4A3IH

Rna polymerase ii binary complex with dna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 20
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3iH00
5GROA 3CP0A 3PO2G 3KDFA 1NMGA 4DV2Q 2MO0A 4R4CA 1Q46A 4LFCQ 4KHZA 4HIMA 1OTCA 5LMUL 4A3JG 5IP7G 1M1KC 2QEXA 3HOVG 4RG1A 4A3IG 3PV0A 3J81j 4DV5Q 3FHWA 1HR0Q 4JI6Q 2MNAA 2D0PA 3PUVA 4GNXB 1VQMA 4L5TA 1PV4A 4BA1I 1PH7A 3BJUA 1R9TH 1VQLA 1LM0A 4X66L 4JV5L 4L5RC 1NMFA 4X64Q 4A3JH 3MXNB 1SLJA 3NEMA 1J5EQ 2EQSA 2PQAA 5IP7H 4AQYL 5IE8A 1LUZA 1YVCA 4NPSA 1I94Q 3HOVH 3CCUA 4GLXA 4DNIA 2UXCQ 2JE6I 1O7IA 1OXXK 4ME3A 3CW2C 5GAGC 5IYDH 4A3CG 1EYGA 4LF5Q 1FVIA 4LF7Q 4XIGS 1FJGQ 1PH3A 3I55A 4LNQA 2BH2A 1AE2A 4L5SA 2VNUD 2D0OA 4GNXC 2EIFA 2RCNA 1HZCA 3CCJA 5IWAL 3A5ZB 1K0RA 3TEHB 1PA6A 4B3TQ 3ULPA 1VQAA 4DV6L 4BY1G 1KL9A 4OXPA 4DV1L 2A1AA 2GVBA 2OQKA 2A19A 2N49A 4A3CH 1SR3A 4P75A 4LUVA 1VQKA 3HKSA 3A74A 4DV0L 1KRTA 3D31A 4C2MH 3ICEA 4DR6Q 3CXCA 2YTVA 1YJNA 3ERSX 1EQRA 5FLMG 4LF9L 3CF5A 4IFDJ 5C0XI 4KI0A 1N8RC 3E0EA 4JI5Q 1HZBA 1B70B 1PH9A 5IYCG 4BY1H 1N34L 4A3LG 3G6EA 2Y0SG 2Z0SA 1EFWA 1IYJB 3EBEA 4B3RQ 2AMCB 1YIJA 5AJ3Q 1HNXQ 3H3VI 2PI2E 4HJAA 4LFBQ 1Q1EA 2ATWA 3J7A5 1QZGA 4NXNQ 3G48A 1YITA 1Y14B 4NXMQ 1KHIA 1W3SA 2IT1A 5IYCH 2UUCQ 4QY7A 2K5VA 4A3LH 4DK3C 2GN5A 4DR3Q 2C35B 4A76A 1G291 1W2BA 2ASBA 2UUAL 4HIDA 1JJGA 3GTJH 2H5XA 3SGIA 1KAWA 1N9WA 1VQJA 4YCWA 1LTLA 1SE8A 2ALYB 2ES2A 2Q2IA 3F2DA 5IP9G 2KHIA 1IBKQ 1X54A 3RNUA 1SMXA 2CQOA 1WJJA 2ZM6L 1IL2A 2EXDA 1TWFH 2DUDA 4DK6C 1K73C 4JYAQ 3PUZA 1GM5A 1PYSB 2I5LX 2OTJA 1HNWL 1N32L 4Y52H 1YJWA 1EOVA 5C4XG 2F4VQ 3PO3G 5HGQA 5IP9H 2JA7G 3EN2A 4JI1L 1VQPA 3IRBA 1Q12A 2Q2HA 3F2CA 1A8VA 2VQEQ 4R1JA 5LMNW 1K8AC 2ZTDA 3OYYA 3UE0A 4DR5L 2E2IH 4JI4L 1MJCA 4DV4Q 2NVTH 4DV7Q 2R92G 1VQFA 4IJHA 2N78A 3RN5A 3K0XA 3CCEA 1TWCH 3KLWA 4DUYQ 5C4XH 1YHAA 4A3FG 1KD1C 3UDFA 2JA7H 1NJIC 4K0KQ 5GQOA 1PYBA 4A3EG 3S15H 1VQGA 1OXUA 2DGYA 1Z9FA 2JK8A 2YU9H 2UXDQ 4LF4Q 2R92H 5BR8L 1QUQB 4X62Q 2CCZA 1XNQL 3AYHB 4JI7L 3GTKH 3K80C 4GN4B 5M5WH 1CKNA 3RZDH 4LUOA 4JOIA 1K3RA 2IY5B 2WP8J 2B63G 4A3EH 5M3MH 2ID0A 4JI2L 2VQFL 2ZJRA 4JBKA 3T1HQ 1X3EA 3KOJA 3U4VA 3L2PA 4B3ML 1L0WA 4IFDI 3KJOA 2R7ZG 3CCMA 1NBWA 2BA0A 4OWWB 1HNZL 3GTQH 2B63H 4IOCA 1E1OA 1EIYB 4YCVA 4MNOA 5E7NA 5GAEC 3TS0A 4P74A 1YEZA 1C9OA 3RN2A 1S40A 1HR0L 1XJVA 4A3KG 2LSSA 1L1OA 2UXBQ 4BBRG 4X6AH 2R7ZH 1UWVA 2CFMA 3F8TA 3UDGA 3M4OH 1Y1VG 3I56A 2JEBI 4YCUA 2PI2A 4X64L 3KF6A 1XNRQ 5JJIA 2VW9A 1J5EL 4GKJQ 1J6QA 4LFAQ 1E7ZA 5C0XG 3HOXG 1I94L 4QQBX 4JI0L 4YHHQ 4KHPL 1JB7A 3CQZH 3KF8B 4A3KH 4DV3Q 3K7UC 4BBRH 4LF5L 3A0JA 4HIKA 5IT9c 4LF7L 1FJGL 1YNXA 4QJFA 1Y1VH 2XGTA 4X65Q 2VL6A 1XMOL 2UU9Q 3M7NA 2YV5A 2OCEA 1K83H 2KCMA 3PCOB 3HOXH 3KYHC 4C3IH 3GTMH 4WJ4A 1E22A 4EQ5A 4DAMA 2K75A 2Q2UA 1PH5A 3S16H 1L2FA 4GOPA 2JA6G 2KCTA 4OX9Q 5LMUQ 1V9PA 2FXQA 3H3VH 3M4QA 4DR6L 4A93G 1BVSA 2JQOA 4LF8Q 2VZAA 2HIXA 4AYBE 2QA4A 3H15A 4JI5L 2XTIA 1UE6A 5M5XH 1WFQA 1IBMQ 4A75A 1AE3A 3M4PA 4YWLA 2K14A 4EX5A 5DLQE 3CPWA 4JV5Q 3KDFB 2JA6H 3S24A 4B3RL 4IPGA 1WI5A 4C3HH 1I5FA 3JAMc 5AJ3L 4AQYQ 4LFBL 4POGA 1L1OB 4AYBG 2I5MX 4HJ8A 1QVGA 2HHHL 1X3FA 4NXNL 1IBLQ 4A93H 3KFUA 1Q7YC 5J3BA 3S2DH 1Q86C 5JEAJ 1Y1WG 2UUCL 4LW1A 1G51A 1E1TA 3VDYA 1M90C 3M3YH 4P72A 2KENA 4DR3L 4UP7A 3PIPA 1XMQL 4DR1Q 3PSIA 2OWOA 2CWPA 2YTXA 2JA9A 2PQAB 1N33Q 4C3JH 1JE5A 4JC0A 1SRUA 3S14H 4A4IA 1PFSA 2UUBQ 1Y1WH 1L1OC 4YWMA 1RL2A 3I4MG 4UP8A 3MEFA 1MIUA 4DUZQ 2IX0A 4IPHA 1SROA 4HJ9A 2K52A 4B3SL 1PH2A 2RHQB 3RZOH 4IOAA 4GOPB 4JYAL 3PUYA 2B3GA 2KHJA 3RR5A 4OWXB 3PIOA 3CC2A 2F4VL 1VQ4A 2VY3A 1A0IA 1HJPA 3E9HA 4YY3Q 2AWNA 2RF4A 3K8AA 4R4TA 5IYBG 1WYDA 3I4MH 1YHBA 5FLXc 2VQEL 3I4NG 2NZOA 1BKBA 1B7YB 2YTYA 3D0FA 3M85A 4DV4L 1D7QA 1VCIA 4JBJA 1HZ9A 1PH8A 4PZ7A 2IHFA 3OTOQ 4IFDG 4DUYL 2JA5G 4A3BG 4A3DG 3F1ZA 3T1YQ 3G71A 5IYBH 3HOZG 3RLNA 3J81c 4GOPC 4DR7L 3EIVA 3I4NH 4K0KL 4JI3Q 1GKHA 1QVCA 3GTGH 2E5LQ 1KXLA 1SFOH 2NVXH 3A5UA 2WB1E 1PHJA 2UXDL 3OW2A 1JJ2A 4X62L 5LMNQ 2NVQH 5FJ8G 1G6PA 4JI8Q 4OO1I 3B6YA 1TWAH 5M3MG 1QVFA 3GTLH 2JA5H 4DR4L 4A3BH 4A3DH 5M3FH 1I3QH 1JMCA 3HOZH 3L7ZC 1BBUA 1PH1A 3HFZB 4OONA 2RHSB 3T1HL 1RIPA 3CMEA 1HNWQ 2I0QA 1EWIA 3ULLA 1GD7A 1WOCA 2K4KA 5FJ8H 1B8AA 1N36Q 3L0OA 4JI1Q 1I50H 2AWOA 1A62A 1PH4A 4PMWA 2JEAI 3ULJA 1VQ8A 1KRSA 2A8VA 1X65A 4GN5A 4HJ5A 4GKKQ 4UPAA 3S1RH 3PF4A 4UP9A 1NE3A 2V1CC 2JJQA 1X9NA 4DV2L 1EIFA 3CCVA 3S1NH 3NBHB 4LFCL 1KQSA 1XPOA 1VQDA 2UXBL 2WFWA 4JG2A 4OWTB 4UY8C 1X55A 3PGZA 1UE7A 4LF6Q 1YI2A 1MJEA 1XNRL 1JT8A 2QGQA 4DV5L 1OXSC 1VQOA 4JI6L 1OXVA 4DR2Q 4WJ3M 3STBC 1YZ6A 1TXYA 4LFAL 4LWCA 1Q81C 4GN3B 1XNQQ 4R4OA 4GKJL 4AIMA 1I6HH 1VQIA 1ASYA 3UE1A 4DV3L 3CCQA 3FP9A 2R7FA 3AEVA 2ZTCA 1C7YA 3RLOA 3TREA 3S1QH 2UXCL 4X65L 2UU9L 4A3MG 3K81C 2E2JH 1WCMG 4R4QA 2NN6I 3CC7A 1IZ6A 1NTGA 3E9IA 2R7DA 4GS3A 1HR0W 2HIVA 5EAYA 2E2HH 3PUXA 3BZKA 3JAMi 3NENA 1HNZQ 1H95A 1HH2P 1P8LA 1CKNB 4OX9L 3CCRA 4JCVE 4B3TL 1MKHA 1XTDA 3JC66 1XPRA 2R93H 2I5HA 4P73A 4H02A 4A3MH 1D8LA 4BBSG 1WCMH 5IYDG 4LF8L 3HOYG 3Q8DA 1DGSA 1S3OA 2PNHA 2HT1A 4LUZA 3ZJYC 4POFA 1IBML 3PO2H 3HOWG 3UDIA 1E3PA 3U4ZA 1Q1BA 1TWGH 2AKWB 4XTCS 1IBLL 1GVPA 4BBSH 1U0LA 4X66Q 2CKZB 2F52A 3GDEA 2N8NA 4A3IH 1EQQA 4JI0Q 4KHPQ 3HOYH 3PUWA 4JOIC 5ELNA 1HNXL 1VQCA 1ASZA 1X6OA 1VQHA 3HOWH 3W1BA 2ZJPA 2KBNA 3LGJA 1XMOQ 5GAHC 2ZJQA 1PH6A 4NXML 3GD7A 3I7FA 1P16A 3KF6B 4DR1L 3S2HH 4P71A 1N33L 3AFQA 3BU2A 4KLKA 4QGUA 2OQ0A 3FKIG 3H0GG 3W5OA 2UUBL 3CD6A 1EUJA 4BXXG 5IWAQ 1OXTA 2Y0SE 2MFIA 3HKZE 3HOUG 4DV6Q 4DUZL 4DV1Q 2AHOB 2K5HA 3TRZA 1PVOA 1K8GA 2NZHA 1UEBA 3PF5A 3GTOH 1IBKL 4DV0Q 1A63A 4OO1G 1CSPA 1VS0A 1AH9A 3CPFA 4PZ8A 3RLFA 3FKIH 3H0GH 3J81i 4BXXH 1UE1A 1Q8KA 1X56A 3GO5A 3CAMA 3HKZG 4YY3L 3CCLA 4LF9Q 1X3GA 5JJLA 1FGUA 4MTNA 2K5NA 1LYLA 3HOUH 4R4IA 1FL0A 3U50C 2HHHQ 1SN8A 1XPUA 1N34Q 5ELOA 5FLMH 2WAQE 4A3GG 2VS1A 1NY4A 3M9BA 3AFPA 2LXKA 4QL5A 4TQUS 3J80i 4ALPA 5K36G 3OTOL 3J7ZC 5HY6A 3U58A 4MZ9A 1QUQA 3T1YL 4IPCA 1CKOA 1CUKA 2D62A 2Z6KA 4DKAC 4DV7L 4IO9A 2OTLA 3GTPH 4IPDA 3S17H 4JI3L 2MQHA 1XMQQ 2E5LL 2NVYH 2WAQG 4O0AA 2JA8G 2VUMG 3UDXA 2R6GA 5M3FG 4A3GH 4FDBA 5LMNL 2UUAQ 3I2ZA 4JI8L 4GLAC 4HJ7A 4PZ6A 1V1QA 2LXJA 4JBWA 4LF4L 5JEAG 1UE5A 1Z47A 3G4SA 1VQ6A 4L5QA 4B3SQ 3NELA 5IY0A 1S72A 5JJKA 3CC4A 3J80c 2VUMH 2JA8H 2F3IA 1E24A 1Q82C 2IX1A 2ZM6Q 1CSQA 3AQQA 1QZHA 1VQ5A 1N36L 2WB1G 3WWVA 4J15A 3DLLA 1VQEA 3TS2A 1N32Q 2K50A 2Q2TA 4GKKL 2GVAA 4BA2I 3I4OA 2NN6G 1VQ9A 2YYZA 4NB3A 4RMFA 4O2DA 2CWAA 3ER0A 4GNXA 4GLVB 3CMAA 4DR5Q 1YHQA 4JI4Q 5C0XJ 2E8GA 1KIXA 3PO3H 1YJ9A 5H1SE 4DR7Q 3W1GA 1VQBA 4LF6L 1YBYA 2HQLA 4PG3A 1GO3E 2IHEA 1JJCB 4DR2L 1CKMA 3KJPA 3TQYA 2ZTEA 2L15A 5C44G 1K9MC 1VQ7A 1U5KA 4BY7G 2N3SA 4DR4Q 3BZCA 1V43A 1IXRA 4A3FH 4QIWE 5BR8Q 1HZAA 4TVAB 2B29A 4APVA 5C3EG 5C4JH 4JI7Q 4YHHL 1KC8C 2BH8A 2MO1A 3K7AH 3STBD 4AH6A 3CCSA 4YWKA 3DM3A 4Y7NH 5C44H 2PMZE 4DPGA 2BA1A 1C0AA 4JBMA 4BY7H 4JI2Q 2VQFQ 1VQNA 2R93G 5M5YH 4IJLA 4DAYB 4HIOA 1T9HA 3S1MH 2Z6KC 3F2BA 5GADC 1TWHH 4B3MQ 1BBWA 5C3EH
chains in the Genus database with same CATH superfamily
3TZDA 1NMGA 3W2DA 1BOSA 1Q46A 5KRUA 1F2ZA 1OTCA 3Q6SA 5COYA 5IP7G 3R3OA 3J7YW 4A3IG 3PV0A 1HR0Q 4CJ2C 3R2TA 1PV4A 4GNXB 5ELBA 4JVZA 3SHLA 1VQLA 1A2UA 1SNOA 4X66L 2BCOA 2VB3X 4RCOA 4AYBB 1STYA 4A3JH 1SLJA 1X3QA 4AQYL 2ZT9C 1YVCA 2Z8LA 4NPSA 3HOVH 3K5MA 2JE6I 4ME3A 4H13C 4UDUC 1DXMA 4F7XA 4NKLA 1DJRD 4ULLA 2BH2A 1PZJD 2D0OA 2EIFA 2EOTA 1HZCA 1LTRD 3I90A 3TEHB 1PA6A 4B3TQ 5IOCA 1TIID 2NBFA 3OWEB 3T51B 2A1AA 2GVBA 5KNDA 1SE4A 2N49A 4LUVA 2BE5C 3FDTA 2D5DA 2YTVA 1KLGD 4JPBW 3ERSX 2F0TA 4LF9L 3CF5A 3A56A 4U673 1PH9A 4BY1H 5T1GA 3X3NA 3N52A 3G6EA 3U9OA 5AJ3Q 2AQ3B 1ZKOA 3H3VI 4HJAA 4ILWA 4G7HC 4DNRB 4NXNQ 3G48A 3GTLB 2VUMB 1TQOA 5M3FB 1WTVA 2IT1A 5IYCH 2F0NA 3SK8A 2K5VA 5JOBA 4A3LH 1WD0A 4DK3C 2GN5A 4A76A 1W2BA 4EGVA 5DNFA 2Z1CA 3GTJH 1N9WA 4X3TA 2QDLA 2ALYB 3K6OA 2ES2A 5JAVA 1RF2D 1IW7C 3QOJA 5IIFA 2WB1B 1F2LA 1E2WA 1SMXA 2CQOA 1WJJA 1C8CA 2P5ZX 2EXDA 2F0GA 3S1NB 2D9UA 1GJXA 5C4XG 5HGQA 1FR3A 3HZXA 3IRBA 1IKLA 5CGKA 2NVTH 2RCFA 3OMCA 2R92G 1A3TA 3K0XA 3KLWA 4DUYQ 2FINB 4V0BA 4BY7B 4PMBA 3S1QB 2JA7H 1NJIC 5A2QE 4RGOS 5KNBA 4HN7A 2Z4IA 1KABA 4DF7A 4QB4A 5DM73 4Z9CB 5M5WH 1SNMA 1FGBD 4QMGA 4LUOA 3BYTB 4JOIA 2L55A 1K3RA 2WP8J 5M3MH 1X3EA 3KOJA 2F0KA 2MUYA 2A73B 1Y8NB 4B3ML 3V2TA 4IFDI 3KUPA 3OIQA 2BA0A 1HNZL 1ILPA 5KGUA 1EIYB 1E1OA 5J39A 5CR3A 5G3LF 1KNAA 1QG7A 1S40A 1EY5A 3HOWB 3SK5A 3F8TA 3UDGA 1ZYRD 2JEBI 5JJIA 4X64L 1XXGA 4CKCA 1J5EL 1SYDA 3LWUA 1I94L 4QQBX 3T16A 1JB7A 4QCLA 4DV3Q 4LF5L 3A0JA 2JA6B 1FJGL 1EY0A 1STHA 3D8GA 2VL6A 3TP7A 1R4QB 3HOXH 5IODA 4WJ4A 4EQ5A 1ICWA 3HOUB 2A74C 4WJWA 1L2FA 4DFAA 2FXQA 2EYHA 5IT9E 2JQOA 3LX0A 2QA4A 3H15A 2Y0SB 2XTIA 5M5XH 1WFQA 2F0EA 3M4PA 4YWLA 2K14A 3CPWA 3KDFB 3CU7A 4B9WA 5C3XA 3JAMc 5NUCA 4AQYQ 4FF4A 4POGA 4A93H 4C3JG 1IYUA 3GV6A 5JEAJ 1CQVA 4LW1A 3VDYA 2KENA 1CZGA 1DCZA 1UEAB 4UP7A 1QNUA 1NUCA 3PSIA 5CV5A 1SRUA 5ELEA 3S14H 4A4IA 2F3VA 1Y1WH 1JOOA 1PMRA 1RL2A 2NWGA 3MHBA 4LJZC 3E5SA 3MEFA 1LLRD 3K57A 2IX0A 3JAML 4B3SL 5CMDA 4OWXB 4KJNA 2VY3A 1DYQA 1X32A 2YU9B 2AWNA 2RF4A 3K8AA 4R4TA 1QCBD 5IYBG 1PTOF 3I4MH 5FLXc 1JE4A 2NZOA 1YNJC 3D0FA 1H9SA 1AFPA 1SYCA 1YNNC 4PZ7A 4IFDG 4A3DG 2IL8A 3HOZG 4K0KL 3RLNA 3EIVA 3K7AB 3I4NH 2LY7A 1QVCA 4Y7NB 