5C4XH

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
146
structure length
135
Chain Sequence
b'MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Transferase/rna/dna
total genus 17
structure length 135
sequence length 146
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5c4xH00
1HZBA 1FVIA 1VQGA 1HR0W 4POFA 3CQZH 1E22A 3AQQA 1VQPA 4HJ5A 3OW2A 2FXQA 2Q2TA 2ASBA 1XPUA 2LXJA 2WAQE 4L5TA 1MIUA 1P16A 2JA7H 4HIOA 4AIMA 3KDFB 1CKOA 1Y14B 4R4CA 4YHHQ 3S2DH 4JYAQ 4JI2L 5FLMH 5C3EH 1BBUA 3SGIA 3KJPA 4GLAC 4JBJA 3FP9A 2RHSB 5C44G 2XGTA 2JEBI 4BBSH 1C7YA 4DV4L 3FHWA 1XMOL 1OXXK 4OO1I 4LNQA 4POGA 2YV5A 4L5SA 1A63A 1OXTA 3PSIA 2R7FA 2Y0SE 5M5YH 5LMNQ 3ULJA 3AFQA 4IPHA 1UE5A 3D31A 3E0EA 5C0XG 2VQFL 1XJVA 4A3GG 2VS1A 3RZDH 2VQEQ 3M4QA 4R4QA 2QEXA 3PF4A 1YI2A 1GM5A 1EUJA 1PYSB 2XTIA 3KF6A 3PUXA 1VQMA 4LUVA 3AFPA 3JAMi 1SN8A 4X66L 4DV7Q 4IPGA 4BA1I 4JI5L 1PH7A 1MJEA 2NZOA 1YJNA 4BY7G 4LFBL 1V43A 2BH8A 5C4JH 1YIJA 4DAMA 1U5KA 1N33L 3M85A 4IPCA 4YWKA 3H3VI 1Y1WH 1TWAH 5AJ3L 3NELA 3KF6B 4KLKA 1E1TA 4LF7L 3BZKA 3JC66 1D7QA 4DUZL 1IBKL 5C0XI 4YCUA 3KJOA 4IFDG 3G71A 1VQJA 2N78A 4DV6Q 1GKHA 1T9HA 1VQEA 3KF8B 5C44H 1FGUA 1C0AA 1QZGA 2AKWB 3WWVA 4C2MH 3CW2C 4B3SL 4DV2L 3H3VH 3PO2H 4R4TA 1K83H 1NBWA 1I3QH 3RLOA 4YCWA 1YJWA 4O0AA 4XIGS 5IP7H 1JJCB 3JAMc 4NXNQ 3RZOH 2CKZB 4DK3C 2Q2UA 2ZJQA 3F1ZA 3J81i 2VNUD 3GDEA 4H02A 1HNZQ 4DV3L 4LF6L 3EIVA 4IFDI 4BY7H 4GNXC 4GNXA 4BY1H 4HJ7A 4HJ9A 4NB3A 1ASYA 3PO3G 4DR6Q 1Q1BA 4A3EH 1K9MC 1N32L 4DR5Q 1RIPA 3J7ZC 2A8VA 3GTQH 1E24A 3PUYA 1E3PA 3G48A 5HY6A 2UXCQ 1XMQL 1IBLL 4YCVA 1Q81C 3I4OA 4A3LH 1X54A 3CF5A 2Z0SA 3TRZA 1KC8C 3HOUH 3PGZA 3CC2A 1V1QA 1WOCA 1VS0A 4UP9A 1FJGL 2ZM6L 1SR3A 5JEAJ 2UXDQ 5IYDH 3HOWH 1HR0Q 3CC7A 2JA6H 1A62A 3B6YA 3I56A 2VZAA 3EN2A 4JI6L 2Z6KC 2Z6KA 5ELNA 4IJLA 1O7IA 4DR2L 1TWHH 1PH3A 4C3IH 1E7ZA 2NZHA 4B3TQ 4JI7L 4A3JG 3J81c 4BBRH 3K7AH 3T1HQ 1UEBA 1Z9FA 2E2IH 2WB1E 2ALYB 4KI0A 2NVQH 4GN3B 3CCLA 2AHOB 1EQRA 2K5NA 2I0QA 4WJ4A 3UDGA 1P8LA 1X56A 1K3RA 3PO3H 1OXVA 2QA4A 3F2CA 4LF4Q 4DUYQ 4OWXB 2JA7G 1NY4A 2JEAI 2K4KA 1X9NA 1Q8KA 1VCIA 2AWOA 1IXRA 2ZTDA 5DLQE 4YHHL 3EBEA 4JYAL 4GKJQ 4A3CH 3GTMH 2A19A 2N8NA 5FLMG 5C3EG 4IOAA 5EAYA 2N49A 4LWCA 1KIXA 1WJJA 4JOIA 4JOIC 2JQOA 1X3FA 4GOPA 4GOPC 1LYLA 4DV5Q 3M3YH 3ER0A 5LMNL 2H5XA 1NMFA 2HIXA 1EWIA 5J3BA 1I94Q 2R7ZG 2ZTEA 3STBC 3I4MH 4JC0A 5M5XH 1NMGA 2HIVA 2VQEL 2MNAA 1PYBA 1B7YB 1YZ6A 4B3MQ 3RN2A 3I4NG 2VY3A 4OX9Q 1VQ6A 4A93G 3KYHC 4DV7L 4OO1G 1KXLA 4GKKQ 1B70B 2KENA 3NENA 1C9OA 3OTOQ 3ERSX 4TVAB 2K14A 4JBWA 5IE8A 4OXPA 3CC4A 4K0KQ 1G291 4DR1Q 2F4VQ 1Y1WG 3GTPH 4O2DA 4UP7A 3T1YQ 1PH2A 1PH9A 1SE8A 4IOCA 3ULLA 3ULPA 3MXNB 1YNXA 4DV6L 1VQNA 2UXBQ 5C4XH 3CCVA 1JMCA 1EQQA 1GO3E 5H1SE 2CCZA 1LM0A 1Q82C 4A75A 3PV0A 2HHHQ 2N3SA 1VQOA 4IO9A 4YWLA 2UUAQ 1BBWA 2R7ZH 3PO2G 1KAWA 1XNQQ 1YVCA 3F2BA 1PFSA 4NXNL 3K8AA 5IP7G 1VQ7A 2I5HA 4GS3A 4PZ6A 3I4NH 1AE3A 2B29A 3NBHB 2CWPA 1K0RA 2F3IA 1S72A 3IRBA 3CCUA 4GLXA 1VQKA 4A93H 4JV5Q 2OTJA 4A3MH 4DR7Q 1CSPA 1WI5A 4BA2I 5BR8Q 2CQOA 1EIYB 4DR6L 4B3RQ 3M7NA 4BY1G 4DR5L 3J7A5 4LF8Q 1LUZA 4A3KH 4A3EG 4TQUS 2UXCL 1I6HH 2GN5A 3CXCA 3H15A 3PUVA 2WB1G 4NPSA 4XTCS 3TREA 1JJ2A 1CUKA 1NTGA 1OXUA 5LMUQ 2K5VA 2VUMH 4A3LG 3HOUG 2A1AA 3RLFA 4DR4Q 1ASZA 3BJUA 4P72A 4DR3Q 1XPOA 1U0LA 2UXDL 2CWAA 3DLLA 4APVA 1N8RC 1HR0L 5IYDG 4KHZA 3HOWG 1L1OC 1L1OA 1K8AC 2JA6G 1L0WA 4DV0Q 4AQYQ 1N36Q 1IL2A 3S14H 4B3TL 1Q86C 1VQDA 4X65Q 3E9IA 2JA5G 3STBD 1HZCA 3HKZE 1S3OA 3T1HL 1QVGA 1VQCA 4P75A 2E2HH 4BBRG 3PUZA 1JE5A 3E9HA 4QIWE 3LGJA 3HFZB 4BXXG 5JJIA 1L1OB 4A3BG 5GROA 4LFAQ 3CAMA 1Q1EA 4LFCQ 1YHQA 1X65A 2GVAA 3CPWA 1W2BA 4LF4L 4DUYL 1KL9A 2I5LX 4P73A 4AYBE 3CCQA 3TS2A 4WJ3M 1UE7A 4MTNA 4JI8Q 3UDFA 3HOVH 4GKJL 5ELOA 4JI4Q 2PI2A 2PNHA 2VW9A 1PH6A 3W5OA 3S1QH 5IYCH 4A3CG 3S24A 1SLJA 1SRUA 2BH2A 2R6GA 1W3SA 2UUCQ 1VQHA 3HOZH 2KHIA 1GVPA 3CCEA 2PQAA 2KBNA 3M9BA 4GNXB 2K75A 4DV5L 2WAQG 2OWOA 3S2HH 4QY7A 2L15A 2PMZE 3L2PA 1I94L 3F8TA 1IBMQ 3UDXA 4DKAC 2YU9H 3CCMA 2R93G 2I5MX 4A4IA 1EYGA 2JA8H 3I4MG 1PA6A 2JA5H 4J15A 2UU9Q 4B3ML 1MJCA 1NE3A 4OX9L 4PZ7A 5FJ8H 1YITA 5GAGC 4BXXH 2B63H 3UE1A 4GKKL 1HZAA 2D0PA 3K7UC 3OTOL 4LF5Q 5GAEC 4A3BH 1M90C 4RMFA 3FKIH 1XNRQ 2Y0SG 3GTKH 1VQIA 1I5FA 1Q46A 1UE6A 4GLVB 3MEFA 4JG2A 4K0KL 3TQYA 4DR1L 2F4VL 4YY3Q 3OYYA 3RNUA 1E1OA 2WP8J 3T1YL 2IX0A 4LUZA 3ZJYC 5IP9G 1OTCA 2UUBQ 2JE6I 3TEHB 2YTVA 2EXDA 1AE2A 2YYZA 2UXBL 1TWFH 4JI1Q 1Q12A 1X3EA 2VL6A 2R92G 5C4XG 2GVBA 4A3IH 4JI3Q 2HHHL 4JBKA 2LSSA 1L2FA 2UUAL 1VQ8A 2MQHA 3UE0A 2JJQA 3GO5A 1VQ4A 2R93H 1LTLA 4Y7NH 2HQLA 2CFMA 2BA0A 3KOJA 3W1GA 1XNQL 2EQSA 3PUWA 1PV4A 3H0GH 4LF6Q 5C0XJ 4NXMQ 4P71A 2OTLA 2Q2HA 1QZHA 1PH1A 2ID0A 4A76A 4JV5L 1S40A 2B3GA 4DR7L 1PVOA 2C35B 4GOPB 4B3RL 1HZ9A 5BR8L 2OCEA 1X6OA 2MFIA 2ZJRA 3CCRA 4A3MG 2E5LQ 2IY5B 4LF8L 1G51A 5GADC 3VDYA 4ALPA 1M1KC 1VQ9A 1HNWQ 2DGYA 4A3KG 1JB7A 3HOYH 1A8VA 3A0JA 5JEAG 5IWAQ 2OQ0A 4YWMA 5FLXc 4GN5A 2IHEA 3TS0A 5LMUL 1TXYA 1BKBA 5IP9H 4DAYB 1D8LA 2RHQB 2AWNA 1YJ9A 1V9PA 4DR3L 2VUMG 1G6PA 3KLWA 3UDIA 3HOXH 4A3DH 1N9WA 1BVSA 1EIFA 2K52A 4IFDJ 2R92H 3KFUA 2KCTA 3S1MH 4DNIA 1HJPA 3A5ZB 4DV0L 3KDFA 4RG1A 4DV1Q 3J80i 4AQYL 1N36L 4Y52H 1FL0A 3A74A 1QUQA 3L7ZC 5HGQA 4X65L 4IPDA 1N34Q 1VQLA 3K0XA 3GTJH 1J5EQ 3CPFA 3PCOB 3CCJA 2PI2E 4LFAL 2HT1A 4LFCL 4GN4B 1TWCH 1HNZL 2YTXA 1UE1A 1QUQB 1XTDA 2JK8A 2ZTCA 4C3HH 3I55A 1PH8A 4LF9Q 1K8GA 4JI8L 4LUOA 5IYBH 1HNXQ 4JI4L 2D0OA 3ICEA 3HOVG 4UP8A 4OONA 4PMWA 1EOVA 1Z47A 4IJHA 4KHPQ 1WCMH 2V1CC 3L0OA 5IYCG 1JJGA 4R4OA 1DGSA 4C3JH 1CKMA 2UUCL 3S17H 3RLNA 4FDBA 3DM3A 4X62Q 3HOZG 1KRTA 3G4SA 5GAHC 3J80c 3A5UA 4EQ5A 1IBML 1TWGH 1YBYA 2K50A 3G6EA 4PZ8A 4X64Q 1IZ6A 1R9TH 4JI0Q 2JA8G 3S15H 4HIMA 2UU9L 1WYDA 2E2JH 1CKNA 1SROA 1VQBA 2KCMA 5FJ8G 2D62A 3U4VA 5M3MG 4UPAA 4JBMA 4LF5L 2B63G 2F52A 2BA1A 3W1BA 1K73C 3AYHB 1XPRA 1XNRL 1VQAA 3J81j 1CSQA 1YHBA 3FKIG 3U50C 3PIOA 3F2DA 1IYJB 4AH6A 4JI2Q 2JA9A 4YY3L 2NVXH 2ATWA 1CKNB 5JJKA 3S1RH 2UUBL 5IT9c 3RR5A 1MKHA 2KHJA 1EFWA 1Y1VG 4DV4Q 1KHIA 4A3FG 1XMOQ 1QVFA 5M5WH 4JI1L 2LXKA 3NEMA 1I50H 4JI3L 4QL5A 4A3IG 4A3GH 1X3GA 1Q7YC 2VQFQ 3I7FA 3M4PA 1NJIC 1J6QA 4LW1A 4NXML 4X66Q 4OWWB 3H0GG 3CD6A 4JI5Q 1SMXA 5LMNW 4LFBQ 3CP0A 2IT1A 2PQAB 2R7DA 5M3MH 3S1NH 1QVCA 4DK6C 1H95A 4R4IA 2E5LL 3U58A 3PIPA 1N33Q 3BU2A 2RCNA 1UWVA 2NVYH 2K5HA 5AJ3Q 1HNWL 3K80C 3CMEA 5IWAL 1VQ5A 4LF7Q 3HOYG 1OXSC 4DUZQ 1IBKQ 2WFWA 3GTGH 2NN6G 4EX5A 2E8GA 2IHFA 1YEZA 3PF5A 3D0FA 1Y1VH 2ZJPA 4A3FH 1PH4A 3GD7A 4B3SQ 3HOXG 4DV2Q 2EIFA 1VQFA 4A3DG 4DV1L 2YTYA 2IX1A 4QJFA 4HJ8A 4MNOA 4QQBX 3U4ZA 5M3FG 1N34L 4R1JA 2Q2IA 1KQSA 4DPGA 1AH9A 4PG3A 2OQKA 1PH5A 1J5EL 4OWTB 4UY8C 4DV3Q 1JT8A 3AEVA 1HH2P 1WFQA 2NN6I 3RN5A 4P74A 5GQOA 2NVTH 1N32Q 2RF4A 4MZ9A 4LF9L 1GD7A 2MO1A 5K36G 3M4OH 4JCVE 1XMQQ 1IBLQ 1A0IA 2MO0A 1KRSA 1X55A 3I2ZA 3Q8DA 1HNXL 3S16H 1YHAA 4HIDA 5IYBG 3HKZG 5E7NA 4KHPL 5IY0A 1FJGQ 4BBSG 2ZM6Q 1WCMG 4DR4L 1B8AA 2ES2A 4X62L 5JJLA 3GTLH 4HIKA 1RL2A 2DUDA 4JI6Q 4QGUA 4HJAA 4X6AH 4ME3A 4AYBG 1SFOH 1PHJA 3CMAA 4X64L 4DR2Q 3K81C 4A3JH 4JI0L 2QGQA 4JI7Q 3GTOH 3CCSA 2AMCB 4L5QA 4L5RC 5M3FH 3BZCA 1KD1C 3HKSA
chains in the Genus database with same CATH superfamily
3EVQA 1VQGA 1YNNC 3DWPA 3MXNA 2M00A 4POFA 5E3FA 3CQZH 3HRZC 2PZTA 2Q2TA 2F0MA 2PYKA 3SVMA 4RCNA 3SK6A 2OEOA 3KDFB 3RZOB 1Y14B 2L55A 1C48A 4R4CA 2OXPA 1G2TA 5C3EH 3SGIA 4GLAC 4CJ1B 1HUMA 2RHSB 3A7AB 5EJWA 5I2YA 4DV4L 4A3EB 1XMOL 4POGA 1A63A 2JN4A 5FK9C 2MJ8A 3PSIA 2R7FA 2FJ2A 3ULJA 3AFQA 3J80E 1I4HA 2VS1A 2VQEQ 1SYDA 1CQFA 2XTIA 3PUXA 1GUGA 3X3MA 4FYDA 1I4QA 3JAMi 5I6YA 4DV7Q 3Q24A 4BY7G 2NZOA 1YJNA 5FO9B 5C4JH 1N33L 1U5KA 3I8ZA 4IPCA 4YWKA 3H3VI 1Y1WH 1LV9A 2NTSA 3JC66 1JE4A 4IFDG 1VQJA 1JQYD 1VQEA 4EQOA 2AKWB 1JICA 5C5MA 2EJMA 3H3VH 1FR3A 1K83H 2PNRC 1YJWA 4O0AA 4XIGS 3QB3A 2XN9C 3AMUA 3O13A 3VA7A 2Q2UA 1TQOA 3J81i 3CU7A 3GDEA 4H02A 4DV3L 1HNZQ 4LF6L 3EIVA 1A3UA 5CV9A 4BY7H 4IFDI 4GNXA 3GQBA 4BY1H 4TRDA 3PO3G 2HCCA 1Q1BA 3GTQH 4M8AA 1E3PA 1Q81C 3SK8A 4NMZA 1AP0A 4ODGA 3HOUH 1SNPA 3VYTA 2AUKA 3PGZA 3DEOA 1VS0A 2ENBA 1FJGL 2ZM6L 1ET9A 3CC7A 1LO5D 4FF2A 2F0SA 2DNCA 2Z6KA 2H4OA 2ICEC 3W3AA 1O7IA 1TWHH 1PH3A 4B3TQ 2I07B 1G2SA 3SR1A 5C4XB 1R4QB 1Z9FA 4KI0A 4MIUA 1E0BA 2L0CA 2I0QA 2K5NA 5EGTA 3UDGA 1WD0A 3PO3H 5CORA 3MFYA 4YHHL 4JYAL 2A68D 5DM63 2BOSA 4A3MB 4FXDA 5CV8A 5EAYA 4LWCA 4JOIC 1D5ZC 4A3KB 1LYLA 2JXMB 3M3YH 5LMNL 3HG9A 2PZUA 2ZTEA 3STBC 3C2PA 1NMGA 1PRTD 2EY6A 1YZ6A 1B7YB 3MHBA 3FMCA 1VQ6A 1CA6A 3MXGA 2F0IA 2KENA 1K3BC 3MAQA 3ERSX 2PQEA 1PYWD 2WACA 1QILA 1FNVA 1BUVT 4O2DA 2EXZA 1STEA 3ULLA 4IOCA 3J7YW 3CCVA 1KTKA 1QCBD 4A75A 4K2KA 1JWMD 2N3SA 4YWLA 4FXKC 1KAWA 1DCZA 2F3WA 1YVCA 4NXNL 5IP7G 1WVLA 2I5HA 4GS3A 3NBHB 2CWPA 1A3VA 4R9WA 3IRBA 1VQKA 1VF7A 4JV5Q 3D4WA 4K8IA 3MWYW 2KA7A 1NSNS 4DR6L 4CKBA 4DR5L 4LF8Q 3IKJA 1JWSD 4A3EG 4TQUS 1I6HH 1RF2D 1M8AA 4RGMA 3A8JE 3PUVA 2WB1G 4NPSA 4XTCS 3TREA 1J8IA 3ITPA 1NTGA 2B63B 3BS1A 3BYTB 4KN7C 4M1UB 3BJUA 2MHVA 1U0LA 2B8GA 4KN4C 5CV5A 1GJXA 2BE5C 4H0LC 4KHZA 3NTHA 1K8AC 3A54A 4DV0Q 2RKSA 2EY1A 1N36Q 4KJOA 3PIP3 1PXUA 1JR0D 2L1BA 2TMPA 2JA5G 1HZCA 2FMCA 1KNEA 3T1HL 1QVGA 1JE5A 3E9HA 3LGJA 3HFZB 5JJIA 3E3XA 1W6JA 1Q1EA 1YHQA 1EY8A 4Y7NB 4DUYL 1KL9A 3CCQA 4WJ3M 4X3SA 3UDFA 4J1MA 3HOVH 5ELOA 4JI4Q 2VW9A 1U4MA 3S1QH 4KY5A 