4HN7A

Crystal structure of e. coli pmrd
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
85
structure length
85
Chain Sequence
b'MEWLVKKSCCNKQDNRHVLMLCDAGGAIKMIAEVKSDFAVKVGDLLSPLQNALYCINREKLHTVKVLSASSYSPDEWERQCKVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Signal transduction protein pmrD
publication title Crystal structure of E. coli PmrD
rcsb
source organism Escherichia coli
molecule tags Signaling protein
total genus 14
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2012-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11183 PmrD Polymyxin resistance protein PmrD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.650 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4hn7A00
4HN7A 2JSOA 2RQXA
chains in the Genus database with same CATH superfamily
1GUGA 2TMPA 5HGTA 2NTTA 2IX0A 2VY3A 2A6EC 3NP8A 2L4NA 1EEID 3K5NA 2NWGA 3K5OA 1F2ZA 1YZ6A 2UUCQ 1HH2P 4A3JG 1IYUA 5IGGA 1I5FA 1GUSA 3I72A 3PIO3 2EYPA 3TP8A 2GVBA 2K04A 1YNNC 3WWVA 2JEAI 4LF5L 4LF7Q 3NBIA 4B3TL 4FO2A 1MJCA 1VQKA 1PYWD 4LUVA 4DV3Q 1LTGD 4KKUA 2B63G 1B9MA 1X9NA 3KJPA 3M4YA 3NE5B 3B6YA 3CQZH 5ISRA 3Q8DA 4P71A 1XPUA 2RF4A 4JI4Q 2DGYA 3H0GG 5IP9G 3EFXD 1X54A 4A3GH 3AFQA 3FKIG 2PZUA 3TZUA 1E24A 1I4PA 1Y1VH 4IO9A 2KOLA 1ASZA 2AWNA 4KTAA 5ELCA 4DA2A 4DAYB 4QUCA 1IKLA 1CI3M 1QNKA 4LUOA 4O1NA 4LF8L 2VUMG 3BVGA 2E2JH 1QWYA 3CPWA 3RNUA 3DHQA 2XN9C 4LF4Q 3U4VA 3C1EA 2HDMA 4IN3A 2RDFA 5J39A 3L2PA 3H3VH 1ENCA 3CQZB 2QW7A 2C9OA 5EKKA 3Q6SA 4H44C 3TS0A 3S24A 1NSNS 4OELB 2FFKB 4MZ9A 1EYAA 5E1FA 4LFAL 4FDBA 2DUDA 4CJ1B 4CHTB 4A3GB 1S40A 4X66Q 1QCBD 3T4AC 1HQRD 3HRZC 1KD1C 5C44G 1RTNA 1Y1VB 1K73C 3CMEA 1SMXA 3OWFA 4U673 1L1OA 4BA2I 1VQBA 1KHIA 4A93H 1FL0A 2BA1A 3CU7A 3M4OH 4A3LG 1V43A 1VQ8A 2E2JB 4NXNQ 5L37A 3P20A 2JA7G 1DOKA 4CKBA 1GUTA 4HAEA 4OEMB 3AMUA 4ODGA 1WTHA 4IPHA 3KOJA 3GD7A 2R92H 4JI0L 5GROA 1N36L 3D6CA 1Q46A 2GA4B 4F8MA 2PI2A 4DV7L 1W6JA 4UAIA 4LF9L 2N49A 1SE2A 3PIOA 1A3TA 2KVMA 1WVLA 1C48A 4H0LC 1QVGA 1E22A 1Q82C 1ICWA 1XNQL 1NJIC 1JJCB 4A93B 1SMYC 1N32L 4YIJA 1OXSC 2B2YA 3M4OB 3RLNA 2KQ3A 3CAMA 3BS1A 2I0QA 3PO3G 3OSOA 1SYCA 3MXPA 4HJ9A 3RUZA 1V1PA 4QQBX 3R2TA 4TRDA 5ELOA 4NP5A 4TSSA 5C3EG 1UE7A 1QZHA 1CA5A 4BBRH 1OTCA 4A3BH 2A19A 1YITA 1F2LA 3S1MH 2B29A 2R92B 1M8AA 2D9UA 1JWSD 5IT9E 1GHJA 4X64Q 4GKJQ 1Y1VG 1RCVD 4B08A 2WP8J 4UHVA 4B3SL 3WDNA 2NZ1D 2HQEA 3S15H 5C0XG 3SGIA 2DY7A 4IUUA 3E0JA 4B3RQ 2R7DA 1HHVA 1J9OA 1VQEA 2VB3X 5M3MG 1SNDA 5D3IB 1VQHA 5I6YA 1YHAA 2YTYA 4LWCA 4AYBG 3ERSX 5DM63 1YHQA 3HOYH 3G7LA 5CMDA 2L0CA 4Q5VA 1LTTD 1N33L 3MFGA 3TS2A 3HZXA 2JP1A 4BBRB 3J81E 4QGUA 4A3BB 1J6QA 2L1BA 1B1ZA 1HZAA 1ONLA 4LUZA 1CKOA 3S1MB 1PVOA 1V8QA 5CBAE 1G2TA 4IUQA 3HG9A 1STHA 1B8AA 1VQJA 2PQEA 1U4PA 3D8GA 3SXHA 5BR8Q 4B9WA 2K4KA 2EDGA 4P72A 1YJ9A 2G9DA 3S15B 4OO1H 4A93G 2YU9H 1LACA 3NWSA 1UNSA 4DV2L 3M4PA 1BXTA 2PNRC 1X3FA 3SVMA 5FKAC 1AE2A 3AU7A 4DV0L 2CW0D 1SRUA 2C5CA 2KEDA 3KJOA 2A69D 2EYFA 1UWVA 1OO9B 3HOYB 1W2BA 3K6OA 4F88A 4KD4A 1BUVT 2RHQB 1WD1A 3G6JB 4EQNA 1ASYA 4QJFA 1QUQA 4RA8A 4C56C 2M9VA 5LMNW 2WB1G 1JT8A 3VDYA 1LTID 2F1MA 3ZYYX 1SSOA 4ABNA 4Y7NH 1I94L 1CKNB 3M7NA 1JC7A 3SHLA 5E4XA 1XJVA 1HR0L 2ZTEA 1PRTD 4IUNA 1JOKA 2EXDA 2Z1CA 4S3SA 1LTBD 4DUZQ 1HNXL 2XWBB 1DYQA 1DOMA 2YU9B 4JI5L 3QJYA 3KF6B 5C4HA 3KBXA 4JBMA 1GUNA 4JG2A 2NB0A 2FXQA 1NMFA 4NDXA 3I56A 2PW5A 4C3IH 4WJ3M 2R93G 4E6IA 2MFIA 3MEFA 3TRZA 2VNUD 1KLUD 2MO0A 4TQUS 4IFDI 3T1HQ 3S17H 1I3QH 1BKBA 1TIID 2NN6I 3CKIB 3U9SA 2BOSA 4K2LA 3C3LA 2B2UC 4CGYB 2RHSB 4A3MH 4Y7NB 3BZCA 1PYSB 4O42A 3RZOH 4XXEA 1TY2A 1HNWQ 3W5OA 1GO3E 2BE5C 2PNHA 4R8IA 2IL8A 3PQIA 2F52A 1AEXA 1SXTA 2VL6A 4AQYL 4JI2Q 2PQAB 4IURA 4GLXA 4GOPB 1STEA 1F9SA 5KIXA 1E7ZA 1SYBA 1VQOA 2Q2IA 1GUOA 5DNFA 2JA5G 3JAMi 4G57A 2OWOA 1KXLA 1EQTA 2ZTDA 4HMJA 4C3IB 1ZYRC 2QDBA 1KLGD 1TY0A 3G4SA 1S72A 3I8ZA 1IKMA 3FVQA 4K6DA 1ILQA 3S17B 1I3QB 1S3OA 4ZRZA 1EY0A 3K7UC 3G48A 5I6WA 4A3MB 1CHQD 1WCMH 4GN4B 1KQSA 4BBSH 3W2DA 4UP8A 2K28A 4OO1G 4QIWE 3RZOB 1TXYA 3NBHB 2CH4W 3MA2B 4XT3B 5LMUL 1EIFA 2VQFL 3CRKC 5M5WH 4FXGC 3K5MA 2WIIB 2D2CC 3HKZB 2UXDL 1F9QA 1ZKOA 2K75A 1K0SA 4ULLA 1HNZQ 2UUAL 1X32A 1LT4D 2SOBA 4YWMA 2IX1A 4BXXG 1IYJB 4ME3A 4XQQA 3SK6A 4LFBL 3CC7A 2JA6H 4L5TA 2WAQE 1W3SA 4C1NI 1I6VC 4JYAL 1SE4A 4YCVA 3HOZG 1S5FD 5JJIA 4A3DG 4RKBA 4EGVA 4ILWA 2F0MA 3VA7A 3PO2H 1EU4A 1IBML 3CCVA 1WCMB 4RGOS 4BBSB 2Y0SE 4EVOA 3CCLA 5IODA 1C4QA 2N88A 4HSPA 3Q24A 2F0LA 1NR2A 5T1IA 4POGA 2PZTA 3CHBD 2AQ3B 2EYLA 1G291 3ND8A 2UUCL 4GKKL 3R2IA 2JYOA 5M5WB 1F2MA 3EA6A 1DONA 4EQOA 1MGSA 4C1NK 3I3CA 1QOHA 2X6GA 1FNUA 1K9MC 1XPOA 4A3KB 4A3CH 4IOAA 3GV3A 5AJ3L 4LK1C 1OXVA 1A8VA 1K83H 1PTOH 1XNRQ 4LF7L 4CKCA 4G7HC 2JA6B 1HR0Q 1Q1EA 3ULLA 4R4OA 1K8AC 2IY5B 4DV3L 1GOZA 4DV5Q 3M3YH 4PV1C 5KYLA 3PO2B 4K5XA 4EQPA 2PMZB 1KDBA 3T1YQ 1Q90A 1HTPA 4JI4L 1EWHA 4A3JH 3KDFA 5JEAJ 3HKZG 5GAHC 3I4OA 5CV5A 5TSSA 5M5YH 5JVH3 2HCIA 2R61A 5KRUA 5G3LD 1WTPA 4KV6A 1E2ZA 3NHHA 1TVXA 4CJ2C 2MPMA 2B63H 4ZAIA 3P75A 1K83B 1PTOB 1LTSD 4CDDC 3JAMc 3TP7A 1HXYD 5A2QE 3GTGH 1I50H 1JJGA 1YNJC 4LF4L 5FLMG 3J80c 1PFSA 3A56A 4BBSG 5CV7A 3I4MB 3M3YB 4HTHA 3H0GH 5IP9H 3UE1A 1X55A 3W1BA 4KD3A 4IQZA 2JN4A 4DV1L 1KNEA 3U58A 1Z47A 2E74C 2YYZA 3CCUA 3CD6A 4A3JB 4PZ7A 1PFNA 2F0GA 5FO9B 2VS1A 4K5WA 2O4XA 1EEFD 4X66L 1Q1BA 5M5YB 3RN2A 4UPAA 2LMCB 3STBC 1PA6A 4A3KG 2CQAA 3T53B 2A1AA 4TVAB 3EVQA 1GD7A 2B63B 2K50A 4GS3A 4DR2Q 2EE1A 4Z9CB 4R4QA 2OXPA 3GTGB 1IW7C 1VQ5A 1I50B 3J81j 4XYOA 2CHBD 1D1IA 4NXNL 4RGNA 5DM73 4C2MH 3U9OA 4B3ML 2X6LA 4IUTA 2VQFQ 4RMFA 3M7GA 4DPGA 2NZOA 2UU9Q 3H0GB 5IWAL 2I5LX 3TP6A 1GXDC 3VR5A 1Q8KA 3NUCA 4CDCC 4RG1A 2RSOA 4WJWA 4YHHL 1JB7A 1FD7D 4QCLA 1AH9A 5C44H 2HD3A 3UDIA 1EIGA 5C4JH 1L1OB 1H9SA 4RHRA 1PRTB 3EROA 1WFQA 1C7YA 4FXDA 1HPCA 3RLOA 4YWLA 5IP7G 1GKHA 4A3LH 1GUWA 3ICEA 2F4VQ 3HOUG 4DR1L 4MTKA 2G5DA 2L5TA 2JA7H 4WORA 3PIP3 1EIYB 1V1QA 5LL6X 5IYCG 2F0TA 1E3PA 2F0VA 4CKEA 2F03A 3I4MG 1JMCA 4C2MB 4KJOA 1PRTF 4JBKA 4K8JA 1W6KA 1PH9A 4POFA 4GKKQ 2A8VA 1BO0A 2K5NA 4HIOA 4KJNA 4KI0A 4A3FG 3J7AV 1PH5A 4PMBA 4BS9A 4JCVE 1E2WA 3OHXC 1JCKB 4JPBW 5C44B 3A8JE 3EIVA 2DJGC 4X64L 1U9RA 5C4JB 4GKJL 5AJ3Q 4P75A 5HURA 5JAVA 1IL2A 2OQKA 2MNAA 2ICIA 1PH8A 4OWTB 4B3RL 3PO3H 2A6ED 4LMQD 3BG3A 1DD2A 1G6ZA 2JA7B 4LW1A 1V1PB 4QMGA 1J8IA 2XSCA 5C3EH 3URYA 1U5KA 1JWMD 2AHOB 3U4ZA 2MHVA 2GVAA 1TWFH 1CSPA 1YNND 4KKSA 1KNAA 1I4GA 4RHSA 3DUZA 4X3TA 2ZM6Q 1AFPA 3GP7A 1NUCA 1TQOA 5D14A 4ZUIA 2O2LD 1X65A 1V1OA 2IHEA 5M9OA 1Q81C 2BDNA 1T9HA 5C0XH 1C9OA 1T5EA 4BY1B 3C1FA 1V9PA 2HIVA 1BCPC 3JAML 1DGSA 3A0JA 5M3MH 1FYCA 5BR8L 3DWAA 3J80L 1S4ZA 3DM3A 3GTJB 1LYLA 4QY7A 3PO3B 4K0KQ 5T1GA 4UDUC 2KEEA 4ZKBB 1WTWA 5C3EB 4DV1Q 5DAUA 4K6LA 1OXTA 2EPBA 1TWFB 1Q7YC 3DWQA 2I5MX 1CTMA 1XMOQ 3VR3A 4DAMA 1WTOA 1AZQA 1Z9FA 4V0BA 3J7AF 1FGBD 3NENA 2OTLA 4DXGA 4HCSA 1VQLA 4CDFC 3R3OA 1PV4A 4A4IA 3X3NA 2ASBA 5M3MB 3PIPA 4X65Q 4DUZL 3H09A 2CWPA 1RF2D 3E9HA 3W3AA 4B3MQ 2WACA 4AYBB 3S1RH 4J6HA 4HN7A 4R1JA 5IT9c 1EUJA 5IWAQ 2Q2UA 1KTKA 2F0QA 2N55A 1CK1A 1QE6A 5HY6A 3KF8A 1L0WA 3PUYA 1GM5A 3QB3A 1JB3A 2JSOA 4YHHQ 4IFDG 1B70B 4J8QA 4KY6A 2NN6G 3NQIA 1X56A 2ZJQA 5H1SE 1VQGA 3A7LA 4JBJA 3I91A 1L0XB 4C3HG 5IE8A 1X3EA 3T1HL 2PZWA 1UE5A 2XGTA 2Z9HA 4NMZA 2F0FA 4BY1G 4DNRB 4DR1Q 1VQCA 2K05A 3HP3A 1JWUD 3EQLC 3RN5A 2K5QA 2XRQD 4N8FA 1PFBA 2F3IA 2EYOA 1HNWL 2F0WA 1NAPA 1VCIA 3N6RA 1EWCA 3HS0C 1NMGA 4A76A 5IGEA 4JI2L 3E6ZX 3S1RB 2R93H 3TN2A 5IGCA 1FR3A 3DM1A 4BA1I 3H94A 2B2UA 2J7ZA 1Z7TA 3T16A 1BOSA 1CM9A 3CCMA 4DV4L 4GNXC 1SYDA 5D3DA 1VQPA 4JI6Q 1IHZA 4M1UB 4GZYC 1SMYD 3H91A 1E0BA 2WB1B 4L8JA 1Y8NB 2CWAA 3EBEA 4DXFA 2ENBA 2OQ0A 2Q8IB 3HOWG 1PTOC 2AQ1B 3SE0A 1K3RA 5G3LF 4ZCKA 4ZYSA 4IPCA 2QEXA 3IFDA 4JV5L 3AYHB 4GLVB 1TS4A 3TZDA 2JA5H 2UXBQ 4HJ8A 5IYBG 1FNWA 2B2VC 2R93B 4DAYA 4JK1C 4PZ6A 2D0OA 5CV9A 4XDXA 4MN3A 5GQOA 1CHPD 1WYDA 3TEHB 1HNZL 1II3A 4N9TA 3I4NG 3CMAA 2NVYH 5BN5A 3I2ZA 2F0IA 2K14A 2FHTA 2XTIA 