5E4WC

Crystal structure of cpsrp43 chromodomains 2 and 3 in complex with the alb3 tail
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
105
structure length
105
Chain Sequence
QVFEYAEVDEIVEKRGKGKDVEYLVRWKDGGDCEWVKGVHVAEDVAKDYEDGLEYAVAESVIGKRVGDDGKTIEYLVKWTDMSDATWEPQDNVDSTLVLLYQQQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Thioredoxin-1
publication title Structural basis for cpSRP43 chromodomain selectivity and dynamics in Alb3 insertase interaction.
pubmed doi rcsb
source organism Escherichia coli o157:h7
total genus 16
structure length 105
sequence length 105
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5e4wC02
3Q6SA 2NYZD 2B2WA 3MWYW 1B53A 2J7ZA 4CJ2C 2B2YC 3DEOA 3KBXA 2L1BA 4X3KA 4UAIA 5T1GA 5CBEE 1DOMA 1QNKA 1SDFA 3P7JA 1ILQA 3KUPA 4XDXA 1AZPA 1CA5A 2RA4A 1B2TA 1RTNA 3IFDA 3FPUB 5D65A 2X6LA 1U4LA 2B2TA 4IURA 1CA6A 2NZ1D 1C8CA 2DY8A 1WTOA 1IL8A 2DY7A 5EPJA 1G2SA 5AFWA 4X3UA 2RSOA 4XT3B 1ILPA 4CJ0B 5T1IA 3N52A 2IL8A 1WTQA 5EQ0A 5D14A 1A15A 2L12A 3F2UA 1IKMA 2EOTA 3I91A 4HCSA 2L9HA 4ZLTF 1HFNA 2JYOA 4OIJA 1G91A 2B2VC 2B2UC 3I8ZA 1NR2A 1ML0D 1PFNA 1PFBA 1J9OA 1S4ZA 1B4OA 4RA8A 1EIHA 1ZXTA 4ZAIA 1EIGA 3HP3A 1O7ZA 1GUWA 2MPMA 3D6WA 2FJ2A 3R93A 1B3AA 1QE6A 2K1BA 2NWGA 4ZKCB 2B2YA 2KVMA 1F9QA 1MI2A 3SVMA 1F9RA 4XT1B 1WVLA 5CMDA 5EKIA 2FFKB 2FMMA 1RODA 2SDFA 3QO2A 5CBAE 1WTWA 2N88A 1ESRA 4IUTA 2L4NA 2R3ZA 1MGSA 2X6GA 3GV6A 4LMQD 5CORA 1F9SA 1MSGA 5EPLA 1AZQA 2FHTA 2D9UA 1HRJA 3ONAB 2MP1A 1EL0A 3DM1A 4NW2A 1J8IA 1Q3LA 3FDTA 1XX8A 4MHEA 4R8IA 2K28A 2KEDA 4RWSC 2MGSA 2EE1A 3GV3A 3MTSA 4O42A 2HUGA 4RAUC 1HUMA 1RHPA 4HEDA 3TZDA 4IUPA 1DOLA 1QG7A 4OIKA 1SSOA 2M2LA 4HAEA 5E4XA 1E0BA 3H91A 2JP1A 4ZK9B 4CJ1B 2B2VA 2B2UA 1RJTA 1G6ZA 2KUMA 1BO0A 1VMPA 2HDMA 2MJ8A 1BNZA 3LWEA 3I90A 1LV9A 1MSHA 5EJWA 1WTXA 2N55A 1HUNA 1WD0A 1X3QA 4X3SA 1KNEA 1SAPA 1X3PA 2FINB 3I3CA 2Q8TA 1O7YA 2HDLA 3UI2A 2HCIA 1XYIA 1HA6A 1JICA 1HFGA 2HCCA 4U68A 1NAPA 4R9WA 4ZKBB 2K04A 1DZ1A 1X32A 2B2WC 3IL8A 1RTOA 2KEEA 1U4RA 1NCVA 1F9PA 1BF4A 2H1EA 1JE4A 2KECA 4QUCA 2RSNA 2Q8RE 1U4MA 1F2LA 1O80A 1EOTA 3G7LA 1PFMA 4X3TA 1CM9A 1WTVA 1IKLA 4IUVA 2K05A 2B2TC 2KOLA 1VMCA 5JJZA 4IUQA 1M8AA 2K01A 2L11A 1NR4A 1DONA 3TN2A 1WTPA 1BBXC 1KNAA 1ICWA 2RVLA 1AP0A 1G2TA 2VXWA 4DN4M 1PDQA 2XIWA 1WD1A 4IUUA 2CVRA 1EQTA 1WTRA 2BDNA 5COYA 2K03A 1TVXA 4MN3A 1PLFA 5DNFA 5E4WC 4QUFA 3DEPA 1HHVA 5EPKA 1U4PA 4HSVA 2EPBA 2X69A 1B50A 1DOKA
chains in the Genus database with same CATH superfamily
5LL6S 2NYZD 1K8MA 3MEFA 2N3SA 2QKIC 1N33Q 1H9MA 3OOCA 3M3YH 1X65A 3L3OC 1QNKA 3CCEA 2CH4W 1Z7TA 3TP6A 1C8CA 1LLRD 3ERQA 4OGQC 2A8VA 4JVZA 4MNOA 1AH9A 1PZJD 3I4MG 3N52A 4HJ9A 1M4VA 3SEBA 1VS0A 2CHBD 5LMUL 4IPDA 1Q86C 2NN6G 1S5DD 5GROA 1Q82C 1QVGA 2YTVA 3VYUA 1HR0Q 3VR4A 4A3IH 2FFKB 1LTGD 5C5LA 1XTCD 2KHJA 1ENFA 3F2CA 5EPLA 4EX5A 1V1PB 4DK0A 1HTLD 4QIWB 4BY7G 1B1ZA 1C4QA 2UUAQ 3GTOB 1Y8PB 4A3BB 3M4PA 2A5HA 2ZJRA 3MTSA 4A3LH 4JK1C 5C6AA 3C2PA 1K83H 3HOWH 3HOVB 4WJWA 1K8AC 5M3MH 3I90A 4ALPA 1FGBD 5ISRA 1HUNA 5CV4A 1ZEQX 3A54A 5HURA 1KNEA 1NE3A 1FJGQ 3TBIB 2HDLA 2HCIA 1K8GA 2L0CA 4A75A 4QY7A 2IX0A 1NJIC 1ET9A 4B08A 3FMCA 3H6MA 3SE0A 5EGTA 2F0KA 4RGOS 1PRTC 4PQXA 4IUVA 1XMQL 2F0OA 1STYA 3E0EA 2D2CC 1BXTA 3CRKC 3HGBA 3MZ5A 3RLNA 2NVYB 1LO5D 3DMUA 4FF4A 1AP0A 1BBWA 2VXWA 3QWNA 4DN4M 1EYGA 4XQNA 3CQZB 4DV6Q 3K7AH 4OELB 5E4WC 1V8QA 3E9IA 5J3BA 3CF5A 1I4PA 1VQ4A 4G7OC 1JB7A 1PH4A 1F2MA 5A2QL 1N8RC 5I2XA 4JCVE 1VQJA 5JJKA 1A0IA 4UAIA 3F2BA 5GADC 4X62L 1VQLA 4A3GH 5M3FG 2WB1G 3K6OA 3IFDA 3CC4A 1IBMQ 2DY8A 5CR3A 3R2IA 3F2DA 4K14A 1LT6D 1SEBD 3OPOA 3P1HA 3RZOB 1PTOF 3OWFA 4HCEA 1K0RA 4XQJA 3KJPA 3S1MB 2RHSB 1HH2P 2B63H 1IKMA 4JG2A 3I91A 2E5LL 1TWGH 3G71A 5A35A 2R93G 1HPCA 1TKWB 4DK1A 5FLXL 2K52A 3WDNA 3HP3A 2BE5D 1CUKA 3D6WA 4LUZA 4IN3A 1D7QA 3K8AA 2ES2A 1VQGA 2F0IA 4DNTB 4JBJA 2R3ZA 1HJPA 2RHQB 2XWBB 1M1KC 1J8IA 2L55A 3E0JA 2NN6I 2R7FA 1RD9D 2GN5A 2IY5B 3S16H 3NP8A 2CW0C 2XN9C 3J81i 3TREA 2MNAA 3KF6B 2M2LA 3H15A 2ZM6L 4JI1Q 3C1EA 1LTLA 2BOSA 1WTXA 4CBVA 4L5RC 4PZ7A 5IP7H 3HOYH 2UU9L 3U4ZA 3OW7A 3GTKB 4H0LC 3VA5A 4U68A 2EYOA 3KF6A 4BS9A 1ZKOA 2TSSA 4H7BA 2F4IA 3AYHB 4LF5L 4J1MA 1UE6A 4QUCA 1IHZA 2Z1CA 2Q8RE 3H0GG 3Q22A 1O80A 3G7LA 1GVPA 4DV5Q 1XJVA 4KD3A 1ZYRC 2R92H 3VR6A 1JOQA 1BCPC 2CH4A 4PV1C 2E74C 2VL6A 1SFOH 1H95A 1JOKA 3NENA 2DNEA 3BZDB 4GZYC 1H9JA 1IW7C 1PLFA 3NELA 2UXBL 2AUKA 2RKSA 4HJAA 1DOKA 3Q6SA 3U58A 2Z6KC 4M8AA 1QUQB 2F3VA 3TS2A 1XPUA 3CP0A 3FHWA 4RGMA 2ZTDA 3RUZA 4DR3Q 2NZHA 3DM3A 1KQSA 2NVQB 4KY5A 1I4RA 1OXXK 4GKKQ 2EYHA 1B9MA 5ELOA 4ULLA 1H9RA 5LMNL 4JBMA 3I4MH 1MKHA 2B2VC 2VNUD 1LM0A 1B4OA 2WFWA 1JORA 2BA0A 3SK4A 3R93A 4PG3A 1XXGA 1F9RA 5CMDA 4H44C 4TQUS 4DNRB 5C4XB 1AZQA 2NN6H 1YBYA 5CV7A 3A55A 4MHEA 4OWTB 4HIKA 5IYBG 3KDFB 1D1KA 5JVG3 4ZUJA 1Y8NB 3CU7A 4LFCL 4BY7H 4OIKA 2NVTB 3LWEA 1LV9A 1FNWA 4OO1G 3HRZC 1EYCA 4DR5Q 1I6VC 4C1NI 1GD7A 1TWAB 4KHPQ 4HIMA 2HHHL 3J81L 2Z4HA 1EEID 2N49A 4JI2Q 4R9WA 2K04A 1X55A 1PTOD 4EQOA 1F9PA 2Q2IA 5FJ8G 3S1QH 4A3DB 2WAQG 3QB3A 5FKAC 1C7YA 1MD2D 4PMCA 3PGZA 2KHSA 1N36Q 1X3GA 3DWPA 5JJZA 3VA7A 2G5DA 1P8LA 1BBXC 1JWUD 1PZKD 1H9KA 1YNND 2PW7A 4RHRA 3B6YA 1JC7A 5IYCG 4A76A 1EOVA 3UDIA 1IXRA 1EQTA 4DR7Q 4EGVA 4UHVA 5IIFA 1XPRA 3NXWA 3DEPA 1WOCA 3K0XA 2K7VA 3CHBD 2X69A 4IUPA 3M4OH 3HZXA 1A2UA 3EROA 3KBXA 4GKJL 5BN4A 4LFBQ 2B8FA 4GNXB 4P2CB 4LF7L 1L0YB 5FLXE 4A93G 2LFNA 4YCWA 1SBBB 3T53B 4XT3B 1CHQD 1C48A 1Y1VB 5CV9A 5EQ0A 4JI4L 2F3WA 4GNXA 2ICEC 1L1OB 5DEHA 4DXGA 4A3FH 2JYOA 3S1NB 3HOUB 2EDGA 2IHFA 1ML0D 4OEMB 5IODA 1O7ZA 1GUWA 4J6HA 2FJ2A 2UUBQ 4B3TL 1DCZA 2KVMA 5ELNA 2PQAA 4C3JH 3W2DA 3BS1A 2R93H 1HR0W 4WFN3 1N9WA 3EN2A 2R7ZH 3MFYA 5C3EH 2IW3A 1A3TA 5EKKA 1RIPA 2MO0A 1MSGA 1W6KA 2OQKA 1D6EC 2XGTA 1K3RA 1QVCA 1I3QH 1QNUA 1TT2A 2WP8J 3TZUA 1L0XB 1Y1WB 1PFSA 1CKOA 2A6EC 3QOLA 4K2LA 4IJHA 4I7ZC 1N34L 1E2WA 2F0NA 4EVOA 3T1HL 2NVXB 5G3LF 1QG7A 4AQYL 1KDAA 1E0BA 4CKEA 1YNJC 2B2UA 3NSWA 4JOIA 1O7IA 1MSHA 3HOXG 3U50C 5LMUQ 2K50A 1IZ6A 1FGUA 2E2JH 1EQVA 5JEAJ 1J6QA 3AEVA 1UEAB 3KK7A 1KDCA 3KLWA 2CWPA 4RKBA 4OO1I 1CM9A 4JBWA 3OIPA 1WTVA 1SYGA 2F0HA 2JA7G 2OTJA 2L11A 1SYFA 5JJLA 3H0GH 3K5NA 1WTPA 2ATWA 1CZGA 3J7AF 3JAME 3SK5A 1XWEA 5JPMC 1JE5A 4DFAA 2E2IH 4KY6A 3GD7A 3FP9A 4LF8L 5IT9E 2PCFB 3PUYA 4WJ4A 1ASYA 1SE8A 2FMCA 2B2WA 1YJWA 5L37A 2Z9HA 4C3IH 5ELDA 4A3MG 1V43A 3S2HH 1Q8KA 4PZ6A 4CHTB 1RTNA 2ENBA 2WINB 4QQBX 5D65A 1CA6A 4BA2I 4L6TB 3M7NA 4KKTA 4DUZL 4K5WA 2JA9A 4B9WA 1VQAA 1R4QB 2K5HA 1SE4A 1SJHD 1JQYD 1HNXL 4RCNA 1JT8A 2NUCA 2CFMA 2L9HA 4NXMQ 3PF5A 3D3RA 4DA2A 4X66Q 3IFTA 2A69C 4JI0L 4C56C 1LT3D 4JW0A 4IFDJ 2XTIA 4G7ZC 4NXNQ 5CBAE 2K5DA 2VQFQ 2PNRC 3I4LA 3J80c 3ONAB 3DM1A 3ND9A 4LWCA 3NTIA 4GLVB 2XRSD 5IGGA 1HUMA 1KL9A 2A6HC 1RHPA 2C9OA 4QF4A 3TZDA 3CAMA 3ULLA 1SMYC 2AWOA 2DN8A 1EQRA 1HZBA 1W6JA 1HTPA 2KCCA 5IYBH 1GUNA 1PH3A 3SR1A 5EJWA 3GTQB 3S15B 3Q8DA 3FKIB 3A7LA 3KJOA 1X9NA 4FF1A 2B39A 4GOPC 1EYDA 3D4DA 3RN2A 2Y0SE 3CCUA 3P20A 2JA5G 4OO1H 2PQEA 1GUTA 3UDXA 2RSNA 1EOTA 3VYRA 1DM0B 3J81j 2CQAA 4DUYL 1EY0A 1VQ6A 4YWKA 2EJGC 1U5KA 4IUQA 4DV7Q 1C0AA 4RHSA 4S3SA 1EEFD 5FJ8H 5KNDA 5DM63 4AIMA 4A3KB 4KHZA 3VR3A 5GQOA 3S17H 1KNAA 2F0TA 2VB2X 3K81C 3PMFA 4X64L 1IBLQ 5DM73 1PDQA 4FP5D 4IUUA 4JI7L 4OXPA 1Z6HA 3AQQA 3IRBA 3GTGH 4G57A 4JI8Q 1JWMD 5M5YH 1NUCA 3ZYYX 1E2ZA 4HSVA 4FVMA 3K58A 5IYCH 1JOOA 5K5PA 3TS0A 2UU9Q 4BBRB 4IZ8A 3SDZA 1MBYA 4YCUA 2EQSA 3V2TA 1FL0A 4DV0L 1I50B 1GM5A 1RF2D 2YU9H 2E2HB 1AZPA 2EJFC 4DXFA 4V0BA 5F2DA 1JR0D 1KC8C 2UXCL 1BUVT 2B2TA 1T5XD 4OX9Q 2ID0A 3BYTB 1H9SB 4C2MB 4IOCA 3GTPB 2RQXA 1PXUA 3BDCA 2IL8A 2RDHA 4A93H 3GTLB 1YZ6A 4APVA 1Q7YC 2ASBA 1TWHH 2ICIA 2KJXA 1H9SA 2BE5C 4BY1B 1VDZA 3NBHB 4NMZA 3PQIA 2UXBQ 5BR8Q 5LHY1 2QEXA 3PO2B 1VQKA 2EXDA 1STAA 2KA7A 1D2BA 3J7ZC 2N88A 2Y0SB 4KN4C 1SYDA 3L2PA 2D9UA 2MP1A 1EL0A 1A3VA 2P5ZX 4A3BH 4RGNA 3NBHA 3M4YA 2O5IC 1UAPA 3GV3A 3W1BA 4WRDA 4DF7A 3RD4A 4ODGA 3UE1A 4DNIA 4EQ5A 1SSOA 3I4NB 3PSIA 1AW7A 1VMPA 4EQNA 1O78A 4FO2A 1WCMG 3AMUA 5LMNQ 4LUVA 4BBSG 2XNAC 2NZOA 4DR2L 4PMWA 1SAPA 1SE3A 1VQPA 1KIXA 3CPWA 2BCOA 1Q12A 1X6OA 1TXYA 3D4RA 1I94L 3HOXH 1I6HB 2QDLA 4V190 1G51A 2PI2E 2KECA 2WKCA 3MXUA 5C4HA 3RNUA 2LY7A 5EBCA 3F8TA 1GUSA 3G48A 4DAPA 1ESFA 2O2LD 3LNNA 4OWXB 2NVYH 3L7ZC 1SNOA 1V1PA 3NK9A 3BVMA 4DR4L 4FXDA 1G2TA 4LFCQ 2JA7H 2RDGA 2PZWA 3T1YQ 3KOJA 1GHJA 4K0KQ 4BXXG 5COYA 3M9BA 1IYUA 1TVXA 4DV3Q 3CCMA 1PRTF 5HY6A 1WYDA 1B53A 1B9NA 5T1GA 5FOBB 3NQIA 1STBA 2PYKA 2EY2A 5JAVA 