3MA2B

Complex membrane type-1 matrix metalloproteinase (mt1-mmp) with tissue inhibitor of metalloproteinase-1 (timp-1)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
124
structure length
117
Chain Sequence
CTCAPVHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFDIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITLCSFVAPWNSLSLAQRRGFTKTYTVGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Matrix metalloproteinase-14
publication title The Intrinsic Protein Flexibility of Endogenous Protease Inhibitor TIMP-1 Controls Its Binding Interface and Affects Its Function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 26
structure length 117
sequence length 124
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3ma2B00
2E2DC 2ICEC 1BUVT 2TMPA 3T4AC 2WIIB 2QKIC 3CU7A 3MA2B 1JB3A 5FOBB 1BR9A 1XWEA 1OO9B 2J0TD 5FO7B 3HS0C 5FO9B 2I07B 4FXGC 3I70A 3HRZC 3G6JB 1GXDC 5JPNC 3OHXC 3KLSA 2B39A 3CKIB 4FXKC 1JC7A 1PXUA 3FRPB 2XWJB 2XWBB 2WINB 1BQQT 5FO8B 3L3OC 1UEAB 5JPMC 3V96A 1D2BA 2A73B 4ILWA 2A74C 1UAPA
chains in the Genus database with same CATH superfamily
1B53A 1ONLA 2F0FA 5C4JB 3T13A 4DAPA 1DCZA 5M5YH 1D5ZC 1JWUD 4OWXB 4BBRB 1HA6A 3D31A 5EKLA 5EPJA 3CC4A 1A0IA 3HOVB 3GDEA 2GVAA 3RZDB 3NWTA 3NHHA 3S1RH 4IURA 4A3BG 4DV1L 1LTAD 4B3MQ 3RN2A 3UI2A 4CKEA 3WDNA 2UXCL 2EYPA 2Q2UA 2PQEA 3KF8A 2C5CA 4JI2Q 2DNEA 3B6YA 3TREA 2HDMA 3CP0A 1O7LA 2EY2A 4IUQA 4QUCA 3CW2C 3NBIA 2ZT9C 3ULLA 1B4OA 2L9HA 2ZTDA 1K8GA 4WRDA 1C4QA 2X6LA 1YIJA 3TP8A 4GOPC 1IKLA 3S2DB 3W1GA 1YJWA 2BA0A 4OO1H 3D6CA 1FR3A 1KNAA 2JA6B 1LTBD 4KKTA 4P73A 1BF4A 1PLFA 5CV7A 2Q8IB 4LF9Q 2HCIA 2L0CA 1C0AA 4AH6A 1G8ZD 4JI3L 3VYSA 1SXTA 1TKWB 3J81c 1DZ1A 4NW2A 3A0JA 4UDUC 1SYDA 3LGJA 1EQTA 2KCTA 2R92B 3LWUA 2H1EA 3FPPA 2EDGA 2R7ZG 4OO1I 2M9VA 5C3EG 3KF6A 3GD7A 5KRUA 2WP8J 4KY5A 1HR0W 4LJZC 1H9SB 4RFBA 2LS01 3J7A5 2RF4A 2KUMA 2KA7A 1PH8A 1STEA 4DV2Q 1VQEA 4RMFA 3KLSX 4ZUIA 1PFSA 1IL8A 4A3FG 2XGTA 3E0EA 2Y0SE 4B9WA 5I9PA 1HA5A 1D8LA 1Z6HA 3PCOB 1J6QA 4IJHA 4GLXA 4A3DG 2H4OA 4LFBL 3BYYB 4HIDA 1EY7A 5IYBG 4DUYL 4K5XA 2G5DA 2TSSA 4FDBA 1Q86C 2WB1G 1EYDA 4G7OC 1PMRA 1L1OB 2JA7B 2VS1A 1HZBA 3M4YA 3MXNB 2UXCQ 1SMYC 5CBAE 4K5VA 2GVBA 4MHEA 4GNXB 3BDOA 2UXDL 1FYCA 1MSHA 3VYUA 1GOZA 4HCEA 5CV6A 1EWCA 3U9OA 3SK6A 2IWHA 3A8IE 2D0PA 3VA5A 4NXMQ 1YNNC 3BDCA 4RGNA 1ML0D 1LTRD 5IOCA 4UAIA 4KY7A 5JEAJ 2BA1A 4R4OA 4L5RC 3S14B 1O7YA 4A3GB 5DLQE 1BR9A 3GTOH 4JI3Q 1B1ZA 1Z7TA 1QILA 3TMEA 3M4QA 3K5OA 3KF8B 1E2VA 4CHTB 3PGZA 1CT1D 4A3CG 1ENFA 1WCMB 1XMQL 3HOWB 3RMHA 1RCVD 1UEAB 1AW7A 2A1AA 1M90C 3T51B 2HQEA 4HMJA 1XNQL 2WAQB 4DA2A 3K59A 3RUZA 4LFCQ 3CCVA 2VQEQ 3ONAB 1QG7A 3GP7A 2K5WA 2F3WA 3FKIG 4FVMA 1A2UA 5KYLA 1ZYRD 4LMQD 4X62Q 2DGYA 1TWHB 4G7ZC 3GTGB 3TS2A 1EQRA 1WVLA 1BBXC 2LY7A 2WKCA 3DUZA 1NR2A 2O4XA 4YCVA 1I4RA 1I50B 1S40A 1HNZQ 4JI5L 3X3NA 2UUAL 1P16A 2Z1CA 5EJWA 1BDOA 2MFIA 2NYZD 3J80c 2B8GA 2UXDQ 1Q8KA 3KF6B 5JAVA 1ZKOA 1D1KA 2EYMA 5JPNC 4JV5L 4G4KA 2B63G 1UE6A 2F0WA 1XNRQ 4X66L 2PNRC 3CCRA 1PH4A 3IL8A 2NVTB 1LTGD 4U68A 3CRLC 4LF6L 4XQNA 3OMCA 1FGBD 1SROA 2R7FA 5CYUA 3DWPA 2IHFA 5IP9H 3A55A 5K36H 3CPWA 3PO3B 5JJIA 1ICWA 4ZCKA 1PH3A 1HHVA 3HFZB 1A3UA 4RH6A 4B08A 5LL6S 1Q81C 1HTLD 3HOUB 1X65A 1VS0A 1SSOA 1N8RC 1QNKA 1A3VA 3EQLC 4A3EB 1LTSD 2PYKA 1PXUA 4QJFA 4LF5Q 4B3RQ 3I91A 2O5JC 3MEFA 2P5ZX 5T1GA 4IALA 2L1BA 4RGOS 5KIXA 4LFAL 4DR1Q 3PUYA 1I4PA 3TZDA 3OYYA 1QZGA 3GTKH 3QB3A 2C35B 3DM1A 3D8GA 1NUCA 3Q23A 4GOPA 4IPCA 2AHOB 4B9XA 1N9WA 4TRDA 4IZ8A 3LNNA 4J1MA 3Q8DA 4OL7A 3NELA 1E2WA 1TWFH 5F2DA 2B2YA 3S1MB 1VQBA 5M9OA 2YYZA 3E9IA 4PZ8A 4DR5L 5ISRA 2RVLA 4OO1G 4BS9A 3WOFA 1I3QH 5C0XH 4YY3L 2JYOA 1AE3A 1HFGA 3FPUB 4JI5Q 2UUAQ 2OCEA 4IPHA 3UDFA 1PYWD 4KHPL 4ODGA 3BS1A 2Q8TA 3GTMB 2B2UC 4P74A 3D6WA 4HJ8A 5BN4A 2EVBA 3I4OA 4R8NA 1AZPA 1HNWL 4CGYB 2SDFA 4QY7A 4L8JA 5C0XI 5KYIA 1JOQA 3P7JA 4HIMA 4X3KA 2B2VC 2NN6I 4LF6Q 1HQRD 1JOOA 1VQJA 2Q2IA 1PH2A 4TKOB 4EQOA 1N33Q 5BR8Q 3JAME 4N8X1 1KDAA 3I4NH 5FO7B 3S9WA 5I6WA 1OXVA 2Q2TA 3K80C 3EIVA 2F0QA 1CZGA 2UU9L 4HSPA 5FLXL 3K8AA 1Y1VH 3CD6A 4DR6L 2LFNA 1PRTB 1CM9A 2E8GA 3HOYH 1D5MC 3MEHA 1EL0A 2CH4A 2E2HH 1VQDA 1ZYRC 1Y1WB 4C3IH 1SNMA 1PFNA 3GV3A 3ND8A 2AKWB 2PQAA 5DM73 3S16H 1SDFA 3V05A 1QVCA 1U9RA 2CVRA 3QOJA 3VR4A 3R2TA 2Y0SB 5ELFA 1EU3A 1MBYA 3HKZG 4KLKA 4XDXA 4MIUA 1GVPA 3OSOA 2RDHA 1HZ9A 1CQFA 1R9TB 4X6AH 4A3IG 4A3BB 2VW9A 2QF7A 5CV4A 4LUZA 4NDXA 1SYCA 2KCNA 3K0XA 4RHRA 3H3VI 2EYOA 2EY1A 4KHPQ 1X3PA 3W5OA 3OWFA 1VQIA 2PO4A 3K57A 4DR3Q 5I2XA 4UP9A 1YZ6A 1KAAA 3I7FA 3GTJB 1EY9A 1BCPD 4OX9L 2AUKA 2RCNA 4GOPB 4C3HH 1IBML 3U9SA 4J8QA 4AYBG 1ET9A 1PV4A 4KTAA 4YHHL 4UP8A 3Q22A 2RHSB 1GM5A 4A93B 4JYAQ 4RA8A 1JICA 2ZXRA 5J3BA 4ABNA 1N36L 3NTHA 2ZM6L 3A7AB 5M3FH 1C48A 4DV0L 2JA5H 2LXKA 4BWGB 3VR5A 2F0IA 1O7IA 3J81E 1JMCA 1EEFD 2R7ZB 1SNQA 2CHBD 5C3EB 1G91A 5DM63 1R4PB 3R2IA 4DR6Q 1LYLA 4PV1C 2Q8RE 4X64L 2HUGA 5ELEA 2QCPX 3PO2B 1G2TA 3FDTA 2ZJQA 3PIP3 2H5XA 2EXZA 5EPLA 2DJGC 2I07B 4M8AA 4HTHA 5ELOA 3VA7A 2PW5A 5IYCG 2K32A 2A69D 2AWOA 4YCUA 3NTKA 1RIPA 1JR0D 5LMUL 3K5LA 2F0PA 2J7ZA 2YV5A 3H15A 1SFOH 5IP9G 3EVQA 1UAPA 5K36G 4DV5Q 2KHIA 4GS3A 5C44H 4A3FH 2X6GA 2F0HA 4JC0A 4F88A 2CQOA 3ZJYC 2O2LD 5HGTA 1K3RA 3E9HA 2ZTCA 4A3DH 1X3QA 4BA2I 1I94Q 1S5CD 1TVXA 4H44C 5IYBH 2N8NA 1EY0A 4LF7L 4OX9Q 1KABA 2PQAB 5E7NA 2RA4A 3E3XA 3KK7A 2E2JB 2K4KA 5GADC 3M4OH 3C1FA 5EBDA 1GUNA 5FOBB 1V1OA 1PHJA 3AU7A 2ZM6Q 4JBJA 2WFWA 1XPRA 4XT3B 1XTDA 5IP7H 1E3PA 2RQXA 4RKBA 4O42A 4R4IA 1IL2A 2NTSA 1KRTA 1Q90A 1VQCA 2G9DA 2EOTA 5C0XG 2B2UA 2Z4IA 4KKUA 5IY0A 2X69A 1QZHA 4C3JH 1VMPA 4KHZA 4X64Q 1SE8A 1TU2B 5IODA 2RSNA 1XPOA 2MO1A 3P75A 1SRUA 4HEDA 4EX5A 1SE3A 1FVIA 1DM0B 3T1HL 4POGA 5ELDA 4P72A 5IGBA 2XWBB 2ICIA 5M3MB 3A5UA 1MIUA 3G48A 1HQMC 4N9TA 4A3JB 4Q5VA 1M1KC 3RN5A 4J15A 3UDIA 3EJIA 4MTNA 4C1NK 2K03A 1BCPC 4NMZA 1Z47A 3I4NG 4R1JA 3J80E 3GTQH 2JN4A 1Y8NB 4DR4Q 2EXDA 3SEBA 2B63B 3CCUA 1N34L 4BY1B 1NMGA 3H0GB 1DOLA 1KD1C 3BG3A 3AMUA 3V96A 2F0EA 1NCVA 4PNYA 2PPBC 3HOYG 1B2TA 1Q7YC 2NVYB 3JAMc 4DNIA 1H9RA 3IFDA 2MPMA 4RWSC 1JJCB 1LO5D 4C3IG 2K05A 2UUBL 2F0JA 2B2WA 4APVA 5M5YB 3N52A 1CFMA 4P2CB 1MHWC 5J1ZA 5IT9c 2Q2HA 3CC2A 2F0DA 3OW7A 2NUCA 1W6KA 4RGMA 1BXTA 1D7QA 2RKSA 2XWJB 2B8FA 2WINB 4DFAA 3MXUA 3C3LA 1XMOQ 5JVG3 1LT5D 3CU7A 5FLMG 1ESFA 2F0OA 1TWGB 4ZAIA 1I6HB 1VQ8A 1E24A 2YTVA 5GAEC 2EJMA 4QUFA 5BN5A 5COYA 2NVQB 1NAPA 4MN3A 3BVMA 2PCFB 1A62A 2VZAA 2B29A 2XN9C 1ASYA 2N55A 5C3XA 3DMUA 2N3SA 4C3HG 4L5SA 3S1NH 2KEDA 4ILWA 4BY7H 1IYVA 2VNUD 2L11A 1ILPA 1S5BD 4GKKQ 2G9HD 3OW2A 1GO3E 4FXGC 5M3FG 2JA5G 2K14A 1YEZA 3AYHB 4YIJA 2IPKD 2LSSA 3J81j 1EYCA 2RCFA 5IGGA 1TWAH 5HGQA 4R4QA 1NSNS 3BU2A 3MFGA 4AQYL 1IYJB 2A74C 1GD7A 2B2YC 1KL9A 2IW3A 3I90A 4DN4M 4KN7C 1Q1EA 1VQLA 3PV0A 1OTCA 1X54A 2F0GA 3U4VA 2UUBQ 4WJWA 5C6AA 4LF4Q 2FXQA 1EIGA 4K0KQ 3KDFA 3M7GA 1LTLA 3FMCA 4DUZL 4A3MG 2PI2A 3Q24A 2V1CC 4X3UA 3FRPB 2PW7A 4R4TA 5KEEA 2JA8B 1TIID 4EQPA 3R3OA 4G57A 4ID6A 4HJ7A 1K3BC 3ICEA 4JK1C 4DR2L 1IBKL 5KGUA 3L0OA 2HHHL 1A6XA 2B2TC 2RBMA 2VY3A 5C44G 1XJVA 1V9PA 1AH9A 1VDZA 3OTOL 3ULPA 2HDLA 1STHA 1WTOA 2MHVA 4H7BA 3PIO3 2FFKB 2SOBA 5KNCA 1KC8C 2JA9A 1QWYA 2KEEA 4F8MA 2Z4HA 4N8FA 1E1OA 3MXPA 3CMAA 4LF8L 4DV1Q 3P1HA 2E2IH 2K28A 1V43A 1QOHA 2WIIB 4LAAA 2K04A 3CCEA 1IW7D 1YITA 3IFTA 3TEHB 2R92H 3GTOB 4TVAB 5CC4A 5IP7G 3BVGA 4P71A 1VQMA 1ET6A 5DEHA 1TS4A 5FO8B 1E7ZA 4A3IH 4V190 1SEBD 4CBVA 4JI0L 1RDPD 2YU9H 4DNRB 1Q3LA 4C3JG 1L2FA 4XIGS 1A15A 1JOKA 1RL2A 2MNAA 3CXCA 3K7UC 4A3KH 4I65A 4XT1B 4JI8L 4B3TL 5K5PA 1WTHA 4HJ9A 1CI3M 3DLLA 3S1QH 4H0LC 1FL0A 3PMFA 3JAMi 4DUZQ 2JA7H 4OWTB 1VQHA 2K5HA 4IJLA 1HZCA 2VB3X 5IGDA 3C2PA 5ELCA 3ERSX 3MWYW 1SJHD 3HGBA 2I5LX 4ZRZA 2R7DA 3D0FA 2AMCB 4DR2Q 4IFDI 4R8IA 5C4XG 2EYLA 5J39A 2HHHQ 1HCZA 3L9AX 4YWMA 3E6ZX 3K6OA 2IY5B 4E6IA 1PA6A 3I70A 3OTOQ 2NTTA 2WB1E 2KJXA 1TR5A 1BBUA 1RD9D 1KNEA 1VQKA 4LFBQ 2F0KA 1WOCA 4DUYQ 4IPDA 5A2QE 5E3FA 3S15B 2K5QA 3KOJA 4UP7A 1H95A 4Y7NB 1LTTD 5M5XH 5LMNL 2K5DA 3NQTA 1CHQD 3I4MB 1B9NA 1XWEA 