3EJIA 1SYGA 2OEOA 2OCEA 1WOCA 2A6HC 4CJ0B 1SFOH 2F0EA 1WTXA 4DR3Q 3E0EA 4YWKA 5IGFA 4DK1A 1KABA 4I7ZC 3A8KE 5I9OA 3D4DA 1S5DD 3KLSX 3ER0A 2KENA 1NTGA 1IXRA 2F3WA 2DNEA 3L9AX 3BZDB 2JA5B 2J0TD 2EIFA 3SK8A 4APVA 1D5XC 4L5RC 4BXXH 2VZAA 1RHPA 3M9BA 2PW7A 1CA6A 3L3OC 1Q12A 3CCRA 4IPGA 2CKZB 1RL2A 3WOEA 3HOZH 2NVYB 1EQVA 4A3DH 1EY9A 4ME5A 2RSNA 5GAEC 5EKIA 1XNRL 4H7BA 2R7FA 3MTSA 3PCOB 1O7ZA 1SFOB 4RKLA 2KCCA 1XTDA 2F3VA 4DV5L 4P74A 1HR0W 4FF3A 2IX3A 3BDLA 2D62A 4R8NA 5IT9L 3T1YL 1I4RA 5C5LA 5EJWA 4OX9Q 1YEZA 1I6HH 4DFAA 2ZT9C 2RBMA 5ELDA 2KA7A 3S2DH 1PH2A 3ND9A 1ENFA 4KLKA 2M2LA 1EFID 2RCFA 2RA4A 2IHFA 4DK0A 4L5QA 2F0NA 1LT5D 2JQOA 5CC4A 3SR1A 4A3IB 1NBWA 3A8IE 3HOZB 2PPBC 1EY5A 2SDFA 4A3DB 5FO7B 2NVXH 3HOVG 4LFCQ 2PYKA 2PO4A 1VMCA 3BDCA 4IUPA 3MXNB 3CW2C 3KDFB 4OIJA 4DKAC 1YBYA 2PMZE 1EL0A 1SDFA 2LXJA 1SNOA 2SNMA 4OL7A 1LTRD 3V96A 1I4HA 2O5IC 1I6HB 5ELBA 2CVRA 1T5XD 2AKWB 4DV4Q 3S2DB 3J80i 1MHWC 3GTLH 1QB5D 2D0PA 3QOJA 1TS2A 3I90A 1KRTA 3CXCA 4NXMQ 2B8GA 2JA9A 1RDPD 2QF7A 3PUWA 1SEBD 2BH8A 4MTNA 4EX5A 4KHVA 3KLWA 1SBBB 4NKLA 4N9PA 2BE5D 4JOIC 1PH4A 2ALYB 1RJTA 3M4QA 5FLMH 1CT1D 2F0DA 3G71A 2F0OA 4F87A 4DR2L 1A63A 3N52A 2NVXB 1EU3A 1M1KC 1WTVA 4JV5Q 4DUYL 4KY5A 5FO8B 1IBKQ 1ZYRD 1UE1A 2MGSA 1TT2A 3MVVA 5HGQA 1KRSA 1SNCA 3DMUA 1SJED 4YY3L 2UU9L 1HFGA 3DEPA 1D6EC 1KDCA 1N34Q 3QR8A 5EBDA 3QG1A 1Q8IA 5K36G 4OHJA 1VQMA 1SR3A 4A3KH 1YI2A 1DCZA 1ML0D 3KLRA 2Z8LA 2ZXOA 4JVZA 3GTLB 3X3MA 2FMMA 1XWEA 1GVPA 4A3IG 3EN2A 5M5XH 1KL9A 4HIMA 5JVG3 5E7NA 1E1TA 2NTSA 2EY1A 1S5BD 1H9RA 2F4VL 2CCZA 3OMGA 2YV5A 2A68C 3H3VI 1NCVA 3F2UA 2B2WA 1XPRA 3GTMH 3O13A 4FXKC 3IAYA 4OWXB 1TWCH 3GTOH 4DNTB 3CCEA 2TSSA 3H3VC 1UAPA 1S5CD 3TP5A 3S16H 4M8AA 2XIWA 5C4ZA 1EWIA 1ENAA 1H9SB 5FK9C 1WTQA 2JJQA 2QCPX 4DR4Q 2NZHA 2K01A 1U0LA 1X3PA 4H02A 4ZK9B 3ULPA 5IP7H 3IFTA 3KLSA 1Y8PB 3A5ZB 5CYUA 3CCJA 2ZTCA 3F8TA 1SNPA 3HOUH 1PHJA 1LT6D 4WRDA 5IYDG 4C3JG 4R4TA 4JI8L 1NY4A 1STYA 1DM0B 2Z0SA 3A54A 4KMUC 4G4KA 1TS3A 3T56B 4DU9A 5M5XB 5IYCH 1M90C 1B2TA 4DV6Q 5IOCA 5J3BA 4I7AA 1B3QA 1IBLL 3I4MH 2L12A 1AZPA 5LMNQ 3KFUA 4PG3A 2ZJRA 2DY8A 3FPUB 5KGUA 4ALPA 5I9PA 3ITPA 3K0XA 1I4QA 3GTMB 4IZ8A 1PYBA 1VQAA 1TWCB 3AEVA 3GTOB 1EIHA 1SLJA 4A3FH 2NVQH 3NEMA 1HZ9A 2D5DA 1C0AA 1IYVA 5FLXc 3K59A 3BDOA 3S16B 2IW3A 2ZM6L 2KHIA 2XWJB 4RH6A 2NVTH 5CGKA 3GV6A 4KHPQ 4KKTA 1X6OA 4RGTA 2UUBL 1RD9D 1SE3A 3K7AH 3OTOL 3HOUB 2OF1A 1LT3D 1G51A 5C4XG 1WI5A 1VS0A 4PNYA 4O0AA 1O7LA 3BU2A 2B2TC 3CCSA 5KYIA 3FEWX 4AH6A 3HEJA 4K0KL 2QKIC 2Z4IA 1KC8C 3BYTB 1ESRA 4B9XA 5EAYA 1PH3A 3IKJA 5GADC 4A3FB 1PZID 2NVQB 3I55A 1XMOL 3G6EA 1MIUA 4L6TB 3P7JA 2R7ZB 1R4PB 2NVTB 1YNJD 1D2BA 1BBUA 4RGMA 1VF5C 5A35A 2KHJA 1ZXTA 2LSSA 1K28A 2BCOA 3D31A 2N3SA 1LO5D 2Z4HA 4DR5Q 3K7AB 4WFN3 1EOVA 4OXPA 2K5DA 1HJPA 5KEEA 4X65L 1K8GA 2AUJD 2WV6D 3AQQA 3DXJC 4DUYQ 2MP1A 1EQQA 1ICFB 3L7ZC 1KDAA 2LFNA 5JEAG 3ONAB 4YY3Q 5JJKA 1A2UA 3KUPA 4ZQ3A 1STGA 1XTCD 2EVBA 3PUZA 4TKOB 3STBD 5EBCA 2B2WC 2EY6A 2CH4A 1PH6A 1ET6A 4G7OC 3A55A 1HQMC 2B8FA 2OTJA 2BDOA 1Y69U 1STAA 1IW7D 3JAME 2N8NA 1TKWB 4OO1I 2EYMA 5KNDA 2M00A 3TSSA 1O7IA 3CRLC 4EQ5A 4XIGS 3J80E 3PF4A 1E1OA 2ATWA 5CV6A 4JI1Q 3KBGA 1EOTA 3RZDH 2HUGA 2WINB 4XQJA 1HZBA 3KF8B 4XTCS 1KAWA 4AIMA 3S2HH 5I2XA 1YJWA 4IFDH 1QNUA 5BN4A 3K81C 3J7A5 1O78A 2NN6H 1EZ6A 5E4WC 4FYDA 4C3HH 5A2QL 3M85A 2IPKD 1VQ6A 4N8X1 4DAPA 3J81i 2WKCA 1FVIA 4HJAA 2F0SA 3UDFA 2EXZA 1VQIA 4BY7G 4X62Q 4BY1H 4JI6L 5COYA 5KNCA 3T51B 2R7ZG 3HOXG 1AE3A 4JI8Q 3C46A 3D0FA 1KIXA 4X6AH 1LABA 3PF5A 3I73A 2AWOA 4GLAC 3GTJH 4DR6L 1IBLQ 1AN8A 2Z6BA 1K3BC 4Y52H 2V1CC 1J5EQ 1NE3A 2VQEQ 1F2YA 2EQSA 4PZ8A 4FVMA 2DN8A 4GNXA 3RZDB 2UXBL 2WAQG 3BVMA 1QJOA 2E5LQ 1G91A 4GOPC 3S2HB 4XYQA 5FLXL 4OONA 4RWSC 2E2HH 4K8IA 3D3RA 2EYJA 2F0PA 1HA6A 4HJ5A 1JOOA 3SK5A 1N9WA 1HTLD 4C3HB 2Y0SG 3GO5A 2E8GA 4IPDA 4MIUA 3TMEA 2UUBQ 2RQXA 5IY0A 4X3UA 3DWPA 3OTOQ 2WB1E 4A3EG 3GTPH 2HHHQ 3HOWH 4R4CA 3BVZA 2FMCA 2RKSA 1RTOA 3I4LA 4DR3L 1FJGQ 1QZGA 1A2TA 4RCNA 2B2VA 4JC0A 4JI7L 4IFDJ 1Y1WG 4DNIA 2L11A 2F4IA 4IJHA 5I4DA 5IYBH 2JA8G 3OMCA 5FOBB 3VYRA 4XT1B 4OGQC 1NR4A 1MI2A 2IJ0A 2DJFC 4BWGB 2O5JC 3I4NH 2E2HB 3R8BA 2EY2A 3P1HA 1BCPD 3NTKA 1A6XA 4RAUC 1UE6A 2NBFA 3NXWA 4G7ZC 3CF5A 1LV9A 1X3GA 3S1NH 1OXXK 1U4LA 1TU2B 3HOWB 2QILA 3GTPB 2L55A 1GHKA 3J7YW 2K5HA 4JW0A 2WFWA 1JE4A 3R93A 1QVFA 2EJFC 1N8RC 3LGJA 2K6AA 4KY7A 4Q0FA 2Q2TA 4QL5A 1H9JA 4PMCA 1QVCA 1JE5A 1TWGH 3LX0A 3A74A 1D5ZC 3C2PA 5FJ8G 4OX9L 3AFPA 2BH2A 1ET9A 4L5SA 3GDEA 4PQXA 2C35B 2RVLA 3VYTA 5C0XJ 1QUQB 1UEAB 1ESFA 3I4NB 1JORA 2MUYA 3QIAA 3IL8A 4JI3L 4PMWA 2VXWA 4LF6Q 2K52A 1BDOA 1LLRD 1EFWA 2Q8RE 2ICEC 3GQBA 3S1NB 2Q8TA 3E9IA 4ID6A 4LFCL 5IGDA 2I5HA 2ZJPA 3J7ZC 5K5PA 3J81c 5E3FA 5JOBA 1H9MA 5DEHA 5EGTA 4UY8C 5F2DA 2Q2HA 1TWAH 3HGBA 2HDLA 3LWUA 1SNMA 4RFBA 1XMQQ 2EJGC 2QEJC 1XX8A 1DJRD 1UUPA 1TWGB 3V2TA 3D4RA 4F7XA 1PH7A 1EY4A 3U50C 1Q3LA 3KYHC 4X3SA 1D1KA 4H13C 3FRPB 1ZEQX 5J22A 1MSHA 4NW2A 4NXML 4DF7A 3NSWA 3TDQA 2HT1A 1HZCA 3OWEB 3HOVH 3PGZA 2Z6KA 3W1GA 1GJXA 5LL6S 4FP5D 2L9HA 4DR6Q 1HCZA 2HCCA 4J15A 3UDXA 3A5UA 3VYUA 4NPSA 4A3GG 2SEBD 1CQFA 1VDZA 3OIPA 2UXCL 3MHBA 2KCMA 4LF5Q 1XXGA 2N78A 3PV0A 1IBKL 2VB2X 4B3TQ 1A15A 2CQOA 1F9RA 1TWAB 4K2KA 4OIKA 5EPJA 3K5LA 1PZKD 3PUVA 4JOIA 1N34L 3OYYA 2A5HA 1SAPA 1IL8A 1A3VA 1PTOD 1EQRA 2H4OA 2ZXPA 3A7AB 4FNFA 1BBXC 5JJLA 1TR5A 3HOVB 1R4QB 2CW0C 3D6WA 2XRSD 2EYHA 3QOLA 5CORA 5EPLA 1EYCA 4JI7Q 1AP0A 1CQVA 2QDLA 5NUCA 3Q0AA 4FF2A 2VW9A 2A69C 3KK7A 1JOQA 2MQHA 1Y8OB 2F0KA 3VA5A 3F2BA 4KK7A 1BF4A 3DEOA 4LF8Q 3JC66 2EOTA 1HRJA 2R3ZA 3SK4A 3FDTA 5K36H 5D65A 1HUMA 3HKZE 4DR4L 2A6HD 2K33A 1WTRA 2B3GA 2K32A 3PUXA 4A3IH 4LJZC 3RD4A 1L1OC 1PRTC 4UP9A 4LAAA 1UEBA 1P8LA 3FP9A 1PXUA 3NPPA 1LTLA 4V190 1S5ED 3OPOA 1ILPA 4LFAQ 2YTVA 1LM0A 4DV6L 4K14A 2RDHA 2R92G 1STBA 2KUMA 1A3UA 5LMNL 1EZ8A 2AUKA 3NWTA 4DK6C 1NNXA 2KBNA 3QO2A 1G8ZD 2K5VA 1PZJD 1HUNA 3F2CA 3OW7A 4O2DA 3S1QH 4KN4C 2JE6I 1C8CA 3E3XA 1VQ4A 4U68A 1DZ1A 1L0YB 2IWHA 5C3WA 1D8LA 1BR9A 5JPNC 4NB3A 2OT2A 2SNSA 4JI3Q 3I7FA 5IYDH 4C3JH 4KHPL 4JBWA 3MZ5A 2EJMA 3V05A 1BVSA 4JI0Q 2B2YC 5ELFA 1N36Q 2QA4A 4BBRG 2HQLA 1B3AA 4A3BG 4DV7Q 1B53A 3J81L 5I2YA 1A62A 1D7QA 3HKSA 4LF9Q 2R6GA 2ID0A 1F9PA 2Z6KC 3NELA 1IZ6A 4CBVA 3TQYA 1K0RA 1QILA 3PSIA 1XNQQ 3S1QB 4RCOA 1VMPA 3NK9A 1N32Q 2LY7A 2E2IH 2PCFB 3OOCA 4IUVA 3TREA 2B2TA 3MXUA 4FF1A 3GTQH 2RCNA 1VQFA 4HR7B 5C4XH 4C3JB 2K1BA 1LTAD 2KJXA 2E75C 5M3FH 3K0YA 1MSGA 4DAVA 3HOYG 4GN3B 3DLLA 4DR5L 1SROA 2FINB 2A73B 2KECA 4MNOA 5ELEA 5GAGC 2K7VA 3VR2A 4HIDA 2UXCQ 3NQTA 1BNZA 3OIQA 3HFZB 4ZUJA 1STNA 4B3SQ 3FMCA 3CCQA 1VF7A 1D5MC 1PDQA 1Y14B 4YCWA 5IIFA 1K8OA 3QWNA 1O80A 1RIPA 1BCPB 1K8MA 2EZVA 1R9TH 2E2DC 5AFWA 2QGQA 2P5ZX 1YHBA 3MXGA 1EY8A 5ELNA 4K5VA 4DR7L 1SYEA 1E2VA 4OWWB 2JEBI 5C0XI 2E2IB 5IGBA 3D4WA 4WJ4A 1B44D 2JXMB 5EKLA 2FJ2A 2B39A 2RDGA 3GTQB 1CUKA 2MO1A 5C4XB 1N33Q 3UDGA 3OW2A 5M3FB 1BCPF 1L2FA 5BN3A 4HEDA 4KN7C 3K8AA 4JI1L 3UE0A 5JEAH 3H15A 1AW7A 1B9NA 2CFMA 4HCEA 2LXKA 1WJJA 4UP7A 1MBYA 2AMCB 4R4IA 3F2DA 1R9TB 1KAAA 4DV2Q 1CKNA 3BZKA 1YIJA 3MAQA 1YJNA 2BA0A 1TS5A 4J1MA 4R9WA 4HIKA 4DV0Q 1VQ7A 1JR0D 4X62L 2A68D 3VYSA 5JJZA 3CPFA 1MD2D 3KF6A 5JPMC 4IJLA 4LNQA 1PLFA 1PFMA 3WOFA 4C3IG 1J5EL 2VQEL 2V4DA 3ULJA 5CV4A 1FGUA 1YNXA 3UI2A 3VR4A 1EY6A 3FPPA 2F0UA 2L15A 1I94Q 3ERQA 4IALA 2E5LL 1G6PA 5EQ0A 2PI2E 3F1ZA 4HSVA 3SDZA 4BY7H 2LKVA 1HNXQ 1VQ9A 4A3MG 2R7ZH 3HOXH 4JI5Q 2WKDA 4X3KA 2H5XA 1B4OA 2NUCA 3CC2A 3Q22A 3GTKH 1EY7A 4L63B 4P73A 1U4MA 3NTHA 3MFYA 2E76C 3MXNA 5CBEE 3S14H 2F0JA 3LWEA 4GN5A 1H9KA 2HHHL 2PQAA 2I46A 4HJ7A 5M3FG 3ZJYC 4GOPA 1FJGL 2J4XA 1B50A 2ZXRA 4GNXB 3S9WA 2ES2A 1VQDA 3FHWA 4KHZA 2EY5A 2G9HD 1SJHD 3CC4A 5LHY1 1CZWA 3BYYB 4IOCA 1BQQT 1CSQA 1DOLA 3T13A 4ZLTF 4A75A 1PMRA 1JICA 1TWHH 2DNCA 1JJ2A 1RKNA 1EYGA 5CR3A 2AQ2B 4QIWB 2KCTA 3MEHA 4BY7B 1WCMG 4AQYQ 4A3EH 1OXUA 3HOXB 1HA5A 3MWYW 4P2CB 3NBHA 5DLQE 3PMFA 1XYIA 3FKIH 3GTKB 4ZKCB 2NYZD 4QF4A 3S14B 3BJUA 1CZGA 1Y1WH 3I70A 2MJ8A 2H1EA 3AB9A 1PTOF 1HFNA 1F77A 2XNAC 2JA8H 2LS01 3K57A 4DK3C 3H6MA 1RODA 2WAQB 4XQNA 5J1ZA 4QB4A 2VUMH 5FLXE 2IT1A 3K80C 5EPKA 3VR6A 1MJEA 1G2SA 2JA6G 1VQNA 4CDEC 2K03A 5C3XA 4DR7Q 1TWHB 2GN5A 4YCUA 4DGZA 1H95A 2Y0SB 3RLFA 1SNQA 2XVSA 2HIXA 1U4RA 3PO2G 1SYFA 2X69A 4HMIA 5LMUQ 5C6AA 3L0OA 1DXMA 1M4VA 1CKMA 1WD0A 4LF6L 1B7YB 1FNVA 4A3EB 3Q23A 4MHEA 2KCNA 5C5MA 1P16A 3E5SA 3NTIA 3RMHA 2UXDQ 4FF4A 3FKIB 1A0IA 2I07B 3CP0A 2KHSA 3LNNA 2UUAQ 2A74C 1Y1WB 1CFMA 5KNBA 2YTXA 5CV8A 2JA8B 2JK8A 3SEBA 1MKHA 1PH1A 4LFBQ 3MC0B 2F0HA 5FJ8H 1BBWA 1X3QA 4AYBE 4DN4M 3TBIB 4JYAQ 1I4XA 3K58A 1XMQL 2K5WA 4A3CG 1SE8A 1YVCA 2VUMB 1O7YA 1Z6HA 3RR5A 1SN8A 3IRBA 4I65A 1JQYD 1IBMQ 1EYDA 1Q86C 1QG7A 1LUZA 4QUFA
