2Q8IB

Pyruvate dehydrogenase kinase isoform 3 in complex with antitumor drug radicicol
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
93
structure length
93
Chain Sequence
SYPPHMQVLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKEADISAFADY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 3
publication title Distinct Structural Mechanisms for Inhibition of Pyruvate Dehydrogenase Kinase Isoforms by AZD7545, Dichloroacetate, and Radicicol.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 15
structure length 93
sequence length 93
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 2007-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2q8iB00
1HPCA 4LJZC 2A6ED 4H13C 1CI3M 3VR4A 3VR5A 2E76C 5K36H 1IW7C 2A69D 3OOCA 1QJOA 1GUTA 1LABA 1OXTA 3A8IE 2KCCA 4OO1G 1B9NA 1K8MA 4DNTB 5BN3A 4JK1C 2PCFB 2JE6I 2QF7A 3A7AB 1OXVA 1OXSC 3GQBA 3U9SA 4G7OC 1GUGA 3CRKC 2JEAI 1IW7D 2JXMB 1VCIA 1Q12A 4KN7C 4OGQC 1GHJA 3W3AA 3WDNA 4LK1C 1BDOA 5C0XG 1IYVA 1DD2A 3KLRA 1H9SA 3HGBA 2K32A 3AB9A 3NE5B 3P20A 5BN4A 4L8JA 3DXJC 3VR6A 4GZYC 1DCZA 3A7LA 1E2ZA 1Q1EA 3D4RA 1CFMA 3M7NA 4BA1I 3I72A 4OO1H 2K33A 4KKTA 1TU2B 3LNNA 1G291 3RLFA 1Z6HA 1DXMA 3OW7A 4KI0A 5A35A 2B8GA 1Y8NB 5BN5A 1VF5C 1CTMA 2EJFC 5KNBA 1ONLA 2NN6I 4G7HC 3TZUA 2V4DA 2BA1A 4JBWA 4BA2I 2EJMA 1H9KA 2E75C 3GD7A 2A6HD 3A8KE 3QIAA 1GJXA 3SE0A 5C0XH 4IFDH 2KA7A 1V8QA 3FPPA 1I6VC 2BA0A 4DK0A 5JEAG 2AUJD 5KNCA 2O5IC 3T51B 1Y8PB 3N6RA 3I4LA 3I73A 3PUZA 3VR3A 2BE5C 1ZYRC 1K8OA 4G7ZC 1OXUA 2DN8A 1FYCA 2B8FA 3IFTA 1FR3A 3CRLC 2E74C 1Y69U 2D2CC 2L5TA 1TKWB 2YYZA 3BG3A 3EQLC 2BE5D 4XTCS 3M85A 1O7LA 1EWHA 2DNCA 2F1MA 4H0LC 4KKUA 4KMUC 3ND8A 1ZKOA 3L7ZC 3M4YA 2BDOA 2CW0C 2R6GA 1E2WA 2PPBC 2A6EC 1H9RA 1PMRA 1VDZA 1HCZA 3VR2A 3IKJA 4KHZA 1YNNC 2IT1A 2LMCB 3LWUA 2EJGC 1OXXK 3MFYA 3H94A 4PV1C 4RCNA 1IYUA 2Q8IB 1O78A 2JEBI 3T56B 2ZT9C 1Z7TA 3PUYA 3MXUA 1SMYC 3D31A 1Y8OB 4TKOB 3PUWA 1V43A 2K7VA 4DNRB 2NN6G 2AWOA 3SDZA 1Q1BA 4KN4C 2A68C 1A6XA 1E2VA 1YNJC 4H44C 2DNEA 3PV0A 1B9MA 2EDGA 3QJYA 3OPOA 1GHKA 1GUSA 4TQUS 5JEAH 2O5JC 1GUNA 1T5EA 5K36G 1Q90A 1H9MA 3QG1A 3FMCA 1H9JA 3PUXA 3ND9A 4DK1A 2D62A 5KNDA 1HQMC 1HTPA 3T53B 2D5DA 4HR7B 1H9SB 2EVBA 4XIGS 1LACA 2A68D 4IFDG 2PNRC 4I7ZC 2A69C 3PUVA 3A8JE 1VF7A 3VA7A 2AUKA 2A6HC 2NN6H 4KKSA 3BDOA 4IQZA 1GUOA
chains in the Genus database with same CATH superfamily
2F0LA 3VYTA 2RF4A 3GTPB 2KCMA 5CV4A 3GTOH 1YNXA 1HZCA 1TWFB 2K28A 4N9TA 4LF9Q 4UY8C 3U4ZA 4RA8A 1XMOL 5LMNL 2E2DC 2L55A 4JK1C 1B3AA 1IBML 4OIKA 4A3DG 3NEMA 2Z9HA 4A3JB 3M3YB 3IFDA 1TWCH 2RVLA 2MO0A 1KDBA 4DNIA 1JR0D 1PZJD 1EEID 4FXKC 2RQXA 3CP0A 4BY1G 2XWJB 4FXGC 5BN4A 1NSNS 5FLMG 3VR6A 3IRBA 4DR7Q 3K58A 4NP5A 3HOVB 1YBYA 3I72A 1PA6A 1YVCA 5C3EB 2WAQB 1Z6HA 4A3DH 1WJJA 3OW7A 1EZ8A 1VF5C 1QVFA 4DR5L 3DUZA 2PO4A 5G3LF 3EROA 3OMGA 4BY1H 1MSHA 3HOUG 2HD3A 1UAPA 2ALYB 4P72A 3HOXH 1A63A 4YWLA 1K28A 2Q8RE 2E2JH 2AQ2B 3HOZH 4JYAQ 1CKMA 1TS2A 3S1MB 1C0AA 4BY7H 3K5MA 4JBJA 1UE5A 2DN8A 3G7LA 3J80E 3J7AV 5KGUA 4DR3L 2D2CC 2LY7A 3PQIA 3S2HB 5EBDA 2F4VL 4HJ5A 2PZUA 3S1QH 1F2LA 2X6GA 4L5SA 1KC8C 3J7ZC 3EA6A 1F9RA 4UP9A 2NVXH 3IKJA 4IPGA 4A3GB 5IGFA 2B29A 4L5RC 2NVTH 2EJGC 3DEOA 5IODA 2G9DA 3RNUA 4LUOA 3MXUA 3AU7A 1TWHB 3I4NB 1GKHA 2K7VA 3Q8DA 4DNRB 3QB3A 1RIPA 3N52A 1XPOA 1F2YA 1CQVA 1VMCA 3SDZA 4B3TQ 4C3HG 3MAQA 1ZYRD 1HNXL 1T5EA 3SK8A 5AJ3L 3MA2B 4ID6A 4JOIC 4TVAB 2LFNA 1K8AC 3NUCA 4DV5Q 2VXWA 4HCEA 2PNRC 4DV1L 1D2BA 4HIMA 3J7YW 5DLQE 3MXPA 4JI8L 5ISRA 1PRTF 3C1EA 1EFID 3ONAB 2A1AA 2ES2A 3ER0A 4H13C 5DM73 2F03A 1ENAA 1MI2A 2A69D 4FF4A 1YNND 3GV3A 1LABA 3A8IE 2K5WA 3H0GG 3KF6A 5IYBG 1K8MA 3WWVA 1EL0A 3S1NH 1BR9A 1A62A 4E6IA 2PNHA 4BBRH 2GN5A 4ZYSA 2J7ZA 3J81c 3CRKC 1IW7D 4TSSA 4JI0L 4DR3Q 3W3AA 1EQRA 2F4VQ 1H9SA 5GAGC 2K6AA 2WFWA 5I2XA 3U58A 3W1GA 2UUBL 4KKTA 1KIXA 5ELFA 4NXML 2ICEC 2B63G 2KECA 1ASZA 3RZDB 4UDUC 2M2LA 2K5DA 4IUUA 4A3MB 5T1IA 4N9PA 2KA7A 3S24A 4DK0A 4DK3C 4NKLA 3V96A 1YEZA 4DF7A 3PUZA 3S15B 2BE5C 1RF2D 1RODA 1HFGA 2PW5A 3CCUA 1OXUA 1YJNA 1HNXQ 1WYDA 3BS1A 5AJ3Q 5IP7H 1GM5A 2CWAA 4JI4L 2NBFA 2L5TA 3RN2A 1UEBA 2M00A 4CDDC 4OX9L 3WOFA 4BBSB 1EY9A 4JI8Q 4A3IG 1CZWA 1IHZA 3IL8A 5J39A 5IGCA 4GLVB 4K5WA 3Q23A 2JP1A 3ZYYX 2JA6B 2LMCB 3CCMA 1OXXK 2KEDA 3MFYA 4HJ7A 1SEBD 2CQOA 2JA7H 4RGTA 1BBUA 1QVCA 2HIXA 4C3IB 4GKKL 4A3IH 5EAYA 2QEJC 3HEJA 5IIFA 1QZGA 3NPPA 2Z6BA 2OF1A 3UDGA 2IPKD 5LMUQ 2PYKA 3BZDB 4UHVA 5C6AA 1XXGA 2LS01 1PH3A 4NXMQ 1FVIA 4JI5L 1WCMH 5C4HA 5CV5A 4ZLTF 4F88A 5D3DA 4A3EB 1V9PA 4XDXA 1CK1A 1RJTA 1BCPC 1U4LA 1BF4A 1E7ZA 1GUTA 3FKIB 1UE6A 4DGZA 3PO2H 2XSCA 4A3KH 3L0OA 1VQ4A 3A7AB 1W6KA 2JA8G 1AN8A 4G7OC 1I94L 4JPBW 2JXMB 1EY8A 5HY6A 3GTLB 1S3OA 3VYSA 4RG1A 1GHJA 3WDNA 1IYVA 1QOHA 2KUMA 3R3OA 3I55A 5CV9A 4GZYC 2R7DA 1Q1EA 3D4RA 4BA1I 1KLGD 2E2IH 1FGBD 3PO3G 3HOYB 1DXMA 2JA8H 4OWTB 3U50C 4J15A 1I6HH 1S72A 5EKIA 1HHVA 4P71A 2RBMA 2XTIA 2F3VA 5C44G 1GJXA 2KENA 3GO5A 4POFA 4GNXA 4JBKA 2RKSA 1BCPB 2WB1G 5JEAG 3RZOB 2K14A 1BNZA 5ELNA 1DONA 1N33Q 4X66Q 4YWMA 3OIQA 3T4AC 2UUAQ 4GKKQ 1R4QB 1WTRA 2BOSA 1WTPA 1RKNA 3SK5A 4OONA 3SR1A 4QQBX 4M8AA 1K3RA 4WJWA 2ICIA 1NR4A 2E74C 3CRLC 1KLUD 1HR0L 2SOBA 4C3JG 3GTJH 1PH5A 5IYDG 3C46A 1EIYB 2OCEA 1WD1A 2WV6D 2DNCA 2F1MA 3HP3A 3M4YA 4A75A 2R6GA 4NXNL 3GTQB 1X3EA 1EOVA 5C5MA 3TZDA 4IN3A 4EVOA 5M5YH 2VQEL 3L9AX 2F0DA 4C3JH 1QUQA 1L1OA 3CQZH 1SYDA 2ZT9C 4K2KA 4LUVA 3S17B 4FYDA 2YTYA 2L1BA 3A5UA 3PUWA 3KF6B 5CGKA 1I50B 5JJIA 4TQUS 3K5OA 3PMFA 3GTPH 4YCVA 1XJVA 1TWFH 4I7AA 1H9SB 1PZID 4C56C 4LFBL 3G6JB 5LMNW 1LT4D 1SE2A 2HQLA 5C3EG 3CKIB 3NSWA 2MUYA 4DAYA 3K59A 4A3JH 3M3YH 5C4ZA 3HOUB 1VQHA 1VQMA 1HPCA 4LJZC 1EY5A 2MHVA 2Z1CA 4A4IA 1D1IA 3J80i 4GN3B 3HOVH 3BDCA 1A3UA 3MZ5A 1STEA 1TIID 5ELBA 1PFSA 2PCFB 1E1OA 5C3EH 1XTCD 1SE3A 1OXSC 1KTKA 2C5CA 3PCOB 2JSOA 5ELEA 4GLXA 1WVLA 2QKIC 2RDGA 5E4WC 1G91A 3FPUB 1V1PA 3ERSX 3T1HL 1ILQA 2K33A 2QEXA 2B2WC 1VQFA 4LNQA 3S1MH 3I8ZA 3HG9A 2BA1A 2F0WA 2G5DA 4A3GG 2VUMG 1DM0B 2VQEQ 4JI6Q 2B2VA 4ZKCB 3S2HH 5JOBA 2G9HD 3CF5A 1MJEA 4FDBA 2HUGA 2AKWB 3RLNA 3I4LA 4C3HB 2KQ3A 2MP1A 1VQ6A 1CHPD 3CAMA 1GXDC 2F0TA 2L4NA 3BDLA 3HKSA 4A3GH 1MHWC 4JI7L 4LFBQ 2MO1A 2BE5D 2EY1A 3M4PA 2MFIA 1A3TA 4RGOS 4IURA 4KMUC 1TWHH 1VQBA 3CCVA 3S1RB 3I4NH 3L7ZC 2I46A 1M4VA 1BUVT 1E2WA 2A6EC 2P5ZX 1DYQA 2ZXPA 1KNAA 2CFMA 3H94A 4PV1C 5C3XA 4GNXC 1SRUA 3QWNA 1BOSA 1EY4A 1O78A 4YWKA 4DAVA 2D9UA 2EXZA 2CCZA 2F0OA 2NB0A 2SNMA 3OW2A 4MTNA 2QDBA 1E2VA 1YNJC 2DNEA 3PV0A 2L15A 3QJYA 1CKNA 4K2LA 2PI2A 3URYA 1H9JA 2XRQD 4YY3Q 3RUZA 3KUPA 1B70B 4JI3Q 2B63B 3K7UC 1TY2A 3OIPA 3K81C 5KYLA 2Z4HA 3FRPB 1J6QA 3EBEA 3WOEA 3NENA 4P75A 3VDYA 2B2UA 4I65A 1EIFA 4LF6Q 1YJ9A 1MKHA 3ZJYC 3K80C 3TDQA 4RWSC 1EEFD 2KCCA 4OO1G 1XMQL 5NUCA 3PSIA 4GNXB 2EYHA 4HJAA 3LGJA 2OT2A 3C1FA 1BCPD 3H6MA 3T1YL 1NY4A 3RZDH 1U0LA 4A3MH 2WACA 2V1CC 1YI2A 4R4TA 3KLRA 5FO8B 1X9NA 4B3RQ 4RCOA 4L8JA 1BXTA 4XT3B 1RL2A 1V1QA 4BBSG 3BVMA 2UXBL 4OO1H 2RHSB 2ZM6Q 1X55A 4A3FG 5IP9G 3TP7A 5M3MG 3S15H 2K5VA 5IGGA 5E4XA 2V4DA 2JA5B 3A5ZB 2A6HD 1HRJA 1II3A 1R9TB 5KNCA 2UU9L 4EQNA 1SNDA 4LF4L 4BBSH 4G57A 1FD7D 1L1OB 1QUQB 3TRZA 4KHPQ 3NBIA 2Z8LA 3GTKB 3HZXA 4K6LA 3SK6A 1KNEA 5C4JB 1JJCB 2JA6H 3CHBD 1EZ6A 2NZOA 4B3SL 4OO1I 1TY0A 2OEOA 2OTLA 2FXQA 4C3IH 1IBKL 2ZJQA 2EPBA 1HCZA 3BVGA 4DAYB 4LF9L 1LTTD 2KEEA 1E22A 3M4OB 2B2VC 4LF7L 1XMQQ 4KY7A 2ZXRA 4A3BG 3S2DB 2L0CA 3CCJA 3FDTA 4DV3L 3J81i 1CA5A 5IYCH 4NPSA 4S3SA 3DWQA 3RN5A 4LUZA 3SXHA 4FNFA 4DAPA 4A3EH 4X3TA 1DOLA 4DR7L 3LWEA 2HDLA 3FMCA 2X6LA 5COYA 1ASYA 3D4DA 3R93A 5FOBB 5FLXc 1A2UA 5M5WB 1HTPA 3FKIH 1CZGA 4AYBG 2UXBQ 1XPRA 3J80L 4X3KA 1LACA 1Q7YC 4IJHA 4X3UA 5C44B 2F0EA 3CW2C 4IQZA 1LO5D 2WIIB 1O7IA 3MC0B 1I4HA 4EQOA 1ENCA 3MXNB 2UU9Q 4JYAL 1WD0A 4RFBA 1SFOB 1K0SA 3TQYA 5ELDA 1VQ5A 1JJGA 4PZ7A 3OMCA 3HOYH 1I4GA 4XQQA 3NHHA 4GN5A 2AWNA 1BDOA 2A5HA 3GTGB 4GLAC 1PYWD 4HJ8A 2K01A 1EWIA 2WKDA 1CKOA 1IBKQ 2YTVA 4IPHA 2B8GA 4MIUA 5IGBA 3Q22A 4BXXG 3MTSA 2B2UC 1B4OA 1JWSD 1JE4A 1HR0W 5GAHC 4DA2A 4LF7Q 3G6EA 3S9WA 5JVH3 1YJWA 1VQGA 4B3TL 1HZ9A 4DV3Q 1VQKA 4OELB 4LMQD 1S5CD 1KHIA 4OWXB 1K8OA 1P16A 1FYCA 3GTQH 1PV4A 4BXXH 1FR3A 3C3LA 4DV5L 4IALA 1IKLA 1EU3A 4ZQ3A 1CKNB 4ALPA 1AZPA 1XPUA 4PMWA 3S17H 4A3CG 2CH4A 2VS1A 1I50H 2EYOA 1SMXA 3Q6SA 5FLMH 3GV6A 1NAPA 1DGSA 4O42A 1Q46A 5LL6S 1HUMA 3DM3A 3KLWA 4V190 4X62Q 4B9XA 2EYJA 4WORA 4ILWA 1Q1BA 3HOUH 1SROA 3TBIB 4FVMA 2OTJA 4LFAQ 1PTOC 1C4QA 1SYFA 1BQQT 4HR7B 