3S24A 3NPPA 3HOZH 4CDDC 1GVPA 2PQAA 1SDFA 2R93G 5LL6X 1PA6A 4J15A 2JA5H 2UU9Q 1F9PA 1WTXA 1MJCA 1NE3A 4A3DB 3MXUA 3S1MB 2G9DA 3P20A 3UE1A 2SDFA 3K7UC 2F0PA 4K8JA 1O80A 3VR4A 3QG1A 4GLVB 2F4VL 3GTJB 4YY3Q 5E1FA 3T1YL 3ONAB 1F9SA 4LUZA 5IP9G 1BCPC 1SAPA 2UUBQ 2B2TA 1X3EA 5C4XG 2GVBA 2JJQA 1VQ4A 2R93H 1WCMB 4IUVA 1ZEQX 1XNQL 1PFNA 5EPKA 3AB9A 2EQSA 4HEDA 4YIJA 1FD7D 3BDCA 5C0XJ 2OTLA 2B2UC 4A76A 1PMRA 1TWGB 4GOPB 4B3RL 1HZ9A 4DU9A 4CGYB 4A3MG 1TS2A 1R9TB 3VDYA 1WTPA 4A3KG 5KNDA 1GUOA 5IWAQ 1GUWA 1SE3A 2NN6H 1BKBA 1EIGA 4B08A 5IP9H 1EYAA 2PMZB 2RHQB 1V9PA 3UDIA 3K57A 1BVSA 2CVRA 1EEID 3L7ZC 5HGQA 1KNAA 1XXGA 1SNQA 4RFBA 1VQLA 3I72A 4X3UA 4IUNA 3K0XA 2B2VC 5M5WB 1PZKD 2EE1A 1S5ED 3PCOB 2PI2E 4A3GB 1ENAA 4LFCL 4GN4B 1HNZL 4K2LA 4QB4A 2ZTCA 5IGEA 5IYBH 4CDFC 4KHPQ 2HUGA 1TIID 3L0OA 5M3MB 1CKMA 1CQVA 3HEJA 3G4SA 1Y8PB 1Y8OB 3P1HA 1O78A 1SJED 3QJYA 3R2TA 2CH4W 4PZ8A 5I6WA 1CTMA 4HIMA 1Y1VB 3BG3A 3T13A 2Z8LA 4UPAA 4LF5L 1U4RA 2B63G 2BA1A 3WOEA 5IOCA 3AYHB 1VQAA 2EYOA 3U50C 3KUPA 3PIOA 2C5CA 1GUTA 3DHQA 1H9RA 3DWQA 4Z9CB 2KHJA 1Y69U 1EFWA 4DV4Q 1XMOQ 1GHJA 4JI1L 1STAA 3TZDA 1I50H 3OIQA 5ELFA 3LX0A 1QNUA 3I7FA 1HA5A 1EFID 1NJIC 4NXML 3GTLB 2TSSA 2KECA 4OWWB 2KQ3A 3NUCA 4EQPA 1V8QA 4OHJA 2E5LL 3U58A 1N33Q 3BU2A 2RCNA 1UWVA 4MHEA 4KKUA 4O1NA 1HNWL 4G57A 5D3IB 1VQ5A 1BQQT 1ENCA 3CQZB 3HP3A 1KDAA 3A56A 1XYIA 4RHRA 3LWUA 1ZXTA 2IHFA 5KGUA 1GHKA 4CKEA 2ZJPA 3GTPB 4A3DG 2EIFA 5C3EB 1HTPA 5M3FG 1F2YA 4R1JA 4DPGA 1NCVA 3CRLC 3I4LA 1AH9A 2OQKA 1SSOA 4UY8C 4DV3Q 4C1NI 1HH2P 5T1IA 1WTWA 3NSWA 4MZ9A 1I4XA 3I4NB 2KJXA 1GD7A 1O7YA 1WTHA 1A0IA 3I2ZA 3KBGA 3S16H 1S5BD 5E7NA 4H44C 4DGZA 1FJGQ 5C4JB 2ZM6Q 1WCMG 2QDLA 1ONLA 1B8AA 5JJLA 3MTSA 1Y1WB 4H13C 1RL2A 4QGUA 4X6AH 5CYUA 2K05A 3K81C 4A3JH 3MC0B 4UAIA 3P7JA 3CCSA 3KK7A 1WTQA 4L5RC 5M3FH 3BZCA 3HKSA 1LLRD 1SXTA 1DM0B 3S9WA 1E22A 4HJ5A 1XPUA 1K83B 5CR3A 2LXJA 3VR6A 5T1GA 1MIUA 2CHBD 5LHY1 4YHHQ 3NHHA 4JYAQ 4JI2L 5EKKA 2HCIA 4QMGA 3KJPA 4UDUC 4BY7B 1TS3A 1DD2A 4BY1B 5C44G 2KVMA 2JEBI 4R8IA 1B3AA 1C7YA 4LNQA 2KCCA 3GTQB 4L5SA 2WKDA 5LMNQ 5M5YH 5C5LA 3MFGA 1KDBA 3HOUB 3D31A 3E0EA 4A3GG 3RZDH 2NUCA 1B9NA 3M4QA 3PF4A 4LUVA 5CMDA 1HFGA 3QOLA 5CGKA 4BA1I 1PH7A 4LFBL 2BH8A 1TWHB 1AZPA 2A68C 1TWAH 1PTOH 1AEXA 1IBKL 4DNTB 3KJOA 3A7LA 3FRPB 2XWBB 1V1PA 4Q5VA 3PO3B 5C44H 1FGUA 3CW2C 3FEWX 1HXYD 4DV2L 4QUFA 2HQEA 3PO2H 5EPLA 1NBWA 1I3QH 2DN8A 1PRTC 2XSCA 4NP5A 3JAMc 4NXNQ 1LTGD 2CKZB 4DK3C 3G6JB 2PPBC 2WAQB 3V96A 1SYCA 3F1ZA 4OGQC 2F0HA 3M3YB 3TSSA 5EKIA 2K5QA 4DR6Q 4HJ9A 1ASYA 4DR5Q 3HGBA 1E24A 1IBLL 4YCVA 3I4OA 3DUZA 5KRUA 3CF5A 3I3CA 1KC8C 1V1QA 2FFKB 1Q90A 4UP9A 1FGBD 4XYOA 3TBIB 2Y0SB 1SR3A 5JEAJ 5IYDH 3HOWH 2JA6H 1A62A 1BXTA 3K58A 3I56A 2VZAA 1LT4D 4WFN3 2NZHA 4F87A 1ESFA 3J81c 2K04A 3T1HQ 3BZDB 3M4YA 2LKVA 2L9HA 4GN3B 3CCLA 4WJ4A 2EVBA 2EY5A 1K3RA 1X56A 3F2CA 1I6VC 4DUYQ 1K8OA 4OWXB 4Y52H 2JEAI 2K4KA 5DLQE 2AWOA 4RHSA 4DXGA 2K1BA 3T4AC 2A19A 2N8NA 4HTHA 5C3EG 4IOAA 4PNYA 1KIXA 3FPPA 1STGA 4JOIA 4OELB 5KNCA 1X3FA 1I6HB 2H5XA 4RKLA 1G8ZD 4JC0A 2HIVA 3I4NG 3RN2A 1CT1D 3NQIA 2E2DC 2AQ3B 5JPNC 1B70B 3NENA 5DEHA 2CQAA 3C46A 5JAVA 4JBWA 2A6ED 3CC4A 1G291 1PTOF 1UAPA 2F0FA 1Y1WG 2F4VQ 3GTPH 4HN7A 2IWHA 2KHSA 3L9AX 3T1YQ 1PH2A 5FO8B 3NWSA 1PH9A 3MXNB 2L12A 1VQNA 1Q8IA 4S3SA 5H1SE 1V1OA 3PV0A 3HOVB 5ELEA 4FP5D 3MA2B 1BBWA 1ML0D 4HCEA 2WB1B 3I90A 1F77A 4IALA 3S1QB 3PIO3 5FO7B 1XNQQ 3R93A 3HOZB 5CC4A 2A73B 3I4NH 1AE3A 1QG7A 2EYHA 1S72A 2OTJA 4CHTB 4GLXA 4B3RQ 2CQOA 2HDMA 1EIYB 2EJGC 4BY1G 1SNDA 1CM9A 2JA5B 2SOBA 5JEAH 1CFMA 1F9QA 1SBBB 3BDLA 3H15A 1CUKA 2K5VA 1WD1A 3HOUG 2A1AA 3RLFA 1HUNA 2UXDL 2CWAA 1N8RC 5G3LF 3OPOA 1TVXA 1B2TA 3RMHA 1Q86C 1B50A 3E9IA 1HRJA 3NK9A 4CDCC 4F88A 2RCFA 3OSOA 5BN4A 1STHA 1VQCA 3PUZA 5AFWA 3JAME 4A3BG 5GROA 4LFCQ 1K0SA 2R93B 3CPWA 1W2BA 3TS2A 1D5XC 4MTNA 2PNHA 3W5OA 5IYCH 1SRUA 1UNSA 1VQHA 2R61A 2K6AA 2H1EA 2KHIA 3CCEA 2KBNA 4MN3A 4GNXB 2OWOA 2WAQG 2L15A 2PMZE 3L2PA 1I94L 4KY6A 3UDXA 2YU9H 4A4IA 1EYGA 2JA8H 1S5CD 3SK4A 1B1ZA 4DA2A 4RGTA 4OX9L 3J81E 5FJ8H 1YNJD 2Z1CA 1JCKB 4LF5Q 4A3BH 5GAEC 2RBMA 4HMJA 3Q22A 2D2CC 3GP7A 2Q8RE 2Z4HA 2Y0SG 3FKIH 2EYFA 3K5NA 1I5FA 1UE6A 2ZXPA 5I9OA 4K0KL 5K5PA 4DR1L 2DJGC 3LNNA 1E1OA 2NTTA 2JE6I 3TEHB 2EXDA 2YYZA 2UXBL 2KCNA 1PFBA 1TWFH 4JI1Q 2VL6A 1KLUD 3TN2A 2UUAL 2MQHA 1HQMC 4LJZC 2RDFA 3FVQA 4NXMQ 3DMUA 5I4DA 2B2UA 1QE6A 1S40A 5BR8L 3CCRA 2MFIA 2E5LQ 1G51A 4XT1B 1LTAD 4B9XA 1HNWQ 2DGYA 4DK1A 4LAAA 4FO2A 3HOYH 3NE5B 5EQ0A 5FLXE 3TS0A 5LMUL 1TXYA 4C3JG 2AWNA 1TKWB 1S5FD 4DR3L 3HOXH 1N9WA 1OO9B 3CHBD 4DNIA 4AQYL 4RG1A 4PV1C 5C3WA 1W6KA 5BN3A 3U9OA 5IGCA 2B2VA 2LMCB 1STYA 3CPFA 3QR8A 4DFAA 1I50B 3CCJA 4LFAL 1LTRD 2HT1A 1TWCH 1RD9D 2JK8A 1PH8A 2ZT9C 1K8GA 4JVZA 3HOVG 2F0JA 4PMWA 2F0OA 3WDNA 3TMEA 1IYVA 2V1CC 1D6EC 4R4OA 4C3JH 2UUCL 3RLNA 2XVSA 3K0YA 5J1ZA 3HOZG 1KRTA 1IBML 1YBYA 1TT2A 1DXMA 1HPCA 2EY2A 3U9SA 5FOBB 1EU3A 2E2JH 1CKNA 1SROA 1VQBA 3KF8A 1DYQA 1U9RA 3J80L 2XRQD 3SE0A 3W1BA 1XNRL 1EWHA 1EU4A 3KLSA 4AH6A 4LMQD 4JI2Q 2R3ZA 1RKNA 2NVXH 2ATWA 1CKNB 2M9VA 5IT9c 5M9OA 1NUCA 2F3VA 4A3FG 1D1KA 4QL5A 3S16B 1SNCA 1IKLA 2J4XA 4LW1A 1F2ZA 2F0KA 5EPJA 2WINB 1XTCD 1SMXA 4LFBQ 2SNSA 2R7DA 2PQAB 3OW7A 5DM73 3S1NH 4DK6C 4A3JB 2X69A 1SEBD 1ET6A 2E75C 2NVYH 5M3FB 2K5HA 2XRSD 3Q0AA 3C1FA 3K80C 4N9PA 2WV6D 2O5JC 1OXSC 1IBKQ 4ZKBB 3IAYA 3BYYB 4KJNA 4DN4M 2A74C 2NN6G 2E8GA 4A3FH 3OMGA 4DV2Q 1VQFA 4WORA 1F2MA 2D9UA 1E2VA 4DV1L 5EBCA 3IFTA 4QQBX 5DNFA 3VR2A 1N34L 2VXWA 4IUTA 4G4KA 4K14A 1LACA 4PG3A 2B39A 4RH6A 1J5EL 4OWTB 4KKSA 5M5YB 1CI3M 5ISRA 1WFQA 2BDNA 2NN6I 2K5DA 4P74A 1DJRD 3J81L 3RZDB 1IBLQ 1X55A 1HNXL 4HIDA 5IYBG 3HS0C 4BBSG 1PFMA 4X62L 5KYIA 4CDEC 5JOBA 5CV7A 1TWAB 2DUDA 5HGTA 1R4PB 2XWJB 4HJAA 4DK0A 1PTOB 1ZYRC 2QW7A 3CMAA 4DAPA 4ILWA 2IW3A 2AMCB 4L5QA 1QJOA 1HFNA 5C44B 4ZRZA 1CHQD 3X3NA 1HZBA 1FVIA 4XQNA 1HR0W 1VQPA 2ASBA 5JVG3 3PO2B 3OW2A 2FXQA 1I3QB 2WAQE 4B9WA 1P16A 2JA7H 1CKOA 5FLMH 3FP9A 1SYGA 3F2UA 4PMCA 2E74C 5E4XA 2K28A 2XGTA 1BBXC 4BBSH 3FHWA 1OXXK 1SYEA 4OO1I 2YV5A 4IN3A 2Y0SE 2VQFL 1XJVA 5C0XG 1CHPD 2QEXA 4R8NA 1GM5A 3NXWA 1VQMA 1PYSB 3HOWB 2JA6B 4OO1H 4X3KA 2NWGA 3AFPA 4XDXA 1SN8A 3ERQA 4IPGA 1MJEA 3ND8A 3K59A 2Z4IA 2L5TA 4K6DA 5ELBA 3M85A 5CBEE 5AJ3L 1G6ZA 4KLKA 1E1TA 1CA5A 4LF7L 3BZKA 4DUZL 5C0XI 2RSOA 4YCUA 1FNWA 3RD4A 1SE4A 1PZID 1EOTA 4RKBA 3G71A 2HD3A 1ICWA 1T9HA 4OEMB 5A2QE 1C0AA 3SK5A 5IT9E 1JC7A 4B3SL 4ZYSA 1SYFA 4R4TA 3RLOA 4KK7A 5C0XH 1IKMA 2VNUD 1IW7C 5L37A 2CW0D 1DOKA 3MEHA 1C8CA 4HJ7A 4NB3A 4HMIA 1K9MC 1N32L 2A6EC 1J9OA 1RIPA 3J7ZC 2F0NA 2WIIB 5TSSA 3G48A 1VMPA 3KBXA 4A3LH 5KNBA 1DONA 4RWSC 2UXDQ 5KIXA 3IFDA 1LTID 2F0TA 4LK1C 4ZUJA 1JORA 1SNOA 3EN2A 4JI6L 3MZ5A 3E0JA 1HHVA 4DR2L 4C3IH 1I4GA 4JI7L 3EROA 1BOSA 5BN5A 4A3JG 4BBRH 3K7AH 1UEBA 2E2IH 2AQ1B 2WB1E 3A8KE 2ALYB 2NVQH 2DNEA 2O5IC 5C6AA 1PLFA 2AHOB 1EQRA 1P8LA 2GA4B 3I70A 1OXVA 2QA4A 4CBVA 1PZJD 1VCIA 2ZTDA 2QF7A 4A3CH 3GTMH 1LT6D 2DJFC 2OF1A 2EZVA 1KLGD 2B8FA 2N49A 2XNAC 1SMYD 2JQOA 1BCPF 4GOPC 1CZWA 5ELDA 1XWEA 4EQNA 3ER0A 1NMFA 2HIXA 1I94Q 2R7ZG 3D6CA 4F8MA 3BDOA 3I4MH 5M5XH 2MNAA 2VY3A 2SNMA 4OX9Q 1AW7A 3KYHC 1GXDC 4N9TA 1KXLA 2M2LA 1MSHA 1A2UA 4DXFA 4RGNA 4TVAB 2DY7A 2K14A 5IE8A 3I73A 4K0KQ 4DR1Q 3N52A 3PQIA 1EWCA 2PW5A 4UP7A 3EA6A 4OIKA 3ULPA 4DV6L 2UXBQ 1EQQA 1GO3E 1Q82C 2RDGA 4IO9A 2UUAQ 4JPBW 4EVOA 2R7ZH 3PO2G 2HDLA 2A69C 1QWYA 1PFSA 3K8AA 1VQ7A 1K8MA 1YNJC 1K0RA 2F3IA 2F03A 1STBA 5NUCA 1Z6HA 1CSPA 2YU9B 4BA2I 2MPMA 5BR8Q 2JA8B 1UUPA 4ZQ3A 3J7A5 4RCOA 1LUZA 2K7VA 2UXCL 2K32A 3D6WA 2GN5A 4XT3B 5IGBA 4F7XA 4N8FA 2O2LD 1NR4A 4DR4Q 1OXUA 5LMUQ 2VUMH 4A3BB 2PW7A 4HCSA 4DR3Q 4P72A 3FKIB 3DLLA 4APVA 1HR0L 5IYDG 3HOWG 1L1OC 3H94A 2JA6G 1EIHA 1L0WA 4N8X1 5HURA 4AQYQ 3GTGB 1IL2A 3S14H 1A3TA 1SNMA 2KEEA 4J8QA 1ZYRD 1TWFB 3NWTA 2L11A 2E2HH 2F0EA 2E76C 1V1PB 4LFAQ 4LF4L 3V2TA 1EY5A 2FINB 2EDGA 1UE7A 5FKAC 4GKJL 2PI2A 2EPBA 2RDHA 2QEJC 2BH2A 4ZUIA 4ZK9B 2UUCQ 3M4OB 5IGDA 4L6TB 2WKCA 4K5XA 4DV5L 5EKLA 3S2HH 4QY7A 1IBMQ 1RDPD 3HOYB 4G7OC 3F8TA 3AU7A 4DKAC 2I5MX 4OL7A 1B53A 4B3ML 4RAUC 3HOXB 3A55A 1HTLD 4PZ7A 4IQZA 4GKKL 1HZAA 3OTOL 3VYRA 4NW2A 1XNRQ 3GTKH 1Q46A 3MEFA 1LABA 4JG2A 2IL8A 2CH4A 3D4RA 5CV4A 1OTCA 4WJWA 2F4IA 4JW0A 1TWCB 1AE2A 1NNXA 5JVH3 1EL0A 1CZGA 3VR3A 1Q12A 2R92G 3NQTA 4A3IH 2HHHL 2LSSA 1L2FA 3HKZB 5F2DA 4G7ZC 3UE0A 3OOCA 4QIWB 2HQLA 2CFMA 3KOJA 3W1GA 4C3JB 3PUWA 3H0GH 4P71A 4AYBB 3L3OC 4K5VA 2B3GA 4DR7L 1PVOA 2C35B 2OCEA 2ZJRA 2IY5B 1IW7D 4ALPA 1TR5A 4ID6A 1M1KC 1VQ9A 1S5DD 2E2JB 3A0JA 3M7GA 5JEAG 5FLXc 1G6PA 1D8LA 2QDBA 1YJ9A 5CBAE 3H3VC 3KLWA 4K6LA 1EIFA 5I2XA 2K52A 4IFDJ 2R92H 3KFUA 2KCTA 3R2IA 1HJPA 4DV1Q 2FHTA 3D3RA 3KDFA 2NVXB 2A6HC 3J80i 5C4ZA 1BDOA 1QUQA 1KABA 4X65L 1N34Q 1Y8NB 4FXGC 1J5EQ 5D14A 4HAEA 1A15A 3EFXD 5K36H 2YTXA 1UE1A 1QUQB 1XTDA 2J7ZA 4C3HH 3I55A 2ZXOA 1BO0A 2P5ZX 4JI8L 4IUQA 1HNXQ 2D0OA 3ICEA 1F9RA 1LT5D 4UP8A 3MVVA 1EOVA 4IJHA 2C9OA 5CV6A 5IYCG 3S1NB 1DGSA 3S17H 2NB0A 3DM3A 2Q8TA 1EY0A 4X62Q 1VF5C 2NVYB 2J0TD 4TSSA 4QCLA 3A8IE 3A5UA 4WRDA 3G6EA 1IZ6A 1JWUD 3VYUA 2JA8G 4ZCKA 3S15H 4A3FB 3QWNA 5FJ8G 2D62A 3U4VA 1UEAB 4JBMA 4DF7A 2F52A 3DWAA 3J81j 1CSQA 3FKIG 1E2WA 1PTOD 1X3QA 1IYJB 2B2WC 3R3OA 2JA9A 2B2YC 3S1RH 1EYDA 1DOMA 1JB3A 3RR5A 1KHIA 2MUYA 1WTVA 4JI3L 1B9MA 3K5LA 