5C4XH

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
146
structure length
135
Chain Sequence
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Transferase/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 17
structure length 135
sequence length 146
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5c4xH00
1VQPA 2ZM6L 4JI3L 2ZJRA 1X54A 4DUZQ 2NN6G 2JA9A 1O7IA 1J6QA 5LMNQ 3S1MH 1VQNA 5LMNL 1IXRA 4KLKA 2VL6A 3HOXG 1E24A 3KLWA 5FLMH 1V43A 1SMXA 3HKZE 3I56A 1GM5A 1XNQQ 1PHJA 1V1QA 3HOZG 3E9HA 3ULLA 1WFQA 4KHPQ 3CP0A 3PV0A 3HOUH 3L0OA 1KD1C 1OXSC 3PO3H 5J3BA 1YJWA 3GTJH 2I5LX 4DV4L 1I5FA 2CWPA 3KF8B 4R4OA 4AH6A 4BBRG 3F2DA 3DLLA 2QA4A 3T1HL 4X65Q 5LMUL 5DLQE 4A3CH 3TEHB 3CMAA 4BBRH 3PIPA 1BBUA 1IBKL 2OTLA 1Y1VH 4BA1I 2VNUD 1K0RA 1PVOA 3W1BA 2V1CC 5JJIA 1MJEA 3KOJA 1L0WA 3RLOA 2HHHQ 1X3EA 4A3DH 3RN2A 4JV5L 1LTLA 2NZHA 2CFMA 4Y52H 4JV5Q 1XNQL 1PV4A 1PA6A 2Q2IA 4JI8L 1KHIA 1RL2A 4JOIA 1A63A 2Q2HA 4EX5A 4WJ4A 1G291 3GTQH 3A5ZB 3TQYA 5M3MH 4GS3A 3S16H 1B8AA 1UE1A 1VQBA 3CCVA 2OQ0A 3H3VI 3PO2H 1VQ9A 3U4VA 2JA7H 3ULJA 3CAMA 1NE3A 3GTKH 1YIJA 1PH5A 2N8NA 3F2CA 2WAQG 1PH2A 1JT8A 1I50H 2AMCB 4A3FG 3K80C 2OQKA 4AYBE 2EXDA 4GN3B 2IHFA 2RHSB 5FLXc 4AQYQ 1VQEA 1N34L 4A93H 4GOPB 2JJQA 1S40A 4LUZA 3D31A 4A76A 2XTIA 2UXBQ 4LFBL 1PFSA 3T1YL 4DV5L 3J81i 1FGUA 4LF9Q 2VUMG 1UE6A 3HFZB 4PZ6A 3PUVA 1VCIA 1E3PA 1TWAH 3MEFA 4X65L 4HJAA 1CUKA 3K7UC 1Z9FA 5M5XH 4LF4Q 1E1TA 2Z6KA 4X64Q 4DUYQ 4OX9L 2ATWA 1BKBA 4HIOA 3S2HH 2PQAA 3JC66 1C0AA 2F4VL 4DV7Q 4P75A 1PH8A 2MO1A 3GTGH 2YTXA 2E2HH 2JQOA 4B3RL 1HNWQ 2K5VA 2FXQA 4JBWA 2YU9H 1PH3A 3J81c 3NBHB 3GTOH 3RZDH 3B6YA 3I2ZA 1PYSB 3M4PA 3G4SA 4IFDI 3CCJA 3NELA 1N9WA 1XMQQ 1BVSA 3PO3G 2GVAA 4QY7A 2Y0SE 4P72A 4JI1Q 3OTOQ 4JI1L 3OTOL 2IT1A 5C0XG 3H0GH 1UEBA 3RLNA 3KF6B 3U4ZA 4JBMA 4XTCS 1FL0A 1EIFA 1DGSA 4OWXB 4TQUS 5GAEC 2NVTH 4DR7L 1K3RA 4BY7G 5AJ3L 1HZAA 4A3MG 1L1OC 2PMZE 2D0OA 4YCVA 1NBWA 4QGUA 1QVFA 3HOVH 1CKNA 1JB7A 5M5WH 1X9NA 4A93G 2PQAB 4DPGA 4FDBA 5EAYA 3RR5A 2R7FA 1YJNA 1QZHA 1KXLA 4R4TA 1SN8A 3UE1A 3H15A 3F2BA 2NVXH 2LXJA 1N33L 1KRTA 3KYHC 1UE7A 1XPOA 4JI5L 1YVCA 3AFPA 5IP7G 4HJ9A 4AIMA 1NMGA 1HH2P 3F8TA 1PH1A 1UE5A 5FLMG 4JCVE 4BBSG 2UXCQ 1EIYB 1VQIA 1WJJA 2JE6I 1Q8KA 1JJCB 1G51A 1QUQA 1ASZA 4UPAA 3BU2A 3CW2C 1WYDA 3AQQA 3HOWH 4H02A 5C4XG 1YITA 2L15A 3M85A 3BJUA 4POGA 3UDIA 1YHQA 3I55A 5E7NA 3TS2A 2R93H 2CKZB 1KRSA 4EQ5A 1J5EL 3S17H 4DR7Q 1WOCA 4A3CG 4JI0Q 2UXDL 5LMNW 2UXDQ 2HIVA 4LUOA 1VQDA 1SLJA 1E1OA 1HZCA 1W2BA 2Z0SA 4LFAQ 1EFWA 1XNRL 3KDFA 3PUYA 4LFAL 1XNRQ 1N32L 4DR4Q 4P73A 3GTMH 3I7FA 3PUZA 3F1ZA 4YY3L 2MFIA 4NXNQ 3S1RH 5IYCG 1XTDA 2VQEL 4K0KL 4A3EG 1Q7YC 3DM3A 2VQEQ 3CXCA 4LF8Q 1I3QH 2N3SA 1VQFA 1D8LA 1OXVA 2RHQB 5H1SE 1IYJB 4B3ML 1M90C 3CC4A 1A62A 2OWOA 3PGZA 4JI6L 4X62L 4OO1G 4DV0Q 1S72A 2JA7G 3S14H 2RCNA 4DAMA 2ASBA 2ZTCA 1T9HA 2CCZA 1YNXA 1IBMQ 3EN2A 1X3GA 5IWAL 3G6EA 3M9BA 4OO1I 3NEMA 4LF5Q 3E9IA 2KHIA 2VUMH 1IBLQ 4DAYB 4DV3Q 1K8AC 4IJHA 4C3HH 5C3EG 1BBWA 4DR1L 4JI0L 2HIXA 2AHOB 4DK6C 1OXXK 1D7QA 4JBJA 2DUDA 3S1NH 2IY5B 4KHPL 3KJPA 1AH9A 5BR8L 3A0JA 5HY6A 2E5LL 4LF6L 4UP9A 1N32Q 1QVGA 3PUXA 4R4IA 2Q2UA 4DV1Q 2GN5A 4GKKL 1N34Q 3S24A 1VQOA 4R1JA 1YEZA 2YTYA 4NXMQ 2KHJA 1A8VA 2PNHA 1GO3E 2E8GA 4QIWE 4GOPC 2JA5H 4DUZL 4DV5Q 4OXPA 1IBKQ 4AYBG 1YHBA 2KCTA 3H0GG 2WP8J 3RLFA 3CC7A 3CCUA 3TS0A 4DK3C 4QQBX 3LGJA 4OONA 2HT1A 4DR5Q 4DKAC 4OWTB 1X65A 1PH4A 2YTVA 4DR3Q 1N36Q 1HNZL 4LF7Q 4X64L 4DUYL 1CKOA 1QZGA 1J5EQ 1FVIA 2E2JH 5JEAG 4ALPA 4P74A 1CSPA 2ID0A 1V9PA 1JJ2A 3EIVA 1CSQA 1P16A 3G71A 1Q82C 4PG3A 1SROA 3EBEA 4DNIA 3D0FA 3HOYG 1XMQL 3HOVG 4IFDG 2OTJA 4NXNL 4K0KQ 3K81C 1XPUA 1TWCH 4BY1G 4MZ9A 1B70B 2UUBL 2RF4A 4RMFA 3A74A 1GD7A 2K50A 1Y1WG 2D62A 3BZCA 1Z47A 4B3MQ 1YZ6A 5IY0A 3PCOB 3J80i 3OW2A 2E2IH 5IP7H 4O0AA 2UUCQ 4Y7NH 4GOPA 3HOWG 4DR2Q 1K8GA 2ZTDA 3CQZH 3OYYA 4IJLA 4JI3Q 5IYDH 2H5XA 3JAMi 3J7A5 1TWFH 2YV5A 2ZM6Q 2QEXA 1NTGA 2C35B 3PF5A 5HGQA 2A8VA 1EWIA 3Q8DA 2R93G 4LF5L 2MQHA 5IE8A 3CCRA 1IBLL 3J81j 1G6PA 4DV6L 4KI0A 5JJLA 4PZ8A 3G48A 4DR6L 1HR0Q 2N78A 3AYHB 3CD6A 4DR6Q 1Y1VG 3UDGA 2UXCL 4TVAB 5M3FG 2B63H 2GVBA 1EOVA 1GVPA 3S1QH 4O2DA 4R4CA 3STBD 5IYCH 4DV1L 2KBNA 1QUQB 5M3MG 1VQLA 4A3DG 2IHEA 2A19A 1E22A 1SRUA 2K75A 4DV2L 2LSSA 2R7DA 4XIGS 4A3KH 2WAQE 4L5RC 4NXML 2BH2A 4MTNA 3H3VH 3RZOH 1RIPA 2AKWB 1FJGL 4JI2L 1C7YA 4C3JH 4HJ7A 2I5MX 3TRZA 4JI2Q 1HZ9A 1VQJA 2KENA 4DR5L 3K7AH 4B3SL 4B3TL 1E7ZA 2R7ZG 3HOXH 4POFA 3UDFA 2HHHL 3CPFA 1TWHH 2ZJQA 4LW1A 5C44H 3I4MG 1HR0L 1OXUA 1PH9A 1N8RC 3KJOA 4A3GH 1IL2A 4HIKA 4BA2I 1VQ5A 2K5HA 4UP8A 2YYZA 1K83H 1LM0A 4GN5A 3UDXA 4JI7Q 5IYDG 3CCLA 2R6GA 3M7NA 4GKJQ 3S15H 1YBYA 1VQGA 2BH8A 3SGIA 2VW9A 3CCSA 3T1HQ 5ELNA 4YWLA 4X66Q 2VQFL 2K5NA 1VQCA 2B63G 2D0PA 2I5HA 3M4OH 1JMCA 1LUZA 4X62Q 1VQ7A 3W1GA 1A0IA 1FJGQ 2ZTEA 2DGYA 1KAWA 5IYBH 2WFWA 4LFCQ 4JYAQ 5AJ3Q 3AFQA 1AE2A 2VY3A 5ELOA 5IYBG 3J7ZC 4DR2L 4HJ5A 4GLAC 4JI8Q 4GNXA 3HOUG 4LFBQ 2JA8H 2ALYB 1U5KA 2F52A 3HKZG 4A3KG 4B3TQ 4A3LG 4JI7L 4UY8C 5GQOA 1PH7A 4YWMA 2Z6KC 1N33Q 1VQ4A 3PO2G 4X6AH 1U0LA 2JEBI 4A4IA 5BR8Q 2E5LQ 3MXNB 2K14A 3WWVA 4A3LH 3PSIA 1VQMA 2JA6G 3ULPA 2F4VQ 2R92G 4GKKQ 1CKNB 2HQLA 4IFDJ 5GAHC 5C0XI 4YHHQ 4YHHL 1IZ6A 4GNXC 1KC8C 5C0XJ 1ASYA 1L2FA 2AWOA 1HZBA 2K52A 4A3GG 4DV4Q 4AQYL 1R9TH 4BY1H 2F3IA 3HKSA 4DV2Q 1YHAA 2N49A 4HIMA 4PZ7A 2UXBL 1W3SA 1VQHA 4MNOA 3PIOA 1L1OB 2OCEA 4IPCA 5C4JH 3T1YQ 1N36L 1K73C 3FKIG 2EIFA 4BBSH 5JJKA 1XMOL 4YWKA 3E0EA 1XMOQ 3IRBA 4LUVA 3CCEA 1TWGH 4IPGA 4LF4L 3FKIH 4A3IH 1I6HH 1Y1WH 4NB3A 1OXTA 4IOCA 4OX9Q 3HOZH 5JEAJ 3KFUA 4GKJL 1P8LA 1K9MC 1WCMG 5FJ8G 2NVYH 4DV7L 5GROA 3KDFB 4YCUA 4YY3Q 4A3IG 4A3FH 3I4NG 4P71A 4A3BG 1JJGA 1AE3A 4BXXG 4QL5A 3S2DH 3FP9A 1SFOH 2K4KA 4IO9A 4GLXA 5C4XH 4GLVB 3GO5A 1NMFA 4LF8L 5GAGC 2WB1G 5IP9G 4BXXH 3STBC 4JI5Q 3TREA 1EUJA 2JK8A 4X66L 2VQFQ 4GNXB 5K36G 5IP9H 2NVQH 1MJCA 3M3YH 3ICEA 4DV0L 2I0QA 4A3MH 3A5UA 3PF4A 4A3EH 2CQOA 1OTCA 2R92H 2NZOA 1X3FA 4RG1A 1SR3A 3L7ZC 3U58A 1YJ9A 1HJPA 3CF5A 1X56A 2JA5G 1JE5A 3GTPH 1X55A 3K8AA 3K0XA 4LNQA 2CWAA 1VQKA 4JBKA 3AEVA 3L2PA 3CMEA 2VZAA 1MIUA 1TXYA 4DR3L 1HNZQ 4DR1Q 1KQSA 4GN4B 1Q46A 3U50C 4LF9L 2QGQA 1CKMA 4JOIC 4C3IH 4NPSA 1XJVA 1WI5A 5C44G 3ZJYC 2XGTA 2B29A 3I4MH 2ES2A 2A1AA 2UU9L 5M5YH 2PI2E 4R4QA 4JI4L 4A3JH 1UWVA 1VS0A 3CCMA 5IT9c 1Q12A 1X6OA 3HOYH 3FHWA 4ME3A 4B3RQ 1HNWL 1PYBA 4BY7H 5C3EH 1Y14B 5LMUQ 1SE8A 4APVA 3RN5A 1C9OA 2AWNA 4QJFA 1Q81C 3I4NH 4C2MH 4LWCA 4HIDA 3KF6A 4A75A 2WB1E 2UUAQ 4KHZA 1I94L 2IX0A 3PUWA 4PMWA 5M3FH 2UUAL 4B3SQ 3J80c 1I94Q 1QVCA 1S3OA 1PH6A 4UP7A 1NY4A 3CPWA 1H95A 1Q86C 3RNUA 1Q1EA 2Q2TA 4LF7L 3GDEA 1YI2A 3GTLH 2BA1A 4IPDA 4JG2A 3JAMc 2PI2A 1KIXA 2VS1A 3VDYA 3GD7A 1IBML 4YCWA 1VQ8A 1EQQA 5IWAQ 3UE0A 1NJIC 1M1KC 3NENA 1VQ6A 4IOAA 2NN6I 4JI4Q 4L5QA 2EQSA 2MO0A 1GKHA 4JC0A 1HR0W 4DR4L 4DV3L 1VQAA 3BZKA 4DV6Q 2R7ZH 1KL9A 3W5OA 2KCMA 1WCMH 5FJ8H 1HNXL 1XPRA 4L5TA 1L1OA 1HNXQ 5GADC 1EYGA 2B3GA 2IX1A 4A3BH 2JA8G 2UUBQ 3ERSX 1EQRA 3I4OA 2MNAA 2JA6H 2Y0SG 4LF6Q 2UU9Q 3CCQA 1B7YB 2ZJPA 2LXKA 4HJ8A 4OWWB 4LFCL 4JI6Q 4JYAL 1MKHA 2JEAI 1LYLA 2UUCL 3CC2A 1Q1BA 4IPHA 4J15A 3M4QA 4L5SA 4WJ3M 3ER0A 2BA0A 4A3JG
chains in the Genus database with same CATH superfamily
2ZJRA 4NP5A 1J6QA 1ESRA 4C2MB 2Z9HA 3P7JA 5LMNL 1FR3A 2N88A 4OGQC 3HKZE 2XN9C 3MC0B 1TKWB 3E9HA 5EBDA 1EIHA 1KLGD 4KHPQ 2K33A 3CP0A 1RJTA 1F9QA 2DNEA 3OIPA 4XT1B 3QR8A 3QOLA 4DV4L 5FO9B 5IIFA 1ICWA 4ULLA 5LMUL 3G6JB 1SAPA 4A3CH 3PIPA 4B08A 2DN8A 3Q22A 1PVOA 3ZYYX 2A69D 5JJIA 3KOJA 4O42A 3RLOA 2HHHQ 1X3EA 3GTLB 1SNOA 4MN3A 2CFMA 4JV5Q 2F0IA 2Q2IA 1L0YB 1IKLA 1K3BC 1RL2A 2NTTA 1QG7A 3A55A 5M3MH 4Q0FA 1CM9A 1VQBA 1B53A 5DNFA 3GTKH 1SMYC 3VR3A 2Z1CA 4HTHA 4EQNA 3F2CA 2OQKA 2EXDA 3IFDA 4MTKA 3NK9A 1ESFA 4OO1H 2IHFA 1N34L 4RFBA 3LNNA 1S40A 1O7ZA 4LUZA 1S5ED 3D31A 3OSOA 1X32A 1RHPA 2A6HD 1LACA 3HFZB 2VUMG 1SNPA 4KN4C 3A54A 1E3PA 1Y8NB 3C46A 4WJWA 5M5XH 4LF4Q 3H91A 4BA2I 4OO1I 4X64Q 5C4HA 2PQAA 3JC66 4A3GB 4FXDA 4P75A 3X3MA 1T5XD 2MO1A 3GTGH 2YTXA 1SXTA 1TWHB 2E2HH 1HNWQ 1HRJA 3A8KE 4CDFC 4F8MA 1STHA 3RZDH 3I2ZA 4GKJL 3CCJA 3PO3G 5EPJA 3OTOQ 2Y0SE 1AN8A 3GP7A 1UEBA 3KF6B 4JBMA 4XTCS 5GAEC 1DGSA 3C3LA 1ET6A 5IODA 5C0XH 4BY7G 4EVOA 1CI3M 2PMZE 3K59A 3HOVH 3D4WA 2B2WC 5C44B 2A6EC 1CKNA 3GTGB 1CHQD 2JYOA 2XRSD 5EAYA 3K7AB 3F2BA 2NVXH 2LXJA 2TMPA 3J7AV 1YVCA 1XX8A 1NCVA 2ENBA 4HJ9A 4AIMA 2HDMA 4JCVE 4BBSG 2XIWA 2UXCQ 1VQIA 2F0HA 1WJJA 1LTTD 3CW2C 1SYFA 3HOWH 4RGMA 1YITA 2KUMA 2L15A 1EFID 2N55A 1CZGA 2ZXRA 3BJUA 1AFPA 2F0MA 2XVSA 5E7NA 1WVLA 1GUWA 2CKZB 4EQ5A 3F2UA 4A3IB 3DEOA 1K8OA 3H3VC 1VQDA 4I7ZC 3KDFA 1BXTA 3I7FA 3PUZA 2KVMA 4G7OC 2F0UA 4A3EG 1G8ZD 2VQEQ 3EQLC 2KHSA 4LF8Q 1D8LA 2SOBA 2RHQB 3FDTA 2WKDA 2BDOA 1A62A 5KEEA 3X3NA 2L11A 3TBIB 4DV0Q 2JA7G 1B9MA 1C4QA 2B2VC 1A2TA 3M9BA 1ZKOA 5L37A 2KHIA 5D3IB 4DAYB 1K8AC 4IJHA 4A3KB 5C3EG 4DR1L 4C3HB 3BVZA 4KHPL 2G9HD 2RVLA 5BR8L 5HY6A 4LF6L 4KY5A 5E3FA 1LTBD 1YEZA 4TSSA 4HCEA 1A8VA 4QIWE 4CHTB 4GOPC 4U673 4U68A 4DNRB 1FNWA 2KCTA 3CC7A 2WP8J 2F4IA 1HXYD 4OONA 3FPPA 3OHXC 1PH4A 1X65A 4DR3Q 2BE5C 4X64L 3SHLA 1J5EQ 3A8JE 1I4RA 4H0LC 3TSSA 3KUPA 1P16A 3T51B 3EBEA 4DNIA 3HOYG 1XMQL 4S3SA 3SK8A 4NXNL 1LTRD 1W6JA 3NE5B 3K81C 1B70B 2UUBL 4RMFA 3I91A 3E0JA 1GD7A 3VR2A 5D14A 1Z47A 2EYLA 4B3MQ 4ZYSA 3PCOB 