5E4WC

Crystal structure of cpsrp43 chromodomains 2 and 3 in complex with the alb3 tail
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
105
structure length
105
Chain Sequence
QVFEYAEVDEIVEKRGKGKDVEYLVRWKDGGDCEWVKGVHVAEDVAKDYEDGLEYAVAESVIGKRVGDDGKTIEYLVKWTDMSDATWEPQDNVDSTLVLLYQQQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for cpSRP43 chromodomain selectivity and dynamics in Alb3 insertase interaction.
pubmed doi rcsb
source organism Escherichia coli o157:h7
molecule tags Transport protein
molecule keywords Thioredoxin-1
total genus 16
structure length 105
sequence length 105
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5e4wC02
1LV9A 1WTVA 3GV3A 1SDFA 4CJ1B 4HSVA 2RVLA 2NYZD 1NCVA 4QUCA 1HFNA 3FDTA 1JE4A 1RJTA 2FINB 1TVXA 2JYOA 1NR4A 2L12A 1EIHA 1MSGA 3HP3A 4XDXA 1WTRA 3DEPA 1S4ZA 5AFWA 1HUMA 2BDNA 4OIKA 1WTWA 1AZQA 1RODA 2XIWA 2HCCA 1U4MA 1WTOA 2CVRA 2J7ZA 2B2VA 3H91A 5D65A 2HDLA 4R9WA 1O80A 4ZK9B 3TN2A 1WTQA 1WVLA 4MHEA 4XT3B 3MTSA 5T1GA 5CBEE 2L9HA 1G6ZA 1HHVA 2HCIA 5E4XA 3SVMA 3GV6A 5JJZA 2B2UC 3DM1A 2EPBA 1JICA 5EPKA 1J8IA 1O7YA 4IUPA 4X3TA 2Q8TA 2JP1A 1KNAA 1IKMA 4ZAIA 2KEDA 1ESRA 2KOLA 3FPUB 2Q8RE 3TZDA 1F9PA 3KUPA 2FJ2A 1WD1A 1EOTA 1WTPA 2B2TC 1XX8A 3I91A 1PFBA 1Q3LA 2K03A 3UI2A 2D9UA 5EKIA 3MWYW 2H1EA 4ZKCB 1VMCA 1AZPA 1RHPA 2X6GA 2EE1A 1ILQA 2M2LA 2DY8A 5EQ0A 5DNFA 2R3ZA 2MJ8A 4ZKBB 4UAIA 1QG7A 5EJWA 1G2TA 2B2UA 1X32A 1U4RA 1HFGA 2VXWA 1XYIA 1IL8A 2RA4A 1EQTA 3N52A 1DOMA 1BO0A 1F9SA 1DOLA 3QO2A 5CMDA 3F2UA 1J9OA 2HUGA 2KVMA 4RA8A 4QUFA 1NR2A 1MI2A 4RWSC 4IUVA 5EPJA 1SSOA 4DN4M 4CJ0B 2B2YA 1F2LA 1EL0A 4X3KA 3IL8A 2DY7A 1GUWA 4O42A 1RTOA 1BNZA 2KEEA 1RTNA 2RSOA 2RSNA 2NZ1D 3DEOA 1PFMA 1DONA 1CA6A 1M8AA 1NAPA 3I8ZA 4X3SA 2MP1A 1CA5A 1IKLA 2EOTA 4IUTA 1DZ1A 1DOKA 1VMPA 2B2TA 3G7LA 2L1BA 4HEDA 1QE6A 3Q6SA 2NWGA 2SDFA 2FHTA 2K28A 1E0BA 1ML0D 1F9QA 1B4OA 1U4PA 2X6LA 4OIJA 5COYA 4LMQD 1O7ZA 1HUNA 5E4WC 2K05A 2K01A 1SAPA 1C8CA 2L11A 4X3UA 3I90A 5D14A 2B2VC 1CM9A 1MSHA 2K04A 2KECA 4HAEA 4NW2A 1QNKA 2X69A 1F9RA 2N55A 5CBAE 1PDQA 1B2TA 4IUQA 2MPMA 1HRJA 1PFNA 4XT1B 1ZXTA 4IURA 1X3PA 4MN3A 3R93A 2N88A 4ZLTF 2K1BA 2B2WC 4R8IA 2FMMA 3KBXA 3D6WA 1BBXC 1X3QA 2IL8A 1ICWA 2HDMA 1WD0A 1ILPA 2B2YC 1U4LA 1G2SA 5EPLA 2MGSA 4CJ2C 3P7JA 1EIGA 1A15A 2L4NA 3I3CA 1B50A 5T1IA 3ONAB 1AP0A 1B3AA 3IFDA 1WTXA 1KNEA 4HCSA 1B53A 1HA6A 4IUUA 3LWEA 2B2WA 2KUMA 4U68A 1G91A 1BF4A 4RAUC 5CORA 1MGSA 1PLFA 2FFKB
chains in the Genus database with same CATH superfamily
1LV9A 4G7HC 1WTVA 4HSPA 1YI2A 4Y52H 2UU9Q 4IFDH 1S5CD 5K36G 2QEXA 1GKHA 3FDTA 5M9OA 2JYOA 3NENA 4G57A 3ULJA 1HA5A 1H9SB 5D65A 3EBEA 4DA2A 3HOVB 3NUCA 3E9IA 3IKJA 2C35B 5CGKA 1TWHH 3C1EA 2D62A 2Z0SA 3A7LA 2F3WA 4DR7Q 2A69C 2F0HA 4IUPA 3CPFA 3CCJA 3O13A 1KRTA 1SE3A 5LL6X 1HR0L 1FYCA 1HXYD 1V1PB 1W2BA 1ZEQX 4J1MA 2DNEA 4OWTB 4KD4A 1IBKQ 2I46A 3RLFA 2E75C 1PH5A 4KY7A 2ALYB 3TS0A 5C3WA 1SEBD 2B2UA 1EU4A 2JA7B 1KLGD 3CKIB 2UXBL 4BXXG 1DGSA 2F0MA 2F4VQ 5M5WH 3ER0A 5IWAQ 2CW0C 1J9OA 1E2WA 1VQ8A 4DK0A 3GTKH 2DNCA 3KJPA 4K5WA 4O0AA 4EQNA 4IQZA 4MZ9A 5KYLA 3PUVA 5CV7A 1JT8A 4OONA 4IPGA 2NZOA 4KJNA 1SROA 3TDQA 3VR5A 2X6LA 3GD7A 3GQBA 4KLKA 4A3GB 2ZJRA 1BUVT 2NVTH 4CKCA 3TS2A 3PO3B 2R7DA 4LUZA 5A2QL 4HIOA 2E5LL 4ABNA 1QNKA 3NWSA 1B2TA 3H0GG 1HRJA 2VL6A 4U673 1RDPD 2K5NA 5IYBH 1B9NA 2UUBL 1E22A 1QJOA 2MGSA 1G51A 4A3LG 2JA8G 2DJGC 5J1ZA 4RH6A 5C0XI 3FHWA 2R92H 4U68A 3V96A 3DXJC 4NB3A 5HGQA 2KCMA 1FNWA 5CV6A 2FXQA 3D0FA 3CCRA 1LTAD 2MO1A 1RJTA 1ASYA 1TVXA 2R93G 1VQEA 3P75A 1IBML 3HP3A 5JJKA 5GROA 4AYBG 1A8VA 2IX0A 1L0YB 4C1NK 4ZK9B 4PMCA 3GDEA 1WVLA 2F0EA 3MTSA 4DV6Q 3Q22A 4DF7A 4C3JH 2BH8A 2A68C 1X3EA 2A6HC 5LMNL 1XMOQ 3J81i 4RFBA 1EY6A 1V9PA 4JI0Q 3ND8A 4UY8C 1KDCA 5CV9A 4JV5L 1AH9A 4OO1I 1ONLA 2KOLA 2EY6A 3KUPA 1XNRQ 1ENAA 4DPGA 1EOTA 5EGTA 4DV2L 2K03A 1PRTD 3UI2A 1OXVA 4ZKCB 2K14A 1PZKD 2JA5B 1IYJB 4DAYB 5BN3A 3K7AB 2XTIA 2VY3A 4YHHL 3JC66 2HHHQ 5ELDA 4LF5Q 4GOPB 1WYDA 2ZJPA 1M1KC 3IL8A 4GLAC 4A75A 4DV1L 4HJAA 1M8AA 3J81E 1DZ1A 5CYUA 4IUTA 3N6RA 3SDZA 1UUPA 4J6HA 3G7LA 1PH1A 1QE6A 2SEBD 2VS1A 1HNWL 3RN2A 3PIOA 2UXBQ 3RZOB 1ASZA 1R9TB 1Q46A 2LY7A 3UDIA 2GN5A 3GTQB 1BOSA 3I90A 2RF4A 3U4VA 1L1OC 1MSHA 2QGQA 4UHVA 3S1RB 4MTKA 3STBC 1XXGA 3M3YH 2RDHA 2ZXRA 1AE3A 1PH9A 3KBXA 1Q8KA 1TU2B 1U4LA 4CJ2C 2VW9A 5FJ8G 4TRDA 2Y0SB 2AUKA 1Y1WH 2QEJC 4IUUA 2AHOB 1CQVA 1TS5A 4OL7A 4G4KA 1QVGA 1GUOA 2RVLA 2XRQD 1HFNA 1JE4A 1ET9A 1K8MA 1MSGA 2ICEC 4ME3A 1NY4A 3HOYB 5D3DA 4M8AA 3K59A 1E2ZA 3S2DB 5JPMC 1TWFH 1EQVA 1PYBA 3E9HA 5M3FG 1N32L 3KYHC 1I50B 1QILA 1EIYB 3K81C 3GTLB 4JI2L 3HOXH 2QDBA 1A63A 4P74A 5IYCG 5M3MG 2EJMA 4WJ3M 5JAVA 3T56B 2MNAA 2JP1A 2EIFA 3TZDA 4CKBA 4GNXB 1I94Q 3S16B 3CRLC 1SJED 1UE1A 5EKLA 2YTVA 1KXLA 1S5DD 3HOWB 2D9UA 5EKIA 1SNQA 1R9TH 1VS0A 4A3DH 1QCBD 4KN4C 4B3SQ 4DAMA 2N78A 5JJLA 2VUMB 1L1OB 4YY3Q 3AFQA 4DU9A 3K5OA 1EQTA 4IFDG 4L6TB 1IHZA 2KQ3A 2Q2IA 3BVGA 1YEZA 5GAEC 3I56A 3OWEB 4O42A 5M3MH 4KHPL 4ILWA 3PO3G 3K0XA 1YHQA 4BBRH 1YBYA 4DV3Q 1DJRD 2V1CC 1PTOB 3I55A 2EYFA 4LFBQ 1O7IA 1E0BA 4KKSA 1YJWA 3HEJA 4HMJA 3HOWH 2F4VL 2EYMA 2ZTDA 4FF4A 2JQOA 3K57A 2IW3A 3S16H 2JA6H 4HAEA 5NUCA 1I3QB 1V1QA 3VA7A 4BY7H 2Q2UA 3PIO3 3DWPA 3RMHA 3R93A 4IPDA 1V1OA 1HR0Q 1UEAB 5M5XB 3MEFA 3F2CA 3I3CA 3RLOA 3U50C 3H0GB 3S2DH 5G3LF 2KUMA 3S14B 3RNUA 5CORA 3ERQA 1LTSD 5FLMH 3S1QH 3PCOB 3K0YA 4JYAQ 2EYHA 4RCOA 3I4NB 2GA4B 4IALA 2VNUD 2A68D 2FINB 4EQOA 1TT2A 1C7YA 1HUMA 1KDAA 1GHJA 4DV7Q 2PMZB 5ELEA 1WTOA 1LLRD 1BQQT 5C3EB 1YIJA 1Q1EA 2Y0SG 2HT1A 1OXUA 3J7AF 1YNJC 1WTQA 3UDXA 5IGBA 4MHEA 3T51B 1NTGA 1IBLQ 5IIFA 4BY1H 3DLLA 4A3LH 4BY1B 5I6WA 1PHJA 2E2JH 4DUYL 3S1RH 3X3NA 2PNHA 3KF8A 2ZXOA 4MIUA 1S5FD 5JJIA 3TSSA 1S40A 4LFAL 2ATWA 2OTJA 2CWAA 4ZRZA 1N34L 1S3OA 4JI5Q 2BE5D 3MEHA 2ZM6Q 3VR4A 4A3KH 4JI6Q 1SNCA 2CFMA 4HMIA 1V1PA 3MFGA 2EY1A 3EJIA 5CC4A 2OXPA 3PF5A 2UUAL 4I7ZC 4P73A 5I9PA 1WOCA 3KLSX 2CH4W 3GTOB 4LK1C 5C0XH 2OWOA 2K4KA 1VDZA 3KDFA 3I8ZA 2UU9L 1IKLA 2EOTA 2F0UA 4KHZA 4UP8A 4JC0A 5IGGA 4A3BG 2L1BA 4ZUIA 3PO2G 1X3FA 2KHJA 3PUXA 2F0WA 1XTDA 3G6JB 2K05A 1SAPA 2MO0A 3CC7A 5D14A 3E6ZX 3JAMc 4GLVB 2JXMB 2KECA 5CR3A 5E1FA 2GVAA 5IGCA 1OTCA 4OX9L 2BH2A 1Q12A 3MZ5A 1PTOH 1ZXTA 3K5LA 1FVIA 2IJ0A 3SK8A 2ZJQA 3NEMA 4FXKC 1XWEA 2F3VA 2OT2A 3T1HL 1FJGL 4K5VA 1NUCA 4DR7L 1ILPA 1A62A 2FMCA 3ONAB 4C3HG 2JK8A 2AQ2B 3D4DA 1B53A 1S5ED 2XWJB 3A8KE 3SK5A 2YYZA 4B3RL 1IW7D 2JEAI 1EY9A 3NTIA 3PV0A 2NN6G 3J80c 4QUCA 2UXDQ 4QGUA 1I4PA 2EXDA 1FR3A 2O4XA 1HQRD 1CQFA 4A93G 3A8JE 1EIFA 2VZAA 4WRDA 1Y69U 1EFID 1ENFA 1CKNB 2EJGC 4CDFC 1EY0A 1PRTB 3AU7A 4TQUS 4NXNL 4DR5Q 3ULLA 1HHVA 4QB4A 1TKWB 2HCIA 1Z7TA 1Y8PB 1W6KA 2K32A 3I4NG 1JICA 4X3TA 4AQYQ 3M7NA 1KNAA 4X62L 4DAPA 1N8RC 1K0RA 4JV5Q 3I91A 1TS3A 2EE1A 4K2KA 5DNFA 1TY0A 3PMFA 5IYDH 1X6OA 1CT1D 1LUZA 2CKZB 4X65Q 1O78A 4L5RC 2VB3X 1SXTA 2R7ZB 2OQ0A 3G6EA 4QUFA 4LF8L 4IFDI 5C4XB 2D0OA 2RDGA 2LXJA 3HOYH 2AQ3B 3PUZA 3U4ZA 4X66Q 4H13C 5IYDG 2K5QA 3M7GA 4NXML 1JB3A 4MTNA 4A3IG 1MD2D 3WWVA 4N9PA 3ITPA 3J81c 1FNVA 2FHTA 5M5YH 1I6HH 2KJXA 4LF7L 2XWBB 3RD4A 1E2VA 4UDUC 1Y1WB 4K0KL 2Z6KA 2IX1A 4XQNA 2SNSA 3RZOH 5LMUL 1SMXA 2A1AA 1K8OA 1IYUA 1EY8A 2JEBI 1VQNA 4L5TA 4XYOA 3AB9A 2B2WC 2FMMA 3FKIG 4A4IA 2HDMA 4CDCC 3KLSA 4AYBE 3HOVH 4FVMA 1N33L 5F2DA 4BS9A 1IYVA 1A15A 5C0XG 5C5MA 4APVA 2PYKA 4R4CA 3KLWA 1WTXA 3J7ZC 3NTKA 1UEBA 1GUNA 1A3VA 2PPBC 3SEBA 1K3RA 3FP9A 1JB7A 2A8VA 1NR4A 3C46A 4ZQ3A 5IOCA 3NBIA 3CMEA 1LT4D 3J80i 3NTHA 1JJCB 2XNAC 2A5HA 1NE3A 4RG1A 2E2IB 1VQBA 2JE6I 4C56C 1I4GA 1NSNS 1AW7A 1CHQD 2K6AA 5J39A 3BS1A 2F03A 2G5DA 1SFOB 4C3IG 2HIXA 2EY2A 3MHBA 2Q8TA 1X54A 1PTOD 2Y0SE 3HS0C 4DV4L 4R4IA 1HZCA 3RUZA 2VQEL 3SHLA 3A74A 2NVQB 3CCVA 1NMFA 1U0LA 1JE5A 3E0JA 2A73B 1U4RA 3G48A 4BXXH 3EA6A 2RHQB 2ZT9C 4A3CH 1N32Q 1DOLA 3QO2A 5CMDA 3MFYA 2EZVA 1PYSB 4G7ZC 2F0FA 4RKBA 1C9OA 2O5JC 4WJWA 4POGA 1L0XB 3NQIA 5C4XH 1GUWA 5G3LD 1BNZA 2KEEA 2RSOA 4XQQA 4A3MB 4F87A 1F2ZA 1D1IA 1CA5A 2AQ1B 3GTMB 1VQKA 1G6PA 4B08A 4OIJA 2QDLA 3J7YW 3C1FA 3V2TA 3EVQA 3GTJB 4GN4B 4OGQC 2E2DC 1D5MC 4A3FG 1K28A 5ELOA 1K3BC 1GM5A 1KIXA 2X69A 4DR3Q 4UP9A 1EWHA 2A6ED 2IHEA 3EIVA 2A6HD 1SE8A 1WI5A 3KOJA 4J15A 4DR2Q 4A3IB 1EIGA 3BDLA 2L4NA 1B50A 1Q82C 2Z8LA 1SNOA 4N8FA 5IGEA 4DV5L 3BYYB 5C0XJ 4ULLA 5KNDA 2R93H 4FDBA 3OMCA 1SYCA 4EQPA 3VYRA 4DXFA 1HNXL 1BCPB 3S1NH 5IYCH 3VR3A 1M90C 3UE0A 1BBWA 3OHXC 4XDXA 4GNXA 1S72A 5AFWA 1GJXA 4KY5A 5DLQE 1G8ZD 3PGZA 2YTXA 4NKLA 1I4QA 3L9AX 1EOVA 2JA8B 5JPNC 3K58A 