2KJXA

Solution structure of the extracellular domain of jtb
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
65
structure length
65
Chain Sequence
b'GSGMKEFPCWLVEEFVVAEECSPCSNFRAKTTPECGPTGYVEKITCSSSKRNEFKSCRSALMEQR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Jumping translocation breakpoint protein
publication title The structure of the extracellular domain of the jumping translocation breakpoint protein reveals a variation of the midkine fold.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 8
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.490 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2kjxA01
2KJXA
chains in the Genus database with same CATH superfamily
3F1ZA 1MSHA 3HOVH 5M5WH 3L2PA 1YNND 2O5IC 1DCZA 1TWCB 2YV5A 3CCSA 2AWNA 1CA6A 2RSOA 2B29A 1X3QA 2AKWB 4BBSG 1LO5D 5I4DA 2E5LQ 5CV9A 1JORA 3GTJB 1UEAB 4GNXB 5C4HA 3NHHA 5C44B 3CC7A 1D5ZC 2CW0D 4A3JG 2PNRC 4J8QA 4DUZQ 1BVSA 1A62A 1CTMA 2KHIA 2UXDL 2N3SA 4KKUA 3VYRA 4KY7A 1BUVT 3R2IA 4U673 3KFUA 1TVXA 2MP1A 4IFDJ 3CMEA 1PMRA 1I4HA 2PZTA 3W2DA 2JA8H 3S17H 5CMDA 1SJHD 4AQYL 3A8JE 2F4VL 4DUYQ 4X6AH 4JI0L 2KUMA 4R4IA 4JI6L 1IBLL 3MXNA 2NUCA 1YJ9A 1QCBD 4HIMA 3WDNA 1G6ZA 4J15A 3J7AV 3TS2A 3BVGA 5IGEA 4PG3A 4DV0Q 4X62L 2UUCL 4XYQA 2B63B 1PYWD 4MNOA 4AH6A 4RMFA 2RHSB 5D3IB 1KD1C 1GO3E 2Z4IA 2CKZB 1TWGB 1EIHA 1CT1D 4K5WA 1RTOA 1X3PA 1BKBA 3S1QH 1IZ6A 3J81E 1SYFA 1VQPA 1DOMA 4NXNQ 4OX9Q 2PZUA 4GKKL 5EKKA 2DNEA 1D7QA 4IUVA 2QCPX 2XRQD 4BY7B 1O7YA 3FPPA 2HDLA 1XPOA 2CFMA 3TBIB 4DV4L 3K0XA 4JBWA 2ZXPA 5IWAL 2EYFA 5C3XA 1K9MC 1EOTA 4FDBA 4ME3A 1L2FA 2I46A 3V2TA 4HIKA 4HMJA 2ZTEA 2K01A 1T5XD 2NB0A 2IPKD 1V9PA 5JVG3 4A3EG 3HP3A 2KCNA 5BN3A 3GTPH 2PI2E 1GUNA 1AP0A 2LMCB 4CDFC 2RDFA 3RUZA 5JAVA 4DV3L 1SXTA 2JA5G 4A3GG 3S1MH 1N8RC 1JMCA 3RD4A 1HH2P 1VQ5A 2DNCA 1EWHA 1XNRQ 1WCMG 1IXRA 3J80c 1PVOA 2N78A 2BH2A 4KY6A 4UDUC 2PQAB 4DU9A 2HHHL 1V1PA 4KJOA 1H9KA 3M7GA 4XTCS 4G7ZC 3A0JA 3H6MA 1S5DD 1A3TA 3MEFA 1NR2A 4A3IH 4ZYSA 5C4XB 3BVMA 2RF4A 2QEJC 4KN7C 1VQGA 3KK7A 2NVYH 2D0OA 3S24A 1PH5A 3NTHA 1B3AA 1HTPA 1SFOB 2Y0SB 4ME5A 4A3DH 2EXZA 3IAYA 4YCWA 4JI7Q 5LL6S 5D65A 1KDAA 4RFBA 3R93A 3SEBA 2K32A 2K05A 2MJ8A 1QNUA 4QQBX 4EGVA 3M9BA 4YWLA 3CCUA 1MKHA 5KYIA 4JI3Q 1HUNA 4I7ZC 5J3BA 4A4IA 3J80E 5I6YA 1G6PA 4ZQ3A 4PMBA 4DV1L 2NVQB 1N33L 3AU7A 1A15A 1EYDA 1PH8A 1LTBD 1NCVA 4B08A 3AYHB 3J80i 2JA6G 2B3GA 1LABA 2ZJPA 1BBXC 4BBRB 1GUTA 1ENCA 2DJGC 3SK5A 4DAVA 1ET6A 1Y1VG 1FNVA 3B6YA 4L5RC 3MXNB 4HN7A 1TWFB 2L5TA 4PMCA 1J5EL 4LFBQ 2A69C 5KNDA 2LXJA 4M1UB 1DYQA 4X65Q 1FYCA 1VMCA 1PDQA 2ENBA 1ZYRC 5A35A 1K8AC 3DWPA 4NB3A 3BDCA 2F3WA 4O2DA 5IGCA 4N8FA 1GD7A 2UXDQ 5G3LD 1TS2A 3A8IE 1BQQT 2XIWA 1PTOF 1X3EA 3R8BA 2BA0A 1S5ED 4AQYQ 3VR4A 2F4VQ 4K5XA 1I94L 3JAMc 2VZAA 1CKOA 1MD2D 1NMGA 4N9PA 4A3MB 1PXUA 4MZ9A 1TWAB 4V190 4X62Q 5JJKA 3OIQA 3PO2B 4X3TA 1U0LA 2KENA 1O7IA 4OL7A 4WRDA 2RKSA 4P72A 4A3LG 2UU9L 1ICFB 5C4ZA 4F8MA 3CXCA 4ODGA 1B9NA 4OELB 3G4SA 2WB1G 3I4NB 3E6ZX 3EIVA 4DR5L 1RCVD 3KOJA 1TR5A 4ABNA 4GKKQ 1PYSB 4HCSA 3BDOA 3F2UA 4KHPL 3E9IA 4R4TA 4A76A 3JAME 1VCIA 1IKMA 1TY2A 3DEPA 4A3BG 1YJNA 4DV4Q 1EYCA 3K5NA 1SYBA 1V1PB 2F4IA 1FNUA 5M3MG 4OWTB 2OQ0A 1GUOA 1STGA 3TP5A 1YITA 3JAMi 3MAQA 4TRDA 1Y1WH 1NE3A 1DOKA 3EJIA 1PZJD 1LUZA 3QR8A 1YEZA 4G57A 4JK1C 1KABA 3I70A 1JB7A 1PHJA 5CBAE 4XT1B 4X3KA 3HOWB 5C4JH 3ULPA 3ULJA 4KY5A 1Q8KA 4BBSH 4DKAC 1RIPA 3RNUA 3U50C 3I90A 5ELNA 1TWHB 2A69D 2F03A 2A73B 4KD3A 1B3QA 3CKIB 4A3JH 3HOZG 4IURA 1ZYRD 2DUDA 3I4MG 4A3CG 2I5LX 4CJ0B 3CPWA 3HOUB 2IX1A 4HSVA 3FDTA 2JA7B 5FO8B 4N8X1 1UNSA 5ELFA 4BS9A 2KQ3A 4BWGB 4HJ7A 1EQVA 1W3SA 2WV6D 4HCEA 5JOBA 5IE8A 2XGTA 3T4AC 3NTIA 3UI2A 3MXPA 3QG1A 1MJCA 3Q22A 4X64L 3MEHA 4C3IG 3ND9A 1XWEA 5E4XA 2L4NA 3K6OA 2VS1A 2M9VA 1SE8A 4YY3L 5E7NA 1FD7D 1DOLA 2KCCA 4FF4A 4QB4A 5KNCA 1GUGA 2XTIA 4CBVA 1K73C 1VQEA 2A5HA 3L9AX 2AHOB 1QUQB 4IN3A 3GV6A 3LWEA 4Q5VA 3GTOH 1H9MA 1KNEA 2R92B 1CQFA 1DONA 1QNKA 3BZCA 2EYJA 5BN4A 1N33Q 4PZ7A 2IHEA 3DM3A 1XNQL 1LT6D 4JI1Q 1B9MA 3D0FA 5CV7A 1CK1A 2E74C 2WKDA 2NTSA 3LWUA 5D14A 5A2QL 1YIJA 3I56A 3MHBA 3K80C 3O13A 3WOFA 4N9TA 1VQ7A 1RODA 5FKAC 2WAQB 5C3EG 4DNTB 4HR7B 4K8IA 4L6TB 2VQFL 3GP7A 1LTLA 4A3EH 1WTRA 5I2YA 4JCVE 5EPKA 4O0AA 2L12A 4C3HB 4IFDH 1A2TA 4A3GH 4UAIA 3U9SA 1FJGL 4DXFA 3T1YL 4FF3A 4LF4L 3UDXA 4MIUA 3A74A 4LF9L 2XWBB 4GKJL 3T13A 3C3LA 1KHIA 1GUWA 1Q3LA 4HJ8A 1WCMH 1PTOB 3A56A 5JPMC 1I94Q 1N36L 2E76C 1VQMA 4ZKBB 3PIPA 2H4OA 1PTOH 3K59A 1YHQA 2OWOA 1Y8PB 3R2TA 2ASBA 1PRTC 1MJEA 2EYOA 1JE4A 3A8KE 1I6HH 5E1FA 1XMOL 3M3YB 4P73A 2E75C 1ZXTA 2JP1A 5EGTA 1KIXA 1IBML 4FXDA 5K36H 2OTJA 4PMWA 1IKLA 3MC0B 2UU9Q 3M3YH 1LT4D 3BZKA 4BY1B 3CU7A 2XWJB 4GN3B 2BOSA 4FVMA 1R4PB 1EY5A 3EN2A 4CKBA 5IYCG 1FGUA 4ULLA 1G291 4KHPQ 3TRZA 1S5CD 4C2MB 2IJ0A 5T1IA 1Q12A 4NXML 1LT5D 1NR4A 2FHTA 1STYA 1I6VC 3UE1A 2X6GA 2EPBA 2X6LA 2YU9H 1NTGA 4C2MH 2X69A 3K7AB 1S40A 1CI3M 4WFN3 1WVLA 4NDXA 4NPSA 1EEID 4IQZA 5IIFA 4BA2I 4RAUC 3GTMB 2DY7A 2ZXRA 1B44D 2YTVA 2K7VA 1D6EC 2K50A 4POFA 3PMFA 4A93H 1Y1VH 4L5TA 1QWYA 3NUCA 4RG1A 1UAPA 2UUAL 1PZID 4C3JH 2A19A 5K5PA 2JSOA 5IT9c 1SMYC 1CUKA 3J7A5 1X3GA 1A0IA 1JWSD 3PUVA 4POGA 1X55A 4QUCA 2Q2IA 1RHPA 1YBYA 3TN2A 4OIKA 2K5DA 1VQFA 2CQOA 2P5ZX 1I4XA 4UPAA 1EY4A 5CV5A 3J81L 1WTVA 1ESFA 4LUZA 4OO1G 1DD2A 4KMUC 3HOXB 4IUTA 2GA4B 1IYVA 2K75A 1Q86C 2CVRA 1B50A 3T51B 5JEAJ 2QDBA 3H94A 1C9OA 1U4PA 4R9WA 3HOYB 3CW2C 1IYJB 3I72A 4R4OA 5IOCA 3ITPA 1S3OA 3CCRA 2I07B 3RN5A 1VF7A 2F0MA 1NUCA 2CCZA 2N88A 3PGZA 5CORA 3H09A 2B8FA 2VL6A 4JVZA 1WD1A 2KHSA 4GN5A 1E2VA 3OHXC 4LF6Q 3S9WA 1UEBA 2HIXA 1HZAA 3PSIA 4YY3Q 1PRTD 3NP8A 3HKZG 1EQRA 5GAGC 1VQKA 4H0LC 1EWCA 3OWFA 3W5OA 3TSSA 1VQ8A 1LTAD 4DR3L 3A7LA 3VYTA 2JEBI 1CKMA 3ONAB 1HNZQ 3X3NA 3VYUA 4A3MG 1PRTB 4M8AA 4DPGA 4CJ1B 2UXCQ 2E2JH 4FP5D 3UDIA 3GTQH 1EY8A 1SROA 2N8NA 1XNQQ 4LF5L 1S5FD 1WOCA 1VDZA 1E24A 3PO2G 1GVPA 1VS0A 1XJVA 3HOVB 3VR3A 5M5WB 3X3MA 1K3RA 2GN5A 3GV3A 5DAUA 1PH4A 3VR6A 1KLUD 2E2DC 1SE4A 2VXWA 4LF8L 3I4NG 4EVOA 4GN4B 3H91A 1KRTA 5IGDA 4S3SA 2AWOA 3H15A 5JEAG 2ZJRA 2B2WA 4K8JA 5CV8A 1UE1A 2EJFC 2NVTH 3HGBA 4IUPA 1B4OA 2B39A 4OWXB 1VQ9A 1SEBD 4L5QA 1QB5D 3S15H 4XQNA 2LKVA 2KEDA 2K1BA 1M8AA 1IW7C 1SMYD 4ZLTF 1EL0A 1QOHA 1I4RA 4XQQA 1EZ6A 3SR1A 2JA8B 4DAPA 4X3SA 3S17B 4IJHA 3N52A 4DAYB 1UE6A 5GAEC 3HOZH 5IGFA 2VW9A 4GKJQ 2KCTA 5H1SE 5JPNC 5M3FG 1VQ6A 4IO9A 3I4MH 4A3CH 1SNPA 1KAAA 1KNAA 3K5OA 2B2WC 4G4KA 3URYA 4O42A 3ZJYC 2EYMA 4QUFA 5GQOA 4CKCA 3DHQA 4EQOA 4LFCL 3A5UA 2MO1A 3CHBD 3LGJA 5BR8Q 3DXJC 2R3ZA 1M4VA 1NAPA 3ICEA 2SEBD 1WFQA 3HKSA 1EYAA 5LMUQ 4C1NI 1JJ2A 1KTKA 4KN4C 1Z6HA 2IX3A 4JBJA 3HOUG 1B1ZA 1VQBA 2F52A 1SDFA 4HAEA 1HPCA 5ISRA 2F3VA 1JJGA 1G8ZD 1DGSA 2HQLA 4G7OC 3S1QB 4DFAA 2XNAC 1AN8A 1H9RA 4UHVA 4KV6A 5FLXc 2A6HC 2DGYA 1SYGA 3IL8A 4HJ5A 3U9OA 1VF5C 2IY5B 4YWMA 1SAPA 1A2UA 3OW2A 4CHTB 2PMZE 5EPLA 2OCEA 3M4OH 3PO3H 1SNDA 3K8AA 4J1MA 1LTTD 4OO1I 2AQ1B 3GTPB 5J39A 2VUMH 4GZYC 3RN2A 2UUAQ 3S1MB 5ELDA 1O78A 5C3EH 1I4GA 1Z9FA 4PZ8A 1STEA 1JB3A 1WTPA 1LLRD 2B8GA 4JI4Q 1IL8A 1RKNA 3H0GG 1E2ZA 2JQOA 4LFAL 5FLXE 5IGGA 2EYLA 4A3FH 3MVVA 1MI2A 1YHBA 3FKIH 1C48A 4C56C 1MSGA 2KHJA 4HJ9A 4IJLA 2OTLA 1ICWA 1A3UA 1IW7D 3K7UC 3HKZE 2C35B 2EZVA 2WAQG 3PV0A 2WFWA 3I2ZA 4HTHA 2VQEQ 1HNXL 4YHHQ 4A3IB 1IBKL 2QW7A 4YWKA 5D3DA 5M5XH 3P1HA 1VMPA 2I5MX 5TSSA 3M7NA 2NVYB 1C4QA 3PUWA 3CQZB 1F9RA 2EY2A 4A3DB 2F0QA 1EY7A 4DV6L 2I5HA 4B3TL 4ZUJA 1CHPD 2J0TD 2XSCA 3TZDA 2UXBQ 3KYHC 1EIGA 5ELBA 3NEMA 3CQZH 4R4QA 3T56B 1XXGA 1ILQA 1GOZA 4L63B 4PZ6A 2L0CA 3ERSX 2G9HD 4AYBB 4DR1L 3KF8A 3CC4A 2R93G 1M90C 2PW5A 5IYBH 1R9TH 1FL0A 5EPJA 3KDFB 2N49A 4LF5Q 3P7JA 1JICA 3JC66 1HJPA 3SGIA 5IYDG 4Y52H 3W3AA 1AW7A 1BBWA 3PCOB 1SYEA 1QE6A 2BE5C 5IY0A 3MXGA 1K8OA 4YIJA 2G9DA 3Q8DA 1VQOA 1WD0A 1NBWA 4B9WA 2EY1A 4PNYA 1FGBD 4HJAA 1STNA 2O4XA 5EAYA 1V1OA 3NPPA 4NW2A 4HEDA 5GADC 3TS0A 4FF2A 2R7ZG 1VQIA 1Y14B 1LTRD 3SDZA 