4WJWA

Crystal structure of the chs5-chs6 exomer cargo adaptor complex bound to portion of chs3
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
74
structure length
68
Chain Sequence
VDVLLTVGKALLTTQDHHVIEFPTVLLPENVKAGSIIKMQSQNLEEEKKQRNHFKSIQAKILEKYGTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinct N-terminal regions of the exomer secretory vesicle cargo Chs3 regulate its trafficking itinerary.
pubmed doi rcsb
molecule keywords Chitin biosynthesis protein CHS5
molecule tags Transport protein/transferase
source organism Saccharomyces cerevisiae
total genus 10
structure length 68
sequence length 74
ec nomenclature
pdb deposition date 2014-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16892 CHS5_N Chitin biosynthesis protein CHS5 N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.890 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4wjwA00
4WJWA 4IN3A
chains in the Genus database with same CATH superfamily
2KCNA 2HHHQ 3SR1A 2K32A 4DNIA 1K9MC 3CKIB 2IL8A 3GP7A 2KA7A 3HZXA 2ZXOA 1SMXA 3PUYA 3IRBA 2VZAA 2N78A 4GN5A 3S1NB 4TRDA 1YHQA 3U9SA 4IUQA 4KI0A 3SGIA 2GN5A 2E2JH 2WB1E 5JJZA 5F2DA 1SRUA 3CAMA 3J7ZC 4FXKC 2HIXA 3VR5A 2BE5C 3M7NA 2CH4W 2HDLA 1SYDA 2NN6I 2AQ3B 1HA5A 5J3BA 4K6DA 4EX5A 2OTJA 1KLGD 2F0JA 4LNQA 1DD2A 3OYYA 2AUJD 2JA7G 3IL8A 1P8LA 3PF4A 2B63B 3OWEB 1FNUA 5M3FG 3CCSA 4A3IG 4L5TA 3KLRA 1HQRD 5LL6X 1U9RA 1LM0A 5M5XB 1SNPA 5C0XI 1IYUA 4OIKA 5KNBA 2HDMA 3CCLA 1ONLA 2JE6I 2EYMA 4WFN3 3HKSA 3BZCA 2B2UC 1SN8A 1TS4A 4MN3A 2JA6G 4BXXG 1HNZL 4DR1Q 3R2TA 3EIVA 4LF7L 1IL2A 3F2CA 1ZYRC 5EGTA 4DF7A 1K0SA 1JJCB 3KFUA 3T16A 2BDOA 1A15A 1A8VA 1N36Q 1HZCA 1HTPA 1ZKOA 3VYTA 4UHVA 4IZ8A 4YHHQ 1VQEA 5JEAH 2I5LX 1IBLL 4CHTB 3WDNA 1EQVA 4C3JH 4MNOA 3Q6SA 2F0UA 1EWHA 2ZTEA 2F52A 5C6AA 4DV1Q 4IUUA 2E2DC 1XWEA 1A63A 4LFCL 1DOLA 2L9HA 3AU7A 1DCZA 2N3SA 4X66Q 1TWAB 4P75A 4DUZL 2RSOA 1UEAB 3S16B 5IYBG 1EZ8A 1QZGA 2XVSA 1VF7A 1F9SA 3BDLA 3HOZG 1Y69U 4S3SA 4HR7B 2NVYB 3JAMi 1LT6D 1RDPD 4A3MG 4KHVA 3X3NA 1O80A 3JC66 4A3KG 3BYTB 4A3LG 5C3EH 3BS1A 4UY8C 2JA8H 3PV0A 1KIXA 3SVMA 4A3DH 3TEHB 2XRQD 4UPAA 4QF4A 4KJOA 4JPBW 1GVPA 1HZBA 1ASYA 1E24A 4GOPC 1A2UA 2MNAA 2BCOA 2NYZD 1PH3A 1KLUD 1NNXA 1SJED 2XGTA 4QY7A 3V05A 2F4IA 2UUAL 4JYAQ 4EQOA 1L1OB 4A75A 3HOVG 4K8JA 1W2BA 2ZT9C 4O0AA 4AQYQ 4IFDG 2AUKA 1UEBA 3NWTA 5A2QE 1RD9D 1T5XD 2RDFA 3HKZG 2WAQE 3TSSA 3O13A 2E74C 1D8LA 1FR3A 1TWHH 2HQEA 1PRTF 2K7VA 3SXHA 1X3EA 2RKSA 4OWXB 2Q8RE 4CDCC 4DR3L 2EJGC 1IYJB 3S1MH 4OO1H 1RTNA 2UUBL 3GTPH 3ZYYX 5JOBA 1VQBA 1VQPA 3NTKA 4FO2A 4EVOA 3K5OA 2L15A 4HJ7A 1N9WA 3EVQA 1HZ9A 2JA6B 1CSPA 4A3EH 1LT3D 4QUCA 2NUCA 5ELNA 1LTSD 1KDAA 1SE8A 2JA9A 2RCNA 4F87A 2XNAC 1NUCA 4XYQA 2NZ1D 4LFAQ 3I4MH 1GXDC 2FXQA 4RWSC 5C4XH 2E5LQ 1HCZA 3G71A 4BY7B 4QIWE 3L0OA 1EU4A 5FLXL 1V1QA 1PH6A 1D2BA 1Y8NB 1WTQA 4N9PA 1K8GA 3E9IA 1PH5A 1KAWA 3KBGA 2K50A 1XMOQ 1H9SB 1EYDA 4NXMQ 1B50A 4HIOA 3NBHB 4HIKA 1Y1WB 2NVQH 4KLKA 4ZK9B 1ESFA 3J80L 2Y0SG 3W3AA 1L2FA 2KCTA 2AQ1B 3S1RH 4P72A 4BBRB 4B9WA 3S2DB 3KK7A 2N88A 5ELBA 1KTKA 1VDZA 1SNQA 3FMCA 5EPJA 5BN3A 3R93A 3AMUA 3BDOA 2I5MX 2NBFA 1CA6A 2VS1A 2IW3A 3Q23A 4JI2Q 3HGBA 1I4GA 1IKMA 5A2QL 2PNRC 2A19A 3U9OA 3CQZH 1EIHA 4QJFA 4A3MB 3I7FA 4DV4L 3VR3A 2HT1A 3PQIA 4DR6L 1NR2A 4A3KB 1E2ZA 3AQQA 1O7IA 4A3BH 1IW7D 1PYWD 2VUMH 4YY3L 3BU2A 4GLAC 4BA1I 3RNUA 2I5HA 4DKAC 4X3SA 4MIUA 1TS5A 3OIPA 5EPLA 3BJUA 1BKBA 1F77A 2F0DA 4H02A 3CMAA 1NE3A 3S2HB 3RZOB 3GO5A 4EGVA 1TKWB 2ZM6Q 3HOVB 2NWGA 1CHPD 3T1YL 1DZ1A 5IT9E 4PMBA 2BOSA 4YWKA 3CC4A 3HKZB 1PFMA 2WIIB 1QVCA 5JJKA 4JI7L 1J5EQ 1PFNA 2GVAA 1PRTD 1SLJA 1II3A 3E0EA 1HQMC 2Z4HA 1YIJA 3MXPA 5FLMH 1Q8KA 2F0IA 1E2VA 5KIXA 3HOYB 3PUWA 1EUJA 1E2WA 4UDUC 3UDIA 2EJFC 3CD6A 1JT8A 5E4XA 3EFXD 2KECA 2UUCQ 3J81L 1K83B 2B2YC 3I4NB 1FNVA 1JJ2A 2SOBA 3M9BA 1S3OA 2JJQA 1PH9A 1JORA 4HMJA 2KJXA 3OIQA 1E1OA 2VQEL 1PFSA 1CK1A 1RKNA 1Z6HA 2CW0C 2HHHL 3D6WA 4C3IG 4LF7Q 5EBDA 1VQJA 5M3MH 4XIGS 1ENCA 1SR3A 2A8VA 1MI2A 4DR2Q 3Q24A 3RLNA 1O7LA 4A93G 1PLFA 2OXPA 4Q0FA 5CV8A 4TVAB 1NCVA 4A3JH 1IBLQ 4DK0A 4GN4B 2E76C 1Q82C 3VYUA 2VB2X 3EJIA 1STBA 1MJCA 4DUYQ 3GTJB 1STGA 1RTOA 4V0BA 5A35A 4XQNA 2MUYA 4G7ZC 1MHWC 5JJIA 2LSSA 2KVMA 1LTBD 4FDBA 3D6CA 4Z9CB 3VDYA 1VMPA 4KV6A 1NSNS 2GVBA 4YIJA 1PV4A 1PFBA 1QNUA 1CSQA 4JBJA 3S16H 3ERSX 1YNJC 1FD7D 3D8GA 3GV3A 1AH9A 3K0XA 1RODA 4K6LA 1KDBA 1VQ4A 1A0IA 1IZ6A 1H9RA 3BVZA 2NVYH 3J81j 3NE5B 2JXMB 3ULLA 1C8CA 2B2VC 4X3KA 3H0GG 4FP5D 1B9NA 3PIPA 3U58A 4UP8A 3SE0A 3H3VI 2A74C 4J6HA 3MXGA 4DAPA 1KHIA 2H4OA 4HEDA 3HP3A 1WCMG 4DR1L 5I6WA 4HJAA 1WOCA 5IGCA 4JI5L 4B08A 2VL6A 1FGBD 1Q8IA 1SDFA 3A7AB 3QOLA 2ZJRA 5J1ZA 2UUAQ 2L4NA 2YTVA 3G7LA 3E3XA 4P71A 2RVLA 2B8FA 3ITPA 1N36L 4DK6C 1BQQT 1BCPC 1RL2A 4YHHL 4NXNQ 3MC0B 5BN5A 5JAVA 2IY5B 3H3VC 5D14A 2JA7H 4HIMA 4GKKQ 1SYCA 2L5TA 3PO2G 3L9AX 4DU9A 4A76A 2VB3X 5M3FH 4A3IH 1S5BD 2YU9H 3V96A 1T9HA 4HCSA 2EOTA 4JI3Q 4BBSG 3N6RA 2UUBQ 4DV1L 1MJEA 2F0VA 3LNNA 5IE8A 4LF4Q 3QB3A 4X66L 3URYA 2QDBA 1J6QA 1B3AA 1GO3E 1X3QA 1HFNA 2N8NA 2PZTA 2JA6H 4BXXH 4DR5Q 1G2TA 5HGQA 1YJ9A 1KXLA 5HURA 3A5ZB 1TWGH 4MHEA 4CGYB 3D3RA 2D5DA 4TSSA 1XPOA 1STAA 3BDCA 5C3EB 1VQ8A 1U4RA 4GN3B 5DLQE 4CJ1B 2JA8B 2VW9A 1VQ6A 4A3DB 4A3CG 1L0WA 2RF4A 2R92G 4GLVB 4OXPA 3S14B 1PMRA 1VQ5A 2L0CA 1XNRQ 4NP5A 3VR6A 2JA5G 1GKHA 2Z8LA 1YNXA 1ZEQX 3SK6A 1STEA 4ZYSA 2EY2A 3RZDB 1BNZA 1QVGA 4AQYL 5D3DA 3S2DH 1LTAD 1TWHB 5IYBH 4RFBA 5C4HA 1D7QA 1H9SA 2EDGA 4CKEA 1YJWA 3CHBD 3MFGA 1IXRA 1EQQA 3HOZH 1X55A 3NBHA 4L6TB 5E4WC 4GZYC 2X69A 1EQRA 2WB1G 2K14A 3NP8A 4HMIA 4PMWA 4A3MH 1G6ZA 3I8ZA 3GTKB 3FRPB 2NVXH 3KLSA 3ND8A 5T1IA 2IX3A 4A3KH 1YITA 4A3LH 1DONA 4WRDA 1TIID 1UAPA 2A68D 2ZJQA 4I7ZC 1PRTB 3S24A 3BVMA 1EY6A 4IPGA 1I6VC 1PH7A 5E3FA 2PW5A 2ZTDA 4J8QA 1I50B 4LK1C 3W1GA 4DR7Q 3T1YQ 5K5PA 3SK4A 2KEEA 4LFAL 4N9TA 3HOVH 5ISRA 1K28A 5I6YA 1PZJD 4P73A 2F3IA 4AYBG 2E5LL 2AHOB 5CORA 4IFDH 1M90C 3LX0A 2IX0A 3GTQB 4IOAA 1JMCA 3MHBA 4K5XA 5T1GA 1XMOL 1EFID 2A6EC 1QB5D 2OWOA 4NXML 3A0JA 1RJTA 4BBSB 4I65A 1BBWA 3S1RB 4ALPA 4H13C 4R4TA 1PTOF 1ET9A 2D9UA 4QQBX 2BDNA 2R7FA 2F0HA 2YV5A 1EYCA 1QILA 3OTOL 4ZQ3A 4DK1A 1S5FD 1QUQB 2KHSA 3CQZB 5KRUA 4JI2L 2R93G 1KAAA 4K2LA 5DM63 3CCVA 3CCEA 4ZKBB 4PZ8A 1F9QA 1WFQA 4LF6Q 4LW1A 4NKLA 2R92B 1QE6A 1B70B 1TWFH 4LAAA 4JOIA 1IW7C 2IPKD 2LKVA 1TVXA 1K8MA 2BH2A 1M4VA 1YHBA 3FPPA 4X62Q 3T13A 4KKTA 3KLWA 5KYIA 1EYAA 3EQLC 4HCEA 2JYOA 2ZM6L 1AE2A 1G91A 1I6HH 2NZOA 1X3GA 3CCUA 3NUCA 1VF5C 1WYDA 2F0SA 1YZ6A 2AWOA 4DK3C 2WFWA 2CQAA 3RUZA 5M5WH 1EOVA 1KNAA 2OEOA 4WJ4A 3NK9A 1K8OA 4IPCA 4P74A 4CJ0B 3H09A 1G291 4N8FA 1J5EL 3MWYW 3MEFA 2PQAB 1MIUA 1S5DD 3GTJH 4JI8Q 3KOJA 4C3HG 2F03A 1U0LA 2PNHA 3JAME 3STBD 4DAYB 1B9MA 5COYA 2FFKB 4K8IA 1B3QA 3A55A 4PNYA 3TREA 4C56C 1LTID 1I4RA 3MTSA 2UUCL 4UP9A 3GTOH 3X3MA 2HCCA 1A2TA 4R9WA 1H9KA 1E1TA 4AYBB 1QNKA 1TQOA 1KRSA 1X32A 3HOXG 2C35B 4ZCKA 1Q12A 4GKJL 1Q1EA 3QG1A 4LUOA 1CKOA 3IAYA 4B3RQ 4CKCA 4OWWB 4TKOB 5M3MB 3WOEA 3OHXC 3NTIA 4R4IA 1XYIA 4RHSA 3BZKA 1EEFD 4JI5Q 5C44G 1AW7A 4KD3A 2IT1A 1XMQQ 1XPUA 4DR2L 2D0OA 3FDTA 5EKKA 1LTLA 2K03A 3DWAA 4A3JB 4UP7A 5NUCA 4FNFA 1B4OA 2FJ2A 2WKDA 1PTOD 3K59A 4B3SL 2PMZB 4DAMA 2AWNA 1K73C 1VQ9A 4L63B 1KABA 5IGBA 1V9PA 3D4WA 5IGEA 1Q46A 4DUYL 4RKBA 2Z9HA 4PMCA 4LF9Q 4B3TQ 4EQPA 5C4ZA 2ES2A 5IIFA 1BUVT 5I4DA 2KENA 3K8AA 2M2LA 1EY9A 1ILPA 2FMCA 2JEAI 1CKNB 2K33A 3I91A 2MFIA 3G6EA 5JPNC 5IYDG 3J7YW 1YJNA 1VQDA 3JAML 4K5VA 4C3IH 1RIPA 4M1UB 1XTDA 2PO4A 3MFYA 4L8JA 4DV7Q 5EKLA 2EVBA 2A69D 1L0YB 1SAPA 5CV5A 4A93H 1DXMA 3NBIA 1G51A 4O1NA 3NQTA 2B39A 3MAQA 4ZUJA 5G3LF 3S14H 1GOZA 3MXUA 2EQSA 3NQIA 5ELFA 2ATWA 5LMUL 4XT3B 3TRZA 1EY5A 3DEPA 4JG2A 1WVLA 3OMGA 3CPFA 4HJ5A 3RZDH 1PH1A 3K6OA 3M3YB 4NXNL 4BA2I 2JA7B 1K8AC 3SK5A 3C1EA 1WTXA 2WKCA 4KJNA 5KYLA 1U4MA 4GKKL 1EIYB 1VQFA 4IO9A 1VQCA 5M3FB 4A3IB 2F1MA 2YU9B 4NW2A 1EL0A 2CHBD 1S5ED 3TZUA 2QKIC 3PO3G 4DFAA 4UAIA 3GTGB 1D1KA 3FKIG 1U5KA 4JI3L 1E3PA 2H5XA 