5GQOA

Structure of the second single stranded dna binding protein (ssbb) from mycobacterium smegmatis
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
117
structure length
97
Chain Sequence
ETPFTVVGNIITNPVRLRFGDQELYKFRVASNSLYVTVNCWGNLARGVSASLGKGDSVVVVGHLYTNEYERSSVEVRATAVGPDLSRCIARVEKVQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Single-stranded DNA-binding protein
publication title Structure of the second Single Stranded DNA Binding protein (SSBb) from Mycobacterium smegmatis.
pubmed doi rcsb
source organism Mycobacterium smegmatis (strain atcc 700084 / mc(2)155)
molecule tags Dna binding protein
total genus 19
structure length 97
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5gqoA00
3CC4A 1WYDA 2WAQE 2Z6KA 5IYBH 4BA2I 3T1HL 5M3FG 4LF8L 3PUYA 1VQ5A 3S15H 1CSPA 3AFQA 2AWNA 2EIFA 4IPGA 1VQ7A 2Y0SG 4HIDA 4JOIC 3SGIA 1N34L 5GAHC 3PGZA 4BA1I 4DK6C 4X64L 2HHHQ 4DR4Q 4EQ5A 5GADC 1VQIA 4DUYQ 2R93G 3UDIA 4O2DA 4X62Q 4MNOA 2BA1A 4ME3A 2JA6G 4GLXA 2HQLA 4X66Q 2E8GA 3EIVA 3M4QA 4IPDA 2KHJA 3U4VA 4BBRG 2E5LL 4DR6L 4DR5L 1PH6A 2H5XA 1VCIA 1MJEA 2CCZA 4A3LH 1G51A 3PO2G 1PA6A 2A1AA 2ZM6Q 1N36Q 4R4QA 1IBKL 3F2BA 1L1OA 2PNHA 2JA8H 1CUKA 4BY1G 4DAYB 2MO1A 2XTIA 1D8LA 1K3RA 1EYGA 3G6EA 4L5TA 4DV2L 4NXML 3U58A 2R7DA 4B3ML 1XNQL 1YJ9A 4DR6Q 2QEXA 4UP7A 1X65A 4BY7G 1Q12A 4JBWA 3HOVH 3TRZA 4DV4Q 1HR0Q 2NZHA 3DM3A 3U50C 4LFCQ 1X55A 3FHWA 1HNWQ 4LF5L 4IPHA 3F8TA 4X6AH 1L2FA 4YY3Q 4OXPA 5IT9c 3D31A 3HKZG 1VQ6A 2VQEL 2I5LX 1WFQA 1JE5A 3MXNB 3I4OA 4LUZA 4A4IA 3L2PA 1Q8KA 4UP9A 1IBLQ 4LF4Q 4IO9A 1YEZA 4GKJL 2Y0SE 4A3JH 1LM0A 1SROA 3OTOL 4QIWE 2VY3A 3GTQH 2MO0A 3H0GG 3EBEA 1EFWA 4JYAQ 4QQBX 4B3TQ 4WJ4A 1E24A 1SR3A 2LXKA 3IRBA 3WWVA 5M3MH 2ZJRA 1NMGA 4DR7Q 1AH9A 5E7NA 4A3CH 1ASZA 5C44G 1KC8C 3CQZH 2YTXA 3L7ZC 1JB7A 1YHQA 2UXDQ 2LSSA 4GLAC 3HOUH 5M5WH 1Y1VH 4AH6A 4QJFA 1HJPA 1WCMH 4LUVA 1B70B 5IWAQ 1EQQA 1KIXA 4HIKA 3PUXA 3OYYA 1EWIA 1E1OA 4R4TA 3M85A 4LF6Q 1L1OB 3A74A 3K81C 3UDGA 4YCWA 4P75A 3S1MH 3FKIG 4TQUS 3ULLA 3HOYG 1K8AC 1NBWA 3RLFA 1XMQL 2ZTDA 4A3EH 5HY6A 4A3KG 1N33Q 4IOAA 4BXXG 1BVSA 4K0KL 1V9PA 2WP8J 1X3FA 4O0AA 3D0FA 1V43A 3I56A 2JA7H 4AYBE 3S1RH 3H3VH 2ID0A 5IYDG 2AHOB 2WAQG 2VNUD 1IYJB 4YCVA 3K80C 2KENA 4MTNA 3BZCA 4BBSH 4KI0A 3K0XA 1U5KA 3CCRA 3GTLH 2YV5A 3PUVA 4LW1A 5LMNQ 2B63H 1NY4A 5K36G 4J15A 1QUQA 5M3FH 1RL2A 4A3IH 2JA9A 3KDFA 4HJ9A 1KD1C 3KYHC 5M3MG 4DR2Q 2OWOA 4JI0L 1N32Q 3J80i 5IP9G 4A3CG 2OCEA 1PV4A 1L1OC 1LTLA 4B3RQ 1X54A 3RLNA 2I0QA 3CCLA 4IJLA 2F4VQ 3GTKH 2OQ0A 4DV1L 2R93H 2Q2HA 2WFWA 4Y52H 2GN5A 2E2HH 3BJUA 2NVQH 3T1HQ 4LF8Q 4JI5L 1X6OA 4BBRH 4OWTB 1G291 1OXVA 2Q2IA 3CCJA 4C2MH 1T9HA 1E7ZA 4POFA 1EIYB 3PO2H 2KCMA 3S2DH 3ER0A 4X64Q 1K9MC 4L5QA 1HZCA 1DGSA 5AJ3L 1XMOL 2N8NA 4B3RL 3AEVA 1JJGA 4BY1H 4IFDJ 3E0EA 4LWCA 4QY7A 1A62A 2K14A 3L0OA 5ELOA 3JAMc 3S1QH 2B63G 3KJOA 2E5LQ 2A8VA 1NMFA 2D62A 1QZHA 4JI6L 3PO3H 2UXBL 4DR5Q 1PVOA 1AE3A 3CPWA 4BY7H 4A3IG 4JV5L 1IBML 3NEMA 2ZJPA 4YWMA 2UUCL 4NXNL 1IBKQ 3BZKA 1SRUA 5C0XG 2UXCQ 2KHIA 2ES2A 1QVCA 3CC7A 2ALYB 1QUQB 3MEFA 1YBYA 4QGUA 1I94L 3ICEA 4DV0L 3KDFB 3RZDH 5JEAG 2ZTCA 3JAMi 4DV2Q 3GTOH 4NXMQ 5IE8A 4B3MQ 4DV3L 1Q1BA 3ZJYC 5FLXc 1QZGA 1XNQQ 1N9WA 1YVCA 3S1NH 3CCUA 4KHPQ 1FL0A 3H0GH 1EUJA 1SMXA 3G48A 3GTJH 3NBHB 4A3MG 4A3BG 3H15A 1TWCH 2MQHA 4A75A 4IOCA 3U4ZA 4LF5Q 4DV6L 4IFDI 2RF4A 1VQHA 4P73A 1JJCB 3KLWA 5C44H 1FJGL 3UDFA 2VQEQ 2YTVA 3GTMH 4FDBA 2VUMG 2UXCL 4WJ3M 4NPSA 4GKJQ 3F2DA 1PH3A 2K75A 3OTOQ 3STBC 1XJVA 3HOWH 2YYZA 2ZTEA 2IT1A 4AYBG 1PH7A 1HNXL 2JQOA 1BBWA 1ASYA 2K5VA 1HNWL 1UE7A 3PO3G 1I5FA 1PYSB 3FKIH 3NELA 4APVA 3HOYH 4KHPL 2R92G 4P74A 4JI1L 4A3KH 5GAGC 3CW2C 1D7QA 4BXXH 1VQOA 2R6GA 5M5YH 3S2HH 3ULJA 2F52A 2MFIA 1TWAH 1VQLA 4GLVB 4C3JH 1X9NA 5IYDH 1WOCA 1H95A 4XTCS 1PHJA 5EAYA 1O7IA 4HIMA 2B29A 3Q8DA 1R9TH 2UUAL 3PSIA 3I7FA 3B6YA 3I4NH 3G4SA 4JBMA 1XMQQ 1I6HH 1LYLA 4LFAL 4K0KQ 3PF5A 3A5ZB 5IP9H 2WB1G 4H02A 3I4MG 2EXDA 2UU9L 4DUZL 2VL6A 1GVPA 2N3SA 5GQOA 1P16A 3EN2A 2HIVA 1A0IA 3A0JA 1M1KC 1S3OA 1E3PA 2YTYA 5C4JH 1NTGA 2D0PA 1NE3A 1YHAA 1Z9FA 3CCEA 1S72A 3HOWG 2Z6KC 1HNZQ 2JJQA 4HIOA 4JI0Q 1JJ2A 3JC66 2L15A 1KAWA 1Q46A 4UY8C 4EX5A 1C7YA 3HOZG 2IHFA 4UPAA 4HJ7A 4OX9L 4JI7L 3PV0A 4OWWB 1XPUA 4HJAA 3STBD 3J80c 4JI4Q 4DV1Q 1QVFA 3PCOB 2RHQB 3HOXG 1J5EQ 2Q2UA 4LF7Q 3GO5A 2HIXA 2NVYH 4KLKA 1S40A 4GN4B 4JI5Q 2N78A 1Y1WG 4GNXB 3I4NG 3CMAA 1Q1EA 2NVTH 1HNZL 3CCQA 1OXSC 1XNRL 1K83H 2D0OA 3M7NA 4AQYL 5LMUQ 1XMOQ 1EQRA 1CKOA 1VQBA 2I5MX 1B7YB 4YWKA 5AJ3Q 1GM5A 3W1GA 4PZ7A 3KF8B 1OTCA 1I50H 1VQPA 4JI4L 1HZBA 4PZ6A 1YIJA 3CPFA 2AMCB 1J5EL 3GTGH 2WB1E 4LF7L 5GAEC 4JI6Q 2UXBQ 5FLMG 3CAMA 2OTJA 5BR8L 2CWPA 1KRTA 4A3BH 1IBMQ 2NN6I 4A3MH 4JV5Q 2UUCQ 1RIPA 4NXNQ 1Q7YC 2PQAA 3PF4A 4JBJA 1MKHA 4LF9Q 2FXQA 4GN5A 4YCUA 4JI3L 4DR3Q 5LMUL 4DV0Q 1I94Q 1YZ6A 3AQQA 2B3GA 1Y14B 5LMNW 2VUMH 5J3BA 1JT8A 1VQKA 4DV3Q 4A3DG 1PH1A 3AFPA 2R7FA 1W3SA 2JA5G 3H3VI 4GOPA 2E2IH 1SN8A 1TWFH 2CFMA 5FJ8G 2RCNA 3M9BA 4ALPA 1N8RC 4DNIA 2E2JH 3VDYA 3K7AH 4OO1G 2F3IA 4OONA 1KHIA 1E22A 4DV6Q 1QVGA 2CKZB 2R92H 5IP7G 4PG3A 1FJGQ 1YI2A 1VQ9A 5C4XH 1OXTA 4DV5L 1NJIC 1TXYA 4JI2L 4LF9L 4DR1L 1MJCA 4DR3L 4GKKQ 1L0WA 4B3SL 1IXRA 4TVAB 5C3EG 3J81c 1HNXQ 4LFBL 3TREA 3K7UC 5IYCG 1FGUA 2XGTA 4A3GG 4JCVE 1KRSA 4JI1Q 4L5RC 3TS0A 4L5SA 1UEBA 4DKAC 1VQDA 2CWAA 3UDXA 1G6PA 2PMZE 2VS1A 1YITA 3I4MH 1VQ8A 1EOVA 3AYHB 3J81i 2QGQA 2UUBL 2A19A 1JMCA 3E9IA 2UUAQ 4IPCA 1VQ4A 2RHSB 2AKWB 2PQAB 4LUOA 2VQFL 3T1YL 4GKKL 2JK8A 4DK3C 1I3QH 2R7ZG 4P72A 1P8LA 3PUZA 4LFAQ 1UE5A 4PMWA 1UE6A 1KXLA 1UE1A 4RMFA 4IFDG 1HZ9A 3S16H 4GOPB 3S24A 3HOZH 4A3FG 1XPRA 1A63A 5C4XG 2UU9Q 3J7ZC 4DUZQ 3CCSA 4GNXA 4KHZA 3CMEA 5JJIA 1BBUA 1M90C 4LNQA 3HOXH 2KCTA 3RZOH 1CSQA 2IY5B 3W1BA 1Q82C 1TWHH 4OWXB 3RR5A 2HHHL 4DR4L 2LXJA 1YJNA 1Y1WH 1C0AA 2KBNA 2PI2A 3KF6A 2IHEA 3TEHB 4DUYL 3OW2A 4A93G 4X62L 3CCVA 4JC0A 4P71A 4OX9Q 2IX1A 1PH9A 5IYBG 4JI7Q 4X66L 2HT1A 5JJKA 3A5UA 1VQJA 1HZAA 3G71A 1K0RA 2QA4A 2K5HA 2DUDA 2CQOA 1C9OA 1GO3E 1PH5A 4GOPC 4DPGA 4DV7Q 4POGA 1MIUA 2ZM6L 1N36L 1HH2P 2BH2A 4JG2A 3M4OH 1YHBA 1GKHA 1SFOH 3GTPH 3ULPA 1HR0W 2K5NA 5FLMH 3CP0A 1B8AA 1OXUA 1IZ6A 3RLOA 1XNRQ 1WJJA 4C3HH 3S14H 4DAMA 2PI2E 5JJLA 4AQYQ 2Q2TA 1SLJA 2K4KA 4YWLA 4YHHQ 3UE1A 1Q81C 1PFSA 3F2CA 3J81j 4A3LG 1CKMA 1VQEA 4MZ9A 4DV4L 1KQSA 1XPOA 4XIGS 1HR0L 1SE8A 1VQFA 2DGYA 3GDEA 4LFCL 2JEBI 2K52A 4JOIA 4C3IH 2JA5H 2BH8A 2GVAA 3CC2A 2JA8G 4YY3L 1FVIA 3F1ZA 3HFZB 4DV7L 4R1JA 5BR8Q 5FJ8H 1KL9A 2MNAA 3CXCA 3I2ZA 2AWOA 1CKNA 4LF4L 1IBLL 5IP7H 3ERSX 2EQSA 3PIPA 4JI3Q 3HOVG 1K8GA 1LUZA 3KF6B 4X65Q 4JYAL 1X56A 3M4PA 4YHHL 2VW9A 1PYBA 3NENA 3CCMA 2ZJQA 4B3TL 4HJ8A 3S17H 4DR7L 3J7A5 1VQCA 1IL2A 2JEAI 5C3EH 1VQNA 2YU9H 2V1CC 2UXDL 2NZOA 2ATWA 3M3YH 4UP8A 2GVBA 4PZ8A 4R4OA 4RG1A 5ELNA 5IYCH 1J6QA 4GN3B 3UE0A 1W2BA 4A3GH 2OQKA 3DLLA 4Y7NH 1PH4A 4A3JG 5IWAL 5C0XJ 1OXXK 1VS0A 4IJHA 3TQYA 2ASBA 1YJWA 3RN2A 3HKZE 4DV5Q 1Q86C 4LF6L 4R4IA 5HGQA 4GNXC 4JI2Q 5JEAJ 4DR1Q 4AIMA 4JBKA 4R4CA 4B3SQ 1WI5A 3FP9A 1N33L 1AE2A 1PH2A 2C35B 4JI8Q 1UWVA 4X65L 2NVXH 3CD6A 4LFBQ 1X3EA 3K8AA 3PIOA 3KJPA 3HOUG 1Y1VG 3LGJA 5M5XH 3CF5A 5IY0A 1U0LA 1WCMG 1VQAA 2NN6G 4HJ5A 2R7ZH 2Z0SA 4QL5A 2N49A 1BKBA 5GROA 3GD7A 1VQGA 5DLQE 2JA6H 2BA0A 4GS3A 5LMNL 1K73C 4A3FH 2OTLA 3TS2A 4OO1I 3E9HA 1A8VA 1YNXA 1Z47A 4A3EG 2UUBQ 4A3DH 1N34Q 1CKNB 1PH8A 1TWGH 2JA7G 3KFUA 4DR2L 1N32L 1EIFA 2VQFQ 3T1YQ 3RNUA 2I5HA 3PUWA 5C0XI 4A76A 3HKSA 1V1QA 1GD7A 4JI8L 2VZAA 1E1TA 4NB3A 1XTDA 2IX0A 1VQMA 3KOJA 5H1SE 2JE6I 2K50A 4BBSG 2F4VL 4A93H 1X3GA 3W5OA 3RN5A 3I55A 3BU2A
chains in the Genus database with same CATH superfamily
1WYDA 2WAQE 3K5LA 4NKLA 5M3FG 4LF8L 2AQ1B 1WD0A 1X3QA 3MXNA 1CSPA 2EIFA 2KJXA 3GTMB 1CK1A 4JOIC 5GAHC 1GUNA 4BA1I 2Z9HA 2K5DA 1SNPA 5GADC 1VQIA 3ND9A 3NP8A 4L8JA 1ZXTA 1BQQT 2I07B 4ME3A 4GLXA 5KEEA 2HQLA 3NPPA 3U4VA 4BBRG 3SVMA 2PO4A 4ZKBB 4O1NA 4KY7A 1PH6A 1ONLA 1VCIA 2QEJC 4V190 2KVMA 3MC0B 1EY5A 3FMCA 1L1OA 2JA8H 2MO1A 3QOLA 1D8LA 1K3RA 1E0BA 1XWEA 2F0PA 4CKEA 4DAPA 5EKLA 4UP7A 5M3MB 1Q12A 1L0YB 5DM63 2FFKB 1HR0Q 3DM3A 1X55A 1HNWQ 4IPHA 1L2FA 4OXPA 3D31A 1WCMB 4MHEA 1DD2A 1EFID 1E2WA 4FVMA 4A4IA 3DWQA 4LF4Q 4IO9A 4GKJL 1WTPA 4LMQD 2VY3A 3MXGA 2A6HC 1SR3A 3DMUA 3S1RB 1WTHA 3J80L 4A3CH 3A54A 2UXDQ 4KJNA 4QJFA 2N88A 2O4XA 4ABNA 4FP5D 1AFPA 3NK9A 1B2TA 5I9PA 1JOQA 3A74A 2B2YA 4CJ1B 3RLFA 2ZTDA 4A3KG 5HY6A 4QIWB 4BXXG 3EQLC 3I56A 2JA7H 1I50B 3GTKB 1F2ZA 2ID0A 5FLXE 4DXGA 3A55A 3LX0A 4YCVA 3T56B 5C4HA 3GTGB 3BZCA 3KK7A 2O5JC 3K0XA 1EQVA 2KA7A 1BCPB 5CV4A 2B63H 3I90A 1JB3A 1QUQA 2IPKD 1LTAD 1RL2A 2JA9A 3KYHC 1N32Q 1A6XA 4DN4M 3WOFA 1DYQA 3RLNA 3CCLA 4XXEA 1NR2A 2R93H 2Q2HA 1J8IA 2WFWA 5I4DA 2NVQH 1G291 1KTKA 3SR1A 2Z4IA 1E7ZA 2F0UA 1EIYB 3D4DA 3ER0A 1K9MC 1SXTA 2N8NA 3P1HA 1DJRD 3IKJA 1NCVA 2K14A 3L0OA 5ELOA 2K01A 4RKBA 3JAMc 1HPCA 3X3MA 3V2TA 2UXBL 1W6JA 1PVOA 1AE3A 4PNYA 3BZDB 4BY7H 1IBKQ 1SRUA 1VDZA 1TT2A 2UXCQ 1BR9A 3WOEA 1QVCA 2EY5A 4FNFA 3MEFA 5CBAE 3RZDH 5IE8A 1EY0A 4L63B 1U4MA 1N9WA 4KHPQ 5ELFA 3H0GH 4BS9A 4A3BG 1F2MA 1NR4A 1RD9D 1G2TA 4LF5Q 4DV6L 3Q23A 4IFDI 1STHA 4C3JB 2QW7A 1ENFA 3AU7A 1CQVA 5E1FA 4WJ3M 1PH3A 1Y1WB 1TS4A 3STBC 1AW7A 1C4QA 2ZTEA 4J8QA 4AYBG 1BBWA 1O7YA 1BCPD 3NBIA 1UE7A 5C6AA 5KGUA 3HOYH 2R92G 4P74A 1I4QA 3CW2C 1VQOA 2R6GA 3TN2A 5M5YH 3S2HH 3DM1A 3ULJA 1GHKA 1I4GA 1WOCA 