4A3IH

Rna polymerase ii binary complex with dna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 20
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3iH00
2UU9Q 2VUMG 2AHOB 4A3EG 1YI2A 4LF6Q 1UE1A 4P75A 1OTCA 4NXML 4WJ4A 4DV6Q 4DR1L 4ME3A 4JYAL 4RG1A 2JE6I 4KHPQ 1E3PA 4POGA 3HOWH 4GN5A 4L5TA 4QJFA 3UDXA 1VQ5A 3A5ZB 4NXNQ 3J81j 1YZ6A 1XMOQ 4L5QA 3FKIH 2JA5G 4JG2A 1PV4A 1VQ9A 4BY1G 5M3MG 4DV7Q 4BY7G 2K50A 3PF5A 3J80i 4A3LH 4UY8C 1WYDA 4DR5Q 4X64Q 4AYBG 4OO1G 2VZAA 2UUCQ 3G48A 5IP9G 2NVXH 1VQLA 3HOVG 3KFUA 2KHIA 4PMWA 3RN2A 2EXDA 4HIKA 2CCZA 3ULLA 3J7A5 1K0RA 1NTGA 4LF7L 4GKKQ 3F2DA 1QVGA 2OQKA 3G71A 2AKWB 1VQEA 4DPGA 1NJIC 4X62Q 4JOIC 4A3JH 3S16H 4IOAA 4IPGA 4LFBL 1W3SA 4DV2Q 5IWAQ 2R92H 3H3VI 1VQDA 4X65L 2KBNA 3CCVA 2XGTA 1E24A 1TWFH 4IJHA 1EQQA 1Q8KA 1HNXL 4DV4L 3GDEA 5GROA 3U50C 1Y14B 4OWXB 4B3RL 1I94Q 1Q7YC 4O0AA 1VQFA 2D0OA 1T9HA 4YCVA 1VQBA 1WCMG 3HOYH 2Q2HA 4A3CH 1BBUA 1P16A 5GAHC 1B70B 3CCUA 3CMEA 4DK6C 1HNWL 3KYHC 2KHJA 4LF9L 3I4MH 1B7YB 2IHFA 5HGQA 1YITA 3L0OA 4PZ7A 4DR7Q 1N36Q 1VQHA 4Y7NH 3ULJA 3A74A 4NPSA 3T1YQ 1BBWA 3PUZA 1Q86C 1I6HH 1L1OB 3UDGA 4A3DG 1CSPA 4JOIA 1D8LA 2CWPA 1PH5A 1CKOA 4DV5L 2UXDQ 2AWOA 4KI0A 3CCSA 1VQCA 1WOCA 4R4TA 1GO3E 4B3MQ 1SRUA 1KAWA 3KOJA 4A3FH 1VQNA 1UE6A 1LUZA 4DUYQ 2YTYA 3HOVH 4JBWA 4R4OA 4UP9A 3M9BA 1NBWA 4OX9L 2R7ZG 4IPCA 3F2BA 4AYBE 2A19A 1SFOH 1I94L 3GTMH 4DR4L 1K83H 5AJ3Q 1EOVA 4LFCL 3CC4A 1M1KC 3G4SA 1QZGA 4JI0L 2OWOA 5FLXc 1XNQL 2IHEA 4IFDJ 2NZHA 4DV3L 2NZOA 2ZJRA 1PA6A 4DV3Q 1C0AA 4JI7L 3NENA 4GKKL 1L1OA 2WAQE 4DR3L 1JJ2A 1SMXA 3BJUA 2K75A 4R4IA 3CXCA 4GKJL 1MJEA 4LFAL 2RCNA 1PYSB 1WFQA 2MFIA 4XIGS 3FP9A 4DK3C 3I4NG 1RIPA 3JC66 4JI6Q 4A3FG 1SE8A 4YY3Q 1YBYA 3KDFB 4B3ML 1QUQB 3PIOA 4DNIA 3STBD 4DV1Q 1VQ4A 1PYBA 1EYGA 4JI6L 4P72A 5ELOA 2ZJQA 3S15H 1EFWA 2K14A 5IYCH 4R1JA 1MKHA 4B3TL 3ULPA 3W1GA 3S1NH 2WB1E 4IJLA 3HOZH 4QY7A 4GKJQ 2I5HA 3DLLA 3CCRA 2Q2IA 2BA0A 4JYAQ 2N8NA 2BH8A 4A3CG 1JMCA 1YJWA 4JBMA 1HNZL 3HOUH 2ASBA 2B3GA 3KF8B 4B3TQ 1L1OC 4DR2L 1PFSA 1XMQL 4EQ5A 5M3MH 1IBLQ 3GTLH 4JI0Q 4BBSH 2NN6G 1TWHH 2VY3A 3TEHB 4JI3Q 4JI5Q 1U5KA 1C9OA 1NE3A 4DR4Q 3VDYA 2UXBQ 2MQHA 4RMFA 4A3IG 2CKZB 1VQMA 1QUQA 1ASYA 4PZ6A 1HH2P 2E2HH 3PUXA 4A3LG 1G291 3CQZH 2VQEL 4A3MG 3H3VH 4DUYL 4LFBQ 3RLFA 4DKAC 1B8AA 1X3GA 3BZCA 3EN2A 5K36G 2E2JH 1XPRA 5J3BA 5IYDG 4AQYL 3HOXG 5H1SE 4FDBA 5GAGC 1HR0W 4DAMA 2A1AA 4DUZL 3U4VA 2RHSB 2K5HA 1K3RA 1N36L 2JJQA 2JA5H 3HOUG 4DR7L 1WI5A 3KJOA 2F3IA 3TREA 4WJ3M 1N32L 1VQJA 4JI2L 1A62A 1OXTA 4YWLA 5M5WH 2CWAA 3G6EA 4LF5L 4A3EH 5JJLA 2ID0A 1YVCA 1VS0A 2UXCL 1UEBA 4OONA 1QVCA 2DGYA 3TQYA 2ATWA 1Z9FA 2QA4A 2YU9H 2KENA 1A0IA 4GN3B 4IPHA 3TRZA 4A3IH 4A3BH 1NY4A 1I5FA 4KHPL 5JJIA 5IE8A 3K7AH 3ZJYC 1U0LA 1VQPA 4JI8L 2HQLA 3GTQH 4UPAA 1X65A 2UU9L 5IWAL 2F4VL 3OTOQ 4A3DH 4BBSG 1CKNA 1V43A 4HJ7A 5C4XG 1JB7A 4LFCQ 2CFMA 4A3KH 3L7ZC 1K8GA 5LMNW 1AE2A 3H15A 1YHBA 1FJGQ 2FXQA 4P74A 2C35B 4ALPA 3U58A 2UUCL 1UWVA 1S72A 2JA7G 3MEFA 1IBKQ 2Q2TA 3I4OA 4DR5L 3E0EA 5C0XJ 1VCIA 3K0XA 4LF5Q 2Y0SG 3CD6A 1N34L 4GOPB 3JAMc 2A8VA 4DV5Q 2PNHA 4XTCS 4AIMA 2ZJPA 1J5EQ 1W2BA 5JJKA 1CKMA 2GN5A 1JE5A 2JK8A 3E9HA 1EIYB 4HJ5A 2JEAI 1YHAA 5C4JH 4HIOA 3SGIA 3S17H 4LF4L 4K0KQ 1PH3A 3HKZG 4IPDA 2HHHQ 1X3FA 1HNWQ 1Q1EA 3LGJA 3T1HL 4GNXB 4HIDA 5M5XH 2HT1A 5IP7H 3S1MH 1Y1VH 2VW9A 4GLAC 3W5OA 1N8RC 3J81i 1KXLA 4OWWB 2R93G 1Q46A 3D0FA 1XJVA 2IY5B 1HJPA 1IZ6A 2V1CC 5C0XI 3HKSA 2B63H 5IYCG 2E5LL 2JA7H 3K80C 3HOYG 3EBEA 4BXXG 4X65Q 4HJ8A 1YJNA 3HOZG 1WJJA 4QIWE 4YCWA 1N9WA 1PH4A 3FKIG 5GADC 2IT1A 4B3SL 1XMQQ 5JEAJ 4IFDG 1VQ6A 4DR2Q 5LMNQ 2E2IH 3T1HQ 3I7FA 3F1ZA 3NBHB 2ES2A 2EIFA 3K81C 5BR8Q 4JV5L 3PGZA 4JI4Q 4L5RC 1UE5A 1Y1WG 3RNUA 1KC8C 3PIPA 4QQBX 1KQSA 3PV0A 3J81c 3I4NH 1NMGA 4YY3L 4IOCA 2UUBQ 3MXNB 1L2FA 1C7YA 1Z47A 4R4CA 1IBKL 2GVAA 2AWNA 3STBC 1S40A 4P71A 1IYJB 1V9PA 4A76A 3CAMA 1FJGL 4NXNL 4UP8A 5FLMH 1PH9A 3UE0A 4A93G 4YHHQ 2KCMA 1XPOA 2MNAA 3J7ZC 4X6AH 4JV5Q 1VQAA 5BR8L 1PH1A 2XTIA 4NXMQ 3M4OH 1SN8A 1HZCA 4X66L 1X54A 4LUVA 4J15A 3HKZE 4EX5A 4BBRG 3UDIA 2R7ZH 3M3YH 4JI8Q 2B63G 3IRBA 1X56A 2UXBL 4C3HH 4Y52H 2NN6I 1XNRQ 4DR6Q 3I55A 1LTLA 1E22A 1P8LA 3ERSX 5C44H 1Q82C 1K9MC 2PQAA 2Y0SE 4GLVB 1H95A 3CCLA 3ICEA 3K7UC 3U4ZA 1SROA 5FJ8G 5DLQE 1E7ZA 1L0WA 2VQFL 3S24A 1Q81C 1VQ7A 2HHHL 2WP8J 2K5VA 2I0QA 4LF4Q 4K0KL 4LUOA 1PVOA 2ZTDA 1A63A 4C2MH 1YNXA 4IFDI 4GS3A 4DUZQ 1SR3A 1WCMH 3S1QH 4TVAB 1GM5A 2ZTCA 1EWIA 1J5EL 1XPUA 2NVYH 3GO5A 2UUAQ 5E7NA 1FVIA 4A4IA 3M4PA 3S1RH 1BKBA 2VL6A 3BU2A 4YCUA 1VQKA 4LF9Q 3AEVA 3PO3G 3GTJH 5FJ8H 1YIJA 3S2HH 5LMUQ 4A3GH 2VUMH 3NEMA 1R9TH 5FLMG 1MJCA 2I5MX 1G51A 2R7DA 4LFAQ 3CF5A 3M7NA 1X6OA 2MO0A 1VQGA 2YYZA 4BA2I 1X55A 1SLJA 2I5LX 1GVPA 2LXJA 2PQAB 2QGQA 3BZKA 4JI3L 4DV4Q 4HIMA 5IY0A 1I50H 4DR3Q 1ASZA 2OTLA 4LF8Q 4GLXA 1J6QA 3UDFA 1IBLL 1KIXA 1LYLA 3E9IA 4X62L 1CUKA 4YWKA 1HNZQ 3F2CA 2K4KA 4LF8L 4KLKA 1V1QA 4BBRH 3I56A 5AJ3L 2LSSA 4C3JH 1TXYA 2ZM6L 3A5UA 3HOXH 1QZHA 2YV5A 3A0JA 1VQOA 2VS1A 2N49A 2JQOA 2B29A 4GNXC 1VQ8A 2CQOA 4X64L 3JAMi 4DV1L 5LMUL 3HFZB 1JT8A 3W1BA 4OXPA 2R6GA 2JA6H 4L5SA 3AYHB 3RN5A 2NVTH 2IX0A 5C0XG 1CSQA 2YTVA 1YHQA 1TWGH 1HZAA 4TQUS 3B6YA 5IYDH 3GTKH 3ER0A 1TWAH 5JEAG 5EAYA 5C3EG 2ZM6Q 4QL5A 1N33L 3T1YL 1KHIA 4DV0Q 1IBMQ 2UUBL 1E1TA 4AQYQ 1Y1WH 4JI4L 4JBKA 3Q8DA 5C44G 4DV6L 5IYBG 2K52A 4LW1A 1Q12A 1PH6A 4JI7Q 4LF6L 3PUVA 4A3GG 2PI2A 4A3MH 2IX1A 3AQQA 3H0GG 4DAYB 5M3FG 3CCJA 1N32Q 2VQEQ 1G6PA 1XNQQ 3I4MG 2L15A 2OQ0A 1UE7A 2K5NA 1FGUA 1HR0L 3CC2A 1VQIA 2WB1G 2JA8H 4DR6L 3M85A 2MO1A 1TWCH 5ELNA 3RLNA 4IO9A 1HNXQ 1KD1C 1PH8A 3KDFA 4OX9Q 2EQSA 1FL0A 1OXSC 3CW2C 3PUYA 4DV2L 2OCEA 3OYYA 1AE3A 2VNUD 1GKHA 4X66Q 2YTXA 4BY1H 4JBJA 1PH7A 1HZBA 3KLWA 1K8AC 2NVQH 3PO2G 1EIFA 1IXRA 2GVBA 3D31A 4A3KG 4PZ8A 2UUAL 2PI2E 4LF7Q 4A93H 3FHWA 4POFA 1O7IA 4DV0L 1IBML 3S14H 1D7QA 3CMAA 2WAQG 5GAEC 2N78A 3WWVA 1DGSA 4JI1Q 2Z6KA 3CCMA 3TS2A 3S2DH 5IYBH 1AH9A 1N34Q 2WFWA 5IP7G 3PO2H 1N33Q 2KCTA 1LM0A 3GTPH 1K73C 1XMOL 3PF4A 3NELA 5IP9H 3PCOB 2Z0SA 3EIVA 2JA8G 2RF4A 1JJCB 2PMZE 5C3EH 4P73A 2QEXA 3GTOH 4DR1Q 1Q1BA 3CCEA 4GN4B 3OW2A 2ZTEA 3H0GH 2Q2UA 4LUZA 4BXXH 4NB3A 4KHZA 4R4QA 5LMNL 1QVFA 1BVSA 4GOPC 3M4QA 1XTDA 1Y1VG 2E8GA 2LXKA 3OTOL 1RL2A 3CPWA 2HIVA 4MZ9A 5IT9c 3CCQA 1X9NA 1EQRA 3PSIA 3HOWG 4LNQA 2E5LQ 3CP0A 4C3IH 3KJPA 1CKNB 4HJAA 4YHHL 2R93H 3AFQA 1NMFA 2ALYB 2OTJA 2D0PA 1OXVA 5M5YH 4GOPA 4MNOA 1KRSA 1MIUA 4BA1I 2H5XA 3UE1A 2UXCQ 3TS0A 4LWCA 3I2ZA 2DUDA 4PG3A 1YJ9A 3KF6B 4MTNA 4YWMA 4QGUA 1M90C 5M3FH 4DV7L 4JI2Q 1GD7A 1A8VA 4A75A 2F52A 2D62A 1OXXK 2N3SA 2UXDL 1IL2A 2BA1A 4JI1L 1KL9A 5GQOA 3RLOA 3DM3A 1PHJA 1X3EA 3K8AA 2JA9A 1JJGA 4OO1I 2HIXA 3AFPA 3GD7A 5HY6A 4JC0A 4UP7A 4OWTB 3F8TA 2VQFQ 2RHQB 4A3JG 3PUWA 1I3QH 1EUJA 4H02A 3RZDH 3L2PA 3J80c 5C4XH 4O2DA 4BY7H 2F4VQ 1S3OA 1YEZA 4B3SQ 4APVA 3CPFA 1OXUA 2R92G 3RR5A 2JEBI 1HZ9A 1KRTA 4GNXA 1XNRL 3CC7A 4B3RQ 2AMCB 4JCVE 4JI5L 4HJ9A 1PH2A 3KF6A 2BH2A 4A3BG 1HR0Q 4AH6A 2JA6G 3RZOH 3PO3H 2Z6KC 3GTGH 2R7FA 1E1OA
chains in the Genus database with same CATH superfamily
2VUMG 1WVLA 1YI2A 4NXML 4DV6Q 3TP6A 4RG1A 2JE6I 1E3PA 3EFXD 1TU2B 2G5DA 1I4PA 2KVMA 3HP3A 1H9SB 1YZ6A 3MXNA 1ET6A 2RDFA 2DN8A 1RHPA 1ENCA 2F0SA 2K33A 3J80i 4UY8C 1WYDA 1T5EA 4B9XA 3RUZA 3MXGA 4AYBG 2VZAA 2UUCQ 3G48A 3I91A 5EQ0A 1VQLA 4IURA 3J7A5 4HN7A 4MIUA 3F2DA 1QVGA 2AKWB 4A3JH 3H0GB 4YIJA 3C2PA 1HRJA 4ODGA 2KBNA 2Q8RE 1BDOA 3X3NA 5LL6X 3U50C 1Y14B 4OWXB 1EY7A 2B2YA 1I94Q 1ZKOA 3GTKB 1BR9A 4YCVA 3VR3A 3U9SA 4A3KB 2LMCB 2Q2HA 4I7ZC 1B9NA 1RCVD 4DK6C 1GUSA 4LF9L 4A3DB 3HOUB 5HGQA 4DR7Q 3K5LA 1YITA 1N36Q 3ULJA 1BBWA 2LKVA 5C3EB 1I6HH 1HFNA 2WB1B 4PQXA 1JWSD 1CHQD 2HDLA 1CSPA 2EYPA 2UXDQ 1VQCA 1NSNS 5BN3A 2Z6BA 3ITPA 1UE6A 4PMCA 4DUYQ 4R4OA 3M9BA 3MEHA 1IW7D 1NBWA 5I6YA 3F2BA 4AYBE 3TZUA 1A3TA 1SFOH 3GTMH 2B2VA 5AJ3Q 1EOVA 3I90A 3T4AC 2OWOA 2NZHA 4C1NI 1LO5D 2NVYB 3HOZB 1SMXA 3BJUA 4C2MB 4V190 4ID6A 1JORA 1WFQA 4DK3C 5LL6S 1RIPA 4IUTA 5TSSA 1SE8A 5KGUA 4YY3Q 3KDFB 1B1ZA 1UAPA 1Y8OB 4A3FB 2ZJQA 2K14A 1MKHA 3S1NH 2WB1E 3HOZH 4HCSA 2EDGA 3V05A 2I5HA 4G7HC 4CJ2C 4M1UB 4Q5VA 2R7ZB 4JYAQ 2B2WA 1JMCA 1HUNA 5L37A 1XMQL 4RHRA 3BVGA 1IBLQ 3GTLH 4BBSH 2Q8IB 5EPKA 1TWHH 4JI3Q 1NE3A 2NVXB 3VDYA 2MQHA 4RMFA 4A3IG 3E0JA 1CZGA 1C48A 3PUXA 1G291 4A3GB 3RLFA 1ZEQX 1RD9D 2A68C 3A8JE 3EN2A 5J3BA 1STGA 4J6HA 5GAGC 3PMFA 4G4KA 1K3RA 4DGZA 1N36L 4RCOA 1AZQA 1EEFD 2JXMB 2JA5H 2BDOA 2F3IA 4WJ3M 1VQJA 1A62A 2QDLA 5C44B 2A6ED 3OIPA 4OONA 3S1RB 5AFWA 1VDZA 3D8GA 2ATWA 3KBXA 4DK0A 3A7AB 1LTRD 3K7AH 3ZJYC 1VQPA 4JI8L 3HOWB 4UPAA 1EY0A 4K5XA 4BBSG 4HJ7A 5G3LF 5C3WA 4IUNA 3VR6A 3OOCA 3HOYB 1HQRD 2A69C 3A54A 3H15A 2XVSA 4P74A 5JJZA 1AP0A 2UUCL 2JA7G 1S72A 1LTID 3DEOA 1IBKQ 3I4OA 4LF5Q 2BDNA 4GOPB 2SNSA 4AIMA 5LHY1 1J5EQ 4BS9A 1S5BD 1G91A 1VF5C 1JE5A 1MBYA 1YHAA 5DM63 5KNDA 2K1BA 4K0KQ 5EBCA 2F0DA 2FMMA 3PO3B 1Q1EA 2FJ2A 4KKSA 2QILA 2VW9A 4GZYC 2B2UC 3W5OA 1KXLA 1V1OA 3J7AV 3R3OA 2R93G 4H7BA 1XJVA 3MVVA 4FYDA 4C3IG 3HKSA 5D65A 1EY5A 1CZWA 2E5LL 3EBEA 3P1HA 3FEWX 5E1FA 4X65Q 3HOZG 1WJJA 3AB9A 1N9WA 4A3EB 1PH4A 2IT1A 1XMQQ 1QILA 2ES2A 4ZKCB 5T1IA 5COYA 2X6LA 3R2TA 1JOKA 1S5FD 2F0MA 4DK1A 3NBHA 4ZUJA 4A93B 3TMEA 3PIPA 2WIIB 4NW2A 1SYFA 1V1PA 3R93A 4H44C 4YY3L 4RKBA 4IOCA 3I3CA 2NN6H 3TDQA 2UUBQ 2NBFA 1U4LA 