4HTHA 2MPMA 3H0GH 1SEBD 4OGQC 3GTKH 3HOWG 5IP9G 3BVGA 4LF4L 1TR5A 4DV0L 1FNWA 3S17B 5C0XJ 4X64L 4XTCS 3DEOA 2R7DA 2IHEA 1UNSA 1NBWA 1TWGB 4DR5L 1WCMH 5C44B 1OXUA 1SYEA 2QA4A 4CDFC 2F0LA 3A5UA 2A6HC 2NB0A 4RA8A 3I55A 4KY5A 3I72A 2JSOA 1K0RA 5CBEE 1QWYA 3HOUG 1I50H 1VQAA 3Q8DA 2XTIA 4WJWA 2NTTA 2ZXPA 4LFBL 3I56A 2OQKA 3KF6B 3Q22A 1SNCA 1QOHA 1XNRL 3PO2H 5FK9C 3GTQH 2E2IB 1Z9FA 1R9TB 1BBUA 4LF5Q 2B2WA 3G6JB 2CQOA 4ZKCB 1YEZA 2IWHA 1PDQA 3GQBA 4BBSH 5H1SE 4OIJA 4BY1G 2KBNA 1JOOA 4KMUC 1KC8C 1I94Q 1V1PB 3CC7A 1YHAA 5GAHC 5I2XA 4U673 3OTOQ 1CQFA 3FP9A 2F0PA 3P75A 3HOZB 5C3WA 3CCJA 2KOLA 2PQEA 3K7UC 3KDFB 5I9PA 2NVXB 1DM0B 1F2YA 4XDXA 1AN8A 4ILWA 3P1HA 1WTHA 2PZUA 3J80i 4H7BA 3IKJA 5HGTA 4A3CH 2R92H 3ONAB 4OEMB 2K52A 1OO9B 1TXYA 1QUQA 4QCLA 4IUTA 3G4SA 1L1OC 3KF8B 2JA5H 3J7A5 4GNXB 2LXJA 2Q2UA 3AYHB 4OWTB 2RA4A 3R3OA 5CV6A 5G3LD 1P16A 1EIGA 4OHJA 5ELCA 2QF7A 4IOCA 4FF1A 4DR7L 2EY6A 5EPKA 1S5CD 1VQHA 3I3CA 1JWSD 3MEHA 3A74A 1BXTA 4FF3A 2YYZA 1N33L 1EY7A 4ZAIA 3CXCA 3K57A 1EY4A 1SBBB 1X54A 1VQNA 3FKIB 3OOCA 5C3XA 1JWMD 4KK7A 3HKZE 1TT2A 1HXYD 1Q1BA 3AB9A 1STHA 3NPPA 4Y7NH 3PUVA 1TS3A 2XN9C 1N34Q 3LGJA 1I4XA 2UXDQ 1JC7A 1VQLA 1W6KA 3HFZB 4IUVA 3TP7A 1SMYC 5LHY1 4NB3A 4LMQD 2V4DA 2Z6BA 2BE5D 3PIOA 3T53B 1SROA 5JVH3 2PCFB 4R4QA 2PQAA 4PV1C 1NY4A 3HOUB 1STNA 3NHHA 4LF6L 3RN5A 1MBYA 2PYKA 1TWFB 1PTOB 2QILA 2L55A 4GKJQ 2QW7A 2KUMA 2KQ3A 2WP8J 2XWBB 2OT2A 1CZGA 4C3JG 4H44C 4DR4Q 4CKBA 2IX1A 3SHLA 2LS01 3PUXA 4X62L 5IGDA 2O2LD 5K36G 1QZHA 3VR4A 3W2DA 2J0TD 2Y0SB 5FLXc 1SE3A 1I6HB 2SEBD 3ERQA 1SJHD 4YCWA 3J81i 2F0KA 1EIFA 4X65Q 4B3SQ 3ND9A 2F4VQ 2KHJA 5M5WB 5IT9L 4IFDI 1ZYRD 3J80c 3ER0A 4B3ML 1ILQA 3UE1A 4LUZA 5CV7A 2DGYA 1Q86C 2R93H 2RHSB 1U4LA 2YTYA 4AIMA 1KD1C 4RCOA 5KEEA 1VQMA 1LTRD 2E75C 4JI8L 5KNDA 2F0WA 2EY5A 3OW7A 1EYGA 4C1NI 2FINB 4IURA 1Z47A 1KRTA 1Q90A 3UE0A 1HFGA 3NSWA 3E6ZX 1IL8A 1ESRA 3GTOB 2P5ZX 2EIFA 1NAPA 2M9VA 3QO2A 4P2CB 1H9JA 1IKLA 3S9WA 1JE5A 3H15A 3S1QH 4O2DA 4LUVA 3AFPA 1CKNA 3B6YA 1A62A 3DM3A 3D4DA 4B3RL 1BO0A 3E5SA 1FJGQ 2AQ2B 2K5WA 3NELA 3E0JA 4C2MB 5LMUQ 2CWPA 4IALA 1JJGA 3KUPA 4JOIC 4DV3Q 1XTCD 1G2SA 2IHFA 1XMQL 2G9DA 4JBWA 4OELB 1ENFA 1E7ZA 4C3HH 4L5SA 1CA5A 4X3TA 3K7AH 1HPCA 3M3YH 4DNTB 1JWUD 3U4VA 5DAUA 2JN4A 5GAGC 5IYCG 4FXGC 4IUNA 3M4YA 1EY8A 1CTMA 1M1KC 3FEWX 1L1OA 4R8IA 4OL7A 4LF9L 4B3TL 3CC2A 2QEJC 3GTGH 1CHQD 1VQIA 3NENA 2DN8A 2CCZA 4DV0Q 3HOXH 4N8X1 4X64Q 3J81c 4JV5Q 1RF2D 4C3IB 4IQZA 1SE4A 3S17H 1DYQA 2QEXA 4IUPA 2SNMA 1Q3LA 2NN6G 2EJMA 1S72A 4DAVA 3D0FA 3CP0A 5C44H 3BYYB 4CBVA 3RLFA 1SFOB 1WTVA 4A93B 4DV7L 1DJRD 4A3FG 4A3GG 4BWGB 1VCIA 3DHQA 2UU9Q 4LFBQ 1BR9A 2ALYB 1V8QA 2LFNA 4POFA 5GAEC 4JBMA 1LTTD 2DNEA 4KHPQ 4R4CA 1L0XB 1F2LA 1PVOA 2LXKA 3BZDB 1BBXC 2E2IH 2VQFQ 1R9TH 2R7ZG 5C0XG 1T5EA 1LT5D 5EAYA 2D62A 5IP7G 1N32L 1V1OA 3KF6A 4YCVA 4JI4Q 2F3VA 1VS0A 1IHZA 2BH8A 4Y52H 4GLXA 1D1IA 5IYDH 2K4KA 2WV6D 1EY0A 2Z4IA 2RHQB 4V190 2G9HD 1M8AA 3UDXA 2NTSA 1SNOA 4ODGA 1CI3M 4B9XA 3DXJC 1SYGA 3CMEA 2BA1A 1TWCB 1HA6A 3H0GB 2J4XA 2WACA 2LMCB 1WTWA 3CPWA 1C48A 1V1PA 2K05A 3BG3A 3RN2A 2N49A 4RKLA 3RLOA 3CRKC 2D0PA 5C5LA 1PZID 3OMCA 4KKUA 1WCMB 1TS2A 1JE4A 3KDFA 1WTOA 3H94A 1H9MA 1D5MC 5CR3A 3C46A 1A6XA 1B1ZA 1LO5D 4QMGA 4HSVA 5FJ8G 4XYOA 2CH4A 1AE3A 1VMCA 5I2YA 1LV9A 4RGTA 1N33Q 2L1BA 1TY0A 2Q2TA 3KF8A 4WJ3M 3PO2B 1Z7TA 3I2ZA 4RGMA 1D5XC 2B63G 2J7ZA 4LF5L 1A3TA 1V43A 2V1CC 3FPUB 3PO3H 1GUGA 1GM5A 4IJHA 3FKIH 1XNQQ 2RDGA 2CFMA 3UI2A 1HNXQ 3D4RA 1CM9A 3HOWH 4ME3A 4HIDA 5IP9H 1PXUA 1LACA 2KCMA 1I94L 1AEXA 5CV9A 3A54A 3I90A 1KL9A 2PZWA 4K2KA 2JEBI 3C1FA 1BCPF 4OONA 1NMGA 5AFWA 3NWSA 3TS0A 1A3UA 4A3GB 1HH2P 5E1FA 1HZAA 5KGUA 1WD1A 2RQXA 3M4PA 4IPDA 3HOUH 4OO1I 1I4HA 1PTOH 2H1EA 3UDFA 5C4JB 2JA5B 4K14A 4KN4C 1UUPA 1LUZA 5L37A 2NVTH 2B2TA 2EYFA 2EY1A 2R7ZB 1IBKQ 4O42A 3PUZA 1S4ZA 2AKWB 1JOQA 2EYHA 1LABA 3KJPA 4MZ9A 4R8NA 4BY1H 4PQXA 1RHPA 4DPGA 1I5FA 2MJ8A 1F2MA 4DXFA 3V2TA 2PI2A 4B3MQ 5IY0A 1VQKA 1GUWA 2E2HH 2QGQA 3I70A 2Z6KA 2WB1B 2Q2IA 5JEAJ 4Y7NB 3I4LA 1B44D 1K3RA 5JVG3 1UE1A 3DWPA 1O7YA 2VY3A 5FO9B 3K0YA 1YI2A 1N34L 2UXDL 1PRTC 2I0QA 4QL5A 1X65A 3W1BA 1E0BA 1NMFA 2B2WC 1E22A 1CQVA 1I4QA 4DGZA 2OQ0A 2G5DA 4H0LC 4JC0A 1WTRA 1U4PA 4K5WA 1I4PA 3A8IE 2L12A 2WAQG 4JCVE 1D6EC 1ASZA 2Z1CA 4L5RC 3M4QA 3MVVA 3ZJYC 3L7ZC 4GOPB 1YNND 3KBXA 3F2DA 5HY6A 1YNJD 2DNCA 4J1MA 1Y1VG 2F0TA 5GADC 4RH6A 1EWIA 1SNMA 2PW7A 4DR4L 1NR4A 1CZWA 5BR8Q 4DV5L 4AYBE 4C2MH 2K04A 1BVSA 3A56A 1EQTA 1QJOA 2M00A 2XSCA 4MTKA 3PSIA 5D65A 2EXZA 4X65L 3K80C 2F4VL 2OCEA 4LWCA 5LL6S 3MXNB 4G7OC 1F9PA 2R93B 1X6OA 1ML0D 3L3OC 3VA5A 1K3BC 3FVQA 1Q7YC 2B8GA 4K0KQ 1BCPD 1IBMQ 4DV2L 2PMZE 4MTNA 4RGOS 3C3LA 4BY7G 1OTCA 1HNWL 1O78A 3QWNA 3P20A 5GQOA 4IJLA 4C1NK 4HJ8A 3GTMB 2R61A 5K36H 2Q8IB 3HS0C 2MO0A 1OXTA 1FVIA 3S1QB 5ELEA 1UE5A 3NXWA 4NMZA 1Y1WG 1VQ7A 2F0OA 1SNDA 1SFOH 3TP8A 3S15H 2XIWA 4BBRG 4YCUA 2F0GA 3KJOA 1G6PA 3TZDA 2ICIA 3CCRA 4EQ5A 2A73B 3WWVA 4DA2A 1FJGL 3D31A 5AJ3L 4FF4A 3T1HQ 3M85A 5I9OA 4DV6Q 2RSNA 3VR2A 4C3HB 1PYBA 4DV3L 3F8TA 2K6AA 5FLXE 4HJ9A 5GROA 1H95A 3K7AB 3GTLH 4JBKA 1N32Q 2HQLA 2EPBA 5IGGA 2RDHA 1W6JA 4OX9Q 1HUMA 1MKHA 1F9RA 3J80E 2WAQB 2LY7A 5TSSA 3F1ZA 2F3WA 5DM73 3W5OA 4RCNA 2R6GA 1GHJA 2K28A 5CYUA 1B2TA 4KTAA 1TWCH 5IWAQ 3HOXB 5M5YH 1JB3A 1Y1VB 2EYPA 1Y14B 2DJFC 4AH6A 1AP0A 4JV5L 1HTLD 2KHIA 3NEMA 1B53A 1XX8A 4TQUS 4QGUA 4F7XA 1WD0A 1CFMA 2MO1A 5IGFA 1FL0A 2UU9L 2PPBC 3TP6A 3H6MA 3HOYG 2A5HA 4KHPL 3CCQA 4QIWB 3K58A 2ZTCA 5IYCH 4LJZC 1SYBA 2K5HA 2VXWA 2F0QA 3Q0AA 2CVRA 2VQFL 1RCVD 4JVZA 3U50C 2UXCQ 2QDLA 2UXBQ 3I4NG 1VQGA 3FHWA 2O5IC 3PCOB 4XT1B 5DNFA 1C9OA 2E8GA 2DUDA 1VQOA 1O7ZA 4JI4L 1HR0L 1I3QH 2MGSA 3ULPA 4ME5A 2A6ED 3DMUA 4EQNA 4Q5VA 5LMNQ 1ENAA 2NN6H 1OXXK 1NJIC 3PIO3 1B8AA 2Q8TA 3JAMc 4A3FH 4A3GH 1J9OA 1R4PB 4FXDA 4XQJA 3EN2A 1Q81C 3J81E 4LF8Q 4X3UA 1ET6A 1GUOA 5C4JH 1LTGD 4JI1L 2R7ZH 2B2UA 2A68C 5C0XH 4JI0Q 4X6AH 3TMEA 2HUGA 3GV6A 5LMNW 5EJWA 5IP7H 4JI6Q 3T56B 1GD7A 2N55A 1X56A 1SYFA 3VYSA 3HEJA 3QOJA 1LYLA 1IYVA 1X3PA 1EEID 3PGZA 4KY7A 3PO3B 2I46A 3LWEA 3A7LA 1G8ZD 2BA0A 3T4AC 4YWMA 1XNQL 2F0MA 3TN2A 2K01A 3HOWB 1HHVA 3DWQA 1HNXL 3S1NH 2RBMA 1BDOA 3MZ5A 1DGSA 4M8AA 1LT4D 2OF1A 4JK1C 3OW2A 3ULJA 4PZ7A 4POGA 3RMHA 3TQYA 5ELDA 3SK8A 2AMCB 2QCPX 1AFPA 2HIVA 1ICWA 1JQYD 3VYRA 2A1AA 3K5LA 3DLLA 5FJ8H 4PZ6A 4ZLTF 4DAYA 2KCCA 4J15A 2YTXA 5JEAG 1BF4A 2NVTB 4G7HC 4HAEA 3KYHC 3PIP3 1X3FA 3TBIB 4DV5Q 2MP1A 2B63H 4KD4A 1BCPB 1IBKL 1N8RC 3TP5A 3N52A 3F2BA 2GA4B 4RHRA 5D3IB 4BY1B 5J39A 3GD7A 4CDEC 3CF5A 4GOPA 3L2PA 3M4OB 1CKMA 4A4IA 1EFWA 5M5XH 4I7AA 4ID6A 4QB4A 1X9NA 2PI2E 2E2HB 2JK8A 2B3GA 1D5ZC 1HNZQ 2EYOA 2Y0SE 3CW2C 4KKSA 1MGSA 1TU2B 2EYLA 1DOMA 1UE6A 3HRZC 5JPMC 5ELOA 1MD2D 3DUZA 4DV2Q 1GUTA 2HD3A 5C3EG 4GNXC 3CCMA 1C0AA 3M7GA 5EBCA 1YBYA 4NDXA 3RR5A 1WTPA 4DXGA 2JA8G 3R8BA 4A3DG 2E2JB 4HN7A 3EROA 3MXNA 3TDQA 1HNWQ 2HCIA 1PHJA 3J7AF 3STBC 2F0FA 1JICA 2F0NA 3T51B 4ABNA 2O5JC 3GTMH 4KHZA 1AZQA 1ICFB 3RD4A 4HSPA 1SSOA 4LFCQ 4RMFA 1NTGA 3I4OA 2NZHA 4DUZQ 4L5QA 1TWAH 1UWVA 2R3ZA 1Y8OB 4KY6A 4YWLA 3A8JE 5FO7B 1YNNC 5AJ3Q 5BR8L 5J22A 1R4QB 2DJGC 1KDCA 1QVFA 5CBAE 2Q2HA 3QJYA 4OO1G 3F2UA 3MA2B 5KNCA 5FO8B 2B2TC 1GJXA 5EQ0A 4A3EG 2B29A 2K5VA 5DEHA 1PTOC 5CV4A 2K5NA 2EYJA 2SDFA 1S40A 1YVCA 3GDEA 5BN4A 2MQHA 2TSSA 1SE2A 4JW0A 1PYSB 2I07B 4K0KL 1IBML 2ICEC 3SEBA 5EKIA 4CJ2C 5M9OA 3I4MG 2WINB 5IOCA 5C4XG 2Z6KC 2IJ0A 3CRLC 3IFTA 4C3JB 3U4ZA 1Y1VH 1MSHA 2C5CA 1GUSA 4DN4M 3PMFA 4APVA 2ZXRA 4DR3Q 1XXGA 2X6LA 1EZ6A 2VNUD 5C5MA 1OXSC 3H91A 3S15B 3I73A 1HRJA 1EU3A 1BOSA 5E7NA 4R4OA 3ICEA 1C4QA 2A69C 1WJJA 1STYA 1Y8PB 2A6HD 3EA6A 3CU7A 3UDGA 1XJVA 4IFDJ 3T1HL 1GHKA 2KEDA 2EE1A 5CC4A 4NPSA 4DV6L 3IFDA 3QR8A 3GTLB 4GS3A 5IT9c 4A3BG 4FVMA 2VUMG 1JB7A 3EBEA 3AFQA 2CWAA 4R1JA 5IODA 1EOTA 1J8IA 5FOBB 1HR0Q 4BY7H 3K5NA 1JR0D 3PF5A 4RAUC 3KLSX 2DY8A 4OX9L 3OWFA 4ZRZA 1PA6A 4ZUIA 3K81C 1AZPA 1PH2A 3C2PA 1TY2A 4JYAL 5FKAC 1A3VA 1Y1WH 3A8KE 3LWUA 5M5YB 5IWAL 1UE7A 2OTLA 3AEVA 2B2YA 1LLRD 4BS9A 1ZXTA 4BBRH 1C7YA 1EWCA 4DNRB 4QUFA 1PH8A 4IPHA 3WOFA 4F88A 2ASBA 1QCBD 1MSGA 2RCFA 5CMDA 2EXDA 4CDDC 4WORA 3E9HA 4JI1Q 4DV4Q 3K5MA 3S1MB 4DR6Q 4U68A 3GTPB 4XQQA 1HR0W 4ULLA 1KNEA 4XXEA 5FLMG 2X6GA 2O4XA 2ID0A 1PZKD 4PG3A 4YY3Q 1JCKB 2MHVA 1QG7A 2K5DA 2L11A 1CUKA 4A3EB 1JOKA 3OSOA 4F8MA 1B7YB 4FYDA 4GNXA 3QIAA 3DM1A 4IN3A 3J7AV 1FYCA 3R2IA 2F0EA 2Z0SA 1DOKA 2UXCL 1FGUA 3I4MB 3S2HH 2UXBL 3RZOH 5C4XB 1I3QB 2K1BA 3G48A 1WI5A 1GUNA 2DY7A 2K5QA 1XPRA 4FF2A 4JI7Q 5LMNL 1KQSA 1SXTA 5M3MG 2NVQB 1W3SA 2ENBA 2EZVA 3VA7A 4A3FB 5JJLA 4G4KA 1HUNA 4KN7C 1SMYD 2D2CC 2C9OA 1PH4A 4RG1A 4RGNA 2SNSA 4A3JG 4E6IA 5CGKA 2CKZB 2K75A 2B2VA 3HOYH 1F2ZA 4LF8L 3SDZA 3TS2A 2FHTA 4G57A 1OXVA 4A3BB 2TMPA 1K83H 2JQOA 4JI0L 2VUMB 3HG9A 2CW0D 3I4NH 2FMMA 3H3VH 3P7JA 3OPOA 3NTHA 1CT1D 2ZJPA 2XRSD 3M4OH 4JI6L 2JP1A 2VQEQ 1HJPA 2XWJB