1WTWA 1H95A 5EAYA 1LTTD 1O7IA 1JC7A 1UNSA 1SFOB 2B29A 5G3LF 1MHWC 1EY6A 3I4NH 3URYA 2B2UA 2RCFA 2EY2A 1HXYD 5IP9H 1L0XB 4KN7C 1LLRD 4DNTB 4B08A 1VMPA 1PTOC 3HP3A 1S3OA 1STAA 3HS0C 4QB4A 1B9MA 1NE3A 2D0PA 3PQIA 3HOWG 2NTTA 1IHZA 1JJ2A 3JC66 2BDOA 1Q46A 2B2TC 4EX5A 1C7YA 4JI7L 3PV0A 4Z9CB 1G2SA 4LF7Q 3GO5A 1H9MA 3MTSA 1K0SA 1D5XC 2K28A 4KLKA 2N78A 4J6HA 1MSHA 2NVTH 3C1EA 1UUPA 3CCQA 1OXSC 1K83H 4AQYL 5DM73 4YWKA 5C0XH 2VUMB 1SNCA 3W1GA 4PZ7A 4KY6A 2Q8RE 1E2ZA 2BDNA 4JI4L 4F7XA 5JEAH 1HZBA 3U9SA 2R7ZB 1BUVT 3NTHA 3K7AB 1J5EL 5GAEC 2CWPA 4JV5Q 4A3MH 1RIPA 4LAAA 1Q7YC 4NW2A 4QMGA 1EU3A 2WKDA 4CBVA 4JBJA 1MKHA 1KDBA 2FXQA 4GN5A 5LMUL 2B3GA 1YNNC 4C1NK 4DV3Q 2IW3A 2WACA 4A3DG 5BN4A 2E2IH 4ZK9B 1PDQA 1TWFH 1N8RC 2RCNA 4TKOB 2ZXOA 1B53A 3VDYA 4IQZA 1KHIA 2F0MA 1QVGA 2Z4HA 1VQ9A 4ZRZA 3QR8A 4DV5L 1WD1A 3HG9A 4DR3L 1MJCA 1I3QB 3HGBA 5C3EG 2KEEA 3K7UC 2FINB 3HOZB 4L5SA 3J80E 2WIIB 5CV8A 2CWAA 1CI3M 2XN9C 1G6PA 1H9SB 2L4NA 2PMZE 2VS1A 1YITA 1VQ8A 3RZOB 1JMCA 4RGNA 2PQAB 3TZDA 2EJFC 3T1YL 1CA6A 1NUCA 4K2KA 4DK3C 2XWBB 4DAVA 4LFAQ 1UE5A 1UE6A 1V1OA 1NSNS 5CV7A 4IFDG 1HZ9A 3S16H 3S24A 1IW7C 1A63A 1XPRA 5C4XG 1EYCA 3J7ZC 4KHZA 1U4LA 4CHTB 2KCTA 1JORA 3C3LA 5E3FA 1TWHH 4OWXB 4R8IA 4DR4L 1YJNA 4HCEA 4DUYL 4X62L 3CCVA 4P71A 4OX9Q 2IX1A 4IUPA 1MBYA 4X66L 2DJFC 3A5UA 5EGTA 3G71A 1H9JA 2K5HA 4C3IB 1GO3E 1EZ8A 4GOPC 4OIJA 4POGA 1MIUA 1N36L 4JG2A 4OL7A 1HR0W 1SSOA 1HQMC 3NWTA 1V8QA 4C3HH 2PI2E 3T51B 2NB0A 1LO5D 4ILWA 2K4KA 1DOMA 3J81j 1VQEA 3C46A 4XIGS 2G9DA 2FMCA 3KLSX 4LFCL 2JEBI 2K52A 2JA5H 2JA8G 1ET9A 4BBSB 4I65A 3CC2A 4YY3L 1FVIA 1GOZA 5FJ8H 1KL9A 3CXCA 2AWOA 4KKUA 5M3FB 1E2VA 4WJWA 5IP7H 4OELB 2R61A 1X56A 2VW9A 1STNA 1PRTD 3S17H 3EA6A 4Q0FA 2JN4A 1STGA 1VQNA 2YU9H 4L6TB 2E2HB 4RG1A 4R4OA 1VMCA 3IL8A 5IYCH 1EWCA 4A3GH 1SAPA 2DNEA 2Z8LA 1TVXA 4A3FB 3EJIA 4BBRB 5IWAL 1UEAB 1VS0A 3FEWX 3TQYA 1YJWA 3HKZE 2L11A 4RFBA 5HGQA 1D1KA 4FF4A 4GNXC 3FP9A 1N33L 2C35B 1MD2D 2A6ED 1X3EA 1WTQA 1F77A 5ELBA 1XYIA 1R4QB 1HTPA 3W3AA 2HCCA 5LL6X 5IY0A 3H09A 1VQAA 1SE2A 4QL5A 1EL0A 1QWYA 5LMNL 2RDHA 3TP6A 4OO1I 1YNXA 1VF7A 2BE5C 2EYLA 5L37A 5FKAC 1CKNB 5CGKA 3D8GA 2JA7G 1EIFA 2VQFQ 5T1GA 3PUWA 5KIXA 5C0XI 4IURA 1WTXA 2O5IC 4JI8L 5C4ZA 5H1SE 1SMYC 3MWYW 5D3DA 2F4VL 4A93H 1RCVD 4Q5VA 3RN5A 3BU2A 4KD4A 1TKWB 1F9SA 3QWNA 2MP1A 4RCNA 3S15H 1EY4A 1IYUA 3AFQA 4FYDA 2AWNA 4IPGA 1VQ7A 4I7ZC 2Y0SG 1ESRA 3PGZA 3TP8A 2PW5A 4DK6C 3DUZA 2R93G 3UDIA 3K5NA 1JQYD 2BA1A 3D6WA 1PFBA 2JA6G 1PXUA 2F0IA 4A3KB 2E8GA 3EIVA 1RKNA 1F2YA 4DU9A 1H9KA 1HQRD 4DR5L 1MJEA 4A3LH 1TWAB 1MGSA 2QDLA 1PA6A 2ZM6Q 1PZJD 5JPMC 4FXKC 1TS2A 3F2BA 2PNHA 1R9TB 1D1IA 4NP5A 1CUKA 4DAYB 3K0YA 4DA2A 5J22A 4A3JB 1B9NA 3M4YA 3G6EA 4DV2L 3U58A 2R7DA 3SK5A 4B3ML 1TS3A 5NUCA 4HEDA 2X69A 4BY7G 1U4RA 4DV4Q 2NZHA 1PTOB 3U50C 1GJXA 3OHXC 5M5WB 5ELDA 2G5DA 3E0JA 1I4HA 5C4JB 2K6AA 4KV6A 2VQEL 2I5LX 1WFQA 3KLRA 3L2PA 1Q8KA 1IBLQ 1A3UA 1YEZA 3DEOA 2Y0SE 3HZXA 3S1MB 2PQEA 3OTOL 3H0GG 1ESFA 4A3EB 4F87A 3EBEA 4JYAQ 4QQBX 4WJ4A 1NNXA 2JXMB 1SE4A 3IRBA 1BOSA 3MZ5A 3WWVA 5M3MH 3DWPA 1ASZA 2XWJB 1KC8C 3M7GA 3HOUH 4U673 4AH6A 3GTLB 1WCMH 2NN6H 1LV9A 1EQQA 4HIKA 3PUXA 5IGGA 4R4TA 4LF6Q 3M85A 4ZLTF 5IIFA 4P75A 3HOYG 5FO8B 1NBWA 4B9XA 4IOAA 4K0KL 4GZYC 4O0AA 3D0FA 3S1RH 2AHOB 2WAQG 1IYJB 2KENA 5IGBA 4BWGB 5JJZA 3CCRA 1GUWA 4A3BB 3PUVA 4HMIA 4HSVA 2HD3A 1PTOF 4JI0L 4HJ9A 3SHLA 5IP9G 1PV4A 1L1OC 1LTLA 4FF1A 3GTKH 2OQ0A 3OSOA 4AYBB 3T1HQ 2R92B 4IUVA 4JI5L 2KCMA 2MJ8A 1LTBD 4X64Q 5DNFA 5AJ3L 4B3RL 3E0EA 1A62A 3GTJB 3S1QH 4ULLA 1TWCB 3KJOA 2E5LQ 2D62A 2F0DA 3SE0A 4A3IG 1A2TA 1IBML 2RDFA 1ET6A 5C44B 3NQTA 2ZJPA 2UUCL 4IZ8A 4XT3B 1EY9A 3BZKA 5C0XG 2OT2A 2K1BA 3CC7A 2ALYB 1YBYA 1I94L 3KDFB 5JEAG 5A35A 2ZTCA 4PV1C 3QJYA 3HOWB 4NXMQ 5EPJA 1XNQQ 1YVCA 3S1NH 3CCUA 3C2PA 1FL0A 1SMXA 4A3MG 3NBHB 2PPBC 4PMCA 4A75A 2CW0D 5ISRA 3IFTA 2EDGA 3KLWA 3NHHA 4EGVA 2YTVA 4FDBA 2EOTA 1ICFB 4G7HC 4FXDA 1YNJC 2YYZA 1HNXL 2IT1A 1I6HB 1PH7A 1SYBA 1ASYA 2K5VA 3A8IE 3PO3G 1I5FA 3NELA 3FKIH 2EXZA 1HHVA 4JI1L 2EYMA 1S5DD 4NDXA 3E3XA 4KHVA 2F52A 2MFIA 5IYDH 4C3JH 1X9NA 4XTCS 1PHJA 3GTPB 3NUCA 3Q8DA 2UUAL 1IYVA 3I7FA 2XRSD 3B6YA 5K36H 1XMQQ 2AQ2B 3G6JB 2EE1A 4YIJA 4CJ0B 3A5ZB 3R2TA 5BN3A 4UAIA 3QG1A 5IGDA 4DUZL 2N3SA 2NVYB 3EN2A 2HIVA 2VB3X 1A0IA 2CH4W 4KN4C 1S72A 1Z9FA 1YHAA 3CCEA 3I72A 2Z6KC 2MPMA 2FMMA 4K5WA 5DAUA 1KAWA 3VR6A 4LJZC 1CTMA 5KYIA 2AQ3B 1XPUA 5KNDA 1JWMD 3J80c 4JI4Q 4DV1Q 1CHPD 4XYOA 3T53B 3H3VC 1S5CD 1SYGA 1J5EQ 1EWHA 2Q2UA 5JVG3 1STEA 2B2VC 4Y7NB 4GNXB 1SYDA 2DNCA 1KAAA 4F8MA 3DWAA 1O7ZA 2F0QA 5D65A 5IGEA 5LMUQ 4H7BA 2OEOA 1XMOQ 2I5MX 1B7YB 3KF8B 5CBEE 4IUQA 4WFN3 2F03A 1K8OA 4JI6Q 2MGSA 4WRDA 2OTJA 1H9SA 1ZYRD 2NN6I 4NXNQ 3MHBA 5C4XB 2M9VA 5J39A 2PQAA 5F2DA 3PF4A 1PZKD 1S4ZA 4KKTA 4YCUA 4DR3Q 4DV0Q 1YZ6A 2VUMH 1B44D 4TRDA 1PH1A 2JA5G 2I46A 5FJ8G 3M9BA 4ALPA 2B2UC 2E2JH 1LT6D 3D4RA 3K7AH 4OONA 1E22A 1FNWA 1PFMA 5IP7G 2D5DA 4PG3A 1FJGQ 5JAVA 1YI2A 4JI2L 2A69D 1ILPA 2A68C 4LFBL 3TREA 3BYTB 5IYCG 1FGUA 2E76C 4A3GG 4JCVE 3RUZA 3VYRA 1EZ6A 1UEBA 2HUGA 1VQDA 3Q6SA 3UDXA 3PMFA 5HGTA 1EEID 3I4MH 2F0TA 1EOVA 2J7ZA 3J81i 2A19A 3E9IA 5C5MA 1VQ4A 2RHSB 5CMDA 4LUOA 4CGYB 1I3QH 3TZUA 4P72A 1P8LA 4XQJA 1VF5C 4PMWA 1KXLA 1D5MC 4RMFA 3HOZH 2UU9Q 1RHPA 1QCBD 3O13A 5IT9L 3CMEA 1BBUA 5I2YA 5IODA 2J4XA 2CQAA 3HOXH 1M90C 4LNQA 3RZOH 1CSQA 5LL6S 3MAQA 3W1BA 5KNBA 1Q82C 1NAPA 2EYFA 2LXJA 3OW7A 3S14B 5K5PA 4A93G 1SDFA 3OW2A 2JP1A 1PH9A 3MFGA 5JJKA 4HR7B 1K0RA 2QA4A 2DUDA 2CQOA 1PH5A 1GUSA 4DPGA 1JR0D 1AEXA 1QNUA 1HH2P 2BH2A 1KDAA 1YHBA 1HA5A 4N9PA 5FLMH 1OXUA 3SK4A 3RLOA 2EYPA 1XNRQ 2D9UA 5G3LD 3ND8A 1SLJA 1RODA 1GUGA 3UE1A 1Q81C 1PFSA 2JYOA 1HFNA 4C56C 4A3LG 3R2IA 1CKMA 1XPOA 1HR0L 1Z7TA 2O2LD 3M3YB 3GDEA 5CORA 4C3IH 3SDZA 1HNWL 2BH8A 3LWEA 1JJGA 2F0FA 4R1JA 5BR8Q 3DXJC 4K5VA 5EBCA 3FVQA 4OO1H 4HSPA 3HEJA 1CKNA 4LF4L 4JI3Q 1K8GA 1CFMA 1F2LA 2RA4A 4X3KA 3SEBA 4YHHL 5DEHA 1PYBA 3NENA 4G57A 3J7A5 5M5XB 3C1FA 2V1CC 2UXDL 2PNRC 1FR3A 3KBGA 1O80A 4PZ8A 1HA6A 3UE0A 2JA6B 2OQKA 3DLLA 1OXXK 3QB3A 3D6CA 2ASBA 2LMCB 4DR1Q 4AIMA 4B3SQ 1WI5A 3CD6A 4JI8Q 4X65L 1UWVA 3IAYA 4ZYSA 3OMCA 3K8AA 1LT3D 3KJPA 3HOUG 1CT1D 1WCMG 2NN6G 2Z0SA 1TS5A 2E2DC 1KDCA 1Q90A 2EJMA 1BKBA 4BY7B 2BA0A 4GS3A 2E74C 3FRPB 4TSSA 4A3FH 3TS2A 2UUBQ 4DAYA 4H44C 1QJOA 5AFWA 1C8CA 1N32L 3HKSA 1E1TA 1LTID 1STYA 3Q22A 3QOJA 3H0GB 3TP7A 4BA2I 2CH4A 3OWEB 5IYBH 4XQQA 2L9HA 1VQ5A 2MHVA 4DK0A 2RDGA 1PFNA 4HIDA 1RTOA 4K8IA 1N34L 2HHHQ 2R3ZA 1JOOA 4EQ5A 2EZVA 3MXUA 2GA4B 2B2WA 4O2DA 1HRJA 5JOBA 3HOYB 3HOVB 5EPKA 4G4KA 1Q3LA 4DXFA 1SE3A 4DR6L 1K8MA 5M5YB 1Z6HA 2H5XA 2CCZA 2HQEA 1G51A 2A1AA 2WAQB 4R4QA 3A7LA 1IBKL 1O78A 3N6RA 1I6VC 1R4PB 3TDQA 3GTQB 1EYGA 3NXWA 1X65A 2XNAC 4HTHA 3EFXD 5KNCA 3IFDA 1D6EC 3FHWA 4LF5L 5EKIA 1FGBD 4X6AH 1QG7A 1CQFA 3J7AF 1SNDA 3HKZG 3L9AX 1FNUA 1JE5A 3L3OC 4EQNA 4A3JH 4QIWE 5CR3A 4B3TQ 2LXKA 2X6LA 4DR7Q 2ZJRA 1NMGA 4K2LA 1AH9A 5E7NA 3CQZH 1JB7A 2LSSA 5JVH3 2ZXPA 5M5WH 1Y1VH 1B70B 1KIXA 1EWIA 1E1OA 4A3IB 1IL8A 3K81C 1K83B 3UDGA 4CDCC 2LY7A 3S1MH 3FKIG 3NTIA 3ULLA 1K8AC 1DONA 1EOTA 4A3EH 3I73A 2Q8TA 2WP8J 2EYOA 4MTKA 3GP7A 4X3TA 5IYDG 2VNUD 2F0VA 1I4PA 4MTNA 2B8FA 1ICWA 2F0GA 1B1ZA 4KI0A 3GTLH 2AUJD 2YV5A 4LW1A 5K36G 4C2MB 3KDFA 2OWOA 1KD1C 4DR2Q 3J80i 4A3CG 2OCEA 1X3PA 1SJHD 4B3RQ 2IX3A 5I9OA 4H13C 2E2IB 4N8FA 3NBHA 3H91A 2A6HD 3PO3B 4LF8Q 5EKKA 3VA5A 5IT9E 2Q2IA 1BCPC 5EQ0A 1T9HA 3PO2H 3S2DH 4XDXA 3J81L 3GTOB 3AEVA 4IN3A 4XT1B 4BY1H 4QY7A 1T5EA 2B63G 1NMFA 4DF7A 1QZHA 2K04A 4JV5L 3T13A 4CDFC 2KHIA 2ES2A 4IUUA 3ICEA 1II3A 4QGUA 3Q24A 4QUCA 2EJGC 3JAMi 1B50A 4DV3L 3ZJYC 5FLXc 1QZGA 3NSWA 3G48A 3GTJH 4G7OC 1TWCH 4IOCA 1LT5D 1VQHA 4P73A 5C44H 1ZEQX 3UDFA 4CKCA 3GTMH 1QNKA 2VUMG 3RD4A 4NPSA 3TMEA 1HCZA 4GKJQ 5E4WC 4S3SA 1XJVA 3HOWH 4KK7A 2QILA 5CC4A 1PYSB 4APVA 1D5ZC 2NTSA 5CYUA 3OIPA 2N55A 4DNRB 1QE6A 1VQLA 2CVRA 3VR3A 2RVLA 4U68A 2P5ZX 3PSIA 1ZKOA 3KUPA 2Q8IB 1I6HH 3KF8A 3BYYB 1A3TA 1LYLA 4LFAL 5ELEA 3PF5A 2L12A 2WB1G 4RHRA 3I4MG 2K7VA 4I7AA 1U9RA 2F0JA 1GVPA 2X6GA 5GQOA 1P16A 2NWGA 3A0JA 1M1KC 1E3PA 1NTGA 2VXWA 5FO9B 4HIOA 2FHTA 4H0LC 3HOZG 1SNOA 2EPBA 2IHFA 4UPAA 4OX9L 4RGTA 4P2CB 4OWWB 3STBD 1QVFA 3SXHA 3PCOB 3HOXG 2C9OA 4QCLA 5I2XA 2NVYH 4M1UB 1S40A 3I4NG 1Q1EA 1HNZL 1HTLD 3V05A 3M7NA 3KBXA 5C5LA 2QDBA 1CKOA 1GM5A 4F88A 3X3NA 1ML0D 1OTCA 2V4DA 1I50H 1PZID 4RCOA 1YIJA 1GUTA 3GTGH 2WB1E 2UXBQ 5FLMG 3CAMA 2NBFA 1KRTA 3J7YW 2BOSA 5ELCA 3BDOA 4UHVA 1PTOD 4ME5A 3AQQA 5LMNW 1K28A 1Y14B 2F4IA 5J3BA 1VQKA 1EIHA 4C3IG 2R7FA 1W3SA 4XQNA 1EYAA 4V0BA 1SN8A 5D14A 2CFMA 3OIQA 1SNQA 4OO1G 4RGMA 4DV6Q 2CKZB 3S15B 4HMJA 3AB9A 5C4XH 1OXTA 1TXYA 3VYUA 4LF9L 3CKIB 3BDCA 1L0WA 1IXRA 1TU2B 2HDMA 5I6YA 3AMUA 2B2YC 2AUKA 4C1NI 2Z6BA 2RSOA 2K03A 1S5FD 4L5RC 2PZWA 2KHSA 1O7LA 4DKAC 2PCFB 3GQBA 1ENCA 5CV5A 3AYHB 5A2QL 4IPCA 2ENBA 2AKWB 2VQFL 4GKKL 1JWSD 1RJTA 2JK8A 3V96A 2WV6D 2M2LA 1BNZA 1XX8A 4GOPB 2DY8A 2BCOA 4A3FG 1YNND 1GUOA 3F2UA 3CCSA 2A74C 3CRLC 1SYFA 2CHBD 4KMUC 3M4OB 3K5OA 2IY5B 2PMZB 2G9HD 5JPNC 3RR5A 1XXGA 1PRTC 3VR2A 2XRQD 1BDOA 1C0AA 1Y1WH 1JOKA 2KBNA 3TEHB 2FJ2A 4O42A 2RSNA 5IYBG 4JI7Q 4E6IA 1VQJA 1HZAA 3FDTA 4A3DB 2KCCA 3HOUB 2ZM6L 3A7AB 2QF7A 4OIKA 1SFOH 2K5NA 2F0EA 2A6EC 2KEDA 1IZ6A 1WJJA 3S14H 5JJLA 4AQYQ 2Q2TA 4KJOA 1WTOA 4YHHQ 3G7LA 3J81E 1T5XD 3CHBD 3F2CA 4DV4L 1KQSA 3E5SA 5C3EB 