5C4XH

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
146
structure length
135
Chain Sequence
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
total genus 17
structure length 135
sequence length 146
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5c4xH00
1KC8C 2KCTA 4Y52H 1WOCA 4P74A 4A3GG 1H95A 4IPDA 1M90C 1Y14B 4DV6Q 2B3GA 2GN5A 4A3LG 1ASYA 1X3EA 2RCNA 4A93H 1VQ7A 2Y0SG 2K52A 4MZ9A 2I5HA 1EOVA 5FLMG 1Q81C 4GNXB 3RLNA 4DV1L 2ID0A 3F2CA 1YVCA 4A4IA 3W5OA 2R93G 1WYDA 4JI8L 1IBKQ 4LFCL 1SE8A 5IYBH 3S17H 4KHZA 4BA2I 4L5SA 3HOVH 3KJOA 1K83H 2NVYH 1TWCH 4JI3L 1S40A 4PMWA 2K75A 1HNXL 3Q8DA 3T1YL 1EIFA 1VQDA 1IBLQ 4RG1A 3S24A 4DR5Q 3TS2A 1HNWQ 1E24A 2Q2HA 4J15A 4JI5Q 1B70B 1P16A 4DK3C 4DUYQ 2B63H 2E8GA 2R7ZH 4IPGA 5JJLA 3RLFA 1G291 4JBKA 3PF4A 2JK8A 4A3DG 1I6HH 1VQIA 2LXKA 5C44H 3CCUA 1X9NA 4X6AH 1XTDA 1VQKA 2ZTEA 1TWGH 5FJ8H 3DM3A 2JA5H 1YHQA 1K3RA 1W2BA 1I94Q 2HT1A 5IWAQ 4AIMA 4GOPB 1J5EQ 1UE1A 2VW9A 2JA8H 4DV3Q 1DGSA 2N8NA 4B3ML 5LMNL 2UXDL 1VQCA 2NZHA 1MKHA 1TWHH 4LFBL 4LUVA 1JMCA 1N33Q 2VQEL 5M5XH 1HZBA 5C3EH 1K0RA 1D7QA 2KENA 4DPGA 2F3IA 3U4ZA 1YHBA 3KF6A 4A3GH 1YI2A 3S14H 2IT1A 1VQJA 3HOZG 4BBRG 1PH2A 1N34L 5ELOA 4YWKA 4A3LH 5IYCH 2VQFL 1GKHA 3F2BA 4LF4L 4B3SL 3M85A 2ZJRA 3U4VA 4GLAC 1L1OA 3GTLH 4UP9A 1AE2A 4LUOA 4A3FG 3B6YA 1Q1EA 1EQQA 3MEFA 2UUAL 4DV6L 4BY7G 4QGUA 1KIXA 1YIJA 3K0XA 5GADC 3F8TA 1HH2P 3E9IA 4L5QA 3U58A 3HKZG 4DUZQ 4BBSG 1CKNB 1PYBA 3AFPA 1A0IA 4HJ7A 5IP7G 1CKOA 1UE7A 1SLJA 3I55A 3S1NH 2JEAI 4DR7L 4YCWA 5IE8A 1MJCA 3CC2A 2NVQH 4A3DH 3GTOH 5GAGC 4DR1L 1K8AC 5JEAJ 3J7ZC 4A3BG 2PNHA 1L1OC 4DR5L 3I4MG 4C2MH 2F4VL 3UDFA 4X64L 5LMUQ 4JBWA 4DUYL 4AYBG 3S15H 1HR0Q 4HIOA 2WB1G 4A3JG 1KRTA 2YTXA 2AMCB 1V9PA 2UUBL 4YY3Q 4NXNQ 4A3CG 3HKZE 4R4TA 3CCSA 3PUWA 1JJCB 2VUMG 1YITA 3A74A 4HJ5A 3GO5A 5IT9c 4LF8L 1Q82C 2ZJQA 2Q2IA 1Q1BA 4WJ3M 3CCRA 3CF5A 3K81C 1I94L 4IJLA 4IFDJ 3F1ZA 1J5EL 4JI6Q 3PO3G 4BBRH 4A3KG 1EQRA 1XPRA 4DV3L 1VQGA 3KF8B 1B8AA 3CPFA 4B3TQ 4DV0L 4DR2Q 2K5VA 3STBC 2WFWA 1N33L 2CKZB 2NN6I 4AYBE 3MXNB 4HJ8A 1QZGA 4PZ7A 3M4QA 1PH3A 1KAWA 4A3FH 3J7A5 4YCUA 3M4OH 2OTJA 1ASZA 4GN5A 1C0AA 1OXUA 1X6OA 4DV4L 3GTPH 4BY7H 3A5ZB 3GTJH 1AE3A 3HOYH 1PA6A 3TQYA 2B29A 1RIPA 4POFA 4B3RQ 4JI1L 1WJJA 2E5LL 4BBSH 1X56A 2HQLA 1N32L 2N3SA 1E7ZA 4A3IG 4GN4B 5IP7H 3A5UA 3TS0A 4JBJA 1PH7A 4UY8C 2KHJA 1LYLA 3G4SA 1FL0A 2WAQE 4LF7Q 2UXBQ 1BKBA 1TWFH 3PUZA 1XNRQ 2NZOA 1QUQB 3HKSA 2AWOA 4YHHL 4DV7Q 1SN8A 4JI0Q 5M3MH 2HHHL 4TQUS 3TRZA 5JJIA 4EX5A 1V1QA 1GM5A 1AH9A 3VDYA 3L0OA 3DLLA 1N8RC 1OXSC 2NVTH 1BBUA 4A3JH 4UPAA 5E7NA 3OTOQ 2A8VA 4A3CH 5ELNA 4OO1G 5C4JH 3EIVA 1MIUA 1PFSA 2VUMH 5GQOA 4XTCS 1KHIA 2R7FA 2PMZE 1PVOA 3M7NA 1S72A 4UP7A 3K8AA 3HOWG 5LMUL 1VQ5A 5JEAG 1YNXA 3G48A 1K73C 4NXNL 3OYYA 3PO3H 2UXCL 1CUKA 4R4OA 4YY3L 4DV5Q 2YU9H 3FP9A 4L5RC 1L1OB 2D62A 2VNUD 2I5MX 4GKKQ 4LF6L 1EUJA 3CCEA 2Y0SE 4NXMQ 3RZDH 4OWWB 1QVFA 1E1TA 1L0WA 3JAMi 1XJVA 4OXPA 5EAYA 4JBMA 3E0EA 4JI6L 2V1CC 4AH6A 4X65L 3CMEA 2OQ0A 1PH8A 1EFWA 1CSQA 1NMFA 4IPHA 1FJGQ 3S1RH 4LW1A 2YTVA 3T1HQ 1JE5A 4O0AA 4DR2L 3ICEA 2K50A 1VQLA 1FGUA 1JT8A 3CMAA 4A3IH 2R6GA 4C3IH 4DR3Q 3PSIA 2ES2A 4JI7L 4LF9Q 3PO2G 3L2PA 4ALPA 2UUCL 4IFDI 4DR6Q 2R7DA 1M1KC 4JYAL 4B3RL 3HOXG 5C4XG 3CXCA 5DLQE 2VZAA 3S1MH 4A3MG 2AHOB 1A8VA 1Y1WG 3J80i 4HIMA 3K80C 3KDFB 1HZ9A 1VCIA 2YYZA 1A63A 3FKIG 5FLMH 4LF7L 3S2DH 1XNRL 3CCJA 2PQAA 4BY1G 1NTGA 2OWOA 2R93H 3I2ZA 5GROA 1Q46A 1K8GA 2UU9Q 3RN2A 4JI0L 5C0XI 3F2DA 3H0GG 4GNXA 1EWIA 3FHWA 3ULJA 1QVGA 1C7YA 4YWLA 4TVAB 1NBWA 2Q2TA 2Z6KA 3EBEA 3OTOL 3ER0A 4A75A 2QEXA 1XPOA 4OX9Q 1XMOQ 3CCQA 1P8LA 5HY6A 5HGQA 5AJ3Q 1IBKL 3U50C 4R4CA 4AQYQ 2EXDA 3I4NG 1HZAA 3A0JA 1JB7A 4PG3A 1IBLL 2D0OA 1LM0A 1HNWL 4OWXB 1HR0W 4JI5L 3EN2A 4GKJQ 4DNIA 2D0PA 3PCOB 1VQMA 1QVCA 2KCMA 2K14A 1YJNA 2LXJA 2IHEA 3BU2A 1PH5A 4ME3A 2CFMA 3BZCA 1KD1C 1WFQA 2K5HA 4IPCA 2BA1A 4GOPA 3PGZA 5IP9G 2DGYA 3H3VH 1FJGL 1Q12A 5IWAL 4DV1Q 3UDGA 3S16H 2MNAA 1G51A 1E3PA 2H5XA 3HOZH 3AYHB 1L2FA 1CKMA 1UWVA 1X3GA 4O2DA 4LFAQ 5IYDG 4LFCQ 1MJEA 1J6QA 1VQEA 1X65A 1Y1WH 3PUVA 3PIPA 3NBHB 4LF9L 1VQNA 2JA6G 2JA7G 1Q8KA 3T1YQ 2IHFA 2WB1E 1X3FA 4UP8A 3GDEA 1K9MC 4BY1H 2BA0A 4QL5A 2XGTA 4JI2Q 4BA1I 1XNQQ 1UE6A 1X54A 3STBD 1PH9A 2OCEA 3I4OA 3H0GH 4RMFA 4Y7NH 5C0XJ 3HOUG 4JOIA 1O7IA 3CQZH 3L7ZC 2L15A 4YWMA 3G6EA 2MQHA 3CW2C 1FVIA 3I56A 3I7FA 4HJ9A 1VQ9A 2B63G 2R92G 1NY4A 2RF4A 4R4QA 1NMGA 4P73A 1CSPA 4MTNA 3I4NH 4C3HH 4JI4Q 5LMNQ 4DUZL 5C44G 4A3BH 4X62Q 3KFUA 1WI5A 4JC0A 1PV4A 3TREA 4POGA 3K7AH 3I4MH 4LFBQ 1RL2A 1HZCA 1HJPA 1VQFA 5AJ3L 3S2HH 2MFIA 2K5NA 3KYHC 4DKAC 1B7YB 1Y1VG 4B3SQ 2A1AA 1JJ2A 3GTKH 1VQHA 4MNOA 3KF6B 3CC4A 4DAMA 3ULPA 3CCMA 2ASBA 3CAMA 2VQFQ 4X66Q 5IP9H 4LF4Q 4HIDA 4HIKA 5C3EG 4PZ8A 3GTMH 4GKJL 4JV5Q 4GLXA 1HR0L 4QY7A 3UE1A 1NJIC 3GD7A 4YCVA 4A3KH 2UUAQ 1T9HA 5IYDH 3CPWA 1UE5A 1TWAH 3ULLA 2IX1A 4OONA 2JA7H 2F52A 2PQAB 5IYCG 1Q7YC 4LNQA 2JA6H 5BR8Q 4EQ5A 1XPUA 4IFDG 1BBWA 1A62A 1SMXA 1LTLA 1R9TH 1PH4A 4FDBA 3W1BA 4DV2Q 1VQ8A 4LFAL 4QIWE 3H15A 1VQOA 3RZOH 4DR7Q 2RHSB 1XMQQ 1Q86C 1PHJA 1EYGA 3KJPA 1VS0A 1IXRA 1N36Q 4B3TL 1IL2A 3HOUH 4HJAA 3ZJYC 3D31A 1E1OA 4DR1Q 3GTQH 1IBMQ 4DK6C 4JCVE 3OW2A 1OXTA 1X55A 4QJFA 3CD6A 2F4VQ 4DR4Q 4X64Q 2N49A 4OO1I 4WJ4A 1XNQL 4JI2L 3BJUA 3CP0A 2R92H 2AKWB 3M4PA 1BVSA 4H02A 2KHIA 4C3JH 2UUBQ 2NVXH 4LWCA 4A3EG 1VQ4A 3S1QH 3J81i 4LUZA 4A76A 4XIGS 4LF8Q 5C0XG 4LF5Q 4PZ6A 2WP8J 1QUQA 2ZTCA 3RLOA 2BH2A 3RN5A 1D8LA 5JJKA 1N9WA 2ZJPA 1I5FA 1Y1VH 2UXBL 3D0FA 2CWAA 3PUXA 1KRSA 4JI4L 4DAYB 1WCMG 3CC7A 4DV7L 4X62L 1OTCA 2ZM6Q 4DV0Q 3UDXA 3HOWH 2JEBI 1JJGA 2CCZA 1U5KA 2YV5A 1Z47A 1VQPA 1KL9A 4DV4Q 3E9HA 4NPSA 4R4IA 1C9OA 1SRUA 2OTLA 4QQBX 3M9BA 1KQSA 4X66L 1HNZQ 1SROA 2E5LQ 1U0LA 2E2JH 2HIVA 4K0KQ 4JV5L 1N32Q 5K36G 5M5WH 3GTGH 4KHPL 4IOCA 3H3VI 2I0QA 3RNUA 4IO9A 1VQAA 2CWPA 1YZ6A 4JI1Q 5M3FG 4DV5L 2Q2UA 3PIOA 3KLWA 4GKKL 4OWTB 3HOYG 3G71A 5BR8L 3M3YH 4BXXG 4KLKA 4YHHQ 4NXML 4GNXC 5GAHC 2HHHQ 2MO0A 3HFZB 3K7UC 4P72A 1YHAA 1QZHA 2E2IH 2Z6KC 3CCLA 3PO2H 2NN6G 1PH6A 3NEMA 4DV2L 2HIXA 2C35B 3WWVA 1XMQL 4A3EH 3T1HL 1TXYA 1YJWA 1N36L 3ERSX 4IJHA 5H1SE 3NELA 3HOXH 5C4XH 2JJQA 4JI8Q 1IBML 5FLXc 3UDIA 4A3MH 2ALYB 1OXXK 5M3MG 1UEBA 2OQKA 2VS1A 1LUZA 3RR5A 4GN3B 4DR3L 2E2HH 4DR4L 4A93G 1SFOH 1OXVA 2K4KA 4P71A 3JAMc 2JQOA 4JI3Q 1V43A 2EQSA 3FKIH 4GLVB 1YBYA 1HNXQ 4JG2A 4DR6L 4KHPQ 1GD7A 2IX0A 3AEVA 2UXCQ 3IRBA 3TEHB 3KOJA 2I5LX 5IY0A 1WCMH 3KDFA 4P75A 3AQQA 4GS3A 3AFQA 2LSSA 4LF6Q 4IOAA 5IYBG 1Z9FA 1IZ6A 4LF5L 3HOVG 3JC66 3J81j 3CCVA 3SGIA 1EIYB 3NENA 2JE6I 4GOPC 1VQ6A 2FXQA 1G6PA 2BH8A 2MO1A 1PH1A 2ATWA 1W3SA 2ZTDA 4X65Q 1YJ9A 2QGQA 3J81c 1CKNA 2GVBA 2KBNA 2A19A 2WAQG 5GAEC 2ZM6L 2XTIA 2UU9L 2R7ZG 2IY5B 1SR3A 5LMNW 2QA4A 1E22A 2DUDA 1I50H 4B3MQ 4BXXH 2UXDQ 2VY3A 4L5TA 1NE3A 3J80c 1S3OA 2PI2A 3UE0A 4JI7Q 2VQEQ 4R1JA 5M3FH 2UUCQ 4OX9L 1IYJB 4KI0A 1XMOL 2RHQB 3W1GA 5FJ8G 2JA5G 2Z0SA 1GVPA 2PI2E 4JYAQ 2JA9A 3LGJA 2YTYA 3PV0A 3PF5A 1GO3E 1VQBA 4NB3A 1HNZL 4AQYL 4APVA 5J3BA 2EIFA 2JA8G 4K0KL 1N34Q 1KXLA 2VL6A 4JOIC 5M5YH 1PYSB 1I3QH 2N78A 3BZKA 2GVAA 2CQOA 2AWNA 1YEZA 3PUYA
chains in the Genus database with same CATH superfamily
3R8BA 2KCTA 4ZKCB 1Y14B 3L9AX 4A93H 4ZYSA 3VR5A 2I5HA 3C46A 1Q81C 1B2TA 5C3WA 4GNXB 4DV1L 2ID0A 3F2CA 1WTXA 4A4IA 3H09A 4FF2A 4EVOA 4CDFC 3HOVH 4M8AA 5E4XA 2N88A 3X3MA 4PMWA 1IBLQ 1HNXL 3TS2A 3T1YL 1EIFA 4DR5Q 4DK1A 5TSSA 2Q8RE 4IPGA 4BBSB 1I6HH 1VQIA 2BCOA 1RJTA 1IW7C 4DXFA 2ZTEA 3Q6SA 1W2BA 1A3VA 4GOPB 1J5EQ 1KNEA 1Z7TA 2JA8H 3BDLA 4B3ML 1MKHA 2VQEL 5C3EH 2DN8A 1D7QA 4DPGA 1WTHA 2WB1B 3U4ZA 1AFPA 3KF6A 2CH4A 5L37A 2EXZA 2IT1A 2VUMB 4C1NK 1BCPD 4A3LH 3DMUA 4LF4L 2ZJRA 1L1OA 2XRQD 1EL0A 4RKLA 1Q1EA 3K5MA 1WD1A 2UUAL 2K33A 4QGUA 2J0TD 5E3FA 3F8TA 2L0CA 3QB3A 2FMCA 1CKNB 4BWGB 4DUZQ 4RHRA 4BBSG 2GA4B 2O2LD 4ABNA 1A0IA 2F0DA 5JJZA 2CH4W 1STBA 4DR7L 5AFWA 5GAGC 1F2YA 2KJXA 3QOLA 3J7ZC 1D2BA 3AB9A 2WB1G 4KY5A 4KN7C 2PYKA 3CCSA 2VUMG 1SNQA 1CZWA 4LF8L 3GO5A 2CVRA 4UDUC 1UEAB 1I94L 1Y1VB 2EVBA 1UNSA 1SNCA 1SYDA 3CPFA 4B3TQ 2K5VA 1N33L 3G6JB 1V8QA 3M4QA 4PZ7A 3KBXA 1B9NA 2OTJA 5K36H 1C0AA 1OXUA 4RGTA 2WKDA 2F0LA 3E6ZX 4RFBA 3TQYA 1B53A 1EY0A 1I4HA 2EOTA 2A6EC 2N3SA 4GN4B 3EA6A 3KBGA 1LYLA 2B2UC 4NP5A 1XNRQ 2NZOA 5DM63 3FVQA 4DV7Q 2E2IB 2BOSA 5JJIA 3H6MA 1V1QA 1GM5A 1AH9A 2D2CC 4L6TB 4A3CH 3HOXB 4FYDA 5CBAE 1PFSA 5GQOA 4G7ZC 3DWPA 2Z6BA 1Y1WB 2G9DA 2RBMA 3D4DA 5LMUL 5EBCA 1YNXA 3G48A 1QILA 2K5QA 1A15A 4BY1B 3PO3H 1R4PB 4YY3L 4DV5Q 1PZKD 1X3QA 2RKSA 3MC0B 4LF6L 3CCEA 3QO2A 1LV9A 1YNNC 1HTPA 4RCOA 4NXMQ 2H1EA 5I9OA 3E0EA 4X65L 1PH8A 1CSQA 2B2YC 2F0JA 4IPHA 1FJGQ 3SXHA 1RF2D 3I4NB 2K1BA 4XQJA 3CMAA 4DR3Q 1M8AA 5M3FB 1PMRA 3L2PA 3MFGA 1EZ6A 5DEHA 1M1KC 3E3XA 1D6EC 3FDTA 1X3PA 3HOXG 4HCEA 3QOJA 3TP7A 1Y1WG 1JR0D 1HZ9A 1A6XA 2YYZA 3MAQA 5FLMH 4LF7L 3HS0C 1GUSA 2RCFA 4BY1G 2R93H 2I07B 4Z9CB 2SOBA 3I70A 4A93B 2JA7B 3F2DA 4GNXA 1QVGA 2X69A 5G3LF 3OTOL 3J81E 1XPOA 1ESFA 1P8LA 5HURA 3I3CA 3GV3A 3SDZA 2RSNA 2QKIC 3I4NG 4EQOA 5KIXA 1JB7A 1IBLL 1H9MA 4DN4M 1LM0A 4CDCC 3KUPA 4FXKC 1HR0W 5KNCA 4DNIA 4C3JB 1VQMA 2NVXB 4B9XA 1I4XA 1AW7A 2IHEA 4PNYA 3BU2A 2PPBC 2CFMA 1IYVA 2L9HA 1WFQA 4GOPA 3A55A 2E76C 5JOBA 3HOZH 4L8JA 3AYHB 1L2FA 2MHVA 1D5ZC 1J6QA 2M9VA 4LF9L 4PV1C 5C3EB 2JA7G 1QJOA 4RGNA 1FR3A 1X3FA 