4CDCC

Human dpp1 in complex with (2s)-2-amino-n-((1s)-1-cyano-2-(4- phenylphenyl)ethyl)butanamide
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
68
structure length
68
Chain Sequence
PFNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGTDECAIESIAVAATPIPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cathepsin C Inhibitors: Property Optimization and Identification of a Clinical Candidate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords DIPEPTIDYL PEPTIDASE 1 EXCLUSION DOMAIN CHAIN
total genus 8
structure length 68
sequence length 68
chains with identical sequence F, I, L
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2013-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.170 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Cysteine proteinases. Chain C 4cdcC00
1ICFB 4OELB 2DJFC 4CDCC 4OEMB 4CDFC 1K3BC 4CDDC 2DJGC 1MHWC 4CDEC
chains in the Genus database with same CATH superfamily
1Z7TA 2F0VA 4DR5L 4KK7A 2HDMA 3GV6A 2PCFB 4DR4L 3PO3G 1EYAA 2R6GA 4DA2A 1VS0A 1EIHA 3NQTA 4YWLA 3RR5A 3VYSA 1TWGB 2ATWA 4AQYL 1GUSA 3J7ZC 1D1IA 1UAPA 3EN2A 2CW0C 2YU9H 2UXDQ 1JOOA 2NVXB 5LL6X 2XRQD 1XJVA 3CPWA 3U58A 5IYCG 5G3LD 4CBVA 3K7UC 3OMGA 5KGUA 2MJ8A 3HKZG 4NPSA 3SVMA 4A75A 4JI0L 4C3IG 1VQIA 2JN4A 3NUCA 2AQ1B 3CCEA 3I2ZA 3P7JA 1EY8A 3L2PA 1JB3A 1YNNC 4BBSB 3H0GG 4KY7A 5F2DA 1HTLD 1BCPB 3RZDH 4KD3A 1MSHA 2EJFC 2XN9C 5D14A 4BY1G 1EY9A 3RD4A 3DEOA 2G9HD 2MNAA 1FJGQ 4DUYQ 4DV7L 3TS2A 2JA8H 5I6WA 2DY8A 3JAMi 3CMAA 2RSOA 2CKZB 2EY6A 3DEPA 1EOVA 5ELBA 1Y1WH 1EZ8A 3C3LA 1X56A 1PTOD 4NXMQ 3UE0A 4LW1A 4DR6L 3NBHB 1V8QA 1LTGD 3B6YA 4P72A 3T1HQ 3DM1A 3PO3B 1F2MA 1S5FD 1WCMG 3CU7A 4DR3Q 4JOIA 4GN4B 4DAPA 1ZEQX 5COYA 4JBJA 2NN6G 4DV3L 4CKCA 3UDXA 2KECA 1EL0A 3KFUA 3T4AC 1S5DD 1ZKOA 4GKKQ 4N9TA 1E0BA 1QE6A 3WOFA 1S5CD 2B2WA 1QNKA 5BN5A 4RCNA 1IBLL 4K6LA 2KCTA 4C1NI 2ZT9C 4QUFA 4ALPA 4B9WA 1HJPA 2E8GA 1YEZA 4A4IA 1AFPA 4KMUC 2D5DA 3RLNA 3S1MH 1UE1A 4GKJL 1SFOH 5JVH3 1FNVA 4A3GB 3FPUB 5C4JB 3K7AH 4G7ZC 3OYYA 3PIO3 1P16A 2E76C 4XYQA 1LTID 4KTAA 1Y69U 1HFGA 1V1PA 1H9RA 4YHHQ 2BA0A 1BO0A 2UXBQ 1X3QA 1STEA 4DV5L 4RAUC 1LTLA 1MSGA 1T5EA 4LNQA 1NJIC 3VR4A 1PYBA 4N9PA 1STGA 4WFN3 1C7YA 3JC66 4ILWA 5IGEA 1EWIA 3MWYW 4MN3A 1XPUA 1UE6A 2UXCQ 4DNTB 1VQGA 4KV6A 2N88A 2Q2UA 2J7ZA 2K7VA 2MGSA 3K80C 1I4HA 3TP5A 3PUWA 2XTIA 2OF1A 2ZXOA 5ELDA 1KXLA 4XXEA 1TWCH 3A7AB 2VQFL 3S17H 1KRTA 3FDTA 1NR4A 1O7IA 3A55A 3CQZH 1TY0A 1K8GA 1L0YB 1U4MA 3Q0AA 2A69D 1MJEA 4GZYC 1Q12A 4TQUS 1SBBB 2YYZA 5E4XA 1T9HA 1D8LA 2ES2A 1NBWA 2L55A 1DOMA 4DXFA 4OWXB 3FP9A 1GO3E 1XMQL 1YHQA 3IRBA 1ET9A 4Q5VA 1BF4A 3PUXA 1JCKB 2A5HA 2B29A 1VQPA 1VQMA 1RD9D 5IT9c 3DXJC 1WI5A 3NXWA 3WWVA 4DR3L 1YHBA 1FR3A 3AEVA 3F2UA 2PNRC 4ZAIA 4PV1C 4LAAA 2F0HA 4EQPA 3M3YH 3T1HL 1HUMA 5IWAQ 1PZKD 2K01A 3RNUA 1F9PA 3BS1A 4DV7Q 1EFID 1R9TH 1N34Q 4P2CB 1KABA 3VR5A 5M3FG 4QL5A 4LMQD 3CF5A 2RBMA 1Y8OB 1WTOA 1YJ9A 4KHVA 2FFKB 4ME3A 4GNXB 4QUCA 2KOLA 4A3MG 2H4OA 2CHBD 2F0PA 5I6YA 1A3TA 3C1EA 4YCVA 1EOTA 1S4ZA 2B8FA 2MP1A 1TR5A 3KK7A 4XT1B 3K5NA 4DV0Q 4RHSA 5J22A 1WTRA 1MIUA 4L5TA 4FYDA 4NMZA 2JA6B 4JI7Q 4BBRH 3J81E 4X62Q 4BY7H 1F9SA 2LSSA 1QVCA 1BKBA 4RGTA 3VR3A 1HA5A 4FO2A 1GJXA 3J7AF 3D4DA 5KEEA 1Q3LA 1PA6A 1J6QA 2PQEA 4V0BA 3J81i 4AQYQ 3PO2G 4JBMA 2PI2A 4RH6A 2BH2A 3UI2A 5EPJA 3DM3A 1EQTA 4LUZA 4R4OA 1X9NA 1IL2A 3MTSA 1MI2A 2AWOA 1ASYA 4DR4Q 2Z9HA 3BZKA 3K7AB 4GLVB 2EXDA 4DR6Q 4EX5A 5C4JH 5K36H 4A3DH 3PIPA 1CZGA 1SFOB 4AYBE 2K4KA 1XMOL 1MBYA 1YJWA 2WV6D 1VQ7A 1NCVA 4A3EG 4DV0L 1HA6A 2HIVA 1GOZA 4ZK9B 4BY1H 1WOCA 4DV6Q 3I4NH 2ICEC 1G291 1B50A 1X32A 1X6OA 1OXTA 3RUZA 2PMZE 3M4YA 1M4VA 2E2HB 1LTRD 2KVMA 3TMEA 2JA7H 1BQQT 3T1YL 1VQHA 3TP8A 2K28A 3GP7A 4KKSA 3IFTA 2F52A 3S1QH 2WB1B 5C0XH 2JA7G 1D2BA 2F0UA 3ICEA 4RG1A 2WIIB 2UU9Q 3BDLA 1LT5D 3SK6A 4LFBL 1ESRA 4JBWA 1STHA 1AZQA 4WRDA 3UDGA 2QA4A 2R7DA 1RHPA 4XQQA 2Z0SA 2KHSA 4CJ0B 3U9SA 4G7OC 2VL6A 4QF4A 5E4WC 5TSSA 2MPMA 4WJ3M 3S16H 1GVPA 1K9MC 2UU9L 2F0JA 5J1ZA 2JA9A 4HN7A 3A7LA 4IUPA 5IGDA 3I3CA 4QY7A 3HOZH 1X3EA 5IOCA 3G7LA 3E0JA 2AKWB 1IKLA 2KCNA 2PW7A 4KY6A 1K83B 3GTKB 3K5LA 2NZOA 5IGFA 5M3MB 4BBSH 2PZWA 3DMUA 3KF8A 1QJOA 4BY1B 4PZ8A 3E5SA 3G48A 4LFAQ 3T53B 2E2JB 2J0TD 4A93H 2PI2E 2F0TA 1E2ZA 3FEWX 4QQBX 2BOSA 2MO0A 5LMNW 3SGIA 1LT6D 1PDQA 1CM9A 4PMWA 2Q8IB 3H3VI 1IBKL 1U0LA 2OXPA 3R2IA 4QIWB 4KN7C 1I4GA 2Q8TA 4X66Q 4BA2I 1PH9A 3URYA 1LO5D 2KHJA 4CGYB 3BYYB 5JJZA 1D5XC 4A3IG 5BN4A 1RJTA 4HJ7A 1WFQA 3RLOA 1STYA 2R93H 3BU2A 4IFDH 2EJGC 1AZPA 2OQ0A 3FMCA 1VQBA 2HUGA 2ZXPA 1LACA 1JR0D 4LJZC 3HOZG 1UEAB 3KF6B 1XNQQ 2Z6BA 1HNXL 4JCVE 1L1OB 2KCMA 5I9PA 1KQSA 4JI7L 3LGJA 1KTKA 4BBRB 5C44G 2JA6H 1JT8A 2HHHL 2NVYH 4DF7A 1CT1D 1EQRA 2SDFA 1S5BD 1X65A 4B3SL 3S24A 4CDEC 5D3IB 4U68A 3Q22A 1JJGA 4K0KQ 1GHJA 4C2MB 1W2BA 1LTTD 1JOKA 3KUPA 3S2DH 3NBIA 2A8VA 2JK8A 1CQVA 1C48A 2LS01 5I4DA 4UPAA 2UUBL 3SXHA 1U4LA 3KBGA 4IN3A 5ISRA 5C0XG 5FLMG 1PH6A 3H15A 3S1RH 3I4MG 4MZ9A 1B9NA 5C44B 3GTQB 2PZUA 4PG3A 4GOPC 2IJ0A 4H0LC 3PF5A 1Q8KA 3S2HH 3AMUA 1V1OA 3ULPA 3NENA 4IFDI 5JOBA 3QIAA 4DNIA 1XYIA 4L5RC 1JE4A 3KDFA 2R3ZA 3HKSA 