5IP7H

Structure of rna polymerase ii-tfg1 peptide complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Transcription initiation complex structures elucidate DNA opening.
pubmed doi rcsb
molecule tags Transcription
total genus 22
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2016-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5ip7H00
2BA1A 2NVXH 4C3JH 4JI8L 4IJHA 3DM3A 3T1YQ 5FLMG 4JI4Q 3CCMA 1QVGA 1YVCA 4AYBE 2VQEL 2OWOA 1VQ4A 2ZJPA 2ZJRA 3LGJA 1XMOQ 3HOXG 1SR3A 3I2ZA 3CCJA 1VQLA 3K7UC 1XNQQ 3CMAA 1K0RA 4QJFA 1LM0A 5M3MH 2Q2TA 5AJ3Q 1L2FA 5JJLA 4DAMA 1R9TH 4GLXA 2UXBL 3U4ZA 5M5XH 5C4XH 2EXDA 3M9BA 4YWMA 3STBD 2E2JH 2E2HH 5IE8A 2RCNA 2E5LQ 3AFPA 3GTMH 3S1QH 4DR2L 4B3TQ 4EQ5A 4DUZL 1XTDA 2R7DA 2D0PA 2PQAA 3TQYA 1M90C 2UUCL 3HOUG 4POFA 1A8VA 4IOAA 4B3SL 5IT9c 1B8AA 4JI0Q 4WJ3M 1SMXA 3NBHB 4K0KQ 4EX5A 4JC0A 1PH6A 1IBLL 2E2IH 4B3RQ 2VNUD 4BY7G 3K80C 5C4XG 2NVTH 3J7A5 2AWOA 2NVYH 2YV5A 3UE1A 4YY3L 3F2CA 4DR5L 1IBML 1GD7A 2OTJA 1HR0Q 3I7FA 3CP0A 1XMQQ 1KXLA 1XNRL 4A75A 1IL2A 2CQOA 4X66L 1PH5A 4QY7A 3RR5A 4HJ8A 2K5HA 3J81i 2ATWA 4MTNA 4OONA 2PQAB 4OXPA 4C2MH 2R7ZH 1E1OA 1IBKL 5C0XG 5C4JH 1KAWA 2Q2UA 2ZTCA 1C9OA 4P72A 3H15A 2KBNA 2KHJA 1VQIA 5GAHC 4HJ9A 4DR1L 1XJVA 4B3ML 4KHPQ 4A93G 1SROA 1JJGA 1KRTA 2K5VA 4GN4B 3ICEA 2WAQE 2QGQA 4LF9L 1N33L 1UE6A 5JJKA 1BVSA 1VQ6A 5C3EH 2ZM6Q 2F4VL 4XTCS 2WP8J 1VCIA 4X64L 2PMZE 1VS0A 2DUDA 3KF8B 5IWAQ 3L0OA 2NN6I 2CCZA 4OX9Q 1FGUA 3TS2A 2EQSA 4A3BG 3CC7A 1I50H 4JV5L 2UXCL 2NN6G 4DV1L 4DV6L 2WFWA 1HR0W 5FJ8H 2MNAA 4R4TA 1PH1A 4IFDJ 2VZAA 2UXDL 1RL2A 3ULPA 3M4QA 4LF7Q 1N34Q 3MEFA 4DUYL 2QA4A 1VQ7A 3HOZH 1HNZL 2K4KA 2PNHA 2R6GA 1EQQA 4WJ4A 1HNWL 2UU9Q 1D8LA 3KYHC 1Q46A 4BA1I 1N36L 4DV5L 2NZHA 4NXMQ 1HH2P 4YCWA 2JA8G 3HOYG 2Z0SA 1KHIA 4UP8A 1VQ5A 3M4OH 2K14A 1YBYA 2JEAI 5HY6A 1I3QH 2HIXA 4YHHQ 4GS3A 3KJPA 2QEXA 1FL0A 5FJ8G 2KCMA 3J81j 4HIKA 3S1MH 1EUJA 4O0AA 1ASYA 4JI3Q 4LF8Q 3FKIG 1CSPA 4QIWE 1JT8A 1QVFA 3UE0A 1T9HA 3WWVA 1J5EQ 3PO3G 4OWWB 3D31A 3OW2A 4AQYL 1JJCB 1Q8KA 3STBC 1Q82C 2BH8A 3CCQA 3HKZE 4JI7L 1VQCA 3UDIA 2MO0A 3BU2A 4GKJL 2VQFQ 4JI1Q 1HZAA 4P74A 4LFCL 4YWLA 1GM5A 1C0AA 2HT1A 1GVPA 1KL9A 3CD6A 1QZGA 3S14H 1FJGQ 4YCUA 5IYBH 4GOPA 3J81c 1VQ9A 1E24A 1JE5A 1X54A 5FLMH 2R93H 1UWVA 5LMNQ 2IX1A 4J15A 4A3DH 1X3EA 1IBLQ 2KCTA 4OWTB 3KJOA 4UY8C 4GOPC 5GADC 2RHQB 4GKKL 1PYSB 1H95A 3CC4A 4IPHA 4DR5Q 3VDYA 3ULLA 2UUAL 4DV3L 4NPSA 2VW9A 4L5SA 3EIVA 4DR3L 2JA8H 2WB1G 3GTLH 4P71A 4DR4L 4DR6L 3F1ZA 1N32Q 2B63G 4JI6Q 1WOCA 5LMUL 3UDFA 2ZTEA 5IYBG 3UDGA 2OQ0A 1PYBA 2K75A 4A3DG 3ER0A 3BZCA 3I55A 2JA6H 4GOPB 4JI5Q 2I5LX 2R7FA 2WB1E 3JAMi 1MJEA 3MXNB 3RNUA 2Z6KA 4A3CH 3PUYA 3CMEA 3K0XA 2UUBQ 3HOUH 4LFBL 1BBWA 4X62Q 3G71A 1Y1WH 1SE8A 2B3GA 3I4NH 4KI0A 2RHSB 2Z6KC 4DV0Q 4NXNQ 3EN2A 3RLFA 4FDBA 5IP7H 4BY7H 1G6PA 1Q1BA 3A0JA 4PZ6A 4DV2Q 4BY1G 1V1QA 1I94L 2XTIA 3CCLA 5LMNW 3PUVA 3OTOQ 5J3BA 2N8NA 1PHJA 3TRZA 5GROA 1IYJB 4AIMA 3A5UA 2JA6G 3HOWG 3T1HQ 4KLKA 5IYDG 2AHOB 2XGTA 4LF4L 4A3CG 3PIPA 5JJIA 2DGYA 4L5QA 3PF5A 2R93G 1Y1WG 1Y1VG 4BBSG 3RLOA 3I4NG 1VQEA 5IP7G 4KHZA 1MJCA 3PIOA 1HNZQ 1CKMA 2IY5B 3AQQA 2NZOA 3IRBA 4LF5Q 1W2BA 3DLLA 2JQOA 1NTGA 2CFMA 3CCUA 4A93H 4UP9A 3PGZA 4DV5Q 4Y7NH 1N9WA 4LUOA 2N49A 4HIOA 4BBRH 1VQ8A 1X3GA 2V1CC 2BH2A 1IXRA 2YTYA 4IPDA 5C0XI 4JCVE 3CQZH 1VQHA 2GVBA 1KD1C 4IFDG 3PO3H 1OXUA 4DK6C 4A3BH 1L0WA 2I5MX 2JJQA 1X55A 2KHIA 4DV7L 4JBWA 4QQBX 1Q7YC 3RN5A 1NE3A 1PH9A 1WJJA 3I56A 2N78A 1K8GA 1HNXL 2R92H 1QUQA 4A3KH 4BBRG 4A3GH 3S24A 4ME3A 2HIVA 4MNOA 5C44G 2A1AA 3OYYA 4JG2A 4X65Q 1TWFH 3HOYH 2L15A 4O2DA 4BA2I 1J6QA 4JBMA 3G48A 4A3LG 1GKHA 4JI4L 1HZBA 2MFIA 1TWGH 3PUZA 1XMOL 3EBEA 1YHQA 4IO9A 1MKHA 3CF5A 1OXSC 3JAMc 1XNQL 1TXYA 5BR8Q 2ID0A 2R92G 3FKIH 4LFAL 3W1GA 4A3KG 5AJ3L 4DNIA 1PVOA 3PUXA 3TEHB 4BXXG 4A3GG 4JYAL 3K7AH 2D62A 1QUQB 1WCMG 1A63A 4JI2L 4JOIA 5GAGC 1YITA 4JI8Q 3FHWA 3J80c 3JC66 1PA6A 2E5LL 2OCEA 4DAYB 1EQRA 4A3IG 4OO1G 4B3TL 1JMCA 4JOIC 1VQMA 2VQEQ 1PH7A 3H3VH 1YJ9A 3M4PA 1SFOH 1VQKA 3CC2A 3ULJA 4JI0L 3W1BA 4A3JG 5FLXc 2JA7H 1NY4A 1A0IA 4K0KL 1FVIA 4B3RL 1BBUA 1VQGA 1QZHA 3S2HH 4JBKA 2I5HA 2VY3A 1LUZA 2IHEA 2VUMG 2UXBQ 1CSQA 3GTJH 2AWNA 2Y0SG 1OXXK 5E7NA 4A76A 1XPRA 4R4IA 1HR0L 1EYGA 3H3VI 4DV4L 4DR2Q 4LF6L 1JB7A 4DUZQ 4A4IA 2B63H 5IY0A 3F2BA 3CW2C 1E3PA 4AH6A 2UUCQ 2JA7G 3KFUA 3AYHB 2FXQA 4TQUS 1X6OA 3H0GH 1LTLA 4OWXB 2N3SA 1LYLA 4B3SQ 3GTPH 1VQOA 1V43A 1CKNA 1A62A 3S16H 2PI2A 1YJNA 4A3FG 3E9IA 3CCVA 3GTQH 5EAYA 1X65A 4KHPL 1YZ6A 4YY3Q 1IBMQ 1K3RA 4PG3A 1Z47A 5C0XJ 1S72A 3F8TA 2ES2A 1XNRQ 3GDEA 4RMFA 1WFQA 2D0OA 4X66Q 4BY1H 1G51A 2YTVA 2F52A 1Q1EA 3RZOH 2KENA 3M7NA 3H0GG 4APVA 1VQNA 5IWAL 5M3FG 4HJ7A 1IBKQ 1NMFA 3RZDH 1PV4A 3HOWH 2NVQH 1RIPA 5IYDH 4GN3B 5IYCG 2Q2IA 1YIJA 2HHHL 2AKWB 1CKNB 3BJUA 2CWAA 3B6YA 3RN2A 4LF7L 1N34L 2GVAA 1VQJA 2K52A 3L2PA 1Y1VH 2A19A 3U50C 4DR1Q 4B3MQ 3PO2H 4BBSH 4LUVA 4IFDI 2Q2HA 4RG1A 2IX0A 1GO3E 1X9NA 4A3EG 4A3MG 2UU9L 4AYBG 3J80i 3S1RH 2JA5H 3GD7A 1B7YB 1UE5A 4GLAC 3NELA 4LF9Q 1N33Q 2F4VQ 1SRUA 3S17H 1PH4A 4NXML 4GLVB 1NJIC 3G6EA 2JE6I 4X64Q 5GQOA 1E1TA 2LXKA 1YI2A 4IPGA 2YU9H 1EIFA 2EIFA 3Q8DA 4YHHL 1D7QA 4HJAA 1YNXA 1O7IA 4LWCA 4JV5Q 4R4OA 4R1JA 4DV1Q 4DV6Q 1Z9FA 3J7ZC 4UP7A 4QL5A 2UXCQ 4JI3L 5M5WH 3M85A 2MQHA 1KC8C 4LF8L 3PO2G 4L5RC 4DUYQ 2UXDQ 1U5KA 4C3IH 4LFAQ 2CWPA 1E22A 4GNXA 1J5EL 3PSIA 2JA5G 1HNWQ 4JYAQ 3CCEA 1XPOA 4YWKA 3GO5A 4XIGS 3ZJYC 3K81C 4JI2Q 2IT1A 5JEAJ 3U4VA 1N36Q 1UE7A 1S3OA 4GNXC 1U0LA 4DR7L 1AE2A 1MIUA 2CKZB 2VQFL 4JI1L 4TVAB 3W5OA 5IP9H 1KQSA 4Y52H 5C44H 1WI5A 4LW1A 1S40A 1FJGL 3M3YH 1PH8A 3A5ZB 3CPFA 4A3LH 3NEMA 5M3MG 2LSSA 5LMNL 3NENA 2OTLA 3AEVA 3GTOH 1YEZA 3KOJA 1YJWA 1N8RC 1DGSA 1NMGA 1VQBA 4GNXB 4IOCA 4AQYQ 3GTGH 1VQDA 1VQAA 2H5XA 5IP9G 4C3HH 4JI7Q 4GKJQ 4BXXH 3SGIA 1N32L 4DV4Q 2ZJQA 3PUWA 1UEBA 1CKOA 1V9PA 1WCMH 5H1SE 4JI6L 4LF6Q 5DLQE 3RLNA 2HQLA 4LFCQ 2E8GA 5ELOA 3T1YL 2C35B 4A3IH 4DK3C 5GAEC 2VS1A 4JI5L 3G4SA 2WAQG 1X56A 3I4OA 1G291 4NB3A 1I6HH 3CAMA 2UUBL 1SLJA 1OTCA 1HJPA 2K5NA 1VQPA 3E0EA 4X62L 4A3JH 1K8AC 4GKKQ 2K50A 4H02A 5ELNA 5K36G 1BKBA 2JA9A 3TS0A 4NXNL 1W3SA 4DV0L 4DV3Q 5M5YH 2UUAQ 1XPUA 4DR6Q 4DR3Q 2AMCB 4JBJA 4DKAC 4DR4Q 4IJLA 4DV2L 1P8LA 2VUMH 1K73C 1IZ6A 5LMUQ 3OTOL 4OO1I 1AH9A 2B29A 2I0QA 1C7YA 3HKSA 1PH2A 2R7ZG 4X6AH 4UPAA 3KDFA 1CUKA 3T1HL 2BA0A 4P75A 1Y14B 3KF6A 3UDXA 4HIMA 1E7ZA 2HHHQ 1Q12A 3PF4A 2YTXA 1L1OA 4LFBQ 1M1KC 1L1OC 5HGQA 1PFSA 5C3EG 4LF5L 1KIXA 4A3FH 1I94Q 4LF4Q 3L7ZC 3CCSA 4IPCA 1XMQL 4R4CA 4P73A 4QGUA 4HIDA 3KDFB 1NBWA 3KF6B 3PCOB 4YCVA 3BZKA 4GN5A 2JEBI 4PZ8A 2Y0SE 5JEAG 3AFQA 3CXCA 1PH3A 4POGA 1B70B 3U58A 5M3FH 4ALPA 3ERSX 1L1OB 1I5FA 1EIYB 3HOZG 1OXVA 3S15H 3E9HA 1EWIA 3HKZG 1KRSA 2IHFA 5IYCH 3S2DH 3I4MH 1K83H 1VQFA 3FP9A 1Q81C 4MZ9A 2ASBA 1YHAA 3KLWA 4HJ5A 1YHBA 4DR7Q 2YYZA 1WYDA 3K8AA 2ZM6L 4A3EH 4A3MH 2OQKA 1ASZA 1P16A 1OXTA 3HOVH 3D0FA 1TWAH 3TREA 4X65L 3PV0A 4OX9L 4R4QA 1HZCA 2F3IA 2MO1A 1K9MC 3CCRA 1HZ9A 1TWCH 2ALYB 2VL6A 2A8VA 1Q86C 1TWHH 3I4MG 1QVCA 1JJ2A 4DV7Q 4PMWA 2LXJA 3GTKH 2JK8A 3HOXH 1SN8A 3A74A 3CPWA 3S1NH 2RF4A 4LUZA 4PZ7A 5BR8L 2ZTDA 4LNQA 2PI2E 1UE1A 2GN5A 1X3FA 3HFZB 1HNXQ 3F2DA 1EFWA 1AE3A 3HOVG 1EOVA 4DPGA 4L5TA
chains in the Genus database with same CATH superfamily
2HCIA 2NVXH 4C3JH 1HRJA 4IJHA 2D5DA 3T1YQ 4JI4Q 3CCMA 2EJMA 4AYBE 2OWOA 1VQ4A 1PRTD 4N8X1 2ZJRA 3SK5A 1SR3A 1FYCA 4GZYC 2IWHA 1VQLA 3NBHA 1PFNA 4FF1A 1K0RA 3BDOA 2Q2TA 5M3MH 4L63B 4DAMA 4GLXA 2UXBL 1PXUA 4B9WA 3HOXB 1G2SA 3M9BA 2E2JH 4DA2A 3NQIA 4O42A 4XXEA 4B3TQ 2F0MA 1XTDA 3NPPA 2R7DA 2PQAA 4RAUC 2UUCL 2B8GA 4POFA 1A8VA 2PZWA 4JI0Q 1D2BA 3TP8A 4XDXA 4G7HC 4ZK9B 1JC7A 1H9JA 3EA6A 2AWOA 3HOUB 3A7LA 2NVYH 2YV5A 3KBGA 3F2CA 4DR5L 5BN3A 1IBML 1GD7A 1HR0Q 3MWYW 2FHTA 1PH5A 4X66L 4HJ8A 3KF8A 2ATWA 2AUKA 4IUQA 4OXPA 4HSPA 1E1OA 1KAWA 2J4XA 1GOZA 4P72A 2KBNA 3TN2A 3KK7A 4HJ9A 2F3VA 4DR1L 2B2TA 4KHPQ 4A93G 2BE5D 2K5VA 2B2YC 1BCPB 1BVSA 2B39A 5IGGA 5CC4A 2JP1A 1JWSD 4XTCS 2CCZA 3L0OA 4LK1C 1GUOA 3TS2A 1FGUA 3I3CA 2A6HD 4A3BG 3CC7A 3I91A 2NN6G 3X3NA 1XTCD 1HR0W 5FJ8H 1PH1A 4IFDJ 2RBMA 2UXDL 1RL2A 1N34Q 2Z6BA 2K4KA 4CBVA 2PNHA 2R6GA 1HNWL 3RMHA 4HEDA 1JB3A 2O4XA 4BA1I 3S1QH 4Q5VA 1FNWA 1KHIA 2K14A 5CV6A 2KCMA 2M2LA 3HOYB 2MP1A 1ASYA 4QIWE 1EU3A 2A69C 3OIPA 1T9HA 3WWVA 1J5EQ 2CVRA 1S5ED 2RCFA 5D3DA 4K5XA 4AQYL 4DXFA 4GKJL 4LFCL 4YWLA 1FJGQ 1E24A 3MXNA 1X54A 1DCZA 1UWVA 1F2YA 1IBLQ 3K57A 4OWTB 4UY8C 5D65A 2RHQB 4PV1C 3TP7A 4DV3L 3MC0B 4QUCA 3ITPA 3S2HB 2VW9A 4L5SA 1EYDA 4DR4L 2WIIB 1PFBA 2ZTEA 4A3DG 3ER0A 2WB1B 1CHPD 2LS01 3PUYA 1BBWA 4LAAA 2WKCA 4NP5A 4HCSA 1JORA 3I4NH 4F8MA 1LT6D 3EN2A 1G6PA 4FDBA 2HDMA 3E0JA 4DV2Q 4BY1G 2XTIA 5ELBA 3OTOQ 4AIMA 3A5UA 2ENBA 1LTBD 3GQBA 2B2WC 1LTTD 2DGYA 4RCOA 1HQMC 4N9TA 3SXHA 4BBSG 5AFWA 4QCLA 5C0XH 2JA6B 2NVQB 5IP7G 4KHZA 1CKMA 1K28A 1AZPA 1SYEA 3D4WA 2X6GA 5J1ZA 2R93B 2NTTA 2CFMA 3K5OA 1W6JA 4LUOA 5EBCA 4HIOA 3S1RB 1X3GA 1HA5A 2V1CC 3VA5A 2YTYA 4IPDA 2GVBA 2KHSA 3PO3H 1OXUA 5A2QL 1L0XB 2EYJA 2KHIA 1TS3A 1Q7YC 3RN5A 1CA5A 3QWNA 1K8GA 3JAML 1AN8A 4A3KH 1CM9A 1NNXA 4MNOA 4U673 2EY1A 2QF7A 1TWFH 2RSNA 2L15A 1J6QA 1STAA 4XT1B 5J22A 1STGA 1ILQA 4ZUJA 3CQZB 1SE4A 3CF5A 3JAMc 1XNQL 2CH4W 4IUNA 3QOLA 3PUXA 4BXXG 3L9AX 4JI2L 1JQYD 2R92B 4EQPA 2E5LL 2OCEA 4DAYB 1SAPA 4OO1G 1EL0A 4A3GB 4ME5A 