4A3IH

Rna polymerase ii binary complex with dna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 20
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3iH00
2WAQG 1UEBA 4AYBE 3VDYA 1IZ6A 4OWWB 3A5ZB 4YCVA 5M3FG 1N32L 2JA8H 2A1AA 4P74A 5BR8Q 3W1GA 1X6OA 1Z9FA 2RHQB 5IP9G 1PYSB 4DR2Q 3PUYA 1NJIC 3CD6A 5C4XH 4UPAA 4B3ML 3CCVA 3MEFA 2E8GA 4X66Q 1QUQA 2ZJRA 4QL5A 2JA6G 1X54A 2K14A 1CKOA 4L5TA 3ICEA 2UXDL 3CC7A 1K8GA 1RIPA 2NZHA 3S1QH 4AH6A 1PYBA 5IWAQ 5IYBH 3K7AH 3H15A 3T1HQ 1MJEA 2Q2HA 4XIGS 1PH7A 4GKKQ 1HNWL 1NMGA 3M9BA 1KL9A 2PQAA 1EQRA 1VCIA 2EXDA 2KCTA 5C4JH 2H5XA 5AJ3L 4K0KL 3U58A 1HR0W 3DLLA 4X6AH 1IBMQ 2UUCL 3TEHB 2JA5H 1WOCA 4A4IA 4DR3Q 2K5HA 3PF5A 1D8LA 1K0RA 2YTXA 4DR5Q 4LFBQ 3CCLA 1VQAA 1TXYA 4IPDA 4LF9Q 1MIUA 1XTDA 1YHAA 2JE6I 3CW2C 1X3EA 2QA4A 1L2FA 4DV4L 3HOXG 1QZGA 3G6EA 1OXTA 5C0XI 4LF7L 4KHPQ 2UUBQ 4LF6Q 2KENA 4PZ6A 4GOPC 4GN4B 1L1OA 4IJHA 1IBLL 4B3MQ 2JQOA 3E9IA 1K3RA 1J5EQ 5GROA 2OWOA 4LF6L 3K7UC 2Z6KA 2K5VA 4DUZL 5C4XG 4L5QA 2JA5G 3S24A 3NBHB 4P75A 2YTVA 1HZCA 4NXNL 2PI2E 4JI7Q 4BBSH 3CMAA 1UWVA 2B29A 4GN5A 4A3MG 2DUDA 4C3HH 4BBRH 2CCZA 4A3GH 4JI3L 1MJCA 2R7FA 3UDIA 5GAHC 1WCMG 1B70B 4OWTB 3U4ZA 1VQFA 5IY0A 3NENA 5GADC 1N36L 3M4PA 3PUXA 1BKBA 1HNXQ 4UY8C 1XNRL 4OONA 3PSIA 3F8TA 1V9PA 3GTLH 4NXMQ 1YJ9A 4JCVE 4X65L 1GVPA 1PV4A 4B3SL 4JBJA 3J80i 4J15A 5LMNQ 3K8AA 3ERSX 2B3GA 1OXVA 4H02A 5IYCG 3S14H 4DV6Q 4GOPA 2JA6H 3HKZE 4DV2L 2HQLA 4A3FH 2D0PA 2WP8J 4PZ8A 2HT1A 3S16H 4JI5L 2MNAA 1EIYB 5HGQA 2OQKA 4LUVA 5C0XJ 4HJAA 2JA8G 2UUBL 2N78A 1SLJA 1LUZA 5J3BA 4LF4L 2A8VA 1I94Q 5K36G 3CXCA 4DNIA 1CSPA 1N8RC 3S2DH 3MXNB 3GDEA 4DV1L 1A0IA 3DM3A 4A3EH 2VQEL 1J6QA 4BXXG 4YY3L 3HOVG 4B3RL 3E9HA 2K4KA 4A3JG 3U4VA 4JI8L 4JI2Q 4HJ5A 4HJ8A 2ALYB 4LUOA 3TS0A 1PH8A 1WJJA 2JA7H 3PUVA 1B8AA 1P16A 1HH2P 2HIXA 3RNUA 4JI2L 2R93H 2N3SA 1X56A 2PNHA 2ES2A 3GTQH 2RCNA 4QQBX 3CAMA 2QGQA 1Y1WG 1XPRA 2WFWA 4X65Q 1LYLA 1G51A 4B3SQ 1N34Q 5LMNL 2E2HH 4DK6C 5IYBG 3KJPA 3CP0A 2C35B 3F2DA 1Q8KA 1IBKL 3GTKH 1W3SA 1KAWA 3UDXA 3S2HH 4L5RC 3KDFA 3H3VI 4EQ5A 1Q81C 4DAMA 4UP8A 3I4NH 1TWGH 1VQMA 1AH9A 3HKZG 4A3DG 4DUYQ 5FJ8G 1IL2A 4YCWA 5IP9H 1VQOA 1EIFA 2Z6KC 3H0GH 4R4IA 4A3LG 4DV7L 3KF6B 2ZM6Q 2F3IA 2VQFL 4DR4L 3BU2A 4DUYL 4DR6Q 1XNQQ 3M3YH 3STBD 3GD7A 3U50C 1JJ2A 3H3VH 4IPHA 4LWCA 1VQPA 2VW9A 1HR0L 5IE8A 4JI8Q 1S40A 1JMCA 4BXXH 4WJ4A 2YV5A 2HIVA 1HZ9A 4QJFA 3J81j 5LMUQ 4DV5L 2R6GA 4LFAL 2ZJQA 5IYDG 4IFDJ 3ER0A 3BZCA 2UU9Q 5C44H 5BR8L 4DR2L 2IT1A 1VQDA 1JJGA 2CWAA 2VS1A 4LFAQ 1X3FA 4B3TL 4A76A 3KFUA 1H95A 1PH1A 4R4OA 4C2MH 3BZKA 3G48A 3W5OA 1NTGA 3RZOH 4A3DH 4A93H 3L0OA 1G291 4KHPL 1N33L 2NVQH 4YWLA 3CCEA 5IYCH 3PO3G 1FJGQ 1N32Q 3T1HL 3I4OA 1YZ6A 1YHQA 2MO1A 3UDFA 1VQBA 1KRSA 1Q82C 3WWVA 4JV5Q 3PCOB 1DGSA 1IYJB 2OQ0A 4MZ9A 1S72A 4BY1H 4OX9Q 3K80C 3BJUA 4QIWE 5GAEC 1HNZL 5IP7H 5M5YH 4AQYQ 1KIXA 1VQLA 2EIFA 2GN5A 4DR3L 2VZAA 3AFPA 3L2PA 3FKIH 1M1KC 1HR0Q 4GLAC 4IOCA 3I4MG 3CC2A 1A62A 1I3QH 1HZAA 4IJLA 3NELA 2ZTDA 3GTJH 2UXBL 4NXML 1C9OA 2VNUD 1NE3A 1VQCA 3CCSA 2E2IH 3L7ZC 1Y1VH 4YWMA 2K5NA 4A3IH 2R7ZH 1IBML 3S15H 1J5EL 2AKWB 5ELOA 3UE1A 3OTOL 1CKNA 2LXKA 1ASYA 3GTPH 1I5FA 4IO9A 5AJ3Q 4NXNQ 2N49A 2PQAB 4AYBG 2IX1A 1GO3E 3PV0A 4ME3A 4GKJQ 5JJKA 2AWNA 3PO2G 5C3EG 4APVA 4GOPB 3RR5A 4DPGA 4LFCQ 1TWCH 3S1RH 1N9WA 1PH6A 2I5HA 5JJLA 4QGUA 4P71A 2VUMG 4A3MH 3A74A 1M90C 1VQNA 3CCUA 4JI7L 3G4SA 1PH2A 1EYGA 4BY7H 2GVBA 2YYZA 4LFBL 4WJ3M 1VQ6A 3KDFB 5IP7G 2OTJA 1N36Q 1VQEA 3I4NG 1I50H 4HJ7A 4BY1G 2F4VL 1OXXK 4DUZQ 4HIKA 4IOAA 1YI2A 3RLNA 2Q2TA 4BA2I 1BBWA 3FHWA 2BA0A 2RHSB 2Y0SE 3I2ZA 4ALPA 1E22A 3KOJA 4LF8Q 3PO3H 1JT8A 2AMCB 1A63A 5GQOA 4KI0A 1PFSA 5IT9c 4DV2Q 4YY3Q 4YWKA 4B3RQ 4JBKA 2PI2A 4IPCA 2UXCL 5EAYA 1AE3A 2IX0A 4DV0L 1XMOQ 1SR3A 1Q7YC 1FGUA 4PMWA 1QVGA 4POGA 3A0JA 1UE5A 3JAMc 1E3PA 4NB3A 5H1SE 1T9HA 5E7NA 3D0FA 2IHEA 4EX5A 2UUCQ 2R92G 1TWAH 3NEMA 2JEAI 2UUAL 1EWIA 3HOYG 3CCJA 3M7NA 1G6PA 2B63G 3PIPA 2VQEQ 2OTLA 1OTCA 4JI6Q 1VS0A 1X9NA 3GTMH 2NVXH 1I94L 3F2CA 4JI6L 2NVTH 2BH8A 3I56A 3H0GG 4A3LH 2NVYH 3T1YQ 1GKHA 4A3KG 1O7IA 3F2BA 1JE5A 2EQSA 3SGIA 4X66L 3HFZB 1WI5A 3G71A 4A3KH 4JI4Q 4YHHL 3I55A 4JOIA 3KJOA 2HHHL 2KBNA 2N8NA 1VQJA 3TREA 2UXCQ 4YHHQ 2YU9H 4DV0Q 1XMOL 1YHBA 1EOVA 4JI3Q 2MQHA 2I5LX 3HOWH 2L15A 4LUZA 2AHOB 1FL0A 4JYAQ 2GVAA 2NN6G 4GLVB 4BBSG 1XNQL 4XTCS 5GAGC 1BBUA 1YVCA 2K50A 1PH9A 4HIDA 2D0OA 2I5MX 2ZTCA 1K83H 1TWHH 3J81i 1QZHA 1UE1A 1XPOA 1KRTA 4JV5L 3KYHC 3J7A5 4A3EG 4DV5Q 2OCEA 2BA1A 1PH5A 3JC66 2KCMA 1X3GA 4GS3A 3M4OH 1KQSA 3W1BA 4DR1L 3HKSA 3T1YL 3UE0A 2I0QA 2R7ZG 1IBLQ 4B3TQ 2QEXA 1Q86C 1V1QA 4AQYL 2IY5B 2XTIA 4DV1Q 3GO5A 2R7DA 1GD7A 3M4QA 1GM5A 1YJNA 2B63H 4RMFA 1S3OA 2FXQA 4P72A 2NZOA 2ZM6L 2V1CC 1UE7A 1L1OC 3OYYA 4RG1A 3J80c 2UU9L 1K9MC 3PIOA 1FJGL 4HIMA 1VQGA 1PVOA 2LXJA 1CUKA 3RLOA 1JB7A 1VQ4A 4JBWA 1VQ5A 3AFQA 4GKKL 4JI1L 4HIOA 3HOUG 2JEBI 5ELNA 4A3BH 2ZJPA 1E7ZA 4TVAB 2UXDQ 3RLFA 5HY6A 4C3JH 4PZ7A 1VQIA 2F52A 3KF8B 4R1JA 4A93G 4AIMA 4OXPA 3TS2A 3CPFA 3KLWA 3EIVA 4JI5Q 4OO1I 4QY7A 1SN8A 1AE2A 1NY4A 4LW1A 4DR1Q 1D7QA 4BY7G 2Q2UA 4DV4Q 4K0KQ 3LGJA 4DV7Q 1Y14B 1E1TA 2JJQA 3K81C 1FVIA 3CF5A 1XJVA 4GLXA 4X64L 2VUMH 2E5LL 1VQ8A 4A3CG 3STBC 1X55A 3HOXH 2CWPA 2CFMA 4R4TA 1Y1VG 1YIJA 3CC4A 1KXLA 4O2DA 4DR5L 4IPGA 1VQ9A 1PA6A 4OO1G 4UP7A 2D62A 4DR7Q 1HNXL 4JYAL 3PO2H 1YEZA 4A3CH 1A8VA 5C0XG 3HOWG 2KHJA 1I6HH 5JJIA 1EFWA 3FKIG 3OW2A 3EN2A 3S17H 2F4VQ 4JI1Q 2WB1G 2E2JH 5M5WH 4DV6L 2WAQE 5FJ8H 3M85A 1RL2A 3GTOH 1XNRQ 4LF8L 4R4CA 4GNXA 4DV3Q 4HJ9A 3UDGA 1N33Q 3S1MH 2JA9A 4JOIC 4A3IG 1IBKQ 1C7YA 1MKHA 4OWXB 4LNQA 3K0XA 2ATWA 3JAMi 1C0AA 1V43A 3F1ZA 4DV3L 4LF7Q 1YNXA 4X62Q 3CCRA 1Q46A 2WB1E 3D31A 3IRBA 3TRZA 1HNWQ 3I4MH 2CKZB 1CKNB 3J7ZC 4X64Q 2A19A 4X62L 2Q2IA 3RN2A 5M3FH 3GTGH 1HJPA 1Q1BA 2UUAQ 3S1NH 1QUQB 4LF4Q 3CCMA 5JEAG 3AEVA 2MFIA 3HOZH 1VQHA 4LFCL 3PF4A 4A3JH 4DR7L 2ASBA 3ZJYC 4KHZA 1EUJA 2Y0SG 5M5XH 1PHJA 3FP9A 2VL6A 4LF9L 2K52A 5M3MG 5C3EH 4GNXC 1EQQA 4JBMA 1N34L 1LTLA 4O0AA 5FLMH 4BA1I 3TQYA 2LSSA 1XPUA 4P73A 3CMEA 1W2BA 1SROA 4LF5Q 2ZTEA 1P8LA 1SMXA 3E0EA 2JK8A 2NN6I 2IHFA 1IXRA 2XGTA 3I7FA 4FDBA 4C3IH 1QVCA 4GN3B 1L1OB 1OXSC 3EBEA 1BVSA 1R9TH 4LF5L 4UP9A 1L0WA 1X65A 4TQUS 4A3FG 2BH2A 3PUZA 3J81c 5C44G 5FLMG 4MNOA 1Q12A 4JI0Q 2DGYA 1SRUA 3Q8DA 5M3MH 2VQFQ 4DR6L 4DR4Q 4R4QA 3B6YA 5FLXc 3CPWA 3HOUH 4A3BG 2AWOA 2MO0A 4OX9L 2Z0SA 3A5UA 4JI0L 3PGZA 1WCMH 2K75A 4MTNA 3HOZG 1Z47A 3CCQA 4DK3C 4BBRG 3RN5A 1LM0A 4A3GG 4IFDI 4Y7NH 2YTYA 2R93G 1K8AC 1SE8A 1WYDA 3AQQA 1K73C 2JA7G 1XMQQ 2VY3A 5JEAJ 5LMNW 2CQOA 4PG3A 1XMQL 3HOVH 4A75A 4Y52H 2UXBQ 4JI4L 5LMUL 1KHIA 1B7YB 4GNXB 1KD1C 1VQKA 5DLQE 2PMZE 1VQ7A 1QVFA 1HZBA 1Q1EA 4JG2A 1E1OA 1U0LA 4IFDG 1E24A 2KHIA 4NPSA 3KF6A 4L5SA 4DAYB 3OTOQ 1NMFA 1YBYA 1Y1WH 3ULJA 1PH4A 1ASZA 4JC0A 5IWAL 1UE6A 3ULPA 1SFOH 1YJWA 4DKAC 1PH3A 3HOYH 3PUWA 2HHHQ 1KC8C 4GKJL 1JJCB 1TWFH 2R92H 2E5LQ 4YCUA 3AYHB 1OXUA 1WFQA 1YITA 1NBWA 3CQZH 5IYDH 4POFA 3RZDH 2RF4A 3ULLA 2ID0A 1U5KA 1CSQA 4KLKA 1CKMA 1HNZQ
chains in the Genus database with same CATH superfamily
2WAQG 4C3HB 1EY6A 1TVXA 3VDYA 2N55A 3CKIB 3A5ZB 4YCVA 5M3FG 5IGGA 1EQTA 1Z9FA 5IP9G 3S14B 1TR5A 2E8GA 4ZLTF 4C3JG 4X66Q 1LT3D 2JA6G 1HA6A 3HOUB 4RKBA 4A3IB 2UXDL 1K8GA 5D3DA 1WCMB 2J0TD 2EYMA 2NZHA 4KTAA 1MJEA 2K03A 5FLXE 4K6DA 1EQRA 2EXDA 1GHKA 3U58A 1DXMA 4X6AH 4PQXA 1PZJD 2L55A 1PTOC 5LL6S 1BOSA 1K0RA 3GP7A 4IPDA 3CW2C 1X3EA 3HOXG 4A3MB 1VMPA 4IFDH 1YNND 3PIP3 4DXGA 1JE4A 2XWJB 4IJHA 1IYVA 1QCBD 1CTMA 1J5EQ 3EA6A 2Z6KA 2B2UC 5C4XG 4L5QA 1F9SA 4P75A 3A8JE 4Q5VA 5FO8B 4HSPA 1UWVA 4DAPA 2RBMA 3UI2A 1UUPA 4JI3L 1MJCA 2R7FA 3MHBA 1BBXC 1B70B 2AQ3B 1VQFA 2K28A 1HNXQ 2QF7A 3PSIA 5I6YA 5ELCA 3DEPA 4CJ2C 3VA7A 1YJ9A 4NXMQ 4RHRA 4JBJA 1EZ6A 5LMNQ 4H02A 1OXVA 2F0VA 2B2TC 4GOPA 2A69C 2JA6H 3HKZE 1K8OA 4U68A 4JI5L 2HCIA 4IURA 2OQKA 4HJAA 4HN7A 4N9PA 5J3BA 3S1NB 2J7ZA 1CSPA 1H9SA 3MXNB 4M1UB 4DV1L 1A0IA 3T53B 5IGEA 4YY3L 4J8QA 2JA5B 3E9HA 2A74C 4JVZA 4HJ5A 2XIWA 3PUVA 1V8QA 2F4IA 1B8AA 3QB3A 4C1NK 2WV6D 2Z4HA 1EYCA 2QGQA 1I4GA 4C3IB 2WFWA 5FKAC 1R9TB 5LMNL 2IJ0A 4ABNA 2A68C 3NQTA 1IBKL 3GTKH 1KAWA 4NW2A 2E2IB 1MD2D 1Q81C 1VQMA 4A3DG 5FJ8G 4YCWA 1VQOA 4IUNA 3H0GH 1EY4A 4F88A 4DR4L 5TSSA 1XNQQ 3A55A 1R4QB 2B8FA 3U50C 2OT2A 4HCEA 1UAPA 1VQPA 1FNUA 1S40A 3VYSA 2YV5A 2HIVA 4QJFA 1A3VA 1ENAA 4QIWB 2OXPA 3BZCA 3HGBA 1LLRD 2EE1A 1VQDA 2HCCA 4X3TA 1GUWA 1H95A 1SYGA 4R4OA 3G48A 4MIUA 3RZOH 1N33L 3CCEA 1FD7D 4A3EB 3S9WA 1N32Q 1YZ6A 1VQBA 2O2LD 2TMPA 3WWVA 4BY1H 1CQFA 4XQJA 4OX9Q 5IP7H 4AQYQ 5FOBB 1KIXA 2EIFA 1J9OA 4DR3L 1M1KC 3FKIH 4PMBA 2VUMB 1F9PA 2F0KA 2PZUA 1S5CD 1A62A 1FR3A 2F0SA 3T13A 1ZXTA 3QG1A 1FNWA 2UXBL 2VNUD 1VQCA 3L7ZC 4LAAA 4F7XA 3A7AB 4KMUC 5ELOA 1CKNA 1YNJC 4RAUC 2LXKA 1U4LA 2EXZA 1IKLA 1L0XB 3EJIA 1CI3M 1K8MA 4NXNQ 1DONA 4DFAA 1Q90A 4KV6A 2JN4A 3A54A 3PO2G 2KUMA 5C5MA 5DM73 4DPGA 5T1GA 3KBXA 2I5HA 5JJLA 1GJXA 1DOLA 3IL8A 3NTKA 1EWCA 1BDOA 3URYA 3WOEA 1VQNA 3G4SA 2B2YC 1EYGA 1ILQA 2A68D 1PTOB 1RHPA 3KDFB 2F03A 1CK1A 3I4NG 2TSSA 4HIKA 1TS4A 2F0IA 3RLNA 4ALPA 2RCFA 2BA0A 2RHSB 3FHWA 1A63A 4H0LC 1PFSA 3W3AA 4JBKA 4IPCA 1O80A 5DAUA 1FGUA 1Z7TA 5I2XA 2IHEA 4EX5A 3NEMA 2UUAL 3M7NA 1MSHA 4R9WA 1VS0A 1X9NA 3X3MA 4IUUA 2X69A 3F2CA 4JI6L 1SNDA 3I56A 3R8BA 2NVYH 2EQSA 1WI5A 3I55A 2JP1A 