4LF7Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
101
structure length
101
Chain Sequence
b'PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 20
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lf7Q00
3I7FA 4L5QA 4A3JH 3PUZA 4LUVA 4OWXB 2F4VQ 3F2DA 3GD7A 2A19A 2LSSA 2ZJPA 4QJFA 4A3BH 1IYJB 2VQEQ 3CCMA 4PMWA 4OWWB 3UE0A 3HKSA 3RR5A 1GO3E 4DV5Q 1HNWQ 2NVXH 1OTCA 3GTPH 1JE5A 1N32L 4K0KL 3CC2A 1C0AA 3H0GH 1VQBA 4B3ML 4LF9L 3KLWA 3HOZH 3PO3H 4DV2L 1YNXA 4JI3L 4DV3L 3STBC 4GN4B 4HJ5A 2FXQA 5M5XH 4GKJL 3J81i 4WJ3M 1H95A 4LF8Q 2RHQB 1HZCA 3U4VA 1XMOQ 4EQ5A 1XPOA 1N34Q 1KIXA 4A3DG 4A3EG 2UXDL 1G6PA 4IFDJ 5GAGC 1C9OA 2Q2UA 3TQYA 2MFIA 1GKHA 2K5HA 3S24A 5K36G 2VNUD 3S17H 3CCRA 4GLXA 4B3TQ 1WOCA 1YHQA 4LF7L 4JYAL 2ALYB 2I5HA 4LF8L 1PH2A 1YI2A 2R7DA 3PF5A 1XNQQ 4LF5L 1U5KA 4BY1G 5IYBG 3CF5A 2UUAQ 1LYLA 1AH9A 5J3BA 3W1GA 4DV4Q 4X64L 2WB1G 4LFCL 2ATWA 2AMCB 3TRZA 3CQZH 1Z9FA 1IXRA 3I4OA 4TVAB 2CQOA 2CWAA 2BA1A 1HNXQ 1X3EA 1N33Q 5JJKA 1IBMQ 4LFBL 3H3VH 1N9WA 1YJWA 5C44H 4LUOA 4C3HH 1PH4A 1I94L 2JA6G 3KJPA 3M4QA 4DR2Q 4B3SQ 1D8LA 2N78A 1PHJA 3FKIH 2YTYA 5IP7G 2JA9A 4H02A 4GOPB 1HNZL 4KHZA 4JG2A 4PZ7A 1G291 1JB7A 1FJGQ 1YJNA 3OYYA 4DAMA 4DR5Q 4QY7A 4LFBQ 2UXBL 2BH8A 1N36Q 4JBKA 2ZJRA 2JK8A 3PUXA 4A3KH 1VQOA 2JQOA 2R7FA 4IOAA 1G51A 4NB3A 1JT8A 1HNZQ 4UPAA 5IWAL 1VQIA 2IX0A 2LXJA 3NENA 4YCVA 2ZM6Q 1SFOH 1PYBA 2GVAA 2BA0A 1FVIA 3PUWA 4UP9A 1HR0Q 2E5LL 2IT1A 1EUJA 4JI6Q 3UDXA 2OTLA 3M4PA 4JBWA 3S1QH 4A3LG 1VQ6A 2K14A 4GS3A 3UDIA 4MNOA 2VQEL 1CKMA 1SN8A 3NELA 1PH8A 1SR3A 2D62A 2VQFQ 4BY7H 4YWLA 2KCTA 3DLLA 4DPGA 1AE3A 1OXVA 3AEVA 4KHPQ 3CC4A 1Q1EA 4UY8C 2R92H 4B3MQ 4POFA 2UXCL 2PI2E 1KHIA 2YV5A 1VQEA 1JMCA 2OCEA 4OO1G 3PIOA 2CCZA 1XMQL 1EYGA 2N3SA 1Y1VH 3E0EA 2K4KA 2V1CC 3IRBA 4HJ9A 4PZ6A 2L15A 2IY5B 2IHFA 4OX9L 3JAMi 4IPHA 3J81j 4AH6A 4NXNQ 1BBUA 3BZKA 4LUZA 5BR8L 1UE1A 5H1SE 4X62Q 3ULLA 2B3GA 4RG1A 1WFQA 5C0XG 5LMNQ 1IBLL 2I5LX 3STBD 2K52A 4X65Q 2YU9H 4DR4Q 3S2HH 4P75A 1OXTA 1EOVA 1X55A 4DV6Q 4Y7NH 4A93G 4JCVE 2XTIA 4JI1L 3M85A 4DR7L 1FGUA 4IJLA 1HR0W 1JJGA 3NEMA 2Y0SG 2UUBQ 1E3PA 4B3RL 4LFAQ 4A3IH 3S15H 3KF6A 3T1HQ 2MNAA 1NMGA 1Q1BA 4X65L 5C4XG 1VS0A 3GO5A 3I4NH 3J80c 3TEHB 2PQAB 1KRTA 2UXCQ 1S72A 4B3SL 3GTLH 1MJEA 2RCNA 4NXML 1XJVA 4GLVB 3W1BA 1KXLA 5IP7H 1Y1VG 3ICEA 4GKKL 3CD6A 3SGIA 1BKBA 3J7A5 5IE8A 1X3GA 5FJ8G 2ES2A 1GM5A 1WYDA 2DGYA 5C0XI 2MQHA 1VQMA 4JV5Q 4DV7Q 3M4OH 2NVYH 4C2MH 3GTKH 5GROA 1KAWA 1T9HA 2HIXA 4QIWE 4YWMA 3KYHC 2UUAL 1NE3A 1YVCA 4GNXA 5M3MG 1I3QH 1P8LA 3CXCA 1EQQA 4OO1I 1YITA 4FDBA 3UDGA 2I5MX 4BBSH 4A3LH 3K0XA 4R4TA 1PV4A 1P16A 1EIYB 3NBHB 3PUYA 5HY6A 3AFQA 2GVBA 4IJHA 3ER0A 5AJ3L 2HHHQ 1BBWA 2Y0SE 1I94Q 4BXXG 3T1YL 3GTJH 2PQAA 2UUCL 1YJ9A 4JBJA 4DR1L 4C3JH 4HIOA 1PYSB 5IT9c 3CMAA 3GTQH 4LNQA 3HOVH 4OWTB 1BVSA 4YHHQ 1A62A 3ULPA 2E2HH 3GTGH 3CAMA 4HJ7A 3FHWA 3H15A 2UXBQ 1Z47A 1Y14B 3T1YQ 1EIFA 4YCWA 3PO3G 4RMFA 3UDFA 4NPSA 1K9MC 1MIUA 5GAHC 4JI5Q 1I6HH 1KL9A 4BY1H 1A63A 3PSIA 2OQKA 4A3IG 1J5EL 1C7YA 4HIDA 2YTXA 1KQSA 4DR5L 2CKZB 1NTGA 3K7AH 1CKOA 4LW1A 3I4NG 2MO0A 4EX5A 1M1KC 3RZDH 1X65A 2R6GA 4BBRG 1EQRA 1TXYA 2VW9A 1GVPA 1Q82C 1HZBA 5LMUQ 4DV2Q 2KHIA 3TS2A 4DV6L 4JI1Q 2UU9Q 4DR7Q 1M90C 5IYBH 4DR3L 2AWNA 2PNHA 3HOWG 3HFZB 2E2JH 4O2DA 2ZM6L 1N34L 3PF4A 1DGSA 1V9PA 2VY3A 1N8RC 3S1MH 1TWCH 3KJOA 5M5WH 1VQFA 2AHOB 4AYBG 1VQ8A 1XNRL 4R1JA 4A3DH 1SROA 1Q46A 2JE6I 4GN3B 4JI2L 4JI8Q 3RZOH 2VZAA 4JI7Q 1VQ9A 2HT1A 1R9TH 2IX1A 3HOXH 2WAQE 3MXNB 4R4OA 2EQSA 3RN5A 1IBKL 1UE5A 1LM0A 2QEXA 2Q2HA 1PH6A 1XPUA 2JA7G 2WB1E 2JJQA 3CC7A 4DV1Q 1PH1A 2OTJA 3G4SA 4IPCA 1N32Q 4LF5Q 2AWOA 3KF8B 4DUZL 3CCSA 2KHJA 3RN2A 2VS1A 5FLMH 4JI6L 1V1QA 3K7UC 4X64Q 4JI8L 3LGJA 2K5NA 4QGUA 1VQNA 4KLKA 4XIGS 5IY0A 2JEAI 1OXXK 4A3KG 2R7ZG 4BY7G 4DR4L 2QA4A 5IYDH 3AFPA 1VQ5A 3T1HL 5E7NA 1L0WA 1WJJA 5C3EG 4DV1L 4OXPA 1K73C 1I50H 1IBML 3KF6B 2A8VA 1Y1WG 1FJGL 3CCQA 1XMOL 1A0IA 3I4MH 4A3FG 1L1OB 1IZ6A 4DNIA 1K8GA 3S2DH 3M9BA 4OONA 1SMXA 2CFMA 3HOWH 4DKAC 5GAEC 1B8AA 3HOXG 2EIFA 5C4JH 3OTOQ 1Q81C 4J15A 4UP8A 1SLJA 4NXMQ 3CPWA 3KOJA 2R92G 4IPGA 3A5ZB 3HKZG 3CCUA 1UE6A 1VQJA 4MTNA 1PFSA 1S3OA 5FLMG 1E24A 1SE8A 1PH5A 2OQ0A 4K0KQ 3S1RH 1HR0L 5C0XJ 1L1OA 1YZ6A 4IOCA 2Q2IA 1E1OA 2B29A 3OTOL 4A3BG 1SRUA 3CPFA 4HIKA 1QVCA 3OW2A 3BU2A 1OXSC 1UE7A 1CKNA 1HZ9A 4GN5A 3PV0A 1Q86C 2H5XA 1CSPA 2JA5H 2F3IA 2K5VA 1KD1C 3F2CA 1TWHH 4P74A 1EFWA 4A3CH 1VQAA 1WCMG 2NZOA 4BA1I 5GADC 4LF6Q 1MJCA 4Y52H 1RIPA 3KDFB 5LMUL 4AIMA 4L5TA 3I55A 4JC0A 1PVOA 1RL2A 4P71A 1TWGH 4A3MG 1KC8C 2Z0SA 1NMFA 2KENA 5DLQE 2VUMG 4A3GG 2R93G 4DR3Q 4DV0Q 3U50C 3Q8DA 3RLNA 3PCOB 3AQQA 3I56A 4A75A 2D0PA 2KBNA 1VQHA 2LXKA 4A76A 1JJCB 1X54A 3A0JA 3CCEA 2HIVA 1K83H 2MO1A 2Q2TA 5M3FG 4LF4Q 1A8VA 1Y1WH 3EIVA 3HOZG 4HJAA 2CWPA 5C44G 1NJIC 3I2ZA 3L7ZC 4JI7L 2NN6G 3TREA 4BXXH 3E9IA 4AQYQ 4DV3Q 4JI3Q 3K8AA 2AKWB 4A3FH 3FP9A 1VQDA 1HNXL 1XTDA 3TS0A 4GKJQ 3HOYH 4JI0Q 1CSQA 1K8AC 1JJ2A 1UWVA 1FL0A 2ASBA 3PO2G 1W2BA 5LMNW 1HZAA 4IFDG 4PZ8A 4POGA 2BH2A 1B70B 3K80C 1PH3A 4A3MH 2VUMH 4KHPL 5IYCG 1KRSA 1VQ7A 2UUCQ 1YHBA 2K75A 4BBSG 2F4VL 2PI2A 3PIPA 1X3FA 3JAMc 1TWAH 2ZTDA 1MKHA 4YCUA 4IO9A 1XPRA 1VQLA 4OX9Q 4LF7Q 4JYAQ 4GOPC 4QQBX 3G6EA 1HNWL 3D0FA 3GTMH 3RNUA 4UP7A 4DAYB 2E5LQ 4LF9Q 2Z6KC 4R4QA 4GKKQ 4QL5A 1YEZA 2WFWA 5BR8Q 5LMNL 2JA6H 1J5EQ 3G48A 4KI0A 3A5UA 4P73A 4R4IA 5M3MH 1L2FA 2XGTA 1IL2A 4JV5L 2ID0A 4B3RQ 5M5YH 5ELOA 3WWVA 1VQ4A 3PUVA 5IP9H 1QZGA 1N33L 4MZ9A 2I0QA 2HQLA 2E2IH 1B7YB 2D0OA 1YBYA 1IBKQ 5M3FH 1Q12A 1VCIA 4IFDI 1NY4A 5HGQA 1J6QA 3A74A 3E9HA 2ZTCA 3ZJYC 1VQGA 3G71A 3S1NH 3JC66 1XNQL 2NVTH 1QVFA 3DM3A 2IHEA 4LF6L 1L1OC 2VL6A 4NXNL 1VQPA 4AYBE 3D31A 4LFCQ 4B3TL 1ASZA 1E1TA 3HOUG 2NZHA 3VDYA 2NVQH 3KFUA 2UXDQ 1XNRQ 1K0RA 3BZCA 5IYCH 5IWAQ 1E7ZA 3AYHB 4GLAC 2PMZE 5GQOA 3HOYG 5IP9G 2ZJQA 4DV7L 3CCVA 3MEFA 4X62L 1IBLQ 4JI4L 3J80i 3M3YH 3BJUA 3J7ZC 4LFAL 1VQKA 1CKNB 3S16H 4LWCA 2JEBI 4HJ8A 4DUYL 1VQCA 1I5FA 1WI5A 2YYZA 3M7NA 4X6AH 1O7IA 1W3SA 3ERSX 4C3IH 1U0LA 5ELNA 5JJIA 3W5OA 2DUDA 1D7QA 2YTVA 3EBEA 1LUZA 1S40A 4YWKA 3KDFA 5JEAJ 3CCJA 4JI4Q 1K3RA 3L0OA 1CUKA 4IPDA 3UE1A 4DR6Q 1EWIA 3EN2A 4BBRH 3F1ZA 3CMEA 4AQYL 1AE2A 4DUYQ 1ASYA 4HIMA 3U58A 4L5SA 4A3JG 4ME3A 2UU9L 3L2PA 4JBMA 4XTCS 1PA6A 4PG3A 1V43A 1XMQQ 1GD7A 3CP0A 3H0GG 4X66Q 2KCMA 3PO2H 1OXUA 2B63H 4ALPA 4L5RC 4DR6L 5IYDG 1E22A 4DV4L 4A93H 4JI5L 4YHHL 3CW2C 1YHAA 2RF4A 4P72A 3PGZA 1HH2P 3B6YA 2R7ZH 3H3VI 4TQUS 1QUQA 2K50A 1TWFH 3GTOH 4X66L 5JJLA 3J81c 2A1AA 1UEBA 5FJ8H 2JA8H 1PH9A 2NN6I 4DR2L 1PH7A 2UUBL 2E8GA 2N8NA 4JOIC 4DK6C 3K81C 2OWOA 2VQFL 3RLFA 2JA7H 3U4ZA 3I4MG 4JOIA 4LF4L 1Q7YC 1X56A 1Q8KA 4DUZQ 3HOVG 4WJ4A 1LTLA 1QUQB 4R4CA 4YY3L 5C3EH 1NBWA 2C35B 2Z6KA 3HKZE 4A4IA 3F8TA 5AJ3Q 2HHHL 4JI0L 2N49A 3ULJA 4APVA 4A3EH 1N36L 4O0AA 4BA2I 2RHSB 2ZTEA 2R93H 3GDEA 1X6OA 4DR1Q 1X9NA 2F52A 5FLXc 2GN5A 2QGQA 5C4XH 1QZHA 5EAYA 4DV0L 4GOPA 3HOUH 3S14H 4GNXC 5JEAG 1HJPA 2JA5G 4A3CG 4JI2Q 3FKIG 4GNXB 2WAQG 2EXDA 3F2BA 1YIJA 1WCMH 4DV5L 1QVGA 3RLOA 2B63G 4YY3Q 3CCLA 2JA8G 4A3GH 2WP8J 4DK3C
chains in the Genus database with same CATH superfamily
3MTSA 4DNRB 2F4VQ 1KNAA 1STYA 3S2HB 4KN7C 4PMWA 3UE0A 3HKSA 3RR5A 1GO3E 1LTGD 4DV5Q 1O7YA 1HNWQ 3GTPH 2PYKA 1F77A 3KBGA 1EY4A 4K0KL 1N32L 4LF9L 2OF1A 2AQ2B 4DV2L 4MN3A 2FXQA 1DM0B 4GKJL 4C3HB 1H95A 3BG3A 4LF8Q 2RHQB 1S5BD 3VA5A 5EPKA 4OGQC 1HQMC 2UXDL 1G6PA 5ELEA 5ELDA 3ERQA 5ELCA 1C9OA 3TQYA 2VNUD 3S17H 3S1NB 5AFWA 3MEHA 1C48A 4LF7L 2ALYB 1PH2A 5JPNC 5E4XA 2R7DA 3PF5A 3HG9A 1AH9A 1U5KA 5C4JB 1QNKA 2J4XA 1Y8OB 2R93B 4X3KA 3TSSA 1TY2A 3CQZH 4R9WA 4DXGA 2NYZD 4QUFA 1HPCA 4B9WA 1PTOF 4RGMA 2JSOA 1TS3A 5JJKA 1SMYD 4WJ4A 1GUOA 3UI2A 2JA6G 1I94L 1CA5A 4B3SQ 1BXTA 3AB9A 4PV1C 1LABA 1PHJA 2JA9A 4H02A 1HNZL 3NSWA 1FNUA 4JG2A 2R3ZA 4PZ7A 4KD4A 1JB7A 1FJGQ 1YJNA 3OYYA 3JAME 4LFBQ 1SAPA 3GTPB 5C3WA 2ZJRA 4KKUA 1VQOA 2JQOA 4NB3A 4UPAA 1NR4A 4NW2A 3VYUA 1J8IA 2IX0A 4YCVA 2SNMA 2PNRC 2GVAA 2BA0A 3EJIA 3PUWA 2N88A 1EUJA 5FO9B 2KEDA 4OIJA 1CK1A 2PZUA 2A68C 3QIAA 4RCOA 2VQEL 2D62A 1PFMA 4YWLA 2KCTA 2EYOA 4NDXA 4KHPQ 1Q1EA 2R92H 4B3MQ 3HS0C 3A54A 3OMCA 1KHIA 1X3QA 3VYTA 1JMCA 4OO1G 2CCZA 2N3SA 1Y1VH 4O1NA 3IRBA 4PZ6A 2L15A 2CH4W 3CQZB 5H1SE 3GTGB 1GUGA 2B3GA 5C0XG 4DAYA 2YU9H 4DR4Q 3STBD 2F3WA 3S2HH 2B2VC 1OXTA 3DUZA 4Y7NH 4A93G 4JCVE 3C3LA 5JAVA 1FGUA 1HR0W 1JJGA 3WOFA 2UUBQ 2EYMA 4CDFC 2MNAA 1NMGA 4X65L 2PPBC 2GA4B 1OO9B 3I4NH 1KLGD 1QWYA 4HSPA 3S1MB 4RGTA 1F2ZA 3Q0AA 1RDPD 3W1BA 5IP7H 2KJXA 1BKBA 5IE8A 4RCNA 1CFMA 1WYDA 2MQHA 1NR2A 5GROA 2MGSA 2PO4A 1U4LA 4K5XA 2HQEA 2NVQB 4YWMA 4OHJA 1G8ZD 3A55A 4GNXA 1I3QH 1D5XC 1P8LA 1ICWA 3NQIA 4FDBA 3UDGA 2I5MX 5I2XA 1YITA 4A3LH 4R4TA 1PV4A 4A3BB 1YNND 1ZYRD 3AFQA 1HTLD 4K8IA 5I9PA 5AJ3L 2L5TA 2UUCL 1YJ9A 1LV9A 4C3JH 4HIOA 1HA5A 4Q0FA 4UAIA 2RA4A 5CR3A 4OWTB 2RDFA 4YHHQ 1TVXA 4KMUC 2FMCA 3FHWA 4S3SA 3FDTA 1EIFA 4YCWA 2EY2A 3UDFA 1I6HH 4JI5Q 2DY7A 3S16B 2OQKA 2NWGA 2YTXA 4DR5L 2CKZB 5IGDA 1CKOA 2RBMA 3RZDH 1DOLA 3NTIA 1EQRA 2VW9A 5C44B 4DV2Q 2EVBA 4DV6L 1PZID 4RH6A 4DR7Q 4FF1A 1LLRD 2AWNA 4O2DA 1Z6HA 3DEOA 1DGSA 3S1MH 1TWCH 2E2DC 3HOXB 2AQ3B 2K5DA 1RTNA 4A3DH 1SROA 3J80E 1Q46A 2JE6I 2D9UA 2VZAA 2XVSA 2HT1A 3RN5A 2OT2A 2OTJA 5JVG3 3G4SA 4IPCA 3TN2A 4KN4C 3I72A 2VS1A 1V1QA 4X64Q 3D4WA 1VQNA 2TSSA 5E3FA 