1PTOF

The structure of a pertussis toxin-sugar complex as a model for receptor binding
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
98
structure length
98
Chain Sequence
b'LPTHLYKNFTVQELALKLKGKNQEFCLTAFMSGRSLVRACLSDAGHEHDTWFDTMLGFAISAYALKSRIALTVEDSPYPGTPGDLLELQICPLNGYCE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PERTUSSIS TOXIN (SUBUNIT S1)
molecule tags Toxin
publication title Structure of a pertussis toxin-sugar complex as a model for receptor binding.
pubmed doi rcsb
total genus 17
structure length 98
sequence length 98
chains with identical sequence L
ec nomenclature
pdb deposition date 1994-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF09276 Pertus-S5-tox Pertussis toxin S5 subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ptoF00
3DWAA 3BYYB 2AQ1B 1RDPD 1LTTD 1SXTA 2RDHA 5ELDA 3OWEB 4RHRA 1TS2A 2G9HD 3EFXD 3MFGA 1BXTA 1EEID 1ET9A 1EFID 1AN8A 1PRTC 1D5ZC 3EA6A 5ELEA 1PZID 1I4XA 1B1ZA 1HTLD 1F77A 1TY2A 3SEBA 1BCPF 2AQ3B 1LO5D 2J4XA 2XRQD 1HA5A 1I4QA 4UDUC 1CQVA 2IPKD 1TS5A 1PTOD 1M4VA 1S5DD 3TSSA 2QEJC 1B44D 1I4RA 2ICIA 1EWCA 1D5XC 2CHBD 2WV6D 1RF2D 3R2TA 1PTOB 1UNSA 2Z8LA 3KLSX 5ELBA 3URYA 1S5CD 4C56C 2NTSA 3V05A 2R61A 1TY0A 1EU3A 1KLGD 4RGNA 1T5XD 3BZDB 3BVZA 3CHBD 1SJHD 1FNUA 1PTOC 1SEBD 2SEBD 3R8BA 3O13A 1LTGD 1LTAD 5FKAC 1DJRD 2NTTA 1SJED 1ESFA 1LTSD 1LTRD 1LTBD 2IJ0A 3R2IA 1PZJD 1PRTD 4L63B 2O2LD 1RD9D 1CT1D 5TSSA 1V1OA 4RCOA 4RGOS 1SBBB 1BCPC 3BVMA 3GP7A 3W2DA 1I4HA 1XXGA 1HXYD 1JWUD 1PRTB 3DWQA 4RHSA 1CK1A 1AW7A 4RGMA 1FGBD 1LTID 4TSSA 1TS3A 4ZYSA 1SE2A 4Z9CB 1QILA 1JQYD 4OHJA 4RGTA 1L0YB 1V1PB 1JWMD 1G8ZD 1S5ED 1LT3D 1FNVA 3BVGA 1EU4A 1JCKB 1LT4D 1STEA 2AQ2B 2TSSA 1BCPD 5ELFA 1BCPB 3DWPA 4DXGA 5I4DA 1CHPD 1RCVD 1EEFD 2QILA 2XRSD 1MD2D 1FNWA 1LLRD 1S5FD 1GOZA 1PTOH 1JWSD 1LT6D 1KTKA 4K6LA 3BYTB 1PTOF 1ET6A 1CHQD 1DYQA 1ENFA 2XN9C 1D6EC 1D5MC 1PRTF 4RH6A 1JR0D 1SE3A 2RDGA 1I4PA 1PYWD 4DXFA 1V1PA 1FD7D 5ELCA 1PZKD 4O1NA 2XNAC 1KLUD 4BWGB 1I4GA 1SE4A 5D3DA 4L6TB 5D3IB 5FK9C 1TS4A 3MC0B 1HQRD 1LT5D 1UUPA 1L0XB 1XTCD 1S5BD 4RFBA
chains in the Genus database with same CATH superfamily
5FLXc 3LWEA 4DR6Q 1AE2A 2M2LA 1I6HH 4OIKA 2NN6G 4A3IB 4G57A 1YVCA 1G291 2K32A 1KNAA 3SE0A 1D7QA 1N9WA 4A3GB 2MGSA 3KF6A 1VQFA 2KJXA 1PZID 1Y1VB 3F2DA 4QIWE 5J3BA 2WKCA 2QEXA 4A93H 2N3SA 4A3DB 4G7HC 4GKKQ 2AQ3B 2H5XA 3S2HB 1HA5A 2CKZB 5FLXL 2RHQB 1UE6A 4L5SA 1G6ZA 3TSSA 3OW7A 4B3TQ 3HOZH 3URYA 2ENBA 3N52A 3EIVA 3HOUB 1QNUA 5GAGC 5C4XB 5M5XH 3I4MB 4P72A 1N33L 2ATWA 4A3KB 2NTTA 3H0GH 3CU7A 5M5YB 1LTSD 5IT9c 1LABA 3BZCA 4JI1L 4F88A 3H09A 4X62Q 1I50H 4P73A 4Y52H 1WTXA 3L2PA 4DNRB 2PNHA 4H13C 4RHSA 4CHTB 2XWJB 3DUZA 2HDLA 4N8X1 4S3SA 1JJ2A 1QILA 2UXCL 2CH4A 4A3JG 3MEHA 4JI0L 3BVGA 3HRZC 4CDDC 3DEOA 4A93B 2I5HA 1CFMA 3A0JA 1KL9A 1EIHA 5I4DA 1G2SA 3TP5A 1Y8PB 2DGYA 2HDMA 1SRUA 5G3LD 2I0QA 1JWSD 1KTKA 1A63A 4B3TL 1B4OA 1CHQD 4DK3C 4AIMA 2F3IA 1I4PA 5GAEC 5GQOA 3I4MH 1V1PA 1XMQL 2UU9L 5AFWA 3S9WA 4DV0L 4IUTA 3DLLA 2IX1A 4IPDA 1SE4A 3KOJA 2Z4IA 4LUVA 4OIJA 2F0JA 3HGBA 2Z6KA 2FMCA 4JC0A 5CV6A 3CC7A 4M1UB 1Y14B 1SFOB 1HJPA 4QQBX 4UY8C 5DM63 3ULPA 3DWAA 2JA8G 1X55A 3AMUA 4IUVA 4LUZA 2D0PA 3NUCA 4DF7A 3UDXA 5T1GA 1QUQB 1RJTA 2A69C 1OO9B 4RCNA 3RZOB 2KEEA 1AP0A 3EA6A 5ELEA 1AZPA 3Q0AA 1U5KA 4DK1A 3KF8A 3D8GA 2NN6I 2XTIA 1J5EQ 4LFBL 1XNQQ 4IN3A 3GQBA 3UDFA 2HD3A 1W2BA 1GUGA 2B2TC 2QEJC 3NBHB 4MTKA 3NE5B 4AQYQ 2BDOA 1NBWA 2Z8LA 4C3HB 3S1MH 2DNEA 2FHTA 3K8AA 3BZDB 4FF2A 3BVZA 3S15B 4OL7A 5I2XA 1YNND 5EKKA 3WDNA 2K28A 4A3LH 1H9SB 1VQDA 3I8ZA 1LTAD 3PIOA 3CCRA 2R3ZA 4DA2A 5HY6A 1A3UA 4DR2L 1CUKA 1VQBA 4Q0FA 5JJKA 1RD9D 2CVRA 4CKBA 4GN5A 1K28A 1HZ9A 4JYAQ 4DR6L 3H0GB 3NEMA 2E74C 5M5YH 2K03A 4PZ7A 1WD0A 3DEPA 5I2YA 5LMNQ 1CKNB 3K7AB 2D5DA 3CCQA 4M8AA 3TZUA 5K36H 2EPBA 3NWSA 2JYOA 1VQ8A 3M3YB 1JT8A 5FLMG 1IW7C 5ELFA 4HIMA 5CV9A 1QZGA 2RKSA 1YJNA 4B08A 4BBRB 1L1OC 1BF4A 2B63B 5IGFA 1MD2D 4RKBA 1BVSA 2L55A 5C44B 4JBKA 4CDCC 3I56A 1BBXC 3TP6A 1YBYA 1FJGQ 2MO1A 5IIFA 3E3XA 5LMUQ 3IFDA 1WOCA 3OOCA 1CI3M 3OW2A 3NSWA 4NDXA 4GLXA 3U58A 3MA2B 1VQCA 3P7JA 3TREA 2KCMA 4N9TA 1UUPA 1MSHA 3A5ZB 3HKSA 3N6RA 1YNJD 2K50A 3QR8A 2PI2E 5LMNW 3PUZA 2VUMB 1LTLA 3STBC 5ELDA 2PQEA 1VMPA 1U4RA 4WJ4A 4HCSA 4HIOA 2MP1A 4KJNA 1TXYA 2QF7A 3SK6A 5KIXA 2JA5G 4LNQA 1STAA 1N8RC 1PRTC 1KIXA 4K5WA 3NTHA 5JOBA 4CDFC 1JORA 3SEBA 5IE8A 2J4XA 3PO3G 1Q46A 3ZYYX 4DUZQ 2OT2A 1PTOD 1S5DD 5H1SE 1SNCA 2L11A 1D5XC 1E2WA 1II3A 1STYA 1EQVA 4ID6A 1PDQA 3P75A 2X69A 3OPOA 2A5HA 1T5XD 4LFBQ 2GVBA 4DNTB 1EY4A 2BE5C 1HR0Q 2EYFA 1Z6HA 4HJ8A 2BH8A 5I6YA 5IP7H 2A8VA 2RCNA 4XT1B 2HUGA 2A6HC 3J7AV 1SNPA 4FP5D 2N78A 4WRDA 1HNZL 1EY6A 1EY8A 4RGOS 3S1NH 3OWFA 1JB3A 3WOEA 3CC2A 2B39A 2JA5H 1TS3A 4GS3A 4R4QA 3HOXG 1LT3D 5IOCA 3D31A 5K36G 2CWPA 1K8MA 3C3LA 2JA6H 4HCEA 2F0OA 2X6GA 4R4IA 1ZKOA 3HOYG 4GOPA 4KKTA 3FPUB 2QILA 3I7FA 4A3FG 4QGUA 1IYUA 2DJGC 1H9KA 3C2PA 1X9NA 2Z4HA 5IT9L 1L1OB 4KI0A 4DKAC 3GV6A 1STGA 4WJWA 2SNSA 2EYHA 4DUYQ 1FD7D 3J80E 3GTQH 3P20A 2A6ED 3MWYW 1YHBA 3J80i 4IALA 2FXQA 4R8NA 1TWGB 1X3EA 1IBKQ 3NP8A 4LF4Q 2DNCA 2PCFB 4KN4C 3MC0B 2DJFC 1ICFB 1U4MA 4ZK9B 1WTOA 3M7GA 4FVMA 3GDEA 4JG2A 5BR8L 2WINB 1Y1WG 1ONLA 4NB3A 4DV2Q 2I46A 4HAEA 2IT1A 3PUXA 5LHY1 4DFAA 3NQTA 1WI5A 1TS2A 3KFUA 4C3IH 1E2ZA 4KLKA 4OX9Q 3FPPA 1SE8A 2KQ3A 2OEOA 2E2IH 4HJ7A 2H1EA 3CCUA 4UDUC 2B8FA 2R7FA 4I7ZC 3PO2B 5IYBG 1EWIA 3S1MB 1VQIA 2ICIA 1JOKA 4JI4Q 3K81C 4C1NI 1PTOB 1UNSA 2UXBQ 1JICA 4C56C 1JE5A 4L5QA 5BN4A 1FJGL 2QDLA 5IGDA 4LF5L 4LFAL 3JC66 1F9RA 2WAQB 3QOLA 1W6KA 1A8VA 4DPGA 3A56A 2R6GA 4A3CH 4IFDG 3I2ZA 4JBJA 4PQXA 3CMAA 4JOIA 1Y1WH 2AWNA 4DNIA 1M1KC 3L3OC 2EY1A 4F7XA 4UP9A 4XYOA 5FLXE 5HURA 1YHAA 2EY5A 1SAPA 3D6WA 4TSSA 3QB3A 1JQYD 1TVXA 4JV5Q 1JWMD 4X66Q 1QB5D 2K14A 1WTHA 5KEEA 3T53B 4EVOA 4IOAA 1LT4D 2ZJRA 2KHIA 1BCPD 2F0NA 2K75A 3M4PA 3VA5A 2B2YA 4F87A 3AU7A 1FGUA 4YY3L 4KN7C 5EBCA 4CJ1B 4TVAB 3H3VC 1IL2A 3T51B 3ERQA 4AH6A 5C3EH 2B3GA 3I73A 5M3FB 4I7AA 4C2MB 2B2VC 4NW2A 5EAYA 2RDGA 4IPCA 3AQQA 2OF1A 2K5NA 3S17B 4DK6C 1V43A 4A4IA 4JCVE 1A15A 3D0FA 1SNQA 5C4ZA 2F4VL 3DHQA 3LWUA 3IKJA 2VUMH 3UI2A 3J81L 3NTKA 1TWAH 3KLSA 1VQLA 2XIWA 1C4QA 1X3GA 1JJCB 4POFA 5C4JB 3HOUG 1EFWA 2K1BA 1SYFA 4OO1I 3AB9A 5CBAE 3K59A 2FMMA 4DU9A 1GUWA 2SOBA 2G9HD 3PQIA 3FEWX 3SGIA 3S1RB 3FDTA 4A3KG 1I4XA 1F2MA 3TEHB 4KMUC 1EIYB 3PO3H 1F77A 3SK4A 2XRQD 1WTQA 1HUMA 2BE5D 1PFNA 3CCEA 1SFOH 1Y69U 3V96A 1B44D 1CZGA 3KDFA 1KHIA 4OONA 2HHHQ 1QWYA 3F8TA 2PMZE 3A74A 1S5CD 2E2HB 1EU3A 4DUZL 4A3JB 4GNXA 1NR2A 1PTOC 3R3OA 4DN4M 3ITPA 3HS0C 1GHKA 1GD7A 3O13A 1GUOA 2EYPA 3WOFA 1W3SA 1EY9A 1LTBD 1LTRD 4TRDA 1PZJD 1PRTD 1SYBA 1F2ZA 1R4QB 5T1IA 1SN8A 3UE0A 1N34Q 3AYHB 2VW9A 1YITA 5DLQE 3SK8A 3BVMA 3MXGA 1Y8OB 5JJLA 1EIGA 2VNUD 1JWUD 5ELNA 2KUMA 3STBD 3DM1A 2XGTA 1AW7A 1CK1A 4JI3Q 4YIJA 3K5NA 4OHJA 3J80c 4BA2I 2L12A 4JI8L 4R4TA 1LACA 1EU4A 2O4XA 2BCOA 1STEA 3RZOH 4YHHQ 1K83H 4IO9A 5M3MG 1MGSA 2GVAA 3R93A 1I6VC 3K5LA 1ZYRD 1SROA 4EQNA 1XNRL 4IFDJ 1PLFA 3VYRA 2RVLA 2MPMA 3D4RA 1CKMA 1U4LA 2Z6BA 3NQIA 2F52A 2WB1G 3CCMA 1E7ZA 2KA7A 3D4WA 1G6PA 2F0FA 2OCEA 5LL6S 1VQ6A 4LFAQ 3I4NH 4K5XA 1XMOQ 2KCTA 1BOSA 1AH9A 2A19A 3IFTA 3ER0A 3BDLA 3PUYA 4R1JA 3VR4A 3GTMH 1TWCB 1BXTA 1ET9A 4IPHA 3RNUA 2EYJA 1KDAA 2LFNA 4A3IH 1TY2A 4YCUA 4JPBW 3BDCA 4A3MB 2OTLA 3M7NA 4ZLTF 3W1GA 1WCMB 1PXUA 2VZAA 2NVXB 1YNNC 4ZAIA 1M4VA 1WTVA 3HKZE 2UUCL 4DV6Q 5D14A 4Q5VA 4BY1B 2PQAA 1EIFA 4NP5A 1R9TH 1N36Q 5HGTA 1D2BA 2E2JH 3RLOA 4IUNA 4RWSC 4DR5Q 1WTRA 2XVSA 1FR3A 3GO5A 1PH1A 2PZUA 2CFMA 4ZCKA 3OTOL 3K5MA 4RMFA 1DJRD 3EROA 4AYBG 3I70A 2E5LL 3JAML 2O2LD 2UUBQ 4DV3Q 1O7IA 1TR5A 5C0XJ 1AE3A 2A69D 3G6EA 3GTGH 1PH2A 4CJ0B 5CV7A 2RF4A 1XMOL 4LAAA 2F0DA 1DGSA 3GTKH 3E0EA 3CCSA 1OXXK 4NXNQ 1B70B 1L0YB 1PMRA 2MUYA 1PVOA 2F0VA 1GKHA 2E75C 3GTLB 4ZKBB 1SSOA 2AQ2B 4APVA 1MSGA 1HNXL 5J22A 1U4PA 3UE1A 2KOLA 1EOVA 4C1NK 2O5JC 3BJUA 3M85A 3KJOA 4DV7Q 2HHHL 3FP9A 3RZDH 2UXBL 1EOTA 2VXWA 2E76C 1R9TB 5JPNC 3H15A 4KY6A 4DXFA 3EN2A 3CCLA 1VDZA 2K6AA 5COYA 4A93G 1C48A 4G4KA 1A0IA 5GROA 3OTOQ 2GA4B 4PNYA 2HCCA 4KJOA 4A3CG 1L0XB 3QJYA 2IHEA 4HR7B 2MJ8A 4DV1Q 2PPBC 5JEAJ 3U9SA 1VMCA 4ZUIA 2JA7B 4RHRA 3TZDA 5C6AA 1H9SA 4IUQA 5KYLA 1PH8A 3I4OA 1ESRA 3GTOB 1D5ZC 4X62L 1ASYA 1Q7YC 1CSPA 3HOWB 2NVTB 3NBHA 1CKOA 3TQYA 3CRLC 1BO0A 2OTJA 3NTIA 3IL8A 1DOMA 