1SE8A 1VQFA 2NZ1D 4JOIA 5C3WA 4K5XA 3HFZB 4DV7L 1GHJA 5LHY1 1IW7D 3I2ZA 2IWHA 1IBLL 3HRZC 2L1BA 1G91A 3NTKA 4G7ZC 2NVXB 3KF6B 4X65Q 4JYAL 1CM9A 3M4PA 4RA8A 1TQOA 1VQCA 2JEAI 1BBXC 3M3YH 4OEMB 4KTAA 1W2BA 1RTNA 1J6QA 2XIWA 4C3HG 4A3JG 4HCSA 1U4PA 4IJHA 3RN2A 1Q86C 4DV5Q 4LF6L 2DN8A 1TWGB 1A2UA 4R4CA 1AE2A 4PMBA 5CV6A 1PH2A 2KQ3A 2J0TD 1ENAA 3ITPA 1Y1VG 3LGJA 1PLFA 5M5XH 3CF5A 3JAML 3S1QB 1U0LA 2R7ZH 4JK1C 1G8ZD 4ZQ3A 2N49A 3I91A 1VQGA 2JA6H 1CZWA 3K59A 1A8VA 1Z47A 2F0WA 4FXGC 4A3EG 1FD7D 1N34Q 2RQXA 1PH8A 3KFUA 3HKZB 3T1YQ 1UAPA 4A76A 3BVGA 2IX0A 2JE6I 1V1PB 2K50A 3S1NB 2PZUA 3W5OA 5IGCA 1F9RA 1MSGA 4DR6Q 3CC4A 1IKLA 2Z6KA 2Z1CA 3T1HL 2DY7A 3PUYA 5EJWA 4FF3A 4UDUC 2K5QA 2JA8B 3SGIA 5KRUA 3K57A 4X64L 4DR4Q 5TSSA 1BO0A 1BCPF 4KD3A 4PQXA 4DUYQ 3A56A 3N52A 4X62Q 4MNOA 4ZCKA 1DOKA 3FKIB 2IL8A 4EQPA 1D2BA 2B2VA 4X66Q 2ICIA 1LABA 3M4QA 4IPDA 2E5LL 2KHJA 3H94A 1A3VA 2KCNA 3PO2G 2TMPA 1HUNA 1N36Q 1HUMA 4OHJA 3PIP3 2M00A 4BY1G 2SNMA 2XTIA 4L5TA 4NXML 2BE5D 4R9WA 3QO2A 1XNQL 1YJ9A 2QEXA 3TBIB 3I3CA 4JBWA 2HCIA 3HOVH 3TRZA 4RH6A 1DZ1A 4KY5A 4ZKCB 4LFCQ 3ERQA 4K14A 1SMYD 3F8TA 5E4XA 4YY3Q 5IT9c 3ONAB 1VQ6A 2B39A 2LFNA 3MXNB 4LUZA 3I4OA 1Y8OB 4UP9A 3K5MA 2K05A 1LM0A 1SROA 1I4XA 2XVSA 2MO0A 3GTQH 3PIO3 1EY7A 2H4OA 1S5ED 1EFWA 1E24A 2JA7B 4XYQA 2PYKA 5KYLA 5C44G 2YTXA 3L7ZC 1YHQA 4GLAC 1LACA 1HJPA 4LUVA 2B63B 5IWAQ 3OYYA 2C5CA 1L1OB 4OGQC 4YCWA 2D2CC 1SBBB 4TQUS 4LK1C 1STBA 2Y0SB 1XMQL 2F0KA 1N33Q 1BVSA 1RF2D 1V9PA 3OMGA 3FPPA 1X3FA 3H3VH 1V43A 5I6WA 1Q8IA 4AYBE 5T1IA 2R93B 2B2WC 3K80C 1F9PA 3NE5B 2NVQB 4BBSH 3CRKC 1TY0A 1U5KA 1EU4A 1WTRA 5LMNQ 1GXDC 2QKIC 1NY4A 3K58A 4J15A 5M3FH 4A3IH 4RHSA 5M3MG 4FO2A 5A2QE 2LS01 3BVZA 2CW0C 1X54A 2I0QA 4IJLA 2F4VQ 4DV1L 2WKCA 3FPUB 2E2JB 2DJGC 1C48A 2A5HA 4Y52H 2GN5A 2E2HH 3BJUA 1X6OA 4BBRH 1SNMA 4OWTB 3P7JA 1OXVA 3CCJA 4C2MH 3J7AV 4POFA 3VYTA 4L5QA 1HZCA 1DGSA 3RZDB 1LTGD 1XMOL 1B3AA 3BG3A 4IFDJ 3U9OA 4LWCA 1EY8A 2A8VA 4ZUJA 1QOHA 3R93A 4JI6L 3PO3H 2E75C 4DR5Q 4K6DA 3CPWA 2WB1B 5C3XA 1Y8PB 5M9OA 3NEMA 4YWMA 3I4MB 3QIAA 1XTCD 4NXNL 2B2TA 3MFYA 1ILQA 3OWFA 4R8NA 1QUQB 4DK1A 2F3VA 4DV0L 1QB5D 4DV2Q 3GTOH 4B3MQ 1Q1BA 1Y8NB 2RKSA 1G6ZA 2LKVA 1EQTA 4CJ2C 1EUJA 4KKSA 3I4LA 1DXMA 3NQIA 3H15A 2KECA 2MQHA 3S2HB 3U4ZA 3VA7A 2RF4A 1PMRA 1JJCB 1FJGL 1PRTB 3UI2A 3HOXB 3TSSA 2VQEQ 2UXCL 3F2DA 3I4NB 2K75A 3OTOQ 1KNAA 2QCPX 2JQOA 1B3QA 3OOCA 4ODGA 4KHPL 1KLUD 2L5TA 4A3KH 4RKLA 5GAGC 3LWUA 4BXXH 1D7QA 1WTVA 2F3WA 2NUCA 1TWAH 4GLVB 4HIMA 1R9TH 5IGFA 4M8AA 4N9TA 2ZXRA 3G4SA 4JBMA 1LTRD 3H6MA 3EROA 3S9WA 4K0KQ 2SDFA 3K6OA 4EQOA 2F1MA 1ZYRC 4K6LA 4H02A 1PTOH 2EXDA 2UU9L 2K5WA 2VL6A 3JAME 1RDPD 3EVQA 2EY6A 5C4JH 2YTYA 1BXTA 3I70A 2NVTB 1HNZQ 2JJQA 4JI0Q 3NWSA 2L15A 1CZGA 2KOLA 1JWUD 1PRTF 4UY8C 2F0HA 4HJ7A 1H9RA 4IALA 4RWSC 4ZUIA 3Q0AA 4HJAA 4C3JG 1YNJD 2RHQB 1JCKB 2F0SA 4JVZA 2HIXA 4GN4B 4A3MB 4JI5Q 1Y1WG 3CMAA 2A69C 4JW0A 1AP0A 1XNRL 1EYDA 2EY1A 3LNNA 2D0OA 1S5BD 1EQRA 1VQBA 2NYZD 5AJ3Q 2EYHA 4X3SA 1MI2A 1VQPA 1SEBD 1TWFB 4PZ6A 3CPFA 1CA5A 2AMCB 3A8JE 1B4OA 3KLSA 1AZPA 4LF7L 2OXPA 5HURA 5BR8L 2IJ0A 4A3BH 1IBMQ 1K3BC 4CDEC 2UUCQ 4LF9Q 4JI3L 1I94Q 2HDLA 1JE4A 3RMHA 1JT8A 4MIUA 1FNVA 3D4WA 3VYSA 3AFPA 3H3VI 4GOPA 2SOBA 4DNIA 2F3IA 1J9OA 1KABA 2R92H 2H1EA 1EIGA 1WVLA 1NJIC 1Y69U 4DR1L 4GKKQ 5FK9C 4B3SL 1EEFD 2K33A 4TVAB 3P20A 3J81c 1HNXQ 5FLXL 1A15A 2K32A 1LTSD 2XGTA 3S16B 1KRSA 4JI1Q 3TS0A 3T4AC 1DM0B 4DFAA 3MA2B 2UUBL 2QGQA 1TWHB 2UUAQ 3I8ZA 2ZT9C 1W6KA 4J1MA 1SJED 2R7ZG 4ZAIA 2F0NA 3PUZA 1UE1A 2EVBA 1FYCA 4RGOS 4HN7A 5FO7B 3GV6A 4DUZQ 5J1ZA 1DCZA 1SYCA 4B9WA 2B8GA 4GNXA 5JJIA 2L55A 3E6ZX 4IUNA 5FOBB 2HHHL 1IKMA 4C3HB 3BS1A 3KF6A 2PI2A 3SK6A 2IHEA 3VR5A 5EPLA 3MVVA 4JC0A 2A73B 3R8BA 1JICA 4RAUC 3BDLA 3T16A 2HT1A 2PZTA 1TR5A 3CQZB 2A68D 1M8AA 2JA5B 2EYJA 1C9OA 2ICEC 1Y1VB 4DV7Q 3M4OH 2XSCA 1GKHA 3GTPH 3ULPA 3CP0A 1B8AA 3TP5A 4DAMA 1F9QA 2RBMA 1OO9B 1DOLA 4YWLA 3S17B 4FF2A 1TIID 4MZ9A 2SEBD 2YU9B 4ID6A 2DGYA 3VR4A 4A3DH 3CU7A 1KNEA 5COYA 2GVAA 3MEHA 3F1ZA 4A3GB 3R3OA 2OF1A 5EBDA 3WDNA 4X3UA 3P75A 2MNAA 5D3IB 1QILA 5IOCA 2WINB 3ERSX 2EQSA 3PIPA 1HFGA 4EVOA 3HOVG 5CV9A 1LUZA 4N8X1 1V1PA 4B3TL 2ZJQA 3CCMA 4DR7L 4HJ8A 1IL2A 5C3EH 2NZOA 4NMZA 1AZQA 2ATWA 1CHQD 4UP8A 2GVBA 2MUYA 5ELNA 4CDDC 4GN3B 4QF4A 4Y7NH 1PH4A 1M4VA 2F0OA 4QUFA 5C0XJ 4DGZA 3DHQA 4R4IA 3PO2B 4JI2Q 3S2DB 5JEAJ 1KLGD 4JBKA 2VB2X 2SNSA 3OPOA 2NVXH 4BY1B 4LFBQ 2KUMA 3PIOA 3GV3A 4MN3A 1LT4D 3SK8A 4A93B 4HJ5A 3D3RA 1X32A 2PW7A 3W2DA 1BF4A 2TSSA 5GROA 1TY2A 2JSOA 3GD7A 5DLQE 4IFDH 1PYWD 3MXPA 1K73C 2OTLA 3ZYYX 4HAEA 5BN5A 3E9HA 1I4RA 3DEPA 4JPBW 4CKBA 1TWGH 4DR2L 4K8JA 3RNUA 2I5HA 1V1QA 1GD7A 1VQMA 2VZAA 1SYEA 4NB3A 1XTDA 4WORA 3KOJA 2F0LA 3BVMA 4BBSG 2L0CA 1AN8A 3A8KE 4IUTA 1X3GA 3I55A
chains in the Genus database with same CATH topology
3CC4A 1WYDA 2WAQE 2Z6KA 5IYBH 4BA2I 3T1HL 5M3FG 4LF8L 3PUYA 1VQ5A 3S15H 1CSPA 3AFQA 2AWNA 2EIFA 4IPGA 1VQ7A 2Y0SG 4HIDA 4JOIC 3SGIA 1N34L 5GAHC 3PGZA 4BA1I 4DK6C 4X64L 2HHHQ 4DR4Q 4EQ5A 5GADC 1VQIA 4DUYQ 2R93G 3UDIA 4O2DA 4X62Q 4MNOA 2BA1A 4ME3A 2JA6G 4GLXA 2HQLA 4X66Q 2E8GA 3EIVA 3M4QA 4IPDA 2KHJA 3U4VA 4BBRG 2E5LL 4DR6L 4DR5L 1PH6A 2H5XA 1VCIA 1MJEA 2CCZA 4A3LH 1G51A 3PO2G 1PA6A 2A1AA 2ZM6Q 1N36Q 4R4QA 1IBKL 3F2BA 1L1OA 2PNHA 2JA8H 1CUKA 4BY1G 4DAYB 2MO1A 2XTIA 1D8LA 1K3RA 1EYGA 3G6EA 4L5TA 4DV2L 4NXML 3U58A 2R7DA 4B3ML 1XNQL 1YJ9A 4DR6Q 2QEXA 4UP7A 1X65A 4BY7G 1Q12A 4JBWA 3HOVH 3TRZA 4DV4Q 1HR0Q 2NZHA 3DM3A 3U50C 4LFCQ 1X55A 3FHWA 1HNWQ 4LF5L 4IPHA 3F8TA 4X6AH 1L2FA 4YY3Q 4OXPA 5IT9c 3D31A 3HKZG 1VQ6A 2VQEL 2I5LX 1WFQA 1JE5A 3MXNB 3I4OA 4LUZA 4A4IA 3L2PA 1Q8KA 4UP9A 1IBLQ 4LF4Q 4IO9A 1YEZA 4GKJL 2Y0SE 4A3JH 1LM0A 1SROA 3OTOL 4QIWE 2VY3A 3GTQH 2MO0A 3H0GG 3EBEA 1EFWA 4JYAQ 4QQBX 4B3TQ 4WJ4A 1E24A 1SR3A 2LXKA 3IRBA 3WWVA 5M3MH 2ZJRA 1NMGA 4DR7Q 1AH9A 5E7NA 4A3CH 1ASZA 5C44G 1KC8C 3CQZH 2YTXA 3L7ZC 1JB7A 1YHQA 2UXDQ 2LSSA 4GLAC 3HOUH 5M5WH 1Y1VH 4AH6A 4QJFA 1HJPA 1WCMH 4LUVA 1B70B 5IWAQ 1EQQA 1KIXA 4HIKA 3PUXA 3OYYA 1EWIA 1E1OA 4R4TA 3M85A 4LF6Q 1L1OB 3A74A 3K81C 3UDGA 4YCWA 4P75A 3S1MH 3FKIG 4TQUS 3ULLA 3HOYG 1K8AC 1NBWA 3RLFA 1XMQL 2ZTDA 4A3EH 5HY6A 4A3KG 1N33Q 4IOAA 4BXXG 1BVSA 4K0KL 1V9PA 2WP8J 1X3FA 4O0AA 3D0FA 1V43A 3I56A 2JA7H 4AYBE 3S1RH 3H3VH 2ID0A 5IYDG 2AHOB 2WAQG 2VNUD 1IYJB 4YCVA 3K80C 2KENA 4MTNA 3BZCA 4BBSH 4KI0A 3K0XA 1U5KA 3CCRA 3GTLH 2YV5A 3PUVA 4LW1A 5LMNQ 2B63H 1NY4A 5K36G 4J15A 1QUQA 5M3FH 1RL2A 4A3IH 2JA9A 3KDFA 4HJ9A 1KD1C 3KYHC 5M3MG 4DR2Q 2OWOA 4JI0L 1N32Q 3J80i 5IP9G 4A3CG 2OCEA 1PV4A 1L1OC 1LTLA 4B3RQ 1X54A 3RLNA 2I0QA 3CCLA 4IJLA 2F4VQ 3GTKH 2OQ0A 4DV1L 2R93H 2Q2HA 2WFWA 4Y52H 2GN5A 2E2HH 3BJUA 2NVQH 3T1HQ 4LF8Q 4JI5L 1X6OA 4BBRH 4OWTB 1G291 1OXVA 2Q2IA 3CCJA 4C2MH 1T9HA 1E7ZA 4POFA 1EIYB 3PO2H 2KCMA 3S2DH 3ER0A 4X64Q 1K9MC 4L5QA 1HZCA 1DGSA 5AJ3L 1XMOL 2N8NA 4B3RL 3AEVA 1JJGA 4BY1H 4IFDJ 3E0EA 4LWCA 4QY7A 1A62A 2K14A 3L0OA 5ELOA 3JAMc 3S1QH 2B63G 3KJOA 2E5LQ 2A8VA 1NMFA 2D62A 1QZHA 4JI6L 3PO3H 2UXBL 4DR5Q 1PVOA 1AE3A 3CPWA 4BY7H 4A3IG 4JV5L 1IBML 3NEMA 2ZJPA 4YWMA 2UUCL 4NXNL 1IBKQ 3BZKA 1SRUA 5C0XG 2UXCQ 2KHIA 2ES2A 1QVCA 3CC7A 2ALYB 1QUQB 3MEFA 1YBYA 4QGUA 1I94L 3ICEA 4DV0L 3KDFB 3RZDH 5JEAG 2ZTCA 3JAMi 4DV2Q 3GTOH 4NXMQ 5IE8A 4B3MQ 4DV3L 1Q1BA 3ZJYC 5FLXc 1QZGA 1XNQQ 1N9WA 1YVCA 3S1NH 3CCUA 4KHPQ 1FL0A 3H0GH 1EUJA 1SMXA 3G48A 3GTJH 3NBHB 4A3MG 4A3BG 3H15A 1TWCH 2MQHA 4A75A 4IOCA 3U4ZA 4LF5Q 4DV6L 4IFDI 2RF4A 1VQHA 4P73A 1JJCB 3KLWA 5C44H 1FJGL 3UDFA 2VQEQ 2YTVA 3GTMH 4FDBA 2VUMG 2UXCL 4WJ3M 4NPSA 4GKJQ 3F2DA 1PH3A 2K75A 3OTOQ 3STBC 1XJVA 3HOWH 2YYZA 2ZTEA 2IT1A 4AYBG 1PH7A 1HNXL 2JQOA 1BBWA 1ASYA 2K5VA 1HNWL 1UE7A 3PO3G 1I5FA 1PYSB 3FKIH 3NELA 4APVA 3HOYH 4KHPL 2R92G 4P74A 4JI1L 4A3KH 5GAGC 3CW2C 1D7QA 4BXXH 1VQOA 2R6GA 5M5YH 3S2HH 3ULJA 2F52A 2MFIA 1TWAH 1VQLA 4GLVB 4C3JH 1X9NA 5IYDH 1WOCA 1H95A 4XTCS 1PHJA 5EAYA 1O7IA 4HIMA 2B29A 3Q8DA 1R9TH 2UUAL 3PSIA 3I7FA 3B6YA 3I4NH 3G4SA 4JBMA 1XMQQ 1I6HH 1LYLA 4LFAL 4K0KQ 3PF5A 3A5ZB 5IP9H 2WB1G 4H02A 3I4MG 2EXDA 2UU9L 4DUZL 2VL6A 1GVPA 2N3SA 5GQOA 1P16A 3EN2A 2HIVA 1A0IA 3A0JA 1M1KC 1S3OA 1E3PA 2YTYA 5C4JH 1NTGA 2D0PA 1NE3A 1YHAA 1Z9FA 3CCEA 1S72A 3HOWG 2Z6KC 1HNZQ 2JJQA 4HIOA 4JI0Q 1JJ2A 3JC66 2L15A 1KAWA 1Q46A 4UY8C 4EX5A 1C7YA 3HOZG 2IHFA 4UPAA 4HJ7A 4OX9L 4JI7L 3PV0A 4OWWB 1XPUA 4HJAA 3STBD 3J80c 4JI4Q 4DV1Q 1QVFA 3PCOB 2RHQB 3HOXG 1J5EQ 2Q2UA 4LF7Q 3GO5A 2HIXA 2NVYH 4KLKA 1S40A 4GN4B 4JI5Q 2N78A 1Y1WG 4GNXB 3I4NG 3CMAA 1Q1EA 2NVTH 1HNZL 3CCQA 1OXSC 1XNRL 1K83H 2D0OA 3M7NA 4AQYL 5LMUQ 1XMOQ 1EQRA 1CKOA 1VQBA 2I5MX 1B7YB 4YWKA 5AJ3Q 1GM5A 3W1GA 4PZ7A 3KF8B 1OTCA 1I50H 1VQPA 4JI4L 1HZBA 4PZ6A 1YIJA 3CPFA 2AMCB 1J5EL 3GTGH 2WB1E 4LF7L 5GAEC 4JI6Q 2UXBQ 5FLMG 3CAMA 2OTJA 5BR8L 2CWPA 1KRTA 4A3BH 1IBMQ 2NN6I 4A3MH 4JV5Q 2UUCQ 1RIPA 4NXNQ 1Q7YC 2PQAA 3PF4A 4JBJA 1MKHA 4LF9Q 2FXQA 4GN5A 4YCUA 4JI3L 4DR3Q 5LMUL 4DV0Q 1I94Q 1YZ6A 3AQQA 2B3GA 1Y14B 5LMNW 2VUMH 5J3BA 1JT8A 1VQKA 4DV3Q 4A3DG 1PH1A 3AFPA 2R7FA 1W3SA 2JA5G 3H3VI 4GOPA 2E2IH 1SN8A 1TWFH 2CFMA 5FJ8G 2RCNA 3M9BA 4ALPA 1N8RC 4DNIA 2E2JH 3VDYA 3K7AH 4OO1G 2F3IA 4OONA 1KHIA 1E22A 4DV6Q 1QVGA 2CKZB 2R92H 5IP7G 4PG3A 1FJGQ 1YI2A 1VQ9A 5C4XH 1OXTA 4DV5L 1NJIC 1TXYA 4JI2L 4LF9L 4DR1L 1MJCA 4DR3L 4GKKQ 1L0WA 4B3SL 1IXRA 4TVAB 5C3EG 3J81c 1HNXQ 4LFBL 3TREA 3K7UC 5IYCG 1FGUA 2XGTA 4A3GG 