1G2SA 3S1RB 3L3OC 1VQJA 2UXCQ 1A3TA 4ZCKA 2YU9H 1YHBA 4FF3A 3F2UA 4KJNA 2AHOB 4KK7A 3ZYYX 2NN6G 4B9XA 2R92B 4XTCS 5GAGC 1YVCA 1A3UA 1PH9A 2ZTCA 2D2CC 1K83H 1GUTA 3AMUA 3J7A5 2P5ZX 2KCNA 2K04A 2OCEA 1NR4A 1WTVA 2KCMA 1X3GA 4H13C 2KEDA 3UE0A 3OHXC 2I0QA 4B3TQ 2QEXA 3SE0A 4KKSA 1W6KA 4AQYL 2IY5B 3H6MA 5COYA 3GO5A 5DEHA 2B63H 2V1CC 5DM63 3OYYA 3J80c 1PVOA 2LXJA 1W6JA 3NPPA 3A56A 3RLOA 4JBWA 1V1PB 2B2UA 1XWEA 1VQ5A 5C4ZA 2RQXA 1EEFD 3DEOA 2QCPX 4HIOA 3HOUG 5ELNA 1GUSA 4A3JB 2RVLA 4TVAB 2UXDQ 3RLFA 5M5XB 1QB5D 4QUCA 4A3KB 1VQIA 5IT9E 4AIMA 3TS2A 1WTOA 3I73A 5EGTA 1SN8A 4LW1A 1EZ8A 4EQOA 3NBHA 4DV4Q 1Y8PB 2JJQA 1HA5A 1S4ZA 1KABA 1FVIA 2VUMH 4X64L 2C9OA 2E75C 5JVG3 4A3CG 2R61A 5EKKA 2CWPA 1CHQD 2CFMA 4XQNA 3HOXH 1YIJA 3J7AV 4DK1A 4KY7A 4ZYSA 2KHSA 3PMFA 2KHJA 3TP5A 3NBIA 5D3IB 4RCNA 4A3GB 4Y7NB 2E2JH 2WAQE 3M85A 3GTOH 3MXUA 1EY7A 1TY2A 3OIQA 5CR3A 2KCCA 3S1MH 3GTLB 2GA4B 3SK4A 3JAMi 3F1ZA 4LF7Q 3CCRA 2WB1E 3D31A 1MHWC 3IRBA 3I4MH 2CKZB 2PPBC 4X64Q 1KNAA 1FGBD 4P2CB 3RN2A 2UUAQ 1QUQB 2J4XA 2RDGA 2G5DA 3NXWA 3K57A 4BY7B 1STHA 1EL0A 3TDQA 4DR7L 1TQOA 1E2ZA 1I50B 2HQEA 2MPMA 2VL6A 4KN4C 4GNXC 5T1IA 4EQNA 3IAYA 1SBBB 1F2YA 2NN6I 3E0EA 1EOTA 1OXSC 4WRDA 4KY6A 5CGKA 2JA8B 2BH2A 4CBVA 3OIPA 2DGYA 4R4QA 5FLXc 4A3BG 2AWOA 4OX9L 1B4OA 1AFPA 5I9OA 3RN5A 4DK3C 4QF4A 4A3GG 3LNNA 1O78A 1LTRD 2N88A 3R2IA 1BR9A 3D8GA 5JJZA 2JA7G 3CRKC 1QNKA 5JEAJ 2EYJA 1Y8OB 2CQOA 3P20A 4K8JA 4KY5A 4PG3A 2UXBQ 5LHY1 1KHIA 1VQ7A 1HZBA 2RDHA 1Q1EA 1U0LA 4B08A 1IKMA 5ELBA 4OL7A 3E0JA 4C3IG 1UE6A 4DKAC 5KYLA 1PH3A 3LX0A 1TWFH 3A8IE 1ML0D 5CV7A 2F0OA 1YITA 5IGFA 5E1FA 1TWHB 4POFA 2CH4W 2B2WC 4IUTA 3HOWG 3DUZA 1BCPB 4X3SA 1UEBA 2EYLA 2K33A 3Q6SA 4AYBE 1IZ6A 4OWWB 4EVOA 4HTHA 4QCLA 1N32L 5EPLA 1ESRA 2HDLA 4P74A 4JV5L 3NE5B 3PUYA 2B63B 4DAYA 3C3LA 4DF7A 2K14A 3FDTA 2WINB 3CC7A 3S1QH 1PYBA 2EYFA 3I91A 5IWAQ 5IYBH 4KHVA 3H15A 1SAPA 4QB4A 2FJ2A 2K01A 3GTPB 3KLRA 4OGQC 1VCIA 2KCTA 3VYUA 4K0KL 1WTHA 5JAVA 1LT6D 2JA5H 2ENBA 4A4IA 2K5HA 3DHQA 1D8LA 4DR5Q 3CCLA 1TXYA 1MIUA 2EJGC 5EQ0A 4DV4L 3I90A 2ZXOA 5C0XI 4LF6Q 4GOPC 4B3MQ 1L1OA 1LTID 5ELEA 1K3RA 5GROA 4LF6L 1EY9A 2M2LA 3MTSA 3C46A 2V4DA 3O13A 1GXDC 3S24A 4RKLA 2YTVA 1HZCA 1G6ZA 4GN5A 3H0GB 4C3HH 4A3GH 2CCZA 2IPKD 1PLFA 3UDIA 5IY0A 4IN3A 1BKBA 2EJMA 4FF2A 5G3LD 3BYTB 5C3XA 3D4WA 2XSCA 4RWSC 5EPJA 3ERSX 5IYCG 4DV6Q 3BDOA 2HQLA 1A15A 2K5DA 1EWHA 3ONAB 5HGQA 5D14A 2N78A 1LUZA 3ITPA 4LF4L 5K36G 1XX8A 2A6EC 3NQIA 4A93B 4RCOA 3I72A 3S2DH 1CZWA 2NTSA 3GDEA 4FO2A 1SNMA 3G6JB 4A3EH 1J6QA 4B3RL 4OIKA 3U4VA 1HQRD 1SE4A 1P16A 1HH2P 3RNUA 4JI2L 2R93H 1X56A 2PNHA 2ES2A 1PTOD 4FXDA 2Z8LA 3T16A 1VDZA 3H91A 2IWHA 1MI2A 4OHJA 2KA7A 3F2DA 4RGMA 1Q8KA 3UDXA 3KDFA 2OF1A 5CC4A 1AZPA 3MEHA 1EIFA 2Z6KC 2HDMA 3JAML 4DV7L 3KF6B 1PMRA 3NWSA 1Z6HA 3SXHA 4I7AA 1D5MC 2VW9A 5IE8A 4IUPA 2SEBD 2O4XA 5EBCA 1KLUD 5ELFA 4LFAL 5A2QL 4KKUA 4IFDJ 2NB0A 3ER0A 1G2TA 3FVQA 2UU9Q 1JJGA 1B3AA 2VS1A 1ICFB 1LO5D 4B3TL 1JWUD 3LWEA 3BZKA 4A3DH 3QOLA 1YNNC 4KD4A 3L0OA 1G291 3K5OA 2F3WA 1RTNA 1SMYD 1FYCA 3Q23A 1JICA 3PO3G 1EY0A 5J22A 3T1HL 3KLSA 3I4OA 3H94A 2CW0D 2EPBA 3UDFA 1KRSA 3PCOB 2OQ0A 4MZ9A 3BJUA 4QIWE 1D2BA 5M5YH 1STAA 2GN5A 1PRTD 2MGSA 2EYOA 1HZAA 1DD2A 3NELA 3GTJH 1TWAB 4NXML 1C9OA 1I4RA 1NE3A 3KUPA 3PO2B 1H9MA 1Y1VH 4YWMA 1IBML 2A6HD 2A6HC 3OPOA 1ZKOA 1HUNA 4EQPA 2XN9C 2NWGA 1I5FA 2IX1A 4ME3A 4GKJQ 5JJKA 4CDFC 2K5QA 5C3EG 2HUGA 3K5MA 5CBEE 4E6IA 3S1RH 1Y8NB 1N9WA 1PH6A 3K59A 4P71A 2VUMG 1HCZA 3A74A 4DGZA 4JI7L 1I4HA 2YYZA 2NVQB 1JR0D 5KRUA 1VQEA 5L37A 3NSWA 2F0UA 5KNDA 2Q2TA 5LL6X 1SJED 3KOJA 1JT8A 2B2VA 4TKOB 2NYZD 4DV2Q 2PI2A 4MHEA 2G9DA 4ZKCB 4DV0L 1XMOQ 1SR3A 1Q7YC 3OMCA 4PMWA 2Q8TA 3A0JA 1UE5A 5G3LF 3BVMA 3PIO3 2Z4IA 2EY6A 1RDPD 2B8GA 1VF5C 2F0MA 5JPMC 3V96A 1TS3A 2NVXH 2NVTH 2BH8A 3LWUA 2EZVA 4A3LH 1SYCA 4A3KG 2DY7A 3F2BA 1Y69U 4X66L 1X3PA 4A3KH 3MA2B 1C48A 2A6ED 2HHHL 2KBNA 1PZID 4NDXA 2R93B 4X3UA 1PTOF 1EOVA 1TIID 2MQHA 3X3NA 2I5LX 4XXEA 5EBDA 1CA6A 1FL0A 1PTOH 4F87A 2GVAA 1XNQL 1GOZA 4CDCC 1BBUA 2K50A 4HIDA 2R3ZA 1F9RA 4RGTA 3J81i 1B1ZA 3MWYW 3I4NB 3KYHC 5JPNC 4DV5Q 2BE5C 3HS0C 4TRDA 3JC66 4GS3A 2BOSA 2L5TA 5E3FA 3W1BA 4DR1L 5FO9B 1CZGA 3M7GA 2R7ZG 1NAPA 3U9SA 3S1MB 1K0SA 5CORA 5I6WA 2ZM6L 2Q8IB 5FK9C 4DNTB 1L1OC 1K9MC 2L9HA 2MJ8A 1VQGA 3OMGA 2AUJD 5JOBA 3GTMB 3AFQA 3FPUB 4A3DB 3KLSX 4JI1L 2E74C 1E7ZA 3EQLC 3IFDA 2A69D 3KF8B 4A93G 4I65A 4JI5Q 3I70A 4QY7A 1NY4A 4DR1Q 1FNVA 1M8AA 3CF5A 3NTIA 1WTQA 1KNEA 3CU7A 2ZXRA 1Y1VG 2F0NA 3Q0AA 1KXLA 4O2DA 4DR5L 1NCVA 3GTJB 4OO1G 2XWBB 2H1EA 4A3CH 1A2UA 3TSSA 4O1NA 4CGYB 4RHSA 2FFKB 4JI1Q 1CQVA 4R8IA 5M9OA 5FJ8H 2KJXA 1F2ZA 1XNRQ 2NBFA 4LF8L 1GUOA 4R4CA 4DV3Q 4GNXA 3UDGA 4JOIC 4A3IG 2F0FA 3TP6A 4OWXB 4LNQA 5KYIA 4G7OC 1D1IA 1HFGA 4X62Q 1Q46A 3Q22A 3TRZA 4BWGB 2A19A 4EGVA 3S1NH 4BS9A 2EYPA 4K8IA 2EVBA 1KDCA 4A3JH 3MFYA 5M5XH 5EPKA 2K52A 2F0PA 3QJYA 5FLMH 2QDBA 4RA8A 3T4AC 4P73A 2WB1B 3SHLA 4LF5Q 1JOKA 1P8LA 3GTQB 3I7FA 4FDBA 1SXTA 2EY1A 5FLMG 4MNOA 3GTKB 5M3MH 4DR4Q 3VA5A 2DY8A 3FPPA 3B6YA 2F0HA 3CPWA 1TWGB 4JK1C 2F0GA 4PMCA 3S1QB 4MTNA 2X6GA 2XRQD 3J81L 1XTCD 4Y7NH 2E2JB 2YTYA 2R93G 4IZ8A 1SYBA 3P75A 1SE8A 3GV6A 5BN5A 2WACA 3MVVA 5C4JB 2VY3A 5LMNW 3C1FA 3HOVH 3HP3A 1SEBD 4CKBA 1VQKA 1QVFA 1Q8IA 4UDUC 1PRTB 4JG2A 1MGSA 3AU7A 2F0EA 3TBIB 4NPSA 4CJ1B 1DM0B 3KF6A 1NSNS 1BUVT 1NMFA 3ULJA 1PH4A 1ASZA 4JC0A 2G9HD 2CW0C 4KKTA 1KC8C 5FO7B 2D9UA 2E5LQ 4YCUA 1OXUA 3AYHB 4IQZA 5EKIA 4XYOA 3ULLA 2ID0A 1U5KA 5CV5A 1QJOA 3GQBA 5JVH3 1HNZQ 3WDNA 3BYYB 5JEAH 3NHHA 2CQAA 3FKIB 1CFMA 1H9RA 2JA8H 3CD6A 1X6OA 3HZXA 1O7ZA 2MUYA 3I8ZA 4UPAA 1BF4A 4K2LA 4G4KA 1QUQA 2ZT9C 2ZJRA 1X54A 3CHBD 4L5TA 3ICEA 3S15B 4WJWA 1RIPA 3MXPA 4FXKC 4RFBA 1E2WA 3MFGA 1B50A 2Q2HA 4XIGS 4GKKQ 3M9BA 1KL9A 4TSSA 1TU2B 3QWNA 1IBMQ 2UUCL 3FRPB 2WKCA 2YTXA 1LT5D 3NP8A 4LFBQ 3DWQA 1VQAA 2SNSA 4LF9Q 3BVGA 1YHAA 1BNZA 4LF7L 2A73B 2KENA 4PZ6A 3D6WA 2WIIB 1H9JA 2JQOA 3E9IA 1SE2A 1SNCA 2OWOA 2L1BA 3TN2A 3RZDB 3NBHB 3MZ5A 4NXNL 2PI2E 2MHVA 1EYAA 3CMAA 2B29A 3BDCA 2LFNA 4ODGA 2RSOA 5GAHC 5GADC 1N36L 3NENA 4UY8C 3M4PA 3PUXA 1EYDA 3F8TA 1V9PA 2F0LA 1PV4A 4X65L 1GVPA 4B3SL 5C4XB 4J15A 3K8AA 2Z6BA 2B3GA 4QMGA 3EFXD 4A3FH 2FMCA 2D0PA 3OW7A 1EIYB 1TKWB 3VR5A 4LUVA 5C0XJ 2JA8G 2UUBL 3K7AB 1SLJA 1EFID 4HCSA 1I94Q 1LT4D 3R2TA 3EVQA 4PNYA 1N8RC 4V0BA 3DM3A 3FMCA 2VQEL 4BXXG 4A3JG 1ICWA 3U9OA 4JI2Q 4M8AA 1AP0A 3QOJA 4LUOA 2JA7H 2PMZB 1MBYA 2N3SA 3GTQH 2RCNA 2BDNA 3HOWB 1Y1WG 1E0BA 1XPRA 1IL8A 4X65Q 1LYLA 1G51A 4B3SQ 2E2HH 4XT1B 4DK6C 5IYBG 2C35B 1W3SA 3S2HH 3H3VI 1EU4A 1RF2D 4DAMA 4UP8A 1AH9A 1TWGH 3KF8A 4DUYQ 5C3WA 4R4IA 2F3IA 2VQFL 4DR6Q 3BU2A 3GD7A 1CA5A 1JJ2A 3H3VH 4LWCA 5IT9L 1HR0L 4OO1H 1JMCA 4BXXH 1OO9B 1QG7A 3J81j 4C56C 4K6LA 1AN8A 2ZJQA 5IYDG 2B2VC 3VR4A 2AUKA 4FYDA 1D5ZC 5BR8L 3PQIA 5C44H 4DR2L 3S16B 3KFUA 1I4PA 4LMQD 4Q0FA 1Y1WB 4C2MH 3W5OA 4KD3A 1BO0A 4A93H 1CT1D 5HURA 2NVQH 4YWLA 1ILPA 1FJGQ 1KAAA 1SYEA 2MO1A 4JV5Q 2F3VA 1Q82C 1IYUA 1IYJB 1K3BC 5IIFA 1S5ED 3MAQA 1S72A 1PZKD 1SNOA 3K80C 2WKDA 5GAEC 1VQLA 3KBGA 5ELDA 5BN3A 5E4XA 3AFPA 4ID6A 4WORA 1HR0Q 4GLAC 3IKJA 4IOCA 1I3QH 4IJLA 2E2DC 1ZYRC 4OELB 1STYA 4C1NI 1ZYRD 3CCSA 3TZDA 4A3IH 2R7ZH 3S15H 4KJOA 1U4PA 1ASYA 4CHTB 3ND9A 4IO9A 2VB3X 2N49A 4DU9A 1RD9D 1QE6A 4AYBG 3E5SA 3PV0A 3GV3A 1WTWA 2AWNA 1UNSA 4APVA 4X3KA 3SK5A 1HTPA 4LFCQ 1G8ZD 2RKSA 5EKLA 4HAEA 4A3MH 1D1KA 1M90C 3CCUA 2O5IC 1LABA 4XT3B 1A2TA 4BY7H 4WJ3M 5IP7G 2OTJA 4N9TA 1N36Q 1I50H 4HJ7A 4BY1G 4N8X1 2F4VL 1OXXK 4DUZQ 4IOAA 4UHVA 1BBWA 2Y0SE 3ND8A 1KDBA 5GQOA 1EIGA 5IT9c 4B3RQ 4YWKA 2UXCL 5EAYA 3SK6A 1AE3A 2IX0A 2F0JA 5KIXA 4V190 5IGCA 1QVGA 1HUMA 3JAMc 1ET9A 4NB3A 5H1SE 1T9HA 1CM9A 1I4XA 1LTSD 2PCFB 3W2DA 2UUCQ 1RCVD 1TWAH 2RA4A 2JEAI 3HOYG 1JORA 3D3RA 3QR8A 2VQEQ 4JI6Q 3NUCA 3GTMH 4FVMA 1I94L 5K36H 2IW3A 1PYWD 2KVMA 3H0GG 3T1YQ 1GKHA 1BXTA 1JE5A 1A6XA 1EQVA 1S5FD 1QOHA 3SGIA 3HFZB 4JOIA 2KECA 3E3XA 4J6HA 1TWCB 5E4WC 3KJOA 3WOFA 2JA7B 1S5DD 4HMJA 3K5NA 4DV0Q 1XMOL 1E2VA 1U4RA 3DMUA 3HOWH 1II3A 3OOCA 4CJ0B 3K0YA 4LUZA 1HFNA 4FF1A 4JYAQ 3R3OA 4GLVB 4BBSG 1DYQA 3HRZC 2D0OA 2XNAC 1TWHH 3H3VC 1UE1A 1KRTA 4K2KA 1WTXA 1JCKB 3PO3B 3A7LA 5NUCA 1TS5A 1PH5A 1S5BD 2KQ3A 3NWTA 3M4OH 5M5WB 1BCPC 1KQSA 4ILWA 3HKSA 3T1YL 5FLXL 1LTGD 2QEJC 1Q86C 3V2TA 4DV1Q 1GD7A 1GM5A 4RMFA 1S3OA 2FXQA 1XYIA 2NZOA 3BDLA 1UE7A 5DNFA 2UU9L 2PYKA 1FJGL 4HIMA 3M4YA 2ICIA 1VQ4A 4J1MA 1F2LA 4GKKL 2NVTB 4DN4M 3HKZB 3RZOB 1NNXA 4A3BH 3A8KE 1F77A 1B9NA 1F9QA 5CV4A 4PZ7A 2F52A 4R1JA 4OIJA 4OXPA 4BY1B 3KLWA 1VF7A 2XVSA 1D7QA 1SJHD 4K0KQ 2XRSD 4DV7Q 1Y14B 3K81C 2E5LL 1VQ8A 3STBC 2SNMA 1X55A 2K5WA 1I3QB 3CC4A 4YIJA 4ZKBB 3TP7A 4IPGA 1VQ9A 1PA6A 4UP7A 5C6AA 1TY0A 2VB2X 1HNXL 2L12A 5I2YA 4JYAL 1AZQA 5HGTA 2R7ZB 1A8VA 4LJZC 5JJIA 3P7JA 1DJRD 1EFWA 3FKIG 4CKEA 1JOQA 3S17H 4BBRB 2PZTA 2F4VQ 1WD1A 3SK8A 4HJ9A 3K6OA 3J81E 2Y0SB 3RD4A 2DJGC 1IBKQ 1C7YA 2ATWA 1C0AA 1RKNA 3K0XA 1V43A 3N52A 4DV3L 3ERQA 4O42A 2EYHA 3IFTA 1HNWQ 1CKNB 2K05A 2NTTA 2Q2IA 3D4DA 5M3FH 1H9KA 1HJPA 1Q1BA 3BG3A 3L9AX 1QNUA 2EJFC 3VR2A 5JEAG 2MFIA 1WTRA 3S2DB 3HOYB 4ZAIA 1VQHA 4LFCL 3PF4A 3HOZH 2RSNA 1JC7A 2ASBA 3SVMA 2Y0SG 3CQZB 1SNPA 2HD3A 4LF9L 4JBMA 1LTLA 2AQ2B 4O0AA 3TQYA 1XPUA 2H4OA 3CMEA 1W2BA 1T5EA 2ZTEA 1LTBD 1SMXA 1IXRA 2XGTA 3J80L 5IGBA 