3GQBA 2QA4A 4N8X1 4IUTA 4OXPA 4FXKC 5ISRA 1IBML 4TKOB 1AW7A 5FOBB 1Y1WG 2D2CC 1FJGL 2B8GA 4A3FG 1EOTA 2EJMA 2F03A 3M9BA 3V96A 1SMXA 2CFMA 3VR3A 5GAEC 1B8AA 4UP8A 4X3UA 4IPGA 2JN4A 3HKZG 2DJGC 4XDXA 3BVZA 4MTNA 1PFSA 5M3FB 1STNA 3I3CA 1L1OA 1E1OA 3HGBA 3SEBA 4KTAA 2NB0A 1UE7A 4C3IB 3D4DA 1Q86C 3DMUA 2H5XA 4A3CH 2F3IA 3F2CA 2Q8RE 2KEEA 4ZRZA 1Z7TA 2WACA 4J6HA 2NTSA 2B2WA 5LMUL 1LTSD 4JC0A 5D3IB 1RL2A 4A3MG 1EL0A 2Z0SA 4A3GG 1BDOA 2QEJC 1M4VA 4K5WA 3AQQA 4A75A 4A3JB 1I6VC 1M8AA 2AQ1B 2K32A 2F0DA 4A76A 2HIVA 1ZEQX 1F9SA 1I6HB 2EY5A 5CBAE 1YNNC 5C44G 3I2ZA 4JI7L 4FP5D 1EFID 2NN6G 3CRLC 3TREA 3E9IA 3LWEA 1FNWA 4AQYQ 2K03A 4JI3Q 1BOSA 1HNXL 3FP9A 1VQDA 1XTDA 1SJHD 3TS0A 4JI0Q 3K59A 1FL0A 1STAA 4FVMA 2IL8A 4POGA 1B70B 2CW0C 1PH3A 4RAUC 4A3MH 2EJFC 1MD2D 1KRSA 2UUCQ 4BBSG 4FO2A 1Q3LA 2ZTDA 4YCUA 1XPRA 2B2YC 4OX9Q 2L11A 5J39A 1EZ6A 1KTKA 3D0FA 1TIID 1U4RA 2Z6KC 3G7LA 3KLSX 4GKKQ 1S4ZA 1WTXA 3AMUA 5BR8Q 5LMNL 3C46A 4JV5L 4P73A 4R4IA 1IL2A 5C3XA 3IAYA 3QOLA 5ELOA 2K7VA 2PMZB 5M9OA 2E2IH 2XSCA 1B7YB 2D0OA 5C5MA 1IBKQ 5M3FH 5HGQA 3G71A 3DM1A 1VQGA 1B3AA 1CHQD 1BUVT 1RHPA 1JWSD 1CQVA 5I9OA 1HFNA 2VL6A 4NXNL 1VQPA 5C5LA 1LT6D 3D31A 4LFCQ 2K28A 3I70A 3NP8A 2NZHA 3KFUA 3SHLA 3MA2B 3BZCA 1SE3A 3URYA 4ZKCB 3J80L 3HOYG 2ZJQA 4CBVA 4X62L 3KLRA 3F2UA 4P2CB 4JI4L 1IKMA 3BJUA 3FPUB 1VQCA 1I5FA 3J7YW 3NWTA 3A7AB 1W3SA 3IFTA 2DUDA 1D7QA 1S40A 1LUZA 4QIWB 4DR6Q 3L0OA 1CUKA 3OWFA 1EWIA 4BBRH 3CMEA 4A3IB 4H0LC 4I7ZC 3VA7A 3U58A 3L2PA 1PRTB 4XTCS 4PG3A 3D8GA 3CP0A 1R4QB 2HDMA 3H0GG 3PO2H 2EZVA 5IYDG 3P1HA 4ZUIA 1HH2P 3B6YA 5CV4A 1RJTA 2K50A 1A3UA 2G9HD 4HMJA 1U9RA 2NN6I 3I90A 4DA2A 4DK6C 2KCCA 1W6JA 1H9SB 2EYPA 3IKJA 1E0BA 1LTLA 4R4CA 3HKZE 2C35B 2UXCL 3F8TA 3ULJA 4A3EH 1RODA 2KOLA 4PQXA 3GDEA 3SK5A 2LS01 2EY1A 2QGQA 1AP0A 4L8JA 3HOUH 4A3CG 1HJPA 4CDEC 4GNXB 3QR8A 1ILPA 4C3JB 2F0WA 3CCLA 2PCFB 1O78A 1O7LA 4A3GH 1B4OA 3MWYW 3PUZA 4LUVA 2A19A 4QJFA 4A3BH 4QCLA 1K83B 2VQEQ 2J7ZA 4ZKBB 1JE5A 1JR0D 1C0AA 1HRJA 4B3ML 1XTCD 3HOZH 3PO3H 4DU9A 4JI3L 3STBC 4OO1H 2NVXB 1HZCA 1BCPC 1XMOQ 4A3EG 3H09A 1PYWD 3MXGA 2Q2UA 2MFIA 2K5HA 1CQFA 3S24A 2EYJA 5J1ZA 3CCRA 1YHQA 1RTOA 3MFYA 1ZKOA 5IGEA 1XNQQ 1SYCA 4LF5L 3CF5A 3TP5A 3TP8A 4DV4Q 4U673 2IPKD 4KJNA 1Z9FA 2QW7A 4H44C 3TZUA 1HNXQ 1X3EA 3EVQA 1JC7A 1YJWA 2B2YA 4LUOA 4TRDA 3E3XA 3KBXA 2N78A 1EYAA 4KHZA 3H0GB 2IX3A 5DM73 5IIFA 3W3AA 1IKLA 4QY7A 2BH8A 2O4XA 1N36Q 1DJRD 3PUXA 4K8JA 4DAPA 2R7FA 2BOSA 1G51A 1JT8A 1BNZA 2VXWA 2FFKB 3R93A 3AU7A 1EU4A 2LXJA 3MFGA 1C8CA 1H9JA 2ZM6Q 1WTOA 1FVIA 3HKZB 3UDXA 4JBWA 1EEID 4M8AA 3S1QH 4A3LG 5E1FA 2K14A 1VQ6A 2F0SA 4GS3A 3UDIA 1TR5A 4MNOA 4BY7H 3NELA 1DONA 2VQFQ 5IT9L 3A8IE 1AE3A 1OXVA 2F0OA 3CC4A 4UY8C 2SOBA 4C3IG 5D14A 1I4HA 1VQEA 2F3VA 1HQRD 2PW7A 2OEOA 2K4KA 2V1CC 1LO5D 4IPHA 1BBUA 4DK1A 4AYBB 4X62Q 3ULLA 3GTLH 4MTKA 2I5LX 3NK9A 2K52A 2HUGA 5I6WA 4P75A 4RFBA 4DV6Q 4DR7L 3M85A 1JWUD 3NEMA 2Y0SG 4B3RL 3KF6A 4HTHA 1Q1BA 1JOQA 3GO5A 4J8QA 1EWHA 5KIXA 1K3BC 3TEHB 2UXCQ 5KNBA 1S72A 1PMRA 1ICFB 2DN8A 2RCNA 1KXLA 3IL8A 1H9MA 3K5MA 3SGIA 2DGYA 4DV7Q 3M4OH 1KAWA 1T9HA 3QJYA 5A2QE 2HIXA 2N55A 2FINB 3J81E 1C4QA 1S5ED 5M3MG 1G6ZA 4OO1I 1TQOA 3E0JA 1GUNA 2F0JA 5HY6A 1J9OA 1QE6A 2GVBA 3O13A 4IJHA 1BCPF 3ER0A 1ENAA 5K36H 1DD2A 4BXXG 2DNCA 3GTJH 2PQAA 1WCMB 5IT9c 5CC4A 1UEAB 1BVSA 2V4DA 2M9VA 3I4MB 3H15A 2UXBQ 2D5DA 3T1YQ 4RMFA 1K9MC 1XX8A 2A68D 3PSIA 4A3IG 1J5EL 3NE5B 3TMEA 1NTGA 1XYIA 4LW1A 3I4NG 1X65A 1I4PA 1TXYA 4CJ0B 5LMUQ 1BCPB 1ET9A 2NVTB 4JI1Q 3HOWG 5IGFA 2E2JH 3DWAA 5CV9A 4KY7A 1V9PA 1MI2A 4K14A 3PO2B 3KJOA 1VF5C 1VQ8A 1A15A 1ENCA 4B9XA 4JI8Q 3K0YA 3RZOH 4JI7Q 2WAQE 3MXNB 2EQSA 2Q2HA 1PH6A 1GOZA 4LAAA 3MZ5A 4DV1Q 1PH1A 5COYA 2BE5D 1N32Q 1SJED 2AWOA 3RN2A 3Q23A 1PTOD 4DUZL 5FLMH 3K7UC 1L0XB 1T5XD 2K5NA 4QGUA 2HDLA 4KLKA 1LTBD 1OXXK 1VMCA 2R7ZG 4DR4L 1CZWA 1IW7C 4BY1B 1WTVA 2RSNA 1STBA 1K73C 3BVGA 5FK9C 5EPJA 3KF6B 3IFDA 2A8VA 2TMPA 4G7ZC 4OONA 4DKAC 2G5DA 4IZ8A 3CPWA 3KOJA 5CORA 2A6ED 3A5ZB 3FEWX 1R9TB 1PRTC 1HA6A 3RD4A 4BS9A 1EY8A 4N8FA 3DHQA 4K0KQ 2B29A 2X69A 3OTOL 4HIKA 2F0IA 2XNAC 1MSHA 1OXSC 1A3VA 3ONAB 2K5VA 1XXGA 1LTTD 2XWBB 4P74A 1VQAA 4I7AA 1WCMG 4BA1I 4XT1B 3LWUA 1AFPA 1GHKA 4R8NA 2B8FA 5IGCA 1PVOA 2VUMG 4IUUA 1NMFA 5DLQE 4V190 4DV0Q 2D0PA 3OOCA 2F0PA 2XRQD 1PTOB 1K83H 5M3FG 1Q8IA 1A8VA 2A6HC 3SVMA 5C4XB 5CV7A 1EU3A 3L7ZC 3VR4A 4RKLA 3EA6A 3H6MA 5K5PA 1GJXA 2H1EA 3N52A 3K8AA 2AKWB 4A3FH 4EQPA 3HOYH 1K8AC 3H94A 1UWVA 1SNCA 5LMNW 4PZ8A 2BH2A 2PI2A 3JAMc 1D1KA 1MKHA 5E4WC 4F7XA 4JYAQ 4QQBX 1Q90A 1KDCA 5CV6A 3GTMH 2MHVA 2JXMB 4DN4M 2E75C 3J7AF 4R4QA 2B63B 4RHSA 4KV6A 2HCCA 4QL5A 5C4HA 4G4KA 3BS1A 2JA6H 1J5EQ 4KK7A 3TP6A 4RGNA 1E2WA 1L2FA 2WKDA 1ESRA 3WWVA 1VQ4A 5IOCA 5IP9H 1N33L 4MZ9A 1CI3M 2I0QA 1GUWA 1DOKA 1VCIA 1Y8NB 1NY4A 3OPOA 5M5YB 1J6QA 2ZTCA 3S1QB 3S1NH 1U4PA 4BBSB 3ITPA 4LF6L 3BVMA 3LX0A 1ASZA 3HOUG 5I6YA 4V0BA 3VDYA 1I50B 1K0RA 2WV6D 4C2MB 1E7ZA 3AYHB 4GLAC 5GQOA 2SNSA 2QF7A 5IP9G 2RDGA 5JVH3 3CCVA 1IBLQ 1GHJA 5LHY1 1KABA 3M3YH 3J7ZC 4DUYL 2NN6H 4G7OC 2YYZA 3M7NA 4ABNA 1O7IA 3PIP3 3ERSX 4Z9CB 4BWGB 2YTVA 1SNDA 3EBEA 4YWKA 4IPDA 3QB3A 3EN2A 1KAAA 4HIMA 1K8MA 2MP1A 2UU9L 4JBMA 2EE1A 2QDLA 4X66Q 2KCMA 3Q24A 4DV4L 4A93H 3W2DA 5ELFA 1K8OA 4JI5L 1JB3A 5JOBA 4P72A 4KHVA 3V05A 2R7ZH 3BYYB 1FNVA 4A3KB 1GUTA 2A1AA 1UEBA 2JA8H 1PH9A 1PH7A 3DWQA 2F0MA 3K81C 1IL8A 2VQFL 3I4MG 3U4ZA 1NSNS 4QUCA 4QF4A 1X56A 3HOVG 3PO3B 3L9AX 2R92B 1NBWA 2HHHL 5HURA 1N36L 2RHSB 1HFGA 4DR1Q 1X6OA 2R93H 5FLXc 4CDCC 5EAYA 4DV0L 2PZTA 4GOPA 3QG1A 3SR1A 5JPMC 5EGTA 1WTHA 2A73B 1YIJA 2B63G 1WCMH 3TZDA 4DV5L 2WINB 3HP3A 4YY3Q 2WP8J 3H91A 3I7FA 2YU9B 2EYLA 4A3JH 1SDFA 3F2DA 1PDQA 2ZJPA 2E74C 4OWWB 2CHBD 4OEMB 2NVXH 3TDQA 1OTCA 3CC2A 3H0GH 1JQYD 1VQBA 5FLXE 3KLWA 4XT3B 1SNQA 1YNXA 3K5LA 4HJ5A 3J81i 2Z9HA 4WJ3M 4IURA 1MBYA 3I4LA 1N34Q 3BDLA 1XPOA 1KIXA 1TU2B 1ZYRC 2O2LD 3MXPA 5GAGC 4IFDJ 1CT1D 2JP1A 2AUKA 4ULLA 2Z8LA 1GKHA 2JA5B 5K36G 2R61A 2NZ1D 3NUCA 2EY6A 4IQZA 4JYAL 2I5HA 4CJ2C 4LF8L 2XN9C 2P5ZX 4PMBA 4BY1G 1LYLA 2CQAA 5J3BA 2ATWA 4X64L 2WB1G 4LFCL 1IXRA 1LTID 2CQOA 2BA1A 4CJ1B 1KDBA 1N33Q 1F2LA 2XWJB 1IBMQ 4LFBL 3H3VH 5C44H 1SMYC 3T53B 3KJPA 3M4QA 4DR2Q 1WTQA 1GUSA 3FKIH 2C9OA 2K05A 4GOPB 3HOZB 5EBDA 3GV3A 2KCNA 5FLXL 1G291 4DAMA 2R7ZB 2UXBL 4JBKA 4H13C 2JK8A 1STGA 4A3KH 2QDBA 2O5JC 4ODGA 1V1OA 1HNZQ 2K01A 4KKTA 2B2VA 3K6OA 3SDZA 3NENA 2EYHA 3SK6A 2KVMA 1SFOH 1PYBA 2E5LL 2Z1CA 1HR0Q 1B9MA 1F9PA 1G2SA 4JI6Q 1A2TA 1PH8A 1CKMA 1SN8A 5T1GA 3J7AV 1SR3A 4OELB 2KUMA 3NXWA 4ZAIA 4DPGA 4EGVA 1NUCA 3DLLA 2LFNA 2PI2E 2WAQB 4KY6A 2OCEA 1RCVD 3K5OA 2RCFA 1EYGA 4N9TA 3E0EA 4WFN3 4HJ9A 2IY5B 2IHFA 2VUMB 3J81j 4AH6A 1BF4A 4LUZA 5BR8L 1UE1A 5LMNQ 1IBLL 3TP7A 4RG1A 1WFQA 4X65Q 1EOVA 1X55A 1V8QA 4JI1L 1EIHA 1E3PA 1CZGA 4LFAQ 4A3IH 3S15H 2I46A 1K0SA 4N9PA 5C4XG 1DZ1A 2ZXPA 1TS2A 2PQAB 1B2TA 5C3EB 4HEDA 4GLVB 2ICIA 1Y1WB 1Y1VG 3ICEA 4GKKL 3CD6A 5L37A 3DEPA 1Y8PB 1HCZA 1NAPA 1X3GA 4EQNA 2ES2A 1QG7A 4JV5Q 4ID6A 4C2MH 3WDNA 1ONLA 2L12A 4QIWE 4C1NI 2UUAL 1NE3A 1YVCA 1DYQA 1E2VA 2J0TD 1HUMA 1CHPD 3NTHA 4U68A 1EQQA 4BBSH 2F0VA 3FRPB 3D6CA 1P16A 1EIYB 3PUYA 2Q8IB 2HHHQ 1BBWA 1KLUD 2Y0SE 4JBJA 4DR1L 2VB3X 4J1MA 4K5VA 3S1RB 3ZYYX 1A62A 3ULPA 2E2HH 3GTGH 1Z47A 1Y14B 4NPSA 4Y7NB 1MIUA 5GAHC 3BDOA 3CRKC 1KL9A 3MC0B 5DAUA 5IGGA 2K5QA 1C7YA 4CKCA 2RVLA 3K7AH 2M00A 1B9NA 1SYEA 4EX5A 1I4GA 2L0CA 1GVPA 3I73A 1HZBA 5C6AA 4C3JG 2RQXA 2FJ2A 2QILA 2PNHA 2ZM6L 1N34L 3PF4A 2B2TC 2VY3A 1N8RC 2F0FA 4OL7A 4FXGC 2B2TA 5M5WH 1RF2D 4HR7B 1K28A 2AHOB 2ZXOA 4LJZC 1XNRL 4K2LA 4R1JA 4C56C 1PFBA 4DFAA 2SEBD 4GN3B 4JI2L 5LL6X 1U4MA 1VQ9A 1R9TH 1LT3D 2IX1A 4R4OA 1EY0A 1UE5A 1LM0A 1SE2A 2QEXA 3C2PA 2JA7G 2WB1E 2JJQA 3CC7A 1LT5D 3KF8B 3CCSA 2KHJA 4JI6L 2EDGA 2B39A 3I8ZA 1TS5A 3LGJA 4K6LA 4XIGS 1SNMA 3T13A 2JA8B 4A3KG 4BY7G 4NKLA 5IYDH 3EROA 3T1HL 5E7NA 1WJJA 5C3EG 1I50H 1TY0A 1L1OB 1IZ6A 1K8GA 3NWSA 1MSGA 2ZXRA 1MHWC 4IUVA 2K33A 2EIFA 3WOEA 1VF7A 4OIKA 4NXMQ 2R92G 1B53A 5T1IA 3S14B 1UE6A 1T5EA 3MXUA 1E24A 1A6XA 1SE8A 3S1RH 1HR0L 5C0XJ 1BQQT 2Q2IA 5C4ZA 5FO8B 4IOCA 4A3BG 1EQVA 3HRZC 1SEBD 3CPFA 1NNXA 3OW2A 2F1MA 3NTKA 3PMFA 1HZ9A 4GN5A 1G91A 3FVQA 3PV0A 5JEAH 2JA5H 1S5CD 1EIGA 1EFWA 2NZOA 4LF6Q 1MJCA 1RIPA 4AIMA 1H9KA 4L5TA 1O80A 1SNOA 4P71A 1SNPA 2KENA 2R93G 4DR3Q 3U50C 3Q8DA 3PCOB 3I56A 1EY6A 2LXKA 4LMQD 3D3RA 4XQJA 2X6GA 4FYDA 4ZUJA 1PLFA 2EYFA 2MO1A 4F8MA 3OHXC 1B3QA 2Q2TA 4LF4Q 3EIVA 3HOZG 1E2ZA 4K2KA 4EVOA 5M5WB 2K6AA 1F9QA 4X3SA 4BXXH 4DV3Q 3D6WA 2A69C 1CSQA 2IWHA 1JJ2A 2ASBA 1EY9A 1W2BA 1EY7A 1HZAA 3FMCA 3K80C 1XWEA 4KHPL 5IYCG 1VQ7A 4YIJA 2FHTA 2K75A 3GTMB 3HZXA 2F4VL 3PIPA 2VB2X 1TWFB 4IUPA 4L6TB 1DOMA 4UHVA 1VMPA 4JVZA 4GOPC 1HNWL 1JWMD 4UP7A 4LF9Q 1S5DD 1D1IA 1BO0A 2WFWA 2Z4HA 2A6HD 3GP7A 2XGTA 3ND8A 4B3RQ 5M5YH 2UXDQ 3PUVA 2HQLA 3VR5A 3GTJB 2MUYA 1GXDC 1SSOA 1YBYA 1SFOB 4FF3A 3S15B 1Q12A 4IFDI 1RKNA 2A6EC 3E9HA 3PQIA 3R8BA 3ZJYC 4XQNA 4FF2A 2QKIC 1EYDA 3KLSA 2NBFA 2F0QA 2NVTH 1QVFA 4GZYC 2IHEA 2F0GA 4AYBE 4RKBA 1LTAD 1F2MA 1XNRQ 3VR2A 2NVYB 5IWAQ 5IYCH 5A2QL 1WVLA 2PMZE 1TWAB 2K5WA 3MEFA 3R3OA 1EEFD 1B50A 3P75A 5EJWA 1CKNB 1FYCA 2JEBI 2ENBA 4C1NK 1TT2A 1HTPA 4C3IH 3C1EA 5JJIA 5D3DA 2AUJD 1ESFA 5TSSA 3KDFA 4A3GB 5JEAJ 3HOVB 4JI4Q 3UE1A 3TBIB 3F1ZA 1ASYA 4A3JG 4EQOA 