5IWAQ

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the ge81112 peptide antibiotic
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords 30S ribosomal protein S2
publication title Inhibition of translation initiation complex formation by GE81112 unravels a 16S rRNA structural switch involved in P-site decoding.
pubmed doi rcsb
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5iwaQ00
1SN8A 3J81i 2R7FA 3KOJA 2A8VA 4BXXG 4HIKA 4LW1A 1S40A 2YU9H 3GTPH 2UUCL 2LXJA 4LUOA 2E2HH 1Z47A 4YWLA 2YTXA 2ZJRA 4IPHA 1SRUA 2DGYA 4IPGA 3RNUA 1HR0Q 1G291 2FXQA 4EX5A 4DR6Q 5LMUL 3PCOB 2JA6H 3HOUG 5LMNL 2VZAA 4KLKA 1TWFH 1YVCA 4QL5A 4JI1L 4JBKA 4P73A 3DM3A 4GOPC 1HZ9A 1KXLA 3K80C 3L2PA 3HOWH 3M3YH 2WB1E 3E9HA 4LNQA 1BBWA 3T1HQ 3J7A5 2R7DA 4DK3C 2VS1A 3PF5A 2Y0SE 3STBC 2N8NA 4IPDA 3ULPA 5LMNW 1JJGA 3OW2A 4LUZA 4A3BH 1VQHA 2JK8A 2E5LL 5IE8A 4A3FG 2N49A 3ERSX 3A0JA 4H02A 5C3EG 3IRBA 4PZ8A 2BH8A 1O7IA 2WAQG 4NPSA 1OXSC 5C0XI 1W2BA 2RF4A 3G48A 1UEBA 1XPOA 3BZKA 5IYBH 3JAMi 3UDGA 1XPRA 1HR0L 1VQ7A 4DR6L 3W5OA 1VQLA 4APVA 1Q81C 2JA6G 4A93H 2NN6G 1GD7A 1PHJA 1UE7A 2IHEA 3G6EA 4JOIA 3AYHB 1QUQB 3U4ZA 3PO3G 3KFUA 3ZJYC 4IFDJ 3HOWG 1N34L 3T1HL 2UXDQ 3CAMA 5IYCH 4OONA 1HR0W 4HJ7A 3K8AA 5DLQE 2ZJQA 1NBWA 4HJ8A 2KCMA 1CKNB 1UWVA 2KHIA 4DR3Q 2JA8H 4A3LH 3I2ZA 1FL0A 4AH6A 2JEBI 1HNXQ 1KL9A 3GTJH 2LXKA 1X9NA 4EQ5A 3KF6B 1TWGH 1PH7A 4OWWB 1GKHA 3FKIG 4UP7A 3I4OA 4L5SA 1L1OB 4A3GH 2KCTA 4QJFA 3RN5A 1TWCH 2WP8J 4C3HH 3T1YQ 1VQMA 1WJJA 4DNIA 1Q1EA 3GDEA 1SE8A 3J7ZC 1X55A 2Z6KC 3UE0A 4HIMA 1G6PA 2B63H 2K5HA 5HGQA 4AQYQ 1XNQQ 4GOPA 1I3QH 4IJLA 2UXDL 2A1AA 1I6HH 4YCUA 4YCWA 5IYCG 3FP9A 1HZAA 1Q46A 4DR3L 1I5FA 2NVQH 3BU2A 1PH4A 4PZ7A 2R7ZG 1VQDA 2JA8G 2HT1A 3H3VH 1HNXL 2VUMH 1QVFA 1I94Q 2LSSA 4YWKA 3S24A 1NE3A 2B3GA 4GN5A 2YYZA 3GTMH 3W1BA 4RMFA 1VQNA 3KF8B 4GLAC 1N8RC 2BA1A 3CCSA 4ME3A 1BKBA 1RIPA 2PI2E 1W3SA 1PH3A 3L7ZC 1Q1BA 3U4VA 4A3GG 2BH2A 1AH9A 2PQAB 2I5MX 1XTDA 4A3IG 3AFPA 3WWVA 4GKKL 2YTVA 2YTYA 1Z9FA 3F2DA 2NVYH 2UU9Q 4POFA 5IY0A 1YJ9A 1X3GA 4XTCS 1L0WA 2PI2A 4JI8Q 3PGZA 3D31A 4YHHQ 2YV5A 3CW2C 4AQYL 1XNQL 3D0FA 3M4OH 1E3PA 4J15A 5FLXc 3CC4A 3HKZE 4OXPA 3HOXG 1X3FA 3A5ZB 1JMCA 4JI2Q 2ALYB 3GO5A 3RLOA 4DV6Q 1VQAA 1QZGA 4O2DA 3S17H 1E1OA 1T9HA 4LF6L 1Y1WH 2EQSA 3M4QA 4IOAA 4B3TQ 3HFZB 2EXDA 1I94L 2R92G 2GN5A 4X65Q 2VUMG 1CKMA 4POGA 1JT8A 2ASBA 2ZJPA 4K0KQ 1OXUA 1WCMG 1SFOH 1E1TA 2F52A 5GAGC 5M5XH 3S1NH 2ID0A 1VQJA 1L2FA 1VQ9A 3CXCA 1HZBA 4A76A 1EWIA 1VQIA 1PH6A 3M7NA 2UU9L 4PMWA 3TS0A 4YCVA 4JI8L 4YHHL 4R1JA 1JE5A 1YNXA 2Z6KA 2JA5G 1FVIA 1Q86C 1MJCA 2RHSB 1S72A 4DAMA 4LFAQ 3GTKH 1B7YB 2K52A 4JYAQ 4HJAA 1M90C 4JI2L 1GO3E 2E2JH 2RHQB 4DV6L 1K8AC 3I4MH 3E0EA 1R9TH 5M3FG 3NEMA 1N33Q 5M5YH 1K8GA 4GNXB 1MIUA 4NXNQ 5HY6A 1YBYA 1Y1WG 4B3TL 3PO3H 4JBWA 5GQOA 5GAHC 1JJ2A 2K5VA 2OQ0A 1YJWA 4R4OA 1QVCA 4MNOA 4X65L 1VCIA 2K14A 2AWNA 1MKHA 4K0KL 3CP0A 2VQFQ 1CKOA 3A5UA 2Q2TA 1CSPA 1U0LA 4LFBQ 4DV7Q 1K3RA 2KHJA 2CCZA 2V1CC 1NJIC 2IY5B 3KDFB 4AYBE 3UDXA 1E22A 2ATWA 3HOZG 4X62Q 4LF7Q 4YY3Q 4KHZA 2B29A 2Z0SA 3FKIH 3I56A 4A3KH 5BR8Q 1JB7A 1SMXA 3CCJA 4LFAL 2IX1A 2CWAA 1VQCA 1PH2A 4JYAL 3CCLA 4DR5Q 1EUJA 3CF5A 2UUAQ 4LFCQ 2HHHQ 3I4MG 2EIFA 1NY4A 1X65A 3F8TA 1N33L 4A3CG 1D7QA 3E9IA 1CKNA 4NXNL 3CD6A 3DLLA 1U5KA 5ELOA 1IBKQ 4DUZQ 1EYGA 4JI4Q 2WB1G 1VQKA 4IJHA 1Q12A 1XMQQ 4JI5Q 5C4XH 3CC2A 1VQOA 2CWPA 2VQFL 3GTGH 3M9BA 2CFMA 5EAYA 4B3RQ 3GTQH 5JJIA 2Y0SG 4LFBL 3CMEA 4A4IA 2R7ZH 1J5EQ 4BBSH 5JJKA 1SR3A 1N36Q 4DR2Q 4JCVE 2ZTEA 3L0OA 4AYBG 3GTOH 4P72A 2MO1A 1CUKA 4OWTB 4X62L 2MQHA 2HIVA 4LF7L 3RN2A 1PH9A 5J3BA 1Q82C 4IFDI 1PV4A 1B8AA 4DPGA 5BR8L 2K75A 3CMAA 2JA5H 2JA7H 4A3KG 1YHBA 4IPCA 4KI0A 1VQ8A 1S3OA 4B3MQ 1VQEA 3RZDH 3MXNB 3PF4A 2F4VQ 4DR5L 2UUAL 4LFCL 4ALPA 4C3JH 4A3IH 1KC8C 4QGUA 2HHHL 3S14H 1YIJA 1EQQA 3G71A 4LF5Q 2CQOA 5FLMH 4DUZL 1IBKL 1PFSA 4JI4L 4UY8C 3S2HH 4BBRH 1OXVA 1PA6A 4JI5L 1XMQL 3HOXH 3PO2H 1TWAH 3S15H 1X54A 4X64Q 2VW9A 3OYYA 3HOYH 4WJ4A 4Y52H 5C4XG 1OTCA 4B3RL 3VDYA 3ULJA 4JBMA 4IO9A 4OO1I 1N9WA 4DR4Q 2IX0A 1J5EL 3S2DH 4A3MH 1N36L 1CSQA 4DR2L 4BBSG 3ULLA 1NMFA 2R92H 4QQBX 1SLJA 3OTOQ 1LUZA 1FGUA 4HIOA 1HNWQ 3KJPA 1N32Q 1WCMH 2VY3A 5IP9H 4B3ML 2VQEQ 3F2CA 2JA7G 4A3EH 4NXMQ 3I55A 2F4VL 4TVAB 4X66Q 3T1YL 4DR7Q 2XTIA 4GS3A 4DV0Q 1HZCA 4JC0A 3M85A 1IL2A 3PV0A 4LF5L 1VQFA 1LYLA 2F3IA 4DV4Q 1LTLA 1M1KC 2JA9A 5FLMG 1SROA 2MNAA 4BBRG 1AE3A 2AKWB 5IP7H 4X64L 1TXYA 3F2BA 3CCVA 3PO2G 4GOPB 1K0RA 2C35B 5E7NA 1AE2A 3EIVA 5M3FH 3HOYG 4MTNA 4DR4L 4GN4B 4UP8A 4PG3A 4JI0Q 4JG2A 5K36G 2CKZB 2AMCB 4A3MG 4GKJQ 3TS2A 5C44G 3OTOL 3S1MH 1IZ6A 1WFQA 3J80c 5C0XG 1HNWL 3AEVA 1N32L 1KAWA 2D0OA 1WYDA 1X56A 1EIYB 5IP9G 2VQEL 1L1OC 1YZ6A 4NXML 4X66L 4A3EG 2QGQA 4DR7L 1KRTA 5GROA 4DV0L 2N78A 2D62A 3HOZH 1VS0A 3AFQA 2I5LX 3CQZH 3PUVA 4R4IA 2NVXH 4DV4L 1E24A 3FHWA 5GAEC 4DV2Q 3RZOH 5JJLA 1IXRA 1X3EA 2K50A 3HKZG 5IP7G 1KRSA 3PUYA 3PUXA 3K7UC 5M5WH 2ZTDA 4A3CH 2K4KA 1HH2P 3UDFA 4JI0L 4JI6Q 2E2IH 2KBNA 2PNHA 4GKJL 2AHOB 1A0IA 4R4TA 4R4CA 3MEFA 1WI5A 3BJUA 1X6OA 4P74A 3GTLH 4JBJA 3H0GG 1PH1A 4L5RC 2VNUD 4UP9A 3PIOA 4YWMA 3K81C 4LF9Q 2WAQE 4BY7G 2WFWA 3CCRA 4GLXA 2N3SA 4A3JG 1JJCB 4C2MH 3KYHC 1GVPA 3RR5A 1QUQA 4DV2L 3J81j 1KIXA 1FJGQ 4OO1G 4RG1A 5FJ8H 4WJ3M 1N34Q 1MJEA 4XIGS 4DKAC 4DUYQ 4PZ6A 4JI6L 1B70B 4MZ9A 3SGIA 5IT9c 5C0XJ 1EFWA 3HKSA 4TQUS 3NELA 3TREA 4JI3Q 5IYDH 1C9OA 2HIXA 3RLNA 4P71A 4DAYB 2A19A 4Y7NH 3KF6A 1V9PA 2NVTH 3ER0A 1Y1VH 3U58A 1Y14B 1PYBA 4DV7L 1C0AA 3LGJA 4LF9L 2NZHA 1L1OA 3H3VI 3UE1A 4DV5Q 4BY1H 1J6QA 2L15A 3NENA 4A75A 3F1ZA 2JJQA 4YY3L 5ELNA 1K9MC 5M3MH 3J81c 5AJ3Q 2Q2IA 1A8VA 3CCMA 1FJGL 5JEAG 3M4PA 3UDIA 2UXCQ 1KHIA 2MFIA 1BBUA 4LF8Q 2OCEA 1VQ5A 2NZOA 4L5TA 1IBMQ 1Q8KA 5FJ8G 4A3DH 4GNXC 1VQPA 4DUYL 4B3SQ 1XNRQ 1G51A 4IOCA 3HOVH 5IWAQ 3BZCA 4DV1Q 2PMZE 3TQYA 2R6GA 2VL6A 4DV3Q 4JI3L 3NBHB 2MO0A 4QY7A 4JI7Q 5IYDG 1A63A 4P75A 3J80i 4FDBA 4DK6C 4A3BG 1NMGA 4OX9Q 1C7YA 3JC66 1ASYA 2R93H 1Y1VG 1I50H 1OXXK 2OQKA 4QIWE 1QVGA 1BVSA 1KD1C 4DV5L 2JE6I 1P8LA 3K7AH 5C44H 2PQAA 4L5QA 4BY1G 2GVBA 2UXBQ 2ZM6Q 3Q8DA 5IYBG 3CCUA 2JEAI 5C4JH 3RLFA 4GKKQ 5AJ3L 5M3MG 4DR1Q 2UXCL 1IYJB 2AWOA 4A93G 4LUVA 3AQQA 1IBLQ 4LF8L 1YEZA 3S1QH 1YI2A 1IBML 1DGSA 4NB3A 1XMOQ 2KENA 4KHPQ 4GLVB 4A3DG 4B3SL 2OWOA 1XNRL 1HNZQ 4JV5Q 3JAMc 2UUBQ 1XJVA 5IWAL 2Q2HA 4DV1L 3PIPA 3EBEA 3HOVG 3CC7A 2HQLA 1YJNA 4DV3L 3PUWA 1OXTA 4LF6Q 3B6YA 4JI7L 1Q7YC 1UE6A 1PYSB 3A74A 4R4QA 1K73C 2GVAA 2DUDA 4O0AA 1GM5A 4LF4Q 1E7ZA 4OX9L 4A3LG 1VQBA 3I7FA 2ZTCA 2NN6I 1YHAA 3I4NH 1PVOA 1YITA 2R93G 4LWCA 4OWXB 3STBD 3CCEA 2ES2A 2RCNA 4BA1I 4BA2I 4C3IH 1VQ4A 2UXBL 4X6AH 2ZM6L 2JQOA 5JEAJ 3H0GH 2OTJA 1TWHH 1EIFA 1D8LA 1VQGA 3U50C 3CPWA 4DR1L 1YHQA 1ASZA 4BXXH 5H1SE 2E8GA 3PUZA 2BA0A 2IT1A 4HJ5A 1PH8A 1IBLL 4BY7H 2B63G 2XGTA 2UUCQ 1XMOL 1PH5A 1KQSA 4KHPL 3PSIA 3TRZA 4A3JH 1HNZL 4JV5L 4AIMA 2UUBL 5GADC 1NTGA 1WOCA 3H15A 1EQRA 2OTLA 1K83H 1VQ6A 4GNXA 3HOUH 2IHFA 1QZHA 3EN2A 2Q2UA 2H5XA 3KLWA 5LMUQ 3TEHB 2D0PA 5LMNQ 1V1QA 4JOIC 1LM0A 4JI1Q 1A62A 3KJOA 4LF4L 1XPUA 2QEXA 3ICEA 4UPAA 3I4NG 4HJ9A 3K0XA 1HJPA 1V43A 1UE5A 4IFDG 2I5HA 3CCQA 3W1GA 2K5NA 3GD7A 1P16A 3KDFA 3S1RH 2I0QA 1H95A 3G4SA 1RL2A 4GN3B 4A3FH 3CPFA 1EOVA 2QA4A 2E5LQ 3S16H 4HIDA 5C3EH 1UE1A
chains in the Genus database with same CATH superfamily
4LW1A 1EYAA 2E2HH 5C5MA 1Z47A 1D1KA 4IPHA 1SRUA 2DGYA 1HUMA 2EYFA 4IPGA 2FXQA 4EX5A 1BXTA 1YVCA 4GOPC 1KXLA 2RSNA 3T1HQ 2H1EA 4DK3C 3FVQA 3HOZB 3SR1A 3PF5A 4H0LC 2N8NA 1D6EC 3HS0C 2Z8LA 2B2YC 4CGYB 5LMNW 1DD2A 4TKOB 1LT3D 4A3FG 2HCIA 2EYHA 2AQ2B 4FO2A 4KN4C 3H3VC 2E2IB 2RF4A 5C5LA 5BN3A 3UDGA 4ZUJA 3W5OA 1VQLA 3J7AF 2A68D 2NN6G 2HQEA 1GD7A 1UE7A 3E6ZX 4PQXA 4RHRA 1QUQB 4KKUA 1KABA 4FF3A 4IFDJ 3OIPA 1N34L 3DEOA 3MTSA 1JICA 3K8AA 2ZJQA 4HJ8A 2KHIA 2JA8H 1JC7A 3I2ZA 1YNJC 3GTJH 1MGSA 1O78A 4EQ5A 1DYQA 4OWWB 1FR3A 2ZXPA 3TP8A 2EY2A 2KCTA 1DOLA 2WP8J 4C3HH 3T1YQ 1K3BC 1Q1EA 3K0YA 4HIMA 2SOBA 1SMYC 1Y1VB 2K5HA 3NPPA 4X3UA 4L6TB 2UXDL 4ILWA 4ZRZA 5IYCG 4B9WA 1F9QA 5M3MB 2R7ZG 4K6DA 1HQRD 3SK4A 3W2DA 2F0KA 1QNUA 1LTTD 4B08A 4RAUC 4GLAC 3VYTA 1W3SA 1PH3A 1DCZA 3L7ZC 2IX3A 2BH2A 4GKKL 2YTVA 4XTCS 4AQYL 2V4DA 4YHHQ 1XNQL 4C1NK 4RCNA 3CW2C 1S5ED 3A54A 4XYOA 1SXTA 5C44B 3K7AB 3HOXG 4XQJA 3RLOA 2R61A 1E1OA 1EYDA 5J1ZA 3MZ5A 3SHLA 2K5QA 4X65Q 4I65A 2ZJPA 1EY4A 1WTRA 2VB2X 1QB5D 1ENCA 2K32A 4K5XA 1BNZA 2ID0A 1L2FA 5BN4A 2UU9L 4YCVA 3VR3A 4GZYC 2F0FA 2JA5G 5I2XA 2RHSB 3HG9A 2QW7A 1S72A 1GXDC 3E5SA 3T13A 4JYAQ 3LNNA 4C3IB 4HJAA 1M90C 4JI2L 2E2JH 2NN6H 5M3FG 3H0GB 1TS4A 5C6AA 4FF2A 2Z9HA 4JBWA 5GAHC 2OQ0A 1YJWA 4MNOA 4FF1A 1KLUD 4HTHA 4K0KL 3KK7A 1CT1D 2B2TA 2B39A 3P7JA 4LFBQ 1OO9B 1JORA 3C1EA 4DN4M 3KDFB 5JPNC 1Y8OB 2A69C 1BQQT 2PZWA 3I90A 1SJHD 1VQCA 5EPLA 2KUMA 3H09A 1EUJA 4Z9CB 3GQBA 2HHHQ 3I4MG 1AZPA 1N33L 4A3CG 2IPKD 1IL8A 5C3EB 2XN9C 3IFTA 5LHY1 2WB1G 2E2HB 3RUZA 4IJHA 1XMQQ 3KLSX 4JI5Q 3CC2A 1VQOA 2JSOA 5JJIA 3T4AC 5DEHA 2R7ZH 5JJKA 2IW3A 3SVMA 1TIID 3OMGA 3PO3B 4P72A 1ZYRD 4K5VA 3DHQA 1B8AA 2JA7H 4A3KG 3PIO3 4O1NA 1S3OA 4DR5L 2UUAL 3G71A 4S3SA 1IBKL 3S2HH 4JI4L 1AFPA 2F0VA 4XQQA 2ZT9C 3HOXH 3R3OA 3S15H 4X64Q 2WKCA 4B3RL 3ULJA 2IX0A 3DM1A 4OELB 1SSOA 3M7GA 4EQOA 2F0OA 5K36H 4BBSG 1NMFA 4XDXA 3ND8A 1TKWB 4ZK9B 1LUZA 1FGUA 4HIOA 2JN4A 4OGQC 3I70A 3KJPA 4DFAA 2VQEQ 5KEEA 2DY8A 