1GUGA 3GDEA 1K9MC 4BA1I 1UE6A 1PTOC 2I46A 1Q8IA 3H0GH 5I9PA 4WJWA 2F0SA 4Y7NH 5C0XJ 3V2TA 3NTKA 2E2JB 3R3OA 4X3UA 1WTPA 1NY4A 2RF4A 3DWQA 4C3JG 2HUGA 1TY0A 3D4WA 4DFAA 4MTNA 4C3HH 3OPOA 4JI4Q 4DUZL 3R2TA 3KFUA 5FLXL 3BYTB 3TREA 1STHA 2NYZD 4K8IA 1HJPA 1NR2A 1C48A 2KEDA 2EYLA 1PFNA 3S2HH 2QW7A 1B7YB 2IX3A 1E0BA 2F0VA 2ASBA 5IT9L 4X66Q 5C3EG 4QY7A 3UE1A 2B8FA 1NJIC 2NTTA 4H0LC 1T9HA 1B1ZA 1TWAH 2N55A 2VB3X 1EWHA 1HQRD 2F52A 2PQAB 4EQ5A 3TP8A 3PIO3 1R9TH 1SE2A 3W1BA 4QIWE 3RZOH 3CHBD 4C1NI 1IL2A 4B3TL 3HOUH 1EIGA 2DY7A 3ZJYC 2EYFA 4ID6A 3GTQH 1TT2A 2SEBD 4HR7B 4DR4Q 2N49A 1XXGA 1XNQL 4JI2L 3BJUA 2R92H 4LK1C 2D9UA 3M4PA 2KHIA 2UUBQ 1TY2A 4LWCA 2WKCA 5EQ0A 1G2TA 3S1QH 4B08A 2J4XA 2FINB 1LTBD 4PZ6A 3DM1A 2P5ZX 5JJKA 3URYA 3OSOA 5C4HA 4U673 2CWAA 3IL8A 4DV7L 3NHHA 1CA6A 1STNA 4AYBB 2JEBI 5JEAH 1CM9A 3T51B 1U5KA 2K5DA 2CCZA 1Z47A 1VQPA 3K5LA 2VB2X 1KL9A 3E9HA 3IFTA 2L12A 3S17B 4PMCA 1KQSA 2JYOA 1SROA 1HNZQ 1U0LA 2F0NA 5J22A 4K0KQ 5K36G 5M5WH 3GV6A 3E0JA 1YZ6A 4DV5L 4IFDH 3H3VC 1ENFA 3M3YH 4KKUA 4KLKA 1E2ZA 4NXML 3U9OA 3EQLC 2MO0A 4P72A 1T5XD 3NEMA 3FRPB 5LL6S 3NELA 2F0WA 1FYCA 2Z8LA 5ELEA 3UDIA 2HCIA 3NP8A 4DR3L 4WJ4A 1CHPD 5BN3A 5JAVA 4X3TA 5C3XA 1HNXQ 2DJFC 1JOKA 3VYTA 3TEHB 1WCMH 4P75A 1WVLA 2JSOA 3AFQA 4HMIA 2Y0SB 1PTOD 3SEBA 3W2DA 2ATWA 1W3SA 2ZTDA 3I91A 2R93B 1YJ9A 1TS5A 1PH2A 2GVBA 2A19A 2SNMA 5GAEC 3A54A 3EROA 1SR3A 1I50H 4B3MQ 2XVSA 3GQBA 1S3OA 2PI2A 2VQEQ 4R1JA 3FPPA 1TS3A 3HRZC 5FJ8G 2A74C 3VR4A 3T16A 4JYAQ 3PF5A 4ZAIA 4APVA 5J3BA 4P2CB 1H9SB 4JOIC 5M5YH 3FPUB 2BH2A 1H95A 2OXPA 5K5PA 2Y0SG 1CZGA 1B9MA 1EOVA 5FLMG 2NWGA 3HOZB 2R93G 1IBKQ 5IYBH 4KHZA 2NVYH 2K75A 3Q8DA 1VQDA 2Q2HA 3BYYB 4RGMA 2E8GA 5A2QE 4Y7NB 1RDPD 3HKZB 3PF4A 4CDDC 1EQVA 2B2WC 1RODA 1X9NA 2AQ2B 1TWGH 1I94Q 3SR1A 5CBEE 3M7GA 5IGDA 1CT1D 2EYPA 2UXDL 1VQCA 2NZHA 2KHSA 1TWHH 3U9SA 1N33Q 1K0RA 1BCPC 1S5FD 2F3IA 4A3JB 1YHBA 5ISRA 3S2HB 4A3GH 1NAPA 3HOZG 3HP3A 3JAME 5ELOA 4YWKA 4QF4A 1EY6A 2JP1A 1GKHA 4ZUIA 4B3SL 3M85A 1W6JA 1PZID 4GLAC 3I90A 4UP9A 5IGCA 1EQQA 4LAAA 4DV6L 4ZRZA 2QF7A 2BDOA 2RDFA 5IOCA 1YIJA 5GADC 3HKZG 1QCBD 1R9TB 1KNAA 3QG1A 5IP7G 3I55A 4K2KA 2KOLA 1MJCA 5DAUA 4A3DH 3GTOH 1K8AC 2WINB 1L1OC 3S9WA 4OEMB 4C2MH 1EWCA 3UDFA 2DY8A 5LMUQ 3S15H 4A3JG 4IUVA 1KRTA 2UUBL 1V9PA 4YY3Q 1L0YB 5KGUA 3HKZE 4PMBA 4R4TA 1RTNA 3PUWA 2JN4A 1YITA 3P7JA 2ZJQA 3TDQA 3CCRA 3CF5A 2HDLA 3F1ZA 3ND9A 3BVZA 4BBRH 1XPRA 1DCZA 4DV3L 1Z6HA 3MTSA 1SYGA 3KF8B 2CKZB 1LTGD 1QZGA 4M1UB 1KAWA 4A3FH 4YCUA 4EQNA 3M4OH 1ASZA 4GN5A 2X6LA 3WOEA 1TVXA 1JE4A 1O80A 3GTPH 4KN4C 4BY7H 4NKLA 2B29A 1R4QB 1WJJA 3R2IA 1EYDA 2IJ0A 3T53B 5M5WB 2OEOA 4RCNA 1PTOH 1O78A 2NBFA 4JBJA 1MSGA 2KHJA 2QEJC 3A7AB 5CV8A 4LF7Q 4TRDA 1BKBA 1SYEA 1TWFH 3PUZA 3M3YB 4K2LA 2O5IC 4ZLTF 4IZ8A 3TRZA 2A5HA 4IUUA 4J6HA 3VDYA 3DLLA 1VMPA 5E7NA 3OTOQ 5BN4A 3CRKC 1MIUA 3OIQA 4DXGA 5C5MA 3M7NA 4X3KA 1VQ5A 5JEAG 1K73C 2QDLA 4HMJA 1IL8A 1STEA 1CUKA 3DWAA 2VNUD 4OELB 1KDBA 4GKKQ 1HTLD 4KJNA 3CQZB 4OWWB 1L0WA 4K5VA 4OXPA 5EAYA 3J80L 4JI6L 2V1CC 3CMEA 1IHZA 1ENAA 3S1RH 4F8MA 1FNVA 1FD7D 4N8FA 3ICEA 2K50A 1VQLA 1I50B 2NB0A 1FGUA 4A3IH 2KQ3A 3PSIA 4LF9Q 1STAA 4NMZA 5J1ZA 4ALPA 4DR6Q 1H9SA 4JYAL 4B3RL 3PQIA 1HRJA 3GTKB 2F0UA 3CXCA 4F88A 1TQOA 5M5YB 4MHEA 1C8CA 4H44C 3NXWA 3J80i 2NZ1D 3KDFB 3GTMB 2B2TC 4J1MA 3S2DH 4OO1H 1EEID 3LX0A 3T4AC 1V1PB 1EWIA 1LT4D 4YWLA 1NBWA 4WRDA 4IQZA 2Z6KA 2Q2TA 4A75A 4OX9Q 1XMOQ 3CCQA 1PTOF 1IBKL 1XWEA 3U50C 4R4CA 1BXTA 1SYBA 1ENCA 1JB3A 1HZAA 2D0OA 1UUPA 1KLUD 2CQAA 2PCFB 3C2PA 3PCOB 4KV6A 4O42A 4UHVA 2KCMA 1PH5A 1MBYA 4ME3A 2A6HC 3BZCA 2K5HA 2A68C 3T56B 3MXGA 1KAAA 5EKLA 1MD2D 3H3VH 1ONLA 1QG7A 1G51A 1E3PA 1SSOA 2H5XA 1STYA 1LO5D 1GHKA 1MJEA 1B3AA 1TWHB 1VQEA 1T5EA 3PIPA 3HG9A 2WB1E 4DK0A 1XNQQ 4JI2Q 1X54A 1PH9A 2PO4A 2FMMA 3GTGB 5LL6X 3G6EA 3CW2C 2SNSA 4EGVA 3I7FA 2XN9C 1NMGA 5FO9B 3TN2A 1LT3D 5E4WC 1I4RA 2KVMA 4XDXA 5CGKA 1WI5A 3I4MH 4LFBQ 5AJ3L 4A3EB 3MWYW 2K5NA 3QIAA 2K04A 3KYHC 1Y1VG 2K5WA 3GTOB 4MNOA 4DAMA 4F87A 2E2HB 3CAMA 3QJYA 4HAEA 4GZYC 5IP9H 2MUYA 4HIKA 4GKJL 4GLXA 3BDOA 5HGTA 3TP5A 5IYDH 1UE5A 3MEHA 3ULLA 2IX1A 2VXWA 3D6WA 4LNQA 2JA6H 1XPUA 2F0FA 1G2SA 1NCVA 2Z4IA 1SMXA 2PZUA 5EPKA 3KF8A 4BBRB 5KNBA 1VQ8A 2QILA 4LFAL 3K59A 2IW3A 2RHSB 2KECA 3D31A 4JCVE 1X55A 4CHTB 4X64Q 4OO1I 2EY6A 3GTPB 3D8GA 3KLSA 1BVSA 4H02A 5CV9A 4A3EG 1I3QB 1PTOB 1ZEQX 2WP8J 1EOTA 3VR3A 1N9WA 3KLSX 1I5FA 1G91A 4G4KA 1WTRA 4LMQD 4DAYB 1BR9A 1EY9A 4X62L 1OTCA 1ZYRD 3P1HA 2XSCA 1CK1A 1LTAD 4NPSA 4ULLA 1EFID 1HHVA 3Q23A 3M9BA 3HOVB 3NWSA 1IKMA 4TKOB 1TU2B 2TMPA 2E5LQ 1DD2A 2K01A 3H3VI 1HFNA 1GXDC 3RNUA 4IO9A 1VQAA 2CWPA 5M3FG 1AP0A 2WAQB 3KLWA 4GKKL 4OWTB 5BR8L 1I6HB 1PRTC 1K8OA 5C4ZA 4CJ0B 2HHHQ 3HFZB 3K7UC 3CCLA 1YHAA 1QZHA 4DV2L 2WIIB 1ZKOA 2HIXA 2C35B 3S1RB 3WWVA 1XMQL 1E2WA 2A6HD 2RSOA 4IJHA 5T1GA 2A68D 1N36L 5C4XH 3DEPA 2JA8B 2PMZB 5FLXc 1JORA 1UEBA 2OQKA 4GN3B 4A93G 3SK6A 1SFOH 3JAMc 2EQSA 4DR6L 5IY0A 3KDFA 4X3SA 4GS3A 2F0OA 1Z9FA 4LF5L 4QCLA 3EJIA 5EKKA 3JC66 5JVG3 3HOVG 3I8ZA 3SGIA 3NENA 1EIYB 2F3VA 2M00A 5KEEA 2B2UA 2QGQA 3A8JE 1CKNA 2WAQG 1E22A 2UXDQ 2ICEC 3TBIB 4CDEC 3UE0A 4JI7Q 4OX9L 1XMOL 2F0KA 2RHQB 1GVPA 2PI2E 2YTYA 4BXXH 1GO3E 2K6AA 1K3BC 2JA8G 4KD4A 3D6CA 3IKJA 1LT6D 2LS01 3MVVA 2NN6H 2N78A 3BZKA 2R3ZA 1U4LA 4B3SQ 2CQOA 4JI1L 2ZXRA 2AWNA 4C3IH 3SHLA 1KC8C 1SNPA 4R8NA 3NQTA 3M4YA 4IPDA 1M90C 4DV6Q 5IGGA 2B3GA 4A3LG 1NSNS 1X3EA 2EYOA 2RCNA 1BCPF 4XT1B 3BVGA 5FOBB 4NDXA 5D3IB 1D1KA 3RLNA 2B2YA 5ELBA 1HA5A 4JI8L 1F9RA 3Q0AA 4BA2I 2PQEA 3OIPA 1K83H 1JWSD 4QUFA 1S40A 3BDCA 4JI3L 4KHPL 4EQPA 2F0MA 3S24A 5D65A 1A3UA 1HNWQ 4J15A 4JI5Q 1P16A 2B63H 3VA7A 1QNKA 2R7ZH 5JJLA 3RLFA 3CRLC 3ZYYX 3CCUA 3K6OA 4X6AH 1VQKA 1WD0A 3VA5A 3R93A 2JA5H 2NUCA 1U9RA 1UE1A 2VW9A 4DV3Q 1DGSA 2N8NA 4IN3A 1TIID 3I4MB 4FP5D 4FF3A 4LFBL 4LUVA 1JMCA 5M5XH 1HZBA 1VF7A 2MGSA 4JVZA 1YI2A 3SK5A 1ICWA 1N34L 3OWFA 5EJWA 5CV6A 1HUNA 4QUCA 1A2TA 2PZTA 4ZCKA 2K03A 4HCSA 2WACA 3GTLH 1AE2A 3PO3B 3B6YA 2FJ2A 2K32A 3MEFA 4K6DA 1SJHD 4L5QA 3E9IA 3A8KE 1LACA 1PYBA 4CKCA 1RD9D 3KK7A 1CKOA 3S1NH 4QB4A 2JEAI 1PRTD 1FGBD 1SEBD 1OO9B 1PZJD 4MIUA 1TS2A 3CC2A 2NVQH 3LWEA 4NW2A 5C0XH 1F77A 2PNHA 3NTIA 5NUCA 3I4MG 4X64L 4G7HC 2LY7A 4JBWA 2F0QA 4AYBG 4DU9A 4DUYL 1HXYD 4HIOA 4A3CG 1JJCB 5I2YA 3A74A 2Q2IA 2BDNA 5CC4A 3RD4A 4IJLA 4DAYA 3BS1A 4JI6Q 3PO3G 3OHXC 3NTHA 1M4VA 1GHJA 5BN5A 1B8AA 3K5OA 1DOLA 3STBC 2F0PA 2NN6I 4AYBE 3J7YW 4HJ8A 1PH3A 4S3SA 3P20A 2EPBA 1I4PA 1X6OA 2TSSA 3A5ZB 1AE3A 3Q22A 3HOYH 1BCPB 1PFBA 4POFA 4B3RQ 2XWJB 2EYJA 2E5LL 4BBSH 1X56A 1MSHA 1PDQA 1DM0B 3TS0A 1DZ1A 2E74C 1FL0A 1QUQB 1BOSA 1JOOA 2HHHL 2M2LA 1EYCA 3AU7A 4UPAA 2B2VC 5C4XB 3EIVA 5T1IA 2VUMH 1Y8OB 1JQYD 1KHIA 2R7FA 5IGEA 1PVOA 1S72A 1LTTD 1SFOB 2EJGC 1SNMA 1YNJC 5J39A 1FNUA 4FO2A 4NXNL 3OYYA 1GUWA 4R4OA 2K05A 4L5RC 4HSVA 1L1OB 2D62A 3ERQA 4KKSA 2MJ8A 2AUJD 2HQEA 5ELDA 3SVMA 3H0GB 2ENBA 4DGZA 1EEFD 2Y0SE 3HEJA 2A69C 1QVFA 1E1TA 1XJVA 1ILQA 1LTSD 2OQ0A 1NMFA 3EVQA 3T1HQ 4DR2L 3DUZA 5CR3A 4C3HB 3KLRA 4O1NA 1LABA 4JI7L 4LJZC 2F1MA 4IFDI 1SXTA 2K7VA 5FLXE 4V190 3PIP3 5C4XG 3QR8A 1G6ZA 2AHOB 2G5DA 1CQFA 4HIMA 2B8GA 1VCIA 2HDMA 2ICIA 5IT9E 3BZDB 2PQAA 2OWOA 2ZT9C 1TWAB 3I2ZA 4RAUC 5GROA 4JI0L 3RN2A 5C0XI 1CHQD 3A8IE 3H0GG 3FHWA 1ET9A 4TVAB 3NK9A 1H9RA 3EBEA 3ER0A 1WTWA 4K5WA 2LMCB 2QEXA 3HGBA 3LWUA 1HCZA 3LNNA 3NUCA 3RZOB 5HY6A 5HGQA 5AJ3Q 3HOUB 1K83B 1BQQT 2EXDA 3GTQB 1EY7A 4C3HG 1S5ED 5KYIA 1HNWL 3H94A 4OWXB 2B63B 3IFDA 4JI5L 3EN2A 4GKJQ 2R92B 2D0PA 5IODA 3DXJC 1DXMA 3S1QB 4V0BA 3OMCA 2K14A 2ZXPA 2LXJA 4IPCA 3PGZA 3VYRA 2G9HD 2O4XA 3TZUA 3UDGA 1H9KA 3S16H 3MA2B 2MP1A 1UWVA 1X3GA 2OT2A 4O2DA 4LFAQ 2Q8TA 3HZXA 4LFCQ 2IWHA 1XX8A 1X65A 3T13A 1Y1WH 3NBHB 1VQNA 2EY1A 3DEOA 4UP8A 1LTRD 4BY1H 1CFMA 2BA0A 4QL5A 2XGTA 3STBD 1EZ8A 4DNRB 2OCEA 4IALA 1EY5A 1ESRA 4XQQA 2XWBB 3HOUG 4JOIA 1O7IA 3GTLB 3L7ZC 1BNZA 1Y8PB 4YWMA 1PXUA 3TMEA 2MQHA 1FVIA 3I56A 1VQ9A 2B63G 2R92G 4R4QA 4P73A 1CSPA 3I4NH 3V96A 2R61A 5LMNQ 1DONA 1QB5D 4A3BH 4X62Q 3MZ5A 4JC0A 1PV4A 3K7AH 4R8IA 1RL2A 1HZCA 3K58A 2MFIA 3NSWA 4RWSC 2NVQB 1JCKB 4CGYB 4R9WA 3CC4A 2RA4A 5CV4A 2VQFQ 2E75C 2L11A 4MTKA 4PZ8A 3MXUA 3SE0A 2FFKB 4A3KH 4KMUC 2DNCA 1WCMB 2XIWA 3CPWA 2F3WA 2F0IA 5EGTA 1YNJD 4OONA 2JA7H 3J81L 1WTQA 1Q7YC 5BR8Q 3D4RA 1ET6A 1BBWA 2B2WA 2FHTA 1LTLA 1IKLA 3TP6A 4FDBA 4DV2Q 4IFDG 1VQOA 2F03A 2A69D 1XMQQ 1PHJA 1IXRA 4OHJA 1N36Q 4IUQA 4HJAA 5LHY1 4DR1Q 3NWTA 3C1FA 1OXTA 4IUPA 5KRUA 2F4VQ 3NBIA 5DM73 3MFYA 1MGSA 3CP0A 3X3NA 2AKWB 3HOYB 4C3JH 2NVXH 1BDOA 1E2VA 1W6KA 3J81i 4LUZA 4A76A 1PRTF 4DNTB 4XIGS 1ZXTA 5C0XG 4LF5Q 4Q5VA 5FO7B 1QUQA 4U68A 2ZXOA 3RLOA 1S5DD 1D8LA 2EDGA 1ZYRC 1VMCA 2L55A 3D0FA 1KDCA 4HSPA 1F9SA 3PUXA 1KRSA 1WCMG 2RVLA 3CC7A 3CU7A 4N9PA 5EPJA 4DV0Q 2X6GA 3HOWH 1ICFB 4RA8A 1RHPA 2YV5A 2LFNA 2H4OA 4DV4Q 1AZPA 2KCNA 1SRUA 2NVYB 2A73B 2E2JH 1Y69U 4JV5L 1N32Q 1F2LA 3N52A 4IOCA 2I0QA 3OW7A 4HEDA 1DJRD 1HA6A 4KD3A 1S5CD 4JI1Q 2Q2UA 1C4QA 3HOYG 3ND8A 1AEXA 1U4RA 5C6AA 4YHHQ 4GNXC 5GAHC 4J8QA 3PO2H 1TWGB 1PH6A 3C3LA 2O5JC 3I73A 1RKNA 1SJED 4CJ1B 3T1HL 3ERSX 1NNXA 4JI8Q 1IBML 4A3MH 1G8ZD 1LT5D 1OXXK 2VS1A 3RR5A 1LUZA 1OXVA 4P71A 4JI3Q 1MI2A 3FKIH 2F0HA 4GLVB 4KHPQ 1F2ZA 4A3GB 2UXCQ 1GD7A 2IX0A 3AEVA 1NUCA 3IRBA 3KOJA 2I5LX 4IOAA 2LSSA 2PZWA 5IYBG 1IZ6A 