1PTOF

The structure of a pertussis toxin-sugar complex as a model for receptor binding
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
98
structure length
98
Chain Sequence
LPTHLYKNFTVQELALKLKGKNQEFCLTAFMSGRSLVRACLSDAGHEHDTWFDTMLGFAISAYALKSRIALTVEDSPYPGTPGDLLELQICPLNGYCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords PERTUSSIS TOXIN (SUBUNIT S1)
publication title Structure of a pertussis toxin-sugar complex as a model for receptor binding.
pubmed doi rcsb
total genus 17
structure length 98
sequence length 98
chains with identical sequence L
ec nomenclature
pdb deposition date 1994-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF09276 Pertus-S5-tox Pertussis toxin S5 subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ptoF00
2XRQD 3MC0B 4RGOS 2AQ2B 3BYYB 1EWCA 4RCOA 2O2LD 1JWMD 1SEBD 2RDHA 3SEBA 2AQ3B 2XRSD 5ELDA 1JR0D 1RF2D 1LTID 1PZKD 2XNAC 1AN8A 3TSSA 1HA5A 5FK9C 1EU3A 1FNVA 1I4RA 5ELCA 1UUPA 1PZID 1S5CD 1V1OA 4DXFA 1L0YB 2WV6D 2Z8LA 1V1PA 1CHPD 1AW7A 1V1PB 2IJ0A 1I4GA 3DWQA 1TY0A 4L63B 1ESFA 1BCPB 1JCKB 1STEA 1S5DD 2RDGA 2R61A 1MD2D 3DWPA 5I4DA 1D6EC 4OHJA 1KTKA 4BWGB 1B44D 1L0XB 1BCPD 2CHBD 2NTTA 2SEBD 1TS3A 1EU4A 1DJRD 3O13A 1PRTC 1D5MC 2ICIA 4RGTA 1PRTF 1S5BD 5ELBA 3BZDB 1FGBD 1LLRD 1RDPD 4K6LA 1S5ED 1FNUA 1CT1D 1LTRD 3DWAA 1FNWA 2QEJC 1SJHD 3BVGA 1LT5D 1HTLD 1LO5D 1SE4A 1S5FD 1GOZA 1B1ZA 1BXTA 1SE2A 3GP7A 1PTOC 4RGMA 1PTOF 1D5ZC 5ELFA 1CQVA 1XXGA 1I4HA 1PYWD 1KLUD 2G9HD 1TS2A 1EEID 2J4XA 1EEFD 1CK1A 3EFXD 5ELEA 1SBBB 1HQRD 5FKAC 4TSSA 1HXYD 1BCPF 1SJED 1TY2A 1LTTD 4ZYSA 1XTCD 1RD9D 1LT6D 3KLSX 1EFID 4O1NA 4RGNA 1PRTB 1LT3D 1PTOH 1LTSD 4Z9CB 3R2TA 2QILA 4RHSA 1ET6A 1G8ZD 1KLGD 1I4XA 1PRTD 1SXTA 1LT4D 1M4VA 3V05A 4C56C 5D3DA 2IPKD 1JWSD 3CHBD 4RFBA 2NTSA 1ENFA 1LTAD 1SE3A 4L6TB 1PTOB 1T5XD 1PZJD 1UNSA 5D3IB 1CHQD 1LTGD 1TS4A 2XN9C 3OWEB 1JWUD 1LTBD 1I4PA 2TSSA 3BVMA 4RHRA 2AQ1B 3R8BA 1BCPC 1D5XC 3MFGA 1I4QA 3BVZA 3URYA 4DXGA 1PTOD 3W2DA 1F77A 1QILA 4RH6A 1TS5A 1ET9A 1FD7D 3R2IA 3BYTB 1RCVD 4UDUC 1DYQA 1JQYD 5TSSA 3EA6A
chains in the Genus database with same CATH superfamily
1VQ6A 4JBWA 5C4HA 3CCSA 2VUMB 5KRUA 1ILQA 4MNOA 4OX9L 3GTKH 1IZ6A 4BXXG 5FJ8H 1WOCA 3OOCA 2K5HA 2R92B 2EQSA 3SK8A 3AU7A 1XNRL 1S5CD 1KXLA 2OT2A 4JCVE 3ZYYX 4GNXA 3MXUA 1FGUA 1J9OA 3W1BA 2R92G 5C0XH 3QIAA 1Q1EA 3MZ5A 5ISRA 1QVGA 3GTPH 1N8RC 1STEA 1SYEA 1NUCA 2K14A 3QJYA 3UDXA 1S72A 4GKJQ 2KCMA 3L3OC 3GTQB 4DPGA 4P75A 5J1ZA 3CPFA 1I6HH 1D5MC 3UDGA 2EYOA 2BE5D 1DCZA 4KY6A 1SRUA 3DUZA 4DAYB 2Q2TA 1IL2A 1HRJA 2BOSA 4CKCA 1F9PA 2UXBQ 1S40A 2RCFA 2RA4A 2EJGC 2NVQH 4WJWA 1OXTA 2VQFQ 1JJCB 2K4KA 2IX3A 5IT9L 4DGZA 3S9WA 2D9UA 4KV6A 3WOEA 2B2TA 4YIJA 3P1HA 4EQPA 3I72A 1E0BA 2I5MX 3I4LA 1EIHA 4MTNA 5M5XB 1O7LA 4B3SQ 5CV7A 4BBRH 4CBVA 4AH6A 5LMUL 3SXHA 3HS0C 1YEZA 5KYIA 2PMZB 2VW9A 3J7AV 3CF5A 4IZ8A 3VYUA 3RLOA 2BDNA 1CQFA 2Z4IA 3Q8DA 4OWXB 1Y69U 4TVAB 1JWUD 3K0XA 1LTBD 3LNNA 1A8VA 3OWFA 4B08A 2EZVA 4NPSA 4C2MB 4JI0L 1XTDA 4UPAA 5E7NA 1PFMA 5JJLA 1PYBA 1QILA 4HCEA 2B2TC 1IHZA 1CM9A 3M4OH 1NSNS 1JORA 2XRQD 2EY5A 2F0IA 4CJ0B 2E5LQ 5F2DA 2KENA 4FVMA 3GO5A 2N49A 2R3ZA 4PZ7A 2E8GA 3F2CA 2MHVA 1QUQB 4BS9A 1HNZQ 3BS1A 3MHBA 1IBKL 5KNBA 4UP8A 4DXFA 1AZQA 2K5VA 1V1PA 1IW7C 3K5NA 4L63B 5E4WC 3AEVA 3M4PA 3NTIA 3H0GH 5G3LD 3S1MH 2RDGA 2JA9A 4FF4A 3S14H 3NBHB 3WDNA 3KBGA 3PO2H 4HIDA 2UXDL 4B9WA 3VR6A 4M8AA 1QVCA 1FGBD 2PYKA 5T1GA 3U58A 4TQUS 4KHPQ 4ZCKA 4CKEA 3U9OA 1GOZA 3HEJA 1BXTA 2OTJA 1X3GA 1EUJA 1HHVA 2UU9Q 2ALYB 2FXQA 3LWEA 2DUDA 5LMNL 1YVCA 5JAVA 1SNPA 1EY0A 1WTPA 5ELOA 1SBBB 5A2QE 1HQRD 4IQZA 2QF7A 5IYBG 3AFQA 1WTVA 4LF4Q 4K0KL 3E9HA 4NDXA 5GAGC 2A19A 1XTCD 1RD9D 5EKIA 3M7GA 3GTMB 4B3RQ 1A3TA 4ODGA 4Z9CB 3K7AH 5DNFA 1WI5A 4JK1C 1G8ZD 2DJFC 3RLFA 4BBSB 4CDDC 3BZCA 2Z9HA 1XJVA 5EBCA 1GVPA 1YHAA 4X66L 2NTSA 4BBSG 2Z6KC 1TS4A 4L5QA 1J8IA 1MHWC 5EBDA 3MA2B 3FHWA 5IYDG 1PLFA 3R8BA 1D5XC 3T13A 1G6PA 3A8IE 1SYGA 3PUWA 1F2ZA 4AIMA 1FD7D 1TWFB 1Y1WB 1PH8A 1P16A 2HDLA 1I5FA 3IRBA 3PGZA 2H5XA 2RCNA 1B3QA 3PQIA 1N34L 1XNQL 2F0DA 2HQEA 3MWYW 1YNNC 1Y1WG 1Q8IA 3J80L 5IYCG 4GOPA 2PI2E 2AQ3B 2XRSD 2K50A 2L15A 4K5VA 1EYDA 3EQLC 1E2VA 5C4XH 3A7AB 3P20A 3OW7A 4IPCA 4FXDA 3KF6B 1GD7A 3GTLH 2OXPA 4IOAA 4DKAC 2K03A 2Z4HA 4U673 3PO3B 3D8GA 1ESFA 3DM3A 3NTHA 2EY1A 1YJ9A 1IKLA 1BO0A 2JQOA 3OIPA 1A3UA 2L12A 3RZDH 1DOKA 1TVXA 3TEHB 4EGVA 3S1RH 3GTOB 1LV9A 1DJRD 1EY9A 2VXWA 5C0XJ 3TS0A 5ELBA 1SNMA 2UUCL 3NP8A 2HCIA 2F0UA 3CCEA 3AMUA 3KBXA 4JI8L 2UUBL 4A3DH 4IJHA 2R6GA 4N9PA 3J7YW 3S1QH 4X6AH 4I7AA 1EZ8A 1B1ZA 2CKZB 3I7FA 4DNRB 1WYDA 4JI3L 5C4JH 3H91A 5IP7G 3IAYA 2TMPA 1XXGA 1I50B 4YY3L 2J4XA 2JA8B 2EPBA 1VQLA 4DV2L 4ZLTF 2Y0SE 1HXYD 2FMCA 5LL6X 4A76A 5EJWA 4G57A 3BZKA 4WORA 1D7QA 1IYJB 1I94Q 4JI5L 2JA8G 2EYLA 1QOHA 4FF3A 4ZQ3A 4DR6Q 4B3MQ 2F0HA 2FHTA 1K3BC 4DK6C 1X56A 2ZJRA 2LMCB 2ENBA 5A35A 2H4OA 5GROA 4NXML 2NVXB 1UNSA 5CV5A 1KDCA 4A3LG 2Q8TA 1ZKOA 3X3NA 4IFDJ 4FXGC 4ULLA 4IPGA 2CWAA 1BVSA 3I8ZA 1NCVA 3RN2A 4K2KA 4A3IB 1F9RA 1TWAB 1Z7TA 2BE5C 2AKWB 5M3MG 2VQEL 2A69D 4RAUC 4A3IG 4MZ9A 2F0MA 1EQVA 3JAML 4QIWE 2OCEA 4JYAQ 4H44C 5K36G 4CGYB 3Q22A 1U9RA 3K8AA 3NHHA 3HRZC 2D0PA 3SHLA 4QJFA 4I65A 2WFWA 2F0FA 1AW7A 3RR5A 4ILWA 3KLWA 1VQ9A 3TS2A 3GTKB 1JT8A 4HMJA 3VDYA 1JCKB 4NMZA 2WAQE 2KUMA 1KTKA 4BWGB 2F0NA 1C48A 5FJ8G 4B3TQ 1D2BA 3SK4A 1L2FA 4FYDA 1TS3A 4XTCS 1KQSA 5BR8Q 1YITA 3DM1A 4HN7A 4JOIA 1RDPD 3G48A 5AJ3Q 3T51B 4DV6Q 2CH4W 4XT3B 2DJGC 5C0XG 1XMQQ 3VR4A 3J81j 1SE4A 3MXNA 5C44G 4GZYC 3I90A 1I6HB 1UE1A 2D5DA 3PSIA 2PNRC 1RIPA 5EPJA 2NWGA 1FYCA 1YJNA 1E3PA 3VA5A 3ICEA 4CKBA 2NVQB 4LF9L 5C0XI 4GKKQ 1CKMA 2UUAQ 4RGNA 2ZM6Q 4LF5L 4DR7L 5C5MA 1JB7A 4QB4A 3EBEA 3J81L 4BA2I 4AYBB 4RHSA 3BDOA 3IKJA 2F0SA 4JC0A 1MJEA 1PRTD 3KLRA 3NTKA 3CCMA 4BBRB 4JOIC 3C2PA 5D3DA 4AYBG 4HJAA 4FDBA 3CU7A 2UXCL 1CHQD 4HJ5A 4BBRG 2K32A 3IFTA 1YI2A 2K52A 2DNEA 1H95A 4LFAQ 4K8IA 4IFDG 1RCVD 3AFPA 4DR5L 3ULPA 1T5EA 1KABA 2F0EA 3EA6A 1HTPA 3M3YH 2MO1A 4DUYL 1EYGA 2K33A 1V8QA 1JWMD 3Q0AA 1K8MA 5NUCA 4KD3A 5AFWA 1Y1WH 1WD1A 1AN8A 3M4OB 1EU3A 5IYCH 2IX0A 2AUKA 3T1YQ 3C3LA 1JC7A 4MTKA 4IFDI 1L0YB 2WV6D 3HOWB 5E1FA 1SFOH 2HHHL 1I4GA 2CVRA 3ERSX 1VQ4A 2ZTCA 3FEWX 3U4ZA 2O5IC 3HOWG 1WVLA 5I4DA 2ES2A 1D6EC 4OHJA 2F0QA 3MEFA 3O13A 2QEXA 1GUTA 1YNXA 1E7ZA 3E0JA 4POFA 1FVIA 3FP9A 3EN2A 5CORA 3H0GB 3S1MB 2B63G 3S16H 1STNA 1TWCH 1UE7A 1PFBA 4ZRZA 4UP9A 3S14B 4LJZC 2H1EA 3J7A5 3PO2B 3KF8A 1A15A 4X3SA 4ME5A 2KJXA 4A3KG 3T16A 1KIXA 2L11A 3PO2G 1Y1VG 4XQJA 2F52A 2QA4A 1K8OA 5KGUA 1ILPA 1WTRA 4LF7Q 2AHOB 3M4QA 2KQ3A 1X3FA 2MO0A 1BQQT 1EY6A 1X32A 4UAIA 1UE5A 2PMZE 3MAQA 1QNKA 2AWNA 2Q2UA 4WJ4A 4XQNA 2JN4A 4IUTA 1I4XA 1XPRA 4JPBW 1O7YA 4KD4A 2C35B 1FJGQ 4KI0A 4DV7Q 5IE8A 1PH5A 1PZJD 1STAA 2RDFA 1CA6A 1ASZA 1ML0D 4LFCQ 2EY2A 2TSSA 3BVMA 3A8JE 4RHRA 1N36Q 4GKJL 4A3LH 3CXCA 1PH9A 4DXGA 4LMQD 3CC4A 2RHSB 2NZOA 2KCTA 2C9OA 1SYBA 1PH3A 5C6AA 5JJKA 5IGEA 5M3MH 1MBYA 3C46A 5BN4A 2AQ2B 2UXBL 2A73B 2B8GA 3SDZA 2F3IA 2RDHA 1AZPA 3S17H 1HNWQ 2V1CC 2VQFL 2PQAB 2A6ED 5IT9E 1U4MA 4OGQC 1DZ1A 3NEMA 4Y7NH 2YTXA 5K36H 1WCMH 2IJ0A 4B3SL 5ELNA 3U50C 1VQBA 1KC8C 4RMFA 5C4XB 2B8FA 1S5DD 2Q2HA 3DWPA 1CSPA 1L1OA 3Q24A 3GTLB 5HGTA 3HFZB 3E5SA 2QGQA 5C4XG 2K04A 2ICIA 5GQOA 4LUZA 1STGA 5FOBB 3T56B 1HNXL 4K6LA 1Q81C 3MFYA 5KIXA 3VR3A 1K0RA 3CMEA 4JVZA 2VL6A 1JOOA 3RZDB 3H94A 2IT1A 3K5LA 1XX8A 1S5FD 3NWTA 4DV4Q 3S1RB 1VS0A 1VQOA 1PH6A 3D4WA 5C44H 1D5ZC 1RTOA 4GLXA 1PHJA 1NJIC 3KJPA 4QY7A 4DAVA 1I4HA 1E22A 1B7YB 2A69C 3FKIH 3BDLA 4DV1Q 4A3DB 1G91A 2JSOA 1EEFD 5LHY1 3S1QB 4KLKA 1MKHA 3V2TA 2E5LL 3VYRA 1NE3A 5J39A 4A3DG 1EIGA 5C4JB 1V9PA 3G4SA 1LT6D 4IPDA 1HNZL 4DV5Q 1SAPA 3PMFA 4FF2A 1SMXA 1U5KA 4X62Q 4DR4Q 3LWUA 4LFBQ 1VQAA 1EL0A 4R4QA 1AE3A 2WB1B 2F3VA 1VMPA 1J6QA 2MP1A 1M8AA 1W6JA 2K6AA 3OSOA 5CGKA 2I0QA 3K59A 4GNXC 2WB1G 2ZTDA 3CCVA 1I4QA 2E74C 3W2DA 1SDFA 5FLXL 4XYOA 2IX1A 2JEBI 2JE6I 3GD7A 4N8FA 1DOMA 1GUGA 3DHQA 4P71A 1JQYD 4KHPL 3M7NA 4IUVA 4IFDH 4K2LA 3PF5A 4YWLA 1TU2B 3BYYB 3A5ZB 1VDZA 3CW2C 1Y8OB 3L9AX 3NWSA 1VQDA 2CQOA 2PI2A 4HCSA 4K5WA 3SEBA 2UU9L 1X55A 1BOSA 2NZ1D 2XNAC 3D31A 1B3AA 4GN4B 4QUFA 5ELCA 5T1IA 1HH2P 1GUNA 1H9SA 4DUZQ 3E0EA 1GJXA 4HIOA 1HPCA 5HY6A 4HTHA 3UDIA 4LF4L 4PMWA 2B2WA 2M2LA 1TIID 2JJQA 4HJ7A 1PYSB 2MFIA 3A0JA 3U4VA 4B3RL 1XNRQ 3F2DA 1VQ5A 1L0XB 3HOWH 1HUMA 3CC2A 