2F4VL 4X66Q 4QCLA 4TRDA 3T1YL 2JA8B 3I4LA 5C3XA 4C3JG 4MTKA 4LF5L 1VQFA 1S5DD 3GTJB 1M1KC 4QUCA 1SROA 5EKIA 4ID6A 1LTSD 1YNND 5IP7H 2J0TD 1K0RA 2C35B 5E7NA 5M3FH 4C3HB 5LL6X 3MXUA 1B9MA 4A3MG 4GKJQ 1RTNA 3TS2A 3OTOL 1IZ6A 1HHVA 2QF7A 5CC4A 5IP9G 1B9NA 1YZ6A 1A3VA 2FINB 4CDEC 4DR7L 1KRTA 2DY7A 1GUTA 4DV4L 2VB3X 1O7YA 2SNMA 4HSVA 5ELDA 2G5DA 2DJFC 2K6AA 3K7UC 5M5WH 5CV4A 4A3CH 1LTID 1QE6A 3PIP3 1LTAD 1WD1A 2AHOB 1A0IA 3FMCA 4R4TA 3MEFA 1WI5A 3TBIB 2O5JC 3BJUA 4FVMA 4P74A 3C2PA 4IUPA 3BDCA 2KEDA 4O42A 3K81C 2WAQE 4J8QA 2N3SA 2KVMA 3A8JE 3DWQA 3Q0AA 1F2MA 1GVPA 2OT2A 3RR5A 5JEAH 4DV2L 3J81j 1A6XA 5FJ8H 2E2DC 4XQNA 5A2QE 1BBXC 5IT9E 4DKAC 4DUYQ 1HTPA 1C48A 2NVXB 3HKSA 2HUGA 1EU3A 4QUFA 3RLNA 1Z7TA 4P71A 4DAYB 3FPUB 3D4WA 1A3TA 5KNBA 3U58A 1EEID 1PYBA 2NTTA 1C0AA 1KDBA 2E2JB 3LGJA 4DGZA 2NZHA 4IUQA 4X3SA 4RGTA 3UE1A 2KQ3A 3MHBA 5ELNA 2ZXRA 3OMCA 1U4MA 1PRTC 2Y0SB 1KHIA 2F0UA 1BBUA 2KCNA 5FO9B 4L5TA 3E3XA 4IOCA 2FJ2A 1STEA 3TQYA 2R6GA 5CGKA 2D9UA 2MO0A 4JI7Q 5IYDG 1A63A 3C1FA 3J80i 1XWEA 1NMGA 3NBIA 4OX9Q 1XXGA 2K01A 1Y1VG 4JK1C 4KJNA 1BVSA 4CHTB 4L5QA 2J7ZA 5IGFA 1EIGA 1ML0D 3I8ZA 5J22A 2PW7A 4BWGB 4N8X1 5M3MG 1G2SA 4A93G 2AWOA 1M8AA 1IBLQ 1YEZA 3S1QH 1XMOQ 2R7ZB 1PRTF 1R4QB 4B3SL 1F9RA 2UUBQ 4DV1L 4HN7A 3EBEA 3TP6A 1OXTA 4LF6Q 1LTGD 1GUWA 4KY7A 2JA7B 1ILQA 4O0AA 4A3LG 1GM5A 1O80A 1SBBB 1PVOA 1YITA 3STBD 2ES2A 2F3WA 3LWEA 3S2HB 2UXBL 3VYSA 3HOXB 1VQGA 3OW7A 4DR1L 3NWTA 5H1SE 2Q8TA 3PUZA 2BA0A 3VR4A 1PH8A 2B63G 4KHPL 4JV5L 4ZQ3A 1BCPD 1NTGA 1WOCA 4N8FA 1EQRA 1K83H 2WIIB 2F0HA 2BOSA 1V1QA 4JOIC 1A62A 1MD2D 4LF4L 1XPUA 4M8AA 2WV6D 3K0XA 3S1RH 2CH4A 1TS2A 4C3IG 1RL2A 3CPFA 2BDNA 2Z6BA 3PQIA 1SN8A 3J81i 3KOJA 1JOKA 2R3ZA 5M3FB 2YU9H 2LXJA 3TZDA 3QJYA 2YTXA 5G3LF 4G7HC 1E2VA 2DNEA 3PCOB 2M9VA 5LMNL 4QL5A 4JI1L 4P73A 2DJGC 3DM3A 5F2DA 4ME5A 3M3YH 1PTOC 3K58A 3J7A5 1LTRD 4MN3A 4A3JB 2B2UA 2EPBA 4ZYSA 2B2VC 4I7AA 4R9WA 1VQHA 2E5LL 2AUJD 2N49A 4H02A 3NQTA 5C3EG 5M5WB 3IRBA 4PZ8A 1O7IA 2RDGA 4YIJA 2EDGA 4KY6A 1PMRA 5C0XI 2M00A 1XPOA 1XPRA 1XTCD 4C56C 5JVG3 3Q24A 1Q81C 1JWSD 4A93H 3P75A 2A6HC 1PHJA 3PO3G 3GTPB 2D5DA 2UXDQ 4RA8A 4MIUA 4WORA 5FK9C 1HR0W 1JE4A 5DLQE 2PNRC 1EY0A 1CKNB 1L0YB 4A3LH 1FL0A 1TWFB 2JEBI 2EY5A 2KOLA 5T1IA 2K28A 2NB0A 1PH7A 4K6LA 1LV9A 1WTQA 2G9HD 4QJFA 5KNDA 3RN5A 1O7LA 4DNIA 2IJ0A 3GDEA 1DONA 1NNXA 3J7ZC 2Z6KC 2B63H 1T5EA 4AQYQ 1XNQQ 3IFDA 1XX8A 1HPCA 4GOPA 2LFNA 4YCUA 1RJTA 1RCVD 4PMCA 3FP9A 4DAPA 1HA5A 4DR3L 2NVQH 2N88A 1PH4A 2JA8G 2B2YA 2HT1A 1HNXL 2VUMH 3H3VH 1KDAA 4RCOA 4YWKA 3S24A 1NE3A 2B3GA 3GTMH 3W1BA 5E3FA 1SNQA 4RMFA 3KF8B 4ME3A 1BKBA 1PFBA 4U68A 2E75C 1AH9A 2I5MX 1XTDA 3MC0B 2RA4A 1B3QA 1RF2D 2YTYA 2NVYH 2UU9Q 2A68C 1X3GA 1L0WA 2L0CA 3M4OH 4K8IA 3CC4A 3HKZE 4OXPA 4DXFA 4JI2Q 1UEAB 2ALYB 3DUZA 3GO5A 1VQAA 1QZGA 4O2DA 2CVRA 4JPBW 1PYWD 1T9HA 4LF6L 1Y1WH 2EQSA 3MVVA 5T1GA 3J80E 2EXDA 2IWHA 4DNRB 1I94L 2GN5A 3S1QB 1CKMA 1V1OA 4K0KQ 2SNSA 1SFOH 3QB3A 2F4IA 1D2BA 2F52A 5GAGC 3DXJC 1VQ9A 1PH6A 1EWIA 1HCZA 1QG7A 4PMWA 2K04A 4JI8L 2AUKA 2F0TA 2F0PA 5CV6A 1LT6D 1EIHA 1B7YB 2RCFA 1CK1A 5IOCA 1R9TH 1N33Q 1FNUA 3EA6A 1K8GA 1MIUA 1I4GA 4B3TL 3PO3H 5GQOA 1QVCA 2F0SA 2XWBB 2CQAA 3K5MA 1LT5D 2XWJB 5IODA 2Q2TA 5ELBA 1K83B 5D3IB 1U0LA 5I9PA 3SXHA 3P1HA 3NWSA 1BO0A 3K59A 2CCZA 1PFMA 2B29A 2RQXA 3I56A 1U4LA 1JB7A 1SMXA 4LFAL 2LS01 2EJFC 2F1MA 4OIKA 5COYA 3S1RB 3CCLA 1EWHA 4DR5Q 3EFXD 4ZLTF 2UUAQ 1UUPA 5IGDA 3F8TA 3K5LA 3E9IA 3DLLA 1GHKA 1IBKQ 1EYGA 1ET9A 4JI4Q 4H44C 2YU9B 1B2TA 4K8JA 1Q12A 5C4XH 3UI2A 2CWPA 2VQFL 3M9BA 2CFMA 4V190 3AB9A 4B3RQ 1DOMA 2Y0SG 4G7ZC 4A4IA 1W6JA 2K5DA 4JCVE 3L0OA 4FYDA 2N55A 2MO1A 1CUKA 2MUYA 4X62L 2DNCA 3ND9A 2HIVA 4LF7L 3M3YB 5J3BA 4IFDI 1SJED 5BR8L 2K75A 3FRPB 1VQEA 2F4VQ 1STAA 3J80L 3S14H 5KGUA 1YIJA 1EQQA 4K2LA 4LF5Q 5FLMH 3OHXC 4DUZL 1PFSA 3SEBA 3VR2A 1PA6A 4QF4A 3HOYH 5CV5A 4JBMA 1J5EL 3HEJA 1CSQA 4A93B 5EGTA 3SK6A 1SLJA 3OTOQ 3T16A 2PW5A 3X3NA 3N52A 1STBA 2JA7G 4A3EH 3I55A 1TQOA 4TVAB 1FYCA 4DR7Q 2XTIA 4GS3A 4LMQD 4N9TA 1HZCA 1IL2A 5FOBB 1DM0B 3OIQA 4DV4Q 2EVBA 2MNAA 2L11A 2L9HA 1AE3A 4HR7B 5M9OA 3F2BA 5I4DA 4GOPB 3EIVA 4MTNA 2XRSD 5K36G 1LLRD 2B63B 3S1MH 3J80c 1HNWL 1N32L 1ZYRC 4KN7C 1X56A 1EIYB 1L1OC 1AZQA 4NXML 1KDCA 5GROA 4DV0L 2NVQB 2N78A 1CFMA 3I72A 2NVXH 2I5LX 2VUMB 4R4IA 3GTMB 1E24A 5GAEC 4DV2Q 1EYCA 2K50A 5IP7G 3PUYA 2ZTDA 4WJWA 5D3DA 3J81L 3R2TA 2NVYB 3FPPA 4L63B 3M4OB 3GTLH 4KK7A 4JBJA 1SNOA 1PH1A 4L5RC 2VNUD 3NXWA 4PV1C 4ZAIA 1F77A 2KHSA 2K03A 3BVMA 1Y1WB 2WFWA 2TMPA 4A3JG 1JJCB 4C2MH 3GV3A 2F0GA 1H9MA 3E0JA 1CTMA 2J4XA 2JYOA 1B44D 1SFOB 1YNNC 4KHVA 1IKMA 4WJ3M 3C46A 2PZUA 1MJEA 4DAVA 5KNCA 1EFWA 1C9OA 2HIXA 1VF5C 3KF6A 1V9PA 4KMUC 3ER0A 1R9TB 3A7LA 4BY1H 1JWMD 1J6QA 2L15A 3NTKA 2F0NA 4P2CB 3J81c 1FJGL 2JXMB 5JEAG 1SYEA 2XIWA 3TMEA 5FJ8G 1ZEQX 4GNXC 4B3SQ 5JVH3 3BZCA 4DV1Q 2PMZE 4J1MA 2SEBD 1WD0A 1QNKA 4P75A 1JOOA 4QMGA 1PDQA 2RSOA 4DK6C 4A3BG 2K5WA 1C7YA 3JC66 2DN8A 1I50H 1D1IA 1OXXK 2OQKA 4QIWE 2JE6I 2PQAA 2PPBC 2UXBQ 5CBEE 5IYBG 3CCUA 5C4JH 5C4XB 5AJ3L 4DR1Q 1IYJB 3BYTB 4I7ZC 4LF8L 1UAPA 1IBML 1DGSA 2KENA 4KHPQ 4GLVB 4DF7A 4JV5Q 5JAVA 5IWAL 4G7OC 1A15A 2PYKA 2K33A 3K6OA 1TVXA 2HQLA 3CC7A 1BDOA 4DV3L 4QB4A 4HAEA 1GOZA 1PYSB 2VXWA 3A74A 1K73C 2GVAA 4LF4Q 1Y8PB 1E7ZA 2F0QA 2Z4HA 2NYZD 1YHAA 3S14B 3CCEA 3EROA 1VQ4A 2ZM6L 1JQYD 2JQOA 5JEAJ 2OTJA 3U50C 4CDFC 4BXXH 1EQVA 3HOYB 3A8KE 3BG3A 1ASZA 3BDLA 4NW2A 2E8GA 2MPMA 1KQSA 3PSIA 4A3JH 5GADC 3DWPA 1VQ6A 3HOUH 1G2TA 2Q2UA 2H5XA 3KLWA 1DZ1A 3TEHB 5LMNQ 1LM0A 4CDCC 4JI1Q 1MSGA 1SE3A 1ZXTA 1J9OA 3KJOA 4A3EB 1ILPA 1II3A 1CA6A 3ICEA 2LY7A 4UPAA 5KRUA 1V43A 5JOBA 2I0QA 1H95A 3G4SA 4GN3B 5IGEA 2E5LQ 1UE1A 2A8VA 3GTPH 1U9RA 2UUCL 2FMCA 4LUOA 3VA7A 5IGCA 2RDHA 5EPJA 4YWLA 3K57A 2ZJRA 1EY9A 2JP1A 1WTPA 3S1MB 3TZUA 5LMUL 2HDMA 2JA6H 3BS1A 1AN8A 4KLKA 1TWFH 4KJOA 1HZ9A 1HA6A 3K80C 3HOWH 2WB1E 2F0IA 2QCPX 2NUCA 2R7DA 4KV6A 4RWSC 4ZCKA 2VS1A 3STBC 3ULPA 1JJGA 2EJMA 4A3BH 1I4XA 2K1BA 3ERSX 3A0JA 3KBGA 3LWUA 3AU7A 2BH8A 3TSSA 3MXNA 3DMUA 1OXSC 1KNAA 3G48A 2I07B 1UEBA 3BZKA 5IYBH 1HR0L 1BCPC 2EYPA 3VA5A 1VQ7A 4DR6L 2A5HA 1SNDA 3GTLB 5J39A 1ESFA 3EVQA 5DM73 2IHEA 3G6EA 2K7VA 4JOIA 3AYHB 4DU9A 3BVZA 2IL8A 5JPMC 4L8JA 3CAMA 5D65A 1NBWA 4C2MB 1UWVA 4DR3Q 1EEFD 2CW0D 5FLXL 4CJ1B 1HNXQ 1Z6HA 5C3WA 3KF6B 1GKHA 3NUCA 1C4QA 2A6ED 3I4OA 4A3GH 5IIFA 3A7AB 1PTOH 1VQMA 1SE8A 1X55A 1G6PA 5HGQA 1NUCA 3OSOA 1I3QH 3R2IA 4BY1B 1I6HH 1I6VC 3D4DA 1Q46A 1I5FA 3BU2A 1ESRA 2B2VA 1K28A 1I4QA 1I94Q 1LTBD 3U9OA 4GN5A 2YYZA 1IYVA 1NR2A 2BA1A 2EXZA 1FNVA 4RKBA 1RIPA 2PI2E 2PMZB 4X3KA 1S5BD 3U4VA 1TY0A 2PQAB 3WWVA 1EOTA 3F2DA 1Z9FA 4RHSA 5IY0A 1YJ9A 4JI8Q 2PI2A 2BDOA 3PGZA 4R8IA 2YV5A 4QIWB 3K5NA 1I50B 3D0FA 1XYIA 1E3PA 4J15A 5FLXc 1SYFA 3MXPA 1ENFA 3S17H 4HSPA 5C4JB 2X6GA 4R8NA 4CJ2C 4KD3A 4B3TQ 3HFZB 2VUMG 3QG1A 5ELEA 3QOJA 1JT8A 4UDUC 2ASBA 1WCMG 1TT2A 1MBYA 2H4OA 3TN2A 5M5XH 1K0SA 4HMIA 2MHVA 1VQJA 1GUGA 2AQ1B 1EZ8A 3Q23A 4A76A 1GUNA 1VQIA 2EOTA 3KLRA 3CKIB 4R1JA 2Z6KA 1FVIA 1Q86C 1MJCA 4LFAQ 3GTKH 1KTKA 4MHEA 1PRTB 4KD4A 3H6MA 2PO4A 1GO3E 2RHQB 4DV6L 1K8AC 4UHVA 3NEMA 5M5YH 4DK1A 5I9OA 1YBYA 1Y1WG 1TU2B 3KLSA 5ELCA 1VCIA 2AWNA 1MKHA 3CP0A 1SE4A 2VQFQ 3HOUB 4DV7Q 2KHJA 4CKBA 1NJIC 3KUPA 4AYBE 1H9JA 1GHJA 2WKDA 1E22A 2ATWA 4X62Q 5KYLA 4LF7Q 1IKLA 4KHZA 5BR8Q 2IX1A 3OWEB 1PH2A 5I6YA 3TDQA 5EBDA 1TS5A 2G9DA 2Q8IB 1D7QA 4NXNL 3NBHA 1U5KA 4DUZQ 1F2LA 3EJIA 2WAQB 1QJOA 1B50A 1GUOA 1VQKA 2EZVA 2B8GA 1PTOF 5EAYA 4IQZA 3CMEA 1J5EQ 2JA6B 1IW7D 1WTHA 3GTOH 4B9XA 4OWTB 3HOWB 2A73B 3G6JB 1VMPA 2C5CA 1PH9A 1Q82C 2CHBD 1PV4A 1FNWA 1YHBA 3QOLA 4KI0A 4EGVA 1STHA 3RZDH 1KNEA 3MXNB 3PF4A 4LFCL 4ALPA 4V0BA 1KC8C 4RGMA 4A3BB 2L12A 1PXUA 3V05A 4BBRH 3VYRA 3SDZA 3PO2H 1X54A 3OYYA 5C4XG 1OTCA 3VDYA 1SYDA 4OO1I 1K8MA 1UNSA 2BE5D 2I46A 3S2DH 1N36L 4DR2L 3ULLA 4QQBX 5C0XH 3QR8A 1HNWQ 1N32Q 4CDDC 1F9PA 1WCMH 1JR0D 4B3ML 3F2CA 4NXMQ 3NK9A 1SYGA 3PMFA 1I4RA 4JW0A 4DV0Q 3QO2A 4JC0A 3M85A 4K2KA 3L9AX 4CKEA 1LYLA 2F3IA 1LTLA 4E6IA 2JA9A 5FLMG 1A2TA 1C8CA 2AKWB 1L0XB 1TXYA 1HXYD 3CCVA 4A3GB 5DAUA 3HOYG 3RMHA 1PTOB 3I3CA 1RHPA 4GN4B 4DR4L 4UP8A 2XVSA 3GP7A 4JG2A 2CKZB 5K5PA 3QIAA 1WFQA 2A74C 3VR5A 1I3QB 1KAWA 2D0OA 1WYDA 4F88A 1I6HB 1A2UA 1B4OA 2OEOA 4A3EG 2QGQA 3S9WA 2D62A 1VS0A 3PUVA 2EYJA 3D8GA 1QOHA 2E76C 1KAAA 5CV8A 3FHWA 4OO1H 3RZOH 1IXRA 1TR5A 1KRSA 3PUXA 5CBAE 3UDFA 1ICWA 2M2LA 4JI0L 2KBNA 2PNHA 4R4CA 1EL0A 1WTWA 1WTVA 3J7AV 4IN3A 4UP9A 4M1UB 4YWMA 2B2WC 3S17B 4BY7G 4F7XA 2X69A 1F9SA 1RODA 4NDXA 1X3QA 2AQ3B 3MA2B 3BZDB 1G91A 5LL6S 1FJGQ 5AFWA 1BF4A 3R93A 5M5XB 1MSHA 4XIGS 4JI6L 4KKTA 1B70B 4FF4A 1RTOA 3CQZB 4TQUS 3NELA 3TREA 2F03A 5FO7B 2RBMA 1ONLA 3GTKB 4Y7NH 2NVTH 4DV7L 4LF9L 1L1OA 4NMZA 5M5YB 1RDPD 4X3TA 2L55A 1V1PA 3J81E 3F1ZA 2JJQA 3P20A 1K9MC 3NTIA 3MFYA 4KKSA 3MWYW 2L4NA 5AJ3Q 3CCMA 1D5XC 2EYOA 4F87A 3M4PA 4LF8Q 1VQ5A 2NZOA 3D3RA 1IBMQ 1Q8KA 4A3DH 1JB3A 3BYYB 4AYBB 2EYMA 1G51A 3U9SA 3HOVH 3AMUA 5IWAQ 2XNAC 4DV3Q 4JI3L 3NBHB 4FXKC 4QY7A 1Y8NB 1PFNA 5EJWA 1ASYA 2R93H 1K8OA 1HTLD 1QVGA 1KD1C 3Q22A 4DV5L 1SDFA 1P8LA 4BY1G 1FGBD 2ZM6Q 3RD4A 3Q8DA 2JEAI 3RLFA 1PZID 3CU7A 2UXCL 3AQQA 1RKNA 2Z4IA 1YI2A 4NB3A 1M4VA 1XNRL 3GTOB 1XJVA 2NTSA 2CH4W 3PUWA 4UAIA 4C1NI 2SDFA 1Q7YC 1VDZA 4R4QA 5IGGA 3HP3A 2DUDA 3RZDB 1VQBA 1D5MC 4EQNA 3I7FA 