3MA2B

Complex membrane type-1 matrix metalloproteinase (mt1-mmp) with tissue inhibitor of metalloproteinase-1 (timp-1)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
124
structure length
117
Chain Sequence
b'CTCAPVHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFDIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITLCSFVAPWNSLSLAQRRGFTKTYTVGC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Matrix metalloproteinase-14
publication title The Intrinsic Protein Flexibility of Endogenous Protease Inhibitor TIMP-1 Controls Its Binding Interface and Affects Its Function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 26
structure length 117
sequence length 124
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3ma2B00
2QKIC 1GXDC 1OO9B 3MA2B 3HS0C 3T4AC 5FO8B 5FOBB 1BR9A 2XWBB 3V96A 1D2BA 3I70A 5JPNC 4ILWA 2WIIB 5FO9B 2A73B 4FXGC 3L3OC 2B39A 3KLSA 1UAPA 3CKIB 3FRPB 1XWEA 5JPMC 3HRZC 2J0TD 5FO7B 1PXUA 1BUVT 2E2DC 1BQQT 2I07B 3CU7A 3G6JB 2WINB 2XWJB 1UEAB 3OHXC 2ICEC 2TMPA 1JB3A 1JC7A 2A74C 4FXKC
chains in the Genus database with same CATH superfamily
1VS0A 3GTQH 2XVSA 4KD4A 1HR0Q 5HGQA 2Q8IB 3I56A 4RA8A 4RAUC 5C5MA 2N55A 2VQEQ 4GLXA 1PH1A 2ASBA 4QMGA 3X3NA 3RZDH 4JBWA 3H6MA 2B39A 4DV6L 1NR2A 1EU4A 4A93H 2G9HD 1AN8A 2F0KA 3HP3A 2GN5A 1J6QA 2LMCB 4A3MH 1IZ6A 1XX8A 1GOZA 2JA8G 1STAA 1LO5D 4DF7A 4OWXB 3CCVA 4JI0L 2FINB 3CCUA 3H3VH 2CVRA 5FLMH 4L5QA 5IGBA 1W6JA 1KLUD 1PFMA 3A56A 4DV1Q 2KEEA 2E5LL 1Q3LA 1OTCA 3PF4A 1CSPA 2JSOA 4R1JA 2N8NA 3NQTA 1ET9A 4DK6C 5C4XG 5M5YH 2PQAB 4DR1L 1D8LA 4B08A 2IWHA 4DU9A 2SNSA 1BBUA 4H7BA 1EY5A 4HSVA 3CQZB 4PV1C 3J7A5 4X66L 1QILA 4AYBG 1LTID 3KJOA 2WKDA 4ILWA 2Q2TA 4IURA 3K58A 1FJGL 5M3MH 1YIJA 1LTGD 4MNOA 2K5QA 2VL6A 3TDQA 1YVCA 3Q22A 2R7ZH 5IWAL 1XNQL 1S3OA 3M4YA 3CCQA 2UU9L 2ENBA 3OIPA 3TSSA 2WAQB 4YWLA 1LTAD 1CHQD 2I5HA 3D0FA 4CKBA 5IGFA 3G7LA 3UI2A 2VUMB 3L0OA 4OIKA 5A2QL 2NN6I 4JI8Q 4DUYL 4RGTA 3AU7A 4GKKL 4DUZQ 4YWMA 1D5MC 1TKWB 1HHVA 3M4QA 3UE1A 3E0JA 5IT9E 4CGYB 1ICWA 