1KXLA 2H1EA 2SNSA 2A69C 1PHJA 1JJ2A 4X62L 1PYWD 3A7LA 1U4MA 4JI8Q 1QVFA 3QOLA 2B63B 1I3QH 1LTBD 4DXFA 5C3EB 2PPBC 5EPLA 5FLXL 2RHSB 3CMEA 3J81E 4CDDC 1HQMC 2I0QA 4HTHA 3ULLA 3VR4A 1B44D 2K4KA 1B8AA 2AWOA 4FP5D 4PMWA 3OMGA 1X65A 3FRPB 1B9NA 1Q90A 1R9TB 2BDNA 2JJQA 3OWFA 4DV2L 3CCVA 1Y1VB 1VQDA 1U4RA 1H9SB 4JG2A 3J80L 4H44C 1K83B 3Q0AA 1YI2A 1MJEA 1DONA 4JI6L 2KUMA 4L8JA 2WV6D 4WJ3M 3STBC 4LFAL 4LWCA 2EY2A 3I72A 4AIMA 4EQOA 4RKLA 5ELFA 4PQXA 4RKBA 4QUCA 5KYLA 2UXCL 5I9OA 2UU9L 3K81C 1BO0A 1WTQA 1NTGA 3E9IA 4GS3A 2HIVA 5EAYA 4C3HB 3PUXA 4ZYSA 1HNZQ 1SYGA 1CKNB 3CCRA 2I5HA 3I91A 3S2DB 1STNA 1D8LA 4BBSG 4LF8L 3M3YB 1A3VA 2F0SA 2HT1A 4POFA 1XWEA 3NTIA 4HSVA 3UDIA 1E3PA 5CV4A 1TWGH 1CA6A 1ML0D 4IN3A 1JC7A 4HMIA 1IBLL 1U0LA 3TBIB 4A3IH 2N8NA 1EQQA 4OIJA 3HOYH 1PTOB 4JOIC 1HNXL 1VQHA 2E74C 1KDCA 4NXML 3GD7A 3I7FA 3KF6B 3BU2A 5FK9C 5CC4A 3W5OA 3R2IA 3CD6A 2SOBA 5IWAQ 3ND8A 1RJTA 2AHOB 3TRZA 3PF5A 3L9AX 3E6ZX 1CSPA 1VS0A 1X56A 3GO5A 3HKZG 4YY3L 1X3GA 2EY5A 1FGUA 2O5JC 3MFGA 1FL0A 1D6EC 1N34Q 1SDFA 1TWAB 2KHSA 3K59A 2VS1A 4K14A 3M9BA 4A3BB 4QL5A 2R92B 3QB3A 3OTOL 5HY6A 5C4HA 4MZ9A 3RMHA 4DV7L 1SAPA 3SXHA 2QF7A 4IPDA 4JI3L 1I4QA 4FO2A 2E5LL 2NVYH 2WAQG 2VUMG 3UDXA 5M3FG 1EYCA 4A3GH 4KD3A 3I2ZA 4GLAC 3DHQA 2KCNA 1V1QA 4JBWA 2OT2A 3KBGA 4B3SQ 5JJKA 2F3IA 1E24A 1QZHA 3AQQA 5J1ZA 1VQ5A 3K5OA 2WB1G 2JYOA 3A8KE 5JEAH 1B9MA 3FPUB 4GKKL 3H6MA 3OW7A 1I6HB 3I4OA 4NB3A 5EQ0A 3CMAA 5C0XJ 5I6WA 2OF1A 3OHXC 5ELDA 2E2JB 4LF6L 3DMUA 3MXNA 2HQLA 1SYBA 1JOKA 1CKMA 2E2HB 1WTRA 3TQYA 2L15A 5FKAC 1K9MC 2RDGA 4BY7G 1WD1A 4KY7A 4QIWE 3OPOA 5BR8Q 5DAUA 2B29A 3S16B 2RDHA 4JI7Q 5IGDA 2MO1A 3STBD 4YWKA 1A6XA 5C44H 2L9HA 2F0UA 1C0AA 3MXPA 4O42A 3TN2A 3S1MH 2EYFA 5CBAE 4O1NA 3NE5B 5BN5A 3CP0A 5BN3A 4DV2Q 2MO0A 4HIMA 5LMUL 4K6LA 1LTGD 1TR5A 2XVSA 4EQNA 3J81j 2NTSA 3NSWA 4JI6Q 1U4PA 4CDFC 4J8QA 5L37A 4JV5L 1WTXA 2Z6BA 2D2CC 3MXGA 3MXNB 3NEMA 1EFID 3AB9A 2UXCQ 4DNIA 1O7IA 1OXXK 4F88A 2L1BA 1MSHA 3FKIB 1FVIA 4LF7Q 4XIGS 3I55A 3RZOB 2RVLA 1AE2A 1X3PA 1DOMA 1I4PA 4G57A 3QO2A 4ZLTF 2O4XA 4RCNA 1V1PA 4A3CH 1SR3A 3HKSA 3A74A 4DV0L 1KRTA 4C2MH 3GTPB 4RAUC 3S17B 1YJNA 5FLMG 1QWYA 1N8RC 4JI5Q 1HZBA 1GOZA 1B70B 4KK7A 5I4DA 2CW0D 3NXWA 1NNXA 2Y0SG 4NMZA 1SFOB 4HCEA 1YIJA 1ENFA 1HNXQ 1AP0A 3ONAB 2EXZA 1HFGA 2DJFC 3ITPA 1Y14B 5AFWA 4NXMQ 4A3DB 1KHIA 1W3SA 2Q8TA 3HOZB 2UUCQ 1RTOA 1LT5D 2HDMA 4QY7A 1PFBA 1IKMA 4KY5A 4DR3Q 1G291 4KKTA 2ASBA 2UUAL 3T4AC 1UNSA 4HR7B 2H5XA 3SGIA 3Q24A 1VQJA 4YCWA 1FD7D 1BR9A 1D5MC 1JQYD 1RDPD 3A7AB 3F2DA 1U9RA 4R9WA 4I7ZC 1PFMA 1X54A 5EKKA 1MI2A 3C46A 1IL2A 2M9VA 4MHEA 5D14A 4DK6C 3MAQA 3PUZA 1GM5A 2VXWA 3GV3A 5ELCA 1JR0D 1N32L 5E3FA 2CH4W 4OGQC 5IP9H 3MA2B 4C56C 2VQEQ 4R1JA 5LMNW 1EZ8A 2K01A 2XNAC 4HMJA 3OYYA 4DR5L 4JI4L 4DV7Q 2FHTA 2CQAA 1B4OA 1VQFA 1TWCH 3R93A 3UDFA 5GQOA 3UI2A 1PYBA 3S15H 5JJZA 1XX8A 3K5LA 1Z9FA 3FEWX 2UXDQ 4K5XA 3ERQA 1QUQB 5D3DA 1XNQL 3AYHB 4RH6A 3GTKH 2KECA 4GN4B 1A2TA 1HA5A 2HD3A 2IY5B 2B63G 4A3EH 1Q3LA 2ID0A 4JI2L 2VQFL 3T1HQ 1SXTA 3CKIB 3P1HA 3PO2B 1TY0A 3L2PA 2XSCA 4KV6A 2R7ZG 2NYZD 4ZUJA 4IALA 4S3SA 1TY2A 3HOVB 4IOCA 2SDFA 5J22A 3K5NA 3FPPA 1VDZA 2EYLA 4ZAIA 4FXGC 1YEZA 1C9OA 4OIKA 3RN2A 1XJVA 2X6GA 1ZYRC 2E2DC 2LSSA 2B2WA 3IFDA 1UWVA 2CFMA 2HUGA 3M4OH 1Y1VG 1XNRQ 1BF4A 3NWSA 3MXUA 1J6QA 1A15A 1E7ZA 3SE0A 4KHPL 5FOBB 4BS9A 3KF8B 4A3KH 4BBRH 3MEHA 1QJOA 3D4DA 2XGTA 4X65Q 4BY1B 2YV5A 2OCEA 3PCOB 5C0XH 4C3IH 3GTMH 1E22A 1PRTD 2IX3A 2Q2UA 1DD2A 4OX9Q 5LMUQ 1V9PA 4C3HG 2Z9HA 3M4QA 4DR6L 1CQFA 5DM63 2F0VA 4AYBE 5EGTA 2K7VA 3HKZB 3VR2A 3CHBD 1IBMQ 5JVH3 4EX5A 5DLQE 4JV5Q 2JA6H 3S24A 4B3RL 1I5FA 4LFBL 2ZXRA 2HHHL 1H9RA 2HCCA 1Q7YC 3LNNA 5J3BA 4DAVA 2I07B 2F03A 2DJGC 2WAQB 3EJIA 1J8IA 3PIPA 5E1FA 1XMQL 4DR1Q 4FF1A 2QCPX 3JAME 4JC0A 3KLSX 2UUBQ 4YWMA 1VMPA 4UP8A 1MIUA 4IPHA 2EYOA 1PH2A 4JYAL 2JA7B 3PIOA 2F4VL 3E9HA 2XN9C 3SEBA 1WYDA 1O7ZA 4DV4L 1DOKA 5M5WB 1VCIA 1FNWA 1HZ9A 4JBJA 2IHFA 1EY8A 4LMQD 1SYFA 5LL6S 2JA5G 4A3BG 2EY6A 3G71A 4DR7L 3GTGH 4TRDA 1B50A 2WB1E 3OW2A 3NTKA 2G9DA 5FLXE 5LMNQ 2NVQH 2A6ED 1LTSD 2B2TA 1G6PA 3Q22A 4OO1I 3B6YA 3BDCA 3GTLH 5M3FH 1BBUA 4P2CB 1EOTA 1EWIA 2B2UA 5FJ8H 3J7AF 4NP5A 3L0OA 1A62A 1NAPA 2LS01 1T5XD 3BS1A 2A8VA 3J80E 3PF4A 2PCFB 2ZXOA 3I73A 1NE3A 2V1CC 3D4WA 1QE6A 2J4XA 3GQBA 3S1NH 1KQSA 1XPOA 2EPBA 2UXBL 3TP6A 1JT8A 2QGQA 4WORA 4DV5L 1VQOA 4DR2Q 2PZWA 1B3QA 4K5VA 4RHRA 1TXYA 1XNQQ 4GKJL 1TS2A 3VR5A 1VQIA 2PW7A 1ASYA 3UE1A 4DGZA 3AEVA 3TREA 3S1QH 4A3MG 2NN6I 3CC7A 5A35A 1WTPA 1CI3M 3R8BA 3BDOA 4ZQ3A 3BZKA 1H95A 4A93B 1P8LA 2QILA 3OIPA 2JSOA 1MKHA 1XTDA 1G2TA 2KVMA 1WCMH 5IYDG 3KLSA 3Q8DA 3HS0C 2PNHA 4FXKC 3ZJYC 2Q8IB 4WFN3 2QEJC 2WINB 4ZK9B 1TS4A 3S14B 3V96A 1SBBB 1II3A 4X66Q 2CKZB 2F52A 3GDEA 4KHPQ 5EBCA 5KNCA 2NUCA 2K6AA 1VQCA 1ASZA 1X6OA 4K6DA 3HOWH 1IHZA 3BDLA 3NWTA 3LGJA 1H9JA 2L0CA 2GA4B 2KJXA 1C48A 1BQQT 1N33L 3AFQA 4E6IA 2F0QA 4QGUA 2OQ0A 3FKIG 3H0GG 4ZCKA 4BXXG 2Y0SE 2MFIA 5T1IA 3PMFA 4DUZL 2K5HA 1PVOA 2DY7A 1K8GA 3MFYA 2MJ8A 2NZHA 2B2WC 2RSNA 1IBKL 4OO1G 1HRJA 1HXYD 1WTWA 1UE1A 3TSSA 4LF9Q 3CCLA 2F0WA 3HOUH 4TSSA 2E75C 1BUVT 1ESFA 4IUPA 2HHHQ 1Y8OB 5FLMH 1NY4A 3AFPA 2LXKA 1I3QB 2F0PA 1ET6A 2DY8A 4FVMA 3T1YL 4IPCA 4XYQA 1CKOA 3RZDB 3URYA 2MQHA 2N88A 2JXMB 2K05A 1XMQQ 2JA8G 2R6GA 4KN4C 5K36H 2RA4A 4HJ7A 2RBMA 3L3OC 4PZ6A 1W6KA 2J0TD 2LXJA 4HCSA 4L5QA 1HQRD 4N8X1 3T53B 5IY0A 3VYUA 1S72A 3J80c 1CSQA 1N36L 1SEBD 4J15A 2R7ZB 1HUNA 2GVAA 3RD4A 2NN6G 3VYTA 4RMFA 1WTHA 4RHSA 1YHQA 4GLVB 2E8GA 4UAIA 4DR7Q 5FO8B 3ND9A 2R3ZA 1S5ED 3PQIA 1GO3E 4PG3A 1BCPD 5D3IB 3KJPA 1MHWC 3TP5A 5EJWA 2N3SA 2WKDA 1AN8A 1GUOA 2FJ2A 4TVAB 1QNKA 2JP1A 5CV9A 4YHHL 3K7AH 3CCSA 4Y7NH 5KEEA 4RGMA 3BVMA 1UAPA 2BA1A 1ONLA 2F0MA 3NTHA 4JBMA 1TWGB 3QJYA 4IJLA 5ISRA 4HIOA 1XTCD 3CRKC 2Z6KC 3I70A 4J6HA 5GADC 1TWHH 4B3MQ 1BBWA 3F2UA 5C3EH 3HOYB 3PO2G 1CZWA 4PMCA 4A3JG 1L0YB 1SMYD 1ZEQX 1IL8A 1LT6D 1EY6A 1M1KC 3A55A 1PZID 3HOVG 4RG1A 2ZXPA 4DV5Q 1BDOA 1H9MA 1VQMA 4L5TA 2B2TC 2A5HA 4BA1I 1XYIA 2EYPA 1PH7A 2CH4A 3W3AA 1R9TH 2NZ1D 4L5RC 1NMFA 4X64Q 3EQLC 1J5EQ 2PQAA 5IP7H 5I2YA 5IE8A 4HSPA 1LUZA 1RTNA 3K0YA 1I94Q 1AW7A 3J7AV 1B1ZA 5GAGC 2B2UC 3NP8A 2BOSA 4LF5Q 2EY1A 1FJGQ 4DNTB 4LNQA 1SE2A 4K2KA 1HA6A 1PDQA 2IJ0A 3CCJA 2CHBD 3A5ZB 4BWGB 1VQAA 4DV6L 4BY1G 1KL9A 4OXPA 1EWCA 4DV1L 4B9XA 2OQKA 2A19A 1VQKA 3D31A 2QKIC 5CBEE 3CXCA 5CYUA 2CW0C 1H9KA 4IFDJ 4KI0A 1VMCA 4A3GB 1CM9A 3MWYW 5IYCG 4A3LG 2EYJA 3MTSA 1EEID 2PYKA 2Z0SA 1EFWA 3EBEA 1SNQA 2PQEA 2PI2E 1Q1EA 1FYCA 1ICFB 1YITA 3D4RA 2F1MA 2JA5B 2K5WA 1S4ZA 2OXPA 1O80A 2C35B 3GP7A 1JJGA 1WTOA 3P20A 1E2VA 1V1OA 4FF3A 1PTOH 4OELB 1I50B 1GHJA 1EIHA 2AUKA 2L11A 2KHIA 1IBKQ 1CK1A 3S1RB 3BZDB 2ZM6L 1TWFH 4KHVA 1K73C 2NTTA 1G91A 1I4RA 1K3BC 1PYSB 2I5LX 3VR6A 1HNWL 3H09A 4G7ZC 2C5CA 1PXUA 4UHVA 2JA7G 4JI1L 1VQPA 1Q12A 2Q2HA 1K8AC 4YIJA 2B2YC 3UE0A 2E2IH 1MJCA 5HURA 1EY7A 4RFBA 3RN5A 5D65A 4DK1A 5C44B 1Z6HA 3BVGA 3D6CA 5C4XH 1KD1C 4K0KQ 3WOEA 1HTLD 2F0HA 1VQGA 1OXUA 2R92H 1O78A 4CBVA 4X62Q 2CCZA 1DOLA 1RHPA 1B2TA 2R93B 4RGTA 4A3MB 1CHPD 2Q8RE 2K32A 1LTID 3U4VA 2TMPA 1NSNS 1L0WA 1ENCA 3EFXD 3CCMA 1KAAA 3GTQH 1ILQA 4ZKCB 2F0LA 4YCVA 5E7NA 2LKVA 2I46A 5CV8A 1MD2D 1HR0L 3E0JA 4X6AH 4X3UA 2ICIA 3S2HB 3I56A 4YCUA 1PZKD 2VW9A 4LFAQ 3HOXG 1SNPA 4YHHQ 3V05A 3CQZH 1SNDA 1GUSA 3GTOB 5M9OA 1XMOL 2UU9Q 1PRTC 1LO5D 2DNCA 2QDBA 3H0GB 1J9OA 5EPJA 1FNUA 4ME5A 2BDOA 3BVZA 2K75A 1DM0B 4KN7C 3S16H 3H3VH 3SVMA 4A93G 3IFTA 3QWNA 1BVSA 4LF8Q 5JVG3 4RA8A 3IAYA 1UE6A 4CKBA 2F0OA 2K03A 2K04A 3X3MA 1UUPA 4IPGA 5AJ3L 1QVGA 2I5MX 1X3FA 2FMCA 4NXNL 1IBLQ 3KFUA 5EKLA 3E3XA 3DEOA 1Y1WG 3FMCA 1G51A 1Z7TA 1K0SA 3C1EA 1M90C 4P72A 4IUUA 2JA8B 2PZUA 1JORA 3LWEA 3TDQA 4NDXA 3EVQA 1JE5A 4C3JH 1V8QA 1EL0A 2G5DA 1SE3A 4KMUC 1L1OC 3I4MG 3SK6A 1TWCB 2XRQD 2K52A 3PO3B 2RHQB 3RZOH 4IOAA 1AEXA 2B3GA 2KHJA 3RR5A 4FYDA 4HEDA 3CC2A 1SJHD 3I3CA 2RDFA 1VQ4A 3S15B 4YY3Q 2EJMA 1V1PB 5JPNC 1BNZA 1YHBA 3I4NG 4QUFA 1BKBA 1EEFD 1B7YB 3M85A 3I4LA 3HGBA 3DM1A 4A3FB 3A8JE 4L63B 3OTOQ 4CGYB 4DUYL 4A3EB 5C4JB 1G2SA 5IYBH 4GOPC 4L6TB 4JI3Q 2A6EC 2E5LQ 2K1BA 1SFOH 2NVXH 4KKUA 1WVLA 5M5YB 4IFDH 4ABNA 1JB3A 2X6LA 4A3DH 2IPKD 1GUWA 3HOZH 1PH1A 2LFNA 3HFZB 4K2LA 4OONA 1S5DD 1JWUD 1RIPA 1K8OA 2SNMA 1HNWQ 2EZVA 4F8MA 1WOCA 2KEDA 4JI1Q 2RQXA 5G3LD 1CHQD 3HP3A 5LL6X 2JEAI 3ULJA 1VQ8A 1LABA 4X3SA 2PMZB 4GN5A 3WOFA 4HJ5A 4GKKQ 4A3JB 4A3KB 4BBRB 1SSOA 4LFCL 1JOQA 1D1IA 2WFWA 4UY8C 1STEA 3AU7A 3NK9A 3PGZA 4LF6Q 1OXSC 1OXVA 1D5ZC 4GN3B 4R4OA 4HAEA 2NB0A 3O13A 2KCCA 4DV3L 3CCQA 2R7FA 2EJFC 1C7YA 2WACA 3T56B 2HCIA 3NPPA 1KDBA 1EQTA 2ICEC 1Y8PB 4MN3A 1XPRA 1SYEA 1RD9D 3H3VC 2B39A 4H02A 1I4HA 4FXDA 3H94A 3HOYG 1F2YA 4LUZA 3PO2H 5BN4A 3T13A 4OEMB 3KLRA 3U4ZA 1Q1BA 5KIXA 1W6JA 4DAPA 1M4VA 4XTCS 1SNCA 1GVPA 2B8GA 4IUNA 3G6JB 3GTJB 4BBSH 5ELNA 4KY6A 2FFKB 3C2PA 2ZJPA 1R4PB 4V190 1XMOQ 5GAHC 2ZJQA 4KLKA 1EUJA 3D6WA 1OXTA 3HKZE 2A68D 2NVTB 3IL8A 5LHY1 3N6RA 1EU4A 4DV0Q 2KEEA 3G7LA 1PTOD 1A63A 1AH9A 4J1MA 3CPFA 3RLFA 3GTGB 3J81i 3CAMA 1LYLA 1G6ZA 2O2LD 4R4IA 2NVQB 1Y69U 2PZTA 1SN8A 4A3GG 2WAQE 4ALPA 4XDXA 4TQUS 3ZYYX 4IUQA 3J7ZC 1O7LA 4IURA 2Z6KA 4IZ8A 4DKAC 4IO9A 1KDAA 2OTLA 1EY9A 2E76C 2HDLA 1F2MA 1K28A 4C1NK 4O0AA 3QIAA 5M3MB 2MP1A 2UUAQ 4JI8L 1MBYA 4LF4L 5JEAG 3TZUA 3NELA 2K5QA 3CC4A 