5IWAQ

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the ge81112 peptide antibiotic
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of translation initiation complex formation by GE81112 unravels a 16S rRNA structural switch involved in P-site decoding.
pubmed doi rcsb
molecule tags Translation
molecule keywords 30S ribosomal protein S2
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5iwaQ00
2C35B 1G6PA 2K75A 4DUZL 3S2HH 4JI2Q 2E2JH 5IT9c 5AJ3L 3Q8DA 3H3VH 3I4MG 1M90C 1VQAA 4IPCA 4NXMQ 1VQHA 2CKZB 2CQOA 3MXNB 3J81c 4WJ4A 3PUZA 1VQPA 3W1GA 2E5LQ 2I0QA 3CW2C 1UE7A 1LUZA 1UEBA 2UXDQ 5IYBG 2Z6KA 1E24A 3KLWA 3RN2A 3CC4A 4DV2L 2D0OA 2BA0A 2AWNA 2JE6I 2YYZA 1Q82C 3KDFB 1I94Q 3CP0A 4JI6L 4DV5Q 1PH5A 4R1JA 4YWMA 1YHBA 4JBMA 2MNAA 2GVBA 2UXDL 1CKMA 1SLJA 1Z47A 4KHZA 5IWAQ 3RR5A 4X62Q 3E9IA 4LF4L 4P74A 1NE3A 5GAGC 2QGQA 1TXYA 3PUYA 1XMQQ 5C3EH 4X64L 4NXML 4DR6L 1RIPA 1TWAH 5IWAL 3T1YL 4NPSA 5LMNL 1E7ZA 1EOVA 3LGJA 4UP8A 4DPGA 2JK8A 4LWCA 3HOUH 1BVSA 2VQEL 3M3YH 4DV6Q 3I7FA 4DR7Q 3S24A 1RL2A 3RN5A 1SROA 1FJGL 1YBYA 2OTLA 1CUKA 4DR2L 4C3HH 1XNRL 3J7ZC 4PZ8A 4YHHL 1XMOQ 5C4JH 4DKAC 4GN4B 4OO1I 3DM3A 4JV5L 3FKIH 4B3MQ 4PG3A 1VQCA 1V9PA 2Q2HA 1HZBA 1YI2A 3S1MH 3M4QA 4JI4L 2V1CC 3IRBA 4MTNA 4UP9A 3CCMA 2UU9L 2NVTH 1HR0Q 4JI3Q 3L7ZC 3KF6B 3F2BA 5LMNQ 1TWFH 2CWPA 2EIFA 1HZCA 5IY0A 4DR3L 3GTOH 4LW1A 2VQFL 1SFOH 1A0IA 1EWIA 1Q12A 4JC0A 3UDGA 1MJEA 2VUMG 1C9OA 1K3RA 3BJUA 3B6YA 4GKJQ 5JEAG 1JB7A 2PQAA 2JJQA 4IPGA 1FJGQ 3CC2A 3FP9A 5GADC 2HT1A 3G6EA 1IBKL 2VUMH 1L1OA 2AWOA 2NN6G 2UXCL 4GN3B 4PZ7A 1PFSA 4DV4L 4LF6L 1MKHA 3AFPA 3S15H 1PA6A 1EYGA 3GTQH 1YIJA 5IYBH 4DR1Q 3KYHC 2ASBA 1KQSA 3U4VA 1X65A 4JCVE 4DR5Q 1VQLA 1SRUA 1Z9FA 3A5ZB 2VZAA 4GLVB 3STBC 1J5EL 1KIXA 2VQFQ 2LXJA 2MO0A 4LF4Q 3HOZH 3K8AA 3F2CA 1I50H 4HIKA 2YU9H 4JI5Q 1N32Q 1YEZA 2CFMA 3A5UA 2RF4A 4A3EG 3AYHB 2ES2A 1PH6A 1IBMQ 1P8LA 1E3PA 4RG1A 1YHQA 1Q86C 4HJ8A 5C44H 4DV2Q 4JI8L 1VCIA 4P71A 5E7NA 1QZGA 2N49A 3A74A 2R92G 3GTGH 4P75A 1XPUA 2R93G 3CCQA 4DV1L 1EIYB 4L5TA 2R6GA 3M85A 4MZ9A 3HOUG 4XTCS 4X62L 1PH8A 1VQ8A 1PH1A 1YNXA 4NB3A 5LMNW 3F2DA 1X55A 4HIOA 4A3IG 4Y52H 2JA9A 2WAQE 1Q46A 2AMCB 1VQ4A 4POFA 2UUAQ 1XJVA 2OQKA 4DR1L 2N8NA 1T9HA 1N36Q 1FL0A 1X3GA 3J7A5 3STBD 1N32L 2R7ZG 4JI4Q 2KHIA 3HOVG 1S3OA 2Y0SE 3KOJA 4LF5Q 2R7FA 2DUDA 5ELOA 5C0XG 3HOYG 4AQYL 1A63A 4P73A 5IYDG 3S1NH 4IOAA 3PO2G 5C4XH 1YJNA 4YWLA 2OWOA 4A3DH 3PUWA 1EQRA 4QY7A 3PIOA 3GTLH 1YHAA 4O2DA 2KCTA 2RCNA 2AKWB 3I2ZA 3FHWA 2WAQG 2WP8J 4JI1Q 3WWVA 4DV0Q 1XNQL 3J80i 1PH7A 1A62A 2BH8A 2K5VA 2XGTA 2Z0SA 3I4MH 1WFQA 3JC66 3GTMH 2IX0A 1VQBA 4A3LG 3G4SA 5IYCG 1YJWA 4GNXB 1SE8A 1N8RC 2VY3A 3S14H 1YJ9A 2VNUD 1VQFA 1WJJA 2UUBL 2RHSB 4LF5L 3GDEA 1QVCA 1L0WA 1XNRQ 4LUVA 4JBJA 1PH2A 3NEMA 3OYYA 1BBWA 3M4OH 2AHOB 1IZ6A 2ZJPA 4JI6Q 4JI5L 5M3FH 4TVAB 4DV4Q 1E1OA 1CKOA 2MO1A 2VS1A 4FDBA 1VQGA 2UUAL 2ATWA 1IBML 1HH2P 3CD6A 4A3CH 3H15A 4LFAL 3AFQA 1PH9A 5HY6A 3H3VI 4EX5A 3D31A 1XMQL 1XPOA 4AYBE 1HNWQ 2JA5G 1DGSA 1GVPA 2Q2IA 1KAWA 1L1OB 3CCLA 4IFDJ 2VW9A 2I5MX 1X3EA 2PNHA 4JBWA 4JI2L 4B3RQ 4UY8C 4GS3A 1Y1WH 1N34L 4JI7L 1NMGA 4QQBX 1KHIA 2L15A 3JAMi 1N36L 4LF6Q 4K0KQ 1B70B 2JA8G 2WB1G 1JT8A 4OWWB 2ID0A 1PYBA 3EIVA 4X66L 4BXXH 3T1HQ 4YHHQ 3M4PA 1NTGA 3H0GG 4K0KL 3TREA 1WCMH 2IT1A 2YV5A 4UPAA 2IHFA 1SR3A 1PHJA 4L5SA 2VL6A 3K7UC 1VQKA 3I56A 3HKSA 4A3JH 2HIVA 2JA6H 4BBSG 3NENA 4HIMA 4BA2I 1HNWL 4BY7H 2Y0SG 2QEXA 1Q81C 4A3BH 2E5LL 4XIGS 1Q1EA 1J5EQ 3UDIA 4APVA 1K73C 1VQ9A 5M5YH 4DUYL 1VQEA 1EFWA 1K8GA 3I4NG 3RLOA 1EQQA 1PH4A 1I6HH 3MEFA 4IFDI 3E0EA 4BA1I 5AJ3Q 1X9NA 1GO3E 1HR0L 1S72A 1UE6A 1HR0W 1CSQA 1G291 5IP9H 1JMCA 2K5NA 2HHHQ 4POGA 4X6AH 3CQZH 3M7NA 1I3QH 3CCUA 2DGYA 3OTOL 1JE5A 4R4CA 4R4OA 3W1BA 3J80c 5M5WH 4AYBG 3T1YQ 4A93G 4KHPQ 5JJLA 1BKBA 1Y1VG 2E2HH 4KLKA 4LFAQ 4AQYQ 2KENA 3M9BA 4LFCQ 4X66Q 1FGUA 4DV6L 4B3SQ 3PCOB 1UE1A 2JA7H 4JI3L 3ZJYC 4DK6C 3GD7A 3HKZG 2F4VL 4YCUA 1JJ2A 4HIDA 4NXNQ 2F3IA 1AE2A 2ZJRA 4IJHA 4A3MH 2B63H 3S1QH 1KRSA 3K7AH 4IPDA 4DR4Q 4X64Q 2JEAI 2ZM6Q 1OXXK 4GNXA 1O7IA 3UDFA 4GKKL 4BBRH 4GOPB 4A3MG 2B63G 3KF8B 4GNXC 3TQYA 4OONA 3NBHB 4ALPA 3TRZA 2ALYB 1C0AA 3CAMA 4DR4L 1X56A 3PUXA 4PZ6A 4A3KH 4A3FH 3GO5A 2FXQA 2UU9Q 1LM0A 1QVFA 4DV0L 3EBEA 2KBNA 3ERSX 4LF8L 1CKNA 4Y7NH 3HOXH 1Y1VH 1GM5A 3HFZB 4L5RC 5GROA 1KRTA 1LTLA 5IP7H 3PUVA 2UUBQ 5FJ8H 1V1QA 1VQ6A 3K0XA 4GOPA 1K83H 2K4KA 2RHQB 4WJ3M 4DR7L 3KJOA 3VDYA 4JYAL 4LFBL 3CMAA 4BY1H 1HNZL 3HOXG 3HOWG 2GVAA 4GN5A 2R7DA 5H1SE 5GAEC 5C0XI 4B3SL 2OTJA 3CPWA 1CKNB 4IO9A 1N33L 4OX9L 3I4OA 2K14A 4HJAA 5GQOA 5M5XH 2NZHA 4GOPC 4LF9L 5M3MG 1W3SA 4BBRG 5FLMH 5FLMG 1VQMA 2Z6KC 4OX9Q 2BH2A 4R4TA 4A3GG 3BZCA 2R92H 2D62A 3AQQA 4JI1L 4JI8Q 1XNQQ 3PF4A 3S17H 2HIXA 2B3GA 1BBUA 2ZTCA 2WFWA 2NN6I 4IPHA 4R4QA 1XPRA 2MFIA 4DV7Q 4GLXA 2I5LX 3GTJH 1HNZQ 3PO3H 2N3SA 1V43A 3K80C 4BXXG 2F52A 2NZOA 3J81i 1LYLA 4B3ML 3I55A 1VQ7A 1NY4A 4BY1G 3HOWH 1NBWA 1J6QA 1HZ9A 4IOCA 5GAHC 1IYJB 2QA4A 4HJ5A 1Y1WG 4GKKQ 1GD7A 1UWVA 4OWTB 1AE3A 1X3FA 2NVYH 5IP7G 3S1RH 4LF9Q 3NELA 1YVCA 2ZJQA 2I5HA 4QIWE 4B3TL 4B3RL 4GKJL 3GTKH 1GKHA 5C0XJ 2JA5H 1ASYA 1TWHH 2KHJA 4O0AA 4DV3L 3UE1A 4JV5Q 4LUOA 3J81j 1UE5A 4OXPA 3PO3G 1VQNA 2YTYA 3CCVA 4A3FG 3D0FA 3T1HL 2K5HA 3F1ZA 4UP7A 4A76A 5M3FG 1XTDA 1NJIC 1N33Q 4EQ5A 3PSIA 1ASZA 2E8GA 1WYDA 5HGQA 1VQDA 4C2MH 1U0LA 4A3GH 1FVIA 4DR2Q 1E1TA 3E9HA 4OO1G 4YWKA 5ELNA 4JI7Q 3CCJA 1W2BA 5M3MH 1G51A 4AH6A 4LF7L 1U5KA 1K8AC 4QJFA 5IYCH 3CCRA 4B3TQ 2JA7G 1WCMG 3U50C 4A3LH 5JJIA 4GLAC 4JBKA 1B7YB 5LMUQ 3PGZA 4JI0Q 4KHPL 2Q2TA 2GN5A 3RZDH 4DUYQ 2JA8H 2IX1A 2N78A 4A93H 1PH3A 5J3BA 3TS2A 3RLNA 5FJ8G 4A3DG 2UXBL 2HHHL 1N34Q 3L2PA 4DUZQ 1P16A 2OQ0A 5IP9G 2A1AA 1KXLA 4LF8Q 4YY3L 1HJPA 2MQHA 4PMWA 3S16H 2CWAA 4IFDG 1K0RA 5DLQE 1IBLL 3RNUA 4DAMA 1WI5A 2A19A 2LXKA 4DAYB 1HZAA 4DK3C 2OCEA 3PIPA 4YY3Q 4A3CG 4QL5A 2PMZE 4DV1Q 4A3KG 3GTPH 5JEAJ 4JYAQ 4LFBQ 5IE8A 4A3BG 1VQIA 2E2IH 1YITA 4NXNL 1WOCA 4BBSH 1QVGA 3BU2A 2JA6G 1OXTA 3ICEA 2ZTDA 4JG2A 1HNXQ 1OXUA 1TWGH 2H5XA 3H0GH 1B8AA 5C44G 3CMEA 4DR5L 2XTIA 1XMOL 2JEBI 3PF5A 2UUCQ 1QZHA 1D8LA 4C3IH 1YZ6A 2WB1E 1X6OA 1KC8C 1KL9A 4JOIA 3UDXA 4DNIA 2UXBQ 2JQOA 1S40A 1IL2A 5C4XG 1OXSC 3BZKA 3KDFA 1L1OC 1L2FA 5BR8Q 3KJPA 1MJCA 3OW2A 3TS0A 2BA1A 3S2DH 4LNQA 1EIFA 2YTVA 3G48A 3HOYH 5K36G 1K9MC 1IBLQ 1Q1BA 3HOVH 1OTCA 3I4NH 1HNXL 4J15A 1Q8KA 3ULLA 4A4IA 2VQEQ 2EQSA 2CCZA 1IBKQ 1N9WA 3CPFA 4H02A 4HJ9A 4YCWA 3CCSA 2PI2E 3G71A 1VQOA 4LUZA 2UUCL 1TWCH 4BY7G 3EN2A 1M1KC 2YTXA 4AIMA 3A0JA 4LFCL 3RLFA 5JJKA 1I5FA 3RZOH 3CC7A 1JJGA 4A3JG 1MIUA 4JI0L 2R93H 2NVXH 1E22A 4QGUA 4TQUS 4KI0A 2K50A 2Q2UA 1D7QA 4IJLA 2F4VQ 4YCVA 5BR8L 1Q7YC 1H95A 3FKIG 3F8TA 2ZTEA 4DR3Q 4A3EH 3HKZE 4OWXB 1AH9A 3JAMc 3DLLA 3CXCA 1VQ5A 3TEHB 3HOZG 2A8VA 3U4ZA 3KF6A 2B29A 3UE0A 3SGIA 4MNOA 3KFUA 2IHEA 1X54A 1A8VA 4DR6Q 3PO2H 1QUQA 4C3JH 3U58A 4HJ7A 5IYDH 1EUJA 4JOIC 3PV0A 1SMXA 3CCEA 4LF7Q 2EXDA 4DV7L 2NVQH 2PQAB 3K81C 4RMFA 4X65Q 4L5QA 3AEVA 2R7ZH 5C3EG 3ER0A 2PI2A 1NMFA 4P72A 1SN8A 1VQJA 2KCMA 1IXRA 1PV4A 2IY5B 3L0OA 5EAYA 2HQLA 1OXVA 4X65L 1Y14B 1PVOA 3W5OA 5FLXc 1VS0A 5LMUL 1CSPA 4A3IH 2K52A 4A75A 1R9TH 4DV5L 1QUQB 3ULPA 3CF5A 1JJCB 2LSSA 3OTOQ 2ZM6L 4ME3A 1I94L 4DV3Q 4R4IA 1PYSB 2D0PA 2UXCQ 1KD1C 3ULJA 1C7YA
chains in the Genus database with same CATH superfamily
1I6VC 4DUZL 4ABNA 1TVXA 5IT9c 5AJ3L 3I4MG 2PPBC 1SYGA 1VQAA 2CKZB 2KCCA 3VA7A 2FFKB 1FR3A 2J0TD 3MXNB 3J81c 2I0QA 5T1GA 5IYBG 2Z6KA 1DJRD 4L8JA 3KLWA 3CC4A 4DV2L 4RH6A 4RCOA 4DN4M 4DXGA 2AWNA 3KDFB 1PH5A 2CH4W 4R1JA 1G6PA 4J8QA 5C4JB 4KHZA 1TU2B 1DONA 2KA7A 4X62Q 4HMIA 2ZXOA 2KUMA 4LF4L 5KNBA 5GAGC 3PUYA 2LS01 4HAEA 4DR6L 3T1YL 5LMNL 1LTID 2LKVA 2NWGA 1EOVA 4UHVA 4IURA 3HOUH 2VQEL 3I7FA 4DR7Q 1I4PA 1TS5A 3HOUB 2F1MA 1RODA 4YHHL 2F0TA 5FLXE 3DM3A 3TP5A 2HCCA 2MGSA 2IL8A 2V1CC 4MTNA 3C3LA 1EQVA 4UP9A 2OT2A 3GTPH 2CWPA 1JICA 4XQJA 1A0IA 1EWIA 1Q3LA 2VUMG 4K6DA 2PQAA 2JJQA 4IPGA 4K2LA 1PDQA 5GADC 4R8NA 2HT1A 1IBKL 2VUMH 3EFXD 1F9PA 3FKIB 2XWJB 3OIPA 4RGMA 5EPLA 2K6AA 1ZXTA 5EKKA 3S15H 1PA6A 1EYGA 1RJTA 1YIJA 4DR1Q 3KYHC 2ASBA 4FF2A 3HZXA 1X65A 3VYRA 1MSGA 3PQIA 3STBC 2VZAA 4GLVB 1F2MA 2B2TA 2VQFQ 1QOHA 2EVBA 2LXJA 2MO0A 2V4DA 1WTVA 2CFMA 2RF4A 4F7XA 1PH6A 2EJFC 3DMUA 2A6HD 4P71A 4ZKBB 3NQIA 3GTGH 2H4OA 4L5TA 2R6GA 3R2TA 1PH8A 1YNXA 4NB3A 2A6HC 2B2WA 4HCEA 4A3IG 2WAQE 1W6KA 1VQ4A 3V2TA 1XJVA 1X32A 1T9HA 2N8NA 2K01A 4NKLA 2LFNA 1WTQA 3STBD 2R7ZG 4IFDH 3BVGA 5ELOA 5C0XG 4IZ8A 1A63A 4P73A 1U4RA 3M4OB 5C4XH 1YJNA 2OWOA 4A3DH 4QY7A 3GTLH 2IWHA 1STYA 1G6ZA 4JI1Q 2EY5A 5IGCA 1A62A 1G2SA 2B8FA 3I4MH 2DNCA 1BQQT 3GTMH 3BVZA 1VQBA 2SOBA 1YJWA 3S14H 1VQFA 1J9OA 1WJJA 3KF8A 3GDEA 1XNRQ 1NSNS 4JBJA 1IL8A 3OYYA 1RTOA 5ELCA 1IZ6A 3NP8A 1ZEQX 4TVAB 5KNDA 1E1OA 2UUAL 3M3YH 2ATWA 1VQGA 1HH2P 3T13A 4A3EB 1EWCA 3UI2A 1PH9A 1TT2A 3WDNA 3D31A 5CMDA 2MP1A 1HTPA 1KAWA 4KKUA 1L1OB 4R9WA 5ELBA 3CCLA 4RKLA 2VW9A 2NVQB 1X3EA 1JOQA 5IGDA 4O42A 5IOCA 4JI7L 1N34L 1N36L 4ME5A 4LF6Q 3CRKC 1TR5A 5IT9L 3EIVA 4BXXH 2B8GA 3EA6A 2KEDA 1A3VA 4N9PA 4YHHQ 2CW0D 3Q24A 4K0KL 2IT1A 2YV5A 2IHFA 3D3RA 2VL6A 1VQKA 2B2UC 3TMEA 2JA6H 2CW0C 1BDOA 2L12A 3NENA 4XDXA 4FXKC 2Y0SG 3O13A 2EPBA 4X3TA 2QEXA 2J4XA 4XIGS 3K57A 3S2HB 3I4NB 1Q1EA 1ZKOA 1J5EQ 1WTWA 1I6HH 1EYCA 5AJ3Q 1AN8A 1GO3E 4CDCC 2E2DC 1UE6A 3QWNA 1CSQA 