2OT2A 2JA6G 3GDEA 4XQNA 4YWKA 4TRDA 5AJ3L 1BUVT 1AW7A 2F4VQ 1IBLL 1SBBB 4ZKCB 1AZQA 2JYOA 1E0BA 1DOKA 1TR5A 1HFGA 3NTIA 5DM63 5JVG3 4FDBA 1JWUD 4UPAA 5E7NA 2G5DA 1Y69U 2K50A 3NELA 1I4PA 5C4JB 2RDFA 1WTWA 3ND8A 4KJOA 4JG2A 4JVZA 1JOKA 1KAAA 4A3BH 2GVAA 1A62A 5D3IB 3G6EA 4EVOA 1E1OA 2PQAA 5JVH3 2E2DC 3E5SA 4NXNL 3A7LA 3BDLA 1YEZA 1UWVA 2MUYA 2KHSA 1V43A 1SYFA 3CCMA 4LF6L 1S5CD 2OWOA 1SDFA 2F0JA 5C3EG 5EQ0A 1JWSD 1EIGA 1F9SA 3LNNA 4DV6Q 1B70B 4A3DH 4APVA 5FJ8H 4BBRH 1S5DD 1F9QA 4DV3L 2XRQD 2R93H 3C46A 2KJXA 2OQKA 4JBJA 2EYLA 5C4XH 4JI0Q 2NVTB 2E74C 4RWSC 1QWYA 3RR5A 3CMEA 1DXMA 2NTSA 1WCMG 5M9OA 1V1OA 3PQIA 1YJNA 4ZRZA 2BA1A 2WFWA 4BS9A 2E5LQ 1CT1D 4IFDI 2R7DA 2EXZA 1GUWA 1K0RA 3HOVB 2KEDA 2AHOB 3H0GB 3OTOL 4DR1Q 5CYUA 2R92B 5IIFA 4OWTB 5DLQE 1LT5D 1IBML 2NVYB 1M90C 2KA7A 3WWVA 3ULPA 3I7FA 1JMCA 1UNSA 2MNAA 4DV4L 4CBVA 5M3FB 3S2HH 4IUVA 2RKSA 4LFBL 1Q90A 1BVSA 1FJGQ 5IYCG 4BY1G 1SNCA 2BE5C 3U50C 3V2TA 1CHPD 4OO1I 3W3AA 5C0XI 5IWAQ 1ENAA 2UU9Q 4UDUC 4G7HC 2F0HA 1M4VA 1BF4A 1TWFH 1U4PA 2OQ0A 4DK3C 4EQOA 3HOYG 3AFPA 1TY2A 1PH9A 1I4RA 1DD2A 1L1OC 3PV0A 4QY7A 4UP9A 2Q8RE 4K6DA 4BA2I 3OWEB 2ZTDA 4UY8C 3NTKA 1SAPA 1IBKL 4DUYQ 4GKKQ 4YCUA 5EBCA 5JOBA 3S1QB 1QVFA 2A6HC 1AFPA 1NSNS 4GN3B 1PTOH 5JJIA 1EQQA 4L5SA 1QG7A 2HQEA 4GN4B 1LABA 3L2PA 1IBLQ 4N8X1 1BCPF 2A5HA 4QIWE 1G291 2A74C 2LKVA 4FYDA 2IHEA 3HKZE 1L0XB 4IQZA 1T5XD 1VQ8A 1KRSA 2B8GA 4EGVA 2N78A 4R4IA 5CV7A 4EQ5A 1KQSA 3K5OA 2ICIA 1WI5A 2ALYB 3DEOA 2PZWA 4X64L 2J4XA 4C3IB 3U58A 2PMZB 5IP7G 3GTGB 3HOXB 4DR4L 3FRPB 4LF5L 4A3EG 4WJWA 1YJWA 3UDXA 3D8GA 1EWHA 3BVGA 1LT4D 4NXNQ 2K5WA 1WTQA 1HNZL 1D1KA 4CDFC 3N6RA 3BVZA 4LF6Q 4X3UA 1IXRA 4K8IA 3U9SA 1E22A 1D5XC 5EJWA 4DV2Q 2HDMA 4R4OA 3FEWX 2C5CA 3WOFA 1GD7A 1EY8A 1WD1A 3GV6A 4LF7L 2WACA 4DV3Q 2NN6H 4A3IG 1KNEA 2NZHA 2DUDA 2K01A 2E2IB 2Z4IA 3FKIB 1IL2A 1KL9A 4DN4M 1GUGA 4NB3A 1MJEA 4FF1A 1VQDA 4XYOA 1II3A 2KCNA 1TWCH 3D31A 1LT6D 3PMFA 2JA7H 1TS5A 4FP5D 2EJGC 1L1OB 1WTOA 1XYIA 1NUCA 2BOSA 4IUNA 3HOUB 4X6AH 2NVQH 3OTOQ 3I55A 4DV5L 2MP1A 