1GUGA 4DXGA 5JPMC 2VUMH 1D2BA 1Q82C 5CORA 2IX1A 1A3UA 3DLLA 1N32Q 1JWSD 2WKCA 1QOHA 2K50A 2Q2TA 4BA2I 1RCVD 1VQ9A 2YYZA 2G9HD 4O2DA 2CWAA 3ER0A 4Q0FA 1CT1D 4DR5Q 4JI4Q 3M4YA 1KIXA 1BCPC 4K8JA 2TSSA 1VQBA 2A6HC 5F2DA 1YBYA 2IHEA 5KYIA 3C3LA 1JJCB 2H4OA 4RWSC 1JICA 3AMUA 5C44G 1VQ7A 1U5KA 3HOXB 2SEBD 3BZCA 5FO9B 1IXRA 1B53A 1GXDC 1HZAA 1WCMB 3I8ZA 4APVA 4ODGA 1KC8C 2BH8A 3HG9A 4BY7H 4JI2Q 2VQFQ 2R93G 1HFNA 1T9HA 4DA2A 5M5XB 3OOCA 1EYAA 5GROA 1TVXA 3KDFA 1SMYC 4R4CA 4LAAA 4LFCQ 4KHZA 1STBA 3H91A 2QEXA 3FHWA 4H7BA 4KJOA 2MNAA 2D0PA 3PUVA 3BJUA 2B8FA 1LM0A 1KTKA 3Q23A 2DN8A 4WRDA 1E0BA 3HEJA 3TMEA 4CDEC 2EQSA 1Y1WB 3CCUA 1TS3A 4GLXA 1AZPA 3MVVA 3CW2C 5IGFA 4A3CG 1EYGA 4IQZA 2B2YA 4I7AA 3TP8A 1PH3A 5HGTA 4L5SA 1NR4A 2VNUD 4GNXC 2RCNA 1EIGA 5IWAL 1OO9B 1K0RA 4N9PA 3ULPA 3I4MB 1KNEA 2L5TA 4P75A 1PRTF 1U4LA 4N8FA 3CRLC 1NCVA 3ICEA 4DR6Q 1C4QA 2BE5D 1EQRA 5IGCA 5C5LA 5C0XI 1S5CD 3E0EA 4XYOA 3I4NB 1N34L 1IYJB 2FMMA 4B3RQ 2AMCB 1LV9A 4LFBQ 2ATWA 3J7A5 1QZGA 4KD4A 4R8IA 2OEOA 1CTMA 4HIDA 1KAWA 1LTLA 1CFMA 1SE8A 2Q2IA 3D3RA 5IP9G 3RNUA 1IW7D 2DUDA 1T5EA 3MZ5A 1LTAD 4JYAQ 2OTJA 4JK1C 4Y52H 1YJWA 1EOVA 4U68A 2F4VQ 3PO3G 1FNVA 1HPCA 3EN2A 3F2CA 1A8VA 2ZTDA 5C6AA 4N9TA 3PIP3 4DV4Q 1F9RA 4IJHA 2N78A 3CCEA 1BBXC 4XT1B 1HCZA 3DEPA 3VA7A 1YHAA 4A3FG 1MGSA 1I4XA 2EDGA 1JWMD 4A3EG 1TWHB 2DGYA 2JK8A 2YU9H 1DZ1A 2EYMA 4LF4Q 5BR8L 2A6HD 3DWAA 2L12A 4JI7L 5A2QL 3K80C 3PIO3 1CKNA 3RZDH 4M8AA 2XRSD 3C1FA 2ZJRA 4JBKA 3QR8A 3KJOA 1S5BD 1NBWA 4OWWB 4PNYA 2B63H 4A3IB 3K58A 4MNOA 2F3WA 5GAEC 3TS0A 4P74A 1GHKA 3WDNA 1PRTB 4A3KG 1L1OA 3BYYB 2UXBQ 4BBRG 2R7ZH 2F0FA 3OSOA 2J7ZA 2PI2A 3KF6A 2MPMA 5FO7B 4GKJQ 2RSOA 3SDZA 5C0XG 4C3IG 4FNFA 4B08A 4JI0L 1RODA 3SR1A 1ET9A 3K7UC 4ZUIA 4HIKA 5IT9c 5DEHA 4LF7L 1YNXA 2F4IA 1Y1VH 4JW0A 4QJFA 3M7NA 2RKSA 4QF4A 1B3AA 1K83H 2KCMA 2ENBA 3KYHC 2F0JA 4XQQA 1PFNA 4DAMA 4CKEA 1PH5A 4GOPA 4TKOB 2JA6G 2KCTA 1TT2A 4CDCC 2CVRA 1EQVA 1EU3A 3KK7A 1ESRA 5K5PA 2VZAA 2HIXA 4XT3B 4LK1C 2B2VA 4JI5L 2QW7A 2PO4A 5TSSA 2O5IC 3NHHA 4K8IA 2XWJB 4A75A 1AE3A 4XXEA 3MC0B 2NVYB 2AUJD 1WI5A 3P7JA 5IT9L 4C3HH 2KOLA 5IGEA 1L1OB 2K33A 4AYBG 4HJ8A 3P75A 3DWQA 1M8AA 3S2DH 1Q86C 2UUCL 1F9SA 2L4NA 1TWFB 1E1TA 4XQJA 3M3YH 4DR3L 3HRZC 1ENAA 2OWOA 2CWPA 2YTXA 2JA9A 2PQAB 1N33Q 4C1NI 5C5MA 2EJGC 4CJ1B 2V4DA 5I2XA 4XQNA 1PFSA 2E2IB 1IYVA 3NQIA 4DUZQ 2EE1A 1SROA 4HJ9A 5C4XB 3EA6A 1G8ZD 4GOPB 3PUYA 4M1UB 1QB5D 3QG1A 4F87A 1A0IA 1HJPA 3NQTA 3NBHA 2VQEL 2XIWA 2YTYA 1AZQA 1D7QA 4GZYC 1I4GA 5E4WC 1PH8A 1YNJD 2PW5A 4EVOA 1YNND 2HQEA 3F1ZA 3T1YQ 1Q8IA 3VR3A 4FF2A 3J81c 1GKHA 2UXDL 2R61A 3A5UA 2IW3A 5FJ8G 1NR2A 1VF5C 3S1MB 2A69D 3GTQB 1TWAH 1LTTD 5M3MG 2JA5H 4DR4L 4A3BH 1RKNA 1JMCA 1I6VC 3L7ZC 5EBDA 3IKJA 3T1HL 1S5FD 4QIWB 1GD7A 3VA5A 4ZKBB 1N36Q 1I50H 1PH4A 1HTPA 5C3WA 1KRSA 3J81L 1O7YA 4UPAA 3S1RH 3CQZB 2XWBB 4UP9A 1TKWB 1X9NA 1EIFA 3NBHB 1K8MA 3A54A 1EZ6A 4OWTB 1X55A 2M00A 3DUZA 1ZXTA 4DK0A 1LT4D 1UE7A 1XNRL 2K5DA 1YZ6A 1Q81C 2Z4HA 1I6HH 1BCPF 4I65A 4RGNA 3FP9A 3EROA 2ZTCA 3RLOA 5IGBA 4X65L 4C2MB 2E2JH 1KLUD 1WCMG 4R4QA 2AQ1B 1EWHA 2PNRC 1IZ6A 4G7OC 2R7DA 5I6YA 1HR0W 2F0IA 2E2HH 2JN4A 3JAMi 3NENA 1HH2P 4OX9L 4B3TL 4JCVE 4NW2A 3JC66 2R93H 4P73A 2MHVA 4A3MH 1CA5A 4X3KA 1EYDA 3DXJC 1DGSA 1S3OA 1IBML 2AQ2B 3HOWG 4C3JB 4MIUA 3A8IE 3DWPA 2AKWB 3FVQA 4JI0Q 1STAA 5IYDH 3BG3A 3PUWA 4CJ0B 1SJED 4IUTA 3W1BA 2KBNA 1PH6A 2X69A 3SK4A 1HUMA 1P16A 3NBIA 4DR1L 4IUVA 3S2HH 1LT3D 2KQ3A 4P71A 2UUBL 3M7GA 5I9PA 2A68C 3HOUG 1L0XB 4DV6Q 4G4KA 4DV1Q 1PTOC 1JCKB 3NUCA 4H0LC 1UEBA 1QILA 4OHJA 3GTOH 2WIIB 2N55A 4PZ8A 2VB2X 3FKIH 3H0GH 4R8NA 4BXXH 1Q8KA 2NVXB 3KBXA 1STGA 5JJLA 4Q5VA 4DN4M 4MTNA 2K5NA 2IWHA 3U50C 1TU2B 1XPUA 1MSGA 5ELOA 2C9OA 3VYSA 3J80i 5K36G 4OO1H 3VYRA 3U58A 4DU9A 1QUQA 4CHTB 1CUKA 2D62A 3GTKB 3GTPH 3S17H 2F0DA 1BXTA 1VF7A 4FDBA 5C4ZA 5LMNL 1F9QA 2MGSA 5CV6A 4EQPA 4OL7A 1UE5A 1Z47A 2EVBA 3G4SA 1VQ6A 3U9SA 4ZRZA 2B2VC 4DAYA 1BCPB 5CV7A 2JA8H 5IGGA 2ZM6Q 1EY4A 1E2ZA 3WWVA 1VQEA 3TS2A 4K5WA 3M4OB 4KTAA 4ID6A 4KKSA 1PLFA 5EKIA 4GNXA 3PO3H 1GUNA 1YJ9A 5H1SE 1D1KA 3W1GA 4PV1C 3KF8A 4MTKA 4DR2L 2NN6H 2ZTEA 1LACA 1F9PA 2DNEA 5E4XA 5EPKA 4DR4Q 1V43A 4C3IB 4A3FH 3GTMB 1D5XC 1TS5A 3S9WA 5C3EG 5C4JH 2K28A 4AH6A 2KA7A 3DM3A 1HHVA 2PMZE 4DPGA 2M2LA 1VQNA 5M5YH 1GUTA 4DAYB 1F77A 3RUZA 3F2BA 4BBSB 2LMCB
chains in the Genus database with same CATH topology
5GROA 3CP0A 3PO2G 3KDFA 1NMGA 4DV2Q 2MO0A 4R4CA 1Q46A 4LFCQ 4KHZA 4HIMA 1OTCA 5LMUL 4A3JG 5IP7G 1M1KC 2QEXA 3HOVG 4RG1A 4A3IG 3PV0A 3J81j 4DV5Q 3FHWA 1HR0Q 4JI6Q 2MNAA 2D0PA 3PUVA 4GNXB 1VQMA 4L5TA 1PV4A 4BA1I 1PH7A 3BJUA 1R9TH 1VQLA 1LM0A 4X66L 4JV5L 4L5RC 1NMFA 4X64Q 4A3JH 3MXNB 1SLJA 3NEMA 1J5EQ 2EQSA 2PQAA 5IP7H 4AQYL 5IE8A 1LUZA 1YVCA 4NPSA 1I94Q 3HOVH 3CCUA 4GLXA 4DNIA 2UXCQ 2JE6I 1O7IA 1OXXK 4ME3A 3CW2C 5GAGC 5IYDH 4A3CG 1EYGA 4LF5Q 1FVIA 4LF7Q 4XIGS 1FJGQ 1PH3A 3I55A 4LNQA 2BH2A 1AE2A 4L5SA 2VNUD 2D0OA 4GNXC 2EIFA 2RCNA 1HZCA 3CCJA 5IWAL 3A5ZB 1K0RA 3TEHB 1PA6A 4B3TQ 3ULPA 1VQAA 4DV6L 4BY1G 1KL9A 4OXPA 4DV1L 2A1AA 2GVBA 2OQKA 2A19A 2N49A 4A3CH 1SR3A 4P75A 4LUVA 1VQKA 3HKSA 3A74A 4DV0L 1KRTA 3D31A 4C2MH 3ICEA 4DR6Q 3CXCA 2YTVA 1YJNA 3ERSX 1EQRA 5FLMG 4LF9L 3CF5A 4IFDJ 5C0XI 4KI0A 1N8RC 3E0EA 4JI5Q 1HZBA 1B70B 1PH9A 5IYCG 4BY1H 1N34L 4A3LG 3G6EA 2Y0SG 2Z0SA 1EFWA 1IYJB 3EBEA 4B3RQ 2AMCB 1YIJA 5AJ3Q 1HNXQ 3H3VI 2PI2E 4HJAA 4LFBQ 1Q1EA 2ATWA 3J7A5 1QZGA 4NXNQ 3G48A 1YITA 1Y14B 4NXMQ 1KHIA 1W3SA 2IT1A 5IYCH 2UUCQ 4QY7A 2K5VA 4A3LH 4DK3C 2GN5A 4DR3Q 2C35B 4A76A 1G291 1W2BA 2ASBA 2UUAL 4HIDA 1JJGA 3GTJH 2H5XA 3SGIA 1KAWA 1N9WA 1VQJA 4YCWA 1LTLA 1SE8A 2ALYB 2ES2A 2Q2IA 3F2DA 5IP9G 2KHIA 1IBKQ 1X54A 3RNUA 1SMXA 2CQOA 1WJJA 2ZM6L 1IL2A 2EXDA 1TWFH 2DUDA 4DK6C 1K73C 4JYAQ 3PUZA 1GM5A 1PYSB 2I5LX 2OTJA 1HNWL 1N32L 4Y52H 1YJWA 1EOVA 5C4XG 2F4VQ 3PO3G 5HGQA 5IP9H 2JA7G 3EN2A 4JI1L 1VQPA 3IRBA 1Q12A 2Q2HA 3F2CA 1A8VA 2VQEQ 4R1JA 5LMNW 1K8AC 2ZTDA 3OYYA 3UE0A 4DR5L 2E2IH 4JI4L 1MJCA 4DV4Q 2NVTH 4DV7Q 2R92G 1VQFA 4IJHA 2N78A 3RN5A 3K0XA 3CCEA 1TWCH 3KLWA 4DUYQ 5C4XH 1YHAA 4A3FG 1KD1C 3UDFA 2JA7H 1NJIC 4K0KQ 5GQOA 1PYBA 4A3EG 3S15H 1VQGA 1OXUA 2DGYA 1Z9FA 2JK8A 2YU9H 2UXDQ 4LF4Q 2R92H 5BR8L 1QUQB 4X62Q 2CCZA 1XNQL 3AYHB 4JI7L 3GTKH 3K80C 4GN4B 5M5WH 1CKNA 3RZDH 4LUOA 4JOIA 1K3RA 2IY5B 2WP8J 2B63G 4A3EH 5M3MH 2ID0A 4JI2L 2VQFL 2ZJRA 4JBKA 3T1HQ 1X3EA 3KOJA 3U4VA 3L2PA 4B3ML 1L0WA 4IFDI 3KJOA 2R7ZG 3CCMA 1NBWA 2BA0A 4OWWB 1HNZL 3GTQH 2B63H 4IOCA 1E1OA 1EIYB 4YCVA 4MNOA 5E7NA 5GAEC 3TS0A 4P74A 1YEZA 1C9OA 3RN2A 1S40A 1HR0L 1XJVA 4A3KG 2LSSA 1L1OA 2UXBQ 4BBRG 4X6AH 2R7ZH 1UWVA 2CFMA 3F8TA 3UDGA 3M4OH 1Y1VG 3I56A 2JEBI 4YCUA 2PI2A 4X64L 3KF6A 1XNRQ 5JJIA 2VW9A 1J5EL 4GKJQ 1J6QA 4LFAQ 1E7ZA 5C0XG 3HOXG 1I94L 4QQBX 4JI0L 4YHHQ 4KHPL 1JB7A 3CQZH 3KF8B 4A3KH 4DV3Q 3K7UC 4BBRH 4LF5L 3A0JA 4HIKA 5IT9c 4LF7L 1FJGL 1YNXA 4QJFA 1Y1VH 2XGTA 4X65Q 2VL6A 1XMOL 2UU9Q 3M7NA 2YV5A 2OCEA 1K83H 2KCMA 3PCOB 3HOXH 3KYHC 4C3IH 3GTMH 4WJ4A 1E22A 4EQ5A 4DAMA 2K75A 2Q2UA 1PH5A 3S16H 1L2FA 4GOPA 2JA6G 2KCTA 4OX9Q 5LMUQ 1V9PA 2FXQA 3H3VH 3M4QA 4DR6L 4A93G 1BVSA 2JQOA 4LF8Q 2VZAA 2HIXA 4AYBE 2QA4A 3H15A 4JI5L 2XTIA 1UE6A 5M5XH 1WFQA 1IBMQ 4A75A 1AE3A 3M4PA 4YWLA 2K14A 4EX5A 5DLQE 3CPWA 4JV5Q 3KDFB 2JA6H 3S24A 4B3RL 4IPGA 1WI5A 4C3HH 1I5FA 3JAMc 5AJ3L 4AQYQ 4LFBL 4POGA 1L1OB 4AYBG 2I5MX 4HJ8A 1QVGA 2HHHL 1X3FA 4NXNL 1IBLQ 4A93H 3KFUA 1Q7YC 5J3BA 3S2DH 1Q86C 5JEAJ 1Y1WG 2UUCL 4LW1A 1G51A 1E1TA 3VDYA 1M90C 3M3YH 4P72A 2KENA 4DR3L 4UP7A 3PIPA 1XMQL 4DR1Q 3PSIA 2OWOA 2CWPA 2YTXA 2JA9A 2PQAB 1N33Q 4C3JH 1JE5A 4JC0A 1SRUA 3S14H 4A4IA 1PFSA 2UUBQ 1Y1WH 1L1OC 4YWMA 1RL2A 3I4MG 4UP8A 3MEFA 1MIUA 4DUZQ 2IX0A 4IPHA 1SROA 4HJ9A 2K52A 4B3SL 1PH2A 2RHQB 3RZOH 4IOAA 4GOPB 4JYAL 3PUYA 2B3GA 2KHJA 3RR5A 4OWXB 3PIOA 3CC2A 2F4VL 1VQ4A 2VY3A 1A0IA 1HJPA 3E9HA 4YY3Q 2AWNA 2RF4A 3K8AA 4R4TA 5IYBG 1WYDA 3I4MH 1YHBA 5FLXc 2VQEL 3I4NG 2NZOA 1BKBA 1B7YB 2YTYA 3D0FA 3M85A 4DV4L 1D7QA 1VCIA 4JBJA 1HZ9A 1PH8A 4PZ7A 2IHFA 3OTOQ 4IFDG 4DUYL 2JA5G 4A3BG 4A3DG 3F1ZA 3T1YQ 3G71A 5IYBH 3HOZG 3RLNA 3J81c 4GOPC 4DR7L 3EIVA 3I4NH 4K0KL 4JI3Q 1GKHA 1QVCA 3GTGH 2E5LQ 1KXLA 1SFOH 2NVXH 3A5UA 2WB1E 1PHJA 2UXDL 3OW2A 1JJ2A 4X62L 5LMNQ 2NVQH 5FJ8G 1G6PA 4JI8Q 4OO1I 3B6YA 1TWAH 5M3MG 1QVFA 3GTLH 2JA5H 4DR4L 4A3BH 4A3DH 5M3FH 1I3QH 1JMCA 3HOZH 3L7ZC 1BBUA 1PH1A 3HFZB 4OONA 2RHSB 3T1HL 1RIPA 3CMEA 1HNWQ 2I0QA 1EWIA 3ULLA 1GD7A 1WOCA 2K4KA 5FJ8H 1B8AA 1N36Q 3L0OA 4JI1Q 1I50H 2AWOA 1A62A 1PH4A 4PMWA 2JEAI 3ULJA 1VQ8A 1KRSA 2A8VA 1X65A 4GN5A 4HJ5A 4GKKQ 4UPAA 3S1RH 3PF4A 4UP9A 1NE3A 2V1CC 2JJQA 1X9NA 4DV2L 1EIFA 3CCVA 3S1NH 3NBHB 4LFCL 1KQSA 1XPOA 1VQDA 2UXBL 2WFWA 4JG2A 4OWTB 4UY8C 1X55A 3PGZA 1UE7A 4LF6Q 1YI2A 1MJEA 1XNRL 1JT8A 2QGQA 4DV5L 1OXSC 1VQOA 4JI6L 1OXVA 4DR2Q 4WJ3M 3STBC 1YZ6A 1TXYA 4LFAL 4LWCA 1Q81C 4GN3B 1XNQQ 4R4OA 4GKJL 4AIMA 1I6HH 1VQIA 1ASYA 3UE1A 4DV3L 3CCQA 3FP9A 2R7FA 3AEVA 2ZTCA 1C7YA 3RLOA 3TREA 3S1QH 2UXCL 4X65L 2UU9L 4A3MG 3K81C 2E2JH 1WCMG 4R4QA 2NN6I 3CC7A 1IZ6A 1NTGA 3E9IA 2R7DA 4GS3A 1HR0W 2HIVA 5EAYA 2E2HH 3PUXA 3BZKA 3JAMi 3NENA 1HNZQ 1H95A 1HH2P 1P8LA 1CKNB 4OX9L 3CCRA 4JCVE 4B3TL 1MKHA 1XTDA 3JC66 1XPRA 2R93H 2I5HA 4P73A 4H02A 4A3MH 1D8LA 4BBSG 1WCMH 5IYDG 4LF8L 3HOYG 3Q8DA 1DGSA 1S3OA 2PNHA 2HT1A 4LUZA 