1PTOF

The structure of a pertussis toxin-sugar complex as a model for receptor binding
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
98
structure length
98
Chain Sequence
LPTHLYKNFTVQELALKLKGKNQEFCLTAFMSGRSLVRACLSDAGHEHDTWFDTMLGFAISAYALKSRIALTVEDSPYPGTPGDLLELQICPLNGYCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a pertussis toxin-sugar complex as a model for receptor binding.
pubmed doi rcsb
molecule tags Toxin
molecule keywords PERTUSSIS TOXIN (SUBUNIT S1)
total genus 17
structure length 98
sequence length 98
chains with identical sequence L
ec nomenclature
pdb deposition date 1994-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF09276 Pertus-S5-tox Pertussis toxin S5 subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ptoF00
4RGMA 1KLGD 5FK9C 2RDHA 1HXYD 1CQVA 1TS4A 1LLRD 1EEID 1FNUA 5ELBA 1UNSA 3EFXD 3EA6A 4K6LA 1EFID 1PRTB 1RD9D 2NTSA 4Z9CB 2O2LD 1PRTD 3CHBD 3MC0B 1SXTA 2AQ1B 1PTOH 1I4QA 1PTOB 4DXGA 1PZKD 1PZJD 5FKAC 1FD7D 4OHJA 1B1ZA 1DYQA 2XNAC 3DWPA 1TS3A 1CHQD 1LO5D 1B44D 1JQYD 3SEBA 3DWAA 1BCPD 1PTOF 2IPKD 4BWGB 1ET9A 1LTGD 1G8ZD 3BVMA 3KLSX 1PTOD 5D3DA 1JWMD 3URYA 3GP7A 1L0YB 1SBBB 1D5MC 1SE3A 4RHSA 2J4XA 1KLUD 1S5DD 1D5ZC 1TS2A 1D6EC 1ET6A 1CHPD 1F77A 1PZID 5ELFA 2XN9C 2XRSD 3BYYB 1SJHD 3R2IA 5I4DA 1PRTF 3V05A 4O1NA 4RGNA 2TSSA 5ELEA 1LT5D 4RGTA 5D3IB 3DWQA 1I4HA 2IJ0A 1I4RA 1M4VA 1STEA 2RDGA 5TSSA 1SE4A 3OWEB 1JR0D 1FGBD 1FNVA 4RCOA 1SJED 4TSSA 1SE2A 1BXTA 2CHBD 1LTSD 1MD2D 3BVGA 4UDUC 1S5FD 1V1OA 1RCVD 1BCPC 2G9HD 1EWCA 1S5BD 4L63B 1I4XA 4ZYSA 4RFBA 1JWUD 1I4GA 2AQ3B 1RF2D 1LT3D 1PYWD 5ELCA 4RGOS 1EU4A 1QILA 1LTRD 3BYTB 1L0XB 2QILA 1HTLD 1LTTD 1D5XC 1S5CD 1XXGA 2ICIA 2WV6D 3TSSA 1SEBD 1AW7A 1XTCD 1LT4D 1V1PB 1FNWA 2SEBD 4C56C 2R61A 1TY0A 3BVZA 1JCKB 3BZDB 1PRTC 1LTAD 2XRQD 3W2DA 2QEJC 1BCPB 1RDPD 1EEFD 1JWSD 1LT6D 3R8BA 1PTOC 1EU3A 2AQ2B 1GOZA 1V1PA 1S5ED 1HA5A 1CT1D 1LTID 1UUPA 1LTBD 2Z8LA 1CK1A 4L6TB 1KTKA 3O13A 1DJRD 3R2TA 1I4PA 1T5XD 4RH6A 4DXFA 1HQRD 1ENFA 2NTTA 1ESFA 5ELDA 1AN8A 1TS5A 1BCPF 1TY2A 4RHRA 3MFGA
chains in the Genus database with same CATH superfamily
1KRSA 1BF4A 2KOLA 1Z9FA 2A68C 1A3TA 1LLRD 2NWGA 2X6GA 3GTKH 1D8LA 5KNDA 3M7GA 3A74A 5IWAL 1NE3A 1RTNA 2KBNA 1C9OA 5JPNC 1PRTD 1MJCA 2HDLA 3R3OA 5FKAC 4P73A 2NB0A 5IOCA 3F8TA 2KJXA 4J8QA 4HN7A 3GD7A 1JQYD 2V1CC 1Q3LA 1DXMA 3UDXA 4DR4L 2K03A 4C3HB 2F3VA 2MGSA 3OIPA 2IL8A 2JEBI 4C2MB 4FF1A 3KLWA 1I6HB 5ELFA 1SYGA 2XRSD 1B2TA 1PRTF 4WJWA 1HA6A 1GUNA 2XVSA 2RCNA 5IYBH 4LUZA 4K2LA 1A3UA 1B4OA 3HOXH 1CKNB 2D9UA 5IGEA 1MGSA 3OWEB 4JYAQ 3S17B 1Z7TA 2F4VL 4RA8A 1MD2D 1HZAA 4DV0L 4LF6Q 3PF5A 2O5JC 5FLXc 1JORA 2BE5D 1YNNC 1A63A 1GJXA 1EY6A 4IUVA 1GUWA 1EQQA 1U4RA 2UUBL 3A7LA 1G2TA 3WDNA 4EQOA 4EVOA 1IYVA 2Z0SA 1I3QH 1VQMA 2R7DA 3PO2G 3M4QA 4EQ5A 5JAVA 1HCZA 2NVXB 3U58A 4NB3A 3NUCA 2JA6B 2ICEC 4I65A 1GUTA 5CR3A 1K83H 3PMFA 2G5DA 3WWVA 1TKWB 1WYDA 4A3BB 3J7YW 4L6TB 1X6OA 4X65Q 1HZCA 3SK6A 2BOSA 3OW2A 2FFKB 3M4OH 2SNMA 2Z9HA 3I3CA 4A3FG 5ELDA 4LF9Q 4GKJL 4K14A 1Q82C 5M5XH 4MZ9A 3HOWB 4X3SA 1C4QA 1TS4A 1EEID 1VF7A 1CZGA 2HCIA 2XIWA 3C1EA 1BUVT 1TQOA 1CZWA 2XWJB 4S3SA 4E6IA 4Z9CB 4IJHA 3PO3H 4A4IA 2Z4IA 2Z6BA 2JA5B 5IGFA 1RIPA 1STAA 4BY7H 1IKLA 2HQLA 3DWPA 2Q2TA 4OWTB 1LO5D 1UEAB 3EIVA 3NE5B 3HKSA 2F0LA 1PTOD 4NP5A 1SFOB 2FJ2A 4MTNA 4G4KA 1L0YB 3PO2B 1SNCA 4JI8Q 1EYAA 1K83B 5KGUA 2UXCQ 5D65A 3BDCA 2J7ZA 4AYBE 3D8GA 2R93G 2YV5A 3FEWX 2CQOA 4B3MQ 4A3KG 5D3IB 1QOHA 2NVYB 2NN6I 1X3GA 2AWOA 2R7ZB 2FMCA 1JJ2A 2JA7G 1FNVA 3FPPA 4XT1B 5EKIA 3W1BA 3RD4A 3GTMB 3HOZG 3OMGA 1RCVD 5J3BA 1BCPC 3F1ZA 3RLNA 4LF5Q 4JK1C 2E2JB 4RFBA 3J7ZC 3J7A5 2B8GA 4BBRH 3A5ZB 3EJIA 2F0OA 2X6LA 2F0WA 4QIWE 1LTRD 3A54A 4F88A 2WINB 1XYIA 4OIKA 3HKZG 4U673 3G7LA 2PQEA 1WTOA 3C3LA 3S1MB 3BVZA 5IT9L 5FLXE 4QUCA 1VQAA 2VXWA 3NXWA 1VQLA 4A3FB 2MP1A 1RDPD 4CGYB 1SFOH 3W1GA 3GV3A 4B08A 3QJYA 4ILWA 3SE0A 4A3GG 3PCOB 1X9NA 3CCLA 1A0IA 1OXSC 1PFMA 1S5ED 3HOYG 4FYDA 4DV4Q 2FINB 1VQPA 1LTID 1YBYA 1K3RA 5IP7G 1CK1A 4A93B 4QQBX 3AB9A 3TP7A 2H4OA 3KJPA 3S1NH 4NPSA 3CCVA 1BCPF 4A3IG 2O4XA 4RG1A 1BBUA 1IW7D 1N32Q 5FK9C 1R4QB 1FNUA 5IYCH 4GN3B 3J7AV 5FOBB 2RSNA 5CMDA 2VS1A 5IYBG 2EYOA 2HT1A 1HUNA 3J81L 1XNRQ 3I56A 2OEOA 4V0BA 1HH2P 5JPMC 3PQIA 5M5XB 3OIQA 1C8CA 1SYFA 4AQYL 4C1NK 3AFQA 2EXZA 5E4WC 1DYQA 1VQ9A 5FJ8G 5BN4A 1CHQD 3DWAA 1IBLQ 1WVLA 4EX5A 2Z6KC 1ET9A 2R93B 3FMCA 4P2CB 3KLSX 4C3JB 1FR3A 3FRPB 3RN2A 2PZUA 3L2PA 1SE3A 1SE8A 4NXML 3FKIH 4MHEA 3BZKA 1BBWA 4KKSA 2E2JH 2L9HA 4H02A 2RBMA 2B39A 5IGGA 1Q12A 3GTPB 3CCJA 2SNSA 4C3JH 2IJ0A 1Q7YC 1I4RA 3X3NA 5CV9A 1ILPA 4G7ZC 1RTOA 4HJ5A 1Y8PB 1EOTA 2UXDQ 1B9NA 1E7ZA 4LFBL 4YY3L 4IJLA 4C3IG 5F2DA 1I6HH 2F1MA 2UXCL 4LFCQ 4A3FH 4AYBG 1VF5C 4DV2L 1PH8A 2LY7A 1F9RA 4ZKBB 1MI2A 3NTHA 3K5LA 2K4KA 5EJWA 5EGTA 5I6YA 1C7YA 4JI0L 1GHKA 5ELNA 4DR6Q 4L5SA 2ICIA 1WTPA 3VR3A 3PV0A 2HD3A 2DY7A 1KDAA 3M4OB 2UUAQ 3I4OA 3G6EA 3S1NB 2F3WA 2Y0SB 4GOPA 2B2TA 4KJNA 2YTXA 1UAPA 1PHJA 1JB7A 4FF2A 3AFPA 4IFDG 2R3ZA 2F0KA 5IWAQ 5DEHA 4A3IH 4A3KH 1KIXA 3RZOB 1DJRD 4KN4C 4HIDA 3C1FA 2EDGA 3GTGB 1K0SA 1STNA 1IW7C 3GTOH 1C48A 3J7AF 1VQGA 3K7UC 3J80E 3T16A 1HXYD 5I9OA 2H1EA 1GKHA 1Y8NB 4RKBA 3GTJH 3VR4A 3AU7A 5LMUQ 4X3UA 1XMQQ 1KDCA 3HGBA 3K58A 4DR7L 5C5LA 2CWAA 4A3DB 2E2HB 5KIXA 2B2WA 2E2HH 2BA1A 1RJTA 1KD1C 2BDOA 1PTOH 2RVLA 1I6VC 2ZJPA 3K57A 3STBD 1B1ZA 4OWXB 1EIGA 4BBSG 1U4MA 1B44D 2E2DC 3PO3B 5D3DA 1I3QB 3OSOA 1K8GA 2F0MA 5C3EB 5JEAJ 2L4NA 3C2PA 4RHSA 4DAMA 5IGDA 2IX0A 5IP7H 4LF8Q 2VUMG 5C0XI 1H9MA 1TS2A 1F77A 2A74C 4KLKA 4RMFA 2HUGA 2A8VA 4KKTA 1R4PB 5KYLA 1FYCA 1YIJA 4RGTA 1XPRA 1TWCB 2EY2A 1M4VA 3LWUA 5C4HA 2PQAB 4H44C 1STBA 2IWHA 2JA8G 3I8ZA 1LTSD 1O7YA 4CDEC 4KY6A 3T13A 2JA5H 4R4OA 1L1OA 2L15A 3SDZA 5GAHC 1PYBA 4QCLA 4B3ML 2KCTA 3CCMA 1YHQA 2OTLA 2M9VA 1LT3D 4LF7L 1EQTA 4JI3Q 2D5DA 3FVQA 4PNYA 1WCMG 5C44B 1QZGA 2I46A 5FJ8H 3GV6A 3OHXC 2PQAA 3I91A 5ISRA 3TSSA 4K0KL 1NUCA 1AW7A 3JC66 3NHHA 2JQOA 4KHZA 3CD6A 2M2LA 1VQJA 1PRTC 3NEMA 4DV3L 4BXXG 3K8AA 5AJ3Q 4DV1Q 4PG3A 2CWPA 4JBMA 3KF6A 2BE5C 4I7ZC 4KJOA 2ZXPA 1PVOA 1EY5A 2WB1E 4DAYB 1HFGA 1OTCA 4A3EB 1SYBA 4HSVA 1KNAA 4HJ9A 1X32A 3KLRA 5M3FG 1NTGA 3HOVG 1KRTA 4H0LC 2CKZB 1KLGD 2L12A 3LWEA 5C3XA 2EVBA 1SMYD 1UWVA 1QJOA 4K6LA 2RHQB 2DGYA 4DAPA 1I94Q 4NW2A 4UY8C 3I55A 3K59A 1DZ1A 1PFNA 3KLSA 4C1NI 1D7QA 1NMFA 2JK8A 1L0WA 3KYHC 1CA6A 2XNAC 4JVZA 1CM9A 1TS3A 3K6OA 1ZEQX 3E0JA 2B2TC 3JAMc 2UU9L 1G8ZD 4FF3A 1T5EA 2YYZA 1P8LA 4CKCA 5JJLA 1LTLA 3Q6SA 2LS01 1JOQA 1V8QA 2MJ8A 5LL6S 2YU9B 4JBKA 3IAYA 1Y1VG 3I4MB 2WAQG 3KF8B 2BDNA 3RNUA 4O1NA 1N33Q 4QGUA 2P5ZX 1XNQQ 3H3VH 1A62A 3TDQA 4QMGA 4JI2Q 3OOCA 2RDGA 3A8JE 5EKLA 5LL6X 1SE4A 4OX9L 3FP9A 1Y69U 2SDFA 4HIOA 1K73C 1L1OB 1CA5A 3MXPA 2LSSA 2G9HD 3VYUA 4B3SQ 1QB5D 1RF2D 5JVG3 3M4PA 3MTSA 3PIP3 1G6ZA 4X64L 4DUZL 4LFAL 1F2MA 1HTLD 3NWSA 2EXDA 1KXLA 1PH5A 4MNOA 1HNZQ 1H9SA 3W3AA 3CQZH 4WJ4A 4JI7Q 4LFCL 1WTRA 4BS9A 1XJVA 3HKZB 3RR5A 4DK3C 2RQXA 4DF7A 1SNDA 2BH2A 1QNKA 3H3VC 4K2KA 5COYA 1JE5A 4GKKL 4JI0Q 1DM0B 1S4ZA 1KTKA 4J6HA 3A56A 4CDCC 4DN4M 3ER0A 4Q0FA 3CCEA 4DV7Q 4CBVA 2UUAL 1HJPA 1F9SA 1TS5A 4A3MB 4X6AH 1VQBA 2VQEQ 3HEJA 2EY6A 1PYSB 3E5SA 1PH2A 2NVQB 1AE2A 3K5MA 2B2VA 2WB1G 1JE4A 1QZHA 3I4NH 3NTIA 1K8AC 1BNZA 1EL0A 5FLXL 1M1KC 3G71A 2UXBL 3JAMi 2B8FA 3T4AC 2R6GA 2KCNA 4OHJA 1SAPA 3CMAA 1I50B 1PH9A 1BCPD 4L5QA 4R4CA 4WJ3M 4DUYQ 1KAAA 5A35A 1AFPA 3GP7A 2AWNA 4LFBQ 4V190 4DKAC 5JJKA 2ID0A 1IBML 4TQUS 3OWFA 4XTCS 4A3JG 2X69A 2TMPA 4AIMA 3GTPH 1HNXL 4OO1I 3U4VA 3HZXA 4XDXA 5H1SE 2LXKA 1Q90A 3CRKC 4NKLA 5TSSA 2KQ3A 3OTOL 2PO4A 1Q1BA 3V96A 2EJFC 5HGTA 1YITA 1BVSA 1U4PA 1VQ4A 3PIO3 2CW0C 3QR8A 3CXCA 3TBIB 1LABA 1V1OA 3MHBA 3E0EA 4CKBA 4A75A 3TZDA 2A1AA 5C4XB 1HR0W 3L3OC 3CP0A 2XWBB 1B7YB 3P20A 4QJFA 4JI2L 1SROA 3RZOH 4B3RL 1M8AA 1SNPA 3S16H 1W2BA 4JOIA 1VQCA 3ZYYX 3S17H 1H9KA 3SK4A 4Y7NB 3PUXA 4C56C 1N8RC 1S40A 3U4ZA 3H3VI 1ESRA 2EOTA 2OF1A 1ONLA 4DR3Q 4A76A 1BCPB 2EJMA 2PW5A 3TEHB 1JWSD 1EIHA 2VZAA 1PTOC 2F3IA 3M7NA 4ZLTF 4DXFA 1ENCA 1SNQA 4Q5VA 1AN8A 3OW7A 4BA2I 4AH6A 4RHRA 4M8AA 3BZCA 4JPBW 4JI4L 3NBHA 4JBJA 4DV1L 5KNCA 3S2DB 2B2UC 2IY5B 1TXYA 2HHHL 3DXJC 3NP8A 3I73A 3ULPA 1E0BA 1SMXA 4KV6A 1HZ9A 3PF4A 2VW9A 4X66Q 4JCVE 3CQZB 1PTOB 2Z6KA 1J5EL 3GTLB 1PV4A 3L0OA 3BDOA 4POGA 1WOCA 3SEBA 4X62Q 1H9RA 4JYAL 1Z47A 1SBBB 4J15A 3HFZB 