4JCVE 1KRSA 4JI1Q 4L5RC 3TS0A 4L5SA 1UEBA 4DKAC 1VQDA 2CWAA 3UDXA 1G6PA 2PMZE 2VS1A 1YITA 3I4MH 1VQ8A 1EOVA 3AYHB 3J81i 2QGQA 2UUBL 2A19A 1JMCA 3E9IA 2UUAQ 4IPCA 1VQ4A 2RHSB 2AKWB 2PQAB 4LUOA 2VQFL 3T1YL 4GKKL 2JK8A 4DK3C 1I3QH 2R7ZG 4P72A 1P8LA 3PUZA 4LFAQ 1UE5A 4PMWA 1UE6A 1KXLA 1UE1A 4RMFA 4IFDG 1HZ9A 3S16H 4GOPB 3S24A 3HOZH 4A3FG 1XPRA 1A63A 5C4XG 2UU9Q 3J7ZC 4DUZQ 3CCSA 4GNXA 4KHZA 3CMEA 5JJIA 1BBUA 1M90C 4LNQA 3HOXH 2KCTA 3RZOH 1CSQA 2IY5B 3W1BA 1Q82C 1TWHH 4OWXB 3RR5A 2HHHL 4DR4L 2LXJA 1YJNA 1Y1WH 1C0AA 2KBNA 2PI2A 3KF6A 2IHEA 3TEHB 4DUYL 3OW2A 4A93G 4X62L 3CCVA 4JC0A 4P71A 4OX9Q 2IX1A 1PH9A 5IYBG 4JI7Q 4X66L 2HT1A 5JJKA 3A5UA 1VQJA 1HZAA 3G71A 1K0RA 2QA4A 2K5HA 2DUDA 2CQOA 1C9OA 1GO3E 1PH5A 4GOPC 4DPGA 4DV7Q 4POGA 1MIUA 2ZM6L 1N36L 1HH2P 2BH2A 4JG2A 3M4OH 1YHBA 1GKHA 1SFOH 3GTPH 3ULPA 1HR0W 2K5NA 5FLMH 3CP0A 1B8AA 1OXUA 1IZ6A 3RLOA 1XNRQ 1WJJA 4C3HH 3S14H 4DAMA 2PI2E 5JJLA 4AQYQ 2Q2TA 1SLJA 2K4KA 4YWLA 4YHHQ 3UE1A 1Q81C 1PFSA 3F2CA 3J81j 4A3LG 1CKMA 1VQEA 4MZ9A 4DV4L 1KQSA 1XPOA 4XIGS 1HR0L 1SE8A 1VQFA 2DGYA 3GDEA 4LFCL 2JEBI 2K52A 4JOIA 4C3IH 2JA5H 2BH8A 2GVAA 3CC2A 2JA8G 4YY3L 1FVIA 3F1ZA 3HFZB 4DV7L 4R1JA 5BR8Q 5FJ8H 1KL9A 2MNAA 3CXCA 3I2ZA 2AWOA 1CKNA 4LF4L 1IBLL 5IP7H 3ERSX 2EQSA 3PIPA 4JI3Q 3HOVG 1K8GA 1LUZA 3KF6B 4X65Q 4JYAL 1X56A 3M4PA 4YHHL 2VW9A 1PYBA 3NENA 3CCMA 2ZJQA 4B3TL 4HJ8A 3S17H 4DR7L 3J7A5 1VQCA 1IL2A 2JEAI 5C3EH 1VQNA 2YU9H 2V1CC 2UXDL 2NZOA 2ATWA 3M3YH 4UP8A 2GVBA 4PZ8A 4R4OA 4RG1A 5ELNA 5IYCH 1J6QA 4GN3B 3UE0A 1W2BA 4A3GH 2OQKA 3DLLA 4Y7NH 1PH4A 4A3JG 5IWAL 5C0XJ 1OXXK 1VS0A 4IJHA 3TQYA 2ASBA 1YJWA 3RN2A 3HKZE 4DV5Q 1Q86C 4LF6L 4R4IA 5HGQA 4GNXC 4JI2Q 5JEAJ 4DR1Q 4AIMA 4JBKA 4R4CA 4B3SQ 1WI5A 3FP9A 1N33L 1AE2A 1PH2A 2C35B 4JI8Q 1UWVA 4X65L 2NVXH 3CD6A 4LFBQ 1X3EA 3K8AA 3PIOA 3KJPA 3HOUG 1Y1VG 3LGJA 5M5XH 3CF5A 5IY0A 1U0LA 1WCMG 1VQAA 2NN6G 4HJ5A 2R7ZH 2Z0SA 4QL5A 2N49A 1BKBA 5GROA 3GD7A 1VQGA 5DLQE 2JA6H 2BA0A 4GS3A 5LMNL 1K73C 4A3FH 2OTLA 3TS2A 4OO1I 3E9HA 1A8VA 1YNXA 1Z47A 4A3EG 2UUBQ 4A3DH 1N34Q 1CKNB 1PH8A 1TWGH 2JA7G 3KFUA 4DR2L 1N32L 1EIFA 2VQFQ 3T1YQ 3RNUA 2I5HA 3PUWA 5C0XI 4A76A 3HKSA 1V1QA 1GD7A 4JI8L 2VZAA 1E1TA 4NB3A 1XTDA 2IX0A 1VQMA 3KOJA 5H1SE 2JE6I 2K50A 4BBSG 2F4VL 4A93H 1X3GA 3W5OA 3RN5A 3I55A 3BU2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC4 A;  1WYD A;  2WAQ E;  2Z6K A;  5IYB H;  4BA2 I;  3T1H L;  5M3F G;  4LF8 L;  3PUY A;  1VQ5 A;  3S15 H;  1CSP A;  3AFQ A;  2AWN A;  2EIF A;  4IPG A;  1VQ7 A;  2Y0S G;  4HID A;  4JOI C;  3SGI A;  1N34 L;  5GAH C;  3PGZ A;  4BA1 I;  4DK6 C;  4X64 L;  2HHH Q;  4DR4 Q;  4EQ5 A;  5GAD C;  1VQI A;  4DUY Q;  2R93 G;  3UDI A;  4O2D A;  4X62 Q;  4MNO A;  2BA1 A;  4ME3 A;  2JA6 G;  4GLX A;  2HQL A;  4X66 Q;  2E8G A;  3EIV A;  3M4Q A;  4IPD A;  2KHJ A;  3U4V A;  4BBR G;  2E5L L;  4DR6 L;  4DR5 L;  1PH6 A;  2H5X A;  1VCI A;  1MJE A;  2CCZ A;  4A3L H;  1G51 A;  3PO2 G;  1PA6 A;  2A1A A;  2ZM6 Q;  1N36 Q;  4R4Q A;  1IBK L;  3F2B A;  1L1O A;  2PNH A;  2JA8 H;  1CUK A;  4BY1 G;  4DAY B;  2MO1 A;  2XTI A;  1D8L A;  1K3R A;  1EYG A;  3G6E A;  4L5T A;  4DV2 L;  4NXM L;  3U58 A;  2R7D A;  4B3M L;  1XNQ L;  1YJ9 A;  4DR6 Q;  2QEX A;  4UP7 A;  1X65 A;  4BY7 G;  1Q12 A;  4JBW A;  3HOV H;  3TRZ A;  4DV4 Q;  1HR0 Q;  2NZH A;  3DM3 A;  3U50 C;  4LFC Q;  1X55 A;  3FHW A;  1HNW Q;  4LF5 L;  4IPH A;  3F8T A;  4X6A H;  1L2F A;  4YY3 Q;  4OXP A;  5IT9 c;  3D31 A;  3HKZ G;  1VQ6 A;  2VQE L;  2I5L X;  1WFQ A;  1JE5 A;  3MXN B;  3I4O A;  4LUZ A;  4A4I A;  3L2P A;  1Q8K A;  4UP9 A;  1IBL Q;  4LF4 Q;  4IO9 A;  1YEZ A;  4GKJ L;  2Y0S E;  4A3J H;  1LM0 A;  1SRO A;  3OTO L;  4QIW E;  2VY3 A;  3GTQ H;  2MO0 A;  3H0G G;  3EBE A;  1EFW A;  4JYA Q;  4QQB X;  4B3T Q;  4WJ4 A;  1E24 A;  1SR3 A;  2LXK A;  3IRB A;  3WWV A;  5M3M H;  2ZJR A;  1NMG A;  4DR7 Q;  1AH9 A;  5E7N A;  4A3C H;  1ASZ A;  5C44 G;  1KC8 C;  3CQZ H;  2YTX A;  3L7Z C;  1JB7 A;  1YHQ A;  2UXD Q;  2LSS A;  4GLA C;  3HOU H;  5M5W H;  1Y1V H;  4AH6 A;  4QJF A;  1HJP A;  1WCM H;  4LUV A;  1B70 B;  5IWA Q;  1EQQ A;  1KIX A;  4HIK A;  3PUX A;  3OYY A;  1EWI A;  1E1O A;  4R4T A;  3M85 A;  4LF6 Q;  1L1O B;  3A74 A;  3K81 C;  3UDG A;  4YCW A;  4P75 A;  3S1M H;  3FKI G;  4TQU S;  3ULL A;  3HOY G;  1K8A C;  1NBW A;  3RLF A;  1XMQ L;  2ZTD A;  4A3E H;  5HY6 A;  4A3K G;  1N33 Q;  4IOA A;  4BXX G;  1BVS A;  4K0K L;  1V9P A;  2WP8 J;  1X3F A;  4O0A A;  3D0F A;  1V43 A;  3I56 A;  2JA7 H;  4AYB E;  3S1R H;  3H3V H;  2ID0 A;  5IYD G;  2AHO B;  2WAQ G;  2VNU D;  1IYJ B;  4YCV A;  3K80 C;  2KEN A;  4MTN A;  3BZC A;  4BBS H;  4KI0 A;  3K0X A;  1U5K A;  3CCR A;  3GTL H;  2YV5 A;  3PUV A;  4LW1 A;  5LMN Q;  2B63 H;  1NY4 A;  5K36 G;  4J15 A;  1QUQ A;  5M3F H;  1RL2 A;  4A3I H;  2JA9 A;  3KDF A;  4HJ9 A;  1KD1 C;  3KYH C;  5M3M G;  4DR2 Q;  2OWO A;  4JI0 L;  1N32 Q;  3J80 i;  5IP9 G;  4A3C G;  2OCE A;  1PV4 A;  1L1O C;  1LTL A;  4B3R Q;  1X54 A;  3RLN A;  2I0Q A;  3CCL A;  4IJL A;  2F4V Q;  3GTK H;  2OQ0 A;  4DV1 L;  2R93 H;  2Q2H A;  2WFW A;  4Y52 H;  2GN5 A;  2E2H H;  3BJU A;  2NVQ H;  3T1H Q;  4LF8 Q;  4JI5 L;  1X6O A;  4BBR H;  4OWT B;  1G29 1;  1OXV A;  2Q2I A;  3CCJ A;  4C2M H;  1T9H A;  1E7Z A;  4POF A;  1EIY B;  3PO2 H;  2KCM A;  3S2D H;  3ER0 A;  4X64 Q;  1K9M C;  4L5Q A;  1HZC A;  1DGS A;  5AJ3 L;  1XMO L;  2N8N A;  4B3R L;  3AEV A;  1JJG A;  4BY1 H;  4IFD J;  3E0E A;  4LWC A;  4QY7 A;  1A62 A;  2K14 A;  3L0O A;  5ELO A;  3JAM c;  3S1Q H;  2B63 G;  3KJO A;  2E5L Q;  2A8V A;  1NMF A;  2D62 A;  1QZH A;  4JI6 L;  3PO3 H;  2UXB L;  4DR5 Q;  1PVO A;  1AE3 A;  3CPW A;  4BY7 H;  4A3I G;  4JV5 L;  1IBM L;  3NEM A;  2ZJP A;  4YWM A;  2UUC L;  4NXN L;  1IBK Q;  3BZK A;  1SRU A;  5C0X G;  2UXC Q;  2KHI A;  2ES2 A;  1QVC A;  3CC7 A;  2ALY B;  1QUQ B;  3MEF A;  1YBY A;  4QGU A;  1I94 L;  3ICE A;  4DV0 L;  3KDF B;  3RZD H;  5JEA G;  2ZTC A;  3JAM i;  4DV2 Q;  3GTO H;  4NXM Q;  5IE8 A;  4B3M Q;  4DV3 L;  1Q1B A;  3ZJY C;  5FLX c;  1QZG A;  1XNQ Q;  1N9W A;  1YVC A;  3S1N H;  3CCU A;  4KHP Q;  1FL0 A;  3H0G H;  1EUJ A;  1SMX A;  3G48 A;  3GTJ H;  3NBH B;  4A3M G;  4A3B G;  3H15 A;  1TWC H;  2MQH A;  4A75 A;  4IOC A;  3U4Z A;  4LF5 Q;  4DV6 L;  4IFD I;  2RF4 A;  1VQH A;  4P73 A;  1JJC B;  3KLW A;  5C44 H;  1FJG L;  3UDF A;  2VQE Q;  2YTV A;  3GTM H;  4FDB A;  2VUM G;  2UXC L;  4WJ3 M;  4NPS A;  4GKJ Q;  3F2D A;  1PH3 A;  2K75 A;  3OTO Q;  3STB C;  1XJV A;  3HOW H;  2YYZ A;  2ZTE A;  2IT1 A;  4AYB G;  1PH7 A;  1HNX L;  2JQO A;  1BBW A;  1ASY A;  2K5V A;  1HNW L;  1UE7 A;  3PO3 G;  1I5F A;  1PYS B;  3FKI H;  3NEL A;  4APV A;  3HOY H;  4KHP L;  2R92 G;  4P74 A;  4JI1 L;  4A3K H;  5GAG C;  3CW2 C;  1D7Q A;  4BXX H;  1VQO A;  2R6G A;  5M5Y H;  3S2H H;  3ULJ A;  2F52 A;  2MFI A;  1TWA H;  1VQL A;  4GLV B;  4C3J H;  1X9N A;  5IYD H;  1WOC A;  1H95 A;  4XTC S;  1PHJ A;  5EAY A;  1O7I A;  4HIM A;  2B29 A;  3Q8D A;  1R9T H;  2UUA L;  3PSI A;  3I7F A;  3B6Y A;  3I4N H;  3G4S A;  4JBM A;  1XMQ Q;  1I6H H;  1LYL A;  4LFA L;  4K0K Q;  3PF5 A;  3A5Z B;  5IP9 H;  2WB1 G;  4H02 A;  3I4M G;  2EXD A;  2UU9 L;  4DUZ L;  2VL6 A;  1GVP A;  2N3S A;  5GQO A;  1P16 A;  3EN2 A;  2HIV A;  1A0I A;  3A0J A;  1M1K C;  1S3O A;  1E3P A;  2YTY A;  5C4J H;  1NTG A;  2D0P A;  1NE3 A;  1YHA A;  1Z9F A;  3CCE A;  1S72 A;  3HOW G;  2Z6K C;  1HNZ Q;  2JJQ A;  4HIO A;  4JI0 Q;  1JJ2 A;  3JC6 6;  2L15 A;  1KAW A;  1Q46 A;  4UY8 C;  4EX5 A;  1C7Y A;  3HOZ G;  2IHF A;  4UPA A;  4HJ7 A;  4OX9 L;  4JI7 L;  3PV0 A;  4OWW B;  1XPU A;  4HJA A;  3STB D;  3J80 c;  4JI4 Q;  4DV1 Q;  1QVF A;  3PCO B;  2RHQ B;  3HOX G;  1J5E Q;  2Q2U A;  4LF7 Q;  3GO5 A;  2HIX A;  2NVY H;  4KLK A;  1S40 A;  4GN4 B;  4JI5 Q;  2N78 A;  1Y1W G;  4GNX B;  3I4N G;  3CMA A;  1Q1E A;  2NVT H;  1HNZ L;  3CCQ A;  1OXS C;  1XNR L;  1K83 H;  2D0O A;  3M7N A;  4AQY L;  5LMU Q;  1XMO Q;  1EQR A;  1CKO A;  1VQB A;  2I5M X;  1B7Y B;  4YWK A;  5AJ3 Q;  1GM5 A;  3W1G A;  4PZ7 A;  3KF8 B;  1OTC A;  1I50 H;  1VQP A;  4JI4 L;  1HZB A;  4PZ6 A;  1YIJ A;  3CPF A;  2AMC B;  1J5E L;  3GTG H;  2WB1 E;  4LF7 L;  5GAE C;  4JI6 Q;  2UXB Q;  5FLM G;  3CAM A;  2OTJ A;  5BR8 L;  2CWP A;  1KRT A;  4A3B H;  1IBM Q;  2NN6 I;  4A3M H;  4JV5 Q;  2UUC Q;  1RIP A;  4NXN Q;  1Q7Y C;  2PQA A;  3PF4 A;  4JBJ A;  1MKH A;  4LF9 Q;  2FXQ A;  4GN5 A;  4YCU A;  4JI3 L;  4DR3 Q;  5LMU L;  4DV0 Q;  1I94 Q;  1YZ6 A;  3AQQ A;  2B3G A;  1Y14 B;  5LMN W;  2VUM H;  5J3B A;  1JT8 A;  1VQK A;  4DV3 Q;  4A3D G;  1PH1 A;  3AFP A;  2R7F A;  1W3S A;  2JA5 G;  3H3V I;  4GOP A;  2E2I H;  1SN8 A;  1TWF H;  2CFM A;  5FJ8 G;  2RCN A;  3M9B A;  4ALP A;  1N8R C;  4DNI A;  2E2J H;  3VDY A;  3K7A H;  4OO1 G;  2F3I A;  4OON A;  1KHI A;  1E22 A;  4DV6 Q;  1QVG A;  2CKZ B;  2R92 H;  5IP7 G;  4PG3 A;  1FJG Q;  1YI2 A;  1VQ9 A;  5C4X H;  1OXT A;  4DV5 L;  1NJI C;  1TXY A;  4JI2 L;  4LF9 L;  4DR1 L;  1MJC A;  4DR3 L;  4GKK Q;  1L0W A;  4B3S L;  1IXR A;  4TVA B;  5C3E G;  3J81 c;  1HNX Q;  4LFB L;  3TRE A;  3K7U C;  5IYC G;  1FGU A;  2XGT A;  4A3G G;  4JCV E;  1KRS A;  4JI1 Q;  4L5R C;  3TS0 A;  4L5S A;  1UEB A;  4DKA C;  1VQD A;  2CWA A;  3UDX A;  1G6P A;  2PMZ E;  2VS1 A;  1YIT A;  3I4M H;  1VQ8 A;  1EOV A;  3AYH B;  3J81 i;  2QGQ A;  2UUB L;  2A19 