2KJXA

Solution structure of the extracellular domain of jtb
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
65
structure length
65
Chain Sequence
GSGMKEFPCWLVEEFVVAEECSPCSNFRAKTTPECGPTGYVEKITCSSSKRNEFKSCRSALMEQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Jumping translocation breakpoint protein
publication title The structure of the extracellular domain of the jumping translocation breakpoint protein reveals a variation of the midkine fold.
pubmed doi rcsb
source organism Homo sapiens
total genus 8
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.490 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2kjxA01
2KJXA
chains in the Genus database with same CATH superfamily
2RCNA 2X6GA 4LF9L 2OEOA 4QY7A 3S1NH 1AN8A 1EU4A 4JI5L 1SROA 1ICFB 5ELDA 1NR2A 1UE7A 4JVZA 1YJWA 1NUCA 2VQFL 4GNXB 3HKZE 3DM3A 4J15A 2CVRA 2JA7H 4DAPA 4XTCS 5C4HA 1WTXA 3K6OA 2F0KA 4J1MA 1ICWA 1AP0A 1PFMA 2HQEA 3S16H 2F0EA 4AIMA 2E75C 5BR8L 1CHPD 2VW9A 1G51A 1LTLA 4L5TA 1PYBA 3JAML 4UAIA 4NXMQ 2M00A 1S4ZA 3J81j 1XNQQ 4LF4Q 2JEAI 3L9AX 4LFAQ 1PFNA 4TKOB 3H91A 1EWIA 4GS3A 2DNCA 4DV7L 2NVXH 3E0EA 3SR1A 2Q2IA 3D8GA 4OONA 1SNPA 3HGBA 5IYBH 3M9BA 1GUNA 1NAPA 3QR8A 2FMCA 4DR1L 1WD0A 3KUPA 1IBLL 3HOWB 3U9OA 5FO8B 4A3FG 3EA6A 1EL0A 1M4VA 1HNZQ 2JA5B 2RKSA 4UPAA 1SMXA 3BVGA 4XXEA 4RCNA 1X55A 5KNBA 1LTGD 3K5NA 3HKSA 3SK6A 5G3LF 1CKMA 3A8KE 1K3RA 3OWFA 1BCPB 1Y1WH 1MIUA 4RA8A 5LMUL 4RAUC 2R61A 2X6LA 5JJKA 1BBWA 3IAYA 1JE4A 2Q8IB 1QNKA 1ZEQX 3A55A 1STGA 1WD1A 4OGQC 3M7GA 3RZOH 2EJMA 4LK1C 5IT9c 1O78A 4LW1A 1Y8NB 3K0YA 4WJ3M 3DLLA 1F2MA 3NXWA 2A68D 4NDXA 3KJPA 4A93B 1TWAH 1XMOL 1JOQA 4CJ0B 2JA8B 1CI3M 4KHPL 5FOBB 3WWVA 1G2TA 3PO3B 1GHKA 1LT3D 4DNRB 3J81c 4APVA 1PZID 1DD2A 1O7IA 4O1NA 1JORA 2KA7A 1W6KA 1EUJA 1U9RA 2AQ1B 3HOUB 5EJWA 1K0RA 2R3ZA 1BXTA 1F77A 3CQZH 1CK1A 1TT2A 1D5MC 4TSSA 4A3FH 2E5LQ 2VUMB 3GTLH 2F0NA 1VQKA 1PH6A 1Q46A 1TQOA 4HAEA 4XYOA 3T1HQ 4F7XA 3RD4A 1DYQA 1I3QB 5M5XH 1SFOH 3I3CA 3RN5A 1PRTF 4RGMA 4P71A 3J7ZC 1V1OA 5IYDG 4R4CA 3TDQA 5E4XA 5LMNW 3S14B 2A68C 2GN5A 5C4XB 5EPKA 4ZUJA 3S17B 3BDCA 2D0PA 2FJ2A 4HJ7A 4OELB 1WCMB 4YCUA 3J80L 1K83H 1IHZA 2ZM6L 2PCFB 4R4IA 1IBKL 1BVSA 2Z6KC 3FPPA 1LV9A 2QDLA 4L5RC 3NUCA 3JAMc 4DV5L 1RTNA 1AEXA 2F0FA 3D6CA 3T56B 3TBIB 5H1SE 4V190 3NQIA 2L1BA 2LXKA 1H9JA 2ID0A 2UXCQ 3R8BA 2KJXA 3PUZA 1RTOA 3DHQA 3IFTA 3R93A 1R4PB 3PMFA 3GTQH 3S15H 3A54A 1HZBA 4JBMA 1A15A 2LSSA 4QIWB 4LF5L 2E2IB 1PFBA 1B53A 1EWCA 4K2LA 1TIID 1TS5A 4LF7Q 2LKVA 3PIP3 3CCJA 2H5XA 2ZT9C 4JOIC 5IGCA 2PYKA 3P1HA 1EWHA 4R4QA 1DOLA 1U0LA 2KEEA 3CU7A 4KD3A 1GKHA 3K8AA 3OOCA 1S5ED 2M9VA 3I73A 5LMNL 2E2HH 4NKLA 3FKIB 1YBYA 2K14A 2K5VA 2EJGC 5IYDH 2B3GA 1QZHA 4DK6C 2J0TD 3D4RA 1SE2A 1I6HB 4XT3B 1PFSA 1GUOA 5M5WH 4OWWB 1BUVT 1EYDA 1SLJA 2LFNA 3K57A 4XDXA 2E2JH 3DMUA 3VYRA 2EY6A 1SR3A 3I4OA 4ZRZA 5GQOA 1JT8A 4KN4C 2JA5G 4IPCA 5ELBA 3NWSA 2R93B 4AH6A 1STYA 3S1QH 1E1TA 1ENCA 1HZCA 1VQEA 1C8CA 2EIFA 1HFGA 2RQXA 1E1OA 3NTIA 5GADC 3H6MA 1CSQA 2A6HD 1FNWA 2EYOA 3BVMA 4KMUC 4PZ7A 3HS0C 1Z6HA 1WTRA 2KBNA 1JJ2A 2E8GA 4IUVA 3WOEA 1N36Q 1OO9B 1U4PA 1B4OA 4DV3Q 1OXSC 1WTOA 4DFAA 2QW7A 3K59A 1D8LA 1RIPA 3F2CA 1G8ZD 5M3FB 2F3VA 2YV5A 3UE0A 2V1CC 2I46A 4G7OC 1B1ZA 4XIGS 1T5EA 3GTJB 2L4NA 4DN4M 3EROA 3NTKA 4GOPA 1VQ4A 4A93G 1PH9A 2WINB 1HFNA 2Z4HA 3F1ZA 3OYYA 3PO3G 4OHJA 4IFDH 2A6HC 4LF6Q 1IZ6A 3VA7A 2ATWA 4CBVA 2CWPA 2AQ2B 5IGFA 4CKEA 4K0KL 4A3JB 4LF8L 2A73B 1G291 1UE6A 3HOWH 4FF4A 3MXNA 5ELOA 1RDPD 3NELA 3FEWX 4DK1A 3LWEA 2H1EA 5EKIA 4IUPA 3HOZB 3MVVA 3W3AA 2VUMG 1UAPA 2JA5H 1GUSA 3ULPA 4JI2L 4JW0A 3VR2A 4HIDA 1I4XA 1Q1EA 1DM0B 2A5HA 2F4VL 1QILA 5IIFA 4HIMA 1DOKA 4POGA 1HA6A 2RSNA 4IUUA 3N6RA 1PH2A 1N32Q 2R92B 4RKLA 1J9OA 3G4SA 5C0XI 5HY6A 4GN5A 5KGUA 1WCMG 4M8AA 3P20A 2NZ1D 1LT6D 1SRUA 5J3BA 1FJGL 3AU7A 2F0LA 2A6ED 1OXVA 4JI0Q 1SNDA 2VB2X 3HOXB 1I5FA 4A3EB 2AHOB 3S2HB 4KV6A 1QNUA 1GUGA 1ASYA 3VR6A 4KI0A 1PRTC 3GTPB 4J8QA 4A93H 4B3SL 5FJ8G 3SEBA 2BDOA 1VQ5A 5L37A 1B44D 1F2LA 2PI2E 3NENA 3PO3H 5J39A 4H44C 2B2UC 5I2XA 3AEVA 1Q86C 3BDLA 2JP1A 5JVH3 1O7ZA 4XQNA 2A6EC 2VUMH 2EYJA 1SXTA 3R2TA 3W5OA 4U673 1D6EC 4LAAA 1SE4A 1I3QH 3FKIG 3OTOQ 4RH6A 1Z47A 1KL9A 3S14H 4Q5VA 1S5BD 3L0OA 2QEXA 3PGZA 2MPMA 3SK8A 4JK1C 1VQMA 3PV0A 1NY4A 4LFBL 4J6HA 3PF4A 3S17H 2WIIB 1T9HA 5CBEE 1WCMH 4OO1I 3TQYA 2ZJQA 4DR5Q 2OXPA 4GOPB 3I4LA 5M9OA 1Z7TA 1V9PA 4AYBB 4B3ML 4A3GB 3HRZC 4BY7B 1G6ZA 2R93G 4ZCKA 4DR7L 3E5SA 3H0GB 1ILQA 4X65Q 3CC4A 4R8IA 4K5XA 1RF2D 2A8VA 3E0JA 3GTMB 3VA5A 4JI6L 1DZ1A 1HNWQ 4JG2A 2XGTA 4JI1L 4DV6L 1G2SA 1CZWA 5FJ8H 3SGIA 1SYDA 1C0AA 2EDGA 1IKMA 1YNJD 4IO9A 3J7A5 1MKHA 3HOVB 4JI8L 4IZ8A 3I2ZA 4TQUS 2E2IH 1TY0A 4PV1C 5AJ3L 1XNRL 1N34L 1F9QA 3OIQA 3K80C 4KHZA 4X64L 2QKIC 3KK7A 1X65A 2K32A 1SYGA 4JI5Q 3BYTB 5EBDA 4BA1I 1ILPA 1X6OA 5GROA 3FKIH 3RR5A 4ZUIA 4L8JA 1NSNS 3PF5A 2KCCA 5CV9A 1O80A 3GTOB 4DV1L 1W6JA 4HSPA 1GM5A 1HR0Q 4JYAL 2JXMB 1YNJC 3EJIA 3PIO3 1B70B 2F0TA 2O5JC 4EVOA 4JI3L 3EFXD 4K6LA 1NMGA 1A63A 2HCCA 2XTIA 5E1FA 3HOZG 3KDFA 2PW5A 2F0DA 2R93H 5COYA 1E24A 3NE5B 2OTLA 2VL6A 1DONA 1B8AA 4AQYL 4F87A 1EEFD 2EPBA 2FHTA 3S1RB 4RKBA 2PQEA 4ZKCB 1XTCD 4BBRB 4DR1Q 3QOJA 5DEHA 1PVOA 2K5WA 4DR2Q 3IRBA 1ML0D 3H94A 1IXRA 2I5MX 4PQXA 3IFDA 1AW7A 3SE0A 2B2YC 4MTKA 4DV0L 4IALA 4F88A 2F0QA 3HOXG 2F1MA 4A3EG 1HQMC 1E2ZA 1CQFA 2HIVA 4JI7Q 2YTXA 2F0HA 1SE3A 4HMIA 2CKZB 1EQQA 2RHSB 1UWVA 1GO3E 1PDQA 2XNAC 2HIXA 3OMCA 4BWGB 5EAYA 1JCKB 2K33A 3NK9A 1VCIA 2MP1A 4GNXC 5E3FA 4A3JH 1PZJD 2L9HA 1J5EL 2Y0SB 4ID6A 2ZJPA 3E6ZX 3MTSA 3HOZH 1VQGA 5IP7G 1N9WA 1QJOA 5FLXE 1YJ9A 2UUBQ 4UHVA 3L3OC 2XVSA 4FF2A 2IWHA 1VQJA 5C3EB 1BCPD 2I5LX 1HNXL 4A3DB 4K6DA 4PZ8A 4DU9A 1D1IA 2R92H 2HHHL 1JOKA 1NCVA 3RZDB 2D62A 3ICEA 1Q81C 1QUQA 2UXBL 3A7LA 3OMGA 1IBMQ 1A8VA 3D3RA 4RWSC 1YEZA 4ULLA 3CPFA 5C5MA 3HZXA 4AYBG 4C3HB 4A3GG 4BY7G 3HOXH 2NVTB 2L0CA 3PIPA 3H0GG 4A75A 4A3EH 3S2HH 5C0XJ 4DAYB 2YTYA 4BA2I 1IW7D 2F3IA 2SEBD 3GTPH 4MZ9A 4CJ2C 2MO0A 1F9RA 1BCPC 3ERQA 1YHQA 2CFMA 4R1JA 3CW2C 4ZYSA 2OT2A 1VMPA 5M3MB 1BBUA 4FXDA 3KLSX 3H09A 5J22A 2QCPX 1LO5D 3LGJA 3TN2A 5M5YB 4KKSA 3X3MA 4M1UB 2KCNA 1I94L 3K58A 3O13A 1Y1WG 4IOCA 4IUTA 5IP7H 2V4DA 4A3KG 5ISRA 1PH7A 4HCSA 4OX9L 5A2QL 5JPNC 5JJZA 4HJ8A 3V96A 3V2TA 4B3RL 2NN6H 1IW7C 2AWOA 2JK8A 1VQLA 1D1KA 3KJOA 3U4VA 4X3KA 4JBKA 2WAQG 1XJVA 2MNAA 5LMNQ 3TRZA 3DWAA 1JC7A 1L2FA 1HTLD 5IGEA 2XRSD 4A3GH 2ZTDA 4BY7H 4DAVA 4UDUC 3CF5A 3H0GH 2K6AA 1XMQL 3V05A 1H9SA 1DOMA 4GN4B 2K1BA 4C2MB 2SDFA 3GTMH 4IUQA 2PNHA 1PH5A 1KABA 1K73C 3P7JA 2X69A 3PQIA 3Q22A 1PH4A 2D5DA 1X3PA 4K5VA 3AMUA 4LNQA 4B08A 3HOVH 3D31A 2N49A 5IT9E 1KXLA 2EZVA 1LTAD 4LFCL 1HUMA 2KCTA 4DNIA 5EPJA 2MO1A 1UEAB 3BYYB 3OHXC 1IYVA 4S3SA 2B2WC 3RMHA 4A3KH 3A7AB 1KNAA 3T53B 3NTHA 3GTGB 1TU2B 2M2LA 2JJQA 4N8FA 1PTOB 3DEOA 1QUQB 1HA5A 2NWGA 5KEEA 4KD4A 1W2BA 3TMEA 2QEJC 5CGKA 3PUWA 5I6YA 4ILWA 2YYZA 1UEBA 3AYHB 3MFGA 2P5ZX 4G7ZC 4G7HC 3URYA 1F9SA 3VR5A 3U9SA 1SYFA 1K8AC 1VQ6A 2RCFA 1LLRD 1I6VC 1E0BA 2PQAA 4DUZL 5C3EG 3RLNA 3H3VH 1K8OA 5JPMC 4GZYC 3HG9A 4K0KQ 4RFBA 4JI4L 1X3GA 3TZUA 1JWUD 4K14A 5IY0A 1E3PA 1N33L 3R3OA 3STBD 5BN3A 3K7AB 4DUYQ 3I4NG 4PNYA 4HR7B 4XYQA 4PMCA 2CQOA 2F4VQ 1TWHB 1TS3A 2K5DA 1LTID 2AWNA 4IFDI 4B9WA 1BKBA 2EJFC 1VQCA 1AZPA 1F2ZA 1Q1BA 1A2TA 1PV4A 5EPLA 4HJAA 1TXYA 1EY6A 4POFA 1CSPA 3F8TA 1JJCB 5IGBA 2B8GA 5IGDA 2N8NA 3S1MB 4JBWA 1Y1VB 1X3QA 4C1NI 3W1GA 2C9OA 3QO2A 1TWFB 3TP8A 2XN9C 4HCEA 3STBC 2F0JA 1QVCA 1RJTA 1TWGH 2KVMA 4ZLTF 4YY3L 1H9SB 2ENBA 1HZAA 1I4GA 2IX0A 4GLAC 1WVLA 3VR3A 1HZ9A 1NMFA 2CWAA 4JOIA 5C3EH 1B3QA 4GKJQ 1VMCA 3KF8A 1CA5A 2PI2A 1ZXTA 2VQEL 3CCEA 1HPCA 2UXDL 3BZCA 1Y69U 1HH2P 1D7QA 4C56C 5KYIA 4YHHQ 3DM1A 5JEAG 3I4NH 5DM63 3KLWA 1H9KA 2RSOA 5CV7A 3RZDH 1VQHA 3QIAA 4PG3A 2Q8TA 5BN5A 1VQ8A 3GTKH 3MXPA 4ABNA 4L63B 4DR3Q 3C3LA 1C48A 4KN7C 4WRDA 2NVTH 1HTPA 4X62L 2O5IC 3SK5A 1BO0A 3A5ZB 3EN2A 4DR4Q 4IFDG 1YIJA 1VF5C 4PMWA 1Y8OB 1F2YA 