2KJXA

Solution structure of the extracellular domain of jtb
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
65
structure length
65
Chain Sequence
GSGMKEFPCWLVEEFVVAEECSPCSNFRAKTTPECGPTGYVEKITCSSSKRNEFKSCRSALMEQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Jumping translocation breakpoint protein
publication title The structure of the extracellular domain of the jumping translocation breakpoint protein reveals a variation of the midkine fold.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 8
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.490 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2kjxA01
2KJXA
chains in the Genus database with same CATH superfamily
5AFWA 3MXPA 3I4LA 2F0SA 2Z8LA 3NTIA 2AHOB 5IGFA 1NMFA 2K1BA 4KLKA 4P72A 1PRTC 4J6HA 3Q6SA 3A54A 2EY2A 1EY8A 5CV7A 2KOLA 2V1CC 1EQVA 3H6MA 3KBGA 3VR4A 4IJLA 1VMPA 1D1KA 4OELB 1NTGA 2RHSB 3DWPA 3GV6A 1G2SA 4DK0A 4DR7Q 3HOWG 2PCFB 1Q7YC 2Z6KA 1E24A 3E3XA 4QCLA 3GD7A 2JA8G 1PTOC 4ME5A 4A3LG 3OWEB 4DR4Q 1F77A 1TWFH 2QCPX 1R9TH 4DXFA 2VW9A 1EYGA 2K50A 1SE2A 4DK3C 3ULLA 3MVVA 5FO7B 1VQ8A 1PLFA 2ZXRA 2VNUD 1CKNB 4IOAA 1HNWQ 3MXGA 3NBIA 4PMBA 2BCOA 3TQYA 3MTSA 1NY4A 1U9RA 1TWAH 3MAQA 5GROA 3PO3B 1DXMA 2Q2UA 5FKAC 2NZHA 4RWSC 3JAMi 3FKIH 4G7HC 1XJVA 1X3QA 1CA6A 4KMUC 4X3SA 4A3MG 2KVMA 1RKNA 2B2TA 1YZ6A 4DAMA 3GTGH 4A3GG 1HA6A 3NSWA 4PNYA 2F0GA 1H9JA 3H3VH 1EOVA 5D3IB 5LL6S 2ZTCA 1VQ6A 3ERQA 3PMFA 5C44B 1DONA 2F0QA 1SE4A 1XPUA 2VB3X 2OTJA 3KF6B 1S40A 2KHJA 1B7YB 4ABNA 1HZAA 2N55A 3T56B 1SYBA 2GN5A 1C7YA 2NZ1D 3NK9A 2EY1A 4MTNA 2F0EA 2F3WA 1Y1VG 5JVH3 4X66L 1SNCA 1DGSA 3MWYW 1TS3A 1LTRD 2PZWA 4XT3B 5M5XB 3A55A 2IHEA 2O2LD 2ZXOA 1XMOL 4GNXC 2PW5A 2LMCB 5BN4A 2IW3A 2IJ0A 1KNEA 4ODGA 4QQBX 1D6EC 2G9HD 4EQOA 3T1YL 2BE5D 4K2KA 1EUJA 2R92B 2OT2A 1YHAA 2KBNA 2D62A 1AZPA 1FJGL 2QILA 2Q2TA 3F2BA 4ZQ3A 3SEBA 2V4DA 2JA9A 3H3VI 1SNMA 3CKIB 1Y69U 1SRUA 5BN5A 2XVSA 4JI5Q 4K0KQ 4WJ3M 4HCEA 1CFMA 5FOBB 5I6YA 1I6HH 1D1IA 2K6AA 1CI3M 1ONLA 1DJRD 2JP1A 3W1BA 1CQFA 1PRTD 1K3BC 3H3VC 4ZLTF 4DXGA 3K5LA 4YCUA 1C9OA 2Q8TA 2C35B 4JI1Q 1C48A 2IL8A 4R4CA 4BWGB 1E1OA 3WDNA 2NBFA 4QMGA 1I50B 2EIFA 1TWGB 3LWUA 4V190 2R93B 4DV1L 1IHZA 3L2PA 2XIWA 1SAPA 3CQZH 1SFOH 4UPAA 4O0AA 1BCPF 2L1BA 4JBKA 1TS2A 2KCCA 3TZDA 5C4JH 4K5XA 1E0BA 3NUCA 2CQOA 2O5JC 1IBLL 2UXBQ 3KDFB 3HKZG 2B63H 4YY3Q 1PYSB 3K8AA 1TIID 1HR0Q 4A3IB 3ULJA 2CWAA 3NBHA 3F2DA 3S14B 4C3HB 1AZQA 2IWHA 1F9QA 2UXCL 4B3ML 2UUBL 3Q22A 3W5OA 1K8AC 3BYTB 3RZOH 2J0TD 1ASZA 1MIUA 5GAHC 4BBRG 4RHSA 3EA6A 4X64Q 3W3AA 3FPPA 2IPKD 1MJCA 5FLXL 1B9MA 4PMWA 5M3MB 2NN6G 2HDMA 3S1QH 1SN8A 1VQCA 2EYJA 4A3DB 1PH3A 5EKIA 2N78A 3PF5A 2B2UC 4QUFA 1L1OB 2TSSA 1B50A 1N36Q 4ZAIA 1KDBA 4X3KA 2KENA 2F0TA 5A35A 4Z9CB 4MTKA 2A69C 4FNFA 3GTPB 1VQNA 3DM3A 4IPGA 1ET6A 5CV9A 3BVMA 1GHKA 4EQNA 1UUPA 1Q82C 4BBSH 1TT2A 1NJIC 3DHQA 3ND8A 3HOYH 2WB1G 2KCNA 1EIHA 1JQYD 4DR3L 2HCIA 3G6EA 4EVOA 4A93H 2HD3A 2LY7A 4DAYA 2VB2X 2A68C 3I8ZA 5IT9c 4RH6A 3JAME 2F03A 4R1JA 2JJQA 2YTXA 1YVCA 4IPCA 2EOTA 1I94L 4LF4L 5CBAE 1TU2B 1TWCB 1V8QA 3E6ZX 3J7ZC 2A8VA 4EQ5A 3B6YA 4A3JH 4RMFA 2RBMA 2ZJRA 2VQEL 2R7ZG 2N88A 5LMNW 2ZJQA 2Q2HA 1N9WA 1SMYD 4JYAQ 4DUZQ 1FGUA 1F9RA 3OSOA 2B63G 2K5WA 2JA7B 1Q46A 4B08A 4IALA 4DF7A 2YTVA 5J3BA 2E5LQ 1PH9A 4JI2L 1GUNA 4GZYC 2JA6H 1UEBA 2EY6A 2KCTA 3HOUB 3D31A 3CPFA 1AH9A 4BY7B 1VMCA 3M7NA 3RLFA 2K5VA 1KNAA 2I0QA 2PPBC 1N34Q 4A3BH 4A3FB 4A3EH 5D3DA 2WAQG 4DAVA 3N52A 1A15A 1BVSA 1EU4A 3CCQA 3G4SA 2Y0SE 3TP6A 3KBXA 4NXMQ 2ICEC 1VQOA 1YJ9A 4L6TB 3C2PA 5CV4A 4LF9L 3S2HH 5D14A 5IYCH 4B3RQ 1YNXA 3CC7A 5CV6A 3HOYG 1KD1C 1PXUA 1YNJC 5CYUA 3DM1A 1ZYRC 1PFNA 3A56A 1PH6A 1VQFA 1X3FA 3OMCA 4H02A 2PO4A 2F4VQ 1B53A 4A4IA 1YNNC 3HOXH 1N32L 3D4DA 4IUVA 3TP5A 1N33L 4AYBE 2RA4A 4K2LA 1EU3A 1Z9FA 3RMHA 1SLJA 4GKKL 2QW7A 3FVQA 5M5WB 1JT8A 4LJZC 4EQPA 1CA5A 1O7LA 4A3JG 1QCBD 2L12A 2DGYA 1L0XB 4GN4B 3PUXA 3GTMH 1EL0A 1QNUA 1CK1A 4YHHQ 4KY5A 1Q1BA 5K36H 2R61A 2VL6A 1HTPA 4LFCL 1VQ7A 4DV7Q 5LMUL 2UU9L 1Z7TA 1TS4A 2DN8A 2ZM6Q 1JJGA 3RZDB 2F4IA 3H15A 3QR8A 2R7DA 4H7BA 3CPWA 2KJXA 5IP9H 1C8CA 1ILQA 1VQ9A 4JI3Q 3D4WA 1I6VC 4JI8Q 1WTOA 1XNRQ 1IKMA 4C3HG 1H9RA 1N8RC 2NVYB 3E9IA 4BY1H 1PRTF 1PH7A 3PV0A 3A7LA 4NMZA 5HY6A 5NUCA 1NSNS 5E4WC 1MGSA 4A3EG 1Q8IA 2K28A 5A2QE 1CM9A 2VZAA 5BR8Q 3KOJA 4JC0A 1H9MA 3T4AC 1UNSA 4FVMA 1AW7A 1O80A 5M3MG 3M4OB 2NVTB 5H1SE 2JE6I 2HHHL 4HR7B 4G7OC 3VDYA 4A3DG 3PO2B 4X62L 1TQOA 4UP8A 4IOCA 3EIVA 1V9PA 1I4GA 3EROA 1F9PA 5IYCG 5M3FH 3KYHC 2J7ZA 4DN4M 1BNZA 4RG1A 3L7ZC 3K80C 3TP7A 3M4PA 3I4MB 1B2TA 1EYAA 3HFZB 2A6HC 3MFGA 5L37A 2RDFA 4R8IA 1HR0W 1BXTA 4KJOA 1YJWA 3S17H 1O7ZA 1B8AA 3D6WA 2XN9C 1RF2D 1U5KA 4RAUC 1HFNA 1VQIA 1OXTA 5ELEA 4HSVA 1XXGA 1P16A 2EY5A 3KUPA 3HOXG 2XRQD 3NHHA 4L5RC 1JWUD 1QOHA 2K75A 1WYDA 3J7YW 4A3KH 1B1ZA 1AEXA 2PQEA 2Y0SB 3NBHB 1YIJA 4GN3B 3V05A 3SR1A 4KD4A 1KXLA 4F88A 4FXGC 3GTKH 4ALPA 4Y7NH 4DV2L 4WRDA 4CDEC 1ZYRD 1LT3D 1QUQA 2XNAC 2F0PA 1RIPA 3CCMA 3LWEA 4H0LC 3AYHB 4R9WA 2MO1A 1A3UA 4I7AA 3QJYA 2UUAQ 5M5YH 3J80E 2MJ8A 3VR2A 3D4RA 3S1NH 1JE5A 3HOZB 3VYTA 1JOKA 3K57A 4DV6L 3GTLB 2CWPA 2JSOA 4QB4A 2Z6KC 2FFKB 2VUMB 2JA5B 3S1RB 3BJUA 3O13A 5IP9G 2G9DA 2FINB 2XWJB 4NB3A 2PYKA 1RCVD 2L0CA 2JA7G 5T1IA 3BDLA 1PFSA 4K8JA 1Y1WB 3JC66 5FLMG 1EY5A 4BY1G 2EYPA 4X66Q 4HN7A 1V1OA 4RFBA 2BA1A 4NDXA 3HOUG 2CW0D 1L1OA 1XMOQ 5I4DA 1RODA 2K05A 4BY7G 4M1UB 4DUYQ 2XGTA 5C3EH 2JA8H 4OO1I 3IFDA 3T1YQ 3MC0B 4A3LH 1IW7D 4HMIA 3HRZC 4DAYB 2VS1A 4K5WA 1SDFA 4L5TA 2E2IH 4LF7L 5E4XA 1FJGQ 3CCVA 1Q90A 5M3FG 2B2TC 2SEBD 2F0LA 1PFMA 3TP8A 4L8JA 1KLGD 1UWVA 1Z6HA 2F3IA 4AQYL 1SYCA 2EYOA 2EXZA 1HFGA 1ZXTA 1YBYA 3E0EA 5JEAJ 1PMRA 1NR4A 1LTID 4F8MA 5FLXc 2B2YA 4MNOA 1TWHB 5JJIA 2N3SA 4A3MH 4JBMA 4IFDJ 1PTOH 2UUCL 3J7A5 2HQEA 3GP7A 4HSPA 4O1NA 3VR3A 3SK5A 1LYLA 3I90A 5CV5A 4DR2L 2NUCA 4DV1Q 4JI4L 1VF5C 2E8GA 1A8VA 3Q0AA 3A7AB 2JXMB 2B8FA 4OO1G 4UHVA 4J15A 1CHQD 3RLOA 3PUVA 4G4KA 2H4OA 2PI2A 1E22A 1YJNA 2HIVA 1WCMB 1LUZA 3QOJA 2ZXPA 4MZ9A 5J22A 1ET9A 4CJ0B 2FMCA 2F0KA 1Y1VH 1IBLQ 3LX0A 1LTLA 3FDTA 4PZ8A 1ENCA 4B3MQ 2E2HH 2UUBQ 3MEFA 4LNQA 4DV0Q 2CFMA 4HJAA 1PYBA 4I7ZC 1BDOA 3FHWA 2AKWB 1GUGA 1K8GA 5M9OA 3NENA 1FNVA 2DY8A 1I3QB 5CR3A 1CUKA 1LLRD 3D3RA 1SEBD 5ELOA 5C3EG 1G2TA 2AWNA 2IX0A 3GTOB 2EZVA 2L55A 1X3GA 1F2MA 5IOCA 4FF3A 1I6HB 1EY9A 1JE4A 3U9OA 5IYBG 4UAIA 3U4ZA 1S5BD 2OXPA 1ESRA 2KHIA 1Q81C 1HNZL 3AFQA 3OWFA 5CGKA 3K7AB 4DR3Q 3R2TA 4G7ZC 1L0WA 3M85A 5EKLA 3J80c 3M4YA 2CKZB 1D8LA 1FNWA 1YHQA 4LMQD 2Q8RE 3I4MG 1PVOA 4RCOA 3CCSA 1A3VA 1WTQA 3T1HL 3WOEA 1I94Q 1HUMA 4LF4Q 5FO8B 2E2JH 5IT9E 2K04A 3L3OC 1A6XA 4NPSA 3C46A 4OGQC 4YWMA 1IL8A 1WOCA 4OWXB 1AE2A 2VQEQ 1EY6A 3GTJB 4BA2I 5I2XA 1LTBD 2MO0A 4BBRH 2YU9H 4DV4L 1L2FA 1IBML 2RF4A 1QB5D 1EZ6A 3G7LA 2F0IA 1LM0A 1G6ZA 1GHJA 2NN6H 1E3PA 4LFBL 1T5XD 1K83B 1BQQT 4OHJA 1M1KC 2A74C 1EYCA 4JI2Q 1NE3A 2AMCB 3QO2A 4P74A 3SHLA 1CSQA 2VQFL 1UE5A 2A6ED 1S5FD 3I3CA 2K5HA 4JV5L 1NBWA 2A5HA 3BU2A 2VXWA 5ISRA 2JA5G 3CC2A 2M9VA 4AYBG 1Q8KA 2K14A 1Y1WG 2PI2E 4JI7L 3MEHA 4X3TA 4BBSB 1GJXA 3RN2A 1CHPD 4QIWE 2HUGA 5FJ8G 1NAPA 3J81E 4LK1C 1E7ZA 2Q2IA 2QGQA 3S15B 1JORA 2WINB 4C3IB 3SK8A 1S3OA 2NN6I 1HJPA 1PYWD 1EIYB 1HNXL 1SNPA 1QILA 2K03A 1DOMA 4Q5VA 3EBEA 5JVG3 1STHA 1PTOD 2E2DC 1QUQB 4KN4C 3CMEA 2R7ZH 3ITPA 5IWAL 2EYLA 4JOIA 3GQBA 4AH6A 5AJ3L 4R8NA 1HCZA 3T51B 3PSIA 3HKSA 1S5CD 2EJFC 1N32Q 1N33Q 3G71A 2AUJD 4QGUA 1KL9A 4GLAC 1K73C 4GKKQ 3PIO3 1OTCA 1UE7A 1G91A 1LACA 1I4XA 3IRBA 4JPBW 4XIGS 3N6RA 1LTAD 3KFUA 1B44D 2JA6B 4P73A 1Q3LA 3OPOA 4POFA 1BCPB 3OMGA 4LFCQ 2UU9Q 5LMUQ 5C44H 2L5TA 4ME3A 3VR5A 5JJKA 5C5MA 4O42A 2LS01 1LABA 4RGOS 5LMNL 1LO5D 1GUWA 1WCMG 1QZHA 1W3SA 3I55A 4ZYSA 5FO9B 2K01A 1KHIA 1EIFA 2Z4IA 2N8NA 5M5XH 2WP8J 1WI5A 3U4VA 1J5EL 3HS0C 4KHVA 3KK7A 2R7FA 4DU9A 4KV6A 5J39A 1VQGA 1NR2A 1EY7A 3I7FA 1CT1D 5JOBA 1C0AA 3NTHA 2RKSA 4L5SA 1GM5A 3PIOA 2HHHQ 3P7JA 3H0GB 4UY8C 4X62Q 4PZ6A 