5GQOA

Structure of the second single stranded dna binding protein (ssbb) from mycobacterium smegmatis
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
117
structure length
97
Chain Sequence
b'ETPFTVVGNIITNPVRLRFGDQELYKFRVASNSLYVTVNCWGNLARGVSASLGKGDSVVVVGHLYTNEYERSSVEVRATAVGPDLSRCIARVEKVQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Single-stranded DNA-binding protein
publication title Structure of the second Single Stranded DNA Binding protein (SSBb) from Mycobacterium smegmatis.
pubmed doi rcsb
source organism Mycobacterium smegmatis (strain atcc 700084 / mc(2)155)
molecule tags Dna binding protein
total genus 19
structure length 97
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5gqoA00
1UE5A 1EQQA 4A4IA 1D7QA 2MO1A 2R92G 5IP9G 5GAGC 1HNZL 3JC66 3PUXA 4BY7G 3L0OA 3STBC 4JCVE 1CSQA 4LF6Q 4DV4Q 3S1RH 1G51A 2IHFA 1SE8A 4IPDA 1SLJA 2Z6KC 4DR5L 4DV1L 3GTMH 1JMCA 3KFUA 3S1NH 1WFQA 5IYBG 2JA6H 2F4VQ 2OWOA 4GNXC 2R7DA 3ULLA 5LMUL 3KLWA 4A3JH 1VQ8A 1CKNA 1OXSC 1A0IA 4YHHQ 2R6GA 4DAMA 2L15A 3IRBA 2B3GA 3E9HA 4LUVA 1TWAH 1G291 3J7ZC 4RMFA 1J5EL 2E2HH 2YU9H 2F52A 1WI5A 4Y7NH 4LFBQ 4C3IH 3UDGA 4C2MH 2K5VA 1K8AC 4R4TA 4DPGA 1O7IA 5LMNW 1PV4A 3PO2G 1N34L 3CCSA 3DM3A 4X64L 4ALPA 1XJVA 3H0GG 3MEFA 1IBKL 3KDFB 4JI6L 3J7A5 5GQOA 1X9NA 4JG2A 4B3SQ 3S17H 1J6QA 1KL9A 4O2DA 4NXNL 1VQKA 3CMEA 2JEBI 3PCOB 4AQYL 1XTDA 3U4VA 1VQ7A 4JI5Q 2GVAA 4MZ9A 4A3KH 4DR3Q 3CCQA 2UUAL 3TQYA 1YHQA 1G6PA 2ZTEA 3I4MH 4HJ9A 5EAYA 4APVA 1BBWA 2ALYB 2GN5A 3AQQA 4KLKA 3L2PA 3U50C 1V9PA 1WJJA 4OONA 1HZCA 4RG1A 1E1TA 1EIFA 3HKZE 4JOIA 4DR2L 1YI2A 4KHPQ 2QGQA 1MIUA 4A3IG 1LUZA 2ZM6L 4JI4L 4GKJQ 4LF4L 5J3BA 4JBKA 4POGA 1IZ6A 1EIYB 3JAMi 3K0XA 4A3CH 1XNQL 1OXUA 2K50A 3BZCA 4L5RC 3T1YQ 1NY4A 3I7FA 5M5WH 3TREA 4DK6C 4DUYL 3PUZA 4DR4L 1VCIA 2RHQB 2YTYA 3FHWA 2NVQH 2IT1A 1YJWA 4BXXG 2Z6KA 4OWTB 4LFAQ 2FXQA 4A3BG 2CKZB 3RR5A 4X65Q 5C44G 3CCLA 2IY5B 4GNXA 5C4JH 2UU9Q 4DV6Q 1I5FA 3OYYA 1Q82C 5C0XG 1JT8A 3FP9A 5GAEC 4DUZL 3MXNB 1MKHA 3UDXA 4NPSA 1L0WA 4HJAA 1N33L 3TRZA 2KENA 1HNZQ 1NE3A 3LGJA 3K8AA 3NBHB 1VQCA 1Y1VH 2JA6G 2YTXA 4X6AH 3JAMc 4IO9A 3KYHC 4BY1H 4A3JG 1VQPA 3HOWG 2UXDQ 1A63A 3GTJH 1Q1BA 4QIWE 2Q2UA 3F8TA 4JBJA 4NXMQ 2K5NA 2ZJPA 2Y0SE 4UPAA 3KF8B 3H0GH 4PMWA 4L5SA 2YTVA 2CQOA 4BBRH 3PGZA 4JI7L 4OO1G 1CKNB 4TQUS 4NB3A 1HNWL 4LFCQ 4XIGS 2K4KA 4YCVA 3CCUA 1J5EQ 2V1CC 1Z9FA 4LF9L 3RZOH 3PUYA 3HOZH 2CWAA 5C0XJ 2UXBL 4HJ8A 4X66L 4DV2L 4K0KQ 4L5QA 5LMNL 4JI2Q 2ASBA 1GKHA 1EOVA 5JJLA 4X64Q 3KJPA 2D0OA 5M5YH 3CMAA 3GTOH 1N32L 4HIDA 1IBML 4A3KG 4JV5L 1U0LA 3F2DA 4DV7Q 1NMGA 3D0FA 5FJ8G 4A3IH 2ZTDA 2XGTA 3HOUH 4AH6A 1CKOA 4LUZA 2OTLA 1VQEA 4DR7Q 3CF5A 1L2FA 3S2HH 4EQ5A 4QGUA 2N78A 3GTGH 4DR1Q 3HKSA 1I94Q 4JOIC 1B7YB 1D8LA 4DK3C 3S15H 4YCWA 3HOYH 5IWAL 1HNXL 2BH2A 1S3OA 1HNXQ 4LFBL 1XPOA 4A3BH 1LYLA 2NZHA 4A3DG 4BA1I 2WB1G 4JI4Q 2R7FA 1M1KC 1XNRL 1LTLA 3CP0A 2PQAA 3TEHB 4B3RQ 1P8LA 1PFSA 2VUMG 4EX5A 1HZAA 4LF8L 3GO5A 2NZOA 1KAWA 3AFQA 3K7AH 3UE1A 1XPUA 3CC4A 1GD7A 4IFDI 5HGQA 3CCMA 2UUCQ 4JI0L 3T1HQ 1TWHH 3GTKH 4BBSH 1QVCA 4OO1I 3KOJA 1L1OA 2NN6G 1PVOA 2LXJA 4HJ5A 1W2BA 4YY3L 4Y52H 4A3GH 3WWVA 4GNXB 3G71A 3HOWH 1C9OA 1VS0A 2KCMA 4H02A 3HOXG 4MTNA 1VQ4A 4OX9L 1BKBA 3PUWA 3CCJA 2ZJRA 4KHZA 1X56A 3I2ZA 2DGYA 1Y1VG 1JJ2A 2N8NA 1SN8A 5GROA 1VQLA 1QVFA 1NMFA 4BY1G 2WAQG 3J81i 4GLAC 2C35B 1EWIA 3K80C 1PH3A 1BVSA 3FKIH 5GADC 1Q1EA 3CC2A 4A3LH 2VNUD 4BBRG 4DV0L 4X62L 2MNAA 4JBWA 3PIPA 2E2IH 4BA2I 1E3PA 3G6EA 4A93H 2RF4A 2ZTCA 5AJ3L 3BJUA 1SRUA 1FJGQ 4PG3A 3HOZG 1V43A 4AIMA 1N8RC 4UP9A 5FJ8H 2E5LQ 2KHIA 1VQHA 1YBYA 1UE1A 3CPWA 2R93H 1OXXK 4HIMA 3I4NG 1X3EA 3I55A 2VW9A 1KRTA 3GD7A 4HIKA 4UP7A 4JI1L 1HR0L 1K73C 1V1QA 3CAMA 3E9IA 3GDEA 5H1SE 2UUBL 2MQHA 1U5KA 3J80i 1N36Q 4P72A 3M7NA 1TWGH 4DV3L 3HOUG 4C3JH 3PIOA 4DV5L 1IBMQ 4YWKA 1H95A 2D0PA 4JI3L 3HOVH 2NN6I 5E7NA 3A5ZB 2JK8A 4GKKQ 4JI8Q 4DAYB 2Q2TA 4A3DH 4R4QA 4O0AA 4GOPC 4LF7Q 3RZDH 3OTOQ 1AE2A 3B6YA 1VQ5A 4MNOA 1IBLL 2HHHQ 2VUMH 3HOYG 1E1OA 5IY0A 1PH4A 3AFPA 2D62A 1XMQQ 1VQBA 1EUJA 1IL2A 4B3MQ 5BR8L 2IX0A 4WJ4A 1BBUA 3HFZB 4LF5Q 2E8GA 5IWAQ 3CCEA 3PF5A 1XMOQ 4LWCA 2ID0A 1CSPA 2IX1A 3W1BA 1UWVA 1PYSB 4JYAL 2VZAA 3PUVA 2PQAB 3BU2A 4GN3B 3SGIA 3HOXH 5GAHC 4IPGA 4BBSG 3TS0A 3K81C 3CC7A 2RHSB 1Q46A 5DLQE 3ULJA 3S24A 5M3MH 4A3GG 3M3YH 1L1OC 1RIPA 3PSIA 4L5TA 3UDIA 4DR5Q 4DV1Q 2K14A 3NENA 4YY3Q 2A19A 1N9WA 1UE6A 5LMUQ 4AYBE 4PZ7A 2K75A 2JQOA 4R4CA 1AE3A 2QEXA 4TVAB 1KIXA 3GTLH 1YITA 1X3GA 1Q81C 1XPRA 2I5MX 2EIFA 4A3LG 3FKIG 1Y14B 4UP8A 1E22A 3K7UC 3KJOA 3UE0A 2R7ZH 2AHOB 3U58A 4A3FH 1N34Q 4A93G 2B63H 3GTQH 3OW2A 4JI6Q 3RNUA 2YYZA 1IBKQ 4B3SL 3I4NH 2PNHA 4KI0A 3PV0A 4JBMA 3EN2A 2VS1A 3VDYA 4NXNQ 1TWFH 5HY6A 4OWXB 4JI5L 4AQYQ 1SR3A 1VQ9A 2N49A 5M3FH 2R93G 3DLLA 4IJHA 1WCMG 1KHIA 4GOPA 3E0EA 1PHJA 2UUAQ 3ICEA 4POFA 1VQNA 3S16H 5IYDH 1KD1C 5C0XI 1YJ9A 1S72A 1MJEA 4B3TL 4C3HH 4GLXA 1YJNA 4GN4B 5M5XH 2NVXH 1QUQA 1SMXA 1PA6A 4KHPL 2CCZA 1HR0Q 1YIJA 4DR2Q 4QJFA 3HOVG 1PH5A 3Q8DA 4GS3A 4WJ3M 3I4OA 4GKJL 3M85A 1QZHA 2ZM6Q 1JJCB 3A5UA 4LF4Q 2PI2E 4A3MH 4IJLA 3L7ZC 1S40A 1FL0A 1XNQQ 4QQBX 3T1YL 2K52A 2BH8A 2B29A 2HIXA 2HIVA 1NBWA 4DUYQ 1VQIA 2OQ0A 3AYHB 4DR4Q 4IOAA 5IP7H 1PH9A 2ZJQA 4LFAL 3EIVA 3CD6A 4X65L 3G4SA 2BA1A 3F2CA 3CCRA 1Q12A 1VQAA 4R1JA 1VQFA 1JB7A 1EYGA 1Z47A 1I3QH 2JE6I 1UEBA 2JEAI 2Q2HA 3M4OH 3U4ZA 3H3VH 5JEAG 1X54A 2RCNA 2QA4A 4DUZQ 3PO3H 1PH8A 1KRSA 4YCUA 2Q2IA 5M3MG 2WB1E 1ASZA 1N33Q 4JYAQ 3ERSX 3W5OA 2JA5G 1HJPA 2GVBA 3H15A 1JJGA 4DKAC 4P71A 3RLFA 2UXDL 2OQKA 3D31A 2VQEL 4HJ7A 3NEMA 2NVYH 1E7ZA 4NXML 1ASYA 2Z0SA 1QVGA 2E2JH 1C0AA 4JI7Q 2JJQA 3M4PA 2VY3A 4LFCL 4A3EH 1A62A 2LXKA 2R7ZG 1HNWQ 1VQOA 1KC8C 4YWMA 4A3FG 4DR6L 4LF9Q 2B63G 3CCVA 2H5XA 1VQDA 2JA8H 1WCMH 3HKZG 2PMZE 2UXBQ 2WAQE 5JEAJ 4K0KL 4X66Q 4JI2L 4LUOA 4DV2Q 1VQGA 5LMNQ 3RLOA 1M90C 2AWNA 1N32Q 5M3FG 3J81c 1SFOH 3F1ZA 4DV7L 5IYCH 2JA7G 4JV5Q 2KHJA 1IXRA 2AMCB 5IYDG 3I56A 5JJIA 1JE5A 4OXPA 3ULPA 3PF4A 5C3EG 1X55A 4LW1A 1K8GA 2EQSA 1Y1WH 4DR7L 4GOPB 2UXCL 1NTGA 4R4OA 1X65A 1YZ6A 2MO0A 1OXTA 2WP8J 2KBNA 1YHAA 1HZBA 1EQRA 4B3TQ 4DR1L 1I94L 5C44H 1QUQB 2VL6A 5IT9c 1UE7A 1RL2A 1IYJB 4A3MG 1T9HA 1A8VA 1B70B 3KF6A 2DUDA 3A74A 3CXCA 4PZ6A 2OCEA 3W1GA 2VQFL 1VQMA 1GM5A 1OXVA 5C4XH 4B3RL 2MFIA 1XNRQ 2F3IA 3J81j 3J80c 2AKWB 4LF8Q 5IP7G 4LF6L 1YEZA 1FGUA 4DV4L 5IE8A 2UUCL 5FLMG 2IHEA 3T1HL 1VQ6A 2OTJA 4JI0Q 2R92H 5IP9H 1I50H 1CUKA 3CQZH 2JA5H 1NJIC 1L1OB 4BY7H 4ME3A 4HIOA 2F4VL 2K5HA 3EBEA 2Y0SG 1YHBA 5K36G 3RN5A 2HT1A 1VQJA 4FDBA 1PH1A 3AEVA 4AYBG 3PO3G 4QL5A 2CFMA 1KXLA 4J15A 3M9BA 1KQSA 4YHHL 5IYBH 1HZ9A 4OX9Q 2HQLA 1K83H 1DGSA 1Q8KA 2ES2A 5JJKA 4DNIA 1TWCH 1GO3E 1AH9A 3F2BA 2I0QA 3GTPH 4IPCA 1X6OA 4XTCS 3S2DH 1PYBA 1TXYA 3CPFA 1X3FA 3KDFA 3S14H 3G48A 3RN2A 4DV0Q 2BA0A 3ER0A 4GLVB 4X62Q 2VQEQ 2NVTH 2CWPA 4A3EG 2ATWA 3PO2H 3TS2A 4IFDG 1SROA 3BZKA 5AJ3Q 1FJGL 2A8VA 4DR3L 3S1MH 4P73A 2JA8G 1Q86C 1C7YA 2JA7H 2KCTA 2N3SA 3NELA 2E5LL 1Q7YC 4DR6Q 1GVPA 1HH2P 5C3EH 4OWWB 1HR0W 2LSSA 4P74A 4YWLA 4GN5A 3UDFA 1K3RA 3RLNA 2PI2A 2JA9A 4JI1Q 5IYCG 2I5LX 4UY8C 1PH2A 1N36L 1E24A 1YNXA 4A76A 2UUBQ 4P75A 2WFWA 2XTIA 5FLXc 4QY7A 4DV3Q 4IPHA 1Y1WG 2I5HA 3A0JA 4DV5Q 1CKMA 1K0RA 1P16A 4JI3Q 4JI8L 3I4MG 4GKKL 3M4QA 1I6HH 2AWOA 1WYDA 3H3VI 1W3SA 4LF7L 1MJCA 3OTOL 1OTCA 1FVIA 1QZGA 3CW2C 5ELOA 1EFWA 1WOCA 2HHHL 2UXCQ 1IBLQ 4IFDJ 4PZ8A 1XMQL 4R4IA 1B8AA 2EXDA 4B3ML 3S1QH 2YV5A 4JC0A 4A75A 3STBD 5FLMH 5BR8Q 5C4XG 1K9MC 3ZJYC 2UU9L 5ELNA 4DV6L 4LNQA 4LF5L 1LM0A 4BXXH 4A3CG 2A1AA 3KF6B 1PH6A 1XMOL 4IOCA 1R9TH 1PH7A 2VQFQ 1YVCA
chains in the Genus database with same CATH superfamily
1UE5A 2B2TC 5EBCA 5IP9G 4JCVE 1KTKA 1PTOD 2IHFA 4DV1L 1BF4A 3KFUA 2Z4IA 2JA6H 2R7DA 3KF8A 5LMUL 1SMYC 4XQNA 1A0IA 2KECA 1LTSD 4YHHQ 2Z9HA 4LUVA 2E2HH 1IKLA 4FF3A 2HDMA 4RMFA 3EJIA 1WI5A 1HA5A 2ICEC 4QF4A 4DPGA 2FJ2A 1O7IA 2Z4HA 2A69D 3VYRA 1N34L 2K05A 4U673 4JI6L 4A3EB 2YU9B 1EZ8A 4H44C 5GQOA 4O2DA 3CMEA 4C2MB 3U4VA 2MHVA 4XXEA 1JWMD 4A3KH 2UUAL 2M2LA 3I4MH 3V96A 4KLKA 2VB2X 3MA2B 3D6WA 4OIJA 1YI2A 3X3NA 4ZUJA 2LFNA 3KK7A 4JBKA 1L0XB 1IZ6A 5KNDA 3JAMi 1WTQA 4CGYB 4A3CH 2D9UA 1YNNC 2PPBC 1NY4A 5M5WH 3MEHA 3PUZA 3FHWA 2YTYA 3HRZC 4CBVA 5DM73 4LFAQ 2CKZB 2I07B 3RR5A 4DFAA 5C44G 3CCLA 4GNXA 3TDQA 2NN6H 4XYQA 3OYYA 4DUZL 1K8MA 3UDXA 3TRZA 4RHRA 1EU4A 5EPJA 3NBHB 5C4JB 4RGTA 3JAMc 4IO9A 3MC0B 1DYQA 4IN3A 5EPLA 4A3JG 3NTHA 1A63A 3F8TA 4JBJA 4KMUC 2ZJPA 1H9RA 3H0GH 4OO1G 5IGFA 3NWTA 4C3IG 1BQQT 1F9SA 5FK9C 4BY1B 1B3QA 2PMZB 2WAQB 3R8BA 3ND8A 1J5EQ 1BR9A 2R3ZA 2V1CC 3GTJB 2BDNA 5BN4A 3RZOH 2FHTA 5BN3A 5C0XJ 4BBRB 4DV2L 4K0KQ 4L5QA 5LMNL 4JI2Q 2ASBA 2F0UA 5IGEA 1EOVA 2SNSA 5JJLA 4X64Q 3JAML 5M5YH 3CMAA 4HIDA 1U0LA 1Y8OB 1EIGA 2A73B 3L9AX 1EWHA 3HOUH 5JVG3 4QCLA 1JCKB 5IODA 3GTOB 3CF5A 2A6HD 5C3WA 4YCWA 1HFNA 1HNXL 4LFBL 1S3OA 1LYLA 4BA1I 4RFBA 1MI2A 4ZQ3A 3S2HB 1LTLA 2G9HD 3CP0A 3DEOA 1PFSA 3WDNA 5C0XH 4EX5A 1O7LA 3AFQA 3S15B 1GD7A 4RHSA 5HGQA 3CCMA 2UUCQ 3KOJA 1L1OA 1NSNS 1PVOA 5FO7B 4HJ5A 4YY3L 3WWVA 5IT9E 3G71A 1VS0A 1E2ZA 4JVZA 3HOXG 2QEJC 4KJOA 1VQ4A 3CCJA 4MIUA 4CDCC 4CJ2C 2ZJRA 1QNKA 1X56A 2DGYA 1JJ2A 3GV3A 2N8NA 3A54A 1T5XD 4Z9CB 2C35B 3HOWB 3H3VC 1PH3A 3CC2A 3FKIH 4G7OC 3KLRA 4CKCA 4JBWA 3PIPA 1SYGA 3AB9A 4BA2I 1EY9A 4A93H 2F0WA 1LT4D 2RF4A 3MXUA 1TQOA 2SNMA 4FF1A 2O5JC 4PG3A 4IUTA 1SEBD 3E0JA 