9D A;  1X55 A;  3S1Q B;  1GUT A;  4QF4 A;  4B3T Q;  2RDG A;  1E1O A;  4Y52 H;  2GN5 A;  2XSC A;  3RR5 A;  1NJI C;  3QOJ A;  5ELB A;  1PRT D;  2D62 A;  1TWH B;  4DAV A;  2KEE A;  2IPK D;  3TEH B;  5FLM H;  1U4R A;  3NP8 A;  4DXG A;  3AFP A;  5IP7 G;  1A62 A;  2MUY A;  3U9S A;  5HUR A;  1IHZ A;  4NMZ A;  3IFD A;  4DR7 L;  5EGT A;  1B9N A;  3OWF A;  4FO2 A;  2UUA L;  5LL6 S;  2Z1C A;  2VQF L;  1Y1V B;  1Y8P B;  1I94 L;  1SYE A;  4G7H C;  1X3Q A;  5I9O A;  5C4X B;  1VQF A;  2VW9 A;  5GAH C;  2E75 C;  1Z47 A;  4MTK A;  4GKJ L;  4O42 A;  1TU2 B;  2X6G A;  5EBD A;  2A1A A;  3A8K E;  4CGY B;  3FKI H;  2HQL A;  4A3J B;  4GLX A;  2K5N A;  2N78 A;  1WD1 A;  4B3M L;  4OIJ A;  2XRS D;  1VQD A;  1PTO B;  1VQ4 A;  4B9X A;  4LAA A;  3TP5 A;  2D2C C;  1I4Q A;  3QB3 A;  3M3Y B;  4HCS A;  4J15 A;  2JA7 H;  1ENA A;  2PNR C;  4P71 A;  2UUA Q;  5CBE E;  3EBE A;  2G5D A;  3SHL A;  4YY3 L;  2PPB C;  3EJI A;  5JPN C;  4UAI A;  5FK9 C;  1XPU A;  5IYB H;  2KA7 A;  1B3A A;  1I94 Q;  1IBM L;  3IL8 A;  1B50 A;  3PQI A;  1TQO A;  3A54 A;  4GKJ Q;  1MI2 A;  5LHY 1;  5IT9 E;  3H94 A;  3T53 B;  1I50 B;  2ID0 A;  1DOL A;  3K5O A;  4B3M Q;  1E22 A;  1RTN A;  3U4Z A;  5E7N A;  3T4A C;  2AWO A;  2CWP A;  4KKT A;  4A3K B;  1OXT A;  3PO2 G;  5IT9 L;  4DNR B;  3ULJ A;  5L37 A;  1KAB A;  3IKJ A;  2OTL A;  4YY3 Q;  2MFI A;  3FVQ A;  2UUB Q;  1Q46 A;  2LXK A;  3FMC A;  3BU2 A;  1X3P A;  2LY7 A;  1AP0 A;  2MHV A;  3DM1 A;  1GVP A;  1IBM Q;  1QCB D;  1IYJ B;  5NUC A;  3AQQ A;  1C8C A;  5IGC A;  2GVB A;  1IZ6 A;  2WB1 B;  4G57 A;  4RA8 A;  4ZQ3 A;  2MO1 A;  4C1N I;  4PNY A;  4JV5 L;  1PYW D;  4DV2 L;  1T5E A;  2BE5 D;  3H09 A;  3MHB A;  4HMJ A;  4CDE C;  5HGQ A;  3HKZ B;  5LMN L;  3F2C A;  4C56 C;  3D6W A;  4OO1 H;  3D4W A;  4IUN A;  4ZYS A;  5GAE C;  1CQV A;  4BBR H;  1BCP D;  5M5X H;  3MXU A;  4YWK A;  5IP7 H;  3VA5 A;  5GAG C;  1O80 A;  5ELE A;  1EIY B;  4RAU C;  1MJC A;  2MO0 A;  1G2S A;  5M3M B;  3GTG H;  2Z4I A;  2VY3 A;  2A68 C;  4PZ8 A;  4J8Q A;  4A3M B;  1ILP A;  4IOA A;  4JV5 Q;  5CR3 A;  1NY4 A;  1XXG A;  1Y1V G;  3CCU A;  1J9O A;  3M4P A;  1YNX A;  4IUR A;  4DV2 Q;  1K8O A;  1TS3 A;  2TSS A;  4DR6 L;  4AYB B;  1CK1 A;  1PFM A;  5LMN Q;  2YTV A;  5C4X G;  5JJZ A;  1EQV A;  3GTQ B;  4HJ7 A;  1FNV A;  4IFD G;  1N33 L;  5CYU A;  1TT2 A;  1H9K A;  2B2W C;  4A3J G;  3IAY A;  1B4O A;  4R1J A;  3VYT A;  4IPH A;  2EXZ A;  2JJQ A;  1X32 A;  1WCM H;  2ES2 A;  2NZ1 D;  2BDN A;  2O5J C;  1EY0 A;  1WTR A;  3PUZ A;  1V1Q A;  3CMA A;  1SXT A;  3J81 c;  4OL7 A;  5M5Y B;  4GKK L;  4KLK A;  4C3I B;  4RGT A;  1LV9 A;  4LUO A;  4DR6 Q;  1PTO C;  3S17 H;  3NEN A;  2HDL A;  3AFQ A;  4PMB A;  1YJW A;  4A3L H;  1VMC A;  2PZU A;  4YCW A;  1N33 Q;  1IL8 A;  3H6M A;  4V0B A;  3F1Z A;  4JBK A;  2UUC L;  5AJ3 L;  4A76 A;  5EPJ A;  2KOL A;  4H02 A;  1PH5 A;  2HIX A;  5CV9 A;  4E6I A;  4A3K G;  1BQQ T;  1EU3 A;  2K03 A;  2QGQ A;  4WOR A;  3CPF A;  5TSS A;  1EWH A;  3EFX D;  4KKU A;  1G51 A;  4JOI A;  