4LF7Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
101
structure length
101
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 20
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lf7Q00
3M9BA 1TWGH 2R6GA 3RR5A 3D0FA 2WAQE 1IXRA 4LUZA 5IYDH 1PH8A 4R4CA 3I55A 3G4SA 1SFOH 2EIFA 1D7QA 1YJWA 3PO3G 4JI8Q 1PVOA 1PH2A 3S14H 2ZJPA 4A3BH 3CCVA 3ULJA 3RN2A 2JK8A 4JI3L 2VW9A 3ER0A 4A3LG 4KHPL 5C0XG 5HY6A 1EQQA 2XGTA 4HJ5A 4A75A 3MEFA 2VQFL 4A3DH 2K4KA 4LFCL 2YTXA 4A3KG 3AFQA 5IT9c 2IHEA 1VQ4A 4APVA 2JA8G 2D62A 1Q86C 2R7ZH 5FJ8H 3KF6A 4JI4Q 4BA1I 3S17H 1VQ6A 1WFQA 4IJHA 1N32Q 3I56A 1UWVA 1YHBA 4LWCA 3ZJYC 4B3RQ 1YVCA 2EQSA 4GOPA 1TWFH 2JA5G 2ALYB 4FDBA 4HIDA 2IY5B 1LYLA 1BBWA 5IP7H 2B3GA 2R92H 1L0WA 2L15A 3T1HL 4C3IH 4LFBL 2Q2TA 1YHQA 3MXNB 5EAYA 3GO5A 5BR8L 3RLNA 4JI6L 4DV4L 1XPRA 2E5LL 2YU9H 2OWOA 3I4NG 4BBSG 4LF4Q 5M3MH 1K73C 2E8GA 1VQDA 3F2CA 2HQLA 5K36G 1PHJA 4HJAA 3L0OA 5AJ3L 4L5SA 1SRUA 3PUWA 3HOUG 4DV1Q 1HNWL 1E7ZA 2VUMG 2UXDL 1X3EA 4OX9L 1VQ7A 4MZ9A 3HOVH 2VZAA 1K83H 1EOVA 1GO3E 2ID0A 1Q7YC 2Z6KC 3U4VA 2HIXA 4DK3C 4XIGS 4A3EH 1Q82C 3U50C 3W5OA 1X9NA 3CQZH 3STBC 4IFDI 2I5MX 4P71A 1I94L 2IX0A 2AWNA 3T1HQ 1QZHA 3I4OA 1JJ2A 2HHHQ 1FJGQ 1P8LA 4OONA 1S72A 2NVXH 2UUAQ 2B63G 3HOXG 4JV5L 3H15A 1K0RA 4A3MG 3J80c 3ULPA 1P16A 5M5WH 4DV4Q 1J5EL 1KQSA 2E5LQ 4BY1H 1X6OA 2GVAA 1XNRQ 1Q1BA 4JI1L 2JA7G 3HOWG 1N33Q 3UE0A 5FLMG 3J81j 1N36Q 1HNZL 5C44G 4L5QA 1MKHA 2GN5A 5GAEC 1OXSC 5JJLA 4GNXC 1EQRA 2WB1G 1U5KA 1Z47A 1I50H 4OX9Q 5JJIA 1YZ6A 3G6EA 4DR4L 1QVCA 3AEVA 3NENA 2JA6G 3W1GA 2V1CC 2K5NA 3H0GG 4DV2L 4DUZQ 4DK6C 4QY7A 1HNXL 4K0KQ 3CW2C 4BXXG 5IP9G 1I5FA 3ULLA 1IBKL 1HZBA 4DR6Q 3NELA 1CKNB 4OWXB 4X66Q 2B29A 4JI1Q 4DV0Q 4B3MQ 4DPGA 1Q81C 1HNZQ 3A5ZB 1C9OA 5LMNW 1UE6A 4DUYQ 3HOZG 4GLAC 4JI5L 1PV4A 1WJJA 1X65A 1W3SA 1PYBA 3FKIG 1K8AC 2JA9A 1N34L 4X6AH 4JI0Q 1PH9A 4DR4Q 4IJLA 5IY0A 3G71A 4LF8Q 1JB7A 2MO0A 2VS1A 2KHIA 3NBHB 4AYBG 1X56A 2PI2A 5IYDG 1X54A 1S3OA 2QGQA 5C4JH 4GOPB 2VQEL 1HNXQ 5LMUL 4O0AA 2Q2UA 1Q12A 1XNQL 2VNUD 1VQIA 1XMQL 1QZGA 4A3BG 1VQ9A 3K0XA 3S15H 2NVTH 4C3HH 1HR0W 1Q1EA 3S1NH 1OXVA 3CAMA 3DLLA 2PQAB 4A3DG 2H5XA 2BA0A 3A74A 5J3BA 4DR1Q 3U4ZA 4BBRG 4DV5Q 2R7ZG 1NTGA 3F1ZA 4LUOA 1VQBA 5FJ8G 5C0XI 2A8VA 3PCOB 2UU9L 1IL2A 4GKJL 1ASYA 1CKNA 1N34Q 2Z0SA 1Q46A 3PGZA 4JI7Q 3GTQH 5GROA 5ELOA 3OTOL 3L7ZC 1MIUA 4Y52H 1XPUA 1TWAH 3AFPA 4IPGA 2BH2A 2Y0SG 5IP7G 2ZJRA 2C35B 3EIVA 4R1JA 2R92G 4DV6L 4P73A 3PIOA 3S1MH 4GN4B 3KF8B 3E9HA 3HKZE 3KDFB 2NZOA 4JI2Q 4DAMA 1W2BA 4B3TL 1K9MC 4UP8A 3CPWA 1E24A 2ATWA 1WYDA 4HJ7A 1IBLQ 1O7IA 5M3MG 4X62Q 3TS0A 4BA2I 1VQCA 1FGUA 1IZ6A 3L2PA 1VQPA 1PA6A 2EXDA 4B3SL 2CWPA 4PG3A 1G6PA 4Y7NH 2R7FA 4A3IH 4JG2A 1JJCB 4JBKA 1V1QA 2WFWA 4YY3L 1N8RC 4YCUA 1Q8KA 5IYCH 2MFIA 3TREA 1T9HA 5FLXc 3HOVG 2RCNA 4OO1I 4A3EG 2PQAA 4JI3Q 4KHPQ 1CKMA 2MNAA 2YTYA 4DR2L 1UE1A 3S1QH 1PH6A 3VDYA 1Y1VH 2NVQH 2VQFQ 4LFCQ 1XPOA 2CWAA 4L5RC 2GVBA 2E2JH 3PO3H 3KJPA 3D31A 4POFA 1VQNA 2K75A 4AQYL 4DR5L 4BY1G 3UE1A 5GQOA 2K52A 1E22A 1A0IA 3NEMA 1VQMA 1CKOA 2KHJA 4B3SQ 3PSIA 2WB1E 4KI0A 1KD1C 3GTLH 3CCEA 5C4XH 1VQ8A 2JE6I 3KDFA 3OYYA 5M3FG 4NXNL 5DLQE 3BU2A 4DV3L 4LFBQ 5C0XJ 2ASBA 1NJIC 2N3SA 1X3GA 4DV7L 1EWIA 1GVPA 2MO1A 5JEAJ 4JBWA 3CC2A 4JYAL 2WP8J 5BR8Q 5LMNL 4JI6Q 1VQKA 4NXML 3CCSA 3T1YL 2YTVA 5M5XH 1KXLA 2K5HA 2CCZA 4GLXA 2NN6G 4GLVB 1FL0A 2JJQA 4X65L 2OQKA 3TRZA 5AJ3Q 4LFAL 2MQHA 1L2FA 4HIKA 1KRSA 4IOCA 1HNWQ 1NMFA 4GN5A 1Y1WH 1IBML 4P75A 1E3PA 2UXDQ 1S40A 4LF9L 3RZDH 3FP9A 4YWKA 3GD7A 1L1OC 4XTCS 4LF5L 2ZTEA 2PI2E 1M1KC 3M4OH 3K80C 5IYBH 1QVFA 4JC0A 3FHWA 4A3FG 1E1TA 2BA1A 5M5YH 1XMOL 1BBUA 4OWWB 3HOUH 1I94Q 2K14A 2N8NA 1HR0L 2I5LX 1AH9A 3UDXA 4UP9A 1OXTA 3ICEA 4IFDG 3CCQA 4JV5Q 3PUVA 3PO2H 4QQBX 1QVGA 4OXPA 1VQGA 3J7ZC 5LMNQ 1G291 2FXQA 1AE3A 3F8TA 4AYBE 1J5EQ 2LXJA 2UUCL 2IX1A 2YV5A 3RN5A 4DNIA 4GKKL 1UEBA 1YBYA 3KYHC 3LGJA 2RHQB 4RMFA 4X65Q 3CCLA 4BY7H 4IOAA 4NB3A 4X64L 4LFAQ 3J7A5 4AIMA 1ASZA 4A3GH 2BH8A 4MTNA 1IBMQ 3I4MH 5C3EG 1YHAA 3WWVA 3CCJA 4UPAA 3M7NA 3K8AA 4LF5Q 3TQYA 3HOYH 4QL5A 1WOCA 4DKAC 4WJ3M 4GNXB 2JA8H 4JBJA 1QUQB 1VQJA 1EUJA 4IPCA 4DV2Q 1GM5A 4RG1A 1TWHH 1SR3A 3CMEA 1JT8A 2ZM6L 1YJ9A 1WCMH 1C0AA 3PF4A 1IBKQ 3CCMA 1YJNA 3F2BA 2UUCQ 2CKZB 1I6HH 2Z6KA 2NZHA 4HJ8A 1CUKA 4X64Q 1M90C 5HGQA 2CFMA 3A5UA 4JI8L 1I3QH 4JI5Q 4O2DA 1XJVA 3J81i 3RNUA 4KHZA 4P72A 2ZTDA 2E2IH 4A3JH 4UY8C 1RIPA 1J6QA 2E2HH 3IRBA 2OQ0A 4EQ5A 3A0JA 3AQQA 3HFZB 4A3IG 2VY3A 4PZ6A 3GTJH 3PUZA 2VQEQ 3I7FA 4JI4L 3KFUA 1PFSA 3SGIA 5LMUQ 5IYCG 3JC66 1XNQQ 4DR7L 1XMQQ 4LW1A 2A1AA 3EN2A 4ME3A 1PH7A 3M4QA 4B3RL 4IPDA 4GNXA 3CD6A 2QA4A 4TVAB 5GAHC 3KJOA 2ZJQA 2ES2A 1GKHA 3TEHB 2K5VA 3UDFA 1DGSA 1QUQA 4YCWA 1Y1VG 4A3CH 1Y14B 3CC7A 1A62A 3GTGH 1HZCA 1SE8A 4GN3B 4OWTB 4JOIC 3JAMi 3GTKH 3EBEA 3G48A 4GKJQ 3CCUA 1KHIA 4LF6L 1JE5A 1VQAA 3UDIA 3W1BA 2UU9Q 2D0OA 4PZ7A 3M3YH 1EFWA 3OTOQ 2RHSB 5JEAG 4A93H 1SROA 2KBNA 4A4IA 2N49A 1NY4A 4C3JH 4LF4L 2N78A 1OXUA 4A76A 1EIYB 1MJCA 1EYGA 5C4XG 4BBRH 2JQOA 4HJ9A 1N32L 2KENA 4DAYB 4DV1L 4DV6Q 1B7YB 1KAWA 1MJEA 2R7DA 4MNOA 4DR7Q 2WAQG 4R4QA 3K7AH 2UUBL 1TXYA 4NPSA 2F52A 4B3TQ 1KIXA 2D0PA 4A3LH 1FVIA 3S1RH 5GADC 3S16H 1YIJA 1PH1A 2HIVA 3RLOA 2HHHL 1FJGL 4A3KH 1LTLA 2DGYA 2IT1A 3DM3A 2UUAL 4HIOA 2UXCL 1E1OA 2ZTCA 3GTOH 1LM0A 2LSSA 1IYJB 2I5HA 4QGUA 1D8LA 1Y1WG 4YY3Q 4LF6Q 1X3FA 1XNRL 2JEAI 1BVSA 3HKZG 1V9PA 2NN6I 1CSPA 3K7UC 5IYBG 2I0QA 4YHHL 2VL6A 1N33L 4OO1G 2Q2IA 4DR2Q 2JA5H 3I2ZA 5E7NA 1N36L 2F4VL 1SMXA 2K50A 1PH3A 4LF7L 1PH5A 1TWCH 2AHOB 1JMCA 1PYSB 3GDEA 1NE3A 3CC4A 1SLJA 3KLWA 2UUBQ 3PO2G 2PMZE 4AQYQ 4DR5Q 2UXBL 1G51A 2CQOA 2A19A 4R4IA 1SN8A 1U0LA 3PUXA 2KCMA 3J81c 2KCTA 2OCEA 1X55A 3I4NH 4BBSH 4QIWE 3H3VI 4DUZL 4BY7G 1OTCA 1WI5A 3K81C 1BKBA 4K0KL 1Z9FA 2UXCQ 3B6YA 4JCVE 1A8VA 2AKWB 3CMAA 4IO9A 3STBD 4A3GG 3I4MG 4NXNQ 5IWAL 2VUMH 4DR6L 4DV3Q 1YNXA 4EX5A 4X66L 4DV7Q 1RL2A 3HOYG 1N9WA 2OTLA 4WJ4A 3U58A 4DV0L 1HZ9A 4B3ML 4JYAQ 4JBMA 4YHHQ 4LNQA 4NXMQ 1VQFA 4YWMA 1HH2P 3CPFA 3F2DA 3T1YQ 4P74A 2F4VQ 1HJPA 4DUYL 3RLFA 4DR3L 4LF7Q 3BZKA 3CF5A 5M3FH 1CSQA 5GAGC 5H1SE 2B63H 1WCMG 4QJFA 3HOXH 3GTPH 3Q8DA 3KOJA 1OXXK 4JOIA 3TS2A 4JI0L 2UXBQ 3S2HH 3PIPA 4A3MH 4GOPC 3JAMc 4LF9Q 3PUYA 1NBWA 4LF8L 1LUZA 4YWLA 2JA7H 3HOWH 1XTDA 2R93H 4AH6A 5FLMH 1PH4A 1YITA 1L1OB 1HZAA 5C44H 1XMOQ 1VQ5A 3E0EA 1R9TH 1HR0Q 5IWAQ 1KRTA 1NMGA 3S24A 1A63A 4A3JG 2JEBI 4UP7A 2OTJA 3CCRA 5IE8A 4YCVA 2LXKA 1VQOA 1YI2A 2Y0SE 3S2DH 5JJKA 4A3FH 3BJUA 4IPHA 1VQHA 4R4OA 3RZOH 4PMWA 2JA6H 4DR3Q 4GKKQ 3H0GH 4DR1L 3CXCA 4DV5L 1K3RA 3M85A 3CP0A 4R4TA 2IHFA 3H3VH 1JJGA 3M4PA 2NVYH 5IP9H 4JI7L 4BXXH 1UE5A 3KF6B 4C2MH 2RF4A 2R93G 1K8GA 5ELNA 2XTIA 4GS3A 1KL9A 1KC8C 3PF5A 1EIFA 4PZ8A 2HT1A 3GTMH 4A3CG 4ALPA 4IFDJ 3UDGA 3HKSA 1H95A 4HIMA 4LUVA 1V43A 3J80i 1B70B 2DUDA 3E9IA 1YEZA 2Q2HA 4J15A 3OW2A 2YYZA 4POGA 3HOZH 3ERSX 3PV0A 4L5TA 1GD7A 2F3IA 4KLKA 5C3EH 1VQEA 2ZM6Q 4JI2L 1C7YA 1VS0A 3FKIH 4H02A 1IBLL 4A93G 1UE7A 1B8AA 2AMCB 4X62L 2AWOA 3BZCA 3AYHB 1VCIA 2PNHA 2QEXA 1AE2A 4TQUS 1VQLA 1L1OA
chains in the Genus database with same CATH superfamily
3M9BA 3RR5A 3D0FA 2WAQE 4IALA 2ZXRA 4K14A 5I6WA 1D5XC 4PV1C 3PO3G 2ZXPA 4RGOS 3S14H 1W6KA 2K03A 2RCFA 1Y1WB 4A3LG 1TY0A 4J1MA 2CVRA 2XGTA 3RZDB 1AEXA 3HKZB 1ILQA 3MEFA 4A3DH 4LFCL 2D62A 2R7ZH 3KF6A 5I2YA 3HOUB 3DEPA 3HRZC 1N32Q 3I56A 4B3RQ 4MIUA 2EQSA 3E0JA 1ESRA 1H9KA 1BBXC 3ITPA 2L15A 1L0WA 3VA7A 2K6AA 4LFBL 1Q3LA 4JPBW 1STNA 3GO5A 4K5VA 2KCCA 3DWQA 3FMCA 3VR2A 3I4NG 4BBSG 4LF4Q 3V05A 5K36G 1S4ZA 1HNWL 2VUMG 2EY2A 4C1NI 3NXWA 1TWHB 4OX9L 2B8FA 3C3LA 1PTOH 3TP5A 2Z6KC 4DK3C 4A3EH 1K8MA 1SYEA 1X9NA 3STBC 1QNKA 2I5MX 4IFDI 5FKAC 1BOSA 4OONA 2UUAQ 2NVXH 4JV5L 3HEJA 4DXFA 4A3MG 4C2MB 1J5EL 1KQSA 3IFTA 1D1IA 2GVAA 1HFNA 4A3JB 4JI1L 2JA7G 2NYZD 3FVQA 1N33Q 1WVLA 4L5QA 1HA5A 1MKHA 2GN5A 2Z9HA 1SAPA 1OXSC 3SK8A 1WTVA 1EQRA 5JJLA 1PZKD 5BN5A 3OWEB 3OOCA 1FYCA 2WINB 4DR4L 1QVCA 3MXUA 2L1BA 5JAVA 5EKIA 3NENA 3W1GA 3J7AV 2RSOA 5CORA 1QILA 3NE5B 4DN4M 1IBKL 3EVQA 1HZBA 1VMCA 3GTKB 1LT3D 4X66Q 1QJOA 1Q81C 1LABA 1C9OA 5C3WA 3L9AX 1SNPA 4C3JB 1UE6A 4RAUC 4JI5L 1X65A 2Z6BA 4IFDH 2PZWA 1SYCA 1K8AC 2JA9A 4X6AH 4R9WA 4JI0Q 2F0TA 4IJLA 5IY0A 3OMGA 2PZUA 1ZKOA 2G5DA 2MO0A 1JQYD 3BDLA 1SYDA 2ICIA 4GOPB 5C4JH 2L5TA 3ONAB 4QB4A 2VNUD 1VQIA 2C9OA 1CQVA 4NMZA 5EBCA 1VQ9A 4A3BG 3S15H 2H1EA 2NVTH 3G7LA 4C3HH 3MXGA 1QNUA 1BNZA 2BA0A 4RWSC 2JA5B 1I4GA 3IFDA 1MHWC 3U4ZA 3AMUA 4LUOA 1DJRD 3I72A 1K3BC 1ASYA 1D7QA 2Z0SA 1Q46A 4CKCA 3I3CA 3GQBA 1K8OA 4B08A 4ZKBB 1TWAH 1X32A 3OW7A 2B2TC 3R93A 4FF3A 5L37A 5IP7G 1FD7D 2C35B 3EIVA 4DV6L 1PDQA 4P73A 3PIOA 4GN4B 4DAPA 4FF1A 3GV3A 1W2BA 4DAMA 1K9MC 1E24A 3HGBA 1WYDA 2DNEA 5M3MG 1S5ED 4K8JA 1VQCA 2QKIC 4BA2I 3T56B 4B3SL 2CH4A 1JJCB 3NHHA 4BWGB 3DMUA 1Q8KA 4OO1I 2YTYA 3IAYA 1PH6A 4S3SA 1AW7A 4LFCQ 3HOWB 2E2JH 5KIXA 4DAVA 5C44B 2K75A 4AQYL 1EEFD 1R9TB 3EJIA 1EYCA 4BY1G 3TDQA 2WB1B 5GQOA 5M9OA 4UDUC 1E22A 4OEMB 2NWGA 2MP1A 3PSIA 4KI0A 4RH6A 1KD1C 1VQ8A 1V1OA 2JA6B 5M3FG 4DV3L 4LFBQ 2ASBA 1EWIA 3CC2A 4JBWA 4JYAL 2WP8J 3WDNA 4L8JA 2NN6G 2EOTA 2F0IA 2KHSA 1EY9A 2MQHA 1L2FA 1HNWQ 1KRSA 4QIWB 2K05A 1IKLA 3FP9A 4LF5L 1CQFA 1DCZA 1YNNC 2AQ2B 2PPBC 2F0GA 3M4OH 3FKIB 1QVFA 2D5DA 3BS1A 4JC0A 4OO1H 2EXZA 4RKLA 1BBUA 1HR0L 1TWGB 4AYBB 1D6EC 