4WJWA

Crystal structure of the chs5-chs6 exomer cargo adaptor complex bound to portion of chs3
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
74
structure length
68
Chain Sequence
VDVLLTVGKALLTTQDHHVIEFPTVLLPENVKAGSIIKMQSQNLEEEKKQRNHFKSIQAKILEKYGTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitin biosynthesis protein CHS5
publication title Distinct N-terminal regions of the exomer secretory vesicle cargo Chs3 regulate its trafficking itinerary.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transport protein/transferase
total genus 10
structure length 68
sequence length 74
ec nomenclature
pdb deposition date 2014-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16892 CHS5_N Chitin biosynthesis protein CHS5 N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.890 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4wjwA00
4IN3A 4WJWA
chains in the Genus database with same CATH superfamily
4IUUA 3I2ZA 1JOKA 4IURA 4POFA 2K03A 3M9BA 2WP8J 3CCEA 4JYAL 4C3JB 3FPUB 2ZM6L 4Z9CB 4LK1C 3NXWA 1HJPA 3MXNA 4JOIA 3GTGB 4KJOA 1A63A 2KECA 3SR1A 1DXMA 1KQSA 1PFBA 1J6QA 1R4PB 1RTNA 3FRPB 4NP5A 1PH1A 2Q8IB 3BZDB 1EFWA 5D3DA 1D7QA 1YJNA 4OO1I 1YJ9A 1SE3A 4LF8L 2F0EA 2UU9L 1Q3LA 1DZ1A 5JEAJ 1W3SA 3FKIB 1ASZA 1RODA 4K6LA 3SGIA 3R93A 4G7ZC 4BY7B 2RBMA 3HOUG 1X3GA 1YHBA 4GOPC 4DNIA 3AEVA 1SLJA 3HRZC 4CJ0B 2RSOA 3TZDA 4CKCA 4A3JH 1HR0W 4KI0A 3S2DH 3S15B 5IODA 2J4XA 4ZK9B 2A6HC 3HOUH 3N6RA 5M3MH 2AUJD 2SDFA 4A3GB 4OELB 1PRTB 4LAAA 1B4OA 2JE6I 4IFDG 4LF8Q 1LTAD 3J7YW 2F0WA 5E4XA 2NZOA 4RKBA 4X6AH 3QO2A 1D6EC 4FF3A 2CKZB 1VQOA 3IKJA 1LTLA 4IFDH 1VQ9A 1I4HA 5KNBA 3LNNA 4NW2A 1AZQA 4AQYQ 2KCTA 1A2TA 1C4QA 1LLRD 3Q8DA 1YHAA 3PUVA 1SMYC 4GNXC 3KDFB 1KL9A 3EBEA 1O7LA 1PH6A 1UUPA 2PZUA 3HP3A 4C1NK 4BY1B 2ZXPA 2RHQB 1VQJA 3D31A 1YI2A 4GOPA 4DFAA 3J81j 1MJCA 1LTSD 3ZYYX 4JG2A 1TT2A 5CBEE 1WTRA 3OW2A 4LF7Q 3TZUA 3RNUA 1ENCA 1KLGD 4PMBA 4HEDA 4A3MG 5IGFA 3HOWH 1YVCA 2VQEL 1HA6A 1PMRA 1N34L 3CU7A 2A68D 2ES2A 4AYBB 1PH9A 3GV3A 3BVZA 2X6GA 3OTOQ 3LWEA 1FNVA 3D6CA 4L63B 3U9OA 4C1NI 1WTQA 1BUVT 1UE7A 2A6EC 5D3IB 4F88A 2PQAB 1FJGQ 2NUCA 4UP7A 2NVQB 1MGSA 1LUZA 3RN2A 1MKHA 3S1NB 1SAPA 2F4VL 1K9MC 4ID6A 4QQBX 3SDZA 1XTCD 2F3VA 2VQEQ 4GNXA 1N34Q 1NE3A 3S9WA 5M9OA 4OX9L 3UDIA 1O7YA 4DK1A 3SE0A 2HDLA 5EKIA 1U9RA 5TSSA 4DNTB 1JWSD 4RAUC 4DV4Q 1WTHA 2NTSA 4E6IA 2GA4B 3WOFA 1KLUD 2F0JA 5LL6X 2EXZA 3UE1A 1KDAA 2HIXA 4Y7NH 5E7NA 3BYYB 3TDQA 4K0KL 5M5XH 4A3LH 4JCVE 3W2DA 1KAWA 2R6GA 5D14A 1N33L 3I72A 1EIGA 2JA9A 4OX9Q 3TSSA 2F52A 3GTMH 1STGA 4UAIA 1VQIA 5HGTA 1JOOA 2K6AA 1EY4A 4H02A 3OWEB 4IQZA 3W3AA 3GTLH 2XSCA 2RQXA 2A6HD 2Z8LA 4KTAA 3J7AV 2B2TC 3S24A 4A3JB 1TWFB 1XPOA 3PUZA 4K2LA 3S2DB 5KIXA 3GTPH 4CJ2C 2WB1E 1F2YA 1PH2A 3HOUB 1PTOF 1Y1WG 4JBKA 3GV6A 1YNND 1N33Q 3URYA 4J1MA 1VQAA 4FDBA 1GHKA 1S72A 4RHSA 1TY2A 4DR3Q 2IHFA 4UP8A 1VQKA 4DR6L 1Y1WH 4F7XA 4A3CH 4PZ7A 3F8TA 3HG9A 2FMCA 3RZOH 1U4RA 5DLQE 3CCJA 4UPAA 2EYOA 3CRLC 3AB9A 3QR8A 1SMYD 5FK9C 4N9PA 5C3XA 4XT3B 4LUVA 2VL6A 1WTXA 3CCLA 1SNPA 2Z4IA 1PTOC 4MTNA 1BCPB 3HKZE 4A3KH 3VR6A 1J5EQ 2E2DC 3DWAA 2F0UA 3PF5A 3PMFA 4DR6Q 4F87A 2B2TA 2C9OA 5AFWA 3WDNA 4B3MQ 4LF5Q 2EVBA 3T4AC 3TP8A 2NVXH 5BN4A 1FL0A 3BYTB 3MEHA 5ELEA 1PH7A 1CI3M 3ULLA 2UUBQ 2QGQA 1K73C 4IUQA 1YJWA 2XWJB 4P74A 2IWHA 2RA4A 3E9HA 1QG7A 4G57A 4DV0L 1PRTF 4CJ1B 1UEAB 1STAA 2A6ED 2FJ2A 4ZKCB 1G6PA 5JPMC 2UXBQ 3IFDA 3MFGA 1TWHH 3C1FA 2L55A 3QJYA 4MTKA 4NPSA 2JA7H 2K05A 3EJIA 2HUGA 2Q2HA 4IJHA 4RGNA 3EQLC 3TQYA 5BR8L 4IFDI 4FXDA 4LF6L 1I94L 3CCQA 1XNQL 1I4XA 1NMFA 1XMOQ 5EBDA 1TY0A 1CQFA 3HOZG 3MZ5A 4O1NA 1FD7D 3BDCA 2NWGA 3IRBA 5COYA 1U5KA 3BVMA 3SEBA 3BJUA 2Z9HA 1PRTC 1TR5A 4K5WA 1JR0D 1X6OA 2HDMA 1DOLA 3TS2A 3GP7A 3C3LA 2I5HA 2QW7A 4Y7NB 1VF7A 5IWAL 4G7OC 1V9PA 5M5XB 1FNWA 1JICA 1HTLD 5GAGC 4QMGA 1F2ZA 2F0NA 5BR8Q 2XIWA 1Y8PB 2HT1A 4LF6Q 3T16A 1I94Q 2BH8A 5FO8B 1JJ2A 1MHWC 3MTSA 1E0BA 1K3BC 1FYCA 3E5SA 3L2PA 4IFDJ 4A3IG 3GTKH 1XMQL 1OXSC 1GUTA 3A56A 1NTGA 2B29A 1CKMA 1G91A 3GTLB 3LWUA 1PFNA 1JCKB 3TP7A 2AWOA 4DV6L 3GTPB 1T9HA 5IWAQ 5IGGA 4B3RL 3FEWX 4ODGA 3U4VA 4YIJA 4G7HC 4DV1L 1G8ZD 4IALA 4TSSA 5IYBG 1HTPA 2LKVA 3A0JA 2HHHL 3I4NH 1EFID 2O4XA 4JI1L 1MD2D 2CW0C 5JEAH 1Y1WB 4NXNQ 1EYAA 2P5ZX 3RZOB 3P20A 4HMIA 2IHEA 4ZUIA 3J81L 4JK1C 1QUQB 1BBWA 3ERSX 1E7ZA 1EIHA 2OQ0A 2LFNA 2F0HA 2L9HA 1PTOD 4TRDA 2Y0SE 3U4ZA 4DV6Q 1IBKL 5CBAE 1U0LA 4B3RQ 3FPPA 2R93G 2E75C 3PGZA 3I4MG 3KDFA 1ET6A 2IJ0A 4GN5A 2BA0A 2ZJQA 5JPNC 1G2SA 2HHHQ 4RWSC 5LMUQ 4RMFA 2EY6A 4CBVA 1PVOA 1ZYRC 1II3A 2R93H 4BWGB 2NVXB 3A8IE 1H9RA 1G291 5EAYA 3F2BA 4DR1L 3A55A 1KTKA 1S5ED 5FOBB 2E2IH 3J81E 3PIPA 3J80L 1E24A 2WKDA 1STBA 1OXVA 1ILQA 3HOVG 1HZBA 2UUCL 2RF4A 1GOZA 3CPFA 3T1HQ 2R92G 4RCOA 3EN2A 2DN8A 1IL2A 4GKKL 1QCBD 3CMAA 1I3QH 3T53B 1MI2A 4CKBA 4QIWE 1Q46A 1A6XA 1N32Q 2JA7B 4C56C 5C4ZA 1GUWA 5FO9B 3HOVH 2QDLA 3F1ZA 1LTID 5J1ZA 2N8NA 2LMCB 3VYTA 4AIMA 3HOXG 4X64L 2ASBA 2CFMA 2EPBA 4JI5Q 2J7ZA 4DAYB 1VQPA 4QL5A 1W6JA 4YY3Q 1PRTD 1C8CA 1XNRL 1SYCA 4A75A 4YCVA 1O7ZA 2ZTEA 3J80E 4A3FG 4DPGA 3G7LA 4LF9L 2UUCQ 1SSOA 1SMXA 3HS0C 4H7BA 3HOZB 1K83H 2L15A 2PI2A 3UDGA 2RDGA 4X65L 4I7AA 2NB0A 5A2QL 1M8AA 2VQFL 4L6TB 3IAYA 4BA1I 3K6OA 4YWKA 2ALYB 1XX8A 2VB2X 4BS9A 1TWCH 3GTJH 1N9WA 4KY7A 4CDFC 3T51B 3PIOA 1EYGA 1XNRQ 2IT1A 1EY5A 2B2YC 1KIXA 1PV4A 3GTKB 1RHPA 4LF9Q 1SE2A 5ELBA 3ND8A 3H0GG 1XXGA 1CK1A 2WB1G 3NBHB 3OMGA 3AFQA 1GUGA 1HA5A 1WYDA 4X65Q 1BKBA 1STEA 1X55A 3PIO3 2VQFQ 4XT1B 4H0LC 4QUCA 4WRDA 5A2QE 2EZVA 2CCZA 1LT4D 2KHJA 1D1KA 2CW0D 3I4NB 2VUMG 3NBIA 4G4KA 1GO3E 2R7ZG 2GVBA 1Q7YC 3HFZB 4PQXA 1ILPA 1AP0A 5CGKA 2YV5A 2FHTA 2IW3A 2IX3A 1EQQA 3S1RH 3Q24A 3H91A 5IGEA 5HGQA 1L1OB 2N78A 1TKWB 4PNYA 3F2DA 2K5VA 1LT6D 2MGSA 2VUMH 2R7ZH 3U50C 3J80i 3HKZG 3A5UA 1C48A 1H9SB 1BVSA 5ELDA 4R4CA 1Q1BA 3NSWA 2B2YA 2I07B 3S1MH 4LW1A 1JORA 1JMCA 1C9OA 4HN7A 1V1PB 3X3MA 1GD7A 3T13A 3NENA 2B63G 4A3BG 2F1MA 3D3RA 4RHRA 1E3PA 5DEHA 2R93B 4POGA 1Q8KA 3I4MB 4JI0L 1JWMD 4EX5A 2E2JH 2BDNA 2E2IB 3PUXA 2V4DA 2HCCA 1PYWD 1NR2A 2ZT9C 4DUYL 2SOBA 4DV5L 4A3BH 5C44G 1VCIA 5GADC 2F0MA 1DCZA 3GDEA 2CQOA 3CW2C 3M7GA 2ID0A 4HCEA 4HIDA 1NAPA 4GKJL 5IYDG 1O80A 1GUNA 1IHZA 1L2FA 1I3QB 4DR5L 3JAMc 4FP5D 2DNCA 5D65A 1PH8A 5CV6A 2R3ZA 1X3PA 4ZLTF 5C5LA 2OF1A 3HOVB 1GUSA 2HIVA 2R92B 5IYDH 5FJ8G 1HXYD 2KUMA 4KKUA 4EQ5A 3PV0A 1DONA 2E2HB 1HFGA 1E2VA 4DAPA 4DV5Q 5T1GA 4BBRH 1F77A 1H9JA 4DNRB 3ONAB 4J15A 1IKLA 1V1QA 1SJHD 2K52A 1V8QA 4GKJQ 5IP7G 1VS0A 4DU9A 4YWMA 5G3LF 1IW7C 2ICIA 2L11A 1K83B 1CKNA 2SEBD 2F03A 4JBWA 3CF5A 1EZ6A 2DJFC 2DUDA 3KBXA 3JAMi 2AWNA 3U58A 1HR0Q 3VDYA 2A1AA 2JA8G 2ZJPA 4UY8C 2O2LD 2EOTA 2BH2A 1TWCB 1LTBD 2EQSA 1EIYB 3GTJB 2EY1A 1BCPD 3EVQA 2A73B 4JYAQ 2ZM6Q 2XN9C 2YTYA 3K80C 2HCIA 1HCZA 2JA8H 2DY7A 2FMMA 1X56A 1PLFA 3RZDH 1KNAA 1TWFH 3H6MA 3RR5A 1Q12A 1D8LA 3RMHA 3VYUA 1PDQA 1Y1VG 2EE1A 4XIGS 1R4QB 5J22A 3L9AX 4DA2A 2XNAC 5FO7B 3OYYA 2RHSB 4WJWA 3CKIB 5KYLA 2NVTH 1Y8OB 3FHWA 1FVIA 2WB1B 2K5QA 1YNNC 5IOCA 2UU9Q 1Y1VH 1AW7A 4MZ9A 1QNKA 3BVGA 4FVMA 5GQOA 4JBJA 4H13C 1LT3D 1I4RA 2E74C 2N88A 3D8GA 4N8X1 2KQ3A 1A3TA 2OTLA 3S1RB 3PF4A 3RLOA 5I9OA 2Y0SG 5GAHC 5AJ3L 2G9DA 1E22A 3RLFA 4R8NA 4ALPA 2JA5G 2ZTDA 1W6KA 3VR5A 2VUMB 4XYOA 1QUQA 2R7ZB 2IPKD 4DUZL 3M4OH 1SYDA 4BBSG 3RLNA 3CQZH 3EIVA 3S1MB 2D0OA 1U4MA 1AZPA 4KLKA 1OXUA 5CMDA 3FMCA 1I6VC 3HKZB 5HY6A 1VQMA 2B2WC 1LT5D 5CV8A 3TBIB 1QWYA 3M3YH 4BBSH 3KF8B 1M90C 5C4XG 3OPOA 4CHTB 5AJ3Q 1EUJA 1BBUA 2CHBD 2E2JB 5EQ0A 5KRUA 5LMNW 4A3EG 4EQNA 4A3BB 2KBNA 3K58A 3CXCA 2O5JC 3GD7A 5C4XH 4A3MH 4R1JA 2ICEC 3CC2A 2K7VA 4B3TL 3E0EA 1SNOA 4EQPA 5CV9A 1Q8IA 2KOLA 3P1HA 5C44B 1ICFB 2BCOA 1SROA 2MNAA 2M00A 2PW5A 1Z47A 1VQ6A 3I4LA 1F9PA 2AQ3B 1NMGA 5KNCA 4X3SA 5ELOA 2UXDL 5M5WB 3PQIA 3A7AB 4DAMA 4BBRB 1SFOH 1EY7A 2OQKA 1EY6A 3ERQA 3TP6A 1X9NA 1IW7D 2MFIA 3NUCA 4B3TQ 5GROA 3MA2B 5K5PA 1Q1EA 1KDBA 2F4VQ 4DV7L 2XWBB 4A93G 1WVLA 4A3DG 3D4WA 1KHIA 3W1BA 2Z4HA 3BS1A 