3KJPA 1XNRQ 2C5CA 4OWWB 1FNUA 4B3RL 1C0AA 2LY7A 1M90C 4C3JB 3A54A 5C4XH 5IYDG 4BXXG 3WWVA 1VQJA 1T5EA 3PCOB 2JE6I 2IJ0A 3R2IA 4Y7NB 4R8IA 4GKKL 2F0SA 4L5TA 2Q8RE 1CT1D 1O80A 4GOPC 1VQMA 1BCPC 1NTGA 2EVBA 3MZ5A 4LFCQ 3GV3A 2ZTEA 4ILWA 1YNXA 3VR2A 1JJGA 3PGZA 1B2TA 4DV3L 5A2QE 1PFMA 1G8ZD 1VQHA 1S5ED 4R4CA 2KVMA 5CR3A 3CAMA 3G7LA 1JCKB 5FO9B 1NE3A 5I9PA 1XYIA 2A74C 1Y1VH 1Q82C 1KDBA 5JJIA 1B9NA 4MNOA 2JA8H 3G4SA 2EXDA 3MVVA 4NKLA 3M9BA 2JA6B 1N36L 3L0OA 3VYUA 2X6LA 3GTJH 1D5MC 1J5EL 4DAMA 3T13A 1SYDA 3ERSX 2KCNA 3FVQA 5DM73 4P75A 3LGJA 2L15A 4F8MA 1HZCA 3TBIB 1EYAA 4CKEA 1QVCA 1LM0A 2NZOA 3CW2C 3ICEA 3BU2A 3JAMc 1JE4A 2KHSA 5CBEE 3EJIA 1UEBA 5JEAG 1PH5A 2F0LA 2E5LQ 4LF9Q 3MFGA 5C3XA 3T4AC 3FKIG 3ZJYC 4MTNA 4JI8Q 4JYAL 4GLVB 1ENAA 3K80C 1H9RA 2Z6KC 3CPWA 2IPKD 3SXHA 4BS9A 3X3NA 4DR1Q 1E2VA 3HOWH 4JOIC 2EY2A 1X56A 2KBNA 4O2DA 1MBYA 2QCPX 5C3EB 1PFSA 2UXDQ 1VQNA 2KEDA 2A6EC 3J81j 2R61A 1CQFA 5A35A 1Q12A 1KLGD 3A5UA 2WKDA 2BH2A 1X3QA 4AYBE 4A3GH 2JN4A 4MZ9A 3M3YH 2EXZA 4X3KA 5KNDA 4ZUJA 2L1BA 3EQLC 3EVQA 3V2TA 2JQOA 1RTOA 3I72A 3J7AF 1L1OA 1SBBB 3HOZG 1RODA 5IP9H 2CQOA 5M5WH 1O7LA 3I4NG 1B53A 4RGMA 1I3QH 5DEHA 4ZYSA 4KD3A 1K8AC 1QOHA 3J81c 2NZHA 1VCIA 4U673 1A6XA 1UE1A 2LS01 4YCWA 1HZAA 1IKLA 3A55A 4A3EB 2R7DA 2WB1E 4IFDH 2AMCB 3S1RH 1BUVT 2PMZB 2B2UC 3W1BA 1KD1C 4KHVA 3MXNA 4A3IG 4IFDI 2K52A 4FXGC 1Y8NB 1FNWA 2ZT9C 1IBMQ 1E0BA 1NCVA 3U9OA 3CKIB 2JK8A 4QUCA 1DYQA 2SNMA 1ML0D 2VQEL 4B3RQ 2MFIA 2E2HH 1GM5A 3SVMA 2NVXH 2R93G 2JA9A 1MI2A 3G48A 3KBXA 4A3FB 2R7ZG 1CKNA 5FOBB 1QE6A 4JI6Q 1K83B 1LYLA 1XMQQ 5LMUL 1XTCD 1VQ9A 1HR0L 2A68D 4H44C 2JSOA 3BYYB 1XPUA 3HOVB 2Z9HA 4XQJA 1JB7A 4P74A 1D1IA 2GN5A 5JEAH 3JAME 4H7BA 5KGUA 2B2WA 1KNEA 1BR9A 4DV2L 3S1NB 1GHJA 1OTCA 5JVH3 3E0JA 3VR5A 1EL0A 1VS0A 4UHVA 3OSOA 4IUPA 4JK1C 1HA6A 2EJMA 3KLRA 2JA5B 2IW3A 1J9OA 2WV6D 4K5VA 1KRTA 5LMNL 1A2UA 1TY0A 5ELOA 2WFWA 3PMFA 4C3JH 4JI5L 4BY7H 3CHBD 2UUCQ 2G5DA 4OO1H 2F3WA 2IWHA 1CSQA 1BBWA 2YTYA 4OXPA 1WTPA 3TS0A 4A3GG 2ASBA 3PF4A 4OWTB 1G91A 3W3AA 1UAPA 1X3PA 5KYIA 1I94Q 2V4DA 5IY0A 5GAHC 3PUVA 1E3PA 1HTPA 2NUCA 2ZM6L 3KF8B 3IAYA 1IW7D 4K0KQ 4IURA 3EBEA 3GTQB 1PRTB 1MKHA 1LTID 5C5LA 1PFBA 2EDGA 4B3SL 2HIXA 2LMCB 3FRPB 3S15H 3H3VH 3HKZB 1VQEA 3PSIA 3CQZB 2TSSA 2J0TD 2JA8B 1EQQA 1K8GA 3NWTA 1EY0A 3T56B 2A6HD 3J81E 1VQ4A 3GTJB 2EJGC 1TWFB 3GTPH 1LT6D 4K6LA 4BY7G 1ET6A 3SHLA 1DOLA 2XN9C 3T1YL 1STBA 1UE7A 3PV0A 1IYVA 3NELA 3I3CA 1O78A 4DV7L 2UUAL 1P16A 4J15A 4WJ3M 3HOYB 2R92B 4BWGB 5IODA 3KLWA 2UXDL 5K5PA 4K6DA 4JI2L 1VQGA 4BXXH 5IYDH 1V1QA 3E9IA 4BY1G 2RQXA 2PO4A 2Q2IA 3KYHC 4BBRH 2RBMA 1WTWA 1A3VA 2ZM6Q 5JAVA 1LTTD 5C44H 1CZWA 2CWAA 4DR3Q 5C0XG 4DV4L 1HRJA 5CV5A 1BNZA 2VS1A 2ZXRA 3K7UC 3S16H 3OYYA 3QWNA 1YNJC 1LO5D 3H0GG 5E1FA 5J1ZA 3I55A 4L8JA 1PYSB 4YWMA 1IXRA 2I5MX 1SLJA 4RKLA 2RDFA 5AJ3L 3R2TA 3RZDB 2B8GA 4KHPL 2NTSA 3OMGA 2OXPA 4GNXB 1SJHD 1WVLA 1KAWA 4ZRZA 2SEBD 1RKNA 4QY7A 4OX9L 2F0WA 4P71A 3A7LA 3UDGA 1K3BC 2PW7A 3MXUA 1B8AA 1HHVA 1P8LA 4IUUA 1K3RA 1I3QB 3GP7A 2J7ZA 1XXGA 4MHEA 1QZHA 3DWQA 2WAQG 3MAQA 3S17H 1SNDA 1X6OA 1FGBD 1IZ6A 4P2CB 4NMZA 2IHFA 4XDXA 5CORA 5NUCA 5IP7G 4IQZA 3S1QH 2EQSA 4LFCL 2ES2A 3S16B 2YYZA 3GTOH 2VUMG 3DWPA 1Z47A 1CHPD 1RCVD 3KF6B 4QIWB 1B9MA 2PNRC 1GOZA 3GTLH 4QMGA 5IYCH 5CV8A 2WAQE 1S40A 1Z7TA 2A73B 3OHXC 4HEDA 1NJIC 2ZXOA 1GO3E 3CC4A 2OQKA 5CV4A 4DR7L 1BKBA 4BBSG 1PZKD 2R7ZH 2F0QA 2B2TA 3S24A 2F4IA 2L4NA 3HOYH 1WJJA 3C1EA 2RHSB 3MXNB 3TP7A 1JOOA 1K9MC 4KV6A 4A3DG 1K73C 1ZYRC 1RDPD 5EPLA 4BBRG 4NXMQ 1B3AA 1HNWL 1N32L 2B63G 3PIO3 1EYDA 1F9SA 1AZQA 4N8FA 2ALYB 3VYSA 5KRUA 4X65L 1RTNA 1EEID 1EFID 4LK1C 2PI2A 4B3SQ 5EGTA 4CJ2C 1VQAA 1B50A 4R4OA 1B1ZA 1GVPA 4IPGA 4N9PA 4LF8L 2EJFC 3NENA 3P1HA 2A1AA 2F0KA 4DV4Q 1PV4A 2LKVA 1FVIA 4TQUS 1DONA 3CXCA 4WORA 2BA1A 5C4JH 3T16A 4ABNA 2PZWA 3C1FA 1C7YA 2ICEC 4E6IA 4GKJQ 4RGNA 3K0YA 4POGA 3CMEA 3CF5A 4XQNA 5M3FH 2NVYH 2ZTDA 1MJEA 2MO0A 5AJ3Q 1KQSA 5FKAC 2F0TA 3S14B 1SJED 2JEAI 2HT1A 4GLAC 1XJVA 1OXUA 3KDFB 1XNQL 4QCLA 1QVGA 3I90A 3H91A 1ICWA 1IL8A 1MJCA 1STHA 4RAUC 1J6QA 1I4HA 5E3FA 2K4KA 1F2YA 2K5HA 3CD6A 1LV9A 1XWEA 3NK9A 1LUZA 3H3VI 3TMEA 3MFYA 1IBLL 1UE5A 4A3BB 2AUJD 2EIFA 1ILQA 1YIJA 1KABA 1PA6A 3FMCA 1TWHB 4PV1C 5E4WC 4QL5A 4LF6Q 2ZJQA 4JI1Q 2XRSD 4FXDA 4GZYC 5I9OA 1Q81C 2KECA 1X3FA 3BYTB 2K01A 1VQ5A 4KY5A 4NPSA 3QO2A 3FKIB 4WFN3 4QUFA 1AEXA 1X54A 1PYWD 3Q24A 4A3JH 5ELCA 4XQQA 1KLUD 1E1TA 4IJLA 1S3OA 4IZ8A 3U50C 2CQAA 4BY1H 5D3DA 1PYBA 3Q23A 2XWBB 4DAYB 3KBGA 4HIKA 2VQEQ 1SMYC 2WIIB 1ZXTA 1LT5D 4R9WA 4EQPA 4DV6L 1NR4A 2UUAQ 2B2YC 2E2JB 4A3DH 2WP8J 2XSCA 1WFQA 4HJ5A 2LXKA 1TIID 2WB1B 3OWEB 2LXJA 3F2BA 3PO2H 1VQPA 2UUBL 3M4QA 4CDEC 4KD4A 1EY7A 4XYQA 5FO7B 4O42A 5C5MA 3GTGB 1X65A 3NBIA 2B29A 1Q8IA 1I4QA 1Q3LA 5JJZA 1HZBA 1W6JA 3QOJA 4YCVA 3L7ZC 1E24A 1TWAB 1BQQT 1EWCA 2L5TA 3F2UA 3GTKB 3T1HL 2IX3A 3I4NB 4BA1I 1IHZA 2NVQB 4JVZA 1Q90A 3HOXH 1Y1WB 2ZXPA 1EUJA 4OEMB 3A8IE 4G7OC 2QW7A 4FXKC 2MNAA 4FNFA 1YHQA 4KHPQ 4KK7A 2FFKB 2VY3A 2NVYB 4FYDA 4JI5Q 4DR5L 2SDFA 1R4PB 2Y0SB 1VF7A 1NAPA 4PZ8A 4ODGA 2UXCQ 1RL2A 5TSSA 1C8CA 1QG7A 1QVFA 3MXPA 4A3FH 3S14H 3VA7A 4ME3A 1UWVA 5CMDA 2F0GA 1PH3A 4GOPB 2RSOA 4OELB 1WD1A 3ONAB 2V1CC 4Z9CB 5C44G 4X64Q 1VQ7A 1TT2A 1SMYD 5IGGA 1FNVA 2NYZD 2D62A 2PQAB 2KCCA 5M5WB 4A3LG 3S2DB 2I07B 5EPKA 4K2LA 5IGBA 4NXNL 5GADC 3PIPA 5IYCG 4HIDA 1HCZA 5E4XA 4DUYL 1KRSA 2EE1A 4OGQC 4A3EH 1H9JA 2M9VA 2BA0A 1EY5A 4KKSA 4RH6A 1XPOA 1SE3A 3RR5A 4C3IG 5LL6X 3A8KE 3W5OA 4O0AA 1I6HB 5FK9C 4DR4Q 5IYBH 3RN5A 4I65A 3J7ZC 4B3MQ 1V8QA 5M3MH 5DAUA 1NUCA 1BDOA 4AQYL 4RFBA 3Q6SA 2CH4W 4K0KL 3TRZA 2HCIA 1YJ9A 3PO3B 2F0HA 3OIQA 1RHPA 5ISRA 3B6YA 5EJWA 4CGYB 2Q2TA 3S2HH 5D65A 4X3SA 4B9WA 1YI2A 5C4XG 2PYKA 4X3TA 5F2DA 4DR2Q 1HH2P 1DZ1A 2F03A 1HNWQ 1N32Q 3CQZH 1G51A 5KNBA 2CW0C 4DR3L 5M9OA 4X65Q 1A3TA 4UP7A 1SDFA 5EPJA 2RCFA 1HFNA 2N8NA 3NXWA 5BR8Q 5CGKA 2CHBD 3F1ZA 1RF2D 1O7ZA 5IWAQ 3GTPB 1O7YA 3E6ZX 4YWLA 1NMFA 4LF7Q 3M4OH 4ME5A 2EZVA 1F9PA 3L9AX 1SYEA 2ZJPA 1A2TA 1GXDC 3AEVA 3SK5A 2OQ0A 4PMBA 5IT9E 1HNZQ 3GTMB 1PH6A 2KHJA 3G6JB 2YV5A 1Y1VG 1EYCA 1GJXA 3HOXB 4L63B 1A62A 2CCZA 4KHZA 5C3EG 2AKWB 4JV5L 3X3MA 2IY5B 2NWGA 3BS1A 2HIVA 4C3JG 4H0LC 1DD2A 1DOKA 2HQEA 2Z1CA 1EQRA 3HP3A 2WACA 3TS2A 2B63H 2F0IA 5JPMC 2R92G 2L9HA 3TDQA 4MN3A 1IKMA 2E2IB 3I4MG 1OXTA 1QNKA 5KNCA 2NB0A 2Z0SA 2Q2UA 2RA4A 3LX0A 4LF4L 3DXJC 1BCPB 3KK7A 1EEFD 2Q8TA 3SR1A 1S5FD 3HOUH 3F2CA 3PUWA 2EY6A 3BDOA 2NBFA 1PTOF 3ND8A 1D6EC 1JMCA 1DCZA 2RSNA 4A3MG 2DN8A 3ULLA 2XNAC 4DV5L 2K5QA 1DXMA 5D3IB 1ASZA 2JA6G 3G71A 4IOCA 4FF3A 2K7VA 1HQRD 4OWXB 2YU9B 1HQMC 4YWKA 3MHBA 4GNXC 4JW0A 2O5IC 3PO2G 2RDHA 1C9OA 4HSVA 4FF4A 3H6MA 3KUPA 4K8IA 1K0RA 5M3MB 3RN2A 3JAMi 3D3RA 1IBLQ 3S1QB 1K0SA 1NMGA 1I5FA 4LW1A 3M4YA 5EKIA 1YJWA 4FO2A 5A2QL 2K5WA 2R7ZB 1B3QA 1X32A 1S72A 1BCPF 3MEFA 2VB3X 1TS5A 2OWOA 5CYUA 4LF5Q 1TWCH 3D6CA 3GD7A 4J6HA 3HOVG 4X64L 2VQFL 5ELBA 2N49A 1VQOA 3KLSX 4A3BH 3V05A 3MTSA 5FO8B 1U9RA 2N55A 4UP8A 5FJ8H 1SEBD 2JA7H 3AFQA 4HN7A 3T1HQ 4JBMA 4DV0Q 3FHWA 4XTCS 3D4DA 5IGEA 5FLMH 2F0PA 2HQLA 4EX5A 1UEAB 1V1OA 1YEZA 1PH9A 1L2FA 4JI4L 1HUNA 5C4HA 1EZ6A 1B7YB 4C3HG 4DR4L 1D8LA 2B2VA 4JI6L 1V9PA 5G3LF 3J81i 4RG1A 2D0OA 5EBDA 2IL8A 5JVG3 4XT3B 3LNNA 2D2CC 1N34L 2F1MA 2AUKA 1WYDA 4GN3B 3VR3A 3BZKA 1LLRD 3PF5A 4FDBA 5J39A 1SYGA 3CPFA 5BN5A 4AYBB 4QB4A 2BOSA 3NPPA 1TWGH 1Q86C 1Q1EA 1ENFA 1FYCA 4GKJL 1J8IA 3VR6A 1DM0B 2DY8A 4JI7Q 1ENCA 1JR0D 1EQTA 1EWHA 1MHWC 1GUNA 4A3MH 1HFGA 4O1NA 1Q8KA 2MQHA 1I4GA 4XXEA 1D1KA 2F0EA 4LUOA 4LF7L 2EYLA 1TWHH 4X66L 4KKUA 1S5BD 4BY7B 1CM9A 1Q1BA 1NY4A 2IX0A 2AQ1B 3QIAA 1SXTA 2K05A 1KAAA 2R93B 2YU9H 1GUTA 3HEJA 3RLNA 1NNXA 2JXMB 3TN2A 4C2MH 1HPCA 1AN8A 5C0XI 1K8OA 2TMPA 3J7A5 3QG1A 4KY7A 4X6AH 4GN4B 1JC7A 1I4RA 1U0LA 2NZ1D 4HMIA 4X3UA 3HOVH 5L37A 4J1MA 1HR0W 4FF1A 2ID0A 2EYOA 3HG9A 4QJFA 4HJAA 1SNOA 1PH4A 2NVTH 4DR1L 1SNMA 1M8AA 3HFZB 1VF5C 4DK0A 2M00A 1RIPA 1S4ZA 1G2TA 3FKIH 1SYCA 5BN3A 5FJ8G 2VQFQ 3A8JE 4DV5Q 3K57A 2JA7G 3K6OA 4YHHL 1TWFH 2K33A 3J80L 4YY3Q 3RUZA 1CA5A 1TQOA 4RCOA 1CTMA 3W2DA 4K2KA 3HOWG 1Z9FA 1F2LA 4A76A 4EGVA 2A68C 2R92H 5C3WA 2PW5A 1SE2A 5M3FG 4RGTA 1V1PB 1GUSA 4C3HH 3E9HA 2K5VA 4HTHA 2F4VQ 2P5ZX 2QA4A 4JI2Q 2K04A 4DXGA 1I94L 2QKIC 2F3VA 1KDCA 2VB2X 1E1OA 4MIUA 2F0UA 4QF4A 3RD4A 2EYMA 1EYGA 4HJ9A 3HKZG 5IP9G 5C0XH 2B2WC 2FJ2A 1QUQA 1XTDA 