1PH7A 3M4PA 1SFOH 2JA7H 1H9SB 5EBDA 4A3IB 4K0KL 3NWSA 1BBUA 2OXPA 5FO9B 2UXBQ 1H9RA 1AEXA 4R4IA 1AFPA 5JOBA 4DV4L 2VUMB 3F2BA 2UUCQ 1S4ZA 1IYUA 5E1FA 2N3SA 1VQOA 1CKNA 2MGSA 2BDNA 2PI2A 1CK1A 3E9IA 5CYUA 5EPKA 3CCVA 1GUNA 1IBMQ 1Z47A 3S9WA 1HUMA 4A3FB 4X66Q 1G51A 5JPNC 4APVA 4HJ7A 5CV7A 2MHVA 1NMFA 3RZDH 1SJHD 3HOWH 5ELEA 5IYDH 1YIJA 4MHEA 1B50A 3BJUA 2CWAA 3GP7A 5I6WA 4LF7L 3H0GB 4DR1Q 3PO2H 5JAVA 3IAYA 4LUVA 3S16B 2XIWA 2Q2HA 4RG1A 2IX0A 5KYLA 2JA5H 3S17H 1SBBB 4BWGB 3GTQB 2CH4A 4DXGA 1PH4A 4GLVB 4HN7A 4OEMB 2YU9H 4HR7B 2F3WA 1O7ZA 4YHHL 1HTPA 1KTKA 4AYBB 3S1MB 3NSWA 3BDLA 4JI3L 5M5WH 1KC8C 2UXDQ 2D9UA 2Z8LA 5E3FA 1STYA 1TWCB 1U5KA 3D8GA 5COYA 2CWPA 2LMCB 1LTGD 1HNWQ 2NUCA 4I7ZC 4JYAQ 3CCEA 4YWKA 3C1EA 4C3JG 2F0NA 1S3OA 4GNXC 2SDFA 2VQFL 2PZUA 1SNPA 2HCCA 3W5OA 1YNNC 5C44H 4LW1A 1ZEQX 2EY2A 5M3MG 1HFNA 3AEVA 4MIUA 5T1GA 3VYRA 4FVMA 1NMGA 1RTOA 4GNXB 4IOCA 5I2YA 5IGFA 4AQYQ 4C3IB 4C3HH 4GKJQ 3N6RA 2F0IA 1UEBA 5JVH3 4LFCQ 1QB5D 3RLNA 3MEHA 2HQLA 1PTOH 3T1YL 2C35B 5IIFA 3E5SA 2WAQG 1X56A 1G291 4NB3A 5HURA 1A3TA 2L0CA 3I72A 5ELFA 1HJPA 1KAAA 3MFGA 2B2YA 4RGTA 4X62L 4A3JH 2K50A 3TS0A 4NXNL 1S5FD 1TKWB 4DV3Q 1KABA 4ZKBB 2BDOA 4DKAC 4DR4Q 1PFMA 1F2ZA 3BVMA 1AH9A 1C7YA 1IYVA 3J7YW 4FNFA 4HIMA 1E7ZA 2YTXA 4C2MB 2R7ZB 1M1KC 3QR8A 4KJNA 1L1OC 1S5BD 5CR3A 1WTQA 3PCOB 3BZKA 4POGA 4JK1C 1QILA 3GTLB 5M3FH 4QIWB 1L1OB 1EIYB 3S15H 2A68C 3E9HA 3HKZG 1A15A 1XYIA 5KNBA 3I4MH 1VQFA 3FP9A 3ONAB 4S3SA 5C4ZA 1ILPA 1ZKOA 3QIAA 1WYDA 2YYZA 1UNSA 3P7JA 4HAEA 4A3EH 1ASZA 2CW0C 1P16A 5DM73 3W3AA 3TREA 5C5LA 4R4QA 3M4OB 2MO1A 3BS1A 2HUGA 1WTOA 3OPOA 2JYOA 3HOXH 3A74A 3CPWA 3S1NH 1KNEA 4LUZA 5BR8L 2ZTDA 3X3MA 1UE1A 1X3FA 5JVG3 2OF1A 3VA7A 4R8IA 4FYDA 4ZLTF 4JI8L 1DZ1A 4U68A 1DM0B 3T53B 3T13A 4P2CB 1QVGA 4I65A 2VQEL 1EQVA 1TQOA 3K7UC 1XNQQ 5FOBB 2ZXPA 2OT2A 4UDUC 1TWHB 2BOSA 1L2FA 1R9TH 2TSSA 3U4ZA 2F4IA 4K2KA 1MGSA 4YWMA 2B2WA 2RCNA 2E5LQ 4DR2L 3HP3A 4DUZL 2D0PA 5ELCA 1B8AA 1E0BA 1SMXA 1Q90A 3E3XA 4EX5A 1PH6A 1IBLL 4K0KQ 2HQEA 5C4XG 2F0SA 4C56C 2JN4A 2D2CC 3I7FA 5I9OA 3CP0A 1XMQQ 1E2WA 4A75A 1SE2A 4QY7A 4ZQ3A 4MTNA 4OONA 2PNRC 5C0XG 2Z4HA 1K3BC 2Q2UA 2ZTCA 2KHJA 3OW7A 4QF4A 1SROA 1JJGA 3IFDA 3J7AV 2HD3A 3ICEA 1SYFA 2WAQE 2G5DA 3WOFA 1N33L 5C3EH 2ZM6Q 1EIGA 4CJ0B 2WP8J 4A93B 1O80A 4X64L 1VS0A 2DUDA 2PMZE 5DM63 4Y7NB 3PO3G 2NN6I 3IFTA 3KLRA 1F2LA 1D5XC 3NTIA 4WORA 4DV6L 2MNAA 1H9SA 1BXTA 3ULPA 4LF7Q 3MEFA 4DUYL 1VQ7A 3T16A 4WJ4A 1EQQA 1D1KA 1D8LA 1Q46A 2JA8G 3H94A 1HH2P 1I3QH 2HIXA 4JPBW 4YHHQ 4DK1A 5BN5A 1BCPD 2AQ2B 3K59A 5DEHA 1EUJA 4JI3Q 1EZ6A 1YNJC 4MN3A 2F0EA 1JJCB 5M9OA 3EQLC 3HKZE 4JI7L 1SNCA 3BU2A 2VQFQ 2F0UA 1HZAA 4HMIA 4P74A 1C0AA 5C5MA 2L4NA 5A2QE 2O5JC 2QEJC 5ELDA 4RA8A 3S14H 4YCUA 1TU2B 4GOPA 1JE5A 5FLMH 2EE1A 1V1PA 4DK0A 4J15A 4IURA 2KVMA 1G2TA 2XRQD 5GADC 3JAME 2CHBD 1PYSB 1D1IA 4NPSA 5I2XA 4DR3L 1DJRD 2OEOA 3UDFA 5IYBG 1A3VA 4FO2A 2OQ0A 4PQXA 4UAIA 5C6AA 5CBEE 2JA6H 3LWUA 2I5LX 2R7FA 3JAMi 1MJEA 3L3OC 2I07B 4BS9A 2Z6KA 4A3CH 3K0XA 3C3LA 4LFBL 1PTOF 2A69D 4X62Q 5BN4A 1NUCA 1SE8A 4A3DB 4KI0A 4NXNQ 2EYOA 4BY7H 3EROA 1B3AA 1Q1BA 4L8JA 1SSOA 4CJ1B 2N8NA 5GROA 1BO0A 1IYJB 3HOWG 5CORA 2PPBC 4KLKA 5IYDG 2RA4A 2KCNA 2XGTA 4OELB 4BY1B 3PIPA 2ICIA 4HSVA 4KTAA 1WTXA 2IW3A 1Y1WG 1VQEA 2DJFC 2F0HA 1GUTA 3WOEA 2H4OA 1HNZQ 2TMPA 1PLFA 3A8IE 3FEWX 3Q0AA 3DLLA 4BBSB 1GHKA 4UP9A 1LV9A 3M4YA 4DV5Q 1T5XD 1STEA 3ND9A 1BCPC 3CQZH 1KD1C 3BVGA 4DK6C 1A2TA 1T5EA 2JJQA 1X55A 4DV7L 1H9KA 4JBWA 4QQBX 5C3XA 2N88A 1NE3A 3EFXD 1WJJA 2R92H 2XWBB 4BBRG 4ZKCB 4A3GH 3S24A 3E6ZX 5C44G 3OYYA 4JG2A 4XT3B 1FR3A 2NWGA 2L11A 3IKJA 4RH6A 1HZBA 3MFYA 2MFIA 3J80L 1QCBD 3T51B 3EBEA 1XMOL 4CDDC 1MKHA 1OXSC 5BR8Q 3FMCA 1M8AA 3FKIH 3W1GA 4DGZA 5AJ3L 5I6YA 4RHRA 4JYAL 3K7AH 1AW7A 5IGCA 1ML0D 1QUQB 1LTID 4G57A 4JOIA 5GAGC 4JI8Q 3J80c 3GTGB 1MSHA 2IX3A 1EQRA 1XXGA 1F77A 2A74C 4B08A 1WD0A 5CV8A 3NTHA 3A55A 2VQEQ 3SK8A 3BYTB 5EKIA 4KV6A 1VQKA 3W1BA 1XX8A 4OGQC 5K5PA 4A3JG 1NY4A 4B3RL 1TWGB 2E2DC 5JPMC 2VY3A 1B2TA 1ZXTA 1CSQA 4DU9A 4CKBA 2Y0SG 5E7NA 1RD9D 3DEOA 4EQOA 1EYGA 3G6JB 4V0BA 5M5YB 1V8QA 4DR2Q 3V2TA 3BDCA 4DUZQ 3CW2C 1PZJD 4AH6A 4J1MA 3KFUA 4TQUS 1X6OA 3H0GH 1LTLA 2EDGA 2SNSA 5IGEA 1V43A 3S16H 1JOOA 1GHJA 5CV9A 1BF4A 3GTQH 4F7XA 2WACA 2A6EC 1PZKD 1S72A 5EKKA 3TDQA 3GTJB 4RMFA 3S1MH 2F52A 2E75C 2K33A 1JR0D 3MHBA 5M3FG 1DOKA 2KQ3A 3TP5A 1PV4A 1LT5D 4FXDA 2F0GA 1RIPA 5KNDA 2B63B 1SYDA 2Q2IA 5TSSA 2GVAA 1Y1VH 3GTPB 4LMQD 1GO3E 1SMYD 2F0DA 4A3EG 1X9NA 2ASBA 4IFDG 3S2DB 1K83B 1N33Q 4GLAC 3NELA 3CRLC 2IL8A 2JXMB 1II3A 3NHHA 3G6EA 4X64Q 1D7QA 3Q8DA 4HJAA 1YNXA 1O7IA 2QW7A 4DV6Q 3RZOB 2E74C 1NSNS 1D5MC 4LF8L 4H13C 1MHWC 4DUYQ 2ZXOA 1BOSA 4C3IH 2O5IC 1K8MA 1XPOA 4PMBA 2MJ8A 3CKIB 3K81C 3U4VA 4RGOS 3NBIA 1U0LA 2K6AA 4C3JB 1PRTF 2B2UA 3I8ZA 1UAPA 3M3YH 1PH8A 4A3LH 3GV6A 2OTLA 1E2ZA 2FJ2A 3GTOH 1YEZA 4F87A 4HCEA 3RD4A 1H9MA 5M3MB 1VQAA 5K36H 4RFBA 5IP9G 4JI7Q 5EPJA 2ZJQA 3PUWA 1WCMH 4JI6L 5H1SE 1QOHA 2G9HD 4LF6Q 2HT1A 3O13A 2UUBL 4HMJA 1SLJA 2VB3X 4H02A 1DOLA 2C9OA 4DV0L 4PMCA 2WAQB 5A35A 1NCVA 4DR3Q 4JBJA 3QJYA 1D5ZC 3K5MA 1K73C 1PDQA 2NVYB 1HXYD 4X6AH 3KDFA 1CUKA 5IGDA 2BA0A 1YNND 1Y14B 3T1HL 2J7ZA 3UDXA 2HHHQ 1Q12A 3MAQA 5I9PA 1WVLA 4LFBQ 4KK7A 5FO8B 1MD2D 1I6HB 3HRZC 5D14A 1SMYC 5C3EG 4LF5L 1K0SA 2Z1CA 1XMQL 2FMMA 4HIDA 4CKCA 3KF6B 4YCVA 4GN5A 4PZ8A 2Y0SE 3MXGA 3AFQA 1CI3M 1B70B 3U58A 1VMPA 5KEEA 1I5FA 5KYIA 4XQJA 1EWIA 4KKTA 3DMUA 2Z4IA 1YHAA 2FFKB 1WTWA 3HKZB 3KLWA 4ZAIA 4DR7Q 2ZM6L 4A3MH 2OQKA 2K03A 3FDTA 4ID6A 2Q8TA 4X65L 1B9MA 3MZ5A 1HZCA 2F3IA 1K9MC 1HZ9A 2ALYB 1TWHH 2RKSA 1QVCA 1JJ2A 3OSOA 4DV7Q 4PZ7A 2PI2E 3NWTA 1O7YA 2GN5A 5I4DA 1EFWA 1AE3A 3HOVG 2L1BA 4L5TA 3ERQA 3Q24A 1LT4D 1HPCA 1QG7A 5FLMG 1JWMD 1EY7A 2ZJPA 2H1EA 1TWAB 3LGJA 1XMOQ 1A2UA 3K0YA 2A68D 5FLXE 5AJ3Q 1CQVA 1F9QA 2EOTA 5M5XH 2MUYA 3Q23A 3PIP3 1EY8A 2E2HH 5IE8A 3GTMH 4FXGC 4KN4C 4CDEC 3K5NA 1XWEA 1G91A 2CW0D 2A73B 1M90C 4X3UA 4ODGA 4DN4M 1SJED 1U4LA 4IOAA 4B3SL 4WJ3M 5L37A 2VNUD 3NBHB 4B3RQ 4JC0A 1EY9A 1C4QA 2E2IH 1SE3A 4BY7G 2NVTH 1IHZA 1Z6HA 3V96A 3UE1A 2OTJA 3D3RA 5C4XB 1HA6A 2CQOA 1CFMA 2RDFA 3RR5A 2K01A 2K28A 1B53A 1O7LA 2PQAB 2SNMA 4LJZC 1WTRA 2PYKA 4N9PA 3NTKA 2NN6H 1C9OA 4F88A 1XJVA 4B3ML 3TZDA 4HTHA 4TSSA 2QGQA 4LF9L 1UE6A 2B2TC 3SK6A 1VQ6A 2F4VL 1GXDC 1Y8OB 2VB2X 1X3QA 3KF8B 1KDAA 1S5CD 1VMCA 2EJFC 4JV5L 3UI2A 2VZAA 1JOKA 3FPUB 3PO3B 5C4JB 2QA4A 3HOZH 1HNZL 1ZYRC 4E6IA 1CA6A 3TP6A 4KHVA 3KYHC 2IPKD 2ICEC 4DV5L 1EY5A 4YCWA 4UP8A 1R4QB 1VQ5A 3ND8A 1RCVD 1YBYA 2QDLA 5G3LD 4GS3A 3KJPA 2QEXA 4KKUA 1FL0A 2XNAC 5FJ8G 4HIKA 2JA8B 4LF8Q 3FKIG 1I50B 3NP8A 4EGVA 3UE0A 4ZRZA 1WTPA 3J81L 1TVXA 2K04A 1TS5A 4NKLA 5EGTA 1IL8A 3RUZA 4V190 2IJ0A 1VQCA 1RKNA 2MO0A 3K5LA 1WTVA 2QILA 1MI2A 1GVPA 3H09A 1QZGA 5FKAC 1RHPA 3J81c 5IODA 2IX1A 4A3DH 3R3OA 3KJOA 1ICWA 3WDNA 3I90A 1SFOB 3HEJA 2M00A 1NR2A 4NMZA 2B2VC 1AZQA 3VDYA 2UUAL 1H95A 4QB4A 1I4RA 4RCNA 4CKEA 4P71A 3F1ZA 3MTSA 4JI6Q 1WOCA 3BYYB 4TKOB 3UDGA 3J80E 4G4KA 2K75A 2WKDA 5HGTA 2WB1E 3DM1A 3MXNB 1YNJD 2UUBQ 1LACA 3HOUH 5JJZA 4JW0A 3G71A 1IW7C 2RHSB 4DV0Q 5IP7H 5FK9C 1DD2A 1STBA 1V1QA 1SYCA 3PUVA 2FINB 3T1HQ 3ZYYX 1LO5D 4LF4L 1EOTA 5JJIA 1DXMA 1Y8PB 4DAPA 3PF5A 1Y1VG 3R93A 1K8OA 3I4NG 3DUZA 2EYFA 2NZOA 3IRBA 4LF5Q 3VR2A 2M9VA 2JQOA 1Y1WB 3NK9A 1EYCA 1N9WA 2N49A 2SEBD 3MXPA 3BVZA 1VQHA 4Q0FA 3U9SA 1Q8IA 4C3IG 1IKMA 2I5MX 2R61A 5M5WB 2MPMA 1PH9A 3I56A 2N78A 3QO2A 4K8IA 1HNXL 1F9RA 2O2LD 4ME3A 4M1UB 4DAYA 4X65Q 3HOYH 2F0FA 4O2DA 4A3LG 1B4OA 4EQNA 1GKHA 4XYQA 4BBRB 1NAPA 4KMUC 1TWGH 3PUZA 5T1IA 4TRDA 1PTOC 1GUSA 2AQ3B 5CMDA 4A3KG 4A3BB 4DNIA 5FLXL 2D62A 1WCMG 1YITA 3C2PA 1PA6A 3JC66 1C48A 4H44C 1YJ9A 1PTOB 2F03A 3CC2A 1TIID 3ULJA 3DEPA 5FLXc 1A0IA 1VQGA 1TS4A 4H0LC 4XYOA 3S2HH 1CQFA 3H3VC 3GTJH 4IZ8A 3H3VI 3HZXA 5E4WC 1JB7A 4LF6L 2B63H 3K58A 2F0TA 3AMUA 1E3PA 2Y0SB 2JA7G 3AYHB 1SNOA 2FXQA 4B3SQ 1LYLA 5E4XA 3GTPH 3HGBA 1X65A 4I7AA 1YZ6A 2K5DA 1CZGA 1K3RA 4PG3A 2ES2A 4RWSC 2D0OA 4ULLA 2YTVA 3RZOH 3M7NA 3T56B 4Z9CB 5IWAL 2EYMA 2NVQH 1EY6A 1VF5C 4GN3B 2HHHL 2E76C 3A7AB 1CKNB 1PYWD 3B6YA 3RN2A 2WINB 1WD1A 4CJ2C 1VQJA 2K52A 4B3MQ 3U50C 5M3FB 2R93H 4IFDI 1EQTA 4A3MG 1RODA 2UU9L 3S1RH 4LF9Q 3GD7A 1B7YB 1UE5A 2DNCA 3BG3A 1SRUA 2A5HA 2F4VQ 3QG1A 4NXML 1NJIC 2JE6I 1E1TA 4IPGA 4MTKA 1EIFA 2RDHA 4DAVA 4IUTA 1EEID 4A3EB 4LWCA 4JV5Q 5FO7B 3J7ZC 4UP7A 4QL5A 3M85A 3PO2G 4LFAQ 1E22A 5J39A 3VYUA 1SEBD 3PSIA 4GNXA 2JA5G 3R2IA 3S1NB 5C4HA 2EJGC 3ZJYC 2IT1A 2A6ED 4DR7L 1STNA 1MIUA 1J9OA 4JI1L 4TVAB 4DFAA 1KQSA 3PIO3 1WI5A 3HG9A 3J7AF 3A5ZB 3CPFA 4FF3A 2LSSA 5LMNL 3NENA 3SEBA 2F0PA 1N8RC 4KKSA 3KBXA 3PMFA 4C1NI 1DGSA 1VQBA 4K6DA 2H5XA 1ENFA 1BUVT 1R9TB 3SGIA 2B8FA 1N32L 3CHBD 1V9PA 2KA7A 4A3IH 4DK3C 5GAEC 2VS1A 3FVQA 4JI5L 3G4SA 2L12A 5KGUA 2EY6A 5CBAE 1I6HH 1ESRA 2K5NA 4B9XA 1KLUD 4KY7A 3E0EA 1VQPA 1JOQA 4R8NA 1V1OA 5ELNA 1BKBA 2JA9A 2NYZD 2UUAQ 1W3SA 1LTAD 4C3HG 2AMCB 3DWQA 4IJLA 2VUMH 1P8LA 4K5WA 4OO1I 2B29A 2I0QA 2QCPX 1PH2A 3VYTA 2KECA 4P75A 5ISRA 1JCKB 4RGMA 2EPBA 3PF4A 1L1OA 2SOBA 1SXTA 4KY6A 3D4RA 1I4XA 2K7VA 5KNCA 4DNTB 5HGQA 1I6VC 1G8ZD 2NTSA 1KIXA 4A3FH 3L7ZC 2V4DA 3CCSA 1I4PA 1AP0A 3OOCA 4P73A 2G9DA 2RSOA 1TR5A 5C3EB 4LF4Q 1PH3A 2JEBI 3CXCA 1PZID 1PRTC 4ALPA 3ERSX 3HOZG 3VR4A 1KRSA 2IHFA 5IYCH 3FRPB 4RKBA 2KEDA 3P20A 