4HN7A

Crystal structure of e. coli pmrd
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
85
structure length
85
Chain Sequence
MEWLVKKSCCNKQDNRHVLMLCDAGGAIKMIAEVKSDFAVKVGDLLSPLQNALYCINREKLHTVKVLSASSYSPDEWERQCKVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Signal transduction protein pmrD
publication title Crystal structure of E. coli PmrD
rcsb
source organism Escherichia coli
total genus 14
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2012-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11183 PmrD Polymyxin resistance protein PmrD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.650 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4hn7A00
2JSOA 2RQXA 4HN7A
chains in the Genus database with same CATH superfamily
3T1YL 1QNUA 2SOBA 4JI3Q 4GLAC 2HCIA 1DOMA 1HCZA 4CBVA 5A2QL 5T1GA 4DV0L 4K0KL 2R92H 1D7QA 1ESRA 4B3TL 3MTSA 4A3DB 3J81j 4B3RQ 4KN4C 1SN8A 2MO0A 1HUMA 3KDFB 5TSSA 2B8GA 3X3MA 2GVBA 1KAWA 2FHTA 2WB1B 1CHPD 2TMPA 1EYGA 2K5HA 3CPWA 2F0KA 5C0XH 3G6EA 4OL7A 1BXTA 3ER0A 2R92G 4DA2A 1KL9A 3E9IA 1IBLQ 1S72A 3QO2A 4JOIA 3HOWB 2D0PA 3K7UC 4RAUC 4FXDA 3S24A 3H6MA 4R4IA 4A93H 1IHZA 1TWFH 3NUCA 2AUJD 3HRZC 3RZOH 2UXBL 5JVG3 1KABA 4A3BH 1EIFA 2MFIA 2JA7B 1E22A 3J7ZC 4HJ9A 2PZUA 3IFTA 1TT2A 3HP3A 4PNYA 1CFMA 1FYCA 5CV5A 5JJKA 3GTLH 5CV9A 1EQVA 2OXPA 2RHSB 1VF5C 4ALPA 2CWPA 3S1MB 4YY3L 1WVLA 4G7OC 3A55A 2Z1CA 1E2WA 3KDFA 3CPFA 1Y1VH 3TRZA 1IYVA 1ENFA 2E2HH 1QVCA 4X3KA 5J39A 2UU9Q 5C4JB 4KHPQ 1HR0L 3H3VH 1SMYC 4WRDA 3Q22A 1VQNA 2F3IA 4APVA 2ZJQA 1TWHH 1QVGA 5IGFA 3KLRA 5C0XI 3A5UA 5GQOA 4AIMA 4X66Q 4ZLTF 4LFBL 5K5PA 4FVMA 2O5JC 4UAIA 4XTCS 4O1NA 1Y1VG 3QG1A 3V96A 2Y0SE 2LMCB 1NNXA 1UWVA 2A6EC 4LF7Q 3GTGB 1IBML 2NVTH 4P74A 4QF4A 2IX3A 3NWTA 4GKKQ 2CWAA 2KBNA 3QOJA 3GTMH 2EPBA 3S15B 4EQPA 3OYYA 3I7FA 3GD7A 4ULLA 3UI2A 1X9NA 1AFPA 4KKSA 5T1IA 1RTOA 1HUNA 1Q82C 4JI2L 4O42A 1UEAB 1BVSA 1KDCA 4GOPB 1LTBD 3TZDA 5JEAG 1IBKL 2SNMA 4KN7C 5IIFA 4TQUS 3I90A 3KFUA 3BU2A 2PYKA 3H3VI 2A6ED 2QKIC 1JB3A 1B50A 2G9HD 1WYDA 4JI5Q 1K0RA 3BDOA 3PUZA 1AE3A 1CA5A 3R2IA 2HDLA 2RA4A 1IBLL 3BJUA 2L9HA 1G6PA 1U4LA 4QQBX 4JI6Q 1R4QB 1SYGA 3HG9A 3MZ5A 1D5ZC 4KK7A 1E2VA 4Y7NH 3VA5A 1I5FA 3W1GA 1SE3A 2PQEA 1VQAA 3NELA 4F87A 4ZUJA 3URYA 4DUYQ 4RHSA 1PH7A 5EBCA 5L37A 1TR5A 1VQKA 3NTKA 1G291 3H15A 1XJVA 1IW7C 1LTSD 1AW7A 4BBSB 2QDLA 3EIVA 1JT8A 2NVXH 4E6IA 3S1RB 5CR3A 3K80C 3K0XA 1I50H 2UU9L 1T5EA 4XYOA 4KHPL 3HOYG 5CV7A 1EY9A 4BY1H 2FFKB 5JJIA 1SNQA 2WB1E 3J81E 3PO3B 1Z7TA 4X66L 4GOPC 1A3TA 3WDNA 1YHAA 4XYQA 3GTKB 4ZRZA 3HS0C 3DM3A 3VYSA 2DJFC 4K2KA 2EQSA 4LF4L 3I4MH 4KJOA 3SEBA 1LUZA 4A3MB 5IT9E 1C48A 1X32A 3K81C 1VDZA 3PV0A 4IUUA 4LF7L 2NN6H 2F4VQ 1IW7D 4KHZA 4OWWB 4IUVA 2L11A 1KD1C 2IT1A 4BY1G 2R3ZA 3RLNA 2Q8TA 4DR1Q 2D2CC 2EYPA 4HIKA 2OF1A 3T56B 5I9OA 3FEWX 2EYLA 2KHIA 2EXZA 2GA4B 3QOLA 4C3JG 3MVVA 5CGKA 2K52A 4DV1Q 4F7XA 3GV6A 1BCPF 1W6KA 2PO4A 3I4MG 1KNEA 2K4KA 3OW2A 4PZ6A 1EU4A 4LFCQ 2NN6G 1BUVT 5I9PA 4F88A 2RCNA 5EGTA 4JBWA 2TSSA 1ILPA 2DN8A 3PF4A 4Y52H 3S1QH 5J22A 3J80c 4DV7Q 4JI5L 4XQJA 5FLXE 5M5WH 2ZTEA 4OEMB 1E3PA 3RZDB 1JCKB 1T9HA 5K36H 4OHJA 1FNWA 1PTOB 4OIKA 1A3VA 2WKCA 5CBAE 3MFYA 2KA7A 4DV4Q 4A3IB 3E0EA 5CORA 2CFMA 3CMEA 3Q24A 2NN6I 4K5VA 5IWAL 4QIWB 3I91A 3KYHC 2J7ZA 3J7YW 4HTHA 4DUYL 5C44H 4CHTB 3A7AB 1CZGA 2HCCA 2JEAI 1LABA 1VQGA 4RA8A 2VUMB 2A6HD 4XDXA 1HH2P 3K5MA 3MA2B 3CQZB 2L55A 1O7ZA 2JA8H 1CT1D 3H0GB 3VR5A 3D4WA 3A8KE 1D2BA 1CSQA 3MXUA 1ONLA 1HRJA 5LL6S 2RSOA 2IX1A 1TY2A 3HZXA 1E1TA 5C44G 4R4QA 1UEBA 4IPGA 4MNOA 4RWSC 1EIYB 4IOAA 2HUGA 4O2DA 4LUVA 2R7ZH 2YTXA 1SYCA 2N8NA 4RGOS 1EQRA 3PSIA 2QA4A 2QCPX 5E7NA 3VDYA 5KNBA 5C0XJ 3VR2A 4X6AH 2KECA 1UE7A 4ME3A 4DR1L 2FXQA 3J80E 1PFBA 1HNXQ 3ZJYC 1PTOC 2B2YC 5IP7G 1YNJD 1PA6A 2B2UC 1DD2A 4DV1L 2WB1G 4RGNA 1X65A 3D4DA 2R7ZG 5DM63 3DUZA 1TS3A 4LF6L 5ELOA 4JI4Q 4MIUA 2B63H 1XX8A 3IRBA 1QJOA 2OQKA 5M5YB 3KUPA 3ERSX 1KNAA 1RL2A 4LFCL 1LACA 2JEBI 3KBXA 1LV9A 1SXTA 1TS4A 3U58A 1YBYA 4IPHA 1EFWA 2IHFA 3VR6A 3HGBA 4DV7L 3ULPA 1SFOB 2E2JH 4G57A 1A62A 5IP9H 3PIPA 3S16H 4CDDC 5M3MH 5IGEA 3IL8A 1N8RC 2JA7G 1W3SA 4H02A 2DNEA 1TS5A 3PMFA 5KRUA 1CKNB 1EWHA 2B63G 1SNPA 2ZT9C 4DFAA 4DV4L 1C7YA 3F1ZA 4KV6A 4HJ8A 4H7BA 3D6WA 1UAPA 3K7AH 4DV6Q 2SDFA 3NQIA 1YHBA 2L15A 3L7ZC 1I6HB 1XMOQ 1HQRD 1X56A 1YJ9A 5ELCA 2R93H 1YZ6A 3U4ZA 1S5ED 1LT4D 1QILA 4EQ5A 3UDGA 1V1OA 1TWHB 2RDFA 1ESFA 1H95A 2K5DA 2R61A 4QCLA 1B44D 3HOUB 2VQFQ 1TIID 2Z0SA 2MNAA 2B2WA 2KHJA 2Z6KC 3OPOA 1IL8A 4G7ZC 2ZJRA 2NBFA 2YU9H 4Z9CB 4R4CA 1EY8A 1WTWA 1E2ZA 1NR4A 5FJ8G 5C3EH 5FO8B 3HOXB 1D8LA 3FRPB 4XXEA 1Q86C 1M1KC 2ZTDA 2O5IC 4H13C 1CKNA 1FJGQ 4JYAL 4DV2L 3M3YH 2LFNA 3L0OA 2JSOA 2F0EA 1HA6A 4KD3A 1WCMB 4NW2A 3SK5A 1VCIA 1DOKA 2Z8LA 3K5NA 1EY0A 3RLOA 2F0WA 1UE6A 2I07B 2BH8A 4PV1C 5I4DA 3RN2A 4MTNA 1JC7A 4PMBA 1PLFA 4U68A 3L9AX 1F9QA 5EPLA 4DNIA 3CCQA 2BOSA 2F0HA 5C3EG 2QW7A 5C4XH 4OELB 4JI4L 3DWPA 3NE5B 2XWBB 1VQCA 2A68C 2RKSA 3S1NB 4BBRH 2A1AA 1H9RA 4TVAB 1UE5A 3HOZG 2DY7A 1EUJA 1A8VA 2WACA 2OEOA 2F0JA 5KYLA 4Y7NB 2XRSD 2K75A 4ZCKA 1HFNA 1UE1A 4X3TA 2JJQA 3AFPA 3TP8A 2AQ2B 4DV0Q 5C4XG 2NZHA 1RDPD 1QZGA 3I4NB 3GQBA 4TKOB 3TP7A 3G4SA 4HJ5A 2K03A 2JA6H 4BBRG 1NE3A 1L2FA 1XPUA 5LHY1 4OIJA 1TKWB 2ES2A 3S17H 1M8AA 5GROA 2IX0A 3MAQA 4BBSG 1I50B 2YV5A 1U0LA 4DR6L 5NUCA 1DONA 1MKHA 1LTTD 2F1MA 2EYJA 3RUZA 1WI5A 4XQQA 5AJ3L 2O4XA 2NYZD 2ICEC 4A3FH 3G48A 4JBJA 3TSSA 4XT3B 3M4QA 3CMAA 2VQFL 1STGA 3RMHA 1XYIA 4CGYB 1SSOA 4FDBA 3M4OB 1STBA 4RH6A 4WJ4A 3VR3A 2NVYH 5FOBB 1ZYRD 1I3QB 3A56A 4HSVA 4GN4B 5ELEA 4C3IH 4A3MG 4HIOA 1SRUA 1BF4A 3SVMA 1Q7YC 5G3LF 4AQYL 1KHIA 4A3FG 2K7VA 1SNCA 3NTHA 1R9TB 3E3XA 3T4AC 1PH3A 4KLKA 2WAQB 3JAME 1K3RA 3NEMA 2O2LD 2Z6BA 2C35B 3TP6A 2JYOA 2X6LA 1AH9A 1I4HA 1VQ6A 3VR4A 1E7ZA 4RMFA 1PRTF 4DAMA 4HMJA 4BY7H 1OXVA 2EXDA 1O78A 1II3A 3I8ZA 2VQEL 2L1BA 2IHEA 1FD7D 4ZQ3A 1IKMA 1D5MC 5D65A 1NY4A 1Y1WB 2ZM6Q 2KENA 3CCRA 1LTID 3K58A 2PQAA 4K2LA 1VQBA 2F0FA 3AMUA 2PI2E 4IUQA 1WTXA 3DMUA 4CKCA 1IBMQ 1GUNA 3STBD 1SNDA 3ICEA 2BDOA 3GV3A 2B2VA 1F2YA 4AYBB 3ULLA 1DOLA 1F77A 4ZUIA 5GAHC 4CDFC 1HZBA 2ZJPA 3GTOB 1H9SB 4A3IG 2KHSA 4A3KG 4BY7G 2KQ3A 3LWEA 1I4GA 1XXGA 2E2IH 4WORA 5EBDA 2NZOA 5E4XA 3NP8A 1Z6HA 2X69A 3OWFA 1VQ7A 1GUTA 1X3QA 1EQTA 1X54A 1K83B 4S3SA 1BCPB 3NXWA 4B9XA 4JI2Q 2B2VC 2JA5B 1CUKA 2L4NA 4FXKC 5M5XH 2LXJA 1IBKQ 4X64Q 1WTOA 4DR2Q 2B39A 4A3EG 1GD7A 1VMCA 2XTIA 4LF9Q 3CU7A 2JA8B 1HA5A 1TVXA 3KF6B 1JJ2A 4A3GH 3GTPH 3CHBD 3GDEA 4HJAA 4C56C 3DEOA 2NB0A 1JE4A 3H0GG 1ZEQX 3K57A 2KCMA 2ID0A 4IURA 4C3HB 1LM0A 3NTIA 4L5QA 2D9UA 2RDHA 3OW7A 3FVQA 1B7YB 2XRQD 4RFBA 4K14A 2K5NA 2OTLA 1IYJB 1N32Q 5FKAC 4X62Q 1LLRD 1SNMA 1J6QA 3SDZA 1NR2A 1JWUD 4JOIC 4A3GG 1WFQA 1JE5A 1H9SA 2YTYA 3BZKA 4ZKBB 4PQXA 1K3BC 3RNUA 4LMQD 2C5CA 2I5HA 1PZID 3S14B 2PZTA 2Z4IA 1KQSA 2NVQH 4M8AA 1GHKA 2A8VA 3NBIA 4A3JB 4FYDA 1VF7A 4JK1C 3KF6A 3J7A5 3P1HA 3GO5A 2E8GA 1BCPC 1VQ5A 1S40A 1BBUA 4DAPA 4LUZA 4L5SA 1Q90A 1CZWA 4I65A 2ZM6L 4CDEC 3PIO3 2K6AA 3T16A 5M3MB 4LF4Q 1B1ZA 4I7AA 5JEAH 3FKIB 1HQMC 1NMGA 1C4QA 1G8ZD 4HCSA 3I72A 1EYCA 3KF8A 4A75A 1WTHA 2A5HA 1PH4A 2CKZB 1WTPA 3OMGA 1SMYD 5CV6A 3H09A 5EJWA 2E5LL 5FLMH 3J81i 1X3FA 3B6YA 4R4OA 1TWAH 3PO2B 3M7GA 4K5WA 4X64L 3ZYYX 1VQFA 4DR3L 1V43A 4DR2L 1EEFD 5C3WA 3H94A 4LF9L 1YNNC 2WAQE 3RR5A 5C6AA 4DPGA 4DF7A 1LT5D 4DK0A 2QILA 2KUMA 1AP0A 4IUPA 2HHHL 2EIFA 1D6EC 3R93A 5FLMG 1GJXA 3D31A 3CCJA 1EYAA 1VQEA 5DNFA 3AB9A 4B08A 2KCCA 1SYBA 1AE2A 3M7NA 1RHPA 4J1MA 5I2YA 2QGQA 3CP0A 1VQMA 2DGYA 4XT1B 4A3LH 2RHQB 1Q12A 3HOXG 1PYSB 2IW3A 1N32L 3HOYH 1QNKA 5IWAQ 4X62L 4C2MH 4DAYB 1P8LA 3PGZA 4FNFA 4DUZQ 4B3SQ 2AQ1B 3ND8A 3S2HB 1A15A 2NTTA 2DY8A 3W1BA 1YNND 3F2CA 1L1OB 1SJED 2LKVA 4AYBE 3PUYA 2A19A 1EEID 2WFWA 4JC0A 3AFQA 1A2UA 1B9NA 3H91A 3G71A 3TP5A 1EWIA 2F52A 2B8FA 4A3LG 2I5MX 4P75A 1GM5A 3J81L 2K1BA 2F0NA 5KNCA 2VZAA 4FF4A 1TWGH 4C3JH 1YHQA 1LYLA 1HTPA 1V1QA 1O80A 1GVPA 3L2PA 