4CDCC

Human dpp1 in complex with (2s)-2-amino-n-((1s)-1-cyano-2-(4- phenylphenyl)ethyl)butanamide
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
68
structure length
68
Chain Sequence
PFNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGTDECAIESIAVAATPIPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords DIPEPTIDYL PEPTIDASE 1 EXCLUSION DOMAIN CHAIN
publication title Cathepsin C Inhibitors: Property Optimization and Identification of a Clinical Candidate.
pubmed doi rcsb
source organism Homo sapiens
total genus 8
structure length 68
sequence length 68
chains with identical sequence F, I, L
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2013-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.170 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Cysteine proteinases. Chain C 4cdcC00
1ICFB 4OELB 4CDCC 1MHWC 4CDEC 4OEMB 4CDDC 4CDFC 2DJGC 2DJFC 1K3BC
chains in the Genus database with same CATH superfamily
1GUGA 4LWCA 2PI2A 1SNCA 2PQAB 1EEFD 3RR5A 2F0EA 2EXZA 4GOPA 4NW2A 1G8ZD 4GKKQ 3HS0C 1KRTA 5CC4A 1C7YA 3GP7A 2A6ED 1OXSC 4KY6A 1IBML 3U58A 4RFBA 1K28A 5M5WB 1CSQA 1KRSA 4KD4A 5D3DA 4IPGA 3NXWA 4F87A 1SYBA 2B39A 2B2WC 4OIJA 4CBVA 2DGYA 4DN4M 1K8MA 1NTGA 1II3A 1E0BA 1M4VA 1KC8C 1VQIA 3KJOA 3K0YA 1CQVA 2HCCA 2JA6B 1HNWQ 5HURA 1KNAA 2KCNA 5BR8Q 3CC7A 5KIXA 3CRLC 5IYCH 3RUZA 3LWUA 4RMFA 4EGVA 4GOPC 1KIXA 4RHSA 2IY5B 2UUAL 3KF8A 3T1HL 4MHEA 2E5LQ 1JJGA 3PO3B 2D62A 1LM0A 2PCFB 5M5XH 3CU7A 3ND8A 3PUZA 4OXPA 3NTHA 3CCLA 5C4XB 3DWQA 2B2TA 1QUQB 1WYDA 3F8TA 1EYAA 4G7HC 3ONAB 3L0OA 5CBEE 4UY8C 3A55A 4JC0A 1E1OA 1IBKQ 4IFDH 3CP0A 5BN3A 4KY5A 2A6EC 3JAMc 2D0PA 4DR4Q 1WI5A 1P16A 1X54A 2CHBD 3VR3A 4BWGB 5C0XJ 4F8MA 2VQFL 4L5QA 3WOEA 2M00A 4R4IA 1YJ9A 4X3KA 3NPPA 1O78A 1V1PA 2JEAI 1CSPA 4HCSA 1STAA 3ZYYX 1F9SA 4KI0A 5JEAG 2AKWB 1MJEA 2XGTA 3LGJA 5GAEC 4KLKA 4DV3Q 4Y7NB 1H9SA 4K8JA 4B3TQ 4A3LH 1BOSA 1T5EA 1W6KA 4GKKL 1BVSA 4P71A 3S17H 5FOBB 4NPSA 3H09A 4QIWE 1SYFA 4DXGA 2NZHA 3DWPA 1YBYA 5IP9H 2EJMA 1I5FA 3DMUA 1B53A 1MI2A 4RA8A 3HOZG 4A3CH 3K5LA 3G6EA 2D2CC 4B9WA 3J80E 4HIDA 2AUJD 3BU2A 2F0KA 2PQEA 3VYUA 2L55A 2M2LA 1HNWL 5IGGA 5BR8L 1C48A 3A5UA 3FPPA 3HOVH 5KNCA 2JYOA 2LXJA 1XWEA 5E3FA 3S2HH 2E5LL 2LKVA 3P20A 5IIFA 3I70A 3I4NH 4HIMA 1CKMA 3STBD 3HFZB 1KHIA 2R7FA 2UUCQ 3R93A 3PSIA 1EY7A 4H02A 4JW0A 4KMUC 1RHPA 5JAVA 2Z6KC 3NE5B 4EQOA 2RCNA 1IBKL 2BDNA 4LFAQ 1PH8A 2KQ3A 3J81j 4DR4L 4CHTB 5DEHA 2VB3X 4A93H 1FJGQ 5NUCA 1BCPD 2NWGA 2EY1A 3F2BA 3X3MA 4P72A 4B3SQ 1E2ZA 3R2IA 1HZCA 3K58A 3BS1A 3FVQA 5C3EG 1A15A 2XSCA 1PH3A 1K83H 4DV3L 3HOUG 4H44C 4B3TL 1YHBA 2OF1A 3A8IE 1ILQA 4F88A 1L0YB 2V4DA 5CMDA 5I9PA 1QZGA 1LTBD 1AE2A 3STBC 1GUOA 2L0CA 4KKUA 3NUCA 1LTID 3KBGA 4MZ9A 4O2DA 3FRPB 2XNAC 5FLXE 1CA5A 5JJKA 3LWEA 1S5FD 3CF5A 5IGEA 2L11A 1B3AA 2RHSB 1HQRD 5EKIA 5AJ3Q 2K01A 4NMZA 4A3BH 2DJGC 2VS1A 1N36Q 3H0GH 2KCTA 4GLAC 2K75A 4DA2A 1L1OA 4IUVA 4BY7B 3GDEA 1VQFA 4MIUA 4A3BB 2R92G 1EY6A 3BVGA 2EXDA 2IX3A 2I07B 4KV6A 1PVOA 3AFQA 2UUCL 4QF4A 4AYBB 4EX5A 4QUFA 1SE3A 5GROA 1PH9A 4OO1H 1ZEQX 3W1BA 4LFAL 1D2BA 1D1KA 2F0UA 3NSWA 1K8OA 2NTTA 1FJGL 4IFDI 1SLJA 3NK9A 3TZDA 3BDCA 2WACA 3CMAA 1UE1A 2VXWA 3C2PA 4RAUC 2NUCA 1PTOB 1RCVD 1TWGH 4UPAA 4KD3A 1IBLQ 2YYZA 4B3SL 4AYBE 3NBHA 3TSSA 2NVYH 3D4WA 1UE7A 2HDLA 3EBEA 4G7OC 1TWGB 2B3GA 4J1MA 1TIID 3H3VI 1GM5A 4DR7Q 4DK3C 2QGQA 2TMPA 2ZJRA 3HEJA 5JVH3 1SN8A 1AZQA 2DY8A 2E2IB 1LUZA 1ESFA 2LSSA 1HA6A 1Q12A 1PFNA 4WJ3M 2KA7A 1X6OA 2RDGA 3HGBA 3UE1A 1NMFA 1PH4A 2N3SA 4DR6Q 1HTPA 2VZAA 1LO5D 2B63H 3TMEA 3RZOH 5AJ3L 1UUPA 1SFOH 1HPCA 4JBJA 4C56C 4A3IB 5ELCA 3SK6A 3RZOB 4NXNQ 5D14A 1LT3D 4C3HH 2F3VA 5EJWA 1SFOB 4KKTA 2PZWA 3OW2A 1E2VA 1FL0A 4IPDA 4CJ2C 1SEBD 3AU7A 2RF4A 1M8AA 2G5DA 2NZOA 4PZ8A 2F0IA 1JE4A 2R3ZA 4DR3Q 1PH7A 1NSNS 1U4LA 4H0LC 3GTGB 2MNAA 1FNWA 2L5TA 4K6DA 1JORA 3OSOA 3SDZA 4CKEA 1OXTA 1KD1C 2AUKA 5M3MH 3FEWX 1K0RA 2JA8G 1S3OA 2YTXA 5I2YA 3TS0A 4A3DG 3WDNA 4A76A 4UP7A 3MHBA 3D3RA 1QZHA 1IBLL 1I4PA 1QE6A 1F9PA 1PRTC 1WCMG 3S1MH 3GTPH 3UDFA 1SE4A 2XTIA 2K5NA 5JEAJ 4B08A 3VYSA 3KLRA 4OL7A 1L0XB 3HZXA 3HOYG 4DR7L 3J81L 2GN5A 1KDBA 3GTPB 5J3BA 2NBFA 1VQ5A 1PRTF 1VQ8A 1IYVA 2RDHA 4ZUIA 2CWAA 1TS5A 4V0BA 3IRBA 2ZTCA 5EPLA 4DR6L 2F0GA 2R93H 1BUVT 5IGFA 2IPKD 2WINB 1Q7YC 1TWCH 3G71A 4KY7A 3R2TA 4FXGC 3U4ZA 1I94Q 1U0LA 4A3FH 1B8AA 3QWNA 4NXNL 2CKZB 4A3MH 3SK5A 2KBNA 1UNSA 2H5XA 3HOWG 1EZ6A 1KTKA 3D0FA 4A3MB 4BS9A 1O7LA 1QVFA 3C3LA 2R7ZH 4DR3L 1NR2A 1XPRA 1XTDA 2L12A 1TS4A 3HKZB 1F9RA 2OCEA 1BCPB 2CVRA 1JE5A 4NDXA 1LTLA 3FP9A 2BA1A 5EKKA 3E3XA 4NXMQ 4H13C 1SROA 3TS2A 5KNDA 1E7ZA 1N8RC 4OO1I 1Q8KA 5IP7G 5EQ0A 5KYLA 2NZ1D 1S72A 4XT1B 1C4QA 2AQ3B 2PMZE 3KBXA 4KTAA 3RLFA 1G91A 1O7ZA 3CCMA 1ZKOA 2P5ZX 2QA4A 1SNQA 3CCEA 1EIHA 2ZT9C 2R7DA 3HKZE 3I72A 5DAUA 1ENFA 1TS3A 1N33Q 2JN4A 3BG3A 5C44G 1DCZA 1AN8A 2A6HC 3K5MA 4IUUA 4R4TA 1D5ZC 2ZXRA 5CV8A 2E2HB 1ESRA 1WCMB 2BE5D 1H9JA 1CI3M 2O5IC 3CCVA 3GTQB 1Y1VH 1EIFA 1LYLA 1IKMA 3I56A 2LXKA 2KVMA 1BKBA 3TEHB 1X65A 1TT2A 2YTYA 1XMOQ 4KN4C 4LUZA 1I94L 5M3FG 4K0KQ 2I5LX 4A3GB 2E75C 3LX0A 4R4CA 3FKIB 3J80L 1IW7D 1DM0B 3A56A 