4JW0A 1QZHA 1TS3A 1VQAA 2VUMB 3VA7A 1EYDA 3G71A 4IUQA 1VQ7A 3CPFA 2JN4A 2R7ZB 4ODGA 3VR4A 4GN4B 2EE1A 1LTAD 4RKLA 2N8NA 1BBXC 1BBWA 3EIVA 2CQAA 1F2ZA 3B6YA 2QF7A 2N78A 1B53A 3EN2A 5BR8Q 4KK7A 1OO9B 3F2BA 2JEAI 3KJOA 3UE0A 1Q8IA 4YHHQ 1YZ6A 3E0EA 2Z6KA 1N34L 3I4OA 2HQEA 3AB9A 1MJCA 1WOCA 1WTWA 1Z47A 2L9HA 1N32Q 1G2TA 4ZAIA 4LFCQ 2K04A 1KAAA 1NTGA 1PTOB 2B3GA 1TU2B 2YU9B 3F8TA 4C3HH 2EOTA 4EGVA 3SEBA 1YHQA 3C2PA 5DNFA 2TMPA 5EKLA 4A93G 5CBEE 1B2TA 1V8QA 1VQPA 4DAMA 3I73A 3S1RH 2H5XA 1KQSA 2UXCL 1QCBD 1EY0A 5LMUL 3H0GH 5H1SE 5IYBH 3CCRA 3GTMB 4K0KQ 1HQRD 4X6AH 4CKEA 1NNXA 5CC4A 1ESRA 2YYZA 2K4KA 4AYBE 1QG7A 1WTXA 3KOJA 1SLJA 4L63B 2QILA 2SEBD 1WTQA 2IX0A 3J81L 1RD9D 3BYTB 3I56A 2EQSA 1FNUA 1X32A 4FP5D 1A0IA 4X3SA 2B63H 3OYYA 1EOTA 3D31A 3W2DA 2LXJA 3J7AF 3KFUA 3T16A 4KLKA 2AWOA 3DHQA 1N34Q 5C0XJ 4UP8A 1KXLA 1WTVA 3R2TA 4DV2Q 1Q86C 3A74A 1LTBD 2NVYB 3E5SA 2ZTCA 4A3FB 3NXWA 2Q2UA 3NWSA 1JB7A 5M3MB 1A8VA 1TT2A 2PPBC 3BDOA 2JA5G 4H02A 3ICEA 4APVA 3BVZA 1CI3M 1EYCA 1N33L 4X66L 2UUAL 2RSNA 5IOCA 1PH4A 1ET6A 2JE6I 3PF4A 2KCTA 1TQOA 1EIHA 2A73B 2UXCQ 2QDLA 1GUGA 4XT1B 2VQFL 2K75A 4P74A 2JA5H 2GVAA 1ZEQX 1O7YA 2B2WA 2F0PA 2FINB 3H3VC 3QOJA 4A76A 3DMUA 3DXJC 5EQ0A 1R9TH 1EUJA 1PH6A 2KBNA 3P7JA 1G6ZA 1N9WA 2R3ZA 1F9SA 1LTSD 4G7HC 3GTKH 3KF8A 2E75C 2MPMA 2R61A 2TSSA 5C4JH 1U5KA 2MQHA 4A3BB 4X65Q 3M7GA 1STYA 4N8X1 3AFPA 2O5IC 1VQEA 1SYBA 1Y8PB 1PVOA 2BDNA 2WKCA 1IXRA 4DR4Q 1K0RA 1ZXTA 2EYMA 2R92G 3J81E 4AYBB 3IFTA 1C48A 2Z6KC 1K8GA 2NVQH 3LX0A 2PZTA 1TWAB 1M1KC 1ICFB 2K5NA 2RCNA 3M4OH 1TWGB 1BKBA 2FJ2A 3ULJA 3NTKA 1GO3E 1VQJA 1WTHA 3UI2A 4V0BA 1PXUA 3ND8A 2IW3A 1ZKOA 5K5PA 1EY6A 2BDOA 4KJNA 3GP7A 1LUZA 3I4MG 1X3FA 2IT1A 3FHWA 5M5WH 3PO3H 3DLLA 2Q8IB 4DR2Q 5IT9c 4F87A 1Q81C 1NE3A 3PUYA 1D5XC 2Z0SA 2ZTDA 4QCLA 4BS9A 4ME5A 4JI1L 1LTLA 2VQFQ 5C44H 2OQ0A 1RCVD 3DWPA 2ZTEA 4RGMA 5JEAH 1BCPF 1SNQA 4DK1A 1IKMA 3MWYW 3NQIA 1HH2P 1T5XD 2NWGA 3T53B 5CV8A 3M4QA 1SFOH 4IFDG 2BCOA 1NMGA 2F3IA 2HHHL 1VF7A 2Q2HA 4EQPA 3ULLA 1AP0A 4IUNA 1IL8A 4JI6L 3QOLA 1W3SA 5C4XG 5IYDH 1PTOD 4QIWE 1F9PA 1IBLL 2E76C 1RTNA 5DM63 3OOCA 3MVVA 1QJOA 1PHJA 4QGUA 4TRDA 4ABNA 1IL2A 4YIJA 3S16B 1OXVA 1D6EC 3U9SA 1LLRD 1NUCA 4K6DA 4KN7C 1Q12A 1KDAA 4DPGA 4XQNA 1UUPA 1C8CA 2RSOA 1CM9A 1A2TA 1I3QB 5IE8A 5EJWA 3U9OA 3HOXB 4IO9A 4GKJQ 3EVQA 2EJMA 3HOZB 2F0IA 1L0YB 5KIXA 3QO2A 5GADC 1SJED 2CH4W 3ULPA 1E0BA 1X3QA 2ZJPA 3D4WA 4IFDI 4JI1Q 4K5VA 1VMPA 4OWWB 4DV6L 1Q8KA 2KHJA 4K14A 4J1MA 4YY3L 4JI3L 1PFMA 3R2IA 5CYUA 4B08A 1L2FA 1YHBA 2NVTB 4KKUA 2HHHQ 1X65A 1JQYD 4LF6L 1LYLA 2F0UA 3TP8A 2AMCB 2LSSA 3UDIA 5L37A 2R7ZG 1DOMA 1IBLQ 3LWUA 3STBC 1XNRQ 1IYJB 4L5QA 2N55A 4QF4A 2RDHA 4BWGB 3TS0A 4R8IA 2NTSA 4MTKA 5JJLA 1Y8OB 1X6OA 4TKOB 1TVXA 2VUMH 4B3RL 5CORA 1GUSA 1LT3D 2KHIA 4IFDJ 1PH7A 1Q90A 5FO7B 5M9OA 4U68A 4IUTA 4R8NA 4MZ9A 2ZM6L 1HQMC 1STHA 4C2MB 4A3LG 2D5DA 1U9RA 3BJUA 4QIWB 1B8AA 3Q24A 3L2PA 4RGNA 4A93B 1HJPA 1JB3A 5EBCA 1QNKA 2EZVA 3MEHA 4LF5Q 3OWFA 3EJIA 3KF8B 4HSPA 4RHSA 5J22A 1PFBA 1OXTA 3A54A 4H7BA 5M5XB 3FEWX 2K50A 3P75A 1A15A 4KHPL 2YU9H 1J9OA 2I5LX 4DV6Q 3GQBA 3HS0C 1CA6A 4AQYQ 4YCUA 2FMMA 1Y1WB 3RMHA 1LTGD 2EYLA 2F0KA 2K5QA 3D6CA 3FVQA 2D0OA 1SJHD 2CVRA 3A7LA 1E2ZA 1CFMA 4IPCA 4M1UB 4JI2Q 3RLFA 3K5NA 1Y8NB 3K0YA 5BN5A 1NCVA 3CD6A 1L0WA 5JAVA 1JORA 5F2DA 1H9KA 3GD7A 3GTMH 3M9BA 1RDPD 1X56A 4R4IA 1CSQA 5FKAC 1CUKA 1VQ8A 1J8IA 3D0FA 4JVZA 4CKCA 1ZYRC 4ZUIA 1I4QA 4G7ZC 1HNZL 4PQXA 1SAPA 4O2DA 2UXDQ 1W2BA 2J0TD 3JAMc 2MNAA 2E2HB 1PZKD 2DGYA 1KABA 1KRTA 3UDXA 1H95A 4XTCS 3M85A 4H0LC 5KEEA 1PFNA 1MD2D 4DXFA 4AIMA 1DJRD 4O0AA 5DEHA 3VR2A 1YNNC 2ID0A 3OTOL 5IGEA 2QCPX 2NVYH 2M9VA 2SDFA 5IP9H 4A3FH 3TP5A 3K7AB 5M3MH 2J4XA 1STNA 4Z9CB 1V43A 4DR6Q 3VYUA 2E5LQ 2NN6G 4KTAA 1LTID 5FO9B 1VQLA 1JWUD 2XN9C 3T13A 1HUNA 5EPJA 2N3SA 2DJFC 2GA4B 1JMCA 2CWPA 1WCMB 1SSOA 3PUXA 4YCWA 4FO2A 4J8QA 2F0NA 2EVBA 2PI2E 2MJ8A 1D7QA 4RHRA 3PO2B 2I5HA 4POGA 2NN6H 1N36Q 1JOKA 1GUOA 2C9OA 3TEHB 1S5ED 3VR5A 2H4OA 4OHJA 4F7XA 5I9OA 1X3GA 2R92B 1SN8A 2DY7A 3CCLA 2I5MX 5E1FA 3J80c 1HNZQ 5HGTA 2EXDA 4WFN3 1VCIA 1JWMD 1DD2A 3HGBA 1MBYA 4A3BH 1V1PB 1DCZA 1BO0A 2PW7A 4QL5A 2KCNA 3I4MB 2B2TA 3GTLH 3LNNA 1QNUA 2DY8A 1HFNA 2E8GA 1SNOA 2PMZE 3TSSA 4KD4A 2NN6I 1KRSA 1UE7A 1S4ZA 2VL6A 3OTOQ 3IAYA 3QIAA 3CCEA 4PMCA 4RMFA 1LV9A 1EQTA 4DV0Q 1TWAH 4X62L 3FPPA 2FMCA 2BA0A 5HURA 3H15A 1C7YA 1TWGH 5FLXL 3PIP3 2GVBA 1X54A 2F0FA 3GTJB 1W6JA 4IZ8A 5IGDA 4LFAL 1AFPA 1YIJA 4LW1A 2HT1A 3RZOH 2K03A 1O7ZA 1B3QA 1V1OA 2R93G 1PH1A 1SE4A 5GAEC 2FFKB 1VS0A 5C4XB 3ERQA 4ZRZA 4KY6A 5KYIA 2Q8TA 2SNSA 2RA4A 2CW0C 1D5ZC 1PMRA 3AFQA 3CC2A 4QMGA 4WJ3M 1AE2A 1WFQA 3KJPA 3UDFA 4Y52H 1HZAA 1UWVA 5BR8L 1Q3LA 3NELA 2HCCA 2XVSA 3H3VI 1EFWA 3Q0AA 1SMYC 4DU9A 4YHHL 3STBD 1A6XA 2EIFA 1N32L 4LFCL 2QW7A 3ND9A 2D62A 3PF5A 4MHEA 3PIPA 3S14B 3KLSA 2H1EA 5J3BA 2F0HA 3S16H 4ZKBB 3HOXG 3F2DA 3CXCA 1JT8A 4P2CB 3HOZG 1KD1C 3OWEB 4BY7G 3G48A 2A6ED 3HKZG 2F0VA 4LWCA 5ELOA 4NB3A 4A3CH 4HIOA 1PYSB 1J5EQ 4B3MQ 2YV5A 1B9NA 4HSVA 4DNTB 3CC7A 4DUYL 2IY5B 4UPAA 3TREA 4QJFA 4JV5L 2A19A 1I3QH 3VYRA 3KBXA 4JBMA 2PQEA 1PRTC 4K0KL 4C1NI 4Y7NB 4HCSA 5J1ZA 4P73A 1QE6A 4DV7L 4G4KA 5C3WA 5C0XG 1YNJD 1JICA 2K32A 1MIUA 4IOCA 1PH9A 1QILA 2PMZB 4R4QA 2F52A 5CV6A 1PYBA 1RHPA 5FLXE 2EY6A 1SNPA 1G291 2AQ3B 4N8FA 1EQQA 4NMZA 1IZ6A 1X3PA 3PGZA 2DJGC 5I4DA 4DUZQ 3A8KE 2L11A 4L6TB 5C0XH 3E9IA 1I4PA 1HZBA 4XXEA 4OEMB 2Q2TA 3T51B 2A8VA 3J7A5 3VR3A 5M3FB 4IUPA 1ET9A 4KY5A 5LMNQ 1XMOQ 1ENFA 4DV2L 1IBMQ 4HJ9A 2C35B 1AW7A 1PRTB 2X69A 2F3WA 3K6OA 4CDFC 1VQNA 1UEAB 3CU7A 1EWHA 2B2TC 1AE3A 3K5LA 3NTIA 2ZXOA 1YHAA 4XYOA 1C9OA 3GDEA 1STGA 1TS5A 4BBRG 4DR5Q 5C0XI 3KLSX 2IHFA 1S5BD 3JC66 2QA4A 1HA5A 1PTOF 4C1NK 3E0JA 1G51A 4DUYQ 4C2MH 1GUWA 2KOLA 4JV5Q 3F1ZA 5D3IB 3RR5A 4IJLA 4DN4M 4CDEC 5TSSA 5E3FA 1GOZA 2D0PA 1Y1WG 4KN4C 4A93H 4DV7Q 4FF2A 5LHY1 1B9MA 2EDGA 3AMUA 2XGTA 5JPMC 2B2YA 5K36G 5GQOA 2IX1A 1EY7A 3E3XA 5KNDA 1P8LA 4GS3A 3H91A 2VZAA 2ZJRA 4JCVE 5M5XH 4KD3A 4CGYB 1HNWL 5JPNC 1PLFA 4KKSA 2PQAA 1Y1WH 2MGSA 4X65L 2Y0SG 2EY2A 3NP8A 5EKKA 1Y1VB 3V05A 4Q0FA 3TMEA 2VNUD 4J6HA 5K36H 1B44D 1Q82C 1EYAA 5IP7G 3EFXD 1E1TA 4DR4L 1K83B 3MXGA 1AH9A 3D6WA 3I7FA 2HCIA 2HIVA 2K1BA 2PZWA 2OXPA 3P20A 4FF1A 5CR3A 2VB3X 3M7NA 3A56A 2O2LD 5C5LA 5A35A 2BH2A 1JE5A 3NK9A 2EJFC 5KNBA 1ONLA 4DV1Q 3MFGA 3TZUA 4JBWA 2JA7G 4EX5A 4DR2L 1SE8A 1M8AA 2F0JA 2E2HH 3OHXC 1SR3A 4R9WA 3A0JA 3L3OC 1FGUA 4R4CA 4LAAA 4U673 4HIDA 3KK7A 4FXDA 1WCMG 4DFAA 4PZ8A 4ZCKA 1D1KA 4JI0Q 1LM0A 3NBHA 3HOWB 3K7AH 1HNWQ 2F0MA 1QVGA 1K9MC 1SNMA 4PZ6A 2CHBD 3W1BA 3PO2G 5G3LD 4OXPA 4A3KG 1CT1D 1H9RA 1SXTA 2UUBQ 2A74C 1E24A 1JCKB 1ILPA 3RD4A 4KHZA 4IPDA 1PH2A 5A2QL 3DEPA 3HKZE 1SYCA 5DAUA 1IYUA 2K05A 2JEBI 2CW0D 4ULLA 5D65A 4L5TA 2RDFA 1M90C 1EQVA 2A68C 5CV7A 4H44C 4QB4A 3D8GA 1TS4A 3I3CA 3OPOA 1NJIC 4IUVA 2O5JC 1GUNA 1PH8A 3QG1A 3TS2A 1SMYD 1FL0A 1ML0D 1XYIA 3S2DH 1HA6A 2EYFA 5EGTA 4CHTB 4JI4Q 4XIGS 2JK8A 4GKJL 1SYEA 4HAEA 1K3BC 2R92H 2QGQA 4UAIA 4OX9Q 2A6HC 3CCSA 3BZKA 1NMFA 1MGSA 2F0GA 3SHLA 1E3PA 2VY3A 2CKZB 4ME3A 2XRSD 4IOAA 2UUCL 3I4MH 4JC0A 2K5HA 2N88A 2Z4IA 1F9QA 5LL6X 2R93B 1R4PB 2R7FA 4LK1C 2OWOA 3JAMi 2LXKA 3GTOB 2B2YC 4WJ4A 3NE5B 2KJXA 4QUCA 1PDQA 2BH8A 3O13A 5IT9L 1PRTD 4CJ2C 5HGQA 4X64L 1A3VA 4KI0A 1XX8A 1TWCB 3GTGH 1AEXA 4ZK9B 1XNRL 4EQ5A 5E7NA 4JI5Q 2XNAC 5ELCA 3I2ZA 4RAUC 1EWCA 4KJOA 4IFDH 1VQDA 2O4XA 3SVMA 3CPWA 3DM1A 5C4XH 1G2SA 4A3DB 5IWAL 4DK6C 4PMBA 3SK4A 3CMAA 4Q5VA 1B1ZA 2NZ1D 2NTTA 4A3JG 4BY1B 1LTRD 5FK9C 2JJQA 3J81j 1Y69U 1I94Q 5A2QE 4RH6A 3EQLC 1I5FA 1JOQA 2JYOA 3NWTA 3PIO3 2E2JB 5EPLA 2AHOB 3I70A 4BY7B 3HOVG 5KRUA 4LF5L 3HKZB 4HN7A 1EIGA 4MN3A 2WAQG 5T1GA 2OQKA 3AQQA 2Y0SE 3CCQA 1HTLD 2PQAB 3KDFA 1I4XA 2UUCQ 4FF3A 4AQYL 1QWYA 3S14H 4CJ0B 3S1QB 4MNOA 4KHVA 1D8LA 1GVPA 2NVXB 1GHKA 4O1NA 3CMEA 5IY0A 4GOPA 1DZ1A 2I0QA 1HXYD 1WTOA 4JI2L 1XNQL 1HR0Q 4X64Q 4QY7A 1DOKA 3X3MA 1YITA 2AUKA 3BZCA 1UE1A 1LT5D 2RHQB 4Y7NH 2HDMA 4OL7A 4NXNQ 5JEAJ 4ZUJA 3K0XA 4UP7A 3MXNA 3PIOA 3SGIA 1JOOA 5BN3A 1VQOA 1F77A 5IT9E 5IWAQ 2R7ZH 4K8JA 5M3FG 3V2TA 2ATWA 3HFZB 2UXDL 4HIKA 3TP6A 1SNCA 3TN2A 3I4NG 2VB2X 1STBA 1GD7A 3F2UA 5JJKA 4DKAC 2KVMA 3S1NB 3NBHB 3VA5A 3K57A 4BBRB 3AEVA 2FHTA 5M3FH 1CTMA 4DXGA 4BA2I 3FP9A 2L12A 4A3LH 1PTOH 4RKBA 3SE0A 4AH6A 3QR8A 1JJ2A 1WI5A 1I6VC 1TR5A 3E6ZX 1CSPA 4DR6L 3H0GB 2E5LL 5JVG3 3N6RA 4HEDA 5CMDA 2NZHA 3I91A 2JQOA 1RTOA 4OIJA 4XQJA 3I90A 1S5DD 4DR1L 1XNQQ 1KL9A 4CKBA 