5C4XH

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
146
structure length
135
Chain Sequence
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Transferase/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 17
structure length 135
sequence length 146
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5c4xH00
1SROA 4A3JH 1VQIA 3JAMc 3AQQA 2MO1A 2ZM6Q 1EIFA 2E5LL 3CC4A 3G48A 3T1HL 2C35B 2R92G 2B3GA 3CAMA 3M4PA 1XPRA 2R93G 4K0KL 3F1ZA 3BU2A 4LF9L 3SGIA 3S1MH 4JI6L 1K0RA 1YBYA 3F2DA 1AE2A 4DR2Q 4OX9Q 1NMFA 1VQEA 1T9HA 3TQYA 1MKHA 2HQLA 2CFMA 4JI3Q 2KENA 3RLFA 3ULPA 1XNQQ 3KJPA 3W5OA 4OXPA 4NXML 3PO2H 1N32L 4BY7G 1VQOA 2EQSA 4A3LH 4A3KG 3Q8DA 3JAMi 2PQAB 1JJCB 4B3ML 2UUAL 1IBKL 4B3RQ 4JI6Q 5ELNA 1H95A 1EOVA 1PFSA 1YIJA 5LMUL 1EUJA 2CCZA 3HKZG 4YCUA 5IP7H 1PH4A 1Z47A 3I4MH 4JI8Q 2YTVA 4JYAQ 1LUZA 3DM3A 3K7UC 3UDIA 5M3FH 1EQQA 2OTJA 4DV3L 1JJ2A 4DV5L 1OXVA 2E2JH 2Q2TA 1RL2A 3ULLA 3F8TA 3FHWA 2UU9Q 3RR5A 2UXCQ 2R6GA 2I0QA 1SR3A 4X65L 3J81c 4DR4Q 5JEAJ 1ASZA 3BJUA 5C4XG 3PF4A 4DR3Q 1XNRQ 2Q2UA 2Y0SG 5GAGC 4GN3B 2VQEQ 3KOJA 3MXNB 2NVYH 3TRZA 2KCTA 4DR3L 1XNRL 3K0XA 4YWLA 3GTPH 4KHPQ 2KHJA 1VQNA 3G4SA 3CCSA 2I5HA 4FDBA 2QGQA 1N9WA 3CCLA 2N8NA 3FKIH 3GTJH 3CCEA 5C0XJ 1VQMA 1V9PA 1LTLA 2K52A 4DUZQ 2NN6G 3HOUH 4A93G 2KCMA 4LUOA 4DV7L 4LWCA 2K75A 1IBLQ 3PO3H 2XTIA 4OWXB 2VW9A 2ZJRA 2JA5G 4DR1L 1N33Q 4B3MQ 3PIPA 4IPGA 3KJOA 4JI7Q 4JI0L 5M3MH 1TWCH 2MNAA 4IJHA 2RHSB 1SE8A 3K81C 3S1QH 1WJJA 2Q2HA 4X6AH 1IL2A 4GN5A 3RLNA 2HIVA 4AYBE 4YWMA 3HOYH 1SRUA 4YCWA 5AJ3L 3I4NG 3KDFB 1EFWA 4HJ9A 1A8VA 4JI0Q 3L2PA 3HOWH 5C44H 1PA6A 3PUZA 3H0GG 1B70B 4B3SL 1G51A 2JE6I 3PUXA 4DV2Q 4A75A 4IO9A 3F2CA 4YHHL 4TQUS 2CKZB 3KDFA 1L1OC 1Y14B 1MJCA 2IHEA 2WB1G 2JA8H 2Z0SA 4BBRH 1YHBA 1Z9FA 2BH8A 1HH2P 1XMOQ 4A3CH 1Y1WG 3KF6A 4A3CG 2UUBL 4JV5L 4IJLA 5IYDH 4BBRG 1U0LA 4JI2Q 4AQYQ 2VQEL 1CUKA 2F3IA 3G6EA 1X9NA 1PH8A 4BY1H 2IY5B 1PH2A 3AEVA 1QZGA 2IX1A 4A3EH 2GVBA 2HIXA 5FJ8H 1TWFH 1VQDA 4DV6L 2UU9L 2UXCL 4R4OA 2F52A 3KF6B 1J5EQ 1CKNA 2K50A 2JK8A 3CD6A 1CKMA 3H0GH 4IFDI 5JJIA 5C44G 3S16H 3BZCA 4C3HH 3M9BA 1KXLA 1PH1A 2AMCB 4GOPB 4R4CA 5IWAQ 1KIXA 4LF6L 1NJIC 1EQRA 1QVFA 2NZHA 3ULJA 3RN2A 4DV7Q 4LFBL 4J15A 4HJ5A 1Y1WH 4OWWB 2R7FA 1AH9A 2UUAQ 5IYBG 5FLMG 1B7YB 3S1RH 5GQOA 5M3MG 1D8LA 2ZJPA 4HIDA 4UP7A 5IYCH 3UDGA 1YNXA 4QJFA 1QVCA 1JB7A 2JA5H 4GKKQ 3OYYA 3CC7A 3J80i 3U4VA 3CP0A 2XGTA 1QVGA 4A3DG 4K0KQ 4JI3L 5IYBH 4GNXB 4PZ8A 1OXTA 1I6HH 1X3EA 2YV5A 2OQ0A 3UDFA 1VQ7A 3HOWG 4UPAA 3GTLH 3PSIA 3PV0A 5E7NA 3J7A5 1E1OA 3J7ZC 4A3GH 4LF9Q 5K36G 3CF5A 4A3GG 4EQ5A 4OO1I 1I50H 2ZTCA 3PUWA 1CSQA 4MZ9A 2AHOB 4PG3A 4YCVA 4DUYL 2Z6KA 4JI5L 1XPOA 1WOCA 4A3FH 4LUVA 1VQLA 4JI4Q 1NBWA 1U5KA 5ELOA 3AYHB 3UE0A 4A3DH 1IYJB 4YY3Q 1Q81C 3DLLA 2LXKA 4JOIA 2UUBQ 2AKWB 4JV5Q 3PO3G 1V1QA 1YEZA 5HGQA 2AWNA 4DR6L 3F2BA 1YITA 1NTGA 2KHIA 4B3SQ 1OTCA 3CC2A 1K83H 3CW2C 3H15A 4NPSA 1HZBA 5JEAG 1GO3E 1I94L 1KRSA 3FKIG 2FXQA 4JBJA 3PCOB 5LMUQ 2NVQH 1R9TH 3NENA 5BR8Q 1HZ9A 3EIVA 1HR0L 5C3EH 2N49A 1FJGL 4LF5L 3S1NH 2CWPA 4LFCL 2D0PA 3MEFA 1AE3A 4A3FG 4HIMA 4HJAA 1K8GA 3EBEA 5AJ3Q 1VQ6A 5C3EG 1PV4A 5C4XH 2JQOA 2EXDA 1JMCA 4NXMQ 4LF4L 1W3SA 1GM5A 4OONA 4BY1G 1Q86C 3D0FA 4DK6C 4DUZL 3I4NH 3OTOL 3S14H 4Y52H 1N36L 2GN5A 4O2DA 4PZ7A 4DK3C 4R4IA 2QEXA 1HNXL 5M3FG 2E5LQ 2VNUD 1HZAA 1KHIA 4TVAB 4RMFA 1HR0Q 3CXCA 1E7ZA 2H5XA 5BR8L 5IE8A 4L5QA 2NVXH 1TWGH 2R93H 2BH2A 4A76A 1IBMQ 2JA6G 4DV4L 4A3BH 1VQ5A 4UP9A 2ZJQA 1UWVA 1VS0A 2PI2A 4KHZA 2F4VL 1HNWL 4YY3L 1UEBA 2B29A 4LUZA 2E2IH 1KRTA 1C0AA 1BBUA 1W2BA 1CKOA 1PYSB 4DUYQ 5LMNQ 4DV1Q 1E3PA 4BY7H 3PUYA 3A5ZB 4HIKA 1TWAH 3JC66 1XMOL 1ASYA 2NN6I 1HR0W 2ALYB 1LYLA 4DNIA 1UE5A 3HOYG 1C7YA 3FP9A 1X54A 1I3QH 3CPWA 3HOZG 4WJ4A 2RCNA 3NBHB 4X66Q 3A74A 1UE7A 2N3SA 3CQZH 4X62L 4L5SA 1BVSA 1V43A 3ZJYC 1K73C 3STBD 3T1YL 4P75A 4GKJQ 3D31A 3AFQA 1VQ8A 2K5HA 2HHHQ 2JA7G 3S2HH 3S17H 3GO5A 3K8AA 4KLKA 5LMNW 4JI8L 4JYAL 2AWOA 1TWHH 1Q82C 3M4QA 1VQ9A 3GTGH 3UE1A 1X56A 4JBWA 4JBKA 2K5VA 1KQSA 2N78A 4JCVE 2RHQB 3AFPA 2VQFL 4A3MH 4NXNQ 5FLMH 3HOUG 4A93H 1YHAA 2JJQA 2OWOA 2RF4A 2K14A 5IY0A 4OO1G 3CPFA 4LNQA 2DGYA 4JI1Q 1VQPA 1PYBA 4P71A 4LFCQ 5M5XH 2YU9H 1FJGQ 1YHQA 2ID0A 4QQBX 4GN4B 4BBSG 5M5WH 5M5YH 4QY7A 3U58A 2HHHL 2UXBL 2ZTDA 1L1OA 3BZKA 1N32Q 4IPDA 3S15H 1EWIA 1OXUA 3CMEA 1OXXK 2OCEA 4A3IH 1XMQL 4DAYB 4A3KH 1XPUA 1X6OA 4X62Q 3WWVA 4LF8Q 4A3EG 3PO2G 1QZHA 1PH9A 1PH3A 4AYBG 1S40A 2JEBI 4C2MH 3M4OH 4JI5Q 2WB1E 4GNXC 4HIOA 5FLXc 1J6QA 4LFAL 5C0XI 3I4OA 2LSSA 1JE5A 2B63G 1K3RA 2VUMG 5J3BA 1CKNB 1PHJA 2PNHA 4Y7NH 2A19A 3VDYA 3GTMH 2JA8G 3NEMA 3L7ZC 2OTLA 2E2HH 1HNZL 3TS2A 5IYCG 1O7IA 2KBNA 2K4KA 1D7QA 1S72A 1IBML 5LMNL 4MTNA 1UE6A 3STBC 2YYZA 2Y0SE 2WFWA 1Q8KA 1VQAA 3U4ZA 4AH6A 4UY8C 5IP9G 3M7NA 4A3LG 3KFUA 2QA4A 4GOPC 2UXBQ 4R4QA 4JBMA 1OXSC 3RN5A 4GS3A 3LGJA 4H02A 5GAEC 4JOIC 1Q12A 4DV0L 2NVTH 3M3YH 3I2ZA 4X64L 3HFZB 3UDXA 2E8GA 1PH5A 3E9IA 1WCMG 2UUCL 4IFDJ 1NMGA 3M85A 4LF6Q 1L2FA 1VQFA 3OTOQ 1E22A 5FJ8G 2UUCQ 4DR2L 1GVPA 1TXYA 4OX9L 3S24A 1QUQA 1IBLL 2PQAA 1YZ6A 1L0WA 4GKJL 1KD1C 3ERSX 2DUDA 3A5UA 2WP8J 3CMAA 1YVCA 2R7DA 5IYDG 4APVA 2WAQE 4JC0A 4QIWE 3T1HQ 1A62A 2L15A 1VQBA 2VS1A 2ASBA 4GNXA 1C9OA 1N8RC 3J81j 4X64Q 3I55A 4WJ3M 4DR7Q 2BA1A 1K8AC 3HKZE 1FGUA 1WI5A 4DV0Q 4A4IA 2I5MX 2K5NA 2YTXA 3GTQH 2PI2E 3ICEA 3A0JA 1SMXA 2IHFA 4HJ8A 3I7FA 4DKAC 1UE1A 3PIOA 5C4JH 3W1BA 4LW1A 4GLVB 2ES2A 4LFAQ 4JG2A 3PGZA 3W1GA 2UXDQ 1KC8C 2HT1A 1MJEA 5DLQE 2D0OA 1EYGA 2WAQG 1HJPA 1VCIA 3K80C 1HNXQ 1X65A 1EIYB 3I4MG 5IP7G 1N36Q 2V1CC 3B6YA 4DV2L 1Q7YC 2MFIA 4DV3Q 4MNOA 4PMWA 1N34L 2EIFA 1IBKQ 1M90C 4PZ6A 4GKKL 2B63H 2R7ZG 4IOAA 3CCQA 1Y1VH 2VY3A 1FL0A 1I5FA 1SLJA 4JI1L 3CCRA 4B3TL 2MO0A 3PF5A 1KAWA 4BA1I 2A8VA 1Q1BA 2Q2IA 1NE3A 2I5LX 1M1KC 1FVIA 4B3TQ 2BA0A 4C3JH 2JA9A 2JEAI 1P16A 1Q46A 4IPHA 4POFA 5IWAL 5EAYA 3HOXG 1I94Q 1JT8A 1G291 2VL6A 1SFOH 3GD7A 4LF7L 4GLAC 4P73A 2ATWA 3HOVG 4OWTB 5C0XG 4LFBQ 1E1TA 1X55A 3HOXH 4BA2I 1J5EL 4L5RC 4DR6Q 4BXXG 1VQKA 2GVAA 4R1JA 3GDEA 2VQFQ 1YJNA 1CSPA 3EN2A 1PH6A 1IZ6A 3IRBA 2LXJA 1YI2A 4IPCA 5IP9H 4AQYL 4JI4L 1N34Q 2IT1A 1BBWA 3T1YQ 2OQKA 4A3JG 2UXDL 5GADC 1WFQA 4O0AA 4QGUA 2R7ZH 3RZOH 4DV6Q 3OW2A 4X66L 4GLXA 2ZM6L 1LM0A 1X3FA 4JI2L 1A63A 1WCMH 1VQGA 3H3VI 3GTOH 5GAHC 2F4VQ 2YTYA 3CCJA 4X65Q 4DR4L 1HNWQ 3HOVH 4KI0A 3TEHB 4YWKA 3TREA 1HZCA 5HY6A 4NB3A 3TS0A 3HOZH 4ME3A 4DV5Q 3S2DH 1PH7A 1GD7A 3H3VH 1Q1EA 2IX0A 3J80c 4B3RL 1GKHA 1B8AA 1VQHA 3HKSA 3RNUA 4LF8L 4POGA 5GROA 3CCMA 1XMQQ 4EX5A 5H1SE 4ALPA 4GOPA 4DR7L 3PUVA 3CCVA 1YJ9A 1YJWA 1Y1VG 3NELA 1XJVA 4DAMA 1S3OA 3KF8B 1K9MC 1NY4A 1XNQL 4BBSH 3CCUA 4LF7Q 4DR5L 4HJ7A 2JA6H 4A3BG 1A0IA 4NXNL 3KYHC 1WYDA 4LF5Q 1VQ4A 2ZTEA 4UP8A 4RG1A 4XTCS 4DR5Q 4DR1Q 1N33L 1IXRA 4QL5A 4LF4Q 4XIGS 2VUMH 5IT9c 2R92H 4DPGA 4P74A 4A3MG 3E0EA 1E24A 2Z6KC 3G71A 2MQHA 4JI7L 1RIPA 2CQOA 1L1OB 2VZAA 3E9HA 3KLWA 3ER0A 2JA7H 1JJGA 3GTKH 2NZOA 4L5TA 1PVOA 1G6PA 4AIMA 4BXXH 1QUQB 1VQCA 4A3IG 1BKBA 4P72A 1XTDA 4C3IH 1MIUA 5JJKA 1HNZQ 1X3GA 5JJLA 2PMZE 1VQJA 2CWAA 3J81i 3RLOA 3U50C 4IOCA 3RZDH 1KL9A 2D62A 4YHHQ 3K7AH 3L0OA 4DV4Q 2A1AA 4R4TA 1P8LA 1SN8A 4DV1L 4IFDG 4KHPL 3I56A 1DGSA
chains in the Genus database with same CATH superfamily
4CDEC 3S16B 1OO9B 2R92G 2E5LL 2L4NA 2B3GA 2O2LD 3GTKB 4K0KL 3F1ZA 4RGMA 3SGIA 3S1MH 1K0RA 1YBYA 5D14A 3K57A 3GP7A 1GUGA 3M7GA 1F2LA 2CFMA 1HXYD 4JI3Q 3KJPA 1QNKA 3G7LA 4IUVA 4A3LH 4A3KG 2E75C 2F0GA 4C56C 5DM73 3H94A 1U4MA 3L3OC 5EPJA 4FF2A 3MTSA 1H95A 1EOVA 1PFSA 1YIJA 2CCZA 1EUJA 2XVSA 4F87A 3S1MB 2YTVA 1WTQA 5ELEA 3DUZA 4K6DA 2Q2TA 4EVOA 2F3VA 3F8TA 3RR5A 2OXPA 5C4XG 3BJUA 1XYIA 3PF4A 1SNCA 4FNFA 4DR3Q 2Q2UA 2Y0SG 2H4OA 2L9HA 4GN3B 5GAGC 2IX3A 2EYHA 4OELB 1U4LA 4DR3L 5C0XH 4KHPQ 4R9WA 4BBSB 2I5HA 5C0XJ 2M2LA 1LTLA 2EYFA 2K52A 2EYOA 1DD2A 1NCVA 2KVMA 4IUPA 1KDAA 2JA5G 4B3MQ 2O5JC 4IPGA 3KJOA 5M3MH 1TWCH 3DHQA 4IJHA 2RHSB 1STBA 4Q0FA 1IL2A 4GN5A 3RLNA 2HIVA 1PXUA 1VF5C 1WTPA 3KDFB 3J80L 1A8VA 3HOVB 1Z6HA 3HOWH 5C44H 5I9PA 5L37A 1B70B 3FVQA 1PRTB 4J6HA 3DMUA 2CKZB 3U9OA 1MJCA 2QILA 3WOEA 2BH8A 3QO2A 1HH2P 3CHBD 5IT9L 5HGTA 4A3CH 2JA6B 1BCPD 2UUBL 3N6RA 4AQYQ 1LT5D 1SFOB 2NBFA 1RHPA 3L9AX 2HIXA 4ZQ3A 4HEDA 3R8BA 2UXCL 2F52A 4XQNA 1SBBB 2K50A 3CD6A 4L8JA 4O42A 3MFGA 1I4RA 5FLXE 4LF6L 2Z1CA 4RHSA 4PQXA 4C3IB 4J15A 4HJ5A 1VMCA 5IYBG 5FLMG 2LKVA 4IALA 3UDGA 2EY6A 2XIWA 3I91A 4GNXB 1OXTA 2GA4B 1I6HH 5C4XB 2CQAA 2D2CC 4UPAA 3CF5A 1J9OA 4OO1I 1I50H 1C48A 1CSQA 4PG3A 4YCVA 2M00A 4FXKC 2A6HD 2Z6KA 2A73B 1I6VC 4A3FH 1VQLA 4JI4Q 4A3DH 1U5KA 3UE0A 1IYJB 3ND9A 2UUBQ 2CVRA 2AKWB 3PO3G 1QB5D 1JOKA 2TMPA 2AWNA 5KYLA 4DR6L 1TR5A 3K58A 1ML0D 5LMUQ 1R9TH 5DAUA 1TS4A 1HZ9A 3EIVA 4UAIA 2E2JB 3PQIA 1GOZA 5C3EG 1RD9D 4LF4L 1A3UA 1G8ZD 3NWSA 4CJ1B 4DUZL 3OTOL 2GN5A 4DK3C 2A69D 1QNUA 1HZAA 4I7AA 4TVAB 1HQRD 4RMFA 2B2VC 3SDZA 3PO2B 1EU3A 5BR8L 4BY1B 3LNNA 3SK8A 2R93H 4A76A 2JA6G 3QB3A 1C8CA 2F4VL 2PI2A 3TMEA 4DF7A 2BE5C 2B29A 5CORA 1W2BA 1KLUD 4DV1Q 4BY7H 1TWAH 1ASYA 5D3DA 2NN6I 2VB2X 1B9NA 3KLSX 1HA5A 1UE5A 1I3QH 5M5YB 4H44C 1LO5D 2IW3A 4L5SA 1V43A 2E76C 4GKJQ 1VQ8A 3GO5A 3K8AA 3QG1A 3DEPA 1TWHH 2FMCA 2KCCA 2A68D 4JBKA 3T16A 1KQSA 4JCVE 1D1KA 3AFPA 3AMUA 2ZT9C 2OWOA 2JJQA 2PO4A 2RF4A 4OO1G 4KTAA 1DZ1A 4LNQA 2DGYA 1VQPA 3MAQA 1RCVD 5M5YH 3U58A 2LMCB 4NKLA 