5E4WC

Crystal structure of cpsrp43 chromodomains 2 and 3 in complex with the alb3 tail
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
105
structure length
105
Chain Sequence
b'QVFEYAEVDEIVEKRGKGKDVEYLVRWKDGGDCEWVKGVHVAEDVAKDYEDGLEYAVAESVIGKRVGDDGKTIEYLVKWTDMSDATWEPQDNVDSTLVLLYQQQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin-1
publication title Structural basis for cpSRP43 chromodomain selectivity and dynamics in Alb3 insertase interaction.
pubmed doi rcsb
source organism Escherichia coli o157:h7
molecule tags Transport protein
total genus 16
structure length 105
sequence length 105
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5e4wC02
2N88A 4ZKCB 3MWYW 1KNEA 1X32A 2X6LA 2KEDA 1ILPA 2K03A 2MJ8A 4CJ2C 1WTVA 3I3CA 2EE1A 5CORA 4XDXA 1WTWA 1LV9A 2RSNA 3N52A 1HFNA 2B2TA 1MI2A 1PFNA 3GV3A 1E0BA 4IUVA 3SVMA 1HA6A 5COYA 4X3TA 1G2SA 2Q8TA 3FPUB 1B4OA 2HDMA 4MHEA 2L4NA 2N55A 4HCSA 1Q3LA 1X3QA 3LWEA 2HDLA 1ZXTA 1J8IA 1G91A 2RA4A 1DOMA 2J7ZA 1NR4A 3DEOA 1AP0A 1JICA 1GUWA 3F2UA 5AFWA 2EOTA 1EIHA 1F9PA 3UI2A 5EPLA 1ICWA 1RTOA 1F9QA 4CJ1B 1RHPA 1BO0A 2BDNA 2L11A 1NR2A 2RSOA 1O80A 2B2VC 1EIGA 4ZK9B 2KOLA 4OIKA 2JYOA 3DM1A 2B2WC 2DY8A 2JP1A 3IL8A 2RVLA 1BF4A 1B50A 4DN4M 2L1BA 2NWGA 1WVLA 5D65A 1HFGA 4IUQA 3KBXA 5E4XA 1XX8A 1HRJA 4RA8A 2HCIA 5EJWA 4ZAIA 1QE6A 1X3PA 2B2VA 3ONAB 1G2TA 2NYZD 2L12A 2R3ZA 2VXWA 4X3SA 3I91A 1HUMA 4IURA 4IUPA 2B2WA 1WD1A 4RAUC 1B53A 4NW2A 2HUGA 1WD0A 1CA6A 4R9WA 1DOKA 3P7JA 3I8ZA 2DY7A 1DOLA 1J9OA 1F9RA 1EOTA 4XT3B 4ZLTF 1EL0A 1QG7A 2B2UC 3FDTA 1AZQA 2K28A 3GV6A 1MGSA 1ESRA 1RODA 1SSOA 2FMMA 4O42A 1VMPA 4QUCA 1HUNA 1IL8A 4HSVA 2KUMA 5CBEE 3MTSA 5EPKA 2K01A 1BBXC 1TVXA 4QUFA 5D14A 1B2TA 5DNFA 3IFDA 1F2LA 2EPBA 2FFKB 1B3AA 2MP1A 1PFBA 2B2UA 4X3KA 1WTXA 1G6ZA 3D6WA 1ML0D 3H91A 1MSGA 3Q6SA 2D9UA 2X6GA 2FHTA 2B2YC 3TN2A 1U4LA 3G7LA 4XT1B 1JE4A 1U4PA 2IL8A 2MPMA 2XIWA 4U68A 5E4WC 2FJ2A 1RJTA 2X69A 1WTOA 1QNKA 1O7YA 2KEEA 1PDQA 1CM9A 2SDFA 4OIJA 5EKIA 1PFMA 3I90A 4ZKBB 1IKMA 1F9SA 1S4ZA 1NAPA 2HCCA 3QO2A 4MN3A 1WTRA 5T1GA 1WTPA 1C8CA 4X3UA 1PLFA 2B2YA 2H1EA 1KNAA 2KVMA 1DONA 1HHVA 3TZDA 1ILQA 2M2LA 1M8AA 1SDFA 1XYIA 2FINB 3DEPA 1SAPA 2CVRA 4UAIA 1NCVA 1U4RA 4HEDA 1EQTA 5T1IA 1MSHA 5EPJA 3R93A 2K04A 2Q8RE 2K05A 4IUTA 4R8IA 1AZPA 2L9HA 1DZ1A 2KECA 1BNZA 5EQ0A 5CBAE 5JJZA 3KUPA 4LMQD 1WTQA 3HP3A 2B2TC 2K1BA 1CA5A 4HAEA 4IUUA 1O7ZA 2NZ1D 2MGSA 1A15A 4CJ0B 1RTNA 4RWSC 5CMDA 1IKLA 1VMCA 1U4MA
chains in the Genus database with same CATH superfamily
1SE4A 5GAEC 4QY7A 4X6AH 4IALA 4F8MA 2ZT9C 5IOCA 2OQKA 1Y69U 2F03A 1YJ9A 1DXMA 5BN4A 2CWAA 3E9IA 3I4MH 3FHWA 2PCFB 1CKOA 4DGZA 4MHEA 3F2BA 4AQYQ 4JPBW 4DUYL 3ND8A 1NE3A 3HKZG 4WORA 5FLXE 3DUZA 3CCMA 1UE5A 3MXUA 4JI7Q 4DV7Q 1II3A 2Q8IB 3UI2A 3PQIA 2L11A 1E3PA 1L0YB 3W2DA 1TY2A 2L15A 4KJOA 2VUMB 4AH6A 1GD7A 4A75A 1FNUA 2PZTA 1XWEA 1GVPA 5EJWA 2A1AA 4ZUIA 3HOXG 5FLXc 2B2VA 3CMAA 1IYVA 3SK5A 2R3ZA 5CV9A 1L0XB 1DOKA 2K75A 4F88A 1GO3E 4MTKA 3A56A 1BBUA 1DOLA 5IYDH 1TQOA 4JI6L 4B3TL 5C44H 1GUTA 3AEVA 1Y8OB 5M3MB 1FNWA 1XPRA 3VYRA 4QUFA 1SYDA 4LFAL 3EQLC 1HZCA 2Z4HA 3TREA 4RHSA 1D7QA 3SXHA 4POGA 2Y0SG 2BH8A 1JT8A 3RMHA 3CAMA 2EJGC 2BDOA 3NE5B 5EKIA 3D3RA 4NXNL 1W6KA 3CMEA 4DV0Q 2IHEA 1EZ6A 1QZHA 1E2WA 1AEXA 1ZYRD 1KTKA 3C1EA 2QA4A 1LTBD 1ASYA 1A3TA 1TS3A 3S2DB 4CKCA 4HJ7A 1O7IA 3NPPA 2YYZA 3K7UC 2NN6G 4MNOA 4CJ0B 4RWSC 4HMJA 4AYBB 4N9PA 4JI2Q 3CCUA 2RSNA 1ICFB 5BN5A 1S5DD 2VW9A 1B7YB 1H95A 4IUVA 2WAQB 3LNNA 1JC7A 1YZ6A 2Z8LA 2WIIB 3D4WA 2AQ3B 3EN2A 1IBLL 1I4QA 3FPUB 2CH4A 2QGQA 4A3FG 3LWEA 3K5MA 1SMYD 4KHPL 3OIPA 2UUCL 5FO8B 3OPOA 1JICA 2F0MA 1GOZA 1RKNA 4FF1A 1H9JA 3KBGA 1R9TH 1A63A 1OTCA 5M9OA 3M4OB 1ESFA 1BO0A 2BDNA 1VQHA 4GLVB 1TT2A 2HT1A 2JA6G 4FXKC 1YI2A 1G8ZD 1OXTA 1RD9D 1E22A 2XRSD 3OW7A 4ID6A 1H9RA 3OMGA 3OSOA 5K36G 2R7FA 3U58A 2QW7A 2R6GA 3A8IE 3R2IA 4YIJA 5M5WB 1SEBD 2RCFA 3HOXH 4B3MQ 4DR6Q 1TWGH 4Y7NB 4K5WA 4PZ7A 2HHHL 2K5HA 3DM3A 1KRTA 1MIUA 1EOTA 2ZXOA 5I4DA 2LXKA 3A8JE 3DLLA 1MGSA 3WWVA 3QOJA 1D5XC 2PQAB 1KC8C 2PQAA 1BBXC 1JMCA 3GTQH 5D14A 4JV5Q 1X3GA 4TVAB 2R92B 1EWCA 2IHFA 1G6ZA 2ZJPA 3TDQA 1U4LA 4RG1A 2IL8A 2DJGC 3L0OA 4DV5Q 4C3HB 1Q12A 4L63B 3G71A 4JI1L 1NAPA 3NWSA 1D6EC 3EVQA 4DNTB 4FXDA 5F2DA 1PH9A 4YWMA 1BCPF 2H1EA 5FLMG 4A3GB 1IYJB 2E2HH 3ZYYX 4H0LC 2OTLA 4IFDI 4R4QA 2L9HA 2IX1A 3RLOA 1EZ8A 1BNZA 2UXCL 4GOPC 5G3LD 3DMUA 3HP3A 1HR0Q 1VQIA 1DD2A 4CBVA 1L1OB 2JA8H 2HIVA 1L1OA 2WFWA 1VQPA 3K6OA 1JWMD 4A3DG 4A93B 4DV4Q 1PRTB 3CRKC 1X6OA 3JC66 2F0WA 1PV4A 1IW7C 1M1KC 2F0QA 1VQNA 1IBMQ 5LMNQ 4NPSA 2HQEA 2DUDA 1WCMG 4H7BA 2HDLA 3CXCA 4YHHL 4A3FH 2J7ZA 3BYYB 3X3MA 1CT1D 3O13A 1VQAA 4IZ8A 5CC4A 5KNCA 1V1QA 4JG2A 1RTOA 2IJ0A 4A3CG 4F7XA 3SHLA 4CGYB 4XIGS 3I4OA 3K58A 2JYOA 1EY5A 4K0KL 3SK8A 1BF4A 4MZ9A 2JA6H 4DN4M 4IFDG 3VR3A 1X9NA 1HFGA 1WFQA 2K7VA 4RA8A 3OOCA 2E2IH 1STBA 1X54A 3F1ZA 2VXWA 2A8VA 1OXSC 1HUMA 1NBWA 4LF4Q 4DR7Q 4DPGA 2ZTDA 3P7JA 1RF2D 4JW0A 3V2TA 4IO9A 1G6PA 1HNWL 4ZLTF 1JJCB 1MD2D 3OTOQ 1K0RA 3VA5A 5IWAL 1PH2A 2O5IC 3NUCA 3PUVA 1I94L 1W6JA 5JVH3 4R8NA 4P71A 2YU9B 3GTLH 4UP8A 4C3IB 4DA2A 3VR4A 2SNMA 2H5XA 3GTKH 1YNJD 1SR3A 4LFAQ 4GNXC 4IJLA 3TQYA 1A0IA 1IXRA 2F0PA 2NVQB 1PDQA 4A3BG 3Q24A 2XWBB 4IOAA 2N78A 5IYCG 2JA7G 5CV6A 5A35A 2M00A 1N9WA 2KCCA 1S5FD 3CCSA 5FLMH 3A5ZB 3PO2B 1LYLA 3S14H 1GUSA 4A3MB 3X3NA 1LTTD 3GTPB 1KXLA 1C4QA 3J81L 1U4MA 4ZKCB 4FP5D 2IW3A 1ZEQX 2JK8A 3QOLA 4OO1I 3WOEA 2MJ8A 4CJ2C 4DU9A 1LM0A 3I3CA 3GTGH 3MFYA 1K83B 2B2TA 2Z9HA 4A3DH 1EWHA 1M90C 1HA6A 1YEZA 4UY8C 2IY5B 4WJ4A 3S17H 1G2SA 1BCPB 1BUVT 5HGQA 2L4NA 1NMGA 5J22A 4JYAQ 2BCOA 3I7FA 2EQSA 1FJGL 1WCMH 2R93B 4FVMA 2EY6A 4DV6L 3VA7A 3FPPA 1VS0A 5TSSA 3MVVA 1QUQB 3MEHA 2XVSA 4G4KA 1QUQA 4OIKA 4A3CH 3HOUB 1ENFA 3IRBA 3M7NA 5C3WA 2CQOA 3M3YB 4IFDH 4NDXA 4UDUC 1K8OA 3GD7A 3G6EA 4N8FA 3FMCA 1AN8A 1BVSA 3QJYA 4B3SQ 2PPBC 3I4NG 4RAUC 4N8X1 4JI7L 4DV7L 1VQ8A 1K73C 2R7ZB 1F9RA 3LWUA 5FOBB 4RGOS 2E75C 5LL6S 1SSOA 1P8LA 3K7AB 4MTNA 5ELBA 5IP7G 3H3VH 1EYDA 4G7OC 5CBEE 2EIFA 1PH5A 4V0BA 1D5MC 1UE6A 3D6WA 3TEHB 3Q23A 3AFQA 2RF4A 4DAPA 5CV7A 2ZJRA 5JJIA 2UUBQ 3UDXA 4P74A 1PTOB 1X3EA 1LLRD 2F0GA 4YY3Q 4NB3A 4LW1A 4GN5A 5JEAG 4A3BH 3SEBA 5IYCH 2JA7H 1WYDA 2F4VL 1Y1VG 2I0QA 4PV1C 2TMPA 4UAIA 1Y1WG 2Q8RE 3U50C 3BDLA 2UXCQ 4LMQD 3UDGA 1E1OA 2I5HA 4RHRA 1A2TA 2A19A 2E2JB 4DXGA 1X32A 1S72A 4DV0L 2WB1E 3D8GA 4UP7A 1LT5D 1LV9A 3GV3A 5EAYA 1I6HB 1CSQA 3GTJH 4YCWA 3BJUA 3GTOH 1CI3M 1D1KA 1ZXTA 1NJIC 1DOMA 3K5OA 2JE6I 2JA5B 2K14A 3BVZA 4QCLA 3NBHB 5EPLA 5CYUA 4CJ1B 4JI2L 1RHPA 3ULLA 4RH6A 3A54A 3NBHA 4C56C 2B2VC 2EY5A 2KOLA 3CCRA 3A74A 2AWNA 2RVLA 2WB1G 1G51A 2L1BA 1U0LA 4EVOA 1KLUD 5A2QE 3HS0C 2BH2A 1I4GA 1JCKB 3S15B 4PMCA 3BDCA 2G9DA 3AB9A 2NVXB 5KGUA 5I2YA 3I4NH 3MXGA 2F3IA 4G57A 1I3QH 1HNWQ 1QG7A 4B3RQ 4HJAA 2A69C 5IGCA 5A2QL 5IWAQ 1Q46A 1IL8A 1QVFA 3FKIB 3W3AA 1OXXK 4KHVA 2PMZE 1YITA 1WI5A 1B3AA 1PFBA 1AFPA 3Q6SA 1XXGA 5C44B 4B3ML 4X62Q 4IPCA 5KRUA 4DR6L 4CDEC 5KIXA 1JE4A 1CSPA 1B9NA 2FJ2A 1Z6HA 4YWKA 3KFUA 2YTXA 5IE8A 1IKMA 1PH8A 2D5DA 3S16H 2Z6KA 4BBSG 1HHVA 3T16A 2K5WA 1XYIA 2Q2IA 1RIPA 2FINB 5JEAH 2ENBA 1RCVD 3T1YQ 5HURA 1NCVA 1UE1A 1C9OA 1Y1VH 2WACA 1UAPA 1Y1WH 2AUJD 1B70B 1SYGA 2E74C 3KUPA 4QQBX 2NUCA 1SE2A 3CD6A 1VQCA 1VDZA 1IKLA 5FO9B 2VB2X 4DV5L 1ILPA 2I07B 1UEBA 4LWCA 3IAYA 3BZDB 1YBYA 1N36Q 4LUVA 3TP7A 1XMOQ 2UUAQ 4A3EB 3J81i 2AUKA 2CW0C 4WFN3 3HKZE 1TU2B 2ZXPA 4Z9CB 2F0OA 1Q3LA 1K8AC 3Q0AA 2K50A 1G91A 1HR0L 1A62A 2IPKD 3T51B 2A6EC 2AKWB 1FJGQ 5AFWA 5M3FG 1XJVA 2KENA 3T4AC 1EIHA 1JR0D 4DV4L 4A4IA 3P75A 3T13A 4HIOA 3DM1A 4DNIA 3S1MB 1EY6A 2ICEC 1IBML 5LMNL 3CQZH 4C2MH 2EXDA 5E4XA 3U9SA 1I4XA 2AHOB 3HFZB 2NB0A 1QE6A 2JA9A 4DK6C 1W3SA 2L5TA 1KRSA 4ZCKA 3I91A 5M5XB 4JBMA 3JAME 1TS4A 3TSSA 4K2KA 5FO7B 2O2LD 3UE1A 2NVTH 4X65Q 5C6AA 3E3XA 1JWSD 2LSSA 1L0WA 1LTGD 5J39A 2M9VA 4DV2Q 1FD7D 3NWTA 3QG1A 5ELNA 4HTHA 4DV3Q 5I6WA 2SEBD 2Y0SE 3C46A 2B2UA 5FLXL 3JAMc 5FK9C 2RHQB 4TKOB 4LF4L 4DR7L 2K52A 4PZ8A 5E4WC 2YV5A 2PI2A 1RJTA 4X64L 4Q0FA 2QF7A 3H0GB 1F2MA 2A74C 4EGVA 5IT9E 4GZYC 3OTOL 1C8CA 4X3UA 3OW2A 2JEAI 3TZDA 2VQEL 1B8AA 2M2LA 1M8AA 3OMCA 5C4JH 3DEPA 2ZM6Q 4S3SA 3MC0B 2F4VQ 2CVRA 4BBSH 1L1OC 1ENCA 1TWFH 1Z9FA 3K5NA 4R8IA 5E3FA 1DZ1A 3J7AF 1CHQD 1KAAA 1KL9A 1PRTC 2ZJQA 1PRTF 3MXNB 5IT9c 1ET6A 3NQTA 3H6MA 3PV0A 3BG3A 3CC2A 3MXNA 5I2XA 3HOWG 4OHJA 3EIVA 4XXEA 3CCEA 1TXYA 1AH9A 4MIUA 2IX0A 3GP7A 3CCVA 1IW7D 2CFMA 2F3VA 5M3MG 1N33Q 1FVIA 2JA8G 1DJRD 4J6HA 1TWCH 1HNZQ 