5GQOA

Structure of the second single stranded dna binding protein (ssbb) from mycobacterium smegmatis
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
117
structure length
97
Chain Sequence
ETPFTVVGNIITNPVRLRFGDQELYKFRVASNSLYVTVNCWGNLARGVSASLGKGDSVVVVGHLYTNEYERSSVEVRATAVGPDLSRCIARVEKVQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Single-stranded DNA-binding protein
publication title Structure of the second Single Stranded DNA Binding protein (SSBb) from Mycobacterium smegmatis.
pubmed doi rcsb
source organism Mycobacterium smegmatis (strain atcc 700084 / mc(2)155)
total genus 19
structure length 97
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5gqoA00
3GO5A 4GN4B 4AYBE 4Y7NH 3CAMA 4DV7L 2Q2IA 3F1ZA 4DR1L 3H3VI 4DUYQ 1XJVA 4DR3Q 2VUMG 2Y0SE 2HIVA 2KHIA 4X66L 5C0XJ 1EQQA 2R7ZG 1GD7A 1QZHA 3DLLA 2VUMH 5GAHC 1N33Q 2V1CC 1IBKL 2ZJRA 1CKMA 3M9BA 4GN5A 1KIXA 2VNUD 1SMXA 2D0PA 2ZJPA 1NMFA 4JV5Q 1YI2A 4GOPB 1LTLA 2JEBI 1RIPA 4R1JA 2R93G 2VY3A 4LFAQ 3CCVA 3CQZH 4JI5L 3GTJH 4DV3L 3HOZG 3RN2A 2R93H 2Q2TA 2QEXA 4A4IA 3F2CA 4PZ6A 3UDIA 3G6EA 4JOIC 2UXDQ 3W1BA 3CP0A 3L7ZC 1TXYA 2ZTEA 3PV0A 3CCSA 1EQRA 5IYCG 2LSSA 3F2BA 1EWIA 5GADC 2VS1A 1XNRQ 4QL5A 2ZM6Q 1SLJA 5C0XG 1K0RA 2WP8J 3J81j 3TRZA 2HT1A 3S24A 1SROA 3OTOL 4KI0A 4X62Q 5IYBG 1N34L 4AQYL 3KDFA 4IPGA 2EXDA 4BY7G 4JYAL 4DK6C 2AHOB 1X55A 3CCUA 3IRBA 4UP9A 4DV5Q 4DR4L 2N49A 1VQNA 3D31A 1JE5A 1P8LA 1RL2A 1TWHH 2OQ0A 2VQEQ 4RG1A 1UEBA 2WAQE 2A1AA 3HOYH 1Q1BA 2AWNA 3F8TA 1DGSA 1EIYB 3AYHB 4P74A 4A3IG 4BA2I 2F4VL 1XPRA 4A3GH 4A3KG 1HNWQ 1PFSA 3E9IA 2IX1A 1S40A 3J7A5 1KD1C 1G291 3PO3G 1WCMG 1QVCA 4A3KH 4GKJL 3I7FA 3CPWA 3GTLH 1VCIA 3T1YL 3W1GA 3I56A 1VQPA 3H3VH 2UXCQ 5GROA 4DNIA 1PH2A 1KXLA 1V43A 1D7QA 4R4QA 1GO3E 3PF4A 4NPSA 2JQOA 1PVOA 1PH6A 4A3LG 4R4OA 1X9NA 1CKNA 2I5LX 1E3PA 2VL6A 2WB1E 3K81C 4JI7Q 3EIVA 4IFDJ 2R92H 4DV4Q 1PV4A 1YHAA 3RLOA 2HQLA 3BJUA 1FGUA 5IY0A 3AFPA 2Z0SA 4LF4L 2GVBA 1XMOL 1IBMQ 3CW2C 4YWKA 4UPAA 4X64Q 4LFBQ 2XGTA 2E2JH 2D0OA 4DUYL 2UUAL 1KAWA 1V1QA 3FP9A 4B3MQ 2GN5A 1PH4A 3G48A 2K75A 2D62A 3PGZA 2HHHL 3I4OA 2UUBQ 4B3RQ 1Y1VG 4LF5L 3M4OH 3PO3H 1HZCA 1Y14B 4OO1G 4LNQA 1UWVA 4IPCA 2NZOA 3H0GH 5M5YH 1J5EQ 4BXXG 1VQJA 1YVCA 5FJ8G 4DR2Q 5M3FH 1WJJA 5C44G 2WFWA 1Q82C 4MNOA 3K7AH 2Q2UA 2DGYA 4LF9L 4BXXH 2ID0A 5FJ8H 4AYBG 4JI2Q 2QA4A 5C44H 1VQ4A 4LUVA 3S16H 1BBUA 2UXBQ 3A74A 5C0XI 4GNXA 3NELA 4IPDA 4TQUS 1N32L 2Y0SG 1BBWA 3KFUA 4DR6Q 5C4XG 2F3IA 2LXKA 2ALYB 4P71A 2I5MX 4BBRH 2VQFQ 4Y52H 5C4XH 1ASZA 3T1HL 4UP8A 1VQCA 3CXCA 4HJAA 4DUZL 4DV2Q 1X56A 1IBLQ 1C0AA 3VDYA 1G6PA 4NXNQ 2OCEA 1TWAH 2K5VA 2JA7H 4POFA 2JA5G 3PF5A 4LWCA 1B8AA 2IT1A 1XNQL 2JA6G 1VQFA 4KHPQ 4X65L 2BH8A 2JA5H 1MJCA 1KRTA 5M5WH 2VZAA 4A76A 4APVA 2K5NA 3NEMA 3CMAA 1HNZL 3OYYA 4A93H 4IOCA 4LF7Q 1K3RA 2OTLA 1AE2A 2MQHA 3EN2A 1TWCH 3KYHC 4KLKA 1K73C 4JI8L 1WYDA 4DV6Q 1PH7A 1UE1A 4LF8L 2MO0A 1WI5A 5BR8L 4YHHQ 3S2HH 4JC0A 1X3FA 3F2DA 2F52A 3G4SA 4C3IH 3PSIA 4DAYB 2IX0A 2PNHA 3MEFA 1A63A 4JI1Q 1VS0A 1JT8A 3BZCA 5JJLA 2B3GA 4JI0Q 4EX5A 2R7ZH 4L5RC 3PO2G 1LYLA 1VQ7A 3RZDH 4GKKL 4GN3B 5IT9c 4BY1G 3PO2H 1HH2P 2NVYH 3PCOB 4A3EG 4A3BH 5FLXc 2A8VA 2EQSA 2WAQG 1I50H 1I3QH 4A75A 3CCJA 1N36Q 3GD7A 3PIPA 3L2PA 1T9HA 1KC8C 1C9OA 3HOZH 3S2DH 4DV0L 1IL2A 2MO1A 2Q2HA 4JI4L 4OX9L 4QQBX 4LF6Q 4J15A 4YWMA 3TEHB 2OWOA 2KCMA 1JJ2A 4JI3Q 5IYCH 3CF5A 5IP7G 3KF6A 4L5QA 4OO1I 4LFCQ 1Y1WG 3FKIG 4YY3Q 3I4MG 1WFQA 1BVSA 2R6GA 4JBMA 2JA9A 4HJ7A 1XMQQ 2UU9Q 3CCEA 1E1TA 3FKIH 5IYBH 5GQOA 5GAEC 4MTNA 4DV1L 4DR5Q 3ULLA 3TS0A 1OTCA 4B3SL 4ALPA 3RR5A 1ASYA 5EAYA 4BY7H 4DAMA 2ATWA 4K0KL 3KDFB 1YIJA 1M90C 1HNXL 4IFDI 2WB1G 1XPOA 1QVGA 1Y1WH 2K4KA 1SRUA 4GNXC 1HR0Q 4A3CG 1HZAA 1E1OA 1HZBA 1I94Q 1IZ6A 3BZKA 1V9PA 5JEAJ 3HOVG 4R4IA 1Q81C 4BBSG 3TQYA 1X65A 4OWXB 4A3CH 1MKHA 1P16A 2HIXA 1D8LA 4B3TL 3HOVH 4BBSH 2L15A 2E2HH 4GLXA 2E5LL 4A3IH 3MXNB 4DR7L 5LMNL 2UUCQ 4AH6A 1WCMH 4OXPA 1CUKA 1JB7A 1XPUA 3CMEA 4NXML 1J6QA 3K0XA 4UP7A 5AJ3Q 1VQ6A 1FVIA 1AE3A 1EOVA 1K9MC 1TWGH 2IHEA 4JI6L 4HJ5A 3A5ZB 1VQAA 3SGIA 4DKAC 4JCVE 4DV7Q 1O7IA 4DR1Q 4A3FG 2K14A 2NN6G 3K7UC 4O0AA 3S15H 5LMUQ 2YU9H 4A3LH 4X66Q 1CSQA 1XTDA 5JEAG 1FJGL 5IE8A 3ULJA 3KJOA 3I4NG 1JJGA 4LF7L 4LUOA 1K8AC 4QIWE 1A8VA 3NBHB 1IBKQ 1PYSB 1CKNB 3GTKH 5JJKA 4FDBA 3I4NH 4PZ8A 5HY6A 1QVFA 1YEZA 2RF4A 3GTMH 3S14H 3S1QH 2N78A 5E7NA 1PH1A 4IJLA 1NJIC 3ERSX 3J80i 4DR3L 4HIMA 4IPHA 3ULPA 4JI5Q 3I2ZA 3RNUA 2PQAA 3CC2A 4C2MH 1E22A 2E8GA 4JI1L 1N33L 1Y1VH 1PYBA 1Z9FA 3KF8B 1FL0A 2YYZA 4JV5L 1NY4A 1L1OA 2MFIA 5K36G 1PH8A 3HOUG 1NE3A 4LFAL 4IFDG 2CFMA 1VQKA 4RMFA 5IYDG 2DUDA 3OTOQ 1PH9A 3HOUH 1N34Q 3HOWG 3GTPH 4AQYQ 2NVXH 4OWWB 4JYAQ 3HKZE 1K83H 1GVPA 2CQOA 2JE6I 5GAGC 2I5HA 4QGUA 1M1KC 2UXDL 5JJIA 1VQBA 4GNXB 4IO9A 1YJWA 4JBKA 3L0OA 1HR0W 1XNRL 2ZM6L 1E7ZA 2EIFA 2NZHA 4DK3C 4IOAA 4P73A 2ZTDA 5J3BA 2GVAA 3LGJA 4C3JH 5IWAQ 3E0EA 1SE8A 3Q8DA 2CWAA 4YCWA 1Q8KA 1OXXK 2KHJA 1IYJB 1QUQA 4X62L 1KQSA 1OXSC 3HOXG 5C3EG 2JA6H 3KLWA 4JBJA 3H15A 4DR5L 2NVTH 2IHFA 4GS3A 5C3EH 3KJPA 4DV5L 2B63G 4A3BG 2JA8G 1PH3A 1I6HH 3U4ZA 2Z6KA 4OONA 3HFZB 5IP9G 2CKZB 3CCRA 3ICEA 1E24A 3M7NA 2JA8H 2AWOA 2OQKA 2R7FA 2E2IH 4GKJQ 3CPFA 2VQEL 2B29A 5ELNA 4A3MG 3OW2A 3TREA 3CCQA 3NENA 2AMCB 1UE5A 1EUJA 1VQ9A 4P72A 1HNWL 2C35B 1NMGA 3M4PA 3PUXA 1SR3A 1MIUA 1SN8A 2JJQA 2RHQB 1U0LA 3D0FA 3FHWA 4P75A 3KOJA 3GTGH 2LXJA 3ZJYC 2NN6I 5ELOA 1PA6A 4H02A 2UXCL 3J81i 4QY7A 1R9TH 4BY1H 4A3EH 4LF4Q 1XMOQ 3AQQA 3J81c 5M5XH 3CCLA 2UUAQ 2F4VQ 2BA0A 4HJ8A 1MJEA 2HHHQ 5LMUL 1QZGA 4JI7L 4LF5Q 3STBD 4DV4L 4GOPA 2CCZA 3GTOH 5M3MG 4TVAB 3HKSA 3GTQH 1GKHA 5M3MH 1VQ8A 1W3SA 1VQIA 5IP7H 1G51A 1IBML 3STBC 1LUZA 3U58A 4LF9Q 4WJ4A 4X64L 4LFBL 3KF6B 4B3ML 3I4MH 4R4TA 3B6YA 1A0IA 2YTVA 2CWPA 2RCNA 3A0JA 4LUZA 3UDGA 2UUBL 4B3RL 4PMWA 2PI2E 5FLMG 3CCMA 3S17H 1CKOA 1L0WA 1N32Q 1VQ5A 2QGQA 1L1OC 1YHBA 5FLMH 1J5EL 4EQ5A 1VQOA 4DR2L 3PIOA 1X54A 2N8NA 3WWVA 1U5KA 3T1HQ 4LW1A 4JI2L 4DUZQ 3RLFA 1VQGA 3PUZA 2UXBL 1JJCB 4JG2A 2MNAA 4JBWA 4GKKQ 3DM3A 1XNQQ 4DR6L 1UE7A 1N9WA 4A3JG 4X65Q 2ZTCA 4X6AH 2VQFL 1X6OA 4PG3A 4A3JH 5LMNW 1YHQA 1HNZQ 3UDFA 3K8AA 1X3EA 1H95A 2JK8A 1N8RC 3UE0A 4DV2L 1YITA 1IBLL 1PHJA 4GLAC 4NXNL 3HOYG 1VQEA 4JI8Q 1KL9A 4NB3A 5IWAL 3S1NH 1VQLA 4A3DH 4KHPL 1B70B 2YV5A 4LF8Q 2R7DA 5BR8Q 1C7YA 2K52A 4ME3A 2Z6KC 3M3YH 2H5XA 2N3SA 4A3GG 1LM0A 3HKZG 4A3FH 2A19A 4XTCS 2KBNA 3E9HA 3PUWA 3A5UA 2ASBA 1CSPA 2PMZE 1GM5A 1HJPA 3EBEA 3GDEA 2PI2A 4IJHA 3JC66 4DV6L 2YTXA 5C4JH 4HIDA 4YHHL 4C3HH 2KENA 4UY8C 3BU2A 1Q46A 1W2BA 1KRSA 5H1SE 4DV3Q 2OTJA 1S3OA 3J80c 4JI0L 4POGA 1VQDA 2K5HA 4DV0Q 3S1MH 2BA1A 4JI4Q 4OX9Q 2R92G 2PQAB 1OXUA 4DPGA 3I55A 2K50A 4JOIA 3M4QA 1YJNA 1VQHA 4L5TA 4AIMA 1N36L 1JMCA 4L5SA 4HJ9A 3RZOH 4MZ9A 3U50C 3ER0A 1OXTA 4YWLA 4A3DG 1L1OB 4HIOA 4GOPC 3M85A 5IYDH 3S1RH 3U4VA 1SFOH 1NBWA 1Q1EA 3HOWH 4DV1Q 1EYGA 3CC4A 4KHZA 4B3SQ 4LF6L 4K0KQ 3CC7A 2XTIA 3H0GG 4DR4Q 1HNXQ 1OXVA 4YCUA 1WOCA 3UDXA 4JI3L 5M3FG 1Z47A 4HIKA 1B7YB 2I0QA 4LFCL 1KHIA 2BH2A 1YZ6A 1I5FA 4YY3L 1X3GA 1AH9A 3RLNA 3CD6A 4WJ3M 2KCTA 3J7ZC 1XMQL 2UU9L 1UE6A 1K8GA 4OWTB 2ES2A 2VW9A 3HOXH 4B3TQ 3K80C 1EFWA 1YBYA 4BBRG 1QUQB 2FXQA 2IY5B 2E5LQ 1VQMA 4DR7Q 1HZ9A 1EIFA 1L2FA 2B63H 5LMNQ 4GLVB 3W5OA 3PUYA 1HR0L 3T1YQ 5IP9H 1S72A 1I94L 4NXMQ 1A62A 2RHSB 3AFQA 2JA7G 4A3MH 2ZJQA 3JAMi 4XIGS 4BA1I 3AEVA 4JI6Q 4QJFA 2JEAI 5HGQA 3PUVA 2NVQH 3RN5A 3TS2A 1Q86C 4YCVA 3JAMc 1BKBA 1YNXA 2UUCL 1YJ9A 4A93G 1PH5A 4PZ7A 1Q7YC 1Q12A 1FJGQ 5DLQE 3UE1A 1TWFH 2AKWB 1IXRA 2YTYA 4O2DA 5AJ3L 4R4CA 3G71A 1NTGA
chains in the Genus database with same CATH superfamily
2RA4A 4Y7NH 4DV7L 2Q2IA 2B2WC 2EYHA 5DAUA 2VUMG 3GTLB 2HIVA 2KHIA 1QZHA 2VUMH 5GAHC 1N33Q 1IBKL 1CKMA 3M7GA 2F0IA 1SBBB 1D2BA 2EPBA 4HSPA 1ZEQX 1LTLA 1RIPA 3CCVA 4JI5L 1KDAA 1W6JA 3GTJH 3URYA 5G3LF 4A4IA 1LT4D 1GUSA 3UDIA 3G6EA 3L7ZC 1TXYA 1FNVA 1GUNA 5IYCG 2LSSA 3F2BA 2XNAC 2VS1A 3S1RB 1XNRQ 1MHWC 3J81j 1JCKB 3QOJA 5ELDA 1R4QB 1HQRD 3OTOL 3I70A 1S5ED 1N34L 1EQTA 3KDFA 2EXDA 4QUFA 1F9SA 4V190 3CCUA 3FPUB 3IRBA 3DUZA 4NDXA 2IX3A 3P1HA 2A6HD 1STHA 1VQNA 5NUCA 3VA7A 1P8LA 1RL2A 4K2LA 1KNEA 2A6HC 1UEBA 4J1MA 2AWNA 5I9PA 1HNWQ 4A3GH 2IX1A 3J7A5 4CDCC 4GKJL 1HA6A 5FO8B 1DONA 2UXCQ 3V05A 4DNIA 1EIHA 1TWFB 1D7QA 3NWSA 1PVOA 4NPSA 2JQOA 4A93B 3EFXD 1TWCB 2MP1A 4CKBA 2EYMA 5CV8A 4JI7Q 2RSNA 1PV4A 1YHAA 3RLOA 3GQBA 1IW7D 3BG3A 5I6WA 2VUMB 1XMOL 4YWKA 1RD9D 1ZYRD 4UHVA 2XGTA 2UUAL 4DUYL 3GTPH 3FP9A 1IW7C 2HHHL 3PO2B 4B3RQ 1ZYRC 3H0GH 5I2YA 4DR2Q 3A54A 2WFWA 2JSOA 2LFNA 4MNOA 5C44G 1DD2A 2ID0A 3S2DB 4JI2Q 2H1EA 5C44H 3OPOA 1BBUA 2RDHA 4XQJA 2A73B 1NR4A 5C0XI 4GNXA 1N32L 1BBWA 3KFUA 2FMMA 2F3IA 2ALYB 5EKIA 1EU4A 2RBMA 4DFAA 4E6IA 4Y52H 1D6EC 2Z4IA 1DYQA 1RTOA 2Z1CA 1NNXA 2DNCA 3H6MA 2F3WA 1C0AA 1G6PA 3MZ5A 3MA2B 1H9MA 2B2UA 2K5VA 2JA7H 1XNQL 3TMEA 1VQFA 2CW0D 4RKBA 5EBCA 4A76A 1RCVD 1K3BC 1B9MA 5CV7A 4APVA 3CMAA 4DK1A 3OYYA 2SNMA 1U9RA 2CW0C 4LF7Q 1BCPD 1JWUD 2MPMA 4IUTA 4B9XA 1UE1A 2X69A 2NZ1D 4YHHQ 4JC0A 2F52A 1BCPC 3J7YW 3PSIA 3BDOA 2AUJD 5F2DA 3P75A 4DAYB 4EQPA 2IX0A 3MEFA 3H09A 4JI1Q 1VS0A 3BZCA 3RMHA 4JI0Q 4EX5A 3H91A 1TWGB 1IYVA 1VQ7A 3RZDH 2NVYH 2D9UA 2EY1A 4R8IA 2YU9B 1RKNA 1N36Q 3PIPA 3L2PA 3FPPA 1EY0A 3D8GA 4RHRA 1H9SA 3HOZH 3DEOA 2MO1A 1QILA 4J15A 1STGA 1FNWA 5IP7G 1H9JA 2E2DC 4HTHA 1QJOA 1RDPD 1WFQA 5C5MA 3FMCA 1AZQA 4JBMA 