1PTOF

The structure of a pertussis toxin-sugar complex as a model for receptor binding
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
98
structure length
98
Chain Sequence
LPTHLYKNFTVQELALKLKGKNQEFCLTAFMSGRSLVRACLSDAGHEHDTWFDTMLGFAISAYALKSRIALTVEDSPYPGTPGDLLELQICPLNGYCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PERTUSSIS TOXIN (SUBUNIT S1)
publication title Structure of a pertussis toxin-sugar complex as a model for receptor binding.
pubmed doi rcsb
molecule tags Toxin
total genus 17
structure length 98
sequence length 98
chains with identical sequence L
ec nomenclature
pdb deposition date 1994-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF09276 Pertus-S5-tox Pertussis toxin S5 subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ptoF00
1D5ZC 3DWPA 4DXGA 1EEID 3EA6A 1ET9A 1CHPD 1ESFA 1LTAD 1RCVD 4ZYSA 1G8ZD 1LTGD 1M4VA 3OWEB 4RGTA 5ELCA 5ELFA 1ENFA 1STEA 1L0XB 1JWUD 3CHBD 4L63B 1CQVA 1SEBD 1PTOD 1PTOH 4OHJA 3V05A 1JR0D 1I4GA 1S5ED 3DWQA 4C56C 1FD7D 1KTKA 1TS4A 2TSSA 2QILA 1LT4D 2SEBD 4BWGB 1BXTA 1BCPC 1EFID 1I4HA 1LT6D 1SJHD 2NTTA 3GP7A 1I4PA 1LT5D 1S5CD 1QILA 2O2LD 3EFXD 1TS5A 1PZID 3DWAA 1V1PA 1HXYD 1LTSD 1JWSD 1PZJD 5ELDA 1PRTF 1BCPF 1S5FD 3TSSA 4RHSA 5I4DA 1TY0A 1RDPD 1UUPA 2AQ2B 4UDUC 3R2IA 1TY2A 1B1ZA 1MD2D 2AQ1B 4Z9CB 1EEFD 5FK9C 1CHQD 1KLUD 1BCPB 1PRTB 1JWMD 3O13A 2Z8LA 1PRTC 4RCOA 1LTBD 1S5DD 5FKAC 2IPKD 2RDHA 4RH6A 1SXTA 2WV6D 1CK1A 1AW7A 1SBBB 1T5XD 4RHRA 1I4XA 3R2TA 2CHBD 1KLGD 1JQYD 3SEBA 1HQRD 2J4XA 2NTSA 1FNUA 2ICIA 1D5MC 3MFGA 2XRSD 2R61A 4RGMA 1I4QA 1D5XC 4TSSA 1FGBD 3KLSX 4RGNA 1SE4A 1V1OA 1EWCA 1SE2A 1SJED 2RDGA 1LTID 5ELEA 3W2DA 1S5BD 1PTOF 1PRTD 1BCPD 1LTRD 1PZKD 2G9HD 1EU3A 4RFBA 1TS3A 4RGOS 1I4RA 2XNAC 2AQ3B 1JCKB 3BVGA 2IJ0A 3BYYB 1LLRD 1DYQA 2QEJC 1PYWD 1UNSA 5D3DA 5TSSA 1PTOB 4L6TB 1CT1D 1RD9D 1FNVA 1PTOC 3BZDB 1V1PB 1SE3A 1EU4A 5D3IB 1LO5D 1GOZA 1HTLD 1L0YB 1XXGA 3BYTB 1ET6A 1D6EC 1XTCD 1FNWA 3URYA 2XN9C 1B44D 1F77A 1TS2A 1LTTD 1AN8A 3MC0B 4O1NA 5ELBA 4K6LA 4DXFA 1RF2D 1DJRD 3BVMA 3R8BA 2XRQD 3BVZA 1HA5A 1LT3D
chains in the Genus database with same CATH superfamily
2ENBA 1IBKQ 1TWAH 5CV8A 1Q1BA 2E75C 2E2DC 4FP5D 1Q81C 1YNXA 1X3FA 5J1ZA 4LF5L 1CQVA 4QGUA 3WOEA 1EOTA 1X3QA 1N32Q 1KQSA 2A68C 3DWQA 2VQEL 1A3TA 1RL2A 1YI2A 1K3RA 1E2ZA 2R3ZA 5T1GA 2F0FA 4KJNA 2ICEC 4A3BB 2JA8G 2D0OA 4B3RL 1CZGA 1QWYA 1PFSA 1XMOL 1WD0A 4A3BH 4IO9A 3F2BA 1WOCA 3J7ZC 1ASYA 1N9WA 3TP5A 3KFUA 1E1TA 3GTGB 4CJ0B 4DUYQ 2PW7A 4OELB 1VQGA 4K8JA 1DZ1A 5C44H 3BG3A 5C3EB 3NK9A 4IFDH 1IBLQ 3SHLA 2VUMH 4ZUJA 5J39A 1ILPA 5JAVA 1TWHB 3HOYH 1VQKA 1YNND 3M85A 4LF4L 4LF9L 3I72A 1U9RA 4LF7L 2PNRC 2C35B 2KOLA 1D5XC 1U0LA 2E8GA 2LKVA 3E5SA 4YWKA 5CV7A 3KLSX 4TKOB 1E3PA 3TREA 4AYBG 4DU9A 1A62A 3W2DA 2JA8B 2MO1A 4CJ2C 1C0AA 1VMPA 2KJXA 2O5JC 2K5VA 1N34Q 2XTIA 5CV9A 2QA4A 1JCKB 2B39A 4K14A 1OXXK 3GO5A 3H91A 5C5MA 4DV6Q 4IOCA 2RDFA 1GD7A 3C1EA 2B2UC 1ML0D 5BN3A 2KQ3A 1XNQL 5FOBB 4YHHL 3CPWA 1VQPA 4CKEA 1KNEA 1VQFA 4E6IA 3T51B 4B3SQ 1OO9B 2X69A 4X62L 1E22A 4M1UB 1A3VA 4GOPB 3S16B 1AN8A 1NR2A 1J8IA 5JVG3 4LF8Q 5IYBG 2L0CA 3BVMA 2N49A 3BJUA 1EQRA 5KNCA 5ISRA 1U4PA 4WORA 4JYAL 3QG1A 3R93A 5JJIA 1DOKA 2VB3X 4C1NI 2UXCQ 1TT2A 3GTJB 1CFMA 1JWUD 3NHHA 5JJZA 3UE1A 2FXQA 3H3VH 3NWTA 4BXXH 4QY7A 4R1JA 1IW7D 3CCRA 1KTKA 2TSSA 3M9BA 4ME5A 3I4LA 1YVCA 1LT4D 4GLVB 3RLFA 2KCMA 4DR1L 1HNXL 4DF7A 3J7YW 4A3LG 1N8RC 3E3XA 4LUOA 3MA2B 3NBHA 2O2LD 2CVRA 1H9SB 3LX0A 3HFZB 4C3IH 5ELNA 4EQPA 3QR8A 3CKIB 4V190 1IBML 1S5FD 2RKSA 4OIKA 1STNA 5GAHC 1RTOA 3MEHA 4UDUC 4B08A 2VXWA 1I3QB 4AQYQ 4A3JH 2XIWA 2B2WA 2EXZA 3M7GA 4DV5Q 4J1MA 3K7UC 4HR7B 3CCSA 5DLQE 2GN5A 2I46A 4DR5Q 2EIFA 2WP8J 3I7FA 3BDLA 3CMAA 2V4DA 2NN6H 1JQYD 3OTOQ 1W6JA 1HQRD 1VQJA 5C4HA 3CD6A 3J80E 2XRSD 3T56B 3BS1A 1WCMG 4DUZL 3K5MA 4WJ3M 1OTCA 4P75A 3AU7A 1D8LA 3D8GA 4KHPL 2PI2E 3H94A 1PZKD 2PMZE 3T1HL 2E2JH 3GTLB 1JE4A 3HGBA 4JI1L 4JI8L 1Q12A 3D0FA 2ZXPA 1DM0B 1PV4A 2BH2A 4LF6L 1CKOA 3NEMA 1XMQL 1L0YB 2IX0A 3SE0A 3SXHA 4K0KL 1HH2P 1LUZA 4LFAL 2K75A 1BQQT 3K8AA 4IFDI 4K6LA 2F0HA 4JVZA 1TKWB 2DNEA 2A69C 2OEOA 1KDCA 2EY2A 4HJ9A 3HOXH 3PCOB 3OHXC 3EA6A 5ELOA 2F03A 4FDBA 2WAQG 2O4XA 3MZ5A 4HEDA 1JOKA 2PMZB 1OXUA 3K7AH 2JYOA 1WCMB 3D4WA 1EIYB 3FKIG 4KY7A 1Y1VH 1STEA 1L0XB 1EYAA 2NVQH 4Q5VA 4OIJA 4NW2A 1JR0D 4X3TA 3UE0A 2L15A 5CYUA 2F0SA 2WAQE 3CCVA 1K8OA 2CW0C 2AWNA 4UP8A 3A5ZB 3T53B 4A3IG 5IGEA 1STHA 4ME3A 5I6YA 2QEXA 4DK1A 1B3QA 3QO2A 3K58A 3A5UA 1GKHA 4JOIC 5IP9H 3PQIA 2YTYA 5IIFA 1VQ8A 4ULLA 2L5TA 3TBIB 2DY8A 2JA7H 2D9UA 5AJ3Q 1WI5A 1R4PB 5NUCA 1VF5C 1O80A 3ER0A 1SFOB 4OWTB 4NXNQ 4A3FB 2A73B 4GNXA 5FKAC 4DNTB 2OTLA 2WAQB 2F3IA 1KDBA 2E2IB 1STYA 4A3FH 3NENA 4EGVA 3J80c 5C0XG 2K5WA 3FKIB 2UXDQ 1SBBB 1D1IA 3QOLA 1SYCA 5J22A 5DAUA 3J80L 2HIXA 1KLGD 4HSVA 3SEBA 3ULLA 5IWAL 1D5MC 1RIPA 1ESRA 3H09A 4YCVA 1YHQA 4IALA 4A3IB 3H3VI 1L1OC 1K83H 1IYUA 3H0GG 1GXDC 4DR2L 2NVTB 2F0LA 3E0EA 1HZBA 2NVTH 2A74C 3PO2H 3RMHA 3G6JB 5IP7H 1HZCA 1I4RA 4NP5A 1JOQA 2OXPA 4DR3L 5LMUL 5GAEC 1MKHA 1E2WA 1V1PB 2UUAQ 1V8QA 1QZHA 1HTLD 3URYA 1VQOA 3MEFA 2MHVA 3M4OB 3KUPA 4HTHA 2BDOA 2KEDA 3P20A 4F8MA 1YBYA 3I3CA 1TVXA 1VQIA 5J3BA 3TZDA 1SRUA 4XT1B 1KRTA 4B9XA 3DWPA 3K5OA 4LAAA 2E74C 3VR3A 2XVSA 1PDQA 4LK1C 2F0TA 2B2TC 1XWEA 4DR7Q 1Q46A 1W3SA 1FVIA 2GVAA 1E1OA 1GUNA 3RZDB 3S15B 1EUJA 3DLLA 2X6LA 5IGDA 5K5PA 2YTVA 1HNZQ 3HKZG 2F4VQ 1QOHA 4DV3Q 3DEPA 3PF4A 3EIVA 1CSPA 4PZ8A 2F0DA 3C2PA 1CM9A 3CMEA 3TP7A 5LMNQ 1F2MA 3L7ZC 4MZ9A 5IT9L 2EPBA 2G9DA 2Z4HA 1A6XA 2HCCA 3HKZE 5GROA 1HR0Q 1STBA 1PRTF 3NWSA 5M5YB 1WTOA 1XNRL 1JORA 3W5OA 4GOPA 2ZTDA 4G57A 3KBXA 1P16A 1EIFA 2Q8TA 5FJ8H 1Q3LA 1YJ9A 1HPCA 5FK9C 3DM1A 3FMCA 4LWCA 2L55A 2KCCA 1MJCA 2CW0D 1QUQB 3E6ZX 3U9OA 2IHEA 1Q8KA 2K32A 1VQCA 1YEZA 1B2TA 1ILQA 4X64Q 1GUGA 4GKKQ 3V2TA 3EJIA 2IL8A 5IOCA 1JICA 2A6HC 2L12A 3RN5A 2NTSA 1F9SA 3ULPA 3HKZB 3PUWA 1MGSA 1Y14B 1CI3M 3MXUA 3QOJA 4KKSA 2A6EC 3L0OA 2LFNA 5M5XB 1EZ8A 1H9SA 4RA8A 1BCPD 3UDIA 1S3OA 3JC66 2O5IC 1EU3A 4XQQA 4JI6L 2Q2TA 1OXTA 4JI2Q 3GTQB 1A8VA 4PQXA 2IJ0A 3GTQH 5FLXE 1X3PA 4A3KH 1EU4A 5KGUA 3KOJA 4JI4L 5EPJA 1EY9A 5IYCH 4XDXA 1HFGA 2QDLA 1QVGA 3GTKB 5M3MH 2NWGA 1YNJD 4GS3A 1U5KA 5FO9B 2C5CA 4QIWE 3E9IA 3S2DH 1HRJA 3ITPA 4JI7L 3Q8DA 3QWNA 4ZRZA 1W6KA 5ELCA 2SOBA 2JA9A 3CHBD 2Z6KA 2JEAI 3FPPA 1SEBD 4NDXA 1ONLA 5CBAE 4C56C 4GLXA 2QILA 5IGCA 4DV0L 3I4NG 1EFID 2K4KA 3FP9A 1RKNA 2E76C 4DR6Q 1I4PA 2H4OA 1FJGQ 1XJVA 1AH9A 2R7ZH 2WKDA 3AQQA 2Z1CA 4G4KA 1NMFA 5I6WA 4QIWB 3PO3B 3GTPB 4UP7A 1MIUA 3PO3H 4DAMA 4KHZA 2MFIA 3GTPH 4XT3B 5F2DA 1D7QA 3A8KE 2M9VA 4A93G 2I07B 1BCPB 2PI2A 1VQ4A 2IPKD 1RTNA 1F2LA 2F0QA 2RDHA 1ZEQX 2CWAA 2F0GA 1Q7YC 5KEEA 2JA5H 4QQBX 1NTGA 1E0BA 3CRKC 2R7DA 1NY4A 2RHSB 4ZKCB 4ILWA 1G51A 2OCEA 1FGBD 3I56A 2IX3A 3I70A 2B2YC 1EYGA 2HQLA 4WJWA 3ERSX 2HDLA 4LFBL 3AFQA 3LGJA 4X3UA 1EYDA 2EYJA 5FLXc 5IY0A 5IE8A 3CAMA 1EY5A 3A7LA 1BF4A 2UXBQ 4IUQA 1X6OA 1DYQA 1CT1D 4G7ZC 3BZDB 3KBGA 4F7XA 2A1AA 4JC0A 4BY1G 2GVBA 3VYRA 4K5XA 4A93B 2HQEA 2MO0A 3S1NB 5FLMG 4LNQA 1T9HA 2CKZB 1TWGH 1VQ7A 1IL8A 5C0XJ 1PH6A 4IJLA 2M2LA 2A6ED 1N33L 4HIOA 1GO3E 1HUMA 4FF4A 4GKJQ 1EY8A 3S1RB 2K01A 1LYLA 2EJMA 4ZCKA 5EJWA 4DPGA 5A2QE 1EZ6A 1WTRA 2UUBL 3S17H 1IHZA 1EQVA 1NBWA 1Q82C 4C2MH 3HOVH 5FO7B 1TS4A 5BN5A 3CC7A 4UPAA 2CH4A 1U4MA 3GP7A 1LT5D 2MNAA 5G3LF 2B2UA 1PH4A 1HTPA 4JV5L 4I7AA 4GNXB 1V1PA 1XPOA 1HXYD 4H0LC 4KV6A 2ZM6L 4BY1B 3CCMA 2Z0SA 2YV5A 1A2UA 4JI5Q 3OMGA 4XQJA 1JJCB 4PV1C 1Q8IA 4LMQD 1HCZA 1SYDA 2F52A 1I94L 2EYMA 1ZKOA 4C1NK 4KKUA 1R9TB 4U673 5D65A 4RCOA 1PFBA 1S5DD 3U4ZA 3OMCA 1J5EQ 1D2BA 1EQQA 3CQZB 4JCVE 1K9MC 4B3ML 2MP1A 3W1GA 1IZ6A 1IYJB 1PFNA 3TMEA 1T5XD 1B53A 4N9TA 2LMCB 2B63B 2PQAB 4DV4L 1H9RA 3MFGA 2B63H 2PQEA 3SGIA 3GTGH 1X54A 1EY7A 4PMCA 4DR4Q 1SE4A 4X66L 4LFCQ 5E4XA 4DV7L 4HJAA 5C3EH 1NUCA 4JW0A 3CCQA 1KAWA 2F0OA 2KBNA 1NSNS 1NAPA 4FO2A 4MTNA 1XX8A 2HCIA 4CGYB 1TWFB 1TWHH 4M8AA 4P74A 4DV2Q 3AEVA 2MUYA 2FMCA 1PTOC 4TVAB 5D3IB 2B2VC 3SK6A 3BYTB 4B3TL 4RMFA 1QUQA 1SLJA 2A19A 1VQLA 2K04A 1X9NA 4J15A 4O1NA 5I9PA 3T1YL 3IFTA 5HGQA 1RF2D 4HJ7A 1S5ED 1PFMA 1QVFA 2JA8H 5A2QL 1TIID 4OX9L 1EEID 3TZUA 2UXBL 4H7BA 1Y8PB 4ZYSA 1LTGD 1G291 1X65A 4AYBE 2Q8IB 1ENFA 1TU2B 2FINB 1YZ6A 3U4VA 4FXKC 5C4JB 1A3UA 2KVMA 2K33A 1TXYA 2LXKA 2NZHA 2DJGC 1G6PA 4CDFC 4HMJA 4BWGB 3MWYW 4A3CG 