3MC0 B;  5FKA C;  2K1B A;  1EEI D;  3HOU B;  3I2Z A;  1EFW A;  1GD7 A;  3VYS A;  4JI8 L;  1X9N A;  2ASB A;  5M3F B;  4DV6 Q;  1D2B A;  4RHR A;  1G29 1;  4DV0 L;  3CAM A;  4JI5 Q;  2K04 A;  3QIA A;  4FYD A;  2UUC Q;  1R4Q B;  1WFQ A;  5AJ3 Q;  2JEA I;  4Y7N B;  2UXB L;  1DOM A;  3H15 A;  3HKZ G;  4RCO A;  5E1F A;  3KJP A;  2RSN A;  2LMC B;  1J5E Q;  1QIL A;  4A4I A;  1DXM A;  2L5T A;  3K7A H;  4YHH L;  2PO4 A;  1XTC D;  4GNX A;  2QF7 A;  5M3M G;  2Q8R E;  1A15 A;  5M5W B;  4JYA L;  1PH3 A;  3A7L A;  2KHI A;  1LTB D;  3CCL A;  4I7A A;  2UXB Q;  2Z6B A;  4RKB A;  1B70 B;  4GN5 A;  4FF4 A;  4R8N A;  4IJL A;  5IGG A;  1L1O C;  4IFD H;  1HR0 W;  1VQC A;  2Q2T A;  4DXF A;  1EOV A;  1E1T A;  1N9W A;  3L2P A;  3FP9 A;  3IFT A;  1GOZ A;  2A69 D;  4QUF A;  4YHH Q;  4GNX B;  4IN3 A;  1U9R A;  3HEJ A;  4NPS A;  3J7A V;  2WB1 E;  1TWG H;  5IP9 G;  4JYA Q;  1OXX K;  3T16 A;  2R92 B;  1H95 A;  4C3I G;  3J81 j;  1CM9 A;  1I4X A;  1CI3 M;  3J7Y W;  4G7O C;  1EIH A;  4XT3 B;  5KNB A;  1L0W A;  5C0X I;  1DZ1 A;  5JVH 3;  3QR8 A;  3S1M B;  1M8A A;  3KLS A;  3FEW X;  1V43 A;  2ZTD A;  1LO5 D;  3PUY A;  3K59 A;  1H9J A;  1PZI D;  3I3C A;  4EQ5 A;  2HCI A;  4FF1 A;  2OT2 A;  1YNJ C;  1JWU D;  1Y69 U;  3NHH A;  2B63 B;  1SRU A;  3C1F A;  1NMF A;  5C3E B;  1PRT F;  5J39 A;  4X3K A;  2VQE L;  2F0K A;  4AYB E;  5DM7 3;  4OON A;  3PO3 B;  1BBX C;  4QGU A;  1TWF H;  3E5S A;  5M3F G;  2SEB D;  1RDP D;  4A93 B;  1H9R A;  2ZJR A;  1STN A;  3RMH A;  4MHE A;  1PZJ D;  2EQS A;  1QVG A;  4C3H H;  4RGO S;  1SE2 A;  1OTC A;  2L1B A;  3IRB A;  2WII B;  1LTG D;  2X6L A;  3P20 A;  1D5X C;  1UUP A;  4YWL A;  2B2U C;  1JOR A;  4HJA A;  3L7Z C;  1Y14 B;  1JJC B;  3T13 A;  2HCC A;  5DEH A;  1Y8O B;  1IW7 D;  2FIN B;  2VQE Q;  1VF5 C;  2ZJQ A;  3S1R H;  2BH2 A;  4JBW A;  3UE0 A;  1SFO H;  3VA7 A;  3I72 A;  2OTJ A;  2JA5 H;  5JJI A;  3KF8 A;  3OYY A;  1ZEQ X;  3VR4 A;  3HOZ H;  2KCT A;  5H1S E;  2PYK A;  2D0O A;  4IUU A;  2SDF A;  4O0A A;  3OTO Q;  3KJO A;  4LF9 L;  2A73 B;  4C3J H;  1K0R A;  3J81 i;  3MEF A;  3S2H H;  1U0L A;  2E74 C;  1HZA A;  2VNU D;  4DAP A;  3OPO A;  5EKK A;  3RZO B;  3M4O H;  5IYD G;  3CC2 A;  4LUV A;  3TZU A;  1J6Q A;  2OXP A;  4LW1 A;  1AEX A;  1XMO L;  3FKI B;  4KHV A;  4QY7 A;  3MEH A;  3KF8 B;  4LJZ C;  3O13 A;  5A35 A;  5T1I A;  1AZP A;  2K5V A;  2R92 G;  2UXD Q;  2JXM B;  2E2J H;  3K6O A;  1GXD C;  2JA7 B;  2X69 A;  4GNX C;  4LF9 Q;  1I5F A;  2K33 A;  1PRT C;  1V8Q A;  1IBK L;  3JAM i;  2MQH A;  1B53 A;  4XTC S;  4HR7 B;  1G91 A;  4DV5 L;  1VQM A;  4DV4 Q;  3G6E A;  3F2U A;  3GD7 A;  1VQI A;  4I7Z C;  3C3L A;  1XMO Q;  1I3Q H;  3BYT B;  3CD6 A;  1BDO A;  2XVS A;  5DAU A;  2B29 A;  1JIC A;  3U4V A;  2QEX A;  1E2Z A;  2B63 G;  3A7A B;  3OW7 A;  5C3E G;  5JPM C;  2HIV A;  3I4M H;  3PO3 G;  1N32 L;  1HH2 P;  1RF2 D;  4LNQ A;  5I6Y A;  3H3V I;  2YYZ A;  2B3G A;  2EYH A;  3CC4 A;  4A93 G;  4ABN A;  3E3X A;  1IBK Q;  4X62 L;  2JA9 A;  4JW0 A;  1P16 A;  2J0T D;  