1Y14B 3KBGA 1S5FD 1O7LA 1N36L 4WRDA 2Y0SB 3DWAA 4NDXA 3T1HQ 4KV6A 1VDZA 1XTDA 4NW2A 1Y1VG 5EPKA 2EY5A 3UE1A 4A3MG 5JJZA 3T56B 5I6WA 1Z7TA 2IHEA 3H09A 1FJGL 2JA9A 2WINB 2YTXA 1L1OC 4CDCC 2WB1E 3BU2A 3KYHC 1EYGA 1B7YB 3D3RA 1B50A 2I07B 1Y1VH 5D14A 1AZQA 4HTHA 3RLOA 2AQ1B 4JI7Q 2A68D 2JA7B 1K83H 4I7ZC 2A69C 3PUVA 1T9HA 1JC7A 4A3IB 2WP8J 1D5MC 2RCFA 4DV0L 1Z9FA 1LT6D 5FJ8G 4DV4L 4LF8L 2XWBB 2ENBA 1TXYA 1IW7C 5AFWA 4CJ1B 3JAML 1F2MA 1SYGA 2JA6G 1BVSA 2NYZD 1U4RA 3MEFA 4HMIA 1VQ9A 1QB5D 1ICWA 4OGQC 5FJ8H 1NR2A 4C3IG 4F8MA 1UNSA 4DR1Q 1SDFA 4GOPC 2F4IA 3HOWG 2LKVA 2N49A 3CC4A 1N8RC 5GROA 4A3KB 2KHSA 1VQIA 3U4VA 2NUCA 1NBWA 4K5XA 1VQCA 3E9HA 3F2CA 3A55A 2WAQE 5IYCG 1FNVA 4A3EG 2DUDA 3W5OA 3HOWH 2AUJD 4CBVA 2IWHA 1FJGQ 2E2IB 2NVQB 1SBBB 3KDFB 3MHBA 3FKIG 4R4OA 4K8IA 1U4PA 1KAWA 4B9WA 3G4SA 2JA8B 1G6PA 3K8AA 1I6HB 2B8FA 1FNWA 2EYPA 1I4RA 4QUFA 3T1YQ 4HMJA 4JOIA 1TKWB 4R1JA 1G8ZD 5I2YA 3BG3A 2Q2IA 4GOPB 1ESFA 2F0QA 3OSOA 4PG3A 3AYHB 1EU4A 2ASBA 1OTCA 3PO3B 3NTHA 2B39A 1XWEA 4DV4Q 3P1HA 4LF8Q 1CHQD 3HOYG 1S40A 1CQFA 1J5EL 3H3VH 4B3ML 4RCNA 3R8BA 3BYYB 3ITPA 1K73C 2WB1B 5I9PA 2F0SA 1U4MA 1MSGA 2IJ0A 2K52A 2IX3A 4LF4Q 5I6YA 1O80A 2IL8A 1H9MA 3HRZC 5M5YB 1STAA 4JG2A 4C3JB 5CBAE 4PNYA 4XYQA 3JAME 3CQZB 4DUZL 3A8JE 2XIWA 2VW9A 1L0XB 4B3SQ 1KDCA 3X3NA 3NQTA 2R93H
chains in the Genus database with same CATH topology
2F0LA 3VYTA 3GTPB 5CV4A 1TWFB 2K28A 4N9TA 4RA8A 2E2DC 2L55A 4JK1C 1B3AA 4OIKA 4A3JB 3M3YB 3IFDA 2RVLA 1KDBA 1JR0D 1PZJD 1EEID 2RQXA 4FXKC 2XWJB 4FXGC 5BN4A 1NSNS 3VR6A 3K58A 4NP5A 3HOVB 3I72A 5C3EB 2WAQB 1Z6HA 3OW7A 1EZ8A 1VF5C 3DUZA 2PO4A 5G3LF 3EROA 3OMGA 1MSHA 1UAPA 2Q8RE 2AQ2B 1TS2A 3S1MB 3K5MA 2DN8A 3G7LA 3J80E 3J7AV 5KGUA 2D2CC 2LY7A 3S2HB 5EBDA 2PZUA 1F2LA 2X6GA 3EA6A 1F9RA 3IKJA 4A3GB 5IGFA 2EJGC 3DEOA 5IODA 2G9DA 3MXUA 3AU7A 1TWHB 3I4NB 2K7VA 4DNRB 3QB3A 3N52A 1F2YA 1CQVA 1VMCA 3SDZA 4C3HG 3MAQA 1ZYRD 1T5EA 3SK8A 3MA2B 4ID6A 2LFNA 3NUCA 2VXWA 4HCEA 2PNRC 1D2BA 3J7YW 3MXPA 5ISRA 1PRTF 3C1EA 1EFID 3ONAB 4H13C 5DM73 2F03A 1ENAA 1MI2A 2A69D 4FF4A 1YNND 3GV3A 1LABA 3A8IE 2K5WA 1K8MA 1EL0A 1BR9A 4E6IA 4ZYSA 2J7ZA 3CRKC 1IW7D 4TSSA 3W3AA 1H9SA 2K6AA 5I2XA 4KKTA 5ELFA 2ICEC 2KECA 3RZDB 4UDUC 2M2LA 2K5DA 4IUUA 4A3MB 5T1IA 4N9PA 2KA7A 4DK0A 4NKLA 3V96A 4DF7A 3PUZA 3S15B 2BE5C 1RF2D 1RODA 1HFGA 2PW5A 1OXUA 3BS1A 2NBFA 2L5TA 2M00A 3WOFA 4BBSB 1EY9A 1CZWA 1IHZA 3IL8A 5J39A 5IGCA 4K5WA 3Q23A 2JP1A 3ZYYX 2JA6B 2LMCB 1OXXK 2KEDA 3MFYA 1SEBD 4RGTA 4C3IB 2QEJC 3HEJA 5IIFA 3NPPA 2OF1A 2IPKD 2PYKA 3BZDB 5C6AA 1XXGA 2LS01 5C4HA 5CV5A 4ZLTF 4F88A 5D3DA 4A3EB 4XDXA 1CK1A 1RJTA 1BCPC 1U4LA 1BF4A 3FKIB 1GUTA 4DGZA 2XSCA 3A7AB 1W6KA 1AN8A 4G7OC 2JXMB 1EY8A 3GTLB 3VYSA 1GHJA 3WDNA 1IYVA 1QOHA 2KUMA 3R3OA 5CV9A 4GZYC 1Q1EA 3D4RA 4BA1I 1KLGD 1FGBD 3HOYB 1DXMA 5EKIA 1HHVA 2RBMA 1GJXA 2F3VA 3GO5A 2RKSA 1BCPB 5JEAG 3RZOB 1BNZA 1DONA 3OIQA 3T4AC 1R4QB 1WTRA 2BOSA 1WTPA 1RKNA 3SK5A 3SR1A 4M8AA 4WJWA 2ICIA 1NR4A 2E74C 3CRLC 1KLUD 2SOBA 4C3JG 3C46A 1WD1A 2WV6D 2DNCA 2F1MA 3HP3A 3M4YA 2R6GA 3GTQB 5C5MA 3TZDA 4IN3A 4EVOA 3L9AX 2F0DA 1SYDA 2ZT9C 4K2KA 3S17B 4FYDA 2L1BA 3PUWA 5CGKA 1I50B 4TQUS 3K5OA 3PMFA 1H9SB 1PZID 4C56C 3G6JB 1LT4D 1SE2A 3CKIB 3NSWA 2MUYA 4DAYA 3K59A 5C4ZA 3HOUB 1HPCA 4LJZC 1EY5A 2MHVA 2Z1CA 1D1IA 3BDCA 1A3UA 3MZ5A 1STEA 1TIID 5ELBA 2PCFB 1XTCD 1SE3A 1OXSC 1KTKA 2C5CA 2JSOA 5ELEA 1WVLA 2QKIC 2RDGA 5E4WC 1G91A 3FPUB 1V1PA 1ILQA 2K33A 2B2WC 3I8ZA 3HG9A 2BA1A 2F0WA 1DM0B 2B2VA 4ZKCB 5JOBA 2G9HD 2HUGA 3I4LA 4C3HB 2KQ3A 2MP1A 1CHPD 1GXDC 2F0TA 2L4NA 3BDLA 2BE5D 2EY1A 4RGOS 1A3TA 4IURA 4KMUC 3S1RB 3L7ZC 2I46A 1M4VA 1BUVT 1E2WA 2A6EC 1DYQA 2ZXPA 1KNAA 3H94A 4PV1C 5C3XA 3QWNA 1BOSA 1EY4A 1O78A 4DAVA 2D9UA 2EXZA 2F0OA 2NB0A 2SNMA 2QDBA 1E2VA 1YNJC 2DNEA 3PV0A 3QJYA 4K2LA 3URYA 1H9JA 2XRQD 3RUZA 3KUPA 2B63B 1TY2A 3OIPA 5KYLA 2Z4HA 3FRPB 3WOEA 2B2UA 4I65A 3TDQA 4RWSC 1EEFD 2KCCA 4OO1G 5NUCA 2EYHA 2OT2A 3C1FA 1BCPD 3H6MA 2WACA 3KLRA 5FO8B 4RCOA 4L8JA 1BXTA 4XT3B 3BVMA 4OO1H 3TP7A 5IGGA 5E4XA 2V4DA 2JA5B 2A6HD 1HRJA 1II3A 1R9TB 5KNCA 4EQNA 1SNDA 4G57A 1FD7D 3NBIA 2Z8LA 3GTKB 3HZXA 4K6LA 3SK6A 1KNEA 5C4JB 3CHBD 1EZ6A 4OO1I 1TY0A 2OEOA 2EPBA 1HCZA 3BVGA 1LTTD 2KEEA 3M4OB 2B2VC 4KY7A 2ZXRA 3S2DB 2L0CA 3FDTA 1CA5A 4S3SA 3DWQA 3SXHA 4DAPA 4FNFA 4X3TA 1DOLA 3LWEA 2HDLA 3FMCA 2X6LA 5COYA 3D4DA 3R93A 5FOBB 5M5WB 1A2UA 1HTPA 1CZGA 3J80L 4X3KA 1LACA 4X3UA 5C44B 2F0EA 4IQZA 1LO5D 2WIIB 3MC0B 1I4HA 4EQOA 1ENCA 1WD0A 4RFBA 1SFOB 5ELDA 3OMCA 1I4GA 4XQQA 3NHHA 2AWNA 1BDOA 2A5HA 3GTGB 1PYWD 2K01A 2WKDA 2B8GA 4MIUA 5IGBA 3Q22A 3MTSA 2B2UC 1B4OA 1JWSD 1JE4A 4DA2A 3S9WA 5JVH3 4LMQD 1S5CD 1K8OA 1FYCA 1FR3A 3C3LA 4IALA 1IKLA 1EU3A 4ZQ3A 1AZPA 4PMWA 2EYOA 3Q6SA 3GV6A 1NAPA 4O42A 5LL6S 1HUMA 4V190 4B9XA 2EYJA 4WORA 4ILWA 1Q1BA 3TBIB 4FVMA 1PTOC 1C4QA 1SYFA 1BQQT 4HR7B 1TS3A 2VUMB 3VA7A 1EYDA 4IUQA 2R7ZB 4ODGA 3VR4A 2EE1A 1LTAD 4RKLA 1BBXC 2CQAA 1F2ZA 2QF7A 1B53A 4KK7A 1OO9B 2JEAI 1Q8IA 2HQEA 3AB9A 1WTWA 1Z47A 2L9HA 1G2TA 4ZAIA 2K04A 1KAAA 1PTOB 1TU2B 2YU9B 2EOTA 4EGVA 3SEBA 3C2PA 5DNFA 2TMPA 5EKLA 5CBEE 1B2TA 1V8QA 3I73A 1QCBD 1EY0A 3GTMB 1HQRD 4CKEA 5CC4A 1ESRA 2YYZA 1QG7A 1WTXA 4L63B 2QILA 2SEBD 1WTQA 2IX0A 3J81L 1RD9D 3BYTB 1FNUA 1X32A 4FP5D 4X3SA 1EOTA 3D31A 3W2DA 3J7AF 3T16A 2AWOA 3DHQA 5C0XJ 1WTVA 3R2TA 1LTBD 2NVYB 3E5SA 4A3FB 3NXWA 3NWSA 5M3MB 1TT2A 2PPBC 3BDOA 3BVZA 1CI3M 1EYCA 2RSNA 5IOCA 1ET6A 2JE6I 1TQOA 1EIHA 2A73B 1GUGA 4XT1B 1ZEQX 1O7YA 2B2WA 2F0PA 2FINB 3H3VC 3QOJA 3DMUA 3DXJC 5EQ0A 3P7JA 1G6ZA 2R3ZA 1F9SA 1LTSD 4G7HC 3KF8A 2E75C 2MPMA 2R61A 2TSSA 4A3BB 3M7GA 1STYA 2O5IC 1SYBA 1Y8PB 2BDNA 2WKCA 1ZXTA 2EYMA 3J81E 4AYBB 3IFTA 1C48A 3LX0A 2PZTA 1TWAB 1TWGB 2FJ2A 3NTKA 3UI2A 4V0BA 1PXUA 2IW3A 5K5PA 3ND8A 1ZKOA 1EY6A 2BDOA 4KJNA 3GP7A 2IT1A 2Q8IB 4F87A 3PUYA 1D5XC 4QCLA 4BS9A 4ME5A 1RCVD 3DWPA 4RGMA 5JEAH 1BCPF 1SNQA 4DK1A 1IKMA 3MWYW 3NQIA 1T5XD 2NWGA 3T53B 5CV8A 4IFDG 2BCOA 1VF7A 4EQPA 1AP0A 4IUNA 1IL8A 3QOLA 1PTOD 1F9PA 2E76C 1RTNA 5DM63 3OOCA 3MVVA 1QJOA 4TRDA 4ABNA 4YIJA 3S16B 1OXVA 1D6EC 3U9SA 1LLRD 1NUCA 4K6DA 4KN7C 1Q12A 1KDAA 4XQNA 1UUPA 1C8CA 2RSOA 1CM9A 1A2TA 1I3QB 5EJWA 3U9OA 3HOXB 3EVQA 2EJMA 3HOZB 2F0IA 1L0YB 5KIXA 3QO2A 1SJED 1E0BA 1X3QA 3D4WA 4IFDI 4K5VA 1VMPA 4K14A 4J1MA 1PFMA 3R2IA 5CYUA 4B08A 2NVTB 4KKUA 1JQYD 2F0UA 3TP8A 1DOMA 3LWUA 2N55A 4QF4A 2RDHA 4BWGB 4R8IA 2NTSA 1Y8OB 4TKOB 1TVXA 5CORA 1GUSA 1LT3D 4IFDJ 1Q90A 5FO7B 5M9OA 4U68A 4IUTA 4R8NA 1HQMC 1STHA 4C2MB 2D5DA 1U9RA 4QIWB 3Q24A 4RGNA 4A93B 1JB3A 5EBCA 1QNKA 2EZVA 3MEHA 3OWFA 3EJIA 4HSPA 4RHSA 5J22A 1PFBA 1OXTA 3A54A 4H7BA 5M5XB 3FEWX 3P75A 1A15A 1J9OA 3GQBA 3HS0C 1CA6A 2FMMA 1Y1WB 3RMHA 1LTGD 2EYLA 2F0KA 2K5QA 3D6CA 3FVQA 1SJHD 2CVRA 3A7LA 1E2ZA 1CFMA 4M1UB 3RLFA 3K5NA 1Y8NB 3K0YA 5BN5A 1NCVA 5JAVA 1JORA 5F2DA 1H9KA 3GD7A 1RDPD 5FKAC 1J8IA 4CKCA 1ZYRC 4ZUIA 1I4QA 4G7ZC 4PQXA 1SAPA 2J0TD 2E2HB 1PZKD 1KABA 4XTCS 3M85A 4H0LC 5KEEA 1PFNA 1MD2D 4DXFA 1DJRD 5DEHA 3VR2A 1YNNC 2ID0A 5IGEA 2QCPX 2M9VA 2SDFA 3TP5A 3K7AB 2J4XA 1STNA 4Z9CB 1V43A 3VYUA 2NN6G 4KTAA 1LTID 5FO9B 1JWUD 2XN9C 3T13A 1HUNA 5EPJA 2GA4B 1WCMB 1SSOA 3PUXA 4FO2A 4J8QA 2F0NA 2EVBA 2MJ8A 4RHRA 3PO2B 2NN6H 1JOKA 1GUOA 2C9OA 1S5ED 3VR5A 2H4OA 4OHJA 4F7XA 5I9OA 2R92B 2DY7A 5E1FA 5HGTA 4WFN3 1VCIA 1JWMD 1DD2A 3HGBA 1MBYA 1V1PB 1DCZA 1BO0A 2PW7A 2KCNA 3I4MB 2B2TA 3LNNA 1QNUA 2DY8A 1HFNA 1SNOA 3TSSA 4KD4A 2NN6I 1S4ZA 3IAYA 3QIAA 4PMCA 1LV9A 1EQTA 3FPPA 2FMCA 2BA0A 5HURA 5FLXL 3PIP3 2F0FA 3GTJB 1W6JA 4IZ8A 5IGDA 1AFPA 2K03A 1O7ZA 1V1OA 1SE4A 2FFKB 5C4XB 3ERQA 4ZRZA 4KY6A 5KYIA 2Q8TA 2SNSA 2RA4A 2CW0C 1D5ZC 1PMRA 4QMGA 1Q3LA 2HCCA 2XVSA 3Q0AA 1SMYC 4DU9A 1A6XA 3ND9A 2D62A 4MHEA 3S14B 3KLSA 2H1EA 2F0HA 4ZKBB 4P2CB 3OWEB 2A6ED 2F0VA 1B9NA 4HSVA 4DNTB 3VYRA 3KBXA 2PQEA 1PRTC 4C1NI 4Y7NB 4HCSA 5J1ZA 1QE6A 5C3WA 4G4KA 5C0XG 1YNJD 1JICA 2K32A 1QILA 2PMZB 5CV6A 1RHPA 5FLXE 2EY6A 1SNPA 1G291 2AQ3B 4NMZA 1X3PA 5I4DA 3A8KE 2L11A 4L6TB 5C0XH 1I4PA 4XXEA 3T51B 3VR3A 5M3FB 4IUPA 1ET9A 4KY5A 1ENFA 1AW7A 1PRTB 2X69A 2F3WA 3K6OA 1UEAB 3CU7A 1EWHA 2B2TC 3K5LA 3NTIA 2ZXOA 4XYOA 1STGA 1TS5A 5C0XI 3KLSX 1S5BD 1HA5A 1PTOF 4C1NK 3E0JA 1GUWA 2KOLA 5D3IB 4DN4M 5TSSA 5E3FA 1GOZA 4KN4C 4FF2A 5LHY1 1B9MA 2EDGA 3AMUA 5JPMC 2B2YA 5K36G 2IX1A 1EY7A 5KNDA 3H91A 4KD3A 4CGYB 5JPNC 1PLFA 4KKSA 2MGSA 3NP8A 2EY2A 5EKKA 1Y1VB 3V05A 4Q0FA 3TMEA 2VNUD 4J6HA 5K36H 1B44D 1EYAA 3EFXD 1K83B 3MXGA 3D6WA 2HCIA 2K1BA 