3P75A 4UDUC 5JJLA 5F2DA 2ZM6Q 4J15A 4TRDA 4IURA 4IUTA 2IX0A 4IUQA 4A3EG 1R9TB 5E1FA 2JSOA 1C9OA 1VQEA 4X6AH 4QQBX 3RNUA 1MD2D 2K52A 5IYDH 1EOVA 1EZ8A 3GV3A 2E76C 4X64Q 1U4MA 1I4XA 1XX8A 1LTSD 4OGQC 5ELNA 4NXML 4RWSC 2HCIA 4RGMA 2ID0A 4O42A 3NTKA 1NY4A 4UHVA 1QVCA 1ASZA 3TZUA 1STNA 4OELB 1SR3A 5EAYA 3VDYA 4U68A 2BE5C 4J8QA 4ZCKA 3K7AB 5LL6X 2K5VA 3H3VC 3A0JA 1WTRA 1V8QA 2YU9B 1FVIA 3RD4A 3PF4A 1TWAB 2EPBA 1U4PA 2NVTB 4GS3A 2EVBA 4EVOA 5CV9A 1SRUA 2EYHA 2OT2A 2WB1B 2JA6G 1N33L 1IW7C 3TREA 1RKNA 5ELOA 5IGDA 3CW2C 3P1HA 4N8X1 2YV5A 4TQUS 3PO3G 3Q24A 3S2DH 1B4OA 2WAQB 3DHQA 3SK8A 3E5SA 4ZQ3A 4BBSH 5C4XG 1XMOL 1RDPD 3SE0A 4K0KL 1GUTA 5C4ZA 2HUGA 2ENBA 2WB1E 2IX1A 1U9RA 4HAEA 5FLXL 1A6XA 2EYFA 2ZM6L 3Q0AA 1EU3A 2CQOA 4XIGS 1UAPA 3PIPA 1OTCA 3IL8A 1FR3A 1I3QH 4IFDG 3Q8DA 1IZ6A 3J7YW 2WAQE 1XNQQ 1QOHA 5M3FB 3CC2A 2PO4A 1SMYD 2AWOA 2I5MX 4PMWA 4X64L 4R4OA 2K5HA 1I3QB 4YIJA 2Z1CA 3IKJA 1TR5A 2FFKB 1JJ2A 4A3KB 1STEA 1PZID 2X69A 2X6LA 1LTTD 1F2YA 1T9HA 2B2WA 3M85A 2I0QA 2BDOA 1BXTA 2EOTA 1HQMC 3S1QH 1FGUA 3GV6A 4A3LG 2UXBQ 5KGUA 4KHZA 5FK9C 1Y8NB 4OHJA 5GAGC 1Y1WH 3LNNA 2PPBC 4L5SA 4IPHA 3GD7A 2Q2TA 1VQBA 2EYOA 2KJXA 5IP9G 1EWHA 2F0WA 2Z6BA 1PTOD 2R6GA 3L3OC 4N9TA 4A3CG 1VQOA 1TWHH 3OPOA 4FF4A 4KHVA 1UEAB 1R4PB 4RGOS 1W6JA 4CKBA 2WKDA 4KHPQ 1MGSA 1TQOA 2KHIA 3ULLA 1TWHB 2RA4A 3HOVG 2VUMH 2E2JH 4I65A 2N88A 1SMYC 1TY2A 1IL8A 4XYQA 2Q2UA 5IT9E 1GD7A 1OXVA 4GN3B 3CCRA 2A1AA 3D6WA 1TXYA 4JI4Q 3VR6A 4FF2A 2Z9HA 1PYBA 1MJCA 4JV5Q 3A7LA 1NAPA 1JWSD 4JI0Q 4JI3Q 3HG9A 4ULLA 3T16A 2RQXA 1HNXQ 2F0JA 1EEID 1SNMA 4RKLA 1NNXA 3OWEB 5FO8B 1ILPA 3EN2A 4MNOA 4QL5A 4AH6A 2XVSA 1FD7D 1XNQL 1YZ6A 1PFSA 5M5XB 5HGTA 1C8CA 4A93G 1PTOC 4BY1H 1DOLA 1D8LA 2OTJA 3KF6B 2GVBA 4C2MH 2H4OA 3K8AA 5T1GA 4ME3A 1D5MC 5K36H 1CKOA 1JQYD 1WTQA 3TDQA 2EYJA 3M7GA 2DUDA 3T53B 4C2MB 1HR0Q 1SYDA 3EROA 4DAVA 3QOJA 3VA5A 3Q6SA 1Y14B 3AMUA 2UXBL 2F0LA 2TSSA 2KHJA 5FJ8G 2SDFA 2NN6H 4POGA 1VQMA 3CHBD 1CM9A 4M1UB 4RHRA 1BBWA 1QWYA 4BXXH 3DLLA 4KK7A 3PO2H 1HFGA 3K81C 5IE8A 5JOBA 2JA7H 2IHEA 2VY3A 4BY7G 3FPUB 3BZKA 4KHPL 1PH1A 4LAAA 2EDGA 3G7LA 3NENA 4PG3A 2Y0SB 5EPJA 4GNXB 3E9HA 5JJIA 4A3BG 3S17B 5LL6S 2HT1A 3H0GG 5IGBA 2DJFC 4DR2Q 5J1ZA 2RSNA 1SE2A 2Z6KA 4DPGA 2MO1A 4AYBG 4JI4L 1B9MA 1YITA 3O13A 4DV0Q 1X55A 2V1CC 4JV5L 3NWSA 1K9MC 4JI0L 2RKSA 1PYWD 4JI3L 4DNRB 2EZVA 3PMFA 3PCOB 2F0FA 1H95A 1HNXL 4HMIA 4LNQA 3HOVB 3PQIA 3OIQA 2LMCB 5D3IB 1NR4A 5DM73 1EIYB 3S2HB 1DYQA 2Y0SE 4RCOA 4HIOA 2F3WA 3M9BA 2WKCA 4A75A 1Z7TA 2CQAA 3DEPA 1EFID 4C3IH 3AQQA 3I4NB 3KJPA 2PNRC 4OWXB 3W3AA 1YIJA 3IFDA 2L1BA 4C3IB 3CCSA 1IYUA 1HZ9A 3B6YA 1HNZQ 3S15H 2AQ1B 1DXMA 1HR0L 1UE5A 4DV2Q 2DN8A 4A93B 2F0OA 4JI7Q 1CUKA 3S15B 1HTLD 1HXYD 1RTOA 3EVQA 3CRKC 2BH2A 2B2UA 1TY0A 2RBMA 3AYHB 3TQYA 3GTOH 2N49A 5EBDA 1H9RA 1S4ZA 2NVQH 1RD9D 3D6CA 2Z4IA 5IWAQ 3CXCA 2JE6I 1XMQQ 3QB3A 1KL9A 4A4IA 4DV1Q 1LT5D 3F2DA 2B2VC 1K83B 4A3IG 3S16H 2NVQB 3SK4A 1H9MA 3TN2A 1C0AA 5LMNQ 5JPMC 2UU9Q 2A73B 3V05A 5D65A 3KDFB 3I3CA 4DR2L 3S16B 1LTGD 1YJWA 1O80A 5E4XA 3HOXH 3J7AV 1I4QA 3J7ZC 4FP5D 3NHHA 4HCEA 2YTVA 4DV0L 2F0VA 3PF5A 2B2UC 1OO9B 5C3WA 1CFMA 3C1EA 5EKLA 1CKNB 1VS0A 1LT6D 1ZXTA 2L9HA 2K03A 3H15A 1BCPC 3BDLA 3ERQA 1RF2D 5IODA 3H0GB 4K8IA 2F3IA 1PH5A 1G51A 1I4RA 3JAME 5COYA 2L4NA 2O2LD 2QILA 3HOZH 1BCPF 3IFTA 4IFDJ 1RL2A 1VQLA 1JICA 2N78A 3K80C 2PYKA 3S1NH 1GUWA 1SXTA 1EY0A 2SEBD 1B9NA 1VQ9A 2F0NA 1SE8A 3SR1A 3WWVA 1CA6A 3T56B 2AHOB 4K5XA 2QKIC 1WTVA 3S1NB 3S14H 2JK8A 4G57A 1HNZL 4QMGA 1EOTA 1TU2B 1UWVA 3MEHA 3M7NA 4DV2L 3PGZA 4QY7A 2KUMA 3E9IA 4FF1A 3X3NA 4JI7L 1H9KA 5TSSA 3K59A 5A35A 1XNRQ 4LUOA 1STGA 1L0WA 4PZ7A 1GOZA 4DXFA 5A2QE 1NMGA 1V43A 2F0QA 3CKIB 5IWAL 4PZ6A 1FGBD 2NVYB 5ELFA 1XMQL 4P2CB 4DV1L 1BBXC 3I4OA 5E7NA 1X56A 4YHHQ 4DU9A 4FYDA 3U9OA 2BOSA 2PI2E 5LMNL 1X3QA 2UU9L 1ENCA 1CHPD 2K32A 2QEJC 3KF8B 5IGCA 3OTOQ 3M4OH 4A3MG 4QCLA 3L2PA 4JBKA 2HIVA 2J0TD 2ASBA 1W3SA 4R8IA 1MSHA 1JOKA 2ICIA 5C3EH 3HKZG 1SSOA 2SNMA 3I4MH 3VYTA 2MP1A 2XRSD 2B63B 1KXLA 5K5PA 3TP7A 1NBWA 2R7ZG 1Q1EA 2GVAA 3BZCA 1E2WA 1B2TA 1XJVA 1K8AC 1QJOA 5IYBG 2CCZA 1UEBA 2EE1A 2QF7A 1TWFH 4C3HB 4XQQA 1ONLA 2O5JC 1NUCA 2EQSA 4DFAA 5I4DA 3RZDH 2MGSA 3I4LA 1TWFB 3IAYA 1PV4A 2MUYA 3OWFA 4OWWB 1J9OA 2KHSA 4R1JA 4WFN3 3CC4A 3D4DA 1HA5A 4JVZA 3VR5A 1G6ZA 3Q23A 4RGNA 2K05A 4C3JH 2PW7A 5M3MB 1Q90A 2B8GA 1WTPA 1DZ1A 1H9SB 2RSOA 3MXUA 2R92H 1N9WA 2DNCA 1SJHD 4RH6A 1OXXK 2KECA 4LFBQ 3UDGA 1XNRL 2ZTEA 4GLVB 1S5CD 4DK0A 2WV6D 5FLMG 3S1MB 1PA6A 3GTLH 4K5VA 4DV7Q 3PUYA 1Y1VG 3J81i 3M4YA 3OIPA 4DUYQ 1CZGA 4YHHL 3CQZH 1CK1A 4GN5A 4A3GG 1RJTA 4HJ8A 3FKIG 4ZAIA 3K0XA 3MVVA 4F7XA 3OTOL 2HD3A 4LK1C 2EJGC 4ODGA 4DV6Q 3GQBA 4LW1A 1ML0D 4X3TA 3J7A5 2R93B 3VR4A 4R9WA 1HZAA 2A74C 5M5YH 5CV5A 1TWCB 2F4IA 2PQAA 5IT9L 2F03A 4HR7B 2IHFA 1Q81C 5IYDG 4A3FB 3W5OA 1MIUA 3N6RA 1U5KA 4QGUA 4I7ZC 3W2DA 1MBYA 1IHZA 4L8JA 1WOCA 4BBRH 1EY5A 2FINB 5GADC 2R7ZB 3I91A 4YY3Q 4HEDA 2RCFA 2F52A 2OEOA 1AW7A 1GJXA 2ICEC 2F0HA 1AEXA 1V1QA 2IL8A 3KLSX 5C5MA 4BA1I 1JT8A 2WB1G 4IPCA 1Q8IA 1JOQA 4MTKA 4QB4A 4K2LA 3PIO3 1CQFA 3GTJH 3R3OA 1CT1D 4Q0FA 1VQAA 2MO0A 1W2BA 1VDZA 