5ELEA 4JV5Q 3NTIA 5LMNQ 1G291 1LO5D 4PMCA 1J5EQ 2IX1A 1HA6A 4GKKL 1YBYA 3KYHC 3LGJA 4H13C 4RMFA 4LMQD 3RMHA 1K28A 4X65Q 3CHBD 3O13A 4LFAQ 4CDCC 4AIMA 5C3EG 3I91A 1FR3A 1WTPA 3K8AA 3MC0B 2TSSA 3E3XA 1DD2A 3S17B 3MVVA 4JBJA 3SDZA 1OO9B 1TWFB 1ZXTA 4IPCA 2JYOA 1CFMA 1GM5A 1SR3A 2L0CA 1WCMH 1C0AA 4V0BA 2R92B 1IBKQ 4C3IB 3CCMA 2UUCQ 2YU9B 1FNUA 3VR6A 3FRPB 1CUKA 1SYFA 4X64Q 1U4LA 1B4OA 1I3QH 4JI5Q 1XJVA 2IL8A 4UY8C 3WOFA 2KCNA 3WOEA 3HOVB 1RIPA 1J6QA 1K83B 2E2HH 3H91A 3IRBA 2OQ0A 2KEEA 3K57A 3KLRA 4JI4L 3SGIA 2EY1A 1PH7A 2A1AA 2R93H 3CD6A 2K01A 4HR7B 1SE2A 4TVAB 1LV9A 2ES2A 3TEHB 2K5VA 3UDFA 1B50A 4YCWA 1Y1VG 3TBIB 2LKVA 4G7ZC 1HZCA 1SE8A 3QR8A 4LF6L 4PZ7A 5I4DA 4OIKA 1I50B 4A93H 3EFXD 2N78A 1OXUA 1EIYB 4HJ9A 3P7JA 2KOLA 4DAYB 1H9JA 4FO2A 1GHJA 4DV6Q 1KAWA 3OIPA 2WAQG 4R4QA 1EWCA 4OGQC 1Y8PB 2F52A 4NPSA 2E75C 2D0PA 3I8ZA 3C2PA 2BE5D 4A3LH 4J8QA 1FVIA 4FF2A 5ELCA 3S16H 4RCOA 3KLSA 3RLOA 2HHHL 2EYLA 2HDMA 1D1KA 2IPKD 2DGYA 2A6HC 5ISRA 3N6RA 1SE3A 1LM0A 4RGMA 4QGUA 1RKNA 1CSPA 1CHQD 3TN2A 5KNCA 3I2ZA 1SBBB 2K50A 4KK7A 2DY7A 4LF7L 3VYTA 3GDEA 2F3WA 1RD9D 1SLJA 2UUBQ 3PO2G 4AQYQ 4KY7A 2PZTA 2TMPA 2B2VA 3I4NH 4BBSH 3S1NB 4R8NA 4DAYA 4OL7A 1WI5A 1GUSA 4ZAIA 1OTCA 3NTHA 1SEBD 3PIP3 4JCVE 4JK1C 4DR6L 5IWAL 2VUMH 4DV3Q 4NP5A 2A69C 1RL2A 3HG9A 2OTLA 4JYAQ 4FNFA 2JA8G 3QB3A 2EPBA 3BYYB 4MN3A 4LNQA 1HH2P 3CPFA 1BCPB 1HJPA 4LAAA 4DUYL 1A2UA 5FOBB 4K6LA 1C8CA 1EQTA 1ICWA 2MGSA 5GAGC 2QILA 2F0UA 4L63B 1HRJA 1EZ6A 4JOIA 3S1MB 2UXBQ 3S2HH 4A3MH 1NBWA 1IW7C 1A6XA 4YWLA 2JA7H 3T16A 2N88A 2EDGA 3FEWX 1HR0Q 1PLFA 2J0TD 4F88A 1KRTA 1G6ZA 4Y7NB 2JEBI 4DK1A 2OTJA 3CKIB 5IE8A 3ZYYX 1VQOA 5JJKA 1H9RA 4A3FH 1VQHA 4R4OA 4GKKQ 4DR1L 4CGYB 5CV7A 4X3UA 2NVQB 3M85A 1SMYC 4KN4C 3R8BA 3M4PA 1UE5A 3PO3B 2JN4A 4B9XA 3PF5A 4A3CG 2F0KA 3GTMH 1H95A 2KA7A 1EY7A 3GTLB 1K0SA 2ZT9C 3ERSX 5KYLA 1VQEA 1C7YA 3KK7A 1TIID 3NQTA 2WACA 3NK9A 1B8AA 2AMCB 4X62L 1LT6D 3AYHB 2PNHA 1EFID 1DOMA 1AE2A 1EL0A 4TQUS 1NR2A 5M5XB 2R6GA 2IJ0A 2Z1CA 1IXRA 1DOKA 1I4HA 5NUCA 4KY6A 3G4SA 1EWHA 1YJWA 2X69A 4KJOA 4A3BH 3CCVA 1AFPA 1SYBA 5CBAE 4A75A 2VQFL 1ET9A 2K4KA 3PMFA 4A3KG 1LTID 4M1UB 4PMBA 5IT9c 3TSSA 1Q86C 3TP8A 1ONLA 4JI4Q 1MD2D 1XX8A 1WFQA 1UWVA 4CJ2C 5FO8B 1JCKB 5IOCA 2XIWA 2OEOA 4XYQA 5CR3A 3OMCA 1A3VA 1BBWA 3MEHA 5IP7H 1EY8A 2F0WA 1CM9A 1F2YA 2DJFC 4BY7B 1YHQA 5J1ZA 1XTCD 2AQ3B 4JI6L 4UHVA 4A3MB 4MTKA 3T51B 4A3GB 3I4MB 3SK4A 2ENBA 5M3MH 3HOYB 1A15A 1STYA 1VQDA 4CJ0B 3L0OA 1EY6A 5EPJA 3D4WA 4L5SA 3PUWA 2B2YA 2UXDL 1VQ7A 1PFMA 1SNQA 2FJ2A 2ID0A 4K5WA 3U4VA 2HIXA 5TSSA 4XIGS 5FK9C 3UI2A 2GA4B 1I6HB 4P71A 2HHHQ 3T1HQ 2AWNA 1QZHA 3TP6A 1P8LA 2B63G 1KAAA 3H15A 4QCLA 1K0RA 1D2BA 4FVMA 2B2UA 3J80c 3VR4A 4DV4Q 4H7BA 2E5LQ 4DFAA 4BY1H 2E2IB 2WKDA 5FLMG 2XVSA 1WD0A 2MUYA 3NTKA 1Z47A 3GTJB 5DM73 4N8X1 3G6EA 2A6ED 4CKBA 5LL6S 2EYJA 2PYKA 2F4IA 2K5NA 3H0GG 1Q8IA 2A68D 2LY7A 4DV2L 3CW2C 1WTXA 2PO4A 4HN7A 3ULLA 4DR6Q 5KNDA 2FHTA 1AP0A 4DPGA 3K5MA 4DUYQ 2KJXA 2QW7A 3GV6A 1PV4A 3HOZG 2IX3A 1W3SA 3E5SA 3P20A 1PH9A 2K28A 3K7AB 3OWFA 1LT4D 2KQ3A 1PZJD 3NBHB 2KHIA 4J6HA 5IYDG 1V8QA 2PI2A 1TS5A 1S3OA 1X54A 4JW0A 1HNXQ 4ID6A 5DNFA 1XNQL 3NWTA 4N9TA 4RFBA 1EY5A 1HR0W 2PQAB 3A55A 2HUGA 1LTAD 4FP5D 4DR1Q 1NTGA 2UU9L 2QEJC 1SNMA 1TR5A 4QF4A 1F9PA 4EQNA 4HAEA 1A3TA 5CGKA 4K6DA 2BH2A 2Y0SG 2KUMA 1SNDA 1J9OA 5I6YA 3KF8B 5EKKA 5EQ0A 3KDFB 3TMEA 4G4KA 4RGNA 4HJ7A 2EY5A 4K2LA 4X62Q 3NBHA 3L2PA 1VQPA 4TKOB 1CA5A 4P2CB 1TQOA 2EJFC 4JBKA 1V1QA 4YY3L 1N8RC 5M3FB 3TREA 1T9HA 3HOXB 2PQAA 1SJED 3TZUA 4DR2L 1G8ZD 1SNOA 3MTSA 3G6JB 1Y1VH 1STHA 2VQFQ 2SEBD 4XT3B 1XPOA 4L5RC 3Q23A 3KJPA 3D31A 1ENFA 1O80A 4Q5VA 2G9DA 2Q8TA 5FO9B 2K52A 4HTHA 1CKOA 1T5XD 2WB1E 3S2DB 1L0YB 3KF8A 1HPCA 1LTBD 2JE6I 3KDFA 3OYYA 5JVH3 4DF7A 5C0XJ 1NJIC 1X3GA 2MO1A 5JEAJ 3MWYW 1JE4A 3R2IA 5LMNL 4JI6Q 2NZ1D 1KXLA 2K5HA 1EQVA 3OHXC 2H4OA 4X65L 3TRZA 3TZDA 4LFAL 1HXYD 1BF4A 4FXGC 4P75A 1CHPD 2HD3A 2UXDQ 5C3EB 1PRTB 4YWKA 1L1OC 3K0YA 1M1KC 3K80C 2NB0A 1JB3A 4FYDA 4A3FG 1E1TA 4ZRZA 5M5YH 2F0FA 4H44C 4UP9A 1SXTA 3M4YA 3PUVA 1RDPD 3PO2H 4QQBX 1QVGA 4AYBE 1AE3A 1BUVT 3S14B 4CHTB 2UUCL 1ZYRD 2YV5A 3VR3A 1NCVA 4DNIA 2RHQB 2M2LA 4IOAA 4B9WA 4X64L 4A3DB 1PFNA 4TRDA 4ILWA 1IBMQ 3M7NA 2CW0D 3WWVA 2R7ZB 4ZLTF 1EIHA 3I4LA 4GNXB 2JA8H 3LWUA 3J7AF 4DV2Q 1JT8A 4HCEA 5IT9E 2ZM6L 1HTPA 2HQEA 1ET6A 2R61A 3D4DA 1W6JA 2M00A 1AN8A 2F0NA 2LS01 2NZHA 4HJ8A 5J39A 1M90C 5HGQA 1M4VA 5C6AA 4O2DA 2JXMB 4P72A 4X3KA 3IKJA 1CK1A 5IT9L 4IUQA 2FMMA 1PTOB 2VB3X 4A3EB 3AQQA 2DJGC 4A3IG 2VY3A 2SOBA 1H9SA 3I7FA 1PFSA 3KFUA 2I07B 1XNQQ 4LW1A 2NVXB 1SE4A 2WAQB 4GNXA 2QA4A 2NUCA 3NPPA 1GKHA 1E0BA 4A3CH 3HZXA 1Y14B 2ICEC 1JR0D 3GTGH 4OWTB 2F0EA 1BR9A 3JAMi 2C5CA 3CCUA 3MA2B 2UU9Q 3UDIA 4I7AA 2V4DA 3M3YH 2RHSB 5JEAG 1TU2B 3J80E 5F2DA 1SROA 1NY4A 2Q8IB 4HEDA 1MBYA 5BN3A 1EYGA 1S5CD 5C4XG 4BBRH 4DV1L 3P1HA 2R7DA 4DR7Q 5ELFA 2UUBL 1TXYA 3N52A 1U9RA 4RGTA 3QO2A 3S1RH 2Z4HA 5GADC 3MFYA 1PH1A 1RHPA 3J80L 4A3KH 1LTLA 4V190 2MPMA 4HIOA 2ZTCA 1Y1WG 1D8LA 2B2WA 2SDFA 4YY3Q 1BVSA 3K59A 3HKZG 4RCNA 3D4RA 1O7LA 1S5DD 5IYBG 2VL6A 4DR2Q 3H94A 3DWAA 2OF1A 1TWCH 1NE3A 5C4JB 1PRTD 2D2CC 2UXBL 2CQOA 1R4PB 1U0LA 1QB5D 5T1IA 3J81c 2KCTA 3S15B 2NVTB 4C3HB 2HCCA 1BXTA 4FXKC 1KNAA 4K0KL 1IKMA 4IUUA 1IYVA 3E6ZX 5E4WC 3MHBA 3U58A 4DV0L 1HZ9A 1LTTD 4JBMA 4YWMA 2MJ8A 4KD3A 2F4VQ 1TWAB 3A7AB 1JORA 3RLFA 3BZKA 1HTLD 5H1SE 1JOOA 2B63H 3GTPH 3OIQA 3TS2A 2EE1A 1Q90A 1T5EA 4GOPC 4DGZA 5I9OA 4DNTB 1S5BD 3IL8A 1XTDA 5FLMH 3C1FA 1NR4A 1VQ5A 2CQAA 2R3ZA 4A3JG 4UP7A 1B1ZA 5LHY1 2LXKA 2Y0SE 3EROA 3BJUA 3RZOH 4PMWA 3H0GH 3DM1A 4DV5L 4PNYA 5J22A 2PQEA 2NVYH 1KDAA 1LTRD 2E2JB 1K8GA 1KL9A 4XYOA 1PTOD 1KC8C 1HUNA 1XWEA 4IFDJ 3UDGA 3HKSA 4LUVA 1V43A 1PZID 3E9IA 1YEZA 4ZCKA 3OW2A 3HOZH 2F0QA 3PV0A 4JI2L 1GD7A 1NAPA 2F3IA 2ZM6Q 1YNJC 1JOQA 1PYWD 1QCBD 1IBLL 4G7OC 4HMJA 3BG3A 3BZCA 2QEXA 5KEEA 5D14A 1YNJD 5IYDH 4LUZA 1PH8A 3I55A 1SFOH 2RDFA 2ZXOA 3ULJA 2LFNA 3RN2A 1WTWA 4JI3L 4KHPL 2VW9A 5HY6A 1EQQA 1B53A 4HJ5A 3M4OB 1AZPA 3BZDB 2YTXA 3AFQA 4RHRA 4APVA 3MZ5A 2BE5C 4EQPA 4BA1I 1VQ6A 4IJHA 5C5MA 4LWCA 3ZJYC 1YVCA 2LMCB 2JA5G 3A56A 2ALYB 4FDBA 1EU3A 2IY5B 1LYLA 2B3GA 1F2MA 3T1HL 1TT2A 3MXNB 2K33A 3GTPB 3DHQA 5BR8L 1UAPA 3BVGA 4QUFA 4DV4L 1XPRA 2E5LL 4ZQ3A 2OWOA 2HCIA 1SYGA 1K73C 4ME5A 1PHJA 1SRUA 4EGVA 4DV1Q 1B9MA 4MZ9A 1JWSD 1EOVA 1WCMB 2JSOA 1Q7YC 3U50C 2XNAC 3CQZH 3BDCA 4IZ8A 3SVMA 2QCPX 3GTOH 1I94L 5A2QE 3I4OA 1S72A 1F77A 2G9HD 1B9NA 1DZ1A 1I3QB 5M5WH 1AZQA 1I4PA 5IGDA 3BVZA 3HOWG 2WV6D 1LT5D 1STBA 3UE0A 3J81j 5C44G 2E2HB 3AB9A 3QWNA 3MXNA 5GAEC 1EYAA 4ZUIA 1CTMA 2WB1G 5EBDA 5A2QL 4XT1B 1II3A 5G3LD 5JJIA 1QE6A 3AEVA 4HCSA 4ZK9B 2R93B 1E2VA 1LTGD 2EVBA 3MFGA 2XRQD 2V1CC 2JA6G 1Y8NB 1HFGA 1NSNS 4QY7A 1HNXL 4K0KQ 1I5FA 3NELA 1GJXA 2F0SA 2K1BA 4DV0Q 1HNZQ 4A93B 3A5ZB 3X3NA 5LMNW 4IUPA 1PXUA 4GLAC 3FPUB 1GUGA 1PYBA 3FKIG 1RCVD 3BVMA 2RBMA 1XYIA 3G71A 4AYBG 1X56A 3S16B 2QGQA 5CC4A 5LMUL 4O0AA 1Q12A 1XMQL 3K0XA 2EJMA 4HMIA 5C5LA 3DLLA 4QMGA 4H0LC 3DWPA 5HGTA 3PIO3 5JPNC 5EGTA 2EZVA 4BBRG 4DV5Q 1EZ8A 3F1ZA 5FJ8G 1VQBA 5C0XI 4GKJL 2Z4IA 5E3FA 1F2LA 2F0PA 2F1MA 2HDLA 2N55A 1N34Q 3K5NA 1Z6HA 2B2VC 3GTQH 5ELOA 3OTOL 1MIUA 1XPUA 3CQZB 3L3OC 4R1JA 2R92G 3I4NB 4BBSB 4C3IG 1EOTA 1TKWB 3E9HA 3HKZE 4JI2Q 1E2WA 4CBVA 4B3TL 3CPWA 2VUMB 1KLUD 1IBLQ 5E4XA 4X3TA 1O7IA 1RTNA 3TS0A 2NTSA 3J81E 3QG1A 2CWPA 4EQOA 2R7FA 4A3IH 1GOZA 4JG2A 3KBXA 3SEBA 2MFIA 3HOVG 2RCNA 1HQRD 2L9HA 4JI3Q 4KHPQ 3S2HB 1CKMA 4MHEA 2MNAA 3S1QH 1UE1A 5AFWA 3URYA 1EEID 2FMCA 1RTOA 2JA7B 2CWAA 2RDGA 2GVBA 3J81L 1VQNA 1RF2D 4DR5L 3I73A 3UE1A 4C56C 5JEAH 1G2SA 1A0IA 2L11A 2KHJA 1ILPA 1U4PA 4L6TB 3U9OA 3CCEA 4A3FB 4ZKCB 5C4XH 1B44D 2N3SA 1BCPC 4DV7L 3S9WA 1F2ZA 5BR8Q 1VQKA 4NXML 4ZUJA 3CCSA 2YTVA 1VMPA 1GHKA 1QWYA 4RHSA 5FO7B 1EY0A 1BCPD 5IGGA 4KV6A 4GLVB 2F0OA 1FL0A 2JJQA 3GTMB 1O78A 1O7ZA 1STGA 2A6EC 4IOCA 4IUTA 1NMFA 1CT1D 1Y1WH 1IBML 3MXPA 3RZDH 3ND9A 3GD7A 4XTCS 2A68C 2ZTEA 1E2ZA 5IYBH 1BCPF 3FHWA 3QIAA 3NBIA 1B2TA 4OWWB 2XSCA 1I94Q 2K14A 3HOUH 1AH9A 5ELBA 3UDXA 3ICEA 2A74C 2FXQA 4A3BB 1SSOA 2XWBB 4NB3A 2K7VA 3A8IE 1WTRA 3J7A5 1ASZA 1IL2A 2BH8A 3V2TA 4UPAA 4QL5A 3T13A 1WOCA 3V96A 4DKAC 4WJ3M 3X3MA 4X3SA 4DU9A 1QUQB 1VQJA 2B8GA 5IIFA 5DAUA 5JVG3 4RG1A 1TWHH 5DM63 3CMEA 4XQNA 2A73B 1YJ9A 3PF4A 4CDEC 1EYDA 2VXWA 3F2BA 2XRSD 2EYHA 5JPMC 2Z6KA 5M3MB 2CFMA 3A8KE 5CV6A 4IURA 4JI8L 3RNUA 1DOLA 1F9SA 4A3JH 5FLXE 2CHBD 4I65A 3A0JA 3HFZB 1I4RA 5KYIA 2B2UC 2J7ZA 3A54A 5EKLA 2VB2X 5LMUQ 5IYCG 4DR7L 1XMQQ 4ME3A 3EN2A 4IPDA 2NBFA 5GAHC 3D6WA 1QUQA 4BY1B 5FLXL 5EPLA 4NW2A 3CC7A 1ENCA 2DN8A 3FPPA 2O5IC 5CV5A 3GTKH 3EBEA 3G48A 4N8FA 4GKJQ 1JE5A 1VQAA 3W1BA 1HCZA 4DK0A 3OTOQ 5JOBA 1GUOA 2K5WA 2DNCA 4C3JH 4RKBA 3QOLA 1MJCA 2JQOA 2KENA 2OXPA 4M8AA 1U4RA 4MNOA 4ULLA 4LK1C 3HP3A 3TP7A 1S5FD 1Z7TA 4B3TQ 2BDNA 5I2XA 2BCOA 1G2TA 4F7XA 1XXGA 5CMDA 2HIVA 1FJGL 1R4QB 3VR5A 1E1OA 1RJTA 1X3FA 1XNRL 3H6MA 3K7UC 3D3RA 2I0QA 1JOKA 2JA5H 1N36L 5E7NA 2F4VL 1SMXA 3K58A 2PMZB 1DONA 3MAQA 5C4ZA 2DY8A 4OIJA 2RDHA 4DR5Q 2A19A 3W2DA 1SN8A 3PUXA 1X55A 1JICA 1CZWA 4QIWE 1MI2A 4DUZL 4BY7G 3K81C 2SNSA 2B2TA 2UXCQ 3B6YA 1A8VA 3CMAA 4A3GG 3STBD 3I4MG 5DEHA 1L0XB 1ZYRC 4DV7Q 1JWUD 1N9WA 3I90A 2EYOA 3HOYG 4WJ4A 4B3ML 1EU4A 4YHHQ 4NXMQ 1VQFA 3F2DA 1C4QA 4JVZA 