1SSO A;  4DV5 Q;  1VQN A;  2F4V L;  1CSQ A;  3HOV G;  2E8G A;  2E2I H;  4WRD A;  2EZV A;  1S5B D;  2R7Z H;  1EZ6 A;  1ZKO A;  4JI4 L;  3NEM A;  3PUV A;  4LFB L;  2RCN A;  3TS2 A;  1JB7 A;  5EPL A;  1QNK A;  1NAP A;  3A55 A;  2WAC A;  5COY A;  5LL6 X;  5AFW A;  3TN2 A;  4BBS H;  3CC7 A;  4A3I H;  2RF4 A;  2SNS A;  2YU9 H;  4FDB A;  1TKW B;  1N32 Q;  4JI0 L;  3GDE A;  2K52 A;  2H1E A;  5M5W H;  5FLM G;  4DV1 Q;  2HDM A;  3NWT A;  4X62 Q;  2E5L L;  3KFU A;  3EA6 A;  4BBR B;  5M5X B;  3HOX H;  4BA2 I;  2F4V Q;  4POF A;  1DJR D;  2A6E D;  2VB3 X;  2EYM A;  3NUC A;  3GTG B;  1G6P A;  5E3F A;  4JI4 Q;  4BXX H;  4LFB Q;  3D6C A;  1E7Z A;  3GTK H;  3DWA A;  2NVY H;  4DR5 L;  1F2L A;  2FJ2 A;  2F0N A;  3G48 A;  4MTN A;  2VUM G;  2CFM A;  2Z6K C;  3NXW A;  4JI0 Q;  3Q0A A;  1YHB A;  4XQQ A;  3DEO A;  1S40 A;  1K3B C;  2E5L Q;  4XIG S;  4ALP A;  1MGS A;  3TP8 A;  1WCM B;  1HR0 L;  2IT1 A;  2JA7 G;  1C7Y A;  2BE5 C;  4NXM L;  2KEC A;  4DN4 M;  4ZRZ A;  3MFY A;  1X6O A;  4LF6 L;  2CQO A;  1DYQ A;  5IYB G;  4GLA C;  3S17 B;  3CQZ H;  2FMM A;  4JI2 L;  1BCP C;  4YIJ A;  3PCO B;  4DK3 C;  1TWA H;  2AUJ D;  1NE3 A;  4IJH A;  1MKH A;  4DAY A;  1QVF A;  3RZD H;  4CBV A;  3RUZ A;  2PCF B;  1QVC A;  5DM6 3;  3NEL A;  2NVX H;  1HR0 Q;  2L15 A;  1E3P A;  4CJ0 B;  5I4D A;  1Q8I A;  3ER0 A;  2EYP A;  1QB5 D;  1YEZ A;  4GN4 B;  4LF6 Q;  3KUP A;  5EPK A;  3OSO A;  2I5M X;  5JJL A;  5ISR A;  3NE5 B;  2CW0 D;  2WKC A;  4KK7 A;  3HOV H;  3KLW A;  1EYG A;  3K7U C;  4JI2 Q;  1DOK A;  1EOT A;  2IX1 A;  4DAY B;  2F52 A;  2B2W A;  1B3Q A;  5C0X H;  1IKM A;  3M9B A;  2PQA A;  3DXJ C;  1XNQ L;  1Z6H A;  3TZD A;  5KEE A;  2EOT A;  1GKH A;  4JBM A;  4K6D A;  1VQ6 A;  4YCU A;  2C35 B;  4A3F H;  3G6J B;  4OO1 G;  4B9W A;  3KDF A;  5C3W A;  3K7A B;  4BBR G;  3ERQ A;  5FO8 B;  3VR3 A;  1ET9 A;  4A3G G;  1PHJ A;  2NN6 I;  5I2Y A;  3PGZ A;  1G8Z D;  4IUQ A;  2N49 A;  5CV6 A;  4CKE A;  1IBL L;  3FPP A;  2VS1 A;  1OO9 B;  3T51 B;  2O4X A;  4DR2 Q;  1K9M C;  1XNQ Q;  3A8I E;  1GHJ A;  2Q2H A;  2HHH L;  2VUM H;  3RNU A;  3RZO H;  3L3O C;  2F0U A;  1LTI D;  1ZYR D;  4XYQ A;  2QEJ C;  1GO3 E;  3KDF B;  3TSS A;  2DNE A;  4RMF A;  4DFA A;  4OWT B;  4DGZ A;  5FLX c;  3MVV A;  1BF4 A;  1WCM G;  2M00 A;  3ZJY C;  1VQL A;  4M8A A;  1ML0 D;  1HQM C;  5D3I B;  1WD0 A;  4DKA C;  1VQJ A;  1IBL Q;  1PFB A;  3WWV A;  2UUB L;  1TWG B;  4H13 C;  4HCE A;  4JBJ A;  3VR2 A;  1Q81 C;  3CHB D;  2I07 B;  2D9U A;  3D0F A;  2HHH Q;  1LTA D;  3N52 A;  5E4X A;  1HNZ L;  3BDC A;  1FGB D;  4A3L G;  2AQ2 B;  3I4N H;  2KBN A;  3SK4 A;  1KNE A;  4CJ1 B;  3C1E A;  2XN9 C;  5D3D A;  1JE4 A;  1B2T A;  1QNU A;  2EDG A;  1N34 L;  2MNA A;  2R3Z A;  4NKL A;  3MAQ A;  5CV8 A;  2F0Q A;  3CRK C;  5FJ8 H;  5HGT A;  2KUM A;  2I5H A;  5BR8 L;  5EBC A;  5LMU L;  5M9O A;  5EAY A;  4DUY L;  4C1N K;  1XJV A;  1PYB A;  1WOC A;  3GQB A;  4RFB A;  4KN7 C;  4RCN A;  1SE3 A;  1M1K C;  3ULL A;  4HIO A;  1L1O A;  1TWF B;  1HNZ Q;  5CGK