4ZLTF 3F2UA 4LFBL 1YNXA 4HSPA 4RGTA 4C1NK 3QJYA 3QOLA 4Y52H 2WAQG 1HZBA 4UP8A 1IKLA 2B2YC 1QUQA 5GQOA 1PLFA 4P75A 4DV7L 2OXPA 3C46A 4HN7A 4DUYL 2EY5A 4LUVA 2JA8H 2A68D 3CCQA 2K5DA 2VL6A 2VQEQ 2HIXA 1F2LA 4L5RC 4A3DH 1JC7A 1L1OB 1SNPA 4CDDC 1I50H 1A3VA 2K5QA 1LT4D 3PUVA 3ULJA 4DV6L 1SYEA 3ERSX 1SMXA 1Y1VB 1EY4A 3NBIA 1QVGA 2A19A 3CCJA 3RN5A 4IUNA 3NTIA 1P8LA 3HOYH 3VR2A 2X6GA 3KLWA 3J80i 3PIP3 4A3KG 4APVA 1CHQD 1BBUA 1F77A 1QNKA 5ELEA 4HSVA 1EWCA 2XRQD 1LTRD 3GTMH 4YY3L 1VF5C 2LY7A 4L5TA 3J7AF 1AP0A 1EIGA 5ELBA 4JOIA 3S1RH 3FHWA 4QJFA 3NBHB 3GTMB 3GTKH 2BH8A 1FYCA 2WP8J 2F0DA 4PNYA 1I6HH 3C1FA 2F4VQ 1VQKA 2EYMA 4DAMA 4ILWA 1S5ED 2ZXPA 1I6HB 3VYRA 3V2TA 4GNXC 2A69D 4JI6Q 3MFYA 1DD2A 3BVMA 4JOIC 1KAWA 4YWLA 1VQPA 3A8KE 4LF9Q 4ZUJA 5IP7H 2Q8RE 3I73A 2VQEL 5C0XH 1HFNA 1ET6A 3MWYW 1FNVA 5IYCG 1S40A 1KDCA 1Z9FA 1KNEA 1A2UA 2I46A 3ND9A 5EGTA 3S2DB 5KYIA 1B44D 4BBSB 2UUBQ 3D31A 4DK6C 2K33A 5HY6A 4TSSA 4IJHA 1K8GA 2XN9C 2C5CA 1GVPA 4O0AA 1E1TA 4BY1G 1Y69U 2FHTA 2O4XA 1AZPA 1KABA 1EY9A 2ALYB 1V9PA 2A69C 4PMCA 1MKHA 1A0IA 1QB5D 3JAML 2IT1A 4LF4Q 4EQNA 1KLGD 3BYTB 1LV9A 3MTSA 3JAMi 1F9QA 1PZJD 1F2MA 3AB9A 1JOOA 4L63B 4ABNA 3PUXA 4KN7C 3AEVA 3EJIA 2HQLA 3M4QA 4ZYSA 2F4VL 1PMRA 4XXEA 2Y0SG 4YWMA 1D7QA 2WFWA 4A3EH 4B3RQ 3PO2G 1YVCA 2QDBA 1NCVA 1I6VC 4IOCA 3MC0B 3S1QB 3I7FA 4JI6L 4ZKBB 5C4HA 1Q46A 1Y1WB 1BO0A 4X3UA 1DGSA 2D0OA 4LF9L 5M9OA 2KCMA 3AFPA 4GKJQ 1EY8A 1TVXA 5A2QL 4IUPA 3BZDB 1EQRA 4DAYB 2J4XA 5JVG3 2IJ0A 5M5WH 2VUMB 2E2JB 2QW7A 1LLRD 3I4NG 4WJ4A 3E0JA 3QR8A 1SJED 1PZKD 2UUBL 1JWUD 3Q22A 2KOLA 4K2KA 1KLUD 4O1NA 2JA6H 2OQKA 1AE3A 4HIKA 2FMMA 3EFXD 4C3IG 1SDFA 1T5XD 1DONA 1U4RA 4M8AA 3A74A 4POFA 4YCVA 3PO3H 5CR3A 1YEZA 2K1BA 2B8FA 1ASYA 1ET9A 5C5LA 3MAQA 4PMBA 5FLXc 5C4XH 5IY0A 3ER0A 1NE3A 4LF4L 3E0EA 2EY2A 3EQLC 3NEMA 3QG1A 3H94A 4ALPA 4BY1B 3TP8A 1E3PA 5HGQA 1PTOF 4L6TB 4JI5Q 5FKAC 5KEEA 2NYZD 2GA4B 4N9PA 2UXCQ 5DLQE 3BJUA 4IO9A 2MJ8A 2L15A 4B3RL 2D5DA 2KEDA 4YWKA 2AMCB 4A3JH 1ENAA 1PH6A 2Q2IA 1BR9A 4MN3A 4QIWB 1YI2A 4PV1C 1M90C 3PUWA 3UI2A 2CFMA 1BDOA 4WORA 3U50C 2JEBI 5G3LD 4CGYB 1GO3E 2F0SA 2K7VA 1CTMA 4OWTB 3A7AB 4A3JB 3D4RA 3HOXG 4Y7NH 3NQTA 1PHJA 3OHXC 1D1IA 1K3RA 1KDAA 4GKJL 3H3VH 1A63A 3PO2B 2JA5H 2B2TC 2JA7B 1HH2P 5C0XI 1VMPA 1VQCA 1L2FA 2JA5B 1HJPA 2EIFA 3HRZC 1X9NA 3K7UC 3SVMA 5EBCA 1HRJA 4RKBA 1RIPA 2K4KA 4R4QA 4AQYQ 1JJCB 4JBWA 3A54A 2XIWA 2PNHA 1VMCA 3CPFA 1EQTA 4DK1A 1IYJB 2OTLA 1B50A 4OO1G 1Q3LA 1JB3A 4KJOA 1XPUA 4CDFC 1JR0D 3KFUA 4N8FA 2BCOA 1JCKB 3KUPA 4XYOA 1J5EQ 1ZYRD 4UP9A 1VQ7A 2M9VA 2NB0A 2EYLA 1D6EC 4OEMB 1WTWA 2E74C 1JWMD 3W1GA 2B2VA 3OYYA 4HTHA 3CPWA 3DXJC 4JI5L 1ICWA 4ZKCB 4EQPA 5J22A 1SYCA 2E8GA 2UXCL 3GO5A 5G3LF 4JCVE 2Z0SA 4WRDA 2DY7A 1QCBD 2F0PA 4GZYC 4FVMA 1EYDA 2UXDQ 3OW7A 3N52A 1YNND 4JBMA 3GTOB 4IALA 2B63G 3TRZA 5DNFA 4NKLA 4JG2A 5JPNC 5I2XA 1ZYRC 3I4MG 3RN2A 4HJAA 3NELA 4DGZA 1B3QA 4C3HG 2EJFC 2FJ2A 5JEAH 5FJ8H 5ISRA 3RLNA 3UE0A 4JYAQ 3MEFA 4AQYL 3HOXB 5H1SE 1AH9A 1VCIA 1TS2A 1AFPA 1SYGA 3QO2A 1X3FA 2K14A 4DF7A 5BN4A 4BY7H 5M3MG 1RTNA 2K04A 1J5EL 3MXNB 2EYPA 5DM63 3I8ZA 1ICFB 5C3XA 3NQIA 2QCPX 4C3JG 1HHVA 4Z9CB 1GXDC 4B3MQ 3HOZB 3ITPA 1CZWA 1YNNC 2K6AA 3U9SA 3URYA 2ZTDA 4YCUA 1Y8OB 2QDLA 3FMCA 4B9XA 4KKSA 1QG7A 1VQJA 3R8BA 1VQ4A 5ELDA 3K5NA 1WVLA 1PH2A 4GOPB 1QNUA 4LJZC 1LACA 4EQ5A 4P73A 3S14B 4ID6A 2VW9A 4TKOB 1SNDA 2IWHA 2WIIB 1PTOH 1HR0W 2NN6I 1L1OC 5CBAE 2UXDL 2A8VA 1QILA 3NP8A 2R93G 3A8JE 3K6OA 1VQNA 4ZRZA 2RHQB 3RMHA 3DM1A 2C35B 2MHVA 4H7BA 4IN3A 1EQQA 3SXHA 4A3FG 2E2IH 2FXQA 3PV0A 4RCNA 1PFBA 2G9HD 3M4OB 5EPKA 4JYAL 2KCCA 4XDXA 3HOUH 4C1NI 5LMUQ 4DNIA 4LF8Q 4IOAA 1EUJA 5C3EB 2LFNA 2Z4HA 3G6JB 3T1YQ 1MHWC 4ME5A 4BBRG 4CJ1B 4LF6Q 3I4MB 3CCUA 4FO2A 2ZXOA 4P74A 4LF5Q 4A3IH 3WOFA 3HOUB 5KRUA 1XPOA 1JB7A 3JC66 1GUSA 1PRTD 5AFWA 3ICEA 1KAAA 4IZ8A 1VQ6A 1N36L 1J8IA 2AQ2B 2F1MA 4LFCQ 5CV4A 2PZTA 1X32A 1Z47A 1J6QA 3DUZA 4WJWA 5GAHC 4IJLA 4DUZQ 3M3YH 2SOBA 4B3ML 3RZDB 1V1PB 3U4VA 1YJNA 2DNEA 3GTGH 2SNSA 5FO7B 1EL0A 1WD1A 3M3YB 2JQOA 2N8NA 4JI1Q 5FO9B 3EIVA 4TVAB 1GHJA 3DEOA 1B7YB 5I6YA 5CV7A 3TP5A 3M4PA 4C3JB 2J7ZA 5CV6A 1HCZA 2R61A 1XTCD 2FMCA 2R92B 4UAIA 5C6AA 4E6IA 2ATWA 2N55A 3E6ZX 4K14A 4DR1Q 2K50A 1WTXA 3KOJA 1O7YA 3GTLB 1S5DD 3DWAA 1PDQA 5L37A 1YHAA 4XQNA 3NWTA 1EU4A 3CQZB 1JMCA 3D8GA 4NP5A 3TBIB 1B1ZA 1V1OA 1D5XC 1DJRD 2RDFA 3CAMA 4FDBA 4HJ5A 1A2TA 5LMNW 1EWIA 1G2TA 2XWBB 2Q8IB 4X62Q 1EYCA 4DR5Q 5E4WC 3BDOA 5CGKA 4X66Q 5LMUL 4LF8L 4PQXA 3T1YL 4LF6L 2B29A 5M5YB 4LF5L 5J39A 1PYSB 2NTSA 3SHLA 1N34Q 2JP1A 2QEXA 2D9UA 1A3UA 2HHHQ 1K73C 4FXDA 4LFCL 5IOCA 4LMQD 2B2YA 2CW0D 4DUZL 3S24A 3TP6A 4S3SA 4DAYA 2JXMB 5JJZA 4OIKA 2C9OA 2A6HD 4BBRB 1Q86C 4RG1A 1Q82C 3MZ5A 2PMZB 3ZJYC 4JI1L 1SAPA 4JI8Q 4K5WA 5IYBH 2F0TA 3OOCA 1HUMA 3GTJB 1HUNA 2BA0A 2AWNA 3BYYB 1PFMA 4J6HA 2I5HA 4ZK9B 1XYIA 1YNJD 4X65Q 5C0XG 4DV5Q 3CD6A 1VF7A 4DR1L 4JK1C 3KF6A 2K28A 4BBSG 3ULPA 2ZJQA 4DKAC 4OONA 1S5BD 4X3SA 1PXUA 2HQEA 1NJIC 2JJQA 2JA8B 3G4SA 3HP3A 2CW0C 2H1EA 3J81c 2E2HH 2Q8TA 4A3DB 2MQHA 4NB3A 1WCMH 4K6LA 2XWJB 5I9OA 1X3PA 1VQHA 1K0SA 1F2ZA 1I50B 3GTQH 4X62L 4DR5L 3A5ZB 1KQSA 5FLMH 4X66L 