2NZ1D 1X3GA 1Q7YC 4GZYC 2F1MA 4KV6A 2VQFQ 1VDZA 1PRTF 3M4PA 1J6QA 1EYCA 4X3TA 3Q23A 5EBDA 2K5WA 2A69D 1Q3LA 2RA4A 4JK1C 3CD6A 4KKTA 2JSOA 3OMCA 1PDQA 1GOZA 5AJ3Q 3K5MA 3CMEA 5D65A 5IGFA 4LF7Q 3HOYG 4IFDH 4DUZQ 3DEPA 1FYCA 2FMMA 3GTGH 2KUMA 1RHPA 2JA7B 1NAPA 1YEZA 4RA8A 5G3LD 3Q6SA 1TS5A 4B3SQ 5IGGA 3HOXG 4MTKA 2F0LA 1EQTA 2KEDA 3CKIB 3QO2A 2YTYA 5C4HA 1H9MA 1AFPA 4QJFA 4HJ8A 1TY0A 4BBSB 4E6IA 1U4PA 2Q8IB 3D4DA 1BCPB 1PH5A 5C3XA 1JT8A 4NDXA 3RN5A 2NVTH 1N32Q 2RF4A 4LF9L 3M4OH 4A93B 4JCVE 3TZUA 1KRSA 4J6HA 1YHAA 3TP5A 4H7BA 3HKZG 4DR4L 3TP7A 3NBIA 5ELCA 2ICIA 4HR7B 4JI6Q 3T16A 4ME3A 4AYBG 1SFOH 4X64L 4DR2Q 2ZXRA 4U68A 3H09A 3GTOH 4JI0L 2QGQA 4JI7Q 1EY6A 3DXJC 1KD1C 4HSVA 2CW0C 2A5HA 3AQQA 4V0BA 3J7AV 1LTSD 4L5TA 2IJ0A 4HIOA 4AIMA 1LTTD 4DNRB 4L63B 5JPMC 3S2DH 5IIFA 1BBUA 3EJIA 2F0QA 4JBJA 3NBHA 3TDQA 2IX3A 2KOLA 2JYOA 1RCVD 1OXTA 2AQ2B 1G91A 3BVGA 4IPHA 1UE5A 2IPKD 4ZLTF 3I91A 4R4QA 1YI2A 1EUJA 3KF6A 1H9KA 2XIWA 5COYA 3E6ZX 5J22A 4X66L 1QNKA 2QILA 4JI5L 1II3A 1V43A 1YIJA 4I65A 4C3IB 4FF1A 4DAMA 1X3PA 4BBRB 2K01A 3K7AB 3NELA 2E2IB 3KF6B 5KEEA 2NVQB 3WOFA 1AZQA 1D7QA 1MI2A 2X6LA 1SMYC 2N78A 1WTOA 4DV6Q 1GKHA 1H9JA 3KF8B 4C1NK 1QZGA 3WWVA 4C2MH 1D5MC 2EYLA 4KHVA 4IUPA 3GTMB 2NYZD 3GV3A 1EQVA 4YCWA 5IP7H 1JJCB 3RZOH 2ZJQA 2A6HD 1RTNA 4IURA 2LY7A 1YNND 4GNXC 2F0DA 3I4MB 4A3EH 5M5XB 1HQRD 1U4LA 2A8VA 3V05A 3E5SA 3PUYA 2UXCQ 5HY6A 1XMQL 1IYUA 3JAML 5A35A 2VB3X 1X54A 3TRZA 2Z0SA 4FVMA 3CC2A 1WOCA 1I4PA 1FNUA 3SXHA 4CJ2C 1HR0Q 3B6YA 4FNFA 2Z6KC 5ELNA 4IJLA 4O42A 3G7LA 1E7ZA 2Z9HA 1D2BA 3ND9A 2G5DA 3VYSA 4KMUC 4PQXA 1SYBA 2QKIC 3C1EA 2R7ZB 1EY4A 3EQLC 4FF3A 1O7ZA 1EEFD 4LF4Q 2JA7G 1NY4A 1X9NA 1Q8KA 1IXRA 4XQJA 3EBEA 4GKJQ 1T5EA 2EYPA 4TKOB 5FLMG 1BNZA 3CRKC 3IL8A 1L0YB 1BF4A 1WJJA 2BCOA 3D8GA 1ENFA 4GOPA 3N6RA 1VMCA 1QB5D 4DV5Q 4P2CB 1K28A 3NP8A 2RVLA 1EWIA 5J3BA 1TS4A 2VUMB 4ZAIA 3HZXA 2K03A 2VQEL 1DZ1A 1PYBA 4B3MQ 4XQQA 4A93G 4DV7L 4OO1G 4GKKQ 1MHWC 1C9OA 1MBYA 3OTOQ 3S14B 1EZ8A 4UHVA 3QOJA 2SEBD 4OXPA 1M4VA 2E2HB 2MP1A 1RTOA 4CKCA 1ILQA 1TU2B 3GV6A 4IZ8A 4OIJA 1SE8A 4U673 4QUCA 1YNXA 2N88A 5C4XH 4DAVA 1JMCA 3SDZA 4IUUA 2CCZA 1LM0A 4KD4A 2HHHQ 3T51B 1VQOA 5FLXL 1SJHD 3FPUB 5I9PA 2F0VA 3KLSX 3F2BA 3MXPA 1JOKA 4PZ6A 2B29A 3H91A 2PCFB 3S2HB 3CCUA 4A93H 2JP1A 4A3MH 4DR7Q 1WI5A 1MGSA 4RGOS 1IHZA 2F0UA 3NTIA 3M7NA 4A3KH 2DY8A 1JOOA 3CXCA 3R8BA 1JJ2A 1AN8A 2BDOA 4A3LG 1JOQA 1T5XD 4NKLA 4KD3A 1ASZA 4ZKCB 3ZYYX 1XPOA 3J7AF 3GTKB 4BWGB 1L1OA 2MGSA 4I7ZC 3H6MA 3C3LA 2L4NA 2RQXA 4B3TL 1VQDA 4X65Q 3STBD 4C3IG 3HKZE 1S3OA 4QF4A 4P75A 1LTBD 4BBRG 4QIWE 1B3QA 4BXXG 4A3IB 1L1OB 1X32A 2K33A 3CAMA 1X65A 2GVAA 4BS9A 1KAAA 4P73A 2I5LX 4AYBE 4JI8Q 1PRTB 3H0GB 1PH6A 4A3CG 5LL6S 1GUNA 2N55A 3P75A 1SLJA 2R6GA 1W3SA 4XYQA 4Q0FA 1TY2A 3FDTA 2EYMA 3M9BA 2K75A 1MD2D 1STNA 3CCMA 1EZ6A 1XX8A 3I4MG 1H9SA 4V190 2R92B 1IL8A 1NR2A 3BVMA 1YITA 5GAGC 4ME5A 4CJ0B 2B63H 4BXXH 2D0PA 1M90C 1WTRA 4RMFA 1VQIA 1MSGA 2PZWA 1H9SB 2Z6BA 3TQYA 3OYYA 3RNUA 2WP8J 2IX0A 3VA5A 3ZJYC 2YTVA 1C4QA 2B2TC 4C3HB 1HCZA 1ZKOA 4JBKA 4JI3Q 2BE5D 2EJFC 4ULLA 1F2LA 1VQ8A 1B44D 5D3DA 1KDCA 3GO5A 1LTLA 4Y7NH 1RODA 2BA0A 3S17B 1PV4A 4LF6Q 3W2DA 2Q2HA 1QZHA 1PH1A 2ID0A 4JV5L 3BVZA 4DAYA 3QIAA 1X6OA 4LF8L 1PTOC 5GADC 3S15B 2QCPX 3OWFA 1JB7A 1A8VA 1SE2A 2OQ0A 4YWMA 4GN5A 2IHEA 2F0GA 4DAYB 2VUMG 4A3DH 4PMBA 3S1MH 4K5WA 3A5ZB 4DV0L 3K6OA 1N36L 3S1RB 1FL0A 2X6GA 3A74A 3SHLA 4C56C 4IPDA 1QOHA 1RJTA 3GTJH 5JJZA 1DOLA 1L0XB 2LFNA 2I46A 3LWEA 4LF9Q 1Z7TA 1I4RA 4LUOA 4JI4L 4OONA 1Z47A 1BR9A 1WCMH 1JJGA 1BCPD 4FDBA 3PMFA 5KYLA 5GAHC 3J80c 4EQ5A 1E2ZA 4I7AA 1TWGH 2K50A 4X64Q 1D1IA 4HSPA 1R9TH 4JI0Q 2UU9L 1WYDA 3URYA 1CK1A 2NBFA 3K5OA 1EY9A 2KCMA 4G7HC 5M3MG 3VR5A 3KLRA 3SEBA 1K73C 1XPRA 5J39A 1YHBA 3F2DA 2B2WA 2EYJA 5DAUA 2B2YA 4YY3L 5JJKA 2UUBL 1MKHA 1Y1VG 2NVTB 1QVFA 5E4WC 5M5WH 2LXKA 3NEMA 4A3IG 4A3GH 4XXEA 5A2QL 1EY7A 5IT9L 2AUJD 4X66Q 3H0GG 4JI5Q 5LMNW 1GUSA 1S4ZA 3CP0A 1SFOB 2IT1A 5M3MH 1QVCA 3GTOB 1H95A 4R4IA 3OWEB 3PIPA 4ABNA 5IWAL 1ICFB 2F0WA 2WFWA 4KY7A 1A6XA 2RSNA 4EX5A 3PF5A 1B4OA 3D0FA 1Y1VH 1PH4A 3GD7A 4FF4A 3S2DB 3T53B 3TP8A 3OHXC 3UI2A 2OT2A 2IX1A 3T56B 4MNOA 3RUZA 3U4ZA 1LT3D 4L8JA 2Q2IA 4KTAA 1KQSA 1HA6A 3AEVA 2G9HD 5GQOA 2MO1A 3DM1A 5K36G 4C3HG 1XMQQ 2MO0A 3Q8DA 3TP6A 4KHPL 5IY0A 5IODA 2EOTA 2ES2A 1A2TA 3OIPA 3GTLH 4HIKA 1ILPA 2O4XA 2D5DA 1ESRA 2LS01 1PHJA 1O7LA 2V4DA 3NTKA 2VB2X 4EGVA 2PO4A 4C2MB
chains in the Genus database with same CATH topology
1HZBA 1FVIA 1VQGA 1HR0W 4POFA 3CQZH 1E22A 3AQQA 1VQPA 4HJ5A 3OW2A 2FXQA 2Q2TA 2ASBA 1XPUA 2LXJA 2WAQE 4L5TA 1MIUA 1P16A 2JA7H 4HIOA 4AIMA 3KDFB 1CKOA 1Y14B 4R4CA 4YHHQ 3S2DH 4JYAQ 4JI2L 5FLMH 5C3EH 1BBUA 3SGIA 3KJPA 4GLAC 4JBJA 3FP9A 2RHSB 5C44G 2XGTA 2JEBI 4BBSH 1C7YA 4DV4L 3FHWA 1XMOL 1OXXK 4OO1I 4LNQA 4POGA 2YV5A 4L5SA 1A63A 1OXTA 3PSIA 2R7FA 2Y0SE 5M5YH 5LMNQ 3ULJA 3AFQA 4IPHA 1UE5A 3D31A 3E0EA 5C0XG 2VQFL 1XJVA 4A3GG 2VS1A 3RZDH 2VQEQ 3M4QA 4R4QA 2QEXA 3PF4A 1YI2A 1GM5A 1EUJA 1PYSB 2XTIA 3KF6A 3PUXA 1VQMA 4LUVA 3AFPA 3JAMi 1SN8A 4X66L 4DV7Q 4IPGA 4BA1I 4JI5L 1PH7A 1MJEA 2NZOA 1YJNA 4BY7G 4LFBL 1V43A 2BH8A 5C4JH 1YIJA 4DAMA 1U5KA 1N33L 3M85A 4IPCA 4YWKA 3H3VI 1Y1WH 1TWAH 5AJ3L 3NELA 3KF6B 4KLKA 1E1TA 4LF7L 3BZKA 3JC66 1D7QA 4DUZL 1IBKL 5C0XI 4YCUA 3KJOA 4IFDG 3G71A 1VQJA 2N78A 4DV6Q 1GKHA 1T9HA 1VQEA 3KF8B 5C44H 1FGUA 1C0AA 1QZGA 2AKWB 3WWVA 4C2MH 3CW2C 4B3SL 4DV2L 3H3VH 3PO2H 4R4TA 1K83H 1NBWA 1I3QH 3RLOA 4YCWA 1YJWA 4O0AA 4XIGS 5IP7H 1JJCB 3JAMc 4NXNQ 3RZOH 2CKZB 4DK3C 2Q2UA 2ZJQA 3F1ZA 3J81i 2VNUD 3GDEA 4H02A 1HNZQ 4DV3L 4LF6L 3EIVA 4IFDI 4BY7H 4GNXC 4GNXA 4BY1H 4HJ7A 4HJ9A 4NB3A 1ASYA 3PO3G 4DR6Q 1Q1BA 4A3EH 1K9MC 1N32L 4DR5Q 1RIPA 3J7ZC 2A8VA 3GTQH 1E24A 3PUYA 1E3PA 3G48A 5HY6A 2UXCQ 1XMQL 1IBLL 4YCVA 1Q81C 3I4OA 4A3LH 1X54A 3CF5A 2Z0SA 3TRZA 1KC8C 3HOUH 3PGZA 3CC2A 1V1QA 1WOCA 1VS0A 4UP9A 1FJGL 2ZM6L 1SR3A 5JEAJ 2UXDQ 5IYDH 3HOWH 1HR0Q 3CC7A 2JA6H 1A62A 3B6YA 3I56A 2VZAA 3EN2A 4JI6L 2Z6KC 2Z6KA 5ELNA 4IJLA 1O7IA 4DR2L 1TWHH 1PH3A 4C3IH 1E7ZA 2NZHA 4B3TQ 4JI7L 4A3JG 3J81c 4BBRH 3K7AH 3T1HQ 1UEBA 1Z9FA 2E2IH 2WB1E 2ALYB 4KI0A 2NVQH 4GN3B 3CCLA 2AHOB 1EQRA 2K5NA 2I0QA 4WJ4A 3UDGA 1P8LA 1X56A 1K3RA 3PO3H 1OXVA 2QA4A 3F2CA 4LF4Q 4DUYQ 4OWXB 2JA7G 1NY4A 2JEAI 2K4KA 1X9NA 1Q8KA 1VCIA 2AWOA 1IXRA 2ZTDA 5DLQE 4YHHL 3EBEA 4JYAL 4GKJQ 4A3CH 3GTMH 2A19A 2N8NA 5FLMG 5C3EG 4IOAA 5EAYA 2N49A 4LWCA 1KIXA 1WJJA 4JOIA 4JOIC 2JQOA 1X3FA 4GOPA 4GOPC 1LYLA 4DV5Q 3M3YH 3ER0A 5LMNL 2H5XA 1NMFA 2HIXA 1EWIA 5J3BA 1I94Q 2R7ZG 2ZTEA 3STBC 3I4MH 4JC0A 5M5XH 1NMGA 2HIVA 2VQEL 2MNAA 1PYBA 1B7YB 1YZ6A 4B3MQ 3RN2A 3I4NG 2VY3A 4OX9Q 1VQ6A 4A93G 3KYHC 4DV7L 4OO1G 1KXLA 4GKKQ 1B70B 2KENA 3NENA 1C9OA 3OTOQ 3ERSX 4TVAB 2K14A 4JBWA 5IE8A 4OXPA 3CC4A 4K0KQ 1G291 4DR1Q 2F4VQ 1Y1WG 3GTPH 4O2DA 4UP7A 3T1YQ 1PH2A 1PH9A 1SE8A 4IOCA 3ULLA 3ULPA 3MXNB 1YNXA 4DV6L 1VQNA 2UXBQ 5C4XH 3CCVA 1JMCA 1EQQA 1GO3E 5H1SE 2CCZA 1LM0A 1Q82C 4A75A 3PV0A 2HHHQ 2N3SA 1VQOA 4IO9A 4YWLA 2UUAQ 1BBWA 2R7ZH 3PO2G 1KAWA 1XNQQ 1YVCA 3F2BA 1PFSA 4NXNL 3K8AA 5IP7G 1VQ7A 2I5HA 4GS3A 4PZ6A 3I4NH 1AE3A 2B29A 3NBHB 2CWPA 1K0RA 2F3IA 1S72A 3IRBA 3CCUA 4GLXA 1VQKA 4A93H 4JV5Q 2OTJA 4A3MH 4DR7Q 1CSPA 1WI5A 4BA2I 5BR8Q 2CQOA 1EIYB 4DR6L 4B3RQ 3M7NA 4BY1G 4DR5L 3J7A5 4LF8Q 1LUZA 4A3KH 4A3EG 4TQUS 2UXCL 1I6HH 2GN5A 3CXCA 3H15A 3PUVA 2WB1G 4NPSA 4XTCS 3TREA 1JJ2A 1CUKA 1NTGA 1OXUA 5LMUQ 2K5VA 2VUMH 4A3LG 3HOUG 2A1AA 3RLFA 4DR4Q 1ASZA 3BJUA 4P72A 4DR3Q 1XPOA 1U0LA 2UXDL 2CWAA 3DLLA 4APVA 1N8RC 1HR0L 5IYDG 4KHZA 3HOWG 1L1OC 1L1OA 1K8AC 2JA6G 1L0WA 4DV0Q 4AQYQ 1N36Q 1IL2A 3S14H 4B3TL 1Q86C 1VQDA 4X65Q 3E9IA 2JA5G 3STBD 1HZCA 3HKZE 1S3OA 3T1HL 1QVGA 1VQCA 4P75A 2E2HH 4BBRG 3PUZA 1JE5A 3E9HA 4QIWE 3LGJA 3HFZB 4BXXG 5JJIA 1L1OB 4A3BG 5GROA 4LFAQ 3CAMA 1Q1EA 4LFCQ 1YHQA 1X65A 2GVAA 3CPWA 1W2BA 4LF4L 4DUYL 1KL9A 2I5LX 4P73A 4AYBE 3CCQA 3TS2A 4WJ3M 1UE7A 4MTNA 4JI8Q 3UDFA 3HOVH 4GKJL 5ELOA 4JI4Q 2PI2A 2PNHA 2VW9A 1PH6A 3W5OA 3S1QH 5IYCH 4A3CG 3S24A 1SLJA 1SRUA 2BH2A 2R6GA 1W3SA 2UUCQ 1VQHA 3HOZH 2KHIA 1GVPA 3CCEA 2PQAA 2KBNA 3M9BA 4GNXB 2K75A 4DV5L 2WAQG 2OWOA 3S2HH 4QY7A 2L15A 2PMZE 3L2PA 1I94L 3F8TA 1IBMQ 3UDXA 4DKAC 2YU9H 3CCMA 2R93G 2I5MX 4A4IA 1EYGA 2JA8H 3I4MG 1PA6A 2JA5H 4J15A 2UU9Q 4B3ML 1MJCA 1NE3A 4OX9L 4PZ7A 5FJ8H 1YITA 5GAGC 4BXXH 2B63H 3UE1A 4GKKL 1HZAA 2D0PA 3K7UC 3OTOL 4LF5Q 5GAEC 4A3BH 1M90C 4RMFA 3FKIH 1XNRQ 2Y0SG 3GTKH 1VQIA 1I5FA 1Q46A 1UE6A 4GLVB 3MEFA 4JG2A 4K0KL 3TQYA 4DR1L 2F4VL 4YY3Q 3OYYA 3RNUA 1E1OA 2WP8J 3T1YL 2IX0A 4LUZA 3ZJYC 5IP9G 1OTCA 2UUBQ 2JE6I 3TEHB 2YTVA 2EXDA 1AE2A 2YYZA 2UXBL 1TWFH 4JI1Q 1Q12A 1X3EA 2VL6A 2R92G 5C4XG 2GVBA 4A3IH 4JI3Q 2HHHL 4JBKA 2LSSA 1L2FA 2UUAL 1VQ8A 2MQHA 3UE0A 2JJQA 3GO5A 1VQ4A 2R93H 1LTLA 4Y7NH 2HQLA 2CFMA 2BA0A 3KOJA 3W1GA 1XNQL 2EQSA 3PUWA 1PV4A 3H0GH 4LF6Q 5C0XJ 4NXMQ 4P71A 2OTLA 2Q2HA 1QZHA 1PH1A 2ID0A 4A76A 4JV5L 1S40A 2B3GA 4DR7L 1PVOA 2C35B 4GOPB 4B3RL 1HZ9A 5BR8L 2OCEA 1X6OA 2MFIA 2ZJRA 3CCRA 4A3MG 2E5LQ 2IY5B 4LF8L 1G51A 5GADC 3VDYA 4ALPA 1M1KC 1VQ9A 1HNWQ 2DGYA 4A3KG 1JB7A 3HOYH 1A8VA 3A0JA 5JEAG 5IWAQ 2OQ0A 4YWMA 5FLXc 4GN5A 2IHEA 3TS0A 5LMUL 1TXYA 1BKBA 5IP9H 4DAYB 1D8LA 2RHQB 2AWNA 1YJ9A 1V9PA 4DR3L 2VUMG 1G6PA 3KLWA 3UDIA 3HOXH 4A3DH 1N9WA 1BVSA 1EIFA 2K52A 4IFDJ 2R92H 