5IWAQ

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the ge81112 peptide antibiotic
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of translation initiation complex formation by GE81112 unravels a 16S rRNA structural switch involved in P-site decoding.
pubmed doi rcsb
molecule tags Translation
molecule keywords 30S ribosomal protein S2
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5iwaQ00
1K73C 5DLQE 3CPFA 4NXMQ 5IYDG 4ME3A 5FLMH 4DR2L 3S14H 3T1HQ 2WFWA 3I4NH 1VQBA 3L2PA 1CUKA 3S2HH 1RL2A 1WFQA 4YWMA 4LF4L 2ATWA 1X65A 4X66Q 4DV4Q 3TREA 1Q46A 2B29A 1KD1C 1X54A 5M5XH 2VS1A 1XPUA 1YHBA 5M3MH 3CC7A 1GVPA 3AQQA 2K14A 2JA5G 4APVA 4POFA 2MNAA 4JYAL 2LXJA 3EIVA 4DK3C 1XTDA 2EXDA 4X64Q 1KC8C 4NB3A 2GVBA 4LF4Q 1H95A 4JI6L 2RF4A 3CAMA 2OQ0A 3I55A 4OX9L 4Y7NH 3M85A 3A5ZB 2NZOA 2E2JH 3GTQH 1FVIA 2CKZB 4MTNA 3CC2A 2E5LL 4GNXB 1PA6A 1EQRA 5GAHC 4NXML 3M7NA 3FKIG 1AE3A 1VQEA 2YU9H 2CCZA 4DR4L 1PVOA 1VQJA 1HZ9A 1L2FA 2K4KA 2EQSA 3OW2A 4IFDG 3FKIH 2JA7G 4XIGS 1G6PA 2PNHA 1VQDA 4EX5A 2H5XA 2MO0A 2NVQH 4JI7Q 3H3VH 1EUJA 1EWIA 3RLFA 2R7ZG 1VQHA 4O2DA 1YVCA 1J5EQ 3FHWA 1JJ2A 1JB7A 1JJCB 1TWFH 5ELOA 3J81c 1OTCA 2Q2HA 1Q82C 1HNXQ 3KDFA 5IY0A 1YI2A 1XMOQ 1D7QA 2GVAA 2D62A 4DUYQ 1Z9FA 1C0AA 3KYHC 1YHAA 3U50C 1BKBA 1YIJA 2VW9A 1DGSA 3UDGA 4JI8Q 2ID0A 1VQFA 3I7FA 4NXNQ 2XTIA 3RNUA 2E2IH 3PUWA 1CSPA 2ES2A 4LF7Q 1YITA 1Y1WH 2F4VQ 3GTGH 3K80C 1PH2A 4JYAQ 5BR8L 4BA2I 4NXNL 4C3IH 5E7NA 4OWXB 4JI4L 4AQYQ 2OWOA 1PYSB 2UUBQ 2JA6G 1IBKQ 1IL2A 4QQBX 3CCSA 4C2MH 4GLVB 1ASZA 3TEHB 5IP7G 4A75A 1AH9A 2K75A 3UDFA 5C44G 2K52A 5M5YH 1N33L 3S1MH 1VQNA 3HOVH 3LGJA 2R6GA 3UE0A 5JJLA 4IJHA 1N32L 2UXDL 4DK6C 1KQSA 1HZCA 2QA4A 3ICEA 1UE1A 2JA6H 3D0FA 3ZJYC 4X62L 5IWAQ 4DV5L 1I94L 1PV4A 2JE6I 4BY7G 2B3GA 4K0KL 4A3GG 1N32Q 4BBSG 5C0XJ 4ALPA 2DUDA 1QVCA 1NJIC 4YWKA 3DM3A 4LNQA 1IYJB 1X3GA 4A3KH 4C3JH 2MO1A 1VQMA 2CWAA 4QJFA 4B3TQ 2ZM6Q 2IHFA 4JBKA 1VQ6A 4AIMA 1X56A 3RZOH 1VQCA 2MQHA 3PSIA 4R1JA 2AWOA 3JAMc 3WWVA 4EQ5A 2ASBA 2KHIA 2WAQG 3PV0A 2R93G 3MXNB 3OTOL 1G51A 1MJEA 5LMNL 2IHEA 4PZ8A 1XNRQ 2F4VL 2CQOA 2YV5A 4LUOA 2NVTH 3HOZH 3ULLA 2I5HA 3ULJA 4XTCS 3S16H 4A3EG 4DR5L 3HOUG 1HZBA 3CXCA 3G48A 2HIVA 2WB1G 4JI1Q 2F3IA 1NBWA 4GLAC 3T1HL 2D0OA 1C7YA 2ZTEA 1HNWQ 2JA9A 1WOCA 4DR7Q 1Q1BA 3CCVA 1VCIA 3F2DA 4DR5Q 2WB1E 1QVGA 3I4MH 4LUZA 1PHJA 2UUBL 5LMUQ 2PI2E 2LSSA 1KRTA 2BH2A 1NTGA 2IX0A 4JI4Q 4WJ4A 1SRUA 4OONA 3HOUH 3S15H 5LMNQ 5FLMG 1SROA 1EIYB 4DR3L 3AEVA 3TS2A 4Y52H 4DV3L 3PCOB 4DV1L 4GOPB 3UE1A 4BBRH 4R4QA 3H0GH 2I5LX 3G4SA 2VNUD 1PH1A 3S2DH 1KXLA 2VUMH 3I2ZA 4LF6Q 1NMFA 1IXRA 3EN2A 4B3TL 4R4IA 4LFCQ 3KFUA 1TWGH 1IZ6A 5IT9c 4DR3Q 3AYHB 3F2CA 3HOZG 2EIFA 3PIOA 3M3YH 4YWLA 3U58A 2R92H 4A3DG 2FXQA 1SLJA 1HR0Q 3CD6A 3A0JA 5J3BA 5LMUL 4JI7L 3PUZA 4KHPQ 3KOJA 1VQ4A 1XMQL 4LF9Q 5C4XG 2AHOB 2N8NA 4KHZA 1EYGA 1W3SA 3RLNA 3HKSA 3W1BA 4A3MH 2OTLA 1I6HH 1E1OA 1KL9A 3STBC 4HIDA 1PH5A 2VL6A 1LTLA 2K50A 1M1KC 2Q2TA 1L1OC 5FJ8H 4DR7L 1VQAA 4B3ML 1IBKL 4A93G 2B63H 3M4OH 5IP7H 4OX9Q 1Y1VH 3SGIA 4P74A 1GKHA 1HNZQ 4A4IA 3TRZA 3PUYA 4TVAB 4L5SA 3S1NH 1XPRA 4DV6L 2UU9L 2OCEA 3K0XA 1Q8KA 3MEFA 1I5FA 2Q2UA 1VQ8A 1VQIA 2WAQE 2JA8H 1JJGA 1LUZA 4LF6L 5C44H 2L15A 2PMZE 4IJLA 1OXUA 3PF5A 2R7ZH 4BY7H 1OXSC 4KI0A 4JI6Q 2KCMA 5K36G 1YHQA 1WI5A 1TXYA 1VQLA 1Q1EA 2HT1A 4L5QA 1QZHA 3PGZA 4TQUS 5HY6A 4IFDI 1WJJA 1U0LA 3JAMi 2VQFQ 2JEBI 3HOXH 4JI0L 4JOIA 4DV1Q 4P75A 2QGQA 4LFAL 1KHIA 2DGYA 2F52A 3RLOA 4BA1I 4DV4L 3HOWG 1HNZL 4B3RQ 2PQAB 1HJPA 3BZKA 3S24A 4PZ6A 5IWAL 4HJAA 2NN6G 3CCJA 4LWCA 1B7YB 5GADC 4UPAA 1QVFA 3W5OA 4A3IH 2IY5B 1NE3A 3AFQA 4GKJL 2JEAI 4QGUA 1CSQA 2K5VA 1OXTA 3M4PA 1Q81C 1V43A 3I56A 4DV7L 2GN5A 2BA1A 2E8GA 1I50H 3H0GG 3OYYA 4GOPA 4A3CH 2N49A 3CCMA 1LM0A 2KHJA 1TWHH 4A3LG 2C35B 2YTVA 2RHQB 4A76A 4A3CG 4A3FG 2Z0SA 4DV6Q 2UU9Q 1A63A 3KJOA 5IYDH 3BU2A 1N34L 3CMAA 2QEXA 1GM5A 1N8RC 4IOAA 4AH6A 1K8GA 1QUQA 1PH7A 4JI2Q 4X65L 2ZJPA 3AFPA 4DR6L 1PYBA 4LF7L 1MIUA 1WCMH 1EIFA 4A3IG 4IFDJ 4HJ8A 1L1OB 4OWTB 1K83H 1Y14B 4P73A 4YCWA 2Q2IA 3KF6B 1XPOA 2YTYA 4A3LH 1WCMG 4K0KQ 4A3MG 3I4NG 5C3EG 5IYBG 4IO9A 4BBSH 4HJ5A 1R9TH 2ZJQA 1B8AA 2A1AA 3ULPA 1J5EL 2I0QA 4OWWB 1YNXA 1PH8A 1S72A 3PO3H 4BBRG 4JCVE 3CCRA 5M3FG 1YJ9A 3JC66 2BH8A 1XJVA 1OXXK 2V1CC 1Y1WG 1HNWL 3PO2G 3M4QA 1WYDA 4GLXA 4X6AH 5FLXc 5IE8A 2HIXA 4H02A 5ELNA 5GROA 1L0WA 4GN4B 1YJNA 2LXKA 1VQKA 4JI2L 2NVYH 4R4TA 4GOPC 3HOYG 4UP7A 3H3VI 2I5MX 3GD7A 4GN5A 1V1QA 4WJ3M 3PF4A 4YCUA 3PO3G 1Z47A 1XNQQ 4P72A 3L0OA 2RHSB 1UWVA 4UP9A 2A8VA 1TWCH 1GD7A 4GS3A 1HR0L 3CCEA 3GTMH 5BR8Q 3K8AA 4YY3Q 1PH6A 4DR1L 1YZ6A 3OTOQ 4DV2L 4X66L 4DKAC 3NELA 1TWAH 1VS0A 3GO5A 4YCVA 1VQOA 3KJPA 4DR2Q 4B3SQ 1O7IA 1EQQA 1UE6A 3A5UA 4L5RC 4IPGA 2OTJA 1N9WA 1SN8A 1YEZA 3J81i 4QY7A 4DV0L 4UY8C 1EOVA 3W1GA 4OO1G 1OXVA 4DNIA 3HOYH 1D8LA 1HH2P 3CW2C 2R7DA 2ZTCA 4NPSA 1I94Q 3ERSX 1XMQQ 1SR3A 2B63G 4LFBQ 4DR4Q 3GTKH 2HHHL 2NVXH 4PMWA 4JI0Q 4BXXH 4JG2A 4A3KG 1K8AC 2R93H 3G6EA 4JBWA 4DV0Q 2E5LQ 2VQEL 2HQLA 1IBLQ 1N33Q 1VQGA 1E3PA 1KRSA 3F1ZA 3H15A 1P8LA 1E22A 5IYCG 4JI1L 4JI5L 4A3FH 4R4OA 3E9HA 4BXXG 4BY1G 2JQOA 1K9MC 4B3SL 1E24A 1M90C 4QIWE 1NY4A 1YBYA 3VDYA 4A3BH 4X65Q 4DR6Q 1QUQB 2KCTA 2UUCQ 4MNOA 4LF8L 1EFWA 5EAYA 1XNRL 4IPCA 5HGQA 4X64L 4A3GH 4DR1Q 3CMEA 3RR5A 4YY3L 2D0PA 1UEBA 4GNXC 1T9HA 4JI8L 4R4CA 4HJ9A 3KLWA 1SFOH 1A8VA 2BA0A 2Y0SG 2Z6KC 3U4ZA 5M5WH 2UXDQ 1AE2A 3HOVG 2AMCB 3HFZB 3I4OA 3UDIA 1JMCA 3NBHB 5GAEC 2VZAA 4HJ7A 3A74A 3T1YL 4A3JH 1X55A 3I4MG 4LF5L 5IP9H 1VQ7A 1RIPA 4JI3L 4PZ7A 4AYBG 5C0XI 1FJGQ 3HOXG 4AQYL 1BVSA 1BBUA 3J81j 5JJIA 2UXCL 1GO3E 1UE7A 5C4JH 3RN2A 3K7AH 4QL5A 3KF6A 1CKOA 1SMXA 3NENA 4LFCL 4C3HH 2VQFL 4YHHL 2UUAQ 2CFMA 4IPHA 2E2HH 4GKKL 1JE5A 4LUVA 5C0XG 1IBML 3CP0A 2JK8A 4DV3Q 2KENA 1W2BA 2VY3A 1HNXL 1N34Q 2IX1A 1E1TA 2VQEQ 5IP9G 2PI2A 4A3EH 3CC4A 1X9NA 3BZCA 5AJ3L 5IYBH 4X62Q 4DV5Q 1Q12A 1XNQL 4A93H 1KIXA 1FJGL 1VQ5A 1CKNA 3PO2H 2ALYB 4JI3Q 2JA7H 4JBMA 1FGUA 4IOCA 3E0EA 4HIKA 3L7ZC 3T1YQ 1N36L 3STBD 4B3MQ 4HIOA 1ASYA 3Q8DA 4GKJQ 1NMGA 1Y1VG 3B6YA 5M3MG 2HHHQ 3S1RH 3S17H 3F2BA 4UP8A 2ZJRA 4A3DH 1QZGA 1X6OA 4JBJA 4J15A 3HKZE 4IPDA 1PH4A 3FP9A 4P71A 1S3OA 5GAGC 2ZTDA 1S40A 4BY1H 1PH3A 1JT8A 4DV2Q 4MZ9A 3CF5A 3TS0A 3GTLH 2VUMG 4LFAQ 5LMNW 2XGTA 5AJ3Q 2OQKA 1J6QA 1PH9A 3J7ZC 4GNXA 1MJCA 3CCLA 4LF8Q 3TQYA 3E9IA 1LYLA 3U4VA 4GKKQ 2WP8J 5C3EH 4YHHQ 2UUAL 2N78A 4PG3A 3K81C 4DUYL 1IBMQ 2JJQA 1XMOL 4JI5Q 1YJWA 2R92G 3F8TA 2K5NA 3RN5A 3KDFB 1C9OA 1IBLL 4LW1A 1CKNB 1I3QH 3EBEA 3KF8B 3PUVA 2Z6KA 3HOWH 1G291 4JOIC 3IRBA 5JEAG 4JV5L 5C4XH 4L5TA 3CCQA 1MKHA 4RMFA 4LFBL 1Q7YC 3HKZG 4AYBE 2AWNA 2UXBQ 1VQPA 3UDXA 3G71A 2K5HA 3J80c 3DLLA 4LF5Q 1L1OA 1KAWA 4DPGA 1SE8A 1P16A 4A3JG 4OXPA 5H1SE 2AKWB 1X3FA 1U5KA 1N36Q 4POGA 2JA8G 2KBNA 1CKMA 4O0AA 1VQ9A 2Y0SE 1E7ZA 2A19A 4RG1A 4DAYB 2YYZA 4HIMA 5GQOA 2RCNA 4LF9L 1V9PA 3GTPH 4KHPL 1B70B 4JC0A 3PUXA 3D31A 4JV5Q 3CCUA 5JJKA 4FDBA 5FJ8G 2IT1A 3ER0A 3M9BA 1A0IA 2CWPA 3GTJH 5JEAJ 2JA5H 1Q86C 2UUCL 3GTOH 3RZDH 3S1QH 4DAMA 3PIPA 2NZHA 5IYCH 4KLKA 2UXCQ 2ZM6L 1UE5A 4OO1I 2PQAA 3BJUA 3CPWA 4DUZL 4GN3B 2NN6I 1BBWA 1PFSA 2N3SA 3J7A5 4A3BG 1HZAA 3CQZH 2YTXA 3GDEA 1A62A 1K0RA 5M3FH 1HR0W 2R7FA 2UXBL 3K7UC 4B3RL 1K3RA 2MFIA 1FL0A 3NEMA 3J80i 4DV7Q 1X3EA 4DUZQ
chains in the Genus database with same CATH superfamily
2DN8A 3TBIB 3AU7A 5FLMH 4DR2L 3S14H 3T1HQ 3HOUB 2WFWA 1VQBA 3L2PA 3S2HH 2J4XA 1JOQA 4XYQA 3TREA 1YHBA 1JWMD 2LXJA 2EXDA 1S5ED 2NB0A 4LF4Q 3NTKA 3MXGA 3NBIA 3IFTA 4Y7NH 3D3RA 3A5ZB 4MTNA 2E5LL 4GNXB 3GTGB 1GHKA 1HZ9A 2K6AA 4IFDG 3Q0AA 5I9PA 2JA7G 2A68D 1RTOA 5EPLA 1KLUD 1TS5A 1VQDA 3ND9A 2NVQH 1ENCA 3H3VH 2QEJC 4O2DA 1PZID 5C5MA 3FHWA 1JJ2A 2XWJB 5BN5A 1W6JA 1WVLA 2Q2HA 1Q82C 5IY0A 5KYLA 4XQNA 1YI2A 2JA6B 2GVAA 3DMUA 4DUYQ 3L3OC 1SE4A 3KYHC 4FNFA 2VW9A 1MI2A 1V1OA 2Y0SB 2E2IH 3PUWA 4V190 1RF2D 1ZYRD 5BR8L 2EY5A 3DM1A 4ILWA 2Z4HA 4OGQC 4XQJA 1QNKA 4B08A 2UUBQ 4QQBX 3CCSA 2A6HD 4KKTA 4GLVB 3UDFA 5C44G 1VQNA 2HCCA 5JJLA 4DK6C 2CH4W 4FF2A 4DV5L 3ZJYC 3I4NB 5IWAQ 1HFNA 5E4WC 3DXJC 1B9NA 4NMZA 4YWKA 2SDFA 3DM3A 4LNQA 1IYJB 4C3JH 1VQMA 4C3IB 2CWAA 1G6ZA 1EYDA 4Q5VA 2JXMB 1PTOD 4A3BB 3Q22A 3PV0A 4RH6A 4WJWA 1G51A 4KD4A 2F4VL 3FVQA 3N52A 2CQOA 2E2JB 1ICFB 1EY8A 2NBFA 2JN4A 4FF3A 3HOZH 1EWHA 3HOUG 1HZBA 3G48A 1HA6A 2O4XA 1DJRD 3T1HL 2D0OA 3OMCA 2ZTEA 3LWEA 4DR7Q 2F0SA 2WB1E 4X3SA 1PHJA 2UUBL 4DFAA 5LMUQ 4V0BA 1XTCD 4WJ4A 2IX0A 4OONA 3S15H 4H0LC 3D6CA 4DV3L 4GOPB 4C1NK 1PH1A 2VUMH 3I2ZA 1PLFA 4B3TL 3W3AA 2F3VA 5IT9c 1K0SA 3AYHB 3F2CA 3M3YH 3PIOA 4M8AA 4OO1H 3OSOA 4LF9Q 4KHZA 2E76C 3RLNA 3HKSA 1PYWD 3W1BA 2OTLA 1E1OA 1KL9A 1JWUD 1M1KC 1L1OC 1KDAA 1M8AA 1D1IA 1HNZQ 4A3DB 3NXWA 2ICEC 3MXNA 4LAAA 4TVAB 4XYOA 4DNRB 1XPRA 2UU9L 1Q8KA 2Q2UA 2A74C 4QUFA 4ZRZA 3PO2B 4KI0A 1WI5A 2HT1A 5HY6A 1MGSA 2QGQA 3NE5B 4BA1I 5IGEA 4PZ6A 3EROA 3CCJA 1EWCA 5GADC 1S5FD 2NTSA 4DF7A 3AFQA 3M7GA 1IHZA 2K5VA 4FVMA 2BA1A 4GOPA 1AP0A 4A3CH 2N49A 3FDTA 2KHJA 1LTRD 2Q8RE 5KNBA 1A2UA 3C1FA 1H9MA 2XIWA 4A3FG 2ZXRA 3BU2A 2F0GA 3J80E 1GM5A 4U68A 1MD2D 2MP1A 4JI2Q 4X65L 2ZJPA 4IFDJ 2F0DA 1WCMH 1EIFA 5EQ0A 2SNSA 4HR7B 1K83H 1Y14B 3HOYB 4YCWA 4A3LH 2YTYA 1PFNA 1ESRA 2L0CA 4RGMA 3SEBA 4BBSH 1R9TH 1SNMA 2ZJQA 2A1AA 1YNND 1YNXA 1FGBD 5IGCA 1S72A 1PH8A 5CBAE 2KUMA 2RSNA 3F2UA 2BH8A 1YNJC 3VR4A 2VB2X 2V1CC 4DNTB 