1G291 1JMCA 4Q5VA 2K5NA 3E6ZX 3M7NA 3HOVB 3OTOL 4DGZA 5ELFA 4C3IG 3K5LA 4A93G 2E2HH 1PTOH 3DM1A 3H91A 5CV6A 3M9BA 1GUWA 3ZJYC 2QDBA 3HKZG 2L5TA 3DHQA 4IJHA 4DR4Q 3K7AH 5T1IA 4GNXA 3UDFA 2X6GA 4BY1B 1JWMD 2NUCA 5ELDA 1G8ZD 2FJ2A 1C0AA 4DR4L 4PZ6A 3DEPA 3X3NA 4A3FH 2FXQA 5HGTA 1WCMB 3FVQA 3EBEA 3N6RA 1E2ZA 2K5QA 1CKNA 2HUGA 1O7LA 3GTOB 4I7AA 4L5RC 2K5DA 5IP7H 3C46A 3S1QB 4GOPA 1EY0A 1C8CA 2K4KA 2RHQB 4WJ3M 2EYJA 1DOMA 1A6XA 3W3AA 1HCZA 4JYAL 4LFBL 4BY1H 5M5YB 3HOWG 3VR3A 4GN5A 3MFGA 1F2ZA 4ZYSA 3G7LA 5H1SE 4H44C 4B3SL 1R9TB 4DAPA 1B4OA 1KDBA 1EL0A 3ZYYX 4IO9A 1IYVA 1N33L 4OX9L 1ILPA 4GOPC 2NZHA 1W3SA 3I70A 4CKCA 3Q0AA 3SVMA 2Z6KC 3NWSA 4OX9Q 4R4TA 4FXGC 2XNAC 4PV1C 1XNQQ 3HG9A 2ZTCA 4R4QA 2NN6I 4GLXA 2I5LX 4QIWB 2N3SA 3K80C 2NZOA 1H9SA 3J81i 1LYLA 4B3ML 3I55A 3HOWH 1NY4A 4BY1G 1HZ9A 5GAHC 1GD7A 1UWVA 4OWTB 5CV4A 2NVYH 2EE1A 1LABA 3H6MA 4KY5A 1YVCA 4QIWE 4DF7A 1EY6A 1MD2D 5LL6X 5C0XJ 4O0AA 2B2YC 5ISRA 4OXPA 3PO3G 1VQNA 4GZYC 4WORA 4A3FG 3T1HL 3GTJB 4EGVA 3P1HA 1XTDA 1NJIC 2XVSA 1ASZA 2D9UA 1ENFA 1WYDA 2E8GA 4C2MH 1U0LA 4OIJA 3E9HA 4OO1G 5ELNA 1MHWC 3Q6SA 2WB1B 1D6EC 3MFYA 4QJFA 4C2MB 4B3TQ 1HQMC 1L0XB 2WKDA 2HDLA 3QB3A 1SNQA 2GN5A 4DUYQ 1B1ZA 2WACA 2IX1A 1PH3A 4BBSB 1ILQA 3RLNA 3L2PA 2OQ0A 1TY0A 3URYA 1KXLA 1XTCD 1LACA 4PMWA 4UAIA 3FMCA 4ZAIA 1K0RA 5DLQE 3RNUA 2OEOA 2K33A 1HZAA 4DK3C 3PIPA 1K83B 4R8IA 1QILA 4DV1Q 4A3KG 1PRTC 5JEAJ 2F0WA 1VQIA 5E1FA 2J7ZA 4K2KA 2JA6G 1OXTA 4F88A 2FMMA 4JVZA 1HNXQ 2H5XA 1B8AA 4G7HC 1XMOL 3DEOA 1HA6A 2EYOA 2XRSD 1ZYRC 3MA2B 5CGKA 1KLGD 4I65A 1YZ6A 3HOYB 1X6OA 1KC8C 4JOIA 5BN5A 2UXBQ 2EY2A 2JQOA 3TN2A 2JSOA 1ZYRD 5BR8Q 1EY8A 3KJPA 3MEHA 2YTVA 2QF7A 4C3IB 3K58A 2K03A 4CBVA 1BOSA 2B2VC 3A7AB 3MTSA 4IUNA 1OTCA 3HOVH 1LT6D 1HNXL 1YNNC 3HRZC 1Q8KA 2ZXPA 4HR7B 2M9VA 1IBKQ 3CPFA 4H02A 3K6OA 1GXDC 1I6HB 3J81E 4QCLA 4AIMA 4X3UA 5G3LD 4LFCL 5JJKA 3CC7A 1MIUA 4OEMB 1ICWA 1E22A 2EY1A 4QGUA 2K50A 2Q2UA 1Q7YC 3C1FA 2OXPA 1SBBB 1DOKA 3SHLA 4A3EH 3DLLA 3CXCA 1VQ5A 2NVXB 3HOZG 1IHZA 3QO2A 3UE0A 3K0YA 3SGIA 3GQBA 2IHEA 2RDHA 4C3JH 1A3UA 4HJ7A 3U58A 1YNJC 1LTRD 2PZWA 3D4WA 1PTOF 3SK5A 3PV0A 3U9OA 1SMXA 2NVQH 1PYWD 1SN8A 2KCMA 1Y1WB 1PXUA 3NTIA 1PVOA 1GUOA 5FK9C 5FO7B 2F0NA 4A75A 1D2BA 1II3A 3P7JA 1KD1C 1EU3A 1WVLA 2XN9C 3Q8DA 1SAPA 3OWEB 4NXMQ 2CQOA 2Q8TA 4KTAA 1EEFD 1H9KA 4WJ4A 4FNFA 3D4RA 3J80E 3BDLA 5COYA 3PO3B 3CW2C 1LUZA 1UEBA 4RGTA 3OMGA 3M7GA 2D0OA 2YYZA 1Q82C 3NXWA 4JI6L 1OO9B 2A68C 1JQYD 1CKMA 5IWAQ 3RR5A 2R3ZA 3E9IA 3IAYA 1XMQQ 4X64L 1RIPA 1DYQA 4ZQ3A 4UP8A 2JK8A 1PTOB 1RD9D 4DV6Q 1VF5C 3RN5A 3J80L 1AFPA 2A5HA 3K7AB 3J7AF 2NBFA 2AQ3B 3HP3A 3S14B 4C3HH 4PZ8A 3QOLA 4DKAC 3MVVA 3FKIH 1VQCA 1V9PA 2Q2HA 1CZWA 1YI2A 3S1MH 4JI4L 3IRBA 4FP5D 3CCMA 2UU9L 2BCOA 3KF6B 5LMNQ 4KN7C 4DNRB 4LW1A 3UDGA 1K3RA 3H3VC 3SR1A 3FP9A 2BDOA 1L0YB 2AWOA 1MKHA 2Z1CA 5A2QE 3DWPA 3T4AC 5IYBH 2F0KA 5LHY1 1EY7A 2VXWA 4BWGB 1Z9FA 1J5EL 4LF4Q 1ENAA 3IKJA 3G6JB 3MXUA 3F2CA 4JI5Q 1YEZA 1CA5A 4A3EG 3AYHB 3I72A 2ES2A 1E3PA 1Q86C 5JPNC 4DV2Q 4JI8L 1QZGA 1EY5A 2R92G 3J7AV 4A3BB 4DV1L 4XT3B 4A3IB 1VQ8A 1TQOA 4Y52H 4KN4C 1Q46A 2KHSA 2DNEA 2OQKA 4DU9A 5E4WC 3VR6A 1KDCA 1N36Q 1JB3A 1X3GA 3KBGA 1EEID 3NBIA 1N32L 3TBIB 4JI4Q 2KHIA 1B3AA 3HOVG 2Y0SE 1I4XA 2VB2X 2DUDA 5C44B 3CKIB 4AQYL 3OSOA 5IYDG 3S1NH 4IOAA 2D2CC 1XXGA 3PUWA 4K5WA 3PIOA 3P75A 1YHAA 4O2DA 1B53A 2RCNA 3FHWA 2EY6A 2K5VA 1NCVA 5I6WA 5G3LF 4A3LG 5IYCG 1RF2D 1N8RC 1SE8A 2VY3A 5EBDA 1YJ9A 1PZID 3VR5A 1E2WA 2JA8B 3VYTA 3ERQA 3A8JE 1PH2A 5JJZA 1BBWA 1BBXC 3M4OH 1WTPA 2ZJPA 4JI6Q 4JI5L 5M3FH 4DV4Q 2MO1A 4XYOA 4FDBA 1IBML 2A6ED 3CD6A 3H15A 3OPOA 3A8KE 1B44D 1RHPA 4A3JB 1XMQL 2AQ1B 1XPOA 1DGSA 2Q2IA 1QNUA 2EYMA 1SDFA 4N9TA 1KABA 2F0UA 2RA4A 4WJWA 2O5JC 3H09A 4X3KA 5DM73 4XXEA 4QQBX 1KHIA 3JAMi 5I9OA 4K0KQ 1SE2A 2JA8G 2WB1G 1JT8A 1PYBA 4MN3A 2E2IB 1UUPA 1NTGA 1WCMH 4LAAA 5D3DA 1SR3A 1PHJA 3D8GA 5IGGA 2F3VA 3I56A 1PZJD 2HIVA 3S2DB 3NE5B 4HIMA 2ZXRA 5E4XA 4BY7H 4KY6A 3MC0B 5A35A 1BCPD 4A3BH 3OHXC 4RCNA 3UDIA 4APVA 1K73C 1VQ9A 4TKOB 3E0JA 3KLRA 4CGYB 1K8GA 5FO9B 1EQQA 4ULLA 3HS0C 3E0EA 1C48A 3M4YA 4X6AH 2EOTA 3CCUA 2DGYA 1JE5A 4R4CA 3W1BA 4RWSC 4IALA 3J80c 1EYDA 4KHPQ 1K8OA 1BKBA 1Y1VG 4K14A 1SNCA 4LFAQ 4AQYQ 4OIKA 2KENA 4LFCQ 4X66Q 1BF4A 1T5XD 4DV6L 1JJ2A 1AZPA 4HIDA 2WINB 2ZJRA 3S1QH 3KK7A 4X64Q 2ZM6Q 3S1NB 4ZKCB 4ALPA 3NBHB 3TRZA 3D4DA 5KYIA 1DD2A 4RHRA 3PUXA 5BN3A 1HHVA 3GO5A 1H9MA 2L0CA 3NK9A 1IYUA 1YNJD 4LF8L 4Y7NH 1Y1VH 2B39A 1I4RA 4ILWA 1LTLA 2NB0A 3K0XA 1EQTA 1D1IA 3NTHA 5I2XA 2L4NA 3E3XA 2VUMB 1H9RA 3CPWA 1CKNB 2Q8RE 3I4OA 3MHBA 5M5XH 1HPCA 4A93B 5FLMH 2K28A 2BH2A 4F8MA 2F0JA 1PFBA 3PF4A 2HIXA 1BO0A 4S3SA 3I73A 2B2YA 3GTJH 1HNZQ 1V43A 2F52A 2CH4A 5FO8B 1KTKA 1J6QA 1NBWA 2AQ2B 2A68D 4DAVA 4HJ5A 1Y1WG 1AE3A 3F2UA 4LF9Q 2I5HA 1KDAA 4B3TL 4B3RL 3GTKH 1ASYA 1TKWB 2KHJA 4RGNA 5CV7A 4LUOA 3J81j 1F2LA 2H1EA 3D0FA 2K5HA 1ONLA 4A76A 1CQFA 1R4QB 4DK1A 1VQDA 1SE4A 1CI3M 2I07B 3A7LA 4A3GH 1O78A 1E1TA 1UAPA 5I9PA 3CCJA 1G51A 3LX0A 4LF7L 1K8AC 2XRQD 4KY7A 4ODGA 4A3LH 1STHA 4UDUC 3LNNA 4GLAC 5DEHA 2HCIA 4BBRB 1V1PA 2Q2TA 2EJMA 1LLRD 1STBA 5I2YA 3HEJA 1SYEA 4OL7A 3TS2A 2UXBL 5FJ8G 3R8BA 3NPPA 2HHHL 4Y7NB 3DUZA 4N8FA 5IP9G 1EYAA 2JXMB 1HJPA 3S15B 3TZUA 3S16H 2PMZB 3ITPA 2E2JB 2CWAA 2F0PA 4JK1C 1WI5A 2A19A 4DAYB 1DXMA 2KEEA 2OCEA 1WTOA 3D6WA 1RDPD 1CZGA 2SDFA 1FGBD 4A3BG 4NW2A 1Q8IA 4NXNL 1SEBD 3T16A 3PIP3 4JG2A 4CJ2C 1K0SA 3MXNA 1VMCA 2XTIA 1FNWA 3RUZA 3PF5A 2UUCQ 1QZHA 3VA5A 3QG1A 2O4XA 1D8LA 1D1KA 4C3IH 1FNUA 3SDZA 2KJXA 2M2LA 2TSSA 1JCKB 1IL2A 5C4XG 3KDFA 2VB3X 3OW2A 3TS0A 3S2DH 1GUSA 3TSSA 1EIFA 4LNQA 3HOYH 1S5BD 1S5ED 1IBLQ 1Q1BA 2L1BA 1NNXA 1U4PA 5EPKA 4HJ9A 1EY4A 2Z9HA 3BYTB 5KYLA 1QNKA 2UUCL 3PO2B 3EN2A 2YTXA 3VR2A 4DXFA 3GTLB 3CHBD 1QG7A 4B9XA 1I5FA 1KNEA 1QCBD 4A3JG 1DM0B 3NUCA 2NVXH 2R93H 4TQUS 2F4VQ 4YCVA 2CVRA 5BR8L 3GTKB 2EYPA 2IPKD 3FKIG 3F8TA 1SSOA 3HKZE 4OWXB 1SNMA 3JAMc 4G7ZC 4BS9A 1IKLA 2KECA 1RTNA 2ZT9C 3KFUA 1X54A 4DR6Q 2QW7A 3VYSA 1EUJA 4HEDA 4KJOA 4LF7Q 2EXDA 2PQAB 3AEVA 2X6LA 4TRDA 4P72A 2PQEA 1LTSD 1IXRA 2IY5B 1O80A 3L0OA 5EAYA 1WTXA 1OXVA 2F0FA 3W5OA 5FLXc 1VS0A 4N8X1 3ULPA 3S1MB 2LSSA 1I94L 5FOBB 1C4QA 3ULJA 4H13C 2C35B 3WOEA 3NSWA 2E2JH 1M90C 2A69D 1QJOA 3PUZA 1VQPA 2E5LQ 2Y0SB 4K5VA 3J7YW 2UXDQ 4A3DB 5EQ0A 2BA0A 4DV5Q 2NN6H 4YWMA 4JBMA 1BUVT 2UXDL 2MNAA 3S17B 1B50A 1SLJA 1YNND 1S5FD 2MUYA 1NE3A 5DM63 2QGQA 4C56C 5C3EH 3Q23A 4P2CB 4LWCA 2EJGC 1SJHD 2E75C 4C3JG 1TIID 1RL2A 1Y8PB 2ICIA 3A8IE 2JA5B 3X3MA 1YBYA 2OTLA 4KD3A 5CYUA 1CUKA 1GOZA 3TZDA 1XNRL 2F0LA 1G91A 5JOBA 1ML0D 2I46A 3IL8A 4GN4B 4XT1B 2EYLA 4B3MQ 5AFWA 1HZBA 1AP0A 3KUPA 3BYYB 3OW7A 4M1UB 3F2BA 2N55A 1PZKD 2O2LD 1HZCA 3A54A 1X3PA 3GTOH 4L63B 1SFOH 3EVQA 1Q12A 2YU9B 1MJEA 2Z6BA 1Y8OB 1C9OA 3BJUA 1BCPF 3B6YA 5JEAG 1JWUD 1JB7A 1TWFB 5EPJA 3SE0A 1FJGQ 3CC2A 3NQTA 1L1OA 3D6CA 2Z4IA 4GN3B 1SE3A 2G5DA 3MWYW 4EQOA 1KLUD 3VR4A 3TP7A 1KQSA 1FYCA 4DR5Q 1VQLA 1HA5A 2FHTA 5FKAC 4HIKA 2YU9H 3A5UA 1FD7D 5EKLA 1IBMQ 1P8LA 3IFTA 4HJ8A 1VCIA 5KIXA 5E7NA 2C5CA 1XPUA 2R93G 3CCQA 1EIYB 3AMUA 3HOUG 4XTCS 1PH1A 5M5WB 1CQVA 2IJ0A 5LMNW 1X55A 4JPBW 3GTQB 2JA9A 5J22A 3A56A 2UUAQ 4DR1L 5D3IB 1FL0A 4KV6A 4EQNA 2EDGA 3E5SA 1BCPB 2QILA 1S3OA 4IQZA 2A73B 1TS4A 2R7FA 3HOYG 1GHJA 4NDXA 5EJWA 4KJNA 3GTGB 3PO2G 3PIO3 4YWLA 5TSSA 1EQRA 2AKWB 1SMYD 2SNMA 3I2ZA 5CV5A 1XNQL 3WWVA 4DV0Q 2A6EC 3J80i 4V190 2BH8A 1CHPD 3JC66 2IX0A 5J39A 1SMYC 2AUJD 4GNXB 3MAQA 2KVMA 2UUBL 1QVCA 3OIQA 1CA6A 1D5ZC 2JN4A 4RGOS 3NEMA 1KAAA 4HN7A 1GHKA 3C2PA 4GKJQ 4A3CH 1SNOA 4NP5A 2PYKA 5EGTA 4PMCA 4YIJA 3H3VI 5IGBA 4XYQA 1O7YA 2F0SA 4KHVA 3DWQA 3I8ZA 4WRDA 1PFNA 4IFDJ 1JWSD 1EU4A 2PNHA 5D65A 1NMGA 1LTBD 2F0GA 3I90A 4DNTB 2PW5A 1B70B 1M8AA 2EYFA 2ID0A 4OWWB 5M3FB 3M4PA 3TREA 3NTKA 5JAVA 5C4HA 1I50B 3K7UC 3R3OA 3HKSA 4A3JH 1G2TA 5CV8A 2F03A 5C4ZA 4K8JA 5KRUA 4XQNA 3QJYA 1HNWL 3NHHA 3Q22A 2E5LL 3EROA 1H9SB 1EZ6A 4FF1A 2NZ1D 5M5YH 4DUYL 1EFWA 1DOLA 2LMCB 1PH4A 4BA1I 1X9NA 1PMRA 4FF3A 1STAA 2QKIC 1STEA 1AEXA 5IT9E 2PCFB 1S72A 4POGA 4CKBA 2MHVA 1EZ8A 3R93A 1E2VA 4NMZA 4AYBG 3BG3A 1T5EA 4PQXA 2F0EA 2IW3A 4LJZC 3PCOB 1UE1A 4JI3L 4DK6C 3GD7A 4YCUA 4NXNQ 1B9NA 2F3IA 4A3MH 2B63H 2KQ3A 3T53B 4IPDA 2EZVA 2JEAI 4GKKL 4OO1H 1O7IA 4BBRH 4HMJA 4A3MG 2B63G 3KF8B 4GNXC 4O1NA 4OONA 3PMFA 1STGA 3CAMA 1E0BA 2X69A 1X56A 1EFID 2UU9Q 5CR3A 2XIWA 4DV0L 2KBNA 3ERSX 1A2UA 2Z8LA 4X3SA 4HSPA 1GM5A 5GROA 1KRTA 2B2VA 2UUBQ 5FJ8H 1CT1D 3T51B 1VQ6A 3AU7A 2QEJC 1LT3D 3NBHA 3CMAA 2WIIB 3HOXG 1JC7A 1SNDA 2BDNA 1EY9A 3GV3A 4DA2A 2IX3A 4IUPA 4QMGA 2K14A 4HJAA 5GQOA 2M00A 4CDDC 1VQMA 4A3GG 1ESFA 2D62A 4JI1L 4RKBA 3S17H 4EVOA 1BBUA 1ET6A 1XPRA 2MFIA 4DV7Q 3S1RB 2L11A 1Q90A 4BXXG 1F9RA 1VQ7A 4A3MB 2B63B 5JVH3 3GP7A 1IYJB 3JAML 5KNCA 4KK7A 1BNZA 3S1RH 2RDFA 3OOCA 5IP7G 2PZUA 4CKEA 3BDOA 1GKHA 3K59A 3UE1A 4JV5Q 3GV6A 1UE5A 2YTYA 3CCVA 1TWGB 4AYBB 2K04A 3F1ZA 1TWHB 1N33Q 5HGQA 1FVIA 2MJ8A 1A15A 1K8MA 2RVLA 1W2BA 5M3MH 4AH6A 1I3QB 4MTKA 4J1MA 5CBEE 3I4MB 1WCMG 5HURA 5JJIA 4JBKA 1B7YB 1V1OA 3PGZA 4JI0Q 3RZDH 3W2DA 2F0DA 2JA8H 1JOOA 2N78A 4IN3A 4A93H 1S5CD 5CBAE 1X3QA 4A3DG 2R7ZB 4DUZQ 1TY2A 2PO4A 2A1AA 4LF8Q 1BR9A 2MQHA 1ESRA 1HTLD 1M4VA 4IFDG 1CFMA 1HQRD 1SXTA 4LK1C 1V1PB 4YY3Q 4QL5A 2PMZE 5I4DA 2RKSA 5IE8A 5DAUA 3V05A 4OHJA 4F87A 2R92B 5CV9A 2N88A 2E2IH 