3GQBA 4OL7A 4PMBA 1O7LA 3NHHA 4O0AA 3U4ZA 2RHQB 2B63G 3QWNA 3HOWG 4WJ4A 2XWBB 4EGVA 2B2TA 2Q2HA 4FO2A 4RG1A 3PCOB 4X66L 3VDYA 5M3MH 1FYCA 3WDNA 4WJWA 4ZQ3A 1BBXC 1A3TA 3EBEA 1H95A 4WFN3 5GAHC 5C44B 1A2UA 2F0VA 2PQAB 4R9WA 4JI6Q 5M5YH 1XNQL 3T13A 4LF4L 3I72A 4G4KA 3J80E 3PIOA 5JJIA 3RLOA 4A3BB 4ALPA 1DXMA 1WFQA 4JI8Q 1A6XA 3AQQA 2E74C 5C5LA 1XNRQ 2L55A 1MSGA 2R7ZB 1HNZL 1KLUD 1A62A 1TKWB 3RN2A 3CKIB 2EYPA 3NWTA 3VR4A 5JEAH 1SMYD 2AUJD 1WOCA 2IPKD 2HDLA 4CKBA 3CC2A 1TY2A 2C35B 2JA8G 3ZYYX 4H13C 5KNCA 1CFMA 3D4DA 4DV1Q 4BY1B 4NW2A 4C2MH 2O2LD 3ULLA 1FL0A 2B39A 3G48A 4JV5L 3HOUG 1SYCA 2WKCA 1RKNA 4JI3Q 4NXNQ 2B63H 1Q3LA 1S5DD 1S5CD 3VYSA 3TREA 3LWUA 5FK9C 5C4JB 1PXUA 4FVMA 1JB3A 1EZ8A 4B3TQ 1ET6A 3EIVA 4AQYQ 4MTNA 2NVQB 4GOPC 4RGOS 1SMYC 4MN3A 3KF8B 5C4XG 2OWOA 3CAMA 4FDBA 1EOVA 1LM0A 3KLSA 2RA4A 3CD6A 2WB1E 4QL5A 4RHSA 3GTGH 1C4QA 4FYDA 1ONLA 1C9OA 3M85A 2UUAQ 3KF6A 3MC0B 2E5LL 1B9MA 2AUKA 3CC7A 3T1HL 4MNOA 4KKTA 3K0XA 2D0OA 1SDFA 1SNQA 3IL8A 1LYLA 4MIUA 3EQLC 3C46A 3S2DB 1OTCA 3GD7A 3SDZA 1XPUA 1GUWA 2B2UA 3CCRA 2JA8H 2GVAA 2RBMA 1EIGA 2WACA 2Z9HA 4IOAA 3DEPA 2IJ0A 3OPOA 3FDTA 2HT1A 3HOUH 1VQFA 1IL2A 1KNEA 1B7YB 1L0WA 2JA6B 1HXYD 2K5QA 2UXCL 3K7AH 5KNDA 1SBBB 2B2VA 3MEHA 3CCQA 2DUDA 1RD9D 2KENA 1MI2A 3H15A 2BA0A 2KEDA 4I7ZC 1SSOA 5GAGC 1XYIA 1YITA 1TWHH 5J1ZA 3VYUA 3G6JB 1QOHA 3U58A 4PZ6A 3MFYA 1BCPF 5JAVA 5LL6X 2OTJA 5T1IA 1I50B 5EQ0A 5C4XH 4JBJA 4HEDA 1OXTA 3H3VC 3EVQA 3T1YQ 3CP0A 4NPSA 1LTBD 3I4MB 4R8NA 4UY8C 1V1PA 5CC4A 1MBYA 2EY5A 3OW7A 4GLVB 4IFDJ 2K52A 2CH4A 3A0JA 2EXDA 1VQ9A 1EIFA 1Y1VH 4X3UA 2VXWA 3I7FA 4EQPA 3CHBD 1TWFH 5C44G 4OWXB 3S9WA 2JA7B 1L1OA 2SOBA 1KAWA 2UU9Q 5D65A 2K03A 3HOYB 4GN3B 1Z9FA 1JQYD 3MXNB 4IURA 4CDFC 3F2UA 1Q12A 1RCVD 2K75A 2KHIA 3FMCA 4DR6Q 3GV3A 4IPDA 2RVLA 5CYUA 3I55A 4FF1A 1MD2D 2ALYB 1V8QA 2VS1A 2F0OA 1KRTA 3Q8DA 4CKCA 4LF9Q 1ET9A 5M3FG 4TVAB 1QG7A 3NEMA 4LJZC 3UDGA 4EQOA 4C3JB 5IYCG 5ELFA 2WV6D 4E6IA 2ASBA 5EKLA 2VQFQ 2MQHA 2RDGA 3KF6B 1N36L 5CBAE 1CZGA 3N52A 4GKKL 1HQRD 4DV2L 4DV3L 3BVZA 1I6HH 2XIWA 4DAMA 1PRTB 2I5HA 3DWQA 1PYWD 4YCWA 3MZ5A 5BR8Q 4Q0FA 3J7AF 1JWMD 4A3JG 3R2IA 4N9PA 2A1AA 1CUKA 1YI2A 2QDBA 2DY8A 1EZ6A 2BCOA 4IPHA 1XMQQ 1K9MC 4DKAC 5C44H 2NN6I 3BS1A 1X9NA 2B29A 4DV7Q 4CDEC 4LF6L 5HGQA 2HDMA 4JC0A 4A3BH 1NNXA 1IBLQ 1QZGA 3J80i 2R92G 4L5QA 4XT1B 2B2YA 5EBCA 4HTHA 1RHPA 1MSHA 1UE5A 1BOSA 2BDNA 5CV8A 3TS2A 2R6GA 4XQJA 2DN8A 4KLKA 1PLFA 2PMZE 3UI2A 4IUNA 5M3FH 3OWEB 4QQBX 5LMUQ 4BBSB 3W1BA 4A3LG 5IYCH 3GTJH 3FP9A 1N32L 3DXJC 3T4AC 2IX1A 1V1PB 3MXUA 2EOTA 3MEFA 3OSOA 3CMEA 3A8JE 1EOTA 2WAQE 4BY1H 4OXPA 1QVGA 2KECA 3S24A 1LUZA 2FFKB 5K36G 4LUOA 2L12A 4DV4L 4K5WA 1L1OB 3NBHA 3BJUA 2AQ3B 1XMOQ 4P72A 1JB7A 1BQQT 4KHPQ 1ZKOA 5C4JH 1CM9A 2F0IA 2KCMA 1UUPA 3WOFA 3E9HA 1D5XC 4DUZQ 3GP7A 3DUZA 3NPPA 2LS01 3ULJA 2NVQH 1KLGD 1KQSA 2NN6G 2FINB 3D4WA 1VF7A 1ESRA 2MFIA 2ZXRA 1PTOD 5CMDA 4A4IA 5AFWA 1IYUA 3PUVA 2JE6I 2JQOA 1FD7D 4EQNA 4DGZA 3HFZB 2MGSA 4L6TB 1SNMA 1TS4A 4DF7A 1B2TA 2IT1A 4A3CG 3H3VI 2PPBC 2KHSA 2PZWA 2D2CC 4CJ1B 2EY1A 3I8ZA 1VS0A 2CW0D 4OEMB 3S2DH 1PZKD 3G7LA 4A3LH 1LABA 4B9XA 3HKZB 3M4YA 2ICEC 1M1KC 1EIYB 3HOYG 2ZM6Q 1CKNA 4N9TA 1IBKQ 2ZTCA 5EGTA 1CKOA 1I4PA 5DAUA 3HOVG 3LX0A 1P8LA 2FMMA 4DR5L 2DJFC 2NB0A 2PO4A 4DV5Q 3MXGA 3KDFB 1PTOC 2PW7A 3BZKA 1E22A 2B8FA 4HJ5A 1QB5D 4HIKA 5K36H 4MHEA 2EXZA 2DJGC 2PZTA 4UP7A 3Q23A 4LMQD 4F8MA 4X65L 2JA6H 2IW3A 1Y8PB 4IJHA 1HNWL 2EY2A 5JOBA 1JR0D 3PUYA 4EQ5A 5T1GA 4C3JG 2RDFA 1K8MA 3W2DA 1WI5A 3GDEA 3TZDA 4CGYB 1ESFA 4LF5Q 5IWAL 1TS2A 2K05A 2VY3A 3T16A 1KDCA 1VQIA 2CW0C 2I07B 2UXDQ 1X56A 1JMCA 2NYZD 4DK3C 5I2YA 1YVCA 5ELCA 2NTTA 1UNSA 1PMRA 5FO9B 1A3VA 3I4MH 2JYOA 1LTTD 4K8IA 4ODGA 3ND9A 2B63B 4RHRA 4X62Q 3BU2A 4A3CH 1VQNA 2G5DA 3Q24A 2F0WA 4OWTB 3SXHA 4H02A 2KOLA 4IPGA 1CT1D 5BN4A 4ZAIA 4ZK9B 1SAPA 1HR0L 1B3AA 4BBRG 3HOYH 1HCZA 3NBHB 4X66Q 3TS0A 1EFID 2K50A 4IN3A 1XPOA 3NQTA 4QMGA 1YNND 2F52A 2UUCL 4ME3A 1Q8IA 3A56A 2B2WA 2Z6BA 1EQRA 3KBXA 2EYHA 3FRPB 3QB3A 3G6EA 2EVBA 4DA2A 4DNTB 5IE8A 1OXUA 3CCVA 1PHJA 3K81C 2YU9B 4QB4A 4BBSG 4C3JH 1STBA 1ASZA 4QJFA 3J81E 4H7BA 4GLXA 1RL2A 4KY5A 4DR2L 5FO7B 1VQBA 1FR3A 1FGBD 3Q0AA 3GTOH 5HGTA 2Z0SA 5D3IB 5E4WC 1II3A 3KBGA 5A2QE 3ER0A 1YNNC 4QGUA 4FNFA 2Y0SG 3OW2A 4RGTA 5KRUA 1K8GA 4JI7L 3AFPA 3QJYA 1CKNB 2LXJA 1BNZA 4DXGA 1WTQA 1ENFA 4JV5Q 3S1RH 5I9PA 1ZYRD 4A3DG 1EQVA 1EU3A 4LF8Q 1PA6A 1EY8A 3K7UC 4BBRH 4KJNA 1LT4D 2GA4B 3JAME 1PYSB 3MHBA 1FNUA 2OQKA 4JI2Q 2HD3A 5IODA 2XRQD 4JPBW 3ERSX 2UUBL 4WORA 1KDAA 3T51B 2K4KA 4G57A 2N78A 1TVXA 4C3HG 2HUGA 1EY9A 4NP5A 4KY7A 2ZXPA 4BBSH 5CV6A 3RLFA 3GV6A 2Z6KA 1YHBA 1X32A 4QF4A 5E7NA 3HKZG 4IJLA 2ZJRA 4JCVE 1CQVA 2G9HD 1J6QA 1C7YA 1FJGQ 3JC66 3FVQA 1ZYRC 5IGGA 2XWJB 1IBML 5M3MG 1S5FD 1STAA 2F0MA 1ENAA 1XX8A 2D9UA 4O42A 3K5OA 1CHQD 4KKUA 4B3SQ 5GAEC 1U4MA 4A3MB 4FXKC 3TP6A 2Z1CA 1BR9A 4XQQA 1XPRA 4QUCA 1H9MA 5I6WA 2HQLA 5I9OA 2TMPA 2A69D 4A3DH 4I7AA 3M4OB 2YTVA 1Q82C 1U4RA 1EY4A 2BA1A 2GVBA 3PO2B 3QG1A 1EYAA 3RNUA 1VDZA 3J7AV 4KY6A 1IYJB 1NE3A 1EEID 1JE5A 3A8IE 4K8JA 2WKDA 4QCLA 3AB9A 1PH8A 4FF3A 4C3IB 1DJRD 1EYCA 4C3HH 4O2DA 3G71A 4LFBQ 1Q7YC 1AE2A 4P75A 2E2DC 4X6AH 1MJEA 4X3TA 1XXGA 2F3WA 3HP3A 1KD1C 5ELEA 2BE5D 3MA2B 3D0FA 1HUNA 4X3SA 2F0GA 2KHJA 1QVFA 2IX3A 2E76C 5NUCA 3E9IA 1VQOA 2WFWA 4P73A 1HJPA 2A69C 1FNVA 2Z4IA 4Y7NB 4KK7A 4B3MQ 1Y14B 2AKWB 1NTGA 4DR7Q 1N8RC 4KTAA 5DM73 1EY5A 1U5KA 1GD7A 3FHWA 4NXML 1I4HA 1BF4A 1D2BA 1OXXK 1SYEA 4YCVA 4JI1Q 4LFAL 4DV6Q 1CA6A 1M8AA 4C1NK 5KIXA 4HN7A 2R7DA 4QIWE 3RUZA 2VB3X 2OCEA 1S40A 1GOZA 2F0PA 5AJ3Q 1TWCB 5JVG3 2MUYA 5LHY1 1S72A 1N34Q 4X64Q 2BE5C 5G3LD 1S3OA 1SJHD 2B2TC 4DXFA 2EYFA 2NZOA 2ZXOA 2CHBD 2NVYB 4UP9A 3CCLA 1AE3A 2EQSA 2MJ8A 1GXDC 2WB1B 4GKKQ 2A74C 4DV2Q 1BDOA 3BDOA 2K5HA 3M7NA 4JYAQ 2BH2A 2F0SA 1STEA 1SNOA 2O4XA 1SNCA 3L7ZC 3C1FA 3D6WA 1XWEA 1SN8A 4BS9A 2JSOA 3K5LA 3ITPA 1WTPA 1SJED 1V1QA 3A74A 3J80c 3KFUA 4V0BA 3ND8A 3NBIA 1MJCA 1QWYA 4L5SA 2N3SA 1EY0A 4KJOA 2BH8A 4UP8A 4HMJA 3C2PA 3M3YB 2YU9H 1TR5A 1LTRD 3BZDB 1EFWA 2Q8RE 1VQPA 2CQAA 4DUYL 5CORA 1PTOH 1O7YA 2OQ0A 1E7ZA 3J81i 1PRTD 2RF4A 4DV0Q 5C3XA 1FVIA 1Y1VG 4R4TA 3UDIA 4KHVA 5EKKA 2G9DA 1XTDA 1KHIA 5CR3A 2L11A 4OIKA 2BOSA 1X54A 2NTSA 4A3MG 3SHLA 1IKLA 3E3XA 1H9RA 2F4IA 1EYGA 4Z9CB 4R4OA 2SNMA 2N55A 5ELNA 3AFQA 4FP5D 2K04A 4DV4Q 3TP5A 3B6YA 1J5EQ 3QOLA 2Q2UA 3PUXA 3Q6SA 3PO2G 1EIHA 1LACA 1NJIC 1WTVA 3IKJA 1R9TB 1STHA 3JAMi 1KRSA 3C1EA 4ME5A 3MAQA 1X3EA 2PZUA 5C3WA 1HNXQ 3GO5A 4A3IB 4C3IG 2H4OA 5JEAJ 4GKJL 3A5UA 2PNRC 3MWYW 3CMAA 2JA9A 4QUFA 5IOCA 1GHJA 3DWPA 2HHHQ 4LF7L 1MHWC 2N88A 3FPUB 5HURA 1KIXA 3S1NB 1PTOF 2IHFA 4YWKA 4ZKBB 2QF7A 4YHHL 2UXBQ 1I4QA 5CV4A 4DR3L 3S1MH 1E2VA 2B2VC 5LL6S 2JN4A 2K7VA 1HHVA 2CCZA 4DR4L 1DGSA 1L0YB 3I91A 3NSWA 4A3BG 3S16B 1K28A 4A3MH 4RMFA 2VNUD 5C0XG 3KYHC 5F2DA 3UDFA 1K0SA 1B50A 3TP7A 5JJLA 2SNSA 2R7ZG 2EYMA 3UE1A 1KTKA 3M4OH 1G6PA 2K01A 2IL8A 1I94Q 3PO2H 2J4XA 3LNNA 2NVXB 2CH4W 4LUZA 1YJNA 4H0LC 4DPGA 3F2BA 1GVPA 4OX9Q 2ZTEA 2NZHA 1L1OC 5IWAQ 1EQTA 1UE1A 4B3RQ 1KAAA 2F0UA 2NBFA 2OF1A 2WB1G 3I90A 4C3IH 1X3FA 1F9PA 1A3UA 4LWCA 1B9NA 4BY1G 1WJJA 2KQ3A 2KUMA 5DLQE 1Y1WB 3SK4A 3CCMA 2PMZB 5CV5A 4A3KB 4AYBE 3UDXA 1YHAA 2I0QA 1MGSA 2MHVA 4BXXG 1Q8KA 3K5MA 1YNXA 4Y7NH 2QILA 5D3DA 1AFPA 5K5PA 3CXCA 1LT5D 4HIOA 4RCOA 1STNA 4DAYA 5FLXL 1Q90A 2J7ZA 3TEHB 1KC8C 3RZOB 2EE1A 3CRKC 2WAQB 3F2DA 1JJGA 1JWSD 5C0XH 4NXNL 4OO1G 2UUCQ 1TWAB 1K3BC 2DGYA 2Z8LA 1J8IA 4LFCQ 1TWCH 2ES2A 2R7ZH 1HRJA 2EYLA 4B3TL 2VZAA 5KYLA 4TRDA 1D5ZC 2Q2TA 1SEBD 1JOOA 1W3SA 2NVYH 3CQZB 4HSVA 3P75A 5C4ZA 2LMCB 3CRLC 2NUCA 4A3FB 5DNFA 4HJ9A 3GTLB 5C6AA 2L15A 4GNXA 3SVMA 2UUAL 1YZ6A 4P74A 1M90C 3CPWA 5M5XB 1SFOB 2F03A 2DY7A 4JI0L 5FKAC 3CCUA 2K5NA 1P16A 4Y52H 5IP9G 1PH3A 2JA6G 1I4RA 1SE8A 3M4PA 1VQ7A 4BXXH 1AZQA 5FLMG 4NMZA 3OIPA 1K83B 3NP8A 1JICA 2DNEA 4A3IG 1EY7A 2C5CA 4JI4Q 2ICIA 3CCSA 1GJXA 1N33Q 1TWGB 5A35A 3M3YH 4CDCC 1V43A 1QE6A 2TSSA 4OO1H 4EX5A 4YWLA 2WP8J 1E2WA 3I4MG 1IL8A 3KLRA 3U50C 1NBWA 1A0IA 1U4LA 3GTQB 4IQZA 1WTWA 3S15B 1VQAA 2RDHA 1GUTA 1DCZA 3I56A 3OTOL 3I70A 4K2KA 4CHTB 3ONAB 3J7YW 2JA7G 1WTHA 3BG3A 1SYBA 1WYDA 4P2CB 3X3NA 5I4DA 3ZJYC 4A76A 3I4NB 4RGNA 2QA4A 3T1YL 2QGQA 3GTKB 3PSIA 4CDDC 2E2HB 1NR4A 1HR0W 4FXGC 1KDBA 1G91A 2AMCB 2IHEA 1RODA 5TSSA 1VQDA 1CTMA 2XSCA 2Y0SE 4YY3Q 2R7FA 2K28A 5IT9L 1LTSD 2A19A 1L0XB 2IY5B 5FLXc 1R4QB 1T5XD 5IP9H 2FXQA 5M5WB 2UU9L 4YWMA 4LUVA 2L5TA 5FLMH 2E2JB 5IYBG 1R9TH 2LY7A 4YIJA 4I65A 3TSSA 3M4QA 1QCBD 3VYTA 2VQEQ 4A3IH 4U68A 4DK0A 3J81L 4DR6L 4OIJA 4NB3A 3KOJA 1AH9A 1I50H 3S1QB 1PH1A 1FGUA 2JEBI 4N8X1 3L2PA 5D14A 3HEJA 2HCIA