1PRTF 3OMCA 1AFPA 3J7YW 4ULLA 1KXLA 2Y0SE 1IBML 4EQ5A 3CCVA 4ALPA 4PMCA 4UPAA 1ZEQX 3T1YQ 4B9XA 1IYJB 2E2DC 4L6TB 4U68A 4V0BA 4JI3L 3AFPA 3K5OA 2Q8IB 5E7NA 4XIGS 4V190 3BG3A 5CC4A 3CCJA 2NN6H 3DMUA 3H94A 4CBVA 2CW0D 4H02A 3CRKC 3C46A 3E5SA 4B3ML 5EQ0A 4BBSB 3EFXD 4LMQD 2MHVA 1FL0A 5IGCA 3I4LA 1XX8A 1HTLD 2R93H 2DUDA 2LSSA 1EZ8A 2Y0SG 4NXML 2KENA 3HOZB 4IJHA 3S2DH 1QCBD 2L0CA 3IRBA 1CQVA 1YZ6A 3OIPA 2UU9Q 5M5XB 1N33Q 1SR3A 3ULJA 4LWCA 2BDNA 2AHOB 4ZKCB 2I5LX 1BBUA 1OXSC 2Q2HA 5DNFA 1T9HA 2JJQA 4DV1L 2EOTA 4EQOA 4JI7L 4KTAA 2H4OA 1E22A 4DGZA 3R8BA 5IWAL 3Q8DA 1LTGD 2NVQH 3I91A 1STNA 1I50B 1HNXQ 1IBKL 1ESFA 4LF8Q 3PIP3 2E8GA 2B2UA 2FINB 1L0WA 1VQKA 4JI0Q 2YTXA 1JOQA 4L5RC 3K58A 1WCMH 4HMJA 4JBWA 1KC8C 2QGQA 1HXYD 2VL6A 1F9QA 4C3IB 1ILPA 2K5DA 2C9OA 4UAIA 1XPRA 4OO1G 1MIUA 1OXVA 2N88A 2PZTA 3U4ZA 1CA6A 3CP0A 4K14A 4BBSH 4PZ6A 3Q22A 1SMXA 2YTVA 3K7AH 3ND9A 2JEBI 4G7ZC 3TP8A 5EKLA 3U4VA 4RA8A 4TKOB 2F0MA 3HZXA 1H95A 4J8QA 2D9UA 4PMWA 2QDBA 1PHJA 1TKWB 1PTOH 2JP1A 2AWOA 5I6WA 1NSNS 4DAVA 3UDIA 4K8JA 3DM3A 2ZTCA 3NHHA 3RMHA 4CKCA 3VDYA 3K0XA 4A3BG 4LF6L 4PG3A 4HSPA 5HGQA 3VYTA 3M4OB 1H9MA 4Y7NH 3A7AB 2DY7A 1QJOA 4A3KH 2C35B 4DAPA 4LJZC 3RLFA 4ZQ3A 3SDZA 1TS4A 2G9DA 4DAYA 1PH7A 4A75A 1WCMG 4LF9L 4DR7Q 4A3EG 1TU2B
chains in the Genus database with same CATH topology
3LWEA 2M2LA 4OIKA 2NN6G 4A3IB 4G57A 1G291 2K32A 1KNAA 3SE0A 4A3GB 2MGSA 2KJXA 1PZID 1Y1VB 2WKCA 4A3DB 4G7HC 2AQ3B 3S2HB 1HA5A 5FLXL 1G6ZA 3TSSA 3OW7A 3URYA 2ENBA 3N52A 3HOUB 1QNUA 3I4MB 4A3KB 2NTTA 5M5YB 3CU7A 1LTSD 1LABA 4F88A 3H09A 1WTXA 4DNRB 4H13C 4RHSA 4CHTB 2XWJB 3DUZA 2HDLA 4S3SA 1QILA 3MEHA 3BVGA 3HRZC 3DEOA 4A93B 1CFMA 1EIHA 5I4DA 1G2SA 3TP5A 1Y8PB 2HDMA 5G3LD 1JWSD 1KTKA 1B4OA 1CHQD 1I4PA 1V1PA 5AFWA 3S9WA 4IUTA 2IX1A 1SE4A 2Z4IA 4OIJA 2F0JA 3HGBA 2FMCA 1SFOB 5CV6A 4M1UB 5DM63 3DWAA 3AMUA 4IUVA 3NUCA 4DF7A 5T1GA 1RJTA 2A69C 1OO9B 4RCNA 3RZOB 2KEEA 1AP0A 3EA6A 5ELEA 1AZPA 3Q0AA 4DK1A 3KF8A 3D8GA 2NN6I 4IN3A 3GQBA 1GUGA 2B2TC 2QEJC 3NE5B 2BDOA 2Z8LA 4C3HB 2DNEA 2FHTA 3BZDB 4FF2A 3BVZA 3S15B 4OL7A 5I2XA 1YNND 5EKKA 3WDNA 2K28A 1H9SB 3I8ZA 1LTAD 2R3ZA 4DA2A 1A3UA 4Q0FA 1RD9D 2CVRA 4CKBA 3H0GB 2E74C 2K03A 1WD0A 3DEPA 5I2YA 3K7AB 2D5DA 4M8AA 3TZUA 5K36H 2EPBA 3NWSA 2JYOA 3M3YB 1IW7C 5ELFA 5CV9A 2RKSA 4B08A 4BBRB 1BF4A 2B63B 5IGFA 1MD2D 4RKBA 2L55A 5C44B 1BBXC 3TP6A 5IIFA 3IFDA 3OOCA 1CI3M 3NSWA 4NDXA 3MA2B 3P7JA 4N9TA 1UUPA 1MSHA 3N6RA 1YNJD 3PUZA 2VUMB 5ELDA 2PQEA 1VMPA 1U4RA 4HCSA 2MP1A 4KJNA 2QF7A 3SK6A 5KIXA 1STAA 1PRTC 4K5WA 3NTHA 5JOBA 1JORA 3SEBA 2J4XA 3ZYYX 2OT2A 1PTOD 1S5DD 1SNCA 2L11A 1D5XC 1E2WA 1II3A 1STYA 1EQVA 4ID6A 1PDQA 3P75A 2X69A 3OPOA 2A5HA 1T5XD 4DNTB 1EY4A 2BE5C 2EYFA 1Z6HA 5I6YA 4XT1B 2HUGA 2A6HC 3J7AV 1SNPA 4FP5D 4WRDA 1EY6A 1EY8A 4RGOS 3OWFA 1JB3A 3WOEA 2B39A 1TS3A 1LT3D 5IOCA 3D31A 5K36G 1K8MA 3C3LA 4HCEA 2F0OA 2X6GA 1ZKOA 4KKTA 3FPUB 2QILA 1IYUA 1H9KA 3C2PA 2Z4HA 5IT9L 4KI0A 3GV6A 1STGA 4WJWA 2SNSA 2EYHA 1FD7D 3J80E 3P20A 2A6ED 3MWYW 4IALA 4R8NA 1TWGB 3NP8A 2DNCA 2PCFB 4KN4C 3MC0B 1U4MA 4ZK9B 1WTOA 3M7GA 4FVMA 2WINB 1ONLA 2I46A 4HAEA 2IT1A 3PUXA 5LHY1 4DFAA 3NQTA 1TS2A 1E2ZA 3FPPA 2KQ3A 2OEOA 2H1EA 4UDUC 2B8FA 3PO2B 4I7ZC 3S1MB 2ICIA 1JOKA 4C1NI 1PTOB 1UNSA 1JICA 4C56C 5BN4A 5IGDA 1F9RA 2WAQB 3QOLA 1W6KA 3A56A 2R6GA 4IFDG 4PQXA 2AWNA 3L3OC 2EY1A 4F7XA 4XYOA 5FLXE 5HURA 2EY5A 1SAPA 3D6WA 4TSSA 3QB3A 1JQYD 1TVXA 1JWMD 1QB5D 5KEEA 3T53B 4EVOA 1LT4D 1BCPD 2F0NA 3VA5A 2B2YA 4F87A 3AU7A 4KN7C 5EBCA 4CJ1B 3H3VC 3T51B 3ERQA 3I73A 5M3FB 4C2MB 2B2VC 4NW2A 2RDGA 2OF1A 3S17B 1V43A 1A15A 1SNQA 5C4ZA 3DHQA 3LWUA 3IKJA 3J81L 3UI2A 3NTKA 3KLSA 2XIWA 1C4QA 5C4JB 2K1BA 1SYFA 4OO1I 3AB9A 5CBAE 3K59A 2FMMA 4DU9A 1GUWA 2SOBA 2G9HD 3FEWX 3S1RB 3FDTA 1I4XA 1F2MA 4KMUC 1F77A 3SK4A 2XRQD 1WTQA 1HUMA 2BE5D 1PFNA 1Y69U 3V96A 1B44D 1CZGA 1QWYA 1S5CD 2E2HB 1EU3A 4A3JB 1NR2A 1PTOC 3R3OA 4DN4M 3ITPA 3HS0C 1GHKA 3O13A 1GUOA 2EYPA 3WOFA 1EY9A 1LTBD 1LTRD 4TRDA 1PZJD 1PRTD 1SYBA 1F2ZA 1R4QB 5T1IA 5C4XB 3SK8A 3BVMA 3MXGA 1Y8OB 1EIGA 2VNUD 1JWUD 2KUMA 3DM1A 1AW7A 1CK1A 4YIJA 3K5NA 4OHJA 4BA2I 2L12A 1LACA 1EU4A 2O4XA 2BCOA 1STEA 1MGSA 3R93A 1I6VC 3K5LA 1ZYRD 4EQNA 4IFDJ 1PLFA 3VYRA 2RVLA 2MPMA 3D4RA 1U4LA 3NQIA 2KA7A 3D4WA 2F0FA 5LL6S 4K5XA 1BOSA 3PUYA 3IFTA 3VR4A 3BDLA 1TWCB 1BXTA 1ET9A 2EYJA 1KDAA 2LFNA 1TY2A 4A3MB 3M7NA 3BDCA 4ZLTF 1WCMB 1PXUA 2NVXB 1YNNC 4ZAIA 1M4VA 1WTVA 5D14A 4Q5VA 4BY1B 4NP5A 5HGTA 1D2BA 4IUNA 4RWSC 1WTRA 2XVSA 1FR3A 3GO5A 2PZUA 3K5MA 1DJRD 3EROA 3I70A 3JAML 2O2LD 1TR5A 5C0XJ 2A69D 4CJ0B 5CV7A 4LAAA 2F0DA 1OXXK 1L0YB 1PMRA 2MUYA 2F0VA 2E75C 3GTLB 4ZKBB 1SSOA 2AQ2B 1MSGA 5J22A 1U4PA 2KOLA 4C1NK 2O5JC 3M85A 1EOTA 2VXWA 2E76C 1R9TB 5JPNC 4KY6A 4DXFA 1VDZA 2K6AA 5COYA 1C48A 4G4KA 2GA4B 4PNYA 2HCCA 4KJOA 1L0XB 3QJYA 4HR7B 2MJ8A 2PPBC 5JEAJ 3U9SA 1VMCA 4ZUIA 2JA7B 3TZDA 4RHRA 5C6AA 1H9SA 4IUQA 5KYLA 1ESRA 3GTOB 1D5ZC 3HOWB 2NVTB 3NBHA 3CRLC 1BO0A 3NTIA 3IL8A 1DOMA 2C5CA 1FNUA 2LY7A 4C3JB 3A54A 1T5EA 2JE6I 2IJ0A 3R2IA 4Y7NB 4R8IA 2F0SA 2Q8RE 1CT1D 1O80A 1BCPC 2EVBA 3MZ5A 3GV3A 4ILWA 3VR2A 1B2TA 5A2QE 1PFMA 1G8ZD 1S5ED 2KVMA 5CR3A 3G7LA 1JCKB 5FO9B 5I9PA 1XYIA 2A74C 1KDBA 1B9NA 3MVVA 4NKLA 2JA6B 3VYUA 2X6LA 1D5MC 3T13A 1SYDA 2KCNA 3FVQA 5DM73 4F8MA 3TBIB 1EYAA 4CKEA 1JE4A 2KHSA 5CBEE 3EJIA 5JEAG 2F0LA 3MFGA 5C3XA 3T4AC 1ENAA 1H9RA 2IPKD 3SXHA 4BS9A 3X3NA 1E2VA 2EY2A 1MBYA 2QCPX 5C3EB 2KEDA 2A6EC 2R61A 1CQFA 5A35A 1Q12A 1KLGD 2WKDA 1X3QA 2EXZA 4X3KA 5KNDA 4ZUJA 2L1BA 3EQLC 3EVQA 3V2TA 1RTOA 3I72A 3J7AF 1SBBB 1RODA 1O7LA 1B53A 4RGMA 5DEHA 4ZYSA 4KD3A 1QOHA 4U673 1VCIA 1A6XA 2LS01 1IKLA 3A55A 4A3EB 4IFDH 1BUVT 2PMZB 2B2UC 4KHVA 3MXNA 4IFDI 4FXGC 1Y8NB 1FNWA 2ZT9C 1E0BA 1NCVA 3U9OA 3CKIB 4QUCA 1DYQA 2SNMA 1ML0D 3SVMA 1MI2A 3KBXA 4A3FB 5FOBB 1QE6A 1K83B 1XTCD 2A68D 4H44C 2JSOA 3BYYB 3HOVB 4XQJA 1D1IA 5JEAH 3JAME 4H7BA 5KGUA 2B2WA 1KNEA 1BR9A 3S1NB 1GHJA 5JVH3 3E0JA 3VR5A 1EL0A 3OSOA 4IUPA 4JK1C 1HA6A 2EJMA 3KLRA 2JA5B 2IW3A 1J9OA 2WV6D 4K5VA 1A2UA 1TY0A 3PMFA 3CHBD 4OO1H 2F3WA 2IWHA 1WTPA 1G91A 3W3AA 1UAPA 1X3PA 5KYIA 2V4DA 3PUVA 1HTPA 2NUCA 3IAYA 1IW7D 4IURA 3GTQB 1PRTB 1LTID 5C5LA 1PFBA 2EDGA 2LMCB 3FRPB 3HKZB 3CQZB 2TSSA 2J0TD 2JA8B 3NWTA 1EY0A 3T56B 2A6HD 3J81E 3GTJB 2EJGC 1TWFB 1LT6D 4K6LA 1ET6A 3SHLA 1DOLA 2XN9C 1STBA 3PV0A 1IYVA 3I3CA 1O78A 3HOYB 2R92B 4BWGB 5IODA 5K5PA 4K6DA 2RQXA 2PO4A 2RBMA 1WTWA 1A3VA 5JAVA 1LTTD 1CZWA 5C0XG 1HRJA 5CV5A 1BNZA 2ZXRA 3QWNA 1YNJC 1LO5D 5E1FA 5J1ZA 4L8JA 4RKLA 2RDFA 3R2TA 3RZDB 2B8GA 2NTSA 3OMGA 2OXPA 1SJHD 1WVLA 4ZRZA 2SEBD 1RKNA 2F0WA 3A7LA 2PW7A 3MXUA 1HHVA 4IUUA 1I3QB 3GP7A 2J7ZA 1XXGA 4MHEA 3DWQA 3MAQA 1SNDA 1FGBD 4P2CB 4NMZA 4XDXA 5CORA 5NUCA 4IQZA 3S16B 2YYZA 3DWPA 1Z47A 1CHPD 1RCVD 4QIWB 1B9MA 2PNRC 1GOZA 4QMGA 5CV8A 1Z7TA 2A73B 3OHXC 4HEDA 2ZXOA 5CV4A 1PZKD 2F0QA 2B2TA 2F4IA 2L4NA 3C1EA 3TP7A 1JOOA 4KV6A 1ZYRC 1RDPD 5EPLA 1B3AA 3PIO3 1EYDA 1F9SA 1AZQA 3VYSA 5KRUA 1RTNA 1EEID 1EFID 4LK1C 5EGTA 4CJ2C 1B50A 1B1ZA 4N9PA 2EJFC 3P1HA 2F0KA 2LKVA 4TQUS 1DONA 4WORA 2BA1A 3T16A 4ABNA 2PZWA 3C1FA 2ICEC 4E6IA 4RGNA 3K0YA 4XQNA 5FKAC 2F0TA 3S14B 1SJED 2JEAI 1OXUA 4QCLA 3I90A 3H91A 1ICWA 1IL8A 1STHA 4RAUC 1I4HA 5E3FA 1F2YA 1LV9A 1XWEA 3NK9A 3TMEA 3MFYA 4A3BB 2AUJD 1ILQA 1KABA 3FMCA 5E4WC 1TWHB 4PV1C 4FXDA 2XRSD 4GZYC 5I9OA 2KECA 3BYTB 2K01A 4KY5A 3QO2A 3FKIB 4WFN3 4QUFA 1AEXA 1PYWD 3Q24A 5ELCA 4XQQA 1KLUD 4IZ8A 2CQAA 5D3DA 3Q23A 2XWBB 3KBGA 1SMYC 2WIIB 1ZXTA 4EQPA 1LT5D 4R9WA 1NR4A 2B2YC 2E2JB 2WP8J 2XSCA 1TIID 2WB1B 3OWEB 4KD4A 1EY7A 4XYQA 5FO7B 4O42A 5C5MA 3GTGB 3NBIA 1Q8IA 1I4QA 1Q3LA 5JJZA 3QOJA 1W6JA 1TWAB 3L7ZC 1BQQT 1EWCA 2L5TA 3F2UA 3GTKB 2IX3A 3I4NB 4BA1I 1IHZA 2NVQB 1Q90A 1Y1WB 2ZXPA 4G7OC 3A8IE 4FXKC 4FNFA 4KK7A 2FFKB 4FYDA 2NVYB 2SDFA 1R4PB 2Y0SB 1VF7A 1NAPA 4ODGA 5TSSA 1C8CA 1QG7A 3MXPA 3VA7A 5CMDA 2F0GA 2RSOA 1WD1A 3ONAB 4Z9CB 1TT2A 1SMYD 5IGGA 1FNVA 2NYZD 2D62A 2KCCA 5M5WB 3S2DB 2I07B 5EPKA 4K2LA 5IGBA 1HCZA 5E4XA 2EE1A 4OGQC 1H9JA 2M9VA 2BA0A 1EY5A 4KKSA 4RH6A 1SE3A 4C3IG 5LL6X 3A8KE 1I6HB 5FK9C 4I65A 1V8QA 5DAUA 1NUCA 1BDOA 4RFBA 3Q6SA 2HCIA 3PO3B 2F0HA 3OIQA 1RHPA 5ISRA 5EJWA 4CGYB 5D65A 4X3SA 4B9WA 2PYKA 4X3TA 5F2DA 1DZ1A 2F03A 5KNBA 2CW0C 5M9OA 1A3TA 1SDFA 5EPJA 1HFNA 5CGKA 3NXWA 2CHBD 1RF2D 1O7ZA 3GTPB 1O7YA 3E6ZX 4ME5A 2EZVA 1F9PA 3L9AX 1SYEA 1A2TA 1GXDC 