4DK0A 3BU2A 1HUNA 2FMCA 2ZTDA 3KLSX 1OXUA 3CMEA 2HDMA 1TS2A 1A2TA 1TWAB 1U4MA 5E3FA 3T56B 1KL9A 3H0GB 4DNIA 2B2TC 1OXSC 1MJCA 3G48A 5K36G 3P20A 1K9MC 1SYCA 1H9JA 1XYIA 1SYDA 4RA8A 2E74C 3I4NH 2MPMA 3ULLA 2VQEQ 2CCZA 1N9WA 1PTOC 2PI2E 4BY7G 3OMCA 2QCPX 2G9HD 3GTPB 5J1ZA 1B2TA 4KKTA 4FXDA 3RLFA 2E76C 2HQEA 5M9OA 1LO5D 1LT4D 2K05A 4JI0L 4KI0A 3MXGA 2LY7A 1F9SA 4DR3Q 1F9QA 2XSCA 2PW7A 3TEHB 2A8VA 4A3FB 3KF6A 4OGQC 4QF4A 4MNOA 3PO2H 1QUQA 5CORA 1TWCB 3CU7A 4WFN3 4KMUC 4JOIC 3CCEA 2BE5C 3K81C 4RMFA 4L5QA 2R93B 2R7ZH 5C3EG 3ER0A 1O7ZA 2PI2A 1NMFA 3FEWX 3MXPA 4CJ0B 1LTGD 2RSOA 5JPMC 2DN8A 1ET9A 4RHSA 5EKIA 2BE5D 2AUKA 2JYOA 3RZDB 5I6YA 4B9WA 4A3IH 3FPUB 2JA6B 2K52A 1R9TH 1SNPA 4DV5L 2A69C 1WTHA 3S9WA 2ZM6L 4R4IA 1PYSB 2D0PA 2UXCQ 1C7YA 2F0QA 1HFGA 2K75A 3S2HH 4CDFC 1XWEA 4JI2Q 3N52A 3I3CA 3H3VH 3MZ5A 1K3BC 4IPCA 3BVMA 1VQHA 2WKCA 1KNAA 4C3HG 4CDEC 3K5OA 3KLSA 3BS1A 3W1GA 2F4IA 1EIHA 3CQZB 1UE7A 3TP8A 1E24A 2L55A 3RN2A 4U673 1LTAD 1NR2A 1PRTF 1EWHA 2JE6I 1I94Q 3CP0A 2OF1A 1YHBA 2GVBA 1Z47A 4B08A 4P74A 2CHBD 1MBYA 1TXYA 4NXML 1NR4A 4C1NK 1TWAH 4C3JB 5IWAL 4NPSA 1E7ZA 3LGJA 4Z9CB 4DPGA 1JR0D 1I4QA 4IUQA 4C3HB 4DFAA 1BVSA 1VF7A 4C1NI 4PNYA 3S24A 1SROA 1FJGL 3M3YB 4IUTA 4HSVA 1WTRA 2F0IA 4QB4A 4DR2L 1F2YA 3IFDA 1QE6A 4FVMA 3J7ZC 1EOTA 1XMOQ 5C4JH 1CM9A 4OO1I 4JV5L 5D14A 4PG3A 1F77A 3M4QA 1J8IA 2NVTH 1HR0Q 1XX8A 1CHQD 3L7ZC 4JI3Q 1TWFH 2EIFA 3R2IA 5IY0A 4DR3L 1EIGA 2VQFL 4JC0A 1GUTA 1MI2A 2QDLA 1A3TA 4FO2A 2SEBD 1HRJA 1LT5D 3G6EA 1FNVA 2NN6G 2UXCL 4PZ7A 4DV4L 1PFSA 4LF6L 2P5ZX 3AFPA 3GTQH 1PRTB 3U4VA 4OELB 4JCVE 1SRUA 3A5ZB 1KIXA 3S16B 3HOZH 3K8AA 1I50H 2NTTA 2XWBB 3I91A 3ND8A 1N32Q 2RBMA 2CQAA 4RG1A 1YHQA 5C44H 3SK6A 4HCSA 2N49A 3A74A 4P75A 1HFNA 2C9OA 3M85A 4EQPA 4MZ9A 4E6IA 4X62L 1DCZA 4HIOA 3F2DA 4KD4A 2AMCB 2RDGA 1RKNA 4POFA 3RD4A 3QR8A 1LTTD 3J7A5 2K1BA 4K8IA 3ONAB 3KOJA 4LF5Q 5K36H 2L9HA 5C5MA 2K5WA 2EXZA 4ZUJA 2KCTA 2JA7B 2WAQG 2WP8J 4K5XA 1PH7A 2XGTA 2Z0SA 1WFQA 1WD0A 2DJGC 4RFBA 3G4SA 1JE4A 3CRLC 2F0VA 2VNUD 1S4ZA 2RHSB 4LF5L 1GUGA 1L0WA 4LUVA 3GTMB 3L9AX 2AHOB 1CKOA 2VS1A 4JW0A 4LFAL 3NWTA 3AFQA 5C5LA 5HY6A 1PLFA 3EQLC 4EX5A 5M5XB 4AYBE 1HNWQ 2JA5G 1GVPA 4J6HA 3A55A 3AB9A 2I5MX 2B2UA 5K5PA 4JBWA 4B3RQ 4JI2L 3HKZB 2BOSA 4UY8C 4GS3A 3SK8A 1Y1WH 4ZK9B 5DNFA 2L15A 2NTSA 1B3QA 2KCNA 3OWFA 5CC4A 4X66L 2EYHA 3T1HQ 3FDTA 3H0GG 2ENBA 4UPAA 4L5SA 1Y69U 4BBSG 4BA2I 1Q81C 2RQXA 3HOWB 1QB5D 2D5DA 1VQEA 3I4NG 3RLOA 1HXYD 3MEFA 4IFDI 2JP1A 1HR0L 1PTOD 1HR0W 5IP9H 2HHHQ 4M8AA 2K32A 3CQZH 3BDCA 1I3QH 1GJXA 4HTHA 2PNRC 4R4OA 5M5WH 3T1YQ 5JJLA 5IODA 4KLKA 5C4XB 1FGUA 4ID6A 4ZLTF 4B3SQ 2JA7H 5C3EB 4G7OC 1STNA 2DJFC 2F4VL 1AE2A 4JYAQ 4LFBQ 1KRSA 3DWAA 1OXXK 2WV6D 4GOPB 3TQYA 1I4GA 2ALYB 4IUUA 1Z7TA 2NYZD 2FINB 4A3KH 3QOJA 2A74C 5NUCA 2GA4B 1LM0A 1Y8NB 1QVFA 5FLXL 4K6LA 2R61A 3HOXH 1S5DD 4G57A 3HFZB 5C3XA 1PFMA 5EBCA 1GUNA 2NVTB 1IKMA 3PUVA 2TMPA 3K5MA 1V1QA 3KBXA 4ZCKA 1K83H 1ICFB 4H7BA 4DR7L 3KJOA 3ND9A 4V0BA 3VDYA 1HNZL 2GVAA 3EJIA 4I7ZC 2R7DA 4LMQD 5GAEC 5C0XI 2OTJA 1VMPA 3FPPA 4LF9L 3TDQA 5M3MG 1Y1VB 4BBRG 5F2DA 1R4PB 2SNSA 5BN4A 5FLMG 3BZCA 4G4KA 5IIFA 3AQQA 4JI8Q 3U9SA 2B3GA 3V96A 2WFWA 4IPHA 3HOZB 4KKSA 3PO3H 1CK1A 1IW7C 3LWUA 1SYFA 2RCFA 4IOCA 2QA4A 4GKKQ 2HD3A 4XQQA 5M3MB 3WOFA 4QUFA 1X3FA 1IW7D 4ZRZA 3NELA 2ZJQA 1HUMA 4GKJL 2JA5H 3L3OC 1TWHH 4DV3L 2Q8IB 4U68A 1SJED 2RSNA 4FYDA 4UP7A 5M3FG 1BXTA 4EQ5A 3PSIA 4DR2Q 2F0MA 4YWKA 4JI7Q 2B2WC 1U5KA 4FF4A 1SYBA 5IYCH 3CCRA 2JA7G 4A3GB 3SEBA 3U50C 5A2QL 3RMHA 2F3WA 4TSSA 1AZQA 5LMUQ 4KHPL 3FRPB 1SFOB 5J3BA 4IUVA 1N34Q 1P16A 3HOXB 4YY3L 3H94A 1VDZA 1IBLL 4DAMA 2LXKA 4A3KB 3VYUA 1I4HA 1UNSA 1NUCA 4A3CG 1JOKA 2DY7A 1CTMA 1TS3A 2G9DA 3JAME 1YITA 5ELEA 1WOCA 4BBSH 5IGEA 1QVGA 1DZ1A 4L6TB 3BZDB 3ICEA 1UEAB 1MSHA 2WAQB 1TWGH 2K7VA 3H0GH 5C44G 5IGFA 4DR5L 2JEBI 5C3WA 3LWEA 5C6AA 2WB1E 2F0OA 4PMBA 2O5IC 3QIAA 3UDXA 1Z6HA 1S40A 4BY7B 3HGBA 5JVG3 3BZKA 1L1OC 1L2FA 2BA1A 2PZTA 5L37A 5C0XH 1ENCA 1PRTD 1AW7A 3SK4A 2NVYB 4CHTB 1BCPC 4J15A 2DY8A 4A4IA 2EQSA 3RZOB 1U4LA 1JORA 4YCWA 3CCSA 1WD1A 1VQOA 3G71A 4LUZA 1TWCH 4ZUIA 1M1KC 1V8QA 3A0JA 3TP6A 3RZOH 1JJGA 2E2HB 1NAPA 1D7QA 4IJLA 1H95A 1D5XC 2ZTEA 5KGUA 4QUCA 1U9RA 1AH9A 3C1EA 1D5MC 3U4ZA 2B29A 4CJ1B 4MIUA 1A8VA 3J81L 3SXHA 3K5NA 2Z4HA 1RCVD 5IYDH 4DV7L 4X65Q 1LV9A 4H0LC 1VQJA 1PV4A 2HQLA 5JEAH 4X65L 1W6JA 1MGSA 1QWYA 1Y14B 4DAYA 5KEEA 5LMUL 5LL6S 1CSPA 2F0HA 1QUQB 4MHEA 4RAUC 3CF5A 1JJCB 3OTOQ 1B9MA 2ICEC 4ME3A 3DXJC 4DV3Q 1K28A 3I4LA 2KOLA 2R92H 4Q0FA
chains in the Genus database with same CATH topology
2C35B 1G6PA 2K75A 4DUZL 3S2HH 4JI2Q 2E2JH 5IT9c 5AJ3L 3Q8DA 3H3VH 3I4MG 1M90C 1VQAA 4IPCA 4NXMQ 1VQHA 2CKZB 2CQOA 3MXNB 3J81c 4WJ4A 3PUZA 1VQPA 3W1GA 2E5LQ 2I0QA 3CW2C 1UE7A 1LUZA 1UEBA 2UXDQ 5IYBG 2Z6KA 1E24A 3KLWA 3RN2A 3CC4A 4DV2L 2D0OA 2BA0A 2AWNA 2JE6I 2YYZA 1Q82C 3KDFB 1I94Q 3CP0A 4JI6L 4DV5Q 1PH5A 4R1JA 4YWMA 1YHBA 4JBMA 2MNAA 2GVBA 2UXDL 1CKMA 1SLJA 1Z47A 4KHZA 5IWAQ 3RR5A 4X62Q 3E9IA 4LF4L 4P74A 1NE3A 5GAGC 2QGQA 1TXYA 3PUYA 1XMQQ 5C3EH 4X64L 4NXML 4DR6L 1RIPA 1TWAH 5IWAL 3T1YL 4NPSA 5LMNL 1E7ZA 1EOVA 3LGJA 4UP8A 4DPGA 2JK8A 4LWCA 3HOUH 1BVSA 2VQEL 3M3YH 4DV6Q 3I7FA 4DR7Q 3S24A 1RL2A 3RN5A 1SROA 1FJGL 1YBYA 2OTLA 1CUKA 4DR2L 4C3HH 1XNRL 3J7ZC 4PZ8A 4YHHL 1XMOQ 5C4JH 4DKAC 4GN4B 4OO1I 3DM3A 4JV5L 3FKIH 4B3MQ 4PG3A 1VQCA 1V9PA 2Q2HA 1HZBA 1YI2A 3S1MH 3M4QA 4JI4L 2V1CC 3IRBA 4MTNA 4UP9A 3CCMA 2UU9L 2NVTH 1HR0Q 4JI3Q 3L7ZC 3KF6B 3F2BA 5LMNQ 1TWFH 2CWPA 2EIFA 1HZCA 5IY0A 4DR3L 3GTOH 4LW1A 2VQFL 1SFOH 1A0IA 1EWIA 1Q12A 4JC0A 3UDGA 1MJEA 2VUMG 1C9OA 1K3RA 3BJUA 3B6YA 4GKJQ 5JEAG 1JB7A 2PQAA 2JJQA 4IPGA 1FJGQ 3CC2A 3FP9A 5GADC 2HT1A 3G6EA 1IBKL 2VUMH 1L1OA 2AWOA 2NN6G 2UXCL 4GN3B 4PZ7A 1PFSA 4DV4L 4LF6L 1MKHA 3AFPA 3S15H 1PA6A 1EYGA 3GTQH 1YIJA 5IYBH 4DR1Q 3KYHC 2ASBA 1KQSA 3U4VA 1X65A 4JCVE 4DR5Q 1VQLA 1SRUA 1Z9FA 3A5ZB 2VZAA 4GLVB 3STBC 1J5EL 1KIXA 2VQFQ 2LXJA 2MO0A 4LF4Q 3HOZH 3K8AA 3F2CA 1I50H 4HIKA 2YU9H 4JI5Q 1N32Q 1YEZA 2CFMA 3A5UA 2RF4A 4A3EG 3AYHB 2ES2A 1PH6A 1IBMQ 1P8LA 1E3PA 4RG1A 1YHQA 1Q86C 4HJ8A 5C44H 4DV2Q 4JI8L 1VCIA 4P71A 5E7NA 1QZGA 2N49A 3A74A 2R92G 3GTGH 4P75A 1XPUA 2R93G 3CCQA 4DV1L 1EIYB 4L5TA 2R6GA 3M85A 4MZ9A 3HOUG 4XTCS 4X62L 1PH8A 1VQ8A 1PH1A 1YNXA 4NB3A 5LMNW 3F2DA 1X55A 4HIOA 4A3IG 4Y52H 2JA9A 2WAQE 1Q46A 2AMCB 1VQ4A 4POFA 2UUAQ 1XJVA 2OQKA 4DR1L 2N8NA 1T9HA 1N36Q 1FL0A 1X3GA 3J7A5 3STBD 1N32L 2R7ZG 4JI4Q 2KHIA 3HOVG 1S3OA 2Y0SE 3KOJA 4LF5Q 2R7FA 2DUDA 5ELOA 5C0XG 3HOYG 4AQYL 1A63A 4P73A 5IYDG 3S1NH 4IOAA 3PO2G 5C4XH 1YJNA 4YWLA 2OWOA 4A3DH 3PUWA 1EQRA 4QY7A 3PIOA 3GTLH 1YHAA 4O2DA 2KCTA 2RCNA 2AKWB 3I2ZA 3FHWA 2WAQG 2WP8J 4JI1Q 3WWVA 4DV0Q 1XNQL 3J80i 1PH7A 1A62A 2BH8A 2K5VA 2XGTA 2Z0SA 3I4MH 1WFQA 3JC66 3GTMH 2IX0A 1VQBA 4A3LG 3G4SA 5IYCG 1YJWA 4GNXB 1SE8A 1N8RC 2VY3A 3S14H 1YJ9A 2VNUD 1VQFA 1WJJA 2UUBL 2RHSB 4LF5L 3GDEA 1QVCA 1L0WA 1XNRQ 4LUVA 4JBJA 1PH2A 3NEMA 3OYYA 1BBWA 3M4OH 2AHOB 1IZ6A 2ZJPA 4JI6Q 4JI5L 5M3FH 4TVAB 4DV4Q 1E1OA 1CKOA 2MO1A 2VS1A 4FDBA 1VQGA 2UUAL 2ATWA 1IBML 1HH2P 3CD6A 4A3CH 3H15A 4LFAL 3AFQA 1PH9A 5HY6A 3H3VI 4EX5A 3D31A 1XMQL 1XPOA 4AYBE 1HNWQ 2JA5G 1DGSA 1GVPA 2Q2IA 1KAWA 1L1OB 3CCLA 4IFDJ 2VW9A 2I5MX 1X3EA 2PNHA 4JBWA 4JI2L 4B3RQ 4UY8C 4GS3A 1Y1WH 1N34L 4JI7L 1NMGA 4QQBX 1KHIA 2L15A 3JAMi 1N36L 4LF6Q 4K0KQ 1B70B 2JA8G 2WB1G 1JT8A 4OWWB 2ID0A 1PYBA 3EIVA 4X66L 4BXXH 3T1HQ 4YHHQ 3M4PA 1NTGA 3H0GG 4K0KL 3TREA 1WCMH 2IT1A 2YV5A 4UPAA 2IHFA 1SR3A 1PHJA 4L5SA 2VL6A 3K7UC 1VQKA 3I56A 3HKSA 4A3JH 2HIVA 2JA6H 4BBSG 3NENA 4HIMA 4BA2I 1HNWL 4BY7H 2Y0SG 2QEXA 1Q81C 4A3BH 2E5LL 4XIGS 1Q1EA 1J5EQ 3UDIA 4APVA 1K73C 1VQ9A 5M5YH 4DUYL 1VQEA 1EFWA 1K8GA 3I4NG 3RLOA 1EQQA 1PH4A 1I6HH 3MEFA 4IFDI 3E0EA 4BA1I 5AJ3Q 1X9NA 1GO3E 1HR0L 1S72A 1UE6A 1HR0W 1CSQA 1G291 5IP9H 1JMCA 2K5NA 2HHHQ 4POGA 4X6AH 3CQZH 3M7NA 1I3QH 3CCUA 2DGYA 3OTOL 1JE5A 4R4CA 4R4OA 3W1BA 3J80c 5M5WH 4AYBG 3T1YQ 4A93G 4KHPQ 5JJLA 1BKBA 1Y1VG 2E2HH 4KLKA 4LFAQ 4AQYQ 2KENA 3M9BA 4LFCQ 4X66Q 1FGUA 4DV6L 4B3SQ 3PCOB 1UE1A 2JA7H 4JI3L 3ZJYC 4DK6C 3GD7A 3HKZG 2F4VL 4YCUA 1JJ2A 4HIDA 4NXNQ 2F3IA 1AE2A 2ZJRA 4IJHA 4A3MH 2B63H 3S1QH 1KRSA 3K7AH 4IPDA 4DR4Q 4X64Q 2JEAI 2ZM6Q 1OXXK 4GNXA 1O7IA 3UDFA 4GKKL 4BBRH 4GOPB 4A3MG 2B63G 3KF8B 4GNXC 3TQYA 4OONA 3NBHB 4ALPA 3TRZA 2ALYB 1C0AA 3CAMA 4DR4L 1X56A 3PUXA 4PZ6A 4A3KH 4A3FH 3GO5A 2FXQA 2UU9Q 1LM0A 1QVFA 4DV0L 3EBEA 2KBNA 3ERSX 4LF8L 1CKNA 4Y7NH 3HOXH 1Y1VH 1GM5A 3HFZB 4L5RC 5GROA 1KRTA 1LTLA 5IP7H 3PUVA 2UUBQ 5FJ8H 1V1QA 1VQ6A 3K0XA 4GOPA 1K83H 2K4KA 2RHQB 4WJ3M 4DR7L 3KJOA 3VDYA 4JYAL 4LFBL 3CMAA 4BY1H 1HNZL 3HOXG 3HOWG 2GVAA 4GN5A 2R7DA 5H1SE 5GAEC 5C0XI 4B3SL 2OTJA 3CPWA 1CKNB 4IO9A 1N33L 4OX9L 3I4OA 2K14A 4HJAA 5GQOA 5M5XH 2NZHA 4GOPC 4LF9L 5M3MG 1W3SA 4BBRG 5FLMH 5FLMG 1VQMA 2Z6KC 4OX9Q 2BH2A 4R4TA 4A3GG 3BZCA 2R92H 2D62A 3AQQA 4JI1L 4JI8Q 1XNQQ 3PF4A 3S17H 2HIXA 2B3GA 1BBUA 2ZTCA 2WFWA 2NN6I 4IPHA 4R4QA 1XPRA 2MFIA 4DV7Q 4GLXA 2I5LX 3GTJH 1HNZQ 3PO3H 2N3SA 1V43A 3K80C 4BXXG 2F52A 2NZOA 3J81i 1LYLA 4B3ML 3I55A 1VQ7A 1NY4A 4BY1G 3HOWH 1NBWA 1J6QA 1HZ9A 4IOCA 5GAHC 1IYJB 2QA4A 4HJ5A 1Y1WG 4GKKQ 1GD7A 1UWVA 4OWTB 1AE3A 1X3FA 2NVYH 5IP7G 3S1RH 4LF9Q 3NELA 1YVCA 2ZJQA 2I5HA 4QIWE 4B3TL 4B3RL 4GKJL 3GTKH 1GKHA 5C0XJ 2JA5H 1ASYA 1TWHH 2KHJA 4O0AA 4DV3L 