2AWNA 2CW0C 3STBC 1FJGL 1RTOA 3UE0A 2KCMA 2PZTA 4CKBA 1PDQA 1SN8A 3ND9A 5ISRA 4X66L 3D4WA 4LUVA 3HKZE 3GTQB 2RQXA 2DY8A 1WTXA 2NUCA 3QR8A 2NN6I 4AYBB 1E22A 3QO2A 5M5WB 2QW7A 2Y0SE 4GLVB 1MGSA 3ICEA 4K2LA 1F9QA 2JYOA 1SROA 1Q81C 2L0CA 2HHHL 2WP8J 5C0XH 1YNXA 4GS3A 1D1IA 3NE5B 4Q0FA 1XPUA 5E7NA 3BU2A 4MTKA 3AEVA 4CDDC 4LAAA 1R9TH 2I5MX 1K83B 5G3LD 4LFAQ 3CF5A 1X6OA 1VQGA 2F0UA 1X55A 4RKLA 4DR3Q 3LNNA 4GLXA 1J6QA 1D5XC 3E9IA 1HNZQ 2PPBC 4LF8L 4BBRH 2RVLA 5AJ3L 3ZYYX 4IN3A 1E2ZA 4HCEA 2CHBD 4R8NA 4GNXC 1JT8A 1LT4D 2IX0A 1CSQA 5KYLA 4EQPA 3ER0A 1TWAH 4C56C 3MXPA 5EAYA 5C5MA 3HGBA 4JI4L 3EJIA 1E2WA 3Q8DA 4EQOA 1SJHD 4MHEA 3OPOA 4FF4A 1EY9A 4TSSA 3CCJA 4KKUA 2OQ0A 1UE7A 2K5NA 3V96A 3CC2A 3RMHA 3IKJA 4RCNA 1TWCH 3RLNA 4C3JB 3DWQA 5EKKA 2B2TC 3HOVB 2EY1A 1FL0A 2RKSA 4DV2L 2OCEA 3OYYA 1GKHA 1Q8IA 4CBVA 4JBJA 2DJFC 1M8AA 3KLWA 1EIFA 1IXRA 2N88A 4LF7Q 1WCMB 3S1QB 2A6HC 1DD2A 3SXHA 1I50B 2OF1A 4DV0L 1D5MC 5GAEC 3KF8A 3SVMA 1KLGD 4ABNA 1F2YA 2Z6KA 1H9SA 4O1NA 3NWTA 3QOJA 1K73C 1XMOL 1IYUA 2D9UA 5ELEA 2Z0SA 1D2BA 2RF4A 4P73A 2R92B 3CCEA 3OW2A 4FF3A 3S16B 4KHZA 3I73A 1BVSA 2ICEC 4XXEA 2E8GA 3CPWA 1RL2A 2Z4HA 1BCPB 5IT9c 1X9NA 1M4VA 4IQZA 4DNTB 1CKNB 3Q22A 1RJTA 1GJXA 2DNCA 4H0LC 2ALYB 2D0PA 2IW3A 1MIUA 4L63B 3N52A 2H5XA 4UDUC 1KNAA 1ONLA 2UXCQ 4KK7A 2UUBL 1N33L 1BQQT 3KF6B 4MTNA 2ZT9C 4YWMA 4F88A 1WTPA 1OXXK 2I07B 2ZXRA 3DM3A 1PHJA 4CHTB 1A2UA 1LT3D 1JJGA 4OO1I 1EWCA 2HIXA 3DUZA 4EQNA 1SMYD 3GD7A 1IHZA 4U68A 4A3JG 2RHQB 1I3QH 4H02A 2ICIA 3J80c 1RKNA 2AQ1B 4RA8A 1EQVA 4B3SQ 2F0VA 4WRDA 2PO4A 1DOLA 2R92G 5CBAE 4GNXA 2EYFA 4JCVE 1EEID 3KF6A 1RTNA 3SR1A 1HR0Q 2F3VA 2JA6G 3RZOH 3HG9A 4JVZA 3GTGH 2M9VA 5IOCA 1CA6A 4LF6Q 1UE1A 4P75A 4RGNA 3RZOB 4DR1L 3A8KE 4ZQ3A 3NQTA 4KHPQ 3HOWH 1FYCA 4QJFA 4NXNQ 3J81j 1WTRA 1XMOQ 2Z9HA 3FKIH 3NTIA 1K28A 4DV7Q 4BY7G 1QJOA 2E2DC 1UNSA 4A3LH 4DR5Q 1I3QB 1EQTA 2WKDA 5CV7A 1ET9A 5IP9G 3HOVG 3PIP3 2L12A 3RN2A 4HIKA 1K0RA 1NTGA 4WJWA 3G71A 3P20A 4DPGA 1NJIC 4JOIC 4IOAA 2HCCA 4DV2Q 2MPMA 5JAVA 2R92H 3H3VI 1ENAA 1VQDA 4X65L 3CCVA 1TWFH 2PZWA 1Y8PB 1G2TA 1WCMG 4K2KA 4A3CH 4ZRZA 2E74C 1J8IA 3AU7A 2EYJA 3I4MH 2IHFA 4DN4M 4Y7NH 3A74A 4NPSA 2IPKD 3PUZA 2K32A 4G7OC 1L1OB 3UDGA 1ESRA 4A3DG 1D8LA 2CWPA 4HMJA 1CKOA 1PTOD 4DV5L 4NKLA 2KHSA 3D6CA 2K6AA 1NR2A 4A3FH 1KAWA 3KOJA 2E2HB 1A6XA 1A3UA 2YTYA 4JBWA 3HOVH 1ZXTA 2RDGA 1I94L 4DR4L 2EVBA 1FR3A 3HOXB 1QOHA 1K83H 1STAA 1II3A 4DAVA 2WV6D 5EKLA 2SDFA 5D14A 4IFDJ 1SNMA 5FLXc 2IHEA 3MHBA 2NZOA 1KAAA 3TP5A 3L3OC 4GKKL 1L1OA 5IGCA 2WAQE 4DR3L 3J7AF 4G57A 1I6HB 1QB5D 3KK7A 1TWCB 2NVTB 3HEJA 1SFOB 4RH6A 3GTMB 3FP9A 3BDCA 1NCVA 4ZUIA 3SK4A 1GUGA 3V2TA 1YBYA 2VUMB 1L0XB 1QUQB 4DNIA 1TY0A 3STBD 1EYGA 1PYBA 4P72A 3S15H 3FRPB 1EFWA 1G8ZD 1O7LA 3ULPA 1O78A 3DLLA 1HA6A 4IZ8A 3NTHA 2Q2IA 1EU3A 1E2VA 2F0LA 1SMYC 2OXPA 1PLFA 1YJWA 4JBMA 2K5WA 3H94A 3VR2A 2ASBA 4FVMA 1L1OC 4B3TQ 4DR2L 4EQ5A 5M3MH 4JI0Q 1J9OA 2NN6G 4JI5Q 2EY2A 2RSOA 4DR4Q 1QUQA 1EZ8A 2G9HD 4PZ6A 1HH2P 2OT2A 4A3MG 3LWEA 2PW5A 4DKAC 1X3GA 4A3JB 2E2JH 3VYTA 1XPRA 1QCBD 3NSWA 5H1SE 4FDBA 2A5HA 3U4VA 2RHSB 3I4MB 3FPUB 2JJQA 3D6WA 4DR7L 3KJOA 3TREA 1CQVA 1N32L 1OXTA 3VYUA 5M5WH 3G6EA 3T16A 2UXCL 4HEDA 4QF4A 3TQYA 1BCPD 5A35A 1SNCA 1A0IA 4GN3B 2Q8TA 3TP7A 3TRZA 3K58A 1LTAD 3GTQH 3D4DA 1B53A 1ILQA 1MSGA 2J0TD 4KKTA 2L11A 4BY1B 3Q6SA 1CM9A 2K5DA 2VXWA 3I70A 3KUPA 1STBA 4C3HG 3K57A 1AE2A 2CH4A 1PZJD 3U58A 2A6EC 4IFDH 5FKAC 2KOLA 2Q2TA 1ICFB 2B2WC 3CD6A 1Y1VB 2Y0SG 4BY7B 3CRLC 3MZ5A 3A8IE 4WORA 2PNHA 2MGSA 5DAUA 1CKMA 3MFGA 2B2UA 5C4JH 3SGIA 4LF4L 3HKZG 1X3FA 1HNWQ 3ERQA 3LGJA 3S1MH 1Y1VH 3BDLA 1H9MA 1N8RC 4OWWB 1CFMA 3D0FA 2IY5B 2V1CC 5C0XI 2MJ8A 2B63H 1GUWA 4HJ8A 3TZDA 4B3SL 5GADC 3PO2B 4IFDG 5JEAJ 3J80L 2HDMA 3F1ZA 1EZ6A 2A6HD 4JV5L 3PGZA 3QB3A 4JI4Q 2X69A 1FGBD 3VA7A 1PZKD 2A74C 5ELCA 3QG1A 4KMUC 2FFKB 3I4NH 3J81c 3T51B 2IL8A 1EYDA 1CTMA 1F2ZA 1L2FA 1C7YA 4R4CA 1IBKL 4P71A 1DOMA 2AQ3B 5FLMH 1B44D 2QEJC 3NPPA 4X6AH 2EYMA 2XTIA 2E75C 1HZCA 4KY5A 3TSSA 4EX5A 3M3YH 4JI8Q 2F0IA 1B50A 3IRBA 2UXBL 3MXUA 4Y52H 5EPJA 4FP5D 2SOBA 2XIWA 3I55A 1LTGD 2LY7A 2CW0D 1H95A 1VF7A 2F4IA 3U4ZA 1MSHA 4RGMA 5FJ8G 4A3GG 1N32Q 2A68D 3S24A 1VQ7A 1A63A 1KTKA 1BUVT 4C2MH 1DYQA 1SR3A 1EFID 4TVAB 1HHVA 1TR5A 2NVYH 1SYGA 2I46A 1BKBA 1A15A 4YCUA 2Y0SB 2K5QA 3QJYA 5I9OA 2JA5B 3M7NA 2MO0A 1TWHB 1GVPA 4DV4Q 2QGQA 2A8VA 1X32A 3EROA 5IY0A 4K14A 1U4PA 3OHXC 1X3PA 4U673 1BCPF 4ZLTF 3KLRA 1R4QB 4DU9A 5NUCA 2LSSA 1D6EC 1TXYA 5K5PA 4IALA 3HOXH 3DWAA 5KRUA 2ZM6L 1QZHA 2CVRA 1HXYD 1GUOA 1ILPA 2N49A 2JQOA 5IGEA 1SYBA 2KEEA 3BYYB 3MAQA 5LMUL 1U9RA 3HFZB 2R6GA 2JA6H 3AYHB 2FMCA 1DZ1A 1YHQA 1HZAA 4TQUS 3B6YA 1VMPA 3GV3A 3GTKH 3KLSX 5IYDH 1Y1WB 3Q24A 4QL5A 3T1YL 3PIO3 2TSSA 1Y1WH 4DV6L 3A56A 2K52A 4JI7Q 5DNFA 2PI2A 1EYCA 3H0GG 5CV4A 5M3FG 3QOLA 1G6PA 1HR0L 1H9JA 1TY2A 1VQIA 2WB1G 2MO1A 5ELNA 1EU4A 1B3QA 2EQSA 3PUYA 2VNUD 2YTXA 1CI3M 1HZBA 2NVQH 1SNOA 2GVBA 4A3KG 2UUAL 1IBML 3L9AX 3WWVA 1Z7TA 2NYZD 2G9DA 2PZUA 5ELBA 1QWYA 5IP7G 4N8FA 1XYIA 3LWUA 4R9WA 1SNQA 3NELA 5IP9H 3I4NB 3PCOB 4KN4C 1K8OA 3N6RA 2JA8G 2WAQB 4OL7A 3SK5A 4CDFC 3IL8A 4OHJA 4RHSA 3GTOH 4DR1Q 4GN4B 4FO2A 2ZTEA 4BXXH 4NB3A 1QVFA 3M4QA 3MFYA 2OEOA 1F9PA 4ZKBB 2IWHA 1QE6A 4OIKA 4MZ9A 1F2MA 3CCQA 3OWEB 3PSIA 3HOWG 2K04A 2J7ZA 5EJWA 1AEXA 1OO9B 3TBIB 1NMFA 2PMZB 2SEBD 1OXVA 5M5YH 4GOPA 1XX8A 4MNOA 3M3YB 2PQEA 3DEPA 4LWCA 3NXWA 4DAPA 1YJ9A 5M3FH 1A8VA 4A75A 2F52A 2BA1A 4HAEA 2O4XA 2PNRC 2EE1A 3WDNA 4FXGC 5E3FA 1X3EA 3K8AA 2JA9A 2KQ3A 4JC0A 1PFBA 4ZYSA 4UP7A 2VQFQ 2XRQD 4FF2A 3E5SA 3RZDH 3OW7A 4BY7H 5CYUA 2KA7A 4APVA 3CPFA 1O7ZA 4JW0A 4A3IB 1KRTA 2EYHA 4B3RQ 2R93B 2EJFC 2BH2A 4AH6A 2B8FA 1KABA 3PO3H 2Z6KC 4CJ0B 1HPCA 2R7FA 1MD2D 1E1OA 4BY1H 2UU9Q 5DEHA 3ND8A 1JQYD 4JYAL 2JSOA 1WTWA 4POGA 2NWGA 3OSOA 3NBIA 1VQ5A 2E76C 3X3MA 2KJXA 2F0GA 2K03A 4JG2A 1VQ9A 4BY1G 2K50A 3PF5A 1DM0B 2WACA 4N9PA 2F0TA 1QG7A 3KFUA 2KHIA 4PMWA 5C4ZA 3DHQA 1AZPA 1LLRD 4MN3A 4GKKQ 2OQKA 1VQEA 3URYA 4K8IA 1W3SA 1G6ZA 1TQOA 3GTOB 1ZYRC 3A55A 3K5MA 4IJHA 1E24A 4QIWB 1TS2A 1WTHA 4DV4L 2F1MA 3GDEA 4B3RL 1V8QA 4O0AA 1VQFA 3S15B 2D0OA 2HD3A 1GHJA 3NK9A 4NDXA 5KNCA 3CMEA 1O7YA 2AUJD 2KHJA 4A3MB 3GQBA 2M2LA 3OMCA 3C1FA 4KJNA 3H91A 5JPNC 1BNZA 3T1YQ 2KECA 3I72A 1Q86C 2Z4IA 4DA2A 2NVQB 1O80A 4KJOA 2AWOA 2DY7A 1WOCA 1SRUA 2L55A 1IKLA 1SEBD 1VQNA 5CV5A 5I9PA 1LUZA 1CT1D 4UP9A 3U9OA 4P2CB 2JA8B 2A19A 3S14B 5CV6A 4LFCL 1M1KC 1S5CD 1QZGA 3DWPA 1XNQL 4DV3L 2ZJRA 1C0AA 1R4PB 4RFBA 4K6LA 4JI7L 1E0BA 3NENA 4R4IA 3CXCA 3FDTA 4GKJL 5I6WA 1PRTC 2MFIA 4XIGS 3I4NG 3JC66 4A3FG 5M3MB 4B3ML 1CK1A 3PIOA 4DV1Q 1VQ4A 2QCPX 1F9RA 1Q90A 4IJLA 1PZID 4QY7A 4GKJQ 4DNRB 2BA0A 4NP5A 3CKIB 2BH8A 5IODA 2B3GA 3HZXA 3KF8B 1PFSA 5IT9E 1W6KA 1PRTD 4CDCC 1LTBD 1K0SA 3TEHB 1U5KA 4DAYA 1C9OA 1KLUD 4I7AA 1JWUD 2UXBQ 1VQMA 1ASYA 5C4HA 4IUUA 3DMUA 4A3LG 3CQZH 4RAUC 3H3VH 1EYAA 4DUYL 1XWEA 2PCFB 4L8JA 1C8CA 1B2TA 2X6GA 1B8AA 1PXUA 1B3AA 5K36G 3J81L 1FNVA 4AQYL 3HOXG 4KN7C 1PMRA 1HR0W 4DAMA 3F2UA 4XQNA 2K5HA 1H9KA 3HOUG 2A69D 4LK1C 3IAYA 3J80E 4YWLA 5JJLA 4LF5L 4HTHA 1EOTA 5I2XA 2ID0A 3C46A 4FXKC 1UEBA 2DGYA 2YU9H 4QMGA 1YNNC 4A3BH 1I5FA 1NY4A 1U0LA 2AQ2B 3W2DA 5IWAL 3OTOQ 2CH4W 1CKNA 1V43A 1SE3A 1I4HA 1SYDA 2K05A 1SAPA 3WOEA 2F0KA 3L7ZC 5JOBA 2EJGC 2VB3X 2F0WA 5LMNW 1PFNA 1FJGQ 1S4ZA 2XN9C 1QNUA 2C35B 4ZK9B 1UWVA 3MEFA 3CHBD 1H9RA 4DR5L 3E0EA 1BCPC 3K0XA 2EXZA 3JAME 1YNND 2RBMA 5D3DA 4XTCS 5KEEA 2ZJPA 5JVG3 5JJKA 3S17B 1KDAA 2GN5A 2JK8A 3E9HA 1EIYB 4HJ5A 2JEAI 4HIOA 3S17H 1PH3A 3TP8A 4GNXB 5M5XH 5IP7H 4GLAC 2JA7B 1K8MA 5M9OA 3EVQA 5FLXL 1Q46A 1B9MA 1HJPA 1IZ6A 1IW7C 4DF7A 1ENFA 2KCNA 3HOYG 3K80C 4BXXG 2K28A 4QIWE 3FKIG 1SDFA 2V4DA 4O42A 2E2IH 1LTTD 2EIFA 3G6JB 3K81C 5BR8Q 2F03A 4NMZA 3RD4A 4IUVA 1STHA 3NWSA 3RNUA 5IGDA 2EYOA 2KEDA 4X3UA 4X3TA 3BG3A 4QQBX 1HTLD 3S1MB 2DJGC 5CMDA 1JR0D 3MXNB 1Z47A 4RGTA 1GXDC 4XQJA 1IYJB 1V9PA 3CAMA 4NXNL 2GA4B 5C4JB 4XYOA 4YHHQ 1XPOA 1HUMA 3K59A 1SJED 3J7ZC 4JV5Q 2K7VA 5BR8L 1Y8NB 1PH1A 3M4OH 1KDCA 4IUQA 2XRSD 4UAIA 1JCKB 1X56A 3EA6A 4C3HH 5IGBA 2HUGA 5C3XA 1GUTA 1XNRQ 4DR6Q 1FD7D 5C6AA 3ERSX 5FO9B 3BVZA 3CCLA 4H13C 5DLQE 1E7ZA 1L0WA 2I0QA 2C9OA 4K0KL 1PVOA 4LUOA 4XT1B 1WTQA 4CGYB 4R8IA 1SYEA 2ZXOA 4IFDI 4DXGA 1LTSD 2FINB 1GM5A 2ZTCA 2E2JB 1TWAB 4KD3A 2L1BA 2VL6A 1VQKA 1YIJA 3S2HH 3NEMA 1DCZA 1MJCA 2LFNA 1G51A 2R7DA 2YYZA 2I5LX 5F2DA 3WOFA 3BZKA 1ASZA 1NUCA 4JI3L 2OTLA 4HIMA 5I2YA 1I50H 4LF8Q 2BOSA 4C1NK 4BBRB 1KIXA 1IBLL 1LYLA 3GV6A 4X62L 2R61A 3F2CA 4J8QA 1KNEA 3I56A 5JVH3 4C3JH 3A5UA 2HCIA 1TWGB 4KTAA 2VS1A 2B29A 1VQ8A 5KIXA 5IGFA 3JAMi 4DV1L 1SXTA 3W1BA 2CQAA 2P5ZX 1LABA 3SK8A 3RN5A 5C0XG 2YTVA 1PTOH 1YNJC 5C3EG 4LJZC 1KHIA 1HFGA 4DV0Q 1E1TA 4K5VA 4AQYQ 5IIFA 4JBKA 3NHHA 5IYBG 3LX0A 4LW1A 1Q12A 4CKEA 1PH6A 3PUVA 1BOSA 1JC7A 4A3MH 1UEAB 3I4MG 2L15A 1FGUA 1BXTA 1PH8A 3KDFA 1OXSC 2NZ1D 2IJ0A 3HRZC 4HSPA 4X66Q 5FLXE 1PH7A 2F0OA 4QUCA 1AW7A 4L6TB 1K8AC 5EBDA 4N8X1 2EOTA 3D31A 1PRTB 4A93H 1JOOA 3FHWA 4POFA 1O7IA 2ZXPA 5KYIA 1DJRD 4QCLA 2WAQG 2N78A 1XXGA 1DGSA 2B39A 3CCMA 3S2DH 1R9TB 5IYBH 2F0NA 1AH9A 1IYVA 2WFWA 2K01A 4IUPA 4UHVA 1N33Q 2KCTA 1LM0A 3GTPH 5KNBA 2B2TA 2WINB 1JJCB 1STEA 2PMZE 1D1KA 1I6VC 2QEXA 1Q1BA 2Q2UA 3K0YA 5C4XB 4K8JA 4GOPC 1BO0A 1XTDA 3BZDB 1EQRA 4LNQA 2E5LQ 