4DGZA 4OO1H 1C9OA 4R8IA 1SNQA 3MXGA 1YIJA 3NTIA 2A6HD 2BE5D 4A3CH 5M3MH 4P71A 2PZTA 4QIWE 3VA7A 2EYFA 3S15H 3J80i 3VR2A 1IXRA 4JV5L 4P75A 4I7AA 1JB7A 1QUQA 3D4WA 2JQOA 3ZJYC 4C3HB 3HOZB 1YNJC 3T1YQ 1MHWC 2E2IH 2FHTA 1WYDA 2MHVA 1OTCA 3PV0A 4A3BG 2RF4A 2K04A 1ICWA 5JJIA 1TS3A 5M3FH 4MHEA 2F4IA 1KNEA 3HOWB 1GKHA 1LM0A 4X65L 1XTCD 5FO9B 2M00A 2BDOA 5GAGC 5IP7H 4A3GG 5C4ZA 2A73B 1QWYA 4A3DG 3FKIH 2AQ2B 3CQZB 3I4OA 5A2QE 1HR0Q 2I5HA 2R7FA 4OL7A 1TWCB 2Q2TA 3OMCA 1RCVD 1P8LA 1A8VA 1EEFD 5EAYA 3N6RA 2F1MA 2NN6I 1QCBD 3FVQA 5IP9G 1CQFA 3TP6A 2SNSA 3HOYH 1TWFB 2RDFA 1Q90A 3F1ZA 1N34L 2L1BA 5C3EH 1OXXK 3E0EA 1PFBA 2GVAA 1VQNA 1TS4A 5DM73 5IODA 4IOCA 1UNSA 2K32A 3VDYA 2UUCL 4X66L 4YHHL 1B53A 4GOPA 4A3LH 2TSSA 4GN3B 3D31A 2DUDA 4X3KA 2R61A 2EYPA 2K33A 4A3FB 1NE3A 5CR3A 3W1BA 1OXVA 1RODA 4F88A 4ABNA 3W1GA 1Z9FA 1I3QH 4DUYL 4YCWA 4HJ8A 1ILPA 2N8NA 1ZYRC 3KOJA 1SYEA 4MNOA 1G91A 3M9BA 5HGTA 4HSVA 3HOYB 4ID6A 1Y1VB 5JVG3 3AQQA 4R4IA 2IX3A 2VUMG 1NSNS 4GKKL 4LF8L 1PMRA 1YNXA 4X64L 4HIDA 3AFPA 4IPGA 4R4CA 5ELFA 3KLRA 4JOIC 2AMCB 4JI8Q 1PTOB 3OPOA 3PO2H 3ER0A 4A3JG 1ILQA 3Q6SA 4DV3Q 2V4DA 4JV5Q 3PO3H 4J1MA 1SNPA 1CKMA 5FO7B 5GQOA 4ZKCB 4NP5A 4K5WA 1SYCA 4NXML 3PO2B 4RHRA 2KHIA 4ZCKA 3CAMA 1K28A 1JJ2A 2ASBA 2ICIA 4RWSC 1O78A 2UXDL 4OIKA 2JA8B 3I91A 4RMFA 1FVIA 5FLXE 1WTQA 1Y1VH 1Q82C 4JW0A 3HOXG 1E1TA 4DAVA 2ZTCA 3I4NG 2F0KA 4PMCA 4DXGA 4DPGA 1XMQQ 1EYCA 1GUOA 5E1FA 1BOSA 4XIGS 1LYLA 4IUVA 5CBEE 1CSPA 2WAQE 2EIFA 2PMZB 5JJKA 2DJFC 4LF4Q 1CSQA 1VQAA 4B3TL 1UE5A 4JI8L 1Q81C 4A3MB 4GKJQ 3TZDA 2VQFQ 2F3VA 1AE3A 1VQDA 4DK3C 4F7XA 2R93G 4IQZA 3EJIA 1NR2A 1F2ZA 4IPDA 4ODGA 1HRJA 1PRTB 3HOVB 1EYDA 4C3JB 4A3LG 5CV7A 1Q86C 4WJWA 4ZUJA 5L37A 1TWGH 4CJ1B 1II3A 5LHY1 2F3IA 5M5XB 4OWWB 3FHWA 2EZVA 4PZ6A 4UHVA 3X3NA 3NWTA 5C4XB 1BNZA 2F4VQ 2VB2X 5IWAL 1IYUA 1IW7D 5CV5A 4BBRG 3S17B 4M1UB 2ZJPA 4JBKA 2J4XA 2JXMB 3FKIB 2BA1A 2ZJQA 2DJGC 3GTMH 3F2DA 4P73A 3U4VA 3HOWH 2BDNA 3OSOA 5JAVA 4K8IA 1U5KA 2QKIC 3M85A 4AIMA 4OELB 1BCPC 2G9DA 1K8OA 2F0LA 1SJHD 2ZM6L 1KHIA 1Y8NB 1NAPA 3PIP3 2IL8A 3CCLA 2EYJA 3CRLC 3D4RA 2JSOA 1Y8PB 1IBMQ 2XWJB 1J5EQ 2R92B 1J5EL 2I07B 3I70A 3S14H 5CYUA 4C3HH 3KLWA 4FXGC 1CKNA 1MD2D 1HNWL 1H95A 3CHBD 1A3VA 3DWAA 2K5DA 2CVRA 2OCEA 5IT9E 1E2WA 1RL2A 3GV3A 3TRZA 3OWEB 3GTJH 1H9MA 2VB3X 1B1ZA 5C6AA 4APVA 4LF6L 3NTKA 2E2JH 2OTJA 2X6GA 3DLLA 4A3KB 2NVTB 3M7NA 3GTKH 2H5XA 4K6DA 2EPBA 3STBC 1LLRD 1B7YB 1BBWA 2DNEA 4NW2A 3S1RB 1H9JA 1SR3A 1SJED 2XIWA 2K05A 4IUQA 3C2PA 4EQNA 4PQXA 5I9OA 4R4QA 4KHPQ 2Z6KC 4POGA 1DXMA 1JWSD 1SE4A 3MFGA 3S2DB 3S16B 5FLMH 2OT2A 5C3EG 3I90A 4DV1L 1TS2A 3I8ZA 4POFA 3KLSX 4R9WA 5HURA 1PZJD 1Y1VG 2E5LL 1B3AA 2K5NA 4FXKC 4Z9CB 1OXUA 2NVYB 5CV4A 1DJRD 3BJUA 5CORA 3M4OH 2JA5B 4HIKA 4B3TQ 1WTXA 5CBAE 5KNCA 1EWHA 2B2TA 1WD1A 2K5VA 2F0MA 2DY7A 2A68C 3FRPB 3KLSA 2EVBA 2EY5A 4XYOA 3W3AA 1UE7A 1XPOA 3K58A 1VCIA 2RQXA 1DGSA 2EY1A 4KHZA 2PW5A 1XXGA 4HJ9A 1AW7A 3I4NB 2WKCA 3EVQA 5JEAJ 1SYGA 1S40A 1N8RC 4DV5Q 1B2TA 2L15A 1L2FA 4DV4Q 1QILA 4DV4L 5FOBB 3ITPA 1PRTC 4HTHA 1VQEA 2Y0SE 4A3MH 2F0OA 4AH6A 3J80L 4DAMA 1PZID 1EIYB 3V05A 2P5ZX 1NMFA 2JEBI 4JI4L 4IPCA 1ET6A 1FYCA 1E1OA 2HCCA 4FF4A 3A0JA 3H3VH 5ELNA 3CC4A 5EKIA 4DR2L 5A2QL 5M5WB 1QB5D 1K8AC 1L0XB 1TKWB 1HNWQ 1F9RA 4JK1C 1WTWA 2L4NA 4DR7Q 1YZ6A 3HRZC 3ND9A 5AJ3L 4DFAA 1KNAA 3GTOH 1G6ZA 5LMNQ 2KA7A 4GOPB 1RTOA 2VZAA 1TQOA 2IX0A 2XRSD 3N52A 1JICA 5IYDG 3M4OB 3GDEA 4YWMA 5J39A 1SAPA 1F2YA 1YVCA 5JJLA 4R1JA 1VQCA 3BG3A 1TY2A 2LXJA 2A6EC 2DN8A 4DV1Q 3V2TA 2B63B 2QGQA 4JYAL 5DAUA 3NE5B 4C56C 1E3PA 5C3WA 1DYQA 4F87A 2FMCA 4YWKA 1SEBD 1Q1EA 3D6CA 2IWHA 2WB1G 2JA7B 1N32L 4KN4C 3K5OA 2B2TC 4LUVA 1FL0A 4IZ8A 1L1OC 4C1NK 4DK0A 4DR1L 2FXQA 2NBFA 2K52A 1TXYA 4U673 3QJYA 5ELOA 1K3RA 4JI5Q 1M8AA 4X3TA 1JORA 1CI3M 5M5YB 1I3QB 3OIPA 4BWGB 2WAQG 4DU9A 5EKKA 4S3SA 4O42A 2HQLA 3AB9A 3Q8DA 3GTJB 1BCPF 2O5JC 3PUVA 2IPKD 2WACA 4DKAC 1N36Q 3P20A 3I4LA 4HIOA 1PH1A 1PFMA 3CW2C 1HHVA 2FINB 1DM0B 1NNXA 1NY4A 4KLKA 3NQIA 1Q8IA 4KI0A 5K5PA 2KEDA 1WTHA 4EGVA 1AEXA 1X3FA 3H94A 3K81C 3S14B 5C3EB 4KHPL 2B39A 2YTYA 5IE8A 4IFDJ 3R93A 1AH9A 2G5DA 1CKNB 1N32Q 3RMHA 1K3BC 3UE1A 3A74A 1DOLA 2NB0A 1QVGA 4BY7B 4L6TB 3R8BA 5KNBA 4B3RQ 4ZKBB 4BS9A 1YJNA 1YBYA 1WTPA 3HZXA 5DLQE 2Y0SG 3D8GA 5HY6A 5T1IA 3BZDB 4HMJA 1VQOA 1O7ZA 1ML0D 4P74A 1KLGD 4JI2L 2IHEA 4OO1G 3MXPA 4FVMA 2VQEQ 3NSWA 3PUYA 1HZCA 3W5OA 1ENFA 1STAA 2I5LX 3H0GH 1EY0A 1S5ED 4X64Q 5M5XH 4G7HC 1H9SB 1HZ9A 1JE5A 1ZXTA 4YY3L 2YTVA 1QG7A 1R4PB 2A74C 1LABA 1SYDA 1SRUA 4IALA 1I94Q 1CUKA 4OX9Q 2F0IA 2L5TA 3SK5A 1E22A 2EJMA 3I72A 1LTSD 4BA1I 2O5IC 3F2BA 3WOEA 2B2YA 4LF7L 2LXKA 4X3UA 4CHTB 1Y1WG 2RCNA 3CRKC 1L1OA 4XQNA 3G6EA 1VQKA 2WAQB 4H13C 3U4ZA 3CCVA 5LL6S 4A3GH 4JI2Q 1QNUA 1N33Q 1HTPA 3R2TA 2F0DA 4JI6L 1J9OA 1LUZA 1SNMA 2F4VL 3LNNA 3QR8A 1A6XA 1EEID 2KCCA 2NN6H 2Q8RE 2ENBA 3KBXA 3I7FA 3W2DA 5C4XG 3J81L 3MHBA 1TVXA 4ZLTF 5CGKA 1VQJA 1PXUA 1PHJA 5I2YA 1VF7A 3SK4A 1AP0A 2OTLA 1IKMA 3DUZA 4JI3L 1PFNA 2LFNA 1NUCA 1TWAH 2KEEA 1LT3D 3A5UA 1KRSA 2QILA 2A6ED 3QWNA 2LY7A 1VQ6A 4JYAQ 3GO5A 1HXYD 3U9OA 1N33L 1HUNA 1IHZA 4BXXG 3NELA 2L12A 2B63H 