3SR1A 3TZUA 3DWAA 4ZUIA 5A35A 1SNOA 1XMQL 4A3KH 4ME5A 3WWVA 1O7LA 1QZHA 1PH9A 3GTOB 5IGFA 1D1IA 4OGQC 3M4OH 4U68A 1PTOB 5C3WA 5FLXc 1J6QA 4ABNA 4EQOA 3DM1A 3PO3B 1K0SA 2B63G 1SYEA 1UAPA 3QR8A 3TP5A 3VA7A 5J3BA 2A19A 5CV6A 3GTMH 4Q5VA 3NEMA 2OTLA 2A69C 2E2HH 3TP8A 1RODA 1HNZL 3TS2A 5IYCG 2K4KA 1I4PA 2BCOA 3GTQB 4MTNA 4RH6A 3STBC 2Y0SE 2EZVA 1VQAA 5COYA 2UXBQ 5T1IA 3KFUA 4GOPC 1M4VA 2ICEC 4YIJA 2V4DA 4JBMA 1OXSC 3MWYW 4HSVA 1Q12A 3M3YH 4CKBA 1WVLA 1DM0B 3HFZB 5IGCA 1MD2D 3E6ZX 3KBXA 1PH5A 1WCMG 4BY7B 3M85A 4LF6Q 5KGUA 5CV8A 5LHY1 5FJ8G 2QF7A 4XQQA 2PQAA 3C46A 3ERSX 4KKUA 2DUDA 4IUNA 2Z9HA 3T56B 3HEJA 1A62A 1STNA 5FO9B 4GNXA 2K7VA 3AB9A 3EQLC 2BA1A 3BVMA 3P20A 2Z6BA 1WI5A 4C3IG 2F0WA 1SMXA 4HJ8A 3I7FA 2F0NA 5CV7A 3VR3A 2F0JA 2K6AA 3W1GA 2UXDQ 1KC8C 5IT9E 3R93A 2D0OA 3HOWB 1DJRD 2NUCA 2DNCA 2V1CC 3CU7A 2WKDA 3B6YA 2KEDA 4KY5A 1N34L 2P5ZX 1M90C 1JWMD 1I5FA 1HRJA 3CCRA 2WACA 4RFBA 1NE3A 4N8X1 4RKLA 1LTTD 4RCNA 4P73A 1WTXA 1X55A 3HOXH 3ND8A 3HOZB 4L5RC 3U9SA 1VQKA 2VQFQ 1LTSD 1EY6A 4LMQD 1CSPA 1PH6A 4FF4A 5IP9H 1B50A 4MN3A 3T1YQ 3DWPA 5AFWA 1LTBD 3A56A 1LM0A 1HTPA 2I46A 2K28A 3H3VI 2F4VQ 2YTYA 3CCJA 2R92B 2K03A 4YWKA 3TREA 1HZCA 4DV5Q 4UHVA 1PH7A 3VYTA 2IX0A 4B3RL 5M3MB 3OMCA 5GROA 3T13A 2IJ0A 1Y1VG 2WB1B 3KF8B 1K9MC 1NY4A 1WTOA 3CCUA 4HMIA 4HJ7A 2QEJC 1NUCA 5EKIA 3UI2A 3KYHC 5JJZA 1A2TA 4K5VA 2ZTEA 4RG1A 1V8QA 3JAML 4XIGS 1X32A 2R92H 1EY5A 3LX0A 3S2DB 3QJYA 1STEA 2PCFB 3E0EA 1EY4A 3E9HA 1LTAD 2MUYA 1PVOA 2NZOA 5DNFA 5IGBA 1JORA 1BKBA 4P72A 3ERQA 2NZ1D 3SK4A 3IL8A 1UEAB 1PZID 1H9KA 3J81i 3RZDH 1KL9A 2K04A 2D62A 4DV1L 5K5PA 1DGSA 1GO3E 1A3VA 3NBIA 1VQIA 2HCIA 3JAMc 2XRSD 2H1EA 1EIFA 3CC4A 3T1HL 3CAMA 3M4PA 4O1NA 1Q90A 2R93G 3BU2A 2QDLA 1R4PB 4H7BA 4ZLTF 4DR2Q 1T9HA 2HQLA 3HG9A 2B39A 3LWUA 4OXPA 4NXML 1N32L 1VQOA 1K8OA 4CJ2C 2F0MA 2BE5D 4XDXA 1RF2D 4CKEA 3JAMi 4PMCA 4MHEA 1MBYA 2MGSA 1ILQA 4B3ML 2UUAL 4C1NI 1LTRD 1IBKL 5JVG3 3GQBA 4YCUA 1XTCD 5IP7H 4JI8Q 3DM3A 3EJIA 3K7UC 4QIWB 1EQQA 3H91A 2EYJA 5I9OA 2F0LA 5EPKA 4C3HG 4X65L 5KNCA 4RKBA 1CI3M 5LL6S 3K0XA 4YWLA 1I6HB 1VQNA 2EJFC 2LS01 1SEBD 2N8NA 4XQJA 3CCEA 3MXNA 1YNND 1VQMA 1V9PA 2L55A 3HOUH 4BWGB 2K1BA 2B8FA 2K75A 2WIIB 4LWCA 2KA7A 2XTIA 3A8JE 4OWXB 2VW9A 2XWJB 4V0BA 4K2LA 1L0XB 4JI0L 3WOFA 2KOLA 3P1HA 3K81C 4DA2A 3S1QH 1JOOA 1WJJA 4DAVA 2J4XA 1HQMC 4AYBE 1SRUA 4YCWA 1EQVA 4HJ9A 1J8IA 1Y69U 1RDPD 3PUZA 1KLGD 1TWAB 1VF7A 4A75A 4IO9A 4YHHL 4TQUS 2IWHA 1TVXA 2VUMB 3KDFA 3HZXA 1L1OC 2WB1G 1Y1VB 2RDGA 4WFN3 2L5TA 1YHBA 1F2ZA 1SNQA 4BBRH 5M5WB 2RCFA 4QMGA 4A3CG 1F2YA 4JV5L 3V96A 4HMJA 3J7AV 1YNJC 1CUKA 4BY1H 1PH2A 1QZGA 2IX1A 5FO7B 3E0JA 1GUWA 4R4OA 2B2TA 1J5EQ 2DN8A 3D4WA 5JPNC 5G3LF 3F2UA 5JJIA 5C44G 3BZCA 1HFGA 4C3HH 1KXLA 4RGOS 4R4CA 3T4AC 1NJIC 3C1EA 3E5SA 1Y1WH 4A3BB 3OWEB 1F9SA 1AH9A 2UUAQ 5KIXA 3VYSA 2ZJPA 2SEBD 1YNNC 4HIDA 2JA5H 1YNXA 1JB7A 4GKKQ 1O7YA 1PTOH 3OYYA 3CC7A 2K5DA 4CHTB 1H9SA 3IFTA 3U4VA 3CP0A 2RSNA 4K0KQ 4JI3L 2CH4A 2WV6D 4PZ8A 3UDFA 2YV5A 4K6LA 1VQ7A 4JPBW 3HOWG 3GTLH 3M4YA 3PV0A 3KF8A 1BR9A 4LF9Q 2Q8IB 4A3GG 1AEXA 3HP3A 2F0HA 1BQQT 2C5CA 4JI5L 3AYHB 1GHJA 1PYWD 1TY0A 2WAQB 4JV5Q 4JOIA 1FNVA 3I4MB 1YEZA 1QG7A 2LY7A 3F2BA 2KHIA 4B3SQ 3RUZA 3CC2A 1D5XC 2DJGC 4NPSA 1I94L 1F9QA 1KRSA 4DXGA 1CFMA 3DEOA 1B2TA 2QW7A 4LF5L 4LFCL 1AE3A 3EBEA 3S2HB 5C4XH 2JQOA 2EXDA 4NXMQ 5CR3A 4KKTA 4E6IA 1EU4A 4BY1G 4QUCA 3SVMA 1N36L 2QEXA 4PZ7A 2ICIA 2E2DC 2OEOA 4IUUA 1E7ZA 2F0IA 4A3DB 2B2WC 4L5QA 1O7ZA 3KLSA 4DV4L 1UWVA 2A6HC 4KN4C 1B44D 3W3AA 1F9RA 4PNYA 3FMCA 2RKSA 2E2IH 1KRTA 4FXDA 1C0AA 2K5QA 1E3PA 1TS5A 4HTHA 2F0VA 2Y0SB 4ZAIA 1LYLA 2YU9B 3FP9A 1X54A 3CPWA 4WJ4A 2N3SA 5FO8B 3CKIB 3K5MA 1BVSA 1CA5A 1JCKB 1K73C 3D4DA 3GTLB 3D31A 3CRKC 3AFQA 5BN5A 2HHHQ 4FYDA 2DNEA 4KLKA 3T51B 4R8IA 4JYAL 1Q82C 1VQ9A 2SDFA 1WCMB 4A3MH 3HOUG 4CBVA 3I90A 2K14A 2JA7B 3EVQA 3A7AB 5C6AA 3Q0AA 1PYBA 4LFCQ 1PMRA 4IZ8A 2YU9H 1YHQA 1EY9A 1GUOA 1N32Q 2EJMA 4A3IH 1OXUA 1XPUA 2F1MA 1SNPA 4X62Q 4DFAA 4LF8Q 1KTKA 1PH3A 4G4KA 4JI5Q 2WB1E 1I4HA 2B2UA 4LFAL 5JAVA 3I4OA 2LSSA 1B3AA 3HS0C 2O4XA 2ZXOA 1PHJA 2PNHA 2XNAC 3VDYA 2JSOA 1HPCA 1NNXA 3L7ZC 1RJTA 3TN2A 1RTOA 1T5EA 2A6EC 3HOYB 2WFWA 2QA4A 2MHVA 2A68C 4KK7A 4I7ZC 4GS3A 1JWUD 2AQ2B 3LGJA 3RN5A 5E4XA 1GXDC 4A3GB 2E8GA 4UDUC 1ZYRC 3IKJA 4L6TB 4DR2L 1GVPA 1JOQA 5DM63 1L0WA 3BYTB 2PPBC 4GKJL 4HR7B 1PZKD 1XX8A 1TKWB 1QILA 1YVCA 2R7DA 5IYDG 1ZXTA 2EOTA 5CV4A 1MHWC 1HUMA 4B9XA 1C9OA 1N8RC 2PW5A 4ODGA 4X64Q 4X3KA 3J81j 3I55A 4DR7Q 4WJ3M 1K83B 3HKZE 1S5BD 4XXEA 2ENBA 1FGUA 1E0BA 4DV0Q 5KYIA 3GTQH 2PI2E 1DXMA 5C4JH 3W1BA 4GLVB 2FINB 4LFAQ 1BF4A 1LABA 3PGZA 4DK1A 2JA5B 4ZCKA 3H3VC 3K80C 1EIYB 1Y8NB 1CK1A 3C1FA 5T1GA 2R7ZB 4DU9A 5M9OA 4PMWA 4PZ6A 3J7AF 2D9UA 1FGBD 2IPKD 1Y1VH 1FL0A 5BN3A 4B3TL 5EKKA 2A8VA 3D8GA 5FOBB 2Q2IA 1M1KC 4B3TQ 5I4DA 2F4IA 1P16A 1Q46A 4IPHA 1JT8A 4HSPA 5IGGA 2FJ2A 3T53B 4BA2I 2NB0A 4M8AA 1KABA 5J22A 3IRBA 2LXJA 1YI2A 1UUPA 4QGUA 1LTID 3K5NA 4DV6Q 5CMDA 1QE6A 4X66L 4GLXA 3A8KE 2ZM6L 1PFBA 1X3FA 1VQGA 1IL8A 2AUJD 4X65Q 3HOVH 3TEHB 5HY6A 4NB3A 3HRZC 3MEHA 2XSCA 2X6LA 3J80c 4OL7A 2PNRC 1GKHA 5IGEA 5I6WA 2HDMA 2NTSA 3PUVA 1XJVA 4GZYC 2BDOA 5HURA 1XNQL 5ISRA 4BBSH 4LF7Q 2JA6H 2Z8LA 4LF5Q 1N33L 1EL0A 5IT9c 1IKMA 1CA6A 3C3LA 4A3MG 3D6CA 1E24A 2EY5A 1X3PA 2B2UC 4FF1A 1L1OB 2PYKA 3MFYA 1S5CD 2TSSA 1G6PA 4A3IG 1XTDA 4C3IH 1MIUA 1EEFD 2CH4W 5KRUA 4KHVA 1VDZA 3U50C 4IOCA 1SE2A 4OIJA 1BO0A 4YHHQ 4DV4Q 1STGA 3A54A 4R4TA 1SN8A 4IFDG 1BXTA 3I56A 3IFDA 1SROA 3CRLC 1BNZA 4KJNA 2C35B 1ICWA 1Y8PB 1HCZA 1T5XD 5IGDA 1H9MA 1EYDA 5CC4A 4JI6L 2RDHA 5C5MA 1NMFA 4RWSC 1VQEA 2Z4HA 1TS2A 1MKHA 3QOJA 2KENA 3RLFA 1XNQQ 4ZYSA 3WDNA 1NR2A 2EQSA 2HQEA 4N9TA 2NVXB 3Q8DA 4KY6A 1SYCA 2PQAB 1JJCB 1ZEQX 5ELFA 5C4HA 5ELNA 1WD1A 4PV1C 5LMUL 1G91A 3FKIB 3GTJB 3Q24A 1PH4A 1Z47A 1JQYD 1G2SA 5M3FH 3UDIA 1Y8OB 1CQFA 2OTJA 3TSSA 4DK0A 2AQ3B 4DV3L 1JJ2A 4HCSA 1OXVA 3D4RA 3P7JA 2E2JH 1BCPC 2UU9Q 1ET9A 3HKZB 2R6GA 4V190 1SR3A 1XXGA 1AN8A 5JEAJ 1ASZA 4XT3B 2VQEQ 3MXNB 3NQTA 4OHJA 2CW0D 1SYBA 4A3IB 2MJ8A 2QGQA 2XRQD 1N9WA 3CCLA 3FKIH 3GTJH 4OO1H 4NMZA 3J81E 1NR4A 5EQ0A 2EYLA 2KCMA 2XN9C 5ELDA 4DV7L 1IBLQ 1N33Q 2RVLA 3PIPA 3KLRA 1PZJD 4YWMA 2G9DA 3J81L 1RTNA 5AJ3L 4FF3A 3FPPA 3KBGA 3HOYH 4KV6A 2K01A 4JI0Q 3L2PA 4A3EB 1SYFA 2NYZD 4OIKA 1G51A 3QIAA 2NVTB 2RDFA 3PUXA 1IKLA 4DV2Q 3NE5B 2B2YA 4K5XA 2IHEA 2JA8H 1HFNA 2PZTA 2Z0SA 3EROA 1XMOQ 1Y1WG 4QUFA 2AUKA 3OOCA 4BBRG 1U0LA 2VQEL 2F3IA 3G6EA 5I6YA 3AEVA 4A3MB 5I2YA 1W6KA 2GVBA 3SK6A 4DAPA 5FJ8H 1TWFH 1VQDA 4A3EH 3KF6B 4WORA 3N52A 4B9WA 1SJHD 1CKNA 4Z9CB 1CKMA 3H0GH 2PMZB 4A3JB 1EIHA 1E2WA 3VYUA 4XYQA 3M9BA 3I73A 1PH1A 2AMCB 1QVFA 1F2MA 2NZHA 4DV7Q 4LFBL 2E2HB 1B7YB 5GQOA 2K33A 2NVQB 5IYCH 4QJFA 5KNDA 4BS9A 1CTMA 3HGBA 3J80i 3TDQA 4A3DG 5IYBH 4RHRA 5I2XA 2CHBD 3H0GB 3A8IE 1BOSA 3PSIA 5E7NA 1E1OA 4G7HC 2QCPX 4MZ9A 2AHOB 1QWYA 1K3BC 1FNUA 1WOCA 1TS3A 4LUVA 5ELOA 2K32A 3EA6A 5ELCA 1V1QA 3VA5A 1IHZA 5HGQA 1YITA 1NTGA 2KHSA 1OTCA 3CW2C 3NQIA 2NVYB 5CBAE 3NWTA 4JBJA 1WTHA 4LK1C 3NENA 3NPPA 5BR8Q 4F88A 1ICFB 4KD3A 2PZWA 1HR0L 1HA6A 1F77A 1SE4A 2EYPA 2N49A 1FJGL 2CWPA 3H09A 5TSSA 2D0PA 3MEFA 4HIMA 1K8GA 5AJ3Q 1VQ6A 3OPOA 1JMCA 1GM5A 4OONA 2MPMA 3VYRA 4DK6C 1Q86C 3S14H 4R4IA 4N9PA 1HNXL 2VNUD 2E5LQ 4ULLA 1KHIA 2HUGA 2Q8RE 4MTKA 1KDCA 2H5XA 1EQTA 2F3WA 1SJED 1TWGH 1CQVA 3TP6A 1IBMQ 1Y1WB 4A3BH 1VQ5A 4UP9A 1D6EC 4YY3L 1UEBA 2F0FA 1H9RA 1SNMA 1H9SB 4NP5A 1QCBD 5LMNQ 4HIKA 1XMOL 1NSNS 1K8MA 3JAME 3HOYG 2HCCA 1C7YA 1BCPF 2RCNA 4X66Q 1UE7A 3CQZH 4TKOB 1TIID 4H0LC 3T1YL 3S2HH 2K5HA 2JA7G 5C4JB 5LMNW 3GTGH 3M4QA 3RD4A 4JBWA 2N78A 3V05A 2KECA 3D3RA 2RQXA 3FRPB 1Q3LA 5EBDA 4P71A 2F0QA 5EPLA 4QQBX 4BBRB 5M5WH 1XWEA 1ESRA 2HHHL 2UXBL 1L1OA 1EY8A 3S15H 3NTKA 1JC7A 1MSHA 2EY2A 1OXXK 1HUNA 1EIGA 1SAPA 4AYBG 2J7ZA 2JEBI 1Z7TA 4HIOA 2MP1A 4XYOA 2VUMG 1K3RA 3R2TA 2R61A 5J1ZA 1EWHA 3S14B 1O7IA 1A15A 2IL8A 1S72A 1QJOA 1MGSA 4AH6A 3K6OA 3URYA 4RAUC 4QF4A 4UY8C 5IP9G 4A3LG 1CHPD 1TWGB 2F0UA 5GAEC 1JICA 3I2ZA 4X3UA 4JK1C 2F03A 2KEEA 1IYVA 1Q8IA 2RA4A 3NP8A 4QB4A 3E9IA 4IFDJ 1NMGA 2ZXRA 1VQFA 3RZOB 1E22A 2JN4A 1TXYA 1QUQA 4TSSA 1IBLL 1FYCA 1YZ6A 4HAEA 3CMAA 2WP8J 1ENAA 3W2DA 2WINB 1CT1D 2WAQE 4JC0A 4QIWE 1R9TB 2L15A 4RGTA 1V1PA 1VQBA 2O5IC 5IODA 4A4IA 4ZKCB 5CV9A 3Q22A 1TQOA 3R2IA 4DKAC 3PIOA 4LW1A 3KUPA 5JOBA 2ES2A 1IW7D 2HT1A 5E1FA 4ZKBB 1MJEA 1B4OA 3QOLA 3C2PA 1SXTA 4G7OC 3BG3A 1X65A 3I4MG 5IP7G 1PFMA 5A2QL 2DY7A 2MFIA 2EIFA 3NK9A 1PFNA 1VMPA 2JA8B 2VY3A 1SLJA 4JI1L 2MO0A 4BA1I 1TT2A 2I5LX 1FVIA 1HHVA 2BA0A 3MXUA 4C3JH 1SDFA 3K5OA 1I94Q 3K7AB 5EAYA 1SFOH 1B3QA 4LF7L 4GLAC 3HOVG 4OWTB 5C0XG 3OIPA 4AYBB 4LFBQ 1E1TA 2RSOA 4FO2A 1J5EL 4DR6Q 1JWSD 4R1JA 2L12A 2EJGC 3BVGA 4CDFC 1GUSA 3BVZA 4AQYL 1N34Q 4A3JG 5GADC 1WFQA 2R7ZH 1X3QA 3RZOH 1PTOF 3S9WA 1I4QA 3HOUB 2L0CA 1PTOC 1H9JA 2A6ED 4L63B 4JI2L 2FFKB 1DOLA 1PLFA 1WCMH 5GAHC 4ZUJA 2N55A 4KI0A 3HOZH 5M3FB 3S2DH 1O78A 1U9RA 1VQHA 1DOMA 3RNUA 1I4GA 4X3SA 3CCMA 1XMQQ 4EX5A 4R8NA 3CCVA 1YJWA 1I50B 4U673 4DR5L 4DAYA 2EY1A 1WYDA 1VQ4A 2NTTA 2Z4IA 4XTCS 4DR5Q 4DR1Q 4QL5A 2M9VA 2VUMH 1ILPA 4DPGA 3FEWX 4P74A 1D5MC 3MHBA 3G71A 1PRTC 1V1OA 2MQHA 1RIPA 2VZAA 5C4ZA 4IUTA 3KLWA 2JA7H 1JJGA 2F0EA 4AIMA 1VQCA 3VR2A 4EQNA 3X3NA 5A2QE 1SSOA 2EYMA 1X3GA 2PMZE 4A93B 3S1NB 2B63B 3K7AH 2K05A 