1L1OC 4HJ9A 1AE3A 1Y69U 1X3FA 1W2BA 3OMCA 2SNSA 4WJ3M 1S5DD 2DY8A 1DD2A 2KCCA 2RKSA 1PZJD 2A8VA 4A93H 1KRSA 2K33A 1DOMA 2V1CC 1TIID 3CCVA 3MXPA 1NJIC 1TXYA 5G3LD 2JA8B 5IP9G 3RZDB 2Q2UA 3NHHA 1O78A 1B3QA 1SYEA 1J9OA 2UXCL 1AH9A 5I6YA 4BA2I 1SYBA 4FNFA 5I6WA 2IX1A 4LUZA 3Q0AA 4K0KQ 1RF2D 4DV7Q 1D2BA 4R4IA 3CCSA 2GVAA 1P16A 2NVYB 1K0RA 2NVTB 1GKHA 1KAAA 1B2TA 3JC66 4JBMA 2VNUD 1Y1VB 4HJAA 3K8AA 2C35B 2CVRA 1K8AC 5DAUA 4UDUC 1Q86C 2F0DA 2JQOA 1VMPA 1STNA 1GVPA 2FINB 2NN6G 1CSQA 1FGUA 2OWOA 1A15A 4EVOA 2VXWA 3KLSA 3M4OB 3I56A 1JOQA 2PZWA 1PHJA 4Y52H 1QE6A 1RCVD 3CQZB 2Y0SB 1MSGA 4PG3A 1E1OA 2A69D 4IPDA 4C3HG 2F3WA 1ESRA 5I4DA 2YU9H 5JAVA 1SNMA 1V1PA 1MSHA 3IL8A 5JVH3 3M3YB 1JJGA 4BBSB 3UE0A 3Q23A 5M5YH 3HKSA 3D0FA 1TQOA 4MNOA 4PMWA 4IOAA 2OCEA 3K0YA 3NQTA 1NUCA 1YNJC 2X6LA 4IJLA 1YITA 2O5IC 1CT1D 3TP5A 4L5TA 2QF7A 4ULLA 3S2HH 5C4XB 4A3MB 4HR7B 4FYDA 3PO3G 2VZAA 1M4VA 1PH3A 4A3EB 1XTDA 5FKAC 3VR4A 3K7AB 2Z6KC 4QIWB 3PO3H 4FF2A 1SNQA 4IPHA 3VR2A 1P8LA 4A76A 2E5LL 1HUNA 3C2PA 1HQMC 2KEEA 2L1BA 5EBCA 3SK6A 1XYIA 2MJ8A 3BU2A 4DV0Q 1SFOB 2PQEA 4K8IA 2VW9A 1ZXTA 3FVQA 2EXDA 1ICWA 3HOZH 3DEOA 2JEBI 1Y8NB 4IZ8A 3E0JA 1E1TA 3R8BA 1HFNA 5JOBA 4AH6A 4RGMA 1LACA 4LJZC 1WD1A 1DM0B 4FO2A 2PI2E 3L0OA 2EY2A 4WJ4A 2F0VA 4FXGC 3RUZA 3SK5A 1X3QA 1XNQQ 4KKSA 3A54A 3K0XA 1CZWA 1CQVA 1NCVA 4A93B 1DGSA 3NP8A 5EPJA 3I55A 5E1FA 5FLMG 2E76C 4Q5VA 1LTTD 2Z6KA 5CV7A 1SYGA 1IYUA 3J7AF 4R8IA 3KLRA 4A3IH 1BQQT 4CDCC 4JI2L 2QCPX 4O2DA 5FLMH 4LFBL 2JSOA 1TWAB 1FR3A 4XXEA 2B3GA 4A4IA 5I9PA 2L12A 4LNQA 4IUPA 1S5FD 2F0GA 1SE8A 4JVZA 5NUCA 4U68A 3NELA 1R9TH 2XVSA 2YYZA 4HSPA 5T1IA 1XMQQ 1HNWL 4KHVA 4RFBA 3K81C 1A2UA 2F0FA 5IYBH 1OO9B 3CC4A 1EU4A 2DGYA 2NTTA 2CH4A 3H94A 3W5OA 2EYHA 3CPWA 2QA4A 4OL7A 4GN4B 1HH2P 4JW0A 4OGQC 2B8GA 2WAQG 4JI3L 4LFBQ 5K36G 1PZKD 5M3FG 4DV1Q 2K50A 1GJXA 1EIFA 1OTCA 2N49A 2VS1A 4IUTA 4HJ5A 1OXXK 3CMEA 3CCRA 2YU9B 3DWQA 4JI1Q 5KEEA 1VQHA 4JC0A 3D4RA 3MXGA 2G5DA 2BOSA 4OWWB 1HNWQ 1F2MA 3I4MH 5M5YB 1S5BD 2GN5A 3DM3A 1BNZA 3NPPA 1MBYA 1YNJD 4C3HB 1VQ5A 4P72A 1IYJB 3TMEA 3QG1A 2AHOB 4HAEA 1IBKQ 1RL2A 5C3EG 2JA6G 3S2HB 4MIUA 5C4JH 1RTOA 3PUYA 4LUOA 3V96A 1RJTA 3HGBA 3UI2A 1Z9FA 1DOKA 1BBXC 5ELCA 2ZXOA 4YHHL 1TWGH 3CAMA 2H4OA 2B2UC 2PQAA 1KRTA 2R92H 3RD4A 3PO3B 4DR1Q 3KUPA 2E2HH 5BN3A 1HQRD 2EYFA 3D6WA 4QUFA 3KF6B 5CV4A 1YNXA 3EA6A 3KJPA 3K5MA 2PNHA 3D4DA 3HOXH 1BCPF 1JE5A 2K5NA 3BZCA 4GKKQ 3E3XA 4NXML 4HIKA 3PO2G 4C3JG 1N8RC 1G2TA 1ET9A 3AMUA 4YHHQ 4L5RC 4A3FH 2MO1A 3KLSX 4B9WA 4P71A 4X64Q 2CWPA 2I0QA 5EPKA 3PO2H 3PCOB 3S17H 4N9TA 4HTHA 1I5FA 4ZRZA 1IBLL 1N36L 1STYA 1WTPA 5JVG3 3A74A 5ELNA 3A5ZB 2LS01 1BCPC 2EIFA 3HEJA 4NXMQ 3MEFA 4K5XA 2B2UA 4BY7G 1JWUD 2LSSA 4GLAC 3HOYG 3BZKA 3EROA 4X3TA 2RVLA 2J0TD 4LFCL 4HJ7A 4A3IB 1Q90A 1IZ6A 3JAML 3I73A 3H0GH 3WOEA 2IL8A 4ABNA 1LTGD 3NE5B 3KYHC 3U9SA 3T56B 4KHPL 2AUKA 2F0TA 1F9RA 1B50A 1H9KA 1R9TB 1GM5A 1EY9A 3ICEA 2FFKB 4DR4L 4DR7L 4PZ6A 5IT9c 1VQCA 1ZEQX 5EGTA 3ULPA 1HHVA 4X62L 2JK8A 1QVGA 1VQNA 4DF7A 2HD3A 1WTOA 4LFCQ 4OXPA 1H95A 4MN3A 4DXGA 2H5XA 4RH6A 4V190 5C3WA 3JAME 1HNXL 1G6ZA 5E3FA 2WACA 1SR3A 3CP0A 2MO0A 2CWAA 4KHPQ 3MHBA 3ULJA 4NKLA 4CGYB 2EJMA 4ZQ3A 1B1ZA 2XRSD 3CC7A 4DXFA 1K3RA 1SN8A 2QKIC 4XQQA 4UHVA 3ZJYC 1D5XC 1XWEA 4PZ8A 4X62Q 1F2LA 1CTMA 3NEMA 2B63H 3OOCA 4I65A 2ENBA 4CDEC 3TREA 3LX0A 4AYBG 5KGUA 4JOIC 3DLLA 4X3UA 3QIAA 1UE1A 5C4JB 4DN4M 3A8KE 1UWVA 1QOHA 1EYDA 1X54A 4ME5A 4O42A 5C44H 3TN2A 1D5MC 3NQIA 2A5HA 4GLVB 2VB3X 1TWGB 3OHXC 5CC4A 5FLXc 2RCFA 4JI0Q 4RKLA 5GAEC 2OXPA 1EEFD 4KK7A 4JI6L 5M5WH 1S40A 2C5CA 3F2CA 4DUYQ 2ATWA 2WINB 3HOXB 5FJ8H 2R61A 1NNXA 1ENFA 3I70A 1WCMG 3STBC 2ZJRA 3MWYW 4LMQD 4JI4L 1NBWA 2AMCB 1YIJA 5H1SE 4DR5Q 5C0XG 4RGTA 4DK6C 1OXTA 2PMZE 1YBYA 2LXJA 4YWLA 1AN8A 4A3FB 4JPBW 2M9VA 1WCMH 4FXKC 5IP7H 3PO2B 4XQNA 4QGUA 5C0XH 2F0OA 1WOCA 3S17B 2MUYA 2NBFA 4JI6Q 3H3VH 2Z1CA 4JI8L 1QJOA 5KYIA 4XDXA 1VMCA 4U673 1VQ8A 3K5OA 1L0XB 2N55A 1Q81C 2KHSA 4XQJA 1S5CD 2F0QA 5I2YA 2VY3A 1TS2A 4P2CB 2IX0A 4JI4Q 1EWHA 1PA6A 1A62A 4TVAB 3K5LA 1HZAA 5IGDA 4LFAL 1VQDA 3Q6SA 3S16H 1JC7A 4A3JG 4H44C 4ME3A 3H0GB 2F0PA 2NVYH 3K7UC 1SE4A 5LMNL 5M3MG 1L0WA 3E9IA 1SEBD 2EYMA 3A8JE 4JI8Q 3HOYB 1B53A 1EU3A 5IGCA 3NWTA 3DM1A 3R3OA 4IO9A 4WORA 4IPGA 3V05A 3KJOA 1CA5A 4AQYL 3KLWA 3SVMA 3J7A5 3SHLA 3I7FA 1SNDA 3G48A 1SDFA 2XGTA 1EYCA 4LFAQ 5C5MA 3QOJA 1TS5A 4F8MA 5E4WC 1WD0A 1HNZL 1BDOA 3E6ZX 1DJRD 1I4QA 2RCNA 4R4QA 2JA5H 5LMNQ 4LF7L 3DEPA 1RKNA 2WAQE 4P75A 2M2LA 2MQHA 3AQQA 2A69C 3G6EA 1I50H 1IKMA 1LM0A 2I5LX 3SK4A 2NZ1D 2N3SA 1BXTA 3OTOL 1EOVA 3K57A 1K8GA 1I4GA 2TMPA 5C4HA 1BOSA 2B63B 2KCMA 1LV9A 1NR4A 2XTIA 4DUZQ 3CD6A 3HOWG 1VF5C 1WJJA 1VQ7A 3H09A 1HNZQ 1FJGL 2JJQA 3DWPA 1GUOA 1LYLA 3KFUA 3LGJA 1EY8A 4FF1A 4KMUC 1SBBB 4A3EH 3K7AH 1B9MA 1D1IA 1C7YA 2NYZD 2HQLA 3DMUA 3EFXD 4QF4A 4ZKBB 2Z0SA 4OEMB 4TQUS 1PYBA 2K5WA 4DV4L 3M4YA 3A7LA 1ENAA 4DAYA 3KK7A 1YZ6A 4Q0FA 3STBD 2K28A 4KD3A 1I6HB 4QCLA 1KC8C 3KF6A 4JV5L 2EDGA 2B2WA 4DV3L 1SNCA 1CA6A 2PYKA 2PNRC 3NWSA 3UDXA 1UNSA 1WCMB 4XYQA 4OIJA 3GTOH 1HPCA 1A8VA 1U4PA 3QOLA 2ZXRA 1EY0A 4A3LG 1QB5D 2UXDQ 1TS3A 2AKWB 3SXHA 4NMZA 4L8JA 2PCFB 5JJIA 4ZCKA 3RN5A 4A3DH 1VDZA 2YTXA 4JV5Q 1CFMA 2G9HD 2K75A 4DV3Q 4KJNA 3K5NA 3NTKA 4RCNA 3UDFA 5JJZA 1IL8A 2NZHA 4DV2L 3MVVA 3PSIA 1PZID 4LWCA 4DR3L 3OSOA 3S16B 3NBHA 1PFMA 1TWAH 4KHZA 5IP9H 1QVFA 2Z6BA 4GS3A 5J3BA 4HIOA 4DKAC 4ILWA 1TS4A 2CQAA 2TSSA 4YCWA 1DYQA 2B39A 2K32A 4HSVA 1V1OA 4OWXB 3S14H 3BDOA 3C46A 5EJWA 4B08A 5EKLA 4DGZA 5M3MB 3M4PA 5IY0A 4A3CG 4ZAIA 2UXCQ 1TVXA 2KEDA 4IOCA 3R2IA 1K0SA 1L1OA 3P75A 1J5EL 4DV2Q 1K8MA 2KENA 5DM73 4BXXG 1NY4A 1B9NA 1KD1C 1H9SA 5CYUA 5C0XI 1BF4A 2XRQD 4B3ML 2JA5B 4LF5L 2NN6H 3H3VI 1AE2A 1EQVA 2BE5C 1HRJA 2OT2A 3MAQA 4A3KG 1IBML 2UUBL 4ZYSA 2B8FA 4EGVA 1I50B 2QEJC 4BXXH 2CH4W 4C3HH 1UE6A 2LXKA 3M7NA 1O7IA 2KVMA 3AU7A 4KN7C 1SJED 2UXBL 1RIPA 2LY7A 3MC0B 1G51A 4GLXA 1QZHA 4AYBE 2AQ2B 2R7FA 3HOWB 3HZXA 1IBMQ 4HMJA 1XMOL 2PPBC 4TKOB 5C0XJ 2RDFA 3P7JA 3GO5A 2KJXA 1WTVA 2JA7G 2K5DA 1VQLA 3TEHB 1EWCA 1QZGA 5EKKA 2EYLA 1LTRD 2D5DA 4OIKA 2PZTA 3BDLA 4I7ZC 3N52A 3QB3A 1CHQD 4K2KA 5L37A 2JP1A 1CZGA 3WWVA 4C3IG 4K14A 1PXUA 1B44D 1HUMA 2X69A 1V43A 5I2XA 3FP9A 3MXNB 4C2MH 3GTOB 1F9SA 4OWTB 2BA1A 5ISRA 1D5ZC 2E5LQ 1Z7TA 4C3IH 3GTQH 1CKNB 2D2CC 3TS0A 5HURA 2F0SA 3H15A 4A3DB 1KXLA 2K1BA 1SXTA 2HQEA 2WV6D 3L7ZC 4K6DA 5CORA 4KY5A 1M1KC 4JI7L 1X65A 5A35A 1FNUA 2A19A 5IIFA 3GTMB 3O13A 4RG1A 3L3OC 3NTIA 4NXNL 1ZKOA 3G71A 1RD9D 2MHVA 1BR9A 3AYHB 3TRZA 2KA7A 3I4NG 1EEID 2Q2TA 4MHEA 4PV1C 4GZYC 1A3UA 4X3KA 3S14B 3KBGA 3CCUA 2MPMA 5JEAG 2BDOA 1S3OA 1LABA 3I3CA 4FF4A 3CRKC 3GQBA 2K4KA 4JI7Q 4RA8A 1Q82C 1KABA 4M1UB 2EJGC 2PO4A 5KNDA 4JI2Q 2RSNA 1QILA 5CV5A 4DK3C 3ER0A 4IN3A 5LMUL 1EQRA 2EJFC 1GXDC 2BE5D 1B70B 5EPLA 1AFPA 1VQBA 4LF4L 4R4OA 5IE8A 1JB3A 5J39A 3M85A 1UE5A 1JE4A 3IFTA 2UUAL 1C0AA 2L4NA 5K36H 5CR3A 5M3FH 5IYCG 4B3SL 2KHIA 1AEXA 2F0IA 1F9QA 1CHPD 3KF8A 3T1HL 4WFN3 4GOPB 5JJKA 1J8IA 1E2ZA 4A3KB 4OO1G 5JJLA 1YEZA 4KN4C 4PMCA 3M4QA 5IYCH 1N32L 3FDTA 4KKTA 4JI3Q 3AFPA 3V2TA 3W1GA 3H3VC 1Z6HA 2D0PA 4LF4Q 3G6JB 4JI5L 2OTJA 4OO1H 3J7ZC 2A74C 5C3EH 2JA6H 2UUAQ 1B3AA 3S1QH 1K8OA 3VYRA 4YY3L 1E2WA 3T1YL 4K5VA 3B6YA 4B3SQ 4L5SA 2L0CA 1TU2B 2Q8TA 2WIIB 1X32A 4IPCA 4NDXA 1MJEA 4V0BA 3X3NA 2I46A 5IT9L 2E8GA 2ZTCA 2R7DA 3ND9A 1HZ9A 2AQ1B 1TWHB 4YCUA 2QDBA 1CSPA 3VYSA 3PIP3 4GNXB 1WFQA 2NN6I 1QNUA 1PTOH 1PH4A 2Q2IA 1JB7A 1IYVA 2OEOA 1SYFA 4APVA 2D9UA 2I5MX 3PUWA 4X66L 2WFWA 3OWFA 2PMZB 3T1YQ 3J81c 3R2TA 4C3JH 4C2MB 4KV6A 1JJCB 2QILA 1PYSB 1HZCA 4IUNA 3GTGH 1WI5A 3I90A 4C3IB 4R9WA 2K14A 3GTQB 1BO0A 3KOJA 1VQ4A 1B7YB 1CM9A 5IT9E 3MXUA 3FKIG 2K01A 1T5XD 3VA5A 1NSNS 4S3SA 1KNEA 1QVCA 4J6HA 4DAVA 3I8ZA 3C1EA 4R4TA 1LO5D 1I4PA 1IXRA 1EQTA 2RDHA 1JQYD 4N8FA 4RGOS 1ML0D 2KCNA 1Y14B 4X66Q 3FKIH 2FXQA 2EY5A 4CDDC 1K28A 1STHA 3CHBD 2H1EA 3Q22A 4QJFA 4BY7H 2D62A 1FGBD 1T5EA 4ZUJA 1H9MA 3G4SA 2MP1A 4A3GG 2F3IA 5FLXL 3J80c 1IBLQ 2EYPA 3HOYH 1N36Q 1L0YB 3J81i 3OW7A 2F0KA 3F2UA 3DUZA 3S15H 1VQGA 2L5TA 2Q8RE 3NTHA 1JT8A 4DK0A 4IUVA 5LHY1 4A3GH 1XJVA 4EQOA 1X3EA 1EOTA 3SK8A 4J8QA 4P73A 3MFYA 1MIUA 4XTCS 2PW7A 1RDPD 2YTVA 3NK9A 5C6AA 4DR2L 5IGBA 1ESFA 2K04A 2F4IA 1XPRA 5ELFA 1UEBA 2B2VC 2JYOA 4M8AA 4BY1G 5DM63 1CUKA 1WTWA 3I4OA 2JEAI 1EWIA 4NB3A 5FLXE 1YHQA 2WAQB 2JN4A 4B9XA 4DR4Q 4QB4A 4DR7Q 5M3FB 4HJ8A 4K8JA 1ONLA 4OONA 4BY1H 1GHJA 1PFSA 5LL6S 1U4LA 1B8AA 4KY6A 5DNFA 4DR2Q 1CKOA 3BG3A 1A0IA 2DJGC 1KDCA 1ZYRD 4HIMA 1HNXQ 5BN5A 1UAPA 1PH5A 4L5QA 2EYJA 4CKEA 3VA7A 3I91A 3VR3A 3K59A 4GN3B 1EZ8A 2K5HA 5C3EB 2JA6B 5F2DA 2DNEA 1VQFA 3S1QB 1S4ZA 2QEXA 2A68C 3QWNA 3CCMA 1EL0A 2F0LA 4OHJA 4HCSA 4UP9A 3DXJC 3DHQA 1I6HH 2B2VA 3OIPA 2JXMB 1VQEA 2SNMA 1SRUA 2NVQH 1A3VA 2WKCA 2IY5B 4O0AA 1XPUA 3ITPA 3S1NH 4BBRG 4QY7A 4KD4A 3OIQA 1ASYA 1PTOB 1HR0L