4TRDA 5IYDH 2ASBA 3IFTA 4WJ4A 1VF7A 1SE8A 3A74A 4A76A 3TS2A 1RDPD 3S16B 4KJNA 3C3LA 4FF4A 3TRZA 3MA2B 2G5DA 1XNQL 4ZUJA 4DR6Q 2E76C 2RCFA 3I4OA 4FXDA 4KKSA 4HMJA 4JW0A 1Q1EA 3X3NA 1TWGH 1U0LA 5IY0A 1YEZA 5CC4A 2WFWA 4C3JB 5C4XB 3S24A 4QIWB 1KTKA 3ULPA 3M3YB 1X55A 1JWMD 1EEFD 4LF8Q 2SNSA 3RR5A 3PO3G 4BS9A 5CMDA 4DV3L 4XXEA 1SBBB 1ZKOA 1I4RA 3HOVB 2UXDL 4N9TA 1T9HA 1LT6D 4IQZA 2RCNA 1WVLA 4A3IH 2K4KA 3Q23A 3S14H 3VR6A 3J80i 4C3HH 5ELNA 4LF6L 5C44G 1PDQA 2I07B 1GD7A 2AWOA 5ELCA 5C0XH 3EN2A 2YYZA 4DV6Q 5C5LA 1XTCD 3K5MA 4OIKA 3J81c 3EFXD 1WTRA 3PF4A 3ONAB 2Z0SA 1Z47A 2F0VA 5D65A 1YITA 2KQ3A 2K32A 4QL5A 1EIGA 2OWOA 2RVLA 1S72A 3K59A 5M3MH 3GTQB 4A3DH 5EBCA 4H44C 1JWSD 3HP3A 4OWTB 4LWCA 4IUQA 4XTCS 1VQHA 5IP7H 4RGMA 3NE5B 3K6OA 3GTPH 2XSCA 2R92G 1XMQL 1JOQA 3IAYA 5KYLA 4Y52H 2I46A 2Z1CA 4YCVA 5GAGC 4KD3A 2A69D 3NWSA 4X65L 3KLWA 3HEJA 1KAWA 5TSSA 5IYDG 4LF7Q 1FNUA 3S17B 1SXTA 4HJ9A 4B3SL 1E2ZA 3SK6A 1LT5D 1QVCA 4ULLA 1WTWA 4O2DA 4CDFC 5C0XI 1KRTA 4RA8A 2E74C 1ICFB 2YTYA 4AQYQ 2EQSA 3QOLA 5E7NA 5CORA 5KNBA 1SYDA 4LAAA 3K0YA 1QE6A 4NKLA 3A5UA 3S1MH 4CHTB 5JEAG 5EPKA 1TXYA 2EVBA 2R93G 3URYA 2A68D 1X56A 3L9AX 2NWGA 2KEEA 1K0SA 3IKJA 2B2VA 2CHBD 4YY3L 1BCPC 1TWCH 5JPNC 2UUCQ 1HZCA 5FLXE 2JEAI 3OTOL 4OXPA 4IFDG 1SYGA 4DR2Q 3BZDB 3DWQA 1GUSA 5JJLA 4Q0FA 4JI4Q 1L1OC 4B9XA 3F1ZA 4HJ7A 4N9PA 1QVGA 2EDGA 4NXNL 2M00A 5IGBA 5DAUA 2EJGC 1GOZA 4DR5L 4KHZA 4A3IG 5DNFA 2JA7H 2WV6D 4R4IA 4B3TL 1B3QA 5EGTA 5FLMH 1WFQA 1HTLD 1SMXA 2NB0A 4IUPA 5C0XG 5KNDA 1LTSD 1IYJB 3BDCA 4LF5L 3HOUH 2ZTEA 1S4ZA 5EJWA 4IUNA 5JPMC 4BY7H 5EKKA 3KF8A 2I5MX 3HOWB 3I70A 4V0BA 1SSOA 2NZOA 2TMPA 3A8KE 2F0FA 4ZKBB 5HURA 2B2YC 2JA8B 1A2UA 2I5HA 1PTOF 1OO9B 5IP7G 1EQTA 2FMMA 4POGA 3I91A 4AIMA 4FXKC 1F9SA 2QDLA 4FF2A 5I2YA 3CP0A 1PRTB 1AE3A 2O5IC 1O7YA 1HRJA 3K81C 1A63A 2CVRA 4PZ7A 1LTGD 2NVQH 3S2DH 3BZKA 3U58A 2RQXA 1W6KA 2EYMA 3VYRA 2N49A 4XT1B 1VQBA 1UE1A 1EYDA 1VQEA 4A3MB 1KIXA 3H0GG 2IX3A 4U673 1V1QA 2KA7A 3ERSX 1HNZQ 1PH4A 2F3VA 4A3GB 4IN3A 1YNJD 5IGDA 4DFAA 4CBVA 4OO1H 1U4PA 3I4NB 2JEBI 2B2WA 2EE1A 4TQUS 2NVXB 3CAMA 3SGIA 2IHFA 4DR1L 1ML0D 2ALYB 2R6GA 1K9MC 4PV1C 5KEEA 1VCIA 1YNND 2HQLA 1E1TA 4ZCKA 5M5WH 1TS5A 1J8IA 3T1HQ 1IZ6A 3AQQA 3CU7A 2WB1E 5EPJA 1KAAA 1GO3E 1STYA 1VQLA 1Y1VB 3TSSA 4QY7A 1B9NA 5GADC 4S3SA 4ZKCB 2F0HA 4C2MH 3CCEA 4K8IA 5C4XG 4WFN3 1I4HA 3RZDH 2LXJA 1HPCA 4QF4A 4YIJA 2QKIC 4LUOA 3CF5A 2L15A 4DV4Q 2EYHA 1IBMQ 3HOVG 2F0NA 3J7AV 3K5OA 4K6DA 4IZ8A 4OL7A 4FO2A 1D5ZC 4DV5L 1STGA 2LXKA 5C4HA 4LFBQ 1K8MA 4C1NI 1VDZA 2JYOA 2GVAA 5E1FA 4OEMB 4KHPL 2NVYH 1QVFA 4N8X1 2AQ1B 4A3FG 3STBC 3E0JA 2VQFQ 4C56C 5FK9C 2I5LX 4TVAB 5IYBH 1TWFB 1R9TB 4HCSA 1L0YB 2L11A 1RJTA 1HZBA 3M4OH 4HIMA 2NVTH 4JI7Q 1CTMA 2GVBA 3WWVA 4PQXA 4FYDA 4EX5A 3J81i 1BBWA 2XRSD 1TWAB 1JB3A 3FKIB 3TMEA 3HG9A 3I4MH 1E2WA 4F87A 4MN3A 1STEA 3DWAA 1HNXQ 3NEMA 3GTGB 2WAQE 4YCWA 4IPHA 2DJFC 2X69A 3HKZB 1WD0A 2A6HD 3CCJA 1M4VA 2J4XA 3R93A 5IWAQ 1D5XC 3UDXA 3TEHB 3PUYA 5IGEA 1DYQA 4BBRB 3BVGA 2IT1A 1JICA 4CDDC 5C6AA 3H91A 2UXCQ 2IY5B 1G291 2BE5C 4MIUA 3KLRA 3J81j 2DNCA 2EPBA 1K0RA 2ENBA 3ZYYX 3HOZH 1R4PB 1BUVT 4DGZA 2HDLA 1PA6A 1H9SA 2JA5H 1MJEA 3S1RH 1JMCA 1F2ZA 2VUMH 4GLVB 5KNCA 1PZKD 1K3RA 5BR8L 1FGBD 5LMNQ 1ASYA 1Y1WH 1SE3A 1A3TA 2PNRC 1Y8NB 3U50C 1W6JA 4BA1I 2WB1B 3Q8DA 1XWEA 4FDBA 5FJ8H 1EWCA 1ZEQX 4JOIC 1TKWB 4JI0L 3SE0A 1J5EQ 1C4QA 3I2ZA 3CRKC 3VA5A 5EBDA 5DLQE 4DKAC 1Y14B 3PO2G 1F2LA 2YV5A 1KDCA 3BDOA 1UE6A 1OXXK 3AB9A 3VYUA 5JJZA 2LFNA 4OX9L 4JI6L 3CQZB 1SFOB 1IYVA 3STBD 3CD6A 2R7ZB 3UE0A 5E3FA 5C4JB 3BVZA 3M4QA 4BXXG 2ID0A 5G3LD 2RDHA 3GDEA 1Q12A 2PQAB 1NUCA 5ELBA 2BOSA 3DLLA 1JB7A 2B63B 1AN8A 1TWHH 3SXHA 1XNQQ 4ID6A 1XPOA 3AEVA 3GO5A 3K58A 3JAML 2Y0SG 4GOPA 3RZOB 1EQRA 1EWHA 5LHY1 1LTTD 1A62A 3EVQA 2UUAL 1XTDA 3NELA 1EEID 2CQAA 4OIJA 4YWLA 1IBKL 3I4NG 3MXNB 4QUCA 1QJOA 2F1MA 4DV3Q 4APVA 2ICIA 1X6OA 1JCKB 3NWTA 2F0MA 3S1QB 2D0PA 3QWNA 3OYYA 5COYA 3NXWA 5C4ZA 1STBA 1WCMH 3KF8B 2UXDQ 2K5NA 4UDUC 1STNA 2D2CC 2H5XA 3HOZG 5I9OA 3A8IE 2MPMA 3U9SA 3DEOA 2SDFA 2WAQB 4LUVA 2CCZA 3A8JE 2FXQA 4LF6Q 3F2CA 2VUMG 3C1EA 1V1PA 5KIXA 2QEJC 2JK8A 2FHTA 4DUYL 1IYUA 1G8ZD 3VA7A 2KECA 3T53B 2MNAA 4CGYB 3BG3A 4M8AA 1ENFA 2HIXA 1SNOA 4HIDA 3HOYB 1I3QH 2L4NA 4A93B 4HJ5A 1RL2A 1HA5A 1HH2P 1XX8A 2R3ZA 5C3WA 1TR5A 4LF9Q 3GTOH 2RSNA 3RD4A 1XMQQ 3FPUB 4NP5A 3H94A 3I72A 3ND9A 1LT4D 3CCRA 3I73A 1X32A 5GAEC 2C9OA 2SNMA 1VQ5A 1SMYC 2WKCA 3R8BA 4X65Q 3G48A 1G6PA 1DOKA 4A3JB 2D5DA 4CJ1B 5I6WA 4B3SQ 1S5DD 5IE8A 3KJPA 5GQOA 3ICEA 3K7AH 2F0DA 4GKJL 4KY7A 3PO3H 1FYCA 1KLUD 1PH8A 4KKUA 2CH4A 2D0OA 3FKIG 3CC4A 4KN7C 2AQ2B 3M9BA 1BF4A 3V2TA 2XTIA 2SOBA 4RKLA 4LFAL 3UDGA 4JK1C 4C1NK 1FR3A 1SNDA 2AQ3B 1EFWA 4DNIA 3OTOQ 3WOFA 1AFPA 4CKBA 3AU7A 2BH2A 4IPDA 2Q8IB 2KCMA 4JVZA 3GTJH 4ZK9B 1KABA 4NW2A 1BBUA 3CHBD 1PHJA 4A3BB 4NXNQ 4DV0L 4A3EB 4CDCC 4DR5Q 5KYIA 1B70B 1T5EA 1YI2A 1WTVA 4B3TQ 3T13A 3CW2C 1K83H 2ZJPA 2F0UA 4KI0A 2M2LA 2Z6BA 4UP7A 4XDXA 4DR7L 1GXDC 1PFBA 1HHVA 3A0JA 2CH4W 4LF5Q 1CZGA 1PZJD 2R92H 1KDAA 1GKHA 3S2HB 3DEPA 4DR4L 3EJIA 1TY0A 4R4QA 2K52A 3QB3A 2MFIA 1ENAA 3BYYB 2OQKA 1I5FA 3F2UA 1JC7A 5IODA 2BH8A 1K8OA 2MP1A 4E6IA 4H13C 1NNXA 4OWWB 2B2VC 4XQJA 1ESFA 3K0XA 3OW7A 1I4PA 3W1GA 1HNWL 5A2QL 3UI2A 4GNXA 2MQHA 2F0JA 4RKBA 3HOXB 4HEDA 2PMZE 1RTNA 4KY6A 2QF7A 3S15H 4DK1A 3EQLC 3FP9A 3KLSX 4C3IH 4EGVA 5JEAH 1CSPA 3LGJA 1I50H 4ZRZA 3S1MB 2R93H 3DXJC 1EQQA 3GTMB 2BA0A 3QIAA 3RNUA 1EFID 2DUDA 4IFDH 2KUMA 3MZ5A 3PGZA 4L5QA 3TDQA 1NMGA 4DV2Q 2ZTDA 5ELFA 1MSHA 2DY7A 5C3XA 4YWKA 1GUTA 1S5ED 1KC8C 4DR1Q 1NCVA 3TZUA 1HXYD 5DM63 1D2BA 2IX1A 1R4QB 1H9SB 2JQOA 2QEXA 4FF1A 1D5MC 2F52A 4B9WA 4FP5D 4BY1B 1O7IA 1JJCB 1D7QA 1WD1A 3RLNA 1B4OA 2OEOA 4GN5A 3OIPA 3PIP3 3QG1A 4IUUA 4K5VA 2Z4HA 3E5SA 2HT1A 1EY0A 2MHVA 5ELDA 4F7XA 1B3AA 4K14A 3UDIA 3J80L 1X65A 1GUOA 1QWYA 2OCEA 5KRUA 4JI5L 4K0KL 3D0FA 1GVPA 4IFDI 4DV5Q 4HIOA 2F0WA 2D9UA 1W2BA 5T1GA 2WIIB 5M3FB 1KRSA 3K5NA 1X54A 1WJJA 2ZT9C 1RHPA 5G3LF 4KHPQ 1BR9A 3C1FA 4KK7A 2B2WC 4JI1L 3L0OA 3R2IA 3MXUA 4HAEA 1Y8OB 3RUZA 1PV4A 3PQIA 4BBSG 5DEHA 1CQVA 3PUWA 3PCOB 1EWIA 1RD9D 2NVQB 3S2DB 2B2UA 5K5PA 1RTOA 4J8QA 4DA2A 2EXDA 2P5ZX 1PH5A 1MHWC 4UP9A 4A93G 3BS1A 5I9PA 2B29A 3H0GH 4HTHA 4IJHA 3PUZA 4A3KB 1Y8PB 1MKHA 4C3IG 1BKBA 5CV8A 1FL0A 1MD2D 3GTKB 4P2CB 4Y7NB 1TVXA 4GOPB 3S16H 3OHXC 3PIPA 4RGNA 3V96A 2UXBL 4KKTA 3SVMA 1CKNA 4ILWA 1HR0L 4JCVE 1XYIA 1U4LA 4R4TA 1V43A 2PQAA 5M5YB 3NP8A 3X3MA 2B8GA 3S1NB 2O4XA 1VQKA 4C3JH 2DNEA 1BO0A 4KTAA 5C4XH 2A73B 2KHSA 4X64L 3M3YH 4C2MB 3J7AF 3GV3A 1MSGA 1VQMA 1VQJA 2PMZB 2WACA 4IO9A 2WKDA 3HOVH 3ZJYC 2CW0C 3MFYA 1V1PB 3MXNA 3HZXA 4MHEA 1N36L 4HIKA 3BZCA 5DM73 1JR0D 2L9HA 1PH2A 2ATWA 1HQRD 2JA6G 2PW7A 1CKOA 1IW7C 3KF6A 3W2DA 1OXUA 3CCUA 1WTXA 1WTPA 1VQDA 4JBJA 3F8TA 4GLXA 5C3EB 4A3FH 1J9OA 2RHQB 2F0OA 2VY3A 3HKZE 3DUZA 4A3BG 2E2IB 3H09A 1FD7D 1VS0A 1X3PA 1A2TA 1TY2A 3R3OA 3JAMc 3P1HA 3FRPB 1G51A 3GTQH 1QNKA 1PH1A 3S9WA 2K5DA 2OQ0A 4XQNA 4G57A 2Z9HA 3AFPA 3G6JB 4DK6C 1SR3A 4DNRB 3D6CA 1CKMA 4DNTB 3RN5A 2XWBB 1VQ4A 2B39A 4JI0Q 1UEAB 1QG7A 1U4MA 3KLSA 3TBIB 1OXSC 3ER0A 4OONA 1XPRA 4WORA 2BDOA 1PTOB 4DR6L 2QDBA 4DAPA 3P20A 4PG3A 3MHBA 2E75C 3Q24A 1DOLA 2FJ2A 1H9KA 3OOCA 5EPLA 3NTKA 3VYSA 3K7UC 4OX9Q 4JYAL 4CKEA 1SYEA 3SK4A 3I56A 1YHBA 3NQTA 4DUZL 4JI6Q 1A0IA 1I4QA 1SROA 4QJFA 1P8LA 1CZWA 1EZ8A 4U68A 4LUZA 3AMUA 2ES2A 4X6AH 4TKOB 4LF8L 1EY4A 5IIFA 3IL8A 3D8GA 1SYFA 3P75A 2E5LL 4XYOA 3TN2A 4C3JG 1M8AA 2B3GA 4DPGA 5CBEE 1IL2A 1PZID 1FVIA 1UAPA 2E2HB 4A3CH 1OXVA 1E2VA 5K36G 3OIQA 4N8FA 2OTLA 4RGTA 1MBYA 3KDFA 1HZ9A 1JOOA 1SNQA 1N34L 1MI2A 1BCPD 1IBKQ 1EOTA 5IT9L 1DD2A 3NQIA 5EAYA 2A19A 4XYQA 5LL6X 1ILPA 5HGTA 1IXRA 2MGSA 3T16A 2K33A 2K7VA 4TSSA 4AYBB 2AUKA 5BN3A 1JJ2A 3FEWX 5IGGA 4XQQA 1VQAA 4GS3A 4IUTA 3DMUA 3NPPA 4R4OA 4NXML 2PZTA 1WTHA 2PNHA 2MUYA 2OF1A 4JV5Q 1K28A 3FMCA 5IGCA 2BDNA 4K6LA 5HGQA 5KGUA 1QZGA 4B3RL 1BOSA 4GNXB 3HOWH 2NTSA 2DJGC 2EYFA 4PMCA 1KQSA 3CRLC 3PO2H 1J6QA 1H95A 3LNNA 2QA4A 3CCLA 1X3EA 1U4RA 3E9HA 2F4VL 4CJ2C 3UE1A 2RDGA 4GOPC 1LV9A 1X9NA 1SJHD 1DZ1A 5F2DA 1DCZA 1VQPA 1IKLA 3OW2A 1STAA 4ZUIA 4IURA 2GA4B 2EJMA 4BXXH 2NYZD 5EQ0A 1DM0B 1HQMC 2PZUA 1II3A 4RHRA 1ICWA 3UDFA 3TS0A 4CKCA 2E2JB 1O78A 3CXCA 1SJED 1BBXC 2A1AA 3J81L 3KJOA 2X6GA 4YHHL 1HUNA 4JG2A 4X3UA 2X6LA 3A5ZB 2K5QA 1AP0A 4DV7L 5AJ3Q 2ZM6L 3CMAA 3M7GA 4RCNA 4A3KG 4LW1A 4A3GH 1M90C 2LKVA 2YU9B 4GKJQ 2C5CA 1F2YA 3I4NH 2NVXH 4WJWA 4A75A 2RSOA 2LSSA 4J1MA 4JBWA 4P71A 3SDZA 3TREA 4I65A 4P75A 4JI3L 4JI8L 4A3CG 1XNRL 2A6EC 2H1EA 2NTTA 1Q86C 2KEDA 5C0XJ 3GTLH 4LFAQ 3HGBA 2HCCA 2JN4A 5JAVA 4L63B 4HJ8A 5J1ZA