2KUMA 1EZ8A 4N8FA 4A3JH 2J0TD 2X69A 3AQQA 2MO1A 3ZYYX 2ZM6Q 3G48A 1XPRA 1AFPA 3VR4A 1O80A 4LF9L 5F2DA 3F2DA 1AE2A 2QKIC 3QWNA 4OX9Q 3TQYA 3ULPA 5CYUA 1B53A 3VR5A 1AW7A 3W5OA 2JXMB 2G9HD 3PO2H 4BY7G 3K59A 1LACA 1SYDA 1C4QA 3P75A 4B3RQ 4JI6Q 1DCZA 2SOBA 2N88A 1ENCA 1TWCB 4K2KA 2FMMA 3HKZG 4HN7A 1LT4D 4S3SA 3I4MH 4JYAQ 1EOTA 1LUZA 3R3OA 3S17B 1CZGA 2A5HA 4DV5L 1RL2A 4K14A 3ULLA 2E74C 3FHWA 2UXCQ 2I0QA 3J81c 4DR4Q 1XNRQ 3KOJA 3MC0B 2NVYH 1II3A 3TRZA 2KCTA 1XNRL 3PIP3 3GTPH 2KHJA 3G4SA 3CCSA 2VB3X 1U4PA 4FDBA 2OF1A 5FLXL 1GHKA 2PQEA 3K5LA 4DUZQ 2NN6G 3VR6A 4A93G 2F0SA 4LUOA 5CV5A 3PO3H 1PRTF 1KNEA 1EFID 5G3LD 2ZJRA 4DR1L 2KJXA 1BBXC 4JI7Q 1S4ZA 2MNAA 4CDCC 1SE8A 4X6AH 2Q2HA 1ONLA 1D5ZC 4K8JA 4H13C 3GV6A 2QDBA 3SE0A 3I4NG 5ELBA 1SYGA 1EFWA 4A3FB 3BDOA 5IOCA 4RCOA 1PA6A 3H0GG 3BYYB 1SMYC 1R4QB 1B1ZA 4B3SL 2JE6I 3F2CA 1EY0A 3IAYA 1E2VA 1Y14B 2PZUA 1YNJD 1Z9FA 4IQZA 5JEAH 1JE4A 4XT1B 4KMUC 3KF6A 2Q8TA 1EYAA 2L11A 5EBCA 4IJLA 5IYDH 3G6JB 4JI2Q 2IY5B 3I70A 1X9NA 1PH8A 4P2CB 2FHTA 4DV6L 3M4OB 4MIUA 2UU9L 2RBMA 1PRTD 5DEHA 2JK8A 4IFDI 1KAAA 4QCLA 3S16H 2F0DA 1KIXA 3OIQA 5IWAQ 4GOPB 5K36H 3LWEA 1EQRA 1L0YB 3ULJA 5C3XA 3RN2A 4F7XA 3FPUB 4OWWB 2R7FA 1WTRA 2B2YC 3S1RH 5M3MG 1ESFA 1D8LA 4CKCA 3H6MA 4UP7A 1QVCA 3M3YB 5IIFA 2ZXPA 1TU2B 1CHQD 2XGTA 1QVGA 1AP0A 2F0OA 4NW2A 5JPMC 1X3EA 2OQ0A 3J7A5 3J7ZC 4A3GH 2KCNA 5K36G 4EQ5A 1AZQA 3PUWA 2ZTCA 2B2TC 4DUYL 2WKCA 1XPOA 1KNAA 4CJ0B 1NBWA 1GUNA 4HCEA 4YY3Q 3RMHA 3E3XA 3DLLA 2LXKA 3V2TA 1Q81C 4EGVA 4DGZA 1K83H 3H15A 3MVVA 3J80E 3NUCA 1HZBA 5JEAG 2R93B 2K5WA 3FKIG 1F9PA 2FXQA 3PCOB 4WJWA 2NVQH 1D2BA 5C44B 1I3QB 1G2TA 3SXHA 1LT6D 5C3EH 2BDNA 4OEMB 1V1PB 1QOHA 3S1NH 4A3FG 2G5DA 5CGKA 4HJAA 1G6ZA 3D6WA 1PV4A 1W3SA 1ENFA 1TWHB 2I07B 2HDLA 2R3ZA 1E2ZA 3D0FA 3I4NH 1FD7D 4Y52H 4O2DA 1B9MA 5M3FG 4KD4A 1CZWA 1HR0Q 3CXCA 3BZDB 4K8IA 5IE8A 2NVXH 2BH2A 3A55A 4KY7A 4TRDA 2ZJQA 1VS0A 4KHZA 1HNWL 4LUZA 4IURA 2B8GA 1BBUA 4A3KB 1CKOA 1PYSB 4ZK9B 4DUYQ 3PUYA 3A5ZB 3HOXB 3JC66 1HR0W 2ALYB 4DNIA 5M5XB 3HOZG 5J39A 3NBHB 4K5WA 3A74A 2L1BA 4X62L 3ZJYC 3STBD 4P75A 1PDQA 1MSGA 3S17H 1STAA 2VXWA 4JI8L 2AWOA 1WTWA 3UE1A 1X56A 2K5VA 4NXNQ 2RHQB 2VQFL 4A93H 5FLMH 5EGTA 1EY7A 4RA8A 4PMBA 1YHAA 1A6XA 5KEEA 3OHXC 4IUQA 4JVZA 3GTMB 5IY0A 3CPFA 4JI1Q 5M5XH 1FJGQ 2A74C 2ID0A 4KJOA 2B2WA 4GN4B 4BBSG 5JVH3 4LAAA 4QY7A 2DJFC 2ZTDA 3BZKA 2JP1A 4IPDA 2SNSA 2AQ1B 4JW0A 5E4WC 1EWIA 4DNTB 3CMEA 3RZDB 2OCEA 4DAYB 1X6OA 4C3JG 3I8ZA 1IYUA 4LJZC 4A3EG 3PO2G 1BUVT 4WRDA 3DXJC 1S40A 5C3EB 4C2MH 1TWFB 4GNXC 4ZRZA 5C0XI 1JE5A 3O13A 4DN4M 1CKNB 4Y7NH 2EXZA 5KNBA 2JA8G 5FKAC 1U4RA 3I4NB 3GTGB 2KBNA 1D7QA 1IBML 1LT3D 5LMNL 1GJXA 1DYQA 1UE6A 3U4ZA 2YYZA 1Q8KA 3M7NA 3KK7A 3NSWA 1SE3A 4R4QA 3OMGA 1BDOA 4H02A 4FP5D 4JOIC 4DV0L 4J8QA 2NVTH 1ZYRD 4J1MA 4C2MB 4X64L 1JR0D 1TY2A 2F0KA 3UDXA 2UUCL 1L2FA 4ILWA 3OTOQ 4NDXA 3GTPB 2UUCQ 3SEBA 4OX9L 3OWFA 3S24A 1LV9A 4FXGC 3TZDA 3MA2B 3NXWA 3SHLA 1KD1C 5EKLA 3A5UA 3I4LA 3J7YW 2C9OA 3NBHA 3SK5A 1LLRD 3NTIA 3ONAB 4APVA 4DXFA 3T1HQ 2VS1A 1MI2A 2ASBA 5E3FA 2DY8A 1GUTA 1K8AC 2HD3A 4I65A 1S5FD 2I5MX 2K5NA 2YTXA 1EYCA 1STYA 3ICEA 3A0JA 2IHFA 2JYOA 1UE1A 3DWQA 3NTHA 3EFXD 3S1QB 1BCPB 3S15B 2EDGA 4JG2A 3MXPA 3BDCA 1A3TA 1ZKOA 2KQ3A 5C5LA 5DLQE 3BDLA 1EYGA 4C1NK 2WAQG 1HJPA 1VCIA 3OW7A 1M8AA 2F0PA 3ITPA 4FVMA 1HNXQ 1N36Q 3MZ5A 4ID6A 4DV2L 1Q7YC 2OT2A 1WTVA 4DV3Q 2E2IB 1CM9A 4MNOA 1IBKQ 4GKKL 2B63H 2R7ZG 1EWCA 4IOAA 3TBIB 3X3MA 3PMFA 3I72A 1NAPA 3PIO3 3CCQA 1SMYD 2NN6H 2LFNA 1W6JA 3NHHA 4IFDH 2X6GA 1KAWA 4Y7NB 3PF5A 1Q1BA 4G57A 1ET6A 2JEAI 4M1UB 2JA9A 4POFA 1A2UA 2EPBA 5IWAL 1STHA 3HOXG 1G291 2VL6A 3I3CA 3GD7A 2ATWA 3Q23A 5NUCA 3K0YA 4BXXG 1SNDA 2GVAA 3GDEA 1S5DD 1YJNA 1DONA 3EN2A 1IZ6A 5D3IB 4IPCA 5D65A 4JI4L 3FDTA 2IT1A 1BBWA 2B2VA 3GV3A 2OQKA 3OSOA 2UXDL 4O0AA 1FR3A 3Q6SA 3OW2A 1EZ6A 3MXGA 4IN3A 3S1RB 1A63A 4X3TA 3GTOH 1HNWQ 5FK9C 1WD0A 4DR4L 4C3HB 3TS0A 1I4XA 1KDBA 3TP7A 4ME3A 4B08A 1GD7A 3H3VH 1Q1EA 2BOSA 1EEID 4G7ZC 4DNRB 1B8AA 3HKSA 4LF8L 1DOKA 4C3JB 5CBEE 4POGA 5H1SE 4CDDC 1K28A 4ALPA 4GOPA 4DR7L 1YJ9A 3NELA 1HTLD 4DAMA 1S3OA 2NWGA 4A3BG 1AZPA 4CGYB 1A0IA 4NXNL 2EVBA 1JB3A 4UP8A 1IXRA 4F8MA 5BN4A 4LF4Q 1UNSA 2PW7A 2Z6KC 5EJWA 2SNMA 4JI7L 2CQOA 3BS1A 1FNWA 3CQZB 3ER0A 3GTKH 4L5TA 4KN7C 3A7LA 1LTGD 4BXXH 1QUQB 2F0TA 1RKNA 1S5ED 5LL6X 3AU7A 4EQPA 4RGNA 5JJKA 1HNZQ 1PTOD 1IW7C 5JJLA 1VQJA 2CWAA 3RLOA 2CW0C 2D5DA 4KKSA 2XWBB 3L0OA 2A1AA 1P8LA 4KHPL 2EE1A
chains in the Genus database with same CATH topology
1SROA 4A3JH 1VQIA 3JAMc 3AQQA 2MO1A 2ZM6Q 1EIFA 2E5LL 3CC4A 3G48A 3T1HL 2C35B 2R92G 2B3GA 3CAMA 3M4PA 1XPRA 2R93G 4K0KL 3F1ZA 3BU2A 4LF9L 3SGIA 3S1MH 4JI6L 1K0RA 1YBYA 3F2DA 1AE2A 4DR2Q 4OX9Q 1NMFA 1VQEA 1T9HA 3TQYA 1MKHA 2HQLA 2CFMA 4JI3Q 2KENA 3RLFA 3ULPA 1XNQQ 3KJPA 3W5OA 4OXPA 4NXML 3PO2H 1N32L 4BY7G 1VQOA 2EQSA 4A3LH 4A3KG 3Q8DA 3JAMi 2PQAB 1JJCB 4B3ML 2UUAL 1IBKL 4B3RQ 4JI6Q 5ELNA 1H95A 1EOVA 1PFSA 1YIJA 5LMUL 1EUJA 2CCZA 3HKZG 4YCUA 5IP7H 1PH4A 1Z47A 3I4MH 4JI8Q 2YTVA 4JYAQ 1LUZA 3DM3A 3K7UC 3UDIA 5M3FH 1EQQA 2OTJA 4DV3L 1JJ2A 4DV5L 1OXVA 2E2JH 2Q2TA 1RL2A 3ULLA 3F8TA 3FHWA 2UU9Q 3RR5A 2UXCQ 2R6GA 2I0QA 1SR3A 4X65L 3J81c 4DR4Q 5JEAJ 1ASZA 3BJUA 5C4XG 3PF4A 4DR3Q 1XNRQ 2Q2UA 2Y0SG 5GAGC 4GN3B 2VQEQ 3KOJA 3MXNB 2NVYH 3TRZA 2KCTA 4DR3L 1XNRL 3K0XA 4YWLA 3GTPH 4KHPQ 2KHJA 1VQNA 3G4SA 3CCSA 2I5HA 4FDBA 2QGQA 1N9WA 3CCLA 2N8NA 3FKIH 3GTJH 3CCEA 5C0XJ 1VQMA 1V9PA 1LTLA 2K52A 4DUZQ 2NN6G 3HOUH 4A93G 2KCMA 4LUOA 4DV7L 4LWCA 2K75A 1IBLQ 3PO3H 2XTIA 4OWXB 2VW9A 2ZJRA 2JA5G 4DR1L 1N33Q 4B3MQ 3PIPA 4IPGA 3KJOA 4JI7Q 4JI0L 5M3MH 1TWCH 2MNAA 4IJHA 2RHSB 1SE8A 3K81C 3S1QH 1WJJA 2Q2HA 4X6AH 1IL2A 4GN5A 3RLNA 2HIVA 4AYBE 4YWMA 3HOYH 1SRUA 4YCWA 5AJ3L 3I4NG 3KDFB 1EFWA 4HJ9A 1A8VA 4JI0Q 3L2PA 3HOWH 5C44H 1PA6A 3PUZA 3H0GG 1B70B 4B3SL 1G51A 2JE6I 3PUXA 4DV2Q 4A75A 4IO9A 3F2CA 4YHHL 4TQUS 2CKZB 3KDFA 1L1OC 1Y14B 1MJCA 2IHEA 2WB1G 2JA8H 2Z0SA 4BBRH 1YHBA 1Z9FA 2BH8A 1HH2P 1XMOQ 4A3CH 1Y1WG 3KF6A 4A3CG 2UUBL 4JV5L 4IJLA 5IYDH 4BBRG 1U0LA 4JI2Q 4AQYQ 2VQEL 1CUKA 2F3IA 3G6EA 1X9NA 1PH8A 4BY1H 2IY5B 1PH2A 3AEVA 1QZGA 2IX1A 4A3EH 2GVBA 2HIXA 5FJ8H 1TWFH 1VQDA 4DV6L 2UU9L 2UXCL 4R4OA 2F52A 3KF6B 1J5EQ 1CKNA 2K50A 2JK8A 3CD6A 1CKMA 3H0GH 4IFDI 5JJIA 5C44G 3S16H 3BZCA 4C3HH 3M9BA 1KXLA 1PH1A 2AMCB 4GOPB 4R4CA 5IWAQ 1KIXA 4LF6L 1NJIC 1EQRA 1QVFA 2NZHA 3ULJA 3RN2A 4DV7Q 4LFBL 4J15A 4HJ5A 1Y1WH 4OWWB 2R7FA 1AH9A 2UUAQ 5IYBG 5FLMG 1B7YB 3S1RH 5GQOA 5M3MG 1D8LA 2ZJPA 4HIDA 4UP7A 5IYCH 3UDGA 1YNXA 4QJFA 1QVCA 1JB7A 2JA5H 4GKKQ 3OYYA 3CC7A 3J80i 3U4VA 3CP0A 2XGTA 1QVGA 4A3DG 4K0KQ 4JI3L 5IYBH 4GNXB 4PZ8A 1OXTA 1I6HH 1X3EA 2YV5A 2OQ0A 3UDFA 1VQ7A 3HOWG 4UPAA 3GTLH 3PSIA 3PV0A 5E7NA 3J7A5 1E1OA 3J7ZC 4A3GH 4LF9Q 5K36G 3CF5A 4A3GG 4EQ5A 4OO1I 1I50H 2ZTCA 3PUWA 1CSQA 4MZ9A 2AHOB 4PG3A 4YCVA 4DUYL 2Z6KA 4JI5L 1XPOA 1WOCA 4A3FH 4LUVA 1VQLA 4JI4Q 1NBWA 1U5KA 5ELOA 3AYHB 3UE0A 4A3DH 1IYJB 4YY3Q 1Q81C 3DLLA 2LXKA 4JOIA 2UUBQ 2AKWB 4JV5Q 3PO3G 1V1QA 1YEZA 5HGQA 2AWNA 4DR6L 3F2BA 1YITA 1NTGA 2KHIA 4B3SQ 1OTCA 3CC2A 1K83H 3CW2C 3H15A 4NPSA 1HZBA 5JEAG 1GO3E 1I94L 1KRSA 3FKIG 2FXQA 4JBJA 3PCOB 5LMUQ 2NVQH 1R9TH 3NENA 5BR8Q 1HZ9A 3EIVA 1HR0L 5C3EH 2N49A 1FJGL 4LF5L 3S1NH 2CWPA 4LFCL 2D0PA 3MEFA 1AE3A 4A3FG 4HIMA 4HJAA 1K8GA 3EBEA 5AJ3Q 1VQ6A 5C3EG 1PV4A 5C4XH 2JQOA 2EXDA 1JMCA 4NXMQ 4LF4L 1W3SA 1GM5A 4OONA 4BY1G 1Q86C 3D0FA 4DK6C 4DUZL 3I4NH 3OTOL 3S14H 4Y52H 1N36L 2GN5A 4O2DA 4PZ7A 4DK3C 4R4IA 2QEXA 1HNXL 5M3FG 2E5LQ 2VNUD 1HZAA 1KHIA 4TVAB 4RMFA 1HR0Q 3CXCA 1E7ZA 2H5XA 5BR8L 5IE8A 4L5QA 2NVXH 1TWGH 2R93H 2BH2A 4A76A 1IBMQ 2JA6G 4DV4L 4A3BH 1VQ5A 4UP9A 2ZJQA 1UWVA 1VS0A 2PI2A 4KHZA 2F4VL 1HNWL 4YY3L 1UEBA 2B29A 4LUZA 2E2IH 1KRTA 1C0AA 1BBUA 1W2BA 1CKOA 1PYSB 4DUYQ 5LMNQ 4DV1Q 1E3PA 4BY7H 3PUYA 3A5ZB 4HIKA 1TWAH 3JC66 1XMOL 1ASYA 2NN6I 1HR0W 2ALYB 1LYLA 4DNIA 1UE5A 3HOYG 1C7YA 3FP9A 1X54A 1I3QH 3CPWA 3HOZG 4WJ4A 2RCNA 3NBHB 4X66Q 3A74A 1UE7A 2N3SA 3CQZH 4X62L 4L5SA 1BVSA 1V43A 3ZJYC 1K73C 3STBD 3T1YL 4P75A 4GKJQ 3D31A 3AFQA 1VQ8A 2K5HA 2HHHQ 2JA7G 3S2HH 3S17H 3GO5A 3K8AA 4KLKA 5LMNW 4JI8L 4JYAL 2AWOA 1TWHH 1Q82C 3M4QA 1VQ9A 3GTGH 3UE1A 1X56A 4JBWA 4JBKA 2K5VA 1KQSA 2N78A 4JCVE 2RHQB 3AFPA 2VQFL 4A3MH 4NXNQ 5FLMH 3HOUG 4A93H 1YHAA 2JJQA 2OWOA 2RF4A 2K14A 5IY0A 4OO1G 3CPFA 4LNQA 2DGYA 4JI1Q 1VQPA 1PYBA 4P71A 4LFCQ 5M5XH 2YU9H 1FJGQ 1YHQA 2ID0A 4QQBX 4GN4B 4BBSG 5M5WH 5M5YH 4QY7A 3U58A 2HHHL 2UXBL 2ZTDA 1L1OA 3BZKA 1N32Q 4IPDA 3S15H 1EWIA 1OXUA 3CMEA 1OXXK 2OCEA 4A3IH 1XMQL 4DAYB 4A3KH 1XPUA 1X6OA 4X62Q 3WWVA 4LF8Q 4A3EG 3PO2G 1QZHA 1PH9A 1PH3A 4AYBG 1S40A 2JEBI 4C2MH 3M4OH 4JI5Q 2WB1E 4GNXC 4HIOA 5FLXc 1J6QA 4LFAL 5C0XI 3I4OA 2LSSA 1JE5A 2B63G 1K3RA 2VUMG 5J3BA 1CKNB 1PHJA 2PNHA 4Y7NH 2A19A 3VDYA 3GTMH 2JA8G 3NEMA 3L7ZC 2OTLA 2E2HH 1HNZL 3TS2A 5IYCG 1O7IA 2KBNA 2K4KA 1D7QA 1S72A 1IBML 5LMNL 4MTNA 1UE6A 3STBC 2YYZA 2Y0SE 2WFWA 1Q8KA 1VQAA 3U4ZA 4AH6A 4UY8C 5IP9G 3M7NA 4A3LG 3KFUA 2QA4A 4GOPC 2UXBQ 4R4QA 4JBMA 1OXSC 3RN5A 4GS3A 3LGJA 4H02A 5GAEC 4JOIC 1Q12A 4DV0L 2NVTH 3M3YH 3I2ZA 4X64L 3HFZB 3UDXA 2E8GA 1PH5A 3E9IA 1WCMG 2UUCL 4IFDJ 1NMGA 3M85A 4LF6Q 1L2FA 1VQFA 3OTOQ 1E22A 5FJ8G 2UUCQ 4DR2L 1GVPA 1TXYA 4OX9L 3S24A 1QUQA 1IBLL 2PQAA 1YZ6A 1L0WA 4GKJL 1KD1C 3ERSX 2DUDA 3A5UA 2WP8J 3CMAA 1YVCA 