3UE1A 4JV5Q 4LUOA 3J81j 1UE5A 4OXPA 3PO3G 1VQNA 2YTYA 3CCVA 4A3FG 3D0FA 3T1HL 2K5HA 3F1ZA 4UP7A 4A76A 5M3FG 1XTDA 1NJIC 1N33Q 4EQ5A 3PSIA 1ASZA 2E8GA 1WYDA 5HGQA 1VQDA 4C2MH 1U0LA 4A3GH 1FVIA 4DR2Q 1E1TA 3E9HA 4OO1G 4YWKA 5ELNA 4JI7Q 3CCJA 1W2BA 5M3MH 1G51A 4AH6A 4LF7L 1U5KA 1K8AC 4QJFA 5IYCH 3CCRA 4B3TQ 2JA7G 1WCMG 3U50C 4A3LH 5JJIA 4GLAC 4JBKA 1B7YB 5LMUQ 3PGZA 4JI0Q 4KHPL 2Q2TA 2GN5A 3RZDH 4DUYQ 2JA8H 2IX1A 2N78A 4A93H 1PH3A 5J3BA 3TS2A 3RLNA 5FJ8G 4A3DG 2UXBL 2HHHL 1N34Q 3L2PA 4DUZQ 1P16A 2OQ0A 5IP9G 2A1AA 1KXLA 4LF8Q 4YY3L 1HJPA 2MQHA 4PMWA 3S16H 2CWAA 4IFDG 1K0RA 5DLQE 1IBLL 3RNUA 4DAMA 1WI5A 2A19A 2LXKA 4DAYB 1HZAA 4DK3C 2OCEA 3PIPA 4YY3Q 4A3CG 4QL5A 2PMZE 4DV1Q 4A3KG 3GTPH 5JEAJ 4JYAQ 4LFBQ 5IE8A 4A3BG 1VQIA 2E2IH 1YITA 4NXNL 1WOCA 4BBSH 1QVGA 3BU2A 2JA6G 1OXTA 3ICEA 2ZTDA 4JG2A 1HNXQ 1OXUA 1TWGH 2H5XA 3H0GH 1B8AA 5C44G 3CMEA 4DR5L 2XTIA 1XMOL 2JEBI 3PF5A 2UUCQ 1QZHA 1D8LA 4C3IH 1YZ6A 2WB1E 1X6OA 1KC8C 1KL9A 4JOIA 3UDXA 4DNIA 2UXBQ 2JQOA 1S40A 1IL2A 5C4XG 1OXSC 3BZKA 3KDFA 1L1OC 1L2FA 5BR8Q 3KJPA 1MJCA 3OW2A 3TS0A 2BA1A 3S2DH 4LNQA 1EIFA 2YTVA 3G48A 3HOYH 5K36G 1K9MC 1IBLQ 1Q1BA 3HOVH 1OTCA 3I4NH 1HNXL 4J15A 1Q8KA 3ULLA 4A4IA 2VQEQ 2EQSA 2CCZA 1IBKQ 1N9WA 3CPFA 4H02A 4HJ9A 4YCWA 3CCSA 2PI2E 3G71A 1VQOA 4LUZA 2UUCL 1TWCH 4BY7G 3EN2A 1M1KC 2YTXA 4AIMA 3A0JA 4LFCL 3RLFA 5JJKA 1I5FA 3RZOH 3CC7A 1JJGA 4A3JG 1MIUA 4JI0L 2R93H 2NVXH 1E22A 4QGUA 4TQUS 4KI0A 2K50A 2Q2UA 1D7QA 4IJLA 2F4VQ 4YCVA 5BR8L 1Q7YC 1H95A 3FKIG 3F8TA 2ZTEA 4DR3Q 4A3EH 3HKZE 4OWXB 1AH9A 3JAMc 3DLLA 3CXCA 1VQ5A 3TEHB 3HOZG 2A8VA 3U4ZA 3KF6A 2B29A 3UE0A 3SGIA 4MNOA 3KFUA 2IHEA 1X54A 1A8VA 4DR6Q 3PO2H 1QUQA 4C3JH 3U58A 4HJ7A 5IYDH 1EUJA 4JOIC 3PV0A 1SMXA 3CCEA 4LF7Q 2EXDA 4DV7L 2NVQH 2PQAB 3K81C 4RMFA 4X65Q 4L5QA 3AEVA 2R7ZH 5C3EG 3ER0A 2PI2A 1NMFA 4P72A 1SN8A 1VQJA 2KCMA 1IXRA 1PV4A 2IY5B 3L0OA 5EAYA 2HQLA 1OXVA 4X65L 1Y14B 1PVOA 3W5OA 5FLXc 1VS0A 5LMUL 1CSPA 4A3IH 2K52A 4A75A 1R9TH 4DV5L 1QUQB 3ULPA 3CF5A 1JJCB 2LSSA 3OTOQ 2ZM6L 4ME3A 1I94L 4DV3Q 4R4IA 1PYSB 2D0PA 2UXCQ 1KD1C 3ULJA 1C7YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C35 B;  1G6P A;  2K75 A;  4DUZ L;  3S2H H;  4JI2 Q;  2E2J H;  5IT9 c;  5AJ3 L;  3Q8D A;  3H3V H;  3I4M G;  1M90 C;  1VQA A;  4IPC A;  4NXM Q;  1VQH A;  2CKZ B;  2CQO A;  3MXN B;  3J81 c;  4WJ4 A;  3PUZ A;  1VQP A;  3W1G A;  2E5L Q;  2I0Q A;  3CW2 C;  1UE7 A;  1LUZ A;  1UEB A;  2UXD Q;  5IYB G;  2Z6K A;  1E24 A;  3KLW A;  3RN2 A;  3CC4 A;  4DV2 L;  2D0O A;  2BA0 A;  2AWN A;  2JE6 I;  2YYZ A;  1Q82 C;  3KDF B;  1I94 Q;  3CP0 A;  4JI6 L;  4DV5 Q;  1PH5 A;  4R1J A;  4YWM A;  1YHB A;  4JBM A;  2MNA A;  2GVB A;  2UXD L;  1CKM A;  1SLJ A;  1Z47 A;  4KHZ A;  5IWA Q;  3RR5 A;  4X62 Q;  3E9I A;  4LF4 L;  4P74 A;  1NE3 A;  5GAG C;  2QGQ A;  1TXY A;  3PUY A;  1XMQ Q;  5C3E H;  4X64 L;  4NXM L;  4DR6 L;  1RIP A;  1TWA H;  5IWA L;  3T1Y L;  4NPS A;  5LMN L;  1E7Z A;  1EOV A;  3LGJ A;  4UP8 A;  4DPG A;  2JK8 A;  4LWC A;  3HOU H;  1BVS A;  2VQE L;  3M3Y H;  4DV6 Q;  3I7F A;  4DR7 Q;  3S24 A;  1RL2 A;  3RN5 A;  1SRO A;  1FJG L;  1YBY A;  2OTL A;  1CUK A;  4DR2 L;  4C3H H;  1XNR L;  3J7Z C;  4PZ8 A;  4YHH L;  1XMO Q;  5C4J H;  4DKA C;  4GN4 B;  4OO1 I;  3DM3 A;  4JV5 L;  3FKI H;  4B3M Q;  4PG3 A;  1VQC A;  1V9P A;  2Q2H A;  1HZB A;  1YI2 A;  3S1M H;  3M4Q A;  4JI4 L;  2V1C C;  3IRB A;  4MTN A;  4UP9 A;  3CCM A;  2UU9 L;  2NVT H;  1HR0 Q;  4JI3 Q;  3L7Z C;  3KF6 B;  3F2B A;  5LMN Q;  1TWF H;  2CWP A;  2EIF A;  1HZC A;  5IY0 A;  4DR3 L;  3GTO H;  4LW1 A;  2VQF L;  1SFO H;  1A0I A;  1EWI A;  1Q12 A;  4JC0 A;  3UDG A;  1MJE A;  2VUM G;  1C9O A;  1K3R A;  3BJU A;  3B6Y A;  4GKJ Q;  5JEA G;  1JB7 A;  2PQA A;  2JJQ A;  4IPG A;  1FJG Q;  3CC2 A;  3FP9 A;  5GAD C;  2HT1 A;  3G6E A;  1IBK L;  2VUM H;  1L1O A;  2AWO A;  2NN6 G;  2UXC L;  4GN3 B;  4PZ7 A;  1PFS A;  4DV4 L;  4LF6 L;  1MKH A;  3AFP A;  3S15 H;  1PA6 A;  1EYG A;  3GTQ H;  1YIJ A;  5IYB H;  4DR1 Q;  3KYH C;  2ASB A;  1KQS A;  3U4V A;  1X65 A;  4JCV E;  4DR5 Q;  1VQL A;  1SRU A;  1Z9F A;  3A5Z B;  2VZA A;  4GLV B;  3STB C;  1J5E L;  1KIX A;  2VQF Q;  2LXJ A;  2MO0 A;  4LF4 Q;  3HOZ H;  3K8A A;  3F2C A;  1I50 H;  4HIK A;  2YU9 H;  4JI5 Q;  1N32 Q;  1YEZ A;  2CFM A;  3A5U A;  2RF4 A;  4A3E G;  3AYH B;  2ES2 A;  1PH6 A;  1IBM Q;  1P8L A;  1E3P A;  4RG1 A;  1YHQ A;  1Q86 C;  4HJ8 A;  5C44 H;  4DV2 Q;  4JI8 L;  1VCI A;  4P71 A;  5E7N A;  1QZG A;  2N49 A;  3A74 A;  2R92 G;  3GTG H;  4P75 A;  1XPU A;  2R93 G;  3CCQ A;  4DV1 L;  1EIY B;  4L5T A;  2R6G A;  3M85 A;  4MZ9 A;  3HOU G;  4XTC S;  4X62 L;  1PH8 A;  1VQ8 A;  1PH1 A;  1YNX A;  4NB3 A;  5LMN W;  3F2D A;  1X55 A;  4HIO A;  4A3I G;  4Y52 H;  2JA9 A;  2WAQ E;  1Q46 A;  2AMC B;  1VQ4 A;  4POF A;  2UUA Q;  1XJV A;  2OQK A;  4DR1 L;  2N8N A;  1T9H A;  1N36 Q;  1FL0 A;  1X3G A;  3J7A 5;  3STB D;  1N32 L;  2R7Z G;  4JI4 Q;  2KHI A;  3HOV G;  1S3O A;  2Y0S E;  3KOJ A;  4LF5 Q;  2R7F A;  2DUD A;  5ELO A;  5C0X G;  3HOY G;  4AQY L;  1A63 A;  4P73 A;  5IYD G;  3S1N H;  4IOA A;  3PO2 G;  5C4X H;  1YJN A;  4YWL A;  2OWO A;  4A3D H;  3PUW A;  1EQR A;  4QY7 A;  3PIO A;  3GTL H;  1YHA A;  4O2D A;  2KCT A;  2RCN A;  2AKW B;  3I2Z A;  3FHW A;  2WAQ G;  2WP8 J;  4JI1 Q;  3WWV A;  4DV0 Q;  1XNQ L;  3J80 i;  1PH7 A;  1A62 A;  2BH8 A;  2K5V A;  2XGT A;  2Z0S A;  3I4M H;  1WFQ A;  3JC6 6;  3GTM H;  2IX0 A;  1VQB A;  4A3L G;  3G4S A;  5IYC G;  1YJW A;  4GNX B;  1SE8 A;  1N8R C;  2VY3 A;  3S14 H;  1YJ9 A;  2VNU D;  1VQF A;  1WJJ A;  2UUB L;  2RHS B;  4LF5 L;  3GDE A;  1QVC A;  1L0W A;  1XNR Q;  4LUV A;  4JBJ A;  1PH2 A;  3NEM A;  3OYY A;  1BBW A;  3M4O H;  2AHO B;  1IZ6 A;  2ZJP A;  4JI6 Q;  4JI5 L;  5M3F H;  4TVA B;  4DV4 Q;  1E1O A;  1CKO A;  2MO1 A;  2VS1 A;  4FDB A;  1VQG A;  2UUA L;  2ATW A;  1IBM L;  1HH2 P;  3CD6 A;  4A3C H;  3H15 A;  4LFA L;  3AFQ A;  1PH9 A;  5HY6 A;  3H3V I;  4EX5 A;  3D31 A;  1XMQ L;  1XPO A;  4AYB E;  1HNW Q;  2JA5 G;  1DGS A;  1GVP A;  2Q2I A;  1KAW A;  1L1O B;  3CCL A;  4IFD J;  2VW9 A;  2I5M X;  1X3E A;  2PNH A;  4JBW A;  4JI2 L;  4B3R Q;  4UY8 C;  4GS3 A;  1Y1W H;  1N34 L;  4JI7 L;  1NMG A;  4QQB X;  1KHI A;  2L15 A;  3JAM i;  1N36 L;  4LF6 Q;  4K0K Q;  1B70 B;  2JA8 G;  2WB1 G;  1JT8 A;  4OWW B;  2ID0 A;  1PYB A;  3EIV A;  4X66 L;  4BXX H;  3T1H Q;  4YHH Q;  3M4P A;  1NTG A;  3H0G G;  4K0K L;  3TRE A;  1WCM H;  2IT1 A;  2YV5 A;  4UPA A;  2IHF A;  1SR3 A;  1PHJ A;  4L5S A;  2VL6 A;  3K7U C;  1VQK A;  3I56 A;  3HKS A;  4A3J H;  2HIV A;  2JA6 H;  4BBS G;  3NEN A;  4HIM A;  4BA2 I;  1HNW L;  4BY7 H;  2Y0S G;  2QEX A;  1Q81 C;  4A3B H;  2E5L L;  4XIG S;  1Q1E A;  1J5E Q;  3UDI A;  4APV A;  1K73 C;  1VQ9 A;  5M5Y H;  4DUY L;  1VQE A;  1EFW A;  1K8G A;  3I4N G;  3RLO A;  1EQQ A;  1PH4 A;  1I6H H;  3MEF A;  4IFD I;  3E0E A;  4BA1 I;  5AJ3 Q;  1X9N A;  1GO3 E;  1HR0 L;  1S72 A;  1UE6 A;  1HR0 W;  1CSQ A;  1G29 1;  5IP9 H;  1JMC A;  2K5N A;  2HHH Q;  4POG A;  4X6A H;  3CQZ H;  3M7N A;  1I3Q H;  3CCU A;  2DGY A;  3OTO L;  1JE5 A;  4R4C A;  4R4O A;  3W1B A;  3J80 c;  5M5W H;  4AYB G;  3T1Y Q;  4A93 G;  4KHP Q;  5JJL A;  1BKB A;  1Y1V G;  2E2H H;  4KLK A;  4LFA Q;  4AQY Q;  2KEN A;  3M9B A;  4LFC Q;  4X66 Q;  1FGU A;  4DV6 L;  4B3S Q;  3PCO B;  1UE1 A;  2JA7 H;  4JI3 L;  3ZJY C;  4DK6 C;  3GD7 A;  3HKZ G;  2F4V L;  4YCU A;  1JJ2 A;  4HID A;  4NXN Q;  2F3I A;  1AE2 A;  2ZJR A;  4IJH A;  4A3M H;  2B63 H;  3S1Q H;  1KRS A;  3K7A H;  4IPD A;  4DR4 Q;  4X64 Q;  2JEA I;  2ZM6 Q;  1OXX K;  4GNX A;  1O7I A;  3UDF A;  4GKK L;  4BBR H;  4GOP B;  4A3M G;  2B63 G;  3KF8 B;  4GNX C;  3TQY A;  4OON A;  3NBH B;  4ALP A;  3TRZ A;  2ALY B;  1C0A A;  3CAM A;  4DR4 L;  1X56 A;  3PUX A;  4PZ6 A;  4A3K H;  4A3F H;  3GO5 A;  2FXQ A;  2UU9 Q;  1LM0 A;  1QVF A;  4DV0 L;  3EBE A;  2KBN A;  3ERS X;  4LF8 L;  1CKN A;  4Y7N H;  3HOX H;  1Y1V H;  1GM5 A;  3HFZ B;  4L5R C;  5GRO A;  1KRT A;  1LTL A;  5IP7 H;  3PUV A;  2UUB Q;  5FJ8 H;  1V1Q A;  1VQ6 A;  3K0X A;  4GOP A;  1K83 H;  2K4K A;  2RHQ B;  4WJ3 M;  4DR7 L;  3KJO A;  3VDY A;  4JYA L;  4LFB L;  3CMA A;  4BY1 H;  1HNZ L;  3HOX G;  3HOW G;  2GVA A;  4GN5 A;  2R7D A;  5H1S E;  5GAE C;  5C0X I;  4B3S L;  2OTJ A;  3CPW A;  1CKN B;  4IO9 A;  1N33 L;  4OX9 L;  3I4O A;  2K14 A;  4HJA A;  5GQO A;  5M5X H;  2NZH A;  4GOP C;  4LF9 L;  5M3M G;  1W3S A;  4BBR G;  5FLM H;  5FLM G;  1VQM A;  2Z6K C;  4OX9 Q;  2BH2 A;  4R4T A;  4A3G G;  3BZC A;  2R92 H;  2D62 A;  3AQQ A;  4JI1 L;  4JI8 Q;  1XNQ Q;  3PF4 A;  3S17 H;  2HIX A;  2B3G A;  1BBU A;  2ZTC A;  2WFW A;  2NN6 I;  4IPH A;  4R4Q A;  1XPR A;  2MFI A;  4DV7 Q;  4GLX A;  2I5L X;  3GTJ H;  1HNZ Q;  3PO3 H;  2N3S A;  1V43 A;  3K80 C;  4BXX G;  2F52 A;  2NZO A;  3J81 i;  1LYL A;  4B3M L;  3I55 A;  1VQ7 A;  1NY4 A;  4BY1 G;  3HOW H;  1NBW A;  1J6Q A;  1HZ9 A;  4IOC A;  5GAH C;  1IYJ B;  2QA4 A;  4HJ5 A;  1Y1W G;  4GKK Q;  1GD7 A;  1UWV A;  4OWT B;  1AE3 A;  1X3F A;  2NVY H;  5IP7 G;  3S1R H;  4LF9 Q;  3NEL A;  1YVC A;  2ZJQ A;  2I5H A;  4QIW E;  4B3T L;  4B3R L;  4GKJ L;  3GTK H;  1GKH A;  5C0X J;  2JA5 H;  1ASY A;  1TWH H;  2KHJ A;  4O0A A;  4DV3 L;  3UE1 A;  4JV5 Q;  4LUO A;  3J81 j;  1UE5 A;  4OXP A;  3PO3 G;  1VQN