2K05A 3BJUA 3ND8A 2ZTCA 1XTDA 3CC7A 3S1QH 1N9WA 1J6QA 1G2SA 3A7AB 1E1TA 1S3OA 1XX8A 2AKWB 1EQVA 4UAIA 4UP9A 2D2CC 1TWGH 4L8JA 1SJED 1BXTA 4RCNA 2D0PA 1NR4A 3H0GG 1Q81C 3F2BA 3BVGA 2HQEA 2WFWA 2CH4A 1HUMA 2ZT9C 2K5WA 2PNRC 1JOKA 4OXPA 2J0TD 4L63B 3HOXB 2PZWA 3NQIA 1YVCA 3DM1A 3SK5A 3K0XA 1QVCA 4KD4A 4WFN3 5EPJA 3MXGA 1AE3A 1N36Q 2AUJD 4PZ6A 3JAME 4G7HC 5IT9E 4IZ8A 3M4YA 2M00A 1WCMB 1WCMH 4ID6A 1Y1WG 1FNWA 1JCKB 5IY0A 3HP3A 4B3SL 1JB3A 1DCZA 3CCUA 2DUDA 2Y0SE 3W2DA 4GNXC 3TS0A 2E2IB 1EEFD 4OO1G 4BY7G 1SNMA 2ATWA 2I0QA 1NCVA 2HDMA 4HMIA 1QNUA 3TREA 4B3RQ 1HA5A 2AMCB 3CAMA 4F7XA 1CT1D 1EIYB 4IALA 2K50A 2NVQH 1HQRD 2RF4A 4B3TQ 1SYCA 3NQTA 2Q2IA 4PQXA 4IUUA 1UE7A 4DK6C 3J81E 1EYDA 4KHPQ 1O7LA 3SK8A 5ELBA 2R93H 3KUPA 4OONA 4X3KA 3I2ZA 2QKIC 4XXEA 5C3EH 3I7FA 2R92B 3M3YH 2L0CA 2RKSA 2HCCA 4JBWA 1K28A 1CKOA 4IURA 5KRUA 5C0XG 2JE6I 3I72A 1K9MC 2F0QA 2A69C 4JI1L 4BBRB 3A8KE 2IPKD 1K0RA 3HKZE 1SYEA 1F2YA 4A3IB 2L55A 3LX0A 2DNEA 3I4NB 4P71A 3URYA 5K5PA 5L37A 2I5MX 4X66L 1KNEA 3CC2A 3RMHA 2UXBQ 4IOCA 2RDFA 3MXUA 3GO5A 2D0OA 4JI6Q 4GNXB 4DK0A 1PZID 4N8FA 2GVBA 1EQRA 4HR7B 2KEDA 2N3SA 5ELEA 3GTOB 1ILQA 1IBLL 1D1KA 3MAQA 3J80i 5LHY1 2OCEA 3OPOA 1L1OC 1JC7A 4X64Q 4KTAA 3RLFA 4A3KB 5GAGC 2ZM6L 4A3JB 4DNIA 1LACA 4UDUC 2PPBC 3PUZA 1B3AA 2WIIB 5DM73 2B2YC 2WP8J 3T56B 1DD2A 1SMYC 4C3IH 1QVFA 4R4QA 4DR3L 4IPGA 1PYWD 1Y1WB 4GN4B 5EQ0A 1QILA 4HSPA 2K32A 1PH6A 1QE6A 1L0XB 1RHPA 1LTTD 4TRDA 4IFDJ 3SGIA 1SEBD 3HOZB 4BXXH 2EYLA 1D1IA 4B9WA 3GTMH 1NSNS 4KK7A 1KHIA 3FKIB 2XRQD 1JOOA 2KHJA 3BG3A 4K6DA 5E4XA 1YHAA 4A3CH 2EYFA 1E2WA 3PO3G 1U5KA 5HGQA 2AQ2B 3GTJB 4O2DA 1UE1A 1E2VA 3MXNA 5EPLA 3TS2A 4A3GH 4IFDI 4JOIC 3MFYA 5DNFA 5CBEE 3Q22A 3J80c 1EIFA 3J81c 2F0VA 3MFGA 1DOMA 2WAQB 2UUCQ 3PIOA 4NDXA 3H09A 1FJGL 2JXMB 2RA4A 5JOBA 4DK1A 4OL7A 4CKEA 3K7AH 4IUNA 3VR6A 2GA4B 2VUMH 1LYLA 4N8X1 1RD9D 2F0SA 3CCSA 4GLVB 3T51B 5JEAG 4HIMA 4EQNA 2WB1B 3R93A 1SLJA 4LK1C 3QB3A 3TZUA 5CBAE 5J39A 2NBFA 4GLAC 1RKNA 5KEEA 1ASYA 4IPDA 2HHHQ 4IFDH 2BA0A 5M3FH 4HEDA 1BKBA 3K80C 4F8MA 4BA1I 4G57A 1S5DD 1GUGA 5M3MG 1LT5D 1H9SB 5CORA 4APVA 3F2CA 4HJ8A 2D62A 2VNUD 1I4HA 4BY7B 1TWHH 2JA6G 5BR8L 1EY8A 2JA9A 4TSSA 1L2FA 4KY5A 4DR1Q 1IL8A 4LF8L 2NYZD 5M3FB 4JI6L 3C46A 4JV5Q 4DR2L 1CFMA 1ASZA 4LUVA 3TP8A 1WTQA 3BU2A 2E5LQ 2QDBA 1TU2B 3T1HQ 5D14A 2EYPA 1K3BC 1T9HA 1DOLA 4BY1B 5A2QL 2OWOA 4A3GB 2A6EC 3ERSX 3P1HA 1CSPA 4ODGA 4O42A 2C9OA 1UE6A 2DNCA 3M3YB 3GTGH 4F87A 4YWKA 1IZ6A 2IT1A 1XTCD 4B3TL 1LT4D 3HOUG 1VQFA 2R61A 1TY0A 3KF8A 3TN2A 1R9TB 2JA8H 4HIKA 4K8JA 2F0EA 4JI3L 3UE1A 1NAPA 1LT6D 2I5LX 1EU3A 2VQFQ 4GOPB 1CUKA 1UUPA 4DR6L 1XNRL 1XPOA 3J80L 3D0FA 1HTPA 4K0KQ 4HTHA 1I5FA 1STGA 3G4SA 3TP6A 5I6WA 5M9OA 4RGMA 2E2IH 1TVXA 1FL0A 4P74A 4FF4A 4R4IA 1PXUA 1MKHA 4FNFA 4B9XA 4JI1Q 1UNSA 1CTMA 2DN8A 1EY4A 1EFID 4FO2A 2FMMA 5IODA 3FDTA 1O7IA 3MEHA 4XYQA 1VMCA 4DR5Q 2I07B 3MC0B 1EYGA 3HOZH 3S1MH 4QF4A 1JJCB 1GM5A 1FD7D 2NZHA 1WFQA 2Z4HA 2F4IA 3CU7A 2EQSA 1XMQL 3T1YL 4BWGB 1LTGD 4K5VA 3GTKB 4A3DG 4DAYA 1JMCA 4GS3A 1PLFA 1AZPA 2A19A 4A3DH 4R8NA 1CQFA 3AYHB 1DONA 3T53B 5IGCA 1AZQA 1A8VA 4A3JH 4OIJA 5BN5A 5DM63 5T1IA 3HOWH 1EY0A 2JA6H 4NMZA 3BYYB 5I4DA 2KA7A 1MIUA 1S72A 1X65A 3DMUA 1STEA 3A0JA 5G3LD 1JR0D 5HY6A 1SE2A 1EOVA 1VQIA 4KHVA 2VUMB 1XWEA 5IP9G 5C0XJ 3AEVA 3KDFB 5IP9H 5JVH3 4ZYSA 5JEAH 1SRUA 5AJ3L 2F0FA 4GOPC 3NBHB 4JW0A 2EYMA 4OX9Q 1Y1VB 3I4MG 1BQQT 3E3XA 4IQZA 2F4VQ 2QW7A 1B53A 4LF6L 3J81j 1ZKOA 1GO3E 1YJWA 1G6PA 1YHBA 1PDQA 3D4RA 2R7ZG 5J1ZA 1Z6HA 3PO2H 5C44H 2K01A 4MN3A 3T1HL 3QOLA 4LF7Q 3UI2A 4CJ1B 4DV6Q 4JG2A 5EBDA 2KVMA 3PUVA 3OMCA 4HCEA 3R2TA 2A69D 2JEAI 2DJGC 1D2BA 2B2VC 1EFWA 3DLLA 4ME3A 1QUQA 1QWYA 1ZYRC 4LMQD 2K33A 2JYOA 2F03A 4CHTB 3RN5A 3FHWA 3QOJA 4BBSB 1VQDA 2VQFL 3MVVA 4PV1C 4N9TA 1YNXA 3TRZA 1PRTB 1EWHA 2F0HA 2B2WC 2A5HA 4DV7L 1SXTA 5C3WA 1NBWA 4LF9L 2MO1A 4R1JA 3WOFA 3QWNA 4RKLA 2R92G 3HOVB 3S1QB 1F9QA 4WRDA 2KUMA 2SOBA 1HZBA 5C4XH 3A55A 1N33L 3TMEA 5T1GA 5IYDG 2K5NA 4A3BH 2PNHA 4BY1H 4AYBB 4DR5L 3KBXA 3HRZC 4FXKC 4KY7A 2MHVA 4ABNA 2KCMA 3NELA 3S2HB 1D5ZC 2GN5A 3S2HH 4JV5L 4K5XA 4HJ7A 1Y8OB 1BOSA 5JJZA 2E5LL 1J9OA 2CVRA 2K28A 3SVMA 3OYYA 2UU9Q 1ZXTA 4HAEA 4YWMA 3ICEA 2Y0SG 1JICA 1SR3A 1U4LA 1VS0A 2R7FA 1S5FD 3B6YA 1AH9A 2F0PA 5FLMH 1I50H 1Q1EA 2AUKA 1HNXQ 4WORA 3ULJA 1W6JA 3PIPA 4ALPA 2PMZB 2GVAA 4RGOS 2ALYB 5BR8Q 3CCRA 2KCCA 3NPPA 1TWHB 3OTOQ 4L5TA 1K8OA 4X65L 1D5XC 2FHTA 3CKIB 1UEBA 1XMOQ 1OXVA 4C3IB 3BZDB 4KI0A 5C6AA 4A3BG 2IX3A 2VQEL 2NN6G 3F2DA 2UUCL 1SNOA 1AEXA 1FJGQ 2N49A 4LF4L 1HFNA 3VYRA 2BH8A 5CV4A 1FVIA 3UDGA 5IIFA 4A3CG 4IO9A 3VYSA 1TY2A 4EQPA 3Q23A 1EY7A 3MZ5A 4C3HG 1PH7A 2B29A 3H15A 4XIGS 2N8NA 1G291 3KBGA 2R92H 2FXQA 1YNJD 1Q46A 2NTSA 3W5OA 1QG7A 3IKJA 2JN4A 1I4QA 4DXGA 1Q86C 1VQKA 4JI4Q 2Q8TA 4MTKA 3UE0A 2ZTDA 1CKNA 3GTQH 3S14B 5CV6A 3DEOA 4GLXA 5C4JH 1EY9A 2DJFC 2PI2A 3JAML 2ZXOA 4FDBA 4H13C 3ULLA 1D5MC 4UHVA 2J4XA 4DV0Q 3H6MA 1KLUD 2PI2E 3K5NA 4PMBA 1ET6A 1E3PA 2XN9C 2K6AA 2EE1A 2HIXA 2JA7B 4IUTA 3AQQA 2TSSA 3FKIG 4IN3A 3T1YQ 2EIFA 2K04A 4FP5D 4TKOB 1FGBD 1VQ5A 4DNTB 4L5RC 4CDDC 4JI8L 3BDLA 2N78A 3G6JB 3EROA 4P72A 4OO1H 4CJ2C 3S15H 1S5BD 1WJJA 1X3PA 4YHHL 1I4XA 3H0GH 4OEMB 1B3QA 1I4GA 1YNND 2AQ3B 2ENBA 4J1MA 5CV8A 2F0JA 3CPFA 1YJNA 1OXXK 4DV4L 1XXGA 3HS0C 4YY3Q 5C0XH 1HHVA 4BY1G 2CH4W 2NN6H 3VDYA 3IFTA 2MQHA 2LXJA 4GKJQ 1K8MA 1MSHA 3KF6B 1A2UA 2K5VA 1F2LA 4FXDA 2L1BA 1WTHA 1HQMC 2QEJC 5I2YA 2K1BA 1IBKQ 2RCFA 1GOZA 5ELOA 2OQ0A 3H94A 1N36L 1TR5A 1VMPA 1O7ZA 1RL2A 3O13A 3K7AB 3BS1A 5C4ZA 4UP7A 3S1RH 2A6HC 2VB2X 2NVTB 1STYA 1J5EQ 2NVXH 2QDLA 4DV5Q 2R7ZH 3M85A 3Q24A 1X3FA 1CQVA 2I5HA 1QCBD 2L11A 1Y1WH 3GDEA 1H9JA 5I9PA 3EFXD 4ME5A 4DFAA 2A68D 1U9RA 1B8AA 2PW7A 1WTWA 4RWSC 5M3MB 5K36H 2KENA 1ICWA 4NXMQ 4JC0A 2N88A 3NSWA 2IW3A 1F9PA 1ENAA 1J8IA 2HIVA 2XSCA 5I2XA 4A3EG 2ES2A 3D4DA 3EN2A 1YEZA 2LMCB 1VQ6A 1HNWQ 2QCPX 5M5WB 1V43A 2O5IC 1PFSA 3LGJA 3L9AX 4ZCKA 3P75A 5M5YH 1N34L 4KN7C 5KNBA 1D6EC 1CHPD 1EUJA 2NZOA 2JA7H 4R4TA 1JJGA 4YCWA 4IOAA 2K52A 4LUOA 1VQHA 2C5CA 3U9OA 4X62L 3TP5A 5DAUA 1UE5A 4XYOA 4HCSA 2EJGC 4XQQA 3WOEA 3HOUB 4U68A 2F52A 1PH3A 2YU9H 1W3SA 1U0LA 1XMOL 5AFWA 3D4WA 2EPBA 3SHLA 3Q8DA 3A8IE 1GHJA 4POFA 2OXPA 3E6ZX 2YTYA 2K5DA 3N52A 1B9MA 1HPCA 5ELCA 4A3MG 1EU4A 4ZRZA 3PSIA 3K81C 3HOXG 3S16B 2UXDL 4K8IA 2ZM6Q 2K5HA 1VQ8A 2QEXA 5M3MH 1V1PB 3QG1A 3SXHA 2V4DA 3DM3A 2E74C 5IGBA 2RSOA 1IKMA 5A2QE 3CPWA 1BO0A 5FLMG 1N32L 4PMCA 4KHPL 2KHIA 1OXUA 3M9BA 3PUWA 2G9DA 3ND9A 3EQLC 5LMUL 3I90A 2WKCA 3DHQA 1V1PA 3EBEA 1F2ZA 3P7JA 1E1OA 3QO2A 5FO7B 1A15A 3VR5A 1LTBD 3IL8A 1XPUA 2C35B 1I4PA 2NUCA 1KAWA 1X54A 4RH6A 1NMGA 2Z1CA 1ESFA 4DPGA 3GTLH 5GROA 4H7BA 2F0DA 3S9WA 1B70B 3KOJA 1HR0L 1BDOA 1GD7A 5E3FA 2CQAA 4GN5A 1PH4A 4LF4Q 4LWCA 4R8IA 1TWFH 3EA6A 3K5OA 3I70A 4ZUIA 5CV5A 1MBYA 2IHFA 1X56A 4KKUA 1Q8IA 3FPUB 2ZTEA 4UP8A 4HJAA 4NXNQ 4Y7NH 3HG9A 3IFDA 1PZJD 2Q8RE 3PGZA 4A3MH 2XGTA 1NY4A 2EYHA 5E7NA 5C3EG 3CMEA 3F2UA 2A6ED 1PTOF 3NBIA 5LMNL 4XQJA 3VA7A 1TWAH 5C4XG 3VA5A 2QF7A 2DY8A 2CW0D 2CCZA 1KL9A 2NVTH 3GTQB 3S14H 2OTJA 1EZ6A 1KDBA 2F0IA 3R2IA 4CJ0B 4YHHQ 3V05A 1TWCH 3DWQA 5G3LF 2E8GA 3J81i 1HNWL 3D31A 4UPAA 2ZJRA 3CRLC 3I4NG 1B50A 1IHZA 2N55A 3ERQA 1KQSA 3K0YA 3CF5A 3HOYH 5EPKA 4TVAB 4JI5L 2KECA 5IE8A 1O78A 1LV9A 5C44G 4DAVA 2PZTA 4DV3Q 1YZ6A 2PYKA 2WAQE 3CCQA 3S2DH 1ZYRD 4EGVA 2F0NA 1VDZA 1IXRA 3D6WA 4DR1L 4C3JG 5K36G 3TQYA 1OO9B 2ASBA 1X3QA 2LKVA 5E1FA 4DA2A 3MXNB 4QB4A 1LUZA 1E2ZA 4LJZC 5KYIA 1LTAD 4ZAIA 1KC8C 1TT2A 1VQOA 1G91A 4G7OC 3ITPA 1Y14B 4YWLA 5GQOA 4DR7Q 1W6KA 1PA6A 3IRBA 2Z8LA 4GZYC 4IPHA 3HOWG 3GQBA 4N9PA 1HNZL 2NTTA 1YI2A 4ZQ3A 2PCFB 4JI7L 1LM0A 2ZXRA 1Q8KA 3G48A 3VYTA 4OWWB 4QIWB 4FXGC 1KABA 1A2TA 4BBRG 1IBKL 1MHWC 1ML0D 3D3RA 4CDFC 1X3EA 4DR4Q 4YIJA 5M5WH 1EZ8A 2O2LD 2E75C 4PMWA 5HURA 1Y1VH 2AQ1B 3HOYB 3EVQA 1N34Q 2B63H 2F0GA 1IL2A 3SR1A 1PZKD 5BN3A 4DV5L 1C0AA 3DUZA 1DGSA 1GUOA 5IYDH 2A73B 1WTVA 3KK7A 2MNAA 1XNQL 2EY1A 1VQNA 3STBC 4M1UB 4IPCA 2QA4A 3BVMA 5EKKA 3Q0AA 1NR2A 1GXDC 2VB3X 4QUFA 3KFUA 4NXNL 1SSOA 2LFNA 3QIAA 4DU9A 2F0TA 1X55A 2OT2A 1VQ7A 4RGNA 3I4LA 3RZDH 2WACA 4YCVA 4XQNA 1QVGA 1BR9A 4DNRB 4IUQA 4ULLA 4A3LG 4DUYL 4A3EH 3MEFA 2MO0A 1E22A 4Y52H 4RCOA 4ZUJA 5GAEC 2CHBD 3KDFA 2MFIA 4X3TA 3UDFA 1V9PA 1IBMQ 5M5YB 2EY5A 4LW1A 1TIID 2PMZE 1EWCA 4A3LH 1TWFB 1VCIA 5NUCA 1GUSA 1EWIA 2NZ1D 1CKMA 