4A3IH

Rna polymerase ii binary complex with dna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
145
structure length
133
Chain Sequence
b'SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 20
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3iH00
3EBEA 4HJ7A 1UE6A 4A3CG 4GKKQ 1PH1A 4AH6A 2OTLA 4HIDA 1AE2A 1JT8A 1K0RA 4JI3Q 4BY1G 5IYBH 5AJ3Q 3PF4A 4OWWB 3G4SA 3CCRA 4JI5Q 4DR7L 2Q2HA 1C7YA 1PFSA 4A76A 1Q1EA 2PMZE 5DLQE 4AQYL 4A3KG 1XPRA 3I4MH 3CPFA 4YWLA 4JI4Q 4DV6Q 2Z0SA 3STBC 2A1AA 3K80C 3HOYG 1WCMH 3RR5A 1N33Q 1NBWA 3KLWA 3GO5A 1Y1VH 4LF9Q 1XNRL 2B63G 3HOWG 2VQFQ 3NENA 2HT1A 4BXXG 4LF6Q 1HZAA 2FXQA 3BZCA 4JI6L 2E8GA 1LTLA 4P71A 3PSIA 5C4XG 3AFPA 2NZHA 1L2FA 3UE0A 3F2CA 4DV2Q 1OTCA 4DV3L 3S1QH 1GD7A 2D0OA 5ELOA 1D7QA 4PMWA 3CC7A 3H3VH 2ZJQA 4XTCS 2HIVA 5C44H 3KDFB 3S1RH 4HJAA 1I50H 4ME3A 4X65L 4LWCA 5H1SE 1HR0L 2YV5A 2UUBL 1HZ9A 3U4VA 2BA0A 1K73C 1E24A 4AQYQ 3JAMc 1JJ2A 2N8NA 3J80c 4H02A 3RLNA 3UDGA 1TWHH 4OXPA 1BBWA 1JJCB 1K8GA 1VCIA 4OWTB 4OX9Q 4OO1I 1T9HA 1GO3E 1K8AC 1YZ6A 4GOPC 1Q86C 4DR4L 4X6AH 4JI6Q 1VQFA 3CCQA 4A3MH 3HOVH 3B6YA 4P74A 1L1OA 4C2MH 3AQQA 3ICEA 4DUZQ 4HIKA 1SR3A 1A8VA 1BVSA 1LYLA 2ASBA 4A3BH 1AE3A 1E7ZA 1HR0Q 4X65Q 3PUYA 2UUBQ 4UP7A 4GKJQ 3K81C 4LW1A 3CCEA 3ULPA 4NB3A 3T1YL 3G71A 2LSSA 1X55A 3STBD 4YWKA 1QVFA 2YTVA 2E2IH 3PUZA 3EN2A 1VQCA 2R7FA 1SROA 5FLXc 1X9NA 1IYJB 1MIUA 4BY7H 3I7FA 4JI2Q 1X3GA 5LMUL 2Z6KC 5IWAQ 2F4VL 4DR4Q 1VQ7A 4OONA 3CW2C 1JE5A 2QEXA 4HJ8A 1S72A 1C9OA 1HZBA 1BBUA 2EQSA 1HH2P 2AWNA 2IT1A 5M3MG 1LM0A 3NEMA 4B3TL 3S16H 1G6PA 5FLMH 2K50A 3GTOH 5GAGC 2QGQA 3HFZB 1PYBA 1YITA 1B70B 3T1YQ 1ASZA 5C3EH 4LF4L 1K9MC 2ZM6L 4DR1Q 4IFDJ 4GLAC 2K52A 1WI5A 3PUXA 2E2JH 1YEZA 2I5HA 2VY3A 1E1TA 4DV0L 4B3RQ 5IY0A 5LMUQ 2IHFA 3CCVA 4JBKA 2A8VA 4A3DG 1PH3A 2ZTEA 2N78A 1MJEA 2ATWA 4GLVB 3PGZA 4L5QA 3ULJA 5IE8A 1RIPA 4HJ9A 2R93H 1EOVA 1CSQA 1K83H 4QIWE 3W5OA 3KDFA 4UPAA 3ULLA 5IP7G 3M4QA 4C3IH 4A3JH 4B3TQ 4APVA 4R4OA 4OWXB 5M3FG 3SGIA 1UE5A 3D0FA 1YHAA 4X66L 5LMNQ 4NXML 3HOUH 1V43A 2IX1A 2CFMA 2VS1A 4PZ7A 3J81i 5IYDH 1Q1BA 3A5ZB 3ZJYC 3CC4A 4LF4Q 1PH8A 1CUKA 4DV7L 4DR2L 3HKZG 3H0GH 3Q8DA 2CWPA 4C3HH 2OWOA 5IP9G 3F2BA 1PYSB 5IYCG 2K5HA 4JC0A 4GNXB 4ALPA 4DV0Q 2R92H 2VQEQ 4A3GG 1RL2A 3CP0A 3MEFA 1U0LA 4GLXA 4IPHA 1SN8A 2E5LL 2ES2A 2QA4A 1YBYA 1SFOH 1QVGA 1PH7A 4BA1I 3NBHB 4MNOA 4JI0L 4B3ML 1D8LA 4LFCL 1YJWA 2LXJA 1UWVA 4A3FH 1CKMA 2K5VA 3UDFA 2MNAA 4JYAQ 1A0IA 3PUWA 1FJGL 2JEBI 3GTMH 1EQRA 3I4MG 3G48A 3I4NH 3S2HH 3FKIG 3KF6B 2NVQH 4X66Q 1Q8KA 1GVPA 1N32L 3VDYA 4QL5A 2IHEA 4IO9A 3CMAA 1EQQA 1IBMQ 1Y1VG 2B29A 2ZTDA 2N49A 4DUYL 1C0AA 4DV7Q 4DR2Q 3I56A 4IJHA 1M90C 1YIJA 2WB1E 4R4QA 3M4OH 1CKNA 1EIFA 1MKHA 2AHOB 5K36G 4JBWA 1VQ5A 1WJJA 4A3EH 1IBKQ 3M4PA 1UE7A 4NXNL 1PH6A 2R7ZH 4DAMA 3PUVA 3UDXA 2JA5G 3PO2H 4IFDI 3RN5A 4EQ5A 4JI0Q 1B7YB 3J81j 4IJLA 5C0XG 4B3MQ 4LFCQ 4IPCA 2CKZB 4EX5A 4KI0A 2RF4A 2Q2UA 4BA2I 4A3CH 2UXDL 4QY7A 5HY6A 4DK6C 3S2DH 5EAYA 1HNZL 4DR7Q 1N32Q 3U50C 1IBLL 5GAHC 1J6QA 3PCOB 2N3SA 4YHHL 3HKZE 4GN3B 4P72A 4TQUS 1HJPA 2K4KA 2LXKA 4PZ8A 4DUYQ 1XPOA 2JJQA 2K75A 4A3KH 3PO3H 3GTLH 1X54A 3I4OA 4KLKA 3BJUA 4BBSH 4A3MG 1J5EL 3HOVG 1SE8A 1NTGA 1N8RC 3T1HL 1XNRQ 3KF8B 1Q46A 1Z9FA 2PQAB 3AYHB 5M5WH 2NN6G 1KIXA 3UE1A 1FL0A 1S40A 4NXNQ 4DV4L 4A3BG 3L2PA 1OXSC 4DV1L 4R4CA 4DV3Q 4YCWA 2K5NA 2OQ0A 3NELA 4LF8L 2JE6I 1X3EA 2YTYA 4A93H 2JA7H 3K0XA 5JEAG 1KHIA 2UXDQ 1XJVA 1PH5A 1HNZQ 4YCUA 1N34L 1IBLQ 4L5RC 1I5FA 4GNXA 4BY7G 3U4ZA 2DUDA 3HKSA 3OYYA 2UXBL 3RZDH 1J5EQ 3ER0A 4GS3A 3T1HQ 3CPWA 2MO0A 2NVTH 3S15H 2EXDA 2F3IA 3RZOH 1CKNB 3A5UA 4DV1Q 1TXYA 3KF6A 4A3LG 2OTJA 4Y52H 2AWOA 3CQZH 3BU2A 1Q12A 3RLFA 2HIXA 4LUVA 1Z47A 2KCTA 2A19A 1FVIA 3EIVA 1A62A 1N34Q 3A74A 1V9PA 2GN5A 3D31A 4AIMA 4GOPB 4DNIA 4KHPL 1QUQB 1VQHA 1L1OC 4C3JH 1FGUA 3TREA 3LGJA 5M5XH 1VQGA 3S1MH 2ALYB 3I55A 1NMGA 4FDBA 3HOXH 2R93G 3CCSA 1EIYB 2F4VQ 1G51A 1S3OA 4BBRH 2WB1G 1NY4A 5FJ8G 1YHQA 4B3SL 3HOZH 3TRZA 1SMXA 4POFA 5GADC 3E9HA 3K8AA 4NPSA 2MFIA 4P75A 2ZJPA 1PH2A 2WAQG 5LMNW 1YNXA 1VQBA 4PG3A 2JA9A 4RG1A 3TQYA 1VQ9A 1PH9A 3HOUG 4JOIA 3J7A5 1VQKA 2UU9L 4A3IG 1W3SA 1EFWA 4QGUA 5IYDG 3H15A 4A4IA 4JI8L 3H0GG 4POGA 4J15A 2UXCL 4KHPQ 1KRSA 1GKHA 1VQIA 2VNUD 2EIFA 1M1KC 2R92G 4KHZA 2OCEA 2PQAA 4LFAL 1SLJA 4LUZA 2ZM6Q 1XMOL 4IPDA 1XMQL 3F8TA 3G6EA 2KHJA 5J3BA 1I3QH 4DV5L 4DK3C 1LUZA 4YY3L 1Q81C 2R6GA 3E9IA 2IX0A 4A3FG 2YYZA 2ZTCA 1JB7A 1EWIA 1O7IA 2AKWB 4JI1L 3W1GA 2R7DA 2KHIA 4R4IA 1L0WA 1Y1WH 2VUMH 3I4NG 1NMFA 5IYBG 4GKKL 2GVAA 1VQ8A 1I6HH 1R9TH 4DR6L 4RMFA 2AMCB 4L5TA 2UU9Q 4LF7L 2D62A 2BH2A 1OXUA 1WYDA 4XIGS 4X62Q 5C0XJ 1OXVA 1QZGA 3J81c 3ERSX 4JI8Q 4DR3L 2CCZA 4JI4L 4NXMQ 1WCMG 2JQOA 2OQKA 2JA8H 4LFAQ 4LF9L 2HQLA 1QVCA 1XMOQ 4PZ6A 2VQFL 4A3EG 1QZHA 1EUJA 3I2ZA 3PO2G 3K7AH 1PVOA 4P73A 3M7NA 4DV5Q 1UEBA 2CWAA 5IP9H 3OTOL 2VL6A 3UDIA 2JA6H 2UUAL 2I5MX 1VQMA 1OXXK 2WAQE 2E5LQ 3W1BA 4JCVE 1X65A 4L5SA 1E22A 4IOCA 4LF5L 1A63A 2XGTA 5C44G 4OO1G 4DR6Q 1Q82C 3TS0A 3GTKH 4GOPA 2ZJRA 4LF7Q 1QUQA 1FJGQ 3F1ZA 3AFQA 1B8AA 4QJFA 3FHWA 4DR3Q 1KQSA 4BY1H 3PO3G 2ID0A 1IL2A 3FKIH 4BBSG 4WJ4A 3CXCA 3JAMi 1KD1C 5JEAJ 1EYGA 3GTJH 4IOAA 4YCVA 3J80i 1IZ6A 1K3RA 1VS0A 2RHSB 1NJIC 5JJLA 4OX9L 1TWFH 2JEAI 3RLOA 3S14H 3L0OA 1VQEA 3PIOA 4JBMA 1BKBA 3KJPA 1VQPA 3HOYH 3OTOQ 2VW9A 2UUAQ 4DR5L 5E7NA 2B63H 3HOWH 3MXNB 4R1JA 4BXXH 3K7UC 1UE1A 1YI2A 4A93G 2XTIA 4R4TA 4DUZL 1WFQA 4HIOA 1IXRA 4LF5Q 4HJ5A 2NVYH 2JA7G 4O0AA 5C4XH 4X64L 1HR0W 4Y7NH 2JA5H 3M85A 2Z6KA 5GROA 3RN2A 2JK8A 3A0JA 2DGYA 2GVBA 4GKJL 3S17H 1P16A 1YJ9A 2I5LX 4QQBX 4O2DA 4YHHQ 5IT9c 1KXLA 1PHJA 4B3SQ 1U5KA 4HIMA 3CCLA 3H3VI 4DKAC 1PV4A 2F52A 1JMCA 4IPGA 1KL9A 5C0XI 3OW2A 4JI2L 2BH8A 5IWAL 2D0PA 1N36L 2HHHL 3GD7A 1VQDA 1V1QA 1PA6A 4DR5Q 3IRBA 1XTDA 5HGQA 4UP9A 1HNWL 1OXTA 5M5YH 3WWVA 4DV4Q 1I94L 5FLMG 4JV5L 4X64Q 3CCUA 4LF8Q 2UUCL 1X3FA 4AYBG 1H95A 2C35B 1KC8C 2VZAA 1VQAA 2RCNA 3CAMA 4JBJA 5ELNA 2NVXH 4UY8C 5C3EG 3DLLA 3TEHB 1VQLA 4A75A 2NN6I 3HOXG 2CQOA 2H5XA 1KRTA 1WOCA 4DR1L 1CKOA 2KCMA 3KYHC 1X56A 2IY5B 2KENA 4BBRG 3HOZG 1VQNA 3TS2A 4B3RL 3CCJA 3GTGH 2UXBQ 5C4JH 1AH9A 2HHHQ 5BR8L 1N36Q 2Y0SG 2BA1A 4LNQA 3KFUA 3CCMA 1CSPA 3E0EA 4MZ9A 3S1NH 3GTQH 1KAWA 1YHBA 4A3JG 1HNWQ 4GN4B 4LUOA 2PNHA 1I94Q 1TWGH 4GNXC 4JV5Q 1NE3A 3CD6A 2KBNA 1E3PA 2UUCQ 1DGSA 2K14A 2MO1A 3M9BA 4A3LH 4JG2A 5M3MH 5LMNL 3PIPA 5JJIA 4JI7L 1HNXL 3BZKA 3S24A 3U58A 4K0KL 2I0QA 3CMEA 1TWAH 2Q2IA 3RNUA 1TWCH 1YJNA 1VQJA 1YVCA 1MJCA 1SRUA 2WP8J 4TVAB 5GAEC 1VQ4A 2VQEL 4DAYB 5BR8Q 3PV0A 1Y1WG 3GTPH 4UP8A 4LFBL 1XPUA 2VUMG 1Q7YC 1X6OA 1VQOA 1GM5A 3F2DA 3J7ZC 1XNQL 4A3DH 5FJ8H 4X62L 2Q2TA 1G291 4AYBE 3AEVA 3L7ZC 4DPGA 4JYAL 3CF5A 2RHQB 2V1CC 2YTXA 4JI3L 1L1OB 5AJ3L 3FP9A 3CC2A 4JI5L 1PH4A 5IP7H 1E1OA 2JA8G 4IFDG 5JJKA 4JI7Q 4A3IH 1HNXQ 2E2HH 1IBML 2NZOA 2WFWA 4K0KQ 5M3FH 4DV6L 2UXCQ 1VQ6A 2PI2E 3M3YH 1JJGA 2PI2A 2Y0SE 4MTNA 1N33L 2JA6G 2B3GA 1N9WA 2YU9H 2L15A 1XMQQ 3GDEA 4LF6L 3DM3A 3JC66 3KOJA 4JOIC 1W2BA 2R7ZG 4LFBQ 3KJOA 1IBKL 1HZCA 1P8LA 5GQOA 4YY3Q 5IYCH 1Y14B 2MQHA 4DV2L 3PF5A 1XNQQ 4YWMA 4GN5A 4WJ3M 1ASYA 4A3GH 4JI1Q
chains in the Genus database with same CATH superfamily
2JA5B 1SEBD 1K0RA 1S5ED 4JI3Q 4KD4A 1PZKD 3PF4A 4JI5Q 4DR7L 3D4WA 1PFSA 2KEDA 4A3KG 1XPRA 1FNUA 3STBC 3HOYG 1H9MA 2HDMA 3RR5A 3HZXA 3GO5A 3NENA 2HT1A 4LF6Q 2FXQA 3HGBA 1IYVA 1LTLA 4P71A 1S5CD 1KNAA 3AFPA 5T1IA 3UE0A 3F2CA 3S1QH 1E2VA 2EYJA 1GD7A 4FO2A 4HMIA 5BN3A 1PYWD 3KDFB 4ME3A 5KYIA 4N8X1 4KKSA 1EOTA 2D5DA 1JJ2A 4DAYA 4DNRB 1NCVA 5CV8A 1H9JA 4OXPA 3TP7A 1BBWA 3GTGB 1VCIA 5EJWA 4OX9Q 1T9HA 4ZCKA 1DOKA 4H44C 1K8AC 4XT1B 1TT2A 4GOPC 4JI6Q 3CCQA 2B2WC 2NN6H 4ZAIA 4HIKA 1BVSA 2J7ZA 2Z4HA 1UUPA 2SNSA 2WINB 3MA2B 4DN4M 1PTOF 1AE3A 1HR0Q 4X65Q 5IGFA 2BOSA 4LW1A 3CCEA 3FMCA 4HEDA 1X55A 3STBD 5FLXc 3W3AA 5DNFA 1MIUA 3I7FA 1X3GA 3TBIB 5IWAQ 3IL8A 2O2LD 4A3DB 1HZBA 2A5HA 2EQSA 2AWNA 2IT1A 1R9TB 1F2MA 3I73A 5CBEE 5FLMH 2KECA 3NE5B 4QCLA 2L5TA 2ICIA 2PNRC 1LTID 1PYBA 3HFZB 5CBAE 1YITA 1B70B 3T1YQ 1ASZA 3M3YB 1C8CA 4NDXA 1DD2A 4B3RQ 3K7AB 1HTLD 2DNCA 5G3LD 1D1KA 5I9OA 2PZWA 4EQNA 1NR2A 1SAPA 3EFXD 2ZXPA 1RTOA 3K6OA 4C3IH 1RD9D 4OWXB 5M3FG 1EZ8A 3ND8A 3D0FA 5D14A 1HFGA 1V43A 2VS1A 1VF7A 4DU9A 3J81i 5IYDH 4KY5A 2Z1CA 1Q1BA 1PRTB 4OEMB 1PH8A 1CUKA 4DV7L 1EWCA 4DR2L 3NPPA 3H0GH 4C3HH 3F2BA 3S14B 4DV0Q 3T56B 3MEFA 4CDDC 4JPBW 1SN8A 2ES2A 2QA4A 5EGTA 1SFOH 1QVGA 1O7LA 1SJHD 4JI0L 4B3ML 1T5EA 1D8LA 4A3FH 1UWVA 3UDFA 3GTMH 3S1RB 1STEA 2DN8A 1I50B 1SNCA 3G48A 1I4QA 4F8MA 2A6HC 2F0VA 4QL5A 4ILWA 1EQQA 4OHJA 2ZTDA 1PFMA 1SSOA 2F0PA 1C0AA 5ELBA 1YIJA 3M4OH 2F03A 1GUGA 4IN3A 1CA5A 3HOVB 2NTTA 4DAVA 2RDHA 4A3EH 1IBKQ 4C2MB 2Z9HA 4EQ5A 5E4XA 4IPCA 4EX5A 1PTOH 4RAUC 2Q2UA 4BA2I 1GOZA 4KJNA 4A3CH 4QY7A 4OO1H 4DR7Q 1E2WA 1STHA 4TQUS 1IW7C 4NMZA 2JJQA 2E2IB 2CHBD 3GTLH 4KLKA 3I4OA 3KF8B 1Q46A 1KIXA 2NN6G 2EYOA 1D5XC 1FL0A 3BS1A 4DV1L 4R4CA 2K5NA 4LF8L 4DAPA 4A93H 3GTOB 2QCPX 3K0XA 5EQ0A 4LAAA 4KKUA 5KNCA 2RKSA 2A6HD 2TMPA 3D4RA 2P5ZX 4BWGB 3T1HQ 5FK9C 3WOFA 3RUZA 4X3TA 3I91A 1K83B 3RZOH 1CKNB 2WB1B 1SNQA 5KRUA 1TXYA 2OTJA 2Z4IA 1IKLA 3CQZH 1FNWA 2F0DA 3RLFA 1NSNS 1YNJC 3EIVA 2A19A 1FVIA 1QE6A 2C5CA 3HOUB 1A62A 5EKKA 4ZQ3A 1F9RA 1MGSA 1GUNA 1L1OC 1IW7D 4C3JH 1BCPF 5DM63 1VQGA 4FF1A 2R92B 3I55A 2F0WA 1D2BA 1B9NA 1SNOA 