chains in the Genus database with same CATH topology
4IUUA 1JOKA 4IURA 2K03A 2WP8J 4C3JB 3FPUB 4Z9CB 4LK1C 3NXWA 3MXNA 3GTGB 4KJOA 2KECA 3SR1A 1DXMA 1PFBA 1R4PB 1RTNA 3FRPB 4NP5A 2Q8IB 3BZDB 5D3DA 4OO1I 1SE3A 2F0EA 1Q3LA 1DZ1A 5JEAJ 3FKIB 1RODA 4K6LA 3R93A 4G7ZC 4BY7B 2RBMA 3HRZC 4CJ0B 2RSOA 3TZDA 4CKCA 4KI0A 3S15B 5IODA 2J4XA 4ZK9B 2A6HC 3N6RA 2AUJD 2SDFA 4A3GB 1PRTB 4LAAA 1B4OA 2JE6I 4IFDG 1LTAD 3J7YW 2F0WA 5E4XA 4RKBA 3QO2A 1D6EC 4FF3A 3IKJA 4IFDH 1I4HA 5KNBA 3LNNA 4NW2A 1AZQA 1A2TA 1C4QA 1LLRD 3PUVA 1SMYC 1O7LA 1UUPA 2PZUA 3HP3A 4C1NK 4BY1B 2ZXPA 3D31A 4DFAA 1LTSD 3ZYYX 1TT2A 5CBEE 1WTRA 3TZUA 1ENCA 1KLGD 4PMBA 4HEDA 5IGFA 1HA6A 1PMRA 3CU7A 2A68D 4AYBB 3GV3A 3BVZA 2X6GA 3LWEA 1FNVA 3D6CA 4L63B 3U9OA 4C1NI 1WTQA 1BUVT 2A6EC 5D3IB 4F88A 2NUCA 2NVQB 1MGSA 3S1NB 1SAPA 4ID6A 3SDZA 1XTCD 2F3VA 3S9WA 5M9OA 1O7YA 4DK1A 3SE0A 2HDLA 5EKIA 1U9RA 5TSSA 4DNTB 1JWSD 4RAUC 2NTSA 4E6IA 2GA4B 3WOFA 1KLUD 2F0JA 5LL6X 2EXZA 1KDAA 3BYYB 3TDQA 3W2DA 2R6GA 5D14A 3I72A 1EIGA 3TSSA 1STGA 4UAIA 5HGTA 1JOOA 2K6AA 1EY4A 3OWEB 4IQZA 3W3AA 2XSCA 2RQXA 2A6HD 2Z8LA 4KTAA 3J7AV 2B2TC 4A3JB 1TWFB 3PUZA 4K2LA 3S2DB 5KIXA 4CJ2C 1F2YA 3HOUB 1PTOF 3GV6A 1YNND 3URYA 4J1MA 1GHKA 4RHSA 1TY2A 4F7XA 3HG9A 2FMCA 1U4RA 2EYOA 3CRLC 3AB9A 5FK9C 1SMYD 4N9PA 5C3XA 4XT3B 1WTXA 1SNPA 2Z4IA 1PTOC 1BCPB 3VR6A 2E2DC 3DWAA 2F0UA 3PMFA 4F87A 2B2TA 2C9OA 5AFWA 3WDNA 2EVBA 3T4AC 3TP8A 5BN4A 3BYTB 3MEHA 5ELEA 1CI3M 4IUQA 2XWJB 2IWHA 2RA4A 1QG7A 4G57A 1PRTF 4CJ1B 1UEAB 1STAA 2A6ED 2FJ2A 4ZKCB 5JPMC 3IFDA 3MFGA 3C1FA 2L55A 3QJYA 2K05A 3EJIA 2HUGA 4RGNA 3EQLC 4IFDI 4FXDA 1I4XA 5EBDA 1TY0A 1CQFA 3MZ5A 4O1NA 1FD7D 3BDCA 2NWGA 5COYA 3BVMA 3SEBA 1PRTC 1TR5A 4K5WA 1JR0D 2HDMA 1DOLA 3GP7A 3C3LA 4Y7NB 1VF7A 4G7OC 5M5XB 1FNWA 1JICA 1HTLD 4QMGA 1F2ZA 2F0NA 2XIWA 1Y8PB 3T16A 5FO8B 3MTSA 1E0BA 1FYCA 3E5SA 4IFDJ 1OXSC 1GUTA 3A56A 1G91A 3GTLB 3LWUA 1PFNA 1JCKB 3TP7A 2AWOA 3GTPB 5IGGA 3FEWX 4ODGA 4YIJA 4G7HC 1G8ZD 4IALA 4TSSA 1HTPA 2LKVA 1EFID 2O4XA 1MD2D 2CW0C 5JEAH 1Y1WB 1EYAA 3RZOB 3P20A 4HMIA 4ZUIA 3J81L 4JK1C 1EIHA 2LFNA 2F0HA 2L9HA 1PTOD 4TRDA 5CBAE 3FPPA 2E75C 1ET6A 2IJ0A 2BA0A 5JPNC 1G2SA 4RWSC 2EY6A 4CBVA 1ZYRC 1II3A 4BWGB 2NVXB 3A8IE 1H9RA 1G291 3A55A 1KTKA 1S5ED 5FOBB 3J81E 3J80L 2WKDA 1STBA 1OXVA 1ILQA 1GOZA 4RCOA 2DN8A 1QCBD 3T53B 1MI2A 4CKBA 1A6XA 2JA7B 4C56C 5C4ZA 1GUWA 5FO9B 1LTID 5J1ZA 3VYTA 2LMCB 2EPBA 2J7ZA 1W6JA 1PRTD 1C8CA 1SYCA 1O7ZA 3J80E 3G7LA 1SSOA 3HS0C 4H7BA 3HOZB 2RDGA 2NB0A 5A2QL 1M8AA 4L6TB 3IAYA 4BA1I 3K6OA 1XX8A 2VB2X 4BS9A 4KY7A 3T51B 2IT1A 1EY5A 2B2YC 3GTKB 1RHPA 1SE2A 5ELBA 3ND8A 1XXGA 1CK1A 3OMGA 1GUGA 1HA5A 1STEA 3PIO3 4XT1B 4H0LC 4QUCA 4WRDA 5A2QE 2EZVA 1LT4D 1D1KA 2CW0D 3I4NB 3NBIA 4G4KA 1AP0A 4PQXA 1ILPA 5CGKA 2FHTA 2IW3A 2IX3A 3Q24A 3H91A 5IGEA 1TKWB 4PNYA 2MGSA 1LT6D 1C48A 1H9SB 5ELDA 1Q1BA 3NSWA 2B2YA 2I07B 1JORA 4HN7A 1V1PB 3X3MA 3T13A 2F1MA 3D3RA 4RHRA 5DEHA 2R93B 3I4MB 1JWMD 2E2IB 2BDNA 3PUXA 2V4DA 2HCCA 1PYWD 1NR2A 2ZT9C 2SOBA 1VCIA 2F0MA 1DCZA 3M7GA 2ID0A 4HCEA 1NAPA 1O80A 1GUNA 1IHZA 1I3QB 4FP5D 2DNCA 5D65A 5CV6A 2R3ZA 1X3PA 4ZLTF 5C5LA 2OF1A 3HOVB 1GUSA 2R92B 1HXYD 2KUMA 4KKUA 3PV0A 1DONA 2E2HB 1HFGA 1E2VA 4DAPA 5T1GA 1F77A 1H9JA 4DNRB 3ONAB 1IKLA 1SJHD 1V8QA 4DU9A 5G3LF 1IW7C 2ICIA 2L11A 1K83B 2SEBD 2F03A 4JBWA 1EZ6A 3KBXA 2AWNA 2O2LD 2EOTA 1TWCB 1LTBD 3GTJB 2EY1A 1BCPD 3EVQA 2A73B 2XN9C 2HCIA 1HCZA 2DY7A 2FMMA 1PLFA 1KNAA 3H6MA 1Q12A 3RMHA 3VYUA 1PDQA 2EE1A 4XIGS 1R4QB 5J22A 3L9AX 4DA2A 2XNAC 5FO7B 4WJWA 3CKIB 5KYLA 1Y8OB 2WB1B 2K5QA 1YNNC 5IOCA 1AW7A 1QNKA 3BVGA 4FVMA 4H13C 1LT3D 1I4RA 2E74C 2N88A 3D8GA 2KQ3A 1A3TA 3S1RB 5I9OA 2G9DA 3RLFA 4R8NA 1W6KA 3VR5A 2VUMB 4XYOA 2R7ZB 2IPKD 1SYDA 3S1MB 1U4MA 1AZPA 1OXUA 5CMDA 3FMCA 1I6VC 3HKZB 2B2WC 1LT5D 5CV8A 3TBIB 1QWYA 3OPOA 4CHTB 2CHBD 2E2JB 5EQ0A 5KRUA 4EQNA 4A3BB 3K58A 2O5JC 3GD7A 2ICEC 2K7VA 1SNOA 4EQPA 5CV9A 1Q8IA 2KOLA 3P1HA 5C44B 2BCOA 2M00A 2PW5A 1Z47A 3I4LA 1F9PA 2AQ3B 5KNCA 4X3SA 5M5WB 3A7AB 4BBRB 1EY7A 3TP6A 1EY6A 3ERQA 1IW7D 3NUCA 3MA2B 5K5PA 1Q1EA 1KDBA 2XWBB 1WVLA 3D4WA 3BS1A 2Z4HA 1Y69U 3OMCA 2SNSA 1S5DD 2DY8A 1DD2A 2KCCA 2RKSA 1PZJD 2K33A 1DOMA 1TIID 3MXPA 2JA8B 5G3LD 3RZDB 3NHHA 1O78A 1SYEA 1J9OA 5I6YA 4BA2I 1SYBA 4FNFA 5I6WA 2IX1A 3Q0AA 1RF2D 1D2BA 2NVYB 2NVTB 1KAAA 1B2TA 2VNUD 1Y1VB 2CVRA 5DAUA 4UDUC 2F0DA 1VMPA 1STNA 2FINB 2NN6G 1A15A 4EVOA 2VXWA 3KLSA 3M4OB 1JOQA 2PZWA 1QE6A 1RCVD 3CQZB 2Y0SB 1MSGA 4C3HG 2A69D 2F3WA 1ESRA 5I4DA 5JAVA 1SNMA 1V1PA 1MSHA 3IL8A 5JVH3 3M3YB 4BBSB 3Q23A 1TQOA 4PMWA 3K0YA 3NQTA 1NUCA 1YNJC 2X6LA 2O5IC 1CT1D 3TP5A 2QF7A 4ULLA 5C4XB 4A3MB 4HR7B 4FYDA 1M4VA 4A3EB 5FKAC 3VR4A 3K7AB 4QIWB 4FF2A 1SNQA 3VR2A 1HUNA 3C2PA 1HQMC 2KEEA 2L1BA 5EBCA 3SK6A 1XYIA 2MJ8A 1SFOB 2PQEA 4K8IA 1ZXTA 3FVQA 1ICWA 3DEOA 2JEBI 1Y8NB 4IZ8A 3E0JA 3R8BA 1HFNA 5JOBA 4RGMA 1LACA 4LJZC 1WD1A 1DM0B 4FO2A 2EY2A 2F0VA 4FXGC 3RUZA 3SK5A 1X3QA 4KKSA 3A54A 1CZWA 1CQVA 1NCVA 4A93B 3NP8A 5EPJA 5E1FA 2E76C 4Q5VA 1LTTD 5CV7A 1SYGA 1IYUA 3J7AF 4R8IA 3KLRA 1BQQT 2QCPX 2JSOA 1TWAB 1FR3A 4XXEA 5I9PA 2L12A 4IUPA 1S5FD 2F0GA 5NUCA 4U68A 2XVSA 2YYZA 4HSPA 5T1IA 4KHVA 4RFBA 1A2UA 2F0FA 1OO9B 1EU4A 2NTTA 3H94A 2EYHA 4OL7A 4OGQC 2B8GA 5K36G 1PZKD 1GJXA 4IUTA 1OXXK 2YU9B 3DWQA 5KEEA 3D4RA 3MXGA 2BOSA 1F2MA 5M5YB 1S5BD 1BNZA 3NPPA 1MBYA 1YNJD 4C3HB 3TMEA 3QG1A 4HAEA 3S2HB 4MIUA 1RTOA 3PUYA 3V96A 1RJTA 3HGBA 3UI2A 1BBXC 1DOKA 5ELCA 2ZXOA 2H4OA 2B2UC 3RD4A 3PO3B 3KUPA 5BN3A 1HQRD 2EYFA 3D6WA 4QUFA 5CV4A 3EA6A 3K5MA 3D4DA 1BCPF 4C3JG 1G2TA 1ET9A 3AMUA 3KLSX 4B9WA 5EPKA 4N9TA 4HTHA 4ZRZA 1STYA 1WTPA 5JVG3 2LS01 1BCPC 3HEJA 4K5XA 2B2UA 1JWUD 3EROA 4X3TA 2RVLA 2J0TD 4A3IB 1Q90A 3JAML 3I73A 3WOEA 2IL8A 4ABNA 1LTGD 3NE5B 3U9SA 3T56B 2AUKA 2F0TA 1F9RA 1B50A 1H9KA 1R9TB 1EY9A 2FFKB 1ZEQX 5EGTA 1HHVA 4DF7A 1WTOA 4MN3A 4DXGA 4RH6A 4V190 5C3WA 3JAME 1G6ZA 5E3FA 2WACA 3MHBA 4NKLA 4CGYB 2EJMA 4ZQ3A 1B1ZA 2XRSD 4DXFA 2QKIC 4XQQA 1D5XC 1XWEA 1F2LA 1CTMA 3OOCA 4I65A 2ENBA 3LX0A 5KGUA 4X3UA 3QIAA 5C4JB 4DN4M 3A8KE 1QOHA 1EYDA 4ME5A 4O42A 3TN2A 1D5MC 3NQIA 2A5HA 2VB3X 1TWGB 3OHXC 5CC4A 4RKLA 2OXPA 1EEFD 4KK7A 2C5CA 2WINB 3HOXB 2R61A 1ENFA 3I70A 3MWYW 4LMQD 5C0XG 4RGTA 1OXTA 1AN8A 4A3FB 2M9VA 4FXKC 3PO2B 4XQNA 5C0XH 2F0OA 3S17B 2MUYA 2NBFA 2Z1CA 1QJOA 5KYIA 4XDXA 1VMCA 4U673 3K5OA 1L0XB 2N55A 2KHSA 4XQJA 1S5CD 2F0QA 5I2YA 1TS2A 4P2CB 2IX0A 1EWHA 3K5LA 5IGDA 3Q6SA 1JC7A 4H44C 3H0GB 2F0PA 1SE4A 1SEBD 2EYMA 3A8JE 3HOYB 1B53A 1EU3A 5IGCA 3NWTA 3DM1A 3R3OA 4WORA 3V05A 1CA5A 3SVMA 3SHLA 1SNDA 1SDFA 1EYCA 5C5MA 3QOJA 1TS5A 4F8MA 5E4WC 1WD0A 1BDOA 3E6ZX 1DJRD 1I4QA 3DEPA 1RKNA 2M2LA 2A69C 1IKMA 3SK4A 2NZ1D 1BXTA 3K57A 1I4GA 2TMPA 5C4HA 1BOSA 2B63B 1LV9A 1NR4A 1VF5C 3H09A 3DWPA 1GUOA 1EY8A 4FF1A 4KMUC 1SBBB 1B9MA 1D1IA 2NYZD 3DMUA 3EFXD 4QF4A 4ZKBB 4TQUS 2K5WA 3M4YA 3A7LA 1ENAA 4DAYA 3KK7A 4Q0FA 2K28A 4KD3A 1I6HB 4QCLA 2EDGA 2B2WA 1SNCA 1CA6A 2PYKA 2PNRC 3NWSA 1UNSA 1WCMB 4XYQA 4OIJA 1HPCA 1U4PA 3QOLA 2ZXRA 1EY0A 1QB5D 1TS3A 3SXHA 4NMZA 4L8JA 2PCFB 1VDZA 1CFMA 2G9HD 4KJNA 3K5NA 3NTKA 4RCNA 5JJZA 1IL8A 