1IL8A 4O0AA 1PRTC 2F0JA 5BN5A 4LUOA 1KNEA 1LTRD 4DNIA 5EPLA 4A3BG 4IUNA 2HDMA 3KUPA 3MXPA 3NBIA 3TQYA 2EYPA 3I4NG 1KHIA 2L1BA 1BBUA 3L0OA 3UE0A 2B63H 1CA5A 3F1ZA 1SYCA 2A74C 1SN8A 2EYMA 3N52A 4EQ5A 2F0KA 4JV5Q 2ZJQA 4A3KH 2E2DC 3OW2A 1SNCA 3ERQA 1Y1VH 4LF8Q 3G6JB 5ELEA 4JI7Q 3MEHA 5EQ0A 1B50A 4TSSA 3F2BA 4HIMA 1P8LA 1QCBD 3J80E 2HIVA 5HGQA 3QOJA 1LUZA 4PZ8A 4C3IH 5C3EH 3K57A 4DF7A 1EQTA 1MGSA 2RF4A 3A56A 1IYUA 4K6DA 1KLGD 2YYZA 3S24A 2CH4A 2Z6BA 4AQYQ 1TWGH 4PMBA 1C4QA 3ZJYC 4DR2Q 3E6ZX 2PW5A 4K14A 4JI1Q 5D3IB 5IT9c 3H15A 5G3LF 3H3VH 2O5JC 3PUVA 4KKUA 2EYFA 3BVZA 1Q46A 3URYA 2O4XA 4G7OC 2XWBB 4GN5A 4QF4A 3TP8A 1TQOA 4A3GB 2K28A 4DV0Q 3R2IA 4XYQA 3HOZG 1X54A 3T4AC 3HKZB 5IWAQ 1ZYRD 3DLLA 1HR0W 4A3GG 1KAWA 5IODA 2OF1A 1T9HA 3L7ZC 3HKZG 1RF2D 3TSSA 3J7ZC 2EIFA 4DV3Q 1XMOQ 1STYA 5J3BA 3LGJA 3M3YB 5IGDA 1DXMA 3PF4A 2LKVA 2DY7A 4ABNA 3D3RA 2EE1A 5KNDA 4C1NI 4IN3A 1PV4A 1A2TA 2XSCA 4NKLA 3OIQA 1I94L 4A3JH 4OIJA 2JK8A 2LXKA 3KDFB 3RNUA 4DR6L 4B3ML 3HGBA 4BY1H 1SFOB 1R9TH 4OEMB 2XVSA 3QB3A 1CKNA 4KHVA 5KYLA 4YCVA 1OXUA 2YTYA 4A75A 4DR1Q 1BUVT 3B6YA 3DXJC 4IURA 2KEDA 4X65Q 1HQMC 1LTLA 2PPBC 1BNZA 3S16B 1TWCB 3RLNA 4A3CH 1B8AA 3RUZA 2RSOA 2L5TA 3MXGA 1QZGA 2DGYA 2B2VA 2NBFA 3EFXD 2IWHA 2K05A 1I3QB 3JAME 3H3VC 2ZTEA 1SYFA 1H9KA 2R7FA 3KLSX 4M1UB 4JYAL 2A6EC 4QL5A 4G7HC 2ID0A 4X64Q 5CV6A 4AYBE 1QWYA 3EVQA 1E2WA 3QWNA 5A2QL 4GOPC 3V05A 2HD3A 3K81C 1IYVA 1VMCA 2WKCA 4L6TB 1SE3A 4CJ2C 1LTGD 3KYHC 5FLMG 1BBXC 2F0TA 4B3TL 3MFGA 1IBLQ 5BR8L 1Q12A 1D1IA 3I56A 5AJ3L 3AB9A 3BYTB 4UDUC 1HR0Q 3A7LA 4DV6L 4DFAA 2B2VC 1O7ZA 3AQQA 1HFNA 1XMQL 3MC0B 4ZK9B 1K8AC 1EY7A 2JA6H 1HZ9A 2D62A 1VQKA 1LTID 4P74A 1GHJA 3OTOQ 2OQ0A 3VYTA 2E2IH 3TRZA 1PZID 4JI2Q 4UHVA 5M3MB 2K75A 3HZXA 1MSGA 5JJIA 4GNXB 5DEHA 2CCZA 1K73C 3S17B 2QKIC 2DY8A 3HP3A 4OWWB 1D1KA 3G6EA 4GKKL 2R93G 2UUAL 2ZM6L 2PO4A 4IUQA 4N9TA 1X3PA 4S3SA 4Y7NB 3J81E 1EU4A 1WCMB 3CCJA 3HOUG 3GV6A 4DAYA 1FNWA 1AE2A 2L0CA 3J80c 3DMUA 5IP9H 1SJHD 3T1HQ 4JI4Q 1WCMG 1W2BA 1GUWA 1LT5D 1K8GA 2CFMA 2OEOA 4A3BH 2ZT9C 4ZUJA 1IBMQ 4J15A 1JJ2A 4DU9A 3PIO3 1GUOA 3GP7A 1M1KC 3FVQA 3I4NH 3VR2A 1J5EQ 1CKOA 4IJLA 1VQEA 1A0IA 1VF5C 2GVBA 4LFAL 3J7AF 4X3KA 3UE1A 1YJWA 2UUBQ 4R4OA 1Y14B 2B2UA 1GKHA 3KJOA 4OONA 3TP5A 4A3FH 2K7VA 2VB3X 4A3MH 5C44B 1X3EA 3PCOB 1PRTB 4YHHQ 1X65A 2K5QA 3FKIB 1G51A 4ZKBB 3T1YL 4LK1C 1ET6A 4UP7A 4DK3C 2PZUA 4EQNA 2F1MA 1V1QA 3FKIG 4QMGA 2IPKD 4RFBA 3SK6A 5IGCA 2GVAA 1U4RA 2XN9C 3JC66 3OWEB 4DR3Q 1A3VA 3I4MG 5CBAE 3CRKC 2QDLA 4HSPA 1PTOD 1H9RA 1H9SB 2KEEA 3SVMA 2MJ8A 2YTVA 5IGGA 4C3JG 1QE6A 2A68D 3P75A 1KDAA 1SE8A 5TSSA 2F4VQ 2EYJA 2VZAA 1Q90A 1VQCA 3ULLA 1WTWA 3HOZH 2PQEA 4A3GH 1LABA 4NXNQ 1CFMA 3NE5B 1NAPA 2NZHA 4E6IA 1I4RA 2P5ZX 3SGIA 3CCQA 4R8NA 2NVYH 2FMMA 2NB0A 4HEDA 5I6YA 2IY5B 4LF7L 5KNCA 2V4DA 2Z8LA 3GV3A 4IOCA 2E75C 1HZAA 2R7DA 2M9VA 4C3HG 1V1PB 4P73A 3K58A 3A5UA 4KK7A 1SNQA 4LWCA 2CW0D 1B44D 1NR2A 1G2SA 1BCPD 4DK0A 2EXZA 3BG3A 3AYHB 4R1JA 1SSOA 1PRTF 2OTLA 1QG7A 3BZDB 2N55A 3JAMc 4I7ZC 2QEJC 4FO2A 1FJGL 2HT1A 1Q86C 4DV7L 5GAEC 1M90C 4JBJA 3EROA 4IALA 4LFCL 4BY7B 4LAAA 2K5NA 2Y0SG 5IOCA 4KTAA 2L4NA 1UAPA 3K5OA 1N36L 4K5XA 3PUYA 4RGMA 1F2YA 1VCIA 4EQOA 4BY7G 1KAAA 3A74A 1CK1A 1ASYA 1ZYRC 2B63B 2ASBA 3GDEA 3OMCA 1BCPF 1E1OA 1HNWL 1LTTD 2F4IA 1K83H 4C1NK 4HJ9A 2XWJB 1II3A 2EJMA 4A3KB 4MHEA 2KECA 1Y1VB 5EKLA 2ATWA 1I3QH 4DN4M 1SXTA 1VQ7A 2FINB 4QCLA 2WB1E 2B29A 2L55A 1S3OA 5CR3A 1ENFA 1JOKA 2LSSA 4C3IB 3GQBA 5C3EB 5L37A 1RODA 1JMCA 5FLMH 3CQZH 3MTSA 4C3IG 3RN5A 5C3EG 2ZXOA 1TWGB 4B9XA 2GA4B 3HOVH 1A63A 3W3AA 3S2HH 3D4RA 4RGOS 3CCRA 3J81c 2K01A 4RCOA 4DV4L 2WAQG 2SNSA 4L8JA 2MUYA 2VB2X 1PZKD 5CYUA 4F88A 4GOPB 2YU9H 2F3WA 1B9NA 3FDTA 1K0SA 3A54A 1CKNB 4N8X1 5JPNC 3KF6A 4DV1L 2N8NA 1EWIA 1A2UA 4F8MA 3GTGH 2JA7H 3QOLA 2E2HH 4RA8A 5I9PA 1TY0A 1Z6HA 4OELB 1SR3A 1N33Q 2JP1A 4RWSC 1R4QB 2NYZD 4DV5L 3H3VI 2R93H 4JI6Q 4X62L 4JBKA 4DR4L 4RGTA 1FL0A 4J1MA 4LFBL 1DONA 1N32Q 1HFGA 3HOYG 3HOUH 1S5ED 1ENAA 1CT1D 1NNXA 2ICEC 3F2UA 1D8LA 1XYIA 4A3JB 4X3TA 1BBWA 2ZXPA 4R9WA 2D0OA 5DAUA 5D14A 4ZAIA 2R7ZG 3J80i 4BY1B 5C3WA 4A3JG 1R9TB 1EQRA 2G9DA 1EFWA 2QW7A 2M00A 4BY1G 1CSQA 2ZJPA 2F0GA 1EEID 3CAMA 1TR5A 1X6OA 1LM0A 1NMGA 3I4OA 1SMYD 3D0FA 1RJTA 4G7ZC 1SJED 3Q6SA 1TKWB 3K0YA 4O1NA 4QUCA 1PTOH 2NN6G 1YIJA 1XPOA 5JEAH 1HUNA 4DUZL 1QNUA 1CTMA 2WINB 4YWMA 3NENA 2F0VA 4YWKA 4A3CG 4LF6Q 3F8TA 1K9MC 1AP0A 3PIOA 1VQMA 2VUMG 2Q2IA 2LXJA 1FR3A 2Q8RE 3KLSA 1YHBA 3VR5A 1QVFA 4L5TA 2I46A 2NN6I 1WTHA 3I4MH 2KOLA 2L9HA 3K7UC 4J6HA 3SE0A 4GN3B 4DAMA 1L1OC 2A5HA 3QO2A 3HKZE 3CRLC 4C3JH 1VQNA 2SOBA 1RTNA 4A93H 1C9OA 3G71A 1HJPA 2DN8A 4O2DA 1SEBD 1U4PA 2A8VA 4DK1A 5C3XA 1EOTA 4KMUC 1QZHA 4JV5L 1FNVA 5CV8A 4NP5A 1ZEQX 1EWHA 2E2JH 2B39A 1OO9B 2ZXRA 4OIKA 3NK9A 1Q7YC 4LF8L 4XXEA 4YCWA 2WIIB 2PZTA 1KRSA 4JI7L 3CD6A 3S2DH 3STBD 2JA6B 3KOJA 4DAPA 5M5YH 4QQBX 4C3HH 4PZ6A 4GLVB 2E2IB 3L2PA 3CKIB 1MD2D 4FNFA 2JA6G 3PUXA 1OXXK 4CDFC 2WACA 3C1FA 4YCUA 1S5BD 1LLRD 2PCFB 4AQYL 3K6OA 1YHQA 1VQFA 5CC4A 4DR2L 1GXDC 4JI1L 2IHEA 2X6GA 4IPHA 3JAMi 1PH1A 4OX9Q 1SE2A 2A6HD 3MXNB 1PTOC 1HNXQ 1PVOA 3P7JA 3QR8A 1VQHA 4DV0L 2A68C 3DEPA 5M5WH 4JG2A 3T53B 3HOXH 1O80A 1TS2A 4BY7H 2N3SA 4A3EH 1Y8NB 4A3BB 5IWAL 5IP9G 3I4NB 3I55A 5I6WA 2HIXA 1EFID 3OYYA 4DV3L 2JXMB 2RQXA 1XMOL 1MIUA 1NR4A 4BA1I 2B2YA 1H9MA 4A3FB 4R4CA 1LT4D 4A3MB 4C56C 3WOFA 1LTAD 5IGFA 1WJJA 1O78A 3E9IA 4A3FG 1JICA 4A3MG 2CW0C 1I4PA 3RD4A 2JA5H 1VQ8A 3CP0A 1BCPC 2B2WC 4PQXA 4H02A 1PA6A 2J7ZA 3Q23A 4POGA 2IHFA 1PH2A 1B9MA 3ULJA 4R8IA 4RH6A 2BH2A 3IL8A 4PMCA 1U4LA 1DYQA 5FO7B 4KHZA 2RSNA 5LMNW 5C4ZA 4EX5A 2EVBA 1A6XA 3RZOH 5LMUQ 4DR1L 4UY8C 1E1TA 2EYHA 3MVVA 5ELDA 5E4XA 1ONLA 4X65L 4ID6A 2Z1CA 3J81i 4OO1H 4HR7B 2B2YC 1EQQA 1STHA 2Z6KA 3HOZB 2NVTH 3TBIB 3S1NH 3X3MA 2KCNA 4WJ3M 5COYA 1PMRA 1KD1C 2EDGA 1WTOA 1GUSA 5FLXc 1IXRA 5IIFA 1KL9A 3HG9A 4CDEC 5DLQE 4LNQA 2NVYB 1OTCA 4IUPA 4X64L 2KBNA 4JI0Q 1NTGA 2CHBD 2NTTA 4HMIA 4ZUIA 5GADC 4LUVA 1K28A 4ZKCB 5DM73 1EYCA 5I2XA 3CPWA 3PIP3 3N6RA 3HOYH 3QG1A 3C1EA 4TKOB 4HJ8A 1MSHA 5M3FH 3KF8B 1IBLL 1ICWA 4JBMA 1VQPA 2R7ZH 2XIWA 4XDXA 1IBKQ 3RMHA 1PYWD 4HIKA 1KLUD 3CC7A 1HR0L 3S15H 4JW0A 1JJGA 3D6WA 1WTQA 2AMCB 1QB5D 2SDFA 2EY6A 2EJFC 3M85A 2LY7A 5K5PA 5CV4A 3W5OA 1KRTA 1LT3D 5H1SE 1AH9A 2XTIA 4RCNA 3OTOL 4KJOA 2LS01 3TN2A 2QILA 4PG3A 4JI2L 1TWHH 1VQIA 2UXDQ 2NN6H 1O7IA 3K5MA 1PXUA 4FXKC 2WP8J 5JPMC 4XIGS 2IL8A 4CDCC 1K83B 1JWSD 3OHXC 3M9BA 3BU2A 5JEAJ 1E24A 4BXXH 3KK7A 3SK5A 4EVOA 1HCZA 1ICFB 2AQ1B 1RL2A 2GN5A 2VUMH 5EGTA 1S4ZA 2RBMA 5I2YA 1VQJA 3TMEA 3BDCA 2SNMA 1G6ZA 1TS5A 5LMNQ 3IFDA 4XQQA 3BJUA 4RKLA 3T1HL 2R92H 4JI4L 1QJOA 4TRDA 3I2ZA 1PDQA 2FFKB 4CJ1B 5D65A 3PO3G 1IBML 5LL6S 3CQZB 4K0KQ 4NB3A 1J5EL 4KKSA 4OWTB 2PQAA 3HKSA 3I91A 1OXSC 1Z9FA 1RHPA 3GTJB 3H09A 3HOVB 2MPMA 3CCUA 1SNOA 5CBEE 3S2HB 1X3QA 3FPUB 2JEAI 2HQLA 1V1OA 3GTQH 1NY4A 4J8QA 3HOVG 1HA6A 1SMYC 2LFNA 4HAEA 3NUCA 4X66Q 3TZDA 2YU9B 3U9SA 2YV5A 3VYSA 3ITPA 2R61A 1CI3M 3NELA 1VF7A 4YHHL 1MI2A 1G2TA 1L1OB 3I3CA 4IO9A 3GTGB 1HZBA 2JA7B 2E2HB 1YNJD 3DWAA 3CCLA 2D2CC 3TDQA 1GM5A 2JA7G 3BVGA 5HURA 4PNYA 2I5LX 4DR3L 2R93B 1N34Q 3SR1A 1XNQQ 2K1BA 2MQHA 1B4OA 5M5XH 1KNAA 1YZ6A 5ELFA 3HOUB 2J0TD 2OQKA 1BF4A 4MIUA 2OWOA 1ZXTA 4PV1C 1JE5A 4QGUA 2F4VL 2VNUD 1B53A 3TP7A 2IW3A 5FKAC 1JOQA 2K5WA 3A55A 2DNCA 3G7LA 3FMCA 3NPPA 4NXNL 3EJIA 2N78A 4X3UA 2FJ2A 4APVA 2RVLA 4WRDA 5IY0A 2Z0SA 3R2TA 4O42A 1N9WA 1AEXA 1F2LA 4V190 4C2MH 1UE6A 2BCOA 3STBC 2UUCQ 3R3OA 3TP6A 1KDBA 4KKTA 1PTOB 4JI8Q 1SLJA 3NQTA 2K5DA 5C5LA 3A8KE 1TT2A 5BN3A 4Q5VA 4JI3Q 5JEAG 2X6LA 5EPKA 3EIVA 1EYAA 2A1AA 1IKMA 4YY3Q 1SYDA 4P72A 1I6VC 2AUJD 4DV2Q 4K8JA 4KN7C 2A6HC 2O2LD 3I4MB 2PNHA 1CZWA 4JI5Q 1JR0D 4IUUA 2Q8IB 3UDFA 1HA5A 3NQIA 1Q1BA 2F0PA 3WWVA 3GTPB 2RKSA 2VY3A 4G4KA 1UUPA 4C3JB 2HCCA 3ND8A 4A93B 4RG1A 5EAYA 1C7YA 1H9JA 3DWQA 3NXWA 2F03A 2F0WA 2AWOA 4OXPA 1BCPB 2F0LA 3PUZA 4A93G 2VS1A 4NXMQ 1PFSA 1BR9A 1STBA 2B2UC 4FF1A 2E2JB 5JJZA 1NMFA 1QUQA 5CMDA 2PW7A 5JOBA 3S2DB 1JB3A 3D4DA 4R4IA 1XPUA 1R4PB 1BDOA 3R93A 5M5YB 1FNUA 1EIYB 2C5CA 4C3HB 2VQEQ 5IYBH 1EZ6A 1HTLD 5JVG3 3LX0A 1GHKA 1EOVA 1EY4A 2I5HA 1DM0B 1EY5A 1Q82C 1PTOF 2MGSA 2KHJA 5M9OA 2XGTA 2QCPX 3NBHA 4Q0FA 3GTMH 1VQGA 1EIFA 1UEAB 1CUKA 1UWVA 2KA7A 4BBSH 3UI2A 1IW7D 2G5DA 1TY2A 2Y0SB 1CZGA 5IYDH 2F0OA 4H7BA 1LTSD 5M5WB 3HOXB 