4NDXA 3SDZA 2AUJD 3D4DA 4O1NA 1L0YB 2L9HA 1YHBA 1PRTB 1OXTA 3D0FA 1BCPF 1TWAH 2DJGC 1GJXA 5EJWA 1TWCH 1I3QB 4FP5D 2A8VA 1ET6A 2EYPA 3Q22A 1Q86C 3I4MG 2B2VA 5KIXA 4PMWA 2LXJA 1F9SA 2RF4A 4LNQA 4PNYA 2F1MA 2ZT9C 3HFZB 4IUUA 1HNXQ 2DY7A 4JVZA 2Q8IB 1EOVA 1CTMA 4DPGA 3BZDB 2BA1A 1EWHA 3MXUA 3VR3A 4K14A 3VR5A 3DM3A 1SNMA 3N52A 2HDLA 2F0OA 4J6HA 1YVCA 5CGKA 3HOVB 4KJOA 3HOXG 3I2ZA 2F0KA 5EQ0A 3CCJA 3S14B 2LFNA 1ESFA 3CMAA 1F2MA 1Z7TA 4QJFA 1LM0A 4RHSA 1B44D 2ZXRA 5IT9L 5JJLA 3GTKB 2BE5C 1D6EC 5C4XH 4EVOA 3D6CA 2EXDA 3STBD 4G7OC 2XVSA 2DNEA 3AFPA 4EQ5A 3EJIA 2NVXB 2A6HC 3TQYA 3HOUG 5IT9c 1ET9A 3J81E 1HUNA 3K80C 2DN8A 1X3PA 3J7A5 3SVMA 4ABNA 4H7BA 4YY3L 2AQ1B 1KXLA 4BY7B 1HHVA 2F0WA 1XNRL 1IL2A 4R9WA 4ZCKA 3F2UA 2E2JB 2K5HA 3J81i 4C2MH 2R7ZH 1IBKL 2P5ZX 5C4JH 1KNAA 4OL7A 3H15A 3A8KE 3SHLA 1RTNA 1VQIA 5GAHC 5DNFA 5DAUA 1KRTA 1Y69U 4IUPA 4GN4B 5JJKA 1CZWA 2L5TA 4X3KA 2PMZB 1VCIA 3PQIA 4OX9Q 2JA8H 3GTLH 5IWAQ 2F0QA 5IOCA 1MBYA 2EQSA 3MVVA 1CT1D 1I50H 2UXCL 4DV1L 1EU4A 2WFWA 4R4TA 3KLSX 5LHY1 5JEAH 1QE6A 3M4QA 3OMGA 4RGNA 1QNKA 1HTLD 1TY0A 2Z9HA 2UU9Q 5CV4A 5LL6X 1N36L 3HOYG 2NZHA 4NXMQ 2Z0SA 3M4OH 1ONLA 4IALA 2JEAI 5HY6A 3AU7A 1C8CA 4X3TA 1QNUA 3GV3A 4O0AA 3OWFA 1CSPA 1JT8A 3SK4A 1QVFA 2QKIC 1B9NA 4UHVA 4OWWB 3D31A 4K6LA 3OW2A 1VDZA 3FKIB 1Q8KA 3STBC 1QJOA 1Q82C 1CHQD 1M4VA 2BH8A 3CCQA 3UDIA 3K7AB 4JI1Q 1GM5A 3D6WA 2RVLA 1SNDA 4FXKC 3S1QB 1KL9A 3OHXC 3CD6A 1BBXC 5IYBH 1VQ9A 5LMNQ 1X3EA 2KCTA 1A3UA 4GOPC 4GKKL 2PZTA 1X32A 1ZYRD 3IL8A 4IPHA 3FPPA 3ULLA 4DR5Q 2K5QA 3CC4A 4DR6L 3EIVA 2WB1G 4IN3A 1N32Q 2B63G 5LMUL 3LWEA 1E2VA 3A56A 2BCOA 1OO9B 1PYBA 2L55A 3BZCA 3I55A 1F9PA 4GOPB 4JI5Q 3RNUA 1V1PB 4WFN3 2PCFB 2EVBA 1GUGA 2N55A 3CMEA 4QUFA 4DF7A 1Y1WH 3EVQA 2B3GA 4XQNA 2Z6KC 3RLFA 3A0JA 4PZ6A 3AB9A 1I94L 3CCLA 1UEAB 5LMNW 5J3BA 3TZUA 1PHJA 3TRZA 2JA6G 5KRUA 2AHOB 4C1NK 4A3CG 4KD3A 2K5WA 4L5QA 2XSCA 2R93G 3RLOA 1Q3LA 1S5DD 5EKLA 1MJCA 3PIOA 2KUMA 2PO4A 2IY5B 1G6ZA 3AQQA 1I4HA 2EXZA 1W2BA 1Y1VB 5C3WA 1NTGA 3CCUA 4A93H 3I4NB 1HCZA 3PGZA 4Y7NH 3DHQA 4BBRH 1VQ8A 2BH2A 1IXRA 5C0XI 4JCVE 4RKLA 3MA2B 4A3BH 1L0WA 4FF4A 3NQTA 3C46A 3HS0C 1IW7D 3OWEB 1LTRD 1EIHA 4G7ZC 1QUQA 2KOLA 3TBIB 3VYSA 1I4QA 3I70A 1EY4A 2HIVA 2EY5A 2A1AA 1FGBD 4BA2I 4JBMA 3G48A 2F0JA 2NB0A 1Y8NB 4JI4L 4ILWA 1YHQA 1EFID 3URYA 4IO9A 3M3YB 1TXYA 2ID0A 5EPLA 2R92G 4LFAL 1KLGD 2PW5A 1LT3D 3TEHB 3GTOB 4A3GG 2Q8RE 2F0LA 1A63A 5NUCA 3FHWA 1J8IA 3Q6SA 4A3IG 4A3KB 4CHTB 4B3TL 1JMCA 4JOIC 1VQMA 1HFGA 1WCMB 1R4PB 3H3VH 4WRDA 1TWFB 4YIJA 4JI0L 5IGBA 1FVIA 1STHA 1QZHA 4JBKA 1WTHA 2I5HA 2KCCA 1LLRD 4K8JA 1LUZA 2IHEA 2VUMG 4K2LA 2RQXA 2AWNA 4A76A 1OXXK 2KJXA 1XPRA 2X69A 1FD7D 2XN9C 2RDGA 1HR0L 1W6KA 2C5CA 1MSGA 2NBFA 2F0VA 1ICFB 4A4IA 1QWYA 5IY0A 1BR9A 2K32A 4OWXB 1LTSD 1BDOA 1A62A 3LX0A 1BQQT 3SR1A 3OMCA 1YJNA 1PTOD 4A3FG 2JA7B 1U4PA 4KHPL 5EAYA 4YY3Q 4OIJA 1TY2A 5C0XJ 3F8TA 2PQEA 1XNRQ 4IFDH 3GDEA 1WFQA 3KLSA 4BY1H 1Q1EA 4NW2A 2KENA 1B1ZA 3H0GG 1NR4A 1VQNA 2JSOA 1IBKQ 3G7LA 1U9RA 1EEFD 5IYCG 2AKWB 3TSSA 4KN7C 1N34L 3L2PA 4BBSH 2A19A 1SYBA 3M7GA 1TT2A 4AYBG 4X3SA 3J80i 1PVOA 3VR6A 2LY7A 4QMGA 2VXWA 5GQOA 2LXKA 1YI2A 2EIFA 4A3MB 3CU7A 1B3QA 4J8QA 4M8AA 4R4OA 4R1JA 1Z9FA 3W2DA 4DV1Q 2UXCQ 1UUPA 1FNUA 3H6MA 4WJWA 2MQHA 4IQZA 4L5RC 3RZDB 3A54A 3HOWB 2X6LA 1J5EL 1DYQA 4ZUIA 2PW7A 3R8BA 3GO5A 4XIGS 1RF2D 2CQAA 4K5VA 3PO2B 4JI2Q 5JEAJ 1N36Q 1UE7A 1JICA 3V05A 3U9OA 3A8JE 1AE2A 2CKZB 2JA5B 5IP9H 3S17B 2K05A 4Y52H 3NUCA 3K6OA 1O78A 1S40A 1FJGL 3T4AC 2YU9B 3OIQA 1DOMA 3NEMA 1SYGA 2B2UC 3KOJA 1ENCA 1YJWA 3TMEA 3I4LA 3GTGH 1VQDA 1SDFA 3KUPA 3QOJA 1BNZA 3CRKC 4BXXH 4DV4Q 5M5XB 1CKOA 5D3IB 5DLQE 2E8GA 5ELOA 2E2HB 3H91A 3GTMB 2WV6D 2I46A 4OO1H 1KDCA 1EY0A 3I4OA 3QB3A 4N8FA 5C44B 3I73A 3CAMA 1EZ8A 1TS2A 2EYHA 1OTCA 4GKKQ 1K8AC 1JWUD 3P75A 5K36G 2GA4B 4XQQA 2E2IB 1XPUA 1IKLA 5M5YH 4DR6Q 2NVTB 4DV2L 1IZ6A 5LMUQ 3OTOL 3HKSA 2R7ZG 4UPAA 4C3HB 3SE0A 2J0TD 2QDBA 3KF6A 1U4MA 2LKVA 1VF7A 1GUWA 3C1FA 5IT9E 4KD4A 1SNQA 4DNRB 1HQRD 4KY5A 5CV5A 1PFSA 1EYAA 2XRSD 1I4GA 2KEEA 3NE5B 1I94Q 4A3JB 2FMCA 2DY8A 4IPCA 4R4CA 4QGUA 3KDFB 1NBWA 5F2DA 5JEAG 2R3ZA 4L6TB 4CDCC 1OXVA 1FNVA 1EWCA 3DXJC 3S2DH 1JE4A 1K83H 3DWPA 1U4RA 1Q81C 1A6XA 4MZ9A 1DONA 4CDFC 3HOZB 4ZYSA 2XWJB 4FF2A 1PMRA 1RDPD 4HJ5A 4OIKA 5G3LF 3K8AA 3P1HA 3HOVH 3NXWA 4IUVA 1LABA 4OX9L 1ENAA 3PV0A 3R2TA 2EZVA 1KDBA 4CGYB 3CCRA 2VL6A 3LNNA 3GTKH 2NZ1D 2JK8A 1SN8A 1RJTA 2EYLA 3DWAA 3S15B 4OHJA 3F2DA 3I4MB 2K1BA 3J81j 5LL6S
chains in the Genus database with same CATH topology
2BA1A 2NVXH 4C3JH 4JI8L 4IJHA 3DM3A 3T1YQ 5FLMG 4JI4Q 3CCMA 1QVGA 1YVCA 4AYBE 2VQEL 2OWOA 1VQ4A 2ZJPA 2ZJRA 3LGJA 1XMOQ 3HOXG 1SR3A 3I2ZA 3CCJA 1VQLA 3K7UC 1XNQQ 3CMAA 1K0RA 4QJFA 1LM0A 5M3MH 2Q2TA 5AJ3Q 1L2FA 5JJLA 4DAMA 1R9TH 4GLXA 2UXBL 3U4ZA 5M5XH 5C4XH 2EXDA 3M9BA 4YWMA 3STBD 2E2JH 2E2HH 5IE8A 2RCNA 2E5LQ 3AFPA 3GTMH 3S1QH 4DR2L 4B3TQ 4EQ5A 4DUZL 1XTDA 2R7DA 2D0PA 2PQAA 3TQYA 1M90C 2UUCL 3HOUG 4POFA 1A8VA 4IOAA 4B3SL 5IT9c 1B8AA 4JI0Q 4WJ3M 1SMXA 3NBHB 4K0KQ 4EX5A 4JC0A 1PH6A 1IBLL 2E2IH 4B3RQ 2VNUD 4BY7G 3K80C 5C4XG 2NVTH 3J7A5 2AWOA 2NVYH 2YV5A 3UE1A 4YY3L 3F2CA 4DR5L 1IBML 1GD7A 2OTJA 1HR0Q 3I7FA 3CP0A 1XMQQ 1KXLA 1XNRL 4A75A 1IL2A 2CQOA 4X66L 1PH5A 4QY7A 3RR5A 4HJ8A 2K5HA 3J81i 2ATWA 4MTNA 4OONA 2PQAB 4OXPA 4C2MH 2R7ZH 1E1OA 1IBKL 5C0XG 5C4JH 1KAWA 2Q2UA 2ZTCA 1C9OA 4P72A 3H15A 2KBNA 2KHJA 1VQIA 5GAHC 4HJ9A 4DR1L 1XJVA 4B3ML 4KHPQ 4A93G 1SROA 1JJGA 1KRTA 2K5VA 4GN4B 3ICEA 2WAQE 2QGQA 4LF9L 1N33L 1UE6A 5JJKA 1BVSA 1VQ6A 5C3EH 2ZM6Q 2F4VL 4XTCS 2WP8J 1VCIA 4X64L 2PMZE 1VS0A 2DUDA 3KF8B 5IWAQ 3L0OA 2NN6I 2CCZA 4OX9Q 1FGUA 3TS2A 2EQSA 4A3BG 3CC7A 1I50H 4JV5L 2UXCL 2NN6G 4DV1L 4DV6L 2WFWA 1HR0W 5FJ8H 2MNAA 4R4TA 1PH1A 4IFDJ 2VZAA 2UXDL 1RL2A 3ULPA 3M4QA 4LF7Q 1N34Q 3MEFA 4DUYL 2QA4A 1VQ7A 3HOZH 1HNZL 2K4KA 2PNHA 2R6GA 1EQQA 4WJ4A 1HNWL 2UU9Q 1D8LA 3KYHC 1Q46A 4BA1I 1N36L 4DV5L 2NZHA 4NXMQ 1HH2P 4YCWA 2JA8G 3HOYG 2Z0SA 1KHIA 4UP8A 1VQ5A 3M4OH 2K14A 1YBYA 2JEAI 5HY6A 1I3QH 2HIXA 4YHHQ 4GS3A 3KJPA 2QEXA 1FL0A 5FJ8G 2KCMA 3J81j 4HIKA 3S1MH 1EUJA 4O0AA 1ASYA 4JI3Q 4LF8Q 3FKIG 1CSPA 4QIWE 1JT8A 1QVFA 3UE0A 1T9HA 3WWVA 1J5EQ 3PO3G 4OWWB 3D31A 3OW2A 4AQYL 1JJCB 1Q8KA 3STBC 1Q82C 2BH8A 3CCQA 3HKZE 4JI7L 1VQCA 3UDIA 2MO0A 3BU2A 4GKJL 2VQFQ 4JI1Q 1HZAA 4P74A 4LFCL 4YWLA 1GM5A 1C0AA 2HT1A 1GVPA 1KL9A 3CD6A 1QZGA 3S14H 1FJGQ 4YCUA 5IYBH 4GOPA 3J81c 1VQ9A 1E24A 1JE5A 1X54A 5FLMH 2R93H 1UWVA 5LMNQ 2IX1A 4J15A 4A3DH 1X3EA 1IBLQ 2KCTA 4OWTB 3KJOA 4UY8C 4GOPC 5GADC 2RHQB 4GKKL 1PYSB 1H95A 3CC4A 4IPHA 4DR5Q 3VDYA 3ULLA 2UUAL 4DV3L 4NPSA 2VW9A 4L5SA 3EIVA 4DR3L 2JA8H 2WB1G 3GTLH 4P71A 4DR4L 4DR6L 3F1ZA 1N32Q 2B63G 4JI6Q 1WOCA 5LMUL 3UDFA 2ZTEA 5IYBG 3UDGA 2OQ0A 1PYBA 2K75A 4A3DG 3ER0A 3BZCA 3I55A 2JA6H 4GOPB 4JI5Q 2I5LX 2R7FA 2WB1E 3JAMi 1MJEA 3MXNB 3RNUA 2Z6KA 4A3CH 3PUYA 3CMEA 3K0XA 2UUBQ 3HOUH 4LFBL 1BBWA 4X62Q 3G71A 1Y1WH 1SE8A 2B3GA 3I4NH 4KI0A 2RHSB 2Z6KC 4DV0Q 4NXNQ 3EN2A 3RLFA 4FDBA 5IP7H 4BY7H 1G6PA 1Q1BA 3A0JA 4PZ6A 4DV2Q 4BY1G 1V1QA 1I94L 2XTIA 3CCLA 5LMNW 3PUVA 3OTOQ 5J3BA 2N8NA 1PHJA 3TRZA 5GROA 1IYJB 4AIMA 3A5UA 2JA6G 3HOWG 3T1HQ 4KLKA 5IYDG 2AHOB 2XGTA 4LF4L 4A3CG 3PIPA 5JJIA 2DGYA 4L5QA 3PF5A 2R93G 1Y1WG 1Y1VG 4BBSG 3RLOA 3I4NG 1VQEA 5IP7G 4KHZA 1MJCA 3PIOA 1HNZQ 1CKMA 2IY5B 3AQQA 2NZOA 3IRBA 4LF5Q 1W2BA 3DLLA 2JQOA 1NTGA 2CFMA 3CCUA 4A93H 4UP9A 3PGZA 4DV5Q 4Y7NH 1N9WA 4LUOA 2N49A 4HIOA 4BBRH 1VQ8A 1X3GA 2V1CC 2BH2A 1IXRA 2YTYA 4IPDA 5C0XI 4JCVE 3CQZH 1VQHA 2GVBA 1KD1C 4IFDG 3PO3H 1OXUA 4DK6C 4A3BH 1L0WA 2I5MX 2JJQA 1X55A 2KHIA 4DV7L 4JBWA 4QQBX 1Q7YC 3RN5A 1NE3A 1PH9A 1WJJA 3I56A 2N78A 1K8GA 1HNXL 2R92H 1QUQA 4A3KH 4BBRG 4A3GH 3S24A 4ME3A 2HIVA 4MNOA 5C44G 2A1AA 3OYYA 4JG2A 4X65Q 1TWFH 3HOYH 2L15A 4O2DA 4BA2I 1J6QA 4JBMA 3G48A 4A3LG 1GKHA 4JI4L 1HZBA 2MFIA 1TWGH 3PUZA 1XMOL 3EBEA 1YHQA 4IO9A 1MKHA 3CF5A 1OXSC 3JAMc 1XNQL 1TXYA 5BR8Q 2ID0A 2R92G 3FKIH 4LFAL 3W1GA 4A3KG 5AJ3L 4DNIA 1PVOA 3PUXA 3TEHB 4BXXG 4A3GG 4JYAL 3K7AH 2D62A 1QUQB 1WCMG 1A63A 4JI2L 4JOIA 5GAGC 1YITA 4JI8Q 3FHWA 3J80c 3JC66 1PA6A 2E5LL 2OCEA 4DAYB 1EQRA 4A3IG 4OO1G 4B3TL 1JMCA 4JOIC 1VQMA 2VQEQ 1PH7A 3H3VH 1YJ9A 3M4PA 1SFOH 1VQKA 3CC2A 3ULJA 4JI0L 3W1BA 4A3JG 5FLXc 2JA7H 1NY4A 1A0IA 4K0KL 1FVIA 4B3RL 1BBUA 1VQGA 1QZHA 3S2HH 4JBKA 2I5HA 2VY3A 1LUZA 2IHEA 2VUMG 2UXBQ 1CSQA 3GTJH 2AWNA 2Y0SG 1OXXK 5E7NA 4A76A 1XPRA 4R4IA 1HR0L 1EYGA 3H3VI 4DV4L 4DR2Q 4LF6L 1JB7A 4DUZQ 4A4IA 2B63H 5IY0A 3F2BA 3CW2C 1E3PA 4AH6A 2UUCQ 2JA7G 3KFUA 3AYHB 2FXQA 4TQUS 1X6OA 3H0GH 1LTLA 4OWXB 2N3SA 1LYLA 4B3SQ 3GTPH 1VQOA 1V43A 1CKNA 1A62A 3S16H 2PI2A 1YJNA 4A3FG 3E9IA 3CCVA 3GTQH 5EAYA 1X65A 4KHPL 1YZ6A 4YY3Q 1IBMQ 1K3RA 4PG3A 1Z47A 5C0XJ 1S72A 3F8TA 2ES2A 1XNRQ 3GDEA 4RMFA 1WFQA 2D0OA 4X66Q 4BY1H 1G51A 2YTVA 2F52A 1Q1EA 3RZOH 2KENA 3M7NA 3H0GG 4APVA 1VQNA 5IWAL 5M3FG 4HJ7A 1IBKQ 1NMFA 3RZDH 1PV4A 3HOWH 2NVQH 1RIPA 5IYDH 4GN3B 5IYCG 2Q2IA 1YIJA 2HHHL 2AKWB 1CKNB 3BJUA 2CWAA 3B6YA 3RN2A 4LF7L 1N34L 2GVAA 1VQJA 2K52A 3L2PA 1Y1VH 2A19A 3U50C 4DR1Q 4B3MQ 3PO2H 4BBSH 4LUVA 4IFDI 2Q2HA 4RG1A 2IX0A 1GO3E 1X9NA 4A3EG 4A3MG 2UU9L 4AYBG 3J80i 3S1RH 2JA5H 3GD7A 1B7YB 1UE5A 4GLAC 3NELA 4LF9Q 1N33Q 2F4VQ 1SRUA 3S17H 1PH4A 4NXML 4GLVB 1NJIC 3G6EA 2JE6I 4X64Q 5GQOA 1E1TA 2LXKA 1YI2A 4IPGA 2YU9H 1EIFA 