2K14A 2K75A 5LMNW 3L7ZC 4GKKQ 3BYTB 1TWAB 3S24A 1II3A 2OQKA 2B63G 2BCOA 1S5CD 2WV6D 1CSQA 3HOVH 2XTIA 1HRJA 3N6RA 4OELB 3CC4A 3I4MH 4C3HH 3H0GB 4DR2Q 1EYCA 1VQEA 1HR0Q 4DGZA 3S15B 2UUBQ 1OXTA 2YTVA 3R8BA 2RHSB 5GADC 2KEEA 4PZ7A 4LFAQ 4DUZQ 1GVPA 1I94L 1A6XA 4OGQC 3DEPA 3RUZA 2ZJQA 2JP1A 5CGKA 1P16A 2QGQA 2RDHA 3MA2B 1CI3M 3MWYW 2MUYA 3RZDB 1YNJC 3PUYA 5DLQE 2EYJA 5EBCA 2B2YA 5LMNQ 5C4JB 3CHBD 1ICFB 4R9WA 4LNQA 1JT8A 1BBXC 4RAUC 1AP0A 3U9SA 3ONAB 5FO9B 2B2UA 4I7AA 4PZ8A 4XT3B 5J22A 1IYJB 2WKDA 4LAAA 2IHEA 1MSGA 1PMRA 1NNXA 2B3GA 4BBSH 1O80A 1JWMD 2JJQA 2Q2HA 3LNNA 4KD3A 2B63B 1DOKA 4FVMA 4JI5Q 2F0UA 2JSOA 2K7VA 2IX1A 3KJOA 4KMUC 1SJHD 2L5TA 3NWTA 2EZVA 1M90C 2NVYH 4QY7A 3U50C 2CFMA 2AHOB 1A3VA 2Q2UA 4MIUA 1WTXA 3H91A 4C2MH 2E76C 4ZKCB 3HOUH 2H5XA 2KHSA 5CYUA 5CC4A 4P75A 3NK9A 3D6CA 3A5UA 2JA5G 2VL6A 5FO8B 1JWUD 4HMJA 3AMUA 1WI5A 5IT9c 3CW2C 1QUQB 2K5QA 4DV6L 3VR2A 3E9HA 1MJEA 3E9IA 2QILA 4ZK9B 1G51A 3ZJYC 1SDFA 3UDIA 1PH1A 1TWGB 4A93H 4QL5A 2Q8IB 5C5MA 3S1RB 2SEBD 3RLOA 4A93G 1R9TH 2MPMA 2JA8B 4LF5L 4GNXA 5EAYA 5IYCG 1NJIC 4DV2Q 3V2TA 1YJ9A 4K5WA 1V1QA 3NENA 4YCUA 1SN8A 1WD0A 4O0AA 5CV7A 1IYUA 5JJIA 2A6HD 1STHA 1T5XD 3X3MA 1FGUA 1RODA 1WD1A 1PFBA 1H95A 1ENFA 3NTKA 2VY3A 1E24A 4IUPA 1SYDA 4AQYQ
chains in the Genus database with same CATH topology
1BF4A 2KOLA 2A68C 1A3TA 1LLRD 2NWGA 2X6GA 5KNDA 3M7GA 1RTNA 5JPNC 1PRTD 2HDLA 3R3OA 5FKAC 2NB0A 5IOCA 2KJXA 4J8QA 4HN7A 3GD7A 1JQYD 1Q3LA 1DXMA 2K03A 4C3HB 2F3VA 2MGSA 3OIPA 2IL8A 2JEBI 4C2MB 4FF1A 1I6HB 5ELFA 1SYGA 2XRSD 1B2TA 1PRTF 4WJWA 1HA6A 1GUNA 2XVSA 4K2LA 1A3UA 1B4OA 2D9UA 5IGEA 1MGSA 3OWEB 3S17B 1Z7TA 4RA8A 1MD2D 2O5JC 1JORA 2BE5D 1YNNC 1GJXA 1EY6A 4IUVA 1GUWA 1U4RA 3A7LA 1G2TA 3WDNA 4EQOA 4EVOA 1IYVA 5JAVA 1HCZA 2NVXB 3NUCA 2JA6B 2ICEC 4I65A 1GUTA 5CR3A 3PMFA 1TKWB 4A3BB 3J7YW 4L6TB 3SK6A 2BOSA 2FFKB 2SNMA 3I3CA 5ELDA 4K14A 3HOWB 4X3SA 1C4QA 1TS4A 1EEID 1VF7A 1CZGA 2HCIA 2XIWA 3C1EA 1BUVT 1TQOA 1CZWA 2XWJB 4S3SA 4E6IA 4Z9CB 2Z4IA 2JA5B 5IGFA 1STAA 1IKLA 3DWPA 1LO5D 1UEAB 3NE5B 2F0LA 1PTOD 4NP5A 1SFOB 2FJ2A 4G4KA 1L0YB 3PO2B 1SNCA 1EYAA 1K83B 5KGUA 5D65A 3BDCA 2J7ZA 3D8GA 3FEWX 5D3IB 1QOHA 2NVYB 2NN6I 2AWOA 2R7ZB 2FMCA 1FNVA 3FPPA 4XT1B 5EKIA 3RD4A 3GTMB 3OMGA 1RCVD 1BCPC 4JK1C 2E2JB 4RFBA 2B8GA 3EJIA 2F0OA 2X6LA 2F0WA 1LTRD 3A54A 4F88A 2WINB 1XYIA 4OIKA 4U673 3G7LA 2PQEA 1WTOA 3C3LA 3S1MB 3BVZA 5IT9L 5FLXE 4QUCA 2VXWA 3NXWA 4A3FB 2MP1A 1RDPD 4CGYB 3GV3A 4B08A 3QJYA 4ILWA 3SE0A 4FYDA 1OXSC 1PFMA 1S5ED 2FINB 1LTID 1CK1A 4A93B 3AB9A 3TP7A 2H4OA 1BCPF 2O4XA 1IW7D 5FK9C 1R4QB 1FNUA 3J7AV 5FOBB 2RSNA 5CMDA 2EYOA 1HUNA 3J81L 2OEOA 4V0BA 5JPMC 5M5XB 3OIQA 1C8CA 1SYFA 4C1NK 2EXZA 5E4WC 1DYQA 5BN4A 1CHQD 3DWAA 1WVLA 1ET9A 2R93B 3FMCA 4P2CB 3KLSX 4C3JB 1FR3A 3FRPB 2PZUA 1SE3A 4MHEA 4KKSA 2L9HA 2RBMA 2B39A 5IGGA 1Q12A 3GTPB 2SNSA 2IJ0A 1I4RA 3X3NA 5CV9A 1ILPA 4G7ZC 1RTOA 1Y8PB 1EOTA 1B9NA 4C3IG 5F2DA 2F1MA 1VF5C 2LY7A 1F9RA 4ZKBB 1MI2A 3NTHA 3K5LA 5EJWA 5EGTA 5I6YA 1GHKA 2ICIA 1WTPA 3VR3A 3PV0A 2DY7A 1KDAA 3M4OB 3S1NB 2F3WA 2Y0SB 2B2TA 4KJNA 1UAPA 4FF2A 4IFDG 2R3ZA 2F0KA 5DEHA 3RZOB 1DJRD 4KN4C 3C1FA 2EDGA 3GTGB 1STNA 1IW7C 1C48A 3J7AF 3J80E 3T16A 1HXYD 5I9OA 2H1EA 1Y8NB 4RKBA 3VR4A 3AU7A 4X3UA 1KDCA 3HGBA 3K58A 5C5LA 4A3DB 2E2HB 5KIXA 2B2WA 2BA1A 1RJTA 2BDOA 1PTOH 2RVLA 1I6VC 3K57A 1B1ZA 1EIGA 1U4MA 1B44D 2E2DC 3PO3B 5D3DA 1I3QB 3OSOA 2F0MA 5C3EB 5JEAJ 2L4NA 3C2PA 4RHSA 5IGDA 2IX0A 5C0XI 1H9MA 1TS2A 1F77A 2A74C 2HUGA 1R4PB 4KKTA 5KYLA 1FYCA 4RGTA 1TWCB 2EY2A 1M4VA 3LWUA 5C4HA 4H44C 1STBA 2IWHA 3I8ZA 1LTSD 1O7YA 4KY6A 3T13A 3SDZA 4QCLA 2M9VA 1LT3D 1EQTA 2D5DA 3FVQA 4PNYA 5C44B 2I46A 3GV6A 3OHXC 3I91A 5ISRA 3TSSA 1NUCA 1AW7A 3NHHA 4KHZA 2M2LA 1PRTC 2BE5C 4I7ZC 4KJOA 2ZXPA 1EY5A 1HFGA 4A3EB 1SYBA 4HSVA 1KNAA 1X32A 3KLRA 4H0LC 1KLGD 2L12A 3LWEA 5C3XA 2EVBA 1SMYD 1QJOA 4K6LA 4DAPA 4NW2A 3K59A 1DZ1A 1PFNA 3KLSA 4C1NI 1CA6A 2XNAC 1CM9A 1TS3A 3K6OA 1ZEQX 3E0JA 2B2TC 1G8ZD 4FF3A 1T5EA 2YYZA 4CKCA 3Q6SA 2LS01 1JOQA 1V8QA 2MJ8A 5LL6S 2YU9B 3IAYA 3I4MB 2BDNA 4O1NA 3TDQA 4QMGA 3OOCA 2RDGA 3A8JE 5LL6X 5EKLA 1SE4A 1Y69U 2SDFA 1CA5A 3MXPA 2G9HD 3VYUA 1QB5D 1RF2D 5JVG3 3MTSA 3PIP3 1G6ZA 1F2MA 1HTLD 3NWSA 1H9SA 3W3AA 1WTRA 4BS9A 3HKZB 2RQXA 4DF7A 1SNDA 1QNKA 3H3VC 4K2KA 5COYA 1DM0B 1S4ZA 1KTKA 4J6HA 3A56A 4DN4M 4Q0FA 4CBVA 1F9SA 1TS5A 4A3MB 3HEJA 2EY6A 3E5SA 2NVQB 3K5MA 2B2VA 1JE4A 3NTIA 1BNZA 1EL0A 5FLXL 2B8FA 3T4AC 2R6GA 2KCNA 4OHJA 1SAPA 1I50B 1BCPD 1KAAA 5A35A 1AFPA 3GP7A 2AWNA 4V190 2ID0A 4TQUS 3OWFA 4XTCS 2X69A 2TMPA 4OO1I 3HZXA 4XDXA 1Q90A 3CRKC 4NKLA 5TSSA 2KQ3A 2PO4A 1Q1BA 3V96A 2EJFC 5HGTA 1U4PA 3PIO3 2CW0C 3TBIB 1LABA 1V1OA 3MHBA 4CKBA 3TZDA 5C4XB 3L3OC 2XWBB 3P20A 1M8AA 1SNPA 3ZYYX 1H9KA 3SK4A 4Y7NB 3PUXA 4C56C 1ESRA 2EOTA 2OF1A 1ONLA 1BCPB 2EJMA 2PW5A 1JWSD 1EIHA 1PTOC 3M7NA 4ZLTF 4DXFA 1ENCA 1SNQA 4Q5VA 1AN8A 3OW7A 4BA2I 4RHRA 4M8AA 3NBHA 5KNCA 3S2DB 2B2UC 3DXJC 3NP8A 3I73A 1E0BA 4KV6A 3CQZB 1PTOB 3GTLB 3BDOA 3SEBA 1H9RA 1Z47A 1SBBB 2K05A 3ND8A 1G2SA 3A7AB 1XX8A 1EQVA 4UAIA 2D2CC 4L8JA 1SJED 1BXTA 4RCNA 1NR4A 3BVGA 2HQEA 1HUMA 2ZT9C 2K5WA 2PNRC 1JOKA 2J0TD 4L63B 3HOXB 2PZWA 3NQIA 3DM1A 3SK5A 4KD4A 4WFN3 5EPJA 3MXGA 2AUJD 3JAME 4G7HC 5IT9E 4IZ8A 3M4YA 2M00A 1WCMB 4ID6A 1FNWA 1JCKB 3HP3A 1JB3A 1DCZA 3W2DA 2E2IB 1EEFD 4OO1G 1SNMA 1NCVA 2HDMA 4HMIA 1QNUA 1HA5A 4F7XA 1CT1D 4IALA 1HQRD 1SYCA 3NQTA 4PQXA 4IUUA 3J81E 1EYDA 1O7LA 3SK8A 5ELBA 3KUPA 4X3KA 2QKIC 4XXEA 2R92B 2L0CA 2RKSA 2HCCA 4JBWA 4IURA 5KRUA 5C0XG 2JE6I 3I72A 2F0QA 2A69C 4BBRB 3A8KE 2IPKD 1SYEA 1F2YA 4A3IB 2L55A 3LX0A 2DNEA 3I4NB 3URYA 5K5PA 1KNEA 3RMHA 2RDFA 3MXUA 3GO5A 4DK0A 1PZID 4HR7B 2KEDA 5ELEA 3GTOB 1ILQA 1D1KA 3MAQA 5LHY1 3OPOA 1JC7A 4KTAA 3RLFA 4A3KB 4A3JB 1LACA 4UDUC 2PPBC 3PUZA 1B3AA 2WIIB 5DM73 2B2YC 2WP8J 3T56B 1DD2A 1SMYC 1PYWD 1Y1WB 5EQ0A 1QILA 4HSPA 2K32A 1QE6A 1L0XB 1RHPA 1LTTD 4TRDA 4IFDJ 1SEBD 3HOZB 2EYLA 1D1IA 4B9WA 1NSNS 4KK7A 3FKIB 2XRQD 1JOOA 3BG3A 4K6DA 5E4XA 2EYFA 1E2WA 2AQ2B 3GTJB 1E2VA 3MXNA 5EPLA 4IFDI 3MFYA 5DNFA 5CBEE 3Q22A 2F0VA 3MFGA 1DOMA 2WAQB 4NDXA 3H09A 2JXMB 2RA4A 5JOBA 4DK1A 4OL7A 4CKEA 4IUNA 3VR6A 2GA4B 1RD9D 2F0SA 3T51B 5JEAG 4EQNA 2WB1B 3R93A 4LK1C 3QB3A 3TZUA 5CBAE 5J39A 2NBFA 1RKNA 5KEEA 4IFDH 2BA0A 4HEDA 4F8MA 4BA1I 4G57A 1S5DD 1GUGA 1LT5D 1H9SB 5CORA 2VNUD 4BY7B 2D62A 1I4HA 1EY8A 4TSSA 4KY5A 1IL8A 2NYZD 5M3FB 3C46A 1CFMA 3TP8A 1WTQA 2QDBA 1TU2B 5D14A 2EYPA 1DOLA 4BY1B 5A2QL 4A3GB 2A6EC 3P1HA 4ODGA 4O42A 2C9OA 2DNCA 3M3YB 4F87A 2IT1A 1XTCD 1LT4D 2R61A 1TY0A 3KF8A 3TN2A 1R9TB 4K8JA 2F0EA 1NAPA 1LT6D 1EU3A 1UUPA 3J80L 1HTPA 4HTHA 1STGA 3TP6A 5I6WA 5M9OA 4RGMA 1TVXA 4FF4A 1PXUA 4FNFA 4B9XA 1UNSA 1CTMA 2DN8A 1EY4A 1EFID 5IODA 2FMMA 4FO2A 3FDTA 3MEHA 4XYQA 1VMCA 2I07B 3MC0B 4QF4A 1FD7D 2Z4HA 2F4IA 3CU7A 4BWGB 1LTGD 4K5VA 3GTKB 4DAYA 1PLFA 1AZPA 4R8NA 1CQFA 1DONA 3T53B 5IGCA 1AZQA 4OIJA 5BN5A 5DM63 5T1IA 1EY0A 4NMZA 3BYYB 5I4DA 2KA7A 3DMUA 1STEA 5G3LD 1JR0D 1SE2A 4KHVA 2VUMB 1XWEA 5C0XJ 5JVH3 4ZYSA 5JEAH 2F0FA 2EYMA 1Y1VB 1BQQT 4IQZA 1B53A 1ZKOA 1PDQA 3D4RA 5J1ZA 1Z6HA 2K01A 4MN3A 3QOLA 3UI2A 4CJ1B 5EBDA 2KVMA 3PUVA 3OMCA 4HCEA 3R2TA 2A69D 2JEAI 1D2BA 2B2VC 1QWYA 1ZYRC 4LMQD 2K33A 2JYOA 2F03A 4CHTB 3QOJA 4BBSB 3MVVA 4PV1C 4N9TA 1PRTB 1EWHA 2F0HA 2B2WC 2A5HA 1SXTA 5C3WA 3WOFA 3QWNA 4RKLA 3HOVB 3S1QB 1F9QA 4WRDA 2KUMA 2SOBA 3A55A 3TMEA 5T1GA 4AYBB 3KBXA 3HRZC 4FXKC 4KY7A 2MHVA 4ABNA 3S2HB 1D5ZC 4K5XA 1Y8OB 1BOSA 5JJZA 1J9OA 2CVRA 2K28A 3SVMA 1ZXTA 4HAEA 1JICA 1U4LA 1S5FD 2F0PA 1Q1EA 2AUKA 4WORA 1W6JA 2PMZB 4RGOS 2KCCA 3NPPA 1TWHB 1K8OA 1D5XC 2FHTA 3CKIB 1OXVA 4C3IB 3BZDB 4KI0A 5C6AA 2IX3A 2NN6G 1SNOA 1AEXA 1HFNA 3VYRA 5CV4A 5IIFA 3VYSA 1TY2A 4EQPA 3Q23A 1EY7A 3MZ5A 4C3HG 4XIGS 1G291 3KBGA 1YNJD 2NTSA 1QG7A 3IKJA 1I4QA 4DXGA 2Q8TA 3S14B 5CV6A 3DEOA 1EY9A 3JAML 2ZXOA 4H13C 1D5MC 2J4XA 1KLUD 3H6MA 3K5NA 4PMBA 1ET6A 2XN9C 2K6AA 2EE1A 2JA7B 4IUTA 2TSSA 4IN3A 2K04A 4FP5D 4TKOB 1FGBD 4DNTB 3BDLA 3G6JB 3EROA 4OO1H 4CJ2C 1S5BD 1X3PA 1I4XA 1I4GA 1YNND 2AQ3B 2ENBA 4J1MA 5CV8A 2F0JA 1OXXK 1XXGA 3HS0C 5C0XH 1HHVA 2NN6H 3IFTA 1K8MA 1MSHA 1A2UA 1F2LA 4FXDA 2L1BA 2QEJC 1HQMC 5I2YA 2K1BA 1GOZA 3H94A 1TR5A 1VMPA 1O7ZA 3O13A 3BS1A 3K7AB 5C4ZA 2A6HC 2VB2X 2NVTB 1STYA 3M85A 3Q24A 1CQVA 2L11A 1QCBD 1H9JA 5I9PA 3EFXD 4ME5A 4DFAA 2A68D 1U9RA 2PW7A 1WTWA 4RWSC 5M3MB 