3ZJYC 4POFA 1IBML 3PO2H 3HOWG 3UDIA 1E3PA 3U4ZA 1Q1BA 1TWGH 2AKWB 4XTCS 1IBLL 1GVPA 4BBSH 1U0LA 4X66Q 2CKZB 2F52A 3GDEA 2N8NA 4A3IH 1EQQA 4JI0Q 4KHPQ 3HOYH 3PUWA 4JOIC 5ELNA 1HNXL 1VQCA 1ASZA 1X6OA 1VQHA 3HOWH 3W1BA 2ZJPA 2KBNA 3LGJA 1XMOQ 5GAHC 2ZJQA 1PH6A 4NXML 3GD7A 3I7FA 1P16A 3KF6B 4DR1L 3S2HH 4P71A 1N33L 3AFQA 3BU2A 4KLKA 4QGUA 2OQ0A 3FKIG 3H0GG 3W5OA 2UUBL 3CD6A 1EUJA 4BXXG 5IWAQ 1OXTA 2Y0SE 2MFIA 3HKZE 3HOUG 4DV6Q 4DUZL 4DV1Q 2AHOB 2K5HA 3TRZA 1PVOA 1K8GA 2NZHA 1UEBA 3PF5A 3GTOH 1IBKL 4DV0Q 1A63A 4OO1G 1CSPA 1VS0A 1AH9A 3CPFA 4PZ8A 3RLFA 3FKIH 3H0GH 3J81i 4BXXH 1UE1A 1Q8KA 1X56A 3GO5A 3CAMA 3HKZG 4YY3L 3CCLA 4LF9Q 1X3GA 5JJLA 1FGUA 4MTNA 2K5NA 1LYLA 3HOUH 4R4IA 1FL0A 3U50C 2HHHQ 1SN8A 1XPUA 1N34Q 5ELOA 5FLMH 2WAQE 4A3GG 2VS1A 1NY4A 3M9BA 3AFPA 2LXKA 4QL5A 4TQUS 3J80i 4ALPA 5K36G 3OTOL 3J7ZC 5HY6A 3U58A 4MZ9A 1QUQA 3T1YL 4IPCA 1CKOA 1CUKA 2D62A 2Z6KA 4DKAC 4DV7L 4IO9A 2OTLA 3GTPH 4IPDA 3S17H 4JI3L 2MQHA 1XMQQ 2E5LL 2NVYH 2WAQG 4O0AA 2JA8G 2VUMG 3UDXA 2R6GA 5M3FG 4A3GH 4FDBA 5LMNL 2UUAQ 3I2ZA 4JI8L 4GLAC 4HJ7A 4PZ6A 1V1QA 2LXJA 4JBWA 4LF4L 5JEAG 1UE5A 1Z47A 3G4SA 1VQ6A 4L5QA 4B3SQ 3NELA 5IY0A 1S72A 5JJKA 3CC4A 3J80c 2VUMH 2JA8H 2F3IA 1E24A 1Q82C 2IX1A 2ZM6Q 1CSQA 3AQQA 1QZHA 1VQ5A 1N36L 2WB1G 3WWVA 4J15A 3DLLA 1VQEA 3TS2A 1N32Q 2K50A 2Q2TA 4GKKL 2GVAA 4BA2I 3I4OA 2NN6G 1VQ9A 2YYZA 4NB3A 4RMFA 4O2DA 2CWAA 3ER0A 4GNXA 4GLVB 3CMAA 4DR5Q 1YHQA 4JI4Q 5C0XJ 2E8GA 1KIXA 3PO3H 1YJ9A 5H1SE 4DR7Q 3W1GA 1VQBA 4LF6L 1YBYA 2HQLA 4PG3A 1GO3E 2IHEA 1JJCB 4DR2L 1CKMA 3KJPA 3TQYA 2ZTEA 2L15A 5C44G 1K9MC 1VQ7A 1U5KA 4BY7G 2N3SA 4DR4Q 3BZCA 1V43A 1IXRA 4A3FH 4QIWE 5BR8Q 1HZAA 4TVAB 2B29A 4APVA 5C3EG 5C4JH 4JI7Q 4YHHL 1KC8C 2BH8A 2MO1A 3K7AH 3STBD 4AH6A 3CCSA 4YWKA 3DM3A 4Y7NH 5C44H 2PMZE 4DPGA 2BA1A 1C0AA 4JBMA 4BY7H 4JI2Q 2VQFQ 1VQNA 2R93G 5M5YH 4IJLA 4DAYB 4HIOA 1T9HA 3S1MH 2Z6KC 3F2BA 5GADC 1TWHH 4B3MQ 1BBWA 5C3EH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GRO A;  3CP0 A;  3PO2 G;  3KDF A;  1NMG A;  4DV2 Q;  2MO0 A;  4R4C A;  1Q46 A;  4LFC Q;  4KHZ A;  4HIM A;  1OTC A;  5LMU L;  4A3J G;  5IP7 G;  1M1K C;  2QEX A;  3HOV G;  4RG1 A;  4A3I G;  3PV0 A;  3J81 j;  4DV5 Q;  3FHW A;  1HR0 Q;  4JI6 Q;  2MNA A;  2D0P A;  3PUV A;  4GNX B;  1VQM A;  4L5T A;  1PV4 A;  4BA1 I;  1PH7 A;  3BJU A;  1R9T H;  1VQL A;  1LM0 A;  4X66 L;  4JV5 L;  4L5R C;  1NMF A;  4X64 Q;  4A3J H;  3MXN B;  1SLJ A;  3NEM A;  1J5E Q;  2EQS A;  2PQA A;  5IP7 H;  4AQY L;  5IE8 A;  1LUZ A;  1YVC A;  4NPS A;  1I94 Q;  3HOV H;  3CCU A;  4GLX A;  4DNI A;  2UXC Q;  2JE6 I;  1O7I A;  1OXX K;  4ME3 A;  3CW2 C;  5GAG C;  5IYD H;  4A3C G;  1EYG A;  4LF5 Q;  1FVI A;  4LF7 Q;  4XIG S;  1FJG Q;  1PH3 A;  3I55 A;  4LNQ A;  2BH2 A;  1AE2 A;  4L5S A;  2VNU D;  2D0O A;  4GNX C;  2EIF A;  2RCN A;  1HZC A;  3CCJ A;  5IWA L;  3A5Z B;  1K0R A;  3TEH B;  1PA6 A;  4B3T Q;  3ULP A;  1VQA A;  4DV6 L;  4BY1 G;  1KL9 A;  4OXP A;  4DV1 L;  2A1A A;  2GVB A;  2OQK A;  2A19 A;  2N49 A;  4A3C H;  1SR3 A;  4P75 A;  4LUV A;  1VQK A;  3HKS A;  3A74 A;  4DV0 L;  1KRT A;  3D31 A;  4C2M H;  3ICE A;  4DR6 Q;  3CXC A;  2YTV A;  1YJN A;  3ERS X;  1EQR A;  5FLM G;  4LF9 L;  3CF5 A;  4IFD J;  5C0X I;  4KI0 A;  1N8R C;  3E0E A;  4JI5 Q;  1HZB A;  1B70 B;  1PH9 A;  5IYC G;  4BY1 H;  1N34 L;  4A3L G;  3G6E A;  2Y0S G;  2Z0S A;  1EFW A;  1IYJ B;  3EBE A;  4B3R Q;  2AMC B;  1YIJ A;  5AJ3 Q;  1HNX Q;  3H3V I;  2PI2 E;  4HJA A;  4LFB Q;  1Q1E A;  2ATW A;  3J7A 5;  1QZG A;  4NXN Q;  3G48 A;  1YIT A;  1Y14 B;  4NXM Q;  1KHI A;  1W3S A;  2IT1 A;  5IYC H;  2UUC Q;  4QY7 A;  2K5V A;  4A3L H;  4DK3 C;  2GN5 A;  4DR3 Q;  2C35 B;  4A76 A;  1G29 1;  1W2B A;  2ASB A;  2UUA L;  4HID A;  1JJG A;  3GTJ H;  2H5X A;  3SGI A;  1KAW A;  1N9W A;  1VQJ A;  4YCW A;  1LTL A;  1SE8 A;  2ALY B;  2ES2 A;  2Q2I A;  3F2D A;  5IP9 G;  2KHI A;  1IBK Q;  1X54 A;  3RNU A;  1SMX A;  2CQO A;  1WJJ A;  2ZM6 L;  1IL2 A;  2EXD A;  1TWF H;  2DUD A;  4DK6 C;  1K73 C;  4JYA Q;  3PUZ A;  1GM5 A;  1PYS B;  2I5L X;  2OTJ A;  1HNW L;  1N32 L;  4Y52 H;  1YJW A;  1EOV A;  5C4X G;  2F4V Q;  3PO3 G;  5HGQ A;  5IP9 H;  2JA7 G;  3EN2 A;  4JI1 L;  1VQP A;  3IRB A;  1Q12 A;  2Q2H A;  3F2C A;  1A8V A;  2VQE Q;  4R1J A;  5LMN W;  1K8A C;  2ZTD A;  3OYY A;  3UE0 A;  4DR5 L;  2E2I H;  4JI4 L;  1MJC A;  4DV4 Q;  2NVT H;  4DV7 Q;  2R92 G;  1VQF A;  4IJH A;  2N78 A;  3RN5 A;  3K0X A;  3CCE A;  1TWC H;  3KLW A;  4DUY Q;  5C4X H;  1YHA A;  4A3F G;  1KD1 C;  3UDF A;  2JA7 H;  1NJI C;  4K0K Q;  5GQO A;  1PYB A;  4A3E G;  3S15 H;  1VQG A;  1OXU A;  2DGY A;  1Z9F A;  2JK8 A;  2YU9 H;  2UXD Q;  4LF4 Q;  2R92 H;  5BR8 L;  1QUQ B;  4X62 Q;  2CCZ A;  1XNQ L;  3AYH B;  4JI7 L;  3GTK H;  3K80 C;  4GN4 B;  5M5W H;  1CKN A;  3RZD H;  4LUO A;  4JOI A;  1K3R A;  2IY5 B;  2WP8 J;  2B63 G;  4A3E H;  5M3M H;  2ID0 A;  4JI2 L;  2VQF L;  2ZJR A;  4JBK A;  3T1H Q;  1X3E A;  3KOJ A;  3U4V A;  3L2P A;  4B3M L;  1L0W A;  4IFD I;  3KJO A;  2R7Z G;  3CCM A;  1NBW A;  2BA0 A;  4OWW B;  1HNZ L;  3GTQ H;  2B63 H;  4IOC A;  1E1O A;  1EIY B;  4YCV A;  4MNO A;  5E7N A;  5GAE C;  3TS0 A;  4P74 A;  1YEZ A;  1C9O A;  3RN2 A;  1S40 A;  1HR0 L;  1XJV A;  4A3K G;  2LSS A;  1L1O A;  2UXB Q;  4BBR G;  4X6A H;  2R7Z H;  1UWV A;  2CFM A;  3F8T A;  3UDG A;  3M4O H;  1Y1V G;  3I56 A;  2JEB I;  4YCU A;  2PI2 A;  4X64 L;  3KF6 A;  1XNR Q;  5JJI A;  2VW9 A;  1J5E L;  4GKJ Q;  1J6Q A;  4LFA Q;  1E7Z A;  5C0X G;  3HOX G;  1I94 L;  4QQB X;  4JI0 L;  4YHH Q;  4KHP L;  1JB7 A;  3CQZ H;  3KF8 B;  4A3K H;  4DV3 Q;  3K7U C;  4BBR H;  4LF5 L;  3A0J A;  4HIK A;  5IT9 c;  4LF7 L;  1FJG L;  1YNX A;  4QJF A;  1Y1V H;  2XGT A;  4X65 Q;  2VL6 A;  1XMO L;  2UU9 Q;  3M7N A;  2YV5 A;  2OCE A;  1K83 H;  2KCM A;  3PCO B;  3HOX H;  3KYH C;  4C3I H;  3GTM H;  4WJ4 A;  1E22 A;  4EQ5 A;  4DAM A;  2K75 A;  2Q2U A;  1PH5 A;  3S16 H;  1L2F A;  4GOP A;  2JA6 G;  2KCT A;  4OX9 Q;  5LMU Q;  1V9P A;  2FXQ A;  3H3V H;  3M4Q A;  4DR6 L;  4A93 G;  1BVS A;  2JQO A;  4LF8 Q;  2VZA A;  2HIX A;  4AYB E;  2QA4 A;  3H15 A;  4JI5 L;  2XTI A;  1UE6 A;  5M5X H;  1WFQ A;  1IBM Q;  4A75 A;  1AE3 A;  3M4P A;  4YWL A;  2K14 A;  4EX5 A;  5DLQ E;  3CPW A;  4JV5 Q;  3KDF B;  2JA6 H;  3S24 A;  4B3R L;  4IPG A;  1WI5 A;  4C3H H;  1I5F A;  3JAM c;  5AJ3 L;  4AQY Q;  4LFB L;  4POG A;  1L1O B;  4AYB G;  2I5M X;  4HJ8 A;  1QVG A;  2HHH L;  1X3F A;  4NXN L;  1IBL Q;  4A93 H;  3KFU A;  1Q7Y C;  5J3B A;  3S2D H;  1Q86 C;  5JEA J;  1Y1W G;  2UUC L;  4LW1 A;  1G51 A;  1E1T A;  3VDY A;  1M90 C;  3M3Y H;  4P72 A;  2KEN A;  4DR3 L;  4UP7 A;  3PIP A;  1XMQ L;  4DR1 Q;  3PSI A;  2OWO A;  2CWP A;  2YTX A;  2JA9 A;  2PQA B;  1N33 Q;  4C3J H;  1JE5 A;  4JC0 A;  1SRU A;  3S14 H;  4A4I A;  1PFS A;  2UUB Q;  1Y1W H;  1L1O C;  4YWM A;  1RL2 A;  3I4M G;  4UP8 A;  3MEF A;  1MIU A;  4DUZ Q;  2IX0 A;  4IPH A;  1SRO A;  4HJ9 A;  2K52 A;  4B3S L;  1PH2 A;  2RHQ B;  3RZO H;  4IOA A;  4GOP B;  4JYA L;  3PUY A;  2B3G A;  2KHJ A;  3RR5 A;  4OWX B;  3PIO A;  3CC2 A;  2F4V L;  1VQ4 A;  2VY3 A;  1A0I A;  1HJP A;  3E9H A;  4YY3 Q;  2AWN A;  2RF4 A;  3K8A A;  4R4T A;  5IYB G;  1WYD A;  3I4M H;  1YHB A;  5FLX c;  2VQE L;  3I4N G;  2NZO A;  1BKB A;  1B7Y B;  2YTY A;  3D0F A;  3M85 A;  4DV4 L;  1D7Q A;  1VCI A;  4JBJ A;  1HZ9 A;  1PH8 A;  4PZ7 A;  2IHF A;  3OTO Q;  4IFD G;  4DUY L;  2JA5 G;  4A3B G;  4A3D G;  3F1Z A;  3T1Y Q;  3G71 A;  5IYB H;  3HOZ G;  3RLN A;  3J81 c;  4GOP C;  4DR7 L;  3EIV A;  3I4N H;  4K0K L;  4JI3 Q;  1GKH A;  1QVC A;  3GTG H;  2E5L Q;  1KXL A;  1SFO H;  2NVX H;  3A5U A;  2WB1 E;  1PHJ A;  2UXD L;  3OW2 A;  1JJ2 A;  4X62 L;  5LMN Q;  2NVQ H;  5FJ8 G;  1G6P A;  4JI8 Q;  4OO1 I;  3B6Y A;  1TWA H;  5M3M G;  1QVF A;  3GTL H;  2JA5 H;  4DR4 L;  4A3B H;  4A3D H;  5M3F H;  1I3Q H;  1JMC A;  3HOZ H;  3L7Z C;  1BBU A;  1PH1 A;  3HFZ B;  4OON A;  2RHS B;  3T1H L;  1RIP A;  3CME A;  1HNW Q;  2I0Q A;  1EWI A;  3ULL A;  1GD7 A;  1WOC A;  2K4K A;  5FJ8 H;  1B8A A;  1N36 Q;  3L0O A;  4JI1 Q;  1I50 H;  2AWO A;  1A62 A;  1PH4 A;  4PMW A;  2JEA I;  3ULJ A;  1VQ8 A;  1KRS A;  2A8V A;  1X65 A;  4GN5 A;  4HJ5 A;  4GKK Q;  4UPA A;  3S1R H;  3PF4 A;  4UP9 A;  1NE3 A;  2V1C C;  2JJQ A;  1X9N A;  4DV2 L;  1EIF A;  3CCV A;  3S1N H;  3NBH B;  4LFC L;  1KQS A;  1XPO A;  1VQD A;  2UXB L;  2WFW A;  4JG2 A;  4OWT B;  4UY8 C;  1X55 A;  3PGZ A;  1UE7 A;  4LF6 Q;  1YI2 A;  1MJE A;  1XNR L;  1JT8 A;  2QGQ A;  4DV5 L;  1OXS C;  1VQO A;  4JI6 L;  1OXV A;  4DR2 Q;  4WJ3 M;  3STB C;  1YZ6 A;  1TXY A;  4LFA L;  4LWC A;  1Q81 C;  4GN3 B;  1XNQ Q;  4R4O A;  4GKJ L;  4AIM A;  1I6H H;  1VQI A;  1ASY A;  3UE1 A;  4DV3 L;  3CCQ A;  3FP9 A;  2R7F A;  3AEV A;  2ZTC A;  1C7Y A;  3RLO A;  3TRE A;  3S1Q H;  2UXC L;  4X65 L;  2UU9 L;  4A3M G;  3K81 C;  2E2J H;  1WCM G;  4R4Q A;  2NN6 I;  3CC7 A;  1IZ6 A;  1NTG A;  3E9I A;  2R7D A;  4GS3 A;  1HR0 W;  2HIV A;  5EAY A;  2E2H H;  3PUX A;  3BZK A;  3JAM i;  3NEN A;  1HNZ Q;  1H95 A;  1HH2 P;  1P8L A;  1CKN B;  4OX9 L;  3CCR A;  4JCV E;  4B3T L;  1MKH A;  1XTD A;  3JC6 6;  1XPR A;  2R93 H;  2I5H A;  4P73 A;  4H02 A;  4A3M H;  1D8L A;  4BBS G;  1WCM H;  5IYD G;  4LF8 L;  3HOY G;  3Q8D A;  