2PZWA 2OXPA 3P20A 4FF1A 5CR3A 2VB3X 3M7NA 3A56A 2O2LD 5C5LA 5A35A 3NK9A 2EJFC 5KNBA 1ONLA 3MFGA 3TZUA 4JBWA 1M8AA 2F0JA 3OHXC 4R9WA 3L3OC 4LAAA 4U673 3KK7A 4FXDA 4DFAA 1D1KA 3NBHA 3HOWB 2F0MA 1SNMA 2CHBD 5G3LD 1CT1D 1H9RA 1SXTA 2A74C 1JCKB 1ILPA 3RD4A 4KHZA 5A2QL 3DEPA 1SYCA 5DAUA 1IYUA 2K05A 2JEBI 2CW0D 4ULLA 5D65A 2RDFA 1EQVA 2A68C 5CV7A 4H44C 4QB4A 3D8GA 1TS4A 3I3CA 3OPOA 4IUVA 2O5JC 1GUNA 3QG1A 1SMYD 1ML0D 1XYIA 1HA6A 2EYFA 5EGTA 4CHTB 4XIGS 1SYEA 4HAEA 4UAIA 2A6HC 1MGSA 2F0GA 3SHLA 2XRSD 2N88A 2Z4IA 1F9QA 5LL6X 2R93B 1R4PB 4LK1C 3GTOB 2B2YC 3NE5B 2KJXA 4QUCA 1PDQA 3O13A 5IT9L 1PRTD 4CJ2C 1A3VA 4KI0A 1XX8A 1TWCB 1AEXA 4ZK9B 2XNAC 5ELCA 4RAUC 1EWCA 4KJOA 4IFDH 2O4XA 3SVMA 3DM1A 1G2SA 4A3DB 4PMBA 3SK4A 4Q5VA 1B1ZA 2NZ1D 2NTTA 4BY1B 1LTRD 5FK9C 1Y69U 5A2QE 4RH6A 3EQLC 1JOQA 2JYOA 3NWTA 3PIO3 2E2JB 5EPLA 3I70A 4BY7B 5KRUA 3HKZB 4HN7A 1EIGA 4MN3A 5T1GA 1HTLD 1I4XA 4FF3A 1QWYA 4CJ0B 3S1QB 4KHVA 2NVXB 1GHKA 4O1NA 1DZ1A 1HXYD 1WTOA 1DOKA 3X3MA 2AUKA 1LT5D 2HDMA 4OL7A 5JEAJ 4ZUJA 3MXNA 1JOOA 5BN3A 1F77A 5IT9E 4K8JA 3V2TA 3TP6A 1SNCA 3TN2A 2VB2X 1STBA 3F2UA 2KVMA 3S1NB 3K57A 3VA5A 4BBRB 2FHTA 1CTMA 4DXGA 4BA2I 2L12A 1PTOH 4RKBA 3SE0A 1I6VC 1TR5A 3E6ZX 3H0GB 5JVG3 3N6RA 4HEDA 5CMDA 3I91A 1RTOA 4OIJA 4XQJA 3I90A 1S5DD 4CKBA 3KBGA 1S5FD 1O7LA 4WRDA 2Y0SB 3DWAA 4NDXA 4KV6A 1VDZA 4NW2A 5EPKA 2EY5A 5JJZA 3T56B 5I6WA 1Z7TA 3H09A 2WINB 3D3RA 1B50A 2I07B 5D14A 1AZQA 4HTHA 2AQ1B 2A68D 2JA7B 4I7ZC 2A69C 3PUVA 1JC7A 4A3IB 2WP8J 1D5MC 1LT6D 2XWBB 2ENBA 1IW7C 5AFWA 4CJ1B 3JAML 1F2MA 1SYGA 2NYZD 1U4RA 4HMIA 1QB5D 1ICWA 4OGQC 1NR2A 4C3IG 4F8MA 1UNSA 1SDFA 2F4IA 2LKVA 4A3KB 2KHSA 2NUCA 4K5XA 3A55A 1FNVA 2AUJD 4CBVA 2IWHA 2E2IB 2NVQB 1SBBB 3MHBA 4K8IA 1U4PA 4B9WA 2JA8B 1I6HB 2B8FA 1FNWA 2EYPA 1I4RA 4QUFA 4HMJA 1TKWB 1G8ZD 5I2YA 3BG3A 1ESFA 2F0QA 3OSOA 1EU4A 3PO3B 3NTHA 2B39A 1XWEA 3P1HA 1CHQD 1CQFA 4RCNA 3R8BA 3BYYB 3ITPA 2WB1B 5I9PA 2F0SA 1U4MA 1MSGA 2IJ0A 2IX3A 5I6YA 1O80A 2IL8A 1H9MA 3HRZC 5M5YB 1STAA 4C3JB 5CBAE 4PNYA 4XYQA 3JAME 3CQZB 3A8JE 2XIWA 1L0XB 1KDCA 3X3NA 3NQTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HPC A;  4LJZ C;  2A6E D;  4H13 C;  1CI3 M;  3VR4 A;  3VR5 A;  2E76 C;  5K36 H;  1IW7 C;  2A69 D;  3OOC A;  1QJO A;  1GUT A;  1LAB A;  1OXT A;  3A8I E;  2KCC A;  4OO1 G;  1B9N A;  1K8M A;  4DNT B;  5BN3 A;  4JK1 C;  2PCF B;  2JE6 I;  2QF7 A;  3A7A B;  1OXV A;  1OXS C;  3GQB A;  3U9S A;  4G7O C;  1GUG A;  3CRK C;  2JEA I;  1IW7 D;  2JXM B;  1VCI A;  1Q12 A;  4KN7 C;  4OGQ C;  1GHJ A;  3W3A A;  3WDN A;  4LK1 C;  1BDO A;  5C0X G;  1IYV A;  1DD2 A;  3KLR A;  1H9S A;  3HGB A;  2K32 A;  3AB9 A;  3NE5 B;  3P20 A;  5BN4 A;  4L8J A;  3DXJ C;  3VR6 A;  4GZY C;  1DCZ A;  3A7L A;  1E2Z A;  1Q1E A;  3D4R A;  1CFM A;  3M7N A;  4BA1 I;  3I72 A;  4OO1 H;  2K33 A;  4KKT A;  1TU2 B;  3LNN A;  1G29 1;  3RLF A;  1Z6H A;  1DXM A;  3OW7 A;  4KI0 A;  5A35 A;  2B8G A;  1Y8N B;  5BN5 A;  1VF5 C;  1CTM A;  2EJF C;  5KNB A;  1ONL A;  2NN6 I;  4G7H C;  3TZU A;  2V4D A;  2BA1 A;  4JBW A;  4BA2 I;  2EJM A;  1H9K A;  2E75 C;  3GD7 A;  2A6H D;  3A8K E;  3QIA A;  1GJX A;  3SE0 A;  5C0X H;  4IFD H;  2KA7 A;  1V8Q A;  3FPP A;  1I6V C;  2BA0 A;  4DK0 A;  5JEA G;  2AUJ D;  5KNC A;  2O5I C;  3T51 B;  1Y8P B;  3N6R A;  3I4L A;  3I73 A;  3PUZ A;  3VR3 A;  2BE5 C;  1ZYR C;  1K8O A;  4G7Z C;  1OXU A;  2DN8 A;  1FYC A;  2B8F A;  3IFT A;  1FR3 A;  3CRL C;  2E74 C;  1Y69 U;  2D2C C;  2L5T A;  1TKW B;  2YYZ A;  3BG3 A;  3EQL C;  2BE5 D;  4XTC S;  3M85 A;  1O7L A;  1EWH A;  2DNC A;  2F1M A;  4H0L C;  4KKU A;  4KMU C;  3ND8 A;  1ZKO A;  3L7Z C;  3M4Y A;  2BDO A;  2CW0 C;  2R6G A;  1E2W A;  2PPB C;  2A6E C;  1H9R A;  1PMR A;  1VDZ A;  1HCZ A;  3VR2 A;  3IKJ A;  4KHZ A;  1YNN C;  2IT1 A;  2LMC B;  3LWU A;  2EJG C;  1OXX K;  3MFY A;  3H94 A;  4PV1 C;  4RCN A;  1IYU A;  2Q8I B;  1O78 A;  2JEB I;  3T56 B;  2ZT9 C;  1Z7T A;  3PUY A;  3MXU A;  1SMY C;  3D31 A;  1Y8O B;  4TKO B;  3PUW A;  1V43 A;  2K7V A;  4DNR B;  2NN6 G;  2AWO A;  3SDZ A;  1Q1B A;  4KN4 C;  2A68 C;  1A6X A;  1E2V A;  1YNJ C;  4H44 C;  2DNE A;  3PV0 A;  1B9M A;  2EDG A;  3QJY A;  3OPO A;  1GHK A;  1GUS A;  4TQU S;  5JEA H;  2O5J C;  1GUN A;  1T5E A;  5K36 G;  1Q90 A;  1H9M A;  3QG1 A;  3FMC A;  1H9J A;  3PUX A;  3ND9 A;  4DK1 A;  2D62 A;  5KND A;  1HQM C;  1HTP A;  3T53 B;  2D5D A;  4HR7 B;  1H9S B;  2EVB A;  4XIG S;  1LAC A;  2A68 D;  4IFD G;  2PNR C;  4I7Z C;  2A69 C;  3PUV A;  3A8J E;  1VF7 A;  3VA7 A;  2AUK A;  2A6H C;  2NN6 H;  4KKS A;  3BDO A;  4IQZ A;  1GUO A; 
#chains in the Genus database with same CATH topology
 2F0L A;  3VYT A;  2RF4 A;  3GTP B;  2KCM A;  5CV4 A;  3GTO H;  1YNX A;  1HZC A;  1TWF B;  2K28 A;  4N9T A;  4LF9 Q;  4UY8 C;  3U4Z A;  4RA8 A;  1XMO L;  5LMN L;  2E2D C;  2L55 A;  4JK1 C;  1B3A A;  1IBM L;  4OIK A;  4A3D G;  3NEM A;  2Z9H A;  4A3J B;  3M3Y B;  3IFD A;  1TWC H;  2RVL A;  2MO0 A;  1KDB A;  4DNI A;  1JR0 D;  1PZJ D;  1EEI D;  4FXK C;  2RQX A;  3CP0 A;  4BY1 G;  2XWJ B;  4FXG C;  5BN4 A;  1NSN S;  5FLM G;  3VR6 A;  3IRB A;  4DR7 Q;  3K58 A;  4NP5 A;  3HOV B;  1YBY A;  3I72 A;  1PA6 A;  1YVC A;  5C3E B;  2WAQ B;  1Z6H A;  4A3D H;  1WJJ A;  3OW7 A;  1EZ8 A;  1VF5 C;  1QVF A;  4DR5 L;  3DUZ A;  2PO4 A;  5G3L F;  3ERO A;  3OMG A;  4BY1 H;  1MSH A;  3HOU G;  2HD3 A;  1UAP A;  2ALY B;  4P72 A;  3HOX H;  1A63 A;  4YWL A;  1K28 A;  2Q8R E;  2E2J H;  2AQ2 B;  3HOZ H;  4JYA Q;  1CKM A;  1TS2 A;  3S1M B;  1C0A A;  4BY7 H;  3K5M A;  4JBJ A;  1UE5 A;  2DN8 A;  3G7L A;  3J80 E;  3J7A V;  5KGU A;  4DR3 L;  2D2C C;  2LY7 A;  3PQI A;  3S2H B;  5EBD A;  2F4V L;  4HJ5 A;  2PZU A;  3S1Q H;  1F2L A;  2X6G A;  4L5S A;  1KC8 C;  3J7Z C;  3EA6 A;  1F9R A;  4UP9 A;  2NVX H;  3IKJ A;  4IPG A;  4A3G B;  5IGF A;  2B29 A;  4L5R C;  2NVT H;  2EJG C;  3DEO A;  5IOD A;  2G9D A;  3RNU A;  4LUO A;  3MXU A;  3AU7 A;  1TWH B;  3I4N B;  1GKH A;  2K7V A;  3Q8D A;  4DNR B;  3QB3 A;  1RIP A;  3N52 A;  1XPO A;  1F2Y A;  1CQV A;  1VMC A;  3SDZ A;  4B3T Q;  4C3H G;  3MAQ A;  1ZYR D;  1HNX L;  1T5E A;  3SK8 A;  5AJ3 L;  3MA2 B;  4ID6 A;  4JOI C;  4TVA B;  2LFN A;  1K8A C;  3NUC A;  4DV5 Q;  2VXW A;  4HCE A;  2PNR C;  4DV1 L;  1D2B A;  4HIM A;  3J7Y W;  5DLQ E;  3MXP A;  4JI8 L;  5ISR A;  1PRT F;  3C1E A;  1EFI D;  3ONA B;  2A1A A;  2ES2 A;  3ER0 A;  4H13 C;  5DM7 3;  2F03 A;  1ENA A;  1MI2 A;  2A69 D;  4FF4 A;  1YNN D;  3GV3 A;  1LAB A;  3A8I E;  2K5W A;  3H0G G;  3KF6 A;  5IYB G;  1K8M A;  3WWV A;  1EL0 A;  3S1N H;  1BR9 A;  1A62 A;  4E6I A;  2PNH A;  4BBR H;  2GN5 A;  4ZYS A;  2J7Z A;  3J81 c;  3CRK C;  1IW7 D;  4TSS A;  4JI0 L;  4DR3 Q;  3W3A A;  1EQR A;  2F4V Q;  1H9S A;  5GAG C;  2K6A A;  2WFW A;  5I2X A;  3U58 A;  3W1G A;  2UUB L;  4KKT A;  1KIX A;  5ELF A;  4NXM L;  2ICE C;  2B63 G;  2KEC A;  1ASZ A;  3RZD B;  4UDU C;  2M2L A;  2K5D A;  4IUU A;  4A3M B;  5T1I A;  4N9P A;  2KA7 A;  3S24 A;  4DK0 A;  4DK3 C;  4NKL A;  3V96 A;  1YEZ A;  4DF7 A;  3PUZ A;  3S15 B;  2BE5 C;  1RF2 D;  1ROD A;  1HFG A;  2PW5 A;  3CCU A;  1OXU A;  1YJN A;  1HNX Q;  1WYD A;  3BS1 A;  5AJ3 Q;  5IP7 H;  1GM5 A;  2CWA A;  4JI4 L;  2NBF A;  2L5T A;  3RN2 A;  1UEB A;  2M00 A;  4CDD C;  4OX9 L;  3WOF A;  4BBS B;  1EY9 A;  4JI8 Q;  4A3I G;  1CZW A;  1IHZ A;  3IL8 A;  5J39 A;  5IGC A;  4GLV B;  4K5W A;  3Q23 A;  2JP1 A;  3ZYY X;  2JA6 B;  2LMC B;  3CCM A;  1OXX K;  2KED A;  3MFY A;  4HJ7 A;  1SEB D;  2CQO A;  2JA7 H;  4RGT A;  1BBU A;  1QVC A;  2HIX A;  4C3I B;  4GKK L;  4A3I H;  5EAY A;  2QEJ C;  3HEJ A;  5IIF A;  1QZG A;  3NPP A;  2Z6B A;  2OF1 A;  3UDG A;  2IPK D;  5LMU Q;  2PYK A;  3BZD B;  4UHV A;  5C6A A;  1XXG A;  2LS0 1;  1PH3 A;  4NXM Q;  1FVI A;  4JI5 L;  1WCM H;  5C4H A;  5CV5 A;  4ZLT F;  4F88 A;  5D3D A;  4A3E B;  1V9P A;  4XDX A;  1CK1 A;  1RJT A;  1BCP C;  1U4L A;  1BF4 A;  1E7Z A;  1GUT A;  3FKI B;  1UE6 A;  4DGZ A;  3PO2 H;  2XSC A;  4A3K H;  3L0O A;  1VQ4 A;  3A7A B;  1W6K A;  2JA8 G;  1AN8 A;  4G7O C;  1I94 L;  4JPB W;  2JXM B;  1EY8 A;  5HY6 A;  3GTL B;  1S3O A;  3VYS A;  4RG1 A;  1GHJ A;  3WDN A;  1IYV A;  1QOH A;  2KUM A;  3R3O A;  3I55 A;  5CV9 A;  4GZY C;  2R7D A;  1Q1E A;  3D4R A;  4BA1 I;  1KLG D;  2E2I H;  1FGB D;  3PO3 G;  3HOY B;  1DXM A;  2JA8 H;  4OWT B;  3U50 C;  4J15 A;  1I6H H;  1S72 A;  5EKI A;  1HHV A;  4P71 A;  2RBM A;  2XTI A;  2F3V A;  5C44 G;  1GJX