chains in the Genus database with same CATH topology
2KCNA 3SR1A 2K32A 3CKIB 2IL8A 3GP7A 2KA7A 3HZXA 2ZXOA 3PUYA 3S1NB 4TRDA 3U9SA 4IUQA 4KI0A 5JJZA 5F2DA 4FXKC 3VR5A 2BE5C 3M7NA 2HDLA 1SYDA 2NN6I 2AQ3B 1HA5A 4K6DA 1KLGD 2F0JA 1DD2A 2AUJD 3IL8A 2B63B 3OWEB 1FNUA 3KLRA 1HQRD 5LL6X 1U9RA 5M5XB 1SNPA 5C0XI 1IYUA 4OIKA 5KNBA 2HDMA 1ONLA 2JE6I 2EYMA 4WFN3 2B2UC 1TS4A 4MN3A 3R2TA 1ZYRC 5EGTA 4DF7A 3T16A 2BDOA 1A15A 1HTPA 1ZKOA 3VYTA 4IZ8A 5JEAH 4CHTB 3WDNA 1EQVA 3Q6SA 2F0UA 1EWHA 5C6AA 4IUUA 2E2DC 1XWEA 1DOLA 2L9HA 3AU7A 1DCZA 1TWAB 2RSOA 1UEAB 3S16B 1EZ8A 2XVSA 1VF7A 1F9SA 3BDLA 1Y69U 4S3SA 4HR7B 2NVYB 1LT6D 1RDPD 4KHVA 3X3NA 1O80A 3BYTB 3BS1A 3PV0A 3SVMA 2XRQD 4QF4A 4KJOA 1A2UA 2BCOA 2NYZD 1KLUD 1SJED 3V05A 2F4IA 4EQOA 4K8JA 2ZT9C 4IFDG 2AUKA 3NWTA 5A2QE 1RD9D 1T5XD 2RDFA 3TSSA 3O13A 2E74C 1FR3A 2HQEA 1PRTF 2K7VA 3SXHA 2RKSA 2Q8RE 2EJGC 4OO1H 1RTNA 3ZYYX 5JOBA 3NTKA 4FO2A 4EVOA 3K5OA 3EVQA 2JA6B 1LT3D 4QUCA 2NUCA 1LTSD 1KDAA 4F87A 2XNAC 1NUCA 4XYQA 2NZ1D 1GXDC 4RWSC 4BY7B 1HCZA 5FLXL 1EU4A 1D2BA 1Y8NB 1WTQA 4N9PA 3KBGA 1H9SB 1EYDA 1B50A 1Y1WB 4ZK9B 1ESFA 3J80L 3W3AA 2AQ1B 4BBRB 4B9WA 3S2DB 3KK7A 2N88A 5ELBA 1KTKA 5EPJA 1SNQA 5BN3A 1VDZA 3FMCA 3R93A 3AMUA 3BDOA 2NBFA 1CA6A 2IW3A 3Q23A 3HGBA 1I4GA 1IKMA 5A2QL 2PNRC 3U9OA 1EIHA 4A3MB 3VR3A 1NR2A 4A3KB 1E2ZA 1IW7D 1PYWD 4BA1I 4X3SA 4MIUA 1TS5A 3OIPA 5EPLA 1F77A 2F0DA 3S2HB 3RZOB 3GO5A 4EGVA 1TKWB 3HOVB 2NWGA 1CHPD 1DZ1A 5IT9E 4PMBA 2BOSA 3HKZB 1PFMA 2WIIB 1PFNA 1PRTD 1II3A 1HQMC 2Z4HA 3MXPA 2F0IA 1E2VA 5KIXA 3HOYB 3PUWA 4UDUC 1E2WA 2EJFC 5E4XA 3EFXD 2KECA 3J81L 1K83B 2B2YC 3I4NB 1FNVA 2SOBA 1JORA 4HMJA 2KJXA 3OIQA 1RKNA 1CK1A 1Z6HA 2CW0C 3D6WA 4C3IG 5EBDA 4XIGS 1ENCA 1MI2A 3Q24A 1O7LA 1PLFA 2OXPA 4Q0FA 5CV8A 1NCVA 4DK0A 2E76C 3VYUA 2VB2X 3EJIA 1STBA 3GTJB 1STGA 1RTOA 4V0BA 5A35A 4XQNA 2MUYA 4G7ZC 2KVMA 1LTBD 3D6CA 4Z9CB 1VMPA 4KV6A 1NSNS 4YIJA 1PFBA 1QNUA 1YNJC 1FD7D 3D8GA 3GV3A 1RODA 4K6LA 1KDBA 1H9RA 3BVZA 1C8CA 3NE5B 2JXMB 2B2VC 4X3KA 4FP5D 1B9NA 3SE0A 2A74C 4J6HA 3MXGA 4DAPA 2H4OA 4HEDA 3HP3A 5I6WA 5IGCA 4B08A 1FGBD 1Q8IA 1SDFA 3A7AB 3QOLA 5J1ZA 2L4NA 3G7LA 2RVLA 2B8FA 3ITPA 1BQQT 1BCPC 3MC0B 5BN5A 5JAVA 3H3VC 5D14A 1SYCA 2L5TA 3L9AX 4DU9A 2VB3X 1S5BD 3V96A 4HCSA 2EOTA 3N6RA 2F0VA 3LNNA 3QB3A 3URYA 2QDBA 1B3AA 1X3QA 1HFNA 2PZTA 1G2TA 5HURA 4MHEA 4CGYB 3D3RA 2D5DA 4TSSA 1STAA 3BDCA 5C3EB 1U4RA 4CJ1B 2JA8B 4A3DB 3S14B 1PMRA 2L0CA 4NP5A 3VR6A 2Z8LA 1ZEQX 3SK6A 1STEA 4ZYSA 2EY2A 3RZDB 1BNZA 5D3DA 1LTAD 1TWHB 4RFBA 5C4HA 1H9SA 2EDGA 4CKEA 3CHBD 3MFGA 3NBHA 4L6TB 5E4WC 4GZYC 2X69A 3NP8A 4PMWA 4HMIA 1G6ZA 3I8ZA 3GTKB 3FRPB 3KLSA 3ND8A 5T1IA 2IX3A 1DONA 4WRDA 1TIID 1UAPA 2A68D 4I7ZC 1PRTB 3BVMA 1EY6A 1I6VC 5E3FA 2PW5A 4J8QA 1I50B 4LK1C 5K5PA 3SK4A 2KEEA 4N9TA 5ISRA 5I6YA 1PZJD 4IFDH 5CORA 3LX0A 2IX0A 3GTQB 3MHBA 4K5XA 5T1GA 1EFID 2A6EC 1QB5D 1RJTA 4BBSB 4I65A 3S1RB 4H13C 1PTOF 1ET9A 2D9UA 2BDNA 2F0HA 1EYCA 1QILA 4ZQ3A 4DK1A 1S5FD 2KHSA 3CQZB 5KRUA 1KAAA 4K2LA 5DM63 4ZKBB 1F9QA 4NKLA 2R92B 1QE6A 4LAAA 1IW7C 2IPKD 2LKVA 1TVXA 1K8MA 1M4VA 3FPPA 3T13A 4KKTA 5KYIA 1EYAA 3EQLC 4HCEA 2JYOA 1G91A 3NUCA 1VF5C 2F0SA 2AWOA 2CQAA 3RUZA 1K8OA 1KNAA 2OEOA 3NK9A 4CJ0B 3H09A 1G291 3MWYW 1S5DD 4C3HG 2F03A 3JAME 1B9MA 5COYA 2FFKB 4K8IA 3A55A 4PNYA 4C56C 1LTID 1I4RA 3MTSA 3X3MA 2HCCA 1A2TA 4R9WA 1H9KA 4AYBB 1QNKA 1TQOA 1X32A 1Q12A 1Q1EA 3QG1A 3IAYA 4CKCA 4TKOB 5M3MB 3WOEA 3OHXC 3NTIA 1XYIA 4RHSA 1EEFD 1AW7A 4KD3A 2IT1A 3FDTA 5EKKA 2K03A 3DWAA 4A3JB 5NUCA 4FNFA 1B4OA 2FJ2A 2WKDA 1PTOD 3K59A 2PMZB 2AWNA 4L63B 1KABA 5IGBA 3D4WA 5IGEA 4RKBA 4PMCA 4EQPA 5C4ZA 5IIFA 1BUVT 5I4DA 2M2LA 1EY9A 1ILPA 2FMCA 2JEAI 2K33A 3I91A 5JPNC 3J7YW 3JAML 4K5VA 4M1UB 2PO4A 3MFYA 4L8JA 5EKLA 2EVBA 2A69D 1L0YB 1SAPA 5CV5A 1DXMA 3NBIA 4O1NA 3NQTA 2B39A 3MAQA 4ZUJA 5G3LF 1GOZA 3MXUA 3NQIA 5ELFA 4XT3B 1EY5A 3DEPA 1WVLA 3OMGA 3K6OA 3M3YB 4BA2I 2JA7B 3SK5A 3C1EA 1WTXA 2WKCA 4KJNA 5KYLA 1U4MA 5M3FB 4A3IB 1EL0A 2F1MA 2YU9B 4NW2A 2CHBD 1S5ED 3TZUA 2QKIC 4DFAA 4UAIA 3GTGB 1D1KA 4HTHA 2MPMA 1SEBD 4OGQC 3BVGA 1TR5A 1FNWA 3S17B 5C0XJ 4XTCS 3DEOA 1UNSA 1TWGB 5C44B 1OXUA 1SYEA 2F0LA 2A6HC 2NB0A 4RA8A 4KY5A 3I72A 2JSOA 5CBEE 1QWYA 4WJWA 2NTTA 2ZXPA 3Q22A 1SNCA 1QOHA 5FK9C 2E2IB 1R9TB 2B2WA 3G6JB 4ZKCB 2IWHA 1PDQA 3GQBA 4OIJA 1JOOA 4KMUC 1V1PB 5I2XA 4U673 1CQFA 2F0PA 3P75A 3HOZB 5C3WA 2KOLA 2PQEA 5I9PA 2NVXB 1DM0B 1F2YA 4XDXA 1AN8A 4ILWA 3P1HA 2PZUA 4H7BA 3IKJA 5HGTA 3ONAB 4QCLA 1OO9B 4IUTA 2RA4A 3R3OA 5CV6A 5G3LD 1EIGA 4OHJA 5ELCA 2QF7A 4FF1A 2EY6A 5EPKA 1S5CD 3I3CA 1JWSD 3MEHA 1BXTA 4FF3A 2YYZA 1EY7A 4ZAIA 3K57A 1EY4A 1SBBB 3FKIB 3OOCA 5C3XA 1JWMD 4KK7A 1TT2A 1HXYD 1Q1BA 3AB9A 1STHA 3NPPA 1TS3A 2XN9C 3PUVA 1I4XA 1JC7A 1W6KA 4IUVA 3TP7A 1SMYC 5LHY1 4LMQD 2V4DA 2BE5D 3T53B 5JVH3 2PCFB 4PV1C 3HOUB 1STNA 3NHHA 1MBYA 2PYKA 1TWFB 1PTOB 2QILA 2L55A 2WP8J 2KUMA 2KQ3A 2XWBB 2OT2A 1CZGA 4C3JG 4H44C 4CKBA 2IX1A 3SHLA 2LS01 3PUXA 5IGDA 2O2LD 5K36G 3VR4A 3W2DA 2J0TD 2Y0SB 1SE3A 1I6HB 2SEBD 3ERQA 1SJHD 2F0KA 3ND9A 5M5WB 5IT9L 4IFDI 1ZYRD 1ILQA 5CV7A 1U4LA 4RCOA 5KEEA 1LTRD 2E75C 5KNDA 2F0WA 2EY5A 3OW7A 4C1NI 2FINB 4IURA 1Z47A 1Q90A 1HFGA 3NSWA 3E6ZX 1IL8A 1ESRA 3GTOB 1NAPA 2M9VA 3QO2A 4P2CB 1H9JA 1IKLA 3S9WA 3D4DA 1BO0A 3E5SA 2AQ2B 2K5WA 4C2MB 3E0JA 4IALA 3KUPA 1XTCD 1G2SA 2G9DA 4JBWA 1ENFA 1CA5A 4X3TA 1HPCA 4DNTB 1JWUD 5DAUA 4FXGC 4IUNA 3M4YA 1EY8A 1CTMA 3FEWX 4R8IA 4OL7A 2QEJC 1CHQD 2DN8A 1RF2D 4C3IB 4IQZA 1SE4A 1DYQA 4IUPA 2SNMA 1Q3LA 2NN6G 2EJMA 4DAVA 3BYYB 4CBVA 3RLFA 1SFOB 1WTVA 4A93B 1DJRD 4BWGB 1VCIA 3DHQA 1BR9A 1V8QA 2LFNA 1LTTD 2DNEA 1L0XB 1F2LA 3BZDB 1BBXC 5C0XG 1T5EA 1LT5D 2D62A 1V1OA 2F3VA 1IHZA 1D1IA 2WV6D 1EY0A 2Z4IA 4V190 2G9HD 1M8AA 2NTSA 1SNOA 4ODGA 1CI3M 4B9XA 3DXJC 1SYGA 2BA1A 1TWCB 1HA6A 3H0GB 2J4XA 2WACA 2LMCB 1WTWA 1C48A 1V1PA 2K05A 3BG3A 4RKLA 3CRKC 5C5LA 1PZID 3OMCA 4KKUA 1WCMB 1TS2A 1JE4A 1WTOA 3H94A 1H9MA 1D5MC 5CR3A 3C46A 1A6XA 1B1ZA 1LO5D 4QMGA 4HSVA 4XYOA 1VMCA 5I2YA 1LV9A 4RGTA 2L1BA 1TY0A 3KF8A 3PO2B 1Z7TA 4RGMA 1D5XC 2J7ZA 1A3TA 1V43A 3FPUB 1GUGA 2RDGA 3UI2A 3D4RA 1CM9A 1PXUA 1LACA 1AEXA 5CV9A 3A54A 3I90A 2PZWA 4K2KA 2JEBI 3C1FA 1BCPF 5AFWA 3NWSA 1A3UA 4A3GB 5E1FA 5KGUA 1WD1A 2RQXA 4OO1I 1I4HA 1PTOH 2H1EA 5C4JB 2JA5B 4K14A 4KN4C 1UUPA 2B2TA 2EYFA 2EY1A 2R7ZB 4O42A 3PUZA 1S4ZA 1JOQA 2EYHA 1LABA 4R8NA 4PQXA 1RHPA 2MJ8A 1F2MA 4DXFA 3V2TA 1GUWA 3I70A 2WB1B 5JEAJ 4Y7NB 3I4LA 1B44D 5JVG3 3DWPA 1O7YA 5FO9B 3K0YA 1PRTC 1E0BA 2B2WC 1CQVA 1I4QA 4DGZA 4H0LC 1WTRA 1U4PA 4K5WA 1I4PA 3A8IE 2L12A 1D6EC 2Z1CA 3MVVA 3L7ZC 1YNND 3KBXA 1YNJD 2DNCA 4J1MA 2F0TA 4RH6A 1SNMA 2PW7A 1NR4A 1CZWA 2K04A 3A56A 1EQTA 1QJOA 2M00A 2XSCA 5D65A 2EXZA 5LL6S 4G7OC 1F9PA 2R93B 1ML0D 3L3OC 3VA5A 3FVQA 2B8GA 1BCPD 4RGOS 3C3LA 1O78A 3QWNA 3P20A 4C1NK 3GTMB 2R61A 5K36H 2Q8IB 3HS0C 1OXTA 3S1QB 5ELEA 3NXWA 4NMZA 2F0OA 1SNDA 3TP8A 2XIWA 2F0GA 3TZDA 2ICIA 2A73B 4DA2A 3D31A 4FF4A 3M85A 5I9OA 2RSNA 3VR2A 4C3HB 5FLXE 2K6AA 3K7AB 2EPBA 5IGGA 2RDHA 1W6JA 1HUMA 1F9RA 3J80E 2WAQB 2LY7A 5TSSA 2F3WA 5DM73 4RCNA 2R6GA 1GHJA 2K28A 5CYUA 1B2TA 