3E5SA 4FF4A 1EQTA 3J81j 3CCVA 4MN3A 4GOPC 1HFGA 4N9TA 3SK8A 1RCVD 2BH8A 2KEEA 2L4NA 1VDZA 1F2MA 4XXEA 1SYFA 4ILWA 2KBNA 2ZM6L 2XTIA 2IY5B 3PMFA 4XYQA 3BG3A 2DUDA 3IAYA 2VY3A 1NE3A 1XTCD 4CBVA 4K14A 2UUCQ 4KI0A 1PFMA 3W1GA 3SK4A 2JA9A 4A3DB 1VQBA 4NB3A 3EFXD 1N34Q 1CA5A 3GP7A 2VL6A 4C2MB 2MPMA 1GJXA 4ODGA 2GVAA 1A2UA 5FO8B 3S15B 3PUYA 4Y52H 1WOCA 1WTVA 4P74A 4A3GG 3V05A 2GN5A 2EJFC 4K8JA 3J7AV 1ASYA 1VQ7A 2BE5C 2EZVA 2K52A 4MZ9A 3S16B 1PRTB 4DAVA 1YVCA 3P75A 3NBHA 3W5OA 1WYDA 3BVMA 1LTID 1SE8A 4LFCL 3S17H 2XNAC 3MHBA 4L5SA 3KJOA 1TWCH 2Z9HA 4RHSA 4A3FB 2IL8A 3M4OB 4RG1A 3OWEB 4E6IA 1E24A 1JWUD 1B70B 4DK3C 4DUYQ 4BY7B 4CKEA 4K5XA 1G291 4JBKA 2PNRC 1B3QA 2JK8A 3N6RA 2LXKA 5C44H 4A3DG 3O13A 1K28A 1TR5A 1XTDA 2B2TA 5FJ8H 3DM3A 1YHQA 1K3RA 2J7ZA 2HT1A 5IWAQ 4XQNA 1TWFB 3F2UA 4JPBW 2Z4HA 2F0EA 4AIMA 4I65A 4RGOS 2QCPX 1IW7D 1WTOA 4A3BB 5LMNL 1DOMA 3K7AB 3VYSA 1KABA 2KENA 2EYMA 3S14H 5I6WA 1VQJA 4BBRG 4ZKBB 3VR2A 5IYCH 5E1FA 2VQFL 3F2BA 4BS9A 5EKIA 3U4VA 1V1OA 3NE5B 4LUOA 4A3FG 2JXMB 5FKAC 1U4MA 4RH6A 4A3KB 5KNDA 4BY7G 1KIXA 4CKBA 1D1IA 3K0XA 4WORA 4ZQ3A 1HUMA 3UI2A 1HH2P 1SE3A 4FXGC 4OIJA 3U58A 2OF1A 2K28A 5M9OA 3W3AA 3AFPA 4HJ7A 2HCCA 4KHVA 1UE7A 1SLJA 4YCWA 3J80E 5IE8A 1SMYC 4DR1L 1F9QA 1STGA 4A3IB 5JEAJ 4A3BG 1O7ZA 4DR5L 2F4VL 5ELFA 1HR0Q 2KCCA 4NXNQ 2YTXA 2AMCB 4FNFA 1ILPA 1SYCA 4HJ5A 5IT9c 1FNWA 1Q82C 1Q1BA 4WJ3M 1B50A 3K81C 4FF1A 3S2DB 4IFDJ 2F4IA 1J5EL 1BF4A 4A3KG 1EQRA 1V1PA 4QIWB 5CMDA 1VQGA 4KK7A 4DV0L 4DR2Q 3HOWB 2WFWA 1XYIA 3MXNB 2Q8IB 5A2QL 5CYUA 3J7A5 1LLRD 2EE1A 4IURA 4DV4L 1Q3LA 3GTJH 3NPPA 1PA6A 1RIPA 4RKBA 2HQLA 5I4DA 4UAIA 1N32L 1E7ZA 4A3IG 2RQXA 5IP7H 3A5UA 1PH7A 4UY8C 4JK1C 3G4SA 2WAQE 2A6ED 2UXBQ 2DNEA 2F0GA 5DNFA 3HKSA 2AWOA 4YHHL 1SN8A 4JI0Q 1A3TA 5M3MH 4TQUS 3PO2B 3L3OC 4EX5A 2PW5A 5FK9C 1N8RC 3L0OA 3JAML 1OXSC 3G7LA 1BBUA 4A3JH 2NVTH 4OL7A 1TS4A 1EY4A 5ELNA 4OO1G 5C4JH 4XTCS 2BE5D 4A3MB 3WDNA 4ZUJA 2PMZE 2EY5A 3A7LA 4UP7A 3K8AA 3HOWG 1I6VC 2DJGC 3FKIB 2UXCL 1EYAA 1NR4A 3FP9A 1K8MA 2YU9H 2I5MX 1EUJA 4ME5A 5D14A 3RZDH 3K57A 3JAMi 1KTKA 3K0YA 4JBMA 1QWYA 2CW0C 4AH6A 1EFWA 1YNND 1B4OA 4FXDA 1J8IA 4LW1A 2YTVA 1JE5A 4O0AA 3VYUA 3ITPA 1JT8A 1EY8A 2EY2A 2R6GA 2ES2A 1AN8A 1D5XC 2CHBD 3PO2G 2UUCL 1PYWD 2R7DA 3OOCA 5DLQE 5I2XA 2VZAA 3S1MH 4A3MG 1A8VA 3OMGA 1I4GA 3K80C 1A63A 3FKIG 2AQ3B 1XNRL 1SNDA 1SDFA 3CCJA 5KYLA 1NTGA 4FVMA 1Q46A 2LKVA 4IUNA 1UAPA 4XYOA 1K8GA 1ML0D 2UU9Q 2JA6B 4KTAA 1MHWC 3I72A 3ULJA 1C7YA 4OIKA 1QE6A 3CKIB 2AUKA 3RUZA 1SE4A 1SNOA 4JW0A 1TWCB 4AQYQ 4KJOA 3A0JA 4PG3A 5COYA 4OGQC 2KUMA 3QWNA 4ZK9B 4L63B 1SMYD 1EU4A 1QVCA 1GUTA 1U4PA 5C44B 1YJNA 2L1BA 1KD1C 3J7AF 2BA1A 5IP9G 2AQ1B 2DGYA 2E2DC 1VF5C 1FJGL 1Q12A 2EJMA 5IWAL 4DV1Q 1DOKA 2MNAA 2A8VA 1CKMA 5IYDG 3WOFA 4B9WA 3PUVA 2JA6G 1Q8KA 4H7BA 3T1YQ 2IHFA 3S14B 2L5TA 2SDFA 3FEWX 1D5MC 3I4OA 1EU3A 4RMFA 4YIJA 1S4ZA 3CQZH 2V4DA 2L15A 1GOZA 4WFN3 2B39A 4HJ9A 1I4QA 3H91A 5JVH3 5C44G 5EPLA 4POGA 1H9JA 3FMCA 1VQFA 5F2DA 1KLGD 4I7ZC 4DKAC 2A1AA 1JJ2A 3GTKH 1VQHA 4G7OC 5D3DA 3KF6B 1AZQA 3ULPA 3CCMA 3C1EA 5CV7A 5IGFA 4LF4Q 4HIDA 4F7XA 3GTMH 5CV5A 1KDAA 1HR0L 4JV5Q 3GD7A 4YCVA 5CORA 2UUAQ 4IUTA 4C56C 3ONAB 4HN7A 1JOQA 5IYCG 1EIHA 3AMUA 1A62A 1PH4A 3Q24A 1F9PA 3MXPA 1II3A 3MXNA 3H15A 4DR7Q 1Q86C 1RTOA 3I4LA 1EYGA 3KJPA 1GUNA 1VS0A 2QDBA 2CW0D 1E1OA 1QOHA 2EYHA 4DK6C 3OW2A 1IBMQ 4QJFA 3CD6A 3D3RA 1GUOA 5A35A 4K6LA 3GTJB 1BUVT 1L0XB 1VQ4A 4LF8Q 1BO0A 1SAPA 2NTSA 1S5BD 2ZTCA 4C3IB 3RN5A 1QNUA 1Q90A 2Z1CA 1B44D 4HTHA 2ZJPA 2UXBL 1Y1VH 1JC7A 4CJ2C 4H13C 4JI4L 5M3MB 1Y8NB 4KY7A 2ZM6Q 4DF7A 3UDXA 2RDGA 4KKTA 1JJGA 5ELCA 4DAPA 2NVTB 4N8X1 1DYQA 5C4JB 3RMHA 1K0SA 4R4IA 1C9OA 4Q0FA 2OTLA 4QQBX 2D5DA 1SBBB 4X66L 2C9OA 2HIVA 2F0TA 3K5NA 3GTGH 1CQVA 4TSSA 1CTMA 2YU9B 4PQXA 3PIOA 2R7ZB 4G57A 3G71A 4BXXG 3RZDB 2KA7A 2HD3A 1BBXC 2E2IH 2Z6KC 2NN6G 2JA5B 4C3IG 4A3EH 3A56A 1J9OA 1TXYA 2XRSD 4QMGA 3HOXH 5H1SE 1YJWA 2JJQA 3TZDA 2ALYB 5M3MG 2E2HH 4DR4L 3DHQA 5M5XB 1O7YA 2K4KA 2JQOA 1JICA 1O7LA 1V43A 1YBYA 2WV6D 4JG2A 3TSSA 3AQQA 3S1MB 4LF6Q 5G3LD 1VQ6A 2JE6I 1G6PA 2FXQA 1HQMC 2PW7A 1PH1A 2MO1A 5EBDA 4X65Q 1PLFA 5JPNC 2RDHA 3J81c 5IGBA 2UU9L 2IPKD 2R7ZG 4DA2A 5IIFA 5C5LA 3VR6A 2QA4A 5LMNW 4L5TA 3J80c 2C5CA 4XT3B 1JWMD 5M3FH 3S1NB 1IYJB 1TKWB 2B2VA 5I6YA 2JA5G 2Z0SA 3LGJA 1IYUA 3PV0A 1CI3M 1HNZL 4I7AA 5JPMC 4AQYL 2EIFA 4K0KL 1KXLA 1HPCA 3NQIA 4KY6A 1X32A 1PYSB 1I3QH 1YEZA
chains in the Genus database with same CATH topology
1KC8C 2KCTA 4Y52H 1WOCA 4P74A 4A3GG 1H95A 4IPDA 1M90C 1Y14B 4DV6Q 2B3GA 2GN5A 4A3LG 1ASYA 1X3EA 2RCNA 4A93H 1VQ7A 2Y0SG 2K52A 4MZ9A 2I5HA 1EOVA 5FLMG 1Q81C 4GNXB 3RLNA 4DV1L 2ID0A 3F2CA 1YVCA 4A4IA 3W5OA 2R93G 1WYDA 4JI8L 1IBKQ 4LFCL 1SE8A 5IYBH 3S17H 4KHZA 4BA2I 4L5SA 3HOVH 3KJOA 1K83H 2NVYH 1TWCH 4JI3L 1S40A 4PMWA 2K75A 1HNXL 3Q8DA 3T1YL 1EIFA 1VQDA 1IBLQ 4RG1A 3S24A 4DR5Q 3TS2A 1HNWQ 1E24A 2Q2HA 4J15A 4JI5Q 1B70B 1P16A 4DK3C 4DUYQ 2B63H 2E8GA 2R7ZH 4IPGA 5JJLA 3RLFA 1G291 4JBKA 3PF4A 2JK8A 4A3DG 1I6HH 1VQIA 2LXKA 5C44H 3CCUA 1X9NA 4X6AH 1XTDA 1VQKA 2ZTEA 1TWGH 5FJ8H 3DM3A 2JA5H 1YHQA 1K3RA 1W2BA 1I94Q 2HT1A 5IWAQ 4AIMA 4GOPB 1J5EQ 1UE1A 2VW9A 2JA8H 4DV3Q 1DGSA 2N8NA 4B3ML 5LMNL 2UXDL 1VQCA 2NZHA 1MKHA 1TWHH 4LFBL 4LUVA 1JMCA 1N33Q 2VQEL 5M5XH 1HZBA 5C3EH 1K0RA 1D7QA 2KENA 4DPGA 2F3IA 3U4ZA 1YHBA 3KF6A 4A3GH 1YI2A 3S14H 2IT1A 1VQJA 3HOZG 4BBRG 1PH2A 1N34L 5ELOA 4YWKA 4A3LH 5IYCH 2VQFL 1GKHA 3F2BA 4LF4L 4B3SL 3M85A 2ZJRA 3U4VA 4GLAC 1L1OA 3GTLH 4UP9A 1AE2A 4LUOA 4A3FG 3B6YA 1Q1EA 1EQQA 3MEFA 2UUAL 4DV6L 4BY7G 4QGUA 1KIXA 1YIJA 3K0XA 5GADC 3F8TA 1HH2P 3E9IA 4L5QA 3U58A 3HKZG 4DUZQ 4BBSG 1CKNB 1PYBA 3AFPA 1A0IA 4HJ7A 5IP7G 1CKOA 1UE7A 1SLJA 3I55A 3S1NH 2JEAI 4DR7L 4YCWA 5IE8A 1MJCA 3CC2A 2NVQH 4A3DH 3GTOH 5GAGC 4DR1L 1K8AC 5JEAJ 3J7ZC 4A3BG 2PNHA 1L1OC 4DR5L 3I4MG 4C2MH 2F4VL 3UDFA 4X64L 5LMUQ 4JBWA 4DUYL 4AYBG 3S15H 1HR0Q 4HIOA 2WB1G 4A3JG 1KRTA 2YTXA 2AMCB 1V9PA 2UUBL 4YY3Q 4NXNQ 4A3CG 3HKZE 4R4TA 3CCSA 3PUWA 1JJCB 2VUMG 1YITA 3A74A 4HJ5A 3GO5A 5IT9c 4LF8L 1Q82C 2ZJQA 2Q2IA 1Q1BA 4WJ3M 3CCRA 3CF5A 3K81C 1I94L 4IJLA 4IFDJ 3F1ZA 1J5EL 4JI6Q 3PO3G 4BBRH 4A3KG 1EQRA 1XPRA 4DV3L 1VQGA 3KF8B 1B8AA 3CPFA 4B3TQ 4DV0L 4DR2Q 2K5VA 3STBC 2WFWA 1N33L 2CKZB 2NN6I 4AYBE 3MXNB 4HJ8A 1QZGA 4PZ7A 3M4QA 1PH3A 1KAWA 4A3FH 3J7A5 4YCUA 3M4OH 2OTJA 1ASZA 4GN5A 1C0AA 1OXUA 1X6OA 4DV4L 3GTPH 4BY7H 3A5ZB 3GTJH 1AE3A 3HOYH 1PA6A 3TQYA 2B29A 1RIPA 4POFA 4B3RQ 4JI1L 1WJJA 2E5LL 4BBSH 1X56A 2HQLA 1N32L 2N3SA 1E7ZA 4A3IG 4GN4B 5IP7H 3A5UA 3TS0A 4JBJA 1PH7A 4UY8C 2KHJA 1LYLA 3G4SA 1FL0A 2WAQE 4LF7Q 2UXBQ 1BKBA 1TWFH 3PUZA 1XNRQ 2NZOA 1QUQB 3HKSA 2AWOA 4YHHL 4DV7Q 1SN8A 4JI0Q 5M3MH 2HHHL 4TQUS 3TRZA 5JJIA 4EX5A 1V1QA 1GM5A 1AH9A 3VDYA 3L0OA 3DLLA 1N8RC 1OXSC 2NVTH 1BBUA 4A3JH 4UPAA 5E7NA 3OTOQ 2A8VA 4A3CH 5ELNA 4OO1G 5C4JH 3EIVA 1MIUA 1PFSA 2VUMH 5GQOA 4XTCS 1KHIA 2R7FA 2PMZE 1PVOA 3M7NA 1S72A 4UP7A 3K8AA 3HOWG 5LMUL 1VQ5A 5JEAG 1YNXA 3G48A 1K73C 4NXNL 3OYYA 3PO3H 2UXCL 1CUKA 4R4OA 4YY3L 4DV5Q 2YU9H 3FP9A 4L5RC 1L1OB 2D62A 2VNUD 2I5MX 4GKKQ 4LF6L 1EUJA 3CCEA 2Y0SE 4NXMQ 3RZDH 4OWWB 1QVFA 1E1TA 1L0WA 3JAMi 1XJVA 4OXPA 5EAYA 4JBMA 3E0EA 4JI6L 2V1CC 4AH6A 4X65L 3CMEA 2OQ0A 1PH8A 1EFWA 1CSQA 1NMFA 4IPHA 1FJGQ 3S1RH 4LW1A 2YTVA 3T1HQ 1JE5A 4O0AA 4DR2L 3ICEA 2K50A 1VQLA 1FGUA 1JT8A 3CMAA 4A3IH 2R6GA 4C3IH 4DR3Q 3PSIA 2ES2A 4JI7L 4LF9Q 3PO2G 3L2PA 4ALPA 2UUCL 4IFDI 4DR6Q 2R7DA 1M1KC 4JYAL 4B3RL 3HOXG 5C4XG 3CXCA 5DLQE 2VZAA 3S1MH 4A3MG 2AHOB 1A8VA 1Y1WG 3J80i 4HIMA 3K80C 3KDFB 1HZ9A 1VCIA 2YYZA 1A63A 3FKIG 5FLMH 4LF7L 3S2DH 1XNRL 3CCJA 2PQAA 4BY1G 1NTGA 2OWOA 2R93H 3I2ZA 5GROA 1Q46A 1K8GA 2UU9Q 3RN2A 4JI0L 5C0XI 3F2DA 3H0GG 4GNXA 1EWIA 3FHWA 3ULJA 1QVGA 1C7YA 4YWLA 4TVAB 1NBWA 2Q2TA 2Z6KA 3EBEA 3OTOL 3ER0A 4A75A 2QEXA 1XPOA 4OX9Q 1XMOQ 3CCQA 1P8LA 5HY6A 5HGQA 5AJ3Q 1IBKL 3U50C 4R4CA 4AQYQ 2EXDA 3I4NG 1HZAA 3A0JA 1JB7A 4PG3A 1IBLL 2D0OA 1LM0A 1HNWL 4OWXB 1HR0W 4JI5L 3EN2A 4GKJQ 4DNIA 2D0PA 3PCOB 1VQMA 1QVCA 2KCMA 2K14A 1YJNA 2LXJA 2IHEA 3BU2A 1PH5A 4ME3A 2CFMA 3BZCA 1KD1C 1WFQA 2K5HA 4IPCA 2BA1A 4GOPA 3PGZA 5IP9G 2DGYA 3H3VH 1FJGL 1Q12A 5IWAL 4DV1Q 3UDGA 3S16H 2MNAA 1G51A 1E3PA 2H5XA 3HOZH 3AYHB 1L2FA 1CKMA 1UWVA 1X3GA 4O2DA 4LFAQ 5IYDG 4LFCQ 1MJEA 1J6QA 1VQEA 1X65A 1Y1WH 3PUVA 3PIPA 3NBHB 4LF9L 1VQNA 2JA6G 2JA7G 1Q8KA 3T1YQ 2IHFA 2WB1E 1X3FA 4UP8A 3GDEA 1K9MC 4BY1H 2BA0A 4QL5A 2XGTA 4JI2Q 4BA1I 1XNQQ 1UE6A 1X54A 3STBD 1PH9A 2OCEA 3I4OA 3H0GH 4RMFA 4Y7NH 5C0XJ 3HOUG 4JOIA 1O7IA 3CQZH 3L7ZC 2L15A 4YWMA 3G6EA 2MQHA 3CW2C 1FVIA 3I56A 3I7FA 4HJ9A 1VQ9A 2B63G 2R92G 1NY4A 2RF4A 4R4QA 1NMGA 4P73A 1CSPA 4MTNA 3I4NH 4C3HH 4JI4Q 5LMNQ 4DUZL 5C44G 4A3BH 4X62Q 3KFUA 1WI5A 4JC0A 1PV4A 3TREA 4POGA 3K7AH 3I4MH 4LFBQ 1RL2A 1HZCA 1HJPA 1VQFA 5AJ3L 3S2HH 2MFIA 2K5NA 3KYHC 4DKAC 1B7YB 1Y1VG 4B3SQ 2A1AA 1JJ2A 3GTKH 1VQHA 4MNOA 3KF6B 3CC4A 4DAMA 3ULPA 3CCMA 2ASBA 3CAMA 2VQFQ 4X66Q 5IP9H 4LF4Q 4HIDA 4HIKA 5C3EG 4PZ8A 3GTMH 4GKJL 4JV5Q 4GLXA 1HR0L 4QY7A 3UE1A 1NJIC 3GD7A 4YCVA 4A3KH 2UUAQ 1T9HA 5IYDH 3CPWA 1UE5A 1TWAH 3ULLA 2IX1A 4OONA 2JA7H 2F52A 2PQAB 5IYCG 1Q7YC 4LNQA 2JA6H 5BR8Q 4EQ5A 1XPUA 4IFDG 1BBWA 1A62A 1SMXA 1LTLA 1R9TH 1PH4A 4FDBA 3W1BA 4DV2Q 1VQ8A 4LFAL 4QIWE 3H15A 1VQOA 3RZOH 4DR7Q 2RHSB 1XMQQ 1Q86C 1PHJA 1EYGA 3KJPA 1VS0A 