1FGUA 4H13C 3V05A 5M3FH 3RLNA 2AMCB 1QOHA 2VS1A 2LY7A 1EQQA 4A3FB 2K5QA 2XSCA 4HJ8A 2PZUA 4L5TA 4DR3L 1E2VA 3AQQA 1K8MA 2NWGA 3D4DA 4JYAL 1C48A 4DK1A 5LMUQ 3HOVG 1JOQA 2UXDQ 2JN4A 4IUPA 3AMUA 1JE5A 4NW2A 3TP6A 4BA1I 4TQUS 4HMIA 1VQJA 2B3GA 2DY7A 2F0LA 1TS5A 3AU7A 4XT3B 2OQ0A 4IFDJ 2ZTEA 4AYBG 3S1RB 4DF7A 2F0HA 2SNSA 5D3DA 1HUNA 4YCVA 1EYCA 1SNCA 4JBWA 3TS2A 1Q86C 5GADC 1T5XD 5C3EG 1BR9A 2CQAA 3TN2A 4B3SL 1LO5D 4JI0L 1LTLA 3I4LA 2F0TA 1YJNA 1O7YA 4K14A 4HJ5A 3GTLB 3HG9A 1O78A 5T1GA 5D3IB 1Q90A 3GTKB 2EYMA 4KLKA 2IWHA 1PH4A 2O4XA 1MSHA 5EPJA 3J80E 1YJWA 1SNMA 4KHZA 2V4DA 4LAAA 2B2TC 2JXMB 3SGIA 2HIXA 1A2UA 3HOZB 3T56B 2UUBL 1KNEA 4YY3L 2BOSA 1BCPC 3S14B 1NY4A 3K0XA 4RKLA 1PH1A 1I50H 4JBJA 3V96A 4B9WA 3ND9A 3J80c 3DHQA 3NENA 3HOWH 4LF7Q 5BR8Q 1XTDA 5CR3A 4YCUA 4F87A 1PA6A 4BY7G 1NUCA 1J8IA 2MUYA 1DYQA 4BY1G 3VYTA 5M3MH 4A3JG 1CQVA 2R92G 3NP8A 3S17B 3HKSA 3G6JB 4OXPA 2FMCA 4BS9A 1KAWA 4EQNA 2RSOA 4GN3B 1O80A 3PGZA 1WCMB 3QB3A 2CKZB 2DNCA 1S5BD 3E6ZX 4AIMA 4JI3Q 3L7ZC 4R4IA 2WP8J 1PZKD 4FF3A 3I73A 4M1UB 3RD4A 4UP9A 1VQMA 1FYCA 2LMCB 1HZ9A 3S2DH 4IQZA 3DWPA 2UXBQ 3HOVH 2ALYB 4R9WA 1D2BA 2F0IA 1ZYRC 1VQ6A 3MEFA 1SFOH 2RDFA 1XPOA 3NXWA 5JPNC 2QEJC 2F4IA 5EBCA 2SOBA 3S1QH 3GV6A 1LT6D 2FMMA 2F0SA 5M5YB 3OHXC 4A93G 3EJIA 1PMRA 4LF5Q 2K01A 1NMFA 5C5MA 4LF8Q 1KDBA 1PTOC 3CU7A 1ML0D 2X6GA 5C3EH 3STBC 1PTOF 3VDYA 1EU4A 1HZAA 4DK0A 4OIJA 3GO5A 4DXFA 5IP9G 4X64Q 4KMUC 4GS3A 2HCCA 4K6LA 1Z47A 4B3RL 2KCTA 3MXPA 4RFBA 2F52A 1ILQA 1SBBB 1SDFA 1EY4A 1QB5D 2MHVA 3LX0A 2VQEQ 1SMYC 1H9MA 1LT3D 5IGGA 1B44D 1AZPA 3AYHB 3T53B 2KECA 2WINB 4PMWA 1EFWA 4A3BB 2EYHA 4X62L 2K1BA 1EYAA 2NZ1D 5JEAJ 5CMDA 1GJXA 2MO1A 2DGYA 4B08A 2K03A 2DNEA 1SYBA 3RLFA 4XDXA 1SNOA 3NSWA 2IT1A 4XYOA 4RCNA 3T1YL 1B4OA 2A68C 5ELFA 1Q7YC 4DR5L 1TWAH 3NK9A 2AWOA 4R1JA 1N8RC 4BY7H 4JI8Q 4C3IG 4BBRB 4BY1H 3GTOB 2XNAC 1F9PA 4JK1C 4A3JH 1H9KA 1V9PA 2R92H 4XQJA 1Y8NB 5DM63 1N36L 1XMOL 2UUAL 3NTHA 4DV1Q 1A6XA 2KHSA 3K0YA 2H4OA 4QJFA 3Q8DA 4IPHA 1VQDA 4DR3Q 2RDGA 2EY2A 4KY7A 2XN9C 4GKJL 4K2LA 2B2WA 1FR3A 2ZXRA 4UPAA 1VQ9A 1YHAA 5C4ZA 5C5LA 4HR7B 2PYKA 1V1OA 3T1HQ 4HJ9A 3VYUA 4CHTB 1EIYB 1I4RA 4TRDA 4BXXG 4ME5A 1K28A 3NELA 2LS01 1OXUA 1S5ED 2BA0A 3ICEA 1N32L 2F1MA 3LGJA 3I4NB 2F0KA 5C4HA 2A69D 4A93H 3SE0A 1I3QB 1F2LA 2EPBA 5DAUA 5G3LF 4R4OA 2C35B 4RGMA 5I6YA 1O7LA 3F2DA 2HD3A 2NVYB 1EQRA 2Z6KC 1ET9A 1FNVA 5E1FA 4JI0Q 3S9WA 4X65L 4PZ6A 3W1BA 2B63B 4OO1G 1S4ZA 3E5SA 5IP9H 4JOIA 1RL2A 4DV2L 1CQFA 3VR6A 4DFAA 5GAHC 5FKAC 1SNQA 4DV3L 1SJED 2CHBD 5ELCA 2K5VA 3F8TA 3RN2A 2OF1A 3CRLC 3ULPA 5IYBG 5EQ0A 5CBAE 1VQ7A 1EY0A 4KKTA 2OTJA 1A15A 3TBIB 3P20A 3CC7A 3RZDH 1EYGA 3OWFA 1VCIA 4O2DA 4EQPA 1Y1WB 2PW5A 1HFNA 3W1GA 2R7ZG 1B1ZA 3RR5A 1JOOA 4H44C 2ZM6L 3J7ZC 1P16A 1IBKL 3PO3B 3I70A 3L9AX 2N55A 3VYSA 1HQRD 2YTVA 3S1NH 3BS1A 3A5UA 2RA4A 1X3FA 5C4XB 1BOSA 2F0UA 4LFCQ 3HOYG 3KLSA 2F0VA 5GQOA 1TR5A 3KLRA 2YU9H 2A6ED 4RKBA 4C3IH 1PVOA 4DUZL 1HA5A 4LF9Q 1ONLA 1EIGA 5H1SE 4KKUA 1JQYD 2B29A 2DY8A 1B50A 2IX3A 3E0JA 3KLWA 2QKIC 4O0AA 1IL2A 1LACA 3PIO3 2PNRC 1K8GA 3BVGA 4JI4Q 1HRJA 5EKLA 1N33L 3KJPA 2NYZD 4R4CA 4RGNA 2R61A 5I9OA 1SYFA 4FYDA 4DR2L 1K9MC 1HNZL 3I4MB 1CK1A 4C2MB 2WB1B 4OL7A 3NBIA 2B2UC 3M7GA 2K28A 1ESRA 3CW2C 4QUCA 4BXXH 4I65A 2I5MX 4KK7A 5J1ZA 1LTAD 3MHBA 2PW7A 4QIWE 2A5HA 3G48A 2XWJB 3H91A 2RKSA 5LMUL 2UXDL 4DKAC 1Q1EA 3VR2A 1I5FA 4EX5A 3K57A 2BE5C 5LHY1 4K8IA 2X69A 4JCVE 3FEWX 2JA5G 3NTKA 4J15A 1CKMA 1WTPA 1SRUA 2LKVA 1FL0A 3U4ZA 4OO1H 2JSOA 2KVMA 3SDZA 1K0SA 2VB3X 5NUCA 3S24A 4C3JG 1CUKA 3M4PA 1STAA 1NNXA 5ELOA 2GA4B 1SMXA 5KYLA 1PZJD 1A8VA 3H09A 1Q81C 3RZOH 4HAEA 5IYBH 1O7ZA 2C5CA 5C4JB 2JJQA 4A3KG 4BBSB 1TWFB 1Q8IA 3K5LA 4NKLA 4K8JA 3RUZA 1SE8A 2RDHA 1AE3A 1E0BA 5I9PA 1CZGA 2F0JA 1K3RA 1WTHA 2R7ZH 3CP0A 2PMZB 3UDIA 1VQOA 3MA2B 1S3OA 4KJNA 4HCEA 3K7AH 4P72A 4DR5Q 2DJFC 1QVGA 1EQVA 1NR4A 1GUOA 3DEOA 4JI5L 3K59A 1VF5C 1STYA 3E9HA 1STHA 5CV8A 3HOYH 4ZQ3A 1ICWA 1UUPA 1U9RA 3ZJYC 1UEAB 1NR2A 3E0EA 3K81C 1MKHA 1KLGD 4ZK9B 1TWHH 1E1TA 1UWVA 2UU9L 1NSNS 3GTMH 1TWCB 5CV4A 4LF7L 5BR8L 4FDBA 1PTOH 1HXYD 1Y8PB 4IUQA 3KBXA 4OX9Q 5IODA 1DCZA 2HCIA 2HQLA 1HZBA 1FGBD 5KNDA 2RBMA 4IJHA 1HTLD 3M9BA 2CCZA 4KY6A 4GKJQ 3TP5A 1WD0A 3M4QA 3R2TA 3QIAA 4A3IG 5GAGC 1EY7A 2V1CC 3CKIB 1JJ2A 4O42A 3S2HH 3OWEB 2E2JH 2XRQD 2PZWA 4HSVA 3HKZB 4P73A 1GXDC 1KDCA 4L6TB 4JI3L 1N32Q 1XNQL 1R9TB 3IFDA 5C3XA 3OYYA 3BYTB 4H02A 1I6HH 4LUZA 3M85A 3I55A 2UXBL 2XIWA 1QZGA 1A3UA 3MFGA 2ATWA 1QNKA 2A6HC 2KEEA 1V43A 5IGDA 1B3QA 1AE2A 4MN3A 1JWUD 4FXGC 1HH2P 2JA5H 4ZRZA 2RQXA 3HOXB 2CH4W 1HPCA 3M4YA 1TWGB 4LF5L 5T1IA 1LTID 4LF8L 2KCMA 4C3JH 4BA2I 2EJFC 3JAML 3CPWA 4DR1L 2PI2E 3DXJC 1BKBA 4IUUA 1YNXA 4KV6A 4ODGA 4PQXA 5ISRA 2QDBA 1CKNB 4RGTA 1VMCA 2N88A 1A3VA 1I4PA 2X6LA 1CKNA 3GTQB 3ITPA 3KK7A 2O5JC 3QWNA 1CTMA 3PIP3 4A3KH 2WKDA 3S15H 2OT2A 2ASBA 2NVXH 4CDDC 4OEMB 1SJHD 1BCPD 1IBKQ 2Q8TA 2HDMA 2Y0SB 4HCSA 1TS2A 2VUMG 1X3QA 1XNRQ 1XPUA 1PYSB 1HNXQ 1I50B 2NN6I 3W5OA 4L8JA 4DR4Q 2KHJA 3F2UA 3FKIH 3HOWB 2E2HB 2B39A 1RDPD 5IT9L 2G9HD 3WOFA 1F9QA 4CKEA 5E7NA 4XTCS 4DUZQ 2K33A 2VZAA 1DGSA 2QEXA 4L5QA 3H0GG 5HGTA 5ELDA 2JA8B 2EXZA 3SR1A 3PMFA 3A7AB 4KD4A 1MJEA 1G2TA 5IGEA 4JI8L 3QR8A 4DR2Q 1CHPD 1QJOA 1X65A 4AYBE 1PH6A 4YWLA 1JB7A 1SROA 5AJ3Q 4WRDA 4C1NK 4A3IH 4DV1L 1V8QA 4KY5A 4ZUJA 2WAQE 3HOVB 3MTSA 3H3VC 1TVXA 5JJLA 1SFOB 1B2TA 4KN4C 4X3KA 3S1QB 1GHKA 4DAVA 4A3EH 3FVQA 2D0OA 2VQFL 1SNDA 3G7LA 4XT1B 2OWOA 1PTOD 2JA6B 2D2CC 2SDFA 3T1HL 3DWQA 1PFMA 3STBD 2JEBI 5J3BA 5L37A 2E2IB 4I7AA 2B2YA 1GUNA 3ER0A 5C3EB 3PUYA 2I46A 1XMQQ 1LTSD 1PXUA 3KF8B 5K5PA 1YNNC 2K04A 4IUTA 3KF8A 1G291 3PUZA 5JAVA 4OELB 4Q5VA 2PO4A 2WAQG 4P75A 1STNA 4E6IA 1BQQT 1TIID 4LUOA 3S1MH 4I7ZC 2F3WA 1DONA 5KEEA 2KEDA 2B8GA 4LFBL 1SYCA 1JB3A 5M5XH 4KKSA 4LF6Q 2QILA 3NTIA 4QGUA 5COYA 2EJMA 5CGKA 2RCNA 4GKKL 4J8QA 3AFPA 4OONA 1K3BC 4QB4A 1EOVA 1VQBA 4ALPA 2F0FA 2A68D 2OEOA 3J7YW 2VUMH 4IUNA 1GUWA 4JI5Q 3BVMA 2FXQA 2CWPA 5JJKA 4APVA 1VQEA 3P1HA 1TWAB 4OWTB 4LJZC 4BY7B 2B2WC 2JP1A 3IL8A 3J80L 4BY1B 1IYUA 2UU9Q 5HY6A 3H0GH 4LNQA 4A3JB 1XX8A 1OXVA 1VQGA 1D8LA 2VL6A 3GTGB 1STGA 1QCBD 1J5EQ 4NXMQ 4L5SA 4LFCL 3PF5A 4A3DB 2OXPA 2HUGA 2ID0A 2MNAA 1S40A 1KQSA 2A73B 1EL0A 4LF9L 3FRPB 3HOZG 1JJGA 3FDTA 2GVAA 3BU2A 1TKWB 4C1NI 4C3HG 3TP8A 3FP9A 1CFMA 2KUMA 2TSSA 4OGQC 2Q2UA 2K5NA 1VF7A 5DM73 2EDGA 1HJPA 4JI4L 4HIKA 1PFSA 2KCNA 3D0FA 4R4TA 2N3SA 4A3GG 2N49A 2NZOA 1XNQQ 1KABA 4JOIC 5C0XJ 1SN8A 2D9UA 2FHTA 3HEJA 3I2ZA 1LTRD 4WJWA 1C0AA 1U4PA 2NN6H 4CKBA 1MHWC 3L3OC 1WTOA 2Z1CA 1PH7A 3C3LA 5IIFA 2E5LL 3H3VI 3IKJA 1QNUA 3CCQA 1KNAA 1Z7TA 3I72A 1LUZA 2EVBA 1EUJA 1IZ6A 5CV5A 1SAPA 4OWWB 1EQTA 3R93A 4L5RC 1YIJA 1AW7A 1JOKA 2KHIA 5IY0A 4DUYQ 5JJZA 2QCPX 4PG3A 4UHVA 1WTQA 4DR1Q 1MJCA 4DNRB 4WJ3M 3J81j 1JORA 2EZVA 4K5XA 2KQ3A 3MWYW 5EBDA 1HCZA 3CHBD 1J6QA 3JAMi 1E2ZA 2EE1A 4EQOA 3CC4A 4JBKA 1U5KA 1MI2A 1EY9A 4P2CB 1GHJA 3IFTA 2GVBA 1KIXA 2EYPA 1N34L 1STEA 3RZDB 3M4OH 2Q2HA 3KOJA 2ICIA 5K36H 2BA1A 1NTGA 2NTSA 2PNHA 3S1RH 3L2PA 1YVCA 2VY3A 2JA7B 4V190 5C0XI 3S1NB 1PZID 4HIDA 4JI6Q 5M5WH 4B3TQ 2F0DA 4G7HC 3WDNA 4OWXB 4Y7NH 2P5ZX 3I56A 3Q22A 1EEID 1PHJA 2EYFA 5D65A 4ZYSA 2EY1A 3EFXD 2LXJA 1XTCD 3SK4A 4U673 2L12A 3K8AA 4XQQA 2WV6D 4IURA 4QMGA 1CA6A 1ZKOA 3MAQA 3DWAA 4JC0A 1W2BA 3GTJB 4NXNQ 3J81E 1WOCA 2G5DA 1AZQA 3J7A5 1VMPA 2K5DA 1T9HA 3HOZH 2WKCA 2K4KA 2JQOA 1IHZA 4C3HH 4OX9L 1HTPA 5KYIA 4RMFA 4NMZA 2OCEA 4NP5A 3ULJA 2YTYA 2GN5A 2J4XA 4A3GH 3PO2G 2MPMA 2VQFQ 3J81c 2D0PA 4A3MG 2E2DC 1EEFD 4ZKBB 2E76C 5FJ8G 5C0XG 3CCJA 1F9SA 1BDOA 2BE5D 3QO2A 1PH3A 4BBRG 2XTIA 2R7DA 1QILA 1PLFA 3PUWA 3PF4A 1U4RA 1IBLQ 3KYHC 2F0NA 3OIQA 4X66L 3D31A 4ME3A 1MBYA 4FF4A 2C9OA 1CZWA 3A0JA 4DAMA 3HRZC 2E8GA 3U4VA 1CA5A 4KHPQ 5GROA 2MQHA 2VNUD 2UUCQ 3N6RA 3NEMA 2MGSA 1SE3A 3PIOA 3HGBA 3D4RA 1X56A 1I6VC 4XYQA 2KBNA 3TZUA 3A55A 4GOPB 2L55A 1E24A 2D62A 1WTVA 2R93G 1WTWA 3N52A 4GOPA 4LFBQ 4Y52H 3A8KE 3RZOB 1EIFA 2J0TD 1ENAA 3UE0A 3MZ5A 4AQYL 2DN8A 5IGBA 2KA7A 4GKKQ 3KLSX 4O1NA 3HOUG 4KI0A 2XGTA 3S16B 1DM0B 5M5YH 3C1FA 4XQNA 2EYOA 4POFA 2EOTA 1WJJA 2N8NA 2HHHQ 1T5EA 1KD1C 1Y1VB 4N9TA 3RN5A 3KJOA 4DK3C 3BZCA 4HN7A 2B63G 5KNBA 3RNUA 1VQLA 3B6YA 1H9SB 1WVLA 5JVG3 3HOYB 1LABA 1H9SA 2MO0A 4ZAIA 2CW0D 1XNRL 2QDLA 1HNXL 2NZHA 1TWHB 1VQ5A 2AQ1B 4DR4L 3C2PA 3SK6A 3J80i 4M8AA 1WD1A 1YHBA 3GTMB 1TY0A 1BBWA 2K32A 4LK1C 1ASZA 1VQKA 3KF6B 1Y14B 2F0EA 4JI1Q 3URYA 3KF6A 2Z0SA 1RODA 4PMBA 1KHIA 3TRZA 4FNFA 3TMEA 3TS0A 3BDOA 3CF5A 4JVZA 