4HJ7A 5IYBH 3ULLA 4K0KL 3MTSA 3MVVA 2ATWA 4Q0FA 4CGYB 2BCOA 5C44B 3BZDB 2K5WA 1S4ZA 2K4KA 3G7LA 4EQOA 1PXUA 1E1OA 1U4RA 3BZKA 5DM73 1V9PA 5JEAJ 2A68D 1X65A 1LTTD 4OWXB 1MKHA 4PMBA 4XQNA 4B3TL 1AFPA 2A68C 4OIKA 2KCNA 5CBEE 4AH6A 4FNFA 1XPUA 1CUKA 3C1FA 1J6QA 4KKSA 1FVIA 1G6ZA 1EOVA 1B4OA 2IHEA 1LTGD 4HJ5A 2EY2A 1VQAA 3SGIA 4DV7Q 1WTOA 1O7IA 1KABA 3MFGA 5I9OA 4FXDA 2FMCA 4CDFC 2F03A 3TSSA 2E2IB 4A3LH 5JEAG 1XTDA 3ULJA 2J0TD 4LUOA 4QB4A 5JEAH 1IBKQ 1PYSB 2EE1A 4KY6A 1PYWD 3S14H 3S1QH 5E7NA 2F0PA 1GUTA 1A6XA 1E2ZA 4IPHA 3RZDB 4JI5Q 3I2ZA 3RNUA 2PQAA 4C2MH 1E22A 3NK9A 1R9TB 1Y1VH 4BWGB 1Z9FA 3KF8B 2YYZA 1CI3M 1HA5A 1TQOA 3K59A 3HOUG 1NE3A 3I91A 4RMFA 1I4XA 3OTOQ 3HOUH 1N34Q 3HOWG 2F0EA 2GA4B 3KK7A 1EFID 5GAGC 1GVPA 2CQOA 2JE6I 1M1KC 3GTQB 1DJRD 4HSVA 3SHLA 1YJWA 1LT3D 1H9KA 2NZHA 4DK3C 1WTVA 5J3BA 1QB5D 3K58A 3U9SA 3E0EA 5D3IB 1SE8A 3Q8DA 2KHJA 1XXGA 2TMPA 4JBJA 4DR5L 3SK6A 1LLRD 3A7AB 1C4QA 1CT1D 1A2UA 2F0OA 3HFZB 3CCRA 4GKJQ 1E24A 5JVG3 1RHPA 2OQKA 2VQEL 3OW2A 4Q5VA 2PPBC 2AMCB 3EA6A 1SYGA 4ME5A 4O42A 1ZXTA 4FP5D 3M4PA 1NMGA 2LMCB 1MIUA 1U0LA 4H7BA 4XYOA 2K03A 1PA6A 1DOKA 4H02A 4G57A 1EY8A 4NKLA 2Z6BA 1XMOQ 4X3KA 5M5XH 2UUAQ 3MC0B 2HHHQ 5LMUL 3VYRA 3HP3A 5LL6S 1QZGA 1GUOA 1PRTF 4DV4L 5ELFA 1L0YB 1W3SA 3HGBA 1LUZA 2K01A 4KV6A 4G7OC 4B3ML 2PNRC 3A0JA 1EEID 3UDGA 3HRZC 3I73A 2PI2E 5FLMG 1N32Q 2KVMA 1PZJD 1VQ5A 2B39A 1L1OC 1YHBA 5FLMH 2XRSD 3HOUB 1X54A 3WWVA 1U5KA 3D4RA 1SFOB 3T51B 3HOWB 1BOSA 1STYA 3HZXA 3RLFA 2UXBL 2WKCA 1JJCB 4NP5A 3W3AA 1XNQQ 3I8ZA 1M4VA 3R93A 2VQFL 3MEHA 3X3MA 4ZK9B 1YHQA 3UDFA 1H95A 3UE0A 1KAAA 2L11A 1YITA 3UI2A 1HPCA 5IWAL 4H0LC 3JAML 1VQLA 4RAUC 2R7DA 2F0VA 2XN9C 5A2QL 4ME3A 2Z6KC 3I90A 2N3SA 3K5OA 4K8JA 3HKZG 2RDFA 2H4OA 5KIXA 2KBNA 3E9HA 3PUWA 1CSPA 3EVQA 3GDEA 2PI2A 2NVQB 2SNSA 3JC66 5C4JH 2XIWA 1SNMA 1C8CA 1F2ZA 1RTNA 5BN5A 3OWFA 1W2BA 1GHKA 2OTJA 1S3OA 1EY9A 1KNAA 2D2CC 3H3VC 1CZWA 3I55A 1DXMA 4HCEA 4JOIA 1VQHA 4TKOB 1JMCA 4L5SA 3RZOH 2EY5A 4HIOA 2F0KA 3U4VA 3CC4A 1O78A 4HMJA 4LF6L 4K0KQ 1Z47A 3KLSX 3LX0A 1YZ6A 4YY3L 4MN3A 4CBVA 1K8OA 1A15A 1XMQL 2UU9L 4OWTB 1GUWA 1ZKOA 4B3TQ 4BBRG 1QUQB 4QIWB 2B63H 2A69D 5KNCA 1HR0L 1I94L 2IL8A 3O13A 2HUGA 2NTTA 2A69C 3QB3A 3AEVA 1BUVT 4QJFA 3TS2A 4OELB 3JAMc 3X3NA 3BDLA 4PZ7A 3A55A 5DLQE 3UE1A 2AKWB 4R4CA 2K5DA 5E3FA 4ZRZA 3VR4A 3CAMA 3HKZB 2J4XA 1BBXC 1CTMA 4DR1L 4A3KB 5A35A 1I4RA 2AQ2B 2Y0SE 4X66L 5C0XJ 1QG7A 4K6DA 1PFMA 2V1CC 4KKTA 1KIXA 2F0FA 1SMXA 2D0PA 4LAAA 1NMFA 4GOPB 2JEBI 2NWGA 2R93G 3CQZH 4DV3L 2R93H 2QEXA 3F2CA 2K1BA 3CP0A 2VXWA 3PV0A 2ZTEA 4K5XA 1EWIA 5GADC 5C3WA 1D5ZC 1SLJA 4B08A 4I7AA 5C0XG 1K0RA 4M8AA 3NXWA 2HT1A 1GUGA 4BY7G 4JYAL 4DK6C 2AHOB 1AZPA 4UP9A 1CZGA 3VR2A 2L0CA 3D31A 3S16B 4X3UA 2F0SA 1SJHD 5C6AA 1TWHH 2OQ0A 2VQEQ 2A1AA 2DJFC 4BBRB 2Y0SB 2P5ZX 3MXNA 3AYHB 4P74A 4A3IG 1XPRA 3KLSA 4WFN3 1KD1C 1S5CD 2KA7A 3MXPA 1TWAB 3GTLH 1VCIA 3W1GA 3V96A 5M5WB 3H3VH 1PH2A 2LY7A 5KGUA 3SEBA 1AN8A 4R4QA 1GO3E 4MHEA 3PIO3 4RHSA 3NBHA 1X9NA 1PFBA 1E3PA 2WB1E 1UEAB 3EIVA 5CBAE 4DV4Q 2PYKA 1FGUA 2ICIA 3R3OA 4LF4L 2GVBA 1B53A 2Q8RE 2E2JH 2D0OA 4B3MQ 1UNSA 2PO4A 2GN5A 4LF5L 1BF4A 1Y14B 1ML0D 4LNQA 1UWVA 1I50B 1YVCA 5FJ8G 2R93B 4K8IA 5FJ8H 1VQ4A 2MHVA 1DCZA 3E6ZX 2UXBQ 2PMZB 2I46A 4TQUS 3QR8A 3HS0C 1MBYA 2E76C 2I5MX 3C3LA 1DOLA 2VQFQ 4F7XA 3OHXC 1ASZA 3Q23A 3K5MA 4UP8A 4C3JG 4HJAA 2F0WA 3VDYA 4BY7B 2OCEA 4GKKL 2JA5G 3PF5A 4LWCA 2JA6G 4UDUC 4X65L 2B2YC 1MJCA 2JA5H 4FXKC 2WB1B 2BDNA 2EYPA 2CH4W 4A93H 4F87A 3BYTB 1K3RA 1TWCH 4LMQD 3E0JA 2ICEC 2NBFA 4A3IB 2MO0A 1WI5A 3S2HH 1WTXA 4H44C 3J7AF 4PV1C 4KD4A 2B3GA 1F2YA 1G2SA 4L5RC 3PO2G 3PO2H 1OO9B 1NAPA 2F0TA 4A3EG 2A8VA 4DGZA 1JOKA 2HCCA 1EY6A 3J80L 1Y8NB 5COYA 1B1ZA 1PRTB 1KC8C 3S2DH 1IL2A 5JAVA 2Q2HA 4JI4L 4OX9L 4LF6Q 5AFWA 2E2JB 4F88A 5IYCH 3CF5A 3KF6A 4OO1I 1ESRA 2L12A 3I4MG 5JPNC 4YY3Q 4KD3A 1XMQQ 2UU9Q 3CCEA 1E1TA 3TS0A 1ASYA 5EAYA 1CHPD 3KDFB 1YIJA 3K57A 4IFDI 4FVMA 5EKKA 1QVGA 5HURA 1SRUA 1HR0Q 1I94Q 1KDBA 2SEBD 3HOVG 3TQYA 2SOBA 1HRJA 1P16A 3HOVH 1SSOA 2PW7A 4K5VA 4C3JB 2B2VA 4HMIA 4OXPA 3CMEA 2JA5B 5JVH3 2JA6B 1X3PA 1AE3A 5IGFA 2R61A 1TWGH 5D3DA 4JI6L 5T1GA 1O7LA 5CR3A 3CRKC 1I6HB 4DR1Q 2AQ1B 2K14A 1EQVA 4RGNA 4Z9CB 4G7HC 2I07B 1LABA 4X66Q 2YU9H 1FJGL 2ZXPA 3S2HB 1HTPA 2IWHA 1BDOA 3KJOA 4CJ2C 1LACA 1A8VA 3J81L 1QVFA 3GTMH 1R4PB 4IJLA 3NSWA 3VYSA 5C4HA 3ULPA 2ZXOA 4RCOA 4C1NI 2E8GA 2NTSA 2O5IC 4A3EB 2PW5A 3U9OA 1HFGA 1PYBA 2OEOA 2QW7A 4JV5L 1NY4A 5EKLA 2L1BA 3EJIA 5G3LD 1B44D 4LFAL 1STAA 2L4NA 1WTRA 1JORA 4JYAQ 3BS1A 2QILA 4QGUA 2UXDL 4GNXB 4IO9A 4JBKA 1SNQA 2O5JC 1B3AA 5IODA 1NSNS 2ZM6L 3I4MB 4IOAA 4P73A 1EU3A 2HDLA 3JAME 2B2TA 4FYDA 1TS2A 1OXXK 3HOXG 1AW7A 5EPJA 3GV3A 4IUVA 2IHFA 2M9VA 3KJPA 2A74C 1HQMC 5IP9G 3ICEA 2CKZB 3HOVB 3M7NA 2R7FA 2E2IH 2XVSA 3CPFA 2B29A 5ELNA 3V2TA 4RA8A 3TREA 2JN4A 2RSOA 1UE5A 1LTRD 4P72A 3PUXA 1UUPA 4KJOA 3LWEA 1SN8A 2JJQA 5EPKA 3D0FA 1G8ZD 3FHWA 4KHVA 4KTAA 1EEFD 2NN6I 5CYUA 1R9TH 1CQVA 3GP7A 4LF4Q 4X3SA 3J81c 4LJZC 1E0BA 1MJEA 3GTMB 2PQEA 4LF5Q 4LK1C 4K5WA 2RDGA 1H9SB 1TS3A 3STBD 5LL6X 4WJWA 3GTQH 2XSCA 1VQIA 5IP7H 3STBC 3U58A 2B8GA 1X32A 4LFBL 4R4TA 2CWPA 2RCNA 2UUBL 3QWNA 5EBDA 1L0WA 2WKDA 2MJ8A 1J5EL 4EQ5A 1V8QA 3PIOA 2F1MA 2N8NA 4WRDA 2WIIB 4LW1A 3KBGA 2EJGC 1VQGA 3PUZA 4QF4A 4GKKQ 2MUYA 3DM3A 2FFKB 4DR6L 1DZ1A 1N9WA 3OW7A 1LV9A 4X65Q 1JC7A 1IL8A 3ND8A 1EZ6A 1N8RC 1CM9A 1JOOA 4DV2L 1HFNA 3HOXB 4NXNL 1B9NA 3HOYG 4NB3A 2Q8IB 4KHPL 3E5SA 5I6YA 1C7YA 2K04A 2QDLA 1V1OA 4CHTB 2FINB 4XTCS 3A5UA 2B2WA 2ASBA 5J1ZA 4DAVA 4IJHA 2K7VA 2AUKA 5J39A 2EZVA 3C1EA 2ENBA 2X6LA 1Q46A 5H1SE 1B50A 3ITPA 1XX8A 2XRQD 4POGA 1D1IA 2EJMA 2K5HA 4JI4Q 4OX9Q 2R92G 2PQAB 4DN4M 3AMUA 2CH4A 3M4QA 1AEXA 5LHY1 2JYOA 4YWLA 4A3DG 1VF7A 4GOPC 3TBIB 3VYTA 1MD2D 1SFOH 1NBWA 4XQQA 3HOWH 1EYGA 4KHZA 1JWSD 3CC7A 2EYJA 2WACA 1UAPA 4HIKA 5M3FG 2I0QA 3H94A 1O80A 1KHIA 2BH2A 1I5FA 4XT1B 3RLNA 4WJ3M 1UE6A 1K8GA 4QMGA 3K80C 1EFWA 1YBYA 1JE4A 1MSGA 1BR9A 4RCNA 2F0LA 1WTWA 3IKJA 1SAPA 1HZ9A 1PZID 1SMYD 3A7LA 1S72A 1SMYC 3SXHA 3JAMi 4KK7A 4BA1I 4JI6Q 1IHZA 5HGQA 2NVQH 4YCVA 2ZXRA 1KDCA 2KOLA 1YNXA 5IGEA 2UUCL 1YJ9A 1PH5A 3NHHA 2G5DA 1FJGQ 3HOYB 4O2DA 3R8BA 1NTGA 2VW9A 3G6JB 3GO5A 5EGTA 4AYBE 1A3TA 2BOSA 2F4IA 4DUYQ 4IQZA 1XJVA 1YNND 2K28A 2R7ZG 1GD7A 3OWEB 3DLLA 1W6KA 1YNNC 3M9BA 4GN5A 2Z9HA 1KTKA 4ZQ3A 2ZJPA 4JV5Q 1YI2A 1KLGD 2B8FA 4R1JA 2VY3A 4LFAQ 3ONAB 4DA2A 2R92B 2Q2TA 3NBIA 4U673 4PZ6A 5JOBA 2UXDQ 3W1BA 2L9HA 3QIAA 3CCSA 1EQRA 5DEHA 2ZM6Q 1LTAD 4A3DB 4FO2A 5ELBA 3A56A 4FF1A 5L37A 2EVBA 5M5YB 1MGSA 4AQYL 4EQNA 1DOMA 5FKAC 2WINB 1X55A 5M3FB 1SYCA 3K7AB 2EJFC 4DR4L 2N49A 4I65A 2OT2A 1PTOF 1JE5A 3HEJA 2WAQE 1Q1BA 2DY7A 3F8TA 1EIYB 1QWYA 4BA2I 3C46A 4A3KG 4DNRB 1WCMG 4ZUIA 1QVCA 4A3KH 1ICWA 4I7ZC 3T1YL 1VQPA 1GXDC 4XDXA 1KXLA 1V43A 3PF4A 1FD7D 4J8QA 1XWEA 5IT9L 1CKNA 5T1IA 2I5LX 3NWTA 3K81C 5FLXL 4GZYC 4IFDJ 3MHBA 4MTKA 1ENCA 3BJUA 3W2DA 1A3UA 5IY0A 3L9AX 1QOHA 4LFBQ 2R7ZB 1PRTD 3TP7A 5EPLA 2F4VL 4G7ZC 3PO3G 1V1QA 3PGZA 2UUBQ 1EWHA 1WD1A 3M4OH 3PO3H 1HZCA 4OO1G 1PRTC 1I3QB 2A5HA 2NZOA 1J5EQ 4BXXG 1FYCA 5ELCA 3T16A 3D6WA 2Q2UA 4LF9L 2DGYA 4BXXH 4OGQC 4LUVA 3S16H 2QCPX 2KECA 4DF7A 2J7ZA 2Y0SG 4DR6Q 3I3CA 2LXKA 4P71A 4BBRH 2L5TA 5KNDA 3VA5A 4IUUA 1VQCA 4DUZL 4DV2Q 1X56A 1II3A 4NXNQ 1TWAH 2K5QA 4KHPQ 2IT1A 1CA6A 3CKIB 2BH8A 1KRTA 5M5WH 4RGMA 3RD4A 1HNZL 1VMCA 4IOCA 2OTLA 2MQHA 4KLKA 3J81E 1K73C 4U68A 4JI8L 2E2HB 1WYDA 1PH7A 4LF8L 3I4LA 3F2DA 3G4SA 2JXMB 3VYUA 1WCMB 1Q90A 1A63A 1BO0A 1TU2B 1V1PA 5JJLA 1TKWB 5JPMC 1TY0A 3A8IE 2K6AA 5I4DA 5IT9c 4BY1G 1HH2P 5IGDA 5FLXc 1D5XC 1TS5A 1I50H 1LTBD 4ULLA 4PNYA 3GD7A 1C9OA 3OOCA 4QUCA 4DV0L 2F0NA 4QQBX 5E4XA 3TEHB 2OWOA 1JJ2A 2BDOA 4IZ8A 4CKEA 3KUPA 2EYOA 4L5QA 3PO3B 3M4OB 5C0XH 3FKIG 2VB3X 2EYLA 4KN4C 3FKIH 4DR5Q 1OTCA 2VNUD 4MTNA 4BY7H 2NB0A 4ALPA 3RR5A 2CVRA 5D14A 2C9OA 3OSOA 5K5PA 1EL0A 1JR0D 2WB1G 2EDGA 1BNZA 1LT5D 2X6GA 4GNXC 1ILQA 1HZAA 1HZBA 2DN8A 1ET6A 1STEA 3Q6SA 1K83B 1QNKA 4BBSG 4R4IA 2HIXA 1D8LA 1HUNA 1EY5A 4BBSH 2L15A 4A3IH 3MXNB 4DR7L 5LMNL 2UUCQ 2B2UC 2F0HA 1JB7A 1VQ6A 1K9MC 2NVTB 3QO2A 5ISRA 1IYUA 4JCVE 3G71A 4CDDC 1Z6HA 4A3FG 2KUMA 4L63B 2NN6G 3K7UC 4O0AA 4RGOS 4FF2A 5LMUQ 3IFDA 1CSQA 3J7AV 5IE8A 3IAYA 1JJGA 4LF7L 1K8AC 2PZUA 3NBHB 5HGTA 3GTKH 3R2IA 4PZ8A 1YEZA 2EXZA 2F0MA 1PH1A 1NJIC 3J80i 4DR3L 3GTGB 3CC2A 1XTCD 2Z4HA 4JI1L 4BY1B 5TSSA 4N8FA 1HCZA 1FL0A 5CV5A 3BVZA 1L0XB 1L1OA 1FNUA 1SNOA 5K36G 5IYDG 1PH9A 4AQYQ 4OWWB 4ZCKA 3Q24A 4RKLA 3L0OA 1HR0W 3FKIB 2ZTDA 2NYZD 1SDFA 4C3JH 5IWAQ 3S17B 2IJ0A 2CWAA 4X62L 1KQSA 1OXSC 3P20A 4IUNA 4JW0A 2JA6H 3KLWA 3LNNA 4GS3A 4A3BG 4DV5L 4K14A 2IPKD 4ZLTF 5CMDA 1PH3A 2JA8G 1I6HH 4A3BH 2Z6KA 4OONA 2N88A 3DWQA 3VR6A 4BBSB 4B9WA 1ET9A 2JA8H 1TS4A 4A3MG 1H9RA 4ILWA 3NENA 1I4PA 4A3JB 5C3XA 1VQ9A 5C4ZA 3PQIA 1CQFA 3DWPA 1SR3A 5E1FA 3S1NB 4OIJA 4P75A 3KOJA 2Q8TA 2LXJA 5ELOA 3M3YB 3J81i 4A3FB 1BXTA 4A3EH 2KCCA 3AQQA 3SK8A 4XT3B 3GTKB 1S5BD 1I4QA 4QCLA 2F4VQ 1J8IA 3NP8A 2BA0A 3MWYW 1LTID 3QJYA 1SYDA 2CCZA 3GTOH 3EROA 4PQXA 1VQ8A 4WJ4A 5IGBA 4LF9Q 1IBML 4X64L 3S1MB 3KF6B 3L3OC 4IURA 3I4MH 3B6YA 1A0IA 1ENFA 2YTVA 3D4DA 4LUZA 1SYFA 1QE6A 4PMWA 3CCMA 1CKOA 2PCFB 4DK0A 2K05A 3D6CA 1B2TA 4DUZQ 1EIGA 1UE7A 3M4YA 2ZTCA 2IW3A 1PTOB 3I72A 1WVLA 5LMNW 1HNZQ 3DM1A 4CJ1B 3K8AA 2JK8A 2M00A 1IBLL 3FDTA 3Q22A 4JI8Q 1ICFB 4HCSA 1RF2D 