1IXRA 1N36Q 4B3TL 1IL2A 3HOUH 4HJAA 3ZJYC 3D31A 1E1OA 4DR1Q 3GTQH 1IBMQ 4DK6C 4JCVE 3OW2A 1OXTA 1X55A 4QJFA 3CD6A 2F4VQ 4DR4Q 4X64Q 2N49A 4OO1I 4WJ4A 1XNQL 4JI2L 3BJUA 3CP0A 2R92H 2AKWB 3M4PA 1BVSA 4H02A 2KHIA 4C3JH 2UUBQ 2NVXH 4LWCA 4A3EG 1VQ4A 3S1QH 3J81i 4LUZA 4A76A 4XIGS 4LF8Q 5C0XG 4LF5Q 4PZ6A 2WP8J 1QUQA 2ZTCA 3RLOA 2BH2A 3RN5A 1D8LA 5JJKA 1N9WA 2ZJPA 1I5FA 1Y1VH 2UXBL 3D0FA 2CWAA 3PUXA 1KRSA 4JI4L 4DAYB 1WCMG 3CC7A 4DV7L 4X62L 1OTCA 2ZM6Q 4DV0Q 3UDXA 3HOWH 2JEBI 1JJGA 2CCZA 1U5KA 2YV5A 1Z47A 1VQPA 1KL9A 4DV4Q 3E9HA 4NPSA 4R4IA 1C9OA 1SRUA 2OTLA 4QQBX 3M9BA 1KQSA 4X66L 1HNZQ 1SROA 2E5LQ 1U0LA 2E2JH 2HIVA 4K0KQ 4JV5L 1N32Q 5K36G 5M5WH 3GTGH 4KHPL 4IOCA 3H3VI 2I0QA 3RNUA 4IO9A 1VQAA 2CWPA 1YZ6A 4JI1Q 5M3FG 4DV5L 2Q2UA 3PIOA 3KLWA 4GKKL 4OWTB 3HOYG 3G71A 5BR8L 3M3YH 4BXXG 4KLKA 4YHHQ 4NXML 4GNXC 5GAHC 2HHHQ 2MO0A 3HFZB 3K7UC 4P72A 1YHAA 1QZHA 2E2IH 2Z6KC 3CCLA 3PO2H 2NN6G 1PH6A 3NEMA 4DV2L 2HIXA 2C35B 3WWVA 1XMQL 4A3EH 3T1HL 1TXYA 1YJWA 1N36L 3ERSX 4IJHA 5H1SE 3NELA 3HOXH 5C4XH 2JJQA 4JI8Q 1IBML 5FLXc 3UDIA 4A3MH 2ALYB 1OXXK 5M3MG 1UEBA 2OQKA 2VS1A 1LUZA 3RR5A 4GN3B 4DR3L 2E2HH 4DR4L 4A93G 1SFOH 1OXVA 2K4KA 4P71A 3JAMc 2JQOA 4JI3Q 1V43A 2EQSA 3FKIH 4GLVB 1YBYA 1HNXQ 4JG2A 4DR6L 4KHPQ 1GD7A 2IX0A 3AEVA 2UXCQ 3IRBA 3TEHB 3KOJA 2I5LX 5IY0A 1WCMH 3KDFA 4P75A 3AQQA 4GS3A 3AFQA 2LSSA 4LF6Q 4IOAA 5IYBG 1Z9FA 1IZ6A 4LF5L 3HOVG 3JC66 3J81j 3CCVA 3SGIA 1EIYB 3NENA 2JE6I 4GOPC 1VQ6A 2FXQA 1G6PA 2BH8A 2MO1A 1PH1A 2ATWA 1W3SA 2ZTDA 4X65Q 1YJ9A 2QGQA 3J81c 1CKNA 2GVBA 2KBNA 2A19A 2WAQG 5GAEC 2ZM6L 2XTIA 2UU9L 2R7ZG 2IY5B 1SR3A 5LMNW 2QA4A 1E22A 2DUDA 1I50H 4B3MQ 4BXXH 2UXDQ 2VY3A 4L5TA 1NE3A 3J80c 1S3OA 2PI2A 3UE0A 4JI7Q 2VQEQ 4R1JA 5M3FH 2UUCQ 4OX9L 1IYJB 4KI0A 1XMOL 2RHQB 3W1GA 5FJ8G 2JA5G 2Z0SA 1GVPA 2PI2E 4JYAQ 2JA9A 3LGJA 2YTYA 3PV0A 3PF5A 1GO3E 1VQBA 4NB3A 1HNZL 4AQYL 4APVA 5J3BA 2EIFA 2JA8G 4K0KL 1N34Q 1KXLA 2VL6A 4JOIC 5M5YH 1PYSB 1I3QH 2N78A 3BZKA 2GVAA 2CQOA 2AWNA 1YEZA 3PUYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KC8 C;  2KCT A;  4Y52 H;  1WOC A;  4P74 A;  4A3G G;  1H95 A;  4IPD A;  1M90 C;  1Y14 B;  4DV6 Q;  2B3G A;  2GN5 A;  4A3L G;  1ASY A;  1X3E A;  2RCN A;  4A93 H;  1VQ7 A;  2Y0S G;  2K52 A;  4MZ9 A;  2I5H A;  1EOV A;  5FLM G;  1Q81 C;  4GNX B;  3RLN A;  4DV1 L;  2ID0 A;  3F2C A;  1YVC A;  4A4I A;  3W5O A;  2R93 G;  1WYD A;  4JI8 L;  1IBK Q;  4LFC L;  1SE8 A;  5IYB H;  3S17 H;  4KHZ A;  4BA2 I;  4L5S A;  3HOV H;  3KJO A;  1K83 H;  2NVY H;  1TWC H;  4JI3 L;  1S40 A;  4PMW A;  2K75 A;  1HNX L;  3Q8D A;  3T1Y L;  1EIF A;  1VQD A;  1IBL Q;  4RG1 A;  3S24 A;  4DR5 Q;  3TS2 A;  1HNW Q;  1E24 A;  2Q2H A;  4J15 A;  4JI5 Q;  1B70 B;  1P16 A;  4DK3 C;  4DUY Q;  2B63 H;  2E8G A;  2R7Z H;  4IPG A;  5JJL A;  3RLF A;  1G29 1;  4JBK A;  3PF4 A;  2JK8 A;  4A3D G;  1I6H H;  1VQI A;  2LXK A;  5C44 H;  3CCU A;  1X9N A;  4X6A H;  1XTD A;  1VQK A;  2ZTE A;  1TWG H;  5FJ8 H;  3DM3 A;  2JA5 H;  1YHQ A;  1K3R A;  1W2B A;  1I94 Q;  2HT1 A;  5IWA Q;  4AIM A;  4GOP B;  1J5E Q;  1UE1 A;  2VW9 A;  2JA8 H;  4DV3 Q;  1DGS A;  2N8N A;  4B3M L;  5LMN L;  2UXD L;  1VQC A;  2NZH A;  1MKH A;  1TWH H;  4LFB L;  4LUV A;  1JMC A;  1N33 Q;  2VQE L;  5M5X H;  1HZB A;  5C3E H;  1K0R A;  1D7Q A;  2KEN A;  4DPG A;  2F3I A;  3U4Z A;  1YHB A;  3KF6 A;  4A3G H;  1YI2 A;  3S14 H;  2IT1 A;  1VQJ A;  3HOZ G;  4BBR G;  1PH2 A;  1N34 L;  5ELO A;  4YWK A;  4A3L H;  5IYC H;  2VQF L;  1GKH A;  3F2B A;  4LF4 L;  4B3S L;  3M85 A;  2ZJR A;  3U4V A;  4GLA C;  1L1O A;  3GTL H;  4UP9 A;  1AE2 A;  4LUO A;  4A3F G;  3B6Y A;  1Q1E A;  1EQQ A;  3MEF A;  2UUA L;  4DV6 L;  4BY7 G;  4QGU A;  1KIX A;  1YIJ A;  3K0X A;  5GAD C;  3F8T A;  1HH2 P;  3E9I A;  4L5Q A;  3U58 A;  3HKZ G;  4DUZ Q;  4BBS G;  1CKN B;  1PYB A;  3AFP A;  1A0I A;  4HJ7 A;  5IP7 G;  1CKO A;  1UE7 A;  1SLJ A;  3I55 A;  3S1N H;  2JEA I;  4DR7 L;  4YCW A;  5IE8 A;  1MJC A;  3CC2 A;  2NVQ H;  4A3D H;  3GTO H;  5GAG C;  4DR1 L;  1K8A C;  5JEA J;  3J7Z C;  4A3B G;  2PNH A;  1L1O C;  4DR5 L;  3I4M G;  4C2M H;  2F4V L;  3UDF A;  4X64 L;  5LMU Q;  4JBW A;  4DUY L;  4AYB G;  3S15 H;  1HR0 Q;  4HIO A;  2WB1 G;  4A3J G;  1KRT A;  2YTX A;  2AMC B;  1V9P A;  2UUB L;  4YY3 Q;  4NXN Q;  4A3C G;  3HKZ E;  4R4T A;  3CCS A;  3PUW A;  1JJC B;  2VUM G;  1YIT A;  3A74 A;  4HJ5 A;  3GO5 A;  5IT9 c;  4LF8 L;  1Q82 C;  2ZJQ A;  2Q2I A;  1Q1B A;  4WJ3 M;  3CCR A;  3CF5 A;  3K81 C;  1I94 L;  4IJL A;  4IFD J;  3F1Z A;  1J5E L;  4JI6 Q;  3PO3 G;  4BBR H;  4A3K G;  1EQR A;  1XPR A;  4DV3 L;  1VQG A;  3KF8 B;  1B8A A;  3CPF A;  4B3T Q;  4DV0 L;  4DR2 Q;  2K5V A;  3STB C;  2WFW A;  1N33 L;  2CKZ B;  2NN6 I;  4AYB E;  3MXN B;  4HJ8 A;  1QZG A;  4PZ7 A;  3M4Q A;  1PH3 A;  1KAW A;  4A3F H;  3J7A 5;  4YCU A;  3M4O H;  2OTJ A;  1ASZ A;  4GN5 A;  1C0A A;  1OXU A;  1X6O A;  4DV4 L;  3GTP H;  4BY7 H;  3A5Z B;  3GTJ H;  1AE3 A;  3HOY H;  1PA6 A;  3TQY A;  2B29 A;  1RIP A;  4POF A;  4B3R Q;  4JI1 L;  1WJJ A;  2E5L L;  4BBS H;  1X56 A;  2HQL A;  1N32 L;  2N3S A;  1E7Z A;  4A3I G;  4GN4 B;  5IP7 H;  3A5U A;  3TS0 A;  4JBJ A;  1PH7 A;  4UY8 C;  2KHJ A;  1LYL A;  3G4S A;  1FL0 A;  2WAQ E;  4LF7 Q;  2UXB Q;  1BKB A;  1TWF H;  3PUZ A;  1XNR Q;  2NZO A;  1QUQ B;  3HKS A;  2AWO A;  4YHH L;  4DV7 Q;  1SN8 A;  4JI0 Q;  5M3M H;  2HHH L;  4TQU S;  3TRZ A;  5JJI A;  4EX5 A;  1V1Q A;  1GM5 A;  1AH9 A;  3VDY A;  3L0O A;  3DLL A;  1N8R C;  1OXS C;  2NVT H;  1BBU A;  4A3J H;  4UPA A;  5E7N A;  3OTO Q;  2A8V A;  4A3C H;  5ELN A;  4OO1 G;  5C4J H;  3EIV A;  1MIU A;  1PFS A;  2VUM H;  5GQO A;  4XTC S;  1KHI A;  2R7F A;  2PMZ E;  1PVO A;  3M7N A;  1S72 A;  4UP7 A;  3K8A A;  3HOW G;  5LMU L;  1VQ5 A;  5JEA G;  1YNX A;  3G48 A;  1K73 C;  4NXN L;  3OYY A;  3PO3 H;  2UXC L;  1CUK A;  4R4O A;  4YY3 L;  4DV5 Q;  2YU9 H;  3FP9 A;  4L5R C;  1L1O B;  2D62 A;  2VNU D;  2I5M X;  4GKK Q;  4LF6 L;  1EUJ A;  3CCE A;  2Y0S E;  4NXM Q;  3RZD H;  4OWW B;  1QVF A;  1E1T A;  1L0W A;  3JAM i;  1XJV A;  4OXP A;  5EAY A;  4JBM A;  3E0E A;  4JI6 L;  2V1C C;  4AH6 A;  4X65 L;  3CME A;  2OQ0 A;  1PH8 A;  1EFW A;  1CSQ A;  1NMF A;  4IPH A;  1FJG Q;  3S1R H;  4LW1 A;  2YTV A;  3T1H Q;  1JE5 A;  4O0A A;  4DR2 L;  3ICE A;  2K50 A;  1VQL A;  1FGU A;  1JT8 A;  3CMA A;  4A3I H;  2R6G A;  4C3I H;  4DR3 Q;  3PSI A;  2ES2 A;  4JI7 L;  4LF9 Q;  3PO2 G;  3L2P A;  4ALP A;  2UUC L;  4IFD I;  4DR6 Q;  2R7D A;  1M1K C;  4JYA L;  4B3R L;  3HOX G;  5C4X G;  3CXC A;  5DLQ E;  2VZA A;  3S1M H;  4A3M G;  2AHO B;  1A8V A;  1Y1W G;  3J80 i;  4HIM A;  3K80 C;  3KDF B;  1HZ9 A;  1VCI A;  2YYZ A;  1A63 A;  3FKI G;  5FLM H;  4LF7 L;  3S2D H;  1XNR L;  3CCJ A;  2PQA A;  4BY1 G;  1NTG A;  2OWO A;  2R93 H;  3I2Z A;  5GRO A;  1Q46 A;  1K8G A;  2UU9 Q;  3RN2 A;  4JI0 L;  5C0X I;  3F2D A;  3H0G G;  4GNX A;  1EWI A;  3FHW A;  3ULJ A;  1QVG A;  1C7Y A;  4YWL A;  4TVA B;  1NBW A;  2Q2T A;  2Z6K A;  3EBE A;  3OTO L;  3ER0 A;  4A75 A;  2QEX A;  1XPO A;  4OX9 Q;  1XMO Q;  3CCQ A;  1P8L A;  5HY6 A;  5HGQ A;  5AJ3 Q;  1IBK L;  3U50 C;  4R4C A;  4AQY Q;  2EXD A;  3I4N G;  1HZA A;  3A0J A;  1JB7 A;  4PG3 A;  1IBL L;  2D0O A;  1LM0 A;  1HNW L;  4OWX B;  1HR0 W;  4JI5 L;  3EN2 A;  4GKJ Q;  4DNI A;  2D0P A;  3PCO B;  1VQM A;  1QVC A;  2KCM A;  2K14 A;  1YJN A;  2LXJ A;  2IHE A;  3BU2 A;  1PH5 A;  4ME3 A;  2CFM A;  3BZC A;  1KD1 C;  1WFQ A;  2K5H A;  4IPC A;  2BA1 A;  4GOP A;  3PGZ A;  5IP9 G;  2DGY A;  3H3V H;  1FJG L;  1Q12 A;  5IWA L;  4DV1 Q;  3UDG A;  3S16 H;  2MNA A;  1G51 A;  1E3P A;  2H5X A;  3HOZ H;  3AYH B;  1L2F A;  1CKM A;  1UWV A;  1X3G A;  4O2D A;  4LFA Q;  5IYD G;  4LFC Q;  1MJE A;  1J6Q A;  1VQE A;  1X65 A;  1Y1W H;  3PUV A;  3PIP A;  3NBH B;  4LF9 L;  1VQN A;  2JA6 G;  2JA7 G;  1Q8K A;  3T1Y Q;  2IHF A;  2WB1 E;  1X3F A;  4UP8 A;  3GDE A;  1K9M C;  4BY1 H;  2BA0 A;  4QL5 A;  2XGT A;  4JI2 Q;  4BA1 I;  1XNQ Q;  1UE6 A;  1X54 A;  3STB D;  1PH9 A;  2OCE A;  3I4O A;  3H0G H;  4RMF A;  4Y7N H;  5C0X J;  3HOU G;  4JOI A;  1O7I A;  3CQZ H;  3L7Z C;  2L15 A;  4YWM A;  3G6E A;  2MQH A;  3CW2 C;  1FVI A;  3I56 A;  3I7F A;  4HJ9 A;  1VQ9 A;  2B63 G;  2R92 G;  1NY4 A;  2RF4 A;  4R4Q A;  1NMG A;  4P73 A;  1CSP A;  4MTN A;  3I4N H;  4C3H H;  4JI4 Q;  5LMN Q;  4DUZ L;  5C44 G;  4A3B H;  4X62 Q;  3KFU A;  1WI5 A;  4JC0 A;  1PV4 A;  3TRE A;  4POG A;  3K7A H;  3I4M H;  4LFB Q;  1RL2 A;  1HZC A;  1HJP A;  1VQF A;  5AJ3 L;  3S2H H;  2MFI A;  2K5N A;  3KYH C;  4DKA C;  1B7Y B;  1Y1V G;  4B3S Q;  2A1A A;  1JJ2 A;  3GTK H;  1VQH A;  4MNO A;  3KF6 B;  3CC4 A;  4DAM A;  3ULP A;  3CCM A;  2ASB A;  3CAM A;  2VQF Q;  4X66 Q;  5IP9 H;  4LF4 Q;  4HID A;  4HIK A;  5C3E G;  4PZ8 A;  3GTM H;  4GKJ L;  4JV5 Q;  4GLX A;  1HR0 L;  4QY7 A;  3UE1 A;  1NJI C;  3GD7 A;  4YCV A;  4A3K H;  2UUA Q;  1T9H A;  5IYD H;  3CPW A;  1UE5 A;  1TWA H;  3ULL A;  2IX1 A;  4OON A;  2JA7 H;  2F52 A;  2PQA B;  5IYC G;  1Q7Y C;  4LNQ A;  2JA6 H;  5BR8 Q;  4EQ5 A;  1XPU A;  4IFD G;  1BBW A;  1A62 A;  1SMX A;  1LTL A;  1R9T H;  1PH4 A;  4FDB A;  3W1B A;  4DV2 Q;  1VQ8 A;  4LFA L;  4QIW E;  3H15 A;  1VQO A;  3RZO H;  4DR7 Q;  2RHS B;  1XMQ Q;  1Q86 C;  1PHJ A;  1EYG A;  3KJP A;  1VS0 A;  1IXR A;  