5DLQE 2KCMA 1YZ6A 1QUQA 1JWMD 3S1NH 3CCVA 1X3FA 3IKJA 2C9OA 1SSOA 2RCNA 3QIAA 3K81C 5JJIA 1S4ZA 2NTTA 3K5LA 3KBGA 2EXDA 3J7ZC 4A3KH 4DK3C 4JI0Q 1F2MA 1EQQA 1I3QB 3S16H 4OIJA 4JI6Q 4RGMA 4K14A 1QJOA 1IBLQ 1D5XC 2NBFA 3M4QA 2JXMB 2CHBD 3D4WA 3U58A 3CAMA 1I3QH 1KXLA 2XVSA 3DEOA 2E2IH 3HRZC 4BXXG 2UUCQ 3C1EA 3NK9A 1JCKB 4DR2L 1YI2A 1WYDA 1Q81C 1XX8A 5GROA 1G91A 2Z6KC 4MTNA 2OQKA 2K5NA 5COYA 1LTGD 1X32A 2D0PA 2H1EA 3GO5A 4B3RL 2MPMA 5FLMG 2JA9A 2YTYA 3CCMA 4OONA 2F0SA 4GLAC 3BVZA 3OYYA 4HIOA 4KLKA 1GXDC 3RZDH 2FMCA 5IWAQ 1Y1WB 3KUPA 3D4DA 3D8GA 3H3VI 5IP9G 2NYZD 3UDFA 4JI8L 4APVA 3J81j 1S72A 4AIMA 1EIFA 3G48A 5C0XJ 5C4JB 1OXVA 2NVXH 2WAQE 3CRLC 2K52A 2BE5D 1F77A 3NWSA 4KTAA 2L15A 4BBSB 3NENA 1PTOC 4GLVB 2V1CC 1II3A 1KAWA 1OXSC 1CA5A 3SVMA 4DV3Q 1HFNA 4A3JB 1WI5A 2FJ2A 1RTNA 3M85A 3T53B 4IUQA 3C2PA 2RHQB 1F9PA 3PF5A 5ELEA 1E3PA 1HA6A 4K5VA 1D1IA 1HCZA 3KF8B 2B2YA 3K0YA 5JJLA 3Q24A 1Q90A 4DNIA 1H9JA 3VR2A 2HHHQ 3PUXA 5M3FH 2F0NA 1ASYA 2KEEA 1IBKQ 4F87A 3RLNA 5GAHC 5C44G 2FINB 1AZQA 1EFWA 3L3OC 4DV6Q 4B3TQ 1E22A 2QKIC 2RVLA 4KD4A 2JA8G 4IPGA 4DN4M 2B2YC 3OIPA 2XN9C 1XTCD 3WOEA 1PH7A 1HA5A 4B3ML 1WTOA 3GTOB 2YTXA 1JT8A 4ZK9B 1CSQA 1TXYA 4QIWB 3TQYA 2SOBA 4DR1Q 1CZGA 4U68A 2RCFA 1CZWA 3PIP3 2UUBL 1HXYD 2ZJQA 2D9UA 4IUNA 2L11A 1N32L 2PPBC 4DV1Q 2Z4HA 3NWTA 5F2DA 1BBUA 3OMCA 1G51A 5C0XG 4CKEA 2B63G 5DM73 4JYAL 3QO2A 2DN8A 1IL2A 1MHWC 2IWHA 3GTLH 5CV4A 2K5QA 3EQLC 2ZTCA 3F2BA 1KC8C 2MNAA 3FRPB 4DV7L 1CM9A 4A3EB 4I65A 4NKLA 3RZOH 2QA4A 3BU2A 5EBCA 4JPBW 1J5EQ 1K83H 4KKSA 3T1HL 4B9XA 2EY6A 4A3GB 1KDCA 5KIXA 1BCPF 4BY7G 1VQJA 1JR0D 1NMFA 1PTOD 5KRUA 2PQEA 2EJGC 2JA5H 3NQIA 1WCMB 1AEXA 2HCIA 4IZ8A 2NZHA 1KDBA 3G6JB 1ML0D 2R7DA 4JW0A 4DV2L 5J1ZA 2QEXA 1Y69U 1ENFA 2K04A 1QZGA 1W6KA 2DY8A 3ULLA 1B2TA 3BS1A 3RMHA 4HMIA 4OGQC 4R4CA 3G71A 5ELCA 1I6HB 2BCOA 2O5JC 4KKTA 3EROA 4DUZL 1EU4A 5FK9C 3P20A 5CR3A 2WIIB 4K2KA 1PFSA 3SE0A 1JE5A 1ZKOA 1JC7A 2F0KA 4DF7A 3QWNA 4DR2Q 2SNMA 4TQUS 4J6HA 3I7FA 2A68C 3PUZA 1AE3A 1PYBA 1C7YA 4P2CB 2AQ2B 5AJ3L 5C5MA 3L7ZC 1SYDA 2VB2X 4B3SL 2D62A 1BCPB 1Z47A 1ENAA 4DAYA 2IW3A 4P74A 1SYCA 4FXGC 1LM0A 4DR5Q 2J7ZA 4OXPA 4L8JA 4JI5L 2R93H 4RGTA 5C4XG 1EIYB 3AQQA 2YU9B 4XT3B 1A3VA 2O2LD 1SE2A 4XXEA 1I4QA 1ILPA 5HURA 5CV6A 2Y0SG 3TP8A 3DLLA 2PO4A 4RKLA 1XPRA 1AZPA 3J7AF 1HFGA 3K57A 2JA6H 1SBBB 1T5EA 5IYDH 4A93B 1Y1VB 3S2DH 1D8LA 1F2YA 4C3JB 3D31A 2PNHA 2F0LA 3CPFA 1GHKA 1EY0A 1OXUA 1QVGA 3CCQA 1HRJA 4NXNL 3CCJA 2JJQA 1V8QA 3V96A 1HZBA 2RSNA 1P16A 2R7ZH 4LWCA 2JYOA 2HDMA 3S14B 4Q0FA 4V0BA 1RD9D 1SMXA 2BA1A 4BBRG 2NN6G 1EWIA 1SNCA 1Y8NB 3E9HA 1YNXA 3I73A 2L55A 1O80A 3A55A 2ZTDA 3S14H 4KJNA 5L37A 3EA6A 3SK6A 1TIID 2VNUD 1KL9A 3S2HH 3FVQA 1O7LA 3HFZB 2XRSD 2MUYA 4FO2A 1S5BD 2A1AA 3A54A 2OF1A 5KGUA 1F2ZA 1LV9A 3A7AB 4ZRZA 1EYGA 1U4MA 1XTDA 3FP9A 4X64Q 2JEAI 1B7YB 5LMNL 3C1FA 5IT9E 5DM63 5C0XI 5CC4A 4YCVA 5J22A 4BXXH 3SK4A 4BA1I 2ATWA 2G5DA 3F8TA 3G6EA 2F0WA 1XPUA 2E2JB 1L0YB 2WB1B 3GTQB 3MA2B 4A3LH 2EYPA 1K0RA 2JN4A 3FEWX 2Q8TA 2IL8A 2EQSA 5A2QE 3N6RA 4UP9A 1L0XB 2KECA 4RWSC 5IGBA 5LHY1 1BR9A 3AEVA 2F0PA 1I50H 2F0JA 4HSPA 4LK1C 1XYIA 4JYAQ 4JBKA 4JOIA 5FO7B 1RJTA 4JI7L 1E1OA 1UE7A 2QF7A 4A3BH 4LW1A 2E8GA 1QG7A 5M3MH 2NVTB 4PV1C 4DK1A 3S15B 2VQFQ 3T1HQ 3W1GA 1TT2A 4QGUA 3IFTA 5E3FA 5LMNW 4OWWB 3J80L 5IP7G 4JOIC 1STBA 1KLGD 1Y1WG 3HOZB 3D6WA 1SE3A 3I4MB 1FJGQ 3KDFA 1IHZA 4ZKCB 3T1YQ 4ZAIA 1TS4A 1LYLA 5CGKA 4LF4Q 3K58A 3STBC 2J4XA 4LAAA 4DV2Q 4LF9Q 4EQPA 4IOAA 4WJ3M 1TS5A 1V43A 4LFBL 5ELOA 4QMGA 5CBEE 4X65L 1TWCH 5I6WA 1N36Q 3HOWG 4XDXA 1BOSA 1TQOA 1VQHA 2KVMA 2A8VA 2F0HA 3KBXA 5EKIA 4FXKC 3DM1A 3GTJH 1OTCA 4OEMB 1TU2B 2EDGA 5C44H 4C3IB 2ES2A 4IPHA 1XMOQ 1W6JA 3QOJA 4MTKA 3Q6SA 1IBMQ 3J81c 3AB9A 2Y0SE 4KHZA 5CYUA 4C3IH 4R1JA 2JA7G 4ZCKA 2HUGA 4IPCA 5G3LF 5AJ3Q 4RHRA 1WTQA 1XMQL 2AUKA 3D6CA 4AYBE 4B3SQ 2B2UA 4EQNA 3MTSA 4JI5Q 2PZWA 4WJWA 2F0GA 4P75A 1Q7YC 2PI2A 3OWEB 1KQSA 2Q2HA 2ALYB 2CQAA 3ZYYX 3M4OB 3U4VA 4DV5L 3PO3B 1SR3A 4NXMQ 5C0XH 2F0OA 2K6AA 1OXXK 3CRKC 2B63H 2V4DA 2F1MA 2NZOA 1E0BA 2KOLA 3J7YW 2F0TA 2VUMB 4DAMA 2ICEC 1AH9A 2NN6I 1SN8A 2QILA 1UWVA 1K0SA 2FMMA 2ZM6L 2B2UC 2Q8RE 5C3EB 3CMAA 1TWGH 2EJMA 2EOTA 4QF4A 1SLJA 2R92G 3WWVA 1JOKA 4G7HC 1SRUA 2K14A 4GOPA 2GVBA 4A3FB 3AFPA 4XYOA 3VA7A 3FKIB 3CCLA 4LF7L 2E2HB 4QL5A 1MGSA 3J81i 3QOLA 4UP7A 4LNQA 3TREA 1D5MC 3RLFA 4BY7H 1Q82C 5HY6A 3TMEA 3NQTA 4H7BA 5C6AA 3JAML 2E2HH 3F2CA 4K0KL 4RGOS 2F0UA 3RR5A 1CFMA 2A6EC 5M5XB 1E2WA 2R7FA 4IFDG 1Q1BA 3STBD 4GOPC 2KBNA 1JOOA 1C0AA 4RGNA 1FNWA 1GHJA 1TY0A 1DM0B 1Y8OB 4RCNA 5NUCA 3E0EA 3OTOL 4C3HG 3GD7A 1B8AA 2PCFB 4OHJA 1VQAA 2VB3X 5LMNQ 3OMGA 4HIDA 2MO0A 1F9SA 2L1BA 3VA5A 3OPOA 1HQRD 3F2DA 4KK7A 1EQTA 4CDDC 4DR3Q 5M9OA 5AFWA 1R9TB 2HCCA 2EYHA 2N55A 2IHFA 1EOVA 4H02A 4IPDA 1PZKD 4CDCC 2EE1A 2WACA 4TKOB 1PH1A 5FJ8G 1D2BA 3I55A 1QILA 2LFNA 4IUUA 2BH8A 3P75A 5K36G 1EY9A 3EBEA 3W1BA 4X66L 3MXUA 2A6HD 5C4XH 5IYCH 2K03A 1WJJA 1L1OA 1L0WA 3GTGB 1U4RA 2K4KA 1SFOH 3GDEA 2AUJD 4DK0A 1DJRD 5C5LA 3KLSX 4DNRB 3GTGH 3KJOA 1SNQA 4BY1G 4C1NK 4LF8Q 2OT2A 1PA6A 1OXTA 1YHAA 2R61A 1K8GA 3S1NB 1U5KA 1LACA 1G2SA 4R8IA 4JI1L 1F2LA 2PMZB 2F0IA 5DEHA 5M5YB 2NVQH 3UDGA 3QJYA 2RDHA 1L1OC 3LX0A 2K28A 3Q23A 1GUSA 2YYZA 1HNWL 5M5YH 4A93G 1YNJC 1SJED 3CD6A 4BBRH 2NN6H 4A3KB 4OO1H 1EU3A 5HGQA 4C3JG 1X56A 2CH4W 3S16B 1STHA 2Q8IB 5I9PA 2Z6KA 4I7AA 3GTKB 1TWFH 1MIUA 3ERQA 5IODA 4FF1A 4LFCQ 2A6ED 1ET9A 5DNFA 3UE0A 3CP0A 2E2IB 3GTKH 1JOQA 2Z1CA 3VYSA 1R4QB 3CCEA 3HOXG 5EKLA 2VY3A 2SNSA 3CC2A 3HKZB 1GJXA 2Z9HA 1HQMC 1EFID 3K5MA 4LJZC 2SDFA 1J9OA 2HIVA 4DK6C 4GOPB 2GVAA 3HOYG 4RKBA 3I3CA 4RCOA 5C3WA 1XMQQ 4DR7L 4QIWE 1W2BA 3AMUA 1VQNA 3NE5B 4KHVA 5EBDA 1KRSA 1U9RA 1M1KC 3T16A 3HS0C 3MWYW 3RZDB 1H9SA 4A3MH 3VR5A 3BJUA 2MFIA 4DV5Q 4L5SA 1N34L 2Z0SA 2LXKA 3QB3A 3VDYA 1TWAH 1GKHA 2PYKA 1HR0L 3H3VC 2EVBA 3MZ5A 3NTKA 2R6GA 3PO2H 3DWAA 4JBMA 3EVQA 1Z7TA 2NVXB 3PIO3 1JQYD 1SNOA 3HG9A 4EQ5A 3NELA 2ZM6Q 1TS3A 2JE6I 1LT3D 2BDOA 1BDOA 3BYYB 4RH6A 2CH4A 4DR6L 1U4LA 5BN5A 1CQVA 2ZT9C 4P71A 1NSNS 2CWPA 3I4NH 3TP7A 3U4ZA 5FO9B 4ALPA 1WTWA 2HT1A 2Q2UA 3I4LA 1J8IA 4ZUIA 2K5WA 2QDLA 4XIGS 5I9OA 4IFDI 4LF7Q 5JEAH 3DMUA 2OEOA 4LFAQ 3HOVG 1B53A 1LTSD 1PH9A 4F88A 2D2CC 5IP7H 2LSSA 5M3FB 1NY4A 4K0KQ 2HD3A 2F0DA 1JWUD 5I2XA 1P8LA 1YNJD 1HNXQ 3GQBA 4FNFA 1TKWB 2F0VA 1HR0W 1L1OB 3SXHA 2ICIA 1FVIA 5HGTA 1VQDA 3OTOQ 3HOWH 4PQXA 5KEEA 4ILWA 3E3XA 1EY6A 1DXMA 1TWHH 1VQLA 1FR3A 2A74C 1VQCA 2F0EA 2FXQA 4YCUA 1UUPA 1CHQD 1RF2D 4NP5A 4JI2L 3HOUH 1A63A 2JA7H 3PIOA 3SHLA 1HZCA 1OO9B 3KLSA 2K5HA 1G2TA 2LS01 1BO0A 3KJPA 3HZXA 1QVCA 2K33A 2LY7A 1PH6A 4RA8A 3PQIA 4X66Q 3OSOA 3NXWA 1EZ8A 4LF6L 3GTLB 4K2LA 2MGSA 3TDQA 5E4WC 1QVFA 4UY8C 3TZUA 3NBHA 3RZOB 2NWGA 4H13C 1HNZL 1PRTF 5IT9L 1K83B 2DJFC 4EX5A 4DR4L 1DZ1A 2B2TA 2UXCL 1E7ZA 3BG3A 3ER0A 1A6XA 2M00A 4WORA 3I91A 3PF4A 3NBIA 2EIFA 2R92H 4KI0A 2JA5B 3PO3G 3H0GB 4JV5L 2RQXA 4Z9CB 3BZDB 5T1GA 4MHEA 1EEFD 1ESRA 2WP8J 3E0JA 1HNWQ 3H3VH 1F9QA 2VUMG 4K6DA 3H0GH 4ID6A 3CF5A 3C46A 3E5SA 1K3BC 4QJFA 2QGQA 2B2TC 5FOBB 1PFNA 1PFMA 4IOCA 1RDPD 1H9SB 2B2VA 1I4PA 4H44C 1CKNA 3KF6A 2E5LL 4A3FG 2K5VA 1SNMA 4K6LA 3FKIG 1PV4A 1YJWA 2C5CA 1AFPA 3IRBA 4C3HH 3BDLA 3A5ZB 3SK8A 1AE2A 2L9HA 1Q1EA 3EFXD 5JVH3 5LL6X 2Z8LA 3D3RA 4DA2A 2Z6BA 1PH2A 1I5FA 4WJ4A 3DUZA 4DUYL 4DR7Q 2D5DA 1WTHA 2B2VC 4QY7A 2R93B 4CGYB 4A3IG 2WB1E 4MN3A 1C8CA 5BR8L 4B3RQ 1ZEQX 3M4YA 3D4RA 4DV0L 4A3DG 5LMUL 1N34Q 1X6OA 5FJ8H 1HHVA 1X9NA 1O7ZA 3TEHB 2TSSA 4GNXA 1HR0Q 2JA6B 4QCLA 2BDNA 3FPUB 3RLOA 3S2DB 2EY5A 4R8NA 2AQ3B 1H95A 4JG2A 4LMQD 3DWQA 1BCPC 1N9WA 3OW7A 3KLRA 4JI8Q 5IYBG 1PLFA 4AYBG 4Y7NB 4DR6Q 2KJXA 2RA4A 1K28A 2R7ZB 4BY1H 3FMCA 3PUYA 4OX9L 2MHVA 4Y7NH 4GS3A 1NNXA 1BXTA 1PH3A 3KLWA 2RBMA 1VQ4A 1YNNC 4GNXC 2RDGA 4LUVA 1GM5A 3G7LA 3LNNA 1E1TA 1V1QA 2OXPA 5EJWA 1YVCA 1Q8IA 3NSWA 4NMZA 3BYTB 2PW7A 4CDEC 2WKCA 1STAA 3S2HB 1CSPA 3AFQA 1WTXA 3K7AH 4XQJA 4FYDA 2ZXOA 3HEJA 4X3UA 4CJ2C 2CW0C 1HUMA 1BNZA 2HQEA 3GTMH 3OOCA 2TMPA 1B70B 4JI4L 4TVAB 2CWAA 1X54A 4JC0A 4DXGA 2JK8A 3NBHB 5EQ0A 4F7XA 3MFYA 1UE5A 4GLXA 1MBYA 4E6IA 1XNRL 1X65A 4A3KG 1ONLA 3FHWA 3HOXH 2H5XA 5FLXL 2F3IA 1K8MA 4B3MQ 2VQEL 4JI2Q 4YHHL 1EUJA 1BF4A 2Q2TA 2M2LA 1Q46A 2WINB 4IALA 2UUBQ 3HOYH 1IYUA 2ID0A 3S1RB 1I50B 4LUOA 2AMCB 2A68D 4UP8A 1N32Q 3M4PA 4A75A 3Q0AA 2NZ1D 2UXBL 1D1KA 1QZHA 3S1RH 2I0QA 5JJZA 3L0OA 4A3BB 5FLMH 1LTID 1A8VA 4DGZA 1HZ9A 1J6QA 1T9HA 5M3MB 4TSSA 1RL2A 1CKNB 5KYLA 1PFBA 3KF6B 1HTLD 3R3OA 4DR4Q 5KNBA 4JI3L 4DV7Q 2F0FA 5IP9H 3ND8A 2IX0A 3I8ZA 1BCPD 3V05A 2PQAA 3MFGA 1JJCB 2KA7A 2FFKB 3IFDA 4RHSA 4JV5Q 3I4OA 2MQHA 3TP6A 1NJIC 1ASZA 4O1NA 2IT1A