2MUYA 5IP7H 1XXGA 4O0AA 2FINB 5ELDA 5J39A 1I4XA 5IT9E 4CJ2C 3R93A 2ZTDA 4JI3Q 3JAMi 2E2DC 4BS9A 2C35B 1JCKB 3A56A 2A6HC 3NBIA 2F03A 4PZ8A 2N78A 1Z7TA 4DR6Q 2UXCL 3UDGA 4CGYB 2KJXA 4FF3A 4FF2A 3HOWB 2GVBA 3TP5A 4O2DA 2EYPA 2KBNA 2L4NA 1H9MA 4DV2L 2LSSA 4A3FB 3H3VH 4MTNA 2Z8LA 2F0NA 1B9NA 2JN4A 2AKWB 3O13A 4X3KA 4HJ7A 2KENA 2XNAC 4B3TL 4B3SL 3T16A 3UDFA 1DOLA 2AUKA 4C3JG 3CPFA 1DYQA 3W2DA 1HR0L 1OXUA 1EWHA 1N8RC 4A3GH 1PZJD 1FD7D 4UP8A 2F3WA 1LM0A 2YYZA 1CK1A 1TS5A 3U9OA 4HSPA 4A3MB 1JORA 3T1HQ 3SGIA 3CCSA 2JXMB 1U9RA 4IN3A 5ELNA 4YWLA 2K5NA 5EKIA 2B2UA 1LUZA 4IUPA 1VQ7A 1CQFA 2FHTA 1UNSA 4JPBW 1KAWA 3GTPB 2WFWA 1GUNA 2F0SA 4JK1C 3SE0A 1BO0A 2LFNA 4GNXA 4LAAA 4A3KG 4UY8C 5CV6A 4YWMA 1JC7A 5TSSA 3VA7A 4E6IA 1JR0D 2XSCA 3DM1A 1VQMA 2K5QA 3M4OB 3H94A 3ULPA 2J7ZA 4IFDJ 1SJED 2HQLA 4V190 2B2YC 2FFKB 4HMIA 1I3QB 1ASYA 2K52A 4RHRA 4DV2Q 4HIMA 2F0VA 2WAQB 1A6XA 4MNOA 2EIFA 4ZKBB 2CW0D 3K57A 1GHJA 1HPCA 2F0TA 1EY6A 3FKIH 4A3IH 4RH6A 2NVTB 4NMZA 4IOCA 4OX9Q 3I4NB 1K9MC 1U4MA 1F2ZA 1BCPC 3KDFB 1GHKA 3K5LA 4P71A 4A3BG 4O1NA 5JVG3 2RDHA 3GO5A 2GA4B 3RUZA 2B63B 4BXXH 3TREA 4A3BB 2VQFQ 3BYYB 3J80L 1PDQA 3NQTA 3GTJB 1H9KA 2I0QA 2A5HA 4GZYC 2Z4IA 3PF4A 2R92H 1YJ9A 1HJPA 3CF5A 1X56A 1ENFA 3K8AA 1EWCA 2H1EA 3K0XA 4X3TA 1VQKA 3L2PA 3I4LA 1EY9A 1HNZQ 4FF4A 1Q46A 4C3IH 5C5LA 4KN7C 3I4MH 3ZJYC 4G7HC 2Z4HA 3RMHA 3BS1A 2UU9L 4R4QA 4JI4L 1KNAA 4K2KA 1Q12A 3HOYH 2CHBD 3QWNA 1XTCD 5JPNC 4QJFA 4DF7A 3VYUA 4OIKA 5KIXA 3OMCA 4XYOA 4FXKC 4KHZA 2WB1B 1I94L 2IX0A 5M3FH 1BBXC 2UUAL 1LT5D 3J80c 4CKCA 1S3OA 2G9DA 1SYDA 3RNUA 3GTLH 2RQXA 2VS1A 3JAML 1F2LA 3QJYA 3GD7A 3TP7A 2PYKA 3NENA 1LTID 2NN6I 4L5QA 5T1IA 2K01A 1DJRD 1I6VC 4C3IB 4DV3L 5FOBB 3W5OA 1WCMH 4K8IA 1XPRA 1HNXQ 1EYGA 1J8IA 3K5NA 2JA8G 3I4OA 5LHY1 4LF6Q 1HUMA 4LFCL 1KABA 4JYAL 1MKHA 3I73A 2JEAI 1TR5A 4FYDA 1ICFB 3M4QA 1PH9A 4K5XA 1EYAA 1NR2A 1PYWD 1ZYRC 4KY6A 3S1MB 4DUZQ 4EGVA 2BCOA 1IW7D 5LMNQ 2QDBA 4XXEA 2EDGA 3KLWA 5FLMH 1V43A 1SMXA 1GM5A 5IGGA 5CV5A 1NNXA 1X3PA 3IFTA 1WFQA 2VUMB 3HOUH 5CBAE 1KD1C 1CTMA 3PO3H 2JA5B 5J3BA 1LT3D 2CWPA 3KF8B 5J22A 3EFXD 2QA4A 3D3RA 4X65Q 4DXGA 4K5WA 1K8MA 3CMAA 4BBRH 1I4QA 1QB5D 3W1BA 4EQOA 2V1CC 2D5DA 3R2IA 2EPBA 1DCZA 1YNJD 4A3DH 3RN2A 2NZHA 4XDXA 3JAME 1XNQL 1PV4A 2CH4A 4JI8L 3W3AA 4R9WA 5LL6S 3TQYA 4B9WA 3CAMA 2N8NA 1JT8A 4QMGA 1RKNA 4AYBE 1SBBB 3G7LA 1F2MA 2A73B 1HTLD 4KTAA 1VQEA 1GJXA 4GOPB 1EEFD 2K7VA 4BBRB 1HA5A 4LFBL 3T1YL 4LF9Q 2B8GA 4LK1C 2A6ED 4PZ6A 1VCIA 4HJAA 2IL8A 3V05A 3S2HH 1E1TA 2CW0C 4FVMA 3PIO3 4DUYQ 2ATWA 4ZRZA 2B8FA 4HIOA 1JWSD 1EY4A 4DU9A 3DUZA 2JQOA 4J6HA 2YU9H 1PH3A 3MEHA 1TS2A 3GTOH 4NKLA 3B6YA 3M4PA 3G4SA 3NELA 4CKBA 4JI1Q 4P72A 1A15A 4ZLTF 1MSGA 3VA5A 1O7YA 4OWXB 4DR7L 1HZAA 1H9JA 3MHBA 2D0OA 4YCVA 1DM0B 1NBWA 3URYA 1K0SA 4CJ1B 5M5WH 4C56C 4RHSA 3SK4A 2PQAB 4DPGA 2R7FA 4HEDA 4R4TA 1BQQT 1SN8A 3S2HB 1KRTA 1QNKA 1DXMA 3AFPA 1I50B 3BDOA 1NMGA 2NYZD 5CGKA 1PH1A 1PRTC 1Q8KA 1EIGA 4UPAA 3MFYA 3AQQA 5C4XG 2Y0SB 3M85A 4POGA 2C5CA 1GUGA 1KTKA 3EVQA 3I55A 1VMCA 3SK6A 3OWEB 1EZ8A 1KRSA 3S17H 5FKAC 1WOCA 5LMNW 1SJHD 4IUVA 3DWAA 1SLJA 1E1OA 5ELFA 1EFWA 4LFAQ 1A3TA 4LFAL 2F0EA 5E4WC 1B2TA 1VMPA 4YY3L 1YNNC 2MFIA 3S1RH 2CH4W 4K0KL 2TSSA 5A2QE 1Q7YC 1B3QA 3NPPA 2Q8IB 3U9SA 4G7ZC 4B3ML 4ZK9B 2HUGA 4JI6L 3VR6A 3I8ZA 4KD4A 3I72A 5FO7B 4DAMA 1UEAB 1RTNA 2PZWA 4CBVA 4R8NA 5IWAL 4LF5Q 3FPUB 4DV3Q 4KJNA 1BBWA 1D7QA 2HIXA 1SNMA 2DUDA 3KJPA 1N32Q 2O5JC 1ET9A 1STYA 1L0XB 4R1JA 1VQOA 1FNUA 2PNHA 1GO3E 4HCSA 4OXPA 4AYBG 1YHBA 3H0GG 3RLFA 5FO8B 3CCUA 4ID6A 2ICEC 3LGJA 2Q8RE 1F2YA 1CHPD 2FMCA 4OWTB 3GV3A 2YTVA 2F0OA 2E2JH 5EPKA 1CSPA 1V9PA 1ENCA 1JJ2A 3E5SA 5IGCA 4UDUC 1Q82C 4IFDG 2OTJA 1EU4A 4K2LA 5KRUA 1O80A 1TWCH 3OWFA 3J7AF 4HSVA 3S1QB 3A74A 1PZID 1Y1WG 2D62A 1YZ6A 3SVMA 5DM73 4UHVA 5G3LF 4Y7NH 3GTMB 4RAUC 3CQZH 4FO2A 5IYDH 1TWFH 2A68D 1EWIA 1PMRA 4LF5L 3CCRA 4KKSA 1IBLL 1DZ1A 1CQVA 1S5FD 1BCPD 4KI0A 3J80E 5JJLA 2KEDA 3C2PA 4DR6L 2BE5D 5AFWA 4DFAA 4FP5D 1PTOF 3L3OC 1EOVA 4R4CA 5I6WA 5IYCH 2B2WA 4DV1L 4A3DG 1VQLA 1E22A 2F0KA 2K75A 2WAQE 3RZOH 2KCNA 1VDZA 1WTOA 2PW5A 1R4QB 2I5MX 4JI2Q 1D2BA 1HZ9A 1HQRD 2X69A 2R7ZG 3HOXH 2O2LD 4C3IG 1U4PA 1TWHH 2E2HB 3KLSA 3I4MG 3VR4A 2WV6D 1AZPA 1EOTA 1D5ZC 1VQ5A 3UDXA 5JEAH 1K83H 2R6GA 1T5EA 2HCCA 3S15H 4N9TA 2BH8A 2VW9A 5CMDA 1VQCA 2D0PA 3ITPA 3VYSA 4ABNA 1FJGQ 4A93B 3D8GA 1AEXA 2YU9B 4H44C 5AJ3Q 3AFQA 4H7BA 1AE2A 2IPKD 5IYBG 4DR2L 4JI8Q 2B2YA 4FXGC 1IKMA 4A3LG 1LTGD 1PH7A 4KK7A 2Z6KC 4X6AH 1VQ4A 2MGSA 5BR8Q 3FRPB 2L5TA 3WWVA 3PMFA 3PSIA 2F0QA 1PZKD 1GOZA 2F4VQ 3KK7A 4GKKQ 1CKNB 1PRTD 5GAHC 5C0XI 4YHHQ 3HGBA 4GNXC 4ZCKA 1S5BD 4A3GG 5NUCA 4BY1H 3KLSX 2F3IA 1YHAA 2N49A 2UXBL 1X3QA 3PIOA 1L1OB 2HDLA 2OCEA 5JJKA 2NUCA 4YWKA 3E0EA 1XMOQ 3IRBA 1I6HH 4NB3A 3NXWA 1DD2A 3KFUA 1P8LA 1WCMG 5M3FB 5FLXL 2NVYB 3S2DH 1SFOH 5KNDA 1PTOH 5C4XH 2DNCA 4NDXA 3AB9A 3STBC 2I07B 2XRQD 4X66L 4CDEC 3LWUA 5CV8A 1WCMB 5K36G 5IP9H 3M3YH 3ICEA 4RCNA 3A5UA 3L9AX 1LLRD 2NZOA 1X3FA 3U58A 2BOSA 3EROA 2CWAA 1Y1VB 3DHQA 3AEVA 2VZAA 1E0BA 3J81L 1K28A 2F0JA 4JOIC 4C1NI 1A2UA 3D6CA 1CA6A 5C44G 2XGTA 3PO3B 4A3EB 5M5YH 2PI2E 3MVVA 4A3JH 4YIJA 1JOKA 1X6OA 4ME3A 1HNWL 4BY7H 3IL8A 5C3WA 3PO2B 3K58A 1SYEA 3HOZB 1F9PA 4N9PA 3C1EA 4HIDA 2F1MA 1WTQA 1TIID 2WB1E 1U4LA 3PUWA 2B63G 2EZVA 1I94Q 4UP7A 1Q86C 4LF7L 1SYGA 4QF4A 3GDEA 1HCZA 1YI2A 4JG2A 2BA1A 1RCVD 3JAMc 1KIXA 1R9TB 3VDYA 1QILA 1EQQA 5M5YB 3NSWA 5HURA 4IOAA 4N8FA 2A68C 4JI4Q 4DR4L 4BBSB 1GKHA 1QJOA 3BZKA 2L9HA 2B2TA 3P20A 1KL9A 2A74C 1TS3A 2ZXOA 2JA6H 3S15B 2OF1A 1Q3LA 2UU9Q 3CCQA 4HJ8A 2EY2A 3GQBA 3LWEA 1TWFB 1LYLA 3CC2A 3A7LA 4J15A 1SYBA 4L5SA 3CU7A 4X65L 1HTPA 1KDCA 2K32A 2ZM6L 1O7IA 3BYTB 5EBCA 1WTPA 3CRKC 1VQNA 3D6WA 1IXRA 2SDFA 4KLKA 2VL6A 3HOXG 1GUSA 1XNQQ 2PCFB 3HOZG 4M8AA 2PZTA 1E2WA 3L0OA 3GV6A 4XQQA 1YJWA 3GTJH 3IAYA 1I5FA 4AH6A 3F2DA 5EGTA 3NWTA 3OW7A 3IKJA 5DAUA 2OTLA 4OELB 5CYUA 2VNUD 1K0RA 4BY1B 1TT2A 1MJEA 1LTLA 2E76C 2MP1A 5JJZA 4IALA 4CDDC 4PQXA 3N52A 1JQYD 4EX5A 1MBYA 3KLRA 3BG3A 2CQAA 2OQ0A 3BDLA 1C8CA 3H3VI 1VQ9A 2K6AA 3U4VA 4K8JA 1AZQA 2JA7H 4M1UB 1NE3A 1YIJA 5ELCA 1PH5A 1PH2A 1I50H 2AMCB 4AYBB 5C3XA 4A3FG 3K80C 4TRDA 4GN3B 2NZ1D 2LS01 3I4MB 3NQIA 2RHSB 5FLXc 2RDFA 4IZ8A 4A93H 2JJQA 1O78A 2LY7A 3BVMA 1BR9A 4RKBA 5C4JB 2UXBQ 2XTIA 4K14A 1PFSA 2RBMA 1FGUA 4LJZC 1UE6A 3PUVA 1TWAH 3MEFA 5DEHA 1WD0A 1CUKA 3K7UC 1Z9FA 5K5PA 1A3UA 3TZUA 1C0AA 1KDAA 2F4VL 4DV7Q 3Q23A 2K5VA 4JBWA 3WOFA 4F7XA 1LV9A 4UAIA 1XYIA 3J81c 3NBHB 1RODA 2EJGC 1PYSB 3ND9A 1N9WA 1VF7A 2K05A 3NTKA 4IUTA 1WTXA 1MHWC 4HMJA 4KKTA 4JI1L 1PTOC 2WIIB 3H0GH 4MHEA 5C0XG 1W6KA 3RLNA 2A69C 5KNCA 3VR5A 3T56B 3DXJC 2G5DA 2NVTH 1TWAB 1K3RA 4HAEA 3RD4A 4IQZA 5AJ3L 5CC4A 2OXPA 4QGUA 2L0CA 3DMUA 1QZHA 2HD3A 1VF5C 3UE1A 1N33L 5IGEA 1UE7A 3E3XA 1XPOA 5T1GA 3MXGA 5IP7G 1LTSD 3H0GB 1HH2P 3CRLC 3F8TA 4ZUIA 1YNJC 1EIYB 4G4KA 2JE6I 5FLXE 1JJCB 1ASZA 3TMEA 1G2SA 1S4ZA 4H02A 4DAPA 3S2DB 2K1BA 4C3JB 2XWBB 2WINB 4XQNA 2IX3A 3PIP3 1YHQA 2L55A 1J5EL 1IL8A 4A3CG 1DONA 2UXDL 1SE4A 1KLUD 1EEID 2UXDQ 2J4XA 1W2BA 1HZCA 1QE6A 2EYJA 1ONLA 3PUYA 2LKVA 2JSOA 4DR4Q 5LL6X 4P73A 4Y7NB 3GTMH 5E1FA 2O5IC 3F1ZA 4NXNQ 5IYCG 2B39A 3MFGA 1H9SB 2EY6A 1I3QH 4ZQ3A 1OXVA 2EJFC 1IYJB 4QB4A 1TWCB 1M90C 3PGZA 2C9OA 3N6RA 5G3LD 3CQZB 3S14H 2QCPX 1FGBD 2DY7A 2RCNA 1I4GA 1Z6HA 2CCZA 1YNXA 1JICA 3KBGA 3I3CA 1J9OA 1ZXTA 1TY2A 1IBLQ 4C3HH 4PMCA 3HKZB 2AHOB 4DK6C 1OXXK 2EOTA 5C5MA 3SK5A 1C48A 1AH9A 2E5LL 3FKIB 4UP9A 4CDCC 1QVGA 2Q2UA 2RDGA 5M9OA 2GN5A 1ILQA 4GKKL 1N34Q 3S24A 2EY5A 3BZDB 2RSNA 1S5DD 2E8GA 4DV5Q 2NB0A 1IBKQ 5ELEA 3ND8A 4QQBX 1UUPA 4DR5Q 1G91A 1N36Q 1HNZL 4F87A 1QZGA 1CKOA 2M00A 1CFMA 3I90A 1FVIA 5JEAG 4DAYA 4QIWB 4ALPA 2ID0A 5JVH3 2F0DA 2Z6BA 1TU2B 1CSQA 5M3MB 3G71A 1PXUA 3NTIA 4PG3A 1SROA 3HOVG 4KMUC 2QW7A 3T53B 1XPUA 2EYOA 2F3VA 4BY1G 4MZ9A 2RF4A 1TWGB 2F0FA 2K50A 3BZCA 5IY0A 5JPMC 1JB3A 2UUCQ 3KF8A 5CV9A 4DNTB 4IJLA 3OYYA 3R3OA 1XWEA 2H5XA 3CHBD 1JOQA 2YV5A 2ZM6Q 4A3JB 5A2QL 1ZEQX 3Q8DA 2R93G 2K28A 3VYTA 4QUFA 4OL7A 3J81j 3SR1A 5I9OA 1PFBA 1HR0Q 3AYHB 5M3FG 3RZDB 3S1QH 1IW7C 3K0YA 1WTWA 3STBD 1QUQB 3ONAB 2A19A 1Y8PB 2MPMA 2R7DA 4L5RC 4XIGS 2BH2A 4X3UA 1V8QA 3HZXA 2SNSA 2NN6H 2ZXPA 3GTQB 1RIPA 1FJGL 1MI2A 4C3JH 1U4RA 2NVXB 1TVXA 4CKEA 1VQJA 2EY1A 3K7AH 1S5CD 4IUQA 1E7ZA 3EA6A 1G6ZA 2ZJQA 5C44H 2AQ3B 2RA4A 1EU3A 4RCOA 1IL2A 3QIAA 1LT4D 4GN5A 5EJWA 4ZKCB 4JI7Q 5IYDG 2EE1A 3M7NA 4GKJQ 4QCLA 3R8BA 5D65A 1YBYA 1VQGA 2WACA 5K36H 4X66Q 1H9RA 2I5HA 5JOBA 3HEJA 3W1GA 2ZTEA 3HOUB 5KNBA 4KHVA 5ELOA 2F0LA 3J7ZC 1STNA 1BF4A 4PMBA 3HOUG 2JA8H 2ALYB 1U5KA 2F52A 3HKZG 4B3TQ 3AMUA 3WOEA 1N33Q 3PO2G 4JVZA 2JEBI 5D3DA 4A4IA 4ZUJA 2JA6G 4C1NK 4WORA 2P5ZX 4YHHL 1IZ6A 4ZAIA 4I7AA 1L2FA 3QG1A 4Z9CB 1QWYA 5HGTA 4AQYL 3HKSA 1D5MC 3A7AB 4PZ7A 1HHVA 4PV1C 1VQHA 1N36L 3E6ZX 1GUTA 4DGZA 3FKIG 1XMOL 2PZUA 4LUVA 3CCEA 4IPGA 4K5VA 4G57A 4LF4L 1OXTA 3M4YA 4RGNA 1Y8OB 3HOZH 5JEAJ 2OEOA 4DV7L 4YCUA 3I4NG 4A3IG 5EPLA 3OPOA 1AE3A 4PNYA 4BXXG 4QL5A 3BDCA 3FP9A 5E4XA 1TQOA 3PQIA 4GLXA 1NMFA 5GAGC 1DOKA 2WB1G 1GXDC 4JI5Q 1EUJA 2JK8A 4J8QA 2PNRC 3DWQA 5I2XA 4DV0L 3RZOB 4OIJA 4A3MH 2CQOA 1LABA 3MZ5A 1SR3A 3L7ZC 3J81E 4CJ0B 2R92B 4WRDA 3TN2A 4XQJA 2B2TC 2JA6B 1NSNS 1TXYA 1FYCA 4DR3L 2HCIA 2PO4A 1KQSA 2QGQA 1CKMA 1STBA 5I6YA 2M9VA 1XJVA 2AUJD 2B29A 