1N36 Q;  4B3T L;  1IL2 A;  3HOU H;  4HJA A;  3ZJY C;  3D31 A;  1E1O A;  4DR1 Q;  3GTQ H;  1IBM Q;  4DK6 C;  4JCV E;  3OW2 A;  1OXT A;  1X55 A;  4QJF A;  3CD6 A;  2F4V Q;  4DR4 Q;  4X64 Q;  2N49 A;  4OO1 I;  4WJ4 A;  1XNQ L;  4JI2 L;  3BJU A;  3CP0 A;  2R92 H;  2AKW B;  3M4P A;  1BVS A;  4H02 A;  2KHI A;  4C3J H;  2UUB Q;  2NVX H;  4LWC A;  4A3E G;  1VQ4 A;  3S1Q H;  3J81 i;  4LUZ A;  4A76 A;  4XIG S;  4LF8 Q;  5C0X G;  4LF5 Q;  4PZ6 A;  2WP8 J;  1QUQ A;  2ZTC A;  3RLO A;  2BH2 A;  3RN5 A;  1D8L A;  5JJK A;  1N9W A;  2ZJP A;  1I5F A;  1Y1V H;  2UXB L;  3D0F A;  2CWA A;  3PUX A;  1KRS A;  4JI4 L;  4DAY B;  1WCM G;  3CC7 A;  4DV7 L;  4X62 L;  1OTC A;  2ZM6 Q;  4DV0 Q;  3UDX A;  3HOW H;  2JEB I;  1JJG A;  2CCZ A;  1U5K A;  2YV5 A;  1Z47 A;  1VQP A;  1KL9 A;  4DV4 Q;  3E9H A;  4NPS A;  4R4I A;  1C9O A;  1SRU A;  2OTL A;  4QQB X;  3M9B A;  1KQS A;  4X66 L;  1HNZ Q;  1SRO A;  2E5L Q;  1U0L A;  2E2J H;  2HIV A;  4K0K Q;  4JV5 L;  1N32 Q;  5K36 G;  5M5W H;  3GTG H;  4KHP L;  4IOC A;  3H3V I;  2I0Q A;  3RNU A;  4IO9 A;  1VQA A;  2CWP A;  1YZ6 A;  4JI1 Q;  5M3F G;  4DV5 L;  2Q2U A;  3PIO A;  3KLW A;  4GKK L;  4OWT B;  3HOY G;  3G71 A;  5BR8 L;  3M3Y H;  4BXX G;  4KLK A;  4YHH Q;  4NXM L;  4GNX C;  5GAH C;  2HHH Q;  2MO0 A;  3HFZ B;  3K7U C;  4P72 A;  1YHA A;  1QZH A;  2E2I H;  2Z6K C;  3CCL A;  3PO2 H;  2NN6 G;  1PH6 A;  3NEM A;  4DV2 L;  2HIX A;  2C35 B;  3WWV A;  1XMQ L;  4A3E H;  3T1H L;  1TXY A;  1YJW A;  1N36 L;  3ERS X;  4IJH A;  5H1S E;  3NEL A;  3HOX H;  5C4X H;  2JJQ A;  4JI8 Q;  1IBM L;  5FLX c;  3UDI A;  4A3M H;  2ALY B;  1OXX K;  5M3M G;  1UEB A;  2OQK A;  2VS1 A;  1LUZ A;  3RR5 A;  4GN3 B;  4DR3 L;  2E2H H;  4DR4 L;  4A93 G;  1SFO H;  1OXV A;  2K4K A;  4P71 A;  3JAM c;  2JQO A;  4JI3 Q;  1V43 A;  2EQS A;  3FKI H;  4GLV B;  1YBY A;  1HNX Q;  4JG2 A;  4DR6 L;  4KHP Q;  1GD7 A;  2IX0 A;  3AEV A;  2UXC Q;  3IRB A;  3TEH B;  3KOJ A;  2I5L X;  5IY0 A;  1WCM H;  3KDF A;  4P75 A;  3AQQ A;  4GS3 A;  3AFQ A;  2LSS A;  4LF6 Q;  4IOA A;  5IYB G;  1Z9F A;  1IZ6 A;  4LF5 L;  3HOV G;  3JC6 6;  3J81 j;  3CCV A;  3SGI A;  1EIY B;  3NEN A;  2JE6 I;  4GOP C;  1VQ6 A;  2FXQ A;  1G6P A;  2BH8 A;  2MO1 A;  1PH1 A;  2ATW A;  1W3S A;  2ZTD A;  4X65 Q;  1YJ9 A;  2QGQ A;  3J81 c;  1CKN A;  2GVB A;  2KBN A;  2A19 A;  2WAQ G;  5GAE C;  2ZM6 L;  2XTI A;  2UU9 L;  2R7Z G;  2IY5 B;  1SR3 A;  5LMN W;  2QA4 A;  1E22 A;  2DUD A;  1I50 H;  4B3M Q;  4BXX H;  2UXD Q;  2VY3 A;  4L5T A;  1NE3 A;  3J80 c;  1S3O A;  2PI2 A;  3UE0 A;  4JI7 Q;  2VQE Q;  4R1J A;  5M3F H;  2UUC Q;  4OX9 L;  1IYJ B;  4KI0 A;  1XMO L;  2RHQ B;  3W1G A;  5FJ8 G;  2JA5 G;  2Z0S A;  1GVP A;  2PI2 E;  4JYA Q;  2JA9 A;  3LGJ A;  2YTY A;  3PV0 A;  3PF5 A;  1GO3 E;  1VQB A;  4NB3 A;  1HNZ L;  4AQY L;  4APV A;  5J3B A;  2EIF A;  2JA8 G;  4K0K L;  1N34 Q;  1KXL A;  2VL6 A;  4JOI C;  5M5Y H;  1PYS B;  1I3Q H;  2N78 A;  3BZK A;  2GVA A;  2CQO A;  2AWN A;  1YEZ A;  3PUY A; 
#chains in the Genus database with same CATH topology
 3R8B A;  2KCT A;  4ZKC B;  1Y14 B;  3L9A X;  4A93 H;  4ZYS A;  3VR5 A;  2I5H A;  3C46 A;  1Q81 C;  1B2T A;  5C3W A;  4GNX B;  4DV1 L;  2ID0 A;  3F2C A;  1WTX A;  4A4I A;  3H09 A;  4FF2 A;  4EVO A;  4CDF C;  3HOV H;  4M8A A;  5E4X A;  2N88 A;  3X3M A;  4PMW A;  1IBL Q;  1HNX L;  3TS2 A;  3T1Y L;  1EIF A;  4DR5 Q;  4DK1 A;  5TSS A;  2Q8R E;  4IPG A;  4BBS B;  1I6H H;  1VQI A;  2BCO A;  1RJT A;  1IW7 C;  4DXF A;  2ZTE A;  3Q6S A;  1W2B A;  1A3V A;  4GOP B;  1J5E Q;  1KNE A;  1Z7T A;  2JA8 H;  3BDL A;  4B3M L;  1MKH A;  2VQE L;  5C3E H;  2DN8 A;  1D7Q A;  4DPG A;  1WTH A;  2WB1 B;  3U4Z A;  1AFP A;  3KF6 A;  2CH4 A;  5L37 A;  2EXZ A;  2IT1 A;  2VUM B;  4C1N K;  1BCP D;  4A3L H;  3DMU A;  4LF4 L;  2ZJR A;  1L1O A;  2XRQ D;  1EL0 A;  4RKL A;  1Q1E A;  3K5M A;  1WD1 A;  2UUA L;  2K33 A;  4QGU A;  2J0T D;  5E3F A;  3F8T A;  2L0C A;  3QB3 A;  2FMC A;  1CKN B;  4BWG B;  4DUZ Q;  4RHR A;  4BBS G;  2GA4 B;  2O2L D;  4ABN A;  1A0I A;  2F0D A;  5JJZ A;  2CH4 W;  1STB A;  4DR7 L;  5AFW A;  5GAG C;  1F2Y A;  2KJX A;  3QOL A;  3J7Z C;  1D2B A;  3AB9 A;  2WB1 G;  4KY5 A;  4KN7 C;  2PYK A;  3CCS A;  2VUM G;  1SNQ A;  1CZW A;  4LF8 L;  3GO5 A;  2CVR A;  4UDU C;  1UEA B;  1I94 L;  1Y1V B;  2EVB A;  1UNS A;  1SNC A;  1SYD A;  3CPF A;  4B3T Q;  2K5V A;  1N33 L;  3G6J B;  1V8Q A;  3M4Q A;  4PZ7 A;  3KBX A;  1B9N A;  2OTJ A;  5K36 H;  1C0A A;  1OXU A;  4RGT A;  2WKD A;  2F0L A;  3E6Z X;  4RFB A;  3TQY A;  1B53 A;  1EY0 A;  1I4H A;  2EOT A;  2A6E C;  2N3S A;  4GN4 B;  3EA6 A;  3KBG A;  1LYL A;  2B2U C;  4NP5 A;  1XNR Q;  2NZO A;  5DM6 3;  3FVQ A;  4DV7 Q;  2E2I B;  2BOS A;  5JJI A;  3H6M A;  1V1Q A;  1GM5 A;  1AH9 A;  2D2C C;  4L6T B;  4A3C H;  3HOX B;  4FYD A;  5CBA E;  1PFS A;  5GQO A;  4G7Z C;  3DWP A;  2Z6B A;  1Y1W B;  2G9D A;  2RBM A;  3D4D A;  5LMU L;  5EBC A;  1YNX A;  3G48 A;  1QIL A;  2K5Q A;  1A15 A;  4BY1 B;  3PO3 H;  1R4P B;  4YY3 L;  4DV5 Q;  1PZK D;  1X3Q A;  2RKS A;  3MC0 B;  4LF6 L;  3CCE A;  3QO2 A;  1LV9 A;  1YNN C;  1HTP A;  4RCO A;  4NXM Q;  2H1E A;  5I9O A;  3E0E A;  4X65 L;  1PH8 A;  1CSQ A;  2B2Y C;  2F0J A;  4IPH A;  1FJG Q;  3SXH A;  1RF2 D;  3I4N B;  2K1B A;  4XQJ A;  3CMA A;  4DR3 Q;  1M8A A;  5M3F B;  1PMR A;  3L2P A;  3MFG A;  1EZ6 A;  5DEH A;  1M1K C;  3E3X A;  1D6E C;  3FDT A;  1X3P A;  3HOX G;  4HCE A;  3QOJ A;  3TP7 A;  1Y1W G;  1JR0 D;  1HZ9 A;  1A6X A;  2YYZ A;  3MAQ A;  5FLM H;  4LF7 L;  3HS0 C;  1GUS A;  2RCF A;  4BY1 G;  2R93 H;  2I07 B;  4Z9C B;  2SOB A;  3I70 A;  4A93 B;  2JA7 B;  3F2D A;  4GNX A;  1QVG A;  2X69 A;  5G3L F;  3OTO L;  3J81 E;  1XPO A;  1ESF A;  1P8L A;  5HUR A;  3I3C A;  3GV3 A;  3SDZ A;  2RSN A;  2QKI C;  3I4N G;  4EQO A;  5KIX A;  1JB7 A;  1IBL L;  1H9M A;  4DN4 M;  1LM0 A;  4CDC C;  3KUP A;  4FXK C;  1HR0 W;  5KNC A;  4DNI A;  4C3J B;  1VQM A;  2NVX B;  4B9X A;  1I4X A;  1AW7 A;  2IHE A;  4PNY A;  3BU2 A;  2PPB C;  2CFM A;  1IYV A;  2L9H A;  1WFQ A;  4GOP A;  3A55 A;  2E76 C;  5JOB A;  3HOZ H;  4L8J A;  3AYH B;  1L2F A;  2MHV A;  1D5Z C;  1J6Q A;  2M9V A;  4LF9 L;  4PV1 C;  5C3E B;  2JA7 G;  1QJO A;  4RGN A;  1FR3 A;  1X3F A;  1GUG A;  3GDE A;  1K9M C;  4BA1 I;  1UE6 A;  1PTO C;  2I46 A;  1Q8I A;  3H0G H;  5I9P A;  4WJW A;  2F0S A;  4Y7N H;  5C0X J;  3V2T A;  3NTK A;  2E2J B;  3R3O A;  4X3U A;  1WTP A;  1NY4 A;  2RF4 A;  3DWQ A;  4C3J G;  2HUG A;  1TY0 A;  3D4W A;  4DFA A;  4MTN A;  4C3H H;  3OPO A;  4JI4 Q;  4DUZ L;  3R2T A;  3KFU A;  5FLX L;  3BYT B;  3TRE A;  1STH A;  2NYZ D;  4K8I A;  1HJP A;  1NR2 A;  1C48 A;  2KED A;  2EYL A;  1PFN A;  3S2H H;  2QW7 A;  1B7Y B;  2IX3 A;  1E0B A;  2F0V A;  2ASB A;  5IT9 L;  4X66 Q;  5C3E G;  4QY7 A;  3UE1 A;  2B8F A;  1NJI C;  2NTT A;  4H0L C;  1T9H A;  1B1Z A;  1TWA H;  2N55 A;  2VB3 X;  1EWH A;  1HQR D;  2F52 A;  2PQA B;  4EQ5 A;  3TP8 A;  3PIO 3;  1R9T H;  1SE2 A;  3W1B A;  4QIW E;  3RZO H;  3CHB D;  4C1N I;  1IL2 A;  4B3T L;  3HOU H;  1EIG A;  2DY7 A;  3ZJY C;  2EYF A;  4ID6 A;  3GTQ H;  1TT2 A;  2SEB D;  4HR7 B;  4DR4 Q;  2N49 A;  1XXG A;  1XNQ L;  4JI2 L;  3BJU A;  2R92 H;  4LK1 C;  2D9U A;  3M4P A;  2KHI A;  2UUB Q;  1TY2 A;  4LWC A;  2WKC A;  5EQ0 A;  1G2T A;  3S1Q H;  4B08 A;  2J4X A;  2FIN B;  1LTB D;  4PZ6 A;  3DM1 A;  2P5Z X;  5JJK A;  3URY A;  3OSO A;  5C4H A;  4U67 3;  2CWA A;  3IL8 A;  4DV7 L;  3NHH A;  1CA6 A;  1STN A;  4AYB B;  2JEB I;  5JEA H;  1CM9 A;  3T51 B;  1U5K A;  2K5D A;  2CCZ A;  1Z47 A;  1VQP A;  3K5L A;  2VB2 X;  1KL9 A;  3E9H A;  3IFT A;  2L12 A;  3S17 B;  4PMC A;  1KQS A;  2JYO A;  1SRO A;  1HNZ Q;  1U0L A;  2F0N A;  5J22 A;  4K0K Q;  5K36 G;  5M5W H;  3GV6 A;  3E0J A;  1YZ6 A;  4DV5 L;  4IFD H;  3H3V C;  1ENF A;  3M3Y H;  4KKU A;  4KLK A;  1E2Z A;  4NXM L;  3U9O A;  3EQL C;  2MO0 A;  4P72 A;  1T5X D;  3NEM A;  3FRP B;  5LL6 S;  3NEL A;  2F0W A;  1FYC A;  2Z8L A;  5ELE A;  3UDI A;  2HCI A;  3NP8 A;  4DR3 L;  4WJ4 A;  1CHP D;  5BN3 A;  5JAV A;  4X3T A;  5C3X A;  1HNX Q;  2DJF C;  1JOK A;  3VYT A;  3TEH B;  1WCM H;  4P75 A;  1WVL A;  2JSO A;  3AFQ A;  4HMI A;  2Y0S B;  1PTO D;  3SEB A;  3W2D A;  2ATW A;  1W3S A;  2ZTD A;  3I91 A;  2R93 B;  1YJ9 A;  1TS5 A;  1PH2 A;  2GVB A;  2A19 A;  2SNM A;  5GAE C;  3A54 A;  3ERO A;  1SR3 A;  1I50 H;  4B3M Q;  2XVS A;  3GQB A;  1S3O A;  2PI2 A;  2VQE Q;  4R1J A;  3FPP A;  1TS3 A;  3HRZ C;  5FJ8 G;  2A74 C;  3VR4 A;  3T16 A;  4JYA Q;  3PF5 A;  4ZAI A;  4APV A;  5J3B A;  4P2C B;  1H9S B;  4JOI C;  5M5Y H;  3FPU B;  2BH2 A;  1H95 A;  2OXP A;  5K5P A;  2Y0S G;  1CZG A;  1B9M A;  1EOV A;  5FLM G;  2NWG A;  3HOZ B;  2R93 G;  1IBK Q;  5IYB H;  4KHZ A;  2NVY H;  2K75 A;  3Q8D A;  1VQD A;  2Q2H A;  3BYY B;  4RGM A;  2E8G A;  5A2Q E;  4Y7N B;  1RDP D;  3HKZ B;  3PF4 A;  4CDD C;  1EQV A;  2B2W C;  1ROD A;  1X9N A;  2AQ2 B;  1TWG H;  1I94 Q;  3SR1 A;  5CBE E;  3M7G A;  5IGD A;  1CT1 D;  2EYP A;  2UXD L;  1VQC A;  2NZH A;  2KHS A;  1TWH H;  3U9S A;  1N33 Q;  1K0R A;  1BCP C;  1S5F D;  2F3I A;  4A3J B;  1YHB A;  5ISR A;  3S2H B;  4A3G H;  1NAP A;  3HOZ G;  3HP3 A;  3JAM E;  5ELO A;  4YWK A;  4QF4 A;  1EY6 A;  2JP1 A;  1GKH A;  4ZUI A;  4B3S L;  3M85 A;  1W6J A;  1PZI