2VY3A 1KDAA 2AWNA 5IODA 1QOHA 1A2TA 1ET6A 3GTJB 4ZYSA 4P71A 1EQQA 3TS0A 4A3CG 2NWGA 5ISRA 5IT9L 1X3GA 1B3QA 3A54A 5M3FB 4KHVA 2JA6B 4DAYA 2A69C 4JBKA 1RCVD 3K8AA 4HEDA 4IFDG 4MZ9A 1N36Q 4P2CB 1L1OA 4AH6A 5BN3A 4LF6Q 1BBWA 5BN4A 5HGTA 1RTNA 4EX5A 3E0JA 4WJ3M 1OXXK 5IYDG 4JG2A 3CRLC 4K5XA 2UUBQ 4DR4Q 1QB5D 2JA9A 2Y0SG 4A76A 4YIJA 4DK6C 1F9RA 4L5TA 2MHVA 2NVYB 4GLXA 1X6OA 5FLXL 5JJLA 1EZ8A 1DZ1A 1PH8A 1JR0D 3G7LA 1W6JA 1JOOA 2RBMA 3GP7A 2B2TA 1NSNS 2MO1A 5F2DA 2KCTA 5ELBA 3E6ZX 2G9DA 3HOVB 2D62A 2YTVA 1TWCH 1F2MA 4LJZC 3QWNA 4DUZL 4B3SL 4HN7A 4IZ8A 3UDFA 4HIMA 1M4VA 2EVBA 3NBHB 3TEHB 2WAQG 3S2DH 5ELFA 1R4PB 5CV4A 3LGJA 2UUAQ 2K04A 3K6OA 3CC2A 4K8JA 1F9SA 2ALYB 3GTQB 1JOKA 4DXFA 1BOSA 2A74C 1PVOA 3BVMA 4L5RC 1Q1EA 4Q0FA 3ERQA 2K01A 1JMCA 1I94Q 5FK9C 2DUDA 1ICWA 4QB4A 1HNWQ 1Y1WG 3D8GA 4R9WA 3P75A 2EY5A 5IP7H 4NKLA 2XSCA 2XGTA 2EE1A 3VYUA 4IOCA 1PHJA 3Q8DA 1FNUA 2P5ZX 2VL6A 2EJGC 3A5ZB 4P72A 4MHEA 4G7HC 4JYAQ 3BDLA 4DV2Q 2R92B 5KEEA 4FO2A 1STNA 4OONA 5EQ0A 2F0QA 3JC66 1GUGA 4DK3C 4A3DG 4UP7A 4A4IA 3HOWH 3R3OA 3NBHA 4JW0A 1N36L 1XPOA 1PRTB 5BN5A 2MP1A 2JA5G 2JA7H 1HPCA 1LTLA 2Q2UA 4QMGA 3FMCA 4PZ7A 2VW9A 5IYCH 3RLFA 4JVZA 1HZ9A 2DNCA 1XPRA 3IAYA 3DHQA 1SYEA 1WTRA 5C3XA 1SLJA 3BZCA 1PDQA 2OWOA 3CCEA 2UUBL 3S1MH 1H9KA 4DR4L 1L0XB 1SEBD 4BS9A 3M9BA 1SYDA 2BCOA 3C2PA 1KDBA 1EIHA 1UNSA 1AZPA 4KKUA 4ABNA 2B3GA 4A93B 1TWFB 3HOWG 2I5LX 5AFWA 3RZOB 3CKIB 4A3BB 5DEHA 3OIQA 4IUNA 4RG1A 2CW0C 4KTAA 1BDOA 5C4JH 1PTOD 3CC4A 1PH9A 5IYCG 4Q5VA 3GTLB 1JQYD 2MJ8A 2AUKA 1BQQT 3CCMA 3P20A 1XMQL 1NAPA 2KVMA 2ASBA 1Y1VB 1PFMA 1T5XD 1HNZQ 5C5LA 4GZYC 2E2HB 1GXDC 2JXMB 1Q81C 4OO1H 5COYA 5FJ8H 5A35A 4UP8A 1VQ8A 4QGUA 2UUAL 3GTGH 4DR6Q 5JEAJ 4X65L 3PIP3 2F0IA 1HFGA 5AJ3Q 1QWYA 5EAYA 3CCVA 4A3JG 4YWKA 1NCVA 1STEA 1CQVA 3S15H 3BS1A 2PW7A 3RN5A 5LMUQ 4B3MQ 2JP1A 2CW0D 1CSPA 2XVSA 5DAUA 2XNAC 2N49A 1PRTC 1I94L 3D4RA 1HNWL 4L6TB 3DXJC 4KY5A 5LL6X 1XTCD 2PZWA 1QUQB 4DK1A 2NVTB 3L3OC 4OO1G 2MUYA 1ICFB 1BNZA 1I4PA 3GTMB 4N8X1 4AQYQ 1CM9A 3Q6SA 1ML0D 1RF2D 3LNNA 1V1PB 2AQ3B 2B2WC 2K33A 3BVZA 4FF3A 4GN3B 3HOZH 4OWTB 1DXMA 4IALA 4DGZA 1D5XC 3M85A 4QL5A 4CDCC 4JPBW 1HJPA 1JWMD 4JI8L 4KJNA 4JV5Q 3ONAB 1K73C 3SR1A 3PF5A 4PMCA 2Q8IB 3EN2A 4QIWE 3HEJA 3PO2G 4OO1I 2NTSA 1O7LA 4QJFA 2HQEA 2VXWA 2VQEQ 4NDXA 1WJJA 2QEXA 1CA6A 1PH1A 2VB2X 1KIXA 1N34Q 1GUSA 3E9HA 1PH2A 1IL2A 3MXPA 1S5FD 4RKLA 2OT2A 1L0YB 3H3VC 3I3CA 4XQNA 3U4VA 3JAMi 4LK1C 4FXGC 4BBSH 2IY5B 3UDIA 1OO9B 1QUQA 3SE0A 5JOBA 3HOYB 2Q8RE 3T13A 1HTLD 1V1PA 1WTQA 1G51A 2X6GA 1WTVA 4OWXB 1K28A 4U673 5FO9B 4POGA 2F0SA 2A68D 2BE5C 3GTKH 2NVXB 4UDUC 1G6ZA 4KD4A 1HNZL 1SE8A 2IJ0A 2OTJA 2PNRC 1Q8IA 2F0MA 4A3MH 2K14A 1FGBD 3P7JA 4TRDA 3E5SA 4UPAA 3OSOA 4BY1B 1JICA 1JJGA 2EDGA 1RD9D 1YIJA 3A8IE 5LMUL 4B3ML 1U4PA 3PO3G 3M4PA 3OOCA 5KGUA 4HIDA 2PQAB 3W5OA 3T1HQ 1S5BD 1Y8NB 3I4MB 1ASZA 3OTOQ 4DR5L 1OXUA 4LW1A 1VS0A 3FHWA 4CKEA 2F0PA 4YCVA 5I6WA 2HDMA 3EBEA 1QZHA 1OXTA 2H1EA 3PCOB 1JJCB 4MTKA 3QIAA 4RCNA 3VYRA 5M3FG 3A0JA 3J7AF 1WD1A 1AEXA 2HIVA 3KLWA 4FP5D 4DU9A 2K5QA 4EQOA 4GNXA 1CTMA 3JAML 5I6YA 5KIXA 3RZDH 4JV5L 1XNRL 1PMRA 3EFXD 2F4IA 4DR7Q 2OCEA 1RKNA 4EQNA 3O13A 1Q46A 3FP9A 1PTOH 1A6XA 4V190 4JI7Q 1H9JA 1KTKA 1NTGA 4A3IH 4A3KH 1VQOA 1IKLA 2NUCA 4GS3A 4I7ZC 3S1QB 5LMNW 4IUTA 3C3LA 3I56A 3U50C 1LTGD 1N34L 3MC0B 2VNUD 3NENA 5M5WB 1IZ6A 2XN9C 5JPNC 2K5WA 1D1IA 2UUCL 1CHQD 1JORA 1DCZA 4BWGB 2IL8A 4A3EH 2VUMH 3NK9A 4PG3A 2WV6D 1O7IA 5IGBA 2WP8J 4IPCA 2QDBA 1FR3A 2RDGA 5E3FA 3CQZH 5CC4A 2N55A 1KLUD 1STHA 3F2BA 1SAPA 2EOTA 3U9SA 3H0GH 3SXHA 3HOVG 2E5LQ 3EVQA 5C44B 1X55A 1Y69U 2L5TA 1EY7A 1MJCA 4NXNL 5LMNQ 1I4QA 2HD3A 2AHOB 4K6LA 4ZK9B 4DR3Q 1GKHA 3K59A 5A2QE 1YNXA 4J15A 2VUMG 3T53B 4ME5A 1Y8OB 3UDXA 2VS1A 2F0LA 2QF7A 5EPJA 3ITPA 2HHHQ 3C1FA 1NJIC 1QVFA 3AQQA 2SNSA 1KRSA 2EY2A 4OX9Q 1N33Q 1D1KA 3DM1A 1LT6D 1VQJA 4DV5L 2R7ZB 3T1HL 4L63B 3PUWA 3OTOL 3TZUA 3KF8B 3KLSA 1KC8C 1DJRD 3CF5A 1I6VC 2M2LA 5M5YH 2YYZA 3I2ZA 1SDFA 1EZ6A 1LT3D 2RCFA 3EJIA 4YCUA 2GN5A 3CCUA 3KJOA 4IJHA 3MXNB 4NXML 1Q3LA 5IE8A 1CKMA 1SFOH 4LF5Q 3TS2A 4EGVA 1A0IA 3ND9A 1F2ZA 1C8CA 2B63B 1LTRD 3OIPA 5JJZA 4DR7L 1G2TA 3CAMA 2CVRA 5C0XG 3Q23A 4JI7L 2QEJC 4IQZA 2SEBD 3PIOA 3KJPA 2HQLA 2IPKD 2EZVA 1K0SA 4NP5A 2PCFB 4YHHQ 2K05A 4GKJQ 2E2JB 1TQOA 1EY4A 3S16B 1F2LA 4JI1L 5H1SE 5GAEC 1I6HH 1I4RA 1GHJA 4CJ0B 4A93G 4HMIA 1EOTA 3CD6A 4DKAC 4LF8L 4A3BG 4FF2A 4QY7A 1G91A 3KLSX 4JI0Q 3D6CA 1U9RA 1X3PA 2N78A 4R8NA 3HOUH 3K7AB 1B3AA 5IGCA 3QJYA 2ZXOA 1HHVA 1E1OA 2ENBA 3CW2C 3DWAA 2R93B 1IXRA 3MXNA 1BCPD 2V1CC 3KK7A 1B4OA 1RJTA 5LMNL 2RVLA 5J3BA 1VQHA 4ILWA 1E0BA 3HOXH 4JI3L 1VQ9A 4X3UA 1YVCA 3NSWA 3J81c 2JN4A 1PV4A 1J8IA 3HOUG 1S5CD 2DJGC 2K28A 1ZKOA 2ZTCA 1XNQQ 1WCMH 4B3RL 3I4OA 4CKBA 2ICIA 2YU9B 3UE1A 1SMXA 5JAVA 4OX9L 2F0GA 1CKOA 5C3EB 5IT9c 1N33L 1SROA 2C9OA 2JQOA 5D3DA 5I2XA 2CCZA 3U9OA 4P73A 4UY8C 1ILQA 2LY7A 3M3YB 2F0UA 4XIGS 1SJHD 2KOLA 3HOZB 5CV8A 3S1NH 3BZDB 4LUOA 2ATWA 4H44C 1KAAA 1WCMG 2AWOA 2F0DA 2RF4A 3OHXC 1KXLA 3OWEB 4LF5L 2L0CA 1L0WA 4A3CH 5C4XB 1MD2D 1GUOA 3PUVA 5IOCA 4N9PA 5M9OA 4BBRB 3I70A 1QE6A 4RHRA 3SK6A 3I4NH 3DEPA 1NBWA 2A73B 4IFDH 3TN2A 1AN8A 3C46A 3BVGA 5FLXc 5DM73 1FGUA 1OXSC 1U4RA 3FDTA 4K8IA 3AEVA 2WIIB 4YHHL 1F9PA 4GKJL 1AZQA 4R4TA 1V9PA 4PMWA 4GOPA 3WWVA 1BKBA 5IGDA 3I4LA 5C4HA 2Q2HA 3BG3A 3DWQA 3HKSA 4UP9A 2JK8A 5IYDH 2PPBC 4DV3Q 2LSSA 4JBMA 3OMCA 1O7YA 4JI0L 3AU7A 5KYIA 3I4NG 2EYMA 3EA6A 3DLLA 2EJMA 1GUWA 3FPPA 2ZXRA 4L8JA 4O0AA 1K8GA 3S17B 3M4OH 3VYTA 1YITA 1J5EQ 3J7AV 1MGSA 3PUXA 4WFN3 1I3QH 1XWEA 1K8MA 4A3FB 4GKKL 1G2SA 2BA0A 1B9MA 4B9WA 1SR3A 1VMPA 2E75C 1HZAA 1L1OC 1ET9A 3HFZB 2XWJB 1BO0A 4KI0A 3WOEA 1R9TH 1EWCA 4FF1A 1ASYA 4C1NI 1XNQL 4IFDI 2D5DA 5IY0A 1B8AA 2A69D 3J80i 4HJ7A 2ZXPA 1FNVA 4KKTA 4JCVE 3A7LA 3K5LA 4C3IB 3HKZB 5C5MA 5CYUA 2E76C 2F3WA 2H5XA 1MI2A 1N9WA 1VQPA 1VQ4A 2UXDQ 1SYFA 5IYBH 3WOFA 2FMMA 2F0OA 3MWYW 1U4MA 2HIXA 3I73A 1XMQQ 3EQLC 2A6HC 1YJWA 1PFNA 1Y1WH 2PW5A 4PZ8A 5FO7B 3KBGA 1STYA 3KOJA 5C4ZA 2B2TC 2H4OA 4JI6L 1BR9A 1MIUA 2IWHA 2Q2TA 2J0TD 4J8QA 2KCNA 4X65Q 2EY6A 3W3AA 4NB3A 4DNRB 4WJWA 2D0OA 1PFSA 3UE0A 4A3KB 4BY7B 3C1EA 4KY6A 4G4KA 4UHVA 2K50A 3AYHB 3M4YA 1DGSA 4RGMA 5IYBG 3GTOH 3NPPA 2R6GA 2E74C 5KNDA 1B2TA 4A3DH 1PZJD 1K83H 2KEEA 4DNTB 4M1UB 1HXYD 2JA5H 2WKDA 4A3EB 5K36G 4TSSA 5HGQA 1S4ZA 3CC7A 3NWSA 4R1JA 5CBEE 4AYBG 1ZXTA 4DV3L 3A8JE 2E2IB 4GLVB 1YNJC 2AKWB 2EYFA 1P16A 3IKJA 1S3OA 3MHBA 3SK8A 4JI8Q 2FINB 1YJNA 5EKLA 4C3HH 3J80L 5M5XB 1C9OA 1QCBD 3CCSA 4YWMA 3QR8A 3RD4A 1JOQA 2FMCA 1J5EL 1PYBA 2PMZB 1MJEA 4IJLA 2B2YA 4A3GB 2B2UA 1RODA 5EKKA 3GTPB 5J1ZA 2CQOA 2F4VL 3V05A 2EYOA 2JA8G 4HSPA 1FL0A 3N52A 2HT1A 5JVH3 3SHLA 2MPMA 3VA7A 1LTAD 1W2BA 3TQYA 4C3HG 3S14H 3CRKC 1E24A 2CH4W 2MQHA 5EKIA 1TY0A 4A3JH 2LXKA 3N6RA 4R8IA 1VQDA 1Z47A 4LFAQ 2EYHA 2M9VA 2UXDL 1K8OA 1BBXC 4NMZA 2F0VA 2BDNA 1WD0A 4F8MA 3EROA 2NVQB 1J9OA 4GN5A 1H9MA 1PYWD 1GOZA 5EPKA 3FKIH 4V0BA 1WOCA 1Q8KA 1EYDA 2EJFC 1PH5A 2KEDA 4ODGA 3G6JB 1C0AA 5GADC 2CH4A 1KRTA 5IP9G 1PH6A 4DR5Q 1STAA 2V4DA 1CQFA 2Z4HA 3V2TA 5M3MG 3PO2H 2Z6KA 4BXXH 2R7FA 4LAAA 1SE2A 3FKIG 1SBBB 1TU2B 2NZ1D 2F03A 1FVIA 5G3LD 1CK1A 2E2DC 4N8FA 2RSNA 4EVOA 3I55A 3MEFA 4QUFA 4RCOA 1KLGD 3T51B 2CHBD 1Y14B 2F3VA 3HKZE 5CMDA 4KMUC 1TWAB 2M00A 2K5VA 2GVAA 5DLQE 1XNRQ 2R93G 2K32A 3W2DA 1PRTD 4BXXG 2VB3X 3NHHA 1MHWC 4IN3A 1ENCA 5JPMC 2LS01 1JWSD 3D0FA 3ULJA 4X3SA 1PXUA 1DM0B 4DXGA 3S9WA 3R8BA 1I4XA 3S2HH 4POFA 1M90C 2UUCQ 2WINB 3FPUB 1YEZA 1MSGA 1HNXL 1DYQA 4RKBA 3CCLA 1A63A 1ENAA 4ID6A 4QUCA 3S1RH 3F2DA 4C2MB 1IYUA 2PI2A 2BH2A 3PQIA 5ELNA 5E1FA 2Q2IA 4LFAL 3K0YA 4ZAIA 4NXNQ 3JAMc 3PO3H 2UXCQ 3SK4A 3CXCA 1X3EA 5D3IB 4GNXB 2JE6I 5BR8Q 4IFDJ 2G5DA 1V8QA 3NQTA 3T1YQ 2PNHA 2N3SA 2J4XA 5IGGA 1LO5D 2L12A 3GTJH 4CJ2C 4K0KQ 4B3TQ 1SNOA 2I0QA 4HAEA 1TS2A 2OQ0A 2CQAA 1PTOF 5M3FH 3LWUA 4YWLA 5E4WC 1B53A 1NMFA 1ZYRC 1TWGB 4IPDA 4C3JB 4DV6L 3QB3A 2PMZE 2FJ2A 4DV5Q 3TMEA 3D3RA 1XMOL 1VQLA 1PZKD 3BYYB 1B70B 4OXPA 1OTCA 4LWCA 1GO3E 4N9TA 4LNQA 1A3UA 2BE5D 3F2UA 4RGTA 1QG7A 2Y0SB 3IFDA 4KY7A 1K9MC 3R2TA 1EY5A 1EY6A 3MEHA 3MXGA 2JA6G 3X3NA 2BA1A 3K5OA 4NXMQ 4DN4M 1HZCA 4CJ1B 1HR0W 4BA1I 2R7DA 2UXBQ 3TREA 1U5KA 4IO9A 5GAGC 2EY1A 3MFGA 1JB7A 1EL0A 1CI3M 1RIPA 1VQIA 1FJGL 1EOVA 4GNXC 4YY3Q 3HOVH 3SGIA 2N88A 1EU3A 1EFID 3STBC 3TBIB 5HURA 1Z9FA 4JI1Q 4C1NK 4DAVA 4HR7B 1NUCA 4NPSA 1EIGA 4LF8Q 5D14A 1XTDA 1HR0Q 1Y8PB 4HCEA 1YI2A 3LX0A 3HKZG 4C3IG 3GTQH 4H0LC 3BYTB 3F8TA 4J6HA 4MN3A 2I46A 1Q1BA 1UUPA 4LFBQ 2F0TA 1SE4A 1TWCB 4YCWA 1K8AC 3BDCA 2KJXA 2MGSA 1MBYA 1MSHA 4ZKCB 3Q0AA 2RQXA 2B29A 4BA2I 3TDQA 3S2DB 2UXCL 2AMCB 2Z9HA 4OGQC 5BR8L 2XIWA 3A74A 5ELDA 5HY6A 4K6DA 1TXYA 1S5DD