4A3EB 3FPPA 3V96A 4NW2A 3PIPA 1YBYA 3ONAB 1PH4A 1M4VA 3HOXG 1F9QA 4A3EG 1K3RA 3CHBD 4OL7A 4V0BA 1TWFH 1N33L 4MN3A 4GLAC 4HSVA 4JI6L 1ESRA 3VA7A 2I07B 2EOTA 4RKBA 4DA2A 1PFNA 5E3FA 1SNDA 3M4YA 1U0LA 3CMAA 3I73A 2X69A 1N32L 1C8CA 1ET9A 1A62A 1F2MA 2CWPA 4KN4C 2JA5B 1EY8A 1WFQA 1L0WA 2KHSA 4LF9Q 1EWCA 1Z47A 5EKKA 1C0AA 3PO3H 2JA5G 4WFN3 2MNAA 1B70B 4LF5Q 2EXDA 1TXYA 5I9OA 4QIWB 4DR7Q 5FK9C 2KHIA 1SROA 4XT1B 4F7XA 2KCCA 3E3XA 4R4TA 5FO8B 3GTOH 1CHPD 3RZOB 4ME3A 2BA0A 4LW1A 3H0GG 3NSWA 3OMGA 3GTJH 1GO3E 3D6CA 2WAQB 3H6MA 2N88A 2UXCQ 2E76C 3KDFA 1F9SA 2BA1A 1AFPA 5IP7H 2NVTB 2RHQB 2SEBD 3S1NB 3TZUA 1HZCA 2JYOA 3K80C 2B3GA 3PV0A 4OO1G 1DGSA 3W1GA 1WTXA 4LF6L 4A4IA 1OXVA 4ALPA 4DR5Q 1Q3LA 5IGBA 1I50H 4KJNA 3FRPB 1WD0A 1XWEA 1LO5D 5DM63 4KY7A 2HUGA 1W6KA 1BKBA 4DUYQ 2JA8H 1YNND 1E2ZA 2KVMA 4L5RC 3I70A 1JE4A 1CQVA 1V43A 4FP5D 1X9NA 5J22A 2G9HD 3HOYB 4OO1I 1MJCA 3ER0A 4CHTB 4Y52H 3K7AB 5M3FB 5CV9A 2HHHQ 4DNTB 2R7ZB 1NBWA 4ZYSA 3ND9A 2PZWA 5M3FG 1PH7A 2NVXH 5GAHC 1W3SA 4H0LC 3S15B 4U68A 1LACA 5JVH3 4F87A 3DEOA 3OPOA 2CQAA 4GS3A 1DOLA 2WKDA 5FLXE 2BDOA 5FO9B 4A3IH 4KY5A 3TREA 1TWAH 1G291 2QDBA 1T5XD 1UEBA 1RKNA 4L5SA 4H13C 1Q8KA 1TWHB 1ENCA 1LYLA 1B2TA 4P2CB 1YNJC 1F77A 3KFUA 1Y8PB 2NUCA 1DD2A 5KEEA 2BH8A
chains in the Genus database with same CATH topology
4JBWA 5C4HA 2VUMB 5KRUA 1ILQA 3OOCA 2R92B 3SK8A 3AU7A 1S5CD 2OT2A 3ZYYX 3MXUA 1J9OA 5C0XH 3QIAA 1Q1EA 3MZ5A 5ISRA 1STEA 1SYEA 1NUCA 3QJYA 3L3OC 3GTQB 5J1ZA 1D5MC 2EYOA 2BE5D 1DCZA 4KY6A 3DUZA 1HRJA 2BOSA 4CKCA 1F9PA 2RA4A 2EJGC 4WJWA 1OXTA 2IX3A 5IT9L 4DGZA 3S9WA 2D9UA 4KV6A 3WOEA 2B2TA 4YIJA 3P1HA 4EQPA 3I72A 1E0BA 3I4LA 1EIHA 5M5XB 1O7LA 5CV7A 4CBVA 3SXHA 3HS0C 5KYIA 2PMZB 3J7AV 4IZ8A 3VYUA 2BDNA 1CQFA 2Z4IA 1Y69U 1JWUD 1LTBD 3LNNA 3OWFA 4B08A 2EZVA 4C2MB 1PFMA 1QILA 4HCEA 2B2TC 1IHZA 1CM9A 1NSNS 1JORA 2XRQD 2EY5A 2F0IA 4CJ0B 5F2DA 4FVMA 3GO5A 2R3ZA 2MHVA 4BS9A 3BS1A 3MHBA 5KNBA 4DXFA 1AZQA 1V1PA 1IW7C 3K5NA 4L63B 5E4WC 3NTIA 5G3LD 2RDGA 4FF4A 3WDNA 3KBGA 4B9WA 3VR6A 4M8AA 1FGBD 2PYKA 5T1GA 4TQUS 4CKEA 3U9OA 1GOZA 3HEJA 1BXTA 1HHVA 3LWEA 5JAVA 1SNPA 1EY0A 1WTPA 1SBBB 5A2QE 1HQRD 4IQZA 2QF7A 1WTVA 4NDXA 1XTCD 1RD9D 5EKIA 3M7GA 3GTMB 1A3TA 4ODGA 4Z9CB 5DNFA 4JK1C 4BBSB 1G8ZD 3RLFA 5EBCA 2NTSA 1TS4A 1J8IA 5EBDA 3MA2B 1PLFA 3R8BA 1D5XC 3T13A 3A8IE 1SYGA 3PUWA 1F2ZA 1FD7D 1TWFB 1Y1WB 2HDLA 2F0DA 2HQEA 3MWYW 1YNNC 1Q8IA 3J80L 2AQ3B 2XRSD 4K5VA 1EYDA 3EQLC 1E2VA 3A7AB 3P20A 3OW7A 4FXDA 2OXPA 2K03A 2Z4HA 4U673 3PO3B 3D8GA 1ESFA 3NTHA 2EY1A 1IKLA 1BO0A 3OIPA 1A3UA 2L12A 1DOKA 1TVXA 4EGVA 3GTOB 1LV9A 1DJRD 1EY9A 2VXWA 5C0XJ 5ELBA 1SNMA 3NP8A 2HCIA 2F0UA 3AMUA 3KBXA 2R6GA 4N9PA 3J7YW 1EZ8A 1B1ZA 4DNRB 3IAYA 3H91A 2TMPA 1XXGA 1I50B 2J4XA 2JA8B 2EPBA 4ZLTF 1HXYD 2FMCA 5LL6X 5EJWA 4G57A 4WORA 2EYLA 1QOHA 4FF3A 4ZQ3A 2F0HA 2FHTA 2LMCB 2ENBA 5A35A 2H4OA 2NVXB 1UNSA 5CV5A 1KDCA 2Q8TA 1ZKOA 3X3NA 4IFDJ 4FXGC 4ULLA 1NCVA 3I8ZA 4K2KA 4A3IB 1F9RA 1TWAB 1Z7TA 2BE5C 2A69D 4RAUC 2F0MA 1EQVA 3JAML 4H44C 5K36G 4CGYB 3Q22A 1U9RA 3NHHA 3HRZC 3SHLA 4I65A 2F0FA 1AW7A 4ILWA 3GTKB 4HMJA 1JCKB 4NMZA 2KUMA 1KTKA 4BWGB 2F0NA 1C48A 1D2BA 3SK4A 4FYDA 1TS3A 4XTCS 3DM1A 4HN7A 1RDPD 3T51B 4XT3B 5C0XG 3VR4A 1SE4A 3MXNA 4GZYC 3I90A 1I6HB 2D5DA 2PNRC 5EPJA 2NWGA 1FYCA 3VA5A 4CKBA 2NVQB 5C0XI 4RGNA 5C5MA 4QB4A 3J81L 4BA2I 4AYBB 4RHSA 3BDOA 3IKJA 2F0SA 1PRTD 3KLRA 3NTKA 4BBRB 3C2PA 5D3DA 3CU7A 1CHQD 2K32A 3IFTA 2DNEA 4K8IA 4IFDG 1RCVD 1T5EA 1KABA 2F0EA 3EA6A 1HTPA 2K33A 1V8QA 1JWMD 3Q0AA 1K8MA 5NUCA 4KD3A 5AFWA 1WD1A 1AN8A 3M4OB 1EU3A 2IX0A 2AUKA 3C3LA 1JC7A 4IFDI 1L0YB 2WV6D 3HOWB 5E1FA 1I4GA 2CVRA 3FEWX 2O5IC 1WVLA 5I4DA 1D6EC 4OHJA 2F0QA 3O13A 1GUTA 3E0JA 5CORA 3H0GB 3S1MB 1STNA 1PFBA 4ZRZA 3S14B 4LJZC 2H1EA 3PO2B 3KF8A 1A15A 4X3SA 4ME5A 2KJXA 3T16A 2L11A 4XQJA 1K8OA 5KGUA 1ILPA 1WTRA 2KQ3A 1BQQT 1EY6A 1X32A 4UAIA 3MAQA 1QNKA 2AWNA 4XQNA 4IUTA 1I4XA 1O7YA 4KD4A 4KI0A 1PZJD 1STAA 2RDFA 1CA6A 1ML0D 2EY2A 2TSSA 3BVMA 3A8JE 4RHRA 4DXGA 4LMQD 2C9OA 1SYBA 5C6AA 5IGEA 1MBYA 3C46A 5BN4A 2AQ2B 2A73B 2B8GA 3SDZA 2RDHA 1AZPA 2A6ED 5IT9E 1U4MA 4OGQC 1DZ1A 5K36H 2IJ0A 5C4XB 2B8FA 1S5DD 3DWPA 3Q24A 3GTLB 5HGTA 3E5SA 2K04A 2ICIA 1STGA 5FOBB 3T56B 4K6LA 3MFYA 5KIXA 3VR3A 1JOOA 3RZDB 3H94A 2IT1A 3K5LA 1XX8A 1S5FD 3NWTA 3S1RB 3D4WA 1D5ZC 1RTOA 4DAVA 1I4HA 2A69C 4A3DB 3BDLA 1G91A 2JSOA 1EEFD 5LHY1 3S1QB 3V2TA 3VYRA 5J39A 1EIGA 5C4JB 1LT6D 1SAPA 3PMFA 4FF2A 3LWUA 1EL0A 2WB1B 2F3VA 1VMPA 2MP1A 1M8AA 1W6JA 2K6AA 3OSOA 5CGKA 3K59A 1I4QA 2E74C 3W2DA 1SDFA 5FLXL 4XYOA 2IX1A 2JEBI 2JE6I 3GD7A 1DOMA 1GUGA 3DHQA 1JQYD 3M7NA 4IUVA 4IFDH 4K2LA 1TU2B 3BYYB 1VDZA 3L9AX 1Y8OB 3NWSA 4HCSA 4K5WA 3SEBA 1BOSA 2NZ1D 2XNAC 3D31A 1B3AA 4QUFA 5ELCA 5T1IA 1GUNA 1H9SA 1GJXA 1HPCA 4HTHA 4PMWA 2B2WA 2M2LA 1TIID 1L0XB 1HUMA 1IL8A 1PRTC 2F0JA 5BN5A 1KNEA 1LTRD 5EPLA 4IUNA 2HDMA 3KUPA 3MXPA 3NBIA 2EYPA 2L1BA 1CA5A 1SYCA 2A74C 2EYMA 3N52A 2F0KA 2E2DC 1SNCA 3ERQA 3G6JB 5ELEA 3MEHA 5EQ0A 1B50A 4TSSA 1QCBD 3J80E 3QOJA 3K57A 4DF7A 1EQTA 1MGSA 3A56A 1IYUA 4K6DA 1KLGD 2YYZA 4PMBA 1C4QA 3E6ZX 2PW5A 4K14A 5D3IB 5G3LF 2O5JC 3PUVA 4KKUA 2EYFA 3BVZA 3URYA 4G7OC 2O4XA 2XWBB 4QF4A 3TP8A 1TQOA 4A3GB 2K28A 3R2IA 4XYQA 3T4AC 3HKZB 1ZYRD 5IODA 2OF1A 3L7ZC 1RF2D 3TSSA 1STYA 3M3YB 5IGDA 1DXMA 2LKVA 2DY7A 4ABNA 3D3RA 2EE1A 5KNDA 4C1NI 4IN3A 1A2TA 2XSCA 4NKLA 3OIQA 4OIJA 3HGBA 1SFOB 2XVSA 3QB3A 4KHVA 5KYLA 1OXUA 1BUVT 3DXJC 4IURA 2KEDA 1HQMC 2PPBC 1BNZA 3S16B 1TWCB 3RUZA 2RSOA 2L5TA 3MXGA 3EFXD 2B2VA 2NBFA 2IWHA 2K05A 1I3QB 3JAME 3H3VC 1SYFA 1H9KA 3KLSX 4M1UB 2A6EC 4G7HC 2ID0A 5CV6A 1QWYA 3EVQA 1E2WA 3QWNA 5A2QL 3V05A 1IYVA 1VMCA 2WKCA 4L6TB 1SE3A 4CJ2C 1LTGD 1BBXC 2F0TA 3MFGA 1Q12A 1D1IA 3AB9A 3BYTB 4UDUC 3A7LA 4DFAA 2B2VC 1O7ZA 1HFNA 3MC0B 4ZK9B 1EY7A 2D62A 1LTID 1GHJA 3VYTA 1PZID 5M3MB 3HZXA 1MSGA 5DEHA 3S17B 2QKIC 2DY8A 3HP3A 1D1KA 2PO4A 4IUQA 4N9TA 1X3PA 4S3SA 4Y7NB 3J81E 1EU4A 1WCMB 3GV6A 4DAYA 1FNWA 2L0CA 3DMUA 1SJHD 1GUWA 1LT5D 2OEOA 2ZT9C 4ZUJA 4DU9A 3PIO3 1GUOA 3GP7A 3FVQA 3VR2A 1VF5C 3J7AF 4X3KA 2B2UA 3TP5A 2K7VA 2VB3X 5C44B 1PRTB 2K5QA 3FKIB 4ZKBB 4LK1C 1ET6A 2PZUA 4EQNA 2F1MA 4QMGA 2IPKD 4RFBA 3SK6A 5IGCA 1U4RA 2XN9C 3OWEB 1A3VA 5CBAE 3CRKC 4HSPA 1PTOD 1H9RA 1H9SB 2KEEA 3SVMA 2MJ8A 5IGGA 4C3JG 1QE6A 2A68D 3P75A 1KDAA 5TSSA 2EYJA 1Q90A 1WTWA 2PQEA 1LABA 1CFMA 3NE5B 1NAPA 4E6IA 1I4RA 4R8NA 2FMMA 2NB0A 4HEDA 5I6YA 5KNCA 2V4DA 2Z8LA 3GV3A 2E75C 2M9VA 4C3HG 1V1PB 3K58A 4KK7A 1SNQA 2CW0D 1B44D 1NR2A 1G2SA 1BCPD 4DK0A 2EXZA 3BG3A 1SSOA 1PRTF 1QG7A 3BZDB 2N55A 4I7ZC 2QEJC 4FO2A 3EROA 4IALA 4BY7B 4LAAA 5IOCA 4KTAA 2L4NA 1UAPA 3K5OA 4K5XA 3PUYA 4RGMA 1F2YA 1VCIA 4EQOA 1KAAA 1CK1A 1ZYRC 2B63B 3OMCA 1BCPF 1LTTD 2F4IA 4C1NK 2XWJB 1II3A 2EJMA 4A3KB 4MHEA 2KECA 1Y1VB 5EKLA 4DN4M 1SXTA 2FINB 4QCLA 2L55A 5CR3A 1ENFA 1JOKA 4C3IB 3GQBA 5C3EB 1RODA 3MTSA 4C3IG 2ZXOA 1TWGB 4B9XA 2GA4B 3W3AA 3D4RA 4RGOS 2K01A 4RCOA 2SNSA 4L8JA 2MUYA 2VB2X 5CYUA 1PZKD 4F88A 2F3WA 1B9NA 3FDTA 3A54A 5JPNC 1A2UA 4F8MA 3QOLA 4RA8A 5I9PA 1TY0A 1Z6HA 2JP1A 4RWSC 1R4QB 2NYZD 4RGTA 4J1MA 1DONA 1HFGA 1S5ED 1ENAA 1CT1D 2ICEC 3F2UA 1XYIA 4A3JB 4X3TA 2ZXPA 4R9WA 5DAUA 5D14A 4ZAIA 4BY1B 5C3WA 1R9TB 2G9DA 2M00A 2F0GA 1EEID 1TR5A 1SMYD 1RJTA 4G7ZC 1SJED 3Q6SA 1TKWB 3K0YA 4O1NA 4QUCA 1PTOH 2NN6G 5JEAH 1HUNA 1QNUA 1CTMA 2WINB 2F0VA 1AP0A 2Q8RE 1FR3A 3KLSA 3VR5A 2I46A 2NN6I 2KOLA 2L9HA 4J6HA 3SE0A 2A5HA 3QO2A 3CRLC 2SOBA 1RTNA 2DN8A 1SEBD 1U4PA 4DK1A 5C3XA 1EOTA 4KMUC 1FNVA 5CV8A 4NP5A 1ZEQX 1EWHA 2B39A 1OO9B 2ZXRA 4OIKA 3NK9A 4XXEA 2WIIB 2PZTA 2JA6B 4DAPA 2E2IB 3CKIB 1MD2D 4FNFA 3PUXA 1OXXK 2WACA 3C1FA 1S5BD 1LLRD 2PCFB 3K6OA 5CC4A 1GXDC 2X6GA 1SE2A 2A6HD 1PTOC 3P7JA 2A68C 3DEPA 3T53B 1O80A 1TS2A 4A3BB 1Y8NB 3I4NB 5I6WA 1EFID 2JXMB 2RQXA 1NR4A 4BA1I 2B2YA 1H9MA 4A3FB 1LT4D 4A3MB 4C56C 3WOFA 1LTAD 5IGFA 1O78A 1JICA 2CW0C 1I4PA 3RD4A 1BCPC 2B2WC 4PQXA 2J7ZA 3Q23A 1B9MA 4R8IA 4RH6A 3IL8A 4PMCA 1U4LA 1DYQA 5FO7B 4KHZA 2RSNA 5C4ZA 2EVBA 1A6XA 2EYHA 3MVVA 5ELDA 5E4XA 1ONLA 4ID6A 2Z1CA 4OO1H 4HR7B 2B2YC 1STHA 3HOZB 3TBIB 3X3MA 2KCNA 5COYA 1PMRA 2EDGA 1WTOA 1GUSA 5IIFA 3HG9A 2NVYB 4IUPA 4HMIA 2CHBD 2NTTA 4ZUIA 4ZKCB 5DM73 1EYCA 5I2XA 3PIP3 3N6RA 3QG1A 3C1EA 4TKOB 1MSHA 1ICWA 2XIWA 4XDXA 3RMHA 1PYWD 1KLUD 3D6WA 1WTQA 1QB5D 2SDFA 2EY6A 2EJFC 3M85A 2LY7A 5K5PA 5CV4A 1LT3D 4RCNA 4KJOA 2LS01 