5K36H 1ICWA 2N88A 3NSWA 2IW3A 1F9PA 1ENAA 1J8IA 2XSCA 5I2XA 3D4DA 2LMCB 2QCPX 5M5WB 1V43A 2O5IC 3L9AX 3P75A 4KN7C 5KNBA 1D6EC 1CHPD 2C5CA 3U9OA 3TP5A 5DAUA 4XYOA 4HCSA 2EJGC 4XQQA 3WOEA 3HOUB 4U68A 5AFWA 3D4WA 2EPBA 3SHLA 3A8IE 1GHJA 2OXPA 3E6ZX 2K5DA 3N52A 1B9MA 1HPCA 5ELCA 1EU4A 4ZRZA 3S16B 4K8IA 1V1PB 3QG1A 3SXHA 2V4DA 2E74C 5IGBA 2RSOA 1IKMA 5A2QE 1BO0A 4PMCA 1OXUA 3PUWA 2G9DA 3EQLC 3ND9A 3I90A 2WKCA 3DHQA 1V1PA 1F2ZA 3P7JA 3QO2A 5FO7B 1A15A 3VR5A 1LTBD 3IL8A 1I4PA 2NUCA 4RH6A 2Z1CA 1ESFA 4H7BA 2F0DA 3S9WA 1BDOA 5E3FA 2CQAA 4R8IA 3EA6A 3K5OA 3I70A 4ZUIA 5CV5A 1MBYA 4KKUA 1Q8IA 3FPUB 3HG9A 3IFDA 1PZJD 2Q8RE 2EYHA 3F2UA 2A6ED 1PTOF 3NBIA 4XQJA 3VA7A 3VA5A 2QF7A 2DY8A 2CW0D 3GTQB 1EZ6A 1KDBA 2F0IA 3R2IA 4CJ0B 3V05A 5G3LF 3DWQA 3D31A 3CRLC 1B50A 1IHZA 2N55A 3ERQA 3K0YA 5EPKA 2KECA 1O78A 1LV9A 4DAVA 2PZTA 2PYKA 1ZYRD 4EGVA 2F0NA 1VDZA 3D6WA 4C3JG 5K36G 1OO9B 1X3QA 2LKVA 5E1FA 4DA2A 4QB4A 4LJZC 1E2ZA 5KYIA 1LTAD 4ZAIA 1TT2A 1G91A 4G7OC 3ITPA 1W6KA 2Z8LA 4GZYC 3GQBA 4N9PA 2NTTA 4ZQ3A 2PCFB 2ZXRA 3VYTA 4QIWB 4FXGC 1KABA 1A2TA 1ML0D 3D3RA 4YIJA 1EZ8A 2O2LD 2E75C 4PMWA 5HURA 2AQ1B 3HOYB 3EVQA 2F0GA 3SR1A 1PZKD 5BN3A 3DUZA 1GUOA 2A73B 1WTVA 3KK7A 2EY1A 4M1UB 3BVMA 5EKKA 3Q0AA 1NR2A 1GXDC 2VB3X 4QUFA 1SSOA 2LFNA 3QIAA 4DU9A 2F0TA 2OT2A 4RGNA 3I4LA 2WACA 4XQNA 1BR9A 4DNRB 4IUQA 4ULLA 4RCOA 4ZUJA 2CHBD 4X3TA 5M5YB 2EY5A 1TIID 1EWCA 1TWFB 1VCIA 5NUCA 1GUSA 2NZ1D 3L7ZC 3BYTB 1TWAB 1II3A 2BCOA 1S5CD 2WV6D 1HRJA 3N6RA 3H0GB 1EYCA 4DGZA 3S15B 1OXTA 3R8BA 2KEEA 1A6XA 4OGQC 3DEPA 3RUZA 2JP1A 5CGKA 2RDHA 3MA2B 1CI3M 3MWYW 2MUYA 3RZDB 1YNJC 3PUYA 2EYJA 5EBCA 2B2YA 5C4JB 3CHBD 4R9WA 1BBXC 4RAUC 1AP0A 3U9SA 3ONAB 5FO9B 2B2UA 4XT3B 5J22A 2WKDA 4LAAA 1MSGA 1PMRA 1O80A 1JWMD 3LNNA 2B63B 4KD3A 1DOKA 4FVMA 2F0UA 2JSOA 2K7VA 2IX1A 4KMUC 1SJHD 2L5TA 3NWTA 2EZVA 1A3VA 4MIUA 1WTXA 3H91A 4ZKCB 2E76C 2KHSA 5CYUA 5CC4A 3NK9A 3D6CA 5FO8B 1JWUD 4HMJA 3AMUA 2K5QA 3VR2A 2QILA 4ZK9B 1SDFA 1TWGB 2Q8IB 5C5MA 3S1RB 2SEBD 2JA8B 2MPMA 3V2TA 4K5WA 1WD0A 5CV7A 1IYUA 2A6HD 1STHA 1T5XD 3X3MA 1RODA 1WD1A 1PFBA 1ENFA 3NTKA 4IUPA 1SYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RGM A;  1KLG D;  5FK9 C;  2RDH A;  1HXY D;  1CQV A;  1TS4 A;  1LLR D;  1EEI D;  1FNU A;  5ELB A;  1UNS A;  3EFX D;  3EA6 A;  4K6L A;  1EFI D;  1PRT B;  1RD9 D;  2NTS A;  4Z9C B;  2O2L D;  1PRT D;  3CHB D;  3MC0 B;  1SXT A;  2AQ1 B;  1PTO H;  1I4Q A;  1PTO B;  4DXG A;  1PZK D;  1PZJ D;  5FKA C;  1FD7 D;  4OHJ A;  1B1Z A;  1DYQ A;  2XNA C;  3DWP A;  1TS3 A;  1CHQ D;  1LO5 D;  1B44 D;  1JQY D;  3SEB A;  3DWA A;  1BCP D;  1PTO F;  2IPK D;  4BWG B;  1ET9 A;  1LTG D;  1G8Z D;  3BVM A;  3KLS X;  1PTO D;  5D3D A;  1JWM D;  3URY A;  3GP7 A;  1L0Y B;  1SBB B;  1D5M C;  1SE3 A;  4RHS A;  2J4X A;  1KLU D;  1S5D D;  1D5Z C;  1TS2 A;  1D6E C;  1ET6 A;  1CHP D;  1F77 A;  1PZI D;  5ELF A;  2XN9 C;  2XRS D;  3BYY B;  1SJH D;  3R2I A;  5I4D A;  1PRT F;  3V05 A;  4O1N A;  4RGN A;  2TSS A;  5ELE A;  1LT5 D;  4RGT A;  5D3I B;  3DWQ A;  1I4H A;  2IJ0 A;  1I4R A;  1M4V A;  1STE A;  2RDG A;  5TSS A;  1SE4 A;  3OWE B;  1JR0 D;  1FGB D;  1FNV A;  4RCO A;  1SJE D;  4TSS A;  1SE2 A;  1BXT A;  2CHB D;  1LTS D;  1MD2 D;  3BVG A;  4UDU C;  1S5F D;  1V1O A;  1RCV D;  1BCP C;  2G9H D;  1EWC A;  1S5B D;  4L63 B;  1I4X A;  4ZYS A;  4RFB A;  1JWU D;  1I4G A;  2AQ3 B;  1RF2 D;  1LT3 D;  1PYW D;  5ELC A;  4RGO S;  1EU4 A;  1QIL A;  1LTR D;  3BYT B;  1L0X B;  2QIL A;  1HTL D;  1LTT D;  1D5X C;  1S5C D;  1XXG A;  2ICI A;  2WV6 D;  3TSS A;  1SEB D;  1AW7 A;  1XTC D;  1LT4 D;  1V1P B;  1FNW A;  2SEB D;  4C56 C;  2R61 A;  1TY0 A;  3BVZ A;  1JCK B;  3BZD B;  1PRT C;  1LTA D;  2XRQ D;  3W2D A;  2QEJ C;  1BCP B;  1RDP D;  1EEF D;  1JWS D;  1LT6 D;  3R8B A;  1PTO C;  1EU3 A;  2AQ2 B;  1GOZ A;  1V1P A;  1S5E D;  1HA5 A;  1CT1 D;  1LTI D;  1UUP A;  1LTB D;  2Z8L A;  1CK1 A;  4L6T B;  1KTK A;  3O13 A;  1DJR D;  3R2T A;  1I4P A;  1T5X D;  4RH6 A;  4DXF A;  1HQR D;  1ENF A;  2NTT A;  1ESF A;  5ELD A;  1AN8 A;  1TS5 A;  1BCP F;  1TY2 A;  4RHR A;  3MFG A; 
#chains in the Genus database with same CATH topology
 1KRS A;  1BF4 A;  2KOL A;  1Z9F A;  2A68 C;  1A3T A;  1LLR D;  2NWG A;  2X6G A;  3GTK H;  1D8L A;  5KND A;  3M7G A;  3A74 A;  5IWA L;  1NE3 A;  1RTN A;  2KBN A;  1C9O A;  5JPN C;  1PRT D;  1MJC A;  2HDL A;  3R3O A;  5FKA C;  4P73 A;  2NB0 A;  5IOC A;  3F8T A;  2KJX A;  4J8Q A;  4HN7 A;  3GD7 A;  1JQY D;  2V1C C;  1Q3L A;  1DXM A;  3UDX A;  4DR4 L;  2K03 A;  4C3H B;  2F3V A;  2MGS A;  3OIP A;  2IL8 A;  2JEB I;  4C2M B;  4FF1 A;  3KLW A;  1I6H B;  5ELF A;  1SYG A;  2XRS D;  1B2T A;  1PRT F;  4WJW A;  1HA6 A;  1GUN A;  2XVS A;  2RCN A;  5IYB H;  4LUZ A;  4K2L A;  1A3U A;  1B4O A;  3HOX H;  1CKN B;  2D9U A;  5IGE A;  1MGS A;  3OWE B;  4JYA Q;  3S17 B;  1Z7T A;  2F4V L;  4RA8 A;  1MD2 D;  1HZA A;  4DV0 L;  4LF6 Q;  3PF5 A;  2O5J C;  5FLX c;  1JOR A;  2BE5 D;  1YNN C;  1A63 A;  1GJX A;  1EY6 A;  4IUV A;  1GUW A;  1EQQ A;  1U4R A;  2UUB L;  3A7L A;  1G2T A;  3WDN A;  4EQO A;  4EVO A;  1IYV A;  2Z0S A;  1I3Q H;  1VQM A;  2R7D A;  3PO2 G;  3M4Q A;  4EQ5 A;  5JAV A;  1HCZ A;  2NVX B;  3U58 A;  4NB3 A;  3NUC A;  2JA6 B;  2ICE C;  4I65 A;  1GUT A;  5CR3 A;  1K83 H;  3PMF A;  2G5D A;  3WWV A;  1TKW B;  1WYD A;  4A3B B;  3J7Y W;  4L6T B;  1X6O A;  4X65 Q;  1HZC A;  3SK6 A;  2BOS A;  3OW2 A;  2FFK B;  3M4O H;  2SNM A;  2Z9H A;  3I3C A;  4A3F G;  5ELD A;  4LF9 Q;  4GKJ L;  4K14 A;  1Q82 C;  5M5X H;  4MZ9 A;  3HOW B;  4X3S A;  1C4Q A;  1TS4 A;  1EEI D;  1VF7 A;  1CZG A;  2HCI A;  2XIW A;  3C1E A;  1BUV T;  1TQO A;  1CZW A;  2XWJ B;  4S3S A;  4E6I A;  4Z9C B;  4IJH A;  3PO3 H;  4A4I A;  2Z4I A;  2Z6B A;  2JA5 B;  5IGF A;  1RIP A;  1STA A;  4BY7 H;  1IKL A;  2HQL A;  3DWP A;  2Q2T A;  4OWT B;  1LO5 D;  1UEA B;  3EIV A;  3NE5 B;  3HKS A;  2F0L A;  1PTO D;  4NP5 A;  1SFO B;  2FJ2 A;  4MTN A;  4G4K A;  1L0Y B;  3PO2 B;  1SNC A;  4JI8 Q;  1EYA A;  1K83 B;  5KGU A;  2UXC Q;  5D65 A;  3BDC A;  2J7Z A;  4AYB E;  3D8G A;  2R93 G;  2YV5 A;  3FEW X;  2CQO A;  4B3M Q;  4A3K G;  5D3I B;  1QOH A;  2NVY B;  2NN6 I;  1X3G A;  2AWO A;  2R7Z B;  2FMC A;  1JJ2 A;  2JA7 G;  1FNV A;  3FPP A;  4XT1 B;  5EKI A;  3W1B A;  3RD4 A;  3GTM B;  3HOZ G;  3OMG A;  1RCV D;  5J3B A;  1BCP C;  3F1Z A;  3RLN A;  4LF5 Q;  4JK1 C;  2E2J B;  4RFB A;  3J7Z C;  3J7A 5;  2B8G A;  4BBR H;  3A5Z B;  3EJI A;  2F0O A;  2X6L A;  2F0W A;  4QIW E;  1LTR D;  3A54 A;  4F88 A;  2WIN B;  1XYI A;  4OIK A;  3HKZ G;  4U67 3;  3G7L A;  2PQE A;  1WTO A;  3C3L A;  3S1M B;  3BVZ A;  5IT9 L;  5FLX E;  4QUC A;  1VQA A;  2VXW A;  3NXW A;  1VQL A;  4A3F B;  2MP1 A;  1RDP D;  4CGY B;  1SFO H;  3W1G A;  3GV3 A;  4B08 A;  3QJY A;  4ILW A;  3SE0 A;  4A3G G;  3PCO B;  1X9N A;  3CCL A;  1A0I A;  1OXS C;  1PFM A;  1S5E D;  3HOY G;  4FYD A;  4DV4 Q;  2FIN B;  1VQP A;  1LTI D;  1YBY A;  1K3R A;  5IP7 G;  1CK1 A;  4A93 B;  4QQB X;  3AB9 A;  3TP7 A;  2H4O A;  3KJP A;  3S1N H;  4NPS A;  3CCV A;  1BCP F;  4A3I G;  2O4X A;  4RG1 A;  1BBU A;  1IW7 D;  1N32 Q;  5FK9 C;  1R4Q B;  1FNU A;  5IYC H;  4GN3 B;  3J7A V;  5FOB B;  2RSN A;  5CMD A;  2VS1 A;  5IYB G;  2EYO A;  2HT1 A;  1HUN A;  3J81 L;  1XNR Q;  3I56 A;  2OEO A;  4V0B A;  1HH2 P;  5JPM C;  3PQI A;  5M5X B;  3OIQ A;  1C8C A;  1SYF A;  4AQY L;  4C1N K;  3AFQ A;  2EXZ A;  5E4W C;  1DYQ A;  1VQ9 A;  5FJ8 G;  5BN4 A;  1CHQ D;  3DWA A;  1IBL Q;  1WVL A;  4EX5 A;  2Z6K C;  1ET9 A;  2R93 B;  3FMC A;  4P2C B;  3KLS X;  4C3J B;  1FR3 A;  3FRP B;  3RN2 A;  2PZU A;  3L2P A;  1SE3 A;  1SE8 A;  4NXM L;  3FKI H;  4MHE A;  3BZK A;  1BBW A;  4KKS A;  2E2J H;  2L9H A;  4H02 A;  2RBM A;  2B39 A;  5IGG A;  1Q12 A;  3GTP B;  3CCJ A;  2SNS A;  4C3J H;  2IJ0 A;  1Q7Y C;  1I4R A;  3X3N A;  5CV9 A;  1ILP A;  4G7Z C;  1RTO A;  4HJ5 A;  1Y8P B;  1EOT A;  2UXD Q;  1B9N A;  1E7Z A;  4LFB L;  4YY3 L;  4IJL A;  4C3I G;  5F2D A;  1I6H H;  2F1M A;  2UXC L;  4LFC Q;  4A3F H;  4AYB G;  1VF5 C;  4DV2 L;  1PH8 A;  2LY7 A;  1F9R A;  4ZKB B;  1MI2 A;  3NTH A;  3K5L A;  2K4K A;  5EJW A;  5EGT A;  5I6Y A;  1C7Y A;  4JI0 L;  1GHK A;  5ELN A;  4DR6 Q;  4L5S A;  2ICI A;  1WTP A;  3VR3 A;  3PV0 A;  2HD3 A;  2DY7 A;  1KDA A;  3M4O B;  2UUA Q;  3I4O A;  3G6E A;  3S1N