chains in the Genus database with same CATH topology
1GUGA 2TMPA 5HGTA 2NTTA 2IX0A 2A6EC 3NP8A 2L4NA 1EEID 3K5NA 2NWGA 3K5OA 1F2ZA 1IYUA 5IGGA 1GUSA 3I72A 3PIO3 2EYPA 3TP8A 2K04A 1YNNC 2JEAI 3NBIA 4FO2A 1PYWD 1LTGD 4KKUA 1B9MA 3M4YA 3NE5B 5ISRA 3EFXD 2PZUA 3TZUA 1I4PA 2KOLA 2AWNA 4KTAA 5ELCA 4DA2A 4QUCA 1IKLA 1CI3M 1QNKA 4O1NA 3BVGA 1QWYA 3DHQA 2XN9C 3C1EA 2HDMA 4IN3A 2RDFA 5J39A 1ENCA 3CQZB 2C9OA 5EKKA 3Q6SA 4H44C 1NSNS 2FFKB 1EYAA 5E1FA 4CJ1B 4CHTB 4A3GB 1QCBD 3T4AC 1HQRD 3HRZC 1RTNA 1Y1VB 3OWFA 4U673 4BA2I 2BA1A 3CU7A 1V43A 2E2JB 3P20A 1DOKA 4CKBA 1GUTA 4HAEA 3AMUA 4ODGA 3GD7A 3D6CA 2GA4B 4F8MA 1W6JA 4UAIA 1SE2A 1A3TA 2KVMA 1WVLA 1C48A 4H0LC 1ICWA 4A93B 1SMYC 4YIJA 1OXSC 2B2YA 3M4OB 2KQ3A 3BS1A 3OSOA 1SYCA 3MXPA 3RUZA 1V1PA 3R2TA 4TRDA 4NP5A 4TSSA 1CA5A 1F2LA 2R92B 1M8AA 2D9UA 1JWSD 5IT9E 1GHJA 1RCVD 4B08A 2WP8J 3WDNA 2NZ1D 2HQEA 5C0XG 2DY7A 4IUUA 3E0JA 1HHVA 1J9OA 2VB3X 1SNDA 5D3IB 5I6YA 5DM63 3G7LA 5CMDA 2L0CA 4Q5VA 1LTTD 3MFGA 3HZXA 2JP1A 4BBRB 3J81E 4A3BB 2L1BA 1B1ZA 1ONLA 3S1MB 1V8QA 5CBAE 1G2TA 4IUQA 3HG9A 1STHA 2PQEA 1U4PA 3D8GA 3SXHA 4B9WA 2EDGA 4OO1H 2G9DA 3S15B 1LACA 3NWSA 1UNSA 1BXTA 2PNRC 3SVMA 5FKAC 3AU7A 2CW0D 2C5CA 2KEDA 2A69D 2EYFA 1OO9B 3HOYB 3K6OA 4F88A 4KD4A 1BUVT 1WD1A 3G6JB 4EQNA 4RA8A 4C56C 2M9VA 1LTID 2F1MA 3ZYYX 1SSOA 4ABNA 3M7NA 1JC7A 3SHLA 5E4XA 1PRTD 4IUNA 1JOKA 2Z1CA 4S3SA 1LTBD 2XWBB 1DYQA 1DOMA 2YU9B 3QJYA 5C4HA 3KBXA 1GUNA 2NB0A 4NDXA 2PW5A 4E6IA 2VNUD 1KLUD 4TQUS 4IFDI 1TIID 2NN6I 3CKIB 3U9SA 2BOSA 4K2LA 3C3LA 2B2UC 4CGYB 4Y7NB 4O42A 4XXEA 1TY2A 2BE5C 4R8IA 2IL8A 1AEXA 1SXTA 4IURA 1STEA 1F9SA 5KIXA 1SYBA 1GUOA 5DNFA 4G57A 1EQTA 4HMJA 4C3IB 1ZYRC 2QDBA 1KLGD 1TY0A 3I8ZA 1IKMA 3FVQA 4K6DA 1ILQA 3S17B 1I3QB 4ZRZA 1EY0A 5I6WA 4A3MB 1CHQD 3W2DA 2K28A 4OO1G 3RZOB 3MA2B 4XT3B 3CRKC 4FXGC 3K5MA 2WIIB 2D2CC 3HKZB 1F9QA 1ZKOA 4ULLA 1X32A 1LT4D 2SOBA 2IX1A 4XQQA 3SK6A 4C1NI 1I6VC 1SE4A 1S5FD 4RKBA 4EGVA 4ILWA 2F0MA 3VA7A 1EU4A 1WCMB 4RGOS 4BBSB 4EVOA 5IODA 1C4QA 2N88A 4HSPA 3Q24A 2F0LA 1NR2A 5T1IA 2PZTA 3CHBD 2AQ3B 2EYLA 1G291 3ND8A 3R2IA 2JYOA 5M5WB 1F2MA 3EA6A 1DONA 4EQOA 1MGSA 4C1NK 3I3CA 1QOHA 2X6GA 1FNUA 4A3KB 3GV3A 4LK1C 1OXVA 1PTOH 4CKCA 4G7HC 2JA6B 1Q1EA 1GOZA 4PV1C 5KYLA 3PO2B 4K5XA 4EQPA 2PMZB 1KDBA 1Q90A 1HTPA 1EWHA 5JEAJ 5CV5A 5TSSA 5JVH3 2HCIA 2R61A 5KRUA 5G3LD 1WTPA 4KV6A 1E2ZA 3NHHA 1TVXA 4CJ2C 2MPMA 4ZAIA 3P75A 1K83B 1PTOB 1LTSD 5A2QE 3TP7A 1HXYD 1YNJC 3A56A 5CV7A 3I4MB 3M3YB 4HTHA 4KD3A 4IQZA 1KNEA 1Z47A 2E74C 2YYZA 4A3JB 1PFNA 2F0GA 5FO9B 4K5WA 2O4XA 1EEFD 1Q1BA 5M5YB 2LMCB 2CQAA 3T53B 3EVQA 2B63B 2EE1A 4Z9CB 2OXPA 3GTGB 1IW7C 1I50B 4XYOA 2CHBD 1D1IA 4RGNA 5DM73 3U9OA 2X6LA 4IUTA 3M7GA 3H0GB 3TP6A 1GXDC 3VR5A 3NUCA 4WJWA 2RSOA 4QCLA 1FD7D 1EIGA 1H9SA 4RHRA 1PRTB 3EROA 4FXDA 1HPCA 1GUWA 2L5TA 4WORA 3PIP3 5LL6X 2F0TA 2F0VA 4CKEA 2F03A 4C2MB 4KJOA 1PRTF 4K8JA 1W6KA 1BO0A 4KJNA 4KI0A 3J7AV 4PMBA 4BS9A 1E2WA 3OHXC 1JCKB 5C44B 3A8JE 1U9RA 5C4JB 5HURA 5JAVA 2ICIA 2A6ED 4LMQD 3BG3A 1DD2A 1G6ZA 2JA7B 1J8IA 1V1PB 4QMGA 2XSCA 3URYA 1JWMD 2MHVA 1YNND 4KKSA 1KNAA 1I4GA 4RHSA 3DUZA 4X3TA 1AFPA 3GP7A 1NUCA 1TQOA 5D14A 4ZUIA 2O2LD 1V1OA 5M9OA 2BDNA 5C0XH 1T5EA 4BY1B 3C1FA 1BCPC 3JAML 1FYCA 3DWAA 3J80L 1S4ZA 3GTJB 3PO3B 5T1GA 4UDUC 2KEEA 4ZKBB 1WTWA 5C3EB 5DAUA 4K6LA 1OXTA 2EPBA 1TWFB 3DWQA 1CTMA 3VR3A 1WTOA 1AZQA 4V0BA 3J7AF 1FGBD 4DXGA 4HCSA 3R3OA 3X3NA 5M3MB 3H09A 1RF2D 3W3AA 2WACA 4AYBB 4J6HA 4HN7A 1KTKA 2F0QA 2N55A 1CK1A 1QE6A 3KF8A 3PUYA 3QB3A 1JB3A 2JSOA 4IFDG 4J8QA 4KY6A 2NN6G 3NQIA 3A7LA 3I91A 1L0XB 4C3HG 2PZWA 4NMZA 2F0FA 4DNRB 2K05A 3HP3A 1JWUD 3EQLC 2K5QA 2XRQD 1PFBA 2EYOA 2F0WA 1NAPA 1VCIA 3N6RA 1EWCA 3HS0C 5IGEA 3E6ZX 3S1RB 3TN2A 5IGCA 1FR3A 3DM1A 4BA1I 3H94A 2B2UA 2J7ZA 1Z7TA 3T16A 1BOSA 1CM9A 1SYDA 5D3DA 1IHZA 4M1UB 4GZYC 1SMYD 3H91A 1E0BA 2WB1B 4L8JA 1Y8NB 4DXFA 2ENBA 2Q8IB 1PTOC 2AQ1B 3SE0A 5G3LF 4ZYSA 3IFDA 3TZDA 1TS4A 1FNWA 2B2VC 2R93B 4DAYA 4JK1C 5CV9A 4XDXA 4MN3A 1CHPD 1II3A 4N9TA 5BN5A 2F0IA 2FHTA 3EJIA 1SYGA 2OEOA 4CJ0B 2A6HC 2F0EA 1WTXA 5IGFA 4DK1A 1KABA 4I7ZC 3A8KE 5I9OA 3D4DA 1S5DD 3KLSX 2F3WA 2DNEA 3L9AX 3BZDB 2JA5B 2J0TD 3SK8A 1D5XC 1RHPA 2PW7A 1CA6A 3L3OC 1Q12A 3WOEA 2NVYB 1EQVA 1EY9A 4ME5A 2RSNA 5EKIA 4H7BA 3MTSA 1O7ZA 1SFOB 4RKLA 2KCCA 2F3VA 4FF3A 2IX3A 3BDLA 2D62A 4R8NA 5IT9L 1I4RA 5C5LA 5EJWA 4DFAA 2ZT9C 2RBMA 5ELDA 2KA7A 3ND9A 1ENFA 2M2LA 1EFID 2RA4A 4DK0A 2F0NA 1LT5D 5CC4A 3SR1A 4A3IB 3A8IE 3HOZB 2PPBC 1EY5A 2SDFA 4A3DB 5FO7B 2PYKA 2PO4A 1VMCA 3BDCA 4IUPA 4OIJA 1EL0A 1SDFA 1SNOA 2SNMA 4OL7A 1LTRD 3V96A 1I4HA 2O5IC 1I6HB 5ELBA 2CVRA 1T5XD 3S2DB 1QB5D 3QOJA 1TS2A 3I90A 2B8GA 1RDPD 2QF7A 3PUWA 1SEBD 4KHVA 1SBBB 4NKLA 4N9PA 2BE5D 1RJTA 1CT1D 2F0DA 2F0OA 4F87A 3N52A 2NVXB 1EU3A 1WTVA 4KY5A 5FO8B 1ZYRD 2MGSA 1TT2A 3MVVA 1SNCA 3DMUA 1SJED 1HFGA 3DEPA 1D6EC 1KDCA 5EBDA 3QG1A 1Q8IA 5K36G 4OHJA 1DCZA 1ML0D 3KLRA 2Z8LA 2ZXOA 3GTLB 3X3MA 2FMMA 1XWEA 5JVG3 2NTSA 2EY1A 1S5BD 1H9RA 3OMGA 2A68C 1NCVA 3F2UA 2B2WA 3O13A 4FXKC 3IAYA 4DNTB 2TSSA 3H3VC 1UAPA 1S5CD 3TP5A 4M8AA 2XIWA 5C4ZA 1ENAA 1H9SB 5FK9C 1WTQA 2QCPX 2K01A 1X3PA 4ZK9B 3IFTA 3KLSA 1Y8PB 5CYUA 1SNPA 1LT6D 4WRDA 4C3JG 1STYA 1DM0B 3A54A 4KMUC 4DU9A 4G4KA 1TS3A 3T56B 5M5XB 1B2TA 5IOCA 2L12A 1AZPA 2DY8A 3FPUB 5KGUA 5I9PA 3ITPA 1I4QA 3GTMB 4IZ8A 1TWCB 3GTOB 1EIHA 2D5DA 1IYVA 3K59A 3BDOA 3S16B 2IW3A 2XWJB 4RH6A 5CGKA 3GV6A 4KKTA 4RGTA 1RD9D 1SE3A 3HOUB 2OF1A 1LT3D 4PNYA 1O7LA 2B2TC 5KYIA 3FEWX 3HEJA 2QKIC 2Z4IA 3BYTB 1ESRA 4B9XA 3IKJA 4A3FB 1PZID 2NVQB 4L6TB 3P7JA 2R7ZB 1R4PB 2NVTB 1YNJD 1D2BA 4RGMA 1VF5C 5A35A 1ZXTA 2BCOA 3D31A 1LO5D 2Z4HA 3K7AB 4WFN3 2K5DA 5KEEA 2AUJD 2WV6D 3DXJC 2MP1A 3L7ZC 1KDAA 2LFNA 5JEAG 3ONAB 1A2UA 3KUPA 4ZQ3A 1STGA 1XTCD 2EVBA 3PUZA 4TKOB 5EBCA 2B2WC 2EY6A 1ET6A 4G7OC 3A55A 1HQMC 2B8FA 2BDOA 1Y69U 1STAA 1IW7D 3JAME 1TKWB 4OO1I 2EYMA 5KNDA 2M00A 3TSSA 3CRLC 4XIGS 3J80E 5CV6A 3KBGA 1EOTA 2HUGA 2WINB 4XQJA 4XTCS 5I2XA 4IFDH 1QNUA 5BN4A 1O78A 2NN6H 1EZ6A 5E4WC 4FYDA 5A2QL 3M85A 2IPKD 4DAPA 2WKCA 2F0SA 2EXZA 5COYA 5KNCA 3T51B 3C46A 1LABA 3I73A 2AWOA 1AN8A 1F2YA 4FVMA 2DN8A 3RZDB 3BVMA 1QJOA 1G91A 3S2HB 4XYQA 5FLXL 4RWSC 4K8IA 2EYJA 2F0PA 3D3RA 1HA6A 1JOOA 3SK5A 1HTLD 4C3HB 3GO5A 4MIUA 3TMEA 2RQXA 4X3UA 3DWPA 3BVZA 2FMCA 2RKSA 1RTOA 3I4LA 1A2TA 4RCNA 2B2VA 4IFDJ 2L11A 2F4IA 5I4DA 3OMCA 5FOBB 3VYRA 4XT1B 4OGQC 1NR4A 1MI2A 2IJ0A 4BWGB 2O5JC 2E2HB 3R8BA 2EY2A 3P1HA 1BCPD 3NTKA 1A6XA 4RAUC 2NBFA 3NXWA 4G7ZC 1LV9A 1OXXK 1U4LA 1TU2B 3HOWB 2QILA 3GTPB 2L55A 1GHKA 3J7YW 1JE4A 3R93A 2EJFC 2K6AA 4KY7A 4Q0FA 1H9JA 4PMCA 3LX0A 3C2PA 1D5ZC 1ET9A 4PQXA 2RVLA 3VYTA 5C0XJ 1UEAB 1ESFA 3I4NB 1JORA 2MUYA 3QIAA 3IL8A 4PMWA 2VXWA 1BDOA 1LLRD 2Q8RE 2ICEC 3GQBA 3S1NB 2Q8TA 4ID6A 5IGDA 5K5PA 5E3FA 5JOBA 1H9MA 5DEHA 5EGTA 5F2DA 3HGBA 2HDLA 3LWUA 1SNMA 4RFBA 2EJGC 2QEJC 1XX8A 1DJRD 1UUPA 1TWGB 3V2TA 3D4RA 4F7XA 1EY4A 1Q3LA 4X3SA 1D1KA 4H13C 3FRPB 1ZEQX 5J22A 1MSHA 4NW2A 4DF7A 3NSWA 3TDQA 3OWEB 1GJXA 5LL6S 4FP5D 2L9HA 1HCZA 2HCCA 3VYUA 2SEBD 1CQFA 1VDZA 3OIPA 3MHBA 1XXGA 3PV0A 2VB2X 1A15A 1F9RA 1TWAB 4K2KA 4OIKA 5EPJA 3K5LA 1PZKD 3PUVA 2A5HA 1SAPA 1IL8A 1A3VA 1PTOD 2H4OA 2ZXPA 3A7AB 4FNFA 