A;  2YTY A;  3CCV A;  4A3F G;  3D0F A;  3T1H L;  2K5H A;  3F1Z A;  4UP7 A;  4A76 A;  5M3F G;  1XTD A;  1NJI C;  1N33 Q;  4EQ5 A;  3PSI A;  1ASZ A;  2E8G A;  1WYD A;  5HGQ A;  1VQD A;  4C2M H;  1U0L A;  4A3G H;  1FVI A;  4DR2 Q;  1E1T A;  3E9H A;  4OO1 G;  4YWK A;  5ELN A;  4JI7 Q;  3CCJ A;  1W2B A;  5M3M H;  1G51 A;  4AH6 A;  4LF7 L;  1U5K A;  1K8A C;  4QJF A;  5IYC H;  3CCR A;  4B3T Q;  2JA7 G;  1WCM G;  3U50 C;  4A3L H;  5JJI A;  4GLA C;  4JBK A;  1B7Y B;  5LMU Q;  3PGZ A;  4JI0 Q;  4KHP L;  2Q2T A;  2GN5 A;  3RZD H;  4DUY Q;  2JA8 H;  2IX1 A;  2N78 A;  4A93 H;  1PH3 A;  5J3B A;  3TS2 A;  3RLN A;  5FJ8 G;  4A3D G;  2UXB L;  2HHH L;  1N34 Q;  3L2P A;  4DUZ Q;  1P16 A;  2OQ0 A;  5IP9 G;  2A1A A;  1KXL A;  4LF8 Q;  4YY3 L;  1HJP A;  2MQH A;  4PMW A;  3S16 H;  2CWA A;  4IFD G;  1K0R A;  5DLQ E;  1IBL L;  3RNU A;  4DAM A;  1WI5 A;  2A19 A;  2LXK A;  4DAY B;  1HZA A;  4DK3 C;  2OCE A;  3PIP A;  4YY3 Q;  4A3C G;  4QL5 A;  2PMZ E;  4DV1 Q;  4A3K G;  3GTP H;  5JEA J;  4JYA Q;  4LFB Q;  5IE8 A;  4A3B G;  1VQI A;  2E2I H;  1YIT A;  4NXN L;  1WOC A;  4BBS H;  1QVG A;  3BU2 A;  2JA6 G;  1OXT A;  3ICE A;  2ZTD A;  4JG2 A;  1HNX Q;  1OXU A;  1TWG H;  2H5X A;  3H0G H;  1B8A A;  5C44 G;  3CME A;  4DR5 L;  2XTI A;  1XMO L;  2JEB I;  3PF5 A;  2UUC Q;  1QZH A;  1D8L A;  4C3I H;  1YZ6 A;  2WB1 E;  1X6O A;  1KC8 C;  1KL9 A;  4JOI A;  3UDX A;  4DNI A;  2UXB Q;  2JQO A;  1S40 A;  1IL2 A;  5C4X G;  1OXS C;  3BZK A;  3KDF A;  1L1O C;  1L2F A;  5BR8 Q;  3KJP A;  1MJC A;  3OW2 A;  3TS0 A;  2BA1 A;  3S2D H;  4LNQ A;  1EIF A;  2YTV A;  3G48 A;  3HOY H;  5K36 G;  1K9M C;  1IBL Q;  1Q1B A;  3HOV H;  1OTC A;  3I4N H;  1HNX L;  4J15 A;  1Q8K A;  3ULL A;  4A4I A;  2VQE Q;  2EQS A;  2CCZ A;  1IBK Q;  1N9W A;  3CPF A;  4H02 A;  4HJ9 A;  4YCW A;  3CCS A;  2PI2 E;  3G71 A;  1VQO A;  4LUZ A;  2UUC L;  1TWC H;  4BY7 G;  3EN2 A;  1M1K C;  2YTX A;  4AIM A;  3A0J A;  4LFC L;  3RLF A;  5JJK A;  1I5F A;  3RZO H;  3CC7 A;  1JJG A;  4A3J G;  1MIU A;  4JI0 L;  2R93 H;  2NVX H;  1E22 A;  4QGU A;  4TQU S;  4KI0 A;  2K50 A;  2Q2U A;  1D7Q A;  4IJL A;  2F4V Q;  4YCV A;  5BR8 L;  1Q7Y C;  1H95 A;  3FKI G;  3F8T A;  2ZTE A;  4DR3 Q;  4A3E H;  3HKZ E;  4OWX B;  1AH9 A;  3JAM c;  3DLL A;  3CXC A;  1VQ5 A;  3TEH B;  3HOZ G;  2A8V A;  3U4Z A;  3KF6 A;  2B29 A;  3UE0 A;  3SGI A;  4MNO A;  3KFU A;  2IHE A;  1X54 A;  1A8V A;  4DR6 Q;  3PO2 H;  1QUQ A;  4C3J H;  3U58 A;  4HJ7 A;  5IYD H;  1EUJ A;  4JOI C;  3PV0 A;  1SMX A;  3CCE A;  4LF7 Q;  2EXD A;  4DV7 L;  2NVQ H;  2PQA B;  3K81 C;  4RMF A;  4X65 Q;  4L5Q A;  3AEV A;  2R7Z H;  5C3E G;  3ER0 A;  2PI2 A;  1NMF A;  4P72 A;  1SN8 A;  1VQJ A;  2KCM A;  1IXR A;  1PV4 A;  2IY5 B;  3L0O A;  5EAY A;  2HQL A;  1OXV A;  4X65 L;  1Y14 B;  1PVO A;  3W5O A;  5FLX c;  1VS0 A;  5LMU L;  1CSP A;  4A3I H;  2K52 A;  4A75 A;  1R9T H;  4DV5 L;  1QUQ B;  3ULP A;  3CF5 A;  1JJC B;  2LSS A;  3OTO Q;  2ZM6 L;  4ME3 A;  1I94 L;  4DV3 Q;  4R4I A;  1PYS B;  2D0P A;  2UXC Q;  1KD1 C;  3ULJ A;  1C7Y A; 
#chains in the Genus database with same CATH topology
 1I6V C;  4DUZ L;  4ABN A;  1TVX A;  5IT9 c;  5AJ3 L;  3I4M G;  2PPB C;  1SYG A;  1VQA A;  2CKZ B;  2KCC A;  3VA7 A;  2FFK B;  1FR3 A;  2J0T D;  3MXN B;  3J81 c;  2I0Q A;  5T1G A;  5IYB G;  2Z6K A;  1DJR D;  4L8J A;  3KLW A;  3CC4 A;  4DV2 L;  4RH6 A;  4RCO A;  4DN4 M;  4DXG A;  2AWN A;  3KDF B;  1PH5 A;  2CH4 W;  4R1J A;  1G6P A;  4J8Q A;  5C4J B;  4KHZ A;  1TU2 B;  1DON A;  2KA7 A;  4X62 Q;  4HMI A;  2ZXO A;  2KUM A;  4LF4 L;  5KNB A;  5GAG C;  3PUY A;  2LS0 1;  4HAE A;  4DR6 L;  3T1Y L;  5LMN L;  1LTI D;  2LKV A;  2NWG A;  1EOV A;  4UHV A;  4IUR A;  3HOU H;  2VQE L;  3I7F A;  4DR7 Q;  1I4P A;  1TS5 A;  3HOU B;  2F1M A;  1ROD A;  4YHH L;  2F0T A;  5FLX E;  3DM3 A;  3TP5 A;  2HCC A;  2MGS A;  2IL8 A;  2V1C C;  4MTN A;  3C3L A;  1EQV A;  4UP9 A;  2OT2 A;  3GTP H;  2CWP A;  1JIC A;  4XQJ A;  1A0I A;  1EWI A;  1Q3L A;  2VUM G;  4K6D A;  2PQA A;  2JJQ A;  4IPG A;  4K2L A;  1PDQ A;  5GAD C;  4R8N A;  2HT1 A;  1IBK L;  2VUM H;  3EFX D;  1F9P A;  3FKI B;  2XWJ B;  3OIP A;  4RGM A;  5EPL A;  2K6A A;  1ZXT A;  5EKK A;  3S15 H;  1PA6 A;  1EYG A;  1RJT A;  1YIJ A;  4DR1 Q;  3KYH C;  2ASB A;  4FF2 A;  3HZX A;  1X65 A;  3VYR A;  1MSG A;  3PQI A;  3STB C;  2VZA A;  4GLV B;  1F2M A;  2B2T A;  2VQF Q;  1QOH A;  2EVB A;  2LXJ A;  2MO0 A;  2V4D A;  1WTV A;  2CFM A;  2RF4 A;  4F7X A;  1PH6 A;  2EJF C;  3DMU A;  2A6H D;  4P71 A;  4ZKB B;  3NQI A;  3GTG H;  2H4O A;  4L5T A;  2R6G A;  3R2T A;  1PH8 A;  1YNX A;  4NB3 A;  2A6H C;  2B2W A;  4HCE A;  4A3I G;  2WAQ E;  1W6K A;  1VQ4 A;  3V2T A;  1XJV A;  1X32 A;  1T9H A;  2N8N A;  2K01 A;  4NKL A;  2LFN A;  1WTQ A;  3STB D;  2R7Z G;  4IFD H;  3BVG A;  5ELO A;  5C0X G;  4IZ8 A;  1A63 A;  4P73 A;  1U4R A;  3M4O B;  5C4X H;  1YJN A;  2OWO A;  4A3D H;  4QY7 A;  3GTL H;  2IWH A;  1STY A;  1G6Z A;  4JI1 Q;  2EY5 A;  5IGC A;  1A62 A;  1G2S A;  2B8F A;  3I4M H;  2DNC A;  1BQQ T;  3GTM H;  3BVZ A;  1VQB A;  2SOB A;  1YJW A;  3S14 H;  1VQF A;  1J9O A;  1WJJ A;  3KF8 A;  3GDE A;  1XNR Q;  1NSN S;  4JBJ A;  1IL8 A;  3OYY A;  1RTO A;  5ELC A;  1IZ6 A;  3NP8 A;  1ZEQ X;  4TVA B;  5KND A;  1E1O A;  2UUA L;  3M3Y H;  2ATW A;  1VQG A;  1HH2 P;  3T13 A;  4A3E B;  1EWC A;  3UI2 A;  1PH9 A;  1TT2 A;  3WDN A;  3D31 A;  5CMD A;  2MP1 A;  1HTP A;  1KAW A;  4KKU A;  1L1O B;  4R9W A;  5ELB A;  3CCL A;  4RKL A;  2VW9 A;  2NVQ B;  1X3E A;  1JOQ A;  5IGD A;  4O42 A;  5IOC A;  4JI7 L;  1N34 L;  1N36 L;  4ME5 A;  4LF6 Q;  3CRK C;  1TR5 A;  5IT9 L;  3EIV A;  4BXX H;  2B8G A;  3EA6 A;  2KED A;  1A3V A;  4N9P A;  4YHH Q;  2CW0 D;  3Q24 A;  4K0K L;  2IT1 A;  2YV5 A;  2IHF A;  3D3R A;  2VL6 A;  1VQK A;  2B2U C;  3TME A;  2JA6 H;  2CW0 C;  1BDO A;  2L12 A;  3NEN A;  4XDX A;  4FXK C;  2Y0S G;  3O13 A;  2EPB A;  4X3T A;  2QEX A;  2J4X A;  4XIG S;  3K57 A;  3S2H B;  3I4N B;  1Q1E A;  1ZKO A;  1J5E Q;  1WTW A;  1I6H H;  1EYC A;  5AJ3 Q;  1AN8 A;  1GO3 E;  4CDC C;  2E2D C;  1UE6 A;  3QWN A;  1CSQ A;  1G29 1;  1JMC A;  4Q5V A;  2K5N A;  3E6Z X;  3M7N A;  3HOV B;  3OTO L;  4DGZ A;  5ELF A;  4C3I G;  3K5L A;  4A93 G;  2E2H H;  1PTO H;  3DM1 A;  3H91 A;  5CV6 A;  3M9B A;  1GUW A;  3ZJY C;  2QDB A;  3HKZ G;  2L5T A;  3DHQ A;  4IJH A;  4DR4 Q;  3K7A H;  5T1I A;  4GNX A;  3UDF A;  2X6G A;  4BY1 B;  1JWM D;  2NUC A;  5ELD A;  1G8Z D;  2FJ2 A;  1C0A A;  4DR4 L;  4PZ6 A;  3DEP A;  3X3N A;  4A3F H;  2FXQ A;  5HGT A;  1WCM B;  3FVQ A;  3EBE A;  3N6R A;  1E2Z A;  2K5Q A;  1CKN A;  2HUG A;  1O7L A;  3GTO B;  4I7A A;  4L5R C;  2K5D A;  5IP7 H;  3C46 A;  3S1Q B;  4GOP A;  1EY0 A;  1C8C A;  2K4K A;  2RHQ B;  4WJ3 M;  2EYJ A;  1DOM A;  1A6X A;  3W3A A;  1HCZ A;  4JYA L;  4LFB L;  4BY1 H;  5M5Y B;  3HOW G;  3VR3 A;  4GN5 A;  3MFG A;  1F2Z A;  4ZYS A;  3G7L A;  5H1S E;  4H44 C;  4B3S L;  1R9T B;  4DAP A;  1B4O A;  1KDB A;  1EL0 A;  3ZYY X;  4IO9 A;  1IYV A;  1N33 L;  4OX9 L;  1ILP A;  4GOP C;  2NZH A;  1W3S A;  3I70 A;  4CKC A;  3Q0A A;  3SVM A;  2Z6K C;  3NWS A;  4OX9 Q;  4R4T A;  4FXG C;  2XNA C;  4PV1 C;  1XNQ Q;  3HG9 A;  2ZTC A;  4R4Q A;  2NN6 I;  4GLX A;  2I5L X;  4QIW B;  2N3S A;  3K80 C;  2NZO A;  1H9S A;  3J81 i;  1LYL A;  4B3M L;  3I55 A;  3HOW H;  1NY4 A;  4BY1 G;  1HZ9 A;  5GAH C;  1GD7 A;  1UWV A;  4OWT B;  5CV4 A;  2NVY H;  2EE1 A;  1LAB A;  3H6M A;  4KY5 A;  1YVC A;  4QIW E;  4DF7 A;  1EY6 A;  1MD2 D;  5LL6 X;  5C0X J;  4O0A A;  2B2Y C;  5ISR A;  4OXP A;  3PO3 G;  1VQN A;  4GZY C;  4WOR A;  4A3F G;  3T1H L;  3GTJ B;  4EGV A;  3P1H A;  1XTD A;  1NJI C;  2XVS A;  1ASZ A;  2D9U A;  1ENF A;  1WYD A;  2E8G A;  4C2M H;  1U0L A;  4OIJ A;  3E9H A;  4OO1 G;  5ELN A;  1MHW C;  3Q6S A;  2WB1 B;  1D6E C;  3MFY A;  4QJF A;  4C2M B;  4B3T Q;  1HQM C;  1L0X B;  2WKD A;  2HDL A;  3QB3 A;  1SNQ A;  2GN5 A;  4DUY Q;  1B1Z A;  2WAC A;  2IX1 A;  1PH3 A;  4BBS B;  1ILQ A;  3RLN A;  3L2P A;  2OQ0 A;  1TY0 A;  3URY A;  1KXL A;  1XTC D;  1LAC A;  4PMW A;  4UAI A;  3FMC A;  4ZAI A;  1K0R A;  5DLQ E;  3RNU A;  2OEO A;  2K33 A;  1HZA A;  4DK3 C;  3PIP A;  1K83 B;  4R8I A;  1QIL A;  4DV1 Q;  4A3K G;  1PRT C;  5JEA J;  2F0W A;  1VQI A;  5E1F A;  2J7Z A;  4K2K A;  2JA6 G;  1OXT A;  4F88 A;  2FMM A;  4JVZ A;  1HNX Q;  2H5X A;  1B8A A;  4G7H C;  1XMO L;  3DEO A;  1HA6 A;  2EYO A;  2XRS D;  1ZYR C;  3MA2 B;  5CGK A;  1KLG D;  4I65 A;  1YZ6 A;  3HOY B;  1X6O A;  1KC8 C;  4JOI A;  5BN5 A;  2UXB Q;  2EY2 A;  2JQO A;  3TN2 A;  2JSO A;  1ZYR D;  5BR8 Q;  1EY8 A;  3KJP A;  3MEH A;  2YTV A;  2QF7 A;  4C3I B;  3K58 A;  2K03 A;  4CBV A;  1BOS A;  2B2V C;  3A7A B;  3MTS A;  4IUN A;  1OTC A;  3HOV H;  1LT6 D;  1HNX L;  1YNN C;  3HRZ C;  1Q8K A;  2ZXP A;  4HR7 B;  2M9V A;  1IBK Q;  3CPF A;  4H02 A;  3K6O A;  1GXD C;  1I6H B;  3J81 E;  4QCL A;  4AIM A;  4X3U A;  5G3L D;  4LFC L;  5JJK A;  3CC7 A;  1MIU A;  4OEM B;  1ICW A;  1E22 A;  2EY1 A;  4QGU A;  2K50 A;  2Q2U A;  1Q7Y C;  3C1F A;  2OXP A;  1SBB B;  1DOK A;  3SHL A;  4A3E H;  3DLL A;  3CXC A;  1VQ5 A;  2NVX B;  3HOZ G;  1IHZ A;  3QO2 A;  3UE0 A;  3K0Y A;  3SGI A;  3GQB A;  2IHE A;  2RDH A;  4C3J H;  1A3U A;  4HJ7 A;  3U58 A;  1YNJ C;  1LTR D;  2PZW