3L2PA 1WTRA 1EFWA 4H02A 5AFWA 3M4PA 4PQXA 3SVMA 2GA4B 3HOXG 1GUGA 1GXDC 4CDDC 1WCMH 5IYCH 1U4MA 1KIXA 2BH8A 1U4PA 4ME5A 1NR4A 3W3AA 3W2DA 4FXDA 1WTVA 1SLJA 2NBFA 4OHJA 3KUPA 3UDXA 1SE4A 2OXPA 1WTXA 1Z9FA 1BBWA 3TQYA 3GTKB 4R9WA 3F2UA 2K50A 3URYA 1TY2A 1EZ6A 3AQQA 1AN8A 4A75A 3L7ZC 2AUJD 4HIKA 1P8LA 2QDLA 3GTGH 3GQBA 3J7ZC 2F0MA 3SK4A 1HNXL 4FXKC 1KLUD 1TWFB 5IGEA 1DD2A 1X3EA 1T5XD 4DV6L 4TSSA 1RHPA 1A8VA 1Y69U 4R4CA 3DHQA 2VXWA 4DXFA 4DV3L 3RLOA 3J81i 2LKVA 1XMQQ 4BY7G 4FNFA 1F9SA 2XSCA 1S5FD 4FO2A 4K6DA 1UWVA 1S3OA 3J7AF 1XNQQ 1LLRD 3PF4A 1MSGA 2K75A 4HSVA 2Z9HA 3HKSA 3CCJA 4HJ5A 3TS0A 1I4GA 2AWNA 4LW1A 3NEMA 4JBWA 5CBEE 1HFNA 1F2YA 1EY6A 4K8JA 3I8ZA 2QDBA 4XQQA 2SEBD 4O1NA 1CK1A 4HR7B 2EIFA 5D3IB 1HTPA 2PNHA 4K8IA 4J6HA 1QJOA 4O2DA 4F7XA 3SE0A 2E2DC 2F1MA 2NN6H 4JI6L 4BBRG 1N32L 3NENA 5LMNQ 3KLWA 3CCSA 1XTCD 3HOVG 1KLGD 2AQ1B 4A3EH 5D3DA 4KKSA 1BCPB 2DJFC 3M3YB 2OWOA 4X65L 2A6ED 4JV5Q 2E75C 1XPUA 2B2TA 4PG3A 4X66Q 4UPAA 2XVSA 4OELB 2XRQD 4ZQ3A 1Y1VB 3T1YL 2VUMB 1PTOF 3MC0B 3DWAA 1DOKA 1I4HA 4K6LA 1H9MA 3D4DA 4OIJA 2D9UA 1VQFA 1X9NA 5I4DA 1EYGA 1X32A 4ULLA 4EGVA 3QWNA 3VDYA 1QE6A 2JSOA 1Q82C 1W6JA 2JA6G 1Y14B 1PDQA 1O7ZA 2F4VL 5IT9E 2F4IA 2KHJA 3AB9A 1HNXQ 2LXJA 5NUCA 2DNCA 1Y8PB 4BBSB 3BZDB 4BXXG 3GTPH 3V2TA 1TS2A 5GQOA 1SJED 2HIXA 1IKMA 4DV3Q 1K8MA 1F9QA 1JWSD 4FF2A 4LFAQ 3GTMH 3F2BA 3HOZH 2NWGA 1WJJA 2F03A 4DK0A 4EQ5A 4FF1A 1HJPA 3X3MA 1VF5C 1KAWA 2QILA 1K8AC 2R92G 3H3VH 4X3SA 1PH9A 4GN5A 2EE1A 4JI4L 3M7NA 1FNVA 5I2YA 1STNA 2B2WC 2A68D 2NZHA 4DR5Q 4IOCA 1L0YB 3OIQA 3FP9A 4UHVA 5JPMC 5G3LF 1QNUA 4QB4A 4C3HB 4CDCC 3DEOA 2D5DA 4YY3Q 4IFDG 1N32Q 1DJRD 5FLMH 4A3KG 3VYTA 2F0SA 2KENA 3CAMA 4Z9CB 3HRZC 1YHAA 2RHQB 5M3FB 5FJ8G 2JA5B 3BJUA 1HNWQ 4X65Q 2JA7G 3H91A 3J80i 1B44D 5JVH3 2L4NA 2JE6I 4P75A 1PYBA 2NVXH 3T1YQ 3S17B 4KD4A 1UE1A 1D1IA 2ZJRA 1B7YB 3LX0A 1WTPA 1TWCH 2TMPA 2MGSA 1AP0A 4KJNA 1V1PA 2KCMA 5D65A 4ZYSA 1B70B 4NP5A 2R6GA 2YTYA 1AZQA 4DKAC 5AJ3L 4CKCA 1F2MA 1VQ4A 2F4VQ 1MJEA 3U4ZA 1L0XB 4DNTB 2UU9Q 5A35A 3UE1A 5LMNW 1VCIA 1K8OA 1HH2P 1F9PA 4A3GG 4GN4B 4H13C 1CA5A 1SFOB 3AFPA 3A7LA 2WKDA 1VQOA 4QL5A 1Y8OB 1B3QA 2HIVA 2I0QA 2N88A 4A3FB 3MFYA 4IPGA 4CJ2C 3C1EA 2KVMA 3HKZE 1K0RA 1F9RA 5JJZA 5E4XA 3ULJA 3E5SA 3G6EA 1WD1A 4A3DB 3I55A 2R93H 2Z8LA 1STYA 1WCMG 2MJ8A 5FLXc 4A3MH 4DF7A 2CFMA 1C9OA 1BQQT 1CKOA 1U0LA 5IGCA 2EZVA 2WB1B 2WAQG 5BN3A 1K83B 4A93H 1SYFA 2QKIC 3SR1A 2A6EC 3BYTB 4I7ZC 3M4OB 3HZXA 1VF7A 4IO9A 1M4VA 1STGA 3WWVA 2JEAI 1TT2A 4KI0A 1QUQA 4GZYC 1RTOA 2MP1A 5JJLA 4AYBE 4OWWB 5CGKA 1NY4A 1VQGA 1LT4D 1EOTA 1QCBD 3JAML 3PO2H 4WJ3M 1IBMQ 1PH6A 3T56B 2MO0A 1JWMD 1F2ZA 4K2LA 1VQ7A 4LNQA 1TS3A 1J5EL 4GLAC 4YHHQ 5IT9L 1JT8A 1WTQA 4MTKA 4Q0FA 3GTLB 4V0BA 4RAUC 1N36Q 1LT6D 3K7AB 4JBMA 1DYQA 2SNSA 1H9JA 4DV0Q 1JC7A 2CWAA 1BNZA 2B3GA 5IWAL 2NN6G 2UXBL 1UNSA 3MVVA 1FNUA 1X55A 3HOUG 5FKAC 1WTWA 5JEAH 2A68C 2AQ3B 1JB7A 2L12A 1PVOA 4A3EG 2ATWA 1RKNA 3QOLA 1X3GA 4DGZA 5M5WB 5L37A 3CF5A 2R61A 3GTQB 3FKIB 5C0XJ 1SNCA 4L5QA 1SNDA 4A3LH 1V1PB 2RSOA 3S2HH 5LMUQ 3A8JE 2F0NA 2PI2E 1Q8IA 2E5LL 4L63B 1LV9A 1EY5A 2ICEC 5CV9A 4RG1A 2K01A 1GHJA 4CJ0B 5C5MA 3TDQA 5C4XH 1KRSA 1GUOA 3CQZB 3I2ZA 4A76A 1G6ZA 4C2MH 3OWEB 2EQSA 3RD4A 1ENCA 2JK8A 3RZOB 4POFA 2L5TA 2IJ0A 1VQPA 3GO5A 4NPSA 1CTMA 1CQVA 3I73A 2OQKA 4LF7Q 2UUCL 1DOMA 1XYIA 1WD0A 1UUPA 4JI2L 3EBEA 4QMGA 1T5EA 3HOZG 2CCZA 3HP3A 2Z6KC 3H3VC 3J81L 1SMYD 2SNMA 3TP5A 3HOXH 2QGQA 4GLVB 4CKBA 5I6YA 4CJ1B 4DV4L 5M3MH 4X3TA 3NPPA 3RNUA 5KNBA 4QGUA 2BH2A 3G4SA 2NZ1D 3ITPA 3S1RB 4LF9L 1HUMA 4G7HC 1SYGA 2CH4W 2I5MX 1RTNA 2IT1A 3OMGA 4JI7L 2DY8A 5IWAQ 3S1NB 3U50C 1A2TA 1UE5A 1VQAA 3ZYYX 3PIPA 4FF3A 2RDFA 5EKKA 1M8AA 2A69C 1CUKA 3MXNA 3VR3A 1EQQA 1CSQA 4BY1H 1R4QB 2QA4A 3H0GH 1D5XC 3WOEA 3T1HQ 5EPKA 3T53B 2K6AA 4DV2L 2C9OA 1TWAB 1PTOH 2D62A 4PMCA 4ZK9B 3TSSA 1EU4A 2E5LQ 2CW0D 3IAYA 3HG9A 2JQOA 3MXGA 2JEBI 1FNWA 3I56A 1BCPF 1JB3A 2IX0A 3VYRA 2Y0SG 3R8BA 3G6JB 2F0LA 1CA6A 2MQHA 4BA1I 3CHBD 3KLRA 4KY6A 1K28A 2OEOA 1X6OA 1VQNA 2PZWA 1T9HA 3H09A 2ZXPA 1E2ZA 3STBD 1N34Q 3KFUA 2QW7A 1Q1BA 5C4JH 3F1ZA 3QJYA 3KJOA 2UUCQ 2KQ3A 1JE4A 1TWGH 4WORA 1I6HH 4BBRH 1K73C 1IYUA 2XNAC 4IUTA 2L55A 4N9PA 3MA2B 3A74A 1E0BA 3F2CA 1B9MA 2NVQH 3HOVH 2J4XA 2ASBA 3RZDH 3DM3A 4NXML 1GUWA 2XIWA 3CKIB 4L5TA 2R93G 1PRTF 2E74C 4DV4Q 2EYJA 5E4WC 1V1QA 3L3OC 2PZUA 1K9MC 3DXJC 3A8KE 1CHPD 1EIYB 5EBCA 4A93G 3PUVA 4QIWE 2E2IB 4RGTA 4LK1C 4JI7Q 1O80A 2ZJPA 1PTOD 3CCLA 1K0SA 1I4QA 1PZKD 5IE8A 3A56A 3T16A 2Z0SA 3FHWA 1DXMA 1PZID 3S2DH 2JA6H 4DXGA 3TRZA 1OXXK 3NTIA 4JW0A 5EGTA 3HKZB 4BXXH 2VL6A 3PO2G 4KD3A 1PFMA 4A3IB 5IGFA 2KECA 2EY6A 4LFCL 3TZUA 2VQEL 5TSSA 3J80L 2YU9B 3CC7A 1ESRA 1CSPA 1AFPA 4X62L 4A3KB 1EYAA 1YJNA 5GAGC 4C56C 1EZ8A 3NBHA 3DWQA 3PUWA 3CCMA 1EWIA 1II3A 4U673 2JA8H 3NXWA 3S1QB 5IYDH 1Q12A 1HNZL 2BE5D 4JBKA 4KJOA 4TQUS 3U58A 4UY8C 2OTLA 1G291 3CRKC 4PZ6A 2EPBA 3FVQA 5GROA 1YNJD 5H1SE 3DEPA 2A5HA 4OONA 4AQYQ 4IN3A 3UE0A 3S24A 4AYBB 5G3LD 4IFDH 1I5FA 1SN8A 3PUZA 2BDNA 5JEAG 1W3SA 4XYOA 4IUPA 1XNRL 3G7LA 3E0JA 1NBWA 1BVSA 2HT1A 5FJ8H 1YVCA 2D2CC 4AIMA 2CWPA 1XX8A 1AE2A 2BCOA 1QVGA 3Q6SA 4A3LG 1TXYA 1MKHA 3K5MA 3M9BA 2KCCA 4JVZA 1NMFA 5CV5A 1WI5A 5M5XB 1IBKQ 1JQYD 1DONA 3KJPA 1GUTA 5ELBA 1ENAA 4B3RL 4LF5L 3J7AV 3KLSA 3NSWA 1S5ED 4JI1L 2EYFA 2CW0C 1VMCA 3R93A 1HPCA 4DK1A 4DR1L 4FF4A 4HIOA 3NP8A 3J7YW 2Z6KA 5FLXE 4NXNL 1ASZA 1KXLA 3TP6A 1KQSA 3S14H 4A3GH 4LF8Q 4YCWA 2PZTA 3D4RA 3KDFB 1E1TA 2FHTA 3STBC 4DK6C 1QB5D 3CPFA 3EROA 4RHSA 5DAUA 3OHXC 1HUNA 1MD2D 5M3MG 3HOWH 1D6EC 4HMIA 2EJGC 4A3JG 1RF2D 2HD3A 1JE5A 5C4HA 3NQIA 3G71A 1EEID 4EQNA 4KV6A 3HEJA 1VQ9A 4NB3A 3I4LA 3EN2A 3D4WA 3ER0A 4JI0Q 1QVFA 4ME3A 4ZUJA 1SNPA 1B3AA 4IUNA 2FJ2A 5ELNA 2JJQA 4B3TQ 4JI8Q 1TWHH 1X56A 4BY1G 3H94A 1G51A 1O78A 2M00A 3H0GG 4ZLTF 4XXEA 1I50H 3S15H 4Y7NH 4GKJL 1PTOC 2JP1A 1YHQA 2K5VA 1AEXA 3EA6A 3CMEA 1A63A 3N6RA 3SXHA 1I3QB 4CDFC 1N33L 5BR8L 3F2DA 3I4MH 2E76C 4HJAA 1GKHA 1I6VC 3NBHB 4WFN3 1GJXA 5DNFA 3K58A 2YTXA 1PYSB 3PIOA 1YJ9A 1EIFA 2JXMB 1BOSA 3PUXA 4QQBX 3BZCA 3D3RA 2DN8A 2NVTH 3ND9A 3QG1A 4XQJA 1IBLL 3NE5B 2NB0A 4JI1Q 1RODA 4I7AA 1ZEQX 4QF4A 1IW7C 4JPBW 1EUJA 4XYQA 3PO3H 5C5LA 3A5ZB 2K33A 4NXNQ 4YWKA 2IL8A 2ES2A 1LACA 3HOUH 2BE5C 4DAMA 5FO9B 1EY4A 4DPGA 3K5NA 3I4NB 1XXGA 4OGQC 1YNJC 2F3VA 3OIPA 2OQ0A 4ZKBB 2VB2X 1FJGL 2EJFC 1A3TA 2A6HD 2BDOA 3GTPB 1ZXTA 3Q0AA 1IHZA 3TBIB 4MZ9A 1SYEA 4O0AA 3K81C 3HOYB 3BVZA 2V4DA 2E2HB 3C46A 3VR2A 4C3IB 3HOZB 1IZ6A 3BZKA 4DR3L 2PMZE 4Y52H 2FINB 3S1MH 4DAYA 2IHEA 4K5WA 3S16B 3SHLA 2F0VA 1HZAA 3LWEA 1EY8A 4JOIC 1C8CA 2N49A 3M85A 1OXSC 1U4LA 1LABA 3SK5A 3NK9A 4DK3C 4DV6Q 4GKJQ 2A19A 3OPOA 1LM0A 2KHSA 3PF5A 1CKNA 4JYAL 1SYBA 5EAYA 4IQZA 4CDEC 3TP7A 4WJ4A 4HCSA 1VQ5A 3M3YH 4HN7A 3O13A 1NJIC 4LUVA 4QIWB 5CMDA 1LT3D 1YBYA 1TY0A 5LL6X 1MGSA 3FEWX 4F87A 1SE2A 4OXPA 1MI2A 1DGSA 5IYDG 5A2QL 1I4XA 4A4IA 2JA8G 2VUMH 3IKJA 5T1IA 1Q46A 2ID0A 1IBLQ 4S3SA 2K1BA 1D2BA 1EIHA 2NVXB 1F77A 1F2LA 3T4AC 4JI6Q 1TWCB 1ILQA 1JJGA 3MAQA 5HY6A 1X3FA 2BOSA 1L1OC 4BBSH 4C1NI 2XTIA 1EQVA 2K52A 2QEJC 1STBA 4K2KA 2F52A 3EFXD 1FGUA 4GNXC 3MZ5A 4DV5L 1FJGQ 1Y1WH 4IFDJ 3MHBA 5EKIA 4YWLA 2KBNA 2F0UA 4B3SL 4ZKCB 2ENBA 2L15A 2O5IC 1NE3A 1E22A 1I94L 1EWHA 1SMXA 2OT2A 2DY7A 3RLNA 1C7YA 3PSIA 1R9TH 2ALYB 1OXUA 4LWCA 4A3BH 2R93B 3CCQA 3TN2A 4QCLA 4A3MB 1W2BA 2ZTEA 3QIAA 2FMMA 1G2SA 4DR7L 2N78A 1CZWA 2WACA 4RCOA 2LMCB 4PMWA 3OOCA 1SBBB 1BKBA 5C44B 4DU9A 3I3CA 1SR3A 5C3WA 2A8VA 3GTJH 2WV6D 1SNOA 5D14A 5JOBA 2ZXOA 4JI4Q 5J22A 2K7VA 3HOWG 1EOVA 2IX3A 3AEVA 3S17H 4KMUC 1IXRA 4RKLA 1EFID 5CORA 2A73B 3H6MA 1PRTD 4DAYB 3KBGA 3NWSA 4DV7L 2RDGA 3PQIA 5FK9C 2I5HA 2NZOA 3SDZA 5I9OA 3P20A 4OEMB 2A6HC 5CV8A 2CQAA 2R7ZH 1YNXA 1CKNB 5C3EH 2DUDA 4MNOA 3RLFA 1J9OA 1U5KA 2R3ZA 4L6TB 2AQ2B 3KBXA 1HR0L 3W1BA 4IOAA 4K14A 2EY5A 3I4MG 2M2LA 1TQOA 1CKMA 1L0WA 4RCNA 1B8AA 4C3JB 4B3SQ 1NNXA 5EQ0A 4DR4L 1WFQA 1SAPA 4KN4C 2EYHA 4KHVA 2OTJA 4DAVA 4OIKA 5AJ3Q 1UEBA 1U4RA 4JCVE 3BDLA 1K83H 1PH7A 1PH5A 2VQFQ 3GV6A 2OF1A 3IRBA 3PO3G 3S2HB 1KDBA 1PZJD 1PH1A 4DR7Q 2F0TA 2CKZB 2XRSD 1YI2A 5JJKA 5C4XB 4EVOA 2F3IA 2MUYA 4C2MB 4KK7A 4ALPA 1ICFB 5CR3A 5HURA 3SK8A 1FD7D 2GN5A 2WAQE 3JC66 3VR6A 3F8TA 4PZ7A 2VQFL 1XMOL 2IX1A 2HQLA 2E2JH 3QO2A 1OXTA 3A54A 4FYDA 3GTLH 4JOIA 4IUUA 3K7AH 2Z6BA 3QR8A 4DV7Q 5KNDA 2B2VA 3ERQA 1S4ZA 1V8QA 4FP5D 1J8IA 2FMCA 1JORA 2B39A 3HOXB 3K0YA 1MJCA 4B3ML 4A3CH 2KOLA 1GUSA 1HXYD 1JCKB 5E1FA 2HCCA 1KDCA 1HR0Q 1KHIA 1H9KA 2I46A 4NKLA 5C4ZA 4GKKL 5GAHC 1PFBA 3I72A 1BUVT 1B50A 1S5DD 1H9SA 3AFQA 4PMBA 1VQ6A 4IUVA 1UE7A 2QEXA 5M5WH 1OO9B 2J0TD 3HS0C 4XTCS 1KTKA 1RJTA 1J5EQ 1JJ2A 3FKIH 1NTGA 4GN3B 5LHY1 5IIFA 1LTID 1Y1VG 2VUMG 4JG2A 2PMZB 2K5NA 4A3JH 1HRJA 1PTOB 1WYDA 3CQZH 1S72A 3SGIA 1LUZA 1YNND 4BY7B 3UDGA 1L1OA 1QUQB 2UXBQ 4LF4L 4HAEA 3RZOH 4K0KL 2D0OA 3MTSA 4LUOA 1G6PA 1TS5A 4GNXA 2B63H 3RR5A 3NUCA 1PRTC 4BBSG 4M1UB 3KYHC 1YHBA 2NVYH 1GHKA 1Y1WG 1BO0A 1STAA