4GN3B 1L1OB 1BVSA 4LF5L 2BDOA 1L0WA 1SMYC 1SYFA 4WFN3 4K5WA 1Q12A 2K6AA 4DAVA 3Q8DA 4L63B 3HOUH 1HPCA 2K1BA 2Z0SA 3T51B 1JWSD 1WCMH 2ZXPA 4U673 3HOZG 1Z47A 4BBRG 4FP5D 4G57A 1K73C 4JPBW 3AQQA 1XMQQ 1T5XD 5D65A 2NUCA 1V1PA 2F0QA 4IALA 3OWFA 4I7ZC 5CV9A 4Y52H 3QIAA 4F8MA 5LMUL 1B7YB 1JQYD 1KD1C 1E1OA 2K7VA 2KHIA 4NMZA 3RUZA 2YU9B 4L5SA 4DAYB 4UAIA 1YBYA 4JW0A 1DZ1A 5IWAL 3PUWA 4GKJL 4K5XA 3NK9A 1JJCB 2DJFC 2Z1CA 2R92H 5IYDH 1K83B 3RZDH 3DWPA 1CSQA 5CYUA 3N6RA 2ICEC 4OEMB 3GTGH 1STBA 5M5YB 5C5LA 1B53A 1D6EC 4FXGC 3I3CA 2A1AA 5BR8Q 3W1GA 4DR2Q 2RHQB 1NJIC 1PYSB 5A2QE 5C4XH 5ISRA 4B3ML 3CCVA 3MEFA 1BCPF 4QL5A 3K5LA 2JYOA 4G7HC 1Y1VB 1CKOA 2I07B 4HR7B 4AH6A 3SEBA 3K7AH 3T1HQ 1PH7A 1HNWL 1X32A 1NMGA 3QO2A 2PQAA 4Z9CB 3KK7A 5C4JH 2H5XA 5AJ3L 1L0YB 1HR0W 3DLLA 3TEHB 1RJTA 2JXMB 3HOVB 1WOCA 4DR3Q 3PF5A 1HTLD 2OEOA 2B2WA 1KTKA 1XTDA 1X3QA 2JE6I 2CVRA 2QA4A 1L2FA 1F2MA 5KNCA 1QZGA 4R8NA 3G6EA 1OXTA 1IHZA 3VR6A 1QILA 4KHPQ 3OSOA 2UUBQ 4GN4B 3DWAA 1IBLL 2E2HB 3T56B 4S3SA 3K7UC 1IW7D 1JWMD 2K5VA 3S2HB 4DUZL 2JA5G 4MN3A 3RMHA 3BS1A 4JI7Q 4BBSH 2NZ1D 4CDEC 1HQMC 4A3MG 2DUDA 4BBRH 3H09A 3FEWX 2PZWA 1WCMG 4OWTB 3U4ZA 2M00A 5KGUA 2B39A 1SNQA 1XNRL 5I4DA 2QILA 4OONA 3GTLH 4JCVE 3J80i 3S14H 4L8JA 4DV2L 4PZ8A 2WP8J 2HT1A 2DN8A 5C44B 3S16H 2MNAA 2SOBA 4HEDA 3EROA 5IOCA 2NVXB 2CH4A 2A8VA 3CXCA 1V1OA 2LKVA 4DNIA 3OWEB 3HOZB 1EU3A 3TZUA 1RTOA 1PFBA 3HOVG 4IUQA 2K4KA 4JI8L 4HJ8A 2ALYB 5C4HA 3TS0A 1PH8A 1WJJA 1AW7A 5AFWA 2HIXA 3VYTA 4QQBX 2PQEA 1U4MA 1DCZA 3CAMA 5BN4A 1N34Q 2EOTA 3KJPA 4RH6A 3CP0A 3SDZA 4DK0A 1C4QA 4L5RC 2AQ1B 4HSVA 5I9PA 4EQ5A 3I4NH 1EIHA 3HKZG 1IL2A 5IP9H 2SDFA 4HMIA 4A3LG 4CKCA 5CV8A 2ZM6Q 4ZQ3A 1STNA 4DUYL 1K28A 4NP5A 3STBD 3M3YH 4IPHA 5CBAE 3BVZA 4JI8Q 1EY8A 4ZK9B 4WJ4A 1HZ9A 4DV5L 5LMUQ 4ZUIA 1ZEQX 2JA6B 2R6GA 4A3FB 3J7AF 2IT1A 2CWAA 2PNRC 4K5VA 4LFAQ 1X3FA 5J39A 2EY5A 4A76A 1D5XC 1PH1A 1NTGA 3D6CA 4KHPL 1TWFB 5IYCH 1YHQA 4QUFA 4C3JB 2RDFA 1DGSA 3D4RA 3JAME 1HNZL 3P1HA 4DNRB 4GZYC 2VZAA 2EDGA 2Q8RE 3L2PA 3VYRA 5C0XH 3I4MG 3CC2A 2ZTDA 4RGOS 2IL8A 3DXJC 2E2IH 2K5NA 5K5PA 1G91A 1PXUA 1I6HB 1J5EL 3MXNA 2AKWB 3UE1A 3OTOL 3GTPH 4KN7C 4MTKA 5AJ3Q 2PQAB 2NVYB 1GO3E 1UEAB 4H44C 1B2TA 1BQQT 1MSGA 2A5HA 2QKIC 4GOPB 3RR5A 1HXYD 1LACA 1TWCH 4LK1C 4QGUA 1I4QA 1PH2A 2GVBA 4LFBL 2CHBD 4G7ZC 1VQ6A 1O7YA 1ENCA 1GUNA 1AEXA 1YI2A 5C3EB 1WD0A 4BA2I 3I2ZA 2X6LA 1E22A 4LF8Q 3PO3H 4BBSB 2AMCB 1LTAD 4KI0A 3NTHA 4K14A 4YY3Q 1IW7C 2FINB 4POGA 1E3PA 4PV1C 5E7NA 1SE3A 3D0FA 4FF4A 5J1ZA 4CDDC 4NKLA 2R92G 5M3MB 1EWIA 3CCJA 2E76C 1JOOA 1G6PA 2B63G 1M4VA 3PIPA 3V05A 2OTLA 1TT2A 2FHTA 1OTCA 3Q24A 5KNBA 1SDFA 2F0DA 4RGNA 4A3BB 1U9RA 1EEID 1O7IA 4ME5A 1BCPD 2BCOA 2JSOA 3G71A 4JI4Q 4YHHL 1B3QA 5KEEA 2N8NA 3TREA 4YHHQ 2D5DA 4JI3Q 1STEA 2L15A 3DM1A 1SFOB 3HOXB 1NR2A 1QWYA 3VR3A 4ZRZA 2I5MX 5A35A 1QZHA 1XPOA 4A3EG 1J8IA 2BA1A 4XQQA 1TS2A 1HRJA 3I4LA 2F1MA 3M3YB 1IBLQ 3MXGA 1V1QA 4XYQA 2XTIA 3M4QA 2R7DA 1YJNA 4P72A 4RG1A 3PIOA 1KLGD 4B9WA 1CUKA 1JB7A 3I4MB 1LV9A 4N8FA 2B2YA 1JB3A 3J7YW 2VXWA 1PFMA 5EJWA 3CRLC 2WAQB 2JEBI 4C3HG 2O5JC 2ZJPA 5HY6A 1ET6A 2K32A 3C1EA 2F0WA 4C3JH 1GUGA 1RODA 1NUCA 5F2DA 1I6VC 3CPFA 3EIVA 4OO1I 1AE2A 3E6ZX 3AB9A 4BY7G 2Q2UA 3LGJA 1E1TA 1XJVA 1B44D 4GLXA 3TP8A 2M9VA 4R4TA 1ENFA 1CHPD 1PRTC 2QW7A 2L11A 3C2PA 2D62A 2B2TA 4DR7Q 5CMDA 3PO2H 1YEZA 1B9MA 3R93A 5C0XG 1I6HH 2QDLA 1SYDA 3OW2A 3EN2A 1R4PB 2WB1G 3M4OB 5M5WH 4DV6L 1RL2A 4DA2A 1H9SB 1N33Q 2JA9A 2L0CA 1MKHA 4XDXA 5IODA 1YNJD 1EY5A 1YNXA 1XXGA 4IUVA 5IGDA 3J7ZC 2KOLA 3G7LA 4X62L 4LF4Q 1WTPA 3CCMA 3J80E 3AEVA 5CV6A 1LTTD 2F0TA 1GHJA 3ZJYC 4KHZA 1HHVA 1EUJA 1PHJA 3FP9A 5M3MG 5C3EH 1EQQA 4AYBB 1N34L 1O7LA 3SR1A 4BA1I 3GTGB 2LSSA 4L6TB 1PDQA 1SROA 2BE5D 2JK8A 2L4NA 2IHFA 4C3IH 1QVCA 1DOKA 3EBEA 1R9TH 4UP9A 4A3FG 1X65A 4H7BA 4TQUS 2C5CA 3PUZA 5C44G 3J81c 1VMCA 4JI0Q 1SRUA 2VQFQ 2Z9HA 4DR6L 2NN6H 1WVLA 1ONLA 3BZDB 2MO0A 1DOMA 3A5UA 4JI0L 3HG9A 3PGZA 4DXFA 1KDAA 2K75A 2DNEA 3CCQA 3S17B 1Q3LA 1LM0A 1C8CA 4IFDI 2FMMA 1PRTF 1K8AC 1WYDA 3GTOB 2EY2A 4FNFA 3TMEA 2KEEA 1XMQL 1PFNA 3HEJA 2LY7A 4A75A 4JI4L 4GNXB 5DLQE 2PMZE 2IX3A 4IFDG 1E24A 3OTOQ 2PO4A 1Y1WH 2I46A 5M3FB 4C2MB 3ULPA 1SFOH 1YJWA 1ESFA 3MC0B 3HOYH 2LMCB 2HHHQ 1WFQA 4ZUJA 1NBWA 2LS01 3CQZH 3K58A 2PW5A 2RF4A 1SSOA 1STGA 2DNCA 4ULLA 4KLKA 1CKMA 2PW7A 2MP1A
chains in the Genus database with same CATH topology
2WAQG 1UEBA 4AYBE 3VDYA 1IZ6A 4OWWB 3A5ZB 4YCVA 5M3FG 1N32L 2JA8H 2A1AA 4P74A 5BR8Q 3W1GA 1X6OA 1Z9FA 2RHQB 5IP9G 1PYSB 4DR2Q 3PUYA 1NJIC 3CD6A 5C4XH 4UPAA 4B3ML 3CCVA 3MEFA 2E8GA 4X66Q 1QUQA 2ZJRA 4QL5A 2JA6G 1X54A 2K14A 1CKOA 4L5TA 3ICEA 2UXDL 3CC7A 1K8GA 1RIPA 2NZHA 3S1QH 4AH6A 1PYBA 5IWAQ 5IYBH 3K7AH 3H15A 3T1HQ 1MJEA 2Q2HA 4XIGS 1PH7A 4GKKQ 1HNWL 1NMGA 3M9BA 1KL9A 2PQAA 1EQRA 1VCIA 2EXDA 2KCTA 5C4JH 2H5XA 5AJ3L 4K0KL 3U58A 1HR0W 3DLLA 4X6AH 1IBMQ 2UUCL 3TEHB 2JA5H 1WOCA 4A4IA 4DR3Q 2K5HA 3PF5A 1D8LA 1K0RA 2YTXA 4DR5Q 4LFBQ 3CCLA 1VQAA 1TXYA 4IPDA 4LF9Q 1MIUA 1XTDA 1YHAA 2JE6I 3CW2C 1X3EA 2QA4A 1L2FA 4DV4L 3HOXG 1QZGA 3G6EA 1OXTA 5C0XI 4LF7L 4KHPQ 2UUBQ 4LF6Q 2KENA 4PZ6A 4GOPC 4GN4B 1L1OA 4IJHA 1IBLL 4B3MQ 2JQOA 3E9IA 1K3RA 1J5EQ 5GROA 2OWOA 4LF6L 3K7UC 2Z6KA 2K5VA 4DUZL 5C4XG 4L5QA 2JA5G 3S24A 3NBHB 4P75A 2YTVA 1HZCA 4NXNL 2PI2E 4JI7Q 4BBSH 3CMAA 1UWVA 2B29A 4GN5A 4A3MG 2DUDA 4C3HH 4BBRH 2CCZA 4A3GH 4JI3L 1MJCA 2R7FA 3UDIA 5GAHC 1WCMG 1B70B 4OWTB 3U4ZA 1VQFA 5IY0A 3NENA 5GADC 1N36L 3M4PA 3PUXA 1BKBA 1HNXQ 4UY8C 1XNRL 4OONA 3PSIA 3F8TA 1V9PA 3GTLH 4NXMQ 1YJ9A 4JCVE 4X65L 1GVPA 1PV4A 4B3SL 4JBJA 3J80i 4J15A 5LMNQ 3K8AA 3ERSX 2B3GA 1OXVA 4H02A 5IYCG 3S14H 4DV6Q 4GOPA 2JA6H 3HKZE 4DV2L 2HQLA 4A3FH 2D0PA 2WP8J 4PZ8A 2HT1A 3S16H 4JI5L 2MNAA 1EIYB 5HGQA 2OQKA 4LUVA 5C0XJ 4HJAA 2JA8G 2UUBL 2N78A 1SLJA 1LUZA 5J3BA 4LF4L 2A8VA 1I94Q 5K36G 3CXCA 4DNIA 1CSPA 1N8RC 3S2DH 3MXNB 3GDEA 4DV1L 1A0IA 3DM3A 4A3EH 2VQEL 1J6QA 4BXXG 4YY3L 3HOVG 4B3RL 3E9HA 2K4KA 4A3JG 3U4VA 4JI8L 4JI2Q 4HJ5A 4HJ8A 2ALYB 4LUOA 3TS0A 1PH8A 1WJJA 2JA7H 3PUVA 1B8AA 1P16A 1HH2P 2HIXA 3RNUA 4JI2L 2R93H 2N3SA 1X56A 2PNHA 2ES2A 3GTQH 2RCNA 4QQBX 3CAMA 2QGQA 1Y1WG 1XPRA 2WFWA 4X65Q 1LYLA 1G51A 4B3SQ 1N34Q 5LMNL 2E2HH 4DK6C 5IYBG 3KJPA 3CP0A 2C35B 3F2DA 1Q8KA 1IBKL 3GTKH 1W3SA 1KAWA 3UDXA 3S2HH 4L5RC 3KDFA 3H3VI 4EQ5A 1Q81C 4DAMA 4UP8A 3I4NH 1TWGH 1VQMA 1AH9A 3HKZG 4A3DG 4DUYQ 5FJ8G 1IL2A 4YCWA 5IP9H 1VQOA 1EIFA 2Z6KC 3H0GH 4R4IA 4A3LG 4DV7L 3KF6B 2ZM6Q 2F3IA 2VQFL 4DR4L 3BU2A 4DUYL 4DR6Q 1XNQQ 3M3YH 3STBD 3GD7A 3U50C 1JJ2A 3H3VH 4IPHA 4LWCA 1VQPA 2VW9A 1HR0L 5IE8A 4JI8Q 1S40A 1JMCA 4BXXH 4WJ4A 2YV5A 2HIVA 1HZ9A 4QJFA 3J81j 5LMUQ 4DV5L 2R6GA 4LFAL 2ZJQA 5IYDG 4IFDJ 3ER0A 3BZCA 2UU9Q 5C44H 5BR8L 4DR2L 2IT1A 1VQDA 1JJGA 2CWAA 2VS1A 4LFAQ 1X3FA 4B3TL 4A76A 3KFUA 1H95A 1PH1A 4R4OA 4C2MH 3BZKA 3G48A 3W5OA 1NTGA 3RZOH 4A3DH 4A93H 3L0OA 1G291 4KHPL 1N33L 2NVQH 4YWLA 3CCEA 5IYCH 3PO3G 1FJGQ 1N32Q 3T1HL 3I4OA 1YZ6A 1YHQA 2MO1A 3UDFA 1VQBA 1KRSA 1Q82C 3WWVA 4JV5Q 3PCOB 1DGSA 1IYJB 2OQ0A 4MZ9A 1S72A 4BY1H 4OX9Q 3K80C 3BJUA 4QIWE 5GAEC 1HNZL 5IP7H 5M5YH 4AQYQ 1KIXA 1VQLA 2EIFA 2GN5A 4DR3L 2VZAA 3AFPA 3L2PA 3FKIH 1M1KC 1HR0Q 4GLAC 4IOCA 3I4MG 3CC2A 1A62A 1I3QH 1HZAA 4IJLA 3NELA 2ZTDA 3GTJH 2UXBL 4NXML 1C9OA 2VNUD 1NE3A 1VQCA 3CCSA 2E2IH 3L7ZC 1Y1VH 4YWMA 2K5NA 4A3IH 2R7ZH 1IBML 3S15H 1J5EL 2AKWB 5ELOA 3UE1A 3OTOL 1CKNA 2LXKA 1ASYA 3GTPH 1I5FA 4IO9A 5AJ3Q 4NXNQ 2N49A 2PQAB 4AYBG 2IX1A 1GO3E 3PV0A 4ME3A 4GKJQ 5JJKA 2AWNA 3PO2G 5C3EG 4APVA 4GOPB 3RR5A 4DPGA 4LFCQ 1TWCH 3S1RH 1N9WA 1PH6A 2I5HA 5JJLA 4QGUA 4P71A 2VUMG 4A3MH 3A74A 1M90C 1VQNA 3CCUA 4JI7L 3G4SA 1PH2A 1EYGA 4BY7H 2GVBA 2YYZA 4LFBL 4WJ3M 1VQ6A 3KDFB 5IP7G 2OTJA 1N36Q 1VQEA 3I4NG 1I50H 4HJ7A 4BY1G 2F4VL 1OXXK 4DUZQ 4HIKA 4IOAA 1YI2A 3RLNA 2Q2TA 4BA2I 1BBWA 3FHWA 2BA0A 2RHSB 2Y0SE 3I2ZA 4ALPA 1E22A 3KOJA 4LF8Q 3PO3H 1JT8A 2AMCB 1A63A 5GQOA 4KI0A 1PFSA 5IT9c 4DV2Q 4YY3Q 4YWKA 4B3RQ 4JBKA 2PI2A 4IPCA 2UXCL 5EAYA 1AE3A 2IX0A 4DV0L 1XMOQ 1SR3A 1Q7YC 1FGUA 4PMWA 1QVGA 4POGA 3A0JA 1UE5A 3JAMc 1E3PA 4NB3A 5H1SE 1T9HA 5E7NA 3D0FA 2IHEA 4EX5A 2UUCQ 2R92G 1TWAH 3NEMA 2JEAI 2UUAL 1EWIA 3HOYG 3CCJA 3M7NA 1G6PA 2B63G 3PIPA 2VQEQ 2OTLA 1OTCA 4JI6Q 1VS0A 1X9NA 3GTMH 2NVXH 1I94L 3F2CA 4JI6L 2NVTH 2BH8A 3I56A 3H0GG 4A3LH 2NVYH 3T1YQ 1GKHA 4A3KG 1O7IA 3F2BA 1JE5A 2EQSA 3SGIA 4X66L 3HFZB 1WI5A 3G71A 4A3KH 4JI4Q 4YHHL 3I55A 4JOIA 3KJOA 2HHHL 2KBNA 2N8NA 1VQJA 3TREA 2UXCQ 4YHHQ 2YU9H 4DV0Q 1XMOL 1YHBA 1EOVA 4JI3Q 2MQHA 2I5LX 3HOWH 2L15A 4LUZA 2AHOB 1FL0A 4JYAQ 2GVAA 2NN6G 4GLVB 4BBSG 1XNQL 4XTCS 5GAGC 1BBUA 1YVCA 2K50A 1PH9A 4HIDA 2D0OA 2I5MX 2ZTCA 1K83H 1TWHH 3J81i 1QZHA 1UE1A 1XPOA 1KRTA 4JV5L 3KYHC 3J7A5 4A3EG 4DV5Q 2OCEA 2BA1A 1PH5A 3JC66 2KCMA 1X3GA 4GS3A 3M4OH 1KQSA 3W1BA 4DR1L 3HKSA 3T1YL 3UE0A 2I0QA 2R7ZG 1IBLQ 4B3TQ 2QEXA 1Q86C 1V1QA 4AQYL 2IY5B 2XTIA 4DV1Q 3GO5A 2R7DA 1GD7A 3M4QA 1GM5A 1YJNA 2B63H 4RMFA 1S3OA 2FXQA 4P72A 2NZOA 2ZM6L 2V1CC 1UE7A 1L1OC 3OYYA 4RG1A 3J80c 2UU9L 1K9MC 3PIOA 1FJGL 4HIMA 1VQGA 1PVOA 2LXJA 1CUKA 3RLOA 1JB7A 1VQ4A 4JBWA 1VQ5A 3AFQA 4GKKL 4JI1L 4HIOA 3HOUG 2JEBI 5ELNA 4A3BH 2ZJPA 1E7ZA 4TVAB 2UXDQ 3RLFA 5HY6A 4C3JH 4PZ7A 1VQIA 2F52A 3KF8B 4R1JA 4A93G 4AIMA 4OXPA 3TS2A 3CPFA 3KLWA 3EIVA 4JI5Q 4OO1I 4QY7A 1SN8A 1AE2A 1NY4A 4LW1A 4DR1Q 