3J7A5 1V43A 1BDOA 1GUWA 5FJ8H 1HR0W 4OXPA 4CKEA 4H02A 4X65Q 1JQYD 5ELEA 2NTTA 2RA4A 1B70B 5IGBA 3C1FA 4IUUA 4LF9Q 3ONAB 1VQ9A 1W6JA 4XT3B 3TS0A 2Z8LA 3GTOB 1J8IA 5KRUA 1HQMC 3CXCA 4LF9L 2WP8J 1PV4A 3MXUA 3I4MH 1B9MA 4YY3Q 5GADC 5BR8Q 2EY2A 1A2TA 5M9OA 3G6JB 1IYJB 4A3FH 1XMOQ 1Z6HA 5M5WH 3G71A 3TBIB 4B3SQ 5KYIA 2QEXA 3RN2A 1VQ8A 5IT9L 4FXDA 2JJQA 4QGUA 1SSOA 1MKHA 4IO9A 2CCZA 2EXZA 1HZBA 5C3XA 5E7NA 4QCLA 3D6WA 3S1MB 1EY5A 3H6MA 4A3BH 4PNYA 2KUMA 2IY5B 1Q7YC 4GN5A 1FJGL 2Q2HA 3ND8A 1HPCA 2YTXA 4K14A 3KYHC 4L8JA 3CP0A 1C4QA 1K83H 4CDCC 2EE1A 4YCUA 1R4QB 1RIPA 3CKIB 4G57A 1O7YA 3IKJA 2EYMA 2IX1A 3PUZA 5JEAH 3TN2A 1STBA 1EY7A 4LWCA 3K57A 2D9UA 3A8KE 5IGGA 4JC0A 1I4RA 4A3EH 2JA5H 3R3OA 3J81c 5DEHA 1JC7A 1EFWA 2HD3A 1KC8C 5M3MG 4A3CG 1TWAB 5EKLA 1I4XA 4KY5A 5BN3A 5CC4A 1SLJA 5M3FB 2RHQB 1PLFA 4OHJA 2Y0SB 1GXDC 3K8AA 3Q24A 3M4QA 3NP8A 4JPBW 1LTBD 4RCOA 1DCZA 1GUGA 4UP7A 2R7ZG 3WDNA 3MZ5A 3STBD 2H1EA 1DONA 3QB3A 2K1BA 3L0OA 4AYBB 1SMYD 2JEAI 3CD6A 1A63A 5H1SE 4FF1A 2VXWA 2VY3A 1A0IA 3AFQA 4DR5Q 2KQ3A 1VQ5A 1WTVA 1KL9A 1MGSA 3MXNB 1A15A 2M9VA 1M90C 3CCUA 4LUOA 4QB4A 3MVVA 5A35A 2C9OA 3M4PA 3HEJA 1VMPA 4RKLA 3NBHA 4ZYSA 4A3JB 4DAYB 3HOVG 4A3DB 2CWAA 5BR8L 5LMNL 3TZUA 4HR7B 2VUMH 1SE8A 1SMYC 3HOWG 3S2HB 3OTOQ 4LFAL 1ONLA 4GLAC 5IYCH 2R92G 1EQQA 2JA6G 4NDXA 2BCOA 4O0AA 1UEBA 2K14A 3P1HA 1IBML 2N55A 3MXNA 3VR6A 2UUAQ 2R92H 4KD4A 1GUTA 1L0WA 1LV9A 2I0QA 4K0KL 1V1QA 2QEJC 4UY8C 1FD7D 4L63B 4B9XA 5D3DA 1PH4A 4DV2Q 3HOXB 5EBCA 3PIOA 4K8JA 3HOUH 3MA2B 1X55A 1Z47A 4LFCL 3TDQA 2HHHQ 2F0SA 1UUPA 5CV9A 2N49A 3DWQA 3RZOB 2F03A 3TQYA 4LFBQ 4EVOA 2K50A 3UDIA 3HOUB 2F0FA 1D5ZC 1JMCA 2UXCL 1O80A 1C8CA 2B2UC 2HCIA 2XSCA 4AYBG 4DV2L 1CFMA 4PMBA 4FNFA 5DM63 5C4XH 2AQ3B 3GTLB 4A76A 4C3JG 4IJLA 4MTNA 1W6KA 2EQSA 1PH2A 1F77A 1I4QA 1OXSC 2TMPA 3J80E 1CKOA 1D1KA 1EWCA 2UUAL 2R93B 3SDZA 4Y7NH 4OWTB 1KDCA 1KDAA 1V1PB 1G2SA 1T5XD 3RLFA 4C3JH 1YNJD 4DV6L 5IYDH 2VUMB 3AU7A 1B3QA 3PQIA 3NTHA 2KBNA 4IUNA 4IPHA 4A3JH 1IBKQ 4JI1Q 4UAIA 3I55A 3A56A 2BE5C 1B4OA 2HT1A 3VYTA 2A6HC 1X3PA 1XNRQ 3I73A 3QO2A 1SE2A 3K59A 4JI1L 5J3BA 1F9QA 1KIXA 4A93B 2CQOA 2Z4HA 3HKZB 1LTAD 4RFBA 3KF8B 5IGCA 4LF5Q 4DR7L 2QDBA 4OX9L 2HDLA 4RKBA 3T56B 3F8TA 4EQOA 2O2LD 1FNUA 4DR2Q 2AWNA 3GTGH 3U50C 3HP3A 5HGQA 1D7QA 4JI4Q 3BVZA 1I6HH 4OEMB 5GAEC 3F2CA 3HG9A 1H9SA 3MEHA 4HCEA 3A54A 1PH5A 5FK9C 4WORA 3PMFA 4J15A 4O2DA 1U4PA 2GN5A 4LF6Q 1I6VC 1ENCA 1Q1BA 3D0FA 1SMXA 3VYUA 5FLXL 2PNHA 3LWEA 5IYBH 2WKDA 2Q2IA 2K6AA 4HJAA 1I6HB 2RSNA 2L0CA 3T16A 1CTMA 2RDHA 4UDUC 5IYBG 3OOCA 1PTOH 2I5MX 3A8JE 3EROA 2CWPA 2KENA 5DNFA 1ZYRD 1RF2D 2R7ZH 4ZRZA 3G4SA 1XWEA 4IOAA 4QMGA 2ZM6Q 5C0XI 3Q23A 1JWMD 1C0AA 5LMUL 2B2UA 4QJFA 4A3FG 2QW7A 1DOKA 5E3FA 4KJOA 3T13A 2ID0A 4A3BB 5C5MA 1CK1A 1EU4A 1N36L 5EQ0A 1HCZA 2Z6KA 3JAMc 5EGTA 2HQEA 4GNXC 3QOJA 2C35B 4F8MA 2B2WC 3CMEA 1LT4D 2WINB 1A62A 1EUJA 5I2XA 1PRTD 1SROA 4ZUIA 3SEBA 1JWUD 1CA6A 1VQ4A 1B44D 1XTDA 2B2VC 1PYWD 1EIGA 4R4TA 1IZ6A 2OWOA 2K03A 1PH3A 3TEHB 3PCOB 4K5VA 2AUKA 2MFIA 4X62L 1KD1C 1CZWA 5IP7G 3CCMA 1DD2A 4JI6Q 1TS5A 3IL8A 1PVOA 2A68D 4EQ5A 2IW3A 3HFZB 1SNDA 2FMMA 3RZOH 4X3SA 1TWHH 4K2KA 1E2VA 1KDBA 3HKZE 4FF3A 3L9AX 2RHSB 3CCSA 4I65A 1SNOA 3IFDA 2XNAC 4RA8A 2RCFA 3HOXH 2K5WA 2OEOA 2X69A 4DNRB 4BBSG 1RKNA 4Y52H 4C3IH 2EDGA 1EY4A 4UP9A 1HQRD 3H91A 2SNMA 4OO1I 3MC0B 4MIUA 2QCPX 2B8GA 2K5QA 2JE6I 2XVSA 1GM5A 2CH4W 2E2IB 4DK6C 5IIFA 1GUNA 3KJOA 4DAYA 1HZAA 4I7ZC 1R9TB 2WB1E 1SDFA 3OIQA 1PH8A 2PQAB 1EZ6A 4XDXA 2UXBL 3ULLA 2NZ1D 4MTKA 3MAQA 4IFDG 1H9KA 2B63G 3RZDB 2F3WA 1X3GA 3EA6A 4ULLA 3SK8A 1M1KC 1HNZQ 4A3IH 2AHOB 3M3YB 1PFSA 5GAHC 5T1GA 1SN8A 4N8X1 4A3IB 1KLUD 1RTNA 4UP8A 2LMCB 3HGBA 1EY6A 1QZHA 2PO4A 3X3MA 2PQAA 2RKSA 4M8AA 4H7BA 1AN8A 1ICFB 5KYLA 1U4RA 1OO9B 1JOQA 1E7ZA 4YIJA 1NTGA 4JVZA 5AJ3Q 4DUZQ 5EPLA 3K0XA 5IY0A 4ZQ3A 1EYGA 2YU9B 1PTOF 5C44H 3O13A 3JAML 5JPNC 3OTOL 4ME5A 3VYRA 2IHFA 3H0GB 1HH2P 1KAAA 3OHXC 1G8ZD 5C0XJ 2NTSA 3GTMB 1I50H 1A2UA 4C3IB 4A3EB 4GS3A 2EYHA 2D62A 2E5LQ 4JI0Q 4B08A 1HNZL 3NWSA 1STNA 4L5SA 3JAME 4N8FA 2Z1CA 3CPFA 2DGYA 5D65A 2JYOA 1D6EC 4J8QA 1I50B 4OIJA 2AUJD 3HOUG 4KJNA 4JI5L 2NVQH 3CCRA 4B3ML 3EFXD 3LX0A 4HJ5A 1AE2A 4X6AH 4JI3Q 4IUTA 4L5QA 2QDLA 3HOVH 4HEDA 4PZ7A 1XX8A 4B3MQ 5LMUQ 1EQVA 3CCJA 3KF6A 5JEAG 1O7LA 2N78A 2FJ2A 3L7ZC 5NUCA 2F0NA 3A5ZB 3GQBA 5ELCA 1WD0A 4A93G 3BDCA 3H09A 2ZJRA 2JA5G 4RGNA 1VQFA 5CV6A 2CFMA 3GTPB 5EJWA 3K5MA 4LF7Q 1BVSA 1RDPD 2MQHA 2MUYA 1EU3A 2F0QA 3CCQA 2LKVA 2YV5A 1PRTF 5M5YH 3QOLA 2MO1A 2X6LA 3V96A 3DWPA 5FO8B 3I4MB 1JJCB 4DR1Q 4DK1A 1TU2B 3FKIG 3IAYA 2EYLA 2CH4A 1XNQL 1QZGA 1IBLQ 4HCSA 4CJ2C 2K5HA 1K73C 1K0RA 3TP7A 5FKAC 2JA8G 3L3OC 5KIXA 1N9WA 2A1AA 5K36G 2OQKA 1V9PA 3KDFB 4TKOB 1D5MC 3CC7A 4KKTA 2PPBC 4LF5L 2VNUD 3SHLA 2QF7A 4B3RL 1XPRA 1FGUA 1IYVA 3RN5A 1WJJA 3MEFA 1TWHB 3TREA 3E6ZX 1S72A 4GLXA 3MFYA 1Y1WB 4H44C 3BZCA 4FDBA 4A3KG 1ASZA 3ZYYX 2N3SA 2XGTA 1CHQD 1BBXC 4XQJA 1X54A 4LF8Q 1CA5A 1HFNA 3S1QB 3E9HA 5G3LF 2IT1A 3D3RA 1FGBD 3GTGB 4R8NA 3NEMA 4JG2A 1I94L 3EIVA 3AYHB 4LK1C 2UUBQ 1PYSB 1UWVA 4NKLA 4IURA 2F0EA 3GD7A 2C5CA 4TSSA 2RVLA 3A8IE 1MJCA 2E2HH 