4JW0A 3T13A 1SR3A 1GO3E 1H95A 4CDDC 1Y8NB 4QIWB 1ASZA 2WV6D 1IBMQ 4GZYC 2PNRC 5BR8L 4IPCA 5K36G 3MA2B 3E9HA 4DV4Q 5GADC 1Y1WG 4QJFA 4LFBQ 2D0PA 3D4RA 3P7JA 1X65A 2OEOA 4FVMA 1CFMA 5D3DA 4KHZA 2A6HD 2B2YA 2ZJRA 1BXTA 4PZ7A 4DV7L 4IPDA 4LF4Q 4HJ7A 5IY0A 4B3ML 1C7YA 1H9JA 1QOHA 3STBC 1PH2A 3GD7A 1YNJC 5IGCA 3GV3A 4IALA 5IT9c 3NPPA 5CV6A 3J7AF 1CK1A 3DXJC 3OSOA 4LWCA 4G7ZC 3F2UA 2R6GA 3I2ZA 1CTMA 4PZ8A 2BH8A 5I2YA 3J7YW 4KKTA 1IBKQ 3S1MH 4AYBE 2MFIA 2JA5H 5C44G 2CW0D 1H9KA 1X55A 2AQ1B 2EYMA 1YBYA 1STNA 1YNXA 2J0TD 4H02A 3I4LA 2P5ZX 3T53B 4LUOA 3I91A 3L7ZC 3GTJB 4V190 5IT9L 1XJVA 3VR5A 1K8OA 4A3EH 4ZUJA 1H9MA 1XTCD 2DN8A 3TMEA 4BBSG 5EPKA 1P16A 3IRBA 1FYCA 2BDOA 5E1FA 3MC0B 3M4OB 1L1OA 4X64Q 1SMYD 1PV4A 1JJ2A 4YCWA 2MGSA 1BCPD 3TREA 1EZ8A 4DR4Q 1N32L 2F0WA 3VYUA 1B1ZA 1D5ZC 3UDIA 3MFYA 3RLOA 2DY8A 5I9OA 4YY3L 3SHLA 1JCKB 1YHQA 2K33A 3IL8A 1O7ZA 1V8QA 5CMDA 2F0OA 1X3EA 1KIXA 1HNZQ 2VW9A 4OX9L 2JA8B 3K0YA 2F0EA 1C4QA 4B3RL 2L4NA 1E3PA 2PYKA 1Q8KA 1SFOH 1G2TA 2Y0SG 4KV6A 5CV5A 3A8IE 5EKLA 2HQLA 3D6WA 1K3BC 2F3WA 4IN3A 4XQQA 4EQNA 3HRZC 4LF7Q 3CW2C 4JPBW 3K81C 1HJPA 1K8AC 2IT1A 1S5FD 1F77A 4YCVA 4LF8L 1SMXA 4RG1A 1X56A 1Q81C 2XWBB 3EBEA 1NJIC 1I4XA 4AYBB 2ZJQA 3GO5A 1TWAH 1F9PA 5K36H 1SXTA 1G91A 2KVMA 2KCMA 1TS4A 4DAVA 1SROA 4K2KA 2CHBD 4DV5Q 3VDYA 3GTOB 1X54A 3HOZG 4DXGA 4RKBA 4C2MB 5JPNC 5BR8Q 1X3GA 2F0GA 5AFWA 3FP9A 1NTGA 3P20A 1BBWA 5E4WC 1PRTF 3V05A 5I6WA 2EQSA 1VQPA 4A93G 3BDOA 1FNWA 1K83H 3DWQA 5H1SE 2RVLA 2B2WC 4AQYQ 3MFGA 1ET6A 2JQOA 3CKIB 4DV7Q 2BDNA 2JA6B 4RKLA 4HR7B 1TY0A 1TQOA 2K6AA 1GUSA 3PIPA 3CC4A 5FLMG 2AMCB 3VR2A 4AIMA 4WFN3 3CCEA 2VQFL 5JJKA 3J7AV 1E24A 1A6XA 3J80c 3MXPA 1CZGA 1KDBA 4ZAIA 3PUYA 1KD1C 4K2LA 1TIID 1SJED 3GTLH 1N34Q 5J3BA 4P71A 1ESFA 1KRTA 3TQYA 3X3MA 3S17B 4GN5A 1EZ6A 3GP7A 3M85A 3T1YL 4V0BA 2XWJB 1FVIA 3S1NH 3S16H 1QVGA 1PRTC 2H4OA 1U4LA 2I46A 3HGBA 2AWNA 2KECA 2Z6BA 3J80L 2Q2UA 4JI2L 1KAWA 1K73C 2B63H 2R7ZG 2EYFA 3M3YB 1M1KC 5C3EB 1VQEA 4IUQA 1X3PA 3VR6A 1EEFD 1CUKA 4KK7A 1Y1VG 1R9TH 3J81j 5FO7B 1A0IA 