2FINB 1IYUA 2SNMA 1UUPA 1TS3A 1ML0D 2CW0C 4KKTA 4QJFA 3KOJA 3PIPA 1H9SB 4BS9A 3PUYA 4LF8L 1JC7A 5I9PA 3HOWH 2PCFB 4AH6A 1PH4A 1TVXA 1HZAA 5C44H 1R9TH 1PMRA 2BOSA 1I4QA 1A63A 3K6OA 3CCRA 4YCVA 1YI2A 4Q0FA 1GUWA 2EY6A 3U9SA 2JA6H 1TY2A 4DR3Q 5D3DA 4OHJA 5IODA 2XWJB 1Y1VB 1JJGA 4JI7L 2EYMA 1BDOA 5ELNA 5EPKA 2Q8RE 2XTIA 1A2TA 1U4MA 2HT1A 1EIFA 1KTKA 4PZ8A 2E2DC 3KBGA 4DNRB 3LWEA 3J80i 1B70B 4POGA 4J15A 2YYZA 4KKUA 4L5TA 4WORA 1DM0B 1VS0A 3FKIH 1V1PB 1UE7A 3SR1A 1X3PA 2AWOA 1VCIA 4N9PA 3CRKC 1KDBA 1TWGH 3NSWA 3T4AC 2O4XA 4R4CA 3NP8A 2EIFA 1TS4A 4JI8Q 3T53B 1PVOA 1PH2A 2ZJPA 2O2LD 2JK8A 3ER0A 1ENAA 5C0XG 1LACA 1MSGA 2IHEA 1VQ4A 3NQIA 5FJ8H 5M5YB 2MHVA 3S17H 3OPOA 1YHBA 3PO2B 3DEOA 4GOPA 1TWFH 3FDTA 4OELB 4HIDA 3SK5A 3H3VC 5EJWA 3Q6SA 3BDOA 2R92H 1C48A 4C3IH 2Q2TA 5EAYA 2AUJD 3C1EA 1V1PA 3RLNA 1QOHA 3PQIA 3SXHA 5IGEA 2EYPA 1WTOA 2YU9H 3C46A 2PW7A 4U673 2E8GA 3F2CA 2HQLA 2JA8B 4HJAA 1MSHA 1PRTC 4C1NK 5AJ3L 3HOUG 1E7ZA 1X3EA 3NUCA 3HOVH 2VZAA 1K83H 1GO3E 3JAME 1Q82C 2M9VA 3W5OA 2D9UA 2K04A 3Q22A 1FJGQ 2IX0A 1JJ2A 2Z8LA 4KMUC 3HOXG 2O5JC 4QUCA 1PRTF 3ULPA 1P16A 2KVMA 1XNRQ 1F9RA 1X6OA 2K32A 1ESFA 1Q1BA 3EA6A 1ICFB 2L4NA 1HNZL 1N36Q 3JAML 2NTTA 4GNXC 1U5KA 4OX9Q 1I50H 1YZ6A 3CU7A 2K5DA 1B3AA 5CYUA 1RODA 3H09A 1YNND 4DUZQ 4DK6C 3QJYA 1M8AA 4BXXG 5IP9G 3GTGB 1LTSD 2QDBA 1CKNB 4OWXB 2B29A 4JI1Q 4B3MQ 2X6GA 4KY5A 4PQXA 3M3YB 3DUZA 2A5HA 1WTHA 1L1OA 3RD4A 1WJJA 2L55A 4UAIA 4BBRB 1SNCA 4FXDA 3P75A 1PTOC 3SK6A 1N34L 4DR4Q 5COYA 3J7YW 1STAA 5JJZA 4LF8Q 1JB7A 1BO0A 1X3QA 2VS1A 3S1RB 2B2WC 4CKEA 2VQEL 1VF7A 5KGUA 2Q2UA 4A3KB 4WFN3 1QZGA 1Q1EA 3S1NH 1MGSA 1OXVA 2FFKB 3CAMA 1I4XA 2F03A 4IUNA 1PTOF 4C3JG 4XDXA 4A3DG 3HS0C 2H5XA 3A74A 1LLRD 5J3BA 3K5OA 2R7ZG 5A35A 1FNVA 2A8VA 3BYTB 3PCOB 5CV9A 4KKSA 2I46A 1CKNA 1TWCB 3PGZA 4JI7Q 5GROA 3L7ZC 4Y52H 3AFPA 3AU7A 4IPGA 1UNSA 1KLGD 4YIJA 2ZJRA 1I6VC 3S1MH 2EJGC 2NZOA 1VF5C 4UP8A 2ATWA 4HSPA 1SJHD 4K5XA 4HSVA 1FGUA 1IZ6A 4G57A 1PA6A 2EXDA 4PG3A 1G6PA 4Y7NH 2F0HA 4KN7C 1NUCA 1UEAB 2WFWA 1G91A 4YCUA 5IYCH 5CBEE 5FLXc 3DXJC 2B63B 1CI3M 1NNXA 4A3EG 2B39A 2KEDA 4WRDA 1WTQA 3VDYA 2NVQH 2AUKA 2PW5A 4TSSA 1BQQT 3PO3H 2X6LA 4POFA 4Z9CB 2L12A 2CH4W 1IL8A 2IWHA 5C3XA 3NEMA 4GZYC 1VQMA 3A7LA 4B3SQ 3GTLH 2OT2A 3RZOB 4DA2A 4NXNL 3H0GB 3BU2A 5DLQE 1ZEQX 4XQJA 3R3OA 2A6HD 1GVPA 4CDFC 4ZYSA 2NVYB 2RSNA 4NDXA 4E6IA 3T1YL 5M5XH 1GXDC 2CCZA 4GLXA 1KDCA 2OQKA 4IN3A 2F0JA 5AJ3Q 4RA8A 4WJWA 4HIKA 5E1FA 1KNEA 4GN5A 3HOZB 1E3PA 1S40A 4LF9L 2PI2E 4KHVA 3EQLC 3VYRA 5K36H 2BA1A 1STEA 1XMOL 3OSOA 2N8NA 2I5LX 2RVLA 1OXTA 3QOJA 4IFDG 1Y8OB 3CCQA 1SFOB 4OXPA 1VQGA 3J7ZC 5G3LF 3F8TA 2LXJA 3RN5A 2A69D 1UEBA 1GUTA 4NKLA 3CCLA 1FNWA 4BY7H 4K2KA 4A3GH 4MTNA 3I4MH 2KECA 1CZGA 1YHAA 3CCJA 4C3HG 4LF5Q 3TQYA 3HOYH 5T1GA 4CDDC 1WD1A 5D65A 3K5LA 1EUJA 1IW7D 3F2UA 2QDLA 3Q24A 2Y0SB 1YJNA 2CKZB 1I6HH 4XXEA 5C4HA 4IQZA 1D5ZC 1QG7A 2E76C 3A5UA 1IHZA 2BDOA 3J81i 4KHZA 4F8MA 2ZTDA 2E2IH 1JWMD 2WKCA 1SMYD 3VYSA 4EVOA 5KNBA 4EQ5A 1H9MA 4PZ6A 3GTJH 2RA4A 3PUZA 2VQEQ 3GTOB 3JC66 3SE0A 1N32L 4B3RL 3M4QA 4I7ZC 2ZJQA 3KJOA 5M5WB 1DGSA 4KD4A 5ELDA 1A62A 2RQXA 4GN3B 2AQ1B 4JOIC 3ERQA 3A8JE 1KHIA 4IUVA 2D0OA 1EFWA 2P5ZX 3W3AA 1EIGA 2KBNA 4A4IA 4O42A 2N49A 4LF4L 4A76A 5IGFA 3RUZA 1HQMC 1B7YB 1MJEA 1Y69U 4R8IA 3LX0A 3K7AH 3M7GA 1SDFA 3LNNA 1KIXA 5C0XH 1HHVA 3KUPA 1YIJA 1CA6A 2IT1A 2IW3A 1O7YA 3DM3A 2UUAL 2F0VA 5IGCA 1F9QA 2J4XA 2UXCL 4LF6Q 2LSSA 1IYJB 1HUMA 2I5HA 2K5QA 2JEAI 1A3UA 1B3QA 2EYFA 1V9PA 2NN6I 4LJZC 4YHHL 1N33L 1FGBD 2Q2IA 2QF7A 4OO1G 1PH3A 5K5PA 2JP1A 1PH5A 2AHOB 1TS2A 1JMCA 1PYSB 3CC4A 1J8IA 3KLWA 2PMZE 1KABA 3Q0AA 4O1NA 1G51A 4R4IA 2KCMA 2OCEA 3SHLA 3H3VI 4K8IA 1BKBA 2WIIB 1Z9FA 4CJ1B 2AKWB 4IO9A 2PNRC 4NXNQ 3VYUA 5LL6X 1YNXA 4EX5A 3D6CA 3D8GA 4X66L 2RKSA 1GUNA 3GTQB 1EY4A 3T1YQ 2F0MA 2F0LA 4P74A 1PFBA 4DR3L 4LF7Q 3CF5A 5M3FH 1CSQA 3KLSX 1D5MC 1WCMG 4DXGA 3HOXH 5HURA 3Q8DA 1OXXK 4JI0L 3JAMc 4LF9Q 3NWSA 1LUZA 3I70A 3VA5A 2NN6H 1YITA 1L1OB 3CRLC 1XMOQ 3E0EA 5IWAQ 1NMGA 4A3IB 3S24A 4FF4A 1DXMA 3S2DH 5IGBA 5KRUA 4IPHA 2F0DA 3R2TA 1DYQA 3S1QB 2B2YC 3CXCA 4KTAA 1K3RA 3CP0A 4R4TA 2IHFA 3H3VH 4ABNA 4BXXH 5IP9H 3KF6B 4C2MH 2RF4A 4XQQA 2R93G 4GS3A 5D3IB 5BN4A 4U68A 4ALPA 4ODGA 1VDZA 4HIMA 2F3VA 2DUDA 2Q2HA 5C3EH 4KJNA 5C4XB 4KLKA 4H02A 3GP7A 5CV8A 4A93G 2E74C 2XN9C 5CV4A 4F87A 4G7HC 1VQLA 3ND8A
chains in the Genus database with same CATH topology
3M9BA 1TWGH 2R6GA 3RR5A 3D0FA 2WAQE 1IXRA 4LUZA 5IYDH 1PH8A 4R4CA 3I55A 3G4SA 1SFOH 2EIFA 1D7QA 1YJWA 3PO3G 4JI8Q 1PVOA 1PH2A 3S14H 2ZJPA 4A3BH 3CCVA 3ULJA 3RN2A 2JK8A 4JI3L 2VW9A 3ER0A 4A3LG 4KHPL 5C0XG 5HY6A 1EQQA 2XGTA 4HJ5A 4A75A 3MEFA 2VQFL 4A3DH 2K4KA 4LFCL 2YTXA 4A3KG 3AFQA 5IT9c 2IHEA 1VQ4A 4APVA 2JA8G 2D62A 1Q86C 2R7ZH 5FJ8H 3KF6A 4JI4Q 4BA1I 3S17H 1VQ6A 1WFQA 4IJHA 1N32Q 3I56A 1UWVA 1YHBA 4LWCA 3ZJYC 4B3RQ 1YVCA 2EQSA 4GOPA 1TWFH 2JA5G 2ALYB 4FDBA 4HIDA 2IY5B 1LYLA 1BBWA 5IP7H 2B3GA 2R92H 1L0WA 2L15A 3T1HL 4C3IH 4LFBL 2Q2TA 1YHQA 3MXNB 5EAYA 3GO5A 5BR8L 3RLNA 4JI6L 4DV4L 1XPRA 2E5LL 2YU9H 2OWOA 3I4NG 4BBSG 4LF4Q 5M3MH 1K73C 2E8GA 1VQDA 3F2CA 2HQLA 5K36G 1PHJA 4HJAA 3L0OA 5AJ3L 4L5SA 1SRUA 3PUWA 3HOUG 4DV1Q 1HNWL 1E7ZA 2VUMG 2UXDL 1X3EA 4OX9L 1VQ7A 4MZ9A 3HOVH 2VZAA 1K83H 1EOVA 1GO3E 2ID0A 1Q7YC 2Z6KC 3U4VA 2HIXA 4DK3C 4XIGS 4A3EH 1Q82C 3U50C 3W5OA 1X9NA 3CQZH 3STBC 4IFDI 2I5MX 4P71A 1I94L 2IX0A 2AWNA 3T1HQ 1QZHA 3I4OA 1JJ2A 2HHHQ 1FJGQ 1P8LA 4OONA 1S72A 2NVXH 2UUAQ 2B63G 3HOXG 4JV5L 3H15A 1K0RA 4A3MG 3J80c 3ULPA 1P16A 5M5WH 4DV4Q 1J5EL 1KQSA 2E5LQ 4BY1H 1X6OA 2GVAA 1XNRQ 1Q1BA 4JI1L 2JA7G 3HOWG 1N33Q 3UE0A 5FLMG 3J81j 1N36Q 1HNZL 5C44G 4L5QA 1MKHA 2GN5A 5GAEC 1OXSC 5JJLA 4GNXC 1EQRA 2WB1G 1U5KA 1Z47A 1I50H 4OX9Q 5JJIA 1YZ6A 3G6EA 4DR4L 1QVCA 3AEVA 3NENA 2JA6G 3W1GA 2V1CC 2K5NA 3H0GG 4DV2L 4DUZQ 4DK6C 4QY7A 1HNXL 4K0KQ 3CW2C 4BXXG 5IP9G 1I5FA 3ULLA 1IBKL 1HZBA 4DR6Q 3NELA 1CKNB 4OWXB 4X66Q 2B29A 4JI1Q 4DV0Q 4B3MQ 4DPGA 1Q81C 1HNZQ 3A5ZB 1C9OA 5LMNW 1UE6A 4DUYQ 3HOZG 4GLAC 4JI5L 1PV4A 1WJJA 1X65A 1W3SA 1PYBA 3FKIG 1K8AC 2JA9A 1N34L 4X6AH 4JI0Q 1PH9A 4DR4Q 4IJLA 5IY0A 3G71A 4LF8Q 1JB7A 2MO0A 2VS1A 2KHIA 3NBHB 4AYBG 1X56A 2PI2A 5IYDG 1X54A 1S3OA 2QGQA 5C4JH 4GOPB 2VQEL 1HNXQ 5LMUL 4O0AA 2Q2UA 1Q12A 1XNQL 2VNUD 1VQIA 1XMQL 1QZGA 4A3BG 1VQ9A 3K0XA 3S15H 2NVTH 4C3HH 1HR0W 1Q1EA 3S1NH 1OXVA 3CAMA 3DLLA 2PQAB 4A3DG 2H5XA 2BA0A 3A74A 5J3BA 4DR1Q 3U4ZA 4BBRG 4DV5Q 2R7ZG 1NTGA 3F1ZA 4LUOA 1VQBA 5FJ8G 5C0XI 2A8VA 3PCOB 2UU9L 1IL2A 4GKJL 1ASYA 1CKNA 1N34Q 2Z0SA 1Q46A 3PGZA 4JI7Q 3GTQH 5GROA 5ELOA 3OTOL 3L7ZC 1MIUA 4Y52H 1XPUA 1TWAH 3AFPA 4IPGA 2BH2A 2Y0SG 5IP7G 2ZJRA 2C35B 3EIVA 4R1JA 2R92G 4DV6L 4P73A 3PIOA 3S1MH 4GN4B 3KF8B 3E9HA 3HKZE 3KDFB 2NZOA 4JI2Q 4DAMA 1W2BA 4B3TL 1K9MC 4UP8A 3CPWA 1E24A 2ATWA 1WYDA 4HJ7A 1IBLQ 1O7IA 5M3MG 4X62Q 3TS0A 4BA2I 1VQCA 1FGUA 1IZ6A 3L2PA 1VQPA 1PA6A 2EXDA 4B3SL 2CWPA 4PG3A 1G6PA 4Y7NH 2R7FA 4A3IH 4JG2A 1JJCB 4JBKA 1V1QA 2WFWA 4YY3L 1N8RC 4YCUA 1Q8KA 5IYCH 2MFIA 3TREA 1T9HA 5FLXc 3HOVG 2RCNA 4OO1I 4A3EG 2PQAA 4JI3Q 4KHPQ 1CKMA 2MNAA 2YTYA 4DR2L 1UE1A 3S1QH 1PH6A 3VDYA 1Y1VH 2NVQH 2VQFQ 4LFCQ 1XPOA 2CWAA 4L5RC 2GVBA 2E2JH 3PO3H 3KJPA 3D31A 4POFA 1VQNA 2K75A 4AQYL 4DR5L 4BY1G 3UE1A 5GQOA 2K52A 1E22A 1A0IA 3NEMA 1VQMA 1CKOA 2KHJA 4B3SQ 3PSIA 2WB1E 4KI0A 1KD1C 3GTLH 3CCEA 5C4XH 1VQ8A 2JE6I 3KDFA 3OYYA 5M3FG 4NXNL 5DLQE 3BU2A 4DV3L 4LFBQ 5C0XJ 2ASBA 1NJIC 2N3SA 1X3GA 4DV7L 1EWIA 1GVPA 2MO1A 5JEAJ 4JBWA 3CC2A 4JYAL 2WP8J 5BR8Q 5LMNL 4JI6Q 1VQKA 4NXML 3CCSA 3T1YL 2YTVA 5M5XH 1KXLA 2K5HA 2CCZA 4GLXA 2NN6G 4GLVB 1FL0A 2JJQA 4X65L 2OQKA 3TRZA 5AJ3Q 4LFAL 2MQHA 1L2FA 4HIKA 1KRSA 4IOCA 1HNWQ 1NMFA 4GN5A 1Y1WH 1IBML 4P75A 1E3PA 2UXDQ 1S40A 4LF9L 3RZDH 3FP9A 4YWKA 3GD7A 1L1OC 4XTCS 4LF5L 2ZTEA 2PI2E 1M1KC 3M4OH 3K80C 5IYBH 1QVFA 4JC0A 3FHWA 4A3FG 1E1TA 2BA1A 5M5YH 1XMOL 1BBUA 4OWWB 3HOUH 1I94Q 2K14A 2N8NA 1HR0L 2I5LX 1AH9A 3UDXA 4UP9A 1OXTA 3ICEA 4IFDG 3CCQA 4JV5Q 3PUVA 3PO2H 4QQBX 1QVGA 4OXPA 1VQGA 3J7ZC 5LMNQ 1G291 2FXQA 1AE3A 3F8TA 4AYBE 1J5EQ 2LXJA 2UUCL 2IX1A 2YV5A 3RN5A 4DNIA 4GKKL 1UEBA 1YBYA 3KYHC 3LGJA 2RHQB 4RMFA 4X65Q 3CCLA 4BY7H 4IOAA 4NB3A 4X64L 4LFAQ 3J7A5 4AIMA 1ASZA 4A3GH 2BH8A 4MTNA 1IBMQ 3I4MH 5C3EG 1YHAA 3WWVA 3CCJA 4UPAA 3M7NA 3K8AA 4LF5Q 3TQYA 3HOYH 4QL5A 1WOCA 4DKAC 4WJ3M 4GNXB 2JA8H 4JBJA 1QUQB 1VQJA 1EUJA 4IPCA 4DV2Q 1GM5A 4RG1A 1TWHH 1SR3A 3CMEA 1JT8A 2ZM6L 1YJ9A 1WCMH 1C0AA 3PF4A 1IBKQ 3CCMA 1YJNA 3F2BA 2UUCQ 2CKZB 1I6HH 2Z6KA 2NZHA 4HJ8A 1CUKA 4X64Q 1M90C 5HGQA 2CFMA 3A5UA 4JI8L 1I3QH 4JI5Q 4O2DA 1XJVA 3J81i 3RNUA 4KHZA 4P72A 2ZTDA 2E2IH 4A3JH 4UY8C 1RIPA 1J6QA 2E2HH 3IRBA 2OQ0A 4EQ5A 3A0JA 3AQQA 3HFZB 4A3IG 2VY3A 4PZ6A 3GTJH 3PUZA 2VQEQ 3I7FA 4JI4L 3KFUA 1PFSA 3SGIA 5LMUQ 5IYCG 3JC66 1XNQQ 4DR7L 1XMQQ 4LW1A 2A1AA 3EN2A 4ME3A 1PH7A 3M4QA 4B3RL 4IPDA 4GNXA 3CD6A 2QA4A 4TVAB 5GAHC 3KJOA 2ZJQA 2ES2A 1GKHA 3TEHB 2K5VA 3UDFA 1DGSA 1QUQA 4YCWA 1Y1VG 4A3CH 1Y14B 3CC7A 1A62A 3GTGH 1HZCA 1SE8A 4GN3B 4OWTB 4JOIC 3JAMi 3GTKH 3EBEA 3G48A 4GKJQ 3CCUA 1KHIA 4LF6L 1JE5A 1VQAA 3UDIA 3W1BA 2UU9Q 2D0OA 4PZ7A 3M3YH 1EFWA 3OTOQ 2RHSB 5JEAG 4A93H 1SROA 2KBNA 4A4IA 2N49A 1NY4A 4C3JH 4LF4L 2N78A 1OXUA 4A76A 1EIYB 1MJCA 1EYGA 5C4XG 4BBRH 2JQOA 4HJ9A 1N32L 2KENA 4DAYB 4DV1L 4DV6Q 1B7YB 1KAWA 1MJEA 2R7DA 