1V1OA 2A1AA 3I70A 1F77A 1VS0A 3GTKB 1EY7A 2QKIC 1B3AA 2EXZA 3FHWA 4B3RQ 1Y14B 5LMUQ 3RN5A 1EQVA 4LWCA 1HQMC 2J0TD 2CVRA 2SNMA 3KF6A 3C1FA 4A75A 3A8IE 1PRTF 4B3SQ 2E2JB 1QVCA 1PH6A 1NY4A 3CPWA 1H95A 2I46A 5CBEE 3MWYW 3HOYB 3V2TA 3H6MA 5M5XB 4IPDA 2PI2A 1VQ8A 4NW2A 5IWAQ 3UE0A 5I4DA 1M1KC 4V0BA 1VQ6A 1NUCA 4JC0A 2BDNA 1VQAA 4DV6Q 3S9WA 1KAAA 5FJ8H 5GADC 4DA2A 1HA6A 1EQRA 2MNAA 2Y0SG 3HP3A 2LXKA 2UUCL 5C4ZA 1HUNA 1EY5A 4WJ3M 3ER0A 4RKLA 4A3JG 3K6OA 1VQPA 2DJGC 4JI3L 2SEBD 1X54A 2NN6G 2JA9A 2FMMA 3S1MH 2VB3X 1D5XC 5CR3A 1E24A 3I56A 5I2YA 1PHJA 1M4VA 1V1QA 2K04A 5F2DA 3ULLA 3PV0A 1LTAD 5EKLA 4ILWA 1OXSC 1SDFA 2D2CC 1KNEA 2JP1A 2I5LX 1ZYRD 4R4OA 3T1HL 4BBRG 3P75A 3DLLA 2AQ1B 2L12A 5DLQE 3TEHB 1BBUA 1IBKL 1E2ZA 1Y1VH 4N8X1 5EKKA 1D6EC 4BA1I 3HOXB 1PTOB 1R4PB 1L0WA 3NBHA 1B44D 4JV5L 4Y52H 3KBXA 4Q5VA 1PA6A 2PW7A 1SE2A 1KHIA 1Y1WB 4JOIA 1A63A 2Q2HA 3OIQA 1JE4A 4DK0A 4WJ4A 5JAVA 1G291 5IGDA 3Q24A 3GTQH 3A5ZB 1IYVA 2Q8TA 3V96A 4GS3A 3S16H 1B8AA 1UE1A 3CCVA 3PO2H 1SSOA 1V1PB 5J1ZA 3ULJA 2WAQG 3BVGA 4KJOA 4LMQD 5C6AA 4XT3B 1Y69U 4AQYQ 5CV7A 4HR7B 1MD2D 2R7ZB 2OT2A 1AW7A 4A76A 2KOLA 4DV5L 3J81i 2RCFA 4C3HG 1Q8IA 4RWSC 2Z6KA 4OX9L 4DK1A 1BKBA 1PH8A 1FNVA 4B3RL 1NR4A 1M8AA 2FXQA 3S16B 2EYMA 3MXPA 3T13A 4IFDI 1PFMA 1XMQQ 5COYA 1BVSA 5C3EB 2GVAA 3M7GA 4QY7A 3OTOL 2IT1A 3U4ZA 3WDNA 1FL0A 1EIFA 4TQUS 4A3MG 3DEPA 1L1OC 3GTOB 1QVFA 4IFDH 1LO5D 4IURA 4KD3A 3J7YW 1JB7A 1OO9B 1X9NA 3CKIB 1SYCA 4A93G 1G2TA 1RF2D 3TDQA 4FDBA 3RR5A 1YJNA 1KXLA 1CZWA 1EYDA 2EYHA 3H15A 3KYHC 4HN7A 3HS0C 2M2LA 4JI5L 5BN5A 1UE5A 5FLMG 3S17B 5I9PA 3OMGA 2QILA 1QUQA 1G51A 1CA5A 1EYCA 2E75C 3BU2A 1WYDA 5CORA 3FMCA 4X3SA 2EVBA 3AU7A 3UDIA 1B50A 4L6TB 3TS2A 2R93H 1V1PA 4DXFA 1WTHA 4DR7Q 1F9SA 3ERQA 4JI0Q 3HG9A 1BCPB 1Q90A 2HIVA 4LUOA 2Z0SA 1XNRL 5A35A 1XNRQ 1N32L 1IHZA 1F9RA 1EL0A 4ODGA 1ILPA 1D1IA 1SMYD 1IYUA 4L8JA 1XTDA 2VQEL 4K6LA 3DM3A 3CXCA 2ZT9C 4XYQA 2N3SA 5FK9C 1VQFA 3S1NB 5H1SE 3S1RB 3CC4A 2KCCA 2V4DA 2OWOA 2R93B 4X62L 4OO1G 1QOHA 1S72A 3HOVB 2ASBA 5ELBA 2ZTCA 1T9HA 1IBMQ 3EN2A 1X3GA 2DY8A 3G6EA 3NEMA 4F88A 5C4XB 3E9IA 2VUMH 1AP0A 3MTSA 3SEBA 4JI0L 4FF1A 2K03A 4JBJA 3MA2B 3S1NH 2B2VA 1WTRA 2IY5B 1STAA 3A0JA 1I6HB 2QEJC 2NBFA 1H9SA 3PUXA 4R4IA 3UI2A 4DV1Q 1EY0A 4WFN3 1JOOA 5KYLA 2YTYA 1BDOA 3S14B 4NXMQ 2KHJA 3TZDA 3FEWX 4JW0A 4DUZL 2JA5H 2RKSA 2X6LA 3TS0A 3MXNA 3MXUA 4DK3C 1SEBD 2HT1A 1SNQA 1KDBA 5DM63 4DKAC 1ML0D 4LF7Q 4DAVA 4DUYL 4P74A 3EIVA 1II3A 1YNND 4RGOS 4R8IA 3D0FA 2KQ3A 3QB3A 4BY7B 1SNDA 4K6DA 2LMCB 4KY7A 4K0KQ 5EQ0A 5KGUA 4P2CB 4TKOB 1TS4A 3OW2A 2H4OA 3J80i 2E2IH 4GOPA 3HOWG 1GUOA 4DR2Q 1K8GA 5ISRA 2MJ8A 3TP6A 3J7A5 2NWGA 2QEXA 1NTGA 4IUUA 5IT9L 3PF5A 5HGQA 2A8VA 2F0WA 1EZ6A 2K5WA 2R3ZA 2MQHA 5IE8A 1WD1A 1D1KA 3P1HA 4ME5A 1G6PA 4DV6L 2EYFA 2HQEA 3VYRA 3G48A 2E74C 3CD6A 1Y1VG 4TVAB 2B63H 2KECA 1GVPA 3K5MA 1A3VA 1DOMA 5M3MG 2PQEA 2IHEA 1SRUA 4A3KH 4NXML 5IGBA 3DWPA 3LX0A 4JI2L 1C7YA 3TRZA 4DR5L 4J1MA 4POFA 2HHHL 1RDPD 5M5WB 3FVQA 4LW1A 1BOSA 1I4PA 4A3DB 2VB2X 3KJOA 4HIKA 2K5HA 4FNFA 3CCLA 2IW3A 3H09A 1K83B 2VQFL 4B9XA 2IJ0A 3M4OH 1JMCA 4X62Q 1STEA 1A0IA 3QO2A 1MGSA 2DGYA 3TP8A 1QCBD 5CV4A 1SE3A 5IYBH 4LFCQ 4JYAQ 2VY3A 1PTOD 4HJ5A 4GLAC 4LFBQ 1E2VA 2JA7B 3NUCA 1CT1D 4JI7L 5GQOA 2L1BA 1O7LA 1U0LA 3R2TA 2E5LQ 2XWJB 3MXNB 2K14A 4A3LH 5IGFA 3OOCA 2R92G 5IOCA 1JWMD 1KC8C 5C0XJ 1WTVA 2AWOA 1HZBA 3K5OA 4DV4Q 2B2UC 1R9TH 4MIUA 1SNCA 1W3SA 5KYIA 3T1YQ 5C4JH 4BBSH 4IPCA 5BN3A 4KKUA 4RGTA 1K73C 2NVQB 3NHHA 2PMZB 1TWGH 1Y1WH 3NWSA 5FJ8G 3M3YB 2NVYH 4A3FH 3EJIA 5GROA 4YY3Q 1PLFA 1BNZA 2KA7A 1JJGA 3SDZA 1BUVT 1LT6D 1NAPA 2K4KA 4IO9A 2O4XA 4GLVB 4OHJA 4LF8L 4DN4M 5IP9G 1PRTB 1SFOB 2EJMA 4GNXB 2RSOA 2NVQH 1EY8A 1MJCA 4L63B 1BCPF 4A3EH 1OTCA 1TY0A 4RG1A 2DJFC 2JA5G 2IWHA 2ICIA 3MAQA 1JE5A 3GTPH 1B4OA 1X55A 4LNQA 4JBKA 3CMEA 4IUNA 2F0GA 1QNUA 1MIUA 3SXHA 4DR1Q 3D4DA 4GN4B 3Q0AA 3U50C 4LF9L 3NTHA 2QDLA 2KEEA 1PFNA 4NPSA 4EQPA 1WI5A 4I65A 4KV6A 2ES2A 1HFNA 2X6GA 1UWVA 3CCMA 5IT9c 4OEMB 2PPBC 1HFGA 1PYBA 2MHVA 5C3EH 1SE8A 4APVA 1C9OA 2AWNA 1Q81C 3I4NH 4C2MH 4RA8A 2D9UA 3T4AC 1RD9D 1RTOA 2UUAQ 1B1ZA 4PMWA 2JA8B 1STGA 1Q1EA 4QUCA 2Q2TA 4H13C 2VXWA 1EQTA 1I4HA 2AQ2B 1IBML 4YCWA 2K5DA 1NJIC 2F0PA 1ENAA 2QF7A 2EQSA 2MO0A 3D4RA 1HR0W 1MSHA 2FJ2A 2R7ZH 2KCMA 1HNXL 5BN4A 4L5TA 4BWGB 1L1OA 2E2IB 4A3BH 2B3GA 2NTSA 2WKCA 2IX1A 2UUBQ 3ERSX 3QOJA 1B7YB 2ZJPA 4OWWB 3Q6SA 1UAPA 4JI6Q 1Q1BA 4IPHA 3NP8A 1JWUD 3HRZC 2BA0A 2R61A
chains in the Genus database with same CATH topology
1VQPA 2ZM6L 4JI3L 2ZJRA 1X54A 4DUZQ 2NN6G 2JA9A 1O7IA 1J6QA 5LMNQ 3S1MH 1VQNA 5LMNL 1IXRA 4KLKA 2VL6A 3HOXG 1E24A 3KLWA 5FLMH 1V43A 1SMXA 3HKZE 3I56A 1GM5A 1XNQQ 1PHJA 1V1QA 3HOZG 3E9HA 3ULLA 1WFQA 4KHPQ 3CP0A 3PV0A 3HOUH 3L0OA 1KD1C 1OXSC 3PO3H 5J3BA 1YJWA 3GTJH 2I5LX 4DV4L 1I5FA 2CWPA 3KF8B 4R4OA 4AH6A 4BBRG 3F2DA 3DLLA 2QA4A 3T1HL 4X65Q 5LMUL 5DLQE 4A3CH 3TEHB 3CMAA 4BBRH 3PIPA 1BBUA 1IBKL 2OTLA 1Y1VH 4BA1I 2VNUD 1K0RA 1PVOA 3W1BA 2V1CC 5JJIA 1MJEA 3KOJA 1L0WA 3RLOA 2HHHQ 1X3EA 4A3DH 3RN2A 4JV5L 1LTLA 2NZHA 2CFMA 4Y52H 4JV5Q 1XNQL 1PV4A 1PA6A 2Q2IA 4JI8L 1KHIA 1RL2A 4JOIA 1A63A 2Q2HA 4EX5A 4WJ4A 1G291 3GTQH 3A5ZB 3TQYA 5M3MH 4GS3A 3S16H 1B8AA 1UE1A 1VQBA 3CCVA 2OQ0A 3H3VI 3PO2H 1VQ9A 3U4VA 2JA7H 3ULJA 3CAMA 1NE3A 3GTKH 1YIJA 1PH5A 2N8NA 3F2CA 2WAQG 1PH2A 1JT8A 1I50H 2AMCB 4A3FG 3K80C 2OQKA 4AYBE 2EXDA 4GN3B 2IHFA 2RHSB 5FLXc 4AQYQ 1VQEA 1N34L 4A93H 4GOPB 2JJQA 1S40A 4LUZA 3D31A 4A76A 2XTIA 2UXBQ 4LFBL 1PFSA 3T1YL 4DV5L 3J81i 1FGUA 4LF9Q 2VUMG 1UE6A 3HFZB 4PZ6A 3PUVA 1VCIA 1E3PA 1TWAH 3MEFA 4X65L 4HJAA 1CUKA 3K7UC 1Z9FA 5M5XH 4LF4Q 1E1TA 2Z6KA 4X64Q 4DUYQ 4OX9L 2ATWA 1BKBA 4HIOA 3S2HH 2PQAA 3JC66 1C0AA 2F4VL 4DV7Q 4P75A 1PH8A 2MO1A 3GTGH 2YTXA 2E2HH 2JQOA 4B3RL 1HNWQ 2K5VA 2FXQA 4JBWA 2YU9H 1PH3A 3J81c 3NBHB 3GTOH 3RZDH 3B6YA 3I2ZA 1PYSB 3M4PA 3G4SA 4IFDI 3CCJA 3NELA 1N9WA 1XMQQ 1BVSA 3PO3G 2GVAA 4QY7A 2Y0SE 4P72A 4JI1Q 3OTOQ 4JI1L 3OTOL 2IT1A 5C0XG 3H0GH 1UEBA 3RLNA 3KF6B 3U4ZA 4JBMA 4XTCS 1FL0A 1EIFA 1DGSA 4OWXB 4TQUS 5GAEC 2NVTH 4DR7L 1K3RA 4BY7G 5AJ3L 1HZAA 4A3MG 1L1OC 2PMZE 2D0OA 4YCVA 1NBWA 4QGUA 1QVFA 3HOVH 1CKNA 1JB7A 5M5WH 1X9NA 4A93G 2PQAB 4DPGA 4FDBA 5EAYA 3RR5A 2R7FA 1YJNA 1QZHA 1KXLA 4R4TA 1SN8A 3UE1A 3H15A 3F2BA 2NVXH 2LXJA 1N33L 1KRTA 3KYHC 1UE7A 1XPOA 4JI5L 1YVCA 3AFPA 5IP7G 4HJ9A 4AIMA 1NMGA 1HH2P 3F8TA 1PH1A 1UE5A 5FLMG 4JCVE 4BBSG 2UXCQ 1EIYB 1VQIA 1WJJA 2JE6I 1Q8KA 1JJCB 1G51A 1QUQA 1ASZA 4UPAA 3BU2A 3CW2C 1WYDA 3AQQA 3HOWH 4H02A 5C4XG 1YITA 2L15A 3M85A 3BJUA 4POGA 3UDIA 1YHQA 3I55A 5E7NA 3TS2A 2R93H 2CKZB 1KRSA 4EQ5A 1J5EL 3S17H 4DR7Q 1WOCA 4A3CG 4JI0Q 2UXDL 5LMNW 2UXDQ 2HIVA 4LUOA 1VQDA 1SLJA 1E1OA 1HZCA 1W2BA 2Z0SA 4LFAQ 1EFWA 1XNRL 3KDFA 3PUYA 4LFAL 1XNRQ 1N32L 4DR4Q 4P73A 3GTMH 3I7FA 3PUZA 3F1ZA 4YY3L 2MFIA 4NXNQ 3S1RH 5IYCG 1XTDA 2VQEL 4K0KL 4A3EG 1Q7YC 3DM3A 2VQEQ 3CXCA 4LF8Q 1I3QH 2N3SA 1VQFA 1D8LA 1OXVA 2RHQB 5H1SE 1IYJB 4B3ML 1M90C 3CC4A 1A62A 2OWOA 3PGZA 4JI6L 4X62L 4OO1G 4DV0Q 1S72A 2JA7G 3S14H 2RCNA 4DAMA 2ASBA 2ZTCA 1T9HA 2CCZA 1YNXA 1IBMQ 3EN2A 1X3GA 5IWAL 3G6EA 3M9BA 4OO1I 3NEMA 4LF5Q 3E9IA 2KHIA 2VUMH 1IBLQ 4DAYB 4DV3Q 1K8AC 4IJHA 4C3HH 5C3EG 1BBWA 4DR1L 4JI0L 2HIXA 2AHOB 4DK6C 1OXXK 1D7QA 4JBJA 2DUDA 3S1NH 2IY5B 4KHPL 3KJPA 1AH9A 5BR8L 3A0JA 5HY6A 2E5LL 4LF6L 4UP9A 1N32Q 1QVGA 3PUXA 4R4IA 2Q2UA 4DV1Q 2GN5A 4GKKL 1N34Q 3S24A 1VQOA 4R1JA 1YEZA 2YTYA 4NXMQ 2KHJA 1A8VA 2PNHA 1GO3E 2E8GA 4QIWE 4GOPC 2JA5H 4DUZL 4DV5Q 4OXPA 1IBKQ 4AYBG 1YHBA 2KCTA 3H0GG 2WP8J 3RLFA 3CC7A 3CCUA 3TS0A 4DK3C 4QQBX 3LGJA 4OONA 2HT1A 4DR5Q 4DKAC 4OWTB 1X65A 1PH4A 2YTVA 4DR3Q 1N36Q 1HNZL 4LF7Q 4X64L 4DUYL 1CKOA 1QZGA 1J5EQ 1FVIA 2E2JH 5JEAG 4ALPA 4P74A 1CSPA 2ID0A 1V9PA 1JJ2A 3EIVA 1CSQA 1P16A 3G71A 1Q82C 4PG3A 1SROA 3EBEA 4DNIA 3D0FA 3HOYG 1XMQL 3HOVG 4IFDG 2OTJA 4NXNL 4K0KQ 3K81C 1XPUA 1TWCH 4BY1G 4MZ9A 1B70B 2UUBL 2RF4A 4RMFA 3A74A 1GD7A 2K50A 1Y1WG 2D62A 3BZCA 1Z47A 4B3MQ 1YZ6A 5IY0A 3PCOB 3J80i 3OW2A 2E2IH 5IP7H 4O0AA 2UUCQ 4Y7NH 4GOPA 3HOWG 4DR2Q 1K8GA 2ZTDA 3CQZH 3OYYA 4IJLA 4JI3Q 5IYDH 2H5XA 3JAMi 3J7A5 1TWFH 2YV5A 2ZM6Q 2QEXA 1NTGA 2C35B 3PF5A 5HGQA 2A8VA 1EWIA 3Q8DA 2R93G 4LF5L 2MQHA 5IE8A 3CCRA 1IBLL 3J81j 1G6PA 4DV6L 4KI0A 5JJLA 4PZ8A 3G48A 4DR6L 1HR0Q 2N78A 3AYHB 3CD6A 4DR6Q 1Y1VG 3UDGA 2UXCL 4TVAB 5M3FG 2B63H 2GVBA 1EOVA 1GVPA 3S1QH 4O2DA 4R4CA 3STBD 5IYCH 4DV1L 2KBNA 1QUQB 5M3MG 1VQLA 4A3DG 2IHEA 2A19A 1E22A 1SRUA 2K75A 4DV2L 2LSSA 2R7DA 4XIGS 4A3KH 2WAQE 4L5RC 4NXML 2BH2A 4MTNA 3H3VH 3RZOH 1RIPA 2AKWB 1FJGL 4JI2L 1C7YA 4C3JH 4HJ7A 2I5MX 3TRZA 4JI2Q 1HZ9A 1VQJA 2KENA 4DR5L 3K7AH 4B3SL 4B3TL 1E7ZA 2R7ZG 3HOXH 4POFA 3UDFA 2HHHL 3CPFA 1TWHH 2ZJQA 4LW1A 5C44H 3I4MG 1HR0L 1OXUA 1PH9A 1N8RC 3KJOA 4A3GH 1IL2A 4HIKA 4BA2I 1VQ5A 2K5HA 4UP8A 2YYZA 1K83H 1LM0A 4GN5A 3UDXA 4JI7Q 5IYDG 3CCLA 2R6GA 3M7NA 4GKJQ 3S15H 1YBYA 1VQGA 2BH8A 3SGIA 2VW9A 3CCSA 3T1HQ 5ELNA 4YWLA 4X66Q 2VQFL 2K5NA 1VQCA 2B63G 2D0PA 2I5HA 3M4OH 1JMCA 1LUZA 4X62Q 1VQ7A 3W1GA 1A0IA 1FJGQ 2ZTEA 2DGYA 1KAWA 5IYBH 2WFWA 4LFCQ 4JYAQ 5AJ3Q 3AFQA 1AE2A 2VY3A 5ELOA 5IYBG 3J7ZC 4DR2L 4HJ5A 4GLAC 4JI8Q 4GNXA 3HOUG 4LFBQ 2JA8H 2ALYB 1U5KA 2F52A 3HKZG 4A3KG 4B3TQ 4A3LG 4JI7L 4UY8C 5GQOA 1PH7A 4YWMA 2Z6KC 1N33Q 1VQ4A 3PO2G 4X6AH 1U0LA 2JEBI 4A4IA 5BR8Q 2E5LQ 3MXNB 2K14A 3WWVA 