chains in the Genus database with same CATH topology
1B53A 1ONLA 2F0FA 5C4JB 3T13A 4DAPA 1DCZA 1D5ZC 1JWUD 4BBRB 1HA6A 3D31A 5EKLA 5EPJA 3HOVB 3RZDB 3NWTA 3NHHA 4IURA 1LTAD 3UI2A 4CKEA 3WDNA 2EYPA 2PQEA 3KF8A 2C5CA 2DNEA 2HDMA 1O7LA 2EY2A 4IUQA 4QUCA 3NBIA 2ZT9C 1B4OA 2L9HA 4WRDA 1C4QA 2X6LA 3TP8A 1IKLA 3S2DB 2BA0A 4OO1H 1FR3A 3D6CA 1KNAA 2JA6B 1LTBD 4KKTA 1BF4A 1PLFA 5CV7A 2Q8IB 2HCIA 2L0CA 1G8ZD 3VYSA 1SXTA 1TKWB 1DZ1A 4NW2A 4UDUC 1SYDA 1EQTA 2R92B 3LWUA 2H1EA 3FPPA 2EDGA 4OO1I 2M9VA 3GD7A 5KRUA 2WP8J 4KY5A 4LJZC 1H9SB 4RFBA 2LS01 2KUMA 2KA7A 1STEA 3KLSX 4ZUIA 1IL8A 4B9WA 5I9PA 1HA5A 1Z6HA 2H4OA 3BYYB 1EY7A 4K5XA 2TSSA 1EYDA 4G7OC 1PMRA 2JA7B 3M4YA 1SMYC 5CBAE 4K5VA 4MHEA 3BDOA 1FYCA 1MSHA 3VYUA 1GOZA 4HCEA 5CV6A 1EWCA 3U9OA 3SK6A 2IWHA 3A8IE 3VA5A 1YNNC 3BDCA 4RGNA 1ML0D 1LTRD 5IOCA 4UAIA 4KY7A 5JEAJ 2BA1A 3S14B 1O7YA 4A3GB 1BR9A 1B1ZA 1Z7TA 1QILA 3TMEA 3K5OA 1E2VA 4CHTB 1CT1D 1ENFA 1WCMB 3HOWB 3RMHA 1RCVD 1UEAB 1AW7A 3T51B 2HQEA 4HMJA 2WAQB 4DA2A 3K59A 3RUZA 3ONAB 1QG7A 3GP7A 2K5WA 2F3WA 4FVMA 1A2UA 5KYLA 1ZYRD 4LMQD 1TWHB 4G7ZC 3GTGB 1WVLA 1BBXC 2LY7A 2WKCA 3DUZA 1NR2A 2O4XA 1I4RA 1I50B 3X3NA 2Z1CA 5EJWA 1BDOA 2NYZD 2B8GA 5JAVA 1ZKOA 1D1KA 2EYMA 5JPNC 4G4KA 2F0WA 2PNRC 3IL8A 2NVTB 1LTGD 4U68A 3CRLC 4XQNA 3OMCA 1FGBD 5CYUA 3DWPA 3A55A 5K36H 3PO3B 1ICWA 1HHVA 1A3UA 4RH6A 4B08A 5LL6S 1HTLD 3HOUB 1SSOA 1QNKA 1A3VA 3EQLC 4A3EB 1LTSD 2PYKA 1PXUA 3I91A 2O5JC 5T1GA 4IALA 2L1BA 4RGOS 5KIXA 3PUYA 1I4PA 3TZDA 3QB3A 3DM1A 3D8GA 1NUCA 3Q23A 4B9XA 4TRDA 4IZ8A 3LNNA 4J1MA 4OL7A 1E2WA 5F2DA 2B2YA 3S1MB 5M9OA 2YYZA 5ISRA 2RVLA 4OO1G 4BS9A 3WOFA 5C0XH 2JYOA 1HFGA 3FPUB 1PYWD 4ODGA 3BS1A 2Q8TA 3GTMB 2B2UC 3D6WA 5BN4A 2EVBA 4R8NA 1AZPA 4CGYB 2SDFA 4L8JA 5C0XI 5KYIA 1JOQA 3P7JA 4X3KA 2B2VC 2NN6I 1HQRD 1JOOA 4TKOB 4EQOA 3JAME 1KDAA 5FO7B 3S9WA 5I6WA 1OXVA 2F0QA 1CZGA 4HSPA 5FLXL 2LFNA 1PRTB 1CM9A 1D5MC 3MEHA 1EL0A 1ZYRC 1Y1WB 1SNMA 1PFNA 3GV3A 3ND8A 5DM73 1SDFA 3V05A 1U9RA 2CVRA 3QOJA 3VR4A 3R2TA 2Y0SB 5ELFA 1EU3A 1MBYA 4XDXA 4MIUA 3OSOA 2RDHA 1CQFA 1R9TB 4A3BB 2QF7A 5CV4A 4NDXA 1SYCA 2KCNA 4RHRA 2EYOA 2EY1A 1X3PA 3OWFA 2PO4A 3K57A 5I2XA 1KAAA 3GTJB 1EY9A 1BCPD 2AUKA 3U9SA 4J8QA 1ET9A 4KTAA 3Q22A 4A93B 4RA8A 1JICA 2ZXRA 4ABNA 3NTHA 3A7AB 1C48A 4BWGB 3VR5A 2F0IA 3J81E 1EEFD 2R7ZB 1SNQA 2CHBD 5C3EB 1G91A 5DM63 1R4PB 3R2IA 4PV1C 2Q8RE 2HUGA 5ELEA 2QCPX 3PO2B 1G2TA 3FDTA 3PIP3 2EXZA 5EPLA 2I07B 4M8AA 4HTHA 3VA7A 2PW5A 2K32A 2A69D 2AWOA 3NTKA 1JR0D 3K5LA 2F0PA 2J7ZA 3EVQA 1UAPA 5K36G 2X6GA 2F0HA 4F88A 2O2LD 5HGTA 1X3QA 4BA2I 1S5CD 1TVXA 4H44C 1EY0A 1KABA 2RA4A 3KK7A 2E2JB 3C1FA 5EBDA 1GUNA 5FOBB 1V1OA 3AU7A 4XT3B 2RQXA 4RKBA 4O42A 2NTSA 1Q90A 2G9DA 2EOTA 5C0XG 2B2UA 2Z4IA 4KKUA 2X69A 1VMPA 4KHZA 1TU2B 5IODA 2RSNA 3P75A 4HEDA 1SE3A 1DM0B 5ELDA 5IGBA 2XWBB 2ICIA 5M3MB 1HQMC 4N9TA 4A3JB 4Q5VA 3EJIA 4C1NK 2K03A 1BCPC 4NMZA 1Z47A 3J80E 1Y8NB 3SEBA 2B63B 4BY1B 3H0GB 1DOLA 3BG3A 3AMUA 3V96A 2F0EA 1NCVA 4PNYA 2PPBC 1B2TA 2NVYB 1H9RA 3IFDA 2MPMA 4RWSC 4C3IG 1LO5D 2K05A 2F0JA 2B2WA 5M5YB 3N52A 1CFMA 4P2CB 5J1ZA 2F0DA 3OW7A 2NUCA 1W6KA 4RGMA 1BXTA 2RKSA 2XWJB 2B8FA 2WINB 4DFAA 3MXUA 3C3LA 5JVG3 1LT5D 3CU7A 1ESFA 2F0OA 1TWGB 4ZAIA 1I6HB 2EJMA 4QUFA 5BN5A 5COYA 2NVQB 1NAPA 4MN3A 3BVMA 2PCFB 2XN9C 2N55A 5C3XA 3DMUA 4C3HG 2KEDA 4ILWA 1IYVA 2VNUD 2L11A 1ILPA 1S5BD 2G9HD 4FXGC 4YIJA 2IPKD 1EYCA 5IGGA 1NSNS 3MFGA 2A74C 2B2YC 2IW3A 3I90A 4DN4M 4KN7C 1Q1EA 3PV0A 2F0GA 4WJWA 5C6AA 1EIGA 3M7GA 3FMCA 3Q24A 4X3UA 3FRPB 2PW7A 5KEEA 2JA8B 1TIID 4EQPA 3R3OA 4G57A 4ID6A 4JK1C 5KGUA 1A6XA 2B2TC 2RBMA 1VDZA 2HDLA 1STHA 2MHVA 4H7BA 3PIO3 2FFKB 2SOBA 5KNCA 1QWYA 2KEEA 4F8MA 2Z4HA 3MXPA 3P1HA 2K28A 1V43A 1QOHA 2WIIB 4LAAA 2K04A 1IW7D 3IFTA 3GTOB 5CC4A 3BVGA 1ET6A 5DEHA 1TS4A 5FO8B 4V190 1SEBD 4CBVA 1RDPD 4DNRB 1Q3LA 4C3JG 4XIGS 1A15A 1JOKA 4I65A 4XT1B 5K5PA 1CI3M 4H0LC 3PMFA 2VB3X 5IGDA 3C2PA 5ELCA 3MWYW 1SJHD 3HGBA 4ZRZA 4IFDI 4R8IA 2EYLA 5J39A 1HCZA 3L9AX 3E6ZX 3K6OA 4E6IA 3I70A 2NTTA 2KJXA 1TR5A 1RD9D 1KNEA 2F0KA 5A2QE 5E3FA 3S15B 2K5QA 4Y7NB 1LTTD 2K5DA 3NQTA 1CHQD 3I4MB 1B9NA 1XWEA 1WTRA 5AFWA 4PQXA 3SVMA 2GA4B 1GUGA 1GXDC 1U4MA 1U4PA 4ME5A 1NR4A 3W3AA 3W2DA 4FXDA 1WTVA 2NBFA 4OHJA 3KUPA 1SE4A 2OXPA 1WTXA 3GTKB 4R9WA 3F2UA 3URYA 1TY2A 1EZ6A 1AN8A 3L7ZC 2AUJD 3GQBA 2F0MA 3SK4A 4FXKC 1KLUD 1TWFB 5IGEA 1DD2A 1T5XD 4TSSA 1RHPA 1Y69U 3DHQA 2VXWA 4DXFA 2LKVA 4FNFA 1F9SA 2XSCA 1S5FD 4FO2A 4K6DA 3J7AF 1LLRD 1MSGA 4HSVA 1I4GA 2AWNA 4JBWA 5CBEE 1HFNA 1F2YA 1EY6A 4K8JA 3I8ZA 2QDBA 4XQQA 2SEBD 4O1NA 1CK1A 4HR7B 5D3IB 1HTPA 4K8IA 4J6HA 1QJOA 4F7XA 3SE0A 2E2DC 2F1MA 2NN6H 1XTCD 1KLGD 2AQ1B 5D3DA 4KKSA 1BCPB 3M3YB 2A6ED 2E75C 2B2TA 2XVSA 2XRQD 4ZQ3A 1Y1VB 2VUMB 1PTOF 3MC0B 3DWAA 1DOKA 1I4HA 4K6LA 1H9MA 3D4DA 4OIJA 2D9UA 5I4DA 1X32A 4ULLA 4EGVA 3QWNA 1QE6A 2JSOA 1W6JA 1PDQA 1O7ZA 5IT9E 2F4IA 3AB9A 5NUCA 2DNCA 1Y8PB 4BBSB 3BZDB 3V2TA 1TS2A 1SJED 1IKMA 1K8MA 1F9QA 1JWSD 4FF2A 2NWGA 2F03A 4DK0A 4FF1A 3X3MA 1VF5C 2QILA 4X3SA 2EE1A 3M7NA 1FNVA 5I2YA 1STNA 2B2WC 2A68D 1L0YB 3OIQA 5JPMC 5G3LF 1QNUA 4QB4A 4C3HB 3DEOA 2D5DA 4IFDG 1DJRD 3VYTA 2F0SA 4Z9CB 3HRZC 5M3FB 2JA5B 3H91A 1B44D 5JVH3 2L4NA 2JE6I 3S17B 4KD4A 1D1IA 3LX0A 1WTPA 2TMPA 2MGSA 1AP0A 4KJNA 1V1PA 5D65A 4ZYSA 4NP5A 2R6GA 1AZQA 4CKCA 1F2MA 1L0XB 4DNTB 5A35A 1VCIA 1K8OA 1F9PA 4H13C 1CA5A 1SFOB 3A7LA 2WKDA 1Y8OB 2N88A 4A3FB 3MFYA 4CJ2C 3C1EA 2KVMA 1F9RA 5JJZA 5E4XA 3E5SA 1WD1A 4A3DB 2Z8LA 1STYA 2MJ8A 4DF7A 1BQQT 5IGCA 2EZVA 2WB1B 5BN3A 1K83B 1SYFA 2QKIC 3SR1A 2A6EC 3BYTB 4I7ZC 3M4OB 3HZXA 1VF7A 1M4VA 1STGA 2JEAI 1TT2A 4KI0A 4GZYC 1RTOA 2MP1A 5CGKA 1LT4D 1EOTA 1QCBD 3JAML 3T56B 1JWMD 1F2ZA 4K2LA 1TS3A 5IT9L 1WTQA 4Q0FA 3GTLB 4V0BA 4RAUC 1LT6D 3K7AB 1DYQA 2SNSA 1H9JA 1JC7A 1BNZA 2NN6G 1UNSA 3MVVA 1FNUA 5FKAC 1WTWA 5JEAH 2A68C 2AQ3B 2L12A 1RKNA 3QOLA 4DGZA 5M5WB 2R61A 3GTQB 3FKIB 5C0XJ 1SNCA 1SNDA 1V1PB 2RSOA 3A8JE 2F0NA 1Q8IA 4L63B 1LV9A 1EY5A 2ICEC 5CV9A 2K01A 1GHJA 4CJ0B 5C5MA 3TDQA 1GUOA 3CQZB 1G6ZA 3OWEB 3RD4A 1ENCA 3RZOB 2L5TA 2IJ0A 3GO5A 1CTMA 1CQVA 3I73A 1DOMA 1XYIA 1WD0A 1UUPA 4QMGA 1T5EA 3HP3A 3H3VC 3J81L 1SMYD 2SNMA 3TP5A 4CKBA 5I6YA 4CJ1B 4X3TA 3NPPA 5KNBA 2NZ1D 3ITPA 3S1RB 1HUMA 4G7HC 1SYGA 1RTNA 2IT1A 3OMGA 2DY8A 3S1NB 1A2TA 3ZYYX 4FF3A 2RDFA 5EKKA 1M8AA 2A69C 3MXNA 3VR3A 1R4QB 1D5XC 3WOEA 5EPKA 3T53B 2K6AA 2C9OA 1TWAB 1PTOH 2D62A 4PMCA 4ZK9B 3TSSA 1EU4A 3IAYA 2CW0D 3HG9A 3MXGA 2JEBI 1FNWA 1BCPF 1JB3A 2IX0A 3VYRA 3R8BA 3G6JB 2F0LA 1CA6A 4BA1I 3CHBD 3KLRA 4KY6A 2OEOA 2PZWA 3H09A 2ZXPA 1E2ZA 1Q1BA 3QJYA 2KQ3A 1JE4A 4WORA 1IYUA 2XNAC 4IUTA 2L55A 4N9PA 3MA2B 1E0BA 1B9MA 2J4XA 1GUWA 2XIWA 3CKIB 1PRTF 2E74C 2EYJA 5E4WC 3L3OC 2PZUA 3DXJC 3A8KE 1CHPD 5EBCA 3PUVA 2E2IB 4RGTA 4LK1C 1O80A 1PTOD 1I4QA 1PZKD 3T16A 3A56A 1DXMA 1PZID 4DXGA 1OXXK 3NTIA 5EGTA 3HKZB 4KD3A 1PFMA 4A3IB 5IGFA 2KECA 2EY6A 3TZUA 5TSSA 3J80L 2YU9B 1ESRA 1AFPA 4A3KB 1EYAA 4C56C 1EZ8A 3NBHA 3DWQA 3PUWA 1II3A 4U673 3NXWA 3S1QB 1Q12A 2BE5D 4KJOA 4TQUS 1G291 3CRKC 2EPBA 3FVQA 1YNJD 3DEPA 2A5HA 4IN3A 4AYBB 5G3LD 4IFDH 3PUZA 2BDNA 5JEAG 4XYOA 4IUPA 3G7LA 3E0JA 2D2CC 1XX8A 2BCOA 3Q6SA 3K5MA 2KCCA 5CV5A 