3CP0A 4C3IH 1LT6D 3KJPA 4HJAA 2R93H 3CRKC 1ESFA 4OEMB 4BA1I 3TS0A 1RF2D 3I2ZA 2DUDA 4PG3A 4XDXA 4I65A 4QGUA 4JI2Q 2D62A 2N3SA 2UXDL 1KL9A 5J1ZA 1BF4A 5T1GA 5E4WC 4C3IB 1EY8A 4JK1C 4XT3B 3S9WA 3F8TA 3DM1A 3L2PA 5C4XH 4O2DA 1S3OA 1L0YB 4FNFA 4KV6A 2F0HA 5EGTA 1OXUA 1GHKA 3M4YA 1NR4A 2JEBI 1HZ9A 3GP7A 1XNRL 1JOQA 4JI5L 4HJ9A 1PH2A 4A3BG 4M8AA 2QDBA 3GTPB 4HR7B 1VMCA 2R3ZA 1LACA 1WD0A 2F4VQ 4ME5A 2AHOB 4A3EG 4V0BA 3HS0C 1OTCA 5JEAH 4WJ4A 1UUPA 4ME3A 4OO1H 1PRTF 4KHVA 2Z8LA 4GN5A 4L5TA 3UDXA 3A5ZB 1QNKA 4L5QA 2JA5G 4Z9CB 1F9SA 1PV4A 1LV9A 3SHLA 5M3MG 5M5XB 4X64Q 5CC4A 4OO1G 2ENBA 2NVXH 1PTOF 4ILWA 3BS1A 1TIID 2VB2X 1F77A 2EXDA 2KCCA 2CCZA 3ULLA 3G7LA 4LF7L 2L9HA 4X62Q 3S16H 4IPGA 4LFBL 3FMCA 5IWAQ 2F3WA 1I4QA 2XGTA 1EQQA 3D4RA 1HNXL 1JICA 1Q8KA 5CR3A 5GROA 1Q7YC 1T9HA 1PTOB 1VQBA 4QB4A 3HOYH 1STNA 1BBUA 1P16A 5GAHC 3GTLB 1TVXA 4BBSB 1B70B 3S2DB 3CCUA 1STYA 3QWNA 3KYHC 1TT2A 1HNWL 2B2YC 1B7YB 3L0OA 4PZ7A 1ICWA 1VQHA 2EY6A 2L5TA 5BN5A 5FOBB 4F8MA 3MA2B 3MWYW 4JOIA 1PH5A 3VYRA 4KI0A 3CCSA 4R4TA 1GO3E 4B3MQ 2L4NA 2SNMA 4K5WA 1SNPA 2R7ZG 4OX9L 1RODA 4IPCA 2PW7A 3P7JA 3E3XA 3CC4A 4N9TA 3G4SA 4EVOA 4JI0L 3SE0A 1PA6A 4DV3Q 2B2VC 3K5NA 1WTOA 1FNWA 1JJ2A 2K75A 1HQMC 1CQFA 5ELDA 1MJEA 2RDHA 3NQIA 4LFAL 2RCNA 1PYSB 4K6DA 2XWJB 4JI6Q 2KUMA 2Z1CA 1U4MA 4JI6L 2F0EA 5ELOA 3TN2A 2PYKA 3H3VC 5IYCH 4R1JA 1IKMA 2MHVA 3W1GA 3SK6A 3NUCA 1DOKA 1K3BC 3CCRA 4X3KA 3P75A 2N8NA 4XYQA 2AUKA 4A3CG 5JPMC 1HNZL 3HOUH 4RGOS 2VY3A 2O5IC 3C3LA 1JWMD 3QIAA 2CKZB 3FPPA 2E2HH 2VQEL 3S2HB 5C5LA 4LFBQ 1PYWD 3BYTB 3BZCA 5IYDG 4OIJA 4PNYA 2A1AA 4Y7NB 4DUZL 1WI5A 2DNEA 3UI2A 4JI2L 2D2CC 1TS3A 3MC0B 2CWAA 2RCFA 4A3EH 1DONA 4OELB 1YVCA 1B4OA 1VS0A 1QVCA 1Z9FA 2QA4A 2QF7A 2KENA 1CHPD 4IPHA 1TKWB 2NB0A 4A3IH 3Q0AA 4FXDA 1HA5A 2HQEA 4KHPL 5JJIA 5IE8A 1I4XA 1KDBA 2HQLA 2J4XA 5ELFA 4EGVA 5A2QE 1X65A 2MUYA 2UU9L 3RZDB 2F4VL 4A3DH 3KBGA 2XNAC 3PQIA 5C4XG 4JPBW 1JB7A 5EPLA 4LFCQ 2CFMA 2EYLA 4A3KH 1K8GA 1YHBA 2FXQA 4ALPA 3BVMA 2EZVA 2N55A 1SNDA 1GUNA 1VCIA 5C0XJ 1D5ZC 2A73B 4LMQD 1N34L 3FKIB 1SE2A 3JAMc 1F2LA 4DV5Q 5M5YB 3M4OB 2RSNA 2XWBB 1W2BA 1NAPA 3EQLC 4KD4A 2RA4A 3DXJC 4IPDA 1WD1A 2HHHQ 2E2IB 4PV1C 4HSVA 4TKOB 3M7GA 3T1HL 4HIDA 2B8GA 5M3FB 2HT1A 1HTPA 3J81i 3I8ZA 4A3BB 3R8BA 5IYCG 2JA7H 2H4OA 1YJNA 4YCWA 4OGQC 2F0FA 1VQ6A 4DR2Q 2C5CA 5LMNQ 2BE5D 3T1HQ 3I7FA 3NBHB 4ULLA 3SDZA 5I4DA 3IFTA 4L5RC 1UE5A 3D3RA 3OMGA 1Y1WG 2D5DA 1EY4A 1KC8C 1KQSA 3PV0A 1NMGA 4CDEC 2O5JC 4F87A 4DFAA 3J7YW 3IFDA 2GVAA 1S40A 4A76A 4QUFA 4UP8A 1I4RA 1PH9A 3K6OA 3FVQA 4A93G 4TRDA 2MNAA 2BE5C 1PFMA 1VQAA 5IT9L 4NXMQ 1MI2A 4RWSC 1X54A 4J15A 5E4XA 5FK9C 4BBRG 1I4GA 3UDIA 2R7ZH 2B63G 2YU9B 3T56B 1ML0D 3VR5A 1TS4A 1LTLA 1P8LA 3O13A 5C44H 1Y69U 1Q82C 1K9MC 2PQAA 1SBBB 1CA5A 3K7UC 2VQFL 5IGGA 1XTCD 4G7ZC 2K5VA 4LF4Q 1DXMA 2ZTDA 3K7AB 4KY6A 1JB3A 1A2TA 4DUZQ 1U4RA 1FNUA 5J39A 1WCMH 3S1QH 1EWIA 1J5EL 1JE4A 3Q23A 3GO5A 3JAML 2UUAQ 4F7XA 1FVIA 1NNXA 2F0PA 2NTSA 2NTTA 3M4PA 4A4IA 5BN4A 3S1RH 4LF9Q 3PO3G 4DXFA 3GTJH 5FJ8H 4A3GH 5LMUQ 2F0QA 1S5ED 2JA6B 5CBEE 2VUMH 3MTSA 5FLMG 3H6MA 1TS5A 4BA2I 2PQAB 1SLJA 2LXJA 2NVTH 4E6IA 1SYCA 3UDFA 4B08A 5K36H 4B9WA 1CUKA 4YWKA 2K4KA 3CQZB 1RDPD 4KLKA 1V1QA 1AFPA 4WFN3 1SSOA 4ZAIA 2YV5A 3A0JA 1VQOA 2H1EA 1A3VA 2CQOA 4X64L 3H09A 3VYSA 4OXPA 3R2IA 4L5SA 3GTJB 1EWHA 1EIHA 1TWGH 2MP1A 4ZCKA 1GOZA 5JEAG 2F0JA 2ZM6Q 4FF1A 4XQQA 3C1EA 3I4LA 1IBMQ 3S1NB 1BBXC 5C44G 4HMIA 3T13A 4LF6L 2IX1A 2TMPA 3AQQA 4DAYB 2QKIC 1ZYRD 2JP1A 2VQEQ 3J81E 1XNQQ 1AN8A 3KLSA 3NP8A 2EJMA 5HGTA 2EPBA 4S3SA 4CKCA 2JA8H 4DR6L 3M85A 2FHTA 4IO9A 1HNXQ 1KD1C 2O2LD 1W6JA 4OX9Q 3ONAB 1TWFB 3CW2C 1Q3LA 2XSCA 1YNJD 1AE3A 4J1MA 3AMUA 1C4QA 5HURA 3HKZB 1S5DD 3PO2G 3VA5A 1SE4A 4PZ8A 2PI2E 1X3QA 1WTVA 3S14H 1D7QA 3CMAA 5FO7B 1PTOC 4JI1Q 3TS2A 1N34Q 3PO2H 1V1PB 1MHWC 5D3IB 3PF4A 1LT5D 3EIVA 4C3HB 1IL8A 5C3EH 3E6ZX 3K5OA 3OWFA 5A2QL 3H0GH 5CORA 5FO8B 4LUZA 3T53B 4R4QA 5LMNL 5EKIA 5CV8A 1Y1VG 2LXKA 3OTOL 3GTGB 2HIVA 3BDOA 4BWGB 4YHHL 3AFQA 4C3JG 2B63B 5DM73 2OTJA 1KRSA 4CJ1B 5J22A 3UE1A 1M90C 4DV7L 1GD7A 3A7LA 1IL2A 4JI1L 2WKCA 5GQOA 2M00A 3RLOA 5CV9A 2JN4A 1T5XD 3VR4A 3W3AA 2LS01 3AFPA 1HCZA 5HY6A 1EY6A 4OWTB 3PUWA 1EUJA 1EL0A 2IX3A 4PMBA 1YEZA 2EY5A 1EIGA 3SEBA 2BCOA 3RR5A 1Z6HA 3CC7A 2AMCB 5CGKA 3CU7A 3NTKA 4X3SA 3OIQA 1G2SA 4KY7A 4B3TL
chains in the Genus database with same CATH topology
2UU9Q 2VUMG 2AHOB 4A3EG 1YI2A 4LF6Q 1UE1A 4P75A 1OTCA 4NXML 4WJ4A 4DV6Q 4DR1L 4ME3A 4JYAL 4RG1A 2JE6I 4KHPQ 1E3PA 4POGA 3HOWH 4GN5A 4L5TA 4QJFA 3UDXA 1VQ5A 3A5ZB 4NXNQ 3J81j 1YZ6A 1XMOQ 4L5QA 3FKIH 2JA5G 4JG2A 1PV4A 1VQ9A 4BY1G 5M3MG 4DV7Q 4BY7G 2K50A 3PF5A 3J80i 4A3LH 4UY8C 1WYDA 4DR5Q 4X64Q 4AYBG 4OO1G 2VZAA 2UUCQ 3G48A 5IP9G 2NVXH 1VQLA 3HOVG 3KFUA 2KHIA 4PMWA 3RN2A 2EXDA 4HIKA 2CCZA 3ULLA 3J7A5 1K0RA 1NTGA 4LF7L 4GKKQ 3F2DA 1QVGA 2OQKA 3G71A 2AKWB 1VQEA 4DPGA 1NJIC 4X62Q 4JOIC 4A3JH 3S16H 4IOAA 4IPGA 4LFBL 1W3SA 4DV2Q 5IWAQ 2R92H 3H3VI 1VQDA 4X65L 2KBNA 3CCVA 2XGTA 1E24A 1TWFH 4IJHA 1EQQA 1Q8KA 1HNXL 4DV4L 3GDEA 5GROA 3U50C 1Y14B 4OWXB 4B3RL 1I94Q 1Q7YC 4O0AA 1VQFA 2D0OA 1T9HA 4YCVA 1VQBA 1WCMG 3HOYH 2Q2HA 4A3CH 1BBUA 1P16A 5GAHC 1B70B 3CCUA 3CMEA 4DK6C 1HNWL 3KYHC 2KHJA 4LF9L 3I4MH 1B7YB 2IHFA 5HGQA 1YITA 3L0OA 4PZ7A 4DR7Q 1N36Q 1VQHA 4Y7NH 3ULJA 3A74A 4NPSA 3T1YQ 1BBWA 3PUZA 1Q86C 1I6HH 1L1OB 3UDGA 4A3DG 1CSPA 4JOIA 1D8LA 2CWPA 1PH5A 1CKOA 4DV5L 2UXDQ 2AWOA 4KI0A 3CCSA 1VQCA 1WOCA 4R4TA 1GO3E 4B3MQ 1SRUA 1KAWA 3KOJA 4A3FH 1VQNA 1UE6A 1LUZA 4DUYQ 2YTYA 3HOVH 4JBWA 4R4OA 4UP9A 3M9BA 1NBWA 4OX9L 2R7ZG 4IPCA 3F2BA 4AYBE 2A19A 1SFOH 1I94L 3GTMH 4DR4L 1K83H 5AJ3Q 1EOVA 4LFCL 3CC4A 1M1KC 3G4SA 1QZGA 4JI0L 2OWOA 5FLXc 1XNQL 2IHEA 4IFDJ 2NZHA 4DV3L 2NZOA 2ZJRA 1PA6A 4DV3Q 1C0AA 4JI7L 3NENA 4GKKL 1L1OA 2WAQE 4DR3L 1JJ2A 1SMXA 3BJUA 2K75A 4R4IA 3CXCA 4GKJL 1MJEA 4LFAL 2RCNA 1PYSB 1WFQA 2MFIA 4XIGS 3FP9A 4DK3C 3I4NG 1RIPA 3JC66 4JI6Q 4A3FG 1SE8A 4YY3Q 1YBYA 3KDFB 4B3ML 1QUQB 3PIOA 4DNIA 3STBD 4DV1Q 1VQ4A 1PYBA 1EYGA 4JI6L 4P72A 5ELOA 2ZJQA 3S15H 1EFWA 2K14A 5IYCH 4R1JA 1MKHA 4B3TL 3ULPA 3W1GA 3S1NH 2WB1E 4IJLA 3HOZH 4QY7A 4GKJQ 2I5HA 3DLLA 3CCRA 2Q2IA 2BA0A 4JYAQ 2N8NA 2BH8A 4A3CG 1JMCA 1YJWA 4JBMA 1HNZL 3HOUH 2ASBA 2B3GA 3KF8B 4B3TQ 1L1OC 4DR2L 1PFSA 1XMQL 4EQ5A 5M3MH 1IBLQ 3GTLH 4JI0Q 4BBSH 2NN6G 1TWHH 2VY3A 3TEHB 4JI3Q 4JI5Q 1U5KA 1C9OA 1NE3A 4DR4Q 3VDYA 2UXBQ 2MQHA 4RMFA 4A3IG 2CKZB 1VQMA 1QUQA 1ASYA 4PZ6A 1HH2P 2E2HH 3PUXA 4A3LG 1G291 3CQZH 2VQEL 4A3MG 3H3VH 4DUYL 4LFBQ 3RLFA 4DKAC 1B8AA 1X3GA 3BZCA 3EN2A 5K36G 2E2JH 1XPRA 5J3BA 5IYDG 4AQYL 3HOXG 5H1SE 4FDBA 5GAGC 1HR0W 4DAMA 2A1AA 4DUZL 3U4VA 2RHSB 2K5HA 1K3RA 1N36L 2JJQA 2JA5H 3HOUG 4DR7L 1WI5A 3KJOA 2F3IA 3TREA 4WJ3M 1N32L 1VQJA 4JI2L 1A62A 1OXTA 4YWLA 5M5WH 2CWAA 3G6EA 4LF5L 4A3EH 5JJLA 2ID0A 1YVCA 1VS0A 2UXCL 1UEBA 4OONA 1QVCA 2DGYA 3TQYA 2ATWA 1Z9FA 2QA4A 2YU9H 2KENA 1A0IA 4GN3B 4IPHA 3TRZA 4A3IH 4A3BH 1NY4A 1I5FA 4KHPL 5JJIA 5IE8A 3K7AH 3ZJYC 1U0LA 1VQPA 4JI8L 2HQLA 3GTQH 4UPAA 1X65A 2UU9L 5IWAL 2F4VL 3OTOQ 4A3DH 4BBSG 1CKNA 1V43A 4HJ7A 5C4XG 1JB7A 4LFCQ 2CFMA 4A3KH 3L7ZC 1K8GA 5LMNW 1AE2A 3H15A 1YHBA 1FJGQ 2FXQA 4P74A 2C35B 4ALPA 3U58A 2UUCL 1UWVA 1S72A 2JA7G 3MEFA 1IBKQ 2Q2TA 3I4OA 4DR5L 3E0EA 5C0XJ 1VCIA 3K0XA 4LF5Q 2Y0SG 3CD6A 1N34L 4GOPB 3JAMc 2A8VA 4DV5Q 2PNHA 4XTCS 4AIMA 2ZJPA 1J5EQ 1W2BA 5JJKA 1CKMA 2GN5A 1JE5A 2JK8A 3E9HA 1EIYB 4HJ5A 2JEAI 1YHAA 5C4JH 4HIOA 3SGIA 3S17H 4LF4L 4K0KQ 1PH3A 3HKZG 4IPDA 2HHHQ 1X3FA 1HNWQ 1Q1EA 3LGJA 3T1HL 4GNXB 4HIDA 5M5XH 2HT1A 5IP7H 3S1MH 1Y1VH 2VW9A 4GLAC 3W5OA 1N8RC 3J81i 1KXLA 4OWWB 2R93G 1Q46A 3D0FA 1XJVA 2IY5B 1HJPA 1IZ6A 2V1CC 5C0XI 3HKSA 2B63H 5IYCG 2E5LL 2JA7H 3K80C 3HOYG 3EBEA 4BXXG 4X65Q 4HJ8A 1YJNA 3HOZG 1WJJA 4QIWE 4YCWA 1N9WA 1PH4A 3FKIG 5GADC 2IT1A 4B3SL 1XMQQ 5JEAJ 4IFDG 1VQ6A 4DR2Q 5LMNQ 2E2IH 3T1HQ 3I7FA 3F1ZA 3NBHB 2ES2A 2EIFA 3K81C 5BR8Q 4JV5L 3PGZA 4JI4Q 4L5RC 1UE5A 1Y1WG 3RNUA 1KC8C 3PIPA 4QQBX 1KQSA 3PV0A 3J81c 3I4NH 1NMGA 4YY3L 4IOCA 2UUBQ 3MXNB 1L2FA 1C7YA 1Z47A 4R4CA 1IBKL 2GVAA 2AWNA 3STBC 1S40A 4P71A 1IYJB 1V9PA 4A76A 3CAMA 1FJGL 4NXNL 4UP8A 5FLMH 1PH9A 3UE0A 4A93G 4YHHQ 2KCMA 1XPOA 2MNAA 3J7ZC 4X6AH 4JV5Q 1VQAA 5BR8L 1PH1A 2XTIA 4NXMQ 3M4OH 1SN8A 1HZCA 4X66L 1X54A 4LUVA 4J15A 3HKZE 4EX5A 4BBRG 3UDIA 2R7ZH 3M3YH 4JI8Q 2B63G 3IRBA 1X56A 2UXBL 4C3HH 4Y52H 2NN6I 1XNRQ 4DR6Q 3I55A 1LTLA 1E22A 1P8LA 3ERSX 5C44H 1Q82C 1K9MC 2PQAA 2Y0SE 4GLVB 1H95A 3CCLA 3ICEA 3K7UC 3U4ZA 1SROA 5FJ8G 5DLQE 1E7ZA 1L0WA 2VQFL 3S24A 1Q81C 1VQ7A 2HHHL 2WP8J 2K5VA 2I0QA 4LF4Q 4K0KL 4LUOA 1PVOA 2ZTDA 1A63A 4C2MH 1YNXA 4IFDI 4GS3A 4DUZQ 1SR3A 1WCMH 3S1QH 4TVAB 1GM5A 2ZTCA 1EWIA 1J5EL 1XPUA 2NVYH 3GO5A 2UUAQ 5E7NA 1FVIA 4A4IA 3M4PA 3S1RH 1BKBA 2VL6A 3BU2A 4YCUA 1VQKA 4LF9Q 3AEVA 3PO3G 3GTJH 5FJ8H 1YIJA 3S2HH 5LMUQ 4A3GH 2VUMH 3NEMA 1R9TH 5FLMG 1MJCA 2I5MX 1G51A 2R7DA 4LFAQ 3CF5A 3M7NA 1X6OA 2MO0A 1VQGA 2YYZA 4BA2I 1X55A 1SLJA 2I5LX 1GVPA 2LXJA 2PQAB 2QGQA 3BZKA 4JI3L 4DV4Q 4HIMA 5IY0A 1I50H 4DR3Q 1ASZA 2OTLA 4LF8Q 4GLXA 1J6QA 3UDFA 1IBLL 1KIXA 1LYLA 3E9IA 4X62L 1CUKA 4YWKA 1HNZQ 3F2CA 2K4KA 4LF8L 4KLKA 1V1QA 4BBRH 3I56A 5AJ3L 2LSSA 4C3JH 1TXYA 2ZM6L 3A5UA 3HOXH 1QZHA 2YV5A 3A0JA 1VQOA 2VS1A 2N49A 2JQOA 2B29A 4GNXC 1VQ8A 2CQOA 4X64L 3JAMi 4DV1L 5LMUL 3HFZB 