2HDLA 2NN6I 2ZTCA 5EKLA 3I4NH 4IFDH 2RCNA 4BA1I 1H9RA 1CM9A 5L37A 4X6AH 4TSSA 4BBRB 1CI3M 4FXGC 3OPOA 1W6KA 5DNFA 1EIFA 1D8LA 3CPWA 3PO2B 4H7BA 5EBCA 1YHQA 1MHWC 2ICIA 5I2YA 2IT1A 4BY7H 2XGTA 2UUCQ 1PH5A 3R8BA 3S2DB 1HNZL 1EFID 3H15A 3D4RA 4GNXA 1ET6A 2EYLA 2IHFA 1QZHA 3VYUA 5LMUQ 3C3LA 1DJRD 4HEDA 1WCMB 2QDLA 3LX0A 4OIJA 3MFGA 4IUTA 1VMCA 4F8MA 2QEXA 4U673 4HJ9A 1HJPA 4IURA 1VF7A 1YNJD 1GUSA 4A3FH 1HQMC 4ABNA 1ENAA 3HKZB 4FNFA 1SEBD 1SAPA 3L3OC 4RFBA 1U4RA 2R7FA 4BXXG 4LK1C 4HIKA 1S40A 4K5WA 1BOSA 4JVZA 3OOCA 3RNUA 1HR0Q 1G291 4DR6Q 1FD7D 3HOUG 1SMYD 2VZAA 1TWHB 2WINB 4JBKA 1J8IA 4DAYA 3L2PA 2MGSA 2F0EA 5NUCA 3E9HA 4LNQA 1BBWA 4RGOS 4LAAA 3EQLC 1CQFA 2Y0SE 4IPDA 1CZWA 2MJ8A 3OW2A 4KY5A 4LUZA 2RDFA 2JK8A 5IE8A 3RZOB 2ZXOA 1CZGA 1SYBA 2KA7A 2WAQG 4NPSA 5E4WC 1W2BA 4XXEA 3JAMi 4OHJA 4PMBA 2L1BA 4APVA 2JA6G 3S16B 1EY7A 3WDNA 3U4ZA 3KFUA 2XRQD 3ZJYC 3HOWG 2RVLA 3T1HL 3HGBA 3NTHA 5IYCH 4OONA 2PCFB 3QWNA 4HJ7A 2KCMA 3M4YA 3BDOA 4AH6A 1HFNA 1KL9A 2FHTA 2LKVA 2LXKA 1X9NA 1SE2A 2EJGC 2TSSA 1TWGH 3FKIG 4UP7A 4ODGA 4L5SA 1L1OB 4KTAA 1TWCH 1WJJA 1V1PB 1B1ZA 3DEPA 3IKJA 3UE0A 5BN5A 4Y7NB 2NVTB 4NP5A 1QWYA 4G57A 3IAYA 2FMMA 4HCEA 4IJLA 5EQ0A 2A1AA 2KEEA 1E2ZA 4YCWA 1HZAA 1EY6A 2L5TA 1AW7A 4PZ7A 1VQDA 3TP7A 2O5IC 4ZKCB 2NBFA 1QVFA 2LSSA 1PZKD 5E1FA 2B2TC 4A3DB 2EE1A 3J7YW 1VQNA 1IHZA 1N8RC 3O13A 3CCSA 3HOVB 1QILA 1Q1BA 3WOFA 1T5XD 4A3GG 2F0LA 5JJZA 4A3IG 3AFPA 1I4PA 2A69D 4DNTB 4POFA 2JA5H 5FLXE 2R93B 3D31A 4FP5D 4RKLA 2NWGA 1Q3LA 5CR3A 1X3FA 3A5ZB 1JMCA 4DV6Q 4G4KA 3M4QA 4IOAA 1SNMA 2R92G 1JOQA 2CW0C 1I4HA 5E4XA 4Q0FA 1TY2A 4POGA 3T56B 1OXUA 4WFN3 1E1TA 1AEXA 2GA4B 2A6EC 1D5ZC 3S1NH 1BUVT 4CJ0B 3CXCA 1HZBA 3M7NA 1Q8IA 3TS0A 2FFKB 4YHHL 1JE5A 1YNXA 1A3UA 3GV6A 3I4NB 3DWAA 4DAMA 2KJXA 3BVGA 3MXGA 2BCOA 2K52A 2PZTA 1BR9A 1NSNS 3I4MH 3E0EA 4GNXB 4NXNQ 5HY6A 1JJ2A 5KIXA 5CYUA 2K5VA 1LO5D 4R4OA 4X65L 4BY7B 2K05A 2K14A 2RKSA 2X6LA 1CKOA 3A5UA 3ERQA 1CSPA 1K3RA 1LABA 2IY5B 2V1CC 1STNA 1QCBD 3UDXA 5A35A 2MP1A 3VR6A 3HOZG 1SYCA 1LACA 1GJXA 4YY3Q 2Z0SA 3W3AA 3FKIH 4A3KH 3CCJA 2CWAA 2QEJC 1CHPD 3NQIA 4JYAL 4J6HA 3CF5A 4LFCQ 3T51B 4A3FB 2EIFA 1NY4A 1X65A 3ONAB 1CKNA 3CD6A 5ELOA 2NZ1D 3HRZC 1PLFA 2QKIC 1RD9D 1X3PA 2XSCA 3GTGH 1JCKB 3GTQH 4LFBL 1LT4D 3MAQA 4BBSH 1U4PA 1CA5A 1SR3A 1N36Q 4DR2Q 1WVLA 2ZTEA 4AYBG 1ICFB 1PZJD 3NE5B 2MQHA 3RN2A 2F0JA 4DPGA 3CMAA 2C9OA 4B3MQ 4IPCA 3NSWA 4OL7A 1VQ8A 4A3IH 4C3JH 2HHHL 4QGUA 1EZ6A 3A55A 1BCPF 1IYUA 2CQOA 3NP8A 3Q6SA 1NAPA 4BS9A 4UY8C 4HMJA 1HUNA 2F0DA 1B3AA 1OXVA 4JI5L 3FEWX 1XMQL 4WJ4A 1TWAH 4RH6A 1STYA 1H9SA 2VW9A 4Y52H 3KF8A 1G6ZA 2WACA 3MEHA 2B8FA 4IO9A 1N9WA 4DR4Q 4A3MH 4IALA 2R92H 1EWCA 2VY3A 5IP9H 4XT3B 1H9KA 3JAME 1AP0A 3PV0A 5KYIA 4BBRG 1TWGB 5FKAC 5HURA 4X64L 1S5CD 1EU4A 5DM63 3PO2G 5ISRA 1AE2A 2EY6A 1WTXA 1TWCB 1E0BA 3OWFA 4PG3A 4Q5VA 4JI0Q 1KLGD 1DOKA 2AMCB 1IW7C 2HCCA 2Q8RE 3SK5A 5C4HA 5IGBA 5C44G 5C0XG 4IZ8A 2ICEC 3I91A 3AEVA 2D2CC 3S15B 1MI2A 4DXGA 2VQEL 5A2QL 4ZKBB 5IT9L 4X66L 1CHQD 4HCSA 3FDTA 3HOZH 3AFQA 3CQZH 2LMCB 5CV9A 1BCPB 1PRTD 5C4ZA 3NHHA 1DXMA 5JJLA 1X3EA 3HKZG 2F0WA 4EVOA 2K4KA 1HH2P 3F2UA 3WOEA 4JI6Q 2E2IH 2BE5C 2O4XA 4GKJL 3X3MA 4RGNA 2JA5B 1EY5A 3T53B 1X6OA 2E74C 1EY8A 3H0GG 5ELFA 4PNYA 1HRJA 3PIOA 3TP5A 1ZKOA 3K5OA 4LF9Q 4IUNA 3CCRA 4GLXA 3N6RA 4CBVA 3IL8A 2HD3A 4CKCA 3KYHC 1SNPA 1O7ZA 1QUQA 4XT1B 1KIXA 4OO1G 4RG1A 1Q90A 2OXPA 1CQVA 3S1NB 1N34Q 4LJZC 4PZ6A 4MZ9A 3SGIA 1X32A 5IT9c 4ZUIA 5C0XJ 4K14A 3CHBD 4XYQA 4JI3Q 5IYDH 5CV7A 2OF1A 2P5ZX 2A19A 3JAML 1B53A 1Y1VH 3D6CA 3V2TA 1Y14B 3I4MB 1JWUD 1SNCA 3V96A 4EQPA 3H3VI 2PQEA 4DV5Q 3NENA 2Z1CA 2KCCA 4A75A 2WB1B 4YY3L 1STGA 3HZXA 3SK8A 1R4PB 5M3MH 5G3LD 5FO8B 2Q2IA 1A8VA 4FXDA 2UXCQ 3UDIA 2MFIA 2OCEA 1NCVA 4IUVA 4N9PA 1VQPA 1S5FD 4DUYL 1XNRQ 2VL6A 1V8QA 3FKIB 4A3KB 1E2WA 2QDBA 3KBXA 4FDBA 5TSSA 5HGTA 2ENBA 2B2WA 3A8IE 3ITPA 5C44H 3K7AH 5EPKA 3H94A 1TS3A 2GVBA 1F2YA 2O2LD 1F2ZA 4GKKQ 3GTGB 2EY1A 4NKLA 4LUVA 5I6WA 3GTQB 2F0MA 4BBSB 3G7LA 4A3DG 5CMDA 2OWOA 1HNZQ 3JAMc 2Q2HA 3PIPA 3HOVG 1YJNA 4ULLA 3B6YA 4JI7L 1UE6A 4DK0A 3ZYYX 1PTOD 2KECA 4OX9L 4WRDA 2B2UC 4A3IB 4C3JB 1H9SB 1EQTA 2R93G 4LWCA 4OWXB 4BA2I 4C3IH 3H0GH 3H91A 3A56A 5CORA 1TWHH 4C3HG 1TWAB 1IBLL 4HJ5A 3I73A 1XMOL 4A3MB 2F3VA 3TRZA 2QILA 4AIMA 2UUBL 2R92B 2OTLA 5EKKA 3EN2A 1G8ZD 4IUUA 2A6HD 1HFGA 2D0PA 1WTOA 3CRLC 4H13C 1Y69U 3URYA 3I4NG 4IFDG 1UE5A 4DA2A 2I5HA 3CCQA 3W1GA 2K5NA 3GD7A 1P16A 3KDFA 1S4ZA 3CRKC 3D6WA 1NR4A 1EOVA 5D14A 2QA4A 3SE0A 4OEMB 4HIDA 5C3EH 3S16H
chains in the Genus database with same CATH topology
1SN8A 3J81i 2R7FA 3KOJA 2A8VA 4BXXG 4HIKA 4LW1A 1S40A 2YU9H 3GTPH 2UUCL 2LXJA 4LUOA 2E2HH 1Z47A 4YWLA 2YTXA 2ZJRA 4IPHA 1SRUA 2DGYA 4IPGA 3RNUA 1HR0Q 1G291 2FXQA 4EX5A 4DR6Q 5LMUL 3PCOB 2JA6H 3HOUG 5LMNL 2VZAA 4KLKA 1TWFH 1YVCA 4QL5A 4JI1L 4JBKA 4P73A 3DM3A 4GOPC 1HZ9A 1KXLA 3K80C 3L2PA 3HOWH 3M3YH 2WB1E 3E9HA 4LNQA 1BBWA 3T1HQ 3J7A5 2R7DA 4DK3C 2VS1A 3PF5A 2Y0SE 3STBC 2N8NA 4IPDA 3ULPA 5LMNW 1JJGA 3OW2A 4LUZA 4A3BH 1VQHA 2JK8A 2E5LL 5IE8A 4A3FG 2N49A 3ERSX 3A0JA 4H02A 5C3EG 3IRBA 4PZ8A 2BH8A 1O7IA 2WAQG 4NPSA 1OXSC 5C0XI 1W2BA 2RF4A 3G48A 1UEBA 1XPOA 3BZKA 5IYBH 3JAMi 3UDGA 1XPRA 1HR0L 1VQ7A 4DR6L 3W5OA 1VQLA 4APVA 1Q81C 2JA6G 4A93H 2NN6G 1GD7A 1PHJA 1UE7A 2IHEA 3G6EA 4JOIA 3AYHB 1QUQB 3U4ZA 3PO3G 3KFUA 3ZJYC 4IFDJ 3HOWG 1N34L 3T1HL 2UXDQ 3CAMA 5IYCH 4OONA 1HR0W 4HJ7A 3K8AA 5DLQE 2ZJQA 1NBWA 4HJ8A 2KCMA 1CKNB 1UWVA 2KHIA 4DR3Q 2JA8H 4A3LH 3I2ZA 1FL0A 4AH6A 2JEBI 1HNXQ 1KL9A 3GTJH 2LXKA 1X9NA 4EQ5A 3KF6B 1TWGH 1PH7A 4OWWB 1GKHA 3FKIG 4UP7A 3I4OA 4L5SA 1L1OB 4A3GH 2KCTA 4QJFA 3RN5A 1TWCH 2WP8J 4C3HH 3T1YQ 1VQMA 1WJJA 4DNIA 1Q1EA 3GDEA 1SE8A 3J7ZC 1X55A 2Z6KC 3UE0A 4HIMA 1G6PA 2B63H 2K5HA 5HGQA 4AQYQ 1XNQQ 4GOPA 1I3QH 4IJLA 2UXDL 2A1AA 1I6HH 4YCUA 4YCWA 5IYCG 3FP9A 1HZAA 1Q46A 4DR3L 1I5FA 2NVQH 3BU2A 1PH4A 4PZ7A 2R7ZG 1VQDA 2JA8G 2HT1A 3H3VH 1HNXL 2VUMH 1QVFA 1I94Q 2LSSA 4YWKA 3S24A 1NE3A 2B3GA 4GN5A 2YYZA 3GTMH 3W1BA 4RMFA 1VQNA 3KF8B 4GLAC 1N8RC 2BA1A 3CCSA 4ME3A 1BKBA 1RIPA 2PI2E 1W3SA 1PH3A 3L7ZC 1Q1BA 3U4VA 4A3GG 2BH2A 1AH9A 2PQAB 2I5MX 1XTDA 4A3IG 3AFPA 3WWVA 4GKKL 2YTVA 2YTYA 1Z9FA 3F2DA 2NVYH 2UU9Q 4POFA 5IY0A 1YJ9A 1X3GA 4XTCS 1L0WA 2PI2A 4JI8Q 3PGZA 3D31A 4YHHQ 2YV5A 3CW2C 4AQYL 1XNQL 3D0FA 3M4OH 1E3PA 4J15A 5FLXc 3CC4A 3HKZE 4OXPA 3HOXG 1X3FA 3A5ZB 1JMCA 4JI2Q 2ALYB 3GO5A 3RLOA 4DV6Q 1VQAA 1QZGA 4O2DA 3S17H 1E1OA 1T9HA 4LF6L 1Y1WH 2EQSA 3M4QA 4IOAA 4B3TQ 3HFZB 2EXDA 1I94L 2R92G 2GN5A 4X65Q 2VUMG 1CKMA 4POGA 1JT8A 2ASBA 2ZJPA 4K0KQ 1OXUA 1WCMG 1SFOH 1E1TA 2F52A 5GAGC 5M5XH 3S1NH 2ID0A 1VQJA 1L2FA 1VQ9A 3CXCA 1HZBA 4A76A 1EWIA 1VQIA 1PH6A 3M7NA 2UU9L 4PMWA 3TS0A 4YCVA 4JI8L 4YHHL 4R1JA 1JE5A 1YNXA 2Z6KA 2JA5G 1FVIA 1Q86C 1MJCA 2RHSB 1S72A 4DAMA 4LFAQ 3GTKH 1B7YB 2K52A 4JYAQ 4HJAA 1M90C 4JI2L 1GO3E 2E2JH 2RHQB 4DV6L 1K8AC 3I4MH 3E0EA 1R9TH 5M3FG 3NEMA 1N33Q 5M5YH 1K8GA 4GNXB 1MIUA 4NXNQ 5HY6A 1YBYA 1Y1WG 4B3TL 3PO3H 4JBWA 5GQOA 5GAHC 1JJ2A 2K5VA 2OQ0A 1YJWA 4R4OA 1QVCA 4MNOA 4X65L 1VCIA 2K14A 2AWNA 1MKHA 4K0KL 3CP0A 2VQFQ 1CKOA 3A5UA 2Q2TA 1CSPA 1U0LA 4LFBQ 4DV7Q 1K3RA 2KHJA 2CCZA 2V1CC 1NJIC 2IY5B 3KDFB 4AYBE 3UDXA 1E22A 2ATWA 3HOZG 4X62Q 4LF7Q 4YY3Q 4KHZA 2B29A 2Z0SA 3FKIH 3I56A 4A3KH 5BR8Q 1JB7A 1SMXA 3CCJA 4LFAL 2IX1A 2CWAA 1VQCA 1PH2A 4JYAL 3CCLA 4DR5Q 1EUJA 3CF5A 2UUAQ 4LFCQ 2HHHQ 3I4MG 2EIFA 1NY4A 1X65A 3F8TA 1N33L 4A3CG 1D7QA 3E9IA 1CKNA 4NXNL 3CD6A 3DLLA 1U5KA 5ELOA 1IBKQ 4DUZQ 1EYGA 4JI4Q 2WB1G 1VQKA 4IJHA 1Q12A 1XMQQ 4JI5Q 5C4XH 3CC2A 1VQOA 2CWPA 2VQFL 3GTGH 3M9BA 2CFMA 5EAYA 4B3RQ 3GTQH 5JJIA 2Y0SG 4LFBL 3CMEA 4A4IA 2R7ZH 1J5EQ 4BBSH 5JJKA 1SR3A 1N36Q 4DR2Q 4JCVE 2ZTEA 3L0OA 4AYBG 3GTOH 4P72A 2MO1A 1CUKA 4OWTB 4X62L 2MQHA 2HIVA 4LF7L 3RN2A 1PH9A 5J3BA 1Q82C 4IFDI 1PV4A 1B8AA 4DPGA 5BR8L 2K75A 3CMAA 2JA5H 2JA7H 4A3KG 1YHBA 4IPCA 4KI0A 1VQ8A 1S3OA 4B3MQ 1VQEA 3RZDH 3MXNB 3PF4A 2F4VQ 4DR5L 2UUAL 4LFCL 4ALPA 4C3JH 4A3IH 1KC8C 4QGUA 2HHHL 3S14H 1YIJA 1EQQA 3G71A 4LF5Q 2CQOA 5FLMH 4DUZL 1IBKL 1PFSA 4JI4L 4UY8C 3S2HH 4BBRH 1OXVA 1PA6A 4JI5L 1XMQL 3HOXH 3PO2H 1TWAH 3S15H 1X54A 4X64Q 2VW9A 3OYYA 3HOYH 4WJ4A 4Y52H 5C4XG 1OTCA 4B3RL 3VDYA 3ULJA 4JBMA 4IO9A 4OO1I 1N9WA 4DR4Q 2IX0A 1J5EL 3S2DH 4A3MH 1N36L 1CSQA 4DR2L 4BBSG 3ULLA 1NMFA 2R92H 4QQBX 1SLJA 3OTOQ 1LUZA 1FGUA 4HIOA 1HNWQ 3KJPA 1N32Q 1WCMH 2VY3A 5IP9H 4B3ML 2VQEQ 3F2CA 2JA7G 4A3EH 4NXMQ 3I55A 2F4VL 4TVAB 4X66Q 3T1YL 4DR7Q 2XTIA 4GS3A 4DV0Q 1HZCA 4JC0A 3M85A 1IL2A 3PV0A 4LF5L 1VQFA 1LYLA 2F3IA 4DV4Q 1LTLA 1M1KC 2JA9A 5FLMG 1SROA 2MNAA 4BBRG 1AE3A 2AKWB 5IP7H 4X64L 1TXYA 3F2BA 3CCVA 3PO2G 4GOPB 1K0RA 2C35B 5E7NA 1AE2A 3EIVA 5M3FH 3HOYG 4MTNA 4DR4L 4GN4B 4UP8A 4PG3A 4JI0Q 4JG2A 5K36G 2CKZB 2AMCB 4A3MG 4GKJQ 3TS2A 5C44G 3OTOL 3S1MH 1IZ6A 1WFQA 3J80c 5C0XG 1HNWL 3AEVA 1N32L 1KAWA 2D0OA 1WYDA 1X56A 1EIYB 5IP9G 2VQEL 1L1OC 1YZ6A 4NXML 4X66L 4A3EG 2QGQA 4DR7L 1KRTA 5GROA 4DV0L 2N78A 2D62A 3HOZH 1VS0A 3AFQA 2I5LX 3CQZH 3PUVA 4R4IA 2NVXH 4DV4L 1E24A 3FHWA 5GAEC 4DV2Q 3RZOH 5JJLA 1IXRA 1X3EA 2K50A 3HKZG 5IP7G 1KRSA 3PUYA 3PUXA 3K7UC 5M5WH 2ZTDA 4A3CH 2K4KA 1HH2P 3UDFA 4JI0L 4JI6Q 2E2IH 2KBNA 2PNHA 4GKJL 2AHOB 1A0IA 4R4TA 4R4CA 3MEFA 1WI5A 3BJUA 1X6OA 4P74A 3GTLH 4JBJA 3H0GG 1PH1A 4L5RC 2VNUD 4UP9A 3PIOA 4YWMA 3K81C 4LF9Q 2WAQE 4BY7G 2WFWA 3CCRA 