3TN2A 2QILA 2NN6H 3K5MA 1PXUA 4FXKC 2WP8J 5JPMC 4XIGS 2IL8A 1K83B 1JWSD 3OHXC 5JEAJ 3KK7A 3SK5A 4EVOA 1HCZA 2AQ1B 5EGTA 1S4ZA 2RBMA 5I2YA 3TMEA 3BDCA 2SNMA 1G6ZA 1TS5A 3IFDA 4XQQA 4RKLA 1QJOA 4TRDA 1PDQA 2FFKB 4CJ1B 5D65A 5LL6S 3CQZB 4KKSA 3I91A 1OXSC 1RHPA 3GTJB 3H09A 3HOVB 2MPMA 1SNOA 5CBEE 3S2HB 1X3QA 3FPUB 2JEAI 1V1OA 4J8QA 1HA6A 1SMYC 2LFNA 4HAEA 3NUCA 3TZDA 2YU9B 3U9SA 3VYSA 3ITPA 2R61A 1CI3M 1VF7A 1MI2A 1G2TA 3I3CA 3GTGB 2JA7B 2E2HB 1YNJD 3DWAA 2D2CC 3TDQA 3BVGA 5HURA 4PNYA 2R93B 3SR1A 2K1BA 1B4OA 1KNAA 5ELFA 3HOUB 2J0TD 1BF4A 4MIUA 1ZXTA 4PV1C 2VNUD 1B53A 3TP7A 2IW3A 5FKAC 1JOQA 2K5WA 3A55A 2DNCA 3G7LA 3FMCA 3NPPA 3EJIA 4X3UA 2FJ2A 2RVLA 4WRDA 3R2TA 4O42A 1AEXA 1F2LA 4V190 2BCOA 3R3OA 3TP6A 1KDBA 4KKTA 1PTOB 3NQTA 2K5DA 5C5LA 3A8KE 1TT2A 5BN3A 4Q5VA 5JEAG 2X6LA 5EPKA 1EYAA 1IKMA 1SYDA 1I6VC 2AUJD 4K8JA 4KN7C 2A6HC 2O2LD 3I4MB 1CZWA 1JR0D 4IUUA 2Q8IB 1HA5A 3NQIA 1Q1BA 2F0PA 3GTPB 2RKSA 4G4KA 4C3JB 1UUPA 2HCCA 3ND8A 4A93B 1H9JA 3DWQA 3NXWA 2F03A 2F0WA 2AWOA 1BCPB 2F0LA 3PUZA 1BR9A 1STBA 2B2UC 4FF1A 2E2JB 5JJZA 5CMDA 2PW7A 5JOBA 3S2DB 1JB3A 3D4DA 1R4PB 1BDOA 3R93A 5M5YB 1FNUA 2C5CA 4C3HB 1EZ6A 1HTLD 5JVG3 3LX0A 1GHKA 1EY4A 1DM0B 1EY5A 1PTOF 2MGSA 5M9OA 2QCPX 3NBHA 4Q0FA 1UEAB 2KA7A 3UI2A 1IW7D 1TY2A 2Y0SB 1CZGA 2F0OA 4H7BA 1LTSD 5M5WB 3HOXB 4A3EB 3FPPA 3V96A 4NW2A 3ONAB 1M4VA 1F9QA 4OL7A 3CHBD 4V0BA 4MN3A 4HSVA 1ESRA 3VA7A 2I07B 2EOTA 4RKBA 4DA2A 1PFNA 5E3FA 1SNDA 3M4YA 3I73A 2X69A 1C8CA 1ET9A 1F2MA 4KN4C 2JA5B 1EY8A 2KHSA 1EWCA 1Z47A 5EKKA 4WFN3 5I9OA 4QIWB 5FK9C 4XT1B 4F7XA 2KCCA 5FO8B 1CHPD 3RZOB 2BA0A 3NSWA 3OMGA 3D6CA 2WAQB 3H6MA 2N88A 2E76C 1F9SA 2BA1A 1AFPA 2NVTB 2SEBD 3S1NB 3TZUA 2JYOA 3PV0A 4OO1G 1WTXA 1OXVA 1Q3LA 5IGBA 4KJNA 3FRPB 1WD0A 1XWEA 1LO5D 5DM63 4KY7A 2HUGA 1W6KA 1YNND 1E2ZA 2KVMA 3I70A 1JE4A 1CQVA 1V43A 4FP5D 5J22A 2G9HD 3HOYB 4OO1I 4CHTB 3K7AB 5M3FB 5CV9A 4DNTB 2R7ZB 4ZYSA 3ND9A 2PZWA 4H0LC 3S15B 4U68A 1LACA 5JVH3 4F87A 3DEOA 3OPOA 2CQAA 1DOLA 2WKDA 5FLXE 2BDOA 5FO9B 4KY5A 1G291 2QDBA 1T5XD 1RKNA 4H13C 1TWHB 1ENCA 1B2TA 4P2CB 1YNJC 1F77A 1Y8PB 2NUCA 1DD2A 5KEEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XRQ D;  3MC0 B;  4RGO S;  2AQ2 B;  3BYY B;  1EWC A;  4RCO A;  2O2L D;  1JWM D;  1SEB D;  2RDH A;  3SEB A;  2AQ3 B;  2XRS D;  5ELD A;  1JR0 D;  1RF2 D;  1LTI D;  1PZK D;  2XNA C;  1AN8 A;  3TSS A;  1HA5 A;  5FK9 C;  1EU3 A;  1FNV A;  1I4R A;  5ELC A;  1UUP A;  1PZI D;  1S5C D;  1V1O A;  4DXF A;  1L0Y B;  2WV6 D;  2Z8L A;  1V1P A;  1CHP D;  1AW7 A;  1V1P B;  2IJ0 A;  1I4G A;  3DWQ A;  1TY0 A;  4L63 B;  1ESF A;  1BCP B;  1JCK B;  1STE A;  1S5D D;  2RDG A;  2R61 A;  1MD2 D;  3DWP A;  5I4D A;  1D6E C;  4OHJ A;  1KTK A;  4BWG B;  1B44 D;  1L0X B;  1BCP D;  2CHB D;  2NTT A;  2SEB D;  1TS3 A;  1EU4 A;  1DJR D;  3O13 A;  1PRT C;  1D5M C;  2ICI A;  4RGT A;  1PRT F;  1S5B D;  5ELB A;  3BZD B;  1FGB D;  1LLR D;  1RDP D;  4K6L A;  1S5E D;  1FNU A;  1CT1 D;  1LTR D;  3DWA A;  1FNW A;  2QEJ C;  1SJH D;  3BVG A;  1LT5 D;  1HTL D;  1LO5 D;  1SE4 A;  1S5F D;  1GOZ A;  1B1Z A;  1BXT A;  1SE2 A;  3GP7 A;  1PTO C;  4RGM A;  1PTO F;  1D5Z C;  5ELF A;  1CQV A;  1XXG A;  1I4H A;  1PYW D;  1KLU D;  2G9H D;  1TS2 A;  1EEI D;  2J4X A;  1EEF D;  1CK1 A;  3EFX D;  5ELE A;  1SBB B;  1HQR D;  5FKA C;  4TSS A;  1HXY D;  1BCP F;  1SJE D;  1TY2 A;  1LTT D;  4ZYS A;  1XTC D;  1RD9 D;  1LT6 D;  3KLS X;  1EFI D;  4O1N A;  4RGN A;  1PRT B;  1LT3 D;  1PTO H;  1LTS D;  4Z9C B;  3R2T A;  2QIL A;  4RHS A;  1ET6 A;  1G8Z D;  1KLG D;  1I4X A;  1PRT D;  1SXT A;  1LT4 D;  1M4V A;  3V05 A;  4C56 C;  5D3D A;  2IPK D;  1JWS D;  3CHB D;  4RFB A;  2NTS A;  1ENF A;  1LTA D;  1SE3 A;  4L6T B;  1PTO B;  1T5X D;  1PZJ D;  1UNS A;  5D3I B;  1CHQ D;  1LTG D;  1TS4 A;  2XN9 C;  3OWE B;  1JWU D;  1LTB D;  1I4P A;  2TSS A;  3BVM A;  4RHR A;  2AQ1 B;  3R8B A;  1BCP C;  1D5X C;  3MFG A;  1I4Q A;  3BVZ A;  3URY A;  4DXG A;  1PTO D;  3W2D A;  1F77 A;  1QIL A;  4RH6 A;  1TS5 A;  1ET9 A;  1FD7 D;  3R2I A;  3BYT B;  1RCV D;  4UDU C;  1DYQ A;  1JQY D;  5TSS A;  3EA6 A; 
#chains in the Genus database with same CATH topology
 1VQ6 A;  4JBW A;  5C4H A;  3CCS A;  2VUM B;  5KRU A;  1ILQ A;  4MNO A;  4OX9 L;  3GTK H;  1IZ6 A;  4BXX G;  5FJ8 H;  1WOC A;  3OOC A;  2K5H A;  2R92 B;  2EQS A;  3SK8 A;  3AU7 A;  1XNR L;  1S5C D;  1KXL A;  2OT2 A;  4JCV E;  3ZYY X;  4GNX A;  3MXU A;  1FGU A;  1J9O A;  3W1B A;  2R92 G;  5C0X H;  3QIA A;  1Q1E A;  3MZ5 A;  5ISR A;  1QVG A;  3GTP H;  1N8R C;  1STE A;  1SYE A;  1NUC A;  2K14 A;  3QJY A;  3UDX A;  1S72 A;  4GKJ Q;  2KCM A;  3L3O C;  3GTQ B;  4DPG A;  4P75 A;  5J1Z A;  3CPF A;  1I6H H;  1D5M C;  3UDG A;  2EYO A;  2BE5 D;  1DCZ A;  4KY6 A;  1SRU A;  3DUZ A;  4DAY B;  2Q2T A;  1IL2 A;  1HRJ A;  2BOS A;  4CKC A;  1F9P A;  2UXB Q;  1S40 A;  2RCF A;  2RA4 A;  2EJG C;  2NVQ H;  4WJW A;  1OXT A;  2VQF Q;  1JJC B;  2K4K A;  2IX3 A;  5IT9 L;  4DGZ A;  3S9W A;  2D9U A;  4KV6 A;  3WOE A;  2B2T A;  4YIJ A;  3P1H A;  4EQP A;  3I72 A;  1E0B A;  2I5M X;  3I4L A;  1EIH A;  4MTN A;  5M5X B;  1O7L A;  4B3S Q;  5CV7 A;  4BBR H;  4CBV A;  4AH6 A;  5LMU L;  3SXH A;  3HS0 C;  1YEZ A;  5KYI A;  2PMZ B;  2VW9 A;  3J7A V;  3CF5 A;  4IZ8 A;  3VYU A;  3RLO A;  2BDN A;  1CQF A;  2Z4I A;  3Q8D A;  4OWX B;  1Y69 U;  4TVA B;  1JWU D;  3K0X A;  1LTB D;  3LNN A;  1A8V A;  3OWF A;  4B08 A;  2EZV A;  4NPS A;  4C2M B;  4JI0 L;  1XTD A;  4UPA A;  5E7N A;  1PFM A;  5JJL A;  1PYB A;  1QIL A;  4HCE A;  2B2T C;  1IHZ A;  1CM9 A;  3M4O H;  1NSN S;  1JOR A;  2XRQ D;  2EY5 A;  2F0I A;  4CJ0 B;  2E5L Q;  5F2D A;  2KEN A;  4FVM A;  3GO5 A;  2N49 A;  2R3Z A;  4PZ7 A;  2E8G A;  3F2C A;  2MHV A;  1QUQ B;  4BS9 A;  1HNZ Q;  3BS1 A;  3MHB A;  1IBK L;  5KNB A;  4UP8 A;  4DXF A;  1AZQ A;  2K5V A;  1V1P A;  1IW7 C;  3K5N A;  4L63 B;  5E4W C;  3AEV A;  3M4P A;  3NTI A;  3H0G H;  5G3L D;  3S1M H;  2RDG A;  2JA9 A;  4FF4 A;  3S14 H;  3NBH B;  3WDN A;  3KBG A;  3PO2 H;  4HID A;  2UXD L;  4B9W A;  3VR6 A;  4M8A A;  1QVC A;  1FGB D;  2PYK A;  5T1G A;  3U58 A;  4TQU S;  4KHP Q;  4ZCK A;  4CKE A;  3U9O A;  1GOZ A;  3HEJ A;  1BXT A;  2OTJ A;  1X3G A;  1EUJ A;  1HHV A;  2UU9 Q;  2ALY B;  2FXQ A;  3LWE A;  2DUD A;  5LMN L;  1YVC A;  5JAV A;  1SNP A;  1EY0 A;  1WTP A;  5ELO A;  1SBB B;  5A2Q E;  1HQR D;  4IQZ A;  2QF7 A;  5IYB G;  3AFQ A;  1WTV A;  4LF4 Q;  4K0K L;  3E9H A;  4NDX A;  5GAG C;  2A19 A;  1XTC D;  1RD9 D;  5EKI A;  3M7G A;  3GTM B;  4B3R Q;  1A3T A;  4ODG A;  4Z9C B;  3K7A H;  5DNF A;  1WI5 A;  4JK1 C;  1G8Z D;  2DJF C;  3RLF A;  4BBS B;  4CDD C;  3BZC A;  2Z9H A;  1XJV A;  5EBC A;  1GVP A;  1YHA A;  4X66 L;  2NTS A;  4BBS G;  2Z6K C;  1TS4 A;  4L5Q A;  1J8I A;  1MHW C;  5EBD A;  3MA2 B;  3FHW A;  5IYD G;  1PLF A;  3R8B A;  1D5X C;  3T13 A;  1G6P A;  3A8I E;  1SYG A;  3PUW A;  1F2Z A;  4AIM A;  1FD7 D;  1TWF B;  1Y1W B;  1PH8 A;  1P16 A;  2HDL A;  1I5F A;  3IRB A;  3PGZ A;  2H5X A;  2RCN A;  1B3Q A;  3PQI A;  1N34 L;  1XNQ L;  2F0D A;  2HQE A;  3MWY W;  1YNN C;  1Y1W G;  1Q8I A;  3J80 L;  5IYC G;  4GOP A;  2PI2 E;  2AQ3 B;  2XRS D;  2K50 A;  2L15 A;  4K5V A;  1EYD A;  3EQL C;  1E2V A;  5C4X H;  3A7A B;  3P20 A;  3OW7 A;  4IPC A;  4FXD A;  3KF6 B;  1GD7 A;  3GTL H;  2OXP A;  4IOA A;  4DKA C;  2K03 A;  2Z4H A;  4U67 3;  3PO3 B;  3D8G A;  1ESF A;  3DM3 A;  3NTH A;  2EY1 A;  1YJ9 A;  1IKL A;  1BO0 A;  2JQO A;  3OIP A;  1A3U A;  2L12 A;  3RZD H;  1DOK A;  1TVX A;  3TEH B;  4EGV A;  3S1R H;  3GTO B;  1LV9 A;  1DJR D;  1EY9 A;  2VXW A;  5C0X J;  3TS0 A;  5ELB A;  1SNM A;  2UUC L;  3NP8 A;  2HCI A;  2F0U A;  3CCE A;  3AMU A;  3KBX A;  4JI8 L;  2UUB L;  4A3D H;  4IJH A;  2R6G A;  4N9P A;  3J7Y W;  3S1Q H;  4X6A H;  4I7A A;  1EZ8 A;  1B1Z A;  2CKZ B;  3I7F A;  4DNR B;  1WYD A;  4JI3 L;  5C4J H;  3H91 A;  5IP7 G;  3IAY A;  2TMP A;  1XXG A;  1I50 B;  4YY3 L;  2J4X A;  2JA8 B;  2EPB A;  1VQL A;  4DV2 L;  4ZLT F;  2Y0S E;  1HXY D;  2FMC A;  5LL6 X;  4A76 A;  5EJW A;  4G57 A;  3BZK A;  4WOR A;  1D7Q A;  1IYJ B;  1I94 Q;  4JI5 L;  2JA8 G;  2EYL A;  1QOH A;  4FF3 A;  4ZQ3 A;  4DR6 Q;  4B3M Q;  2F0H A;  2FHT A;  1K3B C;  4DK6 C;  1X56 A;  2ZJR A;  2LMC B;  2ENB A;  5A35 A;  2H4O A;  5GRO A;  4NXM L;  2NVX B;  1UNS A;  5CV5 A;  1KDC A;  4A3L