4MNOA 4DR7Q 2WAQG 4R4QA 3K7AH 2UUBL 1TXYA 4NPSA 2F52A 4B3TQ 1KIXA 2D0PA 4A3LH 1FVIA 3S1RH 5GADC 3S16H 1YIJA 1PH1A 2HIVA 3RLOA 2HHHL 1FJGL 4A3KH 1LTLA 2DGYA 2IT1A 3DM3A 2UUAL 4HIOA 2UXCL 1E1OA 2ZTCA 3GTOH 1LM0A 2LSSA 1IYJB 2I5HA 4QGUA 1D8LA 1Y1WG 4YY3Q 4LF6Q 1X3FA 1XNRL 2JEAI 1BVSA 3HKZG 1V9PA 2NN6I 1CSPA 3K7UC 5IYBG 2I0QA 4YHHL 2VL6A 1N33L 4OO1G 2Q2IA 4DR2Q 2JA5H 3I2ZA 5E7NA 1N36L 2F4VL 1SMXA 2K50A 1PH3A 4LF7L 1PH5A 1TWCH 2AHOB 1JMCA 1PYSB 3GDEA 1NE3A 3CC4A 1SLJA 3KLWA 2UUBQ 3PO2G 2PMZE 4AQYQ 4DR5Q 2UXBL 1G51A 2CQOA 2A19A 4R4IA 1SN8A 1U0LA 3PUXA 2KCMA 3J81c 2KCTA 2OCEA 1X55A 3I4NH 4BBSH 4QIWE 3H3VI 4DUZL 4BY7G 1OTCA 1WI5A 3K81C 1BKBA 4K0KL 1Z9FA 2UXCQ 3B6YA 4JCVE 1A8VA 2AKWB 3CMAA 4IO9A 3STBD 4A3GG 3I4MG 4NXNQ 5IWAL 2VUMH 4DR6L 4DV3Q 1YNXA 4EX5A 4X66L 4DV7Q 1RL2A 3HOYG 1N9WA 2OTLA 4WJ4A 3U58A 4DV0L 1HZ9A 4B3ML 4JYAQ 4JBMA 4YHHQ 4LNQA 4NXMQ 1VQFA 4YWMA 1HH2P 3CPFA 3F2DA 3T1YQ 4P74A 2F4VQ 1HJPA 4DUYL 3RLFA 4DR3L 4LF7Q 3BZKA 3CF5A 5M3FH 1CSQA 5GAGC 5H1SE 2B63H 1WCMG 4QJFA 3HOXH 3GTPH 3Q8DA 3KOJA 1OXXK 4JOIA 3TS2A 4JI0L 2UXBQ 3S2HH 3PIPA 4A3MH 4GOPC 3JAMc 4LF9Q 3PUYA 1NBWA 4LF8L 1LUZA 4YWLA 2JA7H 3HOWH 1XTDA 2R93H 4AH6A 5FLMH 1PH4A 1YITA 1L1OB 1HZAA 5C44H 1XMOQ 1VQ5A 3E0EA 1R9TH 1HR0Q 5IWAQ 1KRTA 1NMGA 3S24A 1A63A 4A3JG 2JEBI 4UP7A 2OTJA 3CCRA 5IE8A 4YCVA 2LXKA 1VQOA 1YI2A 2Y0SE 3S2DH 5JJKA 4A3FH 3BJUA 4IPHA 1VQHA 4R4OA 3RZOH 4PMWA 2JA6H 4DR3Q 4GKKQ 3H0GH 4DR1L 3CXCA 4DV5L 1K3RA 3M85A 3CP0A 4R4TA 2IHFA 3H3VH 1JJGA 3M4PA 2NVYH 5IP9H 4JI7L 4BXXH 1UE5A 3KF6B 4C2MH 2RF4A 2R93G 1K8GA 5ELNA 2XTIA 4GS3A 1KL9A 1KC8C 3PF5A 1EIFA 4PZ8A 2HT1A 3GTMH 4A3CG 4ALPA 4IFDJ 3UDGA 3HKSA 1H95A 4HIMA 4LUVA 1V43A 3J80i 1B70B 2DUDA 3E9IA 1YEZA 2Q2HA 4J15A 3OW2A 2YYZA 4POGA 3HOZH 3ERSX 3PV0A 4L5TA 1GD7A 2F3IA 4KLKA 5C3EH 1VQEA 2ZM6Q 4JI2L 1C7YA 1VS0A 3FKIH 4H02A 1IBLL 4A93G 1UE7A 1B8AA 2AMCB 4X62L 2AWOA 3BZCA 3AYHB 1VCIA 2PNHA 2QEXA 1AE2A 4TQUS 1VQLA 1L1OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M9B A;  1TWG H;  2R6G A;  3RR5 A;  3D0F A;  2WAQ E;  1IXR A;  4LUZ A;  5IYD H;  1PH8 A;  4R4C A;  3I55 A;  3G4S A;  1SFO H;  2EIF A;  1D7Q A;  1YJW A;  3PO3 G;  4JI8 Q;  1PVO A;  1PH2 A;  3S14 H;  2ZJP A;  4A3B H;  3CCV A;  3ULJ A;  3RN2 A;  2JK8 A;  4JI3 L;  2VW9 A;  3ER0 A;  4A3L G;  4KHP L;  5C0X G;  5HY6 A;  1EQQ A;  2XGT A;  4HJ5 A;  4A75 A;  3MEF A;  2VQF L;  4A3D H;  2K4K A;  4LFC L;  2YTX A;  4A3K G;  3AFQ A;  5IT9 c;  2IHE A;  1VQ4 A;  4APV A;  2JA8 G;  2D62 A;  1Q86 C;  2R7Z H;  5FJ8 H;  3KF6 A;  4JI4 Q;  4BA1 I;  3S17 H;  1VQ6 A;  1WFQ A;  4IJH A;  1N32 Q;  3I56 A;  1UWV A;  1YHB A;  4LWC A;  3ZJY C;  4B3R Q;  1YVC A;  2EQS A;  4GOP A;  1TWF H;  2JA5 G;  2ALY B;  4FDB A;  4HID A;  2IY5 B;  1LYL A;  1BBW A;  5IP7 H;  2B3G A;  2R92 H;  1L0W A;  2L15 A;  3T1H L;  4C3I H;  4LFB L;  2Q2T A;  1YHQ A;  3MXN B;  5EAY A;  3GO5 A;  5BR8 L;  3RLN A;  4JI6 L;  4DV4 L;  1XPR A;  2E5L L;  2YU9 H;  2OWO A;  3I4N G;  4BBS G;  4LF4 Q;  5M3M H;  1K73 C;  2E8G A;  1VQD A;  3F2C A;  2HQL A;  5K36 G;  1PHJ A;  4HJA A;  3L0O A;  5AJ3 L;  4L5S A;  1SRU A;  3PUW A;  3HOU G;  4DV1 Q;  1HNW L;  1E7Z A;  2VUM G;  2UXD L;  1X3E A;  4OX9 L;  1VQ7 A;  4MZ9 A;  3HOV H;  2VZA A;  1K83 H;  1EOV A;  1GO3 E;  2ID0 A;  1Q7Y C;  2Z6K C;  3U4V A;  2HIX A;  4DK3 C;  4XIG S;  4A3E H;  1Q82 C;  3U50 C;  3W5O A;  1X9N A;  3CQZ H;  3STB C;  4IFD I;  2I5M X;  4P71 A;  1I94 L;  2IX0 A;  2AWN A;  3T1H Q;  1QZH A;  3I4O A;  1JJ2 A;  2HHH Q;  1FJG Q;  1P8L A;  4OON A;  1S72 A;  2NVX H;  2UUA Q;  2B63 G;  3HOX G;  4JV5 L;  3H15 A;  1K0R A;  4A3M G;  3J80 c;  3ULP A;  1P16 A;  5M5W H;  4DV4 Q;  1J5E L;  1KQS A;  2E5L Q;  4BY1 H;  1X6O A;  2GVA A;  1XNR Q;  1Q1B A;  4JI1 L;  2JA7 G;  3HOW G;  1N33 Q;  3UE0 A;  5FLM G;  3J81 j;  1N36 Q;  1HNZ L;  5C44 G;  4L5Q A;  1MKH A;  2GN5 A;  5GAE C;  1OXS C;  5JJL A;  4GNX C;  1EQR A;  2WB1 G;  1U5K A;  1Z47 A;  1I50 H;  4OX9 Q;  5JJI A;  1YZ6 A;  3G6E A;  4DR4 L;  1QVC A;  3AEV A;  3NEN A;  2JA6 G;  3W1G A;  2V1C C;  2K5N A;  3H0G G;  4DV2 L;  4DUZ Q;  4DK6 C;  4QY7 A;  1HNX L;  4K0K Q;  3CW2 C;  4BXX G;  5IP9 G;  1I5F A;  3ULL A;  1IBK L;  1HZB A;  4DR6 Q;  3NEL A;  1CKN B;  4OWX B;  4X66 Q;  2B29 A;  4JI1 Q;  4DV0 Q;  4B3M Q;  4DPG A;  1Q81 C;  1HNZ Q;  3A5Z B;  1C9O A;  5LMN W;  1UE6 A;  4DUY Q;  3HOZ G;  4GLA C;  4JI5 L;  1PV4 A;  1WJJ A;  1X65 A;  1W3S A;  1PYB A;  3FKI G;  1K8A C;  2JA9 A;  1N34 L;  4X6A H;  4JI0 Q;  1PH9 A;  4DR4 Q;  4IJL A;  5IY0 A;  3G71 A;  4LF8 Q;  1JB7 A;  2MO0 A;  2VS1 A;  2KHI A;  3NBH B;  4AYB G;  1X56 A;  2PI2 A;  5IYD G;  1X54 A;  1S3O A;  2QGQ A;  5C4J H;  4GOP B;  2VQE L;  1HNX Q;  5LMU L;  4O0A A;  2Q2U A;  1Q12 A;  1XNQ L;  2VNU D;  1VQI A;  1XMQ L;  1QZG A;  4A3B G;  1VQ9 A;  3K0X A;  3S15 H;  2NVT H;  4C3H H;  1HR0 W;  1Q1E A;  3S1N H;  1OXV A;  3CAM A;  3DLL A;  2PQA B;  4A3D G;  2H5X A;  2BA0 A;  3A74 A;  5J3B A;  4DR1 Q;  3U4Z A;  4BBR G;  4DV5 Q;  2R7Z G;  1NTG A;  3F1Z A;  4LUO A;  1VQB A;  5FJ8 G;  5C0X I;  2A8V A;  3PCO B;  2UU9 L;  1IL2 A;  4GKJ L;  1ASY A;  1CKN A;  1N34 Q;  2Z0S A;  1Q46 A;  3PGZ A;  4JI7 Q;  3GTQ H;  5GRO A;  5ELO A;  3OTO L;  3L7Z C;  1MIU A;  4Y52 H;  1XPU A;  1TWA H;  3AFP A;  4IPG A;  2BH2 A;  2Y0S G;  5IP7 G;  2ZJR A;  2C35 B;  3EIV A;  4R1J A;  2R92 G;  4DV6 L;  4P73 A;  3PIO A;  3S1M H;  4GN4 B;  3KF8 B;  3E9H A;  3HKZ E;  3KDF B;  2NZO A;  4JI2 Q;  4DAM A;  1W2B A;  4B3T L;  1K9M C;  4UP8 A;  3CPW A;  1E24 A;  2ATW A;  1WYD A;  4HJ7 A;  1IBL Q;  1O7I A;  5M3M G;  4X62 Q;  3TS0 A;  4BA2 I;  1VQC A;  1FGU A;  1IZ6 A;  3L2P A;  1VQP A;  1PA6 A;  2EXD A;  4B3S L;  2CWP A;  4PG3 A;  1G6P A;  4Y7N H;  2R7F A;  4A3I H;  4JG2 A;  1JJC B;  4JBK A;  1V1Q A;  2WFW A;  4YY3 L;  1N8R C;  4YCU A;  1Q8K A;  5IYC H;  2MFI A;  3TRE A;  1T9H A;  5FLX c;  3HOV G;  2RCN A;  4OO1 I;  4A3E G;  2PQA A;  4JI3 Q;  4KHP Q;  1CKM A;  2MNA A;  2YTY A;  4DR2 L;  1UE1 A;  3S1Q H;  1PH6 A;  3VDY A;  1Y1V H;  2NVQ H;  2VQF Q;  4LFC Q;  1XPO A;  2CWA A;  4L5R C;  2GVB A;  2E2J H;  3PO3 H;  3KJP A;  3D31 A;  4POF A;  1VQN A;  2K75 A;  4AQY L;  4DR5 L;  4BY1 G;  3UE1 A;  5GQO A;  2K52 A;  1E22 A;  1A0I A;  3NEM A;  1VQM A;  1CKO A;  2KHJ A;  4B3S Q;  3PSI A;  2WB1 E;  4KI0 A;  1KD1 C;  3GTL H;  3CCE A;  5C4X H;  1VQ8 A;  2JE6 I;  3KDF A;  3OYY A;  5M3F G;  4NXN L;  5DLQ E;  3BU2 A;  4DV3 L;  4LFB Q;  5C0X J;  2ASB A;  1NJI C;  2N3S A;  1X3G A;  4DV7 L;  1EWI A;  1GVP A;  2MO1 A;  5JEA J;  4JBW A;  3CC2 A;  4JYA L;  2WP8 J;  5BR8 Q;  5LMN L;  4JI6 Q;  1VQK A;  4NXM L;  3CCS A;  3T1Y L;  2YTV A;  5M5X H;  1KXL A;  2K5H A;  2CCZ A;  4GLX A;  2NN6 G;  4GLV B;  1FL0 A;  2JJQ A;  4X65 L;  2OQK A;  3TRZ A;  5AJ3 Q;  4LFA L;  2MQH A;  1L2F A;  4HIK A;  1KRS A;  4IOC A;  1HNW Q;  1NMF A;  4GN5 A;  1Y1W H;  1IBM L;  4P75 A;  1E3P A;  2UXD Q;  1S40 A;  4LF9 L;  3RZD H;  3FP9 A;  4YWK A;  3GD7 A;  1L1O C;  4XTC S;  4LF5 L;  2ZTE A;  2PI2 E;  1M1K C;  3M4O H;  3K80 C;  5IYB H;  1QVF A;  4JC0 A;  3FHW A;  4A3F G;  1E1T A;  2BA1 A;  5M5Y H;  1XMO L;  1BBU A;  4OWW B;  3HOU H;  1I94 Q;  2K14 A;  2N8N A;  1HR0 L;  2I5L X;  1AH9 A;  3UDX A;  4UP9 A;  1OXT A;  3ICE A;  4IFD G;  3CCQ A;  4JV5 Q;  3PUV A;  3PO2 H;  4QQB X;  1QVG A;  4OXP A;  1VQG A;  3J7Z C;  5LMN Q;  1G29 1;  2FXQ A;  1AE3 A;  3F8T A;  4AYB E;  1J5E Q;  2LXJ A;  2UUC L;  2IX1 A;  2YV5 A;  3RN5 A;  4DNI A;  4GKK L;  1UEB A;  1YBY A;  3KYH C;  3LGJ A;  2RHQ B;  4RMF A;  4X65 Q;  3CCL A;  4BY7 H;  4IOA A;  4NB3 A;  4X64 L;  4LFA Q;  3J7A 5;  4AIM A;  1ASZ A;  4A3G H;  2BH8 A;  4MTN A;  1IBM Q;  3I4M H;  5C3E G;  1YHA A;  3WWV A;  3CCJ A;  4UPA A;  3M7N A;  3K8A A;  4LF5 Q;  3TQY A;  3HOY H;  4QL5 A;  1WOC A;  4DKA C;  4WJ3 M;  4GNX B;  2JA8 H;  4JBJ A;  1QUQ B;  1VQJ A;  1EUJ A;  4IPC A;  4DV2 Q;  1GM5 A;  4RG1 A;  1TWH H;  1SR3 A;  3CME A;  1JT8 A;  2ZM6 L;  1YJ9 A;  1WCM H;  1C0A A;  3PF4 A;  1IBK Q;  3CCM A;  1YJN A;  3F2B A;  2UUC Q;  2CKZ B;  1I6H H;  2Z6K A;  2NZH A;  4HJ8 A;  1CUK A;  4X64 Q;  1M90 C;  5HGQ A;  2CFM A;  3A5U A;  4JI8 L;  1I3Q H;  4JI5 Q;  4O2D A;  1XJV A;  3J81 i;  3RNU A;  4KHZ A;  4P72 A;  2ZTD A;  2E2I H;  4A3J H;  4UY8 C;  1RIP A;  1J6Q A;  2E2H H;  3IRB A;  2OQ0 A;  4EQ5 A;  3A0J A;  3AQQ A;  3HFZ B;  4A3I G;  2VY3 A;  4PZ6 A;  3GTJ H;  3PUZ A;  2VQE Q;  3I7F A;  4JI4 L;  3KFU A;  1PFS A;  3SGI A;  5LMU Q;  5IYC G;  3JC6 6;  1XNQ Q;  4DR7 L;  1XMQ Q;  4LW1 A;  2A1A A;  3EN2 A;  4ME3 A;  1PH7 A;  3M4Q A;  4B3R L;  4IPD A;  4GNX A;  3CD6 A;  2QA4 A;  4TVA B;  5GAH C;  3KJO A;  2ZJQ A;  2ES2 A;  1GKH A;  3TEH B;  2K5V A;  3UDF A;  1DGS A;  1QUQ A;  4YCW A;  1Y1V G;  4A3C H;  1Y14 B;  3CC7 A;  1A62 A;  3GTG H;  1HZC A;  1SE8 A;  4GN3 B;  4OWT B;  4JOI C;  3JAM i;  3GTK H;  3EBE A;  3G48 A;  4GKJ Q;  3CCU A;  1KHI A;  4LF6 L;  1JE5 A;  1VQA A;  3UDI A;  3W1B A;  2UU9 Q;  2D0O A;  4PZ7 A;  3M3Y H;  1EFW A;  3OTO Q;  2RHS B;  5JEA G;  4A93 H;  1SRO A;  2KBN A;  4A4I A;  2N49 A;  1NY4 A;  4C3J H;  4LF4 L;  2N78 A;  1OXU A;  4A76 A;  1EIY B;  1MJC A;  1EYG A;  5C4X G;  4BBR H;  2JQO A;  4HJ9 A;  1N32 L;  2KEN A;  4DAY B;  4DV1 L;  4DV6 Q;  1B7Y B;  