chains in the Genus database with same CATH topology
1QNUA 2SOBA 2HCIA 1DOMA 1HCZA 4CBVA 5A2QL 5T1GA 1ESRA 3MTSA 4A3DB 4KN4C 1HUMA 5TSSA 2B8GA 3X3MA 2FHTA 2WB1B 1CHPD 2TMPA 2F0KA 5C0XH 4OL7A 1BXTA 4DA2A 3QO2A 3HOWB 4RAUC 4FXDA 3H6MA 1IHZA 3NUCA 2AUJD 3HRZC 2JA7B 5JVG3 1KABA 2PZUA 3IFTA 1TT2A 3HP3A 4PNYA 1CFMA 1FYCA 5CV5A 5CV9A 1EQVA 2OXPA 1VF5C 3S1MB 1WVLA 4G7OC 3A55A 2Z1CA 1E2WA 1IYVA 1ENFA 4X3KA 5J39A 5C4JB 1SMYC 4WRDA 3Q22A 5IGFA 3KLRA 5C0XI 4ZLTF 5K5PA 4FVMA 2O5JC 4UAIA 4XTCS 4O1NA 3V96A 3QG1A 2LMCB 2A6EC 3GTGB 2IX3A 4QF4A 3NWTA 3QOJA 2EPBA 3S15B 4EQPA 3GD7A 4ULLA 3UI2A 1AFPA 4KKSA 5T1IA 1RTOA 1HUNA 4O42A 1UEAB 1KDCA 1LTBD 3TZDA 5JEAG 2SNMA 4KN7C 5IIFA 4TQUS 3I90A 2PYKA 2A6ED 2QKIC 1JB3A 1B50A 2G9HD 3BDOA 3PUZA 1CA5A 3R2IA 2HDLA 2RA4A 2L9HA 1U4LA 1R4QB 1SYGA 3HG9A 3MZ5A 1D5ZC 4KK7A 1E2VA 3VA5A 1SE3A 2PQEA 4F87A 4ZUJA 3URYA 4RHSA 5EBCA 1TR5A 3NTKA 1G291 1IW7C 1LTSD 1AW7A 4BBSB 4E6IA 3S1RB 5CR3A 1T5EA 4XYOA 5CV7A 1EY9A 2FFKB 1SNQA 3J81E 3PO3B 1Z7TA 1A3TA 3WDNA 4XYQA 3GTKB 4ZRZA 3HS0C 3VYSA 4K2KA 4KJOA 3SEBA 4A3MB 5IT9E 1C48A 1X32A 3PV0A 1VDZA 4IUUA 2NN6H 1IW7D 4KHZA 4IUVA 2L11A 2IT1A 2R3ZA 2Q8TA 2D2CC 2EYPA 2OF1A 3T56B 5I9OA 3FEWX 2EYLA 2EXZA 2GA4B 3QOLA 4C3JG 3MVVA 5CGKA 4F7XA 3GV6A 1BCPF 1W6KA 2PO4A 1KNEA 1EU4A 2NN6G 1BUVT 5I9PA 4F88A 5EGTA 4JBWA 2TSSA 1ILPA 2DN8A 5J22A 4XQJA 5FLXE 3RZDB 1JCKB 5K36H 4OHJA 1FNWA 1PTOB 4OIKA 1A3VA 2WKCA 5CBAE 3MFYA 2KA7A 4A3IB 5CORA 3Q24A 2NN6I 4K5VA 4QIWB 3I91A 2J7ZA 3J7YW 4HTHA 4CHTB 3A7AB 1CZGA 2HCCA 2JEAI 1LABA 4RA8A 2VUMB 2A6HD 4XDXA 3K5MA 3MA2B 3CQZB 2L55A 1O7ZA 1CT1D 3H0GB 3VR5A 3D4WA 3A8KE 1D2BA 3MXUA 1ONLA 1HRJA 5LL6S 2RSOA 2IX1A 1TY2A 3HZXA 4RWSC 2HUGA 1SYCA 4RGOS 2QCPX 5KNBA 5C0XJ 3VR2A 2KECA 3J80E 1PFBA 1PTOC 2B2YC 1YNJD 2B2UC 1DD2A 4RGNA 3D4DA 5DM63 1TS3A 3DUZA 4MIUA 1XX8A 1QJOA 5M5YB 3KUPA 1KNAA 1LACA 2JEBI 3KBXA 1LV9A 1SXTA 1TS4A 3VR6A 3HGBA 1SFOB 4G57A 5IGEA 3IL8A 2DNEA 1TS5A 3PMFA 5KRUA 1EWHA 1SNPA 2ZT9C 4DFAA 4KV6A 4H7BA 3D6WA 1UAPA 2SDFA 3NQIA 3L7ZC 1I6HB 1HQRD 5ELCA 1S5ED 1LT4D 1QILA 1V1OA 1TWHB 2RDFA 1ESFA 2K5DA 2R61A 4QCLA 1B44D 3HOUB 1TIID 2B2WA 3OPOA 1IL8A 4G7ZC 2NBFA 4Z9CB 1EY8A 1WTWA 1E2ZA 1NR4A 5FO8B 3HOXB 3FRPB 4XXEA 2O5IC 4H13C 2LFNA 2JSOA 2F0EA 1HA6A 4KD3A 1WCMB 4NW2A 3SK5A 1VCIA 1DOKA 2Z8LA 3K5NA 1EY0A 2F0WA 2I07B 4PV1C 5I4DA 1JC7A 4PMBA 1PLFA 4U68A 3L9AX 1F9QA 5EPLA 2BOSA 2F0HA 3DWPA 3NE5B 2XWBB 2A68C 2RKSA 3S1NB 1H9RA 2DY7A 2WACA 2OEOA 2F0JA 5KYLA 4Y7NB 2XRSD 1HFNA 4X3TA 3TP8A 2AQ2B 1RDPD 3I4NB 3GQBA 4TKOB 3TP7A 2K03A 5LHY1 4OIJA 1TKWB 1M8AA 2IX0A 3MAQA 1I50B 5NUCA 1DONA 1LTTD 2F1MA 2EYJA 3RUZA 4XQQA 2O4XA 2NYZD 2ICEC 3TSSA 4XT3B 1STGA 3RMHA 1XYIA 4CGYB 1SSOA 3M4OB 1STBA 4RH6A 3VR3A 5FOBB 1ZYRD 1I3QB 3A56A 4HSVA 5ELEA 1BF4A 3SVMA 5G3LF 2K7VA 1SNCA 3NTHA 1R9TB 3T4AC 2WAQB 3JAME 2O2LD 3TP6A 2JYOA 2X6LA 1I4HA 3VR4A 1PRTF 4HMJA 1OXVA 1O78A 1II3A 3I8ZA 2L1BA 1IKMA 1FD7D 4ZQ3A 1D5MC 5D65A 1Y1WB 1LTID 3K58A 4K2LA 2F0FA 3AMUA 4IUQA 1WTXA 3DMUA 4CKCA 1GUNA 1SNDA 2BDOA 3GV3A 2B2VA 1F2YA 4AYBB 1DOLA 1F77A 4ZUIA 3GTOB 1H9SB 2KHSA 2KQ3A 3LWEA 1I4GA 1XXGA 4WORA 5EBDA 5E4XA 3NP8A 1Z6HA 2X69A 3OWFA 1GUTA 1X3QA 1EQTA 1K83B 4S3SA 1BCPB 3NXWA 4B9XA 2B2VC 2JA5B 2L4NA 4FXKC 1WTOA 2B39A 1VMCA 3CU7A 2JA8B 1HA5A 1TVXA 3CHBD 4C56C 3DEOA 2NB0A 1JE4A 1ZEQX 3K57A 2ID0A 4IURA 4C3HB 3NTIA 2D9UA 2RDHA 3OW7A 3FVQA 4RFBA 2XRQD 4K14A 5FKAC 1LLRD 1SNMA 3SDZA 1NR2A 1JWUD 1H9SA 4ZKBB 4PQXA 4LMQD 2C5CA 1PZID 3S14B 2PZTA 2Z4IA 4M8AA 1GHKA 3NBIA 4A3JB 4FYDA 1VF7A 4JK1C 3P1HA 3GO5A 1BCPC 4DAPA 1Q90A 1CZWA 4I65A 3PIO3 2K6AA 3T16A 5M3MB 1B1ZA 5JEAH 3FKIB 1HQMC 1C4QA 1G8ZD 4HCSA 3I72A 1EYCA 3KF8A 2A5HA 1WTPA 3OMGA 1SMYD 5CV6A 3H09A 5EJWA 3PO2B 3M7GA 4K5WA 3ZYYX 1V43A 1EEFD 5C3WA 3H94A 1YNNC 5C6AA 4DF7A 1LT5D 4DK0A 2QILA 2KUMA 1AP0A 4IUPA 1D6EC 3R93A 1GJXA 3D31A 1EYAA 5DNFA 3AB9A 4B08A 2KCCA 1SYBA 3M7NA 1RHPA 4J1MA 5I2YA 4XT1B 1Q12A 2IW3A 1QNKA 4FNFA 2AQ1B 3ND8A 3S2HB 1A15A 2NTTA 2DY8A 1YNND 1SJED 2LKVA 3PUYA 1EEID 1A2UA 1B9NA 3H91A 3TP5A 2B8FA 3J81L 2K1BA 2F0NA 5KNCA 4FF4A 1HTPA 1O80A 1KDAA 2AWNA 5IODA 1QOHA 1A2TA 1ET6A 3GTJB 4ZYSA 2NWGA 5ISRA 5IT9L 3A54A 5M3FB 4KHVA 2JA6B 4DAYA 2A69C 1RCVD 4HEDA 4IFDG 4P2CB 5BN3A 5BN4A 5HGTA 1RTNA 3E0JA 1OXXK 3CRLC 4K5XA 1QB5D 4YIJA 1F9RA 2MHVA 2NVYB 5FLXL 1DZ1A 1EZ8A 1JR0D 3G7LA 1W6JA 1JOOA 2RBMA 3GP7A 2B2TA 1NSNS 5F2DA 5ELBA 3E6ZX 2G9DA 3HOVB 2D62A 4LJZC 1F2MA 3QWNA 4HN7A 4IZ8A 1M4VA 2EVBA 5ELFA 1R4PB 5CV4A 2K04A 3K6OA 4K8JA 1F9SA 3GTQB 1JOKA 4DXFA 1BOSA 2A74C 3BVMA 1Q1EA 4Q0FA 3ERQA 2K01A 5FK9C 1ICWA 4QB4A 3D8GA 4R9WA 3P75A 2EY5A 4NKLA 2XSCA 2EE1A 3VYUA 1FNUA 2EJGC 4G7HC 4MHEA 3BDLA 2R92B 5KEEA 4FO2A 1STNA 5EQ0A 2F0QA 1GUGA 3R3OA 3NBHA 1PRTB 5BN5A 2MP1A 1HPCA 4QMGA 3FMCA 3RLFA 2DNCA 3IAYA 3DHQA 1SYEA 1WTRA 5C3XA 1PDQA 1H9KA 1L0XB 1SEBD 4BS9A 1SYDA 2BCOA 3C2PA 1KDBA 1EIHA 1UNSA 1AZPA 4KKUA 4ABNA 4A93B 1TWFB 5AFWA 3RZOB 3CKIB 4A3BB 5DEHA 3OIQA 4IUNA 2CW0C 4KTAA 1BDOA 1PTOD 4Q5VA 3GTLB 1JQYD 2MJ8A 2AUKA 1BQQT 3P20A 1NAPA 2KVMA 1Y1VB 1PFMA 1T5XD 5C5LA 4GZYC 2E2HB 1GXDC 2JXMB 4OO1H 5COYA 5A35A 5JEAJ 3PIP3 2F0IA 1HFGA 1QWYA 1NCVA 1STEA 1CQVA 3BS1A 2PW7A 2JP1A 2CW0D 5DAUA 2XVSA 2XNAC 1PRTC 3D4RA 4L6TB 3DXJC 4KY5A 5LL6X 1XTCD 2PZWA 4DK1A 2NVTB 3L3OC 4OO1G 2MUYA 1BNZA 1I4PA 3GTMB 1CM9A 3Q6SA 1ML0D 1RF2D 3LNNA 1V1PB 2AQ3B 2B2WC 2K33A 3BVZA 4FF3A 1DXMA 4IALA 4DGZA 1D5XC 3M85A 1JWMD 4KJNA 3ONAB 3SR1A 4PMCA 2Q8IB 3HEJA 4OO1I 2NTSA 1O7LA 2HQEA 2VXWA 4NDXA 1CA6A 2VB2X 1GUSA 3MXPA 1S5FD 4RKLA 2OT2A 1L0YB 3H3VC 3I3CA 4XQNA 4LK1C 4FXGC 1OO9B 3SE0A 5JOBA 3HOYB 2Q8RE 3T13A 1HTLD 1V1PA 1WTQA 2X6GA 1WTVA 4U673 5FO9B 2F0SA 2A68D 2BE5C 2NVXB 4UDUC 1G6ZA 4KD4A 2IJ0A 2PNRC 1Q8IA 2F0MA 1FGBD 3P7JA 4TRDA 3E5SA 3OSOA 4BY1B 1JICA 2EDGA 1RD9D 3A8IE 1U4PA 3OOCA 5KGUA 1S5BD 1Y8NB 3I4MB 1OXUA 4CKEA 2F0PA 5I6WA 2HDMA 1OXTA 2H1EA 3QIAA 4RCNA 3VYRA 3J7AF 1WD1A 1AEXA 4FP5D 4DU9A 2K5QA 4EQOA 1CTMA 3JAML 5I6YA 5KIXA 1PMRA 3EFXD 2F4IA 4EQNA 1RKNA 3O13A 1A6XA 1PTOH 4V190 1H9JA 1KTKA 1IKLA 2NUCA 4I7ZC 3S1QB 4IUTA 3C3LA 1LTGD 3MC0B 2VNUD 5M5WB 2XN9C 5JPNC 2K5WA 1D1IA 1CHQD 1JORA 1DCZA 4BWGB 2IL8A 3NK9A 2WV6D 5IGBA 2WP8J 2QDBA 1FR3A 2RDGA 5E3FA 5CC4A 2N55A 1KLUD 1STHA 1SAPA 2EOTA 3U9SA 3SXHA 3EVQA 5C44B 1Y69U 2L5TA 1EY7A 1I4QA 4K6LA 4ZK9B 3K59A 5A2QE 3T53B 4ME5A 1Y8OB 2F0LA 2QF7A 5EPJA 3ITPA 3C1FA 2SNSA 2EY2A 1D1KA 3DM1A 1LT6D 2R7ZB 4L63B 3PUWA 3TZUA 3KLSA 1DJRD 1I6VC 2M2LA 2YYZA 1SDFA 1EZ6A 1LT3D 3EJIA 1Q3LA 4EGVA 3ND9A 1F2ZA 1C8CA 2B63B 1LTRD 3OIPA 5JJZA 1G2TA 2CVRA 5C0XG 3Q23A 2QEJC 4IQZA 2SEBD 2IPKD 2EZVA 4NP5A 2PCFB 2K05A 2E2JB 1TQOA 1EY4A 3S16B 1F2LA 1I4RA 1GHJA 4CJ0B 4HMIA 1EOTA 4FF2A 1G91A 3KLSX 3D6CA 1U9RA 1X3PA 4R8NA 3K7AB 1B3AA 5IGCA 3QJYA 2ZXOA 1HHVA 2ENBA 3DWAA 2R93B 3MXNA 1BCPD 3KK7A 1B4OA 1RJTA 2RVLA 4ILWA 1E0BA 4X3UA 3NSWA 1J8IA 1S5CD 2K28A 1ZKOA 4CKBA 2ICIA 2YU9B 5JAVA 2F0GA 5C3EB 2C9OA 5D3DA 5I2XA 3U9OA 1ILQA 2LY7A 3M3YB 2F0UA 4XIGS 1SJHD 2KOLA 3HOZB 5CV8A 3BZDB 4H44C 1KAAA 2AWOA 2F0DA 3OHXC 3OWEB 2L0CA 5C4XB 1MD2D 1GUOA 3PUVA 5IOCA 4N9PA 5M9OA 4BBRB 3I70A 1QE6A 4RHRA 3SK6A 3DEPA 2A73B 4IFDH 3TN2A 1AN8A 3C46A 3BVGA 5DM73 1OXSC 1U4RA 3FDTA 4K8IA 2WIIB 1F9PA 1AZQA 4PMWA 