4ULLA 4A3LG 4ABNA 1OO9B 2NVQH 1YNJC 3R3OA 1D5ZC 3F2CA 4HSPA 4FO2A 5DNFA 2MP1A 4G7ZC 3PO3G 1MSGA 3UDFA 1C7YA 3S2HB 5LL6X 4FF2A 1SYEA 2AQ2B 1YHQA 4KN7C 1VQ4A 3PO2H 5AJ3L 5C4XG 3CQZB 4ILWA 3VR5A 1R4PB 4A3MH 4IPGA 4GNXB 1WTRA 2L0CA 2A6HD 5FJ8H 5C0XH 3CCLA 3NQIA 2E5LQ 3GTPH 4GNXA 1BXTA 4BBRH 4TSSA 3PSIA 2NBFA 4BWGB 4HEDA 4IOCA 4QL5A 1S5CD 3PCOB 5ELEA 2NVTB 4K6DA 1Q82C 5BN3A 1K83H 4YHHQ 1HR0W 4PNYA 1EFID 1RTNA 1D1IA 4EQ5A 1Q1BA 2NTTA 4CDFC 1GKHA 4C3JB 1LT4D 3J7AV 5CORA 4GN4B 4CDCC 3I4MG 1PFNA 3ERQA 2R93H 4K0KQ 3A7LA 1XMQL 3SVMA 2EYJA 4X3TA 1UNSA 1QWYA 1HQMC 4QF4A 4QIWB 5LMNW 1N34Q 4A3KB 2RHSB 3K80C 1QVCA 1F2YA 1B9MA 3GQBA 3KDFB 4B9XA 2Z6BA 3HOUH 4HIMA 1AP0A 2Z4IA 3KDFA 3U9OA 4DAYB 2ES2A 4RCOA 1Q8KA 1PYBA 4DAYA 4A76A 1PRTD 3H15A 1SXTA 3M3YH 1PYWD 4KTAA 3D6CA 2ZTCA 3EBEA 2NVYH 4LF6L 1EWIA 1SNPA 5IP7H 1I94Q 1VQFA 1EY8A 2B63H 3R8BA 1I4HA 4KD3A 3HZXA 1KDAA 3ONAB 1X3PA 5DLQE 2PQEA 4X3SA 3FKIG 3ERSX 1EU3A 3EA6A 1B53A 4IN3A 4J1MA 5IYDG 3CPFA 3I8ZA 1UE7A 3NHHA 5JOBA 1J9OA 5C44G 5IGFA 1GM5A 2MFIA 2Q2TA 3G4SA 1SLJA 1F77A 5EPKA 3H94A 3PIPA 4JV5L 1L2FA 1WTXA 2FFKB 4A3LH 4K5VA 5M3FB 4A3IB 1J5EL 4NXML 1X55A 1GUGA 2B2YC 3EROA 3PO3H 5JPMC 4U68A 4IPDA 2K6AA 1CM9A 3I90A 2KJXA 4GLXA 2LFNA 5C4XH 1E7ZA 3BZKA 5DEHA 1V1PB 1F2ZA 1M4VA 2K05A 1V1PA 1R4QB 2B8FA 5EKKA 4X66Q 4A3EG 3PUXA 4GLAC 1YNND 5EGTA 2EYLA 3GDEA 2I5LX 4DV6Q
chains in the Genus database with same CATH topology
1SE4A 4IALA 4F8MA 2ZT9C 5IOCA 1Y69U 2F03A 1DXMA 5BN4A 2PCFB 4DGZA 4MHEA 3ND8A 4WORA 5FLXE 3DUZA 3MXUA 1II3A 2Q8IB 3UI2A 2L11A 1L0YB 3W2DA 1TY2A 4KJOA 2VUMB 1FNUA 2PZTA 1XWEA 5EJWA 4ZUIA 2B2VA 1IYVA 3SK5A 2R3ZA 5CV9A 1L0XB 1DOKA 4F88A 3A56A 1DOLA 1TQOA 1GUTA 1Y8OB 5M3MB 1FNWA 3VYRA 4QUFA 1SYDA 3EQLC 2Z4HA 4RHSA 3SXHA 3RMHA 2EJGC 2BDOA 3NE5B 5EKIA 3D3RA 1W6KA 1EZ6A 1E2WA 1AEXA 1ZYRD 1KTKA 3C1EA 1LTBD 1A3TA 1TS3A 3S2DB 4CKCA 3NPPA 2YYZA 2NN6G 4CJ0B 4RWSC 4HMJA 4AYBB 4N9PA 2RSNA 5BN5A 1S5DD 4IUVA 2WAQB 3LNNA 1JC7A 2Z8LA 2WIIB 3D4WA 2AQ3B 1I4QA 3FPUB 3LWEA 3K5MA 1SMYD 3OIPA 5FO8B 3OPOA 1JICA 2F0MA 1GOZA 1RKNA 4FF1A 1H9JA 3KBGA 3M4OB 5M9OA 1ESFA 1BO0A 2BDNA 1TT2A 4FXKC 1G8ZD 1OXTA 1RD9D 2XRSD 3OW7A 4ID6A 1H9RA 3OMGA 3OSOA 5K36G 2R6GA 3A8IE 3R2IA 4YIJA 5M5WB 1SEBD 4Y7NB 4K5WA 1EOTA 2ZXOA 5I4DA 3A8JE 1MGSA 3QOJA 1D5XC 1BBXC 5D14A 2R92B 1EWCA 1G6ZA 3TDQA 1U4LA 2IL8A 4C3HB 1Q12A 4L63B 1NAPA 3NWSA 1D6EC 3EVQA 4DNTB 4FXDA 5F2DA 1BCPF 2H1EA 4A3GB 3ZYYX 4H0LC 4IFDI 2L9HA 2IX1A 1EZ8A 1BNZA 5G3LD 3DMUA 3HP3A 1DD2A 4CBVA 3K6OA 1JWMD 4A93B 1PRTB 3CRKC 2F0WA 1IW7C 2F0QA 2HQEA 4H7BA 2HDLA 2J7ZA 3BYYB 3X3MA 1CT1D 3O13A 4IZ8A 5CC4A 5KNCA 1RTOA 2IJ0A 4F7XA 3SHLA 4CGYB 4XIGS 3K58A 2JYOA 1EY5A 3SK8A 1BF4A 4DN4M 4IFDG 3VR3A 1HFGA 2K7VA 4RA8A 3OOCA 1STBA 2VXWA 1OXSC 1HUMA 3P7JA 1RF2D 3V2TA 4ZLTF 1MD2D 3VA5A 2O5IC 3NUCA 3PUVA 1W6JA 5JVH3 4R8NA 2YU9B 4C3IB 4DA2A 3VR4A 2SNMA 1YNJD 2F0PA 2NVQB 1PDQA 3Q24A 2XWBB 5CV6A 5A35A 2M00A 2KCCA 1S5FD 3PO2B 1GUSA 4A3MB 3X3NA 1LTTD 3GTPB 1C4QA 3J81L 1U4MA 4ZKCB 4FP5D 2IW3A 1ZEQX 3QOLA 4OO1I 3WOEA 2MJ8A 4CJ2C 4DU9A 3I3CA 3MFYA 1K83B 2B2TA 1EWHA 1HA6A 1G2SA 1BCPB 1BUVT 2L4NA 5J22A 2BCOA 2R93B 4FVMA 2EY6A 3VA7A 3FPPA 5TSSA 3MVVA 3MEHA 2XVSA 4G4KA 4OIKA 3HOUB 1ENFA 3M7NA 5C3WA 3M3YB 4IFDH 4NDXA 4UDUC 1K8OA 3GD7A 3FMCA 1AN8A 3QJYA 2PPBC 4RAUC 2R7ZB 1F9RA 3LWUA 5FOBB 4RGOS 2E75C 5LL6S 1SSOA 3K7AB 5ELBA 1EYDA 4G7OC 5CBEE 4V0BA 1D5MC 3D6WA 3Q23A 4DAPA 5CV7A 1PTOB 1LLRD 2F0GA 5JEAG 3SEBA 4PV1C 2TMPA 4UAIA 2Q8RE 3BDLA 4LMQD 4RHRA 1A2TA 2E2JB 4DXGA 1X32A 3D8GA 1LT5D 1LV9A 3GV3A 1I6HB 1CI3M 1D1KA 1ZXTA 1DOMA 3K5OA 2JE6I 2JA5B 3BVZA 4QCLA 5EPLA 5CYUA 4CJ1B 1RHPA 4RH6A 3A54A 3NBHA 4C56C 2B2VC 2EY5A 2KOLA 2AWNA 2RVLA 2L1BA 4EVOA 1KLUD 5A2QE 3HS0C 1I4GA 1JCKB 3S15B 4PMCA 3BDCA 2G9DA 3AB9A 2NVXB 5KGUA 5I2YA 3MXGA 4G57A 1QG7A 2A69C 5IGCA 5A2QL 1IL8A 3FKIB 3W3AA 1OXXK 4KHVA 1B3AA 1PFBA 1AFPA 3Q6SA 1XXGA 5C44B 5KRUA 5KIXA 1JE4A 1B9NA 2FJ2A 1Z6HA 1IKMA 2D5DA 1HHVA 3T16A 2K5WA 1XYIA 5JEAH 2FINB 2ENBA 1RCVD 5HURA 1NCVA 2WACA 1UAPA 2AUJD 1SYGA 2E74C 3KUPA 2NUCA 1SE2A 1VDZA 1IKLA 5FO9B 2VB2X 1ILPA 2I07B 3IAYA 3BZDB 3TP7A 4A3EB 2AUKA 2CW0C 4WFN3 1TU2B 2ZXPA 4Z9CB 2F0OA 1Q3LA 3Q0AA 1G91A 2IPKD 3T51B 2A6EC 5AFWA 3T4AC 1EIHA 1JR0D 3P75A 3T13A 3DM1A 3S1MB 1EY6A 2ICEC 5E4XA 3U9SA 1I4XA 2NB0A 1QE6A 2L5TA 3I91A 5M5XB 3JAME 1TS4A 3TSSA 4K2KA 5FO7B 2O2LD 5C6AA 1JWSD 1LTGD 5J39A 2M9VA 1FD7D 3NWTA 3QG1A 4HTHA 5I6WA 2SEBD 3C46A 2B2UA 5FLXL 5FK9C 4TKOB 5E4WC 1RJTA 4Q0FA 2QF7A 3H0GB 1F2MA 2A74C 4EGVA 5IT9E 4GZYC 1C8CA 4X3UA 2JEAI 3TZDA 2M2LA 1M8AA 3OMCA 3DEPA 4S3SA 3MC0B 2CVRA 1ENCA 3K5NA 4R8IA 5E3FA 1DZ1A 3J7AF 1CHQD 1KAAA 1PRTC 1PRTF 1ET6A 3NQTA 3H6MA 3PV0A 3BG3A 3MXNA 5I2XA 4OHJA 4XXEA 4MIUA 2IX0A 3GP7A 1IW7D 2F3VA 1DJRD 4J6HA 4H13C 3V05A 1QOHA 2LY7A 4A3FB 2K5QA 2XSCA 2PZUA 1E2VA 1K8MA 2NWGA 3D4DA 1C48A 4DK1A 1JOQA 4IUPA 3AMUA 4NW2A 3TP6A 4BA1I 4TQUS 4HMIA 2DY7A 2F0LA 1TS5A 3AU7A 4XT3B 4IFDJ 3S1RB 4DF7A 2F0HA 2SNSA 5D3DA 1HUNA 1EYCA 1SNCA 4JBWA 1T5XD 1BR9A 2CQAA 3TN2A 1LO5D 3I4LA 2F0TA 1O7YA 4K14A 3GTLB 3HG9A 1O78A 5T1GA 5D3IB 1Q90A 3GTKB 2EYMA 2IWHA 2O4XA 1MSHA 5EPJA 3J80E 1SNMA 4KHZA 2V4DA 4LAAA 2B2TC 2JXMB 1A2UA 3HOZB 3T56B 1KNEA 2BOSA 1BCPC 3S14B 4RKLA 3V96A 4B9WA 3ND9A 3DHQA 5CR3A 4F87A 1NUCA 1J8IA 2MUYA 1DYQA 3VYTA 1CQVA 3NP8A 3S17B 3G6JB 2FMCA 4BS9A 4EQNA 2RSOA 1O80A 1WCMB 3QB3A 2DNCA 1S5BD 3E6ZX 3L7ZC 2WP8J 1PZKD 4FF3A 3I73A 4M1UB 3RD4A 1FYCA 2LMCB 4IQZA 3DWPA 4R9WA 1D2BA 2F0IA 1ZYRC 2RDFA 3NXWA 5JPNC 2QEJC 2F4IA 5EBCA 2SOBA 3GV6A 1LT6D 2FMMA 2F0SA 5M5YB 3OHXC 3EJIA 1PMRA 2K01A 5C5MA 1KDBA 1PTOC 3CU7A 1ML0D 2X6GA 1PTOF 1EU4A 4DK0A 4OIJA 3GO5A 4DXFA 4KMUC 2HCCA 4K6LA 1Z47A 3MXPA 4RFBA 1ILQA 1SBBB 1SDFA 1EY4A 1QB5D 2MHVA 3LX0A 1SMYC 1H9MA 1LT3D 5IGGA 1B44D 1AZPA 3T53B 2KECA 2WINB 4PMWA 4A3BB 2EYHA 2K1BA 1EYAA 2NZ1D 5CMDA 5JEAJ 1GJXA 4B08A 2K03A 2DNEA 1SYBA 3RLFA 4XDXA 1SNOA 3NSWA 2IT1A 4XYOA 4RCNA 1B4OA 2A68C 5ELFA 3NK9A 2AWOA 4C3IG 4BBRB 3GTOB 2XNAC 1F9PA 4JK1C 1H9KA 4XQJA 1Y8NB 5DM63 3NTHA 1A6XA 2KHSA 3K0YA 2H4OA 2RDGA 2EY2A 4KY7A 2XN9C 4K2LA 2B2WA 1FR3A 2ZXRA 5C4ZA 5C5LA 4HR7B 2PYKA 1V1OA 3VYUA 4CHTB 1I4RA 4TRDA 4ME5A 2LS01 1OXUA 1S5ED 2BA0A 2F1MA 3I4NB 2F0KA 5C4HA 2A69D 3SE0A 1I3QB 1F2LA 2EPBA 5DAUA 5G3LF 4RGMA 5I6YA 1O7LA 2NVYB 1ET9A 1FNVA 5E1FA 3S9WA 2B63B 4OO1G 1S4ZA 3E5SA 1CQFA 3VR6A 4DFAA 5FKAC 1SNQA 1SJED 2CHBD 5ELCA 2OF1A 3CRLC 5EQ0A 5CBAE 1EY0A 4KKTA 1A15A 3TBIB 3P20A 3OWFA 1VCIA 4EQPA 1Y1WB 2PW5A 1HFNA 1B1ZA 1JOOA 4H44C 3PO3B 3I70A 3L9AX 2N55A 3VYSA 1HQRD 3BS1A 2RA4A 5C4XB 1BOSA 2F0UA 3KLSA 2F0VA 1TR5A 3KLRA 2A6ED 4RKBA 1HA5A 1ONLA 1EIGA 4KKUA 1JQYD 2DY8A 1B50A 2IX3A 3E0JA 2QKIC 1LACA 3PIO3 2PNRC 3BVGA 1HRJA 5EKLA 2NYZD 4RGNA 2R61A 5I9OA 1SYFA 4FYDA 3I4MB 1CK1A 4C2MB 2WB1B 4OL7A 3NBIA 2B2UC 3M7GA 2K28A 1ESRA 4QUCA 4I65A 4KK7A 5J1ZA 1LTAD 3MHBA 2PW7A 2A5HA 2XWJB 3H91A 2RKSA 1Q1EA 3VR2A 3K57A 2BE5C 5LHY1 4K8IA 2X69A 3FEWX 3NTKA 1WTPA 2LKVA 4OO1H 2JSOA 2KVMA 3SDZA 2VB3X 5NUCA 4C3JG 1STAA 2GA4B 5KYLA 1PZJD 3H09A 4HAEA 1O7ZA 2C5CA 5C4JB 4BBSB 1TWFB 1Q8IA 3K5LA 4NKLA 4K8JA 3RUZA 2RDHA 1E0BA 5I9PA 1CZGA 2F0JA 2PMZB 3MA2B 4KJNA 4HCEA 1EQVA 1NR4A 1GUOA 3DEOA 3K59A 1VF5C 1STYA 1STHA 5CV8A 4ZQ3A 1ICWA 1UUPA 1U9RA 1UEAB 1NR2A 4ZK9B 1KLGD 1NSNS 1TWCB 5CV4A 1PTOH 1HXYD 1Y8PB 4IUQA 3KBXA 5IODA 1DCZA 2HCIA 1FGBD 5KNDA 2RBMA 1HTLD 4KY6A 3TP5A 1WD0A 3R2TA 3QIAA 1EY7A 3CKIB 4O42A 3OWEB 2XRQD 2PZWA 4HSVA 3HKZB 1GXDC 1KDCA 4L6TB 1R9TB 3IFDA 5C3XA 3BYTB 3M85A 2XIWA 1A3UA 3MFGA 1QNKA 2A6HC 2KEEA 1V43A 5IGDA 4MN3A 1JWUD 4FXGC 4ZRZA 2RQXA 3HOXB 1HPCA 3M4YA 1TWGB 5T1IA 1LTID 4BA2I 2EJFC 3JAML 3DXJC 4IUUA 4KV6A 4ODGA 4PQXA 5ISRA 2QDBA 4RGTA 1VMCA 2N88A 1A3VA 1I4PA 2X6LA 3GTQB 3ITPA 3KK7A 2O5JC 1CTMA 3QWNA 3PIP3 2WKDA 2OT2A 1SJHD 1BCPD 2Q8TA 2HDMA 2Y0SB 4HCSA 1TS2A 1X3QA 1I50B 2NN6I 4L8JA 3F2UA 3HOWB 2E2HB 2B39A 1RDPD 5IT9L 2G9HD 3WOFA 1F9QA 4CKEA 4XTCS 2K33A 5HGTA 5ELDA 2JA8B 2EXZA 3SR1A 3PMFA 3A7AB 4KD4A 1G2TA 5IGEA 1CHPD 1QJOA 4WRDA 4C1NK 1V8QA 4KY5A 4ZUJA 3HOVB 3MTSA 3H3VC 1TVXA 1SFOB 1B2TA 4KN4C 4X3KA 3S1QB 1GHKA 4DAVA 3FVQA 1SNDA 3G7LA 4XT1B 1PTOD 2JA6B 2D2CC 2SDFA 3DWQA 1PFMA 2JEBI 2E2IB 2B2YA 1GUNA 5C3EB 3PUYA 2I46A 1LTSD 1PXUA 5K5PA 1YNNC 2K04A 4IUTA 3KF8A 1G291 3PUZA 5JAVA 4Q5VA 2PO4A 1STNA 4E6IA 1BQQT 1TIID 4I7ZC 2F3WA 1DONA 5KEEA 2KEDA 2B8GA 1SYCA 1JB3A 4KKSA 2QILA 3NTIA 5COYA 2EJMA 5CGKA 4J8QA 4QB4A 2F0FA 2A68D 2OEOA 3J7YW 4IUNA 1GUWA 3BVMA 3P1HA 1TWAB 4LJZC 4BY7B 2B2WC 2JP1A 3IL8A 