1DGS A;  1S3O A;  2PNH A;  2HT1 A;  4LUZ A;  3ZJY C;  4POF A;  1IBM L;  3PO2 H;  3HOW G;  3UDI A;  1E3P A;  3U4Z A;  1Q1B A;  1TWG H;  2AKW B;  4XTC S;  1IBL L;  1GVP A;  4BBS H;  1U0L A;  4X66 Q;  2CKZ B;  2F52 A;  3GDE A;  2N8N A;  4A3I H;  1EQQ A;  4JI0 Q;  4KHP Q;  3HOY H;  3PUW A;  4JOI C;  5ELN A;  1HNX L;  1VQC A;  1ASZ A;  1X6O A;  1VQH A;  3HOW H;  3W1B A;  2ZJP A;  2KBN A;  3LGJ A;  1XMO Q;  5GAH C;  2ZJQ A;  1PH6 A;  4NXM L;  3GD7 A;  3I7F A;  1P16 A;  3KF6 B;  4DR1 L;  3S2H H;  4P71 A;  1N33 L;  3AFQ A;  3BU2 A;  4KLK A;  4QGU A;  2OQ0 A;  3FKI G;  3H0G G;  3W5O A;  2UUB L;  3CD6 A;  1EUJ A;  4BXX G;  5IWA Q;  1OXT A;  2Y0S E;  2MFI A;  3HKZ E;  3HOU G;  4DV6 Q;  4DUZ L;  4DV1 Q;  2AHO B;  2K5H A;  3TRZ A;  1PVO A;  1K8G A;  2NZH A;  1UEB A;  3PF5 A;  3GTO H;  1IBK L;  4DV0 Q;  1A63 A;  4OO1 G;  1CSP A;  1VS0 A;  1AH9 A;  3CPF A;  4PZ8 A;  3RLF A;  3FKI H;  3H0G H;  3J81 i;  4BXX H;  1UE1 A;  1Q8K A;  1X56 A;  3GO5 A;  3CAM A;  3HKZ G;  4YY3 L;  3CCL A;  4LF9 Q;  1X3G A;  5JJL A;  1FGU A;  4MTN A;  2K5N A;  1LYL A;  3HOU H;  4R4I A;  1FL0 A;  3U50 C;  2HHH Q;  1SN8 A;  1XPU A;  1N34 Q;  5ELO A;  5FLM H;  2WAQ E;  4A3G G;  2VS1 A;  1NY4 A;  3M9B A;  3AFP A;  2LXK A;  4QL5 A;  4TQU S;  3J80 i;  4ALP A;  5K36 G;  3OTO L;  3J7Z C;  5HY6 A;  3U58 A;  4MZ9 A;  1QUQ A;  3T1Y L;  4IPC A;  1CKO A;  1CUK A;  2D62 A;  2Z6K A;  4DKA C;  4DV7 L;  4IO9 A;  2OTL A;  3GTP H;  4IPD A;  3S17 H;  4JI3 L;  2MQH A;  1XMQ Q;  2E5L L;  2NVY H;  2WAQ G;  4O0A A;  2JA8 G;  2VUM G;  3UDX A;  2R6G A;  5M3F G;  4A3G H;  4FDB A;  5LMN L;  2UUA Q;  3I2Z A;  4JI8 L;  4GLA C;  4HJ7 A;  4PZ6 A;  1V1Q A;  2LXJ A;  4JBW A;  4LF4 L;  5JEA G;  1UE5 A;  1Z47 A;  3G4S A;  1VQ6 A;  4L5Q A;  4B3S Q;  3NEL A;  5IY0 A;  1S72 A;  5JJK A;  3CC4 A;  3J80 c;  2VUM H;  2JA8 H;  2F3I A;  1E24 A;  1Q82 C;  2IX1 A;  2ZM6 Q;  1CSQ A;  3AQQ A;  1QZH A;  1VQ5 A;  1N36 L;  2WB1 G;  3WWV A;  4J15 A;  3DLL A;  1VQE A;  3TS2 A;  1N32 Q;  2K50 A;  2Q2T A;  4GKK L;  2GVA A;  4BA2 I;  3I4O A;  2NN6 G;  1VQ9 A;  2YYZ A;  4NB3 A;  4RMF A;  4O2D A;  2CWA A;  3ER0 A;  4GNX A;  4GLV B;  3CMA A;  4DR5 Q;  1YHQ A;  4JI4 Q;  5C0X J;  2E8G A;  1KIX A;  3PO3 H;  1YJ9 A;  5H1S E;  4DR7 Q;  3W1G A;  1VQB A;  4LF6 L;  1YBY A;  2HQL A;  4PG3 A;  1GO3 E;  2IHE A;  1JJC B;  4DR2 L;  1CKM A;  3KJP A;  3TQY A;  2ZTE A;  2L15 A;  5C44 G;  1K9M C;  1VQ7 A;  1U5K A;  4BY7 G;  2N3S A;  4DR4 Q;  3BZC A;  1V43 A;  1IXR A;  4A3F H;  4QIW E;  5BR8 Q;  1HZA A;  4TVA B;  2B29 A;  4APV A;  5C3E G;  5C4J H;  4JI7 Q;  4YHH L;  1KC8 C;  2BH8 A;  2MO1 A;  3K7A H;  3STB D;  4AH6 A;  3CCS A;  4YWK A;  3DM3 A;  4Y7N H;  5C44 H;  2PMZ E;  4DPG A;  2BA1 A;  1C0A A;  4JBM A;  4BY7 H;  4JI2 Q;  2VQF Q;  1VQN A;  2R93 G;  5M5Y H;  4IJL A;  4DAY B;  4HIO A;  1T9H A;  3S1M H;  2Z6K C;  3F2B A;  5GAD C;  1TWH H;  4B3M Q;  1BBW A;  5C3E H; 
#chains in the Genus database with same CATH topology
 3TZD A;  1NMG A;  3W2D A;  1BOS A;  1Q46 A;  5KRU A;  1F2Z A;  1OTC A;  3Q6S A;  5COY A;  5IP7 G;  3R3O A;  3J7Y W;  4A3I G;  3PV0 A;  1HR0 Q;  4CJ2 C;  3R2T A;  1PV4 A;  4GNX B;  5ELB A;  4JVZ A;  3SHL A;  1VQL A;  1A2U A;  1SNO A;  4X66 L;  2BCO A;  2VB3 X;  4RCO A;  4AYB B;  1STY A;  4A3J H;  1SLJ A;  1X3Q A;  4AQY L;  2ZT9 C;  1YVC A;  2Z8L A;  4NPS A;  3HOV H;  3K5M A;  2JE6 I;  4ME3 A;  4H13 C;  4UDU C;  1DXM A;  4F7X A;  4NKL A;  1DJR D;  4ULL A;  2BH2 A;  1PZJ D;  2D0O A;  2EIF A;  2EOT A;  1HZC A;  1LTR D;  3I90 A;  3TEH B;  1PA6 A;  4B3T Q;  5IOC A;  1TII D;  2NBF A;  3OWE B;  3T51 B;  2A1A A;  2GVB A;  5KND A;  1SE4 A;  2N49 A;  4LUV A;  2BE5 C;  3FDT A;  2D5D A;  2YTV A;  1KLG D;  4JPB W;  3ERS X;  2F0T A;  4LF9 L;  3CF5 A;  3A56 A;  4U67 3;  1PH9 A;  4BY1 H;  5T1G A;  3X3N A;  3N52 A;  3G6E A;  3U9O A;  5AJ3 Q;  2AQ3 B;  1ZKO A;  3H3V I;  4HJA A;  4ILW A;  4G7H C;  4DNR B;  4NXN Q;  3G48 A;  3GTL B;  2VUM B;  1TQO A;  5M3F B;  1WTV A;  2IT1 A;  5IYC H;  2F0N A;  3SK8 A;  2K5V A;  5JOB A;  4A3L H;  1WD0 A;  4DK3 C;  2GN5 A;  4A76 A;  1W2B A;  4EGV A;  5DNF A;  2Z1C A;  3GTJ H;  1N9W A;  4X3T A;  2QDL A;  2ALY B;  3K6O A;  2ES2 A;  5JAV A;  1RF2 D;  1IW7 C;  3QOJ A;  5IIF A;  2WB1 B;  1F2L A;  1E2W A;  1SMX A;  2CQO A;  1WJJ A;  1C8C A;  2P5Z X;  2EXD A;  2F0G A;  3S1N B;  2D9U A;  1GJX A;  5C4X G;  5HGQ A;  1FR3 A;  3HZX A;  3IRB A;  1IKL A;  5CGK A;  2NVT H;  2RCF A;  3OMC A;  2R92 G;  1A3T A;  3K0X A;  3KLW A;  4DUY Q;  2FIN B;  4V0B A;  4BY7 B;  4PMB A;  3S1Q B;  2JA7 H;  1NJI C;  5A2Q E;  4RGO S;  5KNB A;  4HN7 A;  2Z4I A;  1KAB A;  4DF7 A;  4QB4 A;  5DM7 3;  4Z9C B;  5M5W H;  1SNM A;  1FGB D;  4QMG A;  4LUO A;  3BYT B;  4JOI A;  2L55 A;  1K3R A;  2WP8 J;  5M3M H;  1X3E A;  3KOJ A;  2F0K A;  2MUY A;  2A73 B;  1Y8N B;  4B3M L;  3V2T A;  4IFD I;  3KUP A;  3OIQ A;  2BA0 A;  1HNZ L;  1ILP A;  5KGU A;  1EIY B;  1E1O A;  5J39 A;  5CR3 A;  5G3L F;  1KNA A;  1QG7 A;  1S40 A;  1EY5 A;  3HOW B;  3SK5 A;  3F8T A;  3UDG A;  1ZYR D;  2JEB I;  5JJI A;  4X64 L;  1XXG A;  4CKC A;  1J5E L;  1SYD A;  3LWU A;  1I94 L;  4QQB X;  3T16 A;  1JB7 A;  4QCL A;  4DV3 Q;  4LF5 L;  3A0J A;  2JA6 B;  1FJG L;  1EY0 A;  1STH A;  3D8G A;  2VL6 A;  3TP7 A;  1R4Q B;  3HOX H;  5IOD A;  4WJ4 A;  4EQ5 A;  1ICW A;  3HOU B;  2A74 C;  4WJW A;  1L2F A;  4DFA A;  2FXQ A;  2EYH A;  5IT9 E;  2JQO A;  3LX0 A;  2QA4 A;  3H15 A;  2Y0S B;  2XTI A;  5M5X H;  1WFQ A;  2F0E A;  3M4P A;  4YWL A;  2K14 A;  3CPW A;  3KDF B;  3CU7 A;  4B9W A;  5C3X A;  3JAM c;  5NUC A;  4AQY Q;  4FF4 A;  4POG A;  4A93 H;  4C3J G;  1IYU A;  3GV6 A;  5JEA J;  1CQV A;  4LW1 A;  3VDY A;  2KEN A;  1CZG A;  1DCZ A;  1UEA B;  4UP7 A;  1QNU A;  1NUC A;  3PSI A;  5CV5 A;  1SRU A;  5ELE A;  3S14 H;  4A4I A;  2F3V A;  1Y1W H;  1JOO A;  1PMR A;  1RL2 A;  2NWG A;  3MHB A;  4LJZ C;  3E5S A;  3MEF A;  1LLR D;  3K57 A;  2IX0 A;  3JAM L;  4B3S L;  5CMD A;  4OWX B;  4KJN A;  2VY3 A;  1DYQ A;  1X32 A;  2YU9 B;  2AWN A;  2RF4 A;  3K8A A;  4R4T A;  1QCB D;  5IYB G;  1PTO F;  3I4M H;  5FLX c;  1JE4 A;  2NZO A;  1YNJ C;  3D0F A;  1H9S A;  1AFP A;  1SYC A;  1YNN C;  4PZ7 A;  4IFD G;  4A3D G;  2IL8 A;  3HOZ G;  4K0K L;  3RLN A;  3EIV A;  3K7A B;  3I4N H;  2LY7 A;  1QVC A;  4Y7N B;  1KXL A;  2H1E A;  2SNS A;  2A69 C;  1PHJ A;  1JJ2 A;  4X62 L;  1PYW D;  3A7L A;  1U4M A;  4JI8 Q;  1QVF A;  3QOL A;  2B63 B;  1I3Q H;  1LTB D;  4DXF A;  5C3E B;  2PPB C;  5EPL A;  5FLX L;  2RHS B;  3CME A;  3J81 E;  4CDD C;  1HQM C;  2I0Q A;  4HTH A;  3ULL A;  3VR4 A;  1B44 D;  2K4K A;  1B8A A;  2AWO A;  4FP5 D;  4PMW A;  3OMG A;  1X65 A;  3FRP B;  1B9N A;  1Q90 A;  1R9T B;  2BDN A;  2JJQ A;  3OWF A;  4DV2 L;  3CCV A;  1Y1V B;  1VQD A;  1U4R A;  1H9S B;  4JG2 A;  3J80 L;  4H44 C;  1K83 B;  3Q0A A;  1YI2 A;  1MJE A;  1DON A;  4JI6 L;  2KUM A;  4L8J A;  2WV6 D;  4WJ3 M;  3STB C;  4LFA L;  4LWC A;  2EY2 A;  3I72 A;  4AIM A;  4EQO A;  4RKL A;  5ELF A;  4PQX A;  4RKB A;  4QUC A;  5KYL A;  2UXC L;  5I9O A;  2UU9 L;  3K81 C;  1BO0 A;  1WTQ A;  1NTG A;  3E9I A;  4GS3 A;  2HIV A;  5EAY A;  4C3H B;  3PUX A;  4ZYS A;  1HNZ Q;  1SYG A;  1CKN B;  3CCR A;  2I5H A;  3I91 A;  3S2D B;  1STN A;  1D8L A;  4BBS G;  4LF8 L;  3M3Y B;  1A3V A;  2F0S A;  2HT1 A;  4POF A;  1XWE A;  3NTI A;  4HSV A;  3UDI A;  1E3P A;  5CV4 A;  1TWG H;  1CA6 A;  1ML0 D;  4IN3 A;  1JC7 A;  4HMI A;  1IBL L;  1U0L A;  3TBI B;  4A3I H;  2N8N A;  1EQQ A;  4OIJ A;  3HOY H;  1PTO B;  4JOI C;  1HNX L;  1VQH A;  2E74 C;  1KDC A;  4NXM L;  3GD7 A;  3I7F A;  3KF6 B;  3BU2 A;  5FK9 C;  5CC4 A;  3W5O A;  3R2I A;  3CD6 A;  2SOB A;  5IWA Q;  3ND8 A;  1RJT A;  2AHO B;  3TRZ A;  3PF5 A;  3L9A X;  3E6Z X;  1CSP A;  1VS0 A;  1X56 A;  3GO5 A;  3HKZ G;  4YY3 L;  1X3G A;  2EY5 A;  1FGU A;  2O5J C;  3MFG A;  1FL0 A;  1D6E C;  1N34 Q;  1SDF A;  1TWA B;  2KHS A;  3K59 A;  2VS1 A;  4K14 A;  3M9B A;  4A3B B;  4QL5 A;  2R92 B;  3QB3 A;  3OTO L;  5HY6 A;  5C4H A;  4MZ9 A;  3RMH A;  4DV7 L;  1SAP A;  3SXH A;  2QF7 A;  4IPD A;  4JI3 L;  1I4Q A;  4FO2 A;  2E5L L;  2NVY H;  2WAQ G;  2VUM G;  3UDX A;  5M3F G;  1EYC A;  4A3G H;  4KD3 A;  3I2Z A;  4GLA C;  3DHQ A;  2KCN A;  1V1Q A;  4JBW A;  2OT2 A;  3KBG A;  4B3S Q;  5JJK A;  2F3I A;  1E24 A;  1QZH A;  3AQQ A;  5J1Z A;  1VQ5 A;  3K5O A;  2WB1 G;  2JYO A;  3A8K E;  5JEA H;  1B9M A;  3FPU B;  4GKK L;  3H6M A;  3OW7 A;  1I6H B;  3I4O A;  4NB3 A;  5EQ0 A;  3CMA A;  5C0X J;  5I6W A;  2OF1 A;  3OHX C;  5ELD A;  2E2J B;  4LF6 L;  3DMU A;  3MXN A;  2HQL A;  1SYB A;  1JOK A;  1CKM A;  2E2H B;  1WTR A;  3TQY A;  2L15 A;  5FKA C;  1K9M C;  2RDG A;  4BY7 G;  1WD1 A;  4KY7 A;  4QIW E;  3OPO A;  5BR8 Q;  5DAU A;  2B29 A;  3S16 B;  2RDH A;  4JI7 Q;  5IGD A;  2MO1 A;  3STB D;  4YWK A;  1A6X A;  5C44 H;  2L9H A;  2F0U A;  1C0A A;  3MXP A;  4O42 A;  3TN2 A;  3S1M H;  2EYF A;  5CBA E;  4O1N A;  3NE5 B;  5BN5 A;  3CP0 A;  5BN3 A;  4DV2 Q;  2MO0 A;  4HIM A;  5LMU L;  4K6L A;  1LTG D;  1TR5 A;  2XVS A;  4EQN A;  3J81 j;  2NTS A;  3NSW A;  4JI6 Q;  1U4P A;  4CDF C;  4J8Q A;  5L37 A;  4JV5 L;  1WTX A;  2Z6B A;  2D2C C;  3MXG A;  3MXN B;  3NEM A;  1EFI D;  3AB9 A;  2UXC Q;  4DNI A;  