3SK5A 4PMBA 5IT9E 3GTMB 3G6JB 1EYCA 1GJXA 3HOXB 4L63B 4KHZA 3X3MA 2NWGA 3BS1A 4C3JG 4H0LC 1DD2A 1DOKA 2HQEA 2Z1CA 3HP3A 2WACA 2F0IA 5JPMC 2L9HA 3TDQA 4MN3A 1IKMA 2E2IB 1OXTA 1QNKA 5KNCA 2NB0A 2RA4A 3LX0A 3DXJC 1BCPB 3KK7A 1EEFD 2Q8TA 3SR1A 1S5FD 3PUWA 2EY6A 3BDOA 2NBFA 1PTOF 3ND8A 1D6EC 1DCZA 2RSNA 2DN8A 2XNAC 2K5QA 1DXMA 5D3IB 4FF3A 2K7VA 1HQRD 2YU9B 1HQMC 3MHBA 2O5IC 2RDHA 4HSVA 4FF4A 3H6MA 3KUPA 4K8IA 5M3MB 3D3RA 3S1QB 3M4YA 5EKIA 4FO2A 5A2QL 2K5WA 2R7ZB 1X32A 1BCPF 2VB3X 1TS5A 5CYUA 3D6CA 3GD7A 4J6HA 5ELBA 3KLSX 3V05A 3MTSA 5FO8B 1U9RA 2N55A 1SEBD 4HN7A 4XTCS 3D4DA 5IGEA 2F0PA 1UEAB 1V1OA 1HUNA 5C4HA 1EZ6A 4C3HG 2B2VA 5G3LF 5EBDA 2IL8A 5JVG3 4XT3B 3LNNA 2D2CC 2F1MA 2AUKA 3VR3A 1LLRD 5J39A 1SYGA 5BN5A 4AYBB 4QB4A 2BOSA 3NPPA 1Q1EA 1ENFA 1FYCA 1J8IA 3VR6A 1DM0B 2DY8A 1ENCA 1JR0D 1EQTA 1EWHA 1GUNA 1HFGA 4O1NA 1I4GA 4XXEA 1D1KA 2F0EA 2EYLA 4KKUA 1S5BD 4BY7B 1CM9A 1Q1BA 2IX0A 2AQ1B 3QIAA 1SXTA 2K05A 1KAAA 2R93B 1GUTA 3HEJA 2JXMB 3TN2A 1HPCA 1AN8A 5C0XI 1K8OA 2TMPA 3QG1A 4KY7A 1JC7A 1I4RA 2NZ1D 4HMIA 4X3UA 4J1MA 4FF1A 2ID0A 2EYOA 3HG9A 1SNOA 1SNMA 1M8AA 1VF5C 4DK0A 2M00A 1S4ZA 1G2TA 1SYCA 5BN3A 3A8JE 3K57A 3K6OA 2K33A 3J80L 3RUZA 1CA5A 1TQOA 4RCOA 1CTMA 3W2DA 4K2KA 1F2LA 4EGVA 2A68C 5C3WA 2PW5A 1SE2A 4RGTA 1V1PB 1GUSA 4HTHA 2K04A 4DXGA 2QKIC 2F3VA 1KDCA 2VB2X 4MIUA 2F0UA 4QF4A 3RD4A 2EYMA 5C0XH 2B2WC 2FJ2A 1PRTF 3OMCA 1AFPA 3J7YW 4ULLA 4PMCA 1ZEQX 4B9XA 2E2DC 4V0BA 4L6TB 4U68A 3K5OA 2Q8IB 4XIGS 4V190 3BG3A 5CC4A 2NN6H 3DMUA 3H94A 4CBVA 2CW0D 3CRKC 3C46A 3E5SA 5EQ0A 4BBSB 3EFXD 4LMQD 2MHVA 5IGCA 3I4LA 1XX8A 1HTLD 1EZ8A 3HOZB 1QCBD 2L0CA 1CQVA 3OIPA 5M5XB 2BDNA 4ZKCB 1OXSC 5DNFA 2EOTA 4EQOA 4KTAA 2H4OA 4DGZA 3R8BA 1LTGD 3I91A 1STNA 1I50B 1ESFA 3PIP3 2B2UA 2FINB 3K58A 4HMJA 4JBWA 1HXYD 1F9QA 4C3IB 1ILPA 2K5DA 2C9OA 4UAIA 4OO1G 2N88A 1OXVA 1JOQA 2PZTA 1CA6A 4K14A 3Q22A 3ND9A 2JEBI 4G7ZC 3TP8A 5EKLA 4RA8A 4TKOB 2F0MA 3HZXA 4J8QA 2D9UA 4PMWA 2QDBA 1TKWB 1PTOH 2JP1A 2AWOA 5I6WA 1NSNS 4DAVA 4K8JA 3NHHA 3RMHA 4CKCA 4HSPA 3VYTA 3M4OB 1H9MA 3A7AB 2DY7A 1QJOA 4DAPA 4LJZC 3RLFA 4ZQ3A 3SDZA 1TS4A 2G9DA 4DAYA 1TU2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DWA A;  3BYY B;  2AQ1 B;  1RDP D;  1LTT D;  1SXT A;  2RDH A;  5ELD A;  3OWE B;  4RHR A;  1TS2 A;  2G9H D;  3EFX D;  3MFG A;  1BXT A;  1EEI D;  1ET9 A;  1EFI D;  1AN8 A;  1PRT C;  1D5Z C;  3EA6 A;  5ELE A;  1PZI D;  1I4X A;  1B1Z A;  1HTL D;  1F77 A;  1TY2 A;  3SEB A;  1BCP F;  2AQ3 B;  1LO5 D;  2J4X A;  2XRQ D;  1HA5 A;  1I4Q A;  4UDU C;  1CQV A;  2IPK D;  1TS5 A;  1PTO D;  1M4V A;  1S5D D;  3TSS A;  2QEJ C;  1B44 D;  1I4R A;  2ICI A;  1EWC A;  1D5X C;  2CHB D;  2WV6 D;  1RF2 D;  3R2T A;  1PTO B;  1UNS A;  2Z8L A;  3KLS X;  5ELB A;  3URY A;  1S5C D;  4C56 C;  2NTS A;  3V05 A;  2R61 A;  1TY0 A;  1EU3 A;  1KLG D;  4RGN A;  1T5X D;  3BZD B;  3BVZ A;  3CHB D;  1SJH D;  1FNU A;  1PTO C;  1SEB D;  2SEB D;  3R8B A;  3O13 A;  1LTG D;  1LTA D;  5FKA C;  1DJR D;  2NTT A;  1SJE D;  1ESF A;  1LTS D;  1LTR D;  1LTB D;  2IJ0 A;  3R2I A;  1PZJ D;  1PRT D;  4L63 B;  2O2L D;  1RD9 D;  1CT1 D;  5TSS A;  1V1O A;  4RCO A;  4RGO S;  1SBB B;  1BCP C;  3BVM A;  3GP7 A;  3W2D A;  1I4H A;  1XXG A;  1HXY D;  1JWU D;  1PRT B;  3DWQ A;  4RHS A;  1CK1 A;  1AW7 A;  4RGM A;  1FGB D;  1LTI D;  4TSS A;  1TS3 A;  4ZYS A;  1SE2 A;  4Z9C B;  1QIL A;  1JQY D;  4OHJ A;  4RGT A;  1L0Y B;  1V1P B;  1JWM D;  1G8Z D;  1S5E D;  1LT3 D;  1FNV A;  3BVG A;  1EU4 A;  1JCK B;  1LT4 D;  1STE A;  2AQ2 B;  2TSS A;  1BCP D;  5ELF A;  1BCP B;  3DWP A;  4DXG A;  5I4D A;  1CHP D;  1RCV D;  1EEF D;  2QIL A;  2XRS D;  1MD2 D;  1FNW A;  1LLR D;  1S5F D;  1GOZ A;  1PTO H;  1JWS D;  1LT6 D;  1KTK A;  4K6L A;  3BYT B;  1PTO F;  1ET6 A;  1CHQ D;  1DYQ A;  1ENF A;  2XN9 C;  1D6E C;  1D5M C;  1PRT F;  4RH6 A;  1JR0 D;  1SE3 A;  2RDG A;  1I4P A;  1PYW D;  4DXF A;  1V1P A;  1FD7 D;  5ELC A;  1PZK D;  4O1N A;  2XNA C;  1KLU D;  4BWG B;  1I4G A;  1SE4 A;  5D3D A;  4L6T B;  5D3I B;  5FK9 C;  1TS4 A;  3MC0 B;  1HQR D;  1LT5 D;  1UUP A;  1L0X B;  1XTC D;  1S5B D;  4RFB A; 
#chains in the Genus database with same CATH topology
 5FLX c;  3LWE A;  4DR6 Q;  1AE2 A;  2M2L A;  1I6H H;  4OIK A;  2NN6 G;  4A3I B;  4G57 A;  1YVC A;  1G29 1;  2K32 A;  1KNA A;  3SE0 A;  1D7Q A;  1N9W A;  4A3G B;  2MGS A;  3KF6 A;  1VQF A;  2KJX A;  1PZI D;  1Y1V B;  3F2D A;  4QIW E;  5J3B A;  2WKC A;  2QEX A;  4A93 H;  2N3S A;  4A3D B;  4G7H C;  4GKK Q;  2AQ3 B;  2H5X A;  3S2H B;  1HA5 A;  2CKZ B;  5FLX L;  2RHQ B;  1UE6 A;  4L5S A;  1G6Z A;  3TSS A;  3OW7 A;  4B3T Q;  3HOZ H;  3URY A;  2ENB A;  3N52 A;  3EIV A;  3HOU B;  1QNU A;  5GAG C;  5C4X B;  5M5X H;  3I4M B;  4P72 A;  1N33 L;  2ATW A;  4A3K B;  2NTT A;  3H0G H;  3CU7 A;  5M5Y B;  1LTS D;  5IT9 c;  1LAB A;  3BZC A;  4JI1 L;  4F88 A;  3H09 A;  4X62 Q;  1I50 H;  4P73 A;  4Y52 H;  1WTX A;  3L2P A;  4DNR B;  2PNH A;  4H13 C;  4RHS A;  4CHT B;  2XWJ B;  3DUZ A;  2HDL A;  4N8X 1;  4S3S A;  1JJ2 A;  1QIL A;  2UXC L;  2CH4 A;  4A3J G;  3MEH A;  4JI0 L;  3BVG A;  3HRZ C;  4CDD C;  3DEO A;  4A93 B;  2I5H A;  1CFM A;  3A0J A;  1KL9 A;  1EIH A;  5I4D A;  1G2S A;  3TP5 A;  1Y8P B;  2DGY A;  2HDM A;  1SRU A;  5G3L D;  2I0Q A;  1JWS D;  1KTK A;  1A63 A;  4B3T L;  1B4O A;  1CHQ D;  4DK3 C;  4AIM A;  2F3I A;  1I4P A;  5GAE C;  5GQO A;  3I4M H;  1V1P A;  1XMQ L;  2UU9 L;  5AFW A;  3S9W A;  4DV0 L;  4IUT A;  3DLL A;  2IX1 A;  4IPD A;  1SE4 A;  3KOJ A;  2Z4I A;  4LUV A;  4OIJ A;  2F0J A;  3HGB A;  2Z6K A;  2FMC A;  4JC0 A;  5CV6 A;  3CC7 A;  4M1U B;  1Y14 B;  1SFO B;  1HJP A;  4QQB X;  4UY8 C;  5DM6 3;  3ULP A;  3DWA A;  2JA8 G;  1X55 A;  3AMU A;  4IUV A;  4LUZ A;  2D0P A;  3NUC A;  4DF7 A;  3UDX A;  5T1G A;  1QUQ B;  1RJT A;  2A69 C;  1OO9 B;  4RCN A;  3RZO B;  2KEE A;  1AP0 A;  3EA6 A;  5ELE A;  1AZP A;  3Q0A A;  1U5K A;  4DK1 A;  3KF8 A;  3D8G A;  2NN6 I;  2XTI A;  1J5E Q;  4LFB L;  1XNQ Q;  4IN3 A;  3GQB A;  3UDF A;  2HD3 A;  1W2B A;  1GUG A;  2B2T C;  2QEJ C;  3NBH B;  4MTK A;  3NE5 B;  4AQY Q;  2BDO A;  1NBW A;  2Z8L A;  4C3H B;  3S1M H;  2DNE A;  2FHT A;  3K8A A;  3BZD B;  4FF2 A;  3BVZ A;  3S15 B;  4OL7 A;  5I2X A;  1YNN D;  5EKK A;  3WDN A;  2K28 A;  4A3L H;  1H9S B;  1VQD A;  3I8Z A;  1LTA D;  3PIO A;  3CCR A;  2R3Z A;  4DA2 A;  5HY6 A;  1A3U A;  4DR2 L;  1CUK A;  1VQB A;  4Q0F A;  5JJK A;  1RD9 D;  2CVR A;  4CKB A;  4GN5 A;  1K28 A;  1HZ9 A;  4JYA Q;  4DR6 L;  3H0G B;  3NEM A;  2E74 C;  5M5Y H;  2K03 A;  4PZ7 A;  1WD0 A;  3DEP A;  5I2Y A;  5LMN Q;  1CKN B;  3K7A B;  2D5D A;  3CCQ A;  4M8A A;  3TZU A;  5K36 H;  2EPB A;  3NWS A;  2JYO A;  1VQ8 A;  3M3Y B;  1JT8 A;  5FLM G;  1IW7 C;  5ELF A;  4HIM A;  5CV9 A;  1QZG A;  2RKS A;  1YJN A;  4B08 A;  4BBR B;  1L1O C;  1BF4 A;  2B63 B;  5IGF A;  1MD2 D;  4RKB A;  1BVS A;  2L55 A;  5C44 B;  4JBK A;  4CDC C;  3I56 A;  1BBX C;  3TP6 A;  1YBY A;  1FJG Q;  2MO1 A;  5IIF A;  3E3X A;  5LMU Q;  3IFD A;  1WOC A;  3OOC A;  1CI3 M;  3OW2 A;  3NSW A;  4NDX A;  4GLX A;  3U58 A;  3MA2 B;  1VQC A;  3P7J A;  3TRE A;  2KCM A;  4N9T A;  1UUP A;  1MSH A;  3A5Z B;  3HKS A;  3N6R A;  1YNJ D;  2K50 A;  3QR8 A;  2PI2 E;  5LMN W;  3PUZ A;  2VUM B;  1LTL A;  3STB C;  5ELD A;  2PQE A;  1VMP A;  1U4R A;  4WJ4 A;  4HCS A;  4HIO A;  2MP1 A;  4KJN A;  1TXY A;  2QF7 A;  3SK6 A;  5KIX A;  2JA5 G;  4LNQ A;  1STA A;  1N8R C;  1PRT C;  1KIX A;  4K5W A;  3NTH A;  5JOB A;  4CDF C;  1JOR A;  3SEB A;  5IE8 A;  2J4X A;  3PO3 G;  1Q46 A;  3ZYY X;  4DUZ Q;  2OT2 A;  1PTO D;  1S5D D;  5H1S E;  1SNC A;  2L11 A;  1D5X C;  1E2W A;  1II3 A;  1STY A;  1EQV A;  4ID6 A;  1PDQ A;  3P75 A;  2X69 A;  3OPO A;  2A5H A;  1T5X D;  4LFB Q;  2GVB A;  4DNT B;  1EY4 A;  2BE5 C;  1HR0 Q;  2EYF A;  1Z6H A;  4HJ8 A;  2BH8 A;  5I6Y A;  5IP7 H;  2A8V A;  2RCN A;  4XT1 B;  2HUG A;  2A6H C;  3J7A V;  1SNP A;  4FP5 D;  2N78 A;  4WRD A;  1HNZ L;  1EY6 A;  1EY8 A;  4RGO S;  3S1N H;  3OWF A;  1JB3 A;  3WOE A;  3CC2 A;  2B39 A;  2JA5 H;  1TS3 A;  4GS3 A;  4R4Q A;  3HOX G;  1LT3 D;  5IOC A;  3D31 A;  5K36 G;  2CWP A;  1K8M A;  3C3L A;  2JA6 H;  4HCE A;  2F0O A;  2X6G A;  4R4I A;  1ZKO A;  3HOY G;  4GOP A;  4KKT A;  3FPU B;  2QIL A;  3I7F A;  4A3F G;  4QGU A;  1IYU A;  2DJG C;  1H9K A;  3C2P A;  1X9N A;  2Z4H