5EBDA 1FNWA 2L11A 1F2LA 1QVFA 4NXNQ 4NB3A 1I4PA 3J7YW 2GVBA 2M2LA 1KAWA 3S1NH 2I46A 3S1NB 1S3OA 4FP5D 3ULJA 1W3SA 4IJHA 2ZTDA 1SE3A 1QOHA 2WFWA 1DZ1A 1BBUA 1HNXQ 3S9WA 4HAEA 1TWFH 2VW9A 2NVXH 2ZTEA 3C46A 4BY7G 3J7AV 1I5FA 3OW7A 1NMGA 3OW2A 2R7ZB 2ZXRA 2VS1A 1ENAA 5EPKA 4Q0FA 3BYTB 3CC2A 1SYFA 2B3GA 1BCPD 4BXXH 5C4HA 1VQLA 2E74C 2CQAA 1YI2A 4G4KA 1B8AA 3E3XA 1VDZA 3ERSX 4TVAB 5FJ8G 5GROA 3DHQA 3EQLC 3NHHA 3NK9A 1K8MA 3VA5A 3K0YA 1WVLA 5C5LA 1IW7C 3BVMA 1XNRL 2D0OA 3SR1A 4RGOS 2K75A 2JP1A 2L9HA 1BXTA 2GA4B 5KNDA 4J6HA 1PTOC 2NUCA 1QUQB 1TT2A 2F0WA 4E6IA 1WCMB 4DUZL 3J81j 2V1CC 1Q46A 3E9IA 1VMCA 3NPPA 3KJPA 1ESFA 3PSIA 4HSPA 2Z4IA 5CV8A 4OONA 3ERQA 4TRDA 4O1NA 1TIID 2D2CC 3BVGA 4K5XA 2ALYB 2BH8A 3S15B 2NWGA 4HMIA 1A3UA 3TSSA 1YITA 1SXTA 3UDFA 2XWBB 2NVTH 2NYZD 4A3KH 4CDFC 4GNXA 1IL8A 5FLXc 1VF5C 2EOTA 3K6OA 1YNND 2UUCQ 1K0SA 1SYBA 5AFWA 4OGQC 1E24A 1GD7A 4WJ4A 2B2VA 2HIXA 4LFCQ 2DNCA 1G2TA 4NXNL 3GTPH 2E75C 2RDGA 3FPPA 3GTQH 1CHPD 2D0PA 5JPMC 3I56A 3LWUA 2NZHA 4Y7NB 2F0GA 3T51B 2EYOA 3P75A 3J80c 2SEBD 2O4XA 1Y14B 2KJXA 1G51A 1BR9A 3QG1A 4XTCS 4KKUA 2CW0D 1PH7A 1U9RA 1WCMH 2B2YC 4CDDC 1G6PA 4FF2A 3PF4A 3GTLH 4C2MH 2PYKA 2A69C 4K2LA 3H3VC 1BUVT 3SE0A 1HR0L 1GHKA 4V190 2A19A 2E2DC 3BDOA 3HS0C 4DN4M 3HOYG 2SOBA 4CKBA 3PGZA 2VQEL 2NVQB 5IP9H 4RGMA 1EIFA 3EBEA 4C3HG 4HIMA 3M7GA 1SNCA 4LF4L 5CMDA 3OWFA 1YHAA
chains in the Genus database with same CATH topology
1ICFB 4OELB 2DJFC 4CDCC 4OEMB 4CDFC 1K3BC 4CDDC 2DJGC 1MHWC 4CDEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ICF B;  4OEL B;  2DJF C;  4CDC C;  4OEM B;  4CDF C;  1K3B C;  4CDD C;  2DJG C;  1MHW C;  4CDE C; 
#chains in the Genus database with same CATH topology
 1Z7T A;  2F0V A;  4DR5 L;  4KK7 A;  2HDM A;  3GV6 A;  2PCF B;  4DR4 L;  3PO3 G;  1EYA A;  2R6G A;  4DA2 A;  1VS0 A;  1EIH A;  3NQT A;  4YWL A;  3RR5 A;  3VYS A;  1TWG B;  2ATW A;  4AQY L;  1GUS A;  3J7Z C;  1D1I A;  1UAP A;  3EN2 A;  2CW0 C;  2YU9 H;  2UXD Q;  1JOO A;  2NVX B;  5LL6 X;  2XRQ D;  1XJV A;  3CPW A;  3U58 A;  5IYC G;  5G3L D;  4CBV A;  3K7U C;  3OMG A;  5KGU A;  2MJ8 A;  3HKZ G;  4NPS A;  3SVM A;  4A75 A;  4JI0 L;  4C3I G;  1VQI A;  2JN4 A;  3NUC A;  2AQ1 B;  3CCE A;  3I2Z A;  3P7J A;  1EY8 A;  3L2P A;  1JB3 A;  1YNN C;  4BBS B;  3H0G G;  4KY7 A;  5F2D A;  1HTL D;  1BCP B;  3RZD H;  4KD3 A;  1MSH A;  2EJF C;  2XN9 C;  5D14 A;  4BY1 G;  1EY9 A;  3RD4 A;  3DEO A;  2G9H D;  2MNA A;  1FJG Q;  4DUY Q;  4DV7 L;  3TS2 A;  2JA8 H;  5I6W A;  2DY8 A;  3JAM i;  3CMA A;  2RSO A;  2CKZ B;  2EY6 A;  3DEP A;  1EOV A;  5ELB A;  1Y1W H;  1EZ8 A;  3C3L A;  1X56 A;  1PTO D;  4NXM Q;  3UE0 A;  4LW1 A;  4DR6 L;  3NBH B;  1V8Q A;  1LTG D;  3B6Y A;  4P72 A;  3T1H Q;  3DM1 A;  3PO3 B;  1F2M A;  1S5F D;  1WCM G;  3CU7 A;  4DR3 Q;  4JOI A;  4GN4 B;  4DAP A;  1ZEQ X;  5COY A;  4JBJ A;  2NN6 G;  4DV3 L;  4CKC A;  3UDX A;  2KEC A;  1EL0 A;  3KFU A;  3T4A C;  1S5D D;  1ZKO A;  4GKK Q;  4N9T A;  1E0B A;  1QE6 A;  3WOF A;  1S5C D;  2B2W A;  1QNK A;  5BN5 A;  4RCN A;  1IBL L;  4K6L A;  2KCT A;  4C1N I;  2ZT9 C;  4QUF A;  4ALP A;  4B9W A;  1HJP A;  2E8G A;  1YEZ A;  4A4I A;  1AFP A;  4KMU C;  2D5D A;  3RLN A;  3S1M H;  1UE1 A;  4GKJ L;  1SFO H;  5JVH 3;  1FNV A;  4A3G B;  3FPU B;  5C4J B;  3K7A H;  4G7Z C;  3OYY A;  3PIO 3;  1P16 A;  2E76 C;  4XYQ A;  1LTI D;  4KTA A;  1Y69 U;  1HFG A;  1V1P A;  1H9R A;  4YHH Q;  2BA0 A;  1BO0 A;  2UXB Q;  1X3Q A;  1STE A;  4DV5 L;  4RAU C;  1LTL A;  1MSG A;  1T5E A;  4LNQ A;  1NJI C;  3VR4 A;  1PYB A;  4N9P A;  1STG A;  4WFN 3;  1C7Y A;  3JC6 6;  4ILW A;  5IGE A;  1EWI A;  3MWY W;  4MN3 A;  1XPU A;  1UE6 A;  2UXC Q;  4DNT B;  1VQG A;  4KV6 A;  2N88 A;  2Q2U A;  2J7Z A;  2K7V A;  2MGS A;  3K80 C;  1I4H A;  3TP5 A;  3PUW A;  2XTI A;  2OF1 A;  2ZXO A;  5ELD A;  1KXL A;  4XXE A;  1TWC H;  3A7A B;  2VQF L;  3S17 H;  1KRT A;  3FDT A;  1NR4 A;  1O7I A;  3A55 A;  3CQZ H;  1TY0 A;  1K8G A;  1L0Y B;  1U4M A;  3Q0A A;  2A69 D;  1MJE A;  4GZY C;  1Q12 A;  4TQU S;  1SBB B;  2YYZ A;  5E4X A;  1T9H A;  1D8L A;  2ES2 A;  1NBW A;  2L55 A;  1DOM A;  4DXF A;  4OWX B;  3FP9 A;  1GO3 E;  1XMQ L;  1YHQ A;  3IRB A;  1ET9 A;  4Q5V A;  1BF4 A;  3PUX A;  1JCK B;  2A5H A;  2B29 A;  1VQP A;  1VQM A;  1RD9 D;  5IT9 c;  3DXJ C;  1WI5 A;  3NXW A;  3WWV A;  4DR3 L;  1YHB A;  1FR3 A;  3AEV A;  3F2U A;  2PNR C;  4ZAI A;  4PV1 C;  4LAA A;  2F0H A;  4EQP A;  3M3Y H;  3T1H L;  1HUM A;  5IWA Q;  1PZK D;  2K01 A;  3RNU A;  1F9P A;  3BS1 A;  4DV7 Q;  1EFI D;  1R9T H;  1N34 Q;  4P2C B;  1KAB A;  3VR5 A;  5M3F G;  4QL5 A;  4LMQ D;  3CF5 A;  2RBM A;  1Y8O B;  1WTO A;  1YJ9 A;  4KHV A;  2FFK B;  4ME3 A;  4GNX B;  4QUC A;  2KOL A;  4A3M G;  2H4O A;  2CHB D;  2F0P A;  5I6Y A;  1A3T A;  3C1E A;  4YCV A;  1EOT A;  1S4Z A;  2B8F A;  2MP1 A;  1TR5 A;  3KK7 A;  4XT1 B;  3K5N A;  4DV0 Q;  4RHS A;  5J22 A;  1WTR A;  1MIU A;  4L5T A;  4FYD A;  4NMZ A;  2JA6 B;  4JI7 Q;  4BBR H;  3J81 E;  4X62 Q;  4BY7 H;  1F9S A;  2LSS A;  1QVC A;  1BKB A;  4RGT A;  3VR3 A;  1HA5 A;  4FO2 A;  1GJX A;  3J7A F;  3D4D A;  5KEE