A;  1JMC A;  3E9I A;  2UUA Q;  4IPC A;  1VQ4 A;  2RHS B;  2AKW B;  2PQA B;  4LUO A;  2VQF L;  3T1Y L;  4GKK L;  2JK8 A;  4DK3 C;  1I3Q H;  2R7Z G;  4P72 A;  1P8L A;  3PUZ A;  4LFA Q;  1UE5 A;  4PMW A;  1UE6 A;  1KXL A;  1UE1 A;  4RMF A;  4IFD G;  1HZ9 A;  3S16 H;  4GOP B;  3S24 A;  3HOZ H;  4A3F G;  1XPR A;  1A63 A;  5C4X G;  2UU9 Q;  3J7Z C;  4DUZ Q;  3CCS A;  4GNX A;  4KHZ A;  3CME A;  5JJI A;  1BBU A;  1M90 C;  4LNQ A;  3HOX H;  2KCT A;  3RZO H;  1CSQ A;  2IY5 B;  3W1B A;  1Q82 C;  1TWH H;  4OWX B;  3RR5 A;  2HHH L;  4DR4 L;  2LXJ A;  1YJN A;  1Y1W H;  1C0A A;  2KBN A;  2PI2 A;  3KF6 A;  2IHE A;  3TEH B;  4DUY L;  3OW2 A;  4A93 G;  4X62 L;  3CCV A;  4JC0 A;  4P71 A;  4OX9 Q;  2IX1 A;  1PH9 A;  5IYB G;  4JI7 Q;  4X66 L;  2HT1 A;  5JJK A;  3A5U A;  1VQJ A;  1HZA A;  3G71 A;  1K0R A;  2QA4 A;  2K5H A;  2DUD A;  2CQO A;  1C9O A;  1GO3 E;  1PH5 A;  4GOP C;  4DPG A;  4DV7 Q;  4POG A;  1MIU A;  2ZM6 L;  1N36 L;  1HH2 P;  2BH2 A;  4JG2 A;  3M4O H;  1YHB A;  1GKH A;  1SFO H;  3GTP H;  3ULP A;  1HR0 W;  2K5N A;  5FLM H;  3CP0 A;  1B8A A;  1OXU A;  1IZ6 A;  3RLO A;  1XNR Q;  1WJJ A;  4C3H H;  3S14 H;  4DAM A;  2PI2 E;  5JJL A;  4AQY Q;  2Q2T A;  1SLJ A;  2K4K A;  4YWL A;  4YHH Q;  3UE1 A;  1Q81 C;  1PFS A;  3F2C A;  3J81 j;  4A3L G;  1CKM A;  1VQE A;  4MZ9 A;  4DV4 L;  1KQS A;  1XPO A;  4XIG S;  1HR0 L;  1SE8 A;  1VQF A;  2DGY A;  3GDE A;  4LFC L;  2JEB I;  2K52 A;  4JOI A;  4C3I H;  2JA5 H;  2BH8 A;  2GVA A;  3CC2 A;  2JA8 G;  4YY3 L;  1FVI A;  3F1Z A;  3HFZ B;  4DV7 L;  4R1J A;  5BR8 Q;  5FJ8 H;  1KL9 A;  2MNA A;  3CXC A;  3I2Z A;  2AWO A;  1CKN A;  4LF4 L;  1IBL L;  5IP7 H;  3ERS X;  2EQS A;  3PIP A;  4JI3 Q;  3HOV G;  1K8G A;  1LUZ A;  3KF6 B;  4X65 Q;  4JYA L;  1X56 A;  3M4P A;  4YHH L;  2VW9 A;  1PYB A;  3NEN A;  3CCM A;  2ZJQ A;  4B3T L;  4HJ8 A;  3S17 H;  4DR7 L;  3J7A 5;  1VQC A;  1IL2 A;  2JEA I;  5C3E H;  1VQN A;  2YU9 H;  2V1C C;  2UXD L;  2NZO A;  2ATW A;  3M3Y H;  4UP8 A;  2GVB A;  4PZ8 A;  4R4O A;  4RG1 A;  5ELN A;  5IYC H;  1J6Q A;  4GN3 B;  3UE0 A;  1W2B A;  4A3G H;  2OQK A;  3DLL A;  4Y7N H;  1PH4 A;  4A3J G;  5IWA L;  5C0X J;  1OXX K;  1VS0 A;  4IJH A;  3TQY A;  2ASB A;  1YJW A;  3RN2 A;  3HKZ E;  4DV5 Q;  1Q86 C;  4LF6 L;  4R4I A;  5HGQ A;  4GNX C;  4JI2 Q;  5JEA J;  4DR1 Q;  4AIM A;  4JBK A;  4R4C A;  4B3S Q;  1WI5 A;  3FP9 A;  1N33 L;  1AE2 A;  1PH2 A;  2C35 B;  4JI8 Q;  1UWV A;  4X65 L;  2NVX H;  3CD6 A;  4LFB Q;  1X3E A;  3K8A A;  3PIO A;  3KJP A;  3HOU G;  1Y1V G;  3LGJ A;  5M5X H;  3CF5 A;  5IY0 A;  1U0L A;  1WCM G;  1VQA A;  2NN6 G;  4HJ5 A;  2R7Z H;  2Z0S A;  4QL5 A;  2N49 A;  1BKB A;  5GRO A;  3GD7 A;  1VQG A;  5DLQ E;  2JA6 H;  2BA0 A;  4GS3 A;  5LMN L;  1K73 C;  4A3F H;  2OTL A;  3TS2 A;  4OO1 I;  3E9H A;  1A8V A;  1YNX A;  1Z47 A;  4A3E G;  2UUB Q;  4A3D H;  1N34 Q;  1CKN B;  1PH8 A;  1TWG H;  2JA7 G;  3KFU A;  4DR2 L;  1N32 L;  1EIF A;  2VQF Q;  3T1Y Q;  3RNU A;  2I5H A;  3PUW A;  5C0X I;  4A76 A;  3HKS A;  1V1Q A;  1GD7 A;  4JI8 L;  2VZA A;  1E1T A;  4NB3 A;  1XTD A;  2IX0 A;  1VQM A;  3KOJ A;  5H1S E;  2JE6 I;  2K50 A;  4BBS G;  2F4V L;  4A93 H;  1X3G A;  3W5O A;  3RN5 A;  3I55 A;  3BU2 A; 
#chains in the Genus database with same CATH topology
 1WYD A;  2WAQ E;  3K5L A;  4NKL A;  5M3F G;  4LF8 L;  2AQ1 B;  1WD0 A;  1X3Q A;  3MXN A;  1CSP A;  2EIF A;  2KJX A;  3GTM B;  1CK1 A;  4JOI C;  5GAH C;  1GUN A;  4BA1 I;  2Z9H A;  2K5D A;  1SNP A;  5GAD C;  1VQI A;  3ND9 A;  3NP8 A;  4L8J A;  1ZXT A;  1BQQ T;  2I07 B;  4ME3 A;  4GLX A;  5KEE A;  2HQL A;  3NPP A;  3U4V A;  4BBR G;  3SVM A;  2PO4 A;  4ZKB B;  4O1N A;  4KY7 A;  1PH6 A;  1ONL A;  1VCI A;  2QEJ C;  4V19 0;  2KVM A;  3MC0 B;  1EY5 A;  3FMC A;  1L1O A;  2JA8 H;  2MO1 A;  3QOL A;  1D8L A;  1K3R A;  1E0B A;  1XWE A;  2F0P A;  4CKE A;  4DAP A;  5EKL A;  4UP7 A;  5M3M B;  1Q12 A;  1L0Y B;  5DM6 3;  2FFK B;  1HR0 Q;  3DM3 A;  1X55 A;  1HNW Q;  4IPH A;  1L2F A;  4OXP A;  3D31 A;  1WCM B;  4MHE A;  1DD2 A;  1EFI D;  1E2W A;  4FVM A;  4A4I A;  3DWQ A;  4LF4 Q;  4IO9 A;  4GKJ L;  1WTP A;  4LMQ D;  2VY3 A;  3MXG A;  2A6H C;  1SR3 A;  3DMU A;  3S1R B;  1WTH A;  3J80 L;  4A3C H;  3A54 A;  2UXD Q;  4KJN A;  4QJF A;  2N88 A;  2O4X A;  4ABN A;  4FP5 D;  1AFP A;  3NK9 A;  1B2T A;  5I9P A;  1JOQ A;  3A74 A;  2B2Y A;  4CJ1 B;  3RLF A;  2ZTD A;  4A3K G;  5HY6 A;  4QIW B;  4BXX G;  3EQL C;  3I56 A;  2JA7 H;  1I50 B;  3GTK B;  1F2Z A;  2ID0 A;  5FLX E;  4DXG A;  3A55 A;  3LX0 A;  4YCV A;  3T56 B;  5C4H A;  3GTG B;  3BZC A;  3KK7 A;  2O5J C;  3K0X A;  1EQV A;  2KA7 A;  1BCP B;  5CV4 A;  2B63 H;  3I90 A;  1JB3 A;  1QUQ A;  2IPK D;  1LTA D;  1RL2 A;  2JA9 A;  3KYH C;  1N32 Q;  1A6X A;  4DN4 M;  3WOF A;  1DYQ A;  3RLN A;  3CCL A;  4XXE A;  1NR2 A;  2R93 H;  2Q2H A;  1J8I A;  2WFW A;  5I4D A;  2NVQ H;  1G29 1;  1KTK A;  3SR1 A;  2Z4I A;  1E7Z A;  2F0U A;  1EIY B;  3D4D A;  3ER0 A;  1K9M C;  1SXT A;  2N8N A;  3P1H A;  1DJR D;  3IKJ A;  1NCV A;  2K14 A;  3L0O A;  5ELO A;  2K01 A;  4RKB A;  3JAM c;  1HPC A;  3X3M A;  3V2T A;  2UXB L;  1W6J A;  1PVO A;  1AE3 A;  4PNY A;  3BZD B;  4BY7 H;  1IBK Q;  1SRU A;  1VDZ A;  1TT2 A;  2UXC Q;  1BR9 A;  3WOE A;  1QVC A;  2EY5 A;  4FNF A;  3MEF A;  5CBA E;  3RZD H;  5IE8 A;  1EY0 A;  4L63 B;  1U4M A;  1N9W A;  4KHP Q;  5ELF A;  3H0G H;  4BS9 A;  4A3B G;  1F2M A;  1NR4 A;  1RD9 D;  1G2T A;  4LF5 Q;  4DV6 L;  3Q23 A;  4IFD I;  1STH A;  4C3J B;  2QW7 A;  1ENF A;  3AU7 A;  1CQV A;  5E1F A;  4WJ3 M;  1PH3 A;  1Y1W B;  1TS4 A;  3STB C;  1AW7 A;  1C4Q A;  2ZTE A;  4J8Q A;  4AYB G;  1BBW A;  1O7Y A;  1BCP D;  3NBI A;  1UE7 A;  5C6A A;  5KGU A;  3HOY H;  2R92 G;  4P74 A;  1I4Q A;  3CW2 C;  1VQO A;  2R6G A;  3TN2 A;  5M5Y H;  3S2H H;  3DM1 A;  3ULJ A;  1GHK A;  1I4G A;  1WOC A;  1WTW A;  1H95 A;  5EAY A;  1LTT D;  1O7I A;  1JC7 A;  1UNS A;  1SFO B;  2B29 A;  5G3L F;  1MHW C;  1EY6 A;  3I4N H;  3URY A;  2B2U A;  2RCF A;  2EY2 A;  1HXY D;  5IP9 H;  1L0X B;  4KN7 C;  1LLR D;  4DNT B;  4B08 A;  1VMP A;  1PTO C;  3HP3 A;  1S3O A;  1STA A;  3HS0 C;  4QB4 A;  1B9M A;  1NE3 A;  2D0P A;  3PQI A;  3HOW G;  2NTT A;  1IHZ A;  1JJ2 A;  3JC6 6;  2BDO A;  1Q46 A;  2B2T C;  4EX5 A;  1C7Y A;  4JI7 L;  3PV0 A;  4Z9C B;  1G2S A;  4LF7 Q;  3GO5 A;  1H9M A;  3MTS A;  1K0S A;  1D5X C;  2K28 A;  4KLK A;  2N78 A;  4J6H A;  1MSH A;  2NVT H;  3C1E A;  1UUP A;  3CCQ A;  1OXS C;  1K83 H;  4AQY L;  5DM7 3;  4YWK A;  5C0X H;  2VUM B;  1SNC A;  3W1G A;  4PZ7 A;  4KY6 A;  2Q8R E;  1E2Z A;  2BDN A;  4JI4 L;  4F7X A;  5JEA H;  1HZB A;  3U9S A;  2R7Z B;  1BUV T;  3NTH A;  3K7A B;  1J5E L;  5GAE C;  2CWP A;  4JV5 Q;  4A3M H;  1RIP A;  4LAA A;  1Q7Y C;  4NW2 A;  4QMG A;  1EU3 A;  2WKD A;  4CBV A;  4JBJ A;  1MKH A;  1KDB A;  2FXQ A;  4GN5 A;  5LMU L;  2B3G A;  1YNN C;  4C1N K;  4DV3 Q;  2IW3 A;  2WAC A;  4A3D G;  5BN4 A;  2E2I H;  4ZK9 B;  1PDQ A;  1TWF H;  1N8R C;  2RCN A;  4TKO B;  2ZXO A;  1B53 A;  3VDY A;  4IQZ A;  1KHI A;  2F0M A;  1QVG A;  2Z4H A;  1VQ9 A;  4ZRZ A;  3QR8 A;  4DV5 L;  1WD1 A;  3HG9 A;  4DR3 L;  1MJC A;  1I3Q B;  3HGB A;  5C3E G;  2KEE A;  3K7U C;  2FIN B;  3HOZ B;  4L5S A;  3J80 E;  2WII B;  5CV8 A;  2CWA A;  1CI3 M;  2XN9 C;  1G6P A;  1H9S B;  2L4N A;  2PMZ E;  2VS1 A;  1YIT A;  1VQ8 A;  3RZO B;  1JMC A;  4RGN A;  2PQA B;  3TZD A;  2EJF C;  3T1Y L;  1CA6 A;  1NUC A;  4K2K A;  4DK3 C;  2XWB B;  4DAV A;  4LFA Q;  1UE5 A;  1UE6 A;  1V1O A;  1NSN S;  5CV7 A;  4IFD G;  1HZ9 A;  3S16 H;  3S24 A;  1IW7 C;  1A63 A;  1XPR A;  5C4X G;  1EYC A;  3J7Z C;  4KHZ A;  1U4L A;  4CHT B;  2KCT A;  1JOR A;  3C3L A;  5E3F A;  1TWH H;  4OWX B;  4R8I A;  4DR4 L;  1YJN A;  4HCE A;  4DUY L;  4X62 L;  3CCV A;  4P71 A;  4OX9 Q;  2IX1 A;  4IUP A;  1MBY A;  4X66 L;  2DJF C;  3A5U A;  5EGT A;  3G71 A;  1H9J A;  2K5H A;  4C3I B;  1GO3 E;  1EZ8 A;  4GOP C;  4OIJ A;  4POG A;  1MIU A;  1N36 L;  4JG2 A;  4OL7 A;  1HR0 W;  1SSO A;  1HQM C;  3NWT A;  1V8Q A;  4C3H H;  2PI2 E;  3T51 B;  2NB0 A;  1LO5 D;  4ILW A;  2K4K A;  1DOM A;  3J81 j;  1VQE A;  3C46 A;  4XIG S;  2G9D A;  2FMC A;  3KLS X;  4LFC L;  2JEB I;  2K52 A;  2JA5 H;  2JA8 G;  1ET9 A;  4BBS B;  4I65 A;  3CC2 A;  4YY3 L;  1FVI A;  1GOZ A;  5FJ8 H;  1KL9 A;  3CXC A;  2AWO A;  4KKU A;  5M3F B;  1E2V A;  4WJW A;  5IP7 H;  4OEL B;  2R61 A;  1X56 A;  2VW9 A;  1STN A;  1PRT D;  3S17 H;  3EA6 A;  4Q0F A;  2JN4 A;  1STG A;  1VQN A;  2YU9 H;  4L6T B;  2E2H B;  4RG1 A;  4R4O A;  1VMC A;  3IL8 A;  5IYC H;  1EWC A;  4A3G H;  1SAP A;  2DNE A;  2Z8L A;  1TVX A;  4A3F B;  3EJI A;  4BBR B;  5IWA L;  1UEA B;  1VS0 A;  3FEW X;  3TQY A;  1YJW A;  3HKZ E;  2L11 A;  4RFB A;  5HGQ A;  1D1K A;  4FF4 A;  4GNX C;  3FP9 A;  1N33 L;  2C35 B;  1MD2 D;  2A6E D;  1X3E A;  1WTQ A;  1F77 A;  5ELB A;  1XYI A;  1R4Q B;  1HTP A;  3W3A A;  2HCC A;  5LL6 X;  5IY0 A;  3H09 A;  1VQA A;  1SE2 A;  4QL5 A;  1EL0 A;  1QWY A;  5LMN L;  2RDH A;  3TP6 A;  4OO1 I;  1YNX A;  1VF7 A;  2BE5 C;  2EYL A;  5L37 A;  5FKA C;  1CKN B;  5CGK A;  3D8G A;  2JA7 G;  1EIF A;  2VQF Q;  5T1G A;  3PUW A;  5KIX A;  5C0X I;  4IUR A;  1WTX A;  2O5I C;  4JI8 L;  5C4Z A;  5H1S E;  1SMY C;  3MWY W;  5D3D A;  2F4V L;  4A93 H;  1RCV D;  4Q5V A;  3RN5 A;  3BU2 A;  4KD4 A;  1TKW B;  