2EIFA 3Q8DA 4YHHL 1D7QA 4HJAA 1YNXA 1O7IA 4LWCA 4JV5Q 4R4OA 4R1JA 4DV1Q 4DV6Q 1Z9FA 3J7ZC 4UP7A 4QL5A 2UXCQ 4JI3L 5M5WH 3M85A 2MQHA 1KC8C 4LF8L 3PO2G 4L5RC 4DUYQ 2UXDQ 1U5KA 4C3IH 4LFAQ 2CWPA 1E22A 4GNXA 1J5EL 3PSIA 2JA5G 1HNWQ 4JYAQ 3CCEA 1XPOA 4YWKA 3GO5A 4XIGS 3ZJYC 3K81C 4JI2Q 2IT1A 5JEAJ 3U4VA 1N36Q 1UE7A 1S3OA 4GNXC 1U0LA 4DR7L 1AE2A 1MIUA 2CKZB 2VQFL 4JI1L 4TVAB 3W5OA 5IP9H 1KQSA 4Y52H 5C44H 1WI5A 4LW1A 1S40A 1FJGL 3M3YH 1PH8A 3A5ZB 3CPFA 4A3LH 3NEMA 5M3MG 2LSSA 5LMNL 3NENA 2OTLA 3AEVA 3GTOH 1YEZA 3KOJA 1YJWA 1N8RC 1DGSA 1NMGA 1VQBA 4GNXB 4IOCA 4AQYQ 3GTGH 1VQDA 1VQAA 2H5XA 5IP9G 4C3HH 4JI7Q 4GKJQ 4BXXH 3SGIA 1N32L 4DV4Q 2ZJQA 3PUWA 1UEBA 1CKOA 1V9PA 1WCMH 5H1SE 4JI6L 4LF6Q 5DLQE 3RLNA 2HQLA 4LFCQ 2E8GA 5ELOA 3T1YL 2C35B 4A3IH 4DK3C 5GAEC 2VS1A 4JI5L 3G4SA 2WAQG 1X56A 3I4OA 1G291 4NB3A 1I6HH 3CAMA 2UUBL 1SLJA 1OTCA 1HJPA 2K5NA 1VQPA 3E0EA 4X62L 4A3JH 1K8AC 4GKKQ 2K50A 4H02A 5ELNA 5K36G 1BKBA 2JA9A 3TS0A 4NXNL 1W3SA 4DV0L 4DV3Q 5M5YH 2UUAQ 1XPUA 4DR6Q 4DR3Q 2AMCB 4JBJA 4DKAC 4DR4Q 4IJLA 4DV2L 1P8LA 2VUMH 1K73C 1IZ6A 5LMUQ 3OTOL 4OO1I 1AH9A 2B29A 2I0QA 1C7YA 3HKSA 1PH2A 2R7ZG 4X6AH 4UPAA 3KDFA 1CUKA 3T1HL 2BA0A 4P75A 1Y14B 3KF6A 3UDXA 4HIMA 1E7ZA 2HHHQ 1Q12A 3PF4A 2YTXA 1L1OA 4LFBQ 1M1KC 1L1OC 5HGQA 1PFSA 5C3EG 4LF5L 1KIXA 4A3FH 1I94Q 4LF4Q 3L7ZC 3CCSA 4IPCA 1XMQL 4R4CA 4P73A 4QGUA 4HIDA 3KDFB 1NBWA 3KF6B 3PCOB 4YCVA 3BZKA 4GN5A 2JEBI 4PZ8A 2Y0SE 5JEAG 3AFQA 3CXCA 1PH3A 4POGA 1B70B 3U58A 5M3FH 4ALPA 3ERSX 1L1OB 1I5FA 1EIYB 3HOZG 1OXVA 3S15H 3E9HA 1EWIA 3HKZG 1KRSA 2IHFA 5IYCH 3S2DH 3I4MH 1K83H 1VQFA 3FP9A 1Q81C 4MZ9A 2ASBA 1YHAA 3KLWA 4HJ5A 1YHBA 4DR7Q 2YYZA 1WYDA 3K8AA 2ZM6L 4A3EH 4A3MH 2OQKA 1ASZA 1P16A 1OXTA 3HOVH 3D0FA 1TWAH 3TREA 4X65L 3PV0A 4OX9L 4R4QA 1HZCA 2F3IA 2MO1A 1K9MC 3CCRA 1HZ9A 1TWCH 2ALYB 2VL6A 2A8VA 1Q86C 1TWHH 3I4MG 1QVCA 1JJ2A 4DV7Q 4PMWA 2LXJA 3GTKH 2JK8A 3HOXH 1SN8A 3A74A 3CPWA 3S1NH 2RF4A 4LUZA 4PZ7A 5BR8L 2ZTDA 4LNQA 2PI2E 1UE1A 2GN5A 1X3FA 3HFZB 1HNXQ 3F2DA 1EFWA 1AE3A 3HOVG 1EOVA 4DPGA 4L5TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BA1 A;  2NVX H;  4C3J H;  4JI8 L;  4IJH A;  3DM3 A;  3T1Y Q;  5FLM G;  4JI4 Q;  3CCM A;  1QVG A;  1YVC A;  4AYB E;  2VQE L;  2OWO A;  1VQ4 A;  2ZJP A;  2ZJR A;  3LGJ A;  1XMO Q;  3HOX G;  1SR3 A;  3I2Z A;  3CCJ A;  1VQL A;  3K7U C;  1XNQ Q;  3CMA A;  1K0R A;  4QJF A;  1LM0 A;  5M3M H;  2Q2T A;  5AJ3 Q;  1L2F A;  5JJL A;  4DAM A;  1R9T H;  4GLX A;  2UXB L;  3U4Z A;  5M5X H;  5C4X H;  2EXD A;  3M9B A;  4YWM A;  3STB D;  2E2J H;  2E2H H;  5IE8 A;  2RCN A;  2E5L Q;  3AFP A;  3GTM H;  3S1Q H;  4DR2 L;  4B3T Q;  4EQ5 A;  4DUZ L;  1XTD A;  2R7D A;  2D0P A;  2PQA A;  3TQY A;  1M90 C;  2UUC L;  3HOU G;  4POF A;  1A8V A;  4IOA A;  4B3S L;  5IT9 c;  1B8A A;  4JI0 Q;  4WJ3 M;  1SMX A;  3NBH B;  4K0K Q;  4EX5 A;  4JC0 A;  1PH6 A;  1IBL L;  2E2I H;  4B3R Q;  2VNU D;  4BY7 G;  3K80 C;  5C4X G;  2NVT H;  3J7A 5;  2AWO A;  2NVY H;  2YV5 A;  3UE1 A;  4YY3 L;  3F2C A;  4DR5 L;  1IBM L;  1GD7 A;  2OTJ A;  1HR0 Q;  3I7F A;  3CP0 A;  1XMQ Q;  1KXL A;  1XNR L;  4A75 A;  1IL2 A;  2CQO A;  4X66 L;  1PH5 A;  4QY7 A;  3RR5 A;  4HJ8 A;  2K5H A;  3J81 i;  2ATW A;  4MTN A;  4OON A;  2PQA B;  4OXP A;  4C2M H;  2R7Z H;  1E1O A;  1IBK L;  5C0X G;  5C4J H;  1KAW A;  2Q2U A;  2ZTC A;  1C9O A;  4P72 A;  3H15 A;  2KBN A;  2KHJ A;  1VQI A;  5GAH C;  4HJ9 A;  4DR1 L;  1XJV A;  4B3M L;  4KHP Q;  4A93 G;  1SRO A;  1JJG A;  1KRT A;  2K5V A;  4GN4 B;  3ICE A;  2WAQ E;  2QGQ A;  4LF9 L;  1N33 L;  1UE6 A;  5JJK A;  1BVS A;  1VQ6 A;  5C3E H;  2ZM6 Q;  2F4V L;  4XTC S;  2WP8 J;  1VCI A;  4X64 L;  2PMZ E;  1VS0 A;  2DUD A;  3KF8 B;  5IWA Q;  3L0O A;  2NN6 I;  2CCZ A;  4OX9 Q;  1FGU A;  3TS2 A;  2EQS A;  4A3B G;  3CC7 A;  1I50 H;  4JV5 L;  2UXC L;  2NN6 G;  4DV1 L;  4DV6 L;  2WFW A;  1HR0 W;  5FJ8 H;  2MNA A;  4R4T A;  1PH1 A;  4IFD J;  2VZA A;  2UXD L;  1RL2 A;  3ULP A;  3M4Q A;  4LF7 Q;  1N34 Q;  3MEF A;  4DUY L;  2QA4 A;  1VQ7 A;  3HOZ H;  1HNZ L;  2K4K A;  2PNH A;  2R6G A;  1EQQ A;  4WJ4 A;  1HNW L;  2UU9 Q;  1D8L A;  3KYH C;  1Q46 A;  4BA1 I;  1N36 L;  4DV5 L;  2NZH A;  4NXM Q;  1HH2 P;  4YCW A;  2JA8 G;  3HOY G;  2Z0S A;  1KHI A;  4UP8 A;  1VQ5 A;  3M4O H;  2K14 A;  1YBY A;  2JEA I;  5HY6 A;  1I3Q H;  2HIX A;  4YHH Q;  4GS3 A;  3KJP A;  2QEX A;  1FL0 A;  5FJ8 G;  2KCM A;  3J81 j;  4HIK A;  3S1M H;  1EUJ A;  4O0A A;  1ASY A;  4JI3 Q;  4LF8 Q;  3FKI G;  1CSP A;  4QIW E;  1JT8 A;  1QVF A;  3UE0 A;  1T9H A;  3WWV A;  1J5E Q;  3PO3 G;  4OWW B;  3D31 A;  3OW2 A;  4AQY L;  1JJC B;  1Q8K A;  3STB C;  1Q82 C;  2BH8 A;  3CCQ A;  3HKZ E;  4JI7 L;  1VQC A;  3UDI A;  2MO0 A;  3BU2 A;  4GKJ L;  2VQF Q;  4JI1 Q;  1HZA A;  4P74 A;  4LFC L;  4YWL A;  1GM5 A;  1C0A A;  2HT1 A;  1GVP A;  1KL9 A;  3CD6 A;  1QZG A;  3S14 H;  1FJG Q;  4YCU A;  5IYB H;  4GOP A;  3J81 c;  1VQ9 A;  1E24 A;  1JE5 A;  1X54 A;  5FLM H;  2R93 H;  1UWV A;  5LMN Q;  2IX1 A;  4J15 A;  4A3D H;  1X3E A;  1IBL Q;  2KCT A;  4OWT B;  3KJO A;  4UY8 C;  4GOP C;  5GAD C;  2RHQ B;  4GKK L;  1PYS B;  1H95 A;  3CC4 A;  4IPH A;  4DR5 Q;  3VDY A;  3ULL A;  2UUA L;  4DV3 L;  4NPS A;  2VW9 A;  4L5S A;  3EIV A;  4DR3 L;  2JA8 H;  2WB1 G;  3GTL H;  4P71 A;  4DR4 L;  4DR6 L;  3F1Z A;  1N32 Q;  2B63 G;  4JI6 Q;  1WOC A;  5LMU L;  3UDF A;  2ZTE A;  5IYB G;  3UDG A;  2OQ0 A;  1PYB A;  2K75 A;  4A3D G;  3ER0 A;  3BZC A;  3I55 A;  2JA6 H;  4GOP B;  4JI5 Q;  2I5L X;  2R7F A;  2WB1 E;  3JAM i;  1MJE A;  3MXN B;  3RNU A;  2Z6K A;  4A3C H;  3PUY A;  3CME A;  3K0X A;  2UUB Q;  3HOU H;  4LFB L;  1BBW A;  4X62 Q;  3G71 A;  1Y1W H;  1SE8 A;  2B3G A;  3I4N H;  4KI0 A;  2RHS B;  2Z6K C;  4DV0 Q;  4NXN Q;  3EN2 A;  3RLF A;  4FDB A;  5IP7 H;  4BY7 H;  1G6P A;  1Q1B A;  3A0J A;  4PZ6 A;  4DV2 Q;  4BY1 G;  1V1Q A;  1I94 L;  2XTI A;  3CCL A;  5LMN W;  3PUV A;  3OTO Q;  5J3B A;  2N8N A;  1PHJ A;  3TRZ A;  5GRO A;  1IYJ B;  4AIM A;  3A5U A;  2JA6 G;  3HOW G;  3T1H Q;  4KLK A;  5IYD G;  2AHO B;  2XGT A;  4LF4 L;  4A3C G;  3PIP A;  5JJI A;  2DGY A;  4L5Q A;  3PF5 A;  2R93 G;  1Y1W G;  1Y1V G;  4BBS G;  3RLO A;  3I4N G;  1VQE A;  5IP7 G;  4KHZ A;  1MJC A;  3PIO A;  1HNZ Q;  1CKM A;  2IY5 B;  3AQQ A;  2NZO A;  3IRB A;  4LF5 Q;  1W2B A;  3DLL A;  2JQO A;  1NTG A;  2CFM A;  3CCU A;  4A93 H;  4UP9 A;  3PGZ A;  4DV5 Q;  4Y7N H;  1N9W A;  4LUO A;  2N49 A;  4HIO A;  4BBR H;  1VQ8 A;  1X3G A;  2V1C C;  2BH2 A;  1IXR A;  2YTY A;  4IPD A;  5C0X I;  4JCV E;  3CQZ H;  1VQH A;  2GVB A;  1KD1 C;  4IFD G;  3PO3 H;  1OXU A;  4DK6 C;  4A3B H;  1L0W A;  2I5M X;  2JJQ A;  1X55 A;  2KHI A;  4DV7 L;  4JBW A;  4QQB X;  1Q7Y C;  3RN5 A;  1NE3 A;  1PH9 A;  1WJJ A;  3I56 A;  2N78 A;  1K8G A;  1HNX L;  2R92 H;  1QUQ A;  4A3K H;  4BBR G;  4A3G H;  3S24 A;  4ME3 A;  2HIV A;  4MNO A;  5C44 G;  2A1A A;  3OYY A;  4JG2 A;  4X65 Q;  1TWF H;  3HOY H;  2L15 A;  4O2D A;  4BA2 I;  1J6Q A;  4JBM A;  3G48 A;  4A3L G;  1GKH A;  4JI4 L;  1HZB A;  2MFI A;  1TWG H;  3PUZ A;  1XMO L;  3EBE A;  1YHQ A;  4IO9 A;  1MKH A;  3CF5 A;  1OXS C;  3JAM c;  1XNQ L;  1TXY A;  5BR8 Q;  2ID0 A;  2R92 G;  3FKI H;  4LFA L;  3W1G A;  4A3K G;  5AJ3 L;  4DNI A;  1PVO A;  3PUX A;  3TEH B;  4BXX G;  4A3G G;  4JYA L;  3K7A H;  2D62 A;  1QUQ B;  1WCM G;  1A63 A;  4JI2 L;  4JOI A;  5GAG C;  1YIT A;  4JI8 Q;  3FHW A;  3J80 c;  3JC6 6;  1PA6 A;  2E5L L;  2OCE A;  4DAY B;  1EQR A;  4A3I G;  4OO1 G;  4B3T L;  1JMC A;  4JOI C;  1VQM A;  2VQE Q;  1PH7 A;  3H3V H;  1YJ9 A;  3M4P A;  1SFO H;  1VQK A;  3CC2 A;  3ULJ A;  4JI0 L;  3W1B A;  4A3J G;  5FLX c;  2JA7 H;  1NY4 A;  1A0I A;  4K0K L;  1FVI A;  4B3R L;  1BBU A;  1VQG A;  1QZH A;  3S2H H;  4JBK A;  2I5H A;  2VY3 A;  1LUZ A;  2IHE A;  2VUM G;  2UXB Q;  1CSQ A;  3GTJ H;  2AWN A;  2Y0S G;  1OXX K;  5E7N A;  4A76 A;  1XPR A;  4R4I A;  1HR0 L;  1EYG A;  3H3V I;  4DV4 L;  4DR2 Q;  4LF6 L;  1JB7 A;  4DUZ Q;  4A4I A;  2B63 H;  5IY0 A;  3F2B A;  3CW2 C;  1E3P A;  4AH6 A;  2UUC Q;  2JA7 G;  3KFU A;  3AYH B;  2FXQ A;  4TQU S;  1X6O A;  3H0G H;  1LTL A;  4OWX B;  2N3S A;  1LYL A;  4B3S Q;  3GTP H;  1VQO A;  1V43 A;  1CKN A;  1A62 A;  3S16 H;  2PI2 A;  1YJN A;  4A3F G;  3E9I A;  3CCV A;  3GTQ H;  5EAY A;  1X65 A;  4KHP L;  1YZ6 A;  4YY3 Q;  1IBM Q;  1K3R A;  4PG3 A;  1Z47 A;  5C0X J;  1S72 A;  3F8T A;  2ES2 A;  1XNR Q;  3GDE A;  4RMF A;  1WFQ A;  2D0O A;  4X66 Q;  4BY1 H;  1G51 A;  2YTV A;  2F52 A;  1Q1E A;  3RZO H;  2KEN A;  3M7N A;  3H0G G;  4APV A;  1VQN A;  5IWA L;  5M3F G;  4HJ7 A;  1IBK Q;  1NMF A;  3RZD H;  1PV4 A;  3HOW H;  2NVQ H;  1RIP A;  5IYD H;  4GN3 B;  5IYC G;  2Q2I A;  1YIJ A;  2HHH L;  2AKW B;  1CKN B;  3BJU A;  2CWA A;  3B6Y A;  3RN2 A;  4LF7 L;  1N34 L;  2GVA A;  1VQJ A;  2K52 A;  3L2P A;  1Y1V H;  2A19 A;  3U50 C;  4DR1 Q;  4B3M Q;  3PO2 H;  4BBS H;  4LUV A;  4IFD I;  2Q2H A;  4RG1 A;  2IX0 A;  1GO3 E;  1X9N A;  4A3E G;  4A3M G;  2UU9 L;  4AYB G;  3J80 i;  3S1R H;  2JA5 H;  3GD7 A;  1B7Y B;  1UE5 A;  4GLA C;  3NEL A;  4LF9 Q;  1N33 Q;  2F4V Q;  1SRU A;  3S17 H;  1PH4 A;  4NXM L;  4GLV B;  1NJI C;  3G6E A;  2JE6 I;  4X64 Q;  5GQO A;  1E1T A;  2LXK A;  1YI2 A;  4IPG A;  2YU9 H;  1EIF A;  2EIF A;  3Q8D A;  4YHH L;  1D7Q A;  4HJA