A;  1Q3L A;  1PA6 A;  1J6Q A;  2PQE A;  4V0B A;  3J81 i;  4AQY Q;  3PO2 G;  4JBM A;  2PI2 A;  4RH6 A;  2BH2 A;  3UI2 A;  5EPJ A;  3DM3 A;  1EQT A;  4LUZ A;  4R4O A;  1X9N A;  1IL2 A;  3MTS A;  1MI2 A;  2AWO A;  1ASY A;  4DR4 Q;  2Z9H A;  3BZK A;  3K7A B;  4GLV B;  2EXD A;  4DR6 Q;  4EX5 A;  5C4J H;  5K36 H;  4A3D H;  3PIP A;  1CZG A;  1SFO B;  4AYB E;  2K4K A;  1XMO L;  1MBY A;  1YJW A;  2WV6 D;  1VQ7 A;  1NCV A;  4A3E G;  4DV0 L;  1HA6 A;  2HIV A;  1GOZ A;  4ZK9 B;  4BY1 H;  1WOC A;  4DV6 Q;  3I4N H;  2ICE C;  1G29 1;  1B50 A;  1X32 A;  1X6O A;  1OXT A;  3RUZ A;  2PMZ E;  3M4Y A;  1M4V A;  2E2H B;  1LTR D;  2KVM A;  3TME A;  2JA7 H;  1BQQ T;  3T1Y L;  1VQH A;  3TP8 A;  2K28 A;  3GP7 A;  4KKS A;  3IFT A;  2F52 A;  3S1Q H;  2WB1 B;  5C0X H;  2JA7 G;  1D2B A;  2F0U A;  3ICE A;  4RG1 A;  2WII B;  2UU9 Q;  3BDL A;  1LT5 D;  3SK6 A;  4LFB L;  1ESR A;  4JBW A;  1STH A;  1AZQ A;  4WRD A;  3UDG A;  2QA4 A;  2R7D A;  1RHP A;  4XQQ A;  2Z0S A;  2KHS A;  4CJ0 B;  3U9S A;  4G7O C;  2VL6 A;  4QF4 A;  5E4W C;  5TSS A;  2MPM A;  4WJ3 M;  3S16 H;  1GVP A;  1K9M C;  2UU9 L;  2F0J A;  5J1Z A;  2JA9 A;  4HN7 A;  3A7L A;  4IUP A;  5IGD A;  3I3C A;  4QY7 A;  3HOZ H;  1X3E A;  5IOC A;  3G7L A;  3E0J A;  2AKW B;  1IKL A;  2KCN A;  2PW7 A;  4KY6 A;  1K83 B;  3GTK B;  3K5L A;  2NZO A;  5IGF A;  5M3M B;  4BBS H;  2PZW A;  3DMU A;  3KF8 A;  1QJO A;  4BY1 B;  4PZ8 A;  3E5S A;  3G48 A;  4LFA Q;  3T53 B;  2E2J B;  2J0T D;  4A93 H;  2PI2 E;  2F0T A;  1E2Z A;  3FEW X;  4QQB X;  2BOS A;  2MO0 A;  5LMN W;  3SGI A;  1LT6 D;  1PDQ A;  1CM9 A;  4PMW A;  2Q8I B;  3H3V I;  1IBK L;  1U0L A;  2OXP A;  3R2I A;  4QIW B;  4KN7 C;  1I4G A;  2Q8T A;  4X66 Q;  4BA2 I;  1PH9 A;  3URY A;  1LO5 D;  2KHJ A;  4CGY B;  3BYY B;  5JJZ A;  1D5X C;  4A3I G;  5BN4 A;  1RJT A;  4HJ7 A;  1WFQ A;  3RLO A;  1STY A;  2R93 H;  3BU2 A;  4IFD H;  2EJG C;  1AZP A;  2OQ0 A;  3FMC A;  1VQB A;  2HUG A;  2ZXP A;  1LAC A;  1JR0 D;  4LJZ C;  3HOZ G;  1UEA B;  3KF6 B;  1XNQ Q;  2Z6B A;  1HNX L;  4JCV E;  1L1O B;  2KCM A;  5I9P A;  1KQS A;  4JI7 L;  3LGJ A;  1KTK A;  4BBR B;  5C44 G;  2JA6 H;  1JT8 A;  2HHH L;  2NVY H;  4DF7 A;  1CT1 D;  1EQR A;  2SDF A;  1S5B D;  1X65 A;  4B3S L;  3S24 A;  4CDE C;  5D3I B;  4U68 A;  3Q22 A;  1JJG A;  4K0K Q;  1GHJ A;  4C2M B;  1W2B A;  1LTT D;  1JOK A;  3KUP A;  3S2D H;  3NBI A;  2A8V A;  2JK8 A;  1CQV A;  1C48 A;  2LS0 1;  5I4D A;  4UPA A;  2UUB L;  3SXH A;  1U4L A;  3KBG A;  4IN3 A;  5ISR A;  5C0X G;  5FLM G;  1PH6 A;  3H15 A;  3S1R H;  3I4M G;  4MZ9 A;  1B9N A;  5C44 B;  3GTQ B;  2PZU A;  4PG3 A;  4GOP C;  2IJ0 A;  4H0L C;  3PF5 A;  1Q8K A;  3S2H H;  3AMU A;  1V1O A;  3ULP A;  3NEN A;  4IFD I;  5JOB A;  3QIA A;  4DNI A;  1XYI A;  4L5R C;  1JE4 A;  3KDF A;  2R3Z A;  3HKS A;  4DGZ A;  4OO1 H;  1C9O A;  4R8I A;  1SNQ A;  3MXG A;  1YIJ A;  3NTI A;  2A6H D;  2BE5 D;  4A3C H;  5M3M H;  4P71 A;  2PZT A;  4QIW E;  3VA7 A;  2EYF A;  3S15 H;  3J80 i;  3VR2 A;  1IXR A;  4JV5 L;  4P75 A;  4I7A A;  1JB7 A;  1QUQ A;  3D4W A;  2JQO A;  3ZJY C;  4C3H B;  3HOZ B;  1YNJ C;  3T1Y Q;  1MHW C;  2E2I H;  2FHT A;  1WYD A;  2MHV A;  1OTC A;  3PV0 A;  4A3B G;  2RF4 A;  2K04 A;  1ICW A;  5JJI A;  1TS3 A;  5M3F H;  4MHE A;  2F4I A;  1KNE A;  3HOW B;  1GKH A;  1LM0 A;  4X65 L;  1XTC D;  5FO9 B;  2M00 A;  2BDO A;  5GAG C;  5IP7 H;  4A3G G;  5C4Z A;  2A73 B;  1QWY A;  4A3D G;  3FKI H;  2AQ2 B;  3CQZ B;  3I4O A;  5A2Q E;  1HR0 Q;  2I5H A;  2R7F A;  4OL7 A;  1TWC B;  2Q2T A;  3OMC A;  1RCV D;  1P8L A;  1A8V A;  1EEF D;  5EAY A;  3N6R A;  2F1M A;  2NN6 I;  1QCB D;  3FVQ A;  5IP9 G;  1CQF A;  3TP6 A;  2SNS A;  3HOY H;  1TWF B;  2RDF A;  1Q90 A;  3F1Z A;  1N34 L;  2L1B A;  5C3E H;  1OXX K;  3E0E A;  1PFB A;  2GVA A;  1VQN A;  1TS4 A;  5DM7 3;  5IOD A;  4IOC A;  1UNS A;  2K32 A;  3VDY A;  2UUC L;  4X66 L;  4YHH L;  1B53 A;  4GOP A;  4A3L H;  2TSS A;  4GN3 B;  3D31 A;  2DUD A;  4X3K A;  2R61 A;  2EYP A;  2K33 A;  4A3F B;  1NE3 A;  5CR3 A;  3W1B A;  1OXV A;  1ROD A;  4F88 A;  4ABN A;  3W1G A;  1Z9F A;  1I3Q H;  4DUY L;  4YCW A;  4HJ8 A;  1ILP A;  2N8N A;  1ZYR C;  3KOJ A;  1SYE A;  4MNO A;  1G91 A;  3M9B A;  5HGT A;  4HSV A;  3HOY B;  4ID6 A;  1Y1V B;  5JVG 3;  3AQQ A;  4R4I A;  2IX3 A;  2VUM G;  1NSN S;  4GKK L;  4LF8 L;  1PMR A;  1YNX A;  4X64 L;  4HID A;  3AFP A;  4IPG A;  4R4C A;  5ELF A;  3KLR A;  4JOI C;  2AMC B;  4JI8 Q;  1PTO B;  3OPO A;  3PO2 H;  3ER0 A;  4A3J G;  1ILQ A;  3Q6S A;  4DV3 Q;  2V4D A;  4JV5 Q;  3PO3 H;  4J1M A;  1SNP A;  1CKM A;  5FO7 B;  5GQO A;  4ZKC B;  4NP5 A;  4K5W A;  1SYC A;  4NXM L;  3PO2 B;  4RHR A;  2KHI A;  4ZCK A;  3CAM A;  1K28 A;  1JJ2 A;  2ASB A;  2ICI A;  4RWS C;  1O78 A;  2UXD L;  4OIK A;  2JA8 B;  3I91 A;  4RMF A;  1FVI A;  5FLX E;  1WTQ A;  1Y1V H;  1Q82 C;  4JW0 A;  3HOX G;  1E1T A;  4DAV A;  2ZTC A;  3I4N G;  2F0K A;  4PMC A;  4DXG A;  4DPG A;  1XMQ Q;  1EYC A;  1GUO A;  5E1F A;  1BOS A;  4XIG S;  1LYL A;  4IUV A;  5CBE E;  1CSP A;  2WAQ E;  2EIF A;  2PMZ B;  5JJK A;  2DJF C;  4LF4 Q;  1CSQ A;  1VQA A;  4B3T L;  