A;  5IT9 L;  1L1O B;  4KI0 A;  4DKA C;  3GV6 A;  1STG A;  4WJW A;  2SNS A;  2EYH A;  4DUY Q;  1FD7 D;  3J80 E;  3GTQ H;  3P20 A;  2A6E D;  3MWY W;  1YHB A;  3J80 i;  4IAL A;  2FXQ A;  4R8N A;  1TWG B;  1X3E A;  1IBK Q;  3NP8 A;  4LF4 Q;  2DNC A;  2PCF B;  4KN4 C;  3MC0 B;  2DJF C;  1ICF B;  1U4M A;  4ZK9 B;  1WTO A;  3M7G A;  4FVM A;  3GDE A;  4JG2 A;  5BR8 L;  2WIN B;  1Y1W G;  1ONL A;  4NB3 A;  4DV2 Q;  2I46 A;  4HAE A;  2IT1 A;  3PUX A;  5LHY 1;  4DFA A;  3NQT A;  1WI5 A;  1TS2 A;  3KFU A;  4C3I H;  1E2Z A;  4KLK A;  4OX9 Q;  3FPP A;  1SE8 A;  2KQ3 A;  2OEO A;  2E2I H;  4HJ7 A;  2H1E A;  3CCU A;  4UDU C;  2B8F A;  2R7F A;  4I7Z C;  3PO2 B;  5IYB G;  1EWI A;  3S1M B;  1VQI A;  2ICI A;  1JOK A;  4JI4 Q;  3K81 C;  4C1N I;  1PTO B;  1UNS A;  2UXB Q;  1JIC A;  4C56 C;  1JE5 A;  4L5Q A;  5BN4 A;  1FJG L;  2QDL A;  5IGD A;  4LF5 L;  4LFA L;  3JC6 6;  1F9R A;  2WAQ B;  3QOL A;  1W6K A;  1A8V A;  4DPG A;  3A56 A;  2R6G A;  4A3C H;  4IFD G;  3I2Z A;  4JBJ A;  4PQX A;  3CMA A;  4JOI A;  1Y1W H;  2AWN A;  4DNI A;  1M1K C;  3L3O C;  2EY1 A;  4F7X A;  4UP9 A;  4XYO A;  5FLX E;  5HUR A;  1YHA A;  2EY5 A;  1SAP A;  3D6W A;  4TSS A;  3QB3 A;  1JQY D;  1TVX A;  4JV5 Q;  1JWM D;  4X66 Q;  1QB5 D;  2K14 A;  1WTH A;  5KEE A;  3T53 B;  4EVO A;  4IOA A;  1LT4 D;  2ZJR A;  2KHI A;  1BCP D;  2F0N A;  2K75 A;  3M4P A;  3VA5 A;  2B2Y A;  4F87 A;  3AU7 A;  1FGU A;  4YY3 L;  4KN7 C;  5EBC A;  4CJ1 B;  4TVA B;  3H3V C;  1IL2 A;  3T51 B;  3ERQ A;  4AH6 A;  5C3E H;  2B3G A;  3I73 A;  5M3F B;  4I7A A;  4C2M B;  2B2V C;  4NW2 A;  5EAY A;  2RDG A;  4IPC A;  3AQQ A;  2OF1 A;  2K5N A;  3S17 B;  4DK6 C;  1V43 A;  4A4I A;  4JCV E;  1A15 A;  3D0F A;  1SNQ A;  5C4Z A;  2F4V L;  3DHQ A;  3LWU A;  3IKJ A;  2VUM H;  3UI2 A;  3J81 L;  3NTK A;  1TWA H;  3KLS A;  1VQL A;  2XIW A;  1C4Q A;  1X3G A;  1JJC B;  4POF A;  5C4J B;  3HOU G;  1EFW A;  2K1B A;  1SYF A;  4OO1 I;  3AB9 A;  5CBA E;  3K59 A;  2FMM A;  4DU9 A;  1GUW A;  2SOB A;  2G9H D;  3PQI A;  3FEW X;  3SGI A;  3S1R B;  3FDT A;  4A3K G;  1I4X A;  1F2M A;  3TEH B;  4KMU C;  1EIY B;  3PO3 H;  1F77 A;  3SK4 A;  2XRQ D;  1WTQ A;  1HUM A;  2BE5 D;  1PFN A;  3CCE A;  1SFO H;  1Y69 U;  3V96 A;  1B44 D;  1CZG A;  3KDF A;  1KHI A;  4OON A;  2HHH Q;  1QWY A;  3F8T A;  2PMZ E;  3A74 A;  1S5C D;  2E2H B;  1EU3 A;  4DUZ L;  4A3J B;  4GNX A;  1NR2 A;  1PTO C;  3R3O A;  4DN4 M;  3ITP A;  3HS0 C;  1GHK A;  1GD7 A;  3O13 A;  1GUO A;  2EYP A;  3WOF A;  1W3S A;  1EY9 A;  1LTB D;  1LTR D;  4TRD A;  1PZJ D;  1PRT D;  1SYB A;  1F2Z A;  1R4Q B;  5T1I A;  1SN8 A;  3UE0 A;  1N34 Q;  3AYH B;  2VW9 A;  1YIT A;  5DLQ E;  3SK8 A;  3BVM A;  3MXG A;  1Y8O B;  5JJL A;  1EIG A;  2VNU D;  1JWU D;  5ELN A;  2KUM A;  3STB D;  3DM1 A;  2XGT A;  1AW7 A;  1CK1 A;  4JI3 Q;  4YIJ A;  3K5N A;  4OHJ A;  3J80 c;  4BA2 I;  2L12 A;  4JI8 L;  4R4T A;  1LAC A;  1EU4 A;  2O4X A;  2BCO A;  1STE A;  3RZO H;  4YHH Q;  1K83 H;  4IO9 A;  5M3M G;  1MGS A;  2GVA A;  3R93 A;  1I6V C;  3K5L A;  1ZYR D;  1SRO A;  4EQN A;  1XNR L;  4IFD J;  1PLF A;  3VYR A;  2RVL A;  2MPM A;  3D4R A;  1CKM A;  1U4L A;  2Z6B A;  3NQI A;  2F52 A;  2WB1 G;  3CCM A;  1E7Z A;  2KA7 A;  3D4W A;  1G6P A;  2F0F A;  2OCE A;  5LL6 S;  1VQ6 A;  4LFA Q;  3I4N H;  4K5X A;  1XMO Q;  2KCT A;  1BOS A;  1AH9 A;  2A19 A;  3IFT A;  3ER0 A;  3BDL A;  3PUY A;  4R1J A;  3VR4 A;  3GTM H;  1TWC B;  1BXT A;  1ET9 A;  4IPH A;  3RNU A;  2EYJ A;  1KDA A;  2LFN A;  4A3I H;  1TY2 A;  4YCU A;  4JPB W;  3BDC A;  4A3M B;  2OTL A;  3M7N A;  4ZLT F;  3W1G A;  1WCM B;  1PXU A;  2VZA A;  2NVX B;  1YNN C;  4ZAI A;  1M4V A;  1WTV A;  3HKZ E;  2UUC L;  4DV6 Q;  5D14 A;  4Q5V A;  4BY1 B;  2PQA A;  1EIF A;  4NP5 A;  1R9T H;  1N36 Q;  5HGT A;  1D2B A;  2E2J H;  3RLO A;  4IUN A;  4RWS C;  4DR5 Q;  1WTR A;  2XVS A;  1FR3 A;  3GO5 A;  1PH1 A;  2PZU A;  2CFM A;  4ZCK A;  3OTO L;  3K5M A;  4RMF A;  1DJR D;  3ERO A;  4AYB G;  3I70 A;  2E5L L;  3JAM L;  2O2L D;  2UUB Q;  4DV3 Q;  1O7I A;  1TR5 A;  5C0X J;  1AE3 A;  2A69 D;  3G6E A;  3GTG H;  1PH2 A;  4CJ0 B;  5CV7 A;  2RF4 A;  1XMO L;  4LAA A;  2F0D A;  1DGS A;  3GTK H;  3E0E A;  3CCS A;  1OXX K;  4NXN Q;  1B70 B;  1L0Y B;  1PMR A;  2MUY A;  1PVO A;  2F0V A;  1GKH A;  2E75 C;  3GTL B;  4ZKB B;  1SSO A;  2AQ2 B;  4APV A;  1MSG A;  1HNX L;  5J22 A;  1U4P A;  3UE1 A;  2KOL A;  1EOV A;  4C1N K;  2O5J C;  3BJU A;  3M85 A;  3KJO A;  4DV7 Q;  2HHH L;  3FP9 A;  3RZD H;  2UXB L;  1EOT A;  2VXW A;  2E76 C;  1R9T B;  5JPN C;  3H15 A;  4KY6 A;  4DXF A;  3EN2 A;  3CCL A;  1VDZ A;  2K6A A;  5COY A;  4A93 G;  1C48 A;  4G4K A;  1A0I A;  5GRO A;  3OTO Q;  2GA4 B;  4PNY A;  2HCC A;  4KJO A;  4A3C G;  1L0X B;  3QJY A;  2IHE A;  4HR7 B;  2MJ8 A;  4DV1 Q;  2PPB C;  5JEA J;  3U9S A;  1VMC A;  4ZUI A;  2JA7 B;  4RHR A;  3TZD A;  5C6A A;  1H9S A;  4IUQ A;  5KYL A;  1PH8 A;  3I4O A;  1ESR A;  3GTO B;  1D5Z C;  4X62 L;  1ASY A;  1Q7Y C;  1CSP A;  3HOW B;  2NVT B;  3NBH A;  1CKO A;  3TQY A;  3CRL C;  1BO0 A;  2OTJ A;  3NTI A;  3IL8 A;  1DOM A;  3KJP A;  1XNR Q;  2C5C A;  4OWW B;  1FNU A;  4B3R L;  1C0A A;  2LY7 A;  1M90 C;  4C3J B;  3A54 A;  5C4X H;  5IYD G;  4BXX G;  3WWV A;  1VQJ A;  1T5E A;  3PCO B;  2JE6 I;  2IJ0 A;  3R2I A;  4Y7N B;  4R8I A;  4GKK L;  2F0S A;  4L5T A;  2Q8R E;  1CT1 D;  1O80 A;  4GOP C;  1VQM A;  1BCP C;  1NTG A;  2EVB A;  3MZ5 A;  4LFC Q;  3GV3 A;  2ZTE A;  4ILW A;  1YNX A;  3VR2 A;  1JJG A;  3PGZ A;  1B2T A;  4DV3 L;  5A2Q E;  1PFM A;  1G8Z D;  1VQH A;  1S5E D;  4R4C A;  2KVM A;  5CR3 A;  3CAM A;  3G7L A;  1JCK B;  5FO9 B;  1NE3 A;  5I9P A;  1XYI A;  2A74 C;  1Y1V H;  1Q82 C;  1KDB A;  5JJI A;  1B9N A;  4MNO A;  2JA8 H;  3G4S A;  2EXD A;  3MVV A;  4NKL A;  3M9B A;  2JA6 B;  1N36 L;  3L0O A;  3VYU A;  2X6L A;  3GTJ H;  1D5M C;  1J5E L;  4DAM A;  3T13 A;  1SYD A;  3ERS X;  2KCN A;  3FVQ A;  5DM7 3;  4P75 A;  3LGJ A;  2L15 A;  4F8M A;  1HZC A;  3TBI B;  1EYA A;  4CKE A;  1QVC A;  1LM0 A;  2NZO A;  3CW2 C;  3ICE A;  3BU2 A;  3JAM c;  1JE4 A;  2KHS A;  5CBE E;  3EJI A;  1UEB A;  5JEA G;  1PH5 A;  2F0L A;  2E5L Q;  4LF9 Q;  3MFG A;  5C3X A;  3T4A C;  3FKI G;  3ZJY C;  4MTN A;  4JI8 Q;  4JYA L;  4GLV B;  1ENA A;  3K80 C;  1H9R A;  2Z6K C;  3CPW A;  2IPK D;  3SXH A;  4BS9 A;  3X3N A;  4DR1 Q;  1E2V A;  3HOW H;  4JOI C;  2EY2 A;  1X56 A;  2KBN A;  4O2D A;  1MBY A;  2QCP X;  5C3E B;  1PFS A;  2UXD Q;  1VQN A;  2KED A;  2A6E C;  3J81 j;  2R61 A;  1CQF A;  5A35 A;  1Q12 A;  1KLG D;  3A5U A;  2WKD A;  2BH2 A;  1X3Q A;  4AYB E;  4A3G H;  2JN4 A;  4MZ9 A;  3M3Y H;  2EXZ A;  4X3K A;  5KND A;  4ZUJ A;  2L1B A;  3EQL C;  3EVQ A;  3V2T A;  2JQO A;  1RTO A;  3I72 A;  3J7A F;  1L1O A;  1SBB B;  3HOZ G;  1ROD A;  5IP9 H;  2CQO A;  5M5W H;  1O7L A;  3I4N G;  1B53 A;  4RGM A;  1I3Q H;  5DEH A;  4ZYS A;  4KD3 A;  1K8A C;  1QOH A;  3J81 c;  2NZH A;  1VCI A;  4U67 3;  1A6X A;  1UE1 A;  2LS0 1;  4YCW A;  1HZA A;  1IKL A;  3A55 A;  4A3E B;  2R7D A;  2WB1 E;  4IFD H;  2AMC B;  3S1R H;  1BUV T;  2PMZ B;  2B2U C;  3W1B A;  1KD1 C;  4KHV A;  3MXN A;  4A3I G;  4IFD I;  2K52 A;  4FXG C;  1Y8N B;  1FNW A;  2ZT9 C;  1IBM Q;  1E0B A;  1NCV A;  3U9O A;  3CKI B;  2JK8 A;  4QUC A;  1DYQ A;  2SNM A;  1ML0 D;  2VQE L;  4B3R Q;  2MFI A;  2E2H H;  1GM5 A;  3SVM A;  2NVX H;  2R93 G;  2JA9 A;  1MI2 A;  3G48 A;  3KBX A;  4A3F B;  2R7Z G;  1CKN A;  5FOB B;  1QE6 A;  4JI6 Q;  1K83 B;  1LYL A;  1XMQ Q;  5LMU L;  1XTC D;  1VQ9 A;  1HR0 L;  2A68 D;  4H44 C;  2JSO A;  3BYY B;  1XPU A;  3HOV B;  2Z9H A;  4XQJ A;  1JB7 A;  4P74 A;  1D1I A;  2GN5 A;  5JEA H;  3JAM E;  4H7B A;  5KGU A;  2B2W A;  1KNE A;  1BR9 A;  4DV2 L;  3S1N B;  1GHJ A;  1OTC A;  5JVH 3;  3E0J A;  3VR5 A;  1EL0 A;  1VS0 A;  4UHV A;  3OSO A;  4IUP A;  4JK1 C;  1HA6 A;  2EJM A;  3KLR A;  2JA5 B;  2IW3 A;  1J9O A;  2WV6 D;  4K5V A;  1KRT A;  5LMN L;  1A2U A;  1TY0 A;  5ELO A;  2WFW A;  3PMF A;  4C3J H;  4JI5 L;  4BY7 H;  3CHB D;  2UUC Q;  2G5D A;  4OO1 H;  2F3W A;  2IWH A;  1CSQ A;  1BBW A;  2YTY A;  4OXP A;  1WTP A;  3TS0 A;  4A3G G;  2ASB A;  3PF4 A;  4OWT B;  1G91 A;  3W3A A;  1UAP A;  1X3P A;  5KYI A;  1I94 Q;  2V4D A;  5IY0 A;  5GAH C;  3PUV A;  1E3P A;  1HTP A;  2NUC A;  2ZM6 L;  3KF8 B;  3IAY A;  1IW7 D;  4K0K Q;  4IUR