2RSNA 3A7AB 3FEWX 3HP3A 2YU9B 3UDXA 3S16H 5M9OA 5JJLA 5HURA 3A54A 3H15A 2KEEA 4OWXB 5ELDA 4FYDA 2N3SA 3SDZA 2K5QA 4P73A 4AYBB 2UU9Q 4KD4A 3GTJH 4IUTA 3FHWA 3OSOA 4R4TA 1K73C 1H9MA 2KHIA 4A4IA 1HQMC 3NP8A 4OO1G 3NSWA 2KECA 1B70B 1QJOA 1IBKL 1CK1A 4HIDA 1QG7A 1AEXA 1LTLA 1SNPA 1DD2A 3NQIA 2JN4A 2QF7A 3CC4A 1RJTA 3Q6SA 1HNWQ 1N32L 3PSIA 5EQ0A 1KDAA 4C3JG 1SE2A 4JOIA 1I3QH 2N55A 5IYBH 2A68D 4ZUIA 3OIPA 5K36G 2DGYA 5C3XA 2F0EA 1CTMA 1SNDA 2EYOA 2QEJC 3MXGA 2P5ZX 1FNVA 1SYGA 1O7LA 1YITA 2VQFQ 5IODA 4DUYL 1U4RA 1XTCD 4KTAA 1C4QA 4A3LH 2BDNA 2F0JA 1IBLL 3G7LA 5M3FG 4RCNA 2E2HB 2MJ8A 5I9OA 4YWLA 1F2YA 1KIXA 4BBSG 1L1OA 3GTLH 3HG9A 1CZWA 1Y1VG 3MAQA 4L63B 3U58A 1PTOD 2D5DA 2WACA 4HSPA 2XWJB 2ATWA 3M4YA 1SJHD 2QKIC 3VR4A 1C7YA 2UUCQ 2RF4A 3FDTA 5JEAG 1PH9A 4A3EG 2I5HA 3W1BA 3EFXD 1MSHA 4K6DA 4R4CA 1N34L 2CFMA 1SMYC 2DUDA 3MTSA 4DV6L 3Q24A 4WRDA 2EVBA 4MN3A 3TSSA 2SDFA 1TY0A 1WCMH 3KYHC 5M3FB 4B3SL 2JK8A 2EYLA 4MNOA 4P2CB 1CHQD 4X65Q 2EYHA 1UE6A 3H6MA 4LF8L 3PIOA 4DK3C 2B2TA 3OOCA 3VR5A 4J8QA 3OW2A 1VF7A 4A3GG 1UE5A 1AW7A 4X3KA 1JC7A 1PH7A 5CR3A 3S1MB 5IT9E 2UXCL 1EY6A 1W2BA 1I4QA 4PMWA 3NQTA 3RZOB 1VQBA 1I50B 1PMRA 1EWCA 4RGNA 3QB3A 1HFNA 2JE6I 4A3EB 5C5LA 1F9QA 1FR3A 1WTXA 3RZOH 1QNKA 4O42A 4GZYC 1SFOH 1HHVA 2WIIB 1JJGA 1GVPA 3PGZA 5IP7G 1I6HB 1DCZA 2K03A 4JK1C 1CKNB 2E2IH 4EVOA 1DOMA 4IPHA 4X3SA 2JA6G 5TSSA 1Z6HA 3FKIH 1PTOB 4XQNA 1RD9D 4K2LA 1IYVA 4BA2I 1SAPA 3RNUA 3J7AF 4NMZA 4AQYL 3J7AV 4A3IH 4XXEA 2PZUA 3NTHA 3RLNA 4BA1I 4DV5L 5C4XG 4A3GB 4N8FA 1CA5A 3CXCA 4CDDC 4DR5L 1SYEA 1JMCA 2PQAA 2NZ1D 1XYIA 2EDGA 1G8ZD 4YIJA 3KDFA 4TQUS 2BOSA 4IQZA 2L1BA 1OXVA 1M1KC 5IYDH 1NNXA 3OTOL 2K50A 4R9WA 3OPOA 2HHHQ 2PNHA 3KLWA 2R92G 1I4GA 4UY8C 3NPPA 2QCPX 2G5DA 5BR8Q 4AH6A 3M4OH 1FGUA 2RSOA 3T13A 2F0VA 3GD7A 2RBMA 4DV1Q 1YIJA 2VS1A 3I8ZA 3VDYA 3GTOB 5C0XH 3BDCA 2JA6B 4C3HG 4UHVA 2KCTA 3X3NA 4YCWA 1LTSD 4XTCS 4IUVA 1Q1EA 4LW1A 4I65A 4G7OC 2NN6I 4GN5A 5I4DA 2F0MA 3H0GB 3S24A 3G4SA 4YY3Q 2ZJQA 4GN3B 4R4QA 1B1ZA 1VQNA 3H0GH 3SVMA 1G2TA 3RZDH 3S15H 1EEFD 1H9KA 3GTMB 3HOWG 2PZTA 1AE3A 4JI0Q 3KLSA 2JSOA 4WJ4A 2QDBA 3CRLC 5IT9c 3MFYA 3GV6A 4LUZA 2A69D 1A15A 4R8IA 1PLFA 2B8GA 1K3BC 2J4XA 3NELA 4ALPA 2R92B 2QGQA 2F0WA 1KXLA 3MXPA 4RGMA 1X55A 5M5YH 1YHBA 1PH8A 5CGKA 4IURA 2CH4W 2KHJA 3ND9A 3NUCA 3I4MG 4C3HB 1G91A 1VQHA 5JJKA 2G9HD 2B29A 4MTKA 4JI3Q 4BY7G 3CCLA 3K59A 3FVQA 5BN4A 3TS0A 1KHIA 2EZVA 3WOFA 1LO5D 1XXGA 2A5HA 5AJ3L 2AUKA 3HOWB 1X32A 4POFA 1NE3A 1CQFA 2JP1A 1BO0A 2EY5A 4Y7NB 3G71A 3VR6A 4KJOA 3MC0B 4CDCC 4NXNL 3N6RA 3I55A 3R8BA 5M5XH 3LWUA 1SNOA 1CHPD 1RCVD 3V96A 2D2CC 2FJ2A 2E5LQ 2UXDL 3GDEA 1GJXA 3HOUG 2BH8A 3PMFA 1AP0A 4NXMQ 1ICFB 4HJ8A 2B2YA 1JT8A 2BCOA 1B9MA 3S14B 4PMBA 4XYQA 3M3YB 2N8NA 4KK7A 3RLOA 3I4MB 3S14H 4BBRG 5AFWA 1AZQA 5EKLA 1GM5A 4BY7B 3GTKH 3JAMi 4ZLTF 1WVLA 4OWWB 4N8X1 2YYZA 1K0SA 1CA6A 2DNCA 4KY5A 2Y0SG 4G7HC 4MIUA 2ASBA 1RDPD 2UUAL 5C6AA 3EVQA 4KMUC 1N36Q 3G6EA 5IGBA 1WD1A 1KLUD 2CCZA 4TRDA 1PRTC 4IZ8A 1G2SA 1Y8NB 5E3FA 1BOSA 1BBUA 3HOUB 4IPDA 4HCSA 2NVXB 3D3RA 2DN8A 2DJFC 1L2FA 1PXUA 1YJWA 5KIXA 2NVXH 4LF5Q 1VCIA 1A0IA 1FNUA 4HAEA 2Q2HA 4KD3A 4NPSA 4DR7L 4I7ZC 3OW7A 5IGFA 4A3MG 4BBRB 1KD1C 4RAUC 3J81i 3K5LA 2VQEQ 4DGZA 3KJOA 5JEAJ 2R93G 3QJYA 3S9WA 1P8LA 4APVA 1HNZL 3HOZG 3I73A 2F4VL 1II3A 4DV3L 2CWPA 4IPCA 4B3RQ 2HT1A 4RFBA 1UAPA 1XMOQ 3ICEA 2XNAC 3U9SA 5LMNL 3HS0C 4P71A 5JPMC 3X3MA 1Z7TA 4L6TB 1PH5A 1B4OA 3H3VC 1BNZA 1HR0L 3K0XA 5DM73 3I4NB 1D6EC 2OTJA 1L1OB 4J6HA 3I4NH 3AFPA 4OEMB 3C3LA 1IKMA 2L11A 4GLAC 4DXFA 1Y1WG 2K5DA 3S2HB 2NVYB 1YNNC 3F2CA 1D5ZC 4YWMA 1ESFA 2EXDA 4KI0A 4X64L 4LF4Q 4GKKL 4ABNA 4LF9Q 4HIMA 4LF7Q 4A3MB 1PHJA 3IFDA 3OWEB 3K81C 5L37A 3S1QB 2A6HD 2R93B 3EN2A 3S1QH 2F0KA 3HOZB 1KL9A 3K57A 5COYA 4A93H 1WYDA 3S1NH 5GQOA 1CKNA 2NUCA 4O2DA 4A3DG 2RCFA 4F88A 1BDOA 1TWCB 3TDQA 4FXDA 1TWCH 1MSGA 1EOVA 3DUZA 4JI2L 2OQKA 2B2VA 4EQOA 1LACA 1PZJD 3R3OA 4JBJA 1XNQQ 3S1RH 3FPUB 4YHHQ 1RHPA 4DAYA 3Q23A 4RKBA 5EKIA 4QF4A 3L9AX 4X62Q 3BZCA 3R2IA 2R6GA 3RUZA 1Y1WB 4XYOA 2B3GA 4DK6C 3TP8A 5KYLA 4FXGC 3RD4A 3O13A 5GADC 4OXPA 4U68A 4QUCA 2L9HA 5KNDA 2F4IA 4JYAQ 1CSQA 1M90C 1SE8A 3NTKA 3A0JA 1VQ9A 2B8FA 4L5SA 4DAPA 3C1FA 1I4XA 4A3BG 3NXWA 4K8IA 1B3AA 5HGTA 4BY1H 1QB5D 1K28A 4TSSA 4JG2A 5FLMH 4DR1Q 1HNXQ 5C44G 1X3EA 4A3DB 4IPGA 2J7ZA 2KA7A 1V9PA 4IFDG 2F1MA 3A8IE 1K8GA 3KF6A 1TWAB 1CUKA 1R9TH 2VUMG 4DR6L 1PRTD 1SN8A 2QW7A 1FJGL 4N9PA 2EYPA 2K5NA 3CQZH 3HOYG 3E9HA 5E7NA 1ZXTA 1IBMQ 1EY0A 3I4OA 1V1QA 3P7JA 2EY1A 2IY5B 1GUTA 4R4OA 3KDFB 3NTIA 1JB3A 1MI2A 2XN9C 3ERQA 2CQOA 3CCJA 4UP9A 3CPFA 1SR3A 2D0PA 4HCEA 2WB1G 1IL2A 3QIAA 5KNBA 5CV6A 2K28A 1XTDA 3BVGA 4DXGA 4EQNA 3VYTA 4LUVA 1HZ9A 1LTAD 2ZT9C 3F8TA 1HZAA 2JXMB 4KN4C 3M4PA 4RGTA 4R8NA 2WB1E 1TWFH 4QB4A 5C44B 1F9RA 4DUZQ 5I2YA 4K5VA 2Z6BA 3CC2A 1FD7D 3I91A 1KAAA 1B8AA 4KN7C 2VUMB 1PYBA 4KHPQ 3NE5B 2K1BA 4KLKA 5D14A 4O0AA 3HOYB 1NCVA 2LXJA 4JPBW 3T1HQ 3BU2A 3D6CA 3W3AA 1LABA 4XIGS 4JI1Q 4JI8Q 1O7IA 1PZID 3IL8A 1I6VC 3PUYA 3VYUA 4LF6Q 1XPRA 3PUVA 4L5QA 1XMQQ 1PH3A 1LV9A 1E2VA 4K0KQ 1UUPA 3I90A 5JPNC 1VQDA 3T4AC 4K5WA 2WB1B 5CC4A 1TY2A 4BXXG 4LFAQ 1K8AC 1ASZA 1BBWA 5C4JH 2CQAA 1PRTB 1JWMD 3UI2A 1ZYRC 1VQAA 2LS01 1STAA 4HMIA 4RG1A 3TQYA 2YU9H 4IUUA 4A76A 1EWHA 4GKJL 2WV6D 3R2TA 2NB0A 4C3IG 1EFWA 1EIGA 2Q8RE 1DXMA 4PNYA 1HJPA 2SNMA 3J7A5 4CDEC 2IW3A 4A3JG 2K5HA 3ND8A 3UDFA 5ELEA 2EJFC 2HIVA 2N88A 3VYSA 1LTRD 2OQ0A 1D1KA 3D4RA 5JVH3 4DK0A 4JBWA 1T5EA 3KF8A 2V1CC 1TR5A 1JB7A 2NN6G 5D3DA 3TRZA 1B9NA 4QJFA 1GOZA 2ALYB 2ID0A 2RCNA 4JI5L 1AFPA 3TS2A 1WFQA 4HIKA 1KC8C 4A3CH 2H5XA 3P1HA 1BUVT 4IUNA 1Z47A 1WTHA 4CKCA 3RN2A 5IGGA 3B6YA 2XRQD 1J5EL 2RQXA 4C3IB 2Q2IA 2K52A 3CF5A 4IUPA 4ZKBB 3DHQA 4QUFA 4DKAC 3L3OC 1FL0A 3OYYA 1I5FA 4OGQC 5IWAQ 1SNCA 5ELFA 4A3JB 5M5WB 3T16A 1VQ6A 5LHY1 5M5WH 3L2PA 5EAYA 1DONA 4DR2Q 4EX5A 4DR4L 2IT1A 3MXNA 4LFCL 3STBC 1O7YA 4KHVA 4OO1H 3BDOA 5EGTA 5DNFA 3DM3A 2ZXRA 1JE5A 3K5NA 2E2HH 2C9OA 4ZQ3A 3HOXG 1BVSA 1Q90A 4DR3Q 5LMUQ 4H02A 2OF1A 2RA4A 4KKTA 1BCPF 3C46A 4DV2L 1B7YB 3ZJYC 4C3JB 2ZXOA 3F2DA 4C3JH 1HA6A 1SMXA 1VS0A 3A56A 3KLRA 4H13C 2F3VA 4Z9CB 1FYCA 4DN4M 5FO8B 5K36H 2NZOA 1BKBA 2E2JB 2M00A 1WJJA 5IP9G 4RH6A 2ZJPA 4RKLA 3CCUA 4FF3A 1VDZA 1PH2A 4HN7A 2WINB 4QCLA 2ZJRA 4PZ6A 5C3WA 2JA7G 3PIO3 3HRZC 5G3LD 1PYSB 2RDGA 4DNRB 2RVLA 3ONAB 3AYHB 1MHWC 5M3FH 2BE5C 4DA2A 3HOXB 2GA4B 1ZYRD 2JEBI 2F0IA 4A3FG 2Q2UA 1TS3A 4BBSB 3K7AB 1J6QA 4A75A 1UEBA 1KABA 3BYYB 1Y1VB 4BBSH 1PYWD 1UNSA 2F0PA 1XNRQ 2NVQB 4FVMA 3G48A 3CCEA 4CHTB 3S1MH 2VB2X 2UU9L 2K6AA 1R4QB 4GN4B 1F77A 4L8JA 3SK4A 3D31A 4RWSC 2PW5A 4YCUA 5EPKA 1I50H 4V0BA 5JEAH 2B2WC 1VQEA 3PO2G 3BVZA 4A3EH 4ZK9B 4ZAIA 1ENAA 1GUSA 5CV5A 3WDNA 4B9WA 2VW9A 2JA7B 2VL6A 1I6HH 2H1EA 5CORA 1XPUA 5IYDG 2I5LX 1OXSC 2LSSA 3K6OA 1WTWA 2WFWA 5EBCA 4IFDJ 1PTOH 3J80i 1GUWA 2K7VA 1HNWL 4K2KA 2KHSA 4DAYB 2IHFA 2SEBD 1BCPC 1I4HA 1LT6D 2NTTA 4BS9A 5E4WC 1S5CD 4JBMA 1X3GA 4JI6Q 2MGSA 4A3GH 1TS5A 3DWAA 2HD3A 3K80C 3EQLC 1B50A 4IJHA 1DGSA 4P72A 1X56A 4JI4Q 4RHSA 2OT2A 2XSCA 1K83B 2JJQA 3ULJA 3BZKA 2RHQB 2VQFL 2AWOA 2WKCA 1MD2D 1E24A 3UDGA 2N78A 3PO2B 1YNJC 2F0NA 4PZ7A 3AB9A 1WTPA 1O7ZA 3STBD 5T1IA 2KUMA 3VR2A 1WTQA 4F87A 1MBYA 1C48A 4JI7Q 3GTOH 3KF6B 4RHRA 2BA0A 1QCBD 2JA6H 1DOLA 5HY6A 5EPLA 1NR4A 1C8CA 2SNSA 2Z9HA 1VMCA 5EBDA 3TP6A 2IX1A 1JOOA 1A2TA 2ES2A 5JOBA 2VY3A 1F9PA 4DV0Q 5C4XB 1V1OA 2MQHA 4POGA 1PA6A 1SJED 4Q0FA 5FJ8G 2PO4A 1LTID 5C4XH 2VNUD 1L0WA 3JAME 1G6ZA 3GTMH 2KENA 3IKJA 2UUCL 2PZWA 4OO1I 4HJ5A 1A63A 2I0QA 4R4IA 3K0YA 4DNIA 1E7ZA 1LLRD 3A74A 3PUZA 1SMYD 1H95A 1QNUA 4UAIA 4DFAA 1K8MA 3AMUA 2NYZD 2R92H 3DXJC 3NBIA 4WFN3 1EY4A 1NMGA 3SR1A 1UEAB 1B44D 2FFKB 5KRUA 5ELBA 1JJ2A 2PCFB 3WWVA 4X65L 1BBXC 3OWFA 2BE5D 1GHJA 4IN3A 4C3HH 1PVOA 5E1FA 4Y52H 4GNXC 1UE7A 1F2ZA 2AMCB 3SK5A 1CKMA 1V43A 2HDMA 3LNNA 4EQ5A 3J81E 2NBFA 3TEHB 4A3KG 1HUNA 3Q0AA 3GQBA 5IYCG 2YTXA 2XWBB 4LFBQ 3HOWH 1BXTA 4CBVA 1SYFA 4L5TA 5M3MG 4Y7NH 2OWOA 1QILA 1SROA 4IOAA 2PPBC 1S40A 2J0TD 3CW2C 1QZGA 2AHOB 4ID6A 3KK7A 1VQMA 5H1SE 2DY7A 4NKLA 3M7NA 2EE1A 1PH1A 1O78A 3CU7A 3D6WA 1J9OA 4FF2A 1QE6A 3M3YH 1ENCA 1SDFA 3I4MH 1N33Q 1SNMA 4QMGA 5DM63 4X6AH 4BY7H 2R7ZG 1SXTA 2BA1A 2CHBD 1SNQA 4A3KB 2UUBQ 1MJEA 1AZPA 2ICIA 3HKSA 5C4ZA 3JAMc 3PO3G 1KNAA 3KF8B 3M4QA 2R61A 4FF1A 2MPMA 3A55A 4ODGA 2HHHL 3JAML 5M3MB 2PYKA 1EYCA 4OONA 