1D7QA 4BY7G 2Q2UA 4DV4Q 4K0KQ 3LGJA 4DV7Q 1Y14B 1E1TA 2JJQA 3K81C 1FVIA 3CF5A 1XJVA 4GLXA 4X64L 2VUMH 2E5LL 1VQ8A 4A3CG 3STBC 1X55A 3HOXH 2CWPA 2CFMA 4R4TA 1Y1VG 1YIJA 3CC4A 1KXLA 4O2DA 4DR5L 4IPGA 1VQ9A 1PA6A 4OO1G 4UP7A 2D62A 4DR7Q 1HNXL 4JYAL 3PO2H 1YEZA 4A3CH 1A8VA 5C0XG 3HOWG 2KHJA 1I6HH 5JJIA 1EFWA 3FKIG 3OW2A 3EN2A 3S17H 2F4VQ 4JI1Q 2WB1G 2E2JH 5M5WH 4DV6L 2WAQE 5FJ8H 3M85A 1RL2A 3GTOH 1XNRQ 4LF8L 4R4CA 4GNXA 4DV3Q 4HJ9A 3UDGA 1N33Q 3S1MH 2JA9A 4JOIC 4A3IG 1IBKQ 1C7YA 1MKHA 4OWXB 4LNQA 3K0XA 2ATWA 3JAMi 1C0AA 1V43A 3F1ZA 4DV3L 4LF7Q 1YNXA 4X62Q 3CCRA 1Q46A 2WB1E 3D31A 3IRBA 3TRZA 1HNWQ 3I4MH 2CKZB 1CKNB 3J7ZC 4X64Q 2A19A 4X62L 2Q2IA 3RN2A 5M3FH 3GTGH 1HJPA 1Q1BA 2UUAQ 3S1NH 1QUQB 4LF4Q 3CCMA 5JEAG 3AEVA 2MFIA 3HOZH 1VQHA 4LFCL 3PF4A 4A3JH 4DR7L 2ASBA 3ZJYC 4KHZA 1EUJA 2Y0SG 5M5XH 1PHJA 3FP9A 2VL6A 4LF9L 2K52A 5M3MG 5C3EH 4GNXC 1EQQA 4JBMA 1N34L 1LTLA 4O0AA 5FLMH 4BA1I 3TQYA 2LSSA 1XPUA 4P73A 3CMEA 1W2BA 1SROA 4LF5Q 2ZTEA 1P8LA 1SMXA 3E0EA 2JK8A 2NN6I 2IHFA 1IXRA 2XGTA 3I7FA 4FDBA 4C3IH 1QVCA 4GN3B 1L1OB 1OXSC 3EBEA 1BVSA 1R9TH 4LF5L 4UP9A 1L0WA 1X65A 4TQUS 4A3FG 2BH2A 3PUZA 3J81c 5C44G 5FLMG 4MNOA 1Q12A 4JI0Q 2DGYA 1SRUA 3Q8DA 5M3MH 2VQFQ 4DR6L 4DR4Q 4R4QA 3B6YA 5FLXc 3CPWA 3HOUH 4A3BG 2AWOA 2MO0A 4OX9L 2Z0SA 3A5UA 4JI0L 3PGZA 1WCMH 2K75A 4MTNA 3HOZG 1Z47A 3CCQA 4DK3C 4BBRG 3RN5A 1LM0A 4A3GG 4IFDI 4Y7NH 2YTYA 2R93G 1K8AC 1SE8A 1WYDA 3AQQA 1K73C 2JA7G 1XMQQ 2VY3A 5JEAJ 5LMNW 2CQOA 4PG3A 1XMQL 3HOVH 4A75A 4Y52H 2UXBQ 4JI4L 5LMUL 1KHIA 1B7YB 4GNXB 1KD1C 1VQKA 5DLQE 2PMZE 1VQ7A 1QVFA 1HZBA 1Q1EA 4JG2A 1E1OA 1U0LA 4IFDG 1E24A 2KHIA 4NPSA 3KF6A 4L5SA 4DAYB 3OTOQ 1NMFA 1YBYA 1Y1WH 3ULJA 1PH4A 1ASZA 4JC0A 5IWAL 1UE6A 3ULPA 1SFOH 1YJWA 4DKAC 1PH3A 3HOYH 3PUWA 2HHHQ 1KC8C 4GKJL 1JJCB 1TWFH 2R92H 2E5LQ 4YCUA 3AYHB 1OXUA 1WFQA 1YITA 1NBWA 3CQZH 5IYDH 4POFA 3RZDH 2RF4A 3ULLA 2ID0A 1U5KA 1CSQA 4KLKA 1CKMA 1HNZQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WAQ G;  1UEB A;  4AYB E;  3VDY A;  1IZ6 A;  4OWW B;  3A5Z B;  4YCV A;  5M3F G;  1N32 L;  2JA8 H;  2A1A A;  4P74 A;  5BR8 Q;  3W1G A;  1X6O A;  1Z9F A;  2RHQ B;  5IP9 G;  1PYS B;  4DR2 Q;  3PUY A;  1NJI C;  3CD6 A;  5C4X H;  4UPA A;  4B3M L;  3CCV A;  3MEF A;  2E8G A;  4X66 Q;  1QUQ A;  2ZJR A;  4QL5 A;  2JA6 G;  1X54 A;  2K14 A;  1CKO A;  4L5T A;  3ICE A;  2UXD L;  3CC7 A;  1K8G A;  1RIP A;  2NZH A;  3S1Q H;  4AH6 A;  1PYB A;  5IWA Q;  5IYB H;  3K7A H;  3H15 A;  3T1H Q;  1MJE A;  2Q2H A;  4XIG S;  1PH7 A;  4GKK Q;  1HNW L;  1NMG A;  3M9B A;  1KL9 A;  2PQA A;  1EQR A;  1VCI A;  2EXD A;  2KCT A;  5C4J H;  2H5X A;  5AJ3 L;  4K0K L;  3U58 A;  1HR0 W;  3DLL A;  4X6A H;  1IBM Q;  2UUC L;  3TEH B;  2JA5 H;  1WOC A;  4A4I A;  4DR3 Q;  2K5H A;  3PF5 A;  1D8L A;  1K0R A;  2YTX A;  4DR5 Q;  4LFB Q;  3CCL A;  1VQA A;  1TXY A;  4IPD A;  4LF9 Q;  1MIU A;  1XTD A;  1YHA A;  2JE6 I;  3CW2 C;  1X3E A;  2QA4 A;  1L2F A;  4DV4 L;  3HOX G;  1QZG A;  3G6E A;  1OXT A;  5C0X I;  4LF7 L;  4KHP Q;  2UUB Q;  4LF6 Q;  2KEN A;  4PZ6 A;  4GOP C;  4GN4 B;  1L1O A;  4IJH A;  1IBL L;  4B3M Q;  2JQO A;  3E9I A;  1K3R A;  1J5E Q;  5GRO A;  2OWO A;  4LF6 L;  3K7U C;  2Z6K A;  2K5V A;  4DUZ L;  5C4X G;  4L5Q A;  2JA5 G;  3S24 A;  3NBH B;  4P75 A;  2YTV A;  1HZC A;  4NXN L;  2PI2 E;  4JI7 Q;  4BBS H;  3CMA A;  1UWV A;  2B29 A;  4GN5 A;  4A3M G;  2DUD A;  4C3H H;  4BBR H;  2CCZ A;  4A3G H;  4JI3 L;  1MJC A;  2R7F A;  3UDI A;  5GAH C;  1WCM G;  1B70 B;  4OWT B;  3U4Z A;  1VQF A;  5IY0 A;  3NEN A;  5GAD C;  1N36 L;  3M4P A;  3PUX A;  1BKB A;  1HNX Q;  4UY8 C;  1XNR L;  4OON A;  3PSI A;  3F8T A;  1V9P A;  3GTL H;  4NXM Q;  1YJ9 A;  4JCV E;  4X65 L;  1GVP A;  1PV4 A;  4B3S L;  4JBJ A;  3J80 i;  4J15 A;  5LMN Q;  3K8A A;  3ERS X;  2B3G A;  1OXV A;  4H02 A;  5IYC G;  3S14 H;  4DV6 Q;  4GOP A;  2JA6 H;  3HKZ E;  4DV2 L;  2HQL A;  4A3F H;  2D0P A;  2WP8 J;  4PZ8 A;  2HT1 A;  3S16 H;  4JI5 L;  2MNA A;  1EIY B;  5HGQ A;  2OQK A;  4LUV A;  5C0X J;  4HJA A;  2JA8 G;  2UUB L;  2N78 A;  1SLJ A;  1LUZ A;  5J3B A;  4LF4 L;  2A8V A;  1I94 Q;  5K36 G;  3CXC A;  4DNI A;  1CSP A;  1N8R C;  3S2D H;  3MXN B;  3GDE A;  4DV1 L;  1A0I A;  3DM3 A;  4A3E H;  2VQE L;  1J6Q A;  4BXX G;  4YY3 L;  3HOV G;  4B3R L;  3E9H A;  2K4K A;  4A3J G;  3U4V A;  4JI8 L;  4JI2 Q;  4HJ5 A;  4HJ8 A;  2ALY B;  4LUO A;  3TS0 A;  1PH8 A;  1WJJ A;  2JA7 H;  3PUV A;  1B8A A;  1P16 A;  1HH2 P;  2HIX A;  3RNU A;  4JI2 L;  2R93 H;  2N3S A;  1X56 A;  2PNH A;  2ES2 A;  3GTQ H;  2RCN A;  4QQB X;  3CAM A;  2QGQ A;  1Y1W G;  1XPR A;  2WFW A;  4X65 Q;  1LYL A;  1G51 A;  4B3S Q;  1N34 Q;  5LMN L;  2E2H H;  4DK6 C;  5IYB G;  3KJP A;  3CP0 A;  2C35 B;  3F2D A;  1Q8K A;  1IBK L;  3GTK H;  1W3S A;  1KAW A;  3UDX A;  3S2H H;  4L5R C;  3KDF A;  3H3V I;  4EQ5 A;  1Q81 C;  4DAM A;  4UP8 A;  3I4N H;  1TWG H;  1VQM A;  1AH9 A;  3HKZ G;  4A3D G;  4DUY Q;  5FJ8 G;  1IL2 A;  4YCW A;  5IP9 H;  1VQO A;  1EIF A;  2Z6K C;  3H0G H;  4R4I A;  4A3L G;  4DV7 L;  3KF6 B;  2ZM6 Q;  2F3I A;  2VQF L;  4DR4 L;  3BU2 A;  4DUY L;  4DR6 Q;  1XNQ Q;  3M3Y H;  3STB D;  3GD7 A;  3U50 C;  1JJ2 A;  3H3V H;  4IPH A;  4LWC A;  1VQP A;  2VW9 A;  1HR0 L;  5IE8 A;  4JI8 Q;  1S40 A;  1JMC A;  4BXX H;  4WJ4 A;  2YV5 A;  2HIV A;  1HZ9 A;  4QJF A;  3J81 j;  5LMU Q;  4DV5 L;  2R6G A;  4LFA L;  2ZJQ A;  5IYD G;  4IFD J;  3ER0 A;  3BZC A;  2UU9 Q;  5C44 H;  5BR8 L;  4DR2 L;  2IT1 A;  1VQD A;  1JJG A;  2CWA A;  2VS1 A;  4LFA Q;  1X3F A;  4B3T L;  4A76 A;  3KFU A;  1H95 A;  1PH1 A;  4R4O A;  4C2M H;  3BZK A;  3G48 A;  3W5O A;  1NTG A;  3RZO H;  4A3D H;  4A93 H;  3L0O A;  1G29 1;  4KHP L;  1N33 L;  2NVQ H;  4YWL A;  3CCE A;  5IYC H;  3PO3 G;  1FJG Q;  1N32 Q;  3T1H L;  3I4O A;  1YZ6 A;  1YHQ A;  2MO1 A;  3UDF A;  1VQB A;  1KRS A;  1Q82 C;  3WWV A;  4JV5 Q;  3PCO B;  1DGS A;  1IYJ B;  2OQ0 A;  4MZ9 A;  1S72 A;  4BY1 H;  4OX9 Q;  3K80 C;  3BJU A;  4QIW E;  5GAE C;  1HNZ L;  5IP7 H;  5M5Y H;  4AQY Q;  1KIX A;  1VQL A;  2EIF A;  2GN5 A;  4DR3 L;  2VZA A;  3AFP A;  3L2P A;  3FKI H;  1M1K C;  1HR0 Q;  4GLA C;  4IOC A;  3I4M G;  3CC2 A;  1A62 A;  1I3Q H;  1HZA A;  4IJL A;  3NEL A;  2ZTD A;  3GTJ H;  2UXB L;  4NXM L;  1C9O A;  2VNU D;  1NE3 A;  1VQC A;  3CCS A;  2E2I H;  3L7Z C;  1Y1V H;  4YWM A;  2K5N A;  4A3I H;  2R7Z H;  1IBM L;  3S15 H;  1J5E L;  2AKW B;  5ELO A;  3UE1 A;  3OTO L;  1CKN A;  2LXK A;  1ASY A;  3GTP H;  1I5F A;  4IO9 A;  5AJ3 Q;  4NXN Q;  2N49 A;  2PQA B;  4AYB G;  2IX1 A;  1GO3 E;  3PV0 A;  4ME3 A;  4GKJ Q;  5JJK A;  2AWN A;  3PO2 G;  5C3E G;  4APV A;  4GOP B;  3RR5 A;  4DPG A;  4LFC Q;  1TWC H;  3S1R H;  1N9W A;  1PH6 A;  2I5H A;  5JJL A;  4QGU A;  4P71 A;  2VUM G;  4A3M H;  3A74 A;  1M90 C;  1VQN A;  3CCU A;  4JI7 L;  3G4S A;  1PH2 A;  1EYG A;  4BY7 H;  2GVB A;  2YYZ A;  4LFB L;  4WJ3 M;  1VQ6 A;  3KDF B;  5IP7 G;  2OTJ A;  1N36 Q;  1VQE A;  3I4N G;  1I50 H;  4HJ7 A;  4BY1 G;  2F4V L;  1OXX K;  4DUZ Q;  4HIK A;  4IOA A;  1YI2 A;  3RLN A;  2Q2T A;  4BA2 I;  1BBW A;  3FHW A;  2BA0 A;  2RHS B;  2Y0S E;  3I2Z A;  4ALP A;  1E22 A;  3KOJ A;  4LF8 Q;  3PO3 H;  1JT8 A;  2AMC B;  1A63 A;  5GQO A;  4KI0 A;  1PFS A;  5IT9 c;  4DV2 Q;  4YY3 Q;  4YWK A;  4B3R Q;  4JBK A;  2PI2 A;  4IPC A;  2UXC L;  5EAY A;  1AE3 A;  2IX0 A;  4DV0 L;  1XMO Q;  1SR3 A;  1Q7Y C;  1FGU A;  4PMW A;  1QVG A;  4POG A;  3A0J A;  1UE5 A;  3JAM c;  1E3P A;  4NB3 A;  5H1S E;  1T9H A;  5E7N A;  3D0F A;  2IHE A;  4EX5 A;  2UUC Q;  2R92 G;  1TWA H;  3NEM A;  2JEA I;  2UUA L;  1EWI A;  3HOY G;  3CCJ A;  3M7N A;  1G6P A;  2B63 G;  3PIP A;  2VQE Q;  2OTL A;  1OTC A;  4JI6 Q;  1VS0 A;  1X9N A;  3GTM H;  2NVX H;  1I94 L;  3F2C A;  4JI6 L;  2NVT H;  2BH8 A;  3I56 A;  3H0G G;  4A3L H;  2NVY H;  3T1Y Q;  1GKH A;  4A3K G;  1O7I A;  3F2B A;  1JE5 A;  2EQS A;  3SGI A;  4X66 L;  3HFZ B;  1WI5 A;  3G71 A;  4A3K H;  4JI4 Q;  4YHH L;  3I55 A;  4JOI A;  3KJO A;  2HHH L;  2KBN A;  2N8N A;  1VQJ A;  3TRE A;  2UXC Q;  4YHH Q;  2YU9 H;  4DV0 Q;  1XMO L;  1YHB A;  1EOV A;  4JI3 Q;  2MQH A;  2I5L X;  3HOW H;  2L15 A;  4LUZ A;  2AHO B;  1FL0 A;  4JYA Q;  2GVA A;  2NN6 G;  4GLV B;  4BBS G;  1XNQ L;  4XTC S;  5GAG C;  1BBU A;  1YVC A;  2K50 A;  1PH9 A;  4HID A;  2D0O A;  2I5M X;  2ZTC A;  1K83 H;  1TWH H;  3J81 i;  1QZH A;  1UE1 A;  1XPO A;  1KRT A;  4JV5 L;  3KYH C;  3J7A 5;  4A3E G;  4DV5 Q;  2OCE A;  2BA1 A;  1PH5 A;  3JC6 6;  2KCM A;  1X3G A;  4GS3 A;  3M4O H;  1KQS A;  3W1B A;  4DR1 L;  3HKS A;  3T1Y L;  3UE0 A;  2I0Q A;  2R7Z G;  1IBL Q;  4B3T Q;  2QEX A;  1Q86 C;  1V1Q A;  4AQY L;  2IY5 B;  2XTI A;  4DV1 Q;  3GO5 A;  2R7D A;  1GD7 A;  3M4Q A;  1GM5 A;  1YJN A;  2B63 H;  4RMF A;  1S3O A;  2FXQ A;  4P72 A;  2NZO A;  2ZM6 L;  2V1C C;  1UE7 A;  1L1O C;  3OYY A;  4RG1 A;  3J80 c;  2UU9 L;  1K9M C;  3PIO A;  1FJG L;  4HIM A;  1VQG A;  1PVO A;  2LXJ A;  1CUK A;  3RLO A;  1JB7 A;  1VQ4 A;  4JBW A;  1VQ5 A;  3AFQ A;  4GKK L;  4JI1 L;  4HIO A;  3HOU G;  2JEB I;  5ELN A;  4A3B H;  2ZJP A;  1E7Z A;  4TVA B;  2UXD Q;  3RLF A;  5HY6 A;  4C3J H;  4PZ7 A;  1VQI A;  2F52 A;  3KF8 B;  4R1J A;  4A93 G;  4AIM A;  4OXP A;  3TS2 A;  3CPF A;  3KLW A;  3EIV A;  4JI5 Q;  4OO1 I;  4QY7 A;  