chains in the Genus database with same CATH topology
2X6GA 2OEOA 1AN8A 1EU4A 5ELDA 1NR2A 1NUCA 2CVRA 4DAPA 4XTCS 5C4HA 1WTXA 3K6OA 2F0KA 4J1MA 1ICWA 1AP0A 1PFMA 2HQEA 2F0EA 2E75C 1CHPD 3JAML 4UAIA 2M00A 1S4ZA 2JEAI 3L9AX 1PFNA 4TKOB 3H91A 2DNCA 3SR1A 3D8GA 1SNPA 3HGBA 2B63B 1GUNA 1NAPA 3HOWB 2FMCA 1WD0A 3KUPA 3U9OA 5FO8B 3EA6A 1EL0A 1M4VA 2JA5B 2RKSA 3BVGA 4XXEA 4RCNA 5KNBA 1LTGD 3K5NA 3SK6A 5G3LF 3A8KE 3OWFA 1BCPB 4RA8A 4RAUC 2R61A 2X6LA 3IAYA 1JE4A 2Q8IB 1QNKA 1ZEQX 3A55A 1STGA 1WD1A 4OGQC 3M7GA 2EJMA 4LK1C 1O78A 1Y8NB 3K0YA 1F2MA 3NXWA 2A68D 4NDXA 4A93B 1JOQA 4CJ0B 2JA8B 1CI3M 5FOBB 1G2TA 3PO3B 1GHKA 1LT3D 4DNRB 1PZID 1DD2A 4O1NA 1JORA 2KA7A 1W6KA 1U9RA 2AQ1B 3HOUB 5EJWA 2R3ZA 1BXTA 1F77A 1CK1A 1TT2A 1D5MC 4TSSA 2VUMB 2F0NA 1TQOA 4HAEA 4XYOA 4F7XA 3RD4A 1DYQA 1I3QB 3I3CA 1PRTF 4RGMA 1V1OA 3TDQA 3S14B 5E4XA 2A68C 5C4XB 5EPKA 4ZUJA 3S17B 3BDCA 2FJ2A 1WCMB 3J80L 1IHZA 2PCFB 3FPPA 1LV9A 3NUCA 1RTNA 1AEXA 2F0FA 3D6CA 3T56B 3TBIB 4V190 3NQIA 2L1BA 1H9JA 2ID0A 3R8BA 2KJXA 3PUZA 1RTOA 3DHQA 3IFTA 3R93A 1R4PB 3PMFA 3A54A 1A15A 4QIWB 2E2IB 1PFBA 1B53A 1EWCA 4K2LA 1TIID 1TS5A 2LKVA 3PIP3 2ZT9C 5IGCA 2PYKA 3P1HA 1EWHA 1DOLA 2KEEA 3CU7A 4KD3A 3OOCA 1S5ED 2M9VA 3I73A 4NKLA 3FKIB 2EJGC 2J0TD 3D4RA 1SE2A 1I6HB 4XT3B 1GUOA 1BUVT 1EYDA 2LFNA 3K57A 4XDXA 3DMUA 3VYRA 2EY6A 4ZRZA 4KN4C 5ELBA 3NWSA 2R93B 1STYA 1ENCA 1C8CA 1HFGA 2RQXA 3NTIA 3H6MA 2A6HD 1FNWA 2EYOA 3BVMA 4KMUC 3HS0C 1Z6HA 1WTRA 4IUVA 3WOEA 1OO9B 1U4PA 1B4OA 1OXSC 1WTOA 4DFAA 3K59A 1G8ZD 5M3FB 2F3VA 2I46A 4G7OC 1B1ZA 4XIGS 1T5EA 3GTJB 2L4NA 4DN4M 3EROA 3NTKA 2WINB 1HFNA 2Z4HA 4OHJA 4IFDH 2A6HC 3VA7A 4CBVA 2AQ2B 5IGFA 4CKEA 4A3JB 2A73B 1G291 4FF4A 3MXNA 1RDPD 4DK1A 3FEWX 3LWEA 2H1EA 5EKIA 4IUPA 3HOZB 3MVVA 3W3AA 1UAPA 1GUSA 3VR2A 1I4XA 1Q1EA 1DM0B 2A5HA 1QILA 5IIFA 1DOKA 1HA6A 2RSNA 4IUUA 3N6RA 2R92B 4RKLA 1J9OA 5C0XI 5KGUA 4M8AA 3P20A 2NZ1D 1LT6D 3AU7A 2F0LA 2A6ED 1OXVA 1SNDA 2VB2X 3HOXB 4A3EB 3S2HB 4KV6A 1QNUA 1GUGA 3VR6A 4KI0A 1PRTC 3GTPB 4J8QA 3SEBA 2BDOA 1B44D 1F2LA 5J39A 4H44C 2B2UC 5I2XA 3BDLA 2JP1A 5JVH3 1O7ZA 4XQNA 2A6EC 2EYJA 1SXTA 3R2TA 4U673 1D6EC 4LAAA 1SE4A 4RH6A 1Z47A 4Q5VA 1S5BD 2MPMA 3SK8A 4JK1C 3PV0A 4J6HA 2WIIB 5CBEE 4OO1I 2OXPA 3I4LA 5M9OA 1Z7TA 4AYBB 4A3GB 3HRZC 4BY7B 1G6ZA 3E5SA 3H0GB 1ILQA 4R8IA 4K5XA 1RF2D 1DZ1A 3E0JA 3GTMB 3VA5A 1G2SA 1CZWA 1SYDA 1IKMA 2EDGA 1YNJD 3HOVB 4IZ8A 4TQUS 1TY0A 4PV1C 1F9QA 3OIQA 4KHZA 2QKIC 3KK7A 2K32A 1SYGA 3BYTB 5EBDA 4BA1I 1ILPA 4ZUIA 4L8JA 1NSNS 2KCCA 5CV9A 1O80A 3GTOB 1W6JA 4HSPA 2JXMB 1YNJC 3EJIA 3PIO3 2F0TA 2O5JC 4EVOA 3EFXD 4K6LA 2HCCA 5E1FA 2PW5A 2F0DA 5COYA 3NE5B 1DONA 4F87A 1EEFD 2EPBA 2FHTA 3S1RB 4RKBA 2PQEA 4ZKCB 1XTCD 4BBRB 3QOJA 5DEHA 2K5WA 1ML0D 3H94A 4PQXA 3IFDA 1AW7A 3SE0A 2B2YC 4IALA 4F88A 2F0QA 2F1MA 1HQMC 1E2ZA 1CQFA 2F0HA 1SE3A 4HMIA 1PDQA 2XNAC 4BWGB 3OMCA 1JCKB 2K33A 3NK9A 1VCIA 2MP1A 5E3FA 1PZJD 2L9HA 2Y0SB 4ID6A 3E6ZX 3MTSA 1QJOA 5FLXE 3L3OC 2XVSA 4FF2A 2IWHA 5C3EB 1BCPD 4A3DB 4K6DA 4DU9A 1D1IA 1JOKA 1NCVA 3RZDB 2D62A 3A7LA 3OMGA 3D3RA 4RWSC 4ULLA 5C5MA 3HZXA 4C3HB 2NVTB 2L0CA 5C0XJ 4BA2I 1IW7D 2SEBD 4CJ2C 1F9RA 1BCPC 3ERQA 4ZYSA 2OT2A 1VMPA 5M3MB 4FXDA 3KLSX 3H09A 5J22A 2QCPX 1LO5D 3TN2A 5M5YB 4KKSA 3X3MA 4M1UB 2KCNA 3K58A 3O13A 4IUTA 2V4DA 5ISRA 4HCSA 5A2QL 5JPNC 5JJZA 3V96A 3V2TA 2NN6H 1IW7C 2AWOA 1D1KA 4X3KA 3DWAA 1JC7A 1HTLD 5IGEA 2XRSD 4DAVA 4UDUC 2K6AA 3V05A 1H9SA 1DOMA 2K1BA 4C2MB 2SDFA 4IUQA 1KABA 3P7JA 2X69A 3Q22A 2D5DA 1X3PA 4K5VA 3AMUA 4B08A 3D31A 5IT9E 2EZVA 1LTAD 1HUMA 5EPJA 1UEAB 3BYYB 3OHXC 1IYVA 4S3SA 2B2WC 3RMHA 3A7AB 1KNAA 3T53B 3NTHA 3GTGB 1TU2B 2M2LA 1PTOB 3DEOA 1HA5A 2NWGA 5KEEA 4KD4A 3TMEA 2QEJC 5CGKA 3PUWA 5I6YA 4ILWA 2YYZA 3MFGA 4G7ZC 4G7HC 3URYA 1F9SA 3VR5A 3U9SA 1SYFA 1LLRD 1I6VC 1E0BA 1K8OA 5JPMC 4GZYC 3HG9A 4RFBA 3TZUA 1JWUD 4K14A 3R3OA 5BN3A 3K7AB 4PNYA 4HR7B 4XYQA 4PMCA 1TWHB 1TS3A 2K5DA 1LTID 2AWNA 4IFDI 4B9WA 2EJFC 1AZPA 1F2ZA 1Q1BA 1A2TA 5EPLA 1EY6A 5IGBA 2B8GA 5IGDA 3S1MB 4JBWA 4C1NI 1Y1VB 1X3QA 2C9OA 3QO2A 1TWFB 3TP8A 2XN9C 4HCEA 2F0JA 1RJTA 2KVMA 4ZLTF 1H9SB 2ENBA 1I4GA 2IX0A 1WVLA 3VR3A 1VMCA 3KF8A 1CA5A 1ZXTA 1HPCA 1Y69U 4C56C 5KYIA 3DM1A 5JEAG 5DM63 1H9KA 2RSOA 5CV7A 2Q8TA 3QIAA 5BN5A 3MXPA 4ABNA 4L63B 3C3LA 1C48A 4KN7C 4WRDA 1HTPA 2O5IC 3SK5A 1BO0A 4IFDG 1VF5C 4PMWA 1Y8OB 1F2YA 3GQBA 4OL7A 4PMBA 1O7LA 3NHHA 3QWNA 2XWBB 4EGVA 2B2TA 4FO2A 1FYCA 3WDNA 4WJWA 4ZQ3A 1BBXC 1A3TA 4WFN3 5C44B 1A2UA 2F0VA 4R9WA 3T13A 3I72A 4G4KA 3J80E 4A3BB 1DXMA 1A6XA 2E74C 5C5LA 2R7ZB 2L55A 1MSGA 1KLUD 1TKWB 3CKIB 2EYPA 3NWTA 3VR4A 5JEAH 1SMYD 2AUJD 2IPKD 2HDLA 4CKBA 1TY2A 3ZYYX 4H13C 5KNCA 1CFMA 3D4DA 4BY1B 4NW2A 2O2LD 2B39A 1SYCA 2WKCA 1RKNA 1Q3LA 1S5DD 1S5CD 3VYSA 3LWUA 5FK9C 5C4JB 1PXUA 4FVMA 1JB3A 1EZ8A 1ET6A 2NVQB 4RGOS 1SMYC 4MN3A 3KLSA 2RA4A 4RHSA 1C4QA 4FYDA 1ONLA 3M85A 3MC0B 1B9MA 2AUKA 4KKTA 1SDFA 1SNQA 3IL8A 4MIUA 3EQLC 3C46A 3S2DB 3GD7A 3SDZA 1GUWA 2B2UA 2RBMA 1EIGA 2WACA 3DEPA 2IJ0A 3OPOA 3FDTA 1KNEA 2JA6B 1HXYD 2K5QA 5KNDA 1SBBB 2B2VA 3MEHA 1RD9D 1MI2A 2BA0A 2KEDA 4I7ZC 1SSOA 1XYIA 3VYUA 5J1ZA 3G6JB 1QOHA 3MFYA 1BCPF 5JAVA 5LL6X 5T1IA 1I50B 5EQ0A 4HEDA 1OXTA 3H3VC 3EVQA 1LTBD 3I4MB 4R8NA 1V1PA 5CC4A 1MBYA 2EY5A 3OW7A 4IFDJ 4X3UA 2VXWA 4EQPA 3CHBD 3S9WA 2JA7B 2SOBA 5D65A 2K03A 3HOYB 1JQYD 4IURA 3F2UA 1Q12A 1RCVD 3FMCA 3GV3A 2RVLA 5CYUA 4FF1A 1MD2D 1V8QA 2F0OA 4CKCA 1ET9A 1QG7A 4LJZC 4EQOA 4C3JB 5ELFA 2WV6D 4E6IA 5EKLA 2RDGA 5CBAE 1CZGA 3N52A 1HQRD 3BVZA 2XIWA 1PRTB 3DWQA 1PYWD 3MZ5A 4Q0FA 3J7AF 1JWMD 3R2IA 4N9PA 2QDBA 2DY8A 1EZ6A 2BCOA 3BS1A 2NN6I 2HDMA 4XT1B 2B2YA 5EBCA 4HTHA 1RHPA 1MSHA 1BOSA 2BDNA 5CV8A 2R6GA 4XQJA 2DN8A 1PLFA 3UI2A 4IUNA 3OWEB 4BBSB 3DXJC 3T4AC 2IX1A 1V1PB 3MXUA 2EOTA 3OSOA 3A8JE 1EOTA 2KECA 2FFKB 5K36G 2L12A 4K5WA 3NBHA 2AQ3B 1BQQT 1ZKOA 1CM9A 2F0IA 3WOFA 1UUPA 1D5XC 3GP7A 3DUZA 3NPPA 2LS01 1KLGD 2NN6G 2FINB 3D4WA 1VF7A 1ESRA 2ZXRA 1PTOD 5CMDA 5AFWA 1IYUA 3PUVA 2JE6I 1FD7D 4EQNA 4DGZA 2MGSA 4L6TB 1SNMA 1TS4A 4DF7A 1B2TA 2IT1A 2PPBC 2KHSA 2PZWA 2D2CC 4CJ1B 2EY1A 3I8ZA 2CW0D 1PZKD 3G7LA 1LABA 4B9XA 3HKZB 3M4YA 2ICEC 4N9TA 5EGTA 1I4PA 5DAUA 3LX0A 2FMMA 2NB0A 2PO4A 3MXGA 1PTOC 2PW7A 2B8FA 1QB5D 5K36H 4MHEA 2EXZA 2PZTA 3Q23A 4LMQD 4F8MA 2IW3A 1Y8PB 2EY2A 5JOBA 1JR0D 3PUYA 5T1GA 4C3JG 2RDFA 1K8MA 3W2DA 3TZDA 4CGYB 1ESFA 1TS2A 2K05A 3T16A 1KDCA 2CW0C 2I07B 2NYZD 5I2YA 5ELCA 2NTTA 1UNSA 1PMRA 5FO9B 1A3VA 2JYOA 1LTTD 4K8IA 4ODGA 3ND9A 4RHRA 3Q24A 2F0WA 3SXHA 2KOLA 1CT1D 5BN4A 4ZAIA 4ZK9B 1SAPA 1B3AA 1HCZA 1EFID 4IN3A 3NQTA 4QMGA 1YNND 1Q8IA 3A56A 2B2WA 3KBXA 2EYHA 3FRPB 3QB3A 2EVBA 4DA2A 4DNTB 1OXUA 2YU9B 4QB4A 1STBA 3J81E 4H7BA 4KY5A 5FO7B 1FR3A 1FGBD 3Q0AA 5HGTA 5D3IB 5E4WC 1II3A 3KBGA 5A2QE 1YNNC 4FNFA 4RGTA 5KRUA 3QJYA 1BNZA 4DXGA 1WTQA 1ENFA 5I9PA 1ZYRD 1EQVA 1EU3A 1EY8A 4KJNA 1LT4D 2GA4B 3JAME 3MHBA 1FNUA 5IODA 2XRQD 4WORA 1KDAA 3T51B 4G57A 4C3HG 1TVXA 2HUGA 1EY9A 4NP5A 4KY7A 2ZXPA 5CV6A 3RLFA 3GV6A 4QF4A 1X32A 1CQVA 2G9HD 3FVQA 1ZYRC 5IGGA 2XWJB 1S5FD 1STAA 2F0MA 1ENAA 1XX8A 2D9UA 4O42A 3K5OA 1CHQD 4KKUA 1U4MA 4A3MB 4FXKC 3TP6A 2Z1CA 1BR9A 4XQQA 4QUCA 1H9MA 5I6WA 5I9OA 2TMPA 2A69D 3M4OB 1U4RA 1EY4A 2BA1A 3PO2B 3QG1A 1EYAA 1VDZA 3J7AV 4KY6A 1EEID 3A8IE 4K8JA 2WKDA 