5M5XB 1JQYD 1DONA 1GUTA 5ELBA 1ENAA 3J7AV 3KLSA 3NSWA 1S5ED 2EYFA 2CW0C 1VMCA 3R93A 1HPCA 4DK1A 4FF4A 3NP8A 3J7YW 5FLXE 3TP6A 2PZTA 3D4RA 2FHTA 1QB5D 3EROA 4RHSA 5DAUA 3OHXC 1HUNA 1MD2D 1D6EC 4HMIA 2EJGC 1RF2D 5C4HA 3NQIA 1EEID 4EQNA 4KV6A 3HEJA 3I4LA 3D4WA 4ZUJA 1SNPA 1B3AA 4IUNA 2FJ2A 3H94A 1O78A 2M00A 4ZLTF 4XXEA 1PTOC 2JP1A 1AEXA 3EA6A 3N6RA 3SXHA 1I3QB 2E76C 1I6VC 1GJXA 4WFN3 5DNFA 3K58A 2JXMB 1BOSA 3PUXA 3D3RA 2DN8A 3ND9A 3QG1A 4XQJA 3NE5B 2NB0A 1RODA 1ZEQX 4QF4A 1IW7C 4XYQA 5C5LA 2K33A 2IL8A 1LACA 2BE5C 5FO9B 1EY4A 3K5NA 3I4NB 1XXGA 4OGQC 1YNJC 2F3VA 3OIPA 4ZKBB 2VB2X 2EJFC 1A3TA 2A6HD 2BDOA 3GTPB 1ZXTA 3Q0AA 1IHZA 3TBIB 1SYEA 3HOYB 3BVZA 2V4DA 2E2HB 3C46A 3VR2A 4C3IB 3HOZB 2FINB 4DAYA 4K5WA 3S16B 3SHLA 2F0VA 3LWEA 1EY8A 1C8CA 3M85A 1OXSC 1U4LA 1LABA 3SK5A 3NK9A 3OPOA 2KHSA 1SYBA 4IQZA 3TP7A 4HCSA 4HN7A 3O13A 4QIWB 5CMDA 1LT3D 5LL6X 1TY0A 1WTOA 1MGSA 3FEWX 4F87A 1SE2A 1MI2A 5A2QL 1I4XA 3IKJA 5T1IA 2ID0A 4S3SA 2K1BA 1D2BA 1EIHA 2NVXB 1F77A 1F2LA 3T4AC 1TWCB 1ILQA 3MAQA 2BOSA 4C1NI 1EQVA 2QEJC 1STBA 4K2KA 3EFXD 3MZ5A 4IFDJ 3MHBA 5EKIA 2F0UA 4ZKCB 2ENBA 2O5IC 1EWHA 2OT2A 2DY7A 1OXUA 2R93B 3TN2A 4QCLA 4A3MB 3QIAA 2FMMA 1G2SA 1CZWA 2WACA 4RCOA 2LMCB 4PMWA 3OOCA 1SBBB 5C44B 4DU9A 3I3CA 5C3WA 2WV6D 1SNOA 5D14A 5JOBA 2ZXOA 5J22A 2K7VA 2IX3A 4KMUC 4RKLA 1EFID 5CORA 2A73B 3H6MA 1PRTD 3KBGA 3NWSA 2RDGA 5FK9C 3SDZA 5I9OA 3P20A 2A6HC 5CV8A 2CQAA 3RLFA 1J9OA 2R3ZA 4L6TB 2AQ2B 3KBXA 4K14A 2EY5A 2M2LA 1TQOA 4RCNA 4C3JB 5EQ0A 1SAPA 4KN4C 2EYHA 4KHVA 4DAVA 4OIKA 1U4RA 3BDLA 3GV6A 2OF1A 3S2HB 1KDBA 1PZJD 2F0TA 2XRSD 5C4XB 4EVOA 2MUYA 4C2MB 4KK7A 5CR3A 5HURA 3SK8A 1FD7D 3VR6A 2IX1A 3QO2A 1OXTA 3A54A 4FYDA 4IUUA 5KNDA 2B2VA 3ERQA 1S4ZA 1V8QA 4FP5D 1J8IA 2FMCA 1JORA 2B39A 3HOXB 3K0YA 2KOLA 1GUSA 1HXYD 1JCKB 5E1FA 2HCCA 1KDCA 1H9KA 5C4ZA 2I46A 4NKLA 1PFBA 3I72A 1BUVT 1B50A 1S5DD 1H9SA 4PMBA 4IUVA 1OO9B 2J0TD 3HS0C 4XTCS 1KTKA 1RJTA 5LHY1 5IIFA 1LTID 2PMZB 1HRJA 1PTOB 1YNND 4BY7B 4HAEA 3MTSA 1TS5A 3NUCA 1PRTC 4M1UB 1GHKA 1BO0A 1STAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2D C;  2ICE C;  1BUV T;  2TMP A;  3T4A C;  2WII B;  2QKI C;  3CU7 A;  3MA2 B;  1JB3 A;  5FOB B;  1BR9 A;  1XWE A;  1OO9 B;  2J0T D;  5FO7 B;  3HS0 C;  5FO9 B;  2I07 B;  4FXG C;  3I70 A;  3HRZ C;  3G6J B;  1GXD C;  5JPN C;  3OHX C;  3KLS A;  2B39 A;  3CKI B;  4FXK C;  1JC7 A;  1PXU A;  3FRP B;  2XWJ B;  2XWB B;  2WIN B;  1BQQ T;  5FO8 B;  3L3O C;  1UEA B;  5JPM C;  3V96 A;  1D2B A;  2A73 B;  4ILW A;  2A74 C;  1UAP A; 
#chains in the Genus database with same CATH topology
 1B53 A;  1ONL A;  2F0F A;  5C4J B;  3T13 A;  4DAP A;  1DCZ A;  5M5Y H;  1D5Z C;  1JWU D;  4OWX B;  4BBR B;  1HA6 A;  3D31 A;  5EKL A;  5EPJ A;  3CC4 A;  1A0I A;  3HOV B;  3GDE A;  2GVA A;  3RZD B;  3NWT A;  3NHH A;  3S1R H;  4IUR A;  4A3B G;  4DV1 L;  1LTA D;  4B3M Q;  3RN2 A;  3UI2 A;  4CKE A;  3WDN A;  2UXC L;  2EYP A;  2Q2U A;  2PQE A;  3KF8 A;  2C5C A;  4JI2 Q;  2DNE A;  3B6Y A;  3TRE A;  2HDM A;  3CP0 A;  1O7L A;  2EY2 A;  4IUQ A;  4QUC A;  3CW2 C;  3NBI A;  2ZT9 C;  3ULL A;  1B4O A;  2L9H A;  2ZTD A;  1K8G A;  4WRD A;  1C4Q A;  2X6L A;  1YIJ A;  3TP8 A;  4GOP C;  1IKL A;  3S2D B;  3W1G A;  1YJW A;  2BA0 A;  4OO1 H;  3D6C A;  1FR3 A;  1KNA A;  2JA6 B;  1LTB D;  4KKT A;  4P73 A;  1BF4 A;  1PLF A;  5CV7 A;  2Q8I B;  4LF9 Q;  2HCI A;  2L0C A;  1C0A A;  4AH6 A;  1G8Z D;  4JI3 L;  3VYS A;  1SXT A;  1TKW B;  3J81 c;  1DZ1 A;  4NW2 A;  3A0J A;  4UDU C;  1SYD A;  3LGJ A;  1EQT A;  2KCT A;  2R92 B;  3LWU A;  2H1E A;  3FPP A;  2EDG A;  2R7Z G;  4OO1 I;  2M9V A;  5C3E G;  3KF6 A;  3GD7 A;  5KRU A;  2WP8 J;  4KY5 A;  1HR0 W;  4LJZ C;  1H9S B;  4RFB A;  2LS0 1;  3J7A 5;  2RF4 A;  2KUM A;  2KA7 A;  1PH8 A;  1STE A;  4DV2 Q;  1VQE A;  4RMF A;  3KLS X;  4ZUI A;  1PFS A;  1IL8 A;  4A3F G;  2XGT A;  3E0E A;  2Y0S E;  4B9W A;  5I9P A;  1HA5 A;  1D8L A;  1Z6H A;  3PCO B;  1J6Q A;  4IJH A;  4GLX A;  4A3D G;  2H4O A;  4LFB L;  3BYY B;  4HID A;  1EY7 A;  5IYB G;  4DUY L;  4K5X A;  2G5D A;  2TSS A;  4FDB A;  1Q86 C;  2WB1 G;  1EYD A;  4G7O C;  1PMR A;  1L1O B;  2JA7 B;  2VS1 A;  1HZB A;  3M4Y A;  3MXN B;  2UXC Q;  1SMY C;  5CBA E;  4K5V A;  2GVB A;  4MHE A;  4GNX B;  3BDO A;  2UXD L;  1FYC A;  1MSH A;  3VYU A;  1GOZ A;  4HCE A;  5CV6 A;  1EWC A;  3U9O A;  3SK6 A;  2IWH A;  3A8I E;  2D0P A;  3VA5 A;  4NXM Q;  1YNN C;  3BDC A;  4RGN A;  1ML0 D;  1LTR D;  5IOC A;  4UAI A;  4KY7 A;  5JEA J;  2BA1 A;  4R4O A;  4L5R C;  3S14 B;  1O7Y A;  4A3G B;  5DLQ E;  1BR9 A;  3GTO H;  4JI3 Q;  1B1Z A;  1Z7T A;  1QIL A;  3TME A;  3M4Q A;  3K5O A;  3KF8 B;  1E2V A;  4CHT B;  3PGZ A;  1CT1 D;  4A3C G;  1ENF A;  1WCM B;  1XMQ L;  3HOW B;  3RMH A;  1RCV D;  1UEA B;  1AW7 A;  2A1A A;  1M90 C;  3T51 B;  2HQE A;  4HMJ A;  1XNQ L;  2WAQ B;  4DA2 A;  3K59 A;  3RUZ A;  4LFC Q;  3CCV A;  2VQE Q;  3ONA B;  1QG7 A;  3GP7 A;  2K5W A;  2F3W A;  3FKI G;  4FVM A;  1A2U A;  5KYL A;  1ZYR D;  4LMQ D;  4X62 Q;  2DGY A;  1TWH B;  4G7Z C;  3GTG B;  3TS2 A;  1EQR A;  1WVL A;  1BBX C;  2LY7 A;  2WKC A;  3DUZ A;  1NR2 A;  2O4X A;  4YCV A;  1I4R A;  1I50 B;  1S40 A;  1HNZ Q;  4JI5 L;  3X3N A;  2UUA L;  1P16 A;  2Z1C A;  5EJW A;  1BDO A;  2MFI A;  2NYZ D;  3J80 c;  2B8G A;  2UXD Q;  1Q8K A;  3KF6 B;  5JAV A;  1ZKO A;  1D1K A;  2EYM A;  5JPN C;  4JV5 L;  4G4K A;  2B63 G;  1UE6 A;  2F0W A;  1XNR Q;  4X66 L;  2PNR C;  3CCR A;  1PH4 A;  3IL8 A;  2NVT B;  1LTG D;  4U68 A;  3CRL C;  4LF6 L;  4XQN A;  3OMC A;  1FGB D;  1SRO A;  2R7F A;  5CYU A;  3DWP A;  2IHF A;  5IP9 H;  3A55 A;  5K36 H;  3CPW A;  3PO3 B;  5JJI A;  1ICW A;  4ZCK A;  1PH3 A;  1HHV A;  3HFZ B;  1A3U A;  4RH6 A;  4B08 A;  5LL6 S;  1Q81 C;  1HTL D;  3HOU B;  1X65 A;  1VS0 A;  1SSO A;  1N8R C;  1QNK A;  1A3V A;  3EQL C;  4A3E B;  1LTS D;  2PYK A;  1PXU A;  4QJF A;  4LF5 Q;  4B3R Q;  3I91 A;  2O5J C;  3MEF A;  2P5Z X;  5T1G A;  4IAL A;  2L1B A;  4RGO S;  5KIX A;  4LFA L;  4DR1 Q;  3PUY A;  1I4P A;  3TZD A;  3OYY A;  1QZG A;  3GTK H;  3QB3 A;  2C35 B;  3DM1 A;  3D8G A;  1NUC A;  3Q23 A;  4GOP A;  4IPC A;  2AHO B;  4B9X A;  1N9W A;  4TRD A;  4IZ8 A;  3LNN A;  4J1M A;  3Q8D A;  4OL7 A;  3NEL A;  1E2W A;  1TWF H;  5F2D A;  2B2Y A;  3S1M B;  1VQB A;  5M9O A;  2YYZ A;  3E9I A;  4PZ8 A;  4DR5 L;  5ISR A;  2RVL A;  4OO1 G;  4BS9 A;  3WOF A;  1I3Q H;  5C0X H;  4YY3 L;  2JYO A;  1AE3 A;  1HFG A;  3FPU B;  4JI5 Q;  2UUA Q;  2OCE A;  4IPH A;  3UDF A;  1PYW D;  4KHP L;  4ODG A;  3BS1 A;  2Q8T A;  3GTM B;  2B2U C;  4P74 A;  3D6W A;  4HJ8 A;  5BN4 A;  2EVB A;  3I4O A;  4R8N A;  1AZP A;  1HNW L;  4CGY B;  2SDF A;  4QY7 A;  4L8J A;  5C0X I;  5KYI A;  1JOQ A;  3P7J A;  4HIM A;  4X3K A;  2B2V C;  2NN6 I;  4LF6 Q;  1HQR D;  1JOO A;  1VQJ A;  2Q2I A;  1PH2 A;  4TKO B;  4EQO A;  1N33 Q;  5BR8 Q;  3JAM E;  4N8X 1;  1KDA A;  3I4N H;  5FO7 B;  3S9W A;  5I6W A;  1OXV A;  2Q2T A;  3K80 C;  3EIV A;  2F0Q A;  1CZG A;  2UU9 L;  4HSP A;  5FLX L;  3K8A A;  1Y1V H;  3CD6 A;  4DR6 L;  2LFN A;  1PRT B;  1CM9 A;  2E8G A;  3HOY H;  1D5M C;  3MEH A;  1EL0 A;  2CH4 A;  2E2H H;  1VQD A;  1ZYR C;  1Y1W B;  4C3I H;  1SNM A;  1PFN A;  3GV3 A;  3ND8 A;  2AKW B;  2PQA A;  5DM7 3;  3S16 H;  1SDF A;  3V05 A;  1QVC A;  1U9R A;  2CVR A;  3QOJ A;  3VR4 A;  3R2T A;  2Y0S B;  5ELF A;  1EU3 A;  1MBY A;  3HKZ G;  4KLK A;  4XDX A;  4MIU A;  1GVP A;  3OSO A;  2RDH A;  1HZ9 A;  1CQF A;  1R9T B;  4X6A H;  4A3I G;  4A3B B;  2VW9 A;  2QF7 A;  5CV4 A;  4LUZ A;  4NDX A;  1SYC A;  2KCN A;  3K0X A;  4RHR A;  3H3V I;  2EYO A;  2EY1 A;  4KHP Q;  1X3P A;  3W5O A;  3OWF A;  1VQI A;  2PO4 A;  3K57 A;  4DR3 Q;  5I2X A;  4UP9 A;  1YZ6 A;  1KAA A;  3I7F A;  3GTJ B;  1EY9 A;  1BCP D;  4OX9 L;  2AUK A;  2RCN A;  4GOP B;  4C3H H;  1IBM L;  3U9S A;  4J8Q A;  4AYB G;  1ET9 A;  1PV4 A;  4KTA A;  4YHH L;  4UP8 A;  3Q22 A;  2RHS B;  1GM5 A;  4A93 B;  4JYA Q;  4RA8 A;  1JIC A;  2ZXR A;  5J3B A;  4ABN A;  1N36 L;  3NTH A;  2ZM6 L;  3A7A