5IGDA 3I4LA 5C4HA 3BG3A 3DWQA 2PPBC 3OMCA 1O7YA 3AU7A 5KYIA 2EYMA 3EA6A 2EJMA 1GUWA 3FPPA 2ZXRA 4L8JA 3S17B 3VYTA 3J7AV 1MGSA 3PUXA 4WFN3 1XWEA 1K8MA 4A3FB 1G2SA 2BA0A 1B9MA 4B9WA 1VMPA 2E75C 1ET9A 2XWJB 1BO0A 4KI0A 3WOEA 1EWCA 4FF1A 4C1NI 4IFDI 2D5DA 2A69D 2ZXPA 1FNVA 4KKTA 3K5LA 3A7LA 4C3IB 3HKZB 5C5MA 5CYUA 2E76C 2F3WA 1MI2A 1SYFA 3WOFA 2FMMA 2F0OA 3MWYW 1U4MA 3I73A 3EQLC 2A6HC 1PFNA 2PW5A 5FO7B 3KBGA 1STYA 5C4ZA 2B2TC 2H4OA 1BR9A 2IWHA 2J0TD 4J8QA 2KCNA 2EY6A 3W3AA 4DNRB 4WJWA 4A3KB 4BY7B 3C1EA 4KY6A 4G4KA 3M4YA 4RGMA 3NPPA 2R6GA 2E74C 5KNDA 1B2TA 1PZJD 2KEEA 4DNTB 4M1UB 1HXYD 2WKDA 4A3EB 5K36G 4TSSA 1S4ZA 3NWSA 5CBEE 1ZXTA 3A8JE 2E2IB 1YNJC 2EYFA 3IKJA 3MHBA 3SK8A 2FINB 5EKLA 3J80L 5M5XB 1QCBD 1JOQA 3RD4A 2FMCA 2PMZB 2B2YA 4A3GB 2B2UA 1RODA 5EKKA 3GTPB 5J1ZA 3V05A 2EYOA 4HSPA 3N52A 5JVH3 3SHLA 2MPMA 3VA7A 1LTAD 4C3HG 3CRKC 5EKIA 1TY0A 3N6RA 4R8IA 1Z47A 2EYHA 2M9VA 1K8OA 1BBXC 4NMZA 2F0VA 2BDNA 1WD0A 4F8MA 3EROA 2NVQB 1J9OA 1H9MA 1PYWD 1GOZA 5EPKA 4V0BA 1EYDA 2EJFC 2KEDA 4ODGA 3G6JB 1STAA 2V4DA 1CQFA 2Z4HA 3V2TA 4LAAA 1SE2A 1SBBB 1TU2B 2NZ1D 2F03A 5G3LD 1CK1A 2E2DC 2RSNA 4EVOA 4QUFA 4RCOA 1KLGD 3T51B 2CHBD 2F3VA 5CMDA 4KMUC 1TWAB 2M00A 2K32A 3W2DA 1PRTD 2VB3X 3NHHA 4IN3A 1ENCA 5JPMC 2LS01 1JWSD 4X3SA 1PXUA 1DM0B 4DXGA 3S9WA 3R8BA 1I4XA 2WINB 3FPUB 1MSGA 1DYQA 4RKBA 1ENAA 4ID6A 4QUCA 4C2MB 1IYUA 5E1FA 3K0YA 4ZAIA 3SK4A 5D3IB 2JE6I 4IFDJ 1V8QA 3NQTA 2J4XA 5IGGA 1LO5D 2L12A 4CJ2C 1SNOA 4HAEA 1TS2A 2CQAA 1PTOF 3LWUA 5E4WC 1B53A 1ZYRC 1TWGB 4C3JB 3QB3A 2FJ2A 3TMEA 3D3RA 1PZKD 3BYYB 4N9TA 1A3UA 2BE5D 3F2UA 4RGTA 1QG7A 2Y0SB 3IFDA 4KY7A 3R2TA 1EY5A 1EY6A 3MEHA 3MXGA 3X3NA 2BA1A 3K5OA 4DN4M 4CJ1B 4BA1I 2EY1A 3MFGA 1EL0A 1CI3M 2N88A 1EU3A 1EFID 3TBIB 5HURA 4C1NK 4DAVA 4HR7B 1NUCA 1EIGA 5D14A 1Y8PB 4HCEA 3LX0A 4C3IG 4H0LC 3BYTB 4J6HA 4MN3A 2I46A 1Q1BA 1UUPA 2F0TA 1SE4A 1TWCB 3BDCA 2KJXA 2MGSA 1MBYA 1MSHA 4ZKCB 3Q0AA 2RQXA 4BA2I 3TDQA 3S2DB 4OGQC 2XIWA 5ELDA 4K6DA 1S5DD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JSO A;  2RQX A;  4HN7 A; 
#chains in the Genus database with same CATH topology
 3T1Y L;  1QNU A;  2SOB A;  4JI3 Q;  4GLA C;  2HCI A;  1DOM A;  1HCZ A;  4CBV A;  5A2Q L;  5T1G A;  4DV0 L;  4K0K L;  2R92 H;  1D7Q A;  1ESR A;  4B3T L;  3MTS A;  4A3D B;  3J81 j;  4B3R Q;  4KN4 C;  1SN8 A;  2MO0 A;  1HUM A;  3KDF B;  5TSS A;  2B8G A;  3X3M A;  2GVB A;  1KAW A;  2FHT A;  2WB1 B;  1CHP D;  2TMP A;  1EYG A;  2K5H A;  3CPW A;  2F0K A;  5C0X H;  3G6E A;  4OL7 A;  1BXT A;  3ER0 A;  2R92 G;  4DA2 A;  1KL9 A;  3E9I A;  1IBL Q;  1S72 A;  3QO2 A;  4JOI A;  3HOW B;  2D0P A;  3K7U C;  4RAU C;  4FXD A;  3S24 A;  3H6M A;  4R4I A;  4A93 H;  1IHZ A;  1TWF H;  3NUC A;  2AUJ D;  3HRZ C;  3RZO H;  2UXB L;  5JVG 3;  1KAB A;  4A3B H;  1EIF A;  2MFI A;  2JA7 B;  1E22 A;  3J7Z C;  4HJ9 A;  2PZU A;  3IFT A;  1TT2 A;  3HP3 A;  4PNY A;  1CFM A;  1FYC A;  5CV5 A;  5JJK A;  3GTL H;  5CV9 A;  1EQV A;  2OXP A;  2RHS B;  1VF5 C;  4ALP A;  2CWP A;  3S1M B;  4YY3 L;  1WVL A;  4G7O C;  3A55 A;  2Z1C A;  1E2W A;  3KDF A;  3CPF A;  1Y1V H;  3TRZ A;  1IYV A;  1ENF A;  2E2H H;  1QVC A;  4X3K A;  5J39 A;  2UU9 Q;  5C4J B;  4KHP Q;  1HR0 L;  3H3V H;  1SMY C;  4WRD A;  3Q22 A;  1VQN A;  2F3I A;  4APV A;  2ZJQ A;  1TWH H;  1QVG A;  5IGF A;  3KLR A;  5C0X I;  3A5U A;  5GQO A;  4AIM A;  4X66 Q;  4ZLT F;  4LFB L;  5K5P A;  4FVM A;  2O5J C;  4UAI A;  4XTC S;  4O1N A;  1Y1V G;  3QG1 A;  3V96 A;  2Y0S E;  2LMC B;  1NNX A;  1UWV A;  2A6E C;  4LF7 Q;  3GTG B;  1IBM L;  2NVT H;  4P74 A;  4QF4 A;  2IX3 A;  3NWT A;  4GKK Q;  2CWA A;  2KBN A;  3QOJ A;  3GTM H;  2EPB A;  3S15 B;  4EQP A;  3OYY A;  3I7F A;  3GD7 A;  4ULL A;  3UI2 A;  1X9N A;  1AFP A;  4KKS A;  5T1I A;  1RTO A;  1HUN A;  1Q82 C;  4JI2 L;  4O42 A;  1UEA B;  1BVS A;  1KDC A;  4GOP B;  1LTB D;  3TZD A;  5JEA G;  1IBK L;  2SNM A;  4KN7 C;  5IIF A;  4TQU S;  3I90 A;  3KFU A;  3BU2 A;  2PYK A;  3H3V I;  2A6E D;  2QKI C;  1JB3 A;  1B50 A;  2G9H D;  1WYD A;  4JI5 Q;  1K0R A;  3BDO A;  3PUZ A;  1AE3 A;  1CA5 A;  3R2I A;  2HDL A;  2RA4 A;  1IBL L;  3BJU A;  2L9H A;  1G6P A;  1U4L A;  4QQB X;  4JI6 Q;  1R4Q B;  1SYG A;  3HG9 A;  3MZ5 A;  1D5Z C;  4KK7 A;  1E2V A;  4Y7N H;  3VA5 A;  1I5F A;  3W1G A;  1SE3 A;  2PQE A;  1VQA A;  3NEL A;  4F87 A;  4ZUJ A;  3URY A;  4DUY Q;  4RHS A;  1PH7 A;  5EBC A;  5L37 A;  1TR5 A;  1VQK A;  3NTK A;  1G29 1;  3H15 A;  1XJV A;  1IW7 C;  1LTS D;  1AW7 A;  4BBS B;  2QDL A;  3EIV A;  1JT8 A;  2NVX H;  4E6I A;  3S1R B;  5CR3 A;  3K80 C;  3K0X A;  1I50 H;  2UU9 L;  1T5E A;  4XYO A;  4KHP L;  3HOY G;  5CV7 A;  1EY9 A;  4BY1 H;  2FFK B;  5JJI A;  1SNQ A;  2WB1 E;  3J81 E;  3PO3 B;  1Z7T A;  4X66 L;  4GOP C;  1A3T A;  3WDN A;  1YHA A;  4XYQ A;  3GTK B;  4ZRZ A;  3HS0 C;  3DM3 A;  3VYS A;  2DJF C;  4K2K A;  2EQS A;  4LF4 L;  3I4M H;  4KJO A;  3SEB A;  1LUZ A;  4A3M B;  5IT9 E;  1C48 A;  1X32 A;  3K81 C;  1VDZ A;  3PV0 A;  4IUU A;  4LF7 L;  2NN6 H;  2F4V Q;  1IW7 D;  4KHZ A;  4OWW B;  4IUV A;  2L11 A;  1KD1 C;  2IT1 A;  4BY1 G;  2R3Z A;  3RLN A;  2Q8T A;  4DR1 Q;  2D2C C;  2EYP A;  4HIK A;  2OF1 A;  3T56 B;  5I9O A;  3FEW X;  2EYL A;  2KHI A;  2EXZ A;  2GA4 B;  3QOL A;  4C3J G;  3MVV A;  5CGK A;  2K52 A;  4DV1 Q;  4F7X A;  3GV6 A;  1BCP F;  1W6K A;  2PO4 A;  3I4M G;  1KNE A;  2K4K A;  3OW2 A;  4PZ6 A;  1EU4 A;  4LFC Q;  2NN6 G;  1BUV T;  5I9P A;  4F88 A;  2RCN A;  5EGT A;  4JBW A;  2TSS A;  1ILP A;  2DN8 A;  3PF4 A;  4Y52 H;  3S1Q H;  5J22 A;  3J80 c;  4DV7 Q;  4JI5 L;  4XQJ A;  5FLX E;  5M5W H;  2ZTE A;  4OEM B;  1E3P A;  3RZD B;  1JCK B;  1T9H A;  5K36 H;  4OHJ A;  1FNW A;  1PTO B;  4OIK A;  1A3V A;  2WKC A;  5CBA E;  3MFY A;  2KA7 A;  4DV4 Q;  4A3I B;  3E0E A;  5COR A;  2CFM A;  3CME A;  3Q24 A;  2NN6 I;  4K5V A;  5IWA L;  4QIW B;  3I91 A;  3KYH C;  2J7Z A;  3J7Y W;  4HTH A;  4DUY L;  5C44 H;  4CHT B;  3A7A B;  1CZG A;  2HCC A;  2JEA I;  1LAB A;  1VQG A;  4RA8 A;  2VUM B;  2A6H D;  4XDX A;  1HH2 P;  3K5M A;  3MA2 B;  3CQZ B;  2L55 A;  1O7Z A;  2JA8 H;  1CT1 D;  3H0G B;  3VR5 A;  3D4W A;  3A8K E;  1D2B A;  1CSQ A;  3MXU A;  1ONL A;  1HRJ A;  5LL6 S;  2RSO A;  2IX1 A;  1TY2 A;  3HZX A;  1E1T A;  5C44 G;  4R4Q A;  1UEB A;  4IPG A;  4MNO A;  4RWS C;  1EIY B;  4IOA A;  2HUG A;  4O2D A;  4LUV A;  2R7Z H;  2YTX A;  1SYC A;  2N8N A;  4RGO S;  1EQR A;  3PSI A;  2QA4 A;  2QCP X;  5E7N A;  3VDY A;  5KNB A;  5C0X J;  3VR2 A;  4X6A H;  2KEC A;  1UE7 A;  4ME3 A;  4DR1 L;  2FXQ A;  3J80 E;  1PFB A;  1HNX Q;  3ZJY C;  1PTO C;  2B2Y C;  5IP7 G;  1YNJ D;  1PA6 A;  2B2U C;  1DD2 A;  4DV1 L;  2WB1 G;  4RGN A;  1X65 A;  3D4D A;  2R7Z G;  5DM6 3;  3DUZ A;  1TS3 A;  4LF6 L;  5ELO A;  4JI4 Q;  4MIU A;  2B63 H;  1XX8 A;  3IRB A;  1QJO A;  2OQK A;  5M5Y B;  3KUP A;  3ERS X;  1KNA A;  1RL2 A;  4LFC L;  1LAC A;  2JEB I;  3KBX A;  1LV9 A;  1SXT A;  1TS4 A;  3U58 A;  1YBY A;  4IPH A;  1EFW A;  2IHF A;  3VR6 A;  3HGB A;  4DV7 L;  3ULP A;  1SFO B;  2E2J H;  4G57 A;  1A62 A;  5IP9 H;  3PIP A;  3S16 H;  4CDD C;  5M3M H;  5IGE A;  3IL8 A;  1N8R C;  2JA7 G;  1W3S A;  4H02 A;  2DNE A;  1TS5 A;  3PMF A;  5KRU A;  1CKN B;  1EWH A;  2B63 G;  1SNP A;  2ZT9 C;  4DFA A;  4DV4 L;  1C7Y A;  3F1Z A;  4KV6 A;  4HJ8 A;  4H7B A;  3D6W A;  1UAP A;  3K7A H;  4DV6 Q;  2SDF A;  3NQI A;  1YHB A;  2L15 A;  3L7Z C;  1I6H B;  1XMO Q;  1HQR D;  1X56 A;  1YJ9 A;  5ELC A;  2R93 H;  1YZ6 A;  3U4Z A;  1S5E D;  1LT4 D;  1QIL A;  4EQ5 A;  3UDG A;  1V1O A;  1TWH B;  2RDF A;  1ESF A;  1H95 A;  2K5D A;  2R61 A;  4QCL A;  1B44 D;  3HOU B;  2VQF Q;  1TII D;  2Z0S A;  2MNA A;  2B2W A;  2KHJ A;  2Z6K C;  3OPO A;  1IL8 A;  4G7Z C;  2ZJR A;  2NBF A;  2YU9 H;  4Z9C B;  4R4C A;  1EY8 A;  1WTW A;  1E2Z A;  1NR4 A;  5FJ8 G;  5C3E H;  5FO8 B;  3HOX B;  1D8L A;  3FRP B;  4XXE A;  1Q86 C;  1M1K C;  2ZTD A;  2O5I C;  4H13 C;  1CKN A;  1FJG