4KTAA 3HOXB 1JB3A 1Y1VB 2EYPA 1AP0A 1HTLD 1B53A 1XX8A 4TQUS 4F7XA 1WD0A 1CFMA 5IGFA 2PPBC 3TP6A 3H6MA 2A5HA 4QIWB 3K58A 4LJZC 1SYBA 2VXWA 2F0QA 3Q0AA 2CVRA 1RCVD 2O5IC 4XT1B 5DNFA 1O7ZA 2MGSA 4ME5A 2A6ED 3DMUA 4EQNA 4Q5VA 1ENAA 2NN6H 1OXXK 3PIO3 2Q8TA 1J9OA 1R4PB 4FXDA 4XQJA 3J81E 4X3UA 1ET6A 1GUOA 1LTGD 2B2UA 2A68C 5C0XH 3TMEA 2HUGA 3GV6A 5EJWA 3T56B 2N55A 1SYFA 3VYSA 3HEJA 3QOJA 1IYVA 1X3PA 1EEID 4KY7A 3PO3B 2I46A 3LWEA 3A7LA 1G8ZD 2BA0A 3T4AC 1HHVA 2F0MA 3TN2A 2K01A 3HOWB 3DWQA 2RBMA 1BDOA 3MZ5A 4M8AA 1LT4D 2OF1A 4JK1C 3RMHA 5ELDA 3SK8A 2QCPX 1AFPA 1ICWA 1JQYD 3VYRA 3K5LA 4ZLTF 4DAYA 2KCCA 5JEAG 1BF4A 2NVTB 4G7HC 4HAEA 3PIP3 3TBIB 2MP1A 4KD4A 1BCPB 3TP5A 3N52A 2GA4B 4RHRA 5D3IB 4BY1B 5J39A 3GD7A 3M4OB 4ID6A 4QB4A 2E2HB 1D5ZC 2EYOA 4KKSA 1MGSA 1TU2B 2EYLA 1DOMA 3HRZC 5JPMC 1MD2D 3DUZA 1GUTA 3M7GA 5EBCA 4NDXA 1WTPA 4DXGA 3R8BA 2E2JB 4HN7A 3EROA 3MXNA 3TDQA 2HCIA 3J7AF 2F0FA 1JICA 2F0NA 3T51B 4ABNA 2O5JC 4KHZA 1AZQA 3RD4A 4HSPA 1SSOA 2R3ZA 1Y8OB 4KY6A 3A8JE 5FO7B 1YNNC 5J22A 1R4QB 1KDCA 5CBAE 3QJYA 4OO1G 3F2UA 3MA2B 5KNCA 5FO8B 2B2TC 1GJXA 5EQ0A 5DEHA 1PTOC 5CV4A 2EYJA 2SDFA 5BN4A 2TSSA 1SE2A 2I07B 2ICEC 3SEBA 5EKIA 4CJ2C 5M9OA 2WINB 5IOCA 2IJ0A 3CRLC 3IFTA 4C3JB 1MSHA 2C5CA 1GUSA 4DN4M 3PMFA 2ZXRA 1XXGA 2X6LA 1EZ6A 2VNUD 5C5MA 1OXSC 3H91A 3S15B 3I73A 1HRJA 1EU3A 1BOSA 1C4QA 2A69C 1STYA 1Y8PB 2A6HD 3EA6A 3CU7A 4IFDJ 1GHKA 2KEDA 2EE1A 5CC4A 3IFDA 3GTLB 4FVMA 5IODA 1EOTA 1J8IA 5FOBB 3K5NA 1JR0D 4RAUC 3KLSX 2DY8A 3OWFA 4ZRZA 4ZUIA 1AZPA 3C2PA 1TY2A 5FKAC 1A3VA 3A8KE 3LWUA 5M5YB 2B2YA 1LLRD 4BS9A 1ZXTA 1EWCA 4DNRB 4QUFA 3WOFA 4F88A 1QCBD 1MSGA 5CMDA 4WORA 3K5MA 3S1MB 4U68A 3GTPB 4XQQA 4ULLA 1KNEA 4XXEA 2X6GA 2O4XA 2ID0A 1PZKD 1JCKB 2MHVA 1QG7A 2K5DA 2L11A 4A3EB 1JOKA 3OSOA 4F8MA 4FYDA 3QIAA 3DM1A 4IN3A 3J7AV 1FYCA 3R2IA 2F0EA 1DOKA 3I4MB 5C4XB 1I3QB 2K1BA 1GUNA 2DY7A 2K5QA 4FF2A 1SXTA 2NVQB 2ENBA 2EZVA 3VA7A 4A3FB 4G4KA 1HUNA 4KN7C 1SMYD 2D2CC 2C9OA 4RGNA 2SNSA 4E6IA 5CGKA 2B2VA 1F2ZA 3SDZA 2FHTA 4G57A 1OXVA 4A3BB 2TMPA 2VUMB 3HG9A 2CW0D 2FMMA 3P7JA 3OPOA 3NTHA 1CT1D 2XRSD 2JP1A 2XWJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WJW A;  4IN3 A; 
#chains in the Genus database with same CATH topology
 2KCN A;  2HHH Q;  3SR1 A;  2K32 A;  4DNI A;  1K9M C;  3CKI B;  2IL8 A;  3GP7 A;  2KA7 A;  3HZX A;  2ZXO A;  1SMX A;  3PUY A;  3IRB A;  2VZA A;  2N78 A;  4GN5 A;  3S1N B;  4TRD A;  1YHQ A;  3U9S A;  4IUQ A;  4KI0 A;  3SGI A;  2GN5 A;  2E2J H;  2WB1 E;  5JJZ A;  5F2D A;  1SRU A;  3CAM A;  3J7Z C;  4FXK C;  2HIX A;  3VR5 A;  2BE5 C;  3M7N A;  2CH4 W;  2HDL A;  1SYD A;  2NN6 I;  2AQ3 B;  1HA5 A;  5J3B A;  4K6D A;  4EX5 A;  2OTJ A;  1KLG D;  2F0J A;  4LNQ A;  1DD2 A;  3OYY A;  2AUJ D;  2JA7 G;  3IL8 A;  1P8L A;  3PF4 A;  2B63 B;  3OWE B;  1FNU A;  5M3F G;  3CCS A;  4A3I G;  4L5T A;  3KLR A;  1HQR D;  5LL6 X;  1U9R A;  1LM0 A;  5M5X B;  1SNP A;  5C0X I;  1IYU A;  4OIK A;  5KNB A;  2HDM A;  3CCL A;  1ONL A;  2JE6 I;  2EYM A;  4WFN 3;  3HKS A;  3BZC A;  2B2U C;  1SN8 A;  1TS4 A;  4MN3 A;  2JA6 G;  4BXX G;  1HNZ L;  4DR1 Q;  3R2T A;  3EIV A;  4LF7 L;  1IL2 A;  3F2C A;  1ZYR C;  5EGT A;  4DF7 A;  1K0S A;  1JJC B;  3KFU A;  3T16 A;  2BDO A;  1A15 A;  1A8V A;  1N36 Q;  1HZC A;  1HTP A;  1ZKO A;  3VYT A;  4UHV A;  4IZ8 A;  4YHH Q;  1VQE A;  5JEA H;  2I5L X;  1IBL L;  4CHT B;  3WDN A;  1EQV A;  4C3J H;  4MNO A;  3Q6S A;  2F0U A;  1EWH A;  2ZTE A;  2F52 A;  5C6A A;  4DV1 Q;  4IUU A;  2E2D C;  1XWE A;  1A63 A;  4LFC L;  1DOL A;  2L9H A;  3AU7 A;  1DCZ A;  2N3S A;  4X66 Q;  1TWA B;  4P75 A;  4DUZ L;  2RSO A;  1UEA B;  3S16 B;  5IYB G;  1EZ8 A;  1QZG A;  2XVS A;  1VF7 A;  1F9S A;  3BDL A;  3HOZ G;  1Y69 U;  4S3S A;  4HR7 B;  2NVY B;  3JAM i;  1LT6 D;  1RDP D;  4A3M G;  4KHV A;  3X3N A;  1O80 A;  3JC6 6;  4A3K G;  3BYT B;  4A3L G;  5C3E H;  3BS1 A;  4UY8 C;  2JA8 H;  3PV0 A;  1KIX A;  3SVM A;  4A3D H;  3TEH B;  2XRQ D;  4UPA A;  4QF4 A;  4KJO A;  4JPB W;  1GVP A;  1HZB A;  1ASY A;  1E24 A;  4GOP C;  1A2U A;  2MNA A;  2BCO A;  2NYZ D;  1PH3 A;  1KLU D;  1NNX A;  1SJE D;  2XGT A;  4QY7 A;  3V05 A;  2F4I A;  2UUA L;  4JYA Q;  4EQO A;  1L1O B;  4A75 A;  3HOV G;  4K8J A;  1W2B A;  2ZT9 C;  4O0A A;  4AQY Q;  4IFD G;  2AUK A;  1UEB A;  3NWT A;  5A2Q E;  1RD9 D;  1T5X D;  2RDF A;  3HKZ G;  2WAQ E;  3TSS A;  3O13 A;  2E74 C;  1D8L A;  1FR3 A;  1TWH H;  2HQE A;  1PRT F;  2K7V A;  3SXH A;  1X3E A;  2RKS A;  4OWX B;  2Q8R E;  4CDC C;  4DR3 L;  2EJG C;  1IYJ B;  3S1M H;  4OO1 H;  1RTN A;  2UUB L;  3GTP H;  3ZYY X;  5JOB A;  1VQB A;  1VQP A;  3NTK A;  4FO2 A;  4EVO A;  3K5O A;  2L15 A;  4HJ7 A;  1N9W A;  3EVQ A;  1HZ9 A;  2JA6 B;  1CSP A;  4A3E H;  1LT3 D;  4QUC A;  2NUC A;  5ELN A;  1LTS D;  1KDA A;  1SE8 A;  2JA9 A;  2RCN A;  4F87 A;  2XNA C;  1NUC A;  4XYQ A;  2NZ1 D;  4LFA Q;  3I4M H;  1GXD C;  2FXQ A;  4RWS C;  5C4X H;  2E5L Q;  1HCZ A;  3G71 A;  4BY7 B;  4QIW E;  3L0O A;  1EU4 A;  5FLX L;  1V1Q A;  1PH6 A;  1D2B A;  1Y8N B;  1WTQ A;  4N9P A;  1K8G A;  3E9I A;  1PH5 A;  1KAW A;  3KBG A;  2K50 A;  1XMO Q;  1H9S B;  1EYD A;  4NXM Q;  1B50 A;  4HIO A;  3NBH B;  4HIK A;  1Y1W B;  2NVQ H;  4KLK A;  4ZK9 B;  1ESF A;  3J80 L;  2Y0S G;  3W3A A;  1L2F A;  2KCT A;  2AQ1 B;  3S1R H;  4P72 A;  4BBR B;  4B9W A;  3S2D B;  3KK7 A;  2N88 A;  5ELB A;  1KTK A;  1VDZ A;  1SNQ A;  3FMC A;  5EPJ A;  5BN3 A;  3R93 A;  3AMU A;  3BDO A;  2I5M X;  2NBF A;  1CA6 A;  2VS1 A;  2IW3 A;  3Q23 A;  4JI2 Q;  3HGB A;  1I4G A;  1IKM A;  5A2Q L;  2PNR C;  2A19 A;  3U9O A;  3CQZ H;  1EIH A;  4QJF A;  4A3M B;  3I7F A;  4DV4 L;  3VR3 A;  2HT1 A;  3PQI A;  4DR6 L;  1NR2 A;  4A3K B;  1E2Z A;  3AQQ A;  1O7I A;  4A3B H;  1IW7 D;  1PYW D;  2VUM H;  4YY3 L;  3BU2 A;  4GLA C;  4BA1 I;  3RNU A;  2I5H A;  4DKA C;  4X3S A;  4MIU A;  1TS5 A;  3OIP A;  5EPL A;  3BJU A;  1BKB A;  1F77 A;  2F0D A;  4H02 A;  3CMA A;  1NE3 A;  3S2H B;  3RZO B;  3GO5 A;  4EGV A;  1TKW B;  2ZM6 Q;  3HOV B;  2NWG A;  1CHP D;  3T1Y L;  1DZ1 A;  5IT9 E;  4PMB A;  2BOS A;  4YWK A;  3CC4 A;  3HKZ B;  1PFM A;  2WII B;  1QVC A;  5JJK A;  4JI7 L;  1J5E Q;  1PFN A;  2GVA A;  1PRT D;  1SLJ A;  1II3 A;  3E0E A;  1HQM C;  2Z4H A;  1YIJ A;  3MXP A;  5FLM H;  1Q8K A;  2F0I A;  1E2V A;  5KIX A;  3HOY B;  3PUW A;  1EUJ A;  1E2W A;  4UDU C;  3UDI A;  2EJF C;  3CD6 A;  1JT8 A;  5E4X A;  3EFX D;  2KEC A;  2UUC Q;  3J81 L;  1K83 B;  2B2Y C;  3I4N B;  1FNV A;  1JJ2 A;  2SOB A;  3M9B A;  1S3O A;  2JJQ A;  1PH9 A;  1JOR A;  4HMJ A;  2KJX A;  3OIQ A;  1E1O A;  2VQE L;  1PFS A;  1CK1 A;  1RKN A;  1Z6H A;  2CW0 C;  2HHH L;  3D6W A;  4C3I G;  4LF7 Q;  5EBD A;  1VQJ A;  5M3M H;  4XIG S;  1ENC A;  1SR3 A;  2A8V A;  1MI2 A;  4DR2 Q;  3Q24 A;  3RLN A;  1O7L A;  4A93 G;  1PLF A;  2OXP A;  4Q0F A;  5CV8 A;  4TVA B;  1NCV A;  4A3J H;  1IBL Q;  4DK0 A;  4GN4 B;  2E76 C;  1Q82 C;  3VYU A;  2VB2 X;  3EJI A;  1STB A;  1MJC A;  4DUY Q;  3GTJ B;  1STG A;  1RTO A;  4V0B A;  5A35 A;  4XQN A;  2MUY A;  4G7Z C;  1MHW C;  5JJI A;  2LSS A;  2KVM A;  1LTB D;  4FDB A;  3D6C A;  4Z9C B;  3VDY A;  1VMP A;  4KV6 A;  1NSN S;  2GVB A;  4YIJ A;  1PV4 A;  1PFB A;  1QNU A;  1CSQ A;  4JBJ A;  3S16 H;  3ERS X;  1YNJ C;  1FD7 D;  3D8G A;  3GV3 A;  1AH9 A;  3K0X A;  1ROD A;  4K6L A;  1KDB A;  1VQ4 A;  1A0I A;  1IZ6 A;  1H9R A;  3BVZ A;  2NVY H;  3J81 j;  3NE5 B;  2JXM B;  3ULL A;  1C8C A;  2B2V C;  4X3K A;  3H0G G;  4FP5 D;  1B9N A;  3PIP A;  3U58 A;  4UP8 A;  3SE0 A;  3H3V I;  2A74 C;  4J6H A;  3MXG A;  4DAP A;  1KHI A;  2H4O A;  4HED A;  3HP3 A;  1WCM G;  4DR1 L;  5I6W A;  4HJA A;  1WOC A;  5IGC A;  4JI5 L;  4B08 A;  2VL6 A;  1FGB D;  1Q8I A;  1SDF A;  3A7A B;  3QOL A;  2ZJR A;  5J1Z A;  2UUA Q;  2L4N A;  2YTV A;  3G7L A;  3E3X A;  4P71 A;  2RVL A;  2B8F A;  3ITP A;  1N36 L;  4DK6 C;  1BQQ T;  1BCP C;  1RL2 A;  4YHH L;  4NXN Q;  3MC0 B;  5BN5 A;  5JAV A;  2IY5 B;  3H3V