A;  1YNX A;  1O7I A;  4LWC A;  4JV5 Q;  4R4O A;  4R1J A;  4DV1 Q;  4DV6 Q;  1Z9F A;  3J7Z C;  4UP7 A;  4QL5 A;  2UXC Q;  4JI3 L;  5M5W H;  3M85 A;  2MQH A;  1KC8 C;  4LF8 L;  3PO2 G;  4L5R C;  4DUY Q;  2UXD Q;  1U5K A;  4C3I H;  4LFA Q;  2CWP A;  1E22 A;  4GNX A;  1J5E L;  3PSI A;  2JA5 G;  1HNW Q;  4JYA Q;  3CCE A;  1XPO A;  4YWK A;  3GO5 A;  4XIG S;  3ZJY C;  3K81 C;  4JI2 Q;  2IT1 A;  5JEA J;  3U4V A;  1N36 Q;  1UE7 A;  1S3O A;  4GNX C;  1U0L A;  4DR7 L;  1AE2 A;  1MIU A;  2CKZ B;  2VQF L;  4JI1 L;  4TVA B;  3W5O A;  5IP9 H;  1KQS A;  4Y52 H;  5C44 H;  1WI5 A;  4LW1 A;  1S40 A;  1FJG L;  3M3Y H;  1PH8 A;  3A5Z B;  3CPF A;  4A3L H;  3NEM A;  5M3M G;  2LSS A;  5LMN L;  3NEN A;  2OTL A;  3AEV A;  3GTO H;  1YEZ A;  3KOJ A;  1YJW A;  1N8R C;  1DGS A;  1NMG A;  1VQB A;  4GNX B;  4IOC A;  4AQY Q;  3GTG H;  1VQD A;  1VQA A;  2H5X A;  5IP9 G;  4C3H H;  4JI7 Q;  4GKJ Q;  4BXX H;  3SGI A;  1N32 L;  4DV4 Q;  2ZJQ A;  3PUW A;  1UEB A;  1CKO A;  1V9P A;  1WCM H;  5H1S E;  4JI6 L;  4LF6 Q;  5DLQ E;  3RLN A;  2HQL A;  4LFC Q;  2E8G A;  5ELO A;  3T1Y L;  2C35 B;  4A3I H;  4DK3 C;  5GAE C;  2VS1 A;  4JI5 L;  3G4S A;  2WAQ G;  1X56 A;  3I4O A;  1G29 1;  4NB3 A;  1I6H H;  3CAM A;  2UUB L;  1SLJ A;  1OTC A;  1HJP A;  2K5N A;  1VQP A;  3E0E A;  4X62 L;  4A3J H;  1K8A C;  4GKK Q;  2K50 A;  4H02 A;  5ELN A;  5K36 G;  1BKB A;  2JA9 A;  3TS0 A;  4NXN L;  1W3S A;  4DV0 L;  4DV3 Q;  5M5Y H;  2UUA Q;  1XPU A;  4DR6 Q;  4DR3 Q;  2AMC B;  4JBJ A;  4DKA C;  4DR4 Q;  4IJL A;  4DV2 L;  1P8L A;  2VUM H;  1K73 C;  1IZ6 A;  5LMU Q;  3OTO L;  4OO1 I;  1AH9 A;  2B29 A;  2I0Q A;  1C7Y A;  3HKS A;  1PH2 A;  2R7Z G;  4X6A H;  4UPA A;  3KDF A;  1CUK A;  3T1H L;  2BA0 A;  4P75 A;  1Y14 B;  3KF6 A;  3UDX A;  4HIM A;  1E7Z A;  2HHH Q;  1Q12 A;  3PF4 A;  2YTX A;  1L1O A;  4LFB Q;  1M1K C;  1L1O C;  5HGQ A;  1PFS A;  5C3E G;  4LF5 L;  1KIX A;  4A3F H;  1I94 Q;  4LF4 Q;  3L7Z C;  3CCS A;  4IPC A;  1XMQ L;  4R4C A;  4P73 A;  4QGU A;  4HID A;  3KDF B;  1NBW A;  3KF6 B;  3PCO B;  4YCV A;  3BZK A;  4GN5 A;  2JEB I;  4PZ8 A;  2Y0S E;  5JEA G;  3AFQ A;  3CXC A;  1PH3 A;  4POG A;  1B70 B;  3U58 A;  5M3F H;  4ALP A;  3ERS X;  1L1O B;  1I5F A;  1EIY B;  3HOZ G;  1OXV A;  3S15 H;  3E9H A;  1EWI A;  3HKZ G;  1KRS A;  2IHF A;  5IYC H;  3S2D H;  3I4M H;  1K83 H;  1VQF A;  3FP9 A;  1Q81 C;  4MZ9 A;  2ASB A;  1YHA A;  3KLW A;  4HJ5 A;  1YHB A;  4DR7 Q;  2YYZ A;  1WYD A;  3K8A A;  2ZM6 L;  4A3E H;  4A3M H;  2OQK A;  1ASZ A;  1P16 A;  1OXT A;  3HOV H;  3D0F A;  1TWA H;  3TRE A;  4X65 L;  3PV0 A;  4OX9 L;  4R4Q A;  1HZC A;  2F3I A;  2MO1 A;  1K9M C;  3CCR A;  1HZ9 A;  1TWC H;  2ALY B;  2VL6 A;  2A8V A;  1Q86 C;  1TWH H;  3I4M G;  1QVC A;  1JJ2 A;  4DV7 Q;  4PMW A;  2LXJ A;  3GTK H;  2JK8 A;  3HOX H;  1SN8 A;  3A74 A;  3CPW A;  3S1N H;  2RF4 A;  4LUZ A;  4PZ7 A;  5BR8 L;  2ZTD A;  4LNQ A;  2PI2 E;  1UE1 A;  2GN5 A;  1X3F A;  3HFZ B;  1HNX Q;  3F2D A;  1EFW A;  1AE3 A;  3HOV G;  1EOV A;  4DPG A;  4L5T A; 
#chains in the Genus database with same CATH topology
 2HCI A;  2NVX H;  4C3J H;  1HRJ A;  4IJH A;  2D5D A;  3T1Y Q;  4JI4 Q;  3CCM A;  2EJM A;  4AYB E;  2OWO A;  1VQ4 A;  1PRT D;  4N8X 1;  2ZJR A;  3SK5 A;  1SR3 A;  1FYC A;  4GZY C;  2IWH A;  1VQL A;  3NBH A;  1PFN A;  4FF1 A;  1K0R A;  3BDO A;  2Q2T A;  5M3M H;  4L63 B;  4DAM A;  4GLX A;  2UXB L;  1PXU A;  4B9W A;  3HOX B;  1G2S A;  3M9B A;  2E2J H;  4DA2 A;  3NQI A;  4O42 A;  4XXE A;  4B3T Q;  2F0M A;  1XTD A;  3NPP A;  2R7D A;  2PQA A;  4RAU C;  2UUC L;  2B8G A;  4POF A;  1A8V A;  2PZW A;  4JI0 Q;  1D2B A;  3TP8 A;  4XDX A;  4G7H C;  4ZK9 B;  1JC7 A;  1H9J A;  3EA6 A;  2AWO A;  3HOU B;  3A7L A;  2NVY H;  2YV5 A;  3KBG A;  3F2C A;  4DR5 L;  5BN3 A;  1IBM L;  1GD7 A;  1HR0 Q;  3MWY W;  2FHT A;  1PH5 A;  4X66 L;  4HJ8 A;  3KF8 A;  2ATW A;  2AUK A;  4IUQ A;  4OXP A;  4HSP A;  1E1O A;  1KAW A;  2J4X A;  1GOZ A;  4P72 A;  2KBN A;  3TN2 A;  3KK7 A;  4HJ9 A;  2F3V A;  4DR1 L;  2B2T A;  4KHP Q;  4A93 G;  2BE5 D;  2K5V A;  2B2Y C;  1BCP B;  1BVS A;  2B39 A;  5IGG A;  5CC4 A;  2JP1 A;  1JWS D;  4XTC S;  2CCZ A;  3L0O A;  4LK1 C;  1GUO A;  3TS2 A;  1FGU A;  3I3C A;  2A6H D;  4A3B G;  3CC7 A;  3I91 A;  2NN6 G;  3X3N A;  1XTC D;  1HR0 W;  5FJ8 H;  1PH1 A;  4IFD J;  2RBM A;  2UXD L;  1RL2 A;  1N34 Q;  2Z6B A;  2K4K A;  4CBV A;  2PNH A;  2R6G A;  1HNW L;  3RMH A;  4HED A;  1JB3 A;  2O4X A;  4BA1 I;  3S1Q H;  4Q5V A;  1FNW A;  1KHI A;  2K14 A;  5CV6 A;  2KCM A;  2M2L A;  3HOY B;  2MP1 A;  1ASY A;  4QIW E;  1EU3 A;  2A69 C;  3OIP A;  1T9H A;  3WWV A;  1J5E Q;  2CVR A;  1S5E D;  2RCF A;  5D3D A;  4K5X A;  4AQY L;  4DXF A;  4GKJ L;  4LFC L;  4YWL A;  1FJG Q;  1E24 A;  3MXN A;  1X54 A;  1DCZ A;  1UWV A;  1F2Y A;  1IBL Q;  3K57 A;  4OWT B;  4UY8 C;  5D65 A;  2RHQ B;  4PV1 C;  3TP7 A;  4DV3 L;  3MC0 B;  4QUC A;  3ITP A;  3S2H B;  2VW9 A;  4L5S A;  1EYD A;  4DR4 L;  2WII B;  1PFB A;  2ZTE A;  4A3D G;  3ER0 A;  2WB1 B;  1CHP D;  2LS0 1;  3PUY A;  1BBW A;  4LAA A;  2WKC A;  4NP5 A;  4HCS A;  1JOR A;  3I4N H;  4F8M A;  1LT6 D;  3EN2 A;  1G6P A;  4FDB A;  2HDM A;  3E0J A;  4DV2 Q;  4BY1 G;  2XTI A;  5ELB A;  3OTO Q;  4AIM A;  3A5U A;  2ENB A;  1LTB D;  3GQB A;  2B2W C;  1LTT D;  2DGY A;  4RCO A;  1HQM C;  4N9T A;  3SXH A;  4BBS G;  5AFW A;  4QCL A;  5C0X H;  2JA6 B;  2NVQ B;  5IP7 G;  4KHZ A;  1CKM A;  1K28 A;  1AZP A;  1SYE A;  3D4W A;  2X6G A;  5J1Z A;  2R93 B;  2NTT A;  2CFM A;  3K5O A;  1W6J A;  4LUO A;  5EBC A;  4HIO A;  3S1R B;  1X3G A;  1HA5 A;  2V1C C;  3VA5 A;  2YTY A;  4IPD A;  2GVB A;  2KHS A;  3PO3 H;  1OXU A;  5A2Q L;  1L0X B;  2EYJ A;  2KHI A;  1TS3 A;  1Q7Y C;  3RN5 A;  1CA5 A;  3QWN A;  1K8G A;  3JAM L;  1AN8 A;  4A3K H;  1CM9 A;  1NNX A;  4MNO A;  4U67 3;  2EY1 A;  2QF7 A;  1TWF H;  2RSN A;  2L15 A;  1J6Q A;  1STA A;  4XT1 B;  5J22 A;  1STG A;  1ILQ A;  4ZUJ A;  3CQZ B;  1SE4 A;  3CF5 A;  3JAM c;  1XNQ L;  2CH4 W;  4IUN A;  3QOL A;  3PUX A;  4BXX G;  3L9A X;  4JI2 L;  1JQY D;  2R92 B;  4EQP A;  2E5L L;  2OCE A;  4DAY B;  1SAP A;  4OO1 G;  1EL0 A;  4A3G B;  4ME5 A;  1PH7 A;  3M4P A;  1SFO H;  2JA7 H;  1H9S B;  5EBD A;  4A3I B;  4K0K L;  3NWS A;  1BBU A;  2OXP A;  5FO9 B;  2UXB Q;  1H9R A;  1AEX A;  4R4I A;  1AFP A;  5JOB A;  4DV4 L;  2VUM B;  3F2B A;  2UUC Q;  1S4Z A;  1IYU A;  5E1F A;  2N3S A;  1VQO A;  1CKN A;  2MGS A;  2BDN A;  2PI2 A;  1CK1 A;  3E9I A;  5CYU A;  5EPK A;  3CCV A;  1GUN A;  1IBM Q;  1Z47 A;  3S9W A;  1HUM A;  4A3F B;  4X66 Q;  1G51 A;  5JPN C;  4APV A;  4HJ7 A;  5CV7 A;  2MHV A;  1NMF A;  3RZD H;  1SJH D;  3HOW H;  5ELE A;  5IYD H;  1YIJ A;  4MHE A;  1B50 A;  3BJU A;  2CWA A;  3GP7 A;  5I6W A;  4LF7 L;  3H0G B;  4DR1 Q;  3PO2 H;  5JAV A;  3IAY A;  4LUV A;  3S16 B;  2XIW A;  2Q2H A;  4RG1 A;  2IX0 A;  5KYL A;  2JA5 H;  3S17 H;  1SBB B;  4BWG B;  3GTQ B;  2CH4 A;  4DXG A;  1PH4 A;  4GLV B;  4HN7 A;  4OEM B;  2YU9 H;  4HR7 B;  2F3W A;  1O7Z A;  4YHH L;  1HTP A;  1KTK A;  4AYB B;  3S1M B;  3NSW A;  3BDL A;  4JI3 L;  5M5W H;  1KC8 C;  2UXD Q;  2D9U A;  2Z8L A;  5E3F A;  1STY A;  1TWC B;  1U5K A;  3D8G A;  5COY A;  2CWP A;  2LMC B;  1LTG D;  1HNW Q;  2NUC A;  4I7Z C;  4JYA Q;  3CCE A;  4YWK A;  3C1E A;  4C3J G;  2F0N A;  1S3O A;  4GNX C;  2SDF A;  2VQF L;  2PZU A;  1SNP A;  2HCC A;  3W5O A;  1YNN C;  5C44 H;  4LW1 A;  1ZEQ X;  2EY2 A;  5M3M G;  1HFN A;  3AEV A;  4MIU A;  5T1G A;  3VYR A;  4FVM A;  1NMG A;  1RTO A;  4GNX B;  4IOC A;  5I2Y A;  5IGF A;  4AQY Q;  4C3I B;  4C3H H;  4GKJ Q;  3N6R A;  2F0I A;  1UEB A;  5JVH 3;  4LFC Q;  1QB5 D;  3RLN A;  3MEH A;  2HQL A;  1PTO H;  3T1Y L;  2C35 B;  5IIF A;  3E5S A;  2WAQ G;  1X56 A;  1G29 1;  4NB3 A;  5HUR A;  1A3T A;  2L0C A;  3I72 A;  5ELF A;  1HJP A;  1KAA A;  3MFG A;  2B2Y A;  4RGT A;  4X62 L;  4A3J H;  2K50 A;  3TS0 A;  4NXN L;  1S5F D;  1TKW B;  4DV3 Q;  1KAB A;  4ZKB B;  2BDO A;  4DKA C;  4DR4 Q;  1PFM A;  1F2Z A;  3BVM A;  1AH9 A;  1C7Y A;  1IYV A;  3J7Y W;  4FNF A;  4HIM A;  1E7Z A;  2YTX A;  4C2M B;  2R7Z B;  1M1K C;  3QR8 A;  4KJN A;  1L1O C;  1S5B D;  5CR3 A;  1WTQ A;  3PCO B;  3BZK A;  4POG A;  4JK1 C;  1QIL A;  3GTL B;  5M3F H;  4QIW B;  1L1O B;  1EIY B;  3S15 H;  2A68 C;  3E9H A;  3HKZ G;  1A15 A;  1XYI A;  5KNB A;  3I4M H;  1VQF A;  3FP9 A;  3ONA B;  4S3S A;  5C4Z A;  1ILP A;  1ZKO A;  3QIA A;  1WYD A;  2YYZ A;  1UNS A;  3P7J A;  4HAE A;  4A3E H;  1ASZ A;  2CW0 C;  1P16 A;  5DM7 3;  3W3A A;  3TRE A;  5C5L A;  4R4Q A;  3M4O B;  2MO1 A;  3BS1 A;  2HUG A;  1WTO A;  3OPO A;  2JYO A;  3HOX H;  3A74 A;  3CPW A;  3S1N H;  1KNE A;  4LUZ A;  5BR8 L;  2ZTD A;  3X3M A;  1UE1 A;  1X3F A;  5JVG 3;  2OF1 A;  3VA7 A;  4R8I A;  4FYD A;  4ZLT F;  4JI8 L;  1DZ1 A;  4U68 A;  1DM0 B;  3T53 B;  3T13 A;  4P2C B;  1QVG A;  4I65 A;  2VQE L;  1EQV A;  1TQO A;  3K7U C;  1XNQ Q;  5FOB B;  2ZXP A;  2OT2 A;  4UDU C;  1TWH B;  2BOS A;  1L2F A;  1R9T H;  2TSS A;  3U4Z A;  2F4I A;  4K2K A;  1MGS A;  4YWM A;  2B2W A;  2RCN A;  2E5L Q;  4DR2 L;  3HP3 A;  4DUZ L;  2D0P A;  5ELC A;  1B8A A;  1E0B A;  1SMX A;  1Q90 A;  3E3X A;  4EX5 A;  1PH6 A;  1IBL L;  4K0K Q;  2HQE A;  5C4X G;  2F0S A;  4C56 C;  2JN4 A;  2D2C C;  3I7F A;  5I9O A;  