Q;  4JYA L;  4DV2 L;  3M3Y H;  2LFN A;  3L0O A;  2JSO A;  2F0E A;  1HA6 A;  4KD3 A;  1WCM B;  4NW2 A;  3SK5 A;  1VCI A;  1DOK A;  2Z8L A;  3K5N A;  1EY0 A;  3RLO A;  2F0W A;  1UE6 A;  2I07 B;  2BH8 A;  4PV1 C;  5I4D A;  3RN2 A;  4MTN A;  1JC7 A;  4PMB A;  1PLF A;  4U68 A;  3L9A X;  1F9Q A;  5EPL A;  4DNI A;  3CCQ A;  2BOS A;  2F0H A;  5C3E G;  2QW7 A;  5C4X H;  4OEL B;  4JI4 L;  3DWP A;  3NE5 B;  2XWB B;  1VQC A;  2A68 C;  2RKS A;  3S1N B;  4BBR H;  2A1A A;  1H9R A;  4TVA B;  1UE5 A;  3HOZ G;  2DY7 A;  1EUJ A;  1A8V A;  2WAC A;  2OEO A;  2F0J A;  5KYL A;  4Y7N B;  2XRS D;  2K75 A;  4ZCK A;  1HFN A;  1UE1 A;  4X3T A;  2JJQ A;  3AFP A;  3TP8 A;  2AQ2 B;  4DV0 Q;  5C4X G;  2NZH A;  1RDP D;  1QZG A;  3I4N B;  3GQB A;  4TKO B;  3TP7 A;  3G4S A;  4HJ5 A;  2K03 A;  2JA6 H;  4BBR G;  1NE3 A;  1L2F A;  1XPU A;  5LHY 1;  4OIJ A;  1TKW B;  2ES2 A;  3S17 H;  1M8A A;  5GRO A;  2IX0 A;  3MAQ A;  4BBS G;  1I50 B;  2YV5 A;  1U0L A;  4DR6 L;  5NUC A;  1DON A;  1MKH A;  1LTT D;  2F1M A;  2EYJ A;  3RUZ A;  1WI5 A;  4XQQ A;  5AJ3 L;  2O4X A;  2NYZ D;  2ICE C;  4A3F H;  3G48 A;  4JBJ A;  3TSS A;  4XT3 B;  3M4Q A;  3CMA A;  2VQF L;  1STG A;  3RMH A;  1XYI A;  4CGY B;  1SSO A;  4FDB A;  3M4O B;  1STB A;  4RH6 A;  4WJ4 A;  3VR3 A;  2NVY H;  5FOB B;  1ZYR D;  1I3Q B;  3A56 A;  4HSV A;  4GN4 B;  5ELE A;  4C3I H;  4A3M G;  4HIO A;  1SRU A;  1BF4 A;  3SVM A;  1Q7Y C;  5G3L F;  4AQY L;  1KHI A;  4A3F G;  2K7V A;  1SNC A;  3NTH A;  1R9T B;  3E3X A;  3T4A C;  1PH3 A;  4KLK A;  2WAQ B;  3JAM E;  1K3R A;  3NEM A;  2O2L D;  2Z6B A;  2C35 B;  3TP6 A;  2JYO A;  2X6L A;  1AH9 A;  1I4H A;  1VQ6 A;  3VR4 A;  1E7Z A;  4RMF A;  1PRT F;  4DAM A;  4HMJ A;  4BY7 H;  1OXV A;  2EXD A;  1O78 A;  1II3 A;  3I8Z A;  2VQE L;  2L1B A;  2IHE A;  1FD7 D;  4ZQ3 A;  1IKM A;  1D5M C;  5D65 A;  1NY4 A;  1Y1W B;  2ZM6 Q;  2KEN A;  3CCR A;  1LTI D;  3K58 A;  2PQA A;  4K2L A;  1VQB A;  2F0F A;  3AMU A;  2PI2 E;  4IUQ A;  1WTX A;  3DMU A;  4CKC A;  1IBM Q;  1GUN A;  3STB D;  1SND A;  3ICE A;  2BDO A;  3GV3 A;  2B2V A;  1F2Y A;  4AYB B;  3ULL A;  1DOL A;  1F77 A;  4ZUI A;  5GAH C;  4CDF C;  1HZB A;  2ZJP A;  3GTO B;  1H9S B;  4A3I G;  2KHS A;  4A3K G;  4BY7 G;  2KQ3 A;  3LWE A;  1I4G A;  1XXG A;  2E2I H;  4WOR A;  5EBD A;  2NZO A;  5E4X A;  3NP8 A;  1Z6H A;  2X69 A;  3OWF A;  1VQ7 A;  1GUT A;  1X3Q A;  1EQT A;  1X54 A;  1K83 B;  4S3S A;  1BCP B;  3NXW A;  4B9X A;  4JI2 Q;  2B2V C;  2JA5 B;  1CUK A;  2L4N A;  4FXK C;  5M5X H;  2LXJ A;  1IBK Q;  4X64 Q;  1WTO A;  4DR2 Q;  2B39 A;  4A3E G;  1GD7 A;  1VMC A;  2XTI A;  4LF9 Q;  3CU7 A;  2JA8 B;  1HA5 A;  1TVX A;  3KF6 B;  1JJ2 A;  4A3G H;  3GTP H;  3CHB D;  3GDE A;  4HJA A;  4C56 C;  3DEO A;  2NB0 A;  1JE4 A;  3H0G G;  1ZEQ X;  3K57 A;  2KCM A;  2ID0 A;  4IUR A;  4C3H B;  1LM0 A;  3NTI A;  4L5Q A;  2D9U A;  2RDH A;  3OW7 A;  3FVQ A;  1B7Y B;  2XRQ D;  4RFB A;  4K14 A;  2K5N A;  2OTL A;  1IYJ B;  1N32 Q;  5FKA C;  4X62 Q;  1LLR D;  1SNM A;  1J6Q A;  3SDZ A;  1NR2 A;  1JWU D;  4JOI C;  4A3G G;  1WFQ A;  1JE5 A;  1H9S A;  2YTY A;  3BZK A;  4ZKB B;  4PQX A;  1K3B C;  3RNU A;  4LMQ D;  2C5C A;  2I5H A;  1PZI D;  3S14 B;  2PZT A;  2Z4I A;  1KQS A;  2NVQ H;  4M8A A;  1GHK A;  2A8V A;  3NBI A;  4A3J B;  4FYD A;  1VF7 A;  4JK1 C;  3KF6 A;  3J7A 5;  3P1H A;  3GO5 A;  2E8G A;  1BCP C;  1VQ5 A;  1S40 A;  1BBU A;  4DAP A;  4LUZ A;  4L5S A;  1Q90 A;  1CZW A;  4I65 A;  2ZM6 L;  4CDE C;  3PIO 3;  2K6A A;  3T16 A;  5M3M B;  4LF4 Q;  1B1Z A;  4I7A A;  5JEA H;  3FKI B;  1HQM C;  1NMG A;  1C4Q A;  1G8Z D;  4HCS A;  3I72 A;  1EYC A;  3KF8 A;  4A75 A;  1WTH A;  2A5H A;  1PH4 A;  2CKZ B;  1WTP A;  3OMG A;  1SMY D;  5CV6 A;  3H09 A;  5EJW A;  2E5L L;  5FLM H;  3J81 i;  1X3F A;  3B6Y A;  4R4O A;  1TWA H;  3PO2 B;  3M7G A;  4K5W A;  4X64 L;  3ZYY X;  1VQF A;  4DR3 L;  1V43 A;  4DR2 L;  1EEF D;  5C3W A;  3H94 A;  4LF9 L;  1YNN C;  2WAQ E;  3RR5 A;  5C6A A;  4DPG A;  4DF7 A;  1LT5 D;  4DK0 A;  2QIL A;  2KUM A;  1AP0 A;  4IUP A;  2HHH L;  2EIF A;  1D6E C;  3R93 A;  5FLM G;  1GJX A;  3D31 A;  3CCJ A;  1EYA A;  1VQE A;  5DNF A;  3AB9 A;  4B08 A;  2KCC A;  1SYB A;  1AE2 A;  3M7N A;  1RHP A;  4J1M A;  5I2Y A;  2QGQ A;  3CP0 A;  1VQM A;  2DGY A;  4XT1 B;  4A3L H;  2RHQ B;  1Q12 A;  3HOX G;  1PYS B;  2IW3 A;  1N32 L;  3HOY H;  1QNK A;  5IWA Q;  4X62 L;  4C2M H;  4DAY B;  1P8L A;  3PGZ A;  4FNF A;  4DUZ Q;  4B3S Q;  2AQ1 B;  3ND8 A;  3S2H B;  1A15 A;  2NTT A;  2DY8 A;  3W1B A;  1YNN D;  3F2C A;  1L1O B;  1SJE D;  2LKV A;  4AYB E;  3PUY A;  2A19 A;  1EEI D;  2WFW A;  4JC0 A;  3AFQ A;  1A2U A;  1B9N A;  3H91 A;  3G71 A;  3TP5 A;  1EWI A;  2F52 A;  2B8F A;  4A3L G;  2I5M X;  4P75 A;  1GM5 A;  3J81 L;  2K1B A;  2F0N A;  5KNC A;  2VZA A;  4FF4 A;  1TWG H;  4C3J H;  1YHQ A;  1LYL A;  1HTP A;  1V1Q A;  1O80 A;  1GVP A;  3L2P A;  2VY3 A;  1KDA A;  2AWN A;  5IOD A;  1QOH A;  1A2T A;  1ET6 A;  3GTJ B;  4ZYS A;  4P71 A;  1EQQ A;  3TS0 A;  4A3C G;  2NWG A;  5ISR A;  5IT9 L;  1X3G A;  1B3Q A;  3A54 A;  5M3F B;  4KHV A;  2JA6 B;  4DAY A;  2A69 C;  4JBK A;  1RCV D;  3K8A A;  4HED A;  4IFD G;  4MZ9 A;  1N36 Q;  4P2C B;  1L1O A;  4AH6 A;  5BN3 A;  4LF6 Q;  1BBW A;  5BN4 A;  5HGT A;  1RTN A;  4EX5 A;  3E0J A;  4WJ3 M;  1OXX K;  5IYD G;  4JG2 A;  3CRL C;  4K5X A;  2UUB Q;  4DR4 Q;  1QB5 D;  2JA9 A;  2Y0S G;  4A76 A;  4YIJ A;  4DK6 C;  1F9R A;  4L5T A;  2MHV A;  2NVY B;  4GLX A;  1X6O A;  5FLX L;  5JJL A;  1EZ8 A;  1DZ1 A;  1PH8 A;  1JR0 D;  3G7L A;  1W6J A;  1JOO A;  2RBM A;  3GP7 A;  2B2T A;  1NSN S;  2MO1 A;  5F2D A;  2KCT A;  5ELB A;  3E6Z X;  2G9D A;  3HOV B;  2D62 A;  2YTV A;  1TWC H;  1F2M A;  4LJZ C;  3QWN A;  4DUZ L;  4B3S L;  4HN7 A;  4IZ8 A;  3UDF A;  4HIM A;  1M4V A;  2EVB A;  3NBH B;  3TEH B;  2WAQ G;  3S2D H;  5ELF A;  1R4P B;  5CV4 A;  3LGJ A;  2UUA Q;  2K04 A;  3K6O A;  3CC2 A;  4K8J A;  1F9S A;  2ALY B;  3GTQ B;  1JOK A;  4DXF A;  1BOS A;  2A74 C;  1PVO A;  3BVM A;  4L5R C;  1Q1E A;  4Q0F A;  3ERQ A;  2K01 A;  1JMC A;  1I94 Q;  5FK9 C;  2DUD A;  1ICW A;  4QB4 A;  1HNW Q;  1Y1W G;  3D8G A;  4R9W A;  3P75 A;  2EY5 A;  5IP7 H;  4NKL A;  2XSC A;  2XGT A;  2EE1 A;  3VYU A;  4IOC A;  1PHJ A;  3Q8D A;  1FNU A;  2P5Z X;  2VL6 A;  2EJG C;  3A5Z B;  4P72 A;  4MHE A;  4G7H C;  4JYA Q;  3BDL A;  4DV2 Q;  2R92 B;  5KEE A;  4FO2 A;  1STN A;  4OON A;  5EQ0 A;  2F0Q A;  3JC6 6;  1GUG A;  4DK3 C;  4A3D G;  4UP7 A;  4A4I A;  3HOW H;  3R3O A;  3NBH A;  4JW0 A;  1N36 L;  1XPO A;  1PRT B;  5BN5 A;  2MP1 A;  2JA5 G;  2JA7 H;  1HPC A;  1LTL A;  2Q2U A;  4QMG A;  3FMC A;  4PZ7 A;  2VW9 A;  5IYC H;  3RLF A;  4JVZ A;  1HZ9 A;  2DNC A;  1XPR A;  3IAY A;  3DHQ A;  1SYE A;  1WTR A;  5C3X A;  1SLJ A;  3BZC A;  1PDQ A;  2OWO A;  3CCE A;  2UUB L;  3S1M H;  1H9K A;  4DR4 L;  1L0X B;  1SEB D;  4BS9 A;  3M9B A;  1SYD A;  2BCO A;  3C2P A;  1KDB A;  1EIH A;  1UNS A;  1AZP A;  4KKU A;  4ABN A;  2B3G A;  4A93 B;  1TWF B;  3HOW G;  2I5L X;  5AFW A;  3RZO B;  3CKI B;  4A3B B;  5DEH A;  3OIQ A;  4IUN A;  4RG1 A;  2CW0 C;  4KTA A;  1BDO A;  5C4J H;  1PTO D;  3CC4 A;  1PH9 A;  5IYC G;  4Q5V A;  3GTL B;  1JQY D;  2MJ8 A;  2AUK A;  1BQQ T;  3CCM A;  3P20 A;  1XMQ L;  1NAP A;  2KVM A;  2ASB A;  1Y1V B;  1PFM A;  1T5X D;  1HNZ Q;  5C5L A;  4GZY C;  2E2H B;  1GXD C;  2JXM B;  1Q81 C;  4OO1 H;  5COY A;  5FJ8 H;  5A35 A;  4UP8 A;  1VQ8 A;  4QGU A;  2UUA L;  3GTG H;  4DR6 Q;  5JEA J;  4X65 L;  3PIP 3;  2F0I A;  1HFG A;  5AJ3 Q;  1QWY A;  5EAY A;  3CCV A;  4A3J G;  4YWK A;  1NCV A;  1STE A;  1CQV A;  3S15 H;  3BS1 A;  2PW7 A;  3RN5 A;  5LMU Q;  4B3M Q;  2JP1 A;  2CW0 D;  1CSP A;  2XVS A;  5DAU A;  2XNA C;  2N49 A;  1PRT C;  1I94 L;  3D4R A;  1HNW L;  4L6T B;  3DXJ C;  4KY5 A;  5LL6 X;  1XTC D;  2PZW A;  1QUQ B;  4DK1 A;  2NVT B;  3L3O C;  4OO1 G;  2MUY A;  1ICF B;  1BNZ A;  1I4P A;  3GTM B;  4N8X 