4GLXA 4X6AH 3GQBA 4H02A 2HIXA 1F9PA 5JJKA 4GN4B 4JI2L 2KA7A 5G3LF 3K6OA 4R4TA 4GOPC 3MFGA 3HOYG 4WJ3M 3P75A 3PF4A 4P72A 1CQFA 4UP9A 4DA2A 4GS3A 3CCEA 4DV2L 1S5BD 1KNEA 1HA5A 2K1BA 4HSPA 4X3KA 3S15B 1LT4D 1O7IA 5ELDA 3VR2A 1IYUA 5BN4A 3MXPA 1N9WA 5EPKA 1EOVA 1TKWB 2B2VA 3HOYH 2J0TD 3DWAA 4N8FA 5C44B 1RDPD 1ZXTA 3GV6A 3OPOA 5AFWA 1K8AC 2R93H 2J7ZA 4RKLA 2HQLA 1N33Q 1VQGA 1KRSA 4BY7H 5CBEE 1P8LA 5IYCG 4BXXG 1BCPD 3E9HA 2XRQD 4B3SL 1E24A 4QIWE 1YBYA 4A3GB 4A3BH 3NSWA 4X65Q 3MC0B 2KCTA 1B3AA 1WTPA 2EYOA 4TRDA 4FXKC 1EFWA 4HAEA 5HGQA 4X64L 4DR1Q 3QG1A 4ZQ3A 4BBRB 5JPNC 4K2LA 4FYDA 1T9HA 2KCCA 4HJ9A 3K7AB 2BA0A 3U4ZA 2UXDQ 1E2WA 1ET9A 3WOEA 1JMCA 1IW7D 1I4XA 3A74A 3T1YL 4CJ0B 5J1ZA 4LF5L 2R92B 1J8IA 1JWSD 3A56A 1VQ7A 1RIPA 1ZEQX 4PZ7A 3Q24A 3NQTA 3X3MA 1FJGQ 2EY2A 1D6EC 3A8KE 1JE4A 5JJIA 1D5ZC 1GOZA 1CKOA 4R8IA 3NPPA 3J7AV 1GHJA 2G9HD 4IPHA 4KTAA 3RZOB 2PNRC 4QUCA 2K01A 4DV3Q 2KENA 1W2BA 1HNXL 2EY1A 3EA6A 1N34Q 4U673 1DZ1A 2PI2A 3CC4A 2K33A 5AJ3L 1PMRA 1VQ5A 1CKNA 2ALYB 4JI3Q 4G4KA 1WTHA 4IOCA 1J9OA 2B2TC 1II3A 1GUTA 5EBDA 1B1ZA 2DNCA 4GKJQ 1Y1VG 1VF7A 5EKLA 1TS2A 1QZGA 1X6OA 4J15A 4IPDA 4BS9A 5GAGC 2XRSD 1LTGD 1PH3A 1JT8A 3SK4A 3CF5A 1K83B 2VUMG 2EJMA 4LFAQ 1J6QA 3J7ZC 5I6WA 3E9IA 1LYLA 2WP8J 2UUAL 1ONLA 2X6LA 4RCNA 4LMQD 3KUPA 1ENAA 3F8TA 1IBLL 4LW1A 4F88A 3PUVA 2Z6KA 1G291 3S1MB 1TS4A 4LFBL 2PMZB 1X3PA 2XSCA 5CC4A 1V8QA 4C1NI 3G71A 4MHEA 3BDLA 1VMCA 1JR0D 4A3JG 1AW7A 2AKWB 5C3XA 1X3FA 3BG3A 1LTTD 1QILA 1LT5D 2KBNA 4HMIA 1FR3A 2Y0SE 1AZQA 1EEID 1E7ZA 4DAYB 2YYZA 3R2TA 1JICA 5LL6S 1UEAB 2PCFB 3CCUA 4FDBA 5T1IA 4CGYB 3M9BA 1B44D 1Y8OB 1SNDA 3EFXD 3GTJH 1F9RA 2JA8B 5JEAJ 2PPBC 3GTOH 2ENBA 4DAMA 3LNNA 4RGNA 4KLKA 4OO1I 1F2LA 1V1PA 1D5XC 3CPWA 4GN3B 4R8NA 2NN6I 1BBWA 2YTXA 1A62A 1K0RA 3J80L 5M3FH 1HR0W 2R7FA 3D4WA 2UXBL 4B3RL 4DV7Q 1FL0A 3OWEB 3V05A 1GUOA 1BUVT 1DOLA 5IYDG 2DJFC 1SYFA 1ENFA 3CU7A 1WFQA 3MVVA 4KD3A 1XYIA 4LF4L 1CK1A 4DV4Q 5IIFA 3K58A 3KBGA 5M5XH 2OT2A 2VS1A 1XPUA 3AQQA 2IJ0A 1WTOA 4APVA 1A3TA 3E0JA 1XTDA 3EIVA 4NB3A 1H95A 3CAMA 3T53B 2NVQB 3I55A 4ZKBB 1I4QA 2DY8A 4CJ2C 3M85A 3GTQH 2CKZB 3CC2A 4K5XA 1GUWA 3M7NA 1VQEA 2CW0C 5CV5A 1B50A 3NWSA 2CH4A 4JI7Q 3GTOB 1EWIA 3RLFA 2WINB 1YVCA 5FKAC 1JB7A 1JJCB 1TWFH 3VA7A 3J81c 3Q23A 1OTCA 5JJZA 1DD2A 3KDFA 5ELBA 1D7QA 2IW3A 1QB5D 2QILA 4KY6A 2ID0A 4NXNQ 2QW7A 2XTIA 4OELB 1CSPA 2ES2A 4QCLA 1KABA 1I4GA 4BA2I 2CVRA 5E7NA 4C3IH 4JI4L 4AQYQ 1PYSB 1IBKQ 3NTIA 4WORA 3TEHB 4A75A 2KCNA 2K52A 1O7LA 1N33L 1PTOF 3S1MH 4IUUA 2F0MA 4CJ1B 4C3HG 4RKBA 4IJHA 1N32L 1HZCA 2QA4A 1F9QA 1UE1A 4BY7G 5COYA 5M9OA 2Z9HA 4YIJA 3C46A 4ALPA 1QVCA 1X3GA 2IHFA 3SK5A 1X56A 2ASBA 3WWVA 2KHIA 2K04A 2R93G 3J81E 1KDBA 1RJTA 3ND8A 1UAPA 2IPKD 2YV5A 4LUOA 2V4DA 2NVTH 1U4LA 4BY7B 1T5EA 1HUMA 2I5HA 3DWQA 4XTCS 3ULJA 1IKMA 4A3EG 3HG9A 4DR5L 3P7JA 2RSOA 2AQ2B 4K5WA 4K6DA 2ZT9C 3TMEA 3OOCA 2F3IA 4I65A 1Q1BA 5EKIA 1PRTD 2RQXA 2SNMA 3F2DA 2O5JC 1QVGA 3TSSA 4LUZA 3I4MH 1STEA 4J1MA 2LSSA 3VA5A 5M5YB 4RA8A 2YU9B 1TR5A 1LLRD 5T1GA 5LMNQ 5FLMG 1EIYB 4DR3L 3AEVA 3TS2A 4Y52H 3PCOB 4TKOB 4R4QA 3H0GH 2I5LX 4L8JA 2VNUD 3S2DH 1KXLA 3EN2A 5K5PA 1Y1WB 1TWGH 4NKLA 3I70A 4DR3Q 1FD7D 2EIFA 4ULLA 1PZJD 3U58A 2R92H 1SLJA 1HR0Q 4KMUC 3CD6A 1JB3A 4KHPQ 1H9JA 1WD0A 3ITPA 5F2DA 3S14B 2EYLA 1R4PB 4A3MH 4EGVA 5D3IB 4LK1C 1PH5A 2BE5C 2DY7A 4XXEA 5DAUA 1VQAA 1JOOA 2B8FA 4B3ML 4HCEA 1CT1D 3M4OH 5C6AA 3OHXC 1HHVA 1ZKOA 4KJNA 3SGIA 3S1RB 1WCMB 3TRZA 4DV6L 2OCEA 3K0XA 3MEFA 1RODA 1VQ8A 1FNUA 1VQIA 4AYBB 1JJGA 2L15A 2PMZE 4IJLA 4DK1A 2B2UA 2R7ZH 1OXSC 3H3VC 4A93B 2IX3A 1Q1EA 4L5QA 1QZHA 4TQUS 1I3QB 2HDMA 4JOIA 2F52A 4DV4L 1SJHD 2D2CC 1HNZL 3NUCA 5M5WB 3S24A 5D14A 3N6RA 4HJAA 3P1HA 4WRDA 4A3IH 4KN7C 1NE3A 2CHBD 1JOKA 1EY6A 2JEAI 3SR1A 4QGUA 1CSQA 2LKVA 4FF4A 4DV7L 2EYJA 1D2BA 2E8GA 3OYYA 4TSSA 3CRKC 4IUTA 3VR5A 3CCMA 1TWHH 3T4AC 3HOWB 1O7YA 4A3LG 1RKNA 2E2DC 3W2DA 1LABA 2C35B 4A3CG 1C48A 3AMUA 2Z0SA 4DV6Q 2Z6BA 4XDXA 3T13A 1N8RC 4IOAA 4AH6A 2X69A 3V96A 1A2TA 1PH7A 4DGZA 1PYBA 2PZUA 4A3IG 4XT1B 4HJ8A 3OIPA 5JPMC 3KF6B 1CZWA 1WCMG 3I4NG 5C3EG 4BY1B 4CDEC 1DONA 1B2TA 1B8AA 1J5EL 3ULPA 1EIHA 2WKDA 3MTSA 2BE5D 1F2YA 3I73A 2GA4B 4BBRG 4JCVE 1WTWA 3RD4A 1STBA 2A69D 3NBHA 1XJVA 1OXXK 1Y8NB 1Y1WG 4S3SA 3M4QA 1HTPA 3PO2G 5FLXc 5IE8A 2K03A 1YJNA 2LXKA 1CFMA 4UP7A 4GN5A 3PO3G 3D8GA 2RHSB 2A8VA 1VF5C 1XWEA 3R93A 3OIQA 2A73B 3GTMH 5FLXE 1Y8PB 4DKAC 1PTOH 4E6IA 2EJGC 1H9SA 3KJPA 1EQTA 1EQQA 1UE6A 3A5UA 4L5RC 4IPGA 4IALA 5FOBB 5EBCA 1FNWA 2F1MA 2Z1CA 4QIWB 4OO1G 5KGUA 2EDGA 1B3QA 1HH2P 3H94A 2A5HA 2ZTCA 2B2YA 5CORA 1QOHA 1EY0A 3VYUA 1QJOA 4JI0Q 5JOBA 3G6EA 4DV0Q 2E5LQ 2VQEL 1STAA 2WAQB 3H15A 1E22A 4JI5L 4A3FH 4R4OA 4K14A 4BY1G 3OMGA 1PXUA 3PIP3 1M90C 4RCOA 3VDYA 4DR6Q 1QUQB 2UUCQ 4H7BA 4PV1C 4IPCA 3CMEA 4DU9A 3RR5A 4YY3L 2D0PA 1EYCA 3SXHA 2SOBA 5C4JB 1SFOH 1A8VA 2Y0SG 1ILPA 1AE2A 3HFZB 1SMYC 2VZAA 4HJ7A 5CMDA 1JORA 4R9WA 4IUPA 1X55A 1LTSD 2XWBB 4AQYL 1BBUA 3S16B 1QG7A 2L9HA 4A3IB 5C4JH 2F3WA 2B2YC 4QL5A 4C3HH 1UNSA 3KF6A 4LFCL 3NENA 4CDDC 2UUAQ 4CHTB 1OO9B 4DAPA 5C5LA 1IBML 2L11A 2VY3A 2IX1A 2EYPA 3QIAA 5CYUA 1RD9D 4A3EH 2K7VA 4A3KB 1IYVA 1LV9A 1B4OA 1GJXA 4DV5Q 1Q12A 1A3VA 4A93H 1KIXA 3TP5A 1EY9A 3QR8A 2HD3A 1HXYD 3DUZA 4NW2A 1I4RA 1HFGA 5CV7A 3PO3B 3B6YA 3NP8A 5M3MG 1SE3A 1TIID 2ICIA 3S17H 1D1KA 1I4HA 2Q8TA 3CHBD 3FP9A 1S3OA 3NK9A 2Q8IB 4KKUA 4MZ9A 4KK7A 2OQKA 3K5LA 1SYDA 1WTRA 4OEMB 5ELFA 1TWAB 1TQOA 2IL8A 3K81C 2F0PA 4DUYL 1IBMQ 1JCKB 4HMJA 2R92G 4JI5Q 5ELEA 3KDFB 1C9OA 4M1UB 1I3QH 5I4DA 1ZYRC 5IT9E 3IRBA 5JEAG 3S2HB 1I50B 5EGTA 4RMFA 1WTVA 4IFDH 5DNFA 1Q7YC 3K5OA 2UXBQ 3TP7A 1TT2A 1VQPA 1VDZA 3J80c 3DLLA 3A7LA 1L1OA 4LF5Q 5I2YA 4HSVA 1HQMC 1SE8A 1STYA 1P16A 3KLSX 4GZYC 2JA8G 4JW0A 1CKMA 4O0AA 2A19A 5IGFA 5K36H 4IQZA 1V9PA 3GTPH 3BVMA 4JC0A 2KVMA 3PUXA 4JV5Q 4IUVA 2IT1A 4KY5A 1A0IA 2CWPA 2BCOA 1CTMA 4ZLTF 2UUCL 2QF7A 3KBXA 2NTTA 3S1QH 3PIPA 2NZHA 2A69C 5NUCA 1R4QB 2PQAA 3JAME 1O7ZA 4HEDA 1PFSA 2N3SA 5FLXL 3J7A5 1HZAA 1SNOA 2R61A 2A6ED 1STGA 3H0GB 2EYMA 1I6HB 1JC7A 1WD1A 1X3EA 3FRPB 1N36L 1K73C 5DLQE 3CPFA 2EY6A 2RVLA 3SE0A 4OL7A 2JYOA 2FMCA 3H09A 5M3MH 1GVPA 2JA5G 4POFA 4EQOA 4RFBA 4DK3C 4X64Q 1KC8C 2R7ZB 3H91A 1Q3LA 2RF4A 1EZ6A 2OQ0A 1S5DD 4OX9L 4EQPA 4NDXA 1FVIA 1F2MA 4DXFA 4NXML 1EQRA 3FKIG 2CCZA 1VQJA 1L2FA 2K4KA 2EQSA 3OW2A 1F77A 2FFKB 1G6PA 2PNHA 4EX5A 2EZVA 4ZUJA 2JA5B 3TP6A 4A3MB 2R7ZG 1XX8A 2F0IA 1J5EQ 4IUQA 1RTNA 5ELOA 4ZUIA 5C3WA 3DHQA 1CQVA 5KRUA 1HNXQ 5C4XB 1PDQA 1XMOQ 2D62A 1Q90A 1C0AA 1DCZA 4ZYSA 1GUSA 2FINB 1YHAA 3O13A 3U50C 5KIXA 4IZ8A 1YIJA 3UDGA 4JI8Q 1S4ZA 3I7FA 2RDFA 4PQXA 3RNUA 1Y1WH 3K80C 1PH2A 5CR3A 4JYAQ 4UDUC 3IFDA 1LTID 1DOKA 3I3CA 1NUCA 4C3IG 3CQZB 4C2MH 1ASZA 4FXDA 1L0XB 2PO4A 5M5YH 4K6LA 3HOVH 3PQIA 2UXDL 1I4PA 4PNYA 2JA6H 1BF4A 3D0FA 3T56B 4X62L 1I94L 4K0KL 1N32Q 1PV4A 2JE6I 4A3GG 2O2LD 2L55A 3I90A 2DUDA 3I91A 1NJIC 1PZKD 1NR4A 1X32A 4A3KH 4C56C 4A3EB 3KLSA 2MO1A 4QJFA 5M3FB 1A3UA 2ZM6Q 1VQ6A 4JBKA 4X3TA 1VQCA 2MQHA 4R1JA 2AWOA 1EIGA 4EQ5A 3TZUA 4MTKA 1BQQT 5D3DA 3OTOL 2B2TA 1MJEA 5LMNL 2EXZA 1K3BC 1XNRQ 4NP5A 3M4YA 3ULLA 3S16H 4BWGB 3CXCA 4JI1Q 1KNAA 2D5DA 1BCPC 1C7YA 2ZXOA 4GLAC 3LX0A 2EE1A 1WOCA 3CCVA 5LL6X 4DR5Q 1STNA 3K0YA 1KRTA 2BH2A 2AUJD 1AZPA 1Z7TA 3H6MA 3FPPA 2QCPX 1SYEA 3L9AX 2LY7A 2Z8LA 3UE1A 3HP3A 3MEHA 1NMFA 1F9SA 1IZ6A 3BZDB 5C4ZA 3HOZG 2BDNA 4A3DG 2FXQA 3K5NA 3RZDB 5J3BA 5L37A 3BDOA 5LMUL 2NWGA 3PUZA 3KOJA 1XMQL 5C4XG 2BDOA 2N8NA 1EYGA 2OF1A 1W3SA 1BXTA 2HDLA 4QF4A 3STBC 4HIDA 2VL6A 2K50A 3QOJA 2QKIC 1EY4A 2TSSA 1IBKL 4A93G 2B63H 4OX9Q 4H44C 5C4HA 5HGTA 3S17B 4A4IA 4O1NA 4CKCA 3SVMA 3K57A 3SK6A 2K5WA 4CDCC 1LUZA 4LF6L 1NNXA 5C44H 3PF5A 1OXUA 2KHSA 3GP7A 5IGBA 1XXGA 2F0NA 2PQEA 1U0LA 4EQNA 2VQFQ 2R3ZA 2JEBI 4ZKCB 4A3JB 3MA2B 1BOSA 4P75A 5A2QL 1KHIA 2MGSA 3BVZA 3RLOA 5FO9B 3HOWG 4K5VA 1HJPA 3BZKA 5FO7B 5EJWA 1CHQD 4XT3B 1B7YB 4C3JG 2WV6D 2K32A 1QVFA 3W5OA 5DM73 3MWYW 1CA6A 1K8OA 1DXMA 2HCIA 1OXTA 2D9UA 3M4PA 5TSSA 1EU3A 1TU2B 3H0GG 1I50H 5IODA 2BOSA 2N55A 1C4QA 2YTVA 4A76A 3TDQA 1BCPF 5CV8A 2UU9Q 1A63A 3G6JB 5IYDH 4QB4A 2F0FA 3CMAA 1BR9A 5FK9C 3PIO3 1QUQA 3S1NB 1WTXA 3FEWX 4LF7L 4P73A 3GTLB 2IWHA 2Q2IA 3IL8A 4A3MG 1H9SB 4FXGC 4OWWB 1PRTC 2I0QA 3PMFA 1CHPD 3PO3H 3CCRA 4A3FB 5DEHA 3K5MA 1HNWL 1WYDA 2JA7B 1L0WA 4LF7Q 5GROA 1DM0B 2K5QA 2NVYH 1V1QA 2RCFA 5E4XA 3I4LA 1GUNA 4ZCKA 1UWVA 2L4NA 1B53A 3URYA 5BR8Q 2XNAC 4YY3Q 4ZAIA 1NSNS 3NELA 1TWAH 4B9WA 4LJZC 1VQOA 1O78A 2A6HC 5EKKA 4DR2Q 4K2KA 2OTJA 2KOLA 4K8IA 1IW7C 1YEZA 4QY7A 2HQEA 4DV0L 3W1GA 1OXVA 4DNIA 3CW2C 2R7DA 4G7OC 3ERSX 1DOMA 2B63G 1SR3A 4LFBQ 4DR4Q 3GTKH 2HHHL 2NVXH 2LS01 4PMWA 1IBLQ 1E3PA 3F1ZA 4JI1L 5EPJA 3EQLC 2JQOA 1K9MC 5A35A 4IURA 4KN4C 1NY4A 3A54A 3DWPA 4OIKA 5IT9L 1XNRL 1QE6A 3G7LA 2RA4A 1IKLA 2LFNA 1I6VC 3QO2A 1UEBA 4GNXC 1A15A 4C3HB 3KLWA 4HTHA 4ZK9B 3A7AB 2Z6KC 3HOVG 2AMCB 1EY7A 4G7ZC 3NBHB 5GAEC 2WKCA 3I8ZA 1JQYD 4A3JH 5BN3A 3I4MG 2B2WC 3Q6SA 3E3XA 2EOTA 1CA5A 4JI3L 4AYBG 3HOXG 3J81j 1EQVA 4IN3A 1A6XA 2UXCL 3K59A 1UE7A 1K8MA 2F0QA 2NYZD 5CV4A 2VQFL 1SMXA 1SYBA 2F0JA 4YHHL 3BYTB 1Y1VB 1R9TB 1JE5A 4LUVA 5C0XG 4BBSB 2L5TA 1SSOA 2JK8A 2PZWA 3SDZA 5LHY1 2WB1B 1E1TA 1Q8IA 2VQEQ 1U9RA 2RKSA 3BVGA 3BZCA 1ILQA 2CQAA 4L63B 1FJGL 2TMPA 1MSGA 5IGDA 2JA7H 1YNNC 3E0EA 4HIKA 3HOZB 1Y69U 3L7ZC 3T1YQ 