chains in the Genus database with same CATH topology
1MSHA 1YNND 2O5IC 1DCZA 1TWCB 2AWNA 1CA6A 2RSOA 1X3QA 1LO5D 5I4DA 5CV9A 1JORA 3GTJB 1UEAB 5C4HA 3NHHA 5C44B 1D5ZC 2CW0D 2PNRC 4J8QA 1CTMA 4KKUA 3VYRA 4KY7A 1BUVT 3R2IA 4U673 1TVXA 2MP1A 4IFDJ 1PMRA 1I4HA 2PZTA 3W2DA 5CMDA 1SJHD 3A8JE 2KUMA 3MXNA 2NUCA 1QCBD 3WDNA 1G6ZA 3J7AV 3BVGA 5IGEA 2B63B 4XYQA 1PYWD 5D3IB 2Z4IA 1TWGB 1EIHA 1CT1D 4K5WA 1RTOA 1X3PA 3J81E 1SYFA 1DOMA 2PZUA 5EKKA 2DNEA 4IUVA 2QCPX 2XRQD 4BY7B 1O7YA 3FPPA 2HDLA 3TBIB 4JBWA 2ZXPA 2EYFA 5C3XA 1EOTA 2I46A 3V2TA 4HMJA 2K01A 1T5XD 2NB0A 2IPKD 5JVG3 3HP3A 2KCNA 5BN3A 1GUNA 1AP0A 2LMCB 2RDFA 3RUZA 5JAVA 1SXTA 3RD4A 2DNCA 1EWHA 4KY6A 4UDUC 4DU9A 1V1PA 4KJOA 1H9KA 3M7GA 4XTCS 4G7ZC 3H6MA 1S5DD 1A3TA 1NR2A 4ZYSA 5C4XB 3BVMA 2QEJC 4KN7C 3KK7A 3NTHA 1B3AA 1HTPA 1SFOB 2Y0SB 4ME5A 2EXZA 3IAYA 5LL6S 5D65A 1KDAA 4RFBA 3R93A 3SEBA 2K32A 2K05A 2MJ8A 1QNUA 4EGVA 5KYIA 1HUNA 4I7ZC 3J80E 5I6YA 4ZQ3A 4PMBA 2NVQB 3AU7A 1A15A 1EYDA 1LTBD 1NCVA 4B08A 1LABA 1BBXC 4BBRB 1GUTA 1ENCA 3SK5A 4DAVA 1ET6A 1FNVA 4HN7A 1TWFB 2L5TA 4PMCA 2A69C 5KNDA 4M1UB 1DYQA 1FYCA 5A35A 1PDQA 1VMCA 1ZYRC 2ENBA 3DWPA 3BDCA 2F3WA 5IGCA 5G3LD 1TS2A 3A8IE 1BQQT 2XIWA 1PTOF 3R8BA 2BA0A 1S5ED 3VR4A 4K5XA 1MD2D 4N9PA 4A3MB 1PXUA 1TWAB 4V190 3OIQA 3PO2B 4X3TA 4OL7A 4WRDA 2RKSA 5C4ZA 4F8MA 4ODGA 1B9NA 3I4NB 3E6ZX 1RCVD 1TR5A 4ABNA 4HCSA 3BDOA 3F2UA 1IKMA 3JAME 1VCIA 1TY2A 3DEPA 1EYCA 3K5NA 1SYBA 1V1PB 2F4IA 1FNUA 1GUOA 1STGA 3TP5A 3MAQA 4TRDA 1DOKA 3EJIA 1PZJD 4G57A 4JK1C 1KABA 3I70A 5CBAE 4XT1B 4X3KA 3HOWB 4KY5A 3I90A 1TWHB 2A69D 2F03A 2A73B 4KD3A 3CKIB 4IURA 1ZYRD 4CJ0B 3HOUB 2IX1A 4HSVA 3FDTA 2JA7B 5FO8B 1UNSA 5ELFA 4BS9A 2KQ3A 4BWGB 1EQVA 2WV6D 4HCEA 5JOBA 3T4AC 3NTIA 3UI2A 3MXPA 3QG1A 3Q22A 3MEHA 4C3IG 3ND9A 1XWEA 5E4XA 2L4NA 3K6OA 2M9VA 1FD7D 1DOLA 2KCCA 4FF4A 4QB4A 5KNCA 1GUGA 4CBVA 2A5HA 3L9AX 4IN3A 3GV6A 3LWEA 4Q5VA 1H9MA 1KNEA 2R92B 1CQFA 1DONA 1QNKA 5BN4A 2EYJA 1LT6D 1B9MA 5CV7A 1CK1A 2E74C 2WKDA 2NTSA 3LWUA 5D14A 5A2QL 3MHBA 3O13A 3WOFA 4N9TA 1RODA 5FKAC 2WAQB 4DNTB 4HR7B 4K8IA 4L6TB 3GP7A 1WTRA 5I2YA 5EPKA 2L12A 4C3HB 4IFDH 1A2TA 4UAIA 3U9SA 4DXFA 4FF3A 4MIUA 2XWBB 3T13A 3C3LA 1GUWA 1Q3LA 1PTOB 3A56A 5JPMC 2E76C 4ZKBB 2H4OA 1PTOH 3K59A 1Y8PB 3R2TA 1PRTC 2EYOA 1JE4A 3A8KE 5E1FA 3M3YB 2E75C 1ZXTA 2JP1A 5EGTA 4FXDA 5K36H 4PMWA 1IKLA 3MC0B 1LT4D 4BY1B 3CU7A 2XWJB 2BOSA 4FVMA 1R4PB 1EY5A 4CKBA 4ULLA 1G291 1S5CD 4C2MB 2IJ0A 5T1IA 1Q12A 1LT5D 1NR4A 2FHTA 1STYA 1I6VC 2X6GA 2EPBA 2X6LA 2X69A 3K7AB 1CI3M 4WFN3 1WVLA 4NDXA 1EEID 4IQZA 5IIFA 4BA2I 4RAUC 3GTMB 2DY7A 2ZXRA 1B44D 2K7VA 1D6EC 3PMFA 1QWYA 3NUCA 1UAPA 1PZID 5K5PA 2JSOA 1SMYC 1JWSD 3PUVA 4QUCA 1RHPA 3TN2A 4OIKA 2K5DA 1I4XA 5CV5A 1EY4A 3J81L 1WTVA 1ESFA 4OO1G 1DD2A 4KMUC 3HOXB 4IUTA 2GA4B 1IYVA 2CVRA 1B50A 3T51B 5JEAJ 2QDBA 3H94A 1U4PA 4R9WA 3HOYB 3I72A 5IOCA 3ITPA 2I07B 1VF7A 2F0MA 1NUCA 2N88A 5CORA 3H09A 2B8FA 1WD1A 2KHSA 1E2VA 3OHXC 3S9WA 1PRTD 3NP8A 4H0LC 1EWCA 3OWFA 3TSSA 1LTAD 3A7LA 3VYTA 2JEBI 3ONAB 3X3NA 3VYUA 1PRTB 4M8AA 4CJ1B 4FP5D 1EY8A 1S5FD 1VDZA 3HOVB 3VR3A 5M5WB 3X3MA 3GV3A 5DAUA 3VR6A 1KLUD 2E2DC 1SE4A 2VXWA 4EVOA 3H91A 5IGDA 4S3SA 2AWOA 5JEAG 2B2WA 4K8JA 5CV8A 2EJFC 3HGBA 4IUPA 1B4OA 2B39A 1SEBD 1QB5D 4XQNA 2LKVA 2KEDA 2K1BA 1M8AA 1IW7C 1SMYD 4ZLTF 1EL0A 1QOHA 1I4RA 4XQQA 1EZ6A 3SR1A 2JA8B 4DAPA 4X3SA 3S17B 3N52A 5IGFA 5JPNC 1SNPA 1KAAA 1KNAA 3K5OA 2B2WC 4G4KA 3URYA 4O42A 2EYMA 4QUFA 4CKCA 3DHQA 4EQOA 3CHBD 3DXJC 2R3ZA 1M4VA 1NAPA 2SEBD 1EYAA 4C1NI 1KTKA 4KN4C 1Z6HA 2IX3A 1B1ZA 1SDFA 4HAEA 1HPCA 5ISRA 2F3VA 1G8ZD 4G7OC 3S1QB 4DFAA 2XNAC 1AN8A 1H9RA 4KV6A 2A6HC 1SYGA 3IL8A 3U9OA 1VF5C 1SAPA 1A2UA 4CHTB 5EPLA 1SNDA 4J1MA 1LTTD 4OO1I 2AQ1B 3GTPB 5J39A 4GZYC 3S1MB 5ELDA 1O78A 1I4GA 1STEA 1JB3A 1WTPA 1LLRD 2B8GA 1IL8A 1RKNA 1E2ZA 5FLXE 5IGGA 2EYLA 3MVVA 1MI2A 1C48A 4C56C 1MSGA 1ICWA 1A3UA 1IW7D 2EZVA 3PV0A 4HTHA 4A3IB 5D3DA 3P1HA 1VMPA 5TSSA 3M7NA 2NVYB 1C4QA 3PUWA 3CQZB 1F9RA 2EY2A 4A3DB 2F0QA 1EY7A 4ZUJA 1CHPD 3TZDA 2J0TD 2XSCA 1EIGA 5ELBA 3T56B 1XXGA 1ILQA 1GOZA 4L63B 2L0CA 2G9HD 4AYBB 3KF8A 2PW5A 5EPJA 3P7JA 1JICA 3W3AA 1AW7A 1SYEA 1QE6A 2BE5C 3MXGA 1K8OA 4YIJA 2G9DA 1WD0A 4B9WA 2EY1A 4PNYA 1FGBD 1STNA 2O4XA 1V1OA 3NPPA 4NW2A 4HEDA 4FF2A 1LTRD 3SDZA 1JWMD 3IKJA 2C9OA 1SSOA 3QIAA 1S4ZA 2NTTA 3K5LA 3KBGA 1F2MA 1I3QB 4OIJA 4RGMA 4K14A 1QJOA 1D5XC 2NBFA 2JXMB 2CHBD 3D4WA 2XVSA 3DEOA 3HRZC 3C1EA 3NK9A 1JCKB 1XX8A 1G91A 5COYA 1LTGD 1X32A 2H1EA 3GO5A 2MPMA 2F0SA 3BVZA 1GXDC 2FMCA 1Y1WB 3KUPA 3D4DA 3D8GA 2NYZD 5C0XJ 5C4JB 1OXVA 3CRLC 2BE5D 1F77A 3NWSA 4KTAA 4BBSB 1PTOC 1II3A 1OXSC 1CA5A 3SVMA 1HFNA 4A3JB 2FJ2A 1RTNA 3M85A 3T53B 4IUQA 3C2PA 1F9PA 5ELEA 1HA6A 4K5VA 1D1IA 1HCZA 2B2YA 3K0YA 3Q24A 1Q90A 1H9JA 3VR2A 3PUXA 2F0NA 2KEEA 4F87A 2FINB 1AZQA 3L3OC 2QKIC 2RVLA 4KD4A 4DN4M 2B2YC 3OIPA 2XN9C 1XTCD 3WOEA 1HA5A 1WTOA 3GTOB 4ZK9B 4QIWB 2SOBA 1CZGA 4U68A 3PIP3 1CZWA 1HXYD 2D9UA 4IUNA 2L11A 2PPBC 2Z4HA 3NWTA 5F2DA 3OMCA 5C0XG 4CKEA 5DM73 3QO2A 2DN8A 2IWHA 5CV4A 2K5QA 3EQLC 3FRPB 1CM9A 4A3EB 4I65A 4NKLA 5EBCA 4KKSA 4B9XA 2EY6A 4A3GB 1KDCA 5KIXA 1BCPF 1JR0D 5KRUA 1PTOD 2PQEA 2EJGC 3NQIA 1WCMB 1AEXA 2HCIA 4IZ8A 1KDBA 3G6JB 1ML0D 5J1ZA 1Y69U 1ENFA 2K04A 1W6KA 2DY8A 1B2TA 3BS1A 3RMHA 4HMIA 4OGQC 1I6HB 5ELCA 2BCOA 2O5JC 4KKTA 3EROA 1EU4A 5FK9C 3P20A 5CR3A 2WIIB 4K2KA 3SE0A 1ZKOA 1JC7A 2F0KA 4DF7A 3QWNA 2SNMA 4TQUS 4J6HA 2A68C 3PUZA 4P2CB 2AQ2B 5C5MA 3L7ZC 1SYDA 2VB2X 2D62A 1BCPB 1Z47A 1ENAA 4DAYA 2IW3A 1SYCA 4FXGC 2J7ZA 4L8JA 4RGTA 2YU9B 4XT3B 1A3VA 2O2LD 1SE2A 4XXEA 1I4QA 1ILPA 5HURA 5CV6A 3TP8A 2PO4A 4RKLA 1AZPA 3J7AF 1HFGA 3K57A 1SBBB 1T5EA 4A93B 1Y1VB 1F2YA 4C3JB 3D31A 2F0LA 1GHKA 1EY0A 1OXUA 1HRJA 1V8QA 3V96A 2RSNA 2JYOA 2HDMA 3S14B 4Q0FA 4V0BA 1RD9D 2BA1A 2NN6G 1SNCA 1Y8NB 3I73A 2L55A 1O80A 3A55A 4KJNA 3EA6A 3SK6A 1TIID 2VNUD 3FVQA 1O7LA 2XRSD 2MUYA 4FO2A 1S5BD 3A54A 2OF1A 5KGUA 1F2ZA 1LV9A 3A7AB 4ZRZA 1U4MA 2JEAI 3C1FA 5IT9E 5DM63 5C0XI 5CC4A 5J22A 3SK4A 4BA1I 2F0WA 2E2JB 1L0YB 2WB1B 3GTQB 3MA2B 2EYPA 3FEWX 2Q8TA 2IL8A 5A2QE 3N6RA 1L0XB 2KECA 4RWSC 5IGBA 5LHY1 1BR9A 2F0PA 2F0JA 4HSPA 4LK1C 1XYIA 5FO7B 1RJTA 2QF7A 1QG7A 2NVTB 4PV1C 4DK1A 3S15B 1TT2A 3IFTA 5E3FA 3J80L 1STBA 1KLGD 3HOZB 3D6WA 1SE3A 3I4MB 1IHZA 4ZKCB 4ZAIA 1TS4A 5CGKA 3K58A 2J4XA 4LAAA 4EQPA 1TS5A 1V43A 4QMGA 5CBEE 5I6WA 4XDXA 1BOSA 1TQOA 2KVMA 2F0HA 3KBXA 5EKIA 4FXKC 3DM1A 1TU2B 2EDGA 4C3IB 1W6JA 3QOJA 3Q6SA 3AB9A 4KHZA 5CYUA 2HUGA 5G3LF 4RHRA 1WTQA 2AUKA 3D6CA 2B2UA 4EQNA 3MTSA 2PZWA 4WJWA 2F0GA 3OWEB 2CQAA 3M4OB 3ZYYX 3PO3B 5C0XH 2F0OA 2K6AA 1OXXK 3CRKC 2V4DA 2F1MA 1E0BA 2KOLA 3J7YW 2F0TA 2VUMB 2ICEC 2NN6I 2QILA 2FMMA 2B2UC 2Q8RE 5C3EB 2EJMA 2EOTA 4QF4A 1JOKA 4G7HC 4A3FB 4XYOA 3VA7A 3FKIB 2E2HB 1MGSA 3QOLA 1D5MC 3RLFA 3TMEA 3NQTA 4H7BA 5C6AA 3JAML 4RGOS 2F0UA 1CFMA 2A6EC 5M5XB 1E2WA 4IFDG 1Q1BA 1JOOA 4RGNA 1FNWA 1GHJA 1TY0A 1DM0B 1Y8OB 4RCNA 5NUCA 4C3HG 3GD7A 2PCFB 4OHJA 2VB3X 3OMGA 1F9SA 2L1BA 3VA5A 3OPOA 1HQRD 4KK7A 1EQTA 5M9OA 5AFWA 1R9TB 2HCCA 2EYHA 2N55A 1PZKD 2EE1A 2WACA 4TKOB 1D2BA 1QILA 2LFNA 4IUUA 3P75A 5K36G 1EY9A 3MXUA 2A6HD 2K03A 3GTGB 1U4RA 2AUJD 4DK0A 1DJRD 5C5LA 3KLSX 4DNRB 1SNQA 4C1NK 2OT2A 1OXTA 2R61A 3S1NB 1LACA 1G2SA 4R8IA 