1UE5 A;  4JI8 L;  1Q81 C;  4A3M B;  4GKJ Q;  3TZD A;  2VQF Q;  2F3V A;  1AE3 A;  1VQD A;  4DK3 C;  4F7X A;  2R93 G;  4IQZ A;  3EJI A;  1NR2 A;  1F2Z A;  4IPD A;  4ODG A;  1HRJ A;  1PRT B;  3HOV B;  1EYD A;  4C3J B;  4A3L G;  5CV7 A;  1Q86 C;  4WJW A;  4ZUJ A;  5L37 A;  1TWG H;  4CJ1 B;  1II3 A;  5LHY 1;  2F3I A;  5M5X B;  4OWW B;  3FHW A;  2EZV A;  4PZ6 A;  4UHV A;  3X3N A;  3NWT A;  5C4X B;  1BNZ A;  2F4V Q;  2VB2 X;  5IWA L;  1IYU A;  1IW7 D;  5CV5 A;  4BBR G;  3S17 B;  4M1U B;  2ZJP A;  4JBK A;  2J4X A;  2JXM B;  3FKI B;  2BA1 A;  2ZJQ A;  2DJG C;  3GTM H;  3F2D A;  4P73 A;  3U4V A;  3HOW H;  2BDN A;  3OSO A;  5JAV A;  4K8I A;  1U5K A;  2QKI C;  3M85 A;  4AIM A;  4OEL B;  1BCP C;  2G9D A;  1K8O A;  2F0L A;  1SJH D;  2ZM6 L;  1KHI A;  1Y8N B;  1NAP A;  3PIP 3;  2IL8 A;  3CCL A;  2EYJ A;  3CRL C;  3D4R A;  2JSO A;  1Y8P B;  1IBM Q;  2XWJ B;  1J5E Q;  2R92 B;  1J5E L;  2I07 B;  3I70 A;  3S14 H;  5CYU A;  4C3H H;  3KLW A;  4FXG C;  1CKN A;  1MD2 D;  1HNW L;  1H95 A;  3CHB D;  1A3V A;  3DWA A;  2K5D A;  2CVR A;  2OCE A;  5IT9 E;  1E2W A;  1RL2 A;  3GV3 A;  3TRZ A;  3OWE B;  3GTJ H;  1H9M A;  2VB3 X;  1B1Z A;  5C6A A;  4APV A;  4LF6 L;  3NTK A;  2E2J H;  2OTJ A;  2X6G A;  3DLL A;  4A3K B;  2NVT B;  3M7N A;  3GTK H;  2H5X A;  4K6D A;  2EPB A;  3STB C;  1LLR D;  1B7Y B;  1BBW A;  2DNE A;  4NW2 A;  3S1R B;  1H9J A;  1SR3 A;  1SJE D;  2XIW A;  2K05 A;  4IUQ A;  3C2P A;  4EQN A;  4PQX A;  5I9O A;  4R4Q A;  4KHP Q;  2Z6K C;  4POG A;  1DXM A;  1JWS D;  1SE4 A;  3MFG A;  3S2D B;  3S16 B;  5FLM H;  2OT2 A;  5C3E G;  3I90 A;  4DV1 L;  1TS2 A;  3I8Z A;  4POF A;  3KLS X;  4R9W A;  5HUR A;  1PZJ D;  1Y1V G;  2E5L L;  1B3A A;  2K5N A;  4FXK C;  4Z9C B;  1OXU A;  2NVY B;  5CV4 A;  1DJR D;  3BJU A;  5COR A;  3M4O H;  2JA5 B;  4HIK A;  4B3T Q;  1WTX A;  5CBA E;  5KNC A;  1EWH A;  2B2T A;  1WD1 A;  2K5V A;  2F0M A;  2DY7 A;  2A68 C;  3FRP B;  3KLS A;  2EVB A;  2EY5 A;  4XYO A;  3W3A A;  1UE7 A;  1XPO A;  3K58 A;  1VCI A;  2RQX A;  1DGS A;  2EY1 A;  4KHZ A;  2PW5 A;  1XXG A;  4HJ9 A;  1AW7 A;  3I4N B;  2WKC A;  3EVQ A;  5JEA J;  1SYG A;  1S40 A;  1N8R C;  4DV5 Q;  1B2T A;  2L15 A;  1L2F A;  4DV4 Q;  1QIL A;  4DV4 L;  5FOB B;  3ITP A;  1PRT C;  4HTH A;  1VQE A;  2Y0S E;  4A3M H;  2F0O A;  4AH6 A;  3J80 L;  4DAM A;  1PZI D;  1EIY B;  3V05 A;  2P5Z X;  1NMF A;  2JEB I;  4JI4 L;  4IPC A;  1ET6 A;  1FYC A;  1E1O A;  2HCC A;  4FF4 A;  3A0J A;  3H3V H;  5ELN A;  3CC4 A;  5EKI A;  4DR2 L;  5A2Q L;  5M5W B;  1QB5 D;  1K8A C;  1L0X B;  1TKW B;  1HNW Q;  1F9R A;  4JK1 C;  1WTW A;  2L4N A;  4DR7 Q;  1YZ6 A;  3HRZ C;  3ND9 A;  5AJ3 L;  4DFA A;  1KNA A;  3GTO H;  1G6Z A;  5LMN Q;  2KA7 A;  4GOP B;  1RTO A;  2VZA A;  1TQO A;  2IX0 A;  2XRS D;  3N52 A;  1JIC A;  5IYD G;  3M4O B;  3GDE A;  4YWM A;  5J39 A;  1SAP A;  1F2Y A;  1YVC A;  5JJL A;  4R1J A;  1VQC A;  3BG3 A;  1TY2 A;  2LXJ A;  2A6E C;  2DN8 A;  4DV1 Q;  3V2T A;  2B63 B;  2QGQ A;  4JYA L;  5DAU A;  3NE5 B;  4C56 C;  1E3P A;  5C3W A;  1DYQ A;  4F87 A;  2FMC A;  4YWK A;  1SEB D;  1Q1E A;  3D6C A;  2IWH A;  2WB1 G;  2JA7 B;  1N32 L;  4KN4 C;  3K5O A;  2B2T C;  4LUV A;  1FL0 A;  4IZ8 A;  1L1O C;  4C1N K;  4DK0 A;  4DR1 L;  2FXQ A;  2NBF A;  2K52 A;  1TXY A;  4U67 3;  3QJY A;  5ELO A;  1K3R A;  4JI5 Q;  1M8A A;  4X3T A;  1JOR A;  1CI3 M;  5M5Y B;  1I3Q B;  3OIP A;  4BWG B;  2WAQ G;  4DU9 A;  5EKK A;  4S3S A;  4O42 A;  2HQL A;  3AB9 A;  3Q8D A;  3GTJ B;  1BCP F;  2O5J C;  3PUV A;  2IPK D;  2WAC A;  4DKA C;  1N36 Q;  3P20 A;  3I4L A;  4HIO A;  1PH1 A;  1PFM A;  3CW2 C;  1HHV A;  2FIN B;  1DM0 B;  1NNX A;  1NY4 A;  4KLK A;  3NQI A;  1Q8I A;  4KI0 A;  5K5P A;  2KED A;  1WTH A;  4EGV A;  1AEX A;  1X3F A;  3H94 A;  3K81 C;  3S14 B;  5C3E B;  4KHP L;  2B39 A;  2YTY A;  5IE8 A;  4IFD J;  3R93 A;  1AH9 A;  2G5D A;  1CKN B;  1N32 Q;  3RMH A;  1K3B C;  3UE1 A;  3A74 A;  1DOL A;  2NB0 A;  1QVG A;  4BY7 B;  4L6T B;  3R8B A;  5KNB A;  4B3R Q;  4ZKB B;  4BS9 A;  1YJN A;  1YBY A;  1WTP A;  3HZX A;  5DLQ E;  2Y0S G;  3D8G A;  5HY6 A;  5T1I A;  3BZD B;  4HMJ A;  1VQO A;  1O7Z A;  1ML0 D;  4P74 A;  1KLG D;  4JI2 L;  2IHE A;  4OO1 G;  3MXP A;  4FVM A;  2VQE Q;  3NSW A;  3PUY A;  1HZC A;  3W5O A;  1ENF A;  1STA A;  2I5L X;  3H0G H;  1EY0 A;  1S5E D;  4X64 Q;  5M5X H;  4G7H C;  1H9S B;  1HZ9 A;  1JE5 A;  1ZXT A;  4YY3 L;  2YTV A;  1QG7 A;  1R4P B;  2A74 C;  1LAB A;  1SYD A;  1SRU A;  4IAL A;  1I94 Q;  1CUK A;  4OX9 Q;  2F0I A;  2L5T A;  3SK5 A;  1E22 A;  2EJM A;  3I72 A;  1LTS D;  4BA1 I;  2O5I C;  3F2B A;  3WOE A;  2B2Y A;  4LF7 L;  2LXK A;  4X3U A;  4CHT B;  1Y1W G;  2RCN A;  3CRK C;  1L1O A;  4XQN A;  3G6E A;  1VQK A;  2WAQ B;  4H13 C;  3U4Z A;  3CCV A;  5LL6 S;  4A3G H;  4JI2 Q;  1QNU A;  1N33 Q;  1HTP A;  3R2T A;  2F0D A;  4JI6 L;  1J9O A;  1LUZ A;  1SNM A;  2F4V L;  3LNN A;  3QR8 A;  1A6X A;  1EEI D;  2KCC A;  2NN6 H;  2Q8R E;  2ENB A;  3KBX A;  3I7F A;  3W2D A;  5C4X G;  3J81 L;  3MHB A;  1TVX A;  4ZLT F;  5CGK A;  1VQJ A;  1PXU A;  1PHJ A;  5I2Y A;  1VF7 A;  3SK4 A;  1AP0 A;  