4QCLA 3AB9A 4FF3A 4C3IB 1DJRD 1EYCA 2E2DC 4X3TA 1XXGA 2F3WA 3HP3A 5ELEA 2BE5D 3MA2B 1HUNA 4X3SA 2F0GA 2IX3A 2E76C 5NUCA 2A69C 1FNVA 2Z4IA 4Y7NB 4KK7A 4KTAA 5DM73 1EY5A 1I4HA 1BF4A 1D2BA 1OXXK 1SYEA 1CA6A 1M8AA 4C1NK 5KIXA 4HN7A 3RUZA 2VB3X 1GOZA 2F0PA 1TWCB 5JVG3 2MUYA 5LHY1 2BE5C 5G3LD 1SJHD 2B2TC 4DXFA 2EYFA 2ZXOA 2CHBD 2NVYB 2MJ8A 1GXDC 2WB1B 2A74C 1BDOA 3BDOA 3M7NA 2F0SA 1STEA 1SNOA 2O4XA 1SNCA 3L7ZC 3C1FA 3D6WA 1XWEA 4BS9A 2JSOA 3K5LA 3ITPA 1WTPA 1SJED 4V0BA 3NBIA 3ND8A 1QWYA 1EY0A 4KJOA 4HMJA 3C2PA 3M3YB 1TR5A 1LTRD 3BZDB 2Q8RE 2CQAA 5CORA 1PTOH 1O7YA 1PRTD 5C3XA 4KHVA 5EKKA 2G9DA 5CR3A 2L11A 4OIKA 2BOSA 2NTSA 3SHLA 1IKLA 1H9RA 2F4IA 4Z9CB 2SNMA 2N55A 4FP5D 2K04A 3TP5A 3QOLA 3PUXA 3Q6SA 1EIHA 1LACA 1WTVA 3IKJA 1R9TB 1STHA 3C1EA 4ME5A 3MAQA 2PZUA 5C3WA 3GO5A 4A3IB 4C3IG 2H4OA 5JEAJ 2PNRC 3MWYW 4QUFA 5IOCA 1GHJA 3DWPA 2N88A 3FPUB 5HURA 3S1NB 1PTOF 4ZKBB 2QF7A 1I4QA 5CV4A 1E2VA 2B2VC 5LL6S 2K7VA 1HHVA 1L0YB 3I91A 3NSWA 3S16B 2VNUD 5C0XG 5F2DA 1B50A 3TP7A 2SNSA 2EYMA 1KTKA 2K01A 2IL8A 2J4XA 3LNNA 2NVXB 4H0LC 1EQTA 1KAAA 2F0UA 2NBFA 2OF1A 3I90A 1F9PA 1A3UA 1B9NA 2KQ3A 2KUMA 1Y1WB 3SK4A 2PMZB 5CV5A 4A3KB 1MGSA 2MHVA 3K5MA 2QILA 5D3DA 1AFPA 5K5PA 1LT5D 4RCOA 1STNA 4DAYA 5FLXL 1Q90A 2J7ZA 3RZOB 2EE1A 3CRKC 2WAQB 1JWSD 5C0XH 4OO1G 1TWAB 2Z8LA 1J8IA 1HRJA 2EYLA 5KYLA 4TRDA 1D5ZC 1SEBD 1JOOA 3CQZB 4HSVA 3P75A 5C4ZA 2LMCB 3CRLC 2NUCA 4A3FB 5DNFA 3GTLB 5C6AA 3SVMA 5M5XB 1SFOB 2F03A 2DY7A 5FKAC 1I4RA 1AZQA 4NMZA 3OIPA 1K83B 3NP8A 1JICA 2DNEA 1EY7A 2C5CA 2ICIA 1GJXA 1TWGB 5A35A 1V43A 1QE6A 2TSSA 4OO1H 2WP8J 1E2WA 1IL8A 3KLRA 1U4LA 3GTQB 4IQZA 1WTWA 3S15B 2RDHA 1GUTA 1DCZA 3I70A 4K2KA 4CHTB 3ONAB 3J7YW 3BG3A 1SYBA 4P2CB 3X3NA 5I4DA 3I4NB 4RGNA 3GTKB 2E2HB 1NR4A 4FXGC 1KDBA 1G91A 1RODA 5TSSA 1CTMA 2XSCA 5IT9L 2K28A 1LTSD 1L0XB 1R4QB 1T5XD 5M5WB 2L5TA 2E2JB 2LY7A 4YIJA 4I65A 3TSSA 1QCBD 3VYTA 4U68A 4DK0A 3J81L 4OIJA 3S1QB 2JEBI 5D14A 3HEJA 2HCIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KJX A; 
#chains in the Genus database with same CATH topology
 2RCN A;  2X6G A;  4LF9 L;  2OEO A;  4QY7 A;  3S1N H;  1AN8 A;  1EU4 A;  4JI5 L;  1SRO A;  1ICF B;  5ELD A;  1NR2 A;  1UE7 A;  4JVZ A;  1YJW A;  1NUC A;  2VQF L;  4GNX B;  3HKZ E;  3DM3 A;  4J15 A;  2CVR A;  2JA7 H;  4DAP A;  4XTC S;  5C4H A;  1WTX A;  3K6O A;  2F0K A;  4J1M A;  1ICW A;  1AP0 A;  1PFM A;  2HQE A;  3S16 H;  2F0E A;  4AIM A;  2E75 C;  5BR8 L;  1CHP D;  2VW9 A;  1G51 A;  1LTL A;  4L5T A;  1PYB A;  3JAM L;  4UAI A;  4NXM Q;  2M00 A;  1S4Z A;  3J81 j;  1XNQ Q;  4LF4 Q;  2JEA I;  3L9A X;  4LFA Q;  1PFN A;  4TKO B;  3H91 A;  1EWI A;  4GS3 A;  2DNC A;  4DV7 L;  2NVX H;  3E0E A;  3SR1 A;  2Q2I A;  3D8G A;  4OON A;  1SNP A;  3HGB A;  5IYB H;  3M9B A;  1GUN A;  1NAP A;  3QR8 A;  2FMC A;  4DR1 L;  1WD0 A;  3KUP A;  1IBL L;  3HOW B;  3U9O A;  5FO8 B;  4A3F G;  3EA6 A;  1EL0 A;  1M4V A;  1HNZ Q;  2JA5 B;  2RKS A;  4UPA A;  1SMX A;  3BVG A;  4XXE A;  4RCN A;  1X55 A;  5KNB A;  1LTG D;  3K5N A;  3HKS A;  3SK6 A;  5G3L F;  1CKM A;  3A8K E;  1K3R A;  3OWF A;  1BCP B;  1Y1W H;  1MIU A;  4RA8 A;  5LMU L;  4RAU C;  2R61 A;  2X6L A;  5JJK A;  1BBW A;  3IAY A;  1JE4 A;  2Q8I B;  1QNK A;  1ZEQ X;  3A55 A;  1STG A;  1WD1 A;  4OGQ C;  3M7G A;  3RZO H;  2EJM A;  4LK1 C;  5IT9 c;  1O78 A;  4LW1 A;  1Y8N B;  3K0Y A;  4WJ3 M;  3DLL A;  1F2M A;  3NXW A;  2A68 D;  4NDX A;  3KJP A;  4A93 B;  1TWA H;  1XMO L;  1JOQ A;  4CJ0 B;  2JA8 B;  1CI3 M;  4KHP L;  5FOB B;  3WWV A;  1G2T A;  3PO3 B;  1GHK A;  1LT3 D;  4DNR B;  3J81 c;  4APV A;  1PZI D;  1DD2 A;  1O7I A;  4O1N A;  1JOR A;  2KA7 A;  1W6K A;  1EUJ A;  1U9R A;  2AQ1 B;  3HOU B;  5EJW A;  1K0R A;  2R3Z A;  1BXT A;  1F77 A;  3CQZ H;  1CK1 A;  1TT2 A;  1D5M C;  4TSS A;  4A3F H;  2E5L Q;  2VUM B;  3GTL H;  2F0N A;  1VQK A;  1PH6 A;  1Q46 A;  1TQO A;  4HAE A;  4XYO A;  3T1H Q;  4F7X A;  3RD4 A;  1DYQ A;  1I3Q B;  5M5X H;  1SFO H;  3I3C A;  3RN5 A;  1PRT F;  4RGM A;  4P71 A;  3J7Z C;  1V1O A;  5IYD G;  4R4C A;  3TDQ A;  5E4X A;  5LMN W;  3S14 B;  2A68 C;  2GN5 A;  5C4X B;  5EPK A;  4ZUJ A;  3S17 B;  3BDC A;  2D0P A;  2FJ2 A;  4HJ7 A;  4OEL B;  1WCM B;  4YCU A;  3J80 L;  1K83 H;  1IHZ A;  2ZM6 L;  2PCF B;  4R4I A;  1IBK L;  1BVS A;  2Z6K C;  3FPP A;  1LV9 A;  2QDL A;  4L5R C;  3NUC A;  3JAM c;  4DV5 L;  1RTN A;  1AEX A;  2F0F A;  3D6C A;  3T56 B;  3TBI B;  5H1S E;  4V19 0;  3NQI A;  2L1B A;  2LXK A;  1H9J A;  2ID0 A;  2UXC Q;  3R8B A;  2KJX A;  3PUZ A;  1RTO A;  3DHQ A;  3IFT A;  3R93 A;  1R4P B;  3PMF A;  3GTQ H;  3S15 H;  3A54 A;  1HZB A;  4JBM A;  1A15 A;  2LSS A;  4QIW B;  4LF5 L;  2E2I B;  1PFB A;  1B53 A;  1EWC A;  4K2L A;  1TII D;  1TS5 A;  4LF7 Q;  2LKV A;  3PIP 3;  3CCJ A;  2H5X A;  2ZT9 C;  4JOI C;  5IGC A;  2PYK A;  3P1H A;  1EWH A;  4R4Q A;  1DOL A;  1U0L A;  2KEE A;  3CU7 A;  4KD3 A;  1GKH A;  3K8A A;  3OOC A;  1S5E D;  2M9V A;  3I73 A;  5LMN L;  2E2H H;  4NKL A;  3FKI B;  1YBY A;  2K14 A;  2K5V A;  2EJG C;  5IYD H;  2B3G A;  1QZH A;  4DK6 C;  2J0T D;  3D4R A;  1SE2 A;  1I6H B;  4XT3 B;  1PFS A;  1GUO A;  5M5W H;  4OWW B;  1BUV T;  1EYD A;  1SLJ A;  2LFN A;  3K57 A;  4XDX A;  2E2J H;  3DMU A;  3VYR A;  2EY6 A;  1SR3 A;  3I4O A;  4ZRZ A;  5GQO A;  1JT8 A;  4KN4 C;  2JA5 G;  4IPC A;  5ELB A;  3NWS A;  2R93 B;  4AH6 A;  1STY A;  3S1Q H;  1E1T A;  1ENC A;  1HZC A;  1VQE A;  1C8C A;  2EIF A;  1HFG A;  2RQX A;  1E1O A;  3NTI A;  5GAD C;  3H6M A;  1CSQ A;  2A6H D;  1FNW A;  2EYO A;  3BVM A;  4KMU C;  4PZ7 A;  3HS0 C;  1Z6H A;  1WTR A;  2KBN A;  1JJ2 A;  2E8G A;  4IUV A;  3WOE A;  1N36 Q;  1OO9 B;  1U4P A;  1B4O A;  4DV3 Q;  1OXS C;  1WTO A;  4DFA A;  2QW7 A;  3K59 A;  1D8L A;  1RIP A;  3F2C A;  1G8Z D;  5M3F B;  2F3V A;  2YV5 A;  3UE0 A;  2V1C C;  2I46 A;  4G7O C;  1B1Z A;  4XIG S;  1T5E A;  3GTJ B;  2L4N A;  4DN4 M;  3ERO A;  3NTK A;  4GOP A;  1VQ4 A;  4A93 G;  1PH9 A;  2WIN B;  1HFN A;  2Z4H A;  3F1Z A;  3OYY A;  3PO3 G;  4OHJ A;  4IFD H;  2A6H C;  4LF6 Q;  1IZ6 A;  3VA7 A;  2ATW A;  4CBV A;  2CWP A;  2AQ2 B;  5IGF A;  4CKE A;  4K0K L;  4A3J B;  4LF8 L;  2A73 B;  1G29 1;  1UE6 A;  3HOW H;  4FF4 A;  3MXN A;  5ELO A;  1RDP D;  3NEL A;  3FEW X;  4DK1 A;  3LWE A;  2H1E A;  5EKI A;  4IUP A;  3HOZ B;  3MVV A;  3W3A A;  2VUM G;  1UAP A;  2JA5 H;  1GUS A;  3ULP A;  4JI2 L;  4JW0 A;  3VR2 A;  4HID A;  1I4X A;  1Q1E A;  1DM0 B;  2A5H A;  2F4V L;  1QIL A;  5IIF A;  4HIM A;  1DOK A;  4POG A;  1HA6 A;  2RSN A;  4IUU A;  3N6R A;  1PH2 A;  1N32 Q;  2R92 B;  4RKL A;  1J9O A;  3G4S A;  5C0X I;  5HY6 A;  4GN5 A;  5KGU A;  1WCM G;  4M8A A;  3P20 A;  2NZ1 D;  1LT6 D;  1SRU A;  5J3B A;  1FJG L;  3AU7 A;  2F0L A;  2A6E D;  1OXV A;  4JI0 Q;  1SND A;  2VB2 X;  3HOX B;  1I5F A;  4A3E B;  2AHO B;  3S2H B;  4KV6 A;  1QNU A;  1GUG A;  1ASY A;  3VR6 A;  4KI0 A;  1PRT C;  3GTP B;  4J8Q A;  4A93 H;  4B3S L;  5FJ8 G;  3SEB A;  2BDO A;  1VQ5 A;  5L37 A;  1B44 D;  1F2L A;  2PI2 E;  3NEN A;  3PO3 H;  5J39 A;  4H44 C;  2B2U C;  5I2X A;  3AEV A;  1Q86 C;  3BDL A;  2JP1 A;  5JVH 3;  1O7Z A;  4XQN A;  2A6E C;  2VUM H;  2EYJ A;  1SXT A;  3R2T A;  3W5O A;  4U67 3;  1D6E C;  4LAA A;  1SE4 A;  1I3Q H;  3FKI G;  3OTO Q;  4RH6 A;  1Z47 A;  1KL9 A;  3S14 H;  4Q5V A;  1S5B D;  3L0O A;  2QEX A;  3PGZ A;  2MPM A;  3SK8 A;  4JK1 C;  1VQM A;  3PV0 A;  1NY4 A;  4LFB L;  4J6H A;  3PF4 A;  3S17 H;  2WII B;  1T9H A;  5CBE E;  1WCM H;  4OO1 I;  3TQY A;  2ZJQ A;  4DR5 Q;  2OXP A;  4GOP B;  3I4L A;  5M9O A;  1Z7T A;  1V9P A;  4AYB B;  4B3M L;  4A3G B;  3HRZ C;  4BY7 B;  1G6Z A;  2R93 G;  4ZCK A;  4DR7 L;  3E5S A;  3H0G B;  1ILQ A;  4X65 Q;  3CC4 A;  4R8I A;  4K5X A;  1RF2 D;  2A8V A;  3E0J A;  3GTM B;  3VA5 A;  4JI6 L;  1DZ1 A;  1HNW Q;  4JG2 A;  2XGT A;  4JI1 L;  4DV6 L;  1G2S A;  1CZW A;  5FJ8 H;  3SGI A;  1SYD A;  1C0A A;  2EDG A;  1IKM A;  1YNJ D;  4IO9 