4A3LH 3PSIA 1VQMA 2JA6G 3ULPA 2F4VQ 2R92G 4GKKQ 1CKNB 2HQLA 4IFDJ 5GAHC 5C0XI 4YHHQ 4YHHL 1IZ6A 4GNXC 1KC8C 5C0XJ 1ASYA 1L2FA 2AWOA 1HZBA 2K52A 4A3GG 4DV4Q 4AQYL 1R9TH 4BY1H 2F3IA 3HKSA 4DV2Q 1YHAA 2N49A 4HIMA 4PZ7A 2UXBL 1W3SA 1VQHA 4MNOA 3PIOA 1L1OB 2OCEA 4IPCA 5C4JH 3T1YQ 1N36L 1K73C 3FKIG 2EIFA 4BBSH 5JJKA 1XMOL 4YWKA 3E0EA 1XMOQ 3IRBA 4LUVA 3CCEA 1TWGH 4IPGA 4LF4L 3FKIH 4A3IH 1I6HH 1Y1WH 4NB3A 1OXTA 4IOCA 4OX9Q 3HOZH 5JEAJ 3KFUA 4GKJL 1P8LA 1K9MC 1WCMG 5FJ8G 2NVYH 4DV7L 5GROA 3KDFB 4YCUA 4YY3Q 4A3IG 4A3FH 3I4NG 4P71A 4A3BG 1JJGA 1AE3A 4BXXG 4QL5A 3S2DH 3FP9A 1SFOH 2K4KA 4IO9A 4GLXA 5C4XH 4GLVB 3GO5A 1NMFA 4LF8L 5GAGC 2WB1G 5IP9G 4BXXH 3STBC 4JI5Q 3TREA 1EUJA 2JK8A 4X66L 2VQFQ 4GNXB 5K36G 5IP9H 2NVQH 1MJCA 3M3YH 3ICEA 4DV0L 2I0QA 4A3MH 3A5UA 3PF4A 4A3EH 2CQOA 1OTCA 2R92H 2NZOA 1X3FA 4RG1A 1SR3A 3L7ZC 3U58A 1YJ9A 1HJPA 3CF5A 1X56A 2JA5G 1JE5A 3GTPH 1X55A 3K8AA 3K0XA 4LNQA 2CWAA 1VQKA 4JBKA 3AEVA 3L2PA 3CMEA 2VZAA 1MIUA 1TXYA 4DR3L 1HNZQ 4DR1Q 1KQSA 4GN4B 1Q46A 3U50C 4LF9L 2QGQA 1CKMA 4JOIC 4C3IH 4NPSA 1XJVA 1WI5A 5C44G 3ZJYC 2XGTA 2B29A 3I4MH 2ES2A 2A1AA 2UU9L 5M5YH 2PI2E 4R4QA 4JI4L 4A3JH 1UWVA 1VS0A 3CCMA 5IT9c 1Q12A 1X6OA 3HOYH 3FHWA 4ME3A 4B3RQ 1HNWL 1PYBA 4BY7H 5C3EH 1Y14B 5LMUQ 1SE8A 4APVA 3RN5A 1C9OA 2AWNA 4QJFA 1Q81C 3I4NH 4C2MH 4LWCA 4HIDA 3KF6A 4A75A 2WB1E 2UUAQ 4KHZA 1I94L 2IX0A 3PUWA 4PMWA 5M3FH 2UUAL 4B3SQ 3J80c 1I94Q 1QVCA 1S3OA 1PH6A 4UP7A 1NY4A 3CPWA 1H95A 1Q86C 3RNUA 1Q1EA 2Q2TA 4LF7L 3GDEA 1YI2A 3GTLH 2BA1A 4IPDA 4JG2A 3JAMc 2PI2A 1KIXA 2VS1A 3VDYA 3GD7A 1IBML 4YCWA 1VQ8A 1EQQA 5IWAQ 3UE0A 1NJIC 1M1KC 3NENA 1VQ6A 4IOAA 2NN6I 4JI4Q 4L5QA 2EQSA 2MO0A 1GKHA 4JC0A 1HR0W 4DR4L 4DV3L 1VQAA 3BZKA 4DV6Q 2R7ZH 1KL9A 3W5OA 2KCMA 1WCMH 5FJ8H 1HNXL 1XPRA 4L5TA 1L1OA 1HNXQ 5GADC 1EYGA 2B3GA 2IX1A 4A3BH 2JA8G 2UUBQ 3ERSX 1EQRA 3I4OA 2MNAA 2JA6H 2Y0SG 4LF6Q 2UU9Q 3CCQA 1B7YB 2ZJPA 2LXKA 4HJ8A 4OWWB 4LFCL 4JI6Q 4JYAL 1MKHA 2JEAI 1LYLA 2UUCL 3CC2A 1Q1BA 4IPHA 4J15A 3M4QA 4L5SA 4WJ3M 3ER0A 2BA0A 4A3JG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQP A;  2ZM6 L;  4JI3 L;  2ZJR A;  1X54 A;  4DUZ Q;  2NN6 G;  2JA9 A;  1O7I A;  1J6Q A;  5LMN Q;  3S1M H;  1VQN A;  5LMN L;  1IXR A;  4KLK A;  2VL6 A;  3HOX G;  1E24 A;  3KLW A;  5FLM H;  1V43 A;  1SMX A;  3HKZ E;  3I56 A;  1GM5 A;  1XNQ Q;  1PHJ A;  1V1Q A;  3HOZ G;  3E9H A;  3ULL A;  1WFQ A;  4KHP Q;  3CP0 A;  3PV0 A;  3HOU H;  3L0O A;  1KD1 C;  1OXS C;  3PO3 H;  5J3B A;  1YJW A;  3GTJ H;  2I5L X;  4DV4 L;  1I5F A;  2CWP A;  3KF8 B;  4R4O A;  4AH6 A;  4BBR G;  3F2D A;  3DLL A;  2QA4 A;  3T1H L;  4X65 Q;  5LMU L;  5DLQ E;  4A3C H;  3TEH B;  3CMA A;  4BBR H;  3PIP A;  1BBU A;  1IBK L;  2OTL A;  1Y1V H;  4BA1 I;  2VNU D;  1K0R A;  1PVO A;  3W1B A;  2V1C C;  5JJI A;  1MJE A;  3KOJ A;  1L0W A;  3RLO A;  2HHH Q;  1X3E A;  4A3D H;  3RN2 A;  4JV5 L;  1LTL A;  2NZH A;  2CFM A;  4Y52 H;  4JV5 Q;  1XNQ L;  1PV4 A;  1PA6 A;  2Q2I A;  4JI8 L;  1KHI A;  1RL2 A;  4JOI A;  1A63 A;  2Q2H A;  4EX5 A;  4WJ4 A;  1G29 1;  3GTQ H;  3A5Z B;  3TQY A;  5M3M H;  4GS3 A;  3S16 H;  1B8A A;  1UE1 A;  1VQB A;  3CCV A;  2OQ0 A;  3H3V I;  3PO2 H;  1VQ9 A;  3U4V A;  2JA7 H;  3ULJ A;  3CAM A;  1NE3 A;  3GTK H;  1YIJ A;  1PH5 A;  2N8N A;  3F2C A;  2WAQ G;  1PH2 A;  1JT8 A;  1I50 H;  2AMC B;  4A3F G;  3K80 C;  2OQK A;  4AYB E;  2EXD A;  4GN3 B;  2IHF A;  2RHS B;  5FLX c;  4AQY Q;  1VQE A;  1N34 L;  4A93 H;  4GOP B;  2JJQ A;  1S40 A;  4LUZ A;  3D31 A;  4A76 A;  2XTI A;  2UXB Q;  4LFB L;  1PFS A;  3T1Y L;  4DV5 L;  3J81 i;  1FGU A;  4LF9 Q;  2VUM G;  1UE6 A;  3HFZ B;  4PZ6 A;  3PUV A;  1VCI A;  1E3P A;  1TWA H;  3MEF A;  4X65 L;  4HJA A;  1CUK A;  3K7U C;  1Z9F A;  5M5X H;  4LF4 Q;  1E1T A;  2Z6K A;  4X64 Q;  4DUY Q;  4OX9 L;  2ATW A;  1BKB A;  4HIO A;  3S2H H;  2PQA A;  3JC6 6;  1C0A A;  2F4V L;  4DV7 Q;  4P75 A;  1PH8 A;  2MO1 A;  3GTG H;  2YTX A;  2E2H H;  2JQO A;  4B3R L;  1HNW Q;  2K5V A;  2FXQ A;  4JBW A;  2YU9 H;  1PH3 A;  3J81 c;  3NBH B;  3GTO H;  3RZD H;  3B6Y A;  3I2Z A;  1PYS B;  3M4P A;  3G4S A;  4IFD I;  3CCJ A;  3NEL A;  1N9W A;  1XMQ Q;  1BVS A;  3PO3 G;  2GVA A;  4QY7 A;  2Y0S E;  4P72 A;  4JI1 Q;  3OTO Q;  4JI1 L;  3OTO L;  2IT1 A;  5C0X G;  3H0G H;  1UEB A;  3RLN A;  3KF6 B;  3U4Z A;  4JBM A;  4XTC S;  1FL0 A;  1EIF A;  1DGS A;  4OWX B;  4TQU S;  5GAE C;  2NVT H;  4DR7 L;  1K3R A;  4BY7 G;  5AJ3 L;  1HZA A;  4A3M G;  1L1O C;  2PMZ E;  2D0O A;  4YCV A;  1NBW A;  4QGU A;  1QVF A;  3HOV H;  1CKN A;  1JB7 A;  5M5W H;  1X9N A;  4A93 G;  2PQA B;  4DPG A;  4FDB A;  5EAY A;  3RR5 A;  2R7F A;  1YJN A;  1QZH A;  1KXL A;  4R4T A;  1SN8 A;  3UE1 A;  3H15 A;  3F2B A;  2NVX H;  2LXJ A;  1N33 L;  1KRT A;  3KYH C;  1UE7 A;  1XPO A;  4JI5 L;  1YVC A;  3AFP A;  5IP7 G;  4HJ9 A;  4AIM A;  1NMG A;  1HH2 P;  3F8T A;  1PH1 A;  1UE5 A;  5FLM G;  4JCV E;  4BBS G;  2UXC Q;  1EIY B;  1VQI A;  1WJJ A;  2JE6 I;  1Q8K A;  1JJC B;  1G51 A;  1QUQ A;  1ASZ A;  4UPA A;  3BU2 A;  3CW2 C;  1WYD A;  3AQQ A;  3HOW H;  4H02 A;  5C4X G;  1YIT A;  2L15 A;  3M85 A;  3BJU A;  4POG A;  3UDI A;  1YHQ A;  3I55 A;  5E7N A;  3TS2 A;  2R93 H;  2CKZ B;  1KRS A;  4EQ5 A;  1J5E L;  3S17 H;  4DR7 Q;  1WOC A;  4A3C G;  4JI0 Q;  2UXD L;  5LMN W;  2UXD Q;  2HIV A;  4LUO A;  1VQD A;  1SLJ A;  1E1O A;  1HZC A;  1W2B A;  2Z0S A;  4LFA Q;  1EFW A;  1XNR L;  3KDF A;  3PUY A;  4LFA L;  1XNR Q;  1N32 L;  4DR4 Q;  4P73 A;  3GTM H;  3I7F A;  3PUZ A;  3F1Z A;  4YY3 L;  2MFI A;  4NXN Q;  3S1R H;  5IYC G;  1XTD A;  2VQE L;  4K0K L;  4A3E G;  1Q7Y C;  3DM3 A;  2VQE Q;  3CXC A;  4LF8 Q;  1I3Q H;  2N3S A;  1VQF A;  1D8L A;  1OXV A;  2RHQ B;  5H1S E;  1IYJ B;  4B3M L;  1M90 C;  3CC4 A;  1A62 A;  2OWO A;  3PGZ A;  4JI6 L;  4X62 L;  4OO1 G;  4DV0 Q;  1S72 A;  2JA7 G;  3S14 H;  2RCN A;  4DAM A;  2ASB A;  2ZTC A;  1T9H A;  2CCZ A;  1YNX A;  1IBM Q;  3EN2 A;  1X3G A;  5IWA L;  3G6E A;  3M9B A;  4OO1 I;  3NEM A;  4LF5 Q;  3E9I A;  2KHI A;  2VUM H;  1IBL Q;  4DAY B;  4DV3 Q;  1K8A C;  4IJH A;  4C3H H;  5C3E G;  1BBW A;  4DR1 L;  4JI0 L;  2HIX A;  2AHO B;  4DK6 C;  1OXX K;  1D7Q A;  4JBJ A;  2DUD A;  3S1N H;  2IY5 B;  4KHP L;  3KJP A;  1AH9 A;  5BR8 L;  3A0J A;  5HY6 A;  2E5L L;  4LF6 L;  4UP9 A;  1N32 Q;  1QVG A;  3PUX A;  4R4I A;  2Q2U A;  4DV1 Q;  2GN5 A;  4GKK L;  1N34 Q;  3S24 A;  1VQO A;  4R1J A;  1YEZ A;  2YTY A;  4NXM Q;  2KHJ A;  1A8V A;  2PNH A;  1GO3 E;  2E8G A;  4QIW E;  4GOP C;  2JA5 H;  4DUZ L;  4DV5 Q;  4OXP A;  1IBK Q;  4AYB G;  1YHB A;  2KCT A;  3H0G G;  2WP8 J;  3RLF A;  3CC7 A;  3CCU A;  3TS0 A;  4DK3 C;  4QQB X;  3LGJ A;  4OON A;  2HT1 A;  4DR5 Q;  4DKA C;  4OWT B;  1X65 A;  1PH4 A;  2YTV A;  4DR3 Q;  1N36 Q;  1HNZ L;  4LF7 Q;  4X64 L;  4DUY L;  1CKO A;  1QZG A;  1J5E Q;  1FVI A;  2E2J H;  5JEA G;  4ALP A;  4P74 A;  1CSP A;  2ID0 A;  1V9P A;  1JJ2 A;  3EIV A;  1CSQ A;  1P16 A;  3G71 A;  1Q82 C;  4PG3 A;  1SRO A;  3EBE A;  4DNI A;  3D0F A;  3HOY G;  1XMQ L;  3HOV G;  4IFD G;  2OTJ A;  4NXN L;  4K0K Q;  3K81 C;  1XPU A;  1TWC H;  4BY1 G;  4MZ9 A;  1B70 B;  2UUB L;  2RF4 A;  4RMF A;  3A74 A;  1GD7 A;  2K50 A;  1Y1W G;  2D62 A;  3BZC A;  1Z47 A;  4B3M Q;  1YZ6 A;  5IY0 A;  3PCO B;  3J80 i;  3OW2 A;  2E2I H;  5IP7 H;  4O0A A;  2UUC Q;  4Y7N H;  4GOP A;  3HOW G;  4DR2 Q;  1K8G A;  2ZTD A;  3CQZ H;  3OYY A;  4IJL A;  4JI3 Q;  5IYD H;  2H5X A;  3JAM i;  3J7A 5;  1TWF H;  2YV5 A;  2ZM6 Q;  2QEX A;  1NTG A;  2C35 B;  3PF5 A;  5HGQ A;  2A8V A;  1EWI A;  3Q8D A;  2R93 G;  4LF5 L;  2MQH A;  5IE8 A;  3CCR A;  1IBL L;  3J81 j;  1G6P A;  4DV6 L;  4KI0 A;  5JJL A;  4PZ8 A;  3G48 A;  4DR6 L;  1HR0 Q;  2N78 A;  3AYH B;  3CD6 A;  4DR6 Q;  1Y1V G;  3UDG A;  2UXC L;  4TVA B;  5M3F G;  2B63 H;  2GVB A;  1EOV A;  1GVP A;  3S1Q H;  4O2D A;  4R4C A;  3STB D;  5IYC H;  4DV1 L;  2KBN A;  1QUQ B;  5M3M G;  1VQL A;  4A3D G;  2IHE A;  2A19 A;  1E22 A;  1SRU A;  2K75 A;  4DV2 L;  2LSS A;  2R7D A;  4XIG S;  4A3K H;  2WAQ E;  4L5R C;  4NXM L;  2BH2 A;  4MTN A;  3H3V H;  3RZO H;  1RIP A;  2AKW B;  1FJG L;  4JI2 L;  1C7Y A;  4C3J H;  4HJ7 A;  2I5M X;  3TRZ A;  4JI2 Q;  1HZ9 A;  1VQJ A;  2KEN A;  4DR5 L;  3K7A H;  4B3S L;  4B3T L;  1E7Z A;  2R7Z G;  3HOX H;  4POF A;  3UDF A;  2HHH L;  3CPF A;  1TWH H;  2ZJQ A;  4LW1 A;  5C44 H;  3I4M G;  1HR0 L;  1OXU A;  1PH9 A;  1N8R C;  3KJO A;  4A3G H;  1IL2 A;  4HIK A;  4BA2 I;  1VQ5 A;  2K5H A;  4UP8 A;  2YYZ A;  1K83 H;  1LM0 A;  4GN5 A;  3UDX A;  4JI7 Q;  5IYD G;  3CCL A;  2R6G A;  3M7N A;  4GKJ Q;  3S15 H;  1YBY A;  1VQG A;  2BH8 A;  3SGI A;  2VW9 A;  3CCS A;  3T1H Q;  5ELN A;  4YWL A;  4X66 Q;  2VQF L;  2K5N A;  1VQC A;  2B63 G;  2D0P A;  2I5H A;  3M4O H;  1JMC A;  1LUZ A;  4X62 Q;  1VQ7 A;  3W1G A;  1A0I A;  1FJG Q;  2ZTE A;  2DGY A;  1KAW A;  5IYB H;  2WFW A;  4LFC Q;  4JYA Q;  5AJ3 Q;  3AFQ A;  1AE2 A;  2VY3 A;  5ELO A;  5IYB G;  3J7Z C;  4DR2 L;  4HJ5 A;  4GLA C;  4JI8 Q;  4GNX A;  3HOU G;  4LFB Q;  2JA8 H;  2ALY B;  1U5K A;  2F52 A;  3HKZ G;  4A3K G;  4B3T Q;  4A3L G;  4JI7 L;  4UY8 C;  5GQO A;  1PH7 A;  4YWM A;  2Z6K C;  1N33 Q;  1VQ4 A;  3PO2 G;  4X6A H;  1U0L A;  2JEB I;  4A4I A;  5BR8 Q;  2E5L Q;  3MXN B;  2K14 A;  3WWV A;  4A3L H;  3PSI A;  1VQM A;  2JA6 