3MVVA 1PZID 3OSOA 3S16B 3NBHA 1PFMA 4KHZA 4ILWA 1TS4A 2CQAA 2TSSA 1DYQA 2B39A 2K32A 4HSVA 1V1OA 3BDOA 3C46A 5EJWA 4B08A 5EKLA 4DGZA 5M3MB 4ZAIA 1TVXA 2KEDA 3R2IA 3P75A 1K8MA 5DM73 1B9NA 1H9SA 5CYUA 5C0XI 1BF4A 2XRQD 2JA5B 2NN6H 1EQVA 2BE5C 1HRJA 2OT2A 3MAQA 4ZYSA 2B8FA 4EGVA 1I50B 2QEJC 3M7NA 2KVMA 3AU7A 4KN7C 1SJED 2LY7A 3MC0B 2AQ2B 3HOWB 3HZXA 4HMJA 2PPBC 4TKOB 5C0XJ 2RDFA 3P7JA 3GO5A 2KJXA 1WTVA 2K5DA 1EWCA 5EKKA 2EYLA 1LTRD 2D5DA 4OIKA 2PZTA 3BDLA 4I7ZC 3N52A 3QB3A 1CHQD 4K2KA 2JP1A 1CZGA 4C3IG 4K14A 1PXUA 1B44D 1HUMA 2X69A 1V43A 5I2XA 3GTOB 1F9SA 2BA1A 5ISRA 1D5ZC 1Z7TA 2D2CC 5HURA 2F0SA 4A3DB 2K1BA 1SXTA 2HQEA 2WV6D 3L7ZC 4K6DA 5CORA 4KY5A 5A35A 1FNUA 5IIFA 3GTMB 3O13A 3L3OC 3NTIA 1ZKOA 1RD9D 2MHVA 1BR9A 2KA7A 1EEID 4MHEA 4PV1C 4GZYC 1A3UA 4X3KA 3S14B 3KBGA 2MPMA 5JEAG 2BDOA 1LABA 3I3CA 4FF4A 3CRKC 3GQBA 4RA8A 1KABA 4M1UB 2EJGC 2PO4A 5KNDA 2RSNA 1QILA 5CV5A 4IN3A 2EJFC 1GXDC 2BE5D 5EPLA 1AFPA 1JB3A 5J39A 3M85A 1JE4A 3IFTA 2L4NA 5K36H 5CR3A 1AEXA 2F0IA 1F9QA 1CHPD 3KF8A 4WFN3 1J8IA 1E2ZA 4A3KB 4OO1G 4KN4C 4PMCA 3FDTA 4KKTA 3V2TA 3H3VC 1Z6HA 3G6JB 4OO1H 2A74C 1B3AA 1K8OA 3VYRA 1E2WA 4K5VA 2L0CA 1TU2B 2Q8TA 2WIIB 1X32A 4NDXA 3X3NA 4V0BA 2I46A 5IT9L 3ND9A 2AQ1B 1TWHB 2QDBA 3VYSA 3PIP3 2NN6I 1QNUA 1PTOH 1IYVA 2OEOA 1SYFA 2D9UA 3PUWA 3OWFA 2PMZB 3R2TA 4C2MB 4KV6A 2QILA 4IUNA 3I90A 4C3IB 4R9WA 3GTQB 1BO0A 1CM9A 5IT9E 3MXUA 3VA5A 2K01A 1T5XD 1NSNS 4S3SA 1KNEA 4J6HA 4DAVA 3I8ZA 3C1EA 1LO5D 1I4PA 1EQTA 2RDHA 1JQYD 4RGOS 1ML0D 2KCNA 2EY5A 1STHA 3CHBD 2H1EA 3Q22A 2D62A 1FGBD 1T5EA 4ZUJA 1H9MA 2MP1A 5FLXL 2EYPA 1L0YB 3OW7A 2F0KA 3F2UA 3DUZA 2L5TA 2Q8RE 3NTHA 4DK0A 4IUVA 5LHY1 4EQOA 1EOTA 3SK8A 4J8QA 3MFYA 4XTCS 2PW7A 1RDPD 3NK9A 5C6AA 5IGBA 1ESFA 2K04A 2F4IA 5ELFA 4M8AA 2B2VC 2JYOA 5DM63 1WTWA 2JEAI 5FLXE 2WAQB 4B9XA 4QB4A 5M3FB 4K8JA 1ONLA 1GHJA 5LL6S 1U4LA 4KY6A 5DNFA 3BG3A 1KDCA 1ZYRD 5BN5A 1UAPA 2EYJA 4CKEA 3VA7A 3I91A 3VR3A 3K59A 1EZ8A 5C3EB 2JA6B 5F2DA 2DNEA 3S1QB 1S4ZA 2A68C 3QWNA 1EL0A 2F0LA 4OHJA 4HCSA 3DXJC 3DHQA 2B2VA 3OIPA 2JXMB 2SNMA 1A3VA 2WKCA 3ITPA 4KD4A 3OIQA 1PTOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IN3 A;  4WJW A; 
#chains in the Genus database with same CATH topology
 4IUU A;  3I2Z A;  1JOK A;  4IUR A;  4POF A;  2K03 A;  3M9B A;  2WP8 J;  3CCE A;  4JYA L;  4C3J B;  3FPU B;  2ZM6 L;  4Z9C B;  4LK1 C;  3NXW A;  1HJP A;  3MXN A;  4JOI A;  3GTG B;  4KJO A;  1A63 A;  2KEC A;  3SR1 A;  1DXM A;  1KQS A;  1PFB A;  1J6Q A;  1R4P B;  1RTN A;  3FRP B;  4NP5 A;  1PH1 A;  2Q8I B;  3BZD B;  1EFW A;  5D3D A;  1D7Q A;  1YJN A;  4OO1 I;  1YJ9 A;  1SE3 A;  4LF8 L;  2F0E A;  2UU9 L;  1Q3L A;  1DZ1 A;  5JEA J;  1W3S A;  3FKI B;  1ASZ A;  1ROD A;  4K6L A;  3SGI A;  3R93 A;  4G7Z C;  4BY7 B;  2RBM A;  3HOU G;  1X3G A;  1YHB A;  4GOP C;  4DNI A;  3AEV A;  1SLJ A;  3HRZ C;  4CJ0 B;  2RSO A;  3TZD A;  4CKC A;  4A3J H;  1HR0 W;  4KI0 A;  3S2D H;  3S15 B;  5IOD A;  2J4X A;  4ZK9 B;  2A6H C;  3HOU H;  3N6R A;  5M3M H;  2AUJ D;  2SDF A;  4A3G B;  4OEL B;  1PRT B;  4LAA A;  1B4O A;  2JE6 I;  4IFD G;  4LF8 Q;  1LTA D;  3J7Y W;  2F0W A;  5E4X A;  2NZO A;  4RKB A;  4X6A H;  3QO2 A;  1D6E C;  4FF3 A;  2CKZ B;  1VQO A;  3IKJ A;  1LTL A;  4IFD H;  1VQ9 A;  1I4H A;  5KNB A;  3LNN A;  4NW2 A;  1AZQ A;  4AQY Q;  2KCT A;  1A2T A;  1C4Q A;  1LLR D;  3Q8D A;  1YHA A;  3PUV A;  1SMY C;  4GNX C;  3KDF B;  1KL9 A;  3EBE A;  1O7L A;  1PH6 A;  1UUP A;  2PZU A;  3HP3 A;  4C1N K;  4BY1 B;  2ZXP A;  2RHQ B;  1VQJ A;  3D31 A;  1YI2 A;  4GOP A;  4DFA A;  3J81 j;  1MJC A;  1LTS D;  3ZYY X;  4JG2 A;  1TT2 A;  5CBE E;  1WTR A;  3OW2 A;  4LF7 Q;  3TZU A;  3RNU A;  1ENC A;  1KLG D;  4PMB A;  4HED A;  4A3M G;  5IGF A;  3HOW H;  1YVC A;  2VQE L;  1HA6 A;  1PMR A;  1N34 L;  3CU7 A;  2A68 D;  2ES2 A;  4AYB B;  1PH9 A;  3GV3 A;  3BVZ A;  2X6G A;  3OTO Q;  3LWE A;  1FNV A;  3D6C A;  4L63 B;  3U9O A;  4C1N I;  1WTQ A;  1BUV T;  1UE7 A;  2A6E C;  5D3I B;  4F88 A;  2PQA B;  1FJG Q;  2NUC A;  4UP7 A;  2NVQ B;  1MGS A;  1LUZ A;  3RN2 A;  1MKH A;  3S1N B;  1SAP A;  2F4V L;  1K9M C;  4ID6 A;  4QQB X;  3SDZ A;  1XTC D;  2F3V A;  2VQE Q;  4GNX A;  1N34 Q;  1NE3 A;  3S9W A;  5M9O A;  4OX9 L;  3UDI A;  1O7Y A;  4DK1 A;  3SE0 A;  2HDL A;  5EKI A;  1U9R A;  5TSS A;  4DNT B;  1JWS D;  4RAU C;  4DV4 Q;  1WTH A;  2NTS A;  4E6I A;  2GA4 B;  3WOF A;  1KLU D;  2F0J A;  5LL6 X;  2EXZ A;  3UE1 A;  1KDA A;  2HIX A;  4Y7N H;  5E7N A;  3BYY B;  3TDQ A;  4K0K L;  5M5X H;  4A3L H;  4JCV E;  3W2D A;  1KAW A;  2R6G A;  5D14 A;  1N33 L;  3I72 A;  1EIG A;  2JA9 A;  4OX9 Q;  3TSS A;  2F52 A;  3GTM H;  1STG A;  4UAI A;  1VQI A;  5HGT A;  1JOO A;  2K6A A;  1EY4 A;  4H02 A;  3OWE B;  4IQZ A;  3W3A A;  3GTL H;  2XSC A;  2RQX A;  2A6H D;  2Z8L A;  4KTA A;  3J7A V;  2B2T C;  3S24 A;  4A3J B;  1TWF B;  1XPO A;  3PUZ A;  4K2L A;  3S2D B;  5KIX A;  3GTP H;  4CJ2 C;  2WB1 E;  1F2Y A;  1PH2 A;  3HOU B;  1PTO F;  1Y1W G;  4JBK A;  3GV6 A;  1YNN D;  1N33 Q;  3URY A;  4J1M A;  1VQA A;  4FDB A;  1GHK A;  1S72 A;  4RHS A;  1TY2 A;  4DR3 Q;  2IHF A;  4UP8 A;  1VQK A;  4DR6 L;  1Y1W H;  4F7X A;  4A3C H;  4PZ7 A;  3F8T A;  3HG9 A;  2FMC A;  3RZO H;  1U4R A;  5DLQ E;  3CCJ A;  4UPA A;  2EYO A;  3CRL C;  3AB9 A;  3QR8 A;  1SMY D;  5FK9 C;  4N9P A;  5C3X A;  4XT3 B;  4LUV A;  2VL6 A;  1WTX A;  3CCL A;  1SNP A;  2Z4I A;  1PTO C;  4MTN A;  1BCP B;  3HKZ E;  4A3K H;  3VR6 A;  1J5E Q;  2E2D C;  3DWA A;  2F0U A;  3PF5 A;  3PMF A;  4DR6 Q;  4F87 A;  2B2T A;  2C9O A;  5AFW A;  3WDN A;  4B3M Q;  4LF5 Q;  2EVB A;  3T4A C;  3TP8 A;  2NVX H;  5BN4 A;  1FL0 A;  3BYT B;  3MEH A;  5ELE A;  1PH7 A;  1CI3 M;  3ULL A;  2UUB Q;  2QGQ A;  1K73 C;  4IUQ A;  1YJW A;  2XWJ B;  4P74 A;  2IWH A;  2RA4 A;  3E9H A;  1QG7 A;  4G57 A;  4DV0 L;  1PRT F;  4CJ1 B;  1UEA B;  1STA A;  2A6E D;  2FJ2 A;  4ZKC B;  1G6P A;  5JPM C;  2UXB Q;  3IFD A;  3MFG A;  1TWH H;  3C1F A;  2L55 A;  3QJY A;  4MTK A;  4NPS A;  2JA7 H;  2K05 A;  3EJI A;  2HUG A;  2Q2H A;  4IJH A;  4RGN A;  3EQL C;  3TQY A;  5BR8 L;  4IFD I;  4FXD A;  4LF6 L;  1I94 L;  3CCQ A;  1XNQ L;  1I4X A;  1NMF A;  1XMO Q;  5EBD A;  1TY0 A;  1CQF A;  3HOZ G;  3MZ5 A;  4O1N A;  1FD7 D;  3BDC A;  2NWG A;  3IRB A;  5COY A;  1U5K A;  3BVM A;  3SEB A;  3BJU A;  2Z9H A;  1PRT C;  1TR5 A;  4K5W A;  1JR0 D;  1X6O A;  2HDM A;  1DOL A;  3TS2 A;  3GP7 A;  3C3L A;  2I5H A;  2QW7 A;  4Y7N B;  1VF7 A;  5IWA L;  4G7O C;  1V9P A;  5M5X B;  1FNW A;  1JIC A;  1HTL D;  5GAG C;  4QMG A;  1F2Z A;  2F0N A;  5BR8 Q;  2XIW A;  1Y8P B;  2HT1 A;  4LF6 Q;  3T16 A;  1I94 Q;  2BH8 A;  5FO8 B;  1JJ2 A;  1MHW C;  3MTS A;  1E0B A;  1K3B C;  1FYC A;  3E5S A;  3L2P A;  4IFD J;  4A3I G;  3GTK H;  1XMQ L;  1OXS C;  1GUT A;  3A56 A;  1NTG A;  2B29 A;  1CKM A;  1G91 A;  3GTL B;  3LWU A;  1PFN A;  1JCK B;  3TP7 A;  2AWO A;  4DV6 L;  3GTP B;  1T9H A;  5IWA Q;  5IGG A;  4B3R L;  3FEW X;  4ODG A;  3U4V A;  4YIJ A;  4G7H C;  4DV1 L;  1G8Z D;  4IAL A;  4TSS A;  5IYB G;  1HTP A;  2LKV A;  3A0J A;  2HHH L;  3I4N H;  1EFI D;  2O4X A;  4JI1 L;  1MD2 D;  2CW0 C;  5JEA H;  1Y1W B;  4NXN Q;  1EYA A;  2P5Z X;  3RZO B;  3P20 A;  4HMI A;  2IHE A;  4ZUI A;  3J81 L;  4JK1 C;  1QUQ B;  1BBW A;  3ERS X;  1E7Z A;  1EIH A;  2OQ0 A;  2LFN A;  2F0H A;  2L9H A;  1PTO D;  4TRD A;  2Y0S E;  3U4Z A;  4DV6 Q;  1IBK L;  5CBA E;  1U0L A;  4B3R Q;  3FPP A;  2R93 G;  2E75 C;  3PGZ A;  3I4M G;  3KDF A;  1ET6 A;  2IJ0 A;  4GN5 A;  2BA0 A;  2ZJQ A;  5JPN C;  1G2S A;  2HHH Q;  4RWS C;  5LMU Q;  4RMF A;  2EY6 A;  4CBV A;  1PVO A;  1ZYR C;  1II3 A;  2R93 H;  4BWG B;  2NVX B;  3A8I E;  1H9R A;  1G29 1;  5EAY A;  3F2B A;  4DR1 L;  3A55 A;  1KTK A;  1S5E D;  5FOB B;  2E2I H;  3J81 E;  3PIP A;  3J80 L;  1E24 A;  2WKD A;  1STB A;  1OXV A;  1ILQ A;  3HOV G;  1HZB A;  2UUC L;  2RF4 A;  1GOZ A;  3CPF A;  3T1H Q;  2R92 G;  4RCO A;  3EN2 A;  2DN8 A;  1IL2 A;  4GKK