1G51A 5FJ8G 1HQRD 3HOZH 3R2TA 4L6TB 5DEHA 3I90A 4POFA 3E9HA 4NPSA 2MFIA 4KJOA 1PH2A 3NTHA 4PG3A 3TQYA 1JOOA 1VQ9A 4JOIA 4RCNA 5A2QL 4QGUA 5IYDG 1QCBD 2PZTA 4A4IA 3H15A 3H0GG 5D3DA 2EY1A 4C3HG 4MIUA 1F9PA 3DWAA 4RA8A 2VNUD 3R93A 2OCEA 1SLJA 3C1EA 1Z6HA 4MHEA 5J3BA 2R6GA 4A3FG 2R7ZB 1VQNA 1AH9A 1BXTA 4JI1L 2KHIA 4R4IA 2VUMH 5IYBG 1R9TH 2HDLA 4RMFA 1LACA 3PIP3 1OXUA 1WYDA 2XWBB 4N9TA 4DXGA 1YNJD 5EPKA 3J81c 4M1UB 2CCZA 4JI4L 2JQOA 2OQKA 3DEOA 5C3XA 4IFDH 1PTOD 2NB0A 3T4AC 3PO3B 2M2LA 2HQLA 1QVCA 2B2TC 4PZ6A 4A3EG 3K7AH 3F2UA 5M5WB 1ONLA 2I5MX 3DMUA 1VQMA 1OXXK 4JCVE 1PDQA 4LF5L 3NTKA 2EXZA 3MZ5A 4OO1G 1Q82C 1EY5A 4LF7Q 1QUQA 2N55A 3OOCA 3F1ZA 1HFNA 4QJFA 2MUYA 3FHWA 4BY1H 2ID0A 3FKIH 1F9QA 1PZID 1EY4A 1J9OA 3J80i 1IZ6A 1EWHA 4I65A 3S14H 1QB5D 3PIOA 5E7NA 4E6IA 4BXXH 5K36H 1YI2A 4A93G 2XTIA 4R4TA 1IXRA 2NVYH 1HR0W 5C4XH 4R9WA 2L4NA 2CW0D 2F0NA 1DJRD 4C1NK 3S17H 1W6KA 3J7AV 1DZ1A 4QQBX 4DK0A 5LL6X 2HUGA 1B44D 1PV4A 3TSSA 1A2UA 1LTRD 3W2DA 3OW2A 4JI2L 2D0PA 1BR9A 2F0QA 2KOLA 3K5LA 4DR5Q 3IRBA 1HNWL 1OXTA 2QILA 2L9HA 4X64Q 1SJED 4LF8Q 2E2DC 2C35B 2OXPA 2AUKA 1XYIA 5ELNA 1VQAA 3CAMA 4C3JG 3U9OA 5C3EG 1HRJA 3QWNA 2NN6I 2CQOA 1U4PA 4DR1L 4CKEA 2AQ2B 5K5PA 3HOZG 1N36Q 2Y0SG 3NQIA 3S1NH 1TU2B 1MBYA 1PRTC 4A3JG 4GN4B 1I6HB 2PNHA 4JV5Q 4FXKC 5EKIA 2KBNA 4QF4A 2QEJC 1E3PA 2UUCQ 1BDOA 4RGOS 4FNFA 2LFNA 3U58A 4K0KL 2JA8B 1K8MA 2I0QA 1TWAH 2Q2IA 2IWHA 3RNUA 1YJNA 1VQJA 2K1BA 4TVAB 2EYPA 3FPUB 3MXNA 2VQEL 3PV0A 2CVRA 2VUMG 3BYYB 1ILQA 1X6OA 1GM5A 1FYCA 4XT3B 5C5LA 2B2VC 1PXUA 1G291 1G2SA 2PQEA 3GTKB 4JI3L 4JI5L 2L0CA 2OT2A 4IFDG 2NTSA 4JI7Q 1HNXQ 2F4IA 2B2YC 4RGTA 2O5IC 1TS4A 1JJGA 3MWYW 1I6VC 4B3MQ 4LF6L 4LFBQ 2RSOA 2D9UA 3KJOA 1HZCA 5GQOA 4Q5VA 3PF5A 1PRTD 5D3IB 4GN5A 3QO2A 2BH2A 4A3GH 4JI1Q 4X62Q 1LTTD 3I8ZA 4TRDA 3OPOA 1HUNA 3KLSA 4BY1G 4EQPA 4OWWB 5IGDA 2Q2HA 4PV1C 1HXYD 4A76A 1Q1EA 1EY9A 3I4MH 4JI4Q 4UHVA 1E2ZA 2B2UC 3K80C 4F88A 3BG3A 4KMUC 1N33Q 3URYA 1EYDA 1XNRL 4BXXG 5IGGA 3BZCA 1GHJA 4JI6L 2VXWA 3AMUA 5C4XG 2X69A 1OTCA 5I6WA 3QG1A 2H1EA 3KK7A 1EY6A 5ELOA 3CC7A 5EPLA 4XTCS 3SVMA 5FO7B 1HR0L 4X65L 4LWCA 2YV5A 2BA0A 4AQYQ 1U4RA 2Q8TA 4H02A 3RLNA 3J80c 1TWHH 1RHPA 4OO1I 2V4DA 4K8IA 4X6AH 3GTQB 5IT9L 4A3MH 1DONA 1S5FD 2XIWA 3T13A 4FF3A 2RCFA 1TWGB 2E76C 1A8VA 1STYA 4A3BH 1CT1D 1GUTA 5M3MB 1E7ZA 1B3AA 4HR7B 2A68C 3K81C 4X3SA 3T1YL 1K0SA 2XRSD 2LSSA 4OELB 4RGNA 2YTVA 2G9HD 3PUZA 1VQCA 2R7FA 3K5NA 1X9NA 4JI2Q 2F4VL 2Z6KC 3R8BA 1LT3D 1JOQA 1C9OA 3FDTA 1LM0A 3NEMA 3Q22A 1G6PA 2FHTA 1ML0D 1CHPD 2E2HB 2EY2A 3TP5A 1U9RA 3Q23A 4DR1Q 4IFDJ 4GLAC 2K52A 1A2TA 3PUXA 5IT9E 2I5HA 1E1TA 1GXDC 4DV0L 1WTXA 3HKZB 5IY0A 4K5VA 5LMUQ 2A8VA 1B4OA 2FINB 1PH3A 2K28A 1JCKB 4N8FA 1MJEA 3PGZA 4HJ9A 2R93H 1RIPA 3FVQA 1CSQA 4UPAA 4APVA 3I70A 4J1MA 1EFID 4NXML 4IURA 1MI2A 2PYKA 2CFMA 1TQOA 2A68D 4G4KA 1GJXA 3CC4A 4LF4Q 1LTGD 1Y1VB 5IP9G 1TWFB 4GNXB 1X32A 2K03A 2K5HA 4JC0A 1GUOA 2VQEQ 4A3GG 1RL2A 4WRDA 1CM9A 1YBYA 1EEFD 3SK4A 2HQEA 2RSNA 1E0BA 2C9OA 2K5VA 4FP5D 2MNAA 2J4XA 3LX0A 2L55A 4FF2A 5JPNC 3I4MG 5KYLA 4HCSA 4X66Q 5CV9A 3FPPA 2DY7A 3MXPA 1CKNA 2RDFA 1MKHA 5CV6A 1ICWA 1VQ5A 2SDFA 1WJJA 3PO2H 4IFDI 3S9WA 3RN5A 2F3VA 3C46A 1STGA 4RH6A 3OMCA 4LFCQ 3DUZA 1QNUA 2JN4A 1PFNA 2A6EC 3K5OA 4HMJA 1K3BC 4K14A 3U50C 1N32Q 5GAHC 1J6QA 2N3SA 3UI2A 3GV6A 3HKZE 4L8JA 1HJPA 4PZ8A 5FO8B 3MHBA 4BBSH 4BY7B 4A3MG 4X3UA 1SE8A 3E3XA 1N8RC 3T1HL 1XNRQ 2PQAB 3AYHB 3A7AB 2MGSA 3UE1A 3CRKC 4DV4L 4A3BG 1EIGA 1BUVT 1CQFA 1H9KA 4KV6A 2JA7H 1S5DD 2FMMA 1KHIA 1XJVA 1TS3A 1IBLQ 4L5RC 3TDQA 4M8AA 3C1FA 3NP8A 4QB4A 5C3EB 2TSSA 2I46A 1TWCB 1V8QA 2ENBA 3HKSA 1JC7A 2UXBL 3RZDH 1EL0A 1J5EQ 4ME5A 1BO0A 2IJ0A 4FXGC 3NBHA 4NW2A 2NVTH 4CJ0B 2Z6BA 2F3IA 3RMHA 1SE2A 5FLXL 3KF6A 4A3LG 1FR3A 2EVBA 4G7HC 2HIXA 4LUVA 1QILA 2F0MA 1SE4A 2A6ED 2RDGA 1LV9A 4BS9A 4ODGA 4DNIA 3BDCA 3TREA 5F2DA 3S1MH 2ALYB 2R93G 3D3RA 3AU7A 1O78A 1FNVA 2F4VQ 3SHLA 1NY4A 1YHQA 3D6WA 5I6YA 1M8AA 2EYLA 2ZJPA 4FF4A 2WAQG 1KLGD 5E4WC 5EPJA 1WD1A 1PH9A 3J7A5 1VQKA 4A3IG 4MTKA 1EFWA 3I4NB 2SEBD 3DXJC 4IALA 4CBVA 2XVSA 1BF4A 3H09A 3H94A 1JWUD 4J15A 2UXCL 2EIFA 4KHZA 1A15A 1WCMB 4LUZA 3F8TA 1I3QH 1EU4A 5FLXE 1Q81C 3E9IA 2IX0A 1JB7A 1EWIA 1IL8A 1O7IA 3W1GA 3NUCA 1Y1WH 1L0WA 1EU3A 2GVAA 1XWEA 2UU9Q 4LF7L 5C44B 3S2DB 1GHKA 2EY6A 4NXMQ 1K8OA 2OF1A 4LFAQ 4LF9L 2F0GA 3I3CA 3SE0A 1EUJA 3PO2G 4ZUIA 3OMGA 4DV5Q 1UEBA 1LT4D 1G91A 2JA6H 5AFWA 5ELFA 5LHY1 1E22A 4IOCA 1RF2D 1TY2A 1LABA 3VR5A 1WTVA 1XTCD 2G9DA 5CC4A 4GOPA 2ZJRA 1HCZA 3AFQA 3PMFA 1I4XA 2B2WA 2NYZD 1BBXC 1M4VA 4DR3Q 1KQSA 4BBSG 3K0YA 1IL2A 1JORA 3ONAB 3JAMi 1KD1C 3GTJH 1RKNA 1K3RA 1G6ZA 1TWFH 3RLOA 4S3SA 3SK8A 3R2IA 1VQPA 3MFGA 2VW9A 1R4QB 4DR5L 1WTWA 1LT5D 2B63H 3HOWH 2MPMA 3QOLA 1UE1A 1B53A 4B9XA 4DUZL 2JA7G 3MXGA 4X64L 2JA5H 3I4LA 4K2KA 4X3KA 2DY8A 5C0XH 3RN2A 4ZRZA 2K32A 4GKJL 4AYBB 5A35A 1LLRD 1KXLA 1O7ZA 3GQBA 1U5KA 1Y8NB 5M5XB 1V1PB 1I4RA 1JMCA 4IPGA 3HOXB 1PRTF 3GV3A 1N36L 4BBRB 2RVLA 1PLFA 1XTDA 2E75C 4UP9A 2PZUA 4DV4Q 2K01A 3DM1A 5FLMG 4FYDA 4JV5L 3CCUA 3P1HA 1L0YB 2UUCL 2EYFA 1B50A 1H95A 1KC8C 4UY8C 3DLLA 3TEHB 2BE5C 2QW7A 1KRTA 4V0BA 5IGEA 1H9SA 1R4PB 5FO9B 2KENA 2IY5B 1NR4A 3TS2A 2UXBQ 3GTGH 1Y8PB 2HHHQ 2WKCA 2E74C 1CSPA 3E0EA 1KAWA 4WJWA 4C3IG 4H7BA 5C3WA 4JVZA 1I94Q 1HHVA 1SYDA 4GNXC 1EYAA 1NE3A 3OHXC 3CD6A 1DOLA 3VA5A 2XNAC 3MXUA 3PIPA 2NVQB 1SYEA 4JI7L 1HNXL 3H3VC 3CMEA 5DM73 1TWCH 5J39A 1QJOA 1VQ4A 2KVMA 4DAYB 5BR8Q 4ID6A 1Y1WG 4LFBL 5I9PA 1Q7YC 3F2DA 3QB3A 2D2CC 4A3DH 4X62L 3A55A 4AYBE 3AEVA 1YNNC 4DPGA 2FFKB 4JYAL 2MHVA 2RHQB 2YTXA 3N52A 1KNEA 1MSGA 3CC2A 5IP7H 5JJKA 1Z7TA 3OWFA 2NZOA 2WFWA 4G7OC 3ZYYX 2BE5D 2UXCQ 5HURA 3K58A 1WTPA 3M3YH 4A3KB 2PI2A 4MTNA 1N33L 2JA6G 2PO4A 3TMEA 1N9WA 3HOYB 3J81L 1W2BA 3KOJA 3MFYA 4RHRA 4WFN3 1ET6A 5IYCH 1Y14B 1IKMA 3H91A 3V96A 5KNBA 4WJ3M 1B2TA 1QOHA 4HJ7A 1UE6A 4A3CG 2XRQD 1PH1A 4AH6A 1JT8A 4HIDA 1AE2A 5AJ3Q 3G4SA 1C7YA 1STAA 1EY7A 1HPCA 5DLQE 4AQYL 3Q6SA 1EYCA 3CPFA 1CK1A 4YWLA 2Z0SA 2A1AA 1VMPA 2LMCB 1B3QA 1WCMH 1NBWA 3KLWA 4LF9Q 2B63G 3HOWG 3L3OC 3X3MA 3X3NA 1TVXA 3ERQA 3S15B 4ZUJA 3VYTA 1STBA 3PSIA 5LL6S 4DV2Q 5ELEA 5E1FA 1EY8A 3P7JA 3V2TA 3HS0C 2Q8IB 4PMWA 2ZJQA 4K2LA 3A8JE 2HIVA 1QG7A 5C44H 3S1RH 2QKIC 1D5ZC 1I50H 5CYUA 1K73C 1E24A 3C3LA 3JAMc 2N8NA 3UDGA 4RFBA 5CR3A 3ND9A 3J81E 1SBBB 1ZEQX 3EJIA 3NHHA 1JJCB 1K8GA 5C4JB 4OWTB 2I07B 1YZ6A 1QWYA 1Q86C 1VQFA 3HOVH 1L1OA 4C2MH 2HCCA 3TN2A 1TIID 3ICEA 4DUZQ 1F2ZA 3A7LA 2ASBA 2A73B 1A3VA 3OW7A 5I4DA 2F0JA 4U673 2UUBQ 5JJZA 4KHVA 4UP7A 2F0EA 4GKJQ 1I4HA 1SNMA 2BDOA 5JEAH 1IYUA 2E2IH 3PIO3 3EN2A 1ESRA 1SROA 1X3QA 1IYJB 3GTPB 5LMUL 4DR4Q 1VQ7A 3AB9A 3CW2C 4HJ8A 3ITPA 1HH2P 5CMDA 4ZYSA 1CA6A 1UNSA 1TY0A 1FD7D 3GTOH 5GAGC 4A3IB 1WTRA 2VB2X 3LWEA 5M3FB 1Q8IA 3VR4A 4CJ2C 4CDEC 2L11A 4LF4L 1SYFA 2GA4B 2K5DA 2YU9B 1YEZA 2IHFA 3CCVA 4JBKA 4A3DG 2MJ8A 2N78A 1V1OA 4CKCA 2ATWA 3LNNA 5IE8A 1K83H 3KDFA 2B2TA 5J22A 5T1GA 5JVG3 5IP7G 3M4QA 4B3TQ 5KNDA 1NAPA 3CU7A 2L1BA 3KUPA 5CORA 2H4OA 4DF7A 4X66L 3HOUH 4KY7A 4PZ7A 3EQLC 4HTHA 3A5ZB 3ZJYC 2CQAA 3Q24A 3Q8DA 2CWPA 5IYCG 2R92H 3J7AF 1S5BD 4FVMA 2DNEA 3SEBA 3CP0A 3T16A 4GLXA 1U0LA 4IPHA 4CJ1B 1PH7A 4BA1I 3S1QB 2B8FA 2SOBA 1II3A 4LFCL 2PPBC 2LXJA 1CKMA 1G8ZD 2IX3A 1A0IA 3NTIA 5ISRA 1FJGL 4JYAQ 1EQRA 2CH4W 3FKIG 2NVQH 1Q8KA 1DOMA 5CV4A 4B08A 1N32L 2NZ1D 2IHEA 3CMAA 3WOEA 2N49A 1UEAB 3TZDA 3VR6A 4LJZC 4R4QA 1EIFA 3CHBD 1LTBD 4EQOA 2AHOB 5K36G 3K5MA 4XXEA 1UE7A 2R7ZH 4DAMA 1HTPA 3UDXA 2OEOA 5M5YB 4JK1C 1B7YB 4IJLA 2VB3X 3MAQA 4XDXA 5KEEA 4IQZA 3KBXA 5HY6A 4LMQD 2NVXB 4DA2A 1IBLL 3PCOB 4YHHL 2K4KA 3DWPA 4DUYQ 1XPOA 4OIJA 2K75A 4A3KH 4ZKCB 2F3WA 3PO3H 1X54A 1WVLA 4XQJA 1J5EL 3HOVG 1Z9FA 5M5WH 2F0KA 3J80L 1S40A 4NXNQ 3VYRA 1OXSC 1S4ZA 2OQ0A 3NELA 2JE6I 2ICEC 2UXDQ 5JEAG 4RHSA 1HNZQ 2B8GA 3OIQA 2B39A 4C1NI 5JOBA 5CV5A 2XSCA 3OYYA 1B9MA 3GP7A 3ER0A 4H13C 3S15H 1VDZA 2F0UA 5BN5A 5IIFA 4UAIA 3A5UA 3E6ZX 2K6AA 4R8NA 4N9PA 1Z47A 1IHZA 2Q8RE 2KCTA 2M9VA 4V190 4XQNA 1N34Q 3A74A 3FEWX 1V9PA 2B2VA 2GN5A 3D31A 1QUQB 5EKLA 5JPMC 1VQHA 3H0GB 1MSHA 4C3HB 1C48A 3NXWA 3LGJA 1SE3A 3J80E 1NMGA 4FDBA 5IODA 3BVZA 4XQQA 4K8JA 4O42A 2B2YA 1S3OA 2WB1G 1SFOB 3TRZA 1SMXA 2JP1A 5GADC 4P75A 5TSSA 1ENAA 4A3FB 5LMNW 1YNXA 1VQBA 4F7XA 4RG1A 3GTMB 3HOUG 2UU9L 5FOBB 5C6AA 3NWSA 4RKLA 1KRSA 1GKHA 3QIAA 1AN8A 2IPKD 3KF8A 5I2XA 1M1KC 2R92G 4IUUA 4LFAL 1RJTA 3M4OB 4IPDA 1XMQL 2K05A 2KHJA 4DV5L 4DK3C 4A3EB 1J8IA 4B3SQ 2B2UA 2YYZA 2AKWB 4UDUC 2R7DA 4GKKL 1I6HH 1PTOB 1VQ8A 4XYOA 2AMCB 4L5TA 1AEXA 1AZPA 1QZGA 1OXVA 4JI8Q 4DR3L 2KUMA 5I2YA 1EQVA 2JA8H 4KKTA 3C2PA 3GTLB 1XMOQ 2VQFL 1SNDA 1MHWC 1WTHA 4CDCC 5J1ZA 2K5WA 3G6JB 3M7NA 3KBGA 3I72A 1ILPA 2CWAA 2VL6A 5KGUA 2K04A 5C5MA 3UDIA 4KK7A 1X65A 4L5SA 3OWEB 3VA7A 3DWQA 4DR6Q 4A93B 1DXMA 3GTKH 2EYHA 2JXMB 1FJGQ 1B8AA 3FRPB 3Q0AA 3TZUA 3PO3G 1ZYRC 4WJ4A 4ZLTF 5JEAJ 4YCVA 2RHSB 2IL8A 2JEAI 3L0OA 1VQEA 1OO9B 3KJPA 3MEHA 3OTOQ 2UUAQ 4G57A 3MXNB 3RZOB 2X6GA 2EJMA 3CQZB 4O0AA 2PW7A 2Z6KA 2EE1A 3S16B 2IW3A 2DGYA 2WKDA 5IGCA 2GVBA 4F87A 1T5XD 1ESFA 4O2DA 4ULLA 4YHHQ 4C3JB 3CCLA 4HIMA 3BYTB 1TKWB 5ELDA 4RCOA 1F9SA 2E2JB 2HHHL 3MVVA 3HOZB 1V1QA 1PA6A 1NNXA 5HGQA 2Y0SB 5C4ZA 5M5YH 1I94L 4L63B 4Q0FA 1DM0B 4A3JB 3E0JA 4TKOB 1ENFA 4PMCA 1G2TA 2LKVA 2NVXH 2SNMA 1A3UA 1VQLA 2EY5A 2KA7A 