1B9NA 3HG9A 4KY6A 4YY3Q 4JOIA 4DAMA 4HIKA 2CQAA 2OTLA 1MI2A 2YV5A 4OX9Q 4B3RQ 1X9NA 2O5IC 3HS0C 2E2HH 3CPWA 4RCNA 2F0IA 1Z6HA 3OMGA 2RSNA 1CSQA 1WCMB 3EQLC 1N33L 2CFMA 4DK1A 1VQCA 1EY9A 4R9WA 3PGZA 4X3SA 4A3GH 2AQ2B 3ZYYX 4H13C 4NKLA 2K4KA 3A74A 3K7UC 1I3QH 1RTOA 2A8VA 3NE5B 1RODA 1IW7D 5COYA 3R2TA 2Z9HA 2HDLA 1G6ZA 3HOZH 4LUZA 3TBIB 2Z4HA 4A3KH 4A3BG 1MSGA 4GKJQ 3TP6A 4MHEA 2O2LD 5IYDH 4BY1B 2KENA 3DWPA 1STHA 3WOEA 1HPCA 2RSOA 1VQ6A 4BXXG 1B9MA 3BZKA 4FO2A 1LTRD 4PMCA 4X3KA 4PMBA 2Z1CA 3HOYB 3KLRA 1ZXTA 1YJ9A 3VYTA 1F2LA 5EKKA 4A3DG 3S14B 2HHHL 2YTYA 4LW1A 2UUCL 1HTPA 1PRTB 2RF4A 5FJ8G 4BBRG 4DR5Q 3GTPB 1YITA 4K0KL 2R93G 1IYUA 3SK4A 3M9BA 2KQ3A 1U5KA 1C8CA 4U673 3SDZA 2IHFA 1AP0A 4ZCKA 2V4DA 3SK6A 5CBEE 3K5LA 4LK1C 3KBXA 1GM5A 1SE4A 1SN8A 4GNXC 1RIPA 4A3CH 2B2TA 3VYSA 3K5NA 4LJZC 4QQBX 4IUTA 2SNMA 3J7ZC 2F0QA 3W2DA 1PMRA 1F9RA 4HTHA 3TS0A 3GTKH 1EQRA 3R3OA 1HZCA 4J8QA 3VR4A 4KKUA 3TS2A 4UP7A 3TRZA 4K6LA 1SNPA 4LFCL 3GTMH 1V1PB 3T1YQ 4HAEA 3R93A 1ASYA 2B2WA 5GAEC 1HZ9A 1AE2A 1PYSB 4P73A 2VB2X 3MXNB 1Y1VH 4Y7NB 1B8AA 3ULLA 2EY5A 5HGTA 1SE8A 2F1MA 2K1BA 5CGKA 3S9WA 3RZOH 4JI2Q 3RUZA 1SNDA 1B44D 3M7GA 3M4PA 3P75A 3KLSA 4B9XA 2C9OA 4C3JB 1XNRL 3FMCA 4R4TA 3DWAA 3QB3A 4RFBA 4A3JB 2RQXA 3A5UA 1I6HB 5IP9G 1BBXC 4XQJA 2UXBL 4QGUA 1HFNA 3JAME 4XT1B 1YNNC 4A3IB 3CCJA 1DGSA 3P1HA 1PDQA 1QVCA 3K57A 1GXDC 3KF6B 3T4AC 3S2DH 1DOMA 5M5WH 4GLAC 1NNXA 2E8GA 1Q46A 2LXKA 5JEAH 4DA2A 1N33Q 4OEMB 1HNXL 1I6VC 1V1QA 1N9WA 3NENA 5HURA 2OTJA 1QUQB 5IGEA 4A3FB 2BA0A 5A35A 4A75A 1FNUA 4QUFA 4JI7L 1HTLD 2D9UA 4RGMA 4TSSA 5D14A 4I7ZC 1JE5A 1SE2A 2FFKB 4C3HG 4O42A 2BCOA 3SR1A 1EWCA 3NWSA 1RJTA 4BXXH 1HUNA 2PZUA 5M5XH 5CORA 2B2UC 4NP5A 4GNXB 1Y1WB 4P74A 2NTTA 2Y0SE 1G2SA 4FF4A 4XXEA 2G9DA 2K05A 4HCEA 4ZK9B 1LTTD 3PO3G 1MGSA 3HOWG 1V1PA 3JAMi 4M8AA 3MXNA 3KBGA 3R8BA 2RHQB 1JR0D 2LSSA 1H9RA 4KD3A 2NYZD 3E6ZX 1G8ZD 1NR4A 4TQUS 2NBFA 2HHHQ 2B2YC 1PLFA 3ONAB 2KUMA 2XGTA 1EIHA 3K0XA 1VQ9A 2Q2IA 2NN6G 4K0KQ 4CKEA 5C44B 2A6EC 1PH5A 2PMZE 1Q86C 2L11A 2RA4A 1ICFB 