1LACA 1PA6A 1XMQQ 3VYSA 1GD7A 1KDAA 4E6IA 1R4PB 3T16A 3PIO3 1Y69U 2G9DA 5I4DA 4ALPA 4DR6L 1E22A 4YHHL 3CW2C 3LNNA 3PGZA 5CV8A 5CMDA 3Q6SA 4TQUS 1QUQA 2EXZA 1QNUA 1TWFH 3J81c 2PW5A 5FJ8H 1F2YA 1PXUA 4DR2L 2F0LA 2E8GA 4JOIC 4XQQA 2OWOA 3GV6A 2HCIA 1A3TA 4JOIA 1A2UA 4UDUC 1Q8KA 1V1PB 5C3EH 4L5RC 4A4IA 4APVA 4BA2I 4O0AA 2NUCA 1X9NA 4HCEA 2GN5A 1D5MC 5C4XH 5JEAG 5EBCA 2JA5G 3FKIG 4QMGA 2EXDA 1QVGA 2A74C 1IHZA 4ZQ3A 3GTLB 3DWPA 4L5QA 2L4NA 2BDOA 4OWXB 3GD7A 2LSSA 2BDNA 3T51B 3SE0A 1IYJB 3CCMA 1VDZA 4IUQA 3MAQA 1HXYD 3A8KE 2JYOA 4FXDA 2L55A 4KY5A 1WD0A 4DV3L 4GN4B 3CHBD 5M5XH 3U9SA 3U4VA 2OXPA 4EQ5A 4A3DG 2QCPX 4IN3A 5C0XH 2PQEA 5BN5A 1II3A 3KUPA 4HN7A 4CDDC 4GLXA 1WOCA 4B3TQ 4IALA 1CA6A 4CKEA 1YI2A 3CKIB 5IYBG 4K6DA 2UUAQ 2CH4A 2B2WC 3N6RA 3W1GA 3VYRA 4XYQA 2AMCB 3Q22A 3TRZA 2O5IC 3S9WA 1NCVA 3I4OA 4KD3A 4TVAB 2SDFA 2CWAA 4RGOS 1N9WA 4WORA 4C3HH 1PH4A 5FKAC 1D8LA 3OWEB 3EFXD 3ND9A 2YTYA 4WJWA 5IP7G 3GTKB 4HAEA 1UUPA 4DXFA 4DR5Q 1AEXA 2LMCB 3G6JB 3X3NA 4IOAA 1W6KA 1ZXTA 4X3TA 1EQTA 1PZJD 5IWAL 1VQIA 1IYVA 4UP9A 1EYCA 2IT1A 1AN8A 2Q8TA 2OTLA 3M4PA 1EY5A 1JOKA 5D65A 4BBRB 1MGSA 1PTOC 5IT9E 3AEVA 1YNJC 1LTRD 2DY8A 5M5XB 3X3MA 1HUNA 2DNEA 2XRSD 4POFA 1IYUA 2B2UC 2YV5A 2F0EA 3PIOA 4IUNA 5KYLA 1XMQL 1KNEA 1Y1VB 4HCSA 4OX9L 4A3MB 3JAMi 4NXNQ 2F0UA 3BZKA 3BYTB 2ZT9C 3V2TA 3GTQB 3HEJA 2XTIA 4IJLA 1X3PA 1STEA 3RZOB 4F88A 3T1HQ 2NTTA 4R8IA 1VS0A 2H4OA 3J80c 1KRTA 1SYGA 2X6LA 2E2IB 5I2YA 3T4AC 4B3SL 3S2DB 1MJEA 4G57A 4DAVA 4NXML 1XJVA 3M3YB 1AZPA 3A8JE 3J7A5 1D6EC 1SYFA 5FJ8G 1GM5A 5C0XI 1VQMA 3MXNA 2NVYH 1DCZA 3GTKH 2C5CA 5J22A 1F9RA 4G7HC 3CU7A 3KYHC 1L0YB 3CXCA 3VR6A 4RA8A 3K0XA 3R2IA 1I4XA 3NBHB 5CGKA 1WTRA 1BR9A 1JOOA 1TWHB 4H7BA 2E76C 2IW3A 3KK7A 3C1FA 3NHHA 1I94Q 3HOYB 3T1YL 3FPPA 4ME5A 1PYSB 3CMAA 3GTQH 1QJOA 1TS4A 4LNQA 5EKLA 3HOVH 1RD9D 2L1BA 3CAMA 4HJ7A 1QB5D 3PO3G 5KGUA 1A63A 4BY1H 3E6ZX 1I3QB 2FMMA 4HIDA 1KQSA 2JA7B 5A35A 1DXMA 2BCOA 3OMGA 2F0KA 2MO0A 5KNDA 1M1KC 1Q82C 2R6GA 1PRTF 1O7ZA 4BBRG 5IGBA 3K57A 3P7JA 2KHIA 3TS2A 3D4RA 2UU9Q 1M90C 3M7GA 5IYBH 4DR3L 4BY7B 2KECA 3HFZB 1FR3A 1B1ZA 1JCKB 2Z6BA 3MVVA 4JK1C 4HSVA 2LY7A 2MJ8A 4MIUA 4A3FB 1CM9A 1VQFA 1X32A 4AYBG 2KQ3A 2IJ0A 5DEHA 3HOXH 1IBKL 3SK4A 1XPUA 4RHRA 2JA6B 2WKCA 2Y0SB 1HHVA 4ZYSA 1D2BA 2KA7A 3NBHA 5DNFA 4LF5Q 2BE5C 1WTPA 5JJZA 3FKIB 4JI8L 1SYDA 3R2TA 1IW7D 5IY0A 4M1UB 2JEAI 3AFPA 1VQ5A 1LT4D 4KJOA 1L0WA 4DV1L 2WB1B 4B08A 3I91A 4KKSA 3CCQA 1XMOL 1A0IA 3I4MH 3S2DH 3K5NA 4DNIA 5CYUA 3HOWH 3HOXG 5ELBA 1ET6A 4DNTB 5C4JH 3OTOQ 1Q81C 4J15A 1SLJA 3J81L 4DGZA 1PRTD 2EPBA 3CCUA 2RSOA 4ILWA 3HOUB 5KEEA 1VQJA 1S3OA 5FLMG 1WTWA 2B2UA 3NPPA 1QCBD 1PH5A 2OQ0A 4A3DB 4A3EB 3T56B 3NBIA 1YZ6A 5HGTA 1SRUA 1QVCA 4DF7A 4IFDH 3BU2A 5KRUA 1QOHA 2L9HA 4O42A 1CKNA 2E2JB 1CSPA 1KD1C 1TWHH 4DK0A 5GADC 2RKSA 4Y52H 3L3OC 3KDFB 3I55A 1KC8C 1TWGH 1ML0D 1UNSA 4QB4A 3RLNA 2XIWA 2KBNA 1ILQA 1VQHA 3OSOA 4A93B 4XYOA 4MHEA 4TSSA 1JJCB 4CKBA 1X54A 3A0JA 3M4OB 3CCEA 3RUZA 2WIIB 4ZK9B 4JW0A 4CGYB 3I4NB 1Y1WH 4WRDA 5EPLA 4HJAA 5EKIA 2CWPA 3SXHA 1NJIC 1TKWB 3OIPA 5BN3A 5G3LD 4FNFA 1I4QA 1PZKD 1D5ZC 3HOWB 1EWCA 3U9OA 3P20A 4ZCKA 3OW7A 5IODA 4RWSC 4GKJQ 4F87A 2KHSA 3PO2G 1PFNA 5DM63 4IFDG 3EQLC 2VUMH 1H9RA 1UAPA 1JORA 1YHBA 1X3FA 3GTOB 1TWAH 3A56A 3K7AB 4IO9A 3OIQA 1VQLA 1SYBA 4LF7Q 3G6EA 3RNUA 5LL6S 5F2DA 5CV5A 4DAYB 2E5LQ 3H3VC 5EKKA 2MPMA 1JICA 1YEZA 2E2HB 2K04A 2Z4IA 4Q5VA 1S5FD 3G48A 4KI0A 5M3MH 3A5UA 2ID0A 2F4IA 1QZGA 3E5SA 1QILA 2LKVA 2EOTA 3A74A 5EQ0A 3JC66 1XNQL 4PMCA 3A7LA 4C3HG 3DM3A 1L1OC 1PTOH 5KYIA 4B3TL 2F0NA 3DXJC 1E1TA 5G3LF 2NVQH 3BDCA 3K58A 4FF4A 4JPBW 1I4RA 1TWGB 2I07B 3SK8A 4DV7L 3J80i 4LFAL 1VQKA 3S16H 4LWCA 4HJ8A 1WI5A 2DJFC 5FO7B 1JE4A 4X6AH 1ENFA 1U0LA 5ELNA 5BN4A 3W5OA 3JAML 1FGBD 3RMHA 1TWCB 2RDHA 3CCJA 1K3RA 2M2LA 2A5HA 1V1PA 4AQYL 1AE2A 4L63B 4NMZA 4DUYQ 1B44D 3QOJA 4L5SA 4ME3A 4XXEA 5M3MB 1V43A 3S17B 1OXUA 3MHBA 2B63H 2K1BA 4PNYA 1YHAA 2RF4A 4ZLTF 1SE4A 2A69D 2F0TA 3H3VI 2F0HA 3GTOH 4X66L 5JJLA 2PZWA 2CVRA 3KF8A 1H9SA 2CW0D 3RZDB 2UUBL 1CTMA 2EJGC 2N8NA 3NQTA 3QO2A 5NUCA 1FD7D 1STHA 3RLFA 4LF4L 2JA7H 1Q7YC 1BBXC 4CHTB 4DUZQ 1SXTA 1QUQB 4YY3L 1BCPD 4NP5A 2Z6KA 4JI0L 5AJ3Q 4HMIA 3M4YA 1WD1A 2N49A 5CBEE 2ZTEA 2ICEC 2F52A 4LK1C 1QZHA 1AZQA 1SBBB 3S14H 4GNXC 2HD3A 4JI2Q 1EZ8A 2WAQG 1G2TA 3F2BA 3RLOA 5KNCA 1YNJD 4I65A 2JA8G 3BZDB 3QWNA 4DK3C
chains in the Genus database with same CATH topology
3I7FA 4L5QA 4A3JH 3PUZA 4LUVA 4OWXB 2F4VQ 3F2DA 3GD7A 2A19A 2LSSA 2ZJPA 4QJFA 4A3BH 1IYJB 2VQEQ 3CCMA 4PMWA 4OWWB 3UE0A 3HKSA 3RR5A 1GO3E 4DV5Q 1HNWQ 2NVXH 1OTCA 3GTPH 1JE5A 1N32L 4K0KL 3CC2A 1C0AA 3H0GH 1VQBA 4B3ML 4LF9L 3KLWA 3HOZH 3PO3H 4DV2L 1YNXA 4JI3L 4DV3L 3STBC 4GN4B 4HJ5A 2FXQA 5M5XH 4GKJL 3J81i 4WJ3M 1H95A 4LF8Q 2RHQB 1HZCA 3U4VA 1XMOQ 4EQ5A 1XPOA 1N34Q 1KIXA 4A3DG 4A3EG 2UXDL 1G6PA 4IFDJ 5GAGC 1C9OA 2Q2UA 3TQYA 2MFIA 1GKHA 2K5HA 3S24A 5K36G 2VNUD 3S17H 3CCRA 4GLXA 4B3TQ 1WOCA 1YHQA 4LF7L 4JYAL 2ALYB 2I5HA 4LF8L 1PH2A 1YI2A 2R7DA 3PF5A 1XNQQ 4LF5L 1U5KA 4BY1G 5IYBG 3CF5A 2UUAQ 1LYLA 1AH9A 5J3BA 3W1GA 4DV4Q 4X64L 2WB1G 4LFCL 2ATWA 2AMCB 3TRZA 3CQZH 1Z9FA 1IXRA 3I4OA 4TVAB 2CQOA 2CWAA 2BA1A 1HNXQ 1X3EA 1N33Q 5JJKA 1IBMQ 4LFBL 3H3VH 1N9WA 1YJWA 5C44H 4LUOA 4C3HH 1PH4A 1I94L 2JA6G 3KJPA 3M4QA 4DR2Q 4B3SQ 1D8LA 2N78A 1PHJA 3FKIH 2YTYA 5IP7G 2JA9A 4H02A 4GOPB 1HNZL 4KHZA 4JG2A 4PZ7A 1G291 1JB7A 1FJGQ 1YJNA 3OYYA 4DAMA 4DR5Q 4QY7A 4LFBQ 2UXBL 2BH8A 1N36Q 4JBKA 2ZJRA 2JK8A 3PUXA 4A3KH 1VQOA 2JQOA 2R7FA 4IOAA 1G51A 4NB3A 1JT8A 1HNZQ 4UPAA 5IWAL 1VQIA 2IX0A 2LXJA 3NENA 4YCVA 2ZM6Q 1SFOH 1PYBA 2GVAA 2BA0A 1FVIA 3PUWA 4UP9A 1HR0Q 2E5LL 2IT1A 1EUJA 4JI6Q 3UDXA 2OTLA 3M4PA 4JBWA 3S1QH 4A3LG 1VQ6A 2K14A 4GS3A 3UDIA 4MNOA 2VQEL 1CKMA 1SN8A 3NELA 1PH8A 1SR3A 2D62A 2VQFQ 4BY7H 4YWLA 2KCTA 3DLLA 4DPGA 1AE3A 1OXVA 3AEVA 4KHPQ 3CC4A 1Q1EA 4UY8C 2R92H 4B3MQ 4POFA 2UXCL 2PI2E 1KHIA 2YV5A 1VQEA 1JMCA 2OCEA 4OO1G 3PIOA 2CCZA 1XMQL 1EYGA 2N3SA 1Y1VH 3E0EA 2K4KA 2V1CC 3IRBA 4HJ9A 4PZ6A 2L15A 2IY5B 2IHFA 4OX9L 3JAMi 4IPHA 3J81j 4AH6A 4NXNQ 1BBUA 3BZKA 4LUZA 5BR8L 1UE1A 5H1SE 4X62Q 3ULLA 2B3GA 4RG1A 1WFQA 5C0XG 5LMNQ 1IBLL 2I5LX 3STBD 2K52A 4X65Q 2YU9H 4DR4Q 3S2HH 4P75A 1OXTA 1EOVA 1X55A 4DV6Q 4Y7NH 4A93G 4JCVE 2XTIA 4JI1L 3M85A 4DR7L 1FGUA 4IJLA 1HR0W 1JJGA 3NEMA 2Y0SG 2UUBQ 1E3PA 4B3RL 4LFAQ 4A3IH 3S15H 3KF6A 3T1HQ 2MNAA 1NMGA 1Q1BA 4X65L 5C4XG 1VS0A 3GO5A 3I4NH 3J80c 3TEHB 2PQAB 1KRTA 2UXCQ 1S72A 4B3SL 3GTLH 1MJEA 2RCNA 4NXML 1XJVA 4GLVB 3W1BA 1KXLA 5IP7H 1Y1VG 3ICEA 4GKKL 3CD6A 3SGIA 1BKBA 3J7A5 5IE8A 1X3GA 5FJ8G 2ES2A 1GM5A 1WYDA 2DGYA 5C0XI 2MQHA 1VQMA 4JV5Q 4DV7Q 3M4OH 2NVYH 4C2MH 3GTKH 5GROA 1KAWA 1T9HA 2HIXA 4QIWE 4YWMA 3KYHC 2UUAL 1NE3A 1YVCA 4GNXA 5M3MG 1I3QH 1P8LA 3CXCA 1EQQA 4OO1I 1YITA 4FDBA 3UDGA 2I5MX 4BBSH 4A3LH 3K0XA 4R4TA 1PV4A 1P16A 1EIYB 3NBHB 3PUYA 5HY6A 3AFQA 2GVBA 4IJHA 3ER0A 5AJ3L 2HHHQ 1BBWA 2Y0SE 1I94Q 4BXXG 3T1YL 3GTJH 2PQAA 2UUCL 1YJ9A 4JBJA 4DR1L 4C3JH 4HIOA 1PYSB 5IT9c 3CMAA 3GTQH 4LNQA 3HOVH 4OWTB 1BVSA 4YHHQ 1A62A 3ULPA 2E2HH 3GTGH 3CAMA 4HJ7A 3FHWA 3H15A 2UXBQ 1Z47A 1Y14B 3T1YQ 1EIFA 4YCWA 3PO3G 4RMFA 3UDFA 4NPSA 1K9MC 1MIUA 5GAHC 4JI5Q 1I6HH 1KL9A 4BY1H 1A63A 3PSIA 2OQKA 4A3IG 1J5EL 1C7YA 4HIDA 2YTXA 1KQSA 4DR5L 2CKZB 1NTGA 3K7AH 1CKOA 4LW1A 3I4NG 2MO0A 4EX5A 1M1KC 3RZDH 1X65A 2R6GA 4BBRG 1EQRA 1TXYA 2VW9A 1GVPA 1Q82C 1HZBA 5LMUQ 4DV2Q 2KHIA 3TS2A 4DV6L 4JI1Q 2UU9Q 4DR7Q 1M90C 5IYBH 4DR3L 2AWNA 2PNHA 3HOWG 3HFZB 2E2JH 4O2DA 2ZM6L 1N34L 3PF4A 1DGSA 1V9PA 2VY3A 1N8RC 3S1MH 1TWCH 3KJOA 5M5WH 1VQFA 2AHOB 4AYBG 1VQ8A 1XNRL 4R1JA 4A3DH 1SROA 1Q46A 2JE6I 4GN3B 4JI2L 4JI8Q 3RZOH 2VZAA 4JI7Q 1VQ9A 2HT1A 1R9TH 2IX1A 3HOXH 2WAQE 3MXNB 4R4OA 2EQSA 3RN5A 1IBKL 1UE5A 1LM0A 2QEXA 2Q2HA 1PH6A 1XPUA 2JA7G 2WB1E 2JJQA 3CC7A 4DV1Q 1PH1A 2OTJA 3G4SA 4IPCA 1N32Q 4LF5Q 2AWOA 3KF8B 4DUZL 3CCSA 2KHJA 3RN2A 2VS1A 5FLMH 4JI6L 1V1QA 3K7UC 4X64Q 4JI8L 3LGJA 2K5NA 4QGUA 1VQNA 4KLKA 4XIGS 5IY0A 2JEAI 1OXXK 4A3KG 2R7ZG 4BY7G 4DR4L 2QA4A 5IYDH 3AFPA 1VQ5A 3T1HL 5E7NA 1L0WA 1WJJA 5C3EG 4DV1L 4OXPA 1K73C 1I50H 1IBML 3KF6B 2A8VA 1Y1WG 1FJGL 3CCQA 1XMOL 1A0IA 3I4MH 4A3FG 1L1OB 1IZ6A 4DNIA 1K8GA 3S2DH 3M9BA 4OONA 1SMXA 2CFMA 3HOWH 4DKAC 5GAEC 1B8AA 3HOXG 2EIFA 5C4JH 3OTOQ 1Q81C 4J15A 4UP8A 1SLJA 4NXMQ 3CPWA 3KOJA 2R92G 4IPGA 3A5ZB 3HKZG 3CCUA 1UE6A 1VQJA 4MTNA 1PFSA 1S3OA 5FLMG 1E24A 1SE8A 1PH5A 2OQ0A 4K0KQ 3S1RH 1HR0L 5C0XJ 1L1OA 1YZ6A 4IOCA 2Q2IA 1E1OA 2B29A 3OTOL 4A3BG 1SRUA 3CPFA 4HIKA 1QVCA 3OW2A 3BU2A 1OXSC 1UE7A 1CKNA 1HZ9A 4GN5A 3PV0A 1Q86C 2H5XA 1CSPA 2JA5H 2F3IA 2K5VA 1KD1C 3F2CA 1TWHH 4P74A 1EFWA 4A3CH 1VQAA 1WCMG 2NZOA 4BA1I 5GADC 4LF6Q 1MJCA 4Y52H 1RIPA 3KDFB 5LMUL 4AIMA 4L5TA 3I55A 4JC0A 1PVOA 1RL2A 4P71A 1TWGH 4A3MG 1KC8C 2Z0SA 1NMFA 2KENA 5DLQE 2VUMG 4A3GG 2R93G 4DR3Q 4DV0Q 3U50C 3Q8DA 3RLNA 3PCOB 3AQQA 3I56A 4A75A 2D0PA 2KBNA 1VQHA 2LXKA 4A76A 1JJCB 1X54A 3A0JA 3CCEA 2HIVA 1K83H 2MO1A 2Q2TA 5M3FG 4LF4Q 1A8VA 1Y1WH 3EIVA 3HOZG 4HJAA 2CWPA 5C44G 1NJIC 3I2ZA 3L7ZC 4JI7L 2NN6G 3TREA 4BXXH 3E9IA 4AQYQ 4DV3Q 4JI3Q 3K8AA 2AKWB 4A3FH 3FP9A 1VQDA 1HNXL 1XTDA 3TS0A 4GKJQ 3HOYH 4JI0Q 1CSQA 1K8AC 1JJ2A 1UWVA 1FL0A 2ASBA 3PO2G 1W2BA 5LMNW 1HZAA 4IFDG 4PZ8A 4POGA 2BH2A 1B70B 3K80C 1PH3A 4A3MH 2VUMH 4KHPL 5IYCG 1KRSA 1VQ7A 2UUCQ 