1SN8 A;  1AE2 A;  1NY4 A;  4LW1 A;  4DR1 Q;  1D7Q A;  4BY7 G;  2Q2U A;  4DV4 Q;  4K0K Q;  3LGJ A;  4DV7 Q;  1Y14 B;  1E1T A;  2JJQ A;  3K81 C;  1FVI A;  3CF5 A;  1XJV A;  4GLX A;  4X64 L;  2VUM H;  2E5L L;  1VQ8 A;  4A3C G;  3STB C;  1X55 A;  3HOX H;  2CWP A;  2CFM A;  4R4T A;  1Y1V G;  1YIJ A;  3CC4 A;  1KXL A;  4O2D A;  4DR5 L;  4IPG A;  1VQ9 A;  1PA6 A;  4OO1 G;  4UP7 A;  2D62 A;  4DR7 Q;  1HNX L;  4JYA L;  3PO2 H;  1YEZ A;  4A3C H;  1A8V A;  5C0X G;  3HOW G;  2KHJ A;  1I6H H;  5JJI A;  1EFW A;  3FKI G;  3OW2 A;  3EN2 A;  3S17 H;  2F4V Q;  4JI1 Q;  2WB1 G;  2E2J H;  5M5W H;  4DV6 L;  2WAQ E;  5FJ8 H;  3M85 A;  1RL2 A;  3GTO H;  1XNR Q;  4LF8 L;  4R4C A;  4GNX A;  4DV3 Q;  4HJ9 A;  3UDG A;  1N33 Q;  3S1M H;  2JA9 A;  4JOI C;  4A3I G;  1IBK Q;  1C7Y A;  1MKH A;  4OWX B;  4LNQ A;  3K0X A;  2ATW A;  3JAM i;  1C0A A;  1V43 A;  3F1Z A;  4DV3 L;  4LF7 Q;  1YNX A;  4X62 Q;  3CCR A;  1Q46 A;  2WB1 E;  3D31 A;  3IRB A;  3TRZ A;  1HNW Q;  3I4M H;  2CKZ B;  1CKN B;  3J7Z C;  4X64 Q;  2A19 A;  4X62 L;  2Q2I A;  3RN2 A;  5M3F H;  3GTG H;  1HJP A;  1Q1B A;  2UUA Q;  3S1N H;  1QUQ B;  4LF4 Q;  3CCM A;  5JEA G;  3AEV A;  2MFI A;  3HOZ H;  1VQH A;  4LFC L;  3PF4 A;  4A3J H;  4DR7 L;  2ASB A;  3ZJY C;  4KHZ A;  1EUJ A;  2Y0S G;  5M5X H;  1PHJ A;  3FP9 A;  2VL6 A;  4LF9 L;  2K52 A;  5M3M G;  5C3E H;  4GNX C;  1EQQ A;  4JBM A;  1N34 L;  1LTL A;  4O0A A;  5FLM H;  4BA1 I;  3TQY A;  2LSS A;  1XPU A;  4P73 A;  3CME A;  1W2B A;  1SRO A;  4LF5 Q;  2ZTE A;  1P8L A;  1SMX A;  3E0E A;  2JK8 A;  2NN6 I;  2IHF A;  1IXR A;  2XGT A;  3I7F A;  4FDB A;  4C3I H;  1QVC A;  4GN3 B;  1L1O B;  1OXS C;  3EBE A;  1BVS A;  1R9T H;  4LF5 L;  4UP9 A;  1L0W A;  1X65 A;  4TQU S;  4A3F G;  2BH2 A;  3PUZ A;  3J81 c;  5C44 G;  5FLM G;  4MNO A;  1Q12 A;  4JI0 Q;  2DGY A;  1SRU A;  3Q8D A;  5M3M H;  2VQF Q;  4DR6 L;  4DR4 Q;  4R4Q A;  3B6Y A;  5FLX c;  3CPW A;  3HOU H;  4A3B G;  2AWO A;  2MO0 A;  4OX9 L;  2Z0S A;  3A5U A;  4JI0 L;  3PGZ A;  1WCM H;  2K75 A;  4MTN A;  3HOZ G;  1Z47 A;  3CCQ A;  4DK3 C;  4BBR G;  3RN5 A;  1LM0 A;  4A3G G;  4IFD I;  4Y7N H;  2YTY A;  2R93 G;  1K8A C;  1SE8 A;  1WYD A;  3AQQ A;  1K73 C;  2JA7 G;  1XMQ Q;  2VY3 A;  5JEA J;  5LMN W;  2CQO A;  4PG3 A;  1XMQ L;  3HOV H;  4A75 A;  4Y52 H;  2UXB Q;  4JI4 L;  5LMU L;  1KHI A;  1B7Y B;  4GNX B;  1KD1 C;  1VQK A;  5DLQ E;  2PMZ E;  1VQ7 A;  1QVF A;  1HZB A;  1Q1E A;  4JG2 A;  1E1O A;  1U0L A;  4IFD G;  1E24 A;  2KHI A;  4NPS A;  3KF6 A;  4L5S A;  4DAY B;  3OTO Q;  1NMF A;  1YBY A;  1Y1W H;  3ULJ A;  1PH4 A;  1ASZ A;  4JC0 A;  5IWA L;  1UE6 A;  3ULP A;  1SFO H;  1YJW A;  4DKA C;  1PH3 A;  3HOY H;  3PUW A;  2HHH Q;  1KC8 C;  4GKJ L;  1JJC B;  1TWF H;  2R92 H;  2E5L Q;  4YCU A;  3AYH B;  1OXU A;  1WFQ A;  1YIT A;  1NBW A;  3CQZ H;  5IYD H;  4POF A;  3RZD H;  2RF4 A;  3ULL A;  2ID0 A;  1U5K A;  1CSQ A;  4KLK A;  1CKM A;  1HNZ Q; 
#chains in the Genus database with same CATH topology
 2WAQ G;  4C3H B;  1EY6 A;  1TVX A;  3VDY A;  2N55 A;  3CKI B;  3A5Z B;  4YCV A;  5M3F G;  5IGG A;  1EQT A;  1Z9F A;  5IP9 G;  3S14 B;  1TR5 A;  2E8G A;  4ZLT F;  4C3J G;  4X66 Q;  1LT3 D;  2JA6 G;  1HA6 A;  3HOU B;  4RKB A;  4A3I B;  2UXD L;  1K8G A;  5D3D A;  1WCM B;  2J0T D;  2EYM A;  2NZH A;  4KTA A;  1MJE A;  2K03 A;  5FLX E;  4K6D A;  1EQR A;  2EXD A;  1GHK A;  3U58 A;  1DXM A;  4X6A H;  4PQX A;  1PZJ D;  2L55 A;  1PTO C;  5LL6 S;  1BOS A;  1K0R A;  3GP7 A;  4IPD A;  3CW2 C;  1X3E A;  3HOX G;  4A3M B;  1VMP A;  4IFD H;  1YNN D;  3PIP 3;  4DXG A;  1JE4 A;  2XWJ B;  4IJH A;  1IYV A;  1QCB D;  1CTM A;  1J5E Q;  3EA6 A;  2Z6K A;  2B2U C;  5C4X G;  4L5Q A;  1F9S A;  4P75 A;  3A8J E;  4Q5V A;  5FO8 B;  4HSP A;  1UWV A;  4DAP A;  2RBM A;  3UI2 A;  1UUP A;  4JI3 L;  1MJC A;  2R7F A;  3MHB A;  1BBX C;  1B70 B;  2AQ3 B;  1VQF A;  2K28 A;  1HNX Q;  2QF7 A;  3PSI A;  5I6Y A;  5ELC A;  3DEP A;  4CJ2 C;  3VA7 A;  1YJ9 A;  4NXM Q;  4RHR A;  4JBJ A;  1EZ6 A;  5LMN Q;  4H02 A;  1OXV A;  2F0V A;  2B2T C;  4GOP A;  2A69 C;  2JA6 H;  3HKZ E;  1K8O A;  4U68 A;  4JI5 L;  2HCI A;  4IUR A;  2OQK A;  4HJA A;  4HN7 A;  4N9P A;  5J3B A;  3S1N B;  2J7Z A;  1CSP A;  1H9S A;  3MXN B;  4M1U B;  4DV1 L;  1A0I A;  3T53 B;  5IGE A;  4YY3 L;  4J8Q A;  2JA5 B;  3E9H A;  2A74 C;  4JVZ A;  4HJ5 A;  2XIW A;  3PUV A;  1V8Q A;  2F4I A;  1B8A A;  3QB3 A;  4C1N K;  2WV6 D;  2Z4H A;  1EYC A;  2QGQ A;  1I4G A;  4C3I B;  2WFW A;  5FKA C;  1R9T B;  5LMN L;  2IJ0 A;  4ABN A;  2A68 C;  3NQT A;  1IBK L;  3GTK H;  1KAW A;  4NW2 A;  2E2I B;  1MD2 D;  1Q81 C;  1VQM A;  4A3D G;  5FJ8 G;  4YCW A;  1VQO A;  4IUN A;  3H0G H;  1EY4 A;  4F88 A;  4DR4 L;  5TSS A;  1XNQ Q;  3A55 A;  1R4Q B;  2B8F A;  3U50 C;  2OT2 A;  4HCE A;  1UAP A;  1VQP A;  1FNU A;  1S40 A;  3VYS A;  2YV5 A;  2HIV A;  4QJF A;  1A3V A;  1ENA A;  4QIW B;  2OXP A;  3BZC A;  3HGB A;  1LLR D;  2EE1 A;  1VQD A;  2HCC A;  4X3T A;  1GUW A;  1H95 A;  1SYG A;  4R4O A;  3G48 A;  4MIU A;  3RZO H;  1N33 L;  3CCE A;  1FD7 D;  4A3E B;  3S9W A;  1N32 Q;  1YZ6 A;  1VQB A;  2O2L D;  2TMP A;  3WWV A;  4BY1 H;  1CQF A;  4XQJ A;  4OX9 Q;  5IP7 H;  4AQY Q;  5FOB B;  1KIX A;  2EIF A;  1J9O A;  4DR3 L;  1M1K C;  3FKI H;  4PMB A;  2VUM B;  1F9P A;  2F0K A;  2PZU A;  1S5C D;  1A62 A;  1FR3 A;  2F0S A;  3T13 A;  1ZXT A;  3QG1 A;  1FNW A;  2UXB L;  2VNU D;  1VQC A;  3L7Z C;  4LAA A;  4F7X A;  3A7A B;  4KMU C;  5ELO A;  1CKN A;  1YNJ C;  4RAU C;  2LXK A;  1U4L A;  2EXZ A;  1IKL A;  1L0X B;  3EJI A;  1CI3 M;  1K8M A;  4NXN Q;  1DON A;  4DFA A;  1Q90 A;  4KV6 A;  2JN4 A;  3A54 A;  3PO2 G;  2KUM A;  5C5M A;  5DM7 3;  4DPG A;  5T1G A;  3KBX A;  2I5H A;  5JJL A;  1GJX A;  1DOL A;  3IL8 A;  3NTK A;  1EWC A;  1BDO A;  3URY A;  3WOE A;  1VQN A;  3G4S A;  2B2Y C;  1EYG A;  1ILQ A;  2A68 D;  1PTO B;  1RHP A;  3KDF B;  2F03 A;  1CK1 A;  3I4N G;  2TSS A;  4HIK A;  1TS4 A;  2F0I A;  3RLN A;  4ALP A;  2RCF A;  2BA0 A;  2RHS B;  3FHW A;  1A63 A;  4H0L C;  1PFS A;  3W3A A;  4JBK A;  4IPC A;  1O80 A;  5DAU A;  1FGU A;  1Z7T A;  5I2X A;  2IHE A;  4EX5 A;  3NEM A;  2UUA L;  3M7N A;  1MSH A;  4R9W A;  1VS0 A;  1X9N A;  3X3M A;  4IUU A;  2X69 A;  3F2C A;  4JI6 L;  1SND A;  3I56 A;  3R8B A;  2NVY H;  2EQS A;  1WI5 A;  3I55 A;  2JP1 A;  1G2S A;  3S1R B;  3L3O C;  1VQJ A;  2UXC Q;  1A3T A;  4ZCK A;  2YU9 H;  1YHB A;  4FF3 A;  3F2U A;  4KJN A;  2AHO B;  4KK7 A;  3ZYY X;  2NN6 G;  4B9X A;  2R92 B;  4XTC S;  5GAG C;  1YVC A;  1A3U A;  1PH9 A;  2ZTC A;  2D2C C;  1K83 H;  1GUT A;  3AMU A;  3J7A 5;  2P5Z X;  2KCN A;  2K04 A;  2OCE A;  1NR4 A;  1WTV A;  2KCM A;  1X3G A;  4H13 C;  2KED A;  3UE0 A;  3OHX C;  2I0Q A;  4B3T Q;  2QEX A;  3SE0 A;  4KKS A;  1W6K A;  4AQY L;  2IY5 B;  3H6M A;  5COY A;  3GO5 A;  5DEH A;  2B63 H;  2V1C C;  5DM6 3;  3OYY A;  3J80 c;  1PVO A;  2LXJ A;  1W6J A;  3NPP A;  3A56 A;  3RLO A;  4JBW A;  1V1P B;  2B2U A;  1XWE A;  1VQ5 A;  5C4Z A;  2RQX A;  1EEF D;  3DEO A;  2QCP X;  4HIO A;  3HOU G;  5ELN A;  1GUS A;  4A3J B;  2RVL A;  4TVA B;  2UXD Q;  3RLF A;  5M5X B;  1QB5 D;  4QUC A;  4A3K B;  1VQI A;  5IT9 E;  4AIM A;  3TS2 A;  1WTO A;  3I73 A;  5EGT A;  1SN8 A;  4LW1 A;  1EZ8 A;  4EQO A;  3NBH A;  4DV4 Q;  1Y8P B;  2JJQ A;  1HA5 A;  1S4Z A;  1KAB A;  1FVI A;  2VUM H;  4X64 L;  2C9O A;  2E75 C;  5JVG 3;  4A3C G;  2R61 A;  5EKK A;  2CWP A;  1CHQ D;  2CFM A;  4XQN A;  3HOX H;  1YIJ A;  3J7A V;  4DK1 A;  4KY7 A;  4ZYS A;  2KHS A;  3PMF A;  2KHJ A;  3TP5 A;  3NBI A;  5D3I B;  4RCN A;  4A3G B;  4Y7N B;  2E2J H;  2WAQ E;  3M85 A;  3GTO H;  3MXU A;  1EY7 A;  1TY2 A;  3OIQ A;  5CR3 A;  2KCC A;  3S1M H;  3GTL B;  2GA4 B;  3SK4 A;  3JAM i;  3F1Z A;  4LF7 Q;  3CCR A;  2WB1 E;  3D31 A;  1MHW C;  3IRB A;  3I4M H;  2CKZ B;  2PPB C;  4X64 Q;  1KNA A;  1FGB D;  4P2C B;  3RN2 A;  2UUA Q;  1QUQ B;  2J4X A;  2RDG A;  2G5D A;  3NXW A;  3K57 A;  4BY7 B;  1STH A;  1EL0 A;  3TDQ A;  4DR7 L;  1TQO A;  1E2Z A;  1I50 B;  2HQE A;  2MPM A;  2VL6 A;  4KN4 C;  4GNX C;  5T1I A;  4EQN A;  3IAY A;  1SBB B;  1F2Y A;  2NN6 I;  3E0E A;  1EOT A;  1OXS C;  4WRD A;  4KY6 A;  5CGK A;  2JA8 B;  2BH2 A;  4CBV A;  3OIP A;  2DGY A;  4R4Q A;  5FLX c;  4A3B G;  2AWO A;  4OX9 L;  1B4O A;  1AFP A;  5I9O A;  3RN5 A;  4DK3 C;  4QF4 A;  4A3G G;  3LNN A;  1O78 A;  1LTR D;  2N88 A;  3R2I A;  1BR9 A;  3D8G A;  5JJZ A;  2JA7 G;  3CRK C;  1QNK A;  5JEA J;  2EYJ A;  1Y8O B;  2CQO A;  3P20 A;  4K8J A;  4KY5 A;  4PG3 A;  2UXB Q;  5LHY 1;  1KHI A;  1VQ7 A;  1HZB A;  2RDH A;  1Q1E A;  1U0L A;  4B08 A;  1IKM A;  5ELB A;  4OL7 A;  3E0J A;  4C3I G;  1UE6 A;  4DKA C;  5KYL A;  1PH3 A;  3LX0 A;  1TWF H;  3A8I E;  1ML0 D;  5CV7 A;  2F0O A;  1YIT A;  5IGF A;  5E1F A;  1TWH B;  4POF A;  2CH4 W;  2B2W C;  4IUT A;  3HOW G;  3DUZ A;  1BCP B;  4X3S A;  1UEB A;  2EYL A;  2K33 A;  3Q6S A;  4AYB E;  1IZ6 A;  4OWW B;  4EVO A;  4HTH A;  4QCL A;  1N32 L;  5EPL A;  1ESR A;  2HDL A;  4P74 A;  4JV5 L;  3NE5 B;  3PUY A;  2B63 B;  4DAY A;  3C3L A;  4DF7 A;  2K14 A;  3FDT A;  2WIN B;  3CC7 A;  3S1Q H;  1PYB A;  2EYF A;  3I91 A;  5IWA Q;  5IYB H;  4KHV A;  3H15 A;  1SAP A;  4QB4 A;  2FJ2 A;  2K01 A;  3GTP B;  3KLR A;  4OGQ C;  1VCI A;  