4NMZA 1N8RC 5FJ8H 3CPWA 1UE1A 2R93H 3I55A 4EQNA 1BO0A 4JI1L 1HR0L 3P75A 4KY6A 1FNVA 1U4LA 2D0PA 4JI3L 4DXFA 2NN6I 2AUKA 4JI8Q 4HCSA 4GKKQ 2K6AA 5HURA 2BE5C 2HHHQ 2VUMH 2MGSA 1JC7A 1XMQQ 5ISRA 1D1KA 1B9NA 1I4HA 3HFZB 1XX8A 5D3DA 3FMCA 5IWAQ 1ICFB 1SXTA 1WTRA 3W1BA 1PYSB 4JYAL 1ESRA 2HCIA 1XTCD 2VZAA 1A3TA 5GAHC 4BBSG 3LWEA 2WIIB 3QOJA 5DLQE 2B2YC 4OELB 3ULJA 3PIO3 4A3GG 1EQVA 1L1OC 1RIPA 3PSIA 4ODGA 3UDIA 4DV1Q 2F0KA 4IUPA 3NENA 2A19A 5LMUQ 1KABA 4X3SA 2A6ED 4AYBE 2K75A 2JXMB 2RVLA 4R4CA 1YITA 1QWYA 4G7ZC 4A3LG 3OWFA 1E22A 3K7UC 4ZCKA 5K5PA 5A2QE 2R7ZH 4IUUA 3U58A 1R4PB 1N34Q 4ME5A 3OW2A 4JI6Q 4K5VA 1BUVT 1BCPF 2F0MA 4FVMA 5KEEA 1VQ9A 3GTQB 3E0EA 2UUAQ 1SYEA 5J22A 4WJWA 1KD1C 5C0XI 1MJEA 1MD2D 4GN4B 1F2MA 2LMCB 2CCZA 3HP3A 3Q8DA 3VYUA 4R8IA 4I7ZC 1QZHA 5EKLA 1JJCB 3R3OA 2F0PA 4LJZC 4C3HB 3SXHA 4F8MA 4DGZA 4QQBX 5C4ZA 3T1YL 2HIXA 5CBEE 1VQIA 2F0OA 3AYHB 2F0JA 1CZGA 4A3MB 2F0IA 3OIPA 3CD6A 4X65L 3CCRA 1Q12A 1STAA 1VQAA 1IW7C 1EYGA 1UEBA 3M4OH 2Q8IB 3U4ZA 1X54A 4DUZQ 2Q2IA 1F9QA 1ASZA 2DJGC 1DZ1A 2GVBA 1KDBA 3H15A 1JORA 3Q22A 3C1FA 1JJGA 1BCPC 1CHPD 3BVGA 1I4QA 1DCZA 4R8NA 1E7ZA 4NXML 1ASYA 2Z0SA 2EPBA 1JR0D 1WTWA 1C0AA 2SOBA 3M4PA 2Q8RE 1A62A 1HTPA 1M8AA 1KC8C 4A3FG 2DN8A 3V05A 4DR6L 3QB3A 2B63G 1SNOA 1VQDA 1I4GA 3GV6A 1WCMH 4CDEC 3NK9A 4DV2Q 2R61A 5LMNQ 3E3XA 2K7VA 2XRQD 3F1ZA 2JA7G 3A8JE 3QOLA 5IYDG 3PF4A 5C3EG 1X55A 4LW1A 1K8GA 3FPUB 2H4OA 4FF4A 5NUCA 4DR7L 4R4OA 1X65A 4KKSA 1YZ6A 2EXZA 2WP8J 2KBNA 1HZBA 4B3TQ 3TP7A 1IYJB 5E1FA 1A8VA 1HNXQ 4LFBQ 3W1GA 2OCEA 1OXVA 4B3RL 3A8IE 2F3IA 2F4IA 1WD0A 2R92H 1L1OB 4N9PA 3D8GA 2HT1A 1F2LA 1CZWA 3TZDA 3M9BA 4YHHL 1HZ9A 1VF7A 3K5OA 1Y8PB 3T13A 1DGSA 5E3FA 1I4XA 2XIWA 1TWCH 1FR3A 1AW7A 1AH9A 3GTPH 4DAPA 4KD3A 1BDOA 1NAPA 3Q24A 3S2DH 1CT1D 4PMCA 3NE5B 4K8JA 1PFBA 2BA0A 3H09A 4QUFA 3PO2H 1I4RA 5J1ZA 2R7ZB 3S1MH 1KDCA 3S14B 2E76C 4JPBW 5I2XA 1GVPA 1HH2P 2NZ1D 4YWLA 4P74A 3OWEB 4LMQD 4RWSC 5C6AA 4JI1Q 5IYCG 3MXGA 1PH2A 1N36L 1E24A 1YNXA 2PNRC 2EYJA 2WFWA 4QY7A 5IGBA 1Y1WG 2I5HA 1EY5A 3I4MG 4JI3Q 4DAYA 4DK0A 1GHKA 1SNQA 1QZGA 2RCFA 1WOCA 4U68A 4IFDJ 3T56B 3MXPA 4IOAA 4B3ML 4A75A 5FLMH 4HMIA 1EY4A 2N88A 2EZVA 4TSSA 4BXXH 4A3CG 4RKLA 2A1AA 3KF6B 1PH6A 2FMMA 3NXWA 2VQFQ 3VR6A 3OSOA 4A4IA 1EY7A 2MO1A 3PUXA 3STBC 1CSQA 4L6TB 2KOLA 3QO2A 1BCPB 5C44B 2Z6KC 1AEXA 4AYBB 2F4VQ 2OWOA 3ULLA 1BOSA 1V8QA 2K5DA 2YU9H 5ELBA 1J5EL 4IFDH 3S1NB 1IKMA 5I6WA 4C2MH 1RCVD 4A3JB 5LMNW 3I4LA 4IURA 4X64L 4ALPA 3I90A 3H0GG 1IBKL 3KDFB 3T4AC 1TWAB 1X9NA 3Q6SA 4Y7NB 4MHEA 4X3TA 1VQKA 2JEBI 3PCOB 1VDZA 4MZ9A 3CCQA 1YHQA 3CHBD 5EAYA 4APVA 2ALYB 3L2PA 1WJJA 3VR4A 3V2TA 1HZCA 1E1TA 4JOIA 4DR2L 1Z6HA 1KLGD 2QGQA 3CU7A 1MIUA 3D6CA 2JYOA 4F7XA 1S5ED 4LF4L 5J3BA 4POGA 1EIYB 2FINB 2B2TA 3K0XA 3KLSX 3TP8A 3K5MA 5CV8A 3BZCA 4L5RC 2KA7A 3T1YQ 3I7FA 4DUYL 3TREA 1VCIA 2RHQB 2CH4W 1YJWA 4DNTB 4C56C 1TIID 4X65Q 1CK1A 3OIQA 4ZKBB 2IY5B 1I6VC 5C4JH 4ZYSA 2UU9Q 3NP8A 1PZKD 2XWJB 5C0XG 5GAEC 5FKAC 3MXNB 1SJHD 4GZYC 1TT2A 2KUMA 2NVQB 2IX3A 3N52A 5ELDA 5FO8B 1NE3A 5EGTA 2FFKB 3URYA 1VQCA 4BWGB 5JPNC 4BY1H 3GTJH 1WTXA 4NXMQ 4BBRH 2CQOA 1MSGA 1K3BC 1S5DD 2ICIA 4TQUS 2ZT9C 1HNWL 1DD2A 3QG1A 1U4MA 2RA4A 4OGQC 3HOZH 2CWAA 5I4DA 4HJ8A 1O7ZA 4G4KA 1FGBD 2E2DC 3S1MB 1GKHA 4TRDA 4ZK9B 2D0OA 3GTOH 1PXUA 1SSOA 4JV5L 2IPKD 3F2DA 1PRTC 1NMGA 5FJ8G 5COYA 3C3LA 1QCBD 1VMPA 2OTLA 4V190 1VQEA 1D6EC 4DR7Q 3ND9A 3S2HH 4QGUA 2N78A 4JOIC 4A3IB 5CYUA 3S15H 5IWAL 2BH2A 4N8X1 1XPOA 4KN4C 1DOLA 1STHA 1TS2A 4I7AA 4V0BA 5G3LF 3J81E 3FEWX 1XNRL 4B3RQ 4QUCA 1P8LA 1STYA 2VUMG 1NR4A 3BDOA 4LF8L 3K7AH 2NZOA 1KAWA 1S5BD 5EPKA 1XPUA 4NP5A 3CC4A 4IFDI 4A3BB 2F03A 4WFN3 1W2BA 2NWGA 4S3SA 3HOWH 1C9OA 4H02A 2AQ1B 3BVMA 3MZ5A 3PUWA 1TWHB 3I2ZA 1Y1VG 1PDQA 1LTGD 2G5DA 4A3GB 4G57A 3J80E 3Q23A 2IW3A 1WTPA 3FRPB 2F0VA 4J8QA 1EWIA 1LTRD 1BVSA 1Q1EA 1LABA 5IIFA 4DV0L 1HCZA 4J1MA 1MHWC 5T1IA 3BJUA 1SRUA 4HSVA 1V43A 2K1BA 2E2IB 2H1EA 3A7AB 4HIMA 3GD7A 1II3A 1D5MC 1K73C 3CAMA 3E9IA 3GDEA 2UUBL 2MQHA 1N36Q 1S5FD 2B2VC 4DF7A 1IBMQ 4DV5L 2K28A 2KHSA 2ZXOA 1LT5D 3QWNA 4DAYB 2A74C 3OMCA 3B6YA 4MNOA 3HOYG 1E1OA 1PH4A 2A5HA 2C5CA 2EYPA 3AFPA 1QB5D 4B3MQ 5BR8L 1H9SB 5CV6A 4A3DB 1TR5A 2L11A 3TSSA 3RZDB 5EKIA 1S4ZA 3PF5A 4LWCA 4ULLA 2ID0A 5FLXE 3ONAB 1KNEA 1UWVA 2P5ZX 3BYYB 3FVQA 2PQAB 4L63B 3SGIA 2WKCA 3ITPA 5JEAH 2RHSB 2M9VA 1A2UA 1H9KA 4KTAA 1Y8NB 2K14A 3HS0C 5CMDA 2D5DA 5IT9L 2JQOA 3IFDA 1KIXA 1FYCA 2RBMA 2I5MX 1LTTD 3M7GA 1EFID 1EEFD 5CORA 3KJOA 3GTQH 1ZYRD 1IBKQ 3K58A 4B3SL 2PNHA 3DWPA 1F2ZA 3PV0A 3EN2A 3TBIB 2VS1A 3HOZB 2NB0A 5HY6A 4OWXB 4JI5L 4DA2A 1PRTB 4K6LA 2K33A 4IJHA 1WCMG 2B63B 1KHIA 3I4NB 1PHJA 1QJOA 1IL8A 4NKLA 4B3TL 1S72A 2RDGA 4C3HH 1SNDA 1TWFB 1PTOF 4C3JG 1OO9B 4DR2Q 1B9MA 1PH5A 3HOVG 4WJ3M 3KBGA 3M85A 3S16B 2K5QA 4LF4Q 3CRLC 5JVH3 4A3MH 4IJLA 2EOTA 5M5XB 1D5ZC 1FL0A 5D65A 5JJZA 3J7YW 2K52A 2QW7A 2BH8A 2B2YA 1STGA 2HIVA 4DK1A 4DUYQ 2KJXA 1CQFA 2ZJQA 2RSOA 3EIVA 1VQFA 3K7AB 1HHVA 3A55A 3I73A 3H3VH 1CI3M 3KBXA 3PO3H 1BNZA 4YCUA 5M3MG 1A15A 4EGVA 1HJPA 2B8GA 1SYCA 1I3QB 5HGTA 4P71A 1F77A 5E4WC 1NCVA 2OQKA 1RTOA 1KNAA 3NEMA 3P1HA 1U4PA 1QVGA 2E2JH 1TVXA 2JJQA 4LFCL 1PTOC 1HNWQ 3G7LA 3AMUA 3D4RA 4YWMA 4QB4A 1SAPA 5J39A 5A2QL 3JAME 1L0YB 3RLOA 5KNBA 2F0QA 2DNCA 2QCPX 4IUNA 3T51B 5M3FG 4JV5Q 2KHJA 5JOBA 5M9OA 3I70A 2OT2A 2A69C 2Z1CA 1C4QA 1SFOB 2MO0A 1MBYA 3D4WA 4DR1L 1I94L 1QUQB 2I46A 3EA6A 4FXGC 1ET6A 1T9HA 3KF6A 3CXCA 1A2TA 2VQFL 2WACA 1A6XA 1XNRQ 3KLSA 2QILA 4LF8Q 2QKIC 1EU3A 1GOZA 2HD3A 5IP7G 5IE8A 5FLMG 2IHEA 3WOFA 3T1HL 1VQ6A 2OTJA 5IP9H 4DXGA 3H6MA 2F4VL 2K5HA 5K36G 1JWSD 4B08A 4QL5A 1GUGA 4XQQA 1KXLA 3D3RA 3W3AA 4K14A 2HQLA 5ELEA 1I50B 2JA5B 1Q8KA 3NUCA 2Q8TA 1GO3E 1X6OA 3SK8A 5C5LA 3CPFA 1X3FA 3KDFA 1GUWA 2XWBB 3S14H 3G48A 1HPCA 1ICWA 3NHHA 4DV0Q 2VQEQ 2CWPA 4A3EG 1RHPA 4IFDG 1WTVA 3SEBA 4CKEA 3BZKA 1FJGL 2JA8G 2KCTA 2N3SA 3NELA 3QJYA 5KRUA 2NVTB 2RSNA 3PQIA 2LSSA 2HUGA 2NYZD 1K3RA 4HN7A 2UUBQ 5EBDA 2CW0D 4IPHA 4DV5Q 1K0RA 1I6HH 3M4QA 1GUOA 4P2CB 4FYDA 1PFMA 3H3VI 3U9OA 1MJCA 1OTCA 1FVIA 1HUNA 2EJMA 2B8FA 5ELOA 1EFWA 2UXCQ 4IQZA 4R4IA 2EXDA 3STBD 2EE1A 5BR8Q 1PYWD 5C4XG 2BDOA 2UU9L 5ELNA 3HGBA 3SK6A 1LM0A 1SJED 4IUVA 1XMOL 1GUSA 1UNSA 3MXNA 5C44H 3TP6A 2F0TA 1D7QA 5GAGC 1G91A 1CA6A 4BY7G 2A6HC 2F3WA 4DV4Q 1G51A 1LT3D 4B9XA 1X3PA 3G6JB 4IPDA 1SLJA 3PO3B 3S1NH 4IZ8A 1DXMA 1WFQA 5IYBG 1H9JA 3Q0AA 2F3VA 3KLWA 4KY7A 4A3JH 1VQ8A 3S1RB 1OXSC 5F2DA 2PW7A 2L15A 3IRBA 2B3GA 3IKJA 3E9HA 1TWAH 1G291 3ERQA 1SE3A 3DMUA 1LTBD 3GTMB 1PTOB 4Y7NH 4OO1H 4C3IH 3NQIA 4RH6A 1K8AC 4R4TA 3EQLC 2E2JB 1PV4A 1GJXA 4H7BA 2ZXRA 3DM3A 1XJVA 3J7A5 3MEFA 2F1MA 2JSOA 3S9WA 5CGKA 1RODA 4JG2A 3SE0A 4B3SQ 1J6QA 1KL9A 3DM1A 1XTDA 1Y69U 4JI5Q 2GVAA 4DR3Q 4HAEA 1G6PA 3OW7A 2ZTEA 3S17B 4L8JA 2A68D 1BBWA 1NNXA 1CQVA 3U50C 1PZJD 1EL0A 3C1EA 1EIFA 3BZDB 1DONA 1JQYD 2KCCA 2ZM6L 2DY8A 1XNQL 3VYSA 1OXUA 1Q8IA 2K50A 3K5NA 1F9RA 1HTLD 4DR4L 1G2SA 2NVQH 1O80A 3HG9A 2J7ZA 2Z6KA 4OWTB 3J7AV 5KYLA 2X69A 4DV6Q 1UUPA 1JT8A 3VR5A 4NPSA 1L0WA 4HJAA 1N33L 2JP1A 2KENA 1HNZQ 3LGJA 3K8AA 2JA6G 1X3QA 3DWQA 2YTXA 4PQXA 4X6AH 3HOWG 2C9OA 1Q1BA 4QIWE 2Q2UA 2K5NA 3MWYW 4PMBA 3I8ZA 2YTVA 4JI7L 1Y1VB 2PZUA 1CKNB 4KD4A 3OOCA 4NB3A 3H91A 4LFCQ 4XIGS 1R4QB 4YCVA 3CCUA 3VA7A 4XYOA 2B2UC 2UXBL 2RDHA 2NTSA 2A6EC 1YNJC 2DNEA 1IBML 4A3KG 3D0FA 4A3IH 2ZTDA 4UHVA 2SDFA 4LUZA 1J8IA 3SR1A 3IL8A 3LNNA 5BN5A 4RGMA 4DR1Q 3HKSA 3HZXA 1I94Q 1B7YB 1H9SA 1I6HB 3AU7A 3C46A 3QR8A 4A3BH 1B4OA 1LV9A 2WB1G 4N9TA 4JI4Q 2R7FA 3I91A 5IGDA 2PQAA 3TEHB 4CDFC 3GTGB 4H0LC 1SMYD 1HZAA 3P20A 3GO5A 3HOYB 3SK4A 4JI0L 1HFGA 3T1HQ 1TWHH 2KVMA 4BBSH 4CHTB 4C1NK 4OO1I 2NN6G 2XSCA 1LLRD 4K2KA 4Y52H 4A3GH 1VF5C 4MTNA 1EY6A 1TU2B 3GTKB 4KKUA 1QVFA 3HEJA 2WINB 3J81i 1SYFA 2F0HA 1C8CA 4A3LH 2VNUD 3LWUA 5GADC 4X62L 1H9MA 2E2IH 3ZYYX 2AUJD 4C3IB 2PZWA 1E3PA 3VR3A 4TKOB 1FJGQ 4AIMA 1XWEA 4UP9A 3GP7A 1YBYA 2KHIA 3DWAA 1OXXK 1SYBA 1X3EA 4C1NI 3E6ZX 1YNND 1M4VA 5LL6S 1V1QA 1U5KA 1ONLA 4J6HA 4XDXA 3J80i 3FDTA 3HOUG 1Z7TA 3PIOA 4YWKA 5E7NA 5C5MA 3A5ZB 2JK8A 4A3DH 4C3HG 1ESFA 4O0AA 3PIP3 4GOPC 3RZDH 1PRTF 1AE2A 1VQ5A 3X3MA 2ZXPA 1IBLL 1TWGB 5IY0A 5EJWA 1JICA 3BYTB 1VQBA 2ENBA 2L12A 3HOVB 2F0GA 4NDXA 3NQTA 4WJ4A 4EQOA 2LKVA 2E8GA 5EQ0A 1EYAA 1XMOQ 2CVRA 1CSPA 2IX1A 3J81L 3E5SA 3PUVA 4GN3B 3MFYA 3U9SA 2K5WA 3TS0A 1GUTA 3J7AF 5CV9A 3CC7A 1Q46A 1AFPA 2PO4A 4L5TA 4B9WA 3HOXB 4K6DA 1N9WA 1UE6A 4PZ7A 1W6JA 2EYLA 5M3MB 1AE3A 2QEXA 4TVAB 4KHVA 3M3YB 2LS01 2SEBD 2EIFA 1GHJA 2B2WC 3FKIG 1Y14B 4MTKA 2EY6A 4H13C 1XXGA 1AZQA 2F0SA 5IGGA 3J80L 2AHOB 3A7LA 2L55A 4X3KA 4A3FH 3OHXC 4KN7C 2PZTA 2B63H 3GTLB 4A93G 3I4NH 1ENAA 3RNUA 1E0BA 4F88A 2B2VA 2HDLA 4KI0A 4JBMA 1K0SA 1TWFH 2N49A 2R93G 4UDUC 2OEOA 2EJGC 3KUPA 1U9RA 3S16H 4POFA 5IYDH 1YJNA 2GA4B 5M5XH 1AZPA 1QUQA 1PA6A 4KHPL 1YIJA 3NWSA 4QJFA 4GKJL 3L3OC 5FO9B 2F0FA 3NTKA 2ZM6Q 2VXWA 3A5UA 2PI2E 1S40A 2NVXB 1XNQQ 3FPPA 1KAAA 1WTHA 2B29A 1NBWA 1V1OA 3H94A 2IWHA 1TS5A 4DR4Q 3TZUA 2F0NA 4EVOA 1RDPD 1ZXTA 1PH9A 3OPOA 2BA1A 1SDFA 5AFWA 1JB7A 1Z47A 1I3QH 2MPMA 4K2LA 4BBSB 3BDLA 1PH8A 1KRSA 2WB1E 5FLXL 1N33Q 3ERSX 1NR2A 2OF1A 4KJNA 1JE4A 4QIWB 2XVSA 2UXDL 5KYIA 3O13A 2VQEL 4HJ7A 1ENCA 2K04A 3R2IA 2CHBD 4XT3B 4JI7Q 1LTAD 2VY3A 2K32A 2LXKA 2R7ZG 1VQOA 4O42A 2NVYB 4CKBA 2H5XA 4PV1C 3HKZG 2UXBQ 1PFNA 5JEAJ 3TP5A 3GQBA 2BE5D 1MSHA 4F87A 4M1UB 