chains in the Genus database with same CATH topology
5AFWA 3MXPA 3I4LA 2F0SA 2Z8LA 3NTIA 5IGFA 2K1BA 1PRTC 4J6HA 3Q6SA 3A54A 2EY2A 1EY8A 5CV7A 2KOLA 3KBGA 1EQVA 3H6MA 3VR4A 1VMPA 1D1KA 3DWPA 3GV6A 1G2SA 4DK0A 2PCFB 4QCLA 3GD7A 1PTOC 4ME5A 3OWEB 1F77A 2QCPX 4DXFA 1SE2A 3MVVA 5FO7B 1PLFA 2ZXRA 2VNUD 3MXGA 3NBIA 4PMBA 2BCOA 3MTSA 1U9RA 3MAQA 3PO3B 1DXMA 5FKAC 4RWSC 4G7HC 1X3QA 1CA6A 4KMUC 4X3SA 2KVMA 1RKNA 2B2TA 1HA6A 3NSWA 4PNYA 2F0GA 1H9JA 5D3IB 5LL6S 3ERQA 3PMFA 5C44B 1DONA 2F0QA 1SE4A 2VB3X 4ABNA 3T56B 2N55A 1SYBA 2NZ1D 3NK9A 2EY1A 2F0EA 2F3WA 5JVH3 1SNCA 3MWYW 1TS3A 1LTRD 2PZWA 4XT3B 5M5XB 3A55A 2O2LD 2ZXOA 2PW5A 2LMCB 5BN4A 2IW3A 2IJ0A 1KNEA 4ODGA 1D6EC 2G9HD 4EQOA 2BE5D 4K2KA 2R92B 2OT2A 2D62A 1AZPA 2QILA 4ZQ3A 3SEBA 2V4DA 1SNMA 3CKIB 1Y69U 5BN5A 2XVSA 4HCEA 1CFMA 5FOBB 5I6YA 1D1IA 2K6AA 1CI3M 1ONLA 1DJRD 2JP1A 1CQFA 1PRTD 3H3VC 4ZLTF 4DXGA 3K5LA 2Q8TA 1C48A 2IL8A 4BWGB 3WDNA 2NBFA 4QMGA 1I50B 4V190 1TWGB 3LWUA 2R93B 1IHZA 2XIWA 1SAPA 1BCPF 2L1BA 1TS2A 2KCCA 3TZDA 4K5XA 1E0BA 3NUCA 2O5JC 1TIID 4A3IB 3NBHA 3S14B 4C3HB 1AZQA 2IWHA 1F9QA 3Q22A 3BYTB 2J0TD 4RHSA 3EA6A 3W3AA 3FPPA 2IPKD 5FLXL 1B9MA 4PMWA 5M3MB 2NN6G 2HDMA 4A3DB 2EYJA 5EKIA 2B2UC 4QUFA 2TSSA 1B50A 4ZAIA 1KDBA 4X3KA 2F0TA 5A35A 4Z9CB 2A69C 4FNFA 3GTPB 1ET6A 5CV9A 3BVMA 1GHKA 4EQNA 1UUPA 1TT2A 3DHQA 3ND8A 2KCNA 1EIHA 1JQYD 2HCIA 4EVOA 2LY7A 4DAYA 2VB2X 2A68C 3I8ZA 4RH6A 3JAME 2F03A 2EOTA 5CBAE 1TU2B 1TWCB 1V8QA 3E6ZX 2RBMA 2N88A 1SMYD 1F9RA 3OSOA 2K5WA 2JA7B 4B08A 4IALA 4DF7A 1GUNA 4GZYC 2EY6A 3HOUB 3D31A 4BY7B 1VMCA 3M7NA 3RLFA 1KNAA 2PPBC 4A3FB 5D3DA 4DAVA 3N52A 1A15A 1EU4A 3TP6A 3KBXA 2ICEC 4L6TB 3C2PA 5CV4A 5D14A 5CV6A 1PXUA 1YNJC 5CYUA 3DM1A 1ZYRC 1PFNA 3A56A 3OMCA 2PO4A 1B53A 1YNNC 3D4DA 4IUVA 3TP5A 2RA4A 4K2LA 1EU3A 3RMHA 3FVQA 5M5WB 4LJZC 4EQPA 1CA5A 1O7LA 1QCBD 2L12A 1L0XB 3PUXA 1EL0A 1QNUA 1CK1A 4KY5A 1Q1BA 5K36H 2R61A 1HTPA 1Z7TA 1TS4A 2DN8A 3RZDB 2F4IA 4H7BA 2KJXA 1C8CA 1ILQA 3D4WA 1I6VC 1WTOA 1IKMA 4C3HG 1H9RA 2NVYB 1PRTF 3PV0A 3A7LA 4NMZA 5NUCA 1NSNS 5E4WC 1MGSA 1Q8IA 2K28A 5A2QE 1CM9A 1H9MA 3T4AC 1UNSA 4FVMA 1AW7A 1O80A 3M4OB 2NVTB 4G7OC 2JE6I 4HR7B 3PO2B 1TQOA 1I4GA 3EROA 1F9PA 4DN4M 2J7ZA 1BNZA 3L7ZC 3TP7A 3I4MB 1B2TA 1EYAA 2A6HC 3MFGA 2RDFA 4R8IA 1BXTA 4KJOA 1O7ZA 3D6WA 2XN9C 1RF2D 4RAUC 1HFNA 1OXTA 5ELEA 4HSVA 1XXGA 2EY5A 3KUPA 2XRQD 3NHHA 1JWUD 1QOHA 3J7YW 1B1ZA 1AEXA 2PQEA 2Y0SB 3V05A 3SR1A 4KD4A 4F88A 4FXGC 4WRDA 1ZYRD 1LT3D 2XNAC 2F0PA 3LWEA 4H0LC 4R9WA 1A3UA 3QJYA 3J80E 2MJ8A 3VR2A 3D4RA 3HOZB 3VYTA 1JOKA 3K57A 3GTLB 2JSOA 4QB4A 2FFKB 2VUMB 2JA5B 3S1RB 3O13A 2G9DA 2FINB 2XWJB 2PYKA 1RCVD 2L0CA 5T1IA 3BDLA 4K8JA 1Y1WB 1EY5A 2EYPA 4HN7A 1V1OA 4RFBA 2BA1A 4NDXA 2CW0D 5I4DA 1RODA 2K05A 4M1UB 4OO1I 3IFDA 3MC0B 1IW7D 4HMIA 3HRZC 4K5WA 1SDFA 5E4XA 1Q90A 2B2TC 2SEBD 2F0LA 1PFMA 3TP8A 4L8JA 1KLGD 1Z6HA 1SYCA 2EYOA 2EXZA 1HFGA 1ZXTA 5JEAJ 1PMRA 1NR4A 1LTID 4F8MA 2B2YA 1TWHB 4IFDJ 1PTOH 2HQEA 3GP7A 4HSPA 4O1NA 3VR3A 3SK5A 3I90A 5CV5A 2NUCA 1VF5C 3Q0AA 3A7AB 2JXMB 2B8FA 4OO1G 1CHQD 3PUVA 4G4KA 2H4OA 1WCMB 3QOJA 2ZXPA 5J22A 1ET9A 4CJ0B 2FMCA 2F0KA 3LX0A 3FDTA 1ENCA 4I7ZC 1BDOA 1GUGA 5M9OA 1FNVA 2DY8A 1I3QB 5CR3A 1LLRD 3D3RA 1SEBD 1G2TA 2AWNA 2IX0A 3GTOB 2EZVA 2L55A 1F2MA 5IOCA 4FF3A 1I6HB 1EY9A 1JE4A 3U9OA 4UAIA 1S5BD 2OXPA 1ESRA 3OWFA 5CGKA 3K7AB 3R2TA 4G7ZC 3M85A 5EKLA 3M4YA 1FNWA 4LMQD 2Q8RE 4RCOA 1A3VA 1WTQA 3WOEA 1HUMA 5FO8B 5IT9E 2K04A 3L3OC 1A6XA 3C46A 4OGQC 1IL8A 1EY6A 3GTJB 4BA2I 5I2XA 1LTBD 1QB5D 1EZ6A 3G7LA 2F0IA 1G6ZA 1GHJA 2NN6H 1T5XD 1K83B 1BQQT 4OHJA 2A74C 1EYCA 3QO2A 3SHLA 2A6ED 1S5FD 3I3CA 5ISRA 2A5HA 2VXWA 2M9VA 3MEHA 4X3TA 4BBSB 1GJXA 1CHPD 2HUGA 1NAPA 3J81E 4LK1C 3S15B 1JORA 2WINB 4C3IB 3SK8A 2NN6I 1PYWD 1SNPA 1QILA 2K03A 1DOMA 4Q5VA 5JVG3 1STHA 1PTOD 2E2DC 4KN4C 3ITPA 2EYLA 3GQBA 4R8NA 1HCZA 3T51B 1S5CD 2EJFC 2AUJD 3PIO3 1G91A 1LACA 1I4XA 4XIGS 3N6RA 1LTAD 1B44D 2JA6B 1Q3LA 3OPOA 1BCPB 3OMGA 2L5TA 3VR5A 5C5MA 4O42A 2LS01 1LABA 4RGOS 1LO5D 1GUWA 4ZYSA 5FO9B 2K01A 2Z4IA 2WP8J 3HS0C 4KHVA 3KK7A 4DU9A 4KV6A 5J39A 1NR2A 1EY7A 1CT1D 5JOBA 3NTHA 2RKSA 3P7JA 3H0GB 4TRDA 3IFTA 1VF7A 1RDPD 3S16B 4KJNA 3C3LA 4FF4A 3MA2B 4ZUJA 2E76C 4FXDA 4KKSA 4HMJA 1Q1EA 3X3NA 5CC4A 4C3JB 5C4XB 4QIWB 1KTKA 3M3YB 1JWMD 1EEFD 2SNSA 4BS9A 5CMDA 4XXEA 1SBBB 1ZKOA 1I4RA 3HOVB 4N9TA 1LT6D 4IQZA 1WVLA 3Q23A 3VR6A 1PDQA 2I07B 2AWOA 5ELCA 5C0XH 2YYZA 5C5LA 1XTCD 3K5MA 4OIKA 3EFXD 1WTRA 3ONAB 1Z47A 2F0VA 5D65A 2KQ3A 2K32A 1EIGA 2RVLA 3K59A 3GTQB 5EBCA 4H44C 1JWSD 3HP3A 4IUQA 4XTCS 4RGMA 3NE5B 3K6OA 2XSCA 1JOQA 3IAYA 5KYLA 2I46A 2Z1CA 4KD3A 2A69D 3NWSA 3HEJA 5TSSA 1FNUA 3S17B 1SXTA 1E2ZA 3SK6A 1LT5D 4ULLA 1WTWA 5C0XI 4RA8A 2E74C 3QOLA 5CORA 5KNBA 1SYDA 4LAAA 3K0YA 1QE6A 4NKLA 4CHTB 5JEAG 5EPKA 2EVBA 3URYA 2A68D 3L9AX 2NWGA 2KEEA 3IKJA 2B2VA 2CHBD 1BCPC 5JPNC 5FLXE 2JEAI 4IFDG 1SYGA 3BZDB 3DWQA 1GUSA 4Q0FA 4B9XA 4N9PA 2EDGA 2M00A 5IGBA 5DAUA 2EJGC 1GOZA 4KHZA 5DNFA 2WV6D 5EGTA 1HTLD 2NB0A 4IUPA 5C0XG 5KNDA 1LTSD 3BDCA 1S4ZA 5EJWA 4IUNA 5JPMC 5EKKA 3KF8A 3HOWB 3I70A 4V0BA 1SSOA 2TMPA 3A8KE 2F0FA 4ZKBB 5HURA 2B2YC 2JA8B 1A2UA 1PTOF 1OO9B 1EQTA 2FMMA 3I91A 4FXKC 1F9SA 4FF2A 5I2YA 1PRTB 2O5IC 1O7YA 1HRJA 2CVRA 1LTGD 2RQXA 1W6KA 2EYMA 3VYRA 4XT1B 1EYDA 4A3MB 2IX3A 4U673 2KA7A 4A3GB 2F3VA 4IN3A 1YNJD 5IGDA 4DFAA 4CBVA 4OO1H 1U4PA 3I4NB 2JEBI 2B2WA 2EE1A 4TQUS 2NVXB 1ML0D 2R6GA 4PV1C 5KEEA 1VCIA 1YNND 1TS5A 1J8IA 3CU7A 5EPJA 1KAAA 1STYA 1Y1VB 3TSSA 1B9NA 4S3SA 4ZKCB 2F0HA 4K8IA 4WFN3 1I4HA 1HPCA 4QF4A 4YIJA 2QKIC 2EYHA 2F0NA 3J7AV 3K5OA 4K6DA 4IZ8A 4OL7A 4FO2A 1D5ZC 1STGA 5C4HA 1K8MA 4C1NI 1VDZA 2JYOA 5E1FA 2AQ1B 3E0JA 4C56C 5FK9C 1TWFB 1R9TB 4HCSA 1L0YB 2L11A 1RJTA 1CTMA 4PQXA 4FYDA 2XRSD 1TWAB 1JB3A 3FKIB 3TMEA 3HG9A 1E2WA 4F87A 4MN3A 1STEA 3DWAA 3GTGB 2X69A 3HKZB 1WD0A 2A6HD 1M4VA 2J4XA 3R93A 1D5XC 3PUYA 5IGEA 1DYQA 4BBRB 3BVGA 2IT1A 1JICA 5C6AA 3H91A 1G291 2BE5C 4MIUA 3KLRA 2DNCA 2EPBA 2ENBA 3ZYYX 1R4PB 1BUVT 4DGZA 2HDLA 1H9SA 1F2ZA 5KNCA 1PZKD 1FGBD 1SE3A 1A3TA 2PNRC 1Y8NB 4BA1I 1W6JA 2WB1B 1XWEA 1EWCA 1ZEQX 1TKWB 3SE0A 1C4QA 3CRKC 3VA5A 5EBDA 1F2LA 1KDCA 3BDOA 1OXXK 3AB9A 3VYUA 5JJZA 2LFNA 3CQZB 1SFOB 1IYVA 2R7ZB 5E3FA 5C4JB 3BVZA 2ID0A 5G3LD 2RDHA 1Q12A 1NUCA 5ELBA 2BOSA 2B63B 1AN8A 3SXHA 4ID6A 3GO5A 3K58A 3JAML 3RZOB 1EWHA 5LHY1 1LTTD 3EVQA 4OIJA 1EEID 2CQAA 4QUCA 1QJOA 2F1MA 2ICIA 1JCKB 3NWTA 2F0MA 3S1QB 3QWNA 5COYA 3NXWA 5C4ZA 1STBA 4UDUC 1STNA 2D2CC 5I9OA 3U9SA 3A8IE 2MPMA 3DEOA 2SDFA 2WAQB 3A8JE 3C1EA 1V1PA 5KIXA 2QEJC 2FHTA 1IYUA 1G8ZD 3VA7A 2KECA 3T53B 4CGYB 3BG3A 4M8AA 1ENFA 3HOYB 1SNOA 2L4NA 4A93B 1HA5A 1XX8A 2R3ZA 5C3WA 1TR5A 2RSNA 3RD4A 3FPUB 4NP5A 3H94A 3I72A 3ND9A 1LT4D 1X32A 3I73A 2C9OA 2SNMA 1SMYC 2WKCA 3R8BA 1DOKA 4A3JB 2D5DA 4CJ1B 5I6WA 1S5DD 2F0DA 4KY7A 1FYCA 1KLUD 4KKUA 4KN7C 2AQ2B 1BF4A 3V2TA 2SOBA 4RKLA 4JK1C 4C1NK 1FR3A 1SNDA 2AQ3B 1AFPA 3WOFA 4CKBA 3AU7A 2Q8IB 4ZK9B 1KABA 4NW2A 3CHBD 4A3BB 4A3EB 5KYIA 1WTVA 1T5EA 3T13A 2F0UA 4KI0A 2M2LA 4XDXA 1GXDC 1PFBA 1HHVA 1CZGA 1PZJD 1KDAA 3S2HB 3DEPA 3EJIA 1TY0A 3QB3A 1ENAA 3BYYB 3F2UA 1JC7A 5IODA 1K8OA 2MP1A 4E6IA 4H13C 2B2VC 4XQJA 1ESFA 3OW7A 1I4PA 5A2QL 3UI2A 2F0JA 4RKBA 3HOXB 4HEDA 1RTNA 4KY6A 2QF7A 4DK1A 3EQLC 