3LX0A 3DMUA 2L9HA 3SE0A 1YNJD 3CU7A 5EBDA 4JI8Q 3J80E 2EVBA 2AUJD 2VUMH 1H9MA 4QL5A 2B2UC 3T1HQ 1DM0B 1O7YA 1BXTA 4EVOA 4L5SA 5D3IB 4JI7Q 4ZCKA 1D5XC 1I5FA 3FPUB 3M4PA 4DV2Q 2WINB 1XJVA 1J6QA 1SE2A 5ELCA 1VQJA 3I72A 4TKOB 1I6HB 3BDOA 4B3TQ 1H95A 1WFQA 1TWHB 4GKKL 1I4RA 1YNND 3I73A 4LFCQ 1SYGA 3W1GA 2RA4A 1VQ5A 1I50H 2HD3A 3D3RA 2UXCL 3MXUA 2PMZE 3EN2A 3ND9A 4X3KA 4NXMQ 3QWNA 2OCEA 3GTPH 1LACA 4PQXA 3HOXG 3M9BA 3IAYA 1JC7A 2XVSA 4DV0Q 1DONA 3T1YL 2VQFQ 2WP8J 3S1NB 1O7LA 1QUQA 1B70B 4X3SA 1RF2D 3U9OA 5AJ3L 2HIVA 1E1OA 4BWGB 2B3GA 2L11A 5LHY1 4FF3A 1GHKA 1HR0W 3STBD 4JI4Q 4WORA 3W1BA 1QVFA 1F9RA 1LT6D 4EQ5A 5KNBA 1HZ9A 1NJIC 3PIP3 3W3AA 4A3KB 2GVBA 4A3MG 1UAPA 1BBXC 2G9HD 1X3QA 1PTOC 1G2SA 2K5HA 1FL0A 4B9WA 2XSCA 2OEOA 3IFDA 1CI3M 1PRTC 5FLMG 1JQYD 1XNQQ 4ID6A 3CCLA 3R8BA 3OMGA 4HN7A 4K2LA 3CMAA 4A3JB 5EBCA 2F0IA 4L5QA 3OIPA 2ASBA 2K33A 2L12A 1FD7D 2NVXH 2L55A 1K0SA 5IP9H 3BDCA 2UXCQ 1TR5A 2B2VA 4HIMA 1GD7A 1A3UA 2UXDL 1TS2A 1QUQB 3TN2A 3NHHA 4JBMA 5M5XH 2JA7G 4GKKQ 4FXGC 3UDFA 4DR1Q 3MXPA 4BBSB 5E4XA 4IN3A 3SVMA 2EYOA 1MKHA 3CCEA 1T9HA 1VQPA 1XPRA 2MHVA 5ELFA 1I3QH 4IUNA 5IGFA 1F9PA 3BVZA 4K6LA 1U5KA 5IT9E 2R92G 1Q3LA 1VMCA 1LO5D 2WB1B 2C5CA 4FP5D 4M1UB 5FOBB 1C0AA 5EQ0A 2MFIA 2Z9HA 4UAIA 2B8GA 5EJWA 2R6GA 1HFGA 1TWGB 3M4YA 1IL8A 1SN8A 4PV1C 4XYQA 1DD2A 4JBJA 4K8IA 1IL2A 2HUGA 3G71A 4RWSC 5I4DA 5EPJA 3BZCA 2F3IA 4X66L 1LM0A 4LF9L 2F52A 2NZ1D 2OTLA 4JOIA 3HOWG 2NB0A 3MXNA 2RKSA 1HQMC 1QOHA 4DNTB 3GO5A 1I4XA 2F0LA 5LL6S 1MJEA 4LMQD 1S5BD 5E4WC 1KL9A 2E2HB 1AE2A 1TWAH 4X3UA 1GOZA 2WAQB 1SE4A 2LFNA 1EY5A 2UUCL 1ICFB 2C9OA 1LTGD 3GTGB 5KNCA 4JI5L 4C3JG 4K8JA 3HOXB 1X3PA 3CAMA 1HCZA 1HTPA 1VQ4A 2K1BA 3L7ZC 3NPPA 1HZBA 1CZWA 1SBBB 4LW1A 3C2PA 5IT9L 3MC0B 3NXWA 4JBWA 4RHSA 2F0VA 4NP5A 2F4IA 2NBFA 3L3OC 4OWWB 3LWEA 1AFPA 2LMCB 1JCKB 2NVTB 3CQZB 3OPOA 3FVQA 3OIQA 1C8CA 4A3GH 1ESFA 3I4NH 2K5VA 3H6MA 2PQEA 1UNSA 4JPBW 4J8QA 3DEPA 3T13A 1GVPA 4OIKA 1BCPD 2BA1A 5JEAG 1JJ2A 1BDOA 3M85A 3GTPB 3GTKB 1EZ8A 4P2CB 1SYDA 3S9WA 3EROA 3I4MB 2NTSA 1NBWA 3AQQA 3BZDB 1PA6A 5A2QE 2EYPA 2VB2X 1B44D 1VQIA 4GN3B 2A6EC 1N34Q 3WDNA 3TP6A 1PV4A 4Q0FA 4LFAQ 3S14H 4B3ML 4R4QA 1GUSA 4C2MH 3PSIA 4IZ8A 3OTOL 2DGYA 2OF1A 4PMBA 2MJ8A 2J4XA 5FLXL 2D2CC 2WFWA 5J22A 1C48A 2E8GA 2A19A 1FGUA 2JA6B 1CHPD 4DV7L 3V05A 1K8AC 2B2YA 1E3PA 1RL2A 4A3FH 3CC4A 3HGBA 1A2TA 1VQGA 2JSOA 3CCSA 2RSNA 4DKAC 1Z47A 2N3SA 4EX5A 4LF5L 1XTCD 3UDGA 3RZDB 2B29A 2HHHL 2F0DA 1TXYA 2OQKA 3KFUA 2PQAB 2QILA 2H4OA 4KMUC 3CCMA 4A3KG 4HIDA 5IWAL 3MAQA 3HOUG 4AH6A 3HOZG 3D6CA 3MXGA 2PW5A 4YY3L 2M9VA 3KLRA 1CZGA 1PH2A 1JR0D 2NN6H 5FLXc 5FO9B 1RKNA 5BR8L 3PF4A 2LS01 4A3EH 3D6WA 3HOYG 1I94L 4XTCS 1WD0A 3H3VI 2KA7A 1TY2A 1LTTD 1CSPA 1ENCA 4DV6L 3TREA 5C4HA 2K52A 3A5ZB 3CW2C 1RD9D 1TWGH 1KQSA 1HNZL 1Q90A 3B6YA 4JI1L 3TP7A 3NQTA 4C3JB 4JBKA 3CC2A 2DUDA 1UE7A 2L15A 1VQMA 4DV0L 1TWFB 3VYSA 4LWCA 4EGVA 1D2BA 1D5ZC 5DM63 2ZXPA 3EFXD 4PZ7A 1X56A 2J7ZA 3HRZC 1KABA 1OXXK 1TIID 5L37A 5CBEE 4BBSH 2YTYA 4WJ4A 4YIJA 2YV5A 4CHTB 5DAUA 5EPKA 3TBIB 5C3EG 1TQOA 3A8IE 3HKZE 4HJ5A 4RGOS 3S15B 4DNRB 3TMEA 1WTPA 4X6AH 1TWCB 2RDFA 1LABA 1PFBA 2BA0A 1EU3A 2PNRC 5E7NA 3VDYA 3MWYW 5IP9G 4JI2Q 1BVSA 4NXNQ 1JOQA 1XYIA 4JI8L 4F8MA 2RHSB 1EY7A 3NBHA 4JW0A 2RCNA 1BO0A 3LNNA 1SMYD 1HH2P 2KHIA 2Q8IB 4Q5VA 1JWUD 4LFBL 2KVMA 3F1ZA 2E2IH 1MI2A 3S17B 4OWXB 3PO3H 2CWPA 2KHSA 4HIKA 2WKDA 3HOZH 1D8LA 4A3BH 3D8GA 3DEOA 2WAQG 3IRBA 4ODGA 1CFMA 1Q8IA 1DOKA 1VMPA 1K8GA 1QZGA 1VQ9A 1H9KA 2HQEA 2SDFA 5C3XA 2K28A 1ML0D 1I4HA 3HG9A 3U58A 3H0GH 4OHJA 1HUNA 2BDOA 2PZTA 1Y1VG 4ME5A 3TRZA 1A0IA 3CF5A 5I6YA 5JVH3 1QNUA 1V8QA 2ZTCA 3DWQA 3CD6A 4DR2L 2KCNA 1XPUA 3J81j 1MJCA 2NVYB 4IJLA 4R1JA 1OXSC 3P7JA 2PI2A 1A2UA 2F0OA 1T5EA 1FGBD 4A93B 3QG1A 2DN8A 2IX3A 5I2YA 1XMOL 3HOUB 4DAYA 4BY1G 2FFKB 1QWYA 2RCFA 3GV3A 4PG3A 1E1TA 5CV8A 1XPOA 3I4MG 1EYDA 5GAHC 4LJZC 2CQOA 5C44G 1EYGA 1S4ZA 1ET6A 2WV6D 1WTWA 1IBMQ 1HZAA 2R92B 2SOBA 2HCCA 1U4MA 2IHFA 2UUAQ 2E74C 3M4OH 4KY6A 4FNFA 1PFSA 4N8X1 2QA4A 4R8NA 3QOJA 1B8AA 5M5YB 3U9SA 2ZM6L 4QIWB 5C44H 2R93B 1SYFA 2JA8H 3PIPA 1J5EQ 1ESRA 3PUYA 5DEHA 3HOVG 2V4DA 2R61A 2B2TC 4S3SA 5JEAJ 5C4XG 1D1KA 4WFN3 1PH7A 3LWUA 1P16A 2AWOA 3DUZA 5LMNQ 1OO9B 1E24A 4ZKBB 4H02A 2NN6I 4JI4L 1KC8C 3D4RA 3Q8DA 3A7AB 4R4TA 5ELNA 1BBUA 3FEWX 3F2UA 3PQIA 1VQ6A 4B9XA 1VQOA 2D5DA 1MBYA 4UP7A 2Z6KC 5DM73 2DJFC 3A54A 4RGNA 1MIUA 1EL0A 3I4LA 4LF9Q 4A3IH 3D31A 3C3LA 1PZID 2ENBA 3CRKC 2QW7A 4CDDC 2VQFL 1RCVD 4PMWA 2B2TA 4X64L 5ISRA 3MXNB 2JA6G 4HCEA 4YHHQ 4CDEC 3J7AV 2EQSA 4QCLA 4C3HB 5C4JB 3R3OA 1KDBA 2K01A 4YCWA 4LFCL 1BCPF 1CM9A 1VQAA 3Q0AA 4LAAA 5CBAE 4O1NA 1T5XD 4IUQA 1VQCA 2WB1E 1N33Q 1JOOA 4RMFA 3VA5A 4IURA 1WCMG 1IBKL 1R4PB 3T4AC 2F0NA 4ZLTF 4R8IA 4K5XA 1CKNA 1KD1C 5HURA 4JI7L 1YVCA 2E5LQ 4OO1G 3H09A 5J3BA 3M4OB 2N8NA 2R7FA 2HQLA 1SNPA 3GTQH 1F2MA 2PZWA 4HCSA 1G91A 1EZ6A 1BF4A 1KRSA 2QKIC 3CPWA 1SNDA 4X64Q 3F2DA 3TZUA 4HSVA 1NCVA 4DV3L 1DYQA 2A69D 1YJ9A 1AN8A 1KAWA 4Z9CB 1OXTA 4TVAB 3RN5A 1NNXA 3FMCA 3T53B 1VQ7A 2PQAA 1WCMH 4KI0A 3EQLC 5FJ8H 2NZHA 2CHBD 4V0BA 3GTOH 4A93H 2CVRA 3H91A 4DGZA 3T16A 3S2HB 1H9JA 2F0KA 5BN4A 3J7A5 3DHQA 3S1MB 4KK7A 5T1GA 1W6JA 2F1MA 1ZYRD 5KEEA 1Z6HA 1R4QB 1YZ6A 5C6AA 4B3SL 3E3XA 3GV6A 2UUBQ 3FKIH 2L5TA 3DM1A 3VR2A 3QB3A 4FO2A 3SXHA 4YCVA 4AYBB 4B3TL 3Q24A 5EKKA 2KEDA 3IFTA 1N36Q 2AWNA 4XQJA 2F0QA 5FK9C 4F7XA 3BYTB 1KTKA 3S17H 2PCFB 4BY7G 5ELBA 5FO7B 2F0TA 1AZPA 2I07B 2X6GA 3FPPA 5BN5A 2DY8A 5KIXA 2B63G 3RZDH 5GADC 4POFA 1X32A 1Y1WG 3P20A 3S2HH 2G9DA 3QOLA 3KF6B 3HOZB 3HFZB 1DCZA 3NK9A 2Q2TA 4DR4L 2L0CA 3GTJH 5IP7H 4DN4M 1SSOA 2Q2HA 5C3EH 2DY7A 3NSWA 4OEMB 1PFMA 1U9RA 2K75A 1I6VC 1NAPA 3GTMH 1CK1A 1HJPA 1CKMA 4A3MH 3H3VH 4K6DA 4P75A 4CGYB 1PTOF 1U4PA 3ZJYC 3KDFB 2P5ZX 1UWVA 1EQRA 4QY7A 5M3FH 2I5HA 3JAML 3S24A 4Y7NH 1PRTF 1C4QA 4C2MB 1GXDC 2B2VC 1STHA 3CHBD 4C3IH 4NW2A 4R4OA 4RHRA 4XT1B 1DXMA 1ZYRC 2JA9A 3G4SA 4B3MQ 1CSQA 2NVQH 5IODA 4YWKA 1ICWA 2UUCQ 2YU9H 1EYAA 5EPLA 4GOPA 1Y8OB 5A35A 3SGIA 1STEA 5T1IA 4A3DG 3K80C 3D4WA 4JOIC 1UE5A 1HA6A 4DK1A 3LGJA 4JVZA 3R2TA 3CXCA 3KF8B 2R7ZH 1MGSA 1PLFA 3PUWA 3AFPA 3I4OA 3J80L 1PYWD 4I65A 1RIPA 2IWHA 4HJ8A 3A0JA 1CTMA 4K14A 4BBRB 1WTRA 4N9TA 2XIWA 2KBNA 5M3MB 3K5NA 3RLNA 1PH8A 1PH4A 5M5WB 4R9WA 3OSOA 1PH6A 2JA7H 1XNQL 5C44B 5C5LA 3SR1A 4HR7B 5I2XA 1W3SA 1VQDA 5IGDA 4LF6L 5JJZA 1STYA 3A55A 2EPBA 3W5OA 1JORA 4XIGS 4IOAA 5IY0A 1SR3A 3AEVA 1Z9FA 1XMQL 2Q8RE 5KYIA 3TQYA 2EYJA 3X3MA 4IFDJ 3NWTA 2M2LA 2R3ZA 2CCZA 3KK7A 2WIIB 1AEXA 4DXGA 2JN4A 3MA2B 1VCIA 2EYLA 4HJ7A 3WOEA 4C1NI 1PXUA 3AMUA 4DR6Q 4RA8A 4A3FB 2EY5A 4DFAA 4CJ0B 2ZTEA 5K5PA 1BKBA 1A3TA 1SLJA 3HKSA 1LTBD 3DM3A 1L0WA 1KHIA 4JI3L 1YITA 2MP1A 2NTTA 1LTLA 1VQHA 2NWGA 2B63B 2EJFC 3SK6A 4LF4L 1F9QA 3HOUH 1X3GA 1Q81C 3HKZB 2D0PA 2KCTA 3SK4A 2AMCB 2F0PA 2N55A 4QF4A 2NVYH 4MNOA 1PFNA 5BR8Q 4JCVE 4QQBX 2B8FA 3F2BA 1L1OA 4RGTA 4A3JG 2B2YC 3BG3A 4A3BB 1YJNA 3OW7A 3CQZH 1MHWC 5JEAH 1D7QA 4DR1L 1STGA 3HZXA 4CKEA 5M3FB 4GS3A 1FNUA 2EXZA 1X65A 2J0TD 1SDFA 4LF4Q 2NYZD 2PW7A 4OO1H 4A3JH 3ZYYX 1LTID 3P1HA 1STAA 4CBVA 4RGMA 1TWCH 3BVMA 2BDNA 4ALPA 3GTGH 1EUJA 4FF1A 1GO3E 3S15H 4QJFA 1IZ6A 2HDLA 2E2HH 4IO9A 1HNXQ 1B1ZA 4FXDA 4LUOA 1WTHA 3QR8A 2BOSA 4KKUA 4B3RQ 3CCQA 1K9MC 3OTOQ 1X55A 3MVVA 4GLXA 2RBMA 2N49A 1IKMA 3I2ZA 4ZAIA 1H9RA 2K5DA 4BBRG 1BR9A 4ZYSA 5JOBA 4X62Q 4KN7C 2O5IC 1J5EL 2B63H 2CH4A 4G7OC 1G2TA 3K7AH 4PZ8A 4DNIA 1Y8NB 5HY6A 3N52A 3TP8A 5AJ3Q 5KRUA 4RCNA 4BY7B 3CCUA 3PO2B 1NR2A 3K7UC 4NPSA 1VF7A 4JG2A 1QB5D 4IUVA 2I0QA 1F2LA 1JMCA 4KV6A 1WCMB 4A3EB 1JWMD 1CA6A 2A74C 2XN9C 1UE6A 2PZUA 4QIWE 4DK3C 3Q6SA 3J81L 1Y1VH 1H9SA 2ICIA 1EWCA 2O2LD 4IPHA 4UPAA 1HTLD 4FF2A 1F2YA 3PO2H 4BA2I 3H3VC 2K04A 1YNXA 4DK6C 4KJOA 1NMGA 4JK1C 3JAME 1PDQA 3NELA 2MPMA 2QCPX 1PH3A 4AIMA 2NVXB 3M4QA 3FRPB 5IE8A 3WOFA 4GNXC 1IXRA 3BJUA 1YNNC 4GKJQ 4MN3A 1VF5C 1K73C 1B7YB 4QMGA 4LF6Q 1STNA 4OX9Q 1QZHA 3KF6A 4A3GG 1KNEA 1SYBA 1ZKOA 4DAVA 1CKOA 1K83B 2E2JB 4H0LC 4C3HH 5C4JH 4BBSG 1HNWQ 5JVG3 1X9NA 2F0GA 2LSSA 4A3DB 4GOPC 1EEID 2LXKA 1VQLA 4DV1Q 1GUGA 1AZQA 1WJJA 3AYHB 1SRUA 2B39A 2WAQE 2WB1G 3A56A 1IW7C 4NDXA 1O80A 4DR4Q 2CQAA 4GN5A 4KKTA 3GTLH 4DV5Q 3OW2A 1TS4A 4KTAA 4HJ9A 1G6ZA 2QF7A 1LYLA 3NE5B 3ULPA 4JI6L 3S1QB 4IPCA 1J8IA 5FO8B 3ICEA 1E7ZA 1Q7YC 4O2DA 2Z4IA 3OYYA 4GKJL 5TSSA 2R7ZG 4XXEA 3CP0A 1Q1BA 2FJ2A 1WD1A 1XNRL 1XX8A 4DR3L 3K5MA 2Z6BA 1RHPA 3KBGA 4IJHA 1QG7A 5LMNW 4L63B 3I4MH 4I7AA 4K0KQ 2WACA 1DOMA 1F9SA 4LF7Q 4C3IB 5IYBG 2XRSD 