1YHQA 2CH4A 4XTCS 1SNOA 1BNZA 2OWOA 2JA9A 2F0MA 2HDMA 2A5HA 1TKWB 2CWPA 3MXPA 5CORA 3HOYB 3H6MA 4A3GH 1N34L 1STHA 2IW3A 3FKIH 4IQZA 1B70B 4FNFA 2HHHL 4FXKC 1WD0A 1K3BC 4GNXA 2OQ0A 4R8NA 2MPMA 1YNJC 3L7ZC 3MFGA 1Z6HA 1R9TH 1VQDA 4HMJA 4JI2Q 1I4HA 3V96A 5IT9c 1FNUA 2VB2X 1LTAD 2MFIA 1N32Q 5LHY1 4QUCA 1GUNA 2A68C 4JPBW 2KEEA 1RODA 2PW5A 1BQQT 1XXGA 4LF7Q 1Y1WG 4JI8L 4CDEC 3S1RB 3RLOA 3HOWH 4G7ZC 1X3EA 4CKCA 3GTKB 3P7JA 1WFQA 3SEBA 1Y8PB 4OX9Q 3K7AH 3S9WA 3HOWB 4HJ7A 3KYHC 3HKSA 4U673 4DV4Q 4AIMA 1EFWA 2YU9H 4X65L 3OMCA 4YCWA 1TWAH 4DV5L 1DOMA 2VUMG 4V190 3PIOA 2NVTH 3BVZA 1O7IA 5KNBA 1X3GA 1E24A 3KK7A 2KENA 3I55A 4XT3B 3T51B 1A8VA 5C4JH 1E22A 1WTOA 3K57A 3F2CA 5I6WA 1GKHA 4CDCC 5BN5A 5C4JB 1G2SA 3K5OA 4MTNA 3KLSA 3F1ZA 4DNTB 1LABA 1PRTB 1IBMQ 1OXUA 4GLXA 2G9DA 3EA6A 1A62A 3UDIA 1BF4A 1R4QB 1EYGA 2PZUA 5C44H 4DAPA 1EQVA 3MA2B 2RVLA 3H91A 3I2ZA 4CJ0B 1IL2A 1VQGA 3I90A 5C44B 4I7AA 4GN4B 1GHKA 5K36G 4BA2I 1SBBB 2ZJPA 4HJ9A 3KDFA 3J80c 2UUAQ 3T1HQ 4JI2L 1A3TA 1UE6A 3QIAA 2NVXH 2CH4W 1N32L 3FDTA 5M3FH 2Q2HA 1IXRA 3SGIA 4LF7L 5CYUA 2NN6G 3MXGA 2NVXB 3OMGA 3T13A 1CKNA 1M1KC 4G4KA 4A3JG 2EY6A 4FF3A 4BXXG 1Q1BA 4A3KH 4Q5VA 1MSGA 1I4GA 1WTHA 2LS01 4OX9L 2JA7G 2K5WA 1STYA 3L9AX 4DV4L 2Z8LA 3UDXA 2E2DC 3VA7A 5T1IA 4A3EB 3MXNA 4XQJA 2JA5G 2VNUD 3J81E 2VQFQ 3DM3A 3T4AC 1DOKA 1G6PA 4KJNA 3CMEA 3G48A 1STBA 2ES2A 1WJJA 1G291
chains in the Genus database with same CATH topology
1ICFB 4OELB 4CDCC 1MHWC 4CDEC 4OEMB 4CDDC 4CDFC 2DJGC 2DJFC 1K3BC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ICF B;  4OEL B;  4CDC C;  1MHW C;  4CDE C;  4OEM B;  4CDD C;  4CDF C;  2DJG C;  2DJF C;  1K3B C; 
#chains in the Genus database with same CATH topology
 1GUG A;  4LWC A;  2PI2 A;  1SNC A;  2PQA B;  1EEF D;  3RR5 A;  2F0E A;  2EXZ A;  4GOP A;  4NW2 A;  1G8Z D;  4GKK Q;  3HS0 C;  1KRT A;  5CC4 A;  1C7Y A;  3GP7 A;  2A6E D;  1OXS C;  4KY6 A;  1IBM L;  3U58 A;  4RFB A;  1K28 A;  5M5W B;  1CSQ A;  1KRS A;  4KD4 A;  5D3D A;  4IPG A;  3NXW A;  4F87 A;  1SYB A;  2B39 A;  2B2W C;  4OIJ A;  4CBV A;  2DGY A;  4DN4 M;  1K8M A;  1NTG A;  1II3 A;  1E0B A;  1M4V A;  1KC8 C;  1VQI A;  3KJO A;  3K0Y A;  1CQV A;  2HCC A;  2JA6 B;  1HNW Q;  5HUR A;  1KNA A;  2KCN A;  5BR8 Q;  3CC7 A;  5KIX A;  3CRL C;  5IYC H;  3RUZ A;  3LWU A;  4RMF A;  4EGV A;  4GOP C;  1KIX A;  4RHS A;  2IY5 B;  2UUA L;  3KF8 A;  3T1H L;  4MHE A;  2E5L Q;  1JJG A;  3PO3 B;  2D62 A;  1LM0 A;  2PCF B;  5M5X H;  3CU7 A;  3ND8 A;  3PUZ A;  4OXP A;  3NTH A;  3CCL A;  5C4X B;  3DWQ A;  2B2T A;  1QUQ B;  1WYD A;  3F8T A;  1EYA A;  4G7H C;  3ONA B;  3L0O A;  5CBE E;  4UY8 C;  3A55 A;  4JC0 A;  1E1O A;  1IBK Q;  4IFD H;  3CP0 A;  5BN3 A;  4KY5 A;  2A6E C;  3JAM c;  2D0P A;  4DR4 Q;  1WI5 A;  1P16 A;  1X54 A;  2CHB D;  3VR3 A;  4BWG B;  5C0X J;  4F8M A;  2VQF L;  4L5Q A;  3WOE A;  2M00 A;  4R4I A;  1YJ9 A;  4X3K A;  3NPP A;  1O78 A;  1V1P A;  2JEA I;  1CSP A;  4HCS A;  1STA A;  3ZYY X;  1F9S A;  4KI0 A;  5JEA G;  2AKW B;  1MJE A;  2XGT A;  3LGJ A;  5GAE C;  4KLK A;  4DV3 Q;  4Y7N B;  1H9S A;  4K8J A;  4B3T Q;  4A3L H;  1BOS A;  1T5E A;  1W6K A;  4GKK L;  1BVS A;  4P71 A;  3S17 H;  5FOB B;  4NPS A;  3H09 A;  4QIW E;  1SYF A;  4DXG A;  2NZH A;  3DWP A;  1YBY A;  5IP9 H;  2EJM A;  1I5F A;  3DMU A;  1B53 A;  1MI2 A;  4RA8 A;  3HOZ G;  4A3C H;  3K5L A;  3G6E A;  2D2C C;  4B9W A;  3J80 E;  4HID A;  2AUJ D;  3BU2 A;  2F0K A;  2PQE A;  3VYU A;  2L55 A;  2M2L A;  1HNW L;  5IGG A;  5BR8 L;  1C48 A;  3A5U A;  3FPP A;  3HOV H;  5KNC A;  2JYO A;  2LXJ A;  1XWE A;  5E3F A;  3S2H H;  2E5L L;  2LKV A;  3P20 A;  5IIF A;  3I70 A;  3I4N H;  4HIM A;  1CKM A;  3STB D;  3HFZ B;  1KHI A;  2R7F A;  2UUC Q;  3R93 A;  3PSI A;  1EY7 A;  4H02 A;  4JW0 A;  4KMU C;  1RHP A;  5JAV A;  2Z6K C;  3NE5 B;  4EQO A;  2RCN A;  1IBK L;  2BDN A;  4LFA Q;  1PH8 A;  2KQ3 A;  3J81 j;  4DR4 L;  4CHT B;  5DEH A;  2VB3 X;  4A93 H;  1FJG Q;  5NUC A;  1BCP D;  2NWG A;  2EY1 A;  3F2B A;  3X3M A;  4P72 A;  4B3S Q;  1E2Z A;  3R2I A;  1HZC A;  3K58 A;  3BS1 A;  3FVQ A;  5C3E G;  1A15 A;  2XSC A;  1PH3 A;  1K83 H;  4DV3 L;  3HOU G;  4H44 C;  4B3T L;  1YHB A;  2OF1 A;  3A8I E;  1ILQ A;  4F88 A;  1L0Y B;  2V4D A;  5CMD A;  5I9P A;  1QZG A;  1LTB D;  1AE2 A;  3STB C;  1GUO A;  2L0C A;  4KKU A;  3NUC A;  1LTI D;  3KBG A;  4MZ9 A;  4O2D A;  3FRP B;  2XNA C;  5FLX E;  1CA5 A;  5JJK A;  3LWE A;  1S5F D;  3CF5 A;  5IGE A;  2L11 A;  1B3A A;  2RHS B;  1HQR D;  5EKI A;  5AJ3 Q;  2K01 A;  4NMZ A;  4A3B H;  2DJG C;  2VS1 A;  1N36 Q;  3H0G H;  2KCT A;  4GLA C;  2K75 A;  4DA2 A;  1L1O A;  4IUV A;  4BY7 B;  3GDE A;  1VQF A;  4MIU A;  4A3B B;  2R92 G;  1EY6 A;  3BVG A;  2EXD A;  2IX3 A;  2I07 B;  4KV6 A;  1PVO A;  3AFQ A;  2UUC L;  4QF4 A;  4AYB B;  4EX5 A;  4QUF A;  1SE3 A;  5GRO A;  1PH9 A;  4OO1 H;  1ZEQ X;  3W1B A;  4LFA L;  1D2B A;  1D1K A;  2F0U A;  3NSW A;  1K8O A;  2NTT A;  1FJG L;  4IFD I;  1SLJ A;  3NK9 A;  3TZD A;  3BDC A;  2WAC A;  3CMA A;  1UE1 A;  2VXW A;  3C2P A;  4RAU C;  2NUC A;  1PTO B;  1RCV D;  1TWG H;  4UPA A;  4KD3 A;  