2AKWB 5BR8L 1TQOA 4L5RC 3S2DB 1YHAA 4DV1L 2K14A 2Y0SE 4JV5Q 3E0JA 2AQ3B 2ZM6Q 1IXRA 3HOUH 2JA5G 1EL0A 1M8AA 3NBHB 3DEOA 2EJGC 4PG3A 1SE3A 5CMDA 1K0RA 4FNFA 5EKKA 3MHBA 1I94Q 1Q86C 3P75A 3IAYA 3ZYYX 3OIQA 1C9OA 1SYBA 4MHEA 5DEHA 4YY3L 3F1ZA 3U50C 3F2UA 4BBRH 3VA7A 1LTTD 1KRSA 4NB3A 4GOPC 1H9JA 2R7ZB 4B3MQ 1DJRD 1GHKA 3KJPA 2LY7A 1HA5A 1LT3D 4JI0L 3J81c 2D62A 2KCNA 3MXNB 4S3SA 5C0XI 1ET9A 5LL6S 4CJ1B 3J81L 1M4VA 2Y0SB 3A8JE 1EIHA 4DV4Q 5LMNW 2X6GA 3DMUA 3PF5A 3D4DA 2XGTA 2EQSA 2ZTCA 5GAGC 2ZTEA 4OHJA 3V05A 1HR0W 3I2ZA 4X66Q 4DV7Q 3J81j 1EWIA 1S72A 5LL6X 4AIMA 1LM0A 2I5MX 4H44C 2EYFA 3CP0A 4CKBA 2JA5B 3Q22A 1GUOA 1WTVA 3S2HH 2F0UA 2NVYH 5CV4A 2A8VA 1AE2A 1JWSD 4JI3L 3FRPB 3RR5A 2R7FA 3PV0A 1S4ZA 3PIP3 3HZXA 4B3TQ 4A3MH 2EOTA 3EROA 4DAVA 3HEJA 2AQ2B 5A35A 2JQOA 2AQ1B 1Y69U 3HOVG 2R93H 2AUJD 3T1YQ 3HOZH 2Z8LA 1LTBD 4QL5A 3MVVA 4JBKA 3PIPA 4OX9Q 3LWEA 2EY6A 1UE1A 2HUGA 4OL7A 5FLXL 5CBEE 1NJIC 2F3WA 2IWHA 2E5LL 1STGA 3EBEA 4NXML 3PUXA 1BR9A 1TWGB 3TN2A 1Y8OB 1QVCA 1IKLA 2Z6KC 1ICWA 1Y1WH 1Z9FA 1S5BD 1UWVA 1PTOF 2FMMA 3IRBA 2FHTA 4RGOS 4KY6A 3SK8A 1YJNA 2L4NA 2VZAA 3N52A 3S17B 4LJZC 1U4LA 4C2MB 3HOVB 1IW7C 2B63G 1ET6A 1EQTA 1FNWA 1RODA 1SSOA 2Z4IA 1VQ5A 5KYIA 5I2XA 1TS2A 1N36L 2TMPA 2K05A 4A3DH 3VA5A 5C3EG 3GV3A
chains in the Genus database with same CATH topology
2ENBA 5CV8A 1Q1BA 2E75C 2E2DC 4FP5D 5J1ZA 1CQVA 3WOEA 1EOTA 1X3QA 2A68C 3DWQA 1A3TA 1E2ZA 2R3ZA 5T1GA 2F0FA 4KJNA 2ICEC 4A3BB 1CZGA 1QWYA 1WD0A 3TP5A 3GTGB 4CJ0B 2PW7A 1DZ1A 4K8JA 3BG3A 5C3EB 3NK9A 4IFDH 3SHLA 4ZUJA 5J39A 1ILPA 5JAVA 1TWHB 1YNND 3M85A 3I72A 1U9RA 2PNRC 2KOLA 1D5XC 2LKVA 3E5SA 5CV7A 3KLSX 4TKOB 4DU9A 3W2DA 2JA8B 4CJ2C 1VMPA 2KJXA 2O5JC 5CV9A 1JCKB 2B39A 4K14A 1OXXK 3GO5A 3H91A 5C5MA 2RDFA 3C1EA 2B2UC 1ML0D 5BN3A 2KQ3A 5FOBB 4CKEA 1KNEA 4E6IA 3T51B 1OO9B 2X69A 4M1UB 1A3VA 3S16B 1AN8A 1NR2A 1J8IA 5JVG3 2L0CA 3BVMA 5KNCA 5ISRA 1U4PA 4WORA 3QG1A 3R93A 1DOKA 2VB3X 4C1NI 1TT2A 3GTJB 1CFMA 1JWUD 3NHHA 5JJZA 3NWTA 1IW7D 1KTKA 2TSSA 4ME5A 3I4LA 1LT4D 3RLFA 4DF7A 3J7YW 3MA2B 3NBHA 2O2LD 2CVRA 1H9SB 3LX0A 4EQPA 3CKIB 4V190 1S5FD 2RKSA 4OIKA 1STNA 1RTOA 3MEHA 4UDUC 4B08A 2VXWA 1I3QB 2XIWA 2B2WA 2EXZA 3M7GA 4J1MA 4HR7B 2I46A 2WP8J 3BDLA 2V4DA 2NN6H 1JQYD 1W6JA 1HQRD 5C4HA 3J80E 2XRSD 3T56B 3BS1A 3K5MA 3AU7A 3D8GA 3H94A 1PZKD 3GTLB 1JE4A 3HGBA 1Q12A 2ZXPA 1DM0B 1L0YB 2IX0A 3SE0A 3SXHA 1BQQT 4IFDI 4K6LA 2F0HA 1TKWB 2DNEA 2A69C 2OEOA 1KDCA 2EY2A 3OHXC 3EA6A 2F03A 4HEDA 2O4XA 3MZ5A 1JOKA 2PMZB 1OXUA 2JYOA 1WCMB 3D4WA 4KY7A 1STEA 1L0XB 1EYAA 4Q5VA 4OIJA 4NW2A 1JR0D 4X3TA 5CYUA 2F0SA 1K8OA 2CW0C 2AWNA 3T53B 5IGEA 1STHA 5I6YA 4DK1A 3QO2A 3K58A 5IIFA 4ULLA 2L5TA 3TBIB 2DY8A 2D9UA 1R4PB 5NUCA 1VF5C 1O80A 1SFOB 4A3FB 2A73B 5FKAC 4DNTB 2WAQB 1KDBA 2E2IB 1STYA 4EGVA 5C0XG 2K5WA 3FKIB 1SBBB 1D1IA 3QOLA 1SYCA 5J22A 5DAUA 3J80L 1KLGD 4HSVA 3SEBA 1D5MC 1ESRA 3H09A 4IALA 4A3IB 1GXDC 1IYUA 2NVTB 2F0LA 2A74C 3RMHA 3G6JB 1I4RA 4NP5A 1JOQA 2OXPA 1E2WA 1V1PB 1V8QA 1HTLD 3URYA 2MHVA 3M4OB 3KUPA 4HTHA 2BDOA 2KEDA 3P20A 4F8MA 3I3CA 1TVXA 3TZDA 4XT1B 4B9XA 3DWPA 3K5OA 4LAAA 2E74C 3VR3A 2XVSA 1PDQA 4LK1C 2F0TA 2B2TC 1XWEA 1GUNA 3RZDB 3S15B 2X6LA 5IGDA 5K5PA 1QOHA 3DEPA 3C2PA 2F0DA 1CM9A 3TP7A 1F2MA 3L7ZC 5IT9L 2EPBA 2G9DA 2Z4HA 1A6XA 2HCCA 1STBA 1PRTF 3NWSA 5M5YB 1WTOA 1JORA 4G57A 3KBXA 2Q8TA 1Q3LA 1HPCA 5FK9C 3DM1A 3FMCA 2L55A 2KCCA 2CW0D 3E6ZX 3U9OA 2K32A 1B2TA 1ILQA 1GUGA 3V2TA 3EJIA 2IL8A 5IOCA 1JICA 2A6HC 2L12A 2NTSA 1F9SA 3HKZB 3PUWA 1MGSA 1CI3M 3MXUA 3QOJA 4KKSA 2A6EC 2LFNA 5M5XB 1EZ8A 1H9SA 4RA8A 1BCPD 2O5IC 1EU3A 4XQQA 1OXTA 3GTQB 4PQXA 2IJ0A 5FLXE 1X3PA 1EU4A 5KGUA 5EPJA 1EY9A 4XDXA 1HFGA 3GTKB 2NWGA 1YNJD 5FO9B 2C5CA 1HRJA 3ITPA 3QWNA 4ZRZA 1W6KA 5ELCA 2SOBA 3CHBD 2JEAI 3FPPA 1SEBD 4NDXA 1ONLA 5CBAE 4C56C 2QILA 5IGCA 1EFID 1RKNA 2E76C 1I4PA 2H4OA 2WKDA 2Z1CA 4G4KA 5I6WA 4QIWB 3PO3B 3GTPB 4KHZA 4XT3B 5F2DA 3A8KE 2M9VA 2I07B 1BCPB 2IPKD 1RTNA 1F2LA 2F0QA 2RDHA 1ZEQX 2F0GA 5KEEA 1E0BA 3CRKC 4ZKCB 4ILWA 1FGBD 2IX3A 3I70A 2B2YC 4WJWA 2HDLA 4X3UA 1EYDA 2EYJA 1EY5A 3A7LA 1BF4A 4IUQA 1DYQA 1CT1D 4G7ZC 3BZDB 3KBGA 4F7XA 3VYRA 4K5XA 4A93B 2HQEA 3S1NB 1IL8A 5C0XJ 2M2LA 2A6ED 1HUMA 4FF4A 1EY8A 3S1RB 2K01A 2EJMA 5EJWA 5A2QE 1EZ6A 1WTRA 1IHZA 1EQVA 5FO7B 1TS4A 5BN5A 1U4MA 3GP7A 1LT5D 5G3LF 2B2UA 1HTPA 1V1PA 1HXYD 4H0LC 4KV6A 4BY1B 1A2UA 3OMGA 4XQJA 4PV1C 1Q8IA 4LMQD 1HCZA 1SYDA 2EYMA 1ZKOA 4C1NK 4KKUA 1R9TB 4U673 5D65A 4RCOA 1PFBA 1S5DD 3OMCA 1D2BA 3CQZB 2MP1A 1PFNA 3TMEA 1T5XD 1B53A 4N9TA 2LMCB 2B63B 1H9RA 3MFGA 2PQEA 1EY7A 4PMCA 1SE4A 5E4XA 1NUCA 2F0OA 1NSNS 1NAPA 4FO2A 1XX8A 2HCIA 4CGYB 1TWFB 4M8AA 2MUYA 2FMCA 1PTOC 5D3IB 2B2VC 3SK6A 3BYTB 2K04A 4O1NA 5I9PA 3IFTA 1RF2D 1S5ED 1PFMA 5A2QL 1TIID 1EEID 3TZUA 4H7BA 1Y8PB 4ZYSA 1LTGD 1G291 2Q8IB 1ENFA 1TU2B 2FINB 4FXKC 5C4JB 1A3UA 2KVMA 2K33A 4HMJA 4BWGB 3MWYW 2RSNA 3A7AB 3FEWX 3HP3A 2YU9B 5M9OA 5HURA 3A54A 2KEEA 5ELDA 4FYDA 3SDZA 2K5QA 4AYBB 4KD4A 4IUTA 3OSOA 1H9MA 1HQMC 3NP8A 4OO1G 3NSWA 2KECA 1QJOA 1CK1A 1QG7A 1AEXA 1SNPA 1DD2A 2QF7A 3NQIA 1RJTA 3Q6SA 5EQ0A 1KDAA 4C3JG 1SE2A 2N55A 2A68D 4ZUIA 3OIPA 5K36G 5C3XA 2F0EA 1CTMA 1SNDA 2EYOA 2QEJC 3MXGA 1FNVA 1SYGA 1O7LA 5IODA 1U4RA 1XTCD 4KTAA 1C4QA 2BDNA 2F0JA 3G7LA 4RCNA 2E2HB 2MJ8A 5I9OA 1F2YA 3HG9A 1CZWA 3MAQA 4L63B 1PTOD 2D5DA 2WACA 4HSPA 2XWJB 3M4YA 1SJHD 2QKIC 3VR4A 3FDTA 5JEAG 3EFXD 1MSHA 4K6DA 1SMYC 3MTSA 3Q24A 4WRDA 2EVBA 4MN3A 3TSSA 2SDFA 1TY0A 5M3FB 2EYLA 4P2CB 1CHQD 2EYHA 3H6MA 2B2TA 3OOCA 3VR5A 4J8QA 1VF7A 1AW7A 4X3KA 1JC7A 5CR3A 3S1MB 5IT9E 1EY6A 1I4QA 4PMWA 3NQTA 3RZOB 4RGNA 1I50B 1PMRA 1EWCA 3QB3A 1HFNA 2JE6I 4A3EB 5C5LA 1F9QA 1FR3A 1WTXA 1QNKA 4O42A 4GZYC 1HHVA 2WIIB 1I6HB 1DCZA 2K03A 4JK1C 4EVOA 1DOMA 4X3SA 5TSSA 1Z6HA 1PTOB 4XQNA 1RD9D 4K2LA 1IYVA 4BA2I 1SAPA 3J7AF 4NMZA 3J7AV 4XXEA 2PZUA 3NTHA 4BA1I 4A3GB 1CA5A 1SYEA 2NZ1D 1XYIA 2EDGA 1G8ZD 4YIJA 4TQUS 2BOSA 4IQZA 2L1BA 1OXVA 4R9WA 3OPOA 1I4GA 3NPPA 2QCPX 2RSOA 3T13A 2F0VA 3GD7A 2RBMA 3I8ZA 3GTOB 5C0XH 3BDCA 2JA6B 4C3HG 3X3NA 1LTSD 4XTCS 4IUVA 1Q1EA 4G7OC 4I65A 2NN6I 5I4DA 2F0MA 3H0GB 1B1ZA 3SVMA 1G2TA 1EEFD 1H9KA 3GTMB 2PZTA 3KLSA 2JSOA 2QDBA 3CRLC 3MFYA 3GV6A 2A69D 1A15A 4R8IA 1PLFA 2B8GA 2J4XA 2R92B 2F0WA 3MXPA 4RGMA 5CGKA 4IURA 3ND9A 3NUCA 4C3HB 1G91A 2G9HD 3K59A 3FVQA 5BN4A 2EZVA 3WOFA 1LO5D 1XXGA 2A5HA 2AUKA 3HOWB 1X32A 2JP1A 1CQFA 1BO0A 2EY5A 4Y7NB 3VR6A 4KJOA 3MC0B 3N6RA 3R8BA 3LWUA 1SNOA 1CHPD 1RCVD 3V96A 2D2CC 2FJ2A 1GJXA 3PMFA 1AP0A 2B2YA 2BCOA 1B9MA 3S14B 4PMBA 4XYQA 3M3YB 4KK7A 3I4MB 5AFWA 1AZQA 5EKLA 4BY7B 4ZLTF 1WVLA 2YYZA 1CA6A 2DNCA 4KY5A 4G7HC 4MIUA 1RDPD 5C6AA 3EVQA 4KMUC 5IGBA 1WD1A 1KLUD 4TRDA 1PRTC 4IZ8A 1G2SA 1Y8NB 5E3FA 1BOSA 3HOUB 4HCSA 2NVXB 3D3RA 2DN8A 1PXUA 5KIXA 1VCIA 1FNUA 4HAEA 4KD3A 4I7ZC 3OW7A 5IGFA 4BBRB 4RAUC 3K5LA 4DGZA 5JEAJ 3QJYA 3S9WA 3I73A 1II3A 4RFBA 1UAPA 2XNAC 3U9SA 3HS0C 5JPMC 3X3MA 1Z7TA 4L6TB 3H3VC 1B4OA 1BNZA 5DM73 3I4NB 1D6EC 4J6HA 3C3LA 1IKMA 2L11A 4DXFA 2K5DA 3S2HB 2NVYB 1YNNC 1D5ZC 1ESFA 4KI0A 4ABNA 4A3MB 3IFDA 3OWEB 3S1QB 2A6HD 2R93B 2F0KA 3HOZB 3K57A 5COYA 2NUCA 4F88A 1BDOA 1TWCB 3TDQA 4FXDA 1MSGA 3DUZA 2B2VA 4EQOA 1LACA 1PZJD 3R3OA 3FPUB 1RHPA 4DAYA 3Q23A 4RKBA 5EKIA 4QF4A 3L9AX 3R2IA 2R6GA 3RUZA 1Y1WB 4XYOA 3TP8A 5KYLA 4FXGC 3RD4A 3O13A 4U68A 4QUCA 2L9HA 5KNDA 2F4IA 3NTKA 2B8FA 4DAPA 3C1FA 1I4XA 3NXWA 4K8IA 1B3AA 5HGTA 1QB5D 4TSSA 4A3DB 2J7ZA 2KA7A 4IFDG 2F1MA 3A8IE 1TWAB 1PRTD 4N9PA 2EYPA 1ZXTA 1EY0A 3P7JA 2EY1A 1GUTA 3NTIA 1JB3A 1MI2A 2XN9C 3ERQA 4HCEA 3QIAA 5KNBA 5CV6A 2K28A 3BVGA 4DXGA 4EQNA 3VYTA 1LTAD 2ZT9C 2JXMB 4KN4C 4RGTA 4R8NA 4QB4A 5C44B 1F9RA 5I2YA 4K5VA 1FD7D 3I91A 1KAAA 4KN7C 2VUMB 3NE5B 2K1BA 5D14A 3HOYB 1NCVA 3W3AA 3D6CA 4XIGS 1LABA 1PZID 3IL8A 1I6VC 3PUYA 3VYUA 3PUVA 1LV9A 1E2VA 1UUPA 3I90A 5JPNC 3T4AC 4K5WA 2WB1B 5CC4A 1TY2A 2CQAA 1PRTB 1JWMD 3UI2A 1ZYRC 2LS01 1STAA 4HMIA 4IUUA 1EWHA 2WV6D 3R2TA 2NB0A 4C3IG 1EIGA 2Q8RE 1DXMA 4PNYA 2SNMA 2IW3A 3ND8A 5ELEA 2EJFC 2N88A 3VYSA 1LTRD 1D1KA 3D4RA 5JVH3 4DK0A 4JBWA 1T5EA 3KF8A 1TR5A 2NN6G 5D3DA 1B9NA 1GOZA 1AFPA 2ID0A 3P1HA 1BUVT 4IUNA 1Z47A 4CKCA 5IGGA 2XRQD 2RQXA 4C3IB 4IUPA 4ZKBB 3DHQA 4QUFA 3L3OC 4OGQC 1SNCA 5ELFA 4A3JB 5M5WB 3T16A 5LHY1 1DONA 2IT1A 3MXNA 1O7YA 4KHVA 4OO1H 3BDOA 5EGTA 5DNFA 2ZXRA 3K5NA 2C9OA 4ZQ3A 1Q90A 2OF1A 2RA4A 4KKTA 1BCPF 3C46A 4C3JB 2ZXOA 1HA6A 