2IW3A 3S15B 2Z6KA 2JA7G 1LLRD 4L5RC 3ERQA 5IYBH 1WOCA 3KF6A 4ODGA 4OXPA 4BBSB 3F2CA 3AQQA 3W1BA 4X66Q 2EY2A 2R3ZA 1Q7YC 4Z9CB 4FF3A 2GVBA 5CC4A 2VNUD 1VQHA 1SYBA 1JE4A 3B6YA 3K7AB 3URYA 2YU9H 1QUQA 2A68C 3MEFA 1JJCB 2PPBC 2F3IA 4M1UB 1XNQQ 2EYOA 1MBYA 3LGJA 3OHXC 2NVXH 1WD0A 5C4HA 3CRKC 3E9IA 5IP9H 1U9RA 4RH6A 1SYCA 1S5ED 5C6AA 1SEBD 5BN4A 4GNXA 3J81E 1TVXA 2Y0SB 3TZDA 4G7OC 2ID0A 3TP7A 1B4OA 1U0LA 1S40A 4HIMA 1LUZA 1I50B 2EOTA 1XNRQ 1D7QA 1PH6A 1HQMC 4DV0L 3QWNA 5AJ3Q 4NPSA 3QOLA 3U9OA 1FGBD 3MXUA 1EY0A 2EPBA 2JA5G 3NXWA 4C3HH 4IPHA 3EA6A 4HJ5A 2QF7A 3QG1A 4HIOA 1HNXQ 1IL8A 2EIFA 1O78A 1K3RA 2DY7A 1QNKA 1EL0A 2PNHA 4IFDG 4QF4A 3GTQB 2UUBL 3S1RH 5ELFA 2K32A 5D65A 1HA6A 3U4VA 4K5WA 1PH4A 1NMGA 3CCSA 2RDHA 1HH2P 3N52A 3PO3H 3HOWH 3RZDB 2WB1G 4S3SA 4DKAC 3DEPA 5LMUL 3HKSA 1WTVA 4A93B 3KYHC 1J8IA 2MO0A 1KC8C 4A3MB 2L0CA 4K5VA 3CHBD 4R4QA 1OXUA 4OO1G 2F0TA 5BN5A 2MHVA 3PO2H 5FLXE 4B3SL 1O80A 3EVQA 3PSIA 1AE3A 3K5MA 2B3GA 1SJHD 2F0FA 2AKWB 4X65L 1X6OA 1KNAA 1XMQL 3NEMA 4C1NI 1A2UA 1RKNA 3CP0A 1TWHH 1GUNA 1RCVD 2XSCA 2E2JH 2F0VA 3I4NH 3G4SA 5M5YB 2YTVA 1STGA 2BE5D 4XDXA 1VQ5A 2B2UA 4QL5A 5KGUA 3I4MH 4RHSA 4IFDJ 1AZPA 1NAPA 1QCBD 1N8RC 1TWGH 1VQFA 1Y8OB 4BY7H 2ICEC 2PI2E 3SVMA 3T1HL 5L37A 5LMNW 3PIO3 5KRUA 5EBDA 2IY5B 4NMZA 5M3MB 1FR3A 4F88A 5TSSA 3CXCA 2R7ZB 5C3XA 2QDLA 2I5MX 2Q2HA 1Q1BA 4CDCC 1MJCA 2QGQA 4JC0A 3H15A 2QDBA 3K80C 5IE8A 4I65A 3KFUA 4RGOS 2LXJA 5ELCA 1X3QA 4WJ3M 2HIXA 5ISRA 5C0XJ 3CCLA 2IJ0A 4WJ4A 3JAMc 1EFWA 3C1EA 1L0YB 4ZQ3A 5J22A 2A69C 4HSPA 1SNOA 5IOCA 4ZUIA 3F1ZA 5I6YA 4JOIC 4KY5A 3SK5A 4JI6L 1O7YA 2DJFC 3BZDB 1CQFA 2ATWA 1S4ZA 2Q8TA 4DR7L 1VQBA 1TU2B 4IFDH 2F0NA 2WKCA 3JAML 3E3XA 4KKSA 4ZYSA 2ZM6L 3CQZH 2F03A 4A3BB 2YTXA 4FXDA 4HJAA 3L3OC 1P8LA 2ZTCA 1XPUA 4ABNA 1JB7A 4DFAA 2J7ZA 3PCOB 1BKBA 4KTAA 2EDGA 2CCZA 3JC66 3RLFA 1UE5A 4LF5Q 1HA5A 3C2PA 2UUBQ 3OPOA 2WINB 5A2QE 3LX0A 1LM0A 2B63G 1PTOC 3EIVA 3UDGA 1EFID 4ZLTF 1SYDA 2K5HA 4OO1H 1I5FA 5C0XH 5LMUQ 1NCVA 4A3DB 2KBNA 1FD7D 2A1AA 4KN4C 4N9PA 1Z7TA 3HEJA 4BBRB 