1F2LA 2PMZB 2F0IA 5DEHA 5M5YB 3QJYA 2RDHA 3LX0A 2K28A 3Q23A 1GUSA 2YYZA 1YNJC 1SJED 2NN6H 4A3KB 4OO1H 1EU3A 4C3JG 3S16B 1STHA 2Q8IB 5I9PA 3GTKB 3ERQA 5IODA 4FF1A 2A6ED 1ET9A 5DNFA 2E2IB 1JOQA 2Z1CA 3VYSA 1R4QB 5EKLA 2SNSA 3HKZB 1GJXA 1HQMC 1EFID 3K5MA 4LJZC 2SDFA 1J9OA 4RKBA 3I3CA 4RCOA 5C3WA 3AMUA 3NE5B 4KHVA 5EBDA 1U9RA 3T16A 3HS0C 3MWYW 3RZDB 1H9SA 3VR5A 3QB3A 2PYKA 3H3VC 2EVBA 3MZ5A 3NTKA 2R6GA 3DWAA 3EVQA 1Z7TA 2NVXB 3PIO3 1JQYD 1SNOA 3HG9A 1TS3A 2JE6I 1LT3D 2BDOA 1BDOA 3BYYB 4RH6A 1U4LA 5BN5A 1CQVA 2ZT9C 1NSNS 3TP7A 5FO9B 1WTWA 3I4LA 1J8IA 4ZUIA 2K5WA 4XIGS 5I9OA 4IFDI 5JEAH 3DMUA 2OEOA 1B53A 1LTSD 4F88A 2D2CC 5M3FB 2F0DA 1JWUD 5I2XA 1YNJD 3GQBA 4FNFA 1TKWB 2F0VA 3SXHA 2ICIA 5HGTA 4PQXA 5KEEA 4ILWA 1EY6A 1DXMA 1FR3A 2A74C 2F0EA 1UUPA 1CHQD 1RF2D 4NP5A 3SHLA 1OO9B 3KLSA 1G2TA 2LS01 1BO0A 3HZXA 2K33A 2LY7A 4RA8A 3OSOA 3NXWA 1EZ8A 3GTLB 4K2LA 2MGSA 3TDQA 5E4WC 3TZUA 3NBHA 3RZOB 2NWGA 4H13C 1PRTF 5IT9L 1K83B 1DZ1A 2B2TA 3BG3A 1A6XA 2M00A 4WORA 3I91A 3NBIA 4KI0A 2JA5B 3H0GB 2RQXA 4Z9CB 3BZDB 5T1GA 4MHEA 1EEFD 1ESRA 2WP8J 3E0JA 1F9QA 4K6DA 4ID6A 3C46A 3E5SA 2B2TC 5FOBB 1PFNA 1PFMA 1RDPD 1H9SB 2B2VA 1I4PA 4H44C 1SNMA 4K6LA 2C5CA 1AFPA 3BDLA 3SK8A 2L9HA 1Q1EA 3EFXD 5JVH3 5LL6X 2Z8LA 3D3RA 4DA2A 3DUZA 2D5DA 2B2VC 2R93B 4CGYB 1C8CA 4MN3A 1ZEQX 3M4YA 3D4RA 1HHVA 1O7ZA 2TSSA 2JA6B 4QCLA 2BDNA 3FPUB 3S2DB 2EY5A 4R8NA 2AQ3B 4LMQD 3DWQA 1BCPC 3OW7A 3KLRA 1PLFA 4Y7NB 2KJXA 2RA4A 2R7ZB 3FMCA 3PUYA 2MHVA 1BXTA 2RBMA 1YNNC 2RDGA 3G7LA 3LNNA 2OXPA 5EJWA 1Q8IA 3NSWA 4NMZA 3BYTB 2PW7A 2WKCA 1STAA 3S2HB 1WTXA 4XQJA 4FYDA 2ZXOA 3HEJA 4X3UA 4CJ2C 2CW0C 1HUMA 1BNZA 2HQEA 3OOCA 2TMPA 4DXGA 5EQ0A 4F7XA 3MFYA 1MBYA 4E6IA 1ONLA 5FLXL 1K8MA 1BF4A 2M2LA 2WINB 4IALA 1IYUA 2ID0A 3S1RB 1I50B 2A68D 3Q0AA 2NZ1D 1D1KA 5JJZA 4A3BB 1LTID 4DGZA 5M3MB 4TSSA 5KYLA 1PFBA 1HTLD 3R3OA 5KNBA 2F0FA 3ND8A 2IX0A 3I8ZA 1BCPD 3V05A 3MFGA 2KA7A 2FFKB 3IFDA 4RHSA 3TP6A 4O1NA 2IT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KJX A; 
#chains in the Genus database with same CATH topology
 3F1Z A;  1MSH A;  3HOV H;  5M5W H;  3L2P A;  1YNN D;  2O5I C;  1DCZ A;  1TWC B;  2YV5 A;  3CCS A;  2AWN A;  1CA6 A;  2RSO A;  2B29 A;  1X3Q A;  2AKW B;  4BBS G;  1LO5 D;  5I4D A;  2E5L Q;  5CV9 A;  1JOR A;  3GTJ B;  1UEA B;  4GNX B;  5C4H A;  3NHH A;  5C44 B;  3CC7 A;  1D5Z C;  2CW0 D;  4A3J G;  2PNR C;  4J8Q A;  4DUZ Q;  1BVS A;  1A62 A;  1CTM A;  2KHI A;  2UXD L;  2N3S A;  4KKU A;  3VYR A;  4KY7 A;  1BUV T;  3R2I A;  4U67 3;  3KFU A;  1TVX A;  2MP1 A;  4IFD J;  3CME A;  1PMR A;  1I4H A;  2PZT A;  3W2D A;  2JA8 H;  3S17 H;  5CMD A;  1SJH D;  4AQY L;  3A8J E;  2F4V L;  4DUY Q;  4X6A H;  4JI0 L;  2KUM A;  4R4I A;  4JI6 L;  1IBL L;  3MXN A;  2NUC A;  1YJ9 A;  1QCB D;  4HIM A;  3WDN A;  1G6Z A;  4J15 A;  3J7A V;  3TS2 A;  3BVG A;  5IGE A;  4PG3 A;  4DV0 Q;  4X62 L;  2UUC L;  4XYQ A;  2B63 B;  1PYW D;  4MNO A;  4AH6 A;  4RMF A;  2RHS B;  5D3I B;  1KD1 C;  1GO3 E;  2Z4I A;  2CKZ B;  1TWG B;  1EIH A;  1CT1 D;  4K5W A;  1RTO A;  1X3P A;  1BKB A;  3S1Q H;  1IZ6 A;  3J81 E;  1SYF A;  1VQP A;  1DOM A;  4NXN Q;  4OX9 Q;  2PZU A;  4GKK L;  5EKK A;  2DNE A;  1D7Q A;  4IUV A;  2QCP X;  2XRQ D;  4BY7 B;  1O7Y A;  3FPP A;  2HDL A;  1XPO A;  2CFM A;  3TBI B;  4DV4 L;  3K0X A;  4JBW A;  2ZXP A;  5IWA L;  2EYF A;  5C3X A;  1K9M C;  1EOT A;  4FDB A;  4ME3 A;  1L2F A;  2I46 A;  3V2T A;  4HIK A;  4HMJ A;  2ZTE A;  2K01 A;  1T5X D;  2NB0 A;  2IPK D;  1V9P A;  5JVG 3;  4A3E G;  3HP3 A;  2KCN A;  5BN3 A;  3GTP H;  2PI2 E;  1GUN A;  1AP0 A;  2LMC B;  4CDF C;  2RDF A;  3RUZ A;  5JAV A;  4DV3 L;  1SXT A;  2JA5 G;  4A3G G;  3S1M H;  1N8R C;  1JMC A;  3RD4 A;  1HH2 P;  1VQ5 A;  2DNC A;  1EWH A;  1XNR Q;  1WCM G;  1IXR A;  3J80 c;  1PVO A;  2N78 A;  2BH2 A;  4KY6 A;  4UDU C;  2PQA B;  4DU9 A;  2HHH L;  1V1P A;  4KJO A;  1H9K A;  3M7G A;  4XTC S;  4G7Z C;  3A0J A;  3H6M A;  1S5D D;  1A3T A;  3MEF A;  1NR2 A;  4A3I H;  4ZYS A;  5C4X B;  3BVM A;  2RF4 A;  2QEJ C;  4KN7 C;  1VQG A;  3KK7 A;  2NVY H;  2D0O A;  3S24 A;  1PH5 A;  3NTH A;  1B3A A;  1HTP A;  1SFO B;  2Y0S B;  4ME5 A;  4A3D H;  2EXZ A;  3IAY A;  4YCW A;  4JI7 Q;  5LL6 S;  5D65 A;  1KDA A;  4RFB A;  3R93 A;  3SEB A;  2K32 A;  2K05 A;  2MJ8 A;  1QNU A;  4QQB X;  4EGV A;  3M9B A;  4YWL A;  3CCU A;  1MKH A;  5KYI A;  4JI3 Q;  1HUN A;  4I7Z C;  5J3B A;  4A4I A;  3J80 E;  5I6Y A;  1G6P A;  4ZQ3 A;  4PMB A;  4DV1 L;  2NVQ B;  1N33 L;  3AU7 A;  1A15 A;  1EYD A;  1PH8 A;  1LTB D;  1NCV A;  4B08 A;  3AYH B;  3J80 i;  2JA6 G;  2B3G A;  1LAB A;  2ZJP A;  1BBX C;  4BBR B;  1GUT A;  1ENC A;  2DJG C;  3SK5 A;  4DAV A;  1ET6 A;  1Y1V G;  1FNV A;  3B6Y A;  4L5R C;  3MXN B;  4HN7 A;  1TWF B;  2L5T A;  4PMC A;  1J5E L;  4LFB Q;  2A69 C;  5KND A;  2LXJ A;  4M1U B;  1DYQ A;  4X65 Q;  1FYC A;  1VMC A;  1PDQ A;  2ENB A;  1ZYR C;  5A35 A;  1K8A C;  3DWP A;  4NB3 A;  3BDC A;  2F3W A;  4O2D A;  5IGC A;  4N8F A;  1GD7 A;  2UXD Q;  5G3L D;  1TS2 A;  3A8I E;  1BQQ T;  2XIW A;  1PTO F;  1X3E A;  3R8B A;  2BA0 A;  1S5E D;  4AQY Q;  3VR4 A;  2F4V Q;  4K5X A;  1I94 L;  3JAM c;  2VZA A;  1CKO A;  1MD2 D;  1NMG A;  4N9P A;  4A3M B;  1PXU A;  4MZ9 A;  1TWA B;  4V19 0;  4X62 Q;  5JJK A;  3OIQ A;  3PO2 B;  4X3T A;  1U0L A;  2KEN A;  1O7I A;  4OL7 A;  4WRD A;  2RKS A;  4P72 A;  4A3L G;  2UU9 L;  1ICF B;  5C4Z A;  4F8M A;  3CXC A;  4ODG A;  1B9N A;  4OEL B;  3G4S A;  2WB1 G;  3I4N B;  3E6Z X;  3EIV A;  4DR5 L;  1RCV D;  3KOJ A;  1TR5 A;  4ABN A;  4GKK Q;  1PYS B;  4HCS A;  3BDO A;  3F2U A;  4KHP L;  3E9I A;  4R4T A;  4A76 A;  3JAM E;  1VCI A;  1IKM A;  1TY2 A;  3DEP A;  4A3B G;  1YJN A;  4DV4 Q;  1EYC A;  3K5N A;  1SYB A;  1V1P B;  2F4I A;  1FNU A;  5M3M G;  4OWT B;  2OQ0 A;  1GUO A;  1STG A;  3TP5 A;  1YIT A;  3JAM i;  3MAQ A;  4TRD A;  1Y1W H;  1NE3 A;  1DOK A;  3EJI A;  1PZJ D;  1LUZ A;  3QR8 A;  1YEZ A;  4G57 A;  4JK1 C;  1KAB A;  3I70 A;  1JB7 A;  1PHJ A;  5CBA E;  4XT1 B;  4X3K A;  3HOW B;  5C4J H;  3ULP A;  3ULJ A;  4KY5 A;  1Q8K A;  4BBS H;  4DKA C;  1RIP A;  3RNU A;  3U50 C;  3I90 A;  5ELN A;  1TWH B;  2A69 D;  2F03 A;  2A73 B;  4KD3 A;  1B3Q A;  3CKI B;  4A3J H;  3HOZ G;  4IUR A;  1ZYR D;  2DUD A;  3I4M G;  4A3C G;  2I5L X;  4CJ0 B;  3CPW A;  3HOU B;  2IX1 A;  4HSV A;  3FDT A;  2JA7 B;  5FO8 B;  4N8X 1;  1UNS A;  5ELF A;  4BS9 A;  2KQ3 A;  4BWG B;  4HJ7 A;  1EQV A;  1W3S A;  2WV6 D;  4HCE A;  5JOB A;  5IE8 A;  2XGT A;  3T4A C;  3NTI A;  3UI2 A;  3MXP A;  3QG1 A;  1MJC A;  3Q22 A;  4X64 L;  3MEH A;  4C3I G;  3ND9 A;  1XWE A;  5E4X A;  2L4N A;  3K6O A;  2VS1 A;  2M9V A;  1SE8 A;  4YY3 L;  5E7N A;  1FD7 D;  1DOL A;  2KCC A;  4FF4 A;  4QB4 A;  5KNC A;  1GUG A;  2XTI A;  4CBV A;  1K73 C;  1VQE A;  2A5H A;  3L9A X;  2AHO B;  1QUQ B;  4IN3 A;  3GV6 A;  3LWE A;  4Q5V A;  3GTO H;  1H9M A;  1KNE A;  2R92 B;  1CQF A;  1DON A;  1QNK A;  3BZC A;  2EYJ A;  5BN4 A;  1N33 Q;  4PZ7 A;  2IHE A;  3DM3 A;  1XNQ L;  1LT6 D;  4JI1 Q;  1B9M A;  3D0F A;  5CV7 A;  1CK1 A;  2E74 C;  2WKD A;  2NTS A;  3LWU A;  5D14 A;  5A2Q L;  1YIJ A;  3I56 A;  3MHB A;  3K80 C;  3O13 A;  3WOF A;  4N9T A;  1VQ7 A;  1ROD A;  5FKA C;  2WAQ B;  5C3E G;  4DNT B;  4HR7 B;  4K8I A;  4L6T B;  2VQF L;  3GP7 A;  1LTL A;  4A3E H;  1WTR A;  5I2Y A;  4JCV E;  5EPK A;  4O0A A;  2L12 A;  4C3H B;  4IFD H;  1A2T A;  4A3G H;  4UAI A;  3U9S A;  1FJG L;  4DXF A;  3T1Y L;  4FF3 A;  4LF4 L;  3UDX A;  4MIU A;  3A74 A;  4LF9 L;  2XWB B;  4GKJ L;  3T13 A;  3C3L A;  1KHI A;  1GUW A;  1Q3L A;  4HJ8 A;  1WCM H;  1PTO B;  3A56 A;  5JPM C;  1I94 Q;  1N36 L;  2E76 C;  1VQM A;  4ZKB B;  3PIP A;  2H4O A;  1PTO H;  3K59 A;  1YHQ A;  2OWO A;  1Y8P B;  3R2T A;  2ASB A;  1PRT C;  1MJE A;  2EYO A;  1JE4 A;  3A8K E;  1I6H H;  5E1F A;  1XMO L;  3M3Y B;  4P73 A;  2E75 C;  1ZXT A;  2JP1 A;  5EGT A;  1KIX A;  1IBM L;  4FXD