2K33A 4A75A 1AFPA 4P2CB 1WOCA 1ZYRD 1CZWA 2KCMA 4RWSC 1JR0D 1X56A 4CDFC 3K59A 2PCFB 3CCJA 2PMZB 5BR8L 2BA1A 4LNQA 3KFUA 4HAEA 1ET9A 3GTQH 3NK9A 2F0SA 2VUMB 1TWGH 2A74C 4IZ8A 3SXHA 3BDOA 1DGSA 3M9BA 3TP6A 1KLUD 3S2HB 5M3MH 5LMNL 3BZKA 3S24A 3D8GA 3IFDA 4RGMA 5DAUA 2WIIB 1MJCA 5GAEC 3J7YW 4K6DA 4XYQA 1FGBD 3BZDB 2FJ2A 2NWGA 5FJ8H 2Q2TA 3L7ZC 1KDCA 5HGTA 3QR8A 1GUWA 5AJ3L 3FP9A 1KABA 1E1OA 2JA8G 2L12A 2KEEA 3CRLC 2E2HH 4BY1B 1IBML 1CHQD 3DHQA 3FKIB 4IUPA 4MN3A 1BQQT 1ICFB 1SXTA 4RKBA 2Y0SE 2B3GA 3HEJA 1XMQQ 1RCVD 2AQ3B 4JOIC 1TS2A 2EDGA 4DV2L 1XNQQ 4YWMA 1HUMA 1ASYA 1WTQA 2NVYB 3EBEA 5C4XB 2X6LA 1AZQA 3BVGA 4GKKQ 2OTLA 2PW5A 5IYBH 1CI3M 3CCRA 3S17B 3MTSA 4G7ZC 2PMZE 1BCPB 3NBIA 4DXFA 4DV6Q 1EIHA 4QUCA 5CV7A 1Y1VH 2VQFQ 1HZAA 4JW0A 2E8GA 2F0IA 2NZHA 1D1IA 1L2FA 1DCZA 3NSWA 4DV3L 1ENCA 1I4GA 3D6CA 2D0OA 1D7QA 1RDPD 3H3VH 2RA4A 4QIWB 4HJAA 2UUBL 5H1SE 4ABNA 1HQMC 1HZ9A 3U4VA 1I4PA 1U4LA 1GUSA 4QUFA 3M7GA 1MD2D 2XWJB 4Z9CB 4ZKBB 1GO3E 1LO5D 2K5QA 4DR4L 3R3OA 4CGYB 3S1NB 4CHTB 1RTNA 3B6YA 4P74A 3AQQA 3P75A 5ELCA 1SR3A 1LYLA 2G5DA 3TP8A 4EGVA 3PUYA 1ZXTA 3IFTA 1KTKA 3ULPA 2LY7A 4NB3A 1TWAB 3G71A 1D6EC 2DJGC 4YWKA 1QVFA 2A69C 4BY7H 2ZXOA 1JOKA 2O4XA 4OONA 1JE5A 2QEXA 1S72A 1BBUA 4KD3A 4DK1A 5M3MG 2LS01 4B3TL 2EOTA 4CKBA 3S16H 2K50A 2XN9C 1PZJD 2BCOA 2QGQA 3H6MA 1U4MA 4R8IA 3M4YA 2EYMA 1Y69U 4PQXA 1PTOC 2AUJD 4K5XA 5C3EH 1K9MC 3K57A 2ZM6L 1JWSD 1WI5A 2F0FA 2E2JH 2VY3A 5E3FA 2R3ZA 1HA6A 2ZTEA 1X3PA 4K5WA 4GLVB 3ULJA 4L5QA 1VMCA 1Q90A 2N88A 1EOVA 4A3GB 4QIWE 3W5OA 3ULLA 4A3JH 3VR2A 3P20A 4R4OA 3SGIA 1UE5A 1AP0A 1YHAA 5NUCA 5LMNQ 2IX1A 4HSPA 1KAAA 3I4MB 2M00A 1EQTA 1B1ZA 4QMGA 1F2YA 3HKZG 2OWOA 2F0OA 2A69D 1PYSB 4ALPA 4GZYC 3G7LA 3HG9A 3LWUA 2E5LL 3BDLA 1PFBA 3NBHB 4YIJA 4MNOA 3L9AX 1YJWA 2CW0C 3OSOA 4Y7NB 3PUWA 5IGBA 2JEBI 3I4NH 3S2HH 1O7YA 3KF6B 4DFAA 1LT6D 3D4DA 1GVPA 1JE4A 3BVMA 3VDYA 3KLRA 4HCEA 4IO9A 1IBMQ 1Y1VG 2B29A 2ZXRA 1TWHB 4DUYL 2RBMA 4DV7Q 4DR2Q 3I56A 4IJHA 1M90C 2WB1E 2MP1A 5JVH3 4JBWA 4A3MB 3RD4A 3M4PA 1PH6A 4NXNL 3PUVA 2JA5G 5A2QE 4JI0Q 3J81j 2AQ1B 1PMRA 1EEID 1SYGA 3QJYA 5C0XG 4IUVA 2CKZB 2KJXA 4A3BB 4KI0A 2QF7A 1YNND 2RF4A 4ZK9B 2UXDL 1K28A 4DK6C 3S2DH 5EAYA 1HNZL 4KHPQ 1HA5A 1CQVA 2F0LA 4GN3B 4P72A 2R61A 3SDZA 2LXKA 2EJFC 1LTAD 3BJUA 1NTGA 3JAML 1JQYD 3A8IE 3L2PA 4DV3Q 4YCWA 2YTYA 1X3EA 1Y8OB 3MC0B 3NQTA 4O1NA 2F1MA 3A8KE 3U9SA 1PH5A 1SYCA 2CH4A 4B9WA 4YCUA 1N34L 2WV6D 1I5FA 4GNXA 4BY7G 4NP5A 3U4ZA 4TSSA 2DUDA 2KHSA 4J8QA 1TS5A 3DEPA 5EBDA 4GS3A 1SNPA 3CPWA 1TR5A 2MO0A 4LK1C 4HN7A 2EXDA 2R93B 1VF5C 4DV1Q 3NWTA 4Y52H 2AWOA 3BU2A 1Q12A 1SMYC 2WAQB 3KLSX 1A3TA 4K6LA 4AIMA 4GOPB 4KHPL 1FGUA 3JAME 1EY0A 5M5XH 4OL7A 3HOXH 1NUCA 3CCSA 1EIYB 2ZT9C 2HCIA 4BBRH 2Z8LA 4B3SL 3K8AA 1L0XB 2JA9A 5KIXA 1W3SA 1RODA 3A56A 4C56C 5EBCA 4JI8L 1BNZA 4POGA 1VQIA 5COYA 2PQAA 3T51B 1XMOL 2ZM6Q 4OGQC 1F2LA 3G6EA 1ZKOA 1BCPC 4I7AA 1LUZA 4YY3L 1SYBA 3PO2B 2ZTCA 3SK6A 1JICA 3I4NG 1NMFA 4KTAA 5JAVA 4DR6L 2EPBA 2NUCA 4OIKA 1SMYD 2D62A 3EVQA 4XIGS 4NKLA 5C0XJ 3SR1A 2F0TA 3ERSX 1WCMG 4BBSB 1AW7A 2EZVA 1QZHA 3I2ZA 1PVOA 2KCCA 3HP3A 1KDAA 4P73A 5IP9H 3OTOL 1H9SB 2UUAL 3T53B 2WAQE 2E5LQ 3W1BA 1A63A 2XGTA 5C44G 1XX8A 3TS0A 3HRZC 2JA7B 1KDBA 1F77A 5D65A 2KCNA 4IUQA 4DNTB 2O5JC 1CFMA 5G3LF 1A6XA 3CXCA 5IOCA 4IUNA 4KY6A 4IUTA 1EYGA 1EZ6A 4IOAA 3RZDB 5JJLA 1VS0A 3VYSA 1NJIC 4OX9L 3V05A 3A54A 1CZGA 2NVTB 4JBMA 1BKBA 3HOYH 1LTSD 1BCPD 2KQ3A 4KN4C 5C4HA 1BOSA 4R1JA 3SK5A 3K7UC 5FKAC 4HIOA 2FMCA 4LF5Q 1WFQA 4HJ5A 4EVOA 2HD3A 4Y7NH 3M85A 5GROA 2JK8A 3VR3A 3A0JA 2RQXA 1P16A 1YJ9A 2I5LX 4WORA 5IT9c 1PHJA 3O13A 3H3VI 4DKAC 3E5SA 1WD0A 1CTMA 3S1MB 1H9RA 2F52A 4I7ZC 1KL9A 5C0XI 2BH8A 5IWAL 2JSOA 3GD7A 1VQDA 4HSVA 4U68A 2EJGC 3WWVA 4C3IB 2K7VA 1X3FA 4AYBG 3WDNA 2VZAA 2RCNA 4JBJA 3HOXG 2H5XA 1CKOA 3KYHC 1SDFA 4BBRG 4B3RL 5C4JH 1I3QB 3CCMA 4MZ9A 5M9OA 1YHBA 1Y1WB 1HNWQ 4LUOA 3IKJA 3IAYA 1XXGA 3OIPA 5CGKA 2K14A 2MO1A 4A3LH 1O80A 2QDBA 4J6HA 4JG2A 3EA6A 5JJIA 2DJFC 1C4QA 2WACA 1JWMD 2F0HA 1YVCA 1SRUA 2WP8J 1DYQA 3GTPH 4UP8A 1XPUA 2JA6B 5BN4A 1JB3A 1VQOA 1UAPA 1W6JA 2NBFA 3J7ZC 1XNQL 2BDNA 4PMBA 3VYUA 2J0TD 3PQIA 5L37A 3CF5A 2V1CC 1L1OB 4PNYA 1PH4A 2QDLA 4A3IH 1STNA 4KN7C 1V1PA 4K0KQ 5M3FH 3N6RA 4FXDA 4DV6L 3GTJB 1VQ6A 1D5MC 2PI2E 1WTOA 3EROA 4H0LC 4DGZA 2YU9H 2L15A 1QNKA 3QOJA 3GDEA 3DM3A 3JC66 2R7ZG 2JYOA 1IBKL 1P8LA 3CKIB 2B63B 3HOWB 4YY3Q 2MQHA 1Q3LA
chains in the Genus database with same CATH topology
3EBEA 4HJ7A 1UE6A 4A3CG 4GKKQ 1PH1A 4AH6A 2OTLA 4HIDA 1AE2A 1JT8A 1K0RA 4JI3Q 4BY1G 5IYBH 5AJ3Q 3PF4A 4OWWB 3G4SA 3CCRA 4JI5Q 4DR7L 2Q2HA 1C7YA 1PFSA 4A76A 1Q1EA 2PMZE 5DLQE 4AQYL 4A3KG 1XPRA 3I4MH 3CPFA 4YWLA 4JI4Q 4DV6Q 2Z0SA 3STBC 2A1AA 3K80C 3HOYG 1WCMH 3RR5A 1N33Q 1NBWA 3KLWA 3GO5A 1Y1VH 4LF9Q 1XNRL 2B63G 3HOWG 2VQFQ 3NENA 2HT1A 4BXXG 4LF6Q 1HZAA 2FXQA 3BZCA 4JI6L 2E8GA 1LTLA 4P71A 3PSIA 5C4XG 3AFPA 2NZHA 1L2FA 3UE0A 3F2CA 4DV2Q 1OTCA 4DV3L 3S1QH 1GD7A 2D0OA 5ELOA 1D7QA 4PMWA 3CC7A 3H3VH 2ZJQA 4XTCS 2HIVA 5C44H 3KDFB 3S1RH 4HJAA 1I50H 4ME3A 4X65L 4LWCA 5H1SE 1HR0L 2YV5A 2UUBL 1HZ9A 3U4VA 2BA0A 1K73C 1E24A 4AQYQ 3JAMc 1JJ2A 2N8NA 3J80c 4H02A 3RLNA 3UDGA 1TWHH 4OXPA 1BBWA 1JJCB 1K8GA 1VCIA 4OWTB 4OX9Q 4OO1I 1T9HA 1GO3E 1K8AC 1YZ6A 4GOPC 1Q86C 4DR4L 4X6AH 4JI6Q 1VQFA 3CCQA 4A3MH 3HOVH 3B6YA 4P74A 1L1OA 4C2MH 3AQQA 3ICEA 4DUZQ 4HIKA 1SR3A 1A8VA 1BVSA 1LYLA 2ASBA 4A3BH 1AE3A 1E7ZA 1HR0Q 4X65Q 3PUYA 2UUBQ 4UP7A 4GKJQ 3K81C 4LW1A 3CCEA 3ULPA 4NB3A 3T1YL 3G71A 2LSSA 1X55A 3STBD 4YWKA 1QVFA 2YTVA 2E2IH 3PUZA 3EN2A 1VQCA 2R7FA 1SROA 5FLXc 1X9NA 1IYJB 1MIUA 4BY7H 3I7FA 4JI2Q 1X3GA 5LMUL 2Z6KC 5IWAQ 2F4VL 4DR4Q 1VQ7A 4OONA 3CW2C 1JE5A 2QEXA 4HJ8A 1S72A 1C9OA 1HZBA 1BBUA 2EQSA 1HH2P 2AWNA 2IT1A 5M3MG 1LM0A 3NEMA 4B3TL 3S16H 1G6PA 5FLMH 2K50A 3GTOH 5GAGC 2QGQA 3HFZB 1PYBA 1YITA 1B70B 3T1YQ 1ASZA 5C3EH 4LF4L 1K9MC 2ZM6L 4DR1Q 4IFDJ 4GLAC 2K52A 1WI5A 3PUXA 2E2JH 1YEZA 2I5HA 2VY3A 1E1TA 4DV0L 4B3RQ 5IY0A 5LMUQ 2IHFA 3CCVA 4JBKA 2A8VA 4A3DG 1PH3A 2ZTEA 2N78A 1MJEA 2ATWA 4GLVB 3PGZA 4L5QA 3ULJA 5IE8A 1RIPA 4HJ9A 2R93H 1EOVA 1CSQA 1K83H 4QIWE 3W5OA 3KDFA 4UPAA 3ULLA 5IP7G 3M4QA 4C3IH 4A3JH 4B3TQ 4APVA 4R4OA 4OWXB 5M3FG 3SGIA 1UE5A 3D0FA 1YHAA 4X66L 5LMNQ 4NXML 3HOUH 1V43A 2IX1A 2CFMA 2VS1A 4PZ7A 3J81i 5IYDH 1Q1BA 3A5ZB 3ZJYC 3CC4A 4LF4Q 1PH8A 1CUKA 4DV7L 4DR2L 3HKZG 3H0GH 3Q8DA 2CWPA 4C3HH 2OWOA 5IP9G 3F2BA 1PYSB 5IYCG 2K5HA 4JC0A 4GNXB 4ALPA 4DV0Q 2R92H 2VQEQ 4A3GG 1RL2A 3CP0A 3MEFA 1U0LA 4GLXA 4IPHA 1SN8A 2E5LL 2ES2A 2QA4A 1YBYA 1SFOH 1QVGA 1PH7A 4BA1I 3NBHB 4MNOA 4JI0L 4B3ML 1D8LA 4LFCL 1YJWA 2LXJA 1UWVA 4A3FH 1CKMA 2K5VA 3UDFA 2MNAA 4JYAQ 1A0IA 3PUWA 1FJGL 2JEBI 3GTMH 1EQRA 3I4MG 3G48A 3I4NH 3S2HH 3FKIG 3KF6B 2NVQH 4X66Q 1Q8KA 1GVPA 1N32L 3VDYA 4QL5A 2IHEA 4IO9A 3CMAA 1EQQA 1IBMQ 1Y1VG 2B29A 2ZTDA 2N49A 4DUYL 1C0AA 4DV7Q 4DR2Q 3I56A 4IJHA 1M90C 1YIJA 2WB1E 4R4QA 3M4OH 1CKNA 1EIFA 1MKHA 2AHOB 5K36G 4JBWA 1VQ5A 1WJJA 4A3EH 1IBKQ 3M4PA 1UE7A 4NXNL 1PH6A 2R7ZH 4DAMA 3PUVA 3UDXA 2JA5G 3PO2H 4IFDI 3RN5A 4EQ5A 4JI0Q 1B7YB 3J81j 4IJLA 5C0XG 4B3MQ 4LFCQ 4IPCA 2CKZB 4EX5A 4KI0A 2RF4A 2Q2UA 4BA2I 4A3CH 2UXDL 4QY7A 5HY6A 4DK6C 3S2DH 5EAYA 1HNZL 4DR7Q 1N32Q 3U50C 1IBLL 5GAHC 1J6QA 3PCOB 2N3SA 4YHHL 3HKZE 4GN3B 4P72A 4TQUS 1HJPA 2K4KA 2LXKA 4PZ8A 4DUYQ 1XPOA 2JJQA 2K75A 4A3KH 3PO3H 3GTLH 1X54A 3I4OA 4KLKA 3BJUA 4BBSH 4A3MG 1J5EL 3HOVG 1SE8A 1NTGA 1N8RC 3T1HL 1XNRQ 3KF8B 1Q46A 1Z9FA 2PQAB 3AYHB 5M5WH 2NN6G 1KIXA 3UE1A 1FL0A 1S40A 4NXNQ 4DV4L 4A3BG 3L2PA 1OXSC 4DV1L 4R4CA 4DV3Q 4YCWA 2K5NA 2OQ0A 3NELA 4LF8L 2JE6I 1X3EA 2YTYA 4A93H 2JA7H 3K0XA 5JEAG 1KHIA 2UXDQ 1XJVA 1PH5A 1HNZQ 4YCUA 1N34L 1IBLQ 4L5RC 1I5FA 4GNXA 4BY7G 3U4ZA 2DUDA 3HKSA 3OYYA 2UXBL 3RZDH 1J5EQ 3ER0A 4GS3A 3T1HQ 3CPWA 2MO0A 2NVTH 3S15H 2EXDA 2F3IA 3RZOH 1CKNB 3A5UA 4DV1Q 1TXYA 3KF6A 4A3LG 2OTJA 4Y52H 2AWOA 3CQZH 3BU2A 1Q12A 3RLFA 2HIXA 4LUVA 1Z47A 2KCTA 2A19A 1FVIA 3EIVA 1A62A 1N34Q 3A74A 1V9PA 2GN5A 3D31A 4AIMA 4GOPB 4DNIA 4KHPL 1QUQB 1VQHA 1L1OC 4C3JH 1FGUA 3TREA 3LGJA 5M5XH 1VQGA 3S1MH 2ALYB 3I55A 1NMGA 4FDBA 3HOXH 2R93G 3CCSA 1EIYB 2F4VQ 1G51A 1S3OA 4BBRH 2WB1G 1NY4A 5FJ8G 1YHQA 4B3SL 3HOZH 3TRZA 1SMXA 4POFA 5GADC 3E9HA 3K8AA 4NPSA 2MFIA 4P75A 2ZJPA 1PH2A 2WAQG 5LMNW 1YNXA 1VQBA 4PG3A 2JA9A 4RG1A 3TQYA 1VQ9A 1PH9A 3HOUG 4JOIA 3J7A5 1VQKA 2UU9L 4A3IG 1W3SA 1EFWA 4QGUA 5IYDG 3H15A 4A4IA 4JI8L 3H0GG 4POGA 4J15A 2UXCL 4KHPQ 1KRSA 1GKHA 1VQIA 2VNUD 2EIFA 1M1KC 2R92G 4KHZA 2OCEA 2PQAA 4LFAL 1SLJA 4LUZA 2ZM6Q 1XMOL 4IPDA 1XMQL 3F8TA 3G6EA 2KHJA 5J3BA 1I3QH 4DV5L 4DK3C 1LUZA 4YY3L 1Q81C 2R6GA 3E9IA 2IX0A 4A3FG 2YYZA 2ZTCA 1JB7A 1EWIA 1O7IA 2AKWB 4JI1L 3W1GA 2R7DA 2KHIA 4R4IA 1L0WA 1Y1WH 2VUMH 3I4NG 1NMFA 5IYBG 4GKKL 2GVAA 1VQ8A 1I6HH 1R9TH 4DR6L 4RMFA 2AMCB 4L5TA 2UU9Q 4LF7L 2D62A 2BH2A 1OXUA 1WYDA 4XIGS 4X62Q 5C0XJ 1OXVA 1QZGA 3J81c 3ERSX 4JI8Q 4DR3L 2CCZA 4JI4L 4NXMQ 1WCMG 2JQOA 2OQKA 2JA8H 4LFAQ 4LF9L 2HQLA 1QVCA 1XMOQ 4PZ6A 2VQFL 4A3EG 1QZHA 1EUJA 3I2ZA 3PO2G 3K7AH 1PVOA 4P73A 3M7NA 4DV5Q 1UEBA 2CWAA 5IP9H 3OTOL 2VL6A 3UDIA 2JA6H 2UUAL 2I5MX 1VQMA 1OXXK 2WAQE 2E5LQ 3W1BA 4JCVE 1X65A 4L5SA 1E22A 4IOCA 4LF5L 1A63A 2XGTA 5C44G 4OO1G 4DR6Q 1Q82C 3TS0A 3GTKH 4GOPA 2ZJRA 4LF7Q 1QUQA 1FJGQ 3F1ZA 3AFQA 1B8AA 4QJFA 3FHWA 4DR3Q 1KQSA 4BY1H 3PO3G 2ID0A 1IL2A 