2Q8IB

Pyruvate dehydrogenase kinase isoform 3 in complex with antitumor drug radicicol
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
93
structure length
93
Chain Sequence
b'SYPPHMQVLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKEADISAFADY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 3
publication title Distinct Structural Mechanisms for Inhibition of Pyruvate Dehydrogenase Kinase Isoforms by AZD7545, Dichloroacetate, and Radicicol.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 15
structure length 93
sequence length 93
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 2007-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2q8iB00
2K32A 2KCCA 3ND9A 1O7LA 3QJYA 2BE5C 2PCFB 4TQUS 1DD2A 3VA7A 2DN8A 2AWOA 3MXUA 3BG3A 4G7OC 1HPCA 1OXVA 4LK1C 4DNRB 4L8JA 1Y8OB 4KHZA 3M7NA 5C0XG 2EDGA 2K33A 4TKOB 2D5DA 1FR3A 1ZKOA 2B8GA 2A6EC 2DNCA 2NN6G 1GJXA 3GQBA 2V4DA 1Z6HA 1CTMA 3TZUA 1HTPA 5JEAH 5KNBA 4KN4C 1Q90A 5A35A 1H9MA 4LJZC 2EJFC 3FMCA 3FPPA 5BN4A 1HCZA 2O5JC 3EQLC 4H0LC 1GUNA 4KKSA 1HQMC 2KA7A 1H9RA 1Y8PB 2O5IC 3I4LA 3RLFA 3HGBA 4GZYC 3M4YA 3PUVA 2Q8IB 2AUJD 1YNJC 1CFMA 1Q12A 3MFYA 2PNRC 4G7HC 1FYCA 4IFDG 2LMCB 5K36H 3IFTA 1E2VA 1QJOA 2D2CC 1K8OA 3PUZA 5KNCA 1OXSC 2JE6I 3CRLC 3SDZA 1H9KA 4KMUC 3WDNA 1H9SA 2EVBA 3GD7A 3PUXA 3DXJC 4BA2I 1BDOA 1VCIA 2BE5D 3OOCA 4DK0A 1TKWB 4IQZA 3U9SA 3ND8A 3VR3A 4KN7C 3A8JE 2DNEA 2F1MA 1IYUA 4JK1C 1IW7C 1ONLA 3A8IE 2ZT9C 4KI0A 4PV1C 4XTCS 1A6XA 2A6ED 2D62A 4OGQC 4OO1G 1LABA 2BA0A 3CRKC 5BN3A 3A7AB 1GHKA 1TU2B 1IW7D 4RCNA 3L7ZC 1Y8NB 1YNNC 1E2ZA 3A8KE 1Y69U 2PPBC 3P20A 3OPOA 5C0XH 2EJMA 2L5TA 4G7ZC 1LACA 2K7VA 2NN6H 3PUWA 1ZYRC 3I73A 5BN5A 1E2WA 1B9NA 2JEBI 3SE0A 1GUSA 2A69C 3LNNA 1O78A 2JXMB 1VF7A 3NE5B 3A7LA 3D31A 2E74C 3VR6A 2BA1A 1H9JA 4XIGS 1DCZA 5KNDA 1GUGA 5JEAG 2A6HC 4KKUA 3VR4A 1GHJA 2YYZA 3LWUA 1VDZA 2NN6I 2AUKA 2R6GA 2QF7A 3KLRA 2IT1A 2B8FA 3I72A 1CI3M 2BDOA 4DNTB 3PUYA 3OW7A 2A6HD 1Q1EA 4JBWA 3VR5A 1VF5C 1V8QA 5K36G 1Q1BA 1SMYC 1OXUA 3T56B 1GUOA 3D4RA 1GUTA 2E76C 1B9MA 1IYVA 2JEAI 2EJGC 3QG1A 4H13C 3T53B 2CW0C 1PMRA 2A68C 1OXXK 3W3AA 1Z7TA 4H44C 3H94A 3T51B 1H9SB 1DXMA 4I7ZC 2E75C 3IKJA 3AB9A 1T5EA 4BA1I 4OO1H 2A68D 1G291 1K8MA 2A69D 3BDOA 1EWHA 4DK1A 3PV0A 3VR2A 1V43A 3QIAA 4KKTA 1I6VC 3N6RA 4IFDH 4HR7B 3M85A 1OXTA
chains in the Genus database with same CATH superfamily
1I5FA 2K32A 4O42A 1SYCA 5C3EB 4C2MB 2PZWA 5COYA 1I3QB 3PIOA 4IUQA 1H95A 4A3IH 1FR3A 1XMOL 4ALPA 4EVOA 2ID0A 4LF7L 1HTPA 2VB3X 4P2CB 1Q90A 4DPGA 4RHSA 1YJWA 4LJZC 2CW0D 2IHFA 1QILA 3FKIB 1VQOA 3CCVA 2EYPA 3K7AH 3KJOA 2CCZA 1IBML 5CV8A 4NDXA 2KOLA 5EGTA 3JAMi 2UXCL 4JV5Q 4C56C 3D0FA 2D2CC 2EE1A 1S5BD 1X3FA 1PYSB 2KHIA 4A76A 3S2HH 1YNJD 4DFAA 4IPGA 2MNAA 3I8ZA 1K73C 2Z8LA 3H91A 3KDFB 5FK9C 1I6HB 3VR3A 2PW5A 1W2BA 2K01A 3S2DH 4NXNQ 1MSHA 3OHXC 4B3TL 2UXDQ 3GTLB 2ZT9C 4PV1C 2KCNA 4RKLA 1KD1C 1KIXA 1S3OA 1E2ZA 4AQYL 1IL2A 2B2UA 1EIHA 2IJ0A 4O0AA 3BZCA 2EJMA 2L5TA 2NVXH 3NBHB 3K8AA 1T9HA 1TWGH 2KBNA 1XMOQ 2ICEC 2OTJA 1CZWA 3HKSA 4LF7Q 1U4MA 3VR6A 4XIGS 2X6LA 3EJIA 4K8JA 3J81j 3LWUA 1KQSA 2JA5G 3KLRA 5I6WA 3CXCA 2K52A 4KHPL 1IBMQ 2Y0SE 1M1KC 2UXCQ 4FO2A 1EYAA 3RZDH 4OIJA 4L5QA 3S1NB 5LMUL 3EA6A 3F1ZA 3J81c 1NNXA 4J8QA 4IO9A 2AKWB 4CHTB 2CW0C 5ELNA 1PMRA 3K81C 1F9QA 5JJIA 1QWYA 1IXRA 3A55A 3PGZA 3GV6A 4R4CA 4B3TQ 1R4QB 3GO5A 3VA5A 4A3JG 4DV1L 4DR2L 1B7YB 1PRTB 3HOYG 2XIWA 1XXGA 2XN9C 4AQYQ 4QCLA 5JPNC 3MXUA 4R8NA 3I91A 3M7GA 2IWHA 1SYBA 1VQ5A 1TWFH 1IHZA 4CGYB 4DR5L 1AE3A 3GQBA 2F3VA 1CTMA 1Q7YC 1B44D 2B63H 2Q2TA 1J5EL 5BN4A 4OWXB 1Y1WH 4LFBL 2F0GA 4GNXA 3VYSA 4KHPQ 1WCMG 2IPKD 5CC4A 3ULJA 2XSCA 4XT1B 5HURA 1E1OA 5LMUQ 3NTIA 3HOVB 1NSNS 1IBKL 5BR8L 1TT2A 2Y0SB 1KL9A 4A3EB 1JJ2A 2F1MA 2XWJB 4RFBA 1IW7C 3HOUH 1SSOA 2R7ZG 4DV1Q 1PH6A 4DR2Q 4A3FH 1K83B 3ERQA 2F03A 5ELFA 2PQAA 5CYUA 1STNA 3GTGH 3S1QH 1TWCH 1PXUA 3S9WA 1KRSA 1O80A 3UE0A 5IP7G 4DR5Q 3NE5B 4C3IB 2R93G 5C4XG 3H0GB 2I07B 4FXKC 1GUGA 1J5EQ 3BJUA 4KKUA 4WRDA 4LFBQ 4EQNA 2K5VA 3DEOA 3CD6A 1CHQD 2EY1A 4H02A 1JT8A 3JC66 4ZQ3A 1LYLA 1F2LA 4XT3B 1IBKQ 5BR8Q 1J9OA 1PTOB 4XXEA 1NTGA 2NVTB 1IL8A 3TP7A 3DM1A 4DN4M 1E7ZA 5G3LD 5M3MH 3PO3B 5IGCA 3MAQA 4DGZA 1S4ZA 2XTIA 3PV0A 4Y7NB 5J22A 1B4OA 4QUCA 3S17H 2FHTA 2OCEA 2KCCA 3E0JA 5CBAE 5EKKA 2DN8A 4HIDA 1DJRD 3JAML 1EFID 3BZKA 3I4NG 1K8AC 4KHZA 1QUQB 3KFUA 3GP7A 1C4QA 4J1MA 1GJXA 2DNCA 4A93G 2EY6A 2YTYA 4A3KB 1CZGA 1TWHB 4PMCA 5A35A 5M3FB 2ZTDA 1LT5D 3EQLC 4H0LC 5D65A 1EUJA 2KA7A 1WTWA 2O5IC 2JA6B 3CU7A 3OMCA 2CQAA 1D7QA 1PV4A 4JOIC 3J80i 4DV0L 5KNCA 3CRLC 2EY5A 4KMUC 1LTRD 2NTTA 4N9PA 2K5QA 3CF5A 5TSSA 3UDFA 3KUPA 4RHRA 1RODA 3F2BA 3TP8A 1VQLA 1NE3A 4KI0A 5FKAC 1Q8KA 3AU7A 4ZUJA 2EYOA 1LT4D 3S1RH 4B3RL 4KJNA 3E3XA 4B3ML 2VB2X 1W6JA 2HQLA 3KLWA 1E3PA 4DV6L 1KDAA 1QNUA 4DU9A 1R4PB 2UUAL 5IP9G 4K6LA 2ZTEA 3STBC 2KHJA 3C1FA 1C9OA 2E74C 5C3WA 2R92G 2B2YA 1DCZA 3OWEB 1S5FD 4X64L 1VQHA 2JQOA 2H1EA 2KJXA 2NN6I 1RIPA 3F2DA 3FVQA 4F7XA 4A3CH 3BZDB 4UPAA 3OW7A 5M5WB 1SAPA 3V2TA 3BVZA 1A62A 4DV0Q 1SNDA 4YCWA 2FXQA 2MP1A 3NTHA 3KF8A 3PO2B 2JEAI 3L0OA 1KAWA 4HN7A 1BKBA 1C7YA 2AQ2B 1S40A 1OXXK 4JI3L 3M9BA 1IBLL 1EU4A 2XNAC 3AB9A 3GDEA 2NVYB 3BYTB 1G291 2J7ZA 1GM5A 3C3LA 1SXTA 2XGTA 3UE1A 2JA8G 1S5DD 2NZOA 5FOBB 5J3BA 3J7YW 4B3RQ 1PZKD 4B3MQ 1L1OC 3S16B 4DV6Q 1G8ZD 1RL2A 1XPOA 2R7DA 1OXVA 2O4XA 4XDXA 5CV4A 2EY2A 3DWPA 2UUAQ 2DY8A 1P8LA 4A3BG 4K2KA 1I50H 1X9NA 5E1FA 5ELOA 2J4XA 3DUZA 5KNBA 5FLMG 5JJKA 4X64Q 1HCZA 2VUMB 1XX8A 1G2SA 4FNFA 2RF4A 1PH2A 2Q8IB 1KNAA 2QEJC 3HFZB 3R3OA 2PMZE 2RHQB 3GD7A 1AZQA 2L11A 3K7UC 4IFDJ 1N34Q 1VQIA 2GVAA 1SROA 2XRQD 4JI3Q 1IBLQ 3ULPA 2RDGA 3NWTA 5C44H 2QDBA 4X3TA 4DR3L 3HOWB 2K5NA 4DK6C 3OIQA 2AQ1B 3PSIA 1K9MC 3FHWA 4A3LG 5JOBA 3KLSA 3DWAA 3I4MG 1FNVA 4I7AA 4LUOA 3Q23A 4BBSH 4R4QA 3E5SA 4A4IA 4BY7H 4A3IB 4K8IA 3SE0A 1CA5A 1UWVA 3SVMA 1O78A 3EFXD 1STYA 5ISRA 1PH1A 4LF5L 3FRPB 2CWPA 3MC0B 3C2PA 3K7AB 1PRTD 5JAVA 3I4OA 1ML0D 3K6OA 1JICA 4C3JG 1A15A 3I3CA 2ATWA 2QA4A 2LS01 3S2HB 3J7AV 2KCMA 1QE6A 1JORA 3NENA 2OQKA 1IYVA 2EJGC 1LTGD 1PH7A 3GTOH 3MHBA 3S2DB 3UDGA 2F0MA 1PA6A 4YHHQ 1DXMA 4K6DA 1SNOA 1ZYRD 3E9IA 2A68D 1HFGA 2PMZB 4DR3Q 1NMFA 2B2WC 4ME5A 2QW7A 2K5DA 4KD4A 3DM3A 1X65A 1X3PA 4KY7A 2AWOA 2NVXB 4WORA 5E4WC 2F4IA 1E1TA 4G7OC 1TWGB 3CC2A 1AZPA 5J1ZA 4OIKA 2NN6G 1I4GA 4LF5Q 1MJEA 3T13A 2VS1A 1N8RC 1DYQA 2ENBA 3BVMA 1CKOA 3HG9A 2XVSA 1SNQA 3S1MH 4PG3A 5T1GA 1RTOA 3RZDB 2RDHA 3MFYA 2YU9H 1SYFA 1EZ8A 4BY1G 2ZJQA 5K36H 5IYCH 1QJOA 5KRUA 5IGGA 3CC4A 1EIFA 1I4QA 3BU2A 4HJ5A 3N52A 5GROA 3OSOA 1LV9A 2B2TA 3VYUA 3Q24A 4JI8L 3CQZH 2CWAA 1PRTC 4IQZA 5JPMC 1PFMA 3QOLA 5EQ0A 2LSSA 3H6MA 1UNSA 2DGYA 1MBYA 3A8IE 3K5NA 4IJLA 2WB1G 2A6ED 5I9PA 4DUZL 4LW1A 3NEMA 4A3MH 1X6OA 3HOXH 2WP8J 1QVFA 2F3IA 1SR3A 4JVZA 4HAEA 4K2LA 1WD0A 5C5LA 1DGSA 1PTOD 1TWFB 1ZYRC 2LXJA 5FJ8G 1B3AA 1D8LA 1VF7A 4LF8L 3MXGA 2Z1CA 4IUTA 4RCOA 2MQHA 5AFWA 1PH8A 2B63B 2BA1A 2Z6KA 1Y1WB 1MIUA 4P71A 3CCSA 3HOZH 3DEPA 2D0PA 1QVCA 3PUYA 4JI2L 2A6HD 1LT3D 2ASBA 4GNXB 1V1PA 4K5VA 1OXUA 5LL6S 4L63B 2JA7G 1AE2A 4JI8Q 1Y1VG 4A3DG 2M00A 4BBRG 1HNWL 1FL0A 4CJ2C 3HOUB 1AW7A 4BXXH 4BA1I 4OO1H 4A3FB 3M4PA 1K8MA 1U4RA 4K5WA 4DUZQ 1TS3A 1PFBA 1I6VC 2L0CA 4IFDH 2E2HH 3GTGB 3S1QB 3V05A 2F0WA 1TWCB 1DD2A 2K5HA 3VA7A 1AN8A 3NP8A 1EQTA 4KD3A 1STEA 3MXNA 4C3HG 4DNRB 5IGFA 1TS5A 2SDFA 2EDGA 1M8AA 2A6EC 1YJ9A 1TS4A 4LF8Q 1N36L 2ZXOA 3TRZA 1A8VA 4OELB 3R93A 5FLXL 3MWYW 4ODGA 1PTOC 1ZEQX 3FP9A 1EOTA 4F88A 2YTXA 3PIP3 4JI2Q 4CDDC 1KXLA 1WI5A 3FEWX 3SR1A 2C35B 3W1BA 2YV5A 3KBGA 5IT9c 3GTKH 1D2BA 1MKHA 3SHLA 2N49A 2AQ3B 3H09A 3UDIA 5D14A 5M3MB 1HNWQ 5L37A 2WINB 3Q6SA 4FP5D 1S5ED 3CC7A 2CQOA 2ZM6L 2EPBA 1DOLA 2JA9A 2K05A 5IYBG 2ES2A 1KAAA 2BA0A 5KYLA 3S17B 3A7AB 5KIXA 5IYDG 5GAHC 1JJGA 4AH6A 1Q81C 1HA5A 4NB3A 1TR5A 3JAME 4CKCA 1T5XD 2VY3A 5C0XH 4P75A 3PUWA 3V96A 1EYGA 2SNMA 2Q2IA 3I7FA 2ZTCA 4Q0FA 2QEXA 3NHHA 2ZXPA 3NPPA 1N36Q 4POGA 2Q8TA 3D31A 5C4JH 2WKCA 1VQAA 1PH4A 5JEAG 2CKZB 4ME3A 3K58A 1II3A 1B53A 4FYDA 1SE8A 2VW9A 2OQ0A 4FXGC 4EQPA 4CJ1B 1TQOA 1JOQA 1Q1EA 4KTAA 5ELCA 1V8QA 4RGNA 1R9TH 1IYJB 2MJ8A 3K0YA 1VQPA 1UE1A 1ET9A 3W3AA 4PMBA 1NUCA 2ZM6Q 1EFWA 1MJCA 1EQQA 4X3KA 3S1RB 3J81i 1D6EC 3M85A 1EIGA 1KRTA 2EYFA 2AMCB 2FFKB 3QJYA 1YJNA 3K57A 2L9HA 4FF1A 1G91A 3BG3A 4RWSC 4X62L 1ENCA 5C3EG 3SGIA 1KNEA 3QR8A 1RKNA 1FGBD 2RVLA 3RR5A 5IGEA 4NPSA 2NZHA 2B8GA 5A2QL 2V4DA 2IY5B 1YZ6A 1Z6HA 4HEDA 3RLNA 