3STBD 1ASYA 3Q8DA 1NMGA 1KTKA 2A68C 4FO2A 3S1RH 3F2BA 2ZJRA 4JBJA 2KJXA 4G57A 3HKZE 1PH4A 4BY1H 1IL8A 1S40A 1GXDC 2MJ8A 3GTLH 5LMNW 1SMYD 5JEAH 2XGTA 5AJ3Q 1MJCA 2PW7A 3U4VA 5CV6A 4GKKQ 1TY2A 2KQ3A 5C3EH 4PG3A 5M3MB 2JJQA 2K5NA 2AUKA 1CZGA 2M9VA 1CKNB 3BYYB 1SNQA 3HEJA 3KF8B 4JOIC 5C4XH 3CCQA 1MKHA 2LMCB 2VUMB 1SNPA 1KAWA 4DPGA 4O42A 4OXPA 5H1SE 1LT6D 4DK0A 1N36Q 1SE2A 2F4IA 5HURA 4KV6A 5GQOA 2RCNA 3GTQB 4KHPL 1B70B 3U9SA 3P20A 1KLGD 1PFMA 1BBXC 4P2CB 4XQQA 2B39A 1E0BA 1HCZA 5M5XB 4RHSA 1V1PB 2F0UA 4Q0FA 2UXCQ 2ZM6L 1UE5A 4B9XA 4DUZL 3T51B 1T5XD 2ZXPA 3CQZH 1RHPA 2PYKA 3GDEA 2QDLA 3QB3A 4Y7NB 3C3LA 2F0HA 5FO8B 3RUZA 3D4RA 1EZ8A 4DUZQ 3TS0A 3D6WA 4DAYA 4NXMQ 4ME3A 3RMHA 5G3LD 3I4NH 1CUKA 1RL2A 4N9TA 3V2TA 4YWMA 3OW7A 2ATWA 1X65A 1BO0A 2EYHA 4X66Q 1Q46A 2B29A 1KD1C 1X54A 2K05A 3CC7A 1UUPA 2K14A 2MNAA 4JYAL 2OXPA 2GVBA 3BDCA 3R3OA 4JI6L 4KHVA 5ISRA 2I07B 1ML0D 4FP5D 1NAPA 2NZOA 5J22A 2E2JH 1PA6A 1PRTF 5GAHC 2E2IB 1AE3A 2YU9H 4DR4L 1PVOA 2JP1A 1ET6A 3M4OB 1LO5D 3FKIH 1G2TA 1FNVA 1D5MC 2B2WA 4XIGS 1WTQA 2A6EC 2H5XA 2JSOA 2MO0A 1EUJA 2AQ3B 1VQHA 1YNJD 4ABNA 2N88A 3CKIB 2VXWA 3CRLC 2NVTB 1Z9FA 2KEDA 1BKBA 1MHWC 1DGSA 1VQFA 1TWGB 3ZYYX 4F87A 2F4VQ 4EVOA 1YITA 1SJED 3GTGH 3S2DB 4NXNL 4OWXB 1O80A 2OWOA 2JA6G 1IL2A 1W6KA 3U9OA 1CI3M 5I6YA 5IP7G 1EOTA 1AH9A 2K75A 3S9WA 1SEBD 3LGJA 2R6GA 3UE0A 2NUCA 1SYGA 1KQSA 3ICEA 3HOVB 1PFBA 3FMCA 4KKSA 4DN4M 2B3GA 4BBSG 4C2MB 1SFOB 5C0XJ 3J7AF 1HRJA 2B2UC 5CV9A 3VYRA 3NQIA 4UAIA 3GTPB 1QCBD 4B3TQ 3FKIB 5KEEA 4AIMA 4OHJA 3RZOH 3PSIA 4OIJA 3JAMc 3HKZB 2WAQG 3MXNB 1E2ZA 2IHEA 4PZ8A 1G8ZD 1STHA 2MPMA 3J81L 3KK7A 1BNZA 3GTKB 2HIVA 2WB1G 1NBWA 1HNWQ 2JA9A 3R2IA 4Z9CB 1VCIA 4J8QA 1FYCA 2F0WA 2PI2E 1NTGA 4JI4Q 5C3EB 1SRUA 3HOUH 1SYCA 1AN8A 1SROA 4WFN3 4DV1L 4J6HA 4BBRH 2I46A 3G4SA 4LF6Q 1IXRA 1E2VA 4R4IA 4LFCQ 5KNCA 3QJYA 3KFUA 2AQ1B 2EYFA 3HS0C 4ME5A 4YWLA 2B2VC 5JVG3 2F0LA 3A0JA 4H13C 1HUNA 4JI7L 1VQ4A 4DXGA 4F7XA 2AHOB 5C0XH 4IUNA 1C8CA 2FMMA 1I6HH 5KYIA 3X3NA 5I2XA 1LTLA 2Q2TA 4DR7L 5FJ8H 4HCSA 1EU4A 3MXUA 3VYTA 5IP7H 1B9MA 1Y1VH 1EY5A 4P74A 1GKHA 2HUGA 3PUYA 3T16A 4L5SA 3S1NH 3A8JE 1I5FA 1BDOA 1HTLD 2WAQE 3WDNA 2XVSA 2JA8H 2EVBA 2Z4IA 4JI6Q 2KCMA 2E74C 3ERQA 5K36G 1YHQA 1TXYA 1VQLA 3PGZA 1SXTA 4IFDI 1WJJA 3JAMi 1U4PA 3HOXH 4JI0L 4DV1Q 3JAML 4LFAL 4RGTA 2DGYA 4RWSC 4ID6A 2WIIB 2EJFC 4B3RQ 2E2HB 2PQAB 1PRTB 4CBVA 5IWAL 2NN6G 4LWCA 4CKBA 4UPAA 2IY5B 4GKJL 1Q81C 1V43A 3I56A 2GN5A 1LACA 1G2SA 1LM0A 3OWFA 4X3UA 2CW0D 2P5ZX 2RHQB 3KJOA 5D65A 1N34L 1DYQA 4JPBW 1U4MA 2QEXA 1K8GA 3MFYA 4DR6L 3AFPA 1F2ZA 1MIUA 4OWTB 1L1OB 1EFID 1XPOA 4K0KQ 1SNCA 5IOCA 1LT3D 3VR6A 5IYBG 4IO9A 2L12A 4HJ5A 4PMCA 2X6GA 1H9RA 3A8IE 1PTOB 1EL0A 5M3FG 1YJ9A 3JC66 3MZ5A 3BS1A 3LWUA 5ELNA 1VQKA 3TN2A 5CGKA 1LTBD 1QWYA 4I7AA 3H3VI 2I5MX 3GD7A 2EPBA 4YCUA 2VB3X 1Z47A 2NVYB 1XNQQ 3L0OA 4N9PA 4CDFC 4G7HC 1TWCH 1GD7A 1HR0L 1PTOC 3R8BA 1TY0A 3K8AA 1PH6A 2QDBA 2K28A 1YZ6A 3OTOQ 4DR1L 4X66L 5J39A 1VS0A 2E75C 3GO5A 4YCVA 1RCVD 2M2LA 2K5DA 4B3SQ 2G9DA 4ODGA 5DM63 4N8X1 1SN8A 3J81i 4UY8C 2F0VA 1D8LA 4NPSA 1I94Q 2WACA 2B8GA 3AB9A 1XMQQ 1NCVA 1EEFD 4BXXH 4JG2A 4A3KG 2F0EA 4JBWA 1CM9A 2NVXB 1S5CD 2F0TA 3NTHA 1NR2A 5A2QE 1K28A 2H4OA 2B63B 4MNOA 2C9OA 4LF8L 5EAYA 4A3GH 2OEOA 4RHRA 1Z6HA 4MIUA 2F03A 4JI8L 4R4CA 2FJ2A 5M5WH 2NN6H 3I4OA 2R93B 3UDIA 2DNEA 3KLRA 2RDGA 3HZXA 2O5IC 5IP9H 2MUYA 5IGGA 3HGBA 5C0XI 1HQRD 1BVSA 5E1FA 3FPUB 2H1EA 3DEOA 1GO3E 1GUGA 2DJGC 3RN2A 3K7AH 2C5CA 3IAYA 5JAVA 2CFMA 3WOFA 2E2HH 4GKKL 1H9KA 3GTMB 3CP0A 3IKJA 3HOXB 5IP9G 4C3JB 3DEPA 1X9NA 4FF1A 5IYBH 4X62Q 1XNQL 1TWFB 3GV3A 3PO2H 4QMGA 5E3FA 5KNDA 1SAPA 3VYSA 1EYAA 3HRZC 1FGUA 4JBMA 3C2PA 2NZ1D 4I7ZC 4RGOS 1M4VA 3SK8A 2PZTA 4HN7A 4B3MQ 4JK1C 3EJIA 4HIOA 1MSHA 4A3DH 4DAVA 2HHHQ 4JVZA 4UP8A 3VR3A 3QOLA 4P71A 2ZTDA 1LTAD 4DV2Q 3NHHA 4LF8Q 1PH9A 4RAUC 4GNXA 3CCLA 3TQYA 5I9OA 1U4RA 2XN9C 3MAQA 3E5SA 4YHHQ 2N78A 4KY7A 1AFPA 4K8JA 4KJOA 1XMOL 3I4MB 1YJWA 1TWCB 3RN5A 1MBYA 3NWTA 2M00A 3EBEA 3M3YB 1TWHB 3HOWH 1X3QA 4JV5L 1ESFA 4L5TA 3J7YW 3KF8A 5ELCA 1VMPA 3ONAB 2L1BA 3HKZG 4AYBE 2AWNA 2PW5A 1L0YB 3UDXA 2K5HA 4CKEA 1KDCA 1ICWA 2KEEA 2F0OA 4F8MA 1SBBB 1AEXA 5JVH3 1U5KA 4POGA 3A55A 2RBMA 3C1EA 3I72A 1QNUA 4L6TB 1VQ9A 2G5DA 4RG1A 4HIMA 4LF9L 2KECA 3S1QB 3EVQA 3UI2A 2FHTA 4PMBA 3D31A 3TP8A 3GTJB 1KAAA 2RDHA 3TZDA 5FJ8G 1SDFA 3ER0A 2SEBD 3SHLA 3E6ZX 2JA5H 1Q86C 3RZDH 1TS3A 5IYCH 3MHBA 4MN3A 3BJUA 3D4DA 1TVXA 2MHVA 4UHVA 1BCPB 4A3BG 1HPCA 2F0KA 3QWNA 3K7UC 1K3RA 2MFIA 3NEMA 3J80i 1G91A
chains in the Genus database with same CATH topology
1K73C 5DLQE 3CPFA 4NXMQ 5IYDG 4ME3A 5FLMH 4DR2L 3S14H 3T1HQ 2WFWA 3I4NH 1VQBA 3L2PA 1CUKA 3S2HH 1RL2A 1WFQA 4YWMA 4LF4L 2ATWA 1X65A 4X66Q 4DV4Q 3TREA 1Q46A 2B29A 1KD1C 1X54A 5M5XH 2VS1A 1XPUA 1YHBA 5M3MH 3CC7A 1GVPA 3AQQA 2K14A 2JA5G 4APVA 4POFA 2MNAA 4JYAL 2LXJA 3EIVA 4DK3C 1XTDA 2EXDA 4X64Q 1KC8C 4NB3A 2GVBA 4LF4Q 1H95A 4JI6L 2RF4A 3CAMA 2OQ0A 3I55A 4OX9L 4Y7NH 3M85A 3A5ZB 2NZOA 2E2JH 3GTQH 1FVIA 2CKZB 4MTNA 3CC2A 2E5LL 4GNXB 1PA6A 1EQRA 5GAHC 4NXML 3M7NA 3FKIG 1AE3A 1VQEA 2YU9H 2CCZA 4DR4L 1PVOA 1VQJA 1HZ9A 1L2FA 2K4KA 2EQSA 3OW2A 4IFDG 3FKIH 2JA7G 4XIGS 1G6PA 2PNHA 1VQDA 4EX5A 2H5XA 2MO0A 2NVQH 4JI7Q 3H3VH 1EUJA 1EWIA 3RLFA 2R7ZG 1VQHA 4O2DA 1YVCA 1J5EQ 3FHWA 1JJ2A 1JB7A 1JJCB 1TWFH 5ELOA 3J81c 1OTCA 2Q2HA 1Q82C 1HNXQ 3KDFA 5IY0A 1YI2A 1XMOQ 1D7QA 2GVAA 2D62A 4DUYQ 1Z9FA 1C0AA 3KYHC 1YHAA 3U50C 1BKBA 1YIJA 2VW9A 1DGSA 3UDGA 4JI8Q 2ID0A 1VQFA 3I7FA 4NXNQ 2XTIA 3RNUA 2E2IH 3PUWA 1CSPA 2ES2A 4LF7Q 1YITA 1Y1WH 2F4VQ 3GTGH 3K80C 1PH2A 4JYAQ 5BR8L 4BA2I 4NXNL 4C3IH 5E7NA 4OWXB 4JI4L 4AQYQ 2OWOA 1PYSB 2UUBQ 2JA6G 1IBKQ 1IL2A 4QQBX 3CCSA 4C2MH 4GLVB 1ASZA 3TEHB 5IP7G 4A75A 1AH9A 2K75A 3UDFA 5C44G 2K52A 5M5YH 1N33L 3S1MH 1VQNA 3HOVH 3LGJA 2R6GA 3UE0A 5JJLA 4IJHA 1N32L 2UXDL 4DK6C 1KQSA 1HZCA 2QA4A 3ICEA 1UE1A 2JA6H 3D0FA 3ZJYC 4X62L 5IWAQ 4DV5L 1I94L 1PV4A 2JE6I 4BY7G 2B3GA 4K0KL 4A3GG 1N32Q 4BBSG 5C0XJ 4ALPA 2DUDA 1QVCA 1NJIC 4YWKA 3DM3A 4LNQA 1IYJB 1X3GA 4A3KH 4C3JH 2MO1A 1VQMA 2CWAA 4QJFA 4B3TQ 2ZM6Q 2IHFA 4JBKA 1VQ6A 4AIMA 1X56A 3RZOH 1VQCA 2MQHA 3PSIA 4R1JA 2AWOA 3JAMc 3WWVA 4EQ5A 2ASBA 2KHIA 2WAQG 3PV0A 2R93G 3MXNB 3OTOL 1G51A 1MJEA 5LMNL 2IHEA 4PZ8A 1XNRQ 2F4VL 2CQOA 2YV5A 4LUOA 2NVTH 3HOZH 3ULLA 2I5HA 3ULJA 4XTCS 3S16H 4A3EG 4DR5L 3HOUG 1HZBA 3CXCA 3G48A 2HIVA 2WB1G 4JI1Q 2F3IA 1NBWA 4GLAC 3T1HL 2D0OA 1C7YA 2ZTEA 1HNWQ 2JA9A 1WOCA 4DR7Q 1Q1BA 3CCVA 1VCIA 3F2DA 4DR5Q 2WB1E 1QVGA 3I4MH 4LUZA 1PHJA 2UUBL 5LMUQ 2PI2E 2LSSA 1KRTA 2BH2A 1NTGA 2IX0A 4JI4Q 4WJ4A 1SRUA 4OONA 3HOUH 3S15H 5LMNQ 5FLMG 1SROA 1EIYB 4DR3L 3AEVA 3TS2A 4Y52H 4DV3L 3PCOB 4DV1L 4GOPB 3UE1A 4BBRH 4R4QA 3H0GH 2I5LX 3G4SA 2VNUD 1PH1A 3S2DH 1KXLA 2VUMH 3I2ZA 4LF6Q 1NMFA 1IXRA 3EN2A 4B3TL 4R4IA 4LFCQ 3KFUA 1TWGH 1IZ6A 5IT9c 4DR3Q 3AYHB 3F2CA 3HOZG 2EIFA 3PIOA 3M3YH 4YWLA 3U58A 2R92H 4A3DG 2FXQA 1SLJA 1HR0Q 3CD6A 3A0JA 5J3BA 5LMUL 4JI7L 3PUZA 4KHPQ 3KOJA 1VQ4A 1XMQL 4LF9Q 5C4XG 2AHOB 2N8NA 4KHZA 1EYGA 1W3SA 3RLNA 3HKSA 3W1BA 4A3MH 2OTLA 1I6HH 1E1OA 1KL9A 3STBC 4HIDA 1PH5A 2VL6A 1LTLA 2K50A 1M1KC 2Q2TA 1L1OC 5FJ8H 4DR7L 1VQAA 4B3ML 1IBKL 4A93G 2B63H 3M4OH 5IP7H 4OX9Q 1Y1VH 3SGIA 4P74A 1GKHA 1HNZQ 4A4IA 3TRZA 3PUYA 4TVAB 4L5SA 3S1NH 1XPRA 4DV6L 2UU9L 2OCEA 3K0XA 1Q8KA 3MEFA 1I5FA 2Q2UA 1VQ8A 1VQIA 2WAQE 2JA8H 1JJGA 1LUZA 4LF6L 5C44H 2L15A 2PMZE 4IJLA 1OXUA 3PF5A 2R7ZH 4BY7H 1OXSC 4KI0A 4JI6Q 2KCMA 5K36G 1YHQA 1WI5A 1TXYA 1VQLA 1Q1EA 2HT1A 4L5QA 1QZHA 3PGZA 4TQUS 5HY6A 4IFDI 1WJJA 1U0LA 3JAMi 2VQFQ 2JEBI 3HOXH 4JI0L 4JOIA 4DV1Q 4P75A 2QGQA 4LFAL 1KHIA 2DGYA 2F52A 3RLOA 4BA1I 4DV4L 3HOWG 1HNZL 4B3RQ 2PQAB 1HJPA 3BZKA 3S24A 4PZ6A 5IWAL 4HJAA 2NN6G 3CCJA 4LWCA 1B7YB 5GADC 4UPAA 1QVFA 3W5OA 4A3IH 2IY5B 1NE3A 3AFQA 4GKJL 2JEAI 4QGUA 1CSQA 2K5VA 1OXTA 3M4PA 1Q81C 1V43A 3I56A 4DV7L 2GN5A 2BA1A 2E8GA 1I50H 3H0GG 3OYYA 4GOPA 4A3CH 2N49A 3CCMA 1LM0A 2KHJA 1TWHH 4A3LG 2C35B 2YTVA 2RHQB 4A76A 4A3CG 4A3FG 2Z0SA 4DV6Q 2UU9Q 1A63A 3KJOA 5IYDH 3BU2A 1N34L 3CMAA 2QEXA 1GM5A 1N8RC 4IOAA 4AH6A 1K8GA 1QUQA 1PH7A 4JI2Q 4X65L 2ZJPA 3AFPA 4DR6L 1PYBA 4LF7L 1MIUA 1WCMH 1EIFA 4A3IG 4IFDJ 4HJ8A 1L1OB 4OWTB 1K83H 1Y14B 4P73A 4YCWA 2Q2IA 3KF6B 1XPOA 2YTYA 4A3LH 1WCMG 4K0KQ 4A3MG 3I4NG 5C3EG 5IYBG 4IO9A 4BBSH 4HJ5A 1R9TH 2ZJQA 1B8AA 2A1AA 3ULPA 1J5EL 2I0QA 4OWWB 1YNXA 1PH8A 1S72A 3PO3H 4BBRG 4JCVE 3CCRA 5M3FG 1YJ9A 3JC66 2BH8A 1XJVA 1OXXK 2V1CC 1Y1WG 1HNWL 3PO2G 3M4QA 1WYDA 4GLXA 4X6AH 5FLXc 5IE8A 2HIXA 4H02A 5ELNA 5GROA 1L0WA 4GN4B 1YJNA 2LXKA 1VQKA 4JI2L 2NVYH 4R4TA 4GOPC 3HOYG 4UP7A 3H3VI 2I5MX 3GD7A 4GN5A 1V1QA 4WJ3M 3PF4A 4YCUA 3PO3G 1Z47A 1XNQQ 4P72A 3L0OA 2RHSB 1UWVA 4UP9A 2A8VA 1TWCH 1GD7A 4GS3A 1HR0L 3CCEA 3GTMH 5BR8Q 3K8AA 4YY3Q 1PH6A 4DR1L 1YZ6A 3OTOQ 4DV2L 4X66L 4DKAC 3NELA 1TWAH 1VS0A 3GO5A 4YCVA 1VQOA 3KJPA 4DR2Q 4B3SQ 1O7IA 1EQQA 1UE6A 3A5UA 4L5RC 4IPGA 2OTJA 1N9WA 1SN8A 1YEZA 3J81i 4QY7A 4DV0L 4UY8C 1EOVA 3W1GA 4OO1G 1OXVA 4DNIA 3HOYH 1D8LA 1HH2P 3CW2C 2R7DA 2ZTCA 4NPSA 1I94Q 3ERSX 1XMQQ 1SR3A 2B63G 4LFBQ 4DR4Q 3GTKH 2HHHL 2NVXH 4PMWA 4JI0Q 4BXXH 4JG2A 4A3KG 1K8AC 2R93H 3G6EA 4JBWA 4DV0Q 2E5LQ 2VQEL 2HQLA 1IBLQ 1N33Q 1VQGA 1E3PA 1KRSA 3F1ZA 3H15A 1P8LA 1E22A 5IYCG 4JI1L 4JI5L 4A3FH 4R4OA 3E9HA 4BXXG 4BY1G 2JQOA 1K9MC 4B3SL 1E24A 1M90C 4QIWE 1NY4A 