1IBL Q;  2YYZ A;  4B3S L;  4AYB E;  3NBH A;  3TSS A;  2NVY H;  3D4W A;  1UE7 A;  2HDL A;  3EBE A;  4G7O C;  1TWG B;  2B3G A;  4J1M A;  1TII D;  3H3V I;  1GM5 A;  4DR7 Q;  4DK3 C;  2QGQ A;  2TMP A;  2ZJR A;  3HEJ A;  5JVH 3;  1SN8 A;  1AZQ A;  2DY8 A;  2E2I B;  1LUZ A;  1ESF A;  2LSS A;  1HA6 A;  1Q12 A;  1PFN A;  4WJ3 M;  2KA7 A;  1X6O A;  2RDG A;  3HGB A;  3UE1 A;  1NMF A;  1PH4 A;  2N3S A;  4DR6 Q;  1HTP A;  2VZA A;  1LO5 D;  2B63 H;  3TME A;  3RZO H;  5AJ3 L;  1UUP A;  1SFO H;  1HPC A;  4JBJ A;  4C56 C;  4A3I B;  5ELC A;  3SK6 A;  3RZO B;  4NXN Q;  5D14 A;  1LT3 D;  4C3H H;  2F3V A;  5EJW A;  1SFO B;  4KKT A;  2PZW A;  3OW2 A;  1E2V A;  1FL0 A;  4IPD A;  4CJ2 C;  1SEB D;  3AU7 A;  2RF4 A;  1M8A A;  2G5D A;  2NZO A;  4PZ8 A;  2F0I A;  1JE4 A;  2R3Z A;  4DR3 Q;  1PH7 A;  1NSN S;  1U4L A;  4H0L C;  3GTG B;  2MNA A;  1FNW A;  2L5T A;  4K6D A;  1JOR A;  3OSO A;  3SDZ A;  4CKE A;  1OXT A;  1KD1 C;  2AUK A;  5M3M H;  3FEW X;  1K0R A;  2JA8 G;  1S3O A;  2YTX A;  5I2Y A;  3TS0 A;  4A3D G;  3WDN A;  4A76 A;  4UP7 A;  3MHB A;  3D3R A;  1QZH A;  1IBL L;  1I4P A;  1QE6 A;  1F9P A;  1PRT C;  1WCM G;  3S1M H;  3GTP H;  3UDF A;  1SE4 A;  2XTI A;  2K5N A;  5JEA J;  4B08 A;  3VYS A;  3KLR A;  4OL7 A;  1L0X B;  3HZX A;  3HOY G;  4DR7 L;  3J81 L;  2GN5 A;  1KDB A;  3GTP B;  5J3B A;  2NBF A;  1VQ5 A;  1PRT F;  1VQ8 A;  1IYV A;  2RDH A;  4ZUI A;  2CWA A;  1TS5 A;  4V0B A;  3IRB A;  2ZTC A;  5EPL A;  4DR6 L;  2F0G A;  2R93 H;  1BUV T;  5IGF A;  2IPK D;  2WIN B;  1Q7Y C;  1TWC H;  3G71 A;  4KY7 A;  3R2T A;  4FXG C;  3U4Z A;  1I94 Q;  1U0L A;  4A3F H;  1B8A A;  3QWN A;  4NXN L;  2CKZ B;  4A3M H;  3SK5 A;  2KBN A;  1UNS A;  2H5X A;  3HOW G;  1EZ6 A;  1KTK A;  3D0F A;  4A3M B;  4BS9 A;  1O7L A;  1QVF A;  3C3L A;  2R7Z H;  4DR3 L;  1NR2 A;  1XPR A;  1XTD A;  2L12 A;  1TS4 A;  3HKZ B;  1F9R A;  2OCE A;  1BCP B;  2CVR A;  1JE5 A;  4NDX A;  1LTL A;  3FP9 A;  2BA1 A;  5EKK A;  3E3X A;  4NXM Q;  4H13 C;  1SRO A;  3TS2 A;  5KND A;  1E7Z A;  1N8R C;  4OO1 I;  1Q8K A;  5IP7 G;  5EQ0 A;  5KYL A;  2NZ1 D;  1S72 A;  4XT1 B;  1C4Q A;  2AQ3 B;  2PMZ E;  3KBX A;  4KTA A;  3RLF A;  1G91 A;  1O7Z A;  3CCM A;  1ZKO A;  2P5Z X;  2QA4 A;  1SNQ A;  3CCE A;  1EIH A;  2ZT9 C;  2R7D A;  3HKZ E;  3I72 A;  5DAU A;  1ENF A;  1TS3 A;  1N33 Q;  2JN4 A;  3BG3 A;  5C44 G;  1DCZ A;  1AN8 A;  2A6H C;  3K5M A;  4IUU A;  4R4T A;  1D5Z C;  2ZXR A;  5CV8 A;  2E2H B;  1ESR A;  1WCM B;  2BE5 D;  1H9J A;  1CI3 M;  2O5I C;  3CCV A;  3GTQ B;  1Y1V H;  1EIF A;  1LYL A;  1IKM A;  3I56 A;  2LXK A;  2KVM A;  1BKB A;  3TEH B;  1X65 A;  1TT2 A;  2YTY A;  1XMO Q;  4KN4 C;  4LUZ A;  1I94 L;  5M3F G;  4K0K Q;  2I5L X;  4A3G B;  2E75 C;  3LX0 A;  4R4C A;  3FKI B;  3J80 L;  1IW7 D;  1DM0 B;  3A56 A;  3P75 A;  4UDU C;  5JJL A;  5F2D A;  2ZM6 Q;  4J15 A;  4TRD A;  4IUR A;  4IUT A;  2IX0 A;  4IUQ A;  4A3E G;  1R9T B;  5E1F A;  2JSO A;  1C9O A;  1VQE A;  4X6A H;  4QQB X;  3RNU A;  1MD2 D;  2K52 A;  5IYD H;  1EOV A;  1EZ8 A;  3GV3 A;  2E76 C;  4X64 Q;  1U4M A;  1I4X A;  1XX8 A;  1LTS D;  4OGQ C;  5ELN A;  4NXM L;  4RWS C;  2HCI A;  4RGM A;  2ID0 A;  4O42 A;  3NTK A;  1NY4 A;  4UHV A;  1QVC A;  1ASZ A;  3TZU A;  1STN A;  4OEL B;  1SR3 A;  5EAY A;  3VDY A;  4U68 A;  2BE5 C;  4J8Q A;  4ZCK A;  3K7A B;  5LL6 X;  2K5V A;  3H3V C;  3A0J A;  1WTR A;  1V8Q A;  2YU9 B;  1FVI A;  3RD4 A;  3PF4 A;  1TWA B;  2EPB A;  1U4P A;  2NVT B;  4GS3 A;  2EVB A;  4EVO A;  5CV9 A;  1SRU A;  2EYH A;  2OT2 A;  2WB1 B;  2JA6 G;  1N33 L;  1IW7 C;  3TRE A;  1RKN A;  5ELO A;  5IGD A;  3CW2 C;  3P1H A;  4N8X 1;  2YV5 A;  4TQU S;  3PO3 G;  3Q24 A;  3S2D H;  1B4O A;  2WAQ B;  3DHQ A;  3SK8 A;  3E5S A;  4ZQ3 A;  4BBS H;  5C4X G;  1XMO L;  1RDP D;  3SE0 A;  4K0K L;  1GUT A;  5C4Z A;  2HUG A;  2ENB A;  2WB1 E;  2IX1 A;  1U9R A;  4HAE A;  5FLX L;  1A6X A;  2EYF A;  2ZM6 L;  3Q0A A;  1EU3 A;  2CQO A;  4XIG S;  1UAP A;  3PIP A;  1OTC A;  3IL8 A;  1FR3 A;  1I3Q H;  4IFD G;  3Q8D A;  1IZ6 A;  3J7Y W;  2WAQ E;  1XNQ Q;  1QOH A;  5M3F B;  3CC2 A;  2PO4 A;  1SMY D;  2AWO A;  2I5M X;  4PMW A;  4X64 L;  4R4O A;  2K5H A;  1I3Q B;  4YIJ A;  2Z1C A;  3IKJ A;  1TR5 A;  2FFK B;  1JJ2 A;  4A3K B;  1STE A;  1PZI D;  2X69 A;  2X6L A;  1LTT D;  1F2Y A;  1T9H A;  2B2W A;  3M85 A;  2I0Q A;  2BDO A;  1BXT A;  2EOT A;  1HQM C;  3S1Q H;  1FGU A;  3GV6 A;  4A3L G;  2UXB Q;  5KGU A;  4KHZ A;  5FK9 C;  1Y8N B;  4OHJ A;  5GAG C;  1Y1W H;  3LNN A;  2PPB C;  4L5S A;  4IPH A;  3GD7 A;  2Q2T A;  1VQB A;  2EYO A;  2KJX A;  5IP9 G;  1EWH A;  2F0W A;  2Z6B A;  1PTO D;  2R6G A;  3L3O C;  4N9T A;  4A3C G;  1VQO A;  1TWH H;  3OPO A;  4FF4 A;  4KHV A;  1UEA B;  1R4P B;  4RGO S;  1W6J A;  4CKB A;  2WKD A;  4KHP Q;  1MGS A;  1TQO A;  2KHI A;  3ULL A;  1TWH B;  2RA4 A;  3HOV G;  2VUM H;  2E2J H;  4I65 A;  2N88 A;  1SMY C;  1TY2 A;  1IL8 A;  4XYQ A;  2Q2U A;  5IT9 E;  1GD7 A;  1OXV A;  4GN3 B;  3CCR A;  2A1A A;  3D6W A;  1TXY A;  4JI4 Q;  3VR6 A;  4FF2 A;  2Z9H A;  1PYB A;  1MJC A;  4JV5 Q;  3A7L A;  1NAP A;  1JWS D;  4JI0 Q;  4JI3 Q;  3HG9 