G;  2Q8T A;  1ZKO A;  3X3N A;  4IFD J;  4FXG C;  4ULL A;  4IPG A;  2CWA A;  1BVS A;  3I8Z A;  1NCV A;  3RN2 A;  4K2K A;  4A3I B;  1F9R A;  1TWA B;  1Z7T A;  2BE5 C;  2AKW B;  5M3M G;  2VQE L;  2A69 D;  4RAU C;  4A3I G;  4MZ9 A;  2F0M A;  1EQV A;  3JAM L;  4QIW E;  2OCE A;  4JYA Q;  4H44 C;  5K36 G;  4CGY B;  3Q22 A;  1U9R A;  3K8A A;  3NHH A;  3HRZ C;  2D0P A;  3SHL A;  4QJF A;  4I65 A;  2WFW A;  2F0F A;  1AW7 A;  3RR5 A;  4ILW A;  3KLW A;  1VQ9 A;  3TS2 A;  3GTK B;  1JT8 A;  4HMJ A;  3VDY A;  1JCK B;  4NMZ A;  2WAQ E;  2KUM A;  1KTK A;  4BWG B;  2F0N A;  1C48 A;  5FJ8 G;  4B3T Q;  1D2B A;  3SK4 A;  1L2F A;  4FYD A;  1TS3 A;  4XTC S;  1KQS A;  5BR8 Q;  1YIT A;  3DM1 A;  4HN7 A;  4JOI A;  1RDP D;  3G48 A;  5AJ3 Q;  3T51 B;  4DV6 Q;  2CH4 W;  4XT3 B;  2DJG C;  5C0X G;  1XMQ Q;  3VR4 A;  3J81 j;  1SE4 A;  3MXN A;  5C44 G;  4GZY C;  3I90 A;  1I6H B;  1UE1 A;  2D5D A;  3PSI A;  2PNR C;  1RIP A;  5EPJ A;  2NWG A;  1FYC A;  1YJN A;  1E3P A;  3VA5 A;  3ICE A;  4CKB A;  2NVQ B;  4LF9 L;  5C0X I;  4GKK Q;  1CKM A;  2UUA Q;  4RGN A;  2ZM6 Q;  4LF5 L;  4DR7 L;  5C5M A;  1JB7 A;  4QB4 A;  3EBE A;  3J81 L;  4BA2 I;  4AYB B;  4RHS A;  3BDO A;  3IKJ A;  2F0S A;  4JC0 A;  1MJE A;  1PRT D;  3KLR A;  3NTK A;  3CCM A;  4BBR B;  4JOI C;  3C2P A;  5D3D A;  4AYB G;  4HJA A;  4FDB A;  3CU7 A;  2UXC L;  1CHQ D;  4HJ5 A;  4BBR G;  2K32 A;  3IFT A;  1YI2 A;  2K52 A;  2DNE A;  1H95 A;  4LFA Q;  4K8I A;  4IFD G;  1RCV D;  3AFP A;  4DR5 L;  3ULP A;  1T5E A;  1KAB A;  2F0E A;  3EA6 A;  1HTP A;  3M3Y H;  2MO1 A;  4DUY L;  1EYG A;  2K33 A;  1V8Q A;  1JWM D;  3Q0A A;  1K8M A;  5NUC A;  4KD3 A;  5AFW A;  1Y1W H;  1WD1 A;  1AN8 A;  3M4O B;  1EU3 A;  5IYC H;  2IX0 A;  2AUK A;  3T1Y Q;  3C3L A;  1JC7 A;  4MTK A;  4IFD I;  1L0Y B;  2WV6 D;  3HOW B;  5E1F A;  1SFO H;  2HHH L;  1I4G A;  2CVR A;  3ERS X;  1VQ4 A;  2ZTC A;  3FEW X;  3U4Z A;  2O5I C;  3HOW G;  1WVL A;  5I4D A;  2ES2 A;  1D6E C;  4OHJ A;  2F0Q A;  3MEF A;  3O13 A;  2QEX A;  1GUT A;  1YNX A;  1E7Z A;  3E0J A;  4POF A;  1FVI A;  3FP9 A;  3EN2 A;  5COR A;  3H0G B;  3S1M B;  2B63 G;  3S16 H;  1STN A;  1TWC H;  1UE7 A;  1PFB A;  4ZRZ A;  4UP9 A;  3S14 B;  4LJZ C;  2H1E A;  3J7A 5;  3PO2 B;  3KF8 A;  1A15 A;  4X3S A;  4ME5 A;  2KJX A;  4A3K G;  3T16 A;  1KIX A;  2L11 A;  3PO2 G;  1Y1V G;  4XQJ A;  2F52 A;  2QA4 A;  1K8O A;  5KGU A;  1ILP A;  1WTR A;  4LF7 Q;  2AHO B;  3M4Q A;  2KQ3 A;  1X3F A;  2MO0 A;  1BQQ T;  1EY6 A;  1X32 A;  4UAI A;  1UE5 A;  2PMZ E;  3MAQ A;  1QNK A;  2AWN A;  2Q2U A;  4WJ4 A;  4XQN A;  2JN4 A;  4IUT A;  1I4X A;  1XPR A;  4JPB W;  1O7Y A;  4KD4 A;  2C35 B;  1FJG Q;  4KI0 A;  4DV7 Q;  5IE8 A;  1PH5 A;  1PZJ D;  1STA A;  2RDF A;  1CA6 A;  1ASZ A;  1ML0 D;  4LFC Q;  2EY2 A;  2TSS A;  3BVM A;  3A8J E;  4RHR A;  1N36 Q;  4GKJ L;  4A3L H;  3CXC A;  1PH9 A;  4DXG A;  4LMQ D;  3CC4 A;  2RHS B;  2NZO A;  2KCT A;  2C9O A;  1SYB A;  1PH3 A;  5C6A A;  5JJK A;  5IGE A;  5M3M H;  1MBY A;  3C46 A;  5BN4 A;  2AQ2 B;  2UXB L;  2A73 B;  2B8G A;  3SDZ A;  2F3I A;  2RDH A;  1AZP A;  3S17 H;  1HNW Q;  2V1C C;  2VQF L;  2PQA B;  2A6E D;  5IT9 E;  1U4M A;  4OGQ C;  1DZ1 A;  3NEM A;  4Y7N H;  2YTX A;  5K36 H;  1WCM H;  2IJ0 A;  4B3S L;  5ELN A;  3U50 C;  1VQB A;  1KC8 C;  4RMF A;  5C4X B;  2B8F A;  1S5D D;  2Q2H A;  3DWP A;  1CSP A;  1L1O A;  3Q24 A;  3GTL B;  5HGT A;  3HFZ B;  3E5S A;  2QGQ A;  5C4X G;  2K04 A;  2ICI A;  5GQO A;  4LUZ A;  1STG A;  5FOB B;  3T56 B;  1HNX L;  4K6L A;  1Q81 C;  3MFY A;  5KIX A;  3VR3 A;  1K0R A;  3CME A;  4JVZ A;  2VL6 A;  1JOO A;  3RZD B;  3H94 A;  2IT1 A;  3K5L A;  1XX8 A;  1S5F D;  3NWT A;  4DV4 Q;  3S1R B;  1VS0 A;  1VQO A;  1PH6 A;  3D4W A;  5C44 H;  1D5Z C;  1RTO A;  4GLX A;  1PHJ A;  1NJI C;  3KJP A;  4QY7 A;  4DAV A;  1I4H A;  1E22 A;  1B7Y B;  2A69 C;  3FKI H;  3BDL A;  4DV1 Q;  4A3D B;  1G91 A;  2JSO A;  1EEF D;  5LHY 1;  3S1Q B;  4KLK A;  1MKH A;  3V2T A;  2E5L L;  3VYR A;  1NE3 A;  5J39 A;  4A3D G;  1EIG A;  5C4J B;  1V9P A;  3G4S A;  1LT6 D;  4IPD A;  1HNZ L;  4DV5 Q;  1SAP A;  3PMF A;  4FF2 A;  1SMX A;  1U5K A;  4X62 Q;  4DR4 Q;  3LWU A;  4LFB Q;  1VQA A;  1EL0 A;  4R4Q A;  1AE3 A;  2WB1 B;  2F3V A;  1VMP A;  1J6Q A;  2MP1 A;  1M8A A;  1W6J A;  2K6A A;  3OSO A;  5CGK A;  2I0Q A;  3K59 A;  4GNX C;  2WB1 G;  2ZTD A;  3CCV A;  1I4Q A;  2E74 C;  3W2D A;  1SDF A;  5FLX L;  4XYO A;  2IX1 A;  2JEB I;  2JE6 I;  3GD7 A;  4N8F A;  1DOM A;  1GUG A;  3DHQ A;  4P71 A;  1JQY D;  4KHP L;  3M7N A;  4IUV A;  4IFD H;  4K2L A;  3PF5 A;  4YWL A;  1TU2 B;  3BYY B;  3A5Z B;  1VDZ A;  3CW2 C;  1Y8O B;  3L9A X;  3NWS A;  1VQD A;  2CQO A;  2PI2 A;  4HCS A;  4K5W A;  3SEB A;  2UU9 L;  1X55 A;  1BOS A;  2NZ1 D;  2XNA C;  3D31 A;  1B3A A;  4GN4 B;  4QUF A;  5ELC A;  5T1I A;  1HH2 P;  1GUN A;  1H9S A;  4DUZ Q;  3E0E A;  1GJX A;  4HIO A;  1HPC A;  5HY6 A;  4HTH A;  3UDI A;  4LF4 L;  4PMW A;  2B2W A;  2M2L A;  1TII D;  2JJQ A;  4HJ7 A;  1PYS B;  2MFI A;  3A0J A;  3U4V A;  4B3R L;  1XNR Q;  3F2D A;  1VQ5 A;  1L0X B;  3HOW H;  1HUM A;  3CC2 A;  1IL8 A;  4O0A A;  1PRT C;  2F0J A;  5BN5 A;  4LUO A;  1KNE A;  1LTR D;  4DNI A;  5EPL A;  4A3B G;  4IUN A;  2HDM A;  3KUP A;  3MXP A;  3NBI A;  3TQY A;  2EYP A;  3I4N G;  1KHI A;  2L1B A;  1BBU A;  3L0O A;  3UE0 A;  2B63 H;  1CA5 A;  3F1Z A;  1SYC A;  2A74 C;  1SN8 A;  2EYM A;  3N52 A;  4EQ5 A;  2F0K A;  4JV5 Q;  2ZJQ A;  4A3K H;  2E2D C;  3OW2 A;  1SNC A;  3ERQ A;  1Y1V H;  4LF8 Q;  3G6J B;  5ELE A;  4JI7 Q;  3MEH A;  5EQ0 A;  1B50 A;  4TSS A;  3F2B A;  4HIM A;  1P8L A;  1QCB D;  3J80 E;  2HIV A;  5HGQ A;  3QOJ A;  1LUZ A;  4PZ8 A;  4C3I H;  5C3E H;  3K57 A;  4DF7 A;  1EQT A;  1MGS A;  2RF4 A;  3A56 A;  1IYU A;  4K6D A;  1KLG D;  2YYZ A;  3S24 A;  2CH4 A;  2Z6B A;  4AQY Q;  1TWG H;  4PMB A;  1C4Q A;  3ZJY C;  4DR2 Q;  3E6Z X;  2PW5 A;  4K14 A;  4JI1 Q;  5D3I B;  5IT9 c;  3H15 A;  5G3L F;  3H3V H;  2O5J C;  3PUV A;  4KKU A;  2EYF A;  3BVZ A;  1Q46 A;  3URY A;  2O4X A;  4G7O C;  2XWB B;  4GN5 A;  4QF4 A;  3TP8 A;  1TQO A;  4A3G B;  2K28 A;  4DV0 Q;  3R2I A;  4XYQ A;  3HOZ G;  1X54 A;  3T4A C;  3HKZ B;  5IWA Q;  1ZYR D;  3DLL A;  1HR0 W;  4A3G G;  1KAW A;  5IOD A;  2OF1 A;  1T9H A;  3L7Z C;  3HKZ G;  1RF2 D;  3TSS A;  3J7Z C;  2EIF A;  4DV3 Q;  1XMO Q;  1STY A;  5J3B A;  3LGJ A;  3M3Y B;  5IGD A;  1DXM A;  3PF4 A;  2LKV A;  2DY7 A;  4ABN A;  3D3R A;  2EE1 A;  5KND A;  4C1N I;  4IN3 A;  1PV4 A;  1A2T A;  2XSC A;  4NKL A;  3OIQ A;  1I94 L;  4A3J H;  4OIJ A;  2JK8 A;  2LXK A;  3KDF B;  3RNU A;  4DR6 L;  4B3M L;  3HGB A;  4BY1 H;  1SFO B;  1R9T H;  4OEM B;  2XVS A;  3QB3 A;  1CKN A;  4KHV A;  5KYL A;  4YCV A;  1OXU A;  2YTY A;  4A75 A;  4DR1 Q;  1BUV T;  3B6Y A;  3DXJ C;  4IUR A;  2KED A;  4X65 Q;  1HQM C;  1LTL A;  2PPB C;  1BNZ A;  3S16 B;  1TWC B;  3RLN A;  4A3C H;  1B8A A;  3RUZ A;  2RSO A;  2L5T A;  3MXG A;  1QZG A;  2DGY A;  2B2V A;  2NBF A;  3EFX D;  2IWH A;  2K05 A;  1I3Q B;  3JAM E;  3H3V C;  2ZTE A;  1SYF A;  1H9K A;  2R7F A;  3KLS X;  4M1U B;  4JYA L;  2A6E C;  4QL5 A;  4G7H C;  2ID0 A;  4X64 Q;  5CV6 A;  4AYB E;  1QWY A;  3EVQ A;  1E2W A;  3QWN A;  5A2Q L;  4GOP C;  3V05 A;  2HD3 A;  3K81 C;  1IYV A;  1VMC A;  2WKC A;  4L6T B;  1SE3 A;  4CJ2 C;  1LTG D;  3KYH C;  5FLM G;  1BBX C;  2F0T A;  4B3T L;  3MFG A;  1IBL Q;  5BR8 L;  1Q12 A;  1D1I A;  3I56 A;  5AJ3 L;  3AB9 A;  3BYT B;  4UDU C;  1HR0 Q;  3A7L A;  4DV6 L;  4DFA A;  2B2V C;  1O7Z A;  3AQQ A;  1HFN A;  1XMQ L;  3MC0 B;  4ZK9 B;  1K8A C;  1EY7 A;  2JA6 H;  1HZ9 A;  2D62 A;  1VQK A;  1LTI D;  4P74 A;  1GHJ A;  3OTO Q;  2OQ0 A;  3VYT A;  2E2I H;  3TRZ A;  1PZI D;  4JI2 Q;  4UHV A;  5M3M B;  2K75 A;  3HZX A;  1MSG A;  5JJI A;  4GNX B;  5DEH A;  2CCZ A;  1K73 C;  3S17 B;  2QKI C;  2DY8 A;  3HP3 A;  4OWW B;  1D1K A;  3G6E A;  4GKK L;  2R93 G;  2UUA L;  2ZM6 L;  2PO4 A;  4IUQ A;  4N9T A;  1X3P A;  4S3S A;  4Y7N B;  3J81 E;  1EU4 A;  1WCM B;  3CCJ A;  3HOU G;  3GV6 A;  4DAY A;  1FNW A;  1AE2 A;  2L0C A;  3J80 c;  3DMU A;  5IP9 H;  1SJH D;  3T1H Q;  4JI4 Q;  1WCM G;  1W2B A;  1GUW A;  1LT5 D;  1K8G A;  2CFM A;  2OEO A;  4A3B H;  2ZT9 C;  4ZUJ A;  1IBM Q;  4J15 A;  1JJ2 A;  4DU9 A;  3PIO 3;  1GUO A;  3GP7 A;  1M1K C;  3FVQ A;  3I4N H;  3VR2 A;  1J5E