A;  3J7A 5;  1MKH A;  3HOV B;  4JI8 L;  4IZ8 A;  3I2Z A;  4TQU S;  2E2I H;  1TY0 A;  4PV1 C;  5AJ3 L;  1XNR L;  1N34 L;  1F9Q A;  3OIQ A;  3K80 C;  4KHZ A;  4X64 L;  2QKI C;  3KK7 A;  1X65 A;  2K32 A;  1SYG A;  4JI5 Q;  3BYT B;  5EBD A;  4BA1 I;  1ILP A;  1X6O A;  5GRO A;  3FKI H;  3RR5 A;  4ZUI A;  4L8J A;  1NSN S;  3PF5 A;  2KCC A;  5CV9 A;  1O80 A;  3GTO B;  4DV1 L;  1W6J A;  4HSP A;  1GM5 A;  1HR0 Q;  4JYA L;  2JXM B;  1YNJ C;  3EJI A;  3PIO 3;  1B70 B;  2F0T A;  2O5J C;  4EVO A;  4JI3 L;  3EFX D;  4K6L A;  1NMG A;  1A63 A;  2HCC A;  2XTI A;  5E1F A;  3HOZ G;  3KDF A;  2PW5 A;  2F0D A;  2R93 H;  5COY A;  1E24 A;  3NE5 B;  2OTL A;  2VL6 A;  1DON A;  1B8A A;  4AQY L;  4F87 A;  1EEF D;  2EPB A;  2FHT A;  3S1R B;  4RKB A;  2PQE A;  4ZKC B;  1XTC D;  4BBR B;  4DR1 Q;  3QOJ A;  5DEH A;  1PVO A;  2K5W A;  4DR2 Q;  3IRB A;  1ML0 D;  3H94 A;  1IXR A;  2I5M X;  4PQX A;  3IFD A;  1AW7 A;  3SE0 A;  2B2Y C;  4MTK A;  4DV0 L;  4IAL A;  4F88 A;  2F0Q A;  3HOX G;  2F1M A;  4A3E G;  1HQM C;  1E2Z A;  1CQF A;  2HIV A;  4JI7 Q;  2YTX A;  2F0H A;  1SE3 A;  4HMI A;  2CKZ B;  1EQQ A;  2RHS B;  1UWV A;  1GO3 E;  1PDQ A;  2XNA C;  2HIX A;  3OMC A;  4BWG B;  5EAY A;  1JCK B;  2K33 A;  3NK9 A;  1VCI A;  2MP1 A;  4GNX C;  5E3F A;  4A3J H;  1PZJ D;  2L9H A;  1J5E L;  2Y0S B;  4ID6 A;  2ZJP A;  3E6Z X;  3MTS A;  3HOZ H;  1VQG A;  5IP7 G;  1N9W A;  1QJO A;  5FLX E;  1YJ9 A;  2UUB Q;  4UHV A;  3L3O C;  2XVS A;  4FF2 A;  2IWH A;  1VQJ A;  5C3E B;  1BCP D;  2I5L X;  1HNX L;  4A3D B;  4K6D A;  4PZ8 A;  4DU9 A;  1D1I A;  2R92 H;  2HHH L;  1JOK A;  1NCV A;  3RZD B;  2D62 A;  3ICE A;  1Q81 C;  1QUQ A;  2UXB L;  3A7L A;  3OMG A;  1IBM Q;  1A8V A;  3D3R A;  4RWS C;  1YEZ A;  4ULL A;  3CPF A;  5C5M A;  3HZX A;  4AYB G;  4C3H B;  4A3G G;  4BY7 G;  3HOX H;  2NVT B;  2L0C A;  3PIP A;  3H0G G;  4A75 A;  4A3E H;  3S2H H;  5C0X J;  4DAY B;  2YTY A;  4BA2 I;  1IW7 D;  2F3I A;  2SEB D;  3GTP H;  4MZ9 A;  4CJ2 C;  2MO0 A;  1F9R A;  1BCP C;  3ERQ A;  1YHQ A;  2CFM A;  4R1J A;  3CW2 C;  4ZYS A;  2OT2 A;  1VMP A;  5M3M B;  1BBU A;  4FXD A;  3KLS X;  3H09 A;  5J22 A;  2QCP X;  1LO5 D;  3LGJ A;  3TN2 A;  5M5Y B;  4KKS A;  3X3M A;  4M1U B;  2KCN A;  1I94 L;  3K58 A;  3O13 A;  1Y1W G;  4IOC A;  4IUT A;  5IP7 H;  2V4D A;  4A3K G;  5ISR A;  1PH7 A;  4HCS A;  4OX9 L;  5A2Q L;  5JPN C;  5JJZ A;  4HJ8 A;  3V96 A;  3V2T A;  4B3R L;  2NN6 H;  1IW7 C;  2AWO A;  2JK8 A;  1VQL A;  1D1K A;  3KJO A;  3U4V A;  4X3K A;  4JBK A;  2WAQ G;  1XJV A;  2MNA A;  5LMN Q;  3TRZ A;  3DWA A;  1JC7 A;  1L2F A;  1HTL D;  5IGE A;  2XRS D;  4A3G H;  2ZTD A;  4BY7 H;  4DAV A;  4UDU C;  3CF5 A;  3H0G H;  2K6A A;  1XMQ L;  3V05 A;  1H9S A;  1DOM A;  4GN4 B;  2K1B A;  4C2M B;  2SDF A;  3GTM H;  4IUQ A;  2PNH A;  1PH5 A;  1KAB A;  1K73 C;  3P7J A;  2X69 A;  3PQI A;  3Q22 A;  1PH4 A;  2D5D A;  1X3P A;  4K5V A;  3AMU A;  4LNQ A;  4B08 A;  3HOV H;  3D31 A;  2N49 A;  5IT9 E;  1KXL A;  2EZV A;  1LTA D;  4LFC L;  1HUM A;  2KCT A;  4DNI A;  5EPJ A;  2MO1 A;  1UEA B;  3BYY B;  3OHX C;  1IYV A;  4S3S A;  2B2W C;  3RMH A;  4A3K H;  3A7A B;  1KNA A;  3T53 B;  3NTH A;  3GTG B;  1TU2 B;  2M2L A;  2JJQ A;  4N8F A;  1PTO B;  3DEO A;  1QUQ B;  1HA5 A;  2NWG A;  5KEE A;  4KD4 A;  1W2B A;  3TME A;  2QEJ C;  5CGK A;  3PUW A;  5I6Y A;  4ILW A;  2YYZ A;  1UEB A;  3AYH B;  3MFG A;  2P5Z X;  4G7Z C;  4G7H C;  3URY A;  1F9S A;  3VR5 A;  3U9S A;  1SYF A;  1K8A C;  1VQ6 A;  2RCF A;  1LLR D;  1I6V C;  1E0B A;  2PQA A;  4DUZ L;  5C3E G;  3RLN A;  3H3V H;  1K8O A;  5JPM C;  4GZY C;  3HG9 A;  4K0K Q;  4RFB A;  4JI4 L;  1X3G A;  3TZU A;  1JWU D;  4K14 A;  5IY0 A;  1E3P A;  1N33 L;  3R3O A;  3STB D;  5BN3 A;  3K7A B;  4DUY Q;  3I4N G;  4PNY A;  4HR7 B;  4XYQ A;  4PMC A;  2CQO A;  2F4V Q;  1TWH B;  1TS3 A;  2K5D A;  1LTI D;  2AWN A;  4IFD I;  4B9W A;  1BKB A;  2EJF C;  1VQC A;  1AZP A;  1F2Z A;  1Q1B A;  1A2T A;  1PV4 A;  5EPL A;  4HJA A;  1TXY A;  1EY6 A;  4POF A;  1CSP A;  3F8T A;  1JJC B;  5IGB A;  2B8G A;  5IGD A;  2N8N A;  3S1M B;  4JBW A;  1Y1V B;  1X3Q A;  4C1N I;  3W1G A;  2C9O A;  3QO2 A;  1TWF B;  3TP8 A;  2XN9 C;  4HCE A;  3STB C;  2F0J A;  1QVC A;  1RJT A;  1TWG H;  2KVM A;  4ZLT F;  4YY3 L;  1H9S B;  2ENB A;  1HZA A;  1I4G A;  2IX0 A;  4GLA C;  1WVL A;  3VR3 A;  1HZ9 A;  1NMF A;  2CWA A;  4JOI A;  5C3E H;  1B3Q A;  4GKJ Q;  1VMC A;  3KF8 A;  1CA5 A;  2PI2 A;  1ZXT A;  2VQE L;  3CCE A;  1HPC A;  2UXD L;  3BZC A;  1Y69 U;  1HH2 P;  1D7Q A;  4C56 C;  5KYI A;  4YHH Q;  3DM1 A;  5JEA G;  3I4N H;  5DM6 3;  3KLW A;  1H9K A;  2RSO A;  5CV7 A;  3RZD H;  1VQH A;  3QIA A;  4PG3 A;  2Q8T A;  5BN5 A;  1VQ8 A;  3GTK H;  3MXP A;  4ABN A;  4L63 B;  4DR3 Q;  3C3L A;  1C48 A;  4KN7 C;  4WRD A;  2NVT H;  1HTP A;  4X62 L;  2O5I C;  3SK5 A;  1BO0 A;  3A5Z B;  3EN2 A;  4DR4 Q;  4IFD G;  1YIJ A;  1VF5 C;  4PMW A;  1Y8O B;  1F2Y A;  3GQB A;  4OL7 A;  4PMB A;  1O7L A;  3NHH A;  4O0A A;  3U4Z A;  2RHQ B;  2B63 G;  3QWN A;  3HOW G;  4WJ4 A;  2XWB B;  4EGV A;  2B2T A;  2Q2H A;  4FO2 A;  4RG1 A;  3PCO B;  4X66 L;  3VDY A;  5M3M H;  1FYC A;  3WDN A;  4WJW A;  4ZQ3 A;  1BBX C;  1A3T A;  3EBE A;  1H95 A;  4WFN 3;  5GAH C;  5C44 B;  1A2U A;  2F0V A;  2PQA B;  4R9W A;  4JI6 Q;  5M5Y H;  1XNQ L;  3T13 A;  4LF4 L;  3I72 A;  4G4K A;  3J80 E;  3PIO A;  5JJI A;  3RLO A;  4A3B B;  4ALP A;  1DXM A;  1WFQ A;  4JI8 Q;  1A6X A;  3AQQ A;  2E74 C;  5C5L A;  1XNR Q;  2L55 A;  1MSG A;  2R7Z B;  1HNZ L;  1KLU D;  1A62 A;  1TKW B;  3RN2 A;  3CKI B;  2EYP A;  3NWT A;  3VR4 A;  5JEA H;  1SMY D;  2AUJ D;  1WOC A;  2IPK D;  2HDL A;  4CKB A;  3CC2 A;  1TY2 A;  2C35 B;  2JA8 G;  3ZYY X;  4H13 C;  5KNC A;  1CFM A;  3D4D A;  4DV1 Q;  4BY1 B;  4NW2 A;  4C2M H;  2O2L D;  3ULL A;  1FL0 A;  2B39 A;  3G48 A;  4JV5 L;  3HOU G;  1SYC A;  2WKC A;  1RKN A;  4JI3 Q;  4NXN Q;  2B63 H;  1Q3L A;  1S5D D;  1S5C D;  3VYS A;  3TRE A;  3LWU A;  5FK9 C;  5C4J B;  1PXU A;  4FVM A;  1JB3 A;  1EZ8 A;  4B3T Q;  1ET6 A;  3EIV A;  4AQY Q;  4MTN A;  2NVQ B;  4GOP C;  4RGO S;  1SMY C;  4MN3 A;  3KF8 B;  5C4X G;  2OWO A;  3CAM A;  4FDB A;  1EOV A;  1LM0 A;  3KLS A;  2RA4 A;  3CD6 A;  2WB1 E;  4QL5 A;  4RHS A;  3GTG H;  1C4Q A;  4FYD A;  1ONL A;  1C9O A;  3M85 A;  2UUA Q;  3KF6 A;  3MC0 B;  2E5L L;  1B9M A;  2AUK A;  3CC7 A;  3T1H L;  4MNO A;  4KKT A;  3K0X A;  2D0O A;  1SDF A;  1SNQ A;  3IL8 A;  1LYL A;  4MIU A;  3EQL C;  3C46 A;  3S2D B;  1OTC A;  3GD7 A;  3SDZ A;  1XPU A;  1GUW A;  2B2U A;  3CCR A;  2JA8 H;  2GVA A;  2RBM A;  1EIG A;  2WAC A;  2Z9H A;  4IOA A;  3DEP A;  2IJ0 A;  3OPO A;  3FDT A;  2HT1 A;  3HOU H;  1VQF A;  1IL2 A;  1KNE A;  1B7Y B;  1L0W A;  2JA6 B;  1HXY D;  2K5Q A;  2UXC L;  3K7A H;  5KND A;  1SBB B;  2B2V A;  3MEH A;  3CCQ A;  2DUD A;  1RD9 D;  2KEN A;  1MI2 A;  3H15 A;  2BA0 A;  2KED A;  4I7Z C;  1SSO A;  5GAG C;  1XYI A;  1YIT A;  1TWH H;  5J1Z A;  3VYU A;  3G6J B;  1QOH A;  3U58 A;  4PZ6 A;  3MFY A;  1BCP F;  5JAV A;  5LL6 X;  2OTJ A;  5T1I A;  1I50 B;  5EQ0 A;  5C4X H;  4JBJ A;  4HED A;  1OXT A;  3H3V C;  3EVQ A;  3T1Y Q;  3CP0 A;  4NPS A;  1LTB D;  3I4M B;  4R8N A;  4UY8 C;  1V1P A;  5CC4 A;  1MBY A;  2EY5 A;  3OW7 A;  4GLV B;  4IFD J;  2K52 A;  2CH4 A;  3A0J A;  2EXD A;  1VQ9 A;  1EIF A;  1Y1V H;  4X3U A;  2VXW A;  3I7F A;  4EQP A;  3CHB D;  1TWF H;  5C44 G;  4OWX B;  3S9W A;  2JA7 B;  1L1O A;  2SOB A;  1KAW A;  2UU9 Q;  5D65 A;  2K03 A;  3HOY B;  4GN3 B;  1Z9F A;  1JQY D;  3MXN B;  4IUR A;  4CDF C;  3F2U A;  1Q12 A;  1RCV D;  2K75 A;  2KHI A;  3FMC A;  4DR6 Q;  3GV3 A;  4IPD A;  2RVL A;  5CYU A;  3I55 A;  4FF1 A;  1MD2 D;  2ALY B;  1V8Q A;  2VS1 A;  2F0O A;  1KRT A;  3Q8D A;  4CKC A;  4LF9 Q;  1ET9 A;  5M3F G;  4TVA B;  1QG7 A;  3NEM A;  4LJZ C;  3UDG A;  4EQO A;  4C3J B;  5IYC G;  5ELF A;  2WV6 D;  4E6I A;  2ASB A;  5EKL A;  2VQF Q;  2MQH