3FKIH 4BBSG 4WJ4A 3CXCA 3JAMi 1KD1C 5JEAJ 1EYGA 3GTJH 4IOAA 4YCVA 3J80i 1IZ6A 1K3RA 1VS0A 2RHSB 1NJIC 5JJLA 4OX9L 1TWFH 2JEAI 3RLOA 3S14H 3L0OA 1VQEA 3PIOA 4JBMA 1BKBA 3KJPA 1VQPA 3HOYH 3OTOQ 2VW9A 2UUAQ 4DR5L 5E7NA 2B63H 3HOWH 3MXNB 4R1JA 4BXXH 3K7UC 1UE1A 1YI2A 4A93G 2XTIA 4R4TA 4DUZL 1WFQA 4HIOA 1IXRA 4LF5Q 4HJ5A 2NVYH 2JA7G 4O0AA 5C4XH 4X64L 1HR0W 4Y7NH 2JA5H 3M85A 2Z6KA 5GROA 3RN2A 2JK8A 3A0JA 2DGYA 2GVBA 4GKJL 3S17H 1P16A 1YJ9A 2I5LX 4QQBX 4O2DA 4YHHQ 5IT9c 1KXLA 1PHJA 4B3SQ 1U5KA 4HIMA 3CCLA 3H3VI 4DKAC 1PV4A 2F52A 1JMCA 4IPGA 1KL9A 5C0XI 3OW2A 4JI2L 2BH8A 5IWAL 2D0PA 1N36L 2HHHL 3GD7A 1VQDA 1V1QA 1PA6A 4DR5Q 3IRBA 1XTDA 5HGQA 4UP9A 1HNWL 1OXTA 5M5YH 3WWVA 4DV4Q 1I94L 5FLMG 4JV5L 4X64Q 3CCUA 4LF8Q 2UUCL 1X3FA 4AYBG 1H95A 2C35B 1KC8C 2VZAA 1VQAA 2RCNA 3CAMA 4JBJA 5ELNA 2NVXH 4UY8C 5C3EG 3DLLA 3TEHB 1VQLA 4A75A 2NN6I 3HOXG 2CQOA 2H5XA 1KRTA 1WOCA 4DR1L 1CKOA 2KCMA 3KYHC 1X56A 2IY5B 2KENA 4BBRG 3HOZG 1VQNA 3TS2A 4B3RL 3CCJA 3GTGH 2UXBQ 5C4JH 1AH9A 2HHHQ 5BR8L 1N36Q 2Y0SG 2BA1A 4LNQA 3KFUA 3CCMA 1CSPA 3E0EA 4MZ9A 3S1NH 3GTQH 1KAWA 1YHBA 4A3JG 1HNWQ 4GN4B 4LUOA 2PNHA 1I94Q 1TWGH 4GNXC 4JV5Q 1NE3A 3CD6A 2KBNA 1E3PA 2UUCQ 1DGSA 2K14A 2MO1A 3M9BA 4A3LH 4JG2A 5M3MH 5LMNL 3PIPA 5JJIA 4JI7L 1HNXL 3BZKA 3S24A 3U58A 4K0KL 2I0QA 3CMEA 1TWAH 2Q2IA 3RNUA 1TWCH 1YJNA 1VQJA 1YVCA 1MJCA 1SRUA 2WP8J 4TVAB 5GAEC 1VQ4A 2VQEL 4DAYB 5BR8Q 3PV0A 1Y1WG 3GTPH 4UP8A 4LFBL 1XPUA 2VUMG 1Q7YC 1X6OA 1VQOA 1GM5A 3F2DA 3J7ZC 1XNQL 4A3DH 5FJ8H 4X62L 2Q2TA 1G291 4AYBE 3AEVA 3L7ZC 4DPGA 4JYAL 3CF5A 2RHQB 2V1CC 2YTXA 4JI3L 1L1OB 5AJ3L 3FP9A 3CC2A 4JI5L 1PH4A 5IP7H 1E1OA 2JA8G 4IFDG 5JJKA 4JI7Q 4A3IH 1HNXQ 2E2HH 1IBML 2NZOA 2WFWA 4K0KQ 5M3FH 4DV6L 2UXCQ 1VQ6A 2PI2E 3M3YH 1JJGA 2PI2A 2Y0SE 4MTNA 1N33L 2JA6G 2B3GA 1N9WA 2YU9H 2L15A 1XMQQ 3GDEA 4LF6L 3DM3A 3JC66 3KOJA 4JOIC 1W2BA 2R7ZG 4LFBQ 3KJOA 1IBKL 1HZCA 1P8LA 5GQOA 4YY3Q 5IYCH 1Y14B 2MQHA 4DV2L 3PF5A 1XNQQ 4YWMA 4GN5A 4WJ3M 1ASYA 4A3GH 4JI1Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EBE A;  4HJ7 A;  1UE6 A;  4A3C G;  4GKK Q;  1PH1 A;  4AH6 A;  2OTL A;  4HID A;  1AE2 A;  1JT8 A;  1K0R A;  4JI3 Q;  4BY1 G;  5IYB H;  5AJ3 Q;  3PF4 A;  4OWW B;  3G4S A;  3CCR A;  4JI5 Q;  4DR7 L;  2Q2H A;  1C7Y A;  1PFS A;  4A76 A;  1Q1E A;  2PMZ E;  5DLQ E;  4AQY L;  4A3K G;  1XPR A;  3I4M H;  3CPF A;  4YWL A;  4JI4 Q;  4DV6 Q;  2Z0S A;  3STB C;  2A1A A;  3K80 C;  3HOY G;  1WCM H;  3RR5 A;  1N33 Q;  1NBW A;  3KLW A;  3GO5 A;  1Y1V H;  4LF9 Q;  1XNR L;  2B63 G;  3HOW G;  2VQF Q;  3NEN A;  2HT1 A;  4BXX G;  4LF6 Q;  1HZA A;  2FXQ A;  3BZC A;  4JI6 L;  2E8G A;  1LTL A;  4P71 A;  3PSI A;  5C4X G;  3AFP A;  2NZH A;  1L2F A;  3UE0 A;  3F2C A;  4DV2 Q;  1OTC A;  4DV3 L;  3S1Q H;  1GD7 A;  2D0O A;  5ELO A;  1D7Q A;  4PMW A;  3CC7 A;  3H3V H;  2ZJQ A;  4XTC S;  2HIV A;  5C44 H;  3KDF B;  3S1R H;  4HJA A;  1I50 H;  4ME3 A;  4X65 L;  4LWC A;  5H1S E;  1HR0 L;  2YV5 A;  2UUB L;  1HZ9 A;  3U4V A;  2BA0 A;  1K73 C;  1E24 A;  4AQY Q;  3JAM c;  1JJ2 A;  2N8N A;  3J80 c;  4H02 A;  3RLN A;  3UDG A;  1TWH H;  4OXP A;  1BBW A;  1JJC B;  1K8G A;  1VCI A;  4OWT B;  4OX9 Q;  4OO1 I;  1T9H A;  1GO3 E;  1K8A C;  1YZ6 A;  4GOP C;  1Q86 C;  4DR4 L;  4X6A H;  4JI6 Q;  1VQF A;  3CCQ A;  4A3M H;  3HOV H;  3B6Y A;  4P74 A;  1L1O A;  4C2M H;  3AQQ A;  3ICE A;  4DUZ Q;  4HIK A;  1SR3 A;  1A8V A;  1BVS A;  1LYL A;  2ASB A;  4A3B H;  1AE3 A;  1E7Z A;  1HR0 Q;  4X65 Q;  3PUY A;  2UUB Q;  4UP7 A;  4GKJ Q;  3K81 C;  4LW1 A;  3CCE A;  3ULP A;  4NB3 A;  3T1Y L;  3G71 A;  2LSS A;  1X55 A;  3STB D;  4YWK A;  1QVF A;  2YTV A;  2E2I H;  3PUZ A;  3EN2 A;  1VQC A;  2R7F A;  1SRO A;  5FLX c;  1X9N A;  1IYJ B;  1MIU A;  4BY7 H;  3I7F A;  4JI2 Q;  1X3G A;  5LMU L;  2Z6K C;  5IWA Q;  2F4V L;  4DR4 Q;  1VQ7 A;  4OON A;  3CW2 C;  1JE5 A;  2QEX A;  4HJ8 A;  1S72 A;  1C9O A;  1HZB A;  1BBU A;  2EQS A;  1HH2 P;  2AWN A;  2IT1 A;  5M3M G;  1LM0 A;  3NEM A;  4B3T L;  3S16 H;  1G6P A;  5FLM H;  2K50 A;  3GTO H;  5GAG C;  2QGQ A;  3HFZ B;  1PYB A;  1YIT A;  1B70 B;  3T1Y Q;  1ASZ A;  5C3E H;  4LF4 L;  1K9M C;  2ZM6 L;  4DR1 Q;  4IFD J;  4GLA C;  2K52 A;  1WI5 A;  3PUX A;  2E2J H;  1YEZ A;  2I5H A;  2VY3 A;  1E1T A;  4DV0 L;  4B3R Q;  5IY0 A;  5LMU Q;  2IHF A;  3CCV A;  4JBK A;  2A8V A;  4A3D G;  1PH3 A;  2ZTE A;  2N78 A;  1MJE A;  2ATW A;  4GLV B;  3PGZ A;  4L5Q A;  3ULJ A;  5IE8 A;  1RIP A;  4HJ9 A;  2R93 H;  1EOV A;  1CSQ A;  1K83 H;  4QIW E;  3W5O A;  3KDF A;  4UPA A;  3ULL A;  5IP7 G;  3M4Q A;  4C3I H;  4A3J H;  4B3T Q;  4APV A;  4R4O A;  4OWX B;  5M3F G;  3SGI A;  1UE5 A;  3D0F A;  1YHA A;  4X66 L;  5LMN Q;  4NXM L;  3HOU H;  1V43 A;  2IX1 A;  2CFM A;  2VS1 A;  4PZ7 A;  3J81 i;  5IYD H;  1Q1B A;  3A5Z B;  3ZJY C;  3CC4 A;  4LF4 Q;  1PH8 A;  1CUK A;  4DV7 L;  4DR2 L;  3HKZ G;  3H0G H;  3Q8D A;  2CWP A;  4C3H H;  2OWO A;  5IP9 G;  3F2B A;  1PYS B;  5IYC G;  2K5H A;  4JC0 A;  4GNX B;  4ALP A;  4DV0 Q;  2R92 H;  2VQE Q;  4A3G G;  1RL2 A;  3CP0 A;  3MEF A;  1U0L A;  4GLX A;  4IPH A;  1SN8 A;  2E5L L;  2ES2 A;  2QA4 A;  1YBY A;  1SFO H;  1QVG A;  1PH7 A;  4BA1 I;  3NBH B;  4MNO A;  4JI0 L;  4B3M L;  1D8L A;  4LFC L;  1YJW A;  2LXJ A;  1UWV A;  4A3F H;  1CKM A;  2K5V A;  3UDF A;  2MNA A;  4JYA Q;  1A0I A;  3PUW A;  1FJG L;  2JEB I;  3GTM H;  1EQR A;  3I4M G;  3G48 A;  3I4N H;  3S2H H;  3FKI G;  3KF6 B;  2NVQ H;  4X66 Q;  1Q8K A;  1GVP A;  1N32 L;  3VDY A;  4QL5 A;  2IHE A;  4IO9 A;  3CMA A;  1EQQ A;  1IBM Q;  1Y1V G;  2B29 A;  2ZTD A;  2N49 A;  4DUY L;  1C0A A;  4DV7 Q;  4DR2 Q;  3I56 A;  4IJH A;  1M90 C;  1YIJ A;  2WB1 E;  4R4Q A;  3M4O H;  1CKN A;  1EIF A;  1MKH A;  2AHO B;  5K36 G;  4JBW A;  1VQ5 A;  1WJJ A;  4A3E H;  1IBK Q;  3M4P A;  1UE7 A;  4NXN L;  1PH6 A;  2R7Z H;  4DAM A;  3PUV A;  3UDX A;  2JA5 G;  3PO2 H;  4IFD I;  3RN5 A;  4EQ5 A;  4JI0 Q;  1B7Y B;  3J81 j;  4IJL A;  5C0X G;  4B3M Q;  4LFC Q;  4IPC A;  2CKZ B;  4EX5 A;  4KI0 A;  2RF4 A;  2Q2U A;  4BA2 I;  4A3C H;  2UXD L;  4QY7 A;  5HY6 A;  4DK6 C;  3S2D H;  5EAY A;  1HNZ L;  4DR7 Q;  1N32 Q;  3U50 C;  1IBL L;  5GAH C;  1J6Q A;  3PCO B;  2N3S A;  4YHH L;  3HKZ E;  4GN3 B;  4P72 A;  4TQU S;  1HJP A;  2K4K A;  2LXK A;  4PZ8 A;  4DUY Q;  1XPO A;  2JJQ A;  2K75 A;  4A3K H;  3PO3 H;  3GTL H;  1X54 A;  3I4O A;  4KLK A;  3BJU A;  4BBS H;  4A3M G;  1J5E L;  3HOV G;  1SE8 A;  1NTG A;  1N8R C;  3T1H L;  1XNR Q;  3KF8 B;  1Q46 A;  1Z9F A;  2PQA B;  3AYH B;  5M5W H;  2NN6 G;  1KIX A;  3UE1 A;  1FL0 A;  1S40 A;  4NXN Q;  4DV4 L;  4A3B G;  3L2P A;  1OXS C;  4DV1 L;  4R4C A;  4DV3 Q;  4YCW A;  2K5N A;  2OQ0 A;  3NEL A;  4LF8 L;  2JE6 I;  1X3E A;  2YTY A;  4A93 H;  2JA7 H;  3K0X A;  5JEA G;  1KHI A;  2UXD Q;  1XJV A;  1PH5 A;  1HNZ Q;  4YCU A;  1N34 L;  1IBL Q;  4L5R C;  1I5F A;  4GNX A;  4BY7 G;  3U4Z A;  2DUD A;  3HKS A;  3OYY A;  2UXB L;  3RZD H;  1J5E Q;  3ER0 A;  4GS3 A;  3T1H Q;  3CPW A;  2MO0 A;  2NVT H;  3S15 H;  2EXD A;  2F3I A;  3RZO H;  1CKN B;  3A5U A;  4DV1 Q;  1TXY A;  3KF6 A;  4A3L G;  2OTJ A;  4Y52 H;  2AWO A;  3CQZ H;  3BU2 A;  1Q12 A;  3RLF A;  2HIX A;  4LUV A;  1Z47 A;  2KCT A;  2A19 A;  1FVI A;  3EIV A;  1A62 A;  1N34 Q;  3A74 A;  1V9P A;  2GN5 A;  3D31 A;  4AIM A;  4GOP B;  4DNI A;  4KHP L;  1QUQ B;  1VQH A;  1L1O C;  4C3J H;  1FGU A;  3TRE A;  3LGJ A;  5M5X H;  1VQG A;  3S1M H;  2ALY B;  3I55 A;  1NMG A;  4FDB A;  3HOX H;  2R93 G;  3CCS A;  1EIY B;  2F4V Q;  1G51 A;  1S3O A;  4BBR H;  2WB1 G;  1NY4 A;  5FJ8 G;  1YHQ A;  4B3S L;  3HOZ H;  3TRZ A;  1SMX A;  4POF A;  5GAD C;  3E9H A;  3K8A A;  4NPS A;  2MFI A;  4P75 A;  2ZJP A;  1PH2 A;  2WAQ G;  5LMN W;  1YNX A;  1VQB A;  4PG3 A;  2JA9 A;  4RG1 A;  3TQY A;  1VQ9 A;  1PH9 A;  3HOU G;  4JOI A;  3J7A 5;  1VQK A;  2UU9 L;  4A3I G;  1W3S A;  1EFW A;  4QGU A;  5IYD G;  3H15 A;  4A4I A;  4JI8 L;  3H0G G;  4POG A;  4J15 A;  2UXC L;  4KHP Q;  1KRS A;  1GKH A;  1VQI A;  2VNU D;  2EIF A;  1M1K C;  2R92 G;  4KHZ A;  2OCE A;  2PQA A;  4LFA L;  1SLJ A;  4LUZ A;  2ZM6 Q;  1XMO L;  4IPD A;  1XMQ L;  3F8T A;  3G6E A;  2KHJ A;  5J3B A;  1I3Q H;  4DV5 L;  4DK3 C;  1LUZ A;  4YY3 L;  1Q81 C;  2R6G A;  3E9I A;  2IX0 A;  4A3F G;  2YYZ A;  2ZTC A;  1JB7 A;  1EWI A;  1O7I A;  2AKW B;  4JI1 L;  3W1G A;  2R7D A;  2KHI A;  4R4I A;  1L0W A;  1Y1W H;  2VUM H;  3I4N G;  1NMF A;  5IYB G;  4GKK L;  2GVA A;  1VQ8 A;  1I6H H;  1R9T H;  4DR6 L;  4RMF A;  2AMC B;  4L5T A;  2UU9 Q;  4LF7 L;  2D62 A;  2BH2 A;  1OXU A;  1WYD A;  4XIG S;  4X62 Q;  5C0X J;  1OXV A;  1QZG A;  3J81 c;  3ERS X;  4JI8 Q;  4DR3 L;  2CCZ A;  4JI4 L;  4NXM Q;  1WCM G;  2JQO A;  2OQK A;  2JA8 H;  4LFA Q;  4LF9 L;  2HQL A;  1QVC A;  1XMO Q;  4PZ6 A;  2VQF L;  4A3E G;  1QZH A;  1EUJ A;  3I2Z A;  3PO2 G;  3K7A H;  1PVO A;  4P73 A;  3M7N A;  4DV5 Q;  1UEB A;  2CWA A;  5IP9 H;  3OTO L;  2VL6 A;  3UDI A;  2JA6 H;  2UUA L;  2I5M X;  1VQM A;  1OXX K;  2WAQ E;  2E5L Q;  3W1B A;  4JCV E;  1X65 A;  4L5S A;  1E22 A;  4IOC A;  4LF5 L;  1A63 A;  2XGT A;  5C44 G;  4OO1 G;  4DR6 Q;  1Q82 C;  3TS0 A;  3GTK H;  4GOP A;  2ZJR A;  4LF7 Q;  1QUQ A;  1FJG Q;  3F1Z A;  3AFQ A;  1B8A A;  4QJF A;  3FHW A;  4DR3 Q;  1KQS A;  4BY1 H;  3PO3 G;  2ID0 A;  1IL2 A;  