2OTL A;  1IKM A;  3DUZ A;  4JI3 L;  1PFN A;  2LFN A;  1NUC A;  1TWA H;  2KEE A;  1LT3 D;  3A5U A;  1KRS A;  2QIL A;  2A6E D;  3QWN A;  2LY7 A;  1VQ6 A;  4JYA Q;  3GO5 A;  1HXY D;  3U9O A;  1N33 L;  1HUN A;  1IHZ A;  4BXX G;  3NEL A;  2L12 A;  2B63 H;  3J7A 5;  1V43 A;  1BDO A;  1GUW A;  5FJ8 H;  1HR0 W;  4OXP A;  4CKE A;  4H02 A;  4X65 Q;  1JQY D;  5ELE A;  2NTT A;  2RA4 A;  1B70 B;  5IGB A;  3C1F A;  4IUU A;  4LF9 Q;  3ONA B;  1VQ9 A;  1W6J A;  4XT3 B;  3TS0 A;  2Z8L A;  3GTO B;  1J8I A;  5KRU A;  1HQM C;  3CXC A;  4LF9 L;  2WP8 J;  1PV4 A;  3MXU A;  3I4M H;  1B9M A;  4YY3 Q;  5GAD C;  5BR8 Q;  2EY2 A;  1A2T A;  5M9O A;  3G6J B;  1IYJ B;  4A3F H;  1XMO Q;  1Z6H A;  5M5W H;  3G71 A;  3TBI B;  4B3S Q;  5KYI A;  2QEX A;  3RN2 A;  1VQ8 A;  5IT9 L;  4FXD A;  2JJQ A;  4QGU A;  1SSO A;  1MKH A;  4IO9 A;  2CCZ A;  2EXZ A;  1HZB A;  5C3X A;  5E7N A;  4QCL A;  3D6W A;  3S1M B;  1EY5 A;  3H6M A;  4A3B H;  4PNY A;  2KUM A;  2IY5 B;  1Q7Y C;  4GN5 A;  1FJG L;  2Q2H A;  3ND8 A;  1HPC A;  2YTX A;  4K14 A;  3KYH C;  4L8J A;  3CP0 A;  1C4Q A;  1K83 H;  4CDC C;  2EE1 A;  4YCU A;  1R4Q B;  1RIP A;  3CKI B;  4G57 A;  1O7Y A;  3IKJ A;  2EYM A;  2IX1 A;  3PUZ A;  5JEA H;  3TN2 A;  1STB A;  1EY7 A;  4LWC A;  3K57 A;  2D9U A;  3A8K E;  5IGG A;  4JC0 A;  1I4R A;  4A3E H;  2JA5 H;  3R3O A;  3J81 c;  5DEH A;  1JC7 A;  1EFW A;  2HD3 A;  1KC8 C;  5M3M G;  4A3C G;  1TWA B;  5EKL A;  1I4X A;  4KY5 A;  5BN3 A;  5CC4 A;  1SLJ A;  5M3F B;  2RHQ B;  1PLF A;  4OHJ A;  2Y0S B;  1GXD C;  3K8A A;  3Q24 A;  3M4Q A;  3NP8 A;  4JPB W;  1LTB D;  4RCO A;  1DCZ A;  1GUG A;  4UP7 A;  2R7Z G;  3WDN A;  3MZ5 A;  3STB D;  2H1E A;  1DON A;  3QB3 A;  2K1B A;  3L0O A;  4AYB B;  1SMY D;  2JEA I;  3CD6 A;  1A63 A;  5H1S E;  4FF1 A;  2VXW A;  2VY3 A;  1A0I A;  3AFQ A;  4DR5 Q;  2KQ3 A;  1VQ5 A;  1WTV A;  1KL9 A;  1MGS A;  3MXN B;  1A15 A;  2M9V A;  1M90 C;  3CCU A;  4LUO A;  4QB4 A;  3MVV A;  5A35 A;  2C9O A;  3M4P A;  3HEJ A;  1VMP A;  4RKL A;  3NBH A;  4ZYS A;  4A3J B;  4DAY B;  3HOV G;  4A3D B;  2CWA A;  5BR8 L;  5LMN L;  3TZU A;  4HR7 B;  2VUM H;  1SE8 A;  1SMY C;  3HOW G;  3S2H B;  3OTO Q;  4LFA L;  1ONL A;  4GLA C;  5IYC H;  2R92 G;  1EQQ A;  2JA6 G;  4NDX A;  2BCO A;  4O0A A;  1UEB A;  2K14 A;  3P1H A;  1IBM L;  2N55 A;  3MXN A;  3VR6 A;  2UUA Q;  2R92 H;  4KD4 A;  1GUT A;  1L0W A;  1LV9 A;  2I0Q A;  4K0K L;  1V1Q A;  2QEJ C;  4UY8 C;  1FD7 D;  4L63 B;  4B9X A;  5D3D A;  1PH4 A;  4DV2 Q;  3HOX B;  5EBC A;  3PIO A;  4K8J A;  3HOU H;  3MA2 B;  1X55 A;  1Z47 A;  4LFC L;  3TDQ A;  2HHH Q;  2F0S A;  1UUP A;  5CV9 A;  2N49 A;  3DWQ A;  3RZO B;  2F03 A;  3TQY A;  4LFB Q;  4EVO A;  2K50 A;  3UDI A;  3HOU B;  2F0F A;  1D5Z C;  1JMC A;  2UXC L;  1O80 A;  1C8C A;  2B2U C;  2HCI A;  2XSC A;  4AYB G;  4DV2 L;  1CFM A;  4PMB A;  4FNF A;  5DM6 3;  5C4X H;  2AQ3 B;  3GTL B;  4A76 A;  4C3J G;  4IJL A;  4MTN A;  1W6K A;  2EQS A;  1PH2 A;  1F77 A;  1I4Q A;  1OXS C;  2TMP A;  3J80 E;  1CKO A;  1D1K A;  1EWC A;  2UUA L;  2R93 B;  3SDZ A;  4Y7N H;  4OWT B;  1KDC A;  1KDA A;  1V1P B;  1G2S A;  1T5X D;  3RLF A;  4C3J H;  1YNJ D;  4DV6 L;  5IYD H;  2VUM B;  3AU7 A;  1B3Q A;  3PQI A;  3NTH A;  2KBN A;  4IUN A;  4IPH A;  4A3J H;  1IBK Q;  4JI1 Q;  4UAI A;  3I55 A;  3A56 A;  2BE5 C;  1B4O A;  2HT1 A;  3VYT A;  2A6H C;  1X3P A;  1XNR Q;  3I73 A;  3QO2 A;  1SE2 A;  3K59 A;  4JI1 L;  5J3B A;  1F9Q A;  1KIX A;  4A93 B;  2CQO A;  2Z4H A;  3HKZ B;  1LTA D;  4RFB A;  3KF8 B;  5IGC A;  4LF5 Q;  4DR7 L;  2QDB A;  4OX9 L;  2HDL A;  4RKB A;  3T56 B;  3F8T A;  4EQO A;  2O2L D;  1FNU A;  4DR2 Q;  2AWN A;  3GTG H;  3U50 C;  3HP3 A;  5HGQ A;  1D7Q A;  4JI4 Q;  3BVZ A;  1I6H H;  4OEM B;  5GAE C;  3F2C A;  3HG9 A;  1H9S A;  3MEH A;  4HCE A;  3A54 A;  1PH5 A;  5FK9 C;  4WOR A;  3PMF A;  4J15 A;  4O2D A;  1U4P A;  2GN5 A;  4LF6 Q;  1I6V C;  1ENC A;  1Q1B A;  3D0F A;  1SMX A;  3VYU A;  5FLX L;  2PNH A;  3LWE A;  5IYB H;  2WKD A;  2Q2I A;  2K6A A;  4HJA A;  1I6H B;  2RSN A;  2L0C A;  3T16 A;  1CTM A;  2RDH A;  4UDU C;  5IYB G;  3OOC A;  1PTO H;  2I5M X;  3A8J E;  3ERO A;  2CWP A;  2KEN A;  5DNF A;  1ZYR D;  1RF2 D;  2R7Z H;  4ZRZ A;  3G4S A;  1XWE A;  4IOA A;  4QMG A;  2ZM6 Q;  5C0X I;  3Q23 A;  1JWM D;  1C0A A;  5LMU L;  2B2U A;  4QJF A;  4A3F G;  2QW7 A;  1DOK A;  5E3F A;  4KJO A;  3T13 A;  2ID0 A;  4A3B B;  5C5M A;  1CK1 A;  1EU4 A;  1N36 L;  5EQ0 A;  1HCZ A;  2Z6K A;  3JAM c;  5EGT A;  2HQE A;  4GNX C;  3QOJ A;  2C35 B;  4F8M A;  2B2W C;  3CME A;  1LT4 D;  2WIN B;  1A62 A;  1EUJ A;  5I2X A;  1PRT D;  1SRO A;  4ZUI A;  3SEB A;  1JWU D;  1CA6 A;  1VQ4 A;  1B44 D;  1XTD A;  2B2V C;  1PYW D;  1EIG A;  4R4T A;  1IZ6 A;  2OWO A;  2K03 A;  1PH3 A;  3TEH B;  3PCO B;  4K5V A;  2AUK A;  2MFI A;  4X62 L;  1KD1 C;  1CZW A;  5IP7 G;  3CCM A;  1DD2 A;  4JI6 Q;  1TS5 A;  3IL8 A;  1PVO A;  2A68 D;  4EQ5 A;  2IW3 A;  3HFZ B;  1SND A;  2FMM A;  3RZO H;  4X3S A;  1TWH H;  4K2K A;  1E2V A;  1KDB A;  3HKZ E;  4FF3 A;  3L9A X;  2RHS B;  3CCS A;  4I65 A;  1SNO A;  3IFD A;  2XNA C;  4RA8 A;  2RCF