5KGUA 3I7FA 2SNMA 1SYEA 3JAMi 3M3YB 3F8TA 4JI1Q 1K83H 4JYAL 4LF8Q 2M00A 1PMRA 1HNZQ 5CV5A 3VYUA 2MUYA 1Y14B 4RKLA 2BCOA 4X65L 2LKVA 1L2FA 2VQEQ 1EY4A 3L0OA 4FYDA 1SFOH 4DUZQ 1M4VA 4DV4Q 1N36L 1SNMA 4DUZL 4LUVA 1XMQQ 4DUYQ 4LNQA 4P71A 1KLUD 4AQYL 1CUKA 1V43A 5IT9c 1PVOA 1TWAB 1AP0A 1B3AA 1YHAA 2ID0A 1IBLL 1D6EC 4H7BA 1Q86C 1Y1VB 2TSSA 5H1SE 4DR5L 3OOCA 4IOCA 3FKIB 2IT1A 3BU2A 4CJ1B 4JI3Q 5FKAC 3T1YQ 3TEHB 3URYA 3VR6A 1B9MA 1YHBA 1EIHA 1JJGA 3E5SA 4HTHA 2I5MX 2Z4HA 1RODA 1LTRD 2WKCA 2H5XA 4ZUJA 4GZYC 4L8JA 1II3A 1EQQA 1BCPC 2RQXA 4DR6L 1PZJD 4YWMA 5I9OA 2TMPA 1HPCA 2YU9B 4XT3B 5GQOA 1GUTA 3RR5A 4KD3A 3NP8A 4PNYA 2XGTA 1JOKA 1LT3D 1STBA 5C4ZA 5GAGC 3I70A 3A5UA 2KCCA 5E3FA 1EEFD 2I5LX 3QIAA 5EAYA 1FJGQ 5HGTA 5K36H 2NUCA 5LMUQ 2Z1CA 2BE5C 2H1EA 5CV4A 1EYCA 3DWAA 1A6XA 1ILQA 1EFWA 3OWFA 2VXWA 3K8AA 4A3EG 1G291 3HKZG 2EDGA 3BZKA 1LT5D 4E6IA 2F0JA 2K5WA 5IP7G 1N9WA 2JJQA 2IY5B 4KHVA 2MQHA 4OXPA 4Y7NB 1P8LA 3H94A 4NMZA 3E0EA 4A3CG 4V190 2JA5G 2IPKD 1RTOA 3NBHB 1B3QA 4KHPQ 1F77A 1RTNA 3K6OA 4F88A 3ERSX 3QJYA 3KJOA 4A76A 2K50A 4HEDA 1EWIA 2AKWB 1SMYC 1SJHD 2VUMG 1B4OA 5COYA 3W2DA 1JWSD 1O7ZA 3UE1A 3TP5A 3R2IA 2E76C 2PO4A 2PI2E 3VYTA 2F0SA 3H15A 4PZ6A 3Q23A 2KENA 3L2PA 4OELB 4BA1I 2N88A 2JA5H 4YCUA 4YWLA 2IL8A 3S1MH 5FLXE 2CW0D 3GP7A 4P72A 4JI0L 1QVCA 1VQFA 2B2WA 4TSSA 4H44C 4RAUC 2ES2A 2K7VA 1KAAA
chains in the Genus database with same CATH topology
1LV9A 4G7HC 1WTVA 4HSPA 4IFDH 1S5CD 5K36G 3FDTA 5M9OA 2JYOA 4G57A 1HA5A 1H9SB 5D65A 4DA2A 3HOVB 3NUCA 3IKJA 5CGKA 3C1EA 2D62A 3A7LA 2F3WA 2A69C 2F0HA 4IUPA 3O13A 1SE3A 5LL6X 1FYCA 1HXYD 1V1PB 1ZEQX 4J1MA 2DNEA 4KD4A 2I46A 3RLFA 2E75C 4KY7A 5C3WA 1SEBD 2B2UA 1EU4A 2JA7B 1KLGD 3CKIB 2F0MA 2CW0C 1J9OA 1E2WA 4DK0A 2DNCA 4K5WA 4EQNA 4IQZA 5KYLA 3PUVA 5CV7A 4KJNA 3TDQA 3VR5A 2X6LA 3GD7A 3GQBA 4A3GB 1BUVT 4CKCA 3PO3B 5A2QL 4ABNA 1QNKA 3NWSA 1B2TA 1HRJA 4U673 1RDPD 1B9NA 1QJOA 2MGSA 5J1ZA 4RH6A 5C0XI 4U68A 3V96A 3DXJC 1FNWA 5CV6A 1LTAD 1RJTA 1TVXA 3P75A 3HP3A 2IX0A 1L0YB 4C1NK 4ZK9B 4PMCA 1WVLA 2F0EA 3MTSA 3Q22A 4DF7A 2A68C 2A6HC 4RFBA 1EY6A 3ND8A 1KDCA 5CV9A 4OO1I 1ONLA 2KOLA 2EY6A 3KUPA 1ENAA 1EOTA 5EGTA 2K03A 1PRTD 3UI2A 1OXVA 4ZKCB 1PZKD 2JA5B 5BN3A 3K7AB 5ELDA 3IL8A 1M8AA 3J81E 1DZ1A 5CYUA 4IUTA 3N6RA 3SDZA 1UUPA 4J6HA 3G7LA 1QE6A 2SEBD 3RZOB 1R9TB 2LY7A 3GTQB 1BOSA 3I90A 1MSHA 3S1RB 1XXGA 2RDHA 2ZXRA 3KBXA 1TU2B 1U4LA 4CJ2C 4TRDA 2Y0SB 2AUKA 2QEJC 4IUUA 1CQVA 1TS5A 4OL7A 4G4KA 1GUOA 2RVLA 2XRQD 1HFNA 1JE4A 1ET9A 1K8MA 1MSGA 2ICEC 3HOYB 5D3DA 4M8AA 3K59A 1E2ZA 3S2DB 5JPMC 1EQVA 1I50B 1QILA 3GTLB 2QDBA 2EJMA 5JAVA 3T56B 2JP1A 3S16B 3TZDA 4CKBA 3CRLC 1SJED 5EKLA 1S5DD 3HOWB 2D9UA 5EKIA 1SNQA 1QCBD 4KN4C 2VUMB 4DU9A 3K5OA 1EQTA 4IFDG 4L6TB 1IHZA 2KQ3A 3BVGA 3OWEB 4O42A 4ILWA 1DJRD 1PTOB 2EYFA 1E0BA 4KKSA 3HEJA 4HMJA 2EYMA 4FF4A 3K57A 2IW3A 4HAEA 5NUCA 1I3QB 3VA7A 3PIO3 3DWPA 3RMHA 3R93A 1V1OA 1UEAB 5M5XB 3I3CA 3H0GB 5G3LF 2KUMA 3S14B 5CORA 3ERQA 1LTSD 3K0YA 2EYHA 3I4NB 4RCOA 2GA4B 4IALA 2VNUD 2A68D 2FINB 4EQOA 1TT2A 1HUMA 1KDAA 1GHJA 2PMZB 5ELEA 1WTOA 1LLRD 1BQQT 5C3EB 1Q1EA 3J7AF 1OXUA 1YNJC 1WTQA 5IGBA 4MHEA 3T51B 5IIFA 4BY1B 5I6WA 3X3NA 3KF8A 2ZXOA 4MIUA 1S5FD 3TSSA 4ZRZA 2BE5D 3MEHA 3VR4A 1SNCA 4HMIA 1V1PA 3MFGA 2EY1A 3EJIA 5CC4A 2OXPA 4I7ZC 5I9PA 3KLSX 3GTOB 4LK1C 5C0XH 1VDZA 3I8ZA 1IKLA 2EOTA 2F0UA 4KHZA 5IGGA 2L1BA 4ZUIA 3PUXA 2F0WA 2K05A 3G6JB 1SAPA 5D14A 3E6ZX 2JXMB 2KECA 5CR3A 5E1FA 5IGCA 1Q12A 3MZ5A 1PTOH 1ZXTA 3K5LA 2IJ0A 3SK8A 4FXKC 1XWEA 2F3VA 2OT2A 4K5VA 1NUCA 1ILPA 2FMCA 3ONAB 4C3HG 2AQ2B 3D4DA 1B53A 1S5ED 2XWJB 3A8KE 3SK5A 2YYZA 1IW7D 2JEAI 1EY9A 3NTIA 3PV0A 2NN6G 4QUCA 1I4PA 1FR3A 2O4XA 1HQRD 1CQFA 3A8JE 4WRDA 1Y69U 1EFID 1ENFA 2EJGC 1EY0A 1PRTB 3AU7A 4TQUS 1HHVA 4QB4A 1TKWB 2HCIA 1Z7TA 1Y8PB 1W6KA 2K32A 1JICA 4X3TA 3M7NA 1KNAA 4DAPA 3I91A 1TS3A 2EE1A 4K2KA 5DNFA 1TY0A 3PMFA 1CT1D 1O78A 2VB3X 1SXTA 2R7ZB 4QUFA 5C4XB 4IFDI 2RDGA 2AQ3B 3PUZA 4H13C 2K5QA 3M7GA 1JB3A 1MD2D 4N9PA 3ITPA 1FNVA 2FHTA 2KJXA 2XWBB 3RD4A 1E2VA 4UDUC 1Y1WB 2IX1A 4XQNA 2SNSA 1K8OA 1IYUA 1EY8A 2JEBI 4XYOA 3AB9A 2B2WC 2FMMA 2HDMA 3KLSA 4FVMA 5F2DA 4BS9A 1IYVA 1A15A 5C0XG 5C5MA 2PYKA 1WTXA 3NTKA 1GUNA 1A3VA 2PPBC 3SEBA 1NR4A 3C46A 4ZQ3A 5IOCA 3NBIA 1LT4D 3NTHA 2XNAC 2A5HA 2E2IB 2JE6I 4C56C 1I4GA 1NSNS 1AW7A 1CHQD 2K6AA 5J39A 3BS1A 2F03A 1SFOB 4C3IG 2EY2A 3MHBA 2Q8TA 1PTOD 3HS0C 3RUZA 3SHLA 2NVQB 3E0JA 2A73B 1U4RA 3EA6A 2ZT9C 1DOLA 3QO2A 5CMDA 3MFYA 2EZVA 4G7ZC 2F0FA 4RKBA 2O5JC 4WJWA 1L0XB 3NQIA 1GUWA 5G3LD 1BNZA 2KEEA 2RSOA 4XQQA 4A3MB 4F87A 1F2ZA 1D1IA 1CA5A 2AQ1B 3GTMB 4B08A 4OIJA 3J7YW 3C1FA 3V2TA 3EVQA 3GTJB 4OGQC 2E2DC 1D5MC 2X69A 1EWHA 2A6ED 2A6HD 4A3IB 1EIGA 3BDLA 2L4NA 1B50A 2Z8LA 1SNOA 5IGEA 3BYYB 5C0XJ 4ULLA 5KNDA 3OMCA 1SYCA 4EQPA 3VYRA 4DXFA 1BCPB 3VR3A 3OHXC 4XDXA 5AFWA 1GJXA 4KY5A 1G8ZD 4NKLA 1I4QA 3L9AX 2JA8B 5JPNC 3K58A 3LX0A 3DMUA 2L9HA 3SE0A 1YNJD 3CU7A 5EBDA 3J80E 2EVBA 2AUJD 1H9MA 2B2UC 1DM0B 1O7YA 1BXTA 4EVOA 5D3IB 1D5XC 3FPUB 2WINB 1SE2A 5ELCA 3I72A 4TKOB 1I6HB 3BDOA 1TWHB 1I4RA 1YNND 3I73A 1SYGA 2RA4A 3D3RA 3MXUA 3ND9A 4X3KA 3QWNA 1LACA 4PQXA 3IAYA 1JC7A 2XVSA 1DONA 2WP8J 3S1NB 1O7LA 4X3SA 1RF2D 3U9OA 4BWGB 2L11A 5LHY1 4FF3A 1GHKA 4WORA 1F9RA 1LT6D 5KNBA 3PIP3 3W3AA 4A3KB 1UAPA 1BBXC 2G9HD 1X3QA 1PTOC 1G2SA 4B9WA 2XSCA 2OEOA 3IFDA 1CI3M 1PRTC 1JQYD 4ID6A 3R8BA 3OMGA 4HN7A 4K2LA 4A3JB 5EBCA 2F0IA 3OIPA 2K33A 2L12A 1FD7D 2L55A 3BDCA 1TR5A 2B2VA 1A3UA 1TS2A 3TN2A 3NHHA 4FXGC 3MXPA 4BBSB 5E4XA 4IN3A 3SVMA 2EYOA 2MHVA 5ELFA 4IUNA 5IGFA 1F9PA 3BVZA 4K6LA 5IT9E 1Q3LA 1VMCA 1LO5D 2WB1B 2C5CA 4FP5D 4M1UB 5FOBB 5EQ0A 4UAIA 2B8GA 5EJWA 2R6GA 1HFGA 1TWGB 3M4YA 1IL8A 4PV1C 4XYQA 1DD2A 4K8IA 2HUGA 4RWSC 5I4DA 5EPJA 2NZ1D 2NB0A 3MXNA 2RKSA 1HQMC 1QOHA 4DNTB 3GO5A 1I4XA 2F0LA 5LL6S 4LMQD 1S5BD 5E4WC 2E2HB 4X3UA 1GOZA 2WAQB 1SE4A 2LFNA 1EY5A 3GTGB 2C9OA 1LTGD 5KNCA 4C3JG 4K8JA 3HOXB 1X3PA 1HCZA 1HTPA 2K1BA 3L7ZC 3NPPA 1CZWA 1SBBB 3C2PA 5IT9L 3MC0B 3NXWA 4JBWA 4RHSA 2F0VA 4NP5A 2F4IA 2NBFA 3L3OC 3LWEA 1AFPA 2LMCB 1JCKB 2NVTB 3CQZB 3OPOA 3FVQA 3OIQA 1C8CA 1ESFA 3H6MA 2PQEA 1UNSA 4J8QA 3DEPA 3T13A 4OIKA 1BCPD 2BA1A 5JEAG 1BDOA 3M85A 3GTPB 3GTKB 1EZ8A 4P2CB 1SYDA 3S9WA 3EROA 3I4MB 2NTSA 3BZDB 5A2QE 2EYPA 2VB2X 1B44D 2A6EC 3WDNA 3TP6A 4Q0FA 1GUSA 4IZ8A 2OF1A 4PMBA 2MJ8A 2J4XA 5FLXL 2D2CC 5J22A 1C48A 2JA6B 1CHPD 3V05A 2B2YA 3HGBA 1A2TA 2JSOA 2RSNA 1Z47A 1XTCD 3RZDB 2F0DA 2QILA 2H4OA 4KMUC 3MAQA 3D6CA 3MXGA 2PW5A 2M9VA 3KLRA 1CZGA 1JR0D 2NN6H 5FO9B 1RKNA 2LS01 3D6WA 4XTCS 1WD0A 2KA7A 1TY2A 1LTTD 1ENCA 5C4HA 1RD9D 1Q90A 3TP7A 3NQTA 4C3JB 1TWFB 3VYSA 4EGVA 1D2BA 1D5ZC 5DM63 2ZXPA 3EFXD 2J7ZA 3HRZC 1KABA 1OXXK 1TIID 5CBEE 4YIJA 4CHTB 5DAUA 5EPKA 3TBIB 1TQOA 3A8IE 4RGOS 3S15B 4DNRB 3TMEA 1WTPA 1TWCB 2RDFA 1LABA 1PFBA 2BA0A 1EU3A 2PNRC 3MWYW 1JOQA 1XYIA 4F8MA 1EY7A 3NBHA 1BO0A 3LNNA 1SMYD 2Q8IB 4Q5VA 1JWUD 2KVMA 1MI2A 3S17B 2KHSA 2WKDA 3D8GA 3DEOA 4ODGA 1CFMA 1Q8IA 1DOKA 1VMPA 1H9KA 2HQEA 2SDFA 5C3XA 2K28A 1ML0D 1I4HA 3HG9A 1HUNA 4OHJA 2BDOA 2PZTA 4ME5A 5I6YA 5JVH3 1QNUA 1V8QA 3DWQA 2KCNA 2NVYB 1OXSC 3P7JA 1A2UA 2F0OA 1T5EA 1FGBD 4A93B 3QG1A 2DN8A 2IX3A 5I2YA 3HOUB 4DAYA 2FFKB 1QWYA 3GV3A 5CV8A 1EYDA 4LJZC 1S4ZA 1ET6A 2WV6D 1WTWA 2R92B 2SOBA 2HCCA 1U4MA 2E74C 4KY6A 4FNFA 4R8NA 3QOJA 5M5YB 3U9SA 4QIWB 2R93B 1SYFA 1ESRA 3PUYA 5DEHA 2V4DA 2R61A 2B2TC 4S3SA 5JEAJ 1D1KA 4WFN3 3LWUA 2AWOA 3DUZA 1OO9B 4ZKBB 2NN6I 3D4RA 3A7AB 3FEWX 3F2UA 4B9XA 2D5DA 1MBYA 5DM73 1EL0A 3A54A 4RGNA 3I4LA 3D31A 3C3LA 1PZID 2ENBA 3CRKC 1RCVD 4PMWA 2B2TA 5ISRA 4HCEA 3J7AV 4QCLA 4C3HB 5C4JB 3R3OA 1KDBA 2K01A 1BCPF 1CM9A 3Q0AA 4LAAA 5CBAE 4O1NA 1T5XD 4IUQA 1JOOA 3VA5A 4IURA 1R4PB 3T4AC 2F0NA 4ZLTF 4R8IA 4K5XA 5HURA 4OO1G 3H09A 3M4OB 1SNPA 1F2MA 2PZWA 4HCSA 1G91A 1EZ6A 1BF4A 2QKIC 1SNDA 3TZUA 4HSVA 1NCVA 1DYQA 2A69D 1AN8A 4Z9CB 1OXTA 3FMCA 3T53B 4KI0A 3EQLC 2CHBD 4V0BA 2CVRA 3H91A 4DGZA 3T16A 3S2HB 1H9JA 2F0KA 5BN4A 3DHQA 3S1MB 4KK7A 5T1GA 1W6JA 2F1MA 1ZYRD 5KEEA 1Z6HA 1R4QB 5C6AA 3GV6A 2L5TA 3DM1A 3VR2A 3QB3A 4FO2A 3SXHA 4AYBB 3Q24A 5EKKA 2KEDA 3IFTA 2AWNA 4XQJA 2F0QA 5FK9C 4F7XA 3BYTB 1KTKA 2PCFB 5ELBA 5FO7B 2F0TA 1AZPA 2I07B 2X6GA 3FPPA 5BN5A 2DY8A 5KIXA 1X32A 3P20A 2G9DA 3QOLA 3HOZB 1DCZA 3NK9A 2L0CA 4DN4M 1SSOA 2DY7A 3NSWA 1PFMA 1U9RA 1I6VC 1NAPA 1CK1A 4K6DA 4CGYB 1PTOF 1U4PA 3JAML 1PRTF 1C4QA 4C2MB 1GXDC 2B2VC 1STHA 3CHBD 4NW2A 4RHRA 4XT1B 1DXMA 1ZYRC 5IODA 1ICWA 1EYAA 5EPLA 1Y8OB 5A35A 1STEA 5T1IA 3D4WA 1HA6A 4DK1A 