A;  5K36 H;  2OTJ A;  4PMW A;  1IKL A;  3MC0 B;  2UU9 Q;  3M3Y H;  1LT4 D;  3BZK A;  4BY1 B;  3CU7 A;  2XWJ B;  4GN3 B;  2BOS A;  4FVM A;  1R4P B;  1EY5 A;  3EN2 A;  4CKB A;  5IYC G;  1FGU A;  4ULL A;  1G29 1;  4KHP Q;  3TRZ A;  1S5C D;  4C2M B;  2IJ0 A;  5T1I A;  1Q12 A;  4NXM L;  1LT5 D;  1NR4 A;  2FHT A;  1STY A;  1I6V C;  3UE1 A;  2X6G A;  2EPB A;  2X6L A;  2YU9 H;  1NTG A;  4C2M H;  2X69 A;  3K7A B;  1S40 A;  1CI3 M;  4WFN 3;  1WVL A;  4NDX A;  4NPS A;  1EEI D;  4IQZ A;  5IIF A;  4BA2 I;  4RAU C;  3GTM B;  2DY7 A;  2ZXR A;  1B44 D;  2YTV A;  2K7V A;  1D6E C;  2K50 A;  4POF A;  3PMF A;  4A93 H;  1Y1V H;  4L5T A;  1QWY A;  3NUC A;  4RG1 A;  1UAP A;  2UUA L;  1PZI D;  4C3J H;  2A19 A;  5K5P A;  2JSO A;  5IT9 c;  1SMY C;  1CUK A;  3J7A 5;  1X3G A;  1A0I A;  1JWS D;  3PUV A;  4POG A;  1X55 A;  4QUC A;  2Q2I A;  1RHP A;  1YBY A;  3TN2 A;  4OIK A;  2K5D A;  1VQF A;  2CQO A;  2P5Z X;  1I4X A;  4UPA A;  1EY4 A;  5CV5 A;  3J81 L;  1WTV A;  1ESF A;  4LUZ A;  4OO1 G;  1DD2 A;  4KMU C;  3HOX B;  4IUT A;  2GA4 B;  1IYV A;  2K75 A;  1Q86 C;  2CVR A;  1B50 A;  3T51 B;  5JEA J;  2QDB A;  3H94 A;  1C9O A;  1U4P A;  4R9W A;  3HOY B;  3CW2 C;  1IYJ B;  3I72 A;  4R4O A;  5IOC A;  3ITP A;  1S3O A;  3CCR A;  2I07 B;  3RN5 A;  1VF7 A;  2F0M A;  1NUC A;  2CCZ A;  2N88 A;  3PGZ A;  5COR A;  3H09 A;  2B8F A;  2VL6 A;  4JVZ A;  1WD1 A;  2KHS A;  4GN5 A;  1E2V A;  3OHX C;  4LF6 Q;  3S9W A;  1UEB A;  2HIX A;  1HZA A;  3PSI A;  4YY3 Q;  1PRT D;  3NP8 A;  3HKZ G;  1EQR A;  5GAG C;  1VQK A;  4H0L C;  1EWC A;  3OWF A;  3W5O A;  3TSS A;  1VQ8 A;  1LTA D;  4DR3 L;  3A7L A;  3VYT A;  2JEB I;  1CKM A;  3ONA B;  1HNZ Q;  3X3N A;  3VYU A;  4A3M G;  1PRT B;  4M8A A;  4DPG A;  4CJ1 B;  2UXC Q;  2E2J H;  4FP5 D;  3UDI A;  3GTQ H;  1EY8 A;  1SRO A;  2N8N A;  1XNQ Q;  4LF5 L;  1S5F D;  1WOC A;  1VDZ A;  1E24 A;  3PO2 G;  1GVP A;  1VS0 A;  1XJV A;  3HOV B;  3VR3 A;  5M5W B;  3X3M A;  1K3R A;  2GN5 A;  3GV3 A;  5DAU A;  1PH4 A;  3VR6 A;  1KLU D;  2E2D C;  1SE4 A;  2VXW A;  4LF8 L;  3I4N G;  4EVO A;  4GN4 B;  3H91 A;  1KRT A;  5IGD A;  4S3S A;  2AWO A;  3H15 A;  5JEA G;  2ZJR A;  2B2W A;  4K8J A;  5CV8 A;  1UE1 A;  2EJF C;  2NVT H;  3HGB A;  4IUP A;  1B4O A;  2B39 A;  4OWX B;  1VQ9 A;  1SEB D;  4L5Q A;  1QB5 D;  3S15 H;  4XQN A;  2LKV A;  2KED A;  2K1B A;  1M8A A;  1IW7 C;  1SMY D;  4ZLT F;  1EL0 A;  1QOH A;  1I4R A;  4XQQ A;  1EZ6 A;  3SR1 A;  2JA8 B;  4DAP A;  4X3S A;  3S17 B;  4IJH A;  3N52 A;  4DAY B;  1UE6 A;  5GAE C;  3HOZ H;  5IGF A;  2VW9 A;  4GKJ Q;  2KCT A;  5H1S E;  5JPN C;  5M3F G;  1VQ6 A;  4IO9 A;  3I4M H;  4A3C H;  1SNP A;  1KAA A;  1KNA A;  3K5O A;  2B2W C;  4G4K A;  3URY A;  4O42 A;  3ZJY C;  2EYM A;  4QUF A;  5GQO A;  4CKC A;  3DHQ A;  4EQO A;  4LFC L;  3A5U A;  2MO1 A;  3CHB D;  3LGJ A;  5BR8 Q;  3DXJ C;  2R3Z A;  1M4V A;  1NAP A;  3ICE A;  2SEB D;  1WFQ A;  3HKS A;  1EYA A;  5LMU Q;  4C1N I;  1JJ2 A;  1KTK A;  4KN4 C;  1Z6H A;  2IX3 A;  4JBJ A;  3HOU G;  1B1Z A;  1VQB A;  2F52 A;  1SDF A;  4HAE A;  1HPC A;  5ISR A;  2F3V A;  1JJG A;  1G8Z D;  1DGS A;  2HQL A;  4G7O C;  3S1Q B;  4DFA A;  2XNA C;  1AN8 A;  1H9R A;  4UHV A;  4KV6 A;  5FLX c;  2A6H C;  2DGY A;  1SYG A;  3IL8 A;  4HJ5 A;  3U9O A;  1VF5 C;  2IY5 B;  4YWM A;  1SAP A;  1A2U A;  3OW2 A;  4CHT B;  2PMZ E;  5EPL A;  2OCE A;  3M4O H;  3PO3 H;  1SND A;  3K8A A;  4J1M A;  1LTT D;  4OO1 I;  2AQ1 B;  3GTP B;  5J39 A;  2VUM H;  4GZY C;  3RN2 A;  2UUA Q;  3S1M B;  5ELD A;  1O78 A;  5C3E H;  1I4G A;  1Z9F A;  4PZ8 A;  1STE A;  1JB3 A;  1WTP A;  1LLR D;  2B8G A;  4JI4 Q;  1IL8 A;  1RKN A;  3H0G G;  1E2Z A;  2JQO A;  4LFA L;  5FLX E;  5IGG A;  2EYL A;  4A3F H;  3MVV A;  1MI2 A;  1YHB A;  3FKI H;  1C48 A;  4C56 C;  1MSG A;  2KHJ A;  4HJ9 A;  4IJL A;  2OTL A;  1ICW A;  1A3U A;  1IW7 D;  3K7U C;  3HKZ E;  2C35 B;  2EZV A;  2WAQ G;  3PV0 A;  2WFW A;  3I2Z A;  4HTH A;  2VQE Q;  1HNX L;  4YHH Q;  4A3I B;  1IBK L;  2QW7 A;  4YWK A;  5D3D A;  5M5X H;  3P1H A;  1VMP A;  2I5M X;  5TSS A;  3M7N A;  2NVY B;  1C4Q A;  3PUW A;  3CQZ B;  1F9R A;  2EY2 A;  4A3D B;  2F0Q A;  1EY7 A;  4DV6 L;  2I5H A;  4B3T L;  4ZUJ A;  1CHP D;  2J0T D;  2XSC A;  3TZD A;  2UXB Q;  3KYH C;  1EIG A;  5ELB A;  3NEM A;  3CQZ H;  4R4Q A;  3T56 B;  1XXG A;  1ILQ A;  1GOZ A;  4L63 B;  4PZ6 A;  2L0C A;  3ERS X;  2G9H D;  4AYB B;  4DR1 L;  3KF8 A;  3CC4 A;  2R93 G;  1M90 C;  2PW5 A;  5IYB H;  1R9T H;  1FL0 A;  5EPJ A;  3KDF B;  2N49 A;  4LF5 Q;  3P7J A;  1JIC A;  3JC6 6;  1HJP A;  3SGI A;  5IYD G;  4Y52 H;  3W3A A;  1AW7 A;  1BBW A;  3PCO B;  1SYE A;  1QE6 A;  2BE5 C;  5IY0 A;  3MXG A;  1K8O A;  4YIJ A;  2G9D A;  3Q8D A;  1VQO A;  1WD0 A;  1NBW A;  4B9W A;  2EY1 A;  4PNY A;  1FGB D;  4HJA A;  1STN A;  2O4X A;  5EAY A;  1V1O A;  3NPP A;  4NW2 A;  4HED A;  5GAD C;  3TS0 A;  4FF2 A;  2R7Z G;  1VQI A;  1Y14 B;  1LTR D;  3SDZ A;  5DLQ E;  2KCM A;  1YZ6 A;  1QUQ A;  1JWM D;  3S1N H;  3CCV A;  1X3F A;  3IKJ A;  2C9O A;  1SSO A;  2RCN A;  3QIA A;  3K81 C;  5JJI A;  1S4Z A;  2NTT A;  3K5L A;  3KBG A;  2EXD A;  3J7Z C;  4A3K H;  4DK3 C;  4JI0 Q;  1F2M A;  1EQQ A;  1I3Q B;  3S16 H;  4OIJ A;  4JI6 Q;  4RGM A;  4K14 A;  1QJO A;  1IBL Q;  1D5X C;  2NBF A;  3M4Q A;  2JXM B;  2CHB D;  3D4W A;  3U58 A;  3CAM A;  1I3Q H;  1KXL A;  2XVS A;  3DEO A;  2E2I H;  3HRZ C;  4BXX G;  2UUC Q;  3C1E A;  3NK9 A;  1JCK B;  4DR2 L;  1YI2 A;  1WYD A;  1Q81 C;  1XX8 A;  5GRO A;  1G91 A;  2Z6K C;  4MTN A;  2OQK A;  2K5N A;  5COY A;  1LTG D;  1X32 A;  2D0P A;  2H1E A;  3GO5 A;  4B3R L;  2MPM A;  5FLM G;  2JA9 A;  2YTY A;  3CCM A;  4OON A;  2F0S A;  4GLA C;  3BVZ A;  3OYY A;  4HIO A;  4KLK A;  1GXD C;  3RZD H;  2FMC A;  5IWA Q;  1Y1W B;  3KUP A;  3D4D A;  3D8G A;  3H3V I;  5IP9 G;  2NYZ D;  3UDF A;  4JI8 L;  4APV A;  3J81 j;  1S72 A;  4AIM A;  1EIF A;  3G48 A;  5C0X J;  5C4J B;  1OXV A;  2NVX H;  2WAQ E;  3CRL C;  2K52 A;  2BE5 D;  1F77 A;  3NWS A;  4KTA A;  2L15 A;  4BBS B;  3NEN A;  1PTO C;  4GLV B;  2V1C C;  1II3 A;  1KAW A;  1OXS C;  1CA5 A;  3SVM A;  4DV3 Q;  1HFN A;  4A3J B;  1WI5 A;  2FJ2 A;  1RTN A;  3M85 A;  3T53 B;  4IUQ A;  3C2P A;  2RHQ B;  1F9P A;  3PF5 A;  5ELE A;  1E3P A;  1HA6 A;  4K5V A;  1D1I A;  1HCZ A;  3KF8 B;  2B2Y A;  3K0Y A;  5JJL A;  3Q24 A;  1Q90 A;  4DNI A;  1H9J A;  3VR2 A;  2HHH Q;  3PUX A;  5M3F H;  2F0N A;  1ASY A;  2KEE A;  1IBK Q;  4F87 A;  3RLN A;  5GAH C;  5C44 G;  2FIN B;  1AZQ A;  1EFW A;  3L3O C;  4DV6 Q;  4B3T Q;  1E22 A;  2QKI C;  2RVL A;  4KD4 A;  2JA8 G;  4IPG A;  4DN4 M;  2B2Y C;  3OIP A;  2XN9 C;  1XTC D;  3WOE A;  1PH7 A;  1HA5 A;  4B3M L;  1WTO A;  3GTO B;  2YTX A;  1JT8 A;  4ZK9 B;  1CSQ A;  1TXY A;  4QIW B;  3TQY A;  2SOB A;  4DR1 Q;  1CZG A;  4U68 A;  2RCF A;  1CZW A;  3PIP 3;  2UUB L;  1HXY D;  2ZJQ A;  2D9U A;  4IUN A;  2L11 A;  1N32 L;  2PPB C;  4DV1 Q;  2Z4H A;  3NWT A;  5F2D A;  1BBU A;  3OMC A;  1G51 A;  5C0X G;  4CKE A;  2B63 G;  5DM7 3;  4JYA L;  3QO2 A;  2DN8 A;  1IL2 A;  1MHW C;  2IWH A;  3GTL H;  5CV4 A;  2K5Q A;  3EQL C;  2ZTC A;  3F2B A;  1KC8 C;  2MNA A;  3FRP B;  4DV7 L;  1CM9 A;  4A3E B;  4I65 A;  4NKL A;  3RZO H;  2QA4 A;  3BU2 A;  5EBC A;  4JPB W;  1J5E Q;  1K83 H;  4KKS A;  3T1H L;  4B9X A;  2EY6 A;  4A3G B;  1KDC A;  5KIX A;  1BCP F;  4BY7 G;  1VQJ A;  1JR0 D;  1NMF A;  1PTO D;  5KRU A;  2PQE A;  2EJG C;  2JA5 H;  3NQI A;  1WCM B;  1AEX A;  2HCI A;  4IZ8 A;  2NZH A;  1KDB A;  3G6J B;  1ML0 D;  2R7D A;  4JW0 A;  4DV2 L;  5J1Z A;  2QEX A;  1Y69 U;  1ENF A;  2K04 A;  1QZG A;  1W6K A;  2DY8 A;  3ULL A;  1B2T A;  3BS1 A;  3RMH A;  4HMI A;  4OGQ C;  4R4C A;  3G71 A;  5ELC A;  1I6H B;  2BCO A;  2O5J C;  4KKT A;  3ERO A;  4DUZ L;  1EU4 A;  5FK9 C;  3P20 A;  5CR3 A;  2WII B;  4K2K A;  1PFS A;  3SE0 A;  1JE5 A;  1ZKO A;  1JC7 A;  2F0K A;  4DF7 A;  3QWN A;  4DR2 Q;  2SNM A;  4TQU