3KFUA 2KCTA 3S1MH 4DNIA 1HJPA 3A5ZB 4DV0L 3KDFA 4RG1A 4DV1Q 3J80i 4AQYL 1N36L 4Y52H 1FL0A 3A74A 1QUQA 3L7ZC 5HGQA 4X65L 4IPDA 1N34Q 1VQLA 3K0XA 3GTJH 1J5EQ 3CPFA 3PCOB 3CCJA 2PI2E 4LFAL 2HT1A 4LFCL 4GN4B 1TWCH 1HNZL 2YTXA 1UE1A 1QUQB 1XTDA 2JK8A 2ZTCA 4C3HH 3I55A 1PH8A 4LF9Q 1K8GA 4JI8L 4LUOA 5IYBH 1HNXQ 4JI4L 2D0OA 3ICEA 3HOVG 4UP8A 4OONA 4PMWA 1EOVA 1Z47A 4IJHA 4KHPQ 1WCMH 2V1CC 3L0OA 5IYCG 1JJGA 4R4OA 1DGSA 4C3JH 1CKMA 2UUCL 3S17H 3RLNA 4FDBA 3DM3A 4X62Q 3HOZG 1KRTA 3G4SA 5GAHC 3J80c 3A5UA 4EQ5A 1IBML 1TWGH 1YBYA 2K50A 3G6EA 4PZ8A 4X64Q 1IZ6A 1R9TH 4JI0Q 2JA8G 3S15H 4HIMA 2UU9L 1WYDA 2E2JH 1CKNA 1SROA 1VQBA 2KCMA 5FJ8G 2D62A 3U4VA 5M3MG 4UPAA 4JBMA 4LF5L 2B63G 2F52A 2BA1A 3W1BA 1K73C 3AYHB 1XPRA 1XNRL 1VQAA 3J81j 1CSQA 1YHBA 3FKIG 3U50C 3PIOA 3F2DA 1IYJB 4AH6A 4JI2Q 2JA9A 4YY3L 2NVXH 2ATWA 1CKNB 5JJKA 3S1RH 2UUBL 5IT9c 3RR5A 1MKHA 2KHJA 1EFWA 1Y1VG 4DV4Q 1KHIA 4A3FG 1XMOQ 1QVFA 5M5WH 4JI1L 2LXKA 3NEMA 1I50H 4JI3L 4QL5A 4A3IG 4A3GH 1X3GA 1Q7YC 2VQFQ 3I7FA 3M4PA 1NJIC 1J6QA 4LW1A 4NXML 4X66Q 4OWWB 3H0GG 3CD6A 4JI5Q 1SMXA 5LMNW 4LFBQ 3CP0A 2IT1A 2PQAB 2R7DA 5M3MH 3S1NH 1QVCA 4DK6C 1H95A 4R4IA 2E5LL 3U58A 3PIPA 1N33Q 3BU2A 2RCNA 1UWVA 2NVYH 2K5HA 5AJ3Q 1HNWL 3K80C 3CMEA 5IWAL 1VQ5A 4LF7Q 3HOYG 1OXSC 4DUZQ 1IBKQ 2WFWA 3GTGH 2NN6G 4EX5A 2E8GA 2IHFA 1YEZA 3PF5A 3D0FA 1Y1VH 2ZJPA 4A3FH 1PH4A 3GD7A 4B3SQ 3HOXG 4DV2Q 2EIFA 1VQFA 4A3DG 4DV1L 2YTYA 2IX1A 4QJFA 4HJ8A 4MNOA 4QQBX 3U4ZA 5M3FG 1N34L 4R1JA 2Q2IA 1KQSA 4DPGA 1AH9A 4PG3A 2OQKA 1PH5A 1J5EL 4OWTB 4UY8C 4DV3Q 1JT8A 3AEVA 1HH2P 1WFQA 2NN6I 3RN5A 4P74A 5GQOA 2NVTH 1N32Q 2RF4A 4MZ9A 4LF9L 1GD7A 2MO1A 5K36G 3M4OH 4JCVE 1XMQQ 1IBLQ 1A0IA 2MO0A 1KRSA 1X55A 3I2ZA 3Q8DA 1HNXL 3S16H 1YHAA 4HIDA 5IYBG 3HKZG 5E7NA 4KHPL 5IY0A 1FJGQ 4BBSG 2ZM6Q 1WCMG 4DR4L 1B8AA 2ES2A 4X62L 5JJLA 3GTLH 4HIKA 1RL2A 2DUDA 4JI6Q 4QGUA 4HJAA 4X6AH 4ME3A 4AYBG 1SFOH 1PHJA 3CMAA 4X64L 4DR2Q 3K81C 4A3JH 4JI0L 2QGQA 4JI7Q 3GTOH 3CCSA 2AMCB 4L5QA 4L5RC 5M3FH 3BZCA 1KD1C 3HKSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HZB A;  1FVI A;  1VQG A;  1HR0 W;  4POF A;  3CQZ H;  1E22 A;  3AQQ A;  1VQP A;  4HJ5 A;  3OW2 A;  2FXQ A;  2Q2T A;  2ASB A;  1XPU A;  2LXJ A;  2WAQ E;  4L5T A;  1MIU A;  1P16 A;  2JA7 H;  4HIO A;  4AIM A;  3KDF B;  1CKO A;  1Y14 B;  4R4C A;  4YHH Q;  3S2D H;  4JYA Q;  4JI2 L;  5FLM H;  5C3E H;  1BBU A;  3SGI A;  3KJP A;  4GLA C;  4JBJ A;  3FP9 A;  2RHS B;  5C44 G;  2XGT A;  2JEB I;  4BBS H;  1C7Y A;  4DV4 L;  3FHW A;  1XMO L;  1OXX K;  4OO1 I;  4LNQ A;  4POG A;  2YV5 A;  4L5S A;  1A63 A;  1OXT A;  3PSI A;  2R7F A;  2Y0S E;  5M5Y H;  5LMN Q;  3ULJ A;  3AFQ A;  4IPH A;  1UE5 A;  3D31 A;  3E0E A;  5C0X G;  2VQF L;  1XJV A;  4A3G G;  2VS1 A;  3RZD H;  2VQE Q;  3M4Q A;  4R4Q A;  2QEX A;  3PF4 A;  1YI2 A;  1GM5 A;  1EUJ A;  1PYS B;  2XTI A;  3KF6 A;  3PUX A;  1VQM A;  4LUV A;  3AFP A;  3JAM i;  1SN8 A;  4X66 L;  4DV7 Q;  4IPG A;  4BA1 I;  4JI5 L;  1PH7 A;  1MJE A;  2NZO A;  1YJN A;  4BY7 G;  4LFB L;  1V43 A;  2BH8 A;  5C4J H;  1YIJ A;  4DAM A;  1U5K A;  1N33 L;  3M85 A;  4IPC A;  4YWK A;  3H3V I;  1Y1W H;  1TWA H;  5AJ3 L;  3NEL A;  3KF6 B;  4KLK A;  1E1T A;  4LF7 L;  3BZK A;  3JC6 6;  1D7Q A;  4DUZ L;  1IBK L;  5C0X I;  4YCU A;  3KJO A;  4IFD G;  3G71 A;  1VQJ A;  2N78 A;  4DV6 Q;  1GKH A;  1T9H A;  1VQE A;  3KF8 B;  5C44 H;  1FGU A;  1C0A A;  1QZG A;  2AKW B;  3WWV A;  4C2M H;  3CW2 C;  4B3S L;  4DV2 L;  3H3V H;  3PO2 H;  4R4T A;  1K83 H;  1NBW A;  1I3Q H;  3RLO A;  4YCW A;  1YJW A;  4O0A A;  4XIG S;  5IP7 H;  1JJC B;  3JAM c;  4NXN Q;  3RZO H;  2CKZ B;  4DK3 C;  2Q2U A;  2ZJQ A;  3F1Z A;  3J81 i;  2VNU D;  3GDE A;  4H02 A;  1HNZ Q;  4DV3 L;  4LF6 L;  3EIV A;  4IFD I;  4BY7 H;  4GNX C;  4GNX A;  4BY1 H;  4HJ7 A;  4HJ9 A;  4NB3 A;  1ASY A;  3PO3 G;  4DR6 Q;  1Q1B A;  4A3E H;  1K9M C;  1N32 L;  4DR5 Q;  1RIP A;  3J7Z C;  2A8V A;  3GTQ H;  1E24 A;  3PUY A;  1E3P A;  3G48 A;  5HY6 A;  2UXC Q;  1XMQ L;  1IBL L;  4YCV A;  1Q81 C;  3I4O A;  4A3L H;  1X54 A;  3CF5 A;  2Z0S A;  3TRZ A;  1KC8 C;  3HOU H;  3PGZ A;  3CC2 A;  1V1Q A;  1WOC A;  1VS0 A;  4UP9 A;  1FJG L;  2ZM6 L;  1SR3 A;  5JEA J;  2UXD Q;  5IYD H;  3HOW H;  1HR0 Q;  3CC7 A;  2JA6 H;  1A62 A;  3B6Y A;  3I56 A;  2VZA A;  3EN2 A;  4JI6 L;  2Z6K C;  2Z6K A;  5ELN A;  4IJL A;  1O7I A;  4DR2 L;  1TWH H;  1PH3 A;  4C3I H;  1E7Z A;  2NZH A;  4B3T Q;  4JI7 L;  4A3J G;  3J81 c;  4BBR H;  3K7A H;  3T1H Q;  1UEB A;  1Z9F A;  2E2I H;  2WB1 E;  2ALY B;  4KI0 A;  2NVQ H;  4GN3 B;  3CCL A;  2AHO B;  1EQR A;  2K5N A;  2I0Q A;  4WJ4 A;  3UDG A;  1P8L A;  1X56 A;  1K3R A;  3PO3 H;  1OXV A;  2QA4 A;  3F2C A;  4LF4 Q;  4DUY Q;  4OWX B;  2JA7 G;  1NY4 A;  2JEA I;  2K4K A;  1X9N A;  1Q8K A;  1VCI A;  2AWO A;  1IXR A;  2ZTD A;  5DLQ E;  4YHH L;  3EBE A;  4JYA L;  4GKJ Q;  4A3C H;  3GTM H;  2A19 A;  2N8N A;  5FLM G;  5C3E G;  4IOA A;  5EAY A;  2N49 A;  4LWC A;  1KIX A;  1WJJ A;  4JOI A;  4JOI C;  2JQO A;  1X3F A;  4GOP A;  4GOP C;  1LYL A;  4DV5 Q;  3M3Y H;  3ER0 A;  5LMN L;  2H5X A;  1NMF A;  2HIX A;  1EWI A;  5J3B A;  1I94 Q;  2R7Z G;  2ZTE A;  3STB C;  3I4M H;  4JC0 A;  5M5X H;  1NMG A;  2HIV A;  2VQE L;  2MNA A;  1PYB A;  1B7Y B;  1YZ6 A;  4B3M Q;  3RN2 A;  3I4N G;  2VY3 A;  4OX9 Q;  1VQ6 A;  4A93 G;  3KYH C;  4DV7 L;  4OO1 G;  1KXL A;  4GKK Q;  1B70 B;  2KEN A;  3NEN A;  1C9O A;  3OTO Q;  3ERS X;  4TVA B;  2K14 A;  4JBW A;  5IE8 A;  4OXP A;  3CC4 A;  4K0K Q;  1G29 1;  4DR1 Q;  2F4V Q;  1Y1W G;  3GTP H;  4O2D A;  4UP7 A;  3T1Y Q;  1PH2 A;  1PH9 A;  1SE8 A;  4IOC A;  3ULL A;  3ULP A;  3MXN B;  1YNX A;  4DV6 L;  1VQN A;  2UXB Q;  5C4X H;  3CCV A;  1JMC A;  1EQQ A;  1GO3 E;  5H1S E;  2CCZ A;  1LM0 A;  1Q82 C;  4A75 A;  3PV0 A;  2HHH Q;  2N3S A;  1VQO A;  4IO9 A;  4YWL A;  2UUA Q;  1BBW A;  2R7Z H;  3PO2 G;  1KAW A;  1XNQ Q;  1YVC A;  3F2B A;  1PFS A;  4NXN L;  3K8A A;  5IP7 G;  1VQ7 A;  2I5H A;  4GS3 A;  4PZ6 A;  3I4N H;  1AE3 A;  2B29 A;  3NBH B;  2CWP A;  1K0R A;  2F3I A;  1S72 A;  3IRB A;  3CCU A;  4GLX A;  1VQK A;  4A93 H;  4JV5 Q;  2OTJ A;  4A3M H;  4DR7 Q;  1CSP A;  1WI5 A;  4BA2 I;  5BR8 Q;  2CQO A;  1EIY B;  4DR6 L;  4B3R Q;  3M7N A;  4BY1 G;  4DR5 L;  3J7A 5;  4LF8 Q;  1LUZ A;  4A3K H;  4A3E G;  4TQU S;  2UXC L;  1I6H H;  2GN5 A;  3CXC A;  3H15 A;  3PUV A;  2WB1 G;  4NPS A;  4XTC S;  3TRE A;  1JJ2 A;  1CUK A;  1NTG A;  1OXU A;  5LMU Q;  2K5V A;  2VUM H;  4A3L G;  3HOU G;  2A1A A;  3RLF A;  4DR4 Q;  1ASZ A;  3BJU A;  4P72 A;  4DR3 Q;  1XPO A;  1U0L A;  2UXD L;  2CWA A;  3DLL A;  4APV A;  1N8R C;  1HR0 L;  5IYD G;  4KHZ A;  3HOW G;  1L1O C;  1L1O A;  1K8A C;  2JA6 G;  1L0W A;  4DV0 Q;  4AQY Q;  1N36 Q;  1IL2 A;  3S14 H;  4B3T L;  1Q86 C;  1VQD A;  4X65 Q;  3E9I A;  2JA5 G;  3STB D;  1HZC A;  3HKZ E;  1S3O A;  3T1H L;  1QVG A;  1VQC A;  4P75 A;  2E2H H;  4BBR G;  3PUZ A;  1JE5 A;  3E9H A;  4QIW E;  3LGJ A;  3HFZ B;  4BXX G;  5JJI A;  1L1O B;  4A3B G;  5GRO A;  4LFA Q;  3CAM A;  1Q1E A;  4LFC Q;  1YHQ A;  1X65 A;  2GVA A;  3CPW A;  1W2B A;  4LF4 L;  4DUY L;  1KL9 A;  2I5L X;  4P73 A;  4AYB E;  3CCQ A;  3TS2 A;  4WJ3 M;  1UE7 A;  4MTN A;  4JI8 Q;  3UDF A;  3HOV H;  4GKJ L;  5ELO A;  4JI4 Q;  2PI2 A;  2PNH A;  2VW9 A;  1PH6 A;  3W5O A;  3S1Q H;  5IYC H;  4A3C G;  3S24 A;  1SLJ A;  1SRU A;  2BH2 A;  2R6G A;  1W3S A;  2UUC Q;  1VQH A;  3HOZ H;  2KHI A;  1GVP A;  3CCE A;  2PQA A;  2KBN A;  3M9B A;  4GNX B;  2K75 A;  4DV5 L;  2WAQ G;  2OWO A;  3S2H H;  4QY7 A;  2L15 A;  2PMZ E;  3L2P A;  1I94 L;  3F8T A;  1IBM Q;  3UDX A;  4DKA C;  2YU9 H;  3CCM A;  2R93 G;  2I5M X;  4A4I A;  1EYG A;  2JA8 H;  3I4M G;  1PA6 A;  2JA5 H;  4J15 A;  2UU9 Q;  4B3M L;  1MJC A;  1NE3 A;  4OX9 L;  4PZ7 A;  5FJ8 H;  1YIT A;  5GAG C;  4BXX H;  2B63 H;  3UE1 A;  4GKK L;  1HZA A;  2D0P A;  3K7U C;  3OTO L;  4LF5 Q;  5GAE C;  4A3B H;  1M90 C;  4RMF A;  3FKI H;  1XNR Q;  2Y0S G;  3GTK H;  1VQI A;  1I5F A;  1Q46 A;  1UE6 A;  4GLV B;  3MEF A;  4JG2 A;  4K0K L;  3TQY A;  4DR1 L;  2F4V L;  4YY3 Q;  3OYY A;  3RNU A;  1E1O A;  2WP8 J;  3T1Y L;  2IX0 A;  4LUZ A;  3ZJY C;  5IP9 G;  1OTC A;  2UUB Q;  2JE6 I;  3TEH B;  2YTV A;  2EXD A;  1AE2 A;  2YYZ A;  2UXB L;  1TWF H;  4JI1 Q;  1Q12 A;  1X3E A;  2VL6 A;  2R92 G;  5C4X G;  2GVB A;  4A3I H;  4JI3 Q;  2HHH L;  4JBK A;  2LSS A;  1L2F A;  2UUA L;  1VQ8 A;  2MQH A;  3UE0 A;  2JJQ A;  3GO5 A;  1VQ4 A;  2R93 H;  1LTL A;  4Y7N H;  2HQL A;  2CFM A;  2BA0 A;  3KOJ A;  3W1G A;  1XNQ L;  2EQS A;  3PUW A;  1PV4 A;  3H0G H;  4LF6 Q;  5C0X J;  4NXM Q;  4P71 A;  2OTL A;  2Q2H A;  1QZH A;  1PH1 A;  2ID0 A;  4A76 A;  4JV5 L;  1S40 A;  2B3G A;  4DR7 L;  1PVO A;  2C35 B;  4GOP B;  4B3R L;  1HZ9 A;  5BR8 L;  2OCE A;  1X6O A;  2MFI A;  2ZJR A;  3CCR A;  4A3M G;  2E5L Q;  2IY5 B;  4LF8 L;  1G51 A;  5GAD C;  3VDY A;  4ALP A;  1M1K C;  1VQ9 A;  1HNW Q;  2DGY A;  4A3K G;  1JB7 A;  3HOY H;  1A8V A;  3A0J A;  5JEA G;  5IWA Q;  2OQ0 A;  4YWM A;  5FLX c;  4GN5 A;  2IHE A;  3TS0 A;  5LMU L;  1TXY A;  1BKB A;  5IP9 H;  4DAY B;  1D8L A;  2RHQ B;  2AWN A;  1YJ9 A;  1V9P A;  4DR3 L;  2VUM G;  1G6P A;  3KLW A;  3UDI A;  3HOX H;  4A3D H;  1N9W A;  1BVS A;  1EIF A;  2K52 A;  4IFD J;  2R92 H;  3KFU A;  2KCT A;  