3KLSX 4EGVA 5JEAH 4ZRZA 3S1MB 3DXJC 3GTMB 2BA0A 3QIAA 1EFID 4IFDH 2KUMA 3MZ5A 3TDQA 5ELFA 1MSHA 2DY7A 5C3XA 1GUTA 1S5ED 1NCVA 3TZUA 1HXYD 5DM63 1D2BA 2IX1A 1R4QB 1H9SB 4FF1A 1D5MC 4B9WA 4FP5D 4BY1B 1WD1A 1B4OA 2OEOA 3OIPA 3PIP3 3QG1A 4IUUA 4K5VA 2Z4HA 3E5SA 1EY0A 2MHVA 5ELDA 4F7XA 1B3AA 4K14A 3J80L 1GUOA 1QWYA 5KRUA 4IFDI 2F0WA 2D9UA 5T1GA 2WIIB 5M3FB 3K5NA 2ZT9C 1RHPA 5G3LF 1BR9A 3C1FA 4KK7A 2B2WC 3R2IA 3MXUA 4HAEA 1Y8OB 3RUZA 5DEHA 1CQVA 3PUWA 1RD9D 2NVQB 3S2DB 2B2UA 5K5PA 1RTOA 4J8QA 4DA2A 3BS1A 5I9PA 4HTHA 3PUZA 4A3KB 1Y8PB 4C3IG 5CV8A 1MD2D 3GTKB 4P2CB 4Y7NB 1TVXA 3OHXC 4RGNA 3V96A 4KKTA 3SVMA 4ILWA 1XYIA 1U4LA 1V43A 5M5YB 3NP8A 3X3MA 2B8GA 3S1NB 2O4XA 2DNEA 1BO0A 4KTAA 2A73B 2KHSA 4C2MB 3J7AF 3GV3A 1MSGA 2WACA 2PMZB 2WKDA 2CW0C 3MFYA 1V1PB 3MXNA 3HZXA 4MHEA 5DM73 1JR0D 2L9HA 1HQRD 2PW7A 1IW7C 3W2DA 1OXUA 1WTXA 1WTPA 5C3EB 1J9OA 2F0OA 3DUZA 2E2IB 3H09A 1FD7D 1X3PA 1A2TA 1TY2A 3R3OA 3P1HA 3FRPB 1QNKA 3S9WA 2K5DA 4XQNA 4G57A 3G6JB 4DNRB 3D6CA 4DNTB 2XWBB 2B39A 1UEAB 1QG7A 1U4MA 3KLSA 3TBIB 1OXSC 4WORA 2BDOA 1PTOB 2QDBA 4DAPA 3P20A 3MHBA 2E75C 3Q24A 1DOLA 2FJ2A 1H9KA 3OOCA 5EPLA 3NTKA 3VYSA 4CKEA 1SYEA 3SK4A 3NQTA 1I4QA 1CZWA 1EZ8A 4U68A 3AMUA 4TKOB 1EY4A 5IIFA 3IL8A 3D8GA 1SYFA 3P75A 4XYOA 3TN2A 4C3JG 1M8AA 5CBEE 1PZID 1UAPA 2E2HB 1OXVA 1E2VA 5K36G 3OIQA 4RGTA 1MBYA 1JOOA 1SNQA 1MI2A 1BCPD 1EOTA 5IT9L 1DD2A 3NQIA 4XYQA 5LL6X 1ILPA 5HGTA 2MGSA 3T16A 2K33A 2K7VA 4TSSA 4AYBB 2AUKA 5BN3A 3FEWX 5IGGA 4XQQA 4IUTA 3DMUA 3NPPA 2PZTA 2MUYA 2OF1A 3FMCA 5IGCA 2BDNA 4K6LA 5KGUA 1BOSA 2NTSA 2EYFA 4PMCA 3CRLC 3LNNA 1U4RA 4CJ2C 2RDGA 1LV9A 1SJHD 1DZ1A 5F2DA 1DCZA 1IKLA 1STAA 4ZUIA 4IURA 2GA4B 2EJMA 2NYZD 5EQ0A 1DM0B 1HQMC 2PZUA 1II3A 4RHRA 1ICWA 4CKCA 2E2JB 1O78A 1SJED 1BBXC 3J81L 2X6GA 1HUNA 4X3UA 2X6LA 2K5QA 1AP0A 3M7GA 4RCNA 2LKVA 2YU9B 2C5CA 1F2YA 4WJWA 2RSOA 4J1MA 4JBWA 3SDZA 4I65A 2A6EC 2H1EA 2NTTA 2KEDA 5C0XJ 3HGBA 2HCCA 5JAVA 4L63B 5J1ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KJX A; 
#chains in the Genus database with same CATH topology
 5AFW A;  3MXP A;  3I4L A;  2F0S A;  2Z8L A;  3NTI A;  2AHO B;  5IGF A;  1NMF A;  2K1B A;  4KLK A;  4P72 A;  1PRT C;  4J6H A;  3Q6S A;  3A54 A;  2EY2 A;  1EY8 A;  5CV7 A;  2KOL A;  2V1C C;  1EQV A;  3H6M A;  3KBG A;  3VR4 A;  4IJL A;  1VMP A;  1D1K A;  4OEL B;  1NTG A;  2RHS B;  3DWP A;  3GV6 A;  1G2S A;  4DK0 A;  4DR7 Q;  3HOW G;  2PCF B;  1Q7Y C;  2Z6K A;  1E24 A;  3E3X A;  4QCL A;  3GD7 A;  2JA8 G;  1PTO C;  4ME5 A;  4A3L G;  3OWE B;  4DR4 Q;  1F77 A;  1TWF H;  2QCP X;  1R9T H;  4DXF A;  2VW9 A;  1EYG A;  2K50 A;  1SE2 A;  4DK3 C;  3ULL A;  3MVV A;  5FO7 B;  1VQ8 A;  1PLF A;  2ZXR A;  2VNU D;  1CKN B;  4IOA A;  1HNW Q;  3MXG A;  3NBI A;  4PMB A;  2BCO A;  3TQY A;  3MTS A;  1NY4 A;  1U9R A;  1TWA H;  3MAQ A;  5GRO A;  3PO3 B;  1DXM A;  2Q2U A;  5FKA C;  2NZH A;  4RWS C;  3JAM i;  3FKI H;  4G7H C;  1XJV A;  1X3Q A;  1CA6 A;  4KMU C;  4X3S A;  4A3M G;  2KVM A;  1RKN A;  2B2T A;  1YZ6 A;  4DAM A;  3GTG H;  4A3G G;  1HA6 A;  3NSW A;  4PNY A;  2F0G A;  1H9J A;  3H3V H;  1EOV A;  5D3I B;  5LL6 S;  2ZTC A;  1VQ6 A;  3ERQ A;  3PMF A;  5C44 B;  1DON A;  2F0Q A;  1SE4 A;  1XPU A;  2VB3 X;  2OTJ A;  3KF6 B;  1S40 A;  2KHJ A;  1B7Y B;  4ABN A;  1HZA A;  2N55 A;  3T56 B;  1SYB A;  2GN5 A;  1C7Y A;  2NZ1 D;  3NK9 A;  2EY1 A;  4MTN A;  2F0E A;  2F3W A;  1Y1V G;  5JVH 3;  4X66 L;  1SNC A;  1DGS A;  3MWY W;  1TS3 A;  1LTR D;  2PZW A;  4XT3 B;  5M5X B;  3A55 A;  2IHE A;  2O2L D;  2ZXO A;  1XMO L;  4GNX C;  2PW5 A;  2LMC B;  5BN4 A;  2IW3 A;  2IJ0 A;  1KNE A;  4ODG A;  4QQB X;  1D6E C;  2G9H D;  4EQO A;  3T1Y L;  2BE5 D;  4K2K A;  1EUJ A;  2R92 B;  2OT2 A;  1YHA A;  2KBN A;  2D62 A;  1AZP A;  1FJG L;  2QIL A;  2Q2T A;  3F2B A;  4ZQ3 A;  3SEB A;  2V4D A;  2JA9 A;  3H3V I;  1SNM A;  3CKI B;  1Y69 U;  1SRU A;  5BN5 A;  2XVS A;  4JI5 Q;  4K0K Q;  4WJ3 M;  4HCE A;  1CFM A;  5FOB B;  5I6Y A;  1I6H H;  1D1I A;  2K6A A;  1CI3 M;  1ONL A;  1DJR D;  2JP1 A;  3W1B A;  1CQF A;  1PRT D;  1K3B C;  3H3V C;  4ZLT F;  4DXG A;  3K5L A;  4YCU A;  1C9O A;  2Q8T A;  2C35 B;  4JI1 Q;  1C48 A;  2IL8 A;  4R4C A;  4BWG B;  1E1O A;  3WDN A;  2NBF A;  4QMG A;  1I50 B;  2EIF A;  1TWG B;  3LWU A;  4V19 0;  2R93 B;  4DV1 L;  1IHZ A;  3L2P A;  2XIW A;  1SAP A;  3CQZ H;  1SFO H;  4UPA A;  4O0A A;  1BCP F;  2L1B A;  4JBK A;  1TS2 A;  2KCC A;  3TZD A;  5C4J H;  4K5X A;  1E0B A;  3NUC A;  2CQO A;  2O5J C;  1IBL L;  2UXB Q;  3KDF B;  3HKZ G;  2B63 H;  4YY3 Q;  1PYS B;  3K8A A;  1TII D;  1HR0 Q;  4A3I B;  3ULJ A;  2CWA A;  3NBH A;  3F2D A;  3S14 B;  4C3H B;  1AZQ A;  2IWH A;  1F9Q A;  2UXC L;  4B3M L;  2UUB L;  3Q22 A;  3W5O A;  1K8A C;  3BYT B;  3RZO H;  2J0T D;  1ASZ A;  1MIU A;  5GAH C;  4BBR G;  4RHS A;  3EA6 A;  4X64 Q;  3W3A A;  3FPP A;  2IPK D;  1MJC A;  5FLX L;  1B9M A;  4PMW A;  5M3M B;  2NN6 G;  2HDM A;  3S1Q H;  1SN8 A;  1VQC A;  2EYJ A;  4A3D B;  1PH3 A;  5EKI A;  2N78 A;  3PF5 A;  2B2U C;  4QUF A;  1L1O B;  2TSS A;  1B50 A;  1N36 Q;  4ZAI A;  1KDB A;  4X3K A;  2KEN A;  2F0T A;  5A35 A;  4Z9C B;  4MTK A;  2A69 C;  4FNF A;  3GTP B;  1VQN A;  3DM3 A;  4IPG A;  1ET6 A;  5CV9 A;  3BVM A;  1GHK A;  4EQN A;  1UUP A;  1Q82 C;  4BBS H;  1TT2 A;  1NJI C;  3DHQ A;  3ND8 A;  3HOY H;  2WB1 G;  2KCN A;  1EIH A;  1JQY D;  4DR3 L;  2HCI A;  3G6E A;  4EVO A;  4A93 H;  2HD3 A;  2LY7 A;  4DAY A;  2VB2 X;  2A68 C;  3I8Z A;  5IT9 c;  4RH6 A;  3JAM E;  2F03 A;  4R1J A;  2JJQ A;  2YTX A;  1YVC A;  4IPC A;  2EOT A;  1I94 L;  4LF4 L;  5CBA E;  1TU2 B;  1TWC B;  1V8Q A;  3E6Z X;  3J7Z C;  2A8V A;  4EQ5 A;  3B6Y A;  4A3J H;  4RMF A;  2RBM A;  2ZJR A;  2VQE L;  2R7Z G;  2N88 A;  5LMN W;  2ZJQ A;  2Q2H A;  1N9W A;  1SMY D;  4JYA Q;  4DUZ Q;  1FGU A;  1F9R A;  3OSO A;  2B63 G;  2K5W A;  2JA7 B;  1Q46 A;  4B08 A;  4IAL A;  4DF7 A;  2YTV A;  5J3B A;  2E5L Q;  1PH9 A;  4JI2 L;  1GUN A;  4GZY C;  2JA6 H;  1UEB A;  2EY6 A;  2KCT A;  3HOU B;  3D31 A;  3CPF A;  1AH9 A;  4BY7 B;  1VMC A;  3M7N A;  3RLF A;  2K5V A;  1KNA A;  2I0Q A;  2PPB C;  1N34 Q;  4A3B H;  4A3F B;  4A3E H;  5D3D A;  2WAQ G;  4DAV A;  3N52 A;  1A15 A;  1BVS A;  1EU4 A;  3CCQ A;  3G4S A;  2Y0S E;  3TP6 A;  3KBX A;  4NXM Q;  2ICE C;  1VQO A;  1YJ9 A;  4L6T B;  3C2P A;  5CV4 A;  4LF9 L;  3S2H H;  5D14 A;  5IYC H;  4B3R Q;  1YNX A;  3CC7 A;  5CV6 A;  3HOY G;  1KD1 C;  1PXU A;  1YNJ C;  5CYU A;  3DM1 A;  1ZYR C;  1PFN A;  3A56 A;  1PH6 A;  1VQF A;  1X3F A;  3OMC A;  4H02 A;  2PO4 A;  2F4V Q;  1B53 A;  4A4I A;  1YNN C;  3HOX H;  1N32 L;  3D4D A;  4IUV A;  3TP5 A;  1N33 L;  4AYB E;  2RA4 A;  4K2L A;  1EU3 A;  1Z9F A;  3RMH A;  1SLJ A;  4GKK L;  2QW7 A;  3FVQ A;  5M5W B;  1JT8 A;  4LJZ C;  4EQP A;  1CA5 A;  1O7L A;  4A3J G;  1QCB D;  2L12 A;  2DGY A;  1L0X B;  4GN4 B;  3PUX A;  3GTM H;  1EL0 A;  1QNU A;  1CK1 A;  4YHH Q;  4KY5 A;  1Q1B A;  5K36 H;  2R61 A;  2VL6 A;  1HTP A;  4LFC L;  1VQ7 A;  4DV7 Q;  5LMU L;  2UU9 L;  1Z7T A;  1TS4 A;  2DN8 A;  2ZM6 Q;  1JJG A;  3RZD B;  2F4I A;  3H15 A;  3QR8 A;  2R7D A;  4H7B A;  3CPW A;  2KJX A;  5IP9 H;  1C8C A;  1ILQ A;  1VQ9 A;  4JI3 Q;  3D4W A;  1I6V C;  4JI8 Q;  1WTO A;  1XNR Q;  1IKM A;  4C3H G;  1H9R A;  1N8R C;  2NVY B;  3E9I A;  4BY1 H;  1PRT F;  1PH7 A;  3PV0 A;  3A7L A;  4NMZ A;  5HY6 A;  5NUC A;  1NSN S;  5E4W C;  1MGS A;  4A3E G;  1Q8I A;  2K28 A;  5A2Q E;  1CM9 A;  2VZA A;  5BR8 Q;  3KOJ A;  4JC0 A;  1H9M A;  3T4A C;  1UNS A;  4FVM A;  1AW7 A;  1O80 A;  5M3M G;  3M4O B;  2NVT B;  5H1S E;  2JE6 I;  2HHH L;  4HR7 B;  4G7O C;  3VDY A;  4A3D G;  3PO2 B;  4X62 L;  1TQO A;  4UP8 A;  4IOC A;  3EIV A;  1V9P A;  1I4G A;  3ERO A;  1F9P A;  5IYC G;  5M3F H;  3KYH C;  2J7Z A;  4DN4 M;  1BNZ A;  4RG1 A;  3L7Z C;  3K80 C;  3TP7 A;  3M4P A;  3I4M B;  1B2T A;  1EYA A;  3HFZ B;  2A6H C;  3MFG A;  5L37 A;  2RDF A;  4R8I