B;  5M3F H;  1C48 A;  4DV0 L;  2JA5 H;  2LXK A;  4BWG B;  3VR5 A;  2F0I A;  1O7I A;  3J81 E;  1JMC A;  1EEF D;  2R7Z B;  1SNQ A;  2CHB D;  5C3E B;  1G91 A;  5DM6 3;  1R4P B;  3R2I A;  4DR6 Q;  1LYL A;  4PV1 C;  2Q8R E;  4X64 L;  2HUG A;  5ELE A;  2QCP X;  3PO2 B;  1G2T A;  3FDT A;  2ZJQ A;  3PIP 3;  2H5X A;  2EXZ A;  5EPL A;  2DJG C;  2I07 B;  4M8A A;  4HTH A;  5ELO A;  3VA7 A;  2PW5 A;  5IYC G;  2K32 A;  2A69 D;  2AWO A;  4YCU A;  3NTK A;  1RIP A;  1JR0 D;  5LMU L;  3K5L A;  2F0P A;  2J7Z A;  2YV5 A;  3H15 A;  1SFO H;  5IP9 G;  3EVQ A;  1UAP A;  5K36 G;  4DV5 Q;  2KHI A;  4GS3 A;  5C44 H;  4A3F H;  2X6G A;  2F0H A;  4JC0 A;  4F88 A;  2CQO A;  3ZJY C;  2O2L D;  5HGT A;  1K3R A;  3E9H A;  2ZTC A;  4A3D H;  1X3Q A;  4BA2 I;  1I94 Q;  1S5C D;  1TVX A;  4H44 C;  5IYB H;  2N8N A;  1EY0 A;  4LF7 L;  4OX9 Q;  1KAB A;  2PQA B;  5E7N A;  2RA4 A;  3E3X A;  3KK7 A;  2E2J B;  2K4K A;  5GAD C;  3M4O H;  3C1F A;  5EBD A;  1GUN A;  5FOB B;  1V1O A;  1PHJ A;  3AU7 A;  2ZM6 Q;  4JBJ A;  2WFW A;  1XPR A;  4XT3 B;  1XTD A;  5IP7 H;  1E3P A;  2RQX A;  4RKB A;  4O42 A;  4R4I A;  1IL2 A;  2NTS A;  1KRT A;  1Q90 A;  1VQC A;  2G9D A;  2EOT A;  5C0X G;  2B2U A;  2Z4I A;  4KKU A;  5IY0 A;  2X69 A;  1QZH A;  4C3J H;  1VMP A;  4KHZ A;  4X64 Q;  1SE8 A;  1TU2 B;  5IOD A;  2RSN A;  1XPO A;  2MO1 A;  3P75 A;  1SRU A;  4HED A;  4EX5 A;  1SE3 A;  1FVI A;  1DM0 B;  3T1H L;  4POG A;  5ELD A;  4P72 A;  5IGB A;  2XWB B;  2ICI A;  5M3M B;  3A5U A;  1MIU A;  3G48 A;  1HQM C;  4N9T A;  4A3J B;  4Q5V A;  1M1K C;  3RN5 A;  4J15 A;  3UDI A;  3EJI A;  4MTN A;  4C1N K;  2K03 A;  1BCP C;  4NMZ A;  1Z47 A;  3I4N G;  4R1J A;  3J80 E;  3GTQ H;  2JN4 A;  1Y8N B;  4DR4 Q;  2EXD A;  3SEB A;  2B63 B;  3CCU A;  1N34 L;  4BY1 B;  1NMG A;  3H0G B;  1DOL A;  1KD1 C;  3BG3 A;  3AMU A;  3V96 A;  2F0E A;  1NCV A;  4PNY A;  2PPB C;  3HOY G;  1B2T A;  1Q7Y C;  2NVY B;  3JAM c;  4DNI A;  1H9R A;  3IFD A;  2MPM A;  4RWS C;  1JJC B;  1LO5 D;  4C3I G;  2K05 A;  2UUB L;  2F0J A;  2B2W A;  4APV A;  5M5Y B;  3N52 A;  1CFM A;  4P2C B;  1MHW C;  5J1Z A;  5IT9 c;  2Q2H A;  3CC2 A;  2F0D A;  3OW7 A;  2NUC A;  1W6K A;  4RGM A;  1BXT A;  1D7Q A;  2RKS A;  2XWJ B;  2B8F A;  2WIN B;  4DFA A;  3MXU A;  3C3L A;  1XMO Q;  5JVG 3;  1LT5 D;  3CU7 A;  5FLM G;  1ESF A;  2F0O A;  1TWG B;  4ZAI A;  1I6H B;  1VQ8 A;  1E24 A;  2YTV A;  5GAE C;  2EJM A;  4QUF A;  5BN5 A;  5COY A;  2NVQ B;  1NAP A;  4MN3 A;  3BVM A;  2PCF B;  1A62 A;  2VZA A;  2B29 A;  2XN9 C;  1ASY A;  2N55 A;  5C3X A;  3DMU A;  2N3S A;  4C3H G;  4L5S A;  3S1N H;  2KED A;  4ILW A;  4BY7 H;  1IYV A;  2VNU D;  2L11 A;  1ILP A;  1S5B D;  4GKK Q;  2G9H D;  3OW2 A;  1GO3 E;  4FXG C;  5M3F G;  2JA5 G;  2K14 A;  1YEZ A;  3AYH B;  4YIJ A;  2IPK D;  2LSS A;  3J81 j;  1EYC A;  2RCF A;  5IGG A;  1TWA H;  5HGQ A;  4R4Q A;  1NSN S;  3BU2 A;  3MFG A;  4AQY L;  1IYJ B;  2A74 C;  1GD7 A;  2B2Y C;  1KL9 A;  2IW3 A;  3I90 A;  4DN4 M;  4KN7 C;  1Q1E A;  1VQL A;  3PV0 A;  1OTC A;  1X54 A;  2F0G A;  3U4V A;  2UUB Q;  4WJW A;  5C6A A;  4LF4 Q;  2FXQ A;  1EIG A;  4K0K Q;  3KDF A;  3M7G A;  1LTL A;  3FMC A;  4DUZ L;  4A3M G;  2PI2 A;  3Q24 A;  2V1C C;  4X3U A;  3FRP B;  2PW7 A;  4R4T A;  5KEE A;  2JA8 B;  1TII D;  4EQP A;  3R3O A;  4G57 A;  4ID6 A;  4HJ7 A;  1K3B C;  3ICE A;  4JK1 C;  4DR2 L;  1IBK L;  5KGU A;  3L0O A;  2HHH L;  1A6X A;  2B2T C;  2RBM A;  2VY3 A;  5C44 G;  1XJV A;  1V9P A;  1AH9 A;  1VDZ A;  3OTO L;  3ULP A;  2HDL A;  1STH A;  1WTO A;  2MHV A;  4H7B A;  3PIO 3;  2FFK B;  2SOB A;  5KNC A;  1KC8 C;  2JA9 A;  1QWY A;  2KEE A;  4F8M A;  2Z4H A;  4N8F A;  1E1O A;  3MXP A;  3CMA A;  4LF8 L;  4DV1 Q;  3P1H A;  2E2I H;  2K28 A;  1V43 A;  1QOH A;  2WII B;  4LAA A;  2K04 A;  3CCE A;  1IW7 D;  1YIT A;  3IFT A;  3TEH B;  2R92 H;  3GTO B;  4TVA B;  5CC4 A;  5IP7 G;  3BVG A;  4P71 A;  1VQM A;  1ET6 A;  5DEH A;  1TS4 A;  5FO8 B;  1E7Z A;  4A3I H;  4V19 0;  1SEB D;  4CBV A;  4JI0 L;  1RDP D;  2YU9 H;  4DNR B;  1Q3L A;  4C3J G;  1L2F A;  4XIG S;  1A15 A;  1JOK A;  1RL2 A;  2MNA A;  3CXC A;  3K7U C;  4A3K H;  4I65 A;  4XT1 B;  4JI8 L;  4B3T L;  5K5P A;  1WTH A;  4HJ9 A;  1CI3 M;  3DLL A;  3S1Q H;  4H0L C;  1FL0 A;  3PMF A;  3JAM i;  4DUZ Q;  2JA7 H;  4OWT B;  1VQH A;  2K5H A;  4IJL A;  1HZC A;  2VB3 X;  5IGD A;  3C2P A;  5ELC A;  3ERS X;  3MWY W;  1SJH D;  3HGB A;  2I5L X;  4ZRZ A;  2R7D A;  3D0F A;  2AMC B;  4DR2 Q;  4IFD I;  4R8I A;  5C4X G;  2EYL A;  5J39 A;  2HHH Q;  1HCZ A;  3L9A X;  4YWM A;  3E6Z X;  3K6O A;  2IY5 B;  4E6I A;  1PA6 A;  3I70 A;  3OTO Q;  2NTT A;  2WB1 E;  2KJX A;  1TR5 A;  1BBU A;  1RD9 D;  1KNE A;  1VQK A;  4LFB Q;  2F0K A;  1WOC A;  4DUY Q;  4IPD A;  5A2Q E;  5E3F A;  3S15 B;  2K5Q A;  3KOJ A;  4UP7 A;  1H95 A;  4Y7N B;  1LTT D;  5M5X H;  5LMN L;  2K5D A;  3NQT A;  1CHQ D;  3I4M B;  1B9N A;  1XWE A;  3L2P A;  1WTR A;  1EFW A;  4H02 A;  5AFW A;  3M4P A;  4PQX A;  3SVM A;  2GA4 B;  3HOX G;  1GUG A;  1GXD C;  4CDD C;  1WCM H;  5IYC H;  1U4M A;  1KIX A;  2BH8 A;  1U4P A;  4ME5 A;  1NR4 A;  3W3A A;  3W2D A;  4FXD A;  1WTV A;  1SLJ A;  2NBF A;  4OHJ A;  3KUP A;  3UDX A;  1SE4 A;  2OXP A;  1WTX A;  1Z9F A;  1BBW A;  3TQY A;  3GTK B;  4R9W A;  3F2U A;  2K50 A;  3URY A;  1TY2 A;  1EZ6 A;  3AQQ A;  1AN8 A;  4A75 A;  3L7Z C;  2AUJ D;  4HIK A;  1P8L A;  2QDL A;  3GTG H;  3GQB A;  3J7Z C;  2F0M A;  3SK4 A;  1HNX L;  4FXK C;  1KLU D;  1TWF B;  5IGE A;  1DD2 A;  1X3E A;  1T5X D;  4DV6 L;  4TSS A;  1RHP A;  1A8V A;  1Y69 U;  4R4C A;  3DHQ A;  2VXW A;  4DXF A;  4DV3 L;  3RLO A;  3J81 i;  2LKV A;  1XMQ Q;  4BY7 G;  4FNF A;  1F9S A;  2XSC A;  1S5F D;  4FO2 A;  4K6D A;  1UWV A;  1S3O A;  3J7A F;  1XNQ Q;  1LLR D;  3PF4 A;  1MSG A;  2K75 A;  4HSV A;  2Z9H A;  3HKS A;  3CCJ A;  4HJ5 A;  3TS0 A;  1I4G A;  2AWN A;  4LW1 A;  3NEM A;  4JBW A;  5CBE E;  1HFN A;  1F2Y A;  1EY6 A;  4K8J A;  3I8Z A;  2QDB A;  4XQQ A;  2SEB D;  4O1N A;  1CK1 A;  4HR7 B;  2EIF A;  5D3I B;  1HTP A;  2PNH A;  4K8I A;  4J6H A;  1QJO A;  4O2D A;  4F7X A;  3SE0 A;  2E2D C;  2F1M A;  2NN6 H;  4JI6 L;  4BBR G;  1N32 L;  3NEN A;  5LMN Q;  3KLW A;  3CCS A;  1XTC D;  3HOV G;  1KLG D;  2AQ1 B;  4A3E H;  5D3D A;  4KKS A;  1BCP B;  2DJF C;  3M3Y B;  2OWO A;  4X65 L;  2A6E D;  4JV5 Q;  2E75 C;  1XPU A;  2B2T A;  4PG3 A;  4X66 Q;  4UPA A;  2XVS A;  4OEL B;  2XRQ D;  4ZQ3 A;  1Y1V B;  3T1Y L;  2VUM B;  1PTO F;  3MC0 B;  3DWA A;  1DOK A;  1I4H A;  4K6L A;  1H9M A;  3D4D A;  4OIJ A;  2D9U A;  1VQF A;  1X9N A;  5I4D A;  1EYG A;  1X32 A;  4ULL A;  4EGV A;  3QWN A;  3VDY A;  1QE6 A;  2JSO A;  1Q82 C;  1W6J A;  2JA6 G;  1Y14 B;  1PDQ A;  1O7Z A;  2F4V L;  5IT9 E;  2F4I A;  2KHJ A;  3AB9 A;  1HNX Q;  2LXJ A;  5NUC A;  2DNC A;  1Y8P B;  4BBS B;  3BZD B;  4BXX G;  3GTP H;  3V2T A;  1TS2 A;  5GQO A;  1SJE D;  2HIX A;  1IKM A;  4DV3 Q;  1K8M A;  1F9Q A;  1JWS D;  4FF2 A;  4LFA Q;  3GTM H;  3F2B A;  3HOZ H;  2NWG A;  1WJJ A;  2F03 A;  4DK0 A;  4EQ5 A;  4FF1 A;  1HJP A;  3X3M A;  1VF5 C;  1KAW A;  2QIL A;  1K8A C;  2R92 G;  3H3V H;  4X3S A;  1PH9 A;  4GN5 A;  2EE1 A;  4JI4 L;  3M7N A;  1FNV A;  5I2Y A;  1STN A;  2B2W C;  2A68 D;  2NZH A;  4DR5 Q;  4IOC A;  1L0Y B;  3OIQ A;  3FP9 A;  4UHV A;  5JPM C;  5G3L F;  1QNU A;  4QB4 A;  4C3H B;  4CDC C;  3DEO A;  2D5D A;  4YY3 Q;  4IFD G;  1N32 Q;  1DJR D;  5FLM H;  4A3K G;  3VYT A;  2F0S A;  2KEN A;  3CAM A;  4Z9C B;  3HRZ C;  1YHA A;  2RHQ B;  5M3F B;  5FJ8 G;  2JA5 B;  3BJU A;  1HNW Q;  4X65 Q;  2JA7 G;  3H91 A;  3J80 i;  1B44 D;  5JVH 3;  2L4N A;  2JE6 I;  4P75 A;  1PYB A;  2NVX H;  3T1Y Q;  3S17 B;  4KD4 A;  1UE1 A;  1D1I A;  2ZJR A;  1B7Y B;  3LX0 A;  1WTP A;  1TWC H;  2TMP A;  2MGS A;  1AP0 A;  4KJN A;  1V1P A;  2KCM A;  5D65 A;  4ZYS A;  1B70 B;  4NP5 A;  2R6G A;  2YTY A;  1AZQ A;  4DKA C;  5AJ3 L;  4CKC A;  1F2M A;  1VQ4 A;  2F4V Q;  1MJE A;  3U4Z A;  1L0X B;  4DNT B;  2UU9 Q;  5A35 A;  3UE1 A;  5LMN W;  1VCI A;  1K8O A;  