A;  4ULL A;  3T16 A;  2RQX A;  1HNX Q;  2F0J A;  1EEI D;  1SNM A;  4RKL A;  1NNX A;  3OWE B;  5FO8 B;  1ILP A;  3EN2 A;  4MNO A;  4QL5 A;  4AH6 A;  2XVS A;  1FD7 D;  1XNQ L;  1YZ6 A;  1PFS A;  5M5X B;  5HGT A;  1C8C A;  4A93 G;  1PTO C;  4BY1 H;  1DOL A;  1D8L A;  2OTJ A;  3KF6 B;  2GVB A;  4C2M H;  2H4O A;  3K8A A;  5T1G A;  4ME3 A;  1D5M C;  5K36 H;  1CKO A;  1JQY D;  1WTQ A;  3TDQ A;  2EYJ A;  3M7G A;  2DUD A;  3T53 B;  4C2M B;  1HR0 Q;  1SYD A;  3ERO A;  4DAV A;  3QOJ A;  3VA5 A;  3Q6S A;  1Y14 B;  3AMU A;  2UXB L;  2F0L A;  2TSS A;  2KHJ A;  5FJ8 G;  2SDF A;  2NN6 H;  4POG A;  1VQM A;  3CHB D;  1CM9 A;  4M1U B;  4RHR A;  1BBW A;  1QWY A;  4BXX H;  3DLL A;  4KK7 A;  3PO2 H;  1HFG A;  3K81 C;  5IE8 A;  5JOB A;  2JA7 H;  2IHE A;  2VY3 A;  4BY7 G;  3FPU B;  3BZK A;  4KHP L;  1PH1 A;  4LAA A;  2EDG A;  3G7L A;  3NEN A;  4PG3 A;  2Y0S B;  5EPJ A;  4GNX B;  3E9H A;  5JJI A;  4A3B G;  3S17 B;  5LL6 S;  2HT1 A;  3H0G G;  5IGB A;  2DJF C;  4DR2 Q;  5J1Z A;  2RSN A;  1SE2 A;  2Z6K A;  4DPG A;  2MO1 A;  4AYB G;  4JI4 L;  1B9M A;  1YIT A;  3O13 A;  4DV0 Q;  1X55 A;  2V1C C;  4JV5 L;  3NWS A;  1K9M C;  4JI0 L;  2RKS A;  1PYW D;  4JI3 L;  4DNR B;  2EZV A;  3PMF A;  3PCO B;  2F0F A;  1H95 A;  1HNX L;  4HMI A;  4LNQ A;  3HOV B;  3PQI A;  3OIQ A;  2LMC B;  5D3I B;  1NR4 A;  5DM7 3;  1EIY B;  3S2H B;  1DYQ A;  2Y0S E;  4RCO A;  4HIO A;  2F3W A;  3M9B A;  2WKC A;  4A75 A;  1Z7T A;  2CQA A;  3DEP A;  1EFI D;  4C3I H;  3AQQ A;  3I4N B;  3KJP A;  2PNR C;  4OWX B;  3W3A A;  1YIJ A;  3IFD A;  2L1B A;  4C3I B;  3CCS A;  1IYU A;  1HZ9 A;  3B6Y A;  1HNZ Q;  3S15 H;  2AQ1 B;  1DXM A;  1HR0 L;  1UE5 A;  4DV2 Q;  2DN8 A;  4A93 B;  2F0O A;  4JI7 Q;  1CUK A;  3S15 B;  1HTL D;  1HXY D;  1RTO A;  3EVQ A;  3CRK C;  2BH2 A;  2B2U A;  1TY0 A;  2RBM A;  3AYH B;  3TQY A;  3GTO H;  2N49 A;  5EBD A;  1H9R A;  1S4Z A;  2NVQ H;  1RD9 D;  3D6C A;  2Z4I A;  5IWA Q;  3CXC A;  2JE6 I;  1XMQ Q;  3QB3 A;  1KL9 A;  4A4I A;  4DV1 Q;  1LT5 D;  3F2D A;  2B2V C;  1K83 B;  4A3I G;  3S16 H;  2NVQ B;  3SK4 A;  1H9M A;  3TN2 A;  1C0A A;  5LMN Q;  5JPM C;  2UU9 Q;  2A73 B;  3V05 A;  5D65 A;  3KDF B;  3I3C A;  4DR2 L;  3S16 B;  1LTG D;  1YJW A;  1O80 A;  5E4X A;  3HOX H;  3J7A V;  1I4Q A;  3J7Z C;  4FP5 D;  3NHH A;  4HCE A;  2YTV A;  4DV0 L;  2F0V A;  3PF5 A;  2B2U C;  1OO9 B;  5C3W A;  1CFM A;  3C1E A;  5EKL A;  1CKN B;  1VS0 A;  1LT6 D;  1ZXT A;  2L9H A;  2K03 A;  3H15 A;  1BCP C;  3BDL A;  3ERQ A;  1RF2 D;  5IOD A;  3H0G B;  4K8I A;  2F3I A;  1PH5 A;  1G51 A;  1I4R A;  3JAM E;  5COY A;  2L4N A;  2O2L D;  2QIL A;  3HOZ H;  1BCP F;  3IFT A;  4IFD J;  1RL2 A;  1VQL A;  1JIC A;  2N78 A;  3K80 C;  2PYK A;  3S1N H;  1GUW A;  1SXT A;  1EY0 A;  2SEB D;  1B9N A;  1VQ9 A;  2F0N A;  1SE8 A;  3SR1 A;  3WWV A;  1CA6 A;  3T56 B;  2AHO B;  4K5X A;  2QKI C;  1WTV A;  3S1N B;  3S14 H;  2JK8 A;  4G57 A;  1HNZ L;  4QMG A;  1EOT A;  1TU2 B;  1UWV A;  3MEH A;  3M7N A;  4DV2 L;  3PGZ A;  4QY7 A;  2KUM A;  3E9I A;  4FF1 A;  3X3N A;  4JI7 L;  1H9K A;  5TSS A;  3K59 A;  5A35 A;  1XNR Q;  4LUO A;  1STG A;  1L0W A;  4PZ7 A;  1GOZ A;  4DXF A;  5A2Q E;  1NMG A;  1V43 A;  2F0Q A;  3CKI B;  5IWA L;  4PZ6 A;  1FGB D;  2NVY B;  5ELF A;  1XMQ L;  4P2C B;  4DV1 L;  1BBX C;  3I4O A;  5E7N A;  1X56 A;  4YHH Q;  4DU9 A;  4FYD A;  3U9O A;  2BOS A;  2PI2 E;  5LMN L;  1X3Q A;  2UU9 L;  1ENC A;  1CHP D;  2K32 A;  2QEJ C;  3KF8 B;  5IGC A;  3OTO Q;  3M4O H;  4A3M G;  4QCL A;  3L2P A;  4JBK A;  2HIV A;  2J0T D;  2ASB A;  1W3S A;  4R8I A;  1MSH A;  1JOK A;  2ICI A;  5C3E H;  3HKZ G;  1SSO A;  2SNM A;  3I4M H;  3VYT A;  2MP1 A;  2XRS D;  2B63 B;  1KXL A;  5K5P A;  3TP7 A;  1NBW A;  2R7Z G;  1Q1E A;  2GVA A;  3BZC A;  1E2W A;  1B2T A;  1XJV A;  1K8A C;  1QJO A;  5IYB G;  2CCZ A;  1UEB A;  2EE1 A;  2QF7 A;  1TWF H;  4C3H B;  4XQQ A;  1ONL A;  2O5J C;  1NUC A;  2EQS A;  4DFA A;  5I4D A;  3RZD H;  2MGS A;  3I4L A;  1TWF B;  3IAY A;  1PV4 A;  2MUY A;  3OWF A;  4OWW B;  1J9O A;  2KHS A;  4R1J A;  4WFN 3;  3CC4 A;  3D4D A;  1HA5 A;  4JVZ A;  3VR5 A;  1G6Z A;  3Q23 A;  4RGN A;  2K05 A;  4C3J H;  2PW7 A;  5M3M B;  1Q90 A;  2B8G A;  1WTP A;  1DZ1 A;  1H9S B;  2RSO A;  3MXU A;  2R92 H;  1N9W A;  2DNC A;  1SJH D;  4RH6 A;  1OXX K;  2KEC A;  4LFB Q;  3UDG A;  1XNR L;  2ZTE A;  4GLV B;  1S5C D;  4DK0 A;  2WV6 D;  5FLM G;  3S1M B;  1PA6 A;  3GTL H;  4K5V A;  4DV7 Q;  3PUY A;  1Y1V G;  3J81 i;  3M4Y A;  3OIP A;  4DUY Q;  1CZG A;  4YHH L;  3CQZ H;  1CK1 A;  4GN5 A;  4A3G G;  1RJT A;  4HJ8 A;  3FKI G;  4ZAI A;  3K0X A;  3MVV A;  4F7X A;  3OTO L;  2HD3 A;  4LK1 C;  2EJG C;  4ODG A;  4DV6 Q;  3GQB A;  4LW1 A;  1ML0 D;  4X3T A;  3J7A 5;  2R93 B;  3VR4 A;  4R9W A;  1HZA A;  2A74 C;  5M5Y H;  5CV5 A;  1TWC B;  2F4I A;  2PQA A;  5IT9 L;  2F03 A;  4HR7 B;  2IHF A;  1Q81 C;  5IYD G;  4A3F B;  3W5O A;  1MIU A;  3N6R A;  1U5K A;  4QGU A;  4I7Z C;  3W2D A;  1MBY A;  1IHZ A;  4L8J A;  1WOC A;  4BBR H;  1EY5 A;  2FIN B;  5GAD C;  2R7Z B;  3I91 A;  4YY3 Q;  4HED A;  2RCF A;  2F52 A;  2OEO A;  1AW7 A;  1GJX A;  