1KAW A;  1MJE A;  2R7D A;  4MNO A;  4DR7 Q;  2WAQ G;  4R4Q A;  3K7A H;  2UUB L;  1TXY A;  4NPS A;  2F52 A;  4B3T Q;  1KIX A;  2D0P A;  4A3L H;  1FVI A;  3S1R H;  5GAD C;  3S16 H;  1YIJ A;  1PH1 A;  2HIV A;  3RLO A;  2HHH L;  1FJG L;  4A3K H;  1LTL A;  2DGY A;  2IT1 A;  3DM3 A;  2UUA L;  4HIO A;  2UXC L;  1E1O A;  2ZTC A;  3GTO H;  1LM0 A;  2LSS A;  1IYJ B;  2I5H A;  4QGU A;  1D8L A;  1Y1W G;  4YY3 Q;  4LF6 Q;  1X3F A;  1XNR L;  2JEA I;  1BVS A;  3HKZ G;  1V9P A;  2NN6 I;  1CSP A;  3K7U C;  5IYB G;  2I0Q A;  4YHH L;  2VL6 A;  1N33 L;  4OO1 G;  2Q2I A;  4DR2 Q;  2JA5 H;  3I2Z A;  5E7N A;  1N36 L;  2F4V L;  1SMX A;  2K50 A;  1PH3 A;  4LF7 L;  1PH5 A;  1TWC H;  2AHO B;  1JMC A;  1PYS B;  3GDE A;  1NE3 A;  3CC4 A;  1SLJ A;  3KLW A;  2UUB Q;  3PO2 G;  2PMZ E;  4AQY Q;  4DR5 Q;  2UXB L;  1G51 A;  2CQO A;  2A19 A;  4R4I A;  1SN8 A;  1U0L A;  3PUX A;  2KCM A;  3J81 c;  2KCT A;  2OCE A;  1X55 A;  3I4N H;  4BBS H;  4QIW E;  3H3V I;  4DUZ L;  4BY7 G;  1OTC A;  1WI5 A;  3K81 C;  1BKB A;  4K0K L;  1Z9F A;  2UXC Q;  3B6Y A;  4JCV E;  1A8V A;  2AKW B;  3CMA A;  4IO9 A;  3STB D;  4A3G G;  3I4M G;  4NXN Q;  5IWA L;  2VUM H;  4DR6 L;  4DV3 Q;  1YNX A;  4EX5 A;  4X66 L;  4DV7 Q;  1RL2 A;  3HOY G;  1N9W A;  2OTL A;  4WJ4 A;  3U58 A;  4DV0 L;  1HZ9 A;  4B3M L;  4JYA Q;  4JBM A;  4YHH Q;  4LNQ A;  4NXM Q;  1VQF A;  4YWM A;  1HH2 P;  3CPF A;  3F2D A;  3T1Y Q;  4P74 A;  2F4V Q;  1HJP A;  4DUY L;  3RLF A;  4DR3 L;  4LF7 Q;  3BZK A;  3CF5 A;  5M3F H;  1CSQ A;  5GAG C;  5H1S E;  2B63 H;  1WCM G;  4QJF A;  3HOX H;  3GTP H;  3Q8D A;  3KOJ A;  1OXX K;  4JOI A;  3TS2 A;  4JI0 L;  2UXB Q;  3S2H H;  3PIP A;  4A3M H;  4GOP C;  3JAM c;  4LF9 Q;  3PUY A;  1NBW A;  4LF8 L;  1LUZ A;  4YWL A;  2JA7 H;  3HOW H;  1XTD A;  2R93 H;  4AH6 A;  5FLM H;  1PH4 A;  1YIT A;  1L1O B;  1HZA A;  5C44 H;  1XMO Q;  1VQ5 A;  3E0E A;  1R9T H;  1HR0 Q;  5IWA Q;  1KRT A;  1NMG A;  3S24 A;  1A63 A;  4A3J G;  2JEB I;  4UP7 A;  2OTJ A;  3CCR A;  5IE8 A;  4YCV A;  2LXK A;  1VQO A;  1YI2 A;  2Y0S E;  3S2D H;  5JJK A;  4A3F H;  3BJU A;  4IPH A;  1VQH A;  4R4O A;  3RZO H;  4PMW A;  2JA6 H;  4DR3 Q;  4GKK Q;  3H0G H;  4DR1 L;  3CXC A;  4DV5 L;  1K3R A;  3M85 A;  3CP0 A;  4R4T A;  2IHF A;  3H3V H;  1JJG A;  3M4P A;  2NVY H;  5IP9 H;  4JI7 L;  4BXX H;  1UE5 A;  3KF6 B;  4C2M H;  2RF4 A;  2R93 G;  1K8G A;  5ELN A;  2XTI A;  4GS3 A;  1KL9 A;  1KC8 C;  3PF5 A;  1EIF A;  4PZ8 A;  2HT1 A;  3GTM H;  4A3C G;  4ALP A;  4IFD J;  3UDG A;  3HKS A;  1H95 A;  4HIM A;  4LUV A;  1V43 A;  3J80 i;  1B70 B;  2DUD A;  3E9I A;  1YEZ A;  2Q2H A;  4J15 A;  3OW2 A;  2YYZ A;  4POG A;  3HOZ H;  3ERS X;  3PV0 A;  4L5T A;  1GD7 A;  2F3I A;  4KLK A;  5C3E H;  1VQE A;  2ZM6 Q;  4JI2 L;  1C7Y A;  1VS0 A;  3FKI H;  4H02 A;  1IBL L;  4A93 G;  1UE7 A;  1B8A A;  2AMC B;  4X62 L;  2AWO A;  3BZC A;  3AYH B;  1VCI A;  2PNH A;  2QEX A;  1AE2 A;  4TQU S;  1VQL A;  1L1O A; 
#chains in the Genus database with same CATH topology
 3M9B A;  3RR5 A;  3D0F A;  2WAQ E;  4IAL A;  2ZXR A;  4K14 A;  5I6W A;  1D5X C;  4PV1 C;  3PO3 G;  2ZXP A;  4RGO S;  3S14 H;  1W6K A;  2K03 A;  2RCF A;  1Y1W B;  4A3L G;  1TY0 A;  4J1M A;  2CVR A;  2XGT A;  3RZD B;  1AEX A;  3HKZ B;  1ILQ A;  3MEF A;  4A3D H;  4LFC L;  2D62 A;  2R7Z H;  3KF6 A;  5I2Y A;  3HOU B;  3DEP A;  3HRZ C;  1N32 Q;  3I56 A;  4B3R Q;  4MIU A;  2EQS A;  3E0J A;  1ESR A;  1H9K A;  1BBX C;  3ITP A;  2L15 A;  1L0W A;  3VA7 A;  2K6A A;  4LFB L;  1Q3L A;  4JPB W;  1STN A;  3GO5 A;  4K5V A;  2KCC A;  3DWQ A;  3FMC A;  3VR2 A;  3I4N G;  4BBS G;  4LF4 Q;  3V05 A;  5K36 G;  1S4Z A;  1HNW L;  2VUM G;  2EY2 A;  4C1N I;  3NXW A;  1TWH B;  4OX9 L;  2B8F A;  3C3L A;  1PTO H;  3TP5 A;  2Z6K C;  4DK3 C;  4A3E H;  1K8M A;  1SYE A;  1X9N A;  3STB C;  1QNK A;  2I5M X;  4IFD I;  5FKA C;  1BOS A;  4OON A;  2UUA Q;  2NVX H;  4JV5 L;  3HEJ A;  4DXF A;  4A3M G;  4C2M B;  1J5E L;  1KQS A;  3IFT A;  1D1I A;  2GVA A;  1HFN A;  4A3J B;  4JI1 L;  2JA7 G;  2NYZ D;  3FVQ A;  1N33 Q;  1WVL A;  4L5Q A;  1HA5 A;  1MKH A;  2GN5 A;  2Z9H A;  1SAP A;  1OXS C;  3SK8 A;  1WTV A;  1EQR A;  5JJL A;  1PZK D;  5BN5 A;  3OWE B;  3OOC A;  1FYC A;  2WIN B;  4DR4 L;  1QVC A;  3MXU A;  2L1B A;  5JAV A;  5EKI A;  3NEN A;  3W1G A;  3J7A V;  2RSO A;  5COR A;  1QIL A;  3NE5 B;  4DN4 M;  1IBK L;  3EVQ A;  1HZB A;  1VMC A;  3GTK B;  1LT3 D;  4X66 Q;  1QJO A;  1Q81 C;  1LAB A;  1C9O A;  5C3W A;  3L9A X;  1SNP A;  4C3J B;  1UE6 A;  4RAU C;  4JI5 L;  1X65 A;  2Z6B A;  4IFD H;  2PZW A;  1SYC A;  1K8A C;  2JA9 A;  4X6A H;  4R9W A;  4JI0 Q;  2F0T A;  4IJL A;  5IY0 A;  3OMG A;  2PZU A;  1ZKO A;  2G5D A;  2MO0 A;  1JQY D;  3BDL A;  1SYD A;  2ICI A;  4GOP B;  5C4J H;  2L5T A;  3ONA B;  4QB4 A;  2VNU D;  1VQI A;  2C9O A;  1CQV A;  4NMZ A;  5EBC A;  1VQ9 A;  4A3B G;  3S15 H;  2H1E A;  2NVT H;  3G7L A;  4C3H H;  3MXG A;  1QNU A;  1BNZ A;  2BA0 A;  4RWS C;  2JA5 B;  1I4G A;  3IFD A;  1MHW C;  3U4Z A;  3AMU A;  4LUO A;  1DJR D;  3I72 A;  1K3B C;  1ASY A;  1D7Q A;  2Z0S A;  1Q46 A;  4CKC A;  3I3C A;  3GQB A;  1K8O A;  4B08 A;  4ZKB B;  1TWA H;  1X32 A;  3OW7 A;  2B2T C;  3R93 A;  4FF3 A;  5L37 A;  5IP7 G;  1FD7 D;  2C35 B;  3EIV A;  4DV6 L;  1PDQ A;  4P73 A;  3PIO A;  4GN4 B;  4DAP A;  4FF1 A;  3GV3 A;  1W2B A;  4DAM A;  1K9M C;  1E24 A;  3HGB A;  1WYD A;  2DNE A;  5M3M G;  1S5E D;  4K8J A;  1VQC A;  2QKI C;  4BA2 I;  3T56 B;  4B3S L;  2CH4 A;  1JJC B;  3NHH A;  4BWG B;  3DMU A;  1Q8K A;  4OO1 I;  2YTY A;  3IAY A;  1PH6 A;  4S3S A;  1AW7 A;  4LFC Q;  3HOW B;  2E2J H;  5KIX A;  4DAV A;  5C44 B;  2K75 A;  4AQY L;  1EEF D;  1R9T B;  3EJI A;  1EYC A;  4BY1 G;  3TDQ A;  2WB1 B;  5GQO A;  5M9O A;  4UDU C;  1E22 A;  4OEM B;  2NWG A;  2MP1 A;  3PSI A;  4KI0 A;  4RH6 A;  1KD1 C;  1VQ8 A;  1V1O A;  2JA6 B;  5M3F G;  4DV3 L;  4LFB Q;  2ASB A;  1EWI A;  3CC2 A;  4JBW A;  4JYA L;  2WP8 J;  3WDN A;  4L8J A;  2NN6 G;  2EOT A;  2F0I A;  2KHS A;  1EY9 A;  2MQH A;  1L2F A;  1HNW Q;  1KRS A;  4QIW B;  2K05 A;  1IKL A;  3FP9 A;  4LF5 L;  1CQF A;  1DCZ A;  1YNN C;  2AQ2 B;  2PPB C;  2F0G A;  3M4O H;  3FKI B;  1QVF A;  2D5D A;  3BS1 A;  4JC0 A;  4OO1 H;  2EXZ A;  4RKL A;  1BBU A;  1HR0 L;  1TWG B;  4AYB B;  1D6E C;  5ELE A;  4JV5 Q;  3NTI A;  5LMN Q;  1G29 1;  1LO5 D;  4PMC A;  1J5E Q;  2IX1 A;  1HA6 A;  4GKK L;  1YBY A;  3KYH C;  3LGJ A;  4H13 C;  4RMF A;  4LMQ D;  3RMH A;  1K28 A;  4X65 Q;  3CHB D;  3O13 A;  4LFA Q;  4CDC C;  4AIM A;  5C3E G;  3I91 A;  1FR3 A;  1WTP A;  3K8A A;  3MC0 B;  2TSS A;  3E3X A;  1DD2 A;  3S17 B;  3MVV A;  4JBJ A;  3SDZ A;  1OO9 B;  1TWF B;  1ZXT A;  4IPC A;  2JYO A;  1CFM A;  1GM5 A;  1SR3 A;  2L0C A;  1WCM H;  1C0A A;  4V0B A;  2R92 B;  1IBK Q;  4C3I B;  3CCM A;  2UUC Q;  2YU9 B;  1FNU A;  3VR6 A;  3FRP B;  1CUK A;  1SYF A;  4X64 Q;  1U4L A;  1B4O A;  1I3Q H;  4JI5 Q;  1XJV A;  2IL8 A;  4UY8 C;  3WOF A;  2KCN A;  3WOE A;  3HOV B;  1RIP A;  1J6Q A;  1K83 B;  2E2H H;  3H91 A;  3IRB A;  2OQ0 A;  2KEE A;  3K57 A;  3KLR A;  4JI4 L;  3SGI A;  2EY1 A;  1PH7 A;  2A1A A;  2R93 H;  3CD6 A;  2K01 A;  4HR7 B;  1SE2 A;  4TVA B;  1LV9 A;  2ES2 A;  3TEH B;  2K5V A;  3UDF A;  1B50 A;  4YCW A;  1Y1V G;  3TBI B;  2LKV A;  4G7Z C;  1HZC A;  1SE8 A;  3QR8 A;  4LF6 L;  4PZ7 A;  5I4D A;  4OIK A;  1I50 B;  4A93 H;  3EFX D;  2N78 A;  1OXU A;  1EIY B;  4HJ9 A;  3P7J A;  2KOL A;  4DAY B;  1H9J A;  4FO2 A;  1GHJ A;  4DV6 Q;  1KAW A;  3OIP A;  2WAQ G;  4R4Q A;  1EWC A;  4OGQ C;  1Y8P B;  2F52 A;  4NPS A;  2E75 C;  2D0P A;  3I8Z A;  3C2P A;  2BE5 D;  4A3L H;  4J8Q A;  1FVI A;  4FF2 A;  5ELC A;  3S16 H;  4RCO A;  3KLS A;  3RLO A;  2HHH L;  2EYL A;  2HDM A;  1D1K A;  2IPK D;  2DGY A;  2A6H C;  5ISR A;  3N6R A;  1SE3 A;  1LM0 A;  4RGM A;  4QGU A;  1RKN A;  1CSP A;  1CHQ D;  3TN2 A;  5KNC A;  3I2Z A;  1SBB B;  2K50 A;  4KK7 A;  2DY7 A;  4LF7 L;  3VYT A;  3GDE A;  2F3W A;  1RD9 D;  1SLJ A;  2UUB Q;  3PO2 G;  4AQY Q;  4KY7 A;  2PZT A;  2TMP A;  2B2V A;  3I4N H;  4BBS H;  3S1N B;  4R8N A;  4DAY A;  4OL7 A;  1WI5 A;  1GUS A;  4ZAI A;  1OTC A;  3NTH A;  1SEB D;  3PIP 3;  4JCV E;  4JK1 C;  4DR6 L;  5IWA L;  2VUM H;  4DV3 Q;  4NP5 A;  2A69 C;  1RL2 A;  3HG9 A;  2OTL A;  4JYA Q;  4FNF A;  2JA8 G;  3QB3 A;  2EPB A;  3BYY B;  4MN3 A;  4LNQ A;  1HH2 P;  3CPF A;  1BCP B;  1HJP A;  4LAA A;  4DUY L;  1A2U A;  5FOB B;  4K6L A;  1C8C A;  1EQT A;  1ICW A;  2MGS A;  5GAG C;  2QIL A;  2F0U A;  4L63 B;  1HRJ A;  1EZ6 A;  4JOI A;  3S1M B;  2UXB Q;  3S2H H;  4A3M H;  1NBW A;  1IW7 C;  1A6X A;  4YWL A;  2JA7 H;  3T16 A;  2N88 A;  2EDG A;  3FEW X;  1HR0 Q;  1PLF A;  2J0T D;  4F88 A;  1KRT A;  1G6Z A;  4Y7N B;  2JEB I;  4DK1 A;  2OTJ A;  3CKI B;  5IE8 A;  3ZYY X;  1VQO A;  5JJK A;  1H9R A;  4A3F H;  1VQH A;  4R4O A;  4GKK Q;  4DR1 L;  4CGY B;  5CV7 A;  4X3U A;  2NVQ B;  3M85 A;  1SMY C;  4KN4 C;  3R8B A;  3M4P A;  1UE5 A;  3PO3 B;  2JN4 A;  4B9X A;  3PF5 A;  4A3C G;  2F0K A;  3GTM H;  1H95 A;  2KA7 A;  1EY7 A;  3GTL B;  1K0S A;  2ZT9 C;  3ERS X;  5KYL A;  1VQE A;  1C7Y A;  3KK7 A;  1TII D;  3NQT A;  2WAC A;  3NK9 A;  1B8A A;  2AMC B;  4X62 L;  1LT6 D;  3AYH B;  2PNH A;  1EFI D;  1DOM A;  1AE2 A;  1EL0 A;  4TQU