1HH2 P;  1F9P A;  4A3G G;  4GN4 B;  4H13 C;  1CA5 A;  1SFO B;  3AFP A;  3A7L A;  2WKD A;  1VQO A;  4QL5 A;  1Y8O B;  1B3Q A;  2HIV A;  2I0Q A;  2N88 A;  4A3F B;  3MFY A;  4IPG A;  4CJ2 C;  3C1E A;  2KVM A;  3HKZ E;  1K0R A;  1F9R A;  5JJZ A;  5E4X A;  3ULJ A;  3E5S A;  3G6E A;  1WD1 A;  4A3D B;  3I55 A;  2R93 H;  2Z8L A;  1STY A;  1WCM G;  2MJ8 A;  5FLX c;  4A3M H;  4DF7 A;  2CFM A;  1C9O A;  1BQQ T;  1CKO A;  1U0L A;  5IGC A;  2EZV A;  2WB1 B;  2WAQ G;  5BN3 A;  1K83 B;  4A93 H;  1SYF A;  2QKI C;  3SR1 A;  2A6E C;  3BYT B;  4I7Z C;  3M4O B;  3HZX A;  1VF7 A;  4IO9 A;  1M4V A;  1STG A;  3WWV A;  2JEA I;  1TT2 A;  4KI0 A;  1QUQ A;  4GZY C;  1RTO A;  2MP1 A;  5JJL A;  4AYB E;  4OWW B;  5CGK A;  1NY4 A;  1VQG A;  1LT4 D;  1EOT A;  1QCB D;  3JAM L;  3PO2 H;  4WJ3 M;  1IBM Q;  1PH6 A;  3T56 B;  2MO0 A;  1JWM D;  1F2Z A;  4K2L A;  1VQ7 A;  4LNQ A;  1TS3 A;  1J5E L;  4GLA C;  4YHH Q;  5IT9 L;  1JT8 A;  1WTQ A;  4MTK A;  4Q0F A;  3GTL B;  4V0B A;  4RAU C;  1N36 Q;  1LT6 D;  3K7A B;  4JBM A;  1DYQ A;  2SNS A;  1H9J A;  4DV0 Q;  1JC7 A;  2CWA A;  1BNZ A;  2B3G A;  5IWA L;  2NN6 G;  2UXB L;  1UNS A;  3MVV A;  1FNU A;  1X55 A;  3HOU G;  5FKA C;  1WTW A;  5JEA H;  2A68 C;  2AQ3 B;  1JB7 A;  2L12 A;  1PVO A;  4A3E G;  2ATW A;  1RKN A;  3QOL A;  1X3G A;  4DGZ A;  5M5W B;  5L37 A;  3CF5 A;  2R61 A;  3GTQ B;  3FKI B;  5C0X J;  1SNC A;  4L5Q A;  1SND A;  4A3L H;  1V1P B;  2RSO A;  3S2H H;  5LMU Q;  3A8J E;  2F0N A;  2PI2 E;  1Q8I A;  2E5L L;  4L63 B;  1LV9 A;  1EY5 A;  2ICE C;  5CV9 A;  4RG1 A;  2K01 A;  1GHJ A;  4CJ0 B;  5C5M A;  3TDQ A;  5C4X H;  1KRS A;  1GUO A;  3CQZ B;  3I2Z A;  4A76 A;  1G6Z A;  4C2M H;  3OWE B;  2EQS A;  3RD4 A;  1ENC A;  2JK8 A;  3RZO B;  4POF A;  2L5T A;  2IJ0 A;  1VQP A;  3GO5 A;  4NPS A;  1CTM A;  1CQV A;  3I73 A;  2OQK A;  4LF7 Q;  2UUC L;  1DOM A;  1XYI A;  1WD0 A;  1UUP A;  4JI2 L;  3EBE A;  4QMG A;  1T5E A;  3HOZ G;  2CCZ A;  3HP3 A;  2Z6K C;  3H3V C;  3J81 L;  1SMY D;  2SNM A;  3TP5 A;  3HOX H;  2QGQ A;  4GLV B;  4CKB A;  5I6Y A;  4CJ1 B;  4DV4 L;  5M3M H;  4X3T A;  3NPP A;  3RNU A;  5KNB A;  4QGU A;  2BH2 A;  3G4S A;  2NZ1 D;  3ITP A;  3S1R B;  4LF9 L;  1HUM A;  4G7H C;  1SYG A;  2CH4 W;  2I5M X;  1RTN A;  2IT1 A;  3OMG A;  4JI7 L;  2DY8 A;  5IWA Q;  3S1N B;  3U50 C;  1A2T A;  1UE5 A;  1VQA A;  3ZYY X;  3PIP A;  4FF3 A;  2RDF A;  5EKK A;  1M8A A;  2A69 C;  1CUK A;  3MXN A;  3VR3 A;  1EQQ A;  1CSQ A;  4BY1 H;  1R4Q B;  2QA4 A;  3H0G H;  1D5X C;  3WOE A;  3T1H Q;  5EPK A;  3T53 B;  2K6A A;  4DV2 L;  2C9O A;  1TWA B;  1PTO H;  2D62 A;  4PMC A;  4ZK9 B;  3TSS A;  1EU4 A;  2E5L Q;  2CW0 D;  3IAY A;  3HG9 A;  2JQO A;  3MXG A;  2JEB I;  1FNW A;  3I56 A;  1BCP F;  1JB3 A;  2IX0 A;  3VYR A;  2Y0S G;  3R8B A;  3G6J B;  2F0L A;  1CA6 A;  2MQH A;  4BA1 I;  3CHB D;  3KLR A;  4KY6 A;  1K28 A;  2OEO A;  1X6O A;  1VQN A;  2PZW A;  1T9H A;  3H09 A;  2ZXP A;  1E2Z A;  3STB D;  1N34 Q;  3KFU A;  2QW7 A;  1Q1B A;  5C4J H;  3F1Z A;  3QJY A;  3KJO A;  2UUC Q;  2KQ3 A;  1JE4 A;  1TWG H;  4WOR A;  1I6H H;  4BBR H;  1K73 C;  1IYU A;  2XNA C;  4IUT A;  2L55 A;  4N9P A;  3MA2 B;  3A74 A;  1E0B A;  3F2C A;  1B9M A;  2NVQ H;  3HOV H;  2J4X A;  2ASB A;  3RZD H;  3DM3 A;  4NXM L;  1GUW A;  2XIW A;  3CKI B;  4L5T A;  2R93 G;  1PRT F;  2E74 C;  4DV4 Q;  2EYJ A;  5E4W C;  1V1Q A;  3L3O C;  2PZU A;  1K9M C;  3DXJ C;  3A8K E;  1CHP D;  1EIY B;  5EBC A;  4A93 G;  3PUV A;  4QIW E;  2E2I B;  4RGT A;  4LK1 C;  4JI7 Q;  1O80 A;  2ZJP A;  1PTO D;  3CCL A;  1K0S A;  1I4Q A;  1PZK D;  5IE8 A;  3A56 A;  3T16 A;  2Z0S A;  3FHW A;  1DXM A;  1PZI D;  3S2D H;  2JA6 H;  4DXG A;  3TRZ A;  1OXX K;  3NTI A;  4JW0 A;  5EGT A;  3HKZ B;  4BXX H;  2VL6 A;  3PO2 G;  4KD3 A;  1PFM A;  4A3I B;  5IGF A;  2KEC A;  2EY6 A;  4LFC L;  3TZU A;  2VQE L;  5TSS A;  3J80 L;  2YU9 B;  3CC7 A;  1ESR A;  1CSP A;  1AFP A;  4X62 L;  4A3K B;  1EYA A;  1YJN A;  5GAG C;  4C56 C;  1EZ8 A;  3NBH A;  3DWQ A;  3PUW A;  3CCM A;  1EWI A;  1II3 A;  4U67 3;  2JA8 H;  3NXW A;  3S1Q B;  5IYD H;  1Q12 A;  1HNZ L;  2BE5 D;  4JBK A;  4KJO A;  4TQU S;  3U58 A;  4UY8 C;  2OTL A;  1G29 1;  3CRK C;  4PZ6 A;  2EPB A;  3FVQ A;  5GRO A;  1YNJ D;  5H1S E;  3DEP A;  2A5H A;  4OON A;  4AQY Q;  4IN3 A;  3UE0 A;  3S24 A;  4AYB B;  5G3L D;  4IFD H;  1I5F A;  1SN8 A;  3PUZ A;  2BDN A;  5JEA G;  1W3S A;  4XYO A;  4IUP A;  1XNR L;  3G7L A;  3E0J A;  1NBW A;  1BVS A;  2HT1 A;  5FJ8 H;  1YVC A;  2D2C C;  4AIM A;  2CWP A;  1XX8 A;  1AE2 A;  2BCO A;  1QVG A;  3Q6S A;  4A3L G;  1TXY A;  1MKH A;  3K5M A;  3M9B A;  2KCC A;  4JVZ A;  1NMF A;  5CV5 A;  1WI5 A;  5M5X B;  1IBK Q;  1JQY D;  1DON A;  3KJP A;  1GUT A;  5ELB A;  1ENA A;  4B3R L;  4LF5 L;  3J7A V;  3KLS A;  3NSW A;  1S5E D;  4JI1 L;  2EYF A;  2CW0 C;  1VMC A;  3R93 A;  1HPC A;  4DK1 A;  4DR1 L;  4FF4 A;  4HIO A;  3NP8 A;  3J7Y W;  2Z6K A;  5FLX E;  4NXN L;  1ASZ A;  1KXL A;  3TP6 A;  1KQS A;  3S14 H;  4A3G H;  4LF8 Q;  4YCW A;  2PZT A;  3D4R A;  3KDF B;  1E1T A;  2FHT A;  3STB C;  4DK6 C;  1QB5 D;  3CPF A;  3ERO A;  4RHS A;  5DAU A;  3OHX C;  1HUN A;  1MD2 D;  5M3M G;  3HOW H;  1D6E C;  4HMI A;  2EJG C;  4A3J G;  1RF2 D;  2HD3 A;  1JE5 A;  5C4H A;  3NQI A;  3G71 A;  1EEI D;  4EQN A;  4KV6 A;  3HEJ A;  1VQ9 A;  4NB3 A;  3I4L A;  3EN2 A;  3D4W A;  3ER0 A;  4JI0 Q;  1QVF A;  4ME3 A;  4ZUJ A;  1SNP A;  1B3A A;  4IUN A;  2FJ2 A;  5ELN A;  2JJQ A;  4B3T Q;  4JI8 Q;  1TWH H;  1X56 A;  4BY1 G;  3H94 A;  1G51 A;  1O78 A;  2M00 A;  3H0G G;  4ZLT F;  4XXE A;  1I50 H;  3S15 H;  4Y7N H;  4GKJ L;  1PTO C;  2JP1 A;  1YHQ A;  2K5V A;  1AEX A;  3EA6 A;  3CME A;  1A63 A;  3N6R A;  3SXH A;  1I3Q B;  4CDF C;  1N33 L;  5BR8 L;  3F2D A;  3I4M H;  2E76 C;  4HJA A;  1GKH A;  1I6V C;  3NBH B;  4WFN 3;  1GJX A;  5DNF A;  3K58 A;  2YTX A;  1PYS B;  3PIO A;  1YJ9 A;  1EIF A;  2JXM B;  1BOS A;  3PUX A;  4QQB X;  3BZC A;  3D3R A;  2DN8 A;  2NVT H;  3ND9 A;  3QG1 A;  4XQJ A;  1IBL L;  3NE5 B;  2NB0 A;  4JI1 Q;  1ROD A;  4I7A A;  1ZEQ X;  4QF4 A;  1IW7 C;  4JPB W;  1EUJ A;  4XYQ A;  3PO3 H;  5C5L A;  3A5Z B;  2K33 A;  4NXN Q;  4YWK A;  2IL8 A;  2ES2 A;  1LAC A;  3HOU H;  2BE5 C;  4DAM A;  5FO9 B;  1EY4 A;  4DPG A;  3K5N A;  3I4N B;  1XXG A;  4OGQ C;  1YNJ C;  2F3V A;  3OIP A;  2OQ0 A;  4ZKB B;  2VB2 X;  1FJG L;  2EJF C;  1A3T A;  2A6H D;  2BDO A;  3GTP B;  1ZXT A;  3Q0A A;  1IHZ A;  3TBI B;  4MZ9 A;  1SYE A;  4O0A A;  3K81 C;  3HOY B;  3BVZ A;  2V4D A;  2E2H B;  3C46 A;  3VR2 A;  4C3I B;  3HOZ B;  1IZ6 A;  3BZK A;  4DR3 L;  2PMZ E;  4Y52 H;  2FIN B;  3S1M H;  4DAY A;  2IHE A;  4K5W A;  3S16 B;  3SHL A;  2F0V A;  1HZA A;  3LWE A;  1EY8 A;  4JOI C;  1C8C A;  2N49 A;  3M85 A;  1OXS C;  1U4L A;  1LAB A;  3SK5 A;  3NK9 A;  4DK3 C;  4DV6 Q;  4GKJ Q;  2A19 A;  3OPO A;  1LM0 A;  2KHS A;  3PF5 A;  1CKN A;  4JYA L;  1SYB A;  5EAY A;  4IQZ A;  4CDE C;  3TP7 A;  4WJ4 A;  4HCS A;  1VQ5 A;  3M3Y H;  4HN7 A;  3O13 A;  1NJI C;  4LUV A;  4QIW B;  5CMD A;  1LT3 D;  1YBY A;  1TY0 A;  5LL6 X;  1MGS A;  3FEW X;  4F87 A;  1SE2 A;  4OXP A;  1MI2 A;  1DGS A;  5IYD G;  5A2Q L;  1I4X A;  4A4I A;  2JA8 G;  2VUM H;  3IKJ A;  5T1I A;  1Q46 A;  2ID0 A;  1IBL Q;  4S3S A;  2K1B A;  1D2B A;  1EIH A;  2NVX B;  1F77 A;  1F2L A;  3T4A C;  4JI6 Q;  1TWC B;  1ILQ A;  1JJG A;  3MAQ A;  5HY6 A;  1X3F A;  2BOS A;  1L1O C;  4BBS H;  4C1N I;  2XTI A;  1EQV A;  2K52 A;  2QEJ C;  1STB A;  4K2K A;  2F52 A;  3EFX D;  1FGU A;  4GNX C;  3MZ5 A;  4DV5 L;  1FJG Q;  1Y1W H;  4IFD J;  3MHB A;  5EKI A;  4YWL A;  2KBN A;  2F0U A;  4B3S L;  4ZKC B;  2ENB A;  2L15 A;  2O5I C;  1NE3 A;  1E22 A;  1I94 L;  1EWH A;  1SMX A;  2OT2 A;  2DY7 A;  3RLN A;  1C7Y A;  3PSI A;  1R9T H;  2ALY B;  1OXU A;  4LWC A;  4A3B H;  2R93 B;  3CCQ A;  3TN2 A;  4QCL A;  4A3M B;  1W2B A;  2ZTE A;  3QIA A;  2FMM A;  1G2S A;  4DR7 L;  2N78 A;  1CZW A;  2WAC A;  4RCO A;  2LMC B;  4PMW A;  3OOC A;  1SBB B;  1BKB A;  5C44 B;  4DU9 A;  