G;  3ULP A;  2F4V Q;  2R92 G;  4GKK Q;  1CKN B;  2HQL A;  4IFD J;  5GAH C;  5C0X I;  4YHH Q;  4YHH L;  1IZ6 A;  4GNX C;  1KC8 C;  5C0X J;  1ASY A;  1L2F A;  2AWO A;  1HZB A;  2K52 A;  4A3G G;  4DV4 Q;  4AQY L;  1R9T H;  4BY1 H;  2F3I A;  3HKS A;  4DV2 Q;  1YHA A;  2N49 A;  4HIM A;  4PZ7 A;  2UXB L;  1W3S A;  1VQH A;  4MNO A;  3PIO A;  1L1O B;  2OCE A;  4IPC A;  5C4J H;  3T1Y Q;  1N36 L;  1K73 C;  3FKI G;  2EIF A;  4BBS H;  5JJK A;  1XMO L;  4YWK A;  3E0E A;  1XMO Q;  3IRB A;  4LUV A;  3CCE A;  1TWG H;  4IPG A;  4LF4 L;  3FKI H;  4A3I H;  1I6H H;  1Y1W H;  4NB3 A;  1OXT A;  4IOC A;  4OX9 Q;  3HOZ H;  5JEA J;  3KFU A;  4GKJ L;  1P8L A;  1K9M C;  1WCM G;  5FJ8 G;  2NVY H;  4DV7 L;  5GRO A;  3KDF B;  4YCU A;  4YY3 Q;  4A3I G;  4A3F H;  3I4N G;  4P71 A;  4A3B G;  1JJG A;  1AE3 A;  4BXX G;  4QL5 A;  3S2D H;  3FP9 A;  1SFO H;  2K4K A;  4IO9 A;  4GLX A;  5C4X H;  4GLV B;  3GO5 A;  1NMF A;  4LF8 L;  5GAG C;  2WB1 G;  5IP9 G;  4BXX H;  3STB C;  4JI5 Q;  3TRE A;  1EUJ A;  2JK8 A;  4X66 L;  2VQF Q;  4GNX B;  5K36 G;  5IP9 H;  2NVQ H;  1MJC A;  3M3Y H;  3ICE A;  4DV0 L;  2I0Q A;  4A3M H;  3A5U A;  3PF4 A;  4A3E H;  2CQO A;  1OTC A;  2R92 H;  2NZO A;  1X3F A;  4RG1 A;  1SR3 A;  3L7Z C;  3U58 A;  1YJ9 A;  1HJP A;  3CF5 A;  1X56 A;  2JA5 G;  1JE5 A;  3GTP H;  1X55 A;  3K8A A;  3K0X A;  4LNQ A;  2CWA A;  1VQK A;  4JBK A;  3AEV A;  3L2P A;  3CME A;  2VZA A;  1MIU A;  1TXY A;  4DR3 L;  1HNZ Q;  4DR1 Q;  1KQS A;  4GN4 B;  1Q46 A;  3U50 C;  4LF9 L;  2QGQ A;  1CKM A;  4JOI C;  4C3I H;  4NPS A;  1XJV A;  1WI5 A;  5C44 G;  3ZJY C;  2XGT A;  2B29 A;  3I4M H;  2ES2 A;  2A1A A;  2UU9 L;  5M5Y H;  2PI2 E;  4R4Q A;  4JI4 L;  4A3J H;  1UWV A;  1VS0 A;  3CCM A;  5IT9 c;  1Q12 A;  1X6O A;  3HOY H;  3FHW A;  4ME3 A;  4B3R Q;  1HNW L;  1PYB A;  4BY7 H;  5C3E H;  1Y14 B;  5LMU Q;  1SE8 A;  4APV A;  3RN5 A;  1C9O A;  2AWN A;  4QJF A;  1Q81 C;  3I4N H;  4C2M H;  4LWC A;  4HID A;  3KF6 A;  4A75 A;  2WB1 E;  2UUA Q;  4KHZ A;  1I94 L;  2IX0 A;  3PUW A;  4PMW A;  5M3F H;  2UUA L;  4B3S Q;  3J80 c;  1I94 Q;  1QVC A;  1S3O A;  1PH6 A;  4UP7 A;  1NY4 A;  3CPW A;  1H95 A;  1Q86 C;  3RNU A;  1Q1E A;  2Q2T A;  4LF7 L;  3GDE A;  1YI2 A;  3GTL H;  2BA1 A;  4IPD A;  4JG2 A;  3JAM c;  2PI2 A;  1KIX A;  2VS1 A;  3VDY A;  3GD7 A;  1IBM L;  4YCW A;  1VQ8 A;  1EQQ A;  5IWA Q;  3UE0 A;  1NJI C;  1M1K C;  3NEN A;  1VQ6 A;  4IOA A;  2NN6 I;  4JI4 Q;  4L5Q A;  2EQS A;  2MO0 A;  1GKH A;  4JC0 A;  1HR0 W;  4DR4 L;  4DV3 L;  1VQA A;  3BZK A;  4DV6 Q;  2R7Z H;  1KL9 A;  3W5O A;  2KCM A;  1WCM H;  5FJ8 H;  1HNX L;  1XPR A;  4L5T A;  1L1O A;  1HNX Q;  5GAD C;  1EYG A;  2B3G A;  2IX1 A;  4A3B H;  2JA8 G;  2UUB Q;  3ERS X;  1EQR A;  3I4O A;  2MNA A;  2JA6 H;  2Y0S G;  4LF6 Q;  2UU9 Q;  3CCQ A;  1B7Y B;  2ZJP A;  2LXK A;  4HJ8 A;  4OWW B;  4LFC L;  4JI6 Q;  4JYA L;  1MKH A;  2JEA I;  1LYL A;  2UUC L;  3CC2 A;  1Q1B A;  4IPH A;  4J15 A;  3M4Q A;  4L5S A;  4WJ3 M;  3ER0 A;  2BA0 A;  4A3J G; 
#chains in the Genus database with same CATH topology
 2ZJR A;  4NP5 A;  1J6Q A;  1ESR A;  4C2M B;  2Z9H A;  3P7J A;  5LMN L;  1FR3 A;  2N88 A;  4OGQ C;  3HKZ E;  2XN9 C;  3MC0 B;  1TKW B;  3E9H A;  5EBD A;  1EIH A;  1KLG D;  4KHP Q;  2K33 A;  3CP0 A;  1RJT A;  1F9Q A;  2DNE A;  3OIP A;  4XT1 B;  3QR8 A;  3QOL A;  4DV4 L;  5FO9 B;  5IIF A;  1ICW A;  4ULL A;  5LMU L;  3G6J B;  1SAP A;  4A3C H;  3PIP A;  4B08 A;  2DN8 A;  3Q22 A;  1PVO A;  3ZYY X;  2A69 D;  5JJI A;  3KOJ A;  4O42 A;  3RLO A;  2HHH Q;  1X3E A;  3GTL B;  1SNO A;  4MN3 A;  2CFM A;  4JV5 Q;  2F0I A;  2Q2I A;  1L0Y B;  1IKL A;  1K3B C;  1RL2 A;  2NTT A;  1QG7 A;  3A55 A;  5M3M H;  4Q0F A;  1CM9 A;  1VQB A;  1B53 A;  5DNF A;  3GTK H;  1SMY C;  3VR3 A;  2Z1C A;  4HTH A;  4EQN A;  3F2C A;  2OQK A;  2EXD A;  3IFD A;  4MTK A;  3NK9 A;  1ESF A;  4OO1 H;  2IHF A;  1N34 L;  4RFB A;  3LNN A;  1S40 A;  1O7Z A;  4LUZ A;  1S5E D;  3D31 A;  3OSO A;  1X32 A;  1RHP A;  2A6H D;  1LAC A;  3HFZ B;  2VUM G;  1SNP A;  4KN4 C;  3A54 A;  1E3P A;  1Y8N B;  3C46 A;  4WJW A;  5M5X H;  4LF4 Q;  3H91 A;  4BA2 I;  4OO1 I;  4X64 Q;  5C4H A;  2PQA A;  3JC6 6;  4A3G B;  4FXD A;  4P75 A;  3X3M A;  1T5X D;  2MO1 A;  3GTG H;  2YTX A;  1SXT A;  1TWH B;  2E2H H;  1HNW Q;  1HRJ A;  3A8K E;  4CDF C;  4F8M A;  1STH A;  3RZD H;  3I2Z A;  4GKJ L;  3CCJ A;  3PO3 G;  5EPJ A;  3OTO Q;  2Y0S E;  1AN8 A;  3GP7 A;  1UEB A;  3KF6 B;  4JBM A;  4XTC S;  5GAE C;  1DGS A;  3C3L A;  1ET6 A;  5IOD A;  5C0X H;  4BY7 G;  4EVO A;  1CI3 M;  2PMZ E;  3K59 A;  3HOV H;  3D4W A;  2B2W C;  5C44 B;  2A6E C;  1CKN A;  3GTG B;  1CHQ D;  2JYO A;  2XRS D;  5EAY A;  3K7A B;  3F2B A;  2NVX H;  2LXJ A;  2TMP A;  3J7A V;  1YVC A;  1XX8 A;  1NCV A;  2ENB A;  4HJ9 A;  4AIM A;  2HDM A;  4JCV E;  4BBS G;  2XIW A;  2UXC Q;  1VQI A;  2F0H A;  1WJJ A;  1LTT D;  3CW2 C;  1SYF A;  3HOW H;  4RGM A;  1YIT A;  2KUM A;  2L15 A;  1EFI D;  2N55 A;  1CZG A;  2ZXR A;  3BJU A;  1AFP A;  2F0M A;  2XVS A;  5E7N A;  1WVL A;  1GUW A;  2CKZ B;  4EQ5 A;  3F2U A;  4A3I B;  3DEO A;  1K8O A;  3H3V C;  1VQD A;  4I7Z C;  3KDF A;  1BXT A;  3I7F A;  3PUZ A;  2KVM A;  4G7O C;  2F0U A;  4A3E G;  1G8Z D;  2VQE Q;  3EQL C;  2KHS A;  4LF8 Q;  1D8L A;  2SOB A;  2RHQ B;  3FDT A;  2WKD A;  2BDO A;  1A62 A;  5KEE A;  3X3N A;  2L11 A;  3TBI B;  4DV0 Q;  2JA7 G;  1B9M A;  1C4Q A;  2B2V C;  1A2T A;  3M9B A;  1ZKO A;  5L37 A;  2KHI A;  5D3I B;  4DAY B;  1K8A C;  4IJH A;  4A3K B;  5C3E G;  4DR1 L;  4C3H B;  3BVZ A;  4KHP L;  2G9H D;  2RVL A;  5BR8 L;  5HY6 A;  4LF6 L;  4KY5 A;  5E3F A;  1LTB D;  1YEZ A;  4TSS A;  4HCE A;  1A8V A;  4QIW E;  4CHT B;  4GOP C;  4U67 3;  4U68 A;  4DNR B;  1FNW A;  2KCT A;  3CC7 A;  2WP8 J;  2F4I A;  1HXY D;  4OON A;  3FPP A;  3OHX C;  1PH4 A;  1X65 A;  4DR3 Q;  2BE5 C;  4X64 L;  3SHL A;  1J5E Q;  3A8J E;  1I4R A;  4H0L C;  3TSS A;  3KUP A;  1P16 A;  3T51 B;  3EBE A;  4DNI A;  3HOY G;  1XMQ L;  4S3S A;  3SK8 A;  4NXN L;  1LTR D;  1W6J A;  3NE5 B;  3K81 C;  1B70 B;  2UUB L;  4RMF A;  3I91 A;  3E0J A;  1GD7 A;  3VR2 A;  5D14 A;  1Z47 A;  2EYL A;  4B3M Q;  4ZYS A;  3PCO B;  2MUY A;  5IP7 H;  1XXG A;  4O0A A;  2FIN B;  5ELD A;  5J39 A;  1I4X A;  5IT9 E;  4CJ2 C;  3R93 A;  2ZTD A;  4JI3 Q;  3JAM i;  2E2D C;  4BS9 A;  2C35 B;  1JCK B;  3A56 A;  2A6H C;  3NBI A;  2F03 A;  4PZ8 A;  2N78 A;  1Z7T A;  4DR6 Q;  2UXC L;  3UDG A;  4CGY B;  2KJX A;  4FF3 A;  4FF2 A;  3HOW B;  2GVB A;  3TP5 A;  4O2D A;  2EYP A;  2KBN A;  2L4N A;  1H9M A;  4DV2 L;  2LSS A;  4A3F B;  3H3V H;  4MTN A;  2Z8L A;  2F0N A;  1B9N A;  2JN4 A;  2AKW B;  3O13 A;  4X3K A;  4HJ7 A;  2KEN A;  2XNA C;  4B3T L;  4B3S L;  3T16 A;  3UDF A;  1DOL A;  2AUK A;  4C3J G;  3CPF A;  1DYQ A;  3W2D A;  1HR0 L;  1OXU A;  1EWH A;  1N8R C;  4A3G H;  1PZJ D;  1FD7 D;  4UP8 A;  2F3W A;  1LM0 A;  2YYZ A;  1CK1 A;  1TS5 A;  3U9O A;  4HSP A;  4A3M B;  1JOR A;  3T1H Q;  3SGI A;  3CCS A;  2JXM B;  1U9R A;  4IN3 A;  5ELN A;  4YWL A;  2K5N A;  5EKI A;  2B2U A;  1LUZ A;  4IUP A;  1VQ7 A;  1CQF A;  2FHT A;  1UNS A;  4JPB W;  1KAW A;  3GTP B;  2WFW A;  1GUN A;  2F0S A;  4JK1 C;  3SE0 A;  1BO0 A;  2LFN A;  4GNX A;  4LAA A;  4A3K G;  4UY8 C;  5CV6 A;  4YWM A;  1JC7 A;  5TSS A;  3VA7 A;  4E6I A;  1JR0 D;  2XSC A;  3DM1 A;  1VQM A;  2K5Q A;  3M4O B;  3H94 A;  3ULP A;  2J7Z A;  4IFD J;  1SJE D;  2HQL A;  4V19 0;  2B2Y C;  2FFK B;  4HMI A;  1I3Q B;  1ASY A;  2K52 A;  4RHR A;  4DV2 Q;  4HIM A;  2F0V A;  2WAQ B;  1A6X A;  4MNO A;  2EIF A;  4ZKB B;  2CW0 D;  3K57 A;  1GHJ A;  1HPC A;  2F0T A;  1EY6 A;  3FKI H;  4A3I H;  4RH6 A;  2NVT B;  4NMZ A;  4IOC A;  4OX9 Q;  3I4N B;  1K9M C;  1U4M A;  1F2Z A;  1BCP C;  3KDF B;  1GHK A;  3K5L A;  4P71 A;  4A3B G;  4O1N A;  5JVG 3;  2RDH A;  3GO5 A;  2GA4 B;  3RUZ A;  2B63 B;  4BXX H;  3TRE A;  4A3B B;  2VQF Q;  3BYY B;  3J80 L;  1PDQ A;  3NQT A;  3GTJ B;  1H9K A;  2I0Q A;  2A5H A;  4GZY C;  2Z4I A;  3PF4 A;  2R92 H;  1YJ9 A;  1HJP A;  3CF5 A;  1X56 A;  1ENF A;  3K8A A;  1EWC A;  2H1E A;  3K0X A;  4X3T A;  1VQK A;  3L2P A;  3I4L A;  1EY9 A;  1HNZ Q;  4FF4 A;  1Q46 A;  4C3I H;  5C5L A;  4KN7 C;  3I4M H;  3ZJY C;  4G7H C;  2Z4H A;  3RMH A;  3BS1 A;  2UU9 L;  4R4Q A;  4JI4 L;  1KNA A;  4K2K A;  1Q12 A;  3HOY H;  2CHB D;  3QWN A;  1XTC D;  5JPN C;  4QJF A;  4DF7 A;  3VYU A;  4OIK A;  5KIX A;  3OMC A;  4XYO A;  4FXK C;  4KHZ A;  2WB1 B;  1I94 L;  2IX0 A;  5M3F H;  1BBX C;  2UUA L;  1LT5 D;  3J80 c;  4CKC A;  1S3O A;  2G9D A;  1SYD A;  3RNU A;  3GTL H;  2RQX A;  2VS1 A;  3JAM L;  1F2L A;  3QJY A;  3GD7 A;  3TP7 A;  2PYK A;  3NEN A;  1LTI D;  2NN6 I;  4L5Q A;  5T1I A;  2K01 A;  1DJR D;  1I6V C;  4C3I B;  4DV3 L;  5FOB B;  3W5O A;  1WCM H;  4K8I A;  1XPR A;  1HNX Q;  1EYG A;  1J8I A;  3K5N A;  2JA8 G;  3I4O A;  5LHY 1;  4LF6 Q;  1HUM A;  4LFC L;  1KAB A;  4JYA L;  1MKH A;  3I73 A;  2JEA I;  1TR5 A;  4FYD A;  1ICF B;  3M4Q A;  1PH9 A;  4K5X A;  1EYA A;  1NR2 A;  1PYW D;  1ZYR C;  4KY6 A;  3S1M B;  4DUZ Q;  4EGV A;  2BCO A;  1IW7 D;  5LMN Q;  2QDB A;  4XXE A;  2EDG A;  3KLW A;  5FLM H;  1V43 A;  1SMX A;  1GM5 A;  5IGG A;  5CV5 A;  1NNX A;  1X3P A;  3IFT A;  1WFQ A;  2VUM B;  3HOU H;  5CBA E;  1KD1 C;  1CTM