3CP0 A;  1XMQ Q;  1E2W A;  4A75 A;  1SE2 A;  4QY7 A;  4ZQ3 A;  4MTN A;  4OON A;  2PNR C;  5C0X G;  2Z4H A;  1K3B C;  2Q2U A;  2ZTC A;  2KHJ A;  3OW7 A;  4QF4 A;  1SRO A;  1JJG A;  3IFD A;  3J7A V;  2HD3 A;  3ICE A;  1SYF A;  2WAQ E;  2G5D A;  3WOF A;  1N33 L;  5C3E H;  2ZM6 Q;  1EIG A;  4CJ0 B;  2WP8 J;  4A93 B;  1O80 A;  4X64 L;  1VS0 A;  2DUD A;  2PMZ E;  5DM6 3;  4Y7N B;  3PO3 G;  2NN6 I;  3IFT A;  3KLR A;  1F2L A;  1D5X C;  3NTI A;  4WOR A;  4DV6 L;  2MNA A;  1H9S A;  1BXT A;  3ULP A;  4LF7 Q;  3MEF A;  4DUY L;  1VQ7 A;  3T16 A;  4WJ4 A;  1EQQ A;  1D1K A;  1D8L A;  1Q46 A;  2JA8 G;  3H94 A;  1HH2 P;  1I3Q H;  2HIX A;  4JPB W;  4YHH Q;  4DK1 A;  5BN5 A;  1BCP D;  2AQ2 B;  3K59 A;  5DEH A;  1EUJ A;  4JI3 Q;  1EZ6 A;  1YNJ C;  4MN3 A;  2F0E A;  1JJC B;  5M9O A;  3EQL C;  3HKZ E;  4JI7 L;  1SNC A;  3BU2 A;  2VQF Q;  2F0U A;  1HZA A;  4HMI A;  4P74 A;  1C0A A;  5C5M A;  2L4N A;  5A2Q E;  2O5J C;  2QEJ C;  5ELD A;  4RA8 A;  3S14 H;  4YCU A;  1TU2 B;  4GOP A;  1JE5 A;  5FLM H;  2EE1 A;  1V1P A;  4DK0 A;  4J15 A;  4IUR A;  2KVM A;  1G2T A;  2XRQ D;  5GAD C;  3JAM E;  2CHB D;  1PYS B;  1D1I A;  4NPS A;  5I2X A;  4DR3 L;  1DJR D;  2OEO A;  3UDF A;  5IYB G;  1A3V A;  4FO2 A;  2OQ0 A;  4PQX A;  4UAI A;  5C6A A;  5CBE E;  2JA6 H;  3LWU A;  2I5L X;  2R7F A;  3JAM i;  1MJE A;  3L3O C;  2I07 B;  4BS9 A;  2Z6K A;  4A3C H;  3K0X A;  3C3L A;  4LFB L;  1PTO F;  2A69 D;  4X62 Q;  5BN4 A;  1NUC A;  1SE8 A;  4A3D B;  4KI0 A;  4NXN Q;  2EYO A;  4BY7 H;  3ERO A;  1B3A A;  1Q1B A;  4L8J A;  1SSO A;  4CJ1 B;  2N8N A;  5GRO A;  1BO0 A;  1IYJ B;  3HOW G;  5COR A;  2PPB C;  4KLK A;  5IYD G;  2RA4 A;  2KCN A;  2XGT A;  4OEL B;  4BY1 B;  3PIP A;  2ICI A;  4HSV A;  4KTA A;  1WTX A;  2IW3 A;  1Y1W G;  1VQE A;  2DJF C;  2F0H A;  1GUT A;  3WOE A;  2H4O A;  1HNZ Q;  2TMP A;  1PLF A;  3A8I E;  3FEW X;  3Q0A A;  3DLL A;  4BBS B;  1GHK A;  4UP9 A;  1LV9 A;  3M4Y A;  4DV5 Q;  1T5X D;  1STE A;  3ND9 A;  1BCP C;  3CQZ H;  1KD1 C;  3BVG A;  4DK6 C;  1A2T A;  1T5E A;  2JJQ A;  1X55 A;  4DV7 L;  1H9K A;  4JBW A;  4QQB X;  5C3X A;  2N88 A;  1NE3 A;  3EFX D;  1WJJ A;  2R92 H;  2XWB B;  4BBR G;  4ZKC B;  4A3G H;  3S24 A;  3E6Z X;  5C44 G;  3OYY A;  4JG2 A;  4XT3 B;  1FR3 A;  2NWG A;  2L11 A;  3IKJ A;  4RH6 A;  1HZB A;  3MFY A;  2MFI A;  3J80 L;  1QCB D;  3T51 B;  3EBE A;  1XMO L;  4CDD C;  1MKH A;  1OXS C;  5BR8 Q;  3FMC A;  1M8A A;  3FKI H;  3W1G A;  4DGZ A;  5AJ3 L;  5I6Y A;  4RHR A;  4JYA L;  3K7A H;  1AW7 A;  5IGC A;  1ML0 D;  1QUQ B;  1LTI D;  4G57 A;  4JOI A;  5GAG C;  4JI8 Q;  3J80 c;  3GTG B;  1MSH A;  2IX3 A;  1EQR A;  1XXG A;  1F77 A;  2A74 C;  4B08 A;  1WD0 A;  5CV8 A;  3NTH A;  3A55 A;  2VQE Q;  3SK8 A;  3BYT B;  5EKI A;  4KV6 A;  1VQK A;  3W1B A;  1XX8 A;  4OGQ C;  5K5P A;  4A3J G;  1NY4 A;  4B3R L;  1TWG B;  2E2D C;  5JPM C;  2VY3 A;  1B2T A;  1ZXT A;  1CSQ A;  4DU9 A;  4CKB A;  2Y0S G;  5E7N A;  1RD9 D;  3DEO A;  4EQO A;  1EYG A;  3G6J B;  4V0B A;  5M5Y B;  1V8Q A;  4DR2 Q;  3V2T A;  3BDC A;  4DUZ Q;  3CW2 C;  1PZJ D;  4AH6 A;  4J1M A;  3KFU A;  4TQU S;  1X6O A;  3H0G H;  1LTL A;  2EDG A;  2SNS A;  5IGE A;  1V43 A;  3S16 H;  1JOO A;  1GHJ A;  5CV9 A;  1BF4 A;  3GTQ H;  4F7X A;  2WAC A;  2A6E C;  1PZK D;  1S72 A;  5EKK A;  3TDQ A;  3GTJ B;  4RMF A;  3S1M H;  2F52 A;  2E75 C;  2K33 A;  1JR0 D;  3MHB A;  5M3F G;  1DOK A;  2KQ3 A;  3TP5 A;  1PV4 A;  1LT5 D;  4FXD A;  2F0G A;  1RIP A;  5KND A;  2B63 B;  1SYD A;  2Q2I A;  5TSS A;  2GVA A;  1Y1V H;  3GTP B;  4LMQ D;  1GO3 E;  1SMY D;  2F0D A;  4A3E G;  1X9N A;  2ASB A;  4IFD G;  3S2D B;  1K83 B;  1N33 Q;  4GLA C;  3NEL A;  3CRL C;  2IL8 A;  2JXM B;  1II3 A;  3NHH A;  3G6E A;  4X64 Q;  1D7Q A;  3Q8D A;  4HJA A;  1YNX A;  1O7I A;  2QW7 A;  4DV6 Q;  3RZO B;  2E74 C;  1NSN S;  1D5M C;  4LF8 L;  4H13 C;  1MHW C;  4DUY Q;  2ZXO A;  1BOS A;  4C3I H;  2O5I C;  1K8M A;  1XPO A;  4PMB A;  2MJ8 A;  3CKI B;  3K81 C;  3U4V A;  4RGO S;  3NBI A;  1U0L A;  2K6A A;  4C3J B;  1PRT F;  2B2U A;  3I8Z A;  1UAP A;  3M3Y H;  1PH8 A;  4A3L H;  3GV6 A;  2OTL A;  1E2Z A;  2FJ2 A;  3GTO H;  1YEZ A;  4F87 A;  4HCE A;  3RD4 A;  1H9M A;  5M3M B;  1VQA A;  5K36 H;  4RFB A;  5IP9 G;  4JI7 Q;  5EPJ A;  2ZJQ A;  3PUW A;  1WCM H;  4JI6 L;  5H1S E;  1QOH A;  2G9H D;  4LF6 Q;  2HT1 A;  3O13 A;  2UUB L;  4HMJ A;  1SLJ A;  2VB3 X;  4H02 A;  1DOL A;  2C9O A;  4DV0 L;  4PMC A;  2WAQ B;  5A35 A;  1NCV A;  4DR3 Q;  4JBJ A;  3QJY A;  1D5Z C;  3K5M A;  1K73 C;  1PDQ A;  2NVY B;  1HXY D;  4X6A H;  3KDF A;  1CUK A;  5IGD A;  2BA0 A;  1YNN D;  1Y14 B;  3T1H L;  2J7Z A;  3UDX A;  2HHH Q;  1Q12 A;  3MAQ A;  5I9P A;  1WVL A;  4LFB Q;  4KK7 A;  5FO8 B;  1MD2 D;  1I6H B;  3HRZ C;  5D14 A;  1SMY C;  5C3E G;  4LF5 L;  1K0S A;  2Z1C A;  1XMQ L;  2FMM A;  4HID A;  4CKC A;  3KF6 B;  4YCV A;  4GN5 A;  4PZ8 A;  2Y0S E;  3MXG A;  3AFQ A;  1CI3 M;  1B70 B;  3U58 A;  1VMP A;  5KEE A;  1I5F A;  5KYI A;  4XQJ A;  1EWI A;  4KKT A;  3DMU A;  2Z4I A;  1YHA A;  2FFK B;  1WTW A;  3HKZ B;  3KLW A;  4ZAI A;  4DR7 Q;  2ZM6 L;  4A3M H;  2OQK A;  2K03 A;  3FDT A;  4ID6 A;  2Q8T A;  4X65 L;  1B9M A;  3MZ5 A;  1HZC A;  2F3I A;  1K9M C;  1HZ9 A;  2ALY B;  1TWH H;  2RKS A;  1QVC A;  1JJ2 A;  3OSO A;  4DV7 Q;  4PZ7 A;  2PI2 E;  3NWT A;  1O7Y A;  2GN5 A;  5I4D A;  1EFW A;  1AE3 A;  3HOV G;  2L1B A;  4L5T A;  3ERQ A;  3Q24 A;  1LT4 D;  1HPC A;  1QG7 A;  5FLM G;  1JWM D;  1EY7 A;  2ZJP A;  2H1E A;  1TWA B;  3LGJ A;  1XMO Q;  1A2U A;  3K0Y A;  2A68 D;  5FLX E;  5AJ3 Q;  1CQV A;  1F9Q A;  2EOT A;  5M5X H;  2MUY A;  3Q23 A;  3PIP 3;  1EY8 A;  2E2H H;  5IE8 A;  3GTM H;  4FXG C;  4KN4 C;  4CDE C;  3K5N A;  1XWE A;  1G91 A;  2CW0 D;  2A73 B;  1M90 C;  4X3U A;  4ODG A;  4DN4 M;  1SJE D;  1U4L A;  4IOA A;  4B3S L;  4WJ3 M;  5L37 A;  2VNU D;  3NBH B;  4B3R Q;  4JC0 A;  1EY9 A;  1C4Q A;  2E2I H;  1SE3 A;  4BY7 G;  2NVT H;  1IHZ A;  1Z6H A;  3V96 A;  3UE1 A;  2OTJ A;  3D3R A;  5C4X B;  1HA6 A;  2CQO A;  1CFM A;  2RDF A;  3RR5 A;  2K01 A;  2K28 A;  1B53 A;  1O7L A;  2PQA B;  2SNM A;  4LJZ C;  1WTR A;  2PYK A;  4N9P A;  3NTK A;  2NN6 H;  1C9O A;  4F88 A;  1XJV A;  4B3M L;  3TZD A;  4HTH A;  4TSS A;  2QGQ A;  4LF9 L;  1UE6 A;  2B2T C;  3SK6 A;  1VQ6 A;  2F4V L;  1GXD C;  1Y8O B;  2VB2 X;  1X3Q A;  3KF8 B;  1KDA A;  1S5C D;  1VMC A;  2EJF C;  4JV5 L;  3UI2 A;  2VZA A;  1JOK A;  3FPU B;  3PO3 B;  5C4J B;  2QA4 A;  3HOZ H;  1HNZ L;  1ZYR C;  4E6I A;  1CA6 A;  3TP6 A;  4KHV A;  3KYH C;  2IPK D;  2ICE C;  4DV5 L;  1EY5 A;  4YCW A;  4UP8 A;  1R4Q B;  1VQ5 A;  3ND8 A;  1RCV D;  1YBY A;  2QDL A;  5G3L D;  4GS3 A;  3KJP A;  2QEX A;  4KKU A;  1FL0 A;  2XNA C;  5FJ8 G;  4HIK A;  2JA8 B;  4LF8 Q;  3FKI G;  1I50 B;  3NP8 A;  4EGV A;  3UE0 A;  4ZRZ A;  1WTP A;  3J81 L;  1TVX A;  2K04 A;  1TS5 A;  4NKL A;  5EGT A;  1IL8 A;  3RUZ A;  4V19 0;  2IJ0 A;  1VQC A;  1RKN A;  2MO0 A;  3K5L A;  1WTV A;  2QIL A;  1MI2 A;  1GVP A;  3H09 A;  1QZG A;  5FKA C;  1RHP A;  3J81 c;  5IOD A;  2IX1 A;  4A3D H;  3R3O A;  3KJO A;  1ICW A;  3WDN A;  3I90 A;  1SFO B;  3HEJ A;  2M00 A;  1NR2 A;  4NMZ A;  2B2V C;  1AZQ A;  3VDY A;  2UUA L;  1H95 A;  4QB4 A;  1I4R A;  4RCN A;  4CKE A;  4P71 A;  3F1Z A;  3MTS A;  4JI6 Q;  1WOC A;  3BYY B;  4TKO B;  3UDG A;  3J80 E;  4G4K A;  2K75 A;  2WKD A;  5HGT A;  2WB1 E;  3DM1 A;  3MXN B;  1YNJ D;  2UUB Q;  1LAC A;  3HOU H;  5JJZ A;  4JW0 A;  3G71 A;  1IW7 C;  2RHS B;  4DV0 Q;  5IP7 H;  5FK9 C;  1DD2 A;  1STB A;  1V1Q A;  1SYC A;  3PUV A;  2FIN B;  3T1H Q;  3ZYY X;  1LO5 D;  4LF4 L;  1EOT A;  5JJI A;  1DXM A;  1Y8P B;  4DAP A;  3PF5 A;  1Y1V G;  3R93 A;  1K8O A;  3I4N G;  3DUZ A;  2EYF A;  2NZO A;  3IRB A;  4LF5 Q;  3VR2 A;  2M9V A;  2JQO A;  1Y1W B;  3NK9 A;  1EYC A;  1N9W A;  2N49 A;  2SEB D;  3MXP A;  3BVZ A;  1VQH A;  4Q0F A;  3U9S A;  1Q8I A;  4C3I G;  1IKM A;  2I5M X;  2R61 A;  5M5W B;  2MPM A;  1PH9 A;  3I56 A;  2N78 A;  3QO2 A;  4K8I A;  1HNX L;  1F9R A;  2O2L D;  4ME3 A;  4M1U B;  4DAY A;  4X65 Q;  3HOY H;  2F0F A;  4O2D A;  4A3L G;  1B4O A;  4EQN A;  1GKH A;  4XYQ A;  4BBR B;  1NAP A;  4KMU C;  1TWG H;  3PUZ A;  5T1I A;  4TRD A;  1PTO C;  1GUS A;  2AQ3 B;  5CMD A;  4A3K G;  4A3B B;  4DNI A;  5FLX L;  2D62 A;  1WCM G;  1YIT A;  3C2P A;  1PA6 A;  3JC6 6;  1C48 A;  4H44 C;  1YJ9 A;  1PTO B;  2F03 A;  3CC2 A;  1TII D;  3ULJ A;  3DEP A;  5FLX c;  1A0I A;  1VQG A;  1TS4 A;  4H0L C;  4XYO A;  3S2H H;  1CQF A;  3H3V C;  3GTJ H;  4IZ8 A;  3H3V I;  3HZX A;  5E4W C;  1JB7 A;  4LF6 L;  2B63 H;  3K58 A;  2F0T A;  3AMU A;  1E3P A;  2Y0S B;  2JA7 G;  3AYH B;  1SNO A;  2FXQ A;  4B3S Q;  1LYL A;  5E4X A;  3GTP H;  3HGB A;  1X65 A;  4I7A A;  1YZ6 A;  2K5D A;  1CZG A;  1K3R A;  4PG3 A;  2ES2 A;  4RWS C;  2D0O A;  4ULL A;  2YTV A;  3RZO H;  3M7N A;  3T56 B;  4Z9C B;  5IWA L;  2EYM A;  2NVQ H;  1EY6 A;  1VF5 C;  4GN3 B;  2HHH L;  2E76 C;  3A7A B;  1CKN B;  1PYW D;  3B6Y A;  3RN2 A;  2WIN B;  1WD1 A;  4CJ2 C;  1VQJ A;  2K52 A;  4B3M Q;  3U50 C;  5M3F B;  2R93 H;  4IFD I;  1EQT A;  4A3M G;  1ROD A;  2UU9 L;  3S1R H;  4LF9 Q;  3GD7 A;  1B7Y B;  1UE5 A;  2DNC A;  3BG3 A;  1SRU A;  2A5H A;  2F4V Q;  3QG1 A;  4NXM L;  1NJI C;  2JE6 I;  1E1T A;  4IPG