2ICE C;  2F0H A;  1AEX A;  1V1Q A;  2IL8 A;  3KLS X;  5C5M A;  4BA1 I;  1JT8 A;  2WB1 G;  4IPC A;  1Q8I A;  1JOQ A;  4MTK A;  4QB4 A;  4K2L A;  3PIO 3;  1CQF A;  3GTJ H;  3R3O A;  1CT1 D;  4Q0F A;  1VQA A;  2MO0 A;  1W2B A;  1VDZ A;  4ZLT F;  3F2U A;  4LFB L;  1YNX A;  4HSP A;  4RGT A;  4C1N K;  3QJY A;  3QOL A;  4Y52 H;  2WAQ G;  1HZB A;  4UP8 A;  1IKL A;  2B2Y C;  1QUQ A;  5GQO A;  1PLF A;  4P75 A;  4DV7 L;  2OXP A;  3C46 A;  4HN7 A;  4DUY L;  2EY5 A;  4LUV A;  2JA8 H;  2A68 D;  3CCQ A;  2K5D A;  2VL6 A;  2VQE Q;  2HIX A;  1F2L A;  4L5R C;  4A3D H;  1JC7 A;  1L1O B;  1SNP A;  4CDD C;  1I50 H;  1A3V A;  2K5Q A;  1LT4 D;  3PUV A;  3ULJ A;  4DV6 L;  1SYE A;  3ERS X;  1SMX A;  1Y1V B;  1EY4 A;  3NBI A;  1QVG A;  2A19 A;  3CCJ A;  3RN5 A;  4IUN A;  3NTI A;  1P8L A;  3HOY H;  3VR2 A;  2X6G A;  3KLW A;  3J80 i;  3PIP 3;  4A3K G;  4APV A;  1CHQ D;  1BBU A;  1F77 A;  1QNK A;  5ELE A;  4HSV A;  1EWC A;  2XRQ D;  1LTR D;  3GTM H;  4YY3 L;  1VF5 C;  2LY7 A;  4L5T A;  3J7A F;  1AP0 A;  1EIG A;  5ELB A;  4JOI A;  3S1R H;  3FHW A;  4QJF A;  3NBH B;  3GTM B;  3GTK H;  2BH8 A;  1FYC A;  2WP8 J;  2F0D A;  4PNY A;  1I6H H;  3C1F A;  2F4V Q;  1VQK A;  2EYM A;  4DAM A;  4ILW A;  1S5E D;  2ZXP A;  1I6H B;  3VYR A;  3V2T A;  4GNX C;  2A69 D;  4JI6 Q;  3MFY A;  1DD2 A;  3BVM A;  4JOI C;  1KAW A;  4YWL A;  1VQP A;  3A8K E;  4LF9 Q;  4ZUJ A;  5IP7 H;  2Q8R E;  3I73 A;  2VQE L;  5C0X H;  1HFN A;  1ET6 A;  3MWY W;  1FNV A;  5IYC G;  1S40 A;  1KDC A;  1Z9F A;  1KNE A;  1A2U A;  2I46 A;  3ND9 A;  5EGT A;  3S2D B;  5KYI A;  1B44 D;  4BBS B;  2UUB Q;  3D31 A;  4DK6 C;  2K33 A;  5HY6 A;  4TSS A;  4IJH A;  1K8G A;  2XN9 C;  2C5C A;  1GVP A;  4O0A A;  1E1T A;  4BY1 G;  1Y69 U;  2FHT A;  2O4X A;  1AZP A;  1KAB A;  1EY9 A;  2ALY B;  1V9P A;  2A69 C;  4PMC A;  1MKH A;  1A0I A;  1QB5 D;  3JAM L;  2IT1 A;  4LF4 Q;  4EQN A;  1KLG D;  3BYT B;  1LV9 A;  3MTS A;  3JAM i;  1F9Q A;  1PZJ D;  1F2M A;  3AB9 A;  1JOO A;  4L63 B;  4ABN A;  3PUX A;  4KN7 C;  3AEV A;  3EJI A;  2HQL A;  3M4Q A;  4ZYS A;  2F4V L;  1PMR A;  4XXE A;  2Y0S G;  4YWM A;  1D7Q A;  2WFW A;  4A3E H;  4B3R Q;  3PO2 G;  1YVC A;  2QDB A;  1NCV A;  1I6V C;  4IOC A;  3MC0 B;  3S1Q B;  3I7F A;  4JI6 L;  4ZKB B;  5C4H A;  1Q46 A;  1Y1W B;  1BO0 A;  4X3U A;  1DGS A;  2D0O A;  4LF9 L;  5M9O A;  2KCM A;  3AFP A;  4GKJ Q;  1EY8 A;  1TVX A;  5A2Q L;  4IUP A;  3BZD B;  1EQR A;  4DAY B;  2J4X A;  5JVG 3;  2IJ0 A;  5M5W H;  2VUM B;  2E2J B;  2QW7 A;  1LLR D;  3I4N G;  4WJ4 A;  3E0J A;  3QR8 A;  1SJE D;  1PZK D;  2UUB L;  1JWU D;  3Q22 A;  2KOL A;  4K2K A;  1KLU D;  4O1N A;  2JA6 H;  2OQK A;  1AE3 A;  4HIK A;  2FMM A;  3EFX D;  4C3I G;  1SDF A;  1T5X D;  1DON A;  1U4R A;  4M8A A;  3A74 A;  4POF A;  4YCV A;  3PO3 H;  5CR3 A;  1YEZ A;  2K1B A;  2B8F A;  1ASY A;  1ET9 A;  5C5L A;  3MAQ A;  4PMB A;  5FLX c;  5C4X H;  5IY0 A;  3ER0 A;  1NE3 A;  4LF4 L;  3E0E A;  2EY2 A;  3EQL C;  3NEM A;  3QG1 A;  3H94 A;  4ALP A;  4BY1 B;  3TP8 A;  1E3P A;  5HGQ A;  1PTO F;  4L6T B;  4JI5 Q;  5FKA C;  5KEE A;  2NYZ D;  2GA4 B;  4N9P A;  2UXC Q;  5DLQ E;  3BJU A;  4IO9 A;  2MJ8 A;  2L15 A;  4B3R L;  2D5D A;  2KED A;  4YWK A;  2AMC B;  4A3J H;  1ENA A;  1PH6 A;  2Q2I A;  1BR9 A;  4MN3 A;  4QIW B;  1YI2 A;  4PV1 C;  1M90 C;  3PUW A;  3UI2 A;  2CFM A;  1BDO A;  4WOR A;  3U50 C;  2JEB I;  5G3L D;  4CGY B;  1GO3 E;  2F0S A;  2K7V A;  1CTM A;  4OWT B;  3A7A B;  4A3J B;  3D4R A;  3HOX G;  4Y7N H;  3NQT A;  1PHJ A;  3OHX C;  1D1I A;  1K3R A;  1KDA A;  4GKJ L;  3H3V H;  1A63 A;  3PO2 B;  2JA5 H;  2B2T C;  2JA7 B;  1HH2 P;  5C0X I;  1VMP A;  1VQC A;  1L2F A;  2JA5 B;  1HJP A;  2EIF A;  3HRZ C;  1X9N A;  3K7U C;  3SVM A;  5EBC A;  1HRJ A;  4RKB A;  1RIP A;  2K4K A;  4R4Q A;  4AQY Q;  1JJC B;  4JBW A;  3A54 A;  2XIW A;  2PNH A;  1VMC A;  3CPF A;  1EQT A;  4DK1 A;  1IYJ B;  2OTL A;  1B50 A;  4OO1 G;  1Q3L A;  1JB3 A;  4KJO A;  1XPU A;  4CDF C;  1JR0 D;  3KFU A;  4N8F A;  2BCO A;  1JCK B;  3KUP A;  4XYO A;  1J5E Q;  1ZYR D;  4UP9 A;  1VQ7 A;  2M9V A;  2NB0 A;  2EYL A;  1D6E C;  4OEM B;  1WTW A;  2E74 C;  1JWM D;  3W1G A;  2B2V A;  3OYY A;  4HTH A;  3CPW A;  3DXJ C;  4JI5 L;  1ICW A;  4ZKC B;  4EQP A;  5J22 A;  1SYC A;  2E8G A;  2UXC L;  3GO5 A;  5G3L F;  4JCV E;  2Z0S A;  4WRD A;  2DY7 A;  1QCB D;  2F0P A;  4GZY C;  4FVM A;  1EYD A;  2UXD Q;  3OW7 A;  3N52 A;  1YNN D;  4JBM A;  3GTO B;  4IAL A;  2B63 G;  3TRZ A;  5DNF A;  4NKL A;  4JG2 A;  5JPN C;  5I2X A;  1ZYR C;  3I4M G;  3RN2 A;  4HJA A;  3NEL A;  4DGZ A;  1B3Q A;  4C3H G;  2EJF C;  2FJ2 A;  5JEA H;  5FJ8 H;  5ISR A;  3RLN A;  3UE0 A;  4JYA Q;  3MEF A;  4AQY L;  3HOX B;  5H1S E;  1AH9 A;  1VCI A;  1TS2 A;  1AFP A;  1SYG A;  3QO2 A;  1X3F A;  2K14 A;  4DF7 A;  5BN4 A;  4BY7 H;  5M3M G;  1RTN A;  2K04 A;  1J5E L;  3MXN B;  2EYP A;  5DM6 3;  3I8Z A;  1ICF B;  5C3X A;  3NQI A;  2QCP X;  4C3J G;  1HHV A;  4Z9C B;  1GXD C;  4B3M Q;  3HOZ B;  3ITP A;  1CZW A;  1YNN C;  2K6A A;  3U9S A;  3URY A;  2ZTD A;  4YCU A;  1Y8O B;  2QDL A;  3FMC A;  4B9X A;  4KKS A;  1QG7 