4GLXA 2N3SA 4A3JG 1JJCB 4C2MH 3KYHC 1GVPA 3RR5A 1QUQA 4DV2L 3J81j 1KIXA 1FJGQ 4OO1G 4RG1A 5FJ8H 4WJ3M 1N34Q 1MJEA 4XIGS 4DKAC 4DUYQ 4PZ6A 4JI6L 1B70B 4MZ9A 3SGIA 5IT9c 5C0XJ 1EFWA 3HKSA 4TQUS 3NELA 3TREA 4JI3Q 5IYDH 1C9OA 2HIXA 3RLNA 4P71A 4DAYB 2A19A 4Y7NH 3KF6A 1V9PA 2NVTH 3ER0A 1Y1VH 3U58A 1Y14B 1PYBA 4DV7L 1C0AA 3LGJA 4LF9L 2NZHA 1L1OA 3H3VI 3UE1A 4DV5Q 4BY1H 1J6QA 2L15A 3NENA 4A75A 3F1ZA 2JJQA 4YY3L 5ELNA 1K9MC 5M3MH 3J81c 5AJ3Q 2Q2IA 1A8VA 3CCMA 1FJGL 5JEAG 3M4PA 3UDIA 2UXCQ 1KHIA 2MFIA 1BBUA 4LF8Q 2OCEA 1VQ5A 2NZOA 4L5TA 1IBMQ 1Q8KA 5FJ8G 4A3DH 4GNXC 1VQPA 4DUYL 4B3SQ 1XNRQ 1G51A 4IOCA 3HOVH 5IWAQ 3BZCA 4DV1Q 2PMZE 3TQYA 2R6GA 2VL6A 4DV3Q 4JI3L 3NBHB 2MO0A 4QY7A 4JI7Q 5IYDG 1A63A 4P75A 3J80i 4FDBA 4DK6C 4A3BG 1NMGA 4OX9Q 1C7YA 3JC66 1ASYA 2R93H 1Y1VG 1I50H 1OXXK 2OQKA 4QIWE 1QVGA 1BVSA 1KD1C 4DV5L 2JE6I 1P8LA 3K7AH 5C44H 2PQAA 4L5QA 4BY1G 2GVBA 2UXBQ 2ZM6Q 3Q8DA 5IYBG 3CCUA 2JEAI 5C4JH 3RLFA 4GKKQ 5AJ3L 5M3MG 4DR1Q 2UXCL 1IYJB 2AWOA 4A93G 4LUVA 3AQQA 1IBLQ 4LF8L 1YEZA 3S1QH 1YI2A 1IBML 1DGSA 4NB3A 1XMOQ 2KENA 4KHPQ 4GLVB 4A3DG 4B3SL 2OWOA 1XNRL 1HNZQ 4JV5Q 3JAMc 2UUBQ 1XJVA 5IWAL 2Q2HA 4DV1L 3PIPA 3EBEA 3HOVG 3CC7A 2HQLA 1YJNA 4DV3L 3PUWA 1OXTA 4LF6Q 3B6YA 4JI7L 1Q7YC 1UE6A 1PYSB 3A74A 4R4QA 1K73C 2GVAA 2DUDA 4O0AA 1GM5A 4LF4Q 1E7ZA 4OX9L 4A3LG 1VQBA 3I7FA 2ZTCA 2NN6I 1YHAA 3I4NH 1PVOA 1YITA 2R93G 4LWCA 4OWXB 3STBD 3CCEA 2ES2A 2RCNA 4BA1I 4BA2I 4C3IH 1VQ4A 2UXBL 4X6AH 2ZM6L 2JQOA 5JEAJ 3H0GH 2OTJA 1TWHH 1EIFA 1D8LA 1VQGA 3U50C 3CPWA 4DR1L 1YHQA 1ASZA 4BXXH 5H1SE 2E8GA 3PUZA 2BA0A 2IT1A 4HJ5A 1PH8A 1IBLL 4BY7H 2B63G 2XGTA 2UUCQ 1XMOL 1PH5A 1KQSA 4KHPL 3PSIA 3TRZA 4A3JH 1HNZL 4JV5L 4AIMA 2UUBL 5GADC 1NTGA 1WOCA 3H15A 1EQRA 2OTLA 1K83H 1VQ6A 4GNXA 3HOUH 2IHFA 1QZHA 3EN2A 2Q2UA 2H5XA 3KLWA 5LMUQ 3TEHB 2D0PA 5LMNQ 1V1QA 4JOIC 1LM0A 4JI1Q 1A62A 3KJOA 4LF4L 1XPUA 2QEXA 3ICEA 4UPAA 3I4NG 4HJ9A 3K0XA 1HJPA 1V43A 1UE5A 4IFDG 2I5HA 3CCQA 3W1GA 2K5NA 3GD7A 1P16A 3KDFA 3S1RH 2I0QA 1H95A 3G4SA 1RL2A 4GN3B 4A3FH 3CPFA 1EOVA 2QA4A 2E5LQ 3S16H 4HIDA 5C3EH 1UE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SN8 A;  3J81 i;  2R7F A;  3KOJ A;  2A8V A;  4BXX G;  4HIK A;  4LW1 A;  1S40 A;  2YU9 H;  3GTP H;  2UUC L;  2LXJ A;  4LUO A;  2E2H H;  1Z47 A;  4YWL A;  2YTX A;  2ZJR A;  4IPH A;  1SRU A;  2DGY A;  4IPG A;  3RNU A;  1HR0 Q;  1G29 1;  2FXQ A;  4EX5 A;  4DR6 Q;  5LMU L;  3PCO B;  2JA6 H;  3HOU G;  5LMN L;  2VZA A;  4KLK A;  1TWF H;  1YVC A;  4QL5 A;  4JI1 L;  4JBK A;  4P73 A;  3DM3 A;  4GOP C;  1HZ9 A;  1KXL A;  3K80 C;  3L2P A;  3HOW H;  3M3Y H;  2WB1 E;  3E9H A;  4LNQ A;  1BBW A;  3T1H Q;  3J7A 5;  2R7D A;  4DK3 C;  2VS1 A;  3PF5 A;  2Y0S E;  3STB C;  2N8N A;  4IPD A;  3ULP A;  5LMN W;  1JJG A;  3OW2 A;  4LUZ A;  4A3B H;  1VQH A;  2JK8 A;  2E5L L;  5IE8 A;  4A3F G;  2N49 A;  3ERS X;  3A0J A;  4H02 A;  5C3E G;  3IRB A;  4PZ8 A;  2BH8 A;  1O7I A;  2WAQ G;  4NPS A;  1OXS C;  5C0X I;  1W2B A;  2RF4 A;  3G48 A;  1UEB A;  1XPO A;  3BZK A;  5IYB H;  3JAM i;  3UDG A;  1XPR A;  1HR0 L;  1VQ7 A;  4DR6 L;  3W5O A;  1VQL A;  4APV A;  1Q81 C;  2JA6 G;  4A93 H;  2NN6 G;  1GD7 A;  1PHJ A;  1UE7 A;  2IHE A;  3G6E A;  4JOI A;  3AYH B;  1QUQ B;  3U4Z A;  3PO3 G;  3KFU A;  3ZJY C;  4IFD J;  3HOW G;  1N34 L;  3T1H L;  2UXD Q;  3CAM A;  5IYC H;  4OON A;  1HR0 W;  4HJ7 A;  3K8A A;  5DLQ E;  2ZJQ A;  1NBW A;  4HJ8 A;  2KCM A;  1CKN B;  1UWV A;  2KHI A;  4DR3 Q;  2JA8 H;  4A3L H;  3I2Z A;  1FL0 A;  4AH6 A;  2JEB I;  1HNX Q;  1KL9 A;  3GTJ H;  2LXK A;  1X9N A;  4EQ5 A;  3KF6 B;  1TWG H;  1PH7 A;  4OWW B;  1GKH A;  3FKI G;  4UP7 A;  3I4O A;  4L5S A;  1L1O B;  4A3G H;  2KCT A;  4QJF A;  3RN5 A;  1TWC H;  2WP8 J;  4C3H H;  3T1Y Q;  1VQM A;  1WJJ A;  4DNI A;  1Q1E A;  3GDE A;  1SE8 A;  3J7Z C;  1X55 A;  2Z6K C;  3UE0 A;  4HIM A;  1G6P A;  2B63 H;  2K5H A;  5HGQ A;  4AQY Q;  1XNQ Q;  4GOP A;  1I3Q H;  4IJL A;  2UXD L;  2A1A A;  1I6H H;  4YCU A;  4YCW A;  5IYC G;  3FP9 A;  1HZA A;  1Q46 A;  4DR3 L;  1I5F A;  2NVQ H;  3BU2 A;  1PH4 A;  4PZ7 A;  2R7Z G;  1VQD A;  2JA8 G;  2HT1 A;  3H3V H;  1HNX L;  2VUM H;  1QVF A;  1I94 Q;  2LSS A;  4YWK A;  3S24 A;  1NE3 A;  2B3G A;  4GN5 A;  2YYZ A;  3GTM H;  3W1B A;  4RMF A;  1VQN A;  3KF8 B;  4GLA C;  1N8R C;  2BA1 A;  3CCS A;  4ME3 A;  1BKB A;  1RIP A;  2PI2 E;  1W3S A;  1PH3 A;  3L7Z C;  1Q1B A;  3U4V A;  4A3G G;  2BH2 A;  1AH9 A;  2PQA B;  2I5M X;  1XTD A;  4A3I G;  3AFP A;  3WWV A;  4GKK L;  2YTV A;  2YTY A;  1Z9F A;  3F2D A;  2NVY H;  2UU9 Q;  4POF A;  5IY0 A;  1YJ9 A;  1X3G A;  4XTC S;  1L0W A;  2PI2 A;  4JI8 Q;  3PGZ A;  3D31 A;  4YHH Q;  2YV5 A;  3CW2 C;  4AQY L;  1XNQ L;  3D0F A;  3M4O H;  1E3P A;  4J15 A;  5FLX c;  3CC4 A;  3HKZ E;  4OXP A;  3HOX G;  1X3F A;  3A5Z B;  1JMC A;  4JI2 Q;  2ALY B;  3GO5 A;  3RLO A;  4DV6 Q;  1VQA A;  1QZG A;  4O2D A;  3S17 H;  1E1O A;  1T9H A;  4LF6 L;  1Y1W H;  2EQS A;  3M4Q A;  4IOA A;  4B3T Q;  3HFZ B;  2EXD A;  1I94 L;  2R92 G;  2GN5 A;  4X65 Q;  2VUM G;  1CKM A;  4POG A;  1JT8 A;  2ASB A;  2ZJP A;  4K0K Q;  1OXU A;  1WCM G;  1SFO H;  1E1T A;  2F52 A;  5GAG C;  5M5X H;  3S1N H;  2ID0 A;  1VQJ A;  1L2F A;  1VQ9 A;  3CXC A;  1HZB A;  4A76 A;  1EWI A;  1VQI A;  1PH6 A;  3M7N A;  2UU9 L;  4PMW A;  3TS0 A;  4YCV A;  4JI8 L;  4YHH L;  4R1J A;  1JE5 A;  1YNX A;  2Z6K A;  2JA5 G;  1FVI A;  1Q86 C;  1MJC A;  2RHS B;  1S72 A;  4DAM A;  4LFA Q;  3GTK H;  1B7Y B;  2K52 A;  4JYA Q;  4HJA A;  1M90 C;  4JI2 L;  1GO3 E;  2E2J H;  2RHQ B;  4DV6 L;  1K8A C;  3I4M H;  3E0E A;  1R9T H;  5M3F G;  3NEM A;  1N33 Q;  5M5Y H;  1K8G A;  4GNX B;  1MIU A;  4NXN Q;  5HY6 A;  1YBY A;  1Y1W G;  4B3T L;  3PO3 H;  4JBW A;  5GQO A;  5GAH C;  1JJ2 A;  2K5V A;  2OQ0 A;  1YJW A;  4R4O A;  1QVC A;  4MNO A;  4X65 L;  1VCI A;  2K14 A;  2AWN A;  1MKH A;  4K0K L;  3CP0 A;  2VQF Q;  1CKO A;  3A5U A;  2Q2T A;  1CSP A;  1U0L A;  4LFB Q;  4DV7 Q;  1K3R A;  2KHJ A;  2CCZ A;  2V1C C;  1NJI C;  2IY5 B;  3KDF B;  4AYB E;  3UDX A;  1E22 A;  2ATW A;  3HOZ G;  4X62 Q;  4LF7 Q;  4YY3 Q;  4KHZ A;  2B29 A;  2Z0S A;  3FKI H;  3I56 A;  4A3K H;  5BR8 Q;  1JB7 A;  1SMX A;  3CCJ A;  4LFA L;  2IX1 A;  2CWA A;  1VQC A;  1PH2 A;  4JYA L;  3CCL A;  4DR5 Q;  1EUJ A;  3CF5 A;  2UUA Q;  4LFC Q;  2HHH Q;  3I4M G;  2EIF A;  1NY4 A;  1X65 A;  3F8T A;  1N33 L;  4A3C G;  1D7Q A;  3E9I A;  1CKN A;  4NXN L;  3CD6 A;  3DLL A;  1U5K A;  5ELO A;  1IBK Q;  4DUZ Q;  1EYG A;  4JI4 Q;  2WB1 G;  1VQK A;  4IJH A;  1Q12 A;  1XMQ Q;  4JI5 Q;  5C4X H;  3CC2 A;  1VQO A;  2CWP A;  2VQF L;  3GTG H;  3M9B A;  2CFM A;  5EAY A;  4B3R Q;  3GTQ H;  5JJI A;  2Y0S G;  4LFB L;  3CME A;  4A4I A;  2R7Z H;  1J5E Q;  4BBS H;  5JJK A;  1SR3 A;  1N36 Q;  4DR2 Q;  4JCV E;  2ZTE A;  3L0O A;  4AYB G;  3GTO H;  4P72 A;  2MO1 A;  1CUK A;  4OWT B;  4X62 L;  2MQH A;  2HIV A;  4LF7 L;  3RN2 A;  1PH9 A;  5J3B A;  1Q82 C;  4IFD I;  1PV4 A;  1B8A A;  4DPG A;  5BR8 L;  2K75 A;  3CMA A;  2JA5 H;  2JA7 H;  4A3K G;  1YHB A;  4IPC A;  4KI0 A;  1VQ8 A;  1S3O A;  4B3M Q;  1VQE A;  3RZD H;  3MXN B;  3PF4 A;  2F4V Q;  4DR5 L;  2UUA L;  4LFC L;  4ALP A;  4C3J H;  4A3I H;  1KC8 C;  4QGU A;  2HHH L;  3S14 H;  1YIJ A;  1EQQ A;  3G71 A;  4LF5 Q;  2CQO A;  5FLM H;  4DUZ L;  1IBK L;  1PFS A;  4JI4 L;  4UY8 C;  3S2H H;  4BBR H;  1OXV A;  1PA6 A;  4JI5 L;  1XMQ L;  3HOX H;  3PO2 H;  1TWA H;  3S15 H;  1X54 A;  4X64 Q;  2VW9 A;  3OYY A;  3HOY H;  4WJ4 A;  4Y52 H;  5C4X G;  1OTC A;  4B3R L;  3VDY A;  3ULJ A;  4JBM A;  4IO9 A;  4OO1 I;  1N9W A;  4DR4 Q;  2IX0 A;  1J5E L;  3S2D H;  4A3M H;  1N36 L;  1CSQ A;  4DR2 L;  4BBS G;  3ULL A;  1NMF A;  2R92 H;  4QQB X;  1SLJ A;  3OTO Q;  1LUZ A;  1FGU A;  4HIO A;  1HNW Q;  3KJP A;  1N32 Q;  1WCM H;  2VY3 A;  5IP9 H;  4B3M L;  2VQE Q;  3F2C A;  2JA7 G;  4A3E H;  4NXM Q;  3I55 A;  2F4V L;  4TVA B;  4X66 Q;  3T1Y L;  4DR7 Q;  2XTI A;  4GS3 A;  4DV0 Q;  1HZC A;  4JC0 A;  3M85 A;  1IL2 A;  3PV0 A;  4LF5 L;  1VQF A;  1LYL A;  2F3I A;  4DV4 Q;  1LTL A;  1M1K C;  2JA9 A;  5FLM G;  1SRO A;  2MNA A;  4BBR G;  1AE3 A;  2AKW B;  5IP7 H;  4X64 L;  1TXY A;  3F2B A;  3CCV A;  3PO2 G;  4GOP B;  1K0R A;  2C35 B;  5E7N A;  1AE2 A;  3EIV A;  5M3F H;  3HOY G;  4MTN A;  4DR4 L;  4GN4 B;  4UP8 A;  4PG3 A;  4JI0 Q;  4JG2 A;  5K36 G;  2CKZ B;  2AMC B;  4A3M G;  4GKJ Q;  3TS2 A;  5C44 G;  3OTO L;  3S1M H;  1IZ6 A;  1WFQ A;  3J80 c;  5C0X G;  1HNW L;  3AEV A;  1N32 L;  1KAW A;  2D0O A;  1WYD A;  1X56 A;  1EIY B;  5IP9 G;  2VQE L;  1L1O C;  1YZ6 A;  4NXM L;  4X66 L;  4A3E G;  2QGQ A;  4DR7 L;  1KRT A;  5GRO A;  4DV0 L;  2N78 A;  2D62 A;  3HOZ H;  1VS0 A;  3AFQ A;  2I5L X;  3CQZ H;  3PUV A;  4R4I A;  2NVX H;  4DV4 L;  1E24 A;  3FHW A;  5GAE C;  4DV2 Q;  3RZO H;  5JJL A;  1IXR A;  1X3E A;  2K50 A;  3HKZ G;  5IP7 G;  1KRS A;  3PUY A;  3PUX A;  3K7U C;  5M5W H;  2ZTD A;  4A3C H;  2K4K A;  1HH2 P;  3UDF A;  4JI0 L;  4JI6 Q;  2E2I H;  2KBN A;  2PNH A;  4GKJ L;  2AHO B;  1A0I A;  4R4T A;  4R4C A;  3MEF A;  1WI5 A;  3BJU A;  1X6O A;  4P74 A;  3GTL H;  4JBJ A;  3H0G G;  1PH1 A;  4L5R C;  2VNU D;  4UP9 A;  3PIO A;  4YWM A;  3K81 C;  4LF9 Q;  2WAQ E;  4BY7 G;  2WFW A;  3CCR A;  4GLX A;  2N3S A;  4A3J G;  1JJC B;  4C2M H;  3KYH C;  1GVP A;  