C;  5D14 A;  2JA7 H;  4HIM A;  4GKK Q;  1SYC A;  2L5T A;  3PO2 G;  3L9A X;  4DU9 A;  4A76 A;  2VB3 X;  5M3F H;  4A3I H;  1S5B D;  2YU9 H;  3V96 A;  1T9H A;  4HCS A;  2EOT A;  4JI3 Q;  4BBS G;  3N6R A;  2UUB Q;  4DV1 L;  1MJE A;  2F0V A;  3LNN A;  5IE8 A;  4LF4 Q;  3QB3 A;  4X66 L;  3URY A;  2QDB A;  1J6Q A;  1B3A A;  1GO3 E;  1X3Q A;  1HFN A;  2N8N A;  2PZT A;  2JA6 H;  4BXX H;  4DR5 Q;  1G2T A;  5HGQ A;  1YJ9 A;  1KXL A;  5HUR A;  3A5Z B;  1TWG H;  4MHE A;  4CGY B;  3D3R A;  2D5D A;  4TSS A;  1XPO A;  1STA A;  3BDC A;  5C3E B;  1VQ8 A;  1U4R A;  4GN3 B;  5DLQ E;  4CJ1 B;  2JA8 B;  2VW9 A;  1VQ6 A;  4A3D B;  4A3C G;  1L0W A;  2RF4 A;  2R92 G;  4GLV B;  4OXP A;  3S14 B;  1PMR A;  1VQ5 A;  2L0C A;  1XNR Q;  4NP5 A;  3VR6 A;  2JA5 G;  1GKH A;  2Z8L A;  1YNX A;  1ZEQ X;  3SK6 A;  1STE A;  4ZYS A;  2EY2 A;  3RZD B;  1BNZ A;  1QVG A;  4AQY L;  5D3D A;  3S2D H;  1LTA D;  1TWH B;  5IYB H;  4RFB A;  5C4H A;  1D7Q A;  1H9S A;  2EDG A;  4CKE A;  1YJW A;  3CHB D;  3MFG A;  1IXR A;  1EQQ A;  3HOZ H;  1X55 A;  3NBH A;  4L6T B;  5E4W C;  4GZY C;  2X69 A;  1EQR A;  2WB1 G;  2K14 A;  3NP8 A;  4HMI A;  4PMW A;  4A3M H;  1G6Z A;  3I8Z A;  3GTK B;  3FRP B;  2NVX H;  3KLS A;  3ND8 A;  5T1I A;  2IX3 A;  4A3K H;  1YIT A;  4A3L H;  1DON A;  4WRD A;  1TII D;  1UAP A;  2A68 D;  2ZJQ A;  4I7Z C;  1PRT B;  3S24 A;  3BVM A;  1EY6 A;  4IPG A;  1I6V C;  1PH7 A;  5E3F A;  2PW5 A;  2ZTD A;  4J8Q A;  1I50 B;  4LK1 C;  3W1G A;  4DR7 Q;  3T1Y Q;  5K5P A;  3SK4 A;  2KEE A;  4LFA L;  4N9T A;  3HOV H;  5ISR A;  1K28 A;  5I6Y A;  1PZJ D;  4P73 A;  2F3I A;  4AYB G;  2E5L L;  2AHO B;  5COR A;  4IFD H;  1M90 C;  3LX0 A;  2IX0 A;  3GTQ B;  4IOA A;  1JMC A;  3MHB A;  4K5X A;  5T1G A;  1XMO L;  1EFI D;  2A6E C;  1QB5 D;  2OWO A;  4NXM L;  3A0J A;  1RJT A;  4BBS B;  4I65 A;  1BBW A;  3S1R B;  4ALP A;  4H13 C;  4R4T A;  1PTO F;  1ET9 A;  2D9U A;  4QQB X;  2BDN A;  2R7F A;  2F0H A;  2YV5 A;  1EYC A;  1QIL A;  3OTO L;  4ZQ3 A;  4DK1 A;  1S5F D;  1QUQ B;  2KHS A;  3CQZ B;  5KRU A;  4JI2 L;  2R93 G;  1KAA A;  4K2L A;  5DM6 3;  3CCV A;  3CCE A;  4ZKB B;  4PZ8 A;  1F9Q A;  1WFQ A;  4LF6 Q;  4LW1 A;  4NKL A;  2R92 B;  1QE6 A;  1B70 B;  1TWF H;  4LAA A;  4JOI A;  1IW7 C;  2IPK D;  2LKV A;  1TVX A;  1K8M A;  2BH2 A;  1M4V A;  1YHB A;  3FPP A;  4X62 Q;  3T13 A;  4KKT A;  3KLW A;  5KYI A;  1EYA A;  3EQL C;  4HCE A;  2JYO A;  2ZM6 L;  1AE2 A;  1G91 A;  1I6H H;  2NZO A;  1X3G A;  3CCU A;  3NUC A;  1VF5 C;  1WYD A;  2F0S A;  1YZ6 A;  2AWO A;  4DK3 C;  2WFW A;  2CQA A;  3RUZ A;  5M5W H;  1EOV A;  1KNA A;  2OEO A;  4WJ4 A;  3NK9 A;  1K8O A;  4IPC A;  4P74 A;  4CJ0 B;  3H09 A;  1G29 1;  4N8F A;  1J5E L;  3MWY W;  3MEF A;  2PQA B;  1MIU A;  1S5D D;  3GTJ H;  4JI8 Q;  3KOJ A;  4C3H G;  2F03 A;  1U0L A;  2PNH A;  3JAM E;  3STB D;  4DAY B;  1B9M A;  5COY A;  2FFK B;  4K8I A;  1B3Q A;  3A55 A;  4PNY A;  3TRE A;  4C56 C;  1LTI D;  1I4R A;  3MTS A;  2UUC L;  4UP9 A;  3GTO H;  3X3M A;  2HCC A;  1A2T A;  4R9W A;  1H9K A;  1E1T A;  4AYB B;  1QNK A;  1TQO A;  1KRS A;  1X32 A;  3HOX G;  2C35 B;  4ZCK A;  1Q12 A;  4GKJ L;  1Q1E A;  3QG1 A;  4LUO A;  1CKO A;  3IAY A;  4B3R Q;  4CKC A;  4OWW B;  4TKO B;  5M3M B;  3WOE A;  3OHX C;  3NTI A;  4R4I A;  1XYI A;  4RHS A;  3BZK A;  1EEF D;  4JI5 Q;  5C44 G;  1AW7 A;  4KD3 A;  2IT1 A;  1XMQ Q;  1XPU A;  4DR2 L;  2D0O A;  3FDT A;  5EKK A;  1LTL A;  2K03 A;  3DWA A;  4A3J B;  4UP7 A;  5NUC A;  4FNF A;  1B4O A;  2FJ2 A;  2WKD A;  1PTO D;  3K59 A;  4B3S L;  2PMZ B;  4DAM A;  2AWN A;  1K73 C;  1VQ9 A;  4L63 B;  1KAB A;  5IGB A;  1V9P A;  3D4W A;  5IGE A;  1Q46 A;  4DUY L;  4RKB A;  2Z9H A;  4PMC A;  4LF9 Q;  4B3T Q;  4EQP A;  5C4Z A;  2ES2 A;  5IIF A;  1BUV T;  5I4D A;  2KEN A;  3K8A A;  2M2L A;  1EY9 A;  1ILP A;  2FMC A;  2JEA I;  1CKN B;  2K33 A;  3I91 A;  2MFI A;  3G6E A;  5JPN C;  5IYD G;  3J7Y W;  1YJN A;  1VQD A;  3JAM L;  4K5V A;  4C3I H;  1RIP A;  4M1U B;  1XTD A;  2PO4 A;  3MFY A;  4L8J A;  4DV7 Q;  5EKL A;  2EVB A;  2A69 D;  1L0Y B;  1SAP A;  5CV5 A;  4A93 H;  1DXM A;  3NBI A;  1G51 A;  4O1N A;  3NQT A;  2B39 A;  3MAQ A;  4ZUJ A;  5G3L F;  3S14 H;  1GOZ A;  3MXU A;  2EQS A;  3NQI A;  5ELF A;  2ATW A;  5LMU L;  4XT3 B;  3TRZ A;  1EY5 A;  3DEP A;  4JG2 A;  1WVL A;  3OMG A;  3CPF A;  4HJ5 A;  3RZD H;  1PH1 A;  3K6O A;  3M3Y B;  4NXN L;  4BA2 I;  2JA7 B;  1K8A C;  3SK5 A;  3C1E A;  1WTX A;  2WKC A;  4KJN A;  5KYL A;  1U4M A;  4GKK L;  1EIY B;  1VQF A;  4IO9 A;  1VQC A;  5M3F B;  4A3I B;  2F1M A;  2YU9 B;  4NW2 A;  1EL0 A;  2CHB D;  1S5E D;  3TZU A;  2QKI C;  3PO3 G;  4DFA A;  4UAI A;  3GTG B;  1D1K A;  3FKI G;  1U5K A;  4JI3 L;  1E3P A;  2H5X A;  4HTH A;  2MPM A;  3H0G H;  1SEB D;  4OGQ C;  3GTK H;  3HOW G;  5IP9 G;  3BVG A;  4LF4 L;  1TR5 A;  4DV0 L;  1FNW A;  3S17 B;  5C0X J;  4X64 L;  4XTC S;  3DEO A;  2R7D A;  2IHE A;  1UNS A;  1NBW A;  1TWG B;  4DR5 L;  1WCM H;  5C44 B;  1OXU A;  1SYE A;  2QA4 A;  4CDF C;  2F0L A;  3A5U A;  2A6H C;  2NB0 A;  4RA8 A;  3I55 A;  4KY5 A;  3I72 A;  2JSO A;  1K0R A;  5CBE E;  1QWY A;  3HOU G;  1I50 H;  1VQA A;  3Q8D A;  2XTI A;  4WJW A;  2NTT A;  2ZXP A;  4LFB L;  3I56 A;  2OQK A;  3KF6 B;  3Q22 A;  1SNC A;  1QOH A;  1XNR L;  3PO2 H;  5FK9 C;  3GTQ H;  2E2I B;  1Z9F A;  1R9T B;  1BBU A;  4LF5 Q;  2B2W A;  3G6J B;  2CQO A;  4ZKC B;  1YEZ A;  2IWH A;  1PDQ A;  3GQB A;  4BBS H;  5H1S E;  4OIJ A;  4BY1 G;  2KBN A;  1JOO A;  4KMU C;  1KC8 C;  1I94 Q;  1V1P B;  3CC7 A;  1YHA A;  5GAH C;  5I2X A;  4U67 3;  3OTO Q;  1CQF A;  3FP9 A;  2F0P A;  3P75 A;  3HOZ B;  5C3W A;  3CCJ A;  2KOL A;  2PQE A;  3K7U C;  3KDF B;  5I9P A;  2NVX B;  1DM0 B;  1F2Y A;  4XDX A;  1AN8 A;  4ILW A;  3P1H A;  1WTH A;  2PZU A;  3J80 i;  4H7B A;  3IKJ A;  5HGT A;  4A3C H;  2R92 H;  3ONA B;  4OEM B;  2K52 A;  1OO9 B;  1TXY A;  1QUQ A;  4QCL A;  4IUT A;  3G4S A;  1L1O C;  3KF8 B;  2JA5 H;  3J7A 5;  4GNX B;  2LXJ A;  2Q2U A;  3AYH B;  4OWT B;  2RA4 A;  3R3O A;  5CV6 A;  5G3L D;  1P16 A;  1EIG A;  4OHJ A;  5ELC A;  2QF7 A;  4IOC A;  4FF1 A;  4DR7 L;  2EY6 A;  5EPK A;  1S5C D;  1VQH A;  3I3C A;  1JWS D;  3MEH A;  3A74 A;  1BXT A;  4FF3 A;  2YYZ A;  1N33 L;  1EY7 A;  4ZAI A;  3CXC A;  3K57 A;  1EY4 A;  1SBB B;  1X54 A;  1VQN A;  3FKI B;  3OOC A;  5C3X A;  1JWM D;  4KK7 A;  3HKZ E;  1TT2 A;  1HXY D;  1Q1B A;  3AB9 A;  1STH A;  3NPP A;  4Y7N H;  3PUV A;  1TS3 A;  2XN9 C;  1N34 Q;  3LGJ A;  1I4X A;  2UXD Q;  1JC7 A;  1VQL A;  1W6K A;  3HFZ B;  4IUV A;  3TP7 A;  1SMY C;  5LHY 1;  4NB3 A;  4LMQ D;  2V4D A;  2Z6B A;  2BE5 D;  3PIO A;  3T53 B;  1SRO A;  5JVH 3;  2PCF B;  4R4Q A;  2PQA A;  4PV1 C;  1NY4 A;  3HOU B;  1STN A;  3NHH A;  4LF6 L;  3RN5 A;  1MBY A;  2PYK A;  1TWF B;  1PTO B;  2QIL A;  2L55 A;  4GKJ Q;  2QW7 A;  2KUM A;  2KQ3 A;  2WP8 J;  2XWB B;  2OT2 A;  1CZG A;  4C3J G;  4H44 C;  4DR4 Q;  4CKB A;  2IX1 A;  3SHL A;  2LS0 1;  3PUX A;  4X62 L;  5IGD A;  2O2L D;  5K36 G;  1QZH A;  3VR4 A;  3W2D A;  2J0T D;  2Y0S B;  5FLX c;  1SE3 A;  1I6H B;  2SEB D;  3ERQ A;  1SJH D;  4YCW A;  3J81 i;  2F0K A;  1EIF A;  4X65 Q;  4B3S Q;  3ND9 A;  2F4V Q;  2KHJ A;  5M5W B;  5IT9 L;  4IFD I;  1ZYR D;  3J80 c;  3ER0 A;  4B3M L;  1ILQ A;  3UE1 A;  4LUZ A;  5CV7 A;  2DGY A;  1Q86 C;  2R93 H;  2RHS B;  1U4L A;  2YTY A;  4AIM A;  1KD1 C;  4RCO A;  5KEE A;  1VQM A;  1LTR D;  2E75 C;  4JI8 L;  5KND A;  2F0W A;  2EY5 A;  3OW7 A;  1EYG A;  4C1N I;  2FIN B;  4IUR A;  1Z47 A;  1KRT A;  1Q90 A;  3UE0 A;  1HFG A;  3NSW A;  3E6Z X;  1IL8 A;  1ESR A;  3GTO B;  2P5Z X;  2EIF A;  1NAP A;  2M9V A;  3QO2 A;  4P2C B;  1H9J A;  1IKL A;  3S9W A;  1JE5 A;  3H15 A;  3S1Q H;  4O2D A;  4LUV A;  3AFP A;  1CKN A;  3B6Y A;  1A62 A;  3DM3 A;  3D4D A;  4B3R L;  1BO0 A;  3E5S A;  1FJG Q;  2AQ2 B;  2K5W A;  3NEL A;  3E0J A;  4C2M B;  5LMU Q;  2CWP A;  4IAL A;  1JJG A;  3KUP A;  4JOI C;  4DV3 Q;  1XTC