A;  1HR0 W;  1BXT A;  4KJO A;  1YJW A;  3S17 H;  1O7Z A;  1B8A A;  3D6W A;  2XN9 C;  1RF2 D;  1U5K A;  4RAU C;  1HFN A;  1VQI A;  1OXT A;  5ELE A;  4HSV A;  1XXG A;  1P16 A;  2EY5 A;  3KUP A;  3HOX G;  2XRQ D;  3NHH A;  4L5R C;  1JWU D;  1QOH A;  2K75 A;  1WYD A;  3J7Y W;  4A3K H;  1B1Z A;  1AEX A;  2PQE A;  2Y0S B;  3NBH B;  1YIJ A;  4GN3 B;  3V05 A;  3SR1 A;  4KD4 A;  1KXL A;  4F88 A;  4FXG C;  3GTK H;  4ALP A;  4Y7N H;  4DV2 L;  4WRD A;  4CDE C;  1ZYR D;  1LT3 D;  1QUQ A;  2XNA C;  2F0P A;  1RIP A;  3CCM A;  3LWE A;  4H0L C;  3AYH B;  4R9W A;  2MO1 A;  1A3U A;  4I7A A;  3QJY A;  2UUA Q;  5M5Y H;  3J80 E;  2MJ8 A;  3VR2 A;  3D4R A;  3S1N H;  1JE5 A;  3HOZ B;  3VYT A;  1JOK A;  3K57 A;  4DV6 L;  3GTL B;  2CWP A;  2JSO A;  4QB4 A;  2Z6K C;  2FFK B;  2VUM B;  2JA5 B;  3S1R B;  3BJU A;  3O13 A;  5IP9 G;  2G9D A;  2FIN B;  2XWJ B;  4NB3 A;  2PYK A;  1RCV D;  2L0C A;  2JA7 G;  5T1I A;  3BDL A;  1PFS A;  4K8J A;  1Y1W B;  3JC6 6;  5FLM G;  1EY5 A;  4BY1 G;  2EYP A;  4X66 Q;  4HN7 A;  1V1O A;  4RFB A;  2BA1 A;  4NDX A;  3HOU G;  2CW0 D;  1L1O A;  1XMO Q;  5I4D A;  1ROD A;  2K05 A;  4BY7 G;  4M1U B;  4DUY Q;  2XGT A;  5C3E H;  2JA8 H;  4OO1 I;  3IFD A;  3T1Y Q;  3MC0 B;  4A3L H;  1IW7 D;  4HMI A;  3HRZ C;  4DAY B;  2VS1 A;  4K5W A;  1SDF A;  4L5T A;  2E2I H;  4LF7 L;  5E4X A;  1FJG Q;  3CCV A;  1Q90 A;  5M3F G;  2B2T C;  2SEB D;  2F0L A;  1PFM A;  3TP8 A;  4L8J A;  1KLG D;  1UWV A;  1Z6H A;  2F3I A;  4AQY L;  1SYC A;  2EYO A;  2EXZ A;  1HFG A;  1ZXT A;  1YBY A;  3E0E A;  5JEA J;  1PMR A;  1NR4 A;  1LTI D;  4F8M A;  5FLX c;  2B2Y A;  4MNO A;  1TWH B;  5JJI A;  2N3S A;  4A3M H;  4JBM A;  4IFD J;  1PTO H;  2UUC L;  3J7A 5;  2HQE A;  3GP7 A;  4HSP A;  4O1N A;  3VR3 A;  3SK5 A;  1LYL A;  3I90 A;  5CV5 A;  4DR2 L;  2NUC A;  4DV1 Q;  4JI4 L;  1VF5 C;  2E8G A;  1A8V A;  3Q0A A;  3A7A B;  2JXM B;  2B8F A;  4OO1 G;  4UHV A;  4J15 A;  1CHQ D;  3RLO A;  3PUV A;  4G4K A;  2H4O A;  2PI2 A;  1E22 A;  1YJN A;  2HIV A;  1WCM B;  1LUZ A;  3QOJ A;  2ZXP A;  4MZ9 A;  5J22 A;  1ET9 A;  4CJ0 B;  2FMC A;  2F0K A;  1Y1V H;  1IBL Q;  3LX0 A;  1LTL A;  3FDT A;  4PZ8 A;  1ENC A;  4B3M Q;  2E2H H;  2UUB Q;  3MEF A;  4LNQ A;  4DV0 Q;  2CFM A;  4HJA A;  1PYB A;  4I7Z C;  1BDO A;  3FHW A;  2AKW B;  1GUG A;  1K8G A;  5M9O A;  3NEN A;  1FNV A;  2DY8 A;  1I3Q B;  5CR3 A;  1CUK A;  1LLR D;  3D3R A;  1SEB D;  5ELO A;  5C3E G;  1G2T A;  2AWN A;  2IX0 A;  3GTO B;  2EZV A;  2L55 A;  1X3G A;  1F2M A;  5IOC A;  4FF3 A;  1I6H B;  1EY9 A;  1JE4 A;  3U9O A;  5IYB G;  4UAI A;  3U4Z A;  1S5B D;  2OXP A;  1ESR A;  2KHI A;  1Q81 C;  1HNZ L;  3AFQ A;  3OWF A;  5CGK A;  3K7A B;  4DR3 Q;  3R2T A;  4G7Z C;  1L0W A;  3M85 A;  5EKL A;  3J80 c;  3M4Y A;  2CKZ B;  1D8L A;  1FNW A;  1YHQ A;  4LMQ D;  2Q8R E;  3I4M G;  1PVO A;  4RCO A;  3CCS A;  1A3V A;  1WTQ A;  3T1H L;  3WOE A;  1I94 Q;  1HUM A;  4LF4 Q;  5FO8 B;  2E2J H;  5IT9 E;  2K04 A;  3L3O C;  1A6X A;  4NPS A;  3C46 A;  4OGQ C;  4YWM A;  1IL8 A;  1WOC A;  4OWX B;  1AE2 A;  2VQE Q;  1EY6 A;  3GTJ B;  4BA2 I;  5I2X A;  1LTB D;  2MO0 A;  4BBR H;  2YU9 H;  4DV4 L;  1L2F A;  1IBM L;  2RF4 A;  1QB5 D;  1EZ6 A;  3G7L A;  2F0I A;  1LM0 A;  1G6Z A;  1GHJ A;  2NN6 H;  1E3P A;  4LFB L;  1T5X D;  1K83 B;  1BQQ T;  4OHJ A;  1M1K C;  2A74 C;  1EYC A;  4JI2 Q;  1NE3 A;  2AMC B;  3QO2 A;  4P74 A;  3SHL A;  1CSQ A;  2VQF L;  1UE5 A;  2A6E D;  1S5F D;  3I3C A;  2K5H A;  4JV5 L;  1NBW A;  2A5H A;  3BU2 A;  2VXW A;  5ISR A;  2JA5 G;  3CC2 A;  2M9V A;  4AYB G;  1Q8K A;  2K14 A;  1Y1W G;  2PI2 E;  4JI7 L;  3MEH A;  4X3T A;  4BBS B;  1GJX A;  3RN2 A;  1CHP D;  4QIW E;  2HUG A;  5FJ8 G;  1NAP A;  3J81 E;  4LK1 C;  1E7Z A;  2Q2I A;  2QGQ A;  3S15 B;  1JOR A;  2WIN B;  4C3I B;  3SK8 A;  1S3O A;  2NN6 I;  1HJP A;  1PYW D;  1EIY B;  1HNX L;  1SNP A;  1QIL A;  2K03 A;  1DOM A;  4Q5V A;  3EBE A;  5JVG 3;  1STH A;  1PTO D;  2E2D C;  1QUQ B;  4KN4 C;  3CME A;  2R7Z H;  3ITP A;  5IWA L;  2EYL A;  4JOI A;  3GQB A;  4AH6 A;  5AJ3 L;  4R8N A;  1HCZ A;  3T51 B;  3PSI A;  3HKS A;  1S5C D;  2EJF C;  1N32 Q;  1N33 Q;  3G71 A;  2AUJ D;  4QGU A;  1KL9 A;  4GLA C;  1K73 C;  4GKK Q;  3PIO 3;  1OTC A;  1UE7 A;  1G91 A;  1LAC A;  1I4X A;  3IRB A;  4JPB W;  4XIG S;  3N6R A;  1LTA D;  3KFU A;  1B44 D;  2JA6 B;  4P73 A;  1Q3L A;  3OPO A;  4POF A;  1BCP B;  3OMG A;  4LFC Q;  2UU9 Q;  5LMU Q;  5C44 H;  2L5T A;  4ME3 A;  3VR5 A;  5JJK A;  5C5M A;  4O42 A;  2LS0 1;  1LAB A;  4RGO S;  5LMN L;  1LO5 D;  1GUW A;  1WCM G;  1QZH A;  1W3S A;  3I55 A;  4ZYS A;  5FO9 B;  2K01 A;  1KHI A;  1EIF A;  2Z4I A;  2N8N A;  5M5X H;  2WP8 J;  1WI5 A;  3U4V A;  1J5E L;  3HS0 C;  4KHV A;  3KK7 A;  2R7F A;  4DU9 A;  4KV6 A;  5J39 A;  1VQG A;  1NR2 A;  1EY7 A;  3I7F A;  1CT1 D;  5JOB A;  1C0A A;  3NTH A;  2RKS A;  4L5S A;  1GM5 A;  3PIO A;  2HHH Q;  3P7J A;  3H0G B;  4UY8 C;  4X62 Q;  4PZ6 A;  4TRD A;  5IYD H;  2ASB A;  3IFT A;  4WJ4 A;  1VF7 A;  1SE8 A;  3A74 A;  4A76 A;  3TS2 A;  1RDP D;  3S16 B;  4KJN A;  3C3L A;  4FF4 A;  3TRZ A;  3MA2 B;  2G5D A;  1XNQ L;  4ZUJ A;  4DR6 Q;  2E76 C;  2RCF A;  3I4O A;  4FXD A;  4KKS A;  4HMJ A;  4JW0 A;  1Q1E A;  3X3N A;  1TWG H;  1U0L A;  5IY0 A;  1YEZ A;  5CC4 A;  2WFW A;  4C3J B;  5C4X B;  3S24 A;  4QIW B;  1KTK A;  3ULP A;  3M3Y B;  1X55 A;  1JWM D;  1EEF D;  4LF8 Q;  2SNS A;  3RR5 A;  3PO3 G;  4BS9 A;  5CMD A;  4DV3 L;  4XXE A;  1SBB B;  1ZKO A;  1I4R A;  3HOV B;  2UXD L;  4N9T A;  1T9H A;  1LT6 D;  4IQZ A;  2RCN A;  1WVL A;  4A3I H;  2K4K A;  3Q23 A;  3S14 H;  3VR6 A;  3J80 i;  4C3H H;  5ELN A;  4LF6 L;  5C44 G;  1PDQ A;  2I07 B;  1GD7 A;  2AWO A;  5ELC A;  5C0X H;  3EN2 A;  2YYZ A;  4DV6 Q;  5C5L A;  1XTC D;  3K5M A;  4OIK A;  3J81 c;  3EFX D;  1WTR A;  3PF4 A;  3ONA B;  2Z0S A;  1Z47 A;  2F0V A;  5D65 A;  1YIT A;  2KQ3 A;  2K32 A;  4QL5 A;  1EIG A;  2OWO A;  2RVL A;  1S72 A;  3K59 A;  5M3M H;  3GTQ B;  4A3D H;  5EBC A;  4H44 C;  1JWS D;  3HP3 A;  4OWT B;  4LWC A;  4IUQ A;  4XTC S;  1VQH A;  5IP7 H;  4RGM A;  3NE5 B;  3K6O A;  3GTP H;  2XSC A;  2R92 G;  1XMQ L;  1JOQ A;  3IAY A;  5KYL A;  4Y52 H;  2I46 A;  2Z1C A;  4YCV A;  5GAG C;  4KD3 A;  2A69 D;  3NWS A;  4X65 L;  3KLW A;  3HEJ A;  1KAW A;  5TSS A;  5IYD G;  4LF7 Q;  1FNU A;  3S17 B;  1SXT A;  4HJ9 A;  4B3S L;  1E2Z A;  3SK6 A;  1LT5 D;  1QVC A;  4ULL A;  1WTW A;  4O2D A;  4CDF C;  5C0X I;  1KRT A;  4RA8 A;  2E74 C;  1ICF B;  2YTY A;  4AQY Q;  2EQS A;  3QOL A;  5E7N A;  5COR A;  5KNB A;  1SYD A;  4LAA A;  3K0Y A;  1QE6 A;  4NKL A;  3A5U A;  3S1M H;  4CHT B;  5JEA G;  5EPK A;  1TXY A;  2EVB A;  2R93 G;  3URY A;  2A68 D;  1X56 A;  3L9A X;  2NWG A;  2KEE A;  1K0S A;  3IKJ A;  2B2V A;  2CHB D;  4YY3 L;  1BCP C;  1TWC H;  5JPN C;  2UUC Q;  1HZC A;  5FLX E;  2JEA I;  3OTO L;  4OXP A;  4IFD G;  1SYG A;  4DR2 Q;  3BZD B;  3DWQ A;  1GUS A;  5JJL A;  4Q0F A;  4JI4 Q;  1L1O C;  4B9X A;  3F1Z A;  4HJ7 A;  4N9P A;  1QVG A;  2EDG A;  4NXN L;  2M00 A;  5IGB A;  5DAU A;  2EJG C;  1GOZ A;  4DR5 L;  4KHZ A;  4A3I G;  5DNF A;  2JA7 H;  2WV6 D;  4R4I A;  4B3T L;  1B3Q A;  5EGT A;  5FLM H;  1WFQ A;  1HTL D;  1SMX A;  2NB0 A;  4IUP A;  5C0X G;  5KND A;  1LTS D;  1IYJ B;  3BDC A;  4LF5 L;  3HOU H;  2ZTE A;  1S4Z A;  5EJW A;  4IUN A;  5JPM C;  4BY7 H;  5EKK A;  3KF8 A;  2I5M X;  3HOW B;  3I70 A;  4V0B A;  1SSO A;  2NZO A;  2TMP A;  3A8K E;  2F0F A;  4ZKB B;  5HUR A;  2B2Y C;  2JA8 B;  1A2U A;  2I5H A;  1PTO F;  1OO9 B;  5IP7 G;  1EQT A;  2FMM A;  4POG A;  3I91 A;  4AIM A;  4FXK C;  1F9S A;  2QDL A;  4FF2 A;  5I2Y A;  3CP0 A;  1PRT B;  1AE3 A;  2O5I C;  1O7Y A;  1HRJ A;  3K81 C;  1A63 A;  2CVR A;  4PZ7 A;  1LTG D;  2NVQ H;  3S2D H;  3BZK A;  3U58 A;  2RQX A;  1W6K A;  2EYM A;  3VYR A;  2N49 A;  4XT1 B;  1VQB A;  1UE1 A;  1EYD A;  1VQE A;  4A3M B;  1KIX A;  3H0G G;  2IX3 A;  4U67 3;  1V1Q