1BBXC 1TR5A 3HOVB 1R4QB 2CW0C 3D6WA 2XRSD 2EYHA 3QOLA 5CORA 5EPLA 1EYCA 1AP0A 1CQVA 5NUCA 3Q0AA 4FF2A 1JOQA 2A69C 3KK7A 1Y8OB 2F0KA 3VA5A 4KK7A 1BF4A 3DEOA 2EOTA 1HRJA 2R3ZA 3SK4A 3FDTA 5K36H 5D65A 1HUMA 2A6HD 2K33A 1WTRA 2K32A 3PUXA 4LJZC 3RD4A 1PRTC 4LAAA 1PXUA 3NPPA 4V190 1S5ED 3OPOA 1ILPA 4K14A 2RDHA 1STBA 2KUMA 1A3UA 1EZ8A 2AUKA 3NWTA 3QO2A 1G8ZD 1HUNA 1PZJD 3OW7A 4KN4C 2JE6I 1C8CA 4U68A 1DZ1A 1L0YB 2IWHA 5C3WA 1BR9A 5JPNC 2OT2A 2SNSA 4JBWA 3MZ5A 2EJMA 3V05A 2B2YC 5ELFA 1B3AA 1B53A 3J81L 5I2YA 2R6GA 2ID0A 1F9PA 4CBVA 1QILA 3S1QB 4RCOA 1VMPA 3NK9A 2LY7A 2PCFB 3OOCA 4IUVA 2B2TA 3MXUA 4FF1A 4HR7B 4C3JB 2K1BA 1LTAD 2KJXA 2E75C 3K0YA 1MSGA 4DAVA 2FINB 2A73B 2KECA 5ELEA 2K7VA 3VR2A 3NQTA 1BNZA 3OIQA 4ZUJA 1STNA 3FMCA 1VF7A 1D5MC 1PDQA 5IIFA 1K8OA 3QWNA 1O80A 1BCPB 1K8MA 2EZVA 2E2DC 5AFWA 3MXGA 1EY8A 4K5VA 1SYEA 1E2VA 2JEBI 5C0XI 2E2IB 5IGBA 3D4WA 1B44D 2JXMB 5EKLA 2FJ2A 2B39A 2RDGA 3GTQB 5C4XB 5M3FB 1BCPF 5BN3A 4HEDA 4KN7C 5JEAH 1AW7A 1B9NA 4HCEA 1MBYA 1R9TB 1KAAA 3MAQA 2BA0A 1TS5A 4J1MA 4R9WA 1JR0D 2A68D 3VYSA 5JJZA 1MD2D 5JPMC 1PLFA 1PFMA 3WOFA 4C3IG 2V4DA 5CV4A 3UI2A 3VR4A 1EY6A 3FPPA 2F0UA 3ERQA 4IALA 5EQ0A 4HSVA 3SDZA 2LKVA 2WKDA 4X3KA 1B4OA 2NUCA 3Q22A 1EY7A 4L63B 1U4MA 3NTHA 2E76C 3MFYA 3MXNA 5CBEE 2F0JA 3LWEA 1H9KA 2I46A 2J4XA 1B50A 2ZXRA 3S9WA 4KHZA 2EY5A 2G9HD 1SJHD 5LHY1 1CZWA 3BYYB 1BQQT 1DOLA 3T13A 4ZLTF 1PMRA 1JICA 2DNCA 1RKNA 5CR3A 2AQ2B 4QIWB 3MEHA 4BY7B 1OXUA 3HOXB 1HA5A 3MWYW 4P2CB 3NBHA 3PMFA 1XYIA 3GTKB 4ZKCB 2NYZD 4QF4A 3S14B 1CZGA 2MJ8A 3I70A 2H1EA 3AB9A 1PTOF 1HFNA 1F77A 2XNAC 2LS01 3K57A 3H6MA 1RODA 2WAQB 4XQNA 5J1ZA 4QB4A 5FLXE 2IT1A 5EPKA 3VR6A 1G2SA 2K03A 5C3XA 1TWHB 4DGZA 2Y0SB 3RLFA 1SNQA 2XVSA 1U4RA 1SYFA 2X69A 4HMIA 5C6AA 1DXMA 1M4VA 1WD0A 1FNVA 4A3EB 3Q23A 4MHEA 2KCNA 5C5MA 3NTIA 3E5SA 3RMHA 4FF4A 3FKIB 2I07B 2KHSA 3LNNA 2A74C 1Y1WB 1CFMA 5KNBA 5CV8A 2JA8B 3SEBA 3MC0B 2F0HA 1X3QA 4DN4M 3TBIB 1I4XA 3K58A 2K5WA 2VUMB 1O7YA 1Z6HA 4I65A 1JQYD 1EYDA 1QG7A 4QUFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HN7 A;  2JSO A;  2RQX A; 
#chains in the Genus database with same CATH topology
 1GUG A;  2TMP A;  5HGT A;  2NTT A;  2IX0 A;  2VY3 A;  2A6E C;  3NP8 A;  2L4N A;  1EEI D;  3K5N A;  2NWG A;  3K5O A;  1F2Z A;  1YZ6 A;  2UUC Q;  1HH2 P;  4A3J G;  1IYU A;  5IGG A;  1I5F A;  1GUS A;  3I72 A;  3PIO 3;  2EYP A;  3TP8 A;  2GVB A;  2K04 A;  1YNN C;  3WWV A;  2JEA I;  4LF5 L;  4LF7 Q;  3NBI A;  4B3T L;  4FO2 A;  1MJC A;  1VQK A;  1PYW D;  4LUV A;  4DV3 Q;  1LTG D;  4KKU A;  2B63 G;  1B9M A;  1X9N A;  3KJP A;  3M4Y A;  3NE5 B;  3B6Y A;  3CQZ H;  5ISR A;  3Q8D A;  4P71 A;  1XPU A;  2RF4 A;  4JI4 Q;  2DGY A;  3H0G G;  5IP9 G;  3EFX D;  1X54 A;  4A3G H;  3AFQ A;  3FKI G;  2PZU A;  3TZU A;  1E24 A;  1I4P A;  1Y1V H;  4IO9 A;  2KOL A;  1ASZ A;  2AWN A;  4KTA A;  5ELC A;  4DA2 A;  4DAY B;  4QUC A;  1IKL A;  1CI3 M;  1QNK A;  4LUO A;  4O1N A;  4LF8 L;  2VUM G;  3BVG A;  2E2J H;  1QWY A;  3CPW A;  3RNU A;  3DHQ A;  2XN9 C;  4LF4 Q;  3U4V A;  3C1E A;  2HDM A;  4IN3 A;  2RDF A;  5J39 A;  3L2P A;  3H3V H;  1ENC A;  3CQZ B;  2QW7 A;  2C9O A;  5EKK A;  3Q6S A;  4H44 C;  3TS0 A;  3S24 A;  1NSN S;  4OEL B;  2FFK B;  4MZ9 A;  1EYA A;  5E1F A;  4LFA L;  4FDB A;  2DUD A;  4CJ1 B;  4CHT B;  4A3G B;  1S40 A;  4X66 Q;  1QCB D;  3T4A C;  1HQR D;  3HRZ C;  1KD1 C;  5C44 G;  1RTN A;  1Y1V B;  1K73 C;  3CME A;  1SMX A;  3OWF A;  4U67 3;  1L1O A;  4BA2 I;  1VQB A;  1KHI A;  4A93 H;  1FL0 A;  2BA1 A;  3CU7 A;  3M4O H;  4A3L G;  1V43 A;  1VQ8 A;  2E2J B;  4NXN Q;  5L37 A;  3P20 A;  2JA7 G;  1DOK A;  4CKB A;  1GUT A;  4HAE A;  4OEM B;  3AMU A;  4ODG A;  1WTH A;  4IPH A;  3KOJ A;  3GD7 A;  2R92 H;  4JI0 L;  5GRO A;  1N36 L;  3D6C A;  1Q46 A;  2GA4 B;  4F8M A;  2PI2 A;  4DV7 L;  1W6J A;  4UAI A;  4LF9 L;  2N49 A;  1SE2 A;  3PIO A;  1A3T A;  2KVM A;  1WVL A;  1C48 A;  4H0L C;  1QVG A;  1E22 A;  1Q82 C;  1ICW A;  1XNQ L;  1NJI C;  1JJC B;  4A93 B;  1SMY C;  1N32 L;  4YIJ A;  1OXS C;  2B2Y A;  3M4O B;  3RLN A;  2KQ3 A;  3CAM A;  3BS1 A;  2I0Q A;  3PO3 G;  3OSO A;  1SYC A;  3MXP A;  4HJ9 A;  3RUZ A;  1V1P A;  4QQB X;  3R2T A;  4TRD A;  5ELO A;  4NP5 A;  4TSS A;  5C3E G;  1UE7 A;  1QZH A;  1CA5 A;  4BBR H;  1OTC A;  4A3B H;  2A19 A;  1YIT A;  1F2L A;  3S1M H;  2B29 A;  2R92 B;  1M8A A;  2D9U A;  1JWS D;  5IT9 E;  1GHJ A;  4X64 Q;  4GKJ Q;  1Y1V G;  1RCV D;  4B08 A;  2WP8 J;  4UHV A;  4B3S L;  3WDN A;  2NZ1 D;  2HQE A;  3S15 H;  5C0X G;  3SGI A;  2DY7 A;  4IUU A;  3E0J A;  4B3R Q;  2R7D A;  1HHV A;  1J9O A;  1VQE A;  2VB3 X;  5M3M G;  1SND A;  5D3I B;  1VQH A;  5I6Y A;  1YHA A;  2YTY A;  4LWC A;  4AYB G;  3ERS X;  5DM6 3;  1YHQ A;  3HOY H;  3G7L A;  5CMD A;  2L0C A;  4Q5V A;  1LTT D;  1N33 L;  3MFG A;  3TS2 A;  3HZX A;  2JP1 A;  4BBR B;  3J81 E;  4QGU A;  4A3B B;  1J6Q A;  2L1B A;  1B1Z A;  1HZA A;  1ONL A;  4LUZ A;  1CKO A;  3S1M B;  1PVO A;  1V8Q A;  5CBA E;  1G2T A;  4IUQ A;  3HG9 A;  1STH A;  1B8A A;  1VQJ A;  2PQE A;  1U4P A;  3D8G A;  3SXH A;  5BR8 Q;  4B9W A;  2K4K A;  2EDG A;  4P72 A;  1YJ9 A;  2G9D A;  3S15 B;  4OO1 H;  4A93 G;  2YU9 H;  1LAC A;  3NWS A;  1UNS A;  4DV2 L;  3M4P A;  1BXT A;  2PNR C;  1X3F A;  3SVM A;  5FKA C;  1AE2 A;  3AU7 A;  4DV0 L;  2CW0 D;  1SRU A;  2C5C A;  2KED A;  3KJO A;  2A69 D;  2EYF A;  1UWV A;  1OO9 B;  3HOY B;  1W2B A;  3K6O A;  4F88 A;  4KD4 A;  1BUV T;  2RHQ B;  1WD1 A;  3G6J B;  4EQN A;  1ASY A;  4QJF A;  1QUQ A;  4RA8 A;  4C56 C;  2M9V A;  5LMN W;  2WB1 G;  1JT8 A;  3VDY A;  1LTI D;  2F1M A;  3ZYY X;  1SSO A;  4ABN A;  4Y7N H;  1I94 L;  1CKN B;  3M7N A;  1JC7 A;  3SHL A;  5E4X A;  1XJV A;  1HR0 L;  2ZTE A;  1PRT D;  4IUN A;  1JOK A;  2EXD A;  2Z1C A;  4S3S A;  1LTB D;  4DUZ Q;  1HNX L;  2XWB B;  1DYQ A;  1DOM A;  2YU9 B;  4JI5 L;  3QJY A;  3KF6 B;  5C4H A;  3KBX A;  4JBM A;  1GUN A;  4JG2 A;  2NB0 A;  2FXQ A;  1NMF A;  4NDX A;  3I56 A;  2PW5 A;  4C3I H;  4WJ3 M;  2R93 G;  4E6I A;  2MFI A;  3MEF A;  3TRZ A;  2VNU D;  1KLU D;  2MO0 A;  4TQU S;  4IFD I;  3T1H Q;  3S17 H;  1I3Q H;  1BKB A;  1TII D;  2NN6 I;  3CKI B;  3U9S A;  2BOS A;  4K2L A;  3C3L A;  2B2U C;  4CGY B;  2RHS B;  4A3M H;  4Y7N B;  3BZC A;  1PYS B;  4O42 A;  3RZO H;  4XXE A;  1TY2 A;  1HNW Q;  3W5O A;  1GO3 E;  2BE5 C;  2PNH A;  4R8I A;  2IL8 A;  3PQI A;  2F52 A;  1AEX A;  1SXT A;  2VL6 A;  4AQY L;  4JI2 Q;  2PQA B;  4IUR A;  4GLX A;  4GOP B;  1STE A;  1F9S A;  5KIX A;  1E7Z A;  1SYB A;  1VQO A;  2Q2I A;  1GUO A;  5DNF A;  2JA5 G;  3JAM i;  4G57 A;  2OWO A;  1KXL A;  1EQT A;  2ZTD A;  4HMJ A;  4C3I B;  1ZYR C;  2QDB A;  1KLG D;  1TY0 A;  3G4S A;  1S72 A;  3I8Z A;  1IKM A;  3FVQ A;  4K6D A;  1ILQ A;  3S17 B;  1I3Q B;  1S3O A;  4ZRZ A;  1EY0 A;  3K7U C;  3G48 A;  5I6W A;  4A3M B;  1CHQ D;  1WCM H;  4GN4 B;  1KQS A;  4BBS H;  3W2D A;  4UP8 A;  2K28 A;  4OO1 G;  4QIW E;  3RZO B;  1TXY A;  3NBH B;  2CH4 W;  3MA2 B;  4XT3 B;  5LMU L;  1EIF A;  2VQF L;  3CRK C;  5M5W H;  4FXG C;  3K5M A;  2WII B;  2D2C C;  3HKZ B;  2UXD L;  1F9Q A;  1ZKO A;  2K75 A;  1K0S A;  4ULL A;  1HNZ Q;  2UUA L;  1X32 A;  1LT4 D;  2SOB A;  4YWM A;  2IX1 A;  4BXX G;  1IYJ B;  4ME3 A;  4XQQ A;  3SK6 A;  4LFB L;  3CC7 A;  2JA6 H;  4L5T A;  2WAQ E;  1W3S A;  4C1N I;  1I6V C;  4JYA L;  1SE4 A;  4YCV A;  3HOZ G;  1S5F D;  5JJI A;  4A3D G;  4RKB A;  4EGV A;  4ILW A;  2F0M A;  3VA7 A;  3PO2 H;  1EU4 A;  1IBM L;  3CCV A;  1WCM B;  4RGO S;  4BBS B;  2Y0S E;  4EVO A;  3CCL A;  5IOD A;  1C4Q A;  2N88 A;  4HSP A;  3Q24 A;  2F0L A;  1NR2 A;  5T1I A;  4POG A;  2PZT A;  3CHB D;  2AQ3 B;  2EYL A;  1G29 1;  3ND8 A;  2UUC L;  4GKK L;  3R2I A;  2JYO A;  5M5W B;  1F2M A;  3EA6 A;  1DON A;  4EQO A;  1MGS A;  4C1N K;  3I3C A;  1QOH A;  2X6G A;  1FNU A;  1K9M C;  1XPO A;  4A3K B;  4A3C H;  4IOA A;  3GV3 A;  5AJ3 L;  4LK1 C;  1OXV A;  1A8V A;  1K83 H;  1PTO H;  1XNR