1B70B 2YV5A 4LF8Q 5IGGA 4L8JA 1BCPF 1PMRA 4A3BB 5FO9B 2K52A 2HDMA 2H5XA 2JA8B 4A3GG 1LM0A 3D4WA 3FEWX 4ODGA 4A3MB 3NTIA 2K32A 3RUZA 1HJPA 2RKSA 3EBEA 4K6LA 3LWUA 4C3HG 4DV6L 2YTXA 2LS01 4C3HH 3BU2A 3SK4A 4DV3Q 4XXEA 5CGKA 3J80c 1JICA 1VQDA 4DV0Q 2BA1A 4C56C 4Y7NB 1SYEA 1SJED 4DPGA 3A8JE 4AIMA 1A2TA 4MZ9A 3GTOB 2KJXA 2NUCA 1Q1EA 3VR3A 2V4DA 3TP8A 5KNBA 4OL7A 2KQ3A 3H0GG 3AU7A 3OMCA 2CHBD 3NE5B 4YCUA 1WOCA 2A6ED 4JI3L 1B7YB 5KYIA 3GTJB 4LFCL 1X3GA 1AH9A 5A2QE 4IALA 2EOTA 2A6EC 3P7JA 4P2CB 2KCTA 3J7ZC 1TY2A 4IUPA 2ES2A 1JOQA 3QG1A 4J6HA 1U4PA 3HOXH 3MAQA 2IY5B 1VQMA 4DR7Q 3CU7A 1EIFA 1L2FA 3F2UA 5LMNQ 4GLVB 2JP1A 1F9PA 5IP9H 1A62A 2RHSB 3K6OA 2JA7G 2ZJQA 5EJWA 2JEAI 3EQLC 3PUVA 3RN5A 2PZWA 4N9PA 2DNEA 4M1UB 5IT9E 1NUCA 5FLXE 1Q12A 1Q7YC 3IFTA 5CV6A 2YTYA 5AJ3L 4GN4B 4A3GB 2FHTA 4DAYA 3F1ZA 1I6VC 3H3VI 1I4GA 4DR3Q 1EQQA 1QNUA 4C3HB 2ZJRA 4KKUA 2QKIC 1K8MA 1SNPA 1FGBD 5FK9C 5D65A 3WOFA 2O2LD 1EYAA 3RN2A 3HOZG 1ILPA 4F8MA 2MGSA 1K0SA 4JOIC 1I4HA 2F0QA 4QL5A 3GTPB 2WP8J 3TRZA 1F2LA 5KYLA 3S24A 1SROA 1D1KA 4RFBA 1Q8IA 2QEJC 4KI0A 4L6TB 5IYBG 4X62Q 1SNDA 3H0GB 4IPGA 1VF5C 1J9OA 3T13A 4DV5Q 1F9RA 5CORA 2B2YA 4KY5A 3ZYYX 2FJ2A 4RG1A 4X3TA 3WDNA 3HOYH 1DGSA 4UAIA 3T56B 1PFSA 3E9IA 1S40A 2KEEA 1G291 2F0JA 2HCIA 1PZKD 3OIQA 2JA7B 3I7FA 3CPWA 3I56A 3NTKA 1TR5A 5GROA 2M2LA 3SDZA 5I2XA 1GHJA 4CKCA 1PH6A 4A3LG 4R4OA 4G4KA 1T5EA 2PZTA 3CHBD 2VL6A 2R92H 1Q3LA 3SE0A 2HQLA 3AFPA 2Z0SA 1IBMQ 3CW2C 2RQXA 1U4MA 4UPAA 4X64Q 3NQTA 3SVMA 1KAWA 4A3DH 1PH4A 3G48A 2K75A 2D62A 3I4OA 3KF8A 3PMFA 1Y1VG 2NVYB 2RVLA 5M5YH 4IPCA 1VQJA 4ID6A 1WJJA 4HEDA 5M3FH 1Q82C 3K7AH 1EY4A 3HOZB 1Y69U 4AYBG 2QA4A 1MSHA 4FF4A 1JQYD 3A74A 3NELA 4IPDA 1T5XD 5C4XG 4OEMB 1F9QA 1RJTA 4JVZA 2KHSA 5C4XH 1HUMA 4PMCA 3T1HL 1GOZA 1EWCA 3CXCA 1IBLQ 4EVOA 3DMUA 4POFA 1B8AA 1CHQD 1D5MC 2BE5D 1TIID 5IGCA 2VZAA 3MXGA 1E2VA 4RWSC 2K5NA 3NEMA 5M9OA 1PLFA 2D5DA 3NQIA 2BE5C 3S9WA 1AE2A 3EN2A 3KYHC 4WORA 2Z8LA 1NR2A 1G91A 2VB2X 3DEPA 4DV6Q 4C3IG 5DM63 5BR8L 1X3FA 4C3IH 4RGTA 1M8AA 1JT8A 2PNHA 3K0YA 2R7ZH 4DU9A 1LYLA 4GN3B 3KLRA 3PCOB 2EQSA 2WAQG 1I3QH 4A75A 3CCJA 2L55A 1SNCA 2F0GA 1C48A 1T9HA 1A3VA 3AB9A 3C2PA 1LO5D 4YIJA 3S14B 3S1QB 1HXYD 4YWMA 1STBA 3TZDA 2KCMA 2E74C 4JI3Q 5KEEA 1SXTA 1SE3A 4C2MB 1ONLA 1WTHA 4LFCQ 1Y1WG 5CV4A 2R6GA 1BVSA 1Y1VB 1Z7TA 4H13C 1JWMD 2JA9A 4XYQA 1Y1WH 5GAEC 4DV1L 4R8NA 5GQOA 2QDBA 4B3SL 4ABNA 4DAMA 1HNXL 1M90C 1XPOA 3ND9A 4AYBB 4KMUC 1HTLD 1PDQA 4A3CG 4K2KA 2F3VA 1IZ6A 2G9DA 1Q81C 4A3CH 5C4XB 1LT6D 2E2HH 1NCVA 4GLXA 2E5LL 4HR7B 1IKMA 1SEBD 3FRPB 1WCMH 3R2TA 4NXML 3BDCA 3IL8A 1E2WA 3K0XA 4UP7A 4IN3A 5AJ3Q 4ZKBB 1BCPB 3J80E 1F2MA 3BVMA 3A5ZB 3DHQA 4DKAC 5JJZA 3S15H 5J22A 3N52A 3K5NA 3I4NG 1STNA 2F0DA 3VR5A 4QIWE 4C3IB 5JJKA 1CKNB 3Q0AA 4FDBA 4TSSA 3I4NH 5HY6A 2RF4A 3TP6A 2N78A 1Y8OB 3D3RA 3ERSX 1S5FD 1CFMA 4BS9A 4HIMA 2O4XA 3GV6A 2WV6D 1FR3A 1N33L 5ELEA 4OO1H 1PFNA 2OF1A 3CRLC 4OHJA 3T53B 2WAQB 2ZT9C 4IUQA 5M5XB 4N8X1 2MFIA 4DNTB 1PH8A 4JK1C 4IFDG 2CFMA 1VQKA 2DUDA 3DXJC 5EQ0A 4IFDH 2SDFA 2NVXH 3TDQA 5CC4A 3HKZE 1K83H 2I5HA 5JJIA 1VQBA 2DY8A 3HG9A 4O1NA 1XNRL 1E7ZA 2EIFA 1Y1WB 2GVAA 1EYCA 3BVGA 3LGJA 4YCWA 1Q8KA 1IYJB 1QUQA 4V0BA 1DM0B 5C3EG 5KRUA 3H15A 4ZYSA 1KLUD 2NVTH 1PTOD 1GJXA 3NPPA 5C3EH 2B63G 4RH6A 1O7ZA 3SR1A 3U4ZA 1PTOC 2AWOA 2E75C 1CK1A 1EZ8A 3CCQA 1WD0A 2B2VC 1EUJA 1WTQA 1HNWL 2C35B 3NTHA 4C1NK 2RHQB 4KN7C 1TT2A 4ZUJA 1VDZA 2HD3A 3GTGH 3ZJYC 4DXGA 1V1PB 2XWBB 2UXCL 3S15B 4QY7A 1SE2A 4BY1H 1B3QA 5FO7B 3CCLA 3I4NB 1YNJD 4HJ8A 4JI7L 5BN3A 5C4JB 4GOPA 5M3MG 4TVAB 1YNJC 1TVXA 3HKSA 1GKHA 5M3MH 1MI2A 1G51A 3MXUA 2DJGC 2RCFA 1ESFA 2C5CA 3WOEA 4B3RL 3S17H 3FVQA 1IKLA 1EY7A 2QGQA 2G9HD 1QCBD 1VQOA 4DR2L 3RZOB 2NVXB 1JB3A 5FOBB 2N55A 3T1HQ 4KJNA 4FF3A 5BN4A 4JI2L 4TRDA 4MIUA 3N6RA 4JG2A 2MNAA 4JBWA 1SE4A 2R3ZA 1CA5A 4NW2A 1EYDA 4A3JG 4DXFA 4HAEA 4X6AH 1X6OA 4N9TA 2B2TC 2CQAA 4PG3A 4A3JH 4ZKCB 1X3EA 3NUCA 3PIP3 1F77A 1PHJA 4GLAC 5C3EB 1VQEA 3S1NH 1KL9A 4HN7A 5IOCA 3A8KE 5BR8Q 2B63B 3M3YH 1SYBA 3E3XA 3K5LA 4A3FH 1EOTA 2NN6H 2A19A 1S5DD 2KEDA 1U4LA 4NMZA 2PMZE 4JPBW 1GM5A 3BYYB 5CV9A 2K33A 3OIPA 4HIDA 4YHHL 2KENA 4DAPA 2LKVA 3T4AC 4UY8C 4KY7A 1AP0A 1XYIA 1KRSA 3OMGA 2HQEA 2QF7A 3TZUA 4JI0L 3S1MH 1OXUA 2K50A 1RODA 1YJNA 1X3QA 2OXPA 4L5TA 1N36L 5K36H 4HJ9A 3U50C 3ER0A 1OXTA 3ERQA 1L1OB 3M85A 5IYDH 3SK5A 3S1RH 5M3MB 4DV1Q 4FXGC 4B3SQ 1LTSD 2XTIA 4CDEC 4DR4Q 5E4WC 1VMPA 4S3SA 1OXVA 4EGVA 1HNXQ 1HHVA 3UDXA 1Y8PB 3CQZB 2AQ3B 1PTOH 5C5LA 1G2TA 3CD6A 3TN2A 1WTPA 3DWAA 2FXQA 1K28A 5DNFA 2E5LQ 4R9WA 2EY6A 3W5OA 3KBXA 3PUYA 4CJ0B 3T1YQ 1ENAA 4NXMQ 1O7YA 2EYFA 3AFQA 4A3MH 4XIGS 3MFYA 1Q86C 1BKBA 1TWHB 4A93G 2TSSA 1TWFH 1IXRA 3QOLA 5IIFA 1BQQT 4ZAIA 3TP5A 2XWJB 2F0UA
chains in the Genus database with same CATH topology
3GO5A 4GN4B 4AYBE 4Y7NH 3CAMA 4DV7L 2Q2IA 3F1ZA 4DR1L 3H3VI 4DUYQ 1XJVA 4DR3Q 2VUMG 2Y0SE 2HIVA 2KHIA 4X66L 5C0XJ 1EQQA 2R7ZG 1GD7A 1QZHA 3DLLA 2VUMH 5GAHC 1N33Q 2V1CC 1IBKL 2ZJRA 1CKMA 3M9BA 4GN5A 1KIXA 2VNUD 1SMXA 2D0PA 2ZJPA 1NMFA 4JV5Q 1YI2A 4GOPB 1LTLA 2JEBI 1RIPA 4R1JA 2R93G 2VY3A 4LFAQ 3CCVA 3CQZH 4JI5L 3GTJH 4DV3L 3HOZG 3RN2A 2R93H 2Q2TA 2QEXA 4A4IA 3F2CA 4PZ6A 3UDIA 3G6EA 4JOIC 2UXDQ 3W1BA 3CP0A 3L7ZC 1TXYA 2ZTEA 3PV0A 3CCSA 1EQRA 5IYCG 2LSSA 3F2BA 1EWIA 5GADC 2VS1A 1XNRQ 4QL5A 2ZM6Q 1SLJA 5C0XG 1K0RA 2WP8J 3J81j 3TRZA 2HT1A 3S24A 1SROA 3OTOL 4KI0A 4X62Q 5IYBG 1N34L 4AQYL 3KDFA 4IPGA 2EXDA 4BY7G 4JYAL 4DK6C 2AHOB 1X55A 3CCUA 3IRBA 4UP9A 4DV5Q 4DR4L 2N49A 1VQNA 3D31A 1JE5A 1P8LA 1RL2A 1TWHH 2OQ0A 2VQEQ 4RG1A 1UEBA 2WAQE 2A1AA 3HOYH 1Q1BA 2AWNA 3F8TA 1DGSA 1EIYB 3AYHB 4P74A 4A3IG 4BA2I 2F4VL 1XPRA 4A3GH 4A3KG 1HNWQ 1PFSA 3E9IA 2IX1A 1S40A 3J7A5 1KD1C 1G291 3PO3G 1WCMG 1QVCA 4A3KH 4GKJL 3I7FA 3CPWA 3GTLH 1VCIA 3T1YL 3W1GA 3I56A 1VQPA 3H3VH 2UXCQ 5GROA 4DNIA 1PH2A 1KXLA 1V43A 1D7QA 4R4QA 1GO3E 3PF4A 4NPSA 2JQOA 1PVOA 1PH6A 4A3LG 4R4OA 1X9NA 1CKNA 2I5LX 1E3PA 2VL6A 2WB1E 3K81C 4JI7Q 3EIVA 4IFDJ 2R92H 4DV4Q 1PV4A 1YHAA 3RLOA 2HQLA 3BJUA 1FGUA 5IY0A 3AFPA 2Z0SA 4LF4L 2GVBA 1XMOL 1IBMQ 3CW2C 4YWKA 4UPAA 4X64Q 4LFBQ 2XGTA 2E2JH 2D0OA 4DUYL 2UUAL 1KAWA 1V1QA 3FP9A 4B3MQ 2GN5A 1PH4A 3G48A 2K75A 2D62A 3PGZA 2HHHL 3I4OA 2UUBQ 4B3RQ 1Y1VG 4LF5L 3M4OH 3PO3H 1HZCA 1Y14B 4OO1G 4LNQA 1UWVA 4IPCA 2NZOA 3H0GH 5M5YH 1J5EQ 4BXXG 1VQJA 1YVCA 5FJ8G 4DR2Q 5M3FH 1WJJA 5C44G 2WFWA 1Q82C 4MNOA 3K7AH 2Q2UA 2DGYA 4LF9L 4BXXH 2ID0A 5FJ8H 4AYBG 4JI2Q 2QA4A 5C44H 1VQ4A 4LUVA 3S16H 1BBUA 2UXBQ 3A74A 5C0XI 4GNXA 3NELA 4IPDA 4TQUS 1N32L 2Y0SG 1BBWA 3KFUA 4DR6Q 5C4XG 2F3IA 2LXKA 2ALYB 4P71A 2I5MX 4BBRH 2VQFQ 4Y52H 5C4XH 1ASZA 3T1HL 4UP8A 1VQCA 3CXCA 4HJAA 4DUZL 4DV2Q 1X56A 1IBLQ 1C0AA 3VDYA 1G6PA 4NXNQ 2OCEA 1TWAH 2K5VA 2JA7H 4POFA 2JA5G 3PF5A 4LWCA 1B8AA 2IT1A 1XNQL 2JA6G 1VQFA 4KHPQ 4X65L 2BH8A 2JA5H 1MJCA 1KRTA 5M5WH 2VZAA 4A76A 4APVA 2K5NA 3NEMA 3CMAA 1HNZL 3OYYA 4A93H 4IOCA 4LF7Q 1K3RA 2OTLA 1AE2A 2MQHA 3EN2A 1TWCH 3KYHC 4KLKA 1K73C 4JI8L 1WYDA 4DV6Q 1PH7A 1UE1A 4LF8L 2MO0A 1WI5A 5BR8L 4YHHQ 3S2HH 4JC0A 1X3FA 3F2DA 2F52A 3G4SA 4C3IH 3PSIA 4DAYB 2IX0A 2PNHA 3MEFA 1A63A 4JI1Q 1VS0A 1JT8A 3BZCA 5JJLA 2B3GA 4JI0Q 4EX5A 2R7ZH 4L5RC 3PO2G 1LYLA 1VQ7A 3RZDH 4GKKL 4GN3B 5IT9c 4BY1G 3PO2H 1HH2P 2NVYH 3PCOB 4A3EG 4A3BH 5FLXc 2A8VA 2EQSA 2WAQG 1I50H 1I3QH 4A75A 3CCJA 1N36Q 3GD7A 3PIPA 3L2PA 1T9HA 1KC8C 1C9OA 3HOZH 3S2DH 4DV0L 1IL2A 2MO1A 2Q2HA 4JI4L 4OX9L 4QQBX 4LF6Q 4J15A 4YWMA 3TEHB 2OWOA 2KCMA 1JJ2A 4JI3Q 5IYCH 3CF5A 5IP7G 3KF6A 4L5QA 4OO1I 4LFCQ 1Y1WG 3FKIG 4YY3Q 3I4MG 1WFQA 1BVSA 2R6GA 4JBMA 2JA9A 4HJ7A 1XMQQ 2UU9Q 3CCEA 1E1TA 3FKIH 5IYBH 5GQOA 5GAEC 4MTNA 4DV1L 4DR5Q 3ULLA 3TS0A 1OTCA 4B3SL 4ALPA 3RR5A 1ASYA 5EAYA 4BY7H 4DAMA 2ATWA 4K0KL 3KDFB 1YIJA 1M90C 1HNXL 4IFDI 2WB1G 1XPOA 1QVGA 1Y1WH 2K4KA 1SRUA 4GNXC 1HR0Q 4A3CG 1HZAA 1E1OA 1HZBA 1I94Q 1IZ6A 3BZKA 1V9PA 5JEAJ 3HOVG 4R4IA 1Q81C 4BBSG 3TQYA 1X65A 4OWXB 4A3CH 1MKHA 1P16A 2HIXA 1D8LA 4B3TL 3HOVH 4BBSH 2L15A 2E2HH 4GLXA 2E5LL 4A3IH 3MXNB 4DR7L 5LMNL 2UUCQ 4AH6A 1WCMH 4OXPA 1CUKA 1JB7A 1XPUA 3CMEA 4NXML 1J6QA 3K0XA 4UP7A 5AJ3Q 1VQ6A 1FVIA 1AE3A 1EOVA 1K9MC 1TWGH 2IHEA 4JI6L 4HJ5A 3A5ZB 1VQAA 3SGIA 4DKAC 4JCVE 4DV7Q 1O7IA 4DR1Q 4A3FG 2K14A 2NN6G 3K7UC 4O0AA 3S15H 5LMUQ 2YU9H 4A3LH 4X66Q 1CSQA 1XTDA 5JEAG 1FJGL 5IE8A 3ULJA 3KJOA 3I4NG 1JJGA 4LF7L 4LUOA 1K8AC 4QIWE 1A8VA 3NBHB 1IBKQ 1PYSB 1CKNB 3GTKH 5JJKA 4FDBA 3I4NH 4PZ8A 5HY6A 1QVFA 1YEZA 2RF4A 3GTMH 3S14H 3S1QH 2N78A 5E7NA 1PH1A 4IJLA 1NJIC 3ERSX 3J80i 4DR3L 4HIMA 4IPHA 3ULPA 4JI5Q 3I2ZA 3RNUA 2PQAA 3CC2A 4C2MH 1E22A 2E8GA 4JI1L 1N33L 1Y1VH 1PYBA 1Z9FA 3KF8B 1FL0A 2YYZA 4JV5L 1NY4A 1L1OA 2MFIA 5K36G 1PH8A 3HOUG 1NE3A 4LFAL 4IFDG 2CFMA 1VQKA 4RMFA 5IYDG 2DUDA 3OTOQ 1PH9A 3HOUH 1N34Q 3HOWG 3GTPH 4AQYQ 2NVXH 4OWWB 4JYAQ 3HKZE 1K83H 1GVPA 2CQOA 2JE6I 5GAGC 2I5HA 4QGUA 1M1KC 2UXDL 5JJIA 1VQBA 4GNXB 4IO9A 1YJWA 4JBKA 3L0OA 1HR0W 1XNRL 2ZM6L 1E7ZA 2EIFA 2NZHA 4DK3C 4IOAA 4P73A 2ZTDA 5J3BA 2GVAA 3LGJA 4C3JH 5IWAQ 3E0EA 1SE8A 3Q8DA 2CWAA 4YCWA 1Q8KA 1OXXK 2KHJA 1IYJB 1QUQA 4X62L 1KQSA 1OXSC 3HOXG 5C3EG 2JA6H 3KLWA 4JBJA 3H15A 4DR5L 2NVTH 2IHFA 4GS3A 5C3EH 3KJPA 4DV5L 2B63G 4A3BG 2JA8G 1PH3A 1I6HH 3U4ZA 2Z6KA 4OONA 3HFZB 5IP9G 2CKZB 3CCRA 3ICEA 1E24A 3M7NA 2JA8H 2AWOA 2OQKA 2R7FA 2E2IH 4GKJQ 3CPFA 2VQEL 2B29A 5ELNA 4A3MG 3OW2A 3TREA 3CCQA 3NENA 2AMCB 1UE5A 1EUJA 