2KCT A;  3VYU A;  4K0K L;  1WTH A;  5JAV A;  1LT6 D;  2JA5 H;  2ENB A;  4A4I A;  2K5H A;  3DHQ A;  1D8L A;  4DR5 Q;  3CCL A;  1TXY A;  1MIU A;  2EJG C;  5EQ0 A;  4DV4 L;  3I90 A;  2ZXO A;  5C0X I;  4LF6 Q;  4GOP C;  4B3M Q;  1L1O A;  1LTI D;  5ELE A;  1K3R A;  5GRO A;  4LF6 L;  1EY9 A;  2M2L A;  3MTS A;  3C46 A;  2V4D A;  3O13 A;  1GXD C;  3S24 A;  4RKL A;  2YTV A;  1HZC A;  1G6Z A;  4GN5 A;  3H0G B;  4C3H H;  4A3G H;  2CCZ A;  2IPK D;  1PLF A;  3UDI A;  5IY0 A;  4IN3 A;  1BKB A;  2EJM A;  4FF2 A;  5G3L D;  3BYT B;  5C3X A;  3D4W A;  2XSC A;  4RWS C;  5EPJ A;  3ERS X;  5IYC G;  4DV6 Q;  3BDO A;  2HQL A;  1A15 A;  2K5D A;  1EWH A;  3ONA B;  5HGQ A;  5D14 A;  2N78 A;  1LUZ A;  3ITP A;  4LF4 L;  5K36 G;  1XX8 A;  2A6E C;  3NQI A;  4A93 B;  4RCO A;  3I72 A;  3S2D H;  1CZW A;  2NTS A;  3GDE A;  4FO2 A;  1SNM A;  3G6J B;  4A3E H;  1J6Q A;  4B3R L;  4OIK A;  3U4V A;  1HQR D;  1SE4 A;  1P16 A;  1HH2 P;  3RNU A;  4JI2 L;  2R93 H;  1X56 A;  2PNH A;  2ES2 A;  1PTO D;  4FXD A;  2Z8L A;  3T16 A;  1VDZ A;  3H91 A;  2IWH A;  1MI2 A;  4OHJ A;  2KA7 A;  3F2D A;  4RGM A;  1Q8K A;  3UDX A;  3KDF A;  2OF1 A;  5CC4 A;  1AZP A;  3MEH A;  1EIF A;  2Z6K C;  2HDM A;  3JAM L;  4DV7 L;  3KF6 B;  1PMR A;  3NWS A;  1Z6H A;  3SXH A;  4I7A A;  1D5M C;  2VW9 A;  5IE8 A;  4IUP A;  2SEB D;  2O4X A;  5EBC A;  1KLU D;  5ELF A;  4LFA L;  5A2Q L;  4KKU A;  4IFD J;  2NB0 A;  3ER0 A;  1G2T A;  3FVQ A;  2UU9 Q;  1JJG A;  1B3A A;  2VS1 A;  1ICF B;  1LO5 D;  4B3T L;  1JWU D;  3LWE A;  3BZK A;  4A3D H;  3QOL A;  1YNN C;  4KD4 A;  3L0O A;  1G29 1;  3K5O A;  2F3W A;  1RTN A;  1SMY D;  1FYC A;  3Q23 A;  1JIC A;  3PO3 G;  1EY0 A;  5J22 A;  3T1H L;  3KLS A;  3I4O A;  3H94 A;  2CW0 D;  2EPB A;  3UDF A;  1KRS A;  3PCO B;  2OQ0 A;  4MZ9 A;  3BJU A;  4QIW E;  1D2B A;  5M5Y H;  1STA A;  2GN5 A;  1PRT D;  2MGS A;  2EYO A;  1HZA A;  1DD2 A;  3NEL A;  3GTJ H;  1TWA B;  4NXM L;  1C9O A;  1I4R A;  1NE3 A;  3KUP A;  3PO2 B;  1H9M A;  1Y1V H;  4YWM A;  1IBM L;  2A6H D;  2A6H C;  3OPO A;  1ZKO A;  1HUN A;  4EQP A;  2XN9 C;  2NWG A;  1I5F A;  2IX1 A;  4ME3 A;  4GKJ Q;  5JJK A;  4CDF C;  2K5Q A;  5C3E G;  2HUG A;  3K5M A;  5CBE E;  4E6I A;  3S1R H;  1Y8N B;  1N9W A;  1PH6 A;  3K59 A;  4P71 A;  2VUM G;  1HCZ A;  3A74 A;  4DGZ A;  4JI7 L;  1I4H A;  2YYZ A;  2NVQ B;  1JR0 D;  5KRU A;  1VQE A;  5L37 A;  3NSW A;  2F0U A;  5KND A;  2Q2T A;  5LL6 X;  1SJE D;  3KOJ A;  1JT8 A;  2B2V A;  4TKO B;  2NYZ D;  4DV2 Q;  2PI2 A;  4MHE A;  2G9D A;  4ZKC B;  4DV0 L;  1XMO Q;  1SR3 A;  1Q7Y C;  3OMC A;  4PMW A;  2Q8T A;  3A0J A;  1UE5 A;  5G3L F;  3BVM A;  3PIO 3;  2Z4I A;  2EY6 A;  1RDP D;  2B8G A;  1VF5 C;  2F0M A;  5JPM C;  3V96 A;  1TS3 A;  2NVX H;  2NVT H;  2BH8 A;  3LWU A;  2EZV A;  4A3L H;  1SYC A;  4A3K G;  2DY7 A;  3F2B A;  1Y69 U;  4X66 L;  1X3P A;  4A3K H;  3MA2 B;  1C48 A;  2A6E D;  2HHH L;  2KBN A;  1PZI D;  4NDX A;  2R93 B;  4X3U A;  1PTO F;  1EOV A;  1TII D;  2MQH A;  3X3N A;  2I5L X;  4XXE A;  5EBD A;  1CA6 A;  1FL0 A;  1PTO H;  4F87 A;  2GVA A;  1XNQ L;  1GOZ A;  4CDC C;  1BBU A;  2K50 A;  4HID A;  2R3Z A;  1F9R A;  4RGT A;  3J81 i;  1B1Z A;  3MWY W;  3I4N B;  3KYH C;  5JPN C;  4DV5 Q;  2BE5 C;  3HS0 C;  4TRD A;  3JC6 6;  4GS3 A;  2BOS A;  2L5T A;  5E3F A;  3W1B A;  4DR1 L;  5FO9 B;  1CZG A;  3M7G A;  2R7Z G;  1NAP A;  3U9S A;  3S1M B;  1K0S A;  5COR A;  5I6W A;  2ZM6 L;  2Q8I B;  5FK9 C;  4DNT B;  1L1O C;  1K9M C;  2L9H A;  2MJ8 A;  1VQG A;  3OMG A;  2AUJ D;  5JOB A;  3GTM B;  3AFQ A;  3FPU B;  4A3D B;  3KLS X;  4JI1 L;  2E74 C;  1E7Z A;  3EQL C;  3IFD A;  2A69 D;  3KF8 B;  4A93 G;  4I65 A;  4JI5 Q;  3I70 A;  4QY7 A;  1NY4 A;  4DR1 Q;  1FNV A;  1M8A A;  3CF5 A;  3NTI A;  1WTQ A;  1KNE A;  3CU7 A;  2ZXR A;  1Y1V G;  2F0N A;  3Q0A A;  1KXL A;  4O2D A;  4DR5 L;  1NCV A;  3GTJ B;  4OO1 G;  2XWB B;  2H1E A;  4A3C H;  1A2U A;  3TSS A;  4O1N A;  4CGY B;  4RHS A;  2FFK B;  4JI1 Q;  1CQV A;  4R8I A;  5M9O A;  5FJ8 H;  2KJX A;  1F2Z A;  1XNR Q;  2NBF A;  4LF8 L;  1GUO A;  4R4C A;  4DV3 Q;  4GNX A;  3UDG A;  4JOI C;  4A3I G;  2F0F A;  3TP6 A;  4OWX B;  4LNQ A;  5KYI A;  4G7O C;  1D1I A;  1HFG A;  4X62 Q;  1Q46 A;  3Q22 A;  3TRZ A;  4BWG B;  2A19 A;  4EGV A;  3S1N H;  4BS9 A;  2EYP A;  4K8I A;  2EVB A;  1KDC A;  4A3J H;  3MFY A;  5M5X H;  5EPK A;  2K52 A;  2F0P A;  3QJY A;  5FLM H;  2QDB A;  4RA8 A;  3T4A C;  4P73 A;  2WB1 B;  3SHL A;  4LF5 Q;  1JOK A;  1P8L A;  3GTQ B;  3I7F A;  4FDB A;  1SXT A;  2EY1 A;  5FLM G;  4MNO A;  3GTK B;  5M3M H;  4DR4 Q;  3VA5 A;  2DY8 A;  3FPP A;  3B6Y A;  2F0H A;  3CPW A;  1TWG B;  4JK1 C;  2F0G A;  4PMC A;  3S1Q B;  4MTN A;  2X6G A;  2XRQ D;  3J81 L;  1XTC D;  4Y7N H;  2E2J B;  2YTY A;  2R93 G;  4IZ8 A;  1SYB A;  3P75 A;  1SE8 A;  3GV6 A;  5BN5 A;  2WAC A;  3MVV A;  5C4J B;  2VY3 A;  5LMN W;  3C1F A;  3HOV H;  3HP3 A;  1SEB D;  4CKB A;  1VQK A;  1QVF A;  1Q8I A;  4UDU C;  1PRT B;  4JG2 A;  1MGS A;  3AU7 A;  2F0E A;  3TBI B;  4NPS A;  4CJ1 B;  1DM0 B;  3KF6 A;  1NSN S;  1BUV T;  1NMF A;  3ULJ A;  1PH4 A;  1ASZ A;  4JC0 A;  2G9H D;  2CW0 C;  4KKT A;  1KC8 C;  5FO7 B;  2D9U A;  2E5L Q;  4YCU A;  1OXU A;  3AYH B;  4IQZ A;  5EKI A;  4XYO A;  3ULL A;  2ID0 A;  1U5K A;  5CV5 A;  1QJO A;  3GQB A;  5JVH 3;  1HNZ Q;  3WDN A;  3BYY B;  5JEA H;  3NHH A;  2CQA A;  3FKI B;  1CFM A;  1H9R A;  2JA8 H;  3CD6 A;  1X6O A;  3HZX A;  1O7Z A;  2MUY A;  3I8Z A;  4UPA A;  1BF4 A;  4K2L A;  4G4K A;  1QUQ A;  2ZT9 C;  2ZJR A;  1X54 A;  3CHB D;  4L5T A;  3ICE A;  3S15 B;  4WJW A;  1RIP A;  3MXP A;  4FXK C;  4RFB A;  1E2W A;  3MFG A;  1B50 A;  2Q2H A;  4XIG S;  4GKK Q;  3M9B A;  1KL9 A;  4TSS A;  1TU2 B;  3QWN A;  1IBM Q;  2UUC L;  3FRP B;  2WKC A;  2YTX A;  1LT5 D;  3NP8 A;  4LFB Q;  3DWQ A;  1VQA A;  2SNS A;  4LF9 Q;  3BVG A;  1YHA A;  1BNZ A;  4LF7 L;  2A73 B;  2KEN A;  4PZ6 A;  3D6W A;  2WII B;  1H9J A;  2JQO A;  3E9I A;  1SE2 A;  1SNC A;  2OWO A;  2L1B A;  3TN2 A;  3RZD B;  3NBH B;  3MZ5 A;  4NXN L;  2PI2 E;  2MHV A;  1EYA A;  3CMA A;  2B29 A;  3BDC A;  2LFN A;  4ODG A;  2RSO A;  5GAH C;  5GAD C;  1N36 L;  3NEN A;  4UY8 C;  3M4P A;  3PUX A;  1EYD A;  3F8T A;  1V9P A;  2F0L A;  1PV4 A;  4X65 L;  1GVP A;  4B3S L;  5C4X B;  4J15 A;  3K8A A;  2Z6B A;  2B3G A;  4QMG A;  3EFX D;  4A3F H;  2FMC A;  2D0P A;  3OW7 A;  1EIY B;  1TKW B;  3VR5 A;  4LUV A;  5C0X J;  2JA8 G;  2UUB L;  3K7A B;  1SLJ A;  1EFI D;  4HCS A;  1I94 Q;  1LT4 D;  3R2T A;  3EVQ A;  4PNY A;  1N8R C;  4V0B A;  3DM3 A;  3FMC A;  2VQE L;  4BXX G;  4A3J G;  1ICW A;  3U9O A;  4JI2 Q;  4M8A A;  1AP0 A;  3QOJ A;  4LUO A;  2JA7 H;  2PMZ B;  1MBY A;  2N3S A;  3GTQ H;  2RCN A;  2BDN A;  3HOW B;  1Y1W G;  1E0B A;  1XPR A;  1IL8 A;  4X65 Q;  1LYL A;  1G51 A;  4B3S Q;  2E2H H;  4XT1 B;  4DK6 C;  5IYB G;  2C35 B;  1W3S A;  3S2H H;  3H3V I;  1EU4 A;  1RF2 D;  4DAM A;  4UP8 A;  1AH9 A;  1TWG H;  3KF8 A;  4DUY Q;  5C3W A;  4R4I A;  2F3I A;  2VQF L;  4DR6 Q;  3BU2 A;  3GD7 A;  1CA5 A;  1JJ2 A;  3H3V H;  4LWC A;  5IT9 L;  1HR0 L;  4OO1 H;  1JMC A;  4BXX H;  1OO9 B;  1QG7 A;  3J81 j;  4C56 C;  4K6L A;  1AN8 A;  2ZJQ A;  5IYD G;  2B2V C;  3VR4 A;  2AUK A;  4FYD A;  1D5Z C;  5BR8 L;  3PQI A;  5C44 H;  4DR2 L;  3S16 B;  3KFU A;  1I4P A;  4LMQ D;  4Q0F A;  1Y1W B;  4C2M H;  3W5O A;  4KD3 A;  1BO0 A;  4A93 H;  1CT1 D;  5HUR A;  2NVQ H;  4YWL A;  1ILP A;  1FJG Q;  1KAA A;  1SYE A;  2MO1 A;  4JV5 Q;  2F3V A;  1Q82 C;  1IYU A;  1IYJ B;  1K3B C;  5IIF A;  1S5E D;  3MAQ A;  1S72 A;  1PZK D;  1SNO A;  3K80 C;  2WKD A;  5GAE C;  1VQL A;  3KBG A;  5ELD A;  5BN3 A;  5E4X A;  3AFP A;  4ID6 A;  4WOR A;  1HR0 Q;  4GLA C;  3IKJ A;  4IOC A;  1I3Q H;  4IJL A;  2E2D C;  1ZYR C;  4OEL B;  1STY A;  4C1N I;  1ZYR D;  3CCS A;  3TZD A;  4A3I H;  2R7Z H;  3S15 H;  4KJO A;  1U4P A;  1ASY A;  4CHT B;  3ND9 A;  4IO9 A;  2VB3 X;  2N49 A;  4DU9 A;  1RD9 D;  1QE6 A;  4AYB G;  3E5S A;  3PV0 A;  3GV3 A;  1WTW A;  2AWN A;  1UNS A;  4APV A;  4X3K A;  3SK5 A;  1HTP A;  4LFC Q;  1G8Z D;  2RKS A;  5EKL A;  4HAE A;  4A3M H;  1D1K A;  1M90 C;  3CCU A;  2O5I C;  1LAB A;  4XT3 B;  1A2T A;  4BY7 H;  4WJ3 M;  5IP7 G;  2OTJ A;  4N9T A;  1N36 Q;  1I50 H;  4HJ7 A;  4BY1 G;  4N8X 1;  2F4V L;  1OXX K;  4DUZ Q;  4IOA A;  4UHV A;  1BBW A;  2Y0S E;  3ND8 A;  1KDB A;  5GQO A;  1EIG A;  5IT9 c;  4B3R Q;  4YWK A;  2UXC L;  5EAY A;  3SK6 A;  1AE3 A;  2IX0 A;  2F0J A;  5KIX A;  4V19 0;  5IGC A;  1QVG A;  1HUM A;  3JAM c;  1ET9 A;  4NB3 A;  5H1S E;  1T9H A;  1CM9 A;  1I4X A;  1LTS D;  2PCF B;  3W2D A;  2UUC Q;  1RCV D;  1TWA H;  2RA4 A;  2JEA I;  3HOY G;  1JOR A;  3D3R A;  3QR8 A;  2VQE Q;  4JI6 Q;  3NUC A;  3GTM H;  4FVM A;  1I94 L;  5K36 H;  2IW3 A;  1PYW D;  2KVM A;  3H0G G;  3T1Y Q;  1GKH A;  1BXT A;  1JE5 A;  1A6X A;  1EQV A;  1S5F D;  1QOH A;  3SGI A;  3HFZ B;  4JOI A;  2KEC A;  3E3X A;  4J6H A;  1TWC B;  5E4W C;  3KJO A;  3WOF A;  2JA7 B;  1S5D D;  4HMJ A;  3K5N A;  4DV0 Q;  1XMO L;  1E2V A;  1U4R A;  3DMU A;  3HOW H;  1II3 A;  3OOC A;  4CJ0 B;  3K0Y A;  4LUZ A;  1HFN A;  4FF1 A;  4JYA Q;  3R3O A;  4GLV B;  4BBS G;  1DYQ A;  3HRZ C;  2D0O A;  2XNA C;  1TWH H;  3H3V C;  1UE1 A;  1KRT A;  4K2K A;  1WTX A;  