1KTKA 5I4DA 1EUJA 1PTOB 3RZOH 2HQEA 4A3IB 1WTOA 4A3MH 3S1MH 1S5CD 1PYSB 2IT1A 1EU4A 2OF1A 3JAMi 5AJ3L 3U4VA 2HQLA 2SOBA 1I4GA 2XVSA 3STBC 4YWLA 1S4ZA 1PFNA 1J9OA 1MHWC 3DWAA 1K83B 4DR1L 2EXZA 1YJ9A 2CCZA 4LFAL 3TQYA 3E5SA 4NPSA 1B7YB 1UEBA 3NEMA 4PZ8A 1RODA 2Z4IA 5M3MB 1WTWA 3OMCA 3SXHA 4A3FG 3H09A 4CDFC 4R8IA 4P74A 4Z9CB 2F3IA 5C44G 3W3AA 1A63A 2RBMA 4C3JG 2VY3A 4JYAL 2R7ZG 5C3EG 1X3FA 2Q2TA 4PMBA 3PV0A 4LUOA 2LXKA 1CHPD 1KAAA 1E1TA 3K5OA 4CDDC 1E24A 5C4JB 3GTKH 3I3CA 3NPPA 3BVZA 1OXSC 5KNCA 3UI2A 2KCMA 3QIAA 4B3TQ 1G291 4KI0A 3K7AB 4L5TA 1U4RA 1TWFB 2YV5A 4B3MQ 2K5QA 3C3LA 4DV1L 4C1NK 2I46A 1PFMA 1EWIA 3ND8A 1ENCA 1A3UA 2JA5H 1IYVA 1JMCA 2NTTA 1QILA 3TN2A 4E6IA 1EY6A 2ZXRA 3A7AB 1TS4A 4R4OA 4IPGA 3PO3G 1J5EL 4JI6L 1XNRL 1A62A 4KKSA 4LW1A 1B8AA 2ZJQA 2DJGC 2JEAI 3OWEB 4DAYB 2OCEA 1YI2A 5IWAQ 3MAQA 4KD4A 3HOZG 2L1BA 3TMEA 2L15A 2QA4A 4DR6Q 1N32Q 1BCPF 1E7ZA 3I70A 1YVCA 5ELEA 1ASZA 1E22A 1B2TA 2NVQH 2X6LA 1U4LA 4F7XA 3FPPA 2VUMG 3HG9A 3PCOB 5EPJA 5FK9C 3T16A 4DAYA 1PHJA 2D62A 1PH7A 1XNQL 2MFIA 2AUJD 4C3IG 4N9TA 1JB3A 3K57A 1JJGA 5LL6X 4R4QA 1BVSA 1NR2A 4KJNA 1ZXTA 2HIXA 4DAMA 2K1BA 2NWGA 2KQ3A 3JAML 1YJNA 3GTMB 4Y7NH 2EY5A 2JJQA 1XMOQ 3EJIA 1ESRA 4KKUA 5IT9L 3Q0AA 3I56A 3NWSA 1BQQT 1QUQA 3I2ZA 1AN8A 2JE6I 1SNCA 2Z6BA 4XTCS 1NMGA 4DUZQ 1I4HA 1PYWD 4IPCA 1PRTD 4N8X1 3SK8A 1ICFB 1G6ZA 4B3SQ 4RCOA 4BWGB 2NB0A 4POFA 1VQ5A 1HNZQ 2QCPX 4B9XA 1WD0A 1IBKL 3CD6A 2FINB 1O7YA 5CC4A 1WCMH 1X3EA 4BBSH 1X32A 3D0FA 4FYDA 1HR0L 2G9HD 3OIQA 4LJZC 1LACA 2K05A 1VMCA 4LK1C 1STEA 4HJ7A 3CMEA 5FLXc 2JA6B 3I73A 5I9PA 1HNWL 1U9RA 3KDFA 5NUCA 1D5ZC 1A6XA 1WD1A 2O4XA 4HTHA 3A5UA 1PMRA 3GQBA 2BDNA 2E2DC 3M85A 1HHVA 2TMPA 2YYZA 2D0OA 1U4PA 4YIJA 3S2DB 2D0PA 4MTNA 2LMCB 2Z8LA 5M5XH 5C0XJ 4CJ2C 3I4MB 4BXXH 1TQOA 2F03A 1DOMA 1SDFA 1F77A 4P75A 1VQHA 2RA4A 4DV4Q 4R8NA 4GN4B 2F4VQ 4DUYQ 3DLLA 4BY1G 5C3WA 5FLMH 4J8QA 3ZJYC 1HQRD 2KCTA 3M4QA 3I72A 3RZDB 3PO2G 3HOUH 5D3IB 5E1FA 2WB1E 4ABNA 3A0JA 1SNDA 4JI7Q 1Z9FA 4JBKA 4ZAIA 1O7LA 4DV6L 1TU2B 2MQHA 4HMJA 4BY7B 2B2YA 1DXMA 1LTAD 1MI2A 2DJFC 5IGDA 2SDFA 4KN7C 5CORA 4ME3A 1W2BA 2RF4A 2F0UA 3GP7A 2K6AA 4NW2A 4P73A 2UXCQ 1SNPA 4FNFA 3EFXD 3D6CA 4RWSC 3ITPA 2EE1A 2AMCB 1IBML 2NVXH 3S1QB 1TWCH 4B3RL 5C4ZA 2JQOA 4DKAC 1ZYRD 2JA8B 4C3HB 1TY2A 5C44H 1AFPA 3UE0A 1QOHA 1OXVA 2JEBI 1BCPD 1BOSA 4A3BG 1E3PA 2B3GA 4TVAB 1VQDA 1L1OA 1BKBA 2ZXOA 1VQ7A 3IAYA 3HOVG 4CDEC 1IW7D 2QEJC 2ZT9C 1BF4A 3ULJA 3W5OA 4HMIA 4P71A 4ZUIA 3VYSA 2RCFA 1CI3M 1CFMA 1IKLA 3M4OB 4NB3A 3G6EA 1QZHA 1YHBA 4A3EB 1V1QA 2PZUA 1I5FA 2K32A 1VQIA 3J7AV 3CKIB 4KMUC 4X65L 4GNXC 2CVRA 4WJ3M 1QVFA 2UXDL 5M3FB 5I6WA 1VQ9A 2WB1B 2LXJA 4AH6A 2PW5A 4JI3L 3S14H 4GN3B 1RKNA 3MC0B 4DPGA 3PO3H 4Q5VA 4DR2Q 3MWYW 4LNQA 1HZCA 3ERSX 4IALA 1CQFA 3CMAA 1HA5A 4K5VA 5CBEE 2VB3X 4DV2L 3S24A 1OTCA 5E7NA 1WFQA 4HJ5A 3BVGA 1D5MC 4LAAA 4ME5A 1V9PA 1KRTA 4IO9A 2R93B 3HOZH 1IL8A 2EYJA 2DY7A 4JPBW 4DV5L 2EZVA 2I5LX 2RSOA 4UP9A 3X3MA 2VUMH 3J81c 4DR4Q 2A68C 1R9TH 4KY7A 2B2UC 2IX3A 2QGQA 4JOIC 3WOEA 1AE2A 1B3AA 3WWVA 2F0SA 5IGFA 3SVMA 3HEJA 2BH8A 4IJLA 1FNUA 2NBFA 3S1RH 1MGSA 4UPAA 2E2JB 1XMQQ 3HKZE 1NBWA 3PIO3 4YWMA 1L0WA 5JEAH 2MHVA 1CQVA 4ZCKA 2I5MX 4RAUC 1NNXA 4DR3L 1L2FA 4K2KA 4RGTA 2A19A 3K7UC 1WI5A 2B8GA 4HAEA 1QCBD 2EYFA 3MXPA 3S15H 1Z47A 2KUMA 1ENAA 1SROA 1TS2A 3H0GB 1CTMA 4X3SA 5GAEC 2Q2HA 1SLJA 2YTYA 2Z0SA 4DR1Q 3C46A 1HFGA 4CKBA 3PUVA 1U0LA 4I7AA 4X62Q 2B2WC 3GDEA 3PIOA 2AWNA 4A3CG 3OW2A 2PO4A 1F2LA 5GAHC 4H13C 3K59A 4QMGA 1D1IA 4QB4A 2E8GA 3C1FA 2E5LQ 3O13A 2OTLA 2WAQE 4JYAQ 3KBGA 1EYAA 3CC7A 3AU7A 4L8JA 3GTJB 2K03A 4QUFA 1FYCA 2F0VA 1PH9A 1B50A 4DR5L 3MFGA 3H94A 4P72A 3NE5B 2E2HH 4KHPL 1HCZA 3A56A 4RFBA 1VQNA 4JI2L 1F2YA 4C2MH 1GO3E 4IURA 2A74C 4IFDH 3HKZB 2RCNA 1T9HA 3P75A 4X3UA 4JI5L 3BYYB 2K33A 3GTLH 2ZM6Q 3X3NA 4AYBE 1T5EA 2EOTA 2EY6A 1NSNS 4BY1H 2EYMA 4ZLTF 3A74A 2A6ED 2V1CC 3URYA 1J5EQ 2IJ0A 1PFBA 1XNRQ 1EFID 1EIHA 3CCLA 2ALYB 5EBDA 2O5JC 3PO2H 1YNJD 1QE6A 1SR3A 3NUCA 3QJYA 1F9QA 4LF5Q 5G3LD 4XT1B 3ER0A 3M7GA 3HKSA 2OEOA 3T4AC 2EYPA 4RH6A 4LMQD 3J80E 2BH2A 1E2VA 2EJMA 1MJCA 5EKLA 4LFBL 1SMXA 1FVIA 2MGSA 4KTAA 5DAUA 4JV5L 5C4XG 2GA4B 5E4XA 1Q81C 3A5ZB 2XRQD 2HDMA 5I6YA 2NTSA 2WAQB 1STHA 2R6GA 4FF2A 4ID6A 3D31A 4OL7A 3S17B 1C9OA 1GUOA 4K6LA 1Y14B 1VQFA 2AQ1B 2PMZE 1FNVA 3GTOH 1NAPA 4YY3L 3CCVA 5M5WB 2UUBL 1DZ1A 2RDFA 4UP7A 1LTID 1KDBA 1U4MA 1P16A 3VDYA 1KAWA 3HOVH 3TP5A 1K73C 4A3JB 1CK1A 2B2TC 1TS5A 2UUCL 2YU9B 4GLXA 2N78A 1HZAA 2SNMA 1LYLA 1PH2A 3NTHA 4A3DG 1K8OA 4F88A 4AYBB 5DLQE 1PRTB 5I2YA 4A93B 4KV6A 2AQ2B 1IBKQ 3Q24A 2J7ZA 5IP9G 1TWHB 2IPKD 1EY8A 4X3KA 2A69D 3UDFA 1STNA 1PTOH 3KUPA 3M3YB 1UE7A 2ZXPA 1F2ZA 3H3VI 2NZ1D 1PH1A 1SYBA 2LSSA 1AEXA 1SRUA 1G2SA 5AFWA 3CQZH 1AE3A 3SHLA 1JJ2A 2CKZB 4GS3A 4XYOA 4A4IA 4L5QA 1LUZA 5E3FA 5BN5A 3QG1A 1WTQA 3V05A 4K8IA 1X56A 1VQCA 2L12A 3G6JB 1HNWQ 5TSSA 2FXQA 2A6HD 4OIJA 3J7A5 2BA1A 1GOZA 1SMYD 2AHOB 3TP8A 2HHHQ 3BZCA 3RLFA 4RMFA 1PV4A 1Y1VG 2L5TA 4O0AA 3EVQA 1WVLA 5FLMG 1OXTA 1EIYB 1EY5A 4GLAC 1Q1EA 1S5BD 2PMZB 4LF9L 3SK6A 3HOUG 1JJCB 3NHHA 2FHTA 2A73B 2JXMB 3FDTA 3LGJA 3ICEA 2JA8G 3CPFA 1XX8A 4C3HG 1B3QA 2R7DA 5FO8B 1EQQA 3HOXB 3W1GA 2I07B 2V4DA 4IPHA 3ULPA 1PYBA 4KHVA 5CGKA 4POGA 4WORA 2JP1A 3HOWB 1BO0A 1X54A 1GUGA 4N9PA 5C4JH 1SNQA 1Y1WG 4NXML 1EY4A 1CKNB 1S72A 1S5ED 3I7FA 3QR8A 4X66L 4GKJQ 2JA7B 3EQLC 1TWFH 1PA6A 5HGTA 1VCIA 4UDUC 4LF7Q 1I4XA 4NXNL 4A3EG 1YEZA 2VQFL 2OQ0A 4TRDA 5C0XG 1EU3A 4BA1I 1LTTD 1CKNA 1KLUD 2K4KA 1CKMA 4A3CH 2EYLA 3NBIA 1G6PA 3MHBA 4Y52H 1WJJA 4JI4Q 5C3XA 3LX0A 2KENA 3OTOL 2PI2A 4FDBA 3BDOA 1DYQA 4B3RQ 2WV6D 4EQPA 2J4XA 4KLKA 2SNSA 4LF6L 3I4OA 4A3MB 5H1SE 1IL2A 4YHHL 2K14A 3D8GA 1PTOC 1DD2A 2ZJPA 3DWQA 5FO7B 4KK7A 3RR5A 3U9OA 5JJIA 3VR5A 1BCPB 3MXGA 3K80C 4XIGS 3K5MA 3R2TA 5K36G 4LF4L 1VF7A 2C35B 4XDXA 3H3VH 2VQEL 4OHJA 4A3GB 1YNNC 2PNHA 1N34Q 1CSPA 3T1HQ 4CJ0B 1GXDC 4AQYQ 1BBUA 4DV7L 2F0EA 3F2UA 2MO1A 2K5WA 1HFNA 2B63B 2F52A 3I8ZA 4X65Q 1IBLL 5ELBA 3PIP3 1TWGB 3A8JE 3CCSA 2UXDQ 3UDGA 3GTMH 2Z6KA 3LWUA 4ZKCB 4JI8L 4JI3Q 4ZRZA 2GVAA 1IYJB 3TP7A 1EZ8A 1LT4D 3KF8B 3KLRA 5CV8A 2JN4A 1JWSD 2L4NA 3GV6A 4UY8C 1HRJA 1F9SA 5IGBA 2BDOA 2VZAA 2HT1A 1Q3LA 3RLOA 4DV2Q 1KHIA 2VS1A 2K28A 1HQMC 4RKLA 4OX9L 5IE8A 3CXCA 3CCRA 1VF5C 3KF8A 4ZQ3A 5BN3A 4HEDA 3F1ZA 3S16B 4R4CA 4ZK9B 5KGUA 3PIPA 3H91A 5J39A 4LF8Q 4J15A 2B2VA 3D4WA 1EY9A 2JA5B 1UUPA 1RL2A 5CV6A 2Q8IB 1DGSA 3K0YA 2N55A 5C4XH 5EAYA 4ILWA 3BG3A 5JEAG 1VQ8A 1N33L 4DGZA 2EY1A 1JICA 3HOYB 2HCCA 5BR8L 2F1MA 4ZKBB 4HN7A 3J80i 3IL8A 1RTOA 2F0GA 2KEEA 2F0PA 5IYDG 1KABA 2H1EA 4JC0A 5KYLA 3FKIG 1I4QA 2IWHA 4K5XA 2NVTH 1D8LA 2JA6H 3PUXA 2R92B 1HNXQ 3T56B 3A8IE 1TWAH 1E1OA 2R61A 4ZYSA 5C0XI 1Q46A 4UP8A 4G7HC 1SFOB 4JI0Q 5FO9B 3S2DH 3NWTA 3H3VC 5DNFA 1II3A 3JC66 4A3DH 4A3KG 4PNYA 1EFWA 5C5MA 3L9AX 1V1OA 3STBD 3DUZA 1PVOA 3HKZG 2QDBA 3DHQA 4XYQA 4O1NA 3P7JA 1SYCA 4QL5A 2UUAL 3FPUB 3HFZB 5IP9H 3NQTA 2G9DA 3E9HA 4K6DA 5JPNC 4Y7NB 4HR7B 4BBRG 3T13A 1EZ6A 4NDXA 2F0MA 3RZDH 2F0LA 1RCVD 3R3OA 2B29A 1YITA 3PUZA 4CGYB 3VR2A 2HIVA 1LTRD 2E76C 1GJXA 3T1YL 1FJGL 1EIGA 4K0KL 1GHKA 4IFDG 4DV3L 4F8MA 4O2DA 4L5SA 1QB5D 3CCJA 2FMMA 4NKLA 2DGYA 1MIUA 4IUTA 2X6GA 2AQ3B 4DU9A 1Y1VH 3KYHC 1UE5A 3L0OA 3G4SA 1WCMB 2DNCA 1UE1A 1QZGA 2KEDA 1A2TA 4BBSB 3S1NH 3PF4A 1STGA 4JI5Q 2CW0D 4X64Q 2Y0SG 2JA8H 4C3HH 5A2QE 1UNSA 1XYIA 4CJ1B 1RJTA 5IGCA 2MJ8A 2JSOA 4IQZA 2QF7A 1X3QA 1X3PA 2PZTA 3V96A 1SE2A 5D3DA 2IX1A 2WACA 3CCQA 4DV0Q 4A3JG 5JOBA 1TIID 3I4NG 5HGQA 1Y1WH 3BDLA 4IOAA 1SNMA 2LKVA 3Q23A 1SYEA 1DJRD 3NTKA 3S9WA 3CW2C 3FRPB 4AYBG 4R1JA 5M5XB 4CKCA 2EIFA 2KOLA 3KFUA 1KRSA 4A3EH 2K01A 1YIJA 4KJOA 2VW9A 2OT2A 5C0XH 5KIXA 1DONA 1VQOA 3J80L 1G8ZD 4TKOB 4HIOA 1ICWA 5LMNW 4JV5Q 1OXUA 1SXTA 3JAMc 5M3FH 1XTDA 1W3SA 2PQAB 3A8KE 5GAGC 2XWJB 4XXEA 2A1AA 2KBNA 5IT9c 2XSCA 3QOJA 1LABA 3E6ZX 1OO9B 4QGUA 2B2YC 1TY0A 3DEOA 1B70B 3I55A 2ZTEA 1Y8OB 3N6RA 1XPOA 4YY3Q 3BJUA 1ILQA 1YNXA 2KCNA 1R4PB 2F0WA 3OHXC 4B3ML 1CZWA 1K28A 1D5XC 5K36H 3PUWA 4HJ8A 3TDQA 1ILPA 3OSOA 1SJED 1UWVA 4YCVA 2F0DA 1FR3A 5T1IA 2UUCQ 5KEEA 1SN8A 2WIIB 4JI1L 2K5NA 3RN5A 4OWWB 4HCSA 3OMGA 1CT1D 3K5LA 3EBEA 1QJOA 4A3IG 1G91A 3GO5A 3HS0C 1VQEA 2ZTCA 4RA8A 1TWCB 4A3FB 2H4OA 2MPMA 1I94Q 4N8FA 4U673 3MA2B 4DK3C 4QJFA 1PH8A 5CYUA 1L1OC 1MJEA 5C44B 5EKIA 3AFQA 3QO2A 1B44D 4C3JB 1Q90A 5IWAL 3AFPA 4A3LG 2R7ZB 5C3EB 1ONLA 1N32L 4DR6L 1WTHA 3U9SA 3HOWG 4IFDI 4FXGC 1PH5A 1I3QB 1BR9A 4O42A 5M3MG 1YHQA 1DOLA 4L63B 1BNZA 1GKHA 3BZKA 