3R2TA 1MGSA 1PLFA 3PUWA 3J80L 1PYWD 4I65A 2IWHA 1CTMA 4K14A 4BBRB 1WTRA 4N9TA 2XIWA 5M3MB 3K5NA 5M5WB 4R9WA 3OSOA 5C44B 5C5LA 3SR1A 4HR7B 5I2XA 5IGDA 5JJZA 1STYA 3A55A 2EPBA 1JORA 4XIGS 2Q8RE 5KYIA 2EYJA 3X3MA 4IFDJ 3NWTA 2M2LA 2R3ZA 3KK7A 2WIIB 1AEXA 4DXGA 1VCIA 3MA2B 2EYLA 3WOEA 4C1NI 1PXUA 3AMUA 4RA8A 4A3FB 2EY5A 4DFAA 4CJ0B 5K5PA 1A3TA 1LTBD 2MP1A 2NTTA 2NWGA 2B63B 2EJFC 3SK6A 1F9QA 3HKZB 3SK4A 2F0PA 2N55A 4QF4A 1PFNA 2B8FA 4RGTA 2B2YC 3BG3A 4A3BB 3OW7A 5JEAH 1STGA 3HZXA 4CKEA 5M3FB 1FNUA 2EXZA 2J0TD 1SDFA 2NYZD 2PW7A 4OO1H 3ZYYX 1LTID 3P1HA 1STAA 4CBVA 4RGMA 3BVMA 2BDNA 4FF1A 2HDLA 1B1ZA 4FXDA 4KKUA 2BOSA 3MVVA 2RBMA 1IKMA 4ZAIA 1H9RA 2K5DA 1BR9A 4ZYSA 5JOBA 2O5IC 4KN7C 4G7OC 1G2TA 1Y8NB 3N52A 3TP8A 5KRUA 4RCNA 4BY7B 3PO2B 1NR2A 1VF7A 1QB5D 4IUVA 1F2LA 4KV6A 1WCMB 4A3EB 1JWMD 1CA6A 2A74C 2XN9C 2PZUA 3Q6SA 3J81L 1H9SA 2ICIA 1EWCA 2O2LD 1HTLD 4FF2A 1F2YA 4BA2I 3H3VC 2K04A 4KJOA 4JK1C 3JAME 1PDQA 2MPMA 2QCPX 2NVXB 3FRPB 3WOFA 1YNNC 4MN3A 1VF5C 4QMGA 1STNA 1KNEA 1SYBA 1ZKOA 4DAVA 1K83B 2E2JB 4H0LC 5JVG3 2F0GA 4A3DB 1EEID 1GUGA 1AZQA 3A56A 2B39A 1IW7C 4NDXA 1O80A 2CQAA 4KKTA 1TS4A 4KTAA 1G6ZA 2QF7A 3NE5B 3S1QB 1J8IA 5FO8B 2Z4IA 5TSSA 4XXEA 1WD1A 2FJ2A 1Q1BA 1XX8A 3K5MA 1RHPA 3KBGA 1QG7A 4L63B 2WACA 1DOMA 1F9SA 4C3IB 2XRSD 5KGUA 2SNMA 1SYEA 3M3YB 2M00A 1PMRA 5CV5A 3VYUA 2MUYA 4RKLA 2BCOA 2LKVA 1EY4A 4FYDA 1M4VA 1SNMA 1KLUD 1V43A 1TWAB 1AP0A 1B3AA 2ID0A 1D6EC 4H7BA 1Y1VB 2TSSA 3OOCA 3FKIB 2IT1A 4CJ1B 5FKAC 3URYA 3VR6A 1B9MA 1EIHA 3E5SA 4HTHA 2Z4HA 1RODA 1LTRD 2WKCA 4ZUJA 4GZYC 4L8JA 1II3A 1BCPC 2RQXA 1PZJD 5I9OA 2TMPA 2YU9B 1HPCA 4XT3B 1GUTA 4KD3A 3NP8A 4PNYA 1JOKA 1LT3D 1STBA 5C4ZA 3I70A 2KCCA 5E3FA 1EEFD 3QIAA 5HGTA 5K36H 2NUCA 2Z1CA 5CV4A 2BE5C 2H1EA 1EYCA 3DWAA 1A6XA 1ILQA 3OWFA 2VXWA 1G291 2EDGA 4E6IA 1LT5D 2F0JA 2K5WA 4KHVA 4Y7NB 3H94A 4NMZA 4V190 2IPKD 1RTOA 1F77A 1RTNA 3K6OA 4F88A 3QJYA 4HEDA 1SMYC 1SJHD 1B4OA 5COYA 3W2DA 1JWSD 1O7ZA 3TP5A 3R2IA 2E76C 2PO4A 3VYTA 2F0SA 3Q23A 4BA1I 2N88A 2IL8A 5FLXE 2CW0D 3GP7A 2B2WA 4TSSA 4H44C 4RAUC 2K7VA 1KAAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LV9 A;  1WTV A;  3GV3 A;  1SDF A;  4CJ1 B;  4HSV A;  2RVL A;  2NYZ D;  1NCV A;  4QUC A;  1HFN A;  3FDT A;  1JE4 A;  1RJT A;  2FIN B;  1TVX A;  2JYO A;  1NR4 A;  2L12 A;  1EIH A;  1MSG A;  3HP3 A;  4XDX A;  1WTR A;  3DEP A;  1S4Z A;  5AFW A;  1HUM A;  2BDN A;  4OIK A;  1WTW A;  1AZQ A;  1ROD A;  2XIW A;  2HCC A;  1U4M A;  1WTO A;  2CVR A;  2J7Z A;  2B2V A;  3H91 A;  5D65 A;  2HDL A;  4R9W A;  1O80 A;  4ZK9 B;  3TN2 A;  1WTQ A;  1WVL A;  4MHE A;  4XT3 B;  3MTS A;  5T1G A;  5CBE E;  2L9H A;  1G6Z A;  1HHV A;  2HCI A;  5E4X A;  3SVM A;  3GV6 A;  5JJZ A;  2B2U C;  3DM1 A;  2EPB A;  1JIC A;  5EPK A;  1J8I A;  1O7Y A;  4IUP A;  4X3T A;  2Q8T A;  2JP1 A;  1KNA A;  1IKM A;  4ZAI A;  2KED A;  1ESR A;  2KOL A;  3FPU B;  2Q8R E;  3TZD A;  1F9P A;  3KUP A;  2FJ2 A;  1WD1 A;  1EOT A;  1WTP A;  2B2T C;  1XX8 A;  3I91 A;  1PFB A;  1Q3L A;  2K03 A;  3UI2 A;  2D9U A;  5EKI A;  3MWY W;  2H1E A;  4ZKC B;  1VMC A;  1AZP A;  1RHP A;  2X6G A;  2EE1 A;  1ILQ A;  2M2L A;  2DY8 A;  5EQ0 A;  5DNF A;  2R3Z A;  2MJ8 A;  4ZKB B;  4UAI A;  1QG7 A;  5EJW A;  1G2T A;  2B2U A;  1X32 A;  1U4R A;  1HFG A;  2VXW A;  1XYI A;  1IL8 A;  2RA4 A;  1EQT A;  3N52 A;  1DOM A;  1BO0 A;  1F9S A;  1DOL A;  3QO2 A;  5CMD A;  3F2U A;  1J9O A;  2HUG A;  2KVM A;  4RA8 A;  4QUF A;  1NR2 A;  1MI2 A;  4RWS C;  4IUV A;  5EPJ A;  1SSO A;  4DN4 M;  4CJ0 B;  2B2Y A;  1F2L A;  1EL0 A;  4X3K A;  3IL8 A;  2DY7 A;  1GUW A;  4O42 A;  1RTO A;  1BNZ A;  2KEE A;  1RTN A;  2RSO A;  2RSN A;  2NZ1 D;  3DEO A;  1PFM A;  1DON A;  1CA6 A;  1M8A A;  1NAP A;  3I8Z A;  4X3S A;  2MP1 A;  1CA5 A;  1IKL A;  2EOT A;  4IUT A;  1DZ1 A;  1DOK A;  1VMP A;  2B2T A;  3G7L A;  2L1B A;  4HED A;  1QE6 A;  3Q6S A;  2NWG A;  2SDF A;  2FHT A;  2K28 A;  1E0B A;  1ML0 D;  1F9Q A;  1B4O A;  1U4P A;  2X6L A;  4OIJ A;  5COY A;  4LMQ D;  1O7Z A;  1HUN A;  5E4W C;  2K05 A;  2K01 A;  1SAP A;  1C8C A;  2L11 A;  4X3U A;  3I90 A;  5D14 A;  2B2V C;  1CM9 A;  1MSH A;  2K04 A;  2KEC A;  4HAE A;  4NW2 A;  1QNK A;  2X69 A;  1F9R A;  2N55 A;  5CBA E;  1PDQ A;  1B2T A;  4IUQ A;  2MPM A;  1HRJ A;  1PFN A;  4XT1 B;  1ZXT A;  4IUR A;  1X3P A;  4MN3 A;  3R93 A;  2N88 A;  4ZLT F;  2K1B A;  2B2W C;  4R8I A;  2FMM A;  3KBX A;  3D6W A;  1BBX C;  1X3Q A;  2IL8 A;  1ICW A;  2HDM A;  1WD0 A;  1ILP A;  2B2Y C;  1U4L A;  1G2S A;  5EPL A;  2MGS A;  4CJ2 C;  3P7J A;  1EIG A;  1A15 A;  2L4N A;  3I3C A;  1B50 A;  5T1I A;  3ONA B;  1AP0 A;  1B3A A;  3IFD A;  1WTX A;  1KNE A;  4HCS A;  1B53 A;  1HA6 A;  4IUU A;  3LWE A;  2B2W A;  2KUM A;  4U68 A;  1G91 A;  1BF4 A;  4RAU C;  5COR A;  1MGS A;  1PLF A;  2FFK B; 
#chains in the Genus database with same CATH topology
 1LV9 A;  4G7H C;  1WTV A;  4HSP A;  1YI2 A;  4Y52 H;  2UU9 Q;  4IFD H;  1S5C D;  5K36 G;  2QEX A;  1GKH A;  3FDT A;  5M9O A;  2JYO A;  3NEN A;  4G57 A;  3ULJ A;  1HA5 A;  1H9S B;  5D65 A;  3EBE A;  4DA2 A;  3HOV B;  3NUC A;  3E9I A;  3IKJ A;  2C35 B;  5CGK A;  1TWH H;  3C1E A;  2D62 A;  2Z0S A;  3A7L A;  2F3W A;  4DR7 Q;  2A69 C;  2F0H A;  4IUP A;  3CPF A;  3CCJ A;  3O13 A;  1KRT A;  1SE3 A;  5LL6 X;  1HR0 L;  1FYC A;  1HXY D;  1V1P B;  1W2B A;  1ZEQ X;  4J1M A;  2DNE A;  4OWT B;  4KD4 A;  1IBK Q;  2I46 A;  3RLF A;  2E75 C;  1PH5 A;  4KY7 A;  2ALY B;  3TS0 A;  5C3W A;  1SEB D;  2B2U A;  1EU4 A;  2JA7 B;  1KLG D;  3CKI B;  2UXB L;  4BXX G;  1DGS A;  2F0M A;  2F4V Q;  5M5W H;  3ER0 A;  5IWA Q;  2CW0 C;  1J9O A;  1E2W A;  1VQ8 A;  4DK0 A;  3GTK H;  2DNC A;  3KJP A;  4K5W A;  4O0A A;  4EQN A;  4IQZ A;  4MZ9 A;  5KYL A;  3PUV A;  5CV7 A;  1JT8 A;  4OON A;  4IPG A;  2NZO A;  4KJN A;  1SRO A;  3TDQ A;  3VR5 A;  2X6L A;  3GD7 A;  3GQB A;  4KLK A;  4A3G B;  2ZJR A;  1BUV T;  2NVT H;  4CKC A;  3TS2 A;  3PO3 B;  2R7D A;  4LUZ A;  5A2Q L;  4HIO A;  2E5L L;  4ABN A;  1QNK A;  3NWS A;  1B2T A;  3H0G G;  1HRJ A;  2VL6 A;  4U67 3;  1RDP D;  2K5N A;  5IYB H;  1B9N A;  2UUB L;  1E22 A;  1QJO A;  2MGS A;  1G51 A;  4A3L G;  2JA8 G;  2DJG C;  5J1Z A;  4RH6 A;  5C0X I;  3FHW A;  2R92 H;  4U68 A;  3V96 A;  3DXJ C;  4NB3 A;  5HGQ A;  2KCM A;  1FNW A;  5CV6 A;  2FXQ A;  3D0F A;  3CCR A;  1LTA D;  2MO1 A;  1RJT A;  1ASY A;  1TVX A;  2R93 G;  1VQE A;  3P75 A;  1IBM L;  3HP3 A;  5JJK A;  5GRO A;  4AYB G;  1A8V A;  2IX0 A;  1L0Y B;  4C1N K;  4ZK9 B;  4PMC A;  3GDE A;  1WVL A;  2F0E A;  3MTS A;  4DV6 Q;  3Q22 A;  4DF7 A;  4C3J H;  2BH8 A;  2A68 C;  1X3E A;  2A6H C;  5LMN L;  1XMO Q;  3J81 i;  4RFB A;  1EY6 A;  1V9P A;  4JI0 Q;  3ND8 A;  4UY8 C;  1KDC A;  5CV9 A;  4JV5 L;  1AH9 A;  4OO1 I;  1ONL A;  2KOL A;  2EY6 A;  3KUP A;  1XNR Q;  1ENA A;  4DPG A;  1EOT A;  5EGT A;  4DV2 L;  2K03 A;  1PRT D;  3UI2 A;  1OXV A;  4ZKC B;  2K14 A;  1PZK D;  2JA5 B;  1IYJ B;  4DAY B;  5BN3 A;  3K7A B;  2XTI A;  2VY3 A;  4YHH L;  3JC6 6;  2HHH Q;  5ELD A;  4LF5 Q;  4GOP B;  1WYD A;  2ZJP A;  1M1K C;  3IL8 A;  4GLA C;  4A75 A;  4DV1 L;  4HJA A;  1M8A A;  3J81 E;  1DZ1 A;  5CYU A;  4IUT A;  3N6R A;  3SDZ A;  1UUP A;  4J6H A;  3G7L A;  1PH1 A;  1QE6 A;  2SEB D;  2VS1 A;  1HNW L;  3RN2 A;  3PIO A;  2UXB Q;  3RZO B;  1ASZ A;  1R9T B;  1Q46 A;  2LY7 A;  3UDI A;  2GN5 A;  3GTQ B;  1BOS A;  3I90 A;  2RF4 A;  3U4V A;  1L1O C;  1MSH A;  2QGQ A;  4UHV A;  3S1R B;  4MTK A;  3STB C;  1XXG A;  3M3Y H;  2RDH A;  2ZXR A;  1AE3 A;  1PH9 A;  3KBX A;  1Q8K A;  1TU2 B;  1U4L A;  4CJ2 C;  2VW9 A;  5FJ8 G;  4TRD A;  2Y0S B;  2AUK A;  1Y1W H;  2QEJ C;  4IUU A;  2AHO B;  1CQV A;  1TS5 A;  4OL7 A;  4G4K A;  1QVG A;  1GUO A;  2RVL A;  2XRQ D;  1HFN A;  1JE4 A;  1ET9 A;  1K8M A;  1MSG A;  2ICE C;  4ME3 A;  1NY4 A;  3HOY B;  5D3D A;  4M8A A;  3K59 A;  1E2Z A;  3S2D B;  5JPM C;  1TWF H;  1EQV A;  1PYB A;  3E9H A;  5M3F G;  1N32 L;  3KYH C;  1I50 B;  1QIL A;  1EIY B;  3K81 C;  3GTL B;  4JI2 L;  3HOX H;  2QDB A;  1A63 A;  4P74 A;  5IYC G;  5M3M G;  2EJM A;  4WJ3 M;  5JAV A;  3T56 B;  2MNA A;  2JP1 A;  2EIF A;  3TZD A;  4CKB A;  4GNX B;  1I94 Q;  3S16 B;  3CRL C;  1SJE D;  1UE1 A;  5EKL A;  2YTV A;  1KXL A;  1S5D D;  3HOW B;  2D9U A;  5EKI A;  1SNQ A;  1R9T H;  1VS0 A;  4A3D H;  1QCB D;  4KN4 C;  4B3S Q;  4DAM A;  2N78 A;  5JJL A;  2VUM B;  1L1O B;  4YY3 Q;  3AFQ A;  4DU9 A;  3K5O A;  1EQT A;  4IFD G;  4L6T B;  1IHZ A;  2KQ3 A;  2Q2I A;  3BVG A;  