3A56A 3KLRA 4H13C 2F3VA 4Z9CB 1FYCA 4DN4M 5FO8B 5K36H 2E2JB 2M00A 4RH6A 4RKLA 4FF3A 1VDZA 4HN7A 2WINB 4QCLA 5C3WA 3PIO3 3HRZC 5G3LD 2RDGA 4DNRB 2RVLA 3ONAB 2BE5C 4DA2A 3HOXB 2GA4B 1ZYRD 2JEBI 2F0IA 1TS3A 4BBSB 3K7AB 1KABA 3BYYB 1Y1VB 1PYWD 1UNSA 2F0PA 2NVQB 4FVMA 4CHTB 2VB2X 2K6AA 1R4QB 1F77A 4L8JA 3SK4A 3D31A 4RWSC 2PW5A 5EPKA 4V0BA 5JEAH 2B2WC 3BVZA 4ZK9B 4ZAIA 1ENAA 1GUSA 5CV5A 3WDNA 4B9WA 2JA7B 2H1EA 5CORA 1OXSC 3K6OA 1WTWA 5EBCA 4IFDJ 1PTOH 1GUWA 2K7VA 4K2KA 2KHSA 2SEBD 1BCPC 1I4HA 1LT6D 2NTTA 4BS9A 5E4WC 1S5CD 2MGSA 1TS5A 3DWAA 3EQLC 1B50A 4RHSA 2OT2A 2XSCA 1K83B 2AWOA 2WKCA 1MD2D 3PO2B 1YNJC 2F0NA 3AB9A 1WTPA 1O7ZA 5T1IA 2KUMA 3VR2A 1WTQA 4F87A 1MBYA 1C48A 4RHRA 2BA0A 1QCBD 1DOLA 5EPLA 1NR4A 1C8CA 2SNSA 1VMCA 5EBDA 3TP6A 2IX1A 1JOOA 1A2TA 5JOBA 1F9PA 5C4XB 1V1OA 1SJED 4Q0FA 2PO4A 1LTID 2VNUD 1G6ZA 3JAME 3IKJA 4OO1I 2PZWA 3K0YA 1LLRD 3PUZA 1SMYD 1QNUA 4UAIA 4DFAA 1K8MA 3AMUA 2NYZD 3DXJC 3NBIA 4WFN3 1EY4A 3SR1A 1UEAB 1B44D 2FFKB 5KRUA 5ELBA 2PCFB 1BBXC 3OWFA 2BE5D 1GHJA 4IN3A 5E1FA 1F2ZA 3SK5A 1V43A 2HDMA 3LNNA 3J81E 2NBFA 1HUNA 3Q0AA 3GQBA 2XWBB 1BXTA 4CBVA 1SYFA 1QILA 2PPBC 2J0TD 4ID6A 3KK7A 2DY7A 4NKLA 3M7NA 2EE1A 1O78A 3CU7A 3D6WA 1J9OA 4FF2A 1QE6A 1ENCA 1SDFA 1SNMA 4QMGA 5DM63 1SXTA 2BA1A 2CHBD 1SNQA 4A3KB 1AZPA 2ICIA 5C4ZA 1KNAA 2R61A 4FF1A 2MPMA 3A55A 4ODGA 3JAML 5M3MB 2PYKA 1EYCA 1TQOA 3S2DB 3E0JA 2AQ3B 1EL0A 1M8AA 3DEOA 2EJGC 1SE3A 5CMDA 4FNFA 5EKKA 3MHBA 3P75A 3IAYA 3ZYYX 3OIQA 1SYBA 4MHEA 5DEHA 3F2UA 3VA7A 1LTTD 1H9JA 2R7ZB 1DJRD 1GHKA 2LY7A 1HA5A 1LT3D 2D62A 2KCNA 4S3SA 5C0XI 1ET9A 5LL6S 4CJ1B 3J81L 1M4VA 2Y0SB 3A8JE 1EIHA 2X6GA 3DMUA 3D4DA 4OHJA 3V05A 5LL6X 4H44C 2EYFA 4CKBA 2JA5B 3Q22A 1GUOA 1WTVA 2F0UA 5CV4A 1JWSD 3FRPB 3PV0A 1S4ZA 3PIP3 3HZXA 2EOTA 3EROA 4DAVA 3HEJA 2AQ2B 5A35A 2AQ1B 1Y69U 2AUJD 2Z8LA 1LTBD 3MVVA 3LWEA 2EY6A 2HUGA 4OL7A 5FLXL 5CBEE 2F3WA 2IWHA 1STGA 3PUXA 1BR9A 1TWGB 3TN2A 1Y8OB 1IKLA 1ICWA 1S5BD 1PTOF 2FMMA 2FHTA 4RGOS 4KY6A 3SK8A 2L4NA 3N52A 3S17B 4LJZC 1U4LA 4C2MB 3HOVB 1IW7C 1ET6A 1EQTA 1FNWA 1RODA 1SSOA 2Z4IA 5KYIA 5I2XA 1TS2A 2TMPA 2K05A 3VA5A 3GV3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D5Z C;  3DWP A;  4DXG A;  1EEI D;  3EA6 A;  1ET9 A;  1CHP D;  1ESF A;  1LTA D;  1RCV D;  4ZYS A;  1G8Z D;  1LTG D;  1M4V A;  3OWE B;  4RGT A;  5ELC A;  5ELF A;  1ENF A;  1STE A;  1L0X B;  1JWU D;  3CHB D;  4L63 B;  1CQV A;  1SEB D;  1PTO D;  1PTO H;  4OHJ A;  3V05 A;  1JR0 D;  1I4G A;  1S5E D;  3DWQ A;  4C56 C;  1FD7 D;  1KTK A;  1TS4 A;  2TSS A;  2QIL A;  1LT4 D;  2SEB D;  4BWG B;  1BXT A;  1BCP C;  1EFI D;  1I4H A;  1LT6 D;  1SJH D;  2NTT A;  3GP7 A;  1I4P A;  1LT5 D;  1S5C D;  1QIL A;  2O2L D;  3EFX D;  1TS5 A;  1PZI D;  3DWA A;  1V1P A;  1HXY D;  1LTS D;  1JWS D;  1PZJ D;  5ELD A;  1PRT F;  1BCP F;  1S5F D;  3TSS A;  4RHS A;  5I4D A;  1TY0 A;  1RDP D;  1UUP A;  2AQ2 B;  4UDU C;  3R2I A;  1TY2 A;  1B1Z A;  1MD2 D;  2AQ1 B;  4Z9C B;  1EEF D;  5FK9 C;  1CHQ D;  1KLU D;  1BCP B;  1PRT B;  1JWM D;  3O13 A;  2Z8L A;  1PRT C;  4RCO A;  1LTB D;  1S5D D;  5FKA C;  2IPK D;  2RDH A;  4RH6 A;  1SXT A;  2WV6 D;  1CK1 A;  1AW7 A;  1SBB B;  1T5X D;  4RHR A;  1I4X A;  3R2T A;  2CHB D;  1KLG D;  1JQY D;  3SEB A;  1HQR D;  2J4X A;  2NTS A;  1FNU A;  2ICI A;  1D5M C;  3MFG A;  2XRS D;  2R61 A;  4RGM A;  1I4Q A;  1D5X C;  4TSS A;  1FGB D;  3KLS X;  4RGN A;  1SE4 A;  1V1O A;  1EWC A;  1SE2 A;  1SJE D;  2RDG A;  1LTI D;  5ELE A;  3W2D A;  1S5B D;  1PTO F;  1PRT D;  1BCP D;  1LTR D;  1PZK D;  2G9H D;  1EU3 A;  4RFB A;  1TS3 A;  4RGO S;  1I4R A;  2XNA C;  2AQ3 B;  1JCK B;  3BVG A;  2IJ0 A;  3BYY B;  1LLR D;  1DYQ A;  2QEJ C;  1PYW D;  1UNS A;  5D3D A;  5TSS A;  1PTO B;  4L6T B;  1CT1 D;  1RD9 D;  1FNV A;  1PTO C;  3BZD B;  1V1P B;  1SE3 A;  1EU4 A;  5D3I B;  1LO5 D;  1GOZ A;  1HTL D;  1L0Y B;  1XXG A;  3BYT B;  1ET6 A;  1D6E C;  1XTC D;  1FNW A;  3URY A;  2XN9 C;  1B44 D;  1F77 A;  1TS2 A;  1LTT D;  1AN8 A;  3MC0 B;  4O1N A;  5ELB A;  4K6L A;  4DXF A;  1RF2 D;  1DJR D;  3BVM A;  3R8B A;  2XRQ D;  3BVZ A;  1HA5 A;  1LT3 D; 
#chains in the Genus database with same CATH topology
 2ENB A;  1IBK Q;  1TWA H;  5CV8 A;  1Q1B A;  2E75 C;  2E2D C;  4FP5 D;  1Q81 C;  1YNX A;  1X3F A;  5J1Z A;  4LF5 L;  1CQV A;  4QGU A;  3WOE A;  1EOT A;  1X3Q A;  1N32 Q;  1KQS A;  2A68 C;  3DWQ A;  2VQE L;  1A3T A;  1RL2 A;  1YI2 A;  1K3R A;  1E2Z A;  2R3Z A;  5T1G A;  2F0F A;  4KJN A;  2ICE C;  4A3B B;  2JA8 G;  2D0O A;  4B3R L;  1CZG A;  1QWY A;  1PFS A;  1XMO L;  1WD0 A;  4A3B H;  4IO9 A;  3F2B A;  1WOC A;  3J7Z C;  1ASY A;  1N9W A;  3TP5 A;  3KFU A;  1E1T A;  3GTG B;  4CJ0 B;  4DUY Q;  2PW7 A;  4OEL B;  1VQG A;  4K8J A;  1DZ1 A;  5C44 H;  3BG3 A;  5C3E B;  3NK9 A;  4IFD H;  1IBL Q;  3SHL A;  2VUM H;  4ZUJ A;  5J39 A;  1ILP A;  5JAV A;  1TWH B;  3HOY H;  1VQK A;  1YNN D;  3M85 A;  4LF4 L;  4LF9 L;  3I72 A;  1U9R A;  4LF7 L;  2PNR C;  2C35 B;  2KOL A;  1D5X C;  1U0L A;  2E8G A;  2LKV A;  3E5S A;  4YWK A;  5CV7 A;  3KLS X;  4TKO B;  1E3P A;  3TRE A;  4AYB G;  4DU9 A;  1A62 A;  3W2D A;  2JA8 B;  2MO1 A;  4CJ2 C;  1C0A A;  1VMP A;  2KJX A;  2O5J C;  2K5V A;  1N34 Q;  2XTI A;  5CV9 A;  2QA4 A;  1JCK B;  2B39 A;  4K14 A;  1OXX K;  3GO5 A;  3H91 A;  5C5M A;  4DV6 Q;  4IOC A;  2RDF A;  1GD7 A;  3C1E A;  2B2U C;  1ML0 D;  5BN3 A;  2KQ3 A;  1XNQ L;  5FOB B;  4YHH L;  3CPW A;  1VQP A;  4CKE A;  1KNE A;  1VQF A;  4E6I A;  3T51 B;  4B3S Q;  1OO9 B;  2X69 A;  4X62 L;  1E22 A;  4M1U B;  1A3V A;  4GOP B;  3S16 B;  1AN8 A;  1NR2 A;  1J8I A;  5JVG 3;  4LF8 Q;  5IYB G;  2L0C A;  3BVM A;  2N49 A;  3BJU A;  1EQR A;  5KNC A;  5ISR A;  1U4P A;  4WOR A;  4JYA L;  3QG1 A;  3R93 A;  5JJI A;  1DOK A;  2VB3 X;  4C1N I;  2UXC Q;  1TT2 A;  3GTJ B;  1CFM A;  1JWU D;  3NHH A;  5JJZ A;  3UE1 A;  2FXQ A;  3H3V H;  3NWT A;  4BXX H;  4QY7 A;  4R1J A;  1IW7 D;  3CCR A;  1KTK A;  2TSS A;  3M9B A;  4ME5 A;  3I4L A;  1YVC A;  1LT4 D;  4GLV B;  3RLF A;  2KCM A;  4DR1 L;  1HNX L;  4DF7 A;  3J7Y W;  4A3L G;  1N8R C;  3E3X A;  4LUO A;  3MA2 B;  3NBH A;  2O2L D;  2CVR A;  1H9S B;  3LX0 A;  3HFZ B;  4C3I H;  5ELN A;  4EQP A;  3QR8 A;  3CKI B;  4V19 0;  1IBM L;  1S5F D;  2RKS A;  4OIK A;  1STN A;  5GAH C;  1RTO A;  3MEH A;  4UDU C;  4B08 A;  2VXW A;  1I3Q B;  4AQY Q;  4A3J H;  2XIW A;  2B2W A;  2EXZ A;  3M7G A;  4DV5 Q;  4J1M A;  3K7U C;  4HR7 B;  3CCS A;  5DLQ E;  2GN5 A;  2I46 A;  4DR5 Q;  2EIF A;  2WP8 J;  3I7F A;  3BDL A;  3CMA A;  2V4D A;  2NN6 H;  1JQY D;  3OTO Q;  1W6J A;  1HQR D;  1VQJ A;  5C4H A;  3CD6 A;  3J80 E;  2XRS D;  3T56 B;  3BS1 A;  1WCM G;  4DUZ L;  3K5M A;  4WJ3 M;  1OTC A;  4P75 A;  3AU7 A;  1D8L A;  3D8G A;  4KHP L;  2PI2 E;  3H94 A;  1PZK D;  2PMZ E;  3T1H L;  2E2J H;  3GTL B;  1JE4 A;  3HGB A;  4JI1 L;  4JI8 L;  1Q12 A;  3D0F A;  2ZXP A;  1DM0 B;  1PV4 A;  2BH2 A;  4LF6 L;  1CKO A;  3NEM A;  1XMQ L;  1L0Y B;  2IX0 A;  3SE0 A;  3SXH A;  4K0K L;  1HH2 P;  1LUZ A;  4LFA L;  2K75 A;  1BQQ T;  3K8A A;  4IFD I;  4K6L A;  2F0H A;  4JVZ A;  1TKW B;  2DNE A;  2A69 C;  2OEO A;  1KDC A;  2EY2 A;  4HJ9 A;  3HOX H;  3PCO B;  3OHX C;  3EA6 A;  5ELO A;  2F03 A;  4FDB A;  2WAQ G;  2O4X A;  3MZ5 A;  4HED A;  1JOK A;  2PMZ B;  1OXU A;  3K7A H;  2JYO A;  1WCM B;  3D4W A;  1EIY B;  3FKI G;  4KY7 A;  1Y1V H;  1STE A;  1L0X B;  1EYA A;  2NVQ H;  4Q5V A;  4OIJ A;  4NW2 A;  1JR0 D;  4X3T A;  3UE0 A;  2L15 A;  5CYU A;  2F0S A;  2WAQ E;  3CCV A;  1K8O A;  2CW0 C;  2AWN A;  4UP8 A;  3A5Z B;  3T53 B;  4A3I G;  5IGE A;  1STH A;  4ME3 A;  5I6Y A;  2QEX A;  4DK1 A;  1B3Q A;  3QO2 A;  3K58 A;  3A5U A;  1GKH A;  4JOI C;  5IP9 H;  3PQI A;  2YTY A;  5IIF A;  1VQ8 A;  4ULL A;  2L5T A;  3TBI B;  2DY8 A;  2JA7 H;  2D9U A;  5AJ3 Q;  1WI5 A;  1R4P B;  5NUC A;  1VF5 C;  1O80 A;  3ER0 A;  1SFO B;  4OWT B;  4NXN Q;  4A3F B;  2A73 B;  4GNX A;  5FKA C;  4DNT B;  2OTL A;  2WAQ B;  2F3I A;  1KDB A;  2E2I B;  1STY A;  4A3F H;  3NEN A;  4EGV A;  3J80 c;  5C0X G;  2K5W A;  3FKI B;  2UXD Q;  1SBB B;  1D1I A;  3QOL A;  1SYC A;  5J22 A;  5DAU A;  3J80 L;  2HIX A;  1KLG D;  4HSV A;  3SEB A;  3ULL A;  5IWA L;  1D5M C;  1RIP A;  1ESR A;  3H09 A;  4YCV A;  1YHQ A;  4IAL A;  4A3I B;  3H3V I;  1L1O C;  1K83 H;  1IYU A;  3H0G G;  1GXD C;  4DR2 L;  2NVT