3FKI H;  4BBS G;  4WJ4 A;  3CXC A;  3JAM i;  1KD1 C;  5JEA J;  1EYG A;  3GTJ H;  4IOA A;  4YCV A;  3J80 i;  1IZ6 A;  1K3R A;  1VS0 A;  2RHS B;  1NJI C;  5JJL A;  4OX9 L;  1TWF H;  2JEA I;  3RLO A;  3S14 H;  3L0O A;  1VQE A;  3PIO A;  4JBM A;  1BKB A;  3KJP A;  1VQP A;  3HOY H;  3OTO Q;  2VW9 A;  2UUA Q;  4DR5 L;  5E7N A;  2B63 H;  3HOW H;  3MXN B;  4R1J A;  4BXX H;  3K7U C;  1UE1 A;  1YI2 A;  4A93 G;  2XTI A;  4R4T A;  4DUZ L;  1WFQ A;  4HIO A;  1IXR A;  4LF5 Q;  4HJ5 A;  2NVY H;  2JA7 G;  4O0A A;  5C4X H;  4X64 L;  1HR0 W;  4Y7N H;  2JA5 H;  3M85 A;  2Z6K A;  5GRO A;  3RN2 A;  2JK8 A;  3A0J A;  2DGY A;  2GVB A;  4GKJ L;  3S17 H;  1P16 A;  1YJ9 A;  2I5L X;  4QQB X;  4O2D A;  4YHH Q;  5IT9 c;  1KXL A;  1PHJ A;  4B3S Q;  1U5K A;  4HIM A;  3CCL A;  3H3V I;  4DKA C;  1PV4 A;  2F52 A;  1JMC A;  4IPG A;  1KL9 A;  5C0X I;  3OW2 A;  4JI2 L;  2BH8 A;  5IWA L;  2D0P A;  1N36 L;  2HHH L;  3GD7 A;  1VQD A;  1V1Q A;  1PA6 A;  4DR5 Q;  3IRB A;  1XTD A;  5HGQ A;  4UP9 A;  1HNW L;  1OXT A;  5M5Y H;  3WWV A;  4DV4 Q;  1I94 L;  5FLM G;  4JV5 L;  4X64 Q;  3CCU A;  4LF8 Q;  2UUC L;  1X3F A;  4AYB G;  1H95 A;  2C35 B;  1KC8 C;  2VZA A;  1VQA A;  2RCN A;  3CAM A;  4JBJ A;  5ELN A;  2NVX H;  4UY8 C;  5C3E G;  3DLL A;  3TEH B;  1VQL A;  4A75 A;  2NN6 I;  3HOX G;  2CQO A;  2H5X A;  1KRT A;  1WOC A;  4DR1 L;  1CKO A;  2KCM A;  3KYH C;  1X56 A;  2IY5 B;  2KEN A;  4BBR G;  3HOZ G;  1VQN A;  3TS2 A;  4B3R L;  3CCJ A;  3GTG H;  2UXB Q;  5C4J H;  1AH9 A;  2HHH Q;  5BR8 L;  1N36 Q;  2Y0S G;  2BA1 A;  4LNQ A;  3KFU A;  3CCM A;  1CSP A;  3E0E A;  4MZ9 A;  3S1N H;  3GTQ H;  1KAW A;  1YHB A;  4A3J G;  1HNW Q;  4GN4 B;  4LUO A;  2PNH A;  1I94 Q;  1TWG H;  4GNX C;  4JV5 Q;  1NE3 A;  3CD6 A;  2KBN A;  1E3P A;  2UUC Q;  1DGS A;  2K14 A;  2MO1 A;  3M9B A;  4A3L H;  4JG2 A;  5M3M H;  5LMN L;  3PIP A;  5JJI A;  4JI7 L;  1HNX L;  3BZK A;  3S24 A;  3U58 A;  4K0K L;  2I0Q A;  3CME A;  1TWA H;  2Q2I A;  3RNU A;  1TWC H;  1YJN A;  1VQJ A;  1YVC A;  1MJC A;  1SRU A;  2WP8 J;  4TVA B;  5GAE C;  1VQ4 A;  2VQE L;  4DAY B;  5BR8 Q;  3PV0 A;  1Y1W G;  3GTP H;  4UP8 A;  4LFB L;  1XPU A;  2VUM G;  1Q7Y C;  1X6O A;  1VQO A;  1GM5 A;  3F2D A;  3J7Z C;  1XNQ L;  4A3D H;  5FJ8 H;  4X62 L;  2Q2T A;  1G29 1;  4AYB E;  3AEV A;  3L7Z C;  4DPG A;  4JYA L;  3CF5 A;  2RHQ B;  2V1C C;  2YTX A;  4JI3 L;  1L1O B;  5AJ3 L;  3FP9 A;  3CC2 A;  4JI5 L;  1PH4 A;  5IP7 H;  1E1O A;  2JA8 G;  4IFD G;  5JJK A;  4JI7 Q;  4A3I H;  1HNX Q;  2E2H H;  1IBM L;  2NZO A;  2WFW A;  4K0K Q;  5M3F H;  4DV6 L;  2UXC Q;  1VQ6 A;  2PI2 E;  3M3Y H;  1JJG A;  2PI2 A;  2Y0S E;  4MTN A;  1N33 L;  2JA6 G;  2B3G A;  1N9W A;  2YU9 H;  2L15 A;  1XMQ Q;  3GDE A;  4LF6 L;  3DM3 A;  3JC6 6;  3KOJ A;  4JOI C;  1W2B A;  2R7Z G;  4LFB Q;  3KJO A;  1IBK L;  1HZC A;  1P8L A;  5GQO A;  4YY3 Q;  5IYC H;  1Y14 B;  2MQH A;  4DV2 L;  3PF5 A;  1XNQ Q;  4YWM A;  4GN5 A;  4WJ3 M;  1ASY A;  4A3G H;  4JI1 Q; 
#chains in the Genus database with same CATH topology
 2JA5 B;  1SEB D;  1K0R A;  1S5E D;  4JI3 Q;  4KD4 A;  1PZK D;  3PF4 A;  4JI5 Q;  4DR7 L;  3D4W A;  1PFS A;  2KED A;  4A3K G;  1XPR A;  1FNU A;  3STB C;  3HOY G;  1H9M A;  2HDM A;  3RR5 A;  3HZX A;  3GO5 A;  3NEN A;  2HT1 A;  4LF6 Q;  2FXQ A;  3HGB A;  1IYV A;  1LTL A;  4P71 A;  1S5C D;  1KNA A;  3AFP A;  5T1I A;  3UE0 A;  3F2C A;  3S1Q H;  1E2V A;  2EYJ A;  1GD7 A;  4FO2 A;  4HMI A;  5BN3 A;  1PYW D;  3KDF B;  4ME3 A;  5KYI A;  4N8X 1;  4KKS A;  1EOT A;  2D5D A;  1JJ2 A;  4DAY A;  4DNR B;  1NCV A;  5CV8 A;  1H9J A;  4OXP A;  3TP7 A;  1BBW A;  3GTG B;  1VCI A;  5EJW A;  4OX9 Q;  1T9H A;  4ZCK A;  1DOK A;  4H44 C;  1K8A C;  4XT1 B;  1TT2 A;  4GOP C;  4JI6 Q;  3CCQ A;  2B2W C;  2NN6 H;  4ZAI A;  4HIK A;  1BVS A;  2J7Z A;  2Z4H A;  1UUP A;  2SNS A;  2WIN B;  3MA2 B;  4DN4 M;  1PTO F;  1AE3 A;  1HR0 Q;  4X65 Q;  5IGF A;  2BOS A;  4LW1 A;  3CCE A;  3FMC A;  4HED A;  1X55 A;  3STB D;  5FLX c;  3W3A A;  5DNF A;  1MIU A;  3I7F A;  1X3G A;  3TBI B;  5IWA Q;  3IL8 A;  2O2L D;  4A3D B;  1HZB A;  2A5H A;  2EQS A;  2AWN A;  2IT1 A;  1R9T B;  1F2M A;  3I73 A;  5CBE E;  5FLM H;  2KEC A;  3NE5 B;  4QCL A;  2L5T A;  2ICI A;  2PNR C;  1LTI D;  1PYB A;  3HFZ B;  5CBA E;  1YIT A;  1B70 B;  3T1Y Q;  1ASZ A;  3M3Y B;  1C8C A;  4NDX A;  1DD2 A;  4B3R Q;  3K7A B;  1HTL D;  2DNC A;  5G3L D;  1D1K A;  5I9O A;  2PZW A;  4EQN A;  1NR2 A;  1SAP A;  3EFX D;  2ZXP A;  1RTO A;  3K6O A;  4C3I H;  1RD9 D;  4OWX B;  5M3F G;  1EZ8 A;  3ND8 A;  3D0F A;  5D14 A;  1HFG A;  1V43 A;  2VS1 A;  1VF7 A;  4DU9 A;  3J81 i;  5IYD H;  4KY5 A;  2Z1C A;  1Q1B A;  1PRT B;  4OEM B;  1PH8 A;  1CUK A;  4DV7 L;  1EWC A;  4DR2 L;  3NPP A;  3H0G H;  4C3H H;  3F2B A;  3S14 B;  4DV0 Q;  3T56 B;  3MEF A;  4CDD C;  4JPB W;  1SN8 A;  2ES2 A;  2QA4 A;  5EGT A;  1SFO H;  1QVG A;  1O7L A;  1SJH D;  4JI0 L;  4B3M L;  1T5E A;  1D8L A;  4A3F H;  1UWV A;  3UDF A;  3GTM H;  3S1R B;  1STE A;  2DN8 A;  1I50 B;  1SNC A;  3G48 A;  1I4Q A;  4F8M A;  2A6H C;  2F0V A;  4QL5 A;  4ILW A;  1EQQ A;  4OHJ A;  2ZTD A;  1PFM A;  1SSO A;  2F0P A;  1C0A A;  5ELB A;  1YIJ A;  3M4O H;  2F03 A;  1GUG A;  4IN3 A;  1CA5 A;  3HOV B;  2NTT A;  4DAV A;  2RDH A;  4A3E H;  1IBK Q;  4C2M B;  2Z9H A;  4EQ5 A;  5E4X A;  4IPC A;  4EX5 A;  1PTO H;  4RAU C;  2Q2U A;  4BA2 I;  1GOZ A;  4KJN A;  4A3C H;  4QY7 A;  4OO1 H;  4DR7 Q;  1E2W A;  1STH A;  4TQU S;  1IW7 C;  4NMZ A;  2JJQ A;  2E2I B;  2CHB D;  3GTL H;  4KLK A;  3I4O A;  3KF8 B;  1Q46 A;  1KIX A;  2NN6 G;  2EYO A;  1D5X C;  1FL0 A;  3BS1 A;  4DV1 L;  4R4C A;  2K5N A;  4LF8 L;  4DAP A;  4A93 H;  3GTO B;  2QCP X;  3K0X A;  5EQ0 A;  4LAA A;  4KKU A;  5KNC A;  2RKS A;  2A6H D;  2TMP A;  3D4R A;  2P5Z X;  4BWG B;  3T1H Q;  5FK9 C;  3WOF A;  3RUZ A;  4X3T A;  3I91 A;  1K83 B;  3RZO H;  1CKN B;  2WB1 B;  1SNQ A;  5KRU A;  1TXY A;  2OTJ A;  2Z4I A;  1IKL A;  3CQZ H;  1FNW A;  2F0D A;  3RLF A;  1NSN S;  1YNJ C;  3EIV A;  2A19 A;  1FVI A;  1QE6 A;  2C5C A;  3HOU B;  1A62 A;  5EKK A;  4ZQ3 A;  1F9R A;  1MGS A;  1GUN A;  1L1O C;  1IW7 D;  4C3J H;  1BCP F;  5DM6 3;  1VQG A;  4FF1 A;  2R92 B;  3I55 A;  2F0W A;  1D2B A;  1B9N A;  1SNO A;  1G51 A;  5FJ8 G;  1HQR D;  3HOZ H;  3R2T A;  4L6T B;  5DEH A;  3I90 A;  4POF A;  3E9H A;  4NPS A;  2MFI A;  4KJO A;  1PH2 A;  3NTH A;  4PG3 A;  3TQY A;  1JOO A;  1VQ9 A;  4JOI A;  4RCN A;  5A2Q L;  4QGU A;  5IYD G;  1QCB D;  2PZT A;  4A4I A;  3H15 A;  3H0G G;  5D3D A;  2EY1 A;  4C3H G;  4MIU A;  1F9P A;  3DWA A;  4RA8 A;  2VNU D;  3R93 A;  2OCE A;  1SLJ A;  3C1E A;  1Z6H A;  4MHE A;  5J3B A;  2R6G A;  4A3F G;  2R7Z B;  1VQN A;  1AH9 A;  1BXT A;  4JI1 L;  2KHI A;  4R4I A;  2VUM H;  5IYB G;  1R9T H;  2HDL A;  4RMF A;  1LAC A;  3PIP 3;  1OXU A;  1WYD A;  2XWB B;  4N9T A;  4DXG A;  1YNJ D;  5EPK A;  3J81 c;  4M1U B;  2CCZ A;  4JI4 L;  2JQO A;  2OQK A;  3DEO A;  5C3X A;  4IFD H;  1PTO D;  2NB0 A;  3T4A C;  3PO3 B;  2M2L A;  2HQL A;  1QVC A;  2B2T C;  4PZ6 A;  4A3E G;  3K7A H;  3F2U A;  5M5W B;  1ONL A;  2I5M X;  3DMU A;  1VQM A;  1OXX K;  4JCV E;  1PDQ A;  4LF5 L;  3NTK A;  2EXZ A;  3MZ5 A;  4OO1 G;  1Q82 C;  1EY5 A;  4LF7 Q;  1QUQ A;  2N55 A;  3OOC A;  3F1Z A;  1HFN A;  4QJF A;  2MUY A;  3FHW A;  4BY1 H;  2ID0 A;  3FKI H;  1F9Q A;  1PZI D;  1EY4 A;  1J9O A;  3J80 i;  1IZ6 A;  1EWH A;  4I65 A;  3S14 H;  1QB5 D;  3PIO A;  5E7N A;  4E6I A;  4BXX H;  5K36 H;  1YI2 A;  4A93 G;  2XTI A;  4R4T A;  1IXR A;  2NVY H;  1HR0 W;  5C4X H;  4R9W A;  2L4N A;  2CW0 D;  2F0N A;  1DJR D;  4C1N K;  3S17 H;  1W6K A;  3J7A V;  1DZ1 A;  4QQB X;  4DK0 A;  5LL6 X;  2HUG A;  1B44 D;  1PV4 A;  3TSS A;  1A2U A;  1LTR D;  3W2D A;  3OW2 A;  4JI2 L;  2D0P A;  1BR9 A;  2F0Q A;  2KOL A;  3K5L A;  4DR5 Q;  3IRB A;  1HNW L;  1OXT A;  2QIL A;  2L9H A;  4X64 Q;  1SJE D;  4LF8 Q;  2E2D C;  2C35 B;  2OXP A;  2AUK A;  1XYI A;  5ELN A;  1VQA A;  3CAM A;  4C3J G;  3U9O A;  5C3E G;  1HRJ A;  3QWN A;  2NN6 I;  2CQO A;  1U4P A;  4DR1 L;  4CKE A;  2AQ2 B;  5K5P A;  3HOZ G;  1N36 Q;  2Y0S G;  3NQI A;  3S1N H;  1TU2 B;  1MBY A;  1PRT C;  4A3J G;  4GN4 B;  1I6H B;  2PNH A;  4JV5 Q;  4FXK C;  5EKI A;  2KBN A;  4QF4 A;  2QEJ C;  1E3P A;  2UUC Q;  1BDO A;  4RGO S;  4FNF A;  2LFN A;  3U58 A;  4K0K L;  2JA8 B;  1K8M A;  2I0Q A;  1TWA H;  2Q2I A;  2IWH A;  3RNU A;  1YJN A;  1VQJ A;  2K1B A;  4TVA B;  2EYP A;  3FPU B;  3MXN A;  2VQE L;  3PV0 A;  2CVR A;  2VUM G;  3BYY B;  1ILQ A;  1X6O A;  1GM5 A;  1FYC A;  4XT3 B;  5C5L A;  2B2V C;  1PXU A;  1G29 1;  1G2S A;  2PQE A;  3GTK B;  4JI3 L;  4JI5 L;  2L0C A;  2OT2 A;  4IFD G;  2NTS A;  4JI7 Q;  1HNX Q;  2F4I A;  2B2Y C;  4RGT A;  2O5I C;  1TS4 A;  1JJG A;  3MWY W;  1I6V C;  4B3M Q;  4LF6 L;  4LFB Q;  2RSO A;  2D9U A;  3KJO A;  1HZC A;  5GQO A;  4Q5V A;  3PF5 A;  1PRT D;  5D3I B;  4GN5 A;  3QO2 A;  2BH2 A;  4A3G H;  4JI1 Q;  4X62 Q;  1LTT D;  3I8Z A;  4TRD A;  3OPO A;  1HUN A;  3KLS A;  4BY1 G;  4EQP A;  4OWW B;  5IGD A;  2Q2H A;  4PV1 C;  1HXY D;  4A76 A;  1Q1E A;  1EY9 A;  3I4M H;  4JI4 Q;  4UHV A;  1E2Z A;  2B2U C;  3K80 C;  4F88 A;  3BG3 A;  4KMU C;  1N33 Q;  3URY A;  1EYD A;  1XNR L;  4BXX G;  5IGG A;  3BZC A;  1GHJ A;  4JI6 L;  