3S1M H;  4DNI A;  1HJP A;  3A5Z B;  4DV0 L;  3KDF A;  4RG1 A;  4DV1 Q;  3J80 i;  4AQY L;  1N36 L;  4Y52 H;  1FL0 A;  3A74 A;  1QUQ A;  3L7Z C;  5HGQ A;  4X65 L;  4IPD A;  1N34 Q;  1VQL A;  3K0X A;  3GTJ H;  1J5E Q;  3CPF A;  3PCO B;  3CCJ A;  2PI2 E;  4LFA L;  2HT1 A;  4LFC L;  4GN4 B;  1TWC H;  1HNZ L;  2YTX A;  1UE1 A;  1QUQ B;  1XTD A;  2JK8 A;  2ZTC A;  4C3H H;  3I55 A;  1PH8 A;  4LF9 Q;  1K8G A;  4JI8 L;  4LUO A;  5IYB H;  1HNX Q;  4JI4 L;  2D0O A;  3ICE A;  3HOV G;  4UP8 A;  4OON A;  4PMW A;  1EOV A;  1Z47 A;  4IJH A;  4KHP Q;  1WCM H;  2V1C C;  3L0O A;  5IYC G;  1JJG A;  4R4O A;  1DGS A;  4C3J H;  1CKM A;  2UUC L;  3S17 H;  3RLN A;  4FDB A;  3DM3 A;  4X62 Q;  3HOZ G;  1KRT A;  3G4S A;  5GAH C;  3J80 c;  3A5U A;  4EQ5 A;  1IBM L;  1TWG H;  1YBY A;  2K50 A;  3G6E A;  4PZ8 A;  4X64 Q;  1IZ6 A;  1R9T H;  4JI0 Q;  2JA8 G;  3S15 H;  4HIM A;  2UU9 L;  1WYD A;  2E2J H;  1CKN A;  1SRO A;  1VQB A;  2KCM A;  5FJ8 G;  2D62 A;  3U4V A;  5M3M G;  4UPA A;  4JBM A;  4LF5 L;  2B63 G;  2F52 A;  2BA1 A;  3W1B A;  1K73 C;  3AYH B;  1XPR A;  1XNR L;  1VQA A;  3J81 j;  1CSQ A;  1YHB A;  3FKI G;  3U50 C;  3PIO A;  3F2D A;  1IYJ B;  4AH6 A;  4JI2 Q;  2JA9 A;  4YY3 L;  2NVX H;  2ATW A;  1CKN B;  5JJK A;  3S1R H;  2UUB L;  5IT9 c;  3RR5 A;  1MKH A;  2KHJ A;  1EFW A;  1Y1V G;  4DV4 Q;  1KHI A;  4A3F G;  1XMO Q;  1QVF A;  5M5W H;  4JI1 L;  2LXK A;  3NEM A;  1I50 H;  4JI3 L;  4QL5 A;  4A3I G;  4A3G H;  1X3G A;  1Q7Y C;  2VQF Q;  3I7F A;  3M4P A;  1NJI C;  1J6Q A;  4LW1 A;  4NXM L;  4X66 Q;  4OWW B;  3H0G G;  3CD6 A;  4JI5 Q;  1SMX A;  5LMN W;  4LFB Q;  3CP0 A;  2IT1 A;  2PQA B;  2R7D A;  5M3M H;  3S1N H;  1QVC A;  4DK6 C;  1H95 A;  4R4I A;  2E5L L;  3U58 A;  3PIP A;  1N33 Q;  3BU2 A;  2RCN A;  1UWV A;  2NVY H;  2K5H A;  5AJ3 Q;  1HNW L;  3K80 C;  3CME A;  5IWA L;  1VQ5 A;  4LF7 Q;  3HOY G;  1OXS C;  4DUZ Q;  1IBK Q;  2WFW A;  3GTG H;  2NN6 G;  4EX5 A;  2E8G A;  2IHF A;  1YEZ A;  3PF5 A;  3D0F A;  1Y1V H;  2ZJP A;  4A3F H;  1PH4 A;  3GD7 A;  4B3S Q;  3HOX G;  4DV2 Q;  2EIF A;  1VQF A;  4A3D G;  4DV1 L;  2YTY A;  2IX1 A;  4QJF A;  4HJ8 A;  4MNO A;  4QQB X;  3U4Z A;  5M3F G;  1N34 L;  4R1J A;  2Q2I A;  1KQS A;  4DPG A;  1AH9 A;  4PG3 A;  2OQK A;  1PH5 A;  1J5E L;  4OWT B;  4UY8 C;  4DV3 Q;  1JT8 A;  3AEV A;  1HH2 P;  1WFQ A;  2NN6 I;  3RN5 A;  4P74 A;  5GQO A;  2NVT H;  1N32 Q;  2RF4 A;  4MZ9 A;  4LF9 L;  1GD7 A;  2MO1 A;  5K36 G;  3M4O H;  4JCV E;  1XMQ Q;  1IBL Q;  1A0I A;  2MO0 A;  1KRS A;  1X55 A;  3I2Z A;  3Q8D A;  1HNX L;  3S16 H;  1YHA A;  4HID A;  5IYB G;  3HKZ G;  5E7N A;  4KHP L;  5IY0 A;  1FJG Q;  4BBS G;  2ZM6 Q;  1WCM G;  4DR4 L;  1B8A A;  2ES2 A;  4X62 L;  5JJL A;  3GTL H;  4HIK A;  1RL2 A;  2DUD A;  4JI6 Q;  4QGU A;  4HJA A;  4X6A H;  4ME3 A;  4AYB G;  1SFO H;  1PHJ A;  3CMA A;  4X64 L;  4DR2 Q;  3K81 C;  4A3J H;  4JI0 L;  2QGQ A;  4JI7 Q;  3GTO H;  3CCS A;  2AMC B;  4L5Q A;  4L5R C;  5M3F H;  3BZC A;  1KD1 C;  3HKS A; 
#chains in the Genus database with same CATH topology
 3EVQ A;  1VQG A;  1YNN C;  3DWP A;  3MXN A;  2M00 A;  4POF A;  5E3F A;  3CQZ H;  3HRZ C;  2PZT A;  2Q2T A;  2F0M A;  2PYK A;  3SVM A;  4RCN A;  3SK6 A;  2OEO A;  3KDF B;  3RZO B;  1Y14 B;  2L55 A;  1C48 A;  4R4C A;  2OXP A;  1G2T A;  5C3E H;  3SGI A;  4GLA C;  4CJ1 B;  1HUM A;  2RHS B;  3A7A B;  5EJW A;  5I2Y A;  4DV4 L;  4A3E B;  1XMO L;  4POG A;  1A63 A;  2JN4 A;  5FK9 C;  2MJ8 A;  3PSI A;  2R7F A;  2FJ2 A;  3ULJ A;  3AFQ A;  3J80 E;  1I4H A;  2VS1 A;  2VQE Q;  1SYD A;  1CQF A;  2XTI A;  3PUX A;  1GUG A;  3X3M A;  4FYD A;  1I4Q A;  3JAM i;  5I6Y A;  4DV7 Q;  3Q24 A;  4BY7 G;  2NZO A;  1YJN A;  5FO9 B;  5C4J H;  1N33 L;  1U5K A;  3I8Z A;  4IPC A;  4YWK A;  3H3V I;  1Y1W H;  1LV9 A;  2NTS A;  3JC6 6;  1JE4 A;  4IFD G;  1VQJ A;  1JQY D;  1VQE A;  4EQO A;  2AKW B;  1JIC A;  5C5M A;  2EJM A;  3H3V H;  1FR3 A;  1K83 H;  2PNR C;  1YJW A;  4O0A A;  4XIG S;  3QB3 A;  2XN9 C;  3AMU A;  3O13 A;  3VA7 A;  2Q2U A;  1TQO A;  3J81 i;  3CU7 A;  3GDE A;  4H02 A;  4DV3 L;  1HNZ Q;  4LF6 L;  3EIV A;  1A3U A;  5CV9 A;  4BY7 H;  4IFD I;  4GNX A;  3GQB A;  4BY1 H;  4TRD A;  3PO3 G;  2HCC A;  1Q1B A;  3GTQ H;  4M8A A;  1E3P A;  1Q81 C;  3SK8 A;  4NMZ A;  1AP0 A;  4ODG A;  3HOU H;  1SNP A;  3VYT A;  2AUK A;  3PGZ A;  3DEO A;  1VS0 A;  2ENB A;  1FJG L;  2ZM6 L;  1ET9 A;  3CC7 A;  1LO5 D;  4FF2 A;  2F0S A;  2DNC A;  2Z6K A;  2H4O A;  2ICE C;  3W3A A;  1O7I A;  1TWH H;  1PH3 A;  4B3T Q;  2I07 B;  1G2S A;  3SR1 A;  5C4X B;  1R4Q B;  1Z9F A;  4KI0 A;  4MIU A;  1E0B A;  2L0C A;  2I0Q A;  2K5N A;  5EGT A;  3UDG A;  1WD0 A;  3PO3 H;  5COR A;  3MFY A;  4YHH L;  4JYA L;  2A68 D;  5DM6 3;  2BOS A;  4A3M B;  4FXD A;  5CV8 A;  5EAY A;  4LWC A;  4JOI C;  1D5Z C;  4A3K B;  1LYL A;  2JXM B;  3M3Y H;  5LMN L;  3HG9 A;  2PZU A;  2ZTE A;  3STB C;  3C2P A;  1NMG A;  1PRT D;  2EY6 A;  1YZ6 A;  1B7Y B;  3MHB A;  3FMC A;  1VQ6 A;  1CA6 A;  3MXG A;  2F0I A;  2KEN A;  1K3B C;  3MAQ A;  3ERS X;  2PQE A;  1PYW D;  2WAC A;  1QIL A;  1FNV A;  1BUV T;  4O2D A;  2EXZ A;  1STE A;  3ULL A;  4IOC A;  3J7Y W;  3CCV A;  1KTK A;  1QCB D;  4A75 A;  4K2K A;  1JWM D;  2N3S A;  4YWL A;  4FXK C;  1KAW A;  1DCZ A;  2F3W A;  1YVC A;  4NXN L;  5IP7 G;  1WVL A;  2I5H A;  4GS3 A;  3NBH B;  2CWP A;  1A3V A;  4R9W A;  3IRB A;  1VQK A;  1VF7 A;  4JV5 Q;  3D4W A;  4K8I A;  3MWY W;  2KA7 A;  1NSN S;  4DR6 L;  4CKB A;  4DR5 L;  4LF8 Q;  3IKJ A;  1JWS D;  4A3E G;  4TQU S;  1I6H H;  1RF2 D;  1M8A A;  4RGM A;  3A8J E;  3PUV A;  2WB1 G;  4NPS A;  4XTC S;  3TRE A;  1J8I A;  3ITP A;  1NTG A;  2B63 B;  3BS1 A;  3BYT B;  4KN7 C;  4M1U B;  3BJU A;  2MHV A;  1U0L A;  2B8G A;  4KN4 C;  5CV5 A;  1GJX A;  2BE5 C;  4H0L C;  4KHZ A;  3NTH A;  1K8A C;  3A54 A;  4DV0 Q;  2RKS A;  2EY1 A;  1N36 Q;  4KJO A;  3PIP 3;  1PXU A;  1JR0 D;  2L1B A;  2TMP A;  2JA5 G;  1HZC A;  2FMC A;  1KNE A;  3T1H L;  1QVG A;  1JE5 A;  3E9H A;  3LGJ A;  3HFZ B;  5JJI A;  3E3X A;  1W6J A;  1Q1E A;  1YHQ A;  1EY8 A;  4Y7N B;  4DUY L;  1KL9 A;  3CCQ A;  4WJ3 M;  4X3S A;  3UDF A;  4J1M A;  3HOV H;  5ELO A;  4JI4 Q;  2VW9 A;  1U4M A;  3S1Q H;  4KY5 A;  3S24 A;  3NPP A;  3HOZ H;  4CDD C;  1GVP A;  2PQA A;  1SDF A;  2R93 G;  5LL6 X;  1PA6 A;  4J15 A;  2JA5 H;  2UU9 Q;  1F9P A;  1WTX A;  1MJC A;  1NE3 A;  4A3D B;  3MXU A;  3S1M B;  2G9D A;  3P20 A;  3UE1 A;  2SDF A;  3K7U C;  2F0P A;  4K8J A;  1O80 A;  3VR4 A;  3QG1 A;  4GLV B;  2F4V L;  3GTJ B;  4YY3 Q;  5E1F A;  3T1Y L;  3ONA B;  1F9S A;  4LUZ A;  5IP9 G;  1BCP C;  1SAP A;  2UUB Q;  2B2T A;  1X3E A;  5C4X G;  2GVB A;  2JJQ A;  1VQ4 A;  2R93 H;  1WCM B;  4IUV A;  1ZEQ X;  1XNQ L;  1PFN A;  5EPK A;  3AB9 A;  2EQS A;  4HED A;  4YIJ A;  1FD7 D;  3BDC A;  5C0X J;  2OTL A;  2B2U C;  4A76 A;  1PMR A;  1TWG B;  4GOP B;  4B3R L;  1HZ9 A;  4DU9 A;  4CGY B;  4A3M G;  1TS2 A;  1R9T B;  3VDY A;  1WTP A;  4A3K G;  5KND A;  1GUO A;  5IWA Q;  1GUW A;  1SE3 A;  2NN6 H;  1BKB A;  1EIG A;  4B08 A;  5IP9 H;  1EYA A;  2PMZ B;  2RHQ B;  1V9P A;  3UDI A;  3K57 A;  1BVS A;  2CVR A;  1EEI D;  3L7Z C;  5HGQ A;  1KNA A;  1XXG A;  1SNQ A;  4RFB A;  1VQL A;  3I72 A;  4X3U A;  4IUN A;  3K0X A;  2B2V C;  5M5W B;  1PZK D;  2EE1 A;  1S5E D;  3PCO B;  2PI2 E;  4A3G B;  1ENA A;  4LFC L;  4GN4 B;  1HNZ L;  4K2L A;  4QB4 A;  2ZTC A;  5IGE A;  5IYB H;  4CDF C;  4KHP Q;  2HUG A;  1TII D;  3L0O A;  5M3M B;  1CKM A;  1CQV A;  3HEJ A;  3G4S A;  1Y8P B;  1Y8O B;  3P1H A;  1O78 A;  1SJE D;  3QJY A;  3R2T A;  2CH4 W;  4PZ8 A;  5I6W A;  1CTM A;  4HIM A;  1Y1V B;  3BG3 A;  3T13 A;  2Z8L A;  4UPA A;  4LF5 L;  1U4R A;  2B63 G;  2BA1 A;  3WOE A;  5IOC A;  3AYH B;  1VQA A;  2EYO A;  3U50 C;  3KUP A;  3PIO A;  2C5C A;  1GUT A;  3DHQ A;  1H9R A;  3DWQ A;  4Z9C B;  2KHJ A;  1Y69 U;  1EFW A;  4DV4 Q;  1XMO Q;  1GHJ A;  4JI1 L;  1STA A;  3TZD A;  1I50 H;  3OIQ A;  5ELF A;  3LX0 A;  1QNU A;  3I7F A;  1HA5 A;  1EFI D;  1NJI C;  4NXM L;  3GTL B;  2TSS A;  2KEC A;  4OWW B;  2KQ3 A;  3NUC A;  4EQP A;  1V8Q A;  4OHJ A;  2E5L L;  3U58 A;  1N33 Q;  3BU2 A;  2RCN A;  1UWV A;  4MHE A;  4KKU A;  4O1N A;  1HNW L;  4G57 A;  5D3I B;  1VQ5 A;  1BQQ T;  1ENC A;  3CQZ B;  3HP3 A;  1KDA A;  3A56 A;  1XYI A;  4RHR A;  3LWU A;  1ZXT A;  2IHF A;  5KGU A;  1GHK A;  4CKE A;  2ZJP A;  3GTP B;  4A3D G;  2EIF A;  5C3E B;  1HTP A;  5M3F G;  1F2Y A;  4R1J A;  4DPG A;  1NCV A;  3CRL C;  3I4L A;  1AH9 A;  2OQK A;  1SSO A;  4UY8 C;  4DV3 Q;  4C1N I;  1HH2 P;  5T1I A;  1WTW A;  3NSW A;  4MZ9 A;  1I4X A;  3I4N B;  2KJX A;  1GD7 A;  1O7Y A;  1WTH A;  1A0I A;  3I2Z A;  3KBG A;  3S16 H;  1S5B D;  5E7N A;  4H44 C;  4DGZ A;  1FJG Q;  5C4J B;  2ZM6 Q;  1WCM G;  2QDL A;  1ONL A;  1B8A A;  5JJL A;  3MTS A;  1Y1W B;  4H13 C;  1RL2 A;  4QGU A;  4X6A H;  5CYU A;  2K05 A;  3K81 C;  4A3J H;  3MC0 B;  4UAI A;  3P7J A;  3CCS A;  3KK7 A;  1WTQ A;  4L5R C;  5M3F H;  3BZC A;  3HKS A;  1LLR D;  1SXT A;  1DM0 B;  3S9W A;  1E22 A;  4HJ5 A;  1XPU A;  1K83 B;  5CR3 A;  2LXJ A;  3VR6 A;  5T1G A;  1MIU A;  2CHB D;  5LHY 1;  4YHH Q;  3NHH A;  4JYA Q;  4JI2 L;  5EKK A;  2HCI A;  4QMG A;  3KJP A;  4UDU C;  4BY7 B;  1TS3 A;  1DD2 A;  4BY1 B;  5C44 G;  2KVM A;  2JEB I;  4R8I A;  1B3A A;  1C7Y A;  4LNQ A;  2KCC A;  3GTQ B;  4L5S A;  2WKD A;  5LMN Q;  5M5Y H;  5C5L A;  3MFG A;  1KDB A;  3HOU B;  3D31 A;  3E0E A;  4A3G G;  3RZD H;  2NUC A;  1B9N A;  3M4Q A;  3PF4 A;  4LUV A;  5CMD A;  1HFG A;  3QOL A;  5CGK A;  4BA1 I;  1PH7 A;  4LFB L;  2BH8 A;  1TWH B;  1AZP A;  2A68 C;  1TWA H;  1PTO H;  1AEX A;  1IBK L;  4DNT B;  3KJO A;  3A7L A;  3FRP B;  2XWB B;  1V1P A;  4Q5V A;  3PO3 B;  5C44 H;  1FGU A;  3CW2 C;  3FEW X;  1HXY D;  4DV2 L;  4QUF A;  2HQE A;  3PO2 H;  5EPL A;  1NBW A;  1I3Q H;  2DN8 A;  1PRT C;  2XSC A;  4NP5 A;  3JAM c;  4NXN Q;  1LTG D;  2CKZ B;  4DK3 C;  3G6J B;  2PPB C;  2WAQ B;  3V96 A;  1SYC A;  3F1Z A;  4OGQ C;  2F0H A;  3M3Y B;  3TSS A;  5EKI A;  2K5Q A;  4DR6 Q;  4HJ9 A;  1ASY A;  4DR5 Q;  3HGB A;  1E24 A;  1IBL L;  4YCV A;  3I4O A;  3DUZ A;  5KRU A;  3CF5 A;  3I3C A;  1KC8 C;  1V1Q A;  2FFK B;  1Q90 A;  4UP9 A;  1FGB D;  4XYO A;  3TBI B;  2Y0S B;  1SR3 A;  5JEA J;  5IYD H;  3HOW H;  2JA6 H;  1A62 A;  1BXT A;  3K58 A;  3I56 A;  2VZA A;  1LT4 D;  4WFN 3;  2NZH A;  4F87 A;  1ESF A;  3J81 c;  2K04 A;  3T1H Q;  3BZD B;  3M4Y A;  2LKV A;  2L9H A;  4GN3 B;  3CCL A;  4WJ4 A;  2EVB A;  2EY5 A;  1K3R A;  1X56 A;  3F2C A;  1I6V C;  4DUY Q;  1K8O A;  4OWX B;  4Y52 H;  2JEA I;  2K4K A;  5DLQ E;  2AWO A;  4RHS A;  4DXG A;  2K1B A;  3T4A C;  2A19 A;  2N8N A;  4HTH A;  5C3E G;  4IOA A;  4PNY A;  1KIX A;  3FPP A;  1STG A;  4JOI A;  4OEL B;  5KNC A;  1X3F A;  1I6H B;  2H5X A;  4RKL A;  1G8Z D;  4JC0 A;  2HIV A;  3I4N G;  3RN2 A;  1CT1 D;  3NQI A;  2E2D C;  2AQ3 B;  5JPN C;  1B70 B;  3NEN A;  5DEH A;  2CQA A;  3C46 A;  5JAV A;  4JBW A;  2A6E D;  3CC4 A;  1G29 1;  1PTO F;  1UAP A;  2F0F A;  1Y1W G;  2F4V Q;  3GTP H;  4HN7 A;  2IWH A;  2KHS A;  3L9A X;  3T1Y Q;  1PH2 A;  5FO8 B;  3NWS A;  1PH9 A;  3MXN B;  2L12 A;  1VQN A;  1Q8I A;  4S3S A;  5H1S E;  1V1O A;  3PV0 A;  3HOV B;  5ELE A;  4FP5 D;  3MA2 B;  1BBW A;  1ML0 D;  4HCE A;  2WB1 B;  3I90 A;  1F77 A;  4IAL A;  3S1Q B;  3PIO 3;  5FO7 B;  1XNQ Q;  3R93 A;  3HOZ B;  5CC4 A;  2A73 B;  3I4N H;  1AE3 A;  1QG7 A;  2EYH A;  1S72 A;  2OTJ A;  4CHT B;  4GLX A;  4B3R Q;  2CQO A;  2HDM A;  1EIY B;  2EJG C;  4BY1 G;  1SND A;  1CM9 A;  2JA5 B;  2SOB A;  5JEA H;  1CFM A;  1F9Q A;  1SBB B;  3BDL A;  3H15 A;  1CUK A;  2K5V A;  1WD1 A;  3HOU G;  2A1A A;  3RLF A;  1HUN A;  2UXD L;  2CWA A;  1N8R C;  5G3L F;  3OPO A;  1TVX A;  1B2T A;  3RMH A;  1Q86 C;  1B50 A;  3E9I A;  1HRJ A;  3NK9 A;  4CDC C;  4F88 A;  2RCF A;  3OSO A;  5BN4 A;  1STH A;  1VQC A;  3PUZ A;  5AFW A;  3JAM E;  4A3B G;  5GRO A;  4LFC Q;  1K0S A;  2R93 B;  3CPW A;  1W2B A;  3TS2 A;  1D5X C;  4MTN A;  2PNH A;  3W5O A;  5IYC H;  1SRU A;  1UNS A;  1VQH A;  2R61 A;  2K6A A;  2H1E A;  2KHI A;  3CCE A;  2KBN A;  4MN3 A;  4GNX B;  2OWO A;  2WAQ G;  2L15 A;  2PMZ E;  3L2P A;  1I94 L;  4KY6 A;  3UDX A;  2YU9 H;  4A4I A;  1EYG A;  2JA8 H;  1S5C D;  3SK4 A;  1B1Z A;  4DA2 A;  4RGT A;  4OX9 L;  3J81 E;  5FJ8 H;  1YNJ D;  2Z1C A;  1JCK B;  4LF5 Q;  4A3B H;  5GAE C;  2RBM A;  4HMJ A;  3Q22 A;  2D2C C;  3GP7 A;  2Q8R E;  2Z4H A;  2Y0S G;  3FKI H;  2EYF A;  3K5N A;  1I5F A;  1UE6 A;  2ZXP A;  5I9O A;  4K0K L;  5K5P A;  4DR1 L;  2DJG C;  3LNN A;  1E1O A;  2NTT A;  2JE6 I;  3TEH B;  2EXD A;  2YYZ A;  2UXB L;  2KCN A;  1PFB A;  1TWF H;  4JI1 Q;  2VL6 A;  1KLU D;  3TN2 A;  2UUA L;  2MQH A;  1HQM C;  4LJZ C;  2RDF A;  3FVQ A;  4NXM Q;  3DMU A;  5I4D A;  2B2U A;  1QE6 A;  1S40 A;  5BR8 L;  3CCR A;  2MFI A;  2E5L Q;  1G51 A;  4XT1 B;  1LTA D;  4B9X A;  1HNW Q;  2DGY A;  4DK1 A;  4LAA A;  4FO2 A;  3HOY H;  3NE5 B;  5EQ0 A;  5FLX E;  3TS0 A;  5LMU L;  1TXY A;  4C3J G;  2AWN A;  1TKW B;  1S5F D;  4DR3 L;  3HOX H;  1N9W A;  1OO9 B;  3CHB D;  4DNI A;  4AQY L;  4RG1 A;  4PV1 C;  5C3W A;  1W6K A;  5BN3 A;  3U9O A;  5IGC A;  2B2V A;  2LMC B;  1STY A;  3CPF A;  3QR8 A;  4DFA A;  1I50 B;  3CCJ A;  4LFA L;  1LTR D;  2HT1 A;  1TWC H;  1RD9 D;  2JK8 A;  1PH8 A;  2ZT9 C;  1K8G A;  4JVZ A;  3HOV G;  2F0J A;  4PMW A;  2F0O A;  3WDN A;  3TME A;  1IYV A;  2V1C C;  1D6E C;  4R4O A;  4C3J H;  2UUC L;  3RLN A;  2XVS A;  3K0Y A;  5J1Z A;  3HOZ G;  1KRT A;  1IBM L;  1YBY A;  1TT2 A;  1DXM A;  1HPC A;  2EY2 A;  3U9S A;  5FOB B;  1EU3 A;  2E2J H;  1CKN A;  1SRO A;  1VQB A;  3KF8 A;  1DYQ A;  1U9R A;  3J80 L;  2XRQ D;  3SE0 A;  3W1B A;  1XNR L;  1EWH A;  1EU4 A;  3KLS A;  4AH6 A;  4LMQ D;  4JI2 Q;  2R3Z A;  1RKN A;  2NVX H;  2ATW A;  1CKN B;  2M9V A;  5IT9 c;  5M9O A;  1NUC A;  2F3V A;  4A3F G;  1D1K A;  4QL5 A;  3S16 B;  1SNC A;  1IKL A;  2J4X A;  4LW1 A;  1F2Z A;  2F0K A;  5EPJ A;  2WIN B;  1XTC D;  1SMX A;  4LFB Q;  2SNS A;  2R7D A;  2PQA B;  3OW7 A;  5DM7 3;  3S1N H;  4DK6 C;  4A3J B;  2X69 A;  1SEB D;  1ET6 A;  2E75 C;  2NVY H;  5M3F B;  2K5H A;  2XRS D;  3Q0A A;  3C1F A;  3K80 C;  4N9P A;  2WV6 D;  2O5J C;  1OXS C;  1IBK Q;  4ZKB B;  3IAY A;  3BYY B;  4KJN A;  4DN4 M;  2A74 C;  2NN6 G;  2E8G A;  4A3F H;  3OMG A;  4DV2 Q;  1VQF A;  4WOR A;  1F2M A;  2D9U A;  1E2V A;  4DV1 L;  5EBC A;  3IFT A;  4QQB X;  5DNF A;  3VR2 A;  1N34 L;  2VXW A;  4IUT A;  4G4K A;  4K14 A;  1LAC A;  4PG3 A;  2B39 A;  4RH6 A;  1J5E L;  4OWT B;  4KKS A;  5M5Y B;  1CI3 M;  5ISR A;  1WFQ A;  2BDN A;  2NN6 I;  2K5D A;  4P74 A;  1DJR D;  3J81 L;  3RZD B;  1IBL Q;  1X55 A;  1HNX L;  4HID A;  5IYB G;  3HS0 C;  4BBS G;  1PFM A;  4X62 L;  5KYI A;  4CDE C;  5JOB A;  5CV7 A;  1TWA B;  2DUD A;  5HGT A;  1R4P B;  2XWJ B;  4HJA A;  4DK0 A;  1PTO B;  1ZYR C;  2QW7 A;  3CMA A;  4DAP A;  4ILW A;  2IW3 A;  2AMC B;  4L5Q A;  1QJO A;  1HFN A;  5C44 B;  4ZRZ A;  1CHQ D;  3X3N A;  1HZB A;  1FVI A;  4XQN A;  1HR0 W;  1VQP A;  2ASB A;  5JVG 3;  3PO2 B;  3OW2 A;  2FXQ A;  1I3Q B;  2WAQ E;  4B9W A;  1P16 A;  2JA7 H;  1CKO A;  5FLM H;  3FP9 A;  1SYG A;  3F2U A;  4PMC A;  2E74 C;  5E4X A;  2K28 A;  2XGT A;  1BBX C;  4BBS H;  3FHW A;  1OXX K;  1SYE A;  4OO1 I;  2YV5 A;  4IN3 A;  2Y0S E;  2VQF L;  1XJV A;  5C0X G;  1CHP D;  2QEX A;  4R8N A;  1GM5 A;  3NXW A;  1VQM A;  1PYS B;  3HOW B;  2JA6 B;  4OO1 H;  4X3K A;  2NWG A;  3AFP A;  4XDX A;  1SN8 A;  3ERQ A;  4IPG A;  1MJE A;  3ND8 A;  3K59 A;  2Z4I A;  2L5T A;  4K6D A;  5ELB A;  3M85 A;  5CBE E;  5AJ3 L;  1G6Z A;  4KLK A;  1E1T A;  1CA5 A;  4LF7 L;  3BZK A;  4DUZ L;  5C0X I;  2RSO A;  4YCU A;  1FNW A;  3RD4 A;  1SE4 A;  1PZI D;  1EOT A;  4RKB A;  3G71 A;  2HD3 A;  1ICW A;  1T9H A;  4OEM B;  5A2Q E;  1C0A A;  3SK5 A;  5IT9 E;  1JC7 A;  4B3S L;  4ZYS A;  1SYF A;  4R4T A;  3RLO A;  4KK7 A;  5C0X H;  1IKM A;  2VNU D;  1IW7 C;  5L37 A;  2CW0 D;  1DOK A;  3MEH A;  1C8C A;  4HJ7 A;  4NB3 A;  4HMI A;  1K9M C;  1N32 L;  2A6E C;  1J9O A;  1RIP A;  3J7Z C;  2F0N A;  2WII B;  5TSS A;  3G48 A;  1VMP A;  3KBX A;  4A3L H;  5KNB A;  1DON A;  4RWS C;  2UXD Q;  5KIX A;  3IFD A;  1LTI D;  2F0T A;  4LK1 C;  4ZUJ A;  1JOR A;  1SNO A;  3EN2 A;  4JI6 L;  3MZ5 A;  3E0J A;  1HHV A;  4DR2 L;  4C3I H;  1I4G A;  4JI7 L;  3ERO A;  1BOS A;  5BN5 A;  4A3J G;  4BBR H;  3K7A H;  1UEB A;  2E2I H;  2AQ1 B;  2WB1 E;  3A8K E;  2ALY B;  2NVQ H;  2DNE A;  2O5I C;  5C6A A;  1PLF A;  2AHO B;  1EQR A;  1P8L A;  2GA4 B;  3I70 A;  1OXV A;  2QA4 A;  4CBV A;  1PZJ D;  1VCI A;  2ZTD A;  2QF7 A;  4A3C H;  3GTM H;  1LT6 D;  2DJF C;  2OF1 A;  2EZV A;  1KLG D;  2B8F A;  2N49 A;  2XNA C;  1SMY D;  2JQO A;  1BCP F;  4GOP C;  1CZW A;  5ELD A;  1XWE A;  4EQN A;  3ER0 A;  1NMF A;  2HIX A;  1I94 Q;  2R7Z G;  3D6C A;  4F8M A;  3BDO A;  3I4M H;  5M5X H;  2MNA A;  2VY3 A;  2SNM A;  4OX9 Q;  1AW7 A;  3KYH C;  1GXD C;  4N9T A;  1KXL A;  2M2L A;  1MSH A;  1A2U A;  4DXF A;  4RGN A;  4TVA B;  2DY7 A;  2K14 A;  5IE8 A;  3I73 A;  4K0K Q;  4DR1 Q;  3N52 A;  3PQI A;  1EWC A;  2PW5 A;  4UP7 A;  3EA6 A;  4OIK A;  3ULP A;  4DV6 L;  2UXB Q;  1EQQ A;  1GO3 E;  1Q82 C;  2RDG A;  4IO9 A;  2UUA Q;  4JPB W;  4EVO A;  2R7Z H;  3PO2 G;  2HDL A;  2A69 C;  1QWY A;  1PFS A;  3K8A A;  1VQ7 A;  1K8M A;  1YNJ C;  1K0R A;  2F3I A;  2F03 A;  1STB A;  5NUC A;  1Z6H A;  1CSP A;  2YU9 B;  4BA2 I;  2MPM A;  5BR8 Q;  2JA8 B;  1UUP A;  4ZQ3 A;  3J7A 5;  4RCO A;  1LUZ A;  2K7V A;  2UXC L;  2K32 A;  3D6W A;  2GN5 A;  4XT3 B;  5IGB A;  4F7X A;  4N8F A;  2O2L D;  1NR4 A;  4DR4 Q;  1OXU A;  5LMU Q;  2VUM H;  4A3B B;  2PW7 A;  4HCS A;  4DR3 Q;  4P72 A;  3FKI B;  3DLL A;  4APV A;  1HR0 L;  5IYD G;  3HOW G;  1L1O C;  3H94 A;  2JA6 G;  1EIH A;  1L0W A;  4N8X 1;  5HUR A;  4AQY Q;  3GTG B;  1IL2 A;  3S14 H;  1A3T A;  1SNM A;  2KEE A;  4J8Q A;  1ZYR D;  1TWF B;  3NWT A;  2L11 A;  2E2H H;  2F0E A;  2E76 C;  1V1P B;  4LFA Q;  4LF4 L;  3V2T A;  1EY5 A;  2FIN B;  2EDG A;  1UE7 A;  5FKA C;  4GKJ L;  2PI2 A;  2EPB A;  2RDH A;  2QEJ C;  2BH2 A;  4ZUI A;  4ZK9 B;  2UUC Q;  3M4O B;  5IGD A;  4L6T B;  2WKC A;  4K5X A;  4DV5 L;  5EKL A;  3S2H H;  4QY7 A;  1IBM Q;  1RDP D;  3HOY B;  4G7O C;  3F8T A;  3AU7 A;  4DKA C;  2I5M X;  4OL7 A;  1B53 A;  4B3M L;  4RAU C;  3HOX B;  3A55 A;  1HTL D;  4PZ7 A;  4IQZ A;  4GKK L;  1HZA A;  3OTO L;  3VYR A;  4NW2 A;  1XNR Q;  3GTK H;  1Q46 A;  3MEF A;  1LAB A;  4JG2 A;  2IL8 A;  2CH4 A;  3D4R A;  5CV4 A;  1OTC A;  4WJW A;  2F4I A;  4JW0 A;  1TWC