Q;  1CKO A;  4IJL A;  1VQE A;  1A0I A;  1VF5 C;  2GVB A;  4LFA L;  3J7A F;  4X3K A;  3UE1 A;  1YJW A;  2UUB Q;  4R4O A;  1Y14 B;  2B2U A;  1GKH A;  3KJO A;  4OON A;  3TP5 A;  4A3F H;  2K7V A;  2VB3 X;  4A3M H;  5C44 B;  1X3E A;  3PCO B;  1PRT B;  4YHH Q;  1X65 A;  2K5Q A;  3FKI B;  1G51 A;  4ZKB B;  3T1Y L;  4LK1 C;  1ET6 A;  4UP7 A;  4DK3 C;  2PZU A;  4EQN A;  2F1M A;  1V1Q A;  3FKI G;  4QMG A;  2IPK D;  4RFB A;  3SK6 A;  5IGC A;  2GVA A;  1U4R A;  2XN9 C;  3JC6 6;  3OWE B;  4DR3 Q;  1A3V A;  3I4M G;  5CBA E;  3CRK C;  2QDL A;  4HSP A;  1PTO D;  1H9R A;  1H9S B;  2KEE A;  3SVM A;  2MJ8 A;  2YTV A;  5IGG A;  4C3J G;  1QE6 A;  2A68 D;  3P75 A;  1KDA A;  1SE8 A;  5TSS A;  2F4V Q;  2EYJ A;  2VZA A;  1Q90 A;  1VQC A;  3ULL A;  1WTW A;  3HOZ H;  2PQE A;  4A3G H;  1LAB A;  4NXN Q;  1CFM A;  3NE5 B;  1NAP A;  2NZH A;  4E6I A;  1I4R A;  2P5Z X;  3SGI A;  3CCQ A;  4R8N A;  2NVY H;  2FMM A;  2NB0 A;  4HED A;  5I6Y A;  2IY5 B;  4LF7 L;  5KNC A;  2V4D A;  2Z8L A;  3GV3 A;  4IOC A;  2E75 C;  1HZA A;  2R7D A;  2M9V A;  4C3H G;  1V1P B;  4P73 A;  3K58 A;  3A5U A;  4KK7 A;  1SNQ A;  4LWC A;  2CW0 D;  1B44 D;  1NR2 A;  1G2S A;  1BCP D;  4DK0 A;  2EXZ A;  3BG3 A;  3AYH B;  4R1J A;  1SSO A;  1PRT F;  2OTL A;  1QG7 A;  3BZD B;  2N55 A;  3JAM c;  4I7Z C;  2QEJ C;  4FO2 A;  1FJG L;  2HT1 A;  1Q86 C;  4DV7 L;  5GAE C;  1M90 C;  4JBJ A;  3ERO A;  4IAL A;  4LFC L;  4BY7 B;  4LAA A;  2K5N A;  2Y0S G;  5IOC A;  4KTA A;  2L4N A;  1UAP A;  3K5O A;  1N36 L;  4K5X A;  3PUY A;  4RGM A;  1F2Y A;  1VCI A;  4EQO A;  4BY7 G;  1KAA A;  3A74 A;  1CK1 A;  1ASY A;  1ZYR C;  2B63 B;  2ASB A;  3GDE A;  3OMC A;  1BCP F;  1E1O A;  1HNW L;  1LTT D;  2F4I A;  1K83 H;  4C1N K;  4HJ9 A;  2XWJ B;  1II3 A;  2EJM A;  4A3K B;  4MHE A;  2KEC A;  1Y1V B;  5EKL A;  2ATW A;  1I3Q H;  4DN4 M;  1SXT A;  1VQ7 A;  2FIN B;  4QCL A;  2WB1 E;  2B29 A;  2L55 A;  1S3O A;  5CR3 A;  1ENF A;  1JOK A;  2LSS A;  4C3I B;  3GQB A;  5C3E B;  5L37 A;  1ROD A;  1JMC A;  5FLM H;  3CQZ H;  3MTS A;  4C3I G;  3RN5 A;  5C3E G;  2ZXO A;  1TWG B;  4B9X A;  2GA4 B;  3HOV H;  1A63 A;  3W3A A;  3S2H H;  3D4R A;  4RGO S;  3CCR A;  3J81 c;  2K01 A;  4RCO A;  4DV4 L;  2WAQ G;  2SNS A;  4L8J A;  2MUY A;  2VB2 X;  1PZK D;  5CYU A;  4F88 A;  4GOP B;  2YU9 H;  2F3W A;  1B9N A;  3FDT A;  1K0S A;  3A54 A;  1CKN B;  4N8X 1;  5JPN C;  3KF6 A;  4DV1 L;  2N8N A;  1EWI A;  1A2U A;  4F8M A;  3GTG H;  2JA7 H;  3QOL A;  2E2H H;  4RA8 A;  5I9P A;  1TY0 A;  1Z6H A;  4OEL B;  1SR3 A;  1N33 Q;  2JP1 A;  4RWS C;  1R4Q B;  2NYZ D;  4DV5 L;  3H3V I;  2R93 H;  4JI6 Q;  4X62 L;  4JBK A;  4DR4 L;  4RGT A;  1FL0 A;  4J1M A;  4LFB L;  1DON A;  1N32 Q;  1HFG A;  3HOY G;  3HOU H;  1S5E D;  1ENA A;  1CT1 D;  1NNX A;  2ICE C;  3F2U A;  1D8L A;  1XYI A;  4A3J B;  4X3T A;  1BBW A;  2ZXP A;  4R9W A;  2D0O A;  5DAU A;  5D14 A;  4ZAI A;  2R7Z G;  3J80 i;  4BY1 B;  5C3W A;  4A3J G;  1R9T B;  1EQR A;  2G9D A;  1EFW A;  2QW7 A;  2M00 A;  4BY1 G;  1CSQ A;  2ZJP A;  2F0G A;  1EEI D;  3CAM A;  1TR5 A;  1X6O A;  1LM0 A;  1NMG A;  3I4O A;  1SMY D;  3D0F A;  1RJT A;  4G7Z C;  1SJE D;  3Q6S A;  1TKW B;  3K0Y A;  4O1N A;  4QUC A;  1PTO H;  2NN6 G;  1YIJ A;  1XPO A;  5JEA H;  1HUN A;  4DUZ L;  1QNU A;  1CTM A;  2WIN B;  4YWM A;  3NEN A;  2F0V A;  4YWK A;  4A3C G;  4LF6 Q;  3F8T A;  1K9M C;  1AP0 A;  3PIO A;  1VQM A;  2VUM G;  2Q2I A;  2LXJ A;  1FR3 A;  2Q8R E;  3KLS A;  1YHB A;  3VR5 A;  1QVF A;  4L5T A;  2I46 A;  2NN6 I;  1WTH A;  3I4M H;  2KOL A;  2L9H A;  3K7U C;  4J6H A;  3SE0 A;  4GN3 B;  4DAM A;  1L1O C;  2A5H A;  3QO2 A;  3HKZ E;  3CRL C;  4C3J H;  1VQN A;  2SOB A;  1RTN A;  4A93 H;  1C9O A;  3G71 A;  1HJP A;  2DN8 A;  4O2D A;  1SEB D;  1U4P A;  2A8V A;  4DK1 A;  5C3X A;  1EOT A;  4KMU C;  1QZH A;  4JV5 L;  1FNV A;  5CV8 A;  4NP5 A;  1ZEQ X;  1EWH A;  2E2J H;  2B39 A;  1OO9 B;  2ZXR A;  4OIK A;  3NK9 A;  1Q7Y C;  4LF8 L;  4XXE A;  4YCW A;  2WII B;  2PZT A;  1KRS A;  4JI7 L;  3CD6 A;  3S2D H;  3STB D;  2JA6 B;  3KOJ A;  4DAP A;  5M5Y H;  4QQB X;  4C3H H;  4PZ6 A;  4GLV B;  2E2I B;  3L2P A;  3CKI B;  1MD2 D;  4FNF A;  2JA6 G;  3PUX A;  1OXX K;  4CDF C;  2WAC A;  3C1F A;  4YCU A;  1S5B D;  1LLR D;  2PCF B;  4AQY L;  3K6O A;  1YHQ A;  1VQF A;  5CC4 A;  4DR2 L;  1GXD C;  4JI1 L;  2IHE A;  2X6G A;  4IPH A;  3JAM i;  1PH1 A;  4OX9 Q;  1SE2 A;  2A6H D;  3MXN B;  1PTO C;  1HNX Q;  1PVO A;  3P7J A;  3QR8 A;  1VQH A;  4DV0 L;  2A68 C;  3DEP A;  5M5W H;  4JG2 A;  3T53 B;  3HOX H;  1O80 A;  1TS2 A;  4BY7 H;  2N3S A;  4A3E H;  1Y8N B;  4A3B B;  5IWA L;  5IP9 G;  3I4N B;  3I55 A;  5I6W A;  2HIX A;  1EFI D;  3OYY A;  4DV3 L;  2JXM B;  2RQX A;  1XMO L;  1MIU A;  1NR4 A;  4BA1 I;  2B2Y A;  1H9M A;  4A3F B;  4R4C A;  1LT4 D;  4A3M B;  4C56 C;  3WOF A;  1LTA D;  5IGF A;  1WJJ A;  1O78 A;  3E9I A;  4A3F G;  1JIC A;  4A3M G;  2CW0 C;  1I4P A;  3RD4 A;  2JA5 H;  1VQ8 A;  3CP0 A;  1BCP C;  2B2W C;  4PQX A;  4H02 A;  1PA6 A;  2J7Z A;  3Q23 A;  4POG A;  2IHF A;  1PH2 A;  1B9M A;  3ULJ A;  4R8I A;  4RH6 A;  2BH2 A;  3IL8 A;  4PMC A;  1U4L A;  1DYQ A;  5FO7 B;  4KHZ A;  2RSN A;  5LMN W;  5C4Z A;  4EX5 A;  2EVB A;  1A6X A;  3RZO H;  5LMU Q;  4DR1 L;  4UY8 C;  1E1T A;  2EYH A;  3MVV A;  5ELD A;  5E4X A;  1ONL A;  4X65 L;  4ID6 A;  2Z1C A;  3J81 i;  4OO1 H;  4HR7 B;  2B2Y C;  1EQQ A;  1STH A;  2Z6K A;  3HOZ B;  2NVT H;  3TBI B;  3S1N H;  3X3M A;  2KCN A;  4WJ3 M;  5COY A;  1PMR A;  1KD1 C;  2EDG A;  1WTO A;  1GUS A;  5FLX c;  1IXR A;  5IIF A;  1KL9 A;  3HG9 A;  4CDE C;  5DLQ E;  4LNQ A;  2NVY B;  1OTC A;  4IUP A;  4X64 L;  2KBN A;  4JI0 Q;  1NTG A;  2CHB D;  2NTT A;  4HMI A;  4ZUI A;  5GAD C;  4LUV A;  1K28 A;  4ZKC B;  5DM7 3;  1EYC A;  5I2X A;  3CPW A;  3PIP 3;  3N6R A;  3HOY H;  3QG1 A;  3C1E A;  4TKO B;  4HJ8 A;  1MSH A;  5M3F H;  3KF8 B;  1IBL L;  1ICW A;  4JBM A;  1VQP A;  2R7Z H;  2XIW A;  4XDX A;  1IBK Q;  3RMH A;  1PYW D;  4HIK A;  1KLU D;  3CC7 A;  1HR0 L;  3S15 H;  4JW0 A;  1JJG A;  3D6W A;  1WTQ A;  2AMC B;  1QB5 D;  2SDF A;  2EY6 A;  2EJF C;  3M85 A;  2LY7 A;  5K5P A;  5CV4 A;  3W5O A;  1KRT A;  1LT3 D;  5H1S E;  1AH9 A;  2XTI A;  4RCN A;  3OTO L;  4KJO A;  2LS0 1;  3TN2 A;  2QIL A;  4PG3 A;  4JI2 L;  1TWH H;  1VQI A;  2UXD Q;  2NN6 H;  1O7I A;  3K5M A;  1PXU A;  4FXK C;  2WP8 J;  5JPM C;  4XIG S;  2IL8 A;  4CDC C;  1K83 B;  1JWS D;  3OHX C;  3M9B A;  3BU2 A;  5JEA J;  1E24 A;  4BXX H;  3KK7 A;  3SK5 A;  4EVO A;  1HCZ A;  1ICF B;  2AQ1 B;  1RL2 A;  2GN5 A;  2VUM H;  5EGT A;  1S4Z A;  2RBM A;  5I2Y A;  1VQJ A;  3TME A;  3BDC A;  2SNM A;  1G6Z A;  1TS5 A;  5LMN Q;  3IFD A;  4XQQ A;  3BJU A;  4RKL A;  3T1H L;  2R92 H;  4JI4 L;  1QJO A;  4TRD A;  3I2Z A;  1PDQ A;  2FFK B;  4CJ1 B;  5D65 A;  3PO3 G;  1IBM L;  5LL6 S;  3CQZ B;  4K0K Q;  4NB3 A;  1J5E L;  4KKS A;  4OWT B;  2PQA A;  3HKS A;  3I91 A;  1OXS C;  1Z9F A;  1RHP A;  3GTJ B;  3H09 A;  3HOV B;  2MPM A;  3CCU A;  1SNO A;  5CBE E;  3S2H B;  1X3Q A;  3FPU B;  2JEA I;  2HQL A;  1V1O A;  3GTQ H;  1NY4 A;  4J8Q A;  3HOV G;  1HA6 A;  1SMY C;  2LFN A;  4HAE A;  3NUC A;  4X66 Q;  3TZD A;  2YU9 B;  3U9S A;  2YV5 A;  3VYS A;  3ITP A;  2R61 A;  1CI3 M;  3NEL A;  1VF7 A;  4YHH L;  1MI2 A;  1G2T A;  1L1O B;  3I3C A;  4IO9 A;  3GTG B;  1HZB A;  2JA7 B;  2E2H B;  1YNJ D;  3DWA A;  3CCL A;  2D2C C;  3TDQ A;  1GM5 A;  2JA7 G;  3BVG A;  5HUR A;  4PNY A;  2I5L X;  4DR3 L;  2R93 B;  1N34 Q;  3SR1 A;  1XNQ Q;  2K1B A;  2MQH A;  1B4O A;  5M5X H;  1KNA A;  1YZ6 A;  5ELF A;  3HOU B;  2J0T D;  2OQK A;  1BF4 A;  4MIU A;  2OWO A;  1ZXT A;  4PV1 C;  1JE5 A;  4QGU A;  2F4V L;  2VNU D;  1B53 A;  3TP7 A;  2IW3 A;  5FKA C;  1JOQ A;  2K5W A;  3A55 A;  2DNC A;  3G7L A;  3FMC A;  3NPP A;  4NXN L;  3EJI A;  2N78 A;  4X3U A;  2FJ2 A;  4APV A;  2RVL A;  4WRD A;  5IY0 A;  2Z0S A;  3R2T A;  4O42 A;  1N9W A;  1AEX A;  1F2L A;  4V19 0;  4C2M H;  1UE6 A;  2BCO A;  3STB C;  2UUC Q;  3R3O A;  3TP6 A;  1KDB A;  4KKT A;  1PTO B;  4JI8 Q;  1SLJ A;  3NQT A;  2K5D A;  5C5L A;  3A8K E;  1TT2 A;  5BN3 A;  4Q5V A;  4JI3 Q;  5JEA G;  2X6L A;  5EPK A;  3EIV A;  1EYA A;  2A1A A;  1IKM A;  4YY3 Q;  1SYD A;  4P72 A;  1I6V C;  2AUJ D;  4DV2 Q;  4K8J A;  4KN7 C;  2A6H C;  2O2L D;  3I4M B;  2PNH A;  1CZW A;  4JI5 Q;  