B;  2F3W A;  2Y0S B;  4GOP A;  2B2T A;  4KJN A;  2YTX A;  1UAP A;  1PHJ A;  1JB7 A;  4FF2 A;  3AFP A;  4IFD G;  2R3Z A;  2F0K A;  5IWA Q;  5DEH A;  4A3I H;  4A3K H;  1KIX A;  3RZO B;  1DJR D;  4KN4 C;  4HID A;  3C1F A;  2EDG A;  3GTG B;  1K0S A;  1STN A;  1IW7 C;  3GTO H;  1C48 A;  3J7A F;  1VQG A;  3K7U C;  3J80 E;  3T16 A;  1HXY D;  5I9O A;  2H1E A;  1GKH A;  1Y8N B;  4RKB A;  3GTJ H;  3VR4 A;  3AU7 A;  5LMU Q;  4X3U A;  1XMQ Q;  1KDC A;  3HGB A;  3K58 A;  4DR7 L;  5C5L A;  2CWA A;  4A3D B;  2E2H B;  5KIX A;  2B2W A;  2E2H H;  2BA1 A;  1RJT A;  1KD1 C;  2BDO A;  1PTO H;  2RVL A;  1I6V C;  2ZJP A;  3K57 A;  3STB D;  1B1Z A;  4OWX B;  1EIG A;  4BBS G;  1U4M A;  1B44 D;  2E2D C;  3PO3 B;  5D3D A;  1I3Q B;  3OSO A;  1K8G A;  2F0M A;  5C3E B;  5JEA J;  2L4N A;  3C2P A;  4RHS A;  4DAM A;  5IGD A;  2IX0 A;  5IP7 H;  4LF8 Q;  2VUM G;  5C0X I;  1H9M A;  1TS2 A;  1F77 A;  2A74 C;  4KLK A;  4RMF A;  2HUG A;  2A8V A;  4KKT A;  1R4P B;  5KYL A;  1FYC A;  1YIJ A;  4RGT A;  1XPR A;  1TWC B;  2EY2 A;  1M4V A;  3LWU A;  5C4H A;  2PQA B;  4H44 C;  1STB A;  2IWH A;  2JA8 G;  3I8Z A;  1LTS D;  1O7Y A;  4CDE C;  4KY6 A;  3T13 A;  2JA5 H;  4R4O A;  1L1O A;  2L15 A;  3SDZ A;  5GAH C;  1PYB A;  4QCL A;  4B3M L;  2KCT A;  3CCM A;  1YHQ A;  2OTL A;  2M9V A;  1LT3 D;  4LF7 L;  1EQT A;  4JI3 Q;  2D5D A;  3FVQ A;  4PNY A;  1WCM G;  5C44 B;  1QZG A;  2I46 A;  5FJ8 H;  3GV6 A;  3OHX C;  2PQA A;  3I91 A;  5ISR A;  3TSS A;  4K0K L;  1NUC A;  1AW7 A;  3JC6 6;  3NHH A;  2JQO A;  4KHZ A;  3CD6 A;  2M2L A;  1VQJ A;  1PRT C;  3NEM A;  4DV3 L;  4BXX G;  3K8A A;  5AJ3 Q;  4DV1 Q;  4PG3 A;  2CWP A;  4JBM A;  3KF6 A;  2BE5 C;  4I7Z C;  4KJO A;  2ZXP A;  1PVO A;  1EY5 A;  2WB1 E;  4DAY B;  1HFG A;  1OTC A;  4A3E B;  1SYB A;  4HSV A;  1KNA A;  4HJ9 A;  1X32 A;  3KLR A;  5M3F G;  1NTG A;  3HOV G;  1KRT A;  4H0L C;  2CKZ B;  1KLG D;  2L12 A;  3LWE A;  5C3X A;  2EVB A;  1SMY D;  1UWV A;  1QJO A;  4K6L A;  2RHQ B;  2DGY A;  4DAP A;  1I94 Q;  4NW2 A;  4UY8 C;  3I55 A;  3K59 A;  1DZ1 A;  1PFN A;  3KLS A;  4C1N I;  1D7Q A;  1NMF A;  2JK8 A;  1L0W A;  3KYH C;  1CA6 A;  2XNA C;  4JVZ A;  1CM9 A;  1TS3 A;  3K6O A;  1ZEQ X;  3E0J A;  2B2T C;  3JAM c;  2UU9 L;  1G8Z D;  4FF3 A;  1T5E A;  2YYZ A;  1P8L A;  4CKC A;  5JJL A;  1LTL A;  3Q6S A;  2LS0 1;  1JOQ A;  1V8Q A;  2MJ8 A;  5LL6 S;  2YU9 B;  4JBK A;  3IAY A;  1Y1V G;  3I4M B;  2WAQ G;  3KF8 B;  2BDN A;  3RNU A;  4O1N A;  1N33 Q;  4QGU A;  2P5Z X;  1XNQ Q;  3H3V H;  1A62 A;  3TDQ A;  4QMG A;  4JI2 Q;  3OOC A;  2RDG A;  3A8J E;  5EKL A;  5LL6 X;  1SE4 A;  4OX9 L;  3FP9 A;  1Y69 U;  2SDF A;  4HIO A;  1K73 C;  1L1O B;  1CA5 A;  3MXP A;  2LSS A;  2G9H D;  3VYU A;  4B3S Q;  1QB5 D;  1RF2 D;  5JVG 3;  3M4P A;  3MTS A;  3PIP 3;  1G6Z A;  4X64 L;  4DUZ L;  4LFA L;  1F2M A;  1HTL D;  3NWS A;  2EXD A;  1KXL A;  1PH5 A;  4MNO A;  1HNZ Q;  1H9S A;  3W3A A;  3CQZ H;  4WJ4 A;  4JI7 Q;  4LFC L;  1WTR A;  4BS9 A;  1XJV A;  3HKZ B;  3RR5 A;  4DK3 C;  2RQX A;  4DF7 A;  1SND A;  2BH2 A;  1QNK A;  3H3V C;  4K2K A;  5COY A;  1JE5 A;  4GKK L;  4JI0 Q;  1DM0 B;  1S4Z A;  1KTK A;  4J6H A;  3A56 A;  4CDC C;  4DN4 M;  3ER0 A;  4Q0F A;  3CCE A;  4DV7 Q;  4CBV A;  2UUA L;  1HJP A;  1F9S A;  1TS5 A;  4A3M B;  4X6A H;  1VQB A;  2VQE Q;  3HEJ A;  2EY6 A;  1PYS B;  3E5S A;  1PH2 A;  2NVQ B;  1AE2 A;  3K5M A;  2B2V A;  2WB1 G;  1JE4 A;  1QZH A;  3I4N H;  3NTI A;  1K8A C;  1BNZ A;  1EL0 A;  5FLX L;  1M1K C;  3G71 A;  2UXB L;  3JAM i;  2B8F A;  3T4A C;  2R6G A;  2KCN A;  4OHJ A;  1SAP A;  3CMA A;  1I50 B;  1PH9 A;  1BCP D;  4L5Q A;  4R4C A;  4WJ3 M;  4DUY Q;  1KAA A;  5A35 A;  1AFP A;  3GP7 A;  2AWN A;  4LFB Q;  4V19 0;  4DKA C;  5JJK A;  2ID0 A;  1IBM L;  4TQU S;  3OWF A;  4XTC S;  4A3J G;  2X69 A;  2TMP A;  4AIM A;  3GTP H;  1HNX L;  4OO1 I;  3U4V A;  3HZX A;  4XDX A;  5H1S E;  2LXK A;  1Q90 A;  3CRK C;  4NKL A;  5TSS A;  2KQ3 A;  3OTO L;  2PO4 A;  1Q1B A;  3V96 A;  2EJF C;  5HGT A;  1YIT A;  1BVS A;  1U4P A;  1VQ4 A;  3PIO 3;  2CW0 C;  3QR8 A;  3CXC A;  3TBI B;  1LAB A;  1V1O A;  3MHB A;  3E0E A;  4CKB A;  4A75 A;  3TZD A;  2A1A A;  5C4X B;  1HR0 W;  3L3O C;  3CP0 A;  2XWB B;  1B7Y B;  3P20 A;  4QJF A;  4JI2 L;  1SRO A;  3RZO H;  4B3R L;  1M8A A;  1SNP A;  3S16 H;  1W2B A;  4JOI A;  1VQC A;  3ZYY X;  3S17 H;  1H9K A;  3SK4 A;  4Y7N B;  3PUX A;  4C56 C;  1N8R C;  1S40 A;  3U4Z A;  3H3V I;  1ESR A;  2EOT A;  2OF1 A;  1ONL A;  4DR3 Q;  4A76 A;  1BCP B;  2EJM A;  2PW5 A;  3TEH B;  1JWS D;  1EIH A;  2VZA A;  1PTO C;  2F3I A;  3M7N A;  4ZLT F;  4DXF A;  1ENC A;  1SNQ A;  4Q5V A;  1AN8 A;  3OW7 A;  4BA2 I;  4AH6 A;  4RHR A;  4M8A A;  3BZC A;  4JPB W;  4JI4 L;  3NBH A;  4JBJ A;  4DV1 L;  5KNC A;  3S2D B;  2B2U C;  2IY5 B;  1TXY A;  2HHH L;  3DXJ C;  3NP8 A;  3I73 A;  3ULP A;  1E0B A;  1SMX A;  4KV6 A;  1HZ9 A;  3PF4 A;  2VW9 A;  4X66 Q;  4JCV E;  3CQZ B;  1PTO B;  2Z6K A;  1J5E L;  3GTL B;  1PV4 A;  3L0O A;  3BDO A;  4POG A;  1WOC A;  3SEB A;  4X62 Q;  1H9R A;  4JYA L;  1Z47 A;  1SBB B;  4J15 A;  3HFZ B;  2K05 A;  3BJU A;  3ND8 A;  2ZTC A;  1XTD A;  3CC7 A;  3S1Q H;  1N9W A;  1J6Q A;  1G2S A;  3A7A B;  1E1T A;  1S3O A;  1XX8 A;  2AKW B;  1EQV A;  4UAI A;  4UP9 A;  2D2C C;  1TWG H;  4L8J A;  1SJE D;  1BXT A;  4RCN A;  2D0P A;  1NR4 A;  3H0G G;  1Q81 C;  3F2B A;  3BVG A;  2HQE A;  2WFW A;  2CH4 A;  1HUM A;  2ZT9 C;  2K5W A;  2PNR C;  1JOK A;  4OXP A;  2J0T D;  4L63 B;  3HOX B;  2PZW A;  3NQI A;  1YVC A;  3DM1 A;  3SK5 A;  3K0X A;  1QVC A;  4KD4 A;  4WFN 3;  5EPJ A;  3MXG A;  1AE3 A;  1N36 Q;  2AUJ D;  4PZ6 A;  3JAM E;  4G7H C;  5IT9 E;  4IZ8 A;  3M4Y A;  2M00 A;  1WCM B;  1WCM H;  4ID6 A;  1Y1W G;  1FNW A;  1JCK B;  5IY0 A;  3HP3 A;  4B3S L;  1JB3 A;  1DCZ A;  3CCU A;  2DUD A;  2Y0S E;  3W2D A;  4GNX C;  3TS0 A;  2E2I B;  1EEF D;  4OO1 G;  4BY7 G;  1SNM A;  2ATW A;  2I0Q A;  1NCV A;  2HDM A;  4HMI A;  1QNU A;  3TRE A;  4B3R Q;  1HA5 A;  2AMC B;  3CAM A;  4F7X A;  1CT1 D;  1EIY B;  4IAL A;  2K50 A;  2NVQ H;  1HQR D;  2RF4 A;  4B3T Q;  1SYC A;  3NQT A;  2Q2I A;  4PQX A;  4IUU A;  1UE7 A;  4DK6 C;  3J81 E;  1EYD A;  4KHP Q;  1O7L A;  3SK8 A;  5ELB A;  2R93 H;  3KUP A;  4OON A;  4X3K A;  3I2Z A;  2QKI C;  4XXE A;  5C3E H;  3I7F A;  2R92 B;  3M3Y H;  2L0C A;  2RKS A;  2HCC A;  4JBW A;  1K28 A;  1CKO A;  4IUR A;  5KRU A;  5C0X G;  2JE6 I;  3I72 A;  1K9M C;  2F0Q A;  2A69 C;  4JI1 L;  4BBR B;  3A8K E;  2IPK D;  1K0R A;  3HKZ E;  1SYE A;  1F2Y A;  4A3I B;  2L55 A;  3LX0 A;  2DNE A;  3I4N B;  4P71 A;  3URY A;  5K5P A;  5L37 A;  2I5M X;  4X66 L;  1KNE A;  3CC2 A;  3RMH A;  2UXB Q;  4IOC A;  2RDF A;  3MXU A;  3GO5 A;  2D0O A;  4JI6 Q;  4GNX B;  4DK0 A;  1PZI D;  4N8F A;  2GVB A;  1EQR A;  4HR7 B;  2KED A;  2N3S A;  5ELE A;  3GTO B;  1ILQ A;  1IBL L;  1D1K A;  3MAQ A;  3J80 i;  5LHY 1;  2OCE A;  3OPO A;  1L1O C;  1JC7 A;  4X64 Q;  4KTA A;  3RLF A;  4A3K B;  5GAG C;  2ZM6 L;  4A3J B;  4DNI A;  1LAC A;  4UDU C;  2PPB C;  3PUZ A;  1B3A A;  2WII B;  5DM7 3;  2B2Y C;  2WP8 J;  3T56 B;  1DD2 A;  1SMY C;  4C3I H;  1QVF A;  4R4Q A;  4DR3 L;  4IPG A;  1PYW D;  1Y1W B;  4GN4 B;  5EQ0 A;  1QIL A;  4HSP A;  2K32 A;  1PH6 A;  1QE6 A;  1L0X B;  1RHP A;  1LTT D;  4TRD A;  4IFD J;  3SGI A;  1SEB D;  3HOZ B;  4BXX H;  2EYL A;  1D1I A;  4B9W A;  3GTM H;  1NSN S;  4KK7 A;  1KHI A;  3FKI B;  2XRQ D;  1JOO A;  2KHJ A;  3BG3 A;  4K6D A;  5E4X A;  1YHA A;  4A3C H;  2EYF A;  1E2W A;  3PO3 G;  1U5K A;  5HGQ A;  2AQ2 B;  3GTJ B;  4O2D A;  1UE1 A;  1E2V A;  3MXN A;  5EPL A;  3TS2 A;  4A3G H;  4IFD I;  4JOI C;  3MFY A;  5DNF A;  5CBE E;  3Q22 A;  3J80 c;  1EIF A;  3J81 c;  2F0V A;  3MFG A;  1DOM A;  2WAQ B;  2UUC Q;  3PIO A;  4NDX A;  3H09 A;  1FJG L;  2JXM B;  2RA4 A;  5JOB A;  4DK1 A;  4OL7 A;  4CKE A;  3K7A H;  4IUN A;  3VR6 A;  2GA4 B;  2VUM H;  1LYL A;  4N8X 1;  1RD9 D;  2F0S A;  3CCS A;  4GLV B;  3T51 B;  5JEA G;  4HIM A;  4EQN A;  2WB1 B;  3R93 A;  1SLJ A;  4LK1 C;  3QB3 A;  3TZU A;  5CBA E;  5J39 A;  2NBF A;  4GLA C;  1RKN A;  5KEE A;  1ASY A;  4IPD A;  2HHH Q;  4IFD H;  2BA0 A;  5M3F H;  4HED A;  1BKB A;  3K80 C;  4F8M A;  4BA1 I;  4G57 A;  1S5D D;  1GUG A;  5M3M G;  1LT5 D;  1H9S B;  5COR A;  4APV A;  3F2C A;  4HJ8 A;  2D62 A;  2VNU D;  1I4H