A;  2KEN A;  3GO5 A;  4POF A;  4GNX A;  4JBK A;  2RKS A;  1BCP B;  2WB1 G;  5JEA G;  3RZO B;  2K14 A;  1BNZ A;  5ELN A;  1DON A;  1N33 Q;  4X66 Q;  4YWM A;  3OIQ A;  3T4A C;  2UUA Q;  4GKK Q;  1R4Q B;  1WTR A;  2BOS A;  1WTP A;  1RKN A;  3SK5 A;  4OON A;  3SR1 A;  4QQB X;  4M8A A;  1K3R A;  4WJW A;  2ICI A;  1NR4 A;  2E74 C;  3CRL C;  1KLU D;  1HR0 L;  2SOB A;  4C3J G;  3GTJ H;  1PH5 A;  5IYD G;  3C46 A;  1EIY B;  2OCE A;  1WD1 A;  2WV6 D;  2DNC A;  2F1M A;  3HP3 A;  3M4Y A;  4A75 A;  2R6G A;  4NXN L;  3GTQ B;  1X3E A;  1EOV A;  5C5M A;  3TZD A;  4IN3 A;  4EVO A;  5M5Y H;  2VQE L;  3L9A X;  2F0D A;  4C3J H;  1QUQ A;  1L1O A;  3CQZ H;  1SYD A;  2ZT9 C;  4K2K A;  4LUV A;  3S17 B;  4FYD A;  2YTY A;  2L1B A;  3A5U A;  3PUW A;  3KF6 B;  5CGK A;  1I50 B;  5JJI A;  4TQU S;  3K5O A;  3PMF A;  3GTP H;  4YCV A;  1XJV A;  1TWF H;  4I7A A;  1H9S B;  1PZI D;  4C56 C;  4LFB L;  3G6J B;  5LMN W;  1LT4 D;  1SE2 A;  2HQL A;  5C3E G;  3CKI B;  3NSW A;  2MUY A;  4DAY A;  3K59 A;  4A3J H;  3M3Y H;  5C4Z A;  3HOU B;  1VQH A;  1VQM A;  1HPC A;  4LJZ C;  1EY5 A;  2MHV A;  2Z1C A;  4A4I A;  1D1I A;  3J80 i;  4GN3 B;  3HOV H;  3BDC A;  1A3U A;  3MZ5 A;  1STE A;  1TII D;  5ELB A;  1PFS A;  2PCF B;  1E1O A;  5C3E H;  1XTC D;  1SE3 A;  1OXS C;  1KTK A;  2C5C A;  3PCO B;  2JSO A;  5ELE A;  4GLX A;  1WVL A;  2QKI C;  2RDG A;  5E4W C;  1G91 A;  3FPU B;  1V1P A;  3ERS X;  3T1H L;  1ILQ A;  2K33 A;  2QEX A;  2B2W C;  1VQF A;  4LNQ A;  3S1M H;  3I8Z A;  3HG9 A;  2BA1 A;  2F0W A;  2G5D A;  4A3G G;  2VUM G;  1DM0 B;  2VQE Q;  4JI6 Q;  2B2V A;  4ZKC B;  3S2H H;  5JOB A;  2G9H D;  3CF5 A;  1MJE A;  4FDB A;  2HUG A;  2AKW B;  3RLN A;  3I4L A;  4C3H B;  2KQ3 A;  2MP1 A;  1VQ6 A;  1CHP D;  3CAM A;  1GXD C;  2F0T A;  2L4N A;  3BDL A;  3HKS A;  4A3G H;  1MHW C;  4JI7 L;  4LFB Q;  2MO1 A;  2BE5 D;  2EY1 A;  3M4P A;  2MFI A;  1A3T A;  4RGO S;  4IUR A;  4KMU C;  1TWH H;  1VQB A;  3CCV A;  3S1R B;  3I4N H;  3L7Z C;  2I46 A;  1M4V A;  1BUV T;  1E2W A;  2A6E C;  2P5Z X;  1DYQ A;  2ZXP A;  1KNA A;  2CFM A;  3H94 A;  4PV1 C;  5C3X A;  4GNX C;  1SRU A;  3QWN A;  1BOS A;  1EY4 A;  1O78 A;  4YWK A;  4DAV A;  2D9U A;  2EXZ A;  2CCZ A;  2F0O A;  2NB0 A;  2SNM A;  3OW2 A;  4MTN A;  2QDB A;  1E2V A;  1YNJ C;  2DNE A;  3PV0 A;  2L15 A;  3QJY A;  1CKN A;  4K2L A;  2PI2 A;  3URY A;  1H9J A;  2XRQ D;  4YY3 Q;  3RUZ A;  3KUP A;  1B70 B;  4JI3 Q;  2B63 B;  3K7U C;  1TY2 A;  3OIP A;  3K81 C;  5KYL A;  2Z4H A;  3FRP B;  1J6Q A;  3EBE A;  3WOE A;  3NEN A;  4P75 A;  3VDY A;  2B2U A;  4I65 A;  1EIF A;  4LF6 Q;  1YJ9 A;  1MKH A;  3ZJY C;  3K80 C;  3TDQ A;  4RWS C;  1EEF D;  2KCC A;  4OO1 G;  1XMQ L;  5NUC A;  3PSI A;  4GNX B;  2EYH A;  4HJA A;  3LGJ A;  2OT2 A;  3C1F A;  1BCP D;  3H6M A;  3T1Y L;  1NY4 A;  3RZD H;  1U0L A;  4A3M H;  2WAC A;  2V1C C;  1YI2 A;  4R4T A;  3KLR A;  5FO8 B;  1X9N A;  4B3R Q;  4RCO A;  4L8J A;  1BXT A;  4XT3 B;  1RL2 A;  1V1Q A;  4BBS G;  3BVM A;  2UXB L;  4OO1 H;  2RHS B;  2ZM6 Q;  1X55 A;  4A3F G;  5IP9 G;  3TP7 A;  5M3M G;  3S15 H;  2K5V A;  5IGG A;  5E4X A;  2V4D A;  2JA5 B;  3A5Z B;  2A6H D;  1HRJ A;  1II3 A;  1R9T B;  5KNC A;  2UU9 L;  4EQN A;  1SND A;  4LF4 L;  4BBS H;  4G57 A;  1FD7 D;  1L1O B;  1QUQ B;  3TRZ A;  4KHP Q;  3NBI A;  2Z8L A;  3GTK B;  3HZX A;  4K6L A;  3SK6 A;  1KNE A;  5C4J B;  1JJC B;  2JA6 H;  3CHB D;  1EZ6 A;  2NZO A;  4B3S L;  4OO1 I;  1TY0 A;  2OEO A;  2OTL A;  2FXQ A;  4C3I H;  1IBK L;  2ZJQ A;  2EPB A;  1HCZ A;  3BVG A;  4DAY B;  4LF9 L;  1LTT D;  2KEE A;  1E22 A;  3M4O B;  2B2V C;  4LF7 L;  1XMQ Q;  4KY7 A;  2ZXR A;  4A3B G;  3S2D B;  2L0C A;  3CCJ A;  3FDT A;  4DV3 L;  3J81 i;  1CA5 A;  5IYC H;  4NPS A;  4S3S A;  3DWQ A;  3RN5 A;  4LUZ A;  3SXH A;  4FNF A;  4DAP A;  4A3E H;  4X3T A;  1DOL A;  4DR7 L;  3LWE A;  2HDL A;  3FMC A;  2X6L A;  5COY A;  1ASY A;  3D4D A;  3R93 A;  5FOB B;  5FLX c;  1A2U A;  5M5W B;  1HTP A;  3FKI H;  1CZG A;  4AYB G;  2UXB Q;  1XPR A;  3J80 L;  4X3K A;  1LAC A;  1Q7Y C;  4IJH A;  4X3U A;  5C44 B;  2F0E A;  3CW2 C;  4IQZ A;  1LO5 D;  2WII B;  1O7I A;  3MC0 B;  1I4H A;  4EQO A;  1ENC A;  3MXN B;  2UU9 Q;  4JYA L;  1WD0 A;  4RFB A;  1SFO B;  1K0S A;  3TQY A;  5ELD A;  1VQ5 A;  1JJG A;  4PZ7 A;  3OMC A;  3HOY H;  1I4G A;  4XQQ A;  3NHH A;  4GN5 A;  2AWN A;  1BDO A;  2A5H A;  3GTG B;  4GLA C;  1PYW D;  4HJ8 A;  2K01 A;  1EWI A;  2WKD A;  1CKO A;  1IBK Q;  2YTV A;  4IPH A;  2B8G A;  4MIU A;  5IGB A;  3Q22 A;  4BXX G;  3MTS A;  2B2U C;  1B4O A;  1JWS D;  1JE4 A;  1HR0 W;  5GAH C;  4DA2 A;  4LF7 Q;  3G6E A;  3S9W A;  5JVH 3;  1YJW A;  1VQG A;  4B3T L;  1HZ9 A;  4DV3 Q;  1VQK A;  4OEL B;  4LMQ D;  1S5C D;  1KHI A;  4OWX B;  1K8O A;  1P16 A;  1FYC A;  3GTQ H;  1PV4 A;  4BXX H;  1FR3 A;  3C3L A;  4DV5 L;  4IAL A;  1IKL A;  1EU3 A;  4ZQ3 A;  1CKN B;  4ALP A;  1AZP A;  1XPU A;  4PMW A;  3S17 H;  4A3C G;  2CH4 A;  2VS1 A;  1I50 H;  2EYO A;  1SMX A;  3Q6S A;  5FLM H;  3GV6 A;  1NAP A;  1DGS A;  4O42 A;  1Q46 A;  5LL6 S;  1HUM A;  3DM3 A;  3KLW A;  4V19 0;  4X62 Q;  4B9X A;  2EYJ A;  4WOR A;  4ILW A;  1Q1B A;  3HOU H;  1SRO A;  3TBI B;  4FVM A;  2OTJ A;  4LFA Q;  1PTO C;  1C4Q A;  1SYF A;  1BQQ T;  4HR7 B;  4JW0 A;  1QZH A;  1TS3 A;  1VQA A;  2VUM B;  3VA7 A;  1EYD A;  3G71 A;  4IUQ A;  1VQ7 A;  3CPF A;  2JN4 A;  2R7Z B;  4ODG A;  3VR4 A;  4GN4 B;  2EE1 A;  1LTA D;  4RKL A;  2N8N A;  1BBX C;  1BBW A;  3EIV A;  2CQA A;  1F2Z A;  3B6Y A;  2QF7 A;  2N78 A;  1B53 A;  3EN2 A;  5BR8 Q;  4KK7 A;  1OO9 B;  3F2B A;  2JEA I;  3KJO A;  3UE0 A;  1Q8I A;  4YHH Q;  1YZ6 A;  3E0E A;  2Z6K A;  1N34 L;  3I4O A;  2HQE A;  3AB9 A;  1MJC A;  1WOC A;  1WTW A;  1Z47 A;  2L9H A;  1N32 Q;  1G2T A;  4ZAI A;  4LFC Q;  2K04 A;  1KAA A;  1NTG A;  1PTO B;  2B3G A;  1TU2 B;  2YU9 B;  3F8T A;  4C3H H;  2EOT A;  4EGV A;  3SEB A;  1YHQ A;  3C2P A;  5DNF A;  2TMP A;  5EKL A;  4A93 G;  5CBE E;  1B2T A;  1V8Q A;  1VQP A;  4DAM A;  3I73 A;  3S1R H;  2H5X A;  1KQS A;  2UXC L;  1QCB D;  1EY0 A;  5LMU L;  3H0G H;  5H1S E;  5IYB H;  3CCR A;  3GTM B;  4K0K Q;  1HQR D;  4X6A H;  4CKE A;  1NNX A;  5CC4 A;  1ESR A;  2YYZ A;  2K4K A;  4AYB E;  1QG7 A;  1WTX A;  3KOJ A;  1SLJ A;  4L63 B;  2QIL A;  2SEB D;  1WTQ A;  2IX0 A;  3J81 L;  1RD9 D;  3BYT B;  3I56 A;  2EQS A;  1FNU A;  1X32 A;  4FP5 D;  1A0I A;  4X3S A;  2B63 H;  3OYY A;  1EOT A;  3D31 A;  3W2D A;  2LXJ A;  3J7A F;  3KFU A;  3T16 A;  4KLK A;  2AWO A;  3DHQ A;  1N34 Q;  5C0X J;  4UP8 A;  1KXL A;  1WTV A;  3R2T A;  4DV2 Q;  1Q86 C;  3A74 A;  1LTB D;  2NVY B;  3E5S A;  2ZTC A;  4A3F B;  3NXW A;  2Q2U A;  3NWS A;  1JB7 A;  5M3M B;  1A8V A;  1TT2 A;  2PPB C;  3BDO A;  2JA5 G;  4H02 A;  3ICE A;  4APV A;  3BVZ A;  1CI3 M;  1EYC A;  1N33 L;  4X66 L;  2UUA L;  2RSN A;  5IOC A;  1PH4 A;  1ET6 A;  2JE6 I;  3PF4 A;  2KCT A;  1TQO A;  1EIH A;  2A73 B;  2UXC Q;  2QDL A;  1GUG A;  4XT1 B;  2VQF L;  2K75 A;  4P74 A;  2JA5 H;  2GVA A;  1ZEQ X;  1O7Y A;  2B2W A;  2F0P A;  2FIN B;  3H3V C;  3QOJ A;  4A76 A;  3DMU A;  3DXJ C;  5EQ0 A;  1R9T H;  1EUJ A;  1PH6 A;  2KBN A;  3P7J A;  1G6Z A;  1N9W A;  2R3Z A;  1F9S A;  1LTS D;  4G7H C;  3GTK H;  3KF8 A;  2E75 C;  2MPM A;  2R61 A;  2TSS A;  5C4J H;  1U5K A;  2MQH A;  4A3B B;  4X65 Q;  3M7G A;  1STY A;  4N8X 1;  3AFP A;  2O5I C;  1VQE A;  1SYB A;  1Y8P B;  1PVO A;  2BDN A;  2WKC A;  1IXR A;  4DR4 Q;  1K0R A;  1ZXT A;  2EYM A;  2R92 G;  3J81 E;  4AYB B;  3IFT A;  1C48 A;  2Z6K C;  1K8G A;  2NVQ H;  3LX0 A;  2PZT A;  1TWA B;  1M1K C;  1ICF B;  2K5N A;  2RCN A;  3M4O H;  1TWG B;  1BKB A;  2FJ2 A;  3ULJ A;  3NTK A;  1GO3 E;  1VQJ A;  1WTH A;  3UI2 A;  4V0B A;  1PXU A;  3ND8 A;  2IW3 A;  1ZKO A;  5K5P A;  1EY6 A;  2BDO A;  4KJN A;  3GP7 A;  1LUZ A;  3I4M G;  1X3F A;  2IT1 A;  3FHW A;  5M5W H;  3PO3 H;  3DLL A;  2Q8I B;  4DR2 Q;  5IT9 c;  4F87 A;  1Q81 C;  1NE3 A;  3PUY A;  1D5X C;  2Z0S A;  2ZTD A;  4QCL A;  4BS9 A;  4ME5 A;  4JI1 L;  1LTL A;  2VQF Q;  5C44 H;  2OQ0 A;  1RCV D;  3DWP A;  2ZTE A;  4RGM A;  5JEA H;  1BCP F;  1SNQ A;  4DK1 A;  1IKM A;  3MWY W;  3NQI A;  1HH2 P;  1T5X D;  2NWG A;  3T53 B;  5CV8 A;  3M4Q A;  1SFO H;  4IFD G;  2BCO A;  1NMG A;  2F3I A;  2HHH L;  1VF7 A;  2Q2H A;  4EQP A;  3ULL A;  1AP0 A;  4IUN A;  1IL8 A;  4JI6 L;  3QOL A;  1W3S A;  5C4X G;  5IYD H;  1PTO D;  4QIW E;  1F9P A;  1IBL L;  2E76 C;  