D;  4GLA C;  3I90 A;  4UP9 A;  5IGC A;  1EQQ A;  4LAA A;  4DV6 L;  4ZRZ A;  2QF7 A;  2BDO A;  2RDF A;  5IOC A;  1YIJ A;  5GAD C;  3HKZ G;  1QCB D;  1R9T B;  1KNA A;  3QG1 A;  5IP7 G;  3I55 A;  4K2K A;  2KOL A;  1MJC A;  5DAU A;  4A3D H;  3GTO H;  1K8A C;  2WIN B;  1L1O C;  3S9W A;  4OEM B;  4C2M H;  1EWC A;  3UDF A;  2DY8 A;  5LMU Q;  3S15 H;  4A3J G;  4IUV A;  1KRT A;  2UUB L;  1V9P A;  4YY3 Q;  1L0Y B;  5KGU A;  3HKZ E;  4PMB A;  4R4T A;  1RTN A;  3PUW A;  2JN4 A;  1YIT A;  3P7J A;  2ZJQ A;  3TDQ A;  3CCR A;  3CF5 A;  2HDL A;  3F1Z A;  3ND9 A;  3BVZ A;  4BBR H;  1XPR A;  1DCZ A;  4DV3 L;  1Z6H A;  3MTS A;  1SYG A;  3KF8 B;  2CKZ B;  1LTG D;  1QZG A;  4M1U B;  1KAW A;  4A3F H;  4YCU A;  4EQN A;  3M4O H;  1ASZ A;  4GN5 A;  2X6L A;  3WOE A;  1TVX A;  1JE4 A;  1O80 A;  3GTP H;  4KN4 C;  4BY7 H;  4NKL A;  2B29 A;  1R4Q B;  1WJJ A;  3R2I A;  1EYD A;  2IJ0 A;  3T53 B;  5M5W B;  2OEO A;  4RCN A;  1PTO H;  1O78 A;  2NBF A;  4JBJ A;  1MSG A;  2KHJ A;  2QEJ C;  3A7A B;  5CV8 A;  4LF7 Q;  4TRD A;  1BKB A;  1SYE A;  1TWF H;  3PUZ A;  3M3Y B;  4K2L A;  2O5I C;  4ZLT F;  4IZ8 A;  3TRZ A;  2A5H A;  4IUU A;  4J6H A;  3VDY A;  3DLL A;  1VMP A;  5E7N A;  3OTO Q;  5BN4 A;  3CRK C;  1MIU A;  3OIQ A;  4DXG A;  5C5M A;  3M7N A;  4X3K A;  1VQ5 A;  5JEA G;  1K73 C;  2QDL A;  4HMJ A;  1IL8 A;  1STE A;  1CUK A;  3DWA A;  2VNU D;  4OEL B;  1KDB A;  4GKK Q;  1HTL D;  4KJN A;  3CQZ B;  4OWW B;  1L0W A;  4K5V A;  4OXP A;  5EAY A;  3J80 L;  4JI6 L;  2V1C C;  3CME A;  1IHZ A;  1ENA A;  3S1R H;  4F8M A;  1FNV A;  1FD7 D;  4N8F A;  3ICE A;  2K50 A;  1VQL A;  1I50 B;  2NB0 A;  1FGU A;  4A3I H;  2KQ3 A;  3PSI A;  4LF9 Q;  1STA A;  4NMZ A;  5J1Z A;  4ALP A;  4DR6 Q;  1H9S A;  4JYA L;  4B3R L;  3PQI A;  1HRJ A;  3GTK B;  2F0U A;  3CXC A;  4F88 A;  1TQO A;  5M5Y B;  4MHE A;  1C8C A;  4H44 C;  3NXW A;  3J80 i;  2NZ1 D;  3KDF B;  3GTM B;  2B2T C;  4J1M A;  3S2D H;  4OO1 H;  1EEI D;  3LX0 A;  3T4A C;  1V1P B;  1EWI A;  1LT4 D;  4YWL A;  1NBW A;  4WRD A;  4IQZ A;  2Z6K A;  2Q2T A;  4A75 A;  4OX9 Q;  1XMO Q;  3CCQ A;  1PTO F;  1IBK L;  1XWE A;  3U50 C;  4R4C A;  1BXT A;  1SYB A;  1ENC A;  1JB3 A;  1HZA A;  2D0O A;  1UUP A;  1KLU D;  2CQA A;  2PCF B;  3C2P A;  3PCO B;  4KV6 A;  4O42 A;  4UHV A;  2KCM A;  1PH5 A;  1MBY A;  4ME3 A;  2A6H C;  3BZC A;  2K5H A;  2A68 C;  3T56 B;  3MXG A;  1KAA A;  5EKL A;  1MD2 D;  3H3V H;  1ONL A;  1QG7 A;  1G51 A;  1E3P A;  1SSO A;  2H5X A;  1STY A;  1LO5 D;  1GHK A;  1MJE A;  1B3A A;  1TWH B;  1VQE A;  1T5E A;  3PIP A;  3HG9 A;  2WB1 E;  4DK0 A;  1XNQ Q;  4JI2 Q;  1X54 A;  1PH9 A;  2PO4 A;  2FMM A;  3GTG B;  5LL6 X;  3G6E A;  3CW2 C;  2SNS A;  4EGV A;  3I7F A;  2XN9 C;  1NMG A;  5FO9 B;  3TN2 A;  1LT3 D;  5E4W C;  1I4R A;  2KVM A;  4XDX A;  5CGK A;  1WI5 A;  3I4M H;  4LFB Q;  5AJ3 L;  4A3E B;  3MWY W;  2K5N A;  3QIA A;  2K04 A;  3KYH C;  1Y1V G;  2K5W A;  3GTO B;  4MNO A;  4DAM A;  4F87 A;  2E2H B;  3CAM A;  3QJY A;  4HAE A;  4GZY C;  5IP9 H;  2MUY A;  4HIK A;  4GKJ L;  4GLX A;  3BDO A;  5HGT A;  3TP5 A;  5IYD H;  1UE5 A;  3MEH A;  3ULL A;  2IX1 A;  2VXW A;  3D6W A;  4LNQ A;  2JA6 H;  1XPU A;  2F0F A;  1G2S A;  1NCV A;  2Z4I A;  1SMX A;  2PZU A;  5EPK A;  3KF8 A;  4BBR B;  5KNB A;  1VQ8 A;  2QIL A;  4LFA L;  3K59 A;  2IW3 A;  2RHS B;  2KEC A;  3D31 A;  4JCV E;  1X55 A;  4CHT B;  4X64 Q;  4OO1 I;  2EY6 A;  3GTP B;  3D8G A;  3KLS A;  1BVS A;  4H02 A;  5CV9 A;  4A3E G;  1I3Q B;  1PTO B;  1ZEQ X;  2WP8 J;  1EOT A;  3VR3 A;  1N9W A;  3KLS X;  1I5F A;  1G91 A;  4G4K A;  1WTR A;  4LMQ D;  4DAY B;  1BR9 A;  1EY9 A;  4X62 L;  1OTC A;  1ZYR D;  3P1H A;  2XSC A;  1CK1 A;  1LTA D;  4NPS A;  4ULL A;  1EFI D;  1HHV A;  3Q23 A;  3M9B A;  3HOV B;  3NWS A;  1IKM A;  4TKO B;  1TU2 B;  2TMP A;  2E5L Q;  1DD2 A;  2K01 A;  3H3V I;  1HFN A;  1GXD C;  3RNU A;  4IO9 A;  1VQA A;  2CWP A;  5M3F G;  1AP0 A;  2WAQ B;  3KLW A;  4GKK L;  4OWT B;  5BR8 L;  1I6H B;  1PRT C;  1K8O A;  5C4Z A;  4CJ0 B;  2HHH Q;  3HFZ B;  3K7U C;  3CCL A;  1YHA A;  1QZH A;  4DV2 L;  2WII B;  1ZKO A;  2HIX A;  2C35 B;  3S1R B;  3WWV A;  1XMQ L;  1E2W A;  2A6H D;  2RSO A;  4IJH A;  5T1G A;  2A68 D;  1N36 L;  5C4X H;  3DEP A;  2JA8 B;  2PMZ B;  5FLX c;  1JOR A;  1UEB A;  2OQK A;  4GN3 B;  4A93 G;  3SK6 A;  1SFO H;  3JAM c;  2EQS A;  4DR6 L;  5IY0 A;  3KDF A;  4X3S A;  4GS3 A;  2F0O A;  1Z9F A;  4LF5 L;  4QCL A;  3EJI A;  5EKK A;  3JC6 6;  5JVG 3;  3HOV G;  3I8Z A;  3SGI A;  3NEN A;  1EIY B;  2F3V A;  2M00 A;  5KEE A;  2B2U A;  2QGQ A;  3A8J E;  1CKN A;  2WAQ G;  1E22 A;  2UXD Q;  2ICE C;  3TBI B;  4CDE C;  3UE0 A;  4JI7 Q;  4OX9 L;  1XMO L;  2F0K A;  2RHQ B;  1GVP A;  2PI2 E;  2YTY A;  4BXX H;  1GO3 E;  2K6A A;  1K3B C;  2JA8 G;  4KD4 A;  3D6C A;  3IKJ A;  1LT6 D;  2LS0 1;  3MVV A;  2NN6 H;  2N78 A;  3BZK A;  2R3Z A;  1U4L A;  4B3S Q;  2CQO A;  4JI1 L;  2ZXR A;  2AWN A;  4C3I H;  3SHL A;  1KC8 C;  1SNP A;  4R8N A;  3NQT A;  3M4Y A;  4IPD A;  1M90 C;  4DV6 Q;  5IGG A;  2B3G A;  4A3L G;  1NSN S;  1X3E A;  2EYO A;  2RCN A;  1BCP F;  4XT1 B;  3BVG A;  5FOB B;  4NDX A;  5D3I B;  1D1K A;  3RLN A;  2B2Y A;  5ELB A;  1HA5 A;  4JI8 L;  1F9R A;  3Q0A A;  4BA2 I;  2PQE A;  3OIP A;  1K83 H;  1JWS D;  4QUF A;  1S40 A;  3BDC A;  4JI3 L;  4KHP L;  4EQP A;  2F0M A;  3S24 A;  5D65 A;  1A3U A;  1HNW Q;  4J15 A;  4JI5 Q;  1P16 A;  2B63 H;  3VA7 A;  1QNK A;  2R7Z H;  5JJL A;  3RLF A;  3CRL C;  3ZYY X;  3CCU A;  3K6O A;  4X6A H;  1VQK A;  1WD0 A;  3VA5 A;  3R93 A;  2JA5 H;  2NUC A;  1U9R A;  1UE1 A;  2VW9 A;  4DV3 Q;  1DGS A;  2N8N A;  4IN3 A;  1TII D;  3I4M B;  4FP5 D;  4FF3 A;  4LFB L;  4LUV A;  1JMC A;  5M5X H;  1HZB A;  1VF7 A;  2MGS A;  4JVZ A;  1YI2 A;  3SK5 A;  1ICW A;  1N34 L;  3OWF A;  5EJW A;  5CV6 A;  1HUN A;  4QUC A;  1A2T A;  2PZT A;  4ZCK A;  2K03 A;  4HCS A;  2WAC A;  3GTL H;  1AE2 A;  3PO3 B;  3B6Y A;  2FJ2 A;  2K32 A;  3MEF A;  4K6D A;  1SJH D;  4L5Q A;  3E9I A;  3A8K E;  1LAC A;  1PYB A;  4CKC A;  1RD9 D;  3KK7 A;  1CKO A;  3S1N H;  4QB4 A;  2JEA I;  1PRT D;  1FGB D;  1SEB D;  1OO9 B;  1PZJ D;  4MIU A;  1TS2 A;  3CC2 A;  2NVQ H;  3LWE A;  4NW2 A;  5C0X H;  1F77 A;  2PNH A;  3NTI A;  5NUC A;  3I4M G;  4X64 L;  4G7H C;  2LY7 A;  4JBW A;  2F0Q A;  4AYB G;  4DU9 A;  4DUY L;  1HXY D;  4HIO A;  4A3C G;  1JJC B;  5I2Y A;  3A74 A;  2Q2I A;  2BDN A;  5CC4 A;  3RD4 A;  4IJL A;  4DAY A;  3BS1 A;  4JI6 Q;  3PO3 G;  3OHX C;  3NTH A;  1M4V A;  1GHJ A;  5BN5 A;  1B8A A;  3K5O A;  1DOL A;  3STB C;  2F0P A;  2NN6 I;  4AYB E;  3J7Y W;  4HJ8 A;  1PH3 A;  4S3S A;  3P20 A;  2EPB A;  1I4P A;  1X6O A;  2TSS A;  3A5Z B;  1AE3 A;  3Q22 A;  3HOY H;  1BCP B;  1PFB A;  4POF A;  4B3R Q;  2XWJ B;  2EYJ A;  2E5L L;  4BBS H;  1X56 A;  1MSH A;  1PDQ A;  1DM0 B;  3TS0 A;  1DZ1 A;  2E74 C;  1FL0 A;  1QUQ B;  1BOS A;  1JOO A;  2HHH L;  2M2L A;  1EYC A;  3AU7 A;  4UPA A;  2B2V C;  5C4X B;  3EIV A;  5T1I A;  2VUM H;  1Y8O B;  1JQY D;  1KHI A;  2R7F A;  5IGE A;  1PVO A;  1S72 A;  1LTT D;  1SFO B;  2EJG C;  1SNM A;  1YNJ C;  5J39 A;  1FNU A;  4FO2 A;  4NXN L;  3OYY A;  1GUW A;  4R4O A;  2K05 A;  4L5R C;  4HSV A;  1L1O B;  2D62 A;  3ERQ A;  4KKS A;  2MJ8 A;  2AUJ D;  2HQE A;  5ELD A;  3SVM A;  3H0G B;  2ENB A;  4DGZ A;  1EEF D;  2Y0S E;  3HEJ A;  2A69 C;  1QVF A;  1E1T A;  1XJV A;  1ILQ A;  1LTS D;  2OQ0 A;  1NMF A;  3EVQ A;  3T1H Q;  4DR2 L;  3DUZ A;  5CR3 A;  4C3H B;  3KLR A;  4O1N A;  1LAB A;  4JI7 L;  4LJZ C;  2F1M A;  4IFD I;  1SXT A;  2K7V A;  5FLX E;  4V19 0;  3PIP 3;  5C4X G;  3QR8 A;  1G6Z A;  2AHO B;  2G5D A;  1CQF A;  4HIM A;  2B8G A;  1VCI A;  2HDM A;  2ICI A;  5IT9 E;  3BZD B;  2PQA A;  2OWO A;  2ZT9 C;  1TWA B;  3I2Z A;  4RAU C;  5GRO A;  4JI0 L;  3RN2 A;  5C0X I;  1CHQ D;  3A8I E;  3H0G G;  3FHW A;  1ET9 A;  4TVA B;  3NK9 A;  1H9R A;  3EBE A;  3ER0 A;  1WTW A;  4K5W A;  2LMC B;  2QEX A;  3HGB A;  3LWU A;  1HCZ A;  3LNN A;  3NUC A;  3RZO B;  5HY6 A;  5HGQ A;  5AJ3 Q;  3HOU B;  1K83 B;  1BQQ T;  2EXD A;  3GTQ B;  1EY7 A;  4C3H G;  1S5E D;  5KYI A;  1HNW L;  3H94 A;  4OWX B;  2B63 B;  3IFD A;  4JI5 L;  3EN2 A;  4GKJ Q;  2R92 B;  2D0P A;  5IOD A;  3DXJ C;  1DXM A;  3S1Q B;  4V0B A;  3OMC A;  2K14 A;  2ZXP A;  2LXJ A;  4IPC A;  3PGZ A;  3VYR A;  2G9H D;  2O4X A;  3TZU A;  3UDG A;  1H9K A;  3S16 H;  3MA2 B;  2MP1 A;  1UWV A;  1X3G A;  2OT2 A;  4O2D A;  4LFA Q;  2Q8T A;  3HZX A;  4LFC Q;  2IWH A;  1XX8 A;  1X65 A;  3T13 A;  1Y1W H;  3NBH B;  1VQN A;  2EY1 A;  3DEO A;  4UP8 A;  1LTR D;  4BY1 H;  1CFM A;  2BA0 A;  4QL5 A;  2XGT A;  3STB D;  1EZ8 A;  4DNR B;  2OCE A;  4IAL A;  1EY5 A;  1ESR A;  4XQQ A;  2XWB B;  3HOU G;  4JOI A;  1O7I A;  3GTL B;  3L7Z C;  1BNZ A;  1Y8P B;  4YWM A;  1PXU A;  3TME A;  2MQH A;  1FVI A;  3I56 A;  1VQ9 A;  2B63 G;  2R92 G;  4R4Q A;  4P73 A;  1CSP A;  3I4N H;  3V96 A;  2R61 A;  5LMN Q;  1DON A;  1QB5 D;  4A3B H;  4X62 Q;  3MZ5 A;  4JC0 A;  1PV4 A;  3K7A H;  4R8I A;  1RL2 A;  1HZC A;  3K58 A;  2MFI A;  3NSW A;  4RWS C;  2NVQ B;  1JCK B;  4CGY B;  4R9W A;  3CC4 A;  2RA4 A;  5CV4 A;  2VQF Q;  2E75 C;  2L11 A;  4MTK A;  4PZ8 A;  3MXU A;  3SE0 A;  2FFK B;  4A3K H;  4KMU C;  2DNC A;  1WCM B;  2XIW A;  3CPW A;  2F3W A;  