2VXW A;  3AMU A;  5C4X G;  2X69 A;  1OTC A;  5I6W A;  3QG1 A;  2H1E A;  3KK7 A;  1EY6 A;  5ELO A;  3CC7 A;  5EPL A;  4XTC S;  3SVM A;  5FO7 B;  1HR0 L;  4X65 L;  4LWC A;  2YV5 A;  2BA0 A;  4AQY Q;  1U4R A;  2Q8T A;  4H02 A;  3RLN A;  3J80 c;  1TWH H;  1RHP A;  4OO1 I;  2V4D A;  4K8I A;  4X6A H;  3GTQ B;  5IT9 L;  4A3M H;  1DON A;  1S5F D;  2XIW A;  3T13 A;  4FF3 A;  2RCF A;  1TWG B;  2E76 C;  1A8V A;  1STY A;  4A3B H;  1CT1 D;  1GUT A;  5M3M B;  1E7Z A;  1B3A A;  4HR7 B;  2A68 C;  3K81 C;  4X3S A;  3T1Y L;  1K0S A;  2XRS D;  2LSS A;  4OEL B;  4RGN A;  2YTV A;  2G9H D;  3PUZ A;  1VQC A;  2R7F A;  3K5N A;  1X9N A;  4JI2 Q;  2F4V L;  2Z6K C;  3R8B A;  1LT3 D;  1JOQ A;  1C9O A;  3FDT A;  1LM0 A;  3NEM A;  3Q22 A;  1G6P A;  2FHT A;  1ML0 D;  1CHP D;  2E2H B;  2EY2 A;  3TP5 A;  1U9R A;  3Q23 A;  4DR1 Q;  4IFD J;  4GLA C;  2K52 A;  1A2T A;  3PUX A;  5IT9 E;  2I5H A;  1E1T A;  1GXD C;  4DV0 L;  1WTX A;  3HKZ B;  5IY0 A;  4K5V A;  5LMU Q;  2A8V A;  1B4O A;  2FIN B;  1PH3 A;  2K28 A;  1JCK B;  4N8F A;  1MJE A;  3PGZ A;  4HJ9 A;  2R93 H;  1RIP A;  3FVQ A;  1CSQ A;  4UPA A;  4APV A;  3I70 A;  4J1M A;  1EFI D;  4NXM L;  4IUR A;  1MI2 A;  2PYK A;  2CFM A;  1TQO A;  2A68 D;  4G4K A;  1GJX A;  3CC4 A;  4LF4 Q;  1LTG D;  1Y1V B;  5IP9 G;  1TWF B;  4GNX B;  1X32 A;  2K03 A;  2K5H A;  4JC0 A;  1GUO A;  2VQE Q;  4A3G G;  1RL2 A;  4WRD A;  1CM9 A;  1YBY A;  1EEF D;  3SK4 A;  2HQE A;  2RSN A;  1E0B A;  2C9O A;  2K5V A;  4FP5 D;  2MNA A;  2J4X A;  3LX0 A;  2L55 A;  4FF2 A;  5JPN C;  3I4M G;  5KYL A;  4HCS A;  4X66 Q;  5CV9 A;  3FPP A;  2DY7 A;  3MXP A;  1CKN A;  2RDF A;  1MKH A;  5CV6 A;  1ICW A;  1VQ5 A;  2SDF A;  1WJJ A;  3PO2 H;  4IFD I;  3S9W A;  3RN5 A;  2F3V A;  3C46 A;  1STG A;  4RH6 A;  3OMC A;  4LFC Q;  3DUZ A;  1QNU A;  2JN4 A;  1PFN A;  2A6E C;  3K5O A;  4HMJ A;  1K3B C;  4K14 A;  3U50 C;  1N32 Q;  5GAH C;  1J6Q A;  2N3S A;  3UI2 A;  3GV6 A;  3HKZ E;  4L8J A;  1HJP A;  4PZ8 A;  5FO8 B;  3MHB A;  4BBS H;  4BY7 B;  4A3M G;  4X3U A;  1SE8 A;  3E3X A;  1N8R C;  3T1H L;  1XNR Q;  2PQA B;  3AYH B;  3A7A B;  2MGS A;  3UE1 A;  3CRK C;  4DV4 L;  4A3B G;  1EIG A;  1BUV T;  1CQF A;  1H9K A;  4KV6 A;  2JA7 H;  1S5D D;  2FMM A;  1KHI A;  1XJV A;  1TS3 A;  1IBL Q;  4L5R C;  3TDQ A;  4M8A A;  3C1F A;  3NP8 A;  4QB4 A;  5C3E B;  2TSS A;  2I46 A;  1TWC B;  1V8Q A;  2ENB A;  3HKS A;  1JC7 A;  2UXB L;  3RZD H;  1EL0 A;  1J5E Q;  4ME5 A;  1BO0 A;  2IJ0 A;  4FXG C;  3NBH A;  4NW2 A;  2NVT H;  4CJ0 B;  2Z6B A;  2F3I A;  3RMH A;  1SE2 A;  5FLX L;  3KF6 A;  4A3L G;  1FR3 A;  2EVB A;  4G7H C;  2HIX A;  4LUV A;  1QIL A;  2F0M A;  1SE4 A;  2A6E D;  2RDG A;  1LV9 A;  4BS9 A;  4ODG A;  4DNI A;  3BDC A;  3TRE A;  5F2D A;  3S1M H;  2ALY B;  2R93 G;  3D3R A;  3AU7 A;  1O78 A;  1FNV A;  2F4V Q;  3SHL A;  1NY4 A;  1YHQ A;  3D6W A;  5I6Y A;  1M8A A;  2EYL A;  2ZJP A;  4FF4 A;  2WAQ G;  1KLG D;  5E4W C;  5EPJ A;  1WD1 A;  1PH9 A;  3J7A 5;  1VQK A;  4A3I G;  4MTK A;  1EFW A;  3I4N B;  2SEB D;  3DXJ C;  4IAL A;  4CBV A;  2XVS A;  1BF4 A;  3H09 A;  3H94 A;  1JWU D;  4J15 A;  2UXC L;  2EIF A;  4KHZ A;  1A15 A;  1WCM B;  4LUZ A;  3F8T A;  1I3Q H;  1EU4 A;  5FLX E;  1Q81 C;  3E9I A;  2IX0 A;  1JB7 A;  1EWI A;  1IL8 A;  1O7I A;  3W1G A;  3NUC A;  1Y1W H;  1L0W A;  1EU3 A;  2GVA A;  1XWE A;  2UU9 Q;  4LF7 L;  5C44 B;  3S2D B;  1GHK A;  2EY6 A;  4NXM Q;  1K8O A;  2OF1 A;  4LFA Q;  4LF9 L;  2F0G A;  3I3C A;  3SE0 A;  1EUJ A;  3PO2 G;  4ZUI A;  3OMG A;  4DV5 Q;  1UEB A;  1LT4 D;  1G91 A;  2JA6 H;  5AFW A;  5ELF A;  5LHY 1;  1E22 A;  4IOC A;  1RF2 D;  1TY2 A;  1LAB A;  3VR5 A;  1WTV A;  1XTC D;  2G9D A;  5CC4 A;  4GOP A;  2ZJR A;  1HCZ A;  3AFQ A;  3PMF A;  1I4X A;  2B2W A;  2NYZ D;  1BBX C;  1M4V A;  4DR3 Q;  1KQS A;  4BBS G;  3K0Y A;  1IL2 A;  1JOR A;  3ONA B;  3JAM i;  1KD1 C;  3GTJ H;  1RKN A;  1K3R A;  1G6Z A;  1TWF H;  3RLO A;  4S3S A;  3SK8 A;  3R2I A;  1VQP A;  3MFG A;  2VW9 A;  1R4Q B;  4DR5 L;  1WTW A;  1LT5 D;  2B63 H;  3HOW H;  2MPM A;  3QOL A;  1UE1 A;  1B53 A;  4B9X A;  4DUZ L;  2JA7 G;  3MXG A;  4X64 L;  2JA5 H;  3I4L A;  4K2K A;  4X3K A;  2DY8 A;  5C0X H;  3RN2 A;  4ZRZ A;  2K32 A;  4GKJ L;  4AYB B;  5A35 A;  1LLR D;  1KXL A;  1O7Z A;  3GQB A;  1U5K A;  1Y8N B;  5M5X B;  1V1P B;  1I4R A;  1JMC A;  4IPG A;  3HOX B;  1PRT F;  3GV3 A;  1N36 L;  4BBR B;  2RVL A;  1PLF A;  1XTD A;  2E75 C;  4UP9 A;  2PZU A;  4DV4 Q;  2K01 A;  3DM1 A;  5FLM G;  4FYD A;  4JV5 L;  3CCU A;  3P1H A;  1L0Y B;  2UUC L;  2EYF A;  1B50 A;  1H95 A;  1KC8 C;  4UY8 C;  3DLL A;  3TEH B;  2BE5 C;  2QW7 A;  1KRT A;  4V0B A;  5IGE A;  1H9S A;  1R4P B;  5FO9 B;  2KEN A;  2IY5 B;  1NR4 A;  3TS2 A;  2UXB Q;  3GTG H;  1Y8P B;  2HHH Q;  2WKC A;  2E74 C;  1CSP A;  3E0E A;  1KAW A;  4WJW A;  4C3I G;  4H7B A;  5C3W A;  4JVZ A;  1I94 Q;  1HHV A;  1SYD A;  4GNX C;  1EYA A;  1NE3 A;  3OHX C;  3CD6 A;  1DOL A;  3VA5 A;  2XNA C;  3MXU A;  3PIP A;  2NVQ B;  1SYE A;  4JI7 L;  1HNX L;  3H3V C;  3CME A;  5DM7 3;  1TWC H;  5J39 A;  1QJO A;  1VQ4 A;  2KVM A;  4DAY B;  5BR8 Q;  4ID6 A;  1Y1W G;  4LFB L;  5I9P A;  1Q7Y C;  3F2D A;  3QB3 A;  2D2C C;  4A3D H;  4X62 L;  3A55 A;  4AYB E;  3AEV A;  1YNN C;  4DPG A;  2FFK B;  4JYA L;  2MHV A;  2RHQ B;  2YTX A;  3N52 A;  1KNE A;  1MSG A;  3CC2 A;  5IP7 H;  5JJK A;  1Z7T A;  3OWF A;  2NZO A;  2WFW A;  4G7O C;  3ZYY X;  2BE5 D;  2UXC Q;  5HUR A;  3K58 A;  1WTP A;  3M3Y H;  4A3K B;  2PI2 A;  4MTN A;  1N33 L;  2JA6 G;  2PO4 A;  3TME A;  1N9W A;  3HOY B;  3J81 L;  1W2B A;  3KOJ A;  3MFY A;  4RHR A;  4WFN 3;  1ET6 A;  5IYC H;  1Y14 B;  1IKM A;  3H91 A;  3V96 A;  5KNB A;  4WJ3 M;  1B2T A;  1QOH A;  4HJ7 A;  1UE6 A;  4A3C G;  2XRQ D;  1PH1 A;  4AH6 A;  1JT8 A;  4HID A;  1AE2 A;  5AJ3 Q;  3G4S A;  1C7Y A;  1STA A;  1EY7 A;  1HPC A;  5DLQ E;  4AQY L;  3Q6S A;  1EYC A;  3CPF A;  1CK1 A;  4YWL A;  2Z0S A;  2A1A A;  1VMP A;  2LMC B;  1B3Q A;  1WCM H;  1NBW A;  3KLW A;  4LF9 Q;  2B63 G;  3HOW G;  3L3O C;  3X3M A;  3X3N A;  1TVX A;  3ERQ A;  3S15 B;  4ZUJ A;  3VYT A;  1STB A;  3PSI A;  5LL6 S;  4DV2 Q;  5ELE A;  5E1F A;  1EY8 A;  3P7J A;  3V2T A;  3HS0 C;  2Q8I B;  4PMW A;  2ZJQ A;  4K2L A;  3A8J E;  2HIV A;  1QG7 A;  5C44 H;  3S1R H;  2QKI C;  1D5Z C;  1I50 H;  5CYU A;  1K73 C;  1E24 A;  3C3L A;  3JAM c;  2N8N A;  3UDG A;  4RFB A;  5CR3 A;  3ND9 A;  3J81 E;  1SBB B;  1ZEQ X;  3EJI A;  3NHH A;  1JJC B;  1K8G A;  5C4J B;  4OWT B;  2I07 B;  1YZ6 A;  1QWY A;  1Q86 C;  1VQF A;  3HOV H;  1L1O A;  4C2M H;  2HCC A;  3TN2 A;  1TII D;  3ICE A;  4DUZ Q;  1F2Z A;  3A7L A;  2ASB A;  2A73 B;  1A3V A;  3OW7 A;  5I4D A;  2F0J A;  4U67 3;  2UUB Q;  5JJZ A;  4KHV A;  4UP7 A;  2F0E A;  4GKJ Q;  1I4H A;  1SNM A;  2BDO A;  5JEA H;  1IYU A;  2E2I H;  3PIO 3;  3EN2 A;  1ESR A;  1SRO A;  1X3Q A;  1IYJ B;  3GTP B;  5LMU L;  4DR4 Q;  1VQ7 A;  3AB9 A;  3CW2 C;  4HJ8 A;  3ITP A;  1HH2 P;  5CMD A;  4ZYS A;  1CA6 A;  1UNS A;  1TY0 A;  1FD7 D;  3GTO H;  5GAG C;  4A3I B;  1WTR A;  2VB2 X;  3LWE A;  5M3F B;  1Q8I A;  3VR4 A;  4CJ2 C;  4CDE C;  2L11 A;  4LF4 L;  1SYF A;  2GA4 B;  2K5D A;  2YU9 B;  1YEZ A;  2IHF A;  3CCV A;  4JBK A;  4A3D G;  2MJ8 A;  2N78 A;  1V1O A;  4CKC A;  2ATW A;  3LNN A;  5IE8 A;  1K83 H;  3KDF A;  2B2T A;  5J22 A;  5T1G A;  5JVG 3;  5IP7 G;  3M4Q A;  4B3T Q;  5KND A;  1NAP A;  3CU7 A;  2L1B A;  3KUP A;  5COR A;  2H4O A;  4DF7 A;  4X66 L;  3HOU H;  4KY7 A;  4PZ7 A;  3EQL C;  4HTH A;  3A5Z B;  3ZJY C;  2CQA A;  3Q24 A;  3Q8D A;  2CWP A;  5IYC G;  2R92 H;  3J7A F;  1S5B D;  4FVM A;  2DNE A;  3SEB A;  3CP0 A;  3T16 A;  4GLX A;  1U0L A;  4IPH A;  4CJ1 B;  1PH7 A;  4BA1 I;  3S1Q B;  2B8F A;  2SOB A;  1II3 A;  4LFC L;  2PPB C;  2LXJ A;  1CKM A;  1G8Z D;  2IX3 A;  1A0I A;  3NTI A;  5ISR A;  1FJG L;  4JYA Q;  1EQR A;  2CH4 W;  3FKI G;  2NVQ H;  1Q8K A;  1DOM A;  5CV4 A;  4B08 A;  1N32 L;  2NZ1 D;  2IHE A;  3CMA A;  3WOE A;  2N49 A;  1UEA B;  3TZD A;  3VR6 A;  4LJZ C;  4R4Q A;  1EIF A;  3CHB D;  1LTB D;  4EQO A;  2AHO B;  5K36 G;  3K5M A;  4XXE A;  1UE7 A;  2R7Z H;  4DAM A;  1HTP A;  3UDX A;  2OEO A;  5M5Y B;  4JK1 C;  1B7Y B;  4IJL A;  2VB3 X;  3MAQ A;  4XDX A;  5KEE A;  4IQZ A;  3KBX A;  5HY6 A;  4LMQ D;  2NVX B;  4DA2 A;  1IBL L;  3PCO B;  4YHH L;  2K4K A;  3DWP A;  4DUY Q;  1XPO A;  4OIJ A;  2K75 A;  4A3K H;  4ZKC B;  2F3W A;  3PO3 H;  1X54 A;  1WVL A;  4XQJ A;  1J5E L;  3HOV G;  1Z9F A;  5M5W H;  2F0K A;  3J80 L;  1S40 A;  4NXN Q;  3VYR A;  1OXS C;  1S4Z A;  2OQ0 A;  3NEL A;  2JE6 I;  2ICE C;  2UXD Q;  5JEA G;  4RHS A;  1HNZ Q;  2B8G A;  3OIQ A;  2B39 A;  4C1N I;  5JOB A;  5CV5 A;  2XSC A;  3OYY A;  1B9M A;  3GP7 A;  3ER0 A;  4H13 C;  3S15 H;  1VDZ A;  2F0U A;  5BN5 A;  5IIF A;  4UAI A;  3A5U A;  3E6Z X;  2K6A A;  4R8N A;  4N9P A;  1Z47 A;  1IHZ A;  2Q8R E;  2KCT A;  2M9V A;  4V19 0;  4XQN A;  1N34 Q;  3A74 A;  3FEW X;  1V9P A;  2B2V A;  2GN5 A;  3D31 A;  1QUQ B;  5EKL A;  5JPM C;  1VQH A;  3H0G B;  1MSH A;  4C3H B;  1C48 A;  3NXW A;  3LGJ A;  1SE3 A;  3J80 E;  1NMG A;  4FDB A;  5IOD A;  3BVZ A;  4XQQ A;  4K8J A;  4O42 A;  2B2Y A;  1S3O A;  2WB1 G;  1SFO B;  3TRZ A;  1SMX A;  2JP1 A;  5GAD C;  4P75 A;  5TSS A;  1ENA A;  4A3F