1SFOH 1EEID 4DV7L 5IYCH 1IXRA 3I56A 2JA8B 1FNUA 2G9DA 5A35A 4RGOS 4K5WA 5JJIA 3BVZA 2EQSA 1Y1WH 4GOPB 2UXCL 4R9WA 1EY0A 4FP5D 2PCFB 5IT9c 1UE7A 1KDAA 1B70B 1VQMA 2DUDA 3A74A 4PZ6A 1GM5A 2HCCA 2MFIA 3F2UA 2AKWB 3K6OA 1YEZA 4DV4L 5KIXA 4JI0Q 4OIKA 1I50H 2JA5H 5C4XB 4HIOA 5T1GA 3EBEA 2Y0SG 5I9PA 3RN5A 3AEVA 1VQJA 4AYBG 1MGSA 1O78A 1EOTA 3T16A 4KY5A 3TMEA 3CQZB 4BY7B 2CQAA 1SNPA 2ES2A 5JJKA 4DNIA 2I0QA 4XTCS 4HSPA 5TSSA 1K83B 3RN2A 2NVTH 4X62Q 4MN3A 3TS2A 1ET9A 5D14A 1SROA 4DR3L 4P73A 4A3FB 1Q86C 1C7YA 2E5LL 2JN4A 5IGCA 3VA5A 1Q7YC 1QE6A 2E74C 4OWWB 2PW5A 4LK1C 4GN5A 4FXKC 1TS4A 2I5LX 3VYTA 5DAUA 2JA7B 4N8FA 4A76A 4HCEA 3IFTA 4P75A 5C3EB 1IW7D 1CKMA 1P16A 2EDGA 2QDBA 3OMGA 2AWOA 1WYDA 4LF7L 3SHLA 3OTOL 3TN2A 1XYIA 4O1NA 1IBLQ 4FF2A 4JK1C 1B8AA 4JC0A 1K9MC 1AN8A 2L9HA 1BCPD 1D5XC 4DV6L 4LNQA 4LF5L 1D2BA 1RTNA 4IOCA 3S1QB 1EQQA 2R92G 2D2CC 1HXYD 3JC66 4XT1B 1HNZL 3L0OA 3EVQA 4LF6Q 3S1RH 2WKDA 4CJ0B 1SE8A 1R9TB 1G6ZA 4HEDA 4DR5L 3GTMH 1JMCA 1PTOH 3SK5A 2RQXA 4GNXC 4G7HC 1CKNA 2L5TA 2R6GA 4DAMA 4M8AA 3J7ZC 1QG7A 1EWCA 2F52A 1JB3A 5LL6X 2JA6B 1B1ZA 1RF2D 3UDGA 2F0DA 2K5VA 4UAIA 3PO2G 1ZEQX 4HR7B 3CCSA 4E6IA 2E2HB 3S17H 4OHJA 4NXNL 3MVVA 4AQYL 4QMGA 1VQ7A 3K5LA 4OL7A 3I3CA 3TQYA 4HJ9A 3AQQA 2GN5A 4IALA 1V9PA 4OONA 4Q0FA 4RG1A 3HKZE 4KHPQ 2RKSA 2DJFC 4A3KB 1Y1WB 4A3IG 5EKKA 1LUZA 3I4MB 4JI4L 4GKJQ 2EYOA 4ILWA 1HUMA 4FO2A 3VR2A 2CH4A 2EYMA 5I6YA 1ILPA 4DK6C 1J9OA 1JOOA 1KLUD 3UI2A 3SDZA 4RCOA 2IT1A 4BXXG 4A3BG 2FXQA 3A56A 5DM63 1CFMA 1ENFA 2MUYA 2WB1B 1I5FA 4ID6A 2V4DA 3W2DA 5M5WB 1Q82C 3FP9A 2XN9C 5DEHA 1MKHA 3MTSA 1WTOA 1HQMC 2B39A 4XQJA 1Y1VH 1PZID 1CA5A 3KYHC 2UXDQ 1VQPA 1VMCA 4RAUC 2Y0SE 2TMPA 3KF8B 4UPAA 4PMWA 4RCNA 4DNRB 1QNUA 4WRDA 4L5SA 1HRJA 2KEDA 3PGZA 1CTMA 1DOKA 1YNJD 4NW2A 5CV7A 3R2TA 2K4KA 1Z9FA 3P7JA 3BDCA 4LF9L 3PUYA 3H0GB 4K5XA 1TS3A 4X66L 5CR3A 4DAVA 1STNA 5I9OA 3KJPA 1N32L 4DV7Q 1B53A 3RZOB 2K03A 1TY2A 2XGTA 4AH6A 1CKOA 2TSSA 3NBIA 3RD4A 2OXPA 1W6KA 4X3UA 5M5YB 1L2FA 1ZYRC 1JOQA 4EQ5A 4ZAIA 2EJFC 1K28A 3GTGH 2NTTA 4DN4M 1FNWA 1D8LA 4DK3C 3HOYH 3HOUB 2NZHA 4ZKCB 4A3DG 1M1KC 1K8OA 1SNCA 1E2VA 3C2PA 1S5CD 3UE1A 2XRSD 1JOKA 3CRKC 3GTKH 1QVCA 4RGNA 1EYDA 1V1PA 3EROA 2LXJA 4EQPA 5FOBB 2J4XA 3K59A 4GNXB 2KCMA 2LY7A 4OX9L 1BKBA 1SYDA 4KHZA 1NUCA 5CBAE 5GROA 1SN8A 1VQLA 1NMFA 4BY1G 2WAQG 2B2UA 4GLAC 3K57A 1T5EA 3K80C 5LHY1 4BBRG 1RKNA 5KGUA 2FMCA 1EZ6A 2MNAA 2X6GA 3R93A 3G6EA 2ZTCA 5AJ3L 2PQEA 3HOZG 2KCNA 3FKIB 4YIJA 1ML0D 2E5LQ 1D1IA 1VQHA 5IOCA 3I4NG 2PYKA 1SE4A 2VW9A 4A93B 1KRTA 4HIKA 4UP7A 1G8ZD 1F2YA 2K01A 5H1SE 4DU9A 4P72A 3M7NA 1TWGH 4DV3L 2M00A 4C3JH 3DHQA 5JAVA 2R93B 1H95A 3WOEA 3HOVH 3PMFA 5CV5A 4CJ1B 1LO5D 2Q2TA 4R4QA 4LF7Q 2RDFA 3OTOQ 2KEEA 1C48A 3NTIA 2EY5A 2D62A 1EUJA 5CC4A 1IL2A 2EYFA 2IX0A 1FD7D 1BBUA 1LACA 4LF5Q 3CCEA 2VUMB 2BOSA 2IJ0A 4KV6A 4BS9A 1I4PA 3BU2A 3HOXH 3IAYA 4IPGA 2AQ2B 4KK7A 3K81C 4K8IA 1F9PA 3S24A 5M3MH 3M3YH 1IHZA 2O4XA 2O5IC 2DY7A 1SE2A 4DR5Q 4ZLTF 4YY3Q 2WV6D 1STBA 1IYUA 3GTLH 3BS1A 3D4DA 1UEAB 1X3GA 1XPRA 2L1BA 5KNCA 1Q81C 1PRTD 1HA6A 2EYHA 4UP8A 4OEMB 3UE0A 1O7YA 1PLFA 2YYZA 3CKIB 2BCOA 5D3IB 3K0YA 4HTHA 3VDYA 4NXNQ 4KKTA 4AQYQ 1SR3A 3EFXD 5L37A 5M3FH 1LT6D 3DLLA 1X32A 4GOPA 3ICEA 2Z6BA 1VQNA 3HKZB 1EY8A 1YJ9A 4GLXA 2NVXH 1SMXA 2EY2A 1HR0Q 1SNMA 4GS3A 3I4OA 3NPPA 5ELFA 3L7ZC 4JW0A 1U4RA 1B3AA 2E75C 2OQ0A 5I2YA 5IP7H 2CW0C 4LFAL 3G4SA 3F2CA 4R1JA 3MHBA 1EYCA 3NSWA 2JE6I 2IL8A 3M4YA 3RMHA 2JEAI 2Q2HA 1B2TA 2X6LA 5K36H 5JEAG 2RCNA 2QA4A 4JYAQ 3W5OA 1AP0A 2JA5G 2B2WA 2NUCA 3NBHA 1DM0B 3M4OB 4DKAC 3RLFA 1A3UA 1SBBB 2Y0SB 1DOMA 1WD1A 1PMRA 3D31A 4Q5VA 2NVYH 1TY0A 5G3LD 1UAPA 4ZUIA 1EIHA 1Q3LA 4ABNA 1CHQD 4A3EH 2QDLA 4LF9Q 3CCVA 5DNFA 2JA8H 2PMZE 2WAQE 4K0KL 4X66Q 2AQ3B 4JI2L 4LUOA 1VQGA 1M90C 2AWNA 1N32Q 3J81c 2L4NA 3DUZA 5C4HA 2J0TD 2AMCB 1WCMB 1STEA 3QIAA 1JE5A 4OXPA 3ULPA 4RKBA 5E4XA 1NTGA 1OXTA 4C3JB 1JWUD 1YHAA 4IUQA 1EQRA 5C3XA 1CM9A 4FNFA 1HQRD 2VL6A 1RL2A 4A3MG 4FXDA 2EY1A 4LAAA 3DXJC 1B44D 1BXTA 2EVBA 5C4XH 2HQEA 2MJ8A 4WORA 2A68C 1B50A 3J81j 3J80c 4LF6L 1FGUA 2UUCL 1BBXC 1A3VA 1CUKA 3CQZH 1NJIC 4BY7H 4ME3A 1RD9D 1V1PB 1YHBA 4FDBA 1PH1A 3PO3G 2CFMA 2F0EA 1ZKOA 4J15A 1WVLA 1KQSA 5IYBH 4OX9Q 2MP1A 2Z8LA 3A8KE 2R92B 1K83H 4PNYA 3N6RA 2NBFA 1ILQA 2F0LA 3BG3A 3F2BA 4CDDC 3DEPA 4IPCA 2O2LD 2XNAC 2L0CA 5CV4A 1PYBA 1TXYA 3MFGA 2KQ3A 1G2TA 3ER0A 2N55A 1GUNA 4GLVB 4HMJA 2ATWA 1TWCB 3GTPB 1E2WA 1DJRD 5AJ3Q 2A8VA 1TKWB 3S2DB 2JA7H 3LX0A 1RJTA 2QF7A 4ZRZA 5JPMC 3PO2B 4DR6Q 5C3EH 3SVMA 1HR0W 3UDFA 3RLNA 2PI2A 2JA9A 4I65A 5M3FB 4UY8C 3MAQA 2VB3X 1LTID 4RA8A 2XTIA 5FLXc 4DV3Q 5ELCA 3A0JA 4GKKL 4JI8L 1QOHA 1W3SA 3CW2C 2HHHL 1GXDC 1Q90A 1IYVA 4PZ8A 1XMQL 3S1QH 1EQTA 2YV5A 3RUZA 3ZJYC 1QILA 3I72A 3T53B 1R9TH 1PH7A 1YVCA
chains in the Genus database with same CATH topology
1UE5A 1EQQA 4A4IA 1D7QA 2MO1A 2R92G 5IP9G 5GAGC 1HNZL 3JC66 3PUXA 4BY7G 3L0OA 3STBC 4JCVE 1CSQA 4LF6Q 4DV4Q 3S1RH 1G51A 2IHFA 1SE8A 4IPDA 1SLJA 2Z6KC 4DR5L 4DV1L 3GTMH 1JMCA 3KFUA 3S1NH 1WFQA 5IYBG 2JA6H 2F4VQ 2OWOA 4GNXC 2R7DA 3ULLA 5LMUL 3KLWA 4A3JH 1VQ8A 1CKNA 1OXSC 1A0IA 4YHHQ 2R6GA 4DAMA 2L15A 3IRBA 2B3GA 3E9HA 4LUVA 1TWAH 1G291 3J7ZC 4RMFA 1J5EL 2E2HH 2YU9H 2F52A 1WI5A 4Y7NH 4LFBQ 4C3IH 3UDGA 4C2MH 2K5VA 1K8AC 4R4TA 4DPGA 1O7IA 5LMNW 1PV4A 3PO2G 1N34L 3CCSA 3DM3A 4X64L 4ALPA 1XJVA 3H0GG 3MEFA 1IBKL 3KDFB 4JI6L 3J7A5 5GQOA 1X9NA 4JG2A 4B3SQ 3S17H 1J6QA 1KL9A 4O2DA 4NXNL 1VQKA 3CMEA 2JEBI 3PCOB 4AQYL 1XTDA 3U4VA 1VQ7A 4JI5Q 2GVAA 4MZ9A 4A3KH 4DR3Q 3CCQA 2UUAL 3TQYA 1YHQA 1G6PA 2ZTEA 3I4MH 4HJ9A 5EAYA 4APVA 1BBWA 2ALYB 2GN5A 3AQQA 4KLKA 3L2PA 3U50C 1V9PA 1WJJA 4OONA 1HZCA 4RG1A 1E1TA 1EIFA 3HKZE 4JOIA 4DR2L 1YI2A 4KHPQ 2QGQA 1MIUA 4A3IG 1LUZA 2ZM6L 4JI4L 4GKJQ 4LF4L 5J3BA 4JBKA 4POGA 1IZ6A 1EIYB 3JAMi 3K0XA 4A3CH 1XNQL 1OXUA 2K50A 3BZCA 4L5RC 3T1YQ 1NY4A 3I7FA 5M5WH 3TREA 4DK6C 4DUYL 3PUZA 4DR4L 1VCIA 2RHQB 2YTYA 3FHWA 2NVQH 2IT1A 1YJWA 4BXXG 2Z6KA 4OWTB 4LFAQ 2FXQA 4A3BG 2CKZB 3RR5A 4X65Q 5C44G 3CCLA 2IY5B 4GNXA 5C4JH 2UU9Q 4DV6Q 1I5FA 3OYYA 1Q82C 5C0XG 1JT8A 3FP9A 5GAEC 4DUZL 3MXNB 1MKHA 3UDXA 4NPSA 1L0WA 4HJAA 1N33L 3TRZA 2KENA 1HNZQ 1NE3A 3LGJA 3K8AA 3NBHB 1VQCA 1Y1VH 2JA6G 2YTXA 4X6AH 3JAMc 4IO9A 3KYHC 4BY1H 4A3JG 1VQPA 3HOWG 2UXDQ 1A63A 3GTJH 1Q1BA 4QIWE 2Q2UA 3F8TA 4JBJA 4NXMQ 2K5NA 2ZJPA 2Y0SE 4UPAA 3KF8B 3H0GH 4PMWA 4L5SA 2YTVA 2CQOA 4BBRH 3PGZA 4JI7L 4OO1G 1CKNB 4TQUS 4NB3A 1HNWL 4LFCQ 4XIGS 2K4KA 4YCVA 3CCUA 1J5EQ 2V1CC 1Z9FA 4LF9L 3RZOH 3PUYA 3HOZH 2CWAA 5C0XJ 2UXBL 4HJ8A 4X66L 4DV2L 4K0KQ 4L5QA 5LMNL 4JI2Q 2ASBA 1GKHA 1EOVA 5JJLA 4X64Q 3KJPA 2D0OA 5M5YH 3CMAA 3GTOH 1N32L 4HIDA 1IBML 4A3KG 4JV5L 1U0LA 3F2DA 4DV7Q 1NMGA 3D0FA 5FJ8G 4A3IH 2ZTDA 2XGTA 3HOUH 4AH6A 1CKOA 4LUZA 2OTLA 1VQEA 4DR7Q 3CF5A 1L2FA 3S2HH 4EQ5A 4QGUA 2N78A 3GTGH 4DR1Q 3HKSA 1I94Q 4JOIC 1B7YB 1D8LA 4DK3C 3S15H 4YCWA 3HOYH 5IWAL 1HNXL 2BH2A 1S3OA 1HNXQ 4LFBL 1XPOA 4A3BH 1LYLA 2NZHA 4A3DG 4BA1I 2WB1G 4JI4Q 2R7FA 1M1KC 1XNRL 1LTLA 3CP0A 2PQAA 3TEHB 4B3RQ 1P8LA 1PFSA 2VUMG 4EX5A 1HZAA 4LF8L 3GO5A 2NZOA 1KAWA 3AFQA 3K7AH 3UE1A 1XPUA 3CC4A 1GD7A 4IFDI 5HGQA 3CCMA 2UUCQ 4JI0L 3T1HQ 1TWHH 3GTKH 4BBSH 1QVCA 4OO1I 3KOJA 1L1OA 2NN6G 1PVOA 2LXJA 4HJ5A 1W2BA 4YY3L 4Y52H 4A3GH 3WWVA 4GNXB 3G71A 3HOWH 1C9OA 1VS0A 2KCMA 4H02A 3HOXG 4MTNA 1VQ4A 4OX9L 1BKBA 3PUWA 3CCJA 2ZJRA 4KHZA 1X56A 3I2ZA 2DGYA 1Y1VG 1JJ2A 2N8NA 1SN8A 5GROA 1VQLA 1QVFA 1NMFA 4BY1G 2WAQG 3J81i 4GLAC 2C35B 1EWIA 3K80C 1PH3A 1BVSA 3FKIH 5GADC 1Q1EA 3CC2A 4A3LH 2VNUD 4BBRG 4DV0L 4X62L 2MNAA 4JBWA 3PIPA 2E2IH 4BA2I 1E3PA 3G6EA 4A93H 2RF4A 2ZTCA 5AJ3L 3BJUA 1SRUA 1FJGQ 4PG3A 3HOZG 1V43A 4AIMA 1N8RC 4UP9A 5FJ8H 2E5LQ 2KHIA 1VQHA 1YBYA 1UE1A 3CPWA 2R93H 1OXXK 4HIMA 3I4NG 1X3EA 3I55A 2VW9A 1KRTA 3GD7A 4HIKA 4UP7A 4JI1L 1HR0L 1K73C 1V1QA 3CAMA 3E9IA 3GDEA 5H1SE 2UUBL 2MQHA 1U5KA 3J80i 1N36Q 4P72A 3M7NA 1TWGH 4DV3L 3HOUG 4C3JH 3PIOA 4DV5L 1IBMQ 4YWKA 1H95A 2D0PA 4JI3L 3HOVH 2NN6I 5E7NA 3A5ZB 2JK8A 4GKKQ 4JI8Q 4DAYB 2Q2TA 4A3DH 4R4QA 4O0AA 4GOPC 4LF7Q 3RZDH 3OTOQ 1AE2A 3B6YA 1VQ5A 4MNOA 1IBLL 2HHHQ 2VUMH 3HOYG 1E1OA 5IY0A 1PH4A 3AFPA 2D62A 1XMQQ 1VQBA 1EUJA 1IL2A 4B3MQ 5BR8L 2IX0A 4WJ4A 1BBUA 3HFZB 4LF5Q 2E8GA 5IWAQ 3CCEA 3PF5A 1XMOQ 4LWCA 2ID0A 1CSPA 2IX1A 3W1BA 1UWVA 1PYSB 4JYAL 2VZAA 3PUVA 2PQAB 3BU2A 4GN3B 3SGIA 3HOXH 5GAHC 4IPGA 4BBSG 3TS0A 3K81C 3CC7A 2RHSB 1Q46A 5DLQE 3ULJA 3S24A 5M3MH 4A3GG 3M3YH 1L1OC 1RIPA 3PSIA 4L5TA 3UDIA 4DR5Q 4DV1Q 2K14A 3NENA 4YY3Q 2A19A 1N9WA 1UE6A 5LMUQ 4AYBE 4PZ7A 2K75A 2JQOA 4R4CA 1AE3A 2QEXA 4TVAB 1KIXA 3GTLH 1YITA 1X3GA 1Q81C 1XPRA 2I5MX 2EIFA 4A3LG 3FKIG 1Y14B 4UP8A 1E22A 3K7UC 3KJOA 3UE0A 2R7ZH 2AHOB 3U58A 4A3FH 1N34Q 4A93G 2B63H 3GTQH 3OW2A 4JI6Q 3RNUA 2YYZA 1IBKQ 4B3SL 3I4NH 2PNHA 4KI0A 3PV0A 4JBMA 3EN2A 2VS1A 3VDYA 4NXNQ 1TWFH 5HY6A 4OWXB 4JI5L 4AQYQ 1SR3A 1VQ9A 2N49A 5M3FH 2R93G 3DLLA 4IJHA 1WCMG 1KHIA 4GOPA 3E0EA 1PHJA 2UUAQ 3ICEA 4POFA 1VQNA 3S16H 5IYDH 1KD1C 5C0XI 1YJ9A 1S72A 1MJEA 4B3TL 4C3HH 4GLXA 1YJNA 4GN4B 5M5XH 2NVXH 1QUQA 1SMXA 1PA6A 4KHPL 2CCZA 1HR0Q 1YIJA 4DR2Q 4QJFA 3HOVG 1PH5A 3Q8DA 4GS3A 4WJ3M 3I4OA 4GKJL 3M85A 1QZHA 2ZM6Q 1JJCB 3A5UA 4LF4Q 2PI2E 4A3MH 4IJLA 3L7ZC 1S40A 1FL0A 1XNQQ 4QQBX 3T1YL 2K52A 2BH8A 2B29A 2HIXA 2HIVA 1NBWA 4DUYQ 1VQIA 2OQ0A 3AYHB 4DR4Q 4IOAA 5IP7H 1PH9A 2ZJQA 4LFAL 3EIVA 3CD6A 4X65L 3G4SA 2BA1A 3F2CA 