A;  3PO3 H;  2JA5 B;  5J3B A;  1LT3 D;  2CWP A;  3KF8 B;  5J22 A;  3EFX D;  2QA4 A;  3D3R A;  4X65 Q;  4DXG A;  4K5W A;  1K8M A;  3CMA A;  4BBR H;  1I4Q A;  1QB5 D;  3W1B A;  4EQO A;  2V1C C;  2D5D A;  3R2I A;  2EPB A;  1DCZ A;  1YNJ D;  4A3D H;  3RN2 A;  2NZH A;  4XDX A;  3JAM E;  1XNQ L;  1PV4 A;  2CH4 A;  4JI8 L;  3W3A A;  4R9W A;  5LL6 S;  3TQY A;  4B9W A;  3CAM A;  2N8N A;  1JT8 A;  4QMG A;  1RKN A;  4AYB E;  1SBB B;  3G7L A;  1F2M A;  2A73 B;  1HTL D;  4KTA A;  1VQE A;  1GJX A;  4GOP B;  1EEF D;  2K7V A;  4BBR B;  1HA5 A;  4LFB L;  3T1Y L;  4LF9 Q;  2B8G A;  4LK1 C;  2A6E D;  4PZ6 A;  1VCI A;  4HJA A;  2IL8 A;  3V05 A;  3S2H H;  1E1T A;  2CW0 C;  4FVM A;  3PIO 3;  4DUY Q;  2ATW A;  4ZRZ A;  2B8F A;  4HIO A;  1JWS D;  1EY4 A;  4DU9 A;  3DUZ A;  2JQO A;  4J6H A;  2YU9 H;  1PH3 A;  3MEH A;  1TS2 A;  3GTO H;  4NKL A;  3B6Y A;  3M4P A;  3G4S A;  3NEL A;  4CKB A;  4JI1 Q;  4P72 A;  1A15 A;  4ZLT F;  1MSG A;  3VA5 A;  1O7Y A;  4OWX B;  4DR7 L;  1HZA A;  1H9J A;  3MHB A;  2D0O A;  4YCV A;  1DM0 B;  1NBW A;  3URY A;  1K0S A;  4CJ1 B;  5M5W H;  4C56 C;  4RHS A;  3SK4 A;  2PQA B;  4DPG A;  2R7F A;  4HED A;  4R4T A;  1BQQ T;  1SN8 A;  3S2H B;  1KRT A;  1QNK A;  1DXM A;  3AFP A;  1I50 B;  3BDO A;  1NMG A;  2NYZ D;  5CGK A;  1PH1 A;  1PRT C;  1Q8K A;  1EIG A;  4UPA A;  3MFY A;  3AQQ A;  5C4X G;  2Y0S B;  3M85 A;  4POG A;  2C5C A;  1GUG A;  1KTK A;  3EVQ A;  3I55 A;  1VMC A;  3SK6 A;  3OWE B;  1EZ8 A;  1KRS A;  3S17 H;  5FKA C;  1WOC A;  5LMN W;  1SJH D;  4IUV A;  3DWA A;  1SLJ A;  1E1O A;  5ELF A;  1EFW A;  4LFA Q;  1A3T A;  4LFA L;  2F0E A;  5E4W C;  1B2T A;  1VMP A;  4YY3 L;  1YNN C;  2MFI A;  3S1R H;  2CH4 W;  4K0K L;  2TSS A;  5A2Q E;  1Q7Y C;  1B3Q A;  3NPP A;  2Q8I B;  3U9S A;  4G7Z C;  4B3M L;  4ZK9 B;  2HUG A;  4JI6 L;  3VR6 A;  3I8Z A;  4KD4 A;  3I72 A;  5FO7 B;  4DAM A;  1UEA B;  1RTN A;  2PZW A;  4CBV A;  4R8N A;  5IWA L;  4LF5 Q;  3FPU B;  4DV3 Q;  4KJN A;  1BBW A;  1D7Q A;  2HIX A;  1SNM A;  2DUD A;  3KJP A;  1N32 Q;  2O5J C;  1ET9 A;  1STY A;  1L0X B;  4R1J A;  1VQO A;  1FNU A;  2PNH A;  1GO3 E;  4HCS A;  4OXP A;  4AYB G;  1YHB A;  3H0G G;  3RLF A;  5FO8 B;  3CCU A;  4ID6 A;  2ICE C;  3LGJ A;  2Q8R E;  1F2Y A;  1CHP D;  2FMC A;  4OWT B;  3GV3 A;  2YTV A;  2F0O A;  2E2J H;  5EPK A;  1CSP A;  1V9P A;  1ENC A;  1JJ2 A;  3E5S A;  5IGC A;  4UDU C;  1Q82 C;  4IFD G;  2OTJ A;  1EU4 A;  4K2L A;  5KRU A;  1O80 A;  1TWC H;  3OWF A;  3J7A F;  4HSV A;  3S1Q B;  3A74 A;  1PZI D;  1Y1W G;  2D62 A;  1YZ6 A;  3SVM A;  5DM7 3;  4UHV A;  5G3L F;  4Y7N H;  3GTM B;  4RAU C;  3CQZ H;  4FO2 A;  5IYD H;  1TWF H;  2A68 D;  1EWI A;  1PMR A;  4LF5 L;  3CCR A;  4KKS A;  1IBL L;  1DZ1 A;  1CQV A;  1S5F D;  1BCP D;  4KI0 A;  3J80 E;  5JJL A;  2KED A;  3C2P A;  4DR6 L;  2BE5 D;  5AFW A;  4DFA A;  4FP5 D;  1PTO F;  3L3O C;  1EOV A;  4R4C A;  5I6W A;  5IYC H;  2B2W A;  4DV1 L;  4A3D G;  1VQL A;  1E22 A;  2F0K A;  2K75 A;  2WAQ E;  3RZO H;  2KCN A;  1VDZ A;  1WTO A;  2PW5 A;  1R4Q B;  2I5M X;  4JI2 Q;  1D2B A;  1HZ9 A;  1HQR D;  2X69 A;  2R7Z G;  3HOX H;  2O2L D;  4C3I G;  1U4P A;  1TWH H;  2E2H B;  3KLS A;  3I4M G;  3VR4 A;  2WV6 D;  1AZP A;  1EOT A;  1D5Z C;  1VQ5 A;  3UDX A;  5JEA H;  1K83 H;  2R6G A;  1T5E A;  2HCC A;  3S15 H;  4N9T A;  2BH8 A;  2VW9 A;  5CMD A;  1VQC A;  2D0P A;  3ITP A;  3VYS A;  4ABN A;  1FJG Q;  4A93 B;  3D8G A;  1AEX A;  2YU9 B;  4H44 C;  5AJ3 Q;  3AFQ A;  4H7B A;  1AE2 A;  2IPK D;  5IYB G;  4DR2 L;  4JI8 Q;  2B2Y A;  4FXG C;  1IKM A;  4A3L G;  1LTG D;  1PH7 A;  4KK7 A;  2Z6K C;  4X6A H;  1VQ4 A;  2MGS A;  5BR8 Q;  3FRP B;  2L5T A;  3WWV A;  3PMF A;  3PSI A;  2F0Q A;  1PZK D;  1GOZ A;  2F4V Q;  3KK7 A;  4GKK Q;  1CKN B;  1PRT D;  5GAH C;  5C0X I;  4YHH Q;  3HGB A;  4GNX C;  4ZCK A;  1S5B D;  4A3G G;  5NUC A;  4BY1 H;  3KLS X;  2F3I A;  1YHA A;  2N49 A;  2UXB L;  1X3Q A;  3PIO A;  1L1O B;  2HDL A;  2OCE A;  5JJK A;  2NUC A;  4YWK A;  3E0E A;  1XMO Q;  3IRB A;  1I6H H;  4NB3 A;  3NXW A;  1DD2 A;  3KFU A;  1P8L A;  1WCM G;  5M3F B;  5FLX L;  2NVY B;  3S2D H;  1SFO H;  5KND A;  1PTO H;  5C4X H;  2DNC A;  4NDX A;  3AB9 A;  3STB C;  2I07 B;  2XRQ D;  4X66 L;  4CDE C;  3LWU A;  5CV8 A;  1WCM B;  5K36 G;  5IP9 H;  3M3Y H;  3ICE A;  4RCN A;  3A5U A;  3L9A X;  1LLR D;  2NZO A;  1X3F A;  3U58 A;  2BOS A;  3ERO A;  2CWA A;  1Y1V B;  3DHQ A;  3AEV A;  2VZA A;  1E0B A;  3J81 L;  1K28 A;  2F0J A;  4JOI C;  4C1N I;  1A2U A;  3D6C A;  1CA6 A;  5C44 G;  2XGT A;  3PO3 B;  4A3E B;  5M5Y H;  2PI2 E;  3MVV A;  4A3J H;  4YIJ A;  1JOK A;  1X6O A;  4ME3 A;  1HNW L;  4BY7 H;  3IL8 A;  5C3W A;  3PO2 B;  3K58 A;  1SYE A;  3HOZ B;  1F9P A;  4N9P A;  3C1E A;  4HID A;  2F1M A;  1WTQ A;  1TII D;  2WB1 E;  1U4L A;  3PUW A;  2B63 G;  2EZV A;  1I94 Q;  4UP7 A;  1Q86 C;  4LF7 L;  1SYG A;  4QF4 A;  3GDE A;  1HCZ A;  1YI2 A;  4JG2 A;  2BA1 A;  1RCV D;  3JAM c;  1KIX A;  1R9T B;  3VDY A;  1QIL A;  1EQQ A;  5M5Y B;  3NSW A;  5HUR A;  4IOA A;  4N8F A;  2A68 C;  4JI4 Q;  4DR4 L;  4BBS B;  1GKH A;  1QJO A;  3BZK A;  2L9H A;  2B2T A;  3P20 A;  1KL9 A;  2A74 C;  1TS3 A;  2ZXO A;  2JA6 H;  3S15 B;  2OF1 A;  1Q3L A;  2UU9 Q;  3CCQ A;  4HJ8 A;  2EY2 A;  3GQB A;  3LWE A;  1TWF B;  1LYL A;  3CC2 A;  3A7L A;  4J15 A;  1SYB A;  4L5S A;  3CU7 A;  4X65 L;  1HTP A;  1KDC A;  2K32 A;  2ZM6 L;  1O7I A;  3BYT B;  5EBC A;  1WTP A;  3CRK C;  1VQN A;  3D6W A;  1IXR A;  2SDF A;  4KLK A;  2VL6 A;  3HOX G;  1GUS A;  1XNQ Q;  2PCF B;  3HOZ G;  4M8A A;  2PZT A;  1E2W A;  3L0O A;  3GV6 A;  4XQQ A;  1YJW A;  3GTJ H;  3IAY A;  1I5F A;  4AH6 A;  3F2D A;  5EGT A;  3NWT A;  3OW7 A;  3IKJ A;  5DAU A;  2OTL A;  4OEL B;  5CYU A;  2VNU D;  1K0R A;  4BY1 B;  1TT2 A;  1MJE A;  1LTL A;  2E76 C;  2MP1 A;  5JJZ A;  4IAL A;  4CDD C;  4PQX A;  3N52 A;  1JQY D;  4EX5 A;  1MBY A;  3KLR A;  3BG3 A;  2CQA A;  2OQ0 A;  3BDL A;  1C8C A;  3H3V I;  1VQ9 A;  2K6A A;  3U4V A;  4K8J A;  1AZQ A;  2JA7 H;  4M1U B;  1NE3 A;  1YIJ A;  5ELC A;  1PH5 A;  1PH2 A;  1I50 H;  2AMC B;  4AYB B;  5C3X A;  4A3F G;  3K80 C;  4TRD A;  4GN3 B;  2NZ1 D;  2LS0 1;  3I4M B;  3NQI A;  2RHS B;  5FLX c;  2RDF A;  4IZ8 A;  4A93 H;  2JJQ A;  1O78 A;  2LY7 A;  3BVM A;  1BR9 A;  4RKB A;  5C4J B;  2UXB Q;  2XTI A;  4K14 A;  1PFS A;  2RBM A;  1FGU A;  4LJZ C;  1UE6 A;  3PUV A;  1TWA H;  3MEF A;  5DEH A;  1WD0 A;  1CUK A;  3K7U C;  1Z9F A;  5K5P A;  1A3U A;  3TZU A;  1C0A A;  1KDA A;  2F4V L;  4DV7 Q;  3Q23 A;  2K5V A;  4JBW A;  3WOF A;  4F7X A;  1LV9 A;  4UAI A;  1XYI A;  3J81 c;  3NBH B;  1ROD A;  2EJG C;  1PYS B;  3ND9 A;  1N9W A;  1VF7 A;  2K05 A;  3NTK A;  4IUT A;  1WTX A;  1MHW C;  4HMJ A;  4KKT A;  4JI1 L;  1PTO C;  2WII B;  3H0G H;  4MHE A;  5C0X G;  1W6K A;  3RLN A;  2A69 C;  5KNC A;  3VR5 A;  3T56 B;  3DXJ C;  2G5D A;  2NVT H;  1TWA B;  1K3R A;  4HAE A;  3RD4 A;  4IQZ A;  5AJ3 L;  5CC4 A;  2OXP A;  4QGU A;  2L0C A;  3DMU A;  1QZH A;  2HD3 A;  1VF5 C;  3UE1 A;  1N33 L;  5IGE A;  1UE7 A;  3E3X A;  1XPO A;  5T1G A;  3MXG A;  5IP7 G;  1LTS D;  3H0G B;  1HH2 P;  3CRL C;  3F8T A;  4ZUI A;  1YNJ C;  1EIY B;  4G4K A;  2JE6 I;  5FLX E;  1JJC B;  1ASZ A;  3TME A;  1G2S A;  1S4Z A;  4H02 A;  4DAP A;  3S2D B;  2K1B A;  4C3J B;  2XWB B;  2WIN B;  4XQN A;  2IX3 A;  3PIP 3;  1YHQ A;  2L55 A;  1J5E L;  1IL8 A;  4A3C G;  1DON A;  2UXD L;  1SE4 A;  1KLU D;  1EEI D;  2UXD Q;  2J4X A;  1W2B A;  1HZC A;  1QE6 A;  2EYJ A;  1ONL A;  3PUY A;  2LKV A;  2JSO A;  4DR4 Q;  5LL6 X;  4P73 A;  4Y7N B;  3GTM H;  5E1F A;  2O5I C;  3F1Z A;  4NXN Q;  5IYC G;  2B39 A;  3MFG A;  1H9S B;  2EY6 A;  1I3Q H;  4ZQ3 A;  1OXV A;  2EJF C;  1IYJ B;  4QB4 A;  1TWC B;  1M90 C;  3PGZ A;  2C9O A;  3N6R A;  5G3L D;  3CQZ B;  3S14 H;  2QCP X;  1FGB D;  2DY7 A;  2RCN A;  1I4G A;  1Z6H A;  2CCZ A;  1YNX A;  1JIC A;  3KBG A;  3I3C A;  1J9O A;  1ZXT A;  1TY2 A;  1IBL Q;  4C3H H;  4PMC A;  3HKZ B;  2AHO B;  4DK6 C;  1OXX K;  2EOT A;  5C5M A;  3SK5 A;  1C48 A;  1AH9 A;  2E5L L;  3FKI B;  4UP9 A;  4CDC C;  1QVG A;  2Q2U A;  2RDG A;  5M9O A;  2GN5 A;  1ILQ A;  4GKK L;  1N34 Q;  3S24 A;  2EY5 A;  3BZD B;  2RSN A;  1S5D D;  2E8G A;  4DV5 Q;  2NB0 A;  1IBK Q;  5ELE A;  3ND8 A;  4QQB X;  1UUP A;  4DR5 Q;  1G91 A;  1N36 Q;  1HNZ L;  4F87 A;  1QZG A;  1CKO A;  2M00 A;  1CFM A;  3I90 A;  1FVI A;  5JEA G;  4DAY A;  4QIW B;  4ALP A;  2ID0 A;  5JVH 3;  2F0D A;  2Z6B A;  1TU2 B;  1CSQ A;  5M3M B;  3G71 A;  1PXU A;  3NTI A;  4PG3 A;  1SRO A;  3HOV G;  4KMU C;  2QW7 A;  3T53 B;  1XPU A;  2EYO A;  2F3V A;  4BY1 G;  4MZ9 A;  2RF4 A;  1TWG B;  2F0F A;  2K50 A;  3BZC A;  5IY0 A;  5JPM C;  1JB3 A;  2UUC Q;  3KF8 A;  5CV9 A;  4DNT B;  4IJL A;  3OYY A;  3R3O A;  1XWE A;  2H5X A;  3CHB D;  1JOQ A;  2YV5 A;  2ZM6 Q;  4A3J B;  5A2Q L;  1ZEQ X;  3Q8D A;  2R93 G;  2K28 A;  3VYT A;  4QUF A;  4OL7 A;  3J81 j;  3SR1 A;  5I9O A;  1PFB A;  1HR0 Q;  3AYH B;  5M3F G;  3RZD B;  3S1Q H;  1IW7 C;  3K0Y A;  1WTW A;  3STB D;  1QUQ B;  3ONA B;  2A19 A;  1Y8P B;  2MPM A;  2R7D A;  4L5R C;  4XIG S;  2BH2 A;  4X3U A;  1V8Q A;  3HZX A;  2SNS A;  2NN6 H;  2ZXP A;  3GTQ B;  1RIP A;  1FJG L;  1MI2 A;  4C3J H;  1U4R A;  2NVX B;  1TVX A;  4CKE A;  1VQJ A;  2EY1 