L;  1QCB D;  3CMA A;  1I3Q H;  3T53 B;  1MI2 A;  4CKB A;  4QIW E;  1Q46 A;  1A6X A;  1N32 Q;  2JA7 B;  4C56 C;  5C4Z A;  1GUW A;  5FO9 B;  3HOV H;  2QDL A;  3F1Z A;  1LTI D;  5J1Z A;  2N8N A;  2LMC B;  3VYT A;  4AIM A;  3HOX G;  4X64 L;  2ASB A;  2CFM A;  2EPB A;  4JI5 Q;  2J7Z A;  4DAY B;  1VQP A;  4QL5 A;  1W6J A;  4YY3 Q;  1PRT D;  1C8C A;  1XNR L;  1SYC A;  4A75 A;  4YCV A;  1O7Z A;  2ZTE A;  3J80 E;  4A3F G;  4DPG A;  3G7L A;  4LF9 L;  2UUC Q;  1SSO A;  1SMX A;  3HS0 C;  4H7B A;  3HOZ B;  1K83 H;  2L15 A;  2PI2 A;  3UDG A;  2RDG A;  4X65 L;  4I7A A;  2NB0 A;  5A2Q L;  1M8A A;  2VQF L;  4L6T B;  3IAY A;  4BA1 I;  3K6O A;  4YWK A;  2ALY B;  1XX8 A;  2VB2 X;  4BS9 A;  1TWC H;  3GTJ H;  1N9W A;  4KY7 A;  4CDF C;  3T51 B;  3PIO A;  1EYG A;  1XNR Q;  2IT1 A;  1EY5 A;  2B2Y C;  1KIX A;  1PV4 A;  3GTK B;  1RHP A;  4LF9 Q;  1SE2 A;  5ELB A;  3ND8 A;  3H0G G;  1XXG A;  1CK1 A;  2WB1 G;  3NBH B;  3OMG A;  3AFQ A;  1GUG A;  1HA5 A;  1WYD A;  4X65 Q;  1BKB A;  1STE A;  1X55 A;  3PIO 3;  2VQF Q;  4XT1 B;  4H0L C;  4QUC A;  4WRD A;  5A2Q E;  2EZV A;  2CCZ A;  1LT4 D;  2KHJ A;  1D1K A;  2CW0 D;  3I4N B;  2VUM G;  3NBI A;  4G4K A;  1GO3 E;  2R7Z G;  2GVB A;  1Q7Y C;  3HFZ B;  4PQX A;  1ILP A;  1AP0 A;  5CGK A;  2YV5 A;  2FHT A;  2IW3 A;  2IX3 A;  1EQQ A;  3S1R H;  3Q24 A;  3H91 A;  5IGE A;  5HGQ A;  1L1O B;  2N78 A;  1TKW B;  4PNY A;  3F2D A;  2K5V A;  1LT6 D;  2MGS A;  2VUM H;  2R7Z H;  3U50 C;  3J80 i;  3HKZ G;  3A5U A;  1C48 A;  1H9S B;  1BVS A;  5ELD A;  4R4C A;  1Q1B A;  3NSW A;  2B2Y A;  2I07 B;  3S1M H;  4LW1 A;  1JOR A;  1JMC A;  1C9O A;  4HN7 A;  1V1P B;  3X3M A;  1GD7 A;  3T13 A;  3NEN A;  2B63 G;  4A3B G;  2F1M A;  3D3R A;  4RHR A;  1E3P A;  5DEH A;  2R93 B;  4POG A;  1Q8K A;  3I4M B;  4JI0 L;  1JWM D;  4EX5 A;  2E2J H;  2BDN A;  2E2I B;  3PUX A;  2V4D A;  2HCC A;  1PYW D;  1NR2 A;  2ZT9 C;  4DUY L;  2SOB A;  4DV5 L;  4A3B H;  5C44 G;  1VCI A;  5GAD C;  2F0M A;  1DCZ A;  3GDE A;  2CQO A;  3CW2 C;  3M7G A;  2ID0 A;  4HCE A;  4HID A;  1NAP A;  4GKJ L;  5IYD G;  1O80 A;  1GUN A;  1IHZ A;  1L2F A;  1I3Q B;  4DR5 L;  3JAM c;  4FP5 D;  2DNC A;  5D65 A;  1PH8 A;  5CV6 A;  2R3Z A;  1X3P A;  4ZLT F;  5C5L A;  2OF1 A;  3HOV B;  1GUS A;  2HIV A;  2R92 B;  5IYD H;  5FJ8 G;  1HXY D;  2KUM A;  4KKU A;  4EQ5 A;  3PV0 A;  1DON A;  2E2H B;  1HFG A;  1E2V A;  4DAP A;  4DV5 Q;  5T1G A;  4BBR H;  1F77 A;  1H9J A;  4DNR B;  3ONA B;  4J15 A;  1IKL A;  1V1Q A;  1SJH D;  2K52 A;  1V8Q A;  4GKJ Q;  5IP7 G;  1VS0 A;  4DU9 A;  4YWM A;  5G3L F;  1IW7 C;  2ICI A;  2L11 A;  1K83 B;  1CKN A;  2SEB D;  2F03 A;  4JBW A;  3CF5 A;  1EZ6 A;  2DJF C;  2DUD A;  3KBX A;  3JAM i;  2AWN A;  3U58 A;  1HR0 Q;  3VDY A;  2A1A A;  2JA8 G;  2ZJP A;  4UY8 C;  2O2L D;  2EOT A;  2BH2 A;  1TWC B;  1LTB D;  2EQS A;  1EIY B;  3GTJ B;  2EY1 A;  1BCP D;  3EVQ A;  2A73 B;  4JYA Q;  2ZM6 Q;  2XN9 C;  2YTY A;  3K80 C;  2HCI A;  1HCZ A;  2JA8 H;  2DY7 A;  2FMM A;  1X56 A;  1PLF A;  3RZD H;  1KNA A;  1TWF H;  3H6M A;  3RR5 A;  1Q12 A;  1D8L A;  3RMH A;  3VYU A;  1PDQ A;  1Y1V G;  2EE1 A;  4XIG S;  1R4Q B;  5J22 A;  3L9A X;  4DA2 A;  2XNA C;  5FO7 B;  3OYY A;  2RHS B;  4WJW A;  3CKI B;  5KYL A;  2NVT H;  1Y8O B;  3FHW A;  1FVI A;  2WB1 B;  2K5Q A;  1YNN C;  5IOC A;  2UU9 Q;  1Y1V H;  1AW7 A;  4MZ9 A;  1QNK A;  3BVG A;  4FVM A;  5GQO A;  4JBJ A;  4H13 C;  1LT3 D;  1I4R A;  2E74 C;  2N88 A;  3D8G A;  4N8X 1;  2KQ3 A;  1A3T A;  2OTL A;  3S1R B;  3PF4 A;  3RLO A;  5I9O A;  2Y0S G;  5GAH C;  5AJ3 L;  2G9D A;  1E22 A;  3RLF A;  4R8N A;  4ALP A;  2JA5 G;  2ZTD A;  1W6K A;  3VR5 A;  2VUM B;  4XYO A;  1QUQ A;  2R7Z B;  2IPK D;  4DUZ L;  3M4O H;  1SYD A;  4BBS G;  3RLN A;  3CQZ H;  3EIV A;  3S1M B;  2D0O A;  1U4M A;  1AZP A;  4KLK A;  1OXU A;  5CMD A;  3FMC A;  1I6V C;  3HKZ B;  5HY6 A;  1VQM A;  2B2W C;  1LT5 D;  5CV8 A;  3TBI B;  1QWY A;  3M3Y H;  4BBS H;  3KF8 B;  1M90 C;  5C4X G;  3OPO A;  4CHT B;  5AJ3 Q;  1EUJ A;  1BBU A;  2CHB D;  2E2J B;  5EQ0 A;  5KRU A;  5LMN W;  4A3E G;  4EQN A;  4A3B B;  2KBN A;  3K58 A;  3CXC A;  2O5J C;  3GD7 A;  5C4X H;  4A3M H;  4R1J A;  2ICE C;  3CC2 A;  2K7V A;  4B3T L;  3E0E A;  1SNO A;  4EQP A;  5CV9 A;  1Q8I A;  2KOL A;  3P1H A;  5C44 B;  1ICF B;  2BCO A;  1SRO A;  2MNA A;  2M00 A;  2PW5 A;  1Z47 A;  1VQ6 A;  3I4L A;  1F9P A;  2AQ3 B;  1NMG A;  5KNC A;  4X3S A;  5ELO A;  2UXD L;  5M5W B;  3PQI A;  3A7A B;  4DAM A;  4BBR B;  1SFO H;  1EY7 A;  2OQK A;  1EY6 A;  3ERQ A;  3TP6 A;  1X9N A;  1IW7 D;  2MFI A;  3NUC A;  4B3T Q;  5GRO A;  3MA2 B;  5K5P A;  1Q1E A;  1KDB A;  2F4V Q;  4DV7 L;  2XWB B;  4A93 G;  1WVL A;  4A3D G;  3D4W A;  1KHI A;  3W1B A;  2Z4H A;  3BS1 A;  1L1O C;  4HJ9 A;  1AE3 A;  1Y69 U;  1X3F A;  1W2B A;  3OMC A;  2SNS A;  4WJ3 M;  1S5D D;  2DY8 A;  1DD2 A;  2KCC A;  2RKS A;  1PZJ D;  2A8V A;  4A93 H;  1KRS A;  2K33 A;  1DOM A;  2V1C C;  1TII D;  3CCV A;  3MXP A;  1NJI C;  1TXY A;  5G3L D;  2JA8 B;  5IP9 G;  3RZD B;  2Q2U A;  3NHH A;  1O78 A;  1B3Q A;  1SYE A;  1J9O A;  2UXC L;  1AH9 A;  5I6Y A;  4BA2 I;  1SYB A;  4FNF A;  5I6W A;  2IX1 A;  4LUZ A;  3Q0A A;  4K0K Q;  1RF2 D;  4DV7 Q;  1D2B A;  4R4I A;  3CCS A;  2GVA A;  1P16 A;  2NVY B;  1K0R A;  2NVT B;  1GKH A;  1KAA A;  1B2T A;  3JC6 6;  4JBM A;  2VNU D;  1Y1V B;  4HJA A;  3K8A A;  2C35 B;  2CVR A;  1K8A C;  5DAU A;  4UDU C;  1Q86 C;  2F0D A;  2JQO A;  1VMP A;  1STN A;  1GVP A;  2FIN B;  2NN6 G;  1CSQ A;  1FGU A;  2OWO A;  1A15 A;  4EVO A;  2VXW A;  3KLS A;  3M4O B;  3I56 A;  1JOQ A;  2PZW A;  1PHJ A;  4Y52 H;  1QE6 A;  1RCV D;  3CQZ B;  2Y0S B;  1MSG A;  4PG3 A;  1E1O A;  2A69 D;  4IPD A;  4C3H G;  2F3W A;  1ESR A;  5I4D A;  2YU9 H;  5JAV A;  1SNM A;  1V1P A;  1MSH A;  3IL8 A;  5JVH 3;  3M3Y B;  1JJG A;  4BBS B;  3UE0 A;  3Q23 A;  5M5Y H;  3HKS A;  3D0F A;  1TQO A;  4MNO A;  4PMW A;  4IOA A;  2OCE A;  3K0Y A;  3NQT A;  1NUC A;  1YNJ C;  2X6L A;  4IJL A;  1YIT A;  2O5I C;  1CT1 D;  3TP5 A;  4L5T A;  2QF7 A;  4ULL A;  3S2H H;  5C4X B;  4A3M B;  4HR7 B;  4FYD A;  3PO3 G;  2VZA A;  1M4V A;  1PH3 A;  4A3E B;  1XTD A;  5FKA C;  3VR4 A;  3K7A B;  2Z6K C;  4QIW B;  3PO3 H;  4FF2 A;  1SNQ A;  4IPH A;  3VR2 A;  1P8L A;  4A76 A;  2E5L L;  1HUN A;  3C2P A;  1HQM C;  2KEE A;  2L1B A;  5EBC A;  3SK6 A;  1XYI A;  2MJ8 A;  3BU2 A;  4DV0 Q;  1SFO B;  2PQE A;  4K8I A;  2VW9 A;  1ZXT A;  3FVQ A;  2EXD A;  1ICW A;  3HOZ H;  3DEO A;  2JEB I;  1Y8N B;  4IZ8 A;  3E0J A;  1E1T A;  3R8B A;  1HFN A;  5JOB A;  4AH6 A;  4RGM A;  1LAC A;  4LJZ C;  1WD1 A;  1DM0 B;  4FO2 A;  2PI2 E;  3L0O A;  2EY2 A;  4WJ4 A;  2F0V A;  4FXG C;  3RUZ A;  3SK5 A;  1X3Q A;  1XNQ Q;  4KKS A;  3A54 A;  3K0X A;  1CZW A;  1CQV A;  1NCV A;  4A93 B;  1DGS A;  3NP8 A;  5EPJ A;  3I55 A;  5E1F A;  5FLM G;  2E76 C;  4Q5V A;  1LTT D;  2Z6K A;  5CV7 A;  1SYG A;  1IYU A;  3J7A F;  4R8I A;  3KLR A;  4A3I H;  1BQQ T;  4CDC C;  4JI2 L;  2QCP X;  4O2D A;  5FLM H;  4LFB L;  2JSO A;  1TWA B;  1FR3 A;  4XXE A;  2B3G A;  4A4I A;  5I9P A;  2L12 A;  4LNQ A;  4IUP A;  1S5F D;  2F0G A;  1SE8 A;  4JVZ A;  5NUC A;  4U68 A;  3NEL A;  1R9T H;  2XVS A;  2YYZ A;  4HSP A;  5T1I A;  1XMQ Q;  1HNW L;  4KHV A;  4RFB A;  3K81 C;  1A2U A;  2F0F A;  5IYB H;  1OO9 B;  3CC4 A;  1EU4 A;  2DGY A;  2NTT A;  2CH4 A;  3H94 A;  3W5O A;  2EYH A;  3CPW A;  2QA4 A;  4OL7 A;  4GN4 B;  1HH2 P;  4JW0 A;  4OGQ C;  2B8G A;  2WAQ G;  4JI3 L;  4LFB Q;  5K36 G;  1PZK D;  5M3F G;  4DV1 Q;  2K50 A;  1GJX A;  1EIF A;  1OTC A;  2N49 A;  2VS1 A;  4IUT A;  4HJ5 A;  1OXX K;  3CME A;  3CCR A;  2YU9 B;  3DWQ A;  4JI1 Q;  5KEE A;  1VQH A;  4JC0 A;  3D4R A;  3MXG A;  2G5D A;  2BOS A;  4OWW B;  1HNW Q;  1F2M A;  3I4M H;  5M5Y B;  1S5B D;  2GN5 A;  3DM3 A;  1BNZ A;  3NPP A;  1MBY A;  1YNJ D;  4C3H B;  1VQ5 A;  4P72 A;  1IYJ B;  3TME A;  3QG1 A;  2AHO B;  4HAE A;  1IBK Q;  1RL2 A;  5C3E G;  2JA6 