A;  3D4W A;  1PTO F;  3SK5 A;  3PV0 A;  3U9O A;  1SMX A;  2NVQ H;  1PYW D;  1SN8 A;  2KCM A;  1Y1W B;  1PXU A;  3NTI A;  1PVO A;  1GUO A;  5FK9 C;  5FO7 B;  2F0N A;  4A75 A;  1D2B A;  1II3 A;  3P7J A;  1KD1 C;  1EU3 A;  1WVL A;  2XN9 C;  3Q8D A;  1SAP A;  3OWE B;  4NXM Q;  2CQO A;  2Q8T A;  4KTA A;  1EEF D;  1H9K A;  4WJ4 A;  4FNF A;  3D4R A;  3J80 E;  3BDL A;  5COY A;  3PO3 B;  3CW2 C;  1LUZ A;  1UEB A;  4RGT A;  3OMG A;  3M7G A;  2D0O A;  2YYZ A;  1Q82 C;  3NXW A;  4JI6 L;  1OO9 B;  2A68 C;  1JQY D;  1CKM A;  5IWA Q;  3RR5 A;  2R3Z A;  3E9I A;  3IAY A;  1XMQ Q;  4X64 L;  1RIP A;  1DYQ A;  4ZQ3 A;  4UP8 A;  2JK8 A;  1PTO B;  1RD9 D;  4DV6 Q;  1VF5 C;  3RN5 A;  3J80 L;  1AFP A;  2A5H A;  3K7A B;  3J7A F;  2NBF A;  2AQ3 B;  3HP3 A;  3S14 B;  4C3H H;  4PZ8 A;  3QOL A;  4DKA C;  3MVV A;  3FKI H;  1VQC A;  1V9P A;  2Q2H A;  1CZW A;  1YI2 A;  3S1M H;  4JI4 L;  3IRB A;  4FP5 D;  3CCM A;  2UU9 L;  2BCO A;  3KF6 B;  5LMN Q;  4KN7 C;  4DNR B;  4LW1 A;  3UDG A;  1K3R A;  3H3V C;  3SR1 A;  3FP9 A;  2BDO A;  1L0Y B;  2AWO A;  1MKH A;  2Z1C A;  5A2Q E;  3DWP A;  3T4A C;  5IYB H;  2F0K A;  5LHY 1;  1EY7 A;  2VXW A;  4BWG B;  1Z9F A;  1J5E L;  4LF4 Q;  1ENA A;  3IKJ A;  3G6J B;  3MXU A;  3F2C A;  4JI5 Q;  1YEZ A;  1CA5 A;  4A3E G;  3AYH B;  3I72 A;  2ES2 A;  1E3P A;  1Q86 C;  5JPN C;  4DV2 Q;  4JI8 L;  1QZG A;  1EY5 A;  2R92 G;  3J7A V;  4A3B B;  4DV1 L;  4XT3 B;  4A3I B;  1VQ8 A;  1TQO A;  4Y52 H;  4KN4 C;  1Q46 A;  2KHS A;  2DNE A;  2OQK A;  4DU9 A;  5E4W C;  3VR6 A;  1KDC A;  1N36 Q;  1JB3 A;  1X3G A;  3KBG A;  1EEI D;  3NBI A;  1N32 L;  3TBI B;  4JI4 Q;  2KHI A;  1B3A A;  3HOV G;  2Y0S E;  1I4X A;  2VB2 X;  2DUD A;  5C44 B;  3CKI B;  4AQY L;  3OSO A;  5IYD G;  3S1N H;  4IOA A;  2D2C C;  1XXG A;  3PUW A;  4K5W A;  3PIO A;  3P75 A;  1YHA A;  4O2D A;  1B53 A;  2RCN A;  3FHW A;  2EY6 A;  2K5V A;  1NCV A;  5I6W A;  5G3L F;  4A3L G;  5IYC G;  1RF2 D;  1N8R C;  1SE8 A;  2VY3 A;  5EBD A;  1YJ9 A;  1PZI D;  3VR5 A;  1E2W A;  2JA8 B;  3VYT A;  3ERQ A;  3A8J E;  1PH2 A;  5JJZ A;  1BBW A;  1BBX C;  3M4O H;  1WTP A;  2ZJP A;  4JI6 Q;  4JI5 L;  5M3F H;  4DV4 Q;  2MO1 A;  4XYO A;  4FDB A;  1IBM L;  2A6E D;  3CD6 A;  3H15 A;  3OPO A;  3A8K E;  1B44 D;  1RHP A;  4A3J B;  1XMQ L;  2AQ1 B;  1XPO A;  1DGS A;  2Q2I A;  1QNU A;  2EYM A;  1SDF A;  4N9T A;  1KAB A;  2F0U A;  2RA4 A;  4WJW A;  2O5J C;  3H09 A;  4X3K A;  5DM7 3;  4XXE A;  4QQB X;  1KHI A;  3JAM i;  5I9O A;  4K0K Q;  1SE2 A;  2JA8 G;  2WB1 G;  1JT8 A;  1PYB A;  4MN3 A;  2E2I B;  1UUP A;  1NTG A;  1WCM H;  4LAA A;  5D3D A;  1SR3 A;  1PHJ A;  3D8G A;  5IGG A;  2F3V A;  3I56 A;  1PZJ D;  2HIV A;  3S2D B;  3NE5 B;  4HIM A;  2ZXR A;  5E4X A;  4BY7 H;  4KY6 A;  3MC0 B;  5A35 A;  1BCP D;  4A3B H;  3OHX C;  4RCN A;  3UDI A;  4APV A;  1K73 C;  1VQ9 A;  4TKO B;  3E0J A;  3KLR A;  4CGY B;  1K8G A;  5FO9 B;  1EQQ A;  4ULL A;  3HS0 C;  3E0E A;  1C48 A;  3M4Y A;  4X6A H;  2EOT A;  3CCU A;  2DGY A;  1JE5 A;  4R4C A;  3W1B A;  4RWS C;  4IAL A;  3J80 c;  1EYD A;  4KHP Q;  1K8O A;  1BKB A;  1Y1V G;  4K14 A;  1SNC A;  4LFA Q;  4AQY Q;  4OIK A;  2KEN A;  4LFC Q;  4X66 Q;  1BF4 A;  1T5X D;  4DV6 L;  1JJ2 A;  1AZP A;  4HID A;  2WIN B;  2ZJR A;  3S1Q H;  3KK7 A;  4X64 Q;  2ZM6 Q;  3S1N B;  4ZKC B;  4ALP A;  3NBH B;  3TRZ A;  3D4D A;  5KYI A;  1DD2 A;  4RHR A;  3PUX A;  5BN3 A;  1HHV A;  3GO5 A;  1H9M A;  2L0C A;  3NK9 A;  1IYU A;  1YNJ D;  4LF8 L;  4Y7N H;  1Y1V H;  2B39 A;  1I4R A;  4ILW A;  1LTL A;  2NB0 A;  3K0X A;  1EQT A;  1D1I A;  3NTH A;  5I2X A;  2L4N A;  3E3X A;  2VUM B;  1H9R A;  3CPW A;  1CKN B;  2Q8R E;  3I4O A;  3MHB A;  5M5X H;  1HPC A;  4A93 B;  5FLM H;  2K28 A;  2BH2 A;  4F8M A;  2F0J A;  1PFB A;  3PF4 A;  2HIX A;  1BO0 A;  4S3S A;  3I73 A;  2B2Y A;  3GTJ H;  1HNZ Q;  1V43 A;  2F52 A;  2CH4 A;  5FO8 B;  1KTK A;  1J6Q A;  1NBW A;  2AQ2 B;  2A68 D;  4DAV A;  4HJ5 A;  1Y1W G;  1AE3 A;  3F2U A;  4LF9 Q;  2I5H A;  1KDA A;  4B3T L;  4B3R L;  3GTK H;  1ASY A;  1TKW B;  2KHJ A;  4RGN A;  5CV7 A;  4LUO A;  3J81 j;  1F2L A;  2H1E A;  3D0F A;  2K5H A;  1ONL A;  4A76 A;  1CQF A;  1R4Q B;  4DK1 A;  1VQD A;  1SE4 A;  1CI3 M;  2I07 B;  3A7L A;  4A3G H;  1O78 A;  1E1T A;  1UAP A;  5I9P A;  3CCJ A;  1G51 A;  3LX0 A;  4LF7 L;  1K8A C;  2XRQ D;  4KY7 A;  4ODG A;  4A3L H;  1STH A;  4UDU C;  3LNN A;  4GLA C;  5DEH A;  2HCI A;  4BBR B;  1V1P A;  2Q2T A;  2EJM A;  1LLR D;  1STB A;  5I2Y A;  3HEJ A;  1SYE A;  4OL7 A;  3TS2 A;  2UXB L;  5FJ8 G;  3R8B A;  3NPP A;  2HHH L;  4Y7N B;  3DUZ A;  4N8F A;  5IP9 G;  1EYA A;  2JXM B;  1HJP A;  3S15 B;  3TZU A;  3S16 H;  2PMZ B;  3ITP A;  2E2J B;  2CWA A;  2F0P A;  4JK1 C;  1WI5 A;  2A19 A;  4DAY B;  1DXM A;  2KEE A;  2OCE A;  1WTO A;  3D6W A;  1RDP D;  1CZG A;  2SDF A;  1FGB D;  4A3B G;  4NW2 A;  1Q8I A;  4NXN L;  1SEB D;  3T16 A;  3PIP 3;  4JG2 A;  4CJ2 C;  1K0S A;  3MXN A;  1VMC A;  2XTI A;  1FNW A;  3RUZ A;  3PF5 A;  2UUC Q;  1QZH A;  3VA5 A;  3QG1 A;  2O4X A;  1D8L A;  1D1K A;  4C3I H;  1FNU A;  3SDZ A;  2KJX A;  2M2L A;  2TSS A;  1JCK B;  1IL2 A;  5C4X G;  3KDF A;  2VB3 X;  3OW2 A;  3TS0 A;  3S2D H;  1GUS A;  3TSS A;  1EIF A;  4LNQ A;  3HOY H;  1S5B D;  1S5E D;  1IBL Q;  1Q1B A;  2L1B A;  1NNX A;  1U4P A;  5EPK A;  4HJ9 A;  1EY4 A;  2Z9H A;  3BYT B;  5KYL A;  1QNK A;  2UUC L;  3PO2 B;  3EN2 A;  2YTX A;  3VR2 A;  4DXF A;  3GTL B;  3CHB D;  1QG7 A;  4B9X A;  1I5F A;  1KNE A;  1QCB D;  4A3J G;  1DM0 B;  3NUC A;  2NVX H;  2R93 H;  4TQU S;  2F4V Q;  4YCV A;  2CVR A;  5BR8 L;  3GTK B;  2EYP A;  2IPK D;  3FKI G;  3F8T A;  1SSO A;  3HKZ E;  4OWX B;  1SNM A;  3JAM c;  4G7Z C;  4BS9 A;  1IKL A;  2KEC A;  1RTN A;  2ZT9 C;  3KFU A;  1X54 A;  4DR6 Q;  2QW7 A;  3VYS A;  1EUJ A;  4HED A;  4KJO A;  4LF7 Q;  2EXD A;  2PQA B;  3AEV A;  2X6L A;  4TRD A;  4P72 A;  2PQE A;  1LTS D;  1IXR A;  2IY5 B;  1O80 A;  3L0O A;  5EAY A;  1WTX A;  1OXV A;  2F0F A;  3W5O A;  5FLX c;  1VS0 A;  4N8X 1;  3ULP A;  3S1M B;  2LSS A;  1I94 L;  5FOB B;  1C4Q A;  3ULJ A;  4H13 C;  2C35 B;  3WOE A;  3NSW A;  2E2J H;  1M90 C;  2A69 D;  1QJO A;  3PUZ A;  1VQP A;  2E5L Q;  2Y0S B;  4K5V A;  3J7Y W;  2UXD Q;  4A3D B;  5EQ0 A;  2BA0 A;  4DV5 Q;  2NN6 H;  4YWM A;  4JBM A;  1BUV T;  2UXD L;  2MNA A;  3S17 B;  1B50 A;  1SLJ A;  1YNN D;  1S5F D;  2MUY A;  1NE3 A;  5DM6 3;  2QGQ A;  4C56 C;  5C3E H;  3Q23 A;  4P2C B;  4LWC A;  2EJG C;  1SJH D;  2E75 C;  4C3J G;  1TII D;  1RL2 A;  1Y8P B;  2ICI A;  3A8I E;  2JA5 B;  3X3M A;  1YBY A;  2OTL A;  4KD3 A;  5CYU A;  1CUK A;  1GOZ A;  3TZD A;  1XNR L;  2F0L A;  1G91 A;  5JOB A;  1ML0 D;  2I46 A;  3IL8 A;  4GN4 B;  4XT1 B;  2EYL A;  4B3M Q;  5AFW A;  1HZB A;  1AP0 A;  3KUP A;  3BYY B;  3OW7 A;  4M1U B;  3F2B A;  2N55 A;  1PZK D;  2O2L D;  1HZC A;  3A54 A;  1X3P A;  3GTO H;  4L63 B;  1SFO H;  3EVQ A;  1Q12 A;  2YU9 B;  1MJE A;  2Z6B A;  1Y8O B;  1C9O A;  3BJU A;  1BCP F;  3B6Y A;  5JEA G;  1JWU D;  1JB7 A;  1TWF B;  5EPJ A;  3SE0 A;  1FJG Q;  3CC2 A;  3NQT A;  1L1O A;  3D6C A;  2Z4I A;  4GN3 B;  1SE3 A;  2G5D A;  3MWY W;  4EQO A;  1KLU D;  3VR4 A;  3TP7 A;  1KQS A;  1FYC A;  4DR5 Q;  1VQL A;  1HA5 A;  2FHT A;  5FKA C;  4HIK A;  2YU9 H;  3A5U A;  1FD7 D;  5EKL A;  1IBM Q;  1P8L A;  3IFT A;  4HJ8 A;  1VCI A;  5KIX A;  5E7N A;  2C5C A;  1XPU A;  2R93 G;  3CCQ A;  1EIY B;  3AMU A;  3HOU G;  4XTC S;  1PH1 A;  5M5W B;  1CQV A;  2IJ0 A;  5LMN W;  1X55 A;  4JPB W;  3GTQ B;  2JA9 A;  5J22 A;  3A56 A;  2UUA Q;  4DR1 L;  5D3I B;  1FL0 A;  4KV6 A;  4EQN A;  2EDG A;  3E5S A;  1BCP B;  2QIL A;  1S3O A;  4IQZ A;  2A73 B;  1TS4 A;  2R7F A;  3HOY G;  1GHJ A;  4NDX A;  5EJW A;  4KJN A;  3GTG B;  3PO2 G;  3PIO 3;  4YWL A;  5TSS A;  1EQR A;  2AKW B;  1SMY D;  2SNM A;  3I2Z A;  5CV5 A;  1XNQ L;  3WWV A;  4DV0 Q;  2A6E C;  3J80 i;  4V19 0;  2BH8 A;  1CHP D;  3JC6 6;  2IX0 A;  5J39 A;  1SMY C;  2AUJ D;  4GNX B;  3MAQ A;  2KVM A;  2UUB L;  1QVC A;  3OIQ A;  1CA6 A;  1D5Z C;  2JN4 A;  4RGO S;  3NEM A;  1KAA A;  4HN7 A;  1GHK A;  3C2P A;  4GKJ Q;  4A3C H;  1SNO A;  4NP5 A;  2PYK A;  5EGT A;  4PMC A;  4YIJ A;  3H3V I;  5IGB A;  4XYQ A;  1O7Y A;  2F0S A;  4KHV A;  3DWQ A;  3I8Z A;  4WRD A;  1PFN A;  4IFD J;  1JWS D;  1EU4 A;  2PNH A;  5D65 A;  1NMG A;  1LTB D;  2F0G A;  3I90 A;  4DNT B;  2PW5 A;  1B70 B;  1M8A A;  2EYF A;  2ID0 A;  4OWW B;  5M3F B;  3M4P A;  3TRE A;  3NTK A;  5JAV A;  5C4H A;  1I50 B;  3K7U C;  3R3O A;  3HKS A;  4A3J H;  1G2T A;  5CV8 A;  2F03 A;  5C4Z A;  4K8J A;  5KRU A;  4XQN A;  3QJY A;  1HNW L;  3NHH A;  3Q22 A;  2E5L L;  3ERO A;  1H9S B;  1EZ6 A;  4FF1 A;  2NZ1 D;  5M5Y H;  4DUY L;  1EFW A;  1DOL A;  2LMC B;  1PH4 A;  4BA1 I;  1X9N A;  1PMR A;  4FF3 A;  1STA A;  2QKI C;  1STE A;  1AEX A;  5IT9 E;  2PCF B;  1S72 A;  4POG A;  4CKB A;  2MHV A;  1EZ8 A;  3R93 A;  1E2V A;  4NMZ A;  4AYB G;  3BG3 A;  1T5E A;  4PQX A;  2F0E A;  2IW3 A;  4LJZ C;  3PCO B;  1UE1 A;  4JI3 L;  4DK6 C;  3GD7 A;  4YCU A;  4NXN Q;  1B9N A;  2F3I A;  4A3M H;  2B63 H;  2KQ3 A;  3T53 B;  4IPD A;  2EZV A;  2JEA I;  4GKK L;  4OO1 H;  1O7I A;  4BBR H;  4HMJ A;  4A3M G;  2B63 G;  3KF8 B;  4GNX C;  4O1N A;  4OON A;  3PMF A;  1STG A;  3CAM A;  1E0B A;  2X69 A;  1X56 A;  