1FD7D 2JK8A 2YTXA 5KYIA 2I0QA 2Q8TA 3TSSA 1PH6A 3CC2A 2OWOA 2CQOA 2EVBA 1A8VA 2H5XA 1NCVA 3WOFA 2SEBD 3RMHA 5CV5A 1JE4A 4R4IA 1M90C 3S14B 1XMOL 4LF9Q 1Y69U 5J1ZA 2CWAA 3PO3B 4G4KA 4X3TA 2K75A 1LTSD 4GKKL 2M9VA 1K3BC 4GOPB 5IYDH 3IKJA 1M8AA 5AJ3Q 3GTQH 1HXYD 1NR4A 3CRLC 2F0JA 4H02A 3FKIH 1JCKB 3VYTA 1EIFA 2RVLA 1LTBD 4I65A 3GTJH 3HOZB 4CDCC 5IGEA 4LFAQ 3R8BA 2E2IB 4GOPA 4RG1A 4B3SL 2E75C 1VQBA 1HNZL 2EPBA 4A3GG 1S40A 2VUMB 4TSSA 4K8JA 4NP5A 1R9TB 4OONA 2I5HA 4MTKA 1EWCA 4DK6C 1CA5A 4C3IB 4A3KH 4F87A 3S2HB 1PZID 4IUNA 4HSPA 1EWHA 2B63G 2J0TD 3S1RB 2QW7A 1BDOA 2PPBC 1Q1BA 1TS3A 3J81E 5D14A 1A15A 3OTOQ 3EIVA 3EA6A 4BBRH 4LF6Q 1VQMA 1I50H 5IOCA 5M9OA 3MXNB 4YHHQ 2DUDA 1CSQA 2LS01 2OXPA 5JVH3 2F0FA 4FF3A 5I9OA 2M00A 3DXJC 4R4TA 1EY7A 4DV1Q 3GTPH 3KLSA 2MUYA 2GVBA 4LF4Q 5J22A 3OYYA 4GN5A 1N36L 3FVQA 3MXNA 2VQEQ 3SGIA 3T51B 4DV4L 1TR5A 5KRUA 2HUGA 2Q2UA 3FEWX 1LT5D 2F0QA 2F4VL 1S3OA 4JI6Q 5IP7G 3MEHA 3HOYG 4MIUA 4DR7L 4QCLA 3E3XA 2WKDA 1YHAA 3AB9A 2HD3A 2C5CA 2KHIA 3MVVA 1HZ9A 5M5WH 1NMFA 1HA6A 1Q8IA 2K5VA 1S5FD 5ELCA 2R92G 1KLGD 4QIWE 1NY4A 4A3JH 3TRZA 3I4NH 1ET6A 5ELFA 1XNQQ 2N8NA 2AKWB 4XQQA 4DAVA 4X6AH 3KLSX 1QWYA 2D5DA 1NTGA 1RDPD 2IHEA 5KNBA 4FXKC 2QILA 4HIDA 4M1UB 1K0SA 5IY0A 2XIWA 1KXLA 3BU2A 1WTRA 1I6HH 3J7YW 4MN3A 1KD1C 4MZ9A 5EPKA 3GTGB 4Q0FA 3TEHB 2JA6G 1K9MC 5M5YB 2A68D
chains in the Genus database with same CATH topology
5LL6S 2NYZD 1K8MA 2QKIC 1H9MA 3OOCA 3L3OC 1QNKA 1Z7TA 3TP6A 1C8CA 1LLRD 3ERQA 4OGQC 1PZJD 3N52A 1M4VA 3SEBA 2CHBD 2NN6G 1S5DD 3VYUA 3VR4A 2FFKB 1LTGD 5C5LA 1XTCD 1ENFA 5EPLA 1V1PB 4DK0A 1HTLD 4QIWB 1B1ZA 1C4QA 3GTOB 1Y8PB 4A3BB 2A5HA 3MTSA 4JK1C 5C6AA 3C2PA 3HOVB 4WJWA 3I90A 1FGBD 5ISRA 1HUNA 5CV4A 1ZEQX 3A54A 5HURA 1KNEA 3TBIB 2HDLA 2HCIA 2L0CA 2IX0A 1ET9A 4B08A 3FMCA 3H6MA 3SE0A 5EGTA 2F0KA 4RGOS 1PRTC 4PQXA 4IUVA 2F0OA 1STYA 2D2CC 1BXTA 3CRKC 3HGBA 3MZ5A 2NVYB 1LO5D 3DMUA 4FF4A 1AP0A 2VXWA 3QWNA 4DN4M 4XQNA 3CQZB 5E4WC 1V8QA 1I4PA 4G7OC 1F2MA 5A2QL 5I2XA 4UAIA 3K6OA 3IFDA 2DY8A 5CR3A 3R2IA 4K14A 1LT6D 1SEBD 3OPOA 3P1HA 3RZOB 1PTOF 3OWFA 4HCEA 4XQJA 3S1MB 1IKMA 3I91A 5A35A 1HPCA 1TKWB 4DK1A 5FLXL 3WDNA 3HP3A 2BE5D 3D6WA 4IN3A 2F0IA 4DNTB 2R3ZA 2XWBB 1J8IA 2L55A 3E0JA 2NN6I 1RD9D 3NP8A 2CW0C 2XN9C 2M2LA 3C1EA 2BOSA 1WTXA 4CBVA 3OW7A 3GTKB 4H0LC 3VA5A 4U68A 2EYOA 4BS9A 1ZKOA 2TSSA 4H7BA 2F4IA 4J1MA 4QUCA 1IHZA 2Z1CA 2Q8RE 3Q22A 1O80A 3G7LA 4KD3A 1ZYRC 3VR6A 1JOQA 1BCPC 4PV1C 2E74C 1JOKA 2DNEA 3BZDB 4GZYC 1H9JA 1IW7C 1PLFA 2AUKA 2RKSA 1DOKA 3Q6SA 4M8AA 2F3VA 4RGMA 3RUZA 2NVQB 4KY5A 1I4RA 1OXXK 2EYHA 1B9MA 4ULLA 1H9RA 2B2VC 2VNUD 1B4OA 1JORA 2BA0A 3SK4A 3R93A 1XXGA 1F9RA 5CMDA 4H44C 4TQUS 4DNRB 5C4XB 1AZQA 2NN6H 5CV7A 3A55A 4MHEA 5JVG3 1D1KA 4ZUJA 1Y8NB 3CU7A 4OIKA 2NVTB 3LWEA 1LV9A 1FNWA 4OO1G 3HRZC 1EYCA 1I6VC 4C1NI 1TWAB 3J81L 2Z4HA 1EEID 4R9WA 2K04A 1PTOD 4EQOA 1F9PA 4A3DB 3QB3A 5FKAC 1MD2D 4PMCA 2KHSA 3DWPA 5JJZA 3VA7A 1BBXC 1JWUD 1PZKD 1H9KA 1YNND 2PW7A 4RHRA 1JC7A 1EQTA 4EGVA 5IIFA 3NXWA 3DEPA 2K7VA 3CHBD 2X69A 4IUPA 3HZXA 1A2UA 3EROA 3KBXA 5BN4A 2B8FA 4P2CB 1L0YB 5FLXE 2LFNA 1SBBB 3T53B 4XT3B 1CHQD 1C48A 1Y1VB 5CV9A 5EQ0A 2F3WA 2ICEC 5DEHA 4DXGA 3S1NB 2JYOA 3HOUB 2EDGA 1ML0D 5IODA 1O7ZA 1GUWA 4J6HA 2FJ2A 1DCZA 2KVMA 3W2DA 3BS1A 4WFN3 3MFYA 2IW3A 1A3TA 5EKKA 1MSGA 1W6KA 1D6EC 1QNUA 1TT2A 2WP8J 3TZUA 1L0XB 1Y1WB 2A6EC 3QOLA 4K2LA 4I7ZC 1E2WA 2F0NA 4EVOA 2NVXB 5G3LF 1QG7A 1KDAA 1E0BA 4CKEA 1YNJC 2B2UA 3NSWA 1MSHA 1EQVA 5JEAJ 1UEAB 3KK7A 1KDCA 4RKBA 4OO1I 1CM9A 4JBWA 3OIPA 1WTVA 1SYGA 2F0HA 2L11A 1SYFA 3K5NA 1WTPA 1CZGA 3J7AF 3JAME 3SK5A 1XWEA 5JPMC 4DFAA 4KY6A 3GD7A 5IT9E 2PCFB 3PUYA 2FMCA 2B2WA 5ELDA 1V43A 4CHTB 1RTNA 2ENBA 2WINB 5D65A 1CA6A 4BA2I 4L6TB 3M7NA 4KKTA 4K5WA 4B9WA 1R4QB 1SE4A 1SJHD 1JQYD 4RCNA 2NUCA 2L9HA 3D3RA 4DA2A 3IFTA 2A69C 4C56C 1LT3D 4IFDJ 4G7ZC 5CBAE 2K5DA 2PNRC 3I4LA 3ONAB 3DM1A 3ND9A 3NTIA 2XRSD 5IGGA 1HUMA 2A6HC 1RHPA 2C9OA 4QF4A 3TZDA 1SMYC 2AWOA 2DN8A 1W6JA 1HTPA 2KCCA 1GUNA 3SR1A 5EJWA 3GTQB 3S15B 3FKIB 3A7LA 4FF1A 2B39A 1EYDA 3D4DA 3P20A 4OO1H 2PQEA 1GUTA 2RSNA 1EOTA 3VYRA 1DM0B 2CQAA 1EY0A 2EJGC 4IUQA 4RHSA 4S3SA 1EEFD 5KNDA 5DM63 4A3KB 4KHZA 3VR3A 1KNAA 2F0TA 2VB2X 3PMFA 5DM73 1PDQA 4FP5D 4IUUA 1Z6HA 4G57A 1JWMD 1NUCA 3ZYYX 1E2ZA 4HSVA 4FVMA 3K58A 1JOOA 5K5PA 4BBRB 4IZ8A 3SDZA 1MBYA 3V2TA 1I50B 1RF2D 2E2HB 1AZPA 2EJFC 4DXFA 4V0BA 5F2DA 1JR0D 1BUVT 2B2TA 1T5XD 2ID0A 3BYTB 1H9SB 4C2MB 3GTPB 2RQXA 1PXUA 3BDCA 2IL8A 2RDHA 3GTLB 2ICIA 2KJXA 1H9SA 2BE5C 4BY1B 1VDZA 4NMZA 5LHY1 3PO2B 1STAA 2KA7A 1D2BA 2N88A 2Y0SB 4KN4C 1SYDA 2D9UA 2MP1A 1EL0A 1A3VA 4RGNA 3NBHA 3M4YA 2O5IC 1UAPA 3GV3A 4WRDA 4DF7A 3RD4A 4ODGA 1SSOA 3I4NB 1AW7A 1VMPA 4EQNA 1O78A 4FO2A 3AMUA 2XNAC 4PMWA 1SAPA 1SE3A 2BCOA 1Q12A 3D4RA 1I6HB 4V190 2KECA 5C4HA 2WKCA 3MXUA 2LY7A 5EBCA 1GUSA 4DAPA 1ESFA 2O2LD 3LNNA 3L7ZC 1SNOA 1V1PA 3NK9A 3BVMA 4FXDA 1G2TA 2RDGA 2PZWA 1GHJA 5COYA 1IYUA 1TVXA 1PRTF 1B53A 1B9NA 5T1GA 5FOBB 3NQIA 1STBA 2PYKA 2EY2A 5JAVA 1KTKA 5I4DA 1PTOB 2HQEA 4A3IB 1WTOA 1S5CD 2IT1A 1EU4A 2OF1A 2SOBA 1I4GA 2XVSA 1S4ZA 1PFNA 1J9OA 3DWAA 1K83B 2EXZA 3E5SA 5M3MB 1RODA 2Z4IA 1WTWA 3OMCA 3SXHA 3H09A 4R8IA 4Z9CB 3W3AA 2RBMA 4C3JG 4PMBA 3PV0A 1CHPD 1KAAA 3K5OA 5C4JB 3I3CA 3NPPA 3BVZA 1OXSC 5KNCA 3UI2A 3QIAA 1G291 4KI0A 3K7AB 1U4RA 1TWFB 2K5QA 3C3LA 4C1NK 2I46A 1PFMA 3ND8A 1ENCA 1A3UA 1IYVA 2NTTA 1QILA 3TN2A 4E6IA 1EY6A 2ZXRA 3A7AB 1TS4A 4KKSA 2JEAI 3OWEB 3MAQA 4KD4A 2L1BA 3TMEA 1BCPF 3I70A 5ELEA 1B2TA 2X6LA 1U4LA 4F7XA 3FPPA 3HG9A 3T16A 5EPJA 5FK9C 4DAYA 2D62A 2AUJD 4C3IG 4N9TA 1JB3A 3K57A 5LL6X 1NR2A 4KJNA 1ZXTA 2K1BA 2NWGA 2KQ3A 3JAML 3GTMB 2EY5A 3EJIA 1ESRA 4KKUA 5IT9L 3Q0AA 3NWSA 1BQQT 1AN8A 2JE6I 1SNCA 4XTCS 1I4HA 1PYWD 3SK8A 1PRTD 1G6ZA 4RCOA 4BWGB 2NB0A 2QCPX 4B9XA 1WD0A 2FINB 1O7YA 5CC4A 1X32A 4FYDA 2G9HD 3OIQA 4LJZC 1LACA 2K05A 1VMCA 4LK1C 1STEA 2JA6B 3I73A 5I9PA 1U9RA 5NUCA 1D5ZC 1A6XA 1WD1A 2O4XA 4HTHA 1PMRA 3GQBA 2BDNA 2E2DC 3M85A 1HHVA 2TMPA 2YYZA 3S2DB 1U4PA 4YIJA 2LMCB 2Z8LA 5C0XJ 4CJ2C 3I4MB 1TQOA 2F03A 1DOMA 1SDFA 1F77A 2RA4A 4R8NA 5C3WA 4J8QA 1HQRD 3I72A 3RZDB 5D3IB 5E1FA 4ABNA 1SNDA 4ZAIA 1O7LA 1TU2B 4HMJA 4BY7B 2B2YA 1DXMA 1LTAD 1MI2A 5IGDA 2SDFA 4KN7C 5CORA 2F0UA 3GP7A 2K6AA 4NW2A 1SNPA 4FNFA 3EFXD 3D6CA 4RWSC 3ITPA 2EE1A 3S1QB 5C4ZA 1ZYRD 2JA8B 4C3HB 1TY2A 1AFPA 1QOHA 1OXVA 2JEBI 1BCPD 1BOSA 2ZXOA 3IAYA 1IW7D 2QEJC 2ZT9C 1BF4A 4HMIA 4ZUIA 3VYSA 1CI3M 1CFMA 1IKLA 3M4OB 4A3EB 2PZUA 2K32A 3J7AV 3CKIB 4KMUC 2CVRA 5M3FB 5I6WA 2WB1B 2PW5A 1RKNA 3MC0B 4Q5VA 3MWYW 4IALA 1CQFA 1HA5A 4K5VA 5CBEE 2VB3X 3BVGA 1D5MC 4LAAA 4ME5A 2R93B 1IL8A 2EYJA 2DY7A 2EZVA 2RSOA 3X3MA 2A68C 4KY7A 2B2UC 2IX3A 3WOEA 1B3AA 2F0SA 5IGFA 3SVMA 3HEJA 1FNUA 2NBFA 1MGSA 2E2JB 3PIO3 5JEAH 2MHVA 1CQVA 4RAUC 4K2KA 4RGTA 2B8GA 4HAEA 1QCBD 2EYFA 3MXPA 1Z47A 2KUMA 1ENAA 1TS2A 3H0GB 1CTMA 4X3SA 3C46A 1HFGA 4CKBA 3PUVA 2B2WC 2AWNA 2PO4A 1F2LA 4H13C 3K59A 4QMGA 1D1IA 4QB4A 3C1FA 3O13A 3KBGA 1EYAA 3AU7A 4L8JA 3GTJB 2K03A 4QUFA 1FYCA 2F0VA 1B50A 3MFGA 3H94A 3NE5B 1HCZA 3A56A 4RFBA 1F2YA 4IURA 2A74C 4IFDH 3HKZB 3P75A 4X3UA 3BYYB 2K33A 3X3NA 1T5EA 2EOTA 2EY6A 1NSNS 2EYMA 4ZLTF 2A6ED 3URYA 2IJ0A 1PFBA 1EFID 1EIHA 2O5JC 5EBDA 1YNJD 1QE6A 3NUCA 3QJYA 1F9QA 5G3LD 4XT1B 3M7GA 2OEOA 3T4AC 2EYPA 4RH6A 4LMQD 3J80E 1E2VA 2EJMA 5EKLA 2MGSA 4KTAA 5DAUA 2GA4B 5E4XA 2XRQD 2HDMA 5I6YA 2NTSA 2WAQB 1STHA 2R6GA 4FF2A 4ID6A 3D31A 4OL7A 3S17B 1GUOA 4K6LA 2AQ1B 1FNVA 1NAPA 5M5WB 1DZ1A 2RDFA 1LTID 1KDBA 1U4MA 3TP5A 4A3JB 1CK1A 2B2TC 1TS5A 2YU9B 2SNMA 3NTHA 1K8OA 4F88A 4AYBB 1PRTB 5I2YA 4A93B 4KV6A 2AQ2B 3Q24A 2J7ZA 1TWHB 2IPKD 1EY8A 4X3KA 2A69D 1STNA 1PTOH 3KUPA 3M3YB 2ZXPA 1F2ZA 2NZ1D 1SYBA 1AEXA 1G2SA 5AFWA 3SHLA 4XYOA 5E3FA 5BN5A 3QG1A 1WTQA 3V05A 4K8IA 2L12A 3G6JB 5TSSA 2A6HD 4OIJA 2BA1A 1GOZA 1SMYD 3TP8A 3RLFA 2L5TA 3EVQA 1WVLA 1OXTA 1EY5A 1Q1EA 1S5BD 2PMZB 3SK6A 3NHHA 2FHTA 2A73B 2JXMB 3FDTA 1XX8A 4C3HG 5FO8B 3HOXB 2I07B 2V4DA 4KHVA 5CGKA 4WORA 2JP1A 3HOWB 1BO0A 1GUGA 4N9PA 1SNQA 1EY4A 1S5ED 2JA7B 3EQLC 5HGTA 1VCIA 4UDUC 1I4XA 5C0XG 4TRDA 1EU3A 4BA1I 1LTTD 1KLUD 2EYLA 3NBIA 3MHBA 5C3XA 3LX0A 3BDOA 1DYQA 2WV6D 4EQPA 2J4XA 2SNSA 4A3MB 3D8GA 1PTOC 1DD2A 3DWQA 5FO7B 4KK7A 3U9OA 3VR5A 1BCPB 3MXGA 3K5MA 4XIGS 3R2TA 5K36G 1VF7A 4XDXA 4OHJA 4A3GB 1YNNC 4CJ0B 1GXDC 2F0EA 3F2UA 2K5WA 1HFNA 2B63B 3I8ZA 5ELBA 3PIP3 1TWGB 3A8JE 3LWUA 4ZKCB 4ZRZA 3TP7A 1EZ8A 1LT4D 3KLRA 5CV8A 1JWSD 2L4NA 3GV6A 1HRJA 1F9SA 5IGBA 2BDOA 1Q3LA 2K28A 1HQMC 4RKLA 