A;  4BY7 B;  1TWH H;  2JA6 G;  5BR8 L;  1EY8 A;  2JA9 A;  4TSS A;  1L2F A;  4KY5 A;  4DR1 Q;  1IL8 A;  4LF8 L;  2NYZ D;  5M3F B;  4JI6 L;  3C46 A;  4JV5 Q;  4DR2 L;  1CFM A;  1ASZ A;  4LUV A;  3TP8 A;  1WTQ A;  3BU2 A;  2E5L Q;  2QDB A;  1TU2 B;  3T1H Q;  5D14 A;  2EYP A;  1K3B C;  1T9H A;  1DOL A;  4BY1 B;  5A2Q L;  2OWO A;  4A3G B;  2A6E C;  3ERS X;  3P1H A;  1CSP A;  4ODG A;  4O42 A;  2C9O A;  1UE6 A;  2DNC A;  3M3Y B;  3GTG H;  4F87 A;  4YWK A;  1IZ6 A;  2IT1 A;  1XTC D;  4B3T L;  1LT4 D;  3HOU G;  1VQF A;  2R61 A;  1TY0 A;  3KF8 A;  3TN2 A;  1R9T B;  2JA8 H;  4HIK A;  4K8J A;  2F0E A;  4JI3 L;  3UE1 A;  1NAP A;  1LT6 D;  2I5L X;  1EU3 A;  2VQF Q;  4GOP B;  1CUK A;  1UUP A;  4DR6 L;  1XNR L;  1XPO A;  3J80 L;  3D0F A;  1HTP A;  4K0K Q;  4HTH A;  1I5F A;  1STG A;  3G4S A;  3TP6 A;  5I6W A;  5M9O A;  4RGM A;  2E2I H;  1TVX A;  1FL0 A;  4P74 A;  4FF4 A;  4R4I A;  1PXU A;  1MKH A;  4FNF A;  4B9X A;  4JI1 Q;  1UNS A;  1CTM A;  2DN8 A;  1EY4 A;  1EFI D;  4FO2 A;  2FMM A;  5IOD A;  3FDT A;  1O7I A;  3MEH A;  4XYQ A;  1VMC A;  4DR5 Q;  2I07 B;  3MC0 B;  1EYG A;  3HOZ H;  3S1M H;  4QF4 A;  1JJC B;  1GM5 A;  1FD7 D;  2NZH A;  1WFQ A;  2Z4H A;  2F4I A;  3CU7 A;  2EQS A;  1XMQ L;  3T1Y L;  4BWG B;  1LTG D;  4K5V A;  3GTK B;  4A3D G;  4DAY A;  1JMC A;  4GS3 A;  1PLF A;  1AZP A;  2A19 A;  4A3D H;  4R8N A;  1CQF A;  3AYH B;  1DON A;  3T53 B;  5IGC A;  1AZQ A;  1A8V A;  4A3J H;  4OIJ A;  5BN5 A;  5DM6 3;  5T1I A;  3HOW H;  1EY0 A;  2JA6 H;  4NMZ A;  3BYY B;  5I4D A;  2KA7 A;  1MIU A;  1S72 A;  1X65 A;  3DMU A;  1STE A;  3A0J A;  5G3L D;  1JR0 D;  5HY6 A;  1SE2 A;  1EOV A;  1VQI A;  4KHV A;  2VUM B;  1XWE A;  5IP9 G;  5C0X J;  3AEV A;  3KDF B;  5IP9 H;  5JVH 3;  4ZYS A;  5JEA H;  1SRU A;  5AJ3 L;  2F0F A;  4GOP C;  3NBH B;  4JW0 A;  2EYM A;  4OX9 Q;  1Y1V B;  3I4M G;  1BQQ T;  3E3X A;  4IQZ A;  2F4V Q;  2QW7 A;  1B53 A;  4LF6 L;  3J81 j;  1ZKO A;  1GO3 E;  1YJW A;  1G6P A;  1YHB A;  1PDQ A;  3D4R A;  2R7Z G;  5J1Z A;  1Z6H A;  3PO2 H;  5C44 H;  2K01 A;  4MN3 A;  3T1H L;  3QOL A;  4LF7 Q;  3UI2 A;  4CJ1 B;  4DV6 Q;  4JG2 A;  5EBD A;  2KVM A;  3PUV A;  3OMC A;  4HCE A;  3R2T A;  2A69 D;  2JEA I;  2DJG C;  1D2B A;  2B2V C;  1EFW A;  3DLL A;  4ME3 A;  1QUQ A;  1QWY A;  1ZYR C;  4LMQ D;  2K33 A;  2JYO A;  2F03 A;  4CHT B;  3RN5 A;  3FHW A;  3QOJ A;  4BBS B;  1VQD A;  2VQF L;  3MVV A;  4PV1 C;  4N9T A;  1YNX A;  3TRZ A;  1PRT B;  1EWH A;  2F0H A;  2B2W C;  2A5H A;  4DV7 L;  1SXT A;  5C3W A;  1NBW A;  4LF9 L;  2MO1 A;  4R1J A;  3WOF A;  3QWN A;  4RKL A;  2R92 G;  3HOV B;  3S1Q B;  1F9Q A;  4WRD A;  2KUM A;  2SOB A;  1HZB A;  5C4X H;  3A55 A;  1N33 L;  3TME A;  5T1G A;  5IYD G;  2K5N A;  4A3B H;  2PNH A;  4BY1 H;  4AYB B;  4DR5 L;  3KBX A;  3HRZ C;  4FXK C;  4KY7 A;  2MHV A;  4ABN A;  2KCM A;  3NEL A;  3S2H B;  1D5Z C;  2GN5 A;  3S2H H;  4JV5 L;  4K5X A;  4HJ7 A;  1Y8O B;  1BOS A;  5JJZ A;  2E5L L;  1J9O A;  2CVR A;  2K28 A;  3SVM A;  3OYY A;  2UU9 Q;  1ZXT A;  4HAE A;  4YWM A;  3ICE A;  2Y0S G;  1JIC A;  1SR3 A;  1U4L A;  1VS0 A;  2R7F A;  1S5F D;  3B6Y A;  1AH9 A;  2F0P A;  5FLM H;  1I50 H;  1Q1E A;  2AUK A;  1HNX Q;  4WOR A;  3ULJ A;  1W6J A;  3PIP A;  4ALP A;  2PMZ B;  2GVA A;  4RGO S;  2ALY B;  5BR8 Q;  3CCR A;  2KCC A;  3NPP A;  1TWH B;  3OTO Q;  4L5T A;  1K8O A;  4X65 L;  1D5X C;  2FHT A;  3CKI B;  1UEB A;  1XMO Q;  1OXV A;  4C3I B;  3BZD B;  4KI0 A;  5C6A A;  4A3B G;  2IX3 A;  2VQE L;  2NN6 G;  3F2D A;  2UUC L;  1SNO A;  1AEX A;  1FJG Q;  2N49 A;  4LF4 L;  1HFN A;  3VYR A;  2BH8 A;  5CV4 A;  1FVI A;  3UDG A;  5IIF A;  4A3C G;  4IO9 A;  3VYS A;  1TY2 A;  4EQP A;  3Q23 A;  1EY7 A;  3MZ5 A;  4C3H G;  1PH7 A;  2B29 A;  3H15 A;  4XIG S;  2N8N A;  1G29 1;  3KBG A;  2R92 H;  2FXQ A;  1YNJ D;  1Q46 A;  2NTS A;  3W5O A;  1QG7 A;  3IKJ A;  2JN4 A;  1I4Q A;  4DXG A;  1Q86 C;  1VQK A;  4JI4 Q;  2Q8T A;  4MTK A;  3UE0 A;  2ZTD A;  1CKN A;  3GTQ H;  3S14 B;  5CV6 A;  3DEO A;  4GLX A;  5C4J H;  1EY9 A;  2DJF C;  2PI2 A;  3JAM L;  2ZXO A;  4FDB A;  4H13 C;  3ULL A;  1D5M C;  4UHV A;  2J4X A;  4DV0 Q;  3H6M A;  1KLU D;  2PI2 E;  3K5N A;  4PMB A;  1ET6 A;  1E3P A;  2XN9 C;  2K6A A;  2EE1 A;  2HIX A;  2JA7 B;  4IUT A;  3AQQ A;  2TSS A;  3FKI G;  4IN3 A;  3T1Y Q;  2EIF A;  2K04 A;  4FP5 D;  4TKO B;  1FGB D;  1VQ5 A;  4DNT B;  4L5R C;  4CDD C;  4JI8 L;  3BDL A;  2N78 A;  3G6J B;  3ERO A;  4P72 A;  4OO1 H;  4CJ2 C;  3S15 H;  1S5B D;  1WJJ A;  1X3P A;  4YHH L;  1I4X A;  3H0G H;  4OEM B;  1B3Q A;  1I4G A;  1YNN D;  2AQ3 B;  2ENB A;  4J1M A;  5CV8 A;  2F0J A;  3CPF A;  1YJN A;  1OXX K;  4DV4 L;  1XXG A;  3HS0 C;  4YY3 Q;  5C0X H;  1HHV A;  4BY1 G;  2CH4 W;  2NN6 H;  3VDY A;  3IFT A;  2MQH A;  2LXJ A;  4GKJ Q;  1K8M A;  1MSH A;  3KF6 B;  1A2U A;  2K5V A;  1F2L A;  4FXD A;  2L1B A;  1WTH A;  1HQM C;  2QEJ C;  5I2Y A;  2K1B A;  1IBK Q;  2RCF A;  1GOZ A;  5ELO A;  2OQ0 A;  3H94 A;  1N36 L;  1TR5 A;  1VMP A;  1O7Z A;  1RL2 A;  3O13 A;  3K7A B;  3BS1 A;  5C4Z A;  4UP7 A;  3S1R H;  2A6H C;  2VB2 X;  2NVT B;  1STY A;  1J5E Q;  2NVX H;  2QDL A;  4DV5 Q;  2R7Z H;  3M85 A;  3Q24 A;  1X3F A;  1CQV A;  2I5H A;  1QCB D;  2L11 A;  1Y1W H;  3GDE A;  1H9J A;  5I9P A;  3EFX D;  4ME5 A;  4DFA A;  2A68 D;  1U9R A;  1B8A A;  2PW7 A;  1WTW A;  4RWS C;  5M3M B;  5K36 H;  2KEN A;  1ICW A;  4NXM Q;  4JC0 A;  2N88 A;  3NSW A;  2IW3 A;  1F9P A;  1ENA A;  1J8I A;  2HIV A;  2XSC A;  5I2X A;  4A3E G;  2ES2 A;  3D4D A;  3EN2 A;  1YEZ A;  2LMC B;  1VQ6 A;  1HNW Q;  2QCP X;  5M5W B;  1V43 A;  2O5I C;  1PFS A;  3LGJ A;  3L9A X;  4ZCK A;  3P75 A;  5M5Y H;  1N34 L;  4KN7 C;  5KNB A;  1D6E C;  1CHP D;  1EUJ A;  2NZO A;  2JA7 H;  4R4T A;  1JJG A;  4YCW A;  4IOA A;  2K52 A;  4LUO A;  1VQH A;  2C5C A;  3U9O A;  4X62 L;  3TP5 A;  5DAU A;  1UE5 A;  4XYO A;  4HCS A;  2EJG C;  4XQQ A;  3WOE A;  3HOU B;  4U68 A;  2F52 A;  1PH3 A;  2YU9 H;  1W3S A;  1U0L A;  1XMO L;  5AFW A;  3D4W A;  2EPB A;  3SHL A;  3Q8D A;  3A8I E;  1GHJ A;  4POF A;  2OXP A;  3E6Z X;  2YTY A;  2K5D A;  3N52 A;  1B9M A;  1HPC A;  5ELC A;  4A3M G;  1EU4 A;  4ZRZ A;  3PSI A;  3K81 C;  3HOX G;  3S16 B;  2UXD L;  4K8I A;  2ZM6 Q;  2K5H A;  1VQ8 A;  2QEX A;  5M3M H;  1V1P B;  3QG1 A;  3SXH A;  2V4D A;  3DM3 A;  2E74 C;  5IGB A;  2RSO A;  1IKM A;  5A2Q E;  3CPW A;  1BO0 A;  5FLM G;  1N32 L;  4PMC A;  4KHP L;  2KHI A;  1OXU A;  3M9B A;  3PUW A;  2G9D A;  3ND9 A;  3EQL C;  5LMU L;  3I90 A;  2WKC A;  3DHQ A;  1V1P A;  3EBE A;  1F2Z A;  3P7J A;  1E1O A;  3QO2 A;  5FO7 B;  1A15 A;  3VR5 A;  1LTB D;  3IL8 A;  1XPU A;  2C35 B;  1I4P A;  2NUC A;  1KAW A;  1X54 A;  4RH6 A;  1NMG A;  2Z1C A;  1ESF A;  4DPG A;  3GTL H;  5GRO A;  4H7B A;  2F0D A;  3S9W A;  1B70 B;  3KOJ A;  1HR0 L;  1BDO A;  1GD7 A;  5E3F A;  2CQA A;  4GN5 A;  1PH4 A;  4LF4 Q;  4LWC A;  4R8I A;  1TWF H;  3EA6 A;  3K5O A;  3I70 A;  4ZUI A;  5CV5 A;  1MBY A;  2IHF A;  1X56 A;  4KKU A;  1Q8I A;  3FPU B;  2ZTE A;  4UP8 A;  4HJA A;  4NXN Q;  4Y7N H;  3HG9 A;  3IFD A;  1PZJ D;  2Q8R E;  3PGZ A;  4A3M H;  2XGT A;  1NY4 A;  2EYH A;  5E7N A;  5C3E G;  3CME A;  3F2U A;  2A6E D;  1PTO F;  3NBI A;  5LMN L;  4XQJ A;  3VA7 A;  1TWA H;  5C4X G;  3VA5 A;  2QF7 A;  2DY8 A;  2CW0 D;  2CCZ A;  1KL9 A;  2NVT H;  3GTQ B;  3S14 H;  2OTJ A;  1EZ6 A;  1KDB A;  2F0I A;  3R2I A;  4CJ0 B;  4YHH Q;  3V05 A;  1TWC H;  3DWQ A;  5G3L F;  2E8G A;  3J81 i;  1HNW L;  3D31 A;  4UPA A;  2ZJR A;  3CRL C;  3I4N G;  1B50 A;  1IHZ A;  2N55 A;  3ERQ A;  1KQS A;  3K0Y A;  3CF5 A;  3HOY H;  5EPK A;  4TVA B;  4JI5 L;  2KEC A;  5IE8 A;  1O78 A;  1LV9 A;  5C44 G;  4DAV A;  2PZT A;  4DV3 Q;  1YZ6 A;  2PYK A;  2WAQ E;  3CCQ A;  3S2D H;  1ZYR D;  4EGV A;  2F0N A;  1VDZ A;  1IXR A;  3D6W A;  4DR1 L;  4C3J G;  5K36 G;  3TQY A;  1OO9 B;  2ASB A;  1X3Q A;  2LKV A;  5E1F A;  4DA2 A;  3MXN B;  4QB4 A;  1LUZ A;  1E2Z A;  4LJZ C;  5KYI A;  1LTA D;  4ZAI A;  1KC8 C;  1TT2 A;  1VQO A;  1G91 A;  4G7O C;  3ITP A;  1Y14 B;  4YWL A;  5GQO A;  4DR7 Q;  1W6K A;  1PA6 A;  3IRB A;  2Z8L A;  4GZY C;  4IPH A;  3HOW G;  3GQB A;  4N9P A;  1HNZ L;  2NTT A;  1YI2 A;  4ZQ3 A;  2PCF B;  4JI7 L;  1LM0 A;  2ZXR A;  1Q8K A;  3G48 A;  3VYT A;  4OWW B;  4QIW B;  4FXG C;  1KAB A;  1A2T A;  4BBR G;  1IBK L;  