S;  4J6H A;  3I7F A;  2A68 C;  3PUZ A;  1AE3 A;  1PYB A;  1C7Y A;  4P2C B;  2AQ2 B;  5AJ3 L;  5C5M A;  3L7Z C;  1SYD A;  2VB2 X;  4B3S L;  2D62 A;  1BCP B;  1Z47 A;  1ENA A;  4DAY A;  2IW3 A;  4P74 A;  1SYC A;  4FXG C;  1LM0 A;  4DR5 Q;  2J7Z A;  4OXP A;  4L8J A;  4JI5 L;  2R93 H;  4RGT A;  5C4X G;  1EIY B;  3AQQ A;  2YU9 B;  4XT3 B;  1A3V A;  2O2L D;  1SE2 A;  4XXE A;  1I4Q A;  1ILP A;  5HUR A;  5CV6 A;  2Y0S G;  3TP8 A;  3DLL A;  2PO4 A;  4RKL A;  1XPR A;  1AZP A;  3J7A F;  1HFG A;  3K57 A;  2JA6 H;  1SBB B;  1T5E A;  5IYD H;  4A93 B;  1Y1V B;  3S2D H;  1D8L A;  1F2Y A;  4C3J B;  3D31 A;  2PNH A;  2F0L A;  3CPF A;  1GHK A;  1EY0 A;  1OXU A;  1QVG A;  3CCQ A;  1HRJ A;  4NXN L;  3CCJ A;  2JJQ A;  1V8Q A;  3V96 A;  1HZB A;  2RSN A;  1P16 A;  2R7Z H;  4LWC A;  2JYO A;  2HDM A;  3S14 B;  4Q0F A;  4V0B A;  1RD9 D;  1SMX A;  2BA1 A;  4BBR G;  2NN6 G;  1EWI A;  1SNC A;  1Y8N B;  3E9H A;  1YNX A;  3I73 A;  2L55 A;  1O80 A;  3A55 A;  2ZTD A;  3S14 H;  4KJN A;  5L37 A;  3EA6 A;  3SK6 A;  1TII D;  2VNU D;  1KL9 A;  3S2H H;  3FVQ A;  1O7L A;  3HFZ B;  2XRS D;  2MUY A;  4FO2 A;  1S5B D;  2A1A A;  3A54 A;  2OF1 A;  5KGU A;  1F2Z A;  1LV9 A;  3A7A B;  4ZRZ A;  1EYG A;  1U4M A;  1XTD A;  3FP9 A;  4X64 Q;  2JEA I;  1B7Y B;  5LMN L;  3C1F A;  5IT9 E;  5DM6 3;  5C0X I;  5CC4 A;  4YCV A;  5J22 A;  4BXX H;  3SK4 A;  4BA1 I;  2ATW A;  2G5D A;  3F8T A;  3G6E A;  2F0W A;  1XPU A;  2E2J B;  1L0Y B;  2WB1 B;  3GTQ B;  3MA2 B;  4A3L H;  2EYP A;  1K0R A;  2JN4 A;  3FEW X;  2Q8T A;  2IL8 A;  2EQS A;  5A2Q E;  3N6R A;  4UP9 A;  1L0X B;  2KEC A;  4RWS C;  5IGB A;  5LHY 1;  1BR9 A;  3AEV A;  2F0P A;  1I50 H;  2F0J A;  4HSP A;  4LK1 C;  1XYI A;  4JYA Q;  4JBK A;  4JOI A;  5FO7 B;  1RJT A;  4JI7 L;  1E1O A;  1UE7 A;  2QF7 A;  4A3B H;  4LW1 A;  2E8G A;  1QG7 A;  5M3M H;  2NVT B;  4PV1 C;  4DK1 A;  3S15 B;  2VQF Q;  3T1H Q;  3W1G A;  1TT2 A;  4QGU A;  3IFT A;  5E3F A;  5LMN W;  4OWW B;  3J80 L;  5IP7 G;  4JOI C;  1STB A;  1KLG D;  1Y1W G;  3HOZ B;  3D6W A;  1SE3 A;  3I4M B;  1FJG Q;  3KDF A;  1IHZ A;  4ZKC B;  3T1Y Q;  4ZAI A;  1TS4 A;  1LYL A;  5CGK A;  4LF4 Q;  3K58 A;  3STB C;  2J4X A;  4LAA A;  4DV2 Q;  4LF9 Q;  4EQP A;  4IOA A;  4WJ3 M;  1TS5 A;  1V43 A;  4LFB L;  5ELO A;  4QMG A;  5CBE E;  4X65 L;  1TWC H;  5I6W A;  1N36 Q;  3HOW G;  4XDX A;  1BOS A;  1TQO A;  1VQH A;  2KVM A;  2A8V A;  2F0H A;  3KBX A;  5EKI A;  4FXK C;  3DM1 A;  3GTJ H;  1OTC A;  4OEM B;  1TU2 B;  2EDG A;  5C44 H;  4C3I B;  2ES2 A;  4IPH A;  1XMO Q;  1W6J A;  3QOJ A;  4MTK A;  3Q6S A;  1IBM Q;  3J81 c;  3AB9 A;  2Y0S E;  4KHZ A;  5CYU A;  4C3I H;  4R1J A;  2JA7 G;  4ZCK A;  2HUG A;  4IPC A;  5G3L F;  5AJ3 Q;  4RHR A;  1WTQ A;  1XMQ L;  2AUK A;  3D6C A;  4AYB E;  4B3S Q;  2B2U A;  4EQN A;  3MTS A;  4JI5 Q;  2PZW A;  4WJW A;  2F0G A;  4P75 A;  1Q7Y C;  2PI2 A;  3OWE B;  1KQS A;  2Q2H A;  2ALY B;  2CQA A;  3ZYY X;  3M4O B;  3U4V A;  4DV5 L;  3PO3 B;  1SR3 A;  4NXM Q;  5C0X H;  2F0O A;  2K6A A;  1OXX K;  3CRK C;  2B63 H;  2V4D A;  2F1M A;  2NZO A;  1E0B A;  2KOL A;  3J7Y W;  2F0T A;  2VUM B;  4DAM A;  2ICE C;  1AH9 A;  2NN6 I;  1SN8 A;  2QIL A;  1UWV A;  1K0S A;  2FMM A;  2ZM6 L;  2B2U C;  2Q8R E;  5C3E B;  3CMA A;  1TWG H;  2EJM A;  2EOT A;  4QF4 A;  1SLJ A;  2R92 G;  3WWV A;  1JOK A;  4G7H C;  1SRU A;  2K14 A;  4GOP A;  2GVB A;  4A3F B;  3AFP A;  4XYO A;  3VA7 A;  3FKI B;  3CCL A;  4LF7 L;  2E2H B;  4QL5 A;  1MGS A;  3J81 i;  3QOL A;  4UP7 A;  4LNQ A;  3TRE A;  1D5M C;  3RLF A;  4BY7 H;  1Q82 C;  5HY6 A;  3TME A;  3NQT A;  4H7B A;  5C6A A;  3JAM L;  2E2H H;  3F2C A;  4K0K L;  4RGO S;  2F0U A;  3RR5 A;  1CFM A;  2A6E C;  5M5X B;  1E2W A;  2R7F A;  4IFD G;  1Q1B A;  3STB D;  4GOP C;  2KBN A;  1JOO A;  1C0A A;  4RGN A;  1FNW A;  1GHJ A;  1TY0 A;  1DM0 B;  1Y8O B;  4RCN A;  5NUC A;  3E0E A;  3OTO L;  4C3H G;  3GD7 A;  1B8A A;  2PCF B;  4OHJ A;  1VQA A;  2VB3 X;  5LMN Q;  3OMG A;  4HID A;  2MO0 A;  1F9S A;  2L1B A;  3VA5 A;  3OPO A;  1HQR D;  3F2D A;  4KK7 A;  1EQT A;  4CDD C;  4DR3 Q;  5M9O A;  5AFW A;  1R9T B;  2HCC A;  2EYH A;  2N55 A;  2IHF A;  1EOV A;  4H02 A;  4IPD A;  1PZK D;  4CDC C;  2EE1 A;  2WAC A;  4TKO B;  1PH1 A;  5FJ8 G;  1D2B A;  3I55 A;  1QIL A;  2LFN A;  4IUU A;  2BH8 A;  3P75 A;  5K36 G;  1EY9 A;  3EBE A;  3W1B A;  4X66 L;  3MXU A;  2A6H D;  5C4X H;  5IYC H;  2K03 A;  1WJJ A;  1L1O A;  1L0W A;  3GTG B;  1U4R A;  2K4K A;  1SFO H;  3GDE A;  2AUJ D;  4DK0 A;  1DJR D;  5C5L A;  3KLS X;  4DNR B;  3GTG H;  3KJO A;  1SNQ A;  4BY1 G;  4C1N K;  4LF8 Q;  2OT2 A;  1PA6 A;  1OXT A;  1YHA A;  2R61 A;  1K8G A;  3S1N B;  1U5K A;  1LAC A;  1G2S A;  4R8I A;  4JI1 L;  1F2L A;  2PMZ B;  2F0I A;  5DEH A;  5M5Y B;  2NVQ H;  3UDG A;  3QJY A;  2RDH A;  1L1O C;  3LX0 A;  2K28 A;  3Q23 A;  1GUS A;  2YYZ A;  1HNW L;  5M5Y H;  4A93 G;  1YNJ C;  1SJE D;  3CD6 A;  4BBR H;  2NN6 H;  4A3K B;  4OO1 H;  1EU3 A;  5HGQ A;  4C3J G;  1X56 A;  2CH4 W;  3S16 B;  1STH A;  2Q8I B;  5I9P A;  2Z6K A;  4I7A A;  3GTK B;  1TWF H;  1MIU A;  3ERQ A;  5IOD A;  4FF1 A;  4LFC Q;  2A6E D;  1ET9 A;  5DNF A;  3UE0 A;  3CP0 A;  2E2I B;  3GTK H;  1JOQ A;  2Z1C A;  3VYS A;  1R4Q B;  3CCE A;  3HOX G;  5EKL A;  2VY3 A;  2SNS A;  3CC2 A;  3HKZ B;  1GJX A;  2Z9H A;  1HQM C;  1EFI D;  3K5M A;  4LJZ C;  2SDF A;  1J9O A;  2HIV A;  4DK6 C;  4GOP B;  2GVA A;  3HOY G;  4RKB A;  3I3C A;  4RCO A;  5C3W A;  1XMQ Q;  4DR7 L;  4QIW E;  1W2B A;  3AMU A;  1VQN A;  3NE5 B;  4KHV A;  5EBD A;  1KRS A;  1U9R A;  1M1K C;  3T16 A;  3HS0 C;  3MWY W;  3RZD B;  1H9S A;  4A3M H;  3VR5 A;  3BJU A;  2MFI A;  4DV5 Q;  4L5S A;  1N34 L;  2Z0S A;  2LXK A;  3QB3 A;  3VDY A;  1TWA H;  1GKH A;  2PYK A;  1HR0 L;  3H3V C;  2EVB A;  3MZ5 A;  3NTK A;  2R6G A;  3PO2 H;  3DWA A;  4JBM A;  3EVQ A;  1Z7T A;  2NVX B;  3PIO 3;  1JQY D;  1SNO A;  3HG9 A;  4EQ5 A;  3NEL A;  2ZM6 Q;  1TS3 A;  2JE6 I;  1LT3 D;  2BDO A;  1BDO A;  3BYY B;  4RH6 A;  2CH4 A;  4DR6 L;  1U4L A;  5BN5 A;  1CQV A;  2ZT9 C;  4P71 A;  1NSN S;  2CWP A;  3I4N H;  3TP7 A;  3U4Z A;  5FO9 B;  4ALP A;  1WTW A;  2HT1 A;  2Q2U A;  3I4L A;  1J8I A;  4ZUI A;  2K5W A;  2QDL A;  4XIG S;  5I9O A;  4IFD I;  4LF7 Q;  5JEA H;  3DMU A;  2OEO A;  4LFA Q;  3HOV G;  1B53 A;  1LTS D;  1PH9 A;  4F88 A;  2D2C C;  5IP7 H;  2LSS A;  5M3F B;  1NY4 A;  4K0K Q;  2HD3 A;  2F0D A;  1JWU D;  5I2X A;  1P8L A;  1YNJ D;  1HNX Q;  3GQB A;  4FNF A;  1TKW B;  2F0V A;  1HR0 W;  1L1O B;  3SXH A;  2ICI A;  1FVI A;  5HGT A;  1VQD A;  3OTO Q;  3HOW H;  4PQX A;  5KEE A;  4ILW A;  3E3X A;  1EY6 A;  1DXM A;  1TWH H;  1VQL A;  1FR3 A;  2A74 C;  1VQC A;  2F0E A;  2FXQ A;  4YCU A;  1UUP A;  1CHQ D;  1RF2 D;  4NP5 A;  4JI2 L;  3HOU H;  1A63 A;  2JA7 H;  3PIO A;  3SHL A;  1HZC A;  1OO9 B;  3KLS A;  2K5H A;  1G2T A;  2LS0 1;  1BO0 A;  3KJP A;  3HZX A;  1QVC A;  2K33 A;  2LY7 A;  1PH6 A;  4RA8 A;  3PQI A;  4X66 Q;  3OSO A;  3NXW A;  1EZ8 A;  4LF6 L;  3GTL B;  4K2L A;  2MGS A;  3TDQ A;  5E4W C;  1QVF A;  4UY8 C;  3TZU A;  3NBH A;  3RZO B;  2NWG A;  4H13 C;  1HNZ L;  1PRT F;  5IT9 L;  1K83 B;  2DJF C;  4EX5 A;  4DR4 L;  1DZ1 A;  2B2T A;  2UXC L;  1E7Z A;  3BG3 A;  3ER0 A;  1A6X A;  2M00 A;  4WOR A;  3I91 A;  3PF4 A;  3NBI A;  2EIF A;  2R92 H;  4KI0 A;  2JA5 B;  3PO3 G;  3H0G B;  4JV5 L;  2RQX A;  4Z9C B;  3BZD B;  5T1G A;  4MHE A;  1EEF D;  1ESR A;  2WP8 J;  3E0J A;  1HNW Q;  3H3V H;  1F9Q A;  2VUM G;  4K6D A;  3H0G H;  4ID6 A;  3CF5 A;  3C46 A;  3E5S A;  1K3B C;  4QJF A;  2QGQ A;  2B2T C;  5FOB B;  1PFN A;  1PFM A;  4IOC A;  1RDP D;  1H9S B;  2B2V A;  1I4P A;  4H44 C;  1CKN A;  3KF6 A;  2E5L L;  4A3F G;  2K5V A;  1SNM A;  4K6L A;  3FKI G;  1PV4 A;  1YJW A;  2C5C A;  1AFP A;  3IRB A;  4C3H H;  3BDL A;  3A5Z B;  3SK8 A;  1AE2 A;  2L9H A;  1Q1E A;  3EFX D;  5JVH 3;  5LL6 X;  2Z8L A;  3D3R A;  4DA2 A;  2Z6B A;  