1VF5C 3KF8A 4ZQ3A 5BN3A 4HEDA 3S16B 4ZK9B 5KGUA 3H91A 5J39A 2JA5B 2B2VA 3D4WA 1EY9A 1UUPA 5CV6A 2Q8IB 3K0YA 2N55A 4ILWA 3BG3A 5JEAG 4DGZA 2EY1A 1JICA 3HOYB 2HCCA 2F1MA 4ZKBB 4HN7A 3IL8A 1RTOA 2F0GA 2KEEA 2F0PA 1KABA 2H1EA 5KYLA 1I4QA 2IWHA 4K5XA 3PUXA 2R92B 3T56B 3A8IE 2R61A 4ZYSA 5C0XI 4G7HC 1SFOB 5FO9B 3NWTA 3H3VC 5DNFA 1II3A 4PNYA 5C5MA 3L9AX 1V1OA 3DUZA 2QDBA 3DHQA 4XYQA 4O1NA 3P7JA 1SYCA 3FPUB 4K6DA 3NQTA 5JPNC 2G9DA 4Y7NB 4HR7B 3T13A 1EZ6A 4NDXA 2F0MA 2F0LA 1RCVD 3R3OA 3PUZA 4CGYB 3VR2A 1LTRD 2E76C 1GJXA 1EIGA 1GHKA 4IFDG 4F8MA 1QB5D 2FMMA 4NKLA 4IUTA 2X6GA 2AQ3B 4DU9A 1WCMB 2DNCA 2KEDA 1A2TA 4BBSB 1STGA 2CW0D 5A2QE 1UNSA 1XYIA 4CJ1B 1RJTA 5IGCA 2MJ8A 2JSOA 4IQZA 2QF7A 1X3QA 1X3PA 2PZTA 3V96A 1SE2A 5D3DA 2IX1A 2WACA 5JOBA 1TIID 3BDLA 1SNMA 2LKVA 3Q23A 1SYEA 1DJRD 3NTKA 3S9WA 3FRPB 5M5XB 4CKCA 2KOLA 2K01A 4KJOA 2OT2A 5C0XH 5KIXA 1DONA 3J80L 1G8ZD 4TKOB 1ICWA 1OXUA 1SXTA 3A8KE 2XWJB 4XXEA 2XSCA 3QOJA 1LABA 3E6ZX 1OO9B 2B2YC 1TY0A 3DEOA 1Y8OB 3N6RA 1ILQA 2KCNA 1R4PB 2F0WA 3OHXC 1CZWA 1D5XC 5K36H 3PUWA 3TDQA 1ILPA 3OSOA 1SJED 2F0DA 1FR3A 5T1IA 5KEEA 2WIIB 4HCSA 3OMGA 1CT1D 3K5LA 1QJOA 1G91A 3GO5A 3HS0C 4RA8A 1TWCB 4A3FB 2H4OA 2MPMA 4U673 3MA2B 5CYUA 5C44B 5EKIA 3QO2A 1B44D 4C3JB 1Q90A 2R7ZB 5C3EB 1ONLA 3U9SA 4IFDI 4FXGC 1I3QB 1BR9A 4O42A 1DOLA 4L63B 1BNZA 1FD7D 5KYIA 2Q8TA 3TSSA 2EVBA 1NCVA 3WOFA 2SEBD 3RMHA 5CV5A 1JE4A 3S14B 1Y69U 5J1ZA 3PO3B 4G4KA 4X3TA 1LTSD 2M9VA 3IKJA 1M8AA 1HXYD 1NR4A 3CRLC 2F0JA 1JCKB 3VYTA 2RVLA 1LTBD 4I65A 3HOZB 5IGEA 3R8BA 2E2IB 2E75C 2EPBA 2VUMB 4TSSA 4K8JA 4NP5A 1R9TB 1EWCA 1CA5A 4C3IB 4F87A 3S2HB 1PZID 4IUNA 4HSPA 1EWHA 2J0TD 3S1RB 1BDOA 2PPBC 1Q1BA 1TS3A 3J81E 5D14A 1A15A 3EA6A 5IOCA 5M9OA 2LS01 2OXPA 5JVH3 2F0FA 4FF3A 5I9OA 2M00A 3DXJC 1EY7A 3KLSA 2MUYA 5J22A 3FVQA 3MXNA 3T51B 1TR5A 5KRUA 2HUGA 3FEWX 1LT5D 2F0QA 3MEHA 4MIUA 4QCLA 2WKDA 3AB9A 2C5CA 3MVVA 1HA6A 1Q8IA 1S5FD 5ELCA 1KLGD 1ET6A 5ELFA 4DAVA 4XQQA 3KLSX 1QWYA 2D5DA 1RDPD 5KNBA 4FXKC 2QILA 4M1UB 2XIWA 1WTRA 3J7YW 4MN3A 5EPKA 3GTGB 4Q0FA 5M5YB 2A68D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q6S A;  2NYZ D;  2B2W A;  3MWY W;  1B53 A;  2J7Z A;  4CJ2 C;  2B2Y C;  3DEO A;  3KBX A;  2L1B A;  4X3K A;  4UAI A;  5T1G A;  5CBE E;  1DOM A;  1QNK A;  1SDF A;  3P7J A;  1ILQ A;  3KUP A;  4XDX A;  1AZP A;  1CA5 A;  2RA4 A;  1B2T A;  1RTN A;  3IFD A;  3FPU B;  5D65 A;  2X6L A;  1U4L A;  2B2T A;  4IUR A;  1CA6 A;  2NZ1 D;  1C8C A;  2DY8 A;  1WTO A;  1IL8 A;  2DY7 A;  5EPJ A;  1G2S A;  5AFW A;  4X3U A;  2RSO A;  4XT3 B;  1ILP A;  4CJ0 B;  5T1I A;  3N52 A;  2IL8 A;  1WTQ A;  5EQ0 A;  5D14 A;  1A15 A;  2L12 A;  3F2U A;  1IKM A;  2EOT A;  3I91 A;  4HCS A;  2L9H A;  4ZLT F;  1HFN A;  2JYO A;  4OIJ A;  1G91 A;  2B2V C;  2B2U C;  3I8Z A;  1NR2 A;  1ML0 D;  1PFN A;  1PFB A;  1J9O A;  1S4Z A;  1B4O A;  4RA8 A;  1EIH A;  1ZXT A;  4ZAI A;  1EIG A;  3HP3 A;  1O7Z A;  1GUW A;  2MPM A;  3D6W A;  2FJ2 A;  3R93 A;  1B3A A;  1QE6 A;  2K1B A;  2NWG A;  4ZKC B;  2B2Y A;  2KVM A;  1F9Q A;  1MI2 A;  3SVM A;  1F9R A;  4XT1 B;  1WVL A;  5CMD A;  5EKI A;  2FFK B;  2FMM A;  1ROD A;  2SDF A;  3QO2 A;  5CBA E;  1WTW A;  2N88 A;  1ESR A;  4IUT A;  2L4N A;  2R3Z A;  1MGS A;  2X6G A;  3GV6 A;  4LMQ D;  5COR A;  1F9S A;  1MSG A;  5EPL A;  1AZQ A;  2FHT A;  2D9U A;  1HRJ A;  3ONA B;  2MP1 A;  1EL0 A;  3DM1 A;  4NW2 A;  1J8I A;  1Q3L A;  3FDT A;  1XX8 A;  4MHE A;  4R8I A;  2K28 A;  2KED A;  4RWS C;  2MGS A;  2EE1 A;  3GV3 A;  3MTS A;  4O42 A;  2HUG A;  4RAU C;  1HUM A;  1RHP A;  4HED A;  3TZD A;  4IUP A;  1DOL A;  1QG7 A;  4OIK A;  1SSO A;  2M2L A;  4HAE A;  5E4X A;  1E0B A;  3H91 A;  2JP1 A;  4ZK9 B;  4CJ1 B;  2B2V A;  2B2U A;  1RJT A;  1G6Z A;  2KUM A;  1BO0 A;  1VMP A;  2HDM A;  2MJ8 A;  1BNZ A;  3LWE A;  3I90 A;  1LV9 A;  1MSH A;  5EJW A;  1WTX A;  2N55 A;  1HUN A;  1WD0 A;  1X3Q A;  4X3S A;  1KNE A;  1SAP A;  1X3P A;  2FIN B;  3I3C A;  2Q8T A;  1O7Y A;  2HDL A;  3UI2 A;  2HCI A;  1XYI A;  1HA6 A;  1JIC A;  1HFG A;  2HCC A;  4U68 A;  1NAP A;  4R9W A;  4ZKB B;  2K04 A;  1DZ1 A;  1X32 A;  2B2W C;  3IL8 A;  1RTO A;  2KEE A;  1U4R A;  1NCV A;  1F9P A;  1BF4 A;  2H1E A;  1JE4 A;  2KEC A;  4QUC A;  2RSN A;  2Q8R E;  1U4M A;  1F2L A;  1O80 A;  1EOT A;  3G7L A;  1PFM A;  4X3T A;  1CM9 A;  1WTV A;  1IKL A;  4IUV A;  2K05 A;  2B2T C;  2KOL A;  1VMC A;  5JJZ A;  4IUQ A;  1M8A A;  2K01 A;  2L11 A;  1NR4 A;  1DON A;  3TN2 A;  1WTP A;  1BBX C;  1KNA A;  1ICW A;  2RVL A;  1AP0 A;  1G2T A;  2VXW A;  4DN4 M;  1PDQ A;  2XIW A;  1WD1 A;  4IUU A;  2CVR A;  1EQT A;  1WTR A;  2BDN A;  5COY A;  2K03 A;  1TVX A;  4MN3 A;  1PLF A;  5DNF A;  5E4W C;  4QUF A;  3DEP A;  1HHV A;  5EPK A;  1U4P A;  4HSV A;  2EPB A;  2X69 A;  1B50 A;  1DOK A; 
#chains in the Genus database with same CATH topology
 5LL6 S;  2NYZ D;  1K8M A;  3MEF A;  2N3S A;  2QKI C;  1N33 Q;  1H9M A;  3OOC A;  3M3Y H;  1X65 A;  3L3O C;  1QNK A;  3CCE A;  2CH4 W;  1Z7T A;  3TP6 A;  1C8C A;  1LLR D;  3ERQ A;  4OGQ C;  2A8V A;  4JVZ A;  4MNO A;  1AH9 A;  1PZJ D;  3I4M G;  3N52 A;  4HJ9 A;  1M4V A;  3SEB A;  1VS0 A;  2CHB D;  5LMU L;  4IPD A;  1Q86 C;  2NN6 G;  1S5D D;  5GRO A;  1Q82 C;  1QVG A;  2YTV A;  3VYU A;  1HR0 Q;  3VR4 A;  4A3I H;  2FFK B;  1LTG D;  5C5L A;  1XTC D;  2KHJ A;  1ENF A;  3F2C A;  5EPL A;  4EX5 A;  1V1P B;  4DK0 A;  1HTL D;  4QIW B;  4BY7 G;  1B1Z A;  1C4Q A;  2UUA Q;  3GTO B;  1Y8P B;  4A3B B;  3M4P A;  2A5H A;  2ZJR A;  3MTS A;  4A3L H;  4JK1 C;  5C6A A;  3C2P A;  1K83 H;  3HOW H;  3HOV B;  4WJW A;  1K8A C;  5M3M H;  3I90 A;  4ALP A;  1FGB D;  5ISR A;  1HUN A;  5CV4 A;  1ZEQ X;  3A54 A;  5HUR A;  1KNE A;  1NE3 A;  1FJG Q;  3TBI B;  2HDL A;  2HCI A;  1K8G A;  2L0C A;  4A75 A;  4QY7 A;  2IX0 A;  1NJI C;  1ET9 A;  4B08 A;  3FMC A;  3H6M A;  3SE0 A;  5EGT A;  2F0K A;  4RGO S;  1PRT C;  4PQX A;  4IUV A;  1XMQ L;  2F0O A;  1STY A;  3E0E A;  2D2C C;  1BXT A;  3CRK C;  3HGB A;  3MZ5 A;  3RLN A;  2NVY B;  1LO5 D;  3DMU A;  4FF4 A;  1AP0 A;  1BBW A;  2VXW A;  3QWN A;  4DN4 M;  1EYG A;  4XQN A;  3CQZ B;  4DV6 Q;  3K7A H;  4OEL B;  5E4W C;  1V8Q A;  3E9I A;  5J3B A;  3CF5 A;  1I4P A;  1VQ4 A;  4G7O C;  1JB7 A;  1PH4 A;  1F2M A;  5A2Q L;  1N8R C;  5I2X A;  4JCV E;  1VQJ A;  5JJK A;  1A0I A;  4UAI A;  3F2B A;  5GAD C;  4X62 L;  1VQL A;  4A3G H;  5M3F G;  2WB1 G;  3K6O A;  3IFD A;  3CC4 A;  1IBM Q;  2DY8 A;  5CR3 A;  3R2I A;  3F2D A;  4K14 A;  1LT6 D;  1SEB D;  3OPO A;  3P1H A;  3RZO B;  1PTO F;  3OWF A;  4HCE A;  1K0R A;  4XQJ A;  3KJP A;  3S1M B;  2RHS B;  1HH2 P;  2B63 H;  1IKM A;  4JG2 A;  3I91 A;  2E5L L;  1TWG H;  3G71 A;  5A35 A;  2R93 G;  1HPC A;  1TKW B;  4DK1 A;  5FLX L;  2K52 A;  3WDN A;  3HP3 A;  2BE5 D;  1CUK A;  3D6W A;  4LUZ A;  4IN3 A;  1D7Q A;  3K8A A;  2ES2 A;  1VQG A;  2F0I A;  4DNT B;  4JBJ A;  2R3Z A;  1HJP A;  2RHQ B;  2XWB B;  1M1K C;  1J8I A;  2L55 A;  3E0J A;  2NN6 I;  2R7F A;  1RD9 D;  2GN5 A;  2IY5 B;  3S16 H;  3NP8 A;  2CW0 C;  2XN9 C;  3J81 i;  3TRE A;  2MNA A;  3KF6 B;  2M2L A;  3H15 A;  2ZM6 L;  4JI1 Q;  3C1E A;  1LTL A;  2BOS A;  1WTX A;  4CBV A;  4L5R C;  4PZ7 A;  5IP7 H;  3HOY H;  2UU9 L;  3U4Z A;  3OW7 A;  3GTK B;  4H0L C;  3VA5 A;  4U68 A;  2EYO A;  3KF6 A;  4BS9 A;  1ZKO A;  2TSS A;  4H7B A;  2F4I A;  3AYH B;  4LF5 L;  4J1M A;  1UE6 A;  4QUC A;  1IHZ A;  2Z1C A;  2Q8R E;  3H0G G;  3Q22 A;  1O80 A;  3G7L A;  1GVP A;  4DV5 Q;  1XJV A;  4KD3 A;  1ZYR C;  2R92 H;  3VR6 A;  1JOQ A;  1BCP C;  2CH4 A;  4PV1 C;  2E74 C;  2VL6 A;  1SFO H;  1H95 A;  1JOK A;  3NEN A;  2DNE A;  3BZD B;  4GZY C;  1H9J A;  1IW7 C;  1PLF A;  3NEL A;  2UXB L;  2AUK A;  2RKS A;  4HJA A;  1DOK A;  3Q6S A;  3U58 A;  2Z6K C;  4M8A A;  1QUQ B;  2F3V A;  3TS2 A;  1XPU A;  3CP0 A;  3FHW A;  4RGM A;  2ZTD A;  3RUZ A;  4DR3 Q;  2NZH A;  3DM3 A;  1KQS A;  2NVQ B;  4KY5 A;  1I4R A;  1OXX K;  4GKK Q;  2EYH A;  1B9M A;  5ELO A;  4ULL A;  1H9R A;  5LMN L;  4JBM A;  3I4M H;  1MKH A;  2B2V C;  2VNU D;  1LM0 A;  1B4O A;  2WFW A;  1JOR A;  2BA0 A;  3SK4 A;  3R93 A;  4PG3 A;  1XXG A;  1F9R A;  5CMD A;  4H44 C;  4TQU S;  4DNR B;  5C4X B;  1AZQ A;  2NN6 H;  1YBY A;  5CV7 A;  3A55 A;  4MHE A;  4OWT B;  4HIK A;  5IYB G;  3KDF B;  1D1K A;  5JVG 3;  4ZUJ A;  1Y8N B;  3CU7 A;  4LFC L;  4BY7 H;  4OIK A;  2NVT B;  3LWE A;  1LV9 A;  1FNW A;  4OO1 G;  3HRZ C;  1EYC A;  4DR5 Q;  1I6V C;  4C1N I;  1GD7 A;  1TWA B;  4KHP Q;  