2F0I A;  5EGT A;  1YNJ D;  4OON A;  2JA7 H;  3J81 L;  1WTQ A;  1Q7Y C;  5BR8 Q;  3D4R A;  1ET6 A;  1BBW A;  2B2W A;  2FHT A;  1LTL A;  1IKL A;  3TP6 A;  4FDB A;  4DV2 Q;  4IFD G;  1VQO A;  2F03 A;  2A69 D;  1XMQ Q;  1PHJ A;  1IXR A;  4OHJ A;  1N36 Q;  4IUQ A;  4HJA A;  5LHY 1;  4DR1 Q;  3NWT A;  3C1F A;  1OXT A;  4IUP A;  5KRU A;  2F4V Q;  3NBI A;  5DM7 3;  3MFY A;  1MGS A;  3CP0 A;  3X3N A;  2AKW B;  3HOY B;  4C3J H;  2NVX H;  1BDO A;  1E2V A;  1W6K A;  3J81 i;  4LUZ A;  4A76 A;  1PRT F;  4DNT B;  4XIG S;  1ZXT A;  5C0X G;  4LF5 Q;  4Q5V A;  5FO7 B;  1QUQ A;  4U68 A;  2ZXO A;  3RLO A;  1S5D D;  1D8L A;  2EDG A;  1ZYR C;  1VMC A;  2L55 A;  3D0F A;  1KDC A;  4HSP A;  1F9S A;  3PUX A;  1KRS A;  1WCM G;  2RVL A;  3CC7 A;  3CU7 A;  4N9P A;  5EPJ A;  4DV0 Q;  2X6G A;  3HOW H;  1ICF B;  4RA8 A;  1RHP A;  2YV5 A;  2LFN A;  2H4O A;  4DV4 Q;  1AZP A;  2KCN A;  1SRU A;  2NVY B;  2A73 B;  2E2J H;  1Y69 U;  4JV5 L;  1N32 Q;  1F2L A;  3N52 A;  4IOC A;  2I0Q A;  3OW7 A;  4HED A;  1DJR D;  1HA6 A;  4KD3 A;  1S5C D;  4JI1 Q;  2Q2U A;  1C4Q A;  3HOY G;  3ND8 A;  1AEX A;  1U4R A;  5C6A A;  4YHH Q;  4GNX C;  5GAH C;  4J8Q A;  3PO2 H;  1TWG B;  1PH6 A;  3C3L A;  2O5J C;  3I73 A;  1RKN A;  1SJE D;  4CJ1 B;  3T1H L;  3ERS X;  1NNX A;  4JI8 Q;  1IBM L;  4A3M H;  1G8Z D;  1LT5 D;  1OXX K;  2VS1 A;  3RR5 A;  1LUZ A;  1OXV A;  4P71 A;  4JI3 Q;  1MI2 A;  3FKI H;  2F0H A;  4GLV B;  4KHP Q;  1F2Z A;  4A3G B;  2UXC Q;  1GD7 A;  2IX0 A;  3AEV A;  1NUC A;  3IRB A;  3KOJ A;  2I5L X;  4IOA A;  2LSS A;  2PZW A;  5IYB G;  1IZ6 A;  3E5S A;  4FF4 A;  1EQT A;  3J81 j;  3CCV A;  4MN3 A;  4GOP C;  1HFG A;  4N9T A;  3SK8 A;  1RCV D;  2BH8 A;  2KEE A;  2L4N A;  1VDZ A;  1F2M A;  4XXE A;  1SYF A;  4ILW A;  2KBN A;  2ZM6 L;  2XTI A;  2IY5 B;  3PMF A;  4XYQ A;  3BG3 A;  2DUD A;  3IAY A;  2VY3 A;  1NE3 A;  1XTC D;  4CBV A;  4K14 A;  2UUC Q;  4KI0 A;  1PFM A;  3W1G A;  3SK4 A;  2JA9 A;  4A3D B;  1VQB A;  4NB3 A;  3EFX D;  1N34 Q;  1CA5 A;  3GP7 A;  2VL6 A;  4C2M B;  2MPM A;  1GJX A;  4ODG A;  2GVA A;  1A2U A;  5FO8 B;  3S15 B;  3PUY A;  4Y52 H;  1WOC A;  1WTV A;  4P74 A;  4A3G G;  3V05 A;  2GN5 A;  2EJF C;  4K8J A;  3J7A V;  1ASY A;  1VQ7 A;  2BE5 C;  2EZV A;  2K52 A;  4MZ9 A;  3S16 B;  1PRT B;  4DAV A;  1YVC A;  3P75 A;  3NBH A;  3W5O A;  1WYD A;  3BVM A;  1LTI D;  1SE8 A;  4LFC L;  3S17 H;  2XNA C;  3MHB A;  4L5S A;  3KJO A;  1TWC H;  2Z9H A;  4RHS A;  4A3F B;  2IL8 A;  3M4O B;  4RG1 A;  3OWE B;  4E6I A;  1E24 A;  1JWU D;  1B70 B;  4DK3 C;  4DUY Q;  4BY7 B;  4CKE A;  4K5X A;  1G29 1;  4JBK A;  2PNR C;  1B3Q A;  2JK8 A;  3N6R A;  2LXK A;  5C44 H;  4A3D G;  3O13 A;  1K28 A;  1TR5 A;  1XTD A;  2B2T A;  5FJ8 H;  3DM3 A;  1YHQ A;  1K3R A;  2J7Z A;  2HT1 A;  5IWA Q;  4XQN A;  1TWF B;  3F2U A;  4JPB W;  2Z4H A;  2F0E A;  4AIM A;  4I65 A;  4RGO S;  2QCP X;  1IW7 D;  1WTO A;  4A3B B;  5LMN L;  1DOM A;  3K7A B;  3VYS A;  1KAB A;  2KEN A;  2EYM A;  3S14 H;  5I6W A;  1VQJ A;  4BBR G;  4ZKB B;  3VR2 A;  5IYC H;  5E1F A;  2VQF L;  3F2B A;  4BS9 A;  5EKI A;  3U4V A;  1V1O A;  3NE5 B;  4LUO A;  4A3F G;  2JXM B;  5FKA C;  1U4M A;  4RH6 A;  4A3K B;  5KND A;  4BY7 G;  1KIX A;  4CKB A;  1D1I A;  3K0X A;  4WOR A;  4ZQ3 A;  1HUM A;  3UI2 A;  1HH2 P;  1SE3 A;  4FXG C;  4OIJ A;  3U58 A;  2OF1 A;  2K28 A;  5M9O A;  3W3A A;  3AFP A;  4HJ7 A;  2HCC A;  4KHV A;  1UE7 A;  1SLJ A;  4YCW A;  3J80 E;  5IE8 A;  1SMY C;  4DR1 L;  1F9Q A;  1STG A;  4A3I B;  5JEA J;  4A3B G;  1O7Z A;  4DR5 L;  2F4V L;  5ELF A;  1HR0 Q;  2KCC A;  4NXN Q;  2YTX A;  2AMC B;  4FNF A;  1ILP A;  1SYC A;  4HJ5 A;  5IT9 c;  1FNW A;  1Q82 C;  1Q1B A;  4WJ3 M;  1B50 A;  3K81 C;  4FF1 A;  3S2D B;  4IFD J;  2F4I A;  1J5E L;  1BF4 A;  4A3K G;  1EQR A;  1V1P A;  4QIW B;  5CMD A;  1VQG A;  4KK7 A;  4DV0 L;  4DR2 Q;  3HOW B;  2WFW A;  1XYI A;  3MXN B;  2Q8I B;  5A2Q L;  5CYU A;  3J7A 5;  1LLR D;  2EE1 A;  4IUR A;  4DV4 L;  1Q3L A;  3GTJ H;  3NPP A;  1PA6 A;  1RIP A;  4RKB A;  2HQL A;  5I4D A;  4UAI A;  1N32 L;  1E7Z A;  4A3I G;  2RQX A;  5IP7 H;  3A5U A;  1PH7 A;  4UY8 C;  4JK1 C;  3G4S A;  2WAQ E;  2A6E D;  2UXB Q;  2DNE A;  2F0G A;  5DNF A;  3HKS A;  2AWO A;  4YHH L;  1SN8 A;  4JI0 Q;  1A3T A;  5M3M H;  4TQU S;  3PO2 B;  3L3O C;  4EX5 A;  2PW5 A;  5FK9 C;  1N8R C;  3L0O A;  3JAM L;  1OXS C;  3G7L A;  1BBU A;  4A3J H;  2NVT H;  4OL7 A;  1TS4 A;  1EY4 A;  5ELN A;  4OO1 G;  5C4J H;  4XTC S;  2BE5 D;  4A3M B;  3WDN A;  4ZUJ A;  2PMZ E;  2EY5 A;  3A7L A;  4UP7 A;  3K8A A;  3HOW G;  1I6V C;  2DJG C;  3FKI B;  2UXC L;  1EYA A;  1NR4 A;  3FP9 A;  1K8M A;  2YU9 H;  2I5M X;  1EUJ A;  4ME5 A;  5D14 A;  3RZD H;  3K57 A;  3JAM i;  1KTK A;  3K0Y A;  4JBM A;  1QWY A;  2CW0 C;  4AH6 A;  1EFW A;  1YNN D;  1B4O A;  4FXD A;  1J8I A;  4LW1 A;  2YTV A;  1JE5 A;  4O0A A;  3VYU A;  3ITP A;  1JT8 A;  1EY8 A;  2EY2 A;  2R6G A;  2ES2 A;  1AN8 A;  1D5X C;  2CHB D;  3PO2 G;  2UUC L;  1PYW D;  2R7D A;  3OOC A;  5DLQ E;  5I2X A;  2VZA A;  3S1M H;  4A3M G;  1A8V A;  3OMG A;  1I4G A;  3K80 C;  1A63 A;  3FKI G;  2AQ3 B;  1XNR L;  1SND A;  1SDF A;  3CCJ A;  5KYL A;  1NTG A;  4FVM A;  1Q46 A;  2LKV A;  4IUN A;  1UAP A;  4XYO A;  1K8G A;  1ML0 D;  2UU9 Q;  2JA6 B;  4KTA A;  1MHW C;  3I72 A;  3ULJ A;  1C7Y A;  4OIK A;  1QE6 A;  3CKI B;  2AUK A;  3RUZ A;  1SE4 A;  1SNO A;  4JW0 A;  1TWC B;  4AQY Q;  4KJO A;  3A0J A;  4PG3 A;  5COY A;  4OGQ C;  2KUM A;  3QWN A;  4ZK9 B;  4L63 B;  1SMY D;  1EU4 A;  1QVC A;  1GUT A;  1U4P A;  5C44 B;  1YJN A;  2L1B A;  1KD1 C;  3J7A F;  2BA1 A;  5IP9 G;  2AQ1 B;  2DGY A;  2E2D C;  1VF5 C;  1FJG L;  1Q12 A;  2EJM A;  5IWA L;  4DV1 Q;  1DOK A;  2MNA A;  2A8V A;  1CKM A;  5IYD G;  3WOF A;  4B9W A;  3PUV A;  2JA6 G;  1Q8K A;  4H7B A;  3T1Y Q;  2IHF A;  3S14 B;  2L5T A;  2SDF A;  3FEW X;  1D5M C;  3I4O A;  1EU3 A;  4RMF A;  4YIJ A;  1S4Z A;  3CQZ H;  2V4D A;  2L15 A;  1GOZ A;  4WFN 3;  2B39 A;  4HJ9 A;  1I4Q A;  3H91 A;  5JVH 3;  5C44 G;  5EPL A;  4POG A;  1H9J A;  3FMC A;  1VQF A;  5F2D A;  1KLG D;  4I7Z C;  4DKA C;  2A1A A;  1JJ2 A;  3GTK H;  1VQH A;  4G7O C;  5D3D A;  3KF6 B;  1AZQ A;  3ULP A;  3CCM A;  3C1E A;  5CV7 A;  5IGF A;  4LF4 Q;  4HID A;  4F7X A;  3GTM H;  5CV5 A;  1KDA A;  1HR0 L;  4JV5 Q;  3GD7 A;  4YCV A;  5COR A;  2UUA Q;  4IUT A;  4C56 C;  3ONA B;  4HN7 A;  1JOQ A;  5IYC G;  1EIH A;  3AMU A;  1A62 A;  1PH4 A;  3Q24 A;  1F9P A;  3MXP A;  1II3 A;  3MXN A;  3H15 A;  4DR7 Q;  1Q86 C;  1RTO A;  3I4L A;  1EYG A;  3KJP A;  1GUN A;  1VS0 A;  2QDB A;  2CW0 D;  1E1O A;  1QOH A;  2EYH A;  4DK6 C;  3OW2 A;  1IBM Q;  4QJF A;  3CD6 A;  3D3R A;  1GUO A;  5A35 A;  4K6L A;  3GTJ B;  1BUV T;  1L0X B;  1VQ4 A;  4LF8 Q;  1BO0 A;  1SAP A;  2NTS A;  1S5B D;  2ZTC A;  4C3I B;  3RN5 A;  1QNU A;  1Q90 A;  2Z1C A;  1B44 D;  4HTH A;  2ZJP A;  2UXB L;  1Y1V H;  1JC7 A;  4CJ2 C;  4H13 C;  4JI4 L;  5M3M B;  1Y8N B;  4KY7 A;  2ZM6 Q;  4DF7 A;  3UDX A;  2RDG A;  4KKT A;  1JJG A;  5ELC A;  4DAP A;  2NVT B;  4N8X 1;  1DYQ A;  5C4J B;  3RMH A;  1K0S A;  4R4I A;  1C9O A;  4Q0F A;  2OTL A;  4QQB X;  2D5D A;  1SBB B;  4X66 L;  2C9O A;  2HIV A;  2F0T A;  3K5N A;  3GTG H;  1CQV A;  4TSS A;  1CTM A;  2YU9 B;  4PQX A;  3PIO A;  2R7Z B;  4G57 A;  3G71 A;  4BXX G;  3RZD B;  2KA7 A;  2HD3 A;  1BBX C;  2E2I H;  2Z6K C;  2NN6 G;  2JA5 B;  4C3I G;  4A3E H;  3A56 A;  1J9O A;  1TXY A;  2XRS D;  4QMG A;  3HOX H;  5H1S E;  1YJW A;  2JJQ A;  3TZD A;  2ALY B;  5M3M G;  2E2H H;  4DR4 L;  3DHQ A;  5M5X B;  1O7Y A;  2K4K A;  2JQO A;  1JIC A;  1O7L A;  1V43 A;  1YBY A;  2WV6 D;  4JG2 A;  3TSS A;  3AQQ A;  3S1M B;  4LF6 Q;  5G3L D;  1VQ6 A;  2JE6 I;  1G6P A;  2FXQ A;  1HQM C;  2PW7 A;  1PH1 A;  2MO1 A;  5EBD A;  4X65 Q;  1PLF A;  5JPN C;  2RDH A;  3J81 c;  5IGB A;  2UU9 L;  2IPK D;  2R7Z G;  4DA2 A;  5IIF A;  5C5L A;  3VR6 A;  2QA4 A;  5LMN W;  4L5T A;  3J80 c;  2C5C A;  4XT3 B;  1JWM D;  5M3F H;  3S1N B;  1IYJ B;  1TKW B;  2B2V A;  5I6Y A;  2JA5 G;  2Z0S A;  3LGJ A;  1IYU A;  3PV0 A;  1CI3 M;  1HNZ L;  4I7A A;  5JPM C;  4AQY L;  2EIF A;  4K0K L;  1KXL A;  1HPC A;  3NQI A;  4KY6 A;  1X32 A;  1PYS B;  1I3Q H;  1YEZ A; 
#chains in the Genus database with same CATH homology