1JCK B;  3PO3 B;  3A7L A;  5NUC A;  1TS5 A;  1PH5 A;  1S5B D;  2KQ3 A;  3NWT A;  3M4O H;  5M5W B;  1BCP C;  1KQS A;  4ILW A;  3HKS A;  3T1Y L;  5FLX L;  1LTG D;  2QEJ C;  1Q86 C;  3V2T A;  4DV1 Q;  1GD7 A;  1GM5 A;  4RMF A;  1S3O A;  2FXQ A;  1XYI A;  2NZO A;  3BDL A;  1UE7 A;  5DNF A;  2UU9 L;  2PYK A;  1FJG L;  4HIM A;  3M4Y A;  2ICI A;  1VQ4 A;  4J1M A;  1F2L A;  4GKK L;  2NVT B;  4DN4 M;  3HKZ B;  3RZO B;  1NNX A;  4A3B H;  3A8K E;  1F77 A;  1B9N A;  1F9Q A;  5CV4 A;  4PZ7 A;  2F52 A;  4R1J A;  4OIJ A;  4OXP A;  4BY1 B;  3KLW A;  1VF7 A;  2XVS A;  1D7Q A;  1SJH D;  4K0K Q;  2XRS D;  4DV7 Q;  1Y14 B;  3K81 C;  2E5L L;  1VQ8 A;  3STB C;  2SNM A;  1X55 A;  2K5W A;  1I3Q B;  3CC4 A;  4YIJ A;  4ZKB B;  3TP7 A;  4IPG A;  1VQ9 A;  1PA6 A;  4UP7 A;  5C6A A;  1TY0 A;  2VB2 X;  1HNX L;  2L12 A;  5I2Y A;  4JYA L;  1AZQ A;  5HGT A;  2R7Z B;  1A8V A;  4LJZ C;  5JJI A;  3P7J A;  1DJR D;  1EFW A;  3FKI G;  4CKE A;  1JOQ A;  3S17 H;  4BBR B;  2PZT A;  2F4V Q;  1WD1 A;  3SK8 A;  4HJ9 A;  3K6O A;  3J81 E;  2Y0S B;  3RD4 A;  2DJG C;  1IBK Q;  1C7Y A;  2ATW A;  1C0A A;  1RKN A;  3K0X A;  1V43 A;  3N52 A;  4DV3 L;  3ERQ A;  4O42 A;  2EYH A;  3IFT A;  1HNW Q;  1CKN B;  2K05 A;  2NTT A;  2Q2I A;  3D4D A;  5M3F H;  1H9K A;  1HJP A;  1Q1B A;  3BG3 A;  3L9A X;  1QNU A;  2EJF C;  3VR2 A;  5JEA G;  2MFI A;  1WTR A;  3S2D B;  3HOY B;  4ZAI A;  1VQH A;  4LFC L;  3PF4 A;  3HOZ H;  2RSN A;  1JC7 A;  2ASB A;  3SVM A;  2Y0S G;  3CQZ B;  1SNP A;  2HD3 A;  4LF9 L;  4JBM A;  1LTL A;  2AQ2 B;  4O0A A;  3TQY A;  1XPU A;  2H4O A;  3CME A;  1W2B A;  1T5E A;  2ZTE A;  1LTB D;  1SMX A;  1IXR A;  2XGT A;  3J80 L;  5IGB A;  4GN3 B;  1L1O B;  1BVS A;  4LF5 L;  2BDO A;  1L0W A;  1SMY C;  1SYF A;  4WFN 3;  4K5W A;  1Q12 A;  2K6A A;  4DAV A;  3Q8D A;  4L63 B;  3HOU H;  1HPC A;  2K1B A;  2Z0S A;  3T51 B;  1JWS D;  1WCM H;  2ZXP A;  4U67 3;  3HOZ G;  1Z47 A;  4BBR G;  4FP5 D;  4G57 A;  1K73 C;  4JPB W;  3AQQ A;  1XMQ Q;  1T5X D;  5D65 A;  2NUC A;  1V1P A;  2F0Q A;  4IAL A;  3OWF A;  4I7Z C;  5CV9 A;  4Y52 H;  3QIA A;  4F8M A;  5LMU L;  1B7Y B;  1JQY D;  1KD1 C;  1E1O A;  2K7V A;  2KHI A;  4NMZ A;  3RUZ A;  2YU9 B;  4L5S A;  4DAY B;  4UAI A;  1YBY A;  4JW0 A;  1DZ1 A;  5IWA L;  3PUW A;  4GKJ L;  4K5X A;  3NK9 A;  1JJC B;  2DJF C;  2Z1C A;  2R92 H;  5IYD H;  1K83 B;  3RZD H;  3DWP A;  1CSQ A;  5CYU A;  3N6R A;  2ICE C;  4OEM B;  3GTG H;  1STB A;  5M5Y B;  5C5L A;  1B53 A;  1D6E C;  4FXG C;  3I3C A;  2A1A A;  5BR8 Q;  3W1G A;  4DR2 Q;  2RHQ B;  1NJI C;  1PYS B;  5A2Q E;  5C4X H;  5ISR A;  4B3M L;  3CCV A;  3MEF A;  1BCP F;  4QL5 A;  3K5L A;  2JYO A;  4G7H C;  1Y1V B;  1CKO A;  2I07 B;  4HR7 B;  4AH6 A;  3SEB A;  3K7A H;  3T1H Q;  1PH7 A;  1HNW L;  1X32 A;  1NMG A;  3QO2 A;  2PQA A;  4Z9C B;  3KK7 A;  5C4J H;  2H5X A;  5AJ3 L;  1L0Y B;  1HR0 W;  3DLL A;  3TEH B;  1RJT A;  2JXM B;  3HOV B;  1WOC A;  4DR3 Q;  3PF5 A;  1HTL D;  2OEO A;  2B2W A;  1KTK A;  1XTD A;  1X3Q A;  2JE6 I;  2CVR A;  2QA4 A;  1L2F A;  1F2M A;  5KNC A;  1QZG A;  4R8N A;  3G6E A;  1OXT A;  1IHZ A;  3VR6 A;  1QIL A;  4KHP Q;  3OSO A;  2UUB Q;  4GN4 B;  3DWA A;  1IBL L;  2E2H B;  3T56 B;  4S3S A;  3K7U C;  1IW7 D;  1JWM D;  2K5V A;  3S2H B;  4DUZ L;  2JA5 G;  4MN3 A;  3RMH A;  3BS1 A;  4JI7 Q;  4BBS H;  2NZ1 D;  4CDE C;  1HQM C;  4A3M G;  2DUD A;  4BBR H;  3H09 A;  3FEW X;  2PZW A;  1WCM G;  4OWT B;  3U4Z A;  2M00 A;  5KGU A;  2B39 A;  1SNQ A;  1XNR L;  5I4D A;  2QIL A;  4OON A;  3GTL H;  4JCV E;  3J80 i;  3S14 H;  4L8J A;  4DV2 L;  4PZ8 A;  2WP8 J;  2HT1 A;  2DN8 A;  5C44 B;  3S16 H;  2MNA A;  2SOB A;  4HED A;  3ERO A;  5IOC A;  2NVX B;  2CH4 A;  2A8V A;  3CXC A;  1V1O A;  2LKV A;  4DNI A;  3OWE B;  3HOZ B;  1EU3 A;  3TZU A;  1RTO A;  1PFB A;  3HOV G;  4IUQ A;  2K4K A;  4JI8 L;  4HJ8 A;  2ALY B;  5C4H A;  3TS0 A;  1PH8 A;  1WJJ A;  1AW7 A;  5AFW A;  2HIX A;  3VYT A;  4QQB X;  2PQE A;  1U4M A;  1DCZ A;  3CAM A;  5BN4 A;  1N34 Q;  2EOT A;  3KJP A;  4RH6 A;  3CP0 A;  3SDZ A;  4DK0 A;  1C4Q A;  4L5R C;  2AQ1 B;  4HSV A;  5I9P A;  4EQ5 A;  3I4N H;  1EIH A;  3HKZ G;  1IL2 A;  5IP9 H;  2SDF A;  4HMI A;  4A3L G;  4CKC A;  5CV8 A;  2ZM6 Q;  4ZQ3 A;  1STN A;  4DUY L;  1K28 A;  4NP5 A;  3STB D;  3M3Y H;  4IPH A;  5CBA E;  3BVZ A;  4JI8 Q;  1EY8 A;  4ZK9 B;  4WJ4 A;  1HZ9 A;  4DV5 L;  5LMU Q;  4ZUI A;  1ZEQ X;  2JA6 B;  2R6G A;  4A3F B;  3J7A F;  2IT1 A;  2CWA A;  2PNR C;  4K5V A;  4LFA Q;  1X3F A;  5J39 A;  2EY5 A;  4A76 A;  1D5X C;  1PH1 A;  1NTG A;  3D6C A;  4KHP L;  1TWF B;  5IYC H;  1YHQ A;  4QUF A;  4C3J B;  2RDF A;  1DGS A;  3D4R A;  3JAM E;  1HNZ L;  3P1H A;  4DNR B;  4GZY C;  2VZA A;  2EDG A;  2Q8R E;  3L2P A;  3VYR A;  5C0X H;  3I4M G;  3CC2 A;  2ZTD A;  4RGO S;  2IL8 A;  3DXJ C;  2E2I H;  2K5N A;  5K5P A;  1G91 A;  1PXU A;  1I6H B;  1J5E L;  3MXN A;  2AKW B;  3UE1 A;  3OTO L;  3GTP H;  4KN7 C;  4MTK A;  5AJ3 Q;  2PQA B;  2NVY B;  1GO3 E;  1UEA B;  4H44 C;  1B2T A;  1BQQ T;  1MSG A;  2A5H A;  2QKI C;  4GOP B;  3RR5 A;  1HXY D;  1LAC A;  1TWC H;  4LK1 C;  4QGU A;  1I4Q A;  1PH2 A;  2GVB A;  4LFB L;  2CHB D;  4G7Z C;  1VQ6 A;  1O7Y A;  1ENC A;  1GUN A;  1AEX A;  1YI2 A;  5C3E B;  1WD0 A;  4BA2 I;  3I2Z A;  2X6L A;  1E22 A;  4LF8 Q;  3PO3 H;  4BBS B;  2AMC B;  1LTA D;  4KI0 A;  3NTH A;  4K14 A;  4YY3 Q;  1IW7 C;  2FIN B;  4POG A;  1E3P A;  4PV1 C;  5E7N A;  1SE3 A;  3D0F A;  4FF4 A;  5J1Z A;  4CDD C;  4NKL A;  2R92 G;  5M3M B;  1EWI A;  3CCJ A;  2E76 C;  1JOO A;  1G6P A;  2B63 G;  1M4V A;  3PIP A;  3V05 A;  2OTL A;  1TT2 A;  2FHT A;  1OTC A;  3Q24 A;  5KNB A;  1SDF A;  2F0D A;  4RGN A;  4A3B B;  1U9R A;  1EEI D;  1O7I A;  4ME5 A;  1BCP D;  2BCO A;  2JSO A;  3G71 A;  4JI4 Q;  4YHH L;  1B3Q A;  5KEE A;  2N8N A;  3TRE A;  4YHH Q;  2D5D A;  4JI3 Q;  1STE A;  2L15 A;  3DM1 A;  1SFO B;  3HOX B;  1NR2 A;  1QWY A;  3VR3 A;  4ZRZ A;  2I5M X;  5A35 A;  1QZH A;  1XPO A;  4A3E G;  1J8I A;  2BA1 A;  4XQQ A;  1TS2 A;  1HRJ A;  3I4L A;  2F1M A;  3M3Y B;  1IBL Q;  3MXG A;  1V1Q A;  4XYQ A;  2XTI A;  3M4Q A;  2R7D A;  1YJN A;  4P72 A;  4RG1 A;  3PIO A;  1KLG D;  4B9W A;  1CUK A;  1JB7 A;  3I4M B;  1LV9 A;  4N8F A;  2B2Y A;  1JB3 A;  3J7Y W;  2VXW A;  1PFM A;  5EJW A;  3CRL C;  2WAQ B;  2JEB I;  4C3H G;  2O5J C;  2ZJP A;  5HY6 A;  1ET6 A;  2K32 A;  3C1E A;  2F0W A;  4C3J H;  1GUG A;  1ROD A;  1NUC A;  5F2D A;  1I6V C;  3CPF A;  3EIV A;  4OO1 I;  1AE2 A;  3E6Z X;  3AB9 A;  4BY7 G;  2Q2U A;  3LGJ A;  1E1T A;  1XJV A;  1B44 D;  4GLX A;  3TP8 A;  2M9V A;  4R4T A;  1ENF A;  1CHP D;  1PRT C;  2QW7 A;  2L11 A;  3C2P A;  2D62 A;  2B2T A;  4DR7 Q;  5CMD A;  3PO2 H;  1YEZ A;  1B9M A;  3R93 A;  5C0X G;  1I6H H;  2QDL A;  1SYD A;  3OW2 A;  3EN2 A;  1R4P B;  2WB1 G;  3M4O B;  5M5W H;  4DV6 L;  1RL2 A;  4DA2 A;  1H9S B;  1N33 Q;  2JA9 A;  2L0C A;  1MKH A;  4XDX A;  5IOD A;  1YNJ D;  1EY5 A;  1YNX A;  1XXG A;  4IUV A;  5IGD A;  3J7Z C;  2KOL A;  3G7L A;  4X62 L;  4LF4 Q;  1WTP A;  3CCM A;  3J80 E;  3AEV A;  5CV6 A;  1LTT D;  2F0T A;  1GHJ A;  3ZJY C;  4KHZ A;  1HHV A;  1EUJ A;  1PHJ A;  3FP9 A;  5M3M G;  5C3E H;  1EQQ A;  4AYB B;  1N34 L;  1O7L A;  3SR1 A;  4BA1 I;  3GTG B;  2LSS A;  4L6T B;  1PDQ A;  1SRO A;  2BE5 D;  2JK8 A;  2L4N A;  2IHF A;  4C3I H;  1QVC A;  1DOK A;  3EBE A;  1R9T H;  4UP9 A;  4A3F G;  1X65 A;  4H7B A;  4TQU S;  2C5C A;  3PUZ A;  5C44 G;  3J81 c;  1VMC A;  4JI0 Q;  1SRU A;  2VQF Q;  2Z9H A;  4DR6 L;  2NN6 H;  1WVL A;  1ONL A;  3BZD B;  2MO0 A;  1DOM A;  3A5U A;  4JI0 L;  3HG9 A;  3PGZ A;  4DXF A;  1KDA A;  2K75 A;  2DNE A;  3CCQ A;  3S17 B;  1Q3L A;  1LM0 A;  1C8C A;  4IFD I;  2FMM A;  1PRT F;  1K8A C;  1WYD A;  3GTO B;  2EY2 A;  4FNF A;  3TME A;  2KEE A;  1XMQ L;  1PFN A;  3HEJ A;  2LY7 A;  4A75 A;  4JI4 L;  4GNX B;  5DLQ E;  2PMZ E;  2IX3 A;  4IFD G;  1E24 A;  3OTO Q;  2PO4 A;  1Y1W H;  2I46 A;  5M3F B;  4C2M B;  3ULP A;  1SFO H;  1YJW A;  1ESF A;  3MC0 B;  3HOY H;  2LMC B;  2HHH Q;  1WFQ A;  4ZUJ A;  1NBW A;  2LS0 1;  3CQZ H;  3K58 A;  2PW5 A;  2RF4 A;  1SSO A;  1STG A;  2DNC A;  4ULL A;  4KLK A;  1CKM A;  2PW7 A;  2MP1 A; 
#chains in the Genus database with same CATH homology