1YHBA 2K75A 4BBSG 2F4VL 2PI2A 3PIPA 1X3FA 3JAMc 1TWAH 2ZTDA 1MKHA 4YCUA 4IO9A 1XPRA 1VQLA 4OX9Q 4LF7Q 4JYAQ 4GOPC 4QQBX 3G6EA 1HNWL 3D0FA 3GTMH 3RNUA 4UP7A 4DAYB 2E5LQ 4LF9Q 2Z6KC 4R4QA 4GKKQ 4QL5A 1YEZA 2WFWA 5BR8Q 5LMNL 2JA6H 1J5EQ 3G48A 4KI0A 3A5UA 4P73A 4R4IA 5M3MH 1L2FA 2XGTA 1IL2A 4JV5L 2ID0A 4B3RQ 5M5YH 5ELOA 3WWVA 1VQ4A 3PUVA 5IP9H 1QZGA 1N33L 4MZ9A 2I0QA 2HQLA 2E2IH 1B7YB 2D0OA 1YBYA 1IBKQ 5M3FH 1Q12A 1VCIA 4IFDI 1NY4A 5HGQA 1J6QA 3A74A 3E9HA 2ZTCA 3ZJYC 1VQGA 3G71A 3S1NH 3JC66 1XNQL 2NVTH 1QVFA 3DM3A 2IHEA 4LF6L 1L1OC 2VL6A 4NXNL 1VQPA 4AYBE 3D31A 4LFCQ 4B3TL 1ASZA 1E1TA 3HOUG 2NZHA 3VDYA 2NVQH 3KFUA 2UXDQ 1XNRQ 1K0RA 3BZCA 5IYCH 5IWAQ 1E7ZA 3AYHB 4GLAC 2PMZE 5GQOA 3HOYG 5IP9G 2ZJQA 4DV7L 3CCVA 3MEFA 4X62L 1IBLQ 4JI4L 3J80i 3M3YH 3BJUA 3J7ZC 4LFAL 1VQKA 1CKNB 3S16H 4LWCA 2JEBI 4HJ8A 4DUYL 1VQCA 1I5FA 1WI5A 2YYZA 3M7NA 4X6AH 1O7IA 1W3SA 3ERSX 4C3IH 1U0LA 5ELNA 5JJIA 3W5OA 2DUDA 1D7QA 2YTVA 3EBEA 1LUZA 1S40A 4YWKA 3KDFA 5JEAJ 3CCJA 4JI4Q 1K3RA 3L0OA 1CUKA 4IPDA 3UE1A 4DR6Q 1EWIA 3EN2A 4BBRH 3F1ZA 3CMEA 4AQYL 1AE2A 4DUYQ 1ASYA 4HIMA 3U58A 4L5SA 4A3JG 4ME3A 2UU9L 3L2PA 4JBMA 4XTCS 1PA6A 4PG3A 1V43A 1XMQQ 1GD7A 3CP0A 3H0GG 4X66Q 2KCMA 3PO2H 1OXUA 2B63H 4ALPA 4L5RC 4DR6L 5IYDG 1E22A 4DV4L 4A93H 4JI5L 4YHHL 3CW2C 1YHAA 2RF4A 4P72A 3PGZA 1HH2P 3B6YA 2R7ZH 3H3VI 4TQUS 1QUQA 2K50A 1TWFH 3GTOH 4X66L 5JJLA 3J81c 2A1AA 1UEBA 5FJ8H 2JA8H 1PH9A 2NN6I 4DR2L 1PH7A 2UUBL 2E8GA 2N8NA 4JOIC 4DK6C 3K81C 2OWOA 2VQFL 3RLFA 2JA7H 3U4ZA 3I4MG 4JOIA 4LF4L 1Q7YC 1X56A 1Q8KA 4DUZQ 3HOVG 4WJ4A 1LTLA 1QUQB 4R4CA 4YY3L 5C3EH 1NBWA 2C35B 2Z6KA 3HKZE 4A4IA 3F8TA 5AJ3Q 2HHHL 4JI0L 2N49A 3ULJA 4APVA 4A3EH 1N36L 4O0AA 4BA2I 2RHSB 2ZTEA 2R93H 3GDEA 1X6OA 4DR1Q 1X9NA 2F52A 5FLXc 2GN5A 2QGQA 5C4XH 1QZHA 5EAYA 4DV0L 4GOPA 3HOUH 3S14H 4GNXC 5JEAG 1HJPA 2JA5G 4A3CG 4JI2Q 3FKIG 4GNXB 2WAQG 2EXDA 3F2BA 1YIJA 1WCMH 4DV5L 1QVGA 3RLOA 2B63G 4YY3Q 3CCLA 2JA8G 4A3GH 2WP8J 4DK3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I7F A;  4L5Q A;  4A3J H;  3PUZ A;  4LUV A;  4OWX B;  2F4V Q;  3F2D A;  3GD7 A;  2A19 A;  2LSS A;  2ZJP A;  4QJF A;  4A3B H;  1IYJ B;  2VQE Q;  3CCM A;  4PMW A;  4OWW B;  3UE0 A;  3HKS A;  3RR5 A;  1GO3 E;  4DV5 Q;  1HNW Q;  2NVX H;  1OTC A;  3GTP H;  1JE5 A;  1N32 L;  4K0K L;  3CC2 A;  1C0A A;  3H0G H;  1VQB A;  4B3M L;  4LF9 L;  3KLW A;  3HOZ H;  3PO3 H;  4DV2 L;  1YNX A;  4JI3 L;  4DV3 L;  3STB C;  4GN4 B;  4HJ5 A;  2FXQ A;  5M5X H;  4GKJ L;  3J81 i;  4WJ3 M;  1H95 A;  4LF8 Q;  2RHQ B;  1HZC A;  3U4V A;  1XMO Q;  4EQ5 A;  1XPO A;  1N34 Q;  1KIX A;  4A3D G;  4A3E G;  2UXD L;  1G6P A;  4IFD J;  5GAG C;  1C9O A;  2Q2U A;  3TQY A;  2MFI A;  1GKH A;  2K5H A;  3S24 A;  5K36 G;  2VNU D;  3S17 H;  3CCR A;  4GLX A;  4B3T Q;  1WOC A;  1YHQ A;  4LF7 L;  4JYA L;  2ALY B;  2I5H A;  4LF8 L;  1PH2 A;  1YI2 A;  2R7D A;  3PF5 A;  1XNQ Q;  4LF5 L;  1U5K A;  4BY1 G;  5IYB G;  3CF5 A;  2UUA Q;  1LYL A;  1AH9 A;  5J3B A;  3W1G A;  4DV4 Q;  4X64 L;  2WB1 G;  4LFC L;  2ATW A;  2AMC B;  3TRZ A;  3CQZ H;  1Z9F A;  1IXR A;  3I4O A;  4TVA B;  2CQO A;  2CWA A;  2BA1 A;  1HNX Q;  1X3E A;  1N33 Q;  5JJK A;  1IBM Q;  4LFB L;  3H3V H;  1N9W A;  1YJW A;  5C44 H;  4LUO A;  4C3H H;  1PH4 A;  1I94 L;  2JA6 G;  3KJP A;  3M4Q A;  4DR2 Q;  4B3S Q;  1D8L A;  2N78 A;  1PHJ A;  3FKI H;  2YTY A;  5IP7 G;  2JA9 A;  4H02 A;  4GOP B;  1HNZ L;  4KHZ A;  4JG2 A;  4PZ7 A;  1G29 1;  1JB7 A;  1FJG Q;  1YJN A;  3OYY A;  4DAM A;  4DR5 Q;  4QY7 A;  4LFB Q;  2UXB L;  2BH8 A;  1N36 Q;  4JBK A;  2ZJR A;  2JK8 A;  3PUX A;  4A3K H;  1VQO A;  2JQO A;  2R7F A;  4IOA A;  1G51 A;  4NB3 A;  1JT8 A;  1HNZ Q;  4UPA A;  5IWA L;  1VQI A;  2IX0 A;  2LXJ A;  3NEN A;  4YCV A;  2ZM6 Q;  1SFO H;  1PYB A;  2GVA A;  2BA0 A;  1FVI A;  3PUW A;  4UP9 A;  1HR0 Q;  2E5L L;  2IT1 A;  1EUJ A;  4JI6 Q;  3UDX A;  2OTL A;  3M4P A;  4JBW A;  3S1Q H;  4A3L G;  1VQ6 A;  2K14 A;  4GS3 A;  3UDI A;  4MNO A;  2VQE L;  1CKM A;  1SN8 A;  3NEL A;  1PH8 A;  1SR3 A;  2D62 A;  2VQF Q;  4BY7 H;  4YWL A;  2KCT A;  3DLL A;  4DPG A;  1AE3 A;  1OXV A;  3AEV A;  4KHP Q;  3CC4 A;  1Q1E A;  4UY8 C;  2R92 H;  4B3M Q;  4POF A;  2UXC L;  2PI2 E;  1KHI A;  2YV5 A;  1VQE A;  1JMC A;  2OCE A;  4OO1 G;  3PIO A;  2CCZ A;  1XMQ L;  1EYG A;  2N3S A;  1Y1V H;  3E0E A;  2K4K A;  2V1C C;  3IRB A;  4HJ9 A;  4PZ6 A;  2L15 A;  2IY5 B;  2IHF A;  4OX9 L;  3JAM i;  4IPH A;  3J81 j;  4AH6 A;  4NXN Q;  1BBU A;  3BZK A;  4LUZ A;  5BR8 L;  1UE1 A;  5H1S E;  4X62 Q;  3ULL A;  2B3G A;  4RG1 A;  1WFQ A;  5C0X G;  5LMN Q;  1IBL L;  2I5L X;  3STB D;  2K52 A;  4X65 Q;  2YU9 H;  4DR4 Q;  3S2H H;  4P75 A;  1OXT A;  1EOV A;  1X55 A;  4DV6 Q;  4Y7N H;  4A93 G;  4JCV E;  2XTI A;  4JI1 L;  3M85 A;  4DR7 L;  1FGU A;  4IJL A;  1HR0 W;  1JJG A;  3NEM A;  2Y0S G;  2UUB Q;  1E3P A;  4B3R L;  4LFA Q;  4A3I H;  3S15 H;  3KF6 A;  3T1H Q;  2MNA A;  1NMG A;  1Q1B A;  4X65 L;  5C4X G;  1VS0 A;  3GO5 A;  3I4N H;  3J80 c;  3TEH B;  2PQA B;  1KRT A;  2UXC Q;  1S72 A;  4B3S L;  3GTL H;  1MJE A;  2RCN A;  4NXM L;  1XJV A;  4GLV B;  3W1B A;  1KXL A;  5IP7 H;  1Y1V G;  3ICE A;  4GKK L;  3CD6 A;  3SGI A;  1BKB A;  3J7A 5;  5IE8 A;  1X3G A;  5FJ8 G;  2ES2 A;  1GM5 A;  1WYD A;  2DGY A;  5C0X I;  2MQH A;  1VQM A;  4JV5 Q;  4DV7 Q;  3M4O H;  2NVY H;  4C2M H;  3GTK H;  5GRO A;  1KAW A;  1T9H A;  2HIX A;  4QIW E;  4YWM A;  3KYH C;  2UUA L;  1NE3 A;  1YVC A;  4GNX A;  5M3M G;  1I3Q H;  1P8L A;  3CXC A;  1EQQ A;  4OO1 I;  1YIT A;  4FDB A;  3UDG A;  2I5M X;  4BBS H;  4A3L H;  3K0X A;  4R4T A;  1PV4 A;  1P16 A;  1EIY B;  3NBH B;  3PUY A;  5HY6 A;  3AFQ A;  2GVB A;  4IJH A;  3ER0 A;  5AJ3 L;  2HHH Q;  1BBW A;  2Y0S E;  1I94 Q;  4BXX G;  3T1Y L;  3GTJ H;  2PQA A;  2UUC L;  1YJ9 A;  4JBJ A;  4DR1 L;  4C3J H;  4HIO A;  1PYS B;  5IT9 c;  3CMA A;  3GTQ H;  4LNQ A;  3HOV H;  4OWT B;  1BVS A;  4YHH Q;  1A62 A;  3ULP A;  2E2H H;  3GTG H;  3CAM A;  4HJ7 A;  3FHW A;  3H15 A;  2UXB Q;  1Z47 A;  1Y14 B;  3T1Y Q;  1EIF A;  4YCW A;  3PO3 G;  4RMF A;  3UDF A;  4NPS A;  1K9M C;  1MIU A;  5GAH C;  4JI5 Q;  1I6H H;  1KL9 A;  4BY1 H;  1A63 A;  3PSI A;  2OQK A;  4A3I G;  1J5E L;  1C7Y A;  4HID A;  2YTX A;  1KQS A;  4DR5 L;  2CKZ B;  1NTG A;  3K7A H;  1CKO A;  4LW1 A;  3I4N G;  2MO0 A;  4EX5 A;  1M1K C;  3RZD H;  1X65 A;  2R6G A;  4BBR G;  1EQR A;  1TXY A;  2VW9 A;  1GVP A;  1Q82 C;  1HZB A;  5LMU Q;  4DV2 Q;  2KHI A;  3TS2 A;  4DV6 L;  4JI1 Q;  2UU9 Q;  4DR7 Q;  1M90 C;  5IYB H;  4DR3 L;  2AWN A;  2PNH A;  3HOW G;  3HFZ B;  2E2J H;  4O2D A;  2ZM6 L;  1N34 L;  3PF4 A;  1DGS A;  1V9P A;  2VY3 A;  1N8R C;  3S1M H;  1TWC H;  3KJO A;  5M5W H;  1VQF A;  2AHO B;  4AYB G;  1VQ8 A;  1XNR L;  4R1J A;  4A3D H;  1SRO A;  1Q46 A;  2JE6 I;  4GN3 B;  4JI2 L;  4JI8 Q;  3RZO H;  2VZA A;  4JI7 Q;  1VQ9 A;  2HT1 A;  1R9T H;  2IX1 A;  3HOX H;  2WAQ E;  3MXN B;  4R4O A;  2EQS A;  3RN5 A;  1IBK L;  1UE5 A;  1LM0 A;  2QEX A;  2Q2H A;  1PH6 A;  1XPU A;  2JA7 G;  2WB1 E;  2JJQ A;  3CC7 A;  4DV1 Q;  1PH1 A;  2OTJ A;  3G4S A;  4IPC A;  1N32 Q;  4LF5 Q;  2AWO A;  3KF8 B;  4DUZ L;  3CCS A;  2KHJ A;  3RN2 A;  2VS1 A;  5FLM H;  4JI6 L;  1V1Q A;  3K7U C;  4X64 Q;  4JI8 L;  3LGJ A;  2K5N A;  4QGU A;  1VQN A;  4KLK A;  4XIG S;  5IY0 A;  2JEA I;  1OXX K;  4A3K G;  2R7Z G;  4BY7 G;  4DR4 L;  2QA4 A;  5IYD H;  3AFP A;  1VQ5 A;  3T1H L;  5E7N A;  1L0W A;  1WJJ A;  5C3E G;  4DV1 L;  4OXP A;  1K73 C;  1I50 H;  1IBM L;  3KF6 B;  2A8V A;  1Y1W G;  1FJG L;  3CCQ A;  1XMO L;  1A0I A;  3I4M H;  4A3F G;  1L1O B;  1IZ6 A;  4DNI A;  1K8G A;  3S2D H;  3M9B A;  4OON A;  1SMX A;  2CFM A;  3HOW H;  4DKA C;  5GAE C;  1B8A A;  3HOX G;  2EIF A;  5C4J H;  3OTO Q;  1Q81 C;  4J15 A;  4UP8 A;  1SLJ A;  4NXM Q;  3CPW A;  3KOJ A;  2R92 G;  4IPG A;  3A5Z B;  3HKZ G;  3CCU A;  1UE6 A;  1VQJ A;  4MTN A;  1PFS A;  1S3O A;  5FLM G;  1E24 A;  1SE8 A;  1PH5 A;  2OQ0 A;  4K0K Q;  3S1R H;  1HR0 L;  5C0X J;  1L1O A;  1YZ6 A;  4IOC A;  2Q2I A;  1E1O A;  2B29 A;  3OTO L;  4A3B G;  1SRU A;  3CPF A;  4HIK A;  1QVC A;  3OW2 A;  3BU2 A;  1OXS C;  1UE7 A;  1CKN A;  1HZ9 A;  4GN5 A;  3PV0 A;  1Q86 C;  2H5X A;  1CSP A;  2JA5 H;  2F3I A;  2K5V A;  1KD1 C;  3F2C A;  1TWH H;  4P74 A;  1EFW A;  4A3C H;  1VQA A;  1WCM G;  2NZO A;  4BA1 I;  5GAD C;  4LF6 Q;  1MJC A;  4Y52 H;  1RIP A;  3KDF B;  5LMU L;  4AIM A;  4L5T A;  3I55 A;  4JC0 A;  1PVO A;  1RL2 A;  4P71 A;  1TWG H;  4A3M G;  1KC8 C;  2Z0S A;  1NMF A;  2KEN A;  5DLQ E;  2VUM G;  4A3G G;  2R93 G;  4DR3 Q;  4DV0 Q;  3U50 C;  3Q8D A;  3RLN A;  3PCO B;  3AQQ A;  3I56 A;  4A75 A;  2D0P A;  2KBN A;  1VQH A;  2LXK A;  4A76 A;  1JJC B;  1X54 A;  3A0J A;  3CCE A;  2HIV A;  1K83 H;  2MO1 A;  2Q2T A;  5M3F G;  4LF4 Q;  1A8V A;  1Y1W H;  3EIV A;  3HOZ G;  4HJA A;  2CWP A;  5C44 G;  1NJI C;  3I2Z A;  3L7Z C;  4JI7 L;  2NN6 G;  3TRE A;  4BXX H;  3E9I A;  4AQY Q;  4DV3 Q;  4JI3 Q;  3K8A A;  2AKW B;  4A3F H;  3FP9 A;  1VQD A;  1HNX L;  1XTD A;  3TS0 A;  4GKJ Q;  3HOY H;  4JI0 Q;  1CSQ A;  1K8A C;  1JJ2 A;  1UWV A;  1FL0 A;  2ASB A;  3PO2 G;  1W2B A;  5LMN W;  1HZA A;  4IFD G;  4PZ8 A;  4POG A;  2BH2 A;  1B70 B;  3K80 C;  1PH3 A;  4A3M H;  2VUM H;  4KHP L;  5IYC G;  1KRS A;  