B;  2F0L A;  3E0E A;  1HZB A;  2NVT H;  2A74 C;  3PO2 H;  3RMH A;  3G6J B;  5IP7 H;  1HZC A;  1I4R A;  4NP5 A;  1JOQ A;  2OXP A;  4DR3 L;  5LMU L;  5GAE C;  1MKH A;  1E2W A;  1V1P B;  2UUA Q;  1V8Q A;  1QZH A;  1HTL D;  3URY A;  1VQO A;  3MEF A;  2MHV A;  3M4O B;  3KUP A;  4HTH A;  2BDO A;  2KED A;  3P20 A;  4F8M A;  1YBY A;  3I3C A;  1TVX A;  1VQI A;  5J3B A;  3TZD A;  1SRU A;  4XT1 B;  1KRT A;  4B9X A;  3DWP A;  3K5O A;  4LAA A;  2E74 C;  3VR3 A;  2XVS A;  1PDQ A;  4LK1 C;  2F0T A;  2B2T C;  1XWE A;  4DR7 Q;  1Q46 A;  1W3S A;  1FVI A;  2GVA A;  1E1O A;  1GUN A;  3RZD B;  3S15 B;  1EUJ A;  3DLL A;  2X6L A;  5IGD A;  5K5P A;  2YTV A;  1HNZ Q;  3HKZ G;  2F4V Q;  1QOH A;  4DV3 Q;  3DEP A;  3PF4 A;  3EIV A;  1CSP A;  4PZ8 A;  2F0D A;  3C2P A;  1CM9 A;  3CME A;  3TP7 A;  5LMN Q;  1F2M A;  3L7Z C;  4MZ9 A;  5IT9 L;  2EPB A;  2G9D A;  2Z4H A;  1A6X A;  2HCC A;  3HKZ E;  5GRO A;  1HR0 Q;  1STB A;  1PRT F;  3NWS A;  5M5Y B;  1WTO A;  1XNR L;  1JOR A;  3W5O A;  4GOP A;  2ZTD A;  4G57 A;  3KBX A;  1P16 A;  1EIF A;  2Q8T A;  5FJ8 H;  1Q3L A;  1YJ9 A;  1HPC A;  5FK9 C;  3DM1 A;  3FMC A;  4LWC A;  2L55 A;  2KCC A;  1MJC A;  2CW0 D;  1QUQ B;  3E6Z X;  3U9O A;  2IHE A;  1Q8K A;  2K32 A;  1VQC A;  1YEZ A;  1B2T A;  1ILQ A;  4X64 Q;  1GUG A;  4GKK Q;  3V2T A;  3EJI A;  2IL8 A;  5IOC A;  1JIC A;  2A6H C;  2L12 A;  3RN5 A;  2NTS A;  1F9S A;  3ULP A;  3HKZ B;  3PUW A;  1MGS A;  1Y14 B;  1CI3 M;  3MXU A;  3QOJ A;  4KKS A;  2A6E C;  3L0O A;  2LFN A;  5M5X B;  1EZ8 A;  1H9S A;  4RA8 A;  1BCP D;  3UDI A;  1S3O A;  3JC6 6;  2O5I C;  1EU3 A;  4XQQ A;  4JI6 L;  2Q2T A;  1OXT A;  4JI2 Q;  3GTQ B;  1A8V A;  4PQX A;  2IJ0 A;  3GTQ H;  5FLX E;  1X3P A;  4A3K H;  1EU4 A;  5KGU A;  3KOJ A;  4JI4 L;  5EPJ A;  1EY9 A;  5IYC H;  4XDX A;  1HFG A;  2QDL A;  1QVG A;  3GTK B;  5M3M H;  2NWG A;  1YNJ D;  4GS3 A;  1U5K A;  5FO9 B;  2C5C A;  4QIW E;  3E9I A;  3S2D H;  1HRJ A;  3ITP A;  4JI7 L;  3Q8D A;  3QWN A;  4ZRZ A;  1W6K A;  5ELC A;  2SOB A;  2JA9 A;  3CHB D;  2Z6K A;  2JEA I;  3FPP A;  1SEB D;  4NDX A;  1ONL A;  5CBA E;  4C56 C;  4GLX A;  2QIL A;  5IGC A;  4DV0 L;  3I4N G;  1EFI D;  2K4K A;  3FP9 A;  1RKN A;  2E76 C;  4DR6 Q;  1I4P A;  2H4O A;  1FJG Q;  1XJV A;  1AH9 A;  2R7Z H;  2WKD A;  3AQQ A;  2Z1C A;  4G4K A;  1NMF A;  5I6W A;  4QIW B;  3PO3 B;  3GTP B;  4UP7 A;  1MIU A;  3PO3 H;  4DAM A;  4KHZ A;  2MFI A;  3GTP H;  4XT3 B;  5F2D A;  1D7Q A;  3A8K E;  2M9V A;  4A93 G;  2I07 B;  1BCP B;  2PI2 A;  1VQ4 A;  2IPK D;  1RTN A;  1F2L A;  2F0Q A;  2RDH A;  1ZEQ X;  2CWA A;  2F0G A;  1Q7Y C;  5KEE A;  2JA5 H;  4QQB X;  1NTG A;  1E0B A;  3CRK C;  2R7D A;  1NY4 A;  2RHS B;  4ZKC B;  4ILW A;  1G51 A;  2OCE A;  1FGB D;  3I56 A;  2IX3 A;  3I70 A;  2B2Y C;  1EYG A;  2HQL A;  4WJW A;  3ERS X;  2HDL A;  4LFB L;  3AFQ A;  3LGJ A;  4X3U A;  1EYD A;  2EYJ A;  5FLX c;  5IY0 A;  5IE8 A;  3CAM A;  1EY5 A;  3A7L A;  1BF4 A;  2UXB Q;  4IUQ A;  1X6O A;  1DYQ A;  1CT1 D;  4G7Z C;  3BZD B;  3KBG A;  4F7X A;  2A1A A;  4JC0 A;  4BY1 G;  2GVB A;  3VYR A;  4K5X A;  4A93 B;  2HQE A;  2MO0 A;  3S1N B;  5FLM G;  4LNQ A;  1T9H A;  2CKZ B;  1TWG H;  1VQ7 A;  1IL8 A;  5C0X J;  1PH6 A;  4IJL A;  2M2L A;  2A6E D;  1N33 L;  4HIO A;  1GO3 E;  1HUM A;  4FF4 A;  4GKJ Q;  1EY8 A;  3S1R B;  2K01 A;  1LYL A;  2EJM A;  4ZCK A;  5EJW A;  4DPG A;  5A2Q E;  1EZ6 A;  1WTR A;  2UUB L;  3S17 H;  1IHZ A;  1EQV A;  1NBW A;  1Q82 C;  4C2M H;  3HOV H;  5FO7 B;  1TS4 A;  5BN5 A;  3CC7 A;  4UPA A;  2CH4 A;  1U4M A;  3GP7 A;  1LT5 D;  2MNA A;  5G3L F;  2B2U A;  1PH4 A;  1HTP A;  4JV5 L;  4I7A A;  4GNX B;  1V1P A;  1XPO A;  1HXY D;  4H0L C;  4KV6 A;  2ZM6 L;  4BY1 B;  3CCM A;  2Z0S A;  2YV5 A;  1A2U A;  4JI5 Q;  3OMG A;  4XQJ A;  1JJC B;  4PV1 C;  1Q8I A;  4LMQ D;  1HCZ A;  1SYD A;  2F52 A;  1I94 L;  2EYM A;  1ZKO A;  4C1N K;  4KKU A;  1R9T B;  4U67 3;  5D65 A;  4RCO A;  1PFB A;  1S5D D;  3U4Z A;  3OMC A;  1J5E Q;  1D2B A;  1EQQ A;  3CQZ B;  4JCV E;  1K9M C;  4B3M L;  2MP1 A;  3W1G A;  1IZ6 A;  1IYJ B;  1PFN A;  3TME A;  1T5X D;  1B53 A;  4N9T A;  2LMC B;  2B63 B;  2PQA B;  4DV4 L;  1H9R A;  3MFG A;  2B63 H;  2PQE A;  3SGI A;  3GTG H;  1X54 A;  1EY7 A;  4PMC A;  4DR4 Q;  1SE4 A;  4X66 L;  4LFC Q;  5E4X A;  4DV7 L;  4HJA A;  5C3E H;  1NUC A;  4JW0 A;  3CCQ A;  1KAW A;  2F0O A;  2KBN A;  1NSN S;  1NAP A;  4FO2 A;  4MTN A;  1XX8 A;  2HCI A;  4CGY B;  1TWF B;  1TWH H;  4M8A A;  4P74 A;  4DV2 Q;  3AEV A;  2MUY A;  2FMC A;  1PTO C;  4TVA B;  5D3I B;  2B2V C;  3SK6 A;  3BYT B;  4B3T L;  4RMF A;  1QUQ A;  1SLJ A;  2A19 A;  1VQL A;  2K04 A;  1X9N A;  4J15 A;  4O1N A;  5I9P A;  3T1Y L;  3IFT A;  5HGQ A;  1RF2 D;  4HJ7 A;  1S5E D;  1PFM A;  1QVF A;  2JA8 H;  5A2Q L;  1TII D;  4OX9 L;  1EEI D;  3TZU A;  2UXB L;  4H7B A;  1Y8P B;  4ZYS A;  1LTG D;  1G29 1;  1X65 A;  4AYB E;  2Q8I B;  1ENF A;  1TU2 B;  2FIN B;  1YZ6 A;  3U4V A;  4FXK C;  5C4J B;  1A3U A;  2KVM A;  2K33 A;  1TXY A;  2LXK A;  2NZH A;  2DJG C;  1G6P A;  4CDF C;  4HMJ A;  4BWG B;  3MWY W;  4A3C G;  2RSN A;  3A7A B;  3FEW X;  3HP3 A;  2YU9 B;  3UDX A;  3S16 H;  5M9O A;  5JJL A;  5HUR A;  3A54 A;  3H15 A;  2KEE A;  4OWX B;  5ELD A;  4FYD A;  2N3S A;  3SDZ A;  2K5Q A;  4P73 A;  4AYB B;  2UU9 Q;  4KD4 A;  3GTJ H;  4IUT A;  3FHW A;  3OSO A;  4R4T A;  1K73 C;  1H9M A;  2KHI A;  4A4I A;  1HQM C;  3NP8 A;  4OO1 G;  3NSW A;  2KEC A;  1B70 B;  1QJO A;  1IBK L;  1CK1 A;  4HID A;  1QG7 A;  1AEX A;  1LTL A;  1SNP A;  1DD2 A;  3NQI A;  2JN4 A;  2QF7 A;  3CC4 A;  1RJT A;  3Q6S A;  1HNW Q;  1N32 L;  3PSI A;  5EQ0 A;  1KDA A;  4C3J G;  1SE2 A;  4JOI A;  1I3Q H;  2N55 A;  5IYB H;  2A68 D;  4ZUI A;  3OIP A;  5K36 G;  2DGY A;  5C3X A;  2F0E A;  1CTM A;  1SND A;  2EYO A;  2QEJ C;  3MXG A;  2P5Z X;  1FNV A;  1SYG A;  1O7L A;  1YIT A;  2VQF Q;  5IOD A;  4DUY L;  1U4R A;  1XTC D;  4KTA A;  1C4Q A;  4A3L H;  2BDN A;  2F0J A;  1IBL L;  3G7L A;  5M3F G;  4RCN A;  2E2H B;  2MJ8 A;  5I9O A;  4YWL A;  1F2Y A;  1KIX A;  4BBS G;  1L1O A;  3GTL H;  3HG9 A;  1CZW A;  1Y1V G;  3MAQ A;  4L63 B;  3U58 A;  1PTO D;  2D5D A;  2WAC A;  4HSP A;  2XWJ B;  2ATW A;  3M4Y A;  1SJH D;  2QKI C;  3VR4 A;  1C7Y A;  2UUC Q;  2RF4 A;  3FDT A;  5JEA G;  1PH9 A;  4A3E G;  2I5H A;  3W1B A;  3EFX D;  1MSH A;  4K6D A;  4R4C A;  1N34 L;  2CFM A;  1SMY C;  2DUD A;  3MTS A;  4DV6 L;  3Q24 A;  4WRD A;  2EVB A;  4MN3 A;  3TSS A;  2SDF A;  1TY0 A;  1WCM H;  3KYH C;  5M3F B;  4B3S L;  2JK8 A;  2EYL A;  4MNO A;  4P2C B;  1CHQ D;  4X65 Q;  2EYH A;  1UE6 A;  3H6M A;  4LF8 L;  3PIO A;  4DK3 C;  2B2T A;  3OOC A;  3VR5 A;  4J8Q A;  3OW2 A;  1VF7 A;  4A3G G;  1UE5 A;  1AW7 A;  4X3K A;  1JC7 A;  1PH7 A;  5CR3 A;  3S1M B;  5IT9 E;  2UXC L;  1EY6 A;  1W2B A;  1I4Q A;  4PMW A;  3NQT A;  3RZO B;  1VQB A;  1I50 B;  1PMR A;  1EWC A;  4RGN A;  3QB3 A;  1HFN A;  2JE6 I;  4A3E B;  5C5L A;  1F9Q A;  1FR3 A;  1WTX A;  3RZO H;  1QNK A;  4O42 A;  4GZY C;  1SFO H;  1HHV A;  2WII B;  1JJG A;  1GVP A;  3PGZ A;  5IP7 G;  1I6H B;  1DCZ A;  2K03 A;  4JK1 C;  1CKN B;  2E2I H;  4EVO A;  1DOM A;  4IPH A;  4X3S A;  2JA6 G;  5TSS A;  1Z6H A;  3FKI H;  1PTO B;  4XQN A;  1RD9 D;  4K2L A;  1IYV A;  4BA2 I;  1SAP A;  3RNU A;  3J7A F;  4NMZ A;  4AQY L;  3J7A V;  4A3I H;  4XXE A;  2PZU A;  3NTH A;  3RLN A;  4BA1 I;  4DV5 L;  5C4X G;  4A3G B;  4N8F A;  1CA5 A;  3CXC A;  4CDD C;  4DR5 L;  1SYE A;  1JMC A;  2PQA A;  2NZ1 D;  1XYI A;  2EDG A;  1G8Z D;  4YIJ A;  3KDF A;  4TQU S;  2BOS A;  4IQZ A;  2L1B A;  1OXV A;  1M1K C;  5IYD H;  1NNX A;  3OTO L;  2K50 A;  4R9W A;  3OPO A;  2HHH Q;  2PNH A;  3KLW A;  2R92 G;  1I4G A;  4UY8 C;  3NPP A;  2QCP X;  2G5D A;  5BR8 Q;  4AH6 A;  3M4O H;  1FGU A;  2RSO A;  3T13 A;  2F0V A;  3GD7 A;  2RBM A;  4DV1 Q;  1YIJ A;  2VS1 A;  3I8Z A;  3VDY A;  3GTO B;  5C0X H;  3BDC A;  2JA6 B;  4C3H G;  4UHV A;  2KCT A;  3X3N A;  4YCW A;  1LTS D;  4XTC S;  4IUV A;  1Q1E A;  4LW1 A;  4I65 A;  4G7O C;  2NN6 I;  4GN5 A;  5I4D A;  2F0M A;  3H0G B;  3S24 A;  3G4S A;  4YY3 Q;  2ZJQ A;  4GN3 B;  4R4Q A;  1B1Z A;  1VQN A;  3H0G H;  3SVM A;  1G2T A;  3RZD H;  3S15 H;  1EEF D;  1H9K A;  3GTM B;  3HOW G;  2PZT A;  1AE3 A;  4JI0 Q;  3KLS A;  2JSO A;  4WJ4 A;  2QDB A;  3CRL C;  5IT9 c;  3MFY A;  3GV6 A;  4LUZ A;  2A69 D;  1A15 A;  4R8I A;  1PLF A;  2B8G A;  1K3B C;  2J4X A;  3NEL A;  4ALP A;  2R92 B;  2QGQ A;  2F0W A;  1KXL A;  3MXP A;  4RGM A;  1X55 A;  5M5Y H;  1YHB A;  1PH8 A;  5CGK A;  4IUR A;  2CH4 W;  2KHJ A;  3ND9 A;  3NUC A;  3I4M G;  4C3H B;  1G91 A;  1VQH A;  5JJK A;  2G9H D;  2B29 A;  4MTK A;  4JI3 Q;  4BY7 G;  3CCL A;  3K59 A;  3FVQ A;  5BN4 A;  3TS0 A;  1KHI A;  2EZV A;  3WOF A;  1LO5 D;  1XXG A;  2A5H A;  5AJ3 L;  2AUK A;  3HOW B;  1X32 A;  4POF A;  1NE3 A;  1CQF A;  2JP1 A;  1BO0 A;  2EY5 A;  4Y7N B;  3G71 A;  3VR6 A;  4KJO A;  3MC0 B;  4CDC C;  4NXN L;  3N6R A;  3I55 A;  3R8B A;  5M5X H;  3LWU A;  1SNO A;  1CHP D;  1RCV D;  3V96 A;  2D2C C;  2FJ2 A;  2E5L Q;  2UXD L;  3GDE A;  1GJX A;  3HOU G;  2BH8 A;  3PMF A;  1AP0 A;  4NXM Q;  1ICF B;  4HJ8 A;  2B2Y A;  1JT8 A;  2BCO A;  1B9M A;  3S14 B;  4PMB A;  4XYQ A;  3M3Y B;  2N8N A;  4KK7 A;  3RLO A;  3I4M B;  3S14 H;  4BBR G;  5AFW A;  1AZQ A;  5EKL A;  1GM5 A;  4BY7 B;  3GTK H;  3JAM i;  4ZLT F;  1WVL A;  4OWW B;  4N8X 1;  2YYZ A;  1K0S A;  1CA6 A;  2DNC A;  4KY5 A;  2Y0S G;  4G7H C;  4MIU A;  2ASB A;  1RDP D;  2UUA L;  5C6A A;  3EVQ A;  4KMU C;  1N36 Q;  3G6E A;  5IGB A;  1WD1 A;  1KLU D;  2CCZ A;  4TRD A;  1PRT C;  4IZ8 A;  1G2S A;  1Y8N B;  5E3F A;  1BOS A;  1BBU A;  3HOU B;  4IPD A;  4HCS A;  2NVX B;  3D3R A;  2DN8 A;  2DJF C;  1L2F A;  1PXU A;  1YJW A;  5KIX A;  2NVX H;  4LF5 Q;  1VCI A;  1A0I A;  1FNU A;  4HAE A;  2Q2H A;  4KD3 A;  4NPS A;  4DR7 L;  4I7Z C;  3OW7 A;  5IGF A;  4A3M G;  4BBR B;  1KD1 C;  4RAU C;  3J81 i;  3K5L A;  2VQE Q;  4DGZ A;  3KJO A;  5JEA J;  2R93 G;  3QJY A;  3S9W A;  1P8L A;  4APV A;  1HNZ L;  3HOZ G;  3I73 A;  2F4V L;  1II3 A;  4DV3 L;  2CWP A;  4IPC A;  4B3R Q;  2HT1 A;  4RFB A;  1UAP A;  1XMO Q;  3ICE A;  2XNA C;  3U9S A;  5LMN L;  3HS0 C;  4P71 A;  5JPM C;  3X3M A;  1Z7T A;  4L6T B;  1PH5 A;  1B4O A;  3H3V C;  1BNZ A;  1HR0 L;  3K0X A;  5DM7 3;  3I4N B;  1D6E C;  2OTJ A;  1L1O B;  4J6H A;  3I4N H;  3AFP A;  4OEM B;  3C3L A;  1IKM A;  2L11 A;  4GLA C;  4DXF A;  1Y1W G;  2K5D A;  3S2H B;  2NVY B;  1YNN C;  3F2C A;  1D5Z C;  4YWM A;  1ESF A;  2EXD A;  4KI0 A;  4X64 L;  4LF4 Q;  4GKK L;  4ABN A;  4LF9 Q;  4HIM A;  4LF7 Q;  4A3M B;  1PHJ A;  3IFD A;  3OWE B;  3K81 C;  5L37 A;  3S1Q B;  2A6H D;  2R93 B;  3EN2 A;  3S1Q H;  2F0K A;  3HOZ B;  1KL9 A;  3K57 A;  5COY A;  4A93 H;  1WYD A;  3S1N H;  5GQO A;  1CKN A;  2NUC A;  4O2D A;  4A3D G;  2RCF A;  4F88 A;  1BDO A;  1TWC B;  3TDQ A;  4FXD A;  1TWC H;  1MSG A;  1EOV A;  3DUZ A;  4JI2 L;  2OQK A;  2B2V A;  4EQO A;  1LAC A;  1PZJ D;  3R3O A;  4JBJ A;  1XNQ Q;  3S1R H;  3FPU B;  4YHH Q;  1RHP A;  4DAY A;  3Q23 A;  4RKB A;  5EKI A;  4QF4 A;  3L9A X;  4X62 Q;  3BZC A;  3R2I A;  2R6G A;  3RUZ A;  1Y1W B;  4XYO A;  2B3G A;  4DK6 C;  3TP8 A;  5KYL A;  4FXG C;  3RD4 A;  3O13 A;  5GAD C;  4OXP A;  4U68 A;  4QUC A;  2L9H A;  5KND A;  2F4I A;  4JYA Q;  1CSQ A;  1M90 C;  1SE8 A;  3NTK A;  3A0J A;  1VQ9 A;  2B8F A;  4L5S A;  4DAP A;  3C1F A;  1I4X A;  4A3B G;  3NXW A;  4K8I A;  1B3A A;  5HGT A;  4BY1 H;  1QB5 D;  1K28 A;  4TSS A;  4JG2 A;  5FLM H;  4DR1 Q;  1HNX Q;  5C44 G;  1X3E A;  4A3D B;  4IPG A;  2J7Z A;  2KA7 A;  1V9P A;  4IFD G;  2F1M A;  3A8I E;  1K8G A;  3KF6 A;  1TWA B;  1CUK A;  1R9T H;  2VUM G;  4DR6 L;  1PRT D;  1SN8 A;  2QW7 A;  1FJG L;  4N9P A;  2EYP A;  2K5N A;  3CQZ H;  3HOY G;  3E9H A;  5E7N A;  1ZXT A;  1IBM Q;  1EY0 A;  3I4O A;  1V1Q A;  3P7J A;  2EY1 A;  2IY5 B;  1GUT A;  4R4O A;  3KDF B;  3NTI A;  1JB3 A;  1MI2 A;  2XN9 C;  3ERQ A;  2CQO A;  3CCJ A;  4UP9 A;  3CPF A;  1SR3 A;  2D0P A;  4HCE A;  2WB1 G;  1IL2 A;  3QIA A;  5KNB A;  5CV6 A;  2K28 A;  1XTD A;  3BVG A;  4DXG A;  4EQN A;  3VYT A;  4LUV A;  1HZ9 A;  1LTA D;  2ZT9 C;  3F8T A;  1HZA A;  2JXM B;  4KN4 C;  3M4P A;  4RGT A;  4R8N A;  2WB1 E;  1TWF H;  4QB4 A;  5C44 B;  1F9R A;  4DUZ Q;  5I2Y A;  4K5V A;  2Z6B A;  3CC2 A;  1FD7 D;  3I91 A;  1KAA A;  1B8A A;  4KN7 C;  2VUM B;  1PYB A;  4KHP Q;  3NE5 B;  2K1B A;  4KLK A;  5D14 A;  4O0A A;  3HOY B;  1NCV A;  2LXJ A;  4JPB W;  3T1H Q;  3BU2 A;  3D6C A;  3W3A A;  1LAB A;  4XIG S;  4JI1 Q;  4JI8 Q;  1O7I A;  1PZI D;  3IL8 A;  1I6V C;  3PUY A;  3VYU A;  4LF6 Q;  1XPR A;  3PUV A;  4L5Q A;  1XMQ Q;  1PH3 A;  1LV9 A;  1E2V A;  4K0K Q;  1UUP A;  3I90 A;  5JPN C;  1VQD A;  3T4A C;  4K5W A;  2WB1 B;  5CC4 A;  1TY2 A;  4BXX G;  4LFA Q;  1K8A C;  1ASZ A;  1BBW A;  5C4J H;  2CQA A;  1PRT B;  1JWM D;  3UI2 A;  1ZYR C;  1VQA A;  2LS0 1;  1STA A;  4HMI A;  4RG1 A;  3TQY A;  2YU9 H;  4IUU A;  4A76 A;  1EWH A;  4GKJ L;  2WV6 D;  3R2T A;  2NB0 A;  4C3I G;  1EFW A;  1EIG A;  2Q8R E;  1DXM A;  4PNY A;  1HJP A;  2SNM A;  3J7A 5;  4CDE C;  2IW3 A;  4A3J G;  2K5H A;  3ND8 A;  3UDF A;  5ELE A;  2EJF C;  2HIV A;  2N88 A;  3VYS A;  1LTR D;  2OQ0 A;  1D1K A;  3D4R A;  5JVH 3;  4DK0 A;  4JBW A;  1T5E A;  3KF8 A;  2V1C C;  1TR5 A;  1JB7 A;  2NN6 G;  5D3D A;  3TRZ A;  1B9N A;  4QJF A;  1GOZ A;  2ALY B;  2ID0 A;  2RCN A;  4JI5 L;  1AFP A;  3TS2 A;  1WFQ A;  4HIK A;  1KC8 C;  4A3C H;  2H5X A;  3P1H A;  1BUV T;  4IUN A;  1Z47 A;  1WTH A;  4CKC A;  3RN2 A;  5IGG A;  3B6Y A;  2XRQ D;  1J5E L;  2RQX A;  4C3I B;  2Q2I A;  2K52 A;  3CF5 A;  4IUP A;  4ZKB B;  3DHQ A;  4QUF A;  4DKA C;  3L3O C;  1FL0 A;  3OYY A;  1I5F A;  4OGQ C;  5IWA Q;  1SNC A;  5ELF A;  4A3J B;  5M5W B;  3T16 A;  1VQ6 A;  5LHY 1;  5M5W H;  3L2P A;  5EAY A;  1DON A;  4DR2 Q;  4EX5 A;  4DR4 L;  2IT1 A;  3MXN A;  4LFC L;  3STB C;  1O7Y A;  4KHV A;  4OO1 H;  3BDO A;  5EGT A;  5DNF A;  3DM3 A;  2ZXR A;  1JE5 A;  3K5N A;  2E2H H;  2C9O A;  4ZQ3 A;  3HOX G;  1BVS A;  1Q90 A;  4DR3 Q;  5LMU Q;  4H02 A;  2OF1 A;  2RA4 A;  4KKT A;  1BCP F;  3C46 A;  4DV2 L;  1B7Y B;  3ZJY C;  4C3J B;  2ZXO A;  3F2D A;  4C3J H;  1HA6 A;  1SMX A;  1VS0 A;  3A56 A;  3KLR A;  4H13 C;  2F3V A;  4Z9C B;  1FYC A;  4DN4 M;  5FO8 B;  5K36 H;  2NZO A;  1BKB A;  2E2J B;  2M00 A;  1WJJ A;  5IP9 G;  4RH6 A;  2ZJP A;  4RKL A;  3CCU A;  4FF3 A;  1VDZ A;  1PH2 A;  4HN7 A;  2WIN B;  4QCL A;  2ZJR A;  4PZ6 A;  5C3W A;  2JA7 G;  3PIO 3;  3HRZ C;  5G3L D;  1PYS B;  2RDG A;  4DNR B;  2RVL A;  3ONA B;  3AYH B;  1MHW C;  5M3F H;  2BE5 C;  4DA2 A;  3HOX B;  2GA4 B;  1ZYR D;  2JEB I;  2F0I A;  4A3F G;  2Q2U A;  1TS3 A;  4BBS B;  3K7A B;  1J6Q A;  4A75 A;  1UEB A;  1KAB A;  3BYY B;  1Y1V B;  4BBS H;  1PYW D;  1UNS A;  2F0P A;  1XNR Q;  2NVQ B;  4FVM A;  3G48 A;  3CCE A;  4CHT B;  3S1M H;  2VB2 X;  2UU9 L;  2K6A A;  1R4Q B;  4GN4 B;  1F77 A;  4L8J A;  3SK4 A;  3D31 A;  4RWS C;  2PW5 A;  4YCU A;  5EPK A;  1I50 H;  4V0B A;  5JEA H;  2B2W C;  1VQE A;  3PO2 G;  3BVZ A;  4A3E H;  4ZK9 B;  4ZAI A;  1ENA A;  1GUS A;  5CV5 A;  3WDN A;  4B9W A;  2VW9 A;  2JA7 B;  2VL6 A;  1I6H H;  2H1E A;  5COR A;  1XPU A;  5IYD G;  2I5L X;  1OXS C;  2LSS A;  3K6O A;  1WTW A;  2WFW A;  5EBC A;  4IFD J;  1PTO H;  3J80 i;  1GUW A;  2K7V A;  1HNW L;  4K2K A;  2KHS A;  4DAY B;  2IHF A;  2SEB D;  1BCP C;  1I4H A;  1LT6 D;  2NTT A;  4BS9 A;  5E4W C;  1S5C D;  4JBM A;  1X3G A;  4JI6 Q;  2MGS A;  4A3G H;  1TS5 A;  3DWA A;  2HD3 A;  3K80 C;  3EQL C;  1B50 A;  4IJH A;  1DGS A;  4P72 A;  1X56 A;  4JI4 Q;  4RHS A;  2OT2 A;  2XSC A;  1K83 B;  2JJQ A;  3ULJ A;  3BZK A;  2RHQ B;  2VQF L;  2AWO A;  2WKC A;  1MD2 D;  1E24 A;  3UDG A;  2N78 A;  3PO2 B;  1YNJ C;  2F0N A;  4PZ7 A;  3AB9 A;  1WTP A;  1O7Z A;  3STB D;  5T1I A;  2KUM A;  3VR2 A;  1WTQ A;  4F87 A;  1MBY A;  1C48 A;  4JI7 Q;  3GTO H;  3KF6 B;  4RHR A;  2BA0 A;  1QCB D;  2JA6 H;  1DOL A;  5HY6 A;  5EPL A;  1NR4 A;  1C8C A;  2SNS A;  2Z9H A;  1VMC A;  5EBD A;  3TP6 A;  2IX1 A;  1JOO A;  1A2T A;  2ES2 A;  5JOB A;  2VY3 A;  1F9P A;  4DV0 Q;  5C4X B;  1V1O A;  2MQH A;  4POG A;  1PA6 A;  1SJE D;  4Q0F A;  5FJ8 G;  2PO4 A;  1LTI D;  5C4X H;  2VNU D;  1L0W A;  3JAM E;  1G6Z A;  3GTM H;  2KEN A;  3IKJ A;  2UUC L;  2PZW A;  4OO1 I;  4HJ5 A;  1A63 A;  2I0Q A;  4R4I A;  3K0Y A;  4DNI A;  1E7Z A;  1LLR D;  3A74 A;  3PUZ A;  1SMY D;  1H95 A;  1QNU A;  4UAI A;  4DFA A;  1K8M A;  3AMU A;  2NYZ D;  2R92 H;  3DXJ C;  3NBI A;  4WFN 3;  1EY4 A;  1NMG A;  3SR1 A;  1UEA B;  1B44 D;  2FFK B;  5KRU A;  5ELB A;  1JJ2 A;  2PCF B;  3WWV A;  4X65 L;  1BBX C;  3OWF