4ID6A 1YHBA 1VMCA 1FD7D 4LUVA 5DEHA 3K5LA 2FJ2A 1D1KA 1HZ9A 1YNJC 5KYIA 4G7HC 4X6AH 1VQBA 3FKIG 3IFDA 2UUBL 3TS2A 1B2TA 1EL0A 1TWAH 4DXFA 2EQSA 3G6JB 1OXSC 5DNFA 4NW2A 3RN2A 3TP6A 5JVG3 1EYCA 4XQJA 3H3VH 1VQFA 1SFOH 5HY6A 5EJWA 2F0OA 1CKMA 1NR2A 3TBIB 3WOFA 1BVSA 1QG7A 3KF8B 1F2ZA 3S24A 1AFPA 2R3ZA 2G5DA 4BWGB 3OYYA 3LGJA 3HRZC 3WWVA 1TU2B 1O7IA 1EWIA 1MSGA 4LF9L 3CCMA 4LNQA 1KABA 4X62Q 4RH6A 2SEBD 4JI1L 5C3XA 4MIUA 1GUSA 1I50B 1S5CD 2F0VA 3PF5A 2QKIC 1PH5A 3AMUA 3RZOH 2F0IA 2M9VA 3LX0A 1M4VA 1Z9FA 3CCQA 1F2YA 4GLXA 3TEHB 4WJ3M 2UUBQ 3X3MA 1YNXA 3D3RA 3ER0A 4IOAA 4YIJA 1WTVA 4HTHA 4UP9A 1GUOA 3T4AC 4OWTB 3QG1A 3ICEA 1YI2A 2PQEA 1YNND 3SK4A 4X65L 1EY0A 4EQOA 1BF4A 2QILA 5C44B 4CDFC 5D3IB 1STBA 5G3LF 1PLFA 3G4SA 5ELBA 1JE4A 2HDMA 3M3YH 3CPFA 4PZ8A 3AEVA 5IE8A 4ZK9B 4CJ0B 5JJZA 4BBSB 4LF9Q 1W6KA 1EY8A 4BY7B 4U68A 1QOHA 4UY8C 4JI1Q 1AP0A 3DMUA 4OEMB 1HJPA 1CKNA 1ILQA 1LM0A 5CV7A 1D1IA 1JOKA 1LTAD 3G71A 1D5XC 1U0LA 4NXML 4XQQA 2JA5H 2EJFC 3FMCA 1WOCA 1A3VA 3HKZE 2H5XA 2MO0A 3GTJH 1EQRA 3EVQA 1JB3A 2K6AA 2LMCB 1V1QA 1V9PA 2UU9L 2Q8RE 2KHSA 2CH4A 2A19A 4F87A 4KJOA 1Q3LA 1BR9A 1RJTA 3GTOB 4DV3L 4BA2I 2BE5D 4X65Q 1VQNA 3HOVG 4GOPA 2KENA 5EPKA 4A3JH 1K8GA 2Y0SG 4RMFA 2F3WA 2K75A 3KJPA 4A3EG 2K28A 2MPMA 4KV6A 3HOYH 2B2UC 1TY2A 4FF3A 1YNNC 4KY5A 3NQIA 1Y69U 4XQNA 2PPBC 1NJIC 3OPOA 2F0NA 3J80E 1BCPB 4HJ7A 1L0WA 2NB0A 5CV5A 1BUVT 3LNNA 4LWCA 3CMAA 3CCUA 1KLGD 2QDLA 4NXMQ 4GLVB 4PMWA 3S1MB 4C3IG 3CHBD 5M5YH 1WCMH 1C8CA 2R6GA 1YHQA 3T1YL 1CQVA 3H0GG 2YU9B 2F0QA 4LMQD 1TXYA 3J81L 2UU9Q 1M90C 2L1BA 3C1EA 3HKZB 2E76C 3CQZB 4CDEC 4Q5VA 4DV3Q 3T53B 4LAAA 4IFDI 1X54A 4A3GB 4MTNA 5DM63 1EEID 4ZKBB 2R7ZH 2E75C 4JI7L 4R1JA 3F2CA 2WACA 3NWSA 4A3MB 3HOXB 2I46A 1ASYA 3EIVA 3PO3G 3A74A 4HR7B 1EU3A 2OTLA 2PW7A 4QJFA 2BE5C 1ASZA 4QGUA 2LY7A 3NXWA 1X32A 1VQDA 3G48A 3A5ZB 4L8JA 4DR6L 2B2VA 5IP7H 2IW3A 4IPHA 1ESFA 2R93H 5C4XH 1N34L 3E0EA 1DZ1A 1LO5D 4GNXC 5GAEC 2IX1A 4P72A 5I4DA 3HOZB 4A3KG 1X56A 3T1YQ 5IY0A 4JBMA 1FJGL 3PUVA 5M3FG 1KC8C 5CV9A 2F0UA 2OEOA 2C9OA 1A63A 3TQYA 1DOKA 4HSPA 2NVQH 3MA2B 2JA6G 4RA8A 2EVBA 2Z0SA 5EKIA 3K5OA 3VDYA 4IN3A 4ULLA 2HT1A 1V1PB 3WOEA 1VQ6A 2BH2A 2RA4A 4XYQA 1KLUD 1FNWA 4RGMA 4JI7Q 4B08A 4P73A 4LFAL 2G9DA 2Z9HA 4HIKA 5BN3A 2E2HB 1JCKB 3KYHC 3MXPA 1Y8NB 3I4NH 1UAPA 1MGSA 2FMMA 4CBVA 1XTCD 1L0YB 1LACA 4DR6Q 3L9AX 4A93H 2JEBI 5NUCA 2JXMB 3URYA 3MXNB 4Y52H 1A2UA 4YHHL 2VZAA 4FVMA 5FLXE 1C48A 1PRTF 3VR4A 1BQQT 2QF7A 1FJGQ 2CVRA 4A3MG 1JMCA 5JJLA 2BDOA 1XPUA 3LWEA 4HJAA 1JR0D 3GTKB 3I55A 4ZLTF 1B9MA 1BBWA 3U4VA 4H13C 2F0JA 1IKLA 3CAMA 4BS9A 3PO2G 3RD4A 3A0JA 4ZAIA 2UUCL 2LXKA 4LFAQ 4G57A 3J7AF 4UP8A 1V43A 1VQKA 2MGSA 3PF4A 2EYHA 3ULLA 1DM0B 4TQUS 1A2TA 3AQQA 2L55A 3F2UA 4WJWA 3OWFA 2GA4B 5IP9H 2CFMA 4DAYA 3AYHB 2EZVA 2PZUA 4TKOB 2JSOA 3U58A 3EN2A 5C4JB 2R92H 1SMYD 2D9UA 4K14A 3TZUA 4YCVA 1SYDA 1X3QA 5CV6A 2F4VL 1H9MA 2Z4IA 3FPPA 3TSSA 5C0XJ 1HNZL 4OWWB 1VQ7A 4KKSA 1HQMC 4YCUA 4DAMA 2I0QA 2F0TA 2K50A 3M4YA 2AUJD 1K3RA 4IFDG 2VUMG 1JJCB 4AYBE 2EIFA 2WAQE 5EAYA 1NCVA 1SLJA 1EY5A 1A0IA 5I2XA 1R9TB 3U4ZA 3S15H 3DXJC 2K03A 2E2JH 2BDNA 2KEDA 3J80L 5DM73 3KLSX 3BS1A 2PZTA 3A8JE 5DLQE 2UUCQ 2JA8H 4X66L 1ONLA 1CT1D 4LF6L 1EY6A 2JN4A 1P16A 3MVVA 4UHVA 1F9SA 2OWOA 1ICWA 3GTQH 1GHKA 4IUUA 2KVMA 3L7ZC 3HOWG 4GN4B 3PIO3 2L15A 4YWMA 1PTOF 4DF7A 2K7VA 1MD2D 2E2IH 4OX9Q 2QGQA 5BN5A 5A2QE 4A3BH 5EBDA 2B2YC 2F0KA 4A3IG 1CSQA 5FLMH 1PH9A 4A3GH 1H9JA 2F4VQ 1HNZQ 3VYRA 4ZCKA 1KTKA 1QVGA 1O7YA 1GVPA 2B8FA 3W1GA 1ESRA 1L0XB 1ET6A 2PO4A 4QIWE 4JBKA 1TWAB 3NK9A 2HDLA 2GVBA 2A1AA 1SMYC 1SFOB 1GUTA 1JWSD 2P5ZX 2TMPA 2MO1A 5KEEA 2RSNA 2UXBL 2A68C 4AYBB 2WAQB 1EY9A 3CPWA 1CUKA 4X66Q 3DHQA 2N55A 4LF6Q 4A3LH 3HP3A 3TMEA 1HR0W 5IOCA 1F2MA 2RCNA 4HCEA 4KKTA 3I4MH 5CBEE 2M2LA 2F0PA 2HIXA 3TZDA 1HPCA 1XMQL 1Y8OB 4QB4A 3M7NA 4JPBW 4DK3C 3RZOB 1HR0L 1J8IA 1EQVA 4HMIA 1BNZA 1SNMA 1W3SA 2Q2HA 4RGTA 4DUYL 2A8VA 2WV6D 4HSVA 2KECA 1HRJA 1WTPA 1H9RA 4K0KL 4C3JH 5IGDA 1I4HA 2MFIA 5HGTA 4JYAL 1Q12A 3PQIA 1N33L 1G2TA 1N32L 1E2VA 1BCPD 1RDPD 1STAA 2KCTA 3P7JA 2UXBQ 1BDOA 3GTPH 5FO8B 4QIWB 3T1HL 4QL5A 3QWNA 4QY7A 1LUZA 3M3YB 3RNUA 5IT9E 4DR4L 3MEFA 3CCRA 1F9RA 3R8BA 4RCNA 1SDFA 5E3FA 3CMEA 5JEAJ 4DNIA 4OHJA 3CCEA 1MI2A 4APVA 2E5LL 1WTQA 3A54A 4IUPA 1XMQQ 2NN6H 2RCFA 1AEXA 1SYGA 1B9NA 1HR0Q 3CCJA 1Q86C 3M4OH 5M9OA 4HJ8A 1SEBD 2XRSD 2JA5B 3KOJA 1CKNB 4TVAB 2JYOA 5C4HA 4DUYQ 2C5CA 4IPCA 1RCVD 4H7BA 2A6HC 2K4KA 1VS0A 1YITA 2YYZA 3GTJB 4DKAC 3K5MA 4R4TA 2B63G 4K0KQ 1WTRA 4PNYA 4BY1H 4ZYSA 1Y1WG 4JYAQ 3G7LA 1N33Q 3G6EA 1N32Q 1VF5C 3RLOA 3TDQA 4CKEA 1CSPA 4ZRZA 2K5WA 2FMCA 1EIYB 1XYIA 1LT6D 1RTNA 4XYOA 3T1HQ 4A3JB 1Z7TA 3MFGA 1SJED 4I7ZC 1WYDA 3P75A 1T5EA 2HIVA 1O7ZA 1BCPC 3I70A 5I2YA 1BXTA 4GOPB 3HOYB 1LTTD 4DR4Q 2PI2A 3HOUG 2G9HD 4AIMA 4DXGA 2MHVA 5IWAL 4A3FG 1LTID 1OXTA 3ND9A 1UEAB 4M8AA 3TS0A 4OONA 4GKJL 2E5LQ 2H4OA 1I4RA 5FJ8H 1SNCA 4YY3L 1XWEA 2I5HA 4C1NI 3T16A 3HS0C 2DJGC 3JAMc 3SK5A 2KEEA 4G4KA 1B50A 2KUMA 1EY7A 1PVOA 3FPUB 3SEBA 2YTVA 1WCMB 5M5YB 2SNSA 3R2TA 4IUVA 1IKMA 3CKIB 3NUCA 4QUFA 3K0XA 1VQ4A 4HCSA 4MN3A 2SOBA 3J81E 3Q22A 2A5HA 2WIIB 2B2TC 2I5MX 4TSSA 1K8OA 3UI2A 5CMDA 2JA7H 1FGUA 3PMFA 1Y1VH 4A3DH 1JWUD 1GUWA 3IAYA 4JOIA 4L5TA 4BBRH 4GLAC 1TKWB 3U9SA 1E22A 4HIOA 2R7FA 3ND8A 3OIPA 2R7ZB 3SK8A 3TN2A 2O2LD 5F2DA 1PFNA 3KF6A 1RF2D 1YVCA 5M3MG 2F0FA 2AWNA 4XTCS 2D62A 1A6XA 2F0EA 1IW7D 5EPJA 5IWAQ 1CK1A 4C3HH 1LTSD 1SYEA 4GKJQ 3P20A 3Q0AA 4G7ZC 1JB7A 2D0OA 5M5XH 4GN3B 4YY3Q 2R93B 5C4XB 2A74C 2Z6KC 5H1SE 2NZ1D 2OF1A 2EOTA 3D4WA 4B9WA 3GTMH 3DLLA 1B8AA 1GXDC 1I4PA 1GHJA 1J6QA 1CI3M 4J6HA 2NVQB 3VR5A 4JBWA 1X3GA 1B70B 3PIPA 5LL6X 3T56B 1U4LA 4JI0L 1Q8IA 3I56A 3EROA 4MTKA 4IOCA 2CH4W 1QZHA 4HJ9A 5IYBH 2N78A 4WFN3 1K3BC 1HZAA 1U4PA 1BBXC 1SRUA 3U9OA 3PCOB 5IYDH 3OTOL 3OOCA 1BO0A 2FINB 3I4NB 5JVH3 1PDQA 2IHEA 4MHEA 2BCOA 1HNXL 4A93B 2PYKA 1VQ9A 1L1OA 1VQ8A 2A73B 2AHOB 2ZJPA 2VNUD 1SE3A 1ZKOA 3ONAB 3CW2C 3Q8DA 5JEAH 1WVLA 2NWGA 2O5JC 1HUMA 4FDBA 1A3UA 4YWKA 2VXWA 4GZYC 2WFWA 5I6YA 3D8GA 4RAUC 1GO3E 4M1UB 5IT9L 3ZYYX 3IFTA 4A3CG 1PZJD 5C4ZA 4DV2L 1H9SA 2NUCA 3PUXA 4JI0Q 4QQBX 1U9RA 2N3SA 3S14H 4DK0A 2K1BA 5GADC 1VQEA 1VQGA 3SXHA 4O2DA 4UDUC 4JK1C 4LF4L 4NP5A 1SJHD 4QF4A 4CDCC 3H15A 4OGQC 4KHVA 3D6CA 1LABA 3OTOQ 3ERSX 1ICFB 2NTSA 3RMHA 1EOVA 2Q2UA 4HMJA 4FXDA 1S72A 5C3EH 2E2DC 1HNXQ 4WJ4A 4C2MH 2F52A 1I3QH 3I73A 2R92B 4DV5L 2IX0A 3X3NA 4JBJA 4DAYB 3L3OC 2VQFL 2XWBB 3STBD 4LFCL 2B29A 2AUKA 3FKIH 5LMNW 2N8NA 4DA2A 2X69A 3S15B 4EGVA 3KDFA 4B9XA 4DV2Q 3NQTA 3D4RA 4KY6A 2E2JB 2LFNA 1L2FA 4KK7A 3E6ZX 3TP5A 1FNUA 4DAPA 4PQXA 1AH9A 2JA8B 3I90A 1EY4A 5LMNL 1I6HH 2VQEL 2L4NA 3IKJA 3D4DA 4LF4Q 2JK8A 5C44G 3GTQB 2A69D 3C46A 1LTLA 1EWHA 3GTLH 3M4QA 3N6RA 3NBHA 1Q46A 5AJ3L 1CHPD 2B2WA 4GKKL 1CQFA 2ALYB 1TY0A 2E2IB 4OO1I 2K14A 1VMPA 4LK1C 1Z47A 2QCPX 4BBSG 4A3BB 2F0HA 4BY7G 4DAVA 1HQRD 4DV5Q 4X3UA 1B3QA 2KQ3A 3IRBA 3J80c 2LKVA 1TIID 2TSSA 2F0DA 1XPRA 3H3VC 5DAUA 2VQFQ 2HHHL 1QNKA 1GUNA 3D6WA 4LFCQ 1XTDA 3RLFA 2J0TD 1CA6A 2Z4HA 2E8GA 4UAIA 1UUPA 3PUZA 4EQ5A 2GN5A 4R9WA 1H9KA 3S1NH 2RDFA 3F8TA 2RHSB 1ILPA 5GAGC 1HA6A 3HEJA 4TRDA 4N8X1 5FO9B 1XJVA 5LMNQ 2VQEQ 4JI5L 4JI4L 1XNRL 2ZJRA 3QOJA 4N8FA 4NKLA 3I4MB 2NYZD 1JE5A 5AJ3Q 4GKKQ 4MNOA 1EZ6A 4S3SA 1KDCA 1Y14B 2B39A 1DONA 1FVIA 2A69C 4ZUIA 3W5OA 1STGA 3MTSA 4UP7A 2RBMA 2HD3A 5K5PA 5KNDA 2HHHQ 5C0XI 1JOOA 1X3EA 4C3JB 2HQEA 4YWLA 1VDZA 4IJHA 4V0BA 5E7NA 1YHAA 3L2PA 4DNTB 2WB1E 3FDTA 4I65A 5K36G 5IYCG 2Z6BA 1K28A 3GTPB 3HOVH 1JWMD 1G6ZA 3KK7A 1GKHA 2EYMA 3HKZG 4A75A 4H44C 1ENFA 3HZXA 4A3EH 4JI5Q 4JI4Q 1D5MC 2PI2E 1XNRQ 1UE7A 2IX3A 4A3GG 1G51A 3BDOA 4RGOS 1K83H 4DV7L 3HOXG 4JI6L 2PCFB 1HFNA 4R4IA 1CM9A 2K33A 3M4OB 2EYLA 2D5DA 5J39A 3QO2A 1XNQL 4JC0A 1Q82C 4C3IH 4KN4C 5CGKA 4IALA 5EKLA 4O1NA 4PZ7A 3A5UA 5I9OA 3H0GH 3I2ZA 3A56A 4BY1B 2L12A 1JC7A 3IL8A 3I4LA 4DV4L 5IIFA 3AFPA 4C1NK 4OL7A 3ZJYC 3HOZG 1FYCA 2R61A 2F0LA 5FLXc 1ZXTA 1OO9B 1G6PA 1EWCA 1A3TA 2JE6I 4IPDA 3U50C 1HHVA 3SDZA 2EYJA 2IL8A 4GOPC 1BOSA 4ZKCB 2ZXRA 2RQXA 4IUNA 4OX9L 4JG2A 1SBBB 5EBCA 1E24A 1WD1A 1U5KA 2DUDA 1TS2A 1PTOH 2WB1B 3EBEA 2F0SA 3AFQA 2NVTH 1UEBA 5T1IA 5IODA 3CCLA 3PO3H 5C5MA 1PHJA 4BXXG 3H3VI 1I94L 4OO1G 1GOZA 4DV7Q 4Y7NH 1OTCA 4E6IA 4JI6Q 1QUQA 3A8KE 1WFQA 2ICIA 3DWQA 3A7LA 1XNQQ 3QB3A 4F8MA 4A3KH 1NAPA 3O13A 4RKBA 4GS3A 1TWHH 3OW2A 3K80C 5KGUA 5M3FH 4J15A 4DV4Q 2X6GA 4POFA 3B6YA 4Z9CB 1LTBD 2JA6H 2WKDA 2JA7B 4X3SA 1Y1VB 5FO7B 4A3DB 1Q1BA 4BBRB 4HIMA 2HCCA 5IGBA 4RG1A 1PYWD 1RHPA 3BYYB 5E4XA 2EXZA 2N88A 3H94A 3P1HA 4L6TB 3T51B 1K0SA 4QMGA 1YIJA 1SNPA 2RKSA 4R8IA 1HZCA 1I94Q 4DK1A 3BDCA 1HZBA 5GQOA 3VR2A 3KF6B 4C3HB 3J7ZC 1O7LA 2B2VC 4MZ9A 2JP1A 5M5XB 1NR4A 2HUGA 1TVXA 1BBUA 1EYDA 1NBWA 1DOMA 3SK6A 3RN5A 5C0XG 3K59A 1B1ZA 4IZ8A 3GTMB 2OXPA 2BH8A 3RUZA 5LHY1 4OXPA 1NY4A 5D3DA 4DR1L 4V190 1NMGA 5ELDA 3J7A5 1VQJA 3R2IA 1F77A 1K0RA 1WJJA 4P74A 4DR7L 1V1OA 1Y8PB 1UE5A 4N9TA 4L5SA 3HGBA 1CFMA 1STHA 1RD9D 2PNRC 3TREA 1BCPF 1UE6A 1WTOA 5CORA 5M5WH 2DY7A 1E0BA 4FF2A 4IURA 3WDNA 3BDLA 2OT2A 1VCIA 3PO2H 2B3GA 1IZ6A 4GN5A 2BOSA 3GV3A 1F9PA 4KN7C 4NMZA 1YBYA 2DNEA 4ABNA 1IYUA 2CHBD 2DJFC 2HCIA 4CKBA 2JJQA 2NVYH 3MEHA 4B3SL 3UDXA 1SE4A 1VQMA 1KHIA 3CRKC 2VL6A 1GD7A 1WTHA 4PZ6A 1HH2P 2PNHA 4JW0A 5EPLA 1HXYD 3NBIA 2V1CC 3S16H 4L5RC 1EEFD 1PYBA 1E2WA 4LUZA 1N9WA 1L1OB 3BVGA 1QB5D 3KBXA 4DR1Q 5C6AA 1SN8A 2I5LX 1QCBD 4JCVE 4DR7Q 1D5ZC 4K5XA 2IT1A 2VUMH 3I72A 3NTKA 3OMGA 5CR3A 1WTXA 4JV5L 1PH3A 1KDBA 4FF4A 4R4OA 2MUYA 3MZ5A 1QZGA 2EXDA 3VYTA 2PQAB 2NBFA 2K04A 3CP0A 3E9HA 4ILWA 3S14B 3NSWA 1HUNA 1HTLD 1SMXA 3NELA 1PZID 5HGQA 4KLKA 1ENAA 4NXNL 1C0AA 5ELEA 1H9SB 1MHWC 1PFSA 1X55A 1VQCA 2UXDL 3ITPA 2RSOA 4U673 1JQYD 4AYBG 2WAQG 4B3SQ 3QIAA 3HOWH 4EX5A 1SE2A 1I4XA 1LLRD 1YEZA 3W2DA
chains in the Genus database with same CATH topology
2K32A 4O42A 1SYCA 5C3EB 4C2MB 2PZWA 5COYA 1I3QB 4IUQA 1FR3A 4EVOA 2ID0A 1HTPA 2VB3X 4P2CB 1Q90A 4RHSA 4LJZC 2CW0D 1QILA 3FKIB 2EYPA 5CV8A 4NDXA 2KOLA 5EGTA 4C56C 2D2CC 2EE1A 1S5BD 1YNJD 4DFAA 3I8ZA 2Z8LA 3H91A 5FK9C 1I6HB 3VR3A 2PW5A 2K01A 1MSHA 3OHXC 3GTLB 2ZT9C 4PV1C 2KCNA 4RKLA 1E2ZA 2B2UA 1EIHA 2IJ0A 2EJMA 2L5TA 2ICEC 1CZWA 1U4MA 3VR6A 4XIGS 2X6LA 3EJIA 4K8JA 3LWUA 3KLRA 5I6WA 4FO2A 1EYAA 4OIJA 3S1NB 3EA6A 4J8QA 4CHTB 2CW0C 1PMRA 1F9QA 1QWYA 3A55A 3GV6A 1R4QB 3GO5A 3VA5A 1PRTB 2XIWA 1XXGA 2XN9C 4QCLA 5JPNC 3MXUA 4R8NA 3I91A 3M7GA 2IWHA 1SYBA 1IHZA 4CGYB 3GQBA 2F3VA 1CTMA 1B44D 5BN4A 2F0GA 3VYSA 5CC4A 2IPKD 2XSCA 4XT1B 5HURA 3NTIA 3HOVB 1NSNS 1TT2A 2Y0SB 4A3EB 2F1MA 2XWJB 4RFBA 1IW7C 1SSOA 1K83B 3ERQA 2F03A 5ELFA 5CYUA 1STNA 1PXUA 3S9WA 1O80A 3NE5B 4C3IB 3H0GB 2I07B 4FXKC 1GUGA 4KKUA 4WRDA 4EQNA 3DEOA 1CHQD 2EY1A 4ZQ3A 1F2LA 4XT3B 1J9OA 1PTOB 4XXEA 2NVTB 1IL8A 3TP7A 3DM1A 4DN4M 5G3LD 3PO3B 5IGCA 3MAQA 4DGZA 1S4ZA 3PV0A 4Y7NB 5J22A 1B4OA 4QUCA 2FHTA 2KCCA 3E0JA 5CBAE 5EKKA 2DN8A 1DJRD 3JAML 1EFID 4KHZA 3GP7A 1C4QA 4J1MA 1GJXA 2DNCA 2EY6A 4A3KB 1CZGA 1TWHB 4PMCA 5A35A 5M3FB 1LT5D 3EQLC 4H0LC 5D65A 2KA7A 1WTWA 2O5IC 2JA6B 3CU7A 3OMCA 2CQAA 5KNCA 3CRLC 2EY5A 4KMUC 1LTRD 2NTTA 4N9PA 2K5QA 5TSSA 3KUPA 4RHRA 1RODA 3TP8A 4KI0A 5FKAC 3AU7A 4ZUJA 2EYOA 1LT4D 4KJNA 2VB2X 1W6JA 1KDAA 1QNUA 4DU9A 1R4PB 4K6LA 3C1FA 5C3WA 2E74C 2B2YA 1DCZA 3OWEB 1S5FD 2H1EA 2KJXA 2NN6I 3FVQA 4F7XA 3BZDB 3OW7A 5M5WB 1SAPA 3V2TA 3BVZA 1SNDA 2MP1A 3NTHA 3KF8A 3PO2B 2JEAI 4HN7A 2AQ2B 1OXXK 1EU4A 2XNAC 3AB9A 2NVYB 3BYTB 1G291 2J7ZA 3C3LA 1SXTA 1S5DD 5FOBB 3J7YW 1PZKD 3S16B 1G8ZD 1OXVA 2O4XA 4XDXA 5CV4A 2EY2A 3DWPA 2DY8A 4K2KA 5E1FA 2J4XA 3DUZA 5KNBA 1HCZA 2VUMB 1XX8A 1G2SA 4FNFA 2Q8IB 1KNAA 2QEJC 3R3OA 3GD7A 1AZQA 2L11A 4IFDJ 2XRQD 2RDGA 3NWTA 2QDBA 4X3TA 3HOWB 3OIQA 2AQ1B 5JOBA 3KLSA 3DWAA 1FNVA 3Q23A 3E5SA 4A3IB 4K8IA 3SE0A 1CA5A 3SVMA 1O78A 3EFXD 1STYA 5ISRA 3FRPB 3MC0B 3C2PA 3K7AB 1PRTD 5JAVA 1ML0D 3K6OA 1JICA 4C3JG 1A15A 3I3CA 2LS01 3S2HB 3J7AV 1QE6A 1JORA 1IYVA 2EJGC 1LTGD 3MHBA 3S2DB 2F0MA 1DXMA 4K6DA 1SNOA 1ZYRD 2A68D 1HFGA 2PMZB 2B2WC 4ME5A 2K5DA 4KD4A 1X3PA 4KY7A 2AWOA 2NVXB 4WORA 5E4WC 2F4IA 4G7OC 1TWGB 1AZPA 5J1ZA 4OIKA 2NN6G 1I4GA 3T13A 1DYQA 2ENBA 3BVMA 3HG9A 2XVSA 1SNQA 5T1GA 1RTOA 3RZDB 2RDHA 3MFYA 5K36H 1SYFA 1EZ8A 1QJOA 5KRUA 5IGGA 1I4QA 3N52A 3OSOA 1LV9A 2B2TA 3VYUA 3Q24A 1PRTC 4IQZA 5JPMC 1PFMA 3QOLA 5EQ0A 3H6MA 1UNSA 1MBYA 3A8IE 3K5NA 2A6ED 5I9PA 2WP8J 4HAEA 4K2LA 1WD0A 5C5LA 1PTOD 1TWFB 1ZYRC 1B3AA 1VF7A 3MXGA 2Z1CA 4IUTA 4RCOA 2B63B 5AFWA 2BA1A 1Y1WB 3DEPA 3PUYA 2A6HD 1LT3D 1V1PA 4K5VA 1OXUA 5LL6S 4L63B 2M00A 4CJ2C 3HOUB 1AW7A 4BA1I 4OO1H 4A3FB 1K8MA 1U4RA 4K5WA 1TS3A 1PFBA 1I6VC 2L0CA 4IFDH 3GTGB 3S1QB 3V05A 2F0WA 1TWCB 1DD2A 3VA7A 1AN8A 3NP8A 1EQTA 4KD3A 1STEA 3MXNA 4C3HG 4DNRB 5IGFA 1TS5A 2SDFA 2EDGA 1M8AA 2A6EC 1TS4A 2ZXOA 3R93A 5FLXL 3MWYW 4ODGA 1PTOC 1ZEQX 1EOTA 4F88A 3PIP3 3FEWX 3SR1A 1D2BA 3KBGA 3SHLA 2AQ3B 3H09A 5D14A 5M3MB 2WINB 3Q6SA 4FP5D 1S5ED 2EPBA 1DOLA 2K05A 1KAAA 2BA0A 5KYLA 3S17B 3A7AB 5KIXA 1HA5A 1TR5A 3JAME 4CKCA 1T5XD 5C0XH 3PUWA 3V96A 2SNMA 4Q0FA 3NHHA 2ZXPA 3NPPA 2Q8TA 3D31A 2WKCA 5JEAG 3K58A 1II3A 1B53A 4FYDA 4FXGC 4EQPA 4CJ1B 1TQOA 1JOQA 1Q1EA 4KTAA 5ELCA 1V8QA 4RGNA 2MJ8A 3K0YA 1ET9A 3W3AA 4PMBA 1NUCA 4X3KA 3S1RB 1D6EC 3M85A 1EIGA 2EYFA 2FFKB 3QJYA 3K57A 2L9HA 4FF1A 1G91A 3BG3A 4RWSC 1ENCA 1KNEA 1RKNA 1FGBD 2RVLA 5IGEA 2B8GA 5A2QL 2V4DA 1Z6HA 4HEDA 4ID6A 1VMCA 1FD7D 5DEHA 3K5LA 2FJ2A 1D1KA 1YNJC 5KYIA 4G7HC 1EL0A 3IFDA 1B2TA 4DXFA 3G6JB 1OXSC 5DNFA 4NW2A 3TP6A 5JVG3 1EYCA 4XQJA 5EJWA 2F0OA 3TBIB 1NR2A 3WOFA 1QG7A 1F2ZA 1AFPA 2R3ZA 4BWGB 3HRZC 1TU2B 1MSGA 1KABA 4RH6A 2SEBD 5C3XA 4MIUA 1GUSA 1I50B 1S5CD 2F0VA 2QKIC 3AMUA 2F0IA 2M9VA 3LX0A 1M4VA 1F2YA 3X3MA 3D3RA 4YIJA 1WTVA 4HTHA 1GUOA 3T4AC 3QG1A 2PQEA 1YNND 3SK4A 1EY0A 4EQOA 1BF4A 2QILA 5C44B 5D3IB 1STBA 5G3LF 1PLFA 5ELBA 1JE4A 2HDMA 4ZK9B 4CJ0B 5JJZA 4BBSB 1W6KA 1EY8A 4BY7B 4U68A 1QOHA 1AP0A 3DMUA 1ILQA 5CV7A 1D1IA 1JOKA 1LTAD 1D5XC 4XQQA 2EJFC 3FMCA 1A3VA 3EVQA 1JB3A 2K6AA 2LMCB 2Q8RE 2KHSA 4F87A 4KJOA 1Q3LA 1BR9A 1RJTA 3GTOB 4BA2I 2BE5D 5EPKA 2F3WA 2K28A 2MPMA 4KV6A 2B2UC 1TY2A 4FF3A 1YNNC 4KY5A 3NQIA 1Y69U 4XQNA 2PPBC 3OPOA 2F0NA 3J80E 1BCPB 2NB0A 5CV5A 1BUVT 3LNNA 1KLGD 4PMWA 3S1MB 4C3IG 3CHBD 1C8CA 2R6GA 1CQVA 2YU9B 2F0QA 4LMQD 3J81L 2L1BA 3C1EA 3HKZB 2E76C 3CQZB 4Q5VA 3T53B 4LAAA 4IFDI 4A3GB 5DM63 1EEID 4ZKBB 2E75C 2WACA 3NWSA 4A3MB 3HOXB 2I46A 4HR7B 1EU3A 2PW7A 2BE5C 2LY7A 3NXWA 1X32A 4L8JA 2B2VA 2IW3A 1ESFA 1DZ1A 1LO5D 2IX1A 5I4DA 3HOZB 3PUVA 5CV9A 2F0UA 2OEOA 2C9OA 1DOKA 4HSPA 3MA2B 4RA8A 2EVBA 5EKIA 3K5OA 4IN3A 4ULLA 1V1PB 3WOEA 2RA4A 4XYQA 1KLUD 1FNWA 4RGMA 4B08A 2G9DA 5BN3A 2E2HB 1JCKB 3MXPA 1Y8NB 1UAPA 1MGSA 2FMMA 4CBVA 1XTCD 1L0YB 1LACA 3L9AX 2JEBI 5NUCA 2JXMB 3URYA 1A2UA 4FVMA 5FLXE 1C48A 1PRTF 3VR4A 1BQQT 2QF7A 2CVRA 2BDOA 3LWEA 1JR0D 3GTKB 4ZLTF 1B9MA 4H13C 2F0JA 1IKLA 4BS9A 3RD4A 4ZAIA 4G57A 3J7AF 1V43A 2MGSA 2EYHA 1DM0B 4TQUS 1A2TA 2L55A 3F2UA 4WJWA 3OWFA 2GA4B 4DAYA 2EZVA 2PZUA 4TKOB 2JSOA 5C4JB 1SMYD 2D9UA 4K14A 3TZUA 1SYDA 1X3QA 5CV6A 1H9MA 2Z4IA 3FPPA 3TSSA 5C0XJ 4KKSA 1HQMC 2F0TA 3M4YA 2AUJD 4IFDG 1NCVA 1EY5A 5I2XA 1R9TB 3DXJC 2K03A 2BDNA 2KEDA 3J80L 5DM73 3KLSX 3BS1A 2PZTA 3A8JE 1ONLA 1CT1D 1EY6A 3MVVA 1F9SA 1ICWA 1GHKA 4IUUA 2KVMA 3L7ZC 3PIO3 1PTOF 4DF7A 2K7VA 1MD2D 5BN5A 5A2QE 5EBDA 2B2YC 2F0KA 1H9JA 3VYRA 1KTKA 1O7YA 2B8FA 1ESRA 1L0XB 1ET6A 2PO4A 1TWAB 3NK9A 2HDLA 1SMYC 1SFOB 1GUTA 1JWSD 2TMPA 5KEEA 2RSNA 2A68C 4AYBB 2WAQB 1EY9A 3DHQA 2N55A 3HP3A 3TMEA 5IOCA 1F2MA 4HCEA 4KKTA 5CBEE 2M2LA 2F0PA 3TZDA 1HPCA 1Y8OB 4QB4A 3M7NA 3RZOB 1J8IA 1EQVA 4HMIA 1BNZA 1SNMA 4RGTA 2WV6D 4HSVA 2KECA 1HRJA 1WTPA 1H9RA 5IGDA 1I4HA 5HGTA 1Q12A 1G2TA 1E2VA 1BCPD 1RDPD 1STAA 3P7JA 1BDOA 5FO8B 4QIWB 3QWNA 3M3YB 5IT9E 1F9RA 3R8BA 4RCNA 1SDFA 5E3FA 5JEAJ 4OHJA 1MI2A 1WTQA 3A54A 4IUPA 2NN6H 1AEXA 1SYGA 1B9NA 5M9OA 1SEBD 2XRSD 2JA5B 2JYOA 5C4HA 2C5CA 1RCVD 4H7BA 2A6HC 2YYZA 3GTJB 3K5MA 1WTRA 4PNYA 4ZYSA 3G7LA 1VF5C 3TDQA 4CKEA 4ZRZA 2K5WA 2FMCA 1XYIA 1LT6D 1RTNA 4XYOA 4A3JB 1Z7TA 3MFGA 1SJED 4I7ZC 3P75A 1T5EA 1BCPC 1O7ZA 3I70A 5I2YA 1BXTA 3HOYB 1LTTD 2G9HD 4DXGA 2MHVA 1LTID 1OXTA 3ND9A 1UEAB 4M8AA 2H4OA 1I4RA 1SNCA 1XWEA 4C1NI 3T16A 3HS0C 3SK5A 2KEEA 4G4KA 1B50A 2KUMA 1EY7A 3FPUB 3SEBA 5M5YB 1WCMB 2SNSA 3R2TA 4IUVA 1IKMA 3CKIB 3NUCA 4QUFA 4HCSA 4MN3A 2SOBA 3J81E 3Q22A 2A5HA 2WIIB 2B2TC 4TSSA 1K8OA 3UI2A 5CMDA 3PMFA 1JWUD 1GUWA 3IAYA 1TKWB 3U9SA 2R7ZB 3ND8A 3OIPA 3SK8A 3TN2A 2O2LD 5F2DA 1PFNA 1RF2D 2F0FA 2AWNA 4XTCS 2D62A 1A6XA 2F0EA 1IW7D 5EPJA 1CK1A 1LTSD 1SYEA 3P20A 3Q0AA 4G7ZC 2R93B 5C4XB 2A74C 2NZ1D 2OF1A 2EOTA 3D4WA 4B9WA 1GXDC 1I4PA 1GHJA 1CI3M 4J6HA 2NVQB 3VR5A 4JBWA 5LL6X 3T56B 1U4LA 1Q8IA 3EROA 4WFN3 1U4PA 1BBXC 3U9OA 3OOCA 1BO0A 2FINB 3I4NB 5JVH3 1PDQA 4MHEA 2BCOA 4A93B 2PYKA 2A73B 2VNUD 1SE3A 1ZKOA 3ONAB 5JEAH 1WVLA 2NWGA 2O5JC 1HUMA 1A3UA 4GZYC 2VXWA 5I6YA 3D8GA 4RAUC 4M1UB 5IT9L 