Q;  4LF7 L;  4CKC A;  4G7H C;  2JA6 B;  1HR0 Q;  1Q1E A;  3ULL A;  4R4O A;  1K8A C;  2IY5 B;  4DV3 L;  1GOZ A;  4DV5 Q;  3M3Y H;  4PV1 C;  5KYL A;  3PO2 B;  4K5X A;  4EQP A;  2PMZ B;  1KDB A;  3T1Y Q;  1Q90 A;  1HTP A;  4JI4 L;  1EWH A;  4A3J H;  3KDF A;  5JEA J;  3HKZ G;  5GAH C;  3I4O A;  5CV5 A;  5TSS A;  5M5Y H;  5JVH 3;  2HCI A;  2R61 A;  5KRU A;  5G3L D;  1WTP A;  4KV6 A;  1E2Z A;  3NHH A;  1TVX A;  4CJ2 C;  2MPM A;  2B63 H;  4ZAI A;  3P75 A;  1K83 B;  1PTO B;  1LTS D;  4CDD C;  3JAM c;  3TP7 A;  1HXY D;  5A2Q E;  3GTG H;  1I50 H;  1JJG A;  1YNJ C;  4LF4 L;  5FLM G;  3J80 c;  1PFS A;  3A56 A;  4BBS G;  5CV7 A;  3I4M B;  3M3Y B;  4HTH A;  3H0G H;  5IP9 H;  3UE1 A;  1X55 A;  3W1B A;  4KD3 A;  4IQZ A;  2JN4 A;  4DV1 L;  1KNE A;  3U58 A;  1Z47 A;  2E74 C;  2YYZ A;  3CCU A;  3CD6 A;  4A3J B;  4PZ7 A;  1PFN A;  2F0G A;  5FO9 B;  2VS1 A;  4K5W A;  2O4X A;  1EEF D;  4X66 L;  1Q1B A;  5M5Y B;  3RN2 A;  4UPA A;  2LMC B;  3STB C;  1PA6 A;  4A3K G;  2CQA A;  3T53 B;  2A1A A;  4TVA B;  3EVQ A;  1GD7 A;  2B63 B;  2K50 A;  4GS3 A;  4DR2 Q;  2EE1 A;  4Z9C B;  4R4Q A;  2OXP A;  3GTG B;  1IW7 C;  1VQ5 A;  1I50 B;  3J81 j;  4XYO A;  2CHB D;  1D1I A;  4NXN L;  4RGN A;  5DM7 3;  4C2M H;  3U9O A;  4B3M L;  2X6L A;  4IUT A;  2VQF Q;  4RMF A;  3M7G A;  4DPG A;  2NZO A;  2UU9 Q;  3H0G B;  5IWA L;  2I5L X;  3TP6 A;  1GXD C;  3VR5 A;  1Q8K A;  3NUC A;  4CDC C;  4RG1 A;  2RSO A;  4WJW A;  4YHH L;  1JB7 A;  1FD7 D;  4QCL A;  1AH9 A;  5C44 H;  2HD3 A;  3UDI A;  1EIG A;  5C4J H;  1L1O B;  1H9S A;  4RHR A;  1PRT B;  3ERO A;  1WFQ A;  1C7Y A;  4FXD A;  1HPC A;  3RLO A;  4YWL A;  5IP7 G;  1GKH A;  4A3L H;  1GUW A;  3ICE A;  2F4V Q;  3HOU G;  4DR1 L;  4MTK A;  2G5D A;  2L5T A;  2JA7 H;  4WOR A;  3PIP 3;  1EIY B;  1V1Q A;  5LL6 X;  5IYC G;  2F0T A;  1E3P A;  2F0V A;  4CKE A;  2F03 A;  3I4M G;  1JMC A;  4C2M B;  4KJO A;  1PRT F;  4JBK A;  4K8J A;  1W6K A;  1PH9 A;  4POF A;  4GKK Q;  2A8V A;  1BO0 A;  2K5N A;  4HIO A;  4KJN A;  4KI0 A;  4A3F G;  3J7A V;  1PH5 A;  4PMB A;  4BS9 A;  4JCV E;  1E2W A;  3OHX C;  1JCK B;  4JPB W;  5C44 B;  3A8J E;  3EIV A;  2DJG C;  4X64 L;  1U9R A;  5C4J B;  4GKJ L;  5AJ3 Q;  4P75 A;  5HUR A;  5JAV A;  1IL2 A;  2OQK A;  2MNA A;  2ICI A;  1PH8 A;  4OWT B;  4B3R L;  3PO3 H;  2A6E D;  4LMQ D;  3BG3 A;  1DD2 A;  1G6Z A;  2JA7 B;  4LW1 A;  1V1P B;  4QMG A;  1J8I A;  2XSC A;  5C3E H;  3URY A;  1U5K A;  1JWM D;  2AHO B;  3U4Z A;  2MHV A;  2GVA A;  1TWF H;  1CSP A;  1YNN D;  4KKS A;  1KNA A;  1I4G A;  4RHS A;  3DUZ A;  4X3T A;  2ZM6 Q;  1AFP A;  3GP7 A;  1NUC A;  1TQO A;  5D14 A;  4ZUI A;  2O2L D;  1X65 A;  1V1O A;  2IHE A;  5M9O A;  1Q81 C;  2BDN A;  1T9H A;  5C0X H;  1C9O A;  1T5E A;  4BY1 B;  3C1F A;  1V9P A;  2HIV A;  1BCP C;  3JAM L;  1DGS A;  3A0J A;  5M3M H;  1FYC A;  5BR8 L;  3DWA A;  3J80 L;  1S4Z A;  3DM3 A;  3GTJ B;  1LYL A;  4QY7 A;  3PO3 B;  4K0K Q;  5T1G A;  4UDU C;  2KEE A;  4ZKB B;  1WTW A;  5C3E B;  4DV1 Q;  5DAU A;  4K6L A;  1OXT A;  2EPB A;  1TWF B;  1Q7Y C;  3DWQ A;  2I5M X;  1CTM A;  1XMO Q;  3VR3 A;  4DAM A;  1WTO A;  1AZQ A;  1Z9F A;  4V0B A;  3J7A F;  1FGB D;  3NEN A;  2OTL A;  4DXG A;  4HCS A;  1VQL A;  4CDF C;  3R3O A;  1PV4 A;  4A4I A;  3X3N A;  2ASB A;  5M3M B;  3PIP A;  4X65 Q;  4DUZ L;  3H09 A;  2CWP A;  1RF2 D;  3E9H A;  3W3A A;  4B3M Q;  2WAC A;  4AYB B;  3S1R H;  4J6H A;  4HN7 A;  4R1J A;  5IT9 c;  1EUJ A;  5IWA Q;  2Q2U A;  1KTK A;  2F0Q A;  2N55 A;  1CK1 A;  1QE6 A;  5HY6 A;  3KF8 A;  1L0W A;  3PUY A;  1GM5 A;  3QB3 A;  1JB3 A;  2JSO A;  4YHH Q;  4IFD G;  1B70 B;  4J8Q A;  4KY6 A;  2NN6 G;  3NQI A;  1X56 A;  2ZJQ A;  5H1S E;  1VQG A;  3A7L A;  4JBJ A;  3I91 A;  1L0X B;  4C3H G;  5IE8 A;  1X3E A;  3T1H L;  2PZW A;  1UE5 A;  2XGT A;  2Z9H A;  4NMZ A;  2F0F A;  4BY1 G;  4DNR B;  4DR1 Q;  1VQC A;  2K05 A;  3HP3 A;  1JWU D;  3EQL C;  3RN5 A;  2K5Q A;  2XRQ D;  4N8F A;  1PFB A;  2F3I A;  2EYO A;  1HNW L;  2F0W A;  1NAP A;  1VCI A;  3N6R A;  1EWC A;  3HS0 C;  1NMG A;  4A76 A;  5IGE A;  4JI2 L;  3E6Z X;  3S1R B;  2R93 H;  3TN2 A;  5IGC A;  1FR3 A;  3DM1 A;  4BA1 I;  3H94 A;  2B2U A;  2J7Z A;  1Z7T A;  3T16 A;  1BOS A;  1CM9 A;  3CCM A;  4DV4 L;  4GNX C;  1SYD A;  5D3D A;  1VQP A;  4JI6 Q;  1IHZ A;  4M1U B;  4GZY C;  1SMY D;  3H91 A;  1E0B A;  2WB1 B;  4L8J A;  1Y8N B;  2CWA A;  3EBE A;  4DXF A;  2ENB A;  2OQ0 A;  2Q8I B;  3HOW G;  1PTO C;  2AQ1 B;  3SE0 A;  1K3R A;  5G3L F;  4ZCK A;  4ZYS A;  4IPC A;  2QEX A;  3IFD A;  4JV5 L;  3AYH B;  4GLV B;  1TS4 A;  3TZD A;  2JA5 H;  2UXB Q;  4HJ8 A;  5IYB G;  1FNW A;  2B2V C;  2R93 B;  4DAY A;  4JK1 C;  4PZ6 A;  2D0O A;  5CV9 A;  4XDX A;  4MN3 A;  5GQO A;  1CHP D;  1WYD A;  3TEH B;  1HNZ L;  1II3 A;  4N9T A;  3I4N G;  3CMA A;  2NVY H;  5BN5 A;  3I2Z A;  2F0I A;  2K14 A;  2FHT A;  2XTI A;  3EJI A;  1SYG A;  2OEO A;  2OCE A;  1WOC A;  2A6H C;  4CJ0 B;  1SFO H;  2F0E A;  1WTX A;  4DR3 Q;  3E0E A;  4YWK A;  5IGF A;  4DK1 A;  1KAB A;  4I7Z C;  3A8K E;  5I9O A;  3D4D A;  1S5D D;  3KLS X;  3ER0 A;  2KEN A;  1NTG A;  1IXR A;  2F3W A;  2DNE A;  3L9A X;  3BZD B;  2JA5 B;  2J0T D;  2EIF A;  3SK8 A;  4APV A;  1D5X C;  4L5R C;  4BXX H;  2VZA A;  1RHP A;  3M9B A;  2PW7 A;  1CA6 A;  3L3O C;  1Q12 A;  3CCR A;  4IPG A;  2CKZ B;  1RL2 A;  3WOE A;  3HOZ H;  2NVY B;  1EQV A;  4A3D H;  1EY9 A;  4ME5 A;  2RSN A;  5GAE C;  5EKI A;  1XNR L;  4H7B A;  2R7F A;  3MTS A;  3PCO B;  1O7Z A;  1SFO B;  4RKL A;  2KCC A;  1XTD A;  2F3V A;  4DV5 L;  4P74 A;  1HR0 W;  4FF3 A;  2IX3 A;  3BDL A;  2D62 A;  4R8N A;  5IT9 L;  3T1Y L;  1I4R A;  5C5L A;  5EJW A;  4OX9 Q;  1YEZ A;  1I6H H;  4DFA A;  2ZT9 C;  2RBM A;  5ELD A;  2KA7 A;  3S2D H;  1PH2 A;  3ND9 A;  1ENF A;  4KLK A;  2M2L A;  1EFI D;  2RCF A;  2RA4 A;  2IHF A;  4DK0 A;  4L5Q A;  2F0N A;  1LT5 D;  2JQO A;  5CC4 A;  3SR1 A;  4A3I B;  1NBW A;  3A8I E;  3HOZ B;  2PPB C;  1EY5 A;  2SDF A;  4A3D B;  5FO7 B;  2NVX H;  3HOV G;  4LFC Q;  2PYK A;  2PO4 A;  1VMC A;  3BDC A;  4IUP A;  3MXN B;  3CW2 C;  3KDF B;  4OIJ A;  4DKA C;  1YBY A;  2PMZ E;  1EL0 A;  1SDF A;  2LXJ A;  1SNO A;  2SNM A;  4OL7 A;  1LTR D;  3V96 A;  1I4H A;  2O5I C;  1I6H B;  5ELB A;  2CVR A;  1T5X D;  2AKW B;  4DV4 Q;  3S2D B;  3J80 i;  1MHW C;  3GTL H;  1QB5 D;  2D0P A;  3QOJ A;  1TS2 A;  3I90 A;  1KRT A;  3CXC A;  4NXM Q;  2B8G A;  2JA9 A;  1RDP D;  2QF7 A;  3PUW A;  1SEB D;  2BH8 A;  4MTN A;  4EX5 A;  4KHV A;  3KLW A;  1SBB B;  4NKL A;  4N9P A;  2BE5 D;  4JOI C;  1PH4 A;  2ALY B;  1RJT A;  3M4Q A;  5FLM H;  1CT1 D;  2F0D A;  3G71 A;  2F0O A;  4F87 A;  4DR2 L;  1A63 A;  3N52 A;  2NVX B;  1EU3 A;  1M1K C;  1WTV A;  4JV5 Q;  4DUY L;  4KY5 A;  5FO8 B;  1IBK Q;  1ZYR D;  1UE1 A;  2MGS A;  1TT2 A;  3MVV A;  5HGQ A;  1KRS A;  1SNC A;  3DMU A;  1SJE D;  4YY3 L;  2UU9 L;  1HFG A;  3DEP A;  1D6E C;  1KDC A;  1N34 Q;  3QR8 A;  5EBD A;  3QG1 A;  1Q8I A;  5K36 G;  4OHJ A;  1VQM A;  1SR3 A;  4A3K H;  1YI2 A;  1DCZ A;  1ML0 D;  3KLR A;  2Z8L A;  2ZXO A;  4JVZ A;  3GTL B;  3X3M A;  2FMM A;  1XWE A;  1GVP A;  4A3I G;  3EN2 A;  5M5X H;  1KL9 A;  4HIM A;  5JVG 3;  5E7N A;  1E1T A;  2NTS A;  2EY1 A;  1S5B D;  1H9R A;  2F4V L;  2CCZ A;  3OMG A;  2YV5 A;  2A68 C;  3H3V I;  1NCV A;  3F2U A;  2B2W A;  1XPR A;  3GTM H;  3O13 A;  4FXK C;  3IAY A;  4OWX B;  1TWC H;  3GTO H;  4DNT B;  3CCE A;  2TSS A;  3H3V C;  1UAP A;  1S5C D;  3TP5 A;  3S16 H;  4M8A A;  2XIW A;  5C4Z A;  1EWI A;  1ENA A;  1H9S B;  5FK9 C;  1WTQ A;  2JJQ A;  2QCP X;  4DR4 Q;  2NZH A;  2K01 A;  1U0L A;  1X3P A;  4H02 A;  4ZK9 B;  3ULP A;  5IP7 H;  3IFT A;  3KLS A;  1Y8P B;  3A5Z B;  5CYU A;  3CCJ A;  2ZTC A;  3F8T A;  1SNP A;  3HOU H;  1PHJ A;  1LT6 D;  4WRD A;  5IYD G;  4C3J G;  4R4T A;  4JI8 L;  1NY4 A;  1STY A;  1DM0 B;  2Z0S A;  3A54 A;  4KMU C;  4G4K A;  1TS3 A;  3T56 B;  4DU9 A;  5M5X B;  5IYC H;  1M90 C;  1B2T A;  