A;  1SE8 A;  1JT8 A;  2K5D A;  4OEM B;  2A69 C;  2OEO A;  4P75 A;  1LT3 D;  1CTM A;  5HY6 A;  4DPG A;  4LFC L;  4IUT A;  1KDA A;  2JEB I;  1IKL A;  4NB3 A;  1PV4 A;  4C3H B;  3T1Y L;  2Z9H A;  1N34 Q;  4LF8 L;  1C9O A;  1TS4 A;  4KJN A;  1G6Z A;  3GTO H;  4YCV A;  3I4L A;  4EX5 A;  3CME A;  4DR1 Q;  5BR8 Q;  3NQI A;  2B2T A;  5LMU Q;  2L0C A;  4K5V A;  3NPP A;  1LAC A;  5A2Q E;  3W2D A;  5ELO A;  4DUY Q;  4A3G H;  1AFP A;  1WTH A;  3VYR A;  4XQN A;  5IWA L;  3VR6 A;  4FF3 A;  2NTT A;  3J80 c;  1L1O B;  4QIW E;  3BZD B;  1TS5 A;  1TY0 A;  3S1R B;  1SFO B;  1EIF A;  3D8G A;  3UDF A;  1O7I A;  3H3V H;  2JA5 B;  3ITP A;  4ILW A;  5A2Q L;  1FJG Q;  4LFC Q;  1PVO A;  1ENF A;  3HOZ B;  1UAP A;  4IOC A;  2JA8 H;  3T1Y Q;  4LF8 Q;  2EIF A;  3MZ5 A;  3K58 A;  1RD9 D;  4C3J B;  3CW2 C;  4OWW B;  3S2H B;  2SNM A;  1W2B A;  4JVZ A;  2UU9 L;  5IWA Q;  4OXP A;  2ZJP A;  3M4O B;  2ICI A;  1SN8 A;  1GUO A;  3S15 H;  2A8V A;  4ZKB B;  2Z0S A;  3G71 A;  1E2V A;  3GV3 A;  2E2J B;  3I55 A;  2DJF C;  4P74 A;  1EYD A;  1IYV A;  4DV6 L;  4JI7 L;  4JI5 L;  1IW7 C;  2B2U A;  3UDI A;  5I2X A;  5C4Z A;  1NCV A;  3GP7 A;  2ZXO A;  1ET6 A;  1PFS A;  1K83 H;  2UU9 Q;  1SAP A;  4RWS C;  2F0O A;  3EIV A;  2RHQ B;  5GQO A;  4DU9 A;  4AQY L;  3OMC A;  1I3Q B;  2HQE A;  1KRS A;  2EXD A;  3M4Q A;  1J5E L;  3N6R A;  4X66 L;  5CC4 A; 
#chains in the Genus database with same CATH homology
 1OXS C;  3HG9 A;  3EVQ A;  1SMY D;  3M7G A;  3SK8 A;  1T5X D;  3I4M B;  1F2M A;  2WV6 D;  3SEB A;  5EJW A;  4IUP A;  3K0Y A;  1F9R A;  2Z4H A;  3I91 A;  4GZY C;  4C3H G;  4RGN A;  2E2I B;  5G3L F;  1GUS A;  2R7Z B;  3MWY W;  3AMU A;  4L6T B;  3K5L A;  3E6Z X;  3PIO 3;  3SK6 A;  1A3U A;  3PUX A;  3A56 A;  3VR5 A;  4BBS B;  4A3I B;  2YU9 B;  2C5C A;  1KAA A;  1SE4 A;  3KK7 A;  4TRD A;  4ODG A;  4XQJ A;  2R93 B;  4KTA A;  3HOX B;  3V96 A;  3T56 B;  5C4H A;  4ZUJ A;  4FXD A;  3J81 E;  3BS1 A;  4C3J G;  1JQY D;  1EIG A;  1WVL A;  3BVM A;  3GTK B;  4O1N A;  2D5D A;  2NVY B;  5C0X J;  3ND8 A;  1S5F D;  3D4D A;  4EQN A;  4RGM A;  1F9Q A;  1Q90 A;  2LFN A;  4Q5V A;  1A2U A;  1HHV A;  1PRT B;  5CBA E;  4N9P A;  2LS0 1;  1L0X B;  3K57 A;  2B2T C;  3OIP A;  1STY A;  4CKB A;  1JWM D;  2NN6 H;  1DCZ A;  2NYZ D;  2QKI C;  4FXK C;  4WFN 3;  3V05 A;  2F4I A;  4KJO A;  4C2M B;  5FO9 B;  1TY2 A;  4K5W A;  3NTI A;  3CQZ B;  1SNM A;  4OIK A;  1TWA B;  2RSO A;  2A6E C;  3FDT A;  2JYO A;  2F0D A;  2L9H A;  1NR2 A;  3RZD B;  3SE0 A;  3G7L A;  4HED A;  1EL0 A;  1SNC A;  1CQF A;  2NVX B;  4H7B A;  1C4Q A;  1K8M A;  3RD4 A;  2N88 A;  4TKO B;  4ULL A;  2KVM A;  5CMD A;  3LX0 A;  2KCC A;  1VF7 A;  2MGS A;  3C2P A;  1BUV T;  4L8J A;  3I90 A;  1Q12 A;  5IGE A;  3HOV B;  5E4W C;  1VDZ A;  3K5M A;  2F0T A;  2WAQ B;  4CHT B;  3S9W A;  1Y8N B;  1EWC A;  1JOO A;  5JVG 3;  2PW5 A;  2L12 A;  5FOB B;  2L55 A;  4ZKC B;  4A3F B;  1SYC A;  2F0P A;  3QJY A;  5K36 H;  3OWE B;  2PW7 A;  4HMI A;  1L0Y B;  2AWN A;  4Z9C B;  3V2T A;  2ZXP