4HIM A;  2HHH L;  3J81 L;  2Z4H A;  1EEI D;  2N49 A;  4JI2 Q;  4R9W A;  2K04 A;  1X55 A;  1PTO D;  4EQO A;  1F9P A;  2Q2I A;  5FJ8 G;  3S1Q H;  4A3D B;  2WAQ G;  3QB3 A;  5FKA C;  1C7Y A;  1MD2 D;  4PMC A;  3PGZ A;  2KHS A;  1N36 Q;  1X3G A;  3DWP A;  5JJZ A;  3VA7 A;  2G5D A;  1P8L A;  1BBX C;  1JWU D;  1PZK D;  1H9K A;  1YNN D;  2PW7 A;  4RHR A;  3B6Y A;  1JC7 A;  5IYC G;  4A76 A;  1EOV A;  3UDI A;  1IXR A;  1EQT A;  4DR7 Q;  4EGV A;  4UHV A;  5IIF A;  1XPR A;  3NXW A;  3DEP A;  1WOC A;  3K0X A;  2K7V A;  3CHB D;  2X69 A;  4IUP A;  3M4O H;  3HZX A;  1A2U A;  3ERO A;  3KBX A;  4GKJ L;  5BN4 A;  4LFB Q;  2B8F A;  4GNX B;  4P2C B;  4LF7 L;  1L0Y B;  5FLX E;  4A93 G;  2LFN A;  4YCW A;  1SBB B;  3T53 B;  4XT3 B;  1CHQ D;  1C48 A;  1Y1V B;  5CV9 A;  5EQ0 A;  4JI4 L;  2F3W A;  4GNX A;  2ICE C;  1L1O B;  5DEH A;  4DXG A;  4A3F H;  2JYO A;  3S1N B;  3HOU B;  2EDG A;  2IHF A;  1ML0 D;  4OEM B;  5IOD A;  1O7Z A;  1GUW A;  4J6H A;  2FJ2 A;  2UUB Q;  4B3T L;  1DCZ A;  2KVM A;  5ELN A;  2PQA A;  4C3J H;  3W2D A;  3BS1 A;  2R93 H;  1HR0 W;  4WFN 3;  1N9W A;  3EN2 A;  2R7Z H;  3MFY A;  5C3E H;  2IW3 A;  1A3T A;  5EKK A;  1RIP A;  2MO0 A;  1MSG A;  1W6K A;  2OQK A;  1D6E C;  2XGT A;  1K3R A;  1QVC A;  1I3Q H;  1QNU A;  1TT2 A;  2WP8 J;  3TZU A;  1L0X B;  1Y1W B;  1PFS A;  1CKO A;  2A6E C;  3QOL A;  4K2L A;  4IJH A;  4I7Z C;  1N34 L;  1E2W A;  2F0N A;  4EVO A;  3T1H L;  2NVX B;  5G3L F;  1QG7 A;  4AQY L;  1KDA A;  1E0B A;  4CKE A;  1YNJ C;  2B2U A;  3NSW A;  4JOI A;  1O7I A;  1MSH A;  3HOX G;  3U50 C;  5LMU Q;  2K50 A;  1IZ6 A;  1FGU A;  2E2J H;  1EQV A;  5JEA J;  1J6Q A;  3AEV A;  1UEA B;  3KK7 A;  1KDC A;  3KLW A;  2CWP A;  4RKB A;  4OO1 I;  1CM9 A;  4JBW A;  3OIP A;  1WTV A;  1SYG A;  2F0H A;  2JA7 G;  2OTJ A;  2L11 A;  1SYF A;  5JJL A;  3H0G H;  3K5N A;  1WTP A;  2ATW A;  1CZG A;  3J7A F;  3JAM E;  3SK5 A;  1XWE A;  5JPM C;  1JE5 A;  4DFA A;  2E2I H;  4KY6 A;  3GD7 A;  3FP9 A;  4LF8 L;  5IT9 E;  2PCF B;  3PUY A;  4WJ4 A;  1ASY A;  1SE8 A;  2FMC A;  2B2W A;  1YJW A;  5L37 A;  2Z9H A;  4C3I H;  5ELD A;  4A3M G;  1V43 A;  3S2H H;  1Q8K A;  4PZ6 A;  4CHT B;  1RTN A;  2ENB A;  2WIN B;  4QQB X;  5D65 A;  1CA6 A;  4BA2 I;  4L6T B;  3M7N A;  4KKT A;  4DUZ L;  4K5W A;  2JA9 A;  4B9W A;  1VQA A;  1R4Q B;  2K5H A;  1SE4 A;  1SJH D;  1JQY D;  1HNX L;  4RCN A;  1JT8 A;  2NUC A;  2CFM A;  2L9H A;  4NXM Q;  3PF5 A;  3D3R A;  4DA2 A;  4X66 Q;  3IFT A;  2A69 C;  4JI0 L;  4C56 C;  1LT3 D;  4JW0 A;  4IFD J;  2XTI A;  4G7Z C;  4NXN Q;  5CBA E;  2K5D A;  2VQF Q;  2PNR C;  3I4L A;  3J80 c;  3ONA B;  3DM1 A;  3ND9 A;  4LWC A;  3NTI A;  4GLV B;  2XRS D;  5IGG A;  1HUM A;  1KL9 A;  2A6H C;  1RHP A;  2C9O A;  4QF4 A;  3TZD A;  3CAM A;  3ULL A;  1SMY C;  2AWO A;  2DN8 A;  1EQR A;  1HZB A;  1W6J A;  1HTP A;  2KCC A;  5IYB H;  1GUN A;  1PH3 A;  3SR1 A;  5EJW A;  3GTQ B;  3S15 B;  3Q8D A;  3FKI B;  3A7L A;  3KJO A;  1X9N A;  4FF1 A;  2B39 A;  4GOP C;  1EYD A;  3D4D A;  3RN2 A;  2Y0S E;  3CCU A;  3P20 A;  2JA5 G;  4OO1 H;  2PQE A;  1GUT A;  3UDX A;  2RSN A;  1EOT A;  3VYR A;  1DM0 B;  3J81 j;  2CQA A;  4DUY L;  1EY0 A;  1VQ6 A;  4YWK A;  2EJG C;  1U5K A;  4IUQ A;  4DV7 Q;  1C0A A;  4RHS A;  4S3S A;  1EEF D;  5FJ8 H;  5KND A;  5DM6 3;  4AIM A;  4A3K B;  4KHZ A;  3VR3 A;  5GQO A;  3S17 H;  1KNA A;  2F0T A;  2VB2 X;  3K81 C;  3PMF A;  4X64 L;  1IBL Q;  5DM7 3;  1PDQ A;  4FP5 D;  4IUU A;  4JI7 L;  4OXP A;  1Z6H A;  3AQQ A;  3IRB A;  3GTG H;  4G57 A;  4JI8 Q;  1JWM D;  5M5Y H;  1NUC A;  3ZYY X;  1E2Z A;  4HSV A;  4FVM A;  3K58 A;  5IYC H;  1JOO A;  5K5P A;  3TS0 A;  2UU9 Q;  4BBR B;  4IZ8 A;  3SDZ A;  1MBY A;  4YCU A;  2EQS A;  3V2T A;  1FL0 A;  4DV0 L;  1I50 B;  1GM5 A;  1RF2 D;  2YU9 H;  2E2H B;  1AZP A;  2EJF C;  4DXF A;  4V0B A;  5F2D A;  1JR0 D;  1KC8 C;  2UXC L;  1BUV T;  2B2T A;  1T5X D;  4OX9 Q;  2ID0 A;  3BYT B;  1H9S B;  4C2M B;  4IOC A;  3GTP B;  2RQX A;  1PXU A;  3BDC A;  2IL8 A;  2RDH A;  4A93 H;  3GTL B;  1YZ6 A;  4APV A;  1Q7Y C;  2ASB A;  1TWH H;  2ICI A;  2KJX A;  1H9S A;  2BE5 C;  4BY1 B;  1VDZ A;  3NBH B;  4NMZ A;  3PQI A;  2UXB Q;  5BR8 Q;  5LHY 1;  2QEX A;  3PO2 B;  1VQK A;  2EXD A;  1STA A;  2KA7 A;  1D2B A;  3J7Z C;  2N88 A;  2Y0S B;  4KN4 C;  1SYD A;  3L2P A;  2D9U A;  2MP1 A;  1EL0 A;  1A3V A;  2P5Z X;  4A3B H;  4RGN A;  3NBH A;  3M4Y A;  2O5I C;  1UAP A;  3GV3 A;  3W1B A;  4WRD A;  4DF7 A;  3RD4 A;  4ODG A;  3UE1 A;  4DNI A;  4EQ5 A;  1SSO A;  3I4N B;  3PSI A;  1AW7 A;  1VMP A;  4EQN A;  1O78 A;  4FO2 A;  1WCM G;  3AMU A;  5LMN Q;  4LUV A;  4BBS G;  2XNA C;  2NZO A;  4DR2 L;  4PMW A;  1SAP A;  1SE3 A;  1VQP A;  1KIX A;  3CPW A;  2BCO A;  1Q12 A;  1X6O A;  1TXY A;  3D4R A;  1I94 L;  3HOX H;  1I6H B;  2QDL A;  4V19 0;  1G51 A;  2PI2 E;  2KEC A;  2WKC A;  3MXU A;  5C4H A;  3RNU A;  2LY7 A;  5EBC A;  3F8T A;  1GUS A;  3G48 A;  4DAP A;  1ESF A;  2O2L D;  3LNN A;  4OWX B;  2NVY H;  3L7Z C;  1SNO A;  1V1P A;  3NK9 A;  3BVM A;  4DR4 L;  4FXD A;  1G2T A;  4LFC Q;  2JA7 H;  2RDG A;  2PZW A;  3T1Y Q;  3KOJ A;  1GHJ A;  4K0K Q;  4BXX G;  5COY A;  3M9B A;  1IYU A;  1TVX A;  4DV3 Q;  3CCM A;  1PRT F;  5HY6 A;  1WYD A;  1B53 A;  1B9N A;  5T1G A;  5FOB B;  3NQI A;  1STB A;  2PYK A;  2EY2 A;  5JAV A;  1KTK A;  5I4D A;  1EUJ A;  1PTO B;  3RZO H;  2HQE A;  4A3I B;  1WTO A;  4A3M H;  3S1M H;  1S5C D;  1PYS B;  2IT1 A;  1EU4 A;  2OF1 A;  3JAM i;  5AJ3 L;  3U4V A;  2HQL A;  2SOB A;  1I4G A;  2XVS A;  3STB C;  4YWL A;  1S4Z A;  1PFN A;  1J9O A;  1MHW C;  3DWA A;  1K83 B;  4DR1 L;  2EXZ A;  1YJ9 A;  2CCZ A;  4LFA L;  3TQY A;  3E5S A;  4NPS A;  1B7Y B;  1UEB A;  3NEM A;  4PZ8 A;  1ROD A;  2Z4I A;  5M3M B;  1WTW A;  3OMC A;  3SXH A;  4A3F G;  3H09 A;  4CDF C;  4R8I A;  4P74 A;  4Z9C B;  2F3I A;  5C44 G;  3W3A A;  1A63 A;  2RBM A;  4C3J G;  2VY3 A;  4JYA L;  2R7Z G;  5C3E G;  1X3F A;  2Q2T A;  4PMB A;  3PV0 A;  4LUO A;  2LXK A;  1CHP D;  1KAA A;  1E1T A;  3K5O A;  4CDD C;  1E24 A;  5C4J B;  3GTK H;  3I3C A;  3NPP A;  3BVZ A;  1OXS C;  5KNC A;  3UI2 A;  2KCM A;  3QIA A;  4B3T Q;  1G29 1;  4KI0 A;  3K7A B;  4L5T A;  1U4R A;  1TWF B;  2YV5 A;  4B3M Q;  2K5Q A;  3C3L A;  4DV1 L;  4C1N K;  2I46 A;  1PFM A;  1EWI A;  3ND8 A;  1ENC A;  1A3U A;  2JA5 H;  1IYV A;  1JMC A;  2NTT A;  1QIL A;  3TN2 A;  4E6I A;  1EY6 A;  2ZXR A;  3A7A B;  1TS4 A;  4R4O A;  4IPG A;  3PO3 G;  1J5E L;  4JI6 L;  1XNR L;  1A62 A;  4KKS A;  4LW1 A;  1B8A A;  2ZJQ A;  2DJG C;  2JEA I;  3OWE B;  4DAY B;  2OCE A;  1YI2 A;  5IWA Q;  3MAQ A;  4KD4 A;  3HOZ G;  2L1B A;  3TME A;  2L15 A;  2QA4 A;  4DR6 Q;  1N32 Q;  1BCP F;  1E7Z A;  3I70 A;  1YVC A;  5ELE A;  1ASZ A;  1E22 A;  1B2T A;  2NVQ H;  2X6L A;  1U4L A;  4F7X A;  3FPP A;  2VUM G;  3HG9 A;  3PCO B;  5EPJ A;  5FK9 C;  3T16 A;  4DAY A;  1PHJ A;  2D62 A;  1PH7 A;  1XNQ L;  2MFI A;  2AUJ D;  4C3I G;  4N9T A;  1JB3 A;  3K57 A;  1JJG A;  5LL6 X;  4R4Q A;  1BVS A;  1NR2 A;  4KJN A;  1ZXT A;  2HIX A;  4DAM A;  2K1B A;  2NWG A;  2KQ3 A;  3JAM L;  1YJN A;  3GTM B;  4Y7N H;  2EY5 A;  2JJQ A;  1XMO Q;  3EJI A;  1ESR A;  4KKU A;  5IT9 L;  3Q0A A;  3I56 A;  3NWS A;  1BQQ T;  1QUQ A;  3I2Z A;  1AN8 A;  2JE6 I;  1SNC A;  2Z6B A;  4XTC S;  1NMG A;  4DUZ Q;  1I4H A;  1PYW D;  4IPC A;  1PRT D;  4N8X 1;  3SK8 A;  1ICF B;  1G6Z A;  4B3S Q;  4RCO A;  4BWG B;  2NB0 A;  4POF A;  1VQ5 A;  1HNZ Q;  2QCP X;  4B9X A;  1WD0 A;  1IBK L;  3CD6 A;  2FIN B;  1O7Y A;  5CC4 A;  1WCM H;  1X3E A;  4BBS H;  1X32 A;  3D0F A;  4FYD A;  1HR0 L;  2G9H D;  3OIQ A;  4LJZ C;  1LAC A;  2K05 A;  1VMC A;  4LK1 C;  1STE A;  4HJ7 A;  3CME A;  5FLX c;  2JA6 B;  3I73 A;  5I9P A;  1HNW L;  1U9R A;  3KDF A;  5NUC A;  1D5Z C;  1A6X A;  1WD1 A;  2O4X A;  4HTH A;  3A5U A;  1PMR A;  3GQB A;  2BDN A;  2E2D C;  3M85 A;  1HHV A;  2TMP A;  2YYZ A;  2D0O A;  1U4P A;  4YIJ A;  3S2D B;  2D0P A;  4MTN A;  2LMC B;  2Z8L A;  5M5X H;  5C0X J;  4CJ2 C;  3I4M B;  4BXX H;  1TQO A;  2F03 A;  1DOM A;  1SDF A;  1F77 A;  4P75 A;  1VQH A;  2RA4 A;  4DV4 Q;  4R8N A;  4GN4 B;  2F4V Q;  4DUY Q;  3DLL A;  4BY1 G;  5C3W A;  5FLM H;  4J8Q A;  3ZJY C;  1HQR D;  2KCT A;  3M4Q A;  3I72 A;  3RZD B;  3PO2 G;  3HOU H;  5D3I B;  5E1F A;  2WB1 E;  4ABN A;  3A0J A;  1SND A;  4JI7 Q;  1Z9F A;  4JBK A;  4ZAI A;  1O7L A;  4DV6 L;  1TU2 B;  2MQH A;  4HMJ A;  4BY7 B;  2B2Y A;  1DXM A;  1LTA D;  1MI2 A;  2DJF C;  5IGD A;  