3ZYYX 3IFTA 1PZJD 5C4ZA 1H9SA 2NUCA 3PUXA 1U9RA 4DK0A 2K1BA 3SXHA 4UDUC 4JK1C 4NP5A 1SJHD 4QF4A 4OGQC 4KHVA 3D6CA 1LABA 2NTSA 3RMHA 4HMJA 4FXDA 2E2DC 3I73A 2R92B 2IX0A 3X3NA 3L3OC 2XWBB 2AUKA 4DA2A 2X69A 3S15B 4EGVA 4B9XA 3NQTA 3D4RA 4KY6A 2E2JB 2LFNA 4KK7A 3E6ZX 3TP5A 1FNUA 4DAPA 4PQXA 2JA8B 3I90A 1EY4A 2L4NA 3IKJA 3D4DA 3GTQB 2A69D 3C46A 1EWHA 3N6RA 3NBHA 1CHPD 2B2WA 1CQFA 1TY0A 2E2IB 4OO1I 1VMPA 4LK1C 1Z47A 2QCPX 4A3BB 2F0HA 4DAVA 1HQRD 4X3UA 2KQ3A 2LKVA 1TIID 2TSSA 2F0DA 3H3VC 5DAUA 1QNKA 1GUNA 3D6WA 3RLFA 2J0TD 1CA6A 2Z4HA 4UAIA 1UUPA 3PUZA 4R9WA 1H9KA 2RDFA 1ILPA 1HA6A 3HEJA 4TRDA 5FO9B 3QOJA 4NKLA 3I4MB 2NYZD 1EZ6A 4S3SA 1KDCA 2B39A 1DONA 2A69C 4ZUIA 1STGA 3MTSA 2RBMA 5K5PA 5KNDA 5C0XI 1JOOA 4C3JB 2HQEA 1VDZA 4V0BA 4DNTB 3FDTA 4I65A 5K36G 3GTPB 1JWMD 1G6ZA 3KK7A 2EYMA 4H44C 1ENFA 3HZXA 1D5MC 2IX3A 3BDOA 4RGOS 2PCFB 1HFNA 1CM9A 2K33A 3M4OB 2EYLA 2D5DA 5J39A 3QO2A 4KN4C 5CGKA 4IALA 5EKLA 4O1NA 5I9OA 4BY1B 3A56A 2L12A 1JC7A 3IL8A 3I4LA 5IIFA 4C1NK 4OL7A 1FYCA 2R61A 2F0LA 1ZXTA 1OO9B 1EWCA 1A3TA 2JE6I 1HHVA 3SDZA 2EYJA 2IL8A 1BOSA 4ZKCB 2ZXRA 2RQXA 4IUNA 1SBBB 5EBCA 1WD1A 2WB1B 1TS2A 1PTOH 2F0SA 5T1IA 5IODA 5C5MA 4OO1G 1GOZA 4E6IA 3A8KE 2ICIA 3DWQA 3A7LA 3QB3A 4F8MA 1NAPA 3O13A 4RKBA 5KGUA 2X6GA 4Z9CB 1LTBD 2WKDA 2JA7B 4X3SA 1Y1VB 5FO7B 4A3DB 1Q1BA 4BBRB 2HCCA 5IGBA 1PYWD 1RHPA 3BYYB 5E4XA 2EXZA 2N88A 3H94A 3P1HA 3T51B 4L6TB 4QMGA 1SNPA 2RKSA 4R8IA 4DK1A 3BDCA 3VR2A 4C3HB 1O7LA 2B2VC 2JP1A 5M5XB 1NR4A 2HUGA 1TVXA 1EYDA 1DOMA 3SK6A 5C0XG 3K59A 1B1ZA 4IZ8A 3GTMB 2OXPA 3RUZA 5LHY1 5D3DA 4V190 5ELDA 3R2IA 1F77A 1V1OA 1Y8PB 4N9TA 3HGBA 1CFMA 1STHA 1RD9D 2PNRC 1BCPF 1WTOA 5CORA 2DY7A 1E0BA 4FF2A 4IURA 3WDNA 3BDLA 2OT2A 1VCIA 2BOSA 3GV3A 1F9PA 4KN7C 4NMZA 4ABNA 2DNEA 1IYUA 2CHBD 2HCIA 4CKBA 3MEHA 1SE4A 3CRKC 5EPLA 1HXYD 3NBIA 1EEFD 1E2WA 3BVGA 1QB5D 3KBXA 5C6AA 1QCBD 1D5ZC 4K5XA 2IT1A 3I72A 3NTKA 3OMGA 5CR3A 1WTXA 1KDBA 4FF4A 2MUYA 3MZ5A 3VYTA 2NBFA 2K04A 4ILWA 3S14B 3NSWA 1HUNA 1HTLD 1PZID 1ENAA 5ELEA 1H9SB 3ITPA 2RSOA 4U673 1JQYD 3QIAA 1SE2A 1I4XA 1LLRD 3W2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K32 A;  2KCC A;  3ND9 A;  1O7L A;  3QJY A;  2BE5 C;  2PCF B;  4TQU S;  1DD2 A;  3VA7 A;  2DN8 A;  2AWO A;  3MXU A;  3BG3 A;  4G7O C;  1HPC A;  1OXV A;  4LK1 C;  4DNR B;  4L8J A;  1Y8O B;  4KHZ A;  3M7N A;  5C0X G;  2EDG A;  2K33 A;  4TKO B;  2D5D A;  1FR3 A;  1ZKO A;  2B8G A;  2A6E C;  2DNC A;  2NN6 G;  1GJX A;  3GQB A;  2V4D A;  1Z6H A;  1CTM A;  3TZU A;  1HTP A;  5JEA H;  5KNB A;  4KN4 C;  1Q90 A;  5A35 A;  1H9M A;  4LJZ C;  2EJF C;  3FMC A;  3FPP A;  5BN4 A;  1HCZ A;  2O5J C;  3EQL C;  4H0L C;  1GUN A;  4KKS A;  1HQM C;  2KA7 A;  1H9R A;  1Y8P B;  2O5I C;  3I4L A;  3RLF A;  3HGB A;  4GZY C;  3M4Y A;  3PUV A;  2Q8I B;  2AUJ D;  1YNJ C;  1CFM A;  1Q12 A;  3MFY A;  2PNR C;  4G7H C;  1FYC A;  4IFD G;  2LMC B;  5K36 H;  3IFT A;  1E2V A;  1QJO A;  2D2C C;  1K8O A;  3PUZ A;  5KNC A;  1OXS C;  2JE6 I;  3CRL C;  3SDZ A;  1H9K A;  4KMU C;  3WDN A;  1H9S A;  2EVB A;  3GD7 A;  3PUX A;  3DXJ C;  4BA2 I;  1BDO A;  1VCI A;  2BE5 D;  3OOC A;  4DK0 A;  1TKW B;  4IQZ A;  3U9S A;  3ND8 A;  3VR3 A;  4KN7 C;  3A8J E;  2DNE A;  2F1M A;  1IYU A;  4JK1 C;  1IW7 C;  1ONL A;  3A8I E;  2ZT9 C;  4KI0 A;  4PV1 C;  4XTC S;  1A6X A;  2A6E D;  2D62 A;  4OGQ C;  4OO1 G;  1LAB A;  2BA0 A;  3CRK C;  5BN3 A;  3A7A B;  1GHK A;  1TU2 B;  1IW7 D;  4RCN A;  3L7Z C;  1Y8N B;  1YNN C;  1E2Z A;  3A8K E;  1Y69 U;  2PPB C;  3P20 A;  3OPO A;  5C0X H;  2EJM A;  2L5T A;  4G7Z C;  1LAC A;  2K7V A;  2NN6 H;  3PUW A;  1ZYR C;  3I73 A;  5BN5 A;  1E2W A;  1B9N A;  2JEB I;  3SE0 A;  1GUS A;  2A69 C;  3LNN A;  1O78 A;  2JXM B;  1VF7 A;  3NE5 B;  3A7L A;  3D31 A;  2E74 C;  3VR6 A;  2BA1 A;  1H9J A;  4XIG S;  1DCZ A;  5KND A;  1GUG A;  5JEA G;  2A6H C;  4KKU A;  3VR4 A;  1GHJ A;  2YYZ A;  3LWU A;  1VDZ A;  2NN6 I;  2AUK A;  2R6G A;  2QF7 A;  3KLR A;  2IT1 A;  2B8F A;  3I72 A;  1CI3 M;  2BDO A;  4DNT B;  3PUY A;  3OW7 A;  2A6H D;  1Q1E A;  4JBW A;  3VR5 A;  1VF5 C;  1V8Q A;  5K36 G;  1Q1B A;  1SMY C;  1OXU A;  3T56 B;  1GUO A;  3D4R A;  1GUT A;  2E76 C;  1B9M A;  1IYV A;  2JEA I;  2EJG C;  3QG1 A;  4H13 C;  3T53 B;  2CW0 C;  1PMR A;  2A68 C;  1OXX K;  3W3A A;  1Z7T A;  4H44 C;  3H94 A;  3T51 B;  1H9S B;  1DXM A;  4I7Z C;  2E75 C;  3IKJ A;  3AB9 A;  1T5E A;  4BA1 I;  4OO1 H;  2A68 D;  1G29 1;  1K8M A;  2A69 D;  3BDO A;  1EWH A;  4DK1 A;  3PV0 A;  3VR2 A;  1V43 A;  3QIA A;  4KKT A;  1I6V C;  3N6R A;  4IFD H;  4HR7 B;  3M85 A;  1OXT A; 
#chains in the Genus database with same CATH topology
 1I5F A;  2K32 A;  4O42 A;  1SYC A;  5C3E B;  4C2M B;  2PZW A;  5COY A;  1I3Q B;  3PIO A;  4IUQ A;  1H95 A;  4A3I H;  1FR3 A;  1XMO L;  4ALP A;  4EVO A;  2ID0 A;  4LF7 L;  1HTP A;  2VB3 X;  4P2C B;  1Q90 A;  4DPG A;  4RHS A;  1YJW A;  4LJZ C;  2CW0 D;  2IHF A;  1QIL A;  3FKI B;  1VQO A;  3CCV A;  2EYP A;  3K7A H;  3KJO A;  2CCZ A;  1IBM L;  5CV8 A;  4NDX A;  2KOL A;  5EGT A;  3JAM i;  2UXC L;  4JV5 Q;  4C56 C;  3D0F A;  2D2C C;  2EE1 A;  1S5B D;  1X3F A;  1PYS B;  2KHI A;  4A76 A;  3S2H H;  1YNJ D;  4DFA A;  4IPG A;  2MNA A;  3I8Z A;  1K73 C;  2Z8L A;  3H91 A;  3KDF B;  5FK9 C;  1I6H B;  3VR3 A;  2PW5 A;  1W2B A;  2K01 A;  3S2D H;  4NXN Q;  1MSH A;  3OHX C;  4B3T L;  2UXD Q;  3GTL B;  2ZT9 C;  4PV1 C;  2KCN A;  4RKL A;  1KD1 C;  1KIX A;  1S3O A;  1E2Z A;  4AQY L;  1IL2 A;  2B2U A;  1EIH A;  2IJ0 A;  4O0A A;  3BZC A;  2EJM A;  2L5T A;  2NVX H;  3NBH B;  3K8A A;  1T9H A;  1TWG H;  2KBN A;  1XMO Q;  2ICE C;  2OTJ A;  1CZW A;  3HKS A;  4LF7 Q;  1U4M A;  3VR6 A;  4XIG S;  2X6L A;  3EJI A;  4K8J A;  3J81 j;  3LWU A;  1KQS A;  2JA5 G;  3KLR A;  5I6W A;  3CXC A;  2K52 A;  4KHP L;  1IBM Q;  2Y0S E;  1M1K C;  2UXC Q;  4FO2 A;  1EYA A;  3RZD H;  4OIJ A;  4L5Q A;  3S1N B;  5LMU L;  3EA6 A;  3F1Z A;  3J81 c;  1NNX A;  4J8Q A;  4IO9 A;  2AKW B;  4CHT B;  2CW0 C;  5ELN A;  1PMR A;  3K81 C;  1F9Q A;  5JJI A;  1QWY A;  1IXR A;  3A55 A;  3PGZ A;  3GV6 A;  4R4C A;  4B3T Q;  1R4Q B;  3GO5 A;  3VA5 A;  4A3J G;  4DV1 L;  4DR2 L;  1B7Y B;  1PRT B;  3HOY G;  2XIW A;  1XXG A;  2XN9 C;  4AQY Q;  4QCL A;  5JPN C;  3MXU A;  4R8N A;  3I91 A;  3M7G A;  2IWH A;  1SYB A;  1VQ5 A;  1TWF H;  1IHZ A;  4CGY B;  4DR5 L;  1AE3 A;  3GQB A;  2F3V A;  1CTM A;  1Q7Y C;  1B44 D;  2B63 H;  2Q2T A;  1J5E L;  5BN4 A;  4OWX B;  1Y1W H;  4LFB L;  2F0G A;  4GNX A;  3VYS A;  4KHP Q;  1WCM G;  2IPK D;  5CC4 A;  3ULJ A;  2XSC A;  4XT1 B;  5HUR A;  1E1O A;  5LMU Q;  3NTI A;  3HOV B;  1NSN S;  1IBK L;  5BR8 L;  1TT2 A;  2Y0S B;  1KL9 A;  4A3E B;  1JJ2 A;  2F1M A;  2XWJ B;  4RFB A;  1IW7 C;  3HOU H;  1SSO A;  2R7Z G;  4DV1 Q;  1PH6 A;  4DR2 Q;  4A3F H;  1K83 B;  3ERQ A;  2F03 A;  5ELF A;  2PQA A;  5CYU A;  1STN A;  3GTG H;  3S1Q H;  1TWC H;  1PXU A;  3S9W A;  1KRS A;  1O80 A;  3UE0 A;  5IP7 G;  4DR5 Q;  3NE5 B;  4C3I B;  2R93 G;  5C4X G;  3H0G B;  2I07 B;  4FXK C;  1GUG A;  1J5E Q;  3BJU A;  4KKU A;  4WRD A;  4LFB Q;  4EQN A;  2K5V A;  3DEO A;  3CD6 A;  1CHQ D;  2EY1 A;  4H02 A;  1JT8 A;  3JC6 6;  4ZQ3 A;  1LYL A;  1F2L A;  4XT3 B;  1IBK Q;  5BR8 Q;  1J9O A;  1PTO B;  4XXE A;  1NTG A;  2NVT B;  1IL8 A;  3TP7 A;  3DM1 A;  4DN4 M;  1E7Z A;  5G3L D;  5M3M H;  3PO3 B;  5IGC A;  3MAQ A;  4DGZ A;  1S4Z A;  2XTI A;  3PV0 A;  4Y7N B;  5J22 A;  1B4O A;  4QUC A;  3S17 H;  2FHT A;  2OCE A;  2KCC A;  3E0J A;  5CBA E;  5EKK A;  2DN8 A;  4HID A;  1DJR D;  3JAM L;  1EFI D;  3BZK A;  3I4N G;  1K8A C;  4KHZ A;  1QUQ B;  3KFU A;  3GP7 A;  1C4Q A;  4J1M A;  1GJX A;  2DNC A;  4A93 G;  2EY6 A;  2YTY A;  4A3K B;  1CZG A;  1TWH B;  4PMC A;  5A35 A;  5M3F B;  2ZTD A;  1LT5 D;  3EQL C;  4H0L C;  5D65 A;  1EUJ A;  2KA7 A;  1WTW A;  2O5I C;  2JA6 B;  3CU7 A;  3OMC A;  2CQA A;  1D7Q A;  1PV4 A;  4JOI C;  3J80 i;  4DV0 L;  5KNC A;  3CRL C;  2EY5 A;  4KMU C;  1LTR D;  2NTT A;  4N9P A;  2K5Q A;  3CF5 A;  5TSS A;  3UDF A;  3KUP A;  4RHR A;  1ROD A;  3F2B A;  3TP8 A;  1VQL A;  1NE3 A;  4KI0 A;  5FKA C;  1Q8K A;  3AU7 A;  4ZUJ A;  2EYO A;  1LT4 D;  3S1R H;  4B3R L;  4KJN A;  3E3X A;  4B3M L;  2VB2 X;  1W6J A;  2HQL A;  3KLW A;  1E3P A;  4DV6 L;  1KDA A;  1QNU A;  4DU9 A;  1R4P B;  2UUA L;  5IP9 G;  4K6L A;  2ZTE A;  3STB C;  2KHJ A;  3C1F A;  1C9O A;  2E74 C;  5C3W A;  2R92 G;  2B2Y A;  1DCZ A;  3OWE B;  1S5F D;  