A;  2KA7 A;  3ERS X;  1HNZ Q;  1PH4 A;  2F3V A;  4A3G B;  4IN3 A;  1YNJ D;  5IGD A;  4DFA A;  4CBV A;  4OO1 H;  1U4P A;  3I4N B;  2JEB I;  2B2W A;  2EE1 A;  4TQU S;  2NVX B;  3CAM A;  3SGI A;  2IHF A;  4DR1 L;  1ML0 D;  2ALY B;  2R6G A;  1K9M C;  4PV1 C;  5KEE A;  1VCI A;  1YNN D;  2HQL A;  1E1T A;  4ZCK A;  5M5W H;  1TS5 A;  1J8I A;  3T1H Q;  1IZ6 A;  3AQQ A;  3CU7 A;  2WB1 E;  5EPJ A;  1KAA A;  1GO3 E;  1STY A;  1VQL A;  1Y1V B;  3TSS A;  4QY7 A;  1B9N A;  5GAD C;  4S3S A;  4ZKC B;  2F0H A;  4C2M H;  3CCE A;  4K8I A;  5C4X G;  4WFN 3;  1I4H A;  3RZD H;  2LXJ A;  1HPC A;  4QF4 A;  4YIJ A;  2QKI C;  4LUO A;  3CF5 A;  2L15 A;  4DV4 Q;  2EYH A;  1IBM Q;  3HOV G;  2F0N A;  3J7A V;  3K5O A;  4K6D A;  4IZ8 A;  4OL7 A;  4FO2 A;  1D5Z C;  4DV5 L;  1STG A;  2LXK A;  5C4H A;  4LFB Q;  1K8M A;  4C1N I;  1VDZ A;  2JYO A;  2GVA A;  5E1F A;  4OEM B;  4KHP L;  2NVY H;  1QVF A;  4N8X 1;  2AQ1 B;  4A3F G;  3STB C;  3E0J A;  2VQF Q;  4C56 C;  5FK9 C;  2I5L X;  4TVA B;  5IYB H;  1TWF B;  1R9T B;  4HCS A;  1L0Y B;  2L11 A;  1RJT A;  1HZB A;  3M4O H;  4HIM A;  2NVT H;  4JI7 Q;  1CTM A;  2GVB A;  3WWV A;  4PQX A;  4FYD A;  4EX5 A;  3J81 i;  1BBW A;  2XRS D;  1TWA B;  1JB3 A;  3FKI B;  3TME A;  3HG9 A;  3I4M H;  1E2W A;  4F87 A;  4MN3 A;  1STE A;  3DWA A;  1HNX Q;  3NEM A;  3GTG B;  2WAQ E;  4YCW A;  4IPH A;  2DJF C;  2X69 A;  3HKZ B;  1WD0 A;  2A6H D;  3CCJ A;  1M4V A;  2J4X A;  3R93 A;  5IWA Q;  1D5X C;  3UDX A;  3TEH B;  3PUY A;  5IGE A;  1DYQ A;  4BBR B;  3BVG A;  2IT1 A;  1JIC A;  4CDD C;  5C6A A;  3H91 A;  2UXC Q;  2IY5 B;  1G29 1;  2BE5 C;  4MIU A;  3KLR A;  3J81 j;  2DNC A;  2EPB A;  1K0R A;  2ENB A;  3ZYY X;  3HOZ H;  1R4P B;  1BUV T;  4DGZ A;  2HDL A;  1PA6 A;  1H9S A;  2JA5 H;  1MJE A;  3S1R H;  1JMC A;  1F2Z A;  2VUM H;  4GLV B;  5KNC A;  1PZK D;  1K3R A;  5BR8 L;  1FGB D;  5LMN Q;  1ASY A;  1Y1W H;  1SE3 A;  1A3T A;  2PNR C;  1Y8N B;  3U50 C;  1W6J A;  4BA1 I;  2WB1 B;  3Q8D A;  1XWE A;  4FDB A;  5FJ8 H;  1EWC A;  1ZEQ X;  4JOI C;  1TKW B;  4JI0 L;  3SE0 A;  1J5E Q;  1C4Q A;  3I2Z A;  3CRK C;  3VA5 A;  5EBD A;  5DLQ E;  4DKA C;  1Y14 B;  3PO2 G;  1F2L A;  2YV5 A;  1KDC A;  3BDO A;  1UE6 A;  1OXX K;  3AB9 A;  3VYU A;  5JJZ A;  2LFN A;  4OX9 L;  4JI6 L;  3CQZ B;  1SFO B;  1IYV A;  3STB D;  3CD6 A;  2R7Z B;  3UE0 A;  5E3F A;  5C4J B;  3BVZ A;  3M4Q A;  4BXX G;  2ID0 A;  5G3L D;  2RDH A;  3GDE A;  1Q12 A;  2PQA B;  1NUC A;  5ELB A;  2BOS A;  3DLL A;  1JB7 A;  2B63 B;  1AN8 A;  1TWH H;  3SXH A;  1XNQ Q;  4ID6 A;  1XPO A;  3AEV A;  3GO5 A;  3K58 A;  3JAM L;  2Y0S G;  4GOP A;  3RZO B;  1EQR A;  1EWH A;  5LHY 1;  1LTT D;  1A62 A;  3EVQ A;  2UUA L;  1XTD A;  3NEL A;  1EEI D;  2CQA A;  4OIJ A;  4YWL A;  1IBK L;  3I4N G;  3MXN B;  4QUC A;  1QJO A;  2F1M A;  4DV3 Q;  4APV A;  2ICI A;  1X6O A;  1JCK B;  3NWT A;  2F0M A;  3S1Q B;  2D0P A;  3QWN A;  3OYY A;  5COY A;  3NXW A;  5C4Z A;  1STB A;  1WCM H;  3KF8 B;  2UXD Q;  2K5N A;  4UDU C;  1STN A;  2D2C C;  2H5X A;  3HOZ G;  5I9O A;  3A8I E;  2MPM A;  3U9S A;  3DEO A;  2SDF A;  2WAQ B;  4LUV A;  2CCZ A;  3A8J E;  2FXQ A;  4LF6 Q;  3F2C A;  2VUM G;  3C1E A;  1V1P A;  5KIX A;  2QEJ C;  2JK8 A;  2FHT A;  4DUY L;  1IYU A;  1G8Z D;  3VA7 A;  2KEC A;  3T53 B;  2MNA A;  4CGY B;  3BG3 A;  4M8A A;  1ENF A;  2HIX A;  1SNO A;  4HID A;  3HOY B;  1I3Q H;  2L4N A;  4A93 B;  4HJ5 A;  1RL2 A;  1HA5 A;  1HH2 P;  1XX8 A;  2R3Z A;  5C3W A;  1TR5 A;  4LF9 Q;  3GTO H;  2RSN A;  3RD4 A;  1XMQ Q;  3FPU B;  4NP5 A;  3H94 A;  3I72 A;  3ND9 A;  1LT4 D;  3CCR A;  3I73 A;  1X32 A;  5GAE C;  2C9O A;  2SNM A;  1VQ5 A;  1SMY C;  2WKC A;  3R8B A;  4X65 Q;  3G48 A;  1G6P A;  1DOK A;  4A3J B;  2D5D A;  4CJ1 B;  5I6W A;  4B3S Q;  1S5D D;  5IE8 A;  3KJP A;  5GQO A;  3ICE A;  3K7A H;  2F0D A;  4GKJ L;  4KY7 A;  3PO3 H;  1FYC A;  1KLU D;  1PH8 A;  4KKU A;  2CH4 A;  2D0O A;  3FKI G;  3CC4 A;  4KN7 C;  2AQ2 B;  3M9B A;  1BF4 A;  3V2T A;  2XTI A;  2SOB A;  4RKL A;  4LFA L;  3UDG A;  4JK1 C;  4C1N K;  1FR3 A;  1SND A;  2AQ3 B;  1EFW A;  4DNI A;  3OTO Q;  3WOF A;  1AFP A;  4CKB A;  3AU7 A;  2BH2 A;  4IPD A;  2Q8I B;  2KCM A;  4JVZ A;  3GTJ H;  4ZK9 B;  1KAB A;  4NW2 A;  1BBU A;  3CHB D;  1PHJ A;  4A3B B;  4NXN Q;  4DV0 L;  4A3E B;  4CDC C;  4DR5 Q;  5KYI A;  1B70 B;  1T5E A;  1YI2 A;  1WTV A;  4B3T Q;  3T13 A;  3CW2 C;  1K83 H;  2ZJP A;  2F0U A;  4KI0 A;  2M2L A;  2Z6B A;  4UP7 A;  4XDX A;  4DR7 L;  1GXD C;  1PFB A;  1HHV A;  3A0J A;  2CH4 W;  4LF5 Q;  1CZG A;  1PZJ D;  2R92 H;  1KDA A;  1GKH A;  3S2H B;  3DEP A;  4DR4 L;  3EJI A;  1TY0 A;  4R4Q A;  2K52 A;  3QB3 A;  2MFI A;  1ENA A;  3BYY B;  2OQK A;  1I5F A;  3F2U A;  1JC7 A;  5IOD A;  2BH8 A;  1K8O A;  2MP1 A;  4E6I A;  4H13 C;  1NNX A;  4OWW B;  2B2V C;  4XQJ A;  1ESF A;  3K0X A;  3OW7 A;  1I4P A;  3W1G A;  1HNW L;  5A2Q L;  3UI2 A;  4GNX A;  2MQH A;  2F0J A;  4RKB A;  3HOX B;  4HED A;  2PMZ E;  1RTN A;  4KY6 A;  2QF7 A;  3S15 H;  4DK1 A;  3EQL C;  3FP9 A;  3KLS X;  4C3I H;  4EGV A;  5JEA H;  1CSP A;  3LGJ A;  1I50 H;  4ZRZ A;  3S1M B;  2R93 H;  3DXJ C;  1EQQ A;  3GTM B;  2BA0 A;  3QIA A;  3RNU A;  1EFI D;  2DUD A;  4IFD H;  2KUM A;  3MZ5 A;  3PGZ A;  4L5Q A;  3TDQ A;  1NMG A;  4DV2 Q;  2ZTD A;  5ELF A;  1MSH A;  2DY7 A;  5C3X A;  4YWK A;  1GUT A;  1S5E D;  1KC8 C;  4DR1 Q;  1NCV A;  3TZU A;  1HXY D;  5DM6 3;  1D2B A;  2IX1 A;  1R4Q B;  1H9S B;  2JQO A;  2QEX A;  4FF1 A;  1D5M C;  2F52 A;  4B9W A;  4FP5 D;  4BY1 B;  1O7I A;  1JJC B;  1D7Q A;  1WD1 A;  3RLN A;  1B4O A;  2OEO A;  4GN5 A;  3OIP A;  3PIP 3;  3QG1 A;  4IUU A;  4K5V A;  2Z4H A;  3E5S A;  2HT1 A;  1EY0 A;  2MHV A;  5ELD A;  4F7X A;  1B3A A;  4K14 A;  3UDI A;  3J80 L;  1X65 A;  1GUO A;  1QWY A;  2OCE A;  5KRU A;  4JI5 L;  4K0K L;  3D0F A;  1GVP A;  4IFD I;  4DV5 Q;  4HIO A;  2F0W A;  2D9U A;  1W2B A;  5T1G A;  2WII B;  5M3F B;  1KRS A;  3K5N A;  1X54 A;  1WJJ A;  2ZT9 C;  1RHP A;  5G3L F;  4KHP Q;  1BR9 A;  3C1F A;  4KK7 A;  2B2W C;  4JI1 L;  3L0O A;  3R2I A;  3MXU A;  4HAE A;  1Y8O B;  3RUZ A;  1PV4 A;  3PQI A;  4BBS G;  5DEH A;  1CQV A;  3PUW A;  3PCO B;  1EWI A;  1RD9 D;  2NVQ B;  3S2D B;  2B2U A;  5K5P A;  1RTO A;  4J8Q A;  4DA2 A;  2EXD A;  2P5Z X;  1PH5 A;  1MHW C;  4UP9 A;  4A93 G;  3BS1 A;  5I9P A;  2B29 A;  3H0G H;  4HTH A;  4IJH A;  3PUZ A;  4A3K B;  1Y8P B;  1MKH A;  4C3I G;  1BKB A;  5CV8 A;  1FL0 A;  1MD2 D;  3GTK B;  4P2C B;  4Y7N B;  1TVX A;  4GOP B;  3S16 H;  3OHX C;  3PIP A;  4RGN A;  3V96 A;  2UXB L;  4KKT A;  3SVM A;  1CKN A;  4ILW A;  1HR0 L;  4JCV E;  1XYI A;  1U4L A;  4R4T A;  1V43 A;  2PQA A;  5M5Y B;  3NP8 A;  3X3M A;  2B8G A;  3S1N B;  2O4X A;  1VQK A;  4C3J H;  2DNE A;  1BO0 A;  4KTA A;  5C4X H;  2A73 B;  2KHS A;  4X64 L;  3M3Y H;  4C2M B;  3J7A F;  3GV3 A;  1MSG A;  1VQM A;  1VQJ A;  2PMZ B;  2WAC A;  4IO9 A;  2WKD A;  3HOV H;  3ZJY C;  2CW0 C;  3MFY A;  1V1P B;  3MXN A;  3HZX A;  4MHE A;  1N36 L;  4HIK A;  3BZC A;  5DM7 3;  1JR0 D;  2L9H A;  1PH2 A;  2ATW A;  1HQR D;  2JA6 G;  2PW7 A;  1CKO A;  1IW7 C;  3KF6 A;  3W2D A;  1OXU A;  3CCU A;  1WTX A;  1WTP A;  1VQD A;  4JBJ A;  3F8T A;  4GLX A;  5C3E B;  4A3F H;  1J9O A;  2RHQ B;  2F0O A;  2VY3 A;  3HKZ E;  3DUZ A;  4A3B G;  2E2I B;  3H09 A;  1FD7 D;  1VS0 A;  1X3P A;  1A2T A;  1TY2 A;  3R3O A;  3JAM c;  3P1H A;  3FRP B;  1G51 A;  3GTQ H;  1QNK A;  1PH1 A;  3S9W A;  2K5D A;  2OQ0 A;  4XQN A;  4G57 A;  2Z9H A;  3AFP A;  3G6J B;  4DK6 C;  1SR3 A;  4DNR B;  3D6C A;  1CKM A;  4DNT B;  3RN5 A;  2XWB B;  1VQ4 A;  2B39 A;  4JI0 Q;  1UEA B;  1QG7 A;  1U4M A;  3KLS A;  3TBI B;  1OXS C;  3ER0 A;  4OON A;  1XPR A;  4WOR A;  2BDO A;  1PTO B;  4DR6 L;  2QDB A;  4DAP A;  3P20 A;  4PG3 A;  3MHB A;  2E75 C;  3Q24 A;  1DOL A;  2FJ2 A;  1H9K A;  3OOC A;  5EPL A;  3NTK A;  3VYS A;  3K7U C;  4OX9 Q;  4JYA L;  4CKE A;  1SYE A;  