3CCRA 1Q12A 1VQAA 4R1JA 1VQFA 1JB7A 1EYGA 1Z47A 1I3QH 2JE6I 1UEBA 2JEAI 2Q2HA 3M4OH 3U4ZA 3H3VH 5JEAG 1X54A 2RCNA 2QA4A 4DUZQ 3PO3H 1PH8A 1KRSA 4YCUA 2Q2IA 5M3MG 2WB1E 1ASZA 1N33Q 4JYAQ 3ERSX 3W5OA 2JA5G 1HJPA 2GVBA 3H15A 1JJGA 4DKAC 4P71A 3RLFA 2UXDL 2OQKA 3D31A 2VQEL 4HJ7A 3NEMA 2NVYH 1E7ZA 4NXML 1ASYA 2Z0SA 1QVGA 2E2JH 1C0AA 4JI7Q 2JJQA 3M4PA 2VY3A 4LFCL 4A3EH 1A62A 2LXKA 2R7ZG 1HNWQ 1VQOA 1KC8C 4YWMA 4A3FG 4DR6L 4LF9Q 2B63G 3CCVA 2H5XA 1VQDA 2JA8H 1WCMH 3HKZG 2PMZE 2UXBQ 2WAQE 5JEAJ 4K0KL 4X66Q 4JI2L 4LUOA 4DV2Q 1VQGA 5LMNQ 3RLOA 1M90C 2AWNA 1N32Q 5M3FG 3J81c 1SFOH 3F1ZA 4DV7L 5IYCH 2JA7G 4JV5Q 2KHJA 1IXRA 2AMCB 5IYDG 3I56A 5JJIA 1JE5A 4OXPA 3ULPA 3PF4A 5C3EG 1X55A 4LW1A 1K8GA 2EQSA 1Y1WH 4DR7L 4GOPB 2UXCL 1NTGA 4R4OA 1X65A 1YZ6A 2MO0A 1OXTA 2WP8J 2KBNA 1YHAA 1HZBA 1EQRA 4B3TQ 4DR1L 1I94L 5C44H 1QUQB 2VL6A 5IT9c 1UE7A 1RL2A 1IYJB 4A3MG 1T9HA 1A8VA 1B70B 3KF6A 2DUDA 3A74A 3CXCA 4PZ6A 2OCEA 3W1GA 2VQFL 1VQMA 1GM5A 1OXVA 5C4XH 4B3RL 2MFIA 1XNRQ 2F3IA 3J81j 3J80c 2AKWB 4LF8Q 5IP7G 4LF6L 1YEZA 1FGUA 4DV4L 5IE8A 2UUCL 5FLMG 2IHEA 3T1HL 1VQ6A 2OTJA 4JI0Q 2R92H 5IP9H 1I50H 1CUKA 3CQZH 2JA5H 1NJIC 1L1OB 4BY7H 4ME3A 4HIOA 2F4VL 2K5HA 3EBEA 2Y0SG 1YHBA 5K36G 3RN5A 2HT1A 1VQJA 4FDBA 1PH1A 3AEVA 4AYBG 3PO3G 4QL5A 2CFMA 1KXLA 4J15A 3M9BA 1KQSA 4YHHL 5IYBH 1HZ9A 4OX9Q 2HQLA 1K83H 1DGSA 1Q8KA 2ES2A 5JJKA 4DNIA 1TWCH 1GO3E 1AH9A 3F2BA 2I0QA 3GTPH 4IPCA 1X6OA 4XTCS 3S2DH 1PYBA 1TXYA 3CPFA 1X3FA 3KDFA 3S14H 3G48A 3RN2A 4DV0Q 2BA0A 3ER0A 4GLVB 4X62Q 2VQEQ 2NVTH 2CWPA 4A3EG 2ATWA 3PO2H 3TS2A 4IFDG 1SROA 3BZKA 5AJ3Q 1FJGL 2A8VA 4DR3L 3S1MH 4P73A 2JA8G 1Q86C 1C7YA 2JA7H 2KCTA 2N3SA 3NELA 2E5LL 1Q7YC 4DR6Q 1GVPA 1HH2P 5C3EH 4OWWB 1HR0W 2LSSA 4P74A 4YWLA 4GN5A 3UDFA 1K3RA 3RLNA 2PI2A 2JA9A 4JI1Q 5IYCG 2I5LX 4UY8C 1PH2A 1N36L 1E24A 1YNXA 4A76A 2UUBQ 4P75A 2WFWA 2XTIA 5FLXc 4QY7A 4DV3Q 4IPHA 1Y1WG 2I5HA 3A0JA 4DV5Q 1CKMA 1K0RA 1P16A 4JI3Q 4JI8L 3I4MG 4GKKL 3M4QA 1I6HH 2AWOA 1WYDA 3H3VI 1W3SA 4LF7L 1MJCA 3OTOL 1OTCA 1FVIA 1QZGA 3CW2C 5ELOA 1EFWA 1WOCA 2HHHL 2UXCQ 1IBLQ 4IFDJ 4PZ8A 1XMQL 4R4IA 1B8AA 2EXDA 4B3ML 3S1QH 2YV5A 4JC0A 4A75A 3STBD 5FLMH 5BR8Q 5C4XG 1K9MC 3ZJYC 2UU9L 5ELNA 4DV6L 4LNQA 4LF5L 1LM0A 4BXXH 4A3CG 2A1AA 3KF6B 1PH6A 1XMOL 4IOCA 1R9TH 1PH7A 2VQFQ 1YVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UE5 A;  1EQQ A;  4A4I A;  1D7Q A;  2MO1 A;  2R92 G;  5IP9 G;  5GAG C;  1HNZ L;  3JC6 6;  3PUX A;  4BY7 G;  3L0O A;  3STB C;  4JCV E;  1CSQ A;  4LF6 Q;  4DV4 Q;  3S1R H;  1G51 A;  2IHF A;  1SE8 A;  4IPD A;  1SLJ A;  2Z6K C;  4DR5 L;  4DV1 L;  3GTM H;  1JMC A;  3KFU A;  3S1N H;  1WFQ A;  5IYB G;  2JA6 H;  2F4V Q;  2OWO A;  4GNX C;  2R7D A;  3ULL A;  5LMU L;  3KLW A;  4A3J H;  1VQ8 A;  1CKN A;  1OXS C;  1A0I A;  4YHH Q;  2R6G A;  4DAM A;  2L15 A;  3IRB A;  2B3G A;  3E9H A;  4LUV A;  1TWA H;  1G29 1;  3J7Z C;  4RMF A;  1J5E L;  2E2H H;  2YU9 H;  2F52 A;  1WI5 A;  4Y7N H;  4LFB Q;  4C3I H;  3UDG A;  4C2M H;  2K5V A;  1K8A C;  4R4T A;  4DPG A;  1O7I A;  5LMN W;  1PV4 A;  3PO2 G;  1N34 L;  3CCS A;  3DM3 A;  4X64 L;  4ALP A;  1XJV A;  3H0G G;  3MEF A;  1IBK L;  3KDF B;  4JI6 L;  3J7A 5;  5GQO A;  1X9N A;  4JG2 A;  4B3S Q;  3S17 H;  1J6Q A;  1KL9 A;  4O2D A;  4NXN L;  1VQK A;  3CME A;  2JEB I;  3PCO B;  4AQY L;  1XTD A;  3U4V A;  1VQ7 A;  4JI5 Q;  2GVA A;  4MZ9 A;  4A3K H;  4DR3 Q;  3CCQ A;  2UUA L;  3TQY A;  1YHQ A;  1G6P A;  2ZTE A;  3I4M H;  4HJ9 A;  5EAY A;  4APV A;  1BBW A;  2ALY B;  2GN5 A;  3AQQ A;  4KLK A;  3L2P A;  3U50 C;  1V9P A;  1WJJ A;  4OON A;  1HZC A;  4RG1 A;  1E1T A;  1EIF A;  3HKZ E;  4JOI A;  4DR2 L;  1YI2 A;  4KHP Q;  2QGQ A;  1MIU A;  4A3I G;  1LUZ A;  2ZM6 L;  4JI4 L;  4GKJ Q;  4LF4 L;  5J3B A;  4JBK A;  4POG A;  1IZ6 A;  1EIY B;  3JAM i;  3K0X A;  4A3C H;  1XNQ L;  1OXU A;  2K50 A;  3BZC A;  4L5R C;  3T1Y Q;  1NY4 A;  3I7F A;  5M5W H;  3TRE A;  4DK6 C;  4DUY L;  3PUZ A;  4DR4 L;  1VCI A;  2RHQ B;  2YTY A;  3FHW A;  2NVQ H;  2IT1 A;  1YJW A;  4BXX G;  2Z6K A;  4OWT B;  4LFA Q;  2FXQ A;  4A3B G;  2CKZ B;  3RR5 A;  4X65 Q;  5C44 G;  3CCL A;  2IY5 B;  4GNX A;  5C4J H;  2UU9 Q;  4DV6 Q;  1I5F A;  3OYY A;  1Q82 C;  5C0X G;  1JT8 A;  3FP9 A;  5GAE C;  4DUZ L;  3MXN B;  1MKH A;  3UDX A;  4NPS A;  1L0W A;  4HJA A;  1N33 L;  3TRZ A;  2KEN A;  1HNZ Q;  1NE3 A;  3LGJ A;  3K8A A;  3NBH B;  1VQC A;  1Y1V H;  2JA6 G;  2YTX A;  4X6A H;  3JAM c;  4IO9 A;  3KYH C;  4BY1 H;  4A3J G;  1VQP A;  3HOW G;  2UXD Q;  1A63 A;  3GTJ H;  1Q1B A;  4QIW E;  2Q2U A;  3F8T A;  4JBJ A;  4NXM Q;  2K5N A;  2ZJP A;  2Y0S E;  4UPA A;  3KF8 B;  3H0G H;  4PMW A;  4L5S A;  2YTV A;  2CQO A;  4BBR H;  3PGZ A;  4JI7 L;  4OO1 G;  1CKN B;  4TQU S;  4NB3 A;  1HNW L;  4LFC Q;  4XIG S;  2K4K A;  4YCV A;  3CCU A;  1J5E Q;  2V1C C;  1Z9F A;  4LF9 L;  3RZO H;  3PUY A;  3HOZ H;  2CWA A;  5C0X J;  2UXB L;  4HJ8 A;  4X66 L;  4DV2 L;  4K0K Q;  4L5Q A;  5LMN L;  4JI2 Q;  2ASB A;  1GKH A;  1EOV A;  5JJL A;  4X64 Q;  3KJP A;  2D0O A;  5M5Y H;  3CMA A;  3GTO H;  1N32 L;  4HID A;  1IBM L;  4A3K G;  4JV5 L;  1U0L A;  3F2D A;  4DV7 Q;  1NMG A;  3D0F A;  5FJ8 G;  4A3I H;  2ZTD A;  2XGT A;  3HOU H;  4AH6 A;  1CKO A;  4LUZ A;  2OTL A;  1VQE A;  4DR7 Q;  3CF5 A;  1L2F A;  3S2H H;  4EQ5 A;  4QGU A;  2N78 A;  3GTG H;  4DR1 Q;  3HKS A;  1I94 Q;  4JOI C;  1B7Y B;  1D8L A;  4DK3 C;  3S15 H;  4YCW A;  3HOY H;  5IWA L;  1HNX L;  2BH2 A;  1S3O A;  1HNX Q;  4LFB L;  1XPO A;  4A3B H;  1LYL A;  2NZH A;  4A3D G;  4BA1 I;  2WB1 G;  4JI4 Q;  2R7F A;  1M1K C;  1XNR L;  1LTL A;  3CP0 A;  2PQA A;  3TEH B;  4B3R Q;  1P8L A;  1PFS A;  2VUM G;  4EX5 A;  1HZA A;  4LF8 L;  3GO5 A;  2NZO A;  1KAW A;  3AFQ A;  3K7A H;  3UE1 A;  1XPU A;  3CC4 A;  1GD7 A;  4IFD I;  5HGQ A;  3CCM A;  2UUC Q;  4JI0 L;  3T1H Q;  1TWH H;  3GTK H;  4BBS H;  1QVC A;  4OO1 I;  3KOJ A;  1L1O A;  2NN6 G;  1PVO A;  2LXJ A;  4HJ5 A;  1W2B A;  4YY3 L;  4Y52 H;  4A3G H;  3WWV A;  4GNX B;  3G71 A;  3HOW H;  1C9O A;  1VS0 A;  2KCM A;  4H02 A;  3HOX G;  4MTN A;  1VQ4 A;  4OX9 L;  1BKB A;  3PUW A;  3CCJ A;  2ZJR A;  4KHZ A;  1X56 A;  3I2Z A;  2DGY A;  1Y1V G;  1JJ2 A;  2N8N A;  1SN8 A;  5GRO A;  1VQL A;  1QVF A;  1NMF A;  4BY1 G;  2WAQ G;  3J81 i;  4GLA C;  2C35 B;  1EWI A;  3K80 C;  1PH3 A;  1BVS A;  3FKI H;  5GAD C;  1Q1E A;  3CC2 A;  4A3L H;  2VNU D;  4BBR G;  4DV0 L;  4X62 L;  2MNA A;  4JBW A;  3PIP A;  2E2I H;  4BA2 I;  1E3P A;  3G6E A;  4A93 H;  2RF4 A;  2ZTC A;  5AJ3 L;  3BJU A;  1SRU A;  1FJG Q;  4PG3 A;  3HOZ G;  1V43 A;  4AIM A;  1N8R C;  4UP9 A;  5FJ8 H;  2E5L Q;  2KHI A;  1VQH A;  1YBY A;  1UE1 A;  3CPW A;  2R93 H;  1OXX K;  4HIM A;  3I4N G;  1X3E A;  3I55 A;  2VW9 A;  1KRT A;  3GD7 A;  4HIK A;  4UP7 A;  4JI1 L;  1HR0 L;  1K73 C;  1V1Q A;  3CAM A;  3E9I A;  3GDE A;  5H1S E;  2UUB L;  2MQH A;  1U5K A;  3J80 i;  1N36 Q;  4P72 A;  3M7N A;  1TWG H;  4DV3 L;  3HOU G;  4C3J H;  3PIO A;  4DV5 L;  1IBM Q;  4YWK A;  1H95 A;  2D0P A;  4JI3 L;  3HOV H;  2NN6 I;  5E7N A;  3A5Z B;  2JK8 A;  4GKK Q;  4JI8 Q;  4DAY B;  2Q2T A;  4A3D H;  4R4Q A;  4O0A A;  4GOP C;  4LF7 Q;  3RZD H;  3OTO Q;  1AE2 A;  3B6Y A;  1VQ5 A;  4MNO A;  1IBL L;  2HHH Q;  2VUM H;  3HOY G;  1E1O A;  5IY0 A;  1PH4 A;  3AFP A;  2D62 A;  1XMQ Q;  1VQB A;  1EUJ A;  1IL2 A;  4B3M Q;  5BR8 L;  2IX0 A;  4WJ4 A;  1BBU A;  3HFZ B;  4LF5 Q;  2E8G A;  5IWA Q;  3CCE A;  3PF5 A;  1XMO Q;  4LWC A;  2ID0 A;  1CSP A;  2IX1 A;  3W1B A;  1UWV A;  1PYS B;  4JYA L;  2VZA A;  3PUV A;  2PQA B;  3BU2 A;  4GN3 B;  3SGI A;  3HOX H;  5GAH C;  4IPG A;  4BBS G;  3TS0 A;  3K81 C;  3CC7 A;  2RHS B;  1Q46 A;  5DLQ E;  3ULJ A;  3S24 A;  5M3M H;  4A3G G;  3M3Y H;  1L1O C;  1RIP A;  3PSI A;  4L5T A;  3UDI A;  4DR5 Q;  4DV1 Q;  2K14 A;  3NEN A;  4YY3 Q;  2A19 A;  1N9W A;  1UE6 A;  5LMU Q;  4AYB E;  4PZ7 A;  2K75 A;  2JQO A;  4R4C A;  1AE3 A;  2QEX A;  4TVA B;  1KIX A;  3GTL H;  1YIT A;  1X3G A;  1Q81 C;  1XPR A;  2I5M X;  2EIF A;  4A3L G;  3FKI G;  1Y14 B;  4UP8 A;  1E22 A;  3K7U C;  3KJO A;  3UE0 A;  2R7Z H;  2AHO B;  3U58 A;  4A3F H;  1N34 Q;  4A93 G;  2B63 H;  3GTQ H;  3OW2 A;  4JI6 Q;  3RNU A;  2YYZ A;  1IBK Q;  4B3S L;  3I4N H;  2PNH A;  4KI0 A;  3PV0 A;  4JBM A;  3EN2 A;  2VS1 A;  3VDY A;  4NXN Q;  1TWF H;  5HY6 A;  4OWX B;  4JI5 L;  4AQY Q;  1SR3 A;  1VQ9 A;  2N49 A;  5M3F H;  2R93 G;  3DLL A;  4IJH A;  1WCM G;  1KHI A;  4GOP A;  3E0E A;  1PHJ A;  2UUA Q;  3ICE A;  4POF A;  1VQN A;  3S16 H;  5IYD H;  1KD1 C;  5C0X I;  1YJ9 A;  1S72 A;  1MJE A;  4B3T L;  4C3H H;  4GLX A;  1YJN A;  4GN4 B;  5M5X H;  2NVX H;  1QUQ A;  1SMX A;  1PA6 A;  4KHP L;  2CCZ A;  1HR0 Q;  1YIJ A;  4DR2 Q;  4QJF A;  3HOV G;  1PH5 A;  3Q8D A;  4GS3 A;  4WJ3 M;  3I4O A;  4GKJ L;  3M85 A;  1QZH A;  2ZM6 Q;  1JJC B;  3A5U A;  4LF4 Q;  2PI2 E;  4A3M H;  4IJL A;  3L7Z C;  1S40 A;  1FL0 A;  1XNQ Q;  4QQB X;  3T1Y L;  2K52 A;  2BH8 A;  2B29 A;  2HIX A;  2HIV A;  1NBW A;  4DUY Q;  1VQI A;  2OQ0 A;  3AYH B;  4DR4 Q;  4IOA A;  5IP7 H;  1PH9 A;  2ZJQ A;  4LFA L;  3EIV A;  3CD6 A;  4X65 L;  3G4S A;  2BA1 A;  3F2C A;  3CCR A;  1Q12 A;  1VQA A;  4R1J A;  1VQF A;  1JB7 A;  1EYG A;  1Z47 A;  1I3Q H;  2JE6 I;  1UEB A;  2JEA I;  2Q2H A;  3M4O H;  3U4Z A;  3H3V H;  5JEA G;  1X54 A;  2RCN A;  2QA4 A;  4DUZ Q;  3PO3 H;  1PH8 