A;  1VQJ A;  3R8B A;  1VQ4 A;  5ELD A;  3K5N A;  1WVL A;  1PH2 A;  4GOP B;  1QNU A;  4LJZ C;  1LAC A;  4EQ5 A;  4P73 A;  3S14 B;  4ID6 A;  2VW9 A;  4TKO B;  1SND A;  2IWH A;  2WII B;  1PTO H;  1HR0 W;  2NN6 I;  1L1O C;  5CBA E;  2UXD L;  2A8V A;  1QIL A;  3NP8 A;  2R93 G;  3A8J E;  3K6O A;  1VQN A;  4ZRZ A;  2RHQ B;  3RMH A;  3DM1 A;  2C35 B;  2MHV A;  4H7B A;  4IN3 A;  1EQQ A;  3SXH A;  4A3F G;  2E2I H;  2FXQ A;  3PV0 A;  4RCN A;  1PFB A;  2G9H D;  3M4O B;  5EPK A;  4JYA L;  2KCC A;  4XDX A;  3HOU H;  4C1N I;  5LMU Q;  4DNI A;  4LF8 Q;  4IOA A;  1EUJ A;  5C3E B;  2LFN A;  2Z4H A;  3G6J B;  3T1Y Q;  1MHW C;  4ME5 A;  4BBR G;  4CJ1 B;  4LF6 Q;  3I4M B;  3CCU A;  4FO2 A;  2ZXO A;  4P74 A;  4LF5 Q;  4A3I H;  3WOF A;  3HOU B;  5KRU A;  1XPO A;  1JB7 A;  3JC6 6;  1GUS A;  1PRT D;  5AFW A;  3ICE A;  1KAA A;  4IZ8 A;  1VQ6 A;  1N36 L;  1J8I A;  2AQ2 B;  2F1M A;  4LFC Q;  5CV4 A;  2PZT A;  1X32 A;  1Z47 A;  1J6Q A;  3DUZ A;  4WJW A;  5GAH C;  4IJL A;  4DUZ Q;  3M3Y H;  2SOB A;  4B3M L;  3RZD B;  1V1P B;  3U4V A;  1YJN A;  2DNE A;  3GTG H;  2SNS A;  5FO7 B;  1EL0 A;  1WD1 A;  3M3Y B;  2JQO A;  2N8N A;  4JI1 Q;  5FO9 B;  3EIV A;  4TVA B;  1GHJ A;  3DEO A;  1B7Y B;  5I6Y A;  5CV7 A;  3TP5 A;  3M4P A;  4C3J B;  2J7Z A;  5CV6 A;  1HCZ A;  2R61 A;  1XTC D;  2FMC A;  2R92 B;  4UAI A;  5C6A A;  4E6I A;  2ATW A;  2N55 A;  3E6Z X;  4K14 A;  4DR1 Q;  2K50 A;  1WTX A;  3KOJ A;  1O7Y A;  3GTL B;  1S5D D;  3DWA A;  1PDQ A;  5L37 A;  1YHA A;  4XQN A;  3NWT A;  1EU4 A;  3CQZ B;  1JMC A;  3D8G A;  4NP5 A;  3TBI B;  1B1Z A;  1V1O A;  1D5X C;  1DJR D;  2RDF A;  3CAM A;  4FDB A;  4HJ5 A;  1A2T A;  5LMN W;  1EWI A;  1G2T A;  2XWB B;  2Q8I B;  4X62 Q;  1EYC A;  4DR5 Q;  5E4W C;  3BDO A;  5CGK A;  4X66 Q;  5LMU L;  4LF8 L;  4PQX A;  3T1Y L;  4LF6 L;  2B29 A;  5M5Y B;  4LF5 L;  5J39 A;  1PYS B;  2NTS A;  3SHL A;  1N34 Q;  2JP1 A;  2QEX A;  2D9U A;  1A3U A;  2HHH Q;  1K73 C;  4FXD A;  4LFC L;  5IOC A;  4LMQ D;  2B2Y A;  2CW0 D;  4DUZ L;  3S24 A;  3TP6 A;  4S3S A;  4DAY A;  2JXM B;  5JJZ A;  4OIK A;  2C9O A;  2A6H D;  4BBR B;  1Q86 C;  4RG1 A;  1Q82 C;  3MZ5 A;  2PMZ B;  3ZJY C;  4JI1 L;  1SAP A;  4JI8 Q;  4K5W A;  5IYB H;  2F0T A;  3OOC A;  1HUM A;  3GTJ B;  1HUN A;  2BA0 A;  2AWN A;  3BYY B;  1PFM A;  4J6H A;  2I5H A;  4ZK9 B;  1XYI A;  1YNJ D;  4X65 Q;  5C0X G;  4DV5 Q;  3CD6 A;  1VF7 A;  4DR1 L;  4JK1 C;  3KF6 A;  2K28 A;  4BBS G;  3ULP A;  2ZJQ A;  4DKA C;  4OON A;  1S5B D;  4X3S A;  1PXU A;  2HQE A;  1NJI C;  2JJQ A;  2JA8 B;  3G4S A;  3HP3 A;  2CW0 C;  2H1E A;  3J81 c;  2E2H H;  2Q8T A;  4A3D B;  2MQH A;  4NB3 A;  1WCM H;  4K6L A;  2XWJ B;  5I9O A;  1X3P A;  1VQH A;  1K0S A;  1F2Z A;  1I50 B;  3GTQ H;  4X62 L;  4DR5 L;  3A5Z B;  1KQS A;  5FLM H;  4X66 L;  1YHQ A;  2CH4 A;  4XTC S;  1SNO A;  1BNZ A;  2OWO A;  2JA9 A;  2F0M A;  2HDM A;  2A5H A;  1TKW B;  2CWP A;  3MXP A;  5COR A;  3HOY B;  3H6M A;  4A3G H;  1N34 L;  1STH A;  2IW3 A;  3FKI H;  4IQZ A;  1B70 B;  4FNF A;  2HHH L;  4FXK C;  1WD0 A;  1K3B C;  4GNX A;  2OQ0 A;  4R8N A;  2MPM A;  1YNJ C;  3L7Z C;  3MFG A;  1Z6H A;  1R9T H;  1VQD A;  4HMJ A;  4JI2 Q;  1I4H A;  3V96 A;  5IT9 c;  1FNU A;  2VB2 X;  1LTA D;  2MFI A;  1N32 Q;  5LHY 1;  4QUC A;  1GUN A;  2A68 C;  4JPB W;  2KEE A;  1ROD A;  2PW5 A;  1BQQ T;  1XXG A;  4LF7 Q;  1Y1W G;  4JI8 L;  4CDE C;  3S1R B;  3RLO A;  3HOW H;  4G7Z C;  1X3E A;  4CKC A;  3GTK B;  3P7J A;  1WFQ A;  3SEB A;  1Y8P B;  4OX9 Q;  3K7A H;  3S9W A;  3HOW B;  4HJ7 A;  3KYH C;  3HKS A;  4U67 3;  4DV4 Q;  4AIM A;  1EFW A;  2YU9 H;  4X65 L;  3OMC A;  4YCW A;  1TWA H;  4DV5 L;  1DOM A;  2VUM G;  4V19 0;  3PIO A;  2NVT H;  3BVZ A;  1O7I A;  5KNB A;  1X3G A;  1E24 A;  3KK7 A;  2KEN A;  3I55 A;  4XT3 B;  3T51 B;  1A8V A;  5C4J H;  1E22 A;  1WTO A;  3K57 A;  3F2C A;  5I6W A;  1GKH A;  4CDC C;  5BN5 A;  5C4J B;  1G2S A;  3K5O A;  4MTN A;  3KLS A;  3F1Z A;  4DNT B;  1LAB A;  1PRT B;  1IBM Q;  1OXU A;  4GLX A;  2G9D A;  3EA6 A;  1A62 A;  3UDI A;  1BF4 A;  1R4Q B;  1EYG A;  2PZU A;  5C44 H;  4DAP A;  1EQV A;  3MA2 B;  2RVL A;  3H91 A;  3I2Z A;  4CJ0 B;  1IL2 A;  1VQG A;  3I90 A;  5C44 B;  4I7A A;  4GN4 B;  1GHK A;  5K36 G;  4BA2 I;  1SBB B;  2ZJP A;  4HJ9 A;  3KDF A;  3J80 c;  2UUA Q;  3T1H Q;  4JI2 L;  1A3T A;  1UE6 A;  3QIA A;  2NVX H;  2CH4 W;  1N32 L;  3FDT A;  5M3F H;  2Q2H A;  1IXR A;  3SGI A;  4LF7 L;  5CYU A;  2NN6 G;  3MXG A;  2NVX B;  3OMG A;  3T13 A;  1CKN A;  1M1K C;  4G4K A;  4A3J G;  2EY6 A;  4FF3 A;  4BXX G;  1Q1B A;  4A3K H;  4Q5V A;  1MSG A;  1I4G A;  1WTH A;  2LS0 1;  4OX9 L;  2JA7 G;  2K5W A;  1STY A;  3L9A X;  4DV4 L;  2Z8L A;  3UDX A;  2E2D C;  3VA7 A;  5T1I A;  4A3E B;  3MXN A;  4XQJ A;  2JA5 G;  2VNU D;  3J81 E;  2VQF Q;  3DM3 A;  3T4A C;  1DOK A;  1G6P A;  4KJN A;  3CME A;  3G48 A;  1STB A;  2ES2 A;  1WJJ A;  1G29 1; 
#chains in the Genus database with same CATH homology
 1ICF B;  4OEL B;  4CDC C;  1MHW C;  4CDE C;  4OEM B;  4CDD C;  4CDF C;  2DJG C;  2DJF C;  1K3B C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...