4X64 L;  1VQH A;  2JQO A;  2H1E A;  2KJX A;  2NN6 I;  1RIP A;  3F2D A;  3FVQ A;  4F7X A;  4A3C H;  3BZD B;  4UPA A;  3OW7 A;  5M5W B;  1SAP A;  3V2T A;  3BVZ A;  1A62 A;  4DV0 Q;  1SND A;  4YCW A;  2FXQ A;  2MP1 A;  3NTH A;  3KF8 A;  3PO2 B;  2JEA I;  3L0O A;  1KAW A;  4HN7 A;  1BKB A;  1C7Y A;  2AQ2 B;  1S40 A;  1OXX K;  4JI3 L;  3M9B A;  1IBL L;  1EU4 A;  2XNA C;  3AB9 A;  3GDE A;  2NVY B;  3BYT B;  1G29 1;  2J7Z A;  1GM5 A;  3C3L A;  1SXT A;  2XGT A;  3UE1 A;  2JA8 G;  1S5D D;  2NZO A;  5FOB B;  5J3B A;  3J7Y W;  4B3R Q;  1PZK D;  4B3M Q;  1L1O C;  3S16 B;  4DV6 Q;  1G8Z D;  1RL2 A;  1XPO A;  2R7D A;  1OXV A;  2O4X A;  4XDX A;  5CV4 A;  2EY2 A;  3DWP A;  2UUA Q;  2DY8 A;  1P8L A;  4A3B G;  4K2K A;  1I50 H;  1X9N A;  5E1F A;  5ELO A;  2J4X A;  3DUZ A;  5KNB A;  5FLM G;  5JJK A;  4X64 Q;  1HCZ A;  2VUM B;  1XX8 A;  1G2S A;  4FNF A;  2RF4 A;  1PH2 A;  2Q8I B;  1KNA A;  2QEJ C;  3HFZ B;  3R3O A;  2PMZ E;  2RHQ B;  3GD7 A;  1AZQ A;  2L11 A;  3K7U C;  4IFD J;  1N34 Q;  1VQI A;  2GVA A;  1SRO A;  2XRQ D;  4JI3 Q;  1IBL Q;  3ULP A;  2RDG A;  3NWT A;  5C44 H;  2QDB A;  4X3T A;  4DR3 L;  3HOW B;  2K5N A;  4DK6 C;  3OIQ A;  2AQ1 B;  3PSI A;  1K9M C;  3FHW A;  4A3L G;  5JOB A;  3KLS A;  3DWA A;  3I4M G;  1FNV A;  4I7A A;  4LUO A;  3Q23 A;  4BBS H;  4R4Q A;  3E5S A;  4A4I A;  4BY7 H;  4A3I B;  4K8I A;  3SE0 A;  1CA5 A;  1UWV A;  3SVM A;  1O78 A;  3EFX D;  1STY A;  5ISR A;  1PH1 A;  4LF5 L;  3FRP B;  2CWP A;  3MC0 B;  3C2P A;  3K7A B;  1PRT D;  5JAV A;  3I4O A;  1ML0 D;  3K6O A;  1JIC A;  4C3J G;  1A15 A;  3I3C A;  2ATW A;  2QA4 A;  2LS0 1;  3S2H B;  3J7A V;  2KCM A;  1QE6 A;  1JOR A;  3NEN A;  2OQK A;  1IYV A;  2EJG C;  1LTG D;  1PH7 A;  3GTO H;  3MHB A;  3S2D B;  3UDG A;  2F0M A;  1PA6 A;  4YHH Q;  1DXM A;  4K6D A;  1SNO A;  1ZYR D;  3E9I A;  2A68 D;  1HFG A;  2PMZ B;  4DR3 Q;  1NMF A;  2B2W C;  4ME5 A;  2QW7 A;  2K5D A;  4KD4 A;  3DM3 A;  1X65 A;  1X3P A;  4KY7 A;  2AWO A;  2NVX B;  4WOR A;  5E4W C;  2F4I A;  1E1T A;  4G7O C;  1TWG B;  3CC2 A;  1AZP A;  5J1Z A;  4OIK A;  2NN6 G;  1I4G A;  4LF5 Q;  1MJE A;  3T13 A;  2VS1 A;  1N8R C;  1DYQ A;  2ENB A;  3BVM A;  1CKO A;  3HG9 A;  2XVS A;  1SNQ A;  3S1M H;  4PG3 A;  5T1G A;  1RTO A;  3RZD B;  2RDH A;  3MFY A;  2YU9 H;  1SYF A;  1EZ8 A;  4BY1 G;  2ZJQ A;  5K36 H;  5IYC H;  1QJO A;  5KRU A;  5IGG A;  3CC4 A;  1EIF A;  1I4Q A;  3BU2 A;  4HJ5 A;  3N52 A;  5GRO A;  3OSO A;  1LV9 A;  2B2T A;  3VYU A;  3Q24 A;  4JI8 L;  3CQZ H;  2CWA A;  1PRT C;  4IQZ A;  5JPM C;  1PFM A;  3QOL A;  5EQ0 A;  2LSS A;  3H6M A;  1UNS A;  2DGY A;  1MBY A;  3A8I E;  3K5N A;  4IJL A;  2WB1 G;  2A6E D;  5I9P A;  4DUZ L;  4LW1 A;  3NEM A;  4A3M H;  1X6O A;  3HOX H;  2WP8 J;  1QVF A;  2F3I A;  1SR3 A;  4JVZ A;  4HAE A;  4K2L A;  1WD0 A;  5C5L A;  1DGS A;  1PTO D;  1TWF B;  1ZYR C;  2LXJ A;  5FJ8 G;  1B3A A;  1D8L A;  1VF7 A;  4LF8 L;  3MXG A;  2Z1C A;  4IUT A;  4RCO A;  2MQH A;  5AFW A;  1PH8 A;  2B63 B;  2BA1 A;  2Z6K A;  1Y1W B;  1MIU A;  4P71 A;  3CCS A;  3HOZ H;  3DEP A;  2D0P A;  1QVC A;  3PUY A;  4JI2 L;  2A6H D;  1LT3 D;  2ASB A;  4GNX B;  1V1P A;  4K5V A;  1OXU A;  5LL6 S;  4L63 B;  2JA7 G;  1AE2 A;  4JI8 Q;  1Y1V G;  4A3D G;  2M00 A;  4BBR G;  1HNW L;  1FL0 A;  4CJ2 C;  3HOU B;  1AW7 A;  4BXX H;  4BA1 I;  4OO1 H;  4A3F B;  3M4P A;  1K8M A;  1U4R A;  4K5W A;  4DUZ Q;  1TS3 A;  1PFB A;  1I6V C;  2L0C A;  4IFD H;  2E2H H;  3GTG B;  3S1Q B;  3V05 A;  2F0W A;  1TWC B;  1DD2 A;  2K5H A;  3VA7 A;  1AN8 A;  3NP8 A;  1EQT A;  4KD3 A;  1STE A;  3MXN A;  4C3H G;  4DNR B;  5IGF A;  1TS5 A;  2SDF A;  2EDG A;  1M8A A;  2A6E C;  1YJ9 A;  1TS4 A;  4LF8 Q;  1N36 L;  2ZXO A;  3TRZ A;  1A8V A;  4OEL B;  3R93 A;  5FLX L;  3MWY W;  4ODG A;  1PTO C;  1ZEQ X;  3FP9 A;  1EOT A;  4F88 A;  2YTX A;  3PIP 3;  4JI2 Q;  4CDD C;  1KXL A;  1WI5 A;  3FEW X;  3SR1 A;  2C35 B;  3W1B A;  2YV5 A;  3KBG A;  5IT9 c;  3GTK H;  1D2B A;  1MKH A;  3SHL A;  2N49 A;  2AQ3 B;  3H09 A;  3UDI A;  5D14 A;  5M3M B;  1HNW Q;  5L37 A;  2WIN B;  3Q6S A;  4FP5 D;  1S5E D;  3CC7 A;  2CQO A;  2ZM6 L;  2EPB A;  1DOL A;  2JA9 A;  2K05 A;  5IYB G;  2ES2 A;  1KAA A;  2BA0 A;  5KYL A;  3S17 B;  3A7A B;  5KIX A;  5IYD G;  5GAH C;  1JJG A;  4AH6 A;  1Q81 C;  1HA5 A;  4NB3 A;  1TR5 A;  3JAM E;  4CKC A;  1T5X D;  2VY3 A;  5C0X H;  4P75 A;  3PUW A;  3V96 A;  1EYG A;  2SNM A;  2Q2I A;  3I7F A;  2ZTC A;  4Q0F A;  2QEX A;  3NHH A;  2ZXP A;  3NPP A;  1N36 Q;  4POG A;  2Q8T A;  3D31 A;  5C4J H;  2WKC A;  1VQA A;  1PH4 A;  5JEA G;  2CKZ B;  4ME3 A;  3K58 A;  1II3 A;  1B53 A;  4FYD A;  1SE8 A;  2VW9 A;  2OQ0 A;  4FXG C;  4EQP A;  4CJ1 B;  1TQO A;  1JOQ A;  1Q1E A;  4KTA A;  5ELC A;  1V8Q A;  4RGN A;  1R9T H;  1IYJ B;  2MJ8 A;  3K0Y A;  1VQP A;  1UE1 A;  1ET9 A;  3W3A A;  4PMB A;  1NUC A;  2ZM6 Q;  1EFW A;  1MJC A;  1EQQ A;  4X3K A;  3S1R B;  3J81 i;  1D6E C;  3M85 A;  1EIG A;  1KRT A;  2EYF A;  2AMC B;  2FFK B;  3QJY A;  1YJN A;  3K57 A;  2L9H A;  4FF1 A;  1G91 A;  3BG3 A;  4RWS C;  4X62 L;  1ENC A;  5C3E G;  3SGI A;  1KNE A;  3QR8 A;  1RKN A;  1FGB D;  2RVL A;  3RR5 A;  5IGE A;  4NPS A;  2NZH A;  2B8G A;  5A2Q L;  2V4D A;  2IY5 B;  1YZ6 A;  1Z6H A;  4HED A;  3RLN A;  4ID6 A;  1YHB A;  1VMC A;  1FD7 D;  4LUV A;  5DEH A;  3K5L A;  2FJ2 A;  1D1K A;  1HZ9 A;  1YNJ C;  5KYI A;  4G7H C;  4X6A H;  1VQB A;  3FKI G;  3IFD A;  2UUB L;  3TS2 A;  1B2T A;  1EL0 A;  1TWA H;  4DXF A;  2EQS A;  3G6J B;  1OXS C;  5DNF A;  4NW2 A;  3RN2 A;  3TP6 A;  5JVG 3;  1EYC A;  4XQJ A;  3H3V H;  1VQF A;  1SFO H;  5HY6 A;  5EJW A;  2F0O A;  1CKM A;  1NR2 A;  3TBI B;  3WOF A;  1BVS A;  1QG7 A;  3KF8 B;  1F2Z A;  3S24 A;  1AFP A;  2R3Z A;  2G5D A;  4BWG B;  3OYY A;  3LGJ A;  3HRZ C;  3WWV A;  1TU2 B;  1O7I A;  1EWI A;  1MSG A;  4LF9 L;  3CCM A;  4LNQ A;  1KAB A;  4X62 Q;  4RH6 A;  2SEB D;  4JI1 L;  5C3X A;  4MIU A;  1GUS A;  1I50 B;  1S5C D;  2F0V A;  3PF5 A;  2QKI C;  1PH5 A;  3AMU A;  3RZO H;  2F0I A;  2M9V A;  3LX0 A;  1M4V A;  1Z9F A;  3CCQ A;  1F2Y A;  4GLX A;  3TEH B;  4WJ3 M;  2UUB Q;  3X3M A;  1YNX A;  3D3R A;  3ER0 A;  4IOA A;  4YIJ A;  1WTV A;  4HTH A;  4UP9 A;  1GUO A;  3T4A C;  4OWT B;  3QG1 A;  3ICE A;  1YI2 A;  2PQE A;  1YNN D;  3SK4 A;  4X65 L;  1EY0 A;  4EQO A;  1BF4 A;  2QIL A;  5C44 B;  4CDF C;  5D3I B;  1STB A;  5G3L F;  1PLF A;  3G4S A;  5ELB A;  1JE4 A;  2HDM A;  3M3Y H;  3CPF A;  4PZ8 A;  3AEV A;  5IE8 A;  4ZK9 B;  4CJ0 B;  5JJZ A;  4BBS B;  4LF9 Q;  1W6K A;  1EY8 A;  4BY7 B;  4U68 A;  1QOH A;  4UY8 C;  4JI1 Q;  1AP0 A;  3DMU A;  4OEM B;  1HJP A;  1CKN A;  1ILQ A;  1LM0 A;  5CV7 A;  1D1I A;  1JOK A;  1LTA D;  3G71 A;  1D5X C;  1U0L A;  4NXM L;  4XQQ A;  2JA5 H;  2EJF C;  3FMC A;  1WOC A;  1A3V A;  3HKZ E;  2H5X A;  2MO0 A;  3GTJ H;  1EQR A;  3EVQ A;  1JB3 A;  2K6A A;  2LMC B;  1V1Q A;  1V9P A;  2UU9 L;  2Q8R E;  2KHS A;  2CH4 A;  2A19 A;  4F87 A;  4KJO A;  1Q3L A;  1BR9 A;  1RJT A;  3GTO B;  4DV3 L;  4BA2 I;  2BE5 D;  4X65 Q;  1VQN A;  3HOV G;  4GOP A;  2KEN A;  5EPK A;  4A3J H;  1K8G A;  2Y0S G;  4RMF A;  2F3W A;  2K75 A;  3KJP A;  4A3E G;  2K28 A;  2MPM A;  4KV6 A;  3HOY H;  2B2U C;  1TY2 A;  4FF3 A;  1YNN C;  4KY5 A;  3NQI A;  1Y69 U;  4XQN A;  2PPB C;  1NJI C;  3OPO A;  2F0N A;  3J80 E;  1BCP B;  4HJ7 A;  1L0W A;  2NB0 A;  5CV5 A;  1BUV T;  3LNN A;  4LWC A;  3CMA A;  3CCU A;  1KLG D;  2QDL A;  4NXM Q;  4GLV B;  4PMW A;  3S1M B;  4C3I G;  3CHB D;  5M5Y H;  1WCM H;  1C8C A;  2R6G A;  1YHQ A;  3T1Y L;  1CQV A;  3H0G G;  2YU9 B;  2F0Q A;  4LMQ D;  1TXY A;  3J81 L;  2UU9 Q;  1M90 C;  2L1B A;  3C1E A;  3HKZ B;  2E76 C;  3CQZ B;  4CDE C;  4Q5V A;  4DV3 Q;  3T53 B;  4LAA A;  4IFD I;  1X54 A;  4A3G B;  4MTN A;  5DM6 3;  1EEI D;  4ZKB B;  2R7Z H;  2E75 C;  4JI7 L;  4R1J A;  3F2C A;  2WAC A;  3NWS A;  4A3M B;  3HOX B;  2I46 A;  1ASY A;  3EIV A;  3PO3 G;  3A74 A;  4HR7 B;  1EU3 A;  2OTL A;  2PW7 A;  4QJF A;  2BE5 C;  1ASZ A;  4QGU A;  2LY7 A;  3NXW A;  1X32 A;  1VQD A;  3G48 A;  3A5Z B;  4L8J A;  4DR6 L;  2B2V A;  5IP7 H;  2IW3 A;  4IPH A;  1ESF A;  2R93 H;  5C4X H;  1N34 L;  3E0E A;  1DZ1 A;  1LO5 D;  4GNX C;  5GAE C;  2IX1 A;  4P72 A;  5I4D A;  3HOZ B;  4A3K G;  1X56 A;  3T1Y Q;  5IY0 A;  4JBM A;  1FJG L;  3PUV A;  5M3F G;  1KC8 C;  5CV9 A;  2F0U A;  2OEO A;  2C9O A;  1A63 A;  3TQY A;  1DOK A;  4HSP A;  2NVQ H;  3MA2 B;  2JA6 G;  