1VQ9A 4P72A 1HNWL 2C35B 1NMGA 3M4PA 3PUXA 1SR3A 1MIUA 1SN8A 2JJQA 2RHQB 1U0LA 3D0FA 3FHWA 4P75A 3KOJA 3GTGH 2LXJA 3ZJYC 2NN6I 5ELOA 1PA6A 4H02A 2UXCL 3J81i 4QY7A 1R9TH 4BY1H 4A3EH 4LF4Q 1XMOQ 3AQQA 3J81c 5M5XH 3CCLA 2UUAQ 2F4VQ 2BA0A 4HJ8A 1MJEA 2HHHQ 5LMUL 1QZGA 4JI7L 4LF5Q 3STBD 4DV4L 4GOPA 2CCZA 3GTOH 5M3MG 4TVAB 3HKSA 3GTQH 1GKHA 5M3MH 1VQ8A 1W3SA 1VQIA 5IP7H 1G51A 1IBML 3STBC 1LUZA 3U58A 4LF9Q 4WJ4A 4X64L 4LFBL 3KF6B 4B3ML 3I4MH 4R4TA 3B6YA 1A0IA 2YTVA 2CWPA 2RCNA 3A0JA 4LUZA 3UDGA 2UUBL 4B3RL 4PMWA 2PI2E 5FLMG 3CCMA 3S17H 1CKOA 1L0WA 1N32Q 1VQ5A 2QGQA 1L1OC 1YHBA 5FLMH 1J5EL 4EQ5A 1VQOA 4DR2L 3PIOA 1X54A 2N8NA 3WWVA 1U5KA 3T1HQ 4LW1A 4JI2L 4DUZQ 3RLFA 1VQGA 3PUZA 2UXBL 1JJCB 4JG2A 2MNAA 4JBWA 4GKKQ 3DM3A 1XNQQ 4DR6L 1UE7A 1N9WA 4A3JG 4X65Q 2ZTCA 4X6AH 2VQFL 1X6OA 4PG3A 4A3JH 5LMNW 1YHQA 1HNZQ 3UDFA 3K8AA 1X3EA 1H95A 2JK8A 1N8RC 3UE0A 4DV2L 1YITA 1IBLL 1PHJA 4GLAC 4NXNL 3HOYG 1VQEA 4JI8Q 1KL9A 4NB3A 5IWAL 3S1NH 1VQLA 4A3DH 4KHPL 1B70B 2YV5A 4LF8Q 2R7DA 5BR8Q 1C7YA 2K52A 4ME3A 2Z6KC 3M3YH 2H5XA 2N3SA 4A3GG 1LM0A 3HKZG 4A3FH 2A19A 4XTCS 2KBNA 3E9HA 3PUWA 3A5UA 2ASBA 1CSPA 2PMZE 1GM5A 1HJPA 3EBEA 3GDEA 2PI2A 4IJHA 3JC66 4DV6L 2YTXA 5C4JH 4HIDA 4YHHL 4C3HH 2KENA 4UY8C 3BU2A 1Q46A 1W2BA 1KRSA 5H1SE 4DV3Q 2OTJA 1S3OA 3J80c 4JI0L 4POGA 1VQDA 2K5HA 4DV0Q 3S1MH 2BA1A 4JI4Q 4OX9Q 2R92G 2PQAB 1OXUA 4DPGA 3I55A 2K50A 4JOIA 3M4QA 1YJNA 1VQHA 4L5TA 4AIMA 1N36L 1JMCA 4L5SA 4HJ9A 3RZOH 4MZ9A 3U50C 3ER0A 1OXTA 4YWLA 4A3DG 1L1OB 4HIOA 4GOPC 3M85A 5IYDH 3S1RH 3U4VA 1SFOH 1NBWA 1Q1EA 3HOWH 4DV1Q 1EYGA 3CC4A 4KHZA 4B3SQ 4LF6L 4K0KQ 3CC7A 2XTIA 3H0GG 4DR4Q 1HNXQ 1OXVA 4YCUA 1WOCA 3UDXA 4JI3L 5M3FG 1Z47A 4HIKA 1B7YB 2I0QA 4LFCL 1KHIA 2BH2A 1YZ6A 1I5FA 4YY3L 1X3GA 1AH9A 3RLNA 3CD6A 4WJ3M 2KCTA 3J7ZC 1XMQL 2UU9L 1UE6A 1K8GA 4OWTB 2ES2A 2VW9A 3HOXH 4B3TQ 3K80C 1EFWA 1YBYA 4BBRG 1QUQB 2FXQA 2IY5B 2E5LQ 1VQMA 4DR7Q 1HZ9A 1EIFA 1L2FA 2B63H 5LMNQ 4GLVB 3W5OA 3PUYA 1HR0L 3T1YQ 5IP9H 1S72A 1I94L 4NXMQ 1A62A 2RHSB 3AFQA 2JA7G 4A3MH 2ZJQA 3JAMi 4XIGS 4BA1I 3AEVA 4JI6Q 4QJFA 2JEAI 5HGQA 3PUVA 2NVQH 3RN5A 3TS2A 1Q86C 4YCVA 3JAMc 1BKBA 1YNXA 2UUCL 1YJ9A 4A93G 1PH5A 4PZ7A 1Q7YC 1Q12A 1FJGQ 5DLQE 3UE1A 1TWFH 2AKWB 1IXRA 2YTYA 4O2DA 5AJ3L 4R4CA 3G71A 1NTGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GO5 A;  4GN4 B;  4AYB E;  4Y7N H;  3CAM A;  4DV7 L;  2Q2I A;  3F1Z A;  4DR1 L;  3H3V I;  4DUY Q;  1XJV A;  4DR3 Q;  2VUM G;  2Y0S E;  2HIV A;  2KHI A;  4X66 L;  5C0X J;  1EQQ A;  2R7Z G;  1GD7 A;  1QZH A;  3DLL A;  2VUM H;  5GAH C;  1N33 Q;  2V1C C;  1IBK L;  2ZJR A;  1CKM A;  3M9B A;  4GN5 A;  1KIX A;  2VNU D;  1SMX A;  2D0P A;  2ZJP A;  1NMF A;  4JV5 Q;  1YI2 A;  4GOP B;  1LTL A;  2JEB I;  1RIP A;  4R1J A;  2R93 G;  2VY3 A;  4LFA Q;  3CCV A;  3CQZ H;  4JI5 L;  3GTJ H;  4DV3 L;  3HOZ G;  3RN2 A;  2R93 H;  2Q2T A;  2QEX A;  4A4I A;  3F2C A;  4PZ6 A;  3UDI A;  3G6E A;  4JOI C;  2UXD Q;  3W1B A;  3CP0 A;  3L7Z C;  1TXY A;  2ZTE A;  3PV0 A;  3CCS A;  1EQR A;  5IYC G;  2LSS A;  3F2B A;  1EWI A;  5GAD C;  2VS1 A;  1XNR Q;  4QL5 A;  2ZM6 Q;  1SLJ A;  5C0X G;  1K0R A;  2WP8 J;  3J81 j;  3TRZ A;  2HT1 A;  3S24 A;  1SRO A;  3OTO L;  4KI0 A;  4X62 Q;  5IYB G;  1N34 L;  4AQY L;  3KDF A;  4IPG A;  2EXD A;  4BY7 G;  4JYA L;  4DK6 C;  2AHO B;  1X55 A;  3CCU A;  3IRB A;  4UP9 A;  4DV5 Q;  4DR4 L;  2N49 A;  1VQN A;  3D31 A;  1JE5 A;  1P8L A;  1RL2 A;  1TWH H;  2OQ0 A;  2VQE Q;  4RG1 A;  1UEB A;  2WAQ E;  2A1A A;  3HOY H;  1Q1B A;  2AWN A;  3F8T A;  1DGS A;  1EIY B;  3AYH B;  4P74 A;  4A3I G;  4BA2 I;  2F4V L;  1XPR A;  4A3G H;  4A3K G;  1HNW Q;  1PFS A;  3E9I A;  2IX1 A;  1S40 A;  3J7A 5;  1KD1 C;  1G29 1;  3PO3 G;  1WCM G;  1QVC A;  4A3K H;  4GKJ L;  3I7F A;  3CPW A;  3GTL H;  1VCI A;  3T1Y L;  3W1G A;  3I56 A;  1VQP A;  3H3V H;  2UXC Q;  5GRO A;  4DNI A;  1PH2 A;  1KXL A;  1V43 A;  1D7Q A;  4R4Q A;  1GO3 E;  3PF4 A;  4NPS A;  2JQO A;  1PVO A;  1PH6 A;  4A3L G;  4R4O A;  1X9N A;  1CKN A;  2I5L X;  1E3P A;  2VL6 A;  2WB1 E;  3K81 C;  4JI7 Q;  3EIV A;  4IFD J;  2R92 H;  4DV4 Q;  1PV4 A;  1YHA A;  3RLO A;  2HQL A;  3BJU A;  1FGU A;  5IY0 A;  3AFP A;  2Z0S A;  4LF4 L;  2GVB A;  1XMO L;  1IBM Q;  3CW2 C;  4YWK A;  4UPA A;  4X64 Q;  4LFB Q;  2XGT A;  2E2J H;  2D0O A;  4DUY L;  2UUA L;  1KAW A;  1V1Q A;  3FP9 A;  4B3M Q;  2GN5 A;  1PH4 A;  3G48 A;  2K75 A;  2D62 A;  3PGZ A;  2HHH L;  3I4O A;  2UUB Q;  4B3R Q;  1Y1V G;  4LF5 L;  3M4O H;  3PO3 H;  1HZC A;  1Y14 B;  4OO1 G;  4LNQ A;  1UWV A;  4IPC A;  2NZO A;  3H0G H;  5M5Y H;  1J5E Q;  4BXX G;  1VQJ A;  1YVC A;  5FJ8 G;  4DR2 Q;  5M3F H;  1WJJ A;  5C44 G;  2WFW A;  1Q82 C;  4MNO A;  3K7A H;  2Q2U A;  2DGY A;  4LF9 L;  4BXX H;  2ID0 A;  5FJ8 H;  4AYB G;  4JI2 Q;  2QA4 A;  5C44 H;  1VQ4 A;  4LUV A;  3S16 H;  1BBU A;  2UXB Q;  3A74 A;  5C0X I;  4GNX A;  3NEL A;  4IPD A;  4TQU S;  1N32 L;  2Y0S G;  1BBW A;  3KFU A;  4DR6 Q;  5C4X G;  2F3I A;  2LXK A;  2ALY B;  4P71 A;  2I5M X;  4BBR H;  2VQF Q;  4Y52 H;  5C4X H;  1ASZ A;  3T1H L;  4UP8 A;  1VQC A;  3CXC A;  4HJA A;  4DUZ L;  4DV2 Q;  1X56 A;  1IBL Q;  1C0A A;  3VDY A;  1G6P A;  4NXN Q;  2OCE A;  1TWA H;  2K5V A;  2JA7 H;  4POF A;  2JA5 G;  3PF5 A;  4LWC A;  1B8A A;  2IT1 A;  1XNQ L;  2JA6 G;  1VQF A;  4KHP Q;  4X65 L;  2BH8 A;  2JA5 H;  1MJC A;  1KRT A;  5M5W H;  2VZA A;  4A76 A;  4APV A;  2K5N A;  3NEM A;  3CMA A;  1HNZ L;  3OYY A;  4A93 H;  4IOC A;  4LF7 Q;  1K3R A;  2OTL A;  1AE2 A;  2MQH A;  3EN2 A;  1TWC H;  3KYH C;  4KLK A;  1K73 C;  4JI8 L;  1WYD A;  4DV6 Q;  1PH7 A;  1UE1 A;  4LF8 L;  2MO0 A;  1WI5 A;  5BR8 L;  4YHH Q;  3S2H H;  4JC0 A;  1X3F A;  3F2D A;  2F52 A;  3G4S A;  4C3I H;  3PSI A;  4DAY B;  2IX0 A;  2PNH A;  3MEF A;  1A63 A;  4JI1 Q;  1VS0 A;  1JT8 A;  3BZC A;  5JJL A;  2B3G A;  4JI0 Q;  4EX5 A;  2R7Z H;  4L5R C;  3PO2 G;  1LYL A;  1VQ7 A;  3RZD H;  4GKK L;  4GN3 B;  5IT9 c;  4BY1 G;  3PO2 H;  1HH2 P;  2NVY H;  3PCO B;  4A3E G;  4A3B H;  5FLX c;  2A8V A;  2EQS A;  2WAQ G;  1I50 H;  1I3Q H;  4A75 A;  3CCJ A;  1N36 Q;  3GD7 A;  3PIP A;  3L2P A;  1T9H A;  1KC8 C;  1C9O A;  3HOZ H;  3S2D H;  4DV0 L;  1IL2 A;  2MO1 A;  2Q2H A;  4JI4 L;  4OX9 L;  4QQB X;  4LF6 Q;  4J15 A;  4YWM A;  3TEH B;  2OWO A;  2KCM A;  1JJ2 A;  4JI3 Q;  5IYC H;  3CF5 A;  5IP7 G;  3KF6 A;  4L5Q A;  4OO1 I;  4LFC Q;  1Y1W G;  3FKI G;  4YY3 Q;  3I4M G;  1WFQ A;  1BVS A;  2R6G A;  4JBM A;  2JA9 A;  4HJ7 A;  1XMQ Q;  2UU9 Q;  3CCE A;  1E1T A;  3FKI H;  5IYB H;  5GQO A;  5GAE C;  4MTN A;  4DV1 L;  4DR5 Q;  3ULL A;  3TS0 A;  1OTC A;  4B3S L;  4ALP A;  3RR5 A;  1ASY A;  5EAY A;  4BY7 H;  4DAM A;  2ATW A;  4K0K L;  3KDF B;  1YIJ A;  1M90 C;  1HNX L;  4IFD I;  2WB1 G;  1XPO A;  1QVG A;  1Y1W H;  2K4K A;  1SRU A;  4GNX C;  1HR0 Q;  4A3C G;  1HZA A;  1E1O A;  1HZB A;  1I94 Q;  1IZ6 A;  3BZK A;  1V9P A;  5JEA J;  3HOV G;  4R4I A;  1Q81 C;  4BBS G;  3TQY A;  1X65 A;  4OWX B;  4A3C H;  1MKH A;  1P16 A;  2HIX A;  1D8L A;  4B3T L;  3HOV H;  4BBS H;  2L15 A;  2E2H H;  4GLX A;  2E5L L;  4A3I H;  3MXN B;  4DR7 L;  5LMN L;  2UUC Q;  4AH6 A;  1WCM H;  4OXP A;  1CUK A;  1JB7 A;  1XPU A;  3CME A;  4NXM L;  1J6Q A;  3K0X A;  4UP7 A;  5AJ3 Q;  1VQ6 A;  1FVI A;  1AE3 A;  1EOV A;  1K9M C;  1TWG H;  2IHE A;  4JI6 L;  4HJ5 A;  3A5Z B;  1VQA A;  3SGI A;  4DKA C;  4JCV E;  4DV7 Q;  1O7I A;  4DR1 Q;  4A3F G;  2K14 A;  2NN6 G;  3K7U C;  4O0A A;  3S15 H;  5LMU Q;  2YU9 H;  4A3L H;  4X66 Q;  1CSQ A;  1XTD A;  5JEA G;  1FJG L;  5IE8 A;  3ULJ A;  3KJO A;  3I4N G;  1JJG A;  4LF7 L;  4LUO A;  1K8A C;  4QIW E;  1A8V A;  3NBH B;  1IBK Q;  1PYS B;  1CKN B;  3GTK H;  5JJK A;  4FDB A;  3I4N H;  4PZ8 A;  5HY6 A;  1QVF A;  1YEZ A;  2RF4 A;  3GTM H;  3S14 H;  3S1Q H;  2N78 A;  5E7N A;  1PH1 A;  4IJL A;  1NJI C;  3ERS X;  3J80 i;  4DR3 L;  4HIM A;  4IPH A;  3ULP A;  4JI5 Q;  3I2Z A;  3RNU A;  2PQA A;  3CC2 A;  4C2M H;  1E22 A;  2E8G A;  4JI1 L;  1N33 L;  1Y1V H;  1PYB A;  1Z9F A;  3KF8 B;  1FL0 A;  2YYZ A;  4JV5 L;  1NY4 A;  1L1O A;  2MFI A;  5K36 G;  1PH8 A;  3HOU G;  1NE3 A;  4LFA L;  4IFD G;  2CFM A;  1VQK A;  4RMF A;  5IYD G;  2DUD A;  3OTO Q;  1PH9 A;  3HOU H;  1N34 Q;  3HOW G;  3GTP H;  4AQY Q;  2NVX H;  4OWW B;  4JYA Q;  3HKZ E;  1K83 H;  1GVP A;  2CQO A;  2JE6 I;  5GAG C;  2I5H A;  4QGU A;  1M1K C;  2UXD L;  5JJI A;  1VQB A;  4GNX B;  4IO9 A;  1YJW A;  4JBK A;  3L0O A;  1HR0 W;  1XNR L;  2ZM6 L;  1E7Z A;  2EIF A;  2NZH A;  4DK3 C;  4IOA A;  4P73 A;  2ZTD A;  5J3B A;  2GVA A;  3LGJ A;  4C3J H;  5IWA Q;  3E0E A;  1SE8 A;  3Q8D A;  2CWA A;  4YCW A;  1Q8K A;  1OXX K;  2KHJ A;  1IYJ B;  1QUQ A;  4X62 L;  1KQS A;  1OXS C;  3HOX G;  5C3E G;  2JA6 H;  3KLW A;  4JBJ A;  3H15 A;  4DR5 L;  2NVT H;  2IHF A;  4GS3 A;  5C3E H;  3KJP A;  4DV5 L;  2B63 G;  4A3B G;  2JA8 G;  1PH3 A;  1I6H H;  3U4Z A;  2Z6K A;  4OON A;  3HFZ B;  5IP9 G;  2CKZ B;  3CCR A;  3ICE A;  1E24 A;  3M7N A;  2JA8 H;  2AWO A;  2OQK A;  2R7F A;  2E2I H;  4GKJ Q;  3CPF A;  2VQE L;  2B29 A;  5ELN A;  4A3M G;  3OW2 A;  3TRE A;  3CCQ A;  3NEN A;  2AMC B;  1UE5 A;  1EUJ A;  1VQ9 A;  4P72 A;  1HNW L;  2C35 B;  1NMG A;  3M4P A;  3PUX A;  1SR3 A;  1MIU A;  1SN8 A;  2JJQ A;  2RHQ B;  1U0L A;  3D0F A;  3FHW A;  4P75 A;  3KOJ A;  3GTG H;  2LXJ A;  3ZJY C;  2NN6 