3J80L 4BY1B 1IYUA 4A3JB 1XX8A 1OXVA 3GTGB 1STGA 1QCBD 4A3DB 2OXPA 2HUGA 2ID0A 2A73B 1EL0A 3FRPB 3FDTA 1TKWB 4C1NI 4C3HG 3TP8A 1CFMA 2KUMA 2TSSA 4OGQC 1VF7A 5DM73 2EDGA 2KCNA 1KABA 5C0XJ 2D9UA 2FHTA 3HEJA 1LTRD 4WJWA 1U4PA 2NN6H 4CKBA 3L3OC 1WTOA 2Z1CA 3C3LA 5IIFA 3IKJA 1QNUA 1KNAA 1Z7TA 3I72A 2EVBA 5CV5A 1SAPA 1EQTA 3R93A 1AW7A 1JOKA 5JJZA 2QCPX 1WTQA 4DNRB 1JORA 2EZVA 4K5XA 2KQ3A 3MWYW 5EBDA 1HCZA 3CHBD 1E2ZA 2EE1A 4EQOA 1MI2A 1EY9A 4P2CB 1GHJA 3IFTA 2EYPA 1STEA 3RZDB 2ICIA 5K36H 2BA1A 2NTSA 2JA7B 4V190 5C0XI 3S1NB 1PZID 2F0DA 4G7HC 3WDNA 3Q22A 1EEID 2EYFA 5D65A 4ZYSA 2EY1A 3EFXD 1XTCD 3SK4A 4U673 2L12A 4XQQA 2WV6D 4IURA 4QMGA 1CA6A 1ZKOA 3MAQA 3DWAA 3GTJB 3J81E 1AZQA 1VMPA 2K5DA 2WKCA 1IHZA 1HTPA 5KYIA 4NMZA 4NP5A 2J4XA 2MPMA 2E2DC 1EEFD 4ZKBB 2E76C 5C0XG 1F9SA 1BDOA 2BE5D 3QO2A 1QILA 1PLFA 3PUWA 1U4RA 2F0NA 3OIQA 3D31A 1MBYA 4FF4A 2C9OA 1CZWA 3HRZC 1CA5A 2VNUD 3N6RA 2MGSA 1SE3A 3HGBA 3D4RA 1I6VC 4XYQA 3TZUA 3A55A 2L55A 2D62A 1WTVA 1WTWA 3N52A 3A8KE 3RZOB 2J0TD 1ENAA 3MZ5A 2DN8A 5IGBA 2KA7A 3KLSX 4O1NA 4KI0A 3S16B 1DM0B 3C1FA 4XQNA 2EYOA 2EOTA 1T5EA 1Y1VB 4N9TA 4HN7A 5KNBA 1H9SB 1WVLA 5JVG3 3HOYB 1LABA 1H9SA 4ZAIA 2CW0D 1TWHB 2AQ1B 3C2PA 3SK6A 4M8AA 1WD1A 3GTMB 1TY0A 2K32A 4LK1C 2F0EA 3URYA 1RODA 4PMBA 4FNFA 3TMEA 3BDOA 4ULLA 4ABNA 1OO9B 1YNJC 3R3OA 1D5ZC 4HSPA 4FO2A 5DNFA 2MP1A 4G7ZC 1MSGA 3S2HB 5LL6X 4FF2A 1SYEA 2AQ2B 4KN7C 3CQZB 4ILWA 3VR5A 1R4PB 1WTRA 2L0CA 2A6HD 5C0XH 3NQIA 1BXTA 4TSSA 2NBFA 4BWGB 4HEDA 1S5CD 5ELEA 2NVTB 4K6DA 5BN3A 4PNYA 1EFID 1RTNA 1D1IA 1Q1BA 2NTTA 4C3JB 1LT4D 3J7AV 5CORA 1PFNA 3ERQA 3A7LA 3SVMA 2EYJA 4X3TA 1UNSA 1QWYA 1HQMC 4QF4A 4QIWB 4A3KB 1F2YA 1B9MA 3GQBA 4B9XA 1AP0A 2Z4IA 3U9OA 4RCOA 4DAYA 1PRTD 1SXTA 1PYWD 4KTAA 3D6CA 1SNPA 1EY8A 3R8BA 1I4HA 4KD3A 3HZXA 1KDAA 3ONAB 1X3PA 2PQEA 4X3SA 1EU3A 3EA6A 1B53A 4IN3A 4J1MA 3I8ZA 3NHHA 5JOBA 1J9OA 5IGFA 1F77A 5EPKA 3H94A 1WTXA 2FFKB 4K5VA 5M3FB 4A3IB 1GUGA 2B2YC 3EROA 5JPMC 4U68A 2K6AA 1CM9A 3I90A 2KJXA 2LFNA 5DEHA 1V1PB 1F2ZA 1M4VA 2K05A 1V1PA 1R4QB 2B8FA 5EKKA 3PUXA 1YNND 5EGTA 2EYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N88 A;  4ZKC B;  3MWY W;  1KNE A;  1X32 A;  2X6L A;  2KED A;  1ILP A;  2K03 A;  2MJ8 A;  4CJ2 C;  1WTV A;  3I3C A;  2EE1 A;  5COR A;  4XDX A;  1WTW A;  1LV9 A;  2RSN A;  3N52 A;  1HFN A;  2B2T A;  1MI2 A;  1PFN A;  3GV3 A;  1E0B A;  4IUV A;  3SVM A;  1HA6 A;  5COY A;  4X3T A;  1G2S A;  2Q8T A;  3FPU B;  1B4O A;  2HDM A;  4MHE A;  2L4N A;  2N55 A;  4HCS A;  1Q3L A;  1X3Q A;  3LWE A;  2HDL A;  1ZXT A;  1J8I A;  1G91 A;  2RA4 A;  1DOM A;  2J7Z A;  1NR4 A;  3DEO A;  1AP0 A;  1JIC A;  1GUW A;  3F2U A;  5AFW A;  2EOT A;  1EIH A;  1F9P A;  3UI2 A;  5EPL A;  1ICW A;  1RTO A;  1F9Q A;  4CJ1 B;  1RHP A;  1BO0 A;  2BDN A;  2L11 A;  1NR2 A;  2RSO A;  1O80 A;  2B2V C;  1EIG A;  4ZK9 B;  2KOL A;  4OIK A;  2JYO A;  3DM1 A;  2B2W C;  2DY8 A;  2JP1 A;  3IL8 A;  2RVL A;  1BF4 A;  1B50 A;  4DN4 M;  2L1B A;  2NWG A;  1WVL A;  5D65 A;  1HFG A;  4IUQ A;  3KBX A;  5E4X A;  1XX8 A;  1HRJ A;  4RA8 A;  2HCI A;  5EJW A;  4ZAI A;  1QE6 A;  1X3P A;  2B2V A;  3ONA B;  1G2T A;  2NYZ D;  2L12 A;  2R3Z A;  2VXW A;  4X3S A;  3I91 A;  1HUM A;  4IUR A;  4IUP A;  2B2W A;  1WD1 A;  4RAU C;  1B53 A;  4NW2 A;  2HUG A;  1WD0 A;  1CA6 A;  4R9W A;  1DOK A;  3P7J A;  3I8Z A;  2DY7 A;  1DOL A;  1J9O A;  1F9R A;  1EOT A;  4XT3 B;  4ZLT F;  1EL0 A;  1QG7 A;  2B2U C;  3FDT A;  1AZQ A;  2K28 A;  3GV6 A;  1MGS A;  1ESR A;  1ROD A;  1SSO A;  2FMM A;  4O42 A;  1VMP A;  4QUC A;  1HUN A;  1IL8 A;  4HSV A;  2KUM A;  5CBE E;  3MTS A;  5EPK A;  2K01 A;  1BBX C;  1TVX A;  4QUF A;  5D14 A;  1B2T A;  5DNF A;  3IFD A;  1F2L A;  2EPB A;  2FFK B;  1B3A A;  2MP1 A;  1PFB A;  2B2U A;  4X3K A;  1WTX A;  1G6Z A;  3D6W A;  1ML0 D;  3H91 A;  1MSG A;  3Q6S A;  2D9U A;  2X6G A;  2FHT A;  2B2Y C;  3TN2 A;  1U4L A;  3G7L A;  4XT1 B;  1JE4 A;  1U4P A;  2IL8 A;  2MPM A;  2XIW A;  4U68 A;  5E4W C;  2FJ2 A;  1RJT A;  2X69 A;  1WTO A;  1QNK A;  1O7Y A;  2KEE A;  1PDQ A;  1CM9 A;  2SDF A;  4OIJ A;  5EKI A;  1PFM A;  3I90 A;  4ZKB B;  1IKM A;  1F9S A;  1S4Z A;  1NAP A;  2HCC A;  3QO2 A;  4MN3 A;  1WTR A;  5T1G A;  1WTP A;  1C8C A;  4X3U A;  1PLF A;  2B2Y A;  2H1E A;  1KNA A;  2KVM A;  1DON A;  1HHV A;  3TZD A;  1ILQ A;  2M2L A;  1M8A A;  1SDF A;  1XYI A;  2FIN B;  3DEP A;  1SAP A;  2CVR A;  4UAI A;  1NCV A;  1U4R A;  4HED A;  1EQT A;  5T1I A;  1MSH A;  5EPJ A;  3R93 A;  2K04 A;  2Q8R E;  2K05 A;  4IUT A;  4R8I A;  1AZP A;  2L9H A;  1DZ1 A;  2KEC A;  1BNZ A;  5EQ0 A;  5CBA E;  5JJZ A;  3KUP A;  4LMQ D;  1WTQ A;  3HP3 A;  2B2T C;  2K1B A;  1CA5 A;  4HAE A;  4IUU A;  1O7Z A;  2NZ1 D;  2MGS A;  1A15 A;  4CJ0 B;  1RTN A;  4RWS C;  5CMD A;  1IKL A;  1VMC A;  1U4M A; 
#chains in the Genus database with same CATH topology
 1SE4 A;  5GAE C;  4QY7 A;  4X6A H;  4IAL A;  4F8M A;  2ZT9 C;  5IOC A;  2OQK A;  1Y69 U;  2F03 A;  1YJ9 A;  1DXM A;  5BN4 A;  2CWA A;  3E9I A;  3I4M H;  3FHW A;  2PCF B;  1CKO A;  4DGZ A;  4MHE A;  3F2B A;  4AQY Q;  4JPB W;  4DUY L;  3ND8 A;  1NE3 A;  3HKZ G;  4WOR A;  5FLX E;  3DUZ A;  3CCM A;  1UE5 A;  3MXU A;  4JI7 Q;  4DV7 Q;  1II3 A;  2Q8I B;  3UI2 A;  3PQI A;  2L11 A;  1E3P A;  1L0Y B;  3W2D A;  1TY2 A;  2L15 A;  4KJO A;  2VUM B;  4AH6 A;  1GD7 A;  4A75 A;  1FNU A;  2PZT A;  1XWE A;  1GVP A;  5EJW A;  2A1A A;  4ZUI A;  3HOX G;  5FLX c;  2B2V A;  3CMA A;  1IYV A;  3SK5 A;  2R3Z A;  5CV9 A;  1L0X B;  1DOK A;  2K75 A;  4F88 A;  1GO3 E;  4MTK A;  3A56 A;  1BBU A;  1DOL A;  5IYD H;  1TQO A;  4JI6 L;  4B3T L;  5C44 H;  1GUT A;  3AEV A;  1Y8O B;  5M3M B;  1FNW A;  1XPR A;  3VYR A;  4QUF A;  1SYD A;  4LFA L;  3EQL C;  1HZC A;  2Z4H A;  3TRE A;  4RHS A;  1D7Q A;  3SXH A;  4POG A;  2Y0S G;  2BH8 A;  1JT8 A;  3RMH A;  3CAM A;  2EJG C;  2BDO A;  3NE5 B;  5EKI A;  3D3R A;  4NXN L;  1W6K A;  3CME A;  4DV0 Q;  2IHE A;  1EZ6 A;  1QZH A;  1E2W A;  1AEX A;  1ZYR D;  1KTK A;  3C1E A;  2QA4 A;  1LTB D;  1ASY A;  1A3T A;  1TS3 A;  3S2D B;  4CKC A;  4HJ7 A;  1O7I A;  3NPP A;  2YYZ A;  3K7U C;  2NN6 G;  4MNO A;  4CJ0 B;  4RWS C;  4HMJ A;  4AYB B;  4N9P A;  4JI2 Q;  3CCU A;  2RSN A;  1ICF B;  5BN5 A;  1S5D D;  2VW9 A;  1B7Y B;  1H95 A;  4IUV A;  2WAQ B;  3LNN A;  1JC7 A;  1YZ6 A;  2Z8L A;  2WII B;  3D4W A;  2AQ3 B;  3EN2 A;  1IBL L;  1I4Q A;  3FPU B;  2CH4 A;  2QGQ A;  4A3F G;  3LWE A;  3K5M A;  1SMY D;  4KHP L;  3OIP A;  2UUC L;  5FO8 B;  3OPO A;  1JIC A;  2F0M A;  1GOZ A;  1RKN A;  4FF1 A;  1H9J A;  3KBG A;  1R9T H;  1A63 A;  1OTC A;  5M9O A;  3M4O B;  1ESF A;  1BO0 A;  2BDN A;  1VQH A;  4GLV B;  1TT2 A;  2HT1 A;  2JA6 G;  4FXK C;  1YI2 A;  1G8Z D;  1OXT A;  1RD9 D;  1E22 A;  2XRS D;  3OW7 A;  4ID6 A;  1H9R A;  3OMG A;  3OSO A;  5K36 G;  2R7F A;  3U58 A;  2QW7 A;  2R6G A;  3A8I E;  3R2I A;  4YIJ A;  5M5W B;  1SEB D;  2RCF A;  3HOX H;  4B3M Q;  4DR6 Q;  1TWG H;  4Y7N B;  4K5W A;  4PZ7 A;  2HHH L;  2K5H A;  3DM3 A;  1KRT A;  1MIU A;  1EOT A;  2ZXO A;  5I4D A;  2LXK A;  3A8J E;  3DLL A;  1MGS A;  3WWV A;  3QOJ A;  1D5X C;  2PQA B;  1KC8 C;  2PQA A;  1BBX C;  1JMC A;  3GTQ H;  5D14 A;  4JV5 Q;  1X3G A;  4TVA B;  2R92 B;  1EWC A;  2IHF A;  1G6Z A;  2ZJP A;  3TDQ A;  1U4L A;  4RG1 A;  2IL8 A;  2DJG C;  3L0O A;  4DV5 Q;  4C3H B;  1Q12 A;  4L63 B;  3G71 A;  4JI1 L;  1NAP A;  3NWS A;  1D6E C;  3EVQ A;  4DNT B;  4FXD A;  5F2D A;  1PH9 A;  4YWM A;  1BCP F;  2H1E A;  5FLM G;  4A3G B;  1IYJ B;  2E2H H;  3ZYY X;  4H0L C;  2OTL A;  4IFD I;  4R4Q A;  2L9H A;  2IX1 A;  3RLO A;  1EZ8 A;  1BNZ A;  2UXC L;  4GOP C;  5G3L D;  3DMU A;  3HP3 A;  1HR0 Q;  1VQI A;  1DD2 A;  4CBV A;  1L1O B;  2JA8 H;  2HIV A;  1L1O A;  2WFW A;  1VQP A;  3K6O A;  1JWM D;  4A3D G;  4A93 B;  4DV4 Q;  1PRT B;  3CRK C;  1X6O A;  3JC6 6;  2F0W A;  1PV4 A;  1IW7 C;  1M1K C;  2F0Q A;  1VQN A;  1IBM Q;  5LMN Q;  4NPS A;  2HQE A;  2DUD A;  1WCM G;  4H7B A;  2HDL A;  3CXC A;  4YHH L;  4A3F H;  2J7Z A;  3BYY B;  3X3M A;  1CT1 D;  3O13 A;  1VQA A;  4IZ8 A;  5CC4 A;  5KNC A;  1V1Q A;  4JG2 A;  1RTO A;  2IJ0 A;  4A3C G;  4F7X A;  3SHL A;  4CGY B;  4XIG S;  3I4O A;  3K58 A;  2JYO A;  1EY5 A;  4K0K L;  3SK8 A;  1BF4 A;  4MZ9 A;  2JA6 H;  4DN4 M;  4IFD G;  3VR3 A;  1X9N A;  1HFG A;  1WFQ A;  2K7V A;  4RA8 A;  3OOC A;  2E2I H;  1STB A;  1X54 A;  3F1Z A;  2VXW A;  2A8V A;  1OXS C;  1HUM A;  1NBW A;  4LF4 Q;  4DR7 Q;  4DPG A;  2ZTD A;  3P7J