4RA8 A;  2EVB A;  2Z0S A;  5EKI A;  3K5O A;  3VDY A;  4IN3 A;  4ULL A;  2HT1 A;  1V1P B;  3WOE A;  1VQ6 A;  2BH2 A;  2RA4 A;  4XYQ A;  1KLU D;  1FNW A;  4RGM A;  4JI7 Q;  4B08 A;  4P73 A;  4LFA L;  2G9D A;  2Z9H A;  4HIK A;  5BN3 A;  2E2H B;  1JCK B;  3KYH C;  3MXP A;  1Y8N B;  3I4N H;  1UAP A;  1MGS A;  2FMM A;  4CBV A;  1XTC D;  1L0Y B;  1LAC A;  4DR6 Q;  3L9A X;  4A93 H;  2JEB I;  5NUC A;  2JXM B;  3URY A;  3MXN B;  4Y52 H;  1A2U A;  4YHH L;  2VZA A;  4FVM A;  5FLX E;  1C48 A;  1PRT F;  3VR4 A;  1BQQ T;  2QF7 A;  1FJG Q;  2CVR A;  4A3M G;  1JMC A;  5JJL A;  2BDO A;  1XPU A;  3LWE A;  4HJA A;  1JR0 D;  3GTK B;  3I55 A;  4ZLT F;  1B9M A;  1BBW A;  3U4V A;  4H13 C;  2F0J A;  1IKL A;  3CAM A;  4BS9 A;  3PO2 G;  3RD4 A;  3A0J A;  4ZAI A;  2UUC L;  2LXK A;  4LFA Q;  4G57 A;  3J7A F;  4UP8 A;  1V43 A;  1VQK A;  2MGS A;  3PF4 A;  2EYH A;  3ULL A;  1DM0 B;  4TQU S;  1A2T A;  3AQQ A;  2L55 A;  3F2U A;  4WJW A;  3OWF A;  2GA4 B;  5IP9 H;  2CFM A;  4DAY A;  3AYH B;  2EZV A;  2PZU A;  4TKO B;  2JSO A;  3U58 A;  3EN2 A;  5C4J B;  2R92 H;  1SMY D;  2D9U A;  4K14 A;  3TZU A;  4YCV A;  1SYD A;  1X3Q A;  5CV6 A;  2F4V L;  1H9M A;  2Z4I A;  3FPP A;  3TSS A;  5C0X J;  1HNZ L;  4OWW B;  1VQ7 A;  4KKS A;  1HQM C;  4YCU A;  4DAM A;  2I0Q A;  2F0T A;  2K50 A;  3M4Y A;  2AUJ D;  1K3R A;  4IFD G;  2VUM G;  1JJC B;  4AYB E;  2EIF A;  2WAQ E;  5EAY A;  1NCV A;  1SLJ A;  1EY5 A;  1A0I A;  5I2X A;  1R9T B;  3U4Z A;  3S15 H;  3DXJ C;  2K03 A;  2E2J H;  2BDN A;  2KED A;  3J80 L;  5DM7 3;  3KLS X;  3BS1 A;  2PZT A;  3A8J E;  5DLQ E;  2UUC Q;  2JA8 H;  4X66 L;  1ONL A;  1CT1 D;  4LF6 L;  1EY6 A;  2JN4 A;  1P16 A;  3MVV A;  4UHV A;  1F9S A;  2OWO A;  1ICW A;  3GTQ H;  1GHK A;  4IUU A;  2KVM A;  3L7Z C;  3HOW G;  4GN4 B;  3PIO 3;  2L15 A;  4YWM A;  1PTO F;  4DF7 A;  2K7V A;  1MD2 D;  2E2I H;  4OX9 Q;  2QGQ A;  5BN5 A;  5A2Q E;  4A3B H;  5EBD A;  2B2Y C;  2F0K A;  4A3I G;  1CSQ A;  5FLM H;  1PH9 A;  4A3G H;  1H9J A;  2F4V Q;  1HNZ Q;  3VYR A;  4ZCK A;  1KTK A;  1QVG A;  1O7Y A;  1GVP A;  2B8F A;  3W1G A;  1ESR A;  1L0X B;  1ET6 A;  2PO4 A;  4QIW E;  4JBK A;  1TWA B;  3NK9 A;  2HDL A;  2GVB A;  2A1A A;  1SMY C;  1SFO B;  1GUT A;  1JWS D;  2P5Z X;  2TMP A;  2MO1 A;  5KEE A;  2RSN A;  2UXB L;  2A68 C;  4AYB B;  2WAQ B;  1EY9 A;  3CPW A;  1CUK A;  4X66 Q;  3DHQ A;  2N55 A;  4LF6 Q;  4A3L H;  3HP3 A;  3TME A;  1HR0 W;  5IOC A;  1F2M A;  2RCN A;  4HCE A;  4KKT A;  3I4M H;  5CBE E;  2M2L A;  2F0P A;  2HIX A;  3TZD A;  1HPC A;  1XMQ L;  1Y8O B;  4QB4 A;  3M7N A;  4JPB W;  4DK3 C;  3RZO B;  1HR0 L;  1J8I A;  1EQV A;  4HMI A;  1BNZ A;  1SNM A;  1W3S A;  2Q2H A;  4RGT A;  4DUY L;  2A8V A;  2WV6 D;  4HSV A;  2KEC A;  1HRJ A;  1WTP A;  1H9R A;  4K0K L;  4C3J H;  5IGD A;  1I4H A;  2MFI A;  5HGT A;  4JYA L;  1Q12 A;  3PQI A;  1N33 L;  1G2T A;  1N32 L;  1E2V A;  1BCP D;  1RDP D;  1STA A;  2KCT A;  3P7J A;  2UXB Q;  1BDO A;  3GTP H;  5FO8 B;  4QIW B;  3T1H L;  4QL5 A;  3QWN A;  4QY7 A;  1LUZ A;  3M3Y B;  3RNU A;  5IT9 E;  4DR4 L;  3MEF A;  3CCR A;  1F9R A;  3R8B A;  4RCN A;  1SDF A;  5E3F A;  3CME A;  5JEA J;  4DNI A;  4OHJ A;  3CCE A;  1MI2 A;  4APV A;  2E5L L;  1WTQ A;  3A54 A;  4IUP A;  1XMQ Q;  2NN6 H;  2RCF A;  1AEX A;  1SYG A;  1B9N A;  1HR0 Q;  3CCJ A;  1Q86 C;  3M4O H;  5M9O A;  4HJ8 A;  1SEB D;  2XRS D;  2JA5 B;  3KOJ A;  1CKN B;  4TVA B;  2JYO A;  5C4H A;  4DUY Q;  2C5C A;  4IPC A;  1RCV D;  4H7B A;  2A6H C;  2K4K A;  1VS0 A;  1YIT A;  2YYZ A;  3GTJ B;  4DKA C;  3K5M A;  4R4T A;  2B63 G;  4K0K Q;  1WTR A;  4PNY A;  4BY1 H;  4ZYS A;  1Y1W G;  4JYA Q;  3G7L A;  1N33 Q;  3G6E A;  1N32 Q;  1VF5 C;  3RLO A;  3TDQ A;  4CKE A;  1CSP A;  4ZRZ A;  2K5W A;  2FMC A;  1EIY B;  1XYI A;  1LT6 D;  1RTN A;  4XYO A;  3T1H Q;  4A3J B;  1Z7T A;  3MFG A;  1SJE D;  4I7Z C;  1WYD A;  3P75 A;  1T5E A;  2HIV A;  1O7Z A;  1BCP C;  3I70 A;  5I2Y A;  1BXT A;  4GOP B;  3HOY B;  1LTT D;  4DR4 Q;  2PI2 A;  3HOU G;  2G9H D;  4AIM A;  4DXG A;  2MHV A;  5IWA L;  4A3F G;  1LTI D;  1OXT A;  3ND9 A;  1UEA B;  4M8A A;  3TS0 A;  4OON A;  4GKJ L;  2E5L Q;  2H4O A;  1I4R A;  5FJ8 H;  1SNC A;  4YY3 L;  1XWE A;  2I5H A;  4C1N I;  3T16 A;  3HS0 C;  2DJG C;  3JAM c;  3SK5 A;  2KEE A;  4G4K A;  1B50 A;  2KUM A;  1EY7 A;  1PVO A;  3FPU B;  3SEB A;  2YTV A;  1WCM B;  5M5Y B;  2SNS A;  3R2T A;  4IUV A;  1IKM A;  3CKI B;  3NUC A;  4QUF A;  3K0X A;  1VQ4 A;  4HCS A;  4MN3 A;  2SOB A;  3J81 E;  3Q22 A;  2A5H A;  2WII B;  2B2T C;  2I5M X;  4TSS A;  1K8O A;  3UI2 A;  5CMD A;  2JA7 H;  1FGU A;  3PMF A;  1Y1V H;  4A3D H;  1JWU D;  1GUW A;  3IAY A;  4JOI A;  4L5T A;  4BBR H;  4GLA C;  1TKW B;  3U9S A;  1E22 A;  4HIO A;  2R7F A;  3ND8 A;  3OIP A;  2R7Z B;  3SK8 A;  3TN2 A;  2O2L D;  5F2D A;  1PFN A;  3KF6 A;  1RF2 D;  1YVC A;  5M3M G;  2F0F A;  2AWN A;  4XTC S;  2D62 A;  1A6X A;  2F0E A;  1IW7 D;  5EPJ A;  5IWA Q;  1CK1 A;  4C3H H;  1LTS D;  1SYE A;  4GKJ Q;  3P20 A;  3Q0A A;  4G7Z C;  1JB7 A;  2D0O A;  5M5X H;  4GN3 B;  4YY3 Q;  2R93 B;  5C4X B;  2A74 C;  2Z6K C;  5H1S E;  2NZ1 D;  2OF1 A;  2EOT A;  3D4W A;  4B9W A;  3GTM H;  3DLL A;  1B8A A;  1GXD C;  1I4P A;  1GHJ A;  1J6Q A;  1CI3 M;  4J6H A;  2NVQ B;  3VR5 A;  4JBW A;  1X3G A;  1B70 B;  3PIP A;  5LL6 X;  3T56 B;  1U4L A;  4JI0 L;  1Q8I A;  3I56 A;  3ERO A;  4MTK A;  4IOC A;  2CH4 W;  1QZH A;  4HJ9 A;  5IYB H;  2N78 A;  4WFN 3;  1K3B C;  1HZA A;  1U4P A;  1BBX C;  1SRU A;  3U9O A;  3PCO B;  5IYD H;  3OTO L;  3OOC A;  1BO0 A;  2FIN B;  3I4N B;  5JVH 3;  1PDQ A;  2IHE A;  4MHE A;  2BCO A;  1HNX L;  4A93 B;  2PYK A;  1VQ9 A;  1L1O A;  1VQ8 A;  2A73 B;  2AHO B;  2ZJP A;  2VNU D;  1SE3 A;  1ZKO A;  3ONA B;  3CW2 C;  3Q8D A;  5JEA H;  1WVL A;  2NWG A;  2O5J C;  1HUM A;  4FDB A;  1A3U A;  4YWK A;  2VXW A;  4GZY C;  2WFW A;  5I6Y A;  3D8G A;  4RAU C;  1GO3 E;  4M1U B;  5IT9 L;  3ZYY X;  3IFT A;  4A3C G;  1PZJ D;  5C4Z A;  4DV2 L;  1H9S A;  2NUC A;  3PUX A;  4JI0 Q;  4QQB X;  1U9R A;  2N3S A;  3S14 H;  4DK0 A;  2K1B A;  5GAD C;  1VQE A;  1VQG A;  3SXH A;  4O2D A;  4UDU C;  4JK1 C;  4LF4 L;  4NP5 A;  1SJH D;  4QF4 A;  4CDC C;  3H15 A;  4OGQ C;  4KHV A;  3D6C A;  1LAB A;  3OTO Q;  3ERS X;  1ICF B;  2NTS A;  3RMH A;  1EOV A;  2Q2U A;  4HMJ A;  4FXD A;  1S72 A;  5C3E H;  2E2D C;  1HNX Q;  4WJ4 A;  4C2M H;  2F52 A;  1I3Q H;  3I73 A;  2R92 B;  4DV5 L;  2IX0 A;  3X3N A;  4JBJ A;  4DAY B;  3L3O C;  2VQF L;  2XWB B;  3STB D;  4LFC L;  2B29 A;  2AUK A;  3FKI H;  5LMN W;  2N8N A;  4DA2 A;  2X69 A;  3S15 B;  4EGV A;  3KDF A;  4B9X A;  4DV2 Q;  3NQT A;  3D4R A;  4KY6 A;  2E2J B;  2LFN A;  1L2F A;  4KK7 A;  3E6Z X;  3TP5 A;  1FNU A;  4DAP A;  4PQX A;  1AH9 A;  2JA8 B;  3I90 A;  1EY4 A;  5LMN L;  1I6H H;  2VQE L;  2L4N A;  3IKJ A;  3D4D A;  4LF4 Q;  2JK8 A;  5C44 G;  3GTQ B;  2A69 D;  3C46 A;  1LTL A;  1EWH A;  3GTL H;  3M4Q A;  3N6R A;  3NBH A;  1Q46 A;  5AJ3 L;  1CHP D;  2B2W A;  4GKK L;  1CQF A;  2ALY B;  1TY0 A;  2E2I B;  4OO1 I;  2K14 A;  1VMP A;  4LK1 C;  1Z47 A;  2QCP X;  4BBS G;  4A3B B;  2F0H A;  4BY7 G;  4DAV A;  1HQR D;  4DV5 Q;  4X3U A;  1B3Q A;  2KQ3 A;  3IRB A;  3J80 c;  2LKV A;  1TII D;  2TSS A;  2F0D A;  1XPR A;  3H3V C;  5DAU A;  2VQF Q;  2HHH L;  1QNK A;  1GUN A;  3D6W A;  4LFC Q;  1XTD A;  3RLF A;  2J0T D;  1CA6 A;  2Z4H A;  2E8G A;  4UAI A;  1UUP A;  3PUZ A;  4EQ5 A;  2GN5 A;  4R9W A;  1H9K A;  3S1N H;  2RDF A;  3F8T A;  2RHS B;  1ILP A;  5GAG C;  1HA6 A;  3HEJ A;  4TRD A;  4N8X 1;  5FO9 B;  1XJV A;  5LMN Q;  2VQE Q;  4JI5 L;  4JI4 L;  1XNR L;  2ZJR A;  3QOJ A;  4N8F A;  4NKL A;  3I4M B;  2NYZ D;  1JE5 A;  5AJ3 Q;  4GKK Q;  4MNO A;  1EZ6 A;  4S3S A;  1KDC A;  1Y14 B;  2B39 A;  1DON A;  1FVI A;  2A69 C;  4ZUI A;  3W5O A;  1STG A;  3MTS A;  4UP7 A;  2RBM A;  2HD3 A;  5K5P A;  5KND A;  2HHH Q;  5C0X I;  1JOO A;  1X3E A;  4C3J B;  2HQE A;  4YWL A;  1VDZ A;  4IJH A;  4V0B A;  5E7N A;  1YHA A;  3L2P A;  4DNT B;  2WB1 E;  3FDT A;  4I65 A;  5K36 G;  5IYC G;  2Z6B A;  1K28 A;  3GTP B;  3HOV H;  1JWM D;  1G6Z A;  3KK7 A;  1GKH A;  2EYM A;  3HKZ G;  4A75 A;  4H44 C;  1ENF A;  3HZX A;  4A3E H;  4JI5 Q;  4JI4 Q;  1D5M C;  2PI2 E;  1XNR Q;  1UE7 A;  2IX3 A;  4A3G G;  1G51 A;  3BDO A;  4RGO S;  1K83 H;  4DV7 L;  3HOX G;  4JI6 L;  2PCF B;  1HFN A;  4R4I A;  1CM9 A;  2K33 A;  3M4O B;  2EYL A;  2D5D A;  5J39 A;  3QO2 A;  