A;  3K7A H;  1S5C D;  4IUQ A;  1E7Z A;  3EA6 A;  1G6Z A;  2ZJQ A;  5C44 H;  2AQ3 B;  2RA4 A;  1EU3 A;  4RCO A;  1IL2 A;  3QIA A;  1LT4 D;  4GN5 A;  5EJW A;  4ZKC B;  4JI7 Q;  5IYD G;  2EE1 A;  3M7N A;  4GKJ Q;  4QCL A;  3R8B A;  5D65 A;  1YBY A;  1VQG A;  2WAC A;  5K36 H;  4X66 Q;  1H9R A;  2I5H A;  5JOB A;  3HEJ A;  3W1G A;  2ZTE A;  3HOU B;  5KNB A;  4KHV A;  5ELO A;  2F0L A;  3J7Z C;  1STN A;  1BF4 A;  4PMB A;  3HOU G;  2JA8 H;  2ALY B;  1U5K A;  2F52 A;  3HKZ G;  4B3T Q;  3AMU A;  3WOE A;  1N33 Q;  3PO2 G;  4JVZ A;  2JEB I;  5D3D A;  4A4I A;  4ZUJ A;  2JA6 G;  4C1N K;  4WOR A;  2P5Z X;  4YHH L;  1IZ6 A;  4ZAI A;  4I7A A;  1L2F A;  3QG1 A;  4Z9C B;  1QWY A;  5HGT A;  4AQY L;  3HKS A;  1D5M C;  3A7A B;  4PZ7 A;  1HHV A;  4PV1 C;  1VQH A;  1N36 L;  3E6Z X;  1GUT A;  4DGZ A;  3FKI G;  1XMO L;  2PZU A;  4LUV A;  3CCE A;  4IPG A;  4K5V A;  4G57 A;  4LF4 L;  1OXT A;  3M4Y A;  4RGN A;  1Y8O B;  3HOZ H;  5JEA J;  2OEO A;  4DV7 L;  4YCU A;  3I4N G;  4A3I G;  5EPL A;  3OPO A;  1AE3 A;  4PNY A;  4BXX G;  4QL5 A;  3BDC A;  3FP9 A;  5E4X A;  1TQO A;  3PQI A;  4GLX A;  1NMF A;  5GAG C;  1DOK A;  2WB1 G;  1GXD C;  4JI5 Q;  1EUJ A;  2JK8 A;  4J8Q A;  2PNR C;  3DWQ A;  5I2X A;  4DV0 L;  3RZO B;  4OIJ A;  4A3M H;  2CQO A;  1LAB A;  3MZ5 A;  1SR3 A;  3L7Z C;  3J81 E;  4CJ0 B;  2R92 B;  4WRD A;  3TN2 A;  4XQJ A;  2B2T C;  2JA6 B;  1NSN S;  1TXY A;  1FYC A;  4DR3 L;  2HCI A;  2PO4 A;  1KQS A;  2QGQ A;  1CKM A;  1STB A;  5I6Y A;  2M9V A;  1XJV A;  2AUJ D;  2B29 A;  1V1O A;  2A1A A;  3I70 A;  1F77 A;  1VS0 A;  3GTK B;  1EY7 A;  2QKI C;  1B3A A;  2EXZ A;  3FHW A;  4B3R Q;  1Y14 B;  5LMU Q;  3RN5 A;  1EQV A;  4LWC A;  1HQM C;  2J0T D;  2CVR A;  2SNM A;  3KF6 A;  3C1F A;  4A75 A;  3A8I E;  1PRT F;  4B3S Q;  2E2J B;  1QVC A;  1PH6 A;  1NY4 A;  3CPW A;  1H95 A;  2I46 A;  5CBE E;  3MWY W;  3HOY B;  3V2T A;  3H6M A;  5M5X B;  4IPD A;  2PI2 A;  1VQ8 A;  4NW2 A;  5IWA Q;  3UE0 A;  5I4D A;  1M1K C;  4V0B A;  1VQ6 A;  1NUC A;  4JC0 A;  2BDN A;  1VQA A;  4DV6 Q;  3S9W A;  1KAA A;  5FJ8 H;  5GAD C;  4DA2 A;  1HA6 A;  1EQR A;  2MNA A;  2Y0S G;  3HP3 A;  2LXK A;  2UUC L;  5C4Z A;  1HUN A;  1EY5 A;  4WJ3 M;  3ER0 A;  4RKL A;  4A3J G;  3K6O A;  1VQP A;  2DJG C;  4JI3 L;  2SEB D;  1X54 A;  2NN6 G;  2JA9 A;  2FMM A;  3S1M H;  2VB3 X;  1D5X C;  5CR3 A;  1E24 A;  3I56 A;  5I2Y A;  1PHJ A;  1M4V A;  1V1Q A;  2K04 A;  5F2D A;  3ULL A;  3PV0 A;  1LTA D;  5EKL A;  4ILW A;  1OXS C;  1SDF A;  2D2C C;  1KNE A;  2JP1 A;  2I5L X;  1ZYR D;  4R4O A;  3T1H L;  4BBR G;  3P75 A;  3DLL A;  2AQ1 B;  2L12 A;  5DLQ E;  3TEH B;  1BBU A;  1IBK L;  1E2Z A;  1Y1V H;  4N8X 1;  5EKK A;  1D6E C;  4BA1 I;  3HOX B;  1PTO B;  1R4P B;  1L0W A;  3NBH A;  1B44 D;  4JV5 L;  4Y52 H;  3KBX A;  4Q5V A;  1PA6 A;  2PW7 A;  1SE2 A;  1KHI A;  1Y1W B;  4JOI A;  1A63 A;  2Q2H A;  3OIQ A;  1JE4 A;  4DK0 A;  4WJ4 A;  5JAV A;  1G29 1;  5IGD A;  3Q24 A;  3GTQ H;  3A5Z B;  1IYV A;  2Q8T A;  3V96 A;  4GS3 A;  3S16 H;  1B8A A;  1UE1 A;  3CCV A;  3PO2 H;  1SSO A;  1V1P B;  5J1Z A;  3ULJ A;  2WAQ G;  3BVG A;  4KJO A;  4LMQ D;  5C6A A;  4XT3 B;  1Y69 U;  4AQY Q;  5CV7 A;  4HR7 B;  1MD2 D;  2R7Z B;  2OT2 A;  1AW7 A;  4A76 A;  2KOL A;  4DV5 L;  3J81 i;  2RCF A;  4C3H G;  1Q8I A;  4RWS C;  2Z6K A;  4OX9 L;  4DK1 A;  1BKB A;  1PH8 A;  1FNV A;  4B3R L;  1NR4 A;  1M8A A;  2FXQ A;  3S16 B;  2EYM A;  3MXP A;  3T13 A;  4IFD I;  1PFM A;  1XMQ Q;  5COY A;  1BVS A;  5C3E B;  2GVA A;  3M7G A;  4QY7 A;  3OTO L;  2IT1 A;  3U4Z A;  3WDN A;  1FL0 A;  1EIF A;  4TQU S;  4A3M G;  3DEP A;  1L1O C;  3GTO B;  1QVF A;  4IFD H;  1LO5 D;  4IUR A;  4KD3 A;  3J7Y W;  1JB7 A;  1OO9 B;  1X9N A;  3CKI B;  1SYC A;  4A93 G;  1G2T A;  1RF2 D;  3TDQ A;  4FDB A;  3RR5 A;  1YJN A;  1KXL A;  1CZW A;  1EYD A;  2EYH A;  3H15 A;  3KYH C;  4HN7 A;  3HS0 C;  2M2L A;  4JI5 L;  5BN5 A;  1UE5 A;  5FLM G;  3S17 B;  5I9P A;  3OMG A;  2QIL A;  1QUQ A;  1G51 A;  1CA5 A;  1EYC A;  2E75 C;  3BU2 A;  1WYD A;  5COR A;  3FMC A;  4X3S A;  2EVB A;  3AU7 A;  3UDI A;  1B50 A;  4L6T B;  3TS2 A;  2R93 H;  1V1P A;  4DXF A;  1WTH A;  4DR7 Q;  1F9S A;  3ERQ A;  4JI0 Q;  3HG9 A;  1BCP B;  1Q90 A;  2HIV A;  4LUO A;  2Z0S A;  1XNR L;  5A35 A;  1XNR Q;  1N32 L;  1IHZ A;  1F9R A;  1EL0 A;  4ODG A;  1ILP A;  1D1I A;  1SMY D;  1IYU A;  4L8J A;  1XTD A;  2VQE L;  4K6L A;  3DM3 A;  3CXC A;  2ZT9 C;  4XYQ A;  2N3S A;  5FK9 C;  1VQF A;  3S1N B;  5H1S E;  3S1R B;  3CC4 A;  2KCC A;  2V4D A;  2OWO A;  2R93 B;  4X62 L;  4OO1 G;  1QOH A;  1S72 A;  3HOV B;  2ASB A;  5ELB A;  2ZTC A;  1T9H A;  1IBM Q;  3EN2 A;  1X3G A;  2DY8 A;  3G6E A;  3NEM A;  4F88 A;  5C4X B;  3E9I A;  2VUM H;  1AP0 A;  3MTS A;  3SEB A;  4JI0 L;  4FF1 A;  2K03 A;  4JBJ A;  3MA2 B;  3S1N H;  2B2V A;  1WTR A;  2IY5 B;  1STA A;  3A0J A;  1I6H B;  2QEJ C;  2NBF A;  1H9S A;  3PUX A;  4R4I A;  3UI2 A;  4DV1 Q;  1EY0 A;  4WFN 3;  1JOO A;  5KYL A;  2YTY A;  1BDO A;  3S14 B;  4NXM Q;  2KHJ A;  3TZD A;  3FEW X;  4JW0 A;  4DUZ L;  2JA5 H;  2RKS A;  2X6L A;  3TS0 A;  3MXN A;  3MXU A;  4DK3 C;  1SEB D;  2HT1 A;  1SNQ A;  1KDB A;  5DM6 3;  4DKA C;  1ML0 D;  4LF7 Q;  4DAV A;  4DUY L;  4P74 A;  3EIV A;  1II3 A;  1YNN D;  4RGO S;  4R8I A;  3D0F A;  2KQ3 A;  3QB3 A;  4BY7 B;  1SND A;  4K6D A;  2LMC B;  4KY7 A;  4K0K Q;  5EQ0 A;  5KGU A;  4P2C B;  4TKO B;  1TS4 A;  3OW2 A;  2H4O A;  3J80 i;  2E2I H;  4GOP A;  3HOW G;  1GUO A;  4DR2 Q;  1K8G A;  5ISR A;  2MJ8 A;  3TP6 A;  3J7A 5;  2NWG A;  2QEX A;  1NTG A;  4IUU A;  5IT9 L;  3PF5 A;  5HGQ A;  2A8V A;  2F0W A;  1EZ6 A;  2K5W A;  2R3Z A;  2MQH A;  5IE8 A;  1WD1 A;  1D1K A;  3P1H A;  4ME5 A;  1G6P A;  4DV6 L;  2EYF A;  2HQE A;  3VYR A;  3G48 A;  2E74 C;  3CD6 A;  1Y1V G;  4TVA B;  2B63 H;  2KEC A;  1GVP A;  3K5M A;  1A3V A;  1DOM A;  5M3M G;  2PQE A;  2IHE A;  1SRU A;  4A3K H;  4NXM L;  5IGB A;  3DWP A;  3LX0 A;  4JI2 L;  1C7Y A;  3TRZ A;  4DR5 L;  4J1M A;  4POF A;  2HHH L;  1RDP D;  5M5W B;  3FVQ A;  4LW1 A;  1BOS A;  1I4P A;  4A3D B;  2VB2 X;  3KJO A;  4HIK A;  2K5H A;  4FNF A;  3CCL A;  2IW3 A;  3H09 A;  1K83 B;  2VQF L;  4B9X A;  2IJ0 A;  3M4O H;  1JMC A;  4X62 Q;  1STE A;  1A0I A;  3QO2 A;  1MGS A;  2DGY A;  3TP8 A;  1QCB D;  5CV4 A;  1SE3 A;  5IYB H;  4LFC Q;  4JYA Q;  2VY3 A;  1PTO D;  4HJ5 A;  4GLA C;  4LFB Q;  1E2V A;  2JA7 B;  3NUC A;  1CT1 D;  4JI7 L;  5GQO A;  2L1B A;  1O7L A;  1U0L A;  3R2T A;  2E5L Q;  2XWJ B;  3MXN B;  2K14 A;  4A3L H;  5IGF A;  3OOC A;  2R92 G;  5IOC A;  1JWM D;  1KC8 C;  5C0X J;  1WTV A;  2AWO A;  1HZB A;  3K5O A;  4DV4 Q;  2B2U C;  1R9T H;  4MIU A;  1SNC A;  1W3S A;  5KYI A;  3T1Y Q;  5C4J H;  4BBS H;  4IPC A;  5BN3 A;  4KKU A;  4RGT A;  1K73 C;  2NVQ B;  3NHH A;  2PMZ B;  1TWG H;  1Y1W H;  3NWS A;  5FJ8 G;  3M3Y B;  2NVY H;  4A3F H;  3EJI A;  5GRO A;  4YY3 Q;  1PLF A;  1BNZ A;  2KA7 A;  1JJG A;  3SDZ A;  1BUV T;  1LT6 D;  1NAP A;  2K4K A;  4IO9 A;  2O4X A;  4GLV B;  4OHJ A;  4LF8 L;  4DN4 M;  5IP9 G;  1PRT B;  1SFO B;  2EJM A;  4GNX B;  2RSO A;  2NVQ H;  1EY8 A;  1MJC A;  4L63 B;  1BCP F;  4A3E H;  1OTC A;  1TY0 A;  4RG1 A;  2DJF C;  2JA5 G;  2IWH A;  2ICI A;  3MAQ A;  1JE5 A;  3GTP H;  1B4O A;  1X55 A;  4LNQ A;  4JBK A;  3CME A;  4IUN A;  2F0G A;  1QNU A;  1MIU A;  3SXH A;  4DR1 Q;  3D4D A;  4GN4 B;  3Q0A A;  3U50 C;  4LF9 L;  3NTH A;  2QDL A;  2KEE A;  1PFN A;  4NPS A;  4EQP A;  1WI5 A;  4I65 A;  4KV6 A;  2ES2 A;  1HFN A;  2X6G A;  1UWV A;  3CCM A;  5IT9 c;  4OEM B;  2PPB C;  1HFG A;  1PYB A;  2MHV A;  5C3E H;  1SE8 A;  4APV A;  1C9O A;  2AWN A;  1Q81 C;  3I4N H;  4C2M H;  4RA8 A;  2D9U A;  3T4A C;  1RD9 D;  1RTO A;  2UUA Q;  1B1Z A;  4PMW A;  2JA8 B;  1STG A;  1Q1E A;  4QUC A;  2Q2T A;  4H13 C;  2VXW A;  1EQT A;  1I4H A;  2AQ2 B;  1IBM L;  4YCW A;  2K5D A;  1NJI C;  2F0P A;  1ENA A;  2QF7 A;  2EQS A;  2MO0 A;  3D4R A;  1HR0 W;  1MSH A;  2FJ2 A;  2R7Z H;  2KCM A;  1HNX L;  5BN4 A;  4L5T A;  4BWG B;  1L1O A;  2E2I B;  4A3B H;  2B3G A;  2NTS A;  2WKC A;  2IX1 A;  2UUB Q;  3ERS X;  3QOJ A;  1B7Y B;  2ZJP A;  4OWW B;  3Q6S A;  1UAP A;  4JI6 Q;  1Q1B A;  4IPH A;  3NP8 A;  1JWU D;  3HRZ C;  2BA0 A;  2R61 A; 
#chains in the Genus database with same CATH homology