2R7DA 5IYDG 4APVA 2WAQE 4JC0A 4QIWE 3T1HQ 1A62A 2L15A 1VQBA 2VS1A 2ASBA 4GNXA 1C9OA 1N8RC 3J81j 4X64Q 3I55A 4WJ3M 4DR7Q 2BA1A 1K8AC 3HKZE 1FGUA 1WI5A 4DV0Q 4A4IA 2I5MX 2K5NA 2YTXA 3GTQH 2PI2E 3ICEA 3A0JA 1SMXA 2IHFA 4HJ8A 3I7FA 4DKAC 1UE1A 3PIOA 5C4JH 3W1BA 4LW1A 4GLVB 2ES2A 4LFAQ 4JG2A 3PGZA 3W1GA 2UXDQ 1KC8C 2HT1A 1MJEA 5DLQE 2D0OA 1EYGA 2WAQG 1HJPA 1VCIA 3K80C 1HNXQ 1X65A 1EIYB 3I4MG 5IP7G 1N36Q 2V1CC 3B6YA 4DV2L 1Q7YC 2MFIA 4DV3Q 4MNOA 4PMWA 1N34L 2EIFA 1IBKQ 1M90C 4PZ6A 4GKKL 2B63H 2R7ZG 4IOAA 3CCQA 1Y1VH 2VY3A 1FL0A 1I5FA 1SLJA 4JI1L 3CCRA 4B3TL 2MO0A 3PF5A 1KAWA 4BA1I 2A8VA 1Q1BA 2Q2IA 1NE3A 2I5LX 1M1KC 1FVIA 4B3TQ 2BA0A 4C3JH 2JA9A 2JEAI 1P16A 1Q46A 4IPHA 4POFA 5IWAL 5EAYA 3HOXG 1I94Q 1JT8A 1G291 2VL6A 1SFOH 3GD7A 4LF7L 4GLAC 4P73A 2ATWA 3HOVG 4OWTB 5C0XG 4LFBQ 1E1TA 1X55A 3HOXH 4BA2I 1J5EL 4L5RC 4DR6Q 4BXXG 1VQKA 2GVAA 4R1JA 3GDEA 2VQFQ 1YJNA 1CSPA 3EN2A 1PH6A 1IZ6A 3IRBA 2LXJA 1YI2A 4IPCA 5IP9H 4AQYL 4JI4L 1N34Q 2IT1A 1BBWA 3T1YQ 2OQKA 4A3JG 2UXDL 5GADC 1WFQA 4O0AA 4QGUA 2R7ZH 3RZOH 4DV6Q 3OW2A 4X66L 4GLXA 2ZM6L 1LM0A 1X3FA 4JI2L 1A63A 1WCMH 1VQGA 3H3VI 3GTOH 5GAHC 2F4VQ 2YTYA 3CCJA 4X65Q 4DR4L 1HNWQ 3HOVH 4KI0A 3TEHB 4YWKA 3TREA 1HZCA 5HY6A 4NB3A 3TS0A 3HOZH 4ME3A 4DV5Q 3S2DH 1PH7A 1GD7A 3H3VH 1Q1EA 2IX0A 3J80c 4B3RL 1GKHA 1B8AA 1VQHA 3HKSA 3RNUA 4LF8L 4POGA 5GROA 3CCMA 1XMQQ 4EX5A 5H1SE 4ALPA 4GOPA 4DR7L 3PUVA 3CCVA 1YJ9A 1YJWA 1Y1VG 3NELA 1XJVA 4DAMA 1S3OA 3KF8B 1K9MC 1NY4A 1XNQL 4BBSH 3CCUA 4LF7Q 4DR5L 4HJ7A 2JA6H 4A3BG 1A0IA 4NXNL 3KYHC 1WYDA 4LF5Q 1VQ4A 2ZTEA 4UP8A 4RG1A 4XTCS 4DR5Q 4DR1Q 1N33L 1IXRA 4QL5A 4LF4Q 4XIGS 2VUMH 5IT9c 2R92H 4DPGA 4P74A 4A3MG 3E0EA 1E24A 2Z6KC 3G71A 2MQHA 4JI7L 1RIPA 2CQOA 1L1OB 2VZAA 3E9HA 3KLWA 3ER0A 2JA7H 1JJGA 3GTKH 2NZOA 4L5TA 1PVOA 1G6PA 4AIMA 4BXXH 1QUQB 1VQCA 4A3IG 1BKBA 4P72A 1XTDA 4C3IH 1MIUA 5JJKA 1HNZQ 1X3GA 5JJLA 2PMZE 1VQJA 2CWAA 3J81i 3RLOA 3U50C 4IOCA 3RZDH 1KL9A 2D62A 4YHHQ 3K7AH 3L0OA 4DV4Q 2A1AA 4R4TA 1P8LA 1SN8A 4DV1L 4IFDG 4KHPL 3I56A 1DGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SRO A;  4A3J H;  1VQI A;  3JAM c;  3AQQ A;  2MO1 A;  2ZM6 Q;  1EIF A;  2E5L L;  3CC4 A;  3G48 A;  3T1H L;  2C35 B;  2R92 G;  2B3G A;  3CAM A;  3M4P A;  1XPR A;  2R93 G;  4K0K L;  3F1Z A;  3BU2 A;  4LF9 L;  3SGI A;  3S1M H;  4JI6 L;  1K0R A;  1YBY A;  3F2D A;  1AE2 A;  4DR2 Q;  4OX9 Q;  1NMF A;  1VQE A;  1T9H A;  3TQY A;  1MKH A;  2HQL A;  2CFM A;  4JI3 Q;  2KEN A;  3RLF A;  3ULP A;  1XNQ Q;  3KJP A;  3W5O A;  4OXP A;  4NXM L;  3PO2 H;  1N32 L;  4BY7 G;  1VQO A;  2EQS A;  4A3L H;  4A3K G;  3Q8D A;  3JAM i;  2PQA B;  1JJC B;  4B3M L;  2UUA L;  1IBK L;  4B3R Q;  4JI6 Q;  5ELN A;  1H95 A;  1EOV A;  1PFS A;  1YIJ A;  5LMU L;  1EUJ A;  2CCZ A;  3HKZ G;  4YCU A;  5IP7 H;  1PH4 A;  1Z47 A;  3I4M H;  4JI8 Q;  2YTV A;  4JYA Q;  1LUZ A;  3DM3 A;  3K7U C;  3UDI A;  5M3F H;  1EQQ A;  2OTJ A;  4DV3 L;  1JJ2 A;  4DV5 L;  1OXV A;  2E2J H;  2Q2T A;  1RL2 A;  3ULL A;  3F8T A;  3FHW A;  2UU9 Q;  3RR5 A;  2UXC Q;  2R6G A;  2I0Q A;  1SR3 A;  4X65 L;  3J81 c;  4DR4 Q;  5JEA J;  1ASZ A;  3BJU A;  5C4X G;  3PF4 A;  4DR3 Q;  1XNR Q;  2Q2U A;  2Y0S G;  5GAG C;  4GN3 B;  2VQE Q;  3KOJ A;  3MXN B;  2NVY H;  3TRZ A;  2KCT A;  4DR3 L;  1XNR L;  3K0X A;  4YWL A;  3GTP H;  4KHP Q;  2KHJ A;  1VQN A;  3G4S A;  3CCS A;  2I5H A;  4FDB A;  2QGQ A;  1N9W A;  3CCL A;  2N8N A;  3FKI H;  3GTJ H;  3CCE A;  5C0X J;  1VQM A;  1V9P A;  1LTL A;  2K52 A;  4DUZ Q;  2NN6 G;  3HOU H;  4A93 G;  2KCM A;  4LUO A;  4DV7 L;  4LWC A;  2K75 A;  1IBL Q;  3PO3 H;  2XTI A;  4OWX B;  2VW9 A;  2ZJR A;  2JA5 G;  4DR1 L;  1N33 Q;  4B3M Q;  3PIP A;  4IPG A;  3KJO A;  4JI7 Q;  4JI0 L;  5M3M H;  1TWC H;  2MNA A;  4IJH A;  2RHS B;  1SE8 A;  3K81 C;  3S1Q H;  1WJJ A;  2Q2H A;  4X6A H;  1IL2 A;  4GN5 A;  3RLN A;  2HIV A;  4AYB E;  4YWM A;  3HOY H;  1SRU A;  4YCW A;  5AJ3 L;  3I4N G;  3KDF B;  1EFW A;  4HJ9 A;  1A8V A;  4JI0 Q;  3L2P A;  3HOW H;  5C44 H;  1PA6 A;  3PUZ A;  3H0G G;  1B70 B;  4B3S L;  1G51 A;  2JE6 I;  3PUX A;  4DV2 Q;  4A75 A;  4IO9 A;  3F2C A;  4YHH L;  4TQU S;  2CKZ B;  3KDF A;  1L1O C;  1Y14 B;  1MJC A;  2IHE A;  2WB1 G;  2JA8 H;  2Z0S A;  4BBR H;  1YHB A;  1Z9F A;  2BH8 A;  1HH2 P;  1XMO Q;  4A3C H;  1Y1W G;  3KF6 A;  4A3C G;  2UUB L;  4JV5 L;  4IJL A;  5IYD H;  4BBR G;  1U0L A;  4JI2 Q;  4AQY Q;  2VQE L;  1CUK A;  2F3I A;  3G6E A;  1X9N A;  1PH8 A;  4BY1 H;  2IY5 B;  1PH2 A;  3AEV A;  1QZG A;  2IX1 A;  4A3E H;  2GVB A;  2HIX A;  5FJ8 H;  1TWF H;  1VQD A;  4DV6 L;  2UU9 L;  2UXC L;  4R4O A;  2F52 A;  3KF6 B;  1J5E Q;  1CKN A;  2K50 A;  2JK8 A;  3CD6 A;  1CKM A;  3H0G H;  4IFD I;  5JJI A;  5C44 G;  3S16 H;  3BZC A;  4C3H H;  3M9B A;  1KXL A;  1PH1 A;  2AMC B;  4GOP B;  4R4C A;  5IWA Q;  1KIX A;  4LF6 L;  1NJI C;  1EQR A;  1QVF A;  2NZH A;  3ULJ A;  3RN2 A;  4DV7 Q;  4LFB L;  4J15 A;  4HJ5 A;  1Y1W H;  4OWW B;  2R7F A;  1AH9 A;  2UUA Q;  5IYB G;  5FLM G;  1B7Y B;  3S1R H;  5GQO A;  5M3M G;  1D8L A;  2ZJP A;  4HID A;  4UP7 A;  5IYC H;  3UDG A;  1YNX A;  4QJF A;  1QVC A;  1JB7 A;  2JA5 H;  4GKK Q;  3OYY A;  3CC7 A;  3J80 i;  3U4V A;  3CP0 A;  2XGT A;  1QVG A;  4A3D G;  4K0K Q;  4JI3 L;  5IYB H;  4GNX B;  4PZ8 A;  1OXT A;  1I6H H;  1X3E A;  2YV5 A;  2OQ0 A;  3UDF A;  1VQ7 A;  3HOW G;  4UPA A;  3GTL H;  3PSI A;  3PV0 A;  5E7N A;  3J7A 5;  1E1O A;  3J7Z C;  4A3G H;  4LF9 Q;  5K36 G;  3CF5 A;  4A3G G;  4EQ5 A;  4OO1 I;  1I50 H;  2ZTC A;  3PUW A;  1CSQ A;  4MZ9 A;  2AHO B;  4PG3 A;  4YCV A;  4DUY L;  2Z6K A;  4JI5 L;  1XPO A;  1WOC A;  4A3F H;  4LUV A;  1VQL A;  4JI4 Q;  1NBW A;  1U5K A;  5ELO A;  3AYH B;  3UE0 A;  4A3D H;  1IYJ B;  4YY3 Q;  1Q81 C;  3DLL A;  2LXK A;  4JOI A;  2UUB Q;  2AKW B;  4JV5 Q;  3PO3 G;  1V1Q A;  1YEZ A;  5HGQ A;  2AWN A;  4DR6 L;  3F2B A;  1YIT A;  1NTG A;  2KHI A;  4B3S Q;  1OTC A;  3CC2 A;  1K83 H;  3CW2 C;  3H15 A;  4NPS A;  1HZB A;  5JEA G;  1GO3 E;  1I94 L;  1KRS A;  3FKI G;  2FXQ A;  4JBJ A;  3PCO B;  5LMU Q;  2NVQ H;  1R9T H;  3NEN A;  5BR8 Q;  1HZ9 A;  3EIV A;  1HR0 L;  5C3E H;  2N49 A;  1FJG L;  4LF5 L;  3S1N H;  2CWP A;  4LFC L;  2D0P A;  3MEF A;  1AE3 A;  4A3F G;  4HIM A;  4HJA A;  1K8G A;  3EBE A;  5AJ3 Q;  1VQ6 A;  5C3E G;  1PV4 A;  5C4X H;  2JQO A;  2EXD A;  1JMC A;  4NXM Q;  4LF4 L;  1W3S A;  1GM5 A;  4OON A;  4BY1 G;  1Q86 C;  3D0F A;  4DK6 C;  4DUZ L;  3I4N H;  3OTO L;  3S14 H;  4Y52 H;  1N36 L;  2GN5 A;  4O2D A;  4PZ7 A;  4DK3 C;  4R4I A;  2QEX A;  1HNX L;  5M3F G;  2E5L Q;  2VNU D;  1HZA A;  1KHI A;  4TVA B;  4RMF A;  1HR0 Q;  3CXC A;  1E7Z A;  2H5X A;  5BR8 L;  5IE8 A;  4L5Q A;  2NVX H;  1TWG H;  2R93 H;  2BH2 A;  4A76 A;  1IBM Q;  2JA6 G;  4DV4 L;  4A3B H;  1VQ5 A;  4UP9 A;  2ZJQ A;  1UWV A;  1VS0 A;  2PI2 A;  4KHZ A;  2F4V L;  1HNW L;  4YY3 L;  1UEB A;  2B29 A;  4LUZ A;  2E2I H;  1KRT A;  1C0A A;  1BBU A;  1W2B A;  1CKO A;  1PYS B;  4DUY Q;  5LMN Q;  4DV1 Q;  1E3P A;  4BY7 H;  3PUY A;  3A5Z B;  4HIK A;  1TWA H;  3JC6 6;  1XMO L;  1ASY A;  2NN6 I;  1HR0 W;  2ALY B;  1LYL A;  4DNI A;  1UE5 A;  3HOY G;  1C7Y A;  3FP9 A;  1X54 A;  1I3Q H;  3CPW A;  3HOZ G;  4WJ4 A;  2RCN A;  3NBH B;  4X66 Q;  3A74 A;  1UE7 A;  2N3S A;  3CQZ H;  4X62 L;  4L5S A;  1BVS A;  1V43 A;  3ZJY C;  1K73 C;  3STB D;  3T1Y L;  4P75 A;  4GKJ Q;  3D31 A;  3AFQ A;  1VQ8 A;  2K5H A;  2HHH Q;  2JA7 G;  3S2H H;  3S17 H;  3GO5 A;  3K8A A;  4KLK A;  5LMN W;  4JI8 L;  4JYA L;  2AWO A;  1TWH H;  1Q82 C;  3M4Q A;  1VQ9 A;  3GTG H;  3UE1 A;  1X56 A;  4JBW A;  4JBK A;  2K5V A;  1KQS A;  2N78 A;  4JCV E;  2RHQ B;  3AFP A;  2VQF L;  4A3M H;  4NXN Q;  5FLM H;  3HOU G;  4A93 H;  1YHA A;  2JJQ A;  2OWO A;  2RF4 A;  2K14 A;  5IY0 A;  4OO1 G;  3CPF A;  4LNQ A;  2DGY A;  4JI1 Q;  1VQP A;  1PYB A;  4P71 A;  4LFC Q;  5M5X H;  2YU9 H;  1FJG Q;  1YHQ A;  2ID0 A;  4QQB X;  4GN4 B;  4BBS G;  5M5W H;  5M5Y H;  4QY7 A;  3U58 A;  2HHH L;  2UXB L;  2ZTD A;  1L1O A;  3BZK A;  1N32 Q;  4IPD A;  3S15 H;  1EWI A;  1OXU A;  3CME A;  1OXX K;  2OCE A;  4A3I H;  1XMQ L;  4DAY B;  4A3K H;  1XPU A;  1X6O A;  4X62 Q;  3WWV A;  4LF8 Q;  4A3E G;  3PO2 G;  1QZH A;  1PH9 A;  1PH3 A;  4AYB G;  1S40 A;  2JEB I;  4C2M H;  3M4O H;  4JI5 Q;  2WB1 E;  4GNX C;  4HIO A;  5FLX c;  1J6Q A;  4LFA L;  5C0X I;  3I4O A;  2LSS A;  1JE5 A;  2B63 G;  1K3R A;  2VUM G;  5J3B A;  1CKN B;  1PHJ A;  2PNH A;  4Y7N H;  2A19 A;  3VDY A;  3GTM H;  2JA8 G;  3NEM A;  3L7Z C;  2OTL A;  2E2H H;  1HNZ L;  3TS2 A;  5IYC G;  1O7I A;  2KBN A;  2K4K A;  1D7Q A;  1S72 A;  1IBM L;  5LMN L;  4MTN A;  1UE6 A;  3STB C;  2YYZ A;  2Y0S E;  2WFW A;  1Q8K A;  1VQA A;  3U4Z A;  4AH6 A;  4UY8 C;  5IP9 G;  3M7N A;  4A3L G;  3KFU A;  2QA4 A;  4GOP C;  2UXB Q;  4R4Q A;  4JBM A;  1OXS C;  3RN5 A;  4GS3 A;  3LGJ A;  4H02 A;  5GAE C;  4JOI C;  1Q12 A;  4DV0 L;  2NVT H;  3M3Y H;  3I2Z A;  4X64 L;  3HFZ B;  3UDX A;  2E8G A;  1PH5 A;  3E9I A;  1WCM G;  2UUC L;  4IFD J;  1NMG A;  3M85 A;  4LF6 Q;  1L2F A;  1VQF A;  3OTO Q;  1E22 A;  5FJ8 G;  2UUC Q;  4DR2 L;  1GVP A;  1TXY A;  4OX9 L;  3S24 A;  1QUQ A;  1IBL L;  2PQA A;  1YZ6 A;  1L0W A;  4GKJ L;  1KD1 C;  3ERS X;  2DUD A;  3A5U A;  2WP8 J;  3CMA A;  1YVC A;  2R7D A;  5IYD G;  4APV A;  