1XNQ L;  4JC0 A;  1Q82 C;  4C3I H;  4KN4 C;  5CGK A;  4IAL A;  5EKL A;  4O1N A;  4PZ7 A;  3A5U A;  5I9O A;  3H0G H;  3I2Z A;  3A56 A;  4BY1 B;  2L12 A;  1JC7 A;  3IL8 A;  3I4L A;  4DV4 L;  5IIF A;  3AFP A;  4C1N K;  4OL7 A;  3ZJY C;  3HOZ G;  1FYC A;  2R61 A;  2F0L A;  5FLX c;  1ZXT A;  1OO9 B;  1G6P A;  1EWC A;  1A3T A;  2JE6 I;  4IPD A;  3U50 C;  1HHV A;  3SDZ A;  2EYJ A;  2IL8 A;  4GOP C;  1BOS A;  4ZKC B;  2ZXR A;  2RQX A;  4IUN A;  4OX9 L;  4JG2 A;  1SBB B;  5EBC A;  1E24 A;  1WD1 A;  1U5K A;  2DUD A;  1TS2 A;  1PTO H;  2WB1 B;  3EBE A;  2F0S A;  3AFQ A;  2NVT H;  1UEB A;  5T1I A;  5IOD A;  3CCL A;  3PO3 H;  5C5M A;  1PHJ A;  4BXX G;  3H3V I;  1I94 L;  4OO1 G;  1GOZ A;  4DV7 Q;  4Y7N H;  1OTC A;  4E6I A;  4JI6 Q;  1QUQ A;  3A8K E;  1WFQ A;  2ICI A;  3DWQ A;  3A7L A;  1XNQ Q;  3QB3 A;  4F8M A;  4A3K H;  1NAP A;  3O13 A;  4RKB A;  4GS3 A;  1TWH H;  3OW2 A;  3K80 C;  5KGU A;  5M3F H;  4J15 A;  4DV4 Q;  2X6G A;  4POF A;  3B6Y A;  4Z9C B;  1LTB D;  2JA6 H;  2WKD A;  2JA7 B;  4X3S A;  1Y1V B;  5FO7 B;  4A3D B;  1Q1B A;  4BBR B;  4HIM A;  2HCC A;  5IGB A;  4RG1 A;  1PYW D;  1RHP A;  3BYY B;  5E4X A;  2EXZ A;  2N88 A;  3H94 A;  3P1H A;  4L6T B;  3T51 B;  1K0S A;  4QMG A;  1YIJ A;  1SNP A;  2RKS A;  4R8I A;  1HZC A;  1I94 Q;  4DK1 A;  3BDC A;  1HZB A;  5GQO A;  3VR2 A;  3KF6 B;  4C3H B;  3J7Z C;  1O7L A;  2B2V C;  4MZ9 A;  2JP1 A;  5M5X B;  1NR4 A;  2HUG A;  1TVX A;  1BBU A;  1EYD A;  1NBW A;  1DOM A;  3SK6 A;  3RN5 A;  5C0X G;  3K59 A;  1B1Z A;  4IZ8 A;  3GTM B;  2OXP A;  2BH8 A;  3RUZ A;  5LHY 1;  4OXP A;  1NY4 A;  5D3D A;  4DR1 L;  4V19 0;  1NMG A;  5ELD A;  3J7A 5;  1VQJ A;  3R2I A;  1F77 A;  1K0R A;  1WJJ A;  4P74 A;  4DR7 L;  1V1O A;  1Y8P B;  1UE5 A;  4N9T A;  4L5S A;  3HGB A;  1CFM A;  1STH A;  1RD9 D;  2PNR C;  3TRE A;  1BCP F;  1UE6 A;  1WTO A;  5COR A;  5M5W H;  2DY7 A;  1E0B A;  4FF2 A;  4IUR A;  3WDN A;  3BDL A;  2OT2 A;  1VCI A;  3PO2 H;  2B3G A;  1IZ6 A;  4GN5 A;  2BOS A;  3GV3 A;  1F9P A;  4KN7 C;  4NMZ A;  1YBY A;  2DNE A;  4ABN A;  1IYU A;  2CHB D;  2DJF C;  2HCI A;  4CKB A;  2JJQ A;  2NVY H;  3MEH A;  4B3S L;  3UDX A;  1SE4 A;  1VQM A;  1KHI A;  3CRK C;  2VL6 A;  1GD7 A;  1WTH A;  4PZ6 A;  1HH2 P;  2PNH A;  4JW0 A;  5EPL A;  1HXY D;  3NBI A;  2V1C C;  3S16 H;  4L5R C;  1EEF D;  1PYB A;  1E2W A;  4LUZ A;  1N9W A;  1L1O B;  3BVG A;  1QB5 D;  3KBX A;  4DR1 Q;  5C6A A;  1SN8 A;  2I5L X;  1QCB D;  4JCV E;  4DR7 Q;  1D5Z C;  4K5X A;  2IT1 A;  2VUM H;  3I72 A;  3NTK A;  3OMG A;  5CR3 A;  1WTX A;  4JV5 L;  1PH3 A;  1KDB A;  4FF4 A;  4R4O A;  2MUY A;  3MZ5 A;  1QZG A;  2EXD A;  3VYT A;  2PQA B;  2NBF A;  2K04 A;  3CP0 A;  3E9H A;  4ILW A;  3S14 B;  3NSW A;  1HUN A;  1HTL D;  1SMX A;  3NEL A;  1PZI D;  5HGQ A;  4KLK A;  1ENA A;  4NXN L;  1C0A A;  5ELE A;  1H9S B;  1MHW C;  1PFS A;  1X55 A;  1VQC A;  2UXD L;  3ITP A;  2RSO A;  4U67 3;  1JQY D;  4AYB G;  2WAQ G;  4B3S Q;  3QIA A;  3HOW H;  4EX5 A;  1SE2 A;  1I4X A;  1LLR D;  1YEZ A;  3W2D A; 
#chains in the Genus database with same CATH homology
 2K32 A;  4O42 A;  1SYC A;  5C3E B;  4C2M B;  2PZW A;  5COY A;  1I3Q B;  4IUQ A;  1FR3 A;  4EVO A;  2ID0 A;  1HTP A;  2VB3 X;  4P2C B;  1Q90 A;  4RHS A;  4LJZ C;  2CW0 D;  1QIL A;  3FKI B;  2EYP A;  5CV8 A;  4NDX A;  2KOL A;  5EGT A;  4C56 C;  2D2C C;  2EE1 A;  1S5B D;  1YNJ D;  4DFA A;  3I8Z A;  2Z8L A;  3H91 A;  5FK9 C;  1I6H B;  3VR3 A;  2PW5 A;  2K01 A;  1MSH A;  3OHX C;  3GTL B;  2ZT9 C;  4PV1 C;  2KCN A;  4RKL A;  1E2Z A;  2B2U A;  1EIH A;  2IJ0 A;  2EJM A;  2L5T A;  2ICE C;  1CZW A;  1U4M A;  3VR6 A;  4XIG S;  2X6L A;  3EJI A;  4K8J A;  3LWU A;  3KLR A;  5I6W A;  4FO2 A;  1EYA A;  4OIJ A;  3S1N B;  3EA6 A;  4J8Q A;  4CHT B;  2CW0 C;  1PMR A;  1F9Q A;  1QWY A;  3A55 A;  3GV6 A;  1R4Q B;  3GO5 A;  3VA5 A;  1PRT B;  2XIW A;  1XXG A;  2XN9 C;  4QCL A;  5JPN C;  3MXU A;  4R8N A;  3I91 A;  3M7G A;  2IWH A;  1SYB A;  1IHZ A;  4CGY B;  3GQB A;  2F3V A;  1CTM A;  1B44 D;  5BN4 A;  2F0G A;  3VYS A;  5CC4 A;  2IPK D;  2XSC A;  4XT1 B;  5HUR A;  3NTI A;  3HOV B;  1NSN S;  1TT2 A;  2Y0S B;  4A3E B;  2F1M A;  2XWJ B;  4RFB A;  1IW7 C;  1SSO A;  1K83 B;  3ERQ A;  2F03 A;  5ELF A;  5CYU A;  1STN A;  1PXU A;  3S9W A;  1O80 A;  3NE5 B;  4C3I B;  3H0G B;  2I07 B;  4FXK C;  1GUG A;  4KKU A;  4WRD A;  4EQN A;  3DEO A;  1CHQ D;  2EY1 A;  4ZQ3 A;  1F2L A;  4XT3 B;  1J9O A;  1PTO B;  4XXE A;  2NVT B;  1IL8 A;  3TP7 A;  3DM1 A;  4DN4 M;  5G3L D;  3PO3 B;  5IGC A;  3MAQ A;  4DGZ A;  1S4Z A;  3PV0 A;  4Y7N B;  5J22 A;  1B4O A;  4QUC A;  2FHT A;  2KCC A;  3E0J A;  5CBA E;  5EKK A;  2DN8 A;  1DJR D;  3JAM L;  1EFI D;  4KHZ A;  3GP7 A;  1C4Q A;  4J1M A;  1GJX A;  2DNC A;  2EY6 A;  4A3K B;  1CZG A;  1TWH B;  4PMC A;  5A35 A;  5M3F B;  1LT5 D;  3EQL C;  4H0L C;  5D65 A;  2KA7 A;  1WTW A;  2O5I C;  2JA6 B;  3CU7 A;  3OMC A;  2CQA A;  5KNC A;  3CRL C;  2EY5 A;  4KMU C;  1LTR D;  2NTT A;  4N9P A;  2K5Q A;  5TSS A;  3KUP A;  4RHR A;  1ROD A;  3TP8 A;  4KI0 A;  5FKA C;  3AU7 A;  4ZUJ A;  2EYO A;  1LT4 D;  4KJN A;  2VB2 X;  1W6J A;  1KDA A;  1QNU A;  4DU9 A;  1R4P B;  4K6L A;  3C1F A;  5C3W A;  2E74 C;  2B2Y A;  1DCZ A;  3OWE B;  1S5F D;  2H1E A;  2KJX A;  2NN6 I;  3FVQ A;  4F7X A;  3BZD B;  3OW7 A;  5M5W B;  1SAP A;  3V2T A;  3BVZ A;  1SND A;  2MP1 A;  3NTH A;  3KF8 A;  3PO2 B;  2JEA I;  4HN7 A;  2AQ2 B;  1OXX K;  1EU4 A;  2XNA C;  3AB9 A;  2NVY B;  3BYT B;  1G29 1;  2J7Z A;  3C3L A;  1SXT A;  1S5D D;  5FOB B;  3J7Y W;  1PZK D;  3S16 B;  1G8Z D;  1OXV A;  2O4X A;  4XDX A;  5CV4 A;  2EY2 A;  3DWP A;  2DY8 A;  4K2K A;  5E1F A;  2J4X A;  3DUZ A;  5KNB A;  1HCZ A;  2VUM B;  1XX8 A;  1G2S A;  4FNF A;  2Q8I B;  1KNA A;  2QEJ C;  3R3O A;  3GD7 A;  1AZQ A;  2L11 A;  4IFD J;  2XRQ D;  2RDG A;  3NWT A;  2QDB A;  4X3T A;  3HOW B;  3OIQ A;  2AQ1 B;  5JOB A;  3KLS A;  3DWA A;  1FNV A;  3Q23 A;  3E5S A;  4A3I B;  4K8I A;  3SE0 A;  1CA5 A;  3SVM A;  1O78 A;  3EFX D;  1STY A;  5ISR A;  3FRP B;  3MC0 B;  3C2P A;  3K7A B;  1PRT D;  5JAV A;  1ML0 D;  3K6O A;  1JIC A;  4C3J G;  1A15 A;  3I3C A;  2LS0 1;  3S2H B;  3J7A V;  1QE6 A;  1JOR A;  1IYV A;  2EJG C;  1LTG D;  3MHB A;  3S2D B;  2F0M A;  1DXM A;  4K6D A;  1SNO A;  1ZYR D;  2A68 D;  1HFG A;  2PMZ B;  2B2W C;  4ME5 A;  2K5D A;  4KD4 A;  1X3P A;  4KY7 A;  2AWO A;  2NVX B;  4WOR A;  5E4W C;  2F4I A;  4G7O C;  1TWG B;  1AZP A;  5J1Z A;  4OIK A;  2NN6 G;  1I4G A;  3T13 A;  1DYQ A;  2ENB A;  3BVM A;  3HG9 A;  2XVS A;  1SNQ A;  5T1G A;  1RTO A;  3RZD B;  2RDH A;  3MFY A;  5K36 H;  1SYF A;  1EZ8 A;  1QJO A;  5KRU A;  5IGG A;  1I4Q A;  3N52 A;  3OSO A;  1LV9 A;  2B2T A;  3VYU A;  3Q24 A;  1PRT C;  4IQZ A;  5JPM C;  1PFM A;  3QOL A;  5EQ0 A;  3H6M A;  1UNS A;  1MBY A;  3A8I E;  3K5N A;  2A6E D;  5I9P A;  2WP8 J;  4HAE A;  4K2L A;  1WD0 A;  5C5L A;  1PTO D;  1TWF B;  1ZYR C;  1B3A A;  1VF7 A;  3MXG A;  2Z1C A;  4IUT A;  4RCO A;  2B63 B;  5AFW A;  2BA1 A;  1Y1W B;  3DEP A;  3PUY A;  2A6H D;  1LT3 D;  1V1P A;  4K5V A;  1OXU A;  5LL6 S;  4L63 B;  2M00 A;  4CJ2 C;  3HOU B;  1AW7 A;  4BA1 I;  4OO1 H;  4A3F B;  1K8M A;  1U4R A;  4K5W A;  1TS3 A;  1PFB A;  1I6V C;  2L0C A;  4IFD H;  3GTG B;  3S1Q B;  3V05 A;  2F0W A;  1TWC B;  1DD2 A;  3VA7 A;  1AN8 A;  3NP8 A;  1EQT A;  4KD3 A;  1STE A;  3MXN A;  4C3H G;  4DNR B;  5IGF A;  1TS5 A;  2SDF A;  2EDG A;  1M8A A;  2A6E C;  1TS4 A;  2ZXO A;  3R93 A;  5FLX L;  3MWY W;  4ODG A;  1PTO C;  1ZEQ X;  1EOT A;  4F88 A;  3PIP 3;  3FEW X;  3SR1 A;  1D2B A;  3KBG A;  3SHL A;  2AQ3 B;  3H09 A;  5D14 A;  5M3M B;  2WIN B;  3Q6S A;  4FP5 D;  1S5E D;  2EPB A;  1DOL A;  2K05 A;  1KAA A;  2BA0 A;  5KYL A;  3S17 B;  3A7A B;  5KIX A;  1HA5 A;  1TR5 A;  3JAM E;  4CKC A;  1T5X D;  5C0X H;  3PUW A;  3V96 A;  2SNM A;  4Q0F A;  3NHH A;  2ZXP A;  3NPP A;  2Q8T A;  3D31 A;  2WKC A;  5JEA G;  3K58 A;  1II3 A;  1B53 A;  4FYD A;  4FXG C;  4EQP A;  4CJ1 B;  1TQO A;  1JOQ A;  1Q1E A;  4KTA A;  5ELC A;  1V8Q A;  4RGN A;  2MJ8 A;  3K0Y A;  1ET9 A;  3W3A A;  4PMB A;  1NUC A;  4X3K A;  3S1R B;  1D6E C;  3M85 A;  1EIG A;  2EYF A;  2FFK B;  3QJY A;  3K57 A;  2L9H A;  4FF1 A;  1G91 A;  3BG3 A;  4RWS C;  1ENC A;  1KNE A;  1RKN A;  1FGB D;  2RVL A;  5IGE A;  2B8G A;  5A2Q L;  2V4D A;  1Z6H A;  4HED A;  4ID6 A;  1VMC A;  1FD7 D;  5DEH A;  3K5L A;  2FJ2 A;  1D1K A;  1YNJ C;  5KYI A;  4G7H C;  1EL0 A;  3IFD A;  1B2T A;  4DXF A;  3G6J B;  1OXS C;  5DNF A;  4NW2 A;  3TP6 A;  5JVG 3;  1EYC A;  4XQJ A;  5EJW A;  2F0O A;  3TBI B;  1NR2 A;  3WOF A;  1QG7 A;  1F2Z A;  1AFP A;  2R3Z A;  4BWG B;  3HRZ C;  1TU2 B;  1MSG A;  1KAB A;  4RH6 A;  2SEB D;  5C3X A;  4MIU A;  1GUS A;  1I50 B;  1S5C D;  2F0V A;  2QKI C;  3AMU A;  2F0I A;  2M9V A;  3LX0 A;  1M4V A;  1F2Y A;  3X3M A;  3D3R A;  4YIJ A;  1WTV A;  4HTH A;  1GUO A;  3T4A C;  3QG1 A;  2PQE A;  1YNN D;  3SK4 A;  1EY0 A;  4EQO A;  1BF4 A;  2QIL A;  5C44 B;  5D3I B;  1STB A;  5G3L F;  1PLF A;  5ELB A;  1JE4 A;  2HDM A;  4ZK9 B;  4CJ0 B;  5JJZ A;  4BBS B;  1W6K A;  1EY8 A;  4BY7 B;  4U68 A;  1QOH A;  1AP0 A;  3DMU A;  1ILQ A;  5CV7 A;  1D1I A;  1JOK A;  1LTA D;  1D5X C;  4XQQ A;  2EJF C;  3FMC A;  1A3V A;  3EVQ A;  1JB3 A;  2K6A A;  2LMC B;  2Q8R E;  2KHS A;  4F87 A;  4KJO A;  1Q3L A;  1BR9 A;  1RJT A;  3GTO B;  4BA2 I;  2BE5 D;  5EPK A;  2F3W A;  2K28 A;  2MPM A;  4KV6 A;  2B2U C;  1TY2 A;  4FF3 A;  1YNN C;  4KY5 A;  3NQI A;  1Y69 U;  4XQN A;  2PPB C;  3OPO A;  2F0N A;  3J80 E;  1BCP B;  2NB0 A;  5CV5 A;  1BUV T;  3LNN A;  1KLG D;  4PMW A;  3S1M B;  4C3I G;  3CHB D;  1C8C A;  2R6G A;  1CQV A;  2YU9 B;  2F0Q A;  4LMQ D;  3J81 L;  2L1B A;  3C1E A;  3HKZ B;  2E76 C;  3CQZ B;  4Q5V A;  3T53 B;  4LAA A;  4IFD I;  4A3G B;  5DM6 3;  1EEI D;  4ZKB B;  2E75 C;  2WAC A;  3NWS A;  4A3M B;  3HOX B;  2I46 A;  4HR7 B;  1EU3 A;  2PW7 A;  2BE5 C;  2LY7 A;  3NXW A;  1X32 A;  4L8J A;  2B2V A;  2IW3 A;  1ESF A;  1DZ1 A;  1LO5 D;  2IX1 A;  5I4D A;  3HOZ B;  3PUV A;  5CV9 A;  2F0U A;  2OEO A;  2C9O A;  1DOK A;  4HSP A;  3MA2 B;  4RA8 A;  2EVB A;  5EKI A;  3K5O A;  4IN3 A;  4ULL A;  1V1P B;  3WOE A;  2RA4 A;  4XYQ A;  1KLU D;  1FNW A;  4RGM A;  4B08 A;  2G9D A;  5BN3 A;  2E2H B;  1JCK B;  3MXP A;  1Y8N B;  1UAP A;  1MGS A;  2FMM A;  4CBV A;  1XTC D;  1L0Y B;  1LAC A;  3L9A X;  2JEB I;  5NUC A;  2JXM B;  3URY A;  1A2U A;  4FVM A;  5FLX E;  1C48 A;  1PRT F;  3VR4 A;  1BQQ T;  2QF7 A;  2CVR A;  2BDO A;  3LWE A;  1JR0 D;  3GTK B;  4ZLT F;  1B9M A;  4H13 C;  2F0J A;  1IKL A;  4BS9 A;  3RD4 A;  4ZAI A;  4G57 A;  3J7A F;  1V43 A;  2MGS A;  2EYH A;  1DM0 B;  4TQU S;  1A2T A;  2L55 A;  3F2U A;  4WJW A;  3OWF A;  2GA4 B;  4DAY A;  2EZV A;  2PZU A;  4TKO B;  2JSO A;  5C4J B;  1SMY D;  2D9U A;  4K14 A;  3TZU A;  1SYD A;  1X3Q A;  5CV6 A;  1H9M A;  2Z4I A;  3FPP A;  3TSS A;  5C0X J;  4KKS A;  1HQM C;  2F0T A;  3M4Y A;  2AUJ D;  4IFD G;  1NCV A;  1EY5 A;  5I2X A;  1R9T B;  3DXJ C;  2K03 A;  2BDN A;  2KED A;  3J80 L;  5DM7 3;  3KLS X;  3BS1 A;  2PZT A;  3A8J E;  1ONL A;  1CT1 D;  1EY6 A;  3MVV A;  1F9S A;  1ICW A;  1GHK A;  4IUU A;  2KVM A;  3L7Z C;  3PIO 3;  1PTO F;  4DF7 A;  2K7V A;  1MD2 D;  5BN5 A;  5A2Q E;  5EBD A;  2B2Y C;  2F0K A;  1H9J A;  3VYR A;  1KTK A;  1O7Y A;  2B8F A;  1ESR A;  1L0X B;  1ET6 A;  2PO4 A;  1TWA B;  3NK9 A;  2HDL A;  1SMY C;  1SFO B;  1GUT A;  1JWS D;  2TMP A;  5KEE A;  2RSN A;  2A68 C;  4AYB B;  2WAQ B;  1EY9 A;  3DHQ A;  2N55 A;  3HP3 A;  3TME A;  5IOC A;  1F2M A;  4HCE A;  4KKT A;  5CBE E;  2M2L A;  2F0P A;  3TZD A;  1HPC A;  1Y8O B;  4QB4 A;  3M7N A;  3RZO B;  1J8I A;  1EQV A;  4HMI A;  1BNZ A;  1SNM A;  4RGT A;  2WV6 D;  4HSV A;  2KEC A;  1HRJ A;  1WTP A;  1H9R A;  5IGD A;  1I4H A;  5HGT A;  1Q12 A;  1G2T A;  1E2V A;  1BCP D;  1RDP D;  1STA A;  3P7J A;  1BDO A;  5FO8 B;  4QIW B;  3QWN A;  3M3Y B;  5IT9 E;  1F9R A;  3R8B A;  4RCN A;  1SDF A;  5E3F A;  5JEA J;  4OHJ A;  1MI2 A;  1WTQ A;  3A54 A;  4IUP A;  2NN6 H;  1AEX A;  1SYG A;  1B9N A;  5M9O A;  1SEB D;  2XRS D;  2JA5 B;  2JYO A;  5C4H A;  2C5C A;  1RCV D;  4H7B A;  2A6H C;  2YYZ A;  3GTJ B;  3K5M A;  1WTR A;  4PNY A;  4ZYS A;  3G7L A;  1VF5 C;  3TDQ A;  4CKE A;  4ZRZ A;  2K5W A;  2FMC A;  1XYI A;  1LT6 D;  1RTN A;  4XYO A;  4A3J B;  1Z7T A;  3MFG A;  1SJE D;  4I7Z C;  3P75 A;  1T5E A;  1BCP C;  1O7Z A;  3I70 A;  5I2Y A;  1BXT A;  3HOY B;  1LTT D;  2G9H D;  4DXG A;  2MHV A;  1LTI D;  1OXT A;  3ND9 A;  1UEA B;  4M8A A;  2H4O A;  1I4R A;  1SNC A;  1XWE A;  4C1N I;  3T16 A;  3HS0 C;  3SK5 A;  2KEE A;  4G4K A;  1B50 A;  2KUM A;  1EY7 A;  3FPU B;  3SEB A;  5M5Y B;  1WCM B;  2SNS A;  3R2T A;  4IUV A;  1IKM A;  3CKI B;  3NUC A;  4QUF A;  4HCS A;  4MN3 A;  2SOB A;  3J81 E;  3Q22 A;  2A5H A;  2WII B;  2B2T C;  4TSS A;  1K8O A;  3UI2 A;  5CMD A;  3PMF A;  1JWU D;  1GUW A;  3IAY A;  1TKW B;  3U9S A;  2R7Z B;  3ND8 A;  3OIP A;  3SK8 A;  3TN2 A;  2O2L D;  5F2D A;  1PFN A;  1RF2 D;  2F0F A;  2AWN A;  4XTC S;  2D62 A;  1A6X A;  2F0E A;  1IW7 D;  5EPJ A;  1CK1 A;  1LTS D;  1SYE A;  3P20 A;  3Q0A A;  4G7Z C;  2R93 B;  5C4X B;  2A74 C;  2NZ1 D;  2OF1 A;  2EOT A;  3D4W A;  4B9W A;  1GXD C;  1I4P A;  1GHJ A;  1CI3 M;  4J6H A;  2NVQ B;  3VR5 A;  4JBW A;  5LL6 X;  3T56 B;  1U4L A;  1Q8I A;  3ERO A;  4WFN 3;  1U4P A;  1BBX C;  3U9O A;  3OOC A;  1BO0 A;  2FIN B;  3I4N B;  5JVH 3;  1PDQ A;  4MHE A;  2BCO A;  4A93 B;  2PYK A;  2A73 B;  2VNU D;  1SE3 A;  1ZKO A;  3ONA B;  5JEA H;  1WVL A;  2NWG A;  2O5J C;  1HUM A;  1A3U A;  4GZY C;  2VXW A;  5I6Y A;  3D8G A;  4RAU C;  4M1U B;  5IT9 L;  3ZYY X;  3IFT A;  1PZJ D;  5C4Z A;  1H9S A;  2NUC A;  3PUX A;  1U9R A;  4DK0 A;  2K1B A;  3SXH A;  4UDU C;  4JK1 C;  4NP5 A;  1SJH D;  4QF4 A;  4OGQ C;  4KHV A;  3D6C A;  1LAB A;  2NTS A;  3RMH A;  4HMJ A;  4FXD A;  2E2D C;  3I73 A;  2R92 B;  2IX0 A;  3X3N A;  3L3O C;  2XWB B;  2AUK A;  4DA2 A;  2X69 A;  3S15 B;  4EGV A;  4B9X A;  3NQT A;  3D4R A;  4KY6 A;  2E2J B;  2LFN A;  4KK7 A;  3E6Z X;  3TP5 A;  1FNU A;  4DAP A;  4PQX A;  2JA8 B;  3I90 A;  1EY4 A;  2L4N A;  3IKJ A;  3D4D A;  3GTQ B;  2A69 D;  3C46 A;  1EWH A;  3N6R A;  3NBH A;  1CHP D;  2B2W A;  1CQF A;  1TY0 A;  2E2I B;  4OO1 I;  1VMP A;  4LK1 C;  1Z47 A;  2QCP X;  4A3B B;  2F0H A;  4DAV A;  1HQR D;  4X3U A;  2KQ3 A;  2LKV A;  1TII D;  2TSS A;  2F0D A;  3H3V C;  5DAU A;  1QNK A;  1GUN A;  3D6W A;  3RLF A;  2J0T D;  1CA6 A;  2Z4H A;  4UAI A;  1UUP A;  3PUZ A;  4R9W A;  1H9K A;  2RDF A;  1ILP A;  1HA6 A;  3HEJ A;  4TRD A;  5FO9 B;  3QOJ A;  4NKL A;  3I4M B;  2NYZ D;  1EZ6 A;  4S3S A;  1KDC A;  2B39 A;  1DON A;  2A69 C;  4ZUI A;  1STG A;  3MTS A;  2RBM A;  5K5P A;  5KND A;  5C0X I;  1JOO A;  4C3J B;  2HQE A;  1VDZ A;  4V0B A;  4DNT B;  3FDT A;  4I65 A;  5K36 G;  3GTP B;  1JWM D;  1G6Z A;  3KK7 A;  2EYM A;  4H44 C;  1ENF A;  3HZX A;  1D5M C;  2IX3 A;  3BDO A;  4RGO S;  2PCF B;  1HFN A;  1CM9 A;  2K33 A;  3M4O B;  2EYL A;  2D5D A;  5J39 A;  3QO2 A;  4KN4 C;  5CGK A;  4IAL A;  5EKL A;  4O1N A;  5I9O A;  4BY1 B;  3A56 A;  2L12 A;  1JC7 A;  3IL8 A;  3I4L A;  5IIF A;  4C1N K;  4OL7 A;  1FYC A;  2R61 A;  2F0L A;  1ZXT A;  1OO9 B;  1EWC A;  1A3T A;  2JE6 I;  1HHV A;  3SDZ A;  2EYJ A;  2IL8 A;  1BOS A;  4ZKC B;  2ZXR A;  2RQX A;  4IUN A;  1SBB B;  5EBC A;  1WD1 A;  2WB1 B;  1TS2 A;  1PTO H;  2F0S A;  5T1I A;  5IOD A;  5C5M A;  4OO1 G;  1GOZ A;  4E6I A;  3A8K E;  2ICI A;  3DWQ A;  3A7L A;  3QB3 A;  4F8M A;  1NAP A;  3O13 A;  4RKB A;  5KGU A;  2X6G A;  4Z9C B;  1LTB D;  2WKD A;  2JA7 B;  4X3S A;  1Y1V B;  5FO7 B;  4A3D B;  1Q1B A;  4BBR B;  2HCC A;  5IGB A;  1PYW D;  1RHP A;  3BYY B;  5E4X A;  2EXZ A;  2N88 A;  3H94 A;  3P1H A;  3T51 B;  4L6T B;  4QMG A;  1SNP A;  2RKS A;  4R8I A;  4DK1 A;  3BDC A;  3VR2 A;  4C3H B;  1O7L A;  2B2V C;  2JP1 A;  5M5X B;  1NR4 A;  2HUG A;  1TVX A;  1EYD A;  1DOM A;  3SK6 A;  5C0X G;  3K59 A;  1B1Z A;  4IZ8 A;  3GTM B;  2OXP A;  3RUZ A;  5LHY 1;  5D3D A;  4V19 0;  5ELD A;  3R2I A;  1F77 A;  1V1O A;  1Y8P B;  4N9T A;  3HGB A;  1CFM A;  1STH A;  1RD9 D;  2PNR C;  1BCP F;  1WTO A;  5COR A;  2DY7 A;  1E0B A;  4FF2 A;  4IUR A;  3WDN A;  3BDL A;  2OT2 A;  1VCI A;  2BOS A;  3GV3 A;  1F9P A;  4KN7 C;  4NMZ A;  4ABN A;  2DNE A;  1IYU A;  2CHB D;  2HCI A;  4CKB A;  3MEH A;  1SE4 A;  3CRK C;  5EPL A;  1HXY D;  3NBI A;  1EEF D;  1E2W A;  3BVG A;  1QB5 D;  3KBX A;  5C6A A;  1QCB D;  1D5Z C;  4K5X A;  2IT1 A;  3I72 A;  3NTK A;  3OMG A;  5CR3 A;  1WTX A;  1KDB A;  4FF4 A;  2MUY A;  3MZ5 A;  3VYT A;  2NBF A;  2K04 A;  4ILW A;  3S14 B;  3NSW A;  1HUN A;  1HTL D;  1PZI D;  1ENA A;  5ELE A;  1H9S B;  3ITP A;  2RSO A;  4U67 3;  1JQY D;  3QIA A;  1SE2 A;  1I4X A;  1LLR D;  3W2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...