A;  3LNN A;  1RTO A;  3SVM A;  4FF2 A;  3PIP 3;  2VUM B;  3BDO A;  4ZUI A;  2OF1 A;  2CW0 C;  3A8J E;  3LWU A;  1HTP A;  1D5Z C;  1EU4 A;  1HUN A;  2JP1 A;  2N55 A;  2EJF C;  1BCP B;  2PQE A;  2PZT A;  5KIX A;  3NTK A;  3QWN A;  4DA2 A;  1WTP A;  3DWP A;  3BVG A;  2KQ3 A;  2F0I A;  1KTK A;  1PDQ A;  3I4N B;  3ONA B;  3BYY B;  3OIQ A;  2EY1 A;  2H4O A;  1YNN D;  4K8I A;  1MSG A;  2B8G A;  2IWH A;  5FO7 B;  3OHX C;  5CV7 A;  5JEA J;  2EYJ A;  2BA0 A;  1ZYR C;  3PUW A;  5I6W A;  2Z8L A;  4DK1 A;  2BA1 A;  3J7A F;  4K14 A;  2DY8 A;  3FPU B;  5F2D A;  1EY7 A;  5BN5 A;  4K5X A;  4K6L A;  3KBG A;  2EYO A;  5C0X G;  1F2Y A;  2F0L A;  2MJ8 A;  1CA6 A;  2PZW A;  2F0W A;  4PMW A;  3ND9 A;  5COR A;  1F9P A;  3GTO B;  2IW3 A;  1U4M A;  4BA1 I;  4DF7 A;  5IOD A;  1IYU A;  4KD4 A;  4A3G B;  5CV5 A;  1HQR D;  5ELF A;  5G3L D;  2GA4 B;  1PLF A;  3SR1 A;  3NWS A;  2B2V A;  2EY6 A;  1O78 A;  1F9S A;  3PV0 A;  4TQU S;  2JA8 B;  2B39 A;  1MBY A;  3R8B A;  1B9M A;  5C5L A;  3P75 A;  2FFK B;  1B44 D;  1SYG A;  1F2Z A;  1ROD A;  3VYU A;  4IUV A;  4EQP A;  1A6X A;  2K32 A;  2F0V A;  1I4R A;  3S15 B;  1EFI D;  3X3M A;  2CVR A;  1U4P A;  2XWB B;  1A3V A;  1STE A;  2K28 A;  4FP5 D;  4V19 0;  2L11 A;  3NK9 A;  5KYL A;  2IX0 A;  1WTO A;  4X3U A;  1EEF D;  1RHP A;  1K83 B;  2M2L A;  1V1P A;  1I4G A;  3URY A;  1Q3L A;  1TVX A;  4H0L C;  1BO0 A;  1QJO A;  4XXE A;  4QMG A;  2JA6 B;  3EQL C;  4PV1 C;  3M85 A;  2AUK A;  3X3N A;  4X3T A;  1TR5 A;  4EVO A;  1HCZ A;  3TME A;  1XX8 A;  2EVB A;  2R6G A;  2NWG A;  4F88 A;  1V1P B;  1W6K A;  1C48 A;  4Q0F A;  2HUG A;  3Q22 A;  1JR0 D;  3H91 A;  1JB3 A;  1SDF A;  1HFG A;  1XWE A;  1PXU A;  1KNA A;  1SNO A;  1TS2 A;  1Q1B A;  3MXG A;  1GUN A;  1AZQ A;  1FYC A;  2F0H A;  3Q24 A;  1D1I A;  3QO2 A;  1KDC A;  1TII D;  3MXN A;  3KLR A;  3UI2 A;  1SMY C;  5JOB A;  1DD2 A;  1AW7 A;  4OHJ A;  1D1K A;  4F8M A;  1SYB A;  3H3V C;  1KLU D;  5C44 B;  3R3O A;  2F0J A;  1U4L A;  1JOQ A;  5J22 A;  5JEA G;  5IGF A;  4PMC A;  5KRU A;  1WTV A;  4A3D B;  3HOY B;  4TSS A;  5C4J B;  1WTX A;  2XNA C;  4HSP A;  4FVM A;  4X3S A;  2QCP X;  5EQ0 A;  2B2V C;  5KYI A;  1FD7 D;  3HZX A;  1STH A;  2K05 A;  2VXW A;  2F3W A;  3SK5 A;  2ICE C;  1D5M C;  1S5E D;  4QCL A;  2AQ1 B;  4BY7 B;  2A6H D;  1LAB A;  3SDZ A;  1CT1 D;  1M4V A;  1PTO F;  2IL8 A;  1HXY D;  1CA5 A;  4OGQ C;  1OXU A;  2RQX A;  1RJT A;  1LTT D;  4IAL A;  2A74 C;  3NQT A;  1NSN S;  3GTJ B;  5D65 A;  2NB0 A;  1AN8 A;  1RCV D;  1EY5 A;  4G7Z C;  2DNC A;  4KY7 A;  2O5I C;  1STG A;  1Z7T A;  5FLX E;  2K7V A;  1SBB B;  2TMP A;  3BG3 A;  1V1O A;  2WP8 J;  3HS0 C;  5FLX L;  1PMR A;  1GUW A;  1WTQ A;  2A5H A;  2K5W A;  4J1M A;  3WDN A;  3S1N B;  4KV6 A;  5JEA H;  2QDB A;  2RVL A;  5CV4 A;  1DON A;  4XDX A;  1LT6 D;  2FMC A;  2B2Y C;  3CKI B;  1F77 A;  2EYL A;  2RBM A;  2CHB D;  4A3E B;  2NN6 G;  2NVQ B;  2F0S A;  3DWQ A;  1W6J A;  3CU7 A;  3MTS A;  3LWE A;  1JCK B;  1HPC A;  1RKN A;  2L4N A;  3W3A A;  2RDH A;  2XRQ D;  1STA A;  2F0F A;  2MP1 A;  1BR9 A;  3WOE A;  1Q1E A;  4RHS A;  2F3V A;  2WIN B;  1SYD A;  3NBH A;  4ZK9 B;  2E2D C;  4G4K A;  4F7X A;  4NP5 A;  2IX3 A;  5J1Z A;  3R2I A;  4BY1 B;  2CQA A;  5DNF A;  4WJW A;  1O7Z A;  2V4D A;  4IQZ A;  1NUC A;  3SXH A;  1I4H A;  2JE6 I;  2F0E A;  1CHQ D;  3J80 E;  2JSO A;  3WOF A;  4R9W A;  2NTS A;  2KHS A;  1LT5 D;  1EY6 A;  1H9S A;  2XWJ B;  5EKL A;  1EY9 A;  3J80 L;  1JWS D;  1ENC A;  5IGB A;  3FRP B;  3MXP A;  1XYI A;  1EYC A;  1A2T A;  1FNW A;  5K36 G;  1HA6 A;  2KCN A;  3AU7 A;  1O7L A;  1CZW A;  1E0B A;  4KKS A;  1YNN C;  5C6A A;  1H9S B;  4ZAI A;  3D3R A;  2ENB A;  3NBI A;  4LK1 C;  1VMP A;  2E2H B;  2EJG C;  4K2K A;  1A3T A;  3J81 L;  3NTH A;  2Y0S B;  1DM0 B;  4EGV A;  1HFN A;  4UDU C;  2BDO A;  2RA4 A;  1BXT A;  1STB A;  3HGB A;  1ONL A;  3I8Z A;  3L9A X;  4LMQ D;  1PTO H;  4U67 3;  1CHP D;  1KDB A;  4KY6 A;  4N9T A;  1O7Y A;  3JAM E;  4QB4 A;  2VB2 X;  4KY5 A;  3TBI B;  2Q8I B;  2EY2 A;  2F03 A;  1GUG A;  2EE1 A;  2F1M A;  3E0J A;  1HA5 A;  2Q8T A;  2F0G A;  3JAM L;  2PMZ B;  2J7Z A;  4KHZ A;  4F87 A;  2MPM A;  1NR4 A;  3H0G B;  3QG1 A;  4KI0 A;  1I4P A;  3P1H A;  1H9M A;  3GTP B;  2A68 D;  2NBF A;  4U68 A;  2I46 A;  4L63 B;  2SOB A;  3TP7 A;  4A3B B;  1SNP A;  4NDX A;  1EZ8 A;  4JK1 C;  2G9H D;  2E76 C;  3K5N A;  4K2L A;  1QG7 A;  1JC7 A;  4R8I A;  3S2D B;  4EQO A;  4I65 A;  2RKS A;  1ESF A;  2NVT B;  5JAV A;  3ERO A;  2BCO A;  1MSH A;  1PTO D;  2M9V A;  2O2L D;  1LTR D;  1E2W A;  4MIU A;  1ILQ A;  5C3X A;  2WKD A;  4J6H A;  4HTH A;  2J4X A;  2AQ3 B;  4NW2 A;  3BDL A;  4K8J A;  2LKV A;  3AB9 A;  1VCI A;  2DY7 A;  2KJX A;  3C46 A;  3S14 B;  3U9O A;  2EYF A;  2RDF A;  3ZYY X;  3P7J A;  1KLG D;  3NSW A;  3HP3 A;  5ELD A;  5C5M A;  5I9P A;  1JOK A;  1PZK D;  5EKI A;  5BN4 A;  2K6A A;  4S3S A;  3I73 A;  4FNF A;  4B08 A;  5KND A;  2K5Q A;  3D4R A;  3OOC A;  3QOL A;  5IOC A;  1LTS D;  1R4P B;  4ID6 A;  1EY4 A;  1S5C D;  3HOW B;  2K01 A;  3HRZ C;  2NUC A;  4OO1 I;  1FR3 A;  2DN8 A;  5D14 A;  3Q6S A;  3MA2 B;  1QWY A;  2BOS A;  4DK0 A;  5BN3 A;  3GTM B;  3S16 B;  1ESR A;  1EQT A;  5T1G A;  3OMG A;  5KGU A;  1GHK A;  2ZT9 C;  1EY8 A;  3TDQ A;  1SND A;  4BWG B;  1BCP F;  1OXV A;  2FHT A;  4RKL A;  1HRJ A;  1HUM A;  1WTW A;  1I6H B;  4HSV A;  3CRL C;  4KMU C;  2EPB A;  1I6V C;  1ZXT A;  1R9T B;  2ZXR A;  4XT1 B;  3I70 A;  3RLF A;  2EY5 A;  3M7N A;  1SEB D;  4CKC A;  3DHQ A;  1UEA B;  2C9O A;  1SNQ A;  1SYF A;  1Y1W B;  1YNJ D;  3DEP A;  2A6H C;  4DNT B;  4HN7 A;  1TWC B;  1G2T A;  1FNU A;  1SJH D;  4PQX A;  2KED A;  3D31 A;  1B1Z A;  3GO5 A;  2F0M A;  3PMF A;  1ICW A;  5K5P A;  1PFN A;  1S5D D;  1GJX A;  1BNZ A;  3KLS X;  3GTL B;  3R2T A;  1EYA A;  3BVZ A;  2QIL A;  5IIF A;  4BS9 A;  4RH6 A;  1II3 A;  3MFG A;  2R61 A;  5KNC A;  4P2C B;  4H44 C;  1BOS A;  4XYO A;  1MD2 D;  4KN4 C;  1CFM A;  4MN3 A;  1S4Z A;  1D6E C;  4QUC A;  4QIW B;  1CZG A;  2EJM A;  2IJ0 A;  4CJ2 C;  1HTL D;  4IFD J;  