1RTN A;  5DM6 3;  3OOC A;  3MVV A;  1QJO A;  1PHJ A;  4QGU A;  4TRD A;  4ABN A;  1IL2 A;  4YIJ A;  3S16 B;  1OXV A;  1D6E C;  3U9S A;  1LLR D;  1NUC A;  4K6D A;  4KN7 C;  1Q12 A;  1KDA A;  4DPG A;  4XQN A;  1UUP A;  1C8C A;  2RSO A;  1CM9 A;  1A2T A;  1I3Q B;  5IE8 A;  5EJW A;  3U9O A;  3HOX B;  4IO9 A;  4GKJ Q;  3EVQ A;  2EJM A;  3HOZ B;  2F0I A;  1L0Y B;  5KIX A;  3QO2 A;  5GAD C;  1SJE D;  2CH4 W;  3ULP A;  1E0B A;  1X3Q A;  2ZJP A;  3D4W A;  4IFD I;  4JI1 Q;  4K5V A;  1VMP A;  4OWW B;  4DV6 L;  1Q8K A;  2KHJ A;  4K14 A;  4J1M A;  4YY3 L;  4JI3 L;  1PFM A;  3R2I A;  5CYU A;  4B08 A;  1L2F A;  1YHB A;  2NVT B;  4KKU A;  2HHH Q;  1X65 A;  1JQY D;  4LF6 L;  1LYL A;  2F0U A;  3TP8 A;  2AMC B;  2LSS A;  3UDI A;  5L37 A;  2R7Z G;  1DOM A;  1IBL Q;  3LWU A;  3STB C;  1XNR Q;  1IYJ B;  4L5Q A;  2N55 A;  4QF4 A;  2RDH A;  4BWG B;  3TS0 A;  4R8I A;  2NTS A;  4MTK A;  5JJL A;  1Y8O B;  1X6O A;  4TKO B;  1TVX A;  2VUM H;  4B3R L;  5COR A;  1GUS A;  1LT3 D;  2KHI A;  4IFD J;  1PH7 A;  1Q90 A;  5FO7 B;  5M9O A;  4U68 A;  4IUT A;  4R8N A;  4MZ9 A;  2ZM6 L;  1HQM C;  1STH A;  4C2M B;  4A3L G;  2D5D A;  1U9R A;  3BJU A;  4QIW B;  1B8A A;  3Q24 A;  3L2P A;  4RGN A;  4A93 B;  1HJP A;  1JB3 A;  5EBC A;  1QNK A;  2EZV A;  3MEH A;  4LF5 Q;  3OWF A;  3EJI A;  3KF8 B;  4HSP A;  4RHS A;  5J22 A;  1PFB A;  1OXT A;  3A54 A;  4H7B A;  5M5X B;  3FEW X;  2K50 A;  3P75 A;  1A15 A;  4KHP L;  2YU9 H;  1J9O A;  2I5L X;  4DV6 Q;  3GQB A;  3HS0 C;  1CA6 A;  4AQY Q;  4YCU A;  2FMM A;  1Y1W B;  3RMH A;  1LTG D;  2EYL A;  2F0K A;  2K5Q A;  3D6C A;  3FVQ A;  2D0O A;  1SJH D;  2CVR A;  3A7L A;  1E2Z A;  1CFM A;  4IPC A;  4M1U B;  4JI2 Q;  3RLF A;  3K5N A;  1Y8N B;  3K0Y A;  5BN5 A;  1NCV A;  3CD6 A;  1L0W A;  5JAV A;  1JOR A;  5F2D A;  1H9K A;  3GD7 A;  3GTM H;  3M9B A;  1RDP D;  1X56 A;  4R4I A;  1CSQ A;  5FKA C;  1CUK A;  1VQ8 A;  1J8I A;  3D0F A;  4JVZ A;  4CKC A;  1ZYR C;  4ZUI A;  1I4Q A;  4G7Z C;  1HNZ L;  4PQX A;  1SAP A;  4O2D A;  2UXD Q;  1W2B A;  2J0T D;  3JAM c;  2MNA A;  2E2H B;  1PZK D;  2DGY A;  1KAB A;  1KRT A;  3UDX A;  1H95 A;  4XTC S;  3M85 A;  4H0L C;  5KEE A;  1PFN A;  1MD2 D;  4DXF A;  4AIM A;  1DJR D;  4O0A A;  5DEH A;  3VR2 A;  1YNN C;  2ID0 A;  3OTO L;  5IGE A;  2QCP X;  2NVY H;  2M9V A;  2SDF A;  5IP9 H;  4A3F H;  3TP5 A;  3K7A B;  5M3M H;  2J4X A;  1STN A;  4Z9C B;  1V43 A;  4DR6 Q;  3VYU A;  2E5L Q;  2NN6 G;  4KTA A;  1LTI D;  5FO9 B;  1VQL A;  1JWU D;  2XN9 C;  3T13 A;  1HUN A;  5EPJ A;  2N3S A;  2DJF C;  2GA4 B;  1JMC A;  2CWP A;  1WCM B;  1SSO A;  3PUX A;  4YCW A;  4FO2 A;  4J8Q A;  2F0N A;  2EVB A;  2PI2 E;  2MJ8 A;  1D7Q A;  4RHR A;  3PO2 B;  2I5H A;  4POG A;  2NN6 H;  1N36 Q;  1JOK A;  1GUO A;  2C9O A;  3TEH B;  1S5E D;  3VR5 A;  2H4O A;  4OHJ A;  4F7X A;  5I9O A;  1X3G A;  2R92 B;  1SN8 A;  2DY7 A;  3CCL A;  2I5M X;  5E1F A;  3J80 c;  1HNZ Q;  5HGT A;  2EXD A;  4WFN 3;  1VCI A;  1JWM D;  1DD2 A;  3HGB A;  1MBY A;  4A3B H;  1V1P B;  1DCZ A;  1BO0 A;  2PW7 A;  4QL5 A;  2KCN A;  3I4M B;  2B2T A;  3GTL H;  3LNN A;  1QNU A;  2DY8 A;  1HFN A;  2E8G A;  1SNO A;  2PMZ E;  3TSS A;  4KD4 A;  2NN6 I;  1KRS A;  1UE7 A;  1S4Z A;  2VL6 A;  3OTO Q;  3IAY A;  3QIA A;  3CCE A;  4PMC A;  4RMF A;  1LV9 A;  1EQT A;  4DV0 Q;  1TWA H;  4X62 L;  3FPP A;  2FMC A;  2BA0 A;  5HUR A;  3H15 A;  1C7Y A;  1TWG H;  5FLX L;  3PIP 3;  2GVB A;  1X54 A;  2F0F A;  3GTJ B;  1W6J A;  4IZ8 A;  5IGD A;  4LFA L;  1AFP A;  1YIJ A;  4LW1 A;  2HT1 A;  3RZO H;  2K03 A;  1O7Z A;  1B3Q A;  1V1O A;  2R93 G;  1PH1 A;  1SE4 A;  5GAE C;  2FFK B;  1VS0 A;  5C4X B;  3ERQ A;  4ZRZ A;  4KY6 A;  5KYI A;  2Q8T A;  2SNS A;  2RA4 A;  2CW0 C;  1D5Z C;  1PMR A;  3AFQ A;  3CC2 A;  4QMG A;  4WJ3 M;  1AE2 A;  1WFQ A;  3KJP A;  3UDF A;  4Y52 H;  1HZA A;  1UWV A;  5BR8 L;  1Q3L A;  3NEL A;  2HCC A;  2XVS A;  3H3V I;  1EFW A;  3Q0A A;  1SMY C;  4DU9 A;  4YHH L;  3STB D;  1A6X A;  2EIF A;  1N32 L;  4LFC L;  2QW7 A;  3ND9 A;  2D62 A;  3PF5 A;  4MHE A;  3PIP A;  3S14 B;  3KLS A;  2H1E A;  5J3B A;  2F0H A;  3S16 H;  4ZKB B;  3HOX G;  3F2D A;  3CXC A;  1JT8 A;  4P2C B;  3HOZ G;  1KD1 C;  3OWE B;  4BY7 G;  3G48 A;  2A6E D;  3HKZ G;  2F0V A;  4LWC A;  5ELO A;  4NB3 A;  4A3C H;  4HIO A;  1PYS B;  1J5E Q;  4B3M Q;  2YV5 A;  1B9N A;  4HSV A;  4DNT B;  3CC7 A;  4DUY L;  2IY5 B;  4UPA A;  3TRE A;  4QJF A;  4JV5 L;  2A19 A;  1I3Q H;  3VYR A;  3KBX A;  4JBM A;  2PQE A;  1PRT C;  4K0K L;  4C1N I;  4Y7N B;  4HCS A;  5J1Z A;  4P73 A;  1QE6 A;  4DV7 L;  4G4K A;  5C3W A;  5C0X G;  1YNJ D;  1JIC A;  2K32 A;  1MIU A;  4IOC A;  1PH9 A;  1QIL A;  2PMZ B;  4R4Q A;  2F52 A;  5CV6 A;  1PYB A;  1RHP A;  5FLX E;  2EY6 A;  1SNP A;  1G29 1;  2AQ3 B;  4N8F A;  1EQQ A;  4NMZ A;  1IZ6 A;  1X3P A;  3PGZ A;  2DJG C;  5I4D A;  4DUZ Q;  3A8K E;  2L11 A;  4L6T B;  5C0X H;  3E9I A;  1I4P A;  1HZB A;  4XXE A;  4OEM B;  2Q2T A;  3T51 B;  2A8V A;  3J7A 5;  3VR3 A;  5M3F B;  4IUP A;  1ET9 A;  4KY5 A;  5LMN Q;  1XMO Q;  1ENF A;  4DV2 L;  1IBM Q;  4HJ9 A;  2C35 B;  1AW7 A;  1PRT B;  2X69 A;  2F3W A;  3K6O A;  4CDF C;  1VQN A;  1UEA B;  3CU7 A;  1EWH A;  2B2T C;  1AE3 A;  3K5L A;  3NTI A;  2ZXO A;  1YHA A;  4XYO A;  1C9O A;  3GDE A;  1STG A;  1TS5 A;  4BBR G;  4DR5 Q;  5C0X I;  3KLS X;  2IHF A;  1S5B D;  3JC6 6;  2QA4 A;  1HA5 A;  1PTO F;  4C1N K;  3E0J A;  1G51 A;  4DUY Q;  4C2M H;  1GUW A;  2KOL A;  4JV5 Q;  3F1Z A;  5D3I B;  3RR5 A;  4IJL A;  4DN4 M;  4CDE C;  5TSS A;  5E3F A;  1GOZ A;  2D0P A;  1Y1W G;  4KN4 C;  4A93 H;  4DV7 Q;  4FF2 A;  5LHY 1;  1B9M A;  2EDG A;  3AMU A;  2XGT A;  5JPM C;  2B2Y A;  5K36 G;  5GQO A;  2IX1 A;  1EY7 A;  3E3X A;  5KND A;  1P8L A;  4GS3 A;  3H91 A;  2VZA A;  2ZJR A;  4JCV E;  5M5X H;  4KD3 A;  4CGY B;  1HNW L;  5JPN C;  1PLF A;  4KKS A;  2PQA A;  1Y1W H;  2MGS A;  4X65 L;  2Y0S G;  2EY2 A;  3NP8 A;  5EKK A;  1Y1V B;  3V05 A;  4Q0F A;  3TME A;  2VNU D;  4J6H A;  5K36 H;  1B44 D;  1Q82 C;  1EYA A;  5IP7 G;  3EFX D;  1E1T A;  4DR4 L;  1K83 B;  3MXG A;  1AH9 A;  3D6W A;  3I7F A;  2HCI A;  2HIV A;  2K1B A;  2PZW A;  2OXP A;  3P20 A;  4FF1 A;  5CR3 A;  2VB3 X;  3M7N A;  3A56 A;  2O2L D;  5C5L A;  5A35 A;  2BH2 A;  1JE5 A;  3NK9 A;  2EJF C;  5KNB A;  1ONL A;  4DV1 Q;  3MFG A;  3TZU A;  4JBW A;  2JA7 G;  4EX5 A;  4DR2 L;  1SE8 A;  1M8A A;  2F0J A;  2E2H H;  3OHX C;  1SR3 A;  4R9W A;  3A0J A;  3L3O C;  1FGU A;  4R4C A;  4LAA A;  4U67 3;  4HID A;  3KK7 A;  4FXD A;  1WCM G;  4DFA A;  4PZ8 A;  4ZCK A;  1D1K A;  4JI0 Q;  1LM0 A;  3NBH A;  3HOW B;  3K7A H;  1HNW Q;  2F0M A;  1QVG A;  1K9M C;  1SNM A;  4PZ6 A;  2CHB D;  3W1B A;  3PO2 G;  5G3L D;  4OXP A;  4A3K G;  1CT1 D;  1H9R A;  1SXT A;  2UUB Q;  2A74 C;  1E24 A;  1JCK B;  1ILP A;  3RD4 A;  4KHZ A;  4IPD A;  1PH2 A;  5A2Q L;  3DEP A;  3HKZ E;  1SYC A;  5DAU A;  1IYU A;  2K05 A;  2JEB I;  2CW0 D;  4ULL A;  5D65 A;  4L5T A;  2RDF A;  1M90 C;  1EQV A;  2A68 C;  5CV7 A;  4H44 C;  4QB4 A;  3D8G A;  1TS4 A;  3I3C A;  3OPO A;  1NJI C;  4IUV A;  2O5J C;  1GUN A;  1PH8 A;  3QG1 A;  3TS2 A;  1SMY D;  1FL0 A;  1ML0 D;  1XYI A;  3S2D H;  1HA6 A;  2EYF A;  5EGT A;  4CHT B;  4JI4 Q;  4XIG S;  2JK8 A;  4GKJ L;  1SYE A;  4HAE A;  1K3B C;  2R92 H;  2QGQ A;  4UAI A;  4OX9 Q;  2A6H C;  3CCS A;  3BZK A;  1NMF A;  1MGS A;  2F0G A;  3SHL A;  1E3P A;  2VY3 A;  2CKZ B;  4ME3 A;  2XRS D;  4IOA A;  2UUC L;  3I4M H;  4JC0 A;  2K5H A;  2N88 A;  2Z4I A;  1F9Q A;  5LL6 X;  2R93 B;  1R4P B;  2R7F A;  4LK1 C;  2OWO A;  3JAM i;  2LXK A;  3GTO B;  2B2Y C;  4WJ4 A;  3NE5 B;  2KJX A;  4QUC A;  1PDQ A;  2BH8 A;  3O13 A;  5IT9 L;  1PRT D;  4CJ2 C;  5HGQ A;  4X64 L;  1A3V A;  4KI0 A;  1XX8 A;  1TWC B;  3GTG H;  1AEX A;  4ZK9 B;  1XNR L;  4EQ5 A;  5E7N A;  4JI5 Q;  2XNA C;  5ELC A;  3I2Z A;  4RAU C;  1EWC A;  4KJO A;  4IFD H;  1VQD A;  2O4X A;  3SVM A;  3CPW A;  3DM1 A;  5C4X H;  1G2S A;  4A3D B;  5IWA L;  4DK6 C;  4PMB A;  3SK4 A;  3CMA A;  4Q5V A;  1B1Z A;  2NZ1 D;  2NTT A;  4A3J G;  4BY1 B;  1LTR D;  5FK9 C;  2JJQ A;  3J81 j;  1Y69 U;  1I94 Q;  5A2Q E;  4RH6 A;  3EQL C;  1I5F A;  1JOQ A;  2JYO A;  3NWT A;  3PIO 3;  2E2J B;  5EPL A;  2AHO B;  3I70 A;  4BY7 B;  3HOV G;  5KRU A;  4LF5 L;  3HKZ B;  4HN7 A;  1EIG A;  4MN3 A;  2WAQ G;  5T1G A;  2OQK A;  3AQQ A;  2Y0S E;  3CCQ A;  1HTL D;  2PQA B;  3KDF A;  1I4X A;  2UUC Q;  4FF3 A;  4AQY L;  