A;  2BE5 D;  1GHJ A;  4IN3 A;  4C3H H;  1PVO A;  5E1F A;  4Y52 H;  4GNX C;  1UE7 A;  1F2Z A;  2AMC B;  3SK5 A;  1CKM A;  1V43 A;  2HDM A;  3LNN A;  4EQ5 A;  3J81 E;  2NBF A;  3TEH B;  4A3K G;  1HUN A;  3Q0A A;  3GQB A;  5IYC G;  2YTX A;  2XWB B;  4LFB Q;  3HOW H;  1BXT A;  4CBV A;  1SYF A;  4L5T A;  5M3M G;  4Y7N H;  2OWO A;  1QIL A;  1SRO A;  4IOA A;  2PPB C;  1S40 A;  2J0T D;  3CW2 C;  1QZG A;  2AHO B;  4ID6 A;  3KK7 A;  1VQM A;  5H1S E;  2DY7 A;  4NKL A;  3M7N A;  2EE1 A;  1PH1 A;  1O78 A;  3CU7 A;  3D6W A;  1J9O A;  4FF2 A;  1QE6 A;  3M3Y H;  1ENC A;  1SDF A;  3I4M H;  1N33 Q;  1SNM A;  4QMG A;  5DM6 3;  4X6A H;  4BY7 H;  2R7Z G;  1SXT A;  2BA1 A;  2CHB D;  1SNQ A;  4A3K B;  2UUB Q;  1MJE A;  1AZP A;  2ICI A;  3HKS A;  5C4Z A;  3JAM c;  3PO3 G;  1KNA A;  3KF8 B;  3M4Q A;  2R61 A;  4FF1 A;  2MPM A;  3A55 A;  4ODG A;  2HHH L;  3JAM L;  5M3M B;  2PYK A;  1EYC A;  4OON A;  2AKW B;  5BR8 L;  1TQO A;  4L5R C;  3S2D B;  1YHA A;  4DV1 L;  2K14 A;  2Y0S E;  4JV5 Q;  3E0J A;  2AQ3 B;  2ZM6 Q;  1IXR A;  3HOU H;  2JA5 G;  1EL0 A;  1M8A A;  3NBH B;  3DEO A;  2EJG C;  4PG3 A;  1SE3 A;  5CMD A;  1K0R A;  4FNF A;  5EKK A;  3MHB A;  1I94 Q;  1Q86 C;  3P75 A;  3IAY A;  3ZYY X;  3OIQ A;  1C9O A;  1SYB A;  4MHE A;  5DEH A;  4YY3 L;  3F1Z A;  3U50 C;  3F2U A;  4BBR H;  3VA7 A;  1LTT D;  1KRS A;  4NB3 A;  4GOP C;  1H9J A;  2R7Z B;  4B3M Q;  1DJR D;  1GHK A;  3KJP A;  2LY7 A;  1HA5 A;  1LT3 D;  4JI0 L;  3J81 c;  2D62 A;  2KCN A;  3MXN B;  4S3S A;  5C0X I;  1ET9 A;  5LL6 S;  4CJ1 B;  3J81 L;  1M4V A;  2Y0S B;  3A8J E;  1EIH A;  4DV4 Q;  5LMN W;  2X6G A;  3DMU A;  3PF5 A;  3D4D A;  2XGT A;  2EQS A;  2ZTC A;  5GAG C;  2ZTE A;  4OHJ A;  3V05 A;  1HR0 W;  3I2Z A;  4X66 Q;  4DV7 Q;  3J81 j;  1EWI A;  1S72 A;  5LL6 X;  4AIM A;  1LM0 A;  2I5M X;  4H44 C;  2EYF A;  3CP0 A;  4CKB A;  2JA5 B;  3Q22 A;  1GUO A;  1WTV A;  3S2H H;  2F0U A;  2NVY H;  5CV4 A;  2A8V A;  1AE2 A;  1JWS D;  4JI3 L;  3FRP B;  3RR5 A;  2R7F A;  3PV0 A;  1S4Z A;  3PIP 3;  3HZX A;  4B3T Q;  4A3M H;  2EOT A;  3ERO A;  4DAV A;  3HEJ A;  2AQ2 B;  5A35 A;  2JQO A;  2AQ1 B;  1Y69 U;  3HOV G;  2R93 H;  2AUJ D;  3T1Y Q;  3HOZ H;  2Z8L A;  1LTB D;  4QL5 A;  3MVV A;  4JBK A;  3PIP A;  4OX9 Q;  3LWE A;  2EY6 A;  1UE1 A;  2HUG A;  4OL7 A;  5FLX L;  5CBE E;  1NJI C;  2F3W A;  2IWH A;  2E5L L;  1STG A;  3EBE A;  4NXM L;  3PUX A;  1BR9 A;  1TWG B;  3TN2 A;  1Y8O B;  1QVC A;  1IKL A;  2Z6K C;  1ICW A;  1Y1W H;  1Z9F A;  1S5B D;  1UWV A;  1PTO F;  2FMM A;  3IRB A;  2FHT A;  4RGO S;  4KY6 A;  3SK8 A;  1YJN A;  2L4N A;  2VZA A;  3N52 A;  3S17 B;  4LJZ C;  1U4L A;  4C2M B;  3HOV B;  1IW7 C;  2B63 G;  1ET6 A;  1EQT A;  1FNW A;  1ROD A;  1SSO A;  2Z4I A;  1VQ5 A;  5KYI A;  5I2X A;  1TS2 A;  1N36 L;  2TMP A;  2K05 A;  4A3D H;  3VA5 A;  5C3E G;  3GV3 A; 
#chains in the Genus database with same CATH homology
 2ENB A;  5CV8 A;  1Q1B A;  2E75 C;  2E2D C;  4FP5 D;  5J1Z A;  1CQV A;  3WOE A;  1EOT A;  1X3Q A;  2A68 C;  3DWQ A;  1A3T A;  1E2Z A;  2R3Z A;  5T1G A;  2F0F A;  4KJN A;  2ICE C;  4A3B B;  1CZG A;  1QWY A;  1WD0 A;  3TP5 A;  3GTG B;  4CJ0 B;  2PW7 A;  1DZ1 A;  4K8J A;  3BG3 A;  5C3E B;  3NK9 A;  4IFD H;  3SHL A;  4ZUJ A;  5J39 A;  1ILP A;  5JAV A;  1TWH B;  1YNN D;  3M85 A;  3I72 A;  1U9R A;  2PNR C;  2KOL A;  1D5X C;  2LKV A;  3E5S A;  5CV7 A;  3KLS X;  4TKO B;  4DU9 A;  3W2D A;  2JA8 B;  4CJ2 C;  1VMP A;  2KJX A;  2O5J C;  5CV9 A;  1JCK B;  2B39 A;  4K14 A;  1OXX K;  3GO5 A;  3H91 A;  5C5M A;  2RDF A;  3C1E A;  2B2U C;  1ML0 D;  5BN3 A;  2KQ3 A;  5FOB B;  4CKE A;  1KNE A;  4E6I A;  3T51 B;  1OO9 B;  2X69 A;  4M1U B;  1A3V A;  3S16 B;  1AN8 A;  1NR2 A;  1J8I A;  5JVG 3;  2L0C A;  3BVM A;  5KNC A;  5ISR A;  1U4P A;  4WOR A;  3QG1 A;  3R93 A;  1DOK A;  2VB3 X;  4C1N I;  1TT2 A;  3GTJ B;  1CFM A;  1JWU D;  3NHH A;  5JJZ A;  3NWT A;  1IW7 D;  1KTK A;  2TSS A;  4ME5 A;  3I4L A;  1LT4 D;  3RLF A;  4DF7 A;  3J7Y W;  3MA2 B;  3NBH A;  2O2L D;  2CVR A;  1H9S B;  3LX0 A;  4EQP A;  3CKI B;  4V19 0;  1S5F D;  2RKS A;  4OIK A;  1STN A;  1RTO A;  3MEH A;  4UDU C;  4B08 A;  2VXW A;  1I3Q B;  2XIW A;  2B2W A;  2EXZ A;  3M7G A;  4J1M A;  4HR7 B;  2I46 A;  2WP8 J;  3BDL A;  2V4D A;  2NN6 H;  1JQY D;  1W6J A;  1HQR D;  5C4H A;  3J80 E;  2XRS D;  3T56 B;  3BS1 A;  3K5M A;  3AU7 A;  3D8G A;  3H94 A;  1PZK D;  3GTL B;  1JE4 A;  3HGB A;  1Q12 A;  2ZXP A;  1DM0 B;  1L0Y B;  2IX0 A;  3SE0 A;  3SXH A;  1BQQ T;  4IFD I;  4K6L A;  2F0H A;  1TKW B;  2DNE A;  2A69 C;  2OEO A;  1KDC A;  2EY2 A;  3OHX C;  3EA6 A;  2F03 A;  4HED A;  2O4X A;  3MZ5 A;  1JOK A;  2PMZ B;  1OXU A;  2JYO A;  1WCM B;  3D4W A;  4KY7 A;  1STE A;  1L0X B;  1EYA A;  4Q5V A;  4OIJ A;  4NW2 A;  1JR0 D;  4X3T A;  5CYU A;  2F0S A;  1K8O A;  2CW0 C;  2AWN A;  3T53 B;  5IGE A;  1STH A;  5I6Y A;  4DK1 A;  3QO2 A;  3K58 A;  5IIF A;  4ULL A;  2L5T A;  3TBI B;  2DY8 A;  2D9U A;  1R4P B;  5NUC A;  1VF5 C;  1O80 A;  1SFO B;  4A3F B;  2A73 B;  5FKA C;  4DNT B;  2WAQ B;  1KDB A;  2E2I B;  1STY A;  4EGV A;  5C0X G;  2K5W A;  3FKI B;  1SBB B;  1D1I A;  3QOL A;  1SYC A;  5J22 A;  5DAU A;  3J80 L;  1KLG D;  4HSV A;  3SEB A;  1D5M C;  1ESR A;  3H09 A;  4IAL A;  4A3I B;  1GXD C;  1IYU A;  2NVT B;  2F0L A;  2A74 C;  3RMH A;  3G6J B;  1I4R A;  4NP5 A;  1JOQ A;  2OXP A;  1E2W A;  1V1P B;  1V8Q A;  1HTL D;  3URY A;  2MHV A;  3M4O B;  3KUP A;  4HTH A;  2BDO A;  2KED A;  3P20 A;  4F8M A;  3I3C A;  1TVX A;  3TZD A;  4XT1 B;  4B9X A;  3DWP A;  3K5O A;  4LAA A;  2E74 C;  3VR3 A;  2XVS A;  1PDQ A;  4LK1 C;  2F0T A;  2B2T C;  1XWE A;  1GUN A;  3RZD B;  3S15 B;  2X6L A;  5IGD A;  5K5P A;  1QOH A;  3DEP A;  3C2P A;  2F0D A;  1CM9 A;  3TP7 A;  1F2M A;  3L7Z C;  5IT9 L;  2EPB A;  2G9D A;  2Z4H A;  1A6X A;  2HCC A;  1STB A;  1PRT F;  3NWS A;  5M5Y B;  1WTO A;  1JOR A;  4G57 A;  3KBX A;  2Q8T A;  1Q3L A;  1HPC A;  5FK9 C;  3DM1 A;  3FMC A;  2L55 A;  2KCC A;  2CW0 D;  3E6Z X;  3U9O A;  2K32 A;  1B2T A;  1ILQ A;  1GUG A;  3V2T A;  3EJI A;  2IL8 A;  5IOC A;  1JIC A;  2A6H C;  2L12 A;  2NTS A;  1F9S A;  3HKZ B;  3PUW A;  1MGS A;  1CI3 M;  3MXU A;  3QOJ A;  4KKS A;  2A6E C;  2LFN A;  5M5X B;  1EZ8 A;  1H9S A;  4RA8 A;  1BCP D;  2O5I C;  1EU3 A;  4XQQ A;  1OXT A;  3GTQ B;  4PQX A;  2IJ0 A;  5FLX E;  1X3P A;  1EU4 A;  5KGU A;  5EPJ A;  1EY9 A;  4XDX A;  1HFG A;  3GTK B;  2NWG A;  1YNJ D;  5FO9 B;  2C5C A;  1HRJ A;  3ITP A;  3QWN A;  4ZRZ A;  1W6K A;  5ELC A;  2SOB A;  3CHB D;  2JEA I;  3FPP A;  1SEB D;  4NDX A;  1ONL A;  5CBA E;  4C56 C;  2QIL A;  5IGC A;  1EFI D;  1RKN A;  2E76 C;  1I4P A;  2H4O A;  2WKD A;  2Z1C A;  4G4K A;  5I6W A;  4QIW B;  3PO3 B;  3GTP B;  4KHZ A;  4XT3 B;  5F2D A;  3A8K E;  2M9V A;  2I07 B;  1BCP B;  2IPK D;  1RTN A;  1F2L A;  2F0Q A;  2RDH A;  1ZEQ X;  2F0G A;  5KEE A;  1E0B A;  3CRK C;  4ZKC B;  4ILW A;  1FGB D;  2IX3 A;  3I70 A;  2B2Y C;  4WJW A;  2HDL A;  4X3U A;  1EYD A;  2EYJ A;  1EY5 A;  3A7L A;  1BF4 A;  4IUQ A;  1DYQ A;  1CT1 D;  4G7Z C;  3BZD B;  3KBG A;  4F7X A;  3VYR A;  4K5X A;  4A93 B;  2HQE A;  3S1N B;  1IL8 A;  5C0X J;  2M2L A;  2A6E D;  1HUM A;  4FF4 A;  1EY8 A;  3S1R B;  2K01 A;  2EJM A;  5EJW A;  5A2Q E;  1EZ6 A;  1WTR A;  1IHZ A;  1EQV A;  5FO7 B;  1TS4 A;  5BN5 A;  1U4M A;  3GP7 A;  1LT5 D;  5G3L F;  2B2U A;  1HTP A;  1V1P A;  1HXY D;  4H0L C;  4KV6 A;  4BY1 B;  1A2U A;  3OMG A;  4XQJ A;  4PV1 C;  1Q8I A;  4LMQ D;  1HCZ A;  1SYD A;  2EYM A;  1ZKO A;  4C1N K;  4KKU A;  1R9T B;  4U67 3;  5D65 A;  4RCO A;  1PFB A;  1S5D D;  3OMC A;  1D2B A;  3CQZ B;  2MP1 A;  1PFN A;  3TME A;  1T5X D;  1B53 A;  4N9T A;  2LMC B;  2B63 B;  1H9R A;  3MFG A;  2PQE A;  1EY7 A;  4PMC A;  1SE4 A;  5E4X A;  1NUC A;  2F0O A;  1NSN S;  1NAP A;  4FO2 A;  1XX8 A;  2HCI A;  4CGY B;  1TWF B;  4M8A A;  2MUY A;  2FMC A;  1PTO C;  5D3I B;  2B2V C;  3SK6 A;  3BYT B;  2K04 A;  4O1N A;  5I9P A;  3IFT A;  1RF2 D;  1S5E D;  1PFM A;  5A2Q L;  1TII D;  1EEI D;  3TZU A;  4H7B A;  1Y8P B;  4ZYS A;  1LTG D;  1G29 1;  2Q8I B;  1ENF A;  1TU2 B;  2FIN B;  4FXK C;  5C4J B;  1A3U A;  2KVM A;  2K33 A;  4HMJ A;  4BWG B;  3MWY W;  2RSN A;  3A7A B;  3FEW X;  3HP3 A;  2YU9 B;  5M9O A;  5HUR A;  3A54 A;  2KEE A;  5ELD A;  4FYD A;  3SDZ A;  2K5Q A;  4AYB B;  4KD4 