1VQ7 A;  2UUC Q;  1YHB A;  2K75 A;  4BBS G;  2F4V L;  2PI2 A;  3PIP A;  1X3F A;  3JAM c;  1TWA H;  2ZTD A;  1MKH A;  4YCU A;  4IO9 A;  1XPR A;  1VQL A;  4OX9 Q;  4LF7 Q;  4JYA Q;  4GOP C;  4QQB X;  3G6E A;  1HNW L;  3D0F A;  3GTM H;  3RNU A;  4UP7 A;  4DAY B;  2E5L Q;  4LF9 Q;  2Z6K C;  4R4Q A;  4GKK Q;  4QL5 A;  1YEZ A;  2WFW A;  5BR8 Q;  5LMN L;  2JA6 H;  1J5E Q;  3G48 A;  4KI0 A;  3A5U A;  4P73 A;  4R4I A;  5M3M H;  1L2F A;  2XGT A;  1IL2 A;  4JV5 L;  2ID0 A;  4B3R Q;  5M5Y H;  5ELO A;  3WWV A;  1VQ4 A;  3PUV A;  5IP9 H;  1QZG A;  1N33 L;  4MZ9 A;  2I0Q A;  2HQL A;  2E2I H;  1B7Y B;  2D0O A;  1YBY A;  1IBK Q;  5M3F H;  1Q12 A;  1VCI A;  4IFD I;  1NY4 A;  5HGQ A;  1J6Q A;  3A74 A;  3E9H A;  2ZTC A;  3ZJY C;  1VQG A;  3G71 A;  3S1N H;  3JC6 6;  1XNQ L;  2NVT H;  1QVF A;  3DM3 A;  2IHE A;  4LF6 L;  1L1O C;  2VL6 A;  4NXN L;  1VQP A;  4AYB E;  3D31 A;  4LFC Q;  4B3T L;  1ASZ A;  1E1T A;  3HOU G;  2NZH A;  3VDY A;  2NVQ H;  3KFU A;  2UXD Q;  1XNR Q;  1K0R A;  3BZC A;  5IYC H;  5IWA Q;  1E7Z A;  3AYH B;  4GLA C;  2PMZ E;  5GQO A;  3HOY G;  5IP9 G;  2ZJQ A;  4DV7 L;  3CCV A;  3MEF A;  4X62 L;  1IBL Q;  4JI4 L;  3J80 i;  3M3Y H;  3BJU A;  3J7Z C;  4LFA L;  1VQK A;  1CKN B;  3S16 H;  4LWC A;  2JEB I;  4HJ8 A;  4DUY L;  1VQC A;  1I5F A;  1WI5 A;  2YYZ A;  3M7N A;  4X6A H;  1O7I A;  1W3S A;  3ERS X;  4C3I H;  1U0L A;  5ELN A;  5JJI A;  3W5O A;  2DUD A;  1D7Q A;  2YTV A;  3EBE A;  1LUZ A;  1S40 A;  4YWK A;  3KDF A;  5JEA J;  3CCJ A;  4JI4 Q;  1K3R A;  3L0O A;  1CUK A;  4IPD A;  3UE1 A;  4DR6 Q;  1EWI A;  3EN2 A;  4BBR H;  3F1Z A;  3CME A;  4AQY L;  1AE2 A;  4DUY Q;  1ASY A;  4HIM A;  3U58 A;  4L5S A;  4A3J G;  4ME3 A;  2UU9 L;  3L2P A;  4JBM A;  4XTC S;  1PA6 A;  4PG3 A;  1V43 A;  1XMQ Q;  1GD7 A;  3CP0 A;  3H0G G;  4X66 Q;  2KCM A;  3PO2 H;  1OXU A;  2B63 H;  4ALP A;  4L5R C;  4DR6 L;  5IYD G;  1E22 A;  4DV4 L;  4A93 H;  4JI5 L;  4YHH L;  3CW2 C;  1YHA A;  2RF4 A;  4P72 A;  3PGZ A;  1HH2 P;  3B6Y A;  2R7Z H;  3H3V I;  4TQU S;  1QUQ A;  2K50 A;  1TWF H;  3GTO H;  4X66 L;  5JJL A;  3J81 c;  2A1A A;  1UEB A;  5FJ8 H;  2JA8 H;  1PH9 A;  2NN6 I;  4DR2 L;  1PH7 A;  2UUB L;  2E8G A;  2N8N A;  4JOI C;  4DK6 C;  3K81 C;  2OWO A;  2VQF L;  3RLF A;  2JA7 H;  3U4Z A;  3I4M G;  4JOI A;  4LF4 L;  1Q7Y C;  1X56 A;  1Q8K A;  4DUZ Q;  3HOV G;  4WJ4 A;  1LTL A;  1QUQ B;  4R4C A;  4YY3 L;  5C3E H;  1NBW A;  2C35 B;  2Z6K A;  3HKZ E;  4A4I A;  3F8T A;  5AJ3 Q;  2HHH L;  4JI0 L;  2N49 A;  3ULJ A;  4APV A;  4A3E H;  1N36 L;  4O0A A;  4BA2 I;  2RHS B;  2ZTE A;  2R93 H;  3GDE A;  1X6O A;  4DR1 Q;  1X9N A;  2F52 A;  5FLX c;  2GN5 A;  2QGQ A;  5C4X H;  1QZH A;  5EAY A;  4DV0 L;  4GOP A;  3HOU H;  3S14 H;  4GNX C;  5JEA G;  1HJP A;  2JA5 G;  4A3C G;  4JI2 Q;  3FKI G;  4GNX B;  2WAQ G;  2EXD A;  3F2B A;  1YIJ A;  1WCM H;  4DV5 L;  1QVG A;  3RLO A;  2B63 G;  4YY3 Q;  3CCL A;  2JA8 G;  4A3G H;  2WP8 J;  4DK3 C; 
#chains in the Genus database with same CATH topology
 3MTS A;  4DNR B;  2F4V Q;  1KNA A;  1STY A;  3S2H B;  4KN7 C;  4PMW A;  3UE0 A;  3HKS A;  3RR5 A;  1GO3 E;  1LTG D;  4DV5 Q;  1O7Y A;  1HNW Q;  3GTP H;  2PYK A;  1F77 A;  3KBG A;  1EY4 A;  4K0K L;  1N32 L;  4LF9 L;  2OF1 A;  2AQ2 B;  4DV2 L;  4MN3 A;  2FXQ A;  1DM0 B;  4GKJ L;  4C3H B;  1H95 A;  3BG3 A;  4LF8 Q;  2RHQ B;  1S5B D;  3VA5 A;  5EPK A;  4OGQ C;  1HQM C;  2UXD L;  1G6P A;  5ELE A;  5ELD A;  3ERQ A;  5ELC A;  1C9O A;  3TQY A;  2VNU D;  3S17 H;  3S1N B;  5AFW A;  3MEH A;  1C48 A;  4LF7 L;  2ALY B;  1PH2 A;  5JPN C;  5E4X A;  2R7D A;  3PF5 A;  3HG9 A;  1AH9 A;  1U5K A;  5C4J B;  1QNK A;  2J4X A;  1Y8O B;  2R93 B;  4X3K A;  3TSS A;  1TY2 A;  3CQZ H;  4R9W A;  4DXG A;  2NYZ D;  4QUF A;  1HPC A;  4B9W A;  1PTO F;  4RGM A;  2JSO A;  1TS3 A;  5JJK A;  1SMY D;  4WJ4 A;  1GUO A;  3UI2 A;  2JA6 G;  1I94 L;  1CA5 A;  4B3S Q;  1BXT A;  3AB9 A;  4PV1 C;  1LAB A;  1PHJ A;  2JA9 A;  4H02 A;  1HNZ L;  3NSW A;  1FNU A;  4JG2 A;  2R3Z A;  4PZ7 A;  4KD4 A;  1JB7 A;  1FJG Q;  1YJN A;  3OYY A;  3JAM E;  4LFB Q;  1SAP A;  3GTP B;  5C3W A;  2ZJR A;  4KKU A;  1VQO A;  2JQO A;  4NB3 A;  4UPA A;  1NR4 A;  4NW2 A;  3VYU A;  1J8I A;  2IX0 A;  4YCV A;  2SNM A;  2PNR C;  2GVA A;  2BA0 A;  3EJI A;  3PUW A;  2N88 A;  1EUJ A;  5FO9 B;  2KED A;  4OIJ A;  1CK1 A;  2PZU A;  2A68 C;  3QIA A;  4RCO A;  2VQE L;  2D62 A;  1PFM A;  4YWL A;  2KCT A;  2EYO A;  4NDX A;  4KHP Q;  1Q1E A;  2R92 H;  4B3M Q;  3HS0 C;  3A54 A;  3OMC A;  1KHI A;  1X3Q A;  3VYT A;  1JMC A;  4OO1 G;  2CCZ A;  2N3S A;  1Y1V H;  4O1N A;  3IRB A;  4PZ6 A;  2L15 A;  2CH4 W;  3CQZ B;  5H1S E;  3GTG B;  1GUG A;  2B3G A;  5C0X G;  4DAY A;  2YU9 H;  4DR4 Q;  3STB D;  2F3W A;  3S2H H;  2B2V C;  1OXT A;  3DUZ A;  4Y7N H;  4A93 G;  4JCV E;  3C3L A;  5JAV A;  1FGU A;  1HR0 W;  1JJG A;  3WOF A;  2UUB Q;  2EYM A;  4CDF C;  2MNA A;  1NMG A;  4X65 L;  2PPB C;  2GA4 B;  1OO9 B;  3I4N H;  1KLG D;  1QWY A;  4HSP A;  3S1M B;  4RGT A;  1F2Z A;  3Q0A A;  1RDP D;  3W1B A;  5IP7 H;  2KJX A;  1BKB A;  5IE8 A;  4RCN A;  1CFM A;  1WYD A;  2MQH A;  1NR2 A;  5GRO A;  2MGS A;  2PO4 A;  1U4L A;  4K5X A;  2HQE A;  2NVQ B;  4YWM A;  4OHJ A;  1G8Z D;  3A55 A;  4GNX A;  1I3Q H;  1D5X C;  1P8L A;  1ICW A;  3NQI A;  4FDB A;  3UDG A;  2I5M X;  5I2X A;  1YIT A;  4A3L H;  4R4T A;  1PV4 A;  4A3B B;  1YNN D;  1ZYR D;  3AFQ A;  1HTL D;  4K8I A;  5I9P A;  5AJ3 L;  2L5T A;  2UUC L;  1YJ9 A;  1LV9 A;  4C3J H;  4HIO A;  1HA5 A;  4Q0F A;  4UAI A;  2RA4 A;  5CR3 A;  4OWT B;  2RDF A;  4YHH Q;  1TVX A;  4KMU C;  2FMC A;  3FHW A;  4S3S A;  3FDT A;  1EIF A;  4YCW A;  2EY2 A;  3UDF A;  1I6H H;  4JI5 Q;  2DY7 A;  3S16 B;  2OQK A;  2NWG A;  2YTX A;  4DR5 L;  2CKZ B;  5IGD A;  1CKO A;  2RBM A;  3RZD H;  1DOL A;  3NTI A;  1EQR A;  2VW9 A;  5C44 B;  4DV2 Q;  2EVB A;  4DV6 L;  1PZI D;  4RH6 A;  4DR7 Q;  4FF1 A;  1LLR D;  2AWN A;  4O2D A;  1Z6H A;  3DEO A;  1DGS A;  3S1M H;  1TWC H;  2E2D C;  3HOX B;  2AQ3 B;  2K5D A;  1RTN A;  4A3D H;  1SRO A;  3J80 E;  1Q46 A;  2JE6 I;  2D9U A;  2VZA A;  2XVS A;  2HT1 A;  3RN5 A;  2OT2 A;  2OTJ A;  5JVG 3;  3G4S A;  4IPC A;  3TN2 A;  4KN4 C;  3I72 A;  2VS1 A;  1V1Q A;  4X64 Q;  3D4W A;  1VQN A;  2TSS A;  5E3F A;  3GQB A;  2QA4 A;  4N8X 1;  4IUT A;  4OXP A;  4FXK C;  5ISR A;  1IBM L;  4TKO B;  1AW7 A;  5FOB B;  1Y1W G;  2D2C C;  1FJG L;  2B8G A;  4A3F G;  1EOT A;  2EJM A;  2F03 A;  3M9B A;  3V96 A;  1SMX A;  2CFM A;  3VR3 A;  5GAE C;  1B8A A;  4UP8 A;  4X3U A;  4IPG A;  2JN4 A;  3HKZ G;  2DJG C;  4XDX A;  3BVZ A;  4MTN A;  1PFS A;  5M3F B;  1STN A;  3I3C A;  1L1O A;  1E1O A;  3HGB A;  3SEB A;  4KTA A;  2NB0 A;  1UE7 A;  4C3I B;  3D4D A;  1Q86 C;  3DMU A;  2H5X A;  4A3C H;  2F3I A;  3F2C A;  2Q8R E;  2KEE A;  4ZRZ A;  1Z7T A;  2WAC A;  4J6H A;  2NTS A;  2B2W A;  5LMU L;  1LTS D;  4JC0 A;  5D3I B;  1RL2 A;  4A3M G;  1EL0 A;  2Z0S A;  4A3G G;  1BDO A;  2QEJ C;  1M4V A;  4K5W A;  3AQQ A;  4A75 A;  4A3J B;  1I6V C;  1M8A A;  2AQ1 B;  2K32 A;  2F0D A;  4A76 A;  2HIV A;  1ZEQ X;  1F9S A;  1I6H B;  2EY5 A;  5CBA E;  1YNN C;  5C44 G;  3I2Z A;  4JI7 L;  4FP5 D;  1EFI D;  2NN6 G;  3CRL C;  3TRE A;  3E9I A;  3LWE A;  1FNW A;  4AQY Q;  2K03 A;  4JI3 Q;  1BOS A;  1HNX L;  3FP9 A;  1VQD A;  1XTD A;  1SJH D;  3TS0 A;  4JI0 Q;  3K59 A;  1FL0 A;  1STA A;  4FVM A;  2IL8 A;  4POG A;  1B70 B;  2CW0 C;  1PH3 A;  4RAU C;  4A3M H;  2EJF C;  1MD2 D;  1KRS A;  2UUC Q;  4BBS G;  4FO2 A;  1Q3L A;  2ZTD A;  4YCU A;  1XPR A;  2B2Y C;  4OX9 Q;  2L11 A;  5J39 A;  1EZ6 A;  1KTK A;  3D0F A;  1TII D;  1U4R A;  2Z6K C;  3G7L A;  3KLS X;  4GKK Q;  1S4Z A;  1WTX A;  3AMU A;  5BR8 Q;  5LMN L;  3C46 A;  4JV5 L;  4P73 A;  4R4I A;  1IL2 A;  5C3X A;  3IAY A;  3QOL A;  5ELO A;  2K7V A;  2PMZ B;  5M9O A;  2E2I H;  2XSC A;  1B7Y B;  2D0O A;  5C5M A;  1IBK Q;  5M3F H;  5HGQ A;  3G71 A;  3DM1 A;  1VQG A;  1B3A A;  1CHQ D;  1BUV T;  1RHP A;  1JWS D;  1CQV A;  5I9O A;  1HFN A;  2VL6 A;  4NXN L;  1VQP A;  5C5L A;  1LT6 D;  3D31 A;  4LFC Q;  2K28 A;  3I70 A;  3NP8 A;  2NZH A;  3KFU A;  3SHL A;  3MA2 B;  3BZC A;  1SE3 A;  3URY A;  4ZKC B;  3J80 L;  3HOY G;  2ZJQ A;  4CBV A;  4X62 L;  3KLR A;  3F2U A;  4P2C B;  4JI4 L;  1IKM A;  3BJU A;  3FPU B;  1VQC A;  1I5F A;  3J7Y W;  3NWT A;  3A7A B;  1W3S A;  3IFT A;  2DUD A;  1D7Q A;  1S40 A;  1LUZ A;  4QIW B;  4DR6 Q;  3L0O A;  1CUK A;  3OWF A;  1EWI A;  4BBR H;  3CME A;  4A3I B;  4H0L C;  4I7Z C;  3VA7 A;  3U58 A;  3L2P A;  1PRT B;  4XTC S;  4PG3 A;  3D8G A;  3CP0 A;  1R4Q B;  2HDM A;  3H0G G;  3PO2 H;  2EZV A;  5IYD G;  3P1H A;  4ZUI A;  1HH2 P;  3B6Y A;  5CV4 A;  1RJT A;  2K50 A;  1A3U A;  2G9H D;  4HMJ A;  1U9R A;  2NN6 I;  3I90 A;  4DA2 A;  4DK6 C;  2KCC A;  1W6J A;  1H9S B;  2EYP A;  3IKJ A;  1E0B A;  1LTL A;  4R4C A;  3HKZ E;  2C35 B;  2UXC L;  3F8T A;  3ULJ A;  4A3E H;  1ROD A;  2KOL A;  4PQX A;  3GDE A;  3SK5 A;  2LS0 1;  2EY1 A;  2QGQ A;  1AP0 A;  4L8J A;  3HOU H;  4A3C G;  1HJP A;  4CDE C;  4GNX B;  3QR8 A;  1ILP A;  4C3J B;  2F0W A;  3CCL A;  2PCF B;  1O78 A;  1O7L A;  4A3G H;  1B4O A;  3MWY W;  3PUZ A;  4LUV A;  2A19 A;  4QJF A;  4A3B H;  4QCL A;  1K83 B;  2VQE Q;  2J7Z A;  4ZKB B;  1JE5 