1YBYA 3VDYA 4A3BH 4X65Q 4DR6Q 1QUQB 2KCTA 2UUCQ 4MNOA 4LF8L 1EFWA 5EAYA 1XNRL 4IPCA 5HGQA 4X64L 4A3GH 4DR1Q 3CMEA 3RR5A 4YY3L 2D0PA 1UEBA 4GNXC 1T9HA 4JI8L 4R4CA 4HJ9A 3KLWA 1SFOH 1A8VA 2BA0A 2Y0SG 2Z6KC 3U4ZA 5M5WH 2UXDQ 1AE2A 3HOVG 2AMCB 3HFZB 3I4OA 3UDIA 1JMCA 3NBHB 5GAEC 2VZAA 4HJ7A 3A74A 3T1YL 4A3JH 1X55A 3I4MG 4LF5L 5IP9H 1VQ7A 1RIPA 4JI3L 4PZ7A 4AYBG 5C0XI 1FJGQ 3HOXG 4AQYL 1BVSA 1BBUA 3J81j 5JJIA 2UXCL 1GO3E 1UE7A 5C4JH 3RN2A 3K7AH 4QL5A 3KF6A 1CKOA 1SMXA 3NENA 4LFCL 4C3HH 2VQFL 4YHHL 2UUAQ 2CFMA 4IPHA 2E2HH 4GKKL 1JE5A 4LUVA 5C0XG 1IBML 3CP0A 2JK8A 4DV3Q 2KENA 1W2BA 2VY3A 1HNXL 1N34Q 2IX1A 1E1TA 2VQEQ 5IP9G 2PI2A 4A3EH 3CC4A 1X9NA 3BZCA 5AJ3L 5IYBH 4X62Q 4DV5Q 1Q12A 1XNQL 4A93H 1KIXA 1FJGL 1VQ5A 1CKNA 3PO2H 2ALYB 4JI3Q 2JA7H 4JBMA 1FGUA 4IOCA 3E0EA 4HIKA 3L7ZC 3T1YQ 1N36L 3STBD 4B3MQ 4HIOA 1ASYA 3Q8DA 4GKJQ 1NMGA 1Y1VG 3B6YA 5M3MG 2HHHQ 3S1RH 3S17H 3F2BA 4UP8A 2ZJRA 4A3DH 1QZGA 1X6OA 4JBJA 4J15A 3HKZE 4IPDA 1PH4A 3FP9A 4P71A 1S3OA 5GAGC 2ZTDA 1S40A 4BY1H 1PH3A 1JT8A 4DV2Q 4MZ9A 3CF5A 3TS0A 3GTLH 2VUMG 4LFAQ 5LMNW 2XGTA 5AJ3Q 2OQKA 1J6QA 1PH9A 3J7ZC 4GNXA 1MJCA 3CCLA 4LF8Q 3TQYA 3E9IA 1LYLA 3U4VA 4GKKQ 2WP8J 5C3EH 4YHHQ 2UUAL 2N78A 4PG3A 3K81C 4DUYL 1IBMQ 2JJQA 1XMOL 4JI5Q 1YJWA 2R92G 3F8TA 2K5NA 3RN5A 3KDFB 1C9OA 1IBLL 4LW1A 1CKNB 1I3QH 3EBEA 3KF8B 3PUVA 2Z6KA 3HOWH 1G291 4JOIC 3IRBA 5JEAG 4JV5L 5C4XH 4L5TA 3CCQA 1MKHA 4RMFA 4LFBL 1Q7YC 3HKZG 4AYBE 2AWNA 2UXBQ 1VQPA 3UDXA 3G71A 2K5HA 3J80c 3DLLA 4LF5Q 1L1OA 1KAWA 4DPGA 1SE8A 1P16A 4A3JG 4OXPA 5H1SE 2AKWB 1X3FA 1U5KA 1N36Q 4POGA 2JA8G 2KBNA 1CKMA 4O0AA 1VQ9A 2Y0SE 1E7ZA 2A19A 4RG1A 4DAYB 2YYZA 4HIMA 5GQOA 2RCNA 4LF9L 1V9PA 3GTPH 4KHPL 1B70B 4JC0A 3PUXA 3D31A 4JV5Q 3CCUA 5JJKA 4FDBA 5FJ8G 2IT1A 3ER0A 3M9BA 1A0IA 2CWPA 3GTJH 5JEAJ 2JA5H 1Q86C 2UUCL 3GTOH 3RZDH 3S1QH 4DAMA 3PIPA 2NZHA 5IYCH 4KLKA 2UXCQ 2ZM6L 1UE5A 4OO1I 2PQAA 3BJUA 3CPWA 4DUZL 4GN3B 2NN6I 1BBWA 1PFSA 2N3SA 3J7A5 4A3BG 1HZAA 3CQZH 2YTXA 3GDEA 1A62A 1K0RA 5M3FH 1HR0W 2R7FA 2UXBL 3K7UC 4B3RL 1K3RA 2MFIA 1FL0A 3NEMA 3J80i 4DV7Q 1X3EA 4DUZQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K73 C;  5DLQ E;  3CPF A;  4NXM Q;  5IYD G;  4ME3 A;  5FLM H;  4DR2 L;  3S14 H;  3T1H Q;  2WFW A;  3I4N H;  1VQB A;  3L2P A;  1CUK A;  3S2H H;  1RL2 A;  1WFQ A;  4YWM A;  4LF4 L;  2ATW A;  1X65 A;  4X66 Q;  4DV4 Q;  3TRE A;  1Q46 A;  2B29 A;  1KD1 C;  1X54 A;  5M5X H;  2VS1 A;  1XPU A;  1YHB A;  5M3M H;  3CC7 A;  1GVP A;  3AQQ A;  2K14 A;  2JA5 G;  4APV A;  4POF A;  2MNA A;  4JYA L;  2LXJ A;  3EIV A;  4DK3 C;  1XTD A;  2EXD A;  4X64 Q;  1KC8 C;  4NB3 A;  2GVB A;  4LF4 Q;  1H95 A;  4JI6 L;  2RF4 A;  3CAM A;  2OQ0 A;  3I55 A;  4OX9 L;  4Y7N H;  3M85 A;  3A5Z B;  2NZO A;  2E2J H;  3GTQ H;  1FVI A;  2CKZ B;  4MTN A;  3CC2 A;  2E5L L;  4GNX B;  1PA6 A;  1EQR A;  5GAH C;  4NXM L;  3M7N A;  3FKI G;  1AE3 A;  1VQE A;  2YU9 H;  2CCZ A;  4DR4 L;  1PVO A;  1VQJ A;  1HZ9 A;  1L2F A;  2K4K A;  2EQS A;  3OW2 A;  4IFD G;  3FKI H;  2JA7 G;  4XIG S;  1G6P A;  2PNH A;  1VQD A;  4EX5 A;  2H5X A;  2MO0 A;  2NVQ H;  4JI7 Q;  3H3V H;  1EUJ A;  1EWI A;  3RLF A;  2R7Z G;  1VQH A;  4O2D A;  1YVC A;  1J5E Q;  3FHW A;  1JJ2 A;  1JB7 A;  1JJC B;  1TWF H;  5ELO A;  3J81 c;  1OTC A;  2Q2H A;  1Q82 C;  1HNX Q;  3KDF A;  5IY0 A;  1YI2 A;  1XMO Q;  1D7Q A;  2GVA A;  2D62 A;  4DUY Q;  1Z9F A;  1C0A A;  3KYH C;  1YHA A;  3U50 C;  1BKB A;  1YIJ A;  2VW9 A;  1DGS A;  3UDG A;  4JI8 Q;  2ID0 A;  1VQF A;  3I7F A;  4NXN Q;  2XTI A;  3RNU A;  2E2I H;  3PUW A;  1CSP A;  2ES2 A;  4LF7 Q;  1YIT A;  1Y1W H;  2F4V Q;  3GTG H;  3K80 C;  1PH2 A;  4JYA Q;  5BR8 L;  4BA2 I;  4NXN L;  4C3I H;  5E7N A;  4OWX B;  4JI4 L;  4AQY Q;  2OWO A;  1PYS B;  2UUB Q;  2JA6 G;  1IBK Q;  1IL2 A;  4QQB X;  3CCS A;  4C2M H;  4GLV B;  1ASZ A;  3TEH B;  5IP7 G;  4A75 A;  1AH9 A;  2K75 A;  3UDF A;  5C44 G;  2K52 A;  5M5Y H;  1N33 L;  3S1M H;  1VQN A;  3HOV H;  3LGJ A;  2R6G A;  3UE0 A;  5JJL A;  4IJH A;  1N32 L;  2UXD L;  4DK6 C;  1KQS A;  1HZC A;  2QA4 A;  3ICE A;  1UE1 A;  2JA6 H;  3D0F A;  3ZJY C;  4X62 L;  5IWA Q;  4DV5 L;  1I94 L;  1PV4 A;  2JE6 I;  4BY7 G;  2B3G A;  4K0K L;  4A3G G;  1N32 Q;  4BBS G;  5C0X J;  4ALP A;  2DUD A;  1QVC A;  1NJI C;  4YWK A;  3DM3 A;  4LNQ A;  1IYJ B;  1X3G A;  4A3K H;  4C3J H;  2MO1 A;  1VQM A;  2CWA A;  4QJF A;  4B3T Q;  2ZM6 Q;  2IHF A;  4JBK A;  1VQ6 A;  4AIM A;  1X56 A;  3RZO H;  1VQC A;  2MQH A;  3PSI A;  4R1J A;  2AWO A;  3JAM c;  3WWV A;  4EQ5 A;  2ASB A;  2KHI A;  2WAQ G;  3PV0 A;  2R93 G;  3MXN B;  3OTO L;  1G51 A;  1MJE A;  5LMN L;  2IHE A;  4PZ8 A;  1XNR Q;  2F4V L;  2CQO A;  2YV5 A;  4LUO A;  2NVT H;  3HOZ H;  3ULL A;  2I5H A;  3ULJ A;  4XTC S;  3S16 H;  4A3E G;  4DR5 L;  3HOU G;  1HZB A;  3CXC A;  3G48 A;  2HIV A;  2WB1 G;  4JI1 Q;  2F3I A;  1NBW A;  4GLA C;  3T1H L;  2D0O A;  1C7Y A;  2ZTE A;  1HNW Q;  2JA9 A;  1WOC A;  4DR7 Q;  1Q1B A;  3CCV A;  1VCI A;  3F2D A;  4DR5 Q;  2WB1 E;  1QVG A;  3I4M H;  4LUZ A;  1PHJ A;  2UUB L;  5LMU Q;  2PI2 E;  2LSS A;  1KRT A;  2BH2 A;  1NTG A;  2IX0 A;  4JI4 Q;  4WJ4 A;  1SRU A;  4OON A;  3HOU H;  3S15 H;  5LMN Q;  5FLM G;  1SRO A;  1EIY B;  4DR3 L;  3AEV A;  3TS2 A;  4Y52 H;  4DV3 L;  3PCO B;  4DV1 L;  4GOP B;  3UE1 A;  4BBR H;  4R4Q A;  3H0G H;  2I5L X;  3G4S A;  2VNU D;  1PH1 A;  3S2D H;  1KXL A;  2VUM H;  3I2Z A;  4LF6 Q;  1NMF A;  1IXR A;  3EN2 A;  4B3T L;  4R4I A;  4LFC Q;  3KFU A;  1TWG H;  1IZ6 A;  5IT9 c;  4DR3 Q;  3AYH B;  3F2C A;  3HOZ G;  2EIF A;  3PIO A;  3M3Y H;  4YWL A;  3U58 A;  2R92 H;  4A3D G;  2FXQ A;  1SLJ A;  1HR0 Q;  3CD6 A;  3A0J A;  5J3B A;  5LMU L;  4JI7 L;  3PUZ A;  4KHP Q;  3KOJ A;  1VQ4 A;  1XMQ L;  4LF9 Q;  5C4X G;  2AHO B;  2N8N A;  4KHZ A;  1EYG A;  1W3S A;  3RLN A;  3HKS A;  3W1B A;  4A3M H;  2OTL A;  1I6H H;  1E1O A;  1KL9 A;  3STB C;  4HID A;  1PH5 A;  2VL6 A;  1LTL A;  2K50 A;  1M1K C;  2Q2T A;  1L1O C;  5FJ8 H;  4DR7 L;  1VQA A;  4B3M L;  1IBK L;  4A93 G;  2B63 H;  3M4O H;  5IP7 H;  4OX9 Q;  1Y1V H;  3SGI A;  4P74 A;  1GKH A;  1HNZ Q;  4A4I A;  3TRZ A;  3PUY A;  4TVA B;  4L5S A;  3S1N H;  1XPR A;  4DV6 L;  2UU9 L;  2OCE A;  3K0X A;  1Q8K A;  3MEF A;  1I5F A;  2Q2U A;  1VQ8 A;  1VQI A;  2WAQ E;  2JA8 H;  1JJG A;  1LUZ A;  4LF6 L;  5C44 H;  2L15 A;  2PMZ E;  4IJL A;  1OXU A;  3PF5 A;  2R7Z H;  4BY7 H;  1OXS C;  4KI0 A;  4JI6 Q;  2KCM A;  5K36 G;  1YHQ A;  1WI5 A;  1TXY A;  1VQL A;  1Q1E A;  2HT1 A;  4L5Q A;  1QZH A;  3PGZ A;  4TQU S;  5HY6 A;  4IFD I;  1WJJ A;  1U0L A;  3JAM i;  2VQF Q;  2JEB I;  3HOX H;  4JI0 L;  4JOI A;  4DV1 Q;  4P75 A;  2QGQ A;  4LFA L;  1KHI A;  2DGY A;  2F52 A;  3RLO A;  4BA1 I;  4DV4 L;  3HOW G;  1HNZ L;  4B3R Q;  2PQA B;  1HJP A;  3BZK A;  3S24 A;  4PZ6 A;  5IWA L;  4HJA A;  2NN6 G;  3CCJ A;  4LWC A;  1B7Y B;  5GAD C;  4UPA A;  1QVF A;  3W5O A;  4A3I H;  2IY5 B;  1NE3 A;  3AFQ A;  4GKJ L;  2JEA I;  4QGU A;  1CSQ A;  2K5V A;  1OXT A;  3M4P A;  1Q81 C;  1V43 A;  3I56 A;  4DV7 L;  2GN5 A;  2BA1 A;  2E8G A;  1I50 H;  3H0G G;  3OYY A;  4GOP A;  4A3C H;  2N49 A;  3CCM A;  1LM0 A;  2KHJ A;  1TWH H;  4A3L G;  2C35 B;  2YTV A;  2RHQ B;  4A76 A;  4A3C G;  4A3F G;  2Z0S A;  4DV6 Q;  2UU9 Q;  1A63 A;  3KJO A;  5IYD H;  3BU2 A;  1N34 L;  3CMA A;  2QEX A;  1GM5 A;  1N8R C;  4IOA A;  4AH6 A;  1K8G A;  1QUQ A;  1PH7 A;  4JI2 Q;  4X65 L;  2ZJP A;  3AFP A;  4DR6 L;  1PYB A;  4LF7 L;  1MIU A;  1WCM H;  1EIF A;  4A3I G;  4IFD J;  4HJ8 A;  1L1O B;  4OWT B;  1K83 H;  1Y14 B;  4P73 A;  4YCW A;  2Q2I A;  3KF6 B;  1XPO A;  2YTY A;  4A3L H;  1WCM G;  4K0K Q;  4A3M G;  3I4N G;  5C3E G;  5IYB G;  4IO9 A;  4BBS H;  4HJ5 A;  1R9T H;  2ZJQ A;  1B8A A;  2A1A A;  3ULP A;  1J5E L;  2I0Q A;  4OWW B;  1YNX A;  1PH8 A;  1S72 A;  3PO3 H;  4BBR G;  4JCV E;  3CCR A;  5M3F G;  1YJ9 A;  3JC6 6;  2BH8 A;  1XJV A;  1OXX K;  2V1C C;  1Y1W G;  1HNW L;  3PO2 G;  3M4Q A;  1WYD A;  4GLX A;  4X6A H;  5FLX c;  5IE8 A;  2HIX A;  4H02 A;  5ELN A;  5GRO A;  1L0W A;  4GN4 B;  1YJN A;  2LXK A;  1VQK A;  4JI2 L;  2NVY H;  4R4T A;  4GOP C;  3HOY G;  4UP7 A;  3H3V I;  2I5M X;  3GD7 A;  4GN5 A;  1V1Q A;  4WJ3 M;  3PF4 A;  4YCU A;  3PO3 G;  1Z47 A;  1XNQ Q;  4P72 A;  3L0O A;  2RHS B;  1UWV A;  4UP9 A;  2A8V A;  1TWC H;  1GD7 A;  4GS3 A;  1HR0 L;  3CCE A;  3GTM H;  5BR8 Q;  3K8A A;  4YY3 Q;  1PH6 A;  4DR1 L;  1YZ6 A;  3OTO Q;  4DV2 L;  4X66 L;  4DKA C;  3NEL A;  1TWA H;  1VS0 A;  3GO5 A;  4YCV A;  1VQO A;  3KJP A;  4DR2 Q;  4B3S Q;  1O7I A;  1EQQ A;  1UE6 A;  3A5U A;  4L5R C;  4IPG A;  2OTJ A;  1N9W A;  1SN8 A;  1YEZ A;  3J81 i;  4QY7 A;  4DV0 L;  4UY8 C;  1EOV A;  3W1G A;  4OO1 G;  1OXV A;  4DNI A;  3HOY H;  1D8L A;  1HH2 P;  3CW2 C;  2R7D A;  2ZTC A;  4NPS A;  1I94 Q;  3ERS X;  1XMQ Q;  1SR3 A;  2B63 G;  4LFB Q;  4DR4 Q;  3GTK H;  2HHH L;  2NVX H;  4PMW A;  4JI0 Q;  4BXX H;  4JG2 A;  4A3K G;  1K8A C;  2R93 H;  3G6E A;  4JBW A;  4DV0 Q;  2E5L Q;  2VQE L;  2HQL A;  1IBL Q;  1N33 Q;  1VQG A;  1E3P A;  1KRS A;  3F1Z A;  3H15 A;  1P8L A;  1E22 A;  5IYC G;  4JI1 L;  4JI5 L;  4A3F H;  4R4O A;  3E9H A;  4BXX G;  4BY1 G;  2JQO A;  1K9M C;  4B3S L;  1E24 A;  1M90 C;  4QIW E;  1NY4 A;  1YBY A;  3VDY A;  4A3B H;  4X65 Q;  4DR6 Q;  1QUQ B;  2KCT A;  2UUC