B;  1AE2 A;  1NNX A;  5JVH 3;  1EL0 A;  1CZG A;  3VR3 A;  1Q12 A;  2R92 G;  3NQT A;  4A3I H;  2HHH L;  2LSS A;  1L2F A;  3HKZ B;  5F2D A;  4G7Z C;  3UE0 A;  3OOC A;  4QIW B;  2HQL A;  2CFM A;  3KOJ A;  3W1G A;  4C3J B;  3PUW A;  3H0G H;  4P71 A;  4AYB B;  3L3O C;  4K5V A;  2B3G A;  4DR7 L;  1PVO A;  2C35 B;  2OCE A;  2ZJR A;  2IY5 B;  1IW7 D;  4ALP A;  1TR5 A;  4ID6 A;  1M1K C;  1VQ9 A;  1S5D D;  2E2J B;  3A0J A;  3M7G A;  5JEA G;  5FLX c;  1G6P A;  1D8L A;  2QDB A;  1YJ9 A;  5CBA E;  3H3V C;  3KLW A;  4K6L A;  1EIF A;  5I2X A;  2K52 A;  4IFD J;  2R92 H;  3KFU A;  2KCT A;  3R2I A;  1HJP A;  4DV1 Q;  2FHT A;  3D3R A;  3KDF A;  2NVX B;  2A6H C;  3J80 i;  5C4Z A;  1BDO A;  1QUQ A;  1KAB A;  4X65 L;  1N34 Q;  1Y8N B;  4FXG C;  1J5E Q;  5D14 A;  4HAE A;  1A15 A;  3EFX D;  5K36 H;  2YTX A;  1UE1 A;  1QUQ B;  1XTD A;  2J7Z A;  4C3H H;  3I55 A;  2ZXO A;  1BO0 A;  2P5Z X;  4JI8 L;  4IUQ A;  1HNX Q;  2D0O A;  3ICE A;  1F9R A;  1LT5 D;  4UP8 A;  3MVV A;  1EOV A;  4IJH A;  2C9O A;  5CV6 A;  5IYC G;  3S1N B;  1DGS A;  3S17 H;  2NB0 A;  3DM3 A;  2Q8T A;  1EY0 A;  4X62 Q;  1VF5 C;  2NVY B;  2J0T D;  4TSS A;  4QCL A;  3A8I E;  3A5U A;  4WRD A;  3G6E A;  1IZ6 A;  1JWU D;  3VYU A;  2JA8 G;  4ZCK A;  3S15 H;  4A3F B;  3QWN A;  5FJ8 G;  2D62 A;  3U4V A;  1UEA B;  4JBM A;  4DF7 A;  2F52 A;  3DWA A;  3J81 j;  1CSQ A;  3FKI G;  1E2W A;  1PTO D;  1X3Q A;  1IYJ B;  2B2W C;  3R3O A;  2JA9 A;  2B2Y C;  3S1R H;  1EYD A;  1DOM A;  1JB3 A;  3RR5 A;  1KHI A;  2MUY A;  1WTV A;  4JI3 L;  1B9M A;  3K5L A;  2NZ1 D;  1X3G A;  1Q7Y C;  4GZY C;  2F1M A;  4KV6 A;  2VQF Q;  1VDZ A;  1PRT F;  3M4P A;  1J6Q A;  1EYC A;  4X3T A;  3Q23 A;  5EBD A;  2K5W A;  2A69 D;  1Q3L A;  2RA4 A;  4JK1 C;  3CD6 A;  4KKT A;  2JSO A;  3OMC A;  1PDQ A;  1GOZ A;  5AJ3 Q;  3K5M A;  3CME A;  5D65 A;  5IGF A;  4LF7 Q;  3HOY G;  4IFD H;  4DUZ Q;  3DEP A;  1FYC A;  2FMM A;  3GTG H;  2KUM A;  1RHP A;  2JA7 B;  1NAP A;  1YEZ A;  4RA8 A;  5G3L D;  3Q6S A;  1TS5 A;  4B3S Q;  5IGG A;  3HOX G;  4MTK A;  2F0L A;  1EQT A;  2KED A;  3CKI B;  3QO2 A;  2YTY A;  5C4H A;  1H9M A;  1AFP A;  4QJF A;  4HJ8 A;  1TY0 A;  4BBS B;  4E6I A;  1U4P A;  2Q8I B;  3D4D A;  1BCP B;  1PH5 A;  5C3X A;  1JT8 A;  4NDX A;  3RN5 A;  2NVT H;  1N32 Q;  2RF4 A;  4LF9 L;  3M4O H;  4A93 B;  4JCV E;  3TZU A;  1KRS A;  4J6H A;  1YHA A;  3TP5 A;  4H7B A;  3HKZ G;  4DR4 L;  3TP7 A;  3NBI A;  5ELC A;  2ICI A;  4HR7 B;  4JI6 Q;  3T16 A;  4ME3 A;  4AYB G;  1SFO H;  4X64 L;  4DR2 Q;  2ZXR A;  4U68 A;  3H09 A;  3GTO H;  4JI0 L;  2QGQ A;  4JI7 Q;  1EY6 A;  3DXJ C;  1KD1 C;  4HSV A;  2CW0 C;  2A5H A;  3AQQ A;  4V0B A;  3J7A V;  1LTS D;  4L5T A;  2IJ0 A;  4HIO A;  4AIM A;  1LTT D;  4DNR B;  4L63 B;  5JPM C;  3S2D H;  5IIF A;  1BBU A;  3EJI A;  2F0Q A;  4JBJ A;  3NBH A;  3TDQ A;  2IX3 A;  2KOL A;  2JYO A;  1RCV D;  1OXT A;  2AQ2 B;  1G91 A;  3BVG A;  4IPH A;  1UE5 A;  2IPK D;  4ZLT F;  3I91 A;  4R4Q A;  1YI2 A;  1EUJ A;  3KF6 A;  1H9K A;  2XIW A;  5COY A;  3E6Z X;  5J22 A;  4X66 L;  1QNK A;  2QIL A;  4JI5 L;  1II3 A;  1V43 A;  1YIJ A;  4I65 A;  4C3I B;  4FF1 A;  4DAM A;  1X3P A;  4BBR B;  2K01 A;  3K7A B;  3NEL A;  2E2I B;  3KF6 B;  5KEE A;  2NVQ B;  3WOF A;  1AZQ A;  1D7Q A;  1MI2 A;  2X6L A;  1SMY C;  2N78 A;  1WTO A;  4DV6 Q;  1GKH A;  1H9J A;  3KF8 B;  4C1N K;  1QZG A;  3WWV A;  4C2M H;  1D5M C;  2EYL A;  4KHV A;  4IUP A;  3GTM B;  2NYZ D;  3GV3 A;  1EQV A;  4YCW A;  5IP7 H;  1JJC B;  3RZO H;  2ZJQ A;  2A6H D;  1RTN A;  4IUR A;  2LY7 A;  1YNN D;  4GNX C;  2F0D A;  3I4M B;  4A3E H;  5M5X B;  1HQR D;  1U4L A;  2A8V A;  3V05 A;  3E5S A;  3PUY A;  2UXC Q;  5HY6 A;  1XMQ L;  1IYU A;  3JAM L;  5A35 A;  2VB3 X;  1X54 A;  3TRZ A;  2Z0S A;  4FVM A;  3CC2 A;  1WOC A;  1I4P A;  1FNU A;  3SXH A;  4CJ2 C;  1HR0 Q;  3B6Y A;  4FNF A;  2Z6K C;  5ELN A;  4IJL A;  4O42 A;  3G7L A;  1E7Z A;  2Z9H A;  1D2B A;  3ND9 A;  2G5D A;  3VYS A;  4KMU C;  4PQX A;  1SYB A;  2QKI C;  3C1E A;  2R7Z B;  1EY4 A;  3EQL C;  4FF3 A;  1O7Z A;  1EEF D;  4LF4 Q;  2JA7 G;  1NY4 A;  1X9N A;  1Q8K A;  1IXR A;  4XQJ A;  3EBE A;  4GKJ Q;  1T5E A;  2EYP A;  4TKO B;  5FLM G;  1BNZ A;  3CRK C;  3IL8 A;  1L0Y B;  1BF4 A;  1WJJ A;  2BCO A;  3D8G A;  1ENF A;  4GOP A;  3N6R A;  1VMC A;  1QB5 D;  4DV5 Q;  4P2C B;  1K28 A;  3NP8 A;  2RVL A;  1EWI A;  5J3B A;  1TS4 A;  2VUM B;  4ZAI A;  3HZX A;  2K03 A;  2VQE L;  1DZ1 A;  1PYB A;  4B3M Q;  4XQQ A;  4A93 G;  4DV7 L;  4OO1 G;  4GKK Q;  1MHW C;  1C9O A;  1MBY A;  3OTO Q;  3S14 B;  1EZ8 A;  4UHV A;  3QOJ A;  2SEB D;  4OXP A;  1M4V A;  2E2H B;  2MP1 A;  1RTO A;  4CKC A;  1ILQ A;  1TU2 B;  3GV6 A;  4IZ8 A;  4OIJ A;  1SE8 A;  4U67 3;  4QUC A;  1YNX A;  2N88 A;  5C4X H;  4DAV A;  1JMC A;  3SDZ A;  4IUU A;  2CCZ A;  1LM0 A;  4KD4 A;  2HHH Q;  3T51 B;  1VQO A;  5FLX L;  1SJH D;  3FPU B;  5I9P A;  2F0V A;  3KLS X;  3F2B A;  3MXP A;  1JOK A;  4PZ6 A;  2B29 A;  3H91 A;  2PCF B;  3S2H B;  3CCU A;  4A93 H;  2JP1 A;  4A3M H;  4DR7 Q;  1WI5 A;  1MGS A;  4RGO S;  1IHZ A;  2F0U A;  3NTI A;  3M7N A;  4A3K H;  2DY8 A;  1JOO A;  3CXC A;  3R8B A;  1JJ2 A;  1AN8 A;  2BDO A;  4A3L G;  1JOQ A;  1T5X D;  4NKL A;  4KD3 A;  1ASZ A;  4ZKC B;  3ZYY X;  1XPO A;  3J7A F;  3GTK B;  4BWG B;  1L1O A;  2MGS A;  4I7Z C;  3H6M A;  3C3L A;  2L4N A;  2RQX A;  4B3T L;  1VQD A;  4X65 Q;  3STB D;  4C3I G;  3HKZ E;  1S3O A;  4QF4 A;  4P75 A;  1LTB D;  4BBR G;  4QIW E;  1B3Q A;  4BXX G;  4A3I B;  1L1O B;  1X32 A;  2K33 A;  3CAM A;  1X65 A;  2GVA A;  4BS9 A;  1KAA A;  4P73 A;  2I5L X;  4AYB E;  4JI8 Q;  1PRT B;  3H0G B;  1PH6 A;  4A3C G;  5LL6 S;  1GUN A;  2N55 A;  3P75 A;  1SLJ A;  2R6G A;  1W3S A;  4XYQ A;  4Q0F A;  1TY2 A;  3FDT A;  2EYM A;  3M9B A;  2K75 A;  1MD2 D;  1STN A;  3CCM A;  1EZ6 A;  1XX8 A;  3I4M G;  1H9S A;  4V19 0;  2R92 B;  1IL8 A;  1NR2 A;  3BVM A;  1YIT A;  5GAG C;  4ME5 A;  4CJ0 B;  2B63 H;  4BXX H;  2D0P A;  1M90 C;  1WTR A;  4RMF A;  1VQI A;  1MSG A;  2PZW A;  1H9S B;  2Z6B A;  3TQY A;  3OYY A;  3RNU A;  2WP8 J;  2IX0 A;  3VA5 A;  3ZJY C;  2YTV A;  1C4Q A;  2B2T C;  4C3H B;  1HCZ A;  1ZKO A;  4JBK A;  4JI3 Q;  2BE5 D;  2EJF C;  4ULL A;  1F2L A;  1VQ8 A;  1B44 D;  5D3D A;  1KDC A;  3GO5 A;  1LTL A;  4Y7N H;  1ROD A;  2BA0 A;  3S17 B;  1PV4 A;  4LF6 Q;  3W2D A;  2Q2H A;  1QZH A;  1PH1 A;  2ID0 A;  4JV5 L;  3BVZ A;  4DAY A;  3QIA A;  1X6O A;  4LF8 L;  1PTO C;  5GAD C;  3S15 B;  2QCP X;  3OWF A;  1JB7 A;  1A8V A;  1SE2 A;  2OQ0 A;  4YWM A;  4GN5 A;  2IHE A;  2F0G A;  4DAY B;  2VUM G;  4A3D H;  4PMB A;  3S1M H;  4K5W A;  3A5Z B;  4DV0 L;  3K6O A;  1N36 L;  3S1R B;  1FL0 A;  2X6G A;  3A74 A;  3SHL A;  4C56 C;  4IPD A;  1QOH A;  1RJT A;  3GTJ H;  5JJZ A;  1DOL A;  1L0X B;  2LFN A;  2I46 A;  3LWE A;  4LF9 Q;  1Z7T A;  1I4R A;  4LUO A;  4JI4 L;  4OON A;  1Z47 A;  1BR9 A;  1WCM H;  1JJG A;  1BCP D;  4FDB A;  3PMF A;  5KYL A;  5GAH C;  3J80 c;  4EQ5 A;  1E2Z A;  4I7A A;  1TWG H;  2K50 A;  4X64 Q;  1D1I A;  4HSP A;  1R9T H;  4JI0 Q;  2UU9 L;  1WYD A;  3URY A;  1CK1 A;  2NBF A;  3K5O A;  1EY9 A;  2KCM A;  4G7H C;  5M3M G;  3VR5 A;  3KLR A;  3SEB A;  1K73 C;  1XPR A;  5J39 A;  1YHB A;  3F2D A;  2B2W A;  2EYJ A;  5DAU A;  2B2Y A;  4YY3 L;  5JJK A;  2UUB L;  1MKH A;  1Y1V G;  2NVT B;  1QVF A;  5E4W C;  5M5W H;  2LXK A;  3NEM A;  4A3I G;  4A3G H;  4XXE A;  5A2Q L;  1EY7 A;  5IT9 L;  2AUJ D;  4X66 Q;  3H0G G;  4JI5 Q;  5LMN W;  1GUS A;  1S4Z A;  3CP0 A;  1SFO B;  2IT1 A;  5M3M H;  1QVC A;  3GTO B;  1H95 A;  4R4I A;  3OWE B;  3PIP A;  4ABN A;  5IWA L;  1ICF B;  2F0W A;  2WFW A;  4KY7 A;  1A6X A;  2RSN A;  4EX5 A;  3PF5 A;  1B4O A;  3D0F A;  1Y1V H;  1PH4 A;  3GD7 A;  4FF4 A;  3S2D B;  3T53 B;  3TP8 A;  3OHX C;  3UI2 A;  2OT2 A;  2IX1 A;  3T56 B;  4MNO A;  3RUZ A;  3U4Z A;  1LT3 D;  4L8J A;  2Q2I A;  4KTA A;  1KQS A;  1HA6 A;  3AEV A;  2G9H D;  5GQO A;  2MO1 A;  3DM1 A;  5K36 G;  4C3H G;  1XMQ Q;  2MO0 A;  3Q8D A;  3TP6 A;  4KHP L;  5IY0 A;  5IOD A;  2EOT A;  2ES2 A;  1A2T A;  3OIP A;  3GTL H;  4HIK A;  1ILP A;  2O4X A;  2D5D A;  1ESR A;  2LS0 1;  1PHJ A;  1O7L A;  2V4D A;  3NTK A;  2VB2 X;  4EGV A;  2PO4 A;  4C2M B; 
#chains in the Genus database with same CATH homology