S;  1NR2 A;  5M5X B;  2R6G A;  2IJ0 A;  2Z1C A;  1IXR A;  1DOK A;  1I4H A;  5NUC A;  4KY6 A;  3G4S A;  1EWH A;  1YJW A;  2X69 A;  4KJO A;  4A3B H;  3CCV A;  1AFP A;  1SYB A;  5CBA E;  4A75 A;  2VQF L;  1ET9 A;  2K4K A;  3PMF A;  4A3K G;  1LTI D;  4M1U B;  4PMB A;  5IT9 c;  3TSS A;  1Q86 C;  3TP8 A;  1ONL A;  4JI4 Q;  1MD2 D;  1XX8 A;  1WFQ A;  1UWV A;  4CJ2 C;  5FO8 B;  1JCK B;  5IOC A;  2XIW A;  2OEO A;  4XYQ A;  5CR3 A;  3OMC A;  1A3V A;  1BBW A;  3MEH A;  5IP7 H;  1EY8 A;  2F0W A;  1CM9 A;  1F2Y A;  2DJF C;  4BY7 B;  1YHQ A;  5J1Z A;  1XTC D;  2AQ3 B;  4JI6 L;  4UHV A;  4A3M B;  4MTK A;  3T51 B;  4A3G B;  3I4M B;  3SK4 A;  2ENB A;  5M3M H;  3HOY B;  1A15 A;  1STY A;  1VQD A;  4CJ0 B;  3L0O A;  1EY6 A;  5EPJ A;  3D4W A;  4L5S A;  3PUW A;  2B2Y A;  2UXD L;  1VQ7 A;  1PFM A;  1SNQ A;  2FJ2 A;  2ID0 A;  4K5W A;  3U4V A;  2HIX A;  5TSS A;  4XIG S;  5FK9 C;  3UI2 A;  2GA4 B;  1I6H B;  4P71 A;  2HHH Q;  3T1H Q;  2AWN A;  1QZH A;  3TP6 A;  1P8L A;  2B63 G;  1KAA A;  3H15 A;  4QCL A;  1K0R A;  1D2B A;  4FVM A;  2B2U A;  3J80 c;  3VR4 A;  4DV4 Q;  4H7B A;  2E5L Q;  4DFA A;  4BY1 H;  2E2I B;  2WKD A;  5FLM G;  2XVS A;  1WD0 A;  2MUY A;  3NTK A;  1Z47 A;  3GTJ B;  5DM7 3;  4N8X 1;  3G6E A;  2A6E D;  4CKB A;  5LL6 S;  2EYJ A;  2PYK A;  2F4I A;  2K5N A;  3H0G G;  1Q8I A;  2A68 D;  2LY7 A;  4DV2 L;  3CW2 C;  1WTX A;  2PO4 A;  4HN7 A;  3ULL A;  4DR6 Q;  5KND A;  2FHT A;  1AP0 A;  4DPG A;  3K5M A;  4DUY Q;  2KJX A;  2QW7 A;  3GV6 A;  1PV4 A;  3HOZ G;  2IX3 A;  1W3S A;  3E5S A;  3P20 A;  1PH9 A;  2K28 A;  3K7A B;  3OWF A;  1LT4 D;  2KQ3 A;  1PZJ D;  3NBH B;  2KHI A;  4J6H A;  5IYD G;  1V8Q A;  2PI2 A;  1TS5 A;  1S3O A;  1X54 A;  4JW0 A;  1HNX Q;  4ID6 A;  5DNF A;  1XNQ L;  3NWT A;  4N9T A;  4RFB A;  1EY5 A;  1HR0 W;  2PQA B;  3A55 A;  2HUG A;  1LTA D;  4FP5 D;  4DR1 Q;  1NTG A;  2UU9 L;  2QEJ C;  1SNM A;  1TR5 A;  4QF4 A;  1F9P A;  4EQN A;  4HAE A;  1A3T A;  5CGK A;  4K6D A;  2BH2 A;  2Y0S G;  2KUM A;  1SND A;  1J9O A;  5I6Y A;  3KF8 B;  5EKK A;  5EQ0 A;  3KDF B;  3TME A;  4G4K A;  4RGN A;  4HJ7 A;  2EY5 A;  4K2L A;  4X62 Q;  3NBH A;  3L2P A;  1VQP A;  4TKO B;  1CA5 A;  4P2C B;  1TQO A;  2EJF C;  4JBK A;  1V1Q A;  4YY3 L;  1N8R C;  5M3F B;  3TRE A;  1T9H A;  3HOX B;  2PQA A;  1SJE D;  3TZU A;  4DR2 L;  1G8Z D;  1SNO A;  3MTS A;  3G6J B;  1Y1V H;  1STH A;  2VQF Q;  2SEB D;  4XT3 B;  1XPO A;  4L5R C;  3Q23 A;  3KJP A;  3D31 A;  1ENF A;  1O80 A;  4Q5V A;  2G9D A;  2Q8T A;  5FO9 B;  2K52 A;  4HTH A;  1CKO A;  1T5X D;  2WB1 E;  3S2D B;  1L0Y B;  3KF8 A;  1HPC A;  1LTB D;  2JE6 I;  3KDF A;  3OYY A;  5JVH 3;  4DF7 A;  5C0X J;  1NJI C;  1X3G A;  2MO1 A;  5JEA J;  3MWY W;  1JE4 A;  3R2I A;  5LMN L;  4JI6 Q;  2NZ1 D;  1KXL A;  2K5H A;  1EQV A;  3OHX C;  2H4O A;  4X65 L;  3TRZ A;  3TZD A;  4LFA L;  1HXY D;  1BF4 A;  4FXG C;  4P75 A;  1CHP D;  2HD3 A;  2UXD Q;  5C3E B;  1PRT B;  4YWK A;  1L1O C;  3K0Y A;  1M1K C;  3K80 C;  2NB0 A;  1JB3 A;  4FYD A;  4A3F G;  1E1T A;  4ZRZ A;  5M5Y H;  2F0F A;  4H44 C;  4UP9 A;  1SXT A;  3M4Y A;  3PUV A;  1RDP D;  3PO2 H;  4QQB X;  1QVG A;  4AYB E;  1AE3 A;  1BUV T;  3S14 B;  4CHT B;  2UUC L;  1ZYR D;  2YV5 A;  3VR3 A;  1NCV A;  4DNI A;  2RHQ B;  2M2L A;  4IOA A;  4B9W A;  4X64 L;  4A3D B;  1PFN A;  4TRD A;  4ILW A;  1IBM Q;  3M7N A;  2CW0 D;  3WWV A;  2R7Z B;  4ZLT F;  1EIH A;  3I4L A;  4GNX B;  2JA8 H;  3LWU A;  3J7A F;  4DV2 Q;  1JT8 A;  4HCE A;  5IT9 E;  2ZM6 L;  1HTP A;  2HQE A;  1ET6 A;  2R61 A;  3D4D A;  1W6J A;  2M00 A;  1AN8 A;  2F0N A;  2LS0 1;  2NZH A;  4HJ8 A;  5J39 A;  1M90 C;  5HGQ A;  1M4V A;  5C6A A;  4O2D A;  2JXM B;  4P72 A;  4X3K A;  3IKJ A;  1CK1 A;  5IT9 L;  4IUQ A;  2FMM A;  1PTO B;  2VB3 X;  4A3E B;  3AQQ A;  2DJG C;  4A3I G;  2VY3 A;  2SOB A;  1H9S A;  3I7F A;  1PFS A;  3KFU A;  2I07 B;  1XNQ Q;  4LW1 A;  2NVX B;  1SE4 A;  2WAQ B;  4GNX A;  2QA4 A;  2NUC A;  3NPP A;  1GKH A;  1E0B A;  4A3C H;  3HZX A;  1Y14 B;  2ICE C;  1JR0 D;  3GTG H;  4OWT B;  2F0E A;  1BR9 A;  3JAM i;  2C5C A;  3CCU A;  3MA2 B;  2UU9 Q;  3UDI A;  4I7A A;  2V4D A;  3M3Y H;  2RHS B;  5JEA G;  1TU2 B;  3J80 E;  5F2D A;  1SRO A;  1NY4 A;  2Q8I B;  4HED A;  1MBY A;  5BN3 A;  1EYG A;  1S5C D;  5C4X G;  4BBR H;  4DV1 L;  3P1H A;  2R7D A;  4DR7 Q;  5ELF A;  2UUB L;  1TXY A;  3N52 A;  1U9R A;  4RGT A;  3QO2 A;  3S1R H;  2Z4H A;  5GAD C;  3MFY A;  1PH1 A;  1RHP A;  3J80 L;  4A3K H;  1LTL A;  4V19 0;  2MPM A;  4HIO A;  2ZTC A;  1Y1W G;  1D8L A;  2B2W A;  2SDF A;  4YY3 Q;  1BVS A;  3K59 A;  3HKZ G;  4RCN A;  3D4R A;  1O7L A;  1S5D D;  5IYB G;  2VL6 A;  4DR2 Q;  3H94 A;  3DWA A;  2OF1 A;  1TWC H;  1NE3 A;  5C4J B;  1PRT D;  2D2C C;  2UXB L;  2CQO A;  1R4P B;  1U0L A;  1QB5 D;  5T1I A;  3J81 c;  2KCT A;  3S15 B;  2NVT B;  4C3H B;  2HCC A;  1BXT A;  4FXK C;  1KNA A;  4K0K L;  1IKM A;  4IUU A;  1IYV A;  3E6Z X;  5E4W C;  3MHB A;  3U58 A;  4DV0 L;  1HZ9 A;  1LTT D;  4JBM A;  4YWM A;  2MJ8 A;  4KD3 A;  2F4V Q;  1TWA B;  3A7A B;  1JOR A;  3RLF A;  3BZK A;  1HTL D;  5H1S E;  1JOO A;  2B63 H;  3GTP H;  3OIQ A;  3TS2 A;  2EE1 A;  1Q90 A;  1T5E A;  4GOP C;  4DGZ A;  5I9O A;  4DNT B;  1S5B D;  3IL8 A;  1XTD A;  5FLM H;  3C1F A;  1NR4 A;  1VQ5 A;  2CQA A;  2R3Z A;  4A3J G;  4UP7 A;  1B1Z A;  5LHY 1;  2LXK A;  2Y0S E;  3ERO A;  3BJU A;  3RZO H;  4PMW A;  3H0G H;  3DM1 A;  4DV5 L;  4PNY A;  5J22 A;  2PQE A;  2NVY H;  1KDA A;  1LTR D;  2E2J B;  1K8G A;  1KL9 A;  4XYO A;  1PTO D;  1KC8 C;  1HUN A;  1XWE A;  4IFD J;  3UDG A;  3HKS A;  4LUV A;  1V43 A;  1PZI D;  3E9I A;  1YEZ A;  4ZCK A;  3OW2 A;  3HOZ H;  2F0Q A;  3PV0 A;  4JI2 L;  1GD7 A;  1NAP A;  2F3I A;  2ZM6 Q;  1YNJ C;  1JOQ A;  1PYW D;  1QCB D;  1IBL L;  4G7O C;  4HMJ A;  3BG3 A;  3BZC A;  2QEX A;  5KEE A;  5D14 A;  1YNJ D;  5IYD H;  4LUZ A;  1PH8 A;  3I55 A;  1SFO H;  2RDF A;  2ZXO A;  3ULJ A;  2LFN A;  3RN2 A;  1WTW A;  4JI3 L;  4KHP L;  2VW9 A;  5HY6 A;  1EQQ A;  1B53 A;  4HJ5 A;  3M4O B;  1AZP A;  3BZD B;  2YTX A;  3AFQ A;  4RHR A;  4APV A;  3MZ5 A;  2BE5 C;  4EQP A;  4BA1 I;  1VQ6 A;  4IJH A;  5C5M A;  4LWC A;  3ZJY C;  1YVC A;  2LMC B;  2JA5 G;  3A56 A;  2ALY B;  4FDB A;  1EU3 A;  2IY5 B;  1LYL A;  2B3G A;  1F2M A;  3T1H L;  1TT2 A;  3MXN B;  2K33 A;  3GTP B;  3DHQ A;  5BR8 L;  1UAP A;  3BVG A;  4QUF A;  4DV4 L;  1XPR A;  2E5L L;  4ZQ3 A;  2OWO A;  2HCI A;  1SYG A;  1K73 C;  4ME5 A;  1PHJ A;  1SRU A;  4EGV A;  4DV1 Q;  1B9M A;  4MZ9 A;  1JWS D;  1EOV A;  1WCM B;  2JSO A;  1Q7Y C;  3U50 C;  2XNA C;  3CQZ H;  3BDC A;  4IZ8 A;  3SVM A;  2QCP X;  3GTO H;  1I94 L;  5A2Q E;  3I4O A;  1S72 A;  1F77 A;  2G9H D;  1B9N A;  1DZ1 A;  1I3Q B;  5M5W H;  1AZQ A;  1I4P A;  5IGD A;  3BVZ A;  3HOW G;  2WV6 D;  1LT5 D;  1STB A;  3UE0 A;  3J81 j;  5C44 G;  2E2H B;  3AB9 A;  3QWN A;  3MXN A;  5GAE C;  1EYA A;  4ZUI A;  1CTM A;  2WB1 G;  5EBD A;  5A2Q L;  4XT1 B;  1II3 A;  5G3L D;  5JJI A;  1QE6 A;  3AEV A;  4HCS A;  4ZK9 B;  2R93 B;  1E2V A;  1LTG D;  2EVB A;  3MFG A;  2XRQ D;  2V1C C;  2JA6 G;  1Y8N B;  1HFG A;  1NSN S;  4QY7 A;  1HNX L;  4K0K Q;  1I5F A;  3NEL A;  1GJX A;  2F0S A;  2K1B A;  4DV0 Q;  1HNZ Q;  4A93 B;  3A5Z B;  3X3N A;  5LMN W;  4IUP A;  1PXU A;  4GLA C;  3FPU B;  1GUG A;  1PYB A;  3FKI G;  1RCV D;  3BVM A;  2RBM A;  1XYI A;  3G71 A;  4AYB G;  1X56 A;  3S16 B;  2QGQ A;  5CC4 A;  5LMU L;  4O0A A;  1Q12 A;  1XMQ L;  3K0X A;  2EJM A;  4HMI A;  5C5L A;  3DLL A;  4QMG A;  4H0L C;  3DWP A;  5HGT A;  3PIO 3;  5JPN C;  5EGT A;  2EZV A;  4BBR G;  4DV5 Q;  1EZ8 A;  3F1Z A;  5FJ8 G;  1VQB A;  5C0X I;  4GKJ L;  2Z4I A;  5E3F A;  1F2L A;  2F0P A;  2F1M A;  2HDL A;  2N55 A;  1N34 Q;  3K5N A;  1Z6H A;  2B2V C;  3GTQ H;  5ELO A;  3OTO L;  1MIU A;  1XPU A;  3CQZ B;  3L3O C;  4R1J A;  2R92 G;  3I4N B;  4BBS B;  4C3I G;  1EOT A;  1TKW B;  3E9H A;  3HKZ E;  4JI2 Q;  1E2W A;  4CBV A;  4B3T L;  3CPW A;  2VUM B;  1KLU D;  1IBL Q;  5E4X A;  4X3T A;  1O7I A;  1RTN A;  3TS0 A;  2NTS A;  3J81 E;  3QG1 A;  2CWP A;  4EQO A;  2R7F A;  4A3I H;  1GOZ A;  4JG2 A;  3KBX A;  3SEB A;  2MFI A;  3HOV G;  2RCN A;  1HQR D;  2L9H A;  4JI3 Q;  4KHP Q;  3S2H B;  1CKM A;  4MHE A;  2MNA A;  3S1Q H;  1UE1 A;  5AFW A;  3URY A;  1EEI D;  2FMC A;  1RTO A;  2JA7 B;  2CWA A;  2RDG A;  2GVB A;  3J81 L;  1VQN A;  1RF2 D;  4DR5 L;  3I73 A;  3UE1 A;  4C56 C;  5JEA H;  1G2S A;  1A0I A;  2L11 A;  2KHJ A;  1ILP A;  1U4P A;  4L6T B;  3U9O A;  3CCE A;  4A3F B;  4ZKC B;  5C4X H;  1B44 D;  2N3S A;  1BCP C;  4DV7 L;  3S9W A;  1F2Z A;  5BR8 Q;  1VQK A;  4NXM L;  4ZUJ A;  3CCS A;  2YTV A;  1VMP A;  1GHK A;  1QWY A;  4RHS A;  5FO7 B;  1EY0 A;  1BCP D;  5IGG A;  4KV6 A;  4GLV B;  2F0O A;  1FL0 A;  2JJQ A;  3GTM B;  1O78 A;  1O7Z A;  1STG A;  2A6E C;  4IOC A;  4IUT A;  1NMF A;  1CT1 D;  1Y1W H;  1IBM L;  3MXP A;  3RZD H;  3ND9 A;  3GD7 A;  4XTC S;  2A68 C;  2ZTE A;  1E2Z A;  5IYB H;  1BCP F;  3FHW A;  3QIA A;  3NBI A;  1B2T A;  4OWW B;  2XSC A;  1I94 Q;  2K14 A;  3HOU H;  1AH9 A;  5ELB A;  3UDX A;  3ICE A;  2A74 C;  2FXQ A;  4A3B B;  1SSO A;  2XWB B;  4NB3 A;  2K7V A;  3A8I E;  1WTR A;  3J7A 5;  1ASZ A;  1IL2 A;  2BH8 A;  3V2T A;  4UPA A;  4QL5 A;  3T13 A;  1WOC A;  