D;  1G2S A;  2IHF A;  1XMQ L;  2G9D A;  4JBW A;  4OEL B;  1ENF A;  1E7Z A;  4C3H H;  4L5S A;  1CA5 A;  4X3T A;  3K7A H;  1HPC A;  3M3Y H;  4DNT B;  1JWU D;  3U4V A;  5DAU A;  2JN4 A;  5GAG C;  5IYC G;  4FXG C;  4IUN A;  3M4Y A;  1EY8 A;  1CTM A;  1M1K C;  3FEW X;  1L1O A;  4R8I A;  4OL7 A;  4LF9 L;  4B3T L;  3CC2 A;  2QEJ C;  3GTG H;  1CHQ D;  1VQI A;  3NEN A;  2DN8 A;  2CCZ A;  4DV0 Q;  3HOX H;  4N8X 1;  4X64 Q;  3J81 c;  4JV5 Q;  1RF2 D;  4C3I B;  4IQZ A;  1SE4 A;  3S17 H;  1DYQ A;  2QEX A;  4IUP A;  2SNM A;  1Q3L A;  2NN6 G;  2EJM A;  1S72 A;  4DAV A;  3D0F A;  3CP0 A;  5C44 H;  3BYY B;  4CBV A;  3RLF A;  1SFO B;  1WTV A;  4A93 B;  4DV7 L;  1DJR D;  4A3F G;  4A3G G;  4BWG B;  1VCI A;  3DHQ A;  2UU9 Q;  4LFB Q;  1BR9 A;  2ALY B;  1V8Q A;  2LFN A;  4POF A;  5GAE C;  4JBM A;  1LTT D;  2DNE A;  4KHP Q;  4R4C A;  1L0X B;  1F2L A;  1PVO A;  2LXK A;  3BZD B;  1BBX C;  2E2I H;  2VQF Q;  1R9T H;  2R7Z G;  5C0X G;  1T5E A;  1LT5 D;  5EAY A;  2D62 A;  5IP7 G;  1N32 L;  1V1O A;  3KF6 A;  4YCV A;  4JI4 Q;  2F3V A;  1VS0 A;  1IHZ A;  2BH8 A;  4Y52 H;  4GLX A;  1D1I A;  5IYD H;  2K4K A;  2WV6 D;  1EY0 A;  2Z4I A;  2RHQ B;  4V19 0;  2G9H D;  1M8A A;  3UDX A;  2NTS A;  1SNO A;  4ODG A;  1CI3 M;  4B9X A;  3DXJ C;  1SYG A;  3CME A;  2BA1 A;  1TWC B;  1HA6 A;  3H0G B;  2J4X A;  2WAC A;  2LMC B;  1WTW A;  3CPW A;  1C48 A;  1V1P A;  2K05 A;  3BG3 A;  3RN2 A;  2N49 A;  4RKL A;  3RLO A;  3CRK C;  2D0P A;  5C5L A;  1PZI D;  3OMC A;  4KKU A;  1WCM B;  1TS2 A;  1JE4 A;  3KDF A;  1WTO A;  3H94 A;  1H9M A;  1D5M C;  5CR3 A;  3C46 A;  1A6X A;  1B1Z A;  1LO5 D;  4QMG A;  4HSV A;  5FJ8 G;  4XYO A;  2CH4 A;  1AE3 A;  1VMC A;  5I2Y A;  1LV9 A;  4RGT A;  1N33 Q;  2L1B A;  1TY0 A;  2Q2T A;  3KF8 A;  4WJ3 M;  3PO2 B;  1Z7T A;  3I2Z A;  4RGM A;  1D5X C;  2B63 G;  2J7Z A;  4LF5 L;  1A3T A;  1V43 A;  2V1C C;  3FPU B;  3PO3 H;  1GUG A;  1GM5 A;  4IJH A;  3FKI H;  1XNQ Q;  2RDG A;  2CFM A;  3UI2 A;  1HNX Q;  3D4R A;  1CM9 A;  3HOW H;  4ME3 A;  4HID A;  5IP9 H;  1PXU A;  1LAC A;  2KCM A;  1I94 L;  1AEX A;  5CV9 A;  3A54 A;  3I90 A;  1KL9 A;  2PZW A;  4K2K A;  2JEB I;  3C1F A;  1BCP F;  4OON A;  1NMG A;  5AFW A;  3NWS A;  3TS0 A;  1A3U A;  4A3G B;  1HH2 P;  5E1F A;  1HZA A;  5KGU A;  1WD1 A;  2RQX A;  3M4P A;  4IPD A;  3HOU H;  4OO1 I;  1I4H A;  1PTO H;  2H1E A;  3UDF A;  5C4J B;  2JA5 B;  4K14 A;  4KN4 C;  1UUP A;  1LUZ A;  5L37 A;  2NVT H;  2B2T A;  2EYF A;  2EY1 A;  2R7Z B;  1IBK Q;  4O42 A;  3PUZ A;  1S4Z A;  2AKW B;  1JOQ A;  2EYH A;  1LAB A;  3KJP A;  4MZ9 A;  4R8N A;  4BY1 H;  4PQX A;  1RHP A;  4DPG A;  1I5F A;  2MJ8 A;  1F2M A;  4DXF A;  3V2T A;  2PI2 A;  4B3M Q;  5IY0 A;  1VQK A;  1GUW A;  2E2H H;  2QGQ A;  3I70 A;  2Z6K A;  2WB1 B;  2Q2I A;  5JEA J;  4Y7N B;  3I4L A;  1B44 D;  1K3R A;  5JVG 3;  1UE1 A;  3DWP A;  1O7Y A;  2VY3 A;  5FO9 B;  3K0Y A;  1YI2 A;  1N34 L;  2UXD L;  1PRT C;  2I0Q A;  4QL5 A;  1X65 A;  3W1B A;  1E0B A;  1NMF A;  2B2W C;  1E22 A;  1CQV A;  1I4Q A;  4DGZ A;  2OQ0 A;  2G5D A;  4H0L C;  4JC0 A;  1WTR A;  1U4P A;  4K5W A;  1I4P A;  3A8I E;  2L12 A;  2WAQ G;  4JCV E;  1D6E C;  1ASZ A;  2Z1C A;  4L5R C;  3M4Q A;  3MVV A;  3ZJY C;  3L7Z C;  4GOP B;  1YNN D;  3KBX A;  3F2D A;  5HY6 A;  1YNJ D;  2DNC A;  4J1M A;  1Y1V G;  2F0T A;  5GAD C;  4RH6 A;  1EWI A;  1SNM A;  2PW7 A;  4DR4 L;  1NR4 A;  1CZW A;  5BR8 Q;  4DV5 L;  4AYB E;  4C2M H;  2K04 A;  1BVS A;  3A56 A;  1EQT A;  1QJO A;  2M00 A;  2XSC A;  4MTK A;  3PSI A;  5D65 A;  2EXZ A;  4X65 L;  3K80 C;  2F4V L;  2OCE A;  4LWC A;  5LL6 S;  3MXN B;  4G7O C;  1F9P A;  2R93 B;  1X6O A;  1ML0 D;  3L3O C;  3VA5 A;  1K3B C;  3FVQ A;  1Q7Y C;  2B8G A;  4K0K Q;  1BCP D;  1IBM Q;  4DV2 L;  2PMZ E;  4MTN A;  4RGO S;  3C3L A;  4BY7 G;  1OTC A;  1HNW L;  1O78 A;  3QWN A;  3P20 A;  5GQO A;  4IJL A;  4C1N K;  4HJ8 A;  3GTM B;  2R61 A;  5K36 H;  2Q8I B;  3HS0 C;  2MO0 A;  1OXT A;  1FVI A;  3S1Q B;  5ELE A;  1UE5 A;  3NXW A;  4NMZ A;  1Y1W G;  1VQ7 A;  2F0O A;  1SND A;  1SFO H;  3TP8 A;  3S15 H;  2XIW A;  4BBR G;  4YCU A;  2F0G A;  3KJO A;  1G6P A;  3TZD A;  2ICI A;  3CCR A;  4EQ5 A;  2A73 B;  3WWV A;  4DA2 A;  1FJG L;  3D31 A;  5AJ3 L;  4FF4 A;  3T1H Q;  3M85 A;  5I9O A;  4DV6 Q;  2RSN A;  3VR2 A;  4C3H B;  1PYB A;  4DV3 L;  3F8T A;  2K6A A;  5FLX E;  4HJ9 A;  5GRO A;  1H95 A;  3K7A B;  3GTL H;  4JBK A;  1N32 Q;  2HQL A;  2EPB A;  5IGG A;  2RDH A;  1W6J A;  4OX9 Q;  1HUM A;  1MKH A;  1F9R A;  3J80 E;  2WAQ B;  2LY7 A;  5TSS A;  3F1Z A;  2F3W A;  5DM7 3;  3W5O A;  4RCN A;  2R6G A;  1GHJ A;  2K28 A;  5CYU A;  1B2T A;  4KTA A;  1TWC H;  5IWA Q;  3HOX B;  5M5Y H;  1JB3 A;  1Y1V B;  2EYP A;  1Y14 B;  2DJF C;  4AH6 A;  1AP0 A;  4JV5 L;  1HTL D;  2KHI A;  3NEM A;  1B53 A;  1XX8 A;  4TQU S;  4QGU A;  4F7X A;  1WD0 A;  1CFM A;  2MO1 A;  5IGF A;  1FL0 A;  2UU9 L;  2PPB C;  3TP6 A;  3H6M A;  3HOY G;  2A5H A;  4KHP L;  3CCQ A;  4QIW B;  3K58 A;  2ZTC A;  5IYC H;  4LJZ C;  1SYB A;  2K5H A;  2VXW A;  2F0Q A;  3Q0A A;  2CVR A;  2VQF L;  1RCV D;  4JVZ A;  3U50 C;  2UXC Q;  2QDL A;  2UXB Q;  3I4N G;  1VQG A;  3FHW A;  2O5I C;  3PCO B;  4XT1 B;  5DNF A;  1C9O A;  2E8G A;  2DUD A;  1VQO A;  1O7Z A;  4JI4 L;  1HR0 L;  1I3Q H;  2MGS A;  3ULP A;  4ME5 A;  2A6E D;  3DMU A;  4EQN A;  4Q5V A;  5LMN Q;  1ENA A;  2NN6 H;  1OXX K;  1NJI C;  3PIO 3;  1B8A A;  2Q8T A;  3JAM c;  4A3F H;  4A3G H;  1J9O A;  1R4P B;  4FXD A;  4XQJ A;  3EN2 A;  1Q81 C;  3J81 E;  4LF8 Q;  4X3U A;  1ET6 A;  1GUO A;  5C4J H;  1LTG D;  4JI1 L;  2R7Z H;  2B2U A;  2A68 C;  5C0X H;  4JI0 Q;  4X6A H;  3TME A;  2HUG A;  3GV6 A;  5LMN W;  5EJW A;  5IP7 H;  4JI6 Q;  3T56 B;  1GD7 A;  2N55 A;  1X56 A;  1SYF A;  3VYS A;  3HEJ A;  3QOJ A;  1LYL A;  1IYV A;  1X3P A;  1EEI D;  3PGZ A;  4KY7 A;  3PO3 B;  2I46 A;  3LWE A;  3A7L A;  1G8Z D;  2BA0 A;  3T4A C;  4YWM A;  1XNQ L;  2F0M A;  3TN2 A;  2K01 A;  3HOW B;  1HHV A;  3DWQ A;  1HNX L;  3S1N H;  2RBM A;  1BDO A;  3MZ5 A;  1DGS A;  4M8A A;  1LT4 D;  2OF1 A;  4JK1 C;  3OW2 A;  3ULJ A;  4PZ7 A;  4POG A;  3RMH A;  3TQY A;  5ELD A;  3SK8 A;  2AMC B;  2QCP X;  1AFP A;  2HIV A;  1ICW A;  1JQY D;  3VYR A;  2A1A A;  3K5L A;  3DLL A;  5FJ8 H;  4PZ6 A;  4ZLT F;  4DAY A;  2KCC A;  4J15 A;  2YTX A;  5JEA G;  1BF4 A;  2NVT B;  4G7H C;  4HAE A;  3KYH C;  3PIP 3;  1X3F A;  3TBI B;  4DV5 Q;  2MP1 A;  2B63 H;  4KD4 A;  1BCP B;  1IBK L;  1N8R C;  3TP5 A;  3N52 A;  3F2B A;  2GA4 B;  4RHR A;  5D3I B;  4BY1 B;  5J39 A;  3GD7 A;  4CDE C;  3CF5 A;  4GOP A;  3L2P A;  3M4O B;  1CKM A;  4A4I A;  1EFW A;  5M5X H;  4I7A A;  4ID6 A;  4QB4 A;  1X9N A;  2PI2 E;  2E2H B;  2JK8 A;  2B3G A;  1D5Z C;  1HNZ Q;  2EYO A;  2Y0S E;  3CW2 C;  4KKS A;  1MGS A;  1TU2 B;  2EYL A;  1DOM A;  1UE6 A;  3HRZ C;  5JPM C;  5ELO A;  1MD2 D;  3DUZ A;  4DV2 Q;  1GUT A;  2HD3 A;  5C3E G;  4GNX C;  3CCM A;  1C0A A;  3M7G A;  5EBC A;  1YBY A;  4NDX A;  3RR5 A;  1WTP A;  4DXG A;  2JA8 G;  3R8B A;  4A3D G;  2E2J B;  4HN7 A;  3ERO A;  3MXN A;  3TDQ A;  1HNW Q;  2HCI A;  1PHJ A;  3J7A F;  3STB C;  2F0F A;  1JIC A;  2F0N A;  3T51 B;  4ABN A;  2O5J C;  3GTM H;  4KHZ A;  1AZQ A;  1ICF B;  3RD4 A;  4HSP A;  1SSO A;  4LFC Q;  4RMF A;  1NTG A;  3I4O A;  2NZH A;  4DUZ Q;  4L5Q A;  1TWA H;  1UWV A;  2R3Z A;  1Y8O B;  4KY6 A;  4YWL A;  3A8J E;  5FO7 B;  1YNN C;  5AJ3 Q;  5BR8 L;  5J22 A;  1R4Q B;  2DJG C;  1KDC A;  1QVF A;  5CBA E;  2Q2H A;  3QJY A;  4OO1 G;  3F2U A;  3MA2 B;  5KNC A;  5FO8 B;  2B2T C;  1GJX A;  5EQ0 A;  4A3E G;  2B29 A;  2K5V A;  5DEH A;  1PTO C;  5CV4 A;  2K5N A;  2EYJ A;  2SDF A;  1S40 A;  1YVC A;  3GDE A;  5BN4 A;  2MQH A;  2TSS A;  1SE2 A;  4JW0 A;  1PYS B;  2I07 B;  4K0K L;  1IBM L;  2ICE C;  3SEB A;  5EKI A;  4CJ2 C;  5M9O A;  3I4M G;  2WIN B;  5IOC A;  5C4X G;  2Z6K C;  2IJ0 A;  3CRL C;  3IFT A;  4C3J B;  3U4Z A;  1Y1V H;  1MSH A;  2C5C A;  1GUS A;  4DN4 M;  