3SK4 A;  3I56 A;  1YHB A;  3NQT A;  4DUZ L;  4JI6 Q;  1A0I A;  1I4Q A;  1SRO A;  4QJF A;  1P8L A;  1CZW A;  1EZ8 A;  4U68 A;  4LUZ A;  3AMU A;  2ES2 A;  4X6A H;  4TKO B;  4LF8 L;  1EY4 A;  5IIF A;  3IL8 A;  3D8G A;  1SYF A;  3P75 A;  2E5L L;  4XYO A;  3TN2 A;  4C3J G;  1M8A A;  2B3G A;  4DPG A;  5CBE E;  1IL2 A;  1PZI D;  1FVI A;  1UAP A;  2E2H B;  4A3C H;  1OXV A;  1E2V A;  5K36 G;  3OIQ A;  4N8F A;  2OTL A;  4RGT A;  1MBY A;  3KDF A;  1HZ9 A;  1JOO A;  1SNQ A;  1N34 L;  1MI2 A;  1BCP D;  1IBK Q;  1EOT A;  5IT9 L;  1DD2 A;  3NQI A;  5EAY A;  2A19 A;  4XYQ A;  5LL6 X;  1ILP A;  5HGT A;  1IXR A;  2MGS A;  3T16 A;  2K33 A;  2K7V A;  4TSS A;  4AYB B;  2AUK A;  5BN3 A;  1JJ2 A;  3FEW X;  5IGG A;  4XQQ A;  1VQA A;  4GS3 A;  4IUT A;  3DMU A;  3NPP A;  4R4O A;  4NXM L;  2PZT A;  1WTH A;  2PNH A;  2MUY A;  2OF1 A;  4JV5 Q;  1K28 A;  3FMC A;  5IGC A;  2BDN A;  4K6L A;  5HGQ A;  5KGU A;  1QZG A;  4B3R L;  1BOS A;  4GNX B;  3HOW H;  2NTS A;  2DJG C;  2EYF A;  4PMC A;  1KQS A;  3CRL C;  3PO2 H;  1J6Q A;  1H95 A;  3LNN A;  2QA4 A;  3CCL A;  1X3E A;  1U4R A;  3E9H A;  2F4V L;  4CJ2 C;  3UE1 A;  2RDG A;  4GOP C;  1LV9 A;  1X9N A;  1SJH D;  1DZ1 A;  5F2D A;  1DCZ A;  1VQP A;  1IKL A;  3OW2 A;  1STA A;  4ZUI A;  4IUR A;  2GA4 B;  2EJM A;  4BXX H;  2NYZ D;  5EQ0 A;  1DM0 B;  1HQM C;  2PZU A;  1II3 A;  4RHR A;  1ICW A;  3UDF A;  3TS0 A;  4CKC A;  2E2J B;  1O78 A;  3CXC A;  1SJE D;  1BBX C;  2A1A A;  3J81 L;  3KJO A;  2X6G A;  4YHH L;  1HUN A;  4JG2 A;  4X3U A;  2X6L A;  3A5Z B;  2K5Q A;  1AP0 A;  4DV7 L;  5AJ3 Q;  2ZM6 L;  3CMA A;  3M7G A;  4RCN A;  4A3K G;  4LW1 A;  4A3G H;  1M90 C;  2LKV A;  2YU9 B;  4GKJ Q;  2C5C A;  1F2Y A;  3I4N H;  2NVX H;  4WJW A;  4A75 A;  2RSO A;  2LSS A;  4J1M A;  4JBW A;  4P71 A;  3SDZ A;  3TRE A;  4I65 A;  4P75 A;  4JI3 L;  4JI8 L;  4A3C G;  1XNR L;  2A6E C;  2H1E A;  2NTT A;  1Q86 C;  2KED A;  5C0X J;  3GTL H;  4LFA Q;  3HGB A;  2HCC A;  2JN4 A;  5JAV A;  4L63 B;  4HJ8 A;  5J1Z A; 
#chains in the Genus database with same CATH homology
 5AFW A;  3MXP A;  3I4L A;  2F0S A;  2Z8L A;  3NTI A;  5IGF A;  2K1B A;  1PRT C;  4J6H A;  3Q6S A;  3A54 A;  2EY2 A;  1EY8 A;  5CV7 A;  2KOL A;  3KBG A;  1EQV A;  3H6M A;  3VR4 A;  1VMP A;  1D1K A;  3DWP A;  3GV6 A;  1G2S A;  4DK0 A;  2PCF B;  4QCL A;  3GD7 A;  1PTO C;  4ME5 A;  3OWE B;  1F77 A;  2QCP X;  4DXF A;  1SE2 A;  3MVV A;  5FO7 B;  1PLF A;  2ZXR A;  2VNU D;  3MXG A;  3NBI A;  4PMB A;  2BCO A;  3MTS A;  1U9R A;  3MAQ A;  3PO3 B;  1DXM A;  5FKA C;  4RWS C;  4G7H C;  1X3Q A;  1CA6 A;  4KMU C;  4X3S A;  2KVM A;  1RKN A;  2B2T A;  1HA6 A;  3NSW A;  4PNY A;  2F0G A;  1H9J A;  5D3I B;  5LL6 S;  3ERQ A;  3PMF A;  5C44 B;  1DON A;  2F0Q A;  1SE4 A;  2VB3 X;  4ABN A;  3T56 B;  2N55 A;  1SYB A;  2NZ1 D;  3NK9 A;  2EY1 A;  2F0E A;  2F3W A;  5JVH 3;  1SNC A;  3MWY W;  1TS3 A;  1LTR D;  2PZW A;  4XT3 B;  5M5X B;  3A55 A;  2O2L D;  2ZXO A;  2PW5 A;  2LMC B;  5BN4 A;  2IW3 A;  2IJ0 A;  1KNE A;  4ODG A;  1D6E C;  2G9H D;  4EQO A;  2BE5 D;  4K2K A;  2R92 B;  2OT2 A;  2D62 A;  1AZP A;  2QIL A;  4ZQ3 A;  3SEB A;  2V4D A;  1SNM A;  3CKI B;  1Y69 U;  5BN5 A;  2XVS A;  4HCE A;  1CFM A;  5FOB B;  5I6Y A;  1D1I A;  2K6A A;  1CI3 M;  1ONL A;  1DJR D;  2JP1 A;  1CQF A;  1PRT D;  3H3V C;  4ZLT F;  4DXG A;  3K5L A;  2Q8T A;  1C48 A;  2IL8 A;  4BWG B;  3WDN A;  2NBF A;  4QMG A;  1I50 B;  4V19 0;  1TWG B;  3LWU A;  2R93 B;  1IHZ A;  2XIW A;  1SAP A;  1BCP F;  2L1B A;  1TS2 A;  2KCC A;  3TZD A;  4K5X A;  1E0B A;  3NUC A;  2O5J C;  1TII D;  4A3I B;  3NBH A;  3S14 B;  4C3H B;  1AZQ A;  2IWH A;  1F9Q A;  3Q22 A;  3BYT B;  2J0T D;  4RHS A;  3EA6 A;  3W3A A;  3FPP A;  2IPK D;  5FLX L;  1B9M A;  4PMW A;  5M3M B;  2NN6 G;  2HDM A;  4A3D B;  2EYJ A;  5EKI A;  2B2U C;  4QUF A;  2TSS A;  1B50 A;  4ZAI A;  1KDB A;  4X3K A;  2F0T A;  5A35 A;  4Z9C B;  2A69 C;  4FNF A;  3GTP B;  1ET6 A;  5CV9 A;  3BVM A;  1GHK A;  4EQN A;  1UUP A;  1TT2 A;  3DHQ A;  3ND8 A;  2KCN A;  1EIH A;  1JQY D;  2HCI A;  4EVO A;  2LY7 A;  4DAY A;  2VB2 X;  2A68 C;  3I8Z A;  4RH6 A;  3JAM E;  2F03 A;  2EOT A;  5CBA E;  1TU2 B;  1TWC B;  1V8Q A;  3E6Z X;  2RBM A;  2N88 A;  1SMY D;  1F9R A;  3OSO A;  2K5W A;  2JA7 B;  4B08 A;  4IAL A;  4DF7 A;  1GUN A;  4GZY C;  2EY6 A;  3HOU B;  3D31 A;  4BY7 B;  1VMC A;  3M7N A;  3RLF A;  1KNA A;  2PPB C;  4A3F B;  5D3D A;  4DAV A;  3N52 A;  1A15 A;  1EU4 A;  3TP6 A;  3KBX A;  2ICE C;  4L6T B;  3C2P A;  5CV4 A;  5D14 A;  5CV6 A;  1PXU A;  1YNJ C;  5CYU A;  3DM1 A;  1ZYR C;  1PFN A;  3A56 A;  3OMC A;  2PO4 A;  1B53 A;  1YNN C;  3D4D A;  4IUV A;  3TP5 A;  2RA4 A;  4K2L A;  1EU3 A;  3RMH A;  3FVQ A;  5M5W B;  4LJZ C;  4EQP A;  1CA5 A;  1O7L A;  1QCB D;  2L12 A;  1L0X B;  3PUX A;  1EL0 A;  1QNU A;  1CK1 A;  4KY5 A;  1Q1B A;  5K36 H;  2R61 A;  1HTP A;  1Z7T A;  1TS4 A;  2DN8 A;  3RZD B;  2F4I A;  4H7B A;  2KJX A;  1C8C A;  1ILQ A;  3D4W A;  1I6V C;  1WTO A;  1IKM A;  4C3H G;  1H9R A;  2NVY B;  1PRT F;  3PV0 A;  3A7L A;  4NMZ A;  5NUC A;  1NSN S;  5E4W C;  1MGS A;  1Q8I A;  2K28 A;  5A2Q E;  1CM9 A;  1H9M A;  3T4A C;  1UNS A;  4FVM A;  1AW7 A;  1O80 A;  3M4O B;  2NVT B;  4G7O C;  2JE6 I;  4HR7 B;  3PO2 B;  1TQO A;  1I4G A;  3ERO A;  1F9P A;  4DN4 M;  2J7Z A;  1BNZ A;  3L7Z C;  3TP7 A;  3I4M B;  1B2T A;  1EYA A;  2A6H C;  3MFG A;  2RDF A;  4R8I A;  1BXT A;  4KJO A;  1O7Z A;  3D6W A;  2XN9 C;  1RF2 D;  4RAU C;  1HFN A;  1OXT A;  5ELE A;  4HSV A;  1XXG A;  2EY5 A;  3KUP A;  2XRQ D;  3NHH A;  1JWU D;  1QOH A;  3J7Y W;  1B1Z A;  1AEX A;  2PQE A;  2Y0S B;  3V05 A;  3SR1 A;  4KD4 A;  4F88 A;  4FXG C;  4WRD A;  1ZYR D;  1LT3 D;  2XNA C;  2F0P A;  3LWE A;  4H0L C;  4R9W A;  1A3U A;  3QJY A;  3J80 E;  2MJ8 A;  3VR2 A;  3D4R A;  3HOZ B;  3VYT A;  1JOK A;  3K57 A;  3GTL B;  2JSO A;  4QB4 A;  2FFK B;  2VUM B;  2JA5 B;  3S1R B;  3O13 A;  2G9D A;  2FIN B;  2XWJ B;  2PYK A;  1RCV D;  2L0C A;  5T1I A;  3BDL A;  4K8J A;  1Y1W B;  1EY5 A;  2EYP A;  4HN7 A;  1V1O A;  4RFB A;  2BA1 A;  4NDX A;  2CW0 D;  5I4D A;  1ROD A;  2K05 A;  4M1U B;  4OO1 I;  3IFD A;  3MC0 B;  1IW7 D;  4HMI A;  3HRZ C;  4K5W A;  1SDF A;  5E4X A;  1Q90 A;  2B2T C;  2SEB D;  2F0L A;  1PFM A;  3TP8 A;  4L8J A;  1KLG D;  1Z6H A;  1SYC A;  2EYO A;  2EXZ A;  1HFG A;  1ZXT A;  5JEA J;  1PMR A;  1NR4 A;  1LTI D;  4F8M A;  2B2Y A;  1TWH B;  4IFD J;  1PTO H;  2HQE A;  3GP7 A;  4HSP A;  4O1N A;  3VR3 A;  3SK5 A;  3I90 A;  5CV5 A;  2NUC A;  1VF5 C;  3Q0A A;  3A7A B;  2JXM B;  2B8F A;  4OO1 G;  1CHQ D;  3PUV A;  4G4K A;  2H4O A;  1WCM B;  3QOJ A;  2ZXP A;  5J22 A;  1ET9 A;  4CJ0 B;  2FMC A;  2F0K A;  3LX0 A;  3FDT A;  1ENC A;  4I7Z C;  1BDO A;  1GUG A;  5M9O A;  1FNV A;  2DY8 A;  1I3Q B;  5CR3 A;  1LLR D;  3D3R A;  1SEB D;  1G2T A;  2AWN A;  2IX0 A;  3GTO B;  2EZV A;  2L55 A;  1F2M A;  5IOC A;  4FF3 A;  1I6H B;  1EY9 A;  1JE4 A;  3U9O A;  4UAI A;  1S5B D;  2OXP A;  1ESR A;  3OWF A;  5CGK A;  3K7A B;  3R2T A;  4G7Z C;  3M85 A;  5EKL A;  3M4Y A;  1FNW A;  4LMQ D;  2Q8R E;  4RCO A;  1A3V A;  1WTQ A;  3WOE A;  1HUM A;  5FO8 B;  5IT9 E;  2K04 A;  3L3O C;  1A6X A;  3C46 A;  4OGQ C;  1IL8 A;  1EY6 A;  3GTJ B;  4BA2 I;  5I2X A;  1LTB D;  1QB5 D;  1EZ6 A;  3G7L A;  2F0I A;  1G6Z A;  1GHJ A;  2NN6 H;  1T5X D;  1K83 B;  1BQQ T;  4OHJ A;  2A74 C;  1EYC A;  3QO2 A;  3SHL A;  2A6E D;  1S5F D;  3I3C A;  5ISR A;  2A5H A;  2VXW A;  2M9V A;  3MEH A;  4X3T A;  4BBS B;  1GJX A;  1CHP D;  2HUG A;  1NAP A;  3J81 E;  4LK1 C;  3S15 B;  1JOR A;  2WIN B;  4C3I B;  3SK8 A;  2NN6 I;  1PYW D;  1SNP A;  1QIL A;  2K03 A;  1DOM A;  4Q5V A;  5JVG 3;  1STH A;  1PTO D;  2E2D C;  4KN4 C;  3ITP A;  2EYL A;  3GQB A;  4R8N A;  1HCZ A;  3T51 B;  1S5C D;  2EJF C;  2AUJ D;  3PIO 3;  1G91 A;  1LAC A;  1I4X A;  4XIG S;  3N6R A;  1LTA D;  1B44 D;  2JA6 B;  1Q3L A;  3OPO A;  1BCP B;  