4DV6 Q;  5IOC A;  5J3B A;  4I7A A;  1B3Q A;  1IBL L;  3I4M H;  2L12 A;  1AZP A;  5LMN Q;  3KFU A;  4PG3 A;  2ZJR A;  2DY8 A;  3FPU B;  5KGU A;  4ALP A;  5I9P A;  3ITP A;  3K0X A;  1I4Q A;  3GTM B;  4IZ8 A;  1PYB A;  1VQA A;  1TWC B;  3AEV A;  3GTO B;  1EIH A;  1SLJ A;  4A3F H;  2NVQ H;  3NEM A;  1HZ9 A;  2D5D A;  1C0A A;  1IYV A;  5FLX c;  3K59 A;  3BDO A;  3S16 B;  2IW3 A;  2ZM6 L;  2KHI A;  2XWJ B;  4RH6 A;  2NVT H;  5CGK A;  3GV6 A;  4KHP Q;  4KKT A;  1X6O A;  4RGT A;  2UUB L;  1RD9 D;  1SE3 A;  3K7A H;  3OTO L;  3HOU B;  2OF1 A;  1LT3 D;  1G51 A;  5C4X G;  1WI5 A;  1VS0 A;  4PNY A;  4O0A A;  1O7L A;  3BU2 A;  2B2T C;  3CCS A;  5KYI A;  3FEW X;  4AH6 A;  3HEJ A;  4K0K L;  2QKI C;  2Z4I A;  1KC8 C;  3BYT B;  1ESR A;  4B9X A;  5EAY A;  1PH3 A;  3IKJ A;  5GAD C;  4A3F B;  1PZI D;  2NVQ B;  3I55 A;  1XMO L;  3G6E A;  1MIU A;  4L6T B;  3P7J A;  2R7Z B;  1R4P B;  2NVT B;  1YNJ D;  1D2B A;  1BBU A;  4RGM A;  1VF5 C;  5A35 A;  2KHJ A;  1ZXT A;  2LSS A;  1K28 A;  2BCO A;  3D31 A;  2N3S A;  1LO5 D;  2Z4H A;  4DR5 Q;  3K7A B;  4WFN 3;  1EOV A;  4OXP A;  2K5D A;  1HJP A;  5KEE A;  4X65 L;  1K8G A;  2AUJ D;  2WV6 D;  3AQQ A;  3DXJ C;  4DUY Q;  2MP1 A;  1EQQ A;  1ICF B;  3L7Z C;  1KDA A;  2LFN A;  5JEA G;  3ONA B;  4YY3 Q;  5JJK A;  1A2U A;  3KUP A;  4ZQ3 A;  1STG A;  1XTC D;  2EVB A;  3PUZ A;  4TKO B;  3STB D;  5EBC A;  2B2W C;  2EY6 A;  2CH4 A;  1PH6 A;  1ET6 A;  4G7O C;  3A55 A;  1HQM C;  2B8F A;  2OTJ A;  2BDO A;  1Y69 U;  1STA A;  1IW7 D;  3JAM E;  2N8N A;  1TKW B;  4OO1 I;  2EYM A;  5KND A;  2M00 A;  3TSS A;  1O7I A;  3CRL C;  4EQ5 A;  4XIG S;  3J80 E;  3PF4 A;  1E1O A;  2ATW A;  5CV6 A;  4JI1 Q;  3KBG A;  1EOT A;  3RZD H;  2HUG A;  2WIN B;  4XQJ A;  1HZB A;  3KF8 B;  4XTC S;  1KAW A;  4AIM A;  3S2H H;  5I2X A;  1YJW A;  4IFD H;  1QNU A;  5BN4 A;  3K81 C;  3J7A 5;  1O78 A;  2NN6 H;  1EZ6 A;  5E4W C;  4FYD A;  4C3H H;  5A2Q L;  3M85 A;  2IPK D;  1VQ6 A;  4N8X 1;  4DAP A;  3J81 i;  2WKC A;  1FVI A;  4HJA A;  2F0S A;  3UDF A;  2EXZ A;  1VQI A;  4BY7 G;  4X62 Q;  4BY1 H;  4JI6 L;  5COY A;  5KNC A;  3T51 B;  2R7Z G;  3HOX G;  1AE3 A;  4JI8 Q;  3C46 A;  3D0F A;  1KIX A;  4X6A H;  1LAB A;  3PF5 A;  3I73 A;  2AWO A;  4GLA C;  3GTJ H;  4DR6 L;  1IBL Q;  1AN8 A;  2Z6B A;  1K3B C;  4Y52 H;  2V1C C;  1J5E Q;  1NE3 A;  2VQE Q;  1F2Y A;  2EQS A;  4PZ8 A;  4FVM A;  2DN8 A;  4GNX A;  3RZD B;  2UXB L;  2WAQ G;  3BVM A;  1QJO A;  2E5L Q;  1G91 A;  4GOP C;  3S2H B;  4XYQ A;  5FLX L;  4OON A;  4RWS C;  2E2H H;  4K8I A;  3D3R A;  2EYJ A;  2F0P A;  1HA6 A;  4HJ5 A;  1JOO A;  3SK5 A;  1N9W A;  1HTL D;  4C3H B;  2Y0S G;  3GO5 A;  2E8G A;  4IPD A;  4MIU A;  3TME A;  2UUB Q;  2RQX A;  5IY0 A;  4X3U A;  3DWP A;  3OTO Q;  2WB1 E;  4A3E G;  3GTP H;  2HHH Q;  3HOW H;  4R4C A;  3BVZ A;  2FMC A;  2RKS A;  1RTO A;  3I4L A;  4DR3 L;  1FJG Q;  1QZG A;  1A2T A;  4RCN A;  2B2V A;  4JC0 A;  4JI7 L;  4IFD J;  1Y1W G;  4DNI A;  2L11 A;  2F4I A;  4IJH A;  5I4D A;  5IYB H;  2JA8 G;  3OMC A;  5FOB B;  3VYR A;  4XT1 B;  4OGQ C;  1NR4 A;  1MI2 A;  2IJ0 A;  2DJF C;  4BWG B;  2O5J C;  3I4N H;  2E2H B;  3R8B A;  2EY2 A;  3P1H A;  1BCP D;  3NTK A;  1A6X A;  4RAU C;  1UE6 A;  2NBF A;  3NXW A;  4G7Z C;  3CF5 A;  1LV9 A;  1X3G A;  3S1N H;  1OXX K;  1U4L A;  1TU2 B;  3HOW B;  2QIL A;  3GTP B;  2L55 A;  1GHK A;  3J7Y W;  2K5H A;  4JW0 A;  2WFW A;  1JE4 A;  3R93 A;  1QVF A;  2EJF C;  1N8R C;  3LGJ A;  2K6A A;  4KY7 A;  4Q0F A;  2Q2T A;  4QL5 A;  1H9J A;  4PMC A;  1QVC A;  1JE5 A;  1TWG H;  3LX0 A;  3A74 A;  1D5Z C;  3C2P A;  5FJ8 G;  4OX9 L;  3AFP A;  2BH2 A;  1ET9 A;  4L5S A;  3GDE A;  4PQX A;  2C35 B;  2RVL A;  3VYT A;  5C0X J;  1QUQ B;  1UEA B;  1ESF A;  3I4N B;  1JOR A;  2MUY A;  3QIA A;  3IL8 A;  4JI3 L;  4PMW A;  2VXW A;  4LF6 Q;  2K52 A;  1BDO A;  1LLR D;  1EFW A;  2Q8R E;  2ICE C;  3GQB A;  3S1N B;  2Q8T A;  3E9I A;  4ID6 A;  4LFC L;  5IGD A;  2I5H A;  2ZJP A;  3J7Z C;  5K5P A;  3J81 c;  5E3F A;  5JOB A;  1H9M A;  5DEH A;  5EGT A;  4UY8 C;  5F2D A;  2Q2H A;  1TWA H;  3HGB A;  2HDL A;  3LWU A;  1SNM A;  4RFB A;  1XMQ Q;  2EJG C;  2QEJ C;  1XX8 A;  1DJR D;  1UUP A;  1TWG B;  3V2T A;  3D4R A;  4F7X A;  1PH7 A;  1EY4 A;  3U50 C;  1Q3L A;  3KYH C;  4X3S A;  1D1K A;  4H13 C;  3FRP B;  1ZEQ X;  5J22 A;  1MSH A;  4NW2 A;  4NXM L;  4DF7 A;  3NSW A;  3TDQ A;  2HT1 A;  1HZC A;  3OWE B;  3HOV H;  3PGZ A;  2Z6K A;  3W1G A;  1GJX A;  5LL6 S;  4FP5 D;  2L9H A;  4DR6 Q;  1HCZ A;  2HCC A;  4J15 A;  3UDX A;  3A5U A;  3VYU A;  4NPS A;  4A3G G;  2SEB D;  1CQF A;  1VDZ A;  3OIP A;  2UXC L;  3MHB A;  2KCM A;  4LF5 Q;  1XXG A;  2N78 A;  3PV0 A;  1IBK L;  2VB2 X;  4B3T Q;  1A15 A;  2CQO A;  1F9R A;  1TWA B;  4K2K A;  4OIK A;  5EPJ A;  3K5L A;  1PZK D;  3PUV A;  4JOI A;  1N34 L;  3OYY A;  2A5H A;  1SAP A;  1IL8 A;  1A3V A;  1PTO D;  1EQR A;  2H4O A;  2ZXP A;  3A7A B;  4FNF A;  1BBX C;  5JJL A;  1TR5 A;  3HOV B;  1R4Q B;  2CW0 C;  3D6W A;  2XRS D;  2EYH A;  3QOL A;  5COR A;  5EPL A;  1EYC A;  4JI7 Q;  1AP0 A;  1CQV A;  2QDL A;  5NUC A;  3Q0A A;  4FF2 A;  2VW9 A;  2A69 C;  3KK7 A;  1JOQ A;  2MQH A;  1Y8O B;  2F0K A;  3VA5 A;  3F2B A;  4KK7 A;  1BF4 A;  3DEO A;  4LF8 Q;  3JC6 6;  2EOT A;  1HRJ A;  2R3Z A;  3SK4 A;  3FDT A;  5K36 H;  5D65 A;  1HUM A;  3HKZ E;  4DR4 L;  2A6H D;  2K33 A;  1WTR A;  2B3G A;  2K32 A;  3PUX A;  4A3I H;  4LJZ C;  3RD4 A;  1L1O C;  1PRT C;  4UP9 A;  4LAA A;  1UEB A;  1P8L A;  3FP9 A;  1PXU A;  3NPP A;  1LTL A;  4V19 0;  1S5E D;  3OPO A;  1ILP A;  4LFA Q;  2YTV A;  1LM0 A;  4DV6 L;  4K14 A;  2RDH A;  2R92 G;  1STB A;  2KUM A;  1A3U A;  5LMN L;  1EZ8 A;  2AUK A;  3NWT A;  4DK6 C;  1NNX A;  2KBN A;  3QO2 A;  1G8Z D;  2K5V A;  1PZJ D;  1HUN A;  3F2C A;  3OW7 A;  4O2D A;  3S1Q H;  4KN4 C;  2JE6 I;  1C8C A;  3E3X A;  1VQ4 A;  4U68 A;  1DZ1 A;  1L0Y B;  2IWH A;  5C3W A;  1D8L A;  1BR9 A;  5JPN C;  4NB3 A;  2OT2 A;  2SNS A;  4JI3 Q;  3I7F A;  5IYD H;  4C3J H;  4KHP L;  4JBW A;  3MZ5 A;  2EJM A;  3V05 A;  1BVS A;  4JI0 Q;  2B2Y C;  5ELF A;  1N36 Q;  2QA4 A;  4BBR G;  2HQL A;  1B3A A;  4A3B G;  4DV7 Q;  1B53 A;  3J81 L;  5I2Y A;  1A62 A;  1D7Q A;  3HKS A;  4LF9 Q;  2R6G A;  2ID0 A;  1F9P A;  2Z6K C;  3NEL A;  1IZ6 A;  4CBV A;  3TQY A;  1K0R A;  1QIL A;  3PSI A;  1XNQ Q;  3S1Q B;  4RCO A;  1VMP A;  3NK9 A;  1N32 Q;  2LY7 A;  2E2I H;  2PCF B;  3OOC A;  4IUV A;  3TRE A;  2B2T A;  3MXU A;  4FF1 A;  3GTQ H;  2RCN A;  1VQF A;  4HR7 B;  5C4X H;  4C3J B;  2K1B A;  1LTA D;  2KJX A;  2E75 C;  5M3F H;  3K0Y A;  1MSG A;  4DAV A;  3HOY G;  4GN3 B;  3DLL A;  4DR5 L;  1SRO A;  2FIN B;  2A73 B;  2KEC A;  4MNO A;  5ELE A;  5GAG C;  2K7V A;  3VR2 A;  4HID A;  2UXC Q;  3NQT A;  1BNZ A;  3OIQ A;  3HFZ B;  4ZUJ A;  1STN A;  4B3S Q;  3FMC A;  3CCQ A;  1VF7 A;  1D5M C;  1PDQ A;  1Y14 B;  4YCW A;  5IIF A;  1K8O A;  3QWN A;  1O80 A;  1RIP A;  1BCP B;  1K8M A;  2EZV A;  1R9T H;  2E2D C;  5AFW A;  2QGQ A;  2P5Z X;  1YHB A;  3MXG A;  1EY8 A;  5ELN A;  4K5V A;  4DR7 L;  1SYE A;  1E2V A;  4OWW B;  2JEB I;  5C0X I;  2E2I B;  5IGB A;  3D4W A;  4WJ4 A;  1B44 D;  2JXM B;  5EKL A;  2FJ2 A;  2B39 A;  2RDG A;  3GTQ B;  1CUK A;  2MO1 A;  5C4X B;  1N33 Q;  3UDG A;  3OW2 A;  5M3F B;  1BCP F;  1L2F A;  5BN3 A;  4HED A;  4KN7 C;  3K8A A;  4JI1 L;  3UE0 A;  5JEA H;  3H15 A;  1AW7 A;  1B9N A;  2CFM A;  4HCE A;  2LXK A;  1WJJ A;  4UP7 A;  1MBY A;  2AMC B;  4R4I A;  3F2D A;  1R9T B;  1KAA A;  4DV2 Q;  1CKN A;  3BZK A;  1YIJ A;  3MAQ A;  1YJN A;  2BA0 A;  1TS5 A;  4J1M A;  4R9W A;  4HIK A;  4DV0 Q;  1VQ7 A;  1JR0 D;  4X62 L;  2A68 D;  3VYS A;  5JJZ A;  3CPF A;  1MD2 D;  3KF6 A;  5JPM C;  4IJL A;  4LNQ A;  1PLF A;  1PFM A;  3WOF A;  4C3I G;  1J5E L;  2VQE L;  2V4D A;  3ULJ A;  5CV4 A;  1FGU A;  1YNX A;  3UI2 A;  3VR4 A;  1EY6 A;  3FPP A;  2F0U A;  2L15 A;  1I94 Q;  3ERQ A;  4IAL A;  2E5L L;  1G6P A;  