A;  4IUT A;  3OSO A;  1H9M A;  1HQM C;  3NP8 A;  4OO1 G;  3NSW A;  2KEC A;  1QJO A;  1CK1 A;  1QG7 A;  1AEX A;  1SNP A;  1DD2 A;  2QF7 A;  3NQI A;  1RJT A;  3Q6S A;  5EQ0 A;  1KDA A;  4C3J G;  1SE2 A;  2N55 A;  2A68 D;  4ZUI A;  3OIP A;  5K36 G;  5C3X A;  2F0E A;  1CTM A;  1SND A;  2EYO A;  2QEJ C;  3MXG A;  1FNV A;  1SYG A;  1O7L A;  5IOD A;  1U4R A;  1XTC D;  4KTA A;  1C4Q A;  2BDN A;  2F0J A;  3G7L A;  4RCN A;  2E2H B;  2MJ8 A;  5I9O A;  1F2Y A;  3HG9 A;  1CZW A;  3MAQ A;  4L63 B;  1PTO D;  2D5D A;  2WAC A;  4HSP A;  2XWJ B;  3M4Y A;  1SJH D;  2QKI C;  3VR4 A;  3FDT A;  5JEA G;  3EFX D;  1MSH A;  4K6D A;  1SMY C;  3MTS A;  3Q24 A;  4WRD A;  2EVB A;  4MN3 A;  3TSS A;  2SDF A;  1TY0 A;  5M3F B;  2EYL A;  4P2C B;  1CHQ D;  2EYH A;  3H6M A;  2B2T A;  3OOC A;  3VR5 A;  4J8Q A;  1VF7 A;  1AW7 A;  4X3K A;  1JC7 A;  5CR3 A;  3S1M B;  5IT9 E;  1EY6 A;  1I4Q A;  4PMW A;  3NQT A;  3RZO B;  4RGN A;  1I50 B;  1PMR A;  1EWC A;  3QB3 A;  1HFN A;  2JE6 I;  4A3E B;  5C5L A;  1F9Q A;  1FR3 A;  1WTX A;  1QNK A;  4O42 A;  4GZY C;  1HHV A;  2WII B;  1I6H B;  1DCZ A;  2K03 A;  4JK1 C;  4EVO A;  1DOM A;  4X3S A;  5TSS A;  1Z6H A;  1PTO B;  4XQN A;  1RD9 D;  4K2L A;  1IYV A;  4BA2 I;  1SAP A;  3J7A F;  4NMZ A;  3J7A V;  4XXE A;  2PZU A;  3NTH A;  4BA1 I;  4A3G B;  1CA5 A;  1SYE A;  2NZ1 D;  1XYI A;  2EDG A;  1G8Z D;  4YIJ A;  4TQU S;  2BOS A;  4IQZ A;  2L1B A;  1OXV A;  4R9W A;  3OPO A;  1I4G A;  3NPP A;  2QCP X;  2RSO A;  3T13 A;  2F0V A;  3GD7 A;  2RBM A;  3I8Z A;  3GTO B;  5C0X H;  3BDC A;  2JA6 B;  4C3H G;  3X3N A;  1LTS D;  4XTC S;  4IUV A;  1Q1E A;  4G7O C;  4I65 A;  2NN6 I;  5I4D A;  2F0M A;  3H0G B;  1B1Z A;  3SVM A;  1G2T A;  1EEF D;  1H9K A;  3GTM B;  2PZT A;  3KLS A;  2JSO A;  2QDB A;  3CRL C;  3MFY A;  3GV6 A;  2A69 D;  1A15 A;  4R8I A;  1PLF A;  2B8G A;  2J4X A;  2R92 B;  2F0W A;  3MXP A;  4RGM A;  5CGK A;  4IUR A;  3ND9 A;  3NUC A;  4C3H B;  1G91 A;  2G9H D;  3K59 A;  3FVQ A;  5BN4 A;  2EZV A;  3WOF A;  1LO5 D;  1XXG A;  2A5H A;  2AUK A;  3HOW B;  1X32 A;  2JP1 A;  1CQF A;  1BO0 A;  2EY5 A;  4Y7N B;  3VR6 A;  4KJO A;  3MC0 B;  3N6R A;  3R8B A;  3LWU A;  1SNO A;  1CHP D;  1RCV D;  3V96 A;  2D2C C;  2FJ2 A;  1GJX A;  3PMF A;  1AP0 A;  2B2Y A;  2BCO A;  1B9M A;  3S14 B;  4PMB A;  4XYQ A;  3M3Y B;  4KK7 A;  3I4M B;  5AFW A;  1AZQ A;  5EKL A;  4BY7 B;  4ZLT F;  1WVL A;  2YYZ A;  1CA6 A;  2DNC A;  4KY5 A;  4G7H C;  4MIU A;  1RDP D;  5C6A A;  3EVQ A;  4KMU C;  5IGB A;  1WD1 A;  1KLU D;  4TRD A;  1PRT C;  4IZ8 A;  1G2S A;  1Y8N B;  5E3F A;  1BOS A;  3HOU B;  4HCS A;  2NVX B;  3D3R A;  2DN8 A;  1PXU A;  5KIX A;  1VCI A;  1FNU A;  4HAE A;  4KD3 A;  4I7Z C;  3OW7 A;  5IGF A;  4BBR B;  4RAU C;  3K5L A;  4DGZ A;  5JEA J;  3QJY A;  3S9W A;  3I73 A;  1II3 A;  4RFB A;  1UAP A;  2XNA C;  3U9S A;  3HS0 C;  5JPM C;  3X3M A;  1Z7T A;  4L6T B;  3H3V C;  1B4O A;  1BNZ A;  5DM7 3;  3I4N B;  1D6E C;  4J6H A;  3C3L A;  1IKM A;  2L11 A;  4DXF A;  2K5D A;  3S2H B;  2NVY B;  1YNN C;  1D5Z C;  1ESF A;  4KI0 A;  4ABN A;  4A3M B;  3IFD A;  3OWE B;  3S1Q B;  2A6H D;  2R93 B;  2F0K A;  3HOZ B;  3K57 A;  5COY A;  2NUC A;  4F88 A;  1BDO A;  1TWC B;  3TDQ A;  4FXD A;  1MSG A;  3DUZ A;  2B2V A;  4EQO A;  1LAC A;  1PZJ D;  3R3O A;  3FPU B;  1RHP A;  4DAY A;  3Q23 A;  4RKB A;  5EKI A;  4QF4 A;  3L9A X;  3R2I A;  2R6G A;  3RUZ A;  1Y1W B;  4XYO A;  3TP8 A;  5KYL A;  4FXG C;  3RD4 A;  3O13 A;  4U68 A;  4QUC A;  2L9H A;  5KND A;  2F4I A;  3NTK A;  2B8F A;  4DAP A;  3C1F A;  1I4X A;  3NXW A;  4K8I A;  1B3A A;  5HGT A;  1QB5 D;  4TSS A;  4A3D B;  2J7Z A;  2KA7 A;  4IFD G;  2F1M A;  3A8I E;  1TWA B;  1PRT D;  4N9P A;  2EYP A;  1ZXT A;  1EY0 A;  3P7J A;  2EY1 A;  1GUT A;  3NTI A;  1JB3 A;  1MI2 A;  2XN9 C;  3ERQ A;  4HCE A;  3QIA A;  5KNB A;  5CV6 A;  2K28 A;  3BVG A;  4DXG A;  4EQN A;  3VYT A;  1LTA D;  2ZT9 C;  2JXM B;  4KN4 C;  4RGT A;  4R8N A;  4QB4 A;  5C44 B;  1F9R A;  5I2Y A;  4K5V A;  1FD7 D;  3I91 A;  1KAA A;  4KN7 C;  2VUM B;  3NE5 B;  2K1B A;  5D14 A;  3HOY B;  1NCV A;  3W3A A;  3D6C A;  4XIG S;  1LAB A;  1PZI D;  3IL8 A;  1I6V C;  3PUY A;  3VYU A;  3PUV A;  1LV9 A;  1E2V A;  1UUP A;  3I90 A;  5JPN C;  3T4A C;  4K5W A;  2WB1 B;  5CC4 A;  1TY2 A;  2CQA A;  1PRT B;  1JWM D;  3UI2 A;  1ZYR C;  2LS0 1;  1STA A;  4HMI A;  4IUU A;  1EWH A;  2WV6 D;  3R2T A;  2NB0 A;  4C3I G;  1EIG A;  2Q8R E;  1DXM A;  4PNY A;  2SNM A;  2IW3 A;  3ND8 A;  5ELE A;  2EJF C;  2N88 A;  3VYS A;  1LTR D;  1D1K A;  3D4R A;  5JVH 3;  4DK0 A;  4JBW A;  1T5E A;  3KF8 A;  1TR5 A;  2NN6 G;  5D3D A;  1B9N A;  1GOZ A;  1AFP A;  2ID0 A;  3P1H A;  1BUV T;  4IUN A;  1Z47 A;  4CKC A;  5IGG A;  2XRQ D;  2RQX A;  4C3I B;  4IUP A;  4ZKB B;  3DHQ A;  4QUF A;  3L3O C;  4OGQ C;  1SNC A;  5ELF A;  4A3J B;  5M5W B;  3T16 A;  5LHY 1;  1DON A;  2IT1 A;  3MXN A;  1O7Y A;  4KHV A;  4OO1 H;  3BDO A;  5EGT A;  5DNF A;  2ZXR A;  3K5N A;  2C9O A;  4ZQ3 A;  1Q90 A;  2OF1 A;  2RA4 A;  4KKT A;  1BCP F;  3C46 A;  4C3J B;  2ZXO A;  1HA6 A;  3A56 A;  3KLR A;  4H13 C;  2F3V A;  4Z9C B;  1FYC A;  4DN4 M;  5FO8 B;  5K36 H;  2E2J B;  2M00 A;  4RH6 A;  4RKL A;  4FF3 A;  1VDZ A;  4HN7 A;  2WIN B;  4QCL A;  5C3W A;  3PIO 3;  3HRZ C;  5G3L D;  2RDG A;  4DNR B;  2RVL A;  3ONA B;  2BE5 C;  4DA2 A;  3HOX B;  2GA4 B;  1ZYR D;  2JEB I;  2F0I A;  1TS3 A;  4BBS B;  3K7A B;  1KAB A;  3BYY B;  1Y1V B;  1PYW D;  1UNS A;  2F0P A;  2NVQ B;  4FVM A;  4CHT B;  2VB2 X;  2K6A A;  1R4Q B;  1F77 A;  4L8J A;  3SK4 A;  3D31 A;  4RWS C;  2PW5 A;  5EPK A;  4V0B A;  5JEA H;  2B2W C;  3BVZ A;  4ZK9 B;  4ZAI A;  1ENA A;  1GUS A;  5CV5 A;  3WDN A;  4B9W A;  2JA7 B;  2H1E A;  5COR A;  1OXS C;  3K6O A;  1WTW A;  5EBC A;  4IFD J;  1PTO H;  1GUW A;  2K7V A;  4K2K A;  2KHS A;  2SEB D;  1BCP C;  1I4H A;  1LT6 D;  2NTT A;  4BS9 A;  5E4W C;  1S5C D;  2MGS A;  1TS5 A;  3DWA A;  3EQL C;  1B50 A;  4RHS A;  2OT2 A;  2XSC A;  1K83 B;  2AWO A;  2WKC A;  1MD2 D;  3PO2 B;  1YNJ C;  2F0N A;  3AB9 A;  1WTP A;  1O7Z A;  5T1I A;  2KUM A;  3VR2 A;  1WTQ A;  4F87 A;  1MBY A;  1C48 A;  4RHR A;  2BA0 A;  1QCB D;  1DOL A;  5EPL A;  1NR4 A;  1C8C A;  2SNS A;  1VMC A;  5EBD A;  3TP6 A;  2IX1 A;  1JOO A;  1A2T A;  5JOB A;  1F9P A;  5C4X B;  1V1O A;  1SJE D;  4Q0F A;  2PO4 A;  1LTI D;  2VNU D;  1G6Z A;  3JAM E;  3IKJ A;  4OO1 I;  2PZW A;  3K0Y A;  1LLR D;  3PUZ A;  1SMY D;  1QNU A;  4UAI A;  4DFA A;  1K8M A;  3AMU A;  2NYZ D;  3DXJ C;  3NBI A;  4WFN 3;  1EY4 A;  3SR1 A;  1UEA B;  1B44 D;  2FFK B;  5KRU A;  5ELB A;  2PCF B;  1BBX C;  3OWF A;  2BE5 D;  1GHJ A;  4IN3 A;  5E1F A;  1F2Z A;  3SK5 A;  1V43 A;  2HDM A;  3LNN A;  3J81 E;  2NBF A;  1HUN A;  3Q0A A;  3GQB A;  2XWB B;  1BXT A;  4CBV A;  1SYF A;  1QIL A;  2PPB C;  2J0T D;  4ID6 A;  3KK7 A;  2DY7 A;  4NKL A;  3M7N A;  2EE1 A;  1O78 A;  3CU7 A;  3D6W A;  1J9O A;  4FF2 A;  1QE6 A;  1ENC A;  1SDF A;  1SNM A;  4QMG A;  5DM6 3;  1SXT A;  2BA1 A;  2CHB D;  1SNQ A;  4A3K B;  1AZP A;  2ICI A;  5C4Z A;  1KNA A;  2R61 A;  4FF1 A;  2MPM A;  3A55 A;  4ODG A;  3JAM L;  5M3M B;  2PYK A;  1EYC A;  1TQO A;  3S2D B;  3E0J A;  2AQ3 B;  1EL0 A;  1M8A A;  3DEO A;  2EJG C;  1SE3 A;  5CMD A;  4FNF A;  5EKK A;  3MHB A;  3P75 A;  3IAY A;  3ZYY X;  3OIQ A;  1SYB A;  4MHE A;  5DEH A;  3F2U A;  3VA7 A;  1LTT D;  1H9J A;  2R7Z B;  1DJR D;  1GHK A;  2LY7 A;  1HA5 A;  1LT3 D;  2D62 A;  2KCN A;  4S3S A;  5C0X I;  1ET9 A;  5LL6 S;  4CJ1 B;  3J81 L;  1M4V A;  2Y0S B;  3A8J E;  1EIH A;  2X6G A;  3DMU A;  3D4D A;  4OHJ A;  3V05 A;  5LL6 X;  4H44 C;  2EYF A;  4CKB A;  2JA5 B;  3Q22 A;  1GUO A;  1WTV A;  2F0U A;  5CV4 A;  1JWS D;  3FRP B;  3PV0 A;  1S4Z A;  3PIP 3;  3HZX A;  2EOT A;  3ERO A;  4DAV A;  3HEJ A;  2AQ2 B;  5A35 A;  2AQ1 B;  1Y69 U;  2AUJ D;  2Z8L A;  1LTB D;  3MVV A;  3LWE A;  2EY6 A;  2HUG A;  4OL7 A;  5FLX L;  5CBE E;  2F3W A;  2IWH A;  1STG A;  3PUX A;  1BR9 A;  1TWG B;  3TN2 A;  1Y8O B;  1IKL A;  1ICW A;  1S5B D;  1PTO F;  2FMM A;  2FHT A;  4RGO S;  4KY6 A;  3SK8 A;  2L4N A;  3N52 A;  3S17 B;  4LJZ C;  1U4L A;  4C2M B;  3HOV B;  1IW7 C;  1ET6 A;  1EQT A;  1FNW A;  1ROD A;  1SSO A;  2Z4I A;  5KYI A;  5I2X A;  1TS2 A;  2TMP A;  2K05 A;  3VA5 A;  3GV3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...