A;  1RF2 D;  4JW0 A;  3V2T A;  4IO9 A;  1G6P A;  1HNW L;  4ZLT F;  1JJC B;  1MD2 D;  3OTO Q;  1K0R A;  3VA5 A;  5IWA L;  1PH2 A;  2O5I C;  3NUC A;  3PUV A;  1I94 L;  1W6J A;  5JVH 3;  4R8N A;  4P71 A;  2YU9 B;  3GTL H;  4UP8 A;  4C3I B;  4DA2 A;  3VR4 A;  2SNM A;  2H5X A;  3GTK H;  1YNJ D;  1SR3 A;  4LFA Q;  4GNX C;  4IJL A;  3TQY A;  1A0I A;  1IXR A;  2F0P A;  2NVQ B;  1PDQ A;  4A3B G;  3Q24 A;  2XWB B;  4IOA A;  2N78 A;  5IYC G;  2JA7 G;  5CV6 A;  5A35 A;  2M00 A;  1N9W A;  2KCC A;  1S5F D;  3CCS A;  5FLM H;  3A5Z B;  3PO2 B;  1LYL A;  3S14 H;  1GUS A;  4A3M B;  3X3N A;  1LTT D;  3GTP B;  1KXL A;  1C4Q A;  3J81 L;  1U4M A;  4ZKC B;  4FP5 D;  2IW3 A;  1ZEQ X;  2JK8 A;  3QOL A;  4OO1 I;  3WOE A;  2MJ8 A;  4CJ2 C;  4DU9 A;  1LM0 A;  3I3C A;  3GTG H;  3MFY A;  1K83 B;  2B2T A;  2Z9H A;  4A3D H;  1EWH A;  1M90 C;  1HA6 A;  1YEZ A;  4UY8 C;  2IY5 B;  4WJ4 A;  3S17 H;  1G2S A;  1BCP B;  1BUV T;  5HGQ A;  2L4N A;  1NMG A;  5J22 A;  4JYA Q;  2BCO A;  3I7F A;  2EQS A;  1FJG L;  1WCM H;  2R93 B;  4FVM A;  2EY6 A;  4DV6 L;  3VA7 A;  3FPP A;  1VS0 A;  5TSS A;  3MVV A;  1QUQ B;  3MEH A;  2XVS A;  4G4K A;  1QUQ A;  4OIK A;  4A3C H;  3HOU B;  1ENF A;  3IRB A;  3M7N A;  5C3W A;  2CQO A;  3M3Y B;  4IFD H;  4NDX A;  4UDU C;  1K8O A;  3GD7 A;  3G6E A;  4N8F A;  3FMC A;  1AN8 A;  1BVS A;  3QJY A;  4B3S Q;  2PPB C;  3I4N G;  4RAU C;  4N8X 1;  4JI7 L;  4DV7 L;  1VQ8 A;  1K73 C;  2R7Z B;  1F9R A;  3LWU A;  5FOB B;  4RGO S;  2E75 C;  5LL6 S;  1SSO A;  1P8L A;  3K7A B;  4MTN A;  5ELB A;  5IP7 G;  3H3V H;  1EYD A;  4G7O C;  5CBE E;  2EIF A;  1PH5 A;  4V0B A;  1D5M C;  1UE6 A;  3D6W A;  3TEH B;  3Q23 A;  3AFQ A;  2RF4 A;  4DAP A;  5CV7 A;  2ZJR A;  5JJI A;  2UUB Q;  3UDX A;  4P74 A;  1PTO B;  1X3E A;  1LLR D;  2F0G A;  4YY3 Q;  4NB3 A;  4LW1 A;  4GN5 A;  5JEA G;  4A3B H;  3SEB A;  5IYC H;  2JA7 H;  1WYD A;  2F4V L;  1Y1V G;  2I0Q A;  4PV1 C;  2TMP A;  4UAI A;  1Y1W G;  2Q8R E;  3U50 C;  3BDL A;  2UXC Q;  4LMQ D;  3UDG A;  1E1O A;  2I5H A;  4RHR A;  1A2T A;  2A19 A;  2E2J B;  4DXG A;  1X32 A;  1S72 A;  4DV0 L;  2WB1 E;  3D8G A;  4UP7 A;  1LT5 D;  1LV9 A;  3GV3 A;  5EAY A;  1I6H B;  1CSQ A;  3GTJ H;  4YCW A;  3BJU A;  3GTO H;  1CI3 M;  1D1K A;  1ZXT A;  1NJI C;  1DOM A;  3K5O A;  2JE6 I;  2JA5 B;  2K14 A;  3BVZ A;  4QCL A;  3NBH B;  5EPL A;  5CYU A;  4CJ1 B;  4JI2 L;  1RHP A;  3ULL A;  4RH6 A;  3A54 A;  3NBH A;  4C56 C;  2B2V C;  2EY5 A;  2KOL A;  3CCR A;  3A74 A;  2AWN A;  2RVL A;  2WB1 G;  1G51 A;  2L1B A;  1U0L A;  4EVO A;  1KLU D;  5A2Q E;  3HS0 C;  2BH2 A;  1I4G A;  1JCK B;  3S15 B;  4PMC A;  3BDC A;  2G9D A;  3AB9 A;  2NVX B;  5KGU A;  5I2Y A;  3I4N H;  3MXG A;  2F3I A;  4G57 A;  1I3Q H;  1HNW Q;  1QG7 A;  4B3R Q;  4HJA A;  2A69 C;  5IGC A;  5A2Q L;  5IWA Q;  1Q46 A;  1IL8 A;  1QVF A;  3FKI B;  3W3A A;  1OXX K;  4KHV A;  2PMZ E;  1YIT A;  1WI5 A;  1B3A A;  1PFB A;  1AFP A;  3Q6S A;  1XXG A;  5C44 B;  4B3M L;  4X62 Q;  4IPC A;  5KRU A;  4DR6 L;  4CDE C;  5KIX A;  1JE4 A;  1CSP A;  1B9N A;  2FJ2 A;  1Z6H A;  4YWK A;  3KFU A;  2YTX A;  5IE8 A;  1IKM A;  1PH8 A;  2D5D A;  3S16 H;  2Z6K A;  4BBS G;  1HHV A;  3T16 A;  2K5W A;  1XYI A;  2Q2I A;  1RIP A;  2FIN B;  5JEA H;  2ENB A;  1RCV D;  3T1Y Q;  5HUR A;  1NCV A;  1UE1 A;  1C9O A;  1Y1V H;  2WAC A;  1UAP A;  1Y1W H;  2AUJ D;  1B70 B;  1SYG A;  2E74 C;  3KUP A;  4QQB X;  2NUC A;  1SE2 A;  3CD6 A;  1VQC A;  1VDZ A;  1IKL A;  5FO9 B;  2VB2 X;  4DV5 L;  1ILP A;  2I07 B;  1UEB A;  4LWC A;  3IAY A;  3BZD B;  1YBY A;  1N36 Q;  4LUV A;  3TP7 A;  1XMO Q;  2UUA Q;  4A3E B;  3J81 i;  2AUK A;  2CW0 C;  4WFN 3;  3HKZ E;  1TU2 B;  2ZXP A;  4Z9C B;  2F0O A;  1Q3L A;  1K8A C;  3Q0A A;  2K50 A;  1G91 A;  1HR0 L;  1A62 A;  2IPK D;  3T51 B;  2A6E C;  2AKW B;  1FJG Q;  5AFW A;  5M3F G;  1XJV A;  2KEN A;  3T4A C;  1EIH A;  1JR0 D;  4DV4 L;  4A4I A;  3P75 A;  3T13 A;  4HIO A;  3DM1 A;  4DNI A;  3S1M B;  1EY6 A;  2ICE C;  1IBM L;  5LMN L;  3CQZ H;  4C2M H;  2EXD A;  5E4X A;  3U9S A;  1I4X A;  2AHO B;  3HFZ B;  2NB0 A;  1QE6 A;  2JA9 A;  4DK6 C;  1W3S A;  2L5T A;  1KRS A;  4ZCK A;  3I91 A;  5M5X B;  4JBM A;  3JAM E;  1TS4 A;  3TSS A;  4K2K A;  5FO7 B;  2O2L D;  3UE1 A;  2NVT H;  4X65 Q;  5C6A A;  3E3X A;  1JWS D;  2LSS A;  1L0W A;  1LTG D;  5J39 A;  2M9V A;  4DV2 Q;  1FD7 D;  3NWT A;  3QG1 A;  5ELN A;  4HTH A;  4DV3 Q;  5I6W A;  2SEB D;  2Y0S E;  3C46 A;  2B2U A;  5FLX L;  3JAM c;  5FK9 C;  2RHQ B;  4TKO B;  4LF4 L;  4DR7 L;  2K52 A;  4PZ8 A;  5E4W C;  2YV5 A;  2PI2 A;  1RJT A;  4X64 L;  4Q0F A;  2QF7 A;  3H0G B;  1F2M A;  2A74 C;  4EGV A;  5IT9 E;  4GZY C;  3OTO L;  1C8C A;  4X3U A;  3OW2 A;  2JEA I;  3TZD A;  2VQE L;  1B8A A;  2M2L A;  1M8A A;  3OMC A;  5C4J H;  3DEP A;  2ZM6 Q;  4S3S A;  3MC0 B;  2F4V Q;  2CVR A;  4BBS H;  1L1O C;  1ENC A;  1TWF H;  1Z9F A;  3K5N A;  4R8I A;  5E3F A;  1DZ1 A;  3J7A F;  1CHQ D;  1KAA A;  1KL9 A;  1PRT C;  2ZJQ A;  1PRT F;  3MXN B;  5IT9 c;  1ET6 A;  3NQT A;  3H6M A;  3PV0 A;  3BG3 A;  3CC2 A;  3MXN A;  5I2X A;  3HOW G;  4OHJ A;  3EIV A;  4XXE A;  3CCE A;  1TXY A;  1AH9 A;  4MIU A;  2IX0 A;  3GP7 A;  3CCV A;  1IW7 D;  2CFM A;  2F3V A;  5M3M G;  1N33 Q;  1FVI A;  2JA8 G;  1DJR D;  4J6H A;  1TWC H;  1HNZ Q;  1FGU A;  4H13 C;  3V05 A;  5M3F H;  3RLN A;  2AMC B;  1QOH A;  2VS1 A;  2LY7 A;  1EQQ A;  4A3F B;  2K5Q A;  2XSC A;  4HJ8 A;  2PZU A;  4L5T A;  4DR3 L;  1E2V A;  3AQQ A;  1K8M A;  2NWG A;  3D4D A;  4JYA L;  1C48 A;  4DK1 A;  5LMU Q;  3HOV G;  1JOQ A;  2UXD Q;  2JN4 A;  4IUP A;  3AMU A;  1JE5 A;  4NW2 A;  3TP6 A;  4BA1 I;  4TQU S;  4HMI A;  1VQJ A;  2B3G A;  2DY7 A;  2F0L A;  1TS5 A;  3AU7 A;  4XT3 B;  2OQ0 A;  4IFD J;  2ZTE A;  4AYB G;  3S1R B;  4DF7 A;  2F0H A;  2SNS A;  5D3D A;  1HUN A;  4YCV A;  1EYC A;  1SNC A;  4JBW A;  3TS2 A;  1Q86 C;  5GAD C;  1T5X D;  5C3E G;  1BR9 A;  2CQA A;  3TN2 A;  4B3S L;  1LO5 D;  4JI0 L;  1LTL A;  3I4L A;  2F0T A;  1YJN A;  1O7Y A;  4K14 A;  4HJ5 A;  3GTL B;  3HG9 A;  1O78 A;  5T1G A;  5D3I B;  1Q90 A;  3GTK B;  2EYM A;  4KLK A;  2IWH A;  1PH4 A;  2O4X A;  1MSH A;  5EPJ A;  3J80 E;  1YJW A;  1SNM A;  4KHZ A;  2V4D A;  4LAA A;  2B2T C;  2JXM B;  3SGI A;  2HIX A;  1A2U A;  3HOZ B;  3T56 B;  2UUB L;  1KNE A;  4YY3 L;  2BOS A;  1BCP C;  3S14 B;  1NY4 A;  3K0X A;  4RKL A;  1PH1 A;  1I50 H;  4JBJ A;  3V96 A;  4B9W A;  3ND9 A;  3J80 c;  3DHQ A;  3NEN A;  3HOW H;  4LF7 Q;  5BR8 Q;  1XTD A;  5CR3 A;  4YCU A;  4F87 A;  1PA6 A;  4BY7 G;  1NUC A;  1J8I A;  2MUY A;  1DYQ A;  4BY1 G;  3VYT A;  5M3M H;  4A3J G;  1CQV A;  2R92 G;  3NP8 A;  3S17 B;  3HKS A;  3G6J B;  4OXP A;  2FMC A;  4BS9 A;  1KAW A;  4EQN A;  2RSO A;  4GN3 B;  1O80 A;  3PGZ A;  1WCM B;  3QB3 A;  2CKZ B;  2DNC A;  1S5B D;  3E6Z X;  4AIM A;  4JI3 Q;  3L7Z C;  4R4I A;  2WP8 J;  1PZK D;  4FF3 A;  3I73 A;  4M1U B;  3RD4 A;  4UP9 A;  1VQM A;  1FYC A;  2LMC B;  1HZ9 A;  3S2D H;  4IQZ A;  3DWP A;  2UXB Q;  3HOV H;  2ALY B;  4R9W A;  1D2B A;  2F0I A;  1ZYR C;  1VQ6 A;  3MEF A;  1SFO H;  2RDF A;  1XPO A;  3NXW A;  5JPN C;  2QEJ C;  2F4I A;  5EBC A;  2SOB A;  3S1Q H;  3GV6 A;  1LT6 D;  2FMM A;  2F0S A;  5M5Y B;  3OHX C;  4A93 G;  3EJI A;  1PMR A;  4LF5 Q;  2K01 A;  1NMF A;  5C5M A;  4LF8 Q;  1KDB A;  1PTO C;  3CU7 A;  1ML0 D;  2X6G A;  5C3E H;  3STB C;  1PTO F;  3VDY A;  1EU4 A;  1HZA A;  4DK0 A;  4OIJ A;  3GO5 A;  4DXF A;  5IP9 G;  4X64 Q;  4KMU C;  4GS3 A;  2HCC A;  4K6L A;  1Z47 A;  4B3R L;  2KCT A;  3MXP A;  4RFB A;  2F52 A;  1ILQ A;  1SBB B;  1SDF A;  1EY4 A;  1QB5 D;  2MHV A;  3LX0 A;  2VQE Q;  1SMY C;  1H9M A;  1LT3 D;  5IGG A;  1B44 D;  1AZP A;  3AYH B;  3T53 B;  2KEC A;  2WIN B;  4PMW A;  1EFW A;  4A3B B;  2EYH A;  4X62 L;  2K1B A;  1EYA A;  2NZ1 D;  5JEA J;  5CMD A;  1GJX A;  2MO1 A;  2DGY A;  4B08 A;  2K03 A;  2DNE A;  1SYB A;  3RLF A;  4XDX A;  1SNO A;  3NSW A;  2IT1 A;  4XYO A;  4RCN A;  3T1Y L;  1B4O A;  2A68 C;  5ELF A;  1Q7Y C;  4DR5 L;  1TWA H;  3NK9 A;  2AWO A;  4R1J A;  1N8R C;  4BY7 H;  4JI8 Q;  4C3I G;  4BBR B;  4BY1 H;  3GTO B;  2XNA C;  1F9P A;  4JK1 C;  4A3J H;  1H9K A;  1V9P A;  2R92 H;  4XQJ A;  1Y8N B;  5DM6 3;  1N36 L;  1XMO L;  2UUA L;  3NTH A;  4DV1 Q;  1A6X A;  2KHS A;  3K0Y A;  2H4O A;  4QJF A;  3Q8D A;  4IPH A;  1VQD A;  4DR3 Q;  2RDG A;  2EY2 A;  4KY7 A;  2XN9 C;  4GKJ L;  4K2L A;  2B2W A;  1FR3 A;  2ZXR A;  4UPA A;  1VQ9 A;  1YHA A;  5C4Z A;  5C5L A;  