1JT8A 3W1BA 4OXPA 2R6GA 2JA6H 4L5SA 3AYHB 3RN5A 2NVTH 2IX0A 5C0XG 1CSQA 2YTVA 1YHQA 1TWGH 1HZAA 4TQUS 3B6YA 5IYDH 3GTKH 3ER0A 1TWAH 5JEAG 5EAYA 5C3EG 2ZM6Q 4QL5A 1N33L 3T1YL 1KHIA 4DV0Q 1IBMQ 2UUBL 1E1TA 4AQYQ 1Y1WH 4JI4L 4JBKA 3Q8DA 5C44G 4DV6L 5IYBG 2K52A 4LW1A 1Q12A 1PH6A 4JI7Q 4LF6L 3PUVA 4A3GG 2PI2A 4A3MH 2IX1A 3AQQA 3H0GG 4DAYB 5M3FG 3CCJA 1N32Q 2VQEQ 1G6PA 1XNQQ 3I4MG 2L15A 2OQ0A 1UE7A 2K5NA 1FGUA 1HR0L 3CC2A 1VQIA 2WB1G 2JA8H 4DR6L 3M85A 2MO1A 1TWCH 5ELNA 3RLNA 4IO9A 1HNXQ 1KD1C 1PH8A 3KDFA 4OX9Q 2EQSA 1FL0A 1OXSC 3CW2C 3PUYA 4DV2L 2OCEA 3OYYA 1AE3A 2VNUD 1GKHA 4X66Q 2YTXA 4BY1H 4JBJA 1PH7A 1HZBA 3KLWA 1K8AC 2NVQH 3PO2G 1EIFA 1IXRA 2GVBA 3D31A 4A3KG 4PZ8A 2UUAL 2PI2E 4LF7Q 4A93H 3FHWA 4POFA 1O7IA 4DV0L 1IBML 3S14H 1D7QA 3CMAA 2WAQG 5GAEC 2N78A 3WWVA 1DGSA 4JI1Q 2Z6KA 3CCMA 3TS2A 3S2DH 5IYBH 1AH9A 1N34Q 2WFWA 5IP7G 3PO2H 1N33Q 2KCTA 1LM0A 3GTPH 1K73C 1XMOL 3PF4A 3NELA 5IP9H 3PCOB 2Z0SA 3EIVA 2JA8G 2RF4A 1JJCB 2PMZE 5C3EH 4P73A 2QEXA 3GTOH 4DR1Q 1Q1BA 3CCEA 4GN4B 3OW2A 2ZTEA 3H0GH 2Q2UA 4LUZA 4BXXH 4NB3A 4KHZA 4R4QA 5LMNL 1QVFA 1BVSA 4GOPC 3M4QA 1XTDA 1Y1VG 2E8GA 2LXKA 3OTOL 1RL2A 3CPWA 2HIVA 4MZ9A 5IT9c 3CCQA 1X9NA 1EQRA 3PSIA 3HOWG 4LNQA 2E5LQ 3CP0A 4C3IH 3KJPA 1CKNB 4HJAA 4YHHL 2R93H 3AFQA 1NMFA 2ALYB 2OTJA 2D0PA 1OXVA 5M5YH 4GOPA 4MNOA 1KRSA 1MIUA 4BA1I 2H5XA 3UE1A 2UXCQ 3TS0A 4LWCA 3I2ZA 2DUDA 4PG3A 1YJ9A 3KF6B 4MTNA 4YWMA 4QGUA 1M90C 5M3FH 4DV7L 4JI2Q 1GD7A 1A8VA 4A75A 2F52A 2D62A 1OXXK 2N3SA 2UXDL 1IL2A 2BA1A 4JI1L 1KL9A 5GQOA 3RLOA 3DM3A 1PHJA 1X3EA 3K8AA 2JA9A 1JJGA 4OO1I 2HIXA 3AFPA 3GD7A 5HY6A 4JC0A 4UP7A 4OWTB 3F8TA 2VQFQ 2RHQB 4A3JG 3PUWA 1I3QH 1EUJA 4H02A 3RZDH 3L2PA 3J80c 5C4XH 4O2DA 4BY7H 2F4VQ 1S3OA 1YEZA 4B3SQ 4APVA 3CPFA 1OXUA 2R92G 3RR5A 2JEBI 1HZ9A 1KRTA 4GNXA 1XNRL 3CC7A 4B3RQ 2AMCB 4JCVE 4JI5L 4HJ9A 1PH2A 3KF6A 2BH2A 4A3BG 1HR0Q 4AH6A 2JA6G 3RZOH 3PO3H 2Z6KC 3GTGH 2R7FA 1E1OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UU9 Q;  2VUM G;  2AHO B;  4A3E G;  1YI2 A;  4LF6 Q;  1UE1 A;  4P75 A;  1OTC A;  4NXM L;  4WJ4 A;  4DV6 Q;  4DR1 L;  4ME3 A;  4JYA L;  4RG1 A;  2JE6 I;  4KHP Q;  1E3P A;  4POG A;  3HOW H;  4GN5 A;  4L5T A;  4QJF A;  3UDX A;  1VQ5 A;  3A5Z B;  4NXN Q;  3J81 j;  1YZ6 A;  1XMO Q;  4L5Q A;  3FKI H;  2JA5 G;  4JG2 A;  1PV4 A;  1VQ9 A;  4BY1 G;  5M3M G;  4DV7 Q;  4BY7 G;  2K50 A;  3PF5 A;  3J80 i;  4A3L H;  4UY8 C;  1WYD A;  4DR5 Q;  4X64 Q;  4AYB G;  4OO1 G;  2VZA A;  2UUC Q;  3G48 A;  5IP9 G;  2NVX H;  1VQL A;  3HOV G;  3KFU A;  2KHI A;  4PMW A;  3RN2 A;  2EXD A;  4HIK A;  2CCZ A;  3ULL A;  3J7A 5;  1K0R A;  1NTG A;  4LF7 L;  4GKK Q;  3F2D A;  1QVG A;  2OQK A;  3G71 A;  2AKW B;  1VQE A;  4DPG A;  1NJI C;  4X62 Q;  4JOI C;  4A3J H;  3S16 H;  4IOA A;  4IPG A;  4LFB L;  1W3S A;  4DV2 Q;  5IWA Q;  2R92 H;  3H3V I;  1VQD A;  4X65 L;  2KBN A;  3CCV A;  2XGT A;  1E24 A;  1TWF H;  4IJH A;  1EQQ A;  1Q8K A;  1HNX L;  4DV4 L;  3GDE A;  5GRO A;  3U50 C;  1Y14 B;  4OWX B;  4B3R L;  1I94 Q;  1Q7Y C;  4O0A A;  1VQF A;  2D0O A;  1T9H A;  4YCV A;  1VQB A;  1WCM G;  3HOY H;  2Q2H A;  4A3C H;  1BBU A;  1P16 A;  5GAH C;  1B70 B;  3CCU A;  3CME A;  4DK6 C;  1HNW L;  3KYH C;  2KHJ A;  4LF9 L;  3I4M H;  1B7Y B;  2IHF A;  5HGQ A;  1YIT A;  3L0O A;  4PZ7 A;  4DR7 Q;  1N36 Q;  1VQH A;  4Y7N H;  3ULJ A;  3A74 A;  4NPS A;  3T1Y Q;  1BBW A;  3PUZ A;  1Q86 C;  1I6H H;  1L1O B;  3UDG A;  4A3D G;  1CSP A;  4JOI A;  1D8L A;  2CWP A;  1PH5 A;  1CKO A;  4DV5 L;  2UXD Q;  2AWO A;  4KI0 A;  3CCS A;  1VQC A;  1WOC A;  4R4T A;  1GO3 E;  4B3M Q;  1SRU A;  1KAW A;  3KOJ A;  4A3F H;  1VQN A;  1UE6 A;  1LUZ A;  4DUY Q;  2YTY A;  3HOV H;  4JBW A;  4R4O A;  4UP9 A;  3M9B A;  1NBW A;  4OX9 L;  2R7Z G;  4IPC A;  3F2B A;  4AYB E;  2A19 A;  1SFO H;  1I94 L;  3GTM H;  4DR4 L;  1K83 H;  5AJ3 Q;  1EOV A;  4LFC L;  3CC4 A;  1M1K C;  3G4S A;  1QZG A;  4JI0 L;  2OWO A;  5FLX c;  1XNQ L;  2IHE A;  4IFD J;  2NZH A;  4DV3 L;  2NZO A;  2ZJR A;  1PA6 A;  4DV3 Q;  1C0A A;  4JI7 L;  3NEN A;  4GKK L;  1L1O A;  2WAQ E;  4DR3 L;  1JJ2 A;  1SMX A;  3BJU A;  2K75 A;  4R4I A;  3CXC A;  4GKJ L;  1MJE A;  4LFA L;  2RCN A;  1PYS B;  1WFQ A;  2MFI A;  4XIG S;  3FP9 A;  4DK3 C;  3I4N G;  1RIP A;  3JC6 6;  4JI6 Q;  4A3F G;  1SE8 A;  4YY3 Q;  1YBY A;  3KDF B;  4B3M L;  1QUQ B;  3PIO A;  4DNI A;  3STB D;  4DV1 Q;  1VQ4 A;  1PYB A;  1EYG A;  4JI6 L;  4P72 A;  5ELO A;  2ZJQ A;  3S15 H;  1EFW A;  2K14 A;  5IYC H;  4R1J A;  1MKH A;  4B3T L;  3ULP A;  3W1G A;  3S1N H;  2WB1 E;  4IJL A;  3HOZ H;  4QY7 A;  4GKJ Q;  2I5H A;  3DLL A;  3CCR A;  2Q2I A;  2BA0 A;  4JYA Q;  2N8N A;  2BH8 A;  4A3C G;  1JMC A;  1YJW A;  4JBM A;  1HNZ L;  3HOU H;  2ASB A;  2B3G A;  3KF8 B;  4B3T Q;  1L1O C;  4DR2 L;  1PFS A;  1XMQ L;  4EQ5 A;  5M3M H;  1IBL Q;  3GTL H;  4JI0 Q;  4BBS H;  2NN6 G;  1TWH H;  2VY3 A;  3TEH B;  4JI3 Q;  4JI5 Q;  1U5K A;  1C9O A;  1NE3 A;  4DR4 Q;  3VDY A;  2UXB Q;  2MQH A;  4RMF A;  4A3I G;  2CKZ B;  1VQM A;  1QUQ A;  1ASY A;  4PZ6 A;  1HH2 P;  2E2H H;  3PUX A;  4A3L G;  1G29 1;  3CQZ H;  2VQE L;  4A3M G;  3H3V H;  4DUY L;  4LFB Q;  3RLF A;  4DKA C;  1B8A A;  1X3G A;  3BZC A;  3EN2 A;  5K36 G;  2E2J H;  1XPR A;  5J3B A;  5IYD G;  4AQY L;  3HOX G;  5H1S E;  4FDB A;  5GAG C;  1HR0 W;  4DAM A;  2A1A A;  4DUZ L;  3U4V A;  2RHS B;  2K5H A;  1K3R A;  1N36 L;  2JJQ A;  2JA5 H;  3HOU G;  4DR7 L;  1WI5 A;  3KJO A;  2F3I A;  3TRE A;  4WJ3 M;  1N32 L;  1VQJ A;  4JI2 L;  1A62 A;  1OXT A;  4YWL A;  5M5W H;  2CWA A;  3G6E A;  4LF5 L;  4A3E H;  5JJL A;  2ID0 A;  1YVC A;  1VS0 A;  2UXC L;  1UEB A;  4OON A;  1QVC A;  2DGY A;  3TQY A;  2ATW A;  1Z9F A;  2QA4 A;  2YU9 H;  2KEN A;  1A0I A;  4GN3 B;  4IPH A;  3TRZ A;  4A3I H;  4A3B H;  1NY4 A;  1I5F A;  4KHP L;  5JJI A;  5IE8 A;  3K7A H;  3ZJY C;  1U0L A;  1VQP A;  4JI8 L;  2HQL A;  3GTQ H;  4UPA A;  1X65 A;  2UU9 L;  5IWA L;  2F4V L;  3OTO Q;  4A3D H;  4BBS G;  1CKN A;  1V43 A;  4HJ7 A;  5C4X G;  1JB7 A;  4LFC Q;  2CFM A;  4A3K H;  3L7Z C;  1K8G A;  5LMN W;  1AE2 A;  3H15 A;  1YHB A;  1FJG Q;  2FXQ A;  4P74 A;  2C35 B;  4ALP A;  3U58 A;  2UUC L;  1UWV A;  1S72 A;  2JA7 G;  3MEF A;  1IBK Q;  2Q2T A;  3I4O A;  4DR5 L;  3E0E A;  5C0X J;  1VCI A;  3K0X A;  4LF5 Q;  2Y0S G;  3CD6 A;  1N34 L;  4GOP B;  3JAM c;  2A8V A;  4DV5 Q;  2PNH A;  4XTC S;  4AIM A;  2ZJP A;  1J5E Q;  1W2B A;  5JJK A;  1CKM A;  2GN5 A;  1JE5 A;  2JK8 A;  3E9H A;  1EIY B;  4HJ5 A;  2JEA I;  1YHA A;  5C4J H;  4HIO A;  3SGI A;  3S17 H;  4LF4 L;  4K0K Q;  1PH3 A;  3HKZ G;  4IPD A;  2HHH Q;  1X3F A;  1HNW Q;  1Q1E A;  3LGJ A;  3T1H L;  4GNX B;  4HID A;  5M5X H;  2HT1 A;  5IP7 H;  3S1M H;  1Y1V H;  2VW9 A;  4GLA C;  3W5O A;  1N8R C;  3J81 i;  1KXL A;  4OWW B;  2R93 G;  1Q46 A;  3D0F A;  1XJV A;  2IY5 B;  1HJP A;  1IZ6 A;  2V1C C;  5C0X I;  3HKS A;  2B63 H;  5IYC G;  2E5L L;  2JA7 H;  3K80 C;  3HOY G;  3EBE A;  4BXX G;  4X65 Q;  4HJ8 A;  1YJN A;  3HOZ G;  1WJJ A;  4QIW E;  4YCW A;  1N9W A;  1PH4 A;  3FKI G;  5GAD C;  2IT1 A;  4B3S L;  1XMQ Q;  5JEA J;  4IFD G;  1VQ6 A;  4DR2 Q;  5LMN Q;  2E2I H;  3T1H Q;  3I7F A;  3F1Z A;  3NBH B;  2ES2 A;  2EIF A;  3K81 C;  5BR8 Q;  4JV5 L;  3PGZ A;  4JI4 Q;  4L5R C;  1UE5 A;  1Y1W G;  3RNU A;  1KC8 C;  3PIP A;  4QQB X;  1KQS A;  3PV0 A;  3J81 c;  3I4N H;  1NMG A;  4YY3 L;  4IOC A;  2UUB Q;  3MXN B;  1L2F A;  1C7Y A;  1Z47 A;  4R4C A;  1IBK L;  2GVA A;  2AWN A;  3STB C;  1S40 A;  4P71 A;  1IYJ B;  1V9P A;  4A76 A;  3CAM A;  1FJG L;  4NXN L;  4UP8 A;  5FLM H;  1PH9 A;  3UE0 A;  4A93 G;  4YHH Q;  2KCM A;  1XPO A;  2MNA A;  3J7Z C;  4X6A H;  4JV5 Q;  1VQA A;  5BR8 L;  1PH1 A;  2XTI A;  4NXM Q;  3M4O H;  1SN8 A;  1HZC A;  4X66 L;  1X54 A;  4LUV A;  4J15 A;  3HKZ E;  4EX5 A;  4BBR G;  3UDI A;  2R7Z H;  3M3Y H;  4JI8 Q;  2B63 G;  3IRB A;  1X56 A;  2UXB L;  4C3H H;  4Y52 H;  2NN6 I;  1XNR Q;  4DR6 Q;  3I55 A;  1LTL A;  1E22 A;  1P8L A;  3ERS X;  5C44 H;  1Q82 C;  1K9M C;  2PQA A;  2Y0S E;  4GLV B;  1H95 A;  3CCL A;  3ICE A;  3K7U C;  3U4Z A;  1SRO A;  5FJ8 G;  5DLQ E;  1E7Z A;  1L0W A;  2VQF L;  3S24 A;  1Q81 C;  1VQ7 A;  2HHH L;  2WP8 J;  2K5V A;  2I0Q A;  4LF4 Q;  4K0K L;  4LUO A;  1PVO A;  2ZTD A;  1A63 A;  4C2M H;  1YNX A;  4IFD I;  4GS3 A;  4DUZ Q;  1SR3 A;  1WCM H;  3S1Q H;  4TVA B;  1GM5 A;  2ZTC A;  1EWI A;  1J5E L;  1XPU A;  2NVY H;  3GO5 A;  2UUA Q;  5E7N A;  1FVI A;  4A4I A;  3M4P A;  3S1R H;  1BKB A;  2VL6 A;  3BU2 A;  4YCU A;  1VQK A;  4LF9 Q;  3AEV A;  3PO3 G;  3GTJ H;  5FJ8 H;  1YIJ A;  3S2H H;  5LMU Q;  4A3G H;  2VUM H;  3NEM A;  1R9T H;  5FLM G;  1MJC A;  2I5M X;  1G51 A;  2R7D A;  4LFA Q;  3CF5 A;  3M7N A;  1X6O A;  2MO0 A;  1VQG A;  2YYZ A;  4BA2 I;  1X55 A;  1SLJ A;  2I5L X;  1GVP A;  2LXJ A;  2PQA B;  2QGQ A;  3BZK A;  4JI3 L;  4DV4 Q;  4HIM A;  5IY0 A;  1I50 H;  4DR3 Q;  1ASZ A;  2OTL A;  4LF8 Q;  4GLX A;  1J6Q A;  3UDF A;  1IBL L;  1KIX A;  1LYL A;  3E9I A;  4X62 L;  1CUK A;  4YWK A;  1HNZ Q;  3F2C A;  2K4K A;  4LF8 L;  4KLK A;  1V1Q A;  4BBR H;  3I56 A;  5AJ3 L;  2LSS A;  4C3J H;  1TXY A;  2ZM6 L;  3A5U A;  3HOX H;  1QZH A;  2YV5 A;  3A0J A;  1VQO A;  2VS1 A;  2N49 A;  2JQO A;  2B29 A;  4GNX C;  1VQ8 A;  2CQO A;  