5EQ0 A;  2PI2 E;  3F1Z A;  4HSV A;  3SDZ A;  4BY7 H;  2LKV A;  1HNX Q;  1VQ9 A;  4A3M G;  2R7Z H;  3HOX H;  4JI5 Q;  2WKD A;  4X3K A;  2H5X A;  1B4O A;  2NUC A;  3CC2 A;  3Q22 A;  3GTK H;  1EY7 A;  4L63 B;  4P73 A;  1U4M A;  3NTH A;  3MFY A;  2E76 C;  3MXN A;  5CBE E;  3S14 H;  2F0J A;  3LWE A;  4GN5 A;  1H9K A;  2HHH L;  2PQA A;  2I46 A;  4HJ7 A;  5M3F G;  3ZJY C;  4GOP A;  1FJG L;  2J4X A;  1B50 A;  2ZXR A;  4GNX B;  3S9W A;  2ES2 A;  1VQD A;  3FHW A;  4KHZ A;  2EY5 A;  2G9H D;  1SJH D;  3CC4 A;  5LHY 1;  1CZW A;  3BYY B;  4IOC A;  1BQQ T;  1CSQ A;  1DOL A;  3T13 A;  4ZLT F;  4A75 A;  1PMR A;  1JIC A;  1TWH H;  2DNC A;  1JJ2 A;  1RKN A;  1EYG A;  5CR3 A;  2AQ2 B;  4QIW B;  2KCT A;  3MEH A;  4BY7 B;  1WCM G;  4AQY Q;  4A3E H;  1OXU A;  3HOX B;  1HA5 A;  3MWY W;  4P2C B;  3NBH A;  5DLQ E;  3PMF A;  1XYI A;  3FKI H;  3GTK B;  4ZKC B;  2NYZ D;  4QF4 A;  3S14 B;  3BJU A;  1CZG A;  1Y1W H;  3I70 A;  2MJ8 A;  2H1E A;  3AB9 A;  1PTO F;  1HFN A;  1F77 A;  2XNA C;  2JA8 H;  2LS0 1;  3K57 A;  4DK3 C;  3H6M A;  1ROD A;  2WAQ B;  4XQN A;  5J1Z A;  4QB4 A;  2VUM H;  5FLX E;  2IT1 A;  3K80 C;  5EPK A;  3VR6 A;  1MJE A;  1G2S A;  2JA6 G;  1VQN A;  4CDE C;  2K03 A;  5C3X A;  4DR7 Q;  1TWH B;  2GN5 A;  4YCU A;  4DGZ A;  1H95 A;  2Y0S B;  3RLF A;  1SNQ A;  2XVS A;  2HIX A;  1U4R A;  3PO2 G;  1SYF A;  2X69 A;  4HMI A;  5LMU Q;  5C6A A;  3L0O A;  1DXM A;  1M4V A;  1CKM A;  1WD0 A;  4LF6 L;  1B7Y B;  1FNV A;  4A3E B;  3Q23 A;  4MHE A;  2KCN A;  5C5M A;  1P16 A;  3E5S A;  3NTI A;  3RMH A;  2UXD Q;  4FF4 A;  3FKI B;  1A0I A;  2I07 B;  3CP0 A;  2KHS A;  3LNN A;  2UUA Q;  2A74 C;  1Y1W B;  1CFM A;  5KNB A;  2YTX A;  5CV8 A;  2JA8 B;  2JK8 A;  3SEB A;  1MKH A;  1PH1 A;  4LFB Q;  3MC0 B;  2F0H A;  5FJ8 H;  1BBW A;  1X3Q A;  4AYB E;  4DN4 M;  3TBI B;  4JYA Q;  1I4X A;  3K58 A;  1XMQ L;  2K5W A;  4A3C G;  1SE8 A;  1YVC A;  2VUM B;  1O7Y A;  1Z6H A;  3RR5 A;  1SN8 A;  3IRB A;  4I65 A;  1JQY D;  1IBM Q;  1EYD A;  1Q86 C;  1QG7 A;  1LUZ A;  4QUF A; 
#chains in the Genus database with same CATH homology
 1GUG A;  2TMP A;  5HGT A;  2NTT A;  2IX0 A;  2A6E C;  3NP8 A;  2L4N A;  1EEI D;  3K5N A;  2NWG A;  3K5O A;  1F2Z A;  1IYU A;  5IGG A;  1GUS A;  3I72 A;  3PIO 3;  2EYP A;  3TP8 A;  2K04 A;  1YNN C;  2JEA I;  3NBI A;  4FO2 A;  1PYW D;  1LTG D;  4KKU A;  1B9M A;  3M4Y A;  3NE5 B;  5ISR A;  3EFX D;  2PZU A;  3TZU A;  1I4P A;  2KOL A;  2AWN A;  4KTA A;  5ELC A;  4DA2 A;  4QUC A;  1IKL A;  1CI3 M;  1QNK A;  4O1N A;  3BVG A;  1QWY A;  3DHQ A;  2XN9 C;  3C1E A;  2HDM A;  4IN3 A;  2RDF A;  5J39 A;  1ENC A;  3CQZ B;  2C9O A;  5EKK A;  3Q6S A;  4H44 C;  1NSN S;  2FFK B;  1EYA A;  5E1F A;  4CJ1 B;  4CHT B;  4A3G B;  1QCB D;  3T4A C;  1HQR D;  3HRZ C;  1RTN A;  1Y1V B;  3OWF A;  4U67 3;  4BA2 I;  2BA1 A;  3CU7 A;  1V43 A;  2E2J B;  3P20 A;  1DOK A;  4CKB A;  1GUT A;  4HAE A;  3AMU A;  4ODG A;  3GD7 A;  3D6C A;  2GA4 B;  4F8M A;  1W6J A;  4UAI A;  1SE2 A;  1A3T A;  2KVM A;  1WVL A;  1C48 A;  4H0L C;  1ICW A;  4A93 B;  1SMY C;  4YIJ A;  1OXS C;  2B2Y A;  3M4O B;  2KQ3 A;  3BS1 A;  3OSO A;  1SYC A;  3MXP A;  3RUZ A;  1V1P A;  3R2T A;  4TRD A;  4NP5 A;  4TSS A;  1CA5 A;  1F2L A;  2R92 B;  1M8A A;  2D9U A;  1JWS D;  5IT9 E;  1GHJ A;  1RCV D;  4B08 A;  2WP8 J;  3WDN A;  2NZ1 D;  2HQE A;  5C0X G;  2DY7 A;  4IUU A;  3E0J A;  1HHV A;  1J9O A;  2VB3 X;  1SND A;  5D3I B;  5I6Y A;  5DM6 3;  3G7L A;  5CMD A;  2L0C A;  4Q5V A;  1LTT D;  3MFG A;  3HZX A;  2JP1 A;  4BBR B;  3J81 E;  4A3B B;  2L1B A;  1B1Z A;  1ONL A;  3S1M B;  1V8Q A;  5CBA E;  1G2T A;  4IUQ A;  3HG9 A;  1STH A;  2PQE A;  1U4P A;  3D8G A;  3SXH A;  4B9W A;  2EDG A;  4OO1 H;  2G9D A;  3S15 B;  1LAC A;  3NWS A;  1UNS A;  1BXT A;  2PNR C;  3SVM A;  5FKA C;  3AU7 A;  2CW0 D;  2C5C A;  2KED A;  2A69 D;  2EYF A;  1OO9 B;  3HOY B;  3K6O A;  4F88 A;  4KD4 A;  1BUV T;  1WD1 A;  3G6J B;  4EQN A;  4RA8 A;  4C56 C;  2M9V A;  1LTI D;  2F1M A;  3ZYY X;  1SSO A;  4ABN A;  3M7N A;  1JC7 A;  3SHL A;  5E4X A;  1PRT D;  4IUN A;  1JOK A;  2Z1C A;  4S3S A;  1LTB D;  2XWB B;  1DYQ A;  1DOM A;  2YU9 B;  3QJY A;  5C4H A;  3KBX A;  1GUN A;  2NB0 A;  4NDX A;  2PW5 A;  4E6I A;  2VNU D;  1KLU D;  4TQU S;  4IFD I;  1TII D;  2NN6 I;  3CKI B;  3U9S A;  2BOS A;  4K2L A;  3C3L A;  2B2U C;  4CGY B;  4Y7N B;  4O42 A;  4XXE A;  1TY2 A;  2BE5 C;  4R8I A;  2IL8 A;  1AEX A;  1SXT A;  4IUR A;  1STE A;  1F9S A;  5KIX A;  1SYB A;  1GUO A;  5DNF A;  4G57 A;  1EQT A;  4HMJ A;  4C3I B;  1ZYR C;  2QDB A;  1KLG D;  1TY0 A;  3I8Z A;  1IKM A;  3FVQ A;  4K6D A;  1ILQ A;  3S17 B;  1I3Q B;  4ZRZ A;  1EY0 A;  5I6W A;  4A3M B;  1CHQ D;  3W2D A;  2K28 A;  4OO1 G;  3RZO B;  3MA2 B;  4XT3 B;  3CRK C;  4FXG C;  3K5M A;  2WII B;  2D2C C;  3HKZ B;  1F9Q A;  1ZKO A;  4ULL A;  1X32 A;  1LT4 D;  2SOB A;  2IX1 A;  4XQQ A;  3SK6 A;  4C1N I;  1I6V C;  1SE4 A;  1S5F D;  4RKB A;  4EGV A;  4ILW A;  2F0M A;  3VA7 A;  1EU4 A;  1WCM B;  4RGO S;  4BBS B;  4EVO A;  5IOD A;  1C4Q A;  2N88 A;  4HSP A;  3Q24 A;  2F0L A;  1NR2 A;  5T1I A;  2PZT A;  3CHB D;  2AQ3 B;  2EYL A;  1G29 1;  3ND8 A;  3R2I A;  2JYO A;  5M5W B;  1F2M A;  3EA6 A;  1DON A;  4EQO A;  1MGS A;  4C1N K;  3I3C A;  1QOH A;  2X6G A;  1FNU A;  4A3K B;  3GV3 A;  4LK1 C;  1OXV A;  1PTO H;  4CKC A;  4G7H C;  2JA6 B;  1Q1E A;  1GOZ A;  4PV1 C;  5KYL A;  3PO2 B;  4K5X A;  4EQP A;  2PMZ B;  1KDB A;  1Q90 A;  1HTP A;  1EWH A;  5JEA J;  5CV5 A;  5TSS A;  5JVH 3;  2HCI A;  2R61 A;  5KRU A;  5G3L D;  1WTP A;  4KV6 A;  1E2Z A;  3NHH A;  1TVX A;  4CJ2 C;  2MPM A;  4ZAI A;  3P75 A;  1K83 B;  1PTO B;  1LTS D;  5A2Q E;  3TP7 A;  1HXY D;  1YNJ C;  3A56 A;  5CV7 A;  3I4M B;  3M3Y B;  4HTH A;  4KD3 A;  4IQZ A;  1KNE A;  1Z47 A;  2E74 C;  2YYZ A;  4A3J B;  1PFN A;  2F0G A;  5FO9 B;  4K5W A;  2O4X A;  1EEF D;  1Q1B A;  5M5Y B;  2LMC B;  2CQA A;  3T53 B;  3EVQ A;  2B63 B;  2EE1 A;  4Z9C B;  2OXP A;  3GTG B;  1IW7 C;  1I50 B;  4XYO A;  2CHB D;  1D1I A;  4RGN A;  5DM7 3;  3U9O A;  2X6L A;  4IUT A;  3M7G A;  3H0G B;  3TP6 A;  1GXD C;  3VR5 A;  3NUC A;  4WJW A;  2RSO A;  4QCL A;  1FD7 D;  1EIG A;  1H9S A;  4RHR A;  1PRT B;  3ERO A;  4FXD A;  1HPC A;  1GUW A;  2L5T A;  4WOR A;  3PIP 3;  5LL6 X;  2F0T A;  2F0V A;  4CKE A;  2F03 A;  4C2M B;  4KJO A;  1PRT F;  4K8J A;  1W6K A;  1BO0 A;  4KJN A;  4KI0 A;  3J7A V;  4PMB A;  4BS9 A;  1E2W A;  3OHX C;  1JCK B;  5C44 B;  3A8J E;  1U9R A;  5C4J B;  5HUR A;  5JAV A;  2ICI A;  2A6E D;  4LMQ D;  3BG3 A;  1DD2 A;  1G6Z A;  2JA7 B;  1J8I A;  1V1P B;  4QMG A;  2XSC A;  3URY A;  1JWM D;  2MHV A;  1YNN D;  4KKS A;  1KNA A;  1I4G A;  4RHS A;  3DUZ A;  4X3T A;  1AFP A;  3GP7 A;  1NUC A;  1TQO A;  5D14 A;  4ZUI A;  2O2L D;  1V1O A;  5M9O A;  2BDN A;  5C0X H;  1T5E A;  4BY1 B;  3C1F A;  1BCP C;  3JAM L;  1FYC A;  3DWA A;  3J80 L;  1S4Z A;  3GTJ B;  3PO3 B;  5T1G A;  4UDU C;  2KEE A;  4ZKB B;  1WTW A;  5C3E B;  5DAU A;  4K6L A;  1OXT A;  2EPB A;  1TWF B;  3DWQ A;  1CTM A;  3VR3 A;  1WTO A;  1AZQ A;  4V0B A;  3J7A F;  1FGB D;  4DXG A;  4HCS A;  3R3O A;  3X3N A;  5M3M B;  3H09 A;  1RF2 D;  3W3A A;  2WAC A;  4AYB B;  4J6H A;  4HN7 A;  1KTK A;  2F0Q A;  2N55 A;  1CK1 A;  1QE6 A;  3KF8 A;  3PUY A;  3QB3 A;  1JB3 A;  2JSO A;  4IFD G;  4J8Q A;  4KY6 A;  2NN6 G;  3NQI A;  3A7L A;  3I91 A;  1L0X B;  4C3H G;  2PZW A;  4NMZ A;  2F0F A;  4DNR B;  2K05 A;  3HP3 A;  1JWU D;  3EQL C;  2K5Q A;  2XRQ D;  1PFB A;  2EYO A;  2F0W A;  1NAP A;  1VCI A;  3N6R A;  1EWC A;  3HS0 C;  5IGE A;  3E6Z X;  3S1R B;  3TN2 A;  5IGC A;  1FR3 A;  3DM1 A;  4BA1 I;  3H94 A;  2B2U A;  2J7Z A;  1Z7T A;  3T16 A;  1BOS A;  1CM9 A;  1SYD A;  5D3D A;  1IHZ A;  4M1U B;  4GZY C;  1SMY D;  3H91 A;  1E0B A;  2WB1 B;  4L8J A;  1Y8N B;  4DXF A;  2ENB A;  2Q8I B;  1PTO C;  2AQ1 B;  3SE0 A;  5G3L F;  4ZYS A;  3IFD A;  3TZD A;  1TS4 A;  1FNW A;  2B2V