1YEZ A;  5GAE C;  3I56 A;  3OWE B;  4O42 A;  5M3M H;  4KHP L;  4ILW A;  3PO3 G;  3K0X A;  1YHQ A;  4BBR H;  1YBY A;  4DV3 Q;  1DJR D;  2V1C C;  1PTO B;  3I55 A;  2EYF A;  4LFB Q;  1O7I A;  1E0B A;  4KKS A;  1YJW A;  3HEJ A;  4HMJ A;  3HOW H;  2F4V L;  2EYM A;  2ZTD A;  4FF4 A;  2JQO A;  3K57 A;  2IW3 A;  3S16 H;  2JA6 H;  4HAE A;  5NUC A;  1I3Q B;  1V1Q A;  3VA7 A;  4BY7 H;  2Q2U A;  3PIO 3;  3DWP A;  3RMH A;  3R93 A;  4IPD A;  1V1O A;  1HR0 Q;  1UEA B;  5M5X B;  3MEF A;  3F2C A;  3I3C A;  3RLO A;  3U50 C;  3H0G B;  3S2D H;  5G3L F;  2KUM A;  3S14 B;  3RNU A;  5COR A;  3ERQ A;  1LTS D;  5FLM H;  3S1Q H;  3PCO B;  3K0Y A;  4JYA Q;  2EYH A;  4RCO A;  3I4N B;  2GA4 B;  4IAL A;  2VNU D;  2A68 D;  2FIN B;  4EQO A;  1TT2 A;  1C7Y A;  1HUM A;  1KDA A;  1GHJ A;  4DV7 Q;  2PMZ B;  5ELE A;  1WTO A;  1LLR D;  1BQQ T;  5C3E B;  1YIJ A;  1Q1E A;  2Y0S G;  2HT1 A;  1OXU A;  3J7A F;  1YNJ C;  1WTQ A;  3UDX A;  5IGB A;  4MHE A;  3T51 B;  1NTG A;  1IBL Q;  5IIF A;  4BY1 H;  3DLL A;  4A3L H;  4BY1 B;  5I6W A;  1PHJ A;  2E2J H;  4DUY L;  3S1R H;  3X3N A;  2PNH A;  3KF8 A;  2ZXO A;  4MIU A;  1S5F D;  5JJI A;  3TSS A;  1S40 A;  4LFA L;  2ATW A;  2OTJ A;  2CWA A;  4ZRZ A;  1N34 L;  1S3O A;  4JI5 Q;  2BE5 D;  3MEH A;  2ZM6 Q;  3VR4 A;  4A3K H;  4JI6 Q;  1SNC A;  2CFM A;  4HMI A;  1V1P A;  3MFG A;  2EY1 A;  3EJI A;  5CC4 A;  2OXP A;  3PF5 A;  2UUA L;  4I7Z C;  4P73 A;  5I9P A;  1WOC A;  3KLS X;  2CH4 W;  3GTO B;  4LK1 C;  5C0X H;  2OWO A;  2K4K A;  1VDZ A;  3KDF A;  3I8Z A;  2UU9 L;  1IKL A;  2EOT A;  2F0U A;  4KHZ A;  4UP8 A;  4JC0 A;  5IGG A;  4A3B G;  2L1B A;  4ZUI A;  3PO2 G;  1X3F A;  2KHJ A;  3PUX A;  2F0W A;  1XTD A;  3G6J B;  2K05 A;  1SAP A;  2MO0 A;  3CC7 A;  5D14 A;  3E6Z X;  3JAM c;  4GLV B;  2JXM B;  2KEC A;  5CR3 A;  5E1F A;  2GVA A;  5IGC A;  1OTC A;  4OX9 L;  2BH2 A;  1Q12 A;  3MZ5 A;  1PTO H;  1ZXT A;  3K5L A;  1FVI A;  2IJ0 A;  3SK8 A;  2ZJQ A;  3NEM A;  4FXK C;  1XWE A;  2F3V A;  2OT2 A;  3T1H L;  1FJG L;  4K5V A;  1NUC A;  4DR7 L;  1ILP A;  1A62 A;  2FMC A;  3ONA B;  4C3H G;  2JK8 A;  2AQ2 B;  3D4D A;  1B53 A;  1S5E D;  2XWJ B;  3A8K E;  3SK5 A;  2YYZ A;  4B3R L;  1IW7 D;  2JEA I;  1EY9 A;  3NTI A;  3PV0 A;  2NN6 G;  3J80 c;  4QUC A;  2UXD Q;  4QGU A;  1I4P A;  2EXD A;  1FR3 A;  2O4X A;  1HQR D;  1CQF A;  4A93 G;  3A8J E;  1EIF A;  2VZA A;  4WRD A;  1Y69 U;  1EFI D;  1ENF A;  1CKN B;  2EJG C;  4CDF C;  1EY0 A;  1PRT B;  3AU7 A;  4TQU S;  4NXN L;  4DR5 Q;  3ULL A;  1HHV A;  4QB4 A;  1TKW B;  2HCI A;  1Z7T A;  1Y8P B;  1W6K A;  2K32 A;  3I4N G;  1JIC A;  4X3T A;  4AQY Q;  3M7N A;  1KNA A;  4X62 L;  4DAP A;  1N8R C;  1K0R A;  4JV5 Q;  3I91 A;  1TS3 A;  2EE1 A;  4K2K A;  5DNF A;  1TY0 A;  3PMF A;  5IYD H;  1X6O A;  1CT1 D;  1LUZ A;  2CKZ B;  4X65 Q;  1O78 A;  4L5R C;  2VB3 X;  1SXT A;  2R7Z B;  2OQ0 A;  3G6E A;  4QUF A;  4LF8 L;  4IFD I;  5C4X B;  2D0O A;  2RDG A;  2LXJ A;  3HOY H;  2AQ3 B;  3PUZ A;  3U4Z A;  4X66 Q;  4H13 C;  5IYD G;  2K5Q A;  3M7G A;  4NXM L;  1JB3 A;  4MTN A;  4A3I G;  1MD2 D;  3WWV A;  4N9P A;  3ITP A;  3J81 c;  1FNV A;  2FHT A;  5M5Y H;  1I6H H;  2KJX A;  4LF7 L;  2XWB B;  3RD4 A;  1E2V A;  4UDU C;  1Y1W B;  4K0K L;  2Z6K A;  2IX1 A;  4XQN A;  2SNS A;  3RZO H;  5LMU L;  1SMX A;  2A1A A;  1K8O A;  1IYU A;  1EY8 A;  2JEB I;  1VQN A;  4L5T A;  4XYO A;  3AB9 A;  2B2W C;  2FMM A;  3FKI G;  4A4I A;  2HDM A;  4CDC C;  3KLS A;  4AYB E;  3HOV H;  4FVM A;  1N33 L;  5F2D A;  4BS9 A;  1IYV A;  1A15 A;  5C0X G;  5C5M A;  4APV A;  2PYK A;  4R4C A;  3KLW A;  1WTX A;  3J7Z C;  3NTK A;  1UEB A;  1GUN A;  1A3V A;  2PPB C;  3SEB A;  1K3R A;  3FP9 A;  1JB7 A;  2A8V A;  1NR4 A;  3C46 A;  4ZQ3 A;  5IOC A;  3NBI A;  3CME A;  1LT4 D;  3J80 i;  3NTH A;  1JJC B;  2XNA C;  2A5H A;  1NE3 A;  4RG1 A;  2E2I B;  1VQB A;  2JE6 I;  4C56 C;  1I4G A;  1NSN S;  1AW7 A;  1CHQ D;  2K6A A;  5J39 A;  3BS1 A;  2F03 A;  2G5D A;  1SFO B;  4C3I G;  2HIX A;  2EY2 A;  3MHB A;  2Q8T A;  1X54 A;  1PTO D;  2Y0S E;  3HS0 C;  4DV4 L;  4R4I A;  1HZC A;  3RUZ A;  2VQE L;  3SHL A;  3A74 A;  2NVQ B;  3CCV A;  1NMF A;  1U0L A;  1JE5 A;  3E0J A;  2A73 B;  1U4R A;  3G48 A;  4BXX H;  3EA6 A;  2RHQ B;  2ZT9 C;  4A3C H;  1N32 Q;  1DOL A;  3QO2 A;  5CMD A;  3MFY A;  2EZV A;  1PYS B;  4G7Z C;  2F0F A;  4RKB A;  1C9O A;  2O5J C;  4WJW A;  4POG A;  1L0X B;  3NQI A;  5C4X H;  1GUW A;  5G3L D;  1BNZ A;  2KEE A;  2RSO A;  4XQQ A;  4A3M B;  4F87 A;  1F2Z A;  1D1I A;  1CA5 A;  2AQ1 B;  3GTM B;  1VQK A;  1G6P A;  4B08 A;  4OIJ A;  2QDL A;  3J7Y W;  3C1F A;  3V2T A;  3EVQ A;  3GTJ B;  4GN4 B;  4OGQ C;  2E2D C;  1D5M C;  4A3F G;  1K28 A;  5ELO A;  1K3B C;  1GM5 A;  1KIX A;  2X69 A;  4DR3 Q;  4UP9 A;  1EWH A;  2A6E D;  2IHE A;  3EIV A;  2A6H D;  1SE8 A;  1WI5 A;  3KOJ A;  4J15 A;  4DR2 Q;  4A3I B;  1EIG A;  3BDL A;  2L4N A;  1B50 A;  1Q82 C;  2Z8L A;  1SNO A;  4N8F A;  5IGE A;  4DV5 L;  3BYY B;  5C0X J;  4ULL A;  5KND A;  2R93 H;  4FDB A;  3OMC A;  1SYC A;  4EQP A;  3VYR A;  4DXF A;  1HNX L;  1BCP B;  3S1N H;  5IYC H;  3VR3 A;  1M90 C;  3UE0 A;  1BBW A;  3OHX C;  4XDX A;  4GNX A;  1S72 A;  5AFW A;  1GJX A;  4KY5 A;  5DLQ E;  1G8Z D;  3PGZ A;  2YTX A;  4NKL A;  1I4Q A;  3L9A X;  1EOV A;  2JA8 B;  5JPN C;  3K58 A;  3LX0 A;  3DMU A;  2L9H A;  3SE0 A;  1YNJ D;  3CU7 A;  5EBD A;  4JI8 Q;  3J80 E;  2EVB A;  2AUJ D;  2VUM H;  1H9M A;  4QL5 A;  2B2U C;  3T1H Q;  1DM0 B;  1O7Y A;  1BXT A;  4EVO A;  4L5S A;  5D3I B;  4JI7 Q;  4ZCK A;  1D5X C;  1I5F A;  3FPU B;  3M4P A;  4DV2 Q;  2WIN B;  1XJV A;  1J6Q A;  1SE2 A;  5ELC A;  1VQJ A;  3I72 A;  4TKO B;  1I6H B;  3BDO A;  4B3T Q;  1H95 A;  1WFQ A;  1TWH B;  4GKK L;  1I4R A;  1YNN D;  3I73 A;  4LFC Q;  1SYG A;  3W1G A;  2RA4 A;  1VQ5 A;  1I50 H;  2HD3 A;  3D3R A;  2UXC L;  3MXU A;  2PMZ E;  3EN2 A;  3ND9 A;  4X3K A;  4NXM Q;  3QWN A;  2OCE A;  3GTP H;  1LAC A;  4PQX A;  3HOX G;  3M9B A;  3IAY A;  1JC7 A;  2XVS A;  4DV0 Q;  1DON A;  3T1Y L;  2VQF Q;  2WP8 J;  3S1N B;  1O7L A;  1QUQ A;  1B70 B;  4X3S A;  1RF2 D;  3U9O A;  5AJ3 L;  2HIV A;  1E1O A;  4BWG B;  2B3G A;  2L11 A;  5LHY 1;  4FF3 A;  1GHK A;  1HR0 W;  3STB D;  4JI4 Q;  4WOR A;  3W1B A;  1QVF A;  1F9R A;  1LT6 D;  4EQ5 A;  5KNB A;  1HZ9 A;  1NJI C;  3PIP 3;  3W3A A;  4A3K B;  2GVB A;  4A3M G;  1UAP A;  1BBX C;  2G9H D;  1X3Q A;  1PTO C;  1G2S A;  2K5H A;  1FL0 A;  4B9W A;  2XSC A;  2OEO A;  3IFD A;  1CI3 M;  1PRT C;  5FLM G;  1JQY D;  1XNQ Q;  4ID6 A;  3CCL A;  3R8B A;  3OMG A;  4HN7 A;  4K2L A;  3CMA A;  4A3J B;  5EBC A;  2F0I A;  4L5Q A;  3OIP A;  2ASB A;  2K33 A;  2L12 A;  1FD7 D;  2NVX H;  2L55 A;  1K0S A;  5IP9 H;  3BDC A;  2UXC Q;  1TR5 A;  2B2V A;  4HIM A;  1GD7 A;  1A3U A;  2UXD L;  1TS2 A;  1QUQ B;  3TN2 A;  3NHH A;  4JBM A;  5M5X H;  2JA7 G;  4GKK Q;  4FXG C;  3UDF A;  4DR1 Q;  3MXP A;  4BBS B;  5E4X A;  4IN3 A;  3SVM A;  2EYO A;  1MKH A;  3CCE A;  1T9H A;  1VQP A;  1XPR A;  2MHV A;  5ELF A;  1I3Q H;  4IUN A;  5IGF A;  1F9P A;  3BVZ A;  4K6L A;  1U5K A;  5IT9 E;  2R92 G;  1Q3L A;  1VMC A;  1LO5 D;  2WB1 B;  2C5C A;  4FP5 D;  4M1U B;  5FOB B;  1C0A A;  5EQ0 A;  2MFI A;  2Z9H A;  4UAI A;  2B8G A;  5EJW A;  2R6G A;  1HFG A;  1TWG B;  3M4Y A;  1IL8 A;  1SN8 A;  4PV1 C;  4XYQ A;  1DD2 A;  4JBJ A;  4K8I A;  1IL2 A;  2HUG A;  3G71 A;  4RWS C;  5I4D A;  5EPJ A;  3BZC A;  2F3I A;  4X66 L;  1LM0 A;  4LF9 L;  2F52 A;  2NZ1 D;  2OTL A;  4JOI A;  3HOW G;  2NB0 A;  3MXN A;  2RKS A;  1HQM C;  1QOH A;  4DNT B;  3GO5 A;  1I4X A;  2F0L A;  5LL6 S;  1MJE A;  4LMQ D;  1S5B D;  5E4W C;  1KL9 A;  2E2H B;  1AE2 A;  1TWA H;  4X3U A;  1GOZ A;  2WAQ B;  1SE4 A;  2LFN A;  1EY5 A;  2UUC L;  1ICF B;  2C9O A;  1LTG D;  3GTG B;  5KNC A;  4JI5 L;  4C3J G;  4K8J A;  3HOX B;  1X3P A;  3CAM A;  1HCZ A;  1HTP A;  1VQ4 A;  2K1B A;  3L7Z C;  3NPP A;  1HZB A;  1CZW A;  1SBB B;  4LW1 A;  3C2P A;  5IT9 L;  3MC0 B;  3NXW A;  4JBW A;  4RHS A;  2F0V A;  4NP5 A;  2F4I A;  2NBF A;  3L3O C;  4OWW B;  3LWE A;  1AFP A;  2LMC B;  1JCK B;  2NVT B;  3CQZ B;  3OPO A;  3FVQ A;  3OIQ A;  1C8C A;  4A3G H;  1ESF A;  3I4N H;  2K5V A;  3H6M A;  2PQE A;  1UNS A;  4JPB W;  4J8Q A;  3DEP A;  3T13 A;  1GVP A;  4OIK A;  1BCP D;  2BA1 A;  5JEA G;  1JJ2 A;  1BDO A;  3M85 A;  3GTP B;  3GTK B;  1EZ8 A;  4P2C B;  1SYD A;  3S9W A;  3ERO A;  3I4M B;  2NTS A;  1NBW A;  3AQQ A;  3BZD B;  1PA6 A;  5A2Q E;  2EYP A;  2VB2 X;  1B44 