I;  5ELO A;  1PA6 A;  4H02 A;  2UXC L;  3J81 i;  4QY7 A;  1R9T H;  4BY1 H;  4A3E H;  4LF4 Q;  1XMO Q;  3AQQ A;  3J81 c;  5M5X H;  3CCL A;  2UUA Q;  2F4V Q;  2BA0 A;  4HJ8 A;  1MJE A;  2HHH Q;  5LMU L;  1QZG A;  4JI7 L;  4LF5 Q;  3STB D;  4DV4 L;  4GOP A;  2CCZ A;  3GTO H;  5M3M G;  4TVA B;  3HKS A;  3GTQ H;  1GKH A;  5M3M H;  1VQ8 A;  1W3S A;  1VQI A;  5IP7 H;  1G51 A;  1IBM L;  3STB C;  1LUZ A;  3U58 A;  4LF9 Q;  4WJ4 A;  4X64 L;  4LFB L;  3KF6 B;  4B3M L;  3I4M H;  4R4T A;  3B6Y A;  1A0I A;  2YTV A;  2CWP A;  2RCN A;  3A0J A;  4LUZ A;  3UDG A;  2UUB L;  4B3R L;  4PMW A;  2PI2 E;  5FLM G;  3CCM A;  3S17 H;  1CKO A;  1L0W A;  1N32 Q;  1VQ5 A;  2QGQ A;  1L1O C;  1YHB A;  5FLM H;  1J5E L;  4EQ5 A;  1VQO A;  4DR2 L;  3PIO A;  1X54 A;  2N8N A;  3WWV A;  1U5K A;  3T1H Q;  4LW1 A;  4JI2 L;  4DUZ Q;  3RLF A;  1VQG A;  3PUZ A;  2UXB L;  1JJC B;  4JG2 A;  2MNA A;  4JBW A;  4GKK Q;  3DM3 A;  1XNQ Q;  4DR6 L;  1UE7 A;  1N9W A;  4A3J G;  4X65 Q;  2ZTC A;  4X6A H;  2VQF L;  1X6O A;  4PG3 A;  4A3J H;  5LMN W;  1YHQ A;  1HNZ Q;  3UDF A;  3K8A A;  1X3E A;  1H95 A;  2JK8 A;  1N8R C;  3UE0 A;  4DV2 L;  1YIT A;  1IBL L;  1PHJ A;  4GLA C;  4NXN L;  3HOY G;  1VQE A;  4JI8 Q;  1KL9 A;  4NB3 A;  5IWA L;  3S1N H;  1VQL A;  4A3D H;  4KHP L;  1B70 B;  2YV5 A;  4LF8 Q;  2R7D A;  5BR8 Q;  1C7Y A;  2K52 A;  4ME3 A;  2Z6K C;  3M3Y H;  2H5X A;  2N3S A;  4A3G G;  1LM0 A;  3HKZ G;  4A3F H;  2A19 A;  4XTC S;  2KBN A;  3E9H A;  3PUW A;  3A5U A;  2ASB A;  1CSP A;  2PMZ E;  1GM5 A;  1HJP A;  3EBE A;  3GDE A;  2PI2 A;  4IJH A;  3JC6 6;  4DV6 L;  2YTX A;  5C4J H;  4HID A;  4YHH L;  4C3H H;  2KEN A;  4UY8 C;  3BU2 A;  1Q46 A;  1W2B A;  1KRS A;  5H1S E;  4DV3 Q;  2OTJ A;  1S3O A;  3J80 c;  4JI0 L;  4POG A;  1VQD A;  2K5H A;  4DV0 Q;  3S1M H;  2BA1 A;  4JI4 Q;  4OX9 Q;  2R92 G;  2PQA B;  1OXU A;  4DPG A;  3I55 A;  2K50 A;  4JOI A;  3M4Q A;  1YJN A;  1VQH A;  4L5T A;  4AIM A;  1N36 L;  1JMC A;  4L5S A;  4HJ9 A;  3RZO H;  4MZ9 A;  3U50 C;  3ER0 A;  1OXT A;  4YWL A;  4A3D G;  1L1O B;  4HIO A;  4GOP C;  3M85 A;  5IYD H;  3S1R H;  3U4V A;  1SFO H;  1NBW A;  1Q1E A;  3HOW H;  4DV1 Q;  1EYG A;  3CC4 A;  4KHZ A;  4B3S Q;  4LF6 L;  4K0K Q;  3CC7 A;  2XTI A;  3H0G G;  4DR4 Q;  1HNX Q;  1OXV A;  4YCU A;  1WOC A;  3UDX A;  4JI3 L;  5M3F G;  1Z47 A;  4HIK A;  1B7Y B;  2I0Q A;  4LFC L;  1KHI A;  2BH2 A;  1YZ6 A;  1I5F A;  4YY3 L;  1X3G A;  1AH9 A;  3RLN A;  3CD6 A;  4WJ3 M;  2KCT A;  3J7Z C;  1XMQ L;  2UU9 L;  1UE6 A;  1K8G A;  4OWT B;  2ES2 A;  2VW9 A;  3HOX H;  4B3T Q;  3K80 C;  1EFW A;  1YBY A;  4BBR G;  1QUQ B;  2FXQ A;  2IY5 B;  2E5L Q;  1VQM A;  4DR7 Q;  1HZ9 A;  1EIF A;  1L2F A;  2B63 H;  5LMN Q;  4GLV B;  3W5O A;  3PUY A;  1HR0 L;  3T1Y Q;  5IP9 H;  1S72 A;  1I94 L;  4NXM Q;  1A62 A;  2RHS B;  3AFQ A;  2JA7 G;  4A3M H;  2ZJQ A;  3JAM i;  4XIG S;  4BA1 I;  3AEV A;  4JI6 Q;  4QJF A;  2JEA I;  5HGQ A;  3PUV A;  2NVQ H;  3RN5 A;  3TS2 A;  1Q86 C;  4YCV A;  3JAM c;  1BKB A;  1YNX A;  2UUC L;  1YJ9 A;  4A93 G;  1PH5 A;  4PZ7 A;  1Q7Y C;  1Q12 A;  1FJG Q;  5DLQ E;  3UE1 A;  1TWF H;  2AKW B;  1IXR A;  2YTY A;  4O2D A;  5AJ3 L;  4R4C A;  3G71 A;  1NTG A; 
#chains in the Genus database with same CATH topology
 2RA4 A;  4Y7N H;  4DV7 L;  2Q2I A;  2B2W C;  2EYH A;  5DAU A;  2VUM G;  3GTL B;  2HIV A;  2KHI A;  1QZH A;  2VUM H;  5GAH C;  1N33 Q;  1IBK L;  1CKM A;  3M7G A;  2F0I A;  1SBB B;  1D2B A;  2EPB A;  4HSP A;  1ZEQ X;  1LTL A;  1RIP A;  3CCV A;  4JI5 L;  1KDA A;  1W6J A;  3GTJ H;  3URY A;  5G3L F;  4A4I A;  1LT4 D;  1GUS A;  3UDI A;  3G6E A;  3L7Z C;  1TXY A;  1FNV A;  1GUN A;  5IYC G;  2LSS A;  3F2B A;  2XNA C;  2VS1 A;  3S1R B;  1XNR Q;  1MHW C;  3J81 j;  1JCK B;  3QOJ A;  5ELD A;  1R4Q B;  1HQR D;  3OTO L;  3I70 A;  1S5E D;  1N34 L;  1EQT A;  3KDF A;  2EXD A;  4QUF A;  1F9S A;  4V19 0;  3CCU A;  3FPU B;  3IRB A;  3DUZ A;  4NDX A;  2IX3 A;  3P1H A;  2A6H D;  1STH A;  1VQN A;  5NUC A;  3VA7 A;  1P8L A;  1RL2 A;  4K2L A;  1KNE A;  2A6H C;  1UEB A;  4J1M A;  2AWN A;  5I9P A;  1HNW Q;  4A3G H;  2IX1 A;  3J7A 5;  4CDC C;  4GKJ L;  1HA6 A;  5FO8 B;  1DON A;  2UXC Q;  3V05 A;  4DNI A;  1EIH A;  1TWF B;  1D7Q A;  3NWS A;  1PVO A;  4NPS A;  2JQO A;  4A93 B;  3EFX D;  1TWC B;  2MP1 A;  4CKB A;  2EYM A;  5CV8 A;  4JI7 Q;  2RSN A;  1PV4 A;  1YHA A;  3RLO A;  3GQB A;  1IW7 D;  3BG3 A;  5I6W A;  2VUM B;  1XMO L;  4YWK A;  1RD9 D;  1ZYR D;  4UHV A;  2XGT A;  2UUA L;  4DUY L;  3GTP H;  3FP9 A;  1IW7 C;  2HHH L;  3PO2 B;  4B3R Q;  1ZYR C;  3H0G H;  5I2Y A;  4DR2 Q;  3A54 A;  2WFW A;  2JSO A;  2LFN A;  4MNO A;  5C44 G;  1DD2 A;  2ID0 A;  3S2D B;  4JI2 Q;  2H1E A;  5C44 H;  3OPO A;  1BBU A;  2RDH A;  4XQJ A;  2A73 B;  1NR4 A;  5C0X I;  4GNX A;  1N32 L;  1BBW A;  3KFU A;  2FMM A;  2F3I A;  2ALY B;  5EKI A;  1EU4 A;  2RBM A;  4DFA A;  4E6I A;  4Y52 H;  1D6E C;  2Z4I A;  1DYQ A;  1RTO A;  2Z1C A;  1NNX A;  2DNC A;  3H6M A;  2F3W A;  1C0A A;  1G6P A;  3MZ5 A;  3MA2 B;  1H9M A;  2B2U A;  2K5V A;  2JA7 H;  1XNQ L;  3TME A;  1VQF A;  2CW0 D;  4RKB A;  5EBC A;  4A76 A;  1RCV D;  1K3B C;  1B9M A;  5CV7 A;  4APV A;  3CMA A;  4DK1 A;  3OYY A;  2SNM A;  1U9R A;  2CW0 C;  4LF7 Q;  1BCP D;  1JWU D;  2MPM A;  4IUT A;  4B9X A;  1UE1 A;  2X69 A;  2NZ1 D;  4YHH Q;  4JC0 A;  2F52 A;  1BCP C;  3J7Y W;  3PSI A;  3BDO A;  2AUJ D;  5F2D A;  3P75 A;  4DAY B;  4EQP A;  2IX0 A;  3MEF A;  3H09 A;  4JI1 Q;  1VS0 A;  3BZC A;  3RMH A;  4JI0 Q;  4EX5 A;  3H91 A;  1TWG B;  1IYV A;  1VQ7 A;  3RZD H;  2NVY H;  2D9U A;  2EY1 A;  4R8I A;  2YU9 B;  1RKN A;  1N36 Q;  3PIP A;  3L2P A;  3FPP A;  1EY0 A;  3D8G A;  4RHR A;  1H9S A;  3HOZ H;  3DEO A;  2MO1 A;  1QIL A;  4J15 A;  1STG A;  1FNW A;  5IP7 G;  1H9J A;  2E2D C;  4HTH A;  1QJO A;  1RDP D;  1WFQ A;  5C5M A;  3FMC A;  1AZQ A;  4JBM A;  4HJ7 A;  5IYB H;  3ULL A;  4K0K L;  3MTS A;  3MVV A;  2ATW A;  4Q0F A;  4CGY B;  2BCO A;  5C44 B;  3BZD B;  2K5W A;  1S4Z A;  2K4K A;  3G7L A;  4EQO A;  1PXU A;  1E1O A;  1U4R A;  3BZK A;  5DM7 3;  1V9P A;  5JEA J;  2A68 D;  1X65 A;  1LTT D;  4OWX B;  1MKH A;  4PMB A;  4XQN A;  4B3T L;  1AFP A;  2A68 C;  4OIK A;  2KCN A;  5CBE E;  4AH6 A;  4FNF A;  1XPU A;  1CUK A;  3C1F A;  1J6Q A;  4KKS A;  1FVI A;  1G6Z A;  1EOV A;  1B4O A;  2IHE A;  1LTG D;  4HJ5 A;  2EY2 A;  1VQA A;  3SGI A;  4DV7 Q;  1WTO A;  1O7I A;  1KAB A;  3MFG A;  5I9O A;  4FXD A;  2FMC A;  4CDF C;  2F03 A;  3TSS A;  2E2I B;  4A3L H;  5JEA G;  1XTD A;  3ULJ A;  2J0T D;  4LUO A;  4QB4 A;  5JEA H;  1IBK Q;  1PYS B;  2EE1 A;  4KY6 A;  1PYW D;  3S14 H;  3S1Q H;  5E7N A;  2F0P A;  1GUT A;  1A6X A;  1E2Z A;  4IPH A;  3RZD B;  4JI5 Q;  3I2Z A;  3RNU A;  2PQA A;  4C2M H;  1E22 A;  3NK9 A;  1R9T B;  1Y1V H;  4BWG B;  1Z9F A;  3KF8 B;  2YYZ A;  1CI3 M;  1HA5 A;  1TQO A;  3K59 A;  3HOU G;  1NE3 A;  3I91 A;  4RMF A;  1I4X A;  3OTO Q;  3HOU H;  1N34 Q;  3HOW G;  2F0E A;  2GA4 B;  3KK7 A;  1EFI D;  5GAG C;  1GVP A;  2CQO A;  2JE6 I;  1M1K C;  3GTQ B;  1DJR D;  4HSV A;  3SHL A;  1YJW A;  1LT3 D;  1H9K A;  2NZH A;  4DK3 C;  1WTV A;  5J3B A;  1QB5 D;  3K58 A;  3U9S A;  3E0E A;  5D3I B;  1SE8 A;  3Q8D A;  2KHJ A;  1XXG A;  2TMP A;  4JBJ A;  4DR5 L;  3SK6 A;  1LLR D;  3A7A B;  1C4Q A;  1CT1 D;  1A2U A;  2F0O A;  3HFZ B;  3CCR A;  4GKJ Q;  1E24 A;  5JVG 3;  1RHP A;  2OQK A;  2VQE L;  3OW2 A;  4Q5V A;  2PPB C;  2AMC B;  3EA6 A;  1SYG A;  4ME5 A;  4O42 A;  1ZXT A;  4FP5 D;  3M4P A;  1NMG A;  2LMC B;  1MIU A;  1U0L A;  4H7B A;  4XYO A;  2K03 A;  1PA6 A;  1DOK A;  4H02 A;  4G57 A;  1EY8 A;  4NKL A;  2Z6B A;  1XMO Q;  4X3K A;  5M5X H;  2UUA Q;  3MC0 B;  2HHH Q;  5LMU L;  3VYR A;  3HP3 A;  5LL6 S;  1QZG A;  1GUO A;  1PRT F;  4DV4 L;  5ELF A;  1L0Y B;  1W3S A;  3HGB A;  1LUZ A;  2K01 A;  4KV6 A;  4G7O C;  4B3M L;  2PNR C;  3A0J A;  1EEI D;  3UDG A;  3HRZ C;  3I73 A;  2PI2 E;  5FLM G;  1N32 Q;  2KVM A;  1PZJ D;  1VQ5 A;  2B39 A;  1L1O C;  1YHB A;  5FLM H;  2XRS D;  3HOU B;  1X54 A;  3WWV A;  1U5K A;  3D4R A;  1SFO B;  3T51 B;  3HOW B;  1BOS A;  1STY A;  3HZX A;  3RLF A;  2UXB L;  2WKC A;  1JJC B;  4NP5 A;  3W3A A;  1XNQ Q;  3I8Z A;  1M4V A;  3R93 A;  2VQF L;  3MEH A;  3X3M A;  4ZK9 B;  1YHQ A;  3UDF A;  1H95 A;  3UE0 A;  1KAA A;  2L11 A;  1YIT A;  3UI2 A;  1HPC A;  5IWA L;  4H0L C;  3JAM L;  1VQL A;  4RAU C;  2R7D A;  2F0V A;  2XN9 C;  5A2Q L;  4ME3 A;  2Z6K C;  3I90 A;  2N3S A;  3K5O A;  4K8J A;  3HKZ G;  2RDF A;  2H4O A;  5KIX A;  2KBN A;  3E9H A;  3PUW A;  1CSP A;  3EVQ A;  3GDE A;  2PI2 A;  2NVQ B;  2SNS A;  3JC6 6;  5C4J H;  2XIW A;  1SNM A;  1C8C A;  1F2Z A;  1RTN A;  5BN5 A;  3OWF A;  1W2B A;  1GHK A;  2OTJ A;  1S3O A;  1EY9 A;  1KNA A;  2D2C C;  3H3V C;  1CZW A;  3I55 A;  1DXM A;  4HCE A;  4JOI A;  1VQH A;  4TKO B;  1JMC A;  4L5S A;  3RZO H;  2EY5 A;  4HIO A;  2F0K A;  3U4V A;  3CC4 A;  1O78 A;  4HMJ A;  4LF6 L;  4K0K Q;  1Z47 A;  3KLS X;  3LX0 A;  1YZ6 A;  4YY3 L;  4MN3 A;  4CBV A;  1K8O A;  1A15 A;  1XMQ L;  2UU9 L;  4OWT B;  1GUW A;  1ZKO A;  4B3T Q;  4BBR G;  1QUQ B;  4QIW B;  2B63 H;  2A69 D;  5KNC A;  1HR0 L;  1I94 L;  2IL8 A;  3O13 A;  2HUG A;  2NTT A;  2A69 C;  3QB3 A;  3AEV A;  1BUV T;  4QJF A;  3TS2 A;  4OEL B;  3JAM c;  3X3N A;  3BDL A;  4PZ7 A;  3A55 A;  5DLQ E;  3UE1 A;  2AKW B;  4R4C A;  2K5D A;  5E3F A;  4ZRZ A;  3VR4 A;  3CAM A;  3HKZ B;  2J4X A;  1BBX C;  1CTM A;  4DR1 L;  4A3K B;  5A35 A;  1I4R A;  2AQ2 B;  2Y0S E;  4X66 L;  5C0X J;  1QG7 A;  4K6D A;  1PFM A;  2V1C C;  4KKT A;  1KIX A;  2F0F A;  1SMX A;  2D0P A;  4LAA A;  1NMF A;  4GOP B;  2JEB I;  2NWG A;  2R93 G;  3CQZ H;  4DV3 L;  2R93 H;  2QEX A;  3F2C A;  2K1B A;  3CP0 A;  2VXW A;  3PV0 A;  2ZTE A;  4K5X A;  1EWI A;  5GAD C;  5C3W A;  1D5Z C;  1SLJ A;  4B08 A;  4I7A A;  5C0X G;  1K0R A;  4M8A A;  3NXW A;  2HT1 A;  1GUG A;  4BY7 G;  4JYA L;  4DK6 C;  2AHO B;  1AZP A;  4UP9 A;  1CZG A;  3VR2 A;  2L0C A;  3D31 A;  3S16 B;  4X3U A;  2F0S A;  1SJH D;  5C6A A;  1TWH H;  2OQ0 A;  2VQE Q;  2A1A A;  2DJF C;  4BBR B;  2Y0S B;  2P5Z X;  3MXN A;  3AYH B;  4P74 A;  4A3I G;  1XPR A;  3KLS A;  4WFN 3;  1KD1 C;  1S5C D;  2KA7 A;  3MXP A;  1TWA B;  3GTL H;  1VCI A;  3W1G A;  3V96 A;  5M5W B;  3H3V H;  1PH2 A;  2LY7 A;  5KGU A;  3SEB A;  1AN8 A;  4R4Q A;  1GO3 E;  4MHE A;  3PIO 3;  4RHS A;  3NBH A;  1X9N A;  1PFB A;  1E3P A;  2WB1 E;  1UEA B;  3EIV A;  5CBA E;  4DV4 Q;  2PYK A;  1FGU A;  2ICI A;  3R3O A;  4LF4 L;  2GVB A;  1B53 A;  2Q8R E;  2E2J H;  2D0O A;  4B3M Q;  1UNS A;  2PO4 A;  2GN5 A;  4LF5 L;  1BF4 A;  1Y14 B;  1ML0 D;  4LNQ A;  1UWV A;  1I50 B;  1YVC A;  5FJ8 G;  2R93 B;  4K8I A;  5FJ8 H;  1VQ4 A;  2MHV A;  1DCZ A;  3E6Z X;  2UXB Q;  2PMZ B;  2I46 A;  4TQU S;  3QR8 A;  3HS0 C;  1MBY A;  2E76 C;  2I5M X;  3C3L A;  1DOL A;  2VQF Q;  4F7X A;  3OHX C;  1ASZ A;  3Q23 A;  3K5M A;  4UP8 A;  4C3J G;  4HJA A;  2F0W A;  3VDY A;  4BY7 B;  2OCE A;  4GKK L;  2JA5 G;  3PF5 A;  4LWC A;  2JA6 G;  4UDU C;  4X65 L;  2B2Y C;  1MJC A;  2JA5 H;  4FXK C;  2WB1 B;  2BDN A;  2EYP A;  2CH4 W;  4A93 H;  4F87 A;  3BYT B;  1K3R A;  1TWC H;  4LMQ D;  3E0J A;  2ICE C;  2NBF A;  4A3I B;  2MO0 A;  1WI5 A;  3S2H H;  1WTX A;  4H44 C;  3J7A F;  4PV1 C;  4KD4 A;  2B3G A;  1F2Y A;  1G2S A;  4L5R C;  3PO2 G;  3PO2 H;  1OO9 B;  1NAP A;  2F0T A;  4A3E G;  2A8V A;  4DGZ A;  1JOK A;  2HCC A;  1EY6 A;  3J80 L;  1Y8N B;  5COY A;  1B1Z A;  1PRT B;  1KC8 C;  3S2D H;  1IL2 A;  5JAV A;  2Q2H A;  4JI4 L;  4OX9 L;  4LF6 Q;  5AFW A;  2E2J B;  4F88 A;  5IYC H;  3CF5 A;  3KF6 A;  4OO1 I;  1ESR A;  2L12 A;  3I4M G;  5JPN C;  4YY3 Q;  4KD3 A;  1XMQ Q;  2UU9 Q;  3CCE A;  1E1T A;  3TS0 A;  1ASY A;  5EAY A;  1CHP D;  3KDF B;  1YIJ A;  3K57 A;  4IFD I;  4FVM A;  5EKK A;  1QVG A;  5HUR A;  1SRU A;  1HR0 Q;  1I94 Q;  1KDB A;  2SEB D;  3HOV G;  3TQY A;  2SOB A;  1HRJ A;  1P16 A;  3HOV H;  1SSO A;  2PW7 A;  4K5V A;  4C3J B;  2B2V A;  4HMI A;  4OXP A;  3CME A;  2JA5 B;  5JVH 3;  2JA6 B;  1X3P A;  1AE3 A;  5IGF A;  2R61 A;  1TWG H;  5D3D A;  4JI6 L;  5T1G A;  1O7L A;  5CR3 A;  3CRK C;  1I6H B;  4DR1 Q;  2AQ1 B;  2K14 A;  1EQV A;  4RGN A;  4Z9C B;  4G7H C;  2I07 B;  1LAB A;  4X66 Q;  2YU9 H;  1FJG L;  2ZXP A;  3S2H B;  1HTP A;  2IWH A;  1BDO A;  3KJO A;  4CJ2 C;  1LAC A;  1A8V A;  3J81 L;  1QVF A;  3GTM H;  1R4P B;  4IJL A;  3NSW A;  3VYS A;  5C4H A;  3ULP A;  2ZXO A;  4RCO A;  4C1N I;  2E8G A;  2NTS A;  2O5I C;  4A3E B;  2PW5 A;  3U9O A;  1HFG A;  1PYB A;  2OEO A;  2QW7 A;  4JV5 L;  1NY4 A;  5EKL A;  2L1B A;  3EJI A;  5G3L D;  1B44 D;  4LFA L;  1STA A;  2L4N A;  1WTR A;  1JOR A;  4JYA Q;  3BS1 A;  2QIL A;  4QGU A;  2UXD L;  4GNX B;  4IO9 A;  4JBK A;  1SNQ A;  2O5J C;  1B3A A;  5IOD A;  1NSN S;  2ZM6 L;  3I4M B;  4IOA A;  4P73 A;  1EU3 A;  2HDL A;  3JAM E;  2B2T A;  4FYD A;  1TS2 A;  1OXX K;  3HOX G;  1AW7 A;  5EPJ A;  3GV3 A;  4IUV A;  2IHF A;  2M9V A;  3KJP A;  2A74 C;  1HQM C;  5IP9 G;  3ICE A;  2CKZ B;  3HOV B;  3M7N A;  2R7F A;  2E2I H;  2XVS A;  3CPF A;  2B29 A;  5ELN A;  3V2T A;  4RA8 A;  3TRE A;  2JN4 A;  2RSO A;  1UE5 A;  1LTR D;  4P72 A;  3PUX A;  1UUP A;  4KJO A;  3LWE A;  1SN8 A;  2JJQ A;  5EPK A;  3D0F A;  1G8Z D;  3FHW A;  4KHV A;  4KTA A;  1EEF D;  2NN6 I;  5CYU A;  1R9T H;  1CQV A;  3GP7 A;  4LF4 Q;  4X3S A;  3J81 c;  4LJZ C;  1E0B A;  1MJE A;  3GTM B;  2PQE A;  4LF5 Q;  4LK1 C;  4K5W A;  2RDG A;  1H9S B;  1TS3 A;  3STB D;  5LL6 X;  4WJW A;  3GTQ H;  2XSC A;  1VQI A;  5IP7 H;  3STB C;  3U58 A;  2B8G A;  1X32 A;  4LFB L;  4R4T A;  2CWP A;  2RCN A;  2UUB L;  3QWN A;  5EBD A;  1L0W A;  2WKD A;  2MJ8 A;  1J5E L;  4EQ5 A;  1V8Q A;  3PIO A;  2F1M A;  2N8N A;  4WRD A;  2WII B;  4LW1 A;  3KBG A;  2EJG C;  1VQG A;  3PUZ A;  4QF4 A;  4GKK Q;  2MUY A;  3DM3 A;  2FFK B;  4DR6 L;  1DZ1 A;  1N9W A;  3OW7 A;  1LV9 A;  4X65 Q;  1JC7 A;  1IL8 A;  3ND8 A;  1EZ6 A;  1N8R C;  1CM9 A;  1JOO A;  4DV2 L;  1HFN A;  3HOX B;  4NXN L;  1B9N A;  3HOY G;  4NB3 A;  2Q8I B;  4KHP L;  3E5S A;  5I6Y A;  1C7Y A;  2K04 A;  2QDL A;  1V1O A;  4CHT B;  2FIN B;  4XTC S;  3A5U A;  2B2W A;  2ASB A;  5J1Z A;  4DAV A;  4IJH A;  2K7V A;  2AUK A;  5J39 A;  2EZV A;  3C1E A;  2ENB A;  2X6L A;  1Q46 A;  5H1S E;  1B50 A;  3ITP A;  1XX8 A;  2XRQ D;  4POG A;  1D1I A;  2EJM A;  2K5H A;  4JI4 Q;  4OX9 Q;  2R92 G;  2PQA B;  4DN4 M;  3AMU A;  2CH4 A;  3M4Q A;  1AEX A;  5LHY 1;  2JYO A;  4YWL A;  4A3D G;  1VF7 A;  4GOP C;  3TBI B;  3VYT A;  1MD2 D;  1SFO H;  1NBW A;  4XQQ A;  3HOW H;  1EYG A;  4KHZ A;  1JWS D;  3CC7 A;  2EYJ A;  2WAC A;  1UAP A;  4HIK A;  5M3F G;  2I0Q A;  3H94 A;  1O80 A;  1KHI A;  2BH2 A;  1I5F A;  4XT1 B;  3RLN A;  4WJ3 M;  1UE6 A;  1K8G A;  4QMG A;  3K80 C;  1EFW A;  1YBY A;  1JE4 A;  1MSG A;  1BR9 A;  4RCN A;  2F0L A;  1WTW A;  3IKJ A;  1SAP A;  1HZ9 A;  1PZI D;  1SMY D;  3A7L A;  1S72 A;  1SMY C;  3SXH A;  3JAM i;  4KK7 A;  4BA1 I;  4JI6 Q;  1IHZ A;  5HGQ A;  2NVQ H;  4YCV A;  2ZXR A;  1KDC A;  2KOL A;  1YNX A;  5IGE A;  2UUC L;  1YJ9 A;  1PH5 A;  3NHH A;  2G5D A;  1FJG Q;  3HOY B;  4O2D A;  3R8B A;  1NTG A;  2VW9 A;  3G6J B;  3GO5 A;  5EGT A;  4AYB E;  1A3T A;  2BOS A;  2F4I A;  4DUY Q;  4IQZ A;  1XJV A;  1YNN D;  2K28 A;  2R7Z G;  1GD7 A;  3OWE B;  3DLL A;  1W6K A;  1YNN C;  3M9B A;  4GN5 A;  2Z9H A;  1KTK A;  4ZQ3 A;  2ZJP A;  4JV5 Q;  1YI2 A;  1KLG D;  2B8F A;  4R1J A;  2VY3 A;  4LFA Q;  3ONA B;  4DA2 A;  2R92 B;  2Q2T A;  3NBI A;  4U67 3;  4PZ6 A;  5JOB A;  2UXD Q;  3W1B A;  2L9H A;  3QIA A;  3CCS A;  1EQR A;  5DEH A;  2ZM6 Q;  1LTA D;  4A3D B;  4FO2 A;  5ELB A;  3A56 A;  4FF1 A;  5L37 A;  2EVB A;  5M5Y B;  1MGS A;  4AQY L;  4EQN A;  1DOM A;  5FKA C;  2WIN B;  1X55 A;  5M3F B;  1SYC A;  3K7A B;  2EJF C;  4DR4 L;  2N49 A;  4I65 A;  2OT2 A;  1PTO F;  1JE5 A;  3HEJ A;  2WAQ E;  1Q1B A;  2DY7 A;  3F8T A;  1EIY B;  1QWY A;  4BA2 I;  3C46 A;  4A3K G;  4DNR B;  1WCM G;  4ZUI A;  1QVC A;  4A3K H;  1ICW A;  4I7Z C;  3T1Y L;  1VQP A;  1GXD C;  4XDX A;  1KXL A;  1V43 A;  3PF4 A;  1FD7 D;  4J8Q A;  1XWE A;  5IT9 L;  1CKN A;  5T1I A;  2I5L X;  3NWT A;  3K81 C;  5FLX L;  4GZY C;  4IFD J;  3MHB A;  4MTK A;  1ENC A;  3BJU A;  3W2D A;  1A3U A;  5IY0 A;  3L9A X;  1QOH A;  4LFB Q;  2R7Z B;  1PRT D;  3TP7 A;  5EPL A;  2F4V L;  4G7Z C;  3PO3 G;  1V1Q A;  3PGZ A;  2UUB Q;  1EWH A;  1WD1 A;  3M4O H;  3PO3 H;  1HZC A;  4OO1 G;  1PRT C;  1I3Q B;  2A5H A;  2NZO A;  1J5E Q;  4BXX G;  1FYC A;  5ELC A;  3T16 A;  3D6W A;  2Q2U A;  4LF9 L;  2DGY A;  4BXX H;  4OGQ C;  4LUV A;  3S16 H;  2QCP X;  2KEC A;  4DF7 A;  2J7Z A;  2Y0S G;  4DR6 Q;  3I3C A;  2LXK A;  4P71 A;  4BBR H;  2L5T A;  5KND A;  3VA5 A;  4IUU A;  1VQC A;  4DUZ L;  4DV2 Q;  1X56 A;  1II3 A;  4NXN Q;  1TWA H;  2K5Q A;  4KHP Q;  2IT1 A;  1CA6 A;  3CKI B;  2BH8 A;  1KRT A;  5M5W H;  4RGM A;  3RD4 A;  1HNZ L;  1VMC A;  4IOC A;  2OTL A;  2MQH A;  4KLK A;  3J81 E;  1K73 C;  4U68 A;  4JI8 L;  2E2H B;  1WYD A;  1PH7 A;  4LF8 L;  3I4L A;  3F2D A;  3G4S A;  2JXM B;  3VYU A;  1WCM B;  1Q90 A;  1A63 A;  1BO0 A;  1TU2 B;  1V1P A;  5JJL A;  1TKW B;  5JPM C;  1TY0 A;  3A8I E;  2K6A A;  5I4D A;  5IT9 c;  4BY1 G;  1HH2 P;  5IGD A;  5FLX c;  1D5X C;  1TS5 A;  1I50 H;  1LTB D;  4ULL A;  4PNY A;  3GD7 A;  1C9O A;  3OOC A;  4QUC A;  4DV0 L;  2F0N A;  4QQB X;  5E4X A;  3TEH B;  2OWO A;  1JJ2 A;  2BDO A;  4IZ8 A;  4CKE A;  3KUP A;  2EYO A;  4L5Q A;  3PO3 B;  3M4O B;  5C0X H;  3FKI G;  2VB3 X;  2EYL A;  4KN4 C;  3FKI H;  4DR5 Q;  1OTC A;  2VNU D;  4MTN A;  4BY7 H;  2NB0 A;  4ALP A;  3RR5 A;  2CVR A;  5D14 A;  2C9O A;  3OSO A;  5K5P A;  1EL0 A;  1JR0 D;  2WB1 G;  2EDG A;  1BNZ A;  1LT5 D;  2X6G A;  4GNX C;  1ILQ A;  1HZA A;  1HZB A;  2DN8 A;  1ET6 A;  1STE A;  3Q6S A;  1K83 B;  1QNK A;  4BBS G;  4R4I A;  2HIX A;  1D8L A;  1HUN A;  1EY5 A;  4BBS H;  2L15 A;  4A3I H;  3MXN B;  4DR7 L;  5LMN L;  2UUC Q;  2B2U C;  2F0H A;  1JB7 A;  1VQ6 A;  1K9M C;  2NVT B;  3QO2 A;  5ISR A;  1IYU A;  4JCV E;  3G71 A;  4CDD C;  1Z6H A;  4A3F G;  2KUM A;  4L63 B;  2NN6 G;  3K7U C;  4O0A A;  4RGO S;  4FF2 A;  5LMU Q;  3IFD A;  1CSQ A;  3J7A V;  5IE8 A;  3IAY A;  1JJG A;  4LF7 L;  1K8A C;  2PZU A;  3NBH B;  5HGT A;  3GTK H;  3R2I A;  4PZ8 A;  1YEZ A;  2EXZ A;  2F0M A;  1PH1 A;  1NJI C;  3J80 i;  4DR3 L;  3GTG B;  3CC2 A;  1XTC D;  2Z4H A;  4JI1 L;  4BY1 B;  5TSS A;  4N8F A;  1HCZ A;  1FL0 A;  5CV5 A;  3BVZ A;  1L0X B;  1L1O A;  1FNU A;  1SNO A;  5K36 G;  5IYD G;  1PH9 A;  4AQY Q;  4OWW B;  4ZCK A;  3Q24 A;  4RKL A;  3L0O A;  1HR0 W;  3FKI B;  2ZTD A;  2NYZ D;  1SDF A;  4C3J H;  5IWA