 2WAQ G;  1UEB A;  4AYB E;  3VDY A;  1IZ6 A;  4OWW B;  3A5Z B;  4YCV A;  5M3F G;  1N32 L;  2JA8 H;  2A1A A;  4P74 A;  5BR8 Q;  3W1G A;  1X6O A;  1Z9F A;  2RHQ B;  5IP9 G;  1PYS B;  4DR2 Q;  3PUY A;  1NJI C;  3CD6 A;  5C4X H;  4UPA A;  4B3M L;  3CCV A;  3MEF A;  2E8G A;  4X66 Q;  1QUQ A;  2ZJR A;  4QL5 A;  2JA6 G;  1X54 A;  2K14 A;  1CKO A;  4L5T A;  3ICE A;  2UXD L;  3CC7 A;  1K8G A;  1RIP A;  2NZH A;  3S1Q H;  4AH6 A;  1PYB A;  5IWA Q;  5IYB H;  3K7A H;  3H15 A;  3T1H Q;  1MJE A;  2Q2H A;  4XIG S;  1PH7 A;  4GKK Q;  1HNW L;  1NMG A;  3M9B A;  1KL9 A;  2PQA A;  1EQR A;  1VCI A;  2EXD A;  2KCT A;  5C4J H;  2H5X A;  5AJ3 L;  4K0K L;  3U58 A;  1HR0 W;  3DLL A;  4X6A H;  1IBM Q;  2UUC L;  3TEH B;  2JA5 H;  1WOC A;  4A4I A;  4DR3 Q;  2K5H A;  3PF5 A;  1D8L A;  1K0R A;  2YTX A;  4DR5 Q;  4LFB Q;  3CCL A;  1VQA A;  1TXY A;  4IPD A;  4LF9 Q;  1MIU A;  1XTD A;  1YHA A;  2JE6 I;  3CW2 C;  1X3E A;  2QA4 A;  1L2F A;  4DV4 L;  3HOX G;  1QZG A;  3G6E A;  1OXT A;  5C0X I;  4LF7 L;  4KHP Q;  2UUB Q;  4LF6 Q;  2KEN A;  4PZ6 A;  4GOP C;  4GN4 B;  1L1O A;  4IJH A;  1IBL L;  4B3M Q;  2JQO A;  3E9I A;  1K3R A;  1J5E Q;  5GRO A;  2OWO A;  4LF6 L;  3K7U C;  2Z6K A;  2K5V A;  4DUZ L;  5C4X G;  4L5Q A;  2JA5 G;  3S24 A;  3NBH B;  4P75 A;  2YTV A;  1HZC A;  4NXN L;  2PI2 E;  4JI7 Q;  4BBS H;  3CMA A;  1UWV A;  2B29 A;  4GN5 A;  4A3M G;  2DUD A;  4C3H H;  4BBR H;  2CCZ A;  4A3G H;  4JI3 L;  1MJC A;  2R7F A;  3UDI A;  5GAH C;  1WCM G;  1B70 B;  4OWT B;  3U4Z A;  1VQF A;  5IY0 A;  3NEN A;  5GAD C;  1N36 L;  3M4P A;  3PUX A;  1BKB A;  1HNX Q;  4UY8 C;  1XNR L;  4OON A;  3PSI A;  3F8T A;  1V9P A;  3GTL H;  4NXM Q;  1YJ9 A;  4JCV E;  4X65 L;  1GVP A;  1PV4 A;  4B3S L;  4JBJ A;  3J80 i;  4J15 A;  5LMN Q;  3K8A A;  3ERS X;  2B3G A;  1OXV A;  4H02 A;  5IYC G;  3S14 H;  4DV6 Q;  4GOP A;  2JA6 H;  3HKZ E;  4DV2 L;  2HQL A;  4A3F H;  2D0P A;  2WP8 J;  4PZ8 A;  2HT1 A;  3S16 H;  4JI5 L;  2MNA A;  1EIY B;  5HGQ A;  2OQK A;  4LUV A;  5C0X J;  4HJA A;  2JA8 G;  2UUB L;  2N78 A;  1SLJ A;  1LUZ A;  5J3B A;  4LF4 L;  2A8V A;  1I94 Q;  5K36 G;  3CXC A;  4DNI A;  1CSP A;  1N8R C;  3S2D H;  3MXN B;  3GDE A;  4DV1 L;  1A0I A;  3DM3 A;  4A3E H;  2VQE L;  1J6Q A;  4BXX G;  4YY3 L;  3HOV G;  4B3R L;  3E9H A;  2K4K A;  4A3J G;  3U4V A;  4JI8 L;  4JI2 Q;  4HJ5 A;  4HJ8 A;  2ALY B;  4LUO A;  3TS0 A;  1PH8 A;  1WJJ A;  2JA7 H;  3PUV A;  1B8A A;  1P16 A;  1HH2 P;  2HIX A;  3RNU A;  4JI2 L;  2R93 H;  2N3S A;  1X56 A;  2PNH A;  2ES2 A;  3GTQ H;  2RCN A;  4QQB X;  3CAM A;  2QGQ A;  1Y1W G;  1XPR A;  2WFW A;  4X65 Q;  1LYL A;  1G51 A;  4B3S Q;  1N34 Q;  5LMN L;  2E2H H;  4DK6 C;  5IYB G;  3KJP A;  3CP0 A;  2C35 B;  3F2D A;  1Q8K A;  1IBK L;  3GTK H;  1W3S A;  1KAW A;  3UDX A;  3S2H H;  4L5R C;  3KDF A;  3H3V I;  4EQ5 A;  1Q81 C;  4DAM A;  4UP8 A;  3I4N H;  1TWG H;  1VQM A;  1AH9 A;  3HKZ G;  4A3D G;  4DUY Q;  5FJ8 G;  1IL2 A;  4YCW A;  5IP9 H;  1VQO A;  1EIF A;  2Z6K C;  3H0G H;  4R4I A;  4A3L G;  4DV7 L;  3KF6 B;  2ZM6 Q;  2F3I A;  2VQF L;  4DR4 L;  3BU2 A;  4DUY L;  4DR6 Q;  1XNQ Q;  3M3Y H;  3STB D;  3GD7 A;  3U50 C;  1JJ2 A;  3H3V H;  4IPH A;  4LWC A;  1VQP A;  2VW9 A;  1HR0 L;  5IE8 A;  4JI8 Q;  1S40 A;  1JMC A;  4BXX H;  4WJ4 A;  2YV5 A;  2HIV A;  1HZ9 A;  4QJF A;  3J81 j;  5LMU Q;  4DV5 L;  2R6G A;  4LFA L;  2ZJQ A;  5IYD G;  4IFD J;  3ER0 A;  3BZC A;  2UU9 Q;  5C44 H;  5BR8 L;  4DR2 L;  2IT1 A;  1VQD A;  1JJG A;  2CWA A;  2VS1 A;  4LFA Q;  1X3F A;  4B3T L;  4A76 A;  3KFU A;  1H95 A;  1PH1 A;  4R4O A;  4C2M H;  3BZK A;  3G48 A;  3W5O A;  1NTG A;  3RZO H;  4A3D H;  4A93 H;  3L0O A;  1G29 1;  4KHP L;  1N33 L;  2NVQ H;  4YWL A;  3CCE A;  5IYC H;  3PO3 G;  1FJG Q;  1N32 Q;  3T1H L;  3I4O A;  1YZ6 A;  1YHQ A;  2MO1 A;  3UDF A;  1VQB A;  1KRS A;  1Q82 C;  3WWV A;  4JV5 Q;  3PCO B;  1DGS A;  1IYJ B;  2OQ0 A;  4MZ9 A;  1S72 A;  4BY1 H;  4OX9 Q;  3K80 C;  3BJU A;  4QIW E;  5GAE C;  1HNZ L;  5IP7 H;  5M5Y H;  4AQY Q;  1KIX A;  1VQL A;  2EIF A;  2GN5 A;  4DR3 L;  2VZA A;  3AFP A;  3L2P A;  3FKI H;  1M1K C;  1HR0 Q;  4GLA C;  4IOC A;  3I4M G;  3CC2 A;  1A62 A;  1I3Q H;  1HZA A;  4IJL A;  3NEL A;  2ZTD A;  3GTJ H;  2UXB L;  4NXM L;  1C9O A;  2VNU D;  1NE3 A;  1VQC A;  3CCS A;  2E2I H;  3L7Z C;  1Y1V H;  4YWM A;  2K5N A;  4A3I H;  2R7Z H;  1IBM L;  3S15 H;  1J5E L;  2AKW B;  5ELO A;  3UE1 A;  3OTO L;  1CKN A;  2LXK A;  1ASY A;  3GTP H;  1I5F A;  4IO9 A;  5AJ3 Q;  4NXN Q;  2N49 A;  2PQA B;  4AYB G;  2IX1 A;  1GO3 E;  3PV0 A;  4ME3 A;  4GKJ Q;  5JJK A;  2AWN A;  3PO2 G;  5C3E G;  4APV A;  4GOP B;  3RR5 A;  4DPG A;  4LFC Q;  1TWC H;  3S1R H;  1N9W A;  1PH6 A;  2I5H A;  5JJL A;  4QGU A;  4P71 A;  2VUM G;  4A3M H;  3A74 A;  1M90 C;  1VQN A;  3CCU A;  4JI7 L;  3G4S A;  1PH2 A;  1EYG A;  4BY7 H;  2GVB A;  2YYZ A;  4LFB L;  4WJ3 M;  1VQ6 A;  3KDF B;  5IP7 G;  2OTJ A;  1N36 Q;  1VQE A;  3I4N G;  1I50 H;  4HJ7 A;  4BY1 G;  2F4V L;  1OXX K;  4DUZ Q;  4HIK A;  4IOA A;  1YI2 A;  3RLN A;  2Q2T A;  4BA2 I;  1BBW A;  3FHW A;  2BA0 A;  2RHS B;  2Y0S E;  3I2Z A;  4ALP A;  1E22 A;  3KOJ A;  4LF8 Q;  3PO3 H;  1JT8 A;  2AMC B;  1A63 A;  5GQO A;  4KI0 A;  1PFS A;  5IT9 c;  4DV2 Q;  4YY3 Q;  4YWK A;  4B3R Q;  4JBK A;  2PI2 A;  4IPC A;  2UXC L;  5EAY A;  1AE3 A;  2IX0 A;  4DV0 L;  1XMO Q;  1SR3 A;  1Q7Y C;  1FGU A;  4PMW A;  1QVG A;  4POG A;  3A0J A;  1UE5 A;  3JAM c;  1E3P A;  4NB3 A;  5H1S E;  1T9H A;  5E7N A;  3D0F A;  2IHE A;  4EX5 A;  2UUC Q;  2R92 G;  1TWA H;  3NEM A;  2JEA I;  2UUA L;  1EWI A;  3HOY G;  3CCJ A;  3M7N A;  1G6P A;  2B63 G;  3PIP A;  2VQE Q;  2OTL A;  1OTC A;  4JI6 Q;  1VS0 A;  1X9N A;  3GTM H;  2NVX H;  1I94 L;  3F2C A;  4JI6 L;  2NVT H;  2BH8 A;  3I56 A;  3H0G G;  4A3L H;  2NVY H;  3T1Y Q;  1GKH A;  4A3K G;  1O7I A;  3F2B A;  1JE5 A;  2EQS A;  3SGI A;  4X66 L;  3HFZ B;  1WI5 A;  3G71 A;  4A3K H;  4JI4 Q;  4YHH L;  3I55 A;  4JOI A;  3KJO A;  2HHH L;  2KBN A;  2N8N A;  1VQJ A;  3TRE A;  2UXC Q;  4YHH Q;  2YU9 H;  4DV0 Q;  1XMO L;  1YHB A;  1EOV A;  4JI3 Q;  2MQH A;  2I5L X;  3HOW H;  2L15 A;  4LUZ A;  2AHO B;  1FL0 A;  4JYA Q;  2GVA A;  2NN6 G;  4GLV B;  4BBS G;  1XNQ L;  4XTC S;  5GAG C;  1BBU A;  1YVC A;  2K50 A;  1PH9 A;  4HID A;  2D0O A;  2I5M X;  2ZTC A;  1K83 H;  1TWH H;  3J81 i;  1QZH A;  1UE1 A;  1XPO A;  1KRT A;  4JV5 L;  3KYH C;  3J7A 5;  4A3E G;  4DV5 Q;  2OCE A;  2BA1 A;  1PH5 A;  3JC6 6;  2KCM A;  1X3G A;  4GS3 A;  3M4O H;  1KQS A;  3W1B A;  4DR1 L;  3HKS A;  3T1Y L;  3UE0 A;  2I0Q A;  2R7Z G;  1IBL Q;  4B3T Q;  2QEX A;  1Q86 C;  1V1Q A;  4AQY L;  2IY5 B;  2XTI A;  4DV1 Q;  3GO5 A;  2R7D A;  1GD7 A;  3M4Q A;  1GM5 A;  1YJN A;  2B63 H;  4RMF A;  1S3O A;  2FXQ A;  4P72 A;  2NZO A;  2ZM6 L;  2V1C C;  1UE7 A;  1L1O C;  3OYY A;  4RG1 A;  3J80 c;  2UU9 L;  1K9M C;  3PIO A;  1FJG L;  4HIM A;  1VQG A;  1PVO A;  2LXJ A;  1CUK A;  3RLO A;  1JB7 A;  1VQ4 A;  4JBW A;  1VQ5 A;  3AFQ A;  4GKK L;  4JI1 L;  4HIO A;  3HOU G;  2JEB I;  5ELN A;  4A3B H;  2ZJP A;  1E7Z A;  4TVA B;  2UXD Q;  3RLF A;  5HY6 A;  4C3J H;  4PZ7 A;  1VQI A;  2F52 A;  3KF8 B;  4R1J A;  4A93 G;  4AIM A;  4OXP A;  3TS2 A;  3CPF A;  3KLW A;  3EIV A;  4JI5 Q;  4OO1 I;  4QY7 A;  1SN8 A;  1AE2 A;  1NY4 A;  4LW1 A;  4DR1 Q;  1D7Q A;  4BY7 G;  2Q2U A;  4DV4 Q;  4K0K Q;  3LGJ A;  4DV7 Q;  1Y14 B;  1E1T A;  2JJQ A;  3K81 C;  1FVI A;  3CF5 A;  1XJV A;  4GLX A;  4X64 L;  2VUM H;  2E5L L;  1VQ8 A;  4A3C G;  3STB C;  1X55 A;  3HOX H;  2CWP A;  2CFM A;  4R4T A;  1Y1V G;  1YIJ A;  3CC4 A;  1KXL A;  4O2D A;  4DR5 L;  4IPG A;  1VQ9 A;  1PA6 A;  4OO1 G;  4UP7 A;  2D62 A;  4DR7 Q;  1HNX L;  4JYA L;  3PO2 H;  1YEZ A;  4A3C H;  1A8V A;  5C0X G;  3HOW G;  2KHJ A;  1I6H H;  5JJI A;  1EFW A;  3FKI G;  3OW2 A;  3EN2 A;  3S17 H;  2F4V Q;  4JI1 Q;  2WB1 G;  2E2J H;  5M5W H;  4DV6 L;  2WAQ E;  5FJ8 H;  3M85 A;  1RL2 A;  3GTO H;  1XNR Q;  4LF8 L;  4R4C A;  4GNX A;  4DV3 Q;  4HJ9 A;  3UDG A;  1N33 Q;  3S1M H;  2JA9 A;  4JOI C;  4A3I G;  1IBK Q;  1C7Y A;  1MKH A;  4OWX B;  4LNQ A;  3K0X A;  2ATW A;  3JAM i;  1C0A A;  1V43 A;  3F1Z A;  4DV3 L;  4LF7 Q;  1YNX A;  4X62 Q;  3CCR A;  1Q46 A;  2WB1 E;  3D31 A;  3IRB A;  3TRZ A;  1HNW Q;  3I4M H;  2CKZ B;  1CKN B;  3J7Z C;  4X64 Q;  2A19 A;  4X62 L;  2Q2I A;  3RN2 A;  5M3F H;  3GTG H;  1HJP A;  1Q1B A;  2UUA Q;  3S1N H;  1QUQ B;  4LF4 Q;  3CCM A;  5JEA G;  3AEV A;  2MFI A;  3HOZ H;  1VQH A;  4LFC L;  3PF4 A;  4A3J H;  4DR7 L;  2ASB A;  3ZJY C;  4KHZ A;  1EUJ A;  2Y0S G;  5M5X H;  1PHJ A;  3FP9 A;  2VL6 A;  4LF9 L;  2K52 A;  5M3M G;  5C3E H;  4GNX C;  1EQQ A;  4JBM A;  1N34 L;  1LTL A;  4O0A A;  5FLM H;  4BA1 I;  3TQY A;  2LSS A;  1XPU A;  4P73 A;  3CME A;  1W2B A;  1SRO A;  4LF5 Q;  2ZTE A;  1P8L A;  1SMX A;  3E0E A;  2JK8 A;  2NN6 I;  2IHF A;  1IXR A;  2XGT A;  3I7F A;  4FDB A;  4C3I H;  1QVC A;  4GN3 B;  1L1O B;  1OXS C;  3EBE A;  1BVS A;  1R9T H;  4LF5 L;  4UP9 A;  1L0W A;  1X65 A;  4TQU S;  4A3F G;  2BH2 A;  3PUZ A;  3J81 c;  5C44 G;  5FLM G;  4MNO A;  1Q12 A;  4JI0 Q;  2DGY A;  1SRU A;  3Q8D A;  5M3M H;  2VQF Q;  4DR6 L;  4DR4 Q;  4R4Q A;  3B6Y A;  5FLX c;  3CPW A;  3HOU H;  4A3B G;  2AWO A;  2MO0 A;  4OX9 L;  2Z0S A;  3A5U A;  4JI0 L;  3PGZ A;  1WCM H;  2K75 A;  4MTN A;  3HOZ G;  1Z47 A;  3CCQ A;  4DK3 C;  4BBR G;  3RN5 A;  1LM0 A;  4A3G G;  4IFD I;  4Y7N H;  2YTY A;  2R93 G;  1K8A C;  1SE8 A;  1WYD A;  3AQQ A;  1K73 C;  2JA7 G;  1XMQ Q;  2VY3 A;  5JEA J;  5LMN W;  2CQO A;  4PG3 A;  1XMQ L;  3HOV H;  4A75 A;  4Y52 H;  2UXB Q;  4JI4 L;  5LMU L;  1KHI A;  1B7Y B;  4GNX B;  1KD1 C;  1VQK A;  5DLQ E;  2PMZ E;  1VQ7 A;  1QVF A;  1HZB A;  1Q1E A;  4JG2 A;  1E1O A;  1U0L A;  4IFD G;  1E24 A;  2KHI A;  4NPS A;  3KF6 A;  4L5S A;  4DAY B;  3OTO Q;  1NMF A;  1YBY A;  1Y1W H;  3ULJ A;  1PH4 A;  1ASZ A;  4JC0 A;  5IWA L;  1UE6 A;  3ULP A;  1SFO H;  1YJW A;  4DKA C;  1PH3 A;  3HOY H;  3PUW A;  2HHH Q;  1KC8 C;  4GKJ L;  1JJC B;  1TWF H;  2R92 H;  2E5L Q;  4YCU A;  3AYH B;  1OXU A;  1WFQ A;  1YIT A;  1NBW A;  3CQZ H;  5IYD H;  4POF A;  3RZD H;  2RF4 A;  3ULL A;  2ID0 A;  1U5K A;  1CSQ A;  4KLK A;  1CKM A;  1HNZ Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...