1O7I A;  1OXX K;  4F88 A;  2L1B A;  1MSH A;  3FKI B;  1FVI A;  4LF7 Q;  4XIG S;  3I55 A;  3RZO B;  2RVL A;  1AE2 A;  1X3P A;  1DOM A;  1I4P A;  4G57 A;  3QO2 A;  4ZLT F;  2O4X A;  4RCN A;  1V1P A;  4A3C H;  1SR3 A;  3HKS A;  3A74 A;  4DV0 L;  1KRT A;  4C2M H;  3GTP B;  4RAU C;  3S17 B;  1YJN A;  5FLM G;  1QWY A;  1N8R C;  4JI5 Q;  1HZB A;  1GOZ A;  1B70 B;  4KK7 A;  5I4D A;  2CW0 D;  3NXW A;  1NNX A;  2Y0S G;  4NMZ A;  1SFO B;  4HCE A;  1YIJ A;  1ENF A;  1HNX Q;  1AP0 A;  3ONA B;  2EXZ A;  1HFG A;  2DJF C;  3ITP A;  1Y14 B;  5AFW A;  4NXM Q;  4A3D B;  1KHI A;  1W3S A;  2Q8T A;  3HOZ B;  2UUC Q;  1RTO A;  1LT5 D;  2HDM A;  4QY7 A;  1PFB A;  1IKM A;  4KY5 A;  4DR3 Q;  1G29 1;  4KKT A;  2ASB A;  2UUA L;  3T4A C;  1UNS A;  4HR7 B;  2H5X A;  3SGI A;  3Q24 A;  1VQJ A;  4YCW A;  1FD7 D;  1BR9 A;  1D5M C;  1JQY D;  1RDP D;  3A7A B;  3F2D A;  1U9R A;  4R9W A;  4I7Z C;  1PFM A;  1X54 A;  5EKK A;  1MI2 A;  3C46 A;  1IL2 A;  2M9V A;  4MHE A;  5D14 A;  4DK6 C;  3MAQ A;  3PUZ A;  1GM5 A;  2VXW A;  3GV3 A;  5ELC A;  1JR0 D;  1N32 L;  5E3F A;  2CH4 W;  4OGQ C;  5IP9 H;  3MA2 B;  4C56 C;  2VQE Q;  4R1J A;  5LMN W;  1EZ8 A;  2K01 A;  2XNA C;  4HMJ A;  3OYY A;  4DR5 L;  4JI4 L;  4DV7 Q;  2FHT A;  2CQA A;  1B4O A;  1VQF A;  1TWC H;  3R93 A;  3UDF A;  5GQO A;  3UI2 A;  1PYB A;  3S15 H;  5JJZ A;  1XX8 A;  3K5L A;  1Z9F A;  3FEW X;  2UXD Q;  4K5X A;  3ERQ A;  1QUQ B;  5D3D A;  1XNQ L;  3AYH B;  4RH6 A;  3GTK H;  2KEC A;  4GN4 B;  1A2T A;  1HA5 A;  2HD3 A;  2IY5 B;  2B63 G;  4A3E H;  1Q3L A;  2ID0 A;  4JI2 L;  2VQF L;  3T1H Q;  1SXT A;  3CKI B;  3P1H A;  3PO2 B;  1TY0 A;  3L2P A;  2XSC A;  4KV6 A;  2R7Z G;  2NYZ D;  4ZUJ A;  4IAL A;  4S3S A;  1TY2 A;  3HOV B;  4IOC A;  2SDF A;  5J22 A;  3K5N A;  3FPP A;  1VDZ A;  2EYL A;  4ZAI A;  4FXG C;  1YEZ A;  1C9O A;  4OIK A;  3RN2 A;  1XJV A;  2X6G A;  1ZYR C;  2E2D C;  2LSS A;  2B2W A;  3IFD A;  1UWV A;  2CFM A;  2HUG A;  3M4O H;  1Y1V G;  1XNR Q;  1BF4 A;  3NWS A;  3MXU A;  1J6Q A;  1A15 A;  1E7Z A;  3SE0 A;  4KHP L;  5FOB B;  4BS9 A;  3KF8 B;  4A3K H;  4BBR H;  3MEH A;  1QJO A;  3D4D A;  2XGT A;  4X65 Q;  4BY1 B;  2YV5 A;  2OCE A;  3PCO B;  5C0X H;  4C3I H;  3GTM H;  1E22 A;  1PRT D;  2IX3 A;  2Q2U A;  1DD2 A;  4OX9 Q;  5LMU Q;  1V9P A;  4C3H G;  2Z9H A;  3M4Q A;  4DR6 L;  1CQF A;  5DM6 3;  2F0V A;  4AYB E;  5EGT A;  2K7V A;  3HKZ B;  3VR2 A;  3CHB D;  1IBM Q;  5JVH 3;  4EX5 A;  5DLQ E;  4JV5 Q;  2JA6 H;  3S24 A;  4B3R L;  1I5F A;  4LFB L;  2ZXR A;  2HHH L;  1H9R A;  2HCC A;  1Q7Y C;  3LNN A;  5J3B A;  4DAV A;  2I07 B;  2F03 A;  2DJG C;  2WAQ B;  3EJI A;  1J8I A;  3PIP A;  5E1F A;  1XMQ L;  4DR1 Q;  4FF1 A;  2QCP X;  3JAM E;  4JC0 A;  3KLS X;  2UUB Q;  4YWM A;  1VMP A;  4UP8 A;  1MIU A;  4IPH A;  2EYO A;  1PH2 A;  4JYA L;  2JA7 B;  3PIO A;  2F4V L;  3E9H A;  2XN9 C;  3SEB A;  1WYD A;  1O7Z A;  4DV4 L;  1DOK A;  5M5W B;  1VCI A;  1FNW A;  1HZ9 A;  4JBJ A;  2IHF A;  1EY8 A;  4LMQ D;  1SYF A;  5LL6 S;  2JA5 G;  4A3B G;  2EY6 A;  3G71 A;  4DR7 L;  3GTG H;  4TRD A;  1B50 A;  2WB1 E;  3OW2 A;  3NTK A;  2G9D A;  5FLX E;  5LMN Q;  2NVQ H;  2A6E D;  1LTS D;  2B2T A;  1G6P A;  3Q22 A;  4OO1 I;  3B6Y A;  3BDC A;  3GTL H;  5M3F H;  1BBU A;  4P2C B;  1EOT A;  1EWI A;  2B2U A;  5FJ8 H;  3J7A F;  4NP5 A;  3L0O A;  1A62 A;  1NAP A;  2LS0 1;  1T5X D;  3BS1 A;  2A8V A;  3J80 E;  3PF4 A;  2PCF B;  2ZXO A;  3I73 A;  1NE3 A;  2V1C C;  3D4W A;  1QE6 A;  2J4X A;  3GQB A;  3S1N H;  1KQS A;  1XPO A;  2EPB A;  2UXB L;  3TP6 A;  1JT8 A;  2QGQ A;  4WOR A;  4DV5 L;  1VQO A;  4DR2 Q;  2PZW A;  1B3Q A;  4K5V A;  4RHR A;  1TXY A;  1XNQ Q;  4GKJ L;  1TS2 A;  3VR5 A;  1VQI A;  2PW7 A;  1ASY A;  3UE1 A;  4DGZ A;  3AEV A;  3TRE A;  3S1Q H;  4A3M G;  2NN6 I;  3CC7 A;  5A35 A;  1WTP A;  1CI3 M;  3R8B A;  3BDO A;  4ZQ3 A;  3BZK A;  1H95 A;  4A93 B;  1P8L A;  2QIL A;  3OIP A;  2JSO A;  1MKH A;  1XTD A;  1G2T A;  2KVM A;  1WCM H;  5IYD G;  3KLS A;  3Q8D A;  3HS0 C;  2PNH A;  4FXK C;  3ZJY C;  2Q8I B;  4WFN 3;  2QEJ C;  2WIN B;  4ZK9 B;  1TS4 A;  3S14 B;  3V96 A;  1SBB B;  1II3 A;  4X66 Q;  2CKZ B;  2F52 A;  3GDE A;  4KHP Q;  5EBC A;  5KNC A;  2NUC A;  2K6A A;  1VQC A;  1ASZ A;  1X6O A;  4K6D A;  3HOW H;  1IHZ A;  3BDL A;  3NWT A;  3LGJ A;  1H9J A;  2L0C A;  2GA4 B;  2KJX A;  1C48 A;  1BQQ T;  1N33 L;  3AFQ A;  4E6I A;  2F0Q A;  4QGU A;  2OQ0 A;  3FKI G;  3H0G G;  4ZCK A;  4BXX G;  2Y0S E;  2MFI A;  5T1I A;  3PMF A;  4DUZ L;  2K5H A;  1PVO A;  2DY7 A;  1K8G A;  3MFY A;  2MJ8 A;  2NZH A;  2B2W C;  2RSN A;  1IBK L;  4OO1 G;  1HRJ A;  1HXY D;  1WTW A;  1UE1 A;  3TSS A;  4LF9 Q;  3CCL A;  2F0W A;  3HOU H;  4TSS A;  2E75 C;  1BUV T;  1ESF A;  4IUP A;  2HHH Q;  1Y8O B;  5FLM H;  1NY4 A;  3AFP A;  2LXK A;  1I3Q B;  2F0P A;  1ET6 A;  2DY8 A;  4FVM A;  3T1Y L;  4IPC A;  4XYQ A;  1CKO A;  3RZD B;  3URY A;  2MQH A;  2N88 A;  2JXM B;  2K05 A;  1XMQ Q;  2JA8 G;  2R6G A;  4KN4 C;  5K36 H;  2RA4 A;  4HJ7 A;  2RBM A;  3L3O C;  4PZ6 A;  1W6K A;  2J0T D;  2LXJ A;  4HCS A;  4L5Q A;  1HQR D;  4N8X 1;  3T53 B;  5IY0 A;  3VYU A;  1S72 A;  3J80 c;  1CSQ A;  1N36 L;  1SEB D;  4J15 A;  2R7Z B;  1HUN A;  2GVA A;  3RD4 A;  2NN6 G;  3VYT A;  4RMF A;  1WTH A;  4RHS A;  1YHQ A;  4GLV B;  2E8G A;  4UAI A;  4DR7 Q;  5FO8 B;  3ND9 A;  2R3Z A;  1S5E D;  3PQI A;  1GO3 E;  4PG3 A;  1BCP D;  5D3I B;  3KJP A;  1MHW C;  3TP5 A;  5EJW A;  2N3S A;  2WKD A;  1AN8 A;  1GUO A;  2FJ2 A;  4TVA B;  1QNK A;  2JP1 A;  5CV9 A;  4YHH L;  3K7A H;  3CCS A;  4Y7N H;  5KEE A;  4RGM A;  3BVM A;  1UAP A;  2BA1 A;  1ONL A;  2F0M A;  3NTH A;  4JBM A;  1TWG B;  3QJY A;  4IJL A;  5ISR A;  4HIO A;  1XTC D;  3CRK C;  2Z6K C;  3I70 A;  4J6H A;  5GAD C;  1TWH H;  4B3M Q;  1BBW A;  3F2U A;  5C3E H;  3HOY B;  3PO2 G;  1CZW A;  4PMC A;  4A3J G;  1L0Y B;  1SMY D;  1ZEQ X;  1IL8 A;  1LT6 D;  1EY6 A;  1M1K C;  3A55 A;  1PZI D;  3HOV G;  4RG1 A;  2ZXP A;  4DV5 Q;  1BDO A;  1H9M A;  1VQM A;  4L5T A;  2B2T C;  2A5H A;  4BA1 I;  1XYI A;  2EYP A;  1PH7 A;  2CH4 A;  3W3A A;  1R9T H;  2NZ1 D;  4L5R C;  1NMF A;  4X64 Q;  3EQL C;  1J5E Q;  2PQA A;  5IP7 H;  5I2Y A;  5IE8 A;  4HSP A;  1LUZ A;  1RTN A;  3K0Y A;  1I94 Q;  1AW7 A;  3J7A V;  1B1Z A;  5GAG C;  2B2U C;  3NP8 A;  2BOS A;  4LF5 Q;  2EY1 A;  1FJG Q;  4DNT B;  4LNQ A;  1SE2 A;  4K2K A;  1HA6 A;  1PDQ A;  2IJ0 A;  3CCJ A;  2CHB D;  3A5Z B;  4BWG B;  1VQA A;  4DV6 L;  4BY1 G;  1KL9 A;  4OXP A;  1EWC A;  4DV1 L;  4B9X A;  2OQK A;  2A19 A;  1VQK A;  3D31 A;  2QKI C;  5CBE E;  3CXC A;  5CYU A;  2CW0 C;  1H9K A;  4IFD J;  4KI0 A;  1VMC A;  4A3G B;  1CM9 A;  3MWY W;  5IYC G;  4A3L G;  2EYJ A;  3MTS A;  1EEI D;  2PYK A;  2Z0S A;  1EFW A;  3EBE A;  1SNQ A;  2PQE A;  2PI2 E;  1Q1E A;  1FYC A;  1ICF B;  1YIT A;  3D4R A;  2F1M A;  2JA5 B;  2K5W A;  1S4Z A;  2OXP A;  1O80 A;  2C35 B;  3GP7 A;  1JJG A;  1WTO A;  3P20 A;  1E2V A;  1V1O A;  4FF3 A;  1PTO H;  4OEL B;  1I50 B;  1GHJ A;  1EIH A;  2AUK A;  2L11 A;  2KHI A;  1IBK Q;  1CK1 A;  3S1R B;  3BZD B;  2ZM6 L;  1TWF H;  4KHV A;  1K73 C;  2NTT A;  1G91 A;  1I4R A;  1K3B C;  1PYS B;  2I5L X;  3VR6 A;  1HNW L;  3H09 A;  4G7Z C;  2C5C A;  1PXU A;  4UHV A;  2JA7 G;  4JI1 L;  1VQP A;  1Q12 A;  2Q2H A;  1K8A C;  4YIJ A;  2B2Y C;  3UE0 A;  2E2I H;  1MJC A;  5HUR A;  1EY7 A;  4RFB A;  3RN5 A;  5D65 A;  4DK1 A;  5C44 B;  1Z6H A;  3BVG A;  3D6C A;  5C4X H;  1KD1 C;  4K0K Q;  3WOE A;  1HTL D;  2F0H A;  1VQG A;  1OXU A;  2R92 H;  1O78 A;  4CBV A;  4X62 Q;  2CCZ A;  1DOL A;  1RHP A;  1B2T A;  2R93 B;  4RGT A;  4A3M B;  1CHP D;  2Q8R E;  2K32 A;  1LTI D;  3U4V A;  2TMP A;  1NSN S;  1L0W A;  1ENC A;  3EFX D;  3CCM A;  1KAA A;  3GTQ H;  1ILQ A;  4ZKC B;  2F0L A;  4YCV A;  5E7N A;  2LKV A;  2I46 A;  5CV8 A;  1MD2 D;  1HR0 L;  3E0J A;  4X6A H;  4X3U A;  2ICI A;  3S2H B;  3I56 A;  4YCU A;  1PZK D;  2VW9 A;  4LFA Q;  3HOX G;  1SNP A;  4YHH Q;  3V05 A;  3CQZ H;  1SND A;  1GUS A;  3GTO B;  5M9O A;  1XMO L;  2UU9 Q;  1PRT C;  1LO5 D;  2DNC A;  2QDB A;  3H0G B;  1J9O A;  5EPJ A;  1FNU A;  4ME5 A;  2BDO A;  3BVZ A;  2K75 A;  1DM0 B;  4KN7 C;  3S16 H;  3H3V H;  3SVM A;  4A93 G;  3IFT A;  3QWN A;  1BVS A;  4LF8 Q;  5JVG 3;  4RA8 A;  3IAY A;  1UE6 A;  4CKB A;  2F0O A;  2K03 A;  2K04 A;  3X3M A;  1UUP A;  4IPG A;  5AJ3 L;  1QVG A;  2I5M X;  1X3F A;  2FMC A;  4NXN L;  1IBL Q;  3KFU A;  5EKL A;  3E3X A;  3DEO A;  1Y1W G;  3FMC A;  1G51 A;  1Z7T A;  1K0S A;  3C1E A;  1M90 C;  4P72 A;  4IUU A;  2JA8 B;  2PZU A;  1JOR A;  3LWE A;  3TDQ A;  4NDX A;  3EVQ A;  1JE5 A;  4C3J H;  1V8Q A;  1EL0 A;  2G5D A;  1SE3 A;  4KMU C;  1L1O C;  3I4M G;  3SK6 A;  1TWC B;  2XRQ D;  2K52 A;  3PO3 B;  2RHQ B;  3RZO H;  4IOA A;  1AEX A;  2B3G A;  2KHJ A;  3RR5 A;  4FYD A;  4HED A;  3CC2 A;  1SJH D;  3I3C A;  2RDF A;  1VQ4 A;  3S15 B;  4YY3 Q;  2EJM A;  1V1P B;  5JPN C;  1BNZ A;  1YHB A;  3I4N G;  4QUF A;  1BKB A;  1EEF D;  1B7Y B;  3M85 A;  3I4L A;  3HGB A;  3DM1 A;  4A3F B;  3A8J E;  4L63 B;  3OTO Q;  4CGY B;  4DUY L;  4A3E B;  5C4J B;  1G2S A;  5IYB H;  4GOP C;  4L6T B;  4JI3 Q;  2A6E C;  2E5L Q;  2K1B A;  1SFO H;  2NVX H;  4KKU A;  1WVL A;  5M5Y B;  4IFD H;  4ABN A;  1JB3 A;  2X6L A;  