5ELC A;  4IZ8 A;  3DUZ A;  3TP6 A;  3KBX A;  4ZLT F;  1QOH A;  1J8I A;  3PO2 B;  3GV6 A;  4M1U B;  2XIW A;  3R93 A;  4HAE A;  1LT4 D;  1QE6 A;  1UNS A;  3DMU A;  3M4Y A;  4KD3 A;  1SJE D;  1LLR D;  4ME5 A;  3Q23 A;  4IFD I;  2B2Y A;  4FXG C;  2B8F A;  5IGD A;  2G9D A;  3S1Q B;  1GUT A;  4QF4 A;  2RDG A;  2XSC A;  3QOJ A;  5ELB A;  1PRT D;  2D62 A;  1TWH B;  4DAV A;  2KEE A;  2IPK D;  1U4R A;  3NP8 A;  4DXG A;  2MUY A;  3U9S A;  5HUR A;  1IHZ A;  4NMZ A;  3IFD A;  5EGT A;  1B9N A;  3OWF A;  4FO2 A;  5LL6 S;  2Z1C A;  1Y1V B;  1Y8P B;  1SYE A;  4G7H C;  1X3Q A;  5I9O A;  5C4X B;  2E75 C;  1Z47 A;  4O42 A;  5EBD A;  1TU2 B;  2X6G A;  3A8K E;  4CGY B;  4A3J B;  1WD1 A;  4OIJ A;  2XRS D;  1PTO B;  4B9X A;  4LAA A;  3TP5 A;  2D2C C;  1I4Q A;  3QB3 A;  3M3Y B;  4HCS A;  1ENA A;  2PNR C;  5CBE E;  3SHL A;  2PPB C;  3EJI A;  5JPN C;  4UAI A;  5FK9 C;  2KA7 A;  1B3A A;  3IL8 A;  1B50 A;  1TQO A;  3A54 A;  1MI2 A;  5LHY 1;  5IT9 E;  3H94 A;  3T53 B;  1I50 B;  2ID0 A;  1DOL A;  3K5O A;  1RTN A;  3T4A C;  2AWO A;  4KKT A;  4A3K B;  1OXT A;  5IT9 L;  4DNR B;  1KAB A;  3IKJ A;  3FVQ A;  3FMC A;  1X3P A;  2LY7 A;  1AP0 A;  2MHV A;  3DM1 A;  1QCB D;  5NUC A;  1C8C A;  5IGC A;  2WB1 B;  4RA8 A;  4G57 A;  4ZQ3 A;  4C1N I;  4PNY A;  1PYW D;  1T5E A;  2BE5 D;  3H09 A;  3MHB A;  4HMJ A;  3HKZ B;  4C56 C;  3D6W A;  4OO1 H;  3D4W A;  4IUN A;  4ZYS A;  1CQV A;  1BCP D;  3MXU A;  3VA5 A;  1O80 A;  5ELE A;  4RAU C;  5M3M B;  1G2S A;  2Z4I A;  2A68 C;  4J8Q A;  4A3M B;  1ILP A;  5CR3 A;  1XXG A;  1K8O A;  1J9O A;  4IUR A;  1TS3 A;  2TSS A;  4AYB B;  1CK1 A;  1PFM A;  5JJZ A;  1EQV A;  3GTQ B;  1FNV A;  4IFD G;  5CYU A;  1TT2 A;  1H9K A;  2B2W C;  3IAY A;  1B4O A;  3VYT A;  2EXZ A;  1X32 A;  2NZ1 D;  2BDN A;  2O5J C;  1EY0 A;  1WTR A;  3PUZ A;  1SXT A;  4OL7 A;  5M5Y B;  4C3I B;  4RGT A;  1LV9 A;  1PTO C;  2HDL A;  4PMB A;  1VMC A;  2PZU A;  1IL8 A;  3H6M A;  4V0B A;  5EPJ A;  2KOL A;  5CV9 A;  4E6I A;  1BQQ T;  1EU3 A;  2K03 A;  4WOR A;  5TSS A;  1EWH A;  3EFX D;  4KKU A;  5FKA C;  3MC0 B;  2K1B A;  1EEI D;  3HOU B;  3VYS A;  5M3F B;  1D2B A;  4RHR A;  1G29 1;  2K04 A;  3QIA A;  4FYD A;  1R4Q B;  2JEA I;  4Y7N B;  1DOM A;  4RCO A;  5E1F A;  2RSN A;  2LMC B;  1QIL A;  1DXM A;  2L5T A;  2PO4 A;  1XTC D;  2QF7 A;  2Q8R E;  1A15 A;  5M5W B;  3A7L A;  1LTB D;  4RKB A;  4FF4 A;  4R8N A;  5IGG A;  4IFD H;  4DXF A;  3IFT A;  1GOZ A;  2A69 D;  4QUF A;  4IN3 A;  1U9R A;  3HEJ A;  3J7A V;  1OXX K;  3T16 A;  2R92 B;  4C3I G;  1CM9 A;  1I4X A;  1CI3 M;  3J7Y W;  4G7O C;  1EIH A;  4XT3 B;  5KNB A;  5C0X I;  1DZ1 A;  5JVH 3;  3S1M B;  1M8A A;  3KLS A;  3FEW X;  1V43 A;  1LO5 D;  3PUY A;  3K59 A;  1H9J A;  1PZI D;  3I3C A;  2HCI A;  4FF1 A;  2OT2 A;  1YNJ C;  1JWU D;  1Y69 U;  3NHH A;  2B63 B;  3C1F A;  5C3E B;  1PRT F;  5J39 A;  4X3K A;  2F0K A;  5DM7 3;  3PO3 B;  1BBX C;  3E5S A;  2SEB D;  1RDP D;  4A93 B;  1H9R A;  1STN A;  3RMH A;  4MHE A;  1PZJ D;  4RGO S;  1SE2 A;  2L1B A;  