Q;  3S17 B;  2IJ0 A;  2CWA A;  4X62 L;  1KQS A;  1OXS C;  3P20 A;  4IUN A;  4JW0 A;  2JA6 H;  3KLW A;  3LNN A;  4GS3 A;  4A3B G;  4DV5 L;  4K14 A;  2IPK D;  4ZLT F;  5CMD A;  1PH3 A;  2JA8 G;  1I6H H;  4A3B H;  2Z6K A;  4OON A;  2N88 A;  3DWQ A;  3VR6 A;  4BBS B;  4B9W A;  1ET9 A;  2JA8 H;  1TS4 A;  4A3M G;  1H9R A;  4ILW A;  3NEN A;  1I4P A;  4A3J B;  5C3X A;  1VQ9 A;  5C4Z A;  3PQI A;  1CQF A;  3DWP A;  1SR3 A;  5E1F A;  3S1N B;  4OIJ A;  4P75 A;  3KOJ A;  2Q8T A;  2LXJ A;  5ELO A;  3M3Y B;  3J81 i;  4A3F B;  1BXT A;  4A3E H;  2KCC A;  3AQQ A;  3SK8 A;  4XT3 B;  3GTK B;  1S5B D;  1I4Q A;  4QCL A;  2F4V Q;  1J8I A;  3NP8 A;  2BA0 A;  3MWY W;  1LTI D;  3QJY A;  1SYD A;  2CCZ A;  3GTO H;  3ERO A;  4PQX A;  1VQ8 A;  4WJ4 A;  5IGB A;  4LF9 Q;  1IBM L;  4X64 L;  3S1M B;  3KF6 B;  3L3O C;  4IUR A;  3I4M H;  3B6Y A;  1A0I A;  1ENF A;  2YTV A;  3D4D A;  4LUZ A;  1SYF A;  1QE6 A;  4PMW A;  3CCM A;  1CKO A;  2PCF B;  4DK0 A;  2K05 A;  3D6C A;  1B2T A;  4DUZ Q;  1EIG A;  1UE7 A;  3M4Y A;  2ZTC A;  2IW3 A;  1PTO B;  3I72 A;  1WVL A;  5LMN W;  1HNZ Q;  3DM1 A;  4CJ1 B;  3K8A A;  2JK8 A;  2M00 A;  1IBL L;  3FDT A;  3Q22 A;  4JI8 Q;  1ICF B;  4HCS A;  1RF2 D;  1B70 B;  2YV5 A;  4LF8 Q;  5IGG A;  4L8J A;  1BCP F;  1PMR A;  4A3B B;  5FO9 B;  2K52 A;  2HDM A;  2H5X A;  2JA8 B;  4A3G G;  1LM0 A;  3D4W A;  3FEW X;  4ODG A;  4A3M B;  3NTI A;  2K32 A;  3RUZ A;  1HJP A;  2RKS A;  3EBE A;  4K6L A;  3LWU A;  4C3H G;  4DV6 L;  2YTX A;  2LS0 1;  4C3H H;  3BU2 A;  3SK4 A;  4DV3 Q;  4XXE A;  5CGK A;  3J80 c;  1JIC A;  1VQD A;  4DV0 Q;  2BA1 A;  4C56 C;  4Y7N B;  1SYE A;  1SJE D;  4DPG A;  3A8J E;  4AIM A;  1A2T A;  4MZ9 A;  3GTO B;  2KJX A;  2NUC A;  1Q1E A;  3VR3 A;  2V4D A;  3TP8 A;  5KNB A;  4OL7 A;  2KQ3 A;  3H0G G;  3AU7 A;  3OMC A;  2CHB D;  3NE5 B;  4YCU A;  1WOC A;  2A6E D;  4JI3 L;  1B7Y B;  5KYI A;  3GTJ B;  4LFC L;  1X3G A;  1AH9 A;  5A2Q E;  4IAL A;  2EOT A;  2A6E C;  3P7J A;  4P2C B;  2KCT A;  3J7Z C;  1TY2 A;  4IUP A;  2ES2 A;  1JOQ A;  3QG1 A;  4J6H A;  1U4P A;  3HOX H;  3MAQ A;  2IY5 B;  1VQM A;  4DR7 Q;  3CU7 A;  1EIF A;  1L2F A;  3F2U A;  5LMN Q;  4GLV B;  2JP1 A;  1F9P A;  5IP9 H;  1A62 A;  2RHS B;  3K6O A;  2JA7 G;  2ZJQ A;  5EJW A;  2JEA I;  3EQL C;  3PUV A;  3RN5 A;  2PZW A;  4N9P A;  2DNE A;  4M1U B;  5IT9 E;  1NUC A;  5FLX E;  1Q12 A;  1Q7Y C;  3IFT A;  5CV6 A;  2YTY A;  5AJ3 L;  4GN4 B;  4A3G B;  2FHT A;  4DAY A;  3F1Z A;  1I6V C;  3H3V I;  1I4G A;  4DR3 Q;  1EQQ A;  1QNU A;  4C3H B;  2ZJR A;  4KKU A;  2QKI C;  1K8M A;  1SNP A;  1FGB D;  5FK9 C;  5D65 A;  3WOF A;  2O2L D;  1EYA A;  3RN2 A;  3HOZ G;  1ILP A;  4F8M A;  2MGS A;  1K0S A;  4JOI C;  1I4H A;  2F0Q A;  4QL5 A;  3GTP B;  2WP8 J;  3TRZ A;  1F2L A;  5KYL A;  3S24 A;  1SRO A;  1D1K A;  4RFB A;  1Q8I A;  2QEJ C;  4KI0 A;  4L6T B;  5IYB G;  4X62 Q;  1SND A;  3H0G B;  4IPG A;  1VF5 C;  1J9O A;  3T13 A;  4DV5 Q;  1F9R A;  5COR A;  2B2Y A;  4KY5 A;  3ZYY X;  2FJ2 A;  4RG1 A;  4X3T A;  3WDN A;  3HOY H;  1DGS A;  4UAI A;  3T56 B;  1PFS A;  3E9I A;  1S40 A;  2KEE A;  1G29 1;  2F0J A;  2HCI A;  1PZK D;  3OIQ A;  2JA7 B;  3I7F A;  3CPW A;  3I56 A;  3NTK A;  1TR5 A;  5GRO A;  2M2L A;  3SDZ A;  5I2X A;  1GHJ A;  4CKC A;  1PH6 A;  4A3L G;  4R4O A;  4G4K A;  1T5E A;  2PZT A;  3CHB D;  2VL6 A;  2R92 H;  1Q3L A;  3SE0 A;  2HQL A;  3AFP A;  2Z0S A;  1IBM Q;  3CW2 C;  2RQX A;  1U4M A;  4UPA A;  4X64 Q;  3NQT A;  3SVM A;  1KAW A;  4A3D H;  1PH4 A;  3G48 A;  2K75 A;  2D62 A;  3I4O A;  3KF8 A;  3PMF A;  1Y1V G;  2NVY B;  2RVL A;  5M5Y H;  4IPC A;  1VQJ A;  4ID6 A;  1WJJ A;  4HED A;  5M3F H;  1Q82 C;  3K7A H;  1EY4 A;  3HOZ B;  1Y69 U;  4AYB G;  2QA4 A;  1MSH A;  4FF4 A;  1JQY D;  3A74 A;  3NEL A;  4IPD A;  1T5X D;  5C4X G;  4OEM B;  1F9Q A;  1RJT A;  4JVZ A;  2KHS A;  5C4X H;  1HUM A;  4PMC A;  3T1H L;  1GOZ A;  1EWC A;  3CXC A;  1IBL Q;  4EVO A;  3DMU A;  4POF A;  1B8A A;  1CHQ D;  1D5M C;  2BE5 D;  1TII D;  5IGC A;  2VZA A;  3MXG A;  1E2V A;  4RWS C;  2K5N A;  3NEM A;  5M9O A;  1PLF A;  2D5D A;  3NQI A;  2BE5 C;  3S9W A;  1AE2 A;  3EN2 A;  3KYH C;  4WOR A;  2Z8L A;  1NR2 A;  1G91 A;  2VB2 X;  3DEP A;  4DV6 Q;  4C3I G;  5DM6 3;  5BR8 L;  1X3F A;  4C3I H;  4RGT A;  1M8A A;  1JT8 A;  2PNH A;  3K0Y A;  2R7Z H;  4DU9 A;  1LYL A;  4GN3 B;  3KLR A;  3PCO B;  2EQS A;  2WAQ G;  1I3Q H;  4A75 A;  3CCJ A;  2L55 A;  1SNC A;  2F0G A;  1C48 A;  1T9H A;  1A3V A;  3AB9 A;  3C2P A;  1LO5 D;  4YIJ A;  3S14 B;  3S1Q B;  1HXY D;  4YWM A;  1STB A;  3TZD A;  2KCM A;  2E74 C;  4JI3 Q;  5KEE A;  1SXT A;  1SE3 A;  4C2M B;  1ONL A;  1WTH A;  4LFC Q;  1Y1W G;  5CV4 A;  2R6G A;  1BVS A;  1Y1V B;  1Z7T A;  4H13 C;  1JWM D;  2JA9 A;  4XYQ A;  1Y1W H;  5GAE C;  4DV1 L;  4R8N A;  5GQO A;  2QDB A;  4B3S L;  4ABN A;  4DAM A;  1HNX L;  1M90 C;  1XPO A;  3ND9 A;  4AYB B;  4KMU C;  1HTL D;  1PDQ A;  4A3C G;  4K2K A;  2F3V A;  1IZ6 A;  2G9D A;  1Q81 C;  4A3C H;  5C4X B;  1LT6 D;  2E2H H;  1NCV A;  4GLX A;  2E5L L;  4HR7 B;  1IKM A;  1SEB D;  3FRP B;  1WCM H;  3R2T A;  4NXM L;  3BDC A;  3IL8 A;  1E2W A;  3K0X A;  4UP7 A;  4IN3 A;  5AJ3 Q;  4ZKB B;  1BCP B;  3J80 E;  1F2M A;  3BVM A;  3A5Z B;  3DHQ A;  4DKA C;  5JJZ A;  3S15 H;  5J22 A;  3N52 A;  3K5N A;  3I4N G;  1STN A;  2F0D A;  3VR5 A;  4QIW E;  4C3I B;  5JJK A;  1CKN B;  3Q0A A;  4FDB A;  4TSS A;  3I4N H;  5HY6 A;  2RF4 A;  3TP6 A;  2N78 A;  1Y8O B;  3D3R A;  3ERS X;  1S5F D;  1CFM A;  4BS9 A;  4HIM A;  2O4X A;  3GV6 A;  2WV6 D;  1FR3 A;  1N33 L;  5ELE A;  4OO1 H;  1PFN A;  2OF1 A;  3CRL C;  4OHJ A;  3T53 B;  2WAQ B;  2ZT9 C;  4IUQ A;  5M5X B;  4N8X 1;  2MFI A;  4DNT B;  1PH8 A;  4JK1 C;  4IFD G;  2CFM A;  1VQK A;  2DUD A;  3DXJ C;  5EQ0 A;  4IFD H;  2SDF A;  2NVX H;  3TDQ A;  5CC4 A;  3HKZ E;  1K83 H;  2I5H A;  5JJI A;  1VQB A;  2DY8 A;  3HG9 A;  4O1N A;  1XNR L;  1E7Z A;  2EIF A;  1Y1W B;  2GVA A;  1EYC A;  3BVG A;  3LGJ A;  4YCW A;  1Q8K A;  1IYJ B;  1QUQ A;  4V0B A;  1DM0 B;  5C3E G;  5KRU A;  3H15 A;  4ZYS A;  1KLU D;  2NVT H;  1PTO D;  1GJX A;  3NPP A;  5C3E H;  2B63 G;  4RH6 A;  1O7Z A;  3SR1 A;  3U4Z A;  1PTO C;  2AWO A;  2E75 C;  1CK1 A;  1EZ8 A;  3CCQ A;  1WD0 A;  2B2V C;  1EUJ A;  1WTQ A;  1HNW L;  2C35 B;  3NTH A;  4C1N K;  2RHQ B;  4KN7 C;  1TT2 A;  4ZUJ A;  1VDZ A;  2HD3 A;  3GTG H;  3ZJY C;  4DXG A;  1V1P B;  2XWB B;  2UXC L;  3S15 B;  4QY7 A;  1SE2 A;  4BY1 H;  1B3Q A;  5FO7 B;  3CCL A;  3I4N B;  1YNJ D;  4HJ8 A;  4JI7 L;  5BN3 A;  5C4J B;  4GOP A;  5M3M G;  4TVA B;  1YNJ C;  1TVX A;  3HKS A;  1GKH A;  5M3M H;  1MI2 A;  1G51 A;  3MXU A;  2DJG C;  2RCF A;  1ESF A;  2C5C A;  3WOE A;  4B3R L;  3S17 H;  3FVQ A;  1IKL A;  1EY7 A;  2QGQ A;  2G9H D;  1QCB D;  1VQO A;  4DR2 L;  3RZO B;  2NVX B;  1JB3 A;  5FOB B;  2N55 A;  3T1H Q;  4KJN A;  4FF3 A;  5BN4 A;  4JI2 L;  4TRD A;  4MIU A;  3N6R A;  4JG2 A;  2MNA A;  4JBW A;  1SE4 A;  2R3Z A;  1CA5 A;  4NW2 A;  1EYD A;  4A3J G;  4DXF A;  4HAE A;  4X6A H;  1X6O A;  4N9T A;  2B2T C;  2CQA A;  4PG3 A;  4A3J H;  4ZKC B;  1X3E A;  3NUC A;  3PIP 3;  1F77 A;  1PHJ A;  4GLA C;  5C3E B;  1VQE A;  3S1N H;  1KL9 A;  4HN7 A;  5IOC A;  3A8K E;  5BR8 Q;  2B63 B;  3M3Y H;  1SYB A;  3E3X A;  3K5L A;  4A3F H;  1EOT A;  2NN6 H;  2A19 A;  1S5D D;  2KED A;  1U4L A;  4NMZ A;  2PMZ E;  4JPB W;  1GM5 A;  3BYY B;  5CV9 A;  2K33 A;  3OIP A;  4HID A;  4YHH L;  2KEN A;  4DAP A;  2LKV A;  3T4A C;  4UY8 C;  4KY7 A;  1AP0 A;  1XYI A;  1KRS A;  3OMG A;  2HQE A;  2QF7 A;  3TZU A;  4JI0 L;  3S1M H;  1OXU A;  2K50 A;  1ROD A;  1YJN A;  1X3Q A;  2OXP A;  4L5T A;  1N36 L;  5K36 H;  4HJ9 A;  3U50 C;  3ER0 A;  1OXT A;  3ERQ A;  1L1O B;  3M85 A;  5IYD H;  3SK5 A;  3S1R H;  5M3M B;  4DV1 Q;  4FXG C;  4B3S Q;  1LTS D;  2XTI A;  4CDE C;  4DR4 Q;  5E4W C;  1VMP A;  4S3S A;  1OXV A;  4EGV A;  1HNX Q;  1HHV A;  3UDX A;  1Y8P B;  3CQZ B;  2AQ3 B;  1PTO H;  5C5L A;  1G2T A;  3CD6 A;  3TN2 A;  1WTP A;  3DWA A;  2FXQ A;  1K28 A;  5DNF A;  2E5L Q;  4R9W A;  2EY6 A;  3W5O A;  3KBX A;  3PUY A;  4CJ0 B;  3T1Y Q;  1ENA A;  4NXM Q;  1O7Y A;  2EYF A;  3AFQ A;  4A3M H;  4XIG S;  3MFY A;  1Q86 C;  1BKB A;  1TWH B;  4A93 G;  2TSS A;  1TWF H;  1IXR A;  3QOL A;  5IIF A;  1BQQ T;  4ZAI A;  3TP5 A;  2XWJ B;  2F0U A; 
#chains in the Genus database with same CATH homology