2WAQ E;  4JC0 A;  4QIW E;  3T1H Q;  1A62 A;  2L15 A;  1VQB A;  2VS1 A;  2ASB A;  4GNX A;  1C9O A;  1N8R C;  3J81 j;  4X64 Q;  3I55 A;  4WJ3 M;  4DR7 Q;  2BA1 A;  1K8A C;  3HKZ E;  1FGU A;  1WI5 A;  4DV0 Q;  4A4I A;  2I5M X;  2K5N A;  2YTX A;  3GTQ H;  2PI2 E;  3ICE A;  3A0J A;  1SMX A;  2IHF A;  4HJ8 A;  3I7F A;  4DKA C;  1UE1 A;  3PIO A;  5C4J H;  3W1B A;  4LW1 A;  4GLV B;  2ES2 A;  4LFA Q;  4JG2 A;  3PGZ A;  3W1G A;  2UXD Q;  1KC8 C;  2HT1 A;  1MJE A;  5DLQ E;  2D0O A;  1EYG A;  2WAQ G;  1HJP A;  1VCI A;  3K80 C;  1HNX Q;  1X65 A;  1EIY B;  3I4M G;  5IP7 G;  1N36 Q;  2V1C C;  3B6Y A;  4DV2 L;  1Q7Y C;  2MFI A;  4DV3 Q;  4MNO A;  4PMW A;  1N34 L;  2EIF A;  1IBK Q;  1M90 C;  4PZ6 A;  4GKK L;  2B63 H;  2R7Z G;  4IOA A;  3CCQ A;  1Y1V H;  2VY3 A;  1FL0 A;  1I5F A;  1SLJ A;  4JI1 L;  3CCR A;  4B3T L;  2MO0 A;  3PF5 A;  1KAW A;  4BA1 I;  2A8V A;  1Q1B A;  2Q2I A;  1NE3 A;  2I5L X;  1M1K C;  1FVI A;  4B3T Q;  2BA0 A;  4C3J H;  2JA9 A;  2JEA I;  1P16 A;  1Q46 A;  4IPH A;  4POF A;  5IWA L;  5EAY A;  3HOX G;  1I94 Q;  1JT8 A;  1G29 1;  2VL6 A;  1SFO H;  3GD7 A;  4LF7 L;  4GLA C;  4P73 A;  2ATW A;  3HOV G;  4OWT B;  5C0X G;  4LFB Q;  1E1T A;  1X55 A;  3HOX H;  4BA2 I;  1J5E L;  4L5R C;  4DR6 Q;  4BXX G;  1VQK A;  2GVA A;  4R1J A;  3GDE A;  2VQF Q;  1YJN A;  1CSP A;  3EN2 A;  1PH6 A;  1IZ6 A;  3IRB A;  2LXJ A;  1YI2 A;  4IPC A;  5IP9 H;  4AQY L;  4JI4 L;  1N34 Q;  2IT1 A;  1BBW A;  3T1Y Q;  2OQK A;  4A3J G;  2UXD L;  5GAD C;  1WFQ A;  4O0A A;  4QGU A;  2R7Z H;  3RZO H;  4DV6 Q;  3OW2 A;  4X66 L;  4GLX A;  2ZM6 L;  1LM0 A;  1X3F A;  4JI2 L;  1A63 A;  1WCM H;  1VQG A;  3H3V I;  3GTO H;  5GAH C;  2F4V Q;  2YTY A;  3CCJ A;  4X65 Q;  4DR4 L;  1HNW Q;  3HOV H;  4KI0 A;  3TEH B;  4YWK A;  3TRE A;  1HZC A;  5HY6 A;  4NB3 A;  3TS0 A;  3HOZ H;  4ME3 A;  4DV5 Q;  3S2D H;  1PH7 A;  1GD7 A;  3H3V H;  1Q1E A;  2IX0 A;  3J80 c;  4B3R L;  1GKH A;  1B8A A;  1VQH A;  3HKS A;  3RNU A;  4LF8 L;  4POG A;  5GRO A;  3CCM A;  1XMQ Q;  4EX5 A;  5H1S E;  4ALP A;  4GOP A;  4DR7 L;  3PUV A;  3CCV A;  1YJ9 A;  1YJW A;  1Y1V G;  3NEL A;  1XJV A;  4DAM A;  1S3O A;  3KF8 B;  1K9M C;  1NY4 A;  1XNQ L;  4BBS H;  3CCU A;  4LF7 Q;  4DR5 L;  4HJ7 A;  2JA6 H;  4A3B G;  1A0I A;  4NXN L;  3KYH C;  1WYD A;  4LF5 Q;  1VQ4 A;  2ZTE A;  4UP8 A;  4RG1 A;  4XTC S;  4DR5 Q;  4DR1 Q;  1N33 L;  1IXR A;  4QL5 A;  4LF4 Q;  4XIG S;  2VUM H;  5IT9 c;  2R92 H;  4DPG A;  4P74 A;  4A3M G;  3E0E A;  1E24 A;  2Z6K C;  3G71 A;  2MQH A;  4JI7 L;  1RIP A;  2CQO A;  1L1O B;  2VZA A;  3E9H A;  3KLW A;  3ER0 A;  2JA7 H;  1JJG A;  3GTK H;  2NZO A;  4L5T A;  1PVO A;  1G6P A;  4AIM A;  4BXX H;  1QUQ B;  1VQC A;  4A3I G;  1BKB A;  4P72 A;  1XTD A;  4C3I H;  1MIU A;  5JJK A;  1HNZ Q;  1X3G A;  5JJL A;  2PMZ E;  1VQJ A;  2CWA A;  3J81 i;  3RLO A;  3U50 C;  4IOC A;  3RZD H;  1KL9 A;  2D62 A;  4YHH Q;  3K7A H;  3L0O A;  4DV4 Q;  2A1A A;  4R4T A;  1P8L A;  1SN8 A;  4DV1 L;  4IFD G;  4KHP L;  3I56 A;  1DGS A; 
#chains in the Genus database with same CATH topology
 4CDE C;  3S16 B;  1OO9 B;  2R92 G;  2E5L L;  2L4N A;  2B3G A;  2O2L D;  3GTK B;  4K0K L;  3F1Z A;  4RGM A;  3SGI A;  3S1M H;  1K0R A;  1YBY A;  5D14 A;  3K57 A;  3GP7 A;  1GUG A;  3M7G A;  1F2L A;  2CFM A;  1HXY D;  4JI3 Q;  3KJP A;  1QNK A;  3G7L A;  4IUV A;  4A3L H;  4A3K G;  2E75 C;  2F0G A;  4C56 C;  5DM7 3;  3H94 A;  1U4M A;  3L3O C;  5EPJ A;  4FF2 A;  3MTS A;  1H95 A;  1EOV A;  1PFS A;  1YIJ A;  2CCZ A;  1EUJ A;  2XVS A;  4F87 A;  3S1M B;  2YTV A;  1WTQ A;  5ELE A;  3DUZ A;  4K6D A;  2Q2T A;  4EVO A;  2F3V A;  3F8T A;  3RR5 A;  2OXP A;  5C4X G;  3BJU A;  1XYI A;  3PF4 A;  1SNC A;  4FNF A;  4DR3 Q;  2Q2U A;  2Y0S G;  2H4O A;  2L9H A;  4GN3 B;  5GAG C;  2IX3 A;  2EYH A;  4OEL B;  1U4L A;  4DR3 L;  5C0X H;  4KHP Q;  4R9W A;  4BBS B;  2I5H A;  5C0X J;  2M2L A;  1LTL A;  2EYF A;  2K52 A;  2EYO A;  1DD2 A;  1NCV A;  2KVM A;  4IUP A;  1KDA A;  2JA5 G;  4B3M Q;  2O5J C;  4IPG A;  3KJO A;  5M3M H;  1TWC H;  3DHQ A;  4IJH A;  2RHS B;  1STB A;  4Q0F A;  1IL2 A;  4GN5 A;  3RLN A;  2HIV A;  1PXU A;  1VF5 C;  1WTP A;  3KDF B;  3J80 L;  1A8V A;  3HOV B;  1Z6H A;  3HOW H;  5C44 H;  5I9P A;  5L37 A;  1B70 B;  3FVQ A;  1PRT B;  4J6H A;  3DMU A;  2CKZ B;  3U9O A;  1MJC A;  2QIL A;  3WOE A;  2BH8 A;  3QO2 A;  1HH2 P;  3CHB D;  5IT9 L;  5HGT A;  4A3C H;  2JA6 B;  1BCP D;  2UUB L;  3N6R A;  4AQY Q;  1LT5 D;  1SFO B;  2NBF A;  1RHP A;  3L9A X;  2HIX A;  4ZQ3 A;  4HED A;  3R8B A;  2UXC L;  2F52 A;  4XQN A;  1SBB B;  2K50 A;  3CD6 A;  4L8J A;  4O42 A;  3MFG A;  1I4R A;  5FLX E;  4LF6 L;  2Z1C A;  4RHS A;  4PQX A;  4C3I B;  4J15 A;  4HJ5 A;  1VMC A;  5IYB G;  5FLM G;  2LKV A;  4IAL A;  3UDG A;  2EY6 A;  2XIW A;  3I91 A;  4GNX B;  1OXT A;  2GA4 B;  1I6H H;  5C4X B;  2CQA A;  2D2C C;  4UPA A;  3CF5 A;  1J9O A;  4OO1 I;  1I50 H;  1C48 A;  1CSQ A;  4PG3 A;  4YCV A;  2M00 A;  4FXK C;  2A6H D;  2Z6K A;  2A73 B;  1I6V C;  4A3F H;  1VQL A;  4JI4 Q;  4A3D H;  1U5K A;  3UE0 A;  1IYJ B;  3ND9 A;  2UUB Q;  2CVR A;  2AKW B;  3PO3 G;  1QB5 D;  1JOK A;  2TMP A;  2AWN A;  5KYL A;  4DR6 L;  1TR5 A;  3K58 A;  1ML0 D;  5LMU Q;  1R9T H;  5DAU A;  1TS4 A;  1HZ9 A;  3EIV A;  4UAI A;  2E2J B;  3PQI A;  1GOZ A;  5C3E G;  1RD9 D;  4LF4 L;  1A3U A;  1G8Z D;  3NWS A;  4CJ1 B;  4DUZ L;  3OTO L;  2GN5 A;  4DK3 C;  2A69 D;  1QNU A;  1HZA A;  4I7A A;  4TVA B;  1HQR D;  4RMF A;  2B2V C;  3SDZ A;  3PO2 B;  1EU3 A;  5BR8 L;  4BY1 B;  3LNN A;  3SK8 A;  2R93 H;  4A76 A;  2JA6 G;  3QB3 A;  1C8C A;  2F4V L;  2PI2 A;  3TME A;  4DF7 A;  2BE5 C;  2B29 A;  5COR A;  1W2B A;  1KLU D;  4DV1 Q;  4BY7 H;  1TWA H;  1ASY A;  5D3D A;  2NN6 I;  2VB2 X;  1B9N A;  3KLS X;  1HA5 A;  1UE5 A;  1I3Q H;  5M5Y B;  4H44 C;  1LO5 D;  2IW3 A;  4L5S A;  1V43 A;  2E76 C;  4GKJ Q;  1VQ8 A;  3GO5 A;  3K8A A;  3QG1 A;  3DEP A;  1TWH H;  2FMC A;  2KCC A;  2A68 D;  4JBK A;  3T16 A;  1KQS A;  4JCV E;  1D1K A;  3AFP A;  3AMU A;  2ZT9 C;  2OWO A;  2JJQ A;  2PO4 A;  2RF4 A;  4OO1 G;  4KTA A;  1DZ1 A;  4LNQ A;  2DGY A;  1VQP A;  3MAQ A;  1RCV D;  5M5Y H;  3U58 A;  2LMC B;  4NKL A;  3SR1 A;  3TZU A;  3DWA A;  4ZUI A;  5A35 A;  1SNO A;  1XMQ L;  4A3K H;  4ME5 A;  3WWV A;  1O7L A;  1QZH A;  1PH9 A;  3GTO B;  5IGF A;  1D1I A;  4OGQ C;  3M4O H;  4U68 A;  1PTO B;  5C3W A;  5FLX c;  1J6Q A;  4ABN A;  4EQO A;  3DM1 A;  3PO3 B;  1K0S A;  2B63 G;  1SYE A;  1UAP A;  3QR8 A;  3TP5 A;  3VA7 A;  5J3B A;  2A19 A;  5CV6 A;  3GTM H;  4Q5V A;  3NEM A;  2OTL A;  2A69 C;  2E2H H;  3TP8 A;  1ROD A;  1HNZ L;  3TS2 A;  5IYC G;  2K4K A;  1I4P A;  2BCO A;  3GTQ B;  4MTN A;  4RH6 A;  3STB C;  2Y0S E;  2EZV A;  1VQA A;  5COY A;  2UXB Q;  5T1I A;  3KFU A;  4GOP C;  1M4V A;  2ICE C;  4YIJ A;  2V4D A;  4JBM A;  1OXS C;  3MWY W;  4HSV A;  1Q12 A;  3M3Y H;  4CKB A;  1WVL A;  1DM0 B;  3HFZ B;  5IGC A;  1MD2 D;  3E6Z X;  3KBX A;  1PH5 A;  1WCM G;  4BY7 B;  3M85 A;  4LF6 Q;  5KGU A;  5CV8 A;  5LHY 1;  5FJ8 G;  2QF7 A;  4XQQ A;  2PQA A;  3C46 A;  3ERS X;  4KKU A;  2DUD A;  4IUN A;  2Z9H A;  3T56 B;  3HEJ A;  1A62 A;  1STN A;  5FO9 B;  4GNX A;  2K7V A;  3AB9 A;  3EQL C;  2BA1 A;  3BVM A;  3P20 A;  2Z6B A;  1WI5 A;  4C3I G;  2F0W A;  1SMX A;  4HJ8 A;  3I7F A;  2F0N A;  5CV7 A;  3VR3 A;  2F0J A;  2K6A A;  3W1G A;  2UXD Q;  1KC8 C;  5IT9 E;  3R93 A;  2D0O A;  3HOW B;  1DJR D;  2NUC A;  2DNC A;  2V1C C;  3CU7 A;  2WKD A;  3B6Y A;  2KED A;  4KY5 A;  1N34 L;  2P5Z X;  1M90 C;  1JWM D;  1I5F A;  1HRJ A;  3CCR A;  2WAC A;  4RFB A;  1NE3 A;  4N8X 1;  4RKL A;  1LTT D;  4RCN A;  4P73 A;  1WTX A;  1X55 A;  3HOX H;  3ND8 A;  3HOZ B;  4L5R C;  3U9S A;  1VQK A;  2VQF Q;  1LTS D;  1EY6 A;  4LMQ D;  1CSP A;  1PH6 A;  4FF4 A;  5IP9 H;  1B50 A;  4MN3 A;  3T1Y Q;  3DWP A;  5AFW A;  1LTB D;  3A56 A;  1LM0 A;  1HTP A;  2I46 A;  2K28 A;  3H3V I;  2F4V Q;  2YTY A;  3CCJ A;  2R92 B;  2K03 A;  4YWK A;  3TRE A;  1HZC A;  4DV5 Q;  4UHV A;  1PH7 A;  3VYT A;  2IX0 A;  4B3R L;  5M3M B;  3OMC A;  5GRO A;  3T13 A;  2IJ0 A;  1Y1V G;  2WB1 B;  3KF8 B;  1K9M C;  1NY4 A;  1WTO A;  3CCU A;  4HMI A;  4HJ7 A;  2QEJ C;  1NUC A;  5EKI A;  3UI2 A;  3KYH C;  5JJZ A;  1A2T A;  4K5V A;  2ZTE A;  4RG1 A;  1V8Q A;  3JAM L;  4XIG S;  1X32 A;  2R92 H;  1EY5 A;  3LX0 A;  3S2D B;  3QJY A;  1STE A;  2PCF B;  3E0E A;  1EY4 A;  3E9H A;  1LTA D;  2MUY A;  1PVO A;  2NZO A;  5DNF A;  5IGB A;  1JOR A;  1BKB A;  4P72 A;  3ERQ A;  2NZ1 D;  3SK4 A;  3IL8 A;  1UEA B;  1PZI D;  1H9K A;  3J81 i;  3RZD H;  1KL9 A;  2K04 A;  2D62 A;  4DV1 L;  5K5P A;  1DGS A;  1GO3 E;  1A3V A;  3NBI A;  1VQI A;  2HCI A;  3JAM c;  2XRS D;  2H1E A;  1EIF A;  3CC4 A;  3T1H L;  3CAM A;  3M4P A;  4O1N A;  1Q90 A;  2R93 G;  3BU2 A;  2QDL A;  1R4P B;  4H7B A;  4ZLT F;  4DR2 Q;  1T9H A;  2HQL A;  3HG9 A;  2B39 A;  3LWU A;  4OXP A;  4NXM L;  1N32 L;  1VQO A;  1K8O A;  4CJ2 C;  2F0M A;  2BE5 D;  4XDX A;  1RF2 D;  4CKE A;  3JAM i;  4PMC A;  4MHE A;  1MBY A;  2MGS A;  1ILQ A;  4B3M L;  2UUA L;  4C1N I;  1LTR D;  1IBK L;  5JVG 3;  3GQB A;  4YCU A;  1XTC D;  5IP7 H;  4JI8 Q;  3DM3 A;  3EJI A;  3K7U C;  4QIW B;  1EQQ A;  3H91 A;  2EYJ A;  5I9O A;  2F0L A;  5EPK A;  4C3H G;  4X65 L;  5KNC A;  