D;  1VQI A;  4GN3 B;  2A6E C;  1N34 Q;  3WDN A;  3TP6 A;  1PV4 A;  4Q0F A;  4LFA Q;  3S14 H;  4B3M L;  4R4Q A;  1GUS A;  4C2M H;  3PSI A;  4IZ8 A;  3OTO L;  2DGY A;  2OF1 A;  4PMB A;  2MJ8 A;  2J4X A;  5FLX L;  2D2C C;  2WFW A;  5J22 A;  1C48 A;  2E8G A;  2A19 A;  1FGU A;  2JA6 B;  1CHP D;  4DV7 L;  3V05 A;  1K8A C;  2B2Y A;  1E3P A;  1RL2 A;  4A3F H;  3CC4 A;  3HGB A;  1A2T A;  1VQG A;  2JSO A;  3CCS A;  2RSN A;  4DKA C;  1Z47 A;  2N3S A;  4EX5 A;  4LF5 L;  1XTC D;  3UDG A;  3RZD B;  2B29 A;  2HHH L;  2F0D A;  1TXY A;  2OQK A;  3KFU A;  2PQA B;  2QIL A;  2H4O A;  4KMU C;  3CCM A;  4A3K G;  4HID A;  5IWA L;  3MAQ A;  3HOU G;  4AH6 A;  3HOZ G;  3D6C A;  3MXG A;  2PW5 A;  4YY3 L;  2M9V A;  3KLR A;  1CZG A;  1PH2 A;  1JR0 D;  2NN6 H;  5FLX c;  5FO9 B;  1RKN A;  5BR8 L;  3PF4 A;  2LS0 1;  4A3E H;  3D6W A;  3HOY G;  1I94 L;  4XTC S;  1WD0 A;  3H3V I;  2KA7 A;  1TY2 A;  1LTT D;  1CSP A;  1ENC A;  4DV6 L;  3TRE A;  5C4H A;  2K52 A;  3A5Z B;  3CW2 C;  1RD9 D;  1TWG H;  1KQS A;  1HNZ L;  1Q90 A;  3B6Y A;  4JI1 L;  3TP7 A;  3NQT A;  4C3J B;  4JBK A;  3CC2 A;  2DUD A;  1UE7 A;  2L15 A;  1VQM A;  4DV0 L;  1TWF B;  3VYS A;  4LWC A;  4EGV A;  1D2B A;  1D5Z C;  5DM6 3;  2ZXP A;  3EFX D;  4PZ7 A;  1X56 A;  2J7Z A;  3HRZ C;  1KAB A;  1OXX K;  1TII D;  5L37 A;  5CBE E;  4BBS H;  2YTY A;  4WJ4 A;  4YIJ A;  2YV5 A;  4CHT B;  5DAU A;  5EPK A;  3TBI B;  5C3E G;  1TQO A;  3A8I E;  3HKZ E;  4HJ5 A;  4RGO S;  3S15 B;  4DNR B;  3TME A;  1WTP A;  4X6A H;  1TWC B;  2RDF A;  1LAB A;  1PFB A;  2BA0 A;  1EU3 A;  2PNR C;  5E7N A;  3VDY A;  3MWY W;  5IP9 G;  4JI2 Q;  1BVS A;  4NXN Q;  1JOQ A;  1XYI A;  4JI8 L;  4F8M A;  2RHS B;  1EY7 A;  3NBH A;  4JW0 A;  2RCN A;  1BO0 A;  3LNN A;  1SMY D;  1HH2 P;  2KHI A;  2Q8I B;  4Q5V A;  1JWU D;  4LFB L;  2KVM A;  3F1Z A;  2E2I H;  1MI2 A;  3S17 B;  4OWX B;  3PO3 H;  2CWP A;  2KHS A;  4HIK A;  2WKD A;  3HOZ H;  1D8L A;  4A3B H;  3D8G A;  3DEO A;  2WAQ G;  3IRB A;  4ODG A;  1CFM A;  1Q8I A;  1DOK A;  1VMP A;  1K8G A;  1QZG A;  1VQ9 A;  1H9K A;  2HQE A;  2SDF A;  5C3X A;  2K28 A;  1ML0 D;  1I4H A;  3HG9 A;  3U58 A;  3H0G H;  4OHJ A;  1HUN A;  2BDO A;  2PZT A;  1Y1V G;  4ME5 A;  3TRZ A;  1A0I A;  3CF5 A;  5I6Y A;  5JVH 3;  1QNU A;  1V8Q A;  2ZTC A;  3DWQ A;  3CD6 A;  4DR2 L;  2KCN A;  1XPU A;  3J81 j;  1MJC A;  2NVY B;  4IJL A;  4R1J A;  1OXS C;  3P7J A;  2PI2 A;  1A2U A;  2F0O A;  1T5E A;  1FGB D;  4A93 B;  3QG1 A;  2DN8 A;  2IX3 A;  5I2Y A;  1XMO L;  3HOU B;  4DAY A;  4BY1 G;  2FFK B;  1QWY A;  2RCF A;  3GV3 A;  4PG3 A;  1E1T A;  5CV8 A;  1XPO A;  3I4M G;  1EYD A;  5GAH C;  4LJZ C;  2CQO A;  5C44 G;  1EYG A;  1S4Z A;  1ET6 A;  2WV6 D;  1WTW A;  1IBM Q;  1HZA A;  2R92 B;  2SOB A;  2HCC A;  1U4M A;  2IHF A;  2UUA Q;  2E74 C;  3M4O H;  4KY6 A;  4FNF A;  1PFS A;  4N8X 1;  2QA4 A;  4R8N A;  3QOJ A;  1B8A A;  5M5Y B;  3U9S A;  2ZM6 L;  4QIW B;  5C44 H;  2R93 B;  1SYF A;  2JA8 H;  3PIP A;  1J5E Q;  1ESR A;  3PUY A;  5DEH A;  3HOV G;  2V4D A;  2R61 A;  2B2T C;  4S3S A;  5JEA J;  5C4X G;  1D1K A;  4WFN 3;  1PH7 A;  3LWU A;  1P16 A;  2AWO A;  3DUZ A;  5LMN Q;  1OO9 B;  1E24 A;  4ZKB B;  4H02 A;  2NN6 I;  4JI4 L;  1KC8 C;  3D4R A;  3Q8D A;  3A7A B;  4R4T A;  5ELN A;  1BBU A;  3FEW X;  3F2U A;  3PQI A;  1VQ6 A;  4B9X A;  1VQO A;  2D5D A;  1MBY A;  4UP7 A;  2Z6K C;  5DM7 3;  2DJF C;  3A54 A;  4RGN A;  1MIU A;  1EL0 A;  3I4L A;  4LF9 Q;  4A3I H;  3D31 A;  3C3L A;  1PZI D;  2ENB A;  3CRK C;  2QW7 A;  4CDD C;  2VQF L;  1RCV D;  4PMW A;  2B2T A;  4X64 L;  5ISR A;  3MXN B;  2JA6 G;  4HCE A;  4YHH Q;  4CDE C;  3J7A V;  2EQS A;  4QCL A;  4C3H B;  5C4J B;  3R3O A;  1KDB A;  2K01 A;  4YCW A;  4LFC L;  1BCP F;  1CM9 A;  1VQA A;  3Q0A A;  4LAA A;  5CBA E;  4O1N A;  1T5X D;  4IUQ A;  1VQC A;  2WB1 E;  1N33 Q;  1JOO A;  4RMF A;  3VA5 A;  4IUR A;  1WCM G;  1IBK L;  1R4P B;  3T4A C;  2F0N A;  4ZLT F;  4R8I A;  4K5X A;  1CKN A;  1KD1 C;  5HUR A;  4JI7 L;  1YVC A;  2E5L Q;  4OO1 G;  3H09 A;  5J3B A;  3M4O B;  2N8N A;  2R7F A;  2HQL A;  1SNP A;  3GTQ H;  1F2M A;  2PZW A;  4HCS A;  1G91 A;  1EZ6 A;  1BF4 A;  1KRS A;  2QKI C;  3CPW A;  1SND A;  4X64 Q;  3F2D A;  3TZU A;  4HSV A;  1NCV A;  4DV3 L;  1DYQ A;  2A69 D;  1YJ9 A;  1AN8 A;  1KAW A;  4Z9C B;  1OXT A;  4TVA B;  3RN5 A;  1NNX A;  3FMC A;  3T53 B;  1VQ7 A;  2PQA A;  1WCM H;  4KI0 A;  3EQL C;  5FJ8 H;  2NZH A;  2CHB D;  4V0B A;  3GTO H;  4A93 H;  2CVR A;  3H91 A;  4DGZ A;  3T16 A;  3S2H B;  1H9J A;  2F0K A;  5BN4 A;  3J7A 5;  3DHQ A;  3S1M B;  4KK7 A;  5T1G A;  1W6J A;  2F1M A;  1ZYR D;  5KEE A;  1Z6H A;  1R4Q B;  1YZ6 A;  5C6A A;  4B3S L;  3E3X A;  3GV6 A;  2UUB Q;  3FKI H;  2L5T A;  3DM1 A;  3VR2 A;  3QB3 A;  4FO2 A;  3SXH A;  4YCV A;  4AYB B;  4B3T L;  3Q24 A;  5EKK A;  2KED A;  3IFT A;  1N36 Q;  2AWN A;  4XQJ A;  2F0Q A;  5FK9 C;  4F7X A;  3BYT B;  1KTK A;  3S17 H;  2PCF B;  4BY7 G;  5ELB A;  5FO7 B;  2F0T A;  1AZP A;  2I07 B;  2X6G A;  3FPP A;  5BN5 A;  2DY8 A;  5KIX A;  2B63 G;  3RZD H;  5GAD C;  4POF A;  1X32 A;  1Y1W G;  3P20 A;  3S2H H;  2G9D A;  3QOL A;  3KF6 B;  3HOZ B;  3HFZ B;  1DCZ A;  3NK9 A;  2Q2T A;  4DR4 L;  2L0C A;  3GTJ H;  5IP7 H;  4DN4 M;  1SSO A;  2Q2H A;  5C3E H;  2DY7 A;  3NSW A;  4OEM B;  1PFM A;  1U9R A;  2K75 A;  1I6V C;  1NAP A;  3GTM H;  1CK1 A;  1HJP A;  1CKM A;  4A3M H;  3H3V H;  4K6D A;  4P75 A;  4CGY B;  1PTO F;  1U4P A;  3ZJY C;  3KDF B;  2P5Z X;  1UWV A;  1EQR A;  4QY7 A;  5M3F H;  2I5H A;  3JAM L;  3S24 A;  4Y7N H;  1PRT F;  1C4Q A;  4C2M B;  1GXD C;  2B2V C;  1STH A;  3CHB D;  4C3I H;  4NW2 A;  4R4O A;  4RHR A;  4XT1 B;  1DXM A;  1ZYR C;  2JA9 A;  3G4S A;  4B3M Q;  1CSQ A;  2NVQ H;  5IOD A;  4YWK A;  1ICW A;  2UUC Q;  2YU9 H;  1EYA A;  5EPL A;  4GOP A;  1Y8O B;  5A35 A;  3SGI A;  1STE A;  5T1I A;  4A3D G;  3K80 C;  3D4W A;  4JOI C;  1UE5 A;  1HA6 A;  4DK1 A;  3LGJ A;  4JVZ A;  3R2T A;  3CXC A;  3KF8 B;  2R7Z H;  1MGS A;  1PLF A;  3PUW A;  3AFP A;  3I4O A;  3J80 L;  1PYW D;  4I65 A;  1RIP A;  2IWH A;  4HJ8 A;  3A0J A;  1CTM A;  4K14 A;  4BBR B;  1WTR A;  4N9T A;  2XIW A;  2KBN A;  5M3M B;  3K5N A;  3RLN A;  1PH8 A;  1PH4 A;  5M5W B;  4R9W A;  3OSO A;  1PH6 A;  2JA7 H;  1XNQ L;  5C44 B;  5C5L A;  3SR1 A;  4HR7 B;  5I2X A;  1W3S A;  1VQD A;  5IGD A;  4LF6 L;  5JJZ A;  1STY A;  3A55 A;  2EPB A;  3W5O A;  1JOR A;  4XIG S;  4IOA A;  5IY0 A;  1SR3 A;  3AEV A;  1Z9F A;  1XMQ L;  2Q8R E;  5KYI A;  3TQY A;  2EYJ A;  3X3M A;  4IFD J;  3NWT A;  2M2L A;  2R3Z A;  2CCZ A;  3KK7 A;  2WII B;  1AEX A;  4DXG A;  2JN4 A;  3MA2 B;  1VCI A;  2EYL A;  4HJ7 A;  3WOE A;  4C1N I;  1PXU A;  3AMU A;  4DR6 Q;  4RA8 A;  4A3F B;  2EY5 A;  4DFA A;  4CJ0 B;  2ZTE A;  5K5P A;  1BKB A;  1A3T A;  1SLJ A;  3HKS A;  1LTB D;  3DM3 A;  1L0W A;  1KHI A;  4JI3 L;  1YIT A;  2MP1 A;  2NTT A;  1LTL A;  1VQH A;  2NWG A;  2B63 B;  2EJF C;  3SK6 A;  4LF4 L;  1F9Q A;  3HOU H;  1X3G A;  1Q81 C;  3HKZ B;  2D0P A;  2KCT A;  3SK4 A;  2AMC B;  2F0P A;  2N55 A;  4QF4 A;  2NVY H;  4MNO A;  1PFN A;  5BR8 Q;  4JCV E;  4QQB X;  2B8F A;  3F2B A;  1L1O A;  4RGT A;  4A3J G;  2B2Y C;  3BG3 A;  4A3B B;  1YJN A;  3OW7 A;  3CQZ H;  1MHW C;  5JEA H;  1D7Q A;  4DR1 L;  1STG A;  3HZX A;  4CKE A;  5M3F B;  4GS3 A;  1FNU A;  2EXZ A;  1X65 A;  2J0T D;  1SDF A;  4LF4 Q;  2NYZ D;  2PW7 A;  4OO1 H;  4A3J H;  3ZYY X;  1LTI D;  3P1H A;  1STA A;  4CBV A;  4RGM A;  1TWC H;  3BVM A;  2BDN A;  4ALP A;  3GTG H;  1EUJ A;  4FF1 A;  1GO3 E;  3S15 H;  4QJF A;  1IZ6 A;  2HDL A;  2E2H H;  4IO9 A;  1HNX Q;  1B1Z A;  4FXD A;  4LUO A;  1WTH A;  3QR8 A;  2BOS A;  4KKU A;  4B3R Q;  3CCQ A;  1K9M C;  3OTO Q;  1X55 A;  3MVV A;  4GLX A;  2RBM A;  2N49 A;  1IKM A;  3I2Z A;  4ZAI A;  1H9R A;  2K5D A;  4BBR G;  1BR9 A;  4ZYS A;  5JOB A;  4X62 Q;  4KN7 C;  2O5I C;  1J5E L;  2B63 H;  2CH4 A;  4G7O C;  1G2T A;  3K7A H;  4PZ8 A;  4DNI A;  1Y8N B;  5HY6 A;  3N52 A;  3TP8 A;  5AJ3 Q;  5KRU A;  4RCN A;  4BY7 B;  3CCU A;  3PO2 B;  1NR2 A;  3K7U C;  4NPS A;  1VF7 A;  4JG2 A;  1QB5 D;  4IUV A;  2I0Q A;  1F2L A;  1JMC A;  4KV6 A;  1WCM B;  4A3E B;  1JWM D;  1CA6 A;  2A74 C;  2XN9 C;  1UE6 A;  2PZU A;  4QIW E;  4DK3 C;  3Q6S A;  3J81 L;  1Y1V H;  1H9S A;  2ICI A;  1EWC A;  2O2L D;  4IPH A;  4UPA A;  1HTL D;  4FF2 A;  1F2Y A;  3PO2 H;  4BA2 I;  3H3V C;  2K04 A;  1YNX A;  4DK6 C;  4KJO A;  1NMG A;  4JK1 C;  3JAM E;  1PDQ A;  3NEL A;  2MPM A;  