A;  1JR0 D;  1C0A A;  1HRJ A;  4B3M L;  1XTC D;  3HOZ H;  3PO3 H;  4DU9 A;  4JI3 L;  3STB C;  4OO1 H;  2NVX B;  1HZC A;  1BCP C;  1XMO Q;  4A3E G;  3H09 A;  1PYW D;  3MXG A;  2Q2U A;  2MFI A;  2K5H A;  1CQF A;  3S24 A;  2EYJ A;  5J1Z A;  3CCR A;  1YHQ A;  1RTO A;  3MFY A;  1ZKO A;  5IGE A;  1XNQ Q;  1SYC A;  4LF5 L;  3CF5 A;  3TP5 A;  3TP8 A;  4DV4 Q;  4U67 3;  2IPK D;  4KJN A;  1Z9F A;  2QW7 A;  4H44 C;  3TZU A;  1HNX Q;  1X3E A;  3EVQ A;  1JC7 A;  1YJW A;  2B2Y A;  4LUO A;  4TRD A;  3E3X A;  3KBX A;  2N78 A;  1EYA A;  4KHZ A;  3H0G B;  2IX3 A;  5DM7 3;  5IIF A;  3W3A A;  1IKL A;  4QY7 A;  2BH8 A;  2O4X A;  1N36 Q;  1DJR D;  3PUX A;  4K8J A;  4DAP A;  2R7F A;  2BOS A;  1G51 A;  1JT8 A;  1BNZ A;  2VXW A;  2FFK B;  3R93 A;  3AU7 A;  1EU4 A;  2LXJ A;  3MFG A;  1C8C A;  1H9J A;  2ZM6 Q;  1WTO A;  1FVI A;  3HKZ B;  3UDX A;  4JBW A;  1EEI D;  4M8A A;  3S1Q H;  4A3L G;  5E1F A;  2K14 A;  1VQ6 A;  2F0S A;  4GS3 A;  3UDI A;  1TR5 A;  4MNO A;  4BY7 H;  3NEL A;  1DON A;  2VQF Q;  5IT9 L;  3A8I E;  1AE3 A;  1OXV A;  2F0O A;  3CC4 A;  4UY8 C;  2SOB A;  4C3I G;  5D14 A;  1I4H A;  1VQE A;  2F3V A;  1HQR D;  2PW7 A;  2OEO A;  2K4K A;  2V1C C;  1LO5 D;  4IPH A;  1BBU A;  4DK1 A;  4AYB B;  4X62 Q;  3ULL A;  3GTL H;  4MTK A;  2I5L X;  3NK9 A;  2K52 A;  2HUG A;  5I6W A;  4P75 A;  4RFB A;  4DV6 Q;  4DR7 L;  3M85 A;  1JWU D;  3NEM A;  2Y0S G;  4B3R L;  3KF6 A;  4HTH A;  1Q1B A;  1JOQ A;  3GO5 A;  4J8Q A;  1EWH A;  5KIX A;  1K3B C;  3TEH B;  2UXC Q;  5KNB A;  1S72 A;  1PMR A;  1ICF B;  2DN8 A;  2RCN A;  1KXL A;  3IL8 A;  1H9M A;  3K5M A;  3SGI A;  2DGY A;  4DV7 Q;  3M4O H;  1KAW A;  1T9H A;  3QJY A;  5A2Q E;  2HIX A;  2N55 A;  2FIN B;  3J81 E;  1C4Q A;  1S5E D;  5M3M G;  1G6Z A;  4OO1 I;  1TQO A;  3E0J A;  1GUN A;  2F0J A;  5HY6 A;  1J9O A;  1QE6 A;  2GVB A;  3O13 A;  4IJH A;  1BCP F;  3ER0 A;  1ENA A;  5K36 H;  1DD2 A;  4BXX G;  2DNC A;  3GTJ H;  2PQA A;  1WCM B;  5IT9 c;  5CC4 A;  1UEA B;  1BVS A;  2V4D A;  2M9V A;  3I4M B;  3H15 A;  2UXB Q;  2D5D A;  3T1Y Q;  4RMF A;  1K9M C;  1XX8 A;  2A68 D;  3PSI A;  4A3I G;  1J5E L;  3NE5 B;  3TME A;  1NTG A;  1XYI A;  4LW1 A;  3I4N G;  1X65 A;  1I4P A;  1TXY A;  4CJ0 B;  5LMU Q;  1BCP B;  1ET9 A;  2NVT B;  4JI1 Q;  3HOW G;  5IGF A;  2E2J H;  3DWA A;  5CV9 A;  4KY7 A;  1V9P A;  1MI2 A;  4K14 A;  3PO2 B;  3KJO A;  1VF5 C;  1VQ8 A;  1A15 A;  1ENC A;  4B9X A;  4JI8 Q;  3K0Y A;  3RZO H;  4JI7 Q;  2WAQ E;  3MXN B;  2EQS A;  2Q2H A;  1PH6 A;  1GOZ A;  4LAA A;  3MZ5 A;  4DV1 Q;  1PH1 A;  5COY A;  2BE5 D;  1N32 Q;  1SJE D;  2AWO A;  3RN2 A;  3Q23 A;  1PTO D;  4DUZ L;  5FLM H;  3K7U C;  1L0X B;  1T5X D;  2K5N A;  4QGU A;  2HDL A;  4KLK A;  1LTB D;  1OXX K;  1VMC A;  2R7Z G;  4DR4 L;  1CZW A;  1IW7 C;  4BY1 B;  1WTV A;  2RSN A;  1STB A;  1K73 C;  3BVG A;  5FK9 C;  5EPJ A;  3KF6 B;  3IFD A;  2A8V A;  2TMP A;  4G7Z C;  4OON A;  4DKA C;  2G5D A;  4IZ8 A;  3CPW A;  3KOJ A;  5COR A;  2A6E D;  3A5Z B;  3FEW X;  1R9T B;  1PRT C;  1HA6 A;  3RD4 A;  4BS9 A;  1EY8 A;  4N8F A;  3DHQ A;  4K0K Q;  2B29 A;  2X69 A;  3OTO L;  4HIK A;  2F0I A;  2XNA C;  1MSH A;  1OXS C;  1A3V A;  3ONA B;  2K5V A;  1XXG A;  1LTT D;  2XWB B;  4P74 A;  1VQA A;  4I7A A;  1WCM G;  4BA1 I;  4XT1 B;  3LWU A;  1AFP A;  1GHK A;  4R8N A;  2B8F A;  5IGC A;  1PVO A;  2VUM G;  4IUU A;  1NMF A;  5DLQ E;  4V19 0;  4DV0 Q;  2D0P A;  3OOC A;  2F0P A;  2XRQ D;  1PTO B;  1K83 H;  5M3F G;  1Q8I A;  1A8V A;  2A6H C;  3SVM A;  5C4X B;  5CV7 A;  1EU3 A;  3L7Z C;  3VR4 A;  4RKL A;  3EA6 A;  3H6M A;  5K5P A;  1GJX A;  2H1E A;  3N52 A;  3K8A A;  2AKW B;  4A3F H;  4EQP A;  3HOY H;  1K8A C;  3H94 A;  1UWV A;  1SNC A;  5LMN W;  4PZ8 A;  2BH2 A;  2PI2 A;  3JAM c;  1D1K A;  1MKH A;  5E4W C;  4F7X A;  4JYA Q;  4QQB X;  1Q90 A;  1KDC A;  5CV6 A;  3GTM H;  2MHV A;  2JXM B;  4DN4 M;  2E75 C;  3J7A F;  4R4Q A;  2B63 B;  4RHS A;  4KV6 A;  2HCC A;  4QL5 A;  5C4H A;  4G4K A;  3BS1 A;  2JA6 H;  1J5E Q;  4KK7 A;  3TP6 A;  4RGN A;  1E2W A;  1L2F A;  2WKD A;  1ESR A;  3WWV A;  1VQ4 A;  5IOC A;  5IP9 H;  1N33 L;  4MZ9 A;  1CI3 M;  2I0Q A;  1GUW A;  1DOK A;  1VCI A;  1Y8N B;  1NY4 A;  3OPO A;  5M5Y B;  1J6Q A;  2ZTC A;  3S1Q B;  3S1N H;  1U4P A;  4BBS B;  3ITP A;  4LF6 L;  3BVM A;  3LX0 A;  1ASZ A;  3HOU G;  5I6Y A;  4V0B A;  3VDY A;  1I50 B;  1K0R A;  2WV6 D;  4C2M B;  1E7Z A;  3AYH B;  4GLA C;  5GQO A;  2SNS A;  2QF7 A;  5IP9 G;  2RDG A;  5JVH 3;  3CCV A;  1IBL Q;  1GHJ A;  5LHY 1;  1KAB A;  3M3Y H;  3J7Z C;  4DUY L;  2NN6 H;  4G7O C;  2YYZ A;  3M7N A;  4ABN A;  1O7I A;  3PIP 3;  3ERS X;  4Z9C B;  4BWG B;  2YTV A;  1SND A;  3EBE A;  4YWK A;  4IPD A;  3QB3 A;  3EN2 A;  1KAA A;  4HIM A;  1K8M A;  2MP1 A;  2UU9 L;  4JBM A;  2EE1 A;  2QDL A;  4X66 Q;  2KCM A;  3Q24 A;  4DV4 L;  4A93 H;  3W2D A;  5ELF A;  1K8O A;  4JI5 L;  1JB3 A;  5JOB A;  4P72 A;  4KHV A;  3V05 A;  2R7Z H;  3BYY B;  1FNV A;  4A3K B;  1GUT A;  2A1A A;  1UEB A;  2JA8 H;  1PH9 A;  1PH7 A;  3DWQ A;  2F0M A;  3K81 C;  1IL8 A;  2VQF L;  3I4M G;  3U4Z A;  1NSN S;  4QUC A;  4QF4 A;  1X56 A;  3HOV G;  3PO3 B;  3L9A X;  2R92 B;  1NBW A;  2HHH L;  5HUR A;  1N36 L;  2RHS B;  1HFG A;  4DR1 Q;  1X6O A;  2R93 H;  5FLX c;  4CDC C;  5EAY A;  4DV0 L;  2PZT A;  4GOP A;  3QG1 A;  3SR1 A;  5JPM C;  5EGT A;  1WTH A;  2A73 B;  1YIJ A;  2B63 G;  1WCM H;  3TZD A;  4DV5 L;  2WIN B;  3HP3 A;  4YY3 Q;  2WP8 J;  3H91 A;  3I7F A;  2YU9 B;  2EYL A;  4A3J H;  1SDF A;  3F2D A;  1PDQ A;  2ZJP A;  2E74 C;  4OWW B;  2CHB D;  4OEM B;  2NVX H;  3TDQ A;  1OTC A;  3CC2 A;  3H0G H;  1JQY D;  1VQB A;  5FLX E;  3KLW A;  4XT3 B;  1SNQ A;  1YNX A;  3K5L A;  4HJ5 A;  3J81 i;  2Z9H A;  4WJ3 M;  4IUR A;  1MBY A;  3I4L A;  1N34 Q;  3BDL A;  1XPO A;  1KIX A;  1TU2 B;  1ZYR C;  2O2L D;  3MXP A;  5GAG C;  4IFD J;  1CT1 D;  2JP1 A;  2AUK A;  4ULL A;  2Z8L A;  1GKH A;  2JA5 B;  5K36 G;  2R61 A;  2NZ1 D;  3NUC A;  2EY6 A;  4IQZ A;  4JYA L;  2I5H A;  4CJ2 C;  4LF8 L;  2XN9 C;  2P5Z X;  4PMB A;  4BY1 G;  1LYL A;  2CQA A;  5J3B A;  2ATW A;  4X64 L;  2WB1 G;  4LFC L;  1IXR A;  1LTI D;  2CQO A;  2BA1 A;  4CJ1 B;  1KDB A;  1N33 Q;  1F2L A;  2XWJ B;  1IBM Q;  4LFB L;  3H3V H;  5C44 H;  1SMY C;  3T53 B;  3KJP A;  3M4Q A;  4DR2 Q;  1WTQ A;  1GUS A;  3FKI H;  2C9O A;  2K05 A;  4GOP B;  3HOZ B;  5EBD A;  3GV3 A;  2KCN A;  5FLX L;  1G29 1;  4DAM A;  2R7Z B;  2UXB L;  4JBK A;  4H13 C;  2JK8 A;  1STG A;  4A3K H;  2QDB A;  2O5J C;  4ODG A;  1V1O A;  1HNZ Q;  2K01 A;  4KKT A;  2B2V A;  3K6O A;  3SDZ A;  3NEN A;  2EYH A;  3SK6 A;  2KVM A;  1SFO H;  1PYB A;  2E5L L;  2Z1C A;  1HR0 Q;  1B9M A;  1F9P A;  1G2S A;  4JI6 Q;  1A2T A;  1PH8 A;  1CKM A;  1SN8 A;  5T1G A;  3J7A V;  1SR3 A;  4OEL B;  2KUM A;  3NXW A;  4ZAI A;  4DPG A;  4EGV A;  1NUC A;  3DLL A;  2LFN A;  2PI2 E;  2WAQ B;  4KY6 A;  2OCE A;  1RCV D;  3K5O A;  2RCF A;  1EYG A;  4N9T A;  3E0E A;  4WFN 3;  4HJ9 A;  2IY5 B;  2IHF A;  2VUM B;  3J81 j;  4AH6 A;  1BF4 A;  4LUZ A;  5BR8 L;  1UE1 A;  5LMN Q;  1IBL L;  3TP7 A;  4RG1 A;  1WFQ A;  4X65 Q;  1EOV A;  1X55 A;  1V8Q A;  4JI1 L;  1EIH A;  1E3P A;  1CZG A;  4LFA Q;  4A3I H;  3S15 H;  2I46 A;  1K0S A;  4N9P A;  5C4X G;  1DZ1 A;  2ZXP A;  1TS2 A;  2PQA B;  1B2T A;  5C3E B;  4HED A;  4GLV B;  2ICI A;  1Y1W B;  1Y1V G;  3ICE A;  4GKK L;  3CD6 A;  5L37 A;  3DEP A;  1Y8P B;  1HCZ A;  1NAP A;  1X3G A;  4EQN A;  2ES2 A;  1QG7 A;  4JV5 Q;  4ID6 A;  4C2M H;  3WDN A;  1ONL A;  2L12 A;  4QIW E;  4C1N I;  2UUA L;  1NE3 A;  1YVC A;  1DYQ A;  1E2V A;  2J0T D;  1HUM A;  1CHP D;  3NTH A;  4U68 A;  1EQQ A;  4BBS H;  2F0V A;  3FRP B;  3D6C A;  1P16 A;  1EIY B;  3PUY A;  2Q8I B;  2HHH Q;  1BBW A;  1KLU D;  2Y0S E;  4JBJ A;  4DR1 L;  2VB3 X;  4J1M A;  4K5V A;  3S1R B;  3ZYY X;  1A62 A;  3ULP A;  2E2H H;  3GTG H;  1Z47 A;  1Y14 B;  4NPS A;  4Y7N B;  1MIU A;  5GAH C;  3BDO A;  3CRK C;  1KL9 A;  3MC0 B;  5DAU A;  5IGG A;  2K5Q A;  1C7Y A;  4CKC A;  2RVL A;  3K7A H;  2M00 A;  1B9N A;  1SYE A;  4EX5 A;  1I4G A;  2L0C A;  1GVP A;  3I73 A;  1HZB A;  5C6A A;  4C3J G;  2RQX A;  2FJ2 A;  2QIL A;  2PNH A;  2ZM6 L;  1N34 L;  3PF4 A;  2B2T C;  2VY3 A;  1N8R C;  2F0F A;  4OL7 A;  4FXG C;  2B2T A;  5M5W H;  1RF2 D;  4HR7 B;  1K28 A;  2AHO B;  2ZXO A;  4LJZ C;  1XNR L;  4K2L A;  4R1J A;  4C56 C;  1PFB A;  4DFA A;  2SEB D;  4GN3 B;  4JI2 L;  5LL6 X;  1U4M A;  1VQ9 A;  1R9T H;  1LT3 D;  2IX1 A;  4R4O A;  1EY0 A;  1UE5 A;  1LM0 A;  1SE2 A;  2QEX A;  3C2P A;  2JA7 G;  2WB1 E;  2JJQ A;  3CC7 A;  1LT5 D;  3KF8 B;  3CCS A;  2KHJ A;  4JI6 L;  2EDG A;  2B39 A;  3I8Z A;  1TS5 A;  3LGJ A;  4K6L A;  4XIG S;  1SNM A;  3T13 A;  2JA8 B;  4A3K G;  4BY7 G;  4NKL A;  5IYD H;  3ERO A;  3T1H L;  5E7N A;  1WJJ A;  5C3E G;  1I50 H;  1TY0 A;  1L1O B;  1IZ6 A;  1K8G A;  3NWS A;  1MSG A;  2ZXR A;  1MHW C;  4IUV A;  2K33 A;  2EIF A;  3WOE A;  1VF7 A;  4OIK A;  4NXM Q;  2R92 G;  1B53 A;  5T1I A;  3S14 B;  1UE6 A;  1T5E A;  3MXU A;  1E24 A;  1A6X A;  1SE8 A;  3S1R H;  1HR0 L;  5C0X J;  1BQQ T;  2Q2I A;  5C4Z A;  5FO8 B;  4IOC A;  4A3B G;  1EQV A;  3HRZ C;  1SEB D;  3CPF A;  1NNX A;  3OW2 A;  2F1M A;  3NTK A;  3PMF A;  1HZ9 A;  4GN5 A;  1G91 A;  3FVQ A;  3PV0 A;  5JEA