1JR0 D;  4IUU A;  2Q8I B;  3UDF A;  1HA5 A;  3NQI A;  1Q1B A;  2F0P A;  3WWV A;  3GTP B;  2RKS A;  2VY3 A;  4G4K A;  1UUP A;  4C3J B;  2HCC A;  3ND8 A;  4A93 B;  4RG1 A;  5EAY A;  1C7Y A;  1H9J A;  3DWQ A;  3NXW A;  2F03 A;  2F0W A;  2AWO A;  4OXP A;  1BCP B;  2F0L A;  3PUZ A;  4A93 G;  2VS1 A;  4NXM Q;  1PFS A;  1BR9 A;  1STB A;  2B2U C;  4FF1 A;  2E2J B;  5JJZ A;  1NMF A;  1QUQ A;  5CMD A;  2PW7 A;  5JOB A;  3S2D B;  1JB3 A;  3D4D A;  4R4I A;  1XPU A;  1R4P B;  1BDO A;  3R93 A;  5M5Y B;  1FNU A;  1EIY B;  2C5C A;  4C3H B;  2VQE Q;  5IYB H;  1EZ6 A;  1HTL D;  5JVG 3;  3LX0 A;  1GHK A;  1EOV A;  1EY4 A;  2I5H A;  1DM0 B;  1EY5 A;  1Q82 C;  1PTO F;  2MGS A;  2KHJ A;  5M9O A;  2XGT A;  2QCP X;  3NBH A;  4Q0F A;  3GTM H;  1VQG A;  1EIF A;  1UEA B;  1CUK A;  1UWV A;  2KA7 A;  4BBS H;  3UI2 A;  1IW7 D;  2G5D A;  1TY2 A;  2Y0S B;  1CZG A;  5IYD H;  2F0O A;  4H7B A;  1LTS D;  5M5W B;  3HOX B;  4A3E B;  3FPP A;  3V96 A;  4NW2 A;  3PIP A;  1YBY A;  3ONA B;  1PH4 A;  1M4V A;  3HOX G;  1F9Q A;  4A3E G;  1K3R A;  3CHB D;  4OL7 A;  4V0B A;  1TWF H;  1N33 L;  4MN3 A;  4GLA C;  4HSV A;  4JI6 L;  1ESR A;  3VA7 A;  2I07 B;  2EOT A;  4RKB A;  4DA2 A;  1PFN A;  5E3F A;  1SND A;  3M4Y A;  1U0L A;  3CMA A;  3I73 A;  2X69 A;  1N32 L;  1C8C A;  1ET9 A;  1A62 A;  1F2M A;  2CWP A;  4KN4 C;  2JA5 B;  1EY8 A;  1WFQ A;  1L0W A;  2KHS A;  4LF9 Q;  1EWC A;  1Z47 A;  5EKK A;  1C0A A;  3PO3 H;  2JA5 G;  4WFN 3;  2MNA A;  1B70 B;  4LF5 Q;  2EXD A;  1TXY A;  5I9O A;  4QIW B;  4DR7 Q;  5FK9 C;  2KHI A;  1SRO A;  4XT1 B;  4F7X A;  2KCC A;  3E3X A;  4R4T A;  5FO8 B;  3GTO H;  1CHP D;  3RZO B;  4ME3 A;  2BA0 A;  4LW1 A;  3H0G G;  3NSW A;  3OMG A;  3GTJ H;  1GO3 E;  3D6C A;  2WAQ B;  3H6M A;  2N88 A;  2UXC Q;  2E76 C;  3KDF A;  1F9S A;  2BA1 A;  1AFP A;  5IP7 H;  2NVT B;  2RHQ B;  2SEB D;  3S1N B;  3TZU A;  1HZC A;  2JYO A;  3K80 C;  2B3G A;  3PV0 A;  4OO1 G;  1DGS A;  3W1G A;  1WTX A;  4LF6 L;  4A4I A;  1OXV A;  4ALP A;  4DR5 Q;  1Q3L A;  5IGB A;  1I50 H;  4KJN A;  3FRP B;  1WD0 A;  1XWE A;  1LO5 D;  5DM6 3;  4KY7 A;  2HUG A;  1W6K A;  1BKB A;  4DUY Q;  2JA8 H;  1YNN D;  1E2Z A;  2KVM A;  4L5R C;  3I70 A;  1JE4 A;  1CQV A;  1V43 A;  4FP5 D;  1X9N A;  5J22 A;  2G9H D;  3HOY B;  4OO1 I;  1MJC A;  3ER0 A;  4CHT B;  4Y52 H;  3K7A B;  5M3F B;  5CV9 A;  2HHH Q;  4DNT B;  2R7Z B;  1NBW A;  4ZYS A;  3ND9 A;  2PZW A;  5M3F G;  1PH7 A;  2NVX H;  5GAH C;  1W3S A;  4H0L C;  3S15 B;  4U68 A;  1LAC A;  5JVH 3;  4F87 A;  3DEO A;  3OPO A;  2CQA A;  4GS3 A;  1DOL A;  2WKD A;  5FLX E;  2BDO A;  5FO9 B;  4A3I H;  4KY5 A;  3TRE A;  1TWA H;  1G29 1;  2QDB A;  1T5X D;  1UEB A;  1RKN A;  4L5S A;  4H13 C;  1Q8K A;  1TWH B;  1ENC A;  1LYL A;  1B2T A;  4P2C B;  1YNJ C;  1F77 A;  3KFU A;  1Y8P B;  2NUC A;  1DD2 A;  5KEE A;  2BH8 A; 
#chains in the Genus database with same CATH homology
 4JBW A;  5C4H A;  2VUM B;  5KRU A;  1ILQ A;  3OOC A;  2R92 B;  3SK8 A;  3AU7 A;  1S5C D;  2OT2 A;  3ZYY X;  3MXU A;  1J9O A;  5C0X H;  3QIA A;  1Q1E A;  3MZ5 A;  5ISR A;  1STE A;  1SYE A;  1NUC A;  3QJY A;  3L3O C;  3GTQ B;  5J1Z A;  1D5M C;  2EYO A;  2BE5 D;  1DCZ A;  4KY6 A;  3DUZ A;  1HRJ A;  2BOS A;  4CKC A;  1F9P A;  2RA4 A;  2EJG C;  4WJW A;  1OXT A;  2IX3 A;  5IT9 L;  4DGZ A;  3S9W A;  2D9U A;  4KV6 A;  3WOE A;  2B2T A;  4YIJ A;  3P1H A;  4EQP A;  3I72 A;  1E0B A;  3I4L A;  1EIH A;  5M5X B;  1O7L A;  5CV7 A;  4CBV A;  3SXH A;  3HS0 C;  5KYI A;  2PMZ B;  3J7A V;  4IZ8 A;  3VYU A;  2BDN A;  1CQF A;  2Z4I A;  1Y69 U;  1JWU D;  1LTB D;  3LNN A;  3OWF A;  4B08 A;  2EZV A;  4C2M B;  1PFM A;  1QIL A;  4HCE A;  2B2T C;  1IHZ A;  1CM9 A;  1NSN S;  1JOR A;  2XRQ D;  2EY5 A;  2F0I A;  4CJ0 B;  5F2D A;  4FVM A;  3GO5 A;  2R3Z A;  2MHV A;  4BS9 A;  3BS1 A;  3MHB A;  5KNB A;  4DXF A;  1AZQ A;  1V1P A;  1IW7 C;  3K5N A;  4L63 B;  5E4W C;  3NTI A;  5G3L D;  2RDG A;  4FF4 A;  3WDN A;  3KBG A;  4B9W A;  3VR6 A;  4M8A A;  1FGB D;  2PYK A;  5T1G A;  4TQU S;  4CKE A;  3U9O A;  1GOZ A;  3HEJ A;  1BXT A;  1HHV A;  3LWE A;  5JAV A;  1SNP A;  1EY0 A;  1WTP A;  1SBB B;  5A2Q E;  1HQR D;  4IQZ A;  2QF7 A;  1WTV A;  4NDX A;  1XTC D;  1RD9 D;  5EKI A;  3M7G A;  3GTM B;  1A3T A;  4ODG A;  4Z9C B;  5DNF A;  4JK1 C;  4BBS B;  1G8Z D;  3RLF A;  5EBC A;  2NTS A;  1TS4 A;  1J8I A;  5EBD A;  3MA2 B;  1PLF A;  3R8B A;  1D5X C;  3T13 A;  3A8I E;  1SYG A;  3PUW A;  1F2Z A;  1FD7 D;  1TWF B;  1Y1W B;  2HDL A;  2F0D A;  2HQE A;  3MWY W;  1YNN C;  1Q8I A;  3J80 L;  2AQ3 B;  2XRS D;  4K5V A;  1EYD A;  3EQL C;  1E2V A;  3A7A B;  3P20 A;  3OW7 A;  4FXD A;  2OXP A;  2K03 A;  2Z4H A;  4U67 3;  3PO3 B;  3D8G A;  1ESF A;  3NTH A;  2EY1 A;  1IKL A;  1BO0 A;  3OIP A;  1A3U A;  2L12 A;  1DOK A;  1TVX A;  4EGV A;  3GTO B;  1LV9 A;  1DJR D;  1EY9 A;  2VXW A;  5C0X J;  5ELB A;  1SNM A;  3NP8 A;  2HCI A;  2F0U A;  3AMU A;  3KBX A;  2R6G A;  4N9P A;  3J7Y W;  1EZ8 A;  1B1Z A;  4DNR B;  3IAY A;  3H91 A;  2TMP A;  1XXG A;  1I50 B;  2J4X A;  2JA8 B;  2EPB A;  4ZLT F;  1HXY D;  2FMC A;  5LL6 X;  5EJW A;  4G57 A;  4WOR A;  2EYL A;  1QOH A;  4FF3 A;  4ZQ3 A;  2F0H A;  2FHT A;  2LMC B;  2ENB A;  5A35 A;  2H4O A;  2NVX B;  1UNS A;  5CV5 A;  1KDC A;  2Q8T A;  1ZKO A;  3X3N A;  4IFD J;  4FXG C;  4ULL A;  1NCV A;  3I8Z A;  4K2K A;  4A3I B;  1F9R A;  1TWA B;  1Z7T A;  2BE5 C;  2A69 D;  4RAU C;  2F0M A;  1EQV A;  3JAM L;  4H44 C;  5K36 G;  4CGY B;  3Q22 A;  1U9R A;  3NHH A;  3HRZ C;  3SHL A;  4I65 A;  2F0F A;  1AW7 A;  4ILW A;  3GTK B;  4HMJ A;  1JCK B;  4NMZ A;  2KUM A;  1KTK A;  4BWG B;  2F0N A;  1C48 A;  1D2B A;  3SK4 A;  4FYD A;  1TS3 A;  4XTC S;  3DM1 A;  4HN7 A;  1RDP D;  3T51 B;  4XT3 B;  5C0X G;  3VR4 A;  1SE4 A;  3MXN A;  4GZY C;  3I90 A;  1I6H B;  2D5D A;  2PNR C;  5EPJ A;  2NWG A;  1FYC A;  3VA5 A;  4CKB A;  2NVQ B;  5C0X I;  4RGN A;  5C5M A;  4QB4 A;  3J81 L;  4BA2 I;  4AYB B;  4RHS A;  3BDO A;  3IKJ A;  2F0S A;  1PRT D;  3KLR A;  3NTK A;  4BBR B;  3C2P A;  5D3D A;  3CU7 A;  1CHQ D;  2K32 A;  3IFT A;  2DNE A;  4K8I A;  4IFD G;  1RCV D;  1T5E A;  1KAB A;  2F0E A;  3EA6 A;  1HTP A;  2K33 A;  1V8Q A;  1JWM D;  3Q0A A;  1K8M A;  5NUC A;  4KD3 A;  5AFW A;  1WD1 A;  1AN8 A;  3M4O B;  1EU3 A;  2IX0 A;  2AUK A;  3C3L A;  1JC7 A;  4IFD I;  1L0Y B;  2WV6 D;  3HOW B;  5E1F A;  1I4G A;  2CVR A;  3FEW X;  2O5I C;  1WVL A;  5I4D A;  1D6E C;  4OHJ A;  2F0Q A;  3O13 A;  1GUT A;  3E0J A;  5COR A;  3H0G B;  3S1M B;  1STN A;  1PFB A;  4ZRZ A;  3S14 B;  4LJZ C;  2H1E A;  3PO2 B;  3KF8 A;  1A15 A;  4X3S A;  4ME5 A;  2KJX A;  3T16 A;  2L11 A;  4XQJ A;  1K8O A;  5KGU A;  1ILP A;  1WTR A;  2KQ3 A;  1BQQ T;  1EY6 A;  1X32 A;  4UAI A;  3MAQ A;  1QNK A;  2AWN A;  4XQN A;  4IUT A;  1I4X A;  1O7Y A;  4KD4 A;  4KI0 A;  1PZJ D;  1STA A;  2RDF A;  1CA6 A;  1ML0 D;  2EY2 A;  2TSS A;  3BVM A;  3A8J E;  4RHR A;  4DXG A;  4LMQ D;  2C9O A;  1SYB A;  5C6A A;  5IGE A;  1MBY A;  3C46 A;  5BN4 A;  2AQ2 B;  2A73 B;  2B8G A;  3SDZ A;  2RDH A;  1AZP A;  2A6E D;  5IT9 E;  1U4M A;  4OGQ C;  1DZ1 A;  5K36 H;  2IJ0 A;  5C4X B;  2B8F A;  1S5D D;  3DWP A;  3Q24 A;  3GTL B;  5HGT A;  3E5S A;  2K04 A;  2ICI A;  1STG A;  5FOB B;  3T56 B;  4K6L A;  3MFY A;  5KIX A;  3VR3 A;  1JOO A;  3RZD B;  3H94 A;  2IT1 A;  3K5L A;  1XX8 A;  1S5F D;  3NWT A;  3S1R B;  3D4W A;  1D5Z C;  1RTO A;  4DAV A;  1I4H A;  2A69 C;  4A3D B;  3BDL A;  1G91 A;  2JSO A;  1EEF D;  5LHY 1;  3S1Q B;  3V2T A;  3VYR A;  5J39 A;  1EIG A;  5C4J B;  1LT6 D;  1SAP A;  3PMF A;  4FF2 A;  3LWU A;  1EL0 A;  2WB1 B;  2F3V A;  1VMP A;  2MP1 A;  1M8A A;  1W6J A;  2K6A A;  3OSO A;  5CGK A;  3K59 A;  1I4Q A;  2E74 C;  3W2D A;  1SDF A;  5FLX L;  4XYO A;  2IX1 A;  2JEB I;  2JE6 I;  3GD7 A;  1DOM A;  1GUG A;  3DHQ A;  1JQY D;  3M7N A;  4IUV A;  4IFD H;  4K2L A;  1TU2 B;  3BYY B;  1VDZ A;  3L9A X;  1Y8O B;  3NWS A;  4HCS A;  4K5W A;  3SEB A;  1BOS A;  2NZ1 D;  2XNA C;  3D31 A;  1B3A A;  4QUF A;  5ELC A;  5T1I A;  1GUN A;  1H9S A;  1GJX A;  1HPC A;  4HTH A;  4PMW A;  2B2W A;  2M2L A;  1TII D;  1L0X B;  1HUM A;  1IL8 A;  1PRT C;  2F0J A;  5BN5 A;  1KNE A;  1LTR D;  5EPL A;  4IUN A;  2HDM A;  3KUP A;  3MXP A;  3NBI A;  2EYP A;  2L1B A;  1CA5 A;  1SYC A;  2A74 C;  2EYM A;  3N52 A;  2F0K A;  2E2D C;  1SNC A;  