2QCP X;  1PH3 A;  4AIM A;  2NVX B;  3M4Q A;  3FRP B;  5IE8 A;  3WOF A;  4GNX C;  1IXR A;  3BJU A;  1YNN C;  4GKJ Q;  4MN3 A;  1VF5 C;  1K73 C;  1B7Y B;  4QMG A;  4LF6 Q;  1STN A;  4OX9 Q;  1QZH A;  3KF6 A;  4A3G G;  1KNE A;  1SYB A;  1ZKO A;  4DAV A;  1CKO A;  1K83 B;  2E2J B;  4H0L C;  4C3H H;  5C4J H;  4BBS G;  1HNW Q;  5JVG 3;  1X9N A;  2F0G A;  2LSS A;  4A3D B;  4GOP C;  1EEI D;  2LXK A;  1VQL A;  4DV1 Q;  1GUG A;  1AZQ A;  1WJJ A;  3AYH B;  1SRU A;  2B39 A;  2WAQ E;  2WB1 G;  3A56 A;  1IW7 C;  4NDX A;  1O80 A;  4DR4 Q;  2CQA A;  4GN5 A;  4KKT A;  3GTL H;  4DV5 Q;  3OW2 A;  1TS4 A;  4KTA A;  4HJ9 A;  1G6Z A;  2QF7 A;  1LYL A;  3NE5 B;  3ULP A;  4JI6 L;  3S1Q B;  4IPC A;  1J8I A;  5FO8 B;  3ICE A;  1E7Z A;  1Q7Y C;  4O2D A;  2Z4I A;  3OYY A;  4GKJ L;  5TSS A;  2R7Z G;  4XXE A;  3CP0 A;  1Q1B A;  2FJ2 A;  1WD1 A;  1XNR L;  1XX8 A;  4DR3 L;  3K5M A;  2Z6B A;  1RHP A;  3KBG A;  4IJH A;  1QG7 A;  5LMN W;  4L63 B;  3I4M H;  4I7A A;  4K0K Q;  2WAC A;  1DOM A;  1F9S A;  4LF7 Q;  4C3I B;  5IYB G;  2XRS D;  5KGU A;  3I7F A;  2SNM A;  1SYE A;  3JAM i;  3M3Y B;  3F8T A;  4JI1 Q;  1K83 H;  4JYA L;  4LF8 Q;  2M00 A;  1PMR A;  1HNZ Q;  5CV5 A;  3VYU A;  2MUY A;  1Y14 B;  4RKL A;  2BCO A;  4X65 L;  2LKV A;  1L2F A;  2VQE Q;  1EY4 A;  3L0O A;  4FYD A;  1SFO H;  4DUZ Q;  1M4V A;  4DV4 Q;  1N36 L;  1SNM A;  4DUZ L;  4LUV A;  1XMQ Q;  4DUY Q;  4LNQ A;  4P71 A;  1KLU D;  4AQY L;  1CUK A;  1V43 A;  5IT9 c;  1PVO A;  1TWA B;  1AP0 A;  1B3A A;  1YHA A;  2ID0 A;  1IBL L;  1D6E C;  4H7B A;  1Q86 C;  1Y1V B;  2TSS A;  5H1S E;  4DR5 L;  3OOC A;  4IOC A;  3FKI B;  2IT1 A;  3BU2 A;  4CJ1 B;  4JI3 Q;  5FKA C;  3T1Y Q;  3TEH B;  3URY A;  3VR6 A;  1B9M A;  1YHB A;  1EIH A;  1JJG A;  3E5S A;  4HTH A;  2I5M X;  2Z4H A;  1ROD A;  1LTR D;  2WKC A;  2H5X A;  4ZUJ A;  4GZY C;  4L8J A;  1II3 A;  1EQQ A;  1BCP C;  2RQX A;  4DR6 L;  1PZJ D;  4YWM A;  5I9O A;  2TMP A;  1HPC A;  2YU9 B;  4XT3 B;  5GQO A;  1GUT A;  3RR5 A;  4KD3 A;  3NP8 A;  4PNY A;  2XGT A;  1JOK A;  1LT3 D;  1STB A;  5C4Z A;  5GAG C;  3I70 A;  3A5U A;  2KCC A;  5E3F A;  1EEF D;  2I5L X;  3QIA A;  5EAY A;  1FJG Q;  5HGT A;  5K36 H;  2NUC A;  5LMU Q;  2Z1C A;  2BE5 C;  2H1E A;  5CV4 A;  1EYC A;  3DWA A;  1A6X A;  1ILQ A;  1EFW A;  3OWF A;  2VXW A;  3K8A A;  4A3E G;  1G29 1;  3HKZ G;  2EDG A;  3BZK A;  1LT5 D;  4E6I A;  2F0J A;  2K5W A;  5IP7 G;  1N9W A;  2JJQ A;  2IY5 B;  4KHV A;  2MQH A;  4OXP A;  4Y7N B;  1P8L A;  3H94 A;  4NMZ A;  3E0E A;  4A3C G;  4V19 0;  2JA5 G;  2IPK D;  1RTO A;  3NBH B;  1B3Q A;  4KHP Q;  1F77 A;  1RTN A;  3K6O A;  4F88 A;  3ERS X;  3QJY A;  3KJO A;  4A76 A;  2K50 A;  4HED A;  1EWI A;  2AKW B;  1SMY C;  1SJH D;  2VUM G;  1B4O A;  5COY A;  3W2D A;  1JWS D;  1O7Z A;  3UE1 A;  3TP5 A;  3R2I A;  2E76 C;  2PO4 A;  2PI2 E;  3VYT A;  2F0S A;  3H15 A;  4PZ6 A;  3Q23 A;  2KEN A;  3L2P A;  4OEL B;  4BA1 I;  2N88 A;  2JA5 H;  4YCU A;  4YWL A;  2IL8 A;  3S1M H;  5FLX E;  2CW0 D;  3GP7 A;  4P72 A;  4JI0 L;  1QVC A;  1VQF A;  2B2W A;  4TSS A;  4H44 C;  4RAU C;  2ES2 A;  2K7V A;  1KAA A; 
#chains in the Genus database with same CATH homology
 1LV9 A;  4G7H C;  1WTV A;  4HSP A;  4IFD H;  1S5C D;  5K36 G;  3FDT A;  5M9O A;  2JYO A;  4G57 A;  1HA5 A;  1H9S B;  5D65 A;  4DA2 A;  3HOV B;  3NUC A;  3IKJ A;  5CGK A;  3C1E A;  2D62 A;  3A7L A;  2F3W A;  2A69 C;  2F0H A;  4IUP A;  3O13 A;  1SE3 A;  5LL6 X;  1FYC A;  1HXY D;  1V1P B;  1ZEQ X;  4J1M A;  2DNE A;  4KD4 A;  2I46 A;  3RLF A;  2E75 C;  4KY7 A;  5C3W A;  1SEB D;  2B2U A;  1EU4 A;  2JA7 B;  1KLG D;  3CKI B;  2F0M A;  2CW0 C;  1J9O A;  1E2W A;  4DK0 A;  2DNC A;  4K5W A;  4EQN A;  4IQZ A;  5KYL A;  3PUV A;  5CV7 A;  4KJN A;  3TDQ A;  3VR5 A;  2X6L A;  3GD7 A;  3GQB A;  4A3G B;  1BUV T;  4CKC A;  3PO3 B;  5A2Q L;  4ABN A;  1QNK A;  3NWS A;  1B2T A;  1HRJ A;  4U67 3;  1RDP D;  1B9N A;  1QJO A;  2MGS A;  5J1Z A;  4RH6 A;  5C0X I;  4U68 A;  3V96 A;  3DXJ C;  1FNW A;  5CV6 A;  1LTA D;  1RJT A;  1TVX A;  3P75 A;  3HP3 A;  2IX0 A;  1L0Y B;  4C1N K;  4ZK9 B;  4PMC A;  1WVL A;  2F0E A;  3MTS A;  3Q22 A;  4DF7 A;  2A68 C;  2A6H C;  4RFB A;  1EY6 A;  3ND8 A;  1KDC A;  5CV9 A;  4OO1 I;  1ONL A;  2KOL A;  2EY6 A;  3KUP A;  1ENA A;  1EOT A;  5EGT A;  2K03 A;  1PRT D;  3UI2 A;  1OXV A;  4ZKC B;  1PZK D;  2JA5 B;  5BN3 A;  3K7A B;  5ELD A;  3IL8 A;  1M8A A;  3J81 E;  1DZ1 A;  5CYU A;  4IUT A;  3N6R A;  3SDZ A;  1UUP A;  4J6H A;  3G7L A;  1QE6 A;  2SEB D;  3RZO B;  1R9T B;  2LY7 A;  3GTQ B;  1BOS A;  3I90 A;  1MSH A;  3S1R B;  1XXG A;  2RDH A;  2ZXR A;  3KBX A;  1TU2 B;  1U4L A;  4CJ2 C;  4TRD A;  2Y0S B;  2AUK A;  2QEJ C;  4IUU A;  1CQV A;  1TS5 A;  4OL7 A;  4G4K A;  1GUO A;  2RVL A;  2XRQ D;  1HFN A;  1JE4 A;  1ET9 A;  1K8M A;  1MSG A;  2ICE C;  3HOY B;  5D3D A;  4M8A A;  3K59 A;  1E2Z A;  3S2D B;  5JPM C;  1EQV A;  1I50 B;  1QIL A;  3GTL B;  2QDB A;  2EJM A;  5JAV A;  3T56 B;  2JP1 A;  3S16 B;  3TZD A;  4CKB A;  3CRL C;  1SJE D;  5EKL A;  1S5D D;  3HOW B;  2D9U A;  5EKI A;  1SNQ A;  1QCB D;  4KN4 C;  2VUM B;  4DU9 A;  3K5O A;  1EQT A;  4IFD G;  4L6T B;  1IHZ A;  2KQ3 A;  3BVG A;  3OWE B;  4O42 A;  4ILW A;  1DJR D;  1PTO B;  2EYF A;  1E0B A;  4KKS A;  3HEJ A;  4HMJ A;  2EYM A;  4FF4 A;  3K57 A;  2IW3 A;  4HAE A;  5NUC A;  1I3Q B;  3VA7 A;  3PIO 3;  3DWP A;  3RMH A;  3R93 A;  1V1O A;  1UEA B;  5M5X B;  3I3C A;  3H0G B;  5G3L F;  2KUM A;  3S14 B;  5COR A;  3ERQ A;  1LTS D;  3K0Y A;  2EYH A;  3I4N B;  4RCO A;  2GA4 B;  4IAL A;  2VNU D;  2A68 D;  2FIN B;  4EQO A;  1TT2 A;  1HUM A;  1KDA A;  1GHJ A;  2PMZ B;  5ELE A;  1WTO A;  1LLR D;  1BQQ T;  5C3E B;  1Q1E A;  3J7A F;  1OXU A;  1YNJ C;  1WTQ A;  5IGB A;  4MHE A;  3T51 B;  5IIF A;  4BY1 B;  5I6W A;  3X3N A;  3KF8 A;  2ZXO A;  4MIU A;  1S5F D;  3TSS A;  4ZRZ A;  2BE5 D;  3MEH A;  3VR4 A;  1SNC A;  4HMI A;  1V1P A;  3MFG A;  2EY1 A;  3EJI A;  5CC4 A;  2OXP A;  4I7Z C;  5I9P A;  3KLS X;  3GTO B;  4LK1 C;  5C0X H;  1VDZ A;  3I8Z A;  1IKL A;  2EOT A;  2F0U A;  4KHZ A;  5IGG A;  2L1B A;  4ZUI A;  3PUX A;  2F0W A;  2K05 A;  3G6J B;  1SAP A;  5D14 A;  3E6Z X;  2JXM B;  2KEC A;  5CR3 A;  5E1F A;  5IGC A;  1Q12 A;  3MZ5 A;  1PTO H;  1ZXT A;  3K5L A;  2IJ0 A;  3SK8 A;  4FXK C;  1XWE A;  2F3V A;  2OT2 A;  4K5V A;  1NUC A;  1ILP A;  2FMC A;  3ONA B;  4C3H G;  2AQ2 B;  3D4D A;  1B53 A;  1S5E D;  2XWJ B;  3A8K E;  3SK5 A;  2YYZ A;  1IW7 D;  2JEA I;  1EY9 A;  3NTI A;  3PV0 A;  2NN6 G;  4QUC A;  1I4P A;  1FR3 A;  2O4X A;  1HQR D;  1CQF A;  3A8J E;  4WRD A;  1Y69 U;  1EFI D;  1ENF A;  2EJG C;  1EY0 A;  1PRT B;  3AU7 A;  4TQU S;  1HHV A;  4QB4 A;  1TKW B;  2HCI A;  1Z7T A;  1Y8P B;  1W6K A;  2K32 A;  1JIC A;  4X3T A;  3M7N A;  1KNA A;  4DAP A;  3I91 A;  1TS3 A;  2EE1 A;  4K2K A;  5DNF A;  1TY0 A;  3PMF A;  1CT1 D;  1O78 A;  2VB3 X;  1SXT A;  2R7Z B;  4QUF A;  5C4X B;  4IFD I;  2RDG A;  2AQ3 B;  3PUZ A;  4H13 C;  2K5Q A;  3M7G A;  1JB3 A;  1MD2 D;  4N9P A;  3ITP A;  1FNV A;  2FHT A;  2KJX A;  2XWB B;  3RD4 A;  1E2V A;  4UDU C;  1Y1W B;  2IX1 A;  4XQN A;  2SNS A;  1K8O A;  1IYU A;  1EY8 A;  2JEB I;  4XYO A;  3AB9 A;  2B2W C;  2FMM A;  2HDM A;  3KLS A;  4FVM A;  5F2D A;  4BS9 A;  1IYV A;  1A15 A;  5C0X G;  5C5M A;  2PYK A;  1WTX A;  3NTK A;  1GUN A;  1A3V A;  2PPB C;  3SEB A;  1NR4 A;  3C46 A;  4ZQ3 A;  5IOC A;  3NBI A;  1LT4 D;  3NTH A;  2XNA C;  2A5H A;  2E2I B;  2JE6 I;  4C56 C;  1I4G A;  1NSN S;  1AW7 A;  1CHQ D;  2K6A A;  5J39 A;  3BS1 A;  2F03 A;  1SFO B;  4C3I G;  2EY2 A;  3MHB A;  2Q8T A;  1PTO D;  3HS0 C;  3RUZ A;  3SHL A;  2NVQ B;  3E0J A;  2A73 B;  1U4R A;  3EA6 A;  2ZT9 C;  1DOL A;  3QO2 A;  5CMD A;  3MFY A;  2EZV A;  4G7Z C;  2F0F A;  4RKB A;  2O5J C;  4WJW A;  1L0X B;  3NQI A;  1GUW A;  5G3L D;  1BNZ A;  2KEE A;  2RSO A;  4XQQ A;  4A3M B;  4F87 A;  1F2Z A;  1D1I A;  1CA5 A;  2AQ1 B;  3GTM B;  4B08 A;  4OIJ A;  3J7Y W;  3C1F A;  3V2T A;  3EVQ A;  3GTJ B;  4OGQ C;  2E2D C;  1D5M C;  2X69 A;  1EWH A;  2A6E D;  2A6H D;  4A3I B;  1EIG A;  3BDL A;  2L4N A;  1B50 A;  2Z8L A;  1SNO A;  5IGE A;  3BYY B;  5C0X J;  4ULL A;  5KND A;  3OMC A;  1SYC A;  4EQP A;  3VYR A;  4DXF A;  1BCP B;  3VR3 A;  3OHX C;  4XDX A;  5AFW A;  1GJX A;  4KY5 A;  1G8Z D;  4NKL A;  1I4Q A;  3L9A X;  2JA8 B;  5JPN C;  3K58 A;  3LX0 A;  3DMU A;  2L9H A;  3SE0 A;  1YNJ D;  3CU7 A;  5EBD A;  3J80 E;  2EVB A;  2AUJ D;  1H9M A;  