3RR5 A;  1QUQ A;  4DV2 L;  3J81 j;  1KIX A;  1FJG Q;  4OO1 G;  4RG1 A;  5FJ8 H;  4WJ3 M;  1N34 Q;  1MJE A;  4XIG S;  4DKA C;  4DUY Q;  4PZ6 A;  4JI6 L;  1B70 B;  4MZ9 A;  3SGI A;  5IT9 c;  5C0X J;  1EFW A;  3HKS A;  4TQU S;  3NEL A;  3TRE A;  4JI3 Q;  5IYD H;  1C9O A;  2HIX A;  3RLN A;  4P71 A;  4DAY B;  2A19 A;  4Y7N H;  3KF6 A;  1V9P A;  2NVT H;  3ER0 A;  1Y1V H;  3U58 A;  1Y14 B;  1PYB A;  4DV7 L;  1C0A A;  3LGJ A;  4LF9 L;  2NZH A;  1L1O A;  3H3V I;  3UE1 A;  4DV5 Q;  4BY1 H;  1J6Q A;  2L15 A;  3NEN A;  4A75 A;  3F1Z A;  2JJQ A;  4YY3 L;  5ELN A;  1K9M C;  5M3M H;  3J81 c;  5AJ3 Q;  2Q2I A;  1A8V A;  3CCM A;  1FJG L;  5JEA G;  3M4P A;  3UDI A;  2UXC Q;  1KHI A;  2MFI A;  1BBU A;  4LF8 Q;  2OCE A;  1VQ5 A;  2NZO A;  4L5T A;  1IBM Q;  1Q8K A;  5FJ8 G;  4A3D H;  4GNX C;  1VQP A;  4DUY L;  4B3S Q;  1XNR Q;  1G51 A;  4IOC A;  3HOV H;  5IWA Q;  3BZC A;  4DV1 Q;  2PMZ E;  3TQY A;  2R6G A;  2VL6 A;  4DV3 Q;  4JI3 L;  3NBH B;  2MO0 A;  4QY7 A;  4JI7 Q;  5IYD G;  1A63 A;  4P75 A;  3J80 i;  4FDB A;  4DK6 C;  4A3B G;  1NMG A;  4OX9 Q;  1C7Y A;  3JC6 6;  1ASY A;  2R93 H;  1Y1V G;  1I50 H;  1OXX K;  2OQK A;  4QIW E;  1QVG A;  1BVS A;  1KD1 C;  4DV5 L;  2JE6 I;  1P8L A;  3K7A H;  5C44 H;  2PQA A;  4L5Q A;  4BY1 G;  2GVB A;  2UXB Q;  2ZM6 Q;  3Q8D A;  5IYB G;  3CCU A;  2JEA I;  5C4J H;  3RLF A;  4GKK Q;  5AJ3 L;  5M3M G;  4DR1 Q;  2UXC L;  1IYJ B;  2AWO A;  4A93 G;  4LUV A;  3AQQ A;  1IBL Q;  4LF8 L;  1YEZ A;  3S1Q H;  1YI2 A;  1IBM L;  1DGS A;  4NB3 A;  1XMO Q;  2KEN A;  4KHP Q;  4GLV B;  4A3D G;  4B3S L;  2OWO A;  1XNR L;  1HNZ Q;  4JV5 Q;  3JAM c;  2UUB Q;  1XJV A;  5IWA L;  2Q2H A;  4DV1 L;  3PIP A;  3EBE A;  3HOV G;  3CC7 A;  2HQL A;  1YJN A;  4DV3 L;  3PUW A;  1OXT A;  4LF6 Q;  3B6Y A;  4JI7 L;  1Q7Y C;  1UE6 A;  1PYS B;  3A74 A;  4R4Q A;  1K73 C;  2GVA A;  2DUD A;  4O0A A;  1GM5 A;  4LF4 Q;  1E7Z A;  4OX9 L;  4A3L G;  1VQB A;  3I7F A;  2ZTC A;  2NN6 I;  1YHA A;  3I4N H;  1PVO A;  1YIT A;  2R93 G;  4LWC A;  4OWX B;  3STB D;  3CCE A;  2ES2 A;  2RCN A;  4BA1 I;  4BA2 I;  4C3I H;  1VQ4 A;  2UXB L;  4X6A H;  2ZM6 L;  2JQO A;  5JEA J;  3H0G H;  2OTJ A;  1TWH H;  1EIF A;  1D8L A;  1VQG A;  3U50 C;  3CPW A;  4DR1 L;  1YHQ A;  1ASZ A;  4BXX H;  5H1S E;  2E8G A;  3PUZ A;  2BA0 A;  2IT1 A;  4HJ5 A;  1PH8 A;  1IBL L;  4BY7 H;  2B63 G;  2XGT A;  2UUC Q;  1XMO L;  1PH5 A;  1KQS A;  4KHP L;  3PSI A;  3TRZ A;  4A3J H;  1HNZ L;  4JV5 L;  4AIM A;  2UUB L;  5GAD C;  1NTG A;  1WOC A;  3H15 A;  1EQR A;  2OTL A;  1K83 H;  1VQ6 A;  4GNX A;  3HOU H;  2IHF A;  1QZH A;  3EN2 A;  2Q2U A;  2H5X A;  3KLW A;  5LMU Q;  3TEH B;  2D0P A;  5LMN Q;  1V1Q A;  4JOI C;  1LM0 A;  4JI1 Q;  1A62 A;  3KJO A;  4LF4 L;  1XPU A;  2QEX A;  3ICE A;  4UPA A;  3I4N G;  4HJ9 A;  3K0X A;  1HJP A;  1V43 A;  1UE5 A;  4IFD G;  2I5H A;  3CCQ A;  3W1G A;  2K5N A;  3GD7 A;  1P16 A;  3KDF A;  3S1R H;  2I0Q A;  1H95 A;  3G4S A;  1RL2 A;  4GN3 B;  4A3F H;  3CPF A;  1EOV A;  2QA4 A;  2E5L Q;  3S16 H;  4HID A;  5C3E H;  1UE1 A; 
#chains in the Genus database with same CATH topology
 4LW1 A;  1EYA A;  2E2H H;  5C5M A;  1Z47 A;  1D1K A;  4IPH A;  1SRU A;  2DGY A;  1HUM A;  2EYF A;  4IPG A;  2FXQ A;  4EX5 A;  1BXT A;  1YVC A;  4GOP C;  1KXL A;  2RSN A;  3T1H Q;  2H1E A;  4DK3 C;  3FVQ A;  3HOZ B;  3SR1 A;  3PF5 A;  4H0L C;  2N8N A;  1D6E C;  3HS0 C;  2Z8L A;  2B2Y C;  4CGY B;  5LMN W;  1DD2 A;  4TKO B;  1LT3 D;  4A3F G;  2HCI A;  2EYH A;  2AQ2 B;  4FO2 A;  4KN4 C;  3H3V C;  2E2I B;  2RF4 A;  5C5L A;  5BN3 A;  3UDG A;  4ZUJ A;  3W5O A;  1VQL A;  3J7A F;  2A68 D;  2NN6 G;  2HQE A;  1GD7 A;  1UE7 A;  3E6Z X;  4PQX A;  4RHR A;  1QUQ B;  4KKU A;  1KAB A;  4FF3 A;  4IFD J;  3OIP A;  1N34 L;  3DEO A;  3MTS A;  1JIC A;  3K8A A;  2ZJQ A;  4HJ8 A;  2KHI A;  2JA8 H;  1JC7 A;  3I2Z A;  1YNJ C;  3GTJ H;  1MGS A;  1O78 A;  4EQ5 A;  1DYQ A;  4OWW B;  1FR3 A;  2ZXP A;  3TP8 A;  2EY2 A;  2KCT A;  1DOL A;  2WP8 J;  4C3H H;  3T1Y Q;  1K3B C;  1Q1E A;  3K0Y A;  4HIM A;  2SOB A;  1SMY C;  1Y1V B;  2K5H A;  3NPP A;  4X3U A;  4L6T B;  2UXD L;  4ILW A;  4ZRZ A;  5IYC G;  4B9W A;  1F9Q A;  5M3M B;  2R7Z G;  4K6D A;  1HQR D;  3SK4 A;  3W2D A;  2F0K A;  1QNU A;  1LTT D;  4B08 A;  4RAU C;  4GLA C;  3VYT A;  1W3S A;  1PH3 A;  1DCZ A;  3L7Z C;  2IX3 A;  2BH2 A;  4GKK L;  2YTV A;  4XTC S;  4AQY L;  2V4D A;  4YHH Q;  1XNQ L;  4C1N K;  4RCN A;  3CW2 C;  1S5E D;  3A54 A;  4XYO A;  1SXT A;  5C44 B;  3K7A B;  3HOX G;  4XQJ A;  3RLO A;  2R61 A;  1E1O A;  1EYD A;  5J1Z A;  3MZ5 A;  3SHL A;  2K5Q A;  4X65 Q;  4I65 A;  2ZJP A;  1EY4 A;  1WTR A;  2VB2 X;  1QB5 D;  1ENC A;  2K32 A;  4K5X A;  1BNZ A;  2ID0 A;  1L2F A;  5BN4 A;  2UU9 L;  4YCV A;  3VR3 A;  4GZY C;  2F0F A;  2JA5 G;  5I2X A;  2RHS B;  3HG9 A;  2QW7 A;  1S72 A;  1GXD C;  3E5S A;  3T13 A;  4JYA Q;  3LNN A;  4C3I B;  4HJA A;  1M90 C;  4JI2 L;  2E2J H;  2NN6 H;  5M3F G;  3H0G B;  1TS4 A;  5C6A A;  4FF2 A;  2Z9H A;  4JBW A;  5GAH C;  2OQ0 A;  1YJW A;  4MNO A;  4FF1 A;  1KLU D;  4HTH A;  4K0K L;  3KK7 A;  1CT1 D;  2B2T A;  2B39 A;  3P7J A;  4LFB Q;  1OO9 B;  1JOR A;  3C1E A;  4DN4 M;  3KDF B;  5JPN C;  1Y8O B;  2A69 C;  1BQQ T;  2PZW A;  3I90 A;  1SJH D;  1VQC A;  5EPL A;  2KUM A;  3H09 A;  1EUJ A;  4Z9C B;  3GQB A;  2HHH Q;  3I4M G;  1AZP A;  1N33 L;  4A3C G;  2IPK D;  1IL8 A;  5C3E B;  2XN9 C;  3IFT A;  5LHY 1;  2WB1 G;  2E2H B;  3RUZ A;  4IJH A;  1XMQ Q;  3KLS X;  4JI5 Q;  3CC2 A;  1VQO A;  2JSO A;  5JJI A;  3T4A C;  5DEH A;  2R7Z H;  5JJK A;  2IW3 A;  3SVM A;  1TII D;  3OMG A;  3PO3 B;  4P72 A;  1ZYR D;  4K5V A;  3DHQ A;  1B8A A;  2JA7 H;  4A3K G;  3PIO 3;  4O1N A;  1S3O A;  4DR5 L;  2UUA L;  3G71 A;  4S3S A;  1IBK L;  3S2H H;  4JI4 L;  1AFP A;  2F0V A;  4XQQ A;  2ZT9 C;  3HOX H;  3R3O A;  3S15 H;  4X64 Q;  2WKC A;  4B3R L;  3ULJ A;  2IX0 A;  3DM1 A;  4OEL B;  1SSO A;  3M7G A;  4EQO A;  2F0O A;  5K36 H;  4BBS G;  1NMF A;  4XDX A;  3ND8 A;  1TKW B;  4ZK9 B;  1LUZ A;  1FGU A;  4HIO A;  2JN4 A;  4OGQ C;  3I70 A;  3KJP A;  4DFA A;  2VQE Q;  5KEE A;  2DY8 A;  2F4V L;  4X66 Q;  4QCL A;  4TRD A;  3T1Y L;  2JA8 B;  3I4L A;  5C3X A;  4C3J G;  4MTK A;  4LF5 L;  1VQF A;  1S5D D;  3GTJ B;  1M1K C;  4QUC A;  1SRO A;  5EKI A;  4ID6 A;  1LTS D;  1YNN D;  5IP7 H;  2J0T D;  1K0R A;  2C35 B;  5E7N A;  5M3F H;  4C3H B;  5LL6 X;  3MXU A;  1B9M A;  4A3M G;  4GKJ Q;  1RTN A;  3TS2 A;  3OTO L;  1IZ6 A;  1HHV A;  2QF7 A;  5CC4 A;  5IP9 G;  1B9N A;  1YZ6 A;  1A3V A;  2FIN B;  4CDE C;  4DR7 L;  1KRT A;  2DY7 A;  1GUT A;  4DV4 L;  2VB3 X;  1O7Y A;  2SNM A;  4HSV A;  5ELD A;  2G5D A;  2DJF C;  2K6A A;  3K7U C;  5M5W H;  5CV4 A;  4A3C H;  1LTI D;  1QE6 A;  3PIP 3;  1LTA D;  1WD1 A;  2AHO B;  1A0I A;  3FMC A;  4R4T A;  3MEF A;  1WI5 A;  3TBI B;  2O5J C;  3BJU A;  4FVM A;  4P74 A;  3C2P A;  4IUP A;  3BDC A;  2KED A;  4O42 A;  3K81 C;  2WAQ E;  4J8Q A;  2N3S A;  2KVM A;  3A8J E;  3DWQ A;  3Q0A A;  1F2M A;  1GVP A;  2OT2 A;  3RR5 A;  5JEA H;  4DV2 L;  3J81 j;  1A6X A;  5FJ8 H;  2E2D C;  4XQN A;  5A2Q E;  1BBX C;  5IT9 E;  4DKA C;  4DUY Q;  1HTP A;  1C48 A;  2NVX B;  3HKS A;  2HUG A;  1EU3 A;  4QUF A;  3RLN A;  1Z7T A;  4P71 A;  4DAY B;  3FPU B;  3D4W A;  1A3T A;  5KNB A;  3U58 A;  1EEI D;  1PYB A;  2NTT A;  1C0A A;  1KDB A;  2E2J B;  3LGJ A;  4DGZ A;  2NZH A;  4IUQ A;  4X3S A;  4RGT A;  3UE1 A;  2KQ3 A;  3MHB A;  5ELN A;  2ZXR A;  3OMC A;  1U4M A;  1PRT C;  2Y0S B;  1KHI A;  2F0U A;  1BBU A;  2KCN A;  5FO9 B;  4L5T A;  3E3X A;  4IOC A;  2FJ2 A;  1STE A;  3TQY A;  2R6G A;  5CGK A;  2D9U A;  2MO0 A;  4JI7 Q;  5IYD G;  1A63 A;  3C1F A;  3J80 i;  1XWE A;  1NMG A;  3NBI A;  4OX9 Q;  1XXG A;  2K01 A;  1Y1V G;  4JK1 C;  4KJN A;  1BVS A;  4CHT B;  4L5Q A;  2J7Z A;  5IGF A;  1EIG A;  1ML0 D;  3I8Z A;  5J22 A;  2PW7 A;  4BWG B;  4N8X 1;  5M3M G;  1G2S A;  4A93 G;  2AWO A;  1M8A A;  1IBL Q;  1YEZ A;  3S1Q H;  1XMO Q;  2R7Z B;  1PRT F;  1R4Q B;  4B3S L;  1F9R A;  2UUB Q;  4DV1 L;  4HN7 A;  3EBE A;  3TP6 A;  1OXT A;  4LF6 Q;  1LTG D;  1GUW A;  4KY7 A;  2JA7 B;  1ILQ A;  4O0A A;  4A3L G;  1GM5 A;  1O80 A;  1SBB B;  1PVO A;  1YIT A;  3STB D;  2ES2 A;  2F3W A;  3LWE A;  3S2H B;  2UXB L;  3VYS A;  3HOX B;  1VQG A;  3OW7 A;  4DR1 L;  3NWT A;  5H1S E;  2Q8T A;  3PUZ A;  2BA0 A;  3VR4 A;  1PH8 A;  2B63 G;  4KHP L;  4JV5 L;  4ZQ3 A;  1BCP D;  1NTG A;  1WOC A;  4N8F A;  1EQR A;  1K83 H;  2WII B;  2F0H A;  2BOS A;  1V1Q A;  4JOI C;  1A62 A;  1MD2 D;  4LF4 L;  1XPU A;  4M8A A;  2WV6 D;  3K0X A;  3S1R H;  2CH4 A;  1TS2 A;  4C3I G;  1RL2 A;  3CPF A;  2BDN A;  2Z6B A;  3PQI A;  1SN8 A;  3J81 i;  3KOJ A;  1JOK A;  2R3Z A;  5M3F B;  2YU9 H;  2LXJ A;  3TZD A;  3QJY A;  2YTX A;  5G3L F;  4G7H C;  1E2V A;  2DNE A;  3PCO B;  2M9V A;  5LMN L;  4QL5 A;  4JI1 L;  4P73 A;  2DJG C;  3DM3 A;  5F2D A;  4ME5 A;  3M3Y H;  1PTO C;  3K58 A;  3J7A 5;  1LTR D;  4MN3 A;  4A3J B;  2B2U A;  2EPB A;  4ZYS A;  2B2V C;  4I7A A;  4R9W A;  1VQH A;  2E5L L;  2AUJ D;  2N49 A;  4H02 A;  3NQT A;  5C3E G;  5M5W B;  3IRB A;  4PZ8 A;  1O7I A;  2RDG A;  4YIJ A;  2EDG A;  4KY6 A;  1PMR A;  5C0X I;  2M00 A;  1XPO A;  1XPR A;  1XTC D;  4C56 C;  5JVG 3;  3Q24 A;  1Q81 C;  1JWS D;  4A93 H;  3P75 A;  