A;  1KRS A;  4YCU A;  2Q2I A;  5M3M G;  2WB1 E;  1ASZ A;  1N33 Q;  4JYA Q;  3ERS X;  3W5O A;  2JA5 G;  1HJP A;  2GVB A;  3H15 A;  1JJG A;  4DKA C;  4P71 A;  3RLF A;  2UXD L;  2OQK A;  3D31 A;  2VQE L;  4HJ7 A;  3NEM A;  2NVY H;  1E7Z A;  4NXM L;  1ASY A;  2Z0S A;  1QVG A;  2E2J H;  1C0A A;  4JI7 Q;  2JJQ A;  3M4P A;  2VY3 A;  4LFC L;  4A3E H;  1A62 A;  2LXK A;  2R7Z G;  1HNW Q;  1VQO A;  1KC8 C;  4YWM A;  4A3F G;  4DR6 L;  4LF9 Q;  2B63 G;  3CCV A;  2H5X A;  1VQD A;  2JA8 H;  1WCM H;  3HKZ G;  2PMZ E;  2UXB Q;  2WAQ E;  5JEA J;  4K0K L;  4X66 Q;  4JI2 L;  4LUO A;  4DV2 Q;  1VQG A;  5LMN Q;  3RLO A;  1M90 C;  2AWN A;  1N32 Q;  5M3F G;  3J81 c;  1SFO H;  3F1Z A;  4DV7 L;  5IYC H;  2JA7 G;  4JV5 Q;  2KHJ A;  1IXR A;  2AMC B;  5IYD G;  3I56 A;  5JJI A;  1JE5 A;  4OXP A;  3ULP A;  3PF4 A;  5C3E G;  1X55 A;  4LW1 A;  1K8G A;  2EQS A;  1Y1W H;  4DR7 L;  4GOP B;  2UXC L;  1NTG A;  4R4O A;  1X65 A;  1YZ6 A;  2MO0 A;  1OXT A;  2WP8 J;  2KBN A;  1YHA A;  1HZB A;  1EQR A;  4B3T Q;  4DR1 L;  1I94 L;  5C44 H;  1QUQ B;  2VL6 A;  5IT9 c;  1UE7 A;  1RL2 A;  1IYJ B;  4A3M G;  1T9H A;  1A8V A;  1B70 B;  3KF6 A;  2DUD A;  3A74 A;  3CXC A;  4PZ6 A;  2OCE A;  3W1G A;  2VQF L;  1VQM A;  1GM5 A;  1OXV A;  5C4X H;  4B3R L;  2MFI A;  1XNR Q;  2F3I A;  3J81 j;  3J80 c;  2AKW B;  4LF8 Q;  5IP7 G;  4LF6 L;  1YEZ A;  1FGU A;  4DV4 L;  5IE8 A;  2UUC L;  5FLM G;  2IHE A;  3T1H L;  1VQ6 A;  2OTJ A;  4JI0 Q;  2R92 H;  5IP9 H;  1I50 H;  1CUK A;  3CQZ H;  2JA5 H;  1NJI C;  1L1O B;  4BY7 H;  4ME3 A;  4HIO A;  2F4V L;  2K5H A;  3EBE A;  2Y0S G;  1YHB A;  5K36 G;  3RN5 A;  2HT1 A;  1VQJ A;  4FDB A;  1PH1 A;  3AEV A;  4AYB G;  3PO3 G;  4QL5 A;  2CFM A;  1KXL A;  4J15 A;  3M9B A;  1KQS A;  4YHH L;  5IYB H;  1HZ9 A;  4OX9 Q;  2HQL A;  1K83 H;  1DGS A;  1Q8K A;  2ES2 A;  5JJK A;  4DNI A;  1TWC H;  1GO3 E;  1AH9 A;  3F2B A;  2I0Q A;  3GTP H;  4IPC A;  1X6O A;  4XTC S;  3S2D H;  1PYB A;  1TXY A;  3CPF A;  1X3F A;  3KDF A;  3S14 H;  3G48 A;  3RN2 A;  4DV0 Q;  2BA0 A;  3ER0 A;  4GLV B;  4X62 Q;  2VQE Q;  2NVT H;  2CWP A;  4A3E G;  2ATW A;  3PO2 H;  3TS2 A;  4IFD G;  1SRO A;  3BZK A;  5AJ3 Q;  1FJG L;  2A8V A;  4DR3 L;  3S1M H;  4P73 A;  2JA8 G;  1Q86 C;  1C7Y A;  2JA7 H;  2KCT A;  2N3S A;  3NEL A;  2E5L L;  1Q7Y C;  4DR6 Q;  1GVP A;  1HH2 P;  5C3E H;  4OWW B;  1HR0 W;  2LSS A;  4P74 A;  4YWL A;  4GN5 A;  3UDF A;  1K3R A;  3RLN A;  2PI2 A;  2JA9 A;  4JI1 Q;  5IYC G;  2I5L X;  4UY8 C;  1PH2 A;  1N36 L;  1E24 A;  1YNX A;  4A76 A;  2UUB Q;  4P75 A;  2WFW A;  2XTI A;  5FLX c;  4QY7 A;  4DV3 Q;  4IPH A;  1Y1W G;  2I5H A;  3A0J A;  4DV5 Q;  1CKM A;  1K0R A;  1P16 A;  4JI3 Q;  4JI8 L;  3I4M G;  4GKK L;  3M4Q A;  1I6H H;  2AWO A;  1WYD A;  3H3V I;  1W3S A;  4LF7 L;  1MJC A;  3OTO L;  1OTC A;  1FVI A;  1QZG A;  3CW2 C;  5ELO A;  1EFW A;  1WOC A;  2HHH L;  2UXC Q;  1IBL Q;  4IFD J;  4PZ8 A;  1XMQ L;  4R4I A;  1B8A A;  2EXD A;  4B3M L;  3S1Q H;  2YV5 A;  4JC0 A;  4A75 A;  3STB D;  5FLM H;  5BR8 Q;  5C4X G;  1K9M C;  3ZJY C;  2UU9 L;  5ELN A;  4DV6 L;  4LNQ A;  4LF5 L;  1LM0 A;  4BXX H;  4A3C G;  2A1A A;  3KF6 B;  1PH6 A;  1XMO L;  4IOC A;  1R9T H;  1PH7 A;  2VQF Q;  1YVC A; 
#chains in the Genus database with same CATH topology
 1UE5 A;  2B2T C;  5EBC A;  5IP9 G;  4JCV E;  1KTK A;  1PTO D;  2IHF A;  4DV1 L;  1BF4 A;  3KFU A;  2Z4I A;  2JA6 H;  2R7D A;  3KF8 A;  5LMU L;  1SMY C;  4XQN A;  1A0I A;  2KEC A;  1LTS D;  4YHH Q;  2Z9H A;  4LUV A;  2E2H H;  1IKL A;  4FF3 A;  2HDM A;  4RMF A;  3EJI A;  1WI5 A;  1HA5 A;  2ICE C;  4QF4 A;  4DPG A;  2FJ2 A;  1O7I A;  2Z4H A;  2A69 D;  3VYR A;  1N34 L;  2K05 A;  4U67 3;  4JI6 L;  4A3E B;  2YU9 B;  1EZ8 A;  4H44 C;  5GQO A;  4O2D A;  3CME A;  4C2M B;  3U4V A;  2MHV A;  4XXE A;  1JWM D;  4A3K H;  2UUA L;  2M2L A;  3I4M H;  3V96 A;  4KLK A;  2VB2 X;  3MA2 B;  3D6W A;  4OIJ A;  1YI2 A;  3X3N A;  4ZUJ A;  2LFN A;  3KK7 A;  4JBK A;  1L0X B;  1IZ6 A;  5KND A;  3JAM i;  1WTQ A;  4CGY B;  4A3C H;  2D9U A;  1YNN C;  2PPB C;  1NY4 A;  5M5W H;  3MEH A;  3PUZ A;  3FHW A;  2YTY A;  3HRZ C;  4CBV A;  5DM7 3;  4LFA Q;  2CKZ B;  2I07 B;  3RR5 A;  4DFA A;  5C44 G;  3CCL A;  4GNX A;  3TDQ A;  2NN6 H;  4XYQ A;  3OYY A;  4DUZ L;  1K8M A;  3UDX A;  3TRZ A;  4RHR A;  1EU4 A;  5EPJ A;  3NBH B;  5C4J B;  4RGT A;  3JAM c;  4IO9 A;  3MC0 B;  1DYQ A;  4IN3 A;  5EPL A;  4A3J G;  3NTH A;  1A63 A;  3F8T A;  4JBJ A;  4KMU C;  2ZJP A;  1H9R A;  3H0G H;  4OO1 G;  5IGF A;  3NWT A;  4C3I G;  1BQQ T;  1F9S A;  5FK9 C;  4BY1 B;  1B3Q A;  2PMZ B;  2WAQ B;  3R8B A;  3ND8 A;  1J5E Q;  1BR9 A;  2R3Z A;  2V1C C;  3GTJ B;  2BDN A;  5BN4 A;  3RZO H;  2FHT A;  5BN3 A;  5C0X J;  4BBR B;  4DV2 L;  4K0K Q;  4L5Q A;  5LMN L;  4JI2 Q;  2ASB A;  2F0U A;  5IGE A;  1EOV A;  2SNS A;  5JJL A;  4X64 Q;  3JAM L;  5M5Y H;  3CMA A;  4HID A;  1U0L A;  1Y8O B;  1EIG A;  2A73 B;  3L9A X;  1EWH A;  3HOU H;  5JVG 3;  4QCL A;  1JCK B;  5IOD A;  3GTO B;  3CF5 A;  2A6H D;  5C3W A;  4YCW A;  1HFN A;  1HNX L;  4LFB L;  1S3O A;  1LYL A;  4BA1 I;  4RFB A;  1MI2 A;  4ZQ3 A;  3S2H B;  1LTL A;  2G9H D;  3CP0 A;  3DEO A;  1PFS A;  3WDN A;  5C0X H;  4EX5 A;  1O7L A;  3AFQ A;  3S15 B;  1GD7 A;  4RHS A;  5HGQ A;  3CCM A;  2UUC Q;  3KOJ A;  1L1O A;  1NSN S;  1PVO A;  5FO7 B;  4HJ5 A;  4YY3 L;  3WWV A;  5IT9 E;  3G71 A;  1VS0 A;  1E2Z A;  4JVZ A;  3HOX G;  2QEJ C;  4KJO A;  1VQ4 A;  3CCJ A;  4MIU A;  4CDC C;  4CJ2 C;  2ZJR A;  1QNK A;  1X56 A;  2DGY A;  1JJ2 A;  3GV3 A;  2N8N A;  3A54 A;  1T5X D;  4Z9C B;  2C35 B;  3HOW B;  3H3V C;  1PH3 A;  3CC2 A;  3FKI H;  4G7O C;  3KLR A;  4CKC A;  4JBW A;  3PIP A;  1SYG A;  3AB9 A;  4BA2 I;  1EY9 A;  4A93 H;  2F0W A;  1LT4 D;  2RF4 A;  3MXU A;  1TQO A;  2SNM A;  4FF1 A;  2O5J C;  4PG3 A;  4IUT A;  1SEB D;  3E0J A;  4NMZ A;  1N8R C;  5FJ8 H;  3CPW A;  1UE1 A;  2R93 H;  3I55 A;  4EQN A;  1BO0 A;  4JI1 L;  1HR0 L;  3P75 A;  4KY6 A;  1FNV A;  1U4L A;  2D0P A;  4JI3 L;  4DXF A;  2NN6 I;  2AUK A;  4JI8 Q;  4HCS A;  4GKK Q;  2K6A A;  5HUR A;  2BE5 C;  2HHH Q;  2VUM H;  2MGS A;  1JC7 A;  1XMQ Q;  5ISR A;  1D1K A;  1B9N A;  1I4H A;  3HFZ B;  1XX8 A;  5D3D A;  3FMC A;  5IWA Q;  1ICF B;  1SXT A;  1WTR A;  3W1B A;  1PYS B;  4JYA L;  1ESR A;  2HCI A;  1XTC D;  2VZA A;  1A3T A;  5GAH C;  4BBS G;  3LWE A;  2WII B;  3QOJ A;  5DLQ E;  2B2Y C;  4OEL B;  3ULJ A;  3PIO 3;  4A3G G;  1EQV A;  1L1O C;  1RIP A;  3PSI A;  4ODG A;  3UDI A;  4DV1 Q;  2F0K A;  4IUP A;  3NEN A;  2A19 A;  5LMU Q;  1KAB A;  4X3S A;  2A6E D;  4AYB E;  2K75 A;  2JXM B;  2RVL A;  4R4C A;  1YIT A;  1QWY A;  4G7Z C;  4A3L G;  3OWF A;  1E22 A;  3K7U C;  4ZCK A;  5K5P A;  5A2Q E;  2R7Z H;  4IUU A;  3U58 A;  1R4P B;  1N34 Q;  4ME5 A;  3OW2 A;  4JI6 Q;  4K5V A;  1BUV T;  1BCP F;  2F0M A;  4FVM A;  5KEE A;  1VQ9 A;  3GTQ B;  3E0E A;  2UUA Q;  1SYE A;  5J22 A;  4WJW A;  1KD1 C;  5C0X I;  1MJE A;  1MD2 D;  4GN4 B;  1F2M A;  2LMC B;  2CCZ A;  3HP3 A;  3Q8D A;  3VYU A;  4R8I A;  4I7Z C;  1QZH A;  5EKL A;  1JJC B;  3R3O A;  2F0P A;  4LJZ C;  4C3H B;  3SXH A;  4F8M A;  4DGZ A;  4QQB X;  5C4Z A;  3T1Y L;  2HIX A;  5CBE E;  1VQI A;  2F0O A;  3AYH B;  2F0J A;  1CZG A;  4A3M B;  2F0I A;  3OIP A;  3CD6 A;  4X65 L;  3CCR A;  1Q12 A;  1STA A;  1VQA A;  1IW7 C;  1EYG A;  1UEB A;  3M4O H;  2Q8I B;  3U4Z A;  1X54 A;  4DUZ Q;  2Q2I A;  1F9Q A;  1ASZ A;  2DJG C;  1DZ1 A;  2GVB A;  1KDB A;  3H15 A;  1JOR A;  3Q22 A;  3C1F A;  1JJG A;  1BCP C;  1CHP D;  3BVG A;  1I4Q A;  1DCZ A;  4R8N A;  1E7Z A;  4NXM L;  1ASY A;  2Z0S A;  2EPB A;  1JR0 D;  1WTW A;  1C0A A;  2SOB A;  3M4P A;  2Q8R E;  1A62 A;  1HTP A;  1M8A A;  1KC8 C;  4A3F G;  2DN8 A;  3V05 A;  4DR6 L;  3QB3 A;  2B63 G;  1SNO A;  1VQD A;  1I4G A;  3GV6 A;  1WCM H;  4CDE C;  3NK9 A;  4DV2 Q;  2R61 A;  5LMN Q;  3E3X A;  2K7V A;  2XRQ D;  3F1Z A;  2JA7 G;  3A8J E;  3QOL A;  5IYD G;  3PF4 A;  5C3E G;  1X55 A;  4LW1 A;  1K8G A;  3FPU B;  2H4O A;  4FF4 A;  5NUC A;  4DR7 L;  4R4O A;  1X65 A;  4KKS A;  1YZ6 A;  2EXZ A;  2WP8 J;  2KBN A;  1HZB A;  4B3T Q;  3TP7 A;  1IYJ B;  5E1F A;  1A8V A;  1HNX Q;  4LFB Q;  3W1G A;  2OCE A;  1OXV A;  4B3R L;  3A8I E;  2F3I A;  2F4I A;  1WD0 A;  2R92 H;  1L1O B;  4N9P A;  3D8G A;  2HT1 A;  1F2L A;  1CZW A;  3TZD A;  3M9B A;  4YHH L;  1HZ9 A;  1VF7 A;  3K5O A;  1Y8P B;  3T13 A;  1DGS A;  5E3F A;  1I4X A;  2XIW A;  1TWC H;  1FR3 A;  1AW7 A;  1AH9 A;  3GTP H;  4DAP A;  4KD3 A;  1BDO A;  1NAP A;  3Q24 A;  3S2D H;  1CT1 D;  4PMC A;  3NE5 B;  4K8J A;  1PFB A;  2BA0 A;  3H09 A;  4QUF A;  3PO2 H;  1I4R A;  5J1Z A;  2R7Z B;  3S1M H;  1KDC A;  3S14 B;  2E76 C;  4JPB W;  5I2X A;  1GVP A;  1HH2 P;  2NZ1 D;  4YWL A;  4P74 A;  3OWE B;  4LMQ D;  4RWS C;  5C6A A;  4JI1 Q;  5IYC G;  3MXG A;  1PH2 A;  1N36 L;  1E24 A;  1YNX A;  2PNR C;  2EYJ A;  2WFW A;  4QY7 A;  5IGB A;  1Y1W G;  2I5H A;  1EY5 A;  3I4M G;  4JI3 Q;  4DAY A;  4DK0 A;  1GHK A;  1SNQ A;  1QZG A;  2RCF A;  1WOC A;  4U68 A;  4IFD J;  3T56 B;  3MXP A;  4IOA A;  4B3M L;  4A75 A;  5FLM H;  4HMI A;  1EY4 A;  2N88 A;  2EZV A;  4TSS A;  4BXX H;  4A3C G;  4RKL A;  2A1A A;  3KF6 B;  1PH6 A;  2FMM A;  3NXW A;  2VQF Q;  3VR6 A;  3OSO A;  4A4I A;  1EY7 A;  2MO1 A;  3PUX A;  3STB C;  1CSQ A;  4L6T B;  2KOL A;  3QO2 A;  