4HR7 B;  2PYK A;  1V1O A;  3T1H Q;  4HJ9 A;  3VYU A;  4CHT B;  1EIY B;  1I4R A;  4TRD A;  4BXX G;  4ME5 A;  1K28 A;  3NEL A;  2LS0 1;  1OXU A;  1S5E D;  2BA0 A;  3ICE A;  1N32 L;  2F1M A;  3LGJ A;  3I4N B;  2F0K A;  5C4H A;  2A69 D;  4A93 H;  3SE0 A;  1I3Q B;  1F2L A;  2EPB A;  5DAU A;  5G3L F;  4R4O A;  2C35 B;  4RGM A;  5I6Y A;  1O7L A;  3F2D A;  2HD3 A;  2NVY B;  1EQR A;  2Z6K C;  1ET9 A;  1FNV A;  5E1F A;  4JI0 Q;  3S9W A;  4X65 L;  4PZ6 A;  3W1B A;  2B63 B;  4OO1 G;  1S4Z A;  3E5S A;  5IP9 H;  4JOI A;  1RL2 A;  4DV2 L;  1CQF A;  3VR6 A;  4DFA A;  5GAH C;  5FKA C;  1SNQ A;  4DV3 L;  1SJE D;  2CHB D;  5ELC A;  2K5V A;  3F8T A;  3RN2 A;  2OF1 A;  3CRL C;  3ULP A;  5IYB G;  5EQ0 A;  5CBA E;  1VQ7 A;  1EY0 A;  4KKT A;  2OTJ A;  1A15 A;  3TBI B;  3P20 A;  3CC7 A;  3RZD H;  1EYG A;  3OWF A;  1VCI A;  4O2D A;  4EQP A;  1Y1W B;  2PW5 A;  1HFN A;  3W1G A;  2R7Z G;  1B1Z A;  3RR5 A;  1JOO A;  4H44 C;  2ZM6 L;  3J7Z C;  1P16 A;  1IBK L;  3PO3 B;  3I70 A;  3L9A X;  2N55 A;  3VYS A;  1HQR D;  2YTV A;  3S1N H;  3BS1 A;  3A5U A;  2RA4 A;  1X3F A;  5C4X B;  1BOS A;  2F0U A;  4LFC Q;  3HOY G;  3KLS A;  2F0V A;  5GQO A;  1TR5 A;  3KLR A;  2YU9 H;  2A6E D;  4RKB A;  4C3I H;  1PVO A;  4DUZ L;  1HA5 A;  4LF9 Q;  1ONL A;  1EIG A;  5H1S E;  4KKU A;  1JQY D;  2B29 A;  2DY8 A;  1B50 A;  2IX3 A;  3E0J A;  3KLW A;  2QKI C;  4O0A A;  1IL2 A;  1LAC A;  3PIO 3;  2PNR C;  1K8G A;  3BVG A;  4JI4 Q;  1HRJ A;  5EKL A;  1N33 L;  3KJP A;  2NYZ D;  4R4C A;  4RGN A;  2R61 A;  5I9O A;  1SYF A;  4FYD A;  4DR2 L;  1K9M C;  1HNZ L;  3I4M B;  1CK1 A;  4C2M B;  2WB1 B;  4OL7 A;  3NBI A;  2B2U C;  3M7G A;  2K28 A;  1ESR A;  3CW2 C;  4QUC A;  4BXX H;  4I65 A;  2I5M X;  4KK7 A;  5J1Z A;  1LTA D;  3MHB A;  2PW7 A;  4QIW E;  2A5H A;  3G48 A;  2XWJ B;  3H91 A;  2RKS A;  5LMU L;  2UXD L;  4DKA C;  1Q1E A;  3VR2 A;  1I5F A;  4EX5 A;  3K57 A;  2BE5 C;  5LHY 1;  4K8I A;  2X69 A;  4JCV E;  3FEW X;  2JA5 G;  3NTK A;  4J15 A;  1CKM A;  1WTP A;  1SRU A;  2LKV A;  1FL0 A;  3U4Z A;  4OO1 H;  2JSO A;  2KVM A;  3SDZ A;  1K0S A;  2VB3 X;  5NUC A;  3S24 A;  4C3J G;  1CUK A;  3M4P A;  1STA A;  1NNX A;  5ELO A;  2GA4 B;  1SMX A;  5KYL A;  1PZJ D;  1A8V A;  3H09 A;  1Q81 C;  3RZO H;  4HAE A;  5IYB H;  1O7Z A;  2C5C A;  5C4J B;  2JJQ A;  4A3K G;  4BBS B;  1TWF B;  1Q8I A;  3K5L A;  4NKL A;  4K8J A;  3RUZ A;  1SE8 A;  2RDH A;  1AE3 A;  1E0B A;  5I9P A;  1CZG A;  2F0J A;  1K3R A;  1WTH A;  2R7Z H;  3CP0 A;  2PMZ B;  3UDI A;  1VQO A;  3MA2 B;  1S3O A;  4KJN A;  4HCE A;  3K7A H;  4P72 A;  4DR5 Q;  2DJF C;  1QVG A;  1EQV A;  1NR4 A;  1GUO A;  3DEO A;  4JI5 L;  3K59 A;  1VF5 C;  1STY A;  3E9H A;  1STH A;  5CV8 A;  3HOY H;  4ZQ3 A;  1ICW A;  1UUP A;  1U9R A;  3ZJY C;  1UEA B;  1NR2 A;  3E0E A;  3K81 C;  1MKH A;  1KLG D;  4ZK9 B;  1TWH H;  1E1T A;  1UWV A;  2UU9 L;  1NSN S;  3GTM H;  1TWC B;  5CV4 A;  4LF7 L;  5BR8 L;  4FDB A;  1PTO H;  1HXY D;  1Y8P B;  4IUQ A;  3KBX A;  4OX9 Q;  5IOD A;  1DCZ A;  2HCI A;  2HQL A;  1HZB A;  1FGB D;  5KND A;  2RBM A;  4IJH A;  1HTL D;  3M9B A;  2CCZ A;  4KY6 A;  4GKJ Q;  3TP5 A;  1WD0 A;  3M4Q A;  3R2T A;  3QIA A;  4A3I G;  5GAG C;  1EY7 A;  2V1C C;  3CKI B;  1JJ2 A;  4O42 A;  3S2H H;  3OWE B;  2E2J H;  2XRQ D;  2PZW A;  4HSV A;  3HKZ B;  4P73 A;  1GXD C;  1KDC A;  4L6T B;  4JI3 L;  1N32 Q;  1XNQ L;  1R9T B;  3IFD A;  5C3X A;  3OYY A;  3BYT B;  4H02 A;  1I6H H;  4LUZ A;  3M85 A;  3I55 A;  2UXB L;  2XIW A;  1QZG A;  1A3U A;  3MFG A;  2ATW A;  1QNK A;  2A6H C;  2KEE A;  1V43 A;  5IGD A;  1B3Q A;  1AE2 A;  4MN3 A;  1JWU D;  4FXG C;  1HH2 P;  2JA5 H;  4ZRZ A;  2RQX A;  3HOX B;  2CH4 W;  1HPC A;  3M4Y A;  1TWG B;  4LF5 L;  5T1I A;  1LTI D;  4LF8 L;  2KCM A;  4C3J H;  4BA2 I;  2EJF C;  3JAM L;  3CPW A;  4DR1 L;  2PI2 E;  3DXJ C;  1BKB A;  4IUU A;  1YNX A;  4KV6 A;  4ODG A;  4PQX A;  5ISR A;  2QDB A;  1CKN B;  4RGT A;  1VMC A;  2N88 A;  1A3V A;  1I4P A;  2X6L A;  1CKN A;  3GTQ B;  3ITP A;  3KK7 A;  2O5J C;  3QWN A;  1CTM A;  3PIP 3;  4A3K H;  2WKD A;  3S15 H;  2OT2 A;  2ASB A;  2NVX H;  4CDD C;  4OEM B;  1SJH D;  1BCP D;  1IBK Q;  2Q8T A;  2HDM A;  2Y0S B;  4HCS A;  1TS2 A;  2VUM G;  1X3Q A;  1XNR Q;  1XPU A;  1PYS B;  1HNX Q;  1I50 B;  2NN6 I;  3W5O A;  4L8J A;  4DR4 Q;  2KHJ A;  3F2U A;  3FKI H;  3HOW B;  2E2H B;  2B39 A;  1RDP D;  5IT9 L;  2G9H D;  3WOF A;  1F9Q A;  4CKE A;  5E7N A;  4XTC S;  4DUZ Q;  2K33 A;  2VZA A;  1DGS A;  2QEX A;  4L5Q A;  3H0G G;  5HGT A;  5ELD A;  2JA8 B;  2EXZ A;  3SR1 A;  3PMF A;  3A7A B;  4KD4 A;  1MJE A;  1G2T A;  5IGE A;  4JI8 L;  3QR8 A;  4DR2 Q;  1CHP D;  1QJO A;  1X65 A;  4AYB E;  1PH6 A;  4YWL A;  1JB7 A;  1SRO A;  5AJ3 Q;  4WRD A;  4C1N K;  4A3I H;  4DV1 L;  1V8Q A;  4KY5 A;  4ZUJ A;  2WAQ E;  3HOV B;  3MTS A;  3H3V C;  1TVX A;  5JJL A;  1SFO B;  1B2T A;  4KN4 C;  4X3K A;  3S1Q B;  1GHK A;  4DAV A;  4A3E H;  3FVQ A;  2D0O A;  2VQF L;  1SND A;  3G7L A;  4XT1 B;  2OWO A;  1PTO D;  2JA6 B;  2D2C C;  2SDF A;  3T1H L;  3DWQ A;  1PFM A;  3STB D;  2JEB I;  5J3B A;  5L37 A;  2E2I B;  4I7A A;  2B2Y A;  1GUN A;  3ER0 A;  5C3E B;  3PUY A;  2I46 A;  1XMQ Q;  1LTS D;  1PXU A;  3KF8 B;  5K5P A;  1YNN C;  2K04 A;  4IUT A;  3KF8 A;  1G29 1;  3PUZ A;  5JAV A;  4OEL B;  4Q5V A;  2PO4 A;  2WAQ G;  4P75 A;  1STN A;  4E6I A;  1BQQ T;  1TII D;  4LUO A;  3S1M H;  4I7Z C;  2F3W A;  1DON A;  5KEE A;  2KED A;  2B8G A;  4LFB L;  1SYC A;  1JB3 A;  5M5X H;  4KKS A;  4LF6 Q;  2QIL A;  3NTI A;  4QGU A;  5COY A;  2EJM A;  5CGK A;  2RCN A;  4GKK L;  4J8Q A;  3AFP A;  4OON A;  1K3B C;  4QB4 A;  1EOV A;  1VQB A;  4ALP A;  2F0F A;  2A68 D;  2OEO A;  3J7Y W;  2VUM H;  4IUN A;  1GUW A;  4JI5 Q;  3BVM A;  2FXQ A;  2CWP A;  5JJK A;  4APV A;  1VQE A;  3P1H A;  1TWA B;  4OWT B;  4LJZ C;  4BY7 B;  2B2W C;  2JP1 A;  3IL8 A;  3J80 L;  4BY1 B;  1IYU A;  2UU9 Q;  5HY6 A;  3H0G H;  4LNQ A;  4A3J B;  1XX8 A;  1OXV A;  1VQG A;  1D8L A;  2VL6 A;  3GTG B;  1STG A;  1QCB D;  1J5E Q;  4NXM Q;  4L5S A;  4LFC L;  3PF5 A;  4A3D B;  2OXP A;  2HUG A;  2ID0 A;  2MNA A;  1S40 A;  1KQS A;  2A73 B;  1EL0 A;  4LF9 L;  3FRP B;  3HOZ G;  1JJG A;  3FDT A;  2GVA A;  3BU2 A;  1TKW B;  4C1N I;  4C3H G;  3TP8 A;  3FP9 A;  1CFM A;  2KUM A;  2TSS A;  4OGQ C;  2Q2U A;  2K5N A;  1VF7 A;  5DM7 3;  2EDG A;  1HJP A;  4JI4 L;  4HIK A;  1PFS A;  2KCN A;  3D0F A;  4R4T A;  2N3S A;  4A3G G;  2N49 A;  2NZO A;  1XNQ Q;  1KAB A;  4JOI C;  5C0X J;  1SN8 A;  2D9U A;  2FHT A;  3HEJ A;  3I2Z A;  1LTR D;  4WJW A;  1C0A A;  1U4P A;  2NN6 H;  4CKB A;  1MHW C;  3L3O C;  1WTO A;  2Z1C A;  1PH7 A;  3C3L A;  5IIF A;  2E5L L;  3H3V I;  3IKJ A;  1QNU A;  3CCQ A;  1KNA A;  1Z7T A;  3I72 A;  1LUZ A;  2EVB A;  1EUJ A;  1IZ6 A;  5CV5 A;  1SAP A;  4OWW B;  1EQT A;  3R93 A;  4L5R C;  1YIJ A;  1AW7 A;  1JOK A;  2KHI A;  5IY0 A;  4DUY Q;  5JJZ A;  2QCP X;  4PG3 A;  4UHV A;  1WTQ A;  4DR1 Q;  1MJC A;  4DNR B;  4WJ3 M;  3J81 j;  1JOR A;  2EZV A;  4K5X A;  2KQ3 A;  3MWY W;  5EBD A;  1HCZ A;  3CHB D;  1J6Q A;  3JAM i;  1E2Z A;  2EE1 A;  4EQO A;  3CC4 A;  4JBK A;  1U5K A;  1MI2 A;  1EY9 A;  4P2C B;  1GHJ A;  3IFT A;  2GVB A;  1KIX A;  2EYP A;  1N34 L;  1STE A;  3RZD B;  3M4O H;  2Q2H A;  3KOJ A;  2ICI A;  5K36 H;  2BA1 A;  1NTG A;  2NTS A;  2PNH A;  3S1R H;  3L2P A;  1YVC A;  2VY3 A;  2JA7 B;  4V19 0;  5C0X I;  3S1N B;  1PZI D;  4HID A;  4JI6 Q;  5M5W H;  4B3T Q;  2F0D A;  4G7H C;  3WDN A;  4OWX B;  4Y7N H;  2P5Z X;  3I56 A;  3Q22 A;  1EEI D;  1PHJ A;  2EYF A;  5D65 A;  4ZYS A;  2EY1 A;  3EFX D;  2LXJ A;  1XTC D;  3SK4 A;  4U67 3;  2L12 A;  3K8A A;  4XQQ A;  2WV6 D;  4IUR A;  4QMG A;  1CA6 A;  1ZKO A;  3MAQ A;  3DWA A;  4JC0 A;  1W2B A;  3GTJ B;  4NXN Q;  3J81 E;  1WOC A;  2G5D A;  1AZQ A;  3J7A 5;  1VMP A;  2K5D A;  1T9H A;  3HOZ H;  2WKC A;  2K4K A;  2JQO A;  1IHZ A;  4C3H H;  4OX9 L;  1HTP A;  5KYI A;  4RMF A;  4NMZ A;  2OCE A;  4NP5 A;  3ULJ A;  2YTY A;  2GN5 A;  2J4X A;  4A3G H;  3PO2 G;  2MPM A;  2VQF Q;  3J81 c;  2D0P A;  4A3M G;  2E2D C;  1EEF D;  4ZKB B;  2E76 C;  5FJ8 G;  5C0X G;  3CCJ A;  1F9S A;  1BDO A;  2BE5 D;  3QO2 A;  1PH3 A;  4BBR G;  2XTI A;  2R7D A;  1QIL A;  1PLF A;  3PUW A;  3PF4 A;  1U4R A;  1IBL Q;  3KYH C;  2F0N A;  3OIQ A;  4X66 L;  3D31 A;  4ME3 A;  1MBY A;  4FF4 A;  2C9O A;  1CZW A;  3A0J A;  4DAM A;  3HRZ C;  2E8G A;  3U4V A;  1CA5 A;  4KHP Q;  5GRO A;  2MQH A;  2VNU D;  2UUC Q;  3N6R