A;  2RDG A;  3KF6 B;  1N36 L;  5CBA E;  1CZG A;  3N52 A;  4GKK L;  1HQR D;  4DV2 L;  4DV3 L;  3BVZ A;  1I6H H;  2XIW A;  4DAM A;  1PRT B;  2I5H A;  3DWQ A;  1PYW D;  4YCW A;  3MZ5 A;  5BR8 Q;  4Q0F A;  3J7A F;  1JWM D;  4A3J G;  3R2I A;  4N9P A;  2A1A A;  1CUK A;  1YI2 A;  2QDB A;  2DY8 A;  1EZ6 A;  2BCO A;  4IPH A;  1XMQ Q;  1K9M C;  4DKA C;  5C44 H;  2NN6 I;  3BS1 A;  1X9N A;  2B29 A;  4DV7 Q;  4CDE C;  4LF6 L;  5HGQ A;  2HDM A;  4JC0 A;  4A3B H;  1NNX A;  1IBL Q;  1QZG A;  3J80 i;  2R92 G;  4L5Q A;  4XT1 B;  2B2Y A;  5EBC A;  4HTH A;  1RHP A;  1MSH A;  1UE5 A;  1BOS A;  2BDN A;  5CV8 A;  3TS2 A;  2R6G A;  4XQJ A;  2DN8 A;  4KLK A;  1PLF A;  2PMZ E;  3UI2 A;  4IUN A;  5M3F H;  3OWE B;  4QQB X;  5LMU Q;  4BBS B;  3W1B A;  4A3L G;  5IYC H;  3GTJ H;  3FP9 A;  1N32 L;  3DXJ C;  3T4A C;  2IX1 A;  1V1P B;  3MXU A;  2EOT A;  3MEF A;  3OSO A;  3CME A;  3A8J E;  1EOT A;  2WAQ E;  4BY1 H;  4OXP A;  1QVG A;  2KEC A;  3S24 A;  1LUZ A;  2FFK B;  5K36 G;  4LUO A;  2L12 A;  4DV4 L;  4K5W A;  1L1O B;  3NBH A;  3BJU A;  2AQ3 B;  1XMO Q;  4P72 A;  1JB7 A;  1BQQ T;  4KHP Q;  1ZKO A;  5C4J H;  1CM9 A;  2F0I A;  2KCM A;  1UUP A;  3WOF A;  3E9H A;  1D5X C;  4DUZ Q;  3GP7 A;  3DUZ A;  3NPP A;  2LS0 1;  3ULJ A;  2NVQ H;  1KLG D;  1KQS A;  2NN6 G;  2FIN B;  3D4W A;  1VF7 A;  1ESR A;  2MFI A;  2ZXR A;  1PTO D;  5CMD A;  4A4I A;  5AFW A;  1IYU A;  3PUV A;  2JE6 I;  2JQO A;  1FD7 D;  4EQN A;  4DGZ A;  3HFZ B;  2MGS A;  4L6T B;  1SNM A;  1TS4 A;  4DF7 A;  1B2T A;  2IT1 A;  4A3C G;  3H3V I;  2PPB C;  2KHS A;  2PZW A;  2D2C C;  4CJ1 B;  2EY1 A;  3I8Z A;  1VS0 A;  2CW0 D;  4OEM B;  3S2D H;  1PZK D;  3G7L A;  4A3L H;  1LAB A;  4B9X A;  3HKZ B;  3M4Y A;  2ICE C;  1M1K C;  1EIY B;  3HOY G;  2ZM6 Q;  1CKN A;  4N9T A;  1IBK Q;  2ZTC A;  5EGT A;  1CKO A;  1I4P A;  5DAU A;  3HOV G;  3LX0 A;  1P8L A;  2FMM A;  4DR5 L;  2DJF C;  2NB0 A;  2PO4 A;  4DV5 Q;  3MXG A;  3KDF B;  1PTO C;  2PW7 A;  3BZK A;  1E22 A;  2B8F A;  4HJ5 A;  1QB5 D;  4HIK A;  5K36 H;  4MHE A;  2EXZ A;  2DJG C;  2PZT A;  4UP7 A;  3Q23 A;  4LMQ D;  4F8M A;  4X65 L;  2JA6 H;  2IW3 A;  1Y8P B;  4IJH A;  1HNW L;  2EY2 A;  5JOB A;  1JR0 D;  3PUY A;  4EQ5 A;  5T1G A;  4C3J G;  2RDF A;  1K8M A;  3W2D A;  1WI5 A;  3GDE A;  3TZD A;  4CGY B;  1ESF A;  4LF5 Q;  5IWA L;  1TS2 A;  2K05 A;  2VY3 A;  3T16 A;  1KDC A;  1VQI A;  2CW0 C;  2I07 B;  2UXD Q;  1X56 A;  1JMC A;  2NYZ D;  4DK3 C;  5I2Y A;  1YVC A;  5ELC A;  2NTT A;  1UNS A;  1PMR A;  5FO9 B;  1A3V A;  3I4M H;  2JYO A;  1LTT D;  4K8I A;  4ODG A;  3ND9 A;  2B63 B;  4RHR A;  4X62 Q;  3BU2 A;  4A3C H;  1VQN A;  2G5D A;  3Q24 A;  2F0W A;  4OWT B;  3SXH A;  4H02 A;  2KOL A;  4IPG A;  1CT1 D;  5BN4 A;  4ZAI A;  4ZK9 B;  1SAP A;  1HR0 L;  1B3A A;  4BBR G;  3HOY H;  1HCZ A;  3NBH B;  4X66 Q;  3TS0 A;  1EFI D;  2K50 A;  4IN3 A;  1XPO A;  3NQT A;  4QMG A;  1YNN D;  2F52 A;  2UUC L;  4ME3 A;  1Q8I A;  3A56 A;  2B2W A;  2Z6B A;  1EQR A;  3KBX A;  2EYH A;  3FRP B;  3QB3 A;  3G6E A;  2EVB A;  4DA2 A;  4DNT B;  5IE8 A;  1OXU A;  3CCV A;  1PHJ A;  3K81 C;  2YU9 B;  4QB4 A;  4BBS G;  4C3J H;  1STB A;  1ASZ A;  4QJF A;  3J81 E;  4H7B A;  4GLX A;  1RL2 A;  4KY5 A;  4DR2 L;  5FO7 B;  1VQB A;  1FR3 A;  1FGB D;  3Q0A A;  3GTO H;  5HGT A;  2Z0S A;  5D3I B;  5E4W C;  1II3 A;  3KBG A;  5A2Q E;  3ER0 A;  1YNN C;  4QGU A;  4FNF A;  2Y0S G;  3OW2 A;  4RGT A;  5KRU A;  1K8G A;  4JI7 L;  3AFP A;  3QJY A;  1CKN B;  2LXJ A;  1BNZ A;  4DXG A;  1WTQ A;  1ENF A;  4JV5 Q;  3S1R H;  5I9P A;  1ZYR D;  4A3D G;  1EQV A;  1EU3 A;  4LF8 Q;  1PA6 A;  1EY8 A;  3K7U C;  4BBR H;  4KJN A;  1LT4 D;  2GA4 B;  3JAM E;  1PYS B;  3MHB A;  1FNU A;  2OQK A;  4JI2 Q;  2HD3 A;  5IOD A;  2XRQ D;  4JPB W;  3ERS X;  2UUB L;  4WOR A;  1KDA A;  3T51 B;  2K4K A;  4G57 A;  2N78 A;  1TVX A;  4C3H G;  2HUG A;  1EY9 A;  4NP5 A;  4KY7 A;  2ZXP A;  4BBS H;  5CV6 A;  3RLF A;  3GV6 A;  2Z6K A;  1YHB A;  1X32 A;  4QF4 A;  5E7N A;  3HKZ G;  4IJL A;  2ZJR A;  4JCV E;  1CQV A;  2G9H D;  1J6Q A;  1C7Y A;  1FJG Q;  3JC6 6;  3FVQ A;  1ZYR C;  5IGG A;  2XWJ B;  1IBM L;  5M3M G;  1S5F D;  1STA A;  2F0M A;  1ENA A;  1XX8 A;  2D9U A;  4O42 A;  3K5O A;  1CHQ D;  4KKU A;  4B3S Q;  5GAE C;  1U4M A;  4A3M B;  4FXK C;  3TP6 A;  2Z1C A;  1BR9 A;  4XQQ A;  1XPR A;  4QUC A;  1H9M A;  5I6W A;  2HQL A;  5I9O A;  2TMP A;  2A69 D;  4A3D H;  4I7A A;  3M4O B;  2YTV A;  1Q82 C;  1U4R A;  1EY4 A;  2BA1 A;  2GVB A;  3PO2 B;  3QG1 A;  1EYA A;  3RNU A;  1VDZ A;  3J7A V;  4KY6 A;  1IYJ B;  1NE3 A;  1EEI D;  1JE5 A;  3A8I E;  4K8J A;  2WKD A;  4QCL A;  3AB9 A;  1PH8 A;  4FF3 A;  4C3I B;  1DJR D;  1EYC A;  4C3H H;  4O2D A;  3G71 A;  4LFB Q;  1Q7Y C;  1AE2 A;  4P75 A;  2E2D C;  4X6A H;  1MJE A;  4X3T A;  1XXG A;  2F3W A;  3HP3 A;  1KD1 C;  5ELE A;  2BE5 D;  3MA2 B;  3D0F A;  1HUN A;  4X3S A;  2F0G A;  2KHJ A;  1QVF A;  2IX3 A;  2E76 C;  5NUC A;  3E9I A;  1VQO A;  2WFW A;  4P73 A;  1HJP A;  2A69 C;  1FNV A;  2Z4I A;  4Y7N B;  4KK7 A;  4B3M Q;  1Y14 B;  2AKW B;  1NTG A;  4DR7 Q;  1N8R C;  4KTA A;  5DM7 3;  1EY5 A;  1U5K A;  1GD7 A;  3FHW A;  4NXM L;  1I4H A;  1BF4 A;  1D2B A;  1OXX K;  1SYE A;  4YCV A;  4JI1 Q;  4LFA L;  4DV6 Q;  1CA6 A;  1M8A A;  4C1N K;  5KIX A;  4HN7 A;  2R7D A;  4QIW E;  3RUZ A;  2VB3 X;  2OCE A;  1S40 A;  1GOZ A;  2F0P A;  5AJ3 Q;  1TWC B;  5JVG 3;  2MUY A;  5LHY 1;  1S72 A;  1N34 Q;  4X64 Q;  2BE5 C;  5G3L D;  1S3O A;  1SJH D;  2B2T C;  4DXF A;  2EYF A;  2NZO A;  2ZXO A;  2CHB D;  2NVY B;  4UP9 A;  3CCL A;  1AE3 A;  2EQS A;  2MJ8 A;  1GXD C;  2WB1 B;  4GKK Q;  2A74 C;  4DV2 Q;  1BDO A;  3BDO A;  2K5H A;  3M7N A;  4JYA Q;  2BH2 A;  2F0S A;  1STE A;  1SNO A;  2O4X A;  1SNC A;  3L7Z C;  3C1F A;  3D6W A;  1XWE A;  1SN8 A;  4BS9 A;  2JSO A;  3K5L A;  3ITP A;  1WTP A;  1SJE D;  1V1Q A;  3A74 A;  3J80 c;  3KFU A;  4V0B A;  3ND8 A;  3NBI A;  1MJC A;  1QWY A;  4L5S A;  2N3S A;  1EY0 A;  4KJO A;  2BH8 A;  4UP8 A;  4HMJ A;  3C2P A;  3M3Y B;  2YU9 H;  1TR5 A;  1LTR D;  3BZD B;  1EFW A;  2Q8R E;  1VQP A;  2CQA A;  4DUY L;  5COR A;  1PTO H;  1O7Y A;  2OQ0 A;  1E7Z A;  3J81 i;  1PRT D;  2RF4 A;  4DV0 Q;  5C3X A;  1FVI A;  1Y1V G;  4R4T A;  3UDI A;  4KHV A;  5EKK A;  2G9D A;  1XTD A;  1KHI A;  5CR3 A;  2L11 A;  4OIK A;  2BOS A;  1X54 A;  2NTS A;  4A3M G;  3SHL A;  1IKL A;  3E3X A;  1H9R A;  2F4I A;  1EYG A;  4Z9C B;  4R4O A;  2SNM A;  2N55 A;  5ELN A;  3AFQ A;  4FP5 D;  2K04 A;  4DV4 Q;  3TP5 A;  3B6Y A;  1J5E Q;  3QOL A;  2Q2U A;  3PUX A;  3Q6S A;  3PO2 G;  1EIH A;  1LAC A;  1NJI C;  1WTV A;  3IKJ A;  1R9T B;  1STH A;  3JAM i;  1KRS A;  3C1E A;  4ME5 A;  3MAQ A;  1X3E A;  2PZU A;  5C3W A;  1HNX Q;  3GO5 A;  4A3I B;  4C3I G;  2H4O A;  5JEA J;  4GKJ L;  3A5U A;  2PNR C;  3MWY W;  3CMA A;  2JA9 A;  4QUF A;  5IOC A;  1GHJ A;  3DWP A;  2HHH Q;  4LF7 L;  1MHW C;  2N88 A;  3FPU B;  5HUR A;  1KIX A;  3S1N B;  1PTO F;  2IHF A;  4YWK A;  4ZKB B;  2QF7 A;  4YHH L;  2UXB Q;  1I4Q A;  5CV4 A;  4DR3 L;  3S1M H;  1E2V A;  2B2V C;  5LL6 S;  2JN4 A;  2K7V A;  1HHV A;  2CCZ A;  4DR4 L;  1DGS A;  1L0Y B;  3I91 A;  3NSW A;  4A3B G;  3S16 B;  1K28 A;  4A3M H;  4RMF A;  2VNU D;  5C0X G;  3KYH C;  5F2D A;  3UDF A;  1K0S A;  1B50 A;  3TP7 A;  5JJL A;  2SNS A;  2R7Z G;  2EYM A;  3UE1 A;  1KTK A;  3M4O H;  1G6P A;  2K01 A;  2IL8 A;  1I94 Q;  3PO2 H;  2J4X A;  3LNN A;  2NVX B;  2CH4 W;  4LUZ A;  1YJN A;  4H0L C;  4DPG A;  3F2B A;  1GVP A;  4OX9 Q;  2ZTE A;  2NZH A;  1L1O C;  5IWA Q;  1EQT A;  1UE1 A;  4B3R Q;  1KAA A;  2F0U A;  2NBF A;  2OF1 A;  2WB1 G;  3I90 A;  4C3I H;  1X3F A;  1F9P A;  1A3U A;  4LWC A;  1B9N A;  4BY1 G;  1WJJ A;  2KQ3 A;  2KUM A;  5DLQ E;  1Y1W B;  3SK4 A;  3CCM A;  2PMZ B;  5CV5 A;  4A3K B;  4AYB E;  3UDX A;  1YHA A;  2I0Q A;  1MGS A;  2MHV A;  4BXX G;  1Q8K A;  3K5M A;  1YNX A;  4Y7N H;  2QIL A;  5D3D A;  