Q;  4MNO A;  4LF8 L;  1EFW A;  5EAY A;  1XNR L;  4IPC A;  5HGQ A;  4X64 L;  4A3G H;  4DR1 Q;  3CME A;  3RR5 A;  4YY3 L;  2D0P A;  1UEB A;  4GNX C;  1T9H A;  4JI8 L;  4R4C A;  4HJ9 A;  3KLW A;  1SFO H;  1A8V A;  2BA0 A;  2Y0S G;  2Z6K C;  3U4Z A;  5M5W H;  2UXD Q;  1AE2 A;  3HOV G;  2AMC B;  3HFZ B;  3I4O A;  3UDI A;  1JMC A;  3NBH B;  5GAE C;  2VZA A;  4HJ7 A;  3A74 A;  3T1Y L;  4A3J H;  1X55 A;  3I4M G;  4LF5 L;  5IP9 H;  1VQ7 A;  1RIP A;  4JI3 L;  4PZ7 A;  4AYB G;  5C0X I;  1FJG Q;  3HOX G;  4AQY L;  1BVS A;  1BBU A;  3J81 j;  5JJI A;  2UXC L;  1GO3 E;  1UE7 A;  5C4J H;  3RN2 A;  3K7A H;  4QL5 A;  3KF6 A;  1CKO A;  1SMX A;  3NEN A;  4LFC L;  4C3H H;  2VQF L;  4YHH L;  2UUA Q;  2CFM A;  4IPH A;  2E2H H;  4GKK L;  1JE5 A;  4LUV A;  5C0X G;  1IBM L;  3CP0 A;  2JK8 A;  4DV3 Q;  2KEN A;  1W2B A;  2VY3 A;  1HNX L;  1N34 Q;  2IX1 A;  1E1T A;  2VQE Q;  5IP9 G;  2PI2 A;  4A3E H;  3CC4 A;  1X9N A;  3BZC A;  5AJ3 L;  5IYB H;  4X62 Q;  4DV5 Q;  1Q12 A;  1XNQ L;  4A93 H;  1KIX A;  1FJG L;  1VQ5 A;  1CKN A;  3PO2 H;  2ALY B;  4JI3 Q;  2JA7 H;  4JBM A;  1FGU A;  4IOC A;  3E0E A;  4HIK A;  3L7Z C;  3T1Y Q;  1N36 L;  3STB D;  4B3M Q;  4HIO A;  1ASY A;  3Q8D A;  4GKJ Q;  1NMG A;  1Y1V G;  3B6Y A;  5M3M G;  2HHH Q;  3S1R H;  3S17 H;  3F2B A;  4UP8 A;  2ZJR A;  4A3D H;  1QZG A;  1X6O A;  4JBJ A;  4J15 A;  3HKZ E;  4IPD A;  1PH4 A;  3FP9 A;  4P71 A;  1S3O A;  5GAG C;  2ZTD A;  1S40 A;  4BY1 H;  1PH3 A;  1JT8 A;  4DV2 Q;  4MZ9 A;  3CF5 A;  3TS0 A;  3GTL H;  2VUM G;  4LFA Q;  5LMN W;  2XGT A;  5AJ3 Q;  2OQK A;  1J6Q A;  1PH9 A;  3J7Z C;  4GNX A;  1MJC A;  3CCL A;  4LF8 Q;  3TQY A;  3E9I A;  1LYL A;  3U4V A;  4GKK Q;  2WP8 J;  5C3E H;  4YHH Q;  2UUA L;  2N78 A;  4PG3 A;  3K81 C;  4DUY L;  1IBM Q;  2JJQ A;  1XMO L;  4JI5 Q;  1YJW A;  2R92 G;  3F8T A;  2K5N A;  3RN5 A;  3KDF B;  1C9O A;  1IBL L;  4LW1 A;  1CKN B;  1I3Q H;  3EBE A;  3KF8 B;  3PUV A;  2Z6K A;  3HOW H;  1G29 1;  4JOI C;  3IRB A;  5JEA G;  4JV5 L;  5C4X H;  4L5T A;  3CCQ A;  1MKH A;  4RMF A;  4LFB L;  1Q7Y C;  3HKZ G;  4AYB E;  2AWN A;  2UXB Q;  1VQP A;  3UDX A;  3G71 A;  2K5H A;  3J80 c;  3DLL A;  4LF5 Q;  1L1O A;  1KAW A;  4DPG A;  1SE8 A;  1P16 A;  4A3J G;  4OXP A;  5H1S E;  2AKW B;  1X3F A;  1U5K A;  1N36 Q;  4POG A;  2JA8 G;  2KBN A;  1CKM A;  4O0A A;  1VQ9 A;  2Y0S E;  1E7Z A;  2A19 A;  4RG1 A;  4DAY B;  2YYZ A;  4HIM A;  5GQO A;  2RCN A;  4LF9 L;  1V9P A;  3GTP H;  4KHP L;  1B70 B;  4JC0 A;  3PUX A;  3D31 A;  4JV5 Q;  3CCU A;  5JJK A;  4FDB A;  5FJ8 G;  2IT1 A;  3ER0 A;  3M9B A;  1A0I A;  2CWP A;  3GTJ H;  5JEA J;  2JA5 H;  1Q86 C;  2UUC L;  3GTO H;  3RZD H;  3S1Q H;  4DAM A;  3PIP A;  2NZH A;  5IYC H;  4KLK A;  2UXC Q;  2ZM6 L;  1UE5 A;  4OO1 I;  2PQA A;  3BJU A;  3CPW A;  4DUZ L;  4GN3 B;  2NN6 I;  1BBW A;  1PFS A;  2N3S A;  3J7A 5;  4A3B G;  1HZA A;  3CQZ H;  2YTX A;  3GDE A;  1A62 A;  1K0R A;  5M3F H;  1HR0 W;  2R7F A;  2UXB L;  3K7U C;  4B3R L;  1K3R A;  2MFI A;  1FL0 A;  3NEM A;  3J80 i;  4DV7 Q;  1X3E A;  4DUZ Q; 
#chains in the Genus database with same CATH topology
 2DN8 A;  3TBI B;  3AU7 A;  5FLM H;  4DR2 L;  3S14 H;  3T1H Q;  3HOU B;  2WFW A;  1VQB A;  3L2P A;  3S2H H;  2J4X A;  1JOQ A;  4XYQ A;  3TRE A;  1YHB A;  1JWM D;  2LXJ A;  2EXD A;  1S5E D;  2NB0 A;  4LF4 Q;  3NTK A;  3MXG A;  3NBI A;  3IFT A;  4Y7N H;  3D3R A;  3A5Z B;  4MTN A;  2E5L L;  4GNX B;  3GTG B;  1GHK A;  1HZ9 A;  2K6A A;  4IFD G;  3Q0A A;  5I9P A;  2JA7 G;  2A68 D;  1RTO A;  5EPL A;  1KLU D;  1TS5 A;  1VQD A;  3ND9 A;  2NVQ H;  1ENC A;  3H3V H;  2QEJ C;  4O2D A;  1PZI D;  5C5M A;  3FHW A;  1JJ2 A;  2XWJ B;  5BN5 A;  1W6J A;  1WVL A;  2Q2H A;  1Q82 C;  5IY0 A;  5KYL A;  4XQN A;  1YI2 A;  2JA6 B;  2GVA A;  3DMU A;  4DUY Q;  3L3O C;  1SE4 A;  3KYH C;  4FNF A;  2VW9 A;  1MI2 A;  1V1O A;  2Y0S B;  2E2I H;  3PUW A;  4V19 0;  1RF2 D;  1ZYR D;  5BR8 L;  2EY5 A;  3DM1 A;  4ILW A;  2Z4H A;  4OGQ C;  4XQJ A;  1QNK A;  4B08 A;  2UUB Q;  4QQB X;  3CCS A;  2A6H D;  4KKT A;  4GLV B;  3UDF A;  5C44 G;  1VQN A;  2HCC A;  5JJL A;  4DK6 C;  2CH4 W;  4FF2 A;  4DV5 L;  3ZJY C;  3I4N B;  5IWA Q;  1HFN A;  5E4W C;  3DXJ C;  1B9N A;  4NMZ A;  4YWK A;  2SDF A;  3DM3 A;  4LNQ A;  1IYJ B;  4C3J H;  1VQM A;  4C3I B;  2CWA A;  1G6Z A;  1EYD A;  4Q5V A;  2JXM B;  1PTO D;  4A3B B;  3Q22 A;  3PV0 A;  4RH6 A;  4WJW A;  1G51 A;  4KD4 A;  2F4V L;  3FVQ A;  3N52 A;  2CQO A;  2E2J B;  1ICF B;  1EY8 A;  2NBF A;  2JN4 A;  4FF3 A;  3HOZ H;  1EWH A;  3HOU G;  1HZB A;  3G48 A;  1HA6 A;  2O4X A;  1DJR D;  3T1H L;  2D0O A;  3OMC A;  2ZTE A;  3LWE A;  4DR7 Q;  2F0S A;  2WB1 E;  4X3S A;  1PHJ A;  2UUB L;  4DFA A;  5LMU Q;  4V0B A;  1XTC D;  4WJ4 A;  2IX0 A;  4OON A;  3S15 H;  4H0L C;  3D6C A;  4DV3 L;  4GOP B;  4C1N K;  1PH1 A;  2VUM H;  3I2Z A;  1PLF A;  4B3T L;  3W3A A;  2F3V A;  5IT9 c;  1K0S A;  3AYH B;  3F2C A;  3M3Y H;  3PIO A;  4M8A A;  4OO1 H;  3OSO A;  4LF9 Q;  4KHZ A;  2E76 C;  3RLN A;  3HKS A;  1PYW D;  3W1B A;  2OTL A;  1E1O A;  1KL9 A;  1JWU D;  1M1K C;  1L1O C;  1KDA A;  1M8A A;  1D1I A;  1HNZ Q;  4A3D B;  3NXW A;  2ICE C;  3MXN A;  4LAA A;  4TVA B;  4XYO A;  4DNR B;  1XPR A;  2UU9 L;  1Q8K A;  2Q2U A;  2A74 C;  4QUF A;  4ZRZ A;  3PO2 B;  4KI0 A;  1WI5 A;  2HT1 A;  5HY6 A;  1MGS A;  2QGQ A;  3NE5 B;  4BA1 I;  5IGE A;  4PZ6 A;  3ERO A;  3CCJ A;  1EWC A;  5GAD C;  1S5F D;  2NTS A;  4DF7 A;  3AFQ A;  3M7G A;  1IHZ A;  2K5V A;  4FVM A;  2BA1 A;  4GOP A;  1AP0 A;  4A3C H;  2N49 A;  3FDT A;  2KHJ A;  1LTR D;  2Q8R E;  5KNB A;  1A2U A;  3C1F A;  1H9M A;  2XIW A;  4A3F G;  2ZXR A;  3BU2 A;  2F0G A;  3J80 E;  1GM5 A;  4U68 A;  1MD2 D;  2MP1 A;  4JI2 Q;  4X65 L;  2ZJP A;  4IFD J;  2F0D A;  1WCM H;  1EIF A;  5EQ0 A;  2SNS A;  4HR7 B;  1K83 H;  1Y14 B;  3HOY B;  4YCW A;  4A3L H;  2YTY A;  1PFN A;  1ESR A;  2L0C A;  4RGM A;  3SEB A;  4BBS H;  1R9T H;  1SNM A;  2ZJQ A;  2A1A A;  1YNN D;  1YNX A;  1FGB D;  5IGC A;  1S72 A;  1PH8 A;  5CBA E;  2KUM A;  2RSN A;  3F2U A;  2BH8 A;  1YNJ C;  3VR4 A;  2VB2 X;  2V1C C;  4DNT B;  4GLX A;  4X6A H;  3GQB A;  4H02 A;  2HIX A;  1F9P A;  5JJK A;  4GN4 B;  4JI2 L;  2KA7 A;  5G3L F;  3K6O A;  4R4T A;  4GOP C;  3MFG A;  3HOY G;  4WJ3 M;  3P75 A;  3PF4 A;  4P72 A;  1CQF A;  4UP9 A;  4DA2 A;  4GS3 A;  3CCE A;  4DV2 L;  1S5B D;  1KNE A;  1HA5 A;  2K1B A;  4HSP A;  4X3K A;  3S15 B;  1LT4 D;  1O7I A;  5ELD A;  3VR2 A;  1IYU A;  5BN4 A;  3MXP A;  1N9W A;  5EPK A;  1EOV A;  1TKW B;  2B2V A;  3HOY H;  2J0T D;  3DWA A;  4N8F A;  5C44 B;  1RDP D;  1ZXT A;  3GV6 A;  3OPO A;  5AFW A;  1K8A C;  2R93 H;  2J7Z A;  4RKL A;  2HQL A;  1N33 Q;  1VQG A;  1KRS A;  4BY7 H;  5CBE E;  1P8L A;  5IYC G;  4BXX G;  1BCP D;  3E9H A;  2XRQ D;  4B3S L;  1E24 A;  4QIW E;  1YBY A;  4A3G B;  4A3B H;  3NSW A;  4X65 Q;  3MC0 B;  2KCT A;  1B3A A;  1WTP A;  2EYO A;  4TRD A;  4FXK C;  1EFW A;  4HAE A;  5HGQ A;  4X64 L;  4DR1 Q;  3QG1 A;  4ZQ3 A;  4BBR B;  5JPN C;  4K2L A;  4FYD A;  1T9H A;  2KCC A;  4HJ9 A;  3K7A B;  2BA0 A;  3U4Z A;  2UXD Q;  1E2W A;  1ET9 A;  3WOE A;  1JMC A;  1IW7 D;  1I4X A;  3A74 A;  3T1Y L;  4CJ0 B;  5J1Z A;  4LF5 L;  2R92 B;  1J8I A;  1JWS D;  3A56 A;  1VQ7 A;  1RIP A;  1ZEQ X;  4PZ7 A;  3Q24 A;  3NQT A;  3X3M A;  1FJG Q;  2EY2 A;  1D6E C;  3A8K E;  1JE4 A;  5JJI A;  1D5Z C;  1GOZ A;  1CKO A;  4R8I A;  3NPP A;  3J7A V;  1GHJ A;  2G9H D;  4IPH A;  4KTA A;  3RZO B;  2PNR C;  4QUC A;  2K01 A;  4DV3 Q;  2KEN A;  1W2B A;  1HNX L;  2EY1 A;  3EA6 A;  1N34 Q;  4U67 3;  1DZ1 A;  2PI2 A;  3CC4 A;  2K33 A;  5AJ3 L;  1PMR A;  1VQ5 A;  1CKN A;  2ALY B;  4JI3 Q;  4G4K A;  1WTH A;  4IOC A;  1J9O A;  2B2T C;  1II3 A;  1GUT A;  5EBD A;  1B1Z A;  2DNC A;  4GKJ Q;  1Y1V G;  1VF7 A;  5EKL A;  1TS2 A;  1QZG A;  1X6O A;  4J15 A;  4IPD A;  4BS9 A;  5GAG C;  2XRS D;  1LTG D;  1PH3 A;  1JT8 A;  3SK4 A;  3CF5 A;  1K83 B;  2VUM G;  2EJM A;  4LFA Q;  1J6Q A;  3J7Z C;  5I6W A;  3E9I A;  1LYL A;  2WP8 J;  2UUA L;  1ONL A;  2X6L A;  4RCN A;  4LMQ D;  3KUP A;  1ENA A;  3F8T A;  1IBL L;  4LW1 A;  4F88 A;  3PUV A;  2Z6K A;  1G29 1;  3S1M B;  1TS4 A;  4LFB L;  2PMZ B;  1X3P A;  2XSC A;  5CC4 A;  1V8Q A;  4C1N I;  3G71 A;  4MHE A;  3BDL A;  1VMC A;  1JR0 D;  4A3J G;  1AW7 A;  2AKW B;  5C3X A;  1X3F A;  3BG3 A;  1LTT D;  1QIL A;  1LT5 D;  2KBN A;  4HMI A;  1FR3 A;  2Y0S E;  1AZQ A;  1EEI D;  1E7Z A;  4DAY B;  2YYZ A;  3R2T A;  1JIC A;  5LL6 S;  1UEA B;  2PCF B;  3CCU A;  4FDB A;  5T1I A;  4CGY B;  3M9B A;  1B44 D;  1Y8O B;  1SND A;  3EFX D;  3GTJ H;  1F9R A;  2JA8 B;  5JEA J;  2PPB C;  3GTO H;  2ENB A;  4DAM A;  3LNN A;  4RGN A;  4KLK A;  4OO1 I;  1F2L A;  1V1P A;  1D5X C;  3CPW A;  4GN3 B;  4R8N A;  2NN6 I;  1BBW A;  2YTX A;  1A62 A;  1K0R A;  3J80 L;  5M3F H;  1HR0 W;  2R7F A;  3D4W A;  2UXB L;  4B3R L;  4DV7 Q;  1FL0 A;  3OWE B;  3V05 A;  1GUO A;  1BUV T;  1DOL A;  5IYD G;  2DJF C;  1SYF A;  1ENF A;  3CU7 A;  1WFQ A;  3MVV A;  4KD3 A;  1XYI A;  4LF4 L;  1CK1 A;  4DV4 Q;  5IIF A;  3K58 A;  3KBG A;  5M5X H;  2OT2 A;  2VS1 A;  1XPU A;  3AQQ A;  2IJ0 A;  1WTO A;  4APV A;  1A3T A;  3E0J A;  1XTD A;  3EIV A;  4NB3 A;  1H95 A;  3CAM A;  3T53 B;  2NVQ B;  3I55 A;  4ZKB B;  1I4Q A;  2DY8 A;  4CJ2 