G;  3S2H B;  4MIU A;  5C4J H;  1RTO A;  3PUY A;  4LUO A;  3V96 A;  1RJT A;  3HGB A;  3UI2 A;  1Z9F A;  1DOK A;  1BBX C;  5ELC A;  2ZXO A;  4YHH L;  1TWG H;  3CAM A;  2H4O A;  2B2U C;  2PQA A;  1KRT A;  2R92 H;  3RD4 A;  3PO3 B;  4DR1 Q;  3KUP A;  2E2H H;  5BN3 A;  1HQR D;  2EYF A;  3D6W A;  4QUF A;  3KF6 B;  5CV4 A;  1YNX A;  3EA6 A;  3KJP A;  3K5M A;  2PNH A;  3D4D A;  3HOX H;  1BCP F;  1JE5 A;  2K5N A;  3BZC A;  4GKK Q;  3E3X A;  4NXM L;  4HIK A;  3PO2 G;  4C3J G;  1N8R C;  1G2T A;  1ET9 A;  3AMU A;  4YHH Q;  4L5R C;  4A3F H;  2MO1 A;  3KLS X;  4B9W A;  4P71 A;  4X64 Q;  2CWP A;  2I0Q A;  5EPK A;  3PO2 H;  3PCO B;  3S17 H;  4N9T A;  4HTH A;  1I5F A;  4ZRZ A;  1IBL L;  1N36 L;  1STY A;  1WTP A;  5JVG 3;  3A74 A;  5ELN A;  3A5Z B;  2LS0 1;  1BCP C;  2EIF A;  3HEJ A;  4NXM Q;  3MEF A;  4K5X A;  2B2U A;  4BY7 G;  1JWU D;  2LSS A;  4GLA C;  3HOY G;  3BZK A;  3ERO A;  4X3T A;  2RVL A;  2J0T D;  4LFC L;  4HJ7 A;  4A3I B;  1Q90 A;  1IZ6 A;  3JAM L;  3I73 A;  3H0G H;  3WOE A;  2IL8 A;  4ABN A;  1LTG D;  3NE5 B;  3KYH C;  3U9S A;  3T56 B;  4KHP L;  2AUK A;  2F0T A;  1F9R A;  1B50 A;  1H9K A;  1R9T B;  1GM5 A;  1EY9 A;  3ICE A;  2FFK B;  4DR4 L;  4DR7 L;  4PZ6 A;  5IT9 c;  1VQC A;  1ZEQ X;  5EGT A;  3ULP A;  1HHV A;  4X62 L;  2JK8 A;  1QVG A;  1VQN A;  4DF7 A;  2HD3 A;  1WTO A;  4LFC Q;  4OXP A;  1H95 A;  4MN3 A;  4DXG A;  2H5X A;  4RH6 A;  4V19 0;  5C3W A;  3JAM E;  1HNX L;  1G6Z A;  5E3F A;  2WAC A;  1SR3 A;  3CP0 A;  2MO0 A;  2CWA A;  4KHP Q;  3MHB A;  3ULJ A;  4NKL A;  4CGY B;  2EJM A;  4ZQ3 A;  1B1Z A;  2XRS D;  3CC7 A;  4DXF A;  1K3R A;  1SN8 A;  2QKI C;  4XQQ A;  4UHV A;  3ZJY C;  1D5X C;  1XWE A;  4PZ8 A;  4X62 Q;  1F2L A;  1CTM A;  3NEM A;  2B63 H;  3OOC A;  4I65 A;  2ENB A;  4CDE C;  3TRE A;  3LX0 A;  4AYB G;  5KGU A;  4JOI C;  3DLL A;  4X3U A;  3QIA A;  1UE1 A;  5C4J B;  4DN4 M;  3A8K E;  1UWV A;  1QOH A;  1EYD A;  1X54 A;  4ME5 A;  4O42 A;  5C44 H;  3TN2 A;  1D5M C;  3NQI A;  2A5H A;  4GLV B;  2VB3 X;  1TWG B;  3OHX C;  5CC4 A;  5FLX c;  2RCF A;  4JI0 Q;  4RKL A;  5GAE C;  2OXP A;  1EEF D;  4KK7 A;  4JI6 L;  5M5W H;  1S40 A;  2C5C A;  3F2C A;  4DUY Q;  2ATW A;  2WIN B;  3HOX B;  5FJ8 H;  2R61 A;  1NNX A;  1ENF A;  3I70 A;  1WCM G;  3STB C;  2ZJR A;  3MWY W;  4LMQ D;  4JI4 L;  1NBW A;  2AMC B;  1YIJ A;  5H1S E;  4DR5 Q;  5C0X G;  4RGT A;  4DK6 C;  1OXT A;  2PMZ E;  1YBY A;  2LXJ A;  4YWL A;  1AN8 A;  4A3F B;  4JPB W;  2M9V A;  1WCM H;  4FXK C;  5IP7 H;  3PO2 B;  4XQN A;  4QGU A;  5C0X H;  2F0O A;  1WOC A;  3S17 B;  2MUY A;  2NBF A;  4JI6 Q;  3H3V H;  2Z1C A;  4JI8 L;  1QJO A;  5KYI A;  4XDX A;  1VMC A;  4U67 3;  1VQ8 A;  3K5O A;  1L0X B;  2N55 A;  1Q81 C;  2KHS A;  4XQJ A;  1S5C D;  2F0Q A;  5I2Y A;  2VY3 A;  1TS2 A;  4P2C B;  2IX0 A;  4JI4 Q;  1EWH A;  1PA6 A;  1A62 A;  4TVA B;  3K5L A;  1HZA A;  5IGD A;  4LFA L;  1VQD A;  3Q6S A;  3S16 H;  1JC7 A;  4A3J G;  4H44 C;  4ME3 A;  3H0G B;  2F0P A;  2NVY H;  3K7U C;  1SE4 A;  5LMN L;  5M3M G;  1L0W A;  3E9I A;  1SEB D;  2EYM A;  3A8J E;  4JI8 Q;  3HOY B;  1B53 A;  1EU3 A;  5IGC A;  3NWT A;  3DM1 A;  3R3O A;  4IO9 A;  4WOR A;  4IPG A;  3V05 A;  3KJO A;  1CA5 A;  4AQY L;  3KLW A;  3SVM A;  3J7A 5;  3SHL A;  3I7F A;  1SND A;  3G48 A;  1SDF A;  2XGT A;  1EYC A;  4LFA Q;  5C5M A;  3QOJ A;  1TS5 A;  4F8M A;  5E4W C;  1WD0 A;  1HNZ L;  1BDO A;  3E6Z X;  1DJR D;  1I4Q A;  2RCN A;  4R4Q A;  2JA5 H;  5LMN Q;  4LF7 L;  3DEP A;  1RKN A;  2WAQ E;  4P75 A;  2M2L A;  2MQH A;  3AQQ A;  2A69 C;  3G6E A;  1I50 H;  1IKM A;  1LM0 A;  2I5L X;  3SK4 A;  2NZ1 D;  2N3S A;  1BXT A;  3OTO L;  1EOV A;  3K57 A;  1K8G A;  1I4G A;  2TMP A;  5C4H A;  1BOS A;  2B63 B;  2KCM A;  1LV9 A;  1NR4 A;  2XTI A;  4DUZ Q;  3CD6 A;  3HOW G;  1VF5 C;  1WJJ A;  1VQ7 A;  3H09 A;  1HNZ Q;  1FJG L;  2JJQ A;  3DWP A;  1GUO A;  1LYL A;  3KFU A;  3LGJ A;  1EY8 A;  4FF1 A;  4KMU C;  1SBB B;  4A3E H;  3K7A H;  1B9M A;  1D1I A;  1C7Y A;  2NYZ D;  2HQL A;  3DMU A;  3EFX D;  4QF4 A;  4ZKB B;  2Z0S A;  4OEM B;  4TQU S;  1PYB A;  2K5W A;  4DV4 L;  3M4Y A;  3A7L A;  1ENA A;  4DAY A;  3KK7 A;  1YZ6 A;  4Q0F A;  3STB D;  2K28 A;  4KD3 A;  1I6H B;  4QCL A;  1KC8 C;  3KF6 A;  4JV5 L;  2EDG A;  2B2W A;  4DV3 L;  1SNC A;  1CA6 A;  2PYK A;  2PNR C;  3NWS A;  3UDX A;  1UNS A;  1WCM B;  4XYQ A;  4OIJ A;  3GTO H;  1HPC A;  1A8V A;  1U4P A;  3QOL A;  2ZXR A;  1EY0 A;  4A3L G;  1QB5 D;  2UXD Q;  1TS3 A;  2AKW B;  3SXH A;  4NMZ A;  4L8J A;  2PCF B;  5JJI A;  4ZCK A;  3RN5 A;  4A3D H;  1VDZ A;  2YTX A;  4JV5 Q;  1CFM A;  2G9H D;  2K75 A;  4DV3 Q;  4KJN A;  3K5N A;  3NTK A;  4RCN A;  3UDF A;  5JJZ A;  1IL8 A;  2NZH A;  4DV2 L;  3MVV A;  3PSI A;  1PZI D;  4LWC A;  4DR3 L;  3OSO A;  3S16 B;  3NBH A;  1PFM A;  1TWA H;  4KHZ A;  5IP9 H;  1QVF A;  2Z6B A;  4GS3 A;  5J3B A;  4HIO A;  4DKA C;  4ILW A;  1TS4 A;  2CQA A;  2TSS A;  4YCW A;  1DYQ A;  2B39 A;  2K32 A;  4HSV A;  1V1O A;  4OWX B;  3S14 H;  3BDO A;  3C46 A;  5EJW A;  4B08 A;  5EKL A;  4DGZ A;  5M3M B;  3M4P A;  5IY0 A;  4A3C G;  4ZAI A;  2UXC Q;  1TVX A;  2KED A;  4IOC A;  3R2I A;  1K0S A;  1L1O A;  3P75 A;  1J5E L;  4DV2 Q;  1K8M A;  2KEN A;  5DM7 3;  4BXX G;  1NY4 A;  1B9N A;  1KD1 C;  1H9S A;  5CYU A;  5C0X I;  1BF4 A;  2XRQ D;  4B3M L;  2JA5 B;  4LF5 L;  2NN6 H;  3H3V I;  1AE2 A;  1EQV A;  2BE5 C;  1HRJ A;  2OT2 A;  3MAQ A;  4A3K G;  1IBM L;  2UUB L;  4ZYS A;  2B8F A;  4EGV A;  1I50 B;  2QEJ C;  4BXX H;  2CH4 W;  4C3H H;  1UE6 A;  2LXK A;  3M7N A;  1O7I A;  2KVM A;  3AU7 A;  4KN7 C;  1SJE D;  2UXB L;  1RIP A;  2LY7 A;  3MC0 B;  1G51 A;  4GLX A;  1QZH A;  4AYB E;  2AQ2 B;  2R7F A;  3HOW B;  3HZX A;  1IBM Q;  4HMJ A;  1XMO L;  2PPB C;  4TKO B;  5C0X J;  2RDF A;  3P7J A;  3GO5 A;  2KJX A;  1WTV A;  2JA7 G;  2K5D A;  1VQL A;  3TEH B;  1EWC A;  1QZG A;  5EKK A;  2EYL A;  1LTR D;  2D5D A;  4OIK A;  2PZT A;  3BDL A;  4I7Z C;  3N52 A;  3QB3 A;  1CHQ D;  4K2K A;  5L37 A;  2JP1 A;  1CZG A;  3WWV A;  4C3I G;  4K14 A;  1PXU A;  1B44 D;  1HUM A;  2X69 A;  1V43 A;  5I2X A;  3FP9 A;  3MXN B;  4C2M H;  3GTO B;  1F9S A;  4OWT B;  2BA1 A;  5ISR A;  1D5Z C;  2E5L Q;  1Z7T A;  4C3I H;  3GTQ H;  1CKN B;  2D2C C;  3TS0 A;  5HUR A;  2F0S A;  3H15 A;  4A3D B;  1KXL A;  2K1B A;  1SXT A;  2HQE A;  2WV6 D;  3L7Z C;  4K6D A;  5COR A;  4KY5 A;  1M1K C;  4JI7 L;  1X65 A;  5A35 A;  1FNU A;  2A19 A;  5IIF A;  3GTM B;  3O13 A;  4RG1 A;  3L3O C;  3NTI A;  4NXN L;  1ZKO A;  3G71 A;  1RD9 D;  2MHV A;  1BR9 A;  3AYH B;  3TRZ A;  2KA7 A;  3I4N G;  1EEI D;  2Q2T A;  4MHE A;  4PV1 C;  4GZY C;  1A3U A;  4X3K A;  3S14 B;  3KBG A;  3CCU A;  2MPM A;  5JEA G;  2BDO A;  1S3O A;  1LAB A;  3I3C A;  4FF4 A;  3CRK C;  3GQB A;  2K4K A;  4JI7 Q;  4RA8 A;  1Q82 C;  1KAB A;  4M1U B;  2EJG C;  2PO4 A;  5KND A;  4JI2 Q;  2RSN A;  1QIL A;  5CV5 A;  4DK3 C;  3ER0 A;  4IN3 A;  5LMU L;  1EQR A;  2EJF C;  1GXD C;  2BE5 D;  1B70 B;  5EPL A;  1AFP A;  1VQB A;  4LF4 L;  4R4O A;  5IE8 A;  1JB3 A;  5J39 A;  3M85 A;  1UE5 A;  1JE4 A;  3IFT A;  2UUA L;  1C0A A;  2L4N A;  5K36 H;  5CR3 A;  5M3F H;  5IYC G;  4B3S L;  2KHI A;  1AEX A;  2F0I A;  1F9Q A;  1CHP D;  3KF8 A;  3T1H L;  4WFN 3;  4GOP B;  5JJK A;  1J8I A;  1E2Z A;  4A3K B;  4OO1 G;  5JJL A;  1YEZ A;  4KN4 C;  4PMC A;  3M4Q A;  5IYC H;  1N32 L;  3FDT A;  4KKT A;  4JI3 Q;  3AFP A;  3V2T A;  3W1G A;  3H3V C;  1Z6H A;  2D0P A;  4LF4 Q;  3G6J B;  4JI5 L;  2OTJ A;  4OO1 H;  3J7Z C;  2A74 C;  5C3E H;  2JA6 H;  2UUA Q;  1B3A A;  3S1Q H;  1K8O A;  3VYR A;  4YY3 L;  1E2W A;  3T1Y L;  4K5V A;  3B6Y A;  4B3S Q;  4L5S A;  2L0C A;  1TU2 B;  2Q8T A;  2WII B;  1X32 A;  4IPC A;  4NDX A;  1MJE A;  4V0B A;  3X3N A;  2I46 A;  5IT9 L;  2E8G A;  2ZTC A;  2R7D A;  3ND9 A;  1HZ9 A;  2AQ1 B;  1TWH B;  4YCU A;  2QDB A;  1CSP A;  3VYS A;  3PIP 3;  4GNX B;  1WFQ A;  2NN6 I;  1QNU A;  1PTO H;  1PH4 A;  2Q2I A;  1JB7 