1EFI D;  2UU9 Q;  5CR3 A;  2XIW A;  4DV0 L;  2KBN A;  3ERS X;  1A2U A;  2Z8L A;  4X3S A;  4HSP A;  1GM5 A;  5GRO A;  1KRT A;  2B2V A;  2UUB Q;  5FJ8 H;  1CT1 D;  3T51 B;  1VQ6 A;  3AU7 A;  2QEJ C;  1LT3 D;  3NBH A;  3CMA A;  2WII B;  3HOX G;  1JC7 A;  1SND A;  2BDN A;  1EY9 A;  3GV3 A;  4DA2 A;  2IX3 A;  4IUP A;  4QMG A;  2K14 A;  4HJA A;  5GQO A;  2M00 A;  4CDD C;  1VQM A;  4A3G G;  1ESF A;  2D62 A;  4JI1 L;  4RKB A;  3S17 H;  4EVO A;  1BBU A;  1ET6 A;  1XPR A;  2MFI A;  4DV7 Q;  3S1R B;  2L11 A;  1Q90 A;  4BXX G;  1F9R A;  1VQ7 A;  4A3M B;  2B63 B;  5JVH 3;  3GP7 A;  1IYJ B;  3JAM L;  5KNC A;  4KK7 A;  1BNZ A;  3S1R H;  2RDF A;  3OOC A;  5IP7 G;  2PZU A;  4CKE A;  3BDO A;  1GKH A;  3K59 A;  3UE1 A;  4JV5 Q;  3GV6 A;  1UE5 A;  2YTY A;  3CCV A;  1TWG B;  4AYB B;  2K04 A;  3F1Z A;  1TWH B;  1N33 Q;  5HGQ A;  1FVI A;  2MJ8 A;  1A15 A;  1K8M A;  2RVL A;  1W2B A;  5M3M H;  4AH6 A;  1I3Q B;  4MTK A;  4J1M A;  5CBE E;  3I4M B;  1WCM G;  5HUR A;  5JJI A;  4JBK A;  1B7Y B;  1V1O A;  3PGZ A;  4JI0 Q;  3RZD H;  3W2D A;  2F0D A;  2JA8 H;  1JOO A;  2N78 A;  4IN3 A;  4A93 H;  1S5C D;  5CBA E;  1X3Q A;  4A3D G;  2R7Z B;  4DUZ Q;  1TY2 A;  2PO4 A;  2A1A A;  4LF8 Q;  1BR9 A;  2MQH A;  1ESR A;  1HTL D;  1M4V A;  4IFD G;  1CFM A;  1HQR D;  1SXT A;  4LK1 C;  1V1P B;  4YY3 Q;  4QL5 A;  2PMZ E;  5I4D A;  2RKS A;  5IE8 A;  5DAU A;  3V05 A;  4OHJ A;  4F87 A;  2R92 B;  5CV9 A;  2N88 A;  2E2I H;  4DK0 A;  3BU2 A;  1HUN A;  2FMC A;  2ZTD A;  3KLS X;  1OXU A;  3CME A;  2HDM A;  1TS2 A;  1A2T A;  1TWA B;  1U4M A;  5E3F A;  3T56 B;  1KL9 A;  3H0G B;  4DNI A;  2B2T C;  1OXS C;  1MJC A;  3G48 A;  5K36 G;  3P20 A;  1K9M C;  1SYC A;  1H9J A;  1XYI A;  1SYD A;  4RA8 A;  2E74 C;  3I4N H;  2MPM A;  3ULL A;  2VQE Q;  2CCZ A;  1N9W A;  1PTO C;  2PI2 E;  4BY7 G;  3OMC A;  2QCP X;  2G9H D;  3GTP B;  5J1Z A;  1B2T A;  4KKT A;  4FXD A;  3RLF A;  2E76 C;  2HQE A;  5M9O A;  1LO5 D;  1LT4 D;  2K05 A;  4JI0 L;  4KI0 A;  3MXG A;  2LY7 A;  1F9S A;  4DR3 Q;  1F9Q A;  2XSC A;  2PW7 A;  3TEH B;  2A8V A;  4A3F B;  3KF6 A;  4OGQ C;  4QF4 A;  4MNO A;  3PO2 H;  1QUQ A;  5COR A;  1TWC B;  3CU7 A;  4WFN 3;  4KMU C;  4JOI C;  3CCE A;  2BE5 C;  3K81 C;  4RMF A;  4L5Q A;  2R93 B;  2R7Z H;  5C3E G;  3ER0 A;  1O7Z A;  2PI2 A;  1NMF A;  3FEW X;  3MXP A;  4CJ0 B;  1LTG D;  2RSO A;  5JPM C;  2DN8 A;  1ET9 A;  4RHS A;  5EKI A;  2BE5 D;  2AUK A;  2JYO A;  3RZD B;  5I6Y A;  4B9W A;  4A3I H;  3FPU B;  2JA6 B;  2K52 A;  1R9T H;  1SNP A;  4DV5 L;  2A69 C;  1WTH A;  3S9W A;  2ZM6 L;  4R4I A;  1PYS B;  2D0P A;  2UXC Q;  1C7Y A;  2F0Q A;  1HFG A;  2K75 A;  3S2H H;  4CDF C;  1XWE A;  4JI2 Q;  3N52 A;  3I3C A;  3H3V H;  3MZ5 A;  1K3B C;  4IPC A;  3BVM A;  1VQH A;  2WKC A;  1KNA A;  4C3H G;  4CDE C;  3K5O A;  3KLS A;  3BS1 A;  3W1G A;  2F4I A;  1EIH A;  3CQZ B;  1UE7 A;  3TP8 A;  1E24 A;  2L55 A;  3RN2 A;  4U67 3;  1LTA D;  1NR2 A;  1PRT F;  1EWH A;  2JE6 I;  1I94 Q;  3CP0 A;  2OF1 A;  1YHB A;  2GVB A;  1Z47 A;  4B08 A;  4P74 A;  2CHB D;  1MBY A;  1TXY A;  4NXM L;  1NR4 A;  4C1N K;  1TWA H;  4C3J B;  5IWA L;  4NPS A;  1E7Z A;  3LGJ A;  4Z9C B;  4DPG A;  1JR0 D;  1I4Q A;  4IUQ A;  4C3H B;  4DFA A;  1BVS A;  1VF7 A;  4C1N I;  4PNY A;  3S24 A;  1SRO A;  1FJG L;  3M3Y B;  4IUT A;  4HSV A;  1WTR A;  2F0I A;  4QB4 A;  4DR2 L;  1F2Y A;  3IFD A;  1QE6 A;  4FVM A;  3J7Z C;  1EOT A;  1XMO Q;  5C4J H;  1CM9 A;  4OO1 I;  4JV5 L;  5D14 A;  4PG3 A;  1F77 A;  3M4Q A;  1J8I A;  2NVT H;  1HR0 Q;  1XX8 A;  1CHQ D;  3L7Z C;  4JI3 Q;  1TWF H;  2EIF A;  3R2I A;  5IY0 A;  4DR3 L;  1EIG A;  2VQF L;  4JC0 A;  1GUT A;  1MI2 A;  2QDL A;  1A3T A;  4FO2 A;  2SEB D;  1HRJ A;  1LT5 D;  3G6E A;  1FNV A;  2NN6 G;  2UXC L;  4PZ7 A;  4DV4 L;  1PFS A;  4LF6 L;  2P5Z X;  3AFP A;  3GTQ H;  1PRT B;  3U4V A;  4OEL B;  4JCV E;  1SRU A;  3A5Z B;  1KIX A;  3S16 B;  3HOZ H;  3K8A A;  1I50 H;  2NTT A;  2XWB B;  3I91 A;  3ND8 A;  1N32 Q;  2RBM A;  2CQA A;  4RG1 A;  1YHQ A;  5C44 H;  3SK6 A;  4HCS A;  2N49 A;  3A74 A;  4P75 A;  1HFN A;  2C9O A;  3M85 A;  4EQP A;  4MZ9 A;  4E6I A;  4X62 L;  1DCZ A;  4HIO A;  3F2D A;  4KD4 A;  2AMC B;  2RDG A;  1RKN A;  4POF A;  3RD4 A;  3QR8 A;  1LTT D;  3J7A 5;  2K1B A;  4K8I A;  3ONA B;  3KOJ A;  4LF5 Q;  5K36 H;  2L9H A;  5C5M A;  2K5W A;  2EXZ A;  4ZUJ A;  2KCT A;  2JA7 B;  2WAQ G;  2WP8 J;  4K5X A;  1PH7 A;  2XGT A;  2Z0S A;  1WFQ A;  1WD0 A;  2DJG C;  4RFB A;  3G4S A;  1JE4 A;  3CRL C;  2F0V A;  2VNU D;  1S4Z A;  2RHS B;  4LF5 L;  1GUG A;  1L0W A;  4LUV A;  3GTM B;  3L9A X;  2AHO B;  1CKO A;  2VS1 A;  4JW0 A;  4LFA L;  3NWT A;  3AFQ A;  5C5L A;  5HY6 A;  1PLF A;  3EQL C;  4EX5 A;  5M5X B;  4AYB E;  1HNW Q;  2JA5 G;  1GVP A;  4J6H A;  3A55 A;  3AB9 A;  2I5M X;  2B2U A;  5K5P A;  4JBW A;  4B3R Q;  4JI2 L;  3HKZ B;  2BOS A;  4UY8 C;  4GS3 A;  3SK8 A;  1Y1W H;  4ZK9 B;  5DNF A;  2L15 A;  2NTS A;  1B3Q A;  2KCN A;  3OWF A;  5CC4 A;  4X66 L;  2EYH A;  3T1H Q;  3FDT A;  3H0G G;  2ENB A;  4UPA A;  4L5S A;  1Y69 U;  4BBS G;  4BA2 I;  1Q81 C;  2RQX A;  3HOW B;  1QB5 D;  2D5D A;  1VQE A;  3I4N G;  3RLO A;  1HXY D;  3MEF A;  4IFD I;  2JP1 A;  1HR0 L;  1PTO D;  1HR0 W;  5IP9 H;  2HHH Q;  4M8A A;  2K32 A;  3CQZ H;  3BDC A;  1I3Q H;  1GJX A;  4HTH A;  2PNR C;  4R4O A;  5M5W H;  3T1Y Q;  5JJL A;  5IOD A;  4KLK A;  5C4X B;  1FGU A;  4ID6 A;  4ZLT F;  4B3S Q;  2JA7 H;  5C3E B;  4G7O C;  1STN A;  2DJF C;  2F4V L;  1AE2 A;  4JYA Q;  4LFB Q;  1KRS A;  3DWA A;  1OXX K;  2WV6 D;  4GOP B;  3TQY A;  1I4G A;  2ALY B;  4IUU A;  1Z7T A;  2NYZ D;  2FIN B;  4A3K H;  3QOJ A;  2A74 C;  5NUC A;  2GA4 B;  1LM0 A;  1Y8N B;  1QVF A;  5FLX L;  4K6L A;  2R61 A;  3HOX H;  1S5D D;  4G57 A;  3HFZ B;  5C3X A;  1PFM A;  5EBC A;  1GUN A;  2NVT B;  1IKM A;  3PUV A;  2TMP A;  3K5M A;  1V1Q A;  3KBX A;  4ZCK A;  1K83 H;  1ICF B;  4H7B A;  4DR7 L;  3KJO A;  3ND9 A;  4V0B A;  3VDY A;  1HNZ L;  2GVA A;  3EJI A;  4I7Z C;  2R7D A;  4LMQ D;  5GAE C;  5C0X I;  2OTJ A;  1VMP A;  3FPP A;  4LF9 L;  3TDQ A;  5M3M G;  1Y1V B;  4BBR G;  5F2D A;  1R4P B;  2SNS A;  5BN4 A;  5FLM G;  3BZC A;  4G4K A;  5IIF A;  3AQQ A;  4JI8 Q;  3U9S A;  2B3G A;  3V96 A;  2WFW A;  4IPH A;  3HOZ B;  4KKS A;  3PO3 H;  1CK1 A;  1IW7 C;  3LWU A;  1SYF A;  2RCF A;  4IOC A;  2QA4 A;  4GKK Q;  2HD3 A;  4XQQ A;  5M3M B;  3WOF A;  4QUF A;  1X3F A;  1IW7 D;  4ZRZ A;  3NEL A;  2ZJQ A;  1HUM A;  4GKJ L;  2JA5 H;  3L3O C;  1TWH H;  4DV3 L;  2Q8I B;  4U68 A;  1SJE D;  2RSN A;  4FYD A;  4UP7 A;  5M3F G;  1BXT A;  4EQ5 A;  3PSI A;  4DR2 Q;  2F0M A;  4YWK A;  4JI7 Q;  2B2W C;  1U5K A;  4FF4 A;  1SYB A;  5IYC H;  3CCR A;  2JA7 G;  4A3G B;  3SEB A;  3U50 C;  5A2Q L;  3RMH A;  2F3W A;  4TSS A;  1AZQ A;  5LMU Q;  4KHP L;  3FRP B;  1SFO B;  5J3B A;  4IUV A;  1N34 Q;  1P16 A;  3HOX B;  4YY3 L;  3H94 A;  1VDZ A;  1IBL L;  4DAM A;  2LXK A;  4A3K B;  3VYU A;  1I4H A;  1UNS A;  1NUC A;  4A3C G;  1JOK A;  2DY7 A;  1CTM A;  1TS3 A;  2G9D A;  3JAM E;  1YIT A;  5ELE A;  1WOC A;  4BBS H;  5IGE A;  1QVG A;  1DZ1 A;  4L6T B;  3BZD B;  3ICE A;  1UEA B;  1MSH A;  2WAQ B;  1TWG H;  2K7V A;  3H0G H;  5C44 G;  5IGF A;  4DR5 L;  2JEB I;  5C3W A;  3LWE A;  5C6A A;  2WB1 E;  2F0O A;  4PMB A;  2O5I C;  3QIA A;  3UDX A;  1Z6H A;  1S40 A;  4BY7 B;  3HGB A;  5JVG 3;  3BZK A;  1L1O C;  1L2F A;  2BA1 A;  2PZT A;  5L37 A;  5C0X H;  1ENC A;  1PRT D;  1AW7 A;  3SK4 A;  2NVY B;  4CHT B;  1BCP C;  4J15 A;  2DY8 A;  4A4I A;  2EQS A;  3RZO B;  1U4L A;  1JOR A;  4YCW A;  3CCS A;  1WD1 A;  1VQO A;  3G71 A;  4LUZ A;  1TWC H;  4ZUI A;  1M1K C;  1V8Q A;  3A0J A;  3TP6 A;  3RZO H;  1JJG A;  2E2H B;  1NAP A;  1D7Q A;  4IJL A;  1H95 A;  1D5X C;  2ZTE A;  5KGU A;  4QUC A;  1U9R A;  1AH9 A;  3C1E A;  1D5M C;  3U4Z A;  2B29 A;  4CJ1 B;  4MIU A;  1A8V A;  3J81 L;  3SXH A;  3K5N A;  2Z4H A;  1RCV D;  5IYD H;  4DV7 L;  4X65 Q;  1LV9 A;  4H0L C;  1VQJ A;  1PV4 A;  2HQL A;  5JEA H;  4X65 L;  1W6J A;  1MGS A;  1QWY A;  1Y14 B;  4DAY A;  5KEE A;  5LMU L;  5LL6 S;  1CSP A;  2F0H A;  1QUQ B;  4MHE A;  4RAU C;  3CF5 A;  1JJC B;  3OTO Q;  1B9M A;  2ICE C;  4ME3 A;  3DXJ C;  4DV3 Q;  1K28 A;  3I4L A;  2KOL A;  2R92 H;  4Q0F A; 
#chains in the Genus database with same CATH homology