4RKB A;  1CI3 M;  5LL6 S;  3K0X A;  4YWL A;  1I6H B;  1VQN A;  2EJF C;  2LS0 1;  1SEB D;  2N8N A;  4XQJ A;  3CCE A;  3MXN A;  1YNN D;  1VQM A;  1V9P A;  2L55 A;  3HOU H;  4BWG B;  2K1B A;  2B8F A;  2K75 A;  2WII B;  4LWC A;  2KA7 A;  2XTI A;  3A8J E;  4OWX B;  2VW9 A;  2XWJ B;  4V0B A;  4K2L A;  1L0X B;  4JI0 L;  3WOF A;  2KOL A;  3P1H A;  3K81 C;  4DA2 A;  3S1Q H;  1JOO A;  1WJJ A;  4DAV A;  2J4X A;  1HQM C;  4AYB E;  1SRU A;  4YCW A;  1EQV A;  4HJ9 A;  1J8I A;  1Y69 U;  1RDP D;  3PUZ A;  1KLG D;  1TWA B;  1VF7 A;  4A75 A;  4IO9 A;  4YHH L;  4TQU S;  2IWH A;  1TVX A;  2VUM B;  3KDF A;  3HZX A;  1L1O C;  2WB1 G;  1Y1V B;  2RDG A;  4WFN 3;  2L5T A;  1YHB A;  1F2Z A;  1SNQ A;  4BBR H;  5M5W B;  2RCF A;  4QMG A;  4A3C G;  1F2Y A;  4JV5 L;  3V96 A;  4HMJ A;  3J7A V;  1YNJ C;  1CUK A;  4BY1 H;  1PH2 A;  1QZG A;  2IX1 A;  5FO7 B;  3E0J A;  1GUW A;  4R4O A;  2B2T A;  1J5E Q;  2DN8 A;  3D4W A;  5JPN C;  5G3L F;  3F2U A;  5JJI A;  5C44 G;  3BZC A;  1HFG A;  4C3H H;  1KXL A;  4RGO S;  4R4C A;  3T4A C;  1NJI C;  3C1E A;  3E5S A;  1Y1W H;  4A3B B;  3OWE B;  1F9S A;  1AH9 A;  2UUA Q;  5KIX A;  3VYS A;  2ZJP A;  2SEB D;  1YNN C;  4HID A;  2JA5 H;  1YNX A;  1JB7 A;  4GKK Q;  1O7Y A;  1PTO H;  3OYY A;  3CC7 A;  2K5D A;  4CHT B;  1H9S A;  3IFT A;  3U4V A;  3CP0 A;  2RSN A;  4K0K Q;  4JI3 L;  2CH4 A;  2WV6 D;  4PZ8 A;  3UDF A;  2YV5 A;  4K6L A;  1VQ7 A;  4JPB W;  3HOW G;  3GTL H;  3M4Y A;  3PV0 A;  3KF8 A;  1BR9 A;  4LF9 Q;  2Q8I B;  4A3G G;  1AEX A;  3HP3 A;  2F0H A;  1BQQ T;  2C5C A;  4JI5 L;  3AYH B;  1GHJ A;  1PYW D;  1TY0 A;  2WAQ B;  4JV5 Q;  4JOI A;  1FNV A;  3I4M B;  1YEZ A;  1QG7 A;  2LY7 A;  3F2B A;  2KHI A;  4B3S Q;  3RUZ A;  3CC2 A;  1D5X C;  2DJG C;  4NPS A;  1I94 L;  1F9Q A;  1KRS A;  4DXG A;  1CFM A;  3DEO A;  1B2T A;  2QW7 A;  4LF5 L;  4LFC L;  1AE3 A;  3EBE A;  3S2H B;  5C4X H;  2JQO A;  2EXD A;  4NXM Q;  5CR3 A;  4KKT A;  4E6I A;  1EU4 A;  4BY1 G;  4QUC A;  3SVM A;  1N36 L;  2QEX A;  4PZ7 A;  2ICI A;  2E2D C;  2OEO A;  4IUU A;  1E7Z A;  2F0I A;  4A3D B;  2B2W C;  4L5Q A;  1O7Z A;  3KLS A;  4DV4 L;  1UWV A;  2A6H C;  4KN4 C;  1B44 D;  3W3A A;  1F9R A;  4PNY A;  3FMC A;  2RKS A;  2E2I H;  1KRT A;  4FXD A;  1C0A A;  2K5Q A;  1E3P A;  1TS5 A;  4HTH A;  2F0V A;  2Y0S B;  4ZAI A;  1LYL A;  2YU9 B;  3FP9 A;  1X54 A;  3CPW A;  4WJ4 A;  2N3S A;  5FO8 B;  3CKI B;  3K5M A;  1BVS A;  1CA5 A;  1JCK B;  1K73 C;  3D4D A;  3GTL B;  3D31 A;  3CRK C;  3AFQ A;  5BN5 A;  2HHH Q;  4FYD A;  2DNE A;  4KLK A;  3T51 B;  4R8I A;  4JYA L;  1Q82 C;  1VQ9 A;  2SDF A;  1WCM B;  4A3M H;  3HOU G;  4CBV A;  3I90 A;  2K14 A;  2JA7 B;  3EVQ A;  3A7A B;  5C6A A;  3Q0A A;  1PYB A;  4LFC Q;  1PMR A;  4IZ8 A;  2YU9 H;  1YHQ A;  1EY9 A;  1GUO A;  1N32 Q;  2EJM A;  4A3I H;  1OXU A;  1XPU A;  2F1M A;  1SNP A;  4X62 Q;  4DFA A;  4LF8 Q;  1KTK A;  1PH3 A;  4G4K A;  4JI5 Q;  2WB1 E;  1I4H A;  2B2U A;  4LFA L;  5JAV A;  3I4O A;  2LSS A;  1B3A A;  3HS0 C;  2O4X A;  2ZXO A;  1PHJ A;  2PNH A;  2XNA C;  3VDY A;  2JSO A;  1HPC A;  1NNX A;  3L7Z C;  1RJT A;  3TN2 A;  1RTO A;  1T5E A;  2A6E C;  3HOY B;  2WFW A;  2QA4 A;  2MHV A;  2A68 C;  4KK7 A;  4I7Z C;  4GS3 A;  1JWU D;  2AQ2 B;  3LGJ A;  3RN5 A;  5E4X A;  1GXD C;  4A3G B;  2E8G A;  4UDU C;  1ZYR C;  3IKJ A;  4L6T B;  4DR2 L;  1GVP A;  1JOQ A;  5DM6 3;  1L0W A;  3BYT B;  2PPB C;  4GKJ L;  4HR7 B;  1PZK D;  1XX8 A;  1TKW B;  1QIL A;  1YVC A;  2R7D A;  5IYD G;  1ZXT A;  2EOT A;  5CV4 A;  1MHW C;  1HUM A;  4B9X A;  1C9O A;  1N8R C;  2PW5 A;  4ODG A;  4X64 Q;  4X3K A;  3J81 j;  3I55 A;  4DR7 Q;  4WJ3 M;  1K83 B;  3HKZ E;  1S5B D;  4XXE A;  2ENB A;  1FGU A;  1E0B A;  4DV0 Q;  5KYI A;  3GTQ H;  2PI2 E;  1DXM A;  5C4J H;  3W1B A;  4GLV B;  2FIN B;  4LFA Q;  1BF4 A;  1LAB A;  3PGZ A;  4DK1 A;  2JA5 B;  4ZCK A;  3H3V C;  3K80 C;  1EIY B;  1Y8N B;  1CK1 A;  3C1F A;  5T1G A;  2R7Z B;  4DU9 A;  5M9O A;  4PMW A;  4PZ6 A;  3J7A F;  2D9U A;  1FGB D;  2IPK D;  1Y1V H;  1FL0 A;  5BN3 A;  4B3T L;  5EKK A;  2A8V A;  3D8G A;  5FOB B;  2Q2I A;  1M1K C;  4B3T Q;  5I4D A;  2F4I A;  1P16 A;  1Q46 A;  4IPH A;  1JT8 A;  4HSP A;  5IGG A;  2FJ2 A;  3T53 B;  4BA2 I;  2NB0 A;  4M8A A;  1KAB A;  5J22 A;  3IRB A;  2LXJ A;  1YI2 A;  1UUP A;  4QGU A;  1LTI D;  3K5N A;  4DV6 Q;  5CMD A;  1QE6 A;  4X66 L;  4GLX A;  3A8K E;  2ZM6 L;  1PFB A;  1X3F A;  1VQG A;  1IL8 A;  2AUJ D;  4X65 Q;  3HOV H;  3TEH B;  5HY6 A;  4NB3 A;  3HRZ C;  3MEH A;  2XSC A;  2X6L A;  3J80 c;  4OL7 A;  2PNR C;  1GKH A;  5IGE A;  5I6W A;  2HDM A;  2NTS A;  3PUV A;  1XJV A;  4GZY C;  2BDO A;  5HUR A;  1XNQ L;  5ISR A;  4BBS H;  4LF7 Q;  2JA6 H;  2Z8L A;  4LF5 Q;  1N33 L;  1EL0 A;  5IT9 c;  1IKM A;  1CA6 A;  3C3L A;  4A3M G;  3D6C A;  1E24 A;  2EY5 A;  1X3P A;  2B2U C;  4FF1 A;  1L1O B;  2PYK A;  3MFY A;  1S5C D;  2TSS A;  1G6P A;  4A3I G;  1XTD A;  4C3I H;  1MIU A;  1EEF D;  2CH4 W;  5KRU A;  4KHV A;  1VDZ A;  3U50 C;  4IOC A;  1SE2 A;  4OIJ A;  1BO0 A;  4YHH Q;  4DV4 Q;  1STG A;  3A54 A;  4R4T A;  1SN8 A;  4IFD G;  1BXT A;  3I56 A;  3IFD A;  1SRO A;  3CRL C;  1BNZ A;  4KJN A;  2C35 B;  1ICW A;  1Y8P B;  1HCZ A;  1T5X D;  5IGD A;  1H9M A;  1EYD A;  5CC4 A;  4JI6 L;  2RDH A;  5C5M A;  1NMF A;  4RWS C;  1VQE A;  2Z4H A;  1TS2 A;  1MKH A;  3QOJ A;  2KEN A;  3RLF A;  1XNQ Q;  4ZYS A;  3WDN A;  1NR2 A;  2EQS A;  2HQE A;  4N9T A;  2NVX B;  3Q8D A;  4KY6 A;  1SYC A;  2PQA B;  1JJC B;  1ZEQ X;  5ELF A;  5C4H A;  5ELN A;  1WD1 A;  4PV1 C;  5LMU L;  1G91 A;  3FKI B;  3GTJ B;  3Q24 A;  1PH4 A;  1Z47 A;  1JQY D;  1G2S A;  5M3F H;  3UDI A;  1Y8O B;  1CQF A;  2OTJ A;  3TSS A;  4DK0 A;  2AQ3 B;  4DV3 L;  1JJ2 A;  4HCS A;  1OXV A;  3D4R A;  3P7J A;  2E2J H;  1BCP C;  2UU9 Q;  1ET9 A;  3HKZ B;  2R6G A;  4V19 0;  1SR3 A;  1XXG A;  1AN8 A;  5JEA J;  1ASZ A;  4XT3 B;  2VQE Q;  3MXN B;  3NQT A;  4OHJ A;  2CW0 D;  1SYB A;  4A3I B;  2MJ8 A;  2QGQ A;  2XRQ D;  1N9W A;  3CCL A;  3FKI H;  3GTJ H;  4OO1 H;  4NMZ A;  3J81 E;  1NR4 A;  5EQ0 A;  2EYL A;  2KCM A;  2XN9 C;  5ELD A;  4DV7 L;  1IBL Q;  1N33 Q;  2RVL A;  3PIP A;  3KLR A;  1PZJ D;  4YWM A;  2G9D A;  3J81 L;  1RTN A;  5AJ3 L;  4FF3 A;  3FPP A;  3KBG A;  3HOY H;  4KV6 A;  2K01 A;  4JI0 Q;  3L2P A;  4A3E B;  1SYF A;  2NYZ D;  4OIK A;  1G51 A;  3QIA A;  2NVT B;  2RDF A;  3PUX A;  1IKL A;  4DV2 Q;  3NE5 B;  2B2Y A;  4K5X A;  2IHE A;  2JA8 H;  1HFN A;  2PZT A;  2Z0S A;  3ERO A;  1XMO Q;  1Y1W G;  4QUF A;  2AUK A;  3OOC A;  4BBR G;  1U0L A;  2VQE L;  2F3I A;  3G6E A;  5I6Y A;  3AEV A;  4A3M B;  5I2Y A;  1W6K A;  2GVB A;  3SK6 A;  4DAP A;  5FJ8 H;  1TWF H;  1VQD A;  4A3E H;  3KF6 B;  4WOR A;  3N52 A;  4B9W A;  1SJH D;  1CKN A;  4Z9C B;  1CKM A;  3H0G H;  2PMZ B;  4A3J B;  1EIH A;  1E2W A;  3VYU A;  4XYQ A;  3M9B A;  3I73 A;  1PH1 A;  2AMC B;  1QVF A;  1F2M A;  2NZH A;  4DV7 Q;  4LFB L;  2E2H B;  1B7Y B;  5GQO A;  2K33 A;  2NVQ B;  5IYC H;  4QJF A;  5KND A;  4BS9 A;  1CTM A;  3HGB A;  3J80 i;  3TDQ A;  4A3D G;  5IYB H;  4RHR A;  5I2X A;  2CHB D;  3H0G B;  3A8I E;  1BOS A;  3PSI A;  5E7N A;  1E1O A;  4G7H C;  2QCP X;  4MZ9 A;  2AHO B;  1QWY A;  1K3B C;  1FNU A;  1WOC A;  1TS3 A;  4LUV A;  5ELO A;  2K32 A;  3EA6 A;  5ELC A;  1V1Q A;  3VA5 A;  1IHZ A;  5HGQ A;  1YIT A;  1NTG A;  2KHS A;  1OTC A;  3CW2 C;  3NQI A;  2NVY B;  5CBA E;  3NWT A;  4JBJ A;  1WTH A;  4LK1 C;  3NEN A;  3NPP A;  5BR8 Q;  4F88 A;  1ICF B;  4KD3 A;  2PZW A;  1HR0 L;  1HA6 A;  1F77 A;  1SE4 A;  2EYP A;  2N49 A;  1FJG L;  2CWP A;  3H09 A;  5TSS A;  2D0P A;  3MEF A;  4HIM A;  1K8G A;  5AJ3 Q;  1VQ6 A;  3OPO A;  1JMC A;  1GM5 A;  4OON A;  2MPM A;  3VYR A;  4DK6 C;  1Q86 C;  3S14 H;  4R4I A;  4N9P A;  1HNX L;  2VNU D;  2E5L Q;  4ULL A;  1KHI A;  2HUG A;  2Q8R E;  4MTK A;  1KDC A;  2H5X A;  1EQT A;  2F3W A;  1SJE D;  1TWG H;  1CQV A;  3TP6 A;  1IBM Q;  1Y1W B;  4A3B H;  1VQ5 A;  4UP9 A;  1D6E C;  4YY3 L;  1UEB A;  2F0F A;  1H9R A;  1SNM A;  1H9S B;  4NP5 A;  1QCB D;  5LMN Q;  4HIK A;  1XMO L;  1NSN S;  1K8M A;  3JAM E;  3HOY G;  2HCC A;  1C7Y A;  1BCP F;  2RCN A;  4X66 Q;  1UE7 A;  3CQZ H;  4TKO B;  1TII D;  4H0L C;  3T1Y L;  3S2H H;  2K5H A;  2JA7 G;  5C4J B;  5LMN W;  3GTG H;  3M4Q A;  3RD4 A;  4JBW A;  2N78 A;  3V05 A;  2KEC A;  3D3R A;  2RQX A;  3FRP B;  1Q3L A;  5EBD A;  4P71 A;  2F0Q A;  5EPL A;  4QQB X;  4BBR B;  5M5W H;  1XWE A;  1ESR A;  2HHH L;  2UXB L;  1L1O A;  1EY8 A;  3S15 H;  3NTK A;  1JC7 A;  1MSH A;  2EY2 A;  1OXX K;  1HUN A;  1EIG A;  1SAP A;  4AYB G;  2J7Z A;  2JEB I;  1Z7T A;  4HIO A;  2MP1 A;  4XYO A;  2VUM G;  1K3R A;  3R2T A;  2R61 A;  5J1Z A;  1EWH A;  3S14 B;  1O7I A;  1A15 A;  2IL8 A;  1S72 A;  1QJO A;  1MGS A;  4AH6 A;  3K6O A;  3URY A;  4RAU C;  4QF4 A;  4UY8 C;  5IP9 G;  4A3L G;  1CHP D;  1TWG B;  2F0U A;  5GAE C;  1JIC A;  3I2Z A;  4X3U A;  4JK1 C;  2F03 A;  2KEE A;  1IYV A;  1Q8I A;  2RA4 A;  3NP8 A;  4QB4 A;  3E9I A;  4IFD J;  1NMG A;  2ZXR A;  1VQF A;  3RZO B;  1E22 A;  2JN4 A;  1TXY A;  1QUQ A;  4TSS A;  1IBL L;  1FYC A;  1YZ6 A;  4HAE A;  3CMA A;  2WP8 J;  1ENA A;  3W2D A;  2WIN B;  1CT1 D;  2WAQ E;  4JC0 A;  4QIW E;  1R9T B;  2L15 A;  4RGT A;  1V1P A;  1VQB A;  2O5I C;  5IOD A;  4A4I A;  4ZKC