2SDF A;  4KN7 C;  5COR A;  4ME3 A;  1W2B A;  2RF4 A;  2F0U A;  3GP7 A;  2K6A A;  4NW2 A;  4P73 A;  2UXC Q;  1SNP A;  4FNF A;  3EFX D;  3D6C A;  4RWS C;  3ITP A;  2EE1 A;  2AMC B;  1IBM L;  2NVX H;  3S1Q B;  1TWC H;  4B3R L;  5C4Z A;  2JQO A;  4DKA C;  1ZYR D;  2JA8 B;  4C3H B;  1TY2 A;  5C44 H;  1AFP A;  3UE0 A;  1QOH A;  1OXV A;  2JEB I;  1BCP D;  1BOS A;  4A3B G;  1E3P A;  2B3G A;  4TVA B;  1VQD A;  1L1O A;  1BKB A;  2ZXO A;  1VQ7 A;  3IAY A;  3HOV G;  4CDE C;  1IW7 D;  2QEJ C;  2ZT9 C;  1BF4 A;  3ULJ A;  3W5O A;  4HMI A;  4P71 A;  4ZUI A;  3VYS A;  2RCF A;  1CI3 M;  1CFM A;  1IKL A;  3M4O B;  4NB3 A;  3G6E A;  1QZH A;  1YHB A;  4A3E B;  1V1Q A;  2PZU A;  1I5F A;  2K32 A;  1VQI A;  3J7A V;  3CKI B;  4KMU C;  4X65 L;  4GNX C;  2CVR A;  4WJ3 M;  1QVF A;  2UXD L;  5M3F B;  5I6W A;  1VQ9 A;  2WB1 B;  2LXJ A;  4AH6 A;  2PW5 A;  4JI3 L;  3S14 H;  4GN3 B;  1RKN A;  3MC0 B;  4DPG A;  3PO3 H;  4Q5V A;  4DR2 Q;  3MWY W;  4LNQ A;  1HZC A;  3ERS X;  4IAL A;  1CQF A;  3CMA A;  1HA5 A;  4K5V A;  5CBE E;  2VB3 X;  4DV2 L;  3S24 A;  1OTC A;  5E7N A;  1WFQ A;  4HJ5 A;  3BVG A;  1D5M C;  4LAA A;  4ME5 A;  1V9P A;  1KRT A;  4IO9 A;  2R93 B;  3HOZ H;  1IL8 A;  2EYJ A;  2DY7 A;  4JPB W;  4DV5 L;  2EZV A;  2I5L X;  2RSO A;  4UP9 A;  3X3M A;  2VUM H;  3J81 c;  4DR4 Q;  2A68 C;  1R9T H;  4KY7 A;  2B2U C;  2IX3 A;  2QGQ A;  4JOI C;  3WOE A;  1AE2 A;  1B3A A;  3WWV A;  2F0S A;  5IGF A;  3SVM A;  3HEJ A;  2BH8 A;  4IJL A;  1FNU A;  2NBF A;  3S1R H;  1MGS A;  4UPA A;  2E2J B;  1XMQ Q;  3HKZ E;  1NBW A;  3PIO 3;  4YWM A;  1L0W A;  5JEA H;  2MHV A;  1CQV A;  4ZCK A;  2I5M X;  4RAU C;  1NNX A;  4DR3 L;  1L2F A;  4K2K A;  4RGT A;  2A19 A;  3K7U C;  1WI5 A;  2B8G A;  4HAE A;  1QCB D;  2EYF A;  3MXP A;  3S15 H;  1Z47 A;  2KUM A;  1ENA A;  1SRO A;  1TS2 A;  3H0G B;  1CTM A;  4X3S A;  5GAE C;  2Q2H A;  1SLJ A;  2YTY A;  2Z0S A;  4DR1 Q;  3C46 A;  1HFG A;  4CKB A;  3PUV A;  1U0L A;  4I7A A;  4X62 Q;  2B2W C;  3GDE A;  3PIO A;  2AWN A;  4A3C G;  3OW2 A;  2PO4 A;  1F2L A;  5GAH C;  4H13 C;  3K59 A;  4QMG A;  1D1I A;  4QB4 A;  2E8G A;  3C1F A;  2E5L Q;  3O13 A;  2OTL A;  2WAQ E;  4JYA Q;  3KBG A;  1EYA A;  3CC7 A;  3AU7 A;  4L8J A;  3GTJ B;  2K03 A;  4QUF A;  1FYC A;  2F0V A;  1PH9 A;  1B50 A;  4DR5 L;  3MFG A;  3H94 A;  4P72 A;  3NE5 B;  2E2H H;  4KHP L;  1HCZ A;  3A56 A;  4RFB A;  1VQN A;  4JI2 L;  1F2Y A;  4C2M H;  1GO3 E;  4IUR A;  2A74 C;  4IFD H;  3HKZ B;  2RCN A;  1T9H A;  3P75 A;  4X3U A;  4JI5 L;  3BYY B;  2K33 A;  3GTL H;  2ZM6 Q;  3X3N A;  4AYB E;  1T5E A;  2EOT A;  2EY6 A;  1NSN S;  4BY1 H;  2EYM A;  4ZLT F;  3A74 A;  2A6E D;  2V1C C;  3URY A;  1J5E Q;  2IJ0 A;  1PFB A;  1XNR Q;  1EFI D;  1EIH A;  3CCL A;  2ALY B;  5EBD A;  2O5J C;  3PO2 H;  1YNJ D;  1QE6 A;  1SR3 A;  3NUC A;  3QJY A;  1F9Q A;  4LF5 Q;  5G3L D;  4XT1 B;  3ER0 A;  3M7G A;  3HKS A;  2OEO A;  3T4A C;  2EYP A;  4RH6 A;  4LMQ D;  3J80 E;  2BH2 A;  1E2V A;  2EJM A;  1MJC A;  5EKL A;  4LFB L;  1SMX A;  1FVI A;  2MGS A;  4KTA A;  5DAU A;  4JV5 L;  5C4X G;  2GA4 B;  5E4X A;  1Q81 C;  3A5Z B;  2XRQ D;  2HDM A;  5I6Y A;  2NTS A;  2WAQ B;  1STH A;  2R6G A;  4FF2 A;  4ID6 A;  3D31 A;  4OL7 A;  3S17 B;  1C9O A;  1GUO A;  4K6L A;  1Y14 B;  1VQF A;  2AQ1 B;  2PMZ E;  1FNV A;  3GTO H;  1NAP A;  4YY3 L;  3CCV A;  5M5W B;  2UUB L;  1DZ1 A;  2RDF A;  4UP7 A;  1LTI D;  1KDB A;  1U4M A;  1P16 A;  3VDY A;  1KAW A;  3HOV H;  3TP5 A;  1K73 C;  4A3J B;  1CK1 A;  2B2T C;  1TS5 A;  2UUC L;  2YU9 B;  4GLX A;  2N78 A;  1HZA A;  2SNM A;  1LYL A;  1PH2 A;  3NTH A;  4A3D G;  1K8O A;  4F88 A;  4AYB B;  5DLQ E;  1PRT B;  5I2Y A;  4A93 B;  4KV6 A;  2AQ2 B;  1IBK Q;  3Q24 A;  2J7Z A;  5IP9 G;  1TWH B;  2IPK D;  1EY8 A;  4X3K A;  2A69 D;  3UDF A;  1STN A;  1PTO H;  3KUP A;  3M3Y B;  1UE7 A;  2ZXP A;  1F2Z A;  3H3V I;  2NZ1 D;  1PH1 A;  1SYB A;  2LSS A;  1AEX A;  1SRU A;  1G2S A;  5AFW A;  3CQZ H;  1AE3 A;  3SHL A;  1JJ2 A;  2CKZ B;  4GS3 A;  4XYO A;  4A4I A;  4L5Q A;  1LUZ A;  5E3F A;  5BN5 A;  3QG1 A;  1WTQ A;  3V05 A;  4K8I A;  1X56 A;  1VQC A;  2L12 A;  3G6J B;  1HNW Q;  5TSS A;  2FXQ A;  2A6H D;  4OIJ A;  3J7A 5;  2BA1 A;  1GOZ A;  1SMY D;  2AHO B;  3TP8 A;  2HHH Q;  3BZC A;  3RLF A;  4RMF A;  1PV4 A;  1Y1V G;  2L5T A;  4O0A A;  3EVQ A;  1WVL A;  5FLM G;  1OXT A;  1EIY B;  1EY5 A;  4GLA C;  1Q1E A;  1S5B D;  2PMZ B;  4LF9 L;  3SK6 A;  3HOU G;  1JJC B;  3NHH A;  2FHT A;  2A73 B;  2JXM B;  3FDT A;  3LGJ A;  3ICE A;  2JA8 G;  3CPF A;  1XX8 A;  4C3H G;  1B3Q A;  2R7D A;  5FO8 B;  1EQQ A;  3HOX B;  3W1G A;  2I07 B;  2V4D A;  4IPH A;  3ULP A;  1PYB A;  4KHV A;  5CGK A;  4POG A;  4WOR A;  2JP1 A;  3HOW B;  1BO0 A;  1X54 A;  1GUG A;  4N9P A;  5C4J H;  1SNQ A;  1Y1W G;  4NXM L;  1EY4 A;  1CKN B;  1S72 A;  1S5E D;  3I7F A;  3QR8 A;  4X66 L;  4GKJ Q;  2JA7 B;  3EQL C;  1TWF H;  1PA6 A;  5HGT A;  1VCI A;  4UDU C;  4LF7 Q;  1I4X A;  4NXN L;  4A3E G;  1YEZ A;  2VQF L;  2OQ0 A;  4TRD A;  5C0X G;  1EU3 A;  4BA1 I;  1LTT D;  1CKN A;  1KLU D;  2K4K A;  1CKM A;  4A3C H;  2EYL A;  3NBI A;  1G6P A;  3MHB A;  4Y52 H;  1WJJ A;  4JI4 Q;  5C3X A;  3LX0 A;  2KEN A;  3OTO L;  2PI2 A;  4FDB A;  3BDO A;  1DYQ A;  4B3R Q;  2WV6 D;  4EQP A;  2J4X A;  4KLK A;  2SNS A;  4LF6 L;  3I4O A;  4A3M B;  5H1S E;  1IL2 A;  4YHH L;  2K14 A;  3D8G A;  1PTO C;  1DD2 A;  2ZJP A;  3DWQ A;  5FO7 B;  4KK7 A;  3RR5 A;  3U9O A;  5JJI A;  3VR5 A;  1BCP B;  3MXG A;  3K80 C;  4XIG S;  3K5M A;  3R2T A;  5K36 G;  4LF4 L;  1VF7 A;  2C35 B;  4XDX A;  3H3V H;  2VQE L;  4OHJ A;  4A3G B;  1YNN C;  2PNH A;  1N34 Q;  1CSP A;  3T1H Q;  4CJ0 B;  1GXD C;  4AQY Q;  1BBU A;  4DV7 L;  2F0E A;  3F2U A;  2MO1 A;  2K5W A;  1HFN A;  2B63 B;  2F52 A;  3I8Z A;  4X65 Q;  1IBL L;  5ELB A;  3PIP 3;  1TWG B;  3A8J E;  3CCS A;  2UXD Q;  3UDG A;  3GTM H;  2Z6K A;  3LWU A;  4ZKC B;  4JI8 L;  4JI3 Q;  4ZRZ A;  2GVA A;  1IYJ B;  3TP7 A;  1EZ8 A;  1LT4 D;  3KF8 B;  3KLR A;  5CV8 A;  2JN4 A;  1JWS D;  2L4N A;  3GV6 A;  4UY8 C;  1HRJ A;  1F9S A;  5IGB A;  2BDO A;  2VZA A;  2HT1 A;  1Q3L A;  3RLO A;  4DV2 Q;  1KHI A;  2VS1 A;  2K28 A;  1HQM C;  4RKL A;  4OX9 L;  5IE8 A;  3CXC A;  3CCR A;  1VF5 C;  3KF8 A;  4ZQ3 A;  5BN3 A;  4HED A;  3F1Z A;  3S16 B;  4R4C A;  4ZK9 B;  5KGU A;  3PIP A;  3H91 A;  5J39 A;  4LF8 Q;  4J15 A;  2B2V A;  3D4W A;  1EY9 A;  2JA5 B;  1UUP A;  1RL2 A;  5CV6 A;  2Q8I B;  1DGS A;  3K0Y A;  2N55 A;  5C4X H;  5EAY A;  4ILW A;  3BG3 A;  5JEA G;  1VQ8 A;  1N33 L;  4DGZ A;  2EY1 A;  1JIC A;  3HOY B;  2HCC A;  5BR8 L;  2F1M A;  4ZKB B;  4HN7 A;  3J80 i;  3IL8 A;  1RTO A;  2F0G A;  2KEE A;  2F0P A;  5IYD G;  1KAB A;  2H1E A;  4JC0 A;  5KYL A;  3FKI G;  1I4Q A;  2IWH A;  4K5X A;  2NVT H;  1D8L A;  2JA6 H;  3PUX A;  2R92 B;  1HNX Q;  3T56 B;  3A8I E;  1TWA H;  1E1O A;  2R61 A;  4ZYS A;  5C0X I;  1Q46 A;  4UP8 A;  4G7H C;  1SFO B;  4JI0 Q;  5FO9 B;  3S2D H;  3NWT A;  3H3V C;  5DNF A;  1II3 A;  3JC6 6;  4A3D H;  4A3K G;  4PNY A;  1EFW A;  5C5M A;  3L9A X;  1V1O A;  3STB D;  3DUZ A;  1PVO A;  3HKZ G;  2QDB A;  3DHQ A;  4XYQ A;  4O1N A;  3P7J A;  1SYC A;  4QL5 A;  2UUA L;  3FPU B;  3HFZ B;  5IP9 H;  3NQT A;  2G9D A;  3E9H A;  4K6D A;  5JPN C;  4Y7N B;  4HR7 B;  4BBR G;  3T13 A;  1EZ6 A;  4NDX A;  2F0M A;  3RZD H;  2F0L A;  1RCV D;  3R3O A;  2B29 A;  1YIT A;  3PUZ A;  4CGY B;  3VR2 A;  2HIV A;  1LTR D;  2E76 C;  1GJX A;  3T1Y L;  1FJG L;  1EIG A;  4K0K L;  1GHK A;  4IFD G;  4DV3 L;  4F8M A;  4O2D A;  4L5S A;  1QB5 D;  3CCJ A;  2FMM A;  4NKL A;  2DGY A;  1MIU A;  4IUT A;  2X6G A;  2AQ3 B;  4DU9 A;  1Y1V H;  3KYH C;  1UE5 A;  3L0O A;  3G4S A;  1WCM B;  2DNC A;  1UE1 A;  1QZG A;  2KED A;  1A2T A;  4BBS B;  3S1N H;  3PF4 A;  1STG A;  4JI5 Q;  2CW0 D;  4X64 Q;  2Y0S G;  2JA8 H;  4C3H H;  5A2Q E;  1UNS A;  1XYI A;  4CJ1 B;  1RJT A;  5IGC A;  2MJ8 A;  2JSO A;  4IQZ A;  2QF7 A;  1X3Q A;  1X3P A;  2PZT A;  3V96 A;  1SE2 A;  5D3D A;  2IX1 A;  2WAC A;  3CCQ A;  4DV0 Q;  4A3J G;  5JOB A;  1TII D;  3I4N G;  5HGQ A;  1Y1W H;  3BDL A;  4IOA A;  1SNM A;  2LKV A;  3Q23 A;  1SYE A;  1DJR D;  3NTK A;  3S9W A;  3CW2 C;  3FRP B;  4AYB G;  4R1J A;  5M5X B;  4CKC A;  2EIF A;  2KOL A;  3KFU A;  1KRS A;  4A3E H;  2K01 A;  1YIJ A;  4KJO A;  2VW9 A;  2OT2 A;  5C0X H;  5KIX A;  1DON A;  1VQO A;  3J80 L;  1G8Z D;  4TKO B;  4HIO A;  1ICW A;  5LMN W;  4JV5 Q;  1OXU A;  1SXT A;  3JAM c;  5M3F H;  1XTD