3PMF A;  4APV A;  2ZXR A;  4DR3 Q;  1XXG A;  2X6L A;  1EZ6 A;  2VNU D;  5C5M A;  1OXS C;  3H91 A;  3S15 B;  3I73 A;  1HRJ A;  1EU3 A;  1BOS A;  5E7N A;  4R4O A;  3ICE A;  1C4Q A;  2A69 C;  1WJJ A;  1STY A;  1Y8P B;  2A6H D;  3EA6 A;  3CU7 A;  3UDG A;  1XJV A;  4IFD J;  3T1H L;  1GHK A;  2KED A;  2EE1 A;  5CC4 A;  4NPS A;  4DV6 L;  3IFD A;  3QR8 A;  3GTL B;  4GS3 A;  5IT9 c;  4A3B G;  4FVM A;  2VUM G;  1JB7 A;  3EBE A;  3AFQ A;  2CWA A;  4R1J A;  5IOD A;  1EOT A;  1J8I A;  5FOB B;  1HR0 Q;  4BY7 H;  3K5N A;  1JR0 D;  3PF5 A;  4RAU C;  3KLS X;  2DY8 A;  4OX9 L;  3OWF A;  4ZRZ A;  1PA6 A;  4ZUI A;  3K81 C;  1AZP A;  1PH2 A;  3C2P A;  1TY2 A;  4JYA L;  5FKA C;  1A3V A;  1Y1W H;  3A8K E;  3LWU A;  5M5Y B;  5IWA L;  1UE7 A;  2OTL A;  3AEV A;  2B2Y A;  1LLR D;  4BS9 A;  1ZXT A;  4BBR H;  1C7Y A;  1EWC A;  4DNR B;  4QUF A;  1PH8 A;  4IPH A;  3WOF A;  4F88 A;  2ASB A;  1QCB D;  1MSG A;  2RCF A;  5CMD A;  2EXD A;  4CDD C;  4WOR A;  3E9H A;  4JI1 Q;  4DV4 Q;  3K5M A;  3S1M B;  4DR6 Q;  4U68 A;  3GTP B;  4XQQ A;  1HR0 W;  4ULL A;  1KNE A;  4XXE A;  5FLM G;  2X6G A;  2O4X A;  2ID0 A;  1PZK D;  4PG3 A;  4YY3 Q;  1JCK B;  2MHV A;  1QG7 A;  2K5D A;  2L11 A;  1CUK A;  4A3E B;  1JOK A;  3OSO A;  4F8M A;  1B7Y B;  4FYD A;  4GNX A;  3QIA A;  3DM1 A;  4IN3 A;  3J7A V;  1FYC A;  3R2I A;  2F0E A;  2Z0S A;  1DOK A;  2UXC L;  1FGU A;  3I4M B;  3S2H H;  2UXB L;  3RZO H;  5C4X B;  1I3Q B;  2K1B A;  3G48 A;  1WI5 A;  1GUN A;  2DY7 A;  2K5Q A;  1XPR A;  4FF2 A;  4JI7 Q;  5LMN L;  1KQS A;  1SXT A;  5M3M G;  2NVQ B;  1W3S A;  2ENB A;  2EZV A;  3VA7 A;  4A3F B;  5JJL A;  4G4K A;  1HUN A;  4KN7 C;  1SMY D;  2D2C C;  2C9O A;  1PH4 A;  4RG1 A;  4RGN A;  2SNS A;  4A3J G;  4E6I A;  5CGK A;  2CKZ B;  2K75 A;  2B2V A;  3HOY H;  1F2Z A;  4LF8 L;  3SDZ A;  3TS2 A;  2FHT A;  4G57 A;  1OXV A;  4A3B B;  2TMP A;  1K83 H;  2JQO A;  4JI0 L;  2VUM B;  3HG9 A;  2CW0 D;  3I4N H;  2FMM A;  3H3V H;  3P7J A;  3OPO A;  3NTH A;  1CT1 D;  2ZJP A;  2XRS D;  3M4O H;  4JI6 L;  2JP1 A;  2VQE Q;  1HJP A;  2XWJ B; 
#chains in the Genus database with same CATH homology
 2KCN A;  3SR1 A;  2K32 A;  3CKI B;  2IL8 A;  3GP7 A;  2KA7 A;  3HZX A;  2ZXO A;  3PUY A;  3S1N B;  4TRD A;  3U9S A;  4IUQ A;  4KI0 A;  5JJZ A;  5F2D A;  4FXK C;  3VR5 A;  2BE5 C;  3M7N A;  2HDL A;  1SYD A;  2NN6 I;  2AQ3 B;  1HA5 A;  4K6D A;  1KLG D;  2F0J A;  1DD2 A;  2AUJ D;  3IL8 A;  2B63 B;  3OWE B;  1FNU A;  3KLR A;  1HQR D;  5LL6 X;  1U9R A;  5M5X B;  1SNP A;  5C0X I;  1IYU A;  4OIK A;  5KNB A;  2HDM A;  1ONL A;  2JE6 I;  2EYM A;  4WFN 3;  2B2U C;  1TS4 A;  4MN3 A;  3R2T A;  1ZYR C;  5EGT A;  4DF7 A;  3T16 A;  2BDO A;  1A15 A;  1HTP A;  1ZKO A;  3VYT A;  4IZ8 A;  5JEA H;  4CHT B;  3WDN A;  1EQV A;  3Q6S A;  2F0U A;  1EWH A;  5C6A A;  4IUU A;  2E2D C;  1XWE A;  1DOL A;  2L9H A;  3AU7 A;  1DCZ A;  1TWA B;  2RSO A;  1UEA B;  3S16 B;  1EZ8 A;  2XVS A;  1VF7 A;  1F9S A;  3BDL A;  1Y69 U;  4S3S A;  4HR7 B;  2NVY B;  1LT6 D;  1RDP D;  4KHV A;  3X3N A;  1O80 A;  3BYT B;  3BS1 A;  3PV0 A;  3SVM A;  2XRQ D;  4QF4 A;  4KJO A;  1A2U A;  2BCO A;  2NYZ D;  1KLU D;  1SJE D;  3V05 A;  2F4I A;  4EQO A;  4K8J A;  2ZT9 C;  4IFD G;  2AUK A;  3NWT A;  5A2Q E;  1RD9 D;  1T5X D;  2RDF A;  3TSS A;  3O13 A;  2E74 C;  1FR3 A;  2HQE A;  1PRT F;  2K7V A;  3SXH A;  2RKS A;  2Q8R E;  2EJG C;  4OO1 H;  1RTN A;  3ZYY X;  5JOB A;  3NTK A;  4FO2 A;  4EVO A;  3K5O A;  3EVQ A;  2JA6 B;  1LT3 D;  4QUC A;  2NUC A;  1LTS D;  1KDA A;  4F87 A;  2XNA C;  1NUC A;  4XYQ A;  2NZ1 D;  1GXD C;  4RWS C;  4BY7 B;  1HCZ A;  5FLX L;  1EU4 A;  1D2B A;  1Y8N B;  1WTQ A;  4N9P A;  3KBG A;  1H9S B;  1EYD A;  1B50 A;  1Y1W B;  4ZK9 B;  1ESF A;  3J80 L;  3W3A A;  2AQ1 B;  4BBR B;  4B9W A;  3S2D B;  3KK7 A;  2N88 A;  5ELB A;  1KTK A;  5EPJ A;  1SNQ A;  5BN3 A;  1VDZ A;  3FMC A;  3R93 A;  3AMU A;  3BDO A;  2NBF A;  1CA6 A;  2IW3 A;  3Q23 A;  3HGB A;  1I4G A;  1IKM A;  5A2Q L;  2PNR C;  3U9O A;  1EIH A;  4A3M B;  3VR3 A;  1NR2 A;  4A3K B;  1E2Z A;  1IW7 D;  1PYW D;  4BA1 I;  4X3S A;  4MIU A;  1TS5 A;  3OIP A;  5EPL A;  1F77 A;  2F0D A;  3S2H B;  3RZO B;  3GO5 A;  4EGV A;  1TKW B;  3HOV B;  2NWG A;  1CHP D;  1DZ1 A;  5IT9 E;  4PMB A;  2BOS A;  3HKZ B;  1PFM A;  2WII B;  1PFN A;  1PRT D;  1II3 A;  1HQM C;  2Z4H A;  3MXP A;  2F0I A;  1E2V A;  5KIX A;  3HOY B;  3PUW A;  4UDU C;  1E2W A;  2EJF C;  5E4X A;  3EFX D;  2KEC A;  3J81 L;  1K83 B;  2B2Y C;  3I4N B;  1FNV A;  2SOB A;  1JOR A;  4HMJ A;  2KJX A;  3OIQ A;  1RKN A;  1CK1 A;  1Z6H A;  2CW0 C;  3D6W A;  4C3I G;  5EBD A;  4XIG S;  1ENC A;  1MI2 A;  3Q24 A;  1O7L A;  1PLF A;  2OXP A;  4Q0F A;  5CV8 A;  1NCV A;  4DK0 A;  2E76 C;  3VYU A;  2VB2 X;  3EJI A;  1STB A;  3GTJ B;  1STG A;  1RTO A;  4V0B A;  5A35 A;  4XQN A;  2MUY A;  4G7Z C;  2KVM A;  1LTB D;  3D6C A;  4Z9C B;  1VMP A;  4KV6 A;  1NSN S;  4YIJ A;  1PFB A;  1QNU A;  1YNJ C;  1FD7 D;  3D8G A;  3GV3 A;  1ROD A;  4K6L A;  1KDB A;  1H9R A;  3BVZ A;  1C8C A;  3NE5 B;  2JXM B;  2B2V C;  4X3K A;  4FP5 D;  1B9N A;  3SE0 A;  2A74 C;  4J6H A;  3MXG A;  4DAP A;  2H4O A;  4HED A;  3HP3 A;  5I6W A;  5IGC A;  4B08 A;  1FGB D;  1Q8I A;  1SDF A;  3A7A B;  3QOL A;  5J1Z A;  2L4N A;  3G7L A;  2RVL A;  2B8F A;  3ITP A;  1BQQ T;  1BCP C;  3MC0 B;  5BN5 A;  5JAV A;  3H3V C;  5D14 A;  1SYC A;  2L5T A;  3L9A X;  4DU9 A;  2VB3 X;  1S5B D;  3V96 A;  4HCS A;  2EOT A;  3N6R A;  2F0V A;  3LNN A;  3QB3 A;  3URY A;  2QDB A;  1B3A A;  1X3Q A;  1HFN A;  2PZT A;  1G2T A;  5HUR A;  4MHE A;  4CGY B;  3D3R A;  2D5D A;  4TSS A;  1STA A;  3BDC A;  5C3E B;  1U4R A;  4CJ1 B;  2JA8 B;  4A3D B;  3S14 B;  1PMR A;  2L0C A;  4NP5 A;  3VR6 A;  2Z8L A;  1ZEQ X;  3SK6 A;  1STE A;  4ZYS A;  2EY2 A;  3RZD B;  1BNZ A;  5D3D A;  1LTA D;  1TWH B;  4RFB A;  5C4H A;  1H9S A;  2EDG A;  4CKE A;  3CHB D;  3MFG A;  3NBH A;  4L6T B;  5E4W C;  4GZY C;  2X69 A;  3NP8 A;  4PMW A;  4HMI A;  1G6Z A;  3I8Z A;  3GTK B;  3FRP B;  3KLS A;  3ND8 A;  5T1I A;  2IX3 A;  1DON A;  4WRD A;  1TII D;  1UAP A;  2A68 D;  4I7Z C;  1PRT B;  3BVM A;  1EY6 A;  1I6V C;  5E3F A;  2PW5 A;  4J8Q A;  1I50 B;  4LK1 C;  5K5P A;  3SK4 A;  2KEE A;  4N9T A;  5ISR A;  5I6Y A;  1PZJ D;  4IFD H;  5COR A;  3LX0 A;  2IX0 A;  3GTQ B;  3MHB A;  4K5X A;  5T1G A;  1EFI D;  2A6E C;  1QB5 D;  1RJT A;  4BBS B;  4I65 A;  3S1R B;  4H13 C;  1PTO F;  1ET9 A;  2D9U A;  2BDN A;  2F0H A;  1EYC A;  1QIL A;  4ZQ3 A;  4DK1 A;  1S5F D;  2KHS A;  3CQZ B;  5KRU A;  1KAA A;  4K2L A;  5DM6 3;  4ZKB B;  1F9Q A;  4NKL A;  2R92 B;  1QE6 A;  4LAA A;  1IW7 C;  2IPK D;  2LKV A;  1TVX A;  1K8M A;  1M4V A;  3FPP A;  3T13 A;  4KKT A;  5KYI A;  1EYA A;  3EQL C;  4HCE A;  2JYO A;  1G91 A;  3NUC A;  1VF5 C;  2F0S A;  2AWO A;  2CQA A;  3RUZ A;  1K8O A;  1KNA A;  2OEO A;  3NK9 A;  4CJ0 B;  3H09 A;  1G29 1;  3MWY W;  1S5D D;  4C3H G;  2F03 A;  3JAM E;  1B9M A;  5COY A;  2FFK B;  4K8I A;  3A55 A;  4PNY A;  4C56 C;  1LTI D;  1I4R A;  3MTS A;  3X3M A;  2HCC A;  1A2T A;  4R9W A;  1H9K A;  4AYB B;  1QNK A;  1TQO A;  1X32 A;  1Q12 A;  1Q1E A;  3QG1 A;  3IAY A;  4CKC A;  4TKO B;  5M3M B;  3WOE A;  3OHX C;  3NTI A;  1XYI A;  4RHS A;  1EEF D;  1AW7 A;  4KD3 A;  2IT1 A;  3FDT A;  5EKK A;  2K03 A;  3DWA A;  4A3J B;  5NUC A;  4FNF A;  1B4O A;  2FJ2 A;  2WKD A;  1PTO D;  3K59 A;  2PMZ B;  2AWN A;  4L63 B;  1KAB A;  5IGB A;  3D4W A;  5IGE A;  4RKB A;  4PMC A;  4EQP A;  5C4Z A;  5IIF A;  1BUV T;  5I4D A;  2M2L A;  1EY9 A;  1ILP A;  2FMC A;  2JEA I;  2K33 A;  3I91 A;  5JPN C;  3J7Y W;  3JAM L;  4K5V A;  4M1U B;  2PO4 A;  3MFY A;  4L8J A;  5EKL A;  2EVB A;  2A69 D;  1L0Y B;  1SAP A;  5CV5 A;  1DXM A;  3NBI A;  4O1N A;  3NQT A;  2B39 A;  3MAQ A;  4ZUJ A;  5G3L F;  1GOZ A;  3MXU A;  3NQI A;  5ELF A;  4XT3 B;  1EY5 A;  3DEP A;  1WVL A;  3OMG A;  3K6O A;  3M3Y B;  4BA2 I;  2JA7 B;  3SK5 A;  3C1E A;  1WTX A;  2WKC