1MHW C;  1ML0 D;  3D3R A;  4CDF C;  1X3E A;  4DR4 Q;  4YIJ A;  5M5W H;  1EZ8 A;  2O2L D;  2E75 C;  4PMW A;  5HUR A;  1Y1V H;  2AQ1 B;  3HOY B;  3EVQ A;  1N34 Q;  2B63 H;  2F0G A;  1IL2 A;  3SR1 A;  1PZK D;  5BN3 A;  4DV5 L;  1C0A A;  3DUZ A;  1DGS A;  1GUO A;  5IYD H;  2A73 B;  1WTV A;  3KK7 A;  2MNA A;  1XNQ L;  2EY1 A;  1VQN A;  3STB C;  4M1U B;  4IPC A;  2QA4 A;  3BVM A;  5EKK A;  3Q0A A;  1NR2 A;  1GXD C;  2VB3 X;  4QUF A;  3KFU A;  4NXN L;  1SSO A;  2LFN A;  3QIA A;  4DU9 A;  2F0T A;  1X55 A;  2OT2 A;  1VQ7 A;  4RGN A;  3I4L A;  3RZD H;  2WAC A;  4YCV A;  4XQN A;  1QVG A;  1BR9 A;  4DNR B;  4IUQ A;  4ULL A;  4A3L G;  4DUY L;  4A3E H;  3MEF A;  2MO0 A;  1E22 A;  4Y52 H;  4RCO A;  4ZUJ A;  5GAE C;  2CHB D;  3KDF A;  2MFI A;  4X3T A;  3UDF A;  1V9P A;  1IBM Q;  5M5Y B;  2EY5 A;  4LW1 A;  1TII D;  2PMZ E;  1EWC A;  4A3L H;  1TWF B;  1VCI A;  5NUC A;  1GUS A;  1EWI A;  2NZ1 D;  1CKM A;  2K14 A;  2K75 A;  5LMN W;  3L7Z C;  4GKK Q;  3BYT B;  1TWA B;  3S24 A;  1II3 A;  2OQK A;  2B63 G;  2BCO A;  1S5C D;  2WV6 D;  1CSQ A;  3HOV H;  2XTI A;  1HRJ A;  3N6R A;  4OEL B;  3CC4 A;  3I4M H;  4C3H H;  3H0G B;  4DR2 Q;  1EYC A;  1VQE A;  1HR0 Q;  4DGZ A;  3S15 B;  2UUB Q;  1OXT A;  2YTV A;  3R8B A;  2RHS B;  5GAD C;  2KEE A;  4PZ7 A;  4LFA Q;  4DUZ Q;  1GVP A;  1I94 L;  1A6X A;  4OGQ C;  3DEP A;  3RUZ A;  2ZJQ A;  2JP1 A;  5CGK A;  1P16 A;  2QGQ A;  2RDH A;  3MA2 B;  1CI3 M;  3MWY W;  2MUY A;  3RZD B;  1YNJ C;  3PUY A;  5DLQ E;  2EYJ A;  5EBC A;  2B2Y A;  5LMN Q;  5C4J B;  3CHB D;  1ICF B;  4R9W A;  4LNQ A;  1JT8 A;  1BBX C;  4RAU C;  1AP0 A;  3U9S A;  3ONA B;  5FO9 B;  2B2U A;  4I7A A;  4PZ8 A;  4XT3 B;  5J22 A;  1IYJ B;  2WKD A;  4LAA A;  2IHE A;  1MSG A;  1PMR A;  1NNX A;  2B3G A;  4BBS H;  1O80 A;  1JWM D;  2JJQ A;  2Q2H A;  3LNN A;  4KD3 A;  2B63 B;  1DOK A;  4FVM A;  4JI5 Q;  2F0U A;  2JSO A;  2K7V A;  2IX1 A;  3KJO A;  4KMU C;  1SJH D;  2L5T A;  3NWT A;  2EZV A;  1M90 C;  2NVY H;  4QY7 A;  3U50 C;  2CFM A;  2AHO B;  1A3V A;  2Q2U A;  4MIU A;  1WTX A;  3H91 A;  4C2M H;  2E76 C;  4ZKC B;  3HOU H;  2H5X A;  2KHS A;  5CYU A;  5CC4 A;  4P75 A;  3NK9 A;  3D6C A;  3A5U A;  2JA5 G;  2VL6 A;  5FO8 B;  1JWU D;  4HMJ A;  3AMU A;  1WI5 A;  5IT9 c;  3CW2 C;  1QUQ B;  2K5Q A;  4DV6 L;  3VR2 A;  3E9H A;  1MJE A;  3E9I A;  2QIL A;  4ZK9 B;  1G51 A;  3ZJY C;  1SDF A;  3UDI A;  1PH1 A;  1TWG B;  4A93 H;  4QL5 A;  2Q8I B;  5C5M A;  3S1R B;  2SEB D;  3RLO A;  4A93 G;  1R9T H;  2MPM A;  2JA8 B;  4LF5 L;  4GNX A;  5EAY A;  5IYC G;  1NJI C;  4DV2 Q;  3V2T A;  1YJ9 A;  4K5W A;  1V1Q A;  3NEN A;  4YCU A;  1SN8 A;  1WD0 A;  4O0A A;  5CV7 A;  1IYU A;  5JJI A;  2A6H D;  1STH A;  1T5X D;  3X3M A;  1FGU A;  1ROD A;  1WD1 A;  1PFB A;  1H95 A;  1ENF A;  3NTK A;  2VY3 A;  1E24 A;  4IUP A;  1SYD A;  4AQY Q; 
#chains in the Genus database with same CATH homology
 1BF4 A;  2KOL A;  2A68 C;  1A3T A;  1LLR D;  2NWG A;  2X6G A;  5KND A;  3M7G A;  1RTN A;  5JPN C;  1PRT D;  2HDL A;  3R3O A;  5FKA C;  2NB0 A;  5IOC A;  2KJX A;  4J8Q A;  4HN7 A;  3GD7 A;  1JQY D;  1Q3L A;  1DXM A;  2K03 A;  4C3H B;  2F3V A;  2MGS A;  3OIP A;  2IL8 A;  2JEB I;  4C2M B;  4FF1 A;  1I6H B;  5ELF A;  1SYG A;  2XRS D;  1B2T A;  1PRT F;  4WJW A;  1HA6 A;  1GUN A;  2XVS A;  4K2L A;  1A3U A;  1B4O A;  2D9U A;  5IGE A;  1MGS A;  3OWE B;  3S17 B;  1Z7T A;  4RA8 A;  1MD2 D;  2O5J C;  1JOR A;  2BE5 D;  1YNN C;  1GJX A;  1EY6 A;  4IUV A;  1GUW A;  1U4R A;  3A7L A;  1G2T A;  3WDN A;  4EQO A;  4EVO A;  1IYV A;  5JAV A;  1HCZ A;  2NVX B;  3NUC A;  2JA6 B;  2ICE C;  4I65 A;  1GUT A;  5CR3 A;  3PMF A;  1TKW B;  4A3B B;  3J7Y W;  4L6T B;  3SK6 A;  2BOS A;  2FFK B;  2SNM A;  3I3C A;  5ELD A;  4K14 A;  3HOW B;  4X3S A;  1C4Q A;  1TS4 A;  1EEI D;  1VF7 A;  1CZG A;  2HCI A;  2XIW A;  3C1E A;  1BUV T;  1TQO A;  1CZW A;  2XWJ B;  4S3S A;  4E6I A;  4Z9C B;  2Z4I A;  2JA5 B;  5IGF A;  1STA A;  1IKL A;  3DWP A;  1LO5 D;  1UEA B;  3NE5 B;  2F0L A;  1PTO D;  4NP5 A;  1SFO B;  2FJ2 A;  4G4K A;  1L0Y B;  3PO2 B;  1SNC A;  1EYA A;  1K83 B;  5KGU A;  5D65 A;  3BDC A;  2J7Z A;  3D8G A;  3FEW X;  5D3I B;  1QOH A;  2NVY B;  2NN6 I;  2AWO A;  2R7Z B;  2FMC A;  1FNV A;  3FPP A;  4XT1 B;  5EKI A;  3RD4 A;  3GTM B;  3OMG A;  1RCV D;  1BCP C;  4JK1 C;  2E2J B;  4RFB A;  2B8G A;  3EJI A;  2F0O A;  2X6L A;  2F0W A;  1LTR D;  3A54 A;  4F88 A;  2WIN B;  1XYI A;  4OIK A;  4U67 3;  3G7L A;  2PQE A;  1WTO A;  3C3L A;  3S1M B;  3BVZ A;  5IT9 L;  5FLX E;  4QUC A;  2VXW A;  3NXW A;  4A3F B;  2MP1 A;  1RDP D;  4CGY B;  3GV3 A;  4B08 A;  3QJY A;  4ILW A;  3SE0 A;  4FYD A;  1OXS C;  1PFM A;  1S5E D;  2FIN B;  1LTI D;  1CK1 A;  4A93 B;  3AB9 A;  3TP7 A;  2H4O A;  1BCP F;  2O4X A;  1IW7 D;  5FK9 C;  1R4Q B;  1FNU A;  3J7A V;  5FOB B;  2RSN A;  5CMD A;  2EYO A;  1HUN A;  3J81 L;  2OEO A;  4V0B A;  5JPM C;  5M5X B;  3OIQ A;  1C8C A;  1SYF A;  4C1N K;  2EXZ A;  5E4W C;  1DYQ A;  5BN4 A;  1CHQ D;  3DWA A;  1WVL A;  1ET9 A;  2R93 B;  3FMC A;  4P2C B;  3KLS X;  4C3J B;  1FR3 A;  3FRP B;  2PZU A;  1SE3 A;  4MHE A;  4KKS A;  2L9H A;  2RBM A;  2B39 A;  5IGG A;  1Q12 A;  3GTP B;  2SNS A;  2IJ0 A;  1I4R A;  3X3N A;  5CV9 A;  1ILP A;  4G7Z C;  1RTO A;  1Y8P B;  1EOT A;  1B9N A;  4C3I G;  5F2D A;  2F1M A;  1VF5 C;  2LY7 A;  1F9R A;  4ZKB B;  1MI2 A;  3NTH A;  3K5L A;  5EJW A;  5EGT A;  5I6Y A;  1GHK A;  2ICI A;  1WTP A;  3VR3 A;  3PV0 A;  2DY7 A;  1KDA A;  3M4O B;  3S1N B;  2F3W A;  2Y0S B;  2B2T A;  4KJN A;  1UAP A;  4FF2 A;  4IFD G;  2R3Z A;  2F0K A;  5DEH A;  3RZO B;  1DJR D;  4KN4 C;  3C1F A;  2EDG A;  3GTG B;  1STN A;  1IW7 C;  1C48 A;  3J7A F;  3J80 E;  3T16 A;  1HXY D;  5I9O A;  2H1E A;  1Y8N B;  4RKB A;  3VR4 A;  3AU7 A;  4X3U A;  1KDC A;  3HGB A;  3K58 A;  5C5L A;  4A3D B;  2E2H B;  5KIX A;  2B2W A;  2BA1 A;  1RJT A;  2BDO A;  1PTO H;  2RVL A;  1I6V C;  3K57 A;  1B1Z A;  1EIG A;  1U4M A;  1B44 D;  2E2D C;  3PO3 B;  5D3D A;  1I3Q B;  3OSO A;  2F0M A;  5C3E B;  5JEA J;  2L4N A;  3C2P A;  4RHS A;  5IGD A;  2IX0 A;  5C0X I;  1H9M A;  1TS2 A;  1F77 A;  2A74 C;  2HUG A;  1R4P B;  4KKT A;  5KYL A;  1FYC A;  4RGT A;  1TWC B;  2EY2 A;  1M4V A;  3LWU A;  5C4H A;  4H44 C;  1STB A;  2IWH A;  3I8Z A;  1LTS D;  1O7Y A;  4KY6 A;  3T13 A;  3SDZ A;  4QCL A;  2M9V A;  1LT3 D;  1EQT A;  2D5D A;  3FVQ A;  4PNY A;  5C44 B;  2I46 A;  3GV6 A;  3OHX C;  3I91 A;  5ISR A;  3TSS A;  1NUC A;  1AW7 A;  3NHH A;  4KHZ A;  2M2L A;  1PRT C;  2BE5 C;  4I7Z C;  4KJO A;  2ZXP A;  1EY5 A;  1HFG A;  4A3E B;  1SYB A;  4HSV A;  1KNA A;  1X32 A;  3KLR A;  4H0L C;  1KLG D;  2L12 A;  3LWE A;  5C3X A;  2EVB A;  1SMY D;  1QJO A;  4K6L A;  4DAP A;  4NW2 A;  3K59 A;  1DZ1 A;  1PFN A;  3KLS A;  4C1N I;  1CA6 A;  2XNA C;  1CM9 A;  1TS3 A;  3K6O A;  1ZEQ X;  3E0J A;  2B2T C;  1G8Z D;  4FF3 A;  1T5E A;  2YYZ A;  4CKC A;  3Q6S A;  2LS0 1;  1JOQ A;  1V8Q A;  2MJ8 A;  5LL6 S;  2YU9 B;  3IAY A;  3I4M B;  2BDN A;  4O1N A;  3TDQ A;  4QMG A;  3OOC A;  2RDG A;  3A8J E;  5LL6 X;  5EKL A;  1SE4 A;  1Y69 U;  2SDF A;  1CA5 A;  3MXP A;  2G9H D;  3VYU A;  1QB5 D;  1RF2 D;  5JVG 3;  3MTS A;  3PIP 3;  1G6Z A;  1F2M A;  1HTL D;  3NWS A;  1H9S A;  3W3A A;  1WTR A;  4BS9 A;  3HKZ B;  2RQX A;  4DF7 A;  1SND A;  1QNK A;  3H3V C;  4K2K A;  5COY A;  1DM0 B;  1S4Z A;  1KTK A;  4J6H A;  3A56 A;  4DN4 M;  4Q0F A;  4CBV A;  1F9S A;  1TS5 A;  4A3M B;  3HEJ A;  2EY6 A;  3E5S A;  2NVQ B;  3K5M A;  2B2V A;  1JE4 A;  3NTI A;  1BNZ A;  1EL0 A;  5FLX L;  2B8F A;  3T4A C;  2R6G A;  2KCN A;  4OHJ A;  1SAP A;  1I50 B;  1BCP D;  1KAA A;  5A35 A;  1AFP A;  3GP7 A;  2AWN A;  4V19 0;  2ID0 A;  4TQU S;  3OWF A;  4XTC S;  2X69 A;  2TMP A;  4OO1 I;  3HZX A;  4XDX A;  1Q90 A;  3CRK C;  4NKL A;  5TSS A;  2KQ3 A;  2PO4 A;  1Q1B A;  3V96 A;  2EJF C;  5HGT A;  1U4P A;  3PIO 3;  2CW0 C;  3TBI B;  1LAB A;  1V1O A;  3MHB A;  4CKB A;  3TZD A;  5C4X B;  3L3O C;  2XWB B;  3P20 A;  1M8A A;  1SNP A;  3ZYY X;  1H9K A;  3SK4 A;  4Y7N B;  3PUX A;  4C56 C;  1ESR A;  2EOT A;  2OF1 A;  1ONL A;  1BCP B;  2EJM A;  2PW5 A;  1JWS D;  1EIH A;  1PTO C;  3M7N A;  4ZLT F;  4DXF A;  1ENC A;  1SNQ A;  4Q5V A;  1AN8 A;  3OW7 A;  4BA2 I;  4RHR A;  4M8A A;  3NBH A;  5KNC A;  3S2D B;  2B2U C;  3DXJ C;  3NP8 A;  3I73 