3ERQ A;  3G6J B;  5ELE A;  3MEH A;  5EQ0 A;  1B50 A;  4TSS A;  1QCB D;  3J80 E;  3QOJ A;  3K57 A;  4DF7 A;  1EQT A;  1MGS A;  3A56 A;  1IYU A;  4K6D A;  1KLG D;  2YYZ A;  4PMB A;  1C4Q A;  3E6Z X;  2PW5 A;  4K14 A;  5D3I B;  5G3L F;  2O5J C;  3PUV A;  4KKU A;  2EYF A;  3BVZ A;  3URY A;  4G7O C;  2O4X A;  2XWB B;  4QF4 A;  3TP8 A;  1TQO A;  4A3G B;  2K28 A;  3R2I A;  4XYQ A;  3T4A C;  3HKZ B;  1ZYR D;  5IOD A;  2OF1 A;  3L7Z C;  1RF2 D;  3TSS A;  1STY A;  3M3Y B;  5IGD A;  1DXM A;  2LKV A;  2DY7 A;  4ABN A;  3D3R A;  2EE1 A;  5KND A;  4C1N I;  4IN3 A;  1A2T A;  2XSC A;  4NKL A;  3OIQ A;  4OIJ A;  3HGB A;  1SFO B;  2XVS A;  3QB3 A;  4KHV A;  5KYL A;  1OXU A;  1BUV T;  3DXJ C;  4IUR A;  2KED A;  1HQM C;  2PPB C;  1BNZ A;  3S16 B;  1TWC B;  3RUZ A;  2RSO A;  2L5T A;  3MXG A;  3EFX D;  2B2V A;  2NBF A;  2IWH A;  2K05 A;  1I3Q B;  3JAM E;  3H3V C;  1SYF A;  1H9K A;  3KLS X;  4M1U B;  2A6E C;  4G7H C;  2ID0 A;  5CV6 A;  1QWY A;  3EVQ A;  1E2W A;  3QWN A;  5A2Q L;  3V05 A;  1IYV A;  1VMC A;  2WKC A;  4L6T B;  1SE3 A;  4CJ2 C;  1LTG D;  1BBX C;  2F0T A;  3MFG A;  1Q12 A;  1D1I A;  3AB9 A;  3BYT B;  4UDU C;  3A7L A;  4DFA A;  2B2V C;  1O7Z A;  1HFN A;  3MC0 B;  4ZK9 B;  1EY7 A;  2D62 A;  1LTI D;  1GHJ A;  3VYT A;  1PZI D;  5M3M B;  3HZX A;  1MSG A;  5DEH A;  3S17 B;  2QKI C;  2DY8 A;  3HP3 A;  1D1K A;  2PO4 A;  4IUQ A;  4N9T A;  1X3P A;  4S3S A;  4Y7N B;  3J81 E;  1EU4 A;  1WCM B;  3GV6 A;  4DAY A;  1FNW A;  2L0C A;  3DMU A;  1SJH D;  1GUW A;  1LT5 D;  2OEO A;  2ZT9 C;  4ZUJ A;  4DU9 A;  3PIO 3;  1GUO A;  3GP7 A;  3FVQ A;  3VR2 A;  1VF5 C;  3J7A F;  4X3K A;  2B2U A;  3TP5 A;  2K7V A;  2VB3 X;  5C44 B;  1PRT B;  2K5Q A;  3FKI B;  4ZKB B;  4LK1 C;  1ET6 A;  2PZU A;  4EQN A;  2F1M A;  4QMG A;  2IPK D;  4RFB A;  3SK6 A;  5IGC A;  1U4R A;  2XN9 C;  3OWE B;  1A3V A;  5CBA E;  3CRK C;  4HSP A;  1PTO D;  1H9R A;  1H9S B;  2KEE A;  3SVM A;  2MJ8 A;  5IGG A;  4C3J G;  1QE6 A;  2A68 D;  3P75 A;  1KDA A;  5TSS A;  2EYJ A;  1Q90 A;  1WTW A;  2PQE A;  1LAB A;  1CFM A;  3NE5 B;  1NAP A;  4E6I A;  1I4R A;  4R8N A;  2FMM A;  2NB0 A;  4HED A;  5I6Y A;  5KNC A;  2V4D A;  2Z8L A;  3GV3 A;  2E75 C;  2M9V A;  4C3H G;  1V1P B;  3K58 A;  4KK7 A;  1SNQ A;  2CW0 D;  1B44 D;  1NR2 A;  1G2S A;  1BCP D;  4DK0 A;  2EXZ A;  3BG3 A;  1SSO A;  1PRT F;  1QG7 A;  3BZD B;  2N55 A;  4I7Z C;  2QEJ C;  4FO2 A;  3ERO A;  4IAL A;  4BY7 B;  4LAA A;  5IOC A;  4KTA A;  2L4N A;  1UAP A;  3K5O A;  4K5X A;  3PUY A;  4RGM A;  1F2Y A;  1VCI A;  4EQO A;  1KAA A;  1CK1 A;  1ZYR C;  2B63 B;  3OMC A;  1BCP F;  1LTT D;  2F4I A;  4C1N K;  2XWJ B;  1II3 A;  2EJM A;  4A3K B;  4MHE A;  2KEC A;  1Y1V B;  5EKL A;  4DN4 M;  1SXT A;  2FIN B;  4QCL A;  2L55 A;  5CR3 A;  1ENF A;  1JOK A;  4C3I B;  3GQB A;  5C3E B;  1ROD A;  3MTS A;  4C3I G;  2ZXO A;  1TWG B;  4B9X A;  2GA4 B;  3W3A A;  3D4R A;  4RGO S;  2K01 A;  4RCO A;  2SNS A;  4L8J A;  2MUY A;  2VB2 X;  5CYU A;  1PZK D;  4F88 A;  2F3W A;  1B9N A;  3FDT A;  3A54 A;  5JPN C;  1A2U A;  4F8M A;  3QOL A;  4RA8 A;  5I9P A;  1TY0 A;  1Z6H A;  2JP1 A;  4RWS C;  1R4Q B;  2NYZ D;  4RGT A;  4J1M A;  1DON A;  1HFG A;  1S5E D;  1ENA A;  1CT1 D;  2ICE C;  3F2U A;  1XYI A;  4A3J B;  4X3T A;  2ZXP A;  4R9W A;  5DAU A;  5D14 A;  4ZAI A;  4BY1 B;  5C3W A;  1R9T B;  2G9D A;  2M00 A;  2F0G A;  1EEI D;  1TR5 A;  1SMY D;  1RJT A;  4G7Z C;  1SJE D;  3Q6S A;  1TKW B;  3K0Y A;  4O1N A;  4QUC A;  1PTO H;  2NN6 G;  5JEA H;  1HUN A;  1QNU A;  1CTM A;  2WIN B;  2F0V A;  1AP0 A;  2Q8R E;  1FR3 A;  3KLS A;  3VR5 A;  2I46 A;  2NN6 I;  2KOL A;  2L9H A;  4J6H A;  3SE0 A;  2A5H A;  3QO2 A;  3CRL C;  2SOB A;  1RTN A;  2DN8 A;  1SEB D;  1U4P A;  4DK1 A;  5C3X A;  1EOT A;  4KMU C;  1FNV A;  5CV8 A;  4NP5 A;  1ZEQ X;  1EWH A;  2B39 A;  1OO9 B;  2ZXR A;  4OIK A;  3NK9 A;  4XXE A;  2WII B;  2PZT A;  2JA6 B;  4DAP A;  2E2I B;  3CKI B;  1MD2 D;  4FNF A;  3PUX A;  1OXX K;  2WAC A;  3C1F A;  1S5B D;  1LLR D;  2PCF B;  3K6O A;  5CC4 A;  1GXD C;  2X6G A;  1SE2 A;  2A6H D;  1PTO C;  3P7J A;  2A68 C;  3DEP A;  3T53 B;  1O80 A;  1TS2 A;  4A3B B;  1Y8N B;  3I4N B;  5I6W A;  1EFI D;  2JXM B;  2RQX A;  1NR4 A;  4BA1 I;  2B2Y A;  1H9M A;  4A3F B;  1LT4 D;  4A3M B;  4C56 C;  3WOF A;  1LTA D;  5IGF A;  1O78 A;  1JIC A;  2CW0 C;  1I4P A;  3RD4 A;  1BCP C;  2B2W C;  4PQX A;  2J7Z A;  3Q23 A;  1B9M A;  4R8I A;  4RH6 A;  3IL8 A;  4PMC A;  1U4L A;  1DYQ A;  5FO7 B;  4KHZ A;  2RSN A;  5C4Z A;  2EVB A;  1A6X A;  2EYH A;  3MVV A;  5ELD A;  5E4X A;  1ONL A;  4ID6 A;  2Z1C A;  4OO1 H;  4HR7 B;  2B2Y C;  1STH A;  3HOZ B;  3TBI B;  3X3M A;  2KCN A;  5COY A;  1PMR A;  2EDG A;  1WTO A;  1GUS A;  5IIF A;  3HG9 A;  2NVY B;  4IUP A;  4HMI A;  2CHB D;  2NTT A;  4ZUI A;  4ZKC B;  5DM7 3;  1EYC A;  5I2X A;  3PIP 3;  3N6R A;  3QG1 A;  3C1E A;  4TKO B;  1MSH A;  1ICW A;  2XIW A;  4XDX A;  3RMH A;  1PYW D;  1KLU D;  3D6W A;  1WTQ A;  1QB5 D;  2SDF A;  2EY6 A;  2EJF C;  3M85 A;  2LY7 A;  5K5P A;  5CV4 A;  1LT3 D;  4RCN A;  4KJO A;  2LS0 1;  3TN2 A;  2QIL A;  2NN6 H;  3K5M A;  1PXU A;  4FXK C;  2WP8 J;  5JPM C;  4XIG S;  2IL8 A;  1K83 B;  1JWS D;  3OHX C;  5JEA J;  3KK7 A;  3SK5 A;  4EVO A;  1HCZ A;  2AQ1 B;  5EGT A;  1S4Z A;  2RBM A;  5I2Y A;  3TME A;  3BDC A;  2SNM A;  1G6Z A;  1TS5 A;  3IFD A;  4XQQ A;  4RKL A;  1QJO A;  4TRD A;  1PDQ A;  2FFK B;  4CJ1 B;  5D65 A;  5LL6 S;  3CQZ B;  4KKS A;  3I91 A;  1OXS C;  1RHP A;  3GTJ B;  3H09 A;  3HOV B;  2MPM A;  1SNO A;  5CBE E;  3S2H B;  1X3Q A;  3FPU B;  2JEA I;  1V1O A;  4J8Q A;  1HA6 A;  1SMY C;  2LFN A;  4HAE A;  3NUC A;  3TZD A;  2YU9 B;  3U9S A;  3VYS A;  3ITP A;  2R61 A;  1CI3 M;  1VF7 A;  1MI2 A;  1G2T A;  3I3C A;  3GTG B;  2JA7 B;  2E2H B;  1YNJ D;  3DWA A;  2D2C C;  3TDQ A;  3BVG A;  5HUR A;  4PNY A;  2R93 B;  3SR1 A;  2K1B A;  1B4O A;  1KNA A;  5ELF A;  3HOU B;  2J0T D;  1BF4 A;  4MIU A;  1ZXT A;  4PV1 C;  2VNU D;  1B53 A;  3TP7 A;  2IW3 A;  5FKA C;  1JOQ A;  2K5W A;  3A55 A;  2DNC A;  3G7L A;  3FMC A;  3NPP A;  3EJI A;  4X3U A;  2FJ2 A;  2RVL A;  4WRD A;  3R2T A;  4O42 A;  1AEX A;  1F2L A;  4V19 0;  2BCO A;  3R3O A;  3TP6 A;  1KDB A;  4KKT A;  1PTO B;  3NQT A;  2K5D A;  5C5L A;  3A8K E;  1TT2 A;  5BN3 A;  4Q5V A;  5JEA G;  2X6L A;  5EPK A;  1EYA A;  1IKM A;  1SYD A;  1I6V C;  2AUJ D;  4K8J A;  4KN7 C;  2A6H C;  2O2L D;  3I4M B;  1CZW A;  1JR0 D;  4IUU A;  2Q8I B;  1HA5 A;  3NQI A;  1Q1B A;  2F0P A;  3GTP B;  2RKS A;  4G4K A;  4C3J B;  1UUP A;  2HCC A;  3ND8 A;  4A93 B;  1H9J A;  3DWQ A;  3NXW A;  2F03 A;  2F0W A;  2AWO A;  1BCP B;  2F0L A;  3PUZ A;  1BR9 A;  1STB A;  2B2U C;  4FF1 A;  2E2J B;  5JJZ A;  5CMD A;  2PW7 A;  5JOB A;  3S2D B;  1JB3 A;  3D4D A;  1R4P B;  1BDO A;  3R93 A;  5M5Y B;  1FNU A;  2C5C A;  4C3H B;  1EZ6 A;  1HTL D;  5JVG 3;  3LX0 A;  1GHK A;  1EY4 A;  1DM0 B;  1EY5 A;  1PTO F;  2MGS A;  5M9O A;  2QCP X;  3NBH A;  4Q0F A;  1UEA B;  2KA7 A;  3UI2 A;  1IW7 D;  1TY2 A;  2Y0S B;  1CZG A;  2F0O A;  4H7B A;  1LTS D;  5M5W B;  3HOX B;  4A3E B;  3FPP A;  3V96 A;  4NW2 A;  3ONA B;  1M4V A;  1F9Q A;  4OL7 A;  3CHB D;  4V0B A;  4MN3 A;  4HSV A;  1ESR A;  3VA7 A;  2I07 B;  2EOT A;  4RKB A;  4DA2 A;  1PFN A;  5E3F A;  1SND A;  3M4Y A;  3I73 A;  2X69 A;  1C8C A;  1ET9 A;  1F2M A;  4KN4 C;  2JA5 B;  1EY8 A;  2KHS A;  1EWC A;  1Z47 A;  5EKK A;  4WFN 3;  5I9O A;  4QIW B;  5FK9 C;  4XT1 B;  4F7X A;  2KCC A;  5FO8 B;  1CHP D;  3RZO B;  2BA0 A;  3NSW A;  3OMG A;  3D6C A;  2WAQ B;  3H6M A;  2N88 A;  2E76 C;  1F9S A;  2BA1 A;  1AFP A;  2NVT B;  2SEB D;  3S1N B;  3TZU A;  2JYO A;  3PV0 A;  4OO1 G;  1WTX A;  1OXV A;  1Q3L A;  5IGB A;  4KJN A;  3FRP B;  1WD0 A;  1XWE A;  1LO5 D;  5DM6 3;  4KY7 A;  2HUG A;  1W6K A;  1YNN D;  1E2Z A;  2KVM A;  3I70 A;  1JE4 A;  1CQV A;  1V43 A;  4FP5 D;  5J22 A;  2G9H D;  3HOY B;  4OO1 I;  4CHT B;  3K7A B;  5M3F B;  5CV9 A;  4DNT B;  2R7Z B;  4ZYS A;  3ND9 A;  2PZW A;  4H0L C;  3S15 B;  4U68 A;  1LAC A;  5JVH 3;  4F87 A;  3DEO A;  3OPO A;  2CQA A;  1DOL A;  2WKD A;  5FLX E;  2BDO A;  5FO9 B;  4KY5 A;  1G29 1;  2QDB A;  1T5X D;  1RKN A;  4H13 C;  1TWH B;  1ENC A;  1B2T A;  4P2C B;  1YNJ C;  1F77 A;  1Y8P B;  2NUC A;  1DD2 A;  5KEE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...