A;  3EBE A;  3GTQ B;  1PRT B;  1MKH A;  1LTI D;  5C5L A;  1PFB A;  2EDG A;  4B3S L;  2HIX A;  2LMC B;  3FRP B;  3S15 H;  3H3V H;  3HKZ B;  1VQE A;  3PSI A;  3CQZ B;  2TSS A;  2J0T D;  2JA8 B;  1EQQ A;  1K8G A;  3NWT A;  1EY0 A;  3T56 B;  2A6H D;  3J81 E;  1VQ4 A;  3GTJ B;  2EJG C;  1TWF B;  3GTP H;  1LT6 D;  4K6L A;  4BY7 G;  1ET6 A;  3SHL A;  1DOL A;  2XN9 C;  3T1Y L;  1STB A;  1UE7 A;  3PV0 A;  1IYV A;  3NEL A;  3I3C A;  1O78 A;  4DV7 L;  2UUA L;  1P16 A;  4J15 A;  4WJ3 M;  3HOY B;  2R92 B;  4BWG B;  5IOD A;  3KLW A;  2UXD L;  5K5P A;  4K6D A;  4JI2 L;  1VQG A;  4BXX H;  5IYD H;  1V1Q A;  3E9I A;  4BY1 G;  2RQX A;  2PO4 A;  2Q2I A;  3KYH C;  4BBR H;  2RBM A;  1WTW A;  1A3V A;  2ZM6 Q;  5JAV A;  1LTT D;  5C44 H;  1CZW A;  2CWA A;  4DR3 Q;  5C0X G;  4DV4 L;  1HRJ A;  5CV5 A;  1BNZ A;  2VS1 A;  2ZXR A;  3K7U C;  3S16 H;  3OYY A;  3QWN A;  1YNJ C;  1LO5 D;  3H0G G;  5E1F A;  5J1Z A;  3I55 A;  4L8J A;  1PYS B;  4YWM A;  1IXR A;  2I5M X;  1SLJ A;  4RKL A;  2RDF A;  5AJ3 L;  3R2T A;  3RZD B;  2B8G A;  4KHP L;  2NTS A;  3OMG A;  2OXP A;  4GNX B;  1SJH D;  1WVL A;  1KAW A;  4ZRZ A;  2SEB D;  1RKN A;  4QY7 A;  4OX9 L;  2F0W A;  4P71 A;  3A7L A;  3UDG A;  1K3B C;  2PW7 A;  3MXU A;  1B8A A;  1HHV A;  1P8L A;  4IUU A;  1K3R A;  1I3Q B;  3GP7 A;  2J7Z A;  1XXG A;  4MHE A;  1QZH A;  3DWQ A;  2WAQ G;  3MAQ A;  3S17 H;  1SND A;  1X6O A;  1FGB D;  1IZ6 A;  4P2C B;  4NMZ A;  2IHF A;  4XDX A;  5COR A;  5NUC A;  5IP7 G;  4IQZ A;  3S1Q H;  2EQS A;  4LFC L;  2ES2 A;  3S16 B;  2YYZ A;  3GTO H;  2VUM G;  3DWP A;  1Z47 A;  1CHP D;  1RCV D;  3KF6 B;  4QIW B;  1B9M A;  2PNR C;  1GOZ A;  3GTL H;  4QMG A;  5IYC H;  5CV8 A;  2WAQ E;  1S40 A;  1Z7T A;  2A73 B;  3OHX C;  4HED A;  1NJI C;  2ZXO A;  1GO3 E;  3CC4 A;  2OQK A;  5CV4 A;  4DR7 L;  1BKB A;  4BBS G;  1PZK D;  2R7Z H;  2F0Q A;  2B2T A;  3S24 A;  2F4I A;  2L4N A;  3HOY H;  1WJJ A;  3C1E A;  2RHS B;  3MXN B;  3TP7 A;  1JOO A;  1K9M C;  4KV6 A;  4A3D G;  1K73 C;  1ZYR C;  1RDP D;  5EPL A;  4BBR G;  4NXM Q;  1B3A A;  1HNW L;  1N32 L;  2B63 G;  3PIO 3;  1EYD A;  1F9S A;  1AZQ A;  4N8F A;  2ALY B;  3VYS A;  5KRU A;  4X65 L;  1RTN A;  1EEI D;  1EFI D;  4LK1 C;  2PI2 A;  4B3S Q;  5EGT A;  4CJ2 C;  1VQA A;  1B50 A;  4R4O A;  1B1Z A;  1GVP A;  4IPG A;  4N9P A;  4LF8 L;  2EJF C;  3NEN A;  3P1H A;  2A1A A;  2F0K A;  4DV4 Q;  1PV4 A;  2LKV A;  1FVI A;  4TQU S;  1DON A;  3CXC A;  4WOR A;  2BA1 A;  5C4J H;  3T16 A;  4ABN A;  2PZW A;  3C1F A;  1C7Y A;  2ICE C;  4E6I A;  4GKJ Q;  4RGN A;  3K0Y A;  4POG A;  3CME A;  3CF5 A;  4XQN A;  5M3F H;  2NVY H;  2ZTD A;  1MJE A;  2MO0 A;  5AJ3 Q;  1KQS A;  5FKA C;  2F0T A;  3S14 B;  1SJE D;  2JEA I;  2HT1 A;  4GLA C;  1XJV A;  1OXU A;  3KDF B;  1XNQ L;  4QCL A;  1QVG A;  3I90 A;  3H91 A;  1ICW A;  1IL8 A;  1MJC A;  1STH A;  4RAU C;  1J6Q A;  1I4H A;  5E3F A;  2K4K A;  1F2Y A;  2K5H A;  3CD6 A;  1LV9 A;  1XWE A;  3NK9 A;  1LUZ A;  3H3V I;  3TME A;  3MFY A;  1IBL L;  1UE5 A;  4A3B B;  2AUJ D;  2EIF A;  1ILQ A;  1YIJ A;  1KAB A;  1PA6 A;  3FMC A;  1TWH B;  4PV1 C;  5E4W C;  4QL5 A;  4LF6 Q;  2ZJQ A;  4JI1 Q;  2XRS D;  4FXD A;  4GZY C;  5I9O A;  1Q81 C;  2KEC A;  1X3F A;  3BYT B;  2K01 A;  1VQ5 A;  4KY5 A;  4NPS A;  3QO2 A;  3FKI B;  4WFN 3;  4QUF A;  1AEX A;  1X54 A;  1PYW D;  3Q24 A;  4A3J H;  5ELC A;  4XQQ A;  1KLU D;  1E1T A;  4IJL A;  1S3O A;  4IZ8 A;  3U50 C;  2CQA A;  4BY1 H;  5D3D A;  1PYB A;  3Q23 A;  2XWB B;  4DAY B;  3KBG A;  4HIK A;  2VQE Q;  1SMY C;  2WII B;  1ZXT A;  1LT5 D;  4R9W A;  4EQP A;  4DV6 L;  1NR4 A;  2UUA Q;  2B2Y C;  2E2J B;  4A3D H;  2WP8 J;  2XSC A;  1WFQ A;  4HJ5 A;  2LXK A;  1TII D;  2WB1 B;  3OWE B;  2LXJ A;  3F2B A;  3PO2 H;  1VQP A;  2UUB L;  3M4Q A;  4CDE C;  4KD4 A;  1EY7 A;  4XYQ A;  5FO7 B;  4O42 A;  5C5M A;  3GTG B;  1X65 A;  3NBI A;  2B29 A;  1Q8I A;  1I4Q A;  1Q3L A;  5JJZ A;  1HZB A;  1W6J A;  3QOJ A;  4YCV A;  3L7Z C;  1E24 A;  1TWA B;  1BQQ T;  1EWC A;  2L5T A;  3F2U A;  3GTK B;  3T1H L;  2IX3 A;  3I4N B;  4BA1 I;  1IHZ A;  2NVQ B;  4JVZ A;  1Q90 A;  3HOX H;  1Y1W B;  2ZXP A;  1EUJ A;  4OEM B;  3A8I E;  4G7O C;  2QW7 A;  4FXK C;  2MNA A;  4FNF A;  1YHQ A;  4KHP Q;  4KK7 A;  2FFK B;  2VY3 A;  2NVY B;  4FYD A;  4JI5 Q;  4DR5 L;  2SDF A;  1R4P B;  2Y0S B;  1VF7 A;  1NAP A;  4PZ8 A;  4ODG A;  2UXC Q;  1RL2 A;  5TSS A;  1C8C A;  1QG7 A;  1QVF A;  3MXP A;  4A3F H;  3S14 H;  3VA7 A;  4ME3 A;  1UWV A;  5CMD A;  2F0G A;  1PH3 A;  4GOP B;  2RSO A;  4OEL B;  1WD1 A;  3ONA B;  2V1C C;  4Z9C B;  5C44 G;  4X64 Q;  1VQ7 A;  1TT2 A;  1SMY D;  5IGG A;  1FNV A;  2NYZ D;  2D62 A;  2PQA B;  2KCC A;  5M5W B;  4A3L G;  3S2D B;  2I07 B;  5EPK A;  4K2L A;  5IGB A;  4NXN L;  5GAD C;  3PIP A;  5IYC G;  4HID A;  1HCZ A;  5E4X A;  4DUY L;  1KRS A;  2EE1 A;  4OGQ C;  4A3E H;  1H9J A;  2M9V A;  2BA0 A;  1EY5 A;  4KKS A;  4RH6 A;  1XPO A;  1SE3 A;  3RR5 A;  4C3I G;  5LL6 X;  3A8K E;  3W5O A;  4O0A A;  1I6H B;  5FK9 C;  4DR4 Q;  5IYB H;  3RN5 A;  4I65 A;  3J7Z C;  4B3M Q;  1V8Q A;  5M3M H;  5DAU A;  1NUC A;  1BDO A;  4AQY L;  4RFB A;  3Q6S A;  2CH4 W;  4K0K L;  3TRZ A;  2HCI A;  1YJ9 A;  3PO3 B;  2F0H A;  3OIQ A;  1RHP A;  5ISR A;  3B6Y A;  5EJW A;  4CGY B;  2Q2T A;  3S2H H;  5D65 A;  4X3S A;  4B9W A;  1YI2 A;  5C4X G;  2PYK A;  4X3T A;  5F2D A;  4DR2 Q;  1HH2 P;  1DZ1 A;  2F03 A;  1HNW Q;  1N32 Q;  3CQZ H;  1G51 A;  5KNB A;  2CW0 C;  4DR3 L;  5M9O A;  4X65 Q;  1A3T A;  4UP7 A;  1SDF A;  5EPJ A;  2RCF A;  1HFN A;  2N8N A;  3NXW A;  5BR8 Q;  5CGK A;  2CHB D;  3F1Z A;  1RF2 D;  1O7Z A;  5IWA Q;  3GTP B;  1O7Y A;  3E6Z X;  4YWL A;  1NMF A;  4LF7 Q;  3M4O H;  4ME5 A;  2EZV A;  1F9P A;  3L9A X;  1SYE A;  2ZJP A;  1A2T A;  1GXD C;  3AEV A;  3SK5 A;  2OQ0 A;  4PMB A;  5IT9 E;  1HNZ Q;  3GTM B;  1PH6 A;  2KHJ A;  3G6J B;  2YV5 A;  1Y1V G;  1EYC A;  1GJX A;  3HOX B;  4L63 B;  1A62 A;  2CCZ A;  4KHZ A;  5C3E G;  2AKW B;  4JV5 L;  3X3M A;  2IY5 B;  2NWG A;  3BS1 A;  2HIV A;  4C3J G;  4H0L C;  1DD2 A;  1DOK A;  2HQE A;  2Z1C A;  1EQR A;  3HP3 A;  2WAC A;  3TS2 A;  2B63 H;  2F0I A;  5JPM C;  2R92 G;  2L9H A;  3TDQ A;  4MN3 A;  1IKM A;  2E2I B;  3I4M G;  1OXT A;  1QNK A;  5KNC A;  2NB0 A;  2Z0S A;  2Q2U A;  2RA4 A;  3LX0 A;  4LF4 L;  3DXJ C;  1BCP B;  3KK7 A;  1EEF D;  2Q8T A;  3SR1 A;  1S5F D;  3HOU H;  3F2C A;  3PUW A;  2EY6 A;  3BDO A;  2NBF A;  1PTO F;  3ND8 A;  1D6E C;  1JMC A;  1DCZ A;  2RSN A;  4A3M G;  2DN8 A;  3ULL A;  2XNA C;  4DV5 L;  2K5Q A;  1DXM A;  5D3I B;  1ASZ A;  2JA6 G;  3G71 A;  4IOC A;  4FF3 A;  2K7V A;  1HQR D;  4OWX B;  2YU9 B;  1HQM C;  4YWK A;  3MHB A;  4GNX C;  4JW0 A;  2O5I C;  3PO2 G;  2RDH A;  1C9O A;  4HSV A;  4FF4 A;  3H6M A;  3KUP A;  4K8I A;  1K0R A;  5M3M B;  3RN2 A;  3JAM i;  3D3R A;  1IBL Q;  3S1Q B;  1K0S A;  1NMG A;  1I5F A;  4LW1 A;  3M4Y A;  5EKI A;  1YJW A;  4FO2 A;  5A2Q L;  2K5W A;  2R7Z B;  1B3Q A;  1X32 A;  1S72 A;  1BCP F;  3MEF A;  2VB3 X;  1TS5 A;  2OWO A;  5CYU A;  4LF5 Q;  1TWC H;  3D6C A;  3GD7 A;  4J6H A;  3HOV G;  4X64 L;  2VQF L;  5ELB A;  2N49 A;  1VQO A;  3KLS X;  4A3B H;  3V05 A;  3MTS A;  5FO8 B;  1U9R A;  2N55 A;  4UP8 A;  5FJ8 H;  1SEB D;  2JA7 H;  3AFQ A;  4HN7 A;  3T1H Q;  4JBM A;  4DV0 Q;  3FHW A;  4XTC S;  3D4D A;  5IGE A;  5FLM H;  2F0P A;  2HQL A;  4EX5 A;  1UEA B;  1V1O A;  1YEZ A;  1PH9 A;  1L2F A;  4JI4 L;  1HUN A;  5C4H A;  1EZ6 A;  1B7Y B;  4C3H G;  4DR4 L;  1D8L A;  2B2V A;  4JI6 L;  1V9P A;  5G3L F;  3J81 i;  4RG1 A;  2D0O A;  5EBD A;  2IL8 A;  5JVG 3;  4XT3 B;  3LNN A;  2D2C C;  1N34 L;  2F1M A;  2AUK A;  1WYD A;  4GN3 B;  3VR3 A;  3BZK A;  1LLR D;  3PF5 A;  4FDB A;  5J39 A;  1SYG A;  3CPF A;  5BN5 A;  4AYB B;  4QB4 A;  2BOS A;  3NPP A;  1TWG H;  1Q86 C;  1Q1E A;  1ENF A;  1FYC A;  4GKJ L;  1J8I A;  3VR6 A;  1DM0 B;  2DY8 A;  4JI7 Q;  1ENC A;  1JR0 D;  1EQT A;  1EWH A;  1MHW C;  1GUN A;  4A3M H;  1HFG A;  4O1N A;  1Q8K A;  2MQH A;  1I4G A;  4XXE A;  1D1K A;  2F0E A;  4LUO A;  4LF7 L;  2EYL A;  1TWH H;  4X66 L;  4KKU A;  1S5B D;  4BY7 B;  1CM9 A;  1Q1B A;  1NY4 A;  2IX0 A;  2AQ1 B;  3QIA A;  1SXT A;  2K05 A;  1KAA A;  2R93 B;  2YU9 H;  1GUT A;  3HEJ A;  3RLN A;  1NNX A;  2JXM B;  3TN2 A;  4C2M H;  1HPC A;  1AN8 A;  5C0X I;  1K8O A;  2TMP A;  3J7A 5;  3QG1 