1ZYRC 4IUPA 5FO9B 1VQGA 3NBHB 2VUMH 2K04A 2EY1A 4HCSA 1VDZA 3I8ZA 2R93B 2R7FA 5E4XA 2CKZB 1NE3A 1OXSC 3PUVA 3H94A 5C4XB 4B3SQ 1RTNA 1UEBA 1PZKD 3NTHA 1SE3A 3LWEA 2CWAA 2WP8J 1EYGA 4N9TA 4IOCA 4X65Q 2A19A 1HZBA 4R8IA 3ZJYC 1XMQQ 1UE7A 4A3GG 2WIIB 4XIGS 2KHIA 3PUWA 1I94L 1EQTA 3ER0A 4L5TA 3TN2A 4CJ1B 2B2TC 3T56B 3D3RA 5C4JH 2OF1A 1O7IA 3STBD 4O1NA 1YNJD 1RDPD 3SK8A 1KHIA 4QCLA 3A55A 1A3UA 3S2HB 1B2TA 1CZWA 4A3KG 1PYWD 2F0UA 3PUZA 1SSOA 4DR3L 3MWYW 5FK9C 2ZJPA 4JI4L 3EN2A 5IYDG 2VQEL 4F87A 1AEXA 2IL8A 3RMHA 1TXYA 2A69D 2LS01 1A15A 5LL6X 2RDGA 3A0JA 2R61A 2BH2A 1WTRA 2UUAL 1ILQA 4JYAL 1TWFB 2LFNA 4FF2A 4OIJA 4B3MQ 2F4IA 2MO1A 4FNFA 2EYJA 2PI2A 3H09A 4KJNA 1E2ZA 1LTBD 3BU2A 1GUOA 2PO4A 1PH7A 2NUCA 1QZHA 5FOBB 3HFZB 1H9SB 2N49A 4ZKBB 1OXXK 1PTOB 1DOLA 2RCNA 3DM3A 2NVTH 1GVPA 4JI5L 3NBHA 3IAYA 1E1TA 1KDCA 3MXGA 4JI6Q 4KI0A 4A3CG 1KABA 3OYYA 3PUXA 4PQXA 3OW7A 3PF5A 1W2BA 4G4KA 4DGZA 4DR7Q 3HOVH 3H0GH 4I7AA 4PNYA 2R92H 2O4XA 3Q23A 1RD9D 3CC7A 1LTSD 2NVYH 4LUVA 1CQVA 1B50A 2OXPA 2ZM6Q 3TP5A 1SYEA 4Y52H 3MZ5A 1RF2D 2ES2A 2A73B 3A54A 3R2IA 5CV9A 2I5LX 1C0AA 2PW5A 1N32Q 5E3FA 1QZGA 2XIWA 2E76C 2ZXPA 3IKJA 4L63B 2RHSB 2F0DA 4ME5A 1HNWL 3HKZG 5DEHA 1XTDA 4LF9L 3CCRA 4DAYB 1DYQA 2DJGC 1STBA 4LMQD 4JBMA 3H91A 1DCZA 3IFTA 3EJIA 4DUZL 4ME3A 1F2YA 4MN3A 1QB5D 5FKAC 5KIXA 5JJLA 1WTXA 3S1QH 1K8MA 1J5EL 1TWCB 2JN4A 3OIQA 2JA7B 5JEAG 5FO8B 4LF8Q 1H9SA 1B53A 2WB1E 2JK8A 3G48A 3TP8A 4EX5A 1C48A 2X6LA 4LFAL 1JICA 2NVQB 2DNEA 3LWUA 2M9VA 2Z6KC 2MQHA 3F8TA 4C3IH 3KLWA 1Y14B 1YZ6A 3GTGH 4UP8A 3HOXH 2H1EA 1T9HA 3MVVA 2YYZA 4HIDA 1MIUA 4JI4Q 2FHTA 4DR3Q 1CI3M 4DXFA 3ULJA 1EWIA 3A8KE 5CR3A 3C1FA 1WVLA 3BS1A 3BYYB 3M7NA 1FGUA 2UUAQ 1U4MA 4JYAQ 1GHJA 5EPJA 4POFA 3QO2A 3T16A 1RHPA 3F2DA 3Q6SA 2EJMA 4YHHL 1QNUA 4F7XA 5LHY1 1E2WA 2PQEA 1EYAA 1PRTD 5G3LF 4CJ0B 4R8NA 2I0QA 4EQPA 2VQFQ 3SGIA 3S1MB 5JEAJ 4DAYA 1F2ZA 4IPGA 1T5EA 1WYDA 2L15A 2EXDA 2JA5B 2XTIA 4N8FA 2E2IH 3FKIH 4A3LH 2X6GA 4JI5Q 2AQ3B 4UAIA 3AEVA 1SYGA 2IX1A 4JI1L 1FL0A 2L9HA 4JV5L 2Z0SA 4OGQC 5IYBG 