2B2U C;  1DM0 B;  1O7Y A;  1BXT A;  4EVO A;  5D3I B;  1D5X C;  3FPU B;  2WIN B;  1SE2 A;  5ELC A;  3I72 A;  4TKO B;  1I6H B;  3BDO A;  1TWH B;  1I4R A;  1YNN D;  3I73 A;  1SYG A;  2RA4 A;  3D3R A;  3MXU A;  3ND9 A;  4X3K A;  3QWN A;  1LAC A;  4PQX A;  3IAY A;  1JC7 A;  2XVS A;  1DON A;  2WP8 J;  3S1N B;  1O7L A;  4X3S A;  1RF2 D;  3U9O A;  4BWG B;  2L11 A;  5LHY 1;  4FF3 A;  1GHK A;  4WOR A;  1F9R A;  1LT6 D;  5KNB A;  3PIP 3;  3W3A A;  4A3K B;  1UAP A;  1BBX C;  2G9H D;  1X3Q A;  1PTO C;  1G2S A;  4B9W A;  2XSC A;  2OEO A;  3IFD A;  1CI3 M;  1PRT C;  1JQY D;  4ID6 A;  3R8B A;  3OMG A;  4HN7 A;  4K2L A;  4A3J B;  5EBC A;  2F0I A;  3OIP A;  2K33 A;  2L12 A;  1FD7 D;  2L55 A;  3BDC A;  1TR5 A;  2B2V A;  1A3U A;  1TS2 A;  3TN2 A;  3NHH A;  4FXG C;  3MXP A;  4BBS B;  5E4X A;  4IN3 A;  3SVM A;  2EYO A;  2MHV A;  5ELF A;  4IUN A;  5IGF A;  1F9P A;  3BVZ A;  4K6L A;  5IT9 E;  1Q3L A;  1VMC A;  1LO5 D;  2WB1 B;  2C5C A;  4FP5 D;  4M1U B;  5FOB B;  5EQ0 A;  4UAI A;  2B8G A;  5EJW A;  2R6G A;  1HFG A;  1TWG B;  3M4Y A;  1IL8 A;  4PV1 C;  4XYQ A;  1DD2 A;  4K8I A;  2HUG A;  4RWS C;  5I4D A;  5EPJ A;  2NZ1 D;  2NB0 A;  3MXN A;  2RKS A;  1HQM C;  1QOH A;  4DNT B;  3GO5 A;  1I4X A;  2F0L A;  5LL6 S;  4LMQ D;  1S5B D;  5E4W C;  2E2H B;  4X3U A;  1GOZ A;  2WAQ B;  1SE4 A;  2LFN A;  1EY5 A;  3GTG B;  2C9O A;  1LTG D;  5KNC A;  4C3J G;  4K8J A;  3HOX B;  1X3P A;  1HCZ A;  1HTP A;  2K1B A;  3L7Z C;  3NPP A;  1CZW A;  1SBB B;  3C2P A;  5IT9 L;  3MC0 B;  3NXW A;  4JBW A;  4RHS A;  2F0V A;  4NP5 A;  2F4I A;  2NBF A;  3L3O C;  3LWE A;  1AFP A;  2LMC B;  1JCK B;  2NVT B;  3CQZ B;  3OPO A;  3FVQ A;  3OIQ A;  1C8C A;  1ESF A;  3H6M A;  2PQE A;  1UNS A;  4J8Q A;  3DEP A;  3T13 A;  4OIK A;  1BCP D;  2BA1 A;  5JEA G;  1BDO A;  3M85 A;  3GTP B;  3GTK B;  1EZ8 A;  4P2C B;  1SYD A;  3S9W A;  3ERO A;  3I4M B;  2NTS A;  3BZD B;  5A2Q E;  2EYP A;  2VB2 X;  1B44 D;  2A6E C;  3WDN A;  3TP6 A;  4Q0F A;  1GUS A;  4IZ8 A;  2OF1 A;  4PMB A;  2MJ8 A;  2J4X A;  5FLX L;  2D2C C;  5J22 A;  1C48 A;  2JA6 B;  1CHP D;  3V05 A;  2B2Y A;  3HGB A;  1A2T A;  2JSO A;  2RSN A;  1Z47 A;  1XTC D;  3RZD B;  2F0D A;  2QIL A;  2H4O A;  4KMU C;  3MAQ A;  3D6C A;  3MXG A;  2PW5 A;  2M9V A;  3KLR A;  1CZG A;  1JR0 D;  2NN6 H;  5FO9 B;  1RKN A;  2LS0 1;  3D6W A;  4XTC S;  1WD0 A;  2KA7 A;  1TY2 A;  1LTT D;  1ENC A;  5C4H A;  1RD9 D;  1Q90 A;  3TP7 A;  3NQT A;  4C3J B;  1TWF B;  3VYS A;  4EGV A;  1D2B A;  1D5Z C;  5DM6 3;  2ZXP A;  3EFX D;  2J7Z A;  3HRZ C;  1KAB A;  1OXX K;  1TII D;  5CBE E;  4YIJ A;  4CHT B;  5DAU A;  5EPK A;  3TBI B;  1TQO A;  3A8I E;  4RGO S;  3S15 B;  4DNR B;  3TME A;  1WTP A;  1TWC B;  2RDF A;  1LAB A;  1PFB A;  2BA0 A;  1EU3 A;  2PNR C;  3MWY W;  1JOQ A;  1XYI A;  4F8M A;  1EY7 A;  3NBH A;  1BO0 A;  3LNN A;  1SMY D;  2Q8I B;  4Q5V A;  1JWU D;  2KVM A;  1MI2 A;  3S17 B;  2KHS A;  2WKD A;  3D8G A;  3DEO A;  4ODG A;  1CFM A;  1Q8I A;  1DOK A;  1VMP A;  1H9K A;  2HQE A;  2SDF A;  5C3X A;  2K28 A;  1ML0 D;  1I4H A;  3HG9 A;  1HUN A;  4OHJ A;  2BDO A;  2PZT A;  4ME5 A;  5I6Y A;  5JVH 3;  1QNU A;  1V8Q A;  3DWQ A;  2KCN A;  2NVY B;  1OXS C;  3P7J A;  1A2U A;  2F0O A;  1T5E A;  1FGB D;  4A93 B;  3QG1 A;  2DN8 A;  2IX3 A;  5I2Y A;  3HOU B;  4DAY A;  2FFK B;  1QWY A;  3GV3 A;  5CV8 A;  1EYD A;  4LJZ C;  1S4Z A;  1ET6 A;  2WV6 D;  1WTW A;  2R92 B;  2SOB A;  2HCC A;  1U4M A;  2E74 C;  4KY6 A;  4FNF A;  4R8N A;  3QOJ A;  5M5Y B;  3U9S A;  4QIW B;  2R93 B;  1SYF A;  1ESR A;  3PUY A;  5DEH A;  2V4D A;  2R61 A;  2B2T C;  4S3S A;  5JEA J;  1D1K A;  4WFN 3;  3LWU A;  2AWO A;  3DUZ A;  1OO9 B;  4ZKB B;  2NN6 I;  3D4R A;  3A7A B;  3FEW X;  3F2U A;  4B9X A;  2D5D A;  1MBY A;  5DM7 3;  1EL0 A;  3A54 A;  4RGN A;  3I4L A;  3D31 A;  3C3L A;  1PZI D;  2ENB A;  3CRK C;  1RCV D;  4PMW A;  2B2T A;  5ISR A;  4HCE A;  3J7A V;  4QCL A;  4C3H B;  5C4J B;  3R3O A;  1KDB A;  2K01 A;  1BCP F;  1CM9 A;  3Q0A A;  4LAA A;  5CBA E;  4O1N A;  1T5X D;  4IUQ A;  1JOO A;  3VA5 A;  4IUR A;  1R4P B;  3T4A C;  2F0N A;  4ZLT F;  4R8I A;  4K5X A;  5HUR A;  4OO1 G;  3H09 A;  3M4O B;  1SNP A;  1F2M A;  2PZW A;  4HCS A;  1G91 A;  1EZ6 A;  1BF4 A;  2QKI C;  1SND A;  3TZU A;  4HSV A;  1NCV A;  1DYQ A;  2A69 D;  1AN8 A;  4Z9C B;  1OXT A;  3FMC A;  3T53 B;  4KI0 A;  3EQL C;  2CHB D;  4V0B A;  2CVR A;  3H91 A;  4DGZ A;  3T16 A;  3S2H B;  1H9J A;  2F0K A;  5BN4 A;  3DHQ A;  3S1M B;  4KK7 A;  5T1G A;  1W6J A;  2F1M A;  1ZYR D;  5KEE A;  1Z6H A;  1R4Q B;  5C6A A;  3GV6 A;  2L5T A;  3DM1 A;  3VR2 A;  3QB3 A;  4FO2 A;  3SXH A;  4AYB B;  3Q24 A;  5EKK A;  2KED A;  3IFT A;  2AWN A;  4XQJ A;  2F0Q A;  5FK9 C;  4F7X A;  3BYT B;  1KTK A;  2PCF B;  5ELB A;  5FO7 B;  2F0T A;  1AZP A;  2I07 B;  2X6G A;  3FPP A;  5BN5 A;  2DY8 A;  5KIX A;  1X32 A;  3P20 A;  2G9D A;  3QOL A;  3HOZ B;  1DCZ A;  3NK9 A;  2L0C A;  4DN4 M;  1SSO A;  2DY7 A;  3NSW A;  1PFM A;  1U9R A;  1I6V C;  1NAP A;  1CK1 A;  4K6D A;  4CGY B;  1PTO F;  1U4P A;  3JAM L;  1PRT F;  1C4Q A;  4C2M B;  1GXD C;  2B2V C;  1STH A;  3CHB D;  4NW2 A;  4RHR A;  4XT1 B;  1DXM A;  1ZYR C;  5IOD A;  1ICW A;  1EYA A;  5EPL A;  1Y8O B;  5A35 A;  1STE A;  5T1I A;  3D4W A;  1HA6 A;  4DK1 A;  3R2T A;  1MGS A;  1PLF A;  3PUW A;  3J80 L;  1PYW D;  4I65 A;  2IWH A;  1CTM A;  4K14 A;  4BBR B;  1WTR A;  4N9T A;  2XIW A;  5M3M B;  3K5N A;  5M5W B;  4R9W A;  3OSO A;  5C44 B;  5C5L A;  3SR1 A;  4HR7 B;  5I2X A;  5IGD A;  5JJZ A;  1STY A;  3A55 A;  2EPB A;  1JOR A;  4XIG S;  2Q8R E;  5KYI A;  2EYJ A;  3X3M A;  4IFD J;  3NWT A;  2M2L A;  2R3Z A;  3KK7 A;  2WII B;  1AEX A;  4DXG A;  1VCI A;  3MA2 B;  2EYL A;  3WOE A;  4C1N I;  1PXU A;  3AMU A;  4RA8 A;  4A3F B;  2EY5 A;  4DFA A;  4CJ0 B;  5K5P A;  1A3T A;  1LTB D;  2MP1 A;  2NTT A;  2NWG A;  2B63 B;  2EJF C;  3SK6 A;  1F9Q A;  3HKZ B;  3SK4 A;  2F0P A;  2N55 A;  4QF4 A;  1PFN A;  2B8F A;  4RGT A;  2B2Y C;  3BG3 A;  4A3B B;  3OW7 A;  5JEA H;  1STG A;  3HZX A;  4CKE A;  5M3F B;  1FNU A;  2EXZ A;  2J0T D;  1SDF A;  2NYZ D;  2PW7 A;  4OO1 H;  3ZYY X;  1LTI D;  3P1H A;  1STA A;  4CBV A;  4RGM A;  3BVM A;  2BDN A;  4FF1 A;  2HDL A;  1B1Z A;  4FXD A;  4KKU A;  2BOS A;  3MVV A;  2RBM A;  1IKM A;  4ZAI A;  1H9R A;  2K5D A;  1BR9 A;  4ZYS A;  5JOB A;  2O5I C;  4KN7 C;  4G7O C;  1G2T A;  1Y8N B;  3N52 A;  3TP8 A;  5KRU A;  4RCN A;  4BY7 B;  3PO2 B;  1NR2 A;  1VF7 A;  1QB5 D;  4IUV A;  1F2L A;  4KV6 A;  1WCM B;  4A3E B;  1JWM D;  1CA6 A;  2A74 C;  2XN9 C;  2PZU A;  3Q6S A;  3J81 L;  1H9S A;  2ICI A;  1EWC A;  2O2L D;  1HTL D;  4FF2 A;  1F2Y A;  4BA2 I;  3H3V C;  2K04 A;  4KJO A;  4JK1 C;  3JAM E;  1PDQ A;  2MPM A;  2QCP X;  2NVX B;  3FRP B;  3WOF A;  1YNN C;  4MN3 A;  1VF5 C;  4QMG A;  1STN A;  1KNE A;  1SYB A;  1ZKO A;  4DAV A;  1K83 B;  2E2J B;  4H0L C;  5JVG 3;  2F0G A;  4A3D B;  1EEI D;  1GUG A;  1AZQ A;  3A56 A;  2B39 A;  1IW7 C;  4NDX A;  1O80 A;  2CQA A;  4KKT A;  1TS4 A;  4KTA A;  1G6Z A;  2QF7 A;  3NE5 B;  3S1Q B;  1J8I A;  5FO8 B;  2Z4I A;  5TSS A;  4XXE A;  1WD1 A;  2FJ2 A;  1Q1B A;  1XX8 A;  3K5M A;  1RHP A;  3KBG A;  1QG7 A;  4L63 B;  2WAC A;  1DOM A;  1F9S A;  4C3I B;  2XRS D;  5KGU A;  2SNM A;  1SYE A;  3M3Y B;  2M00 A;  1PMR A;  5CV5 A;  3VYU A;  2MUY A;  4RKL A;  2BCO A;  2LKV A;  1EY4 A;  4FYD A;  1M4V A;  1SNM A;  1KLU D;  1V43 A;  1TWA B;  1AP0 A;  1B3A A;  2ID0 A;  1D6E C;  4H7B A;  1Y1V B;  2TSS A;  3OOC A;  3FKI B;  2IT1 A;  4CJ1 B;  5FKA C;  3URY A;  3VR6 A;  1B9M A;  1EIH A;  3E5S A;  4HTH A;  2Z4H A;  1ROD A;  1LTR D;  2WKC A;  4ZUJ A;  4GZY C;  4L8J A;  1II3 A;  1BCP C;  2RQX A;  1PZJ D;  5I9O A;  2TMP A;  2YU9 B;  1HPC A;  4XT3 B;  1GUT A;  4KD3 A;  3NP8 A;  4PNY A;  1JOK A;  1LT3 D;  1STB A;  5C4Z A;  3I70 A;  2KCC A;  5E3F A;  1EEF D;  3QIA A;  5HGT A;  5K36 H;  2NUC A;  2Z1C A;  5CV4 A;  2BE5 C;  2H1E A;  1EYC A;  3DWA A;  1A6X A;  1ILQ A;  3OWF A;  2VXW A;  1G29 1;  2EDG A;  4E6I A;  1LT5 D;  2F0J A;  2K5W A;  4KHV A;  4Y7N B;  3H94 A;  4NMZ A;  4V19 0;  2IPK D;  1RTO A;  1F77 A;  1RTN A;  3K6O A;  4F88 A;  3QJY A;  4HED A;  1SMY C;  1SJH D;  1B4O A;  5COY A;  3W2D A;  1JWS D;  1O7Z A;  3TP5 A;  3R2I A;  2E76 C;  2PO4 A;  3VYT A;  2F0S A;  3Q23 A;  4BA1 I;  2N88 A;  2IL8 A;  5FLX E;  2CW0 D;  3GP7 A;  2B2W A;  4TSS A;  4H44 C;  4RAU C;  2K7V A;  1KAA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...