4A3D H;  2IPK D;  1GUW A;  3HOZ H;  1PH1 A;  2LFN A;  3HFZ B;  4K2L A;  4OON A;  1S5D D;  1JWU D;  1RIP A;  1K8O A;  2SNM A;  1HNW Q;  2EZV A;  4F8M A;  1WOC A;  2KED A;  4JI1 Q;  2RQX A;  5G3L D;  1CHQ D;  3HP3 A;  5LL6 X;  2JEA I;  3ULJ A;  1VQ8 A;  1LAB A;  4X3S A;  2PMZ B;  4GN5 A;  3WOF A;  4HJ5 A;  4GKK Q;  4A3J B;  4A3K B;  4BBR B;  1SSO A;  4LFC L;  1JOQ A;  1D1I A;  2WFW A;  4UY8 C;  1STE A;  3AU7 A;  3NK9 A;  3PGZ A;  4LF6 Q;  1OXS C;  1OXV A;  1D5Z C;  4GN3 B;  4R4O A;  4HAE A;  2NB0 A;  3O13 A;  2KCC A;  4DV3 L;  3CCQ A;  2R7F A;  2EJF C;  1C7Y A;  2WAC A;  3T56 B;  2HCI A;  3NPP A;  1KDB A;  1EQT A;  2ICE C;  1Y8P B;  4MN3 A;  1XPR A;  1SYE A;  1RD9 D;  3H3V C;  2B39 A;  4H02 A;  1I4H A;  4FXD A;  3H94 A;  3HOY G;  1F2Y A;  4LUZ A;  3PO2 H;  5BN4 A;  3T13 A;  4OEM B;  3KLR A;  3U4Z A;  1Q1B A;  5KIX A;  1W6J A;  4DAP A;  1M4V A;  4XTC S;  1SNC A;  1GVP A;  2B8G A;  4IUN A;  3G6J B;  3GTJ B;  4BBS H;  5ELN A;  4KY6 A;  2FFK B;  3C2P A;  2ZJP A;  1R4P B;  4V19 0;  1XMO Q;  5GAH C;  2ZJQ A;  4KLK A;  1EUJ A;  3D6W A;  1OXT A;  3HKZ E;  2A68 D;  2NVT B;  3IL8 A;  5LHY 1;  3N6R A;  1EU4 A;  4DV0 Q;  2KEE A;  3G7L A;  1PTO D;  1A63 A;  1AH9 A;  4J1M A;  3CPF A;  3RLF A;  3GTG B;  3J81 i;  3CAM A;  1LYL A;  1G6Z A;  2O2L D;  4R4I A;  2NVQ B;  1Y69 U;  2PZT A;  1SN8 A;  4A3G G;  2WAQ E;  4ALP A;  4XDX A;  4TQU S;  3ZYY X;  4IUQ A;  3J7Z C;  1O7L A;  4IUR A;  2Z6K A;  4IZ8 A;  4DKA C;  4IO9 A;  1KDA A;  2OTL A;  1EY9 A;  2E76 C;  2HDL A;  1F2M A;  1K28 A;  4C1N K;  4O0A A;  3QIA A;  5M3M B;  2MP1 A;  2UUA Q;  4JI8 L;  1MBY A;  4LF4 L;  5JEA G;  3TZU A;  3NEL A;  2K5Q A;  3CC4 A;  1GUG A;  4DXG A;  5JPM C;  2VUM H;  1D2B A;  1Q82 C;  5COR A;  2IX1 A;  1A3U A;  3DLL A;  1N32 Q;  1JWS D;  2WKC A;  1QOH A;  2K50 A;  2Q2T A;  4BA2 I;  1RCV D;  1VQ9 A;  2YYZ A;  2G9H D;  4O2D A;  2CWA A;  3ER0 A;  4Q0F A;  1CT1 D;  4DR5 Q;  4JI4 Q;  3M4Y A;  1KIX A;  1BCP C;  4K8J A;  2TSS A;  1VQB A;  2A6H C;  5F2D A;  1YBY A;  2IHE A;  5KYI A;  3C3L A;  1JJC B;  2H4O A;  4RWS C;  1JIC A;  3AMU A;  5C44 G;  1VQ7 A;  1U5K A;  3HOX B;  2SEB D;  3BZC A;  5FO9 B;  1IXR A;  1B53 A;  1GXD C;  1HZA A;  1WCM B;  3I8Z A;  4APV A;  4ODG A;  1KC8 C;  2BH8 A;  3HG9 A;  4BY7 H;  4JI2 Q;  2VQF Q;  2R93 G;  1HFN A;  1T9H A;  4DA2 A;  5M5X B;  3OOC A;  1EYA A;  5GRO A;  1TVX A;  3KDF A;  1SMY C;  4R4C A;  4LAA A;  4LFC Q;  4KHZ A;  1STB A;  3H91 A;  2QEX A;  3FHW A;  4H7B A;  4KJO A;  2MNA A;  2D0P A;  3PUV A;  3BJU A;  2B8F A;  1LM0 A;  1KTK A;  3Q23 A;  2DN8 A;  4WRD A;  1E0B A;  3HEJ A;  3TME A;  4CDE C;  2EQS A;  1Y1W B;  3CCU A;  1TS3 A;  4GLX A;  1AZP A;  3MVV A;  3CW2 C;  5IGF A;  4A3C G;  1EYG A;  4IQZ A;  2B2Y A;  4I7A A;  3TP8 A;  1PH3 A;  5HGT A;  4L5S A;  1NR4 A;  2VNU D;  4GNX C;  2RCN A;  1EIG A;  5IWA L;  1OO9 B;  1K0R A;  4N9P A;  3ULP A;  3I4M B;  1KNE A;  2L5T A;  4P75 A;  1PRT F;  1U4L A;  4N8F A;  3CRL C;  1NCV A;  3ICE A;  4DR6 Q;  1C4Q A;  2BE5 D;  1EQR A;  5IGC A;  5C5L A;  5C0X I;  1S5C D;  3E0E A;  4XYO A;  3I4N B;  1N34 L;  1IYJ B;  2FMM A;  4B3R Q;  2AMC B;  1LV9 A;  4LFB Q;  2ATW A;  3J7A 5;  1QZG A;  4KD4 A;  4R8I A;  2OEO A;  1CTM A;  4HID A;  1KAW A;  1LTL A;  1CFM A;  1SE8 A;  2Q2I A;  3D3R A;  5IP9 G;  3RNU A;  1IW7 D;  2DUD A;  1T5E A;  3MZ5 A;  1LTA D;  4JYA Q;  2OTJ A;  4JK1 C;  4Y52 H;  1YJW A;  1EOV A;  4U68 A;  2F4V Q;  3PO3 G;  1FNV A;  1HPC A;  3EN2 A;  3F2C A;  1A8V A;  2ZTD A;  5C6A A;  4N9T A;  3PIP 3;  4DV4 Q;  1F9R A;  4IJH A;  2N78 A;  3CCE A;  1BBX C;  4XT1 B;  1HCZ A;  3DEP A;  3VA7 A;  1YHA A;  4A3F G;  1MGS A;  1I4X A;  2EDG A;  1JWM D;  4A3E G;  1TWH B;  2DGY A;  2JK8 A;  2YU9 H;  1DZ1 A;  2EYM A;  4LF4 Q;  5BR8 L;  2A6H D;  3DWA A;  2L12 A;  4JI7 L;  5A2Q L;  3K80 C;  3PIO 3;  1CKN A;  3RZD H;  4M8A A;  2XRS D;  3C1F A;  2ZJR A;  4JBK A;  3QR8 A;  3KJO A;  1S5B D;  1NBW A;  4OWW B;  4PNY A;  2B63 H;  4A3I B;  3K58 A;  4MNO A;  2F3W A;  5GAE C;  3TS0 A;  4P74 A;  1GHK A;  3WDN A;  1PRT B;  4A3K G;  1L1O A;  3BYY B;  2UXB Q;  4BBR G;  2R7Z H;  2F0F A;  3OSO A;  2J7Z A;  2PI2 A;  3KF6 A;  2MPM A;  5FO7 B;  4GKJ Q;  2RSO A;  3SDZ A;  5C0X G;  4C3I G;  4FNF A;  4B08 A;  4JI0 L;  1ROD A;  3SR1 A;  1ET9 A;  3K7U C;  4ZUI A;  4HIK A;  5IT9 c;  5DEH A;  4LF7 L;  1YNX A;  2F4I A;  1Y1V H;  4JW0 A;  4QJF A;  3M7N A;  2RKS A;  4QF4 A;  1B3A A;  1K83 H;  2KCM A;  2ENB A;  3KYH C;  2F0J A;  4XQQ A;  1PFN A;  4DAM A;  4CKE A;  1PH5 A;  4GOP A;  4TKO B;  2JA6 G;  2KCT A;  1TT2 A;  4CDC C;  2CVR A;  1EQV A;  1EU3 A;  3KK7 A;  1ESR A;  5K5P A;  2VZA A;  2HIX A;  4XT3 B;  4LK1 C;  2B2V A;  4JI5 L;  2QW7 A;  2PO4 A;  5TSS A;  2O5I C;  3NHH A;  4K8I A;  2XWJ B;  4A75 A;  1AE3 A;  4XXE A;  3MC0 B;  2NVY B;  2AUJ D;  1WI5 A;  3P7J A;  5IT9 L;  4C3H H;  2KOL A;  5IGE A;  1L1O B;  2K33 A;  4AYB G;  4HJ8 A;  3P75 A;  3DWQ A;  1M8A A;  3S2D H;  1Q86 C;  2UUC L;  1F9S A;  2L4N A;  1TWF B;  1E1T A;  4XQJ A;  3M3Y H;  4DR3 L;  3HRZ C;  1ENA A;  2OWO A;  2CWP A;  2YTX A;  2JA9 A;  2PQA B;  1N33 Q;  4C1N I;  5C5M A;  2EJG C;  4CJ1 B;  2V4D A;  5I2X A;  4XQN A;  1PFS A;  2E2I B;  1IYV A;  3NQI A;  4DUZ Q;  2EE1 A;  1SRO A;  4HJ9 A;  5C4X B;  3EA6 A;  1G8Z D;  4GOP B;  3PUY A;  4M1U B;  1QB5 D;  3QG1 A;  4F87 A;  1A0I A;  1HJP A;  3NQT A;  3NBH A;  2VQE L;  2XIW A;  2YTY A;  1AZQ A;  1D7Q A;  4GZY C;  1I4G A;  5E4W C;  1PH8 A;  1YNJ D;  2PW5 A;  4EVO A;  1YNN D;  2HQE A;  3F1Z A;  3T1Y Q;  1Q8I A;  3VR3 A;  4FF2 A;  3J81 c;  1GKH A;  2UXD L;  2R61 A;  3A5U A;  2IW3 A;  5FJ8 G;  1NR2 A;  1VF5 C;  3S1M B;  2A69 D;  3GTQ B;  1TWA H;  1LTT D;  5M3M G;  2JA5 H;  4DR4 L;  4A3B H;  1RKN A;  1JMC A;  1I6V C;  3L7Z C;  5EBD A;  3IKJ A;  3T1H L;  1S5F D;  4QIW B;  1GD7 A;  3VA5 A;  4ZKB B;  1N36 Q;  1I50 H;  1PH4 A;  1HTP A;  5C3W A;  1KRS A;  3J81 L;  1O7Y A;  4UPA A;  3S1R H;  3CQZ B;  2XWB B;  4UP9 A;  1TKW B;  1X9N A;  1EIF A;  3NBH B;  1K8M A;  3A54 A;  1EZ6 A;  4OWT B;  1X55 A;  2M00 A;  3DUZ A;  1ZXT A;  4DK0 A;  1LT4 D;  1UE7 A;  1XNR L;  2K5D A;  1YZ6 A;  1Q81 C;  2Z4H A;  1I6H H;  1BCP F;  4I65 A;  4RGN A;  3FP9 A;  3ERO A;  2ZTC A;  3RLO A;  5IGB A;  4X65 L;  4C2M B;  2E2J H;  1KLU D;  1WCM G;  4R4Q A;  2AQ1 B;  1EWH A;  2PNR C;  1IZ6 A;  4G7O C;  2R7D A;  5I6Y A;  1HR0 W;  2F0I A;  2E2H H;  2JN4 A;  3JAM i;  3NEN A;  1HH2 P;  4OX9 L;  4B3T L;  4JCV E;  4NW2 A;  3JC6 6;  2R93 H;  4P73 A;  2MHV A;  4A3M H;  1CA5 A;  4X3K A;  1EYD A;  3DXJ C;  1DGS A;  1S3O A;  1IBM L;  2AQ2 B;  3HOW G;  4C3J B;  4MIU A;  3A8I E;  3DWP A;  2AKW B;  3FVQ A;  4JI0 Q;  1STA A;  5IYD H;  3BG3 A;  3PUW A;  4CJ0 B;  1SJE D;  4IUT A;  3W1B A;  2KBN A;  1PH6 A;  2X69 A;  3SK4 A;  1HUM A;  1P16 A;  3NBI A;  4DR1 L;  4IUV A;  3S2H H;  1LT3 D;  2KQ3 A;  4P71 A;  2UUB L;  3M7G A;  5I9P A;  2A68 C;  3HOU G;  1L0X B;  4DV6 Q;  4G4K A;  4DV1 Q;  1PTO C;  1JCK B;  3NUC A;  4H0L C;  1UEB A;  1QIL A;  4OHJ A;  3GTO H;  2WII B;  2N55 A;  4PZ8 A;  2VB2 X;  3FKI H;  3H0G H;  4R8N A;  4BXX H;  1Q8K A;  2NVX B;  3KBX A;  1STG A;  5JJL A;  4Q5V A;  4DN4 M;  4MTN A;  2K5N A;  2IWH A;  3U50 C;  1TU2 B;  1XPU A;  1MSG A;  5ELO A;  2C9O A;  3VYS A;  3J80 i;  5K36 G;  4OO1 H;  3VYR A;  3U58 A;  4DU9 A;  1QUQ A;  4CHT B;  1CUK A;  2D62 A;  3GTK B;  3GTP H;  3S17 H;  2F0D A;  1BXT A;  1VF7 A;  4FDB A;  5C4Z A;  5LMN L;  1F9Q A;  2MGS A;  5CV6 A;  4EQP A;  4OL7 A;  1UE5 A;  1Z47 A;  2EVB A;  3G4S A;  1VQ6 A;  3U9S A;  4ZRZ A;  2B2V C;  4DAY A;  1BCP B;  5CV7 A;  2JA8 H;  5IGG A;  2ZM6 Q;  1EY4 A;  1E2Z A;  3WWV A;  1VQE A;  3TS2 A;  4K5W A;  3M4O B;  4KTA A;  4ID6 A;  4KKS A;  1PLF A;  5EKI A;  4GNX A;  3PO3 H;  1GUN A;  1YJ9 A;  5H1S E;  1D1K A;  3W1G A;  4PV1 C;  3KF8 A;  4MTK A;  4DR2 L;  2NN6 H;  2ZTE A;  1LAC A;  1F9P A;  2DNE A;  5E4X A;  5EPK A;  4DR4 Q;  1V43 A;  4C3I B;  4A3F H;  3GTM B;  1D5X C;  1TS5 A;  3S9W A;  5C3E G;  5C4J H;  2K28 A;  4AH6 A;  2KA7 A;  3DM3 A;  1HHV A;  2PMZ E;  4DPG A;  2M2L A;  1VQN A;  5M5Y H;  1GUT A;  4DAY B;  1F77 A;  3RUZ A;  3F2B A;  4BBS B;  2LMC B; 
#chains in the Genus database with same CATH homology