4X64 L;  3JAM i;  4DV1 L;  5LMU L;  3HFZ B;  1JT8 A;  3W1B A;  4OXP A;  2R6G A;  2JA6 H;  4L5S A;  3AYH B;  3RN5 A;  2NVT H;  2IX0 A;  5C0X G;  1CSQ A;  2YTV A;  1YHQ A;  1TWG H;  1HZA A;  4TQU S;  3B6Y A;  5IYD H;  3GTK H;  3ER0 A;  1TWA H;  5JEA G;  5EAY A;  5C3E G;  2ZM6 Q;  4QL5 A;  1N33 L;  3T1Y L;  1KHI A;  4DV0 Q;  1IBM Q;  2UUB L;  1E1T A;  4AQY Q;  1Y1W H;  4JI4 L;  4JBK A;  3Q8D A;  5C44 G;  4DV6 L;  5IYB G;  2K52 A;  4LW1 A;  1Q12 A;  1PH6 A;  4JI7 Q;  4LF6 L;  3PUV A;  4A3G G;  2PI2 A;  4A3M H;  2IX1 A;  3AQQ A;  3H0G G;  4DAY B;  5M3F G;  3CCJ A;  1N32 Q;  2VQE Q;  1G6P A;  1XNQ Q;  3I4M G;  2L15 A;  2OQ0 A;  1UE7 A;  2K5N A;  1FGU A;  1HR0 L;  3CC2 A;  1VQI A;  2WB1 G;  2JA8 H;  4DR6 L;  3M85 A;  2MO1 A;  1TWC H;  5ELN A;  3RLN A;  4IO9 A;  1HNX Q;  1KD1 C;  1PH8 A;  3KDF A;  4OX9 Q;  2EQS A;  1FL0 A;  1OXS C;  3CW2 C;  3PUY A;  4DV2 L;  2OCE A;  3OYY A;  1AE3 A;  2VNU D;  1GKH A;  4X66 Q;  2YTX A;  4BY1 H;  4JBJ A;  1PH7 A;  1HZB A;  3KLW A;  1K8A C;  2NVQ H;  3PO2 G;  1EIF A;  1IXR A;  2GVB A;  3D31 A;  4A3K G;  4PZ8 A;  2UUA L;  2PI2 E;  4LF7 Q;  4A93 H;  3FHW A;  4POF A;  1O7I A;  4DV0 L;  1IBM L;  3S14 H;  1D7Q A;  3CMA A;  2WAQ G;  5GAE C;  2N78 A;  3WWV A;  1DGS A;  4JI1 Q;  2Z6K A;  3CCM A;  3TS2 A;  3S2D H;  5IYB H;  1AH9 A;  1N34 Q;  2WFW A;  5IP7 G;  3PO2 H;  1N33 Q;  2KCT A;  1LM0 A;  3GTP H;  1K73 C;  1XMO L;  3PF4 A;  3NEL A;  5IP9 H;  3PCO B;  2Z0S A;  3EIV A;  2JA8 G;  2RF4 A;  1JJC B;  2PMZ E;  5C3E H;  4P73 A;  2QEX A;  3GTO H;  4DR1 Q;  1Q1B A;  3CCE A;  4GN4 B;  3OW2 A;  2ZTE A;  3H0G H;  2Q2U A;  4LUZ A;  4BXX H;  4NB3 A;  4KHZ A;  4R4Q A;  5LMN L;  1QVF A;  1BVS A;  4GOP C;  3M4Q A;  1XTD A;  1Y1V G;  2E8G A;  2LXK A;  3OTO L;  1RL2 A;  3CPW A;  2HIV A;  4MZ9 A;  5IT9 c;  3CCQ A;  1X9N A;  1EQR A;  3PSI A;  3HOW G;  4LNQ A;  2E5L Q;  3CP0 A;  4C3I H;  3KJP A;  1CKN B;  4HJA A;  4YHH L;  2R93 H;  3AFQ A;  1NMF A;  2ALY B;  2OTJ A;  2D0P A;  1OXV A;  5M5Y H;  4GOP A;  4MNO A;  1KRS A;  1MIU A;  4BA1 I;  2H5X A;  3UE1 A;  2UXC Q;  3TS0 A;  4LWC A;  3I2Z A;  2DUD A;  4PG3 A;  1YJ9 A;  3KF6 B;  4MTN A;  4YWM A;  4QGU A;  1M90 C;  5M3F H;  4DV7 L;  4JI2 Q;  1GD7 A;  1A8V A;  4A75 A;  2F52 A;  2D62 A;  1OXX K;  2N3S A;  2UXD L;  1IL2 A;  2BA1 A;  4JI1 L;  1KL9 A;  5GQO A;  3RLO A;  3DM3 A;  1PHJ A;  1X3E A;  3K8A A;  2JA9 A;  1JJG A;  4OO1 I;  2HIX A;  3AFP A;  3GD7 A;  5HY6 A;  4JC0 A;  4UP7 A;  4OWT B;  3F8T A;  2VQF Q;  2RHQ B;  4A3J G;  3PUW A;  1I3Q H;  1EUJ A;  4H02 A;  3RZD H;  3L2P A;  3J80 c;  5C4X H;  4O2D A;  4BY7 H;  2F4V Q;  1S3O A;  1YEZ A;  4B3S Q;  4APV A;  3CPF A;  1OXU A;  2R92 G;  3RR5 A;  2JEB I;  1HZ9 A;  1KRT A;  4GNX A;  1XNR L;  3CC7 A;  4B3R Q;  2AMC B;  4JCV E;  4JI5 L;  4HJ9 A;  1PH2 A;  3KF6 A;  2BH2 A;  4A3B G;  1HR0 Q;  4AH6 A;  2JA6 G;  3RZO H;  3PO3 H;  2Z6K C;  3GTG H;  2R7F A;  1E1O A; 
#chains in the Genus database with same CATH topology
 2VUM G;  1WVL A;  1YI2 A;  4NXM L;  4DV6 Q;  3TP6 A;  4RG1 A;  2JE6 I;  1E3P A;  3EFX D;  1TU2 B;  2G5D A;  1I4P A;  2KVM A;  3HP3 A;  1H9S B;  1YZ6 A;  3MXN A;  1ET6 A;  2RDF A;  2DN8 A;  1RHP A;  1ENC A;  2F0S A;  2K33 A;  3J80 i;  4UY8 C;  1WYD A;  1T5E A;  4B9X A;  3RUZ A;  3MXG A;  4AYB G;  2VZA A;  2UUC Q;  3G48 A;  3I91 A;  5EQ0 A;  1VQL A;  4IUR A;  3J7A 5;  4HN7 A;  4MIU A;  3F2D A;  1QVG A;  2AKW B;  4A3J H;  3H0G B;  4YIJ A;  3C2P A;  1HRJ A;  4ODG A;  2KBN A;  2Q8R E;  1BDO A;  3X3N A;  5LL6 X;  3U50 C;  1Y14 B;  4OWX B;  1EY7 A;  2B2Y A;  1I94 Q;  1ZKO A;  3GTK B;  1BR9 A;  4YCV A;  3VR3 A;  3U9S A;  4A3K B;  2LMC B;  2Q2H A;  4I7Z C;  1B9N A;  1RCV D;  4DK6 C;  1GUS A;  4LF9 L;  4A3D B;  3HOU B;  5HGQ A;  4DR7 Q;  3K5L A;  1YIT A;  1N36 Q;  3ULJ A;  1BBW A;  2LKV A;  5C3E B;  1I6H H;  1HFN A;  2WB1 B;  4PQX A;  1JWS D;  1CHQ D;  2HDL A;  1CSP A;  2EYP A;  2UXD Q;  1VQC A;  1NSN S;  5BN3 A;  2Z6B A;  3ITP A;  1UE6 A;  4PMC A;  4DUY Q;  4R4O A;  3M9B A;  3MEH A;  1IW7 D;  1NBW A;  5I6Y A;  3F2B A;  4AYB E;  3TZU A;  1A3T A;  1SFO H;  3GTM H;  2B2V A;  5AJ3 Q;  1EOV A;  3I90 A;  3T4A C;  2OWO A;  2NZH A;  4C1N I;  1LO5 D;  2NVY B;  3HOZ B;  1SMX A;  3BJU A;  4C2M B;  4V19 0;  4ID6 A;  1JOR A;  1WFQ A;  4DK3 C;  5LL6 S;  1RIP A;  4IUT A;  5TSS A;  1SE8 A;  5KGU A;  4YY3 Q;  3KDF B;  1B1Z A;  1UAP A;  1Y8O B;  4A3F B;  2ZJQ A;  2K14 A;  1MKH A;  3S1N H;  2WB1 E;  3HOZ H;  4HCS A;  2EDG A;  3V05 A;  2I5H A;  4G7H C;  4CJ2 C;  4M1U B;  4Q5V A;  2R7Z B;  4JYA Q;  2B2W A;  1JMC A;  1HUN A;  5L37 A;  1XMQ L;  4RHR A;  3BVG A;  1IBL Q;  3GTL H;  4BBS H;  2Q8I B;  5EPK A;  1TWH H;  4JI3 Q;  1NE3 A;  2NVX B;  3VDY A;  2MQH A;  4RMF A;  4A3I G;  3E0J A;  1CZG A;  1C48 A;  3PUX A;  1G29 1;  4A3G B;  3RLF A;  1ZEQ X;  1RD9 D;  2A68 C;  3A8J E;  3EN2 A;  5J3B A;  1STG A;  4J6H A;  5GAG C;  3PMF A;  4G4K A;  1K3R A;  4DGZ A;  1N36 L;  4RCO A;  1AZQ A;  1EEF D;  2JXM B;  2JA5 H;  2BDO A;  2F3I A;  4WJ3 M;  1VQJ A;  1A62 A;  2QDL A;  5C44 B;  2A6E D;  3OIP A;  4OON A;  3S1R B;  5AFW A;  1VDZ A;  3D8G A;  2ATW A;  3KBX A;  4DK0 A;  3A7A B;  1LTR D;  3K7A H;  3ZJY C;  1VQP A;  4JI8 L;  3HOW B;  4UPA A;  1EY0 A;  4K5X A;  4BBS G;  4HJ7 A;  5G3L F;  5C3W A;  4IUN A;  3VR6 A;  3OOC A;  3HOY B;  1HQR D;  2A69 C;  3A54 A;  3H15 A;  2XVS A;  4P74 A;  5JJZ A;  1AP0 A;  2UUC L;  2JA7 G;  1S72 A;  1LTI D;  3DEO A;  1IBK Q;  3I4O A;  4LF5 Q;  2BDN A;  4GOP B;  2SNS A;  4AIM A;  5LHY 1;  1J5E Q;  4BS9 A;  1S5B D;  1G91 A;  1VF5 C;  1JE5 A;  1MBY A;  1YHA A;  5DM6 3;  5KND A;  2K1B A;  4K0K Q;  5EBC A;  2F0D A;  2FMM A;  3PO3 B;  1Q1E A;  2FJ2 A;  4KKS A;  2QIL A;  2VW9 A;  4GZY C;  2B2U C;  3W5O A;  1KXL A;  1V1O A;  3J7A V;  3R3O A;  2R93 G;  4H7B A;  1XJV A;  3MVV A;  4FYD A;  4C3I G;  3HKS A;  5D65 A;  1EY5 A;  1CZW A;  2E5L L;  3EBE A;  3P1H A;  3FEW X;  5E1F A;  4X65 Q;  3HOZ G;  1WJJ A;  3AB9 A;  1N9W A;  4A3E B;  1PH4 A;  2IT1 A;  1XMQ Q;  1QIL A;  2ES2 A;  4ZKC B;  5T1I A;  5COY A;  2X6L A;  3R2T A;  1JOK A;  1S5F D;  2F0M A;  4DK1 A;  3NBH A;  4ZUJ A;  4A93 B;  3TME A;  3PIP A;  2WII B;  4NW2 A;  1SYF A;  1V1P A;  3R93 A;  4H44 C;  4YY3 L;  4RKB A;  4IOC A;  3I3C A;  2NN6 H;  3TDQ A;  2UUB Q;  2NBF A;  1U4L A;  2AWN A;  2CW0 C;  3STB C;  1FJG L;  1RTO A;  3UE0 A;  2KCM A;  2PZT A;  4CKB A;  1PDQ A;  1SN8 A;  3ND9 A;  5ISR A;  4X66 L;  3D4W A;  4LUV A;  3HKZ E;  3GTQ B;  2RQX A;  2DY8 A;  1WTX A;  2NUC A;  3QR8 A;  2NN6 I;  4AYB B;  1E22 A;  3QO2 A;  5M5W B;  2QW7 A;  2Y0S E;  4GLV B;  1MGS A;  3ICE A;  4K2L A;  1F9Q A;  2JYO A;  1SRO A;  1Q81 C;  2L0C A;  2HHH L;  2WP8 J;  5C0X H;  1YNX A;  4GS3 A;  1D1I A;  3NE5 B;  4Q0F A;  1XPU A;  5E7N A;  3BU2 A;  4MTK A;  3AEV A;  4CDD C;  4LAA A;  1R9T H;  2I5M X;  1K83 B;  5G3L D;  4LFA Q;  3CF5 A;  1X6O A;  1VQG A;  2F0U A;  1X55 A;  4RKL A;  4DR3 Q;  3LNN A;  4GLX A;  1J6Q A;  1D5X C;  3E9I A;  1HNZ Q;  2PPB C;  4LF8 L;  4BBR H;  2RVL A;  5AJ3 L;  3ZYY X;  4IN3 A;  1E2Z A;  4HCE A;  2CHB D;  4R8N A;  4GNX C;  1JT8 A;  1LT4 D;  2IX0 A;  1CSQ A;  5KYL A;  4EQP A;  3ER0 A;  1TWA H;  4C56 C;  3MXP A;  5EAY A;  5C5M A;  3HGB A;  4JI4 L;  3EJI A;  1E2W A;  3Q8D A;  4EQO A;  1SJH D;  4MHE A;  3OPO A;  4FF4 A;  1EY9 A;  4TSS A;  3CCJ A;  4KKU A;  2OQ0 A;  1UE7 A;  2K5N A;  3V96 A;  3CC2 A;  3RMH A;  3IKJ A;  4RCN A;  1TWC H;  3RLN A;  4C3J B;  3DWQ A;  5EKK A;  2B2T C;  3HOV B;  2EY1 A;  1FL0 A;  2RKS A;  4DV2 L;  2OCE A;  3OYY A;  1GKH A;  1Q8I A;  4CBV A;  4JBJ A;  2DJF C;  1M8A A;  3KLW A;  1EIF A;  1IXR A;  2N88 A;  4LF7 Q;  1WCM B;  3S1Q B;  2A6H C;  1DD2 A;  3SXH A;  1I50 B;  2OF1 A;  4DV0 L;  1D5M C;  5GAE C;  3KF8 A;  3SVM A;  1KLG D;  4ABN A;  1F2Y A;  2Z6K A;  1H9S A;  4O1N A;  3NWT A;  3QOJ A;  1K73 C;  1XMO L;  1IYU A;  2D9U A;  5ELE A;  2Z0S A;  1D2B A;  2RF4 A;  4P73 A;  2R92 B;  3CCE A;  3OW2 A;  4FF3 A;  3S16 B;  4KHZ A;  3I73 A;  1BVS A;  2ICE C;  4XXE A;  2E8G A;  3CPW A;  1RL2 A;  2Z4H A;  1BCP B;  5IT9 c;  1X9N A;  1M4V A;  4IQZ A;  4DNT B;  1CKN B;  3Q22 A;  1RJT A;  1GJX A;  2DNC A;  4H0L C;  2ALY B;  2D0P A;  2IW3 A;  1MIU A;  4L63 B;  3N52 A;  2H5X A;  4UDU C;  1KNA A;  1ONL A;  2UXC Q;  4KK7 A;  2UUB L;  1N33 L;  1BQQ T;  3KF6 B;  4MTN A;  2ZT9 C;  4YWM A;  4F88 A;  1WTP A;  1OXX K;  2I07 B;  2ZXR A;  3DM3 A;  1PHJ A;  4CHT B;  1A2U A;  1LT3 D;  1JJG A;  4OO1 I;  1EWC A;  2HIX A;  3DUZ A;  4EQN A;  1SMY D;  3GD7 A;  1IHZ A;  4U68 A;  4A3J G;  2RHQ B;  1I3Q H;  4H02 A;  2ICI A;  3J80 c;  1RKN A;  2AQ1 B;  4RA8 A;  1EQV A;  4B3S Q;  2F0V A;  4WRD A;  2PO4 A;  1DOL A;  2R92 G;  5CBA E;  4GNX A;  2EYF A;  4JCV E;  1EEI D;  3KF6 A;  1RTN A;  3SR1 A;  1HR0 Q;  2F3V A;  2JA6 G;  3RZO H;  3HG9 A;  4JVZ A;  3GTG H;  2M9V A;  5IOC A;  1CA6 A;  4LF6 Q;  1UE1 A;  4P75 A;  4RGN A;  3RZO B;  4DR1 L;  3A8K E;  4ZQ3 A;  3NQT A;  4KHP Q;  3HOW H;  1FYC A;  4QJF A;  4NXN Q;  3J81 j;  1WTR A;  1XMO Q;  2Z9H A;  3FKI H;  3NTI A;  1K28 A;  4DV7 Q;  4BY7 G;  1QJO A;  2E2D C;  1UNS A;  4A3L H;  4DR5 Q;  1I3Q B;  1EQT A;  2WKD A;  5CV7 A;  1ET9 A;  5IP9 G;  3HOV G;  3PIP 3;  2L12 A;  3RN2 A;  4HIK A;  