A;  1W3S A;  2PQA B;  3A8K E;  5GAG C;  2XWJ B;  4XXE A;  2A1A A;  2KBN A;  5IT9 c;  2XSC A;  3QOJ A;  1LAB A;  3E6Z X;  1OO9 B;  4QGU A;  2B2Y C;  1TY0 A;  3DEO A;  1B70 B;  3I55 A;  2ZTE A;  1Y8O B;  3N6R A;  1XPO A;  4YY3 Q;  3BJU A;  1ILQ A;  1YNX A;  2KCN A;  1R4P B;  2F0W A;  3OHX C;  4B3M L;  1CZW A;  1K28 A;  1D5X C;  5K36 H;  3PUW A;  4HJ8 A;  3TDQ A;  1ILP A;  3OSO A;  1SJE D;  1UWV A;  4YCV A;  2F0D A;  1FR3 A;  5T1I A;  2UUC Q;  5KEE A;  1SN8 A;  2WII B;  4JI1 L;  2K5N A;  3RN5 A;  4OWW B;  4HCS A;  3OMG A;  1CT1 D;  3K5L A;  3EBE A;  1QJO A;  4A3I G;  1G91 A;  3GO5 A;  3HS0 C;  1VQE A;  2ZTC A;  4RA8 A;  1TWC B;  4A3F B;  2H4O A;  2MPM A;  1I94 Q;  4N8F A;  4U67 3;  3MA2 B;  4DK3 C;  4QJF A;  1PH8 A;  5CYU A;  1L1O C;  1MJE A;  5C44 B;  5EKI A;  3AFQ A;  3QO2 A;  1B44 D;  4C3J B;  1Q90 A;  5IWA L;  3AFP A;  4A3L G;  2R7Z B;  5C3E B;  1ONL A;  1N32 L;  4DR6 L;  1WTH A;  3U9S A;  3HOW G;  4IFD I;  4FXG C;  1PH5 A;  1I3Q B;  1BR9 A;  4O42 A;  5M3M G;  1YHQ A;  1DOL A;  4L63 B;  1BNZ A;  1GKH A;  3BZK A;  1FD7 D;  2JK8 A;  2YTX A;  5KYI A;  2I0Q A;  2Q8T A;  3TSS A;  1PH6 A;  3CC2 A;  2OWO A;  2CQO A;  2EVB A;  1A8V A;  2H5X A;  1NCV A;  3WOF A;  2SEB D;  3RMH A;  5CV5 A;  1JE4 A;  4R4I A;  1M90 C;  3S14 B;  1XMO L;  4LF9 Q;  1Y69 U;  5J1Z A;  2CWA A;  3PO3 B;  4G4K A;  4X3T A;  2K75 A;  1LTS D;  4GKK L;  2M9V A;  1K3B C;  4GOP B;  5IYD H;  3IKJ A;  1M8A A;  5AJ3 Q;  3GTQ H;  1HXY D;  1NR4 A;  3CRL C;  2F0J A;  4H02 A;  3FKI H;  1JCK B;  3VYT A;  1EIF A;  2RVL A;  1LTB D;  4I65 A;  3GTJ H;  3HOZ B;  4CDC C;  5IGE A;  4LFA Q;  3R8B A;  2E2I B;  4GOP A;  4RG1 A;  4B3S L;  2E75 C;  1VQB A;  1HNZ L;  2EPB A;  4A3G G;  1S40 A;  2VUM B;  4TSS A;  4K8J A;  4NP5 A;  1R9T B;  4OON A;  2I5H A;  4MTK A;  1EWC A;  4DK6 C;  1CA5 A;  4C3I B;  4A3K H;  4F87 A;  3S2H B;  1PZI D;  4IUN A;  4HSP A;  1EWH A;  2B63 G;  2J0T D;  3S1R B;  2QW7 A;  1BDO A;  2PPB C;  1Q1B A;  1TS3 A;  3J81 E;  5D14 A;  1A15 A;  3OTO Q;  3EIV A;  3EA6 A;  4BBR H;  4LF6 Q;  1VQM A;  1I50 H;  5IOC A;  5M9O A;  3MXN B;  4YHH Q;  2DUD A;  1CSQ A;  2LS0 1;  2OXP A;  5JVH 3;  2F0F A;  4FF3 A;  5I9O A;  2M00 A;  3DXJ C;  4R4T A;  1EY7 A;  4DV1 Q;  3GTP H;  3KLS A;  2MUY A;  2GVB A;  4LF4 Q;  5J22 A;  3OYY A;  4GN5 A;  1N36 L;  3FVQ A;  3MXN A;  2VQE Q;  3SGI A;  3T51 B;  4DV4 L;  1TR5 A;  5KRU A;  2HUG A;  2Q2U A;  3FEW X;  1LT5 D;  2F0Q A;  2F4V L;  1S3O A;  4JI6 Q;  5IP7 G;  3MEH A;  3HOY G;  4MIU A;  4DR7 L;  4QCL A;  3E3X A;  2WKD A;  1YHA A;  3AB9 A;  2HD3 A;  2C5C A;  2KHI A;  3MVV A;  1HZ9 A;  5M5W H;  1NMF A;  1HA6 A;  1Q8I A;  2K5V A;  1S5F D;  5ELC A;  2R92 G;  1KLG D;  4QIW E;  1NY4 A;  4A3J H;  3TRZ A;  3I4N H;  1ET6 A;  5ELF A;  1XNQ Q;  2N8N A;  2AKW B;  4XQQ A;  4DAV A;  4X6A H;  3KLS X;  1QWY A;  2D5D A;  1NTG A;  1RDP D;  2IHE A;  5KNB A;  4FXK C;  2QIL A;  4HID A;  4M1U B;  1K0S A;  5IY0 A;  2XIW A;  1KXL A;  3BU2 A;  1WTR A;  1I6H H;  3J7Y W;  4MN3 A;  1KD1 C;  4MZ9 A;  5EPK A;  3GTG B;  4Q0F A;  3TEH B;  2JA6 G;  1K9M C;  5M5Y B;  2A68 D; 
#chains in the Genus database with same CATH homology
 5LL6 S;  2NYZ D;  1K8M A;  2QKI C;  1H9M A;  3OOC A;  3L3O C;  1QNK A;  1Z7T A;  3TP6 A;  1C8C A;  1LLR D;  3ERQ A;  4OGQ C;  1PZJ D;  3N52 A;  1M4V A;  3SEB A;  2CHB D;  2NN6 G;  1S5D D;  3VYU A;  3VR4 A;  2FFK B;  1LTG D;  5C5L A;  1XTC D;  1ENF A;  5EPL A;  1V1P B;  4DK0 A;  1HTL D;  4QIW B;  1B1Z A;  1C4Q A;  3GTO B;  1Y8P B;  4A3B B;  2A5H A;  3MTS A;  4JK1 C;  5C6A A;  3C2P A;  3HOV B;  4WJW A;  3I90 A;  1FGB D;  5ISR A;  1HUN A;  5CV4 A;  1ZEQ X;  3A54 A;  5HUR A;  1KNE A;  3TBI B;  2HDL A;  2HCI A;  2L0C A;  2IX0 A;  1ET9 A;  4B08 A;  3FMC A;  3H6M A;  3SE0 A;  5EGT A;  2F0K A;  4RGO S;  1PRT C;  4PQX A;  4IUV A;  2F0O A;  1STY A;  2D2C C;  1BXT A;  3CRK C;  3HGB A;  3MZ5 A;  2NVY B;  1LO5 D;  3DMU A;  4FF4 A;  1AP0 A;  2VXW A;  3QWN A;  4DN4 M;  4XQN A;  3CQZ B;  5E4W C;  1V8Q A;  1I4P A;  4G7O C;  1F2M A;  5A2Q L;  5I2X A;  4UAI A;  3K6O A;  3IFD A;  2DY8 A;  5CR3 A;  3R2I A;  4K14 A;  1LT6 D;  1SEB D;  3OPO A;  3P1H A;  3RZO B;  1PTO F;  3OWF A;  4HCE A;  4XQJ A;  3S1M B;  1IKM A;  3I91 A;  5A35 A;  1HPC A;  1TKW B;  4DK1 A;  5FLX L;  3WDN A;  3HP3 A;  2BE5 D;  3D6W A;  4IN3 A;  2F0I A;  4DNT B;  2R3Z A;  2XWB B;  1J8I A;  2L55 A;  3E0J A;  2NN6 I;  1RD9 D;  3NP8 A;  2CW0 C;  2XN9 C;  2M2L A;  3C1E A;  2BOS A;  1WTX A;  4CBV A;  3OW7 A;  3GTK B;  4H0L C;  3VA5 A;  4U68 A;  2EYO A;  4BS9 A;  1ZKO A;  2TSS A;  4H7B A;  2F4I A;  4J1M A;  4QUC A;  1IHZ A;  2Z1C A;  2Q8R E;  3Q22 A;  1O80 A;  3G7L A;  4KD3 A;  1ZYR C;  3VR6 A;  1JOQ A;  1BCP C;  4PV1 C;  2E74 C;  1JOK A;  2DNE A;  3BZD B;  4GZY C;  1H9J A;  1IW7 C;  1PLF A;  2AUK A;  2RKS A;  1DOK A;  3Q6S A;  4M8A A;  2F3V A;  4RGM A;  3RUZ A;  2NVQ B;  4KY5 A;  1I4R A;  1OXX K;  2EYH A;  1B9M A;  4ULL A;  1H9R A;  2B2V C;  2VNU D;  1B4O A;  1JOR A;  2BA0 A;  3SK4 A;  3R93 A;  1XXG A;  1F9R A;  5CMD A;  4H44 C;  4TQU S;  4DNR B;  5C4X B;  1AZQ A;  2NN6 H;  5CV7 A;  3A55 A;  4MHE A;  5JVG 3;  1D1K A;  4ZUJ A;  1Y8N B;  3CU7 A;  4OIK A;  2NVT B;  3LWE A;  1LV9 A;  1FNW A;  4OO1 G;  3HRZ C;  1EYC A;  1I6V C;  4C1N I;  1TWA B;  3J81 L;  2Z4H A;  1EEI D;  4R9W A;  2K04 A;  1PTO D;  4EQO A;  1F9P A;  4A3D B;  3QB3 A;  5FKA C;  1MD2 D;  4PMC A;  2KHS A;  3DWP A;  5JJZ A;  3VA7 A;  1BBX C;  1JWU D;  1PZK D;  1H9K A;  1YNN D;  2PW7 A;  4RHR A;  1JC7 A;  1EQT A;  4EGV A;  5IIF A;  3NXW A;  3DEP A;  2K7V A;  3CHB D;  2X69 A;  4IUP A;  3HZX A;  1A2U A;  3ERO A;  3KBX A;  5BN4 A;  2B8F A;  4P2C B;  1L0Y B;  5FLX E;  2LFN A;  1SBB B;  3T53 B;  4XT3 B;  1CHQ D;  1C48 A;  1Y1V B;  5CV9 A;  5EQ0 A;  2F3W A;  2ICE C;  5DEH A;  4DXG A;  3S1N B;  2JYO A;  3HOU B;  2EDG A;  1ML0 D;  5IOD A;  1O7Z A;  1GUW A;  4J6H A;  2FJ2 A;  1DCZ A;  2KVM A;  3W2D A;  3BS1 A;  4WFN 3;  3MFY A;  2IW3 A;  1A3T A;  5EKK A;  1MSG A;  1W6K A;  1D6E C;  1QNU A;  1TT2 A;  2WP8 J;  3TZU A;  1L0X B;  1Y1W B;  2A6E C;  3QOL A;  4K2L A;  4I7Z C;  1E2W A;  2F0N A;  4EVO A;  2NVX B;  5G3L F;  1QG7 A;  1KDA A;  1E0B A;  4CKE A;  1YNJ C;  2B2U A;  3NSW A;  1MSH A;  1EQV A;  5JEA J;  1UEA B;  3KK7 A;  1KDC A;  4RKB A;  4OO1 I;  1CM9 A;  4JBW A;  3OIP A;  1WTV A;  1SYG A;  2F0H A;  2L11 A;  1SYF A;  3K5N A;  1WTP A;  1CZG A;  3J7A F;  3JAM E;  3SK5 A;  1XWE A;  5JPM C;  4DFA A;  4KY6 A;  3GD7 A;  5IT9 E;  2PCF B;  3PUY A;  2FMC A;  2B2W A;  5ELD A;  1V43 A;  4CHT B;  1RTN A;  2ENB A;  2WIN B;  5D65 A;  1CA6 A;  4BA2 I;  4L6T B;  3M7N A;  4KKT A;  4K5W A;  4B9W A;  1R4Q B;  1SE4 A;  1SJH D;  1JQY D;  4RCN A;  2NUC A;  2L9H A;  3D3R A;  4DA2 A;  3IFT A;  2A69 C;  4C56 C;  1LT3 D;  4IFD J;  4G7Z C;  5CBA E;  2K5D A;  2PNR C;  3I4L A;  3ONA B;  3DM1 A;  3ND9 A;  3NTI A;  2XRS D;  5IGG A;  1HUM A;  2A6H C;  1RHP A;  2C9O A;  4QF4 A;  3TZD A;  1SMY C;  2AWO A;  2DN8 A;  1W6J A;  1HTP A;  2KCC A;  1GUN A;  3SR1 A;  5EJW A;  3GTQ B;  3S15 B;  3FKI B;  3A7L A;  4FF1 A;  2B39 A;  1EYD A;  3D4D A;  3P20 A;  4OO1 H;  2PQE A;  1GUT A;  2RSN A;  1EOT A;  3VYR A;  1DM0 B;  2CQA A;  1EY0 A;  2EJG C;  4IUQ A;  4RHS A;  4S3S A;  1EEF D;  5KND A;  5DM6 3;  4A3K B;  4KHZ A;  3VR3 A;  1KNA A;  2F0T A;  2VB2 X;  3PMF A;  5DM7 3;  1PDQ A;  4FP5 D;  4IUU A;  1Z6H A;  4G57 A;  1JWM D;  1NUC A;  3ZYY X;  1E2Z A;  4HSV A;  4FVM A;  3K58 A;  1JOO A;  5K5P A;  4BBR B;  4IZ8 A;  3SDZ A;  1MBY A;  3V2T A;  1I50 B;  1RF2 D;  2E2H B;  1AZP A;  2EJF C;  4DXF A;  4V0B A;  5F2D A;  1JR0 D;  1BUV T;  2B2T A;  1T5X D;  2ID0 A;  3BYT B;  1H9S B;  4C2M B;  3GTP B;  2RQX A;  1PXU A;  3BDC A;  2IL8 A;  2RDH A;  3GTL B;  2ICI A;  2KJX A;  1H9S A;  2BE5 C;  4BY1 B;  1VDZ A;  4NMZ A;  5LHY 1;  3PO2 B;  1STA A;  2KA7 A;  1D2B A;  2N88 A;  2Y0S B;  4KN4 C;  1SYD A;  2D9U A;  2MP1 A;  1EL0 A;  1A3V A;  4RGN A;  3NBH A;  3M4Y A;  2O5I C;  1UAP A;  3GV3 A;  4WRD A;  4DF7 A;  3RD4 A;  4ODG A;  1SSO A;  3I4N B;  1AW7 A;  1VMP A;  4EQN A;  1O78 A;  4FO2 A;  3AMU A;  2XNA C;  4PMW A;  1SAP A;  1SE3 A;  2BCO A;  1Q12 A;  3D4R A;  1I6H B;  4V19 0;  2KEC A;  5C4H A;  2WKC A;  3MXU A;  2LY7 A;  5EBC A;  1GUS A;  4DAP A;  1ESF A;  2O2L D;  3LNN A;  3L7Z C;  1SNO A;  1V1P A;  3NK9 A;  3BVM A;  4FXD A;  1G2T A;  2RDG A;  2PZW A;  1GHJ A;  5COY A;  1IYU A;  1TVX A;  1PRT F;  1B53 