1QWY A;  3S14 H;  4CJ0 B;  3S1Q B;  4MNO A;  4KHV A;  1D8L A;  1GVP A;  2NVX B;  1GHK A;  4O1N A;  3CME A;  5IY0 A;  4GOP A;  1DZ1 A;  2I0Q A;  1HXY D;  1WTO A;  4JI2 L;  1XNQ L;  1HR0 Q;  4X64 Q;  4QY7 A;  1DOK A;  3X3M A;  1YIT A;  2AUK A;  3BZC A;  1UE1 A;  1LT5 D;  2RHQ B;  4Y7N H;  2HDM A;  4OL7 A;  4NXN Q;  5JEA J;  4ZUJ A;  3K0X A;  4UP7 A;  3MXN A;  3PIO A;  3SGI A;  1JOO A;  5BN3 A;  1VQO A;  1F77 A;  5IT9 E;  5IWA Q;  2R7Z H;  4K8J A;  5M3F G;  3V2T A;  2ATW A;  3HFZ B;  2UXD L;  4HIK A;  3TP6 A;  1SNC A;  3TN2 A;  3I4N G;  2VB2 X;  1STB A;  1GD7 A;  3F2U A;  5JJK A;  4DKA C;  2KVM A;  3S1N B;  3NBH B;  3VA5 A;  3K57 A;  4BBR B;  3AEV A;  2FHT A;  5M3F H;  1CTM A;  4DXG A;  4BA2 I;  3FP9 A;  2L12 A;  4A3L H;  1PTO H;  4RKB A;  3SE0 A;  4AH6 A;  3QR8 A;  1JJ2 A;  1WI5 A;  1I6V C;  1TR5 A;  3E6Z X;  1CSP A;  4DR6 L;  3H0G B;  2E5L L;  5JVG 3;  3N6R A;  4HED A;  5CMD A;  2NZH A;  3I91 A;  2JQO A;  1RTO A;  4OIJ A;  4XQJ A;  3I90 A;  1S5D D;  4DR1 L;  1XNQ Q;  1KL9 A;  4CKB A;  1Y14 B;  3KBG A;  1S5F D;  1O7L A;  1N36 L;  4WRD A;  2Y0S B;  3DWA A;  4NDX A;  3T1H Q;  4KV6 A;  1VDZ A;  1XTD A;  4NW2 A;  1Y1V G;  5EPK A;  2EY5 A;  3UE1 A;  4A3M G;  5JJZ A;  3T56 B;  5I6W A;  1Z7T A;  2IHE A;  3H09 A;  1FJG L;  2JA9 A;  2WIN B;  2YTX A;  1L1O C;  4CDC C;  2WB1 E;  3BU2 A;  3KYH C;  1EYG A;  1B7Y B;  3D3R A;  1B50 A;  2I07 B;  1Y1V H;  5D14 A;  1AZQ A;  4HTH A;  3RLO A;  2AQ1 B;  4JI7 Q;  2A68 D;  2JA7 B;  1K83 H;  4I7Z C;  2A69 C;  3PUV A;  1T9H A;  1JC7 A;  4A3I B;  2WP8 J;  1D5M C;  2RCF A;  4DV0 L;  1Z9F A;  1LT6 D;  5FJ8 G;  4DV4 L;  4LF8 L;  2XWB B;  2ENB A;  1TXY A;  1IW7 C;  5AFW A;  4CJ1 B;  3JAM L;  1F2M A;  1SYG A;  2JA6 G;  1BVS A;  2NYZ D;  1U4R A;  3MEF A;  4HMI A;  1VQ9 A;  1QB5 D;  1ICW A;  4OGQ C;  5FJ8 H;  1NR2 A;  4C3I G;  4F8M A;  1UNS A;  4DR1 Q;  1SDF A;  4GOP C;  2F4I A;  3HOW G;  2LKV A;  2N49 A;  3CC4 A;  1N8R C;  5GRO A;  4A3K B;  2KHS A;  1VQI A;  3U4V A;  2NUC A;  1NBW A;  4K5X A;  1VQC A;  3E9H A;  3F2C A;  3A55 A;  2WAQ E;  5IYC G;  1FNV A;  4A3E G;  2DUD A;  3W5O A;  3HOW H;  2AUJ D;  4CBV A;  2IWH A;  1FJG Q;  2E2I B;  2NVQ B;  1SBB B;  3KDF B;  3MHB A;  3FKI G;  4R4O A;  4K8I A;  1U4P A;  1KAW A;  4B9W A;  3G4S A;  2JA8 B;  1G6P A;  3K8A A;  1I6H B;  2B8F A;  1FNW A;  2EYP A;  1I4R A;  4QUF A;  3T1Y Q;  4HMJ A;  4JOI A;  1TKW B;  4R1J A;  1G8Z D;  5I2Y A;  3BG3 A;  2Q2I A;  4GOP B;  1ESF A;  2F0Q A;  3OSO A;  4PG3 A;  3AYH B;  1EU4 A;  2ASB A;  1OTC A;  3PO3 B;  3NTH A;  2B39 A;  1XWE A;  4DV4 Q;  3P1H A;  4LF8 Q;  1CHQ D;  3HOY G;  1S40 A;  1CQF A;  1J5E L;  3H3V H;  4B3M L;  4RCN A;  3R8B A;  3BYY B;  3ITP A;  1K73 C;  2WB1 B;  5I9P A;  2F0S A;  1U4M A;  1MSG A;  2IJ0 A;  2K52 A;  2IX3 A;  4LF4 Q;  5I6Y A;  1O80 A;  2IL8 A;  1H9M A;  3HRZ C;  5M5Y B;  1STA A;  4JG2 A;  4C3J B;  5CBA E;  4PNY A;  4XYQ A;  3JAM E;  3CQZ B;  4DUZ L;  3A8J E;  2XIW A;  2VW9 A;  1L0X B;  4B3S Q;  1KDC A;  3X3N A;  3NQT A;  2R93 H; 
#chains in the Genus database with same CATH homology
 2F0L A;  3VYT A;  3GTP B;  5CV4 A;  1TWF B;  2K28 A;  4N9T A;  4RA8 A;  2E2D C;  2L55 A;  4JK1 C;  1B3A A;  4OIK A;  4A3J B;  3M3Y B;  3IFD A;  2RVL A;  1KDB A;  1JR0 D;  1PZJ D;  1EEI D;  2RQX A;  4FXK C;  2XWJ B;  4FXG C;  5BN4 A;  1NSN S;  3VR6 A;  3K58 A;  4NP5 A;  3HOV B;  3I72 A;  5C3E B;  2WAQ B;  1Z6H A;  3OW7 A;  1EZ8 A;  1VF5 C;  3DUZ A;  2PO4 A;  5G3L F;  3ERO A;  3OMG A;  1MSH A;  1UAP A;  2Q8R E;  2AQ2 B;  1TS2 A;  3S1M B;  3K5M A;  2DN8 A;  3G7L A;  3J80 E;  3J7A V;  5KGU A;  2D2C C;  2LY7 A;  3S2H B;  5EBD A;  2PZU A;  1F2L A;  2X6G A;  3EA6 A;  1F9R A;  3IKJ A;  4A3G B;  5IGF A;  2EJG C;  3DEO A;  5IOD A;  2G9D A;  3MXU A;  3AU7 A;  1TWH B;  3I4N B;  2K7V A;  4DNR B;  3QB3 A;  3N52 A;  1F2Y A;  1CQV A;  1VMC A;  3SDZ A;  4C3H G;  3MAQ A;  1ZYR D;  1T5E A;  3SK8 A;  3MA2 B;  4ID6 A;  2LFN A;  3NUC A;  2VXW A;  4HCE A;  2PNR C;  1D2B A;  3J7Y W;  3MXP A;  5ISR A;  1PRT F;  3C1E A;  1EFI D;  3ONA B;  4H13 C;  5DM7 3;  2F03 A;  1ENA A;  1MI2 A;  2A69 D;  4FF4 A;  1YNN D;  3GV3 A;  1LAB A;  3A8I E;  2K5W A;  1K8M A;  1EL0 A;  1BR9 A;  4E6I A;  4ZYS A;  2J7Z A;  3CRK C;  1IW7 D;  4TSS A;  3W3A A;  1H9S A;  2K6A A;  5I2X A;  4KKT A;  5ELF A;  2ICE C;  2KEC A;  3RZD B;  4UDU C;  2M2L A;  2K5D A;  4IUU A;  4A3M B;  5T1I A;  4N9P A;  2KA7 A;  4DK0 A;  4NKL A;  3V96 A;  4DF7 A;  3PUZ A;  3S15 B;  2BE5 C;  1RF2 D;  1ROD A;  1HFG A;  2PW5 A;  1OXU A;  3BS1 A;  2NBF A;  2L5T A;  2M00 A;  3WOF A;  4BBS B;  1EY9 A;  1CZW A;  1IHZ A;  3IL8 A;  5J39 A;  5IGC A;  4K5W A;  3Q23 A;  2JP1 A;  3ZYY X;  2JA6 B;  2LMC B;  1OXX K;  2KED A;  3MFY A;  1SEB D;  4RGT A;  4C3I B;  2QEJ C;  3HEJ A;  5IIF A;  3NPP A;  2OF1 A;  2IPK D;  2PYK A;  3BZD B;  5C6A A;  1XXG A;  2LS0 1;  5C4H A;  5CV5 A;  4ZLT F;  4F88 A;  5D3D A;  4A3E B;  4XDX A;  1CK1 A;  1RJT A;  1BCP C;  1U4L A;  1BF4 A;  3FKI B;  1GUT A;  4DGZ A;  2XSC A;  3A7A B;  1W6K A;  1AN8 A;  4G7O C;  2JXM B;  1EY8 A;  3GTL B;  3VYS A;  1GHJ A;  3WDN A;  1IYV A;  1QOH A;  2KUM A;  3R3O A;  5CV9 A;  4GZY C;  1Q1E A;  3D4R A;  4BA1 I;  1KLG D;  1FGB D;  3HOY B;  1DXM A;  5EKI A;  1HHV A;  2RBM A;  1GJX A;  2F3V A;  3GO5 A;  2RKS A;  1BCP B;  5JEA G;  3RZO B;  1BNZ A;  1DON A;  3OIQ A;  3T4A C;  1R4Q B;  1WTR A;  2BOS A;  1WTP A;  1RKN A;  3SK5 A;  3SR1 A;  4M8A A;  4WJW A;  2ICI A;  1NR4 A;  2E74 C;  3CRL C;  1KLU D;  2SOB A;  4C3J G;  3C46 A;  1WD1 A;  2WV6 D;  2DNC A;  2F1M A;  3HP3 A;  3M4Y A;  2R6G A;  3GTQ B;  5C5M A;  3TZD A;  4IN3 A;  4EVO A;  3L9A X;  2F0D A;  1SYD A;  2ZT9 C;  4K2K A;  3S17 B;  4FYD A;  2L1B A;  3PUW A;  5CGK A;  1I50 B;  4TQU S;  3K5O A;  3PMF A;  1H9S B;  1PZI D;  4C56 C;  3G6J B;  1LT4 D;  1SE2 A;  3CKI B;  3NSW A;  2MUY A;  4DAY A;  3K59 A;  5C4Z A;  3HOU B;  1HPC A;  4LJZ C;  1EY5 A;  2MHV A;  2Z1C A;  1D1I A;  3BDC A;  1A3U A;  3MZ5 A;  1STE A;  1TII D;  5ELB A;  2PCF B;  1XTC D;  1SE3 A;  1OXS C;  1KTK A;  2C5C A;  2JSO A;  5ELE A;  1WVL A;  2QKI C;  2RDG A;  5E4W C;  1G91 A;  3FPU B;  1V1P A;  1ILQ A;  2K33 A;  2B2W C;  3I8Z A;  3HG9 A;  2BA1 A;  2F0W A;  1DM0 B;  2B2V A;  4ZKC B;  5JOB A;  2G9H D;  2HUG A;  3I4L A;  4C3H B;  2KQ3 A;  2MP1 A;  1CHP D;  1GXD C;  2F0T A;  2L4N A;  3BDL A;  2BE5 D;  2EY1 A;  4RGO S;  1A3T A;  4IUR A;  4KMU C;  3S1R B;  3L7Z C;  2I46 A;  1M4V A;  1BUV T;  1E2W A;  2A6E C;  1DYQ A;  2ZXP A;  1KNA A;  3H94 A;  4PV1 C;  5C3X A;  3QWN A;  1BOS A;  1EY4 A;  1O78 A;  4DAV A;  2D9U A;  2EXZ A;  2F0O A;  2NB0 A;  2SNM A;  2QDB A;  1E2V A;  1YNJ C;  2DNE A;  3PV0 A;  3QJY A;  4K2L A;  3URY A;  1H9J A;  2XRQ D;  3RUZ A;  3KUP A;  2B63 B;  1TY2 A;  3OIP A;  5KYL A;  2Z4H A;  3FRP B;  3WOE A;  2B2U A;  4I65 A;  3TDQ A;  4RWS C;  1EEF D;  2KCC A;  4OO1 G;  5NUC A;  2EYH A;  2OT2 A;  3C1F A;  1BCP D;  3H6M A;  2WAC A;  3KLR A;  5FO8 B;  4RCO A;  4L8J A;  1BXT A;  4XT3 B;  3BVM A;  4OO1 H;  3TP7 A;  5IGG A;  5E4X A;  2V4D A;  2JA5 B;  2A6H D;  1HRJ A;  1II3 A;  1R9T B;  5KNC A;  4EQN A;  1SND A;  4G57 A;  1FD7 D;  3NBI A;  2Z8L A;  3GTK B;  3HZX A;  4K6L A;  3SK6 A;  1KNE A;  5C4J B;  3CHB D;  1EZ6 A;  4OO1 I;  1TY0 A;  2OEO A;  2EPB A;  1HCZ A;  3BVG A;  1LTT D;  2KEE A;  3M4O B;  2B2V C;  4KY7 A;  2ZXR A;  3S2D B;  2L0C A;  3FDT A;  1CA5 A;  4S3S A;  3DWQ A;  3SXH A;  4DAP A;  4FNF A;  4X3T A;  1DOL A;  3LWE A;  2HDL A;  3FMC A;  2X6L A;  5COY A;  3D4D A;  3R93 A;  5FOB B;  5M5W B;  1A2U A;  1HTP A;  1CZG A;  3J80 L;  4X3K A;  1LAC A;  4X3U A;  5C44 B;  2F0E A;  4IQZ A;  1LO5 D;  2WII B;  3MC0 B;  1I4H A;  4EQO A;  1ENC A;  1WD0 A;  4RFB A;  1SFO B;  5ELD A;  3OMC A;  1I4G A;  4XQQ A;  3NHH A;  2AWN A;  1BDO A;  2A5H A;  3GTG B;  1PYW D;  2K01 A;  2WKD A;  2B8G A;  4MIU A;  5IGB A;  3Q22 A;  3MTS A;  2B2U C;  1B4O A;  1JWS D;  1JE4 A;  4DA2 A;  3S9W A;  5JVH 3;  4LMQ D;  1S5C D;  1K8O A;  1FYC A;  1FR3 A;  3C3L A;  4IAL A;  1IKL A;  1EU3 A;  4ZQ3 A;  1AZP A;  4PMW A;  2EYO A;  3Q6S A;  3GV6 A;  1NAP A;  4O42 A;  5LL6 S;  1HUM A;  4V19 0;  4B9X A;  2EYJ A;  4WOR A;  4ILW A;  1Q1B A;  3TBI B;  4FVM A;  1PTO C;  1C4Q A;  1SYF A;  1BQQ T;  4HR7 B;  1TS3 A;  2VUM B;  3VA7 A;  1EYD A;  4IUQ A;  2R7Z B;  4ODG A;  3VR4 A;  2EE1 A;  1LTA D;  4RKL A;  1BBX C;  2CQA A;  1F2Z A;  2QF7 A;  