A;  3NEM A;  2MGS A;  1SE3 A;  3PIO A;  3HGB A;  3D4R A;  1X56 A;  1I6V C;  4XYQ A;  2KBN A;  3TZU A;  3A55 A;  4GOP B;  2L55 A;  1E24 A;  2D62 A;  1WTV A;  2R93 G;  1WTW A;  3N52 A;  4GOP A;  4LFB Q;  4Y52 H;  3A8K E;  3RZO B;  1EIF A;  2J0T D;  1ENA A;  3UE0 A;  3MZ5 A;  4AQY L;  2DN8 A;  5IGB A;  2KA7 A;  4GKK Q;  3KLS X;  4O1N A;  3HOU G;  4KI0 A;  2XGT A;  3S16 B;  1DM0 B;  5M5Y H;  3C1F A;  4XQN A;  2EYO A;  4POF A;  2EOT A;  1WJJ A;  2N8N A;  2HHH Q;  1T5E A;  1KD1 C;  1Y1V B;  4N9T A;  3RN5 A;  3KJO A;  4DK3 C;  3BZC A;  4HN7 A;  2B63 G;  5KNB A;  3RNU A;  1VQL A;  3B6Y A;  1H9S B;  1WVL A;  5JVG 3;  3HOY B;  1LAB A;  1H9S A;  2MO0 A;  4ZAI A;  2CW0 D;  1XNR L;  2QDL A;  1HNX L;  2NZH A;  1TWH B;  1VQ5 A;  2AQ1 B;  4DR4 L;  3C2P A;  3SK6 A;  3J80 i;  4M8A A;  1WD1 A;  1YHB A;  3GTM B;  1TY0 A;  1BBW A;  2K32 A;  4LK1 C;  1ASZ A;  1VQK A;  3KF6 B;  1Y14 B;  2F0E A;  4JI1 Q;  3URY A;  3KF6 A;  2Z0S A;  1ROD A;  4PMB A;  1KHI A;  3TRZ A;  4FNF A;  3TME A;  3TS0 A;  3BDO A;  3CF5 A;  4JVZ A;  4ULL A;  4A3L G;  4ABN A;  1OO9 B;  2NVQ H;  1YNJ C;  3R3O A;  1D5Z C;  3F2C A;  4HSP A;  4FO2 A;  5DNF A;  2MP1 A;  4G7Z C;  3PO3 G;  1MSG A;  3UDF A;  1C7Y A;  3S2H B;  5LL6 X;  4FF2 A;  1SYE A;  2AQ2 B;  1YHQ A;  4KN7 C;  1VQ4 A;  3PO2 H;  5AJ3 L;  5C4X G;  3CQZ B;  4ILW A;  3VR5 A;  1R4P B;  4A3M H;  4IPG A;  4GNX B;  1WTR A;  2L0C A;  2A6H D;  5FJ8 H;  5C0X H;  3CCL A;  3NQI A;  2E5L Q;  3GTP H;  4GNX A;  1BXT A;  4BBR H;  4TSS A;  3PSI A;  2NBF A;  4BWG B;  4HED A;  4IOC A;  4QL5 A;  1S5C D;  3PCO B;  5ELE A;  2NVT B;  4K6D A;  1Q82 C;  5BN3 A;  1K83 H;  4YHH Q;  1HR0 W;  4PNY A;  1EFI D;  1RTN A;  1D1I A;  4EQ5 A;  1Q1B A;  2NTT A;  4CDF C;  1GKH A;  4C3J B;  1LT4 D;  3J7A V;  5COR A;  4GN4 B;  4CDC C;  3I4M G;  1PFN A;  3ERQ A;  2R93 H;  4K0K Q;  3A7L A;  1XMQ L;  3SVM A;  2EYJ A;  4X3T A;  1UNS A;  1QWY A;  1HQM C;  4QF4 A;  4QIW B;  5LMN W;  1N34 Q;  4A3K B;  2RHS B;  3K80 C;  1QVC A;  1F2Y A;  1B9M A;  3GQB A;  3KDF B;  4B9X A;  2Z6B A;  3HOU H;  4HIM A;  1AP0 A;  2Z4I A;  3KDF A;  3U9O A;  4DAY B;  2ES2 A;  4RCO A;  1Q8K A;  1PYB A;  4DAY A;  4A76 A;  1PRT D;  3H15 A;  1SXT A;  3M3Y H;  1PYW D;  4KTA A;  3D6C A;  2ZTC A;  3EBE A;  2NVY H;  4LF6 L;  1EWI A;  1SNP A;  5IP7 H;  1I94 Q;  1VQF A;  1EY8 A;  2B63 H;  3R8B A;  1I4H A;  4KD3 A;  3HZX A;  1KDA A;  3ONA B;  1X3P A;  5DLQ E;  2PQE A;  4X3S A;  3FKI G;  3ERS X;  1EU3 A;  3EA6 A;  1B53 A;  4IN3 A;  4J1M A;  5IYD G;  3CPF A;  3I8Z A;  1UE7 A;  3NHH A;  5JOB A;  1J9O A;  5C44 G;  5IGF A;  1GM5 A;  2MFI A;  2Q2T A;  3G4S A;  1SLJ A;  1F77 A;  5EPK A;  3H94 A;  3PIP A;  4JV5 L;  1L2F A;  1WTX A;  2FFK B;  4A3L H;  4K5V A;  5M3F B;  4A3I B;  1J5E L;  4NXM L;  1X55 A;  1GUG A;  2B2Y C;  3ERO A;  3PO3 H;  5JPM C;  4U68 A;  4IPD A;  2K6A A;  1CM9 A;  3I90 A;  2KJX A;  4GLX A;  2LFN A;  5C4X H;  1E7Z A;  3BZK A;  5DEH A;  1V1P B;  1F2Z A;  1M4V A;  2K05 A;  1V1P A;  1R4Q B;  2B8F A;  5EKK A;  4X66 Q;  4A3E G;  3PUX A;  4GLA C;  1YNN D;  5EGT A;  2EYL A;  3GDE A;  2I5L X;  4DV6 Q; 
#chains in the Genus database with same CATH homology
 1SE4 A;  4IAL A;  4F8M A;  2ZT9 C;  5IOC A;  1Y69 U;  2F03 A;  1DXM A;  5BN4 A;  2PCF B;  4DGZ A;  4MHE A;  3ND8 A;  4WOR A;  5FLX E;  3DUZ A;  3MXU A;  1II3 A;  2Q8I B;  3UI2 A;  2L11 A;  1L0Y B;  3W2D A;  1TY2 A;  4KJO A;  2VUM B;  1FNU A;  2PZT A;  1XWE A;  5EJW A;  4ZUI A;  2B2V A;  1IYV A;  3SK5 A;  2R3Z A;  5CV9 A;  1L0X B;  1DOK A;  4F88 A;  3A56 A;  1DOL A;  1TQO A;  1GUT A;  1Y8O B;  5M3M B;  1FNW A;  3VYR A;  4QUF A;  1SYD A;  3EQL C;  2Z4H A;  4RHS A;  3SXH A;  3RMH A;  2EJG C;  2BDO A;  3NE5 B;  5EKI A;  3D3R A;  1W6K A;  1EZ6 A;  1E2W A;  1AEX A;  1ZYR D;  1KTK A;  3C1E A;  1LTB D;  1A3T A;  1TS3 A;  3S2D B;  4CKC A;  3NPP A;  2YYZ A;  2NN6 G;  4CJ0 B;  4RWS C;  4HMJ A;  4AYB B;  4N9P A;  2RSN A;  5BN5 A;  1S5D D;  4IUV A;  2WAQ B;  3LNN A;  1JC7 A;  2Z8L A;  2WII B;  3D4W A;  2AQ3 B;  1I4Q A;  3FPU B;  3LWE A;  3K5M A;  1SMY D;  3OIP A;  5FO8 B;  3OPO A;  1JIC A;  2F0M A;  1GOZ A;  1RKN A;  4FF1 A;  1H9J A;  3KBG A;  3M4O B;  5M9O A;  1ESF A;  1BO0 A;  2BDN A;  1TT2 A;  4FXK C;  1G8Z D;  1OXT A;  1RD9 D;  2XRS D;  3OW7 A;  4ID6 A;  1H9R A;  3OMG A;  3OSO A;  5K36 G;  2R6G A;  3A8I E;  3R2I A;  4YIJ A;  5M5W B;  1SEB D;  4Y7N B;  4K5W A;  1EOT A;  2ZXO A;  5I4D A;  3A8J E;  1MGS A;  3QOJ A;  1D5X C;  1BBX C;  5D14 A;  2R92 B;  1EWC A;  1G6Z A;  3TDQ A;  1U4L A;  2IL8 A;  4C3H B;  1Q12 A;  4L63 B;  1NAP A;  3NWS A;  1D6E C;  3EVQ A;  4DNT B;  4FXD A;  5F2D A;  1BCP F;  2H1E A;  4A3G B;  3ZYY X;  4H0L C;  4IFD I;  2L9H A;  2IX1 A;  1EZ8 A;  1BNZ A;  5G3L D;  3DMU A;  3HP3 A;  1DD2 A;  4CBV A;  3K6O A;  1JWM D;  4A93 B;  1PRT B;  3CRK C;  2F0W A;  1IW7 C;  2F0Q A;  2HQE A;  4H7B A;  2HDL A;  2J7Z A;  3BYY B;  3X3M A;  1CT1 D;  3O13 A;  4IZ8 A;  5CC4 A;  5KNC A;  1RTO A;  2IJ0 A;  4F7X A;  3SHL A;  4CGY B;  4XIG S;  3K58 A;  2JYO A;  1EY5 A;  3SK8 A;  1BF4 A;  4DN4 M;  4IFD G;  3VR3 A;  1HFG A;  2K7V A;  4RA8 A;  3OOC A;  1STB A;  2VXW A;  1OXS C;  1HUM A;  3P7J A;  1RF2 D;  3V2T A;  4ZLT F;  1MD2 D;  3VA5 A;  2O5I C;  3NUC A;  3PUV A;  1W6J A;  5JVH 3;  4R8N A;  2YU9 B;  4C3I B;  4DA2 A;  3VR4 A;  2SNM A;  1YNJ D;  2F0P A;  2NVQ B;  1PDQ A;  3Q24 A;  2XWB B;  5CV6 A;  5A35 A;  2M00 A;  2KCC A;  1S5F D;  3PO2 B;  1GUS A;  4A3M B;  3X3N A;  1LTT D;  3GTP B;  1C4Q A;  3J81 L;  1U4M A;  4ZKC B;  4FP5 D;  2IW3 A;  1ZEQ X;  3QOL A;  4OO1 I;  3WOE A;  2MJ8 A;  4CJ2 C;  4DU9 A;  3I3C A;  3MFY A;  1K83 B;  2B2T A;  1EWH A;  1HA6 A;  1G2S A;  1BCP B;  1BUV T;  2L4N A;  5J22 A;  2BCO A;  2R93 B;  4FVM A;  2EY6 A;  3VA7 A;  3FPP A;  5TSS A;  3MVV A;  3MEH A;  2XVS A;  4G4K A;  4OIK A;  3HOU B;  1ENF A;  3M7N A;  5C3W A;  3M3Y B;  4IFD H;  4NDX A;  4UDU C;  1K8O A;  3GD7 A;  3FMC A;  1AN8 A;  3QJY A;  2PPB C;  4RAU C;  2R7Z B;  1F9R A;  3LWU A;  5FOB B;  4RGO S;  2E75 C;  5LL6 S;  1SSO A;  3K7A B;  5ELB A;  1EYD A;  4G7O C;  5CBE E;  4V0B A;  1D5M C;  3D6W A;  3Q23 A;  4DAP A;  5CV7 A;  1PTO B;  1LLR D;  2F0G A;  5JEA G;  3SEB A;  4PV1 C;  2TMP A;  4UAI A;  2Q8R E;  3BDL A;  4LMQ D;  4RHR A;  1A2T A;  2E2J B;  4DXG A;  1X32 A;  3D8G A;  1LT5 D;  1LV9 A;  3GV3 A;  1I6H B;  1CI3 M;  1D1K A;  1ZXT A;  1DOM A;  3K5O A;  2JE6 I;  2JA5 B;  3BVZ A;  4QCL A;  5EPL A;  5CYU A;  4CJ1 B;  1RHP A;  4RH6 A;  3A54 A;  3NBH A;  4C56 C;  2B2V C;  2EY5 A;  2KOL A;  2AWN A;  2RVL A;  2L1B A;  4EVO A;  1KLU D;  5A2Q E;  3HS0 C;  1I4G A;  1JCK B;  3S15 B;  4PMC A;  3BDC A;  2G9D A;  3AB9 A;  2NVX B;  5KGU A;  5I2Y A;  3MXG A;  4G57 A;  1QG7 A;  2A69 C;  5IGC A;  5A2Q L;  1IL8 A;  3FKI B;  3W3A A;  1OXX K;  4KHV A;  1B3A A;  1PFB A;  1AFP A;  3Q6S A;  1XXG A;  5C44 B;  5KRU A;  5KIX A;  1JE4 A;  1B9N A;  2FJ2 A;  1Z6H A;  1IKM A;  2D5D A;  1HHV A;  3T16 A;  2K5W A;  1XYI A;  5JEA H;  2FIN B;  2ENB A;  1RCV D;  5HUR A;  1NCV A;  2WAC A;  1UAP A;  2AUJ D;  1SYG A;  2E74 C;  3KUP A;  2NUC A;  1SE2 A;  1VDZ A;  1IKL A;  5FO9 B;  2VB2 X;  1ILP A;  2I07 B;  3IAY A;  3BZD B;  3TP7 A;  4A3E B;  2AUK A;  2CW0 C;  4WFN 3;  1TU2 B;  2ZXP A;  4Z9C B;  2F0O A;  1Q3L A;  3Q0A A;  1G91 A;  2IPK D;  3T51 B;  2A6E C;  5AFW A;  3T4A C;  1EIH A;  1JR0 D;  3P75 A;  3T13 A;  3DM1 A;  3S1M B;  1EY6 A;  2ICE C;  5E4X A;  3U9S A;  1I4X A;  2NB0 A;  1QE6 A;  2L5T A;  3I91 A;  5M5X B;  3JAM E;  1TS4 A;  3TSS A;  4K2K A;  5FO7 B;  2O2L D;  5C6A A;  1JWS D;  1LTG D;  5J39 A;  2M9V A;  1FD7 D;  3NWT A;  3QG1 A;  4HTH A;  5I6W A;  2SEB D;  3C46 A;  2B2U A;  5FLX L;  5FK9 C;  4TKO B;  5E4W C;  1RJT A;  4Q0F A;  2QF7 A;  3H0G B;  1F2M A;  2A74 C;  4EGV A;  5IT9 E;  4GZY C;  1C8C A;  4X3U A;  2JEA I;  3TZD A;  2M2L A;  1M8A A;  3OMC A;  3DEP A;  4S3S A;  3MC0 B;  2CVR A;  1ENC A;  3K5N A;  4R8I A;  5E3F A;  1DZ1 A;  3J7A F;  1CHQ D;  1KAA A;  1PRT C;  1PRT F;  1ET6 A;  3NQT A;  3H6M A;  3PV0 A;  3BG3 A;  3MXN A;  5I2X A;  4OHJ A;  4XXE A;  4MIU A;  2IX0 A;  3GP7 A;  1IW7 D;  2F3V A;  1DJR D;  4J6H A;  4H13 C;  3V05 A;  1QOH A;  2LY7 A;  4A3F B;  2K5Q A;  2XSC A;  2PZU A;  1E2V A;  1K8M A;  2NWG A;  3D4D A;  1C48 A;  4DK1 A;  1JOQ A;  4IUP A;  3AMU A;  4NW2 A;  3TP6 A;  4BA1 I;  4TQU S;  4HMI A;  2DY7 A;  2F0L A;  1TS5 A;  3AU7 A;  4XT3 B;  4IFD J;  3S1R B;  4DF7 A;  2F0H A;  