 1VQP A;  2ZM6 L;  4JI3 L;  2ZJR A;  1X54 A;  4DUZ Q;  2NN6 G;  2JA9 A;  1O7I A;  1J6Q A;  5LMN Q;  3S1M H;  1VQN A;  5LMN L;  1IXR A;  4KLK A;  2VL6 A;  3HOX G;  1E24 A;  3KLW A;  5FLM H;  1V43 A;  1SMX A;  3HKZ E;  3I56 A;  1GM5 A;  1XNQ Q;  1PHJ A;  1V1Q A;  3HOZ G;  3E9H A;  3ULL A;  1WFQ A;  4KHP Q;  3CP0 A;  3PV0 A;  3HOU H;  3L0O A;  1KD1 C;  1OXS C;  3PO3 H;  5J3B A;  1YJW A;  3GTJ H;  2I5L X;  4DV4 L;  1I5F A;  2CWP A;  3KF8 B;  4R4O A;  4AH6 A;  4BBR G;  3F2D A;  3DLL A;  2QA4 A;  3T1H L;  4X65 Q;  5LMU L;  5DLQ E;  4A3C H;  3TEH B;  3CMA A;  4BBR H;  3PIP A;  1BBU A;  1IBK L;  2OTL A;  1Y1V H;  4BA1 I;  2VNU D;  1K0R A;  1PVO A;  3W1B A;  2V1C C;  5JJI A;  1MJE A;  3KOJ A;  1L0W A;  3RLO A;  2HHH Q;  1X3E A;  4A3D H;  3RN2 A;  4JV5 L;  1LTL A;  2NZH A;  2CFM A;  4Y52 H;  4JV5 Q;  1XNQ L;  1PV4 A;  1PA6 A;  2Q2I A;  4JI8 L;  1KHI A;  1RL2 A;  4JOI A;  1A63 A;  2Q2H A;  4EX5 A;  4WJ4 A;  1G29 1;  3GTQ H;  3A5Z B;  3TQY A;  5M3M H;  4GS3 A;  3S16 H;  1B8A A;  1UE1 A;  1VQB A;  3CCV A;  2OQ0 A;  3H3V I;  3PO2 H;  1VQ9 A;  3U4V A;  2JA7 H;  3ULJ A;  3CAM A;  1NE3 A;  3GTK H;  1YIJ A;  1PH5 A;  2N8N A;  3F2C A;  2WAQ G;  1PH2 A;  1JT8 A;  1I50 H;  2AMC B;  4A3F G;  3K80 C;  2OQK A;  4AYB E;  2EXD A;  4GN3 B;  2IHF A;  2RHS B;  5FLX c;  4AQY Q;  1VQE A;  1N34 L;  4A93 H;  4GOP B;  2JJQ A;  1S40 A;  4LUZ A;  3D31 A;  4A76 A;  2XTI A;  2UXB Q;  4LFB L;  1PFS A;  3T1Y L;  4DV5 L;  3J81 i;  1FGU A;  4LF9 Q;  2VUM G;  1UE6 A;  3HFZ B;  4PZ6 A;  3PUV A;  1VCI A;  1E3P A;  1TWA H;  3MEF A;  4X65 L;  4HJA A;  1CUK A;  3K7U C;  1Z9F A;  5M5X H;  4LF4 Q;  1E1T A;  2Z6K A;  4X64 Q;  4DUY Q;  4OX9 L;  2ATW A;  1BKB A;  4HIO A;  3S2H H;  2PQA A;  3JC6 6;  1C0A A;  2F4V L;  4DV7 Q;  4P75 A;  1PH8 A;  2MO1 A;  3GTG H;  2YTX A;  2E2H H;  2JQO A;  4B3R L;  1HNW Q;  2K5V A;  2FXQ A;  4JBW A;  2YU9 H;  1PH3 A;  3J81 c;  3NBH B;  3GTO H;  3RZD H;  3B6Y A;  3I2Z A;  1PYS B;  3M4P A;  3G4S A;  4IFD I;  3CCJ A;  3NEL A;  1N9W A;  1XMQ Q;  1BVS A;  3PO3 G;  2GVA A;  4QY7 A;  2Y0S E;  4P72 A;  4JI1 Q;  3OTO Q;  4JI1 L;  3OTO L;  2IT1 A;  5C0X G;  3H0G H;  1UEB A;  3RLN A;  3KF6 B;  3U4Z A;  4JBM A;  4XTC S;  1FL0 A;  1EIF A;  1DGS A;  4OWX B;  4TQU S;  5GAE C;  2NVT H;  4DR7 L;  1K3R A;  4BY7 G;  5AJ3 L;  1HZA A;  4A3M G;  1L1O C;  2PMZ E;  2D0O A;  4YCV A;  1NBW A;  4QGU A;  1QVF A;  3HOV H;  1CKN A;  1JB7 A;  5M5W H;  1X9N A;  4A93 G;  2PQA B;  4DPG A;  4FDB A;  5EAY A;  3RR5 A;  2R7F A;  1YJN A;  1QZH A;  1KXL A;  4R4T A;  1SN8 A;  3UE1 A;  3H15 A;  3F2B A;  2NVX H;  2LXJ A;  1N33 L;  1KRT A;  3KYH C;  1UE7 A;  1XPO A;  4JI5 L;  1YVC A;  3AFP A;  5IP7 G;  4HJ9 A;  4AIM A;  1NMG A;  1HH2 P;  3F8T A;  1PH1 A;  1UE5 A;  5FLM G;  4JCV E;  4BBS G;  2UXC Q;  1EIY B;  1VQI A;  1WJJ A;  2JE6 I;  1Q8K A;  1JJC B;  1G51 A;  1QUQ A;  1ASZ A;  4UPA A;  3BU2 A;  3CW2 C;  1WYD A;  3AQQ A;  3HOW H;  4H02 A;  5C4X G;  1YIT A;  2L15 A;  3M85 A;  3BJU A;  4POG A;  3UDI A;  1YHQ A;  3I55 A;  5E7N A;  3TS2 A;  2R93 H;  2CKZ B;  1KRS A;  4EQ5 A;  1J5E L;  3S17 H;  4DR7 Q;  1WOC A;  4A3C G;  4JI0 Q;  2UXD L;  5LMN W;  2UXD Q;  2HIV A;  4LUO A;  1VQD A;  1SLJ A;  1E1O A;  1HZC A;  1W2B A;  2Z0S A;  4LFA Q;  1EFW A;  1XNR L;  3KDF A;  3PUY A;  4LFA L;  1XNR Q;  1N32 L;  4DR4 Q;  4P73 A;  3GTM H;  3I7F A;  3PUZ A;  3F1Z A;  4YY3 L;  2MFI A;  4NXN Q;  3S1R H;  5IYC G;  1XTD A;  2VQE L;  4K0K L;  4A3E G;  1Q7Y C;  3DM3 A;  2VQE Q;  3CXC A;  4LF8 Q;  1I3Q H;  2N3S A;  1VQF A;  1D8L A;  1OXV A;  2RHQ B;  5H1S E;  1IYJ B;  4B3M L;  1M90 C;  3CC4 A;  1A62 A;  2OWO A;  3PGZ A;  4JI6 L;  4X62 L;  4OO1 G;  4DV0 Q;  1S72 A;  2JA7 G;  3S14 H;  2RCN A;  4DAM A;  2ASB A;  2ZTC A;  1T9H A;  2CCZ A;  1YNX A;  1IBM Q;  3EN2 A;  1X3G A;  5IWA L;  3G6E A;  3M9B A;  4OO1 I;  3NEM A;  4LF5 Q;  3E9I A;  2KHI A;  2VUM H;  1IBL Q;  4DAY B;  4DV3 Q;  1K8A C;  4IJH A;  4C3H H;  5C3E G;  1BBW A;  4DR1 L;  4JI0 L;  2HIX A;  2AHO B;  4DK6 C;  1OXX K;  1D7Q A;  4JBJ A;  2DUD A;  3S1N H;  2IY5 B;  4KHP L;  3KJP A;  1AH9 A;  5BR8 L;  3A0J A;  5HY6 A;  2E5L L;  4LF6 L;  4UP9 A;  1N32 Q;  1QVG A;  3PUX A;  4R4I A;  2Q2U A;  4DV1 Q;  2GN5 A;  4GKK L;  1N34 Q;  3S24 A;  1VQO A;  4R1J A;  1YEZ A;  2YTY A;  4NXM Q;  2KHJ A;  1A8V A;  2PNH A;  1GO3 E;  2E8G A;  4QIW E;  4GOP C;  2JA5 H;  4DUZ L;  4DV5 Q;  4OXP A;  1IBK Q;  4AYB G;  1YHB A;  2KCT A;  3H0G G;  2WP8 J;  3RLF A;  3CC7 A;  3CCU A;  3TS0 A;  4DK3 C;  4QQB X;  3LGJ A;  4OON A;  2HT1 A;  4DR5 Q;  4DKA C;  4OWT B;  1X65 A;  1PH4 A;  2YTV A;  4DR3 Q;  1N36 Q;  1HNZ L;  4LF7 Q;  4X64 L;  4DUY L;  1CKO A;  1QZG A;  1J5E Q;  1FVI A;  2E2J H;  5JEA G;  4ALP A;  4P74 A;  1CSP A;  2ID0 A;  1V9P A;  1JJ2 A;  3EIV A;  1CSQ A;  1P16 A;  3G71 A;  1Q82 C;  4PG3 A;  1SRO A;  3EBE A;  4DNI A;  3D0F A;  3HOY G;  1XMQ L;  3HOV G;  4IFD G;  2OTJ A;  4NXN L;  4K0K Q;  3K81 C;  1XPU A;  1TWC H;  4BY1 G;  4MZ9 A;  1B70 B;  2UUB L;  2RF4 A;  4RMF A;  3A74 A;  1GD7 A;  2K50 A;  1Y1W G;  2D62 A;  3BZC A;  1Z47 A;  4B3M Q;  1YZ6 A;  5IY0 A;  3PCO B;  3J80 i;  3OW2 A;  2E2I H;  5IP7 H;  4O0A A;  2UUC Q;  4Y7N H;  4GOP A;  3HOW G;  4DR2 Q;  1K8G A;  2ZTD A;  3CQZ H;  3OYY A;  4IJL A;  4JI3 Q;  5IYD H;  2H5X A;  3JAM i;  3J7A 5;  1TWF H;  2YV5 A;  2ZM6 Q;  2QEX A;  1NTG A;  2C35 B;  3PF5 A;  5HGQ A;  2A8V A;  1EWI A;  3Q8D A;  2R93 G;  4LF5 L;  2MQH A;  5IE8 A;  3CCR A;  1IBL L;  3J81 j;  1G6P A;  4DV6 L;  4KI0 A;  5JJL A;  4PZ8 A;  3G48 A;  4DR6 L;  1HR0 Q;  2N78 A;  3AYH B;  3CD6 A;  4DR6 Q;  1Y1V G;  3UDG A;  2UXC L;  4TVA B;  5M3F G;  2B63 H;  2GVB A;  1EOV A;  1GVP A;  3S1Q H;  4O2D A;  4R4C A;  3STB D;  5IYC H;  4DV1 L;  2KBN A;  1QUQ B;  5M3M G;  1VQL A;  4A3D G;  2IHE A;  2A19 A;  1E22 A;  1SRU A;  2K75 A;  4DV2 L;  2LSS A;  2R7D A;  4XIG S;  4A3K H;  2WAQ E;  4L5R C;  4NXM L;  2BH2 A;  4MTN A;  3H3V H;  3RZO H;  1RIP A;  2AKW B;  1FJG L;  4JI2 L;  1C7Y A;  4C3J H;  4HJ7 A;  2I5M X;  3TRZ A;  4JI2 Q;  1HZ9 A;  1VQJ A;  2KEN A;  4DR5 L;  3K7A H;  4B3S L;  4B3T L;  1E7Z A;  2R7Z G;  3HOX H;  4POF A;  3UDF A;  2HHH L;  3CPF A;  1TWH H;  2ZJQ A;  4LW1 A;  5C44 H;  3I4M G;  1HR0 L;  1OXU A;  1PH9 A;  1N8R C;  3KJO A;  4A3G H;  1IL2 A;  4HIK A;  4BA2 I;  1VQ5 A;  2K5H A;  4UP8 A;  2YYZ A;  1K83 H;  1LM0 A;  4GN5 A;  3UDX A;  4JI7 Q;  5IYD G;  3CCL A;  2R6G A;  3M7N A;  4GKJ Q;  3S15 H;  1YBY A;  1VQG A;  2BH8 A;  3SGI A;  2VW9 A;  3CCS A;  3T1H Q;  5ELN A;  4YWL A;  4X66 Q;  2VQF L;  2K5N A;  1VQC A;  2B63 G;  2D0P A;  2I5H A;  3M4O H;  1JMC A;  1LUZ A;  4X62 Q;  1VQ7 A;  3W1G A;  1A0I A;  1FJG Q;  2ZTE A;  2DGY A;  1KAW A;  5IYB H;  2WFW A;  4LFC Q;  4JYA Q;  5AJ3 Q;  3AFQ A;  1AE2 A;  2VY3 A;  5ELO A;  5IYB G;  3J7Z C;  4DR2 L;  4HJ5 A;  4GLA C;  4JI8 Q;  4GNX A;  3HOU G;  4LFB Q;  2JA8 H;  2ALY B;  1U5K A;  2F52 A;  3HKZ G;  4A3K G;  4B3T Q;  4A3L G;  4JI7 L;  4UY8 C;  5GQO A;  1PH7 A;  4YWM A;  2Z6K C;  1N33 Q;  1VQ4 A;  3PO2 G;  4X6A H;  1U0L A;  2JEB I;  4A4I A;  5BR8 Q;  2E5L Q;  3MXN B;  2K14 A;  3WWV A;  4A3L H;  3PSI A;  1VQM A;  2JA6 G;  3ULP A;  2F4V Q;  2R92 G;  4GKK Q;  1CKN B;  2HQL A;  4IFD J;  5GAH C;  5C0X I;  4YHH Q;  4YHH L;  1IZ6 A;  4GNX C;  1KC8 C;  5C0X J;  1ASY A;  1L2F A;  2AWO A;  1HZB A;  2K52 A;  4A3G G;  4DV4 Q;  4AQY L;  1R9T H;  4BY1 H;  2F3I A;  3HKS A;  4DV2 Q;  1YHA A;  2N49 A;  4HIM A;  4PZ7 A;  2UXB L;  1W3S A;  1VQH A;  4MNO A;  3PIO A;  1L1O B;  2OCE A;  4IPC A;  5C4J H;  3T1Y Q;  1N36 L;  1K73 C;  3FKI G;  2EIF A;  4BBS H;  5JJK A;  1XMO L;  4YWK A;  3E0E A;  1XMO Q;  3IRB A;  4LUV A;  3CCE A;  1TWG H;  4IPG A;  4LF4 L;  3FKI H;  4A3I H;  1I6H H;  1Y1W H;  4NB3 A;  1OXT A;  4IOC A;  4OX9 Q;  3HOZ H;  5JEA J;  3KFU A;  4GKJ L;  1P8L A;  1K9M C;  1WCM G;  5FJ8 G;  2NVY H;  4DV7 L;  5GRO A;  3KDF B;  4YCU A;  4YY3 Q;  4A3I G;  4A3F H;  3I4N G;  4P71 A;  4A3B G;  1JJG A;  1AE3 A;  4BXX G;  4QL5 A;  3S2D H;  3FP9 A;  1SFO H;  2K4K A;  4IO9 A;  4GLX A;  5C4X H;  4GLV B;  3GO5 A;  1NMF A;  4LF8 L;  5GAG C;  2WB1 G;  5IP9 G;  4BXX H;  3STB C;  4JI5 Q;  3TRE A;  1EUJ A;  2JK8 A;  4X66 L;  2VQF Q;  4GNX B;  5K36 G;  5IP9 H;  2NVQ H;  1MJC A;  3M3Y H;  3ICE A;  4DV0 L;  2I0Q A;  4A3M H;  3A5U A;  3PF4 A;  4A3E H;  2CQO A;  1OTC A;  2R92 H;  2NZO A;  1X3F A;  4RG1 A;  1SR3 A;  3L7Z C;  3U58 A;  1YJ9 A;  1HJP A;  3CF5 A;  1X56 A;  2JA5 G;  1JE5 A;  3GTP H;  1X55 A;  3K8A A;  3K0X A;  4LNQ A;  2CWA A;  1VQK A;  4JBK A;  3AEV A;  3L2P A;  3CME A;  2VZA A;  1MIU A;  1TXY A;  4DR3 L;  1HNZ Q;  4DR1 Q;  1KQS A;  4GN4 B;  1Q46 A;  3U50 C;  4LF9 L;  2QGQ A;  1CKM A;  4JOI C;  4C3I H;  4NPS A;  1XJV A;  1WI5 A;  5C44 G;  3ZJY C;  2XGT A;  2B29 A;  3I4M H;  2ES2 A;  2A1A A;  2UU9 L;  5M5Y H;  2PI2 E;  4R4Q A;  4JI4 L;  4A3J H;  1UWV A;  1VS0 A;  3CCM A;  5IT9 c;  1Q12 A;  1X6O A;  3HOY H;  3FHW A;  4ME3 A;  4B3R Q;  1HNW L;  1PYB A;  4BY7 H;  5C3E H;  1Y14 B;  5LMU Q;  1SE8 A;  4APV A;  3RN5 A;  1C9O A;  2AWN A;  4QJF A;  1Q81 C;  3I4N H;  4C2M H;  4LWC A;  4HID A;  3KF6 A;  4A75 A;  2WB1 E;  2UUA Q;  4KHZ A;  1I94 L;  2IX0 A;  3PUW A;  4PMW A;  5M3F H;  2UUA L;  4B3S Q;  3J80 c;  1I94 Q;  1QVC A;  1S3O A;  1PH6 A;  4UP7 A;  1NY4 A;  3CPW A;  1H95 A;  1Q86 C;  3RNU A;  1Q1E A;  2Q2T A;  4LF7 L;  3GDE A;  1YI2 A;  3GTL H;  2BA1 A;  4IPD A;  4JG2 A;  3JAM c;  2PI2 A;  1KIX A;  2VS1 A;  3VDY A;  3GD7 A;  1IBM L;  4YCW A;  1VQ8 A;  1EQQ A;  5IWA Q;  3UE0 A;  1NJI C;  1M1K C;  3NEN A;  1VQ6 A;  4IOA A;  2NN6 I;  4JI4 Q;  4L5Q A;  2EQS A;  2MO0 A;  1GKH A;  4JC0 A;  1HR0 W;  4DR4 L;  4DV3 L;  1VQA A;  3BZK A;  4DV6 Q;  2R7Z H;  1KL9 A;  3W5O A;  2KCM A;  1WCM H;  5FJ8 H;  1HNX L;  1XPR A;  4L5T A;  1L1O A;  1HNX Q;  5GAD C;  1EYG A;  2B3G A;  2IX1 A;  4A3B H;  2JA8 G;  2UUB Q;  3ERS X;  1EQR A;  3I4O A;  2MNA A;  2JA6 H;  2Y0S G;  4LF6 Q;  2UU9 Q;  3CCQ A;  1B7Y B;  2ZJP A;  2LXK A;  4HJ8 A;  4OWW B;  4LFC L;  4JI6 Q;  4JYA L;  1MKH A;  2JEA I;  1LYL A;  2UUC L;  3CC2 A;  1Q1B A;  4IPH A;  4J15 A;  3M4Q A;  4L5S A;  4WJ3 M;  3ER0 A;  2BA0 A;  4A3J G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...