2A6H C;  1PHJ A;  3PO3 G;  3GTP B;  2D5D A;  2UXD Q;  4RA8 A;  4MIU A;  4WOR A;  5FK9 C;  1HR0 W;  1JE4 A;  5DLQ E;  2PNR C;  1EY0 A;  1CKN B;  1L0Y B;  4A3L H;  1FL0 A;  1TWF B;  2JEB I;  2EY5 A;  2KOL A;  5T1I A;  2K28 A;  2NB0 A;  1PH7 A;  4K6L A;  1LV9 A;  1WTQ A;  2G9H D;  4QJF A;  5KND A;  3RN5 A;  1O7L A;  4DNI A;  2IJ0 A;  3GDE A;  1DON A;  1NNX A;  3J7Z C;  2Z6K C;  2B63 H;  1T5E A;  4AQY Q;  1XNQ Q;  3IFD A;  1XX8 A;  1HPC A;  4GOP A;  2LFN A;  4YCU A;  1RJT A;  1RCV D;  4PMC A;  3FP9 A;  4DAP A;  1HA5 A;  4DR3 L;  2NVQ H;  2N88 A;  1PH4 A;  2JA8 G;  2B2Y A;  2HT1 A;  1HNX L;  2VUM H;  3H3V H;  1KDA A;  4RCO A;  4YWK A;  3S24 A;  1NE3 A;  2B3G A;  3GTM H;  3W1B A;  5E3F A;  1SNQ A;  4RMF A;  3KF8 B;  4ME3 A;  1BKB A;  1PFB A;  4U68 A;  2E75 C;  1AH9 A;  2I5M X;  1XTD A;  3MC0 B;  2RA4 A;  1B3Q A;  1RF2 D;  2YTY A;  2NVY H;  2UU9 Q;  2A68 C;  1X3G A;  1L0W A;  2L0C A;  3M4O H;  4K8I A;  3CC4 A;  3HKZ E;  4OXP A;  4DXF A;  4JI2 Q;  1UEA B;  2ALY B;  3DUZ A;  3GO5 A;  1VQA A;  1QZG A;  4O2D A;  2CVR A;  4JPB W;  1PYW D;  1T9H A;  4LF6 L;  1Y1W H;  2EQS A;  3MVV A;  5T1G A;  3J80 E;  2EXD A;  2IWH A;  4DNR B;  1I94 L;  2GN5 A;  3S1Q B;  1CKM A;  1V1O A;  4K0K Q;  2SNS A;  1SFO H;  3QB3 A;  2F4I A;  1D2B A;  2F52 A;  5GAG C;  3DXJ C;  1VQ9 A;  1PH6 A;  1EWI A;  1HCZ A;  1QG7 A;  4PMW A;  2K04 A;  4JI8 L;  2AUK A;  2F0T A;  2F0P A;  5CV6 A;  1LT6 D;  1EIH A;  1B7Y B;  2RCF A;  1CK1 A;  5IOC A;  1R9T H;  1N33 Q;  1FNU A;  3EA6 A;  1K8G A;  1MIU A;  1I4G A;  4B3T L;  3PO3 H;  5GQO A;  1QVC A;  2F0S A;  2XWB B;  2CQA A;  3K5M A;  1LT5 D;  2XWJ B;  5IOD A;  2Q2T A;  5ELB A;  1K83 B;  5D3I B;  1U0L A;  5I9P A;  3SXH A;  3P1H A;  3NWS A;  1BO0 A;  3K59 A;  2CCZ A;  1PFM A;  2B29 A;  2RQX A;  3I56 A;  1U4L A;  1JB7 A;  1SMX A;  4LFA L;  2LS0 1;  2EJF C;  2F1M A;  4OIK A;  5COY A;  3S1R B;  3CCL A;  1EWH A;  4DR5 Q;  3EFX D;  4ZLT F;  2UUA Q;  1UUP A;  5IGD A;  3F8T A;  3K5L A;  3E9I A;  3DLL A;  1GHK A;  1IBK Q;  1EYG A;  1ET9 A;  4JI4 Q;  4H44 C;  2YU9 B;  1B2T A;  4K8J A;  1Q12 A;  5C4X H;  3UI2 A;  2CWP A;  2VQF L;  3M9B A;  2CFM A;  4V19 0;  3AB9 A;  4B3R Q;  1DOM A;  2Y0S G;  4G7Z C;  4A4I A;  1W6J A;  2K5D A;  4JCV E;  3L0O A;  4FYD A;  2N55 A;  2MO1 A;  1CUK A;  2MUY A;  4X62 L;  2DNC A;  3ND9 A;  2HIV A;  4LF7 L;  3M3Y B;  5J3B A;  4IFD I;  1SJE D;  5BR8 L;  2K75 A;  3FRP B;  1VQE A;  2F4V Q;  1STA A;  3J80 L;  3S14 H;  5KGU A;  1YIJ A;  1EQQ A;  4K2L A;  4LF5 Q;  5FLM H;  3OHX C;  4DUZ L;  1PFS A;  3SEB A;  3VR2 A;  1PA6 A;  4QF4 A;  3HOY H;  5CV5 A;  4JBM A;  1J5E L;  3HEJ A;  1CSQ A;  4A93 B;  5EGT A;  3SK6 A;  1SLJ A;  3OTO Q;  3T16 A;  2PW5 A;  3X3N A;  3N52 A;  1STB A;  2JA7 G;  4A3E H;  3I55 A;  1TQO A;  4TVA B;  1FYC A;  4DR7 Q;  2XTI A;  4GS3 A;  4LMQ D;  4N9T A;  1HZC A;  1IL2 A;  5FOB B;  1DM0 B;  3OIQ A;  4DV4 Q;  2EVB A;  2MNA A;  2L11 A;  2L9H A;  1AE3 A;  4HR7 B;  5M9O A;  3F2B A;  5I4D A;  4GOP B;  3EIV A;  4MTN A;  2XRS D;  5K36 G;  1LLR D;  2B63 B;  3S1M H;  3J80 c;  1HNW L;  1N32 L;  1ZYR C;  4KN7 C;  1X56 A;  1EIY B;  1L1O C;  1AZQ A;  4NXM L;  1KDC A;  5GRO A;  4DV0 L;  2NVQ B;  2N78 A;  1CFM A;  3I72 A;  2NVX H;  2I5L X;  2VUM B;  4R4I A;  3GTM B;  1E24 A;  5GAE C;  4DV2 Q;  1EYC A;  2K50 A;  5IP7 G;  3PUY A;  2ZTD A;  4WJW A;  5D3D A;  3J81 L;  3R2T A;  2NVY B;  3FPP A;  4L63 B;  3M4O B;  3GTL H;  4KK7 A;  4JBJ A;  1SNO A;  1PH1 A;  4L5R C;  2VNU D;  3NXW A;  4PV1 C;  4ZAI A;  1F77 A;  2KHS A;  2K03 A;  3BVM A;  1Y1W B;  2WFW A;  2TMP A;  4A3J G;  1JJC B;  4C2M H;  3GV3 A;  2F0G A;  1H9M A;  3E0J A;  1CTM A;  2J4X A;  2JYO A;  1B44 D;  1SFO B;  1YNN C;  4KHV A;  1IKM A;  4WJ3 M;  3C46 A;  2PZU A;  1MJE A;  4DAV A;  5KNC A;  1EFW A;  1C9O A;  2HIX A;  1VF5 C;  3KF6 A;  1V9P A;  4KMU C;  3ER0 A;  1R9T B;  3A7L A;  4BY1 H;  1JWM D;  1J6Q A;  2L15 A;  3NTK A;  2F0N A;  4P2C B;  3J81 c;  1FJG L;  2JXM B;  5JEA G;  1SYE A;  2XIW A;  3TME A;  5FJ8 G;  1ZEQ X;  4GNX C;  4B3S Q;  5JVH 3;  3BZC A;  4DV1 Q;  2PMZ E;  4J1M A;  2SEB D;  1WD0 A;  1QNK A;  4P75 A;  1JOO A;  4QMG A;  1PDQ A;  2RSO A;  4DK6 C;  4A3B G;  2K5W A;  1C7Y A;  3JC6 6;  2DN8 A;  1I50 H;  1D1I A;  1OXX K;  2OQK A;  4QIW E;  2JE6 I;  2PQA A;  2PPB C;  2UXB Q;  5CBE E;  5IYB G;  3CCU A;  5C4J H;  5C4X B;  5AJ3 L;  4DR1 Q;  1IYJ B;  3BYT B;  4I7Z C;  4LF8 L;  1UAP A;  1IBM L;  1DGS A;  2KEN A;  4KHP Q;  4GLV B;  4DF7 A;  4JV5 Q;  5JAV A;  5IWA L;  4G7O C;  1A15 A;  2PYK A;  2K33 A;  3K6O A;  1TVX A;  2HQL A;  3CC7 A;  1BDO A;  4DV3 L;  4QB4 A;  4HAE A;  1GOZ A;  1PYS B;  2VXW A;  3A74 A;  1K73 C;  2GVA A;  4LF4 Q;  1Y8P B;  1E7Z A;  2F0Q A;  2Z4H A;  2NYZ D;  1YHA A;  3S14 B;  3CCE A;  3ERO A;  1VQ4 A;  2ZM6 L;  1JQY D;  2JQO A;  5JEA J;  2OTJ A;  3U50 C;  4CDF C;  4BXX H;  1EQV A;  3HOY B;  3A8K E;  3BG3 A;  1ASZ A;  3BDL A;  4NW2 A;  2E8G A;  2MPM A;  1KQS A;  3PSI A;  4A3J H;  5GAD C;  3DWP A;  1VQ6 A;  3HOU H;  1G2T A;  2Q2U A;  2H5X A;  3KLW A;  1DZ1 A;  3TEH B;  5LMN Q;  1LM0 A;  4CDC C;  4JI1 Q;  1MSG A;  1SE3 A;  1ZXT A;  1J9O A;  3KJO A;  4A3E B;  1ILP A;  1II3 A;  1CA6 A;  3ICE A;  2LY7 A;  4UPA A;  5KRU A;  1V43 A;  5JOB A;  2I0Q A;  1H95 A;  3G4S A;  4GN3 B;  5IGE A;  2E5L Q;  1UE1 A;  2A8V A;  3GTP H;  1U9R A;  2UUC L;  2FMC A;  4LUO A;  3VA7 A;  5IGC A;  2RDH A;  5EPJ A;  4YWL A;  3K57 A;  2ZJR A;  1EY9 A;  2JP1 A;  1WTP A;  3S1M B;  3TZU A;  5LMU L;  2HDM A;  2JA6 H;  3BS1 A;  1AN8 A;  4KLK A;  1TWF H;  4KJO A;  1HZ9 A;  1HA6 A;  3K80 C;  3HOW H;  2WB1 E;  2F0I A;  2QCP X;  2NUC A;  2R7D A;  4KV6 A;  4RWS C;  4ZCK A;  2VS1 A;  3STB C;  3ULP A;  1JJG A;  2EJM A;  4A3B H;  1I4X A;  2K1B A;  3ERS X;  3A0J A;  3KBG A;  3LWU A;  3AU7 A;  2BH8 A;  3TSS A;  3MXN A;  3DMU A;  1OXS C;  1KNA A;  3G48 A;  2I07 B;  1UEB A;  3BZK A;  5IYB H;  1HR0 L;  1BCP C;  2EYP A;  3VA5 A;  1VQ7 A;  4DR6 L;  2A5H A;  1SND A;  3GTL B;  5J39 A;  1ESF A;  3EVQ A;  5DM7 3;  2IHE A;  3G6E A;  2K7V A;  4JOI A;  3AYH B;  4DU9 A;  3BVZ A;  2IL8 A;  5JPM C;  4L8J A;  3CAM A;  5D65 A;  1NBW A;  4C2M B;  1UWV A;  4DR3 Q;  1EEF D;  2CW0 D;  5FLX L;  4CJ1 B;  1HNX Q;  1Z6H A;  5C3W A;  3KF6 B;  1GKH A;  3NUC A;  1C4Q A;  2A6E D;  3I4O A;  4A3G H;  5IIF A;  3A7A B;  1PTO H;  1VQM A;  1SE8 A;  1X55 A;  1G6P A;  5HGQ A;  1NUC A;  3OSO A;  1I3Q H;  3R2I A;  4BY1 B;  1I6H H;  1I6V C;  3D4D A;  1Q46 A;  1I5F A;  3BU2 A;  1ESR A;  2B2V A;  1K28 A;  1I4Q A;  1I94 Q;  1LTB D;  3U9O A;  4GN5 A;  2YYZ A;  1IYV A;  1NR2 A;  2BA1 A;  2EXZ A;  1FNV A;  4RKB A;  1RIP A;  2PI2 E;  2PMZ B;  4X3K A;  1S5B D;  3U4V A;  1TY0 A;  2PQA B;  3WWV A;  1EOT A;  3F2D A;  1Z9F A;  4RHS A;  5IY0 A;  1YJ9 A;  4JI8 Q;  2PI2 A;  2BDO A;  3PGZ A;  4R8I A;  2YV5 A;  4QIW B;  3K5N A;  1I50 B;  3D0F A;  1XYI A;  1E3P A;  4J15 A;  5FLX c;  1SYF A;  3MXP A;  1ENF A;  3S17 H;  4HSP A;  5C4J B;  2X6G A;  4R8N A;  4CJ2 C;  4KD3 A;  4B3T Q;  3HFZ B;  2VUM G;  3QG1 A;  5ELE A;  3QOJ A;  1JT8 A;  4UDU C;  2ASB A;  1WCM G;  1TT2 A;  1MBY A;  2H4O A;  3TN2 A;  5M5X H;  1K0S A;  4HMI A;  2MHV A;  1VQJ A;  1GUG A;  2AQ1 B;  1EZ8 A;  3Q23 A;  4A76 A;  1GUN A;  1VQI A;  2EOT A;  3KLR A;  3CKI B;  4R1J A;  2Z6K A;  1FVI A;  1Q86 C;  1MJC A;  4LFA Q;  3GTK H;  1KTK A;  4MHE A;  1PRT B;  4KD4 A;  3H6M A;  2PO4 A;  1GO3 E;  2RHQ B;  4DV6 L;  1K8A C;  4UHV A;  3NEM A;  5M5Y H;  4DK1 A;  5I9O A;  1YBY A;  1Y1W G;  1TU2 B;  3KLS A;  5ELC A;  1VCI A;  2AWN A;  1MKH A;  3CP0 A;  1SE4 A;  2VQF Q;  3HOU B;  4DV7 Q;  2KHJ A;  4CKB A;  1NJI C;  3KUP A;  4AYB E;  1H9J A;  1GHJ A;  2WKD A;  1E22 A;  2ATW A;  4X62 Q;  5KYL A;  4LF7 Q;  1IKL A;  4KHZ A;  5BR8 Q;  2IX1 A;  3OWE B;  1PH2 A;  5I6Y A;  3TDQ A;  5EBD A;  1TS5 A;  2G9D A;  2Q8I B;  1D7Q A;  4NXN L;  3NBH A;  1U5K A;  4DUZ Q;  1F2L A;  3EJI A;  2WAQ B;  1QJO A;  1B50 A;  1GUO A;  1VQK A;  2EZV A;  2B8G A;  1PTO F;  5EAY A;  4IQZ A;  3CME A;  1J5E Q;  2JA6 B;  1IW7 D;  1WTH A;  3GTO H;  4B9X A;  4OWT B;  3HOW B;  2A73 B;  3G6J B;  1VMP A;  2C5C A;  1PH9 A;  1Q82 C;  2CHB D;  1PV4 A;  1FNW A;  1YHB A;  3QOL A;  4KI0 A;  4EGV A;  1STH A;  3RZD H;  1KNE A;  3MXN B;  3PF4 A;  4LFC L;  4ALP A;  4V0B A;  1KC8 C;  4RGM A;  4A3B B;  2L12 A;  1PXU A;  3V05 A;  4BBR H;  3VYR A;  3SDZ A;  3PO2 H;  1X54 A;  3OYY A;  5C4X G;  1OTC A;  3VDY A;  1SYD A;  4OO1 I;  1K8M A;  1UNS A;  2BE5 D;  2I46 A;  3S2D H;  1N36 L;  4DR2 L;  3ULL A;  4QQB X;  5C0X H;  3QR8 A;  1HNW Q;  1N32 Q;  4CDD C;  1F9P A;  1WCM H;  1JR0 D;  4B3M L;  3F2C A;  4NXM Q;  3NK9 A;  1SYG A;  3PMF A;  1I4R A;  4JW0 A;  4DV0 Q;  3QO2 A;  4JC0 A;  3M85 A;  4K2K A;  3L9A X;  4CKE A;  1LYL A;  2F3I A;  1LTL A;  4E6I A;  2JA9 A;  5FLM G;  1A2T A;  1C8C A;  2AKW B;  1L0X B;  1TXY A;  1HXY D;  3CCV A;  4A3G B;  5DAU A;  3HOY G;  3RMH A;  1PTO B;  3I3C A;  1RHP A;  4GN4 B;  4DR4 L;  4UP8 A;  2XVS A;  3GP7 A;  4JG2 A;  2CKZ B;  5K5P A;  3QIA A;  1WFQ A;  2A74 C;  3VR5 A;  1I3Q B;  1KAW A;  2D0O A;  1WYD A;  4F88 A;  1I6H B;  1A2U A;  1B4O A;  2OEO A;  4A3E G;  2QGQ A;  3S9W A;  2D62 A;  1VS0 A;  3PUV A;  2EYJ A;  3D8G A;  1QOH A;  2E76 C;  1KAA A;  5CV8 A;  