H;  2JA5 H;  1S5C D;  1EIG A;  1EFW A;  2NZO A;  4LF6 Q;  1MJC A;  1RIP A;  4AIM A;  1H9K A;  4L5T A;  1O80 A;  1SNO A;  4P71 A;  1SNP A;  2KEN A;  2R93 G;  4DR3 Q;  3U50 C;  3Q8D A;  3PCO B;  3I56 A;  1EY6 A;  2LXK A;  4LMQ D;  3D3R A;  4XQJ A;  2X6G A;  4FYD A;  4ZUJ A;  1PLF A;  2EYF A;  2MO1 A;  4F8M A;  3OHX C;  1B3Q A;  2Q2T A;  4LF4 Q;  3EIV A;  3HOZ G;  1E2Z A;  4K2K A;  4EVO A;  5M5W B;  2K6A A;  1F9Q A;  4X3S A;  4BXX H;  4DV3 Q;  3D6W A;  2A69 C;  1CSQ A;  2IWH A;  1JJ2 A;  2ASB A;  1EY9 A;  1W2B A;  1EY7 A;  1HZA A;  3FMC A;  3K80 C;  1XWE A;  4KHP L;  5IYC G;  1VQ7 A;  4YIJ A;  2FHT A;  2K75 A;  3GTM B;  3HZX A;  2F4V L;  3PIP A;  2VB2 X;  1TWF B;  4IUP A;  4L6T B;  1DOM A;  4UHV A;  1VMP A;  4JVZ A;  4GOP C;  1HNW L;  1JWM D;  4UP7 A;  4LF9 Q;  1S5D D;  1D1I A;  1BO0 A;  2WFW A;  2Z4H A;  2A6H D;  3GP7 A;  2XGT A;  3ND8 A;  4B3R Q;  5M5Y H;  2UXD Q;  3PUV A;  2HQL A;  3VR5 A;  3GTJ B;  2MUY A;  1GXD C;  1SSO A;  1YBY A;  1SFO B;  4FF3 A;  3S15 B;  1Q12 A;  4IFD I;  1RKN A;  2A6E C;  3E9H A;  3PQI A;  3R8B A;  3ZJY C;  4XQN A;  4FF2 A;  2QKI C;  1EYD A;  3KLS A;  2NBF A;  2F0Q A;  2NVT H;  1QVF A;  4GZY C;  2IHE A;  2F0G A;  4AYB E;  4RKB A;  1LTA D;  1F2M A;  1XNR Q;  3VR2 A;  2NVY B;  5IWA Q;  5IYC H;  5A2Q L;  1WVL A;  2PMZ E;  1TWA B;  2K5W A;  3MEF A;  3R3O A;  1EEF D;  1B50 A;  3P75 A;  5EJW A;  1CKN B;  1FYC A;  2JEB I;  2ENB A;  4C1N K;  1TT2 A;  1HTP A;  4C3I H;  3C1E A;  5JJI A;  5D3D A;  2AUJ D;  1ESF A;  5TSS A;  3KDF A;  4A3G B;  5JEA J;  3HOV B;  4JI4 Q;  3UE1 A;  3TBI B;  3F1Z A;  1ASY A;  4A3J G;  4EQO A;  1LAC A;  1PA6 A;  1XMQ Q;  3VYS A;  1GD7 A;  1KDA A;  4E6I A;  1R4P B;  3T16 A;  3PIO 3;  1Y69 U;  2G9D A;  5I4D A;  4ALP A;  4DR6 L;  1E22 A;  4YHH L;  3CW2 C;  3LNN A;  3PGZ A;  5CV8 A;  5CMD A;  3Q6S A;  4TQU S;  1QUQ A;  2EXZ A;  1QNU A;  1TWF H;  3J81 c;  2PW5 A;  5FJ8 H;  1F2Y A;  1PXU A;  4DR2 L;  2F0L A;  2E8G A;  4JOI C;  4XQQ A;  2OWO A;  3GV6 A;  2HCI A;  1A3T A;  4JOI A;  1A2U A;  4UDU C;  1Q8K A;  1V1P B;  5C3E H;  4L5R C;  4A4I A;  4APV A;  4BA2 I;  4O0A A;  2NUC A;  1X9N A;  4HCE A;  2GN5 A;  1D5M C;  5C4X H;  5JEA G;  5EBC A;  2JA5 G;  3FKI G;  4QMG A;  2EXD A;  1QVG A;  2A74 C;  1IHZ A;  4ZQ3 A;  3GTL B;  3DWP A;  4L5Q A;  2L4N A;  2BDO A;  4OWX B;  3GD7 A;  2LSS A;  2BDN A;  3T51 B;  3SE0 A;  1IYJ B;  3CCM A;  1VDZ A;  4IUQ A;  3MAQ A;  1HXY D;  3A8K E;  2JYO A;  4FXD A;  2L55 A;  4KY5 A;  1WD0 A;  4DV3 L;  4GN4 B;  3CHB D;  5M5X H;  3U9S A;  3U4V A;  2OXP A;  4EQ5 A;  4A3D G;  2QCP X;  4IN3 A;  5C0X H;  2PQE A;  5BN5 A;  1II3 A;  3KUP A;  4HN7 A;  4CDD C;  4GLX A;  1WOC A;  4B3T Q;  4IAL A;  1CA6 A;  4CKE A;  1YI2 A;  3CKI B;  5IYB G;  4K6D A;  2UUA Q;  2CH4 A;  2B2W C;  3N6R A;  3W1G A;  3VYR A;  4XYQ A;  2AMC B;  3Q22 A;  3TRZ A;  2O5I C;  3S9W A;  1NCV A;  3I4O A;  4KD3 A;  4TVA B;  2SDF A;  2CWA A;  4RGO S;  1N9W A;  4WOR A;  4C3H H;  1PH4 A;  5FKA C;  1D8L A;  3OWE B;  3EFX D;  3ND9 A;  2YTY A;  4WJW A;  5IP7 G;  3GTK B;  4HAE A;  1UUP A;  4DXF A;  4DR5 Q;  1AEX A;  2LMC B;  3G6J B;  3X3N A;  4IOA A;  1W6K A;  1ZXT A;  4X3T A;  1EQT A;  1PZJ D;  5IWA L;  1VQI A;  1IYV A;  4UP9 A;  1EYC A;  2IT1 A;  1AN8 A;  2Q8T A;  2OTL A;  3M4P A;  1EY5 A;  1JOK A;  5D65 A;  4BBR B;  1MGS A;  1PTO C;  5IT9 E;  3AEV A;  1YNJ C;  1LTR D;  2DY8 A;  5M5X B;  3X3M A;  1HUN A;  2DNE A;  2XRS D;  4POF A;  1IYU A;  2B2U C;  2YV5 A;  2F0E A;  3PIO A;  4IUN A;  5KYL A;  1XMQ L;  1KNE A;  1Y1V B;  4HCS A;  4OX9 L;  4A3M B;  3JAM i;  4NXN Q;  2F0U A;  3BZK A;  3BYT B;  2ZT9 C;  3V2T A;  3GTQ B;  3HEJ A;  2XTI A;  4IJL A;  1X3P A;  1STE A;  3RZO B;  4F88 A;  3T1H Q;  2NTT A;  4R8I A;  1VS0 A;  2H4O A;  3J80 c;  1KRT A;  1SYG A;  2X6L A;  2E2I B;  5I2Y A;  3T4A C;  4B3S L;  3S2D B;  1MJE A;  4G57 A;  4DAV A;  4NXM L;  1XJV A;  3M3Y B;  1AZP A;  3A8J E;  3J7A 5;  1D6E C;  1SYF A;  5FJ8 G;  1GM5 A;  5C0X I;  1VQM A;  3MXN A;  2NVY H;  1DCZ A;  3GTK H;  2C5C A;  5J22 A;  1F9R A;  4G7H C;  3CU7 A;  3KYH C;  1L0Y B;  3CXC A;  3VR6 A;  4RA8 A;  3K0X A;  3R2I A;  1I4X A;  3NBH B;  5CGK A;  1WTR A;  1BR9 A;  1JOO A;  1TWH B;  4H7B A;  2E76 C;  2IW3 A;  3KK7 A;  3C1F A;  3NHH A;  1I94 Q;  3HOY B;  3T1Y L;  3FPP A;  4ME5 A;  1PYS B;  3CMA A;  3GTQ H;  1QJO A;  1TS4 A;  4LNQ A;  5EKL A;  3HOV H;  1RD9 D;  2L1B A;  3CAM A;  4HJ7 A;  1QB5 D;  3PO3 G;  5KGU A;  1A63 A;  4BY1 H;  3E6Z X;  1I3Q B;  2FMM A;  4HID A;  1KQS A;  2JA7 B;  5A35 A;  1DXM A;  2BCO A;  3OMG A;  2F0K A;  2MO0 A;  5KND A;  1M1K C;  1Q82 C;  2R6G A;  1PRT F;  1O7Z A;  4BBR G;  5IGB A;  3K57 A;  3P7J A;  2KHI A;  3TS2 A;  3D4R A;  2UU9 Q;  1M90 C;  3M7G A;  5IYB H;  4DR3 L;  4BY7 B;  2KEC A;  3HFZ B;  1FR3 A;  1B1Z A;  1JCK B;  2Z6B A;  3MVV A;  4JK1 C;  4HSV A;  2LY7 A;  2MJ8 A;  4MIU A;  4A3F B;  1CM9 A;  1VQF A;  1X32 A;  4AYB G;  2KQ3 A;  2IJ0 A;  5DEH A;  3HOX H;  1IBK L;  3SK4 A;  1XPU A;  4RHR A;  2JA6 B;  2WKC A;  2Y0S B;  1HHV A;  4ZYS A;  1D2B A;  2KA7 A;  3NBH A;  5DNF A;  4LF5 Q;  2BE5 C;  1WTP A;  5JJZ A;  3FKI B;  4JI8 L;  1SYD A;  3R2T A;  1IW7 D;  5IY0 A;  4M1U B;  2JEA I;  3AFP A;  1VQ5 A;  1LT4 D;  4KJO A;  1L0W A;  4DV1 L;  2WB1 B;  4B08 A;  3I91 A;  4KKS A;  3CCQ A;  1XMO L;  1A0I A;  3I4M H;  3S2D H;  3K5N A;  4DNI A;  5CYU A;  3HOW H;  3HOX G;  5ELB A;  1ET6 A;  4DNT B;  5C4J H;  3OTO Q;  1Q81 C;  4J15 A;  1SLJ A;  3J81 L;  4DGZ A;  1PRT D;  2EPB A;  3CCU A;  2RSO A;  4ILW A;  3HOU B;  5KEE A;  1VQJ A;  1S3O A;  5FLM G;  1WTW A;  2B2U A;  3NPP A;  1QCB D;  1PH5 A;  2OQ0 A;  4A3D B;  4A3E B;  3T56 B;  3NBI A;  1YZ6 A;  5HGT A;  1SRU A;  1QVC A;  4DF7 A;  4IFD H;  3BU2 A;  5KRU A;  1QOH A;  2L9H A;  4O42 A;  1CKN A;  2E2J B;  1CSP A;  1KD1 C;  1TWH H;  4DK0 A;  5GAD C;  2RKS A;  4Y52 H;  3L3O C;  3KDF B;  3I55 A;  1KC8 C;  1TWG H;  1ML0 D;  1UNS A;  4QB4 A;  3RLN A;  2XIW A;  2KBN A;  1ILQ A;  1VQH A;  3OSO A;  4A93 B;  4XYO A;  4MHE A;  4TSS A;  1JJC B;  4CKB A;  1X54 A;  3A0J A;  3M4O B;  3CCE A;  3RUZ A;  2WII B;  4ZK9 B;  4JW0 A;  4CGY B;  3I4N B;  1Y1W H;  4WRD A;  5EPL A;  4HJA A;  5EKI A;  2CWP A;  3SXH A;  1NJI C;  1TKW B;  3OIP A;  5BN3 A;  5G3L D;  4FNF A;  1I4Q A;  1PZK D;  1D5Z C;  3HOW B;  1EWC A;  3U9O A;  3P20 A;  4ZCK A;  3OW7 A;  5IOD A;  4RWS C;  4GKJ Q;  4F87 A;  2KHS A;  3PO2 G;  1PFN A;  5DM6 3;  4IFD G;  3EQL C;  2VUM H;  1H9R A;  1UAP A;  1JOR A;  1YHB A;  1X3F A;  3GTO B;  1TWA H;  3A56 A;  3K7A B;  4IO9 A;  3OIQ A;  1VQL A;  1SYB A;  4LF7 Q;  3G6E A;  3RNU A;  5LL6 S;  5F2D A;  5CV5 A;  4DAY B;  2E5L Q;  3H3V C;  5EKK A;  2MPM A;  1JIC A;  1YEZ A;  2E2H B;  2K04 A;  2Z4I A;  4Q5V A;  1S5F D;  3G48 A;  4KI0 A;  5M3M H;  3A5U A;  2ID0 A;  2F4I A;  1QZG A;  3E5S A;  1QIL A;  2LKV A;  2EOT A;  3A74 A;  5EQ0 A;  3JC6 6;  1XNQ L;  4PMC A;  3A7L A;  4C3H G;  3DM3 A;  1L1O C;  1PTO H;  5KYI A;  4B3T L;  2F0N A;  3DXJ C;  1E1T A;  5G3L F;  2NVQ H;  3BDC A;  3K58 A;  4FF4 A;  4JPB W;  1I4R A;  1TWG B;  2I07 B;  3SK8 A;  4DV7 L;  3J80 i;  4LFA L;  1VQK A;  3S16 H;  4LWC A;  4HJ8 A;  1WI5 A;  2DJF C;  5FO7 B;  1JE4 A;  4X6A H;  1ENF A;  1U0L A;  5ELN A;  5BN4 A;  3W5O A;  3JAM L;  1FGB D;  3RMH A;  1TWC B;  2RDH A;  3CCJ A;  1K3R A;  2M2L A;  2A5H A;  1V1P A;  4AQY L;  1AE2 A;  4L63 B;  4NMZ A;  4DUY Q;  1B44 D;  3QOJ A;  4L5S A;  4ME3 A;  4XXE A;  5M3M B;  1V43 A;  3S17 B;  1OXU A;  3MHB A;  2B63 H;  2K1B A;  4PNY A;  1YHA A;  2RF4 A;  4ZLT F;  1SE4 A;  2A69 D;  2F0T A;  3H3V I;  2F0H A;  3GTO H;  4X66 L;  5JJL A;  2PZW A;  2CVR A;  3KF8 A;  1H9S A;  2CW0 D;  3RZD B;  2UUB L;  1CTM A;  2EJG C;  2N8N A;  3NQT A;  3QO2 A;  5NUC A;  1FD7 D;  1STH A;  3RLF A;  4LF4 L;  2JA7 H;  1Q7Y C;  1BBX C;  4CHT B;  4DUZ Q;  1SXT A;  1QUQ B;  4YY3 L;  1BCP D;  4NP5 A;  2Z6K A;  4JI0 L;  5AJ3 Q;  4HMI A;  3M4Y A;  1WD1 A;  2N49 A;  5CBE E;  2ZTE A;  2ICE C;  2F52 A;  4LK1 C;  1QZH A;  1AZQ A;  1SBB B;  3S14 H;  4GNX C;  2HD3 A;  4JI2 Q;  1EZ8 A;  2WAQ G;  1G2T A;  3F2B A;  3RLO A;  5KNC A;  1YNJ D;  4I65 A;  2JA8 G;  3BZD B;  3QWN A;  4DK3 C; 
#chains in the Genus database with same CATH homology