B;  5CV9 A;  3Q22 A;  1TQO A;  3R2I A;  4DKA C;  3PIO A;  4LW1 A;  3KUP A;  5JOB A;  2ES2 A;  1IW7 D;  2HT1 A;  5E1F A;  4ZKB B;  1MJE A;  1B4O A;  3QOL A;  3C2P A;  1SXT A;  4G7O C;  3BG3 A;  1X65 A;  3I4M G;  5IP7 G;  1PFM A;  5A2Q L;  2DY7 A;  2MFI A;  2EIF A;  3NK9 A;  1PFN A;  1VMP A;  2JA8 B;  2VY3 A;  1SLJ A;  4JI1 L;  2MO0 A;  4BA1 I;  1TT2 A;  2I5L X;  1FVI A;  1HHV A;  2BA0 A;  3MXU A;  4C3J H;  1SDF A;  3K5O A;  1I94 Q;  3K7A B;  5EAY A;  1SFO H;  1B3Q A;  4LF7 L;  4GLA C;  3HOV G;  4OWT B;  5C0X G;  3OIP A;  4AYB B;  4LFB Q;  1E1T A;  2RSO A;  4FO2 A;  1J5E L;  4DR6 Q;  1JWS D;  4R1J A;  2L12 A;  2EJG C;  3BVG A;  4CDF C;  1GUS A;  3BVZ A;  4AQY L;  1N34 Q;  4A3J G;  5GAD C;  1WFQ A;  2R7Z H;  1X3Q A;  3RZO H;  1PTO F;  3S9W A;  1I4Q A;  3HOU B;  2L0C A;  1PTO C;  1H9J A;  2A6E D;  4L63 B;  4JI2 L;  2FFK B;  1DOL A;  1PLF A;  1WCM H;  5GAH C;  4ZUJ A;  2N55 A;  4KI0 A;  3HOZ H;  5M3F B;  3S2D H;  1O78 A;  1U9R A;  1VQH A;  1DOM A;  3RNU A;  1I4G A;  4X3S A;  3CCM A;  1XMQ Q;  4EX5 A;  4R8N A;  3CCV A;  1YJW A;  1I50 B;  4U67 3;  4DR5 L;  4DAY A;  2EY1 A;  1WYD A;  1VQ4 A;  2NTT A;  2Z4I A;  4XTC S;  4DR5 Q;  4DR1 Q;  4QL5 A;  2M9V A;  2VUM H;  1ILP A;  4DPG A;  3FEW X;  4P74 A;  1D5M C;  3MHB A;  3G71 A;  1PRT C;  1V1O A;  2MQH A;  1RIP A;  2VZA A;  5C4Z A;  4IUT A;  3KLW A;  2JA7 H;  1JJG A;  2F0E A;  4AIM A;  1VQC A;  3VR2 A;  4EQN A;  3X3N A;  5A2Q E;  1SSO A;  2EYM A;  1X3G A;  2PMZ E;  4A93 B;  3S1N B;  2B63 B;  3K7A H;  2K05 A;  2KUM A;  1EZ8 A;  4N8F A;  4A3J H;  2J0T D;  2X69 A;  3AQQ A;  2MO1 A;  3ZYY X;  2ZM6 Q;  3G48 A;  1XPR A;  1AFP A;  3VR4 A;  1O80 A;  4LF9 L;  5F2D A;  3F2D A;  1AE2 A;  2QKI C;  3QWN A;  4OX9 Q;  3TQY A;  3ULP A;  5CYU A;  1B53 A;  3VR5 A;  1AW7 A;  3W5O A;  2JXM B;  2G9H D;  3PO2 H;  4BY7 G;  3K59 A;  1LAC A;  1SYD A;  1C4Q A;  3P75 A;  4B3R Q;  4JI6 Q;  1DCZ A;  2SOB A;  2N88 A;  1ENC A;  1TWC B;  4K2K A;  2FMM A;  3HKZ G;  4HN7 A;  1LT4 D;  4S3S A;  3I4M H;  4JYA Q;  1EOT A;  1LUZ A;  3R3O A;  3S17 B;  1CZG A;  2A5H A;  4DV5 L;  1RL2 A;  4K14 A;  3ULL A;  2E74 C;  3FHW A;  2UXC Q;  2I0Q A;  3J81 c;  4DR4 Q;  1XNR Q;  3KOJ A;  3MC0 B;  2NVY H;  1II3 A;  3TRZ A;  2KCT A;  1XNR L;  3PIP 3;  3GTP H;  2KHJ A;  3G4S A;  3CCS A;  2VB3 X;  1U4P A;  4FDB A;  2OF1 A;  5FLX L;  1GHK A;  2PQE A;  3K5L A;  4DUZ Q;  2NN6 G;  3VR6 A;  4A93 G;  2F0S A;  4LUO A;  5CV5 A;  3PO3 H;  1PRT F;  1KNE A;  1EFI D;  5G3L D;  2ZJR A;  4DR1 L;  2KJX A;  1BBX C;  4JI7 Q;  1S4Z A;  2MNA A;  4CDC C;  1SE8 A;  4X6A H;  2Q2H A;  1ONL A;  1D5Z C;  4K8J A;  4H13 C;  3GV6 A;  2QDB A;  3SE0 A;  3I4N G;  5ELB A;  1SYG A;  1EFW A;  4A3F B;  3BDO A;  5IOC A;  4RCO A;  1PA6 A;  3H0G G;  3BYY B;  1SMY C;  1R4Q B;  1B1Z A;  4B3S L;  2JE6 I;  3F2C A;  1EY0 A;  3IAY A;  1E2V A;  1Y14 B;  2PZU A;  1YNJ D;  1Z9F A;  4IQZ A;  5JEA H;  1JE4 A;  4XT1 B;  4KMU C;  3KF6 A;  2Q8T A;  1EYA A;  2L11 A;  5EBC A;  4IJL A;  5IYD H;  3G6J B;  4JI2 Q;  2IY5 B;  3I70 A;  1X9N A;  1PH8 A;  4P2C B;  2FHT A;  4DV6 L;  3M4O B;  4MIU A;  2UU9 L;  2RBM A;  1PRT D;  5DEH A;  2JK8 A;  4IFD I;  1KAA A;  4QCL A;  3S16 H;  2F0D A;  1KIX A;  3OIQ A;  5IWA Q;  4GOP B;  5K36 H;  3LWE A;  1EQR A;  1L0Y B;  3ULJ A;  5C3X A;  3RN2 A;  4F7X A;  3FPU B;  4OWW B;  2R7F A;  1WTR A;  2B2Y C;  3S1R H;  5M3M G;  1ESF A;  1D8L A;  4CKC A;  3H6M A;  4UP7 A;  1QVC A;  3M3Y B;  5IIF A;  2ZXP A;  1TU2 B;  1CHQ D;  2XGT A;  1QVG A;  1AP0 A;  2F0O A;  4NW2 A;  5JPM C;  1X3E A;  2OQ0 A;  3J7A 5;  3J7Z C;  4A3G H;  2KCN A;  5K36 G;  4EQ5 A;  1AZQ A;  3PUW A;  2ZTC A;  2B2T C;  4DUY L;  2WKC A;  1XPO A;  1KNA A;  4CJ0 B;  1NBW A;  1GUN A;  4HCE A;  4YY3 Q;  3RMH A;  3E3X A;  3DLL A;  2LXK A;  3V2T A;  1Q81 C;  4EGV A;  4DGZ A;  1K83 H;  3H15 A;  3MVV A;  3J80 E;  3NUC A;  1HZB A;  5JEA G;  2R93 B;  2K5W A;  3FKI G;  1F9P A;  2FXQ A;  3PCO B;  4WJW A;  2NVQ H;  1D2B A;  5C44 B;  1I3Q B;  1G2T A;  3SXH A;  1LT6 D;  5C3E H;  2BDN A;  4OEM B;  1V1P B;  1QOH A;  3S1N H;  4A3F G;  2G5D A;  5CGK A;  4HJA A;  1G6Z A;  3D6W A;  1PV4 A;  1W3S A;  1ENF A;  1TWH B;  2I07 B;  2HDL A;  2R3Z A;  1E2Z A;  3D0F A;  3I4N H;  1FD7 D;  4Y52 H;  4O2D A;  1B9M A;  5M3F G;  4KD4 A;  1CZW A;  1HR0 Q;  3CXC A;  3BZD B;  4K8I A;  5IE8 A;  2NVX H;  2BH2 A;  3A55 A;  4KY7 A;  4TRD A;  2ZJQ A;  1VS0 A;  4KHZ A;  1HNW L;  4LUZ A;  4IUR A;  2B8G A;  1BBU A;  4A3K B;  1CKO A;  1PYS B;  4ZK9 B;  4DUY Q;  3PUY A;  3A5Z B;  3HOX B;  3JC6 6;  1HR0 W;  2ALY B;  4DNI A;  5M5X B;  3HOZ G;  5J39 A;  3NBH B;  4K5W A;  3A74 A;  2L1B A;  4X62 L;  3ZJY C;  3STB D;  4P75 A;  1PDQ A;  1MSG A;  3S17 H;  1STA A;  2VXW A;  4JI8 L;  2AWO A;  1WTW A;  3UE1 A;  1X56 A;  2K5V A;  4NXN Q;  2RHQ B;  2VQF L;  4A93 H;  5FLM H;  5EGT A;  1EY7 A;  4RA8 A;  4PMB A;  1YHA A;  1A6X A;  5KEE A;  3OHX C;  4IUQ A;  4JVZ A;  3GTM B;  5IY0 A;  3CPF A;  4JI1 Q;  5M5X H;  1FJG Q;  2A74 C;  2ID0 A;  4KJO A;  2B2W A;  4GN4 B;  4BBS G;  5JVH 3;  4LAA A;  4QY7 A;  2DJF C;  2ZTD A;  3BZK A;  2JP1 A;  4IPD A;  2SNS A;  2AQ1 B;  4JW0 A;  5E4W C;  1EWI A;  4DNT B;  3CME A;  3RZD B;  2OCE A;  4DAY B;  1X6O A;  4C3J G;  3I8Z A;  1IYU A;  4LJZ C;  4A3E G;  3PO2 G;  1BUV T;  4WRD A;  3DXJ C;  1S40 A;  5C3E B;  4C2M H;  1TWF B;  4GNX C;  4ZRZ A;  5C0X I;  1JE5 A;  3O13 A;  4DN4 M;  1CKN B;  4Y7N H;  2EXZ A;  5KNB A;  2JA8 G;  5FKA C;  1U4R A;  3I4N B;  3GTG B;  2KBN A;  1D7Q A;  1IBM L;  1LT3 D;  5LMN L;  1GJX A;  1DYQ A;  1UE6 A;  3U4Z A;  2YYZ A;  1Q8K A;  3M7N A;  3KK7 A;  3NSW A;  1SE3 A;  4R4Q A;  3OMG A;  1BDO A;  4H02 A;  4FP5 D;  4JOI C;  4DV0 L;  4J8Q A;  2NVT H;  1ZYR D;  4J1M A;  4C2M B;  4X64 L;  1JR0 D;  1TY2 A;  2F0K A;  3UDX A;  2UUC L;  1L2F A;  4ILW A;  3OTO Q;  4NDX A;  3GTP B;  2UUC Q;  3SEB A;  4OX9 L;  3OWF A;  3S24 A;  1LV9 A;  4FXG C;  3TZD A;  3MA2 B;  3NXW A;  3SHL A;  1KD1 C;  5EKL A;  3A5U A;  3I4L A;  3J7Y W;  2C9O A;  3NBH A;  3SK5 A;  1LLR D;  3NTI A;  3ONA B;  4APV A;  4DXF A;  3T1H Q;  2VS1 A;  1MI2 A;  2ASB A;  5E3F A;  2DY8 A;  1GUT A;  1K8A C;  2HD3 A;  4I65 A;  1S5F D;  2I5M X;  2K5N A;  2YTX A;  1EYC A;  1STY A;  3ICE A;  3A0J A;  2IHF A;  2JYO A;  1UE1 A;  3DWQ A;  3NTH A;  3EFX D;  3S1Q B;  1BCP B;  3S15 B;  2EDG A;  4JG2 A;  3MXP A;  3BDC A;  1A3T A;  1ZKO A;  2KQ3 A;  5C5L A;  5DLQ E;  3BDL A;  1EYG A;  4C1N K;  2WAQ G;  1HJP A;  1VCI A;  3OW7 A;  1M8A A;  2F0P A;  3ITP A;  4FVM A;  1HNX Q;  1N36 Q;  3MZ5 A;  4ID6 A;  4DV2 L;  1Q7Y C;  2OT2 A;  1WTV A;  4DV3 Q;  2E2I B;  1CM9 A;  4MNO A;  1IBK Q;  4GKK L;  2B63 H;  2R7Z G;  1EWC A;  4IOA A;  3TBI B;  3X3M A;  3PMF A;  3I72 A;  1NAP A;  3PIO 3;  3CCQ A;  1SMY D;  2NN6 H;  2LFN A;  1W6J A;  3NHH A;  4IFD H;  2X6G A;  1KAW A;  4Y7N B;  3PF5 A;  1Q1B A;  4G57 A;  1ET6 A;  2JEA I;  4M1U B;  2JA9 A;  4POF A;  1A2U A;  2EPB A;  5IWA L;  1STH A;  3HOX G;  1G29 1;  2VL6 A;  3I3C A;  3GD7 A;  2ATW A;  3Q23 A;  5NUC A;  3K0Y A;  4BXX G;  1SND A;  2GVA A;  3GDE A;  1S5D D;  1YJN A;  1DON A;  3EN2 A;  1IZ6 A;  5D3I B;  4IPC A;  5D65 A;  4JI4 L;  3FDT A;  2IT1 A;  1BBW A;  2B2V A;  3GV3 A;  2OQK A;  3OSO A;  2UXD L;  4O0A A;  1FR3 A;  3Q6S A;  3OW2 A;  1EZ6 A;  3MXG A;  4IN3 A;  3S1R B;  1A63 A;  4X3T A;  3GTO H;  1HNW Q;  5FK9 C;  1WD0 A;  4DR4 L;  4C3H B;  3TS0 A;  1I4X A;  1KDB A;  3TP7 A;  4ME3 A;  4B08 A;  1GD7 A;  3H3V H;  1Q1E A;  2BOS A;  1EEI D;  4G7Z C;  4DNR B;  1B8A A;  3HKS A;  4LF8 L;  1DOK A;  4C3J B;  5CBE E;  4POG A;  5H1S E;  4CDD C;  1K28 A;  4ALP A;  4GOP A;  4DR7 L;  1YJ9 A;  3NEL A;  1HTL D;  4DAM A;  1S3O A;  2NWG A;  4A3B G;  1AZP A;  4CGY B;  1A0I A;  4NXN L;  2EVB A;  1JB3 A;  4UP8 A;  1IXR A;  4F8M A;  5BN4 A;  4LF4 Q;  1UNS A;  2PW7 A;  2Z6K C;  5EJW A;  2SNM A;  4JI7 L;  2CQO A;  3BS1 A;  1FNW A;  3CQZ B;  3ER0 A;  3GTK H;  4L5T A;  4KN7 C;  3A7L A;  1LTG D;  4BXX H;  1QUQ B;  2F0T A;  1RKN A;  1S5E D;  5LL6 X;  3AU7 A;  4EQP A;  4RGN A;  5JJK A;  1HNZ Q;  1PTO D;  1IW7 C;  5JJL A;  1VQJ A;  2CWA A;  3RLO A;  2CW0 C;  2D5D A;  4KKS A;  2XWB B;  3L0O A;  2A1A A;  1P8L A;  4KHP L;  2EE1 A; 
#chains in the Genus database with same CATH homology