A;  1B9N A;  5T1G A;  5FOB B;  3NQI A;  1STB A;  2PYK A;  2EY2 A;  5JAV A;  1KTK A;  5I4D A;  1PTO B;  2HQE A;  4A3I B;  1WTO A;  1S5C D;  2IT1 A;  1EU4 A;  2OF1 A;  2SOB A;  1I4G A;  2XVS A;  1S4Z A;  1PFN A;  1J9O A;  3DWA A;  1K83 B;  2EXZ A;  3E5S A;  5M3M B;  1ROD A;  2Z4I A;  1WTW A;  3OMC A;  3SXH A;  3H09 A;  4R8I A;  4Z9C B;  3W3A A;  2RBM A;  4C3J G;  4PMB A;  3PV0 A;  1CHP D;  1KAA A;  3K5O A;  5C4J B;  3I3C A;  3NPP A;  3BVZ A;  1OXS C;  5KNC A;  3UI2 A;  3QIA A;  1G29 1;  4KI0 A;  3K7A B;  1U4R A;  1TWF B;  2K5Q A;  3C3L A;  4C1N K;  2I46 A;  1PFM A;  3ND8 A;  1ENC A;  1A3U A;  1IYV A;  2NTT A;  1QIL A;  3TN2 A;  4E6I A;  1EY6 A;  2ZXR A;  3A7A B;  1TS4 A;  4KKS A;  2JEA I;  3OWE B;  3MAQ A;  4KD4 A;  2L1B A;  3TME A;  1BCP F;  3I70 A;  5ELE A;  1B2T A;  2X6L A;  1U4L A;  4F7X A;  3FPP A;  3HG9 A;  3T16 A;  5EPJ A;  5FK9 C;  4DAY A;  2D62 A;  2AUJ D;  4C3I G;  4N9T A;  1JB3 A;  3K57 A;  5LL6 X;  1NR2 A;  4KJN A;  1ZXT A;  2K1B A;  2NWG A;  2KQ3 A;  3JAM L;  3GTM B;  2EY5 A;  3EJI A;  1ESR A;  4KKU A;  5IT9 L;  3Q0A A;  3NWS A;  1BQQ T;  1AN8 A;  2JE6 I;  1SNC A;  4XTC S;  1I4H A;  1PYW D;  3SK8 A;  1PRT D;  1G6Z A;  4RCO A;  4BWG B;  2NB0 A;  2QCP X;  4B9X A;  1WD0 A;  2FIN B;  1O7Y A;  5CC4 A;  1X32 A;  4FYD A;  2G9H D;  3OIQ A;  4LJZ C;  1LAC A;  2K05 A;  1VMC A;  4LK1 C;  1STE A;  2JA6 B;  3I73 A;  5I9P A;  1U9R A;  5NUC A;  1D5Z C;  1A6X A;  1WD1 A;  2O4X A;  4HTH A;  1PMR A;  3GQB A;  2BDN A;  2E2D C;  3M85 A;  1HHV A;  2TMP A;  2YYZ A;  3S2D B;  1U4P A;  4YIJ A;  2LMC B;  2Z8L A;  5C0X J;  4CJ2 C;  3I4M B;  1TQO A;  2F03 A;  1DOM A;  1SDF A;  1F77 A;  2RA4 A;  4R8N A;  5C3W A;  4J8Q A;  1HQR D;  3I72 A;  3RZD B;  5D3I B;  5E1F A;  4ABN A;  1SND A;  4ZAI A;  1O7L A;  1TU2 B;  4HMJ A;  4BY7 B;  2B2Y A;  1DXM A;  1LTA D;  1MI2 A;  5IGD A;  2SDF A;  4KN7 C;  5COR A;  2F0U A;  3GP7 A;  2K6A A;  4NW2 A;  1SNP A;  4FNF A;  3EFX D;  3D6C A;  4RWS C;  3ITP A;  2EE1 A;  3S1Q B;  5C4Z A;  1ZYR D;  2JA8 B;  4C3H B;  1TY2 A;  1AFP A;  1QOH A;  1OXV A;  2JEB I;  1BCP D;  1BOS A;  2ZXO A;  3IAY A;  1IW7 D;  2QEJ C;  2ZT9 C;  1BF4 A;  4HMI A;  4ZUI A;  3VYS A;  1CI3 M;  1CFM A;  1IKL A;  3M4O B;  4A3E B;  2PZU A;  2K32 A;  3J7A V;  3CKI B;  4KMU C;  2CVR A;  5M3F B;  5I6W A;  2WB1 B;  2PW5 A;  1RKN A;  3MC0 B;  4Q5V A;  3MWY W;  4IAL A;  1CQF A;  1HA5 A;  4K5V A;  5CBE E;  2VB3 X;  3BVG A;  1D5M C;  4LAA A;  4ME5 A;  2R93 B;  1IL8 A;  2EYJ A;  2DY7 A;  2EZV A;  2RSO A;  3X3M A;  2A68 C;  4KY7 A;  2B2U C;  2IX3 A;  3WOE A;  1B3A A;  2F0S A;  5IGF A;  3SVM A;  3HEJ A;  1FNU A;  2NBF A;  1MGS A;  2E2J B;  3PIO 3;  5JEA H;  2MHV A;  1CQV A;  4RAU C;  4K2K A;  4RGT A;  2B8G A;  4HAE A;  1QCB D;  2EYF A;  3MXP A;  1Z47 A;  2KUM A;  1ENA A;  1TS2 A;  3H0G B;  1CTM A;  4X3S A;  3C46 A;  1HFG A;  4CKB A;  3PUV A;  2B2W C;  2AWN A;  2PO4 A;  1F2L A;  4H13 C;  3K59 A;  4QMG A;  1D1I A;  4QB4 A;  3C1F A;  3O13 A;  3KBG A;  1EYA A;  3AU7 A;  4L8J A;  3GTJ B;  2K03 A;  4QUF A;  1FYC A;  2F0V A;  1B50 A;  3MFG A;  3H94 A;  3NE5 B;  1HCZ A;  3A56 A;  4RFB A;  1F2Y A;  4IUR A;  2A74 C;  4IFD H;  3HKZ B;  3P75 A;  4X3U A;  3BYY B;  2K33 A;  3X3N A;  1T5E A;  2EOT A;  2EY6 A;  1NSN S;  2EYM A;  4ZLT F;  2A6E D;  3URY A;  2IJ0 A;  1PFB A;  1EFI D;  1EIH A;  2O5J C;  5EBD A;  1YNJ D;  1QE6 A;  3NUC A;  3QJY A;  1F9Q A;  5G3L D;  4XT1 B;  3M7G A;  2OEO A;  3T4A C;  2EYP A;  4RH6 A;  4LMQ D;  3J80 E;  1E2V A;  2EJM A;  5EKL A;  2MGS A;  4KTA A;  5DAU A;  2GA4 B;  5E4X A;  2XRQ D;  2HDM A;  5I6Y A;  2NTS A;  2WAQ B;  1STH A;  2R6G A;  4FF2 A;  4ID6 A;  3D31 A;  4OL7 A;  3S17 B;  1GUO A;  4K6L A;  2AQ1 B;  1FNV A;  1NAP A;  5M5W B;  1DZ1 A;  2RDF A;  1LTI D;  1KDB A;  1U4M A;  3TP5 A;  4A3J B;  1CK1 A;  2B2T C;  1TS5 A;  2YU9 B;  2SNM A;  3NTH A;  1K8O A;  4F88 A;  4AYB B;  1PRT B;  5I2Y A;  4A93 B;  4KV6 A;  2AQ2 B;  3Q24 A;  2J7Z A;  1TWH B;  2IPK D;  1EY8 A;  4X3K A;  2A69 D;  1STN A;  1PTO H;  3KUP A;  3M3Y B;  2ZXP A;  1F2Z A;  2NZ1 D;  1SYB A;  1AEX A;  1G2S A;  5AFW A;  3SHL A;  4XYO A;  5E3F A;  5BN5 A;  3QG1 A;  1WTQ A;  3V05 A;  4K8I A;  2L12 A;  3G6J B;  5TSS A;  2A6H D;  4OIJ A;  2BA1 A;  1GOZ A;  1SMY D;  3TP8 A;  3RLF A;  2L5T A;  3EVQ A;  1WVL A;  1OXT A;  1EY5 A;  1Q1E A;  1S5B D;  2PMZ B;  3SK6 A;  3NHH A;  2FHT A;  2A73 B;  2JXM B;  3FDT A;  1XX8 A;  4C3H G;  5FO8 B;  3HOX B;  2I07 B;  2V4D A;  4KHV A;  5CGK A;  4WOR A;  2JP1 A;  3HOW B;  1BO0 A;  1GUG A;  4N9P A;  1SNQ A;  1EY4 A;  1S5E D;  2JA7 B;  3EQL C;  5HGT A;  1VCI A;  4UDU C;  1I4X A;  5C0X G;  4TRD A;  1EU3 A;  4BA1 I;  1LTT D;  1KLU D;  2EYL A;  3NBI A;  3MHB A;  5C3X A;  3LX0 A;  3BDO A;  1DYQ A;  2WV6 D;  4EQP A;  2J4X A;  2SNS A;  4A3M B;  3D8G A;  1PTO C;  1DD2 A;  3DWQ A;  5FO7 B;  4KK7 A;  3U9O A;  3VR5 A;  1BCP B;  3MXG A;  3K5M A;  4XIG S;  3R2T A;  5K36 G;  1VF7 A;  4XDX A;  4OHJ A;  4A3G B;  1YNN C;  4CJ0 B;  1GXD C;  2F0E A;  3F2U A;  2K5W A;  1HFN A;  2B63 B;  3I8Z A;  5ELB A;  3PIP 3;  1TWG B;  3A8J E;  3LWU A;  4ZKC B;  4ZRZ A;  3TP7 A;  1EZ8 A;  1LT4 D;  3KLR A;  5CV8 A;  1JWS D;  2L4N A;  3GV6 A;  1HRJ A;  1F9S A;  5IGB A;  2BDO A;  1Q3L A;  2K28 A;  1HQM C;  4RKL A;  1VF5 C;  3KF8 A;  4ZQ3 A;  5BN3 A;  4HED A;  3S16 B;  4ZK9 B;  5KGU A;  3H91 A;  5J39 A;  2JA5 B;  2B2V A;  3D4W A;  1EY9 A;  1UUP A;  5CV6 A;  2Q8I B;  3K0Y A;  2N55 A;  4ILW A;  3BG3 A;  5JEA G;  4DGZ A;  2EY1 A;  1JIC A;  3HOY B;  2HCC A;  2F1M A;  4ZKB B;  4HN7 A;  3IL8 A;  1RTO A;  2F0G A;  2KEE A;  2F0P A;  1KAB A;  2H1E A;  5KYL A;  1I4Q A;  2IWH A;  4K5X A;  3PUX A;  2R92 B;  3T56 B;  3A8I E;  2R61 A;  4ZYS A;  5C0X I;  4G7H C;  1SFO B;  5FO9 B;  3NWT A;  3H3V C;  5DNF A;  1II3 A;  4PNY A;  5C5M A;  3L9A X;  1V1O A;  3DUZ A;  2QDB A;  3DHQ A;  4XYQ A;  4O1N A;  3P7J A;  1SYC A;  3FPU B;  4K6D A;  3NQT A;  5JPN C;  2G9D A;  4Y7N B;  4HR7 B;  3T13 A;  1EZ6 A;  4NDX A;  2F0M A;  2F0L A;  1RCV D;  3R3O A;  3PUZ A;  4CGY B;  3VR2 A;  1LTR D;  2E76 C;  1GJX A;  1EIG A;  1GHK A;  4IFD G;  4F8M A;  1QB5 D;  2FMM A;  4NKL A;  4IUT A;  2X6G A;  2AQ3 B;  4DU9 A;  1WCM B;  2DNC A;  2KED A;  1A2T A;  4BBS B;  1STG A;  2CW0 D;  5A2Q E;  1UNS A;  1XYI A;  4CJ1 B;  1RJT A;  5IGC A;  2MJ8 A;  2JSO A;  4IQZ A;  2QF7 A;  1X3Q A;  1X3P A;  2PZT A;  3V96 A;  1SE2 A;  5D3D A;  2IX1 A;  2WAC A;  5JOB A;  1TII D;  3BDL A;  1SNM A;  2LKV A;  3Q23 A;  1SYE A;  1DJR D;  3NTK A;  3S9W A;  3FRP B;  5M5X B;  4CKC A;  2KOL A;  2K01 A;  4KJO A;  2OT2 A;  5C0X H;  5KIX A;  1DON A;  3J80 L;  1G8Z D;  4TKO B;  1ICW A;  1OXU A;  1SXT A;  3A8K E;  2XWJ B;  4XXE A;  2XSC A;  3QOJ A;  1LAB A;  3E6Z X;  1OO9 B;  2B2Y C;  1TY0 A;  3DEO A;  1Y8O B;  3N6R A;  1ILQ A;  2KCN A;  1R4P B;  2F0W A;  3OHX C;  1CZW A;  1D5X C;  5K36 H;  3PUW A;  3TDQ A;  1ILP A;  3OSO A;  1SJE D;  2F0D A;  1FR3 A;  5T1I A;  5KEE A;  2WII B;  4HCS A;  3OMG A;  1CT1 D;  3K5L A;  1QJO A;  1G91 A;  3GO5 A;  3HS0 C;  4RA8 A;  1TWC B;  4A3F B;  2H4O A;  2MPM A;  4U67 3;  3MA2 B;  5CYU A;  5C44 B;  5EKI A;  3QO2 A;  1B44 D;  4C3J B;  1Q90 A;  2R7Z B;  5C3E B;  1ONL A;  3U9S A;  4IFD I;  4FXG C;  1I3Q B;  1BR9 A;  4O42 A;  1DOL A;  4L63 B;  1BNZ A;  1FD7 D;  5KYI A;  2Q8T A;  3TSS A;  2EVB A;  1NCV A;  3WOF A;  2SEB D;  3RMH A;  5CV5 A;  1JE4 A;  3S14 B;  1Y69 U;  5J1Z A;  3PO3 B;  4G4K A;  4X3T A;  1LTS D;  2M9V A;  3IKJ A;  1M8A A;  1HXY D;  1NR4 A;  3CRL C;  2F0J A;  1JCK B;  3VYT A;  2RVL A;  1LTB D;  4I65 A;  3HOZ B;  5IGE A;  3R8B A;  2E2I B;  2E75 C;  2EPB A;  2VUM B;  4TSS A;  4K8J A;  4NP5 A;  1R9T B;  1EWC A;  1CA5 A;  4C3I B;  4F87 A;  3S2H B;  1PZI D;  4IUN A;  4HSP A;  1EWH A;  2J0T D;  3S1R B;  1BDO A;  2PPB C;  1Q1B A;  1TS3 A;  3J81 E;  5D14 A;  1A15 A;  3EA6 A;  5IOC A;  5M9O A;  2LS0 1;  2OXP A;  5JVH 3;  2F0F A;  4FF3 A;  5I9O A;  2M00 A;  3DXJ C;  1EY7 A;  3KLS A;  2MUY A;  5J22 A;  3FVQ A;  3MXN A;  3T51 B;  1TR5 A;  5KRU A;  2HUG A;  3FEW X;  1LT5 D;  2F0Q A;  3MEH A;  4MIU A;  4QCL A;  2WKD A;  3AB9 A;  2C5C A;  3MVV A;  1HA6 A;  1Q8I A;  1S5F D;  5ELC A;  1KLG D;  1ET6 A;  5ELF A;  4DAV A;  4XQQ A;  3KLS X;  1QWY A;  2D5D A;  1RDP D;  5KNB A;  4FXK C;  2QIL A;  4M1U B;  2XIW A;  1WTR A;  3J7Y W;  4MN3 A;  5EPK A;  3GTG B;  4Q0F A;  5M5Y B;  2A68 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...