C;  3M85 A;  3GTQ H;  2CKZ B;  3CC2 A;  4K5X A;  1GUW A;  3M7N A;  1VQE A;  2CW0 C;  5CV5 A;  1B50 A;  3NWS A;  2CH4 A;  4JI7 Q;  3GTO B;  1EWI A;  3RLF A;  2WIN B;  1YVC A;  5FKA C;  1JB7 A;  1JJC B;  1TWF H;  3VA7 A;  3J81 c;  3Q23 A;  1OTC A;  5JJZ A;  1DD2 A;  3KDF A;  5ELB A;  1D7Q A;  2IW3 A;  1QB5 D;  2QIL A;  4KY6 A;  2ID0 A;  4NXN Q;  2QW7 A;  2XTI A;  4OEL B;  1CSP A;  2ES2 A;  4QCL A;  1KAB A;  1I4G A;  4BA2 I;  2CVR A;  5E7N A;  4C3I H;  4JI4 L;  4AQY Q;  1PYS B;  1IBK Q;  3NTI A;  4WOR A;  3TEH B;  4A75 A;  2KCN A;  2K52 A;  1O7L A;  1N33 L;  1PTO F;  3S1M H;  4IUU A;  2F0M A;  4CJ1 B;  4C3H G;  4RKB A;  4IJH A;  1N32 L;  1HZC A;  2QA4 A;  1F9Q A;  1UE1 A;  4BY7 G;  5COY A;  5M9O A;  2Z9H A;  4YIJ A;  3C46 A;  4ALP A;  1QVC A;  1X3G A;  2IHF A;  3SK5 A;  1X56 A;  2ASB A;  3WWV A;  2KHI A;  2K04 A;  2R93 G;  3J81 E;  1KDB A;  1RJT A;  3ND8 A;  1UAP A;  2IPK D;  2YV5 A;  4LUO A;  2V4D A;  2NVT H;  1U4L A;  4BY7 B;  1T5E A;  1HUM A;  2I5H A;  3DWQ A;  4XTC S;  3ULJ A;  1IKM A;  4A3E G;  3HG9 A;  4DR5 L;  3P7J A;  2RSO A;  2AQ2 B;  4K5W A;  4K6D A;  2ZT9 C;  3TME A;  3OOC A;  2F3I A;  4I65 A;  1Q1B A;  5EKI A;  1PRT D;  2RQX A;  2SNM A;  3F2D A;  2O5J C;  1QVG A;  3TSS A;  4LUZ A;  3I4M H;  1STE A;  4J1M A;  2LSS A;  3VA5 A;  5M5Y B;  4RA8 A;  2YU9 B;  1TR5 A;  1LLR D;  5T1G A;  5LMN Q;  5FLM G;  1EIY B;  4DR3 L;  3AEV A;  3TS2 A;  4Y52 H;  3PCO B;  4TKO B;  4R4Q A;  3H0G H;  2I5L X;  4L8J A;  2VNU D;  3S2D H;  1KXL A;  3EN2 A;  5K5P A;  1Y1W B;  1TWG H;  4NKL A;  3I70 A;  4DR3 Q;  1FD7 D;  2EIF A;  4ULL A;  1PZJ D;  3U58 A;  2R92 H;  1SLJ A;  1HR0 Q;  4KMU C;  3CD6 A;  1JB3 A;  4KHP Q;  1H9J A;  1WD0 A;  3ITP A;  5F2D A;  3S14 B;  2EYL A;  1R4P B;  4A3M H;  4EGV A;  5D3I B;  4LK1 C;  1PH5 A;  2BE5 C;  2DY7 A;  4XXE A;  5DAU A;  1VQA A;  1JOO A;  2B8F A;  4B3M L;  4HCE A;  1CT1 D;  3M4O H;  5C6A A;  3OHX C;  1HHV A;  1ZKO A;  4KJN A;  3SGI A;  3S1R B;  1WCM B;  3TRZ A;  4DV6 L;  2OCE A;  3K0X A;  3MEF A;  1ROD A;  1VQ8 A;  1FNU A;  1VQI A;  4AYB B;  1JJG A;  2L15 A;  2PMZ E;  4IJL A;  4DK1 A;  2B2U A;  2R7Z H;  1OXS C;  3H3V C;  4A93 B;  2IX3 A;  1Q1E A;  4L5Q A;  1QZH A;  4TQU S;  1I3Q B;  2HDM A;  4JOI A;  2F52 A;  4DV4 L;  1SJH D;  2D2C C;  1HNZ L;  3NUC A;  5M5W B;  3S24 A;  5D14 A;  3N6R A;  4HJA A;  3P1H A;  4WRD A;  4A3I H;  4KN7 C;  1NE3 A;  2CHB D;  1JOK A;  1EY6 A;  2JEA I;  3SR1 A;  4QGU A;  1CSQ A;  2LKV A;  4FF4 A;  4DV7 L;  2EYJ A;  1D2B A;  2E8G A;  3OYY A;  4TSS A;  3CRK C;  4IUT A;  3VR5 A;  3CCM A;  1TWH H;  3T4A C;  3HOW B;  1O7Y A;  4A3L G;  1RKN A;  2E2D C;  3W2D A;  1LAB A;  2C35 B;  4A3C G;  1C48 A;  3AMU A;  2Z0S A;  4DV6 Q;  2Z6B A;  4XDX A;  3T13 A;  1N8R C;  4IOA A;  4AH6 A;  2X69 A;  3V96 A;  1A2T A;  1PH7 A;  4DGZ A;  1PYB A;  2PZU A;  4A3I G;  4XT1 B;  4HJ8 A;  3OIP A;  5JPM C;  3KF6 B;  1CZW A;  1WCM G;  3I4N G;  5C3E G;  4BY1 B;  4CDE C;  1DON A;  1B2T A;  1B8A A;  1J5E L;  3ULP A;  1EIH A;  2WKD A;  3MTS A;  2BE5 D;  1F2Y A;  3I73 A;  2GA4 B;  4BBR G;  4JCV E;  1WTW A;  3RD4 A;  1STB A;  2A69 D;  3NBH A;  1XJV A;  1OXX K;  1Y8N B;  1Y1W G;  4S3S A;  3M4Q A;  1HTP A;  3PO2 G;  5FLX c;  5IE8 A;  2K03 A;  1YJN A;  2LXK A;  1CFM A;  4UP7 A;  4GN5 A;  3PO3 G;  3D8G A;  2RHS B;  2A8V A;  1VF5 C;  1XWE A;  3R93 A;  3OIQ A;  2A73 B;  3GTM H;  5FLX E;  1Y8P B;  4DKA C;  1PTO H;  4E6I A;  2EJG C;  1H9S A;  3KJP A;  1EQT A;  1EQQ A;  1UE6 A;  3A5U A;  4L5R C;  4IPG A;  4IAL A;  5FOB B;  5EBC A;  1FNW A;  2F1M A;  2Z1C A;  4QIW B;  4OO1 G;  5KGU A;  2EDG A;  1B3Q A;  1HH2 P;  3H94 A;  2A5H A;  2ZTC A;  2B2Y A;  5COR A;  1QOH A;  1EY0 A;  3VYU A;  1QJO A;  4JI0 Q;  5JOB A;  3G6E A;  4DV0 Q;  2E5L Q;  2VQE L;  1STA A;  2WAQ B;  3H15 A;  1E22 A;  4JI5 L;  4A3F H;  4R4O A;  4K14 A;  4BY1 G;  3OMG A;  1PXU A;  3PIP 3;  1M90 C;  4RCO A;  3VDY A;  4DR6 Q;  1QUQ B;  2UUC Q;  4H7B A;  4PV1 C;  4IPC A;  3CME A;  4DU9 A;  3RR5 A;  4YY3 L;  2D0P A;  1EYC A;  3SXH A;  2SOB A;  5C4J B;  1SFO H;  1A8V A;  2Y0S G;  1ILP A;  1AE2 A;  3HFZ B;  1SMY C;  2VZA A;  4HJ7 A;  5CMD A;  1JOR A;  4R9W A;  4IUP A;  1X55 A;  1LTS D;  2XWB B;  4AQY L;  1BBU A;  3S16 B;  1QG7 A;  2L9H A;  4A3I B;  5C4J H;  2F3W A;  2B2Y C;  4QL5 A;  4C3H H;  1UNS A;  3KF6 A;  4LFC L;  3NEN A;  4CDD C;  2UUA Q;  4CHT B;  1OO9 B;  4DAP A;  5C5L A;  1IBM L;  2L11 A;  2VY3 A;  2IX1 A;  2EYP A;  3QIA A;  5CYU A;  1RD9 D;  4A3E H;  2K7V A;  4A3K B;  1IYV A;  1LV9 A;  1B4O A;  1GJX A;  4DV5 Q;  1Q12 A;  1A3V A;  4A93 H;  1KIX A;  3TP5 A;  1EY9 A;  3QR8 A;  2HD3 A;  1HXY D;  3DUZ A;  4NW2 A;  1I4R A;  1HFG A;  5CV7 A;  3PO3 B;  3B6Y A;  3NP8 A;  5M3M G;  1SE3 A;  1TII D;  2ICI A;  3S17 H;  1D1K A;  1I4H A;  2Q8T A;  3CHB D;  3FP9 A;  1S3O A;  3NK9 A;  2Q8I B;  4KKU A;  4MZ9 A;  4KK7 A;  2OQK A;  3K5L A;  1SYD A;  1WTR A;  4OEM B;  5ELF A;  1TWA B;  1TQO A;  2IL8 A;  3K81 C;  2F0P A;  4DUY L;  1IBM Q;  1JCK B;  4HMJ A;  2R92 G;  4JI5 Q;  5ELE A;  3KDF B;  1C9O A;  4M1U B;  1I3Q H;  5I4D A;  1ZYR C;  5IT9 E;  3IRB A;  5JEA G;  3S2H B;  1I50 B;  5EGT A;  4RMF A;  1WTV A;  4IFD H;  5DNF A;  1Q7Y C;  3K5O A;  2UXB Q;  3TP7 A;  1TT2 A;  1VQP A;  1VDZ A;  3J80 c;  3DLL A;  3A7L A;  1L1O A;  4LF5 Q;  5I2Y A;  4HSV A;  1HQM C;  1SE8 A;  1STY A;  1P16 A;  3KLS X;  4GZY C;  2JA8 G;  4JW0 A;  1CKM A;  4O0A A;  2A19 A;  5IGF A;  5K36 H;  4IQZ A;  1V9P A;  3GTP H;  3BVM A;  4JC0 A;  2KVM A;  3PUX A;  4JV5 Q;  4IUV A;  2IT1 A;  4KY5 A;  1A0I A;  2CWP A;  2BCO A;  1CTM A;  4ZLT F;  2UUC L;  2QF7 A;  3KBX A;  2NTT A;  3S1Q H;  3PIP A;  2NZH A;  2A69 C;  5NUC A;  1R4Q B;  2PQA A;  3JAM E;  1O7Z A;  4HED A;  1PFS A;  2N3S A;  5FLX L;  3J7A 5;  1HZA A;  1SNO A;  2R61 A;  2A6E D;  1STG A;  3H0G B;  2EYM A;  1I6H B;  1JC7 A;  1WD1 A;  1X3E A;  3FRP B;  1N36 L;  1K73 C;  5DLQ E;  3CPF A;  2EY6 A;  2RVL A;  3SE0 A;  4OL7 A;  2JYO A;  2FMC A;  3H09 A;  5M3M H;  1GVP A;  2JA5 G;  4POF A;  4EQO A;  4RFB A;  4DK3 C;  4X64 Q;  1KC8 C;  2R7Z B;  3H91 A;  1Q3L A;  2RF4 A;  1EZ6 A;  2OQ0 A;  1S5D D;  4OX9 L;  4EQP A;  4NDX A;  1FVI A;  1F2M A;  4DXF A;  4NXM L;  1EQR A;  3FKI G;  2CCZ A;  1VQJ A;  1L2F A;  2K4K A;  2EQS A;  3OW2 A;  1F77 A;  2FFK B;  1G6P A;  2PNH A;  4EX5 A;  2EZV A;  4ZUJ A;  2JA5 B;  3TP6 A;  4A3M B;  2R7Z G;  1XX8 A;  2F0I A;  1J5E Q;  4IUQ A;  1RTN A;  5ELO A;  4ZUI A;  5C3W A;  3DHQ A;  1CQV A;  5KRU A;  1HNX Q;  5C4X B;  1PDQ A;  1XMO Q;  2D62 A;  1Q90 A;  1C0A A;  1DCZ A;  4ZYS A;  1GUS A;  2FIN B;  1YHA A;  3O13 A;  3U50 C;  5KIX A;  4IZ8 A;  1YIJ A;  3UDG A;  4JI8 Q;  1S4Z A;  3I7F A;  2RDF A;  4PQX A;  3RNU A;  1Y1W H;  3K80 C;  1PH2 A;  5CR3 A;  4JYA Q;  4UDU C;  3IFD A;  1LTI D;  1DOK A;  3I3C A;  1NUC A;  4C3I G;  3CQZ B;  4C2M H;  1ASZ A;  4FXD A;  1L0X B;  2PO4 A;  5M5Y H;  4K6L A;  3HOV H;  3PQI A;  2UXD L;  1I4P A;  4PNY A;  2JA6 H;  1BF4 A;  3D0F A;  3T56 B;  4X62 L;  1I94 L;  4K0K L;  1N32 Q;  1PV4 A;  2JE6 I;  4A3G G;  2O2L D;  2L55 A;  3I90 A;  2DUD A;  3I91 A;  1NJI C;  1PZK D;  1NR4 A;  1X32 A;  4A3K H;  4C56 C;  4A3E B;  3KLS A;  2MO1 A;  4QJF A;  5M3F B;  1A3U A;  2ZM6 Q;  1VQ6 A;  4JBK A;  4X3T A;  1VQC A;  2MQH A;  4R1J A;  2AWO A;  1EIG A;  4EQ5 A;  3TZU A;  4MTK A;  1BQQ T;  5D3D A;  3OTO L;  2B2T A;  1MJE A;  5LMN L;  2EXZ A;  1K3B C;  1XNR Q;  4NP5 A;  3M4Y A;  3ULL A;  3S16 H;  4BWG B;  3CXC A;  4JI1 Q;  1KNA A;  2D5D A;  1BCP C;  1C7Y A;  2ZXO A;  4GLA C;  3LX0 A;  2EE1 A;  1WOC A;  3CCV A;  5LL6 X;  4DR5 Q;  1STN A;  3K0Y A;  1KRT A;  2BH2 A;  2AUJ D;  1AZP A;  1Z7T A;  3H6M A;  3FPP A;  2QCP X;  1SYE A;  3L9A X;  2LY7 A;  2Z8L A;  3UE1 A;  3HP3 A;  3MEH A;  1NMF A;  1F9S A;  1IZ6 A;  3BZD B;  5C4Z A;  3HOZ G;  2BDN A;  4A3D G;  2FXQ A;  3K5N A;  3RZD B;  5J3B A;  5L37 A;  3BDO A;  5LMU L;  2NWG A;  3PUZ A;  3KOJ A;  1XMQ L;  5C4X G;  2BDO A;  2N8N A;  1EYG A;  2OF1 A;  1W3S A;  1BXT A;  2HDL A;  4QF4 A;  3STB C;  4HID A;  2VL6 A;  2K50 A;  3QOJ A;  2QKI C;  1EY4 A;  2TSS A;  1IBK L;  4A93 G;  2B63 H;  4OX9 Q;  4H44 C;  5C4H A;  5HGT A;  3S17 B;  4A4I A;  4O1N A;  4CKC A;  3SVM A;  3K57 A;  3SK6 A;  2K5W A;  4CDC C;  1LUZ A;  4LF6 L;  1NNX A;  5C44 H;  3PF5 A;  1OXU A;  2KHS A;  3GP7 A;  5IGB A;  1XXG A;  2F0N A;  2PQE A;  1U0L A;  4EQN A;  2VQF Q;  2R3Z A;  2JEB I;  4ZKC B;  4A3J B;  3MA2 B;  1BOS A;  4P75 A;  5A2Q L;  1KHI A;  2MGS A;  3BVZ A;  3RLO A;  5FO9 B;  3HOW G;  4K5V A;  1HJP A;  3BZK A;  5FO7 B;  5EJW A;  1CHQ D;  4XT3 B;  1B7Y B;  4C3J G;  2WV6 D;  2K32 A;  1QVF A;  3W5O A;  5DM7 3;  3MWY W;  1CA6 A;  1K8O A;  1DXM A;  2HCI A;  1OXT A;  2D9U A;  3M4P A;  5TSS A;  1EU3 A;  1TU2 B;  3H0G G;  1I50 H;  5IOD A;  2BOS A;  2N55 A;  1C4Q A;  2YTV A;  4A76 A;  3TDQ A;  1BCP F;  5CV8 A;  2UU9 Q;  1A63 A;  3G6J B;  5IYD H;  4QB4 A;  2F0F A;  3CMA A;  1BR9 A;  5FK9 C;  3PIO 3;  1QUQ A;  3S1N B;  1WTX A;  3FEW X;  4LF7 L;  4P73 A;  3GTL B;  2IWH A;  2Q2I A;  3IL8 A;  4A3M G;  1H9S B;  4FXG C;  4OWW B;  1PRT C;  2I0Q A;  3PMF A;  1CHP D;  3PO3 H;  3CCR A;  4A3F B;  5DEH A;  3K5M A;  1HNW L;  1WYD A;  2JA7 B;  1L0W A;  4LF7 Q;  5GRO A;  1DM0 B;  2K5Q A;  2NVY H;  