 1KC8 C;  2KCT A;  4Y52 H;  1WOC A;  4P74 A;  4A3G G;  1H95 A;  4IPD A;  1M90 C;  1Y14 B;  4DV6 Q;  2B3G A;  2GN5 A;  4A3L G;  1ASY A;  1X3E A;  2RCN A;  4A93 H;  1VQ7 A;  2Y0S G;  2K52 A;  4MZ9 A;  2I5H A;  1EOV A;  5FLM G;  1Q81 C;  4GNX B;  3RLN A;  4DV1 L;  2ID0 A;  3F2C A;  1YVC A;  4A4I A;  3W5O A;  2R93 G;  1WYD A;  4JI8 L;  1IBK Q;  4LFC L;  1SE8 A;  5IYB H;  3S17 H;  4KHZ A;  4BA2 I;  4L5S A;  3HOV H;  3KJO A;  1K83 H;  2NVY H;  1TWC H;  4JI3 L;  1S40 A;  4PMW A;  2K75 A;  1HNX L;  3Q8D A;  3T1Y L;  1EIF A;  1VQD A;  1IBL Q;  4RG1 A;  3S24 A;  4DR5 Q;  3TS2 A;  1HNW Q;  1E24 A;  2Q2H A;  4J15 A;  4JI5 Q;  1B70 B;  1P16 A;  4DK3 C;  4DUY Q;  2B63 H;  2E8G A;  2R7Z H;  4IPG A;  5JJL A;  3RLF A;  1G29 1;  4JBK A;  3PF4 A;  2JK8 A;  4A3D G;  1I6H H;  1VQI A;  2LXK A;  5C44 H;  3CCU A;  1X9N A;  4X6A H;  1XTD A;  1VQK A;  2ZTE A;  1TWG H;  5FJ8 H;  3DM3 A;  2JA5 H;  1YHQ A;  1K3R A;  1W2B A;  1I94 Q;  2HT1 A;  5IWA Q;  4AIM A;  4GOP B;  1J5E Q;  1UE1 A;  2VW9 A;  2JA8 H;  4DV3 Q;  1DGS A;  2N8N A;  4B3M L;  5LMN L;  2UXD L;  1VQC A;  2NZH A;  1MKH A;  1TWH H;  4LFB L;  4LUV A;  1JMC A;  1N33 Q;  2VQE L;  5M5X H;  1HZB A;  5C3E H;  1K0R A;  1D7Q A;  2KEN A;  4DPG A;  2F3I A;  3U4Z A;  1YHB A;  3KF6 A;  4A3G H;  1YI2 A;  3S14 H;  2IT1 A;  1VQJ A;  3HOZ G;  4BBR G;  1PH2 A;  1N34 L;  5ELO A;  4YWK A;  4A3L H;  5IYC H;  2VQF L;  1GKH A;  3F2B A;  4LF4 L;  4B3S L;  3M85 A;  2ZJR A;  3U4V A;  4GLA C;  1L1O A;  3GTL H;  4UP9 A;  1AE2 A;  4LUO A;  4A3F G;  3B6Y A;  1Q1E A;  1EQQ A;  3MEF A;  2UUA L;  4DV6 L;  4BY7 G;  4QGU A;  1KIX A;  1YIJ A;  3K0X A;  5GAD C;  3F8T A;  1HH2 P;  3E9I A;  4L5Q A;  3U58 A;  3HKZ G;  4DUZ Q;  4BBS G;  1CKN B;  1PYB A;  3AFP A;  1A0I A;  4HJ7 A;  5IP7 G;  1CKO A;  1UE7 A;  1SLJ A;  3I55 A;  3S1N H;  2JEA I;  4DR7 L;  4YCW A;  5IE8 A;  1MJC A;  3CC2 A;  2NVQ H;  4A3D H;  3GTO H;  5GAG C;  4DR1 L;  1K8A C;  5JEA J;  3J7Z C;  4A3B G;  2PNH A;  1L1O C;  4DR5 L;  3I4M G;  4C2M H;  2F4V L;  3UDF A;  4X64 L;  5LMU Q;  4JBW A;  4DUY L;  4AYB G;  3S15 H;  1HR0 Q;  4HIO A;  2WB1 G;  4A3J G;  1KRT A;  2YTX A;  2AMC B;  1V9P A;  2UUB L;  4YY3 Q;  4NXN Q;  4A3C G;  3HKZ E;  4R4T A;  3CCS A;  3PUW A;  1JJC B;  2VUM G;  1YIT A;  3A74 A;  4HJ5 A;  3GO5 A;  5IT9 c;  4LF8 L;  1Q82 C;  2ZJQ A;  2Q2I A;  1Q1B A;  4WJ3 M;  3CCR A;  3CF5 A;  3K81 C;  1I94 L;  4IJL A;  4IFD J;  3F1Z A;  1J5E L;  4JI6 Q;  3PO3 G;  4BBR H;  4A3K G;  1EQR A;  1XPR A;  4DV3 L;  1VQG A;  3KF8 B;  1B8A A;  3CPF A;  4B3T Q;  4DV0 L;  4DR2 Q;  2K5V A;  3STB C;  2WFW A;  1N33 L;  2CKZ B;  2NN6 I;  4AYB E;  3MXN B;  4HJ8 A;  1QZG A;  4PZ7 A;  3M4Q A;  1PH3 A;  1KAW A;  4A3F H;  3J7A 5;  4YCU A;  3M4O H;  2OTJ A;  1ASZ A;  4GN5 A;  1C0A A;  1OXU A;  1X6O A;  4DV4 L;  3GTP H;  4BY7 H;  3A5Z B;  3GTJ H;  1AE3 A;  3HOY H;  1PA6 A;  3TQY A;  2B29 A;  1RIP A;  4POF A;  4B3R Q;  4JI1 L;  1WJJ A;  2E5L L;  4BBS H;  1X56 A;  2HQL A;  1N32 L;  2N3S A;  1E7Z A;  4A3I G;  4GN4 B;  5IP7 H;  3A5U A;  3TS0 A;  4JBJ A;  1PH7 A;  4UY8 C;  2KHJ A;  1LYL A;  3G4S A;  1FL0 A;  2WAQ E;  4LF7 Q;  2UXB Q;  1BKB A;  1TWF H;  3PUZ A;  1XNR Q;  2NZO A;  1QUQ B;  3HKS A;  2AWO A;  4YHH L;  4DV7 Q;  1SN8 A;  4JI0 Q;  5M3M H;  2HHH L;  4TQU S;  3TRZ A;  5JJI A;  4EX5 A;  1V1Q A;  1GM5 A;  1AH9 A;  3VDY A;  3L0O A;  3DLL A;  1N8R C;  1OXS C;  2NVT H;  1BBU A;  4A3J H;  4UPA A;  5E7N A;  3OTO Q;  2A8V A;  4A3C H;  5ELN A;  4OO1 G;  5C4J H;  3EIV A;  1MIU A;  1PFS A;  2VUM H;  5GQO A;  4XTC S;  1KHI A;  2R7F A;  2PMZ E;  1PVO A;  3M7N A;  1S72 A;  4UP7 A;  3K8A A;  3HOW G;  5LMU L;  1VQ5 A;  5JEA G;  1YNX A;  3G48 A;  1K73 C;  4NXN L;  3OYY A;  3PO3 H;  2UXC L;  1CUK A;  4R4O A;  4YY3 L;  4DV5 Q;  2YU9 H;  3FP9 A;  4L5R C;  1L1O B;  2D62 A;  2VNU D;  2I5M X;  4GKK Q;  4LF6 L;  1EUJ A;  3CCE A;  2Y0S E;  4NXM Q;  3RZD H;  4OWW B;  1QVF A;  1E1T A;  1L0W A;  3JAM i;  1XJV A;  4OXP A;  5EAY A;  4JBM A;  3E0E A;  4JI6 L;  2V1C C;  4AH6 A;  4X65 L;  3CME A;  2OQ0 A;  1PH8 A;  1EFW A;  1CSQ A;  1NMF A;  4IPH A;  1FJG Q;  3S1R H;  4LW1 A;  2YTV A;  3T1H Q;  1JE5 A;  4O0A A;  4DR2 L;  3ICE A;  2K50 A;  1VQL A;  1FGU A;  1JT8 A;  3CMA A;  4A3I H;  2R6G A;  4C3I H;  4DR3 Q;  3PSI A;  2ES2 A;  4JI7 L;  4LF9 Q;  3PO2 G;  3L2P A;  4ALP A;  2UUC L;  4IFD I;  4DR6 Q;  2R7D A;  1M1K C;  4JYA L;  4B3R L;  3HOX G;  5C4X G;  3CXC A;  5DLQ E;  2VZA A;  3S1M H;  4A3M G;  2AHO B;  1A8V A;  1Y1W G;  3J80 i;  4HIM A;  3K80 C;  3KDF B;  1HZ9 A;  1VCI A;  2YYZ A;  1A63 A;  3FKI G;  5FLM H;  4LF7 L;  3S2D H;  1XNR L;  3CCJ A;  2PQA A;  4BY1 G;  1NTG A;  2OWO A;  2R93 H;  3I2Z A;  5GRO A;  1Q46 A;  1K8G A;  2UU9 Q;  3RN2 A;  4JI0 L;  5C0X I;  3F2D A;  3H0G G;  4GNX A;  1EWI A;  3FHW A;  3ULJ A;  1QVG A;  1C7Y A;  4YWL A;  4TVA B;  1NBW A;  2Q2T A;  2Z6K A;  3EBE A;  3OTO L;  3ER0 A;  4A75 A;  2QEX A;  1XPO A;  4OX9 Q;  1XMO Q;  3CCQ A;  1P8L A;  5HY6 A;  5HGQ A;  5AJ3 Q;  1IBK L;  3U50 C;  4R4C A;  4AQY Q;  2EXD A;  3I4N G;  1HZA A;  3A0J A;  1JB7 A;  4PG3 A;  1IBL L;  2D0O A;  1LM0 A;  1HNW L;  4OWX B;  1HR0 W;  4JI5 L;  3EN2 A;  4GKJ Q;  4DNI A;  2D0P A;  3PCO B;  1VQM A;  1QVC A;  2KCM A;  2K14 A;  1YJN A;  2LXJ A;  2IHE A;  3BU2 A;  1PH5 A;  4ME3 A;  2CFM A;  3BZC A;  1KD1 C;  1WFQ A;  2K5H A;  4IPC A;  2BA1 A;  4GOP A;  3PGZ A;  5IP9 G;  2DGY A;  3H3V H;  1FJG L;  1Q12 A;  5IWA L;  4DV1 Q;  3UDG A;  3S16 H;  2MNA A;  1G51 A;  1E3P A;  2H5X A;  3HOZ H;  3AYH B;  1L2F A;  1CKM A;  1UWV A;  1X3G A;  4O2D A;  4LFA Q;  5IYD G;  4LFC Q;  1MJE A;  1J6Q A;  1VQE A;  1X65 A;  1Y1W H;  3PUV A;  3PIP A;  3NBH B;  4LF9 L;  1VQN A;  2JA6 G;  2JA7 G;  1Q8K A;  3T1Y Q;  2IHF A;  2WB1 E;  1X3F A;  4UP8 A;  3GDE A;  1K9M C;  4BY1 H;  2BA0 A;  4QL5 A;  2XGT A;  4JI2 Q;  4BA1 I;  1XNQ Q;  1UE6 A;  1X54 A;  3STB D;  1PH9 A;  2OCE A;  3I4O A;  3H0G H;  4RMF A;  4Y7N H;  5C0X J;  3HOU G;  4JOI A;  1O7I A;  3CQZ H;  3L7Z C;  2L15 A;  4YWM A;  3G6E A;  2MQH A;  3CW2 C;  1FVI A;  3I56 A;  3I7F A;  4HJ9 A;  1VQ9 A;  2B63 G;  2R92 G;  1NY4 A;  2RF4 A;  4R4Q A;  1NMG A;  4P73 A;  1CSP A;  4MTN A;  3I4N H;  4C3H H;  4JI4 Q;  5LMN Q;  4DUZ L;  5C44 G;  4A3B H;  4X62 Q;  3KFU A;  1WI5 A;  4JC0 A;  1PV4 A;  3TRE A;  4POG A;  3K7A H;  3I4M H;  4LFB Q;  1RL2 A;  1HZC A;  1HJP A;  1VQF A;  5AJ3 L;  3S2H H;  2MFI A;  2K5N A;  3KYH C;  4DKA C;  1B7Y B;  1Y1V G;  4B3S Q;  2A1A A;  1JJ2 A;  3GTK H;  1VQH A;  4MNO A;  3KF6 B;  3CC4 A;  4DAM A;  3ULP A;  3CCM A;  2ASB A;  3CAM A;  2VQF Q;  4X66 Q;  5IP9 H;  4LF4 Q;  4HID A;  4HIK A;  5C3E G;  4PZ8 A;  3GTM H;  4GKJ L;  4JV5 Q;  4GLX A;  1HR0 L;  4QY7 A;  3UE1 A;  1NJI C;  3GD7 A;  4YCV A;  4A3K H;  2UUA Q;  1T9H A;  5IYD H;  3CPW A;  1UE5 A;  1TWA H;  3ULL A;  2IX1 A;  4OON A;  2JA7 H;  2F52 A;  2PQA B;  5IYC G;  1Q7Y C;  4LNQ A;  2JA6 H;  5BR8 Q;  4EQ5 A;  1XPU A;  4IFD G;  1BBW A;  1A62 A;  1SMX A;  1LTL A;  1R9T H;  1PH4 A;  4FDB A;  3W1B A;  4DV2 Q;  1VQ8 A;  4LFA L;  4QIW E;  3H15 A;  1VQO A;  3RZO H;  4DR7 Q;  2RHS B;  1XMQ Q;  1Q86 C;  1PHJ A;  1EYG A;  3KJP A;  1VS0 A;  1IXR A;  1N36 Q;  4B3T L;  1IL2 A;  3HOU H;  4HJA A;  3ZJY C;  3D31 A;  1E1O A;  4DR1 Q;  3GTQ H;  1IBM Q;  4DK6 C;  4JCV E;  3OW2 A;  1OXT A;  1X55 A;  4QJF A;  3CD6 A;  2F4V Q;  4DR4 Q;  4X64 Q;  2N49 A;  4OO1 I;  4WJ4 A;  1XNQ L;  4JI2 L;  3BJU A;  3CP0 A;  2R92 H;  2AKW B;  3M4P A;  1BVS A;  4H02 A;  2KHI A;  4C3J H;  2UUB Q;  2NVX H;  4LWC A;  4A3E G;  1VQ4 A;  3S1Q H;  3J81 i;  4LUZ A;  4A76 A;  4XIG S;  4LF8 Q;  5C0X G;  4LF5 Q;  4PZ6 A;  2WP8 J;  1QUQ A;  2ZTC A;  3RLO A;  2BH2 A;  3RN5 A;  1D8L A;  5JJK A;  1N9W A;  2ZJP A;  1I5F A;  1Y1V H;  2UXB L;  3D0F A;  2CWA A;  3PUX A;  1KRS A;  4JI4 L;  4DAY B;  1WCM G;  3CC7 A;  4DV7 L;  4X62 L;  1OTC A;  2ZM6 Q;  4DV0 Q;  3UDX A;  3HOW H;  2JEB I;  1JJG A;  2CCZ A;  1U5K A;  2YV5 A;  1Z47 A;  1VQP A;  1KL9 A;  4DV4 Q;  3E9H A;  4NPS A;  4R4I A;  1C9O A;  1SRU A;  2OTL A;  4QQB X;  3M9B A;  1KQS A;  4X66 L;  1HNZ Q;  1SRO A;  2E5L Q;  1U0L A;  2E2J H;  2HIV A;  4K0K Q;  4JV5 L;  1N32 Q;  5K36 G;  5M5W H;  3GTG H;  4KHP L;  4IOC A;  3H3V I;  2I0Q A;  3RNU A;  4IO9 A;  1VQA A;  2CWP A;  1YZ6 A;  4JI1 Q;  5M3F G;  4DV5 L;  2Q2U A;  3PIO A;  3KLW A;  4GKK L;  4OWT B;  3HOY G;  3G71 A;  5BR8 L;  3M3Y H;  4BXX G;  4KLK A;  4YHH Q;  4NXM L;  4GNX C;  5GAH C;  2HHH Q;  2MO0 A;  3HFZ B;  3K7U C;  4P72 A;  1YHA A;  1QZH A;  2E2I H;  2Z6K C;  3CCL A;  3PO2 H;  2NN6 G;  1PH6 A;  3NEM A;  4DV2 L;  2HIX A;  2C35 B;  3WWV A;  1XMQ L;  4A3E H;  3T1H L;  1TXY A;  1YJW A;  1N36 L;  3ERS X;  4IJH A;  5H1S E;  3NEL A;  3HOX H;  5C4X H;  2JJQ A;  4JI8 Q;  1IBM L;  5FLX c;  3UDI A;  4A3M H;  2ALY B;  1OXX K;  5M3M G;  1UEB A;  2OQK A;  2VS1 A;  1LUZ A;  3RR5 A;  4GN3 B;  4DR3 L;  2E2H H;  4DR4 L;  4A93 G;  1SFO H;  1OXV A;  2K4K A;  4P71 A;  3JAM c;  2JQO A;  4JI3 Q;  1V43 A;  2EQS A;  3FKI H;  4GLV B;  1YBY A;  1HNX Q;  4JG2 A;  4DR6 L;  4KHP Q;  1GD7 A;  2IX0 A;  3AEV A;  2UXC Q;  3IRB A;  3TEH B;  3KOJ A;  2I5L X;  5IY0 A;  1WCM H;  3KDF A;  4P75 A;  3AQQ A;  4GS3 A;  3AFQ A;  2LSS A;  4LF6 Q;  4IOA A;  5IYB G;  1Z9F A;  1IZ6 A;  4LF5 L;  3HOV G;  3JC6 6;  3J81 j;  3CCV A;  3SGI A;  1EIY B;  3NEN A;  2JE6 I;  4GOP C;  1VQ6 A;  2FXQ A;  1G6P A;  2BH8 A;  2MO1 A;  1PH1 A;  2ATW A;  1W3S A;  2ZTD A;  4X65 Q;  1YJ9 A;  2QGQ A;  3J81 c;  1CKN A;  2GVB A;  2KBN A;  2A19 A;  2WAQ G;  5GAE C;  2ZM6 L;  2XTI A;  2UU9 L;  2R7Z G;  2IY5 B;  1SR3 A;  5LMN W;  2QA4 A;  1E22 A;  2DUD A;  1I50 H;  4B3M Q;  4BXX H;  2UXD Q;  2VY3 A;  4L5T A;  1NE3 A;  3J80 c;  1S3O A;  2PI2 A;  3UE0 A;  4JI7 Q;  2VQE Q;  4R1J A;  5M3F H;  2UUC Q;  4OX9 L;  1IYJ B;  4KI0 A;  1XMO L;  2RHQ B;  3W1G A;  5FJ8 G;  2JA5 G;  2Z0S A;  1GVP A;  2PI2 E;  4JYA Q;  2JA9 A;  3LGJ A;  2YTY A;  3PV0 A;  3PF5 A;  1GO3 E;  1VQB A;  4NB3 A;  1HNZ L;  4AQY L;  4APV A;  5J3B A;  2EIF A;  2JA8 G;  4K0K L;  1N34 Q;  1KXL A;  2VL6 A;  4JOI C;  5M5Y H;  1PYS B;  1I3Q H;  2N78 A;  3BZK A;  2GVA A;  2CQO A;  2AWN A;  1YEZ A;  3PUY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...