2WII B;  1LTG D;  2X6L A;  3P20 A;  1D5X C;  1UUP A;  1JOR A;  2B2U C;  3L7Z C;  3T13 A;  2HCC A;  5DEH A;  1Y8O B;  1IW7 D;  2FIN B;  1VF5 C;  4JBW A;  3VA7 A;  3I72 A;  3KF8 A;  3VR4 A;  1ZEQ X;  2PYK A;  4IUU A;  2SDF A;  2A73 B;  2E74 C;  2VNU D;  4DAP A;  3OPO A;  5EKK A;  3RZO B;  3TZU A;  2OXP A;  1AEX A;  3FKI B;  4KHV A;  3MEH A;  4LJZ C;  3O13 A;  5A35 A;  5T1I A;  1AZP A;  2JXM B;  3K6O A;  1GXD C;  2JA7 B;  2X69 A;  2K33 A;  1PRT C;  1V8Q A;  1B53 A;  4XTC S;  4HR7 B;  1G91 A;  3F2U A;  3GD7 A;  4I7Z C;  3C3L A;  3BYT B;  1BDO A;  2XVS A;  5DAU A;  1JIC A;  1E2Z A;  3A7A B;  3OW7 A;  5JPM C;  1RF2 D;  5I6Y A;  2YYZ A;  2EYH A;  4ABN A;  2J0T D;  1SSO A;  4WRD A;  2EZV A;  1S5B D;  1EZ6 A;  1ZKO A;  3PUV A;  5EPL A;  1QNK A;  1NAP A;  3A55 A;  2WAC A;  5COY A;  5LL6 X;  5AFW A;  3TN2 A;  2SNS A;  1TKW B;  2H1E A;  2HDM A;  3NWT A;  3EA6 A;  4BBR B;  5M5X B;  4BA2 I;  1DJR D;  2A6E D;  2VB3 X;  2EYM A;  3NUC A;  3GTG B;  5E3F A;  3D6C A;  3DWA A;  1F2L A;  2FJ2 A;  2F0N A;  3NXW A;  3Q0A A;  4XQQ A;  3DEO A;  4XIG S;  1MGS A;  3TP8 A;  1WCM B;  2IT1 A;  2BE5 C;  2KEC A;  4DN4 M;  4ZRZ A;  3MFY A;  1DYQ A;  3S17 B;  2FMM A;  1BCP C;  4YIJ A;  2AUJ D;  4DAY A;  4CBV A;  3RUZ A;  2PCF B;  5DM6 3;  4CJ0 B;  5I4D A;  1Q8I A;  2EYP A;  1QB5 D;  3KUP A;  5EPK A;  3OSO A;  5ISR A;  3NE5 B;  2CW0 D;  2WKC A;  4KK7 A;  1DOK A;  1EOT A;  2IX1 A;  2B2W A;  5C0X H;  1IKM A;  3DXJ C;  1Z6H A;  3TZD A;  5KEE A;  2EOT A;  4K6D A;  3G6J B;  4OO1 G;  4B9W A;  5C3W A;  3K7A B;  3ERQ A;  5FO8 B;  3VR3 A;  1ET9 A;  2NN6 I;  5I2Y A;  1G8Z D;  4IUQ A;  5CV6 A;  4CKE A;  3FPP A;  1OO9 B;  3T51 B;  2O4X A;  3A8I E;  1GHJ A;  3L3O C;  2F0U A;  1LTI D;  1ZYR D;  4XYQ A;  2QEJ C;  3TSS A;  2DNE A;  4DFA A;  4DGZ A;  3MVV A;  1BF4 A;  2M00 A;  4M8A A;  1ML0 D;  1HQM C;  5D3I B;  1WD0 A;  1PFB A;  1TWG B;  4H13 C;  4HCE A;  3VR2 A;  3CHB D;  2I07 B;  2D9U A;  1LTA D;  3N52 A;  5E4X A;  3BDC A;  1FGB D;  2AQ2 B;  3SK4 A;  1KNE A;  4CJ1 B;  3C1E A;  2XN9 C;  5D3D A;  1JE4 A;  1B2T A;  1QNU A;  2EDG A;  2R3Z A;  4NKL A;  3MAQ A;  5CV8 A;  2F0Q A;  3CRK C;  5HGT A;  2KUM A;  5EBC A;  5M9O A;  4C1N K;  3GQB A;  4RFB A;  4KN7 C;  4RCN A;  1SE3 A;  1TWF B;  5CGK A;  2K5D A;  2A69 C;  2OEO A;  1LT3 D;  1CTM A;  4IUT A;  1KDA A;  2JEB I;  1IKL A;  4C3H B;  1TS4 A;  4KJN A;  1G6Z A;  3I4L A;  3NQI A;  2B2T A;  2L0C A;  4K5V A;  3NPP A;  1LAC A;  5A2Q E;  3W2D A;  1AFP A;  3VYR A;  4XQN A;  3VR6 A;  4FF3 A;  2NTT A;  3BZD B;  1TS5 A;  1TY0 A;  3S1R B;  1SFO B;  3D8G A;  2JA5 B;  3ITP A;  4ILW A;  5A2Q L;  1ENF A;  3HOZ B;  1UAP A;  3MZ5 A;  3K58 A;  1RD9 D;  4C3J B;  3S2H B;  2SNM A;  3M4O B;  2ICI A;  1GUO A;  4ZKB B;  1E2V A;  3GV3 A;  2E2J B;  1EYD A;  1IYV A;  1IW7 C;  2B2U A;  5I2X A;  5C4Z A;  1NCV A;  3GP7 A;  2ZXO A;  1ET6 A;  1SAP A;  4RWS C;  2F0O A;  4DU9 A;  3OMC A;  1I3Q B;  2HQE A;  3N6R A;  5CC4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...