4X62L 1I4QA 1ML0D 4A3EB 1PA6A 2EE1A 1B3AA 2EYPA 2I07B 4K8JA 3MTSA 1CKOA 3HOUH 5T1IA 2VB3X 4DR6L 2QW7A 2D0OA 1XPRA 2WB1B 2DGYA 1U4RA 4CDEC 2DNCA 1SLJA 4TVAB 4IUUA 2EZVA 1HR0W 3W1GA 1ZKOA 3EFXD 1K0SA 4LNQA 2V1CC 2NB0A 2O5JC 1VMCA 5KEEA 4G57A 2AUKA 3C3LA 1D6EC 3HZXA 2VY3A 2MJ8A 1SFOB 1HNWQ 2FXQA 4HJ9A 4LF9Q 1R4QB 2QKIC 1XMOL 1TS2A 2D2CC 2MPMA 3AMUA 1J9OA 4O2DA 3NQIA 4HN7A 2HIVA 1EOVA 4IJHA 2K75A 3OWFA 1JQYD 1E2VA 5LMNL 1R4PB 1JORA 1J5EQ 4WRDA 1OXTA 1V9PA 1LTLA 1HXYD 4P2CB 2QEXA 1BNZA 1TWAB 1GJXA 3GTJH 4JI3L 3QIAA 4OHJA 3K59A 3ND9A 1Q12A 4MIUA 1VF5C 4C1NK 4LFAQ 3I73A 4PG3A 3BZCA 1VF7A 3SXHA 1EEID 3M4OH 1VQOA 3KOJA 5T1GA 3G6JB 5EKIA 1PH3A 1VMPA 5IGGA 3K8AA 4JK1C 5I4DA 4OELB 1JB3A 5EGTA 1Y8PB 1EY7A 1K83B 4ALPA 1AH9A 2JA8H 2KCTA 4YIJA 2UUCQ 4DV2L 4PMWA 1LYLA 5J1ZA 3PO2G 1O7LA 3EROA 3NHHA 1KTKA 4YHHQ 2UXDL 2RBMA 3OW2A 4DR2L 4UHVA 1KXLA 5JJZA 3E0EA 5C4ZA 3ICEA 1BDOA 3DUZA 3TEHB 3A8JE 3I4NG 2B2VC 5I9PA 1VQNA 2Z8LA 5GAHC 3I4MG 1EIYB 3GTLB 5EPLA 1YHBA 1SRUA 3W5OA 2HT1A 3RD4A 4HMJA 3BJUA 4JI1Q 4JV5Q 1GKHA 4BY7G 5G3LD 3H3VC 4P75A 3S1NB 3S16B 4X62Q 4LFCQ 5KYLA 1PFSA 5DAUA 1YNND 2K03A 1L0WA 5KYIA 3CD6A 3OOCA 4DR6Q 2B63B 3GTOH 1ILPA 2ZT9C 2HUGA 2L12A 5CV4A 4XT3B 4C2MH 1D2BA 1SNMA 3FPUB 1X3FA 1R9TB 3I4OA 1JT8A 2K52A 1N36L 1CM9A 2HD3A 2TSSA 4LF4L 2CH4A 4NW2A 4KHPL 2F52A 4Q0FA 4NDXA 3UE0A 4POGA 2XN9C 3I90A 1BQQT 1VQAA 4B3TL 2UXBQ 2E2HB 1HZAA 1W3SA 2JA6H 1TT2A 2IX0A 2JXMB 1XMOQ 2KCCA 1S5BD 3NK9A 3K6OA 1EUJA 2EJFC 3CMAA 4XYQA 1L2FA 4A3GB 3QJYA 3KF8B 2JE6I 1XXGA 3NP8A 5KNBA 2F0MA 1I3QB 3CRLC 3J80E 5LMNQ 5F2DA 4JI7Q 5HY6A 3U4ZA 1NMFA 3HOZB 2K5DA 3S17H 4A3KB 2XRSD 3AB9A 3MHBA 1UE1A 4JI3Q 2M00A 3WDNA 1EYCA 3V96A 4AH6A 3J81i 3D6CA 3KDFB 1PH8A 4DNRB 2PCFB 2N3SA 1YI2A 2CW0C 4L6TB 4CHTB 3UDFA 2A6ED 4QB4A 1IHZA 5JPMC 4WORA 3M3YH 5C3EH 1PZJD 4OONA 2WAQG 5C0XG 5GQOA 3AYHB 2VUMG 5CV8A 3I72A 3KJPA 2IPKD 1OXVA 1QJOA 1SMYC 3AFQA 4C3JG 3QOJA 1BCPC 2XNAC 1VQIA 3KLSX 4A4IA 4A3JG 2A68D 2KOLA 1WCMH 4GLVB 3J80i 2K28A 1FNVA 2UXDQ 5CBAE 1W6KA 4GS3A 1D1IA 4DR2Q 3CPFA 