A;  4KJN A;  5KYL A;  1U4M A;  5M3F B;  4A3I B;  1EL0 A;  2F1M A;  2YU9 B;  4NW2 A;  2CHB D;  1S5E D;  3TZU A;  2QKI C;  4DFA A;  4UAI A;  3GTG B;  1D1K A;  4HTH A;  2MPM A;  1SEB D;  4OGQ C;  3BVG A;  1TR5 A;  1FNW A;  3S17 B;  5C0X J;  4XTC S;  3DEO A;  1UNS A;  1TWG B;  5C44 B;  1OXU A;  1SYE A;  2F0L A;  2A6H C;  2NB0 A;  4RA8 A;  4KY5 A;  3I72 A;  2JSO A;  5CBE E;  1QWY A;  4WJW A;  2NTT A;  2ZXP A;  3Q22 A;  1SNC A;  1QOH A;  5FK9 C;  2E2I B;  1R9T B;  2B2W A;  3G6J B;  4ZKC B;  2IWH A;  1PDQ A;  3GQB A;  4OIJ A;  1JOO A;  4KMU C;  1V1P B;  5I2X A;  4U67 3;  1CQF A;  2F0P A;  3P75 A;  3HOZ B;  5C3W A;  2KOL A;  2PQE A;  5I9P A;  2NVX B;  1DM0 B;  1F2Y A;  4XDX A;  1AN8 A;  4ILW A;  3P1H A;  2PZU A;  4H7B A;  3IKJ A;  5HGT A;  3ONA B;  4QCL A;  1OO9 B;  4IUT A;  2RA4 A;  3R3O A;  5CV6 A;  5G3L D;  1EIG A;  4OHJ A;  5ELC A;  2QF7 A;  4FF1 A;  2EY6 A;  5EPK A;  1S5C D;  3I3C A;  1JWS D;  3MEH A;  1BXT A;  4FF3 A;  2YYZ A;  1EY7 A;  4ZAI A;  3K57 A;  1EY4 A;  1SBB B;  3FKI B;  3OOC A;  5C3X A;  1JWM D;  4KK7 A;  1TT2 A;  1HXY D;  1Q1B A;  3AB9 A;  1STH A;  3NPP A;  1TS3 A;  2XN9 C;  3PUV A;  1I4X A;  1JC7 A;  1W6K A;  4IUV A;  3TP7 A;  1SMY C;  5LHY 1;  4LMQ D;  2V4D A;  2BE5 D;  3T53 B;  5JVH 3;  2PCF B;  4PV1 C;  3HOU B;  1STN A;  3NHH A;  1MBY A;  2PYK A;  1TWF B;  1PTO B;  2QIL A;  2L55 A;  2WP8 J;  2KUM A;  2KQ3 A;  2XWB B;  2OT2 A;  1CZG A;  4C3J G;  4H44 C;  4CKB A;  2IX1 A;  3SHL A;  2LS0 1;  3PUX A;  5IGD A;  2O2L D;  5K36 G;  3VR4 A;  3W2D A;  2J0T D;  2Y0S B;  1SE3 A;  1I6H B;  2SEB D;  3ERQ A;  1SJH D;  2F0K A;  3ND9 A;  5M5W B;  5IT9 L;  4IFD I;  1ZYR D;  1ILQ A;  5CV7 A;  1U4L A;  4RCO A;  5KEE A;  1LTR D;  2E75 C;  5KND A;  2F0W A;  2EY5 A;  3OW7 A;  4C1N I;  2FIN B;  4IUR A;  1Z47 A;  1Q90 A;  1HFG A;  3NSW A;  3E6Z X;  1IL8 A;  1ESR A;  3GTO B;  1NAP A;  2M9V A;  3QO2 A;  4P2C B;  1H9J A;  1IKL A;  3S9W A;  3D4D A;  1BO0 A;  3E5S A;  2AQ2 B;  2K5W A;  4C2M B;  3E0J A;  4IAL A;  3KUP A;  1XTC D;  1G2S A;  2G9D A;  4JBW A;  1ENF A;  1CA5 A;  4X3T A;  1HPC A;  4DNT B;  1JWU D;  5DAU A;  4FXG C;  4IUN A;  3M4Y A;  1EY8 A;  1CTM A;  3FEW X;  4R8I A;  4OL7 A;  2QEJ C;  1CHQ D;  2DN8 A;  1RF2 D;  4C3I B;  4IQZ A;  1SE4 A;  1DYQ A;  4IUP A;  2SNM A;  1Q3L A;  2NN6 G;  2EJM A;  4DAV A;  3BYY B;  4CBV A;  3RLF A;  1SFO B;  1WTV A;  4A93 B;  1DJR D;  4BWG B;  1VCI A;  3DHQ A;  1BR9 A;  1V8Q A;  2LFN A;  1LTT D;  2DNE A;  1L0X B;  1F2L A;  3BZD B;  1BBX C;  5C0X G;  1T5E A;  1LT5 D;  2D62 A;  1V1O A;  2F3V A;  1IHZ A;  1D1I A;  2WV6 D;  1EY0 A;  2Z4I A;  4V19 0;  2G9H D;  1M8A A;  2NTS A;  1SNO A;  4ODG A;  1CI3 M;  4B9X A;  3DXJ C;  1SYG A;  2BA1 A;  1TWC B;  1HA6 A;  3H0G B;  2J4X A;  2WAC A;  2LMC B;  1WTW A;  1C48 A;  1V1P A;  2K05 A;  3BG3 A;  4RKL A;  3CRK C;  5C5L A;  1PZI D;  3OMC A;  4KKU A;  1WCM B;  1TS2 A;  1JE4 A;  1WTO A;  3H94 A;  1H9M A;  1D5M C;  5CR3 A;  3C46 A;  1A6X A;  1B1Z A;  1LO5 D;  4QMG A;  4HSV A;  4XYO A;  1VMC A;  5I2Y A;  1LV9 A;  4RGT A;  2L1B A;  1TY0 A;  3KF8 A;  3PO2 B;  1Z7T A;  4RGM A;  1D5X C;  2J7Z A;  1A3T A;  1V43 A;  3FPU B;  1GUG A;  2RDG A;  3UI2 A;  3D4R A;  1CM9 A;  1PXU A;  1LAC A;  1AEX A;  5CV9 A;  3A54 A;  3I90 A;  2PZW A;  4K2K A;  2JEB I;  3C1F A;  1BCP F;  5AFW A;  3NWS A;  1A3U A;  4A3G B;  5E1F A;  5KGU A;  1WD1 A;  2RQX A;  4OO1 I;  1I4H A;  1PTO H;  2H1E A;  5C4J B;  2JA5 B;  4K14 A;  4KN4 C;  1UUP A;  2B2T A;  2EYF A;  2EY1 A;  2R7Z B;  4O42 A;  3PUZ A;  1S4Z A;  1JOQ A;  2EYH A;  1LAB A;  4R8N A;  4PQX A;  1RHP A;  2MJ8 A;  1F2M A;  4DXF A;  3V2T A;  1GUW A;  3I70 A;  2WB1 B;  5JEA J;  4Y7N B;  3I4L A;  1B44 D;  5JVG 3;  3DWP A;  1O7Y A;  5FO9 B;  3K0Y A;  1PRT C;  1E0B A;  2B2W C;  1CQV A;  1I4Q A;  4DGZ A;  4H0L C;  1WTR A;  1U4P A;  4K5W A;  1I4P A;  3A8I E;  2L12 A;  1D6E C;  2Z1C A;  3MVV A;  3L7Z C;  1YNN D;  3KBX A;  1YNJ D;  2DNC A;  4J1M A;  2F0T A;  4RH6 A;  1SNM A;  2PW7 A;  1NR4 A;  1CZW A;  2K04 A;  3A56 A;  1EQT A;  1QJO A;  2M00 A;  2XSC A;  5D65 A;  2EXZ A;  5LL6 S;  4G7O C;  1F9P A;  2R93 B;  1ML0 D;  3L3O C;  3VA5 A;  3FVQ A;  2B8G A;  1BCP D;  4RGO S;  3C3L A;  1O78 A;  3QWN A;  3P20 A;  4C1N K;  3GTM B;  2R61 A;  5K36 H;  2Q8I B;  3HS0 C;  1OXT A;  3S1Q B;  5ELE A;  3NXW A;  4NMZ A;  2F0O A;  1SND A;  3TP8 A;  2XIW A;  2F0G A;  3TZD A;  2ICI A;  2A73 B;  4DA2 A;  3D31 A;  4FF4 A;  3M85 A;  5I9O A;  2RSN A;  3VR2 A;  4C3H B;  5FLX E;  2K6A A;  3K7A B;  2EPB A;  5IGG A;  2RDH A;  1W6J A;  1HUM A;  1F9R A;  3J80 E;  2WAQ B;  2LY7 A;  5TSS A;  2F3W A;  5DM7 3;  4RCN A;  2R6G A;  1GHJ A;  2K28 A;  5CYU A;  1B2T A;  4KTA A;  3HOX B;  1JB3 A;  1Y1V B;  2EYP A;  1AP0 A;  1HTL D;  1B53 A;  1XX8 A;  4TQU S;  4F7X A;  1WD0 A;  1CFM A;  5IGF A;  2PPB C;  3TP6 A;  3H6M A;  2A5H A;  4QIW B;  3K58 A;  4LJZ C;  1SYB A;  2VXW A;  2F0Q A;  3Q0A A;  2CVR A;  1RCV D;  2O5I C;  4XT1 B;  5DNF A;  1O7Z A;  2MGS A;  4ME5 A;  2A6E D;  3DMU A;  4EQN A;  4Q5V A;  1ENA A;  2NN6 H;  1OXX K;  3PIO 3;  2Q8T A;  1J9O A;  1R4P B;  4FXD A;  4XQJ A;  3J81 E;  4X3U A;  1ET6 A;  1GUO A;  1LTG D;  2B2U A;  2A68 C;  5C0X H;  3TME A;  2HUG A;  3GV6 A;  5EJW A;  3T56 B;  2N55 A;  1SYF A;  3VYS A;  3HEJ A;  3QOJ A;  1IYV A;  1X3P A;  1EEI D;  4KY7 A;  3PO3 B;  2I46 A;  3LWE A;  3A7L A;  1G8Z D;  2BA0 A;  3T4A C;  1HHV A;  2F0M A;  3TN2 A;  2K01 A;  3HOW B;  3DWQ A;  2RBM A;  1BDO A;  3MZ5 A;  4M8A A;  1LT4 D;  2OF1 A;  4JK1 C;  3RMH A;  5ELD A;  3SK8 A;  2QCP X;  1AFP A;  1ICW A;  1JQY D;  3VYR A;  3K5L A;  4ZLT F;  4DAY A;  2KCC A;  5JEA G;  1BF4 A;  2NVT B;  4G7H C;  4HAE A;  3PIP 3;  3TBI B;  2MP1 A;  4KD4 A;  1BCP B;  3TP5 A;  3N52 A;  2GA4 B;  4RHR A;  5D3I B;  4BY1 B;  5J39 A;  3GD7 A;  3M4O B;  4ID6 A;  4QB4 A;  2E2H B;  1D5Z C;  2EYO A;  4KKS A;  1MGS A;  1TU2 B;  2EYL A;  1DOM A;  3HRZ C;  5JPM C;  1MD2 D;  3DUZ A;  1GUT A;  3M7G A;  5EBC A;  4NDX A;  1WTP A;  4DXG A;  3R8B A;  2E2J B;  4HN7 A;  3ERO A;  3MXN A;  3TDQ A;  2HCI A;  3J7A F;  2F0F A;  1JIC A;  2F0N A;  3T51 B;  4ABN A;  2O5J C;  4KHZ A;  1AZQ A;  3RD4 A;  4HSP A;  1SSO A;  2R3Z A;  1Y8O B;  4KY6 A;  3A8J E;  5FO7 B;  1YNN C;  5J22 A;  1R4Q B;  1KDC A;  5CBA E;  3QJY A;  4OO1 G;  3F2U A;  3MA2 B;  5KNC A;  5FO8 B;  2B2T C;  1GJX A;  5EQ0 A;  5DEH A;  1PTO C;  5CV4 A;  2EYJ A;  2SDF A;  5BN4 A;  2TSS A;  1SE2 A;  2I07 B;  2ICE C;  3SEB A;  5EKI A;  4CJ2 C;  5M9O A;  2WIN B;  5IOC A;  2IJ0 A;  3CRL C;  3IFT A;  4C3J B;  1MSH A;  2C5C A;  1GUS A;  4DN4 M;  3PMF A;  2ZXR A;  1XXG A;  2X6L A;  1EZ6 A;  2VNU D;  5C5M A;  1OXS C;  3H91 A;  3S15 B;  3I73 A;  1HRJ A;  1EU3 A;  1BOS A;  1C4Q A;  2A69 C;  1STY A;  1Y8P B;  2A6H D;  3EA6 A;  3CU7 A;  4IFD J;  1GHK A;  2KED A;  2EE1 A;  5CC4 A;  3IFD A;  3GTL B;  4FVM A;  5IOD A;  1EOT A;  1J8I A;  5FOB B;  3K5N A;  1JR0 D;  4RAU C;  3KLS X;  2DY8 A;  3OWF A;  4ZRZ A;  4ZUI A;  1AZP A;  3C2P A;  1TY2 A;  5FKA C;  1A3V A;  3A8K E;  3LWU A;  5M5Y B;  2B2Y A;  1LLR D;  4BS9 A;  1ZXT A;  1EWC A;  4DNR B;  4QUF A;  3WOF A;  4F88 A;  1QCB D;  1MSG A;  5CMD A;  4WOR A;  3K5M A;  3S1M B;  4U68 A;  3GTP B;  4XQQ A;  4ULL A;  1KNE A;  4XXE A;  2X6G A;  2O4X A;  2ID0 A;  1PZK D;  1JCK B;  2MHV A;  1QG7 A;  2K5D A;  2L11 A;  4A3E B;  1JOK A;  3OSO A;  4F8M A;  4FYD A;  3QIA A;  3DM1 A;  4IN3 A;  3J7A V;  1FYC A;  3R2I A;  2F0E A;  1DOK A;  3I4M B;  5C4X B;  1I3Q B;  2K1B A;  1GUN A;  2DY7 A;  2K5Q A;  4FF2 A;  1SXT A;  2NVQ B;  2ENB A;  2EZV A;  3VA7 A;  4A3F B;  4G4K A;  1HUN A;  4KN7 C;  1SMY D;  2D2C C;  2C9O A;  4RGN A;  2SNS A;  4E6I A;  5CGK A;  2B2V A;  1F2Z A;  3SDZ A;  2FHT A;  4G57 A;  1OXV A;  4A3B B;  2TMP A;  2VUM B;  3HG9 A;  2CW0 D;  2FMM A;  3P7J A;  3OPO A;  3NTH A;  1CT1 D;  2XRS D;  2JP1 A;  2XWJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...