1B53 A;  4KK7 A;  1OO9 B;  2JEA I;  1Q8I A;  2HQE A;  3AB9 A;  1WTW A;  1Z47 A;  2L9H A;  1G2T A;  4ZAI A;  2K04 A;  1KAA A;  1PTO B;  1TU2 B;  2YU9 B;  2EOT A;  4EGV A;  3SEB A;  3C2P A;  5DNF A;  2TMP A;  5EKL A;  5CBE E;  1B2T A;  1V8Q A;  3I73 A;  1QCB D;  1EY0 A;  3GTM B;  1HQR D;  4CKE A;  5CC4 A;  1ESR A;  2YYZ A;  1QG7 A;  1WTX A;  4L63 B;  2QIL A;  2SEB D;  1WTQ A;  2IX0 A;  3J81 L;  1RD9 D;  3BYT B;  1FNU A;  1X32 A;  4FP5 D;  4X3S A;  1EOT A;  3D31 A;  3W2D A;  3J7A F;  3T16 A;  2AWO A;  3DHQ A;  5C0X J;  1WTV A;  3R2T A;  1LTB D;  2NVY B;  3E5S A;  4A3F B;  3NXW A;  3NWS A;  5M3M B;  1TT2 A;  2PPB C;  3BDO A;  3BVZ A;  1CI3 M;  1EYC A;  2RSN A;  5IOC A;  1ET6 A;  2JE6 I;  1TQO A;  1EIH A;  2A73 B;  1GUG A;  4XT1 B;  1ZEQ X;  1O7Y A;  2B2W A;  2F0P A;  2FIN B;  3H3V C;  3QOJ A;  3DMU A;  3DXJ C;  5EQ0 A;  3P7J A;  1G6Z A;  2R3Z A;  1F9S A;  1LTS D;  4G7H C;  3KF8 A;  2E75 C;  2MPM A;  2R61 A;  2TSS A;  4A3B B;  3M7G A;  1STY A;  2O5I C;  1SYB A;  1Y8P B;  2BDN A;  2WKC A;  1ZXT A;  2EYM A;  3J81 E;  4AYB B;  3IFT A;  1C48 A;  3LX0 A;  2PZT A;  1TWA B;  1TWG B;  2FJ2 A;  3NTK A;  3UI2 A;  4V0B A;  1PXU A;  2IW3 A;  5K5P A;  3ND8 A;  1ZKO A;  1EY6 A;  2BDO A;  4KJN A;  3GP7 A;  2IT1 A;  2Q8I B;  4F87 A;  3PUY A;  1D5X C;  4QCL A;  4BS9 A;  4ME5 A;  1RCV D;  3DWP A;  4RGM A;  5JEA H;  1BCP F;  1SNQ A;  4DK1 A;  1IKM A;  3MWY W;  3NQI A;  1T5X D;  2NWG A;  3T53 B;  5CV8 A;  4IFD G;  2BCO A;  1VF7 A;  4EQP A;  1AP0 A;  4IUN A;  1IL8 A;  3QOL A;  1PTO D;  1F9P A;  2E76 C;  1RTN A;  5DM6 3;  3OOC A;  3MVV A;  1QJO A;  4TRD A;  4ABN A;  4YIJ A;  3S16 B;  1OXV A;  1D6E C;  3U9S A;  1LLR D;  1NUC A;  4K6D A;  4KN7 C;  1Q12 A;  1KDA A;  4XQN A;  1UUP A;  1C8C A;  2RSO A;  1CM9 A;  1A2T A;  1I3Q B;  5EJW A;  3U9O A;  3HOX B;  3EVQ A;  2EJM A;  3HOZ B;  2F0I A;  1L0Y B;  5KIX A;  3QO2 A;  1SJE D;  1E0B A;  1X3Q A;  3D4W A;  4IFD I;  4K5V A;  1VMP A;  4K14 A;  4J1M A;  1PFM A;  3R2I A;  5CYU A;  4B08 A;  2NVT B;  4KKU A;  1JQY D;  2F0U A;  3TP8 A;  1DOM A;  3LWU A;  2N55 A;  4QF4 A;  2RDH A;  4BWG B;  4R8I A;  2NTS A;  1Y8O B;  4TKO B;  1TVX A;  5COR A;  1GUS A;  1LT3 D;  4IFD J;  1Q90 A;  5FO7 B;  5M9O A;  4U68 A;  4IUT A;  4R8N A;  1HQM C;  1STH A;  4C2M B;  2D5D A;  1U9R A;  4QIW B;  3Q24 A;  4RGN A;  4A93 B;  1JB3 A;  5EBC A;  1QNK A;  2EZV A;  3MEH A;  3OWF A;  3EJI A;  4HSP A;  4RHS A;  5J22 A;  1PFB A;  1OXT A;  3A54 A;  4H7B A;  5M5X B;  3FEW X;  3P75 A;  1A15 A;  1J9O A;  3GQB A;  3HS0 C;  1CA6 A;  2FMM A;  1Y1W B;  3RMH A;  1LTG D;  2EYL A;  2F0K A;  2K5Q A;  3D6C A;  3FVQ A;  1SJH D;  2CVR A;  3A7L A;  1E2Z A;  1CFM A;  4M1U B;  3RLF A;  3K5N A;  1Y8N B;  3K0Y A;  5BN5 A;  1NCV A;  5JAV A;  1JOR A;  5F2D A;  1H9K A;  3GD7 A;  1RDP D;  5FKA C;  1J8I A;  4CKC A;  1ZYR C;  4ZUI A;  1I4Q A;  4G7Z C;  4PQX A;  1SAP A;  2J0T D;  2E2H B;  1PZK D;  1KAB A;  4XTC S;  3M85 A;  4H0L C;  5KEE A;  1PFN A;  1MD2 D;  4DXF A;  1DJR D;  5DEH A;  3VR2 A;  1YNN C;  2ID0 A;  5IGE A;  2QCP X;  2M9V A;  2SDF A;  3TP5 A;  3K7A B;  2J4X A;  1STN A;  4Z9C B;  1V43 A;  3VYU A;  2NN6 G;  4KTA A;  1LTI D;  5FO9 B;  1JWU D;  2XN9 C;  3T13 A;  1HUN A;  5EPJ A;  2GA4 B;  1WCM B;  1SSO A;  3PUX A;  4FO2 A;  4J8Q A;  2F0N A;  2EVB A;  2MJ8 A;  4RHR A;  3PO2 B;  2NN6 H;  1JOK A;  1GUO A;  2C9O A;  1S5E D;  3VR5 A;  2H4O A;  4OHJ A;  4F7X A;  5I9O A;  2R92 B;  2DY7 A;  5E1F A;  5HGT A;  4WFN 3;  1VCI A;  1JWM D;  1DD2 A;  3HGB A;  1MBY A;  1V1P B;  1DCZ A;  1BO0 A;  2PW7 A;  2KCN A;  3I4M B;  2B2T A;  3LNN A;  1QNU A;  2DY8 A;  1HFN A;  1SNO A;  3TSS A;  4KD4 A;  2NN6 I;  1S4Z A;  3IAY A;  3QIA A;  4PMC A;  1LV9 A;  1EQT A;  3FPP A;  2FMC A;  2BA0 A;  5HUR A;  5FLX L;  3PIP 3;  2F0F A;  3GTJ B;  1W6J A;  4IZ8 A;  5IGD A;  1AFP A;  2K03 A;  1O7Z A;  1V1O A;  1SE4 A;  2FFK B;  5C4X B;  3ERQ A;  4ZRZ A;  4KY6 A;  5KYI A;  2Q8T A;  2SNS A;  2RA4 A;  2CW0 C;  1D5Z C;  1PMR A;  4QMG A;  1Q3L A;  2HCC A;  2XVS A;  3Q0A A;  1SMY C;  4DU9 A;  1A6X A;  3ND9 A;  2D62 A;  4MHE A;  3S14 B;  3KLS A;  2H1E A;  2F0H A;  4ZKB B;  4P2C B;  3OWE B;  2A6E D;  2F0V A;  1B9N A;  4HSV A;  4DNT B;  3VYR A;  3KBX A;  2PQE A;  1PRT C;  4C1N I;  4Y7N B;  4HCS A;  5J1Z A;  1QE6 A;  5C3W A;  4G4K A;  5C0X G;  1YNJ D;  1JIC A;  2K32 A;  1QIL A;  2PMZ B;  5CV6 A;  1RHP A;  5FLX E;  2EY6 A;  1SNP A;  1G29 1;  2AQ3 B;  4NMZ A;  1X3P A;  5I4D A;  3A8K E;  2L11 A;  4L6T B;  5C0X H;  1I4P A;  4XXE A;  3T51 B;  3VR3 A;  5M3F B;  4IUP A;  1ET9 A;  4KY5 A;  1ENF A;  1AW7 A;  1PRT B;  2X69 A;  2F3W A;  3K6O A;  1UEA B;  3CU7 A;  1EWH A;  2B2T C;  3K5L A;  3NTI A;  2ZXO A;  4XYO A;  1STG A;  1TS5 A;  5C0X I;  3KLS X;  1S5B D;  1HA5 A;  1PTO F;  4C1N K;  3E0J A;  1GUW A;  2KOL A;  5D3I B;  4DN4 M;  5TSS A;  5E3F A;  1GOZ A;  4KN4 C;  4FF2 A;  5LHY 1;  1B9M A;  2EDG A;  3AMU A;  5JPM C;  2B2Y A;  5K36 G;  2IX1 A;  1EY7 A;  5KND A;  3H91 A;  4KD3 A;  4CGY B;  5JPN C;  1PLF A;  4KKS A;  2MGS A;  3NP8 A;  2EY2 A;  5EKK A;  1Y1V B;  3V05 A;  4Q0F A;  3TME A;  2VNU D;  4J6H A;  5K36 H;  1B44 D;  1EYA A;  3EFX D;  1K83 B;  3MXG A;  3D6W A;  2HCI A;  2K1B A;  2PZW A;  2OXP A;  3P20 A;  4FF1 A;  5CR3 A;  2VB3 X;  3M7N A;  3A56 A;  2O2L D;  5C5L A;  5A35 A;  3NK9 A;  2EJF C;  5KNB A;  1ONL A;  3MFG A;  3TZU A;  4JBW A;  1M8A A;  2F0J A;  3OHX C;  4R9W A;  3L3O C;  4LAA A;  4U67 3;  3KK7 A;  4FXD A;  4DFA A;  1D1K A;  3NBH A;  3HOW B;  2F0M A;  1SNM A;  2CHB D;  5G3L D;  1CT1 D;  1H9R A;  1SXT A;  2A74 C;  1JCK B;  1ILP A;  3RD4 A;  4KHZ A;  5A2Q L;  3DEP A;  1SYC A;  5DAU A;  1IYU A;  2K05 A;  2JEB I;  2CW0 D;  4ULL A;  5D65 A;  2RDF A;  1EQV A;  2A68 C;  5CV7 A;  4H44 C;  4QB4 A;  3D8G A;  1TS4 A;  3I3C A;  3OPO A;  4IUV A;  2O5J C;  1GUN A;  3QG1 A;  1SMY D;  1ML0 D;  1XYI A;  1HA6 A;  2EYF A;  5EGT A;  4CHT B;  4XIG S;  1SYE A;  4HAE A;  4UAI A;  2A6H C;  1MGS A;  2F0G A;  3SHL A;  2XRS D;  2N88 A;  2Z4I A;  1F9Q A;  5LL6 X;  2R93 B;  1R4P B;  4LK1 C;  3GTO B;  2B2Y C;  3NE5 B;  2KJX A;  4QUC A;  1PDQ A;  3O13 A;  5IT9 L;  1PRT D;  4CJ2 C;  1A3V A;  4KI0 A;  1XX8 A;  1TWC B;  1AEX A;  4ZK9 B;  2XNA C;  5ELC A;  4RAU C;  1EWC A;  4KJO A;  4IFD H;  2O4X A;  3SVM A;  3DM1 A;  1G2S A;  4A3D B;  4PMB A;  3SK4 A;  4Q5V A;  1B1Z A;  2NZ1 D;  2NTT A;  4BY1 B;  1LTR D;  5FK9 C;  1Y69 U;  5A2Q E;  4RH6 A;  3EQL C;  1JOQ A;  2JYO A;  3NWT A;  3PIO 3;  2E2J B;  5EPL A;  3I70 A;  4BY7 B;  5KRU A;  3HKZ B;  4HN7 A;  1EIG A;  4MN3 A;  5T1G A;  1HTL D;  1I4X A;  4FF3 A;  1QWY A;  4CJ0 B;  3S1Q B;  4KHV A;  2NVX B;  1GHK A;  4O1N A;  1DZ1 A;  1HXY D;  1WTO A;  1DOK A;  3X3M A;  2AUK A;  1LT5 D;  2HDM A;  4OL7 A;  5JEA J;  4ZUJ A;  3MXN A;  1JOO A;  5BN3 A;  1F77 A;  5IT9 E;  4K8J A;  3V2T A;  3TP6 A;  1SNC A;  3TN2 A;  2VB2 X;  1STB A;  3F2U A;  2KVM A;  3S1N B;  3K57 A;  3VA5 A;  4BBR B;  2FHT A;  1CTM A;  4DXG A;  4BA2 I;  2L12 A;  1PTO H;  4RKB A;  3SE0 A;  1I6V C;  1TR5 A;  3E6Z X;  3H0G B;  5JVG 3;  3N6R A;  4HED A;  5CMD A;  3I91 A;  1RTO A;  4OIJ A;  4XQJ A;  3I90 A;  1S5D D;  4CKB A;  3KBG A;  1S5F D;  1O7L A;  4WRD A;  2Y0S B;  3DWA A;  4NDX A;  4KV6 A;  1VDZ A;  4NW2 A;  5EPK A;  2EY5 A;  5JJZ A;  3T56 B;  5I6W A;  1Z7T A;  3H09 A;  2WIN B;  3D3R A;  1B50 A;  2I07 B;  5D14 A;  1AZQ A;  4HTH A;  2AQ1 B;  2A68 D;  2JA7 B;  4I7Z C;  2A69 C;  3PUV A;  1JC7 A;  4A3I B;  2WP8 J;  1D5M C;  1LT6 D;  2XWB B;  2ENB A;  1IW7 C;  5AFW A;  4CJ1 B;  3JAM L;  1F2M A;  1SYG A;  2NYZ D;  1U4R A;  4HMI A;  1QB5 D;  1ICW A;  4OGQ C;  1NR2 A;  4C3I G;  4F8M A;  1UNS A;  1SDF A;  2F4I A;  2LKV A;  4A3K B;  2KHS A;  2NUC A;  4K5X A;  3A55 A;  1FNV A;  2AUJ D;  4CBV A;  2IWH A;  2E2I B;  2NVQ B;  1SBB B;  3MHB A;  4K8I A;  1U4P A;  4B9W A;  2JA8 B;  1I6H B;  2B8F A;  1FNW A;  2EYP A;  1I4R A;  4QUF A;  4HMJ A;  1TKW B;  1G8Z D;  5I2Y A;  3BG3 A;  1ESF A;  2F0Q A;  3OSO A;  1EU4 A;  3PO3 B;  3NTH A;  2B39 A;  1XWE A;  3P1H A;  1CHQ D;  1CQF A;  4RCN A;  3R8B A;  3BYY B;  3ITP A;  2WB1 B;  5I9P A;  2F0S A;  1U4M A;  1MSG A;  2IJ0 A;  2IX3 A;  5I6Y A;  1O80 A;  2IL8 A;  1H9M A;  3HRZ C;  5M5Y B;  1STA A;  4C3J B;  5CBA E;  4PNY A;  4XYQ A;  3JAM E;  3CQZ B;  3A8J E;  2XIW A;  1L0X B;  1KDC A;  3X3N A;  3NQT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...