1AFP A;  5K5P A;  3CXC A;  1LT5 D;  4HIO A;  4RCO A;  1STN A;  4DAY A;  5FLX L;  1Q90 A;  2J7Z A;  3TEH B;  1KC8 C;  3RZO B;  2EE1 A;  3CRK C;  2WAQ B;  3F2D A;  1JJG A;  1JWS D;  5C0X H;  4NXN L;  4OO1 G;  2UUC Q;  1TWA B;  1K3B C;  2DGY A;  2Z8L A;  1J8I A;  4LFC Q;  1TWC H;  2ES2 A;  2R7Z H;  1HRJ A;  2EYL A;  4B3T L;  2VZA A;  5KYL A;  4TRD A;  1D5Z C;  2Q2T A;  1SEB D;  1JOO A;  1W3S A;  2NVY H;  3CQZ B;  4HSV A;  3P75 A;  5C4Z A;  2LMC B;  3CRL C;  2NUC A;  4A3F B;  5DNF A;  4HJ9 A;  3GTL B;  5C6A A;  2L15 A;  4GNX A;  3SVM A;  2UUA L;  1YZ6 A;  4P74 A;  1M90 C;  3CPW A;  5M5X B;  1SFO B;  2F03 A;  2DY7 A;  4JI0 L;  5FKA C;  3CCU A;  2K5N A;  1P16 A;  4Y52 H;  5IP9 G;  1PH3 A;  2JA6 G;  1I4R A;  1SE8 A;  3M4P A;  1VQ7 A;  4BXX H;  1AZQ A;  5FLM G;  4NMZ A;  3OIP A;  1K83 B;  3NP8 A;  1JIC A;  2DNE A;  4A3I G;  1EY7 A;  2C5C A;  4JI4 Q;  2ICI A;  3CCS A;  1GJX A;  1N33 Q;  1TWG B;  5A35 A;  3M3Y H;  4CDC C;  1V43 A;  1QE6 A;  2TSS A;  4OO1 H;  4EX5 A;  4YWL A;  2WP8 J;  1E2W A;  3I4M G;  1IL8 A;  3KLR A;  3U50 C;  1NBW A;  1A0I A;  1U4L A;  3GTQ B;  4IQZ A;  1WTW A;  3S15 B;  1VQA A;  2RDH A;  1GUT A;  1DCZ A;  3I56 A;  3OTO L;  3I70 A;  4K2K A;  4CHT B;  3ONA B;  3J7Y W;  2JA7 G;  1WTH A;  3BG3 A;  1SYB A;  1WYD A;  4P2C B;  3X3N A;  5I4D A;  3ZJY C;  4A76 A;  3I4N B;  4RGN A;  2QA4 A;  3T1Y L;  2QGQ A;  3GTK B;  3PSI A;  4CDD C;  2E2H B;  1NR4 A;  1HR0 W;  4FXG C;  1KDB A;  1G91 A;  2AMC B;  2IHE A;  1ROD A;  5TSS A;  1VQD A;  1CTM A;  2XSC A;  2Y0S E;  4YY3 Q;  2R7F A;  2K28 A;  5IT9 L;  1LTS D;  2A19 A;  1L0X B;  2IY5 B;  5FLX c;  1R4Q B;  1T5X D;  5IP9 H;  2FXQ A;  5M5W B;  2UU9 L;  4YWM A;  4LUV A;  2L5T A;  5FLM H;  2E2J B;  5IYB G;  1R9T H;  2LY7 A;  4YIJ A;  4I65 A;  3TSS A;  3M4Q A;  1QCB D;  3VYT A;  2VQE Q;  4A3I H;  4U68 A;  4DK0 A;  3J81 L;  4DR6 L;  4OIJ A;  4NB3 A;  3KOJ A;  1AH9 A;  1I50 H;  3S1Q B;  1PH1 A;  1FGU A;  2JEB I;  4N8X 1;  3L2P A;  5D14 A;  3HEJ A;  2HCI A; 
#chains in the Genus database with same CATH homology
 2X6G A;  2OEO A;  1AN8 A;  1EU4 A;  5ELD A;  1NR2 A;  1NUC A;  2CVR A;  4DAP A;  4XTC S;  5C4H A;  1WTX A;  3K6O A;  2F0K A;  4J1M A;  1ICW A;  1AP0 A;  1PFM A;  2HQE A;  2F0E A;  2E75 C;  1CHP D;  3JAM L;  4UAI A;  2M00 A;  1S4Z A;  2JEA I;  3L9A X;  1PFN A;  4TKO B;  3H91 A;  2DNC A;  3SR1 A;  3D8G A;  1SNP A;  3HGB A;  2B63 B;  1GUN A;  1NAP A;  3HOW B;  2FMC A;  1WD0 A;  3KUP A;  3U9O A;  5FO8 B;  3EA6 A;  1EL0 A;  1M4V A;  2JA5 B;  2RKS A;  3BVG A;  4XXE A;  4RCN A;  5KNB A;  1LTG D;  3K5N A;  3SK6 A;  5G3L F;  3A8K E;  3OWF A;  1BCP B;  4RA8 A;  4RAU C;  2R61 A;  2X6L A;  3IAY A;  1JE4 A;  2Q8I B;  1QNK A;  1ZEQ X;  3A55 A;  1STG A;  1WD1 A;  4OGQ C;  3M7G A;  2EJM A;  4LK1 C;  1O78 A;  1Y8N B;  3K0Y A;  1F2M A;  3NXW A;  2A68 D;  4NDX A;  4A93 B;  1JOQ A;  4CJ0 B;  2JA8 B;  1CI3 M;  5FOB B;  1G2T A;  3PO3 B;  1GHK A;  1LT3 D;  4DNR B;  1PZI D;  1DD2 A;  4O1N A;  1JOR A;  2KA7 A;  1W6K A;  1U9R A;  2AQ1 B;  3HOU B;  5EJW A;  2R3Z A;  1BXT A;  1F77 A;  1CK1 A;  1TT2 A;  1D5M C;  4TSS A;  2VUM B;  2F0N A;  1TQO A;  4HAE A;  4XYO A;  4F7X A;  3RD4 A;  1DYQ A;  1I3Q B;  3I3C A;  1PRT F;  4RGM A;  1V1O A;  3TDQ A;  3S14 B;  5E4X A;  2A68 C;  5C4X B;  5EPK A;  4ZUJ A;  3S17 B;  3BDC A;  2FJ2 A;  1WCM B;  3J80 L;  1IHZ A;  2PCF B;  3FPP A;  1LV9 A;  3NUC A;  1RTN A;  1AEX A;  2F0F A;  3D6C A;  3T56 B;  3TBI B;  4V19 0;  3NQI A;  2L1B A;  1H9J A;  2ID0 A;  3R8B A;  2KJX A;  3PUZ A;  1RTO A;  3DHQ A;  3IFT A;  3R93 A;  1R4P B;  3PMF A;  3A54 A;  1A15 A;  4QIW B;  2E2I B;  1PFB A;  1B53 A;  1EWC A;  4K2L A;  1TII D;  1TS5 A;  2LKV A;  3PIP 3;  2ZT9 C;  5IGC A;  2PYK A;  3P1H A;  1EWH A;  1DOL A;  2KEE A;  3CU7 A;  4KD3 A;  3OOC A;  1S5E D;  2M9V A;  3I73 A;  4NKL A;  3FKI B;  2EJG C;  2J0T D;  3D4R A;  1SE2 A;  1I6H B;  4XT3 B;  1GUO A;  1BUV T;  1EYD A;  2LFN A;  3K57 A;  4XDX A;  3DMU A;  3VYR A;  2EY6 A;  4ZRZ A;  4KN4 C;  5ELB A;  3NWS A;  2R93 B;  1STY A;  1ENC A;  1C8C A;  1HFG A;  2RQX A;  3NTI A;  3H6M A;  2A6H D;  1FNW A;  2EYO A;  3BVM A;  4KMU C;  3HS0 C;  1Z6H A;  1WTR A;  4IUV A;  3WOE A;  1OO9 B;  1U4P A;  1B4O A;  1OXS C;  1WTO A;  4DFA A;  3K59 A;  1G8Z D;  5M3F B;  2F3V A;  2I46 A;  4G7O C;  1B1Z A;  4XIG S;  1T5E A;  3GTJ B;  2L4N A;  4DN4 M;  3ERO A;  3NTK A;  2WIN B;  1HFN A;  2Z4H A;  4OHJ A;  4IFD H;  2A6H C;  3VA7 A;  4CBV A;  2AQ2 B;  5IGF A;  4CKE A;  4A3J B;  2A73 B;  1G29 1;  4FF4 A;  3MXN A;  1RDP D;  4DK1 A;  3FEW X;  3LWE A;  2H1E A;  5EKI A;  4IUP A;  3HOZ B;  3MVV A;  3W3A A;  1UAP A;  1GUS A;  3VR2 A;  1I4X A;  1Q1E A;  1DM0 B;  2A5H A;  1QIL A;  5IIF A;  1DOK A;  1HA6 A;  2RSN A;  4IUU A;  3N6R A;  2R92 B;  4RKL A;  1J9O A;  5C0X I;  5KGU A;  4M8A A;  3P20 A;  2NZ1 D;  1LT6 D;  3AU7 A;  2F0L A;  2A6E D;  1OXV A;  1SND A;  2VB2 X;  3HOX B;  4A3E B;  3S2H B;  4KV6 A;  1QNU A;  1GUG A;  3VR6 A;  4KI0 A;  1PRT C;  3GTP B;  4J8Q A;  3SEB A;  2BDO A;  1B44 D;  1F2L A;  5J39 A;  4H44 C;  2B2U C;  5I2X A;  3BDL A;  2JP1 A;  5JVH 3;  1O7Z A;  4XQN A;  2A6E C;  2EYJ A;  1SXT A;  3R2T A;  4U67 3;  1D6E C;  4LAA A;  1SE4 A;  4RH6 A;  1Z47 A;  4Q5V A;  1S5B D;  2MPM A;  3SK8 A;  4JK1 C;  3PV0 A;  4J6H A;  2WII B;  5CBE E;  4OO1 I;  2OXP A;  3I4L A;  5M9O A;  1Z7T A;  4AYB B;  4A3G B;  3HRZ C;  4BY7 B;  1G6Z A;  3E5S A;  3H0G B;  1ILQ A;  4R8I A;  4K5X A;  1RF2 D;  1DZ1 A;  3E0J A;  3GTM B;  3VA5 A;  1G2S A;  1CZW A;  1SYD A;  1IKM A;  2EDG A;  1YNJ D;  3HOV B;  4IZ8 A;  4TQU S;  1TY0 A;  4PV1 C;  1F9Q A;  3OIQ A;  4KHZ A;  2QKI C;  3KK7 A;  2K32 A;  1SYG A;  3BYT B;  5EBD A;  4BA1 I;  1ILP A;  4ZUI A;  4L8J A;  1NSN S;  2KCC A;  5CV9 A;  1O80 A;  3GTO B;  1W6J A;  4HSP A;  2JXM B;  1YNJ C;  3EJI A;  3PIO 3;  2F0T A;  2O5J C;  4EVO A;  3EFX D;  4K6L A;  2HCC A;  5E1F A;  2PW5 A;  2F0D A;  5COY A;  3NE5 B;  1DON A;  4F87 A;  1EEF D;  2EPB A;  2FHT A;  3S1R B;  4RKB A;  2PQE A;  4ZKC B;  1XTC D;  4BBR B;  3QOJ A;  5DEH A;  2K5W A;  1ML0 D;  3H94 A;  4PQX A;  3IFD A;  1AW7 A;  3SE0 A;  2B2Y C;  4IAL A;  4F88 A;  2F0Q A;  2F1M A;  1HQM C;  1E2Z A;  1CQF A;  2F0H A;  1SE3 A;  4HMI A;  1PDQ A;  2XNA C;  4BWG B;  3OMC A;  1JCK B;  2K33 A;  3NK9 A;  1VCI A;  2MP1 A;  5E3F A;  1PZJ D;  2L9H A;  2Y0S B;  4ID6 A;  3E6Z X;  3MTS A;  1QJO A;  5FLX E;  3L3O C;  2XVS A;  4FF2 A;  2IWH A;  5C3E B;  1BCP D;  4A3D B;  4K6D A;  4DU9 A;  1D1I A;  1JOK A;  1NCV A;  3RZD B;  2D62 A;  3A7L A;  3OMG A;  3D3R A;  4RWS C;  4ULL A;  5C5M A;  3HZX A;  4C3H B;  2NVT B;  2L0C A;  5C0X J;  4BA2 I;  1IW7 D;  2SEB D;  4CJ2 C;  1F9R A;  1BCP C;  3ERQ A;  4ZYS A;  2OT2 A;  1VMP A;  5M3M B;  4FXD A;  3KLS X;  3H09 A;  5J22 A;  2QCP X;  1LO5 D;  3TN2 A;  5M5Y B;  4KKS A;  3X3M A;  4M1U B;  2KCN A;  3K58 A;  3O13 A;  4IUT A;  2V4D A;  5ISR A;  4HCS A;  5A2Q L;  5JPN C;  5JJZ A;  3V96 A;  3V2T A;  2NN6 H;  1IW7 C;  2AWO A;  1D1K A;  4X3K A;  3DWA A;  1JC7 A;  1HTL D;  5IGE A;  2XRS D;  4DAV A;  4UDU C;  2K6A A;  3V05 A;  1H9S A;  1DOM A;  2K1B A;  4C2M B;  2SDF A;  4IUQ A;  1KAB A;  3P7J A;  2X69 A;  3Q22 A;  2D5D A;  1X3P A;  4K5V A;  3AMU A;  4B08 A;  3D31 A;  5IT9 E;  2EZV A;  1LTA D;  1HUM A;  5EPJ A;  1UEA B;  3BYY B;  3OHX C;  1IYV A;  4S3S A;  2B2W C;  3RMH A;  3A7A B;  1KNA A;  3T53 B;  3NTH A;  3GTG B;  1TU2 B;  2M2L A;  1PTO B;  3DEO A;  1HA5 A;  2NWG A;  5KEE A;  4KD4 A;  3TME A;  2QEJ C;  5CGK A;  3PUW A;  5I6Y A;  4ILW A;  2YYZ A;  3MFG A;  4G7Z C;  4G7H C;  3URY A;  1F9S A;  3VR5 A;  3U9S A;  1SYF A;  1LLR D;  1I6V C;  1E0B A;  1K8O A;  5JPM C;  4GZY C;  3HG9 A;  4RFB A;  3TZU A;  1JWU D;  4K14 A;  3R3O A;  5BN3 A;  3K7A B;  4PNY A;  4HR7 B;  4XYQ A;  4PMC A;  1TWH B;  1TS3 A;  2K5D A;  1LTI D;  2AWN A;  4IFD I;  4B9W A;  2EJF C;  1AZP A;  1F2Z A;  