1BCP B;  5C44 B;  2Z6K C;  1AEX A;  4AYB B;  2F4V Q;  2OWO A;  3ULL A;  1BOS A;  1V8Q A;  2K5D A;  2YU9 H;  5ELB A;  1J5E L;  4IFD H;  3S1N B;  1IKM A;  5I6W A;  4C2M H;  1RCV D;  4A3J B;  5LMN W;  3I4L A;  4IUR A;  4X64 L;  4ALP A;  3I90 A;  3H0G G;  1IBK L;  3KDF B;  3T4A C;  1TWA B;  1X9N A;  3Q6S A;  4Y7N B;  4MHE A;  4X3T A;  1VQK A;  2JEB I;  3PCO B;  1VDZ A;  4MZ9 A;  3CCQ A;  1YHQ A;  3CHB D;  5EAY A;  4APV A;  2ALY B;  3L2P A;  1WJJ A;  3VR4 A;  3V2T A;  1HZC A;  1E1T A;  4JOI A;  4DR2 L;  1Z6H A;  1KLG D;  2QGQ A;  3CU7 A;  1MIU A;  3D6C A;  2JYO A;  4F7X A;  1S5E D;  4LF4 L;  5J3B A;  4POG A;  1EIY B;  2FIN B;  2B2T A;  3K0X A;  3KLS X;  3TP8 A;  3K5M A;  5CV8 A;  3BZC A;  4L5R C;  2KA7 A;  3T1Y Q;  3I7F A;  4DUY L;  3TRE A;  1VCI A;  2RHQ B;  2CH4 W;  1YJW A;  4DNT B;  4C56 C;  1TII D;  4X65 Q;  1CK1 A;  3OIQ A;  4ZKB B;  2IY5 B;  1I6V C;  5C4J H;  4ZYS A;  2UU9 Q;  3NP8 A;  1PZK D;  2XWJ B;  5C0X G;  5GAE C;  5FKA C;  3MXN B;  1SJH D;  4GZY C;  1TT2 A;  2KUM A;  2NVQ B;  2IX3 A;  3N52 A;  5ELD A;  5FO8 B;  1NE3 A;  5EGT A;  2FFK B;  3URY A;  1VQC A;  4BWG B;  5JPN C;  4BY1 H;  3GTJ H;  1WTX A;  4NXM Q;  4BBR H;  2CQO A;  1MSG A;  1K3B C;  1S5D D;  2ICI A;  4TQU S;  2ZT9 C;  1HNW L;  1DD2 A;  3QG1 A;  1U4M A;  2RA4 A;  4OGQ C;  3HOZ H;  2CWA A;  5I4D A;  4HJ8 A;  1O7Z A;  4G4K A;  1FGB D;  2E2D C;  3S1M B;  1GKH A;  4TRD A;  4ZK9 B;  2D0O A;  3GTO H;  1PXU A;  1SSO A;  4JV5 L;  2IPK D;  3F2D A;  1PRT C;  1NMG A;  5FJ8 G;  5COY A;  3C3L A;  1QCB D;  1VMP A;  2OTL A;  4V19 0;  1VQE A;  1D6E C;  4DR7 Q;  3ND9 A;  3S2H H;  4QGU A;  2N78 A;  4JOI C;  4A3I B;  5CYU A;  3S15 H;  5IWA L;  2BH2 A;  4N8X 1;  1XPO A;  4KN4 C;  1DOL A;  1STH A;  1TS2 A;  4I7A A;  4V0B A;  5G3L F;  3J81 E;  3FEW X;  1XNR L;  4B3R Q;  4QUC A;  1P8L A;  1STY A;  2VUM G;  1NR4 A;  3BDO A;  4LF8 L;  3K7A H;  2NZO A;  1KAW A;  1S5B D;  5EPK A;  1XPU A;  4NP5 A;  3CC4 A;  4IFD I;  4A3B B;  2F03 A;  4WFN 3;  1W2B A;  2NWG A;  4S3S A;  3HOW H;  1C9O A;  4H02 A;  2AQ1 B;  3BVM A;  3MZ5 A;  3PUW A;  1TWH B;  3I2Z A;  1Y1V G;  1PDQ A;  1LTG D;  2G5D A;  4A3G B;  4G57 A;  3J80 E;  3Q23 A;  2IW3 A;  1WTP A;  3FRP B;  2F0V A;  4J8Q A;  1EWI A;  1LTR D;  1BVS A;  1Q1E A;  1LAB A;  5IIF A;  4DV0 L;  1HCZ A;  4J1M A;  1MHW C;  5T1I A;  3BJU A;  1SRU A;  4HSV A;  1V43 A;  2K1B A;  2E2I B;  2H1E A;  3A7A B;  4HIM A;  3GD7 A;  1II3 A;  1D5M C;  1K73 C;  3CAM A;  3E9I A;  3GDE A;  2UUB L;  2MQH A;  1N36 Q;  1S5F D;  2B2V C;  4DF7 A;  1IBM Q;  4DV5 L;  2K28 A;  2KHS A;  2ZXO A;  1LT5 D;  3QWN A;  4DAY B;  2A74 C;  3OMC A;  3B6Y A;  4MNO A;  3HOY G;  1E1O A;  1PH4 A;  2A5H A;  2C5C A;  2EYP A;  3AFP A;  1QB5 D;  4B3M Q;  5BR8 L;  1H9S B;  5CV6 A;  4A3D B;  1TR5 A;  2L11 A;  3TSS A;  3RZD B;  5EKI A;  1S4Z A;  3PF5 A;  4LWC A;  4ULL A;  2ID0 A;  5FLX E;  3ONA B;  1KNE A;  1UWV A;  2P5Z X;  3BYY B;  3FVQ A;  2PQA B;  4L63 B;  3SGI A;  2WKC A;  3ITP A;  5JEA H;  2RHS B;  2M9V A;  1A2U A;  1H9K A;  4KTA A;  1Y8N B;  2K14 A;  3HS0 C;  5CMD A;  2D5D A;  5IT9 L;  2JQO A;  3IFD A;  1KIX A;  1FYC A;  2RBM A;  2I5M X;  1LTT D;  3M7G A;  1EFI D;  1EEF D;  5COR A;  3KJO A;  3GTQ H;  1ZYR D;  1IBK Q;  3K58 A;  4B3S L;  2PNH A;  3DWP A;  1F2Z A;  3PV0 A;  3EN2 A;  3TBI B;  2VS1 A;  3HOZ B;  2NB0 A;  5HY6 A;  4OWX B;  4JI5 L;  4DA2 A;  1PRT B;  4K6L A;  2K33 A;  4IJH A;  1WCM G;  2B63 B;  1KHI A;  3I4N B;  1PHJ A;  1QJO A;  1IL8 A;  4NKL A;  4B3T L;  1S72 A;  2RDG A;  4C3H H;  1SND A;  1TWF B;  1PTO F;  4C3J G;  1OO9 B;  4DR2 Q;  1B9M A;  1PH5 A;  3HOV G;  4WJ3 M;  3KBG A;  3M85 A;  3S16 B;  2K5Q A;  4LF4 Q;  3CRL C;  5JVH 3;  4A3M H;  4IJL A;  2EOT A;  5M5X B;  1D5Z C;  1FL0 A;  5D65 A;  5JJZ A;  3J7Y W;  2K52 A;  2QW7 A;  2BH8 A;  2B2Y A;  1STG A;  2HIV A;  4DK1 A;  4DUY Q;  2KJX A;  1CQF A;  2ZJQ A;  2RSO A;  3EIV A;  1VQF A;  3K7A B;  1HHV A;  3A55 A;  3I73 A;  3H3V H;  1CI3 M;  3KBX A;  3PO3 H;  1BNZ A;  4YCU A;  5M3M G;  1A15 A;  4EGV A;  1HJP A;  2B8G A;  1SYC A;  1I3Q B;  5HGT A;  4P71 A;  1F77 A;  5E4W C;  1NCV A;  2OQK A;  1RTO A;  1KNA A;  3NEM A;  3P1H A;  1U4P A;  1QVG A;  2E2J H;  1TVX A;  2JJQ A;  4LFC L;  1PTO C;  1HNW Q;  3G7L A;  3AMU A;  3D4R A;  4YWM A;  4QB4 A;  1SAP A;  5J39 A;  5A2Q L;  3JAM E;  1L0Y B;  3RLO A;  5KNB A;  2F0Q A;  2DNC A;  2QCP X;  4IUN A;  3T51 B;  5M3F G;  4JV5 Q;  2KHJ A;  5JOB A;  5M9O A;  3I70 A;  2OT2 A;  2A69 C;  2Z1C A;  1C4Q A;  1SFO B;  2MO0 A;  1MBY A;  3D4W A;  4DR1 L;  1I94 L;  1QUQ B;  2I46 A;  3EA6 A;  4FXG C;  1ET6 A;  1T9H A;  3KF6 A;  3CXC A;  1A2T A;  2VQF L;  2WAC A;  1A6X A;  1XNR Q;  3KLS A;  2QIL A;  4LF8 Q;  2QKI C;  1EU3 A;  1GOZ A;  2HD3 A;  5IP7 G;  5IE8 A;  5FLM G;  2IHE A;  3WOF A;  3T1H L;  1VQ6 A;  2OTJ A;  5IP9 H;  4DXG A;  3H6M A;  2F4V L;  2K5H A;  5K36 G;  1JWS D;  4B08 A;  4QL5 A;  1GUG A;  4XQQ A;  1KXL A;  3D3R A;  3W3A A;  4K14 A;  2HQL A;  5ELE A;  1I50 B;  2JA5 B;  1Q8K A;  3NUC A;  2Q8T A;  1GO3 E;  1X6O A;  3SK8 A;  5C5L A;  3CPF A;  1X3F A;  3KDF A;  1GUW A;  2XWB B;  3S14 H;  3G48 A;  1HPC A;  1ICW A;  3NHH A;  4DV0 Q;  2VQE Q;  2CWP A;  4A3E G;  1RHP A;  4IFD G;  1WTV A;  3SEB A;  4CKE A;  3BZK A;  1FJG L;  2JA8 G;  2KCT A;  2N3S A;  3NEL A;  3QJY A;  5KRU A;  2NVT B;  2RSN A;  3PQI A;  2LSS A;  2HUG A;  2NYZ D;  1K3R A;  4HN7 A;  2UUB Q;  5EBD A;  2CW0 D;  4IPH A;  4DV5 Q;  1K0R A;  1I6H H;  3M4Q A;  1GUO A;  4P2C B;  4FYD A;  1PFM A;  3H3V I;  3U9O A;  1MJC A;  1OTC A;  1FVI A;  1HUN A;  2EJM A;  2B8F A;  5ELO A;  1EFW A;  2UXC Q;  4IQZ A;  4R4I A;  2EXD A;  3STB D;  2EE1 A;  5BR8 Q;  1PYW D;  5C4X G;  2BDO A;  2UU9 L;  5ELN A;  3HGB A;  3SK6 A;  1LM0 A;  1SJE D;  4IUV A;  1XMO L;  1GUS A;  1UNS A;  3MXN A;  5C44 H;  3TP6 A;  2F0T A;  1D7Q A;  5GAG C;  1G91 A;  1CA6 A;  4BY7 G;  2A6H C;  2F3W A;  4DV4 Q;  1G51 A;  1LT3 D;  4B9X A;  1X3P A;  3G6J B;  4IPD A;  1SLJ A;  3PO3 B;  3S1N H;  4IZ8 A;  1DXM A;  1WFQ A;  5IYB G;  1H9J A;  3Q0A A;  2F3V A;  3KLW A;  4KY7 A;  4A3J H;  1VQ8 A;  3S1R B;  1OXS C;  5F2D A;  2PW7 A;  2L15 A;  3IRB A;  2B3G A;  3IKJ A;  3E9H A;  1TWA H;  1G29 1;  3ERQ A;  1SE3 A;  3DMU A;  1LTB D;  3GTM B;  1PTO B;  4Y7N H;  4OO1 H;  4C3I H;  3NQI A;  4RH6 A;  1K8A C;  4R4T A;  3EQL C;  2E2J B;  1PV4 A;  1GJX A;  4H7B A;  2ZXR A;  3DM3 A;  1XJV A;  3J7A 5;  3MEF A;  2F1M A;  2JSO A;  3S9W A;  5CGK A;  1ROD A;  4JG2 A;  3SE0 A;  4B3S Q;  1J6Q A;  1KL9 A;  3DM1 A;  1XTD A;  1Y69 U;  4JI5 Q;  2GVA A;  4DR3 Q;  4HAE A;  1G6P A;  3OW7 A;  2ZTE A;  3S17 B;  4L8J A;  2A68 D;  1BBW A;  1NNX A;  1CQV A;  3U50 C;  1PZJ D;  1EL0 A;  3C1E A;  1EIF A;  3BZD B;  1DON A;  1JQY D;  2KCC A;  2ZM6 L;  2DY8 A;  1XNQ L;  3VYS A;  1OXU A;  1Q8I A;  2K50 A;  3K5N A;  1F9R A;  1HTL D;  4DR4 L;  1G2S A;  2NVQ H;  1O80 A;  3HG9 A;  2J7Z A;  2Z6K A;  4OWT B;  3J7A V;  5KYL A;  2X69 A;  4DV6 Q;  1UUP A;  1JT8 A;  3VR5 A;  4NPS A;  1L0W A;  4HJA A;  1N33 L;  2JP1 A;  2KEN A;  1HNZ Q;  3LGJ A;  3K8A A;  2JA6 G;  1X3Q A;  3DWQ A;  2YTX A;  4PQX A;  4X6A H;  3HOW G;  2C9O A;  1Q1B A;  4QIW E;  2Q2U A;  2K5N A;  3MWY W;  4PMB A;  3I8Z A;  2YTV A;  4JI7 L;  1Y1V B;  2PZU A;  1CKN B;  4KD4 A;  3OOC A;  4NB3 A;  3H91 A;  4LFC Q;  4XIG S;  1R4Q B;  4YCV A;  3CCU A;  3VA7 A;  4XYO A;  2B2U C;  2UXB L;  2RDH A;  2NTS A;  2A6E C;  1YNJ C;  2DNE A;  1IBM L;  4A3K G;  3D0F A;  4A3I H;  2ZTD A;  4UHV A;  2SDF A;  4LUZ A;  1J8I A;  3SR1 A;  3IL8 A;  3LNN A;  5BN5 A;  4RGM A;  4DR1 Q;  3HKS A;  3HZX A;  1I94 Q;  1B7Y B;  1H9S A;  1I6H B;  3AU7 A;  3C46 A;  3QR8 A;  4A3B H;  1B4O A;  1LV9 A;  2WB1 G;  4N9T A;  4JI4 Q;  2R7F A;  3I91 A;  5IGD A;  2PQA A;  3TEH B;  4CDF C;  3GTG B;  4H0L C;  1SMY D;  1HZA A;  3P20 A;  3GO5 A;  3HOY B;  3SK4 A;  4JI0 L;  1HFG A;  3T1H Q;  1TWH H;  2KVM A;  4BBS H;  4CHT B;  4C1N K;  4OO1 I;  2NN6 G;  2XSC A;  1LLR D;  4K2K A;  4Y52 H;  4A3G H;  1VF5 C;  4MTN A;  1EY6 A;  1TU2 B;  3GTK B;  4KKU A;  1QVF A;  3HEJ A;  2WIN B;  3J81 i;  1SYF A;  2F0H A;  1C8C A;  4A3L H;  2VNU D;  3LWU A;  5GAD C;  4X62 L;  1H9M A;  2E2I H;  3ZYY X;  2AUJ D;  4C3I B;  2PZW A;  1E3P A;  3VR3 A;  4TKO B;  1FJG Q;  4AIM A;  1XWE A;  4UP9 A;  3GP7 A;  1YBY A;  2KHI A;  3DWA A;  1OXX K;  1SYB A;  1X3E A;  4C1N I;  3E6Z X;  1YNN D;  1M4V A;  5LL6 S;  1V1Q A;  1U5K A;  1ONL A;  4J6H A;  4XDX A;  3J80 i;  3FDT A;  3HOU G;  1Z7T A;  3PIO A;  4YWK A;  5E7N A;  5C5M A;  3A5Z B;  2JK8 A;  4A3D H;  4C3H G;  1ESF A;  4O0A A;  3PIP 3;  4GOP C;  3RZD H;  1PRT F;  1AE2 A;  1VQ5 A;  3X3M A;  2ZXP A;  1IBL L;  1TWG B;  5IY0 A;  5EJW A;  1JIC A;  3BYT B;  1VQB A;  2ENB A;  2L12 A;  3HOV B;  2F0G A;  4NDX A;  3NQT A;  4WJ4 A;  4EQO A;  2LKV A;  2E8G A;  5EQ0 A;  1EYA A;  1XMO Q;  2CVR A;  1CSP A;  2IX1 A;  3J81 L;  3E5S A;  3PUV A;  4GN3 B;  3MFY A;  3U9S A;  2K5W A;  3TS0 A;  1GUT A;  3J7A F;  5CV9 A;  3CC7 A;  1Q46 A;  1AFP A;  2PO4 A;  4L5T A;  4B9W A;  3HOX B;  4K6D A;  1N9W A;  1UE6 A;  4PZ7 A;  1W6J A;  2EYL A;  5M3M B;  1AE3 A;  2QEX A;  4TVA B;  4KHV A;  3M3Y B;  2LS0 1;  2SEB D;  2EIF A;  1GHJ A;  2B2W C;  3FKI G;  1Y14 B;  4MTK A;  2EY6 A;  4H13 C;  1XXG A;  1AZQ A;  2F0S A;  5IGG A;  3J80 