3OMG A;  2L5T A;  3VR5 A;  5C5M A;  4O42 A;  2LS0 1;  1LAB A;  4RGO S;  1LO5 D;  1GUW A;  4ZYS A;  5FO9 B;  2K01 A;  2Z4I A;  2WP8 J;  3HS0 C;  4KHV A;  3KK7 A;  4DU9 A;  4KV6 A;  5J39 A;  1NR2 A;  1EY7 A;  1CT1 D;  5JOB A;  3NTH A;  2RKS A;  3P7J A;  3H0G B;  4TRD A;  3IFT A;  1VF7 A;  1RDP D;  3S16 B;  4KJN A;  3C3L A;  4FF4 A;  3MA2 B;  4ZUJ A;  2E76 C;  4FXD A;  4KKS A;  4HMJ A;  1Q1E A;  3X3N A;  5CC4 A;  4C3J B;  5C4X B;  4QIW B;  1KTK A;  3M3Y B;  1JWM D;  1EEF D;  2SNS A;  4BS9 A;  5CMD A;  4XXE A;  1SBB B;  1ZKO A;  1I4R A;  3HOV B;  4N9T A;  1LT6 D;  4IQZ A;  1WVL A;  3Q23 A;  3VR6 A;  1PDQ A;  2I07 B;  2AWO A;  5ELC A;  5C0X H;  2YYZ A;  5C5L A;  1XTC D;  3K5M A;  4OIK A;  3EFX D;  1WTR A;  3ONA B;  1Z47 A;  2F0V A;  5D65 A;  2KQ3 A;  2K32 A;  1EIG A;  2RVL A;  3K59 A;  3GTQ B;  5EBC A;  4H44 C;  1JWS D;  3HP3 A;  4IUQ A;  4XTC S;  4RGM A;  3NE5 B;  3K6O A;  2XSC A;  1JOQ A;  3IAY A;  5KYL A;  2I46 A;  2Z1C A;  4KD3 A;  2A69 D;  3NWS A;  3HEJ A;  5TSS A;  1FNU A;  3S17 B;  1SXT A;  1E2Z A;  3SK6 A;  1LT5 D;  4ULL A;  1WTW A;  5C0X I;  4RA8 A;  2E74 C;  3QOL A;  5COR A;  5KNB A;  1SYD A;  4LAA A;  3K0Y A;  1QE6 A;  4NKL A;  4CHT B;  5JEA G;  5EPK A;  2EVB A;  3URY A;  2A68 D;  3L9A X;  2NWG A;  2KEE A;  3IKJ A;  2B2V A;  2CHB D;  1BCP C;  5JPN C;  5FLX E;  2JEA I;  4IFD G;  1SYG A;  3BZD B;  3DWQ A;  1GUS A;  4Q0F A;  4B9X A;  4N9P A;  2EDG A;  2M00 A;  5IGB A;  5DAU A;  2EJG C;  1GOZ A;  4KHZ A;  5DNF A;  2WV6 D;  5EGT A;  1HTL D;  2NB0 A;  4IUP A;  5C0X G;  5KND A;  1LTS D;  3BDC A;  1S4Z A;  5EJW A;  4IUN A;  5JPM C;  5EKK A;  3KF8 A;  3HOW B;  3I70 A;  4V0B A;  1SSO A;  2TMP A;  3A8K E;  2F0F A;  4ZKB B;  5HUR A;  2B2Y C;  2JA8 B;  1A2U A;  1PTO F;  1OO9 B;  1EQT A;  2FMM A;  3I91 A;  4FXK C;  1F9S A;  4FF2 A;  5I2Y A;  1PRT B;  2O5I C;  1O7Y A;  1HRJ A;  2CVR A;  1LTG D;  2RQX A;  1W6K A;  2EYM A;  3VYR A;  4XT1 B;  1EYD A;  4A3M B;  2IX3 A;  4U67 3;  2KA7 A;  4A3G B;  2F3V A;  4IN3 A;  1YNJ D;  5IGD A;  4DFA A;  4CBV A;  4OO1 H;  1U4P A;  3I4N B;  2JEB I;  2B2W A;  2EE1 A;  4TQU S;  2NVX B;  1ML0 D;  2R6G A;  4PV1 C;  5KEE A;  1VCI A;  1YNN D;  1TS5 A;  1J8I A;  3CU7 A;  5EPJ A;  1KAA A;  1STY A;  1Y1V B;  3TSS A;  1B9N A;  4S3S A;  4ZKC B;  2F0H A;  4K8I A;  4WFN 3;  1I4H A;  1HPC A;  4QF4 A;  4YIJ A;  2QKI C;  2EYH A;  2F0N A;  3J7A V;  3K5O A;  4K6D A;  4IZ8 A;  4OL7 A;  4FO2 A;  1D5Z C;  1STG A;  5C4H A;  1K8M A;  4C1N I;  1VDZ A;  2JYO A;  5E1F A;  2AQ1 B;  3E0J A;  4C56 C;  5FK9 C;  1TWF B;  1R9T B;  4HCS A;  1L0Y B;  2L11 A;  1RJT A;  1CTM A;  4PQX A;  4FYD A;  2XRS D;  1TWA B;  1JB3 A;  3FKI B;  3TME A;  3HG9 A;  1E2W A;  4F87 A;  4MN3 A;  1STE A;  3DWA A;  3GTG B;  2X69 A;  3HKZ B;  1WD0 A;  2A6H D;  1M4V A;  2J4X A;  3R93 A;  1D5X C;  3PUY A;  5IGE A;  1DYQ A;  4BBR B;  3BVG A;  2IT1 A;  1JIC A;  5C6A A;  3H91 A;  1G29 1;  2BE5 C;  4MIU A;  3KLR A;  2DNC A;  2EPB A;  2ENB A;  3ZYY X;  1R4P B;  1BUV T;  4DGZ A;  2HDL A;  1H9S A;  1F2Z A;  5KNC A;  1PZK D;  1FGB D;  1SE3 A;  1A3T A;  2PNR C;  1Y8N B;  4BA1 I;  1W6J A;  2WB1 B;  1XWE A;  1EWC A;  1ZEQ X;  1TKW B;  3SE0 A;  1C4Q A;  3CRK C;  3VA5 A;  5EBD A;  1F2L A;  1KDC A;  3BDO A;  1OXX K;  3AB9 A;  3VYU A;  5JJZ A;  2LFN A;  3CQZ B;  1SFO B;  1IYV A;  2R7Z B;  5E3F A;  5C4J B;  3BVZ A;  2ID0 A;  5G3L D;  2RDH A;  1Q12 A;  1NUC A;  5ELB A;  2BOS A;  2B63 B;  1AN8 A;  3SXH A;  4ID6 A;  3GO5 A;  3K58 A;  3JAM L;  3RZO B;  1EWH A;  5LHY 1;  1LTT D;  3EVQ A;  4OIJ A;  1EEI D;  2CQA A;  4QUC A;  1QJO A;  2F1M A;  2ICI A;  1JCK B;  3NWT A;  2F0M A;  3S1Q B;  3QWN A;  5COY A;  3NXW A;  5C4Z A;  1STB A;  4UDU C;  1STN A;  2D2C C;  5I9O A;  3U9S A;  3A8I E;  2MPM A;  3DEO A;  2SDF A;  2WAQ B;  3A8J E;  3C1E A;  1V1P A;  5KIX A;  2QEJ C;  2FHT A;  1IYU A;  1G8Z D;  3VA7 A;  2KEC A;  3T53 B;  4CGY B;  3BG3 A;  4M8A A;  1ENF A;  3HOY B;  1SNO A;  2L4N A;  4A93 B;  1HA5 A;  1XX8 A;  2R3Z A;  5C3W A;  1TR5 A;  2RSN A;  3RD4 A;  3FPU B;  4NP5 A;  3H94 A;  3I72 A;  3ND9 A;  1LT4 D;  1X32 A;  3I73 A;  2C9O A;  2SNM A;  1SMY C;  2WKC A;  3R8B A;  1DOK A;  4A3J B;  2D5D A;  4CJ1 B;  5I6W A;  1S5D D;  2F0D A;  4KY7 A;  1FYC A;  1KLU D;  4KKU A;  4KN7 C;  2AQ2 B;  1BF4 A;  3V2T A;  2SOB A;  4RKL A;  4JK1 C;  4C1N K;  1FR3 A;  1SND A;  2AQ3 B;  1AFP A;  3WOF A;  4CKB A;  3AU7 A;  2Q8I B;  4ZK9 B;  1KAB A;  4NW2 A;  3CHB D;  4A3B B;  4A3E B;  5KYI A;  1WTV A;  1T5E A;  3T13 A;  2F0U A;  4KI0 A;  2M2L A;  4XDX A;  1GXD C;  1PFB A;  1HHV A;  1CZG A;  1PZJ D;  1KDA A;  3S2H B;  3DEP A;  3EJI A;  1TY0 A;  3QB3 A;  1ENA A;  3BYY B;  3F2U A;  1JC7 A;  5IOD A;  1K8O A;  2MP1 A;  4E6I A;  4H13 C;  2B2V C;  4XQJ A;  1ESF A;  3OW7 A;  1I4P A;  5A2Q L;  3UI2 A;  2F0J A;  4RKB A;  3HOX B;  4HED A;  1RTN A;  4KY6 A;  2QF7 A;  4DK1 A;  3EQL C;  3KLS X;  4EGV A;  5JEA H;  4ZRZ A;  3S1M B;  3DXJ C;  3GTM B;  2BA0 A;  3QIA A;  1EFI D;  4IFD H;  2KUM A;  3MZ5 A;  3TDQ A;  5ELF A;  1MSH A;  2DY7 A;  5C3X A;  1GUT A;  1S5E D;  1NCV A;  3TZU A;  1HXY D;  5DM6 3;  1D2B A;  2IX1 A;  1R4Q B;  1H9S B;  4FF1 A;  1D5M C;  4B9W A;  4FP5 D;  4BY1 B;  1WD1 A;  1B4O A;  2OEO A;  3OIP A;  3PIP 3;  3QG1 A;  4IUU A;  4K5V A;  2Z4H A;  3E5S A;  1EY0 A;  2MHV A;  5ELD A;  4F7X A;  1B3A A;  4K14 A;  3J80 L;  1GUO A;  1QWY A;  5KRU A;  4IFD I;  2F0W A;  2D9U A;  5T1G A;  2WII B;  5M3F B;  3K5N A;  2ZT9 C;  1RHP A;  5G3L F;  1BR9 A;  3C1F A;  4KK7 A;  2B2W C;  3R2I A;  3MXU A;  4HAE A;  1Y8O B;  3RUZ A;  5DEH A;  1CQV A;  3PUW A;  1RD9 D;  2NVQ B;  3S2D B;  2B2U A;  5K5P A;  1RTO A;  4J8Q A;  4DA2 A;  3BS1 A;  5I9P A;  4HTH A;  3PUZ A;  4A3K B;  1Y8P B;  4C3I G;  5CV8 A;  1MD2 D;  3GTK B;  4P2C B;  4Y7N B;  1TVX A;  3OHX C;  4RGN A;  3V96 A;  4KKT A;  3SVM A;  4ILW A;  1XYI A;  1U4L A;  1V43 A;  5M5Y B;  3NP8 A;  3X3M A;  2B8G A;  3S1N B;  2O4X A;  2DNE A;  1BO0 A;  4KTA A;  2A73 B;  2KHS A;  4C2M B;  3J7A F;  3GV3 A;  1MSG A;  2WAC A;  2PMZ B;  2WKD A;  2CW0 C;  3MFY A;  1V1P B;  3MXN A;  3HZX A;  4MHE A;  5DM7 3;  1JR0 D;  2L9H A;  1HQR D;  2PW7 A;  1IW7 C;  3W2D A;  1OXU A;  1WTX A;  1WTP A;  5C3E B;  1J9O A;  2F0O A;  3DUZ A;  2E2I B;  3H09 A;  1FD7 D;  1X3P A;  1A2T A;  1TY2 A;  3R3O A;  3P1H A;  3FRP B;  1QNK A;  3S9W A;  2K5D A;  4XQN A;  4G57 A;  3G6J B;  4DNR B;  3D6C A;  4DNT B;  2XWB B;  2B39 A;  1UEA B;  1QG7 A;  1U4M A;  3KLS A;  3TBI B;  1OXS C;  4WOR A;  2BDO A;  1PTO B;  2QDB A;  4DAP A;  3P20 A;  3MHB A;  2E75 C;  3Q24 A;  1DOL A;  2FJ2 A;  1H9K A;  3OOC A;  5EPL A;  3NTK A;  3VYS A;  4CKE A;  1SYE A;  3SK4 A;  3NQT A;  1I4Q A;  1CZW A;  1EZ8 A;  4U68 A;  3AMU A;  4TKO B;  1EY4 A;  5IIF A;  3IL8 A;  3D8G A;  1SYF A;  3P75 A;  4XYO A;  3TN2 A;  4C3J G;  1M8A A;  5CBE E;  1PZI D;  1UAP A;  2E2H B;  1OXV A;  1E2V A;  5K36 G;  3OIQ A;  4RGT A;  1MBY A;  1JOO A;  1SNQ A;  1MI2 A;  1BCP D;  1EOT A;  5IT9 L;  1DD2 A;  3NQI A;  4XYQ A;  5LL6 X;  1ILP A;  5HGT A;  2MGS A;  3T16 A;  2K33 A;  2K7V A;  4TSS A;  4AYB B;  2AUK A;  5BN3 A;  3FEW X;  5IGG A;  4XQQ A;  4IUT A;  3DMU A;  3NPP A;  2PZT A;  2MUY A;  2OF1 A;  3FMC A;  5IGC A;  2BDN A;  4K6L A;  5KGU A;  1BOS A;  2NTS A;  2EYF A;  4PMC A;  3CRL C;  3LNN A;  1U4R A;  4CJ2 C;  2RDG A;  1LV9 A;  1SJH D;  1DZ1 A;  5F2D A;  1DCZ A;  1IKL A;  1STA A;  4ZUI A;  4IUR A;  2GA4 B;  2EJM A;  2NYZ D;  5EQ0 A;  1DM0 B;  1HQM C;  2PZU A;  1II3 A;  4RHR A;  1ICW A;  4CKC A;  2E2J B;  1O78 A;  1SJE D;  1BBX C;  3J81 L;  2X6G A;  1HUN A;  4X3U A;  2X6L A;  2K5Q A;  1AP0 A;  3M7G A;  4RCN A;  2LKV A;  2YU9 B;  2C5C A;  1F2Y A;  4WJW A;  2RSO A;  4J1M A;  4JBW A;  3SDZ A;  4I65 A;  2A6E C;  2H1E A;  2NTT A;  2KED A;  5C0X J;  3HGB A;  2HCC A;  5JAV A;  4L63 B;  5J1Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...