 3I7F A;  4L5Q A;  4A3J H;  3PUZ A;  4LUV A;  4OWX B;  2F4V Q;  3F2D A;  3GD7 A;  2A19 A;  2LSS A;  2ZJP A;  4QJF A;  4A3B H;  1IYJ B;  2VQE Q;  3CCM A;  4PMW A;  4OWW B;  3UE0 A;  3HKS A;  3RR5 A;  1GO3 E;  4DV5 Q;  1HNW Q;  2NVX H;  1OTC A;  3GTP H;  1JE5 A;  1N32 L;  4K0K L;  3CC2 A;  1C0A A;  3H0G H;  1VQB A;  4B3M L;  4LF9 L;  3KLW A;  3HOZ H;  3PO3 H;  4DV2 L;  1YNX A;  4JI3 L;  4DV3 L;  3STB C;  4GN4 B;  4HJ5 A;  2FXQ A;  5M5X H;  4GKJ L;  3J81 i;  4WJ3 M;  1H95 A;  4LF8 Q;  2RHQ B;  1HZC A;  3U4V A;  1XMO Q;  4EQ5 A;  1XPO A;  1N34 Q;  1KIX A;  4A3D G;  4A3E G;  2UXD L;  1G6P A;  4IFD J;  5GAG C;  1C9O A;  2Q2U A;  3TQY A;  2MFI A;  1GKH A;  2K5H A;  3S24 A;  5K36 G;  2VNU D;  3S17 H;  3CCR A;  4GLX A;  4B3T Q;  1WOC A;  1YHQ A;  4LF7 L;  4JYA L;  2ALY B;  2I5H A;  4LF8 L;  1PH2 A;  1YI2 A;  2R7D A;  3PF5 A;  1XNQ Q;  4LF5 L;  1U5K A;  4BY1 G;  5IYB G;  3CF5 A;  2UUA Q;  1LYL A;  1AH9 A;  5J3B A;  3W1G A;  4DV4 Q;  4X64 L;  2WB1 G;  4LFC L;  2ATW A;  2AMC B;  3TRZ A;  3CQZ H;  1Z9F A;  1IXR A;  3I4O A;  4TVA B;  2CQO A;  2CWA A;  2BA1 A;  1HNX Q;  1X3E A;  1N33 Q;  5JJK A;  1IBM Q;  4LFB L;  3H3V H;  1N9W A;  1YJW A;  5C44 H;  4LUO A;  4C3H H;  1PH4 A;  1I94 L;  2JA6 G;  3KJP A;  3M4Q A;  4DR2 Q;  4B3S Q;  1D8L A;  2N78 A;  1PHJ A;  3FKI H;  2YTY A;  5IP7 G;  2JA9 A;  4H02 A;  4GOP B;  1HNZ L;  4KHZ A;  4JG2 A;  4PZ7 A;  1G29 1;  1JB7 A;  1FJG Q;  1YJN A;  3OYY A;  4DAM A;  4DR5 Q;  4QY7 A;  4LFB Q;  2UXB L;  2BH8 A;  1N36 Q;  4JBK A;  2ZJR A;  2JK8 A;  3PUX A;  4A3K H;  1VQO A;  2JQO A;  2R7F A;  4IOA A;  1G51 A;  4NB3 A;  1JT8 A;  1HNZ Q;  4UPA A;  5IWA L;  1VQI A;  2IX0 A;  2LXJ A;  3NEN A;  4YCV A;  2ZM6 Q;  1SFO H;  1PYB A;  2GVA A;  2BA0 A;  1FVI A;  3PUW A;  4UP9 A;  1HR0 Q;  2E5L L;  2IT1 A;  1EUJ A;  4JI6 Q;  3UDX A;  2OTL A;  3M4P A;  4JBW A;  3S1Q H;  4A3L G;  1VQ6 A;  2K14 A;  4GS3 A;  3UDI A;  4MNO A;  2VQE L;  1CKM A;  1SN8 A;  3NEL A;  1PH8 A;  1SR3 A;  2D62 A;  2VQF Q;  4BY7 H;  4YWL A;  2KCT A;  3DLL A;  4DPG A;  1AE3 A;  1OXV A;  3AEV A;  4KHP Q;  3CC4 A;  1Q1E A;  4UY8 C;  2R92 H;  4B3M Q;  4POF A;  2UXC L;  2PI2 E;  1KHI A;  2YV5 A;  1VQE A;  1JMC A;  2OCE A;  4OO1 G;  3PIO A;  2CCZ A;  1XMQ L;  1EYG A;  2N3S A;  1Y1V H;  3E0E A;  2K4K A;  2V1C C;  3IRB A;  4HJ9 A;  4PZ6 A;  2L15 A;  2IY5 B;  2IHF A;  4OX9 L;  3JAM i;  4IPH A;  3J81 j;  4AH6 A;  4NXN Q;  1BBU A;  3BZK A;  4LUZ A;  5BR8 L;  1UE1 A;  5H1S E;  4X62 Q;  3ULL A;  2B3G A;  4RG1 A;  1WFQ A;  5C0X G;  5LMN Q;  1IBL L;  2I5L X;  3STB D;  2K52 A;  4X65 Q;  2YU9 H;  4DR4 Q;  3S2H H;  4P75 A;  1OXT A;  1EOV A;  1X55 A;  4DV6 Q;  4Y7N H;  4A93 G;  4JCV E;  2XTI A;  4JI1 L;  3M85 A;  4DR7 L;  1FGU A;  4IJL A;  1HR0 W;  1JJG A;  3NEM A;  2Y0S G;  2UUB Q;  1E3P A;  4B3R L;  4LFA Q;  4A3I H;  3S15 H;  3KF6 A;  3T1H Q;  2MNA A;  1NMG A;  1Q1B A;  4X65 L;  5C4X G;  1VS0 A;  3GO5 A;  3I4N H;  3J80 c;  3TEH B;  2PQA B;  1KRT A;  2UXC Q;  1S72 A;  4B3S L;  3GTL H;  1MJE A;  2RCN A;  4NXM L;  1XJV A;  4GLV B;  3W1B A;  1KXL A;  5IP7 H;  1Y1V G;  3ICE A;  4GKK L;  3CD6 A;  3SGI A;  1BKB A;  3J7A 5;  5IE8 A;  1X3G A;  5FJ8 G;  2ES2 A;  1GM5 A;  1WYD A;  2DGY A;  5C0X I;  2MQH A;  1VQM A;  4JV5 Q;  4DV7 Q;  3M4O H;  2NVY H;  4C2M H;  3GTK H;  5GRO A;  1KAW A;  1T9H A;  2HIX A;  4QIW E;  4YWM A;  3KYH C;  2UUA L;  1NE3 A;  1YVC A;  4GNX A;  5M3M G;  1I3Q H;  1P8L A;  3CXC A;  1EQQ A;  4OO1 I;  1YIT A;  4FDB A;  3UDG A;  2I5M X;  4BBS H;  4A3L H;  3K0X A;  4R4T A;  1PV4 A;  1P16 A;  1EIY B;  3NBH B;  3PUY A;  5HY6 A;  3AFQ A;  2GVB A;  4IJH A;  3ER0 A;  5AJ3 L;  2HHH Q;  1BBW A;  2Y0S E;  1I94 Q;  4BXX G;  3T1Y L;  3GTJ H;  2PQA A;  2UUC L;  1YJ9 A;  4JBJ A;  4DR1 L;  4C3J H;  4HIO A;  1PYS B;  5IT9 c;  3CMA A;  3GTQ H;  4LNQ A;  3HOV H;  4OWT B;  1BVS A;  4YHH Q;  1A62 A;  3ULP A;  2E2H H;  3GTG H;  3CAM A;  4HJ7 A;  3FHW A;  3H15 A;  2UXB Q;  1Z47 A;  1Y14 B;  3T1Y Q;  1EIF A;  4YCW A;  3PO3 G;  4RMF A;  3UDF A;  4NPS A;  1K9M C;  1MIU A;  5GAH C;  4JI5 Q;  1I6H H;  1KL9 A;  4BY1 H;  1A63 A;  3PSI A;  2OQK A;  4A3I G;  1J5E L;  1C7Y A;  4HID A;  2YTX A;  1KQS A;  4DR5 L;  2CKZ B;  1NTG A;  3K7A H;  1CKO A;  4LW1 A;  3I4N G;  2MO0 A;  4EX5 A;  1M1K C;  3RZD H;  1X65 A;  2R6G A;  4BBR G;  1EQR A;  1TXY A;  2VW9 A;  1GVP A;  1Q82 C;  1HZB A;  5LMU Q;  4DV2 Q;  2KHI A;  3TS2 A;  4DV6 L;  4JI1 Q;  2UU9 Q;  4DR7 Q;  1M90 C;  5IYB H;  4DR3 L;  2AWN A;  2PNH A;  3HOW G;  3HFZ B;  2E2J H;  4O2D A;  2ZM6 L;  1N34 L;  3PF4 A;  1DGS A;  1V9P A;  2VY3 A;  1N8R C;  3S1M H;  1TWC H;  3KJO A;  5M5W H;  1VQF A;  2AHO B;  4AYB G;  1VQ8 A;  1XNR L;  4R1J A;  4A3D H;  1SRO A;  1Q46 A;  2JE6 I;  4GN3 B;  4JI2 L;  4JI8 Q;  3RZO H;  2VZA A;  4JI7 Q;  1VQ9 A;  2HT1 A;  1R9T H;  2IX1 A;  3HOX H;  2WAQ E;  3MXN B;  4R4O A;  2EQS A;  3RN5 A;  1IBK L;  1UE5 A;  1LM0 A;  2QEX A;  2Q2H A;  1PH6 A;  1XPU A;  2JA7 G;  2WB1 E;  2JJQ A;  3CC7 A;  4DV1 Q;  1PH1 A;  2OTJ A;  3G4S A;  4IPC A;  1N32 Q;  4LF5 Q;  2AWO A;  3KF8 B;  4DUZ L;  3CCS A;  2KHJ A;  3RN2 A;  2VS1 A;  5FLM H;  4JI6 L;  1V1Q A;  3K7U C;  4X64 Q;  4JI8 L;  3LGJ A;  2K5N A;  4QGU A;  1VQN A;  4KLK A;  4XIG S;  5IY0 A;  2JEA I;  1OXX K;  4A3K G;  2R7Z G;  4BY7 G;  4DR4 L;  2QA4 A;  5IYD H;  3AFP A;  1VQ5 A;  3T1H L;  5E7N A;  1L0W A;  1WJJ A;  5C3E G;  4DV1 L;  4OXP A;  1K73 C;  1I50 H;  1IBM L;  3KF6 B;  2A8V A;  1Y1W G;  1FJG L;  3CCQ A;  1XMO L;  1A0I A;  3I4M H;  4A3F G;  1L1O B;  1IZ6 A;  4DNI A;  1K8G A;  3S2D H;  3M9B A;  4OON A;  1SMX A;  2CFM A;  3HOW H;  4DKA C;  5GAE C;  1B8A A;  3HOX G;  2EIF A;  5C4J H;  3OTO Q;  1Q81 C;  4J15 A;  4UP8 A;  1SLJ A;  4NXM Q;  3CPW A;  3KOJ A;  2R92 G;  4IPG A;  3A5Z B;  3HKZ G;  3CCU A;  1UE6 A;  1VQJ A;  4MTN A;  1PFS A;  1S3O A;  5FLM G;  1E24 A;  1SE8 A;  1PH5 A;  2OQ0 A;  4K0K Q;  3S1R H;  1HR0 L;  5C0X J;  1L1O A;  1YZ6 A;  4IOC A;  2Q2I A;  1E1O A;  2B29 A;  3OTO L;  4A3B G;  1SRU A;  3CPF A;  4HIK A;  1QVC A;  3OW2 A;  3BU2 A;  1OXS C;  1UE7 A;  1CKN A;  1HZ9 A;  4GN5 A;  3PV0 A;  1Q86 C;  2H5X A;  1CSP A;  2JA5 H;  2F3I A;  2K5V A;  1KD1 C;  3F2C A;  1TWH H;  4P74 A;  1EFW A;  4A3C H;  1VQA A;  1WCM G;  2NZO A;  4BA1 I;  5GAD C;  4LF6 Q;  1MJC A;  4Y52 H;  1RIP A;  3KDF B;  5LMU L;  4AIM A;  4L5T A;  3I55 A;  4JC0 A;  1PVO A;  1RL2 A;  4P71 A;  1TWG H;  4A3M G;  1KC8 C;  2Z0S A;  1NMF A;  2KEN A;  5DLQ E;  2VUM G;  4A3G G;  2R93 G;  4DR3 Q;  4DV0 Q;  3U50 C;  3Q8D A;  3RLN A;  3PCO B;  3AQQ A;  3I56 A;  4A75 A;  2D0P A;  2KBN A;  1VQH A;  2LXK A;  4A76 A;  1JJC B;  1X54 A;  3A0J A;  3CCE A;  2HIV A;  1K83 H;  2MO1 A;  2Q2T A;  5M3F G;  4LF4 Q;  1A8V A;  1Y1W H;  3EIV A;  3HOZ G;  4HJA A;  2CWP A;  5C44 G;  1NJI C;  3I2Z A;  3L7Z C;  4JI7 L;  2NN6 G;  3TRE A;  4BXX H;  3E9I A;  4AQY Q;  4DV3 Q;  4JI3 Q;  3K8A A;  2AKW B;  4A3F H;  3FP9 A;  1VQD A;  1HNX L;  1XTD A;  3TS0 A;  4GKJ Q;  3HOY H;  4JI0 Q;  1CSQ A;  1K8A C;  1JJ2 A;  1UWV A;  1FL0 A;  2ASB A;  3PO2 G;  1W2B A;  5LMN W;  1HZA A;  4IFD G;  4PZ8 A;  4POG A;  2BH2 A;  1B70 B;  3K80 C;  1PH3 A;  4A3M H;  2VUM H;  4KHP L;  5IYC G;  1KRS A;  1VQ7 A;  2UUC Q;  1YHB A;  2K75 A;  4BBS G;  2F4V L;  2PI2 A;  3PIP A;  1X3F A;  3JAM c;  1TWA H;  2ZTD A;  1MKH A;  4YCU A;  4IO9 A;  1XPR A;  1VQL A;  4OX9 Q;  4LF7 Q;  4JYA Q;  4GOP C;  4QQB X;  3G6E A;  1HNW L;  3D0F A;  3GTM H;  3RNU A;  4UP7 A;  4DAY B;  2E5L Q;  4LF9 Q;  2Z6K C;  4R4Q A;  4GKK Q;  4QL5 A;  1YEZ A;  2WFW A;  5BR8 Q;  5LMN L;  2JA6 H;  1J5E Q;  3G48 A;  4KI0 A;  3A5U A;  4P73 A;  4R4I A;  5M3M H;  1L2F A;  2XGT A;  1IL2 A;  4JV5 L;  2ID0 A;  4B3R Q;  5M5Y H;  5ELO A;  3WWV A;  1VQ4 A;  3PUV A;  5IP9 H;  1QZG A;  1N33 L;  4MZ9 A;  2I0Q A;  2HQL A;  2E2I H;  1B7Y B;  2D0O A;  1YBY A;  1IBK Q;  5M3F H;  1Q12 A;  1VCI A;  4IFD I;  1NY4 A;  5HGQ A;  1J6Q A;  3A74 A;  3E9H A;  2ZTC A;  3ZJY C;  1VQG A;  3G71 A;  3S1N H;  3JC6 6;  1XNQ L;  2NVT H;  1QVF A;  3DM3 A;  2IHE A;  4LF6 L;  1L1O C;  2VL6 A;  4NXN L;  1VQP A;  4AYB E;  3D31 A;  4LFC Q;  4B3T L;  1ASZ A;  1E1T A;  3HOU G;  2NZH A;  3VDY A;  2NVQ H;  3KFU A;  2UXD Q;  1XNR Q;  1K0R A;  3BZC A;  5IYC H;  5IWA Q;  1E7Z A;  3AYH B;  4GLA C;  2PMZ E;  5GQO A;  3HOY G;  5IP9 G;  2ZJQ A;  4DV7 L;  3CCV A;  3MEF A;  4X62 L;  1IBL Q;  4JI4 L;  3J80 i;  3M3Y H;  3BJU A;  3J7Z C;  4LFA L;  1VQK A;  1CKN B;  3S16 H;  4LWC A;  2JEB I;  4HJ8 A;  4DUY L;  1VQC A;  1I5F A;  1WI5 A;  2YYZ A;  3M7N A;  4X6A H;  1O7I A;  1W3S A;  3ERS X;  4C3I H;  1U0L A;  5ELN A;  5JJI A;  3W5O A;  2DUD A;  1D7Q A;  2YTV A;  3EBE A;  1LUZ A;  1S40 A;  4YWK A;  3KDF A;  5JEA J;  3CCJ A;  4JI4 Q;  1K3R A;  3L0O A;  1CUK A;  4IPD A;  3UE1 A;  4DR6 Q;  1EWI A;  3EN2 A;  4BBR H;  3F1Z A;  3CME A;  4AQY L;  1AE2 A;  4DUY Q;  1ASY A;  4HIM A;  3U58 A;  4L5S A;  4A3J G;  4ME3 A;  2UU9 L;  3L2P A;  4JBM A;  4XTC S;  1PA6 A;  4PG3 A;  1V43 A;  1XMQ Q;  1GD7 A;  3CP0 A;  3H0G G;  4X66 Q;  2KCM A;  3PO2 H;  1OXU A;  2B63 H;  4ALP A;  4L5R C;  4DR6 L;  5IYD G;  1E22 A;  4DV4 L;  4A93 H;  4JI5 L;  4YHH L;  3CW2 C;  1YHA A;  2RF4 A;  4P72 A;  3PGZ A;  1HH2 P;  3B6Y A;  2R7Z H;  3H3V I;  4TQU S;  1QUQ A;  2K50 A;  1TWF H;  3GTO H;  4X66 L;  5JJL A;  3J81 c;  2A1A A;  1UEB A;  5FJ8 H;  2JA8 H;  1PH9 A;  2NN6 I;  4DR2 L;  1PH7 A;  2UUB L;  2E8G A;  2N8N A;  4JOI C;  4DK6 C;  3K81 C;  2OWO A;  2VQF L;  3RLF A;  2JA7 H;  3U4Z A;  3I4M G;  4JOI A;  4LF4 L;  1Q7Y C;  1X56 A;  1Q8K A;  4DUZ Q;  3HOV G;  4WJ4 A;  1LTL A;  1QUQ B;  4R4C A;  4YY3 L;  5C3E H;  1NBW A;  2C35 B;  2Z6K A;  3HKZ E;  4A4I A;  3F8T A;  5AJ3 Q;  2HHH L;  4JI0 L;  2N49 A;  3ULJ A;  4APV A;  4A3E H;  1N36 L;  4O0A A;  4BA2 I;  2RHS B;  2ZTE A;  2R93 H;  3GDE A;  1X6O A;  4DR1 Q;  1X9N A;  2F52 A;  5FLX c;  2GN5 A;  2QGQ A;  5C4X H;  1QZH A;  5EAY A;  4DV0 L;  4GOP A;  3HOU H;  3S14 H;  4GNX C;  5JEA G;  1HJP A;  2JA5 G;  4A3C G;  4JI2 Q;  3FKI G;  4GNX B;  2WAQ G;  2EXD A;  3F2B A;  1YIJ A;  1WCM H;  4DV5 L;  1QVG A;  3RLO A;  2B63 G;  4YY3 Q;  3CCL A;  2JA8 G;  4A3G H;  2WP8 J;  4DK3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...