1V1Q A;  2RCF A;  5E4X A;  3I4L A;  1GUN A;  4ZCK A;  1UWV A;  2L4N A;  1B53 A;  3URY A;  5BR8 Q;  2XNA C;  4YY3 Q;  4ZAI A;  1NSN S;  3NEL A;  1TWA H;  4B9W A;  4LJZ C;  1VQO A;  1O78 A;  2A6H C;  5EKK A;  4DR2 Q;  4K2K A;  2OTJ A;  2KOL A;  4K8I A;  1IW7 C;  1YEZ A;  4QY7 A;  2HQE A;  4DV0 L;  3W1G A;  1OXV A;  4DNI A;  3CW2 C;  2R7D A;  4G7O C;  3ERS X;  1DOM A;  2B63 G;  1SR3 A;  4LFB Q;  4DR4 Q;  3GTK H;  2HHH L;  2NVX H;  2LS0 1;  4PMW A;  1IBL Q;  1E3P A;  3F1Z A;  4JI1 L;  5EPJ A;  3EQL C;  2JQO A;  1K9M C;  5A35 A;  4IUR A;  4KN4 C;  1NY4 A;  3A54 A;  3DWP A;  4OIK A;  5IT9 L;  1XNR L;  1QE6 A;  3G7L A;  2RA4 A;  1IKL A;  2LFN A;  1I6V C;  3QO2 A;  1UEB A;  4GNX C;  1A15 A;  4C3H B;  3KLW A;  4HTH A;  4ZK9 B;  3A7A B;  2Z6K C;  3HOV G;  2AMC B;  1EY7 A;  4G7Z C;  3NBH B;  5GAE C;  2WKC A;  3I8Z A;  1JQY D;  4A3J H;  5BN3 A;  3I4M G;  2B2W C;  3Q6S A;  3E3X A;  2EOT A;  1CA5 A;  4JI3 L;  4AYB G;  3HOX G;  3J81 j;  1EQV A;  4IN3 A;  1A6X A;  2UXC L;  3K59 A;  1UE7 A;  1K8M A;  2F0Q A;  2NYZ D;  5CV4 A;  2VQF L;  1SMX A;  1SYB A;  2F0J A;  4YHH L;  3BYT B;  1Y1V B;  1R9T B;  1JE5 A;  4LUV A;  5C0X G;  4BBS B;  2L5T A;  1SSO A;  2JK8 A;  2PZW A;  3SDZ A;  5LHY 1;  2WB1 B;  1E1T A;  1Q8I A;  2VQE Q;  1U9R A;  2RKS A;  3BVG A;  3BZC A;  1ILQ A;  2CQA A;  4L63 B;  1FJG L;  2TMP A;  1MSG A;  5IGD A;  2JA7 H;  1YNN C;  3E0E A;  4HIK A;  3HOZ B;  1Y69 U;  3L7Z C;  3T1Y Q;  3STB D;  1ASY A;  3Q8D A;  1NMG A;  1KTK A;  2A68 C;  4FO2 A;  3S1R H;  3F2B A;  2ZJR A;  4JBJ A;  2KJX A;  4G57 A;  3HKZ E;  1PH4 A;  4BY1 H;  1IL8 A;  1S40 A;  1GXD C;  2MJ8 A;  3GTL H;  5LMN W;  1SMY D;  5JEA H;  2XGT A;  5AJ3 Q;  1MJC A;  2PW7 A;  3U4V A;  5CV6 A;  4GKK Q;  1TY2 A;  2KQ3 A;  5C3E H;  4PG3 A;  5M3M B;  2JJQ A;  2K5N A;  2AUK A;  1CZG A;  2M9V A;  1CKN B;  3BYY B;  1SNQ A;  3HEJ A;  3KF8 B;  4JOI C;  5C4X H;  3CCQ A;  1MKH A;  2LMC B;  2VUM B;  1SNP A;  1KAW A;  4DPG A;  4O42 A;  4OXP A;  5H1S E;  1LT6 D;  4DK0 A;  1N36 Q;  1SE2 A;  2F4I A;  5HUR A;  4KV6 A;  5GQO A;  2RCN A;  3GTQ B;  4KHP L;  1B70 B;  3U9S A;  3P20 A;  1KLG D;  1PFM A;  1BBX C;  4P2C B;  4XQQ A;  2B39 A;  1E0B A;  1HCZ A;  5M5X B;  4RHS A;  1V1P B;  2F0U A;  4Q0F A;  2UXC Q;  2ZM6 L;  1UE5 A;  4B9X A;  4DUZ L;  3T51 B;  1T5X D;  2ZXP A;  3CQZ H;  1RHP A;  2PYK A;  3GDE A;  2QDL A;  3QB3 A;  4Y7N B;  3C3L A;  2F0H A;  5FO8 B;  3RUZ A;  3D4R A;  1EZ8 A;  4DUZ Q;  3TS0 A;  3D6W A;  4DAY A;  4NXM Q;  4ME3 A;  3RMH A;  5G3L D;  3I4N H;  1CUK A;  1RL2 A;  4N9T A;  3V2T A;  4YWM A;  3OW7 A;  2ATW A;  1X65 A;  1BO0 A;  2EYH A;  4X66 Q;  1Q46 A;  2B29 A;  1KD1 C;  1X54 A;  2K05 A;  3CC7 A;  1UUP A;  2K14 A;  2MNA A;  4JYA L;  2OXP A;  2GVB A;  3BDC A;  3R3O A;  4JI6 L;  4KHV A;  5ISR A;  2I07 B;  1ML0 D;  4FP5 D;  1NAP A;  2NZO A;  5J22 A;  2E2J H;  1PA6 A;  1PRT F;  5GAH C;  2E2I B;  1AE3 A;  2YU9 H;  4DR4 L;  1PVO A;  2JP1 A;  1ET6 A;  3M4O B;  1LO5 D;  3FKI H;  1G2T A;  1FNV A;  1D5M C;  2B2W A;  4XIG S;  1WTQ A;  2A6E C;  2H5X A;  2JSO A;  2MO0 A;  1EUJ A;  2AQ3 B;  1VQH A;  1YNJ D;  4ABN A;  2N88 A;  3CKI B;  2VXW A;  3CRL C;  2NVT B;  1Z9F A;  2KED A;  1BKB A;  1MHW C;  1DGS A;  1VQF A;  1TWG B;  3ZYY X;  4F87 A;  2F4V Q;  4EVO A;  1YIT A;  1SJE D;  3GTG H;  3S2D B;  4NXN L;  4OWX B;  1O80 A;  2OWO A;  2JA6 G;  1IL2 A;  1W6K A;  3U9O A;  1CI3 M;  5I6Y A;  5IP7 G;  1EOT A;  1AH9 A;  2K75 A;  3S9W A;  1SEB D;  3LGJ A;  2R6G A;  3UE0 A;  2NUC A;  1SYG A;  1KQS A;  3ICE A;  3HOV B;  1PFB A;  3FMC A;  4KKS A;  4DN4 M;  2B3G A;  4BBS G;  4C2M B;  1SFO B;  5C0X J;  3J7A F;  1HRJ A;  2B2U C;  5CV9 A;  3VYR A;  3NQI A;  4UAI A;  3GTP B;  1QCB D;  4B3T Q;  3FKI B;  5KEE A;  4AIM A;  4OHJ A;  3RZO H;  3PSI A;  4OIJ A;  3JAM c;  3HKZ B;  2WAQ G;  3MXN B;  1E2Z A;  2IHE A;  4PZ8 A;  1G8Z D;  1STH A;  2MPM A;  3J81 L;  3KK7 A;  1BNZ A;  3GTK B;  2HIV A;  2WB1 G;  1NBW A;  1HNW Q;  2JA9 A;  3R2I A;  4Z9C B;  1VCI A;  4J8Q A;  1FYC A;  2F0W A;  2PI2 E;  1NTG A;  4JI4 Q;  5C3E B;  1SRU A;  3HOU H;  1SYC A;  1AN8 A;  1SRO A;  4WFN 3;  4DV1 L;  4J6H A;  4BBR H;  2I46 A;  3G4S A;  4LF6 Q;  1IXR A;  1E2V A;  4R4I A;  4LFC Q;  5KNC A;  3QJY A;  3KFU A;  2AQ1 B;  2EYF A;  3HS0 C;  4ME5 A;  4YWL A;  2B2V C;  5JVG 3;  2F0L A;  3A0J A;  4H13 C;  1HUN A;  4JI7 L;  1VQ4 A;  4DXG A;  4F7X A;  2AHO B;  5C0X H;  4IUN A;  1C8C A;  2FMM A;  1I6H H;  5KYI A;  3X3N A;  5I2X A;  1LTL A;  2Q2T A;  4DR7 L;  5FJ8 H;  4HCS A;  1EU4 A;  3MXU A;  3VYT A;  5IP7 H;  1B9M A;  1Y1V H;  1EY5 A;  4P74 A;  1GKH A;  2HUG A;  3PUY A;  3T16 A;  4L5S A;  3S1N H;  3A8J E;  1I5F A;  1BDO A;  1HTL D;  2WAQ E;  3WDN A;  2XVS A;  2JA8 H;  2EVB A;  2Z4I A;  4JI6 Q;  2KCM A;  2E74 C;  3ERQ A;  5K36 G;  1YHQ A;  1TXY A;  1VQL A;  3PGZ A;  1SXT A;  4IFD I;  1WJJ A;  3JAM i;  1U4P A;  3HOX H;  4JI0 L;  4DV1 Q;  3JAM L;  4LFA L;  4RGT A;  2DGY A;  4RWS C;  4ID6 A;  2WII B;  2EJF C;  4B3R Q;  2E2H B;  2PQA B;  1PRT B;  4CBV A;  5IWA L;  2NN6 G;  4LWC A;  4CKB A;  4UPA A;  2IY5 B;  4GKJ L;  1Q81 C;  1V43 A;  3I56 A;  2GN5 A;  1LAC A;  1G2S A;  1LM0 A;  3OWF A;  4X3U A;  2CW0 D;  2P5Z X;  2RHQ B;  3KJO A;  5D65 A;  1N34 L;  1DYQ A;  4JPB W;  1U4M A;  2QEX A;  1K8G A;  3MFY A;  4DR6 L;  3AFP A;  1F2Z A;  1MIU A;  4OWT B;  1L1O B;  1EFI D;  1XPO A;  4K0K Q;  1SNC A;  5IOC A;  1LT3 D;  3VR6 A;  5IYB G;  4IO9 A;  2L12 A;  4HJ5 A;  4PMC A;  2X6G A;  1H9R A;  3A8I E;  1PTO B;  1EL0 A;  5M3F G;  1YJ9 A;  3JC6 6;  3MZ5 A;  3BS1 A;  3LWU A;  5ELN A;  1VQK A;  3TN2 A;  5CGK A;  1LTB D;  1QWY A;  4I7A A;  3H3V I;  2I5M X;  3GD7 A;  2EPB A;  4YCU A;  2VB3 X;  1Z47 A;  2NVY B;  1XNQ Q;  3L0O A;  4N9P A;  4CDF C;  4G7H C;  1TWC H;  1GD7 A;  1HR0 L;  1PTO C;  3R8B A;  1TY0 A;  3K8A A;  1PH6 A;  2QDB A;  2K28 A;  1YZ6 A;  3OTO Q;  4DR1 L;  4X66 L;  5J39 A;  1VS0 A;  2E75 C;  3GO5 A;  4YCV A;  1RCV D;  2M2L A;  2K5D A;  4B3S Q;  2G9D A;  4ODG A;  5DM6 3;  4N8X 1;  1SN8 A;  3J81 i;  4UY8 C;  2F0V A;  1D8L A;  4NPS A;  1I94 Q;  2WAC A;  2B8G A;  3AB9 A;  1XMQ Q;  1NCV A;  1EEF D;  4BXX H;  4JG2 A;  4A3K G;  2F0E A;  4JBW A;  1CM9 A;  2NVX B;  1S5C D;  2F0T A;  3NTH A;  1NR2 A;  5A2Q E;  1K28 A;  2H4O A;  2B63 B;  4MNO A;  2C9O A;  4LF8 L;  5EAY A;  4A3G H;  2OEO A;  4RHR A;  1Z6H A;  4MIU A;  2F03 A;  4JI8 L;  4R4C A;  2FJ2 A;  5M5W H;  2NN6 H;  3I4O A;  2R93 B;  3UDI A;  2DNE A;  3KLR A;  2RDG A;  3HZX A;  2O5I C;  5IP9 H;  2MUY A;  5IGG A;  3HGB A;  5C0X I;  1HQR D;  1BVS A;  5E1F A;  3FPU B;  2H1E A;  3DEO A;  1GO3 E;  1GUG A;  2DJG C;  3RN2 A;  3K7A H;  2C5C A;  3IAY A;  5JAV A;  2CFM A;  3WOF A;  2E2H H;  4GKK L;  1H9K A;  3GTM B;  3CP0 A;  3IKJ A;  3HOX B;  5IP9 G;  4C3J B;  3DEP A;  1X9N A;  4FF1 A;  5IYB H;  4X62 Q;  1XNQ L;  1TWF B;  3GV3 A;  3PO2 H;  4QMG A;  5E3F A;  5KND A;  1SAP A;  3VYS A;  1EYA A;  3HRZ C;  1FGU A;  4JBM A;  3C2P A;  2NZ1 D;  4I7Z C;  4RGO S;  1M4V A;  3SK8 A;  2PZT A;  4HN7 A;  4B3M Q;  4JK1 C;  3EJI A;  4HIO A;  1MSH A;  4A3D H;  4DAV A;  2HHH Q;  4JVZ A;  4UP8 A;  3VR3 A;  3QOL A;  4P71 A;  2ZTD A;  1LTA D;  4DV2 Q;  3NHH A;  4LF8 Q;  1PH9 A;  4RAU C;  4GNX A;  3CCL A;  3TQY A;  5I9O A;  1U4R A;  2XN9 C;  3MAQ A;  3E5S A;  4YHH Q;  2N78 A;  4KY7 A;  1AFP A;  4K8J A;  4KJO A;  1XMO L;  3I4M B;  1YJW A;  1TWC B;  3RN5 A;  1MBY A;  3NWT A;  2M00 A;  3EBE A;  3M3Y B;  1TWH B;  3HOW H;  1X3Q A;  4JV5 L;  1ESF A;  4L5T A;  3J7Y W;  3KF8 A;  5ELC A;  1VMP A;  3ONA B;  2L1B A;  3HKZ G;  4AYB E;  2AWN A;  2PW5 A;  1L0Y B;  3UDX A;  2K5H A;  4CKE A;  1KDC A;  1ICW A;  2KEE A;  2F0O A;  4F8M A;  1SBB B;  1AEX A;  5JVH 3;  1U5K A;  4POG A;  3A55 A;  2RBM A;  3C1E A;  3I72 A;  1QNU A;  4L6T B;  1VQ9 A;  2G5D A;  4RG1 A;  4HIM A;  4LF9 L;  2KEC A;  3S1Q B;  3EVQ A;  3UI2 A;  2FHT A;  4PMB A;  3D31 A;  3TP8 A;  3GTJ B;  1KAA A;  2RDH A;  3TZD A;  5FJ8 G;  1SDF A;  3ER0 A;  2SEB D;  3SHL A;  3E6Z X;  2JA5 H;  1Q86 C;  3RZD H;  1TS3 A;  5IYC H;  3MHB A;  4MN3 A;  3BJU A;  3D4D A;  1TVX A;  2MHV A;  4UHV A;  1BCP B;  4A3B G;  1HPC A;  2F0K A;  3QWN A;  3K7U C;  1K3R A;  2MFI A;  3NEM A;  3J80 i;  1G91 A; 
#chains in the Genus database with same CATH homology