1Q1B A;  1A2T A;  5EPL A;  1EY6 A;  5IGB A;  2B8G A;  5IGD A;  3S1M B;  4JBW A;  4C1N I;  1Y1V B;  1X3Q A;  2C9O A;  3QO2 A;  1TWF B;  3TP8 A;  2XN9 C;  4HCE A;  2F0J A;  1RJT A;  2KVM A;  4ZLT F;  1H9S B;  2ENB A;  1I4G A;  2IX0 A;  1WVL A;  3VR3 A;  1VMC A;  3KF8 A;  1CA5 A;  1ZXT A;  1HPC A;  1Y69 U;  4C56 C;  5KYI A;  3DM1 A;  5JEA G;  5DM6 3;  1H9K A;  2RSO A;  5CV7 A;  2Q8T A;  3QIA A;  5BN5 A;  3MXP A;  4ABN A;  4L63 B;  3C3L A;  1C48 A;  4KN7 C;  4WRD A;  1HTP A;  2O5I C;  3SK5 A;  1BO0 A;  4IFD G;  1VF5 C;  4PMW A;  1Y8O B;  1F2Y A;  3GQB A;  4OL7 A;  4PMB A;  1O7L A;  3NHH A;  3QWN A;  2XWB B;  4EGV A;  2B2T A;  4FO2 A;  1FYC A;  3WDN A;  4WJW A;  4ZQ3 A;  1BBX C;  1A3T A;  4WFN 3;  5C44 B;  1A2U A;  2F0V A;  4R9W A;  3T13 A;  3I72 A;  4G4K A;  3J80 E;  4A3B B;  1DXM A;  1A6X A;  2E74 C;  5C5L A;  2R7Z B;  2L55 A;  1MSG A;  1KLU D;  1TKW B;  3CKI B;  2EYP A;  3NWT A;  3VR4 A;  5JEA H;  1SMY D;  2AUJ D;  2IPK D;  2HDL A;  4CKB A;  1TY2 A;  3ZYY X;  4H13 C;  5KNC A;  1CFM A;  3D4D A;  4BY1 B;  4NW2 A;  2O2L D;  2B39 A;  1SYC A;  2WKC A;  1RKN A;  1Q3L A;  1S5D D;  1S5C D;  3VYS A;  3LWU A;  5FK9 C;  5C4J B;  1PXU A;  4FVM A;  1JB3 A;  1EZ8 A;  1ET6 A;  2NVQ B;  4RGO S;  1SMY C;  4MN3 A;  3KLS A;  2RA4 A;  4RHS A;  1C4Q A;  4FYD A;  1ONL A;  3M85 A;  3MC0 B;  1B9M A;  2AUK A;  4KKT A;  1SDF A;  1SNQ A;  3IL8 A;  4MIU A;  3EQL C;  3C46 A;  3S2D B;  3GD7 A;  3SDZ A;  1GUW A;  2B2U A;  2RBM A;  1EIG A;  2WAC A;  3DEP A;  2IJ0 A;  3OPO A;  3FDT A;  1KNE A;  2JA6 B;  1HXY D;  2K5Q A;  5KND A;  1SBB B;  2B2V A;  3MEH A;  1RD9 D;  1MI2 A;  2BA0 A;  2KED A;  4I7Z C;  1SSO A;  1XYI A;  3VYU A;  5J1Z A;  3G6J B;  1QOH A;  3MFY A;  1BCP F;  5JAV A;  5LL6 X;  5T1I A;  1I50 B;  5EQ0 A;  4HED A;  1OXT A;  3H3V C;  3EVQ A;  1LTB D;  3I4M B;  4R8N A;  1V1P A;  5CC4 A;  1MBY A;  2EY5 A;  3OW7 A;  4IFD J;  4X3U A;  2VXW A;  4EQP A;  3CHB D;  3S9W A;  2JA7 B;  2SOB A;  5D65 A;  2K03 A;  3HOY B;  1JQY D;  4IUR A;  3F2U A;  1Q12 A;  1RCV D;  3FMC A;  3GV3 A;  2RVL A;  5CYU A;  4FF1 A;  1MD2 D;  1V8Q A;  2F0O A;  4CKC A;  1ET9 A;  1QG7 A;  4LJZ C;  4EQO A;  4C3J B;  5ELF A;  2WV6 D;  4E6I A;  5EKL A;  2RDG A;  5CBA E;  1CZG A;  3N52 A;  1HQR D;  3BVZ A;  2XIW A;  1PRT B;  3DWQ A;  1PYW D;  3MZ5 A;  4Q0F A;  3J7A F;  1JWM D;  3R2I A;  4N9P A;  2QDB A;  2DY8 A;  1EZ6 A;  2BCO A;  3BS1 A;  2NN6 I;  2HDM A;  4XT1 B;  2B2Y A;  5EBC A;  4HTH A;  1RHP A;  1MSH A;  1BOS A;  2BDN A;  5CV8 A;  2R6G A;  4XQJ A;  2DN8 A;  1PLF A;  3UI2 A;  4IUN A;  3OWE B;  4BBS B;  3DXJ C;  3T4A C;  2IX1 A;  1V1P B;  3MXU A;  2EOT A;  3OSO A;  3A8J E;  1EOT A;  2KEC A;  2FFK B;  5K36 G;  2L12 A;  4K5W A;  3NBH A;  2AQ3 B;  1BQQ T;  1ZKO A;  1CM9 A;  2F0I A;  3WOF A;  1UUP A;  1D5X C;  3GP7 A;  3DUZ A;  3NPP A;  2LS0 1;  1KLG D;  2NN6 G;  2FIN B;  3D4W A;  1VF7 A;  1ESR A;  2ZXR A;  1PTO D;  5CMD A;  5AFW A;  1IYU A;  3PUV A;  2JE6 I;  1FD7 D;  4EQN A;  4DGZ A;  2MGS A;  4L6T B;  1SNM A;  1TS4 A;  4DF7 A;  1B2T A;  2IT1 A;  2PPB C;  2KHS A;  2PZW A;  2D2C C;  4CJ1 B;  2EY1 A;  3I8Z A;  2CW0 D;  1PZK D;  3G7L A;  1LAB A;  4B9X A;  3HKZ B;  3M4Y A;  2ICE C;  4N9T A;  5EGT A;  1I4P A;  5DAU A;  3LX0 A;  2FMM A;  2NB0 A;  2PO4 A;  3MXG A;  1PTO C;  2PW7 A;  2B8F A;  1QB5 D;  5K36 H;  4MHE A;  2EXZ A;  2PZT A;  3Q23 A;  4LMQ D;  4F8M A;  2IW3 A;  1Y8P B;  2EY2 A;  5JOB A;  1JR0 D;  3PUY A;  5T1G A;  4C3J G;  2RDF A;  1K8M A;  3W2D A;  3TZD A;  4CGY B;  1ESF A;  1TS2 A;  2K05 A;  3T16 A;  1KDC A;  2CW0 C;  2I07 B;  2NYZ D;  5I2Y A;  5ELC A;  2NTT A;  1UNS A;  1PMR A;  5FO9 B;  1A3V A;  2JYO A;  1LTT D;  4K8I A;  4ODG A;  3ND9 A;  4RHR A;  3Q24 A;  2F0W A;  3SXH A;  2KOL A;  1CT1 D;  5BN4 A;  4ZAI A;  4ZK9 B;  1SAP A;  1B3A A;  1HCZ A;  1EFI D;  4IN3 A;  3NQT A;  4QMG A;  1YNN D;  1Q8I A;  3A56 A;  2B2W A;  3KBX A;  2EYH A;  3FRP B;  3QB3 A;  2EVB A;  4DA2 A;  4DNT B;  1OXU A;  2YU9 B;  4QB4 A;  1STB A;  3J81 E;  4H7B A;  4KY5 A;  5FO7 B;  1FR3 A;  1FGB D;  3Q0A A;  5HGT A;  5D3I B;  5E4W C;  1II3 A;  3KBG A;  5A2Q E;  1YNN C;  4FNF A;  4RGT A;  5KRU A;  3QJY A;  1BNZ A;  4DXG A;  1WTQ A;  1ENF A;  5I9P A;  1ZYR D;  1EQV A;  1EU3 A;  1EY8 A;  4KJN A;  1LT4 D;  2GA4 B;  3JAM E;  3MHB A;  1FNU A;  5IOD A;  2XRQ D;  4WOR A;  1KDA A;  3T51 B;  4G57 A;  4C3H G;  1TVX A;  2HUG A;  1EY9 A;  4NP5 A;  4KY7 A;  2ZXP A;  5CV6 A;  3RLF A;  3GV6 A;  4QF4 A;  1X32 A;  1CQV A;  2G9H D;  3FVQ A;  1ZYR C;  5IGG A;  2XWJ B;  1S5F D;  1STA A;  2F0M A;  1ENA A;  1XX8 A;  2D9U A;  4O42 A;  3K5O A;  1CHQ D;  4KKU A;  1U4M A;  4A3M B;  4FXK C;  3TP6 A;  2Z1C A;  1BR9 A;  4XQQ A;  4QUC A;  1H9M A;  5I6W A;  5I9O A;  2TMP A;  2A69 D;  3M4O B;  1U4R A;  1EY4 A;  2BA1 A;  3PO2 B;  3QG1 A;  1EYA A;  1VDZ A;  3J7A V;  4KY6 A;  1EEI D;  3A8I E;  4K8J A;  2WKD A;  4QCL A;  3AB9 A;  4FF3 A;  4C3I B;  1DJR D;  1EYC A;  2E2D C;  4X3T A;  1XXG A;  2F3W A;  3HP3 A;  5ELE A;  2BE5 D;  3MA2 B;  1HUN A;  4X3S A;  2F0G A;  2IX3 A;  2E76 C;  5NUC A;  2A69 C;  1FNV A;  2Z4I A;  4Y7N B;  4KK7 A;  4KTA A;  5DM7 3;  1EY5 A;  1I4H A;  1BF4 A;  1D2B A;  1OXX K;  1SYE A;  1CA6 A;  1M8A A;  4C1N K;  5KIX A;  4HN7 A;  3RUZ A;  2VB3 X;  1GOZ A;  2F0P A;  1TWC B;  5JVG 3;  2MUY A;  5LHY 1;  2BE5 C;  5G3L D;  1SJH D;  2B2T C;  4DXF A;  2EYF A;  2ZXO A;  2CHB D;  2NVY B;  2MJ8 A;  1GXD C;  2WB1 B;  2A74 C;  1BDO A;  3BDO A;  3M7N A;  2F0S A;  1STE A;  1SNO A;  2O4X A;  1SNC A;  3L7Z C;  3C1F A;  3D6W A;  1XWE A;  4BS9 A;  2JSO A;  3K5L A;  3ITP A;  1WTP A;  1SJE D;  4V0B A;  3NBI A;  3ND8 A;  1QWY A;  1EY0 A;  4KJO A;  4HMJ A;  3C2P A;  3M3Y B;  1TR5 A;  1LTR D;  3BZD B;  2Q8R E;  2CQA A;  5COR A;  1PTO H;  1O7Y A;  1PRT D;  5C3X A;  4KHV A;  5EKK A;  2G9D A;  5CR3 A;  2L11 A;  4OIK A;  2BOS A;  2NTS A;  3SHL A;  1IKL A;  1H9R A;  2F4I A;  4Z9C B;  2SNM A;  2N55 A;  4FP5 D;  2K04 A;  3TP5 A;  3QOL A;  3PUX A;  3Q6S A;  1EIH A;  1LAC A;  1WTV A;  3IKJ A;  1R9T B;  1STH A;  3C1E A;  4ME5 A;  3MAQ A;  2PZU A;  5C3W A;  3GO5 A;  4A3I B;  4C3I G;  2H4O A;  5JEA J;  2PNR C;  3MWY W;  4QUF A;  5IOC A;  1GHJ A;  3DWP A;  2N88 A;  3FPU B;  5HUR A;  3S1N B;  1PTO F;  4ZKB B;  2QF7 A;  1I4Q A;  5CV4 A;  1E2V A;  2B2V C;  5LL6 S;  2K7V A;  1HHV A;  1L0Y B;  3I91 A;  3NSW A;  3S16 B;  2VNU D;  5C0X G;  5F2D A;  1B50 A;  3TP7 A;  2SNS A;  2EYM A;  1KTK A;  2K01 A;  2IL8 A;  2J4X A;  3LNN A;  2NVX B;  4H0L C;  1EQT A;  1KAA A;  2F0U A;  2NBF A;  2OF1 A;  3I90 A;  1F9P A;  1A3U A;  1B9N A;  2KQ3 A;  2KUM A;  1Y1W B;  3SK4 A;  2PMZ B;  5CV5 A;  4A3K B;  1MGS A;  2MHV A;  3K5M A;  2QIL A;  5D3D A;  1AFP A;  5K5P A;  1LT5 D;  4RCO A;  1STN A;  4DAY A;  5FLX L;  1Q90 A;  2J7Z A;  3RZO B;  2EE1 A;  3CRK C;  2WAQ B;  1JWS D;  5C0X H;  4OO1 G;  1TWA B;  2Z8L A;  1J8I A;  1HRJ A;  2EYL A;  5KYL A;  4TRD A;  1D5Z C;  1SEB D;  1JOO A;  3CQZ B;  4HSV A;  3P75 A;  5C4Z A;  2LMC B;  3CRL C;  2NUC A;  4A3F B;  5DNF A;  3GTL B;  5C6A A;  3SVM A;  5M5X B;  1SFO B;  2F03 A;  2DY7 A;  5FKA C;  1I4R A;  1AZQ A;  4NMZ A;  3OIP A;  1K83 B;  3NP8 A;  1JIC A;  2DNE A;  1EY7 A;  2C5C A;  2ICI A;  1GJX A;  1TWG B;  5A35 A;  1V43 A;  1QE6 A;  2TSS A;  4OO1 H;  2WP8 J;  1E2W A;  1IL8 A;  3KLR A;  1U4L A;  3GTQ B;  4IQZ A;  1WTW A;  3S15 B;  2RDH A;  1GUT A;  1DCZ A;  3I70 A;  4K2K A;  4CHT B;  3ONA B;  3J7Y W;  3BG3 A;  1SYB A;  4P2C B;  3X3N A;  5I4D A;  3I4N B;  4RGN A;  3GTK B;  2E2H B;  1NR4 A;  4FXG C;  1KDB A;  1G91 A;  1ROD A;  5TSS A;  1CTM A;  2XSC A;  5IT9 L;  2K28 A;  1LTS D;  1L0X B;  1R4Q B;  1T5X D;  5M5W B;  2L5T A;  2E2J B;  2LY7 A;  4YIJ A;  4I65 A;  3TSS A;  1QCB D;  3VYT A;  4U68 A;  4DK0 A;  3J81 L;  4OIJ A;  3S1Q B;  2JEB I;  5D14 A;  3HEJ A;  2HCI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...