L;  2AHO B;  3A7L A;  2L55 A;  4X3K A;  4A3F H;  3OHX C;  4KN7 C;  2PZT A;  2B63 H;  3GTL B;  4A93 G;  3I4N H;  1ENA A;  3RNU A;  1E0B A;  4F88 A;  2B2V A;  2HDL A;  4KI0 A;  4JBM A;  1K0S A;  1TWF H;  2N49 A;  2R93 G;  4UDU C;  2OEO A;  2EJG C;  3KUP A;  1U9R A;  3S16 H;  4POF A;  5IYD H;  1YJN A;  2GA4 B;  5M5X H;  1AZP A;  1QUQ A;  1PA6 A;  4KHP L;  1YIJ A;  3NWS A;  4QJF A;  4GKJ L;  3L3O C;  5FO9 B;  2F0F A;  3NTK A;  2ZM6 Q;  2VXW A;  3A5U A;  2PI2 E;  1S40 A;  2NVX B;  1XNQ Q;  3FPP A;  1KAA A;  1WTH A;  2B29 A;  1NBW A;  1V1O A;  3H94 A;  2IWH A;  1TS5 A;  4DR4 Q;  3TZU A;  2F0N A;  4EVO A;  1RDP D;  1ZXT A;  1PH9 A;  3OPO A;  2BA1 A;  1SDF A;  5AFW A;  1JB7 A;  1Z47 A;  1I3Q H;  2MPM A;  4K2L A;  4BBS B;  3BDL A;  1PH8 A;  1KRS A;  2WB1 E;  5FLX L;  1N33 Q;  3ERS X;  1NR2 A;  2OF1 A;  4KJN A;  1JE4 A;  4QIW B;  2XVS A;  2UXD L;  5KYI A;  3O13 A;  2VQE L;  4HJ7 A;  1ENC A;  2K04 A;  3R2I A;  2CHB D;  4XT3 B;  4JI7 Q;  1LTA D;  2VY3 A;  2K32 A;  2LXK A;  2R7Z G;  1VQO A;  4O42 A;  2NVY B;  4CKB A;  2H5X A;  4PV1 C;  3HKZ G;  2UXB Q;  1PFN A;  5JEA J;  3TP5 A;  3GQB A;  2BE5 D;  1MSH A;  4F87 A;  4M1U B;  1SFO H;  1EEI D;  4DV7 L;  5IYC H;  1IXR A;  3I56 A;  2JA8 B;  1FNU A;  2G9D A;  5A35 A;  4RGO S;  4K5W A;  5JJI A;  3BVZ A;  2EQS A;  1Y1W H;  4GOP B;  2UXC L;  4R9W A;  1EY0 A;  4FP5 D;  2PCF B;  5IT9 c;  1UE7 A;  1KDA A;  1B70 B;  1VQM A;  2DUD A;  3A74 A;  4PZ6 A;  1GM5 A;  2HCC A;  2MFI A;  3F2U A;  2AKW B;  3K6O A;  1YEZ A;  4DV4 L;  5KIX A;  4JI0 Q;  4OIK A;  1I50 H;  2JA5 H;  5C4X B;  4HIO A;  5T1G A;  3EBE A;  2Y0S G;  5I9P A;  3RN5 A;  3AEV A;  1VQJ A;  4AYB G;  1MGS A;  1O78 A;  1EOT A;  3T16 A;  4KY5 A;  3TME A;  3CQZ B;  4BY7 B;  2CQA A;  1SNP A;  2ES2 A;  5JJK A;  4DNI A;  2I0Q A;  4XTC S;  4HSP A;  5TSS A;  1K83 B;  3RN2 A;  2NVT H;  4X62 Q;  4MN3 A;  3TS2 A;  1ET9 A;  5D14 A;  1SRO A;  4DR3 L;  4P73 A;  4A3F B;  1Q86 C;  1C7Y A;  2E5L L;  2JN4 A;  5IGC A;  3VA5 A;  1Q7Y C;  1QE6 A;  2E74 C;  4OWW B;  2PW5 A;  4LK1 C;  4GN5 A;  4FXK C;  1TS4 A;  2I5L X;  3VYT A;  5DAU A;  2JA7 B;  4N8F A;  4A76 A;  4HCE A;  3IFT A;  4P75 A;  5C3E B;  1IW7 D;  1CKM A;  1P16 A;  2EDG A;  2QDB A;  3OMG A;  2AWO A;  1WYD A;  4LF7 L;  3SHL A;  3OTO L;  3TN2 A;  1XYI A;  4O1N A;  1IBL Q;  4FF2 A;  4JK1 C;  1B8A A;  4JC0 A;  1K9M C;  1AN8 A;  2L9H A;  1BCP D;  1D5X C;  4DV6 L;  4LNQ A;  4LF5 L;  1D2B A;  1RTN A;  4IOC A;  3S1Q B;  1EQQ A;  2R92 G;  2D2C C;  1HXY D;  3JC6 6;  4XT1 B;  1HNZ L;  3L0O A;  3EVQ A;  4LF6 Q;  3S1R H;  2WKD A;  4CJ0 B;  1SE8 A;  1R9T B;  1G6Z A;  4HED A;  4DR5 L;  3GTM H;  1JMC A;  1PTO H;  3SK5 A;  2RQX A;  4GNX C;  4G7H C;  1CKN A;  2L5T A;  2R6G A;  4DAM A;  4M8A A;  3J7Z C;  1QG7 A;  1EWC A;  2F52 A;  1JB3 A;  5LL6 X;  2JA6 B;  1B1Z A;  1RF2 D;  3UDG A;  2F0D A;  2K5V A;  4UAI A;  3PO2 G;  1ZEQ X;  4HR7 B;  3CCS A;  4E6I A;  2E2H B;  3S17 H;  4OHJ A;  4NXN L;  3MVV A;  4AQY L;  4QMG A;  1VQ7 A;  3K5L A;  4OL7 A;  3I3C A;  3TQY A;  4HJ9 A;  3AQQ A;  2GN5 A;  4IAL A;  1V9P A;  4OON A;  4Q0F A;  4RG1 A;  3HKZ E;  4KHP Q;  2RKS A;  2DJF C;  4A3K B;  1Y1W B;  4A3I G;  5EKK A;  1LUZ A;  3I4M B;  4JI4 L;  4GKJ Q;  2EYO A;  4ILW A;  1HUM A;  4FO2 A;  3VR2 A;  2CH4 A;  2EYM A;  5I6Y A;  1ILP A;  4DK6 C;  1J9O A;  1JOO A;  1KLU D;  3UI2 A;  3SDZ A;  4RCO A;  2IT1 A;  4BXX G;  4A3B G;  2FXQ A;  3A56 A;  5DM6 3;  1CFM A;  1ENF A;  2MUY A;  2WB1 B;  1I5F A;  4ID6 A;  2V4D A;  3W2D A;  5M5W B;  1Q82 C;  3FP9 A;  2XN9 C;  5DEH A;  1MKH A;  3MTS A;  1WTO A;  1HQM C;  2B39 A;  4XQJ A;  1Y1V H;  1PZI D;  1CA5 A;  3KYH C;  2UXD Q;  1VQP A;  1VMC A;  4RAU C;  2Y0S E;  2TMP A;  3KF8 B;  4UPA A;  4PMW A;  4RCN A;  4DNR B;  1QNU A;  4WRD A;  4L5S A;  1HRJ A;  2KED A;  3PGZ A;  1CTM A;  1DOK A;  1YNJ D;  4NW2 A;  5CV7 A;  3R2T A;  2K4K A;  1Z9F A;  3P7J A;  3BDC A;  4LF9 L;  3PUY A;  3H0G B;  4K5X A;  1TS3 A;  4X66 L;  5CR3 A;  4DAV A;  1STN A;  5I9O A;  3KJP A;  1N32 L;  4DV7 Q;  1B53 A;  3RZO B;  2K03 A;  1TY2 A;  2XGT A;  4AH6 A;  1CKO A;  2TSS A;  3NBI A;  3RD4 A;  2OXP A;  1W6K A;  4X3U A;  5M5Y B;  1L2F A;  1ZYR C;  1JOQ A;  4EQ5 A;  4ZAI A;  2EJF C;  1K28 A;  3GTG H;  2NTT A;  4DN4 M;  1FNW A;  1D8L A;  4DK3 C;  3HOY H;  3HOU B;  2NZH A;  4ZKC B;  4A3D G;  1M1K C;  1K8O A;  1SNC A;  1E2V A;  3C2P A;  1S5C D;  3UE1 A;  2XRS D;  1JOK A;  3CRK C;  3GTK H;  1QVC A;  4RGN A;  1EYD A;  1V1P A;  3ERO A;  2LXJ A;  4EQP A;  5FOB B;  2J4X A;  3K59 A;  4GNX B;  2KCM A;  2LY7 A;  4OX9 L;  1BKB A;  1SYD A;  4KHZ A;  1NUC A;  5CBA E;  5GRO A;  1SN8 A;  1VQL A;  1NMF A;  4BY1 G;  2WAQ G;  2B2U A;  4GLA C;  3K57 A;  1T5E A;  3K80 C;  5LHY 1;  4BBR G;  1RKN A;  5KGU A;  2FMC A;  1EZ6 A;  2MNA A;  2X6G A;  3R93 A;  3G6E A;  2ZTC A;  5AJ3 L;  2PQE A;  3HOZ G;  2KCN A;  3FKI B;  4YIJ A;  1ML0 D;  2E5L Q;  1D1I A;  1VQH A;  5IOC A;  3I4N G;  2PYK A;  1SE4 A;  2VW9 A;  4A93 B;  1KRT A;  4HIK A;  4UP7 A;  1G8Z D;  1F2Y A;  2K01 A;  5H1S E;  4DU9 A;  4P72 A;  3M7N A;  1TWG H;  4DV3 L;  2M00 A;  4C3J H;  3DHQ A;  5JAV A;  2R93 B;  1H95 A;  3WOE A;  3HOV H;  3PMF A;  5CV5 A;  4CJ1 B;  1LO5 D;  2Q2T A;  4R4Q A;  4LF7 Q;  2RDF A;  3OTO Q;  2KEE A;  1C48 A;  3NTI A;  2EY5 A;  2D62 A;  1EUJ A;  5CC4 A;  1IL2 A;  2EYF A;  2IX0 A;  1FD7 D;  1BBU A;  1LAC A;  4LF5 Q;  3CCE A;  2VUM B;  2BOS A;  2IJ0 A;  4KV6 A;  4BS9 A;  1I4P A;  3BU2 A;  3HOX H;  3IAY A;  4IPG A;  2AQ2 B;  4KK7 A;  3K81 C;  4K8I A;  1F9P A;  3S24 A;  5M3M H;  3M3Y H;  1IHZ A;  2O4X A;  2O5I C;  2DY7 A;  1SE2 A;  4DR5 Q;  4ZLT F;  4YY3 Q;  2WV6 D;  1STB A;  1IYU A;  3GTL H;  3BS1 A;  3D4D A;  1UEA B;  1X3G A;  1XPR A;  2L1B A;  5KNC A;  1Q81 C;  1PRT D;  1HA6 A;  2EYH A;  4UP8 A;  4OEM B;  3UE0 A;  1O7Y A;  1PLF A;  2YYZ A;  3CKI B;  2BCO A;  5D3I B;  3K0Y A;  4HTH A;  3VDY A;  4NXN Q;  4KKT A;  4AQY Q;  1SR3 A;  3EFX D;  5L37 A;  5M3F H;  1LT6 D;  3DLL A;  1X32 A;  4GOP A;  3ICE A;  2Z6B A;  1VQN A;  3HKZ B;  1EY8 A;  1YJ9 A;  4GLX A;  2NVX H;  1SMX A;  2EY2 A;  1HR0 Q;  1SNM A;  4GS3 A;  3I4O A;  3NPP A;  5ELF A;  3L7Z C;  4JW0 A;  1U4R A;  1B3A A;  2E75 C;  2OQ0 A;  5I2Y A;  5IP7 H;  2CW0 C;  4LFA L;  3G4S A;  3F2C A;  4R1J A;  3MHB A;  1EYC A;  3NSW A;  2JE6 I;  2IL8 A;  3M4Y A;  3RMH A;  2JEA I;  2Q2H A;  1B2T A;  2X6L A;  5K36 H;  5JEA G;  2RCN A;  2QA4 A;  4JYA Q;  3W5O A;  1AP0 A;  2JA5 G;  2B2W A;  2NUC A;  3NBH A;  1DM0 B;  3M4O B;  4DKA C;  3RLF A;  1A3U A;  1SBB B;  2Y0S B;  1DOM A;  1WD1 A;  1PMR A;  3D31 A;  4Q5V A;  2NVY H;  1TY0 A;  5G3L D;  1UAP A;  4ZUI A;  1EIH A;  1Q3L A;  4ABN A;  1CHQ D;  4A3E H;  2QDL A;  4LF9 Q;  3CCV A;  5DNF A;  2JA8 H;  2PMZ E;  2WAQ E;  4K0K L;  4X66 Q;  2AQ3 B;  4JI2 L;  4LUO A;  1VQG A;  1M90 C;  2AWN A;  1N32 Q;  3J81 c;  2L4N A;  3DUZ A;  5C4H A;  2J0T D;  2AMC B;  1WCM B;  1STE A;  3QIA A;  1JE5 A;  4OXP A;  3ULP A;  4RKB A;  5E4X A;  1NTG A;  1OXT A;  4C3J B;  1JWU D;  1YHA A;  4IUQ A;  1EQR A;  5C3X A;  1CM9 A;  4FNF A;  1HQR D;  2VL6 A;  1RL2 A;  4A3M G;  4FXD A;  2EY1 A;  4LAA A;  3DXJ C;  1B44 D;  1BXT A;  2EVB A;  5C4X H;  2HQE A;  2MJ8 A;  4WOR A;  2A68 C;  1B50 A;  3J81 j;  3J80 c;  4LF6 L;  1FGU A;  2UUC L;  1BBX C;  1A3V A;  1CUK A;  3CQZ H;  1NJI C;  4BY7 H;  4ME3 A;  1RD9 D;  1V1P B;  1YHB A;  4FDB A;  1PH1 A;  3PO3 G;  2CFM A;  2F0E A;  1ZKO A;  4J15 A;  1WVL A;  1KQS A;  5IYB H;  4OX9 Q;  2MP1 A;  2Z8L A;  3A8K E;  2R92 B;  1K83 H;  4PNY A;  3N6R A;  2NBF A;  1ILQ A;  2F0L A;  3BG3 A;  3F2B A;  4CDD C;  3DEP A;  4IPC A;  2O2L D;  2XNA C;  2L0C A;  5CV4 A;  1PYB A;  1TXY A;  3MFG A;  2KQ3 A;  1G2T A;  3ER0 A;  2N55 A;  1GUN A;  4GLV B;  4HMJ A;  2ATW A;  1TWC B;  3GTP B;  1E2W A;  1DJR D;  5AJ3 Q;  2A8V A;  1TKW B;  3S2D B;  2JA7 H;  3LX0 A;  1RJT A;  2QF7 A;  4ZRZ A;  5JPM C;  3PO2 B;  4DR6 Q;  5C3E H;  3SVM A;  1HR0 W;  3UDF A;  3RLN A;  2PI2 A;  2JA9 A;  4I65 A;  5M3F B;  4UY8 C;  3MAQ A;  2VB3 X;  1LTI D;  4RA8 A;  2XTI A;  5FLX c;  4DV3 Q;  5ELC A;  3A0J A;  4GKK L;  4JI8 L;  1QOH A;  1W3S A;  3CW2 C;  2HHH L;  1GXD C;  1Q90 A;  1IYV A;  4PZ8 A;  1XMQ L;  3S1Q H;  1EQT A;  2YV5 A;  3RUZ A;  3ZJY C;  1QIL A;  3I72 A;  3T53 B;  1R9T H;  1PH7 A;  1YVC A; 
#chains in the Genus database with same CATH homology