B;  5LMN W;  1YNX A;  1VQB A;  4F7X A;  4RG1 A;  3GTM B;  3HOU G;  2UU9 L;  5FOB B;  5C6A A;  3NWS A;  4RKL A;  1KRS A;  1GKH A;  3QIA A;  1AN8 A;  2IPK D;  3KF8 A;  5I2X A;  1M1K C;  2R92 G;  4IUU A;  4LFA L;  1RJT A;  3M4O B;  4IPD A;  1XMQ L;  2K05 A;  2KHJ A;  4DV5 L;  4DK3 C;  4A3E B;  1J8I A;  4B3S Q;  2B2U A;  2YYZ A;  2AKW B;  4UDU C;  2R7D A;  4GKK L;  1I6H H;  1PTO B;  1VQ8 A;  4XYO A;  2AMC B;  4L5T A;  1AEX A;  1AZP A;  1QZG A;  1OXV A;  4JI8 Q;  4DR3 L;  2KUM A;  5I2Y A;  1EQV A;  2JA8 H;  4KKT A;  3C2P A;  3GTL B;  1XMO Q;  2VQF L;  1SND A;  1MHW C;  1WTH A;  4CDC C;  5J1Z A;  2K5W A;  3G6J B;  3M7N A;  3KBG A;  3I72 A;  1ILP A;  2CWA A;  2VL6 A;  5KGU A;  2K04 A;  5C5M A;  3UDI A;  4KK7 A;  1X65 A;  4L5S A;  3OWE B;  3VA7 A;  3DWQ A;  4DR6 Q;  4A93 B;  1DXM A;  3GTK H;  2EYH A;  2JXM B;  1FJG Q;  1B8A A;  3FRP B;  3Q0A A;  3TZU A;  3PO3 G;  1ZYR C;  4WJ4 A;  4ZLT F;  5JEA J;  4YCV A;  2RHS B;  2IL8 A;  2JEA I;  3L0O A;  1VQE A;  1OO9 B;  3KJP A;  3MEH A;  3OTO Q;  2UUA Q;  4G57 A;  3MXN B;  3RZO B;  2X6G A;  2EJM A;  3CQZ B;  4O0A A;  2PW7 A;  2Z6K A;  2EE1 A;  3S16 B;  2IW3 A;  2DGY A;  2WKD A;  5IGC A;  2GVB A;  4F87 A;  1T5X D;  1ESF A;  4O2D A;  4ULL A;  4YHH Q;  4C3J B;  3CCL A;  4HIM A;  3BYT B;  1TKW B;  5ELD A;  4RCO A;  1F9S A;  2E2J B;  2HHH L;  3MVV A;  3HOZ B;  1V1Q A;  1PA6 A;  1NNX A;  5HGQ A;  2Y0S B;  5C4Z A;  5M5Y H;  1I94 L;  4L63 B;  4Q0F A;  1DM0 B;  4A3J B;  3E0J A;  4TKO B;  1ENF A;  4PMC A;  1G2T A;  2LKV A;  2NVX H;  2SNM A;  1A3U A;  1VQL A;  2EY5 A;  2KA7 A;  2K33 A;  4A75 A;  1AFP A;  4P2C B;  1WOC A;  1ZYR D;  1CZW A;  2KCM A;  4RWS C;  1JR0 D;  1X56 A;  4CDF C;  3K59 A;  2PCF B;  3CCJ A;  2PMZ B;  5BR8 L;  2BA1 A;  4LNQ A;  3KFU A;  4HAE A;  1ET9 A;  3GTQ H;  3NK9 A;  2F0S A;  2VUM B;  1TWG H;  2A74 C;  4IZ8 A;  3SXH A;  3BDO A;  1DGS A;  3M9B A;  3TP6 A;  1KLU D;  3S2H B;  5M3M H;  5LMN L;  3BZK A;  3S24 A;  3D8G A;  3IFD A;  4RGM A;  5DAU A;  2WII B;  1MJC A;  5GAE C;  3J7Y W;  4K6D A;  4XYQ A;  1FGB D;  3BZD B;  2FJ2 A;  2NWG A;  5FJ8 H;  2Q2T A;  3L7Z C;  1KDC A;  5HGT A;  3QR8 A;  1GUW A;  5AJ3 L;  3FP9 A;  1KAB A;  1E1O A;  2JA8 G;  2L12 A;  2KEE A;  3CRL C;  2E2H H;  4BY1 B;  1IBM L;  1CHQ D;  3DHQ A;  3FKI B;  4IUP A;  4MN3 A;  1BQQ T;  1ICF B;  1SXT A;  4RKB A;  2Y0S E;  2B3G A;  3HEJ A;  1XMQ Q;  1RCV D;  2AQ3 B;  4JOI C;  1TS2 A;  2EDG A;  4DV2 L;  1XNQ Q;  4YWM A;  1HUM A;  1ASY A;  1WTQ A;  2NVY B;  3EBE A;  5C4X B;  2X6L A;  1AZQ A;  3BVG A;  4GKK Q;  2OTL A;  2PW5 A;  5IYB H;  1CI3 M;  3CCR A;  3S17 B;  3MTS A;  4G7Z C;  2PMZ E;  1BCP B;  3NBI A;  4DXF A;  4DV6 Q;  1EIH A;  4QUC A;  5CV7 A;  1Y1V H;  2VQF Q;  1HZA A;  4JW0 A;  2E8G A;  2F0I A;  2NZH A;  1D1I A;  1L2F A;  1DCZ A;  3NSW A;  4DV3 L;  1ENC A;  1I4G A;  3D6C A;  2D0O A;  1D7Q A;  1RDP D;  3H3V H;  2RA4 A;  4QIW B;  4HJA A;  2UUB L;  5H1S E;  4ABN A;  1HQM C;  1HZ9 A;  3U4V A;  1I4P A;  1U4L A;  1GUS A;  4QUF A;  3M7G A;  1MD2 D;  2XWJ B;  4Z9C B;  4ZKB B;  1GO3 E;  1LO5 D;  2K5Q A;  4DR4 L;  3R3O A;  4CGY B;  3S1N B;  4CHT B;  1RTN A;  3B6Y A;  4P74 A;  3AQQ A;  3P75 A;  5ELC A;  1SR3 A;  1LYL A;  2G5D A;  3TP8 A;  4EGV A;  3PUY A;  1ZXT A;  3IFT A;  1KTK A;  3ULP A;  2LY7 A;  4NB3 A;  1TWA B;  3G71 A;  1D6E C;  2DJG C;  4YWK A;  1QVF A;  2A69 C;  4BY7 H;  2ZXO A;  1JOK A;  2O4X A;  4OON A;  1JE5 A;  2QEX A;  1S72 A;  1BBU A;  4KD3 A;  4DK1 A;  5M3M G;  2LS0 1;  4B3T L;  2EOT A;  4CKB A;  3S16 H;  2K50 A;  2XN9 C;  1PZJ D;  2BCO A;  2QGQ A;  3H6M A;  1U4M A;  4R8I A;  3M4Y A;  2EYM A;  1Y69 U;  4PQX A;  1PTO C;  2AUJ D;  4K5X A;  5C3E H;  1K9M C;  3K57 A;  2ZM6 L;  1JWS D;  1WI5 A;  2F0F A;  2E2J H;  2VY3 A;  5E3F A;  2R3Z A;  1HA6 A;  2ZTE A;  1X3P A;  4K5W A;  4GLV B;  3ULJ A;  4L5Q A;  1VMC A;  1Q90 A;  2N88 A;  1EOV A;  4A3G B;  4QIW E;  3W5O A;  3ULL A;  4A3J H;  3VR2 A;  3P20 A;  4R4O A;  3SGI A;  1UE5 A;  1AP0 A;  1YHA A;  5NUC A;  5LMN Q;  2IX1 A;  4HSP A;  1KAA A;  3I4M B;  2M00 A;  1EQT A;  1B1Z A;  4QMG A;  1F2Y A;  3HKZ G;  2OWO A;  2F0O A;  2A69 D;  1PYS B;  4ALP A;  4GZY C;  3G7L A;  3HG9 A;  3LWU A;  2E5L L;  3BDL A;  1PFB A;  3NBH B;  4YIJ A;  4MNO A;  3L9A X;  1YJW A;  2CW0 C;  3OSO A;  4Y7N B;  3PUW A;  5IGB A;  2JEB I;  3I4N H;  3S2H H;  1O7Y A;  3KF6 B;  4DFA A;  1LT6 D;  3D4D A;  1GVP A;  1JE4 A;  3BVM A;  3VDY A;  3KLR A;  4HCE A;  4IO9 A;  1IBM Q;  1Y1V G;  2B29 A;  2ZXR A;  1TWH B;  4DUY L;  2RBM A;  4DV7 Q;  4DR2 Q;  3I56 A;  4IJH A;  1M90 C;  2WB1 E;  2MP1 A;  5JVH 3;  4JBW A;  4A3M B;  3RD4 A;  3M4P A;  1PH6 A;  4NXN L;  3PUV A;  2JA5 G;  5A2Q E;  4JI0 Q;  3J81 j;  2AQ1 B;  1PMR A;  1EEI D;  1SYG A;  3QJY A;  5C0X G;  4IUV A;  2CKZ B;  2KJX A;  4A3B B;  4KI0 A;  2QF7 A;  1YNN D;  2RF4 A;  4ZK9 B;  2UXD L;  1K28 A;  4DK6 C;  3S2D H;  5EAY A;  1HNZ L;  4KHP Q;  1HA5 A;  1CQV A;  2F0L A;  4GN3 B;  4P72 A;  2R61 A;  3SDZ A;  2LXK A;  2EJF C;  1LTA D;  3BJU A;  1NTG A;  3JAM L;  1JQY D;  3A8I E;  3L2P A;  4DV3 Q;  4YCW A;  2YTY A;  1X3E A;  1Y8O B;  3MC0 B;  3NQT A;  4O1N A;  2F1M A;  3A8K E;  3U9S A;  1PH5 A;  1SYC A;  2CH4 A;  4B9W A;  4YCU A;  1N34 L;  2WV6 D;  1I5F A;  4GNX A;  4BY7 G;  4NP5 A;  3U4Z A;  4TSS A;  2DUD A;  2KHS A;  4J8Q A;  1TS5 A;  3DEP A;  5EBD A;  4GS3 A;  1SNP A;  3CPW A;  1TR5 A;  2MO0 A;  4LK1 C;  4HN7 A;  2EXD A;  2R93 B;  1VF5 C;  4DV1 Q;  3NWT A;  4Y52 H;  2AWO A;  3BU2 A;  1Q12 A;  1SMY C;  2WAQ B;  3KLS X;  1A3T A;  4K6L A;  4AIM A;  4GOP B;  4KHP L;  1FGU A;  3JAM E;  1EY0 A;  5M5X H;  4OL7 A;  3HOX H;  1NUC A;  3CCS A;  1EIY B;  2ZT9 C;  2HCI A;  4BBR H;  2Z8L A;  4B3S L;  3K8A A;  1L0X B;  2JA9 A;  5KIX A;  1W3S A;  1ROD A;  3A56 A;  4C56 C;  5EBC A;  4JI8 L;  1BNZ A;  4POG A;  1VQI A;  5COY A;  2PQA A;  3T51 B;  1XMO L;  2ZM6 Q;  4OGQ C;  1F2L A;  3G6E A;  1ZKO A;  1BCP C;  4I7A A;  1LUZ A;  4YY3 L;  1SYB A;  3PO2 B;  2ZTC A;  3SK6 A;  1JIC A;  3I4N G;  1NMF A;  4KTA A;  5JAV A;  4DR6 L;  2EPB A;  2NUC A;  4OIK A;  1SMY D;  2D62 A;  3EVQ A;  4XIG S;  4NKL A;  5C0X J;  3SR1 A;  2F0T A;  3ERS X;  1WCM G;  4BBS B;  1AW7 A;  2EZV A;  1QZH A;  3I2Z A;  1PVO A;  2KCC A;  3HP3 A;  1KDA A;  4P73 A;  5IP9 H;  3OTO L;  1H9S B;  2UUA L;  3T53 B;  2WAQ E;  2E5L Q;  3W1B A;  1A63 A;  2XGT A;  5C44 G;  1XX8 A;  3TS0 A;  3HRZ C;  2JA7 B;  1KDB A;  1F77 A;  5D65 A;  2KCN A;  4IUQ A;  4DNT B;  2O5J C;  1CFM A;  5G3L F;  1A6X A;  3CXC A;  5IOC A;  4IUN A;  4KY6 A;  4IUT A;  1EYG A;  1EZ6 A;  4IOA A;  3RZD B;  5JJL A;  1VS0 A;  3VYS A;  1NJI C;  4OX9 L;  3V05 A;  3A54 A;  1CZG A;  2NVT B;  4JBM A;  1BKB A;  3HOY H;  1LTS D;  1BCP D;  2KQ3 A;  4KN4 C;  5C4H A;  1BOS A;  4R1J A;  3SK5 A;  3K7U C;  5FKA C;  4HIO A;  2FMC A;  4LF5 Q;  1WFQ A;  4HJ5 A;  4EVO A;  2HD3 A;  4Y7N H;  3M85 A;  5GRO A;  2JK8 A;  3VR3 A;  3A0J A;  2RQX A;  1P16 A;  1YJ9 A;  2I5L X;  4WOR A;  5IT9 c;  1PHJ A;  3O13 A;  3H3V I;  4DKA C;  3E5S A;  1WD0 A;  1CTM A;  3S1M B;  1H9R A;  2F52 A;  4I7Z C;  1KL9 A;  5C0X I;  2BH8 A;  5IWA L;  2JSO A;  3GD7 A;  1VQD A;  4HSV A;  4U68 A;  2EJG C;  3WWV A;  4C3I B;  2K7V A;  1X3F A;  4AYB G;  3WDN A;  2VZA A;  2RCN A;  4JBJ A;  3HOX G;  2H5X A;  1CKO A;  3KYH C;  1SDF A;  4BBR G;  4B3R L;  5C4J H;  1I3Q B;  3CCM A;  4MZ9 A;  5M9O A;  1YHB A;  1Y1W B;  1HNW Q;  4LUO A;  3IKJ A;  3IAY A;  1XXG A;  3OIP A;  5CGK A;  2K14 A;  2MO1 A;  4A3L H;  1O80 A;  2QDB A;  4J6H A;  4JG2 A;  3EA6 A;  5JJI A;  2DJF C;  1C4Q A;  2WAC A;  1JWM D;  2F0H A;  1YVC A;  1SRU A;  2WP8 J;  1DYQ A;  3GTP H;  4UP8 A;  1XPU A;  2JA6 B;  5BN4 A;  1JB3 A;  1VQO A;  1UAP A;  1W6J A;  2NBF A;  3J7Z C;  1XNQ L;  2BDN A;  4PMB A;  3VYU A;  2J0T D;  3PQI A;  5L37 A;  3CF5 A;  2V1C C;  1L1O B;  4PNY A;  1PH4 A;  2QDL A;  4A3I H;  1STN A;  4KN7 C;  1V1P A;  4K0K Q;  5M3F H;  3N6R A;  4FXD A;  4DV6 L;  3GTJ B;  1VQ6 A;  1D5M C;  2PI2 E;  1WTO A;  3ERO A;  4H0L C;  4DGZ A;  2YU9 H;  2L15 A;  1QNK A;  3QOJ A;  3GDE A;  3DM3 A;  3JC6 6;  2R7Z G;  2JYO A;  1IBK L;  1P8L A;  3CKI B;  2B63 B;  3HOW B;  4YY3 Q;  2MQH A;  1Q3L A; 
#chains in the Genus database with same CATH homology