A;  1E0B A;  4KV6 A;  3CQZ B;  1PTO B;  3GTL B;  3BDO A;  3SEB A;  1H9R A;  1Z47 A;  1SBB B;  2K05 A;  3ND8 A;  1G2S A;  3A7A B;  1XX8 A;  1EQV A;  4UAI A;  2D2C C;  4L8J A;  1SJE D;  1BXT A;  4RCN A;  1NR4 A;  3BVG A;  2HQE A;  1HUM A;  2ZT9 C;  2K5W A;  2PNR C;  1JOK A;  2J0T D;  4L63 B;  3HOX B;  2PZW A;  3NQI A;  3DM1 A;  3SK5 A;  4KD4 A;  4WFN 3;  5EPJ A;  3MXG A;  2AUJ D;  3JAM E;  4G7H C;  5IT9 E;  4IZ8 A;  3M4Y A;  2M00 A;  1WCM B;  4ID6 A;  1FNW A;  1JCK B;  3HP3 A;  1JB3 A;  1DCZ A;  3W2D A;  2E2I B;  1EEF D;  4OO1 G;  1SNM A;  1NCV A;  2HDM A;  4HMI A;  1QNU A;  1HA5 A;  4F7X A;  1CT1 D;  4IAL A;  1HQR D;  1SYC A;  3NQT A;  4PQX A;  4IUU A;  3J81 E;  1EYD A;  1O7L A;  3SK8 A;  5ELB A;  3KUP A;  4X3K A;  2QKI C;  4XXE A;  2R92 B;  2L0C A;  2RKS A;  2HCC A;  4JBW A;  4IUR A;  5KRU A;  5C0X G;  2JE6 I;  3I72 A;  2F0Q A;  2A69 C;  4BBR B;  3A8K E;  2IPK D;  1SYE A;  1F2Y A;  4A3I B;  2L55 A;  3LX0 A;  2DNE A;  3I4N B;  3URY A;  5K5P A;  1KNE A;  3RMH A;  2RDF A;  3MXU A;  3GO5 A;  4DK0 A;  1PZI D;  4HR7 B;  2KED A;  5ELE A;  3GTO B;  1ILQ A;  1D1K A;  3MAQ A;  5LHY 1;  3OPO A;  1JC7 A;  4KTA A;  3RLF A;  4A3K B;  4A3J B;  1LAC A;  4UDU C;  2PPB C;  3PUZ A;  1B3A A;  2WII B;  5DM7 3;  2B2Y C;  2WP8 J;  3T56 B;  1DD2 A;  1SMY C;  1PYW D;  1Y1W B;  5EQ0 A;  1QIL A;  4HSP A;  2K32 A;  1QE6 A;  1L0X B;  1RHP A;  1LTT D;  4TRD A;  4IFD J;  1SEB D;  3HOZ B;  2EYL A;  1D1I A;  4B9W A;  1NSN S;  4KK7 A;  3FKI B;  2XRQ D;  1JOO A;  3BG3 A;  4K6D A;  5E4X A;  2EYF A;  1E2W A;  2AQ2 B;  3GTJ B;  1E2V A;  3MXN A;  5EPL A;  4IFD I;  3MFY A;  5DNF A;  5CBE E;  3Q22 A;  2F0V A;  3MFG A;  1DOM A;  2WAQ B;  4NDX A;  3H09 A;  2JXM B;  2RA4 A;  5JOB A;  4DK1 A;  4OL7 A;  4CKE A;  4IUN A;  3VR6 A;  2GA4 B;  1RD9 D;  2F0S A;  3T51 B;  5JEA G;  4EQN A;  2WB1 B;  3R93 A;  4LK1 C;  3QB3 A;  3TZU A;  5CBA E;  5J39 A;  2NBF A;  1RKN A;  5KEE A;  4IFD H;  2BA0 A;  4HED A;  4F8M A;  4BA1 I;  4G57 A;  1S5D D;  1GUG A;  1LT5 D;  1H9S B;  5COR A;  2VNU D;  4BY7 B;  2D62 A;  1I4H A;  1EY8 A;  4TSS A;  4KY5 A;  1IL8 A;  2NYZ D;  5M3F B;  3C46 A;  1CFM A;  3TP8 A;  1WTQ A;  2QDB A;  1TU2 B;  5D14 A;  2EYP A;  1DOL A;  4BY1 B;  5A2Q L;  4A3G B;  2A6E C;  3P1H A;  4ODG A;  4O42 A;  2C9O A;  2DNC A;  3M3Y B;  4F87 A;  2IT1 A;  1XTC D;  1LT4 D;  2R61 A;  1TY0 A;  3KF8 A;  3TN2 A;  1R9T B;  4K8J A;  2F0E A;  1NAP A;  1LT6 D;  1EU3 A;  1UUP A;  3J80 L;  1HTP A;  4HTH A;  1STG A;  3TP6 A;  5I6W A;  5M9O A;  4RGM A;  1TVX A;  4FF4 A;  1PXU A;  4FNF A;  4B9X A;  1UNS A;  1CTM A;  2DN8 A;  1EY4 A;  1EFI D;  5IOD A;  2FMM A;  4FO2 A;  3FDT A;  3MEH A;  4XYQ A;  1VMC A;  2I07 B;  3MC0 B;  4QF4 A;  1FD7 D;  2Z4H A;  2F4I A;  3CU7 A;  4BWG B;  1LTG D;  4K5V A;  3GTK B;  4DAY A;  1PLF A;  1AZP A;  4R8N A;  1CQF A;  1DON A;  3T53 B;  5IGC A;  1AZQ A;  4OIJ A;  5BN5 A;  5DM6 3;  5T1I A;  1EY0 A;  4NMZ A;  3BYY B;  5I4D A;  2KA7 A;  3DMU A;  1STE A;  5G3L D;  1JR0 D;  1SE2 A;  4KHV A;  2VUM B;  1XWE A;  5C0X J;  5JVH 3;  4ZYS A;  5JEA H;  2F0F A;  2EYM A;  1Y1V B;  1BQQ T;  4IQZ A;  1B53 A;  1ZKO A;  1PDQ A;  3D4R A;  5J1Z A;  1Z6H A;  2K01 A;  4MN3 A;  3QOL A;  3UI2 A;  4CJ1 B;  5EBD A;  2KVM A;  3PUV A;  3OMC A;  4HCE A;  3R2T A;  2A69 D;  2JEA I;  1D2B A;  2B2V C;  1QWY A;  1ZYR C;  4LMQ D;  2K33 A;  2JYO A;  2F03 A;  4CHT B;  3QOJ A;  4BBS B;  3MVV A;  4PV1 C;  4N9T A;  1PRT B;  1EWH A;  2F0H A;  2B2W C;  2A5H A;  1SXT A;  5C3W A;  3WOF A;  3QWN A;  4RKL A;  3HOV B;  3S1Q B;  1F9Q A;  4WRD A;  2KUM A;  2SOB A;  3A55 A;  3TME A;  5T1G A;  4AYB B;  3KBX A;  3HRZ C;  4FXK C;  4KY7 A;  2MHV A;  4ABN A;  3S2H B;  1D5Z C;  4K5X A;  1Y8O B;  1BOS A;  5JJZ A;  1J9O A;  2CVR A;  2K28 A;  3SVM A;  1ZXT A;  4HAE A;  1JIC A;  1U4L A;  1S5F D;  2F0P A;  1Q1E A;  2AUK A;  4WOR A;  1W6J A;  2PMZ B;  4RGO S;  2KCC A;  3NPP A;  1TWH B;  1K8O A;  1D5X C;  2FHT A;  3CKI B;  1OXV A;  4C3I B;  3BZD B;  4KI0 A;  5C6A A;  2IX3 A;  2NN6 G;  1SNO A;  1AEX A;  1HFN A;  3VYR A;  5CV4 A;  5IIF A;  3VYS A;  1TY2 A;  4EQP A;  3Q23 A;  1EY7 A;  3MZ5 A;  4C3H G;  4XIG S;  1G29 1;  3KBG A;  1YNJ D;  2NTS A;  1QG7 A;  3IKJ A;  1I4Q A;  4DXG A;  2Q8T A;  3S14 B;  5CV6 A;  3DEO A;  1EY9 A;  3JAM L;  2ZXO A;  4H13 C;  1D5M C;  2J4X A;  1KLU D;  3H6M A;  3K5N A;  4PMB A;  1ET6 A;  2XN9 C;  2K6A A;  2EE1 A;  2JA7 B;  4IUT A;  2TSS A;  4IN3 A;  2K04 A;  4FP5 D;  4TKO B;  1FGB D;  4DNT B;  3BDL A;  3G6J B;  3ERO A;  4OO1 H;  4CJ2 C;  1S5B D;  1X3P A;  1I4X A;  1I4G A;  1YNN D;  2AQ3 B;  2ENB A;  4J1M A;  5CV8 A;  2F0J A;  1OXX K;  1XXG A;  3HS0 C;  5C0X H;  1HHV A;  2NN6 H;  3IFT A;  1K8M A;  1MSH A;  1A2U A;  1F2L A;  4FXD A;  2L1B A;  2QEJ C;  1HQM C;  5I2Y A;  2K1B A;  1GOZ A;  3H94 A;  1TR5 A;  1VMP A;  1O7Z A;  3O13 A;  3BS1 A;  3K7A B;  5C4Z A;  2A6H C;  2VB2 X;  2NVT B;  1STY A;  3M85 A;  3Q24 A;  1CQV A;  2L11 A;  1QCB D;  1H9J A;  5I9P A;  3EFX D;  4ME5 A;  4DFA A;  2A68 D;  1U9R A;  2PW7 A;  1WTW A;  4RWS C;  5M3M B;  5K36 H;  1ICW A;  2N88 A;  3NSW A;  2IW3 A;  1F9P A;  1ENA A;  1J8I A;  2XSC A;  5I2X A;  3D4D A;  2LMC B;  2QCP X;  5M5W B;  1V43 A;  2O5I C;  3L9A X;  3P75 A;  4KN7 C;  5KNB A;  1D6E C;  1CHP D;  2C5C A;  3U9O A;  3TP5 A;  5DAU A;  4XYO A;  4HCS A;  2EJG C;  4XQQ A;  3WOE A;  3HOU B;  4U68 A;  5AFW A;  3D4W A;  2EPB A;  3SHL A;  3A8I E;  1GHJ A;  2OXP A;  3E6Z X;  2K5D A;  3N52 A;  1B9M A;  1HPC A;  5ELC A;  1EU4 A;  4ZRZ A;  3S16 B;  4K8I A;  1V1P B;  3QG1 A;  3SXH A;  2V4D A;  2E74 C;  5IGB A;  2RSO A;  1IKM A;  5A2Q E;  1BO0 A;  4PMC A;  1OXU A;  3PUW A;  2G9D A;  3EQL C;  3ND9 A;  3I90 A;  2WKC A;  3DHQ A;  1V1P A;  1F2Z A;  3P7J A;  3QO2 A;  5FO7 B;  1A15 A;  3VR5 A;  1LTB D;  3IL8 A;  1I4P A;  2NUC A;  4RH6 A;  2Z1C A;  1ESF A;  4H7B A;  2F0D A;  3S9W A;  1BDO A;  5E3F A;  2CQA A;  4R8I A;  3EA6 A;  3K5O A;  3I70 A;  4ZUI A;  5CV5 A;  1MBY A;  4KKU A;  1Q8I A;  3FPU B;  3HG9 A;  3IFD A;  1PZJ D;  2Q8R E;  2EYH A;  3F2U A;  2A6E D;  1PTO F;  3NBI A;  4XQJ A;  3VA7 A;  3VA5 A;  2QF7 A;  2DY8 A;  2CW0 D;  3GTQ B;  1EZ6 A;  1KDB A;  2F0I A;  3R2I A;  4CJ0 B;  3V05 A;  5G3L F;  3DWQ A;  3D31 A;  3CRL C;  1B50 A;  1IHZ A;  2N55 A;  3ERQ A;  3K0Y A;  5EPK A;  2KEC A;  1O78 A;  1LV9 A;  4DAV A;  2PZT A;  2PYK A;  1ZYR D;  4EGV A;  2F0N A;  1VDZ A;  3D6W A;  4C3J G;  5K36 G;  1OO9 B;  1X3Q A;  2LKV A;  5E1F A;  4DA2 A;  4QB4 A;  4LJZ C;  1E2Z A;  5KYI A;  1LTA D;  4ZAI A;  1TT2 A;  1G91 A;  4G7O C;  3ITP A;  1W6K A;  2Z8L A;  4GZY C;  3GQB A;  4N9P A;  2NTT A;  4ZQ3 A;  2PCF B;  2ZXR A;  3VYT A;  4QIW B;  4FXG C;  1KAB A;  1A2T A;  1ML0 D;  3D3R A;  4YIJ A;  1EZ8 A;  2O2L D;  2E75 C;  4PMW A;  5HUR A;  2AQ1 B;  3HOY B;  3EVQ A;  2F0G A;  3SR1 A;  1PZK D;  5BN3 A;  3DUZ A;  1GUO A;  2A73 B;  1WTV A;  3KK7 A;  2EY1 A;  4M1U B;  3BVM A;  5EKK A;  3Q0A A;  1NR2 A;  1GXD C;  2VB3 X;  4QUF A;  1SSO A;  2LFN A;  3QIA A;  4DU9 A;  2F0T A;  2OT2 A;  4RGN A;  3I4L A;  2WAC A;  4XQN A;  1BR9 A;  4DNR B;  4IUQ A;  4ULL A;  4RCO A;  4ZUJ A;  2CHB D;  4X3T A;  5M5Y B;  2EY5 A;  1TII D;  1EWC A;  1TWF B;  1VCI A;  5NUC A;  1GUS A;  2NZ1 D;  3L7Z C;  3BYT B;  1TWA B;  1II3 A;  2BCO A;  1S5C D;  2WV6 D;  1HRJ A;  3N6R A;  3H0G B;  1EYC A;  4DGZ A;  3S15 B;  1OXT A;  3R8B A;  2KEE A;  1A6X A;  4OGQ C;  3DEP A;  3RUZ A;  2JP1 A;  5CGK A;  2RDH A;  3MA2 B;  1CI3 M;  3MWY W;  2MUY A;  3RZD B;  1YNJ C;  3PUY A;  2EYJ A;  5EBC A;  2B2Y A;  5C4J B;  3CHB D;  4R9W A;  1BBX C;  4RAU C;  1AP0 A;  3U9S A;  3ONA B;  5FO9 B;  2B2U A;  4XT3 B;  5J22 A;  2WKD A;  4LAA A;  1MSG A;  1PMR A;  1O80 A;  1JWM D;  3LNN A;  2B63 B;  4KD3 A;  1DOK A;  4FVM A;  2F0U A;  2JSO A;  2K7V A;  2IX1 A;  4KMU C;  1SJH D;  2L5T A;  3NWT A;  2EZV A;  1A3V A;  4MIU A;  1WTX A;  3H91 A;  4ZKC B;  2E76 C;  2KHS A;  5CYU A;  5CC4 A;  3NK9 A;  3D6C A;  5FO8 B;  1JWU D;  4HMJ A;  3AMU A;  2K5Q A;  3VR2 A;  2QIL A;  4ZK9 B;  1SDF A;  1TWG B;  2Q8I B;  5C5M A;  3S1R B;  2SEB D;  2JA8 B;  2MPM A;  3V2T A;  4K5W A;  1WD0 A;  5CV7 A;  1IYU A;  2A6H D;  1STH A;  1T5X D;  3X3M A;  1ROD A;  1WD1 A;  1PFB A;  1ENF A;  3NTK A;  4IUP A;  1SYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...