1K0R A;  1NTG A;  4WJW A;  3G71 A;  3P20 A;  4DPG A;  1NJI C;  4JOI C;  4IOA A;  2HCC A;  4DV2 Q;  2MPM A;  5JAV A;  2R92 H;  3H3V I;  1ENA A;  1VQD A;  4X65 L;  3CCV A;  1TWF H;  2PZW A;  1Y8P B;  1G2T A;  1WCM G;  4K2K A;  4A3C H;  4ZRZ A;  2E74 C;  1J8I A;  3AU7 A;  2EYJ A;  3I4M H;  2IHF A;  4DN4 M;  4Y7N H;  3A74 A;  4NPS A;  2IPK D;  3PUZ A;  2K32 A;  4G7O C;  1L1O B;  3UDG A;  1ESR A;  4A3D G;  1D8L A;  2CWP A;  4HMJ A;  1CKO A;  1PTO D;  4DV5 L;  4NKL A;  2KHS A;  3D6C A;  2K6A A;  1NR2 A;  4A3F H;  1KAW A;  3KOJ A;  2E2H B;  1A6X A;  1A3U A;  2YTY A;  4JBW A;  3HOV H;  1ZXT A;  2RDG A;  1I94 L;  4DR4 L;  2EVB A;  1FR3 A;  3HOX B;  1QOH A;  1K83 H;  1STA A;  1II3 A;  4DAV A;  2WV6 D;  5EKL A;  2SDF A;  5D14 A;  4IFD J;  1SNM A;  5FLX c;  2IHE A;  3MHB A;  2NZO A;  1KAA A;  3TP5 A;  3L3O C;  4GKK L;  1L1O A;  5IGC A;  2WAQ E;  4DR3 L;  3J7A F;  4G57 A;  1I6H B;  1QB5 D;  3KK7 A;  1TWC B;  2NVT B;  3HEJ A;  1SFO B;  4RH6 A;  3GTM B;  3FP9 A;  3BDC A;  1NCV A;  4ZUI A;  3SK4 A;  1GUG A;  3V2T A;  1YBY A;  2VUM B;  1L0X B;  1QUQ B;  4DNI A;  1TY0 A;  3STB D;  1EYG A;  1PYB A;  4P72 A;  3S15 H;  3FRP B;  1EFW A;  1G8Z D;  1O7L A;  3ULP A;  1O78 A;  3DLL A;  1HA6 A;  4IZ8 A;  3NTH A;  2Q2I A;  1EU3 A;  1E2V A;  2F0L A;  1SMY C;  2OXP A;  1PLF A;  1YJW A;  4JBM A;  2K5W A;  3H94 A;  3VR2 A;  2ASB A;  4FVM A;  1L1O C;  4B3T Q;  4DR2 L;  4EQ5 A;  5M3M H;  4JI0 Q;  1J9O A;  2NN6 G;  4JI5 Q;  2EY2 A;  2RSO A;  4DR4 Q;  1QUQ A;  1EZ8 A;  2G9H D;  4PZ6 A;  1HH2 P;  2OT2 A;  4A3M G;  3LWE A;  2PW5 A;  4DKA C;  1X3G A;  4A3J B;  2E2J H;  3VYT A;  1XPR A;  1QCB D;  3NSW A;  5H1S E;  4FDB A;  2A5H A;  3U4V A;  2RHS B;  3I4M B;  3FPU B;  2JJQ A;  3D6W A;  4DR7 L;  3KJO A;  3TRE A;  1CQV A;  1N32 L;  1OXT A;  3VYU A;  5M5W H;  3G6E A;  3T16 A;  2UXC L;  4HED A;  4QF4 A;  3TQY A;  1BCP D;  5A35 A;  1SNC A;  1A0I A;  4GN3 B;  2Q8T A;  3TP7 A;  3TRZ A;  3K58 A;  1LTA D;  3GTQ H;  3D4D A;  1B53 A;  1ILQ A;  1MSG A;  2J0T D;  4KKT A;  2L11 A;  4BY1 B;  3Q6S A;  1CM9 A;  2K5D A;  2VXW A;  3I70 A;  3KUP A;  1STB A;  4C3H G;  3K57 A;  1AE2 A;  2CH4 A;  1PZJ D;  3U58 A;  2A6E C;  4IFD H;  5FKA C;  2KOL A;  2Q2T A;  1ICF B;  2B2W C;  3CD6 A;  1Y1V B;  2Y0S G;  4BY7 B;  3CRL C;  3MZ5 A;  3A8I E;  4WOR A;  2PNH A;  2MGS A;  5DAU A;  1CKM A;  3MFG A;  2B2U A;  5C4J H;  3SGI A;  4LF4 L;  3HKZ G;  1X3F A;  1HNW Q;  3ERQ A;  3LGJ A;  3S1M H;  1Y1V H;  3BDL A;  1H9M A;  1N8R C;  4OWW B;  1CFM A;  3D0F A;  2IY5 B;  2V1C C;  5C0X I;  2MJ8 A;  2B63 H;  1GUW A;  4HJ8 A;  3TZD A;  4B3S L;  5GAD C;  3PO2 B;  4IFD G;  5JEA J;  3J80 L;  2HDM A;  3F1Z A;  1EZ6 A;  2A6H D;  4JV5 L;  3PGZ A;  3QB3 A;  4JI4 Q;  2X69 A;  1FGB D;  3VA7 A;  1PZK D;  2A74 C;  5ELC A;  3QG1 A;  4KMU C;  2FFK B;  3I4N H;  3J81 c;  3T51 B;  2IL8 A;  1EYD A;  1CTM A;  1F2Z A;  1L2F A;  1C7Y A;  4R4C A;  1IBK L;  4P71 A;  1DOM A;  2AQ3 B;  5FLM H;  1B44 D;  2QEJ C;  3NPP A;  4X6A H;  2EYM A;  2XTI A;  2E75 C;  1HZC A;  4KY5 A;  3TSS A;  4EX5 A;  3M3Y H;  4JI8 Q;  2F0I A;  1B50 A;  3IRB A;  2UXB L;  3MXU A;  4Y52 H;  5EPJ A;  4FP5 D;  2SOB A;  2XIW A;  3I55 A;  1LTG D;  2LY7 A;  2CW0 D;  1H95 A;  1VF7 A;  2F4I A;  3U4Z A;  1MSH A;  4RGM A;  5FJ8 G;  4A3G G;  1N32 Q;  2A68 D;  3S24 A;  1VQ7 A;  1A63 A;  1KTK A;  1BUV T;  4C2M H;  1DYQ A;  1SR3 A;  1EFI D;  4TVA B;  1HHV A;  1TR5 A;  2NVY H;  1SYG A;  2I46 A;  1BKB A;  1A15 A;  4YCU A;  2Y0S B;  2K5Q A;  3QJY A;  5I9O A;  2JA5 B;  3M7N A;  2MO0 A;  1TWH B;  1GVP A;  4DV4 Q;  2QGQ A;  2A8V A;  1X32 A;  3ERO A;  5IY0 A;  4K14 A;  1U4P A;  3OHX C;  1X3P A;  4U67 3;  1BCP F;  4ZLT F;  3KLR A;  1R4Q B;  4DU9 A;  5NUC A;  2LSS A;  1D6E C;  1TXY A;  5K5P A;  4IAL A;  3HOX H;  3DWA A;  5KRU A;  2ZM6 L;  1QZH A;  2CVR A;  1HXY D;  1GUO A;  1ILP A;  2N49 A;  2JQO A;  5IGE A;  1SYB A;  2KEE A;  3BYY B;  3MAQ A;  5LMU L;  1U9R A;  3HFZ B;  2R6G A;  2JA6 H;  3AYH B;  2FMC A;  1DZ1 A;  1YHQ A;  1HZA A;  4TQU S;  3B6Y A;  1VMP A;  3GV3 A;  3GTK H;  3KLS X;  5IYD H;  1Y1W B;  3Q24 A;  4QL5 A;  3T1Y L;  3PIO 3;  2TSS A;  1Y1W H;  4DV6 L;  3A56 A;  2K52 A;  4JI7 Q;  5DNF A;  2PI2 A;  1EYC A;  3H0G G;  5CV4 A;  5M3F G;  3QOL A;  1G6P A;  1HR0 L;  1H9J A;  1TY2 A;  1VQI A;  2WB1 G;  2MO1 A;  5ELN A;  1EU4 A;  1B3Q A;  2EQS A;  3PUY A;  2VNU D;  2YTX A;  1CI3 M;  1HZB A;  2NVQ H;  1SNO A;  2GVB A;  4A3K G;  2UUA L;  1IBM L;  3L9A X;  3WWV A;  1Z7T A;  2NYZ D;  2G9D A;  2PZU A;  5ELB A;  1QWY A;  5IP7 G;  4N8F A;  1XYI A;  3LWU A;  4R9W A;  1SNQ A;  3NEL A;  5IP9 H;  3I4N B;  3PCO B;  4KN4 C;  1K8O A;  3N6R A;  2JA8 G;  2WAQ B;  4OL7 A;  3SK5 A;  4CDF C;  3IL8 A;  4OHJ A;  4RHS A;  3GTO H;  4DR1 Q;  4GN4 B;  4FO2 A;  2ZTE A;  4BXX H;  4NB3 A;  1QVF A;  3M4Q A;  3MFY A;  2OEO A;  1F9P A;  4ZKB B;  2IWH A;  1QE6 A;  4OIK A;  4MZ9 A;  1F2M A;  3CCQ A;  3OWE B;  3PSI A;  3HOW G;  2K04 A;  2J7Z A;  5EJW A;  1AEX A;  1OO9 B;  3TBI B;  1NMF A;  2PMZ B;  2SEB D;  1OXV A;  5M5Y H;  4GOP A;  1XX8 A;  4MNO A;  3M3Y B;  2PQE A;  3DEP A;  4LWC A;  3NXW A;  4DAP A;  1YJ9 A;  5M3F H;  1A8V A;  4A75 A;  2F52 A;  2BA1 A;  4HAE A;  2O4X A;  2PNR C;  2EE1 A;  3WDN A;  4FXG C;  5E3F A;  1X3E A;  3K8A A;  2JA9 A;  2KQ3 A;  4JC0 A;  1PFB A;  4ZYS A;  4UP7 A;  2VQF Q;  2XRQ D;  4FF2 A;  3E5S A;  3RZD H;  3OW7 A;  4BY7 H;  5CYU A;  2KA7 A;  4APV A;  3CPF A;  1O7Z A;  4JW0 A;  4A3I B;  1KRT A;  2EYH A;  4B3R Q;  2R93 B;  2EJF C;  2BH2 A;  4AH6 A;  2B8F A;  1KAB A;  3PO3 H;  2Z6K C;  4CJ0 B;  1HPC A;  2R7F A;  1MD2 D;  1E1O A;  4BY1 H;  2UU9 Q;  5DEH A;  3ND8 A;  1JQY D;  4JYA L;  2JSO A;  1WTW A;  4POG A;  2NWG A;  3OSO A;  3NBI A;  1VQ5 A;  2E76 C;  3X3M A;  2KJX A;  2F0G A;  2K03 A;  4JG2 A;  1VQ9 A;  4BY1 G;  2K50 A;  3PF5 A;  1DM0 B;  2WAC A;  4N9P A;  2F0T A;  1QG7 A;  3KFU A;  2KHI A;  4PMW A;  5C4Z A;  3DHQ A;  1AZP A;  1LLR D;  4MN3 A;  4GKK Q;  2OQK A;  1VQE A;  3URY A;  4K8I A;  1W3S A;  1G6Z A;  1TQO A;  3GTO B;  1ZYR C;  3A55 A;  3K5M A;  4IJH A;  1E24 A;  4QIW B;  1TS2 A;  1WTH A;  4DV4 L;  2F1M A;  3GDE A;  4B3R L;  1V8Q A;  4O0A A;  1VQF A;  3S15 B;  2D0O A;  2HD3 A;  1GHJ A;  3NK9 A;  4NDX A;  5KNC A;  3CME A;  1O7Y A;  2AUJ D;  2KHJ A;  4A3M B;  3GQB A;  2M2L A;  3OMC A;  3C1F A;  4KJN A;  3H91 A;  5JPN C;  1BNZ A;  3T1Y Q;  2KEC A;  3I72 A;  1Q86 C;  2Z4I A;  4DA2 A;  2NVQ B;  1O80 A;  4KJO A;  2AWO A;  2DY7 A;  1WOC A;  1SRU A;  2L55 A;  1IKL A;  1SEB D;  1VQN A;  5CV5 A;  5I9P A;  1LUZ A;  1CT1 D;  4UP9 A;  3U9O A;  4P2C B;  2JA8 B;  2A19 A;  3S14 B;  5CV6 A;  4LFC L;  1M1K C;  1S5C D;  1QZG A;  3DWP A;  1XNQ L;  4DV3 L;  2ZJR A;  1C0A A;  1R4P B;  4RFB A;  4K6L A;  4JI7 L;  1E0B A;  3NEN A;  4R4I A;  3CXC A;  3FDT A;  4GKJ L;  5I6W A;  1PRT C;  2MFI A;  4XIG S;  3I4N G;  3JC6 6;  4A3F G;  5M3M B;  4B3M L;  1CK1 A;  3PIO A;  4DV1 Q;  1VQ4 A;  2QCP X;  1F9R A;  1Q90 A;  4IJL A;  1PZI D;  4QY7 A;  4GKJ Q;  4DNR B;  2BA0 A;  4NP5 A;  3CKI B;  2BH8 A;  5IOD A;  2B3G A;  3HZX A;  3KF8 B;  1PFS A;  5IT9 E;  1W6K A;  1PRT D;  4CDC C;  1LTB D;  1K0S A;  3TEH B;  1U5K A;  4DAY A;  1C9O A;  1KLU D;  4I7A A;  1JWU D;  2UXB Q;  1VQM A;  1ASY A;  5C4H A;  4IUU A;  3DMU A;  4A3L G;  3CQZ H;  4RAU C;  3H3V H;  1EYA A;  4DUY L;  1XWE A;  2PCF B;  4L8J A;  1C8C A;  1B2T A;  2X6G A;  1B8A A;  1PXU A;  1B3A A;  5K36 G;  3J81 L;  1FNV A;  4AQY L;  3HOX G;  4KN7 C;  1PMR A;  1HR0 W;  4DAM A;  3F2U A;  4XQN A;  2K5H A;  1H9K A;  3HOU G;  2A69 D;  4LK1 C;  3IAY A;  3J80 E;  4YWL A;  5JJL A;  4LF5 L;  4HTH A;  1EOT A;  5I2X A;  2ID0 A;  3C46 A;  4FXK C;  1UEB A;  2DGY A;  2YU9 H;  4QMG A;  1YNN C;  4A3B H;  1I5F A;  1NY4 A;  1U0L A;  2AQ2 B;  3W2D A;  5IWA L;  3OTO Q;  2CH4 W;  1CKN A;  1V43 A;  1SE3 A;  1I4H A;  1SYD A;  2K05 A;  1SAP A;  3WOE A;  2F0K A;  3L7Z C;  5JOB A;  2EJG C;  2VB3 X;  2F0W A;  5LMN W;  1PFN A;  1FJG Q;  1S4Z A;  2XN9 C;  1QNU A;  2C35 B;  4ZK9 B;  1UWV A;  3MEF A;  3CHB D;  1H9R A;  4DR5 L;  3E0E A;  1BCP C;  3K0X A;  2EXZ A;  3JAM E;  1YNN D;  2RBM A;  5D3D A;  4XTC S;  5KEE A;  2ZJP A;  5JVG 3;  5JJK A;  3S17 B;  1KDA A;  2GN5 A;  2JK8 A;  3E9H A;  1EIY B;  4HJ5 A;  2JEA I;  4HIO A;  3S17 H;  1PH3 A;  3TP8 A;  4GNX B;  5M5X H;  5IP7 H;  4GLA C;  2JA7 B;  1K8M A;  5M9O A;  3EVQ A;  5FLX L;  1Q46 A;  1B9M A;  1HJP A;  1IZ6 A;  1IW7 C;  4DF7 A;  1ENF A;  2KCN A;  3HOY G;  3K80 C;  4BXX G;  2K28 A;  4QIW E;  3FKI G;  1SDF A;  2V4D A;  4O42 A;  2E2I H;  1LTT D;  2EIF A;  3G6J B;  3K81 C;  5BR8 Q;  2F03 A;  4NMZ A;  3RD4 A;  4IUV A;  1STH A;  3NWS A;  3RNU A;  5IGD A;  2EYO A;  2KED A;  4X3U A;  4X3T A;  3BG3 A;  4QQB X;  1HTL D;  3S1M B;  2DJG C;  5CMD A;  1JR0 D;  3MXN B;  1Z47 A;  4RGT A;  1GXD C;  4XQJ A;  1IYJ B;  1V9P A;  3CAM A;  4NXN L;  2GA4 B;  5C4J B;  4XYO A;  4YHH Q;  1XPO A;  1HUM A;  3K59 A;  1SJE D;  3J7Z C;  4JV5 Q;  2K7V A;  5BR8 L;  1Y8N B;  1PH1 A;  3M4O H;  1KDC A;  4IUQ A;  2XRS D;  4UAI A;  1JCK B;  1X56 A;  3EA6 A;  4C3H H;  5IGB A;  2HUG A;  5C3X A;  1GUT A;  1XNR Q;  4DR6 Q;  1FD7 D;  5C6A A;  3ERS X;  5FO9 B;  3BVZ A;  3CCL A;  4H13 C;  5DLQ E;  