1;  4AQY Q;  1CM9 A;  3Q6S A;  1ML0 D;  1RF2 D;  3LNN A;  1V1P B;  2AQ3 B;  2B2W C;  2K33 A;  3BVZ A;  4FF3 A;  4GN3 B;  3HOZ H;  4OWT B;  1DXM A;  4IAL A;  4DGZ A;  1D5X C;  3M85 A;  4QL5 A;  4CDC C;  4JPB W;  1HJP A;  1JWM D;  4JI8 L;  4KJN A;  4JV5 Q;  3ONA B;  1K73 C;  3SR1 A;  3PF5 A;  4PMC A;  2Q8I B;  3EN2 A;  4QIW E;  3HEJ A;  3PO2 G;  4OO1 I;  2NTS A;  1O7L A;  4QJF A;  2HQE A;  2VXW A;  2VQE Q;  4NDX A;  1WJJ A;  2QEX A;  1CA6 A;  1PH1 A;  2VB2 X;  1KIX A;  1N34 Q;  1GUS A;  3E9H A;  1PH2 A;  1IL2 A;  3MXP A;  1S5F D;  4RKL A;  2OT2 A;  1L0Y B;  3H3V C;  3I3C A;  4XQN A;  3U4V A;  3JAM i;  4LK1 C;  4FXG C;  4BBS H;  2IY5 B;  3UDI A;  1OO9 B;  1QUQ A;  3SE0 A;  5JOB A;  3HOY B;  2Q8R E;  3T13 A;  1HTL D;  1V1P A;  1WTQ A;  1G51 A;  2X6G A;  1WTV A;  4OWX B;  1K28 A;  4U67 3;  5FO9 B;  4POG A;  2F0S A;  2A68 D;  2BE5 C;  3GTK H;  2NVX B;  4UDU C;  1G6Z A;  4KD4 A;  1HNZ L;  1SE8 A;  2IJ0 A;  2OTJ A;  2PNR C;  1Q8I A;  2F0M A;  4A3M H;  2K14 A;  1FGB D;  3P7J A;  4TRD A;  3E5S A;  4UPA A;  3OSO A;  4BY1 B;  1JIC A;  1JJG A;  2EDG A;  1RD9 D;  1YIJ A;  3A8I E;  5LMU L;  4B3M L;  1U4P A;  3PO3 G;  3M4P A;  3OOC A;  5KGU A;  4HID A;  2PQA B;  3W5O A;  3T1H Q;  1S5B D;  1Y8N B;  3I4M B;  1ASZ A;  3OTO Q;  4DR5 L;  1OXU A;  4LW1 A;  1VS0 A;  3FHW A;  4CKE A;  2F0P A;  4YCV A;  5I6W A;  2HDM A;  3EBE A;  1QZH A;  1OXT A;  2H1E A;  3PCO B;  1JJC B;  4MTK A;  3QIA A;  4RCN A;  3VYR A;  5M3F G;  3A0J A;  3J7A F;  1WD1 A;  1AEX A;  2HIV A;  3KLW A;  4FP5 D;  4DU9 A;  2K5Q A;  4EQO A;  4GNX A;  1CTM A;  3JAM L;  5I6Y A;  5KIX A;  3RZD H;  4JV5 L;  1XNR L;  1PMR A;  3EFX D;  2F4I A;  4DR7 Q;  2OCE A;  1RKN A;  4EQN A;  3O13 A;  1Q46 A;  3FP9 A;  1PTO H;  1A6X A;  4V19 0;  4JI7 Q;  1H9J A;  1KTK A;  1NTG A;  4A3I H;  4A3K H;  1VQO A;  1IKL A;  2NUC A;  4GS3 A;  4I7Z C;  3S1Q B;  5LMN W;  4IUT A;  3C3L A;  3I56 A;  3U50 C;  1LTG D;  1N34 L;  3MC0 B;  2VNU D;  3NEN A;  5M5W B;  1IZ6 A;  2XN9 C;  5JPN C;  2K5W A;  1D1I A;  2UUC L;  1CHQ D;  1JOR A;  1DCZ A;  4BWG B;  2IL8 A;  4A3E H;  2VUM H;  3NK9 A;  4PG3 A;  2WV6 D;  1O7I A;  5IGB A;  2WP8 J;  4IPC A;  2QDB A;  1FR3 A;  2RDG A;  5E3F A;  3CQZ H;  5CC4 A;  2N55 A;  1KLU D;  1STH A;  3F2B A;  1SAP A;  2EOT A;  3U9S A;  3H0G H;  3SXH A;  3HOV G;  2E5L Q;  3EVQ A;  5C44 B;  1X55 A;  1Y69 U;  2L5T A;  1EY7 A;  1MJC A;  4NXN L;  5LMN Q;  1I4Q A;  2HD3 A;  2AHO B;  4K6L A;  4ZK9 B;  4DR3 Q;  1GKH A;  3K59 A;  5A2Q E;  1YNX A;  4J15 A;  2VUM G;  3T53 B;  4ME5 A;  1Y8O B;  3UDX A;  2VS1 A;  2F0L A;  2QF7 A;  5EPJ A;  3ITP A;  2HHH Q;  3C1F A;  1NJI C;  1QVF A;  3AQQ A;  2SNS A;  1KRS A;  2EY2 A;  4OX9 Q;  1N33 Q;  1D1K A;  3DM1 A;  1LT6 D;  1VQJ A;  4DV5 L;  2R7Z B;  3T1H L;  4L63 B;  3PUW A;  3OTO L;  3TZU A;  3KF8 B;  3KLS A;  1KC8 C;  1DJR D;  3CF5 A;  1I6V C;  2M2L A;  5M5Y H;  2YYZ A;  3I2Z A;  1SDF A;  1EZ6 A;  1LT3 D;  2RCF A;  3EJI A;  4YCU A;  2GN5 A;  3CCU A;  3KJO A;  4IJH A;  3MXN B;  4NXM L;  1Q3L A;  5IE8 A;  1CKM A;  1SFO H;  4LF5 Q;  3TS2 A;  4EGV A;  1A0I A;  3ND9 A;  1F2Z A;  1C8C A;  2B63 B;  1LTR D;  3OIP A;  5JJZ A;  4DR7 L;  1G2T A;  3CAM A;  2CVR A;  5C0X G;  3Q23 A;  4JI7 L;  2QEJ C;  4IQZ A;  2SEB D;  3PIO A;  3KJP A;  2HQL A;  2IPK D;  2EZV A;  1K0S A;  4NP5 A;  2PCF B;  4YHH Q;  2K05 A;  4GKJ Q;  2E2J B;  1TQO A;  1EY4 A;  3S16 B;  1F2L A;  4JI1 L;  5H1S E;  5GAE C;  1I6H H;  1I4R A;  1GHJ A;  4CJ0 B;  4A93 G;  4HMI A;  1EOT A;  3CD6 A;  4DKA C;  4LF8 L;  4A3B G;  4FF2 A;  4QY7 A;  1G91 A;  3KLS X;  4JI0 Q;  3D6C A;  1U9R A;  1X3P A;  2N78 A;  4R8N A;  3HOU H;  3K7A B;  1B3A A;  5IGC A;  3QJY A;  2ZXO A;  1HHV A;  1E1O A;  2ENB A;  3CW2 C;  3DWA A;  2R93 B;  1IXR A;  3MXN A;  1BCP D;  2V1C C;  3KK7 A;  1B4O A;  1RJT A;  5LMN L;  2RVL A;  5J3B A;  1VQH A;  4ILW A;  1E0B A;  3HOX H;  4JI3 L;  1VQ9 A;  4X3U A;  1YVC A;  3NSW A;  3J81 c;  2JN4 A;  1PV4 A;  1J8I A;  3HOU G;  1S5C D;  2DJG C;  2K28 A;  1ZKO A;  2ZTC A;  1XNQ Q;  1WCM H;  4B3R L;  3I4O A;  4CKB A;  2ICI A;  2YU9 B;  3UE1 A;  1SMX A;  5JAV A;  4OX9 L;  2F0G A;  1CKO A;  5C3E B;  5IT9 c;  1N33 L;  1SRO A;  2C9O A;  2JQO A;  5D3D A;  5I2X A;  2CCZ A;  3U9O A;  4P73 A;  4UY8 C;  1ILQ A;  2LY7 A;  3M3Y B;  2F0U A;  4XIG S;  1SJH D;  2KOL A;  3HOZ B;  5CV8 A;  3S1N H;  3BZD B;  4LUO A;  2ATW A;  4H44 C;  1KAA A;  1WCM G;  2AWO A;  2F0D A;  2RF4 A;  3OHX C;  1KXL A;  3OWE B;  4LF5 L;  2L0C A;  1L0W A;  4A3C H;  5C4X B;  1MD2 D;  1GUO A;  3PUV A;  5IOC A;  4N9P A;  5M9O A;  4BBR B;  3I70 A;  1QE6 A;  4RHR A;  3SK6 A;  3I4N H;  3DEP A;  1NBW A;  2A73 B;  4IFD H;  3TN2 A;  1AN8 A;  3C46 A;  3BVG A;  5FLX c;  5DM7 3;  1FGU A;  1OXS C;  1U4R A;  3FDT A;  4K8I A;  3AEV A;  2WII B;  4YHH L;  1F9P A;  4GKJ L;  1AZQ A;  4R4T A;  1V9P A;  4PMW A;  4GOP A;  3WWV A;  1BKB A;  5IGD A;  3I4L A;  5C4H A;  2Q2H A;  3BG3 A;  3DWQ A;  3HKS A;  4UP9 A;  2JK8 A;  5IYD H;  2PPB C;  4DV3 Q;  2LSS A;  4JBM A;  3OMC A;  1O7Y A;  4JI0 L;  3AU7 A;  5KYI A;  3I4N G;  2EYM A;  3EA6 A;  3DLL A;  2EJM A;  1GUW A;  3FPP A;  2ZXR A;  4L8J A;  4O0A A;  1K8G A;  3S17 B;  3M4O H;  3VYT A;  1YIT A;  1J5E Q;  3J7A V;  1MGS A;  3PUX A;  4WFN 3;  1I3Q H;  1XWE A;  1K8M A;  4A3F B;  4GKK L;  1G2S A;  2BA0 A;  1B9M A;  4B9W A;  1SR3 A;  1VMP A;  2E75 C;  1HZA A;  1L1O C;  1ET9 A;  3HFZ B;  2XWJ B;  1BO0 A;  4KI0 A;  3WOE A;  1R9T H;  1EWC A;  4FF1 A;  1ASY A;  4C1N I;  1XNQ L;  4IFD I;  2D5D A;  5IY0 A;  1B8A A;  2A69 D;  3J80 i;  4HJ7 A;  2ZXP A;  1FNV A;  4KKT A;  4JCV E;  3A7L A;  3K5L A;  4C3I B;  3HKZ B;  5C5M A;  5CYU A;  2E76 C;  2F3W A;  2H5X A;  1MI2 A;  1N9W A;  1VQP A;  1VQ4 A;  2UXD Q;  1SYF A;  5IYB H;  3WOF A;  2FMM A;  2F0O A;  3MWY W;  1U4M A;  2HIX A;  3I73 A;  1XMQ Q;  3EQL C;  2A6H C;  1YJW A;  1PFN A;  1Y1W H;  2PW5 A;  4PZ8 A;  5FO7 B;  3KBG A;  1STY A;  3KOJ A;  5C4Z A;  2B2T C;  2H4O A;  4JI6 L;  1BR9 A;  1MIU A;  2IWH A;  2Q2T A;  2J0T D;  4J8Q A;  2KCN A;  4X65 Q;  2EY6 A;  3W3A A;  4NB3 A;  4DNR B;  4WJW A;  2D0O A;  1PFS A;  3UE0 A;  4A3K B;  4BY7 B;  3C1E A;  4KY6 A;  4G4K A;  4UHV A;  2K50 A;  3AYH B;  3M4Y A;  1DGS A;  4RGM A;  5IYB G;  3GTO H;  3NPP A;  2R6G A;  2E74 C;  5KND A;  1B2T A;  4A3D H;  1PZJ D;  1K83 H;  2KEE A;  4DNT B;  4M1U B;  1HXY D;  2JA5 H;  2WKD A;  4A3E B;  5K36 G;  4TSS A;  5HGQ A;  1S4Z A;  3CC7 A;  3NWS A;  4R1J A;  5CBE E;  4AYB G;  1ZXT A;  4DV3 L;  3A8J E;  2E2I B;  4GLV B;  1YNJ C;  2AKW B;  2EYF A;  1P16 A;  3IKJ A;  1S3O A;  3MHB A;  3SK8 A;  4JI8 Q;  2FIN B;  1YJN A;  5EKL A;  4C3H H;  3J80 L;  5M5X B;  1C9O A;  1QCB D;  3CCS A;  4YWM A;  3QR8 A;  3RD4 A;  1JOQ A;  2FMC A;  1J5E L;  1PYB A;  2PMZ B;  1MJE A;  4IJL A;  2B2Y A;  4A3G B;  2B2U A;  1ROD A;  5EKK A;  3GTP B;  5J1Z A;  2CQO A;  2F4V L;  3V05 A;  2EYO A;  2JA8 G;  4HSP A;  1FL0 A;  3N52 A;  2HT1 A;  5JVH 3;  3SHL A;  2MPM A;  3VA7 A;  1LTA D;  1W2B A;  3TQY A;  4C3H G;  3S14 H;  3CRK C;  1E24 A;  2CH4 W;  2MQH A;  5EKI A;  1TY0 A;  4A3J H;  2LXK A;  3N6R A;  4R8I A;  1VQD A;  1Z47 A;  4LFA Q;  2EYH A;  2M9V A;  2UXD L;  1K8O A;  1BBX C;  4NMZ A;  2F0V A;  2BDN A;  1WD0 A;  4F8M A;  3ERO A;  2NVQ B;  1J9O A;  4GN5 A;  1H9M A;  1PYW D;  1GOZ A;  5EPK A;  3FKI H;  4V0B A;  1WOC A;  1Q8K A;  1EYD A;  2EJF C;  1PH5 A;  2KED A;  4ODG A;  3G6J B;  1C0A A;  5GAD C;  2CH4 A;  1KRT A;  5IP9 G;  1PH6 A;  4DR5 Q;  1STA A;  2V4D A;  1CQF A;  2Z4H A;  3V2T A;  5M3M G;  3PO2 H;  2Z6K A;  4BXX H;  2R7F A;  4LAA A;  1SE2 A;  3FKI G;  1SBB B;  1TU2 B;  2NZ1 D;  2F03 A;  1FVI A;  5G3L D;  1CK1 A;  2E2D C;  4N8F A;  2RSN A;  4EVO A;  3I55 A;  3MEF A;  4QUF A;  4RCO A;  1KLG D;  3T51 B;  2CHB D;  1Y14 B;  2F3V A;  3HKZ E;  5CMD A;  4KMU C;  1TWA B;  2M00 A;  2K5V A;  2GVA A;  5DLQ E;  1XNR Q;  2R93 G;  2K32 A;  