A;  4KY7 A;  4X6A H;  4GN4 B;  1JC7 A;  1I4R A;  1U0L A;  2NZ1 D;  4HMI A;  4X3U A;  3HOV H;  5L37 A;  4J1M A;  1HR0 W;  4FF1 A;  2ID0 A;  2EYO A;  3HG9 A;  4QJF A;  4HJA A;  1SNO A;  1PH4 A;  2NVT H;  4DR1 L;  1SNM A;  1M8A A;  3HFZ B;  1VF5 C;  4DK0 A;  2M00 A;  1RIP A;  1S4Z A;  1G2T A;  3FKI H;  1SYC A;  5BN3 A;  5FJ8 G;  2VQF Q;  3A8J E;  4DV5 Q;  3K57 A;  2JA7 G;  3K6O A;  4YHH L;  1TWF H;  2K33 A;  3J80 L;  4YY3 Q;  3RUZ A;  1CA5 A;  1TQO A;  4RCO A;  1CTM A;  3W2D A;  4K2K A;  3HOW G;  1Z9F A;  1F2L A;  4A76 A;  4EGV A;  2A68 C;  2R92 H;  5C3W A;  2PW5 A;  1SE2 A;  5M3F G;  4RGT A;  1V1P B;  1GUS A;  4C3H H;  3E9H A;  2K5V A;  4HTH A;  2F4V Q;  2P5Z X;  2QA4 A;  4JI2 Q;  2K04 A;  4DXG A;  1I94 L;  2QKI C;  2F3V A;  1KDC A;  2VB2 X;  1E1O A;  4MIU A;  2F0U A;  4QF4 A;  3RD4 A;  2EYM A;  1EYG A;  4HJ9 A;  3HKZ G;  5IP9 G;  5C0X H;  2B2W C;  2FJ2 A;  1QUQ A;  1XTD A;  1PRT F;  3OMC A;  1AFP A;  3J7Y W;  4ULL A;  1KXL A;  2Y0S E;  1IBM L;  4EQ5 A;  3CCV A;  4ALP A;  4PMC A;  4UPA A;  1ZEQ X;  3T1Y Q;  4B9X A;  1IYJ B;  2E2D C;  4L6T B;  4U68 A;  4V0B A;  4JI3 L;  3AFP A;  3K5O A;  2Q8I B;  5E7N A;  4XIG S;  4V19 0;  3BG3 A;  5CC4 A;  3CCJ A;  2NN6 H;  3DMU A;  3H94 A;  4CBV A;  2CW0 D;  4H02 A;  3CRK C;  3C46 A;  3E5S A;  4B3M L;  5EQ0 A;  4BBS B;  3EFX D;  4LMQ D;  2MHV A;  1FL0 A;  5IGC A;  3I4L A;  1XX8 A;  1HTL D;  2R93 H;  2DUD A;  2LSS A;  1EZ8 A;  2Y0S G;  4NXM L;  2KEN A;  3HOZ B;  4IJH A;  3S2D H;  1QCB D;  2L0C A;  3IRB A;  1CQV A;  1YZ6 A;  3OIP A;  2UU9 Q;  5M5X B;  1N33 Q;  1SR3 A;  3ULJ A;  4LWC A;  2BDN A;  2AHO B;  4ZKC B;  2I5L X;  1BBU A;  1OXS C;  2Q2H A;  5DNF A;  1T9H A;  2JJQ A;  4DV1 L;  2EOT A;  4EQO A;  4JI7 L;  4KTA A;  2H4O A;  1E22 A;  4DGZ A;  3R8B A;  5IWA L;  3Q8D A;  1LTG D;  2NVQ H;  3I91 A;  1STN A;  1I50 B;  1HNX Q;  1IBK L;  1ESF A;  4LF8 Q;  3PIP 3;  2E8G A;  2B2U A;  2FIN B;  1L0W A;  1VQK A;  4JI0 Q;  2YTX A;  1JOQ A;  4L5R C;  3K58 A;  1WCM H;  4HMJ A;  4JBW A;  1KC8 C;  2QGQ A;  1HXY D;  2VL6 A;  1F9Q A;  4C3I B;  1ILP A;  2K5D A;  2C9O A;  4UAI A;  1XPR A;  4OO1 G;  1MIU A;  1OXV A;  2N88 A;  2PZT A;  3U4Z A;  1CA6 A;  3CP0 A;  4K14 A;  4BBS H;  4PZ6 A;  3Q22 A;  1SMX A;  2YTV A;  3K7A H;  3ND9 A;  2JEB I;  4G7Z C;  3TP8 A;  5EKL A;  3U4V A;  4RA8 A;  4TKO B;  2F0M A;  3HZX A;  1H95 A;  4J8Q A;  2D9U A;  4PMW A;  2QDB A;  1PHJ A;  1TKW B;  1PTO H;  2JP1 A;  2AWO A;  5I6W A;  1NSN S;  4DAV A;  3UDI A;  4K8J A;  3DM3 A;  2ZTC A;  3NHH A;  3RMH A;  4CKC A;  3VDY A;  3K0X A;  4A3B G;  4LF6 L;  4PG3 A;  4HSP A;  5HGQ A;  3VYT A;  3M4O B;  1H9M A;  4Y7N H;  3A7A B;  2DY7 A;  1QJO A;  4A3K H;  2C35 B;  4DAP A;  4LJZ C;  3RLF A;  4ZQ3 A;  3SDZ A;  1TS4 A;  2G9D A;  4DAY A;  1PH7 A;  4A75 A;  1WCM G;  4LF9 L;  4DR7 Q;  4A3E G;  1TU2 B; 
#chains in the Genus database with same CATH homology
 3LWE A;  2M2L A;  4OIK A;  2NN6 G;  4A3I B;  4G57 A;  1G29 1;  2K32 A;  1KNA A;  3SE0 A;  4A3G B;  2MGS A;  2KJX A;  1PZI D;  1Y1V B;  2WKC A;  4A3D B;  4G7H C;  2AQ3 B;  3S2H B;  1HA5 A;  5FLX L;  1G6Z A;  3TSS A;  3OW7 A;  3URY A;  2ENB A;  3N52 A;  3HOU B;  1QNU A;  3I4M B;  4A3K B;  2NTT A;  5M5Y B;  3CU7 A;  1LTS D;  1LAB A;  4F88 A;  3H09 A;  1WTX A;  4DNR B;  4H13 C;  4RHS A;  4CHT B;  2XWJ B;  3DUZ A;  2HDL A;  4S3S A;  1QIL A;  3MEH A;  3BVG A;  3HRZ C;  3DEO A;  4A93 B;  1CFM A;  1EIH A;  5I4D A;  1G2S A;  3TP5 A;  1Y8P B;  2HDM A;  5G3L D;  1JWS D;  1KTK A;  1B4O A;  1CHQ D;  1I4P A;  1V1P A;  5AFW A;  3S9W A;  4IUT A;  2IX1 A;  1SE4 A;  2Z4I A;  4OIJ A;  2F0J A;  3HGB A;  2FMC A;  1SFO B;  5CV6 A;  4M1U B;  5DM6 3;  3DWA A;  3AMU A;  4IUV A;  3NUC A;  4DF7 A;  5T1G A;  1RJT A;  2A69 C;  1OO9 B;  4RCN A;  3RZO B;  2KEE A;  1AP0 A;  3EA6 A;  5ELE A;  1AZP A;  3Q0A A;  4DK1 A;  3KF8 A;  3D8G A;  2NN6 I;  4IN3 A;  3GQB A;  1GUG A;  2B2T C;  2QEJ C;  3NE5 B;  2BDO A;  2Z8L A;  4C3H B;  2DNE A;  2FHT A;  3BZD B;  4FF2 A;  3BVZ A;  3S15 B;  4OL7 A;  5I2X A;  1YNN D;  5EKK A;  3WDN A;  2K28 A;  1H9S B;  3I8Z A;  1LTA D;  2R3Z A;  4DA2 A;  1A3U A;  4Q0F A;  1RD9 D;  2CVR A;  4CKB A;  3H0G B;  2E74 C;  2K03 A;  1WD0 A;  3DEP A;  5I2Y A;  3K7A B;  2D5D A;  4M8A A;  3TZU A;  5K36 H;  2EPB A;  3NWS A;  2JYO A;  3M3Y B;  1IW7 C;  5ELF A;  5CV9 A;  2RKS A;  4B08 A;  4BBR B;  1BF4 A;  2B63 B;  5IGF A;  1MD2 D;  4RKB A;  2L55 A;  5C44 B;  1BBX C;  3TP6 A;  5IIF A;  3IFD A;  3OOC A;  1CI3 M;  3NSW A;  4NDX A;  3MA2 B;  3P7J A;  4N9T A;  1UUP A;  1MSH A;  3N6R A;  1YNJ D;  3PUZ A;  2VUM B;  5ELD A;  2PQE A;  1VMP A;  1U4R A;  4HCS A;  2MP1 A;  4KJN A;  2QF7 A;  3SK6 A;  5KIX A;  1STA A;  1PRT C;  4K5W A;  3NTH A;  5JOB A;  1JOR A;  3SEB A;  2J4X A;  3ZYY X;  2OT2 A;  1PTO D;  1S5D D;  1SNC A;  2L11 A;  1D5X C;  1E2W A;  1II3 A;  1STY A;  1EQV A;  4ID6 A;  1PDQ A;  3P75 A;  2X69 A;  3OPO A;  2A5H A;  1T5X D;  4DNT B;  1EY4 A;  2BE5 C;  2EYF A;  1Z6H A;  5I6Y A;  4XT1 B;  2HUG A;  2A6H C;  3J7A V;  1SNP A;  4FP5 D;  4WRD A;  1EY6 A;  1EY8 A;  4RGO S;  3OWF A;  1JB3 A;  3WOE A;  2B39 A;  1TS3 A;  1LT3 D;  5IOC A;  3D31 A;  5K36 G;  1K8M A;  3C3L A;  4HCE A;  2F0O A;  2X6G A;  1ZKO A;  4KKT A;  3FPU B;  2QIL A;  1IYU A;  1H9K A;  3C2P A;  2Z4H A;  5IT9 L;  4KI0 A;  3GV6 A;  1STG A;  4WJW A;  2SNS A;  2EYH A;  1FD7 D;  3J80 E;  3P20 A;  2A6E D;  3MWY W;  4IAL A;  4R8N A;  1TWG B;  3NP8 A;  2DNC A;  2PCF B;  4KN4 C;  3MC0 B;  1U4M A;  4ZK9 B;  1WTO A;  3M7G A;  4FVM A;  2WIN B;  1ONL A;  2I46 A;  4HAE A;  2IT1 A;  3PUX A;  5LHY 1;  4DFA A;  3NQT A;  1TS2 A;  1E2Z A;  3FPP A;  2KQ3 A;  2OEO A;  2H1E A;  4UDU C;  2B8F A;  3PO2 B;  4I7Z C;  3S1M B;  2ICI A;  1JOK A;  4C1N I;  1PTO B;  1UNS A;  1JIC A;  4C56 C;  5BN4 A;  5IGD A;  1F9R A;  2WAQ B;  3QOL A;  1W6K A;  3A56 A;  2R6G A;  4IFD G;  4PQX A;  2AWN A;  3L3O C;  2EY1 A;  4F7X A;  4XYO A;  5FLX E;  5HUR A;  2EY5 A;  1SAP A;  3D6W A;  4TSS A;  3QB3 A;  1JQY D;  1TVX A;  1JWM D;  1QB5 D;  5KEE A;  3T53 B;  4EVO A;  1LT4 D;  1BCP D;  2F0N A;  3VA5 A;  2B2Y A;  4F87 A;  3AU7 A;  4KN7 C;  5EBC A;  4CJ1 B;  3H3V C;  3T51 B;  3ERQ A;  3I73 A;  5M3F B;  4C2M B;  2B2V C;  4NW2 A;  2RDG A;  2OF1 A;  3S17 B;  1V43 A;  1A15 A;  1SNQ A;  5C4Z A;  3DHQ A;  3LWU A;  3IKJ A;  3J81 L;  3UI2 A;  3NTK A;  3KLS A;  2XIW A;  1C4Q A;  5C4J B;  2K1B A;  1SYF A;  4OO1 I;  3AB9 A;  5CBA E;  3K59 A;  2FMM A;  4DU9 A;  1GUW A;  2SOB A;  2G9H D;  3FEW X;  3S1R B;  3FDT A;  1I4X A;  1F2M A;  4KMU C;  1F77 A;  3SK4 A;  2XRQ D;  1WTQ A;  1HUM A;  2BE5 D;  1PFN A;  1Y69 U;  3V96 A;  1B44 D;  1CZG A;  1QWY A;  1S5C D;  2E2H B;  1EU3 A;  4A3J B;  1NR2 A;  1PTO C;  3R3O A;  4DN4 M;  3ITP A;  3HS0 C;  1GHK A;  3O13 A;  1GUO A;  2EYP A;  3WOF A;  1EY9 A;  1LTB D;  1LTR D;  4TRD A;  1PZJ D;  1PRT D;  1SYB A;  1F2Z A;  1R4Q B;  5T1I A;  5C4X B;  3SK8 A;  3BVM A;  3MXG A;  1Y8O B;  1EIG A;  2VNU D;  1JWU D;  2KUM A;  3DM1 A;  1AW7 A;  1CK1 A;  4YIJ A;  3K5N A;  4OHJ A;  4BA2 I;  2L12 A;  1LAC A;  1EU4 A;  2O4X A;  2BCO A;  1STE A;  1MGS A;  3R93 A;  1I6V C;  3K5L A;  1ZYR D;  4EQN A;  4IFD J;  1PLF A;  3VYR A;  2RVL A;  2MPM A;  3D4R A;  1U4L A;  3NQI A;  2KA7 A;  3D4W A;  2F0F A;  5LL6 S;  4K5X A;  1BOS A;  3PUY A;  3IFT A;  3VR4 A;  3BDL A;  1TWC B;  1BXT A;  1ET9 A;  2EYJ A;  1KDA A;  2LFN A;  1TY2 A;  4A3M B;  3M7N A;  3BDC A;  4ZLT F;  1WCM B;  1PXU A;  2NVX B;  1YNN C;  4ZAI A;  1M4V A;  1WTV A;  5D14 A;  4Q5V A;  4BY1 B;  4NP5 A;  5HGT A;  1D2B A;  4IUN A;  4RWS C;  1WTR A;  2XVS A;  1FR3 A;  3GO5 A;  2PZU A;  3K5M A;  1DJR D;  3ERO A;  3I70 A;  3JAM L;  2O2L D;  1TR5 A;  5C0X J;  2A69 D;  4CJ0 B;  5CV7 A;  4LAA A;  2F0D A;  1OXX K;  1L0Y B;  1PMR A;  2MUY A;  2F0V A;  2E75 C;  3GTL B;  4ZKB B;  1SSO A;  2AQ2 B;  1MSG A;  5J22 A;  1U4P A;  2KOL A;  4C1N K;  2O5J C;  3M85 A;  1EOT A;  2VXW A;  2E76 C;  1R9T B;  5JPN C;  4KY6 A;  4DXF A;  1VDZ A;  2K6A A;  5COY A;  1C48 A;  4G4K A;  2GA4 B;  4PNY A;  2HCC A;  4KJO A;  1L0X B;  3QJY A;  4HR7 B;  2MJ8 A;  2PPB C;  5JEA J;  3U9S A;  1VMC A;  4ZUI A;  2JA7 B;  3TZD A;  4RHR A;  5C6A A;  1H9S A;  4IUQ A;  5KYL A;  1ESR A;  3GTO B;  1D5Z C;  3HOW B;  2NVT B;  3NBH A;  3CRL C;  1BO0 A;  3NTI A;  3IL8 