A;  1IYV A;  2OEO A;  1SYF A;  4APV A;  2D9U A;  2I5M X;  3PUW A;  4X66 L;  2WFW A;  3OWF A;  2PMZ B;  3T1Y Q;  3J81 c;  3R2T A;  4C3J H;  4C2M B;  4KV6 A;  1JJC B;  2QIL A;  1PYS B;  1HZC A;  4IUN A;  3GTG H;  1WI5 A;  3I90 A;  4C3I B;  4R9W A;  2K14 A;  3GTQ B;  1BO0 A;  3KOJ A;  1VQ4 A;  1B7Y B;  1CM9 A;  5IT9 E;  3MXU A;  3FKI G;  2K01 A;  1T5X D;  3VA5 A;  1NSN S;  4S3S A;  1KNE A;  1QVC A;  4J6H A;  4DAV A;  3I8Z A;  3C1E A;  4R4T A;  1LO5 D;  1I4P A;  1IXR A;  1EQT A;  2RDH A;  1JQY D;  4N8F A;  4RGO S;  1ML0 D;  2KCN A;  1Y14 B;  4X66 Q;  3FKI H;  2FXQ A;  2EY5 A;  4CDD C;  1K28 A;  1STH A;  3CHB D;  2H1E A;  3Q22 A;  4QJF A;  4BY7 H;  2D62 A;  1FGB D;  1T5E A;  4ZUJ A;  1H9M A;  3G4S A;  2MP1 A;  4A3G G;  2F3I A;  5FLX L;  3J80 c;  1IBL Q;  2EYP A;  3HOY H;  1N36 Q;  1L0Y B;  3J81 i;  3OW7 A;  2F0K A;  3F2U A;  3DUZ A;  3S15 H;  1VQG A;  2L5T A;  2Q8R E;  3NTH A;  1JT8 A;  4DK0 A;  4IUV A;  5LHY 1;  4A3G H;  1XJV A;  4EQO A;  1X3E A;  1EOT A;  3SK8 A;  4J8Q A;  4P73 A;  3MFY A;  1MIU A;  4XTC S;  2PW7 A;  1RDP D;  2YTV A;  3NK9 A;  5C6A A;  4DR2 L;  5IGB A;  1ESF A;  2K04 A;  2F4I A;  1XPR A;  5ELF A;  1UEB A;  2B2V C;  2JYO A;  4M8A A;  4BY1 G;  5DM6 3;  1CUK A;  1WTW A;  3I4O A;  2JEA I;  1EWI A;  4NB3 A;  5FLX E;  1YHQ A;  2WAQ B;  2JN4 A;  4B9X A;  4DR4 Q;  4QB4 A;  4DR7 Q;  5M3F B;  4HJ8 A;  4K8J A;  1ONL A;  4OON A;  4BY1 H;  1GHJ A;  1PFS A;  5LL6 S;  1U4L A;  1B8A A;  4KY6 A;  5DNF A;  4DR2 Q;  1CKO A;  3BG3 A;  1A0I A;  2DJG C;  1KDC A;  1ZYR D;  4HIM A;  1HNX Q;  5BN5 A;  1UAP A;  1PH5 A;  4L5Q A;  2EYJ A;  4CKE A;  3VA7 A;  3I91 A;  3VR3 A;  3K59 A;  4GN3 B;  1EZ8 A;  2K5H A;  5C3E B;  2JA6 B;  5F2D A;  2DNE A;  1VQF A;  3S1Q B;  1S4Z A;  2QEX A;  2A68 C;  3QWN A;  3CCM A;  1EL0 A;  2F0L A;  4OHJ A;  4HCS A;  4UP9 A;  3DXJ C;  3DHQ A;  1I6H H;  2B2V A;  3OIP A;  2JXM B;  1VQE A;  2SNM A;  1SRU A;  2NVQ H;  1A3V A;  2WKC A;  2IY5 B;  4O0A A;  1XPU A;  3ITP A;  3S1N H;  4BBR G;  4QY7 A;  4KD4 A;  3OIQ A;  1ASY A;  1PTO B;  1HR0 L; 
#chains in the Genus database with same CATH homology
 4IUU A;  1JOK A;  4IUR A;  2K03 A;  2WP8 J;  4C3J B;  3FPU B;  4Z9C B;  4LK1 C;  3NXW A;  3MXN A;  3GTG B;  4KJO A;  2KEC A;  3SR1 A;  1DXM A;  1PFB A;  1R4P B;  1RTN A;  3FRP B;  4NP5 A;  2Q8I B;  3BZD B;  5D3D A;  4OO1 I;  1SE3 A;  2F0E A;  1Q3L A;  1DZ1 A;  5JEA J;  3FKI B;  1ROD A;  4K6L A;  3R93 A;  4G7Z C;  4BY7 B;  2RBM A;  3HRZ C;  4CJ0 B;  2RSO A;  3TZD A;  4CKC A;  4KI0 A;  3S15 B;  5IOD A;  2J4X A;  4ZK9 B;  2A6H C;  3N6R A;  2AUJ D;  2SDF A;  4A3G B;  1PRT B;  4LAA A;  1B4O A;  2JE6 I;  4IFD G;  1LTA D;  3J7Y W;  2F0W A;  5E4X A;  4RKB A;  3QO2 A;  1D6E C;  4FF3 A;  3IKJ A;  4IFD H;  1I4H A;  5KNB A;  3LNN A;  4NW2 A;  1AZQ A;  1A2T A;  1C4Q A;  1LLR D;  3PUV A;  1SMY C;  1O7L A;  1UUP A;  2PZU A;  3HP3 A;  4C1N K;  4BY1 B;  2ZXP A;  3D31 A;  4DFA A;  1LTS D;  3ZYY X;  1TT2 A;  5CBE E;  1WTR A;  3TZU A;  1ENC A;  1KLG D;  4PMB A;  4HED A;  5IGF A;  1HA6 A;  1PMR A;  3CU7 A;  2A68 D;  4AYB B;  3GV3 A;  3BVZ A;  2X6G A;  3LWE A;  1FNV A;  3D6C A;  4L63 B;  3U9O A;  4C1N I;  1WTQ A;  1BUV T;  2A6E C;  5D3I B;  4F88 A;  2NUC A;  2NVQ B;  1MGS A;  3S1N B;  1SAP A;  4ID6 A;  3SDZ A;  1XTC D;  2F3V A;  3S9W A;  5M9O A;  1O7Y A;  4DK1 A;  3SE0 A;  2HDL A;  5EKI A;  1U9R A;  5TSS A;  4DNT B;  1JWS D;  4RAU C;  2NTS A;  4E6I A;  2GA4 B;  3WOF A;  1KLU D;  2F0J A;  5LL6 X;  2EXZ A;  1KDA A;  3BYY B;  3TDQ A;  3W2D A;  2R6G A;  5D14 A;  3I72 A;  1EIG A;  3TSS A;  1STG A;  4UAI A;  5HGT A;  1JOO A;  2K6A A;  1EY4 A;  3OWE B;  4IQZ A;  3W3A A;  2XSC A;  2RQX A;  2A6H D;  2Z8L A;  4KTA A;  3J7A V;  2B2T C;  4A3J B;  1TWF B;  3PUZ A;  4K2L A;  3S2D B;  5KIX A;  4CJ2 C;  1F2Y A;  3HOU B;  1PTO F;  3GV6 A;  1YNN D;  3URY A;  4J1M A;  1GHK A;  4RHS A;  1TY2 A;  4F7X A;  3HG9 A;  2FMC A;  1U4R A;  2EYO A;  3CRL C;  3AB9 A;  5FK9 C;  1SMY D;  4N9P A;  5C3X A;  4XT3 B;  1WTX A;  1SNP A;  2Z4I A;  1PTO C;  1BCP B;  3VR6 A;  2E2D C;  3DWA A;  2F0U A;  3PMF A;  4F87 A;  2B2T A;  2C9O A;  5AFW A;  3WDN A;  2EVB A;  3T4A C;  3TP8 A;  5BN4 A;  3BYT B;  3MEH A;  5ELE A;  1CI3 M;  4IUQ A;  2XWJ B;  2IWH A;  2RA4 A;  1QG7 A;  4G57 A;  1PRT F;  4CJ1 B;  1UEA B;  1STA A;  2A6E D;  2FJ2 A;  4ZKC B;  5JPM C;  3IFD A;  3MFG A;  3C1F A;  2L55 A;  3QJY A;  2K05 A;  3EJI A;  2HUG A;  4RGN A;  3EQL C;  4IFD I;  4FXD A;  1I4X A;  5EBD A;  1TY0 A;  1CQF A;  3MZ5 A;  4O1N A;  1FD7 D;  3BDC A;  2NWG A;  5COY A;  3BVM A;  3SEB A;  1PRT C;  1TR5 A;  4K5W A;  1JR0 D;  2HDM A;  1DOL A;  3GP7 A;  3C3L A;  4Y7N B;  1VF7 A;  4G7O C;  5M5X B;  1FNW A;  1JIC A;  1HTL D;  4QMG A;  1F2Z A;  2F0N A;  2XIW A;  1Y8P B;  3T16 A;  5FO8 B;  3MTS A;  1E0B A;  1FYC A;  3E5S A;  4IFD J;  1OXS C;  1GUT A;  3A56 A;  1G91 A;  3GTL B;  3LWU A;  1PFN A;  1JCK B;  3TP7 A;  2AWO A;  3GTP B;  5IGG A;  3FEW X;  4ODG A;  4YIJ A;  4G7H C;  1G8Z D;  4IAL A;  4TSS A;  1HTP A;  2LKV A;  1EFI D;  2O4X A;  1MD2 D;  2CW0 C;  5JEA H;  1Y1W B;  1EYA A;  3RZO B;  3P20 A;  4HMI A;  4ZUI A;  3J81 L;  4JK1 C;  1EIH A;  2LFN A;  2F0H A;  2L9H A;  1PTO D;  4TRD A;  5CBA E;  3FPP A;  2E75 C;  1ET6 A;  2IJ0 A;  2BA0 A;  5JPN C;  1G2S A;  4RWS C;  2EY6 A;  4CBV A;  1ZYR C;  1II3 A;  4BWG B;  2NVX B;  3A8I E;  1H9R A;  1G29 1;  3A55 A;  1KTK A;  1S5E D;  5FOB B;  3J81 E;  3J80 L;  2WKD A;  1STB A;  1OXV A;  1ILQ A;  1GOZ A;  4RCO A;  2DN8 A;  1QCB D;  3T53 B;  1MI2 A;  4CKB A;  1A6X A;  2JA7 B;  4C56 C;  5C4Z A;  1GUW A;  5FO9 B;  1LTI D;  5J1Z A;  3VYT A;  2LMC B;  2EPB A;  2J7Z A;  1W6J A;  1PRT D;  1C8C A;  1SYC A;  1O7Z A;  3J80 E;  3G7L A;  1SSO A;  3HS0 C;  4H7B A;  3HOZ B;  2RDG A;  2NB0 A;  5A2Q L;  1M8A A;  4L6T B;  3IAY A;  4BA1 I;  3K6O A;  1XX8 A;  2VB2 X;  4BS9 A;  4KY7 A;  3T51 B;  2IT1 A;  1EY5 A;  2B2Y C;  3GTK B;  1RHP A;  1SE2 A;  5ELB A;  3ND8 A;  1XXG A;  1CK1 A;  3OMG A;  1GUG A;  1HA5 A;  1STE A;  3PIO 3;  4XT1 B;  4H0L C;  4QUC A;  4WRD A;  5A2Q E;  2EZV A;  1LT4 D;  1D1K A;  2CW0 D;  3I4N B;  3NBI A;  4G4K A;  1AP0 A;  4PQX A;  1ILP A;  5CGK A;  2FHT A;  2IW3 A;  2IX3 A;  3Q24 A;  3H91 A;  5IGE A;  1TKW B;  4PNY A;  2MGS A;  1LT6 D;  1C48 A;  1H9S B;  5ELD A;  1Q1B A;  3NSW A;  2B2Y A;  2I07 B;  1JOR A;  4HN7 A;  1V1P B;  3X3M A;  3T13 A;  2F1M A;  3D3R A;  4RHR A;  5DEH A;  2R93 B;  3I4M B;  1JWM D;  2E2I B;  2BDN A;  3PUX A;  2V4D A;  2HCC A;  1PYW D;  1NR2 A;  2ZT9 C;  2SOB A;  1VCI A;  2F0M A;  1DCZ A;  3M7G A;  2ID0 A;  4HCE A;  1NAP A;  1O80 A;  1GUN A;  1IHZ A;  1I3Q B;  4FP5 D;  2DNC A;  5D65 A;  5CV6 A;  2R3Z A;  1X3P A;  4ZLT F;  5C5L A;  2OF1 A;  3HOV B;  1GUS A;  2R92 B;  1HXY D;  2KUM A;  4KKU A;  3PV0 A;  1DON A;  2E2H B;  1HFG A;  1E2V A;  4DAP A;  5T1G A;  1F77 A;  1H9J A;  4DNR B;  3ONA B;  1IKL A;  1SJH D;  1V8Q A;  4DU9 A;  5G3L F;  1IW7 C;  2ICI A;  2L11 A;  1K83 B;  2SEB D;  2F03 A;  4JBW A;  1EZ6 A;  3KBX A;  2AWN A;  2O2L D;  2EOT A;  1TWC B;  1LTB D;  3GTJ B;  2EY1 A;  1BCP D;  3EVQ A;  2A73 B;  2XN9 C;  2HCI A;  1HCZ A;  2DY7 A;  2FMM A;  1PLF A;  1KNA A;  3H6M A;  1Q12 A;  3RMH A;  3VYU A;  1PDQ A;  2EE1 A;  4XIG S;  1R4Q B;  5J22 A;  3L9A X;  4DA2 A;  2XNA C;  5FO7 B;  4WJW A;  3CKI B;  5KYL A;  1Y8O B;  2WB1 B;  2K5Q A;  1YNN C;  5IOC A;  1AW7 A;  1QNK A;  3BVG A;  4FVM A;  4H13 C;  1LT3 D;  1I4R A;  2E74 C;  2N88 A;  3D8G A;  2KQ3 A;  1A3T A;  3S1R B;  5I9O A;  2G9D A;  3RLF A;  4R8N A;  1W6K A;  3VR5 A;  2VUM B;  4XYO A;  2R7Z B;  2IPK D;  1SYD A;  3S1M B;  1U4M A;  1AZP A;  1OXU A;  5CMD A;  3FMC A;  1I6V C;  3HKZ B;  2B2W C;  1LT5 D;  5CV8 A;  3TBI B;  1QWY A;  3OPO A;  4CHT B;  2CHB D;  2E2J B;  5EQ0 A;  5KRU A;  4EQN A;  4A3B B;  3K58 A;  2O5J C;  3GD7 A;  2ICE C;  2K7V A;  1SNO A;  4EQP A;  5CV9 A;  1Q8I A;  2KOL A;  3P1H A;  5C44 