3I3C A;  1SR3 A;  5C3W A;  2A8V A;  3GTJ H;  2WV6 D;  1SNO A;  5D14 A;  5JOB A;  2ZXO A;  4JI4 Q;  5J22 A;  2K7V A;  3HOW G;  1EOV A;  2IX3 A;  3AEV A;  3S17 H;  4KMU C;  1IXR A;  4RKL A;  1EFI D;  5COR A;  2A73 B;  3H6M A;  1PRT D;  4DAY B;  3KBG A;  3NWS A;  4DV7 L;  2RDG A;  3PQI A;  5FK9 C;  2I5H A;  2NZO A;  3SDZ A;  5I9O A;  3P20 A;  4OEM B;  2A6H C;  5CV8 A;  2CQA A;  2R7Z H;  1YNX A;  1CKN B;  5C3E H;  2DUD A;  4MNO A;  3RLF A;  1J9O A;  1U5K A;  2R3Z A;  4L6T B;  2AQ2 B;  3KBX A;  1HR0 L;  3W1B A;  4IOA A;  4K14 A;  2EY5 A;  3I4M G;  2M2L A;  1TQO A;  1CKM A;  1L0W A;  4RCN A;  1B8A A;  4C3J B;  4B3S Q;  1NNX A;  5EQ0 A;  4DR4 L;  1WFQ A;  1SAP A;  4KN4 C;  2EYH A;  4KHV A;  2OTJ A;  4DAV A;  4OIK A;  5AJ3 Q;  1UEB A;  1U4R A;  4JCV E;  3BDL A;  1K83 H;  1PH7 A;  1PH5 A;  2VQF Q;  3GV6 A;  2OF1 A;  3IRB A;  3PO3 G;  3S2H B;  1KDB A;  1PZJ D;  1PH1 A;  4DR7 Q;  2F0T A;  2CKZ B;  2XRS D;  1YI2 A;  5JJK A;  5C4X B;  4EVO A;  2F3I A;  2MUY A;  4C2M B;  4KK7 A;  4ALP A;  1ICF B;  5CR3 A;  5HUR A;  3SK8 A;  1FD7 D;  2GN5 A;  2WAQ E;  3JC6 6;  3VR6 A;  3F8T A;  4PZ7 A;  2VQF L;  1XMO L;  2IX1 A;  2HQL A;  2E2J H;  3QO2 A;  1OXT A;  3A54 A;  4FYD A;  3GTL H;  4JOI A;  4IUU A;  3K7A H;  2Z6B A;  3QR8 A;  4DV7 Q;  5KND A;  2B2V A;  3ERQ A;  1S4Z A;  1V8Q A;  4FP5 D;  1J8I A;  2FMC A;  1JOR A;  2B39 A;  3HOX B;  3K0Y A;  1MJC A;  4B3M L;  4A3C H;  2KOL A;  1GUS A;  1HXY D;  1JCK B;  5E1F A;  2HCC A;  1KDC A;  1HR0 Q;  1KHI A;  1H9K A;  2I46 A;  4NKL A;  5C4Z A;  4GKK L;  5GAH C;  1PFB A;  3I72 A;  1BUV T;  1B50 A;  1S5D D;  1H9S A;  3AFQ A;  4PMB A;  1VQ6 A;  4IUV A;  1UE7 A;  2QEX A;  5M5W H;  1OO9 B;  2J0T D;  3HS0 C;  4XTC S;  1KTK A;  1RJT A;  1J5E Q;  1JJ2 A;  3FKI H;  1NTG A;  4GN3 B;  5LHY 1;  5IIF A;  1LTI D;  1Y1V G;  2VUM G;  4JG2 A;  2PMZ B;  2K5N A;  4A3J H;  1HRJ A;  1PTO B;  1WYD A;  3CQZ H;  1S72 A;  3SGI A;  1LUZ A;  1YNN D;  4BY7 B;  3UDG A;  1L1O A;  1QUQ B;  2UXB Q;  4LF4 L;  4HAE A;  3RZO H;  4K0K L;  2D0O A;  3MTS A;  4LUO A;  1G6P A;  1TS5 A;  4GNX A;  2B63 H;  3RR5 A;  3NUC A;  1PRT C;  4BBS G;  4M1U B;  3KYH C;  1YHB A;  2NVY H;  1GHK A;  1Y1W G;  1BO0 A;  1STA A; 
#chains in the Genus database with same CATH homology
 1B53 A;  1ONL A;  2F0F A;  5C4J B;  3T13 A;  4DAP A;  1DCZ A;  1D5Z C;  1JWU D;  4BBR B;  1HA6 A;  3D31 A;  5EKL A;  5EPJ A;  3HOV B;  3RZD B;  3NWT A;  3NHH A;  4IUR A;  1LTA D;  3UI2 A;  4CKE A;  3WDN A;  2EYP A;  2PQE A;  3KF8 A;  2C5C A;  2DNE A;  2HDM A;  1O7L A;  2EY2 A;  4IUQ A;  4QUC A;  3NBI A;  2ZT9 C;  1B4O A;  2L9H A;  4WRD A;  1C4Q A;  2X6L A;  3TP8 A;  1IKL A;  3S2D B;  2BA0 A;  4OO1 H;  1FR3 A;  3D6C A;  1KNA A;  2JA6 B;  1LTB D;  4KKT A;  1BF4 A;  1PLF A;  5CV7 A;  2Q8I B;  2HCI A;  2L0C A;  1G8Z D;  3VYS A;  1SXT A;  1TKW B;  1DZ1 A;  4NW2 A;  4UDU C;  1SYD A;  1EQT A;  2R92 B;  3LWU A;  2H1E A;  3FPP A;  2EDG A;  4OO1 I;  2M9V A;  3GD7 A;  5KRU A;  2WP8 J;  4KY5 A;  4LJZ C;  1H9S B;  4RFB A;  2LS0 1;  2KUM A;  2KA7 A;  1STE A;  3KLS X;  4ZUI A;  1IL8 A;  4B9W A;  5I9P A;  1HA5 A;  1Z6H A;  2H4O A;  3BYY B;  1EY7 A;  4K5X A;  2TSS A;  1EYD A;  4G7O C;  1PMR A;  2JA7 B;  3M4Y A;  1SMY C;  5CBA E;  4K5V A;  4MHE A;  3BDO A;  1FYC A;  1MSH A;  3VYU A;  1GOZ A;  4HCE A;  5CV6 A;  1EWC A;  3U9O A;  3SK6 A;  2IWH A;  3A8I E;  3VA5 A;  1YNN C;  3BDC A;  4RGN A;  1ML0 D;  1LTR D;  5IOC A;  4UAI A;  4KY7 A;  5JEA J;  2BA1 A;  3S14 B;  1O7Y A;  4A3G B;  1BR9 A;  1B1Z A;  1Z7T A;  1QIL A;  3TME A;  3K5O A;  1E2V A;  4CHT B;  1CT1 D;  1ENF A;  1WCM B;  3HOW B;  3RMH A;  1RCV D;  1UEA B;  1AW7 A;  3T51 B;  2HQE A;  4HMJ A;  2WAQ B;  4DA2 A;  3K59 A;  3RUZ A;  3ONA B;  1QG7 A;  3GP7 A;  2K5W A;  2F3W A;  4FVM A;  1A2U A;  5KYL A;  1ZYR D;  4LMQ D;  1TWH B;  4G7Z C;  3GTG B;  1WVL A;  1BBX C;  2LY7 A;  2WKC A;  3DUZ A;  1NR2 A;  2O4X A;  1I4R A;  1I50 B;  3X3N A;  2Z1C A;  5EJW A;  1BDO A;  2NYZ D;  2B8G A;  5JAV A;  1ZKO A;  1D1K A;  2EYM A;  5JPN C;  4G4K A;  2F0W A;  2PNR C;  3IL8 A;  2NVT B;  1LTG D;  4U68 A;  3CRL C;  4XQN A;  3OMC A;  1FGB D;  5CYU A;  3DWP A;  3A55 A;  5K36 H;  3PO3 B;  1ICW A;  1HHV A;  1A3U A;  4RH6 A;  4B08 A;  5LL6 S;  1HTL D;  3HOU B;  1SSO A;  1QNK A;  1A3V A;  3EQL C;  4A3E B;  1LTS D;  2PYK A;  1PXU A;  3I91 A;  2O5J C;  5T1G A;  4IAL A;  2L1B A;  4RGO S;  5KIX A;  3PUY A;  1I4P A;  3TZD A;  3QB3 A;  3DM1 A;  3D8G A;  1NUC A;  3Q23 A;  4B9X A;  4TRD A;  4IZ8 A;  3LNN A;  4J1M A;  4OL7 A;  1E2W A;  5F2D A;  2B2Y A;  3S1M B;  5M9O A;  2YYZ A;  5ISR A;  2RVL A;  4OO1 G;  4BS9 A;  3WOF A;  5C0X H;  2JYO A;  1HFG A;  3FPU B;  1PYW D;  4ODG A;  3BS1 A;  2Q8T A;  3GTM B;  2B2U C;  3D6W A;  5BN4 A;  2EVB A;  4R8N A;  1AZP A;  4CGY B;  2SDF A;  4L8J A;  5C0X I;  5KYI A;  1JOQ A;  3P7J A;  4X3K A;  2B2V C;  2NN6 I;  1HQR D;  1JOO A;  4TKO B;  4EQO A;  3JAM E;  1KDA A;  5FO7 B;  3S9W A;  5I6W A;  1OXV A;  2F0Q A;  1CZG A;  4HSP A;  5FLX L;  2LFN A;  1PRT B;  1CM9 A;  1D5M C;  3MEH A;  1EL0 A;  1ZYR C;  1Y1W B;  1SNM A;  1PFN A;  3GV3 A;  3ND8 A;  5DM7 3;  1SDF A;  3V05 A;  1U9R A;  2CVR A;  3QOJ A;  3VR4 A;  3R2T A;  2Y0S B;  5ELF A;  1EU3 A;  1MBY A;  4XDX A;  4MIU A;  3OSO A;  2RDH A;  1CQF A;  1R9T B;  4A3B B;  2QF7 A;  5CV4 A;  4NDX A;  1SYC A;  2KCN A;  4RHR A;  2EYO A;  2EY1 A;  1X3P A;  3OWF A;  2PO4 A;  3K57 A;  5I2X A;  1KAA A;  3GTJ B;  1EY9 A;  1BCP D;  2AUK A;  3U9S A;  4J8Q A;  1ET9 A;  4KTA A;  3Q22 A;  4A93 B;  4RA8 A;  1JIC A;  2ZXR A;  4ABN A;  3NTH A;  3A7A B;  1C48 A;  4BWG B;  3VR5 A;  2F0I A;  3J81 E;  1EEF D;  2R7Z B;  1SNQ A;  2CHB D;  5C3E B;  1G91 A;  5DM6 3;  1R4P B;  3R2I A;  4PV1 C;  2Q8R E;  2HUG A;  5ELE A;  2QCP X;  3PO2 B;  1G2T A;  3FDT A;  3PIP 3;  2EXZ A;  5EPL A;  2I07 B;  4M8A A;  4HTH A;  3VA7 A;  2PW5 A;  2K32 A;  2A69 D;  2AWO A;  3NTK A;  1JR0 D;  3K5L A;  2F0P A;  2J7Z A;  3EVQ A;  1UAP A;  5K36 G;  2X6G A;  2F0H A;  4F88 A;  2O2L D;  5HGT A;  1X3Q A;  4BA2 I;  1S5C D;  1TVX A;  4H44 C;  1EY0 A;  1KAB A;  2RA4 A;  3KK7 A;  2E2J B;  3C1F A;  5EBD A;  1GUN A;  5FOB B;  1V1O A;  3AU7 A;  4XT3 B;  2RQX A;  4RKB A;  4O42 A;  2NTS A;  1Q90 A;  2G9D A;  2EOT A;  5C0X G;  2B2U A;  2Z4I A;  4KKU A;  2X69 A;  1VMP A;  4KHZ A;  1TU2 B;  5IOD A;  2RSN A;  3P75 A;  4HED A;  1SE3 A;  1DM0 B;  5ELD A;  5IGB A;  2XWB B;  2ICI A;  5M3M B;  1HQM C;  4N9T A;  4A3J B;  4Q5V A;  3EJI A;  4C1N K;  2K03 A;  1BCP C;  4NMZ A;  1Z47 A;  3J80 E;  1Y8N B;  3SEB A;  2B63 B;  4BY1 B;  3H0G B;  1DOL A;  3BG3 A;  3AMU A;  3V96 A;  2F0E A;  1NCV A;  4PNY A;  2PPB C;  1B2T A;  2NVY B;  1H9R A;  3IFD A;  2MPM A;  4RWS C;  4C3I G;  1LO5 D;  2K05 A;  2F0J A;  2B2W A;  5M5Y B;  3N52 A;  1CFM A;  4P2C B;  5J1Z A;  2F0D A;  3OW7 A;  2NUC A;  1W6K A;  4RGM A;  1BXT A;  2RKS A;  2XWJ B;  2B8F A;  2WIN B;  4DFA A;  3MXU A;  3C3L A;  5JVG 3;  1LT5 D;  3CU7 A;  1ESF A;  2F0O A;  1TWG B;  4ZAI A;  1I6H B;  2EJM A;  4QUF A;  5BN5 A;  5COY A;  2NVQ B;  1NAP A;  4MN3 A;  3BVM A;  2PCF B;  2XN9 C;  2N55 A;  5C3X A;  3DMU A;  4C3H G;  2KED A;  4ILW A;  1IYV A;  2VNU D;  2L11 A;  1ILP A;  1S5B D;  2G9H D;  4FXG C;  4YIJ A;  2IPK D;  1EYC A;  5IGG A;  1NSN S;  3MFG A;  2A74 C;  2B2Y C;  2IW3 A;  3I90 A;  4DN4 M;  4KN7 C;  1Q1E A;  3PV0 A;  2F0G A;  4WJW A;  5C6A A;  1EIG A;  3M7G A;  3FMC A;  3Q24 A;  4X3U A;  3FRP B;  2PW7 A;  5KEE A;  2JA8 B;  1TII D;  4EQP A;  3R3O A;  4G57 A;  4ID6 A;  4JK1 C;  5KGU A;  1A6X A;  2B2T C;  2RBM A;  1VDZ A;  2HDL A;  1STH A;  2MHV A;  4H7B A;  3PIO 3;  2FFK B;  2SOB A;  5KNC A;  1QWY A;  2KEE A;  4F8M A;  2Z4H A;  3MXP A;  3P1H A;  2K28 A;  1V43 A;  1QOH A;  2WII B;  4LAA A;  2K04 A;  1IW7 D;  3IFT A;  3GTO B;  5CC4 A;  3BVG A;  1ET6 A;  5DEH A;  1TS4 A;  5FO8 B;  4V19 0;  1SEB D;  4CBV A;  1RDP D;  4DNR B;  1Q3L A;  4C3J G;  4XIG S;  1A15 A;  1JOK A;  4I65 A;  4XT1 B;  5K5P A;  1CI3 M;  4H0L C;  