 3GO5 A;  4GN4 B;  4AYB E;  4Y7N H;  3CAM A;  4DV7 L;  2Q2I A;  3F1Z A;  4DR1 L;  3H3V I;  4DUY Q;  1XJV A;  4DR3 Q;  2VUM G;  2Y0S E;  2HIV A;  2KHI A;  4X66 L;  5C0X J;  1EQQ A;  2R7Z G;  1GD7 A;  1QZH A;  3DLL A;  2VUM H;  5GAH C;  1N33 Q;  2V1C C;  1IBK L;  2ZJR A;  1CKM A;  3M9B A;  4GN5 A;  1KIX A;  2VNU D;  1SMX A;  2D0P A;  2ZJP A;  1NMF A;  4JV5 Q;  1YI2 A;  4GOP B;  1LTL A;  2JEB I;  1RIP A;  4R1J A;  2R93 G;  2VY3 A;  4LFA Q;  3CCV A;  3CQZ H;  4JI5 L;  3GTJ H;  4DV3 L;  3HOZ G;  3RN2 A;  2R93 H;  2Q2T A;  2QEX A;  4A4I A;  3F2C A;  4PZ6 A;  3UDI A;  3G6E A;  4JOI C;  2UXD Q;  3W1B A;  3CP0 A;  3L7Z C;  1TXY A;  2ZTE A;  3PV0 A;  3CCS A;  1EQR A;  5IYC G;  2LSS A;  3F2B A;  1EWI A;  5GAD C;  2VS1 A;  1XNR Q;  4QL5 A;  2ZM6 Q;  1SLJ A;  5C0X G;  1K0R A;  2WP8 J;  3J81 j;  3TRZ A;  2HT1 A;  3S24 A;  1SRO A;  3OTO L;  4KI0 A;  4X62 Q;  5IYB G;  1N34 L;  4AQY L;  3KDF A;  4IPG A;  2EXD A;  4BY7 G;  4JYA L;  4DK6 C;  2AHO B;  1X55 A;  3CCU A;  3IRB A;  4UP9 A;  4DV5 Q;  4DR4 L;  2N49 A;  1VQN A;  3D31 A;  1JE5 A;  1P8L A;  1RL2 A;  1TWH H;  2OQ0 A;  2VQE Q;  4RG1 A;  1UEB A;  2WAQ E;  2A1A A;  3HOY H;  1Q1B A;  2AWN A;  3F8T A;  1DGS A;  1EIY B;  3AYH B;  4P74 A;  4A3I G;  4BA2 I;  2F4V L;  1XPR A;  4A3G H;  4A3K G;  1HNW Q;  1PFS A;  3E9I A;  2IX1 A;  1S40 A;  3J7A 5;  1KD1 C;  1G29 1;  3PO3 G;  1WCM G;  1QVC A;  4A3K H;  4GKJ L;  3I7F A;  3CPW A;  3GTL H;  1VCI A;  3T1Y L;  3W1G A;  3I56 A;  1VQP A;  3H3V H;  2UXC Q;  5GRO A;  4DNI A;  1PH2 A;  1KXL A;  1V43 A;  1D7Q A;  4R4Q A;  1GO3 E;  3PF4 A;  4NPS A;  2JQO A;  1PVO A;  1PH6 A;  4A3L G;  4R4O A;  1X9N A;  1CKN A;  2I5L X;  1E3P A;  2VL6 A;  2WB1 E;  3K81 C;  4JI7 Q;  3EIV A;  4IFD J;  2R92 H;  4DV4 Q;  1PV4 A;  1YHA A;  3RLO A;  2HQL A;  3BJU A;  1FGU A;  5IY0 A;  3AFP A;  2Z0S A;  4LF4 L;  2GVB A;  1XMO L;  1IBM Q;  3CW2 C;  4YWK A;  4UPA A;  4X64 Q;  4LFB Q;  2XGT A;  2E2J H;  2D0O A;  4DUY L;  2UUA L;  1KAW A;  1V1Q A;  3FP9 A;  4B3M Q;  2GN5 A;  1PH4 A;  3G48 A;  2K75 A;  2D62 A;  3PGZ A;  2HHH L;  3I4O A;  2UUB Q;  4B3R Q;  1Y1V G;  4LF5 L;  3M4O H;  3PO3 H;  1HZC A;  1Y14 B;  4OO1 G;  4LNQ A;  1UWV A;  4IPC A;  2NZO A;  3H0G H;  5M5Y H;  1J5E Q;  4BXX G;  1VQJ A;  1YVC A;  5FJ8 G;  4DR2 Q;  5M3F H;  1WJJ A;  5C44 G;  2WFW A;  1Q82 C;  4MNO A;  3K7A H;  2Q2U A;  2DGY A;  4LF9 L;  4BXX H;  2ID0 A;  5FJ8 H;  4AYB G;  4JI2 Q;  2QA4 A;  5C44 H;  1VQ4 A;  4LUV A;  3S16 H;  1BBU A;  2UXB Q;  3A74 A;  5C0X I;  4GNX A;  3NEL A;  4IPD A;  4TQU S;  1N32 L;  2Y0S G;  1BBW A;  3KFU A;  4DR6 Q;  5C4X G;  2F3I A;  2LXK A;  2ALY B;  4P71 A;  2I5M X;  4BBR H;  2VQF Q;  4Y52 H;  5C4X H;  1ASZ A;  3T1H L;  4UP8 A;  1VQC A;  3CXC A;  4HJA A;  4DUZ L;  4DV2 Q;  1X56 A;  1IBL Q;  1C0A A;  3VDY A;  1G6P A;  4NXN Q;  2OCE A;  1TWA H;  2K5V A;  2JA7 H;  4POF A;  2JA5 G;  3PF5 A;  4LWC A;  1B8A A;  2IT1 A;  1XNQ L;  2JA6 G;  1VQF A;  4KHP Q;  4X65 L;  2BH8 A;  2JA5 H;  1MJC A;  1KRT A;  5M5W H;  2VZA A;  4A76 A;  4APV A;  2K5N A;  3NEM A;  3CMA A;  1HNZ L;  3OYY A;  4A93 H;  4IOC A;  4LF7 Q;  1K3R A;  2OTL A;  1AE2 A;  2MQH A;  3EN2 A;  1TWC H;  3KYH C;  4KLK A;  1K73 C;  4JI8 L;  1WYD A;  4DV6 Q;  1PH7 A;  1UE1 A;  4LF8 L;  2MO0 A;  1WI5 A;  5BR8 L;  4YHH Q;  3S2H H;  4JC0 A;  1X3F A;  3F2D A;  2F52 A;  3G4S A;  4C3I H;  3PSI A;  4DAY B;  2IX0 A;  2PNH A;  3MEF A;  1A63 A;  4JI1 Q;  1VS0 A;  1JT8 A;  3BZC A;  5JJL A;  2B3G A;  4JI0 Q;  4EX5 A;  2R7Z H;  4L5R C;  3PO2 G;  1LYL A;  1VQ7 A;  3RZD H;  4GKK L;  4GN3 B;  5IT9 c;  4BY1 G;  3PO2 H;  1HH2 P;  2NVY H;  3PCO B;  4A3E G;  4A3B H;  5FLX c;  2A8V A;  2EQS A;  2WAQ G;  1I50 H;  1I3Q H;  4A75 A;  3CCJ A;  1N36 Q;  3GD7 A;  3PIP A;  3L2P A;  1T9H A;  1KC8 C;  1C9O A;  3HOZ H;  3S2D H;  4DV0 L;  1IL2 A;  2MO1 A;  2Q2H A;  4JI4 L;  4OX9 L;  4QQB X;  4LF6 Q;  4J15 A;  4YWM A;  3TEH B;  2OWO A;  2KCM A;  1JJ2 A;  4JI3 Q;  5IYC H;  3CF5 A;  5IP7 G;  3KF6 A;  4L5Q A;  4OO1 I;  4LFC Q;  1Y1W G;  3FKI G;  4YY3 Q;  3I4M G;  1WFQ A;  1BVS A;  2R6G A;  4JBM A;  2JA9 A;  4HJ7 A;  1XMQ Q;  2UU9 Q;  3CCE A;  1E1T A;  3FKI H;  5IYB H;  5GQO A;  5GAE C;  4MTN A;  4DV1 L;  4DR5 Q;  3ULL A;  3TS0 A;  1OTC A;  4B3S L;  4ALP A;  3RR5 A;  1ASY A;  5EAY A;  4BY7 H;  4DAM A;  2ATW A;  4K0K L;  3KDF B;  1YIJ A;  1M90 C;  1HNX L;  4IFD I;  2WB1 G;  1XPO A;  1QVG A;  1Y1W H;  2K4K A;  1SRU A;  4GNX C;  1HR0 Q;  4A3C G;  1HZA A;  1E1O A;  1HZB A;  1I94 Q;  1IZ6 A;  3BZK A;  1V9P A;  5JEA J;  3HOV G;  4R4I A;  1Q81 C;  4BBS G;  3TQY A;  1X65 A;  4OWX B;  4A3C H;  1MKH A;  1P16 A;  2HIX A;  1D8L A;  4B3T L;  3HOV H;  4BBS H;  2L15 A;  2E2H H;  4GLX A;  2E5L L;  4A3I H;  3MXN B;  4DR7 L;  5LMN L;  2UUC Q;  4AH6 A;  1WCM H;  4OXP A;  1CUK A;  1JB7 A;  1XPU A;  3CME A;  4NXM L;  1J6Q A;  3K0X A;  4UP7 A;  5AJ3 Q;  1VQ6 A;  1FVI A;  1AE3 A;  1EOV A;  1K9M C;  1TWG H;  2IHE A;  4JI6 L;  4HJ5 A;  3A5Z B;  1VQA A;  3SGI A;  4DKA C;  4JCV E;  4DV7 Q;  1O7I A;  4DR1 Q;  4A3F G;  2K14 A;  2NN6 G;  3K7U C;  4O0A A;  3S15 H;  5LMU Q;  2YU9 H;  4A3L H;  4X66 Q;  1CSQ A;  1XTD A;  5JEA G;  1FJG L;  5IE8 A;  3ULJ A;  3KJO A;  3I4N G;  1JJG A;  4LF7 L;  4LUO A;  1K8A C;  4QIW E;  1A8V A;  3NBH B;  1IBK Q;  1PYS B;  1CKN B;  3GTK H;  5JJK A;  4FDB A;  3I4N H;  4PZ8 A;  5HY6 A;  1QVF A;  1YEZ A;  2RF4 A;  3GTM H;  3S14 H;  3S1Q H;  2N78 A;  5E7N A;  1PH1 A;  4IJL A;  1NJI C;  3ERS X;  3J80 i;  4DR3 L;  4HIM A;  4IPH A;  3ULP A;  4JI5 Q;  3I2Z A;  3RNU A;  2PQA A;  3CC2 A;  4C2M H;  1E22 A;  2E8G A;  4JI1 L;  1N33 L;  1Y1V H;  1PYB A;  1Z9F A;  3KF8 B;  1FL0 A;  2YYZ A;  4JV5 L;  1NY4 A;  1L1O A;  2MFI A;  5K36 G;  1PH8 A;  3HOU G;  1NE3 A;  4LFA L;  4IFD G;  2CFM A;  1VQK A;  4RMF A;  5IYD G;  2DUD A;  3OTO Q;  1PH9 A;  3HOU H;  1N34 Q;  3HOW G;  3GTP H;  4AQY Q;  2NVX H;  4OWW B;  4JYA Q;  3HKZ E;  1K83 H;  1GVP A;  2CQO A;  2JE6 I;  5GAG C;  2I5H A;  4QGU A;  1M1K C;  2UXD L;  5JJI A;  1VQB A;  4GNX B;  4IO9 A;  1YJW A;  4JBK A;  3L0O A;  1HR0 W;  1XNR L;  2ZM6 L;  1E7Z A;  2EIF A;  2NZH A;  4DK3 C;  4IOA A;  4P73 A;  2ZTD A;  5J3B A;  2GVA A;  3LGJ A;  4C3J H;  5IWA Q;  3E0E A;  1SE8 A;  3Q8D A;  2CWA A;  4YCW A;  1Q8K A;  1OXX K;  2KHJ A;  1IYJ B;  1QUQ A;  4X62 L;  1KQS A;  1OXS C;  3HOX G;  5C3E G;  2JA6 H;  3KLW A;  4JBJ A;  3H15 A;  4DR5 L;  2NVT H;  2IHF A;  4GS3 A;  5C3E H;  3KJP A;  4DV5 L;  2B63 G;  4A3B G;  2JA8 G;  1PH3 A;  1I6H H;  3U4Z A;  2Z6K A;  4OON A;  3HFZ B;  5IP9 G;  2CKZ B;  3CCR A;  3ICE A;  1E24 A;  3M7N A;  2JA8 H;  2AWO A;  2OQK A;  2R7F A;  2E2I H;  4GKJ Q;  3CPF A;  2VQE L;  2B29 A;  5ELN A;  4A3M G;  3OW2 A;  3TRE A;  3CCQ A;  3NEN A;  2AMC B;  1UE5 A;  1EUJ A;  1VQ9 A;  4P72 A;  1HNW L;  2C35 B;  1NMG A;  3M4P A;  3PUX A;  1SR3 A;  1MIU A;  1SN8 A;  2JJQ A;  2RHQ B;  1U0L A;  3D0F A;  3FHW A;  4P75 A;  3KOJ A;  3GTG H;  2LXJ A;  3ZJY C;  2NN6 I;  5ELO A;  1PA6 A;  4H02 A;  2UXC L;  3J81 i;  4QY7 A;  1R9T H;  4BY1 H;  4A3E H;  4LF4 Q;  1XMO Q;  3AQQ A;  3J81 c;  5M5X H;  3CCL A;  2UUA Q;  2F4V Q;  2BA0 A;  4HJ8 A;  1MJE A;  2HHH Q;  5LMU L;  1QZG A;  4JI7 L;  4LF5 Q;  3STB D;  4DV4 L;  4GOP A;  2CCZ A;  3GTO H;  5M3M G;  4TVA B;  3HKS A;  3GTQ H;  1GKH A;  5M3M H;  1VQ8 A;  1W3S A;  1VQI A;  5IP7 H;  1G51 A;  1IBM L;  3STB C;  1LUZ A;  3U58 A;  4LF9 Q;  4WJ4 A;  4X64 L;  4LFB L;  3KF6 B;  4B3M L;  3I4M H;  4R4T A;  3B6Y A;  1A0I A;  2YTV A;  2CWP A;  2RCN A;  3A0J A;  4LUZ A;  3UDG A;  2UUB L;  4B3R L;  4PMW A;  2PI2 E;  5FLM G;  3CCM A;  3S17 H;  1CKO A;  1L0W A;  1N32 Q;  1VQ5 A;  2QGQ A;  1L1O C;  1YHB A;  5FLM H;  1J5E L;  4EQ5 A;  1VQO A;  4DR2 L;  3PIO A;  1X54 A;  2N8N A;  3WWV A;  1U5K A;  3T1H Q;  4LW1 A;  4JI2 L;  4DUZ Q;  3RLF A;  1VQG A;  3PUZ A;  2UXB L;  1JJC B;  4JG2 A;  2MNA A;  4JBW A;  4GKK Q;  3DM3 A;  1XNQ Q;  4DR6 L;  1UE7 A;  1N9W A;  4A3J G;  4X65 Q;  2ZTC A;  4X6A H;  2VQF L;  1X6O A;  4PG3 A;  4A3J H;  5LMN W;  1YHQ A;  1HNZ Q;  3UDF A;  3K8A A;  1X3E A;  1H95 A;  2JK8 A;  1N8R C;  3UE0 A;  4DV2 L;  1YIT A;  1IBL L;  1PHJ A;  4GLA C;  4NXN L;  3HOY G;  1VQE A;  4JI8 Q;  1KL9 A;  4NB3 A;  5IWA L;  3S1N H;  1VQL A;  4A3D H;  4KHP L;  1B70 B;  2YV5 A;  4LF8 Q;  2R7D A;  5BR8 Q;  1C7Y A;  2K52 A;  4ME3 A;  2Z6K C;  3M3Y H;  2H5X A;  2N3S A;  4A3G G;  1LM0 A;  3HKZ G;  4A3F H;  2A19 A;  4XTC S;  2KBN A;  3E9H A;  3PUW A;  3A5U A;  2ASB A;  1CSP A;  2PMZ E;  1GM5 A;  1HJP A;  3EBE A;  3GDE A;  2PI2 A;  4IJH A;  3JC6 6;  4DV6 L;  2YTX A;  5C4J H;  4HID A;  4YHH L;  4C3H H;  2KEN A;  4UY8 C;  3BU2 A;  1Q46 A;  1W2B A;  1KRS A;  5H1S E;  4DV3 Q;  2OTJ A;  1S3O A;  3J80 c;  4JI0 L;  4POG A;  1VQD A;  2K5H A;  4DV0 Q;  3S1M H;  2BA1 A;  4JI4 Q;  4OX9 Q;  2R92 G;  2PQA B;  1OXU A;  4DPG A;  3I55 A;  2K50 A;  4JOI A;  3M4Q A;  1YJN A;  1VQH A;  4L5T A;  4AIM A;  1N36 L;  1JMC A;  4L5S A;  4HJ9 A;  3RZO H;  4MZ9 A;  3U50 C;  3ER0 A;  1OXT A;  4YWL A;  4A3D G;  1L1O B;  4HIO A;  4GOP C;  3M85 A;  5IYD H;  3S1R H;  3U4V A;  1SFO H;  1NBW A;  1Q1E A;  3HOW H;  4DV1 Q;  1EYG A;  3CC4 A;  4KHZ A;  4B3S Q;  4LF6 L;  4K0K Q;  3CC7 A;  2XTI A;  3H0G G;  4DR4 Q;  1HNX Q;  1OXV A;  4YCU A;  1WOC A;  3UDX A;  4JI3 L;  5M3F G;  1Z47 A;  4HIK A;  1B7Y B;  2I0Q A;  4LFC L;  1KHI A;  2BH2 A;  1YZ6 A;  1I5F A;  4YY3 L;  1X3G A;  1AH9 A;  3RLN A;  3CD6 A;  4WJ3 M;  2KCT A;  3J7Z C;  1XMQ L;  2UU9 L;  1UE6 A;  1K8G A;  4OWT B;  2ES2 A;  2VW9 A;  3HOX H;  4B3T Q;  3K80 C;  1EFW A;  1YBY A;  4BBR G;  1QUQ B;  2FXQ A;  2IY5 B;  2E5L Q;  1VQM A;  4DR7 Q;  1HZ9 A;  1EIF A;  1L2F A;  2B63 H;  5LMN Q;  4GLV B;  3W5O A;  3PUY A;  1HR0 L;  3T1Y Q;  5IP9 H;  1S72 A;  1I94 L;  4NXM Q;  1A62 A;  2RHS B;  3AFQ A;  2JA7 G;  4A3M H;  2ZJQ A;  3JAM i;  4XIG S;  4BA1 I;  3AEV A;  4JI6 Q;  4QJF A;  2JEA I;  5HGQ A;  3PUV A;  2NVQ H;  3RN5 A;  3TS2 A;  1Q86 C;  4YCV A;  3JAM c;  1BKB A;  1YNX A;  2UUC L;  1YJ9 A;  4A93 G;  1PH5 A;  4PZ7 A;  1Q7Y C;  1Q12 A;  1FJG Q;  5DLQ E;  3UE1 A;  1TWF H;  2AKW B;  1IXR A;  2YTY A;  4O2D A;  5AJ3 L;  4R4C A;  3G71 A;  1NTG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...