A;  4MTK A;  1EIF A;  2RDH A;  4DAV A;  4IUT A;  1EEI D;  4A3E B;  4LWC A;  4JV5 Q;  5FO7 B;  3J7Z C;  4UP7 A;  4QL5 A;  3M85 A;  3PO2 G;  4LFA Q;  1E22 A;  5J39 A;  3VYU A;  1SEB D;  3PSI A;  4GNX A;  2JA5 G;  3R2I A;  3S1N B;  5C4H A;  2EJG C;  3ZJY C;  2IT1 A;  2A6E D;  4DR7 L;  1STN A;  1MIU A;  1J9O A;  4JI1 L;  4TVA B;  4DFA A;  1KQS A;  3PIO 3;  1WI5 A;  3HG9 A;  3J7A F;  3A5Z B;  3CPF A;  4FF3 A;  2LSS A;  5LMN L;  3NEN A;  3SEB A;  2F0P A;  1N8R C;  4KKS A;  3KBX A;  3PMF A;  4C1N I;  1DGS A;  1VQB A;  4K6D A;  2H5X A;  1ENF A;  1BUV T;  1R9T B;  3SGI A;  2B8F A;  1N32 L;  3CHB D;  1V9P A;  2KA7 A;  4A3I H;  4DK3 C;  5GAE C;  2VS1 A;  3FVQ A;  4JI5 L;  3G4S A;  2L12 A;  5KGU A;  2EY6 A;  5CBA E;  1I6H H;  1ESR A;  2K5N A;  4B9X A;  1KLU D;  4KY7 A;  3E0E A;  1VQP A;  1JOQ A;  4R8N A;  1V1O A;  5ELN A;  1BKB A;  2JA9 A;  2NYZ D;  2UUA Q;  1W3S A;  1LTA D;  4C3H G;  2AMC B;  3DWQ A;  4IJL A;  2VUM H;  1P8L A;  4K5W A;  4OO1 I;  2B29 A;  2I0Q A;  2QCP X;  1PH2 A;  3VYT A;  2KEC A;  4P75 A;  5ISR A;  1JCK B;  4RGM A;  2EPB A;  3PF4 A;  1L1O A;  2SOB A;  1SXT A;  4KY6 A;  3D4R A;  1I4X A;  2K7V A;  5KNC A;  4DNT B;  5HGQ A;  1I6V C;  1G8Z D;  2NTS A;  1KIX A;  4A3F H;  3L7Z C;  2V4D A;  3CCS A;  1I4P A;  1AP0 A;  3OOC A;  4P73 A;  2G9D A;  2RSO A;  1TR5 A;  5C3E B;  4LF4 Q;  1PH3 A;  2JEB I;  3CXC A;  1PZI D;  1PRT C;  4ALP A;  3ERS X;  3HOZ G;  3VR4 A;  1KRS A;  2IHF A;  5IYC H;  3FRP B;  4RKB A;  2KED A;  3P20 A;  4NDX A;  3SDZ A;  2AUJ D;  3D4D A;  4O1N A;  1L0Y B;  2L9H A;  1YHB A;  1PRT B;  1OXT A;  3D0F A;  1BCP F;  1TWA H;  2DJG C;  1GJX A;  5EJW A;  1TWC H;  1I3Q B;  4FP5 D;  2A8V A;  1ET6 A;  2EYP A;  3Q22 A;  1Q86 C;  3I4M G;  2B2V A;  5KIX A;  4PMW A;  2LXJ A;  1F9S A;  2RF4 A;  4LNQ A;  4PNY A;  2F1M A;  2ZT9 C;  3HFZ B;  4IUU A;  1HNX Q;  2DY7 A;  4JVZ A;  2Q8I B;  1EOV A;  1CTM A;  4DPG A;  3BZD B;  2BA1 A;  1EWH A;  3MXU A;  3VR3 A;  4K14 A;  3VR5 A;  3DM3 A;  1SNM A;  3N52 A;  2HDL A;  2F0O A;  4J6H A;  1YVC A;  5CGK A;  3HOV B;  4KJO A;  3HOX G;  3I2Z A;  2F0K A;  5EQ0 A;  3CCJ A;  3S14 B;  2LFN A;  1ESF A;  3CMA A;  1F2M A;  1Z7T A;  4QJF A;  1LM0 A;  4RHS A;  1B44 D;  2ZXR A;  5IT9 L;  5JJL A;  3GTK B;  2BE5 C;  1D6E C;  5C4X H;  4EVO A;  3D6C A;  2EXD A;  3STB D;  4G7O C;  2XVS A;  2DNE A;  3AFP A;  4EQ5 A;  3EJI A;  2NVX B;  2A6H C;  3TQY A;  3HOU G;  5IT9 c;  1ET9 A;  3J81 E;  1HUN A;  3K80 C;  2DN8 A;  1X3P A;  3J7A 5;  3SVM A;  4ABN A;  4H7B A;  4YY3 L;  2AQ1 B;  1KXL A;  4BY7 B;  1HHV A;  2F0W A;  1XNR L;  1IL2 A;  4R9W A;  4ZCK A;  3F2U A;  2E2J B;  2K5H A;  3J81 i;  4C2M H;  2R7Z H;  1IBK L;  2P5Z X;  5C4J H;  1KNA A;  4OL7 A;  3H15 A;  3A8K E;  3SHL A;  1RTN A;  1VQI A;  5GAH C;  5DNF A;  5DAU A;  1KRT A;  1Y69 U;  4IUP A;  4GN4 B;  5JJK A;  1CZW A;  2L5T A;  4X3K A;  2PMZ B;  1VCI A;  3PQI A;  4OX9 Q;  2JA8 H;  3GTL H;  5IWA Q;  2F0Q A;  5IOC A;  1MBY A;  2EQS A;  3MVV A;  1CT1 D;  1I50 H;  2UXC L;  4DV1 L;  1EU4 A;  2WFW A;  4R4T A;  3KLS X;  5LHY 1;  5JEA H;  1QE6 A;  3M4Q A;  3OMG A;  4RGN A;  1QNK A;  1HTL D;  1TY0 A;  2Z9H A;  2UU9 Q;  5CV4 A;  5LL6 X;  1N36 L;  3HOY G;  2NZH A;  4NXM Q;  2Z0S A;  3M4O H;  1ONL A;  4IAL A;  2JEA I;  5HY6 A;  3AU7 A;  1C8C A;  4X3T A;  1QNU A;  3GV3 A;  4O0A A;  3OWF A;  1CSP A;  1JT8 A;  3SK4 A;  1QVF A;  2QKI C;  1B9N A;  4UHV A;  4OWW B;  3D31 A;  4K6L A;  3OW2 A;  1VDZ A;  3FKI B;  1Q8K A;  3STB C;  1QJO A;  1Q82 C;  1CHQ D;  1M4V A;  2BH8 A;  3CCQ A;  3UDI A;  3K7A B;  4JI1 Q;  1GM5 A;  3D6W A;  2RVL A;  1SND A;  4FXK C;  3S1Q B;  1KL9 A;  3OHX C;  3CD6 A;  1BBX C;  5IYB H;  1VQ9 A;  5LMN Q;  1X3E A;  2KCT A;  1A3U A;  4GOP C;  4GKK L;  2PZT A;  1X32 A;  1ZYR D;  3IL8 A;  4IPH A;  3FPP A;  3ULL A;  4DR5 Q;  2K5Q A;  3CC4 A;  4DR6 L;  3EIV A;  2WB1 G;  4IN3 A;  1N32 Q;  2B63 G;  5LMU L;  3LWE A;  1E2V A;  3A56 A;  2BCO A;  1OO9 B;  1PYB A;  2L55 A;  3BZC A;  3I55 A;  1F9P A;  4GOP B;  4JI5 Q;  3RNU A;  1V1P B;  4WFN 3;  2PCF B;  2EVB A;  1GUG A;  2N55 A;  3CME A;  4QUF A;  4DF7 A;  1Y1W H;  3EVQ A;  2B3G A;  4XQN A;  2Z6K C;  3RLF A;  3A0J A;  4PZ6 A;  3AB9 A;  1I94 L;  3CCL A;  1UEA B;  5LMN W;  5J3B A;  3TZU A;  1PHJ A;  3TRZ A;  2JA6 G;  5KRU A;  2AHO B;  4C1N K;  4A3C G;  4KD3 A;  2K5W A;  4L5Q A;  2XSC A;  2R93 G;  3RLO A;  1Q3L A;  1S5D D;  5EKL A;  1MJC A;  3PIO A;  2KUM A;  2PO4 A;  2IY5 B;  1G6Z A;  3AQQ A;  1I4H A;  2EXZ A;  1W2B A;  1Y1V B;  5C3W A;  1NTG A;  3CCU A;  4A93 H;  3I4N B;  1HCZ A;  3PGZ A;  4Y7N H;  3DHQ A;  4BBR H;  1VQ8 A;  2BH2 A;  1IXR A;  5C0X I;  4JCV E;  4RKL A;  3MA2 B;  4A3B H;  1L0W A;  4FF4 A;  3NQT A;  3C46 A;  3HS0 C;  1IW7 D;  3OWE B;  1LTR D;  1EIH A;  4G7Z C;  1QUQ A;  2KOL A;  3TBI B;  3VYS A;  1I4Q A;  3I70 A;  1EY4 A;  2HIV A;  2EY5 A;  2A1A A;  1FGB D;  4BA2 I;  4JBM A;  3G48 A;  2F0J A;  2NB0 A;  1Y8N B;  4JI4 L;  4ILW A;  1YHQ A;  1EFI D;  3URY A;  4IO9 A;  3M3Y B;  1TXY A;  2ID0 A;  5EPL A;  2R92 G;  4LFA L;  1KLG D;  2PW5 A;  1LT3 D;  3TEH B;  3GTO B;  4A3G G;  2Q8R E;  2F0L A;  1A63 A;  5NUC A;  3FHW A;  1J8I A;  3Q6S A;  4A3I G;  4A3K B;  4CHT B;  4B3T L;  1JMC A;  4JOI C;  1VQM A;  1HFG A;  1WCM B;  1R4P B;  3H3V H;  4WRD A;  1TWF B;  4YIJ A;  4JI0 L;  5IGB A;  1FVI A;  1STH A;  1QZH A;  4JBK A;  1WTH A;  2I5H A;  2KCC A;  1LLR D;  4K8J A;  1LUZ A;  2IHE A;  2VUM G;  4K2L A;  2RQX A;  2AWN A;  4A76 A;  1OXX K;  2KJX A;  1XPR A;  2X69 A;  1FD7 D;  2XN9 C;  2RDG A;  1HR0 L;  1W6K A;  2C5C A;  1MSG A;  2NBF A;  2F0V A;  1ICF B;  4A4I A;  1QWY A;  5IY0 A;  1BR9 A;  2K32 A;  4OWX B;  1LTS D;  1BDO A;  1A62 A;  3LX0 A;  1BQQ T;  3SR1 A;  3OMC A;  1YJN A;  1PTO D;  4A3F G;  2JA7 B;  1U4P A;  4KHP L;  5EAY A;  4YY3 Q;  4OIJ A;  1TY2 A;  5C0X J;  3F8T A;  2PQE A;  1XNR Q;  4IFD H;  3GDE A;  1WFQ A;  3KLS A;  4BY1 H;  1Q1E A;  4NW2 A;  2KEN A;  1B1Z A;  3H0G G;  1NR4 A;  1VQN A;  2JSO A;  1IBK Q;  3G7L A;  1U9R A;  1EEF D;  5IYC G;  2AKW B;  3TSS A;  4KN7 C;  1N34 L;  3L2P A;  4BBS H;  2A19 A;  1SYB A;  3M7G A;  1TT2 A;  4AYB G;  4X3S A;  3J80 i;  1PVO A;  3VR6 A;  2LY7 A;  4QMG A;  2VXW A;  5GQO A;  2LXK A;  1YI2 A;  2EIF A;  4A3M B;  3CU7 A;  1B3Q A;  4J8Q A;  4M8A A;  4R4O A;  4R1J A;  1Z9F A;  3W2D A;  4DV1 Q;  2UXC Q;  1UUP A;  1FNU A;  3H6M A;  4WJW A;  2MQH A;  4IQZ A;  4L5R C;  3RZD B;  3A54 A;  3HOW B;  2X6L A;  1J5E L;  1DYQ A;  4ZUI A;  2PW7 A;  3R8B A;  3GO5 A;  4XIG S;  1RF2 D;  2CQA A;  4K5V A;  3PO2 B;  4JI2 Q;  5JEA J;  1N36 Q;  1UE7 A;  1JIC A;  3V05 A;  3U9O A;  3A8J E;  1AE2 A;  2CKZ B;  2JA5 B;  5IP9 H;  3S17 B;  2K05 A;  4Y52 H;  3NUC A;  3K6O A;  1O78 A;  1S40 A;  1FJG L;  3T4A C;  2YU9 B;  3OIQ A;  1DOM A;  3NEM A;  1SYG A;  2B2U C;  3KOJ A;  1ENC A;  1YJW A;  3TME A;  3I4L A;  3GTG H;  1VQD A;  1SDF A;  3KUP A;  3QOJ A;  1BNZ A;  3CRK C;  4BXX H;  4DV4 Q;  5M5X B;  1CKO A;  5D3I B;  5DLQ E;  2E8G A;  5ELO A;  2E2H B;  3H91 A;  3GTM B;  2WV6 D;  2I46 A;  4OO1 H;  1KDC A;  1EY0 A;  3I4O A;  3QB3 A;  4N8F A;  5C44 B;  3I73 A;  3CAM A;  1EZ8 A;  1TS2 A;  2EYH A;  1OTC A;  4GKK Q;  1K8A C;  1JWU D;  3P75 A;  5K36 G;  2GA4 B;  4XQQ A;  2E2I B;  1XPU A;  1IKL A;  5M5Y H;  4DR6 Q;  2NVT B;  4DV2 L;  1IZ6 A;  5LMU Q;  3OTO L;  3HKS A;  2R7Z G;  4UPA A;  4C3H B;  3SE0 A;  2J0T D;  2QDB A;  3KF6 A;  1U4M A;  2LKV A;  1VF7 A;  1GUW A;  3C1F A;  5IT9 E;  4KD4 A;  1SNQ A;  4DNR B;  1HQR D;  4KY5 A;  5CV5 A;  1PFS A;  1EYA A;  2XRS D;  1I4G A;  2KEE A;  3NE5 B;  1I94 Q;  4A3J B;  2FMC A;  2DY8 A;  4IPC A;  4R4C A;  4QGU A;  3KDF B;  1NBW A;  5F2D A;  5JEA G;  2R3Z A;  4L6T B;  4CDC C;  1OXV A;  1FNV A;  1EWC A;  3DXJ C;  3S2D H;  1JE4 A;  1K83 H;  3DWP A;  1U4R A;  1Q81 C;  1A6X A;  4MZ9 A;  1DON A;  4CDF C;  3HOZ B;  4ZYS A;  2XWJ B;  4FF2 A;  1PMR A;  1RDP D;  4HJ5 A;  4OIK A;  5G3L F;  3K8A A;  3P1H A;  3HOV H;  3NXW A;  4IUV A;  1LAB A;  4OX9 L;  1ENA A;  3PV0 A;  3R2T A;  2EZV A;  1KDB A;  4CGY B;  3CCR A;  2VL6 A;  3LNN A;  3GTK H;  2NZ1 D;  2JK8 A;  1SN8 A;  1RJT A;  2EYL A;  3DWA A;  3S15 B;  4OHJ A;  3F2D A;  3I4M B;  2K1B A;  3J81 j;  5LL6 S; 
#chains in the Genus database with same CATH homology