1F9S A;  3QWN A;  2MP1 A;  4RCN A;  3S15 H;  1EY4 A;  1IYU A;  3AFQ A;  4FYD A;  2AWN A;  4IPG A;  1VQ7 A;  4I7Z C;  2Y0S G;  1ESR A;  3PGZ A;  3TP8 A;  2PW5 A;  4DK6 C;  3DUZ A;  2R93 G;  3UDI A;  3K5N A;  1JQY D;  2BA1 A;  3D6W A;  1PFB A;  2JA6 G;  1PXU A;  2F0I A;  4A3K B;  2E8G A;  3EIV A;  1RKN A;  1F2Y A;  4DU9 A;  1H9K A;  1HQR D;  4DR5 L;  1MJE A;  4A3L H;  1TWA B;  1MGS A;  2QDL A;  1PA6 A;  2ZM6 Q;  1PZJ D;  5JPM C;  4FXK C;  1TS2 A;  3F2B A;  2PNH A;  1R9T B;  1D1I A;  4NP5 A;  1CUK A;  4DAY B;  3K0Y A;  4DA2 A;  5J22 A;  4A3J B;  1B9N A;  3M4Y A;  3G6E A;  4DV2 L;  3U58 A;  2R7D A;  3SK5 A;  4B3M L;  1TS3 A;  5NUC A;  4HED A;  2X69 A;  4BY7 G;  1U4R A;  4DV4 Q;  2NZH A;  1PTO B;  3U50 C;  1GJX A;  3OHX C;  5M5W B;  5ELD A;  2G5D A;  3E0J A;  1I4H A;  5C4J B;  2K6A A;  4KV6 A;  2VQE L;  2I5L X;  1WFQ A;  3KLR A;  3L2P A;  1Q8K A;  1IBL Q;  1A3U A;  1YEZ A;  3DEO A;  2Y0S E;  3HZX A;  3S1M B;  2PQE A;  3OTO L;  3H0G G;  1ESF A;  4A3E B;  4F87 A;  3EBE A;  4JYA Q;  4QQB X;  4WJ4 A;  1NNX A;  2JXM B;  1SE4 A;  3IRB A;  1BOS A;  3MZ5 A;  3WWV A;  5M3M H;  3DWP A;  1ASZ A;  2XWJ B;  1KC8 C;  3M7G A;  3HOU H;  4U67 3;  4AH6 A;  3GTL B;  1WCM H;  2NN6 H;  1LV9 A;  1EQQ A;  4HIK A;  3PUX A;  5IGG A;  4R4T A;  4LF6 Q;  3M85 A;  4ZLT F;  5IIF A;  4P75 A;  3HOY G;  5FO8 B;  1NBW A;  4B9X A;  4IOA A;  4K0K L;  4GZY C;  4O0A A;  3D0F A;  3S1R H;  2AHO B;  2WAQ G;  1IYJ B;  2KEN A;  5IGB A;  4BWG B;  5JJZ A;  3CCR A;  1GUW A;  4A3B B;  3PUV A;  4HMI A;  4HSV A;  2HD3 A;  1PTO F;  4JI0 L;  4HJ9 A;  3SHL A;  5IP9 G;  1PV4 A;  1L1O C;  1LTL A;  4FF1 A;  3GTK H;  2OQ0 A;  3OSO A;  4AYB B;  3T1H Q;  2R92 B;  4IUV A;  4JI5 L;  2KCM A;  2MJ8 A;  1LTB D;  4X64 Q;  5DNF A;  5AJ3 L;  4B3R L;  3E0E A;  1A62 A;  3GTJ B;  3S1Q H;  4ULL A;  1TWC B;  3KJO A;  2E5L Q;  2D62 A;  2F0D A;  3SE0 A;  4A3I G;  1A2T A;  1IBM L;  2RDF A;  1ET6 A;  5C44 B;  3NQT A;  2ZJP A;  2UUC L;  4IZ8 A;  4XT3 B;  1EY9 A;  3BZK A;  5C0X G;  2OT2 A;  2K1B A;  3CC7 A;  2ALY B;  1YBY A;  1I94 L;  3KDF B;  5JEA G;  5A35 A;  2ZTC A;  4PV1 C;  3QJY A;  3HOW B;  4NXM Q;  5EPJ A;  1XNQ Q;  1YVC A;  3S1N H;  3CCU A;  3C2P A;  1FL0 A;  1SMX A;  4A3M G;  3NBH B;  2PPB C;  4PMC A;  4A75 A;  2CW0 D;  5ISR A;  3IFT A;  2EDG A;  3KLW A;  3NHH A;  4EGV A;  2YTV A;  4FDB A;  2EOT A;  1ICF B;  4G7H C;  4FXD A;  1YNJ C;  2YYZ A;  1HNX L;  2IT1 A;  1I6H B;  1PH7 A;  1SYB A;  1ASY A;  2K5V A;  3A8I E;  3PO3 G;  1I5F A;  3NEL A;  3FKI H;  2EXZ A;  1HHV A;  4JI1 L;  2EYM A;  1S5D D;  4NDX A;  3E3X A;  4KHV A;  2F52 A;  2MFI A;  5IYD H;  4C3J H;  1X9N A;  4XTC S;  1PHJ A;  3GTP B;  3NUC A;  3Q8D A;  2UUA L;  1IYV A;  3I7F A;  2XRS D;  3B6Y A;  5K36 H;  1XMQ Q;  2AQ2 B;  3G6J B;  2EE1 A;  4YIJ A;  4CJ0 B;  3A5Z B;  3R2T A;  5BN3 A;  4UAI A;  3QG1 A;  5IGD A;  4DUZ L;  2N3S A;  2NVY B;  3EN2 A;  2HIV A;  2VB3 X;  1A0I A;  2CH4 W;  4KN4 C;  1S72 A;  1Z9F A;  1YHA A;  3CCE A;  3I72 A;  2Z6K C;  2MPM A;  2FMM A;  4K5W A;  5DAU A;  1KAW A;  3VR6 A;  4LJZ C;  1CTM A;  5KYI A;  2AQ3 B;  1XPU A;  5KND A;  1JWM D;  3J80 c;  4JI4 Q;  4DV1 Q;  1CHP D;  4XYO A;  3T53 B;  3H3V C;  1S5C D;  1SYG A;  1J5E Q;  1EWH A;  2Q2U A;  5JVG 3;  1STE A;  2B2V C;  4Y7N B;  4GNX B;  1SYD A;  2DNC A;  1KAA A;  4F8M A;  3DWA A;  1O7Z A;  2F0Q A;  5D65 A;  5IGE A;  5LMU Q;  4H7B A;  2OEO A;  1XMO Q;  2I5M X;  1B7Y B;  3KF8 B;  5CBE E;  4IUQ A;  4WFN 3;  2F03 A;  1K8O A;  4JI6 Q;  2MGS A;  4WRD A;  2OTJ A;  1H9S A;  1ZYR D;  2NN6 I;  4NXN Q;  3MHB A;  5C4X B;  2M9V A;  5J39 A;  2PQA A;  5F2D A;  3PF4 A;  1PZK D;  1S4Z A;  4KKT A;  4YCU A;  4DR3 Q;  4DV0 Q;  1YZ6 A;  2VUM H;  1B44 D;  4TRD A;  1PH1 A;  2JA5 G;  2I46 A;  5FJ8 G;  3M9B A;  4ALP A;  2B2U C;  2E2J H;  1LT6 D;  3D4R A;  3K7A H;  4OON A;  1E22 A;  1FNW A;  1PFM A;  5IP7 G;  2D5D A;  4PG3 A;  1FJG Q;  5JAV A;  1YI2 A;  4JI2 L;  2A69 D;  1ILP A;  2A68 C;  4LFB L;  3TRE A;  3BYT B;  5IYC G;  1FGU A;  2E76 C;  4A3G G;  4JCV E;  3RUZ A;  3VYR A;  1EZ6 A;  1UEB A;  2HUG A;  1VQD A;  3Q6S A;  3UDX A;  3PMF A;  5HGT A;  1EEI D;  3I4M H;  2F0T A;  1EOV A;  2J7Z A;  3J81 i;  2A19 A;  3E9I A;  5C5M A;  1VQ4 A;  2RHS B;  5CMD A;  4LUO A;  4CGY B;  1I3Q H;  3TZU A;  4P72 A;  1P8L A;  4XQJ A;  1VF5 C;  4PMW A;  1KXL A;  1D5M C;  4RMF A;  3HOZ H;  2UU9 Q;  1RHP A;  1QCB D;  3O13 A;  5IT9 L;  3CME A;  1BBU A;  5I2Y A;  5IOD A;  2J4X A;  2CQA A;  3HOX H;  1M90 C;  4LNQ A;  3RZO H;  1CSQ A;  5LL6 S;  3MAQ A;  3W1B A;  5KNB A;  1Q82 C;  1NAP A;  2EYF A;  2LXJ A;  3OW7 A;  3S14 B;  5K5P A;  4A93 G;  1SDF A;  3OW2 A;  2JP1 A;  1PH9 A;  3MFG A;  5JJK A;  4HR7 B;  1K0R A;  2QA4 A;  2DUD A;  2CQO A;  1PH5 A;  1GUS A;  4DPG A;  1JR0 D;  1AEX A;  1QNU A;  1HH2 P;  2BH2 A;  1KDA A;  1YHB A;  1HA5 A;  4N9P A;  5FLM H;  1OXU A;  3SK4 A;  3RLO A;  2EYP A;  1XNR Q;  2D9U A;  5G3L D;  3ND8 A;  1SLJ A;  1ROD A;  1GUG A;  3UE1 A;  1Q81 C;  1PFS A;  2JYO A;  1HFN A;  4C56 C;  4A3L G;  3R2I A;  1CKM A;  1XPO A;  1HR0 L;  1Z7T A;  2O2L D;  3M3Y B;  3GDE A;  5COR A;  4C3I H;  3SDZ A;  1HNW L;  2BH8 A;  3LWE A;  1JJG A;  2F0F A;  4R1J A;  5BR8 Q;  3DXJ C;  4K5V A;  5EBC A;  3FVQ A;  4OO1 H;  4HSP A;  3HEJ A;  1CKN A;  4LF4 L;  4JI3 Q;  1K8G A;  1CFM A;  1F2L A;  2RA4 A;  4X3K A;  3SEB A;  4YHH L;  5DEH A;  1PYB A;  3NEN A;  4G57 A;  3J7A 5;  5M5X B;  3C1F A;  2V1C C;  2UXD L;  2PNR C;  1FR3 A;  3KBG A;  1O80 A;  4PZ8 A;  1HA6 A;  3UE0 A;  2JA6 B;  2OQK A;  3DLL A;  1OXX K;  3QB3 A;  3D6C A;  2ASB A;  2LMC B;  4DR1 Q;  4AIM A;  4B3S Q;  1WI5 A;  3CD6 A;  4JI8 Q;  4X65 L;  1UWV A;  3IAY A;  4ZYS A;  3OMC A;  3K8A A;  1LT3 D;  3KJP A;  3HOU G;  1CT1 D;  1WCM G;  2NN6 G;  2Z0S A;  1TS5 A;  2E2D C;  1KDC A;  1Q90 A;  2EJM A;  1BKB A;  4BY7 B;  2BA0 A;  4GS3 A;  2E74 C;  3FRP B;  4TSS A;  4A3F H;  3TS2 A;  2UUB Q;  4DAY A;  4H44 C;  1QJO A;  5AFW A;  1C8C A;  1N32 L;  3HKS A;  1E1T A;  1LTI D;  1STY A;  3Q22 A;  3QOJ A;  3H0G B;  3TP7 A;  4BA2 I;  2CH4 A;  3OWE B;  5IYB H;  4XQQ A;  2L9H A;  1VQ5 A;  2MHV A;  4DK0 A;  2RDG A;  1PFN A;  4HID A;  1RTO A;  4K8I A;  1N34 L;  2HHH Q;  2R3Z A;  1JOO A;  4EQ5 A;  2EZV A;  3MXU A;  2GA4 B;  2B2W A;  4O2D A;  1HRJ A;  5JOB A;  3HOY B;  3HOV B;  5EPK A;  4G4K A;  1Q3L A;  4DXF A;  1SE3 A;  4DR6 L;  1K8M A;  5M5Y B;  1Z6H A;  2H5X A;  2CCZ A;  2HQE A;  1G51 A;  2A1A A;  2WAQ B;  4R4Q A;  3A7L A;  1IBK L;  1O78 A;  3N6R A;  1I6V C;  1R4P B;  3TDQ A;  3GTQ B;  1EYG A;  3NXW A;  1X65 A;  2XNA C;  4HTH A;  3EFX D;  5KNC A;  3IFD A;  1D6E C;  3FHW A;  4LF5 L;  5EKI A;  1FGB D;  4X6A H;  1QG7 A;  1CQF A;  3J7A F;  1SND A;  3HKZ G;  3L9A X;  1FNU A;  1JE5 A;  3L3O C;  4EQN A;  4A3J H;  4QIW E;  5CR3 A;  4B3T Q;  2LXK A;  2X6L A;  4DR7 Q;  2ZJR A;  1NMG A;  4K2L A;  1AH9 A;  5E7N A;  3CQZ H;  1JB7 A;  2LSS A;  5JVH 3;  2ZXP A;  5M5W H;  1Y1V H;  1B70 B;  1KIX A;  1EWI A;  1E1O A;  4A3I B;  1IL8 A;  3K81 C;  1K83 B;  3UDG A;  4CDC C;  2LY7 A;  3S1M H;  3FKI G;  3NTI A;  3ULL A;  1K8A C;  1DON A;  1EOT A;  4A3E H;  3I73 A;  2Q8T A;  2WP8 J;  2EYO A;  4MTK A;  3GP7 A;  4X3T A;  5IYD G;  2VNU D;  2F0V A;  1I4P A;  4MTN A;  2B8F A;  1ICW A;  2F0G A;  1B1Z A;  4KI0 A;  3GTL H;  2AUJ D;  2YV5 A;  4LW1 A;  5K36 G;  4C2M B;  3KDF A;  2OWO A;  1KD1 C;  4DR2 Q;  3J80 i;  4A3C G;  2OCE A;  1X3P A;  1SJH D;  4B3R Q;  2IX3 A;  5I9O A;  4H13 C;  2E2I B;  4N8F A;  3NBH A;  3H91 A;  2A6H D;  3PO3 B;  4LF8 Q;  5EKK A;  3VA5 A;  5IT9 E;  2Q2I A;  1BCP C;  5EQ0 A;  1T9H A;  3PO2 H;  3S2D H;  4XDX A;  3J81 L;  3GTO B;  3AEV A;  4IN3 A;  4XT1 B;  4BY1 H;  4QY7 A;  1T5E A;  2B63 G;  1NMF A;  4DF7 A;  1QZH A;  2K04 A;  4JV5 L;  3T13 A;  4CDF C;  2KHI A;  2ES2 A;  4IUU A;  3ICE A;  1II3 A;  4QGU A;  3Q24 A;  4QUC A;  2EJG C;  3JAM i;  1B50 A;  4DV3 L;  3ZJY C;  5FLX c;  1QZG A;  3NSW A;  3G48 A;  3GTJ H;  4G7O C;  1TWC H;  4IOC A;  1LT5 D;  1VQH A;  4P73 A;  5C44 H;  1ZEQ X;  3UDF A;  4CKC A;  3GTM H;  1QNK A;  2VUM G;  3RD4 A;  4NPS A;  3TME A;  1HCZ A;  4GKJ Q;  5E4W C;  4S3S A;  1XJV A;  3HOW H;  4KK7 A;  2QIL A;  5CC4 A;  1PYS B;  4APV A;  1D5Z C;  2NTS A;  5CYU A;  3OIP A;  2N55 A;  4DNR B;  1QE6 A;  1VQL A;  2CVR A;  3VR3 A;  2RVL A;  4U68 A;  2P5Z X;  3PSI A;  1ZKO A;  3KUP A;  2Q8I B;  1I6H H;  3KF8 A;  3BYY B;  1A3T A;  1LYL A;  4LFA L;  5ELE A;  3PF5 A;  2L12 A;  2WB1 G;  4RHR A;  3I4M G;  2K7V A;  4I7A A;  1U9R A;  2F0J A;  1GVP A;  2X6G A;  5GQO A;  1P16 A;  2NWG A;  3A0J A;  1M1K C;  1E3P A;  1NTG A;  2VXW A;  5FO9 B;  4HIO A;  2FHT A;  4H0L C;  3HOZ G;  1SNO A;  2EPB A;  2IHF A;  4UPA A;  4OX9 L;  4RGT A;  4P2C B;  4OWW B;  3STB D;  1QVF A;  3SXH A;  3PCO B;  3HOX G;  2C9O A;  4QCL A;  5I2X A;  2NVY H;  4M1U B;  1S40 A;  3I4N G;  1Q1E A;  1HNZ L;  1HTL D;  3V05 A;  3M7N A;  3KBX A;  5C5L A;  2QDB A;  1CKO A;  1GM5 A;  4F88 A;  3X3N A;  1ML0 D;  1OTC A;  2V4D A;  1I50 H;  1PZI D;  4RCO A;  1YIJ A;  1GUT A;  3GTG H;  2WB1 E;  2UXB Q;  5FLM G;  3CAM A;  2NBF A;  1KRT A;  3J7Y W;  2BOS A;  5ELC A;  3BDO A;  4UHV A;  1PTO D;  4ME5 A;  3AQQ A;  5LMN W;  1K28 A;  1Y14 B;  2F4I A;  5J3B A;  1VQK A;  1EIH A;  4C3I G;  2R7F A;  1W3S A;  4XQN A;  1EYA A;  4V0B