 1UE5 A;  1EQQ A;  4A4I A;  1D7Q A;  2MO1 A;  2R92 G;  5IP9 G;  5GAG C;  1HNZ L;  3JC6 6;  3PUX A;  4BY7 G;  3L0O A;  3STB C;  4JCV E;  1CSQ A;  4LF6 Q;  4DV4 Q;  3S1R H;  1G51 A;  2IHF A;  1SE8 A;  4IPD A;  1SLJ A;  2Z6K C;  4DR5 L;  4DV1 L;  3GTM H;  1JMC A;  3KFU A;  3S1N H;  1WFQ A;  5IYB G;  2JA6 H;  2F4V Q;  2OWO A;  4GNX C;  2R7D A;  3ULL A;  5LMU L;  3KLW A;  4A3J H;  1VQ8 A;  1CKN A;  1OXS C;  1A0I A;  4YHH Q;  2R6G A;  4DAM A;  2L15 A;  3IRB A;  2B3G A;  3E9H A;  4LUV A;  1TWA H;  1G29 1;  3J7Z C;  4RMF A;  1J5E L;  2E2H H;  2YU9 H;  2F52 A;  1WI5 A;  4Y7N H;  4LFB Q;  4C3I H;  3UDG A;  4C2M H;  2K5V A;  1K8A C;  4R4T A;  4DPG A;  1O7I A;  5LMN W;  1PV4 A;  3PO2 G;  1N34 L;  3CCS A;  3DM3 A;  4X64 L;  4ALP A;  1XJV A;  3H0G G;  3MEF A;  1IBK L;  3KDF B;  4JI6 L;  3J7A 5;  5GQO A;  1X9N A;  4JG2 A;  4B3S Q;  3S17 H;  1J6Q A;  1KL9 A;  4O2D A;  4NXN L;  1VQK A;  3CME A;  2JEB I;  3PCO B;  4AQY L;  1XTD A;  3U4V A;  1VQ7 A;  4JI5 Q;  2GVA A;  4MZ9 A;  4A3K H;  4DR3 Q;  3CCQ A;  2UUA L;  3TQY A;  1YHQ A;  1G6P A;  2ZTE A;  3I4M H;  4HJ9 A;  5EAY A;  4APV A;  1BBW A;  2ALY B;  2GN5 A;  3AQQ A;  4KLK A;  3L2P A;  3U50 C;  1V9P A;  1WJJ A;  4OON A;  1HZC A;  4RG1 A;  1E1T A;  1EIF A;  3HKZ E;  4JOI A;  4DR2 L;  1YI2 A;  4KHP Q;  2QGQ A;  1MIU A;  4A3I G;  1LUZ A;  2ZM6 L;  4JI4 L;  4GKJ Q;  4LF4 L;  5J3B A;  4JBK A;  4POG A;  1IZ6 A;  1EIY B;  3JAM i;  3K0X A;  4A3C H;  1XNQ L;  1OXU A;  2K50 A;  3BZC A;  4L5R C;  3T1Y Q;  1NY4 A;  3I7F A;  5M5W H;  3TRE A;  4DK6 C;  4DUY L;  3PUZ A;  4DR4 L;  1VCI A;  2RHQ B;  2YTY A;  3FHW A;  2NVQ H;  2IT1 A;  1YJW A;  4BXX G;  2Z6K A;  4OWT B;  4LFA Q;  2FXQ A;  4A3B G;  2CKZ B;  3RR5 A;  4X65 Q;  5C44 G;  3CCL A;  2IY5 B;  4GNX A;  5C4J H;  2UU9 Q;  4DV6 Q;  1I5F A;  3OYY A;  1Q82 C;  5C0X G;  1JT8 A;  3FP9 A;  5GAE C;  4DUZ L;  3MXN B;  1MKH A;  3UDX A;  4NPS A;  1L0W A;  4HJA A;  1N33 L;  3TRZ A;  2KEN A;  1HNZ Q;  1NE3 A;  3LGJ A;  3K8A A;  3NBH B;  1VQC A;  1Y1V H;  2JA6 G;  2YTX A;  4X6A H;  3JAM c;  4IO9 A;  3KYH C;  4BY1 H;  4A3J G;  1VQP A;  3HOW G;  2UXD Q;  1A63 A;  3GTJ H;  1Q1B A;  4QIW E;  2Q2U A;  3F8T A;  4JBJ A;  4NXM Q;  2K5N A;  2ZJP A;  2Y0S E;  4UPA A;  3KF8 B;  3H0G H;  4PMW A;  4L5S A;  2YTV A;  2CQO A;  4BBR H;  3PGZ A;  4JI7 L;  4OO1 G;  1CKN B;  4TQU S;  4NB3 A;  1HNW L;  4LFC Q;  4XIG S;  2K4K A;  4YCV A;  3CCU A;  1J5E Q;  2V1C C;  1Z9F A;  4LF9 L;  3RZO H;  3PUY A;  3HOZ H;  2CWA A;  5C0X J;  2UXB L;  4HJ8 A;  4X66 L;  4DV2 L;  4K0K Q;  4L5Q A;  5LMN L;  4JI2 Q;  2ASB A;  1GKH A;  1EOV A;  5JJL A;  4X64 Q;  3KJP A;  2D0O A;  5M5Y H;  3CMA A;  3GTO H;  1N32 L;  4HID A;  1IBM L;  4A3K G;  4JV5 L;  1U0L A;  3F2D A;  4DV7 Q;  1NMG A;  3D0F A;  5FJ8 G;  4A3I H;  2ZTD A;  2XGT A;  3HOU H;  4AH6 A;  1CKO A;  4LUZ A;  2OTL A;  1VQE A;  4DR7 Q;  3CF5 A;  1L2F A;  3S2H H;  4EQ5 A;  4QGU A;  2N78 A;  3GTG H;  4DR1 Q;  3HKS A;  1I94 Q;  4JOI C;  1B7Y B;  1D8L A;  4DK3 C;  3S15 H;  4YCW A;  3HOY H;  5IWA L;  1HNX L;  2BH2 A;  1S3O A;  1HNX Q;  4LFB L;  1XPO A;  4A3B H;  1LYL A;  2NZH A;  4A3D G;  4BA1 I;  2WB1 G;  4JI4 Q;  2R7F A;  1M1K C;  1XNR L;  1LTL A;  3CP0 A;  2PQA A;  3TEH B;  4B3R Q;  1P8L A;  1PFS A;  2VUM G;  4EX5 A;  1HZA A;  4LF8 L;  3GO5 A;  2NZO A;  1KAW A;  3AFQ A;  3K7A H;  3UE1 A;  1XPU A;  3CC4 A;  1GD7 A;  4IFD I;  5HGQ A;  3CCM A;  2UUC Q;  4JI0 L;  3T1H Q;  1TWH H;  3GTK H;  4BBS H;  1QVC A;  4OO1 I;  3KOJ A;  1L1O A;  2NN6 G;  1PVO A;  2LXJ A;  4HJ5 A;  1W2B A;  4YY3 L;  4Y52 H;  4A3G H;  3WWV A;  4GNX B;  3G71 A;  3HOW H;  1C9O A;  1VS0 A;  2KCM A;  4H02 A;  3HOX G;  4MTN A;  1VQ4 A;  4OX9 L;  1BKB A;  3PUW A;  3CCJ A;  2ZJR A;  4KHZ A;  1X56 A;  3I2Z A;  2DGY A;  1Y1V G;  1JJ2 A;  2N8N A;  1SN8 A;  5GRO A;  1VQL A;  1QVF A;  1NMF A;  4BY1 G;  2WAQ G;  3J81 i;  4GLA C;  2C35 B;  1EWI A;  3K80 C;  1PH3 A;  1BVS A;  3FKI H;  5GAD C;  1Q1E A;  3CC2 A;  4A3L H;  2VNU D;  4BBR G;  4DV0 L;  4X62 L;  2MNA A;  4JBW A;  3PIP A;  2E2I H;  4BA2 I;  1E3P A;  3G6E A;  4A93 H;  2RF4 A;  2ZTC A;  5AJ3 L;  3BJU A;  1SRU A;  1FJG Q;  4PG3 A;  3HOZ G;  1V43 A;  4AIM A;  1N8R C;  4UP9 A;  5FJ8 H;  2E5L Q;  2KHI A;  1VQH A;  1YBY A;  1UE1 A;  3CPW A;  2R93 H;  1OXX K;  4HIM A;  3I4N G;  1X3E A;  3I55 A;  2VW9 A;  1KRT A;  3GD7 A;  4HIK A;  4UP7 A;  4JI1 L;  1HR0 L;  1K73 C;  1V1Q A;  3CAM A;  3E9I A;  3GDE A;  5H1S E;  2UUB L;  2MQH A;  1U5K A;  3J80 i;  1N36 Q;  4P72 A;  3M7N A;  1TWG H;  4DV3 L;  3HOU G;  4C3J H;  3PIO A;  4DV5 L;  1IBM Q;  4YWK A;  1H95 A;  2D0P A;  4JI3 L;  3HOV H;  2NN6 I;  5E7N A;  3A5Z B;  2JK8 A;  4GKK Q;  4JI8 Q;  4DAY B;  2Q2T A;  4A3D H;  4R4Q A;  4O0A A;  4GOP C;  4LF7 Q;  3RZD H;  3OTO Q;  1AE2 A;  3B6Y A;  1VQ5 A;  4MNO A;  1IBL L;  2HHH Q;  2VUM H;  3HOY G;  1E1O A;  5IY0 A;  1PH4 A;  3AFP A;  2D62 A;  1XMQ Q;  1VQB A;  1EUJ A;  1IL2 A;  4B3M Q;  5BR8 L;  2IX0 A;  4WJ4 A;  1BBU A;  3HFZ B;  4LF5 Q;  2E8G A;  5IWA Q;  3CCE A;  3PF5 A;  1XMO Q;  4LWC A;  2ID0 A;  1CSP A;  2IX1 A;  3W1B A;  1UWV A;  1PYS B;  4JYA L;  2VZA A;  3PUV A;  2PQA B;  3BU2 A;  4GN3 B;  3SGI A;  3HOX H;  5GAH C;  4IPG A;  4BBS G;  3TS0 A;  3K81 C;  3CC7 A;  2RHS B;  1Q46 A;  5DLQ E;  3ULJ A;  3S24 A;  5M3M H;  4A3G G;  3M3Y H;  1L1O C;  1RIP A;  3PSI A;  4L5T A;  3UDI A;  4DR5 Q;  4DV1 Q;  2K14 A;  3NEN A;  4YY3 Q;  2A19 A;  1N9W A;  1UE6 A;  5LMU Q;  4AYB E;  4PZ7 A;  2K75 A;  2JQO A;  4R4C A;  1AE3 A;  2QEX A;  4TVA B;  1KIX A;  3GTL H;  1YIT A;  1X3G A;  1Q81 C;  1XPR A;  2I5M X;  2EIF A;  4A3L G;  3FKI G;  1Y14 B;  4UP8 A;  1E22 A;  3K7U C;  3KJO A;  3UE0 A;  2R7Z H;  2AHO B;  3U58 A;  4A3F H;  1N34 Q;  4A93 G;  2B63 H;  3GTQ H;  3OW2 A;  4JI6 Q;  3RNU A;  2YYZ A;  1IBK Q;  4B3S L;  3I4N H;  2PNH A;  4KI0 A;  3PV0 A;  4JBM A;  3EN2 A;  2VS1 A;  3VDY A;  4NXN Q;  1TWF H;  5HY6 A;  4OWX B;  4JI5 L;  4AQY Q;  1SR3 A;  1VQ9 A;  2N49 A;  5M3F H;  2R93 G;  3DLL A;  4IJH A;  1WCM G;  1KHI A;  4GOP A;  3E0E A;  1PHJ A;  2UUA Q;  3ICE A;  4POF A;  1VQN A;  3S16 H;  5IYD H;  1KD1 C;  5C0X I;  1YJ9 A;  1S72 A;  1MJE A;  4B3T L;  4C3H H;  4GLX A;  1YJN A;  4GN4 B;  5M5X H;  2NVX H;  1QUQ A;  1SMX A;  1PA6 A;  4KHP L;  2CCZ A;  1HR0 Q;  1YIJ A;  4DR2 Q;  4QJF A;  3HOV G;  1PH5 A;  3Q8D A;  4GS3 A;  4WJ3 M;  3I4O A;  4GKJ L;  3M85 A;  1QZH A;  2ZM6 Q;  1JJC B;  3A5U A;  4LF4 Q;  2PI2 E;  4A3M H;  4IJL A;  3L7Z C;  1S40 A;  1FL0 A;  1XNQ Q;  4QQB X;  3T1Y L;  2K52 A;  2BH8 A;  2B29 A;  2HIX A;  2HIV A;  1NBW A;  4DUY Q;  1VQI A;  2OQ0 A;  3AYH B;  4DR4 Q;  4IOA A;  5IP7 H;  1PH9 A;  2ZJQ A;  4LFA L;  3EIV A;  3CD6 A;  4X65 L;  3G4S A;  2BA1 A;  3F2C A;  3CCR A;  1Q12 A;  1VQA A;  4R1J A;  1VQF A;  1JB7 A;  1EYG A;  1Z47 A;  1I3Q H;  2JE6 I;  1UEB A;  2JEA I;  2Q2H A;  3M4O H;  3U4Z A;  3H3V H;  5JEA G;  1X54 A;  2RCN A;  2QA4 A;  4DUZ Q;  3PO3 H;  1PH8 A;  1KRS A;  4YCU A;  2Q2I A;  5M3M G;  2WB1 E;  1ASZ A;  1N33 Q;  4JYA Q;  3ERS X;  3W5O A;  2JA5 G;  1HJP A;  2GVB A;  3H15 A;  1JJG A;  4DKA C;  4P71 A;  3RLF A;  2UXD L;  2OQK A;  3D31 A;  2VQE L;  4HJ7 A;  3NEM A;  2NVY H;  1E7Z A;  4NXM L;  1ASY A;  2Z0S A;  1QVG A;  2E2J H;  1C0A A;  4JI7 Q;  2JJQ A;  3M4P A;  2VY3 A;  4LFC L;  4A3E H;  1A62 A;  2LXK A;  2R7Z G;  1HNW Q;  1VQO A;  1KC8 C;  4YWM A;  4A3F G;  4DR6 L;  4LF9 Q;  2B63 G;  3CCV A;  2H5X A;  1VQD A;  2JA8 H;  1WCM H;  3HKZ G;  2PMZ E;  2UXB Q;  2WAQ E;  5JEA J;  4K0K L;  4X66 Q;  4JI2 L;  4LUO A;  4DV2 Q;  1VQG A;  5LMN Q;  3RLO A;  1M90 C;  2AWN A;  1N32 Q;  5M3F G;  3J81 c;  1SFO H;  3F1Z A;  4DV7 L;  5IYC H;  2JA7 G;  4JV5 Q;  2KHJ A;  1IXR A;  2AMC B;  5IYD G;  3I56 A;  5JJI A;  1JE5 A;  4OXP A;  3ULP A;  3PF4 A;  5C3E G;  1X55 A;  4LW1 A;  1K8G A;  2EQS A;  1Y1W H;  4DR7 L;  4GOP B;  2UXC L;  1NTG A;  4R4O A;  1X65 A;  1YZ6 A;  2MO0 A;  1OXT A;  2WP8 J;  2KBN A;  1YHA A;  1HZB A;  1EQR A;  4B3T Q;  4DR1 L;  1I94 L;  5C44 H;  1QUQ B;  2VL6 A;  5IT9 c;  1UE7 A;  1RL2 A;  1IYJ B;  4A3M G;  1T9H A;  1A8V A;  1B70 B;  3KF6 A;  2DUD A;  3A74 A;  3CXC A;  4PZ6 A;  2OCE A;  3W1G A;  2VQF L;  1VQM A;  1GM5 A;  1OXV A;  5C4X H;  4B3R L;  2MFI A;  1XNR Q;  2F3I A;  3J81 j;  3J80 c;  2AKW B;  4LF8 Q;  5IP7 G;  4LF6 L;  1YEZ A;  1FGU A;  4DV4 L;  5IE8 A;  2UUC L;  5FLM G;  2IHE A;  3T1H L;  1VQ6 A;  2OTJ A;  4JI0 Q;  2R92 H;  5IP9 H;  1I50 H;  1CUK A;  3CQZ H;  2JA5 H;  1NJI C;  1L1O B;  4BY7 H;  4ME3 A;  4HIO A;  2F4V L;  2K5H A;  3EBE A;  2Y0S G;  1YHB A;  5K36 G;  3RN5 A;  2HT1 A;  1VQJ A;  4FDB A;  1PH1 A;  3AEV A;  4AYB G;  3PO3 G;  4QL5 A;  2CFM A;  1KXL A;  4J15 A;  3M9B A;  1KQS A;  4YHH L;  5IYB H;  1HZ9 A;  4OX9 Q;  2HQL A;  1K83 H;  1DGS A;  1Q8K A;  2ES2 A;  5JJK A;  4DNI A;  1TWC H;  1GO3 E;  1AH9 A;  3F2B A;  2I0Q A;  3GTP H;  4IPC A;  1X6O A;  4XTC S;  3S2D H;  1PYB A;  1TXY A;  3CPF A;  1X3F A;  3KDF A;  3S14 H;  3G48 A;  3RN2 A;  4DV0 Q;  2BA0 A;  3ER0 A;  4GLV B;  4X62 Q;  2VQE Q;  2NVT H;  2CWP A;  4A3E G;  2ATW A;  3PO2 H;  3TS2 A;  4IFD G;  1SRO A;  3BZK A;  5AJ3 Q;  1FJG L;  2A8V A;  4DR3 L;  3S1M H;  4P73 A;  2JA8 G;  1Q86 C;  1C7Y A;  2JA7 H;  2KCT A;  2N3S A;  3NEL A;  2E5L L;  1Q7Y C;  4DR6 Q;  1GVP A;  1HH2 P;  5C3E H;  4OWW B;  1HR0 W;  2LSS A;  4P74 A;  4YWL A;  4GN5 A;  3UDF A;  1K3R A;  3RLN A;  2PI2 A;  2JA9 A;  4JI1 Q;  5IYC G;  2I5L X;  4UY8 C;  1PH2 A;  1N36 L;  1E24 A;  1YNX A;  4A76 A;  2UUB Q;  4P75 A;  2WFW A;  2XTI A;  5FLX c;  4QY7 A;  4DV3 Q;  4IPH A;  1Y1W G;  2I5H A;  3A0J A;  4DV5 Q;  1CKM A;  1K0R A;  1P16 A;  4JI3 Q;  4JI8 L;  3I4M G;  4GKK L;  3M4Q A;  1I6H H;  2AWO A;  1WYD A;  3H3V I;  1W3S A;  4LF7 L;  1MJC A;  3OTO L;  1OTC A;  1FVI A;  1QZG A;  3CW2 C;  5ELO A;  1EFW A;  1WOC A;  2HHH L;  2UXC Q;  1IBL Q;  4IFD J;  4PZ8 A;  1XMQ L;  4R4I A;  1B8A A;  2EXD A;  4B3M L;  3S1Q H;  2YV5 A;  4JC0 A;  4A75 A;  3STB D;  5FLM H;  5BR8 Q;  5C4X G;  1K9M C;  3ZJY C;  2UU9 L;  5ELN A;  4DV6 L;  4LNQ A;  4LF5 L;  1LM0 A;  4BXX H;  4A3C G;  2A1A A;  3KF6 B;  1PH6 A;  1XMO L;  4IOC A;  1R9T H;  1PH7 A;  2VQF Q;  1YVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...