 1SRO A;  4A3J H;  1VQI A;  3JAM c;  3AQQ A;  2MO1 A;  2ZM6 Q;  1EIF A;  2E5L L;  3CC4 A;  3G48 A;  3T1H L;  2C35 B;  2R92 G;  2B3G A;  3CAM A;  3M4P A;  1XPR A;  2R93 G;  4K0K L;  3F1Z A;  3BU2 A;  4LF9 L;  3SGI A;  3S1M H;  4JI6 L;  1K0R A;  1YBY A;  3F2D A;  1AE2 A;  4DR2 Q;  4OX9 Q;  1NMF A;  1VQE A;  1T9H A;  3TQY A;  1MKH A;  2HQL A;  2CFM A;  4JI3 Q;  2KEN A;  3RLF A;  3ULP A;  1XNQ Q;  3KJP A;  3W5O A;  4OXP A;  4NXM L;  3PO2 H;  1N32 L;  4BY7 G;  1VQO A;  2EQS A;  4A3L H;  4A3K G;  3Q8D A;  3JAM i;  2PQA B;  1JJC B;  4B3M L;  2UUA L;  1IBK L;  4B3R Q;  4JI6 Q;  5ELN A;  1H95 A;  1EOV A;  1PFS A;  1YIJ A;  5LMU L;  1EUJ A;  2CCZ A;  3HKZ G;  4YCU A;  5IP7 H;  1PH4 A;  1Z47 A;  3I4M H;  4JI8 Q;  2YTV A;  4JYA Q;  1LUZ A;  3DM3 A;  3K7U C;  3UDI A;  5M3F H;  1EQQ A;  2OTJ A;  4DV3 L;  1JJ2 A;  4DV5 L;  1OXV A;  2E2J H;  2Q2T A;  1RL2 A;  3ULL A;  3F8T A;  3FHW A;  2UU9 Q;  3RR5 A;  2UXC Q;  2R6G A;  2I0Q A;  1SR3 A;  4X65 L;  3J81 c;  4DR4 Q;  5JEA J;  1ASZ A;  3BJU A;  5C4X G;  3PF4 A;  4DR3 Q;  1XNR Q;  2Q2U A;  2Y0S G;  5GAG C;  4GN3 B;  2VQE Q;  3KOJ A;  3MXN B;  2NVY H;  3TRZ A;  2KCT A;  4DR3 L;  1XNR L;  3K0X A;  4YWL A;  3GTP H;  4KHP Q;  2KHJ A;  1VQN A;  3G4S A;  3CCS A;  2I5H A;  4FDB A;  2QGQ A;  1N9W A;  3CCL A;  2N8N A;  3FKI H;  3GTJ H;  3CCE A;  5C0X J;  1VQM A;  1V9P A;  1LTL A;  2K52 A;  4DUZ Q;  2NN6 G;  3HOU H;  4A93 G;  2KCM A;  4LUO A;  4DV7 L;  4LWC A;  2K75 A;  1IBL Q;  3PO3 H;  2XTI A;  4OWX B;  2VW9 A;  2ZJR A;  2JA5 G;  4DR1 L;  1N33 Q;  4B3M Q;  3PIP A;  4IPG A;  3KJO A;  4JI7 Q;  4JI0 L;  5M3M H;  1TWC H;  2MNA A;  4IJH A;  2RHS B;  1SE8 A;  3K81 C;  3S1Q H;  1WJJ A;  2Q2H A;  4X6A H;  1IL2 A;  4GN5 A;  3RLN A;  2HIV A;  4AYB E;  4YWM A;  3HOY H;  1SRU A;  4YCW A;  5AJ3 L;  3I4N G;  3KDF B;  1EFW A;  4HJ9 A;  1A8V A;  4JI0 Q;  3L2P A;  3HOW H;  5C44 H;  1PA6 A;  3PUZ A;  3H0G G;  1B70 B;  4B3S L;  1G51 A;  2JE6 I;  3PUX A;  4DV2 Q;  4A75 A;  4IO9 A;  3F2C A;  4YHH L;  4TQU S;  2CKZ B;  3KDF A;  1L1O C;  1Y14 B;  1MJC A;  2IHE A;  2WB1 G;  2JA8 H;  2Z0S A;  4BBR H;  1YHB A;  1Z9F A;  2BH8 A;  1HH2 P;  1XMO Q;  4A3C H;  1Y1W G;  3KF6 A;  4A3C G;  2UUB L;  4JV5 L;  4IJL A;  5IYD H;  4BBR G;  1U0L A;  4JI2 Q;  4AQY Q;  2VQE L;  1CUK A;  2F3I A;  3G6E A;  1X9N A;  1PH8 A;  4BY1 H;  2IY5 B;  1PH2 A;  3AEV A;  1QZG A;  2IX1 A;  4A3E H;  2GVB A;  2HIX A;  5FJ8 H;  1TWF H;  1VQD A;  4DV6 L;  2UU9 L;  2UXC L;  4R4O A;  2F52 A;  3KF6 B;  1J5E Q;  1CKN A;  2K50 A;  2JK8 A;  3CD6 A;  1CKM A;  3H0G H;  4IFD I;  5JJI A;  5C44 G;  3S16 H;  3BZC A;  4C3H H;  3M9B A;  1KXL A;  1PH1 A;  2AMC B;  4GOP B;  4R4C A;  5IWA Q;  1KIX A;  4LF6 L;  1NJI C;  1EQR A;  1QVF A;  2NZH A;  3ULJ A;  3RN2 A;  4DV7 Q;  4LFB L;  4J15 A;  4HJ5 A;  1Y1W H;  4OWW B;  2R7F A;  1AH9 A;  2UUA Q;  5IYB G;  5FLM G;  1B7Y B;  3S1R H;  5GQO A;  5M3M G;  1D8L A;  2ZJP A;  4HID A;  4UP7 A;  5IYC H;  3UDG A;  1YNX A;  4QJF A;  1QVC A;  1JB7 A;  2JA5 H;  4GKK Q;  3OYY A;  3CC7 A;  3J80 i;  3U4V A;  3CP0 A;  2XGT A;  1QVG A;  4A3D G;  4K0K Q;  4JI3 L;  5IYB H;  4GNX B;  4PZ8 A;  1OXT A;  1I6H H;  1X3E A;  2YV5 A;  2OQ0 A;  3UDF A;  1VQ7 A;  3HOW G;  4UPA A;  3GTL H;  3PSI A;  3PV0 A;  5E7N A;  3J7A 5;  1E1O A;  3J7Z C;  4A3G H;  4LF9 Q;  5K36 G;  3CF5 A;  4A3G G;  4EQ5 A;  4OO1 I;  1I50 H;  2ZTC A;  3PUW A;  1CSQ A;  4MZ9 A;  2AHO B;  4PG3 A;  4YCV A;  4DUY L;  2Z6K A;  4JI5 L;  1XPO A;  1WOC A;  4A3F H;  4LUV A;  1VQL A;  4JI4 Q;  1NBW A;  1U5K A;  5ELO A;  3AYH B;  3UE0 A;  4A3D H;  1IYJ B;  4YY3 Q;  1Q81 C;  3DLL A;  2LXK A;  4JOI A;  2UUB Q;  2AKW B;  4JV5 Q;  3PO3 G;  1V1Q A;  1YEZ A;  5HGQ A;  2AWN A;  4DR6 L;  3F2B A;  1YIT A;  1NTG A;  2KHI A;  4B3S Q;  1OTC A;  3CC2 A;  1K83 H;  3CW2 C;  3H15 A;  4NPS A;  1HZB A;  5JEA G;  1GO3 E;  1I94 L;  1KRS A;  3FKI G;  2FXQ A;  4JBJ A;  3PCO B;  5LMU Q;  2NVQ H;  1R9T H;  3NEN A;  5BR8 Q;  1HZ9 A;  3EIV A;  1HR0 L;  5C3E H;  2N49 A;  1FJG L;  4LF5 L;  3S1N H;  2CWP A;  4LFC L;  2D0P A;  3MEF A;  1AE3 A;  4A3F G;  4HIM A;  4HJA A;  1K8G A;  3EBE A;  5AJ3 Q;  1VQ6 A;  5C3E G;  1PV4 A;  5C4X H;  2JQO A;  2EXD A;  1JMC A;  4NXM Q;  4LF4 L;  1W3S A;  1GM5 A;  4OON A;  4BY1 G;  1Q86 C;  3D0F A;  4DK6 C;  4DUZ L;  3I4N H;  3OTO L;  3S14 H;  4Y52 H;  1N36 L;  2GN5 A;  4O2D A;  4PZ7 A;  4DK3 C;  4R4I A;  2QEX A;  1HNX L;  5M3F G;  2E5L Q;  2VNU D;  1HZA A;  1KHI A;  4TVA B;  4RMF A;  1HR0 Q;  3CXC A;  1E7Z A;  2H5X A;  5BR8 L;  5IE8 A;  4L5Q A;  2NVX H;  1TWG H;  2R93 H;  2BH2 A;  4A76 A;  1IBM Q;  2JA6 G;  4DV4 L;  4A3B H;  1VQ5 A;  4UP9 A;  2ZJQ A;  1UWV A;  1VS0 A;  2PI2 A;  4KHZ A;  2F4V L;  1HNW L;  4YY3 L;  1UEB A;  2B29 A;  4LUZ A;  2E2I H;  1KRT A;  1C0A A;  1BBU A;  1W2B A;  1CKO A;  1PYS B;  4DUY Q;  5LMN Q;  4DV1 Q;  1E3P A;  4BY7 H;  3PUY A;  3A5Z B;  4HIK A;  1TWA H;  3JC6 6;  1XMO L;  1ASY A;  2NN6 I;  1HR0 W;  2ALY B;  1LYL A;  4DNI A;  1UE5 A;  3HOY G;  1C7Y A;  3FP9 A;  1X54 A;  1I3Q H;  3CPW A;  3HOZ G;  4WJ4 A;  2RCN A;  3NBH B;  4X66 Q;  3A74 A;  1UE7 A;  2N3S A;  3CQZ H;  4X62 L;  4L5S A;  1BVS A;  1V43 A;  3ZJY C;  1K73 C;  3STB D;  3T1Y L;  4P75 A;  4GKJ Q;  3D31 A;  3AFQ A;  1VQ8 A;  2K5H A;  2HHH Q;  2JA7 G;  3S2H H;  3S17 H;  3GO5 A;  3K8A A;  4KLK A;  5LMN W;  4JI8 L;  4JYA L;  2AWO A;  1TWH H;  1Q82 C;  3M4Q A;  1VQ9 A;  3GTG H;  3UE1 A;  1X56 A;  4JBW A;  4JBK A;  2K5V A;  1KQS A;  2N78 A;  4JCV E;  2RHQ B;  3AFP A;  2VQF L;  4A3M H;  4NXN Q;  5FLM H;  3HOU G;  4A93 H;  1YHA A;  2JJQ A;  2OWO A;  2RF4 A;  2K14 A;  5IY0 A;  4OO1 G;  3CPF A;  4LNQ A;  2DGY A;  4JI1 Q;  1VQP A;  1PYB A;  4P71 A;  4LFC Q;  5M5X H;  2YU9 H;  1FJG Q;  1YHQ A;  2ID0 A;  4QQB X;  4GN4 B;  4BBS G;  5M5W H;  5M5Y H;  4QY7 A;  3U58 A;  2HHH L;  2UXB L;  2ZTD A;  1L1O A;  3BZK A;  1N32 Q;  4IPD A;  3S15 H;  1EWI A;  1OXU A;  3CME A;  1OXX K;  2OCE A;  4A3I H;  1XMQ L;  4DAY B;  4A3K H;  1XPU A;  1X6O A;  4X62 Q;  3WWV A;  4LF8 Q;  4A3E G;  3PO2 G;  1QZH A;  1PH9 A;  1PH3 A;  4AYB G;  1S40 A;  2JEB I;  4C2M H;  3M4O H;  4JI5 Q;  2WB1 E;  4GNX C;  4HIO A;  5FLX c;  1J6Q A;  4LFA L;  5C0X I;  3I4O A;  2LSS A;  1JE5 A;  2B63 G;  1K3R A;  2VUM G;  5J3B A;  1CKN B;  1PHJ A;  2PNH A;  4Y7N H;  2A19 A;  3VDY A;  3GTM H;  2JA8 G;  3NEM A;  3L7Z C;  2OTL A;  2E2H H;  1HNZ L;  3TS2 A;  5IYC G;  1O7I A;  2KBN A;  2K4K A;  1D7Q A;  1S72 A;  1IBM L;  5LMN L;  4MTN A;  1UE6 A;  3STB C;  2YYZ A;  2Y0S E;  2WFW A;  1Q8K A;  1VQA A;  3U4Z A;  4AH6 A;  4UY8 C;  5IP9 G;  3M7N A;  4A3L G;  3KFU A;  2QA4 A;  4GOP C;  2UXB Q;  4R4Q A;  4JBM A;  1OXS C;  3RN5 A;  4GS3 A;  3LGJ A;  4H02 A;  5GAE C;  4JOI C;  1Q12 A;  4DV0 L;  2NVT H;  3M3Y H;  3I2Z A;  4X64 L;  3HFZ B;  3UDX A;  2E8G A;  1PH5 A;  3E9I A;  1WCM G;  2UUC L;  4IFD J;  1NMG A;  3M85 A;  4LF6 Q;  1L2F A;  1VQF A;  3OTO Q;  1E22 A;  5FJ8 G;  2UUC Q;  4DR2 L;  1GVP A;  1TXY A;  4OX9 L;  3S24 A;  1QUQ A;  1IBL L;  2PQA A;  1YZ6 A;  1L0W A;  4GKJ L;  1KD1 C;  3ERS X;  2DUD A;  3A5U A;  2WP8 J;  3CMA A;  1YVC A;  2R7D A;  5IYD G;  4APV A;  2WAQ E;  4JC0 A;  4QIW E;  3T1H Q;  1A62 A;  2L15 A;  1VQB A;  2VS1 A;  2ASB A;  4GNX A;  1C9O A;  1N8R C;  3J81 j;  4X64 Q;  3I55 A;  4WJ3 M;  4DR7 Q;  2BA1 A;  1K8A C;  3HKZ E;  1FGU A;  1WI5 A;  4DV0 Q;  4A4I A;  2I5M X;  2K5N A;  2YTX A;  3GTQ H;  2PI2 E;  3ICE A;  3A0J A;  1SMX A;  2IHF A;  4HJ8 A;  3I7F A;  4DKA C;  1UE1 A;  3PIO A;  5C4J H;  3W1B A;  4LW1 A;  4GLV B;  2ES2 A;  4LFA Q;  4JG2 A;  3PGZ A;  3W1G A;  2UXD Q;  1KC8 C;  2HT1 A;  1MJE A;  5DLQ E;  2D0O A;  1EYG A;  2WAQ G;  1HJP A;  1VCI A;  3K80 C;  1HNX Q;  1X65 A;  1EIY B;  3I4M G;  5IP7 G;  1N36 Q;  2V1C C;  3B6Y A;  4DV2 L;  1Q7Y C;  2MFI A;  4DV3 Q;  4MNO A;  4PMW A;  1N34 L;  2EIF A;  1IBK Q;  1M90 C;  4PZ6 A;  4GKK L;  2B63 H;  2R7Z G;  4IOA A;  3CCQ A;  1Y1V H;  2VY3 A;  1FL0 A;  1I5F A;  1SLJ A;  4JI1 L;  3CCR A;  4B3T L;  2MO0 A;  3PF5 A;  1KAW A;  4BA1 I;  2A8V A;  1Q1B A;  2Q2I A;  1NE3 A;  2I5L X;  1M1K C;  1FVI A;  4B3T Q;  2BA0 A;  4C3J H;  2JA9 A;  2JEA I;  1P16 A;  1Q46 A;  4IPH A;  4POF A;  5IWA L;  5EAY A;  3HOX G;  1I94 Q;  1JT8 A;  1G29 1;  2VL6 A;  1SFO H;  3GD7 A;  4LF7 L;  4GLA C;  4P73 A;  2ATW A;  3HOV G;  4OWT B;  5C0X G;  4LFB Q;  1E1T A;  1X55 A;  3HOX H;  4BA2 I;  1J5E L;  4L5R C;  4DR6 Q;  4BXX G;  1VQK A;  2GVA A;  4R1J A;  3GDE A;  2VQF Q;  1YJN A;  1CSP A;  3EN2 A;  1PH6 A;  1IZ6 A;  3IRB A;  2LXJ A;  1YI2 A;  4IPC A;  5IP9 H;  4AQY L;  4JI4 L;  1N34 Q;  2IT1 A;  1BBW A;  3T1Y Q;  2OQK A;  4A3J G;  2UXD L;  5GAD C;  1WFQ A;  4O0A A;  4QGU A;  2R7Z H;  3RZO H;  4DV6 Q;  3OW2 A;  4X66 L;  4GLX A;  2ZM6 L;  1LM0 A;  1X3F A;  4JI2 L;  1A63 A;  1WCM H;  1VQG A;  3H3V I;  3GTO H;  5GAH C;  2F4V Q;  2YTY A;  3CCJ A;  4X65 Q;  4DR4 L;  1HNW Q;  3HOV H;  4KI0 A;  3TEH B;  4YWK A;  3TRE A;  1HZC A;  5HY6 A;  4NB3 A;  3TS0 A;  3HOZ H;  4ME3 A;  4DV5 Q;  3S2D H;  1PH7 A;  1GD7 A;  3H3V H;  1Q1E A;  2IX0 A;  3J80 c;  4B3R L;  1GKH A;  1B8A A;  1VQH A;  3HKS A;  3RNU A;  4LF8 L;  4POG A;  5GRO A;  3CCM A;  1XMQ Q;  4EX5 A;  5H1S E;  4ALP A;  4GOP A;  4DR7 L;  3PUV A;  3CCV A;  1YJ9 A;  1YJW A;  1Y1V G;  3NEL A;  1XJV A;  4DAM A;  1S3O A;  3KF8 B;  1K9M C;  1NY4 A;  1XNQ L;  4BBS H;  3CCU A;  4LF7 Q;  4DR5 L;  4HJ7 A;  2JA6 H;  4A3B G;  1A0I A;  4NXN L;  3KYH C;  1WYD A;  4LF5 Q;  1VQ4 A;  2ZTE A;  4UP8 A;  4RG1 A;  4XTC S;  4DR5 Q;  4DR1 Q;  1N33 L;  1IXR A;  4QL5 A;  4LF4 Q;  4XIG S;  2VUM H;  5IT9 c;  2R92 H;  4DPG A;  4P74 A;  4A3M G;  3E0E A;  1E24 A;  2Z6K C;  3G71 A;  2MQH A;  4JI7 L;  1RIP A;  2CQO A;  1L1O B;  2VZA A;  3E9H A;  3KLW A;  3ER0 A;  2JA7 H;  1JJG A;  3GTK H;  2NZO A;  4L5T A;  1PVO A;  1G6P A;  4AIM A;  4BXX H;  1QUQ B;  1VQC A;  4A3I G;  1BKB A;  4P72 A;  1XTD A;  4C3I H;  1MIU A;  5JJK A;  1HNZ Q;  1X3G A;  5JJL A;  2PMZ E;  1VQJ A;  2CWA A;  3J81 i;  3RLO A;  3U50 C;  4IOC A;  3RZD H;  1KL9 A;  2D62 A;  4YHH Q;  3K7A H;  3L0O A;  4DV4 Q;  2A1A A;  4R4T A;  1P8L A;  1SN8 A;  4DV1 L;  4IFD G;  4KHP L;  3I56 A;  1DGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...