3V96 A;  4DKA C;  4WJ3 M;  3X3M A;  4X3S A;  4DU9 A;  1QUQ B;  1VQJ A;  2B8G A;  5IIF A;  5DAU A;  5JVG 3;  4RG1 A;  1TWH H;  5DM6 3;  3CME A;  4XQN A;  2A73 B;  1YJ9 A;  3PF4 A;  4CDE C;  1EYD A;  2VXW A;  3F2B A;  2XRS D;  2EYH A;  5JPM C;  2Z6K A;  5M3M B;  2CFM A;  3A8K E;  5CV6 A;  4IUR A;  4JI8 L;  3RNU A;  1DOL A;  1F9S A;  4A3J H;  5FLX E;  2CHB D;  4I65 A;  3A0J A;  3HFZ B;  1I4R A;  5KYI A;  2B2U C;  2J7Z A;  3A54 A;  5EKL A;  2VB2 X;  5LMU Q;  5IYC G;  4DR7 L;  1XMQ Q;  4ME3 A;  3EN2 A;  4IPD A;  2NBF A;  5GAH C;  3D6W A;  1QUQ A;  4BY1 B;  5FLX L;  5EPL A;  4NW2 A;  3CC7 A;  1ENC A;  2DN8 A;  3FPP A;  2O5I C;  5CV5 A;  3GTK H;  3EBE A;  3G48 A;  4N8F A;  4GKJ Q;  1JE5 A;  1VQA A;  3W1B A;  1HCZ A;  4DK0 A;  3OTO Q;  5JOB A;  1GUO A;  2K5W A;  2DNC A;  4C3J H;  4RKB A;  3QOL A;  1MJC A;  2JQO A;  2KEN A;  2OXP A;  4M8A A;  1U4R A;  4MNO A;  4ULL A;  4LK1 C;  3HP3 A;  3TP7 A;  1S5F D;  1Z7T A;  4B3T Q;  2BDN A;  5I2X A;  2BCO A;  1G2T A;  4F7X A;  1XXG A;  5CMD A;  2HIV A;  1FJG L;  1R4Q B;  3VR5 A;  1E1O A;  1RJT A;  1X3F A;  1XNR L;  3H6M A;  3K7U C;  3D3R A;  2I0Q A;  1JOK A;  2JA5 H;  1N36 L;  5E7N A;  2F4V L;  1SMX A;  3K58 A;  2PMZ B;  1DON A;  3MAQ A;  5C4Z A;  2DY8 A;  4OIJ A;  2RDH A;  4DR5 Q;  2A19 A;  3W2D A;  1SN8 A;  3PUX A;  1X55 A;  1JIC A;  1CZW A;  4QIW E;  1MI2 A;  4DUZ L;  4BY7 G;  3K81 C;  2SNS A;  2B2T A;  2UXC Q;  3B6Y A;  1A8V A;  3CMA A;  4A3G G;  3STB D;  3I4M G;  5DEH A;  1L0X B;  1ZYR C;  4DV7 Q;  1JWU D;  1N9W A;  3I90 A;  2EYO A;  3HOY G;  4WJ4 A;  4B3M L;  1EU4 A;  4YHH Q;  4NXM Q;  1VQF A;  3F2D A;  1C4Q A;  4JVZ A;  2FIN B;  1IYU A;  2SNM A;  1UUP A;  1TS3 A;  1ML0 D;  2CW0 C;  4KKT A;  4QJF A;  3KOJ A;  3PIP A;  1H9S B;  4BS9 A;  3PUY A;  4LF8 L;  1JC7 A;  5I9P A;  3HOW H;  2PCF B;  4AH6 A;  1PH4 A;  1TVX A;  1HZA A;  5C44 H;  1R9T H;  1PMR A;  2BOS A;  1I4Q A;  1A63 A;  3K6O A;  3CCR A;  4YCV A;  1YI2 A;  4Q0F A;  1GUW A;  2EY6 A;  3U9S A;  2JA6 H;  1TY2 A;  4DR3 Q;  5D3D A;  4OHJ A;  5IOD A;  2XWJ B;  1Y1V B;  1JJG A;  4JI7 L;  2EYM A;  1BDO A;  5ELN A;  5EPK A;  2Q8R E;  2XTI A;  1A2T A;  1U4M A;  2HT1 A;  1EIF A;  1KTK A;  4PZ8 A;  2E2D C;  3KBG A;  4DNR B;  3LWE A;  3J80 i;  1B70 B;  4POG A;  4J15 A;  2YYZ A;  4KKU A;  4L5T A;  4WOR A;  1DM0 B;  1VS0 A;  3FKI H;  1V1P B;  1UE7 A;  3SR1 A;  1X3P A;  2AWO A;  1VCI A;  4N9P A;  3CRK C;  1KDB A;  1TWG H;  3NSW A;  3T4A C;  2O4X A;  4R4C A;  3NP8 A;  2EIF A;  1TS4 A;  4JI8 Q;  3T53 B;  1PVO A;  1PH2 A;  2ZJP A;  2O2L D;  2JK8 A;  3ER0 A;  1ENA A;  5C0X G;  1LAC A;  1MSG A;  2IHE A;  1VQ4 A;  3NQI A;  5FJ8 H;  5M5Y B;  2MHV A;  3S17 H;  3OPO A;  1YHB A;  3PO2 B;  3DEO A;  4GOP A;  1TWF H;  3FDT A;  4OEL B;  4HID A;  3SK5 A;  3H3V C;  5EJW A;  3Q6S A;  3BDO A;  2R92 H;  1C48 A;  4C3I H;  2Q2T A;  5EAY A;  2AUJ D;  3C1E A;  1V1P A;  3RLN A;  1QOH A;  3PQI A;  3SXH A;  5IGE A;  2EYP A;  1WTO A;  2YU9 H;  3C46 A;  2PW7 A;  4U67 3;  2E8G A;  3F2C A;  2HQL A;  2JA8 B;  4HJA A;  1MSH A;  1PRT C;  4C1N K;  5AJ3 L;  3HOU G;  1E7Z A;  1X3E A;  3NUC A;  3HOV H;  2VZA A;  1K83 H;  1GO3 E;  3JAM E;  1Q82 C;  2M9V A;  3W5O A;  2D9U A;  2K04 A;  3Q22 A;  1FJG Q;  2IX0 A;  1JJ2 A;  2Z8L A;  4KMU C;  3HOX G;  2O5J C;  4QUC A;  1PRT F;  3ULP A;  1P16 A;  2KVM A;  1XNR Q;  1F9R A;  1X6O A;  2K32 A;  1ESF A;  1Q1B A;  3EA6 A;  1ICF B;  2L4N A;  1HNZ L;  1N36 Q;  3JAM L;  2NTT A;  4GNX C;  1U5K A;  4OX9 Q;  1I50 H;  1YZ6 A;  3CU7 A;  2K5D A;  1B3A A;  5CYU A;  1ROD A;  3H09 A;  1YNN D;  4DUZ Q;  4DK6 C;  3QJY A;  1M8A A;  4BXX G;  5IP9 G;  3GTG B;  1LTS D;  2QDB A;  1CKN B;  4OWX B;  2B29 A;  4JI1 Q;  4B3M Q;  2X6G A;  4KY5 A;  4PQX A;  3M3Y B;  3DUZ A;  2A5H A;  1WTH A;  1L1O A;  3RD4 A;  1WJJ A;  2L55 A;  4UAI A;  4BBR B;  1SNC A;  4FXD A;  3P75 A;  1PTO C;  3SK6 A;  1N34 L;  4DR4 Q;  5COY A;  3J7Y W;  1STA A;  5JJZ A;  4LF8 Q;  1JB7 A;  1BO0 A;  1X3Q A;  2VS1 A;  3S1R B;  2B2W C;  4CKE A;  2VQE L;  1VF7 A;  5KGU A;  2Q2U A;  4A3K B;  4WFN 3;  1QZG A;  1Q1E A;  3S1N H;  1MGS A;  1OXV A;  2FFK B;  3CAM A;  1I4X A;  2F03 A;  4IUN A;  1PTO F;  4C3J G;  4XDX A;  4A3D G;  3HS0 C;  2H5X A;  3A74 A;  1LLR D;  5J3B A;  3K5O A;  2R7Z G;  5A35 A;  1FNV A;  2A8V A;  3BYT B;  3PCO B;  5CV9 A;  4KKS A;  2I46 A;  1CKN A;  1TWC B;  3PGZ A;  4JI7 Q;  5GRO A;  3L7Z C;  4Y52 H;  3AFP A;  3AU7 A;  4IPG A;  1UNS A;  1KLG D;  4YIJ A;  2ZJR A;  1I6V C;  3S1M H;  2EJG C;  2NZO A;  1VF5 C;  4UP8 A;  2ATW A;  4HSP A;  1SJH D;  4K5X A;  4HSV A;  1FGU A;  1IZ6 A;  4G57 A;  1PA6 A;  2EXD A;  4PG3 A;  1G6P A;  4Y7N H;  2F0H A;  4KN7 C;  1NUC A;  1UEA B;  2WFW A;  1G91 A;  4YCU A;  5IYC H;  5CBE E;  5FLX c;  3DXJ C;  2B63 B;  1CI3 M;  1NNX A;  4A3E G;  2B39 A;  2KED A;  4WRD A;  1WTQ A;  3VDY A;  2NVQ H;  2AUK A;  2PW5 A;  4TSS A;  1BQQ T;  3PO3 H;  2X6L A;  4POF A;  4Z9C B;  2L12 A;  2CH4 W;  1IL8 A;  2IWH A;  5C3X A;  3NEM A;  4GZY C;  1VQM A;  3A7L A;  4B3S Q;  3GTL H;  2OT2 A;  3RZO B;  4DA2 A;  4NXN L;  3H0G B;  3BU2 A;  5DLQ E;  1ZEQ X;  4XQJ A;  3R3O A;  2A6H D;  1GVP A;  4CDF C;  4ZYS A;  2NVY B;  2RSN A;  4NDX A;  4E6I A;  3T1Y L;  5M5X H;  1GXD C;  2CCZ A;  4GLX A;  1KDC A;  2OQK A;  4IN3 A;  2F0J A;  5AJ3 Q;  4RA8 A;  4WJW A;  4HIK A;  5E1F A;  1KNE A;  4GN5 A;  3HOZ B;  1E3P A;  1S40 A;  4LF9 L;  2PI2 E;  4KHV A;  3EQL C;  3VYR A;  5K36 H;  2BA1 A;  1STE A;  1XMO L;  3OSO A;  2N8N A;  2I5L X;  2RVL A;  1OXT A;  3QOJ A;  4IFD G;  1Y8O B;  3CCQ A;  1SFO B;  4OXP A;  1VQG A;  3J7Z C;  5G3L F;  3F8T A;  2LXJ A;  3RN5 A;  2A69 D;  1UEB A;  1GUT A;  4NKL A;  3CCL A;  1FNW A;  4BY7 H;  4K2K A;  4A3G H;  4MTN A;  3I4M H;  2KEC A;  1CZG A;  1YHA A;  3CCJ A;  4C3H G;  4LF5 Q;  3TQY A;  3HOY H;  5T1G A;  4CDD C;  1WD1 A;  5D65 A;  3K5L A;  1EUJ A;  1IW7 D;  3F2U A;  2QDL A;  3Q24 A;  2Y0S B;  1YJN A;  2CKZ B;  1I6H H;  4XXE A;  5C4H A;  4IQZ A;  1D5Z C;  1QG7 A;  2E76 C;  3A5U A;  1IHZ A;  2BDO A;  3J81 i;  4KHZ A;  4F8M A;  2ZTD A;  2E2I H;  1JWM D;  2WKC A;  1SMY D;  3VYS A;  4EVO A;  5KNB A;  4EQ5 A;  1H9M A;  4PZ6 A;  3GTJ H;  2RA4 A;  3PUZ A;  2VQE Q;  3GTO B;  3JC6 6;  3SE0 A;  1N32 L;  4B3R L;  3M4Q A;  4I7Z C;  2ZJQ A;  3KJO A;  5M5W B;  1DGS A;  4KD4 A;  5ELD A;  1A62 A;  2RQX A;  4GN3 B;  2AQ1 B;  4JOI C;  3ERQ A;  3A8J E;  1KHI A;  4IUV A;  2D0O A;  1EFW A;  2P5Z X;  3W3A A;  1EIG A;  2KBN A;  4A4I A;  4O42 A;  2N49 A;  4LF4 L;  4A76 A;  5IGF A;  3RUZ A;  1HQM C;  1B7Y B;  1MJE A;  1Y69 U;  4R8I A;  3LX0 A;  3K7A H;  3M7G A;  1SDF A;  3LNN A;  1KIX A;  5C0X H;  1HHV A;  3KUP A;  1YIJ A;  1CA6 A;  2IT1 A;  2IW3 A;  1O7Y A;  3DM3 A;  2UUA L;  2F0V A;  5IGC A;  1F9Q A;  2J4X A;  2UXC L;  4LF6 Q;  2LSS A;  1IYJ B;  1HUM A;  2I5H A;  2K5Q A;  2JEA I;  1A3U A;  1B3Q A;  2EYF A;  1V9P A;  2NN6 I;  4LJZ C;  4YHH L;  1N33 L;  1FGB D;  2Q2I A;  2QF7 A;  4OO1 G;  1PH3 A;  5K5P A;  2JP1 A;  1PH5 A;  2AHO B;  1TS2 A;  1JMC A;  1PYS B;  3CC4 A;  1J8I A;  3KLW A;  2PMZ E;  1KAB A;  3Q0A A;  4O1N A;  1G51 A;  4R4I A;  2KCM A;  2OCE A;  3SHL A;  3H3V I;  4K8I A;  1BKB A;  2WII B;  1Z9F A;  4CJ1 B;  2AKW B;  4IO9 A;  2PNR C;  4NXN Q;  3VYU A;  5LL6 X;  1YNX A;  4EX5 A;  3D6C A;  3D8G A;  4X66 L;  2RKS A;  1GUN A;  3GTQ B;  1EY4 A;  3T1Y Q;  2F0M A;  2F0L A;  4P74 A;  1PFB A;  4DR3 L;  4LF7 Q;  3CF5 A;  5M3F H;  1CSQ A;  3KLS X;  1D5M C;  1WCM G;  4DXG A;  3HOX H;  5HUR A;  3Q8D A;  1OXX K;  4JI0 L;  3JAM c;  4LF9 Q;  3NWS A;  1LUZ A;  3I70 A;  3VA5 A;  2NN6 H;  1YIT A;  1L1O B;  3CRL C;  1XMO Q;  3E0E A;  5IWA Q;  1NMG A;  4A3I B;  3S24 A;  4FF4 A;  1DXM A;  3S2D H;  5IGB A;  5KRU A;  4IPH A;  2F0D A;  3R2T A;  1DYQ A;  3S1Q B;  2B2Y C;  3CXC A;  4KTA A;  1K3R A;  3CP0 A;  4R4T A;  2IHF A;  3H3V H;  4ABN A;  4BXX H;  5IP9 H;  3KF6 B;  4C2M H;  2RF4 A;  4XQQ A;  2R93 G;  4GS3 A;  5D3I B;  5BN4 A;  4U68 A;  4ALP A;  4ODG A;  1VDZ A;  4HIM A;  2F3V A;  2DUD A;  2Q2H A;  5C3E H;  4KJN A;  5C4X B;  4KLK A;  4H02 A;  3GP7 A;  5CV8 A;  4A93 G;  2E74 C;  2XN9 C;  5CV4 A;  4F87 A;  4G7H C;  1VQL A;  3ND8 A; 
#chains in the Genus database with same CATH homology