1PH2 A;  1I5F A;  4WJ4 A;  3DUZ A;  4DUY L;  4DR7 Q;  2D5D A;  1WTH A;  2B2V C;  4QY7 A;  2R93 B;  4CGY B;  4A3I G;  2WB1 E;  4MN3 A;  1C8C A;  5BR8 L;  4B3R Q;  1ZEQ X;  3M4Y A;  3D4R A;  4DV0 L;  4A3D G;  5LMU L;  1N34 Q;  1X6O A;  5FJ8 H;  1HHV A;  1X9N A;  1O7Z A;  3TEH B;  2TSS A;  4GNX A;  1HR0 Q;  2JA6 B;  4QCL A;  2BDN A;  3FPU B;  3RLO A;  3S2D B;  2EY5 A;  4R8N A;  2AQ3 B;  1H95 A;  4JG2 A;  4LMQ D;  3DWQ A;  1BCP C;  1N9W A;  3OW7 A;  3KLR A;  4JI8 Q;  5IYB G;  1PLF A;  4AYB G;  4Y7N B;  4DR6 Q;  2KJX A;  2RA4 A;  1K28 A;  2R7Z B;  4BY1 H;  3FMC A;  3PUY A;  4OX9 L;  2MHV A;  4Y7N H;  4GS3 A;  1NNX A;  1BXT A;  1PH3 A;  3KLW A;  2RBM A;  1VQ4 A;  1YNN C;  4GNX C;  2RDG A;  4LUV A;  1GM5 A;  3G7L A;  3LNN A;  1E1T A;  1V1Q A;  2OXP A;  5EJW A;  1YVC A;  1Q8I A;  3NSW A;  4NMZ A;  3BYT B;  2PW7 A;  4CDE C;  2WKC A;  1STA A;  3S2H B;  1CSP A;  3AFQ A;  1WTX A;  3K7A H;  4XQJ A;  4FYD A;  2ZXO A;  3HEJ A;  4X3U A;  4CJ2 C;  2CW0 C;  1HUM A;  1BNZ A;  2HQE A;  3GTM H;  3OOC A;  2TMP A;  1B70 B;  4JI4 L;  4TVA B;  2CWA A;  1X54 A;  4JC0 A;  4DXG A;  2JK8 A;  3NBH B;  5EQ0 A;  4F7X A;  3MFY A;  1UE5 A;  4GLX A;  1MBY A;  4E6I A;  1XNR L;  1X65 A;  4A3K G;  1ONL A;  3FHW A;  3HOX H;  2H5X A;  5FLX L;  2F3I A;  1K8M A;  4B3M Q;  2VQE L;  4JI2 Q;  4YHH L;  1EUJ A;  1BF4 A;  2Q2T A;  2M2L A;  1Q46 A;  2WIN B;  4IAL A;  2UUB Q;  3HOY H;  1IYU A;  2ID0 A;  3S1R B;  1I50 B;  4LUO A;  2AMC B;  2A68 D;  4UP8 A;  1N32 Q;  3M4P A;  4A75 A;  3Q0A A;  2NZ1 D;  2UXB L;  1D1K A;  1QZH A;  3S1R H;  2I0Q A;  5JJZ A;  3L0O A;  4A3B B;  5FLM H;  1LTI D;  1A8V A;  4DGZ A;  1HZ9 A;  1J6Q A;  1T9H A;  5M3M B;  4TSS A;  1RL2 A;  1CKN B;  5KYL A;  1PFB A;  3KF6 B;  1HTL D;  3R3O A;  4DR4 Q;  5KNB A;  4JI3 L;  4DV7 Q;  2F0F A;  5IP9 H;  3ND8 A;  2IX0 A;  3I8Z A;  1BCP D;  3V05 A;  2PQA A;  3MFG A;  1JJC B;  2KA7 A;  2FFK B;  3IFD A;  4RHS A;  4JV5 Q;  3I4O A;  2MQH A;  3TP6 A;  1NJI C;  1ASZ A;  4O1N A;  2IT1 A; 
#chains in the Genus database with same CATH homology
 1MSH A;  1YNN D;  2O5I C;  1DCZ A;  1TWC B;  2AWN A;  1CA6 A;  2RSO A;  1X3Q A;  1LO5 D;  5I4D A;  5CV9 A;  1JOR A;  3GTJ B;  1UEA B;  5C4H A;  3NHH A;  5C44 B;  1D5Z C;  2CW0 D;  2PNR C;  4J8Q A;  1CTM A;  4KKU A;  3VYR A;  4KY7 A;  1BUV T;  3R2I A;  4U67 3;  1TVX A;  2MP1 A;  4IFD J;  1PMR A;  1I4H A;  2PZT A;  3W2D A;  5CMD A;  1SJH D;  3A8J E;  2KUM A;  3MXN A;  2NUC A;  1QCB D;  3WDN A;  1G6Z A;  3J7A V;  3BVG A;  5IGE A;  2B63 B;  4XYQ A;  1PYW D;  5D3I B;  2Z4I A;  1TWG B;  1EIH A;  1CT1 D;  4K5W A;  1RTO A;  1X3P A;  3J81 E;  1SYF A;  1DOM A;  2PZU A;  5EKK A;  2DNE A;  4IUV A;  2QCP X;  2XRQ D;  4BY7 B;  1O7Y A;  3FPP A;  2HDL A;  3TBI B;  4JBW A;  2ZXP A;  2EYF A;  5C3X A;  1EOT A;  2I46 A;  3V2T A;  4HMJ A;  2K01 A;  1T5X D;  2NB0 A;  2IPK D;  5JVG 3;  3HP3 A;  2KCN A;  5BN3 A;  1GUN A;  1AP0 A;  2LMC B;  2RDF A;  3RUZ A;  5JAV A;  1SXT A;  3RD4 A;  2DNC A;  1EWH A;  4KY6 A;  4UDU C;  4DU9 A;  1V1P A;  4KJO A;  1H9K A;  3M7G A;  4XTC S;  4G7Z C;  3H6M A;  1S5D D;  1A3T A;  1NR2 A;  4ZYS A;  5C4X B;  3BVM A;  2QEJ C;  4KN7 C;  3KK7 A;  3NTH A;  1B3A A;  1HTP A;  1SFO B;  2Y0S B;  4ME5 A;  2EXZ A;  3IAY A;  5LL6 S;  5D65 A;  1KDA A;  4RFB A;  3R93 A;  3SEB A;  2K32 A;  2K05 A;  2MJ8 A;  1QNU A;  4EGV A;  5KYI A;  1HUN A;  4I7Z C;  3J80 E;  5I6Y A;  4ZQ3 A;  4PMB A;  2NVQ B;  3AU7 A;  1A15 A;  1EYD A;  1LTB D;  1NCV A;  4B08 A;  1LAB A;  1BBX C;  4BBR B;  1GUT A;  1ENC A;  3SK5 A;  4DAV A;  1ET6 A;  1FNV A;  4HN7 A;  1TWF B;  2L5T A;  4PMC A;  2A69 C;  5KND A;  4M1U B;  1DYQ A;  1FYC A;  5A35 A;  1PDQ A;  1VMC A;  1ZYR C;  2ENB A;  3DWP A;  3BDC A;  2F3W A;  5IGC A;  5G3L D;  1TS2 A;  3A8I E;  1BQQ T;  2XIW A;  1PTO F;  3R8B A;  2BA0 A;  1S5E D;  3VR4 A;  4K5X A;  1MD2 D;  4N9P A;  4A3M B;  1PXU A;  1TWA B;  4V19 0;  3OIQ A;  3PO2 B;  4X3T A;  4OL7 A;  4WRD A;  2RKS A;  5C4Z A;  4F8M A;  4ODG A;  1B9N A;  3I4N B;  3E6Z X;  1RCV D;  1TR5 A;  4ABN A;  4HCS A;  3BDO A;  3F2U A;  1IKM A;  3JAM E;  1VCI A;  1TY2 A;  3DEP A;  1EYC A;  3K5N A;  1SYB A;  1V1P B;  2F4I A;  1FNU A;  1GUO A;  1STG A;  3TP5 A;  3MAQ A;  4TRD A;  1DOK A;  3EJI A;  1PZJ D;  4G57 A;  4JK1 C;  1KAB A;  3I70 A;  5CBA E;  4XT1 B;  4X3K A;  3HOW B;  4KY5 A;  3I90 A;  1TWH B;  2A69 D;  2F03 A;  2A73 B;  4KD3 A;  3CKI B;  4IUR A;  1ZYR D;  4CJ0 B;  3HOU B;  2IX1 A;  4HSV A;  3FDT A;  2JA7 B;  5FO8 B;  1UNS A;  5ELF A;  4BS9 A;  2KQ3 A;  4BWG B;  1EQV A;  2WV6 D;  4HCE A;  5JOB A;  3T4A C;  3NTI A;  3UI2 A;  3MXP A;  3QG1 A;  3Q22 A;  3MEH A;  4C3I G;  3ND9 A;  1XWE A;  5E4X A;  2L4N A;  3K6O A;  2M9V A;  1FD7 D;  1DOL A;  2KCC A;  4FF4 A;  4QB4 A;  5KNC A;  1GUG A;  4CBV A;  2A5H A;  3L9A X;  4IN3 A;  3GV6 A;  3LWE A;  4Q5V A;  1H9M A;  1KNE A;  2R92 B;  1CQF A;  1DON A;  1QNK A;  5BN4 A;  2EYJ A;  1LT6 D;  1B9M A;  5CV7 A;  1CK1 A;  2E74 C;  2WKD A;  2NTS A;  3LWU A;  5D14 A;  5A2Q L;  3MHB A;  3O13 A;  3WOF A;  4N9T A;  1ROD A;  5FKA C;  2WAQ B;  4DNT B;  4HR7 B;  4K8I A;  4L6T B;  3GP7 A;  1WTR A;  5I2Y A;  5EPK A;  2L12 A;  4C3H B;  4IFD H;  1A2T A;  4UAI A;  3U9S A;  4DXF A;  4FF3 A;  4MIU A;  2XWB B;  3T13 A;  3C3L A;  1GUW A;  1Q3L A;  1PTO B;  3A56 A;  5JPM C;  2E76 C;  4ZKB B;  2H4O A;  1PTO H;  3K59 A;  1Y8P B;  3R2T A;  1PRT C;  2EYO A;  1JE4 A;  3A8K E;  5E1F A;  3M3Y B;  2E75 C;  1ZXT A;  2JP1 A;  5EGT A;  4FXD A;  5K36 H;  4PMW A;  1IKL A;  3MC0 B;  1LT4 D;  4BY1 B;  3CU7 A;  2XWJ B;  2BOS A;  4FVM A;  1R4P B;  1EY5 A;  4CKB A;  4ULL A;  1G29 1;  1S5C D;  4C2M B;  2IJ0 A;  5T1I A;  1Q12 A;  1LT5 D;  1NR4 A;  2FHT A;  1STY A;  1I6V C;  2X6G A;  2EPB A;  2X6L A;  2X69 A;  3K7A B;  1CI3 M;  4WFN 3;  1WVL A;  4NDX A;  1EEI D;  4IQZ A;  5IIF A;  4BA2 I;  4RAU C;  3GTM B;  2DY7 A;  2ZXR A;  1B44 D;  2K7V A;  1D6E C;  3PMF A;  1QWY A;  3NUC A;  1UAP A;  1PZI D;  5K5P A;  2JSO A;  1SMY C;  1JWS D;  3PUV A;  4QUC A;  1RHP A;  3TN2 A;  4OIK A;  2K5D A;  1I4X A;  5CV5 A;  1EY4 A;  3J81 L;  1WTV A;  1ESF A;  4OO1 G;  1DD2 A;  4KMU C;  3HOX B;  4IUT A;  2GA4 B;  1IYV A;  2CVR A;  1B50 A;  3T51 B;  5JEA J;  2QDB A;  3H94 A;  1U4P A;  4R9W A;  3HOY B;  3I72 A;  5IOC A;  3ITP A;  2I07 B;  1VF7 A;  2F0M A;  1NUC A;  2N88 A;  5COR A;  3H09 A;  2B8F A;  1WD1 A;  2KHS A;  1E2V A;  3OHX C;  3S9W A;  1PRT D;  3NP8 A;  4H0L C;  1EWC A;  3OWF A;  3TSS A;  1LTA D;  3A7L A;  3VYT A;  2JEB I;  3ONA B;  3X3N A;  3VYU A;  1PRT B;  4M8A A;  4CJ1 B;  4FP5 D;  1EY8 A;  1S5F D;  1VDZ A;  3HOV B;  3VR3 A;  5M5W B;  3X3M A;  3GV3 A;  5DAU A;  3VR6 A;  1KLU D;  2E2D C;  1SE4 A;  2VXW A;  4EVO A;  3H91 A;  5IGD A;  4S3S A;  2AWO A;  5JEA G;  2B2W A;  4K8J A;  5CV8 A;  2EJF C;  3HGB A;  4IUP A;  1B4O A;  2B39 A;  1SEB D;  1QB5 D;  4XQN A;  2LKV A;  2KED A;  2K1B A;  1M8A A;  1IW7 C;  1SMY D;  4ZLT F;  1EL0 A;  1QOH A;  1I4R A;  4XQQ A;  1EZ6 A;  3SR1 A;  2JA8 B;  4DAP A;  4X3S A;  3S17 B;  3N52 A;  5IGF A;  5JPN C;  1SNP A;  1KAA A;  1KNA A;  3K5O A;  2B2W C;  4G4K A;  3URY A;  4O42 A;  2EYM A;  4QUF A;  4CKC A;  3DHQ A;  4EQO A;  3CHB D;  3DXJ C;  2R3Z A;  1M4V A;  1NAP A;  2SEB D;  1EYA A;  4C1N I;  1KTK A;  4KN4 C;  1Z6H A;  2IX3 A;  1B1Z A;  1SDF A;  4HAE A;  1HPC A;  5ISR A;  2F3V A;  1G8Z D;  4G7O C;  3S1Q B;  4DFA A;  2XNA C;  1AN8 A;  1H9R A;  4KV6 A;  2A6H C;  1SYG A;  3IL8 A;  3U9O A;  1VF5 C;  1SAP A;  1A2U A;  4CHT B;  5EPL A;  1SND A;  4J1M A;  1LTT D;  4OO1 I;  2AQ1 B;  3GTP B;  5J39 A;  4GZY C;  3S1M B;  5ELD A;  1O78 A;  1I4G A;  1STE A;  1JB3 A;  1WTP A;  1LLR D;  2B8G A;  1IL8 A;  1RKN A;  1E2Z A;  5FLX E;  5IGG A;  2EYL A;  3MVV A;  1MI2 A;  1C48 A;  4C56 C;  1MSG A;  1ICW A;  1A3U A;  1IW7 D;  2EZV A;  3PV0 A;  4HTH A;  4A3I B;  5D3D A;  3P1H A;  1VMP A;  5TSS A;  3M7N A;  