3PMF A;  2VB3 X;  5IGD A;  3C2P A;  5ELC A;  3MWY W;  1SJH D;  3HGB A;  4ZRZ A;  4IFD I;  4R8I A;  2EYL A;  5J39 A;  1HCZ A;  3L9A X;  3E6Z X;  3K6O A;  4E6I A;  3I70 A;  2NTT A;  2KJX A;  1TR5 A;  1RD9 D;  1KNE A;  2F0K A;  5A2Q E;  5E3F A;  3S15 B;  2K5Q A;  4Y7N B;  1LTT D;  2K5D A;  3NQT A;  1CHQ D;  3I4M B;  1B9N A;  1XWE A;  1WTR A;  5AFW A;  4PQX A;  3SVM A;  2GA4 B;  1GUG A;  1GXD C;  1U4M A;  1U4P A;  4ME5 A;  1NR4 A;  3W3A A;  3W2D A;  4FXD A;  1WTV A;  2NBF A;  4OHJ A;  3KUP A;  1SE4 A;  2OXP A;  1WTX A;  3GTK B;  4R9W A;  3F2U A;  3URY A;  1TY2 A;  1EZ6 A;  1AN8 A;  3L7Z C;  2AUJ D;  3GQB A;  2F0M A;  3SK4 A;  4FXK C;  1KLU D;  1TWF B;  5IGE A;  1DD2 A;  1T5X D;  4TSS A;  1RHP A;  1Y69 U;  3DHQ A;  2VXW A;  4DXF A;  2LKV A;  4FNF A;  1F9S A;  2XSC A;  1S5F D;  4FO2 A;  4K6D A;  3J7A F;  1LLR D;  1MSG A;  4HSV A;  1I4G A;  2AWN A;  4JBW A;  5CBE E;  1HFN A;  1F2Y A;  1EY6 A;  4K8J A;  3I8Z A;  2QDB A;  4XQQ A;  2SEB D;  4O1N A;  1CK1 A;  4HR7 B;  5D3I B;  1HTP A;  4K8I A;  4J6H A;  1QJO A;  4F7X A;  3SE0 A;  2E2D C;  2F1M A;  2NN6 H;  1XTC D;  1KLG D;  2AQ1 B;  5D3D A;  4KKS A;  1BCP B;  3M3Y B;  2A6E D;  2E75 C;  2B2T A;  2XVS A;  2XRQ D;  4ZQ3 A;  1Y1V B;  2VUM B;  1PTO F;  3MC0 B;  3DWA A;  1DOK A;  1I4H A;  4K6L A;  1H9M A;  3D4D A;  4OIJ A;  2D9U A;  5I4D A;  1X32 A;  4ULL A;  4EGV A;  3QWN A;  1QE6 A;  2JSO A;  1W6J A;  1PDQ A;  1O7Z A;  5IT9 E;  2F4I A;  3AB9 A;  5NUC A;  2DNC A;  1Y8P B;  4BBS B;  3BZD B;  3V2T A;  1TS2 A;  1SJE D;  1IKM A;  1K8M A;  1F9Q A;  1JWS D;  4FF2 A;  2NWG A;  2F03 A;  4DK0 A;  4FF1 A;  3X3M A;  1VF5 C;  2QIL A;  4X3S A;  2EE1 A;  3M7N A;  1FNV A;  5I2Y A;  1STN A;  2B2W C;  2A68 D;  1L0Y B;  3OIQ A;  5JPM C;  5G3L F;  1QNU A;  4QB4 A;  4C3H B;  3DEO A;  2D5D A;  4IFD G;  1DJR D;  3VYT A;  2F0S A;  4Z9C B;  3HRZ C;  5M3F B;  2JA5 B;  3H91 A;  1B44 D;  5JVH 3;  2L4N A;  2JE6 I;  3S17 B;  4KD4 A;  1D1I A;  3LX0 A;  1WTP A;  2TMP A;  2MGS A;  1AP0 A;  4KJN A;  1V1P A;  5D65 A;  4ZYS A;  4NP5 A;  2R6G A;  1AZQ A;  4CKC A;  1F2M A;  1L0X B;  4DNT B;  5A35 A;  1VCI A;  1K8O A;  1F9P A;  4H13 C;  1CA5 A;  1SFO B;  3A7L A;  2WKD A;  1Y8O B;  2N88 A;  4A3F B;  3MFY A;  4CJ2 C;  3C1E A;  2KVM A;  1F9R A;  5JJZ A;  5E4X A;  3E5S A;  1WD1 A;  4A3D B;  2Z8L A;  1STY A;  2MJ8 A;  4DF7 A;  1BQQ T;  5IGC A;  2EZV A;  2WB1 B;  5BN3 A;  1K83 B;  1SYF A;  2QKI C;  3SR1 A;  2A6E C;  3BYT B;  4I7Z C;  3M4O B;  3HZX A;  1VF7 A;  1M4V A;  1STG A;  2JEA I;  1TT2 A;  4KI0 A;  4GZY C;  1RTO A;  2MP1 A;  5CGK A;  1LT4 D;  1EOT A;  1QCB D;  3JAM L;  3T56 B;  1JWM D;  1F2Z A;  4K2L A;  1TS3 A;  5IT9 L;  1WTQ A;  4Q0F A;  3GTL B;  4V0B A;  4RAU C;  1LT6 D;  3K7A B;  1DYQ A;  2SNS A;  1H9J A;  1JC7 A;  1BNZ A;  2NN6 G;  1UNS A;  3MVV A;  1FNU A;  5FKA C;  1WTW A;  5JEA H;  2A68 C;  2AQ3 B;  2L12 A;  1RKN A;  3QOL A;  4DGZ A;  5M5W B;  2R61 A;  3GTQ B;  3FKI B;  5C0X J;  1SNC A;  1SND A;  1V1P B;  2RSO A;  3A8J E;  2F0N A;  1Q8I A;  4L63 B;  1LV9 A;  1EY5 A;  2ICE C;  5CV9 A;  2K01 A;  1GHJ A;  4CJ0 B;  5C5M A;  3TDQ A;  1GUO A;  3CQZ B;  1G6Z A;  3OWE B;  3RD4 A;  1ENC A;  3RZO B;  2L5T A;  2IJ0 A;  3GO5 A;  1CTM A;  1CQV A;  3I73 A;  1DOM A;  1XYI A;  1WD0 A;  1UUP A;  4QMG A;  1T5E A;  3HP3 A;  3H3V C;  3J81 L;  1SMY D;  2SNM A;  3TP5 A;  4CKB A;  5I6Y A;  4CJ1 B;  4X3T A;  3NPP A;  5KNB A;  2NZ1 D;  3ITP A;  3S1R B;  1HUM A;  4G7H C;  1SYG A;  1RTN A;  2IT1 A;  3OMG A;  2DY8 A;  3S1N B;  1A2T A;  3ZYY X;  4FF3 A;  2RDF A;  5EKK A;  1M8A A;  2A69 C;  3MXN A;  3VR3 A;  1R4Q B;  1D5X C;  3WOE A;  5EPK A;  3T53 B;  2K6A A;  2C9O A;  1TWA B;  1PTO H;  2D62 A;  4PMC A;  4ZK9 B;  3TSS A;  1EU4 A;  3IAY A;  2CW0 D;  3HG9 A;  3MXG A;  2JEB I;  1FNW A;  1BCP F;  1JB3 A;  2IX0 A;  3VYR A;  3R8B A;  3G6J B;  2F0L A;  1CA6 A;  4BA1 I;  3CHB D;  3KLR A;  4KY6 A;  2OEO A;  2PZW A;  3H09 A;  2ZXP A;  1E2Z A;  1Q1B A;  3QJY A;  2KQ3 A;  1JE4 A;  4WOR A;  1IYU A;  2XNA C;  4IUT A;  2L55 A;  4N9P A;  3MA2 B;  1E0B A;  1B9M A;  2J4X A;  1GUW A;  2XIW A;  3CKI B;  1PRT F;  2E74 C;  2EYJ A;  5E4W C;  3L3O C;  2PZU A;  3DXJ C;  3A8K E;  1CHP D;  5EBC A;  3PUV A;  2E2I B;  4RGT A;  4LK1 C;  1O80 A;  1PTO D;  1I4Q A;  1PZK D;  3T16 A;  3A56 A;  1DXM A;  1PZI D;  4DXG A;  1OXX K;  3NTI A;  5EGT A;  3HKZ B;  4KD3 A;  1PFM A;  4A3I B;  5IGF A;  2KEC A;  2EY6 A;  3TZU A;  5TSS A;  3J80 L;  2YU9 B;  1ESR A;  1AFP A;  4A3K B;  1EYA A;  4C56 C;  1EZ8 A;  3NBH A;  3DWQ A;  3PUW A;  1II3 A;  4U67 3;  3NXW A;  3S1Q B;  1Q12 A;  2BE5 D;  4KJO A;  4TQU S;  1G29 1;  3CRK C;  2EPB A;  3FVQ A;  1YNJ D;  3DEP A;  2A5H A;  4IN3 A;  4AYB B;  5G3L D;  4IFD H;  3PUZ A;  2BDN A;  5JEA G;  4XYO A;  4IUP A;  3G7L A;  3E0J A;  2D2C C;  1XX8 A;  2BCO A;  3Q6S A;  3K5M A;  2KCC A;  5CV5 A;  5M5X B;  1JQY D;  1DON A;  1GUT A;  5ELB A;  1ENA A;  3J7A V;  3KLS A;  3NSW A;  1S5E D;  2EYF A;  2CW0 C;  1VMC A;  3R93 A;  1HPC A;  4DK1 A;  4FF4 A;  3NP8 A;  3J7Y W;  5FLX E;  3TP6 A;  2PZT A;  3D4R A;  2FHT A;  1QB5 D;  3ERO A;  4RHS A;  5DAU A;  3OHX C;  1HUN A;  1MD2 D;  1D6E C;  4HMI A;  2EJG C;  1RF2 D;  5C4H A;  3NQI A;  1EEI D;  4EQN A;  4KV6 A;  3HEJ A;  3I4L A;  3D4W A;  4ZUJ A;  1SNP A;  1B3A A;  4IUN A;  2FJ2 A;  3H94 A;  1O78 A;  2M00 A;  4ZLT F;  4XXE A;  1PTO C;  2JP1 A;  1AEX A;  3EA6 A;  3N6R A;  3SXH A;  1I3Q B;  2E76 C;  1I6V C;  1GJX A;  4WFN 3;  5DNF A;  3K58 A;  2JXM B;  1BOS A;  3PUX A;  3D3R A;  2DN8 A;  3ND9 A;  3QG1 A;  4XQJ A;  3NE5 B;  2NB0 A;  1ROD A;  1ZEQ X;  4QF4 A;  1IW7 C;  4XYQ A;  5C5L A;  2K33 A;  2IL8 A;  1LAC A;  2BE5 C;  5FO9 B;  1EY4 A;  3K5N A;  3I4N B;  1XXG A;  4OGQ C;  1YNJ C;  2F3V A;  3OIP A;  4ZKB B;  2VB2 X;  2EJF C;  1A3T A;  2A6H D;  2BDO A;  3GTP B;  1ZXT A;  3Q0A A;  1IHZ A;  3TBI B;  1SYE A;  3HOY B;  3BVZ A;  2V4D A;  2E2H B;  3C46 A;  3VR2 A;  4C3I B;  3HOZ B;  2FIN B;  4DAY A;  4K5W A;  3S16 B;  3SHL A;  2F0V A;  3LWE A;  1EY8 A;  1C8C A;  3M85 A;  1OXS C;  1U4L A;  1LAB A;  3SK5 A;  3NK9 A;  3OPO A;  2KHS A;  1SYB A;  4IQZ A;  3TP7 A;  4HCS A;  4HN7 A;  3O13 A;  4QIW B;  5CMD A;  1LT3 D;  5LL6 X;  1TY0 A;  1WTO A;  1MGS A;  3FEW X;  4F87 A;  1SE2 A;  1MI2 A;  5A2Q L;  1I4X A;  3IKJ A;  5T1I A;  2ID0 A;  4S3S A;  2K1B A;  1D2B A;  1EIH A;  2NVX B;  1F77 A;  1F2L A;  3T4A C;  1TWC B;  1ILQ A;  3MAQ A;  2BOS A;  4C1N I;  1EQV A;  2QEJ C;  1STB A;  4K2K A;  3EFX D;  3MZ5 A;  4IFD J;  3MHB A;  5EKI A;  2F0U A;  4ZKC B;  2ENB A;  2O5I C;  1EWH A;  2OT2 A;  2DY7 A;  1OXU A;  2R93 B;  3TN2 A;  4QCL A;  4A3M B;  3QIA A;  2FMM A;  1G2S A;  1CZW A;  2WAC A;  4RCO A;  2LMC B;  4PMW A;  3OOC A;  1SBB B;  5C44 B;  4DU9 A;  3I3C A;  5C3W A;  2WV6 D;  1SNO A;  5D14 A;  5JOB A;  2ZXO A;  5J22 A;  2K7V A;  2IX3 A;  4KMU C;  4RKL A;  1EFI D;  5COR A;  2A73 B;  3H6M A;  1PRT D;  3KBG A;  3NWS A;  2RDG A;  5FK9 C;  3SDZ A;  5I9O A;  3P20 A;  2A6H C;  5CV8 A;  2CQA A;  3RLF A;  1J9O A;  2R3Z A;  4L6T B;  2AQ2 B;  3KBX A;  4K14 A;  2EY5 A;  2M2L A;  1TQO A;  4RCN A;  4C3J B;  5EQ0 A;  1SAP A;  4KN4 C;  2EYH A;  4KHV A;  4DAV A;  4OIK A;  1U4R A;  3BDL A;  3GV6 A;  2OF1 A;  3S2H B;  1KDB A;  1PZJ D;  2F0T A;  2XRS D;  5C4X B;  4EVO A;  2MUY A;  4C2M B;  4KK7 A;  5CR3 A;  5HUR A;  3SK8 A;  1FD7 D;  3VR6 A;  2IX1 A;  3QO2 A;  1OXT A;  3A54 A;  4FYD A;  4IUU A;  5KND A;  2B2V A;  3ERQ A;  1S4Z A;  1V8Q A;  4FP5 D;  1J8I A;  2FMC A;  1JOR A;  2B39 A;  3HOX B;  3K0Y A;  2KOL A;  1GUS A;  1HXY D;  1JCK B;  5E1F A;  2HCC A;  1KDC A;  1H9K A;  5C4Z A;  2I46 A;  4NKL A;  1PFB A;  3I72 A;  1BUV T;  1B50 A;  1S5D D;  1H9S A;  4PMB A;  4IUV A;  1OO9 B;  2J0T D;  3HS0 C;  4XTC S;  1KTK A;  1RJT A;  5LHY 1;  5IIF A;  1LTI D;  2PMZ B;  1HRJ A;  1PTO B;  1YNN D;  4BY7 B;  4HAE A;  3MTS A;  1TS5 A;  3NUC A;  1PRT C;  4M1U B;  1GHK A;  1BO0 A;  1STA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...