1E7Z A;  1L0W A;  2I0Q A;  2C9O A;  4K0K L;  1PVO A;  4LUO A;  4XT1 B;  1WTQ A;  4CGY B;  4R8I A;  1SYE A;  2ZXO A;  4IFD I;  4DXG A;  1LTS D;  2FIN B;  1GM5 A;  2ZTC A;  2E2J B;  1TWA B;  4KD3 A;  2L1B A;  2VL6 A;  1VQK A;  1YIJ A;  3S2H H;  3NEM A;  1DCZ A;  1MJC A;  2LFN A;  1G51 A;  2R7D A;  2YYZ A;  2I5L X;  5F2D A;  3WOF A;  3BZK A;  1ASZ A;  1NUC A;  4JI3 L;  2OTL A;  4HIM A;  5I2Y A;  1I50 H;  4LF8 Q;  2BOS A;  4C1N K;  4BBR B;  1KIX A;  1IBL L;  1LYL A;  3GV6 A;  4X62 L;  2R61 A;  3F2C A;  4J8Q A;  1KNE A;  3I56 A;  5JVH 3;  4C3J H;  3A5U A;  2HCI A;  1TWG B;  4KTA A;  2VS1 A;  2B29 A;  1VQ8 A;  5KIX A;  5IGF A;  3JAM i;  4DV1 L;  1SXT A;  3W1B A;  2CQA A;  2P5Z X;  1LAB A;  3SK8 A;  3RN5 A;  5C0X G;  2YTV A;  1PTO H;  1YNJ C;  5C3E G;  4LJZ C;  1KHI A;  1HFG A;  4DV0 Q;  1E1T A;  4K5V A;  4AQY Q;  5IIF A;  4JBK A;  3NHH A;  5IYB G;  3LX0 A;  4LW1 A;  1Q12 A;  4CKE A;  1PH6 A;  3PUV A;  1BOS A;  1JC7 A;  4A3M H;  1UEA B;  3I4M G;  2L15 A;  1FGU A;  1BXT A;  1PH8 A;  3KDF A;  1OXS C;  2NZ1 D;  2IJ0 A;  3HRZ C;  4HSP A;  4X66 Q;  5FLX E;  1PH7 A;  2F0O A;  4QUC A;  1AW7 A;  4L6T B;  1K8A C;  5EBD A;  4N8X 1;  2EOT A;  3D31 A;  1PRT B;  4A93 H;  1JOO A;  3FHW A;  4POF A;  1O7I A;  2ZXP A;  5KYI A;  1DJR D;  4QCL A;  2WAQ G;  2N78 A;  1XXG A;  1DGS A;  2B39 A;  3CCM A;  3S2D H;  1R9T B;  5IYB H;  2F0N A;  1AH9 A;  1IYV A;  2WFW A;  2K01 A;  4IUP A;  4UHV A;  1N33 Q;  2KCT A;  1LM0 A;  3GTP H;  5KNB A;  2B2T A;  2WIN B;  1JJC B;  1STE A;  2PMZ E;  1D1K A;  1I6V C;  2QEX A;  1Q1B A;  2Q2U A;  3K0Y A;  5C4X B;  4K8J A;  4GOP C;  1BO0 A;  1XTD A;  3BZD B;  1EQR A;  4LNQ A;  2E5L Q;  3CP0 A;  4C3I H;  1LT6 D;  3KJP A;  4HJA A;  2R93 H;  3CRK C;  1ESF A;  4OEM B;  4BA1 I;  3TS0 A;  1RF2 D;  3I2Z A;  2DUD A;  4PG3 A;  4XDX A;  4I65 A;  4QGU A;  4JI2 Q;  2D62 A;  2N3S A;  2UXD L;  1KL9 A;  5J1Z A;  1BF4 A;  5T1G A;  5E4W C;  4C3I B;  1EY8 A;  4JK1 C;  4XT3 B;  3S9W A;  3F8T A;  3DM1 A;  3L2P A;  5C4X H;  4O2D A;  1S3O A;  1L0Y B;  4FNF A;  4KV6 A;  2F0H A;  5EGT A;  1OXU A;  1GHK A;  3M4Y A;  1NR4 A;  2JEB I;  1HZ9 A;  3GP7 A;  1XNR L;  1JOQ A;  4JI5 L;  4HJ9 A;  1PH2 A;  4A3B G;  4M8A A;  2QDB A;  3GTP B;  4HR7 B;  1VMC A;  2R3Z A;  1LAC A;  1WD0 A;  2F4V Q;  4ME5 A;  2AHO B;  4A3E G;  4V0B A;  3HS0 C;  1OTC A;  5JEA H;  4WJ4 A;  1UUP A;  4ME3 A;  4OO1 H;  1PRT F;  4KHV A;  2Z8L A;  4GN5 A;  4L5T A;  3UDX A;  3A5Z B;  1QNK A;  4L5Q A;  2JA5 G;  4Z9C B;  1F9S A;  1PV4 A;  1LV9 A;  3SHL A;  5M3M G;  5M5X B;  4X64 Q;  5CC4 A;  4OO1 G;  2ENB A;  2NVX H;  1PTO F;  4ILW A;  3BS1 A;  1TII D;  2VB2 X;  1F77 A;  2EXD A;  2KCC A;  2CCZ A;  3ULL A;  3G7L A;  4LF7 L;  2L9H A;  4X62 Q;  3S16 H;  4IPG A;  4LFB L;  3FMC A;  5IWA Q;  2F3W A;  1I4Q A;  2XGT A;  1EQQ A;  3D4R A;  1HNX L;  1JIC A;  1Q8K A;  5CR3 A;  5GRO A;  1Q7Y C;  1T9H A;  1PTO B;  1VQB A;  4QB4 A;  3HOY H;  1STN A;  1BBU A;  1P16 A;  5GAH C;  3GTL B;  1TVX A;  4BBS B;  1B70 B;  3S2D B;  3CCU A;  1STY A;  3QWN A;  3KYH C;  1TT2 A;  1HNW L;  2B2Y C;  1B7Y B;  3L0O A;  4PZ7 A;  1ICW A;  1VQH A;  2EY6 A;  2L5T A;  5BN5 A;  5FOB B;  4F8M A;  3MA2 B;  3MWY W;  4JOI A;  1PH5 A;  3VYR A;  4KI0 A;  3CCS A;  4R4T A;  1GO3 E;  4B3M Q;  2L4N A;  2SNM A;  4K5W A;  1SNP A;  2R7Z G;  4OX9 L;  1ROD A;  4IPC A;  2PW7 A;  3P7J A;  3E3X A;  3CC4 A;  4N9T A;  3G4S A;  4EVO A;  4JI0 L;  3SE0 A;  1PA6 A;  4DV3 Q;  2B2V C;  3K5N A;  1WTO A;  1FNW A;  1JJ2 A;  2K75 A;  1HQM C;  1CQF A;  5ELD A;  1MJE A;  2RDH A;  3NQI A;  4LFA L;  2RCN A;  1PYS B;  4K6D A;  2XWJ B;  4JI6 Q;  2KUM A;  2Z1C A;  1U4M A;  4JI6 L;  2F0E A;  5ELO A;  3TN2 A;  2PYK A;  3H3V C;  5IYC H;  4R1J A;  1IKM A;  2MHV A;  3W1G A;  3SK6 A;  3NUC A;  1DOK A;  1K3B C;  3CCR A;  4X3K A;  3P75 A;  2N8N A;  4XYQ A;  2AUK A;  4A3C G;  5JPM C;  1HNZ L;  3HOU H;  4RGO S;  2VY3 A;  2O5I C;  3C3L A;  1JWM D;  3QIA A;  2CKZ B;  3FPP A;  2E2H H;  2VQE L;  3S2H B;  5C5L A;  4LFB Q;  1PYW D;  3BYT B;  3BZC A;  5IYD G;  4OIJ A;  4PNY A;  2A1A A;  4Y7N B;  4DUZ L;  1WI5 A;  2DNE A;  3UI2 A;  4JI2 L;  2D2C C;  1TS3 A;  3MC0 B;  2CWA A;  2RCF A;  4A3E H;  1DON A;  4OEL B;  1YVC A;  1B4O A;  1VS0 A;  1QVC A;  1Z9F A;  2QA4 A;  2QF7 A;  2KEN A;  1CHP D;  4IPH A;  1TKW B;  2NB0 A;  4A3I H;  3Q0A A;  4FXD A;  1HA5 A;  2HQE A;  4KHP L;  5JJI A;  5IE8 A;  1I4X A;  1KDB A;  2HQL A;  2J4X A;  5ELF A;  4EGV A;  5A2Q E;  1X65 A;  2MUY A;  2UU9 L;  3RZD B;  2F4V L;  4A3D H;  3KBG A;  2XNA C;  3PQI A;  5C4X G;  4JPB W;  1JB7 A;  5EPL A;  4LFC Q;  2CFM A;  2EYL A;  4A3K H;  1K8G A;  1YHB A;  2FXQ A;  4ALP A;  3BVM A;  2EZV A;  2N55 A;  1SND A;  1GUN A;  1VCI A;  5C0X J;  1D5Z C;  2A73 B;  4LMQ D;  1N34 L;  3FKI B;  1SE2 A;  3JAM c;  1F2L A;  4DV5 Q;  5M5Y B;  3M4O B;  2RSN A;  2XWB B;  1W2B A;  1NAP A;  3EQL C;  4KD4 A;  2RA4 A;  3DXJ C;  4IPD A;  1WD1 A;  2HHH Q;  2E2I B;  4PV1 C;  4HSV A;  4TKO B;  3M7G A;  3T1H L;  4HID A;  2B8G A;  5M3F B;  2HT1 A;  1HTP A;  3J81 i;  3I8Z A;  4A3B B;  3R8B A;  5IYC G;  2JA7 H;  2H4O A;  1YJN A;  4YCW A;  4OGQ C;  2F0F A;  1VQ6 A;  4DR2 Q;  2C5C A;  5LMN Q;  2BE5 D;  3T1H Q;  3I7F A;  3NBH B;  4ULL A;  3SDZ A;  5I4D A;  3IFT A;  4L5R C;  1UE5 A;  3D3R A;  3OMG A;  1Y1W G;  2D5D A;  1EY4 A;  1KC8 C;  1KQS A;  3PV0 A;  1NMG A;  4CDE C;  2O5J C;  4F87 A;  4DFA A;  3J7Y W;  3IFD A;  2GVA A;  1S40 A;  4A76 A;  4QUF A;  4UP8 A;  1I4R A;  1PH9 A;  3K6O A;  3FVQ A;  4A93 G;  4TRD A;  2MNA A;  2BE5 C;  1PFM A;  1VQA A;  5IT9 L;  4NXM Q;  1MI2 A;  4RWS C;  1X54 A;  4J15 A;  5E4X A;  5FK9 C;  4BBR G;  1I4G A;  3UDI A;  2R7Z H;  2B63 G;  2YU9 B;  3T56 B;  1ML0 D;  3VR5 A;  1TS4 A;  1LTL A;  1P8L A;  3O13 A;  5C44 H;  1Y69 U;  1Q82 C;  1K9M C;  2PQA A;  1SBB B;  1CA5 A;  3K7U C;  2VQF L;  5IGG A;  1XTC D;  4G7Z C;  2K5V A;  4LF4 Q;  1DXM A;  2ZTD A;  3K7A B;  4KY6 A;  1JB3 A;  1A2T A;  4DUZ Q;  1U4R A;  1FNU A;  5J39 A;  1WCM H;  3S1Q H;  1EWI A;  1J5E L;  1JE4 A;  3Q23 A;  3GO5 A;  3JAM L;  2UUA Q;  4F7X A;  1FVI A;  1NNX A;  2F0P A;  2NTS A;  2NTT A;  3M4P A;  4A4I A;  5BN4 A;  3S1R H;  4LF9 Q;  3PO3 G;  4DXF A;  3GTJ H;  5FJ8 H;  4A3G H;  5LMU Q;  2F0Q A;  1S5E D;  2JA6 B;  5CBE E;  2VUM H;  3MTS A;  5FLM G;  3H6M A;  1TS5 A;  4BA2 I;  2PQA B;  1SLJ A;  2LXJ A;  2NVT H;  4E6I A;  1SYC A;  3UDF A;  4B08 A;  5K36 H;  4B9W A;  1CUK A;  4YWK A;  2K4K A;  3CQZ B;  1RDP D;  4KLK A;  1V1Q A;  1AFP A;  4WFN 3;  1SSO A;  4ZAI A;  2YV5 A;  3A0J A;  1VQO A;  2H1E A;  1A3V A;  2CQO A;  4X64 L;  3H09 A;  3VYS A;  4OXP A;  3R2I A;  4L5S A;  3GTJ B;  1EWH A;  1EIH A;  1TWG H;  2MP1 A;  4ZCK A;  1GOZ A;  5JEA G;  2F0J A;  2ZM6 Q;  4FF1 A;  4XQQ A;  3C1E A;  3I4L A;  1IBM Q;  3S1N B;  1BBX C;  5C44 G;  4HMI A;  3T13 A;  4LF6 L;  2IX1 A;  2TMP A;  3AQQ A;  4DAY B;  2QKI C;  1ZYR D;  2JP1 A;  2VQE Q;  3J81 E;  1XNQ Q;  1AN8 A;  3KLS A;  3NP8 A;  2EJM A;  5HGT A;  2EPB A;  4S3S A;  4CKC A;  2JA8 H;  4DR6 L;  3M85 A;  2FHT A;  4IO9 A;  1HNX Q;  1KD1 C;  2O2L D;  1W6J A;  4OX9 Q;  3ONA B;  1TWF B;  3CW2 C;  1Q3L A;  2XSC A;  1YNJ D;  1AE3 A;  4J1M A;  3AMU A;  1C4Q A;  5HUR A;  3HKZ B;  1S5D D;  3PO2 G;  3VA5 A;  1SE4 A;  4PZ8 A;  2PI2 E;  1X3Q A;  1WTV A;  3S14 H;  1D7Q A;  3CMA A;  5FO7 B;  1PTO C;  4JI1 Q;  3TS2 A;  1N34 Q;  3PO2 H;  1V1P B;  1MHW C;  5D3I B;  3PF4 A;  1LT5 D;  3EIV A;  4C3H B;  1IL8 A;  5C3E H;  3E6Z X;  3K5O A;  3OWF A;  5A2Q L;  3H0G H;  5COR A;  5FO8 B;  4LUZ A;  3T53 B;  4R4Q A;  5LMN L;  5EKI A;  5CV8 A;  1Y1V G;  2LXK A;  3OTO L;  3GTG B;  2HIV A;  3BDO A;  4BWG B;  4YHH L;  3AFQ A;  4C3J G;  2B63 B;  5DM7 3;  2OTJ A;  1KRS A;  4CJ1 B;  5J22 A;  3UE1 A;  1M90 C;  4DV7 L;  1GD7 A;  3A7L A;  1IL2 A;  4JI1 L;  2WKC A;  5GQO A;  2M00 A;  3RLO A;  5CV9 A;  2JN4 A;  1T5X D;  3VR4 A;  3W3A A;  2LS0 1;  3AFP A;  1HCZ A;  5HY6 A;  1EY6 A;  4OWT B;  3PUW A;  1EUJ A;  1EL0 A;  2IX3 A;  4PMB A;  1YEZ A;  2EY5 A;  1EIG A;  3SEB A;  2BCO A;  3RR5 A;  1Z6H A;  3CC7 A;  2AMC B;  5CGK A;  3CU7 A;  3NTK A;  4X3S A;  3OIQ A;  1G2S A;  4KY7 A;  4B3T L; 
#chains in the Genus database with same CATH homology