 1HZB A;  1FVI A;  1VQG A;  1HR0 W;  4POF A;  3CQZ H;  1E22 A;  3AQQ A;  1VQP A;  4HJ5 A;  3OW2 A;  2FXQ A;  2Q2T A;  2ASB A;  1XPU A;  2LXJ A;  2WAQ E;  4L5T A;  1MIU A;  1P16 A;  2JA7 H;  4HIO A;  4AIM A;  3KDF B;  1CKO A;  1Y14 B;  4R4C A;  4YHH Q;  3S2D H;  4JYA Q;  4JI2 L;  5FLM H;  5C3E H;  1BBU A;  3SGI A;  3KJP A;  4GLA C;  4JBJ A;  3FP9 A;  2RHS B;  5C44 G;  2XGT A;  2JEB I;  4BBS H;  1C7Y A;  4DV4 L;  3FHW A;  1XMO L;  1OXX K;  4OO1 I;  4LNQ A;  4POG A;  2YV5 A;  4L5S A;  1A63 A;  1OXT A;  3PSI A;  2R7F A;  2Y0S E;  5M5Y H;  5LMN Q;  3ULJ A;  3AFQ A;  4IPH A;  1UE5 A;  3D31 A;  3E0E A;  5C0X G;  2VQF L;  1XJV A;  4A3G G;  2VS1 A;  3RZD H;  2VQE Q;  3M4Q A;  4R4Q A;  2QEX A;  3PF4 A;  1YI2 A;  1GM5 A;  1EUJ A;  1PYS B;  2XTI A;  3KF6 A;  3PUX A;  1VQM A;  4LUV A;  3AFP A;  3JAM i;  1SN8 A;  4X66 L;  4DV7 Q;  4IPG A;  4BA1 I;  4JI5 L;  1PH7 A;  1MJE A;  2NZO A;  1YJN A;  4BY7 G;  4LFB L;  1V43 A;  2BH8 A;  5C4J H;  1YIJ A;  4DAM A;  1U5K A;  1N33 L;  3M85 A;  4IPC A;  4YWK A;  3H3V I;  1Y1W H;  1TWA H;  5AJ3 L;  3NEL A;  3KF6 B;  4KLK A;  1E1T A;  4LF7 L;  3BZK A;  3JC6 6;  1D7Q A;  4DUZ L;  1IBK L;  5C0X I;  4YCU A;  3KJO A;  4IFD G;  3G71 A;  1VQJ A;  2N78 A;  4DV6 Q;  1GKH A;  1T9H A;  1VQE A;  3KF8 B;  5C44 H;  1FGU A;  1C0A A;  1QZG A;  2AKW B;  3WWV A;  4C2M H;  3CW2 C;  4B3S L;  4DV2 L;  3H3V H;  3PO2 H;  4R4T A;  1K83 H;  1NBW A;  1I3Q H;  3RLO A;  4YCW A;  1YJW A;  4O0A A;  4XIG S;  5IP7 H;  1JJC B;  3JAM c;  4NXN Q;  3RZO H;  2CKZ B;  4DK3 C;  2Q2U A;  2ZJQ A;  3F1Z A;  3J81 i;  2VNU D;  3GDE A;  4H02 A;  1HNZ Q;  4DV3 L;  4LF6 L;  3EIV A;  4IFD I;  4BY7 H;  4GNX C;  4GNX A;  4BY1 H;  4HJ7 A;  4HJ9 A;  4NB3 A;  1ASY A;  3PO3 G;  4DR6 Q;  1Q1B A;  4A3E H;  1K9M C;  1N32 L;  4DR5 Q;  1RIP A;  3J7Z C;  2A8V A;  3GTQ H;  1E24 A;  3PUY A;  1E3P A;  3G48 A;  5HY6 A;  2UXC Q;  1XMQ L;  1IBL L;  4YCV A;  1Q81 C;  3I4O A;  4A3L H;  1X54 A;  3CF5 A;  2Z0S A;  3TRZ A;  1KC8 C;  3HOU H;  3PGZ A;  3CC2 A;  1V1Q A;  1WOC A;  1VS0 A;  4UP9 A;  1FJG L;  2ZM6 L;  1SR3 A;  5JEA J;  2UXD Q;  5IYD H;  3HOW H;  1HR0 Q;  3CC7 A;  2JA6 H;  1A62 A;  3B6Y A;  3I56 A;  2VZA A;  3EN2 A;  4JI6 L;  2Z6K C;  2Z6K A;  5ELN A;  4IJL A;  1O7I A;  4DR2 L;  1TWH H;  1PH3 A;  4C3I H;  1E7Z A;  2NZH A;  4B3T Q;  4JI7 L;  4A3J G;  3J81 c;  4BBR H;  3K7A H;  3T1H Q;  1UEB A;  1Z9F A;  2E2I H;  2WB1 E;  2ALY B;  4KI0 A;  2NVQ H;  4GN3 B;  3CCL A;  2AHO B;  1EQR A;  2K5N A;  2I0Q A;  4WJ4 A;  3UDG A;  1P8L A;  1X56 A;  1K3R A;  3PO3 H;  1OXV A;  2QA4 A;  3F2C A;  4LF4 Q;  4DUY Q;  4OWX B;  2JA7 G;  1NY4 A;  2JEA I;  2K4K A;  1X9N A;  1Q8K A;  1VCI A;  2AWO A;  1IXR A;  2ZTD A;  5DLQ E;  4YHH L;  3EBE A;  4JYA L;  4GKJ Q;  4A3C H;  3GTM H;  2A19 A;  2N8N A;  5FLM G;  5C3E G;  4IOA A;  5EAY A;  2N49 A;  4LWC A;  1KIX A;  1WJJ A;  4JOI A;  4JOI C;  2JQO A;  1X3F A;  4GOP A;  4GOP C;  1LYL A;  4DV5 Q;  3M3Y H;  3ER0 A;  5LMN L;  2H5X A;  1NMF A;  2HIX A;  1EWI A;  5J3B A;  1I94 Q;  2R7Z G;  2ZTE A;  3STB C;  3I4M H;  4JC0 A;  5M5X H;  1NMG A;  2HIV A;  2VQE L;  2MNA A;  1PYB A;  1B7Y B;  1YZ6 A;  4B3M Q;  3RN2 A;  3I4N G;  2VY3 A;  4OX9 Q;  1VQ6 A;  4A93 G;  3KYH C;  4DV7 L;  4OO1 G;  1KXL A;  4GKK Q;  1B70 B;  2KEN A;  3NEN A;  1C9O A;  3OTO Q;  3ERS X;  4TVA B;  2K14 A;  4JBW A;  5IE8 A;  4OXP A;  3CC4 A;  4K0K Q;  1G29 1;  4DR1 Q;  2F4V Q;  1Y1W G;  3GTP H;  4O2D A;  4UP7 A;  3T1Y Q;  1PH2 A;  1PH9 A;  1SE8 A;  4IOC A;  3ULL A;  3ULP A;  3MXN B;  1YNX A;  4DV6 L;  1VQN A;  2UXB Q;  5C4X H;  3CCV A;  1JMC A;  1EQQ A;  1GO3 E;  5H1S E;  2CCZ A;  1LM0 A;  1Q82 C;  4A75 A;  3PV0 A;  2HHH Q;  2N3S A;  1VQO A;  4IO9 A;  4YWL A;  2UUA Q;  1BBW A;  2R7Z H;  3PO2 G;  1KAW A;  1XNQ Q;  1YVC A;  3F2B A;  1PFS A;  4NXN L;  3K8A A;  5IP7 G;  1VQ7 A;  2I5H A;  4GS3 A;  4PZ6 A;  3I4N H;  1AE3 A;  2B29 A;  3NBH B;  2CWP A;  1K0R A;  2F3I A;  1S72 A;  3IRB A;  3CCU A;  4GLX A;  1VQK A;  4A93 H;  4JV5 Q;  2OTJ A;  4A3M H;  4DR7 Q;  1CSP A;  1WI5 A;  4BA2 I;  5BR8 Q;  2CQO A;  1EIY B;  4DR6 L;  4B3R Q;  3M7N A;  4BY1 G;  4DR5 L;  3J7A 5;  4LF8 Q;  1LUZ A;  4A3K H;  4A3E G;  4TQU S;  2UXC L;  1I6H H;  2GN5 A;  3CXC A;  3H15 A;  3PUV A;  2WB1 G;  4NPS A;  4XTC S;  3TRE A;  1JJ2 A;  1CUK A;  1NTG A;  1OXU A;  5LMU Q;  2K5V A;  2VUM H;  4A3L G;  3HOU G;  2A1A A;  3RLF A;  4DR4 Q;  1ASZ A;  3BJU A;  4P72 A;  4DR3 Q;  1XPO A;  1U0L A;  2UXD L;  2CWA A;  3DLL A;  4APV A;  1N8R C;  1HR0 L;  5IYD G;  4KHZ A;  3HOW G;  1L1O C;  1L1O A;  1K8A C;  2JA6 G;  1L0W A;  4DV0 Q;  4AQY Q;  1N36 Q;  1IL2 A;  3S14 H;  4B3T L;  1Q86 C;  1VQD A;  4X65 Q;  3E9I A;  2JA5 G;  3STB D;  1HZC A;  3HKZ E;  1S3O A;  3T1H L;  1QVG A;  1VQC A;  4P75 A;  2E2H H;  4BBR G;  3PUZ A;  1JE5 A;  3E9H A;  4QIW E;  3LGJ A;  3HFZ B;  4BXX G;  5JJI A;  1L1O B;  4A3B G;  5GRO A;  4LFA Q;  3CAM A;  1Q1E A;  4LFC Q;  1YHQ A;  1X65 A;  2GVA A;  3CPW A;  1W2B A;  4LF4 L;  4DUY L;  1KL9 A;  2I5L X;  4P73 A;  4AYB E;  3CCQ A;  3TS2 A;  4WJ3 M;  1UE7 A;  4MTN A;  4JI8 Q;  3UDF A;  3HOV H;  4GKJ L;  5ELO A;  4JI4 Q;  2PI2 A;  2PNH A;  2VW9 A;  1PH6 A;  3W5O A;  3S1Q H;  5IYC H;  4A3C G;  3S24 A;  1SLJ A;  1SRU A;  2BH2 A;  2R6G A;  1W3S A;  2UUC Q;  1VQH A;  3HOZ H;  2KHI A;  1GVP A;  3CCE A;  2PQA A;  2KBN A;  3M9B A;  4GNX B;  2K75 A;  4DV5 L;  2WAQ G;  2OWO A;  3S2H H;  4QY7 A;  2L15 A;  2PMZ E;  3L2P A;  1I94 L;  3F8T A;  1IBM Q;  3UDX A;  4DKA C;  2YU9 H;  3CCM A;  2R93 G;  2I5M X;  4A4I A;  1EYG A;  2JA8 H;  3I4M G;  1PA6 A;  2JA5 H;  4J15 A;  2UU9 Q;  4B3M L;  1MJC A;  1NE3 A;  4OX9 L;  4PZ7 A;  5FJ8 H;  1YIT A;  5GAG C;  4BXX H;  2B63 H;  3UE1 A;  4GKK L;  1HZA A;  2D0P A;  3K7U C;  3OTO L;  4LF5 Q;  5GAE C;  4A3B H;  1M90 C;  4RMF A;  3FKI H;  1XNR Q;  2Y0S G;  3GTK H;  1VQI A;  1I5F A;  1Q46 A;  1UE6 A;  4GLV B;  3MEF A;  4JG2 A;  4K0K L;  3TQY A;  4DR1 L;  2F4V L;  4YY3 Q;  3OYY A;  3RNU A;  1E1O A;  2WP8 J;  3T1Y L;  2IX0 A;  4LUZ A;  3ZJY C;  5IP9 G;  1OTC A;  2UUB Q;  2JE6 I;  3TEH B;  2YTV A;  2EXD A;  1AE2 A;  2YYZ A;  2UXB L;  1TWF H;  4JI1 Q;  1Q12 A;  1X3E A;  2VL6 A;  2R92 G;  5C4X G;  2GVB A;  4A3I H;  4JI3 Q;  2HHH L;  4JBK A;  2LSS A;  1L2F A;  2UUA L;  1VQ8 A;  2MQH A;  3UE0 A;  2JJQ A;  3GO5 A;  1VQ4 A;  2R93 H;  1LTL A;  4Y7N H;  2HQL A;  2CFM A;  2BA0 A;  3KOJ A;  3W1G A;  1XNQ L;  2EQS A;  3PUW A;  1PV4 A;  3H0G H;  4LF6 Q;  5C0X J;  4NXM Q;  4P71 A;  2OTL A;  2Q2H A;  1QZH A;  1PH1 A;  2ID0 A;  4A76 A;  4JV5 L;  1S40 A;  2B3G A;  4DR7 L;  1PVO A;  2C35 B;  4GOP B;  4B3R L;  1HZ9 A;  5BR8 L;  2OCE A;  1X6O A;  2MFI A;  2ZJR A;  3CCR A;  4A3M G;  2E5L Q;  2IY5 B;  4LF8 L;  1G51 A;  5GAD C;  3VDY A;  4ALP A;  1M1K C;  1VQ9 A;  1HNW Q;  2DGY A;  4A3K G;  1JB7 A;  3HOY H;  1A8V A;  3A0J A;  5JEA G;  5IWA Q;  2OQ0 A;  4YWM A;  5FLX c;  4GN5 A;  2IHE A;  3TS0 A;  5LMU L;  1TXY A;  1BKB A;  5IP9 H;  4DAY B;  1D8L A;  2RHQ B;  2AWN A;  1YJ9 A;  1V9P A;  4DR3 L;  2VUM G;  1G6P A;  3KLW A;  3UDI A;  3HOX H;  4A3D H;  1N9W A;  1BVS A;  1EIF A;  2K52 A;  4IFD J;  2R92 H;  3KFU A;  2KCT A;  3S1M H;  4DNI A;  1HJP A;  3A5Z B;  4DV0 L;  3KDF A;  4RG1 A;  4DV1 Q;  3J80 i;  4AQY L;  1N36 L;  4Y52 H;  1FL0 A;  3A74 A;  1QUQ A;  3L7Z C;  5HGQ A;  4X65 L;  4IPD A;  1N34 Q;  1VQL A;  3K0X A;  3GTJ H;  1J5E Q;  3CPF A;  3PCO B;  3CCJ A;  2PI2 E;  4LFA L;  2HT1 A;  4LFC L;  4GN4 B;  1TWC H;  1HNZ L;  2YTX A;  1UE1 A;  1QUQ B;  1XTD A;  2JK8 A;  2ZTC A;  4C3H H;  3I55 A;  1PH8 A;  4LF9 Q;  1K8G A;  4JI8 L;  4LUO A;  5IYB H;  1HNX Q;  4JI4 L;  2D0O A;  3ICE A;  3HOV G;  4UP8 A;  4OON A;  4PMW A;  1EOV A;  1Z47 A;  4IJH A;  4KHP Q;  1WCM H;  2V1C C;  3L0O A;  5IYC G;  1JJG A;  4R4O A;  1DGS A;  4C3J H;  1CKM A;  2UUC L;  3S17 H;  3RLN A;  4FDB A;  3DM3 A;  4X62 Q;  3HOZ G;  1KRT A;  3G4S A;  5GAH C;  3J80 c;  3A5U A;  4EQ5 A;  1IBM L;  1TWG H;  1YBY A;  2K50 A;  3G6E A;  4PZ8 A;  4X64 Q;  1IZ6 A;  1R9T H;  4JI0 Q;  2JA8 G;  3S15 H;  4HIM A;  2UU9 L;  1WYD A;  2E2J H;  1CKN A;  1SRO A;  1VQB A;  2KCM A;  5FJ8 G;  2D62 A;  3U4V A;  5M3M G;  4UPA A;  4JBM A;  4LF5 L;  2B63 G;  2F52 A;  2BA1 A;  3W1B A;  1K73 C;  3AYH B;  1XPR A;  1XNR L;  1VQA A;  3J81 j;  1CSQ A;  1YHB A;  3FKI G;  3U50 C;  3PIO A;  3F2D A;  1IYJ B;  4AH6 A;  4JI2 Q;  2JA9 A;  4YY3 L;  2NVX H;  2ATW A;  1CKN B;  5JJK A;  3S1R H;  2UUB L;  5IT9 c;  3RR5 A;  1MKH A;  2KHJ A;  1EFW A;  1Y1V G;  4DV4 Q;  1KHI A;  4A3F G;  1XMO Q;  1QVF A;  5M5W H;  4JI1 L;  2LXK A;  3NEM A;  1I50 H;  4JI3 L;  4QL5 A;  4A3I G;  4A3G H;  1X3G A;  1Q7Y C;  2VQF Q;  3I7F A;  3M4P A;  1NJI C;  1J6Q A;  4LW1 A;  4NXM L;  4X66 Q;  4OWW B;  3H0G G;  3CD6 A;  4JI5 Q;  1SMX A;  5LMN W;  4LFB Q;  3CP0 A;  2IT1 A;  2PQA B;  2R7D A;  5M3M H;  3S1N H;  1QVC A;  4DK6 C;  1H95 A;  4R4I A;  2E5L L;  3U58 A;  3PIP A;  1N33 Q;  3BU2 A;  2RCN A;  1UWV A;  2NVY H;  2K5H A;  5AJ3 Q;  1HNW L;  3K80 C;  3CME A;  5IWA L;  1VQ5 A;  4LF7 Q;  3HOY G;  1OXS C;  4DUZ Q;  1IBK Q;  2WFW A;  3GTG H;  2NN6 G;  4EX5 A;  2E8G A;  2IHF A;  1YEZ A;  3PF5 A;  3D0F A;  1Y1V H;  2ZJP A;  4A3F H;  1PH4 A;  3GD7 A;  4B3S Q;  3HOX G;  4DV2 Q;  2EIF A;  1VQF A;  4A3D G;  4DV1 L;  2YTY A;  2IX1 A;  4QJF A;  4HJ8 A;  4MNO A;  4QQB X;  3U4Z A;  5M3F G;  1N34 L;  4R1J A;  2Q2I A;  1KQS A;  4DPG A;  1AH9 A;  4PG3 A;  2OQK A;  1PH5 A;  1J5E L;  4OWT B;  4UY8 C;  4DV3 Q;  1JT8 A;  3AEV A;  1HH2 P;  1WFQ A;  2NN6 I;  3RN5 A;  4P74 A;  5GQO A;  2NVT H;  1N32 Q;  2RF4 A;  4MZ9 A;  4LF9 L;  1GD7 A;  2MO1 A;  5K36 G;  3M4O H;  4JCV E;  1XMQ Q;  1IBL Q;  1A0I A;  2MO0 A;  1KRS A;  1X55 A;  3I2Z A;  3Q8D A;  1HNX L;  3S16 H;  1YHA A;  4HID A;  5IYB G;  3HKZ G;  5E7N A;  4KHP L;  5IY0 A;  1FJG Q;  4BBS G;  2ZM6 Q;  1WCM G;  4DR4 L;  1B8A A;  2ES2 A;  4X62 L;  5JJL A;  3GTL H;  4HIK A;  1RL2 A;  2DUD A;  4JI6 Q;  4QGU A;  4HJA A;  4X6A H;  4ME3 A;  4AYB G;  1SFO H;  1PHJ A;  3CMA A;  4X64 L;  4DR2 Q;  3K81 C;  4A3J H;  4JI0 L;  2QGQ A;  4JI7 Q;  3GTO H;  3CCS A;  2AMC B;  4L5Q A;  4L5R C;  5M3F H;  3BZC A;  1KD1 C;  3HKS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...