 3M9B A;  1TWG H;  2R6G A;  3RR5 A;  3D0F A;  2WAQ E;  1IXR A;  4LUZ A;  5IYD H;  1PH8 A;  4R4C A;  3I55 A;  3G4S A;  1SFO H;  2EIF A;  1D7Q A;  1YJW A;  3PO3 G;  4JI8 Q;  1PVO A;  1PH2 A;  3S14 H;  2ZJP A;  4A3B H;  3CCV A;  3ULJ A;  3RN2 A;  2JK8 A;  4JI3 L;  2VW9 A;  3ER0 A;  4A3L G;  4KHP L;  5C0X G;  5HY6 A;  1EQQ A;  2XGT A;  4HJ5 A;  4A75 A;  3MEF A;  2VQF L;  4A3D H;  2K4K A;  4LFC L;  2YTX A;  4A3K G;  3AFQ A;  5IT9 c;  2IHE A;  1VQ4 A;  4APV A;  2JA8 G;  2D62 A;  1Q86 C;  2R7Z H;  5FJ8 H;  3KF6 A;  4JI4 Q;  4BA1 I;  3S17 H;  1VQ6 A;  1WFQ A;  4IJH A;  1N32 Q;  3I56 A;  1UWV A;  1YHB A;  4LWC A;  3ZJY C;  4B3R Q;  1YVC A;  2EQS A;  4GOP A;  1TWF H;  2JA5 G;  2ALY B;  4FDB A;  4HID A;  2IY5 B;  1LYL A;  1BBW A;  5IP7 H;  2B3G A;  2R92 H;  1L0W A;  2L15 A;  3T1H L;  4C3I H;  4LFB L;  2Q2T A;  1YHQ A;  3MXN B;  5EAY A;  3GO5 A;  5BR8 L;  3RLN A;  4JI6 L;  4DV4 L;  1XPR A;  2E5L L;  2YU9 H;  2OWO A;  3I4N G;  4BBS G;  4LF4 Q;  5M3M H;  1K73 C;  2E8G A;  1VQD A;  3F2C A;  2HQL A;  5K36 G;  1PHJ A;  4HJA A;  3L0O A;  5AJ3 L;  4L5S A;  1SRU A;  3PUW A;  3HOU G;  4DV1 Q;  1HNW L;  1E7Z A;  2VUM G;  2UXD L;  1X3E A;  4OX9 L;  1VQ7 A;  4MZ9 A;  3HOV H;  2VZA A;  1K83 H;  1EOV A;  1GO3 E;  2ID0 A;  1Q7Y C;  2Z6K C;  3U4V A;  2HIX A;  4DK3 C;  4XIG S;  4A3E H;  1Q82 C;  3U50 C;  3W5O A;  1X9N A;  3CQZ H;  3STB C;  4IFD I;  2I5M X;  4P71 A;  1I94 L;  2IX0 A;  2AWN A;  3T1H Q;  1QZH A;  3I4O A;  1JJ2 A;  2HHH Q;  1FJG Q;  1P8L A;  4OON A;  1S72 A;  2NVX H;  2UUA Q;  2B63 G;  3HOX G;  4JV5 L;  3H15 A;  1K0R A;  4A3M G;  3J80 c;  3ULP A;  1P16 A;  5M5W H;  4DV4 Q;  1J5E L;  1KQS A;  2E5L Q;  4BY1 H;  1X6O A;  2GVA A;  1XNR Q;  1Q1B A;  4JI1 L;  2JA7 G;  3HOW G;  1N33 Q;  3UE0 A;  5FLM G;  3J81 j;  1N36 Q;  1HNZ L;  5C44 G;  4L5Q A;  1MKH A;  2GN5 A;  5GAE C;  1OXS C;  5JJL A;  4GNX C;  1EQR A;  2WB1 G;  1U5K A;  1Z47 A;  1I50 H;  4OX9 Q;  5JJI A;  1YZ6 A;  3G6E A;  4DR4 L;  1QVC A;  3AEV A;  3NEN A;  2JA6 G;  3W1G A;  2V1C C;  2K5N A;  3H0G G;  4DV2 L;  4DUZ Q;  4DK6 C;  4QY7 A;  1HNX L;  4K0K Q;  3CW2 C;  4BXX G;  5IP9 G;  1I5F A;  3ULL A;  1IBK L;  1HZB A;  4DR6 Q;  3NEL A;  1CKN B;  4OWX B;  4X66 Q;  2B29 A;  4JI1 Q;  4DV0 Q;  4B3M Q;  4DPG A;  1Q81 C;  1HNZ Q;  3A5Z B;  1C9O A;  5LMN W;  1UE6 A;  4DUY Q;  3HOZ G;  4GLA C;  4JI5 L;  1PV4 A;  1WJJ A;  1X65 A;  1W3S A;  1PYB A;  3FKI G;  1K8A C;  2JA9 A;  1N34 L;  4X6A H;  4JI0 Q;  1PH9 A;  4DR4 Q;  4IJL A;  5IY0 A;  3G71 A;  4LF8 Q;  1JB7 A;  2MO0 A;  2VS1 A;  2KHI A;  3NBH B;  4AYB G;  1X56 A;  2PI2 A;  5IYD G;  1X54 A;  1S3O A;  2QGQ A;  5C4J H;  4GOP B;  2VQE L;  1HNX Q;  5LMU L;  4O0A A;  2Q2U A;  1Q12 A;  1XNQ L;  2VNU D;  1VQI A;  1XMQ L;  1QZG A;  4A3B G;  1VQ9 A;  3K0X A;  3S15 H;  2NVT H;  4C3H H;  1HR0 W;  1Q1E A;  3S1N H;  1OXV A;  3CAM A;  3DLL A;  2PQA B;  4A3D G;  2H5X A;  2BA0 A;  3A74 A;  5J3B A;  4DR1 Q;  3U4Z A;  4BBR G;  4DV5 Q;  2R7Z G;  1NTG A;  3F1Z A;  4LUO A;  1VQB A;  5FJ8 G;  5C0X I;  2A8V A;  3PCO B;  2UU9 L;  1IL2 A;  4GKJ L;  1ASY A;  1CKN A;  1N34 Q;  2Z0S A;  1Q46 A;  3PGZ A;  4JI7 Q;  3GTQ H;  5GRO A;  5ELO A;  3OTO L;  3L7Z C;  1MIU A;  4Y52 H;  1XPU A;  1TWA H;  3AFP A;  4IPG A;  2BH2 A;  2Y0S G;  5IP7 G;  2ZJR A;  2C35 B;  3EIV A;  4R1J A;  2R92 G;  4DV6 L;  4P73 A;  3PIO A;  3S1M H;  4GN4 B;  3KF8 B;  3E9H A;  3HKZ E;  3KDF B;  2NZO A;  4JI2 Q;  4DAM A;  1W2B A;  4B3T L;  1K9M C;  4UP8 A;  3CPW A;  1E24 A;  2ATW A;  1WYD A;  4HJ7 A;  1IBL Q;  1O7I A;  5M3M G;  4X62 Q;  3TS0 A;  4BA2 I;  1VQC A;  1FGU A;  1IZ6 A;  3L2P A;  1VQP A;  1PA6 A;  2EXD A;  4B3S L;  2CWP A;  4PG3 A;  1G6P A;  4Y7N H;  2R7F A;  4A3I H;  4JG2 A;  1JJC B;  4JBK A;  1V1Q A;  2WFW A;  4YY3 L;  1N8R C;  4YCU A;  1Q8K A;  5IYC H;  2MFI A;  3TRE A;  1T9H A;  5FLX c;  3HOV G;  2RCN A;  4OO1 I;  4A3E G;  2PQA A;  4JI3 Q;  4KHP Q;  1CKM A;  2MNA A;  2YTY A;  4DR2 L;  1UE1 A;  3S1Q H;  1PH6 A;  3VDY A;  1Y1V H;  2NVQ H;  2VQF Q;  4LFC Q;  1XPO A;  2CWA A;  4L5R C;  2GVB A;  2E2J H;  3PO3 H;  3KJP A;  3D31 A;  4POF A;  1VQN A;  2K75 A;  4AQY L;  4DR5 L;  4BY1 G;  3UE1 A;  5GQO A;  2K52 A;  1E22 A;  1A0I A;  3NEM A;  1VQM A;  1CKO A;  2KHJ A;  4B3S Q;  3PSI A;  2WB1 E;  4KI0 A;  1KD1 C;  3GTL H;  3CCE A;  5C4X H;  1VQ8 A;  2JE6 I;  3KDF A;  3OYY A;  5M3F G;  4NXN L;  5DLQ E;  3BU2 A;  4DV3 L;  4LFB Q;  5C0X J;  2ASB A;  1NJI C;  2N3S A;  1X3G A;  4DV7 L;  1EWI A;  1GVP A;  2MO1 A;  5JEA J;  4JBW A;  3CC2 A;  4JYA L;  2WP8 J;  5BR8 Q;  5LMN L;  4JI6 Q;  1VQK A;  4NXM L;  3CCS A;  3T1Y L;  2YTV A;  5M5X H;  1KXL A;  2K5H A;  2CCZ A;  4GLX A;  2NN6 G;  4GLV B;  1FL0 A;  2JJQ A;  4X65 L;  2OQK A;  3TRZ A;  5AJ3 Q;  4LFA L;  2MQH A;  1L2F A;  4HIK A;  1KRS A;  4IOC A;  1HNW Q;  1NMF A;  4GN5 A;  1Y1W H;  1IBM L;  4P75 A;  1E3P A;  2UXD Q;  1S40 A;  4LF9 L;  3RZD H;  3FP9 A;  4YWK A;  3GD7 A;  1L1O C;  4XTC S;  4LF5 L;  2ZTE A;  2PI2 E;  1M1K C;  3M4O H;  3K80 C;  5IYB H;  1QVF A;  4JC0 A;  3FHW A;  4A3F G;  1E1T A;  2BA1 A;  5M5Y H;  1XMO L;  1BBU A;  4OWW B;  3HOU H;  1I94 Q;  2K14 A;  2N8N A;  1HR0 L;  2I5L X;  1AH9 A;  3UDX A;  4UP9 A;  1OXT A;  3ICE A;  4IFD G;  3CCQ A;  4JV5 Q;  3PUV A;  3PO2 H;  4QQB X;  1QVG A;  4OXP A;  1VQG A;  3J7Z C;  5LMN Q;  1G29 1;  2FXQ A;  1AE3 A;  3F8T A;  4AYB E;  1J5E Q;  2LXJ A;  2UUC L;  2IX1 A;  2YV5 A;  3RN5 A;  4DNI A;  4GKK L;  1UEB A;  1YBY A;  3KYH C;  3LGJ A;  2RHQ B;  4RMF A;  4X65 Q;  3CCL A;  4BY7 H;  4IOA A;  4NB3 A;  4X64 L;  4LFA Q;  3J7A 5;  4AIM A;  1ASZ A;  4A3G H;  2BH8 A;  4MTN A;  1IBM Q;  3I4M H;  5C3E G;  1YHA A;  3WWV A;  3CCJ A;  4UPA A;  3M7N A;  3K8A A;  4LF5 Q;  3TQY A;  3HOY H;  4QL5 A;  1WOC A;  4DKA C;  4WJ3 M;  4GNX B;  2JA8 H;  4JBJ A;  1QUQ B;  1VQJ A;  1EUJ A;  4IPC A;  4DV2 Q;  1GM5 A;  4RG1 A;  1TWH H;  1SR3 A;  3CME A;  1JT8 A;  2ZM6 L;  1YJ9 A;  1WCM H;  1C0A A;  3PF4 A;  1IBK Q;  3CCM A;  1YJN A;  3F2B A;  2UUC Q;  2CKZ B;  1I6H H;  2Z6K A;  2NZH A;  4HJ8 A;  1CUK A;  4X64 Q;  1M90 C;  5HGQ A;  2CFM A;  3A5U A;  4JI8 L;  1I3Q H;  4JI5 Q;  4O2D A;  1XJV A;  3J81 i;  3RNU A;  4KHZ A;  4P72 A;  2ZTD A;  2E2I H;  4A3J H;  4UY8 C;  1RIP A;  1J6Q A;  2E2H H;  3IRB A;  2OQ0 A;  4EQ5 A;  3A0J A;  3AQQ A;  3HFZ B;  4A3I G;  2VY3 A;  4PZ6 A;  3GTJ H;  3PUZ A;  2VQE Q;  3I7F A;  4JI4 L;  3KFU A;  1PFS A;  3SGI A;  5LMU Q;  5IYC G;  3JC6 6;  1XNQ Q;  4DR7 L;  1XMQ Q;  4LW1 A;  2A1A A;  3EN2 A;  4ME3 A;  1PH7 A;  3M4Q A;  4B3R L;  4IPD A;  4GNX A;  3CD6 A;  2QA4 A;  4TVA B;  5GAH C;  3KJO A;  2ZJQ A;  2ES2 A;  1GKH A;  3TEH B;  2K5V A;  3UDF A;  1DGS A;  1QUQ A;  4YCW A;  1Y1V G;  4A3C H;  1Y14 B;  3CC7 A;  1A62 A;  3GTG H;  1HZC A;  1SE8 A;  4GN3 B;  4OWT B;  4JOI C;  3JAM i;  3GTK H;  3EBE A;  3G48 A;  4GKJ Q;  3CCU A;  1KHI A;  4LF6 L;  1JE5 A;  1VQA A;  3UDI A;  3W1B A;  2UU9 Q;  2D0O A;  4PZ7 A;  3M3Y H;  1EFW A;  3OTO Q;  2RHS B;  5JEA G;  4A93 H;  1SRO A;  2KBN A;  4A4I A;  2N49 A;  1NY4 A;  4C3J H;  4LF4 L;  2N78 A;  1OXU A;  4A76 A;  1EIY B;  1MJC A;  1EYG A;  5C4X G;  4BBR H;  2JQO A;  4HJ9 A;  1N32 L;  2KEN A;  4DAY B;  4DV1 L;  4DV6 Q;  1B7Y B;  1KAW A;  1MJE A;  2R7D A;  4MNO A;  4DR7 Q;  2WAQ G;  4R4Q A;  3K7A H;  2UUB L;  1TXY A;  4NPS A;  2F52 A;  4B3T Q;  1KIX A;  2D0P A;  4A3L H;  1FVI A;  3S1R H;  5GAD C;  3S16 H;  1YIJ A;  1PH1 A;  2HIV A;  3RLO A;  2HHH L;  1FJG L;  4A3K H;  1LTL A;  2DGY A;  2IT1 A;  3DM3 A;  2UUA L;  4HIO A;  2UXC L;  1E1O A;  2ZTC A;  3GTO H;  1LM0 A;  2LSS A;  1IYJ B;  2I5H A;  4QGU A;  1D8L A;  1Y1W G;  4YY3 Q;  4LF6 Q;  1X3F A;  1XNR L;  2JEA I;  1BVS A;  3HKZ G;  1V9P A;  2NN6 I;  1CSP A;  3K7U C;  5IYB G;  2I0Q A;  4YHH L;  2VL6 A;  1N33 L;  4OO1 G;  2Q2I A;  4DR2 Q;  2JA5 H;  3I2Z A;  5E7N A;  1N36 L;  2F4V L;  1SMX A;  2K50 A;  1PH3 A;  4LF7 L;  1PH5 A;  1TWC H;  2AHO B;  1JMC A;  1PYS B;  3GDE A;  1NE3 A;  3CC4 A;  1SLJ A;  3KLW A;  2UUB Q;  3PO2 G;  2PMZ E;  4AQY Q;  4DR5 Q;  2UXB L;  1G51 A;  2CQO A;  2A19 A;  4R4I A;  1SN8 A;  1U0L A;  3PUX A;  2KCM A;  3J81 c;  2KCT A;  2OCE A;  1X55 A;  3I4N H;  4BBS H;  4QIW E;  3H3V I;  4DUZ L;  4BY7 G;  1OTC A;  1WI5 A;  3K81 C;  1BKB A;  4K0K L;  1Z9F A;  2UXC Q;  3B6Y A;  4JCV E;  1A8V A;  2AKW B;  3CMA A;  4IO9 A;  3STB D;  4A3G G;  3I4M G;  4NXN Q;  5IWA L;  2VUM H;  4DR6 L;  4DV3 Q;  1YNX A;  4EX5 A;  4X66 L;  4DV7 Q;  1RL2 A;  3HOY G;  1N9W A;  2OTL A;  4WJ4 A;  3U58 A;  4DV0 L;  1HZ9 A;  4B3M L;  4JYA Q;  4JBM A;  4YHH Q;  4LNQ A;  4NXM Q;  1VQF A;  4YWM A;  1HH2 P;  3CPF A;  3F2D A;  3T1Y Q;  4P74 A;  2F4V Q;  1HJP A;  4DUY L;  3RLF A;  4DR3 L;  4LF7 Q;  3BZK A;  3CF5 A;  5M3F H;  1CSQ A;  5GAG C;  5H1S E;  2B63 H;  1WCM G;  4QJF A;  3HOX H;  3GTP H;  3Q8D A;  3KOJ A;  1OXX K;  4JOI A;  3TS2 A;  4JI0 L;  2UXB Q;  3S2H H;  3PIP A;  4A3M H;  4GOP C;  3JAM c;  4LF9 Q;  3PUY A;  1NBW A;  4LF8 L;  1LUZ A;  4YWL A;  2JA7 H;  3HOW H;  1XTD A;  2R93 H;  4AH6 A;  5FLM H;  1PH4 A;  1YIT A;  1L1O B;  1HZA A;  5C44 H;  1XMO Q;  1VQ5 A;  3E0E A;  1R9T H;  1HR0 Q;  5IWA Q;  1KRT A;  1NMG A;  3S24 A;  1A63 A;  4A3J G;  2JEB I;  4UP7 A;  2OTJ A;  3CCR A;  5IE8 A;  4YCV A;  2LXK A;  1VQO A;  1YI2 A;  2Y0S E;  3S2D H;  5JJK A;  4A3F H;  3BJU A;  4IPH A;  1VQH A;  4R4O A;  3RZO H;  4PMW A;  2JA6 H;  4DR3 Q;  4GKK Q;  3H0G H;  4DR1 L;  3CXC A;  4DV5 L;  1K3R A;  3M85 A;  3CP0 A;  4R4T A;  2IHF A;  3H3V H;  1JJG A;  3M4P A;  2NVY H;  5IP9 H;  4JI7 L;  4BXX H;  1UE5 A;  3KF6 B;  4C2M H;  2RF4 A;  2R93 G;  1K8G A;  5ELN A;  2XTI A;  4GS3 A;  1KL9 A;  1KC8 C;  3PF5 A;  1EIF A;  4PZ8 A;  2HT1 A;  3GTM H;  4A3C G;  4ALP A;  4IFD J;  3UDG A;  3HKS A;  1H95 A;  4HIM A;  4LUV A;  1V43 A;  3J80 i;  1B70 B;  2DUD A;  3E9I A;  1YEZ A;  2Q2H A;  4J15 A;  3OW2 A;  2YYZ A;  4POG A;  3HOZ H;  3ERS X;  3PV0 A;  4L5T A;  1GD7 A;  2F3I A;  4KLK A;  5C3E H;  1VQE A;  2ZM6 Q;  4JI2 L;  1C7Y A;  1VS0 A;  3FKI H;  4H02 A;  1IBL L;  4A93 G;  1UE7 A;  1B8A A;  2AMC B;  4X62 L;  2AWO A;  3BZC A;  3AYH B;  1VCI A;  2PNH A;  2QEX A;  1AE2 A;  4TQU S;  1VQL A;  1L1O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...