A;  1DOM A;  2C5C A;  1FNU A;  2LY7 A;  4C3J B;  3A54 A;  1T5E A;  2JE6 I;  2IJ0 A;  3R2I A;  4Y7N B;  4R8I A;  2F0S A;  2Q8R E;  1CT1 D;  1O80 A;  1BCP C;  2EVB A;  3MZ5 A;  3GV3 A;  4ILW A;  3VR2 A;  1B2T A;  5A2Q E;  1PFM A;  1G8Z D;  1S5E D;  2KVM A;  5CR3 A;  3G7L A;  1JCK B;  5FO9 B;  5I9P A;  1XYI A;  2A74 C;  1KDB A;  1B9N A;  3MVV A;  4NKL A;  2JA6 B;  3VYU A;  2X6L A;  1D5M C;  3T13 A;  1SYD A;  2KCN A;  3FVQ A;  5DM7 3;  4F8M A;  3TBI B;  1EYA A;  4CKE A;  1JE4 A;  2KHS A;  5CBE E;  3EJI A;  5JEA G;  2F0L A;  3MFG A;  5C3X A;  3T4A C;  1ENA A;  1H9R A;  2IPK D;  3SXH A;  4BS9 A;  3X3N A;  1E2V A;  2EY2 A;  1MBY A;  2QCP X;  5C3E B;  2KED A;  2A6E C;  2R61 A;  1CQF A;  5A35 A;  1Q12 A;  1KLG D;  2WKD A;  1X3Q A;  2EXZ A;  4X3K A;  5KND A;  4ZUJ A;  2L1B A;  3EQL C;  3EVQ A;  3V2T A;  1RTO A;  3I72 A;  3J7A F;  1SBB B;  1ROD A;  1O7L A;  1B53 A;  4RGM A;  5DEH A;  4ZYS A;  4KD3 A;  1QOH A;  4U67 3;  1VCI A;  1A6X A;  2LS0 1;  1IKL A;  3A55 A;  4A3E B;  4IFD H;  1BUV T;  2PMZ B;  2B2U C;  4KHV A;  3MXN A;  4IFD I;  4FXG C;  1Y8N B;  1FNW A;  2ZT9 C;  1E0B A;  1NCV A;  3U9O A;  3CKI B;  4QUC A;  1DYQ A;  2SNM A;  1ML0 D;  3SVM A;  1MI2 A;  3KBX A;  4A3F B;  5FOB B;  1QE6 A;  1K83 B;  1XTC D;  2A68 D;  4H44 C;  2JSO A;  3BYY B;  3HOV B;  4XQJ A;  1D1I A;  5JEA H;  3JAM E;  4H7B A;  5KGU A;  2B2W A;  1KNE A;  1BR9 A;  3S1N B;  1GHJ A;  5JVH 3;  3E0J A;  3VR5 A;  1EL0 A;  3OSO A;  4IUP A;  4JK1 C;  1HA6 A;  2EJM A;  3KLR A;  2JA5 B;  2IW3 A;  1J9O A;  2WV6 D;  4K5V A;  1A2U A;  1TY0 A;  3PMF A;  3CHB D;  4OO1 H;  2F3W A;  2IWH A;  1WTP A;  1G91 A;  3W3A A;  1UAP A;  1X3P A;  5KYI A;  2V4D A;  3PUV A;  1HTP A;  2NUC A;  3IAY A;  1IW7 D;  4IUR A;  3GTQ B;  1PRT B;  1LTI D;  5C5L A;  1PFB A;  2EDG A;  2LMC B;  3FRP B;  3HKZ B;  3CQZ B;  2TSS A;  2J0T D;  2JA8 B;  3NWT A;  1EY0 A;  3T56 B;  2A6H D;  3J81 E;  3GTJ B;  2EJG C;  1TWF B;  1LT6 D;  4K6L A;  1ET6 A;  3SHL A;  1DOL A;  2XN9 C;  1STB A;  3PV0 A;  1IYV A;  3I3C A;  1O78 A;  3HOY B;  2R92 B;  4BWG B;  5IOD A;  5K5P A;  4K6D A;  2RQX A;  2PO4 A;  2RBM A;  1WTW A;  1A3V A;  5JAV A;  1LTT D;  1CZW A;  5C0X G;  1HRJ A;  5CV5 A;  1BNZ A;  2ZXR A;  3QWN A;  1YNJ C;  1LO5 D;  5E1F A;  5J1Z A;  4L8J A;  4RKL A;  2RDF A;  3R2T A;  3RZD B;  2B8G A;  2NTS A;  3OMG A;  2OXP A;  1SJH D;  1WVL A;  4ZRZ A;  2SEB D;  1RKN A;  2F0W A;  3A7L A;  2PW7 A;  3MXU A;  1HHV A;  4IUU A;  1I3Q B;  3GP7 A;  2J7Z A;  1XXG A;  4MHE A;  3DWQ A;  3MAQ A;  1SND A;  1FGB D;  4P2C B;  4NMZ A;  4XDX A;  5COR A;  5NUC A;  4IQZ A;  3S16 B;  2YYZ A;  3DWP A;  1Z47 A;  1CHP D;  1RCV D;  4QIW B;  1B9M A;  2PNR C;  1GOZ A;  4QMG A;  5CV8 A;  1Z7T A;  2A73 B;  3OHX C;  4HED A;  2ZXO A;  5CV4 A;  1PZK D;  2F0Q A;  2B2T A;  2F4I A;  2L4N A;  3C1E A;  3TP7 A;  1JOO A;  4KV6 A;  1ZYR C;  1RDP D;  5EPL A;  1B3A A;  3PIO 3;  1EYD A;  1F9S A;  1AZQ A;  3VYS A;  5KRU A;  1RTN A;  1EEI D;  1EFI D;  4LK1 C;  5EGT A;  4CJ2 C;  1B50 A;  1B1Z A;  4N9P A;  2EJF C;  3P1H A;  2F0K A;  2LKV A;  4TQU S;  1DON A;  4WOR A;  2BA1 A;  3T16 A;  4ABN A;  2PZW A;  3C1F A;  2ICE C;  4E6I A;  4RGN A;  3K0Y A;  4XQN A;  5FKA C;  2F0T A;  3S14 B;  1SJE D;  2JEA I;  1OXU A;  4QCL A;  3I90 A;  3H91 A;  1ICW A;  1IL8 A;  1STH A;  4RAU C;  1I4H A;  5E3F A;  1F2Y A;  1LV9 A;  1XWE A;  3NK9 A;  3TME A;  3MFY A;  4A3B B;  2AUJ D;  1ILQ A;  1KAB A;  3FMC A;  5E4W C;  1TWH B;  4PV1 C;  4FXD A;  2XRS D;  4GZY C;  5I9O A;  2KEC A;  3BYT B;  2K01 A;  4KY5 A;  3QO2 A;  3FKI B;  4WFN 3;  4QUF A;  1AEX A;  1PYW D;  3Q24 A;  5ELC A;  4XQQ A;  1KLU D;  4IZ8 A;  2CQA A;  5D3D A;  3Q23 A;  2XWB B;  3KBG A;  1SMY C;  2WII B;  1ZXT A;  4EQP A;  1LT5 D;  4R9W A;  1NR4 A;  2B2Y C;  2E2J B;  2WP8 J;  2XSC A;  1TII D;  2WB1 B;  3OWE B;  4KD4 A;  1EY7 A;  4XYQ A;  5FO7 B;  4O42 A;  5C5M A;  3GTG B;  3NBI A;  1Q8I A;  1I4Q A;  1Q3L A;  5JJZ A;  3QOJ A;  1W6J A;  1TWA B;  3L7Z C;  1BQQ T;  1EWC A;  2L5T A;  3F2U A;  3GTK B;  2IX3 A;  3I4N B;  4BA1 I;  1IHZ A;  2NVQ B;  1Q90 A;  1Y1W B;  2ZXP A;  4G7O C;  3A8I E;  4FXK C;  4FNF A;  4KK7 A;  2FFK B;  4FYD A;  2NVY B;  2SDF A;  1R4P B;  2Y0S B;  1VF7 A;  1NAP A;  4ODG A;  5TSS A;  1C8C A;  1QG7 A;  3MXP A;  3VA7 A;  5CMD A;  2F0G A;  2RSO A;  1WD1 A;  3ONA B;  4Z9C B;  1TT2 A;  1SMY D;  5IGG A;  1FNV A;  2NYZ D;  2D62 A;  2KCC A;  5M5W B;  3S2D B;  2I07 B;  5EPK A;  4K2L A;  5IGB A;  1HCZ A;  5E4X A;  2EE1 A;  4OGQ C;  1H9J A;  2M9V A;  2BA0 A;  1EY5 A;  4KKS A;  4RH6 A;  1SE3 A;  4C3I G;  5LL6 X;  3A8K E;  1I6H B;  5FK9 C;  4I65 A;  1V8Q A;  5DAU A;  1NUC A;  1BDO A;  4RFB A;  3Q6S A;  2HCI A;  3PO3 B;  2F0H A;  3OIQ A;  1RHP A;  5ISR A;  5EJW A;  4CGY B;  5D65 A;  4X3S A;  4B9W A;  2PYK A;  4X3T A;  5F2D A;  1DZ1 A;  2F03 A;  5KNB A;  2CW0 C;  5M9O A;  1A3T A;  1SDF A;  5EPJ A;  1HFN A;  5CGK A;  3NXW A;  2CHB D;  1RF2 D;  1O7Z A;  3GTP B;  1O7Y A;  3E6Z X;  4ME5 A;  2EZV A;  1F9P A;  3L9A X;  1SYE A;  1A2T A;  1GXD C;  3SK5 A;  4PMB A;  5IT9 E;  3GTM B;  3G6J B;  1EYC A;  1GJX A;  3HOX B;  4L63 B;  4KHZ A;  3X3M A;  2NWG A;  3BS1 A;  4C3J G;  4H0L C;  1DD2 A;  1DOK A;  2HQE A;  2Z1C A;  3HP3 A;  2WAC A;  2F0I A;  5JPM C;  2L9H A;  3TDQ A;  4MN3 A;  1IKM A;  2E2I B;  1OXT A;  1QNK A;  5KNC A;  2NB0 A;  2RA4 A;  3LX0 A;  3DXJ C;  1BCP B;  3KK7 A;  1EEF D;  2Q8T A;  3SR1 A;  1S5F D;  3PUW A;  2EY6 A;  3BDO A;  2NBF A;  1PTO F;  3ND8 A;  1D6E C;  1DCZ A;  2RSN A;  2DN8 A;  2XNA C;  2K5Q A;  1DXM A;  5D3I B;  4FF3 A;  2K7V A;  1HQR D;  2YU9 B;  1HQM C;  3MHB A;  2O5I C;  2RDH A;  4HSV A;  4FF4 A;  3H6M A;  3KUP A;  4K8I A;  5M3M B;  3D3R A;  3S1Q B;  3M4Y A;  5EKI A;  4FO2 A;  5A2Q L;  2K5W A;  2R7Z B;  1X32 A;  1BCP F;  2VB3 X;  1TS5 A;  5CYU A;  3D6C A;  3GD7 A;  4J6H A;  5ELB A;  3KLS X;  3V05 A;  3MTS A;  5FO8 B;  1U9R A;  2N55 A;  1SEB D;  4HN7 A;  4XTC S;  3D4D A;  5IGE A;  2F0P A;  1UEA B;  1V1O A;  1HUN A;  5C4H A;  1EZ6 A;  4C3H G;  2B2V A;  5G3L F;  5EBD A;  2IL8 A;  5JVG 3;  4XT3 B;  3LNN A;  2D2C C;  2F1M A;  2AUK A;  3VR3 A;  1LLR D;  5J39 A;  1SYG A;  5BN5 A;  4AYB B;  4QB4 A;  2BOS A;  3NPP A;  1Q1E A;  1ENF A;  1FYC A;  1J8I A;  3VR6 A;  1DM0 B;  2DY8 A;  1ENC A;  1JR0 D;  1EQT A;  1EWH A;  1GUN A;  1HFG A;  4O1N A;  1I4G A;  4XXE A;  1D1K A;  2F0E A;  2EYL A;  4KKU A;  1S5B D;  4BY7 B;  1CM9 A;  1Q1B A;  2IX0 A;  2AQ1 B;  3QIA A;  1SXT A;  2K05 A;  1KAA A;  2R93 B;  1GUT A;  3HEJ A;  2JXM B;  3TN2 A;  1HPC A;  1AN8 A;  5C0X I;  1K8O A;  2TMP A;  3QG1 A;  4KY7 A;  1JC7 A;  1I4R A;  2NZ1 D;  4HMI A;  4X3U A;  4J1M A;  4FF1 A;  2ID0 A;  2EYO A;  3HG9 A;  1SNO A;  1SNM A;  1M8A A;  1VF5 C;  4DK0 A;  2M00 A;  1S4Z A;  1G2T A;  1SYC A;  5BN3 A;  3A8J E;  3K57 A;  3K6O A;  2K33 A;  3J80 L;  3RUZ A;  1CA5 A;  1TQO A;  4RCO A;  1CTM A;  3W2D A;  4K2K A;  1F2L A;  4EGV A;  2A68 C;  5C3W A;  2PW5 A;  1SE2 A;  4RGT A;  1V1P B;  1GUS A;  4HTH A;  2K04 A;  4DXG A;  2QKI C;  2F3V A;  1KDC A;  2VB2 X;  4MIU A;  2F0U A;  4QF4 A;  3RD4 A;  2EYM A;  5C0X H;  2B2W C;  2FJ2 A;  1PRT F;  3OMC A;  1AFP A;  3J7Y W;  4ULL A;  4PMC A;  1ZEQ X;  4B9X A;  2E2D C;  4V0B A;  4L6T B;  4U68 A;  3K5O A;  2Q8I B;  4XIG S;  4V19 0;  3BG3 A;  5CC4 A;  2NN6 H;  3DMU A;  3H94 A;  4CBV A;  2CW0 D;  3CRK C;  3C46 A;  3E5S A;  5EQ0 A;  4BBS B;  3EFX D;  4LMQ D;  2MHV A;  5IGC A;  3I4L A;  1XX8 A;  1HTL D;  1EZ8 A;  3HOZ B;  1QCB D;  2L0C A;  1CQV A;  3OIP A;  5M5X B;  2BDN A;  4ZKC B;  1OXS C;  5DNF A;  2EOT A;  4EQO A;  4KTA A;  2H4O A;  4DGZ A;  3R8B A;  1LTG D;  3I91 A;  1STN A;  1I50 B;  1ESF A;  3PIP 3;  2B2U A;  2FIN B;  3K58 A;  4HMJ A;  4JBW A;  1HXY D;  1F9Q A;  4C3I B;  1ILP A;  2K5D A;  2C9O A;  4UAI A;  4OO1 G;  2N88 A;  1OXV A;  1JOQ A;  2PZT A;  1CA6 A;  4K14 A;  3Q22 A;  3ND9 A;  2JEB I;  4G7Z C;  3TP8 A;  5EKL A;  4RA8 A;  4TKO B;  2F0M A;  3HZX A;  4J8Q A;  2D9U A;  4PMW A;  2QDB A;  1TKW B;  1PTO H;  2JP1 A;  2AWO A;  5I6W A;  1NSN S;  4DAV A;  4K8J A;  3NHH A;  3RMH A;  4CKC A;  4HSP A;  3VYT A;  3M4O B;  1H9M A;  3A7A B;  2DY7 A;  1QJO A;  4DAP A;  4LJZ C;  3RLF A;  4ZQ3 A;  3SDZ A;  1TS4 A;  2G9D A;  4DAY A;  1TU2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...