 1K73 C;  5DLQ E;  3CPF A;  4NXM Q;  5IYD G;  4ME3 A;  5FLM H;  4DR2 L;  3S14 H;  3T1H Q;  2WFW A;  3I4N H;  1VQB A;  3L2P A;  1CUK A;  3S2H H;  1RL2 A;  1WFQ A;  4YWM A;  4LF4 L;  2ATW A;  1X65 A;  4X66 Q;  4DV4 Q;  3TRE A;  1Q46 A;  2B29 A;  1KD1 C;  1X54 A;  5M5X H;  2VS1 A;  1XPU A;  1YHB A;  5M3M H;  3CC7 A;  1GVP A;  3AQQ A;  2K14 A;  2JA5 G;  4APV A;  4POF A;  2MNA A;  4JYA L;  2LXJ A;  3EIV A;  4DK3 C;  1XTD A;  2EXD A;  4X64 Q;  1KC8 C;  4NB3 A;  2GVB A;  4LF4 Q;  1H95 A;  4JI6 L;  2RF4 A;  3CAM A;  2OQ0 A;  3I55 A;  4OX9 L;  4Y7N H;  3M85 A;  3A5Z B;  2NZO A;  2E2J H;  3GTQ H;  1FVI A;  2CKZ B;  4MTN A;  3CC2 A;  2E5L L;  4GNX B;  1PA6 A;  1EQR A;  5GAH C;  4NXM L;  3M7N A;  3FKI G;  1AE3 A;  1VQE A;  2YU9 H;  2CCZ A;  4DR4 L;  1PVO A;  1VQJ A;  1HZ9 A;  1L2F A;  2K4K A;  2EQS A;  3OW2 A;  4IFD G;  3FKI H;  2JA7 G;  4XIG S;  1G6P A;  2PNH A;  1VQD A;  4EX5 A;  2H5X A;  2MO0 A;  2NVQ H;  4JI7 Q;  3H3V H;  1EUJ A;  1EWI A;  3RLF A;  2R7Z G;  1VQH A;  4O2D A;  1YVC A;  1J5E Q;  3FHW A;  1JJ2 A;  1JB7 A;  1JJC B;  1TWF H;  5ELO A;  3J81 c;  1OTC A;  2Q2H A;  1Q82 C;  1HNX Q;  3KDF A;  5IY0 A;  1YI2 A;  1XMO Q;  1D7Q A;  2GVA A;  2D62 A;  4DUY Q;  1Z9F A;  1C0A A;  3KYH C;  1YHA A;  3U50 C;  1BKB A;  1YIJ A;  2VW9 A;  1DGS A;  3UDG A;  4JI8 Q;  2ID0 A;  1VQF A;  3I7F A;  4NXN Q;  2XTI A;  3RNU A;  2E2I H;  3PUW A;  1CSP A;  2ES2 A;  4LF7 Q;  1YIT A;  1Y1W H;  2F4V Q;  3GTG H;  3K80 C;  1PH2 A;  4JYA Q;  5BR8 L;  4BA2 I;  4NXN L;  4C3I H;  5E7N A;  4OWX B;  4JI4 L;  4AQY Q;  2OWO A;  1PYS B;  2UUB Q;  2JA6 G;  1IBK Q;  1IL2 A;  4QQB X;  3CCS A;  4C2M H;  4GLV B;  1ASZ A;  3TEH B;  5IP7 G;  4A75 A;  1AH9 A;  2K75 A;  3UDF A;  5C44 G;  2K52 A;  5M5Y H;  1N33 L;  3S1M H;  1VQN A;  3HOV H;  3LGJ A;  2R6G A;  3UE0 A;  5JJL A;  4IJH A;  1N32 L;  2UXD L;  4DK6 C;  1KQS A;  1HZC A;  2QA4 A;  3ICE A;  1UE1 A;  2JA6 H;  3D0F A;  3ZJY C;  4X62 L;  5IWA Q;  4DV5 L;  1I94 L;  1PV4 A;  2JE6 I;  4BY7 G;  2B3G A;  4K0K L;  4A3G G;  1N32 Q;  4BBS G;  5C0X J;  4ALP A;  2DUD A;  1QVC A;  1NJI C;  4YWK A;  3DM3 A;  4LNQ A;  1IYJ B;  1X3G A;  4A3K H;  4C3J H;  2MO1 A;  1VQM A;  2CWA A;  4QJF A;  4B3T Q;  2ZM6 Q;  2IHF A;  4JBK A;  1VQ6 A;  4AIM A;  1X56 A;  3RZO H;  1VQC A;  2MQH A;  3PSI A;  4R1J A;  2AWO A;  3JAM c;  3WWV A;  4EQ5 A;  2ASB A;  2KHI A;  2WAQ G;  3PV0 A;  2R93 G;  3MXN B;  3OTO L;  1G51 A;  1MJE A;  5LMN L;  2IHE A;  4PZ8 A;  1XNR Q;  2F4V L;  2CQO A;  2YV5 A;  4LUO A;  2NVT H;  3HOZ H;  3ULL A;  2I5H A;  3ULJ A;  4XTC S;  3S16 H;  4A3E G;  4DR5 L;  3HOU G;  1HZB A;  3CXC A;  3G48 A;  2HIV A;  2WB1 G;  4JI1 Q;  2F3I A;  1NBW A;  4GLA C;  3T1H L;  2D0O A;  1C7Y A;  2ZTE A;  1HNW Q;  2JA9 A;  1WOC A;  4DR7 Q;  1Q1B A;  3CCV A;  1VCI A;  3F2D A;  4DR5 Q;  2WB1 E;  1QVG A;  3I4M H;  4LUZ A;  1PHJ A;  2UUB L;  5LMU Q;  2PI2 E;  2LSS A;  1KRT A;  2BH2 A;  1NTG A;  2IX0 A;  4JI4 Q;  4WJ4 A;  1SRU A;  4OON A;  3HOU H;  3S15 H;  5LMN Q;  5FLM G;  1SRO A;  1EIY B;  4DR3 L;  3AEV A;  3TS2 A;  4Y52 H;  4DV3 L;  3PCO B;  4DV1 L;  4GOP B;  3UE1 A;  4BBR H;  4R4Q A;  3H0G H;  2I5L X;  3G4S A;  2VNU D;  1PH1 A;  3S2D H;  1KXL A;  2VUM H;  3I2Z A;  4LF6 Q;  1NMF A;  1IXR A;  3EN2 A;  4B3T L;  4R4I A;  4LFC Q;  3KFU A;  1TWG H;  1IZ6 A;  5IT9 c;  4DR3 Q;  3AYH B;  3F2C A;  3HOZ G;  2EIF A;  3PIO A;  3M3Y H;  4YWL A;  3U58 A;  2R92 H;  4A3D G;  2FXQ A;  1SLJ A;  1HR0 Q;  3CD6 A;  3A0J A;  5J3B A;  5LMU L;  4JI7 L;  3PUZ A;  4KHP Q;  3KOJ A;  1VQ4 A;  1XMQ L;  4LF9 Q;  5C4X G;  2AHO B;  2N8N A;  4KHZ A;  1EYG A;  1W3S A;  3RLN A;  3HKS A;  3W1B A;  4A3M H;  2OTL A;  1I6H H;  1E1O A;  1KL9 A;  3STB C;  4HID A;  1PH5 A;  2VL6 A;  1LTL A;  2K50 A;  1M1K C;  2Q2T A;  1L1O C;  5FJ8 H;  4DR7 L;  1VQA A;  4B3M L;  1IBK L;  4A93 G;  2B63 H;  3M4O H;  5IP7 H;  4OX9 Q;  1Y1V H;  3SGI A;  4P74 A;  1GKH A;  1HNZ Q;  4A4I A;  3TRZ A;  3PUY A;  4TVA B;  4L5S A;  3S1N H;  1XPR A;  4DV6 L;  2UU9 L;  2OCE A;  3K0X A;  1Q8K A;  3MEF A;  1I5F A;  2Q2U A;  1VQ8 A;  1VQI A;  2WAQ E;  2JA8 H;  1JJG A;  1LUZ A;  4LF6 L;  5C44 H;  2L15 A;  2PMZ E;  4IJL A;  1OXU A;  3PF5 A;  2R7Z H;  4BY7 H;  1OXS C;  4KI0 A;  4JI6 Q;  2KCM A;  5K36 G;  1YHQ A;  1WI5 A;  1TXY A;  1VQL A;  1Q1E A;  2HT1 A;  4L5Q A;  1QZH A;  3PGZ A;  4TQU S;  5HY6 A;  4IFD I;  1WJJ A;  1U0L A;  3JAM i;  2VQF Q;  2JEB I;  3HOX H;  4JI0 L;  4JOI A;  4DV1 Q;  4P75 A;  2QGQ A;  4LFA L;  1KHI A;  2DGY A;  2F52 A;  3RLO A;  4BA1 I;  4DV4 L;  3HOW G;  1HNZ L;  4B3R Q;  2PQA B;  1HJP A;  3BZK A;  3S24 A;  4PZ6 A;  5IWA L;  4HJA A;  2NN6 G;  3CCJ A;  4LWC A;  1B7Y B;  5GAD C;  4UPA A;  1QVF A;  3W5O A;  4A3I H;  2IY5 B;  1NE3 A;  3AFQ A;  4GKJ L;  2JEA I;  4QGU A;  1CSQ A;  2K5V A;  1OXT A;  3M4P A;  1Q81 C;  1V43 A;  3I56 A;  4DV7 L;  2GN5 A;  2BA1 A;  2E8G A;  1I50 H;  3H0G G;  3OYY A;  4GOP A;  4A3C H;  2N49 A;  3CCM A;  1LM0 A;  2KHJ A;  1TWH H;  4A3L G;  2C35 B;  2YTV A;  2RHQ B;  4A76 A;  4A3C G;  4A3F G;  2Z0S A;  4DV6 Q;  2UU9 Q;  1A63 A;  3KJO A;  5IYD H;  3BU2 A;  1N34 L;  3CMA A;  2QEX A;  1GM5 A;  1N8R C;  4IOA A;  4AH6 A;  1K8G A;  1QUQ A;  1PH7 A;  4JI2 Q;  4X65 L;  2ZJP A;  3AFP A;  4DR6 L;  1PYB A;  4LF7 L;  1MIU A;  1WCM H;  1EIF A;  4A3I G;  4IFD J;  4HJ8 A;  1L1O B;  4OWT B;  1K83 H;  1Y14 B;  4P73 A;  4YCW A;  2Q2I A;  3KF6 B;  1XPO A;  2YTY A;  4A3L H;  1WCM G;  4K0K Q;  4A3M G;  3I4N G;  5C3E G;  5IYB G;  4IO9 A;  4BBS H;  4HJ5 A;  1R9T H;  2ZJQ A;  1B8A A;  2A1A A;  3ULP A;  1J5E L;  2I0Q A;  4OWW B;  1YNX A;  1PH8 A;  1S72 A;  3PO3 H;  4BBR G;  4JCV E;  3CCR A;  5M3F G;  1YJ9 A;  3JC6 6;  2BH8 A;  1XJV A;  1OXX K;  2V1C C;  1Y1W G;  1HNW L;  3PO2 G;  3M4Q A;  1WYD A;  4GLX A;  4X6A H;  5FLX c;  5IE8 A;  2HIX A;  4H02 A;  5ELN A;  5GRO A;  1L0W A;  4GN4 B;  1YJN A;  2LXK A;  1VQK A;  4JI2 L;  2NVY H;  4R4T A;  4GOP C;  3HOY G;  4UP7 A;  3H3V I;  2I5M X;  3GD7 A;  4GN5 A;  1V1Q A;  4WJ3 M;  3PF4 A;  4YCU A;  3PO3 G;  1Z47 A;  1XNQ Q;  4P72 A;  3L0O A;  2RHS B;  1UWV A;  4UP9 A;  2A8V A;  1TWC H;  1GD7 A;  4GS3 A;  1HR0 L;  3CCE A;  3GTM H;  5BR8 Q;  3K8A A;  4YY3 Q;  1PH6 A;  4DR1 L;  1YZ6 A;  3OTO Q;  4DV2 L;  4X66 L;  4DKA C;  3NEL A;  1TWA H;  1VS0 A;  3GO5 A;  4YCV A;  1VQO A;  3KJP A;  4DR2 Q;  4B3S Q;  1O7I A;  1EQQ A;  1UE6 A;  3A5U A;  4L5R C;  4IPG A;  2OTJ A;  1N9W A;  1SN8 A;  1YEZ A;  3J81 i;  4QY7 A;  4DV0 L;  4UY8 C;  1EOV A;  3W1G A;  4OO1 G;  1OXV A;  4DNI A;  3HOY H;  1D8L A;  1HH2 P;  3CW2 C;  2R7D A;  2ZTC A;  4NPS A;  1I94 Q;  3ERS X;  1XMQ Q;  1SR3 A;  2B63 G;  4LFB Q;  4DR4 Q;  3GTK H;  2HHH L;  2NVX H;  4PMW A;  4JI0 Q;  4BXX H;  4JG2 A;  4A3K G;  1K8A C;  2R93 H;  3G6E A;  4JBW A;  4DV0 Q;  2E5L Q;  2VQE L;  2HQL A;  1IBL Q;  1N33 Q;  1VQG A;  1E3P A;  1KRS A;  3F1Z A;  3H15 A;  1P8L A;  1E22 A;  5IYC G;  4JI1 L;  4JI5 L;  4A3F H;  4R4O A;  3E9H A;  4BXX G;  4BY1 G;  2JQO A;  1K9M C;  4B3S L;  1E24 A;  1M90 C;  4QIW E;  1NY4 A;  1YBY A;  3VDY A;  4A3B H;  4X65 Q;  4DR6 Q;  1QUQ B;  2KCT A;  2UUC Q;  4MNO A;  4LF8 L;  1EFW A;  5EAY A;  1XNR L;  4IPC A;  5HGQ A;  4X64 L;  4A3G H;  4DR1 Q;  3CME A;  3RR5 A;  4YY3 L;  2D0P A;  1UEB A;  4GNX C;  1T9H A;  4JI8 L;  4R4C A;  4HJ9 A;  3KLW A;  1SFO H;  1A8V A;  2BA0 A;  2Y0S G;  2Z6K C;  3U4Z A;  5M5W H;  2UXD Q;  1AE2 A;  3HOV G;  2AMC B;  3HFZ B;  3I4O A;  3UDI A;  1JMC A;  3NBH B;  5GAE C;  2VZA A;  4HJ7 A;  3A74 A;  3T1Y L;  4A3J H;  1X55 A;  3I4M G;  4LF5 L;  5IP9 H;  1VQ7 A;  1RIP A;  4JI3 L;  4PZ7 A;  4AYB G;  5C0X I;  1FJG Q;  3HOX G;  4AQY L;  1BVS A;  1BBU A;  3J81 j;  5JJI A;  2UXC L;  1GO3 E;  1UE7 A;  5C4J H;  3RN2 A;  3K7A H;  4QL5 A;  3KF6 A;  1CKO A;  1SMX A;  3NEN A;  4LFC L;  4C3H H;  2VQF L;  4YHH L;  2UUA Q;  2CFM A;  4IPH A;  2E2H H;  4GKK L;  1JE5 A;  4LUV A;  5C0X G;  1IBM L;  3CP0 A;  2JK8 A;  4DV3 Q;  2KEN A;  1W2B A;  2VY3 A;  1HNX L;  1N34 Q;  2IX1 A;  1E1T A;  2VQE Q;  5IP9 G;  2PI2 A;  4A3E H;  3CC4 A;  1X9N A;  3BZC A;  5AJ3 L;  5IYB H;  4X62 Q;  4DV5 Q;  1Q12 A;  1XNQ L;  4A93 H;  1KIX A;  1FJG L;  1VQ5 A;  1CKN A;  3PO2 H;  2ALY B;  4JI3 Q;  2JA7 H;  4JBM A;  1FGU A;  4IOC A;  3E0E A;  4HIK A;  3L7Z C;  3T1Y Q;  1N36 L;  3STB D;  4B3M Q;  4HIO A;  1ASY A;  3Q8D A;  4GKJ Q;  1NMG A;  1Y1V G;  3B6Y A;  5M3M G;  2HHH Q;  3S1R H;  3S17 H;  3F2B A;  4UP8 A;  2ZJR A;  4A3D H;  1QZG A;  1X6O A;  4JBJ A;  4J15 A;  3HKZ E;  4IPD A;  1PH4 A;  3FP9 A;  4P71 A;  1S3O A;  5GAG C;  2ZTD A;  1S40 A;  4BY1 H;  1PH3 A;  1JT8 A;  4DV2 Q;  4MZ9 A;  3CF5 A;  3TS0 A;  3GTL H;  2VUM G;  4LFA Q;  5LMN W;  2XGT A;  5AJ3 Q;  2OQK A;  1J6Q A;  1PH9 A;  3J7Z C;  4GNX A;  1MJC A;  3CCL A;  4LF8 Q;  3TQY A;  3E9I A;  1LYL A;  3U4V A;  4GKK Q;  2WP8 J;  5C3E H;  4YHH Q;  2UUA L;  2N78 A;  4PG3 A;  3K81 C;  4DUY L;  1IBM Q;  2JJQ A;  1XMO L;  4JI5 Q;  1YJW A;  2R92 G;  3F8T A;  2K5N A;  3RN5 A;  3KDF B;  1C9O A;  1IBL L;  4LW1 A;  1CKN B;  1I3Q H;  3EBE A;  3KF8 B;  3PUV A;  2Z6K A;  3HOW H;  1G29 1;  4JOI C;  3IRB A;  5JEA G;  4JV5 L;  5C4X H;  4L5T A;  3CCQ A;  1MKH A;  4RMF A;  4LFB L;  1Q7Y C;  3HKZ G;  4AYB E;  2AWN A;  2UXB Q;  1VQP A;  3UDX A;  3G71 A;  2K5H A;  3J80 c;  3DLL A;  4LF5 Q;  1L1O A;  1KAW A;  4DPG A;  1SE8 A;  1P16 A;  4A3J G;  4OXP A;  5H1S E;  2AKW B;  1X3F A;  1U5K A;  1N36 Q;  4POG A;  2JA8 G;  2KBN A;  1CKM A;  4O0A A;  1VQ9 A;  2Y0S E;  1E7Z A;  2A19 A;  4RG1 A;  4DAY B;  2YYZ A;  4HIM A;  5GQO A;  2RCN A;  4LF9 L;  1V9P A;  3GTP H;  4KHP L;  1B70 B;  4JC0 A;  3PUX A;  3D31 A;  4JV5 Q;  3CCU A;  5JJK A;  4FDB A;  5FJ8 G;  2IT1 A;  3ER0 A;  3M9B A;  1A0I A;  2CWP A;  3GTJ H;  5JEA J;  2JA5 H;  1Q86 C;  2UUC L;  3GTO H;  3RZD H;  3S1Q H;  4DAM A;  3PIP A;  2NZH A;  5IYC H;  4KLK A;  2UXC Q;  2ZM6 L;  1UE5 A;  4OO1 I;  2PQA A;  3BJU A;  3CPW A;  4DUZ L;  4GN3 B;  2NN6 I;  1BBW A;  1PFS A;  2N3S A;  3J7A 5;  4A3B G;  1HZA A;  3CQZ H;  2YTX A;  3GDE A;  1A62 A;  1K0R A;  5M3F H;  1HR0 W;  2R7F A;  2UXB L;  3K7U C;  4B3R L;  1K3R A;  2MFI A;  1FL0 A;  3NEM A;  3J80 i;  4DV7 Q;  1X3E A;  4DUZ Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...