B;  2BCO A;  2M00 A;  2PW5 A;  1Z47 A;  3I4L A;  1F9P A;  2AQ3 B;  5KNC A;  4X3S A;  5M5W B;  3A7A B;  4BBR B;  1EY7 A;  3TP6 A;  1EY6 A;  3ERQ A;  1IW7 D;  3NUC A;  3MA2 B;  5K5P A;  1Q1E A;  1KDB A;  2XWB B;  1WVL A;  3D4W A;  3BS1 A;  2Z4H A;  1Y69 U;  3OMC A;  2SNS A;  1S5D D;  2DY8 A;  1DD2 A;  2KCC A;  2RKS A;  1PZJ D;  2K33 A;  1DOM A;  1TII D;  3MXP A;  2JA8 B;  5G3L D;  3RZD B;  3NHH A;  1O78 A;  1SYE A;  1J9O A;  5I6Y A;  4BA2 I;  1SYB A;  4FNF A;  5I6W A;  2IX1 A;  3Q0A A;  1RF2 D;  1D2B A;  2NVY B;  2NVT B;  1KAA A;  1B2T A;  2VNU D;  1Y1V B;  2CVR A;  5DAU A;  4UDU C;  2F0D A;  1VMP A;  1STN A;  2FIN B;  2NN6 G;  1A15 A;  4EVO A;  2VXW A;  3KLS A;  3M4O B;  1JOQ A;  2PZW A;  1QE6 A;  1RCV D;  3CQZ B;  2Y0S B;  1MSG A;  4C3H G;  2A69 D;  2F3W A;  1ESR A;  5I4D A;  5JAV A;  1SNM A;  1V1P A;  1MSH A;  3IL8 A;  5JVH 3;  3M3Y B;  4BBS B;  3Q23 A;  1TQO A;  4PMW A;  3K0Y A;  3NQT A;  1NUC A;  1YNJ C;  2X6L A;  2O5I C;  1CT1 D;  3TP5 A;  2QF7 A;  4ULL A;  5C4X B;  4A3M B;  4HR7 B;  4FYD A;  1M4V A;  4A3E B;  5FKA C;  3VR4 A;  3K7A B;  4QIW B;  4FF2 A;  1SNQ A;  3VR2 A;  1HUN A;  3C2P A;  1HQM C;  2KEE A;  2L1B A;  5EBC A;  3SK6 A;  1XYI A;  2MJ8 A;  1SFO B;  2PQE A;  4K8I A;  1ZXT A;  3FVQ A;  1ICW A;  3DEO A;  2JEB I;  1Y8N B;  4IZ8 A;  3E0J A;  3R8B A;  1HFN A;  5JOB A;  4RGM A;  1LAC A;  4LJZ C;  1WD1 A;  1DM0 B;  4FO2 A;  2EY2 A;  2F0V A;  4FXG C;  3RUZ A;  3SK5 A;  1X3Q A;  4KKS A;  3A54 A;  1CZW A;  1CQV A;  1NCV A;  4A93 B;  3NP8 A;  5EPJ A;  5E1F A;  2E76 C;  4Q5V A;  1LTT D;  5CV7 A;  1SYG A;  1IYU A;  3J7A F;  4R8I A;  3KLR A;  1BQQ T;  2QCP X;  2JSO A;  1TWA B;  1FR3 A;  4XXE A;  5I9P A;  2L12 A;  4IUP A;  1S5F D;  2F0G A;  5NUC A;  4U68 A;  2XVS A;  2YYZ A;  4HSP A;  5T1I A;  4KHV A;  4RFB A;  1A2U A;  2F0F A;  1OO9 B;  1EU4 A;  2NTT A;  3H94 A;  2EYH A;  4OL7 A;  4OGQ C;  2B8G A;  5K36 G;  1PZK D;  1GJX A;  4IUT A;  1OXX K;  2YU9 B;  3DWQ A;  5KEE A;  3D4R A;  3MXG A;  2BOS A;  1F2M A;  5M5Y B;  1S5B D;  1BNZ A;  3NPP A;  1MBY A;  1YNJ D;  4C3H B;  3TME A;  3QG1 A;  4HAE A;  3S2H B;  4MIU A;  1RTO A;  3PUY A;  3V96 A;  1RJT A;  3HGB A;  3UI2 A;  1BBX C;  1DOK A;  5ELC A;  2ZXO A;  2H4O A;  2B2U C;  3RD4 A;  3PO3 B;  3KUP A;  5BN3 A;  1HQR D;  2EYF A;  3D6W A;  4QUF A;  5CV4 A;  3EA6 A;  3K5M A;  3D4D A;  1BCP F;  4C3J G;  1G2T A;  1ET9 A;  3AMU A;  3KLS X;  4B9W A;  5EPK A;  4N9T A;  4HTH A;  4ZRZ A;  1STY A;  1WTP A;  5JVG 3;  2LS0 1;  1BCP C;  3HEJ A;  4K5X A;  2B2U A;  1JWU D;  3ERO A;  4X3T A;  2RVL A;  2J0T D;  4A3I B;  1Q90 A;  3JAM L;  3I73 A;  3WOE A;  2IL8 A;  4ABN A;  1LTG D;  3NE5 B;  3U9S A;  3T56 B;  2AUK A;  2F0T A;  1F9R A;  1B50 A;  1H9K A;  1R9T B;  1EY9 A;  2FFK B;  1ZEQ X;  5EGT A;  1HHV A;  4DF7 A;  1WTO A;  4MN3 A;  4DXG A;  4RH6 A;  4V19 0;  5C3W A;  3JAM E;  1G6Z A;  5E3F A;  2WAC A;  3MHB A;  4NKL A;  4CGY B;  2EJM A;  4ZQ3 A;  1B1Z A;  2XRS D;  4DXF A;  2QKI C;  4XQQ A;  1D5X C;  1XWE A;  1F2L A;  1CTM A;  3OOC A;  4I65 A;  2ENB A;  3LX0 A;  5KGU A;  4X3U A;  3QIA A;  5C4J B;  4DN4 M;  3A8K E;  1QOH A;  1EYD A;  4ME5 A;  4O42 A;  3TN2 A;  1D5M C;  3NQI A;  2A5H A;  2VB3 X;  1TWG B;  3OHX C;  5CC4 A;  4RKL A;  2OXP A;  1EEF D;  4KK7 A;  2C5C A;  2WIN B;  3HOX B;  2R61 A;  1ENF A;  3I70 A;  3MWY W;  4LMQ D;  5C0X G;  4RGT A;  1OXT A;  1AN8 A;  4A3F B;  2M9V A;  4FXK C;  3PO2 B;  4XQN A;  5C0X H;  2F0O A;  3S17 B;  2MUY A;  2NBF A;  2Z1C A;  1QJO A;  5KYI A;  4XDX A;  1VMC A;  4U67 3;  3K5O A;  1L0X B;  2N55 A;  2KHS A;  4XQJ A;  1S5C D;  2F0Q A;  5I2Y A;  1TS2 A;  4P2C B;  2IX0 A;  1EWH A;  3K5L A;  5IGD A;  3Q6S A;  1JC7 A;  4H44 C;  3H0G B;  2F0P A;  1SE4 A;  1SEB D;  2EYM A;  3A8J E;  3HOY B;  1B53 A;  1EU3 A;  5IGC A;  3NWT A;  3DM1 A;  3R3O A;  4WOR A;  3V05 A;  1CA5 A;  3SVM A;  3SHL A;  1SND A;  1SDF A;  1EYC A;  5C5M A;  3QOJ A;  1TS5 A;  4F8M A;  5E4W C;  1WD0 A;  1BDO A;  3E6Z X;  1DJR D;  1I4Q A;  3DEP A;  1RKN A;  2M2L A;  2A69 C;  1IKM A;  3SK4 A;  2NZ1 D;  1BXT A;  3K57 A;  1I4G A;  2TMP A;  5C4H A;  1BOS A;  2B63 B;  1LV9 A;  1NR4 A;  1VF5 C;  3H09 A;  3DWP A;  1GUO A;  1EY8 A;  4FF1 A;  4KMU C;  1SBB B;  1B9M A;  1D1I A;  2NYZ D;  3DMU A;  3EFX D;  4QF4 A;  4ZKB B;  4TQU S;  2K5W A;  3M4Y A;  3A7L A;  1ENA A;  4DAY A;  3KK7 A;  4Q0F A;  2K28 A;  4KD3 A;  1I6H B;  4QCL A;  2EDG A;  2B2W A;  1SNC A;  1CA6 A;  2PYK A;  2PNR C;  3NWS A;  1UNS A;  1WCM B;  4XYQ A;  4OIJ A;  1HPC A;  1U4P A;  3QOL A;  2ZXR A;  1EY0 A;  1QB5 D;  1TS3 A;  3SXH A;  4NMZ A;  4L8J A;  2PCF B;  1VDZ A;  1CFM A;  2G9H D;  4KJN A;  3K5N A;  3NTK A;  4RCN A;  5JJZ A;  1IL8 A;  3MVV A;  1PZI D;  3OSO A;  3S16 B;  3NBH A;  1PFM A;  4KHZ A;  4ILW A;  1TS4 A;  2CQA A;  2TSS A;  1DYQ A;  2B39 A;  2K32 A;  4HSV A;  1V1O A;  3BDO A;  3C46 A;  5EJW A;  4B08 A;  5EKL A;  4DGZ A;  5M3M B;  4ZAI A;  1TVX A;  2KED A;  3R2I A;  3P75 A;  1K8M A;  5DM7 3;  1B9N A;  1H9S A;  5CYU A;  5C0X I;  1BF4 A;  2XRQ D;  2JA5 B;  2NN6 H;  1EQV A;  2BE5 C;  1HRJ A;  2OT2 A;  3MAQ A;  4ZYS A;  2B8F A;  4EGV A;  1I50 B;  2QEJ C;  3M7N A;  2KVM A;  3AU7 A;  4KN7 C;  1SJE D;  2LY7 A;  3MC0 B;  2AQ2 B;  3HOW B;  3HZX A;  4HMJ A;  2PPB C;  4TKO B;  5C0X J;  2RDF A;  3P7J A;  3GO5 A;  2KJX A;  1WTV A;  2K5D A;  1EWC A;  5EKK A;  2EYL A;  1LTR D;  2D5D A;  4OIK A;  2PZT A;  3BDL A;  4I7Z C;  3N52 A;  3QB3 A;  1CHQ D;  4K2K A;  2JP1 A;  1CZG A;  4C3I G;  4K14 A;  1PXU A;  1B44 D;  1HUM A;  2X69 A;  1V43 A;  5I2X A;  3GTO B;  1F9S A;  2BA1 A;  5ISR A;  1D5Z C;  1Z7T A;  2D2C C;  5HUR A;  2F0S A;  4A3D B;  2K1B A;  1SXT A;  2HQE A;  2WV6 D;  3L7Z C;  4K6D A;  5COR A;  4KY5 A;  5A35 A;  1FNU A;  5IIF A;  3GTM B;  3O13 A;  3L3O C;  3NTI A;  1ZKO A;  1RD9 D;  2MHV A;  1BR9 A;  2KA7 A;  1EEI D;  4MHE A;  4PV1 C;  4GZY C;  1A3U A;  4X3K A;  3S14 B;  3KBG A;  2MPM A;  5JEA G;  2BDO A;  1LAB A;  3I3C A;  4FF4 A;  3CRK C;  3GQB A;  4RA8 A;  1KAB A;  4M1U B;  2EJG C;  2PO4 A;  5KND A;  2RSN A;  1QIL A;  5CV5 A;  4IN3 A;  2EJF C;  1GXD C;  2BE5 D;  5EPL A;  1AFP A;  1JB3 A;  5J39 A;  3M85 A;  1JE4 A;  3IFT A;  2L4N A;  5K36 H;  5CR3 A;  1AEX A;  2F0I A;  1F9Q A;  1CHP D;  3KF8 A;  4WFN 3;  1J8I A;  1E2Z A;  4A3K B;  4OO1 G;  4KN4 C;  4PMC A;  3FDT A;  4KKT A;  3V2T A;  3H3V C;  1Z6H A;  3G6J B;  4OO1 H;  2A74 C;  1B3A A;  1K8O A;  3VYR A;  1E2W A;  4K5V A;  2L0C A;  1TU2 B;  2Q8T A;  2WII B;  1X32 A;  4NDX A;  3X3N A;  4V0B A;  2I46 A;  5IT9 L;  3ND9 A;  2AQ1 B;  1TWH B;  2QDB A;  3VYS A;  3PIP 3;  2NN6 I;  1QNU A;  1PTO H;  1IYV A;  2OEO A;  1SYF A;  2D9U A;  3PUW A;  3OWF A;  2PMZ B;  3R2T A;  4C2M B;  4KV6 A;  2QIL A;  4IUN A;  3I90 A;  4C3I B;  4R9W A;  3GTQ B;  1BO0 A;  1CM9 A;  5IT9 E;  3MXU A;  3VA5 A;  2K01 A;  1T5X D;  1NSN S;  4S3S A;  1KNE A;  4J6H A;  4DAV A;  3I8Z A;  3C1E A;  1LO5 D;  1I4P A;  1EQT A;  2RDH A;  1JQY D;  4RGO S;  1ML0 D;  2KCN A;  2EY5 A;  1STH A;  3CHB D;  2H1E A;  3Q22 A;  2D62 A;  1FGB D;  1T5E A;  4ZUJ A;  1H9M A;  2MP1 A;  5FLX L;  2EYP A;  1L0Y B;  3OW7 A;  2F0K A;  3F2U A;  3DUZ A;  2L5T A;  2Q8R E;  3NTH A;  4DK0 A;  4IUV A;  5LHY 1;  4EQO A;  1EOT A;  3SK8 A;  4J8Q A;  3MFY A;  4XTC S;  2PW7 A;  1RDP D;  3NK9 A;  5C6A A;  5IGB A;  1ESF A;  2K04 A;  2F4I A;  5ELF A;  4M8A A;  2B2V C;  2JYO A;  5DM6 3;  1WTW A;  2JEA I;  5FLX E;  2WAQ B;  4B9X A;  4QB4 A;  5M3F B;  4K8J A;  1ONL A;  1GHJ A;  5LL6 S;  1U4L A;  4KY6 A;  5DNF A;  3BG3 A;  1KDC A;  1ZYR D;  5BN5 A;  1UAP A;  2EYJ A;  4CKE A;  3VA7 A;  3I91 A;  3VR3 A;  3K59 A;  1EZ8 A;  5C3E B;  2JA6 B;  5F2D A;  2DNE A;  3S1Q B;  1S4Z A;  2A68 C;  3QWN A;  1EL0 A;  2F0L A;  4OHJ A;  4HCS A;  3DXJ C;  3DHQ A;  2B2V A;  3OIP A;  2JXM B;  2SNM A;  1A3V A;  2WKC A;  3ITP A;  4KD4 A;  3OIQ A;  1PTO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...