3FHW A;  4OO1 H;  3RZO H;  1IXR A;  1TR5 A;  1KRS A;  3PUX A;  5CBA E;  3UDF A;  1ICW A;  2M2L A;  4JI0 L;  2KBN A;  2PNH A;  4R4C A;  1EL0 A;  1WTW A;  1WTV A;  3J7A V;  4IN3 A;  4UP9 A;  4M1U B;  4YWM A;  2B2W C;  3S17 B;  4BY7 G;  4F7X A;  2X69 A;  1F9S A;  1ROD A;  4NDX A;  1X3Q A;  2AQ3 B;  3MA2 B;  3BZD B;  1G91 A;  5LL6 S;  1FJG Q;  5AFW A;  1BF4 A;  3R93 A;  5M5X B;  1MSH A;  4XIG S;  4JI6 L;  4KKT A;  1B70 B;  4FF4 A;  1RTO A;  3CQZ B;  4TQU S;  3NEL A;  3TRE A;  2F03 A;  5FO7 B;  2RBM A;  1ONL A;  3GTK B;  4Y7N H;  2NVT H;  4DV7 L;  4LF9 L;  1L1O A;  4NMZ A;  5M5Y B;  1RDP D;  4X3T A;  2L55 A;  1V1P A;  3J81 E;  3F1Z A;  2JJQ A;  3P20 A;  1K9M C;  3NTI A;  3MFY A;  4KKS A;  3MWY W;  2L4N A;  5AJ3 Q;  3CCM A;  1D5X C;  2EYO A;  4F87 A;  3M4P A;  4LF8 Q;  1VQ5 A;  2NZO A;  3D3R A;  1IBM Q;  1Q8K A;  4A3D H;  1JB3 A;  3BYY B;  4AYB B;  2EYM A;  1G51 A;  3U9S A;  3HOV H;  3AMU A;  5IWA Q;  2XNA C;  4DV3 Q;  4JI3 L;  3NBH B;  4FXK C;  4QY7 A;  1Y8N B;  1PFN A;  5EJW A;  1ASY A;  2R93 H;  1K8O A;  1HTL D;  1QVG A;  1KD1 C;  3Q22 A;  4DV5 L;  1SDF A;  1P8L A;  4BY1 G;  1FGB D;  2ZM6 Q;  3RD4 A;  3Q8D A;  2JEA I;  3RLF A;  1PZI D;  3CU7 A;  2UXC L;  3AQQ A;  1RKN A;  2Z4I A;  1YI2 A;  4NB3 A;  1M4V A;  1XNR L;  3GTO B;  1XJV A;  2NTS A;  2CH4 W;  3PUW A;  4UAI A;  4C1N I;  2SDF A;  1Q7Y C;  1VDZ A;  4R4Q A;  5IGG A;  3HP3 A;  2DUD A;  3RZD B;  1VQB A;  1D5M C;  4EQN A;  3I7F A;  2HDL A;  2NN6 I;  2ZTC A;  5EKL A;  3I4N H;  4IFD H;  2RCN A;  4BA1 I;  1H9R A;  1CM9 A;  5L37 A;  4X6A H;  4TSS A;  4BBR B;  1CI3 M;  4FXG C;  3OPO A;  1W6K A;  5DNF A;  1EIF A;  1D8L A;  3CPW A;  3PO2 B;  4H7B A;  5EBC A;  1YHQ A;  1MHW C;  2ICI A;  5I2Y A;  2IT1 A;  4BY7 H;  2XGT A;  2UUC Q;  1PH5 A;  3R8B A;  3S2D B;  1HNZ L;  1EFI D;  3H15 A;  3D4R A;  4GNX A;  1ET6 A;  2EYL A;  2IHF A;  1QZH A;  3VYU A;  5LMU Q;  3C3L A;  1DJR D;  4HED A;  1WCM B;  2QDL A;  3LX0 A;  4OIJ A;  3MFG A;  4IUT A;  1VMC A;  4F8M A;  2QEX A;  4U67 3;  4HJ9 A;  1HJP A;  4IUR A;  1VF7 A;  1YNJ D;  1GUS A;  4A3F H;  1HQM C;  4ABN A;  1ENA A;  3HKZ B;  4FNF A;  1SEB D;  1SAP A;  3L3O C;  4RFB A;  1U4R A;  2R7F A;  4BXX G;  4LK1 C;  4HIK A;  1S40 A;  4K5W A;  1BOS A;  4JVZ A;  3OOC A;  3RNU A;  1HR0 Q;  1G29 1;  4DR6 Q;  1FD7 D;  3HOU G;  1SMY D;  2VZA A;  1TWH B;  2WIN B;  4JBK A;  1J8I A;  4DAY A;  3L2P A;  2MGS A;  2F0E A;  5NUC A;  3E9H A;  4LNQ A;  1BBW A;  4RGO S;  4LAA A;  3EQL C;  1CQF A;  2Y0S E;  4IPD A;  1CZW A;  2MJ8 A;  3OW2 A;  4KY5 A;  4LUZ A;  2RDF A;  2JK8 A;  5IE8 A;  3RZO B;  2ZXO A;  1CZG A;  1SYB A;  2KA7 A;  2WAQ G;  4NPS A;  5E4W C;  1W2B A;  4XXE A;  3JAM i;  4OHJ A;  4PMB A;  2L1B A;  4APV A;  2JA6 G;  3S16 B;  1EY7 A;  3WDN A;  3U4Z A;  3KFU A;  2XRQ D;  3ZJY C;  3HOW G;  2RVL A;  3T1H L;  3HGB A;  3NTH A;  5IYC H;  4OON A;  2PCF B;  3QWN A;  4HJ7 A;  2KCM A;  3M4Y A;  3BDO A;  4AH6 A;  1HFN A;  1KL9 A;  2FHT A;  2LKV A;  2LXK A;  1X9N A;  1SE2 A;  2EJG C;  2TSS A;  1TWG H;  3FKI G;  4UP7 A;  4ODG A;  4L5S A;  1L1O B;  4KTA A;  1TWC H;  1WJJ A;  1V1P B;  1B1Z A;  3DEP A;  3IKJ A;  3UE0 A;  5BN5 A;  4Y7N B;  2NVT B;  4NP5 A;  1QWY A;  4G57 A;  3IAY A;  2FMM A;  4HCE A;  4IJL A;  5EQ0 A;  2A1A A;  2KEE A;  1E2Z A;  4YCW A;  1HZA A;  1EY6 A;  2L5T A;  1AW7 A;  4PZ7 A;  1VQD A;  3TP7 A;  2O5I C;  4ZKC B;  2NBF A;  1QVF A;  2LSS A;  1PZK D;  5E1F A;  2B2T C;  4A3D B;  2EE1 A;  3J7Y W;  1VQN A;  1IHZ A;  1N8R C;  3O13 A;  3CCS A;  3HOV B;  1QIL A;  1Q1B A;  3WOF A;  1T5X D;  4A3G G;  2F0L A;  5JJZ A;  4A3I G;  3AFP A;  1I4P A;  2A69 D;  4DNT B;  4POF A;  2JA5 H;  5FLX E;  2R93 B;  3D31 A;  4FP5 D;  4RKL A;  2NWG A;  1Q3L A;  5CR3 A;  1X3F A;  3A5Z B;  1JMC A;  4DV6 Q;  4G4K A;  3M4Q A;  4IOA A;  1SNM A;  2R92 G;  1JOQ A;  2CW0 C;  1I4H A;  5E4X A;  4Q0F A;  1TY2 A;  4POG A;  3T56 B;  1OXU A;  4WFN 3;  1E1T A;  1AEX A;  2GA4 B;  2A6E C;  1D5Z C;  3S1N H;  1BUV T;  4CJ0 B;  3CXC A;  1HZB A;  3M7N A;  1Q8I A;  3TS0 A;  2FFK B;  4YHH L;  1JE5 A;  1YNX A;  1A3U A;  3GV6 A;  3I4N B;  3DWA A;  4DAM A;  2KJX A;  3BVG A;  3MXG A;  2BCO A;  2K52 A;  2PZT A;  1BR9 A;  1NSN S;  3I4M H;  3E0E A;  4GNX B;  4NXN Q;  5HY6 A;  1JJ2 A;  5KIX A;  5CYU A;  2K5V A;  1LO5 D;  4R4O A;  4X65 L;  4BY7 B;  2K05 A;  2K14 A;  2RKS A;  2X6L A;  1CKO A;  3A5U A;  3ERQ A;  1CSP A;  1K3R A;  1LAB A;  2IY5 B;  2V1C C;  1STN A;  1QCB D;  3UDX A;  5A35 A;  2MP1 A;  3VR6 A;  3HOZ G;  1SYC A;  1LAC A;  1GJX A;  4YY3 Q;  2Z0S A;  3W3A A;  3FKI H;  4A3K H;  3CCJ A;  2CWA A;  2QEJ C;  1CHP D;  3NQI A;  4JYA L;  4J6H A;  3CF5 A;  4LFC Q;  3T51 B;  4A3F B;  2EIF A;  1NY4 A;  1X65 A;  3ONA B;  1CKN A;  3CD6 A;  5ELO A;  2NZ1 D;  3HRZ C;  1PLF A;  2QKI C;  1RD9 D;  1X3P A;  2XSC A;  3GTG H;  1JCK B;  3GTQ H;  4LFB L;  1LT4 D;  3MAQ A;  4BBS H;  1U4P A;  1CA5 A;  1SR3 A;  1N36 Q;  4DR2 Q;  1WVL A;  2ZTE A;  4AYB G;  1ICF B;  1PZJ D;  3NE5 B;  2MQH A;  3RN2 A;  2F0J A;  4DPG A;  3CMA A;  2C9O A;  4B3M Q;  4IPC A;  3NSW A;  4OL7 A;  1VQ8 A;  4A3I H;  4C3J H;  2HHH L;  4QGU A;  1EZ6 A;  3A55 A;  1BCP F;  1IYU A;  2CQO A;  3NP8 A;  3Q6S A;  1NAP A;  4BS9 A;  4UY8 C;  4HMJ A;  1HUN A;  2F0D A;  1B3A A;  1OXV A;  4JI5 L;  3FEW X;  1XMQ L;  4WJ4 A;  1TWA H;  4RH6 A;  1STY A;  1H9S A;  2VW9 A;  4Y52 H;  3KF8 A;  1G6Z A;  2WAC A;  3MEH A;  2B8F A;  4IO9 A;  1N9W A;  4DR4 Q;  4A3M H;  4IAL A;  2R92 H;  1EWC A;  2VY3 A;  5IP9 H;  4XT3 B;  1H9K A;  3JAM E;  1AP0 A;  3PV0 A;  5KYI A;  4BBR G;  1TWG B;  5FKA C;  5HUR A;  4X64 L;  1S5C D;  1EU4 A;  5DM6 3;  3PO2 G;  5ISR A;  1AE2 A;  2EY6 A;  1WTX A;  1TWC B;  1E0B A;  3OWF A;  4PG3 A;  4Q5V A;  4JI0 Q;  1KLG D;  1DOK A;  2AMC B;  1IW7 C;  2HCC A;  2Q8R E;  3SK5 A;  5C4H A;  5IGB A;  5C44 G;  5C0X G;  4IZ8 A;  2ICE C;  3I91 A;  3AEV A;  2D2C C;  3S15 B;  1MI2 A;  4DXG A;  2VQE L;  5A2Q L;  4ZKB B;  5IT9 L;  4X66 L;  1CHQ D;  4HCS A;  3FDT A;  3HOZ H;  3AFQ A;  3CQZ H;  2LMC B;  5CV9 A;  1BCP B;  1PRT D;  5C4Z A;  3NHH A;  1DXM A;  5JJL A;  1X3E A;  3HKZ G;  2F0W A;  4EVO A;  2K4K A;  1HH2 P;  3F2U A;  3WOE A;  4JI6 Q;  2E2I H;  2BE5 C;  2O4X A;  4GKJ L;  3X3M A;  4RGN A;  2JA5 B;  1EY5 A;  3T53 B;  1X6O A;  2E74 C;  1EY8 A;  3H0G G;  5ELF A;  4PNY A;  1HRJ A;  3PIO A;  3TP5 A;  1ZKO A;  3K5O A;  4LF9 Q;  4IUN A;  3CCR A;  4GLX A;  3N6R A;  4CBV A;  3IL8 A;  2HD3 A;  4CKC A;  3KYH C;  1SNP A;  1O7Z A;  1QUQ A;  4XT1 B;  1KIX A;  4OO1 G;  4RG1 A;  1Q90 A;  2OXP A;  1CQV A;  3S1N B;  1N34 Q;  4LJZ C;  4PZ6 A;  4MZ9 A;  3SGI A;  1X32 A;  5IT9 c;  4ZUI A;  5C0X J;  4K14 A;  3CHB D;  4XYQ A;  4JI3 Q;  5IYD H;  5CV7 A;  2OF1 A;  2P5Z X;  2A19 A;  3JAM L;  1B53 A;  1Y1V H;  3D6C A;  3V2T A;  1Y14 B;  3I4M B;  1JWU D;  1SNC A;  3V96 A;  4EQP A;  3H3V I;  2PQE A;  4DV5 Q;  3NEN A;  2Z1C A;  2KCC A;  4A75 A;  2WB1 B;  4YY3 L;  1STG A;  3HZX A;  3SK8 A;  1R4P B;  5M3M H;  5G3L D;  5FO8 B;  2Q2I A;  1A8V A;  4FXD A;  2UXC Q;  3UDI A;  2MFI A;  2OCE A;  1NCV A;  4IUV A;  4N9P A;  1VQP A;  1S5F D;  4DUY L;  1XNR Q;  2VL6 A;  1V8Q A;  3FKI B;  4A3K B;  1E2W A;  2QDB A;  3KBX A;  4FDB A;  5TSS A;  5HGT A;  2ENB A;  2B2W A;  3A8I E;  3ITP A;  5C44 H;  3K7A H;  5EPK A;  3H94 A;  1TS3 A;  2GVB A;  1F2Y A;  2O2L D;  1F2Z A;  4GKK Q;  3GTG B;  2EY1 A;  4NKL A;  4LUV A;  5I6W A;  3GTQ B;  2F0M A;  4BBS B;  3G7L A;  4A3D G;  5CMD A;  2OWO A;  1HNZ Q;  3JAM c;  2Q2H A;  3PIP A;  3HOV G;  1YJN A;  4ULL A;  3B6Y A;  4JI7 L;  1UE6 A;  4DK0 A;  3ZYY X;  1PTO D;  2KEC A;  4OX9 L;  4WRD A;  2B2U C;  4A3I B;  4C3J B;  1H9S B;  1EQT A;  2R93 G;  4LWC A;  4OWX B;  4BA2 I;  4C3I H;  3H0G H;  3H91 A;  3A56 A;  5COR A;  1TWH H;  4C3H G;  1TWA B;  1IBL L;  4HJ5 A;  3I73 A;  1XMO L;  4A3M B;  2F3V A;  3TRZ A;  2QIL A;  4AIM A;  2UUB L;  2R92 B;  2OTL A;  5EKK A;  3EN2 A;  1G8Z D;  4IUU A;  2A6H D;  1HFG A;  2D0P A;  1WTO A;  3CRL C;  4H13 C;  1Y69 U;  3URY A;  3I4N G;  4IFD G;  1UE5 A;  4DA2 A;  2I5H A;  3CCQ A;  3W1G A;  2K5N A;  3GD7 A;  1P16 A;  3KDF A;  1S4Z A;  3CRK C;  3D6W A;  1NR4 A;  1EOV A;  5D14 A;  2QA4 A;  3SE0 A;  4OEM B;  4HID A;  5C3E H;  3S16 H; 
#chains in the Genus database with same CATH homology