3W2D A;  1PRT D;  4BXX G;  2VB3 X;  3NHH A;  1MHW C;  4IN3 A;  1ENC A;  5JPM C;  2LS0 1;  1JWS D;  3D0F A;  3ULJ A;  4X3S A;  1PXU A;  1DM0 B;  4DXG A;  3S9W A;  3R8B A;  1I4X A;  3S2H H;  4POF A;  1M90 C;  2UUC Q;  2WIN B;  3FPU B;  1YEZ A;  1MSG A;  1HNX L;  1DYQ A;  4RKB A;  3CCL A;  1A63 A;  1ENA A;  4ID6 A;  4QUC A;  3S1R H;  3F2D A;  4C2M B;  1IYU A;  2PI2 A;  2BH2 A;  3PQI A;  5ELN A;  5E1F A;  2Q2I A;  4LFA L;  3K0Y A;  4ZAI A;  4NXN Q;  3JAM c;  3PO3 H;  2UXC Q;  3SK4 A;  3CXC A;  1X3E A;  5D3I B;  4GNX B;  2JE6 I;  5BR8 Q;  4IFD J;  2G5D A;  1V8Q A;  3NQT A;  3T1Y Q;  2PNH A;  2N3S A;  2J4X A;  5IGG A;  1LO5 D;  2L12 A;  3GTJ H;  4CJ2 C;  4K0K Q;  4B3T Q;  1SNO A;  2I0Q A;  4HAE A;  1TS2 A;  2OQ0 A;  2CQA A;  1PTO F;  5M3F H;  3LWU A;  4YWL A;  5E4W C;  1B53 A;  1NMF A;  1ZYR C;  1TWG B;  4IPD A;  4C3J B;  4DV6 L;  3QB3 A;  2PMZ E;  2FJ2 A;  4DV5 Q;  3TME A;  3D3R A;  1XMO L;  1VQL A;  1PZK D;  3BYY B;  1B70 B;  4OXP A;  1OTC A;  4LWC A;  1GO3 E;  4N9T A;  4LNQ A;  1A3U A;  2BE5 D;  3F2U A;  4RGT A;  1QG7 A;  2Y0S B;  3IFD A;  4KY7 A;  1K9M C;  3R2T A;  1EY5 A;  1EY6 A;  3MEH A;  3MXG A;  2JA6 G;  3X3N A;  2BA1 A;  3K5O A;  4NXM Q;  4DN4 M;  1HZC A;  4CJ1 B;  1HR0 W;  4BA1 I;  2R7D A;  2UXB Q;  3TRE A;  1U5K A;  4IO9 A;  5GAG C;  2EY1 A;  3MFG A;  1JB7 A;  1EL0 A;  1CI3 M;  1RIP A;  1VQI A;  1FJG L;  1EOV A;  4GNX C;  4YY3 Q;  3HOV H;  3SGI A;  2N88 A;  1EU3 A;  1EFI D;  3STB C;  3TBI B;  5HUR A;  1Z9F A;  4JI1 Q;  4C1N K;  4DAV A;  4HR7 B;  1NUC A;  4NPS A;  1EIG A;  4LF8 Q;  5D14 A;  1XTD A;  1HR0 Q;  1Y8P B;  4HCE A;  1YI2 A;  3LX0 A;  3HKZ G;  4C3I G;  3GTQ H;  4H0L C;  3BYT B;  3F8T A;  4J6H A;  4MN3 A;  2I46 A;  1Q1B A;  1UUP A;  4LFB Q;  2F0T A;  1SE4 A;  1TWC B;  4YCW A;  1K8A C;  3BDC A;  2KJX A;  2MGS A;  1MBY A;  1MSH A;  4ZKC B;  3Q0A A;  2RQX A;  2B29 A;  4BA2 I;  3TDQ A;  3S2D B;  2UXC L;  2AMC B;  2Z9H A;  4OGQ C;  5BR8 L;  2XIW A;  3A74 A;  5ELD A;  5HY6 A;  4K6D A;  1TXY A;  1S5D D; 
#chains in the Genus database with same CATH homology
 1QNU A;  2SOB A;  2HCI A;  1DOM A;  1HCZ A;  4CBV A;  5A2Q L;  5T1G A;  1ESR A;  3MTS A;  4A3D B;  4KN4 C;  1HUM A;  5TSS A;  2B8G A;  3X3M A;  2FHT A;  2WB1 B;  1CHP D;  2TMP A;  2F0K A;  5C0X H;  4OL7 A;  1BXT A;  4DA2 A;  3QO2 A;  3HOW B;  4RAU C;  4FXD A;  3H6M A;  1IHZ A;  3NUC A;  2AUJ D;  3HRZ C;  2JA7 B;  5JVG 3;  1KAB A;  2PZU A;  3IFT A;  1TT2 A;  3HP3 A;  4PNY A;  1CFM A;  1FYC A;  5CV5 A;  5CV9 A;  1EQV A;  2OXP A;  1VF5 C;  3S1M B;  1WVL A;  4G7O C;  3A55 A;  2Z1C A;  1E2W A;  1IYV A;  1ENF A;  4X3K A;  5J39 A;  5C4J B;  1SMY C;  4WRD A;  3Q22 A;  5IGF A;  3KLR A;  5C0X I;  4ZLT F;  5K5P A;  4FVM A;  2O5J C;  4UAI A;  4XTC S;  4O1N A;  3V96 A;  3QG1 A;  2LMC B;  2A6E C;  3GTG B;  2IX3 A;  4QF4 A;  3NWT A;  3QOJ A;  2EPB A;  3S15 B;  4EQP A;  3GD7 A;  4ULL A;  3UI2 A;  1AFP A;  4KKS A;  5T1I A;  1RTO A;  1HUN A;  4O42 A;  1UEA B;  1KDC A;  1LTB D;  3TZD A;  5JEA G;  2SNM A;  4KN7 C;  5IIF A;  4TQU S;  3I90 A;  2PYK A;  2A6E D;  2QKI C;  1JB3 A;  1B50 A;  2G9H D;  3BDO A;  3PUZ A;  1CA5 A;  3R2I A;  2HDL A;  2RA4 A;  2L9H A;  1U4L A;  1R4Q B;  1SYG A;  3HG9 A;  3MZ5 A;  1D5Z C;  4KK7 A;  1E2V A;  3VA5 A;  1SE3 A;  2PQE A;  4F87 A;  4ZUJ A;  3URY A;  4RHS A;  5EBC A;  1TR5 A;  3NTK A;  1G29 1;  1IW7 C;  1LTS D;  1AW7 A;  4BBS B;  4E6I A;  3S1R B;  5CR3 A;  1T5E A;  4XYO A;  5CV7 A;  1EY9 A;  2FFK B;  1SNQ A;  3J81 E;  3PO3 B;  1Z7T A;  1A3T A;  3WDN A;  4XYQ A;  3GTK B;  4ZRZ A;  3HS0 C;  3VYS A;  4K2K A;  4KJO A;  3SEB A;  4A3M B;  5IT9 E;  1C48 A;  1X32 A;  3PV0 A;  1VDZ A;  4IUU A;  2NN6 H;  1IW7 D;  4KHZ A;  4IUV A;  2L11 A;  2IT1 A;  2R3Z A;  2Q8T A;  2D2C C;  2EYP A;  2OF1 A;  3T56 B;  5I9O A;  3FEW X;  2EYL A;  2EXZ A;  2GA4 B;  3QOL A;  4C3J G;  3MVV A;  5CGK A;  4F7X A;  3GV6 A;  1BCP F;  1W6K A;  2PO4 A;  1KNE A;  1EU4 A;  2NN6 G;  1BUV T;  5I9P A;  4F88 A;  5EGT A;  4JBW A;  2TSS A;  1ILP A;  2DN8 A;  5J22 A;  4XQJ A;  5FLX E;  3RZD B;  1JCK B;  5K36 H;  4OHJ A;  1FNW A;  1PTO B;  4OIK A;  1A3V A;  2WKC A;  5CBA E;  3MFY A;  2KA7 A;  4A3I B;  5COR A;  3Q24 A;  2NN6 I;  4K5V A;  4QIW B;  3I91 A;  2J7Z A;  3J7Y W;  4HTH A;  4CHT B;  3A7A B;  1CZG A;  2HCC A;  2JEA I;  1LAB A;  4RA8 A;  2VUM B;  2A6H D;  4XDX A;  3K5M A;  3MA2 B;  3CQZ B;  2L55 A;  1O7Z A;  1CT1 D;  3H0G B;  3VR5 A;  3D4W A;  3A8K E;  1D2B A;  3MXU A;  1ONL A;  1HRJ A;  5LL6 S;  2RSO A;  2IX1 A;  1TY2 A;  3HZX A;  4RWS C;  2HUG A;  1SYC A;  4RGO S;  2QCP X;  5KNB A;  5C0X J;  3VR2 A;  2KEC A;  3J80 E;  1PFB A;  1PTO C;  2B2Y C;  1YNJ D;  2B2U C;  1DD2 A;  4RGN A;  3D4D A;  5DM6 3;  1TS3 A;  3DUZ A;  4MIU A;  1XX8 A;  1QJO A;  5M5Y B;  3KUP A;  1KNA A;  1LAC A;  2JEB I;  3KBX A;  1LV9 A;  1SXT A;  1TS4 A;  3VR6 A;  3HGB A;  1SFO B;  4G57 A;  5IGE A;  3IL8 A;  2DNE A;  1TS5 A;  3PMF A;  5KRU A;  1EWH A;  1SNP A;  2ZT9 C;  4DFA A;  4KV6 A;  4H7B A;  3D6W A;  1UAP A;  2SDF A;  3NQI A;  3L7Z C;  1I6H B;  1HQR D;  5ELC A;  1S5E D;  1LT4 D;  1QIL A;  1V1O A;  1TWH B;  2RDF A;  1ESF A;  2K5D A;  2R61 A;  4QCL A;  1B44 D;  3HOU B;  1TII D;  2B2W A;  3OPO A;  1IL8 A;  4G7Z C;  2NBF A;  4Z9C B;  1EY8 A;  1WTW A;  1E2Z A;  1NR4 A;  5FO8 B;  3HOX B;  3FRP B;  4XXE A;  2O5I C;  4H13 C;  2LFN A;  2JSO A;  2F0E A;  1HA6 A;  4KD3 A;  1WCM B;  4NW2 A;  3SK5 A;  1VCI A;  1DOK A;  2Z8L A;  3K5N A;  1EY0 A;  2F0W A;  2I07 B;  4PV1 C;  5I4D A;  1JC7 A;  4PMB A;  1PLF A;  4U68 A;  3L9A X;  1F9Q A;  5EPL A;  2BOS A;  2F0H A;  3DWP A;  3NE5 B;  2XWB B;  2A68 C;  2RKS A;  3S1N B;  1H9R A;  2DY7 A;  2WAC A;  2OEO A;  2F0J A;  5KYL A;  4Y7N B;  2XRS D;  1HFN A;  4X3T A;  3TP8 A;  2AQ2 B;  1RDP D;  3I4N B;  3GQB A;  4TKO B;  3TP7 A;  2K03 A;  5LHY 1;  4OIJ A;  1TKW B;  1M8A A;  2IX0 A;  3MAQ A;  1I50 B;  5NUC A;  1DON A;  1LTT D;  2F1M A;  2EYJ A;  3RUZ A;  4XQQ A;  2O4X A;  2NYZ D;  2ICE C;  3TSS A;  4XT3 B;  1STG A;  3RMH A;  1XYI A;  4CGY B;  1SSO A;  3M4O B;  1STB A;  4RH6 A;  3VR3 A;  5FOB B;  1ZYR D;  1I3Q B;  3A56 A;  4HSV A;  5ELE A;  1BF4 A;  3SVM A;  5G3L F;  2K7V A;  1SNC A;  3NTH A;  1R9T B;  3T4A C;  2WAQ B;  3JAM E;  2O2L D;  3TP6 A;  2JYO A;  2X6L A;  1I4H A;  3VR4 A;  1PRT F;  4HMJ A;  1OXV A;  1O78 A;  1II3 A;  3I8Z A;  2L1B A;  1IKM A;  1FD7 D;  4ZQ3 A;  1D5M C;  5D65 A;  1Y1W B;  1LTI D;  3K58 A;  4K2L A;  2F0F A;  3AMU A;  4IUQ A;  1WTX A;  3DMU A;  4CKC A;  1GUN A;  1SND A;  2BDO A;  3GV3 A;  2B2V A;  1F2Y A;  4AYB B;  1DOL A;  1F77 A;  4ZUI A;  3GTO B;  1H9S B;  2KHS A;  2KQ3 A;  3LWE A;  1I4G A;  1XXG A;  4WOR A;  5EBD A;  5E4X A;  3NP8 A;  1Z6H A;  2X69 A;  3OWF A;  1GUT A;  1X3Q A;  1EQT A;  1K83 B;  4S3S A;  1BCP B;  3NXW A;  4B9X A;  2B2V C;  2JA5 B;  2L4N A;  4FXK C;  1WTO A;  2B39 A;  1VMC A;  3CU7 A;  2JA8 B;  1HA5 A;  1TVX A;  3CHB D;  4C56 C;  3DEO A;  2NB0 A;  1JE4 A;  1ZEQ X;  3K57 A;  2ID0 A;  4IUR A;  4C3H B;  3NTI A;  2D9U A;  2RDH A;  3OW7 A;  3FVQ A;  4RFB A;  2XRQ D;  4K14 A;  5FKA C;  1LLR D;  1SNM A;  3SDZ A;  1NR2 A;  1JWU D;  1H9S A;  4ZKB B;  4PQX A;  4LMQ D;  2C5C A;  1PZI D;  3S14 B;  2PZT A;  2Z4I A;  4M8A A;  1GHK A;  3NBI A;  4A3J B;  4FYD A;  1VF7 A;  4JK1 C;  3P1H A;  3GO5 A;  1BCP C;  4DAP A;  1Q90 A;  1CZW A;  4I65 A;  3PIO 3;  2K6A A;  3T16 A;  5M3M B;  1B1Z A;  5JEA H;  3FKI B;  1HQM C;  1C4Q A;  1G8Z D;  4HCS A;  3I72 A;  1EYC A;  3KF8 A;  2A5H A;  1WTP A;  3OMG A;  1SMY D;  5CV6 A;  3H09 A;  5EJW A;  3PO2 B;  3M7G A;  4K5W A;  3ZYY X;  1V43 A;  1EEF D;  5C3W A;  3H94 A;  1YNN C;  5C6A A;  4DF7 A;  1LT5 D;  4DK0 A;  2QIL A;  2KUM A;  1AP0 A;  4IUP A;  1D6E C;  3R93 A;  1GJX A;  3D31 A;  1EYA A;  5DNF A;  3AB9 A;  4B08 A;  2KCC A;  1SYB A;  3M7N A;  1RHP A;  4J1M A;  5I2Y A;  4XT1 B;  1Q12 A;  2IW3 A;  1QNK A;  4FNF A;  