A;  1SN8 A;  5D14 A;  2CFM A;  3OIQ A;  1SNQ A;  4OO1 G;  4RGM A;  4DV6 Q;  2CKZ B;  3S15 B;  4HMJ A;  3AB9 A;  5C4X H;  1OXT A;  1TXY A;  3VYU A;  4LF9 L;  3CKI B;  3BDC A;  1L0W A;  1IXR A;  1TU2 B;  2HDM A;  5I6Y A;  3AMU A;  2B2Y C;  2AUK A;  4C1N I;  2Z6B A;  2RSO A;  2K03 A;  1S5F D;  4L5R C;  2PZW A;  2KHS A;  1O7L A;  4DKA C;  2PCF B;  3GQB A;  1ENC A;  5CV5 A;  3AYH B;  5A2Q L;  4IPC A;  2ENB A;  2AKW B;  2VQF L;  4GKK L;  1JWS D;  1RJT A;  2JK8 A;  3V96 A;  2WV6 D;  2M2L A;  1BNZ A;  1XX8 A;  4GOP B;  2DY8 A;  2BCO A;  4A3F G;  1YNN D;  1GUO A;  3F2U A;  3CCS A;  2A74 C;  3CRL C;  1SYF A;  2CHB D;  4KMU C;  3M4O B;  3K5O A;  2IY5 B;  2PMZ B;  2G9H D;  5JPN C;  3RR5 A;  1XXG A;  1PRT C;  3VR2 A;  2XRQ D;  1BDO A;  1C0A A;  1Y1W H;  1JOK A;  2KBN A;  3TEH B;  2FJ2 A;  4O42 A;  2RSN A;  5IYB G;  4JI7 Q;  4E6I A;  1VQJ A;  1HZA A;  3FDT A;  4A3D B;  2KCC A;  3HOU B;  2ZM6 L;  3A7A B;  2QF7 A;  4OIK A;  1SFO H;  2K5N A;  2F0E A;  2A6E C;  2KED A;  1IZ6 A;  1WJJ A;  3S14 H;  5JJL A;  4AQY Q;  2Q2T A;  4KJO A;  1WTO A;  4YHH Q;  3G7L A;  3J81 E;  1T5X D;  3CHB D;  3F2C A;  4DV4 L;  1KQS A;  3E5S A;  5C3E B;  1SE8 A;  1VQF A;  2NZ1 D;  4JOI A;  5C3W A;  4K5X A;  3HFZ B;  4DV7 L;  1GHJ A;  5LHY 1;  1IW7 D;  3I2Z A;  2IWH A;  1IBL L;  3HRZ C;  2L1B A;  1G91 A;  3NTK A;  4G7Z C;  2NVX B;  3KF6 B;  4X65 Q;  4JYA L;  1CM9 A;  3M4P A;  4RA8 A;  1TQO A;  1VQC A;  2JEA I;  1BBX C;  3M3Y H;  4OEM B;  4KTA A;  1W2B A;  1RTN A;  1J6Q A;  2XIW A;  4C3H G;  4A3J G;  4HCS A;  1U4P A;  4IJH A;  3RN2 A;  1Q86 C;  4DV5 Q;  4LF6 L;  2DN8 A;  1TWG B;  1A2U A;  4R4C A;  1AE2 A;  4PMB A;  5CV6 A;  1PH2 A;  2KQ3 A;  2J0T D;  1ENA A;  3ITP A;  1Y1V G;  3LGJ A;  1PLF A;  5M5X H;  3CF5 A;  3JAM L;  3S1Q B;  1U0L A;  2R7Z H;  4JK1 C;  1G8Z D;  4ZQ3 A;  2N49 A;  3I91 A;  1VQG A;  2JA6 H;  1CZW A;  3K59 A;  1A8V A;  1Z47 A;  2F0W A;  4FXG C;  4A3E G;  1FD7 D;  1N34 Q;  2RQX A;  1PH8 A;  3KFU A;  3HKZ B;  3T1Y Q;  1UAP A;  4A76 A;  3BVG A;  2IX0 A;  2JE6 I;  1V1P B;  2K50 A;  3S1N B;  2PZU A;  3W5O A;  5IGC A;  1F9R A;  1MSG A;  4DR6 Q;  3CC4 A;  1IKL A;  2Z6K A;  2Z1C A;  3T1H L;  2DY7 A;  3PUY A;  5EJW A;  4FF3 A;  4UDU C;  2K5Q A;  2JA8 B;  3SGI A;  5KRU A;  3K57 A;  4X64 L;  4DR4 Q;  5TSS A;  1BO0 A;  1BCP F;  4KD3 A;  4PQX A;  4DUY Q;  3A56 A;  3N52 A;  4X62 Q;  4MNO A;  4ZCK A;  1DOK A;  3FKI B;  2IL8 A;  4EQP A;  1D2B A;  2B2V A;  4X66 Q;  2ICI A;  1LAB A;  3M4Q A;  4IPD A;  2E5L L;  2KHJ A;  3H94 A;  1A3V A;  2KCN A;  3PO2 G;  2TMP A;  1HUN A;  1N36 Q;  1HUM A;  4OHJ A;  3PIP 3;  2M00 A;  4BY1 G;  2SNM A;  2XTI A;  4L5T A;  4NXM L;  2BE5 D;  4R9W A;  3QO2 A;  1XNQ L;  1YJ9 A;  2QEX A;  3TBI B;  3I3C A;  4JBW A;  2HCI A;  3HOV H;  3TRZ A;  4RH6 A;  1DZ1 A;  4KY5 A;  4ZKC B;  4LFC Q;  3ERQ A;  4K14 A;  1SMY D;  3F8T A;  5E4X A;  4YY3 Q;  5IT9 c;  3ONA B;  1VQ6 A;  2B39 A;  2LFN A;  3MXN B;  4LUZ A;  3I4O A;  1Y8O B;  4UP9 A;  3K5M A;  2K05 A;  1LM0 A;  1SRO A;  1I4X A;  2XVS A;  2MO0 A;  3GTQ H;  3PIO 3;  1EY7 A;  2H4O A;  1S5E D;  1EFW A;  1E24 A;  2JA7 B;  4XYQ A;  2PYK A;  5KYL A;  5C44 G;  2YTX A;  3L7Z C;  1YHQ A;  4GLA C;  1LAC A;  1HJP A;  4LUV A;  2B63 B;  5IWA Q;  3OYY A;  2C5C A;  1L1O B;  4OGQ C;  4YCW A;  2D2C C;  1SBB B;  4TQU S;  4LK1 C;  1STB A;  2Y0S B;  1XMQ L;  2F0K A;  1N33 Q;  1BVS A;  1RF2 D;  1V9P A;  3OMG A;  3FPP A;  1X3F A;  3H3V H;  1V43 A;  5I6W A;  1Q8I A;  4AYB E;  5T1I A;  2R93 B;  2B2W C;  3K80 C;  1F9P A;  3NE5 B;  2NVQ B;  4BBS H;  3CRK C;  1TY0 A;  1U5K A;  1EU4 A;  1WTR A;  5LMN Q;  1GXD C;  2QKI C;  1NY4 A;  3K58 A;  4J15 A;  5M3F H;  4A3I H;  4RHS A;  5M3M G;  4FO2 A;  5A2Q E;  2LS0 1;  3BVZ A;  2CW0 C;  1X54 A;  2I0Q A;  4IJL A;  2F4V Q;  4DV1 L;  2WKC A;  3FPU B;  2E2J B;  2DJG C;  1C48 A;  2A5H A;  4Y52 H;  2GN5 A;  2E2H H;  3BJU A;  1X6O A;  4BBR H;  1SNM A;  4OWT B;  3P7J A;  1OXV A;  3CCJ A;  4C2M H;  3J7A V;  4POF A;  3VYT A;  4L5Q A;  1HZC A;  1DGS A;  3RZD B;  1LTG D;  1XMO L;  1B3A A;  3BG3 A;  4IFD J;  3U9O A;  4LWC A;  1EY8 A;  2A8V A;  4ZUJ A;  1QOH A;  3R93 A;  4JI6 L;  3PO3 H;  2E75 C;  4DR5 Q;  4K6D A;  3CPW A;  2WB1 B;  5C3X A;  1Y8P B;  5M9O A;  3NEM A;  4YWM A;  3I4M B;  3QIA A;  1XTC D;  4NXN L;  2B2T A;  3MFY A;  1ILQ A;  3OWF A;  4R8N A;  1QUQ B;  4DK1 A;  2F3V A;  4DV0 L;  1QB5 D;  4DV2 Q;  3GTO H;  4B3M Q;  1Q1B A;  1Y8N B;  2RKS A;  1G6Z A;  2LKV A;  1EQT A;  4CJ2 C;  1EUJ A;  4KKS A;  3I4L A;  1DXM A;  3NQI A;  3H15 A;  2KEC A;  2MQH A;  3S2H B;  3U4Z A;  3VA7 A;  2RF4 A;  1PMR A;  1JJC B;  1FJG L;  1PRT B;  3UI2 A;  3HOX B;  3TSS A;  2VQE Q;  2UXC L;  3F2D A;  3I4N B;  2K75 A;  3OTO Q;  1KNA A;  2QCP X;  2JQO A;  1B3Q A;  3OOC A;  4ODG A;  4KHP L;  1KLU D;  2L5T A;  4A3K H;  4RKL A;  5GAG C;  3LWU A;  4BXX H;  1D7Q A;  1WTV A;  2F3W A;  2NUC A;  1TWA H;  4GLV B;  4HIM A;  1R9T H;  5IGF A;  4M8A A;  4N9T A;  2ZXR A;  3G4S A;  4JBM A;  1LTR D;  3H6M A;  3ERO A;  3S9W A;  4K0K Q;  2SDF A;  3K6O A;  4EQO A;  2F1M A;  1ZYR C;  4K6L A;  4H02 A;  1PTO H;  2EXD A;  2UU9 L;  2K5W A;  2VL6 A;  3JAM E;  1RDP D;  3EVQ A;  2EY6 A;  5C4J H;  2YTY A;  1BXT A;  3I70 A;  2NVT B;  1HNZ Q;  2JJQ A;  4JI0 Q;  3NWS A;  2L15 A;  1CZG A;  2KOL A;  1JWU D;  1PRT F;  4UY8 C;  2F0H A;  4HJ7 A;  1H9R A;  4IAL A;  4RWS C;  4ZUI A;  3Q0A A;  4HJA A;  4C3J G;  1YNJ D;  2RHQ B;  1JCK B;  2F0S A;  4JVZ A;  2HIX A;  4GN4 B;  4A3M B;  4JI5 Q;  1Y1W G;  3CMA A;  2A69 C;  4JW0 A;  1AP0 A;  1XNR L;  1EYD A;  2EY1 A;  3LNN A;  2D0O A;  1S5B D;  1EQR A;  1VQB A;  2NYZ D;  5AJ3 Q;  2EYH A;  4X3S A;  1MI2 A;  1VQP A;  1SEB D;  1TWF B;  4PZ6 A;  3CPF A;  1CA5 A;  2AMC B;  3A8J E;  1B4O A;  3KLS A;  1AZP A;  4LF7 L;  2OXP A;  5HUR A;  5BR8 L;  2IJ0 A;  4A3B H;  1IBM Q;  1K3B C;  4CDE C;  2UUC Q;  4LF9 Q;  4JI3 L;  1I94 Q;  2HDL A;  1JE4 A;  3RMH A;  1JT8 A;  4MIU A;  1FNV A;  3D4W A;  3VYS A;  3AFP A;  3H3V I;  4GOP A;  2SOB A;  4DNI A;  2F3I A;  1J9O A;  1KAB A;  2R92 H;  2H1E A;  1EIG A;  1WVL A;  1NJI C;  1Y69 U;  4DR1 L;  4GKK Q;  5FK9 C;  4B3S L;  1EEF D;  2K33 A;  4TVA B;  3P20 A;  3J81 c;  1HNX Q;  5FLX L;  1A15 A;  2K32 A;  1LTS D;  2XGT A;  3S16 B;  1KRS A;  4JI1 Q;  3TS0 A;  3T4A C;  1DM0 B;  4DFA A;  3MA2 B;  2UUB L;  2QGQ A;  1TWH B;  2UUA Q;  3I8Z A;  2ZT9 C;  1W6K A;  4J1M A;  1SJE D;  2R7Z G;  4ZAI A;  2F0N A;  3PUZ A;  1UE1 A;  2EVB A;  1FYC A;  4RGO S;  4HN7 A;  5FO7 B;  3GV6 A;  4DUZ Q;  5J1Z A;  1DCZ A;  1SYC A;  4B9W A;  2B8G A;  4GNX A;  5JJI A;  2L55 A;  3E6Z X;  4IUN A;  5FOB B;  2HHH L;  1IKM A;  4C3H B;  3BS1 A;  3KF6 A;  2PI2 A;  3SK6 A;  2IHE A;  3VR5 A;  5EPL A;  3MVV A;  4JC0 A;  2A73 B;  3R8B A;  1JIC A;  4RAU C;  3BDL A;  3T16 A;  2HT1 A;  2PZT A;  1TR5 A;  3CQZ B;  2A68 D;  1M8A A;  2JA5 B;  2EYJ A;  1C9O A;  2ICE C;  1Y1V B;  4DV7 Q;  3M4O H;  2XSC A;  1GKH A;  3GTP H;  3ULP A;  3CP0 A;  1B8A A;  3TP5 A;  4DAM A;  1F9Q A;  2RBM A;  1OO9 B;  1DOL A;  4YWL A;  3S17 B;  4FF2 A;  1TII D;  4MZ9 A;  2SEB D;  2YU9 B;  4ID6 A;  2DGY A;  3VR4 A;  4A3D H;  3CU7 A;  1KNE A;  5COY A;  2GVA A;  3MEH A;  3F1Z A;  4A3G B;  3R3O A;  2OF1 A;  5EBD A;  3WDN A;  4X3U A;  3P75 A;  2MNA A;  5D3I B;  1QIL A;  5IOC A;  2WIN B;  3ERS X;  2EQS A;  3PIP A;  1HFG A;  4EVO A;  3HOV G;  5CV9 A;  1LUZ A;  4N8X 1;  1V1P A;  4B3T L;  2ZJQ A;  3CCM A;  4DR7 L;  4HJ8 A;  1IL2 A;  5C3E H;  2NZO A;  4NMZ A;  1AZQ A;  2ATW A;  1CHQ D;  4UP8 A;  2GVB A;  2MUY A;  5ELN A;  4CDD C;  4GN3 B;  4QF4 A;  4Y7N H;  1PH4 A;  1M4V A;  2F0O A;  4QUF A;  5C0X J;  4DGZ A;  3DHQ A;  4R4I A;  3PO2 B;  4JI2 Q;  3S2D B;  5JEA J;  1KLG D;  4JBK A;  2VB2 X;  2SNS A;  3OPO A;  2NVX H;  4BY1 B;  4LFB Q;  2KUM A;  3PIO A;  3GV3 A;  4MN3 A;  1LT4 D;  3SK8 A;  4A93 B;  4HJ5 A;  3D3R A;  1X32 A;  2PW7 A;  3W2D A;  1BF4 A;  2TSS A;  5GRO A;  1TY2 A;  2JSO A;  3GD7 A;  5DLQ E;  4IFD H;  1PYW D;  3MXP A;  1K73 C;  2OTL A;  3ZYY X;  4HAE A;  5BN5 A;  3E9H A;  1I4R A;  3DEP A;  4JPB W;  4CKB A;  1TWG H;  4DR2 L;  4K8J A;  3RNU A;  2I5H A;  1V1Q A;  1GD7 A;  1VQM A;  2VZA A;  1SYE A;  4NB3 A;  1XTD A;  4WOR A;  3KOJ A;  2F0L A;  3BVM A;  4BBS G;  2L0C A;  1AN8 A;  3A8K E;  4IUT A;  1X3G A;  3I55 A; 
#chains in the Genus database with same CATH homology