 3EBE A;  4HJ7 A;  1UE6 A;  4A3C G;  4GKK Q;  1PH1 A;  4AH6 A;  2OTL A;  4HID A;  1AE2 A;  1JT8 A;  1K0R A;  4JI3 Q;  4BY1 G;  5IYB H;  5AJ3 Q;  3PF4 A;  4OWW B;  3G4S A;  3CCR A;  4JI5 Q;  4DR7 L;  2Q2H A;  1C7Y A;  1PFS A;  4A76 A;  1Q1E A;  2PMZ E;  5DLQ E;  4AQY L;  4A3K G;  1XPR A;  3I4M H;  3CPF A;  4YWL A;  4JI4 Q;  4DV6 Q;  2Z0S A;  3STB C;  2A1A A;  3K80 C;  3HOY G;  1WCM H;  3RR5 A;  1N33 Q;  1NBW A;  3KLW A;  3GO5 A;  1Y1V H;  4LF9 Q;  1XNR L;  2B63 G;  3HOW G;  2VQF Q;  3NEN A;  2HT1 A;  4BXX G;  4LF6 Q;  1HZA A;  2FXQ A;  3BZC A;  4JI6 L;  2E8G A;  1LTL A;  4P71 A;  3PSI A;  5C4X G;  3AFP A;  2NZH A;  1L2F A;  3UE0 A;  3F2C A;  4DV2 Q;  1OTC A;  4DV3 L;  3S1Q H;  1GD7 A;  2D0O A;  5ELO A;  1D7Q A;  4PMW A;  3CC7 A;  3H3V H;  2ZJQ A;  4XTC S;  2HIV A;  5C44 H;  3KDF B;  3S1R H;  4HJA A;  1I50 H;  4ME3 A;  4X65 L;  4LWC A;  5H1S E;  1HR0 L;  2YV5 A;  2UUB L;  1HZ9 A;  3U4V A;  2BA0 A;  1K73 C;  1E24 A;  4AQY Q;  3JAM c;  1JJ2 A;  2N8N A;  3J80 c;  4H02 A;  3RLN A;  3UDG A;  1TWH H;  4OXP A;  1BBW A;  1JJC B;  1K8G A;  1VCI A;  4OWT B;  4OX9 Q;  4OO1 I;  1T9H A;  1GO3 E;  1K8A C;  1YZ6 A;  4GOP C;  1Q86 C;  4DR4 L;  4X6A H;  4JI6 Q;  1VQF A;  3CCQ A;  4A3M H;  3HOV H;  3B6Y A;  4P74 A;  1L1O A;  4C2M H;  3AQQ A;  3ICE A;  4DUZ Q;  4HIK A;  1SR3 A;  1A8V A;  1BVS A;  1LYL A;  2ASB A;  4A3B H;  1AE3 A;  1E7Z A;  1HR0 Q;  4X65 Q;  3PUY A;  2UUB Q;  4UP7 A;  4GKJ Q;  3K81 C;  4LW1 A;  3CCE A;  3ULP A;  4NB3 A;  3T1Y L;  3G71 A;  2LSS A;  1X55 A;  3STB D;  4YWK A;  1QVF A;  2YTV A;  2E2I H;  3PUZ A;  3EN2 A;  1VQC A;  2R7F A;  1SRO A;  5FLX c;  1X9N A;  1IYJ B;  1MIU A;  4BY7 H;  3I7F A;  4JI2 Q;  1X3G A;  5LMU L;  2Z6K C;  5IWA Q;  2F4V L;  4DR4 Q;  1VQ7 A;  4OON A;  3CW2 C;  1JE5 A;  2QEX A;  4HJ8 A;  1S72 A;  1C9O A;  1HZB A;  1BBU A;  2EQS A;  1HH2 P;  2AWN A;  2IT1 A;  5M3M G;  1LM0 A;  3NEM A;  4B3T L;  3S16 H;  1G6P A;  5FLM H;  2K50 A;  3GTO H;  5GAG C;  2QGQ A;  3HFZ B;  1PYB A;  1YIT A;  1B70 B;  3T1Y Q;  1ASZ A;  5C3E H;  4LF4 L;  1K9M C;  2ZM6 L;  4DR1 Q;  4IFD J;  4GLA C;  2K52 A;  1WI5 A;  3PUX A;  2E2J H;  1YEZ A;  2I5H A;  2VY3 A;  1E1T A;  4DV0 L;  4B3R Q;  5IY0 A;  5LMU Q;  2IHF A;  3CCV A;  4JBK A;  2A8V A;  4A3D G;  1PH3 A;  2ZTE A;  2N78 A;  1MJE A;  2ATW A;  4GLV B;  3PGZ A;  4L5Q A;  3ULJ A;  5IE8 A;  1RIP A;  4HJ9 A;  2R93 H;  1EOV A;  1CSQ A;  1K83 H;  4QIW E;  3W5O A;  3KDF A;  4UPA A;  3ULL A;  5IP7 G;  3M4Q A;  4C3I H;  4A3J H;  4B3T Q;  4APV A;  4R4O A;  4OWX B;  5M3F G;  3SGI A;  1UE5 A;  3D0F A;  1YHA A;  4X66 L;  5LMN Q;  4NXM L;  3HOU H;  1V43 A;  2IX1 A;  2CFM A;  2VS1 A;  4PZ7 A;  3J81 i;  5IYD H;  1Q1B A;  3A5Z B;  3ZJY C;  3CC4 A;  4LF4 Q;  1PH8 A;  1CUK A;  4DV7 L;  4DR2 L;  3HKZ G;  3H0G H;  3Q8D A;  2CWP A;  4C3H H;  2OWO A;  5IP9 G;  3F2B A;  1PYS B;  5IYC G;  2K5H A;  4JC0 A;  4GNX B;  4ALP A;  4DV0 Q;  2R92 H;  2VQE Q;  4A3G G;  1RL2 A;  3CP0 A;  3MEF A;  1U0L A;  4GLX A;  4IPH A;  1SN8 A;  2E5L L;  2ES2 A;  2QA4 A;  1YBY A;  1SFO H;  1QVG A;  1PH7 A;  4BA1 I;  3NBH B;  4MNO A;  4JI0 L;  4B3M L;  1D8L A;  4LFC L;  1YJW A;  2LXJ A;  1UWV A;  4A3F H;  1CKM A;  2K5V A;  3UDF A;  2MNA A;  4JYA Q;  1A0I A;  3PUW A;  1FJG L;  2JEB I;  3GTM H;  1EQR A;  3I4M G;  3G48 A;  3I4N H;  3S2H H;  3FKI G;  3KF6 B;  2NVQ H;  4X66 Q;  1Q8K A;  1GVP A;  1N32 L;  3VDY A;  4QL5 A;  2IHE A;  4IO9 A;  3CMA A;  1EQQ A;  1IBM Q;  1Y1V G;  2B29 A;  2ZTD A;  2N49 A;  4DUY L;  1C0A A;  4DV7 Q;  4DR2 Q;  3I56 A;  4IJH A;  1M90 C;  1YIJ A;  2WB1 E;  4R4Q A;  3M4O H;  1CKN A;  1EIF A;  1MKH A;  2AHO B;  5K36 G;  4JBW A;  1VQ5 A;  1WJJ A;  4A3E H;  1IBK Q;  3M4P A;  1UE7 A;  4NXN L;  1PH6 A;  2R7Z H;  4DAM A;  3PUV A;  3UDX A;  2JA5 G;  3PO2 H;  4IFD I;  3RN5 A;  4EQ5 A;  4JI0 Q;  1B7Y B;  3J81 j;  4IJL A;  5C0X G;  4B3M Q;  4LFC Q;  4IPC A;  2CKZ B;  4EX5 A;  4KI0 A;  2RF4 A;  2Q2U A;  4BA2 I;  4A3C H;  2UXD L;  4QY7 A;  5HY6 A;  4DK6 C;  3S2D H;  5EAY A;  1HNZ L;  4DR7 Q;  1N32 Q;  3U50 C;  1IBL L;  5GAH C;  1J6Q A;  3PCO B;  2N3S A;  4YHH L;  3HKZ E;  4GN3 B;  4P72 A;  4TQU S;  1HJP A;  2K4K A;  2LXK A;  4PZ8 A;  4DUY Q;  1XPO A;  2JJQ A;  2K75 A;  4A3K H;  3PO3 H;  3GTL H;  1X54 A;  3I4O A;  4KLK A;  3BJU A;  4BBS H;  4A3M G;  1J5E L;  3HOV G;  1SE8 A;  1NTG A;  1N8R C;  3T1H L;  1XNR Q;  3KF8 B;  1Q46 A;  1Z9F A;  2PQA B;  3AYH B;  5M5W H;  2NN6 G;  1KIX A;  3UE1 A;  1FL0 A;  1S40 A;  4NXN Q;  4DV4 L;  4A3B G;  3L2P A;  1OXS C;  4DV1 L;  4R4C A;  4DV3 Q;  4YCW A;  2K5N A;  2OQ0 A;  3NEL A;  4LF8 L;  2JE6 I;  1X3E A;  2YTY A;  4A93 H;  2JA7 H;  3K0X A;  5JEA G;  1KHI A;  2UXD Q;  1XJV A;  1PH5 A;  1HNZ Q;  4YCU A;  1N34 L;  1IBL Q;  4L5R C;  1I5F A;  4GNX A;  4BY7 G;  3U4Z A;  2DUD A;  3HKS A;  3OYY A;  2UXB L;  3RZD H;  1J5E Q;  3ER0 A;  4GS3 A;  3T1H Q;  3CPW A;  2MO0 A;  2NVT H;  3S15 H;  2EXD A;  2F3I A;  3RZO H;  1CKN B;  3A5U A;  4DV1 Q;  1TXY A;  3KF6 A;  4A3L G;  2OTJ A;  4Y52 H;  2AWO A;  3CQZ H;  3BU2 A;  1Q12 A;  3RLF A;  2HIX A;  4LUV A;  1Z47 A;  2KCT A;  2A19 A;  1FVI A;  3EIV A;  1A62 A;  1N34 Q;  3A74 A;  1V9P A;  2GN5 A;  3D31 A;  4AIM A;  4GOP B;  4DNI A;  4KHP L;  1QUQ B;  1VQH A;  1L1O C;  4C3J H;  1FGU A;  3TRE A;  3LGJ A;  5M5X H;  1VQG A;  3S1M H;  2ALY B;  3I55 A;  1NMG A;  4FDB A;  3HOX H;  2R93 G;  3CCS A;  1EIY B;  2F4V Q;  1G51 A;  1S3O A;  4BBR H;  2WB1 G;  1NY4 A;  5FJ8 G;  1YHQ A;  4B3S L;  3HOZ H;  3TRZ A;  1SMX A;  4POF A;  5GAD C;  3E9H A;  3K8A A;  4NPS A;  2MFI A;  4P75 A;  2ZJP A;  1PH2 A;  2WAQ G;  5LMN W;  1YNX A;  1VQB A;  4PG3 A;  2JA9 A;  4RG1 A;  3TQY A;  1VQ9 A;  1PH9 A;  3HOU G;  4JOI A;  3J7A 5;  1VQK A;  2UU9 L;  4A3I G;  1W3S A;  1EFW A;  4QGU A;  5IYD G;  3H15 A;  4A4I A;  4JI8 L;  3H0G G;  4POG A;  4J15 A;  2UXC L;  4KHP Q;  1KRS A;  1GKH A;  1VQI A;  2VNU D;  2EIF A;  1M1K C;  2R92 G;  4KHZ A;  2OCE A;  2PQA A;  4LFA L;  1SLJ A;  4LUZ A;  2ZM6 Q;  1XMO L;  4IPD A;  1XMQ L;  3F8T A;  3G6E A;  2KHJ A;  5J3B A;  1I3Q H;  4DV5 L;  4DK3 C;  1LUZ A;  4YY3 L;  1Q81 C;  2R6G A;  3E9I A;  2IX0 A;  4A3F G;  2YYZ A;  2ZTC A;  1JB7 A;  1EWI A;  1O7I A;  2AKW B;  4JI1 L;  3W1G A;  2R7D A;  2KHI A;  4R4I A;  1L0W A;  1Y1W H;  2VUM H;  3I4N G;  1NMF A;  5IYB G;  4GKK L;  2GVA A;  1VQ8 A;  1I6H H;  1R9T H;  4DR6 L;  4RMF A;  2AMC B;  4L5T A;  2UU9 Q;  4LF7 L;  2D62 A;  2BH2 A;  1OXU A;  1WYD A;  4XIG S;  4X62 Q;  5C0X J;  1OXV A;  1QZG A;  3J81 c;  3ERS X;  4JI8 Q;  4DR3 L;  2CCZ A;  4JI4 L;  4NXM Q;  1WCM G;  2JQO A;  2OQK A;  2JA8 H;  4LFA Q;  4LF9 L;  2HQL A;  1QVC A;  1XMO Q;  4PZ6 A;  2VQF L;  4A3E G;  1QZH A;  1EUJ A;  3I2Z A;  3PO2 G;  3K7A H;  1PVO A;  4P73 A;  3M7N A;  4DV5 Q;  1UEB A;  2CWA A;  5IP9 H;  3OTO L;  2VL6 A;  3UDI A;  2JA6 H;  2UUA L;  2I5M X;  1VQM A;  1OXX K;  2WAQ E;  2E5L Q;  3W1B A;  4JCV E;  1X65 A;  4L5S A;  1E22 A;  4IOC A;  4LF5 L;  1A63 A;  2XGT A;  5C44 G;  4OO1 G;  4DR6 Q;  1Q82 C;  3TS0 A;  3GTK H;  4GOP A;  2ZJR A;  4LF7 Q;  1QUQ A;  1FJG Q;  3F1Z A;  3AFQ A;  1B8A A;  4QJF A;  3FHW A;  4DR3 Q;  1KQS A;  4BY1 H;  3PO3 G;  2ID0 A;  1IL2 A;  3FKI H;  4BBS G;  4WJ4 A;  3CXC A;  3JAM i;  1KD1 C;  5JEA J;  1EYG A;  3GTJ H;  4IOA A;  4YCV A;  3J80 i;  1IZ6 A;  1K3R A;  1VS0 A;  2RHS B;  1NJI C;  5JJL A;  4OX9 L;  1TWF H;  2JEA I;  3RLO A;  3S14 H;  3L0O A;  1VQE A;  3PIO A;  4JBM A;  1BKB A;  3KJP A;  1VQP A;  3HOY H;  3OTO Q;  2VW9 A;  2UUA Q;  4DR5 L;  5E7N A;  2B63 H;  3HOW H;  3MXN B;  4R1J A;  4BXX H;  3K7U C;  1UE1 A;  1YI2 A;  4A93 G;  2XTI A;  4R4T A;  4DUZ L;  1WFQ A;  4HIO A;  1IXR A;  4LF5 Q;  4HJ5 A;  2NVY H;  2JA7 G;  4O0A A;  5C4X H;  4X64 L;  1HR0 W;  4Y7N H;  2JA5 H;  3M85 A;  2Z6K A;  5GRO A;  3RN2 A;  2JK8 A;  3A0J A;  2DGY A;  2GVB A;  4GKJ L;  3S17 H;  1P16 A;  1YJ9 A;  2I5L X;  4QQB X;  4O2D A;  4YHH Q;  5IT9 c;  1KXL A;  1PHJ A;  4B3S Q;  1U5K A;  4HIM A;  3CCL A;  3H3V I;  4DKA C;  1PV4 A;  2F52 A;  1JMC A;  4IPG A;  1KL9 A;  5C0X I;  3OW2 A;  4JI2 L;  2BH8 A;  5IWA L;  2D0P A;  1N36 L;  2HHH L;  3GD7 A;  1VQD A;  1V1Q A;  1PA6 A;  4DR5 Q;  3IRB A;  1XTD A;  5HGQ A;  4UP9 A;  1HNW L;  1OXT A;  5M5Y H;  3WWV A;  4DV4 Q;  1I94 L;  5FLM G;  4JV5 L;  4X64 Q;  3CCU A;  4LF8 Q;  2UUC L;  1X3F A;  4AYB G;  1H95 A;  2C35 B;  1KC8 C;  2VZA A;  1VQA A;  2RCN A;  3CAM A;  4JBJ A;  5ELN A;  2NVX H;  4UY8 C;  5C3E G;  3DLL A;  3TEH B;  1VQL A;  4A75 A;  2NN6 I;  3HOX G;  2CQO A;  2H5X A;  1KRT A;  1WOC A;  4DR1 L;  1CKO A;  2KCM A;  3KYH C;  1X56 A;  2IY5 B;  2KEN A;  4BBR G;  3HOZ G;  1VQN A;  3TS2 A;  4B3R L;  3CCJ A;  3GTG H;  2UXB Q;  5C4J H;  1AH9 A;  2HHH Q;  5BR8 L;  1N36 Q;  2Y0S G;  2BA1 A;  4LNQ A;  3KFU A;  3CCM A;  1CSP A;  3E0E A;  4MZ9 A;  3S1N H;  3GTQ H;  1KAW A;  1YHB A;  4A3J G;  1HNW Q;  4GN4 B;  4LUO A;  2PNH A;  1I94 Q;  1TWG H;  4GNX C;  4JV5 Q;  1NE3 A;  3CD6 A;  2KBN A;  1E3P A;  2UUC Q;  1DGS A;  2K14 A;  2MO1 A;  3M9B A;  4A3L H;  4JG2 A;  5M3M H;  5LMN L;  3PIP A;  5JJI A;  4JI7 L;  1HNX L;  3BZK A;  3S24 A;  3U58 A;  4K0K L;  2I0Q A;  3CME A;  1TWA H;  2Q2I A;  3RNU A;  1TWC H;  1YJN A;  1VQJ A;  1YVC A;  1MJC A;  1SRU A;  2WP8 J;  4TVA B;  5GAE C;  1VQ4 A;  2VQE L;  4DAY B;  5BR8 Q;  3PV0 A;  1Y1W G;  3GTP H;  4UP8 A;  4LFB L;  1XPU A;  2VUM G;  1Q7Y C;  1X6O A;  1VQO A;  1GM5 A;  3F2D A;  3J7Z C;  1XNQ L;  4A3D H;  5FJ8 H;  4X62 L;  2Q2T A;  1G29 1;  4AYB E;  3AEV A;  3L7Z C;  4DPG A;  4JYA L;  3CF5 A;  2RHQ B;  2V1C C;  2YTX A;  4JI3 L;  1L1O B;  5AJ3 L;  3FP9 A;  3CC2 A;  4JI5 L;  1PH4 A;  5IP7 H;  1E1O A;  2JA8 G;  4IFD G;  5JJK A;  4JI7 Q;  4A3I H;  1HNX Q;  2E2H H;  1IBM L;  2NZO A;  2WFW A;  4K0K Q;  5M3F H;  4DV6 L;  2UXC Q;  1VQ6 A;  2PI2 E;  3M3Y H;  1JJG A;  2PI2 A;  2Y0S E;  4MTN A;  1N33 L;  2JA6 G;  2B3G A;  1N9W A;  2YU9 H;  2L15 A;  1XMQ Q;  3GDE A;  4LF6 L;  3DM3 A;  3JC6 6;  3KOJ A;  4JOI C;  1W2B A;  2R7Z G;  4LFB Q;  3KJO A;  1IBK L;  1HZC A;  1P8L A;  5GQO A;  4YY3 Q;  5IYC H;  1Y14 B;  2MQH A;  4DV2 L;  3PF5 A;  1XNQ Q;  4YWM A;  4GN5 A;  4WJ3 M;  1ASY A;  4A3G H;  4JI1 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...