 1SN8 A;  3J81 i;  2R7F A;  3KOJ A;  2A8V A;  4BXX G;  4HIK A;  4LW1 A;  1S40 A;  2YU9 H;  3GTP H;  2UUC L;  2LXJ A;  4LUO A;  2E2H H;  1Z47 A;  4YWL A;  2YTX A;  2ZJR A;  4IPH A;  1SRU A;  2DGY A;  4IPG A;  3RNU A;  1HR0 Q;  1G29 1;  2FXQ A;  4EX5 A;  4DR6 Q;  5LMU L;  3PCO B;  2JA6 H;  3HOU G;  5LMN L;  2VZA A;  4KLK A;  1TWF H;  1YVC A;  4QL5 A;  4JI1 L;  4JBK A;  4P73 A;  3DM3 A;  4GOP C;  1HZ9 A;  1KXL A;  3K80 C;  3L2P A;  3HOW H;  3M3Y H;  2WB1 E;  3E9H A;  4LNQ A;  1BBW A;  3T1H Q;  3J7A 5;  2R7D A;  4DK3 C;  2VS1 A;  3PF5 A;  2Y0S E;  3STB C;  2N8N A;  4IPD A;  3ULP A;  5LMN W;  1JJG A;  3OW2 A;  4LUZ A;  4A3B H;  1VQH A;  2JK8 A;  2E5L L;  5IE8 A;  4A3F G;  2N49 A;  3ERS X;  3A0J A;  4H02 A;  5C3E G;  3IRB A;  4PZ8 A;  2BH8 A;  1O7I A;  2WAQ G;  4NPS A;  1OXS C;  5C0X I;  1W2B A;  2RF4 A;  3G48 A;  1UEB A;  1XPO A;  3BZK A;  5IYB H;  3JAM i;  3UDG A;  1XPR A;  1HR0 L;  1VQ7 A;  4DR6 L;  3W5O A;  1VQL A;  4APV A;  1Q81 C;  2JA6 G;  4A93 H;  2NN6 G;  1GD7 A;  1PHJ A;  1UE7 A;  2IHE A;  3G6E A;  4JOI A;  3AYH B;  1QUQ B;  3U4Z A;  3PO3 G;  3KFU A;  3ZJY C;  4IFD J;  3HOW G;  1N34 L;  3T1H L;  2UXD Q;  3CAM A;  5IYC H;  4OON A;  1HR0 W;  4HJ7 A;  3K8A A;  5DLQ E;  2ZJQ A;  1NBW A;  4HJ8 A;  2KCM A;  1CKN B;  1UWV A;  2KHI A;  4DR3 Q;  2JA8 H;  4A3L H;  3I2Z A;  1FL0 A;  4AH6 A;  2JEB I;  1HNX Q;  1KL9 A;  3GTJ H;  2LXK A;  1X9N A;  4EQ5 A;  3KF6 B;  1TWG H;  1PH7 A;  4OWW B;  1GKH A;  3FKI G;  4UP7 A;  3I4O A;  4L5S A;  1L1O B;  4A3G H;  2KCT A;  4QJF A;  3RN5 A;  1TWC H;  2WP8 J;  4C3H H;  3T1Y Q;  1VQM A;  1WJJ A;  4DNI A;  1Q1E A;  3GDE A;  1SE8 A;  3J7Z C;  1X55 A;  2Z6K C;  3UE0 A;  4HIM A;  1G6P A;  2B63 H;  2K5H A;  5HGQ A;  4AQY Q;  1XNQ Q;  4GOP A;  1I3Q H;  4IJL A;  2UXD L;  2A1A A;  1I6H H;  4YCU A;  4YCW A;  5IYC G;  3FP9 A;  1HZA A;  1Q46 A;  4DR3 L;  1I5F A;  2NVQ H;  3BU2 A;  1PH4 A;  4PZ7 A;  2R7Z G;  1VQD A;  2JA8 G;  2HT1 A;  3H3V H;  1HNX L;  2VUM H;  1QVF A;  1I94 Q;  2LSS A;  4YWK A;  3S24 A;  1NE3 A;  2B3G A;  4GN5 A;  2YYZ A;  3GTM H;  3W1B A;  4RMF A;  1VQN A;  3KF8 B;  4GLA C;  1N8R C;  2BA1 A;  3CCS A;  4ME3 A;  1BKB A;  1RIP A;  2PI2 E;  1W3S A;  1PH3 A;  3L7Z C;  1Q1B A;  3U4V A;  4A3G G;  2BH2 A;  1AH9 A;  2PQA B;  2I5M X;  1XTD A;  4A3I G;  3AFP A;  3WWV A;  4GKK L;  2YTV A;  2YTY A;  1Z9F A;  3F2D A;  2NVY H;  2UU9 Q;  4POF A;  5IY0 A;  1YJ9 A;  1X3G A;  4XTC S;  1L0W A;  2PI2 A;  4JI8 Q;  3PGZ A;  3D31 A;  4YHH Q;  2YV5 A;  3CW2 C;  4AQY L;  1XNQ L;  3D0F A;  3M4O H;  1E3P A;  4J15 A;  5FLX c;  3CC4 A;  3HKZ E;  4OXP A;  3HOX G;  1X3F A;  3A5Z B;  1JMC A;  4JI2 Q;  2ALY B;  3GO5 A;  3RLO A;  4DV6 Q;  1VQA A;  1QZG A;  4O2D A;  3S17 H;  1E1O A;  1T9H A;  4LF6 L;  1Y1W H;  2EQS A;  3M4Q A;  4IOA A;  4B3T Q;  3HFZ B;  2EXD A;  1I94 L;  2R92 G;  2GN5 A;  4X65 Q;  2VUM G;  1CKM A;  4POG A;  1JT8 A;  2ASB A;  2ZJP A;  4K0K Q;  1OXU A;  1WCM G;  1SFO H;  1E1T A;  2F52 A;  5GAG C;  5M5X H;  3S1N H;  2ID0 A;  1VQJ A;  1L2F A;  1VQ9 A;  3CXC A;  1HZB A;  4A76 A;  1EWI A;  1VQI A;  1PH6 A;  3M7N A;  2UU9 L;  4PMW A;  3TS0 A;  4YCV A;  4JI8 L;  4YHH L;  4R1J A;  1JE5 A;  1YNX A;  2Z6K A;  2JA5 G;  1FVI A;  1Q86 C;  1MJC A;  2RHS B;  1S72 A;  4DAM A;  4LFA Q;  3GTK H;  1B7Y B;  2K52 A;  4JYA Q;  4HJA A;  1M90 C;  4JI2 L;  1GO3 E;  2E2J H;  2RHQ B;  4DV6 L;  1K8A C;  3I4M H;  3E0E A;  1R9T H;  5M3F G;  3NEM A;  1N33 Q;  5M5Y H;  1K8G A;  4GNX B;  1MIU A;  4NXN Q;  5HY6 A;  1YBY A;  1Y1W G;  4B3T L;  3PO3 H;  4JBW A;  5GQO A;  5GAH C;  1JJ2 A;  2K5V A;  2OQ0 A;  1YJW A;  4R4O A;  1QVC A;  4MNO A;  4X65 L;  1VCI A;  2K14 A;  2AWN A;  1MKH A;  4K0K L;  3CP0 A;  2VQF Q;  1CKO A;  3A5U A;  2Q2T A;  1CSP A;  1U0L A;  4LFB Q;  4DV7 Q;  1K3R A;  2KHJ A;  2CCZ A;  2V1C C;  1NJI C;  2IY5 B;  3KDF B;  4AYB E;  3UDX A;  1E22 A;  2ATW A;  3HOZ G;  4X62 Q;  4LF7 Q;  4YY3 Q;  4KHZ A;  2B29 A;  2Z0S A;  3FKI H;  3I56 A;  4A3K H;  5BR8 Q;  1JB7 A;  1SMX A;  3CCJ A;  4LFA L;  2IX1 A;  2CWA A;  1VQC A;  1PH2 A;  4JYA L;  3CCL A;  4DR5 Q;  1EUJ A;  3CF5 A;  2UUA Q;  4LFC Q;  2HHH Q;  3I4M G;  2EIF A;  1NY4 A;  1X65 A;  3F8T A;  1N33 L;  4A3C G;  1D7Q A;  3E9I A;  1CKN A;  4NXN L;  3CD6 A;  3DLL A;  1U5K A;  5ELO A;  1IBK Q;  4DUZ Q;  1EYG A;  4JI4 Q;  2WB1 G;  1VQK A;  4IJH A;  1Q12 A;  1XMQ Q;  4JI5 Q;  5C4X H;  3CC2 A;  1VQO A;  2CWP A;  2VQF L;  3GTG H;  3M9B A;  2CFM A;  5EAY A;  4B3R Q;  3GTQ H;  5JJI A;  2Y0S G;  4LFB L;  3CME A;  4A4I A;  2R7Z H;  1J5E Q;  4BBS H;  5JJK A;  1SR3 A;  1N36 Q;  4DR2 Q;  4JCV E;  2ZTE A;  3L0O A;  4AYB G;  3GTO H;  4P72 A;  2MO1 A;  1CUK A;  4OWT B;  4X62 L;  2MQH A;  2HIV A;  4LF7 L;  3RN2 A;  1PH9 A;  5J3B A;  1Q82 C;  4IFD I;  1PV4 A;  1B8A A;  4DPG A;  5BR8 L;  2K75 A;  3CMA A;  2JA5 H;  2JA7 H;  4A3K G;  1YHB A;  4IPC A;  4KI0 A;  1VQ8 A;  1S3O A;  4B3M Q;  1VQE A;  3RZD H;  3MXN B;  3PF4 A;  2F4V Q;  4DR5 L;  2UUA L;  4LFC L;  4ALP A;  4C3J H;  4A3I H;  1KC8 C;  4QGU A;  2HHH L;  3S14 H;  1YIJ A;  1EQQ A;  3G71 A;  4LF5 Q;  2CQO A;  5FLM H;  4DUZ L;  1IBK L;  1PFS A;  4JI4 L;  4UY8 C;  3S2H H;  4BBR H;  1OXV A;  1PA6 A;  4JI5 L;  1XMQ L;  3HOX H;  3PO2 H;  1TWA H;  3S15 H;  1X54 A;  4X64 Q;  2VW9 A;  3OYY A;  3HOY H;  4WJ4 A;  4Y52 H;  5C4X G;  1OTC A;  4B3R L;  3VDY A;  3ULJ A;  4JBM A;  4IO9 A;  4OO1 I;  1N9W A;  4DR4 Q;  2IX0 A;  1J5E L;  3S2D H;  4A3M H;  1N36 L;  1CSQ A;  4DR2 L;  4BBS G;  3ULL A;  1NMF A;  2R92 H;  4QQB X;  1SLJ A;  3OTO Q;  1LUZ A;  1FGU A;  4HIO A;  1HNW Q;  3KJP A;  1N32 Q;  1WCM H;  2VY3 A;  5IP9 H;  4B3M L;  2VQE Q;  3F2C A;  2JA7 G;  4A3E H;  4NXM Q;  3I55 A;  2F4V L;  4TVA B;  4X66 Q;  3T1Y L;  4DR7 Q;  2XTI A;  4GS3 A;  4DV0 Q;  1HZC A;  4JC0 A;  3M85 A;  1IL2 A;  3PV0 A;  4LF5 L;  1VQF A;  1LYL A;  2F3I A;  4DV4 Q;  1LTL A;  1M1K C;  2JA9 A;  5FLM G;  1SRO A;  2MNA A;  4BBR G;  1AE3 A;  2AKW B;  5IP7 H;  4X64 L;  1TXY A;  3F2B A;  3CCV A;  3PO2 G;  4GOP B;  1K0R A;  2C35 B;  5E7N A;  1AE2 A;  3EIV A;  5M3F H;  3HOY G;  4MTN A;  4DR4 L;  4GN4 B;  4UP8 A;  4PG3 A;  4JI0 Q;  4JG2 A;  5K36 G;  2CKZ B;  2AMC B;  4A3M G;  4GKJ Q;  3TS2 A;  5C44 G;  3OTO L;  3S1M H;  1IZ6 A;  1WFQ A;  3J80 c;  5C0X G;  1HNW L;  3AEV A;  1N32 L;  1KAW A;  2D0O A;  1WYD A;  1X56 A;  1EIY B;  5IP9 G;  2VQE L;  1L1O C;  1YZ6 A;  4NXM L;  4X66 L;  4A3E G;  2QGQ A;  4DR7 L;  1KRT A;  5GRO A;  4DV0 L;  2N78 A;  2D62 A;  3HOZ H;  1VS0 A;  3AFQ A;  2I5L X;  3CQZ H;  3PUV A;  4R4I A;  2NVX H;  4DV4 L;  1E24 A;  3FHW A;  5GAE C;  4DV2 Q;  3RZO H;  5JJL A;  1IXR A;  1X3E A;  2K50 A;  3HKZ G;  5IP7 G;  1KRS A;  3PUY A;  3PUX A;  3K7U C;  5M5W H;  2ZTD A;  4A3C H;  2K4K A;  1HH2 P;  3UDF A;  4JI0 L;  4JI6 Q;  2E2I H;  2KBN A;  2PNH A;  4GKJ L;  2AHO B;  1A0I A;  4R4T A;  4R4C A;  3MEF A;  1WI5 A;  3BJU A;  1X6O A;  4P74 A;  3GTL H;  4JBJ A;  3H0G G;  1PH1 A;  4L5R C;  2VNU D;  4UP9 A;  3PIO A;  4YWM A;  3K81 C;  4LF9 Q;  2WAQ E;  4BY7 G;  2WFW A;  3CCR A;  4GLX A;  2N3S A;  4A3J G;  1JJC B;  4C2M H;  3KYH C;  1GVP A;  3RR5 A;  1QUQ A;  4DV2 L;  3J81 j;  1KIX A;  1FJG Q;  4OO1 G;  4RG1 A;  5FJ8 H;  4WJ3 M;  1N34 Q;  1MJE A;  4XIG S;  4DKA C;  4DUY Q;  4PZ6 A;  4JI6 L;  1B70 B;  4MZ9 A;  3SGI A;  5IT9 c;  5C0X J;  1EFW A;  3HKS A;  4TQU S;  3NEL A;  3TRE A;  4JI3 Q;  5IYD H;  1C9O A;  2HIX A;  3RLN A;  4P71 A;  4DAY B;  2A19 A;  4Y7N H;  3KF6 A;  1V9P A;  2NVT H;  3ER0 A;  1Y1V H;  3U58 A;  1Y14 B;  1PYB A;  4DV7 L;  1C0A A;  3LGJ A;  4LF9 L;  2NZH A;  1L1O A;  3H3V I;  3UE1 A;  4DV5 Q;  4BY1 H;  1J6Q A;  2L15 A;  3NEN A;  4A75 A;  3F1Z A;  2JJQ A;  4YY3 L;  5ELN A;  1K9M C;  5M3M H;  3J81 c;  5AJ3 Q;  2Q2I A;  1A8V A;  3CCM A;  1FJG L;  5JEA G;  3M4P A;  3UDI A;  2UXC Q;  1KHI A;  2MFI A;  1BBU A;  4LF8 Q;  2OCE A;  1VQ5 A;  2NZO A;  4L5T A;  1IBM Q;  1Q8K A;  5FJ8 G;  4A3D H;  4GNX C;  1VQP A;  4DUY L;  4B3S Q;  1XNR Q;  1G51 A;  4IOC A;  3HOV H;  5IWA Q;  3BZC A;  4DV1 Q;  2PMZ E;  3TQY A;  2R6G A;  2VL6 A;  4DV3 Q;  4JI3 L;  3NBH B;  2MO0 A;  4QY7 A;  4JI7 Q;  5IYD G;  1A63 A;  4P75 A;  3J80 i;  4FDB A;  4DK6 C;  4A3B G;  1NMG A;  4OX9 Q;  1C7Y A;  3JC6 6;  1ASY A;  2R93 H;  1Y1V G;  1I50 H;  1OXX K;  2OQK A;  4QIW E;  1QVG A;  1BVS A;  1KD1 C;  4DV5 L;  2JE6 I;  1P8L A;  3K7A H;  5C44 H;  2PQA A;  4L5Q A;  4BY1 G;  2GVB A;  2UXB Q;  2ZM6 Q;  3Q8D A;  5IYB G;  3CCU A;  2JEA I;  5C4J H;  3RLF A;  4GKK Q;  5AJ3 L;  5M3M G;  4DR1 Q;  2UXC L;  1IYJ B;  2AWO A;  4A93 G;  4LUV A;  3AQQ A;  1IBL Q;  4LF8 L;  1YEZ A;  3S1Q H;  1YI2 A;  1IBM L;  1DGS A;  4NB3 A;  1XMO Q;  2KEN A;  4KHP Q;  4GLV B;  4A3D G;  4B3S L;  2OWO A;  1XNR L;  1HNZ Q;  4JV5 Q;  3JAM c;  2UUB Q;  1XJV A;  5IWA L;  2Q2H A;  4DV1 L;  3PIP A;  3EBE A;  3HOV G;  3CC7 A;  2HQL A;  1YJN A;  4DV3 L;  3PUW A;  1OXT A;  4LF6 Q;  3B6Y A;  4JI7 L;  1Q7Y C;  1UE6 A;  1PYS B;  3A74 A;  4R4Q A;  1K73 C;  2GVA A;  2DUD A;  4O0A A;  1GM5 A;  4LF4 Q;  1E7Z A;  4OX9 L;  4A3L G;  1VQB A;  3I7F A;  2ZTC A;  2NN6 I;  1YHA A;  3I4N H;  1PVO A;  1YIT A;  2R93 G;  4LWC A;  4OWX B;  3STB D;  3CCE A;  2ES2 A;  2RCN A;  4BA1 I;  4BA2 I;  4C3I H;  1VQ4 A;  2UXB L;  4X6A H;  2ZM6 L;  2JQO A;  5JEA J;  3H0G H;  2OTJ A;  1TWH H;  1EIF A;  1D8L A;  1VQG A;  3U50 C;  3CPW A;  4DR1 L;  1YHQ A;  1ASZ A;  4BXX H;  5H1S E;  2E8G A;  3PUZ A;  2BA0 A;  2IT1 A;  4HJ5 A;  1PH8 A;  1IBL L;  4BY7 H;  2B63 G;  2XGT A;  2UUC Q;  1XMO L;  1PH5 A;  1KQS A;  4KHP L;  3PSI A;  3TRZ A;  4A3J H;  1HNZ L;  4JV5 L;  4AIM A;  2UUB L;  5GAD C;  1NTG A;  1WOC A;  3H15 A;  1EQR A;  2OTL A;  1K83 H;  1VQ6 A;  4GNX A;  3HOU H;  2IHF A;  1QZH A;  3EN2 A;  2Q2U A;  2H5X A;  3KLW A;  5LMU Q;  3TEH B;  2D0P A;  5LMN Q;  1V1Q A;  4JOI C;  1LM0 A;  4JI1 Q;  1A62 A;  3KJO A;  4LF4 L;  1XPU A;  2QEX A;  3ICE A;  4UPA A;  3I4N G;  4HJ9 A;  3K0X A;  1HJP A;  1V43 A;  1UE5 A;  4IFD G;  2I5H A;  3CCQ A;  3W1G A;  2K5N A;  3GD7 A;  1P16 A;  3KDF A;  3S1R H;  2I0Q A;  1H95 A;  3G4S A;  1RL2 A;  4GN3 B;  4A3F H;  3CPF A;  1EOV A;  2QA4 A;  2E5L Q;  3S16 H;  4HID A;  5C3E H;  1UE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...