 2C35 B;  1G6P A;  2K75 A;  4DUZ L;  3S2H H;  4JI2 Q;  2E2J H;  5IT9 c;  5AJ3 L;  3Q8D A;  3H3V H;  3I4M G;  1M90 C;  1VQA A;  4IPC A;  4NXM Q;  1VQH A;  2CKZ B;  2CQO A;  3MXN B;  3J81 c;  4WJ4 A;  3PUZ A;  1VQP A;  3W1G A;  2E5L Q;  2I0Q A;  3CW2 C;  1UE7 A;  1LUZ A;  1UEB A;  2UXD Q;  5IYB G;  2Z6K A;  1E24 A;  3KLW A;  3RN2 A;  3CC4 A;  4DV2 L;  2D0O A;  2BA0 A;  2AWN A;  2JE6 I;  2YYZ A;  1Q82 C;  3KDF B;  1I94 Q;  3CP0 A;  4JI6 L;  4DV5 Q;  1PH5 A;  4R1J A;  4YWM A;  1YHB A;  4JBM A;  2MNA A;  2GVB A;  2UXD L;  1CKM A;  1SLJ A;  1Z47 A;  4KHZ A;  5IWA Q;  3RR5 A;  4X62 Q;  3E9I A;  4LF4 L;  4P74 A;  1NE3 A;  5GAG C;  2QGQ A;  1TXY A;  3PUY A;  1XMQ Q;  5C3E H;  4X64 L;  4NXM L;  4DR6 L;  1RIP A;  1TWA H;  5IWA L;  3T1Y L;  4NPS A;  5LMN L;  1E7Z A;  1EOV A;  3LGJ A;  4UP8 A;  4DPG A;  2JK8 A;  4LWC A;  3HOU H;  1BVS A;  2VQE L;  3M3Y H;  4DV6 Q;  3I7F A;  4DR7 Q;  3S24 A;  1RL2 A;  3RN5 A;  1SRO A;  1FJG L;  1YBY A;  2OTL A;  1CUK A;  4DR2 L;  4C3H H;  1XNR L;  3J7Z C;  4PZ8 A;  4YHH L;  1XMO Q;  5C4J H;  4DKA C;  4GN4 B;  4OO1 I;  3DM3 A;  4JV5 L;  3FKI H;  4B3M Q;  4PG3 A;  1VQC A;  1V9P A;  2Q2H A;  1HZB A;  1YI2 A;  3S1M H;  3M4Q A;  4JI4 L;  2V1C C;  3IRB A;  4MTN A;  4UP9 A;  3CCM A;  2UU9 L;  2NVT H;  1HR0 Q;  4JI3 Q;  3L7Z C;  3KF6 B;  3F2B A;  5LMN Q;  1TWF H;  2CWP A;  2EIF A;  1HZC A;  5IY0 A;  4DR3 L;  3GTO H;  4LW1 A;  2VQF L;  1SFO H;  1A0I A;  1EWI A;  1Q12 A;  4JC0 A;  3UDG A;  1MJE A;  2VUM G;  1C9O A;  1K3R A;  3BJU A;  3B6Y A;  4GKJ Q;  5JEA G;  1JB7 A;  2PQA A;  2JJQ A;  4IPG A;  1FJG Q;  3CC2 A;  3FP9 A;  5GAD C;  2HT1 A;  3G6E A;  1IBK L;  2VUM H;  1L1O A;  2AWO A;  2NN6 G;  2UXC L;  4GN3 B;  4PZ7 A;  1PFS A;  4DV4 L;  4LF6 L;  1MKH A;  3AFP A;  3S15 H;  1PA6 A;  1EYG A;  3GTQ H;  1YIJ A;  5IYB H;  4DR1 Q;  3KYH C;  2ASB A;  1KQS A;  3U4V A;  1X65 A;  4JCV E;  4DR5 Q;  1VQL A;  1SRU A;  1Z9F A;  3A5Z B;  2VZA A;  4GLV B;  3STB C;  1J5E L;  1KIX A;  2VQF Q;  2LXJ A;  2MO0 A;  4LF4 Q;  3HOZ H;  3K8A A;  3F2C A;  1I50 H;  4HIK A;  2YU9 H;  4JI5 Q;  1N32 Q;  1YEZ A;  2CFM A;  3A5U A;  2RF4 A;  4A3E G;  3AYH B;  2ES2 A;  1PH6 A;  1IBM Q;  1P8L A;  1E3P A;  4RG1 A;  1YHQ A;  1Q86 C;  4HJ8 A;  5C44 H;  4DV2 Q;  4JI8 L;  1VCI A;  4P71 A;  5E7N A;  1QZG A;  2N49 A;  3A74 A;  2R92 G;  3GTG H;  4P75 A;  1XPU A;  2R93 G;  3CCQ A;  4DV1 L;  1EIY B;  4L5T A;  2R6G A;  3M85 A;  4MZ9 A;  3HOU G;  4XTC S;  4X62 L;  1PH8 A;  1VQ8 A;  1PH1 A;  1YNX A;  4NB3 A;  5LMN W;  3F2D A;  1X55 A;  4HIO A;  4A3I G;  4Y52 H;  2JA9 A;  2WAQ E;  1Q46 A;  2AMC B;  1VQ4 A;  4POF A;  2UUA Q;  1XJV A;  2OQK A;  4DR1 L;  2N8N A;  1T9H A;  1N36 Q;  1FL0 A;  1X3G A;  3J7A 5;  3STB D;  1N32 L;  2R7Z G;  4JI4 Q;  2KHI A;  3HOV G;  1S3O A;  2Y0S E;  3KOJ A;  4LF5 Q;  2R7F A;  2DUD A;  5ELO A;  5C0X G;  3HOY G;  4AQY L;  1A63 A;  4P73 A;  5IYD G;  3S1N H;  4IOA A;  3PO2 G;  5C4X H;  1YJN A;  4YWL A;  2OWO A;  4A3D H;  3PUW A;  1EQR A;  4QY7 A;  3PIO A;  3GTL H;  1YHA A;  4O2D A;  2KCT A;  2RCN A;  2AKW B;  3I2Z A;  3FHW A;  2WAQ G;  2WP8 J;  4JI1 Q;  3WWV A;  4DV0 Q;  1XNQ L;  3J80 i;  1PH7 A;  1A62 A;  2BH8 A;  2K5V A;  2XGT A;  2Z0S A;  3I4M H;  1WFQ A;  3JC6 6;  3GTM H;  2IX0 A;  1VQB A;  4A3L G;  3G4S A;  5IYC G;  1YJW A;  4GNX B;  1SE8 A;  1N8R C;  2VY3 A;  3S14 H;  1YJ9 A;  2VNU D;  1VQF A;  1WJJ A;  2UUB L;  2RHS B;  4LF5 L;  3GDE A;  1QVC A;  1L0W A;  1XNR Q;  4LUV A;  4JBJ A;  1PH2 A;  3NEM A;  3OYY A;  1BBW A;  3M4O H;  2AHO B;  1IZ6 A;  2ZJP A;  4JI6 Q;  4JI5 L;  5M3F H;  4TVA B;  4DV4 Q;  1E1O A;  1CKO A;  2MO1 A;  2VS1 A;  4FDB A;  1VQG A;  2UUA L;  2ATW A;  1IBM L;  1HH2 P;  3CD6 A;  4A3C H;  3H15 A;  4LFA L;  3AFQ A;  1PH9 A;  5HY6 A;  3H3V I;  4EX5 A;  3D31 A;  1XMQ L;  1XPO A;  4AYB E;  1HNW Q;  2JA5 G;  1DGS A;  1GVP A;  2Q2I A;  1KAW A;  1L1O B;  3CCL A;  4IFD J;  2VW9 A;  2I5M X;  1X3E A;  2PNH A;  4JBW A;  4JI2 L;  4B3R Q;  4UY8 C;  4GS3 A;  1Y1W H;  1N34 L;  4JI7 L;  1NMG A;  4QQB X;  1KHI A;  2L15 A;  3JAM i;  1N36 L;  4LF6 Q;  4K0K Q;  1B70 B;  2JA8 G;  2WB1 G;  1JT8 A;  4OWW B;  2ID0 A;  1PYB A;  3EIV A;  4X66 L;  4BXX H;  3T1H Q;  4YHH Q;  3M4P A;  1NTG A;  3H0G G;  4K0K L;  3TRE A;  1WCM H;  2IT1 A;  2YV5 A;  4UPA A;  2IHF A;  1SR3 A;  1PHJ A;  4L5S A;  2VL6 A;  3K7U C;  1VQK A;  3I56 A;  3HKS A;  4A3J H;  2HIV A;  2JA6 H;  4BBS G;  3NEN A;  4HIM A;  4BA2 I;  1HNW L;  4BY7 H;  2Y0S G;  2QEX A;  1Q81 C;  4A3B H;  2E5L L;  4XIG S;  1Q1E A;  1J5E Q;  3UDI A;  4APV A;  1K73 C;  1VQ9 A;  5M5Y H;  4DUY L;  1VQE A;  1EFW A;  1K8G A;  3I4N G;  3RLO A;  1EQQ A;  1PH4 A;  1I6H H;  3MEF A;  4IFD I;  3E0E A;  4BA1 I;  5AJ3 Q;  1X9N A;  1GO3 E;  1HR0 L;  1S72 A;  1UE6 A;  1HR0 W;  1CSQ A;  1G29 1;  5IP9 H;  1JMC A;  2K5N A;  2HHH Q;  4POG A;  4X6A H;  3CQZ H;  3M7N A;  1I3Q H;  3CCU A;  2DGY A;  3OTO L;  1JE5 A;  4R4C A;  4R4O A;  3W1B A;  3J80 c;  5M5W H;  4AYB G;  3T1Y Q;  4A93 G;  4KHP Q;  5JJL A;  1BKB A;  1Y1V G;  2E2H H;  4KLK A;  4LFA Q;  4AQY Q;  2KEN A;  3M9B A;  4LFC Q;  4X66 Q;  1FGU A;  4DV6 L;  4B3S Q;  3PCO B;  1UE1 A;  2JA7 H;  4JI3 L;  3ZJY C;  4DK6 C;  3GD7 A;  3HKZ G;  2F4V L;  4YCU A;  1JJ2 A;  4HID A;  4NXN Q;  2F3I A;  1AE2 A;  2ZJR A;  4IJH A;  4A3M H;  2B63 H;  3S1Q H;  1KRS A;  3K7A H;  4IPD A;  4DR4 Q;  4X64 Q;  2JEA I;  2ZM6 Q;  1OXX K;  4GNX A;  1O7I A;  3UDF A;  4GKK L;  4BBR H;  4GOP B;  4A3M G;  2B63 G;  3KF8 B;  4GNX C;  3TQY A;  4OON A;  3NBH B;  4ALP A;  3TRZ A;  2ALY B;  1C0A A;  3CAM A;  4DR4 L;  1X56 A;  3PUX A;  4PZ6 A;  4A3K H;  4A3F H;  3GO5 A;  2FXQ A;  2UU9 Q;  1LM0 A;  1QVF A;  4DV0 L;  3EBE A;  2KBN A;  3ERS X;  4LF8 L;  1CKN A;  4Y7N H;  3HOX H;  1Y1V H;  1GM5 A;  3HFZ B;  4L5R C;  5GRO A;  1KRT A;  1LTL A;  5IP7 H;  3PUV A;  2UUB Q;  5FJ8 H;  1V1Q A;  1VQ6 A;  3K0X A;  4GOP A;  1K83 H;  2K4K A;  2RHQ B;  4WJ3 M;  4DR7 L;  3KJO A;  3VDY A;  4JYA L;  4LFB L;  3CMA A;  4BY1 H;  1HNZ L;  3HOX G;  3HOW G;  2GVA A;  4GN5 A;  2R7D A;  5H1S E;  5GAE C;  5C0X I;  4B3S L;  2OTJ A;  3CPW A;  1CKN B;  4IO9 A;  1N33 L;  4OX9 L;  3I4O A;  2K14 A;  4HJA A;  5GQO A;  5M5X H;  2NZH A;  4GOP C;  4LF9 L;  5M3M G;  1W3S A;  4BBR G;  5FLM H;  5FLM G;  1VQM A;  2Z6K C;  4OX9 Q;  2BH2 A;  4R4T A;  4A3G G;  3BZC A;  2R92 H;  2D62 A;  3AQQ A;  4JI1 L;  4JI8 Q;  1XNQ Q;  3PF4 A;  3S17 H;  2HIX A;  2B3G A;  1BBU A;  2ZTC A;  2WFW A;  2NN6 I;  4IPH A;  4R4Q A;  1XPR A;  2MFI A;  4DV7 Q;  4GLX A;  2I5L X;  3GTJ H;  1HNZ Q;  3PO3 H;  2N3S A;  1V43 A;  3K80 C;  4BXX G;  2F52 A;  2NZO A;  3J81 i;  1LYL A;  4B3M L;  3I55 A;  1VQ7 A;  1NY4 A;  4BY1 G;  3HOW H;  1NBW A;  1J6Q A;  1HZ9 A;  4IOC A;  5GAH C;  1IYJ B;  2QA4 A;  4HJ5 A;  1Y1W G;  4GKK Q;  1GD7 A;  1UWV A;  4OWT B;  1AE3 A;  1X3F A;  2NVY H;  5IP7 G;  3S1R H;  4LF9 Q;  3NEL A;  1YVC A;  2ZJQ A;  2I5H A;  4QIW E;  4B3T L;  4B3R L;  4GKJ L;  3GTK H;  1GKH A;  5C0X J;  2JA5 H;  1ASY A;  1TWH H;  2KHJ A;  4O0A A;  4DV3 L;  3UE1 A;  4JV5 Q;  4LUO A;  3J81 j;  1UE5 A;  4OXP A;  3PO3 G;  1VQN A;  2YTY A;  3CCV A;  4A3F G;  3D0F A;  3T1H L;  2K5H A;  3F1Z A;  4UP7 A;  4A76 A;  5M3F G;  1XTD A;  1NJI C;  1N33 Q;  4EQ5 A;  3PSI A;  1ASZ A;  2E8G A;  1WYD A;  5HGQ A;  1VQD A;  4C2M H;  1U0L A;  4A3G H;  1FVI A;  4DR2 Q;  1E1T A;  3E9H A;  4OO1 G;  4YWK A;  5ELN A;  4JI7 Q;  3CCJ A;  1W2B A;  5M3M H;  1G51 A;  4AH6 A;  4LF7 L;  1U5K A;  1K8A C;  4QJF A;  5IYC H;  3CCR A;  4B3T Q;  2JA7 G;  1WCM G;  3U50 C;  4A3L H;  5JJI A;  4GLA C;  4JBK A;  1B7Y B;  5LMU Q;  3PGZ A;  4JI0 Q;  4KHP L;  2Q2T A;  2GN5 A;  3RZD H;  4DUY Q;  2JA8 H;  2IX1 A;  2N78 A;  4A93 H;  1PH3 A;  5J3B A;  3TS2 A;  3RLN A;  5FJ8 G;  4A3D G;  2UXB L;  2HHH L;  1N34 Q;  3L2P A;  4DUZ Q;  1P16 A;  2OQ0 A;  5IP9 G;  2A1A A;  1KXL A;  4LF8 Q;  4YY3 L;  1HJP A;  2MQH A;  4PMW A;  3S16 H;  2CWA A;  4IFD G;  1K0R A;  5DLQ E;  1IBL L;  3RNU A;  4DAM A;  1WI5 A;  2A19 A;  2LXK A;  4DAY B;  1HZA A;  4DK3 C;  2OCE A;  3PIP A;  4YY3 Q;  4A3C G;  4QL5 A;  2PMZ E;  4DV1 Q;  4A3K G;  3GTP H;  5JEA J;  4JYA Q;  4LFB Q;  5IE8 A;  4A3B G;  1VQI A;  2E2I H;  1YIT A;  4NXN L;  1WOC A;  4BBS H;  1QVG A;  3BU2 A;  2JA6 G;  1OXT A;  3ICE A;  2ZTD A;  4JG2 A;  1HNX Q;  1OXU A;  1TWG H;  2H5X A;  3H0G H;  1B8A A;  5C44 G;  3CME A;  4DR5 L;  2XTI A;  1XMO L;  2JEB I;  3PF5 A;  2UUC Q;  1QZH A;  1D8L A;  4C3I H;  1YZ6 A;  2WB1 E;  1X6O A;  1KC8 C;  1KL9 A;  4JOI A;  3UDX A;  4DNI A;  2UXB Q;  2JQO A;  1S40 A;  1IL2 A;  5C4X G;  1OXS C;  3BZK A;  3KDF A;  1L1O C;  1L2F A;  5BR8 Q;  3KJP A;  1MJC A;  3OW2 A;  3TS0 A;  2BA1 A;  3S2D H;  4LNQ A;  1EIF A;  2YTV A;  3G48 A;  3HOY H;  5K36 G;  1K9M C;  1IBL Q;  1Q1B A;  3HOV H;  1OTC A;  3I4N H;  1HNX L;  4J15 A;  1Q8K A;  3ULL A;  4A4I A;  2VQE Q;  2EQS A;  2CCZ A;  1IBK Q;  1N9W A;  3CPF A;  4H02 A;  4HJ9 A;  4YCW A;  3CCS A;  2PI2 E;  3G71 A;  1VQO A;  4LUZ A;  2UUC L;  1TWC H;  4BY7 G;  3EN2 A;  1M1K C;  2YTX A;  4AIM A;  3A0J A;  4LFC L;  3RLF A;  5JJK A;  1I5F A;  3RZO H;  3CC7 A;  1JJG A;  4A3J G;  1MIU A;  4JI0 L;  2R93 H;  2NVX H;  1E22 A;  4QGU A;  4TQU S;  4KI0 A;  2K50 A;  2Q2U A;  1D7Q A;  4IJL A;  2F4V Q;  4YCV A;  5BR8 L;  1Q7Y C;  1H95 A;  3FKI G;  3F8T A;  2ZTE A;  4DR3 Q;  4A3E H;  3HKZ E;  4OWX B;  1AH9 A;  3JAM c;  3DLL A;  3CXC A;  1VQ5 A;  3TEH B;  3HOZ G;  2A8V A;  3U4Z A;  3KF6 A;  2B29 A;  3UE0 A;  3SGI A;  4MNO A;  3KFU A;  2IHE A;  1X54 A;  1A8V A;  4DR6 Q;  3PO2 H;  1QUQ A;  4C3J H;  3U58 A;  4HJ7 A;  5IYD H;  1EUJ A;  4JOI C;  3PV0 A;  1SMX A;  3CCE A;  4LF7 Q;  2EXD A;  4DV7 L;  2NVQ H;  2PQA B;  3K81 C;  4RMF A;  4X65 Q;  4L5Q A;  3AEV A;  2R7Z H;  5C3E G;  3ER0 A;  2PI2 A;  1NMF A;  4P72 A;  1SN8 A;  1VQJ A;  2KCM A;  1IXR A;  1PV4 A;  2IY5 B;  3L0O A;  5EAY A;  2HQL A;  1OXV A;  4X65 L;  1Y14 B;  1PVO A;  3W5O A;  5FLX c;  1VS0 A;  5LMU L;  1CSP A;  4A3I H;  2K52 A;  4A75 A;  1R9T H;  4DV5 L;  1QUQ B;  3ULP A;  3CF5 A;  1JJC B;  2LSS A;  3OTO Q;  2ZM6 L;  4ME3 A;  1I94 L;  4DV3 Q;  4R4I A;  1PYS B;  2D0P A;  2UXC Q;  1KD1 C;  3ULJ A;  1C7Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...