 5GRO A;  3CP0 A;  3PO2 G;  3KDF A;  1NMG A;  4DV2 Q;  2MO0 A;  4R4C A;  1Q46 A;  4LFC Q;  4KHZ A;  4HIM A;  1OTC A;  5LMU L;  4A3J G;  5IP7 G;  1M1K C;  2QEX A;  3HOV G;  4RG1 A;  4A3I G;  3PV0 A;  3J81 j;  4DV5 Q;  3FHW A;  1HR0 Q;  4JI6 Q;  2MNA A;  2D0P A;  3PUV A;  4GNX B;  1VQM A;  4L5T A;  1PV4 A;  4BA1 I;  1PH7 A;  3BJU A;  1R9T H;  1VQL A;  1LM0 A;  4X66 L;  4JV5 L;  4L5R C;  1NMF A;  4X64 Q;  4A3J H;  3MXN B;  1SLJ A;  3NEM A;  1J5E Q;  2EQS A;  2PQA A;  5IP7 H;  4AQY L;  5IE8 A;  1LUZ A;  1YVC A;  4NPS A;  1I94 Q;  3HOV H;  3CCU A;  4GLX A;  4DNI A;  2UXC Q;  2JE6 I;  1O7I A;  1OXX K;  4ME3 A;  3CW2 C;  5GAG C;  5IYD H;  4A3C G;  1EYG A;  4LF5 Q;  1FVI A;  4LF7 Q;  4XIG S;  1FJG Q;  1PH3 A;  3I55 A;  4LNQ A;  2BH2 A;  1AE2 A;  4L5S A;  2VNU D;  2D0O A;  4GNX C;  2EIF A;  2RCN A;  1HZC A;  3CCJ A;  5IWA L;  3A5Z B;  1K0R A;  3TEH B;  1PA6 A;  4B3T Q;  3ULP A;  1VQA A;  4DV6 L;  4BY1 G;  1KL9 A;  4OXP A;  4DV1 L;  2A1A A;  2GVB A;  2OQK A;  2A19 A;  2N49 A;  4A3C H;  1SR3 A;  4P75 A;  4LUV A;  1VQK A;  3HKS A;  3A74 A;  4DV0 L;  1KRT A;  3D31 A;  4C2M H;  3ICE A;  4DR6 Q;  3CXC A;  2YTV A;  1YJN A;  3ERS X;  1EQR A;  5FLM G;  4LF9 L;  3CF5 A;  4IFD J;  5C0X I;  4KI0 A;  1N8R C;  3E0E A;  4JI5 Q;  1HZB A;  1B70 B;  1PH9 A;  5IYC G;  4BY1 H;  1N34 L;  4A3L G;  3G6E A;  2Y0S G;  2Z0S A;  1EFW A;  1IYJ B;  3EBE A;  4B3R Q;  2AMC B;  1YIJ A;  5AJ3 Q;  1HNX Q;  3H3V I;  2PI2 E;  4HJA A;  4LFB Q;  1Q1E A;  2ATW A;  3J7A 5;  1QZG A;  4NXN Q;  3G48 A;  1YIT A;  1Y14 B;  4NXM Q;  1KHI A;  1W3S A;  2IT1 A;  5IYC H;  2UUC Q;  4QY7 A;  2K5V A;  4A3L H;  4DK3 C;  2GN5 A;  4DR3 Q;  2C35 B;  4A76 A;  1G29 1;  1W2B A;  2ASB A;  2UUA L;  4HID A;  1JJG A;  3GTJ H;  2H5X A;  3SGI A;  1KAW A;  1N9W A;  1VQJ A;  4YCW A;  1LTL A;  1SE8 A;  2ALY B;  2ES2 A;  2Q2I A;  3F2D A;  5IP9 G;  2KHI A;  1IBK Q;  1X54 A;  3RNU A;  1SMX A;  2CQO A;  1WJJ A;  2ZM6 L;  1IL2 A;  2EXD A;  1TWF H;  2DUD A;  4DK6 C;  1K73 C;  4JYA Q;  3PUZ A;  1GM5 A;  1PYS B;  2I5L X;  2OTJ A;  1HNW L;  1N32 L;  4Y52 H;  1YJW A;  1EOV A;  5C4X G;  2F4V Q;  3PO3 G;  5HGQ A;  5IP9 H;  2JA7 G;  3EN2 A;  4JI1 L;  1VQP A;  3IRB A;  1Q12 A;  2Q2H A;  3F2C A;  1A8V A;  2VQE Q;  4R1J A;  5LMN W;  1K8A C;  2ZTD A;  3OYY A;  3UE0 A;  4DR5 L;  2E2I H;  4JI4 L;  1MJC A;  4DV4 Q;  2NVT H;  4DV7 Q;  2R92 G;  1VQF A;  4IJH A;  2N78 A;  3RN5 A;  3K0X A;  3CCE A;  1TWC H;  3KLW A;  4DUY Q;  5C4X H;  1YHA A;  4A3F G;  1KD1 C;  3UDF A;  2JA7 H;  1NJI C;  4K0K Q;  5GQO A;  1PYB A;  4A3E G;  3S15 H;  1VQG A;  1OXU A;  2DGY A;  1Z9F A;  2JK8 A;  2YU9 H;  2UXD Q;  4LF4 Q;  2R92 H;  5BR8 L;  1QUQ B;  4X62 Q;  2CCZ A;  1XNQ L;  3AYH B;  4JI7 L;  3GTK H;  3K80 C;  4GN4 B;  5M5W H;  1CKN A;  3RZD H;  4LUO A;  4JOI A;  1K3R A;  2IY5 B;  2WP8 J;  2B63 G;  4A3E H;  5M3M H;  2ID0 A;  4JI2 L;  2VQF L;  2ZJR A;  4JBK A;  3T1H Q;  1X3E A;  3KOJ A;  3U4V A;  3L2P A;  4B3M L;  1L0W A;  4IFD I;  3KJO A;  2R7Z G;  3CCM A;  1NBW A;  2BA0 A;  4OWW B;  1HNZ L;  3GTQ H;  2B63 H;  4IOC A;  1E1O A;  1EIY B;  4YCV A;  4MNO A;  5E7N A;  5GAE C;  3TS0 A;  4P74 A;  1YEZ A;  1C9O A;  3RN2 A;  1S40 A;  1HR0 L;  1XJV A;  4A3K G;  2LSS A;  1L1O A;  2UXB Q;  4BBR G;  4X6A H;  2R7Z H;  1UWV A;  2CFM A;  3F8T A;  3UDG A;  3M4O H;  1Y1V G;  3I56 A;  2JEB I;  4YCU A;  2PI2 A;  4X64 L;  3KF6 A;  1XNR Q;  5JJI A;  2VW9 A;  1J5E L;  4GKJ Q;  1J6Q A;  4LFA Q;  1E7Z A;  5C0X G;  3HOX G;  1I94 L;  4QQB X;  4JI0 L;  4YHH Q;  4KHP L;  1JB7 A;  3CQZ H;  3KF8 B;  4A3K H;  4DV3 Q;  3K7U C;  4BBR H;  4LF5 L;  3A0J A;  4HIK A;  5IT9 c;  4LF7 L;  1FJG L;  1YNX A;  4QJF A;  1Y1V H;  2XGT A;  4X65 Q;  2VL6 A;  1XMO L;  2UU9 Q;  3M7N A;  2YV5 A;  2OCE A;  1K83 H;  2KCM A;  3PCO B;  3HOX H;  3KYH C;  4C3I H;  3GTM H;  4WJ4 A;  1E22 A;  4EQ5 A;  4DAM A;  2K75 A;  2Q2U A;  1PH5 A;  3S16 H;  1L2F A;  4GOP A;  2JA6 G;  2KCT A;  4OX9 Q;  5LMU Q;  1V9P A;  2FXQ A;  3H3V H;  3M4Q A;  4DR6 L;  4A93 G;  1BVS A;  2JQO A;  4LF8 Q;  2VZA A;  2HIX A;  4AYB E;  2QA4 A;  3H15 A;  4JI5 L;  2XTI A;  1UE6 A;  5M5X H;  1WFQ A;  1IBM Q;  4A75 A;  1AE3 A;  3M4P A;  4YWL A;  2K14 A;  4EX5 A;  5DLQ E;  3CPW A;  4JV5 Q;  3KDF B;  2JA6 H;  3S24 A;  4B3R L;  4IPG A;  1WI5 A;  4C3H H;  1I5F A;  3JAM c;  5AJ3 L;  4AQY Q;  4LFB L;  4POG A;  1L1O B;  4AYB G;  2I5M X;  4HJ8 A;  1QVG A;  2HHH L;  1X3F A;  4NXN L;  1IBL Q;  4A93 H;  3KFU A;  1Q7Y C;  5J3B A;  3S2D H;  1Q86 C;  5JEA J;  1Y1W G;  2UUC L;  4LW1 A;  1G51 A;  1E1T A;  3VDY A;  1M90 C;  3M3Y H;  4P72 A;  2KEN A;  4DR3 L;  4UP7 A;  3PIP A;  1XMQ L;  4DR1 Q;  3PSI A;  2OWO A;  2CWP A;  2YTX A;  2JA9 A;  2PQA B;  1N33 Q;  4C3J H;  1JE5 A;  4JC0 A;  1SRU A;  3S14 H;  4A4I A;  1PFS A;  2UUB Q;  1Y1W H;  1L1O C;  4YWM A;  1RL2 A;  3I4M G;  4UP8 A;  3MEF A;  1MIU A;  4DUZ Q;  2IX0 A;  4IPH A;  1SRO A;  4HJ9 A;  2K52 A;  4B3S L;  1PH2 A;  2RHQ B;  3RZO H;  4IOA A;  4GOP B;  4JYA L;  3PUY A;  2B3G A;  2KHJ A;  3RR5 A;  4OWX B;  3PIO A;  3CC2 A;  2F4V L;  1VQ4 A;  2VY3 A;  1A0I A;  1HJP A;  3E9H A;  4YY3 Q;  2AWN A;  2RF4 A;  3K8A A;  4R4T A;  5IYB G;  1WYD A;  3I4M H;  1YHB A;  5FLX c;  2VQE L;  3I4N G;  2NZO A;  1BKB A;  1B7Y B;  2YTY A;  3D0F A;  3M85 A;  4DV4 L;  1D7Q A;  1VCI A;  4JBJ A;  1HZ9 A;  1PH8 A;  4PZ7 A;  2IHF A;  3OTO Q;  4IFD G;  4DUY L;  2JA5 G;  4A3B G;  4A3D G;  3F1Z A;  3T1Y Q;  3G71 A;  5IYB H;  3HOZ G;  3RLN A;  3J81 c;  4GOP C;  4DR7 L;  3EIV A;  3I4N H;  4K0K L;  4JI3 Q;  1GKH A;  1QVC A;  3GTG H;  2E5L Q;  1KXL A;  1SFO H;  2NVX H;  3A5U A;  2WB1 E;  1PHJ A;  2UXD L;  3OW2 A;  1JJ2 A;  4X62 L;  5LMN Q;  2NVQ H;  5FJ8 G;  1G6P A;  4JI8 Q;  4OO1 I;  3B6Y A;  1TWA H;  5M3M G;  1QVF A;  3GTL H;  2JA5 H;  4DR4 L;  4A3B H;  4A3D H;  5M3F H;  1I3Q H;  1JMC A;  3HOZ H;  3L7Z C;  1BBU A;  1PH1 A;  3HFZ B;  4OON A;  2RHS B;  3T1H L;  1RIP A;  3CME A;  1HNW Q;  2I0Q A;  1EWI A;  3ULL A;  1GD7 A;  1WOC A;  2K4K A;  5FJ8 H;  1B8A A;  1N36 Q;  3L0O A;  4JI1 Q;  1I50 H;  2AWO A;  1A62 A;  1PH4 A;  4PMW A;  2JEA I;  3ULJ A;  1VQ8 A;  1KRS A;  2A8V A;  1X65 A;  4GN5 A;  4HJ5 A;  4GKK Q;  4UPA A;  3S1R H;  3PF4 A;  4UP9 A;  1NE3 A;  2V1C C;  2JJQ A;  1X9N A;  4DV2 L;  1EIF A;  3CCV A;  3S1N H;  3NBH B;  4LFC L;  1KQS A;  1XPO A;  1VQD A;  2UXB L;  2WFW A;  4JG2 A;  4OWT B;  4UY8 C;  1X55 A;  3PGZ A;  1UE7 A;  4LF6 Q;  1YI2 A;  1MJE A;  1XNR L;  1JT8 A;  2QGQ A;  4DV5 L;  1OXS C;  1VQO A;  4JI6 L;  1OXV A;  4DR2 Q;  4WJ3 M;  3STB C;  1YZ6 A;  1TXY A;  4LFA L;  4LWC A;  1Q81 C;  4GN3 B;  1XNQ Q;  4R4O A;  4GKJ L;  4AIM A;  1I6H H;  1VQI A;  1ASY A;  3UE1 A;  4DV3 L;  3CCQ A;  3FP9 A;  2R7F A;  3AEV A;  2ZTC A;  1C7Y A;  3RLO A;  3TRE A;  3S1Q H;  2UXC L;  4X65 L;  2UU9 L;  4A3M G;  3K81 C;  2E2J H;  1WCM G;  4R4Q A;  2NN6 I;  3CC7 A;  1IZ6 A;  1NTG A;  3E9I A;  2R7D A;  4GS3 A;  1HR0 W;  2HIV A;  5EAY A;  2E2H H;  3PUX A;  3BZK A;  3JAM i;  3NEN A;  1HNZ Q;  1H95 A;  1HH2 P;  1P8L A;  1CKN B;  4OX9 L;  3CCR A;  4JCV E;  4B3T L;  1MKH A;  1XTD A;  3JC6 6;  1XPR A;  2R93 H;  2I5H A;  4P73 A;  4H02 A;  4A3M H;  1D8L A;  4BBS G;  1WCM H;  5IYD G;  4LF8 L;  3HOY G;  3Q8D A;  1DGS A;  1S3O A;  2PNH A;  2HT1 A;  4LUZ A;  3ZJY C;  4POF A;  1IBM L;  3PO2 H;  3HOW G;  3UDI A;  1E3P A;  3U4Z A;  1Q1B A;  1TWG H;  2AKW B;  4XTC S;  1IBL L;  1GVP A;  4BBS H;  1U0L A;  4X66 Q;  2CKZ B;  2F52 A;  3GDE A;  2N8N A;  4A3I H;  1EQQ A;  4JI0 Q;  4KHP Q;  3HOY H;  3PUW A;  4JOI C;  5ELN A;  1HNX L;  1VQC A;  1ASZ A;  1X6O A;  1VQH A;  3HOW H;  3W1B A;  2ZJP A;  2KBN A;  3LGJ A;  1XMO Q;  5GAH C;  2ZJQ A;  1PH6 A;  4NXM L;  3GD7 A;  3I7F A;  1P16 A;  3KF6 B;  4DR1 L;  3S2H H;  4P71 A;  1N33 L;  3AFQ A;  3BU2 A;  4KLK A;  4QGU A;  2OQ0 A;  3FKI G;  3H0G G;  3W5O A;  2UUB L;  3CD6 A;  1EUJ A;  4BXX G;  5IWA Q;  1OXT A;  2Y0S E;  2MFI A;  3HKZ E;  3HOU G;  4DV6 Q;  4DUZ L;  4DV1 Q;  2AHO B;  2K5H A;  3TRZ A;  1PVO A;  1K8G A;  2NZH A;  1UEB A;  3PF5 A;  3GTO H;  1IBK L;  4DV0 Q;  1A63 A;  4OO1 G;  1CSP A;  1VS0 A;  1AH9 A;  3CPF A;  4PZ8 A;  3RLF A;  3FKI H;  3H0G H;  3J81 i;  4BXX H;  1UE1 A;  1Q8K A;  1X56 A;  3GO5 A;  3CAM A;  3HKZ G;  4YY3 L;  3CCL A;  4LF9 Q;  1X3G A;  5JJL A;  1FGU A;  4MTN A;  2K5N A;  1LYL A;  3HOU H;  4R4I A;  1FL0 A;  3U50 C;  2HHH Q;  1SN8 A;  1XPU A;  1N34 Q;  5ELO A;  5FLM H;  2WAQ E;  4A3G G;  2VS1 A;  1NY4 A;  3M9B A;  3AFP A;  2LXK A;  4QL5 A;  4TQU S;  3J80 i;  4ALP A;  5K36 G;  3OTO L;  3J7Z C;  5HY6 A;  3U58 A;  4MZ9 A;  1QUQ A;  3T1Y L;  4IPC A;  1CKO A;  1CUK A;  2D62 A;  2Z6K A;  4DKA C;  4DV7 L;  4IO9 A;  2OTL A;  3GTP H;  4IPD A;  3S17 H;  4JI3 L;  2MQH A;  1XMQ Q;  2E5L L;  2NVY H;  2WAQ G;  4O0A A;  2JA8 G;  2VUM G;  3UDX A;  2R6G A;  5M3F G;  4A3G H;  4FDB A;  5LMN L;  2UUA Q;  3I2Z A;  4JI8 L;  4GLA C;  4HJ7 A;  4PZ6 A;  1V1Q A;  2LXJ A;  4JBW A;  4LF4 L;  5JEA G;  1UE5 A;  1Z47 A;  3G4S A;  1VQ6 A;  4L5Q A;  4B3S Q;  3NEL A;  5IY0 A;  1S72 A;  5JJK A;  3CC4 A;  3J80 c;  2VUM H;  2JA8 H;  2F3I A;  1E24 A;  1Q82 C;  2IX1 A;  2ZM6 Q;  1CSQ A;  3AQQ A;  1QZH A;  1VQ5 A;  1N36 L;  2WB1 G;  3WWV A;  4J15 A;  3DLL A;  1VQE A;  3TS2 A;  1N32 Q;  2K50 A;  2Q2T A;  4GKK L;  2GVA A;  4BA2 I;  3I4O A;  2NN6 G;  1VQ9 A;  2YYZ A;  4NB3 A;  4RMF A;  4O2D A;  2CWA A;  3ER0 A;  4GNX A;  4GLV B;  3CMA A;  4DR5 Q;  1YHQ A;  4JI4 Q;  5C0X J;  2E8G A;  1KIX A;  3PO3 H;  1YJ9 A;  5H1S E;  4DR7 Q;  3W1G A;  1VQB A;  4LF6 L;  1YBY A;  2HQL A;  4PG3 A;  1GO3 E;  2IHE A;  1JJC B;  4DR2 L;  1CKM A;  3KJP A;  3TQY A;  2ZTE A;  2L15 A;  5C44 G;  1K9M C;  1VQ7 A;  1U5K A;  4BY7 G;  2N3S A;  4DR4 Q;  3BZC A;  1V43 A;  1IXR A;  4A3F H;  4QIW E;  5BR8 Q;  1HZA A;  4TVA B;  2B29 A;  4APV A;  5C3E G;  5C4J H;  4JI7 Q;  4YHH L;  1KC8 C;  2BH8 A;  2MO1 A;  3K7A H;  3STB D;  4AH6 A;  3CCS A;  4YWK A;  3DM3 A;  4Y7N H;  5C44 H;  2PMZ E;  4DPG A;  2BA1 A;  1C0A A;  4JBM A;  4BY7 H;  4JI2 Q;  2VQF Q;  1VQN A;  2R93 G;  5M5Y H;  4IJL A;  4DAY B;  4HIO A;  1T9H A;  3S1M H;  2Z6K C;  3F2B A;  5GAD C;  1TWH H;  4B3M Q;  1BBW A;  5C3E H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...