2AQ1 B;  3ND8 A;  3S2H B;  1A15 A;  2NTT A;  2DY8 A;  1YNN D;  1SJE D;  2LKV A;  3PUY A;  1EEI D;  1A2U A;  1B9N A;  3H91 A;  3TP5 A;  2B8F A;  3J81 L;  2K1B A;  2F0N A;  5KNC A;  4FF4 A;  1HTP A;  1O80 A;  1KDA A;  2AWN A;  5IOD A;  1QOH A;  1A2T A;  1ET6 A;  3GTJ B;  4ZYS A;  2NWG A;  5ISR A;  5IT9 L;  3A54 A;  5M3F B;  4KHV A;  2JA6 B;  4DAY A;  2A69 C;  1RCV D;  4HED A;  4IFD G;  4P2C B;  5BN3 A;  5BN4 A;  5HGT A;  1RTN A;  3E0J A;  1OXX K;  3CRL C;  4K5X A;  1QB5 D;  4YIJ A;  1F9R A;  2MHV A;  2NVY B;  5FLX L;  1DZ1 A;  1EZ8 A;  1JR0 D;  3G7L A;  1W6J A;  1JOO A;  2RBM A;  3GP7 A;  2B2T A;  1NSN S;  5F2D A;  5ELB A;  3E6Z X;  2G9D A;  3HOV B;  2D62 A;  4LJZ C;  1F2M A;  3QWN A;  4HN7 A;  4IZ8 A;  1M4V A;  2EVB A;  5ELF A;  1R4P B;  5CV4 A;  2K04 A;  3K6O A;  4K8J A;  1F9S A;  3GTQ B;  1JOK A;  4DXF A;  1BOS A;  2A74 C;  3BVM A;  1Q1E A;  4Q0F A;  3ERQ A;  2K01 A;  5FK9 C;  1ICW A;  4QB4 A;  3D8G A;  4R9W A;  3P75 A;  2EY5 A;  4NKL A;  2XSC A;  2EE1 A;  3VYU A;  1FNU A;  2EJG C;  4G7H C;  4MHE A;  3BDL A;  2R92 B;  5KEE A;  4FO2 A;  1STN A;  5EQ0 A;  2F0Q A;  1GUG A;  3R3O A;  3NBH A;  1PRT B;  5BN5 A;  2MP1 A;  1HPC A;  4QMG A;  3FMC A;  3RLF A;  2DNC A;  3IAY A;  3DHQ A;  1SYE A;  1WTR A;  5C3X A;  1PDQ A;  1H9K A;  1L0X B;  1SEB D;  4BS9 A;  1SYD A;  2BCO A;  3C2P A;  1KDB A;  1EIH A;  1UNS A;  1AZP A;  4KKU A;  4ABN A;  4A93 B;  1TWF B;  5AFW A;  3RZO B;  3CKI B;  4A3B B;  5DEH A;  3OIQ A;  4IUN A;  2CW0 C;  4KTA A;  1BDO A;  1PTO D;  4Q5V A;  3GTL B;  1JQY D;  2MJ8 A;  2AUK A;  1BQQ T;  3P20 A;  1NAP A;  2KVM A;  1Y1V B;  1PFM A;  1T5X D;  5C5L A;  4GZY C;  2E2H B;  1GXD C;  2JXM B;  4OO1 H;  5COY A;  5A35 A;  5JEA J;  3PIP 3;  2F0I A;  1HFG A;  1QWY A;  1NCV A;  1STE A;  1CQV A;  3BS1 A;  2PW7 A;  2JP1 A;  2CW0 D;  5DAU A;  2XVS A;  2XNA C;  1PRT C;  3D4R A;  4L6T B;  3DXJ C;  4KY5 A;  5LL6 X;  1XTC D;  2PZW A;  4DK1 A;  2NVT B;  3L3O C;  4OO1 G;  2MUY A;  1BNZ A;  1I4P A;  3GTM B;  1CM9 A;  3Q6S A;  1ML0 D;  1RF2 D;  3LNN A;  1V1P B;  2AQ3 B;  2B2W C;  2K33 A;  3BVZ A;  4FF3 A;  1DXM A;  4IAL A;  4DGZ A;  1D5X C;  3M85 A;  1JWM D;  4KJN A;  3ONA B;  3SR1 A;  4PMC A;  2Q8I B;  3HEJ A;  4OO1 I;  2NTS A;  1O7L A;  2HQE A;  2VXW A;  4NDX A;  1CA6 A;  2VB2 X;  1GUS A;  3MXP A;  1S5F D;  4RKL A;  2OT2 A;  1L0Y B;  3H3V C;  3I3C A;  4XQN A;  4LK1 C;  4FXG C;  1OO9 B;  3SE0 A;  5JOB A;  3HOY B;  2Q8R E;  3T13 A;  1HTL D;  1V1P A;  1WTQ A;  2X6G A;  1WTV A;  4U67 3;  5FO9 B;  2F0S A;  2A68 D;  2BE5 C;  2NVX B;  4UDU C;  1G6Z A;  4KD4 A;  2IJ0 A;  2PNR C;  1Q8I A;  2F0M A;  1FGB D;  3P7J A;  4TRD A;  3E5S A;  3OSO A;  4BY1 B;  1JIC A;  2EDG A;  1RD9 D;  3A8I E;  1U4P A;  3OOC A;  5KGU A;  1S5B D;  1Y8N B;  3I4M B;  1OXU A;  4CKE A;  2F0P A;  5I6W A;  2HDM A;  1OXT A;  2H1E A;  3QIA A;  4RCN A;  3VYR A;  3J7A F;  1WD1 A;  1AEX A;  4FP5 D;  4DU9 A;  2K5Q A;  4EQO A;  1CTM A;  3JAM L;  5I6Y A;  5KIX A;  1PMR A;  3EFX D;  2F4I A;  4EQN A;  1RKN A;  3O13 A;  1A6X A;  1PTO H;  4V19 0;  1H9J A;  1KTK A;  1IKL A;  2NUC A;  4I7Z C;  3S1Q B;  4IUT A;  3C3L A;  1LTG D;  3MC0 B;  2VNU D;  5M5W B;  2XN9 C;  5JPN C;  2K5W A;  1D1I A;  1CHQ D;  1JOR A;  1DCZ A;  4BWG B;  2IL8 A;  3NK9 A;  2WV6 D;  5IGB A;  2WP8 J;  2QDB A;  1FR3 A;  2RDG A;  5E3F A;  5CC4 A;  2N55 A;  1KLU D;  1STH A;  1SAP A;  2EOT A;  3U9S A;  3SXH A;  3EVQ A;  5C44 B;  1Y69 U;  2L5T A;  1EY7 A;  1I4Q A;  4K6L A;  4ZK9 B;  3K59 A;  5A2Q E;  3T53 B;  4ME5 A;  1Y8O B;  2F0L A;  2QF7 A;  5EPJ A;  3ITP A;  3C1F A;  2SNS A;  2EY2 A;  1D1K A;  3DM1 A;  1LT6 D;  2R7Z B;  4L63 B;  3PUW A;  3TZU A;  3KLS A;  1DJR D;  1I6V C;  2M2L A;  2YYZ A;  1SDF A;  1EZ6 A;  1LT3 D;  3EJI A;  1Q3L A;  4EGV A;  3ND9 A;  1F2Z A;  1C8C A;  2B63 B;  1LTR D;  3OIP A;  5JJZ A;  1G2T A;  2CVR A;  5C0X G;  3Q23 A;  2QEJ C;  4IQZ A;  2SEB D;  2IPK D;  2EZV A;  4NP5 A;  2PCF B;  2K05 A;  2E2J B;  1TQO A;  1EY4 A;  3S16 B;  1F2L A;  1I4R A;  1GHJ A;  4CJ0 B;  4HMI A;  1EOT A;  4FF2 A;  1G91 A;  3KLS X;  3D6C A;  1U9R A;  1X3P A;  4R8N A;  3K7A B;  1B3A A;  5IGC A;  3QJY A;  2ZXO A;  1HHV A;  2ENB A;  3DWA A;  2R93 B;  3MXN A;  1BCP D;  3KK7 A;  1B4O A;  1RJT A;  2RVL A;  4ILW A;  1E0B A;  4X3U A;  3NSW A;  1J8I A;  1S5C D;  2K28 A;  1ZKO A;  4CKB A;  2ICI A;  2YU9 B;  5JAV A;  2F0G A;  5C3E B;  2C9O A;  5D3D A;  5I2X A;  3U9O A;  1ILQ A;  2LY7 A;  3M3Y B;  2F0U A;  4XIG S;  1SJH D;  2KOL A;  3HOZ B;  5CV8 A;  3BZD B;  4H44 C;  1KAA A;  2AWO A;  2F0D A;  3OHX C;  3OWE B;  2L0C A;  5C4X B;  1MD2 D;  1GUO A;  3PUV A;  5IOC A;  4N9P A;  5M9O A;  4BBR B;  3I70 A;  1QE6 A;  4RHR A;  3SK6 A;  3DEP A;  2A73 B;  4IFD H;  3TN2 A;  1AN8 A;  3C46 A;  3BVG A;  5DM7 3;  1OXS C;  1U4R A;  3FDT A;  4K8I A;  2WII B;  1F9P A;  1AZQ A;  4PMW A;  5IGD A;  3I4L A;  5C4H A;  3BG3 A;  3DWQ A;  2PPB C;  3OMC A;  1O7Y A;  3AU7 A;  5KYI A;  2EYM A;  3EA6 A;  2EJM A;  1GUW A;  3FPP A;  2ZXR A;  4L8J A;  3S17 B;  3VYT A;  3J7A V;  1MGS A;  3PUX A;  4WFN 3;  1XWE A;  1K8M A;  4A3F B;  1G2S A;  2BA0 A;  1B9M A;  4B9W A;  1VMP A;  2E75 C;  1ET9 A;  2XWJ B;  1BO0 A;  4KI0 A;  3WOE A;  1EWC A;  4FF1 A;  4C1N I;  4IFD I;  2D5D A;  2A69 D;  2ZXP A;  1FNV A;  4KKT A;  3K5L A;  3A7L A;  4C3I B;  3HKZ B;  5C5M A;  5CYU A;  2E76 C;  2F3W A;  1MI2 A;  1SYF A;  3WOF A;  2FMM A;  2F0O A;  3MWY W;  1U4M A;  3I73 A;  3EQL C;  2A6H C;  1PFN A;  2PW5 A;  5FO7 B;  3KBG A;  1STY A;  5C4Z A;  2B2T C;  2H4O A;  1BR9 A;  2IWH A;  2J0T D;  4J8Q A;  2KCN A;  2EY6 A;  3W3A A;  4DNR B;  4WJW A;  4A3K B;  4BY7 B;  3C1E A;  4KY6 A;  4G4K A;  3M4Y A;  4RGM A;  3NPP A;  2R6G A;  2E74 C;  5KND A;  1B2T A;  1PZJ D;  2KEE A;  4DNT B;  4M1U B;  1HXY D;  2WKD A;  4A3E B;  5K36 G;  4TSS A;  1S4Z A;  3NWS A;  5CBE E;  1ZXT A;  3A8J E;  2E2I B;  1YNJ C;  2EYF A;  3IKJ A;  3MHB A;  3SK8 A;  2FIN B;  5EKL A;  3J80 L;  5M5X B;  1QCB D;  1JOQ A;  3RD4 A;  2FMC A;  2PMZ B;  2B2Y A;  4A3G B;  2B2U A;  1ROD A;  5EKK A;  3GTP B;  5J1Z A;  3V05 A;  2EYO A;  4HSP A;  3N52 A;  5JVH 3;  3SHL A;  2MPM A;  3VA7 A;  1LTA D;  4C3H G;  3CRK C;  5EKI A;  1TY0 A;  3N6R A;  4R8I A;  1Z47 A;  2EYH A;  2M9V A;  1K8O A;  1BBX C;  4NMZ A;  2F0V A;  2BDN A;  1WD0 A;  4F8M A;  3ERO A;  2NVQ B;  1J9O A;  1H9M A;  1PYW D;  1GOZ A;  5EPK A;  4V0B A;  1EYD A;  2EJF C;  2KED A;  4ODG A;  3G6J B;  1STA A;  2V4D A;  1CQF A;  2Z4H A;  3V2T A;  4LAA A;  1SE2 A;  1SBB B;  1TU2 B;  2NZ1 D;  2F03 A;  5G3L D;  1CK1 A;  2E2D C;  2RSN A;  4EVO A;  4QUF A;  4RCO A;  1KLG D;  3T51 B;  2CHB D;  2F3V A;  5CMD A;  4KMU C;  1TWA B;  2M00 A;  2K32 A;  3W2D A;  1PRT D;  2VB3 X;  3NHH A;  4IN3 A;  1ENC A;  5JPM C;  2LS0 1;  1JWS D;  4X3S A;  1PXU A;  1DM0 B;  4DXG A;  3S9W A;  3R8B A;  1I4X A;  2WIN B;  3FPU B;  1MSG A;  1DYQ A;  4RKB A;  1ENA A;  4ID6 A;  4QUC A;  4C2M B;  1IYU A;  5E1F A;  3K0Y A;  4ZAI A;  3SK4 A;  5D3I B;  2JE6 I;  4IFD J;  1V8Q A;  3NQT A;  2J4X A;  5IGG A;  1LO5 D;  2L12 A;  4CJ2 C;  1SNO A;  4HAE A;  1TS2 A;  2CQA A;  1PTO F;  3LWU A;  5E4W C;  1B53 A;  1ZYR C;  1TWG B;  4C3J B;  3QB3 A;  2FJ2 A;  3TME A;  3D3R A;  1PZK D;  3BYY B;  4N9T A;  1A3U A;  2BE5 D;  3F2U A;  4RGT A;  1QG7 A;  2Y0S B;  3IFD A;  4KY7 A;  3R2T A;  1EY5 A;  1EY6 A;  3MEH A;  3MXG A;  3X3N A;  2BA1 A;  3K5O A;  4DN4 M;  4CJ1 B;  4BA1 I;  2EY1 A;  3MFG A;  1EL0 A;  1CI3 M;  2N88 A;  1EU3 A;  1EFI D;  3TBI B;  5HUR A;  4C1N K;  4DAV A;  4HR7 B;  1NUC A;  1EIG A;  5D14 A;  1Y8P B;  4HCE A;  3LX0 A;  4C3I G;  4H0L C;  3BYT B;  4J6H A;  4MN3 A;  2I46 A;  1Q1B A;  1UUP A;  2F0T A;  1SE4 A;  1TWC B;  3BDC A;  2KJX A;  2MGS A;  1MBY A;  1MSH A;  4ZKC B;  3Q0A A;  2RQX A;  4BA2 I;  3TDQ A;  3S2D B;  4OGQ C;  2XIW A;  5ELD A;  4K6D A;  1S5D D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...