 2BA1 A;  2NVX H;  4C3J H;  4JI8 L;  4IJH A;  3DM3 A;  3T1Y Q;  5FLM G;  4JI4 Q;  3CCM A;  1QVG A;  1YVC A;  4AYB E;  2VQE L;  2OWO A;  1VQ4 A;  2ZJP A;  2ZJR A;  3LGJ A;  1XMO Q;  3HOX G;  1SR3 A;  3I2Z A;  3CCJ A;  1VQL A;  3K7U C;  1XNQ Q;  3CMA A;  1K0R A;  4QJF A;  1LM0 A;  5M3M H;  2Q2T A;  5AJ3 Q;  1L2F A;  5JJL A;  4DAM A;  1R9T H;  4GLX A;  2UXB L;  3U4Z A;  5M5X H;  5C4X H;  2EXD A;  3M9B A;  4YWM A;  3STB D;  2E2J H;  2E2H H;  5IE8 A;  2RCN A;  2E5L Q;  3AFP A;  3GTM H;  3S1Q H;  4DR2 L;  4B3T Q;  4EQ5 A;  4DUZ L;  1XTD A;  2R7D A;  2D0P A;  2PQA A;  3TQY A;  1M90 C;  2UUC L;  3HOU G;  4POF A;  1A8V A;  4IOA A;  4B3S L;  5IT9 c;  1B8A A;  4JI0 Q;  4WJ3 M;  1SMX A;  3NBH B;  4K0K Q;  4EX5 A;  4JC0 A;  1PH6 A;  1IBL L;  2E2I H;  4B3R Q;  2VNU D;  4BY7 G;  3K80 C;  5C4X G;  2NVT H;  3J7A 5;  2AWO A;  2NVY H;  2YV5 A;  3UE1 A;  4YY3 L;  3F2C A;  4DR5 L;  1IBM L;  1GD7 A;  2OTJ A;  1HR0 Q;  3I7F A;  3CP0 A;  1XMQ Q;  1KXL A;  1XNR L;  4A75 A;  1IL2 A;  2CQO A;  4X66 L;  1PH5 A;  4QY7 A;  3RR5 A;  4HJ8 A;  2K5H A;  3J81 i;  2ATW A;  4MTN A;  4OON A;  2PQA B;  4OXP A;  4C2M H;  2R7Z H;  1E1O A;  1IBK L;  5C0X G;  5C4J H;  1KAW A;  2Q2U A;  2ZTC A;  1C9O A;  4P72 A;  3H15 A;  2KBN A;  2KHJ A;  1VQI A;  5GAH C;  4HJ9 A;  4DR1 L;  1XJV A;  4B3M L;  4KHP Q;  4A93 G;  1SRO A;  1JJG A;  1KRT A;  2K5V A;  4GN4 B;  3ICE A;  2WAQ E;  2QGQ A;  4LF9 L;  1N33 L;  1UE6 A;  5JJK A;  1BVS A;  1VQ6 A;  5C3E H;  2ZM6 Q;  2F4V L;  4XTC S;  2WP8 J;  1VCI A;  4X64 L;  2PMZ E;  1VS0 A;  2DUD A;  3KF8 B;  5IWA Q;  3L0O A;  2NN6 I;  2CCZ A;  4OX9 Q;  1FGU A;  3TS2 A;  2EQS A;  4A3B G;  3CC7 A;  1I50 H;  4JV5 L;  2UXC L;  2NN6 G;  4DV1 L;  4DV6 L;  2WFW A;  1HR0 W;  5FJ8 H;  2MNA A;  4R4T A;  1PH1 A;  4IFD J;  2VZA A;  2UXD L;  1RL2 A;  3ULP A;  3M4Q A;  4LF7 Q;  1N34 Q;  3MEF A;  4DUY L;  2QA4 A;  1VQ7 A;  3HOZ H;  1HNZ L;  2K4K A;  2PNH A;  2R6G A;  1EQQ A;  4WJ4 A;  1HNW L;  2UU9 Q;  1D8L A;  3KYH C;  1Q46 A;  4BA1 I;  1N36 L;  4DV5 L;  2NZH A;  4NXM Q;  1HH2 P;  4YCW A;  2JA8 G;  3HOY G;  2Z0S A;  1KHI A;  4UP8 A;  1VQ5 A;  3M4O H;  2K14 A;  1YBY A;  2JEA I;  5HY6 A;  1I3Q H;  2HIX A;  4YHH Q;  4GS3 A;  3KJP A;  2QEX A;  1FL0 A;  5FJ8 G;  2KCM A;  3J81 j;  4HIK A;  3S1M H;  1EUJ A;  4O0A A;  1ASY A;  4JI3 Q;  4LF8 Q;  3FKI G;  1CSP A;  4QIW E;  1JT8 A;  1QVF A;  3UE0 A;  1T9H A;  3WWV A;  1J5E Q;  3PO3 G;  4OWW B;  3D31 A;  3OW2 A;  4AQY L;  1JJC B;  1Q8K A;  3STB C;  1Q82 C;  2BH8 A;  3CCQ A;  3HKZ E;  4JI7 L;  1VQC A;  3UDI A;  2MO0 A;  3BU2 A;  4GKJ L;  2VQF Q;  4JI1 Q;  1HZA A;  4P74 A;  4LFC L;  4YWL A;  1GM5 A;  1C0A A;  2HT1 A;  1GVP A;  1KL9 A;  3CD6 A;  1QZG A;  3S14 H;  1FJG Q;  4YCU A;  5IYB H;  4GOP A;  3J81 c;  1VQ9 A;  1E24 A;  1JE5 A;  1X54 A;  5FLM H;  2R93 H;  1UWV A;  5LMN Q;  2IX1 A;  4J15 A;  4A3D H;  1X3E A;  1IBL Q;  2KCT A;  4OWT B;  3KJO A;  4UY8 C;  4GOP C;  5GAD C;  2RHQ B;  4GKK L;  1PYS B;  1H95 A;  3CC4 A;  4IPH A;  4DR5 Q;  3VDY A;  3ULL A;  2UUA L;  4DV3 L;  4NPS A;  2VW9 A;  4L5S A;  3EIV A;  4DR3 L;  2JA8 H;  2WB1 G;  3GTL H;  4P71 A;  4DR4 L;  4DR6 L;  3F1Z A;  1N32 Q;  2B63 G;  4JI6 Q;  1WOC A;  5LMU L;  3UDF A;  2ZTE A;  5IYB G;  3UDG A;  2OQ0 A;  1PYB A;  2K75 A;  4A3D G;  3ER0 A;  3BZC A;  3I55 A;  2JA6 H;  4GOP B;  4JI5 Q;  2I5L X;  2R7F A;  2WB1 E;  3JAM i;  1MJE A;  3MXN B;  3RNU A;  2Z6K A;  4A3C H;  3PUY A;  3CME A;  3K0X A;  2UUB Q;  3HOU H;  4LFB L;  1BBW A;  4X62 Q;  3G71 A;  1Y1W H;  1SE8 A;  2B3G A;  3I4N H;  4KI0 A;  2RHS B;  2Z6K C;  4DV0 Q;  4NXN Q;  3EN2 A;  3RLF A;  4FDB A;  5IP7 H;  4BY7 H;  1G6P A;  1Q1B A;  3A0J A;  4PZ6 A;  4DV2 Q;  4BY1 G;  1V1Q A;  1I94 L;  2XTI A;  3CCL A;  5LMN W;  3PUV A;  3OTO Q;  5J3B A;  2N8N A;  1PHJ A;  3TRZ A;  5GRO A;  1IYJ B;  4AIM A;  3A5U A;  2JA6 G;  3HOW G;  3T1H Q;  4KLK A;  5IYD G;  2AHO B;  2XGT A;  4LF4 L;  4A3C G;  3PIP A;  5JJI A;  2DGY A;  4L5Q A;  3PF5 A;  2R93 G;  1Y1W G;  1Y1V G;  4BBS G;  3RLO A;  3I4N G;  1VQE A;  5IP7 G;  4KHZ A;  1MJC A;  3PIO A;  1HNZ Q;  1CKM A;  2IY5 B;  3AQQ A;  2NZO A;  3IRB A;  4LF5 Q;  1W2B A;  3DLL A;  2JQO A;  1NTG A;  2CFM A;  3CCU A;  4A93 H;  4UP9 A;  3PGZ A;  4DV5 Q;  4Y7N H;  1N9W A;  4LUO A;  2N49 A;  4HIO A;  4BBR H;  1VQ8 A;  1X3G A;  2V1C C;  2BH2 A;  1IXR A;  2YTY A;  4IPD A;  5C0X I;  4JCV E;  3CQZ H;  1VQH A;  2GVB A;  1KD1 C;  4IFD G;  3PO3 H;  1OXU A;  4DK6 C;  4A3B H;  1L0W A;  2I5M X;  2JJQ A;  1X55 A;  2KHI A;  4DV7 L;  4JBW A;  4QQB X;  1Q7Y C;  3RN5 A;  1NE3 A;  1PH9 A;  1WJJ A;  3I56 A;  2N78 A;  1K8G A;  1HNX L;  2R92 H;  1QUQ A;  4A3K H;  4BBR G;  4A3G H;  3S24 A;  4ME3 A;  2HIV A;  4MNO A;  5C44 G;  2A1A A;  3OYY A;  4JG2 A;  4X65 Q;  1TWF H;  3HOY H;  2L15 A;  4O2D A;  4BA2 I;  1J6Q A;  4JBM A;  3G48 A;  4A3L G;  1GKH A;  4JI4 L;  1HZB A;  2MFI A;  1TWG H;  3PUZ A;  1XMO L;  3EBE A;  1YHQ A;  4IO9 A;  1MKH A;  3CF5 A;  1OXS C;  3JAM c;  1XNQ L;  1TXY A;  5BR8 Q;  2ID0 A;  2R92 G;  3FKI H;  4LFA L;  3W1G A;  4A3K G;  5AJ3 L;  4DNI A;  1PVO A;  3PUX A;  3TEH B;  4BXX G;  4A3G G;  4JYA L;  3K7A H;  2D62 A;  1QUQ B;  1WCM G;  1A63 A;  4JI2 L;  4JOI A;  5GAG C;  1YIT A;  4JI8 Q;  3FHW A;  3J80 c;  3JC6 6;  1PA6 A;  2E5L L;  2OCE A;  4DAY B;  1EQR A;  4A3I G;  4OO1 G;  4B3T L;  1JMC A;  4JOI C;  1VQM A;  2VQE Q;  1PH7 A;  3H3V H;  1YJ9 A;  3M4P A;  1SFO H;  1VQK A;  3CC2 A;  3ULJ A;  4JI0 L;  3W1B A;  4A3J G;  5FLX c;  2JA7 H;  1NY4 A;  1A0I A;  4K0K L;  1FVI A;  4B3R L;  1BBU A;  1VQG A;  1QZH A;  3S2H H;  4JBK A;  2I5H A;  2VY3 A;  1LUZ A;  2IHE A;  2VUM G;  2UXB Q;  1CSQ A;  3GTJ H;  2AWN A;  2Y0S G;  1OXX K;  5E7N A;  4A76 A;  1XPR A;  4R4I A;  1HR0 L;  1EYG A;  3H3V I;  4DV4 L;  4DR2 Q;  4LF6 L;  1JB7 A;  4DUZ Q;  4A4I A;  2B63 H;  5IY0 A;  3F2B A;  3CW2 C;  1E3P A;  4AH6 A;  2UUC Q;  2JA7 G;  3KFU A;  3AYH B;  2FXQ A;  4TQU S;  1X6O A;  3H0G H;  1LTL A;  4OWX B;  2N3S A;  1LYL A;  4B3S Q;  3GTP H;  1VQO A;  1V43 A;  1CKN A;  1A62 A;  3S16 H;  2PI2 A;  1YJN A;  4A3F G;  3E9I A;  3CCV A;  3GTQ H;  5EAY A;  1X65 A;  4KHP L;  1YZ6 A;  4YY3 Q;  1IBM Q;  1K3R A;  4PG3 A;  1Z47 A;  5C0X J;  1S72 A;  3F8T A;  2ES2 A;  1XNR Q;  3GDE A;  4RMF A;  1WFQ A;  2D0O A;  4X66 Q;  4BY1 H;  1G51 A;  2YTV A;  2F52 A;  1Q1E A;  3RZO H;  2KEN A;  3M7N A;  3H0G G;  4APV A;  1VQN A;  5IWA L;  5M3F G;  4HJ7 A;  1IBK Q;  1NMF A;  3RZD H;  1PV4 A;  3HOW H;  2NVQ H;  1RIP A;  5IYD H;  4GN3 B;  5IYC G;  2Q2I A;  1YIJ A;  2HHH L;  2AKW B;  1CKN B;  3BJU A;  2CWA A;  3B6Y A;  3RN2 A;  4LF7 L;  1N34 L;  2GVA A;  1VQJ A;  2K52 A;  3L2P A;  1Y1V H;  2A19 A;  3U50 C;  4DR1 Q;  4B3M Q;  3PO2 H;  4BBS H;  4LUV A;  4IFD I;  2Q2H A;  4RG1 A;  2IX0 A;  1GO3 E;  1X9N A;  4A3E G;  4A3M G;  2UU9 L;  4AYB G;  3J80 i;  3S1R H;  2JA5 H;  3GD7 A;  1B7Y B;  1UE5 A;  4GLA C;  3NEL A;  4LF9 Q;  1N33 Q;  2F4V Q;  1SRU A;  3S17 H;  1PH4 A;  4NXM L;  4GLV B;  1NJI C;  3G6E A;  2JE6 I;  4X64 Q;  5GQO A;  1E1T A;  2LXK A;  1YI2 A;  4IPG A;  2YU9 H;  1EIF A;  2EIF A;  3Q8D A;  4YHH L;  1D7Q A;  4HJA A;  1YNX A;  1O7I A;  4LWC A;  4JV5 Q;  4R4O A;  4R1J A;  4DV1 Q;  4DV6 Q;  1Z9F A;  3J7Z C;  4UP7 A;  4QL5 A;  2UXC Q;  4JI3 L;  5M5W H;  3M85 A;  2MQH A;  1KC8 C;  4LF8 L;  3PO2 G;  4L5R C;  4DUY Q;  2UXD Q;  1U5K A;  4C3I H;  4LFA Q;  2CWP A;  1E22 A;  4GNX A;  1J5E L;  3PSI A;  2JA5 G;  1HNW Q;  4JYA Q;  3CCE A;  1XPO A;  4YWK A;  3GO5 A;  4XIG S;  3ZJY C;  3K81 C;  4JI2 Q;  2IT1 A;  5JEA J;  3U4V A;  1N36 Q;  1UE7 A;  1S3O A;  4GNX C;  1U0L A;  4DR7 L;  1AE2 A;  1MIU A;  2CKZ B;  2VQF L;  4JI1 L;  4TVA B;  3W5O A;  5IP9 H;  1KQS A;  4Y52 H;  5C44 H;  1WI5 A;  4LW1 A;  1S40 A;  1FJG L;  3M3Y H;  1PH8 A;  3A5Z B;  3CPF A;  4A3L H;  3NEM A;  5M3M G;  2LSS A;  5LMN L;  3NEN A;  2OTL A;  3AEV A;  3GTO H;  1YEZ A;  3KOJ A;  1YJW A;  1N8R C;  1DGS A;  1NMG A;  1VQB A;  4GNX B;  4IOC A;  4AQY Q;  3GTG H;  1VQD A;  1VQA A;  2H5X A;  5IP9 G;  4C3H H;  4JI7 Q;  4GKJ Q;  4BXX H;  3SGI A;  1N32 L;  4DV4 Q;  2ZJQ A;  3PUW A;  1UEB A;  1CKO A;  1V9P A;  1WCM H;  5H1S E;  4JI6 L;  4LF6 Q;  5DLQ E;  3RLN A;  2HQL A;  4LFC Q;  2E8G A;  5ELO A;  3T1Y L;  2C35 B;  4A3I H;  4DK3 C;  5GAE C;  2VS1 A;  4JI5 L;  3G4S A;  2WAQ G;  1X56 A;  3I4O A;  1G29 1;  4NB3 A;  1I6H H;  3CAM A;  2UUB L;  1SLJ A;  1OTC A;  1HJP A;  2K5N A;  1VQP A;  3E0E A;  4X62 L;  4A3J H;  1K8A C;  4GKK Q;  2K50 A;  4H02 A;  5ELN A;  5K36 G;  1BKB A;  2JA9 A;  3TS0 A;  4NXN L;  1W3S A;  4DV0 L;  4DV3 Q;  5M5Y H;  2UUA Q;  1XPU A;  4DR6 Q;  4DR3 Q;  2AMC B;  4JBJ A;  4DKA C;  4DR4 Q;  4IJL A;  4DV2 L;  1P8L A;  2VUM H;  1K73 C;  1IZ6 A;  5LMU Q;  3OTO L;  4OO1 I;  1AH9 A;  2B29 A;  2I0Q A;  1C7Y A;  3HKS A;  1PH2 A;  2R7Z G;  4X6A H;  4UPA A;  3KDF A;  1CUK A;  3T1H L;  2BA0 A;  4P75 A;  1Y14 B;  3KF6 A;  3UDX A;  4HIM A;  1E7Z A;  2HHH Q;  1Q12 A;  3PF4 A;  2YTX A;  1L1O A;  4LFB Q;  1M1K C;  1L1O C;  5HGQ A;  1PFS A;  5C3E G;  4LF5 L;  1KIX A;  4A3F H;  1I94 Q;  4LF4 Q;  3L7Z C;  3CCS A;  4IPC A;  1XMQ L;  4R4C A;  4P73 A;  4QGU A;  4HID A;  3KDF B;  1NBW A;  3KF6 B;  3PCO B;  4YCV A;  3BZK A;  4GN5 A;  2JEB I;  4PZ8 A;  2Y0S E;  5JEA G;  3AFQ A;  3CXC A;  1PH3 A;  4POG A;  1B70 B;  3U58 A;  5M3F H;  4ALP A;  3ERS X;  1L1O B;  1I5F A;  1EIY B;  3HOZ G;  1OXV A;  3S15 H;  3E9H A;  1EWI A;  3HKZ G;  1KRS A;  2IHF A;  5IYC H;  3S2D H;  3I4M H;  1K83 H;  1VQF A;  3FP9 A;  1Q81 C;  4MZ9 A;  2ASB A;  1YHA A;  3KLW A;  4HJ5 A;  1YHB A;  4DR7 Q;  2YYZ A;  1WYD A;  3K8A A;  2ZM6 L;  4A3E H;  4A3M H;  2OQK A;  1ASZ A;  1P16 A;  1OXT A;  3HOV H;  3D0F A;  1TWA H;  3TRE A;  4X65 L;  3PV0 A;  4OX9 L;  4R4Q A;  1HZC A;  2F3I A;  2MO1 A;  1K9M C;  3CCR A;  1HZ9 A;  1TWC H;  2ALY B;  2VL6 A;  2A8V A;  1Q86 C;  1TWH H;  3I4M G;  1QVC A;  1JJ2 A;  4DV7 Q;  4PMW A;  2LXJ A;  3GTK H;  2JK8 A;  3HOX H;  1SN8 A;  3A74 A;  3CPW A;  3S1N H;  2RF4 A;  4LUZ A;  4PZ7 A;  5BR8 L;  2ZTD A;  4LNQ A;  2PI2 E;  1UE1 A;  2GN5 A;  1X3F A;  3HFZ B;  1HNX Q;  3F2D A;  1EFW A;  1AE3 A;  3HOV G;  1EOV A;  4DPG A;  4L5T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...