 3CC4 A;  1WYD A;  2WAQ E;  2Z6K A;  5IYB H;  4BA2 I;  3T1H L;  5M3F G;  4LF8 L;  3PUY A;  1VQ5 A;  3S15 H;  1CSP A;  3AFQ A;  2AWN A;  2EIF A;  4IPG A;  1VQ7 A;  2Y0S G;  4HID A;  4JOI C;  3SGI A;  1N34 L;  5GAH C;  3PGZ A;  4BA1 I;  4DK6 C;  4X64 L;  2HHH Q;  4DR4 Q;  4EQ5 A;  5GAD C;  1VQI A;  4DUY Q;  2R93 G;  3UDI A;  4O2D A;  4X62 Q;  4MNO A;  2BA1 A;  4ME3 A;  2JA6 G;  4GLX A;  2HQL A;  4X66 Q;  2E8G A;  3EIV A;  3M4Q A;  4IPD A;  2KHJ A;  3U4V A;  4BBR G;  2E5L L;  4DR6 L;  4DR5 L;  1PH6 A;  2H5X A;  1VCI A;  1MJE A;  2CCZ A;  4A3L H;  1G51 A;  3PO2 G;  1PA6 A;  2A1A A;  2ZM6 Q;  1N36 Q;  4R4Q A;  1IBK L;  3F2B A;  1L1O A;  2PNH A;  2JA8 H;  1CUK A;  4BY1 G;  4DAY B;  2MO1 A;  2XTI A;  1D8L A;  1K3R A;  1EYG A;  3G6E A;  4L5T A;  4DV2 L;  4NXM L;  3U58 A;  2R7D A;  4B3M L;  1XNQ L;  1YJ9 A;  4DR6 Q;  2QEX A;  4UP7 A;  1X65 A;  4BY7 G;  1Q12 A;  4JBW A;  3HOV H;  3TRZ A;  4DV4 Q;  1HR0 Q;  2NZH A;  3DM3 A;  3U50 C;  4LFC Q;  1X55 A;  3FHW A;  1HNW Q;  4LF5 L;  4IPH A;  3F8T A;  4X6A H;  1L2F A;  4YY3 Q;  4OXP A;  5IT9 c;  3D31 A;  3HKZ G;  1VQ6 A;  2VQE L;  2I5L X;  1WFQ A;  1JE5 A;  3MXN B;  3I4O A;  4LUZ A;  4A4I A;  3L2P A;  1Q8K A;  4UP9 A;  1IBL Q;  4LF4 Q;  4IO9 A;  1YEZ A;  4GKJ L;  2Y0S E;  4A3J H;  1LM0 A;  1SRO A;  3OTO L;  4QIW E;  2VY3 A;  3GTQ H;  2MO0 A;  3H0G G;  3EBE A;  1EFW A;  4JYA Q;  4QQB X;  4B3T Q;  4WJ4 A;  1E24 A;  1SR3 A;  2LXK A;  3IRB A;  3WWV A;  5M3M H;  2ZJR A;  1NMG A;  4DR7 Q;  1AH9 A;  5E7N A;  4A3C H;  1ASZ A;  5C44 G;  1KC8 C;  3CQZ H;  2YTX A;  3L7Z C;  1JB7 A;  1YHQ A;  2UXD Q;  2LSS A;  4GLA C;  3HOU H;  5M5W H;  1Y1V H;  4AH6 A;  4QJF A;  1HJP A;  1WCM H;  4LUV A;  1B70 B;  5IWA Q;  1EQQ A;  1KIX A;  4HIK A;  3PUX A;  3OYY A;  1EWI A;  1E1O A;  4R4T A;  3M85 A;  4LF6 Q;  1L1O B;  3A74 A;  3K81 C;  3UDG A;  4YCW A;  4P75 A;  3S1M H;  3FKI G;  4TQU S;  3ULL A;  3HOY G;  1K8A C;  1NBW A;  3RLF A;  1XMQ L;  2ZTD A;  4A3E H;  5HY6 A;  4A3K G;  1N33 Q;  4IOA A;  4BXX G;  1BVS A;  4K0K L;  1V9P A;  2WP8 J;  1X3F A;  4O0A A;  3D0F A;  1V43 A;  3I56 A;  2JA7 H;  4AYB E;  3S1R H;  3H3V H;  2ID0 A;  5IYD G;  2AHO B;  2WAQ G;  2VNU D;  1IYJ B;  4YCV A;  3K80 C;  2KEN A;  4MTN A;  3BZC A;  4BBS H;  4KI0 A;  3K0X A;  1U5K A;  3CCR A;  3GTL H;  2YV5 A;  3PUV A;  4LW1 A;  5LMN Q;  2B63 H;  1NY4 A;  5K36 G;  4J15 A;  1QUQ A;  5M3F H;  1RL2 A;  4A3I H;  2JA9 A;  3KDF A;  4HJ9 A;  1KD1 C;  3KYH C;  5M3M G;  4DR2 Q;  2OWO A;  4JI0 L;  1N32 Q;  3J80 i;  5IP9 G;  4A3C G;  2OCE A;  1PV4 A;  1L1O C;  1LTL A;  4B3R Q;  1X54 A;  3RLN A;  2I0Q A;  3CCL A;  4IJL A;  2F4V Q;  3GTK H;  2OQ0 A;  4DV1 L;  2R93 H;  2Q2H A;  2WFW A;  4Y52 H;  2GN5 A;  2E2H H;  3BJU A;  2NVQ H;  3T1H Q;  4LF8 Q;  4JI5 L;  1X6O A;  4BBR H;  4OWT B;  1G29 1;  1OXV A;  2Q2I A;  3CCJ A;  4C2M H;  1T9H A;  1E7Z A;  4POF A;  1EIY B;  3PO2 H;  2KCM A;  3S2D H;  3ER0 A;  4X64 Q;  1K9M C;  4L5Q A;  1HZC A;  1DGS A;  5AJ3 L;  1XMO L;  2N8N A;  4B3R L;  3AEV A;  1JJG A;  4BY1 H;  4IFD J;  3E0E A;  4LWC A;  4QY7 A;  1A62 A;  2K14 A;  3L0O A;  5ELO A;  3JAM c;  3S1Q H;  2B63 G;  3KJO A;  2E5L Q;  2A8V A;  1NMF A;  2D62 A;  1QZH A;  4JI6 L;  3PO3 H;  2UXB L;  4DR5 Q;  1PVO A;  1AE3 A;  3CPW A;  4BY7 H;  4A3I G;  4JV5 L;  1IBM L;  3NEM A;  2ZJP A;  4YWM A;  2UUC L;  4NXN L;  1IBK Q;  3BZK A;  1SRU A;  5C0X G;  2UXC Q;  2KHI A;  2ES2 A;  1QVC A;  3CC7 A;  2ALY B;  1QUQ B;  3MEF A;  1YBY A;  4QGU A;  1I94 L;  3ICE A;  4DV0 L;  3KDF B;  3RZD H;  5JEA G;  2ZTC A;  3JAM i;  4DV2 Q;  3GTO H;  4NXM Q;  5IE8 A;  4B3M Q;  4DV3 L;  1Q1B A;  3ZJY C;  5FLX c;  1QZG A;  1XNQ Q;  1N9W A;  1YVC A;  3S1N H;  3CCU A;  4KHP Q;  1FL0 A;  3H0G H;  1EUJ A;  1SMX A;  3G48 A;  3GTJ H;  3NBH B;  4A3M G;  4A3B G;  3H15 A;  1TWC H;  2MQH A;  4A75 A;  4IOC A;  3U4Z A;  4LF5 Q;  4DV6 L;  4IFD I;  2RF4 A;  1VQH A;  4P73 A;  1JJC B;  3KLW A;  5C44 H;  1FJG L;  3UDF A;  2VQE Q;  2YTV A;  3GTM H;  4FDB A;  2VUM G;  2UXC L;  4WJ3 M;  4NPS A;  4GKJ Q;  3F2D A;  1PH3 A;  2K75 A;  3OTO Q;  3STB C;  1XJV A;  3HOW H;  2YYZ A;  2ZTE A;  2IT1 A;  4AYB G;  1PH7 A;  1HNX L;  2JQO A;  1BBW A;  1ASY A;  2K5V A;  1HNW L;  1UE7 A;  3PO3 G;  1I5F A;  1PYS B;  3FKI H;  3NEL A;  4APV A;  3HOY H;  4KHP L;  2R92 G;  4P74 A;  4JI1 L;  4A3K H;  5GAG C;  3CW2 C;  1D7Q A;  4BXX H;  1VQO A;  2R6G A;  5M5Y H;  3S2H H;  3ULJ A;  2F52 A;  2MFI A;  1TWA H;  1VQL A;  4GLV B;  4C3J H;  1X9N A;  5IYD H;  1WOC A;  1H95 A;  4XTC S;  1PHJ A;  5EAY A;  1O7I A;  4HIM A;  2B29 A;  3Q8D A;  1R9T H;  2UUA L;  3PSI A;  3I7F A;  3B6Y A;  3I4N H;  3G4S A;  4JBM A;  1XMQ Q;  1I6H H;  1LYL A;  4LFA L;  4K0K Q;  3PF5 A;  3A5Z B;  5IP9 H;  2WB1 G;  4H02 A;  3I4M G;  2EXD A;  2UU9 L;  4DUZ L;  2VL6 A;  1GVP A;  2N3S A;  5GQO A;  1P16 A;  3EN2 A;  2HIV A;  1A0I A;  3A0J A;  1M1K C;  1S3O A;  1E3P A;  2YTY A;  5C4J H;  1NTG A;  2D0P A;  1NE3 A;  1YHA A;  1Z9F A;  3CCE A;  1S72 A;  3HOW G;  2Z6K C;  1HNZ Q;  2JJQ A;  4HIO A;  4JI0 Q;  1JJ2 A;  3JC6 6;  2L15 A;  1KAW A;  1Q46 A;  4UY8 C;  4EX5 A;  1C7Y A;  3HOZ G;  2IHF A;  4UPA A;  4HJ7 A;  4OX9 L;  4JI7 L;  3PV0 A;  4OWW B;  1XPU A;  4HJA A;  3STB D;  3J80 c;  4JI4 Q;  4DV1 Q;  1QVF A;  3PCO B;  2RHQ B;  3HOX G;  1J5E Q;  2Q2U A;  4LF7 Q;  3GO5 A;  2HIX A;  2NVY H;  4KLK A;  1S40 A;  4GN4 B;  4JI5 Q;  2N78 A;  1Y1W G;  4GNX B;  3I4N G;  3CMA A;  1Q1E A;  2NVT H;  1HNZ L;  3CCQ A;  1OXS C;  1XNR L;  1K83 H;  2D0O A;  3M7N A;  4AQY L;  5LMU Q;  1XMO Q;  1EQR A;  1CKO A;  1VQB A;  2I5M X;  1B7Y B;  4YWK A;  5AJ3 Q;  1GM5 A;  3W1G A;  4PZ7 A;  3KF8 B;  1OTC A;  1I50 H;  1VQP A;  4JI4 L;  1HZB A;  4PZ6 A;  1YIJ A;  3CPF A;  2AMC B;  1J5E L;  3GTG H;  2WB1 E;  4LF7 L;  5GAE C;  4JI6 Q;  2UXB Q;  5FLM G;  3CAM A;  2OTJ A;  5BR8 L;  2CWP A;  1KRT A;  4A3B H;  1IBM Q;  2NN6 I;  4A3M H;  4JV5 Q;  2UUC Q;  1RIP A;  4NXN Q;  1Q7Y C;  2PQA A;  3PF4 A;  4JBJ A;  1MKH A;  4LF9 Q;  2FXQ A;  4GN5 A;  4YCU A;  4JI3 L;  4DR3 Q;  5LMU L;  4DV0 Q;  1I94 Q;  1YZ6 A;  3AQQ A;  2B3G A;  1Y14 B;  5LMN W;  2VUM H;  5J3B A;  1JT8 A;  1VQK A;  4DV3 Q;  4A3D G;  1PH1 A;  3AFP A;  2R7F A;  1W3S A;  2JA5 G;  3H3V I;  4GOP A;  2E2I H;  1SN8 A;  1TWF H;  2CFM A;  5FJ8 G;  2RCN A;  3M9B A;  4ALP A;  1N8R C;  4DNI A;  2E2J H;  3VDY A;  3K7A H;  4OO1 G;  2F3I A;  4OON A;  1KHI A;  1E22 A;  4DV6 Q;  1QVG A;  2CKZ B;  2R92 H;  5IP7 G;  4PG3 A;  1FJG Q;  1YI2 A;  1VQ9 A;  5C4X H;  1OXT A;  4DV5 L;  1NJI C;  1TXY A;  4JI2 L;  4LF9 L;  4DR1 L;  1MJC A;  4DR3 L;  4GKK Q;  1L0W A;  4B3S L;  1IXR A;  4TVA B;  5C3E G;  3J81 c;  1HNX Q;  4LFB L;  3TRE A;  3K7U C;  5IYC G;  1FGU A;  2XGT A;  4A3G G;  4JCV E;  1KRS A;  4JI1 Q;  4L5R C;  3TS0 A;  4L5S A;  1UEB A;  4DKA C;  1VQD A;  2CWA A;  3UDX A;  1G6P A;  2PMZ E;  2VS1 A;  1YIT A;  3I4M H;  1VQ8 A;  1EOV A;  3AYH B;  3J81 i;  2QGQ A;  2UUB L;  2A19 A;  1JMC A;  3E9I A;  2UUA Q;  4IPC A;  1VQ4 A;  2RHS B;  2AKW B;  2PQA B;  4LUO A;  2VQF L;  3T1Y L;  4GKK L;  2JK8 A;  4DK3 C;  1I3Q H;  2R7Z G;  4P72 A;  1P8L A;  3PUZ A;  4LFA Q;  1UE5 A;  4PMW A;  1UE6 A;  1KXL A;  1UE1 A;  4RMF A;  4IFD G;  1HZ9 A;  3S16 H;  4GOP B;  3S24 A;  3HOZ H;  4A3F G;  1XPR A;  1A63 A;  5C4X G;  2UU9 Q;  3J7Z C;  4DUZ Q;  3CCS A;  4GNX A;  4KHZ A;  3CME A;  5JJI A;  1BBU A;  1M90 C;  4LNQ A;  3HOX H;  2KCT A;  3RZO H;  1CSQ A;  2IY5 B;  3W1B A;  1Q82 C;  1TWH H;  4OWX B;  3RR5 A;  2HHH L;  4DR4 L;  2LXJ A;  1YJN A;  1Y1W H;  1C0A A;  2KBN A;  2PI2 A;  3KF6 A;  2IHE A;  3TEH B;  4DUY L;  3OW2 A;  4A93 G;  4X62 L;  3CCV A;  4JC0 A;  4P71 A;  4OX9 Q;  2IX1 A;  1PH9 A;  5IYB G;  4JI7 Q;  4X66 L;  2HT1 A;  5JJK A;  3A5U A;  1VQJ A;  1HZA A;  3G71 A;  1K0R A;  2QA4 A;  2K5H A;  2DUD A;  2CQO A;  1C9O A;  1GO3 E;  1PH5 A;  4GOP C;  4DPG A;  4DV7 Q;  4POG A;  1MIU A;  2ZM6 L;  1N36 L;  1HH2 P;  2BH2 A;  4JG2 A;  3M4O H;  1YHB A;  1GKH A;  1SFO H;  3GTP H;  3ULP A;  1HR0 W;  2K5N A;  5FLM H;  3CP0 A;  1B8A A;  1OXU A;  1IZ6 A;  3RLO A;  1XNR Q;  1WJJ A;  4C3H H;  3S14 H;  4DAM A;  2PI2 E;  5JJL A;  4AQY Q;  2Q2T A;  1SLJ A;  2K4K A;  4YWL A;  4YHH Q;  3UE1 A;  1Q81 C;  1PFS A;  3F2C A;  3J81 j;  4A3L G;  1CKM A;  1VQE A;  4MZ9 A;  4DV4 L;  1KQS A;  1XPO A;  4XIG S;  1HR0 L;  1SE8 A;  1VQF A;  2DGY A;  3GDE A;  4LFC L;  2JEB I;  2K52 A;  4JOI A;  4C3I H;  2JA5 H;  2BH8 A;  2GVA A;  3CC2 A;  2JA8 G;  4YY3 L;  1FVI A;  3F1Z A;  3HFZ B;  4DV7 L;  4R1J A;  5BR8 Q;  5FJ8 H;  1KL9 A;  2MNA A;  3CXC A;  3I2Z A;  2AWO A;  1CKN A;  4LF4 L;  1IBL L;  5IP7 H;  3ERS X;  2EQS A;  3PIP A;  4JI3 Q;  3HOV G;  1K8G A;  1LUZ A;  3KF6 B;  4X65 Q;  4JYA L;  1X56 A;  3M4P A;  4YHH L;  2VW9 A;  1PYB A;  3NEN A;  3CCM A;  2ZJQ A;  4B3T L;  4HJ8 A;  3S17 H;  4DR7 L;  3J7A 5;  1VQC A;  1IL2 A;  2JEA I;  5C3E H;  1VQN A;  2YU9 H;  2V1C C;  2UXD L;  2NZO A;  2ATW A;  3M3Y H;  4UP8 A;  2GVB A;  4PZ8 A;  4R4O A;  4RG1 A;  5ELN A;  5IYC H;  1J6Q A;  4GN3 B;  3UE0 A;  1W2B A;  4A3G H;  2OQK A;  3DLL A;  4Y7N H;  1PH4 A;  4A3J G;  5IWA L;  5C0X J;  1OXX K;  1VS0 A;  4IJH A;  3TQY A;  2ASB A;  1YJW A;  3RN2 A;  3HKZ E;  4DV5 Q;  1Q86 C;  4LF6 L;  4R4I A;  5HGQ A;  4GNX C;  4JI2 Q;  5JEA J;  4DR1 Q;  4AIM A;  4JBK A;  4R4C A;  4B3S Q;  1WI5 A;  3FP9 A;  1N33 L;  1AE2 A;  1PH2 A;  2C35 B;  4JI8 Q;  1UWV A;  4X65 L;  2NVX H;  3CD6 A;  4LFB Q;  1X3E A;  3K8A A;  3PIO A;  3KJP A;  3HOU G;  1Y1V G;  3LGJ A;  5M5X H;  3CF5 A;  5IY0 A;  1U0L A;  1WCM G;  1VQA A;  2NN6 G;  4HJ5 A;  2R7Z H;  2Z0S A;  4QL5 A;  2N49 A;  1BKB A;  5GRO A;  3GD7 A;  1VQG A;  5DLQ E;  2JA6 H;  2BA0 A;  4GS3 A;  5LMN L;  1K73 C;  4A3F H;  2OTL A;  3TS2 A;  4OO1 I;  3E9H A;  1A8V A;  1YNX A;  1Z47 A;  4A3E G;  2UUB Q;  4A3D H;  1N34 Q;  1CKN B;  1PH8 A;  1TWG H;  2JA7 G;  3KFU A;  4DR2 L;  1N32 L;  1EIF A;  2VQF Q;  3T1Y Q;  3RNU A;  2I5H A;  3PUW A;  5C0X I;  4A76 A;  3HKS A;  1V1Q A;  1GD7 A;  4JI8 L;  2VZA A;  1E1T A;  4NB3 A;  1XTD A;  2IX0 A;  1VQM A;  3KOJ A;  5H1S E;  2JE6 I;  2K50 A;  4BBS G;  2F4V L;  4A93 H;  1X3G A;  3W5O A;  3RN5 A;  3I55 A;  3BU2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...