2SNS A;  5D3D A;  1HUN A;  1EYC A;  1SNC A;  4JBW A;  1T5X D;  1BR9 A;  2CQA A;  3TN2 A;  1LO5 D;  3I4L A;  2F0T A;  1O7Y A;  4K14 A;  3GTL B;  3HG9 A;  1O78 A;  5T1G A;  5D3I B;  1Q90 A;  3GTK B;  2EYM A;  2IWH A;  2O4X A;  1MSH A;  5EPJ A;  3J80 E;  1SNM A;  4KHZ A;  2V4D A;  4LAA A;  2B2T C;  2JXM B;  1A2U A;  3HOZ B;  3T56 B;  1KNE A;  2BOS A;  1BCP C;  3S14 B;  4RKL A;  3V96 A;  4B9W A;  3ND9 A;  3DHQ A;  5CR3 A;  4F87 A;  1NUC A;  1J8I A;  2MUY A;  1DYQ A;  3VYT A;  1CQV A;  3NP8 A;  3S17 B;  3G6J B;  2FMC A;  4BS9 A;  4EQN A;  2RSO A;  1O80 A;  1WCM B;  3QB3 A;  2DNC A;  1S5B D;  3E6Z X;  3L7Z C;  2WP8 J;  1PZK D;  4FF3 A;  3I73 A;  4M1U B;  3RD4 A;  1FYC A;  2LMC B;  4IQZ A;  3DWP A;  4R9W A;  1D2B A;  2F0I A;  1ZYR C;  2RDF A;  3NXW A;  5JPN C;  2QEJ C;  2F4I A;  5EBC A;  2SOB A;  3GV6 A;  1LT6 D;  2FMM A;  2F0S A;  5M5Y B;  3OHX C;  3EJI A;  1PMR A;  2K01 A;  5C5M A;  1KDB A;  1PTO C;  3CU7 A;  1ML0 D;  2X6G A;  1PTO F;  1EU4 A;  4DK0 A;  4OIJ A;  3GO5 A;  4DXF A;  4KMU C;  2HCC A;  4K6L A;  1Z47 A;  3MXP A;  4RFB A;  1ILQ A;  1SBB B;  1SDF A;  1EY4 A;  1QB5 D;  2MHV A;  3LX0 A;  1SMY C;  1H9M A;  1LT3 D;  5IGG A;  1B44 D;  1AZP A;  3T53 B;  2KEC A;  2WIN B;  4PMW A;  4A3B B;  2EYH A;  2K1B A;  1EYA A;  2NZ1 D;  5CMD A;  5JEA J;  1GJX A;  4B08 A;  2K03 A;  2DNE A;  1SYB A;  3RLF A;  4XDX A;  1SNO A;  3NSW A;  2IT1 A;  4XYO A;  4RCN A;  1B4O A;  2A68 C;  5ELF A;  3NK9 A;  2AWO A;  4C3I G;  4BBR B;  3GTO B;  2XNA C;  1F9P A;  4JK1 C;  1H9K A;  4XQJ A;  1Y8N B;  5DM6 3;  3NTH A;  1A6X A;  2KHS A;  3K0Y A;  2H4O A;  2RDG A;  2EY2 A;  4KY7 A;  2XN9 C;  4K2L A;  2B2W A;  1FR3 A;  2ZXR A;  5C4Z A;  5C5L A;  4HR7 B;  2PYK A;  1V1O A;  3VYU A;  4CHT B;  1I4R A;  4TRD A;  4ME5 A;  2LS0 1;  1OXU A;  1S5E D;  2BA0 A;  2F1M A;  3I4N B;  2F0K A;  5C4H A;  2A69 D;  3SE0 A;  1I3Q B;  1F2L A;  2EPB A;  5DAU A;  5G3L F;  4RGM A;  5I6Y A;  1O7L A;  2NVY B;  1ET9 A;  1FNV A;  5E1F A;  3S9W A;  2B63 B;  4OO1 G;  1S4Z A;  3E5S A;  1CQF A;  3VR6 A;  4DFA A;  5FKA C;  1SNQ A;  1SJE D;  2CHB D;  5ELC A;  2OF1 A;  3CRL C;  5EQ0 A;  5CBA E;  1EY0 A;  4KKT A;  1A15 A;  3TBI B;  3P20 A;  3OWF A;  1VCI A;  4EQP A;  1Y1W B;  2PW5 A;  1HFN A;  1B1Z A;  1JOO A;  4H44 C;  3PO3 B;  3I70 A;  3L9A X;  2N55 A;  3VYS A;  1HQR D;  3BS1 A;  2RA4 A;  5C4X B;  1BOS A;  2F0U A;  3KLS A;  2F0V A;  1TR5 A;  3KLR A;  2A6E D;  4RKB A;  1HA5 A;  1ONL A;  1EIG A;  4KKU A;  1JQY D;  2DY8 A;  1B50 A;  2IX3 A;  3E0J A;  2QKI C;  1LAC A;  3PIO 3;  2PNR C;  3BVG A;  1HRJ A;  5EKL A;  2NYZ D;  4RGN A;  2R61 A;  5I9O A;  1SYF A;  4FYD A;  3I4M B;  1CK1 A;  4C2M B;  2WB1 B;  4OL7 A;  3NBI A;  2B2U C;  3M7G A;  2K28 A;  1ESR A;  4QUC A;  4I65 A;  4KK7 A;  5J1Z A;  1LTA D;  3MHB A;  2PW7 A;  2A5H A;  2XWJ B;  3H91 A;  2RKS A;  1Q1E A;  3VR2 A;  3K57 A;  2BE5 C;  5LHY 1;  4K8I A;  2X69 A;  3FEW X;  3NTK A;  1WTP A;  2LKV A;  4OO1 H;  2JSO A;  2KVM A;  3SDZ A;  2VB3 X;  5NUC A;  4C3J G;  1STA A;  2GA4 B;  5KYL A;  1PZJ D;  3H09 A;  4HAE A;  1O7Z A;  2C5C A;  5C4J B;  4BBS B;  1TWF B;  1Q8I A;  3K5L A;  4NKL A;  4K8J A;  3RUZ A;  2RDH A;  1E0B A;  5I9P A;  1CZG A;  2F0J A;  2PMZ B;  3MA2 B;  4KJN A;  4HCE A;  1EQV A;  1NR4 A;  1GUO A;  3DEO A;  3K59 A;  1VF5 C;  1STY A;  1STH A;  5CV8 A;  4ZQ3 A;  1ICW A;  1UUP A;  1U9R A;  1UEA B;  1NR2 A;  4ZK9 B;  1KLG D;  1NSN S;  1TWC B;  5CV4 A;  1PTO H;  1HXY D;  1Y8P B;  4IUQ A;  3KBX A;  5IOD A;  1DCZ A;  2HCI A;  1FGB D;  5KND A;  2RBM A;  1HTL D;  4KY6 A;  3TP5 A;  1WD0 A;  3R2T A;  3QIA A;  1EY7 A;  3CKI B;  4O42 A;  3OWE B;  2XRQ D;  2PZW A;  4HSV A;  3HKZ B;  1GXD C;  1KDC A;  4L6T B;  1R9T B;  3IFD A;  5C3X A;  3BYT B;  3M85 A;  2XIW A;  1A3U A;  3MFG A;  1QNK A;  2A6H C;  2KEE A;  1V43 A;  5IGD A;  4MN3 A;  1JWU D;  4FXG C;  4ZRZ A;  2RQX A;  3HOX B;  1HPC A;  3M4Y A;  1TWG B;  5T1I A;  1LTI D;  4BA2 I;  2EJF C;  3JAM L;  3DXJ C;  4IUU A;  4KV6 A;  4ODG A;  4PQX A;  5ISR A;  2QDB A;  4RGT A;  1VMC A;  2N88 A;  1A3V A;  1I4P A;  2X6L A;  3GTQ B;  3ITP A;  3KK7 A;  2O5J C;  1CTM A;  3QWN A;  3PIP 3;  2WKD A;  2OT2 A;  1SJH D;  1BCP D;  2Q8T A;  2HDM A;  2Y0S B;  4HCS A;  1TS2 A;  1X3Q A;  1I50 B;  2NN6 I;  4L8J A;  3F2U A;  3HOW B;  2E2H B;  2B39 A;  1RDP D;  5IT9 L;  2G9H D;  3WOF A;  1F9Q A;  4CKE A;  4XTC S;  2K33 A;  5HGT A;  5ELD A;  2JA8 B;  2EXZ A;  3SR1 A;  3PMF A;  3A7A B;  4KD4 A;  1G2T A;  5IGE A;  1CHP D;  1QJO A;  4WRD A;  4C1N K;  1V8Q A;  4KY5 A;  4ZUJ A;  3HOV B;  3MTS A;  3H3V C;  1TVX A;  1SFO B;  1B2T A;  4KN4 C;  4X3K A;  3S1Q B;  1GHK A;  4DAV A;  3FVQ A;  1SND A;  3G7L A;  4XT1 B;  1PTO D;  2JA6 B;  2D2C C;  2SDF A;  3DWQ A;  1PFM A;  2JEB I;  2E2I B;  2B2Y A;  1GUN A;  5C3E B;  3PUY A;  2I46 A;  1LTS D;  1PXU A;  5K5P A;  1YNN C;  2K04 A;  4IUT A;  3KF8 A;  1G29 1;  3PUZ A;  5JAV A;  4Q5V A;  2PO4 A;  1STN A;  4E6I A;  1BQQ T;  1TII D;  4I7Z C;  2F3W A;  1DON A;  5KEE A;  2KED A;  2B8G A;  1SYC A;  1JB3 A;  4KKS A;  2QIL A;  3NTI A;  5COY A;  2EJM A;  5CGK A;  4J8Q A;  4QB4 A;  2F0F A;  2A68 D;  2OEO A;  3J7Y W;  4IUN A;  1GUW A;  3BVM A;  3P1H A;  1TWA B;  4LJZ C;  4BY7 B;  2B2W C;  2JP1 A;  3IL8 A;  3J80 L;  4BY1 B;  1IYU A;  4A3J B;  1XX8 A;  1OXV A;  3GTG B;  1STG A;  1QCB D;  4A3D B;  2OXP A;  2HUG A;  2ID0 A;  2A73 B;  1EL0 A;  3FRP B;  3FDT A;  1TKW B;  4C1N I;  4C3H G;  3TP8 A;  1CFM A;  2KUM A;  2TSS A;  4OGQ C;  1VF7 A;  5DM7 3;  2EDG A;  2KCN A;  1KAB A;  5C0X J;  2D9U A;  2FHT A;  3HEJ A;  1LTR D;  4WJW A;  1U4P A;  2NN6 H;  4CKB A;  3L3O C;  1WTO A;  2Z1C A;  3C3L A;  5IIF A;  3IKJ A;  1QNU A;  1KNA A;  1Z7T A;  3I72 A;  2EVB A;  5CV5 A;  1SAP A;  1EQT A;  3R93 A;  1AW7 A;  1JOK A;  5JJZ A;  2QCP X;  1WTQ A;  4DNR B;  1JOR A;  2EZV A;  4K5X A;  2KQ3 A;  3MWY W;  5EBD A;  1HCZ A;  3CHB D;  1E2Z A;  2EE1 A;  4EQO A;  1MI2 A;  1EY9 A;  4P2C B;  1GHJ A;  3IFT A;  2EYP A;  1STE A;  3RZD B;  2ICI A;  5K36 H;  2BA1 A;  2NTS A;  2JA7 B;  4V19 0;  5C0X I;  3S1N B;  1PZI D;  2F0D A;  4G7H C;  3WDN A;  3Q22 A;  1EEI D;  2EYF A;  5D65 A;  4ZYS A;  2EY1 A;  3EFX D;  1XTC D;  3SK4 A;  4U67 3;  2L12 A;  4XQQ A;  2WV6 D;  4IUR A;  4QMG A;  1CA6 A;  1ZKO A;  3MAQ A;  3DWA A;  3GTJ B;  3J81 E;  1AZQ A;  1VMP A;  2K5D A;  2WKC A;  1IHZ A;  1HTP A;  5KYI A;  4NMZ A;  4NP5 A;  2J4X A;  2MPM A;  2E2D C;  1EEF D;  4ZKB B;  2E76 C;  5C0X G;  1F9S A;  1BDO A;  2BE5 D;  3QO2 A;  1QIL A;  1PLF A;  3PUW A;  1U4R A;  2F0N A;  3OIQ A;  3D31 A;  1MBY A;  4FF4 A;  2C9O A;  1CZW A;  3HRZ C;  1CA5 A;  2VNU D;  3N6R A;  2MGS A;  1SE3 A;  3HGB A;  3D4R A;  1I6V C;  4XYQ A;  3TZU A;  3A55 A;  2L55 A;  2D62 A;  1WTV A;  1WTW A;  3N52 A;  3A8K E;  3RZO B;  2J0T D;  1ENA A;  3MZ5 A;  2DN8 A;  5IGB A;  2KA7 A;  3KLS X;  4O1N A;  4KI0 A;  3S16 B;  1DM0 B;  3C1F A;  4XQN A;  2EYO A;  2EOT A;  1T5E A;  1Y1V B;  4N9T A;  4HN7 A;  5KNB A;  1H9S B;  1WVL A;  5JVG 3;  3HOY B;  1LAB A;  1H9S A;  4ZAI A;  2CW0 D;  1TWH B;  2AQ1 B;  3C2P A;  3SK6 A;  4M8A A;  1WD1 A;  3GTM B;  1TY0 A;  2K32 A;  4LK1 C;  2F0E A;  3URY A;  1ROD A;  4PMB A;  4FNF A;  3TME A;  3BDO A;  4ULL A;  4ABN A;  1OO9 B;  1YNJ C;  3R3O A;  1D5Z C;  4HSP A;  4FO2 A;  5DNF A;  2MP1 A;  4G7Z C;  1MSG A;  3S2H B;  5LL6 X;  4FF2 A;  1SYE A;  2AQ2 B;  4KN7 C;  3CQZ B;  4ILW A;  3VR5 A;  1R4P B;  1WTR A;  2L0C A;  2A6H D;  5C0X H;  3NQI A;  1BXT A;  4TSS A;  2NBF A;  4BWG B;  4HED A;  1S5C D;  5ELE A;  2NVT B;  4K6D A;  5BN3 A;  4PNY A;  1EFI D;  1RTN A;  1D1I A;  1Q1B A;  2NTT A;  4C3J B;  1LT4 D;  3J7A V;  5COR A;  1PFN A;  3ERQ A;  3A7L A;  3SVM A;  2EYJ A;  4X3T A;  1UNS A;  1QWY A;  1HQM C;  4QF4 A;  4QIW B;  4A3K B;  1F2Y A;  1B9M A;  3GQB A;  4B9X A;  1AP0 A;  2Z4I A;  3U9O A;  4RCO A;  4DAY A;  1PRT D;  1SXT A;  1PYW D;  4KTA A;  3D6C A;  1SNP A;  1EY8 A;  3R8B A;  1I4H A;  4KD3 A;  3HZX A;  1KDA A;  3ONA B;  1X3P A;  2PQE A;  4X3S A;  1EU3 A;  3EA6 A;  1B53 A;  4IN3 A;  4J1M A;  3I8Z A;  3NHH A;  5JOB A;  1J9O A;  5IGF A;  1F77 A;  5EPK A;  3H94 A;  1WTX A;  2FFK B;  4K5V A;  5M3F B;  4A3I B;  1GUG A;  2B2Y C;  3ERO A;  5JPM C;  4U68 A;  2K6A A;  1CM9 A;  3I90 A;  2KJX A;  2LFN A;  5DEH A;  1V1P B;  1F2Z A;  1M4V A;  2K05 A;  1V1P A;  1R4Q B;  2B8F A;  5EKK A;  3PUX A;  1YNN D;  5EGT A;  2EYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...