C;  2R93 B;  4DAY A;  4JK1 C;  5CV9 A;  4XDX A;  4MN3 A;  1CHP D;  1II3 A;  4N9T A;  5BN5 A;  2F0I A;  2FHT A;  3EJI A;  1SYG A;  2OEO A;  4CJ0 B;  2A6H C;  2F0E A;  1WTX A;  5IGF A;  4DK1 A;  1KAB A;  4I7Z C;  3A8K E;  5I9O A;  3D4D A;  1S5D D;  3KLS X;  2F3W A;  2DNE A;  3L9A X;  3BZD B;  2JA5 B;  2J0T D;  3SK8 A;  1D5X C;  1RHP A;  2PW7 A;  1CA6 A;  3L3O C;  1Q12 A;  3WOE A;  2NVY B;  1EQV A;  1EY9 A;  4ME5 A;  2RSN A;  5EKI A;  4H7B A;  3MTS A;  1O7Z A;  1SFO B;  4RKL A;  2KCC A;  2F3V A;  4FF3 A;  2IX3 A;  3BDL A;  2D62 A;  4R8N A;  5IT9 L;  1I4R A;  5C5L A;  5EJW A;  4DFA A;  2ZT9 C;  2RBM A;  5ELD A;  2KA7 A;  3ND9 A;  1ENF A;  2M2L A;  1EFI D;  2RA4 A;  4DK0 A;  2F0N A;  1LT5 D;  5CC4 A;  3SR1 A;  4A3I B;  3A8I E;  3HOZ B;  2PPB C;  1EY5 A;  2SDF A;  4A3D B;  5FO7 B;  2PYK A;  2PO4 A;  1VMC A;  3BDC A;  4IUP A;  4OIJ A;  1EL0 A;  1SDF A;  1SNO A;  2SNM A;  4OL7 A;  1LTR D;  3V96 A;  1I4H A;  2O5I C;  1I6H B;  5ELB A;  2CVR A;  1T5X D;  3S2D B;  1QB5 D;  3QOJ A;  1TS2 A;  3I90 A;  2B8G A;  1RDP D;  2QF7 A;  3PUW A;  1SEB D;  4KHV A;  1SBB B;  4NKL A;  4N9P A;  2BE5 D;  1RJT A;  1CT1 D;  2F0D A;  2F0O A;  4F87 A;  3N52 A;  2NVX B;  1EU3 A;  1WTV A;  4KY5 A;  5FO8 B;  1ZYR D;  2MGS A;  1TT2 A;  3MVV A;  1SNC A;  3DMU A;  1SJE D;  1HFG A;  3DEP A;  1D6E C;  1KDC A;  5EBD A;  3QG1 A;  1Q8I A;  5K36 G;  4OHJ A;  1DCZ A;  1ML0 D;  3KLR A;  2Z8L A;  2ZXO A;  3GTL B;  3X3M A;  2FMM A;  1XWE A;  5JVG 3;  2NTS A;  2EY1 A;  1S5B D;  1H9R A;  3OMG A;  2A68 C;  1NCV A;  3F2U A;  2B2W A;  3O13 A;  4FXK C;  3IAY A;  4DNT B;  2TSS A;  3H3V C;  1UAP A;  1S5C D;  3TP5 A;  4M8A A;  2XIW A;  5C4Z A;  1ENA A;  1H9S B;  5FK9 C;  1WTQ A;  2QCP X;  2K01 A;  1X3P A;  4ZK9 B;  3IFT A;  3KLS A;  1Y8P B;  5CYU A;  1SNP A;  1LT6 D;  4WRD A;  4C3J G;  1STY A;  1DM0 B;  3A54 A;  4KMU C;  4DU9 A;  4G4K A;  1TS3 A;  3T56 B;  5M5X B;  1B2T A;  5IOC A;  2L12 A;  1AZP A;  2DY8 A;  3FPU B;  5KGU A;  5I9P A;  3ITP A;  1I4Q A;  3GTM B;  4IZ8 A;  1TWC B;  3GTO B;  1EIH A;  2D5D A;  1IYV A;  3K59 A;  3BDO A;  3S16 B;  2IW3 A;  2XWJ B;  4RH6 A;  5CGK A;  3GV6 A;  4KKT A;  4RGT A;  1RD9 D;  1SE3 A;  3HOU B;  2OF1 A;  1LT3 D;  4PNY A;  1O7L A;  2B2T C;  5KYI A;  3FEW X;  3HEJ A;  2QKI C;  2Z4I A;  3BYT B;  1ESR A;  4B9X A;  3IKJ A;  4A3F B;  1PZI D;  2NVQ B;  4L6T B;  3P7J A;  2R7Z B;  1R4P B;  2NVT B;  1YNJ D;  1D2B A;  4RGM A;  1VF5 C;  5A35 A;  1ZXT A;  2BCO A;  3D31 A;  1LO5 D;  2Z4H A;  3K7A B;  4WFN 3;  2K5D A;  5KEE A;  2AUJ D;  2WV6 D;  3DXJ C;  2MP1 A;  3L7Z C;  1KDA A;  2LFN A;  5JEA G;  3ONA B;  1A2U A;  3KUP A;  4ZQ3 A;  1STG A;  1XTC D;  2EVB A;  3PUZ A;  4TKO B;  5EBC A;  2B2W C;  2EY6 A;  1ET6 A;  4G7O C;  3A55 A;  1HQM C;  2B8F A;  2BDO A;  1Y69 U;  1STA A;  1IW7 D;  3JAM E;  1TKW B;  4OO1 I;  2EYM A;  5KND A;  2M00 A;  3TSS A;  3CRL C;  4XIG S;  3J80 E;  5CV6 A;  3KBG A;  1EOT A;  2HUG A;  2WIN B;  4XQJ A;  4XTC S;  5I2X A;  4IFD H;  1QNU A;  5BN4 A;  1O78 A;  2NN6 H;  1EZ6 A;  5E4W C;  4FYD A;  5A2Q L;  3M85 A;  2IPK D;  4DAP A;  2WKC A;  2F0S A;  2EXZ A;  5COY A;  5KNC A;  3T51 B;  3C46 A;  1LAB A;  3I73 A;  2AWO A;  1AN8 A;  1F2Y A;  4FVM A;  2DN8 A;  3RZD B;  3BVM A;  1QJO A;  1G91 A;  3S2H B;  4XYQ A;  5FLX L;  4RWS C;  4K8I A;  2EYJ A;  2F0P A;  3D3R A;  1HA6 A;  1JOO A;  3SK5 A;  1HTL D;  4C3H B;  3GO5 A;  4MIU A;  3TME A;  2RQX A;  4X3U A;  3DWP A;  3BVZ A;  2FMC A;  2RKS A;  1RTO A;  3I4L A;  1A2T A;  4RCN A;  2B2V A;  4IFD J;  2L11 A;  2F4I A;  5I4D A;  3OMC A;  5FOB B;  3VYR A;  4XT1 B;  4OGQ C;  1NR4 A;  1MI2 A;  2IJ0 A;  4BWG B;  2O5J C;  2E2H B;  3R8B A;  2EY2 A;  3P1H A;  1BCP D;  3NTK A;  1A6X A;  4RAU C;  2NBF A;  3NXW A;  4G7Z C;  1LV9 A;  1OXX K;  1U4L A;  1TU2 B;  3HOW B;  2QIL A;  3GTP B;  2L55 A;  1GHK A;  3J7Y W;  1JE4 A;  3R93 A;  2EJF C;  2K6A A;  4KY7 A;  4Q0F A;  1H9J A;  4PMC A;  3LX0 A;  3C2P A;  1D5Z C;  1ET9 A;  4PQX A;  2RVL A;  3VYT A;  5C0X J;  1UEA B;  1ESF A;  3I4N B;  1JOR A;  2MUY A;  3QIA A;  3IL8 A;  4PMW A;  2VXW A;  1BDO A;  1LLR D;  2Q8R E;  2ICE C;  3GQB A;  3S1N B;  2Q8T A;  4ID6 A;  5IGD A;  5K5P A;  5E3F A;  5JOB A;  1H9M A;  5DEH A;  5EGT A;  5F2D A;  3HGB A;  2HDL A;  3LWU A;  1SNM A;  4RFB A;  2EJG C;  2QEJ C;  1XX8 A;  1DJR D;  1UUP A;  1TWG B;  3V2T A;  3D4R A;  4F7X A;  1EY4 A;  1Q3L A;  4X3S A;  1D1K A;  4H13 C;  3FRP B;  1ZEQ X;  5J22 A;  1MSH A;  4NW2 A;  4DF7 A;  3NSW A;  3TDQ A;  3OWE B;  1GJX A;  5LL6 S;  4FP5 D;  2L9H A;  1HCZ A;  2HCC A;  3VYU A;  2SEB D;  1CQF A;  1VDZ A;  3OIP A;  3MHB A;  1XXG A;  3PV0 A;  2VB2 X;  1A15 A;  1F9R A;  1TWA B;  4K2K A;  4OIK A;  5EPJ A;  3K5L A;  1PZK D;  3PUV A;  2A5H A;  1SAP A;  1IL8 A;  1A3V A;  1PTO D;  2H4O A;  2ZXP A;  3A7A B;  4FNF A;  1BBX C;  1TR5 A;  3HOV B;  1R4Q B;  2CW0 C;  3D6W A;  2XRS D;  2EYH A;  3QOL A;  5COR A;  5EPL A;  1EYC A;  1AP0 A;  1CQV A;  5NUC A;  3Q0A A;  4FF2 A;  1JOQ A;  2A69 C;  3KK7 A;  1Y8O B;  2F0K A;  3VA5 A;  4KK7 A;  1BF4 A;  3DEO A;  2EOT A;  1HRJ A;  2R3Z A;  3SK4 A;  3FDT A;  5K36 H;  5D65 A;  1HUM A;  2A6H D;  2K33 A;  1WTR A;  2K32 A;  3PUX A;  4LJZ C;  3RD4 A;  1PRT C;  4LAA A;  1PXU A;  3NPP A;  4V19 0;  1S5E D;  3OPO A;  1ILP A;  4K14 A;  2RDH A;  1STB A;  2KUM A;  1A3U A;  1EZ8 A;  2AUK A;  3NWT A;  3QO2 A;  1G8Z D;  1HUN A;  1PZJ D;  3OW7 A;  4KN4 C;  2JE6 I;  1C8C A;  4U68 A;  1DZ1 A;  1L0Y B;  2IWH A;  5C3W A;  1BR9 A;  5JPN C;  2OT2 A;  2SNS A;  4JBW A;  3MZ5 A;  2EJM A;  3V05 A;  2B2Y C;  5ELF A;  1B3A A;  1B53 A;  3J81 L;  5I2Y A;  2R6G A;  2ID0 A;  1F9P A;  4CBV A;  1QIL A;  3S1Q B;  4RCO A;  1VMP A;  3NK9 A;  2LY7 A;  2PCF B;  3OOC A;  4IUV A;  2B2T A;  3MXU A;  4FF1 A;  4HR7 B;  4C3J B;  2K1B A;  1LTA D;  2KJX A;  2E75 C;  3K0Y A;  1MSG A;  4DAV A;  2FIN B;  2A73 B;  2KEC A;  5ELE A;  2K7V A;  3VR2 A;  3NQT A;  1BNZ A;  3OIQ A;  4ZUJ A;  1STN A;  3FMC A;  1VF7 A;  1D5M C;  1PDQ A;  5IIF A;  1K8O A;  3QWN A;  1O80 A;  1BCP B;  1K8M A;  2EZV A;  2E2D C;  5AFW A;  3MXG A;  1EY8 A;  4K5V A;  1SYE A;  1E2V A;  2JEB I;  5C0X I;  2E2I B;  5IGB A;  3D4W A;  1B44 D;  2JXM B;  5EKL A;  2FJ2 A;  2B39 A;  2RDG A;  3GTQ B;  5C4X B;  5M3F B;  1BCP F;  5BN3 A;  4HED A;  4KN7 C;  5JEA H;  1AW7 A;  1B9N A;  4HCE A;  1MBY A;  1R9T B;  1KAA A;  3MAQ A;  2BA0 A;  1TS5 A;  4J1M A;  4R9W A;  1JR0 D;  2A68 D;  3VYS A;  5JJZ A;  1MD2 D;  5JPM C;  1PLF A;  1PFM A;  3WOF A;  4C3I G;  2V4D A;  5CV4 A;  3UI2 A;  3VR4 A;  1EY6 A;  3FPP A;  2F0U A;  3ERQ A;  4IAL A;  5EQ0 A;  4HSV A;  3SDZ A;  2LKV A;  2WKD A;  4X3K A;  1B4O A;  2NUC A;  3Q22 A;  1EY7 A;  4L63 B;  1U4M A;  3NTH A;  2E76 C;  3MFY A;  3MXN A;  5CBE E;  2F0J A;  3LWE A;  1H9K A;  2I46 A;  2J4X A;  1B50 A;  2ZXR A;  3S9W A;  4KHZ A;  2EY5 A;  2G9H D;  1SJH D;  5LHY 1;  1CZW A;  3BYY B;  1BQQ T;  1DOL A;  3T13 A;  4ZLT F;  1PMR A;  1JIC A;  2DNC A;  1RKN A;  5CR3 A;  2AQ2 B;  4QIW B;  3MEH A;  4BY7 B;  1OXU A;  3HOX B;  1HA5 A;  3MWY W;  4P2C B;  3NBH A;  3PMF A;  1XYI A;  3GTK B;  4ZKC B;  2NYZ D;  4QF4 A;  3S14 B;  1CZG A;  2MJ8 A;  3I70 A;  2H1E A;  3AB9 A;  1PTO F;  1HFN A;  1F77 A;  2XNA C;  2LS0 1;  3K57 A;  3H6M A;  1ROD A;  2WAQ B;  4XQN A;  5J1Z A;  4QB4 A;  5FLX E;  2IT1 A;  5EPK A;  3VR6 A;  1G2S A;  2K03 A;  5C3X A;  1TWH B;  4DGZ A;  2Y0S B;  3RLF A;  1SNQ A;  2XVS A;  1U4R A;  1SYF A;  2X69 A;  4HMI A;  5C6A A;  1DXM A;  1M4V A;  1WD0 A;  1FNV A;  4A3E B;  3Q23 A;  4MHE A;  2KCN A;  5C5M A;  3NTI A;  3E5S A;  3RMH A;  4FF4 A;  3FKI B;  2I07 B;  2KHS A;  3LNN A;  2A74 C;  1Y1W B;  1CFM A;  5KNB A;  5CV8 A;  2JA8 B;  3SEB A;  3MC0 B;  2F0H A;  1X3Q A;  4DN4 M;  3TBI B;  1I4X A;  3K58 A;  2K5W A;  2VUM B;  1O7Y A;  1Z6H A;  4I65 A;  1JQY D;  1EYD A;  1QG7 A;  4QUF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...