2NVY B;  1C4Q A;  3PUW A;  3CQZ B;  1F9R A;  2EY2 A;  4A3D B;  2F0Q A;  1EY7 A;  4ZUJ A;  1CHP D;  3TZD A;  2J0T D;  2XSC A;  1EIG A;  5ELB A;  3T56 B;  1XXG A;  1ILQ A;  1GOZ A;  4L63 B;  2L0C A;  2G9H D;  4AYB B;  3KF8 A;  2PW5 A;  5EPJ A;  3P7J A;  1JIC A;  3W3A A;  1AW7 A;  1SYE A;  1QE6 A;  2BE5 C;  3MXG A;  1K8O A;  4YIJ A;  2G9D A;  1WD0 A;  4B9W A;  2EY1 A;  4PNY A;  1FGB D;  1STN A;  2O4X A;  1V1O A;  3NPP A;  4NW2 A;  4HED A;  4FF2 A;  1LTR D;  3SDZ A;  1JWM D;  3IKJ A;  2C9O A;  1SSO A;  3QIA A;  1S4Z A;  2NTT A;  3K5L A;  3KBG A;  1F2M A;  1I3Q B;  4OIJ A;  4RGM A;  4K14 A;  1QJO A;  1D5X C;  2NBF A;  2JXM B;  2CHB D;  3D4W A;  2XVS A;  3DEO A;  3HRZ C;  3C1E A;  3NK9 A;  1JCK B;  1XX8 A;  1G91 A;  5COY A;  1LTG D;  1X32 A;  2H1E A;  3GO5 A;  2MPM A;  2F0S A;  3BVZ A;  1GXD C;  2FMC A;  1Y1W B;  3KUP A;  3D4D A;  3D8G A;  2NYZ D;  5C0X J;  5C4J B;  1OXV A;  3CRL C;  2BE5 D;  1F77 A;  3NWS A;  4KTA A;  4BBS B;  1PTO C;  1II3 A;  1OXS C;  1CA5 A;  3SVM A;  1HFN A;  4A3J B;  2FJ2 A;  1RTN A;  3M85 A;  3T53 B;  4IUQ A;  3C2P A;  1F9P A;  5ELE A;  1HA6 A;  4K5V A;  1D1I A;  1HCZ A;  2B2Y A;  3K0Y A;  3Q24 A;  1Q90 A;  1H9J A;  3VR2 A;  3PUX A;  2F0N A;  2KEE A;  4F87 A;  2FIN B;  1AZQ A;  3L3O C;  2QKI C;  2RVL A;  4KD4 A;  4DN4 M;  2B2Y C;  3OIP A;  2XN9 C;  1XTC D;  3WOE A;  1HA5 A;  1WTO A;  3GTO B;  4ZK9 B;  4QIW B;  2SOB A;  1CZG A;  4U68 A;  3PIP 3;  1CZW A;  1HXY D;  2D9U A;  4IUN A;  2L11 A;  2PPB C;  2Z4H A;  3NWT A;  5F2D A;  3OMC A;  5C0X G;  4CKE A;  5DM7 3;  3QO2 A;  2DN8 A;  2IWH A;  5CV4 A;  2K5Q A;  3EQL C;  3FRP B;  1CM9 A;  4A3E B;  4I65 A;  4NKL A;  5EBC A;  4KKS A;  4B9X A;  2EY6 A;  4A3G B;  1KDC A;  5KIX A;  1BCP F;  1JR0 D;  5KRU A;  1PTO D;  2PQE A;  2EJG C;  3NQI A;  1WCM B;  1AEX A;  2HCI A;  4IZ8 A;  1KDB A;  3G6J B;  1ML0 D;  5J1Z A;  1Y69 U;  1ENF A;  2K04 A;  1W6K A;  2DY8 A;  1B2T A;  3BS1 A;  3RMH A;  4HMI A;  4OGQ C;  1I6H B;  5ELC A;  2BCO A;  2O5J C;  4KKT A;  3ERO A;  1EU4 A;  5FK9 C;  3P20 A;  5CR3 A;  2WII B;  4K2K A;  3SE0 A;  1ZKO A;  1JC7 A;  2F0K A;  4DF7 A;  3QWN A;  2SNM A;  4TQU S;  4J6H A;  2A68 C;  3PUZ A;  4P2C B;  2AQ2 B;  5C5M A;  3L7Z C;  1SYD A;  2VB2 X;  2D62 A;  1BCP B;  1Z47 A;  1ENA A;  4DAY A;  2IW3 A;  1SYC A;  4FXG C;  2J7Z A;  4L8J A;  4RGT A;  2YU9 B;  4XT3 B;  1A3V A;  2O2L D;  1SE2 A;  4XXE A;  1I4Q A;  1ILP A;  5HUR A;  5CV6 A;  3TP8 A;  2PO4 A;  4RKL A;  1AZP A;  3J7A F;  1HFG A;  3K57 A;  1SBB B;  1T5E A;  4A93 B;  1Y1V B;  1F2Y A;  4C3J B;  3D31 A;  2F0L A;  1GHK A;  1EY0 A;  1OXU A;  1HRJ A;  1V8Q A;  3V96 A;  2RSN A;  2JYO A;  2HDM A;  3S14 B;  4Q0F A;  4V0B A;  1RD9 D;  2BA1 A;  2NN6 G;  1SNC A;  1Y8N B;  3I73 A;  2L55 A;  1O80 A;  3A55 A;  4KJN A;  3EA6 A;  3SK6 A;  1TII D;  2VNU D;  3FVQ A;  1O7L A;  2XRS D;  2MUY A;  4FO2 A;  1S5B D;  3A54 A;  2OF1 A;  5KGU A;  1F2Z A;  1LV9 A;  3A7A B;  4ZRZ A;  1U4M A;  2JEA I;  3C1F A;  5IT9 E;  5DM6 3;  5C0X I;  5CC4 A;  5J22 A;  3SK4 A;  4BA1 I;  2F0W A;  2E2J B;  1L0Y B;  2WB1 B;  3GTQ B;  3MA2 B;  2EYP A;  3FEW X;  2Q8T A;  2IL8 A;  5A2Q E;  3N6R A;  1L0X B;  2KEC A;  4RWS C;  5IGB A;  5LHY 1;  1BR9 A;  2F0P A;  2F0J A;  4HSP A;  4LK1 C;  1XYI A;  5FO7 B;  1RJT A;  2QF7 A;  1QG7 A;  2NVT B;  4PV1 C;  4DK1 A;  3S15 B;  1TT2 A;  3IFT A;  5E3F A;  3J80 L;  1STB A;  1KLG D;  3HOZ B;  3D6W A;  1SE3 A;  3I4M B;  1IHZ A;  4ZKC B;  4ZAI A;  1TS4 A;  5CGK A;  3K58 A;  2J4X A;  4LAA A;  4EQP A;  1TS5 A;  1V43 A;  4QMG A;  5CBE E;  5I6W A;  4XDX A;  1BOS A;  1TQO A;  2KVM A;  2F0H A;  3KBX A;  5EKI A;  4FXK C;  3DM1 A;  1TU2 B;  2EDG A;  4C3I B;  1W6J A;  3QOJ A;  3Q6S A;  3AB9 A;  4KHZ A;  5CYU A;  2HUG A;  5G3L F;  4RHR A;  1WTQ A;  2AUK A;  3D6C A;  2B2U A;  4EQN A;  3MTS A;  2PZW A;  4WJW A;  2F0G A;  3OWE B;  2CQA A;  3M4O B;  3ZYY X;  3PO3 B;  5C0X H;  2F0O A;  2K6A A;  1OXX K;  3CRK C;  2V4D A;  2F1M A;  1E0B A;  2KOL A;  3J7Y W;  2F0T A;  2VUM B;  2ICE C;  2NN6 I;  2QIL A;  2FMM A;  2B2U C;  2Q8R E;  5C3E B;  2EJM A;  2EOT A;  4QF4 A;  1JOK A;  4G7H C;  4A3F B;  4XYO A;  3VA7 A;  3FKI B;  2E2H B;  1MGS A;  3QOL A;  1D5M C;  3RLF A;  3TME A;  3NQT A;  4H7B A;  5C6A A;  3JAM L;  4RGO S;  2F0U A;  1CFM A;  2A6E C;  5M5X B;  1E2W A;  4IFD G;  1Q1B A;  1JOO A;  4RGN A;  1FNW A;  1GHJ A;  1TY0 A;  1DM0 B;  1Y8O B;  4RCN A;  5NUC A;  4C3H G;  3GD7 A;  2PCF B;  4OHJ A;  2VB3 X;  3OMG A;  1F9S A;  2L1B A;  3VA5 A;  3OPO A;  1HQR D;  4KK7 A;  1EQT A;  5M9O A;  5AFW A;  1R9T B;  2HCC A;  2EYH A;  2N55 A;  1PZK D;  2EE1 A;  2WAC A;  4TKO B;  1D2B A;  1QIL A;  2LFN A;  4IUU A;  3P75 A;  5K36 G;  1EY9 A;  3MXU A;  2A6H D;  2K03 A;  3GTG B;  1U4R A;  2AUJ D;  4DK0 A;  1DJR D;  5C5L A;  3KLS X;  4DNR B;  1SNQ A;  4C1N K;  2OT2 A;  1OXT A;  2R61 A;  3S1N B;  1LAC A;  1G2S A;  4R8I A;  1F2L A;  2PMZ B;  2F0I A;  5DEH A;  5M5Y B;  3QJY A;  2RDH A;  3LX0 A;  2K28 A;  3Q23 A;  1GUS A;  2YYZ A;  1YNJ C;  1SJE D;  2NN6 H;  4A3K B;  4OO1 H;  1EU3 A;  4C3J G;  3S16 B;  1STH A;  2Q8I B;  5I9P A;  3GTK B;  3ERQ A;  5IOD A;  4FF1 A;  2A6E D;  1ET9 A;  5DNF A;  2E2I B;  1JOQ A;  2Z1C A;  3VYS A;  1R4Q B;  5EKL A;  2SNS A;  3HKZ B;  1GJX A;  1HQM C;  1EFI D;  3K5M A;  4LJZ C;  2SDF A;  1J9O A;  4RKB A;  3I3C A;  4RCO A;  5C3W A;  3AMU A;  3NE5 B;  4KHV A;  5EBD A;  1U9R A;  3T16 A;  3HS0 C;  3MWY W;  3RZD B;  1H9S A;  3VR5 A;  3QB3 A;  2PYK A;  3H3V C;  2EVB A;  3MZ5 A;  3NTK A;  2R6G A;  3DWA A;  3EVQ A;  1Z7T A;  2NVX B;  3PIO 3;  1JQY D;  1SNO A;  3HG9 A;  1TS3 A;  2JE6 I;  1LT3 D;  2BDO A;  1BDO A;  3BYY B;  4RH6 A;  1U4L A;  5BN5 A;  1CQV A;  2ZT9 C;  1NSN S;  3TP7 A;  5FO9 B;  1WTW A;  3I4L A;  1J8I A;  4ZUI A;  2K5W A;  4XIG S;  5I9O A;  4IFD I;  5JEA H;  3DMU A;  2OEO A;  1B53 A;  1LTS D;  4F88 A;  2D2C C;  5M3F B;  2F0D A;  1JWU D;  5I2X A;  1YNJ D;  3GQB A;  4FNF A;  1TKW B;  2F0V A;  3SXH A;  2ICI A;  5HGT A;  4PQX A;  5KEE A;  4ILW A;  1EY6 A;  1DXM A;  1FR3 A;  2A74 C;  2F0E A;  1UUP A;  1CHQ D;  1RF2 D;  4NP5 A;  3SHL A;  1OO9 B;  3KLS A;  1G2T A;  2LS0 1;  1BO0 A;  3HZX A;  2K33 A;  2LY7 A;  4RA8 A;  3OSO A;  3NXW A;  1EZ8 A;  3GTL B;  4K2L A;  2MGS A;  3TDQ A;  5E4W C;  3TZU A;  3NBH A;  3RZO B;  2NWG A;  4H13 C;  1PRT F;  5IT9 L;  1K83 B;  1DZ1 A;  2B2T A;  3BG3 A;  1A6X A;  2M00 A;  4WOR A;  3I91 A;  3NBI A;  4KI0 A;  2JA5 B;  3H0G B;  2RQX A;  4Z9C B;  3BZD B;  5T1G A;  4MHE A;  1EEF D;  1ESR A;  2WP8 J;  3E0J A;  1F9Q A;  4K6D A;  4ID6 A;  3C46 A;  3E5S A;  2B2T C;  5FOB B;  1PFN A;  1PFM A;  1RDP D;  1H9S B;  2B2V A;  1I4P A;  4H44 C;  1SNM A;  4K6L A;  2C5C A;  1AFP A;  3BDL A;  3SK8 A;  2L9H A;  1Q1E A;  3EFX D;  5JVH 3;  5LL6 X;  2Z8L A;  3D3R A;  4DA2 A;  3DUZ A;  2D5D A;  2B2V C;  2R93 B;  4CGY B;  1C8C A;  4MN3 A;  1ZEQ X;  3M4Y A;  3D4R A;  1HHV A;  1O7Z A;  2TSS A;  2JA6 B;  4QCL A;  2BDN A;  3FPU B;  3S2D B;  2EY5 A;  4R8N A;  2AQ3 B;  4LMQ D;  3DWQ A;  1BCP C;  3OW7 A;  3KLR A;  1PLF A;  4Y7N B;  2KJX A;  2RA4 A;  2R7Z B;  3FMC A;  3PUY A;  2MHV A;  1BXT A;  2RBM A;  1YNN C;  2RDG A;  3G7L A;  3LNN A;  2OXP A;  5EJW A;  1Q8I A;  3NSW A;  4NMZ A;  3BYT B;  2PW7 A;  2WKC A;  1STA A;  3S2H B;  1WTX A;  4XQJ A;  4FYD A;  2ZXO A;  3HEJ A;  4X3U A;  4CJ2 C;  2CW0 C;  1HUM A;  1BNZ A;  2HQE A;  3OOC A;  2TMP A;  4DXG A;  5EQ0 A;  4F7X A;  3MFY A;  1MBY A;  4E6I A;  1ONL A;  5FLX L;  1K8M A;  1BF4 A;  2M2L A;  2WIN B;  4IAL A;  1IYU A;  2ID0 A;  3S1R B;  1I50 B;  2A68 D;  3Q0A A;  2NZ1 D;  1D1K A;  5JJZ A;  4A3B B;  1LTI D;  4DGZ A;  5M3M B;  4TSS A;  5KYL A;  1PFB A;  1HTL D;  3R3O A;  5KNB A;  2F0F A;  3ND8 A;  2IX0 A;  3I8Z A;  1BCP D;  3V05 A;  3MFG A;  2KA7 A;  2FFK B;  3IFD A;  4RHS A;  3TP6 A;  4O1N A;  2IT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...