 2UU9 Q;  2VUM G;  2AHO B;  4A3E G;  1YI2 A;  4LF6 Q;  1UE1 A;  4P75 A;  1OTC A;  4NXM L;  4WJ4 A;  4DV6 Q;  4DR1 L;  4ME3 A;  4JYA L;  4RG1 A;  2JE6 I;  4KHP Q;  1E3P A;  4POG A;  3HOW H;  4GN5 A;  4L5T A;  4QJF A;  3UDX A;  1VQ5 A;  3A5Z B;  4NXN Q;  3J81 j;  1YZ6 A;  1XMO Q;  4L5Q A;  3FKI H;  2JA5 G;  4JG2 A;  1PV4 A;  1VQ9 A;  4BY1 G;  5M3M G;  4DV7 Q;  4BY7 G;  2K50 A;  3PF5 A;  3J80 i;  4A3L H;  4UY8 C;  1WYD A;  4DR5 Q;  4X64 Q;  4AYB G;  4OO1 G;  2VZA A;  2UUC Q;  3G48 A;  5IP9 G;  2NVX H;  1VQL A;  3HOV G;  3KFU A;  2KHI A;  4PMW A;  3RN2 A;  2EXD A;  4HIK A;  2CCZ A;  3ULL A;  3J7A 5;  1K0R A;  1NTG A;  4LF7 L;  4GKK Q;  3F2D A;  1QVG A;  2OQK A;  3G71 A;  2AKW B;  1VQE A;  4DPG A;  1NJI C;  4X62 Q;  4JOI C;  4A3J H;  3S16 H;  4IOA A;  4IPG A;  4LFB L;  1W3S A;  4DV2 Q;  5IWA Q;  2R92 H;  3H3V I;  1VQD A;  4X65 L;  2KBN A;  3CCV A;  2XGT A;  1E24 A;  1TWF H;  4IJH A;  1EQQ A;  1Q8K A;  1HNX L;  4DV4 L;  3GDE A;  5GRO A;  3U50 C;  1Y14 B;  4OWX B;  4B3R L;  1I94 Q;  1Q7Y C;  4O0A A;  1VQF A;  2D0O A;  1T9H A;  4YCV A;  1VQB A;  1WCM G;  3HOY H;  2Q2H A;  4A3C H;  1BBU A;  1P16 A;  5GAH C;  1B70 B;  3CCU A;  3CME A;  4DK6 C;  1HNW L;  3KYH C;  2KHJ A;  4LF9 L;  3I4M H;  1B7Y B;  2IHF A;  5HGQ A;  1YIT A;  3L0O A;  4PZ7 A;  4DR7 Q;  1N36 Q;  1VQH A;  4Y7N H;  3ULJ A;  3A74 A;  4NPS A;  3T1Y Q;  1BBW A;  3PUZ A;  1Q86 C;  1I6H H;  1L1O B;  3UDG A;  4A3D G;  1CSP A;  4JOI A;  1D8L A;  2CWP A;  1PH5 A;  1CKO A;  4DV5 L;  2UXD Q;  2AWO A;  4KI0 A;  3CCS A;  1VQC A;  1WOC A;  4R4T A;  1GO3 E;  4B3M Q;  1SRU A;  1KAW A;  3KOJ A;  4A3F H;  1VQN A;  1UE6 A;  1LUZ A;  4DUY Q;  2YTY A;  3HOV H;  4JBW A;  4R4O A;  4UP9 A;  3M9B A;  1NBW A;  4OX9 L;  2R7Z G;  4IPC A;  3F2B A;  4AYB E;  2A19 A;  1SFO H;  1I94 L;  3GTM H;  4DR4 L;  1K83 H;  5AJ3 Q;  1EOV A;  4LFC L;  3CC4 A;  1M1K C;  3G4S A;  1QZG A;  4JI0 L;  2OWO A;  5FLX c;  1XNQ L;  2IHE A;  4IFD J;  2NZH A;  4DV3 L;  2NZO A;  2ZJR A;  1PA6 A;  4DV3 Q;  1C0A A;  4JI7 L;  3NEN A;  4GKK L;  1L1O A;  2WAQ E;  4DR3 L;  1JJ2 A;  1SMX A;  3BJU A;  2K75 A;  4R4I A;  3CXC A;  4GKJ L;  1MJE A;  4LFA L;  2RCN A;  1PYS B;  1WFQ A;  2MFI A;  4XIG S;  3FP9 A;  4DK3 C;  3I4N G;  1RIP A;  3JC6 6;  4JI6 Q;  4A3F G;  1SE8 A;  4YY3 Q;  1YBY A;  3KDF B;  4B3M L;  1QUQ B;  3PIO A;  4DNI A;  3STB D;  4DV1 Q;  1VQ4 A;  1PYB A;  1EYG A;  4JI6 L;  4P72 A;  5ELO A;  2ZJQ A;  3S15 H;  1EFW A;  2K14 A;  5IYC H;  4R1J A;  1MKH A;  4B3T L;  3ULP A;  3W1G A;  3S1N H;  2WB1 E;  4IJL A;  3HOZ H;  4QY7 A;  4GKJ Q;  2I5H A;  3DLL A;  3CCR A;  2Q2I A;  2BA0 A;  4JYA Q;  2N8N A;  2BH8 A;  4A3C G;  1JMC A;  1YJW A;  4JBM A;  1HNZ L;  3HOU H;  2ASB A;  2B3G A;  3KF8 B;  4B3T Q;  1L1O C;  4DR2 L;  1PFS A;  1XMQ L;  4EQ5 A;  5M3M H;  1IBL Q;  3GTL H;  4JI0 Q;  4BBS H;  2NN6 G;  1TWH H;  2VY3 A;  3TEH B;  4JI3 Q;  4JI5 Q;  1U5K A;  1C9O A;  1NE3 A;  4DR4 Q;  3VDY A;  2UXB Q;  2MQH A;  4RMF A;  4A3I G;  2CKZ B;  1VQM A;  1QUQ A;  1ASY A;  4PZ6 A;  1HH2 P;  2E2H H;  3PUX A;  4A3L G;  1G29 1;  3CQZ H;  2VQE L;  4A3M G;  3H3V H;  4DUY L;  4LFB Q;  3RLF A;  4DKA C;  1B8A A;  1X3G A;  3BZC A;  3EN2 A;  5K36 G;  2E2J H;  1XPR A;  5J3B A;  5IYD G;  4AQY L;  3HOX G;  5H1S E;  4FDB A;  5GAG C;  1HR0 W;  4DAM A;  2A1A A;  4DUZ L;  3U4V A;  2RHS B;  2K5H A;  1K3R A;  1N36 L;  2JJQ A;  2JA5 H;  3HOU G;  4DR7 L;  1WI5 A;  3KJO A;  2F3I A;  3TRE A;  4WJ3 M;  1N32 L;  1VQJ A;  4JI2 L;  1A62 A;  1OXT A;  4YWL A;  5M5W H;  2CWA A;  3G6E A;  4LF5 L;  4A3E H;  5JJL A;  2ID0 A;  1YVC A;  1VS0 A;  2UXC L;  1UEB A;  4OON A;  1QVC A;  2DGY A;  3TQY A;  2ATW A;  1Z9F A;  2QA4 A;  2YU9 H;  2KEN A;  1A0I A;  4GN3 B;  4IPH A;  3TRZ A;  4A3I H;  4A3B H;  1NY4 A;  1I5F A;  4KHP L;  5JJI A;  5IE8 A;  3K7A H;  3ZJY C;  1U0L A;  1VQP A;  4JI8 L;  2HQL A;  3GTQ H;  4UPA A;  1X65 A;  2UU9 L;  5IWA L;  2F4V L;  3OTO Q;  4A3D H;  4BBS G;  1CKN A;  1V43 A;  4HJ7 A;  5C4X G;  1JB7 A;  4LFC Q;  2CFM A;  4A3K H;  3L7Z C;  1K8G A;  5LMN W;  1AE2 A;  3H15 A;  1YHB A;  1FJG Q;  2FXQ A;  4P74 A;  2C35 B;  4ALP A;  3U58 A;  2UUC L;  1UWV A;  1S72 A;  2JA7 G;  3MEF A;  1IBK Q;  2Q2T A;  3I4O A;  4DR5 L;  3E0E A;  5C0X J;  1VCI A;  3K0X A;  4LF5 Q;  2Y0S G;  3CD6 A;  1N34 L;  4GOP B;  3JAM c;  2A8V A;  4DV5 Q;  2PNH A;  4XTC S;  4AIM A;  2ZJP A;  1J5E Q;  1W2B A;  5JJK A;  1CKM A;  2GN5 A;  1JE5 A;  2JK8 A;  3E9H A;  1EIY B;  4HJ5 A;  2JEA I;  1YHA A;  5C4J H;  4HIO A;  3SGI A;  3S17 H;  4LF4 L;  4K0K Q;  1PH3 A;  3HKZ G;  4IPD A;  2HHH Q;  1X3F A;  1HNW Q;  1Q1E A;  3LGJ A;  3T1H L;  4GNX B;  4HID A;  5M5X H;  2HT1 A;  5IP7 H;  3S1M H;  1Y1V H;  2VW9 A;  4GLA C;  3W5O A;  1N8R C;  3J81 i;  1KXL A;  4OWW B;  2R93 G;  1Q46 A;  3D0F A;  1XJV A;  2IY5 B;  1HJP A;  1IZ6 A;  2V1C C;  5C0X I;  3HKS A;  2B63 H;  5IYC G;  2E5L L;  2JA7 H;  3K80 C;  3HOY G;  3EBE A;  4BXX G;  4X65 Q;  4HJ8 A;  1YJN A;  3HOZ G;  1WJJ A;  4QIW E;  4YCW A;  1N9W A;  1PH4 A;  3FKI G;  5GAD C;  2IT1 A;  4B3S L;  1XMQ Q;  5JEA J;  4IFD G;  1VQ6 A;  4DR2 Q;  5LMN Q;  2E2I H;  3T1H Q;  3I7F A;  3F1Z A;  3NBH B;  2ES2 A;  2EIF A;  3K81 C;  5BR8 Q;  4JV5 L;  3PGZ A;  4JI4 Q;  4L5R C;  1UE5 A;  1Y1W G;  3RNU A;  1KC8 C;  3PIP A;  4QQB X;  1KQS A;  3PV0 A;  3J81 c;  3I4N H;  1NMG A;  4YY3 L;  4IOC A;  2UUB Q;  3MXN B;  1L2F A;  1C7Y A;  1Z47 A;  4R4C A;  1IBK L;  2GVA A;  2AWN A;  3STB C;  1S40 A;  4P71 A;  1IYJ B;  1V9P A;  4A76 A;  3CAM A;  1FJG L;  4NXN L;  4UP8 A;  5FLM H;  1PH9 A;  3UE0 A;  4A93 G;  4YHH Q;  2KCM A;  1XPO A;  2MNA A;  3J7Z C;  4X6A H;  4JV5 Q;  1VQA A;  5BR8 L;  1PH1 A;  2XTI A;  4NXM Q;  3M4O H;  1SN8 A;  1HZC A;  4X66 L;  1X54 A;  4LUV A;  4J15 A;  3HKZ E;  4EX5 A;  4BBR G;  3UDI A;  2R7Z H;  3M3Y H;  4JI8 Q;  2B63 G;  3IRB A;  1X56 A;  2UXB L;  4C3H H;  4Y52 H;  2NN6 I;  1XNR Q;  4DR6 Q;  3I55 A;  1LTL A;  1E22 A;  1P8L A;  3ERS X;  5C44 H;  1Q82 C;  1K9M C;  2PQA A;  2Y0S E;  4GLV B;  1H95 A;  3CCL A;  3ICE A;  3K7U C;  3U4Z A;  1SRO A;  5FJ8 G;  5DLQ E;  1E7Z A;  1L0W A;  2VQF L;  3S24 A;  1Q81 C;  1VQ7 A;  2HHH L;  2WP8 J;  2K5V A;  2I0Q A;  4LF4 Q;  4K0K L;  4LUO A;  1PVO A;  2ZTD A;  1A63 A;  4C2M H;  1YNX A;  4IFD I;  4GS3 A;  4DUZ Q;  1SR3 A;  1WCM H;  3S1Q H;  4TVA B;  1GM5 A;  2ZTC A;  1EWI A;  1J5E L;  1XPU A;  2NVY H;  3GO5 A;  2UUA Q;  5E7N A;  1FVI A;  4A4I A;  3M4P A;  3S1R H;  1BKB A;  2VL6 A;  3BU2 A;  4YCU A;  1VQK A;  4LF9 Q;  3AEV A;  3PO3 G;  3GTJ H;  5FJ8 H;  1YIJ A;  3S2H H;  5LMU Q;  4A3G H;  2VUM H;  3NEM A;  1R9T H;  5FLM G;  1MJC A;  2I5M X;  1G51 A;  2R7D A;  4LFA Q;  3CF5 A;  3M7N A;  1X6O A;  2MO0 A;  1VQG A;  2YYZ A;  4BA2 I;  1X55 A;  1SLJ A;  2I5L X;  1GVP A;  2LXJ A;  2PQA B;  2QGQ A;  3BZK A;  4JI3 L;  4DV4 Q;  4HIM A;  5IY0 A;  1I50 H;  4DR3 Q;  1ASZ A;  2OTL A;  4LF8 Q;  4GLX A;  1J6Q A;  3UDF A;  1IBL L;  1KIX A;  1LYL A;  3E9I A;  4X62 L;  1CUK A;  4YWK A;  1HNZ Q;  3F2C A;  2K4K A;  4LF8 L;  4KLK A;  1V1Q A;  4BBR H;  3I56 A;  5AJ3 L;  2LSS A;  4C3J H;  1TXY A;  2ZM6 L;  3A5U A;  3HOX H;  1QZH A;  2YV5 A;  3A0J A;  1VQO A;  2VS1 A;  2N49 A;  2JQO A;  2B29 A;  4GNX C;  1VQ8 A;  2CQO A;  4X64 L;  3JAM i;  4DV1 L;  5LMU L;  3HFZ B;  1JT8 A;  3W1B A;  4OXP A;  2R6G A;  2JA6 H;  4L5S A;  3AYH B;  3RN5 A;  2NVT H;  2IX0 A;  5C0X G;  1CSQ A;  2YTV A;  1YHQ A;  1TWG H;  1HZA A;  4TQU S;  3B6Y A;  5IYD H;  3GTK H;  3ER0 A;  1TWA H;  5JEA G;  5EAY A;  5C3E G;  2ZM6 Q;  4QL5 A;  1N33 L;  3T1Y L;  1KHI A;  4DV0 Q;  1IBM Q;  2UUB L;  1E1T A;  4AQY Q;  1Y1W H;  4JI4 L;  4JBK A;  3Q8D A;  5C44 G;  4DV6 L;  5IYB G;  2K52 A;  4LW1 A;  1Q12 A;  1PH6 A;  4JI7 Q;  4LF6 L;  3PUV A;  4A3G G;  2PI2 A;  4A3M H;  2IX1 A;  3AQQ A;  3H0G G;  4DAY B;  5M3F G;  3CCJ A;  1N32 Q;  2VQE Q;  1G6P A;  1XNQ Q;  3I4M G;  2L15 A;  2OQ0 A;  1UE7 A;  2K5N A;  1FGU A;  1HR0 L;  3CC2 A;  1VQI A;  2WB1 G;  2JA8 H;  4DR6 L;  3M85 A;  2MO1 A;  1TWC H;  5ELN A;  3RLN A;  4IO9 A;  1HNX Q;  1KD1 C;  1PH8 A;  3KDF A;  4OX9 Q;  2EQS A;  1FL0 A;  1OXS C;  3CW2 C;  3PUY A;  4DV2 L;  2OCE A;  3OYY A;  1AE3 A;  2VNU D;  1GKH A;  4X66 Q;  2YTX A;  4BY1 H;  4JBJ A;  1PH7 A;  1HZB A;  3KLW A;  1K8A C;  2NVQ H;  3PO2 G;  1EIF A;  1IXR A;  2GVB A;  3D31 A;  4A3K G;  4PZ8 A;  2UUA L;  2PI2 E;  4LF7 Q;  4A93 H;  3FHW A;  4POF A;  1O7I A;  4DV0 L;  1IBM L;  3S14 H;  1D7Q A;  3CMA A;  2WAQ G;  5GAE C;  2N78 A;  3WWV A;  1DGS A;  4JI1 Q;  2Z6K A;  3CCM A;  3TS2 A;  3S2D H;  5IYB H;  1AH9 A;  1N34 Q;  2WFW A;  5IP7 G;  3PO2 H;  1N33 Q;  2KCT A;  1LM0 A;  3GTP H;  1K73 C;  1XMO L;  3PF4 A;  3NEL A;  5IP9 H;  3PCO B;  2Z0S A;  3EIV A;  2JA8 G;  2RF4 A;  1JJC B;  2PMZ E;  5C3E H;  4P73 A;  2QEX A;  3GTO H;  4DR1 Q;  1Q1B A;  3CCE A;  4GN4 B;  3OW2 A;  2ZTE A;  3H0G H;  2Q2U A;  4LUZ A;  4BXX H;  4NB3 A;  4KHZ A;  4R4Q A;  5LMN L;  1QVF A;  1BVS A;  4GOP C;  3M4Q A;  1XTD A;  1Y1V G;  2E8G A;  2LXK A;  3OTO L;  1RL2 A;  3CPW A;  2HIV A;  4MZ9 A;  5IT9 c;  3CCQ A;  1X9N A;  1EQR A;  3PSI A;  3HOW G;  4LNQ A;  2E5L Q;  3CP0 A;  4C3I H;  3KJP A;  1CKN B;  4HJA A;  4YHH L;  2R93 H;  3AFQ A;  1NMF A;  2ALY B;  2OTJ A;  2D0P A;  1OXV A;  5M5Y H;  4GOP A;  4MNO A;  1KRS A;  1MIU A;  4BA1 I;  2H5X A;  3UE1 A;  2UXC Q;  3TS0 A;  4LWC A;  3I2Z A;  2DUD A;  4PG3 A;  1YJ9 A;  3KF6 B;  4MTN A;  4YWM A;  4QGU A;  1M90 C;  5M3F H;  4DV7 L;  4JI2 Q;  1GD7 A;  1A8V A;  4A75 A;  2F52 A;  2D62 A;  1OXX K;  2N3S A;  2UXD L;  1IL2 A;  2BA1 A;  4JI1 L;  1KL9 A;  5GQO A;  3RLO A;  3DM3 A;  1PHJ A;  1X3E A;  3K8A A;  2JA9 A;  1JJG A;  4OO1 I;  2HIX A;  3AFP A;  3GD7 A;  5HY6 A;  4JC0 A;  4UP7 A;  4OWT B;  3F8T A;  2VQF Q;  2RHQ B;  4A3J G;  3PUW A;  1I3Q H;  1EUJ A;  4H02 A;  3RZD H;  3L2P A;  3J80 c;  5C4X H;  4O2D A;  4BY7 H;  2F4V Q;  1S3O A;  1YEZ A;  4B3S Q;  4APV A;  3CPF A;  1OXU A;  2R92 G;  3RR5 A;  2JEB I;  1HZ9 A;  1KRT A;  4GNX A;  1XNR L;  3CC7 A;  4B3R Q;  2AMC B;  4JCV E;  4JI5 L;  4HJ9 A;  1PH2 A;  3KF6 A;  2BH2 A;  4A3B G;  1HR0 Q;  4AH6 A;  2JA6 G;  3RZO H;  3PO3 H;  2Z6K C;  3GTG H;  2R7F A;  1E1O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...