A;  3HOX H;  2K5W A;  2OEO A;  2X69 A;  4DNR B;  4BBS G;  1RKN A;  4Y52 H;  4C3I H;  2EDG A;  1EY4 A;  4UP9 A;  1HQR D;  3H91 A;  2SNM A;  4OO1 I;  3MC0 B;  4MIU A;  2QCP X;  2B8G A;  2K5Q A;  2JE6 I;  2XVS A;  1GM5 A;  2CH4 W;  2E2I B;  4DK6 C;  5IIF A;  1GUN A;  3KJO A;  4DAY A;  1HZA A;  4I7Z C;  1R9T B;  2WB1 E;  1SDF A;  3OIQ A;  1PH8 A;  2PQA B;  1EZ6 A;  4XDX A;  2UXB L;  3ULL A;  2NZ1 D;  4MTK A;  3MAQ A;  4IFD G;  1H9K A;  2B63 G;  3RZD B;  2F3W A;  1X3G A;  3EA6 A;  4ULL A;  3SK8 A;  1M1K C;  1HNZ Q;  4A3I H;  2AHO B;  3M3Y B;  1PFS A;  5GAH C;  5T1G A;  1SN8 A;  4N8X 1;  4A3I B;  1KLU D;  1RTN A;  4UP8 A;  2LMC B;  3HGB A;  1EY6 A;  1QZH A;  2PO4 A;  3X3M A;  2PQA A;  2RKS A;  4M8A A;  4H7B A;  1AN8 A;  1ICF B;  5KYL A;  1U4R A;  1OO9 B;  1JOQ A;  1E7Z A;  4YIJ A;  1NTG A;  4JVZ A;  5AJ3 Q;  4DUZ Q;  5EPL A;  3K0X A;  5IY0 A;  4ZQ3 A;  1EYG A;  2YU9 B;  1PTO F;  5C44 H;  3O13 A;  3JAM L;  5JPN C;  3OTO L;  4ME5 A;  3VYR A;  2IHF A;  3H0G B;  1HH2 P;  1KAA A;  3OHX C;  1G8Z D;  5C0X J;  2NTS A;  3GTM B;  1I50 H;  1A2U A;  4C3I B;  4A3E B;  4GS3 A;  2EYH A;  2D62 A;  2E5L Q;  4JI0 Q;  4B08 A;  1HNZ L;  3NWS A;  1STN A;  4L5S A;  3JAM E;  4N8F A;  2Z1C A;  3CPF A;  2DGY A;  5D65 A;  2JYO A;  1D6E C;  4J8Q A;  1I50 B;  4OIJ A;  2AUJ D;  3HOU G;  4KJN A;  4JI5 L;  2NVQ H;  3CCR A;  4B3M L;  3EFX D;  3LX0 A;  4HJ5 A;  1AE2 A;  4X6A H;  4JI3 Q;  4IUT A;  4L5Q A;  2QDL A;  3HOV H;  4HED A;  4PZ7 A;  1XX8 A;  4B3M Q;  5LMU Q;  1EQV A;  3CCJ A;  3KF6 A;  5JEA G;  1O7L A;  2N78 A;  2FJ2 A;  3L7Z C;  5NUC A;  2F0N A;  3A5Z B;  3GQB A;  5ELC A;  1WD0 A;  4A93 G;  3BDC A;  3H09 A;  2ZJR A;  2JA5 G;  4RGN A;  1VQF A;  5CV6 A;  2CFM A;  3GTP B;  5EJW A;  3K5M A;  4LF7 Q;  1BVS A;  1RDP D;  2MQH A;  2MUY A;  1EU3 A;  2F0Q A;  3CCQ A;  2LKV A;  2YV5 A;  1PRT F;  5M5Y H;  3QOL A;  2MO1 A;  2X6L A;  3V96 A;  3DWP A;  5FO8 B;  3I4M B;  1JJC B;  4DR1 Q;  4DK1 A;  1TU2 B;  3FKI G;  3IAY A;  2EYL A;  2CH4 A;  1XNQ L;  1QZG A;  1IBL Q;  4HCS A;  4CJ2 C;  2K5H A;  1K73 C;  1K0R A;  3TP7 A;  5FKA C;  2JA8 G;  3L3O C;  5KIX A;  1N9W A;  2A1A A;  5K36 G;  2OQK A;  1V9P A;  3KDF B;  4TKO B;  1D5M C;  3CC7 A;  4KKT A;  2PPB C;  4LF5 L;  2VNU D;  3SHL A;  2QF7 A;  4B3R L;  1XPR A;  1FGU A;  1IYV A;  3RN5 A;  1WJJ A;  3MEF A;  1TWH B;  3TRE A;  3E6Z X;  1S72 A;  4GLX A;  3MFY A;  1Y1W B;  4H44 C;  3BZC A;  4FDB A;  4A3K G;  1ASZ A;  3ZYY X;  2N3S A;  2XGT A;  1CHQ D;  1BBX C;  4XQJ A;  1X54 A;  4LF8 Q;  1CA5 A;  1HFN A;  3S1Q B;  3E9H A;  5G3L F;  2IT1 A;  3D3R A;  1FGB D;  3GTG B;  4R8N A;  3NEM A;  4JG2 A;  1I94 L;  3EIV A;  3AYH B;  4LK1 C;  2UUB Q;  1PYS B;  1UWV A;  4NKL A;  4IUR A;  2F0E A;  3GD7 A;  2C5C A;  4TSS A;  2RVL A;  3A8I E;  1MJC A;  2E2H H;  5EBD A;  1FNW A;  2L11 A;  1F2L A;  1QVF A;  4NXN Q;  4NB3 A;  1I4P A;  3J7Y W;  2GVB A;  2M2L A;  1KAW A;  3S1N H;  2I46 A;  3S1N B;  1S3O A;  4FP5 D;  3ULJ A;  1W3S A;  4IJH A;  2ZTD A;  1SE3 A;  1QOH A;  2WFW A;  1DZ1 A;  1BBU A;  1HNX Q;  3S9W A;  4HAE A;  1TWF H;  2VW9 A;  2NVX H;  2ZTE A;  3C46 A;  4BY7 G;  3J7A V;  1I5F A;  3OW7 A;  1NMG A;  3OW2 A;  2R7Z B;  2ZXR A;  2VS1 A;  1ENA A;  5EPK A;  4Q0F A;  3BYT B;  3CC2 A;  1SYF A;  2B3G A;  1BCP D;  4BXX H;  5C4H A;  1VQL A;  2E74 C;  2CQA A;  1YI2 A;  4G4K A;  1B8A A;  3E3X A;  1VDZ A;  3ERS X;  4TVA B;  5FJ8 G;  5GRO A;  3DHQ A;  3EQL C;  3NHH A;  3NK9 A;  1K8M A;  3VA5 A;  3K0Y A;  1WVL A;  5C5L A;  1IW7 C;  3BVM A;  1XNR L;  2D0O A;  3SR1 A;  4RGO S;  2K75 A;  2JP1 A;  2L9H A;  1BXT A;  2GA4 B;  5KND A;  4J6H A;  1PTO C;  2NUC A;  1QUQ B;  1TT2 A;  2F0W A;  4E6I A;  1WCM B;  4DUZ L;  3J81 j;  2V1C C;  1Q46 A;  3E9I A;  1VMC A;  3NPP A;  3KJP A;  1ESF A;  3PSI A;  4HSP A;  2Z4I A;  5CV8 A;  4OON A;  3ERQ A;  4TRD A;  4O1N A;  1TII D;  2D2C C;  3BVG A;  4K5X A;  2ALY B;  2BH8 A;  3S15 B;  2NWG A;  4HMI A;  1A3U A;  3TSS A;  1YIT A;  1SXT A;  3UDF A;  2XWB B;  2NVT H;  2NYZ D;  4A3K H;  4CDF C;  4GNX A;  1IL8 A;  5FLX c;  1VF5 C;  2EOT A;  3K6O A;  1YNN D;  2UUC Q;  1K0S A;  1SYB A;  5AFW A;  4OGQ C;  1E24 A;  1GD7 A;  4WJ4 A;  2B2V A;  2HIX A;  4LFC Q;  2DNC A;  1G2T A;  4NXN L;  3GTP H;  2E75 C;  2RDG A;  3FPP A;  3GTQ H;  1CHP D;  2D0P A;  5JPM C;  3I56 A;  3LWU A;  2NZH A;  4Y7N B;  2F0G A;  3T51 B;  2EYO A;  3P75 A;  3J80 c;  2SEB D;  2O4X A;  1Y14 B;  2KJX A;  1G51 A;  1BR9 A;  3QG1 A;  4XTC S;  4KKU A;  2CW0 D;  1PH7 A;  1U9R A;  1WCM H;  2B2Y C;  4CDD C;  1G6P A;  4FF2 A;  3PF4 A;  3GTL H;  4C2M H;  2PYK A;  2A69 C;  4K2L A;  3H3V C;  1BUV T;  3SE0 A;  1HR0 L;  1GHK A;  4V19 0;  2A19 A;  2E2D C;  3BDO A;  3HS0 C;  4DN4 M;  3HOY G;  2SOB A;  4CKB A;  3PGZ A;  2VQE L;  2NVQ B;  5IP9 H;  4RGM A;  1EIF A;  3EBE A;  4C3H G;  4HIM A;  3M7G A;  1SNC A;  4LF4 L;  5CMD A;  3OWF A;  1YHA A; 
#chains in the Genus database with same CATH homology
 1ICF B;  4OEL B;  2DJF C;  4CDC C;  4OEM B;  4CDF C;  1K3B C;  4CDD C;  2DJG C;  1MHW C;  4CDE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...