4BA1I 1I4GA 2N88A 1RL2A 3SEBA 4B9WA 4A76A 3GTKB 1EOTA 2C35B 1ENFA 1IYJB 3GQBA 5DM73 1A63A 1ESRA 4H0LC 3GTMB 3KF8A 4RGNA 2GA4B 2JP1A 4U68A 4A3FG 2AWOA 2SEBD 2NZOA 4DNTB 1GUTA 2NZ1D 5IYCH 4BY1H 1Y1VB 3O13A 3QR8A 3CC2A 4ID6A 3BYTB 4JCVE 3RZOB 1GHKA 3HKZB 1Z9FA 1Q8IA 3I3CA 2QEJC 3Q24A 1WFQA 4HJ8A 3HOYH 4R4CA 5LL6S 3VR3A 2JA9A 4RCOA 1K28A 3KDFA 5JAVA 1PTOF 1JWMD 4C56C 3G71A 4AQYL 1N36Q 2B2VA 3S14H 3MEHA 1NBWA 2JEAI 3T51B 1K9MC 1HCZA 4RMFA 3GTPH 4KHPQ 2VS1A 1WTHA 1PXUA 3BG3A 4DV0Q 1DONA 4IO9A 4B3TQ 2L5TA 4F8MA 1B3QA 5KNDA 3S2DB 1Q82C 5M5WB 4CJ2C 4JBKA 1MKHA 5GROA 3RN2A 3OMCA 3RNUA 5DNFA 1EIFA 4K5XA 2ZXOA 1CKNB 4O0AA 5GAGC 3RN5A 2F3VA 5ELOA 1N34L 1UE6A 1VQ7A 3F2BA 1VQMA 2VXWA 5J39A 1PYBA 3HOVG 1IYVA 4KY7A 1F2MA 3H0GG 5EAYA 2R92G 1EQVA 3PIOA 1STYA 1BCPB 2EYHA 5IP7H 2FJ2A 1PZID 1UEAB 4X3TA 5M5XB 1A3TA 3FPPA 2EVBA 1PFNA 5C5LA 4GOPC 2QILA 1LV9A 1DM0B 3S24A 1WJJA 5M3FG 3BVMA 3Q0AA 1I4HA 4Y7NH 1HRJA 4CKCA 2PW7A 3KUPA 2SDFA 4KN7C 1HQRD 3Q8DA 5ELNA 4HMIA 2UXCL 3NWTA 4P72A 4TKOB 3KK7A 3H3VI 3DM1A 1ZEQX 4QUCA 2F0LA 3DHQA 5IODA 2JEBI 4C3JH 1VQJA 1SNQA 4A3JH 1Q1EA 1VQLA 2RCFA 1I6HH 3PIP3 1EY6A 2M2LA 1Z47A 4A3IH 3D4WA 1CKMA 2NWGA 4J1MA 4KLKA 3VYRA 4ULLA 4KMUC 1XWEA 2KHJA 2PZTA 4DPGA 4NXML 5K5PA 2FMCA 2X69A 4A3FH 4IJLA 3CF5A 1X32A 3T1HQ 2SOBA 4E6IA 1HR0L 1KDAA 1PVOA 2CQOA 4OL7A 2YU9B 4GKJL 1CKNA 2B29A 4C3IG 1PFBA 4MZ9A 4FXGC 5ELDA 1MD2D 5NUCA 4BWGB 4LAAA 3HOXG 1JOOA 2NVXB 1Y1WH 3IFDA 3DLLA 3J81c 2D5DA 1K8GA 1PHJA 5ELEA 1DJRD 3BDCA 1XPOA 3VA5A 1M8AA 1A8VA 2H5XA 1IW7C 3CAMA 3A5ZB 3NUCA 2K7VA 2OCEA 3FVQA 1A2TA 1ENCA 1E7ZA 4DR5L 1CA6A 1ONLA 4GOPB 4OWWB 4IOAA 4DV1L 2EY6A 4A3MG 1A3VA 1BOSA 3J81L 1CA5A 3CU7A 5C44H 4RHRA 1G51A 4HEDA 3FKIG 4C3HB 1PTOD 4A3LG 1EYDA 3S15H 1IKLA 1S72A 1BR9A 2LY7A 1MSHA 2IX3A 1ZYRD 1VQKA 4BBSH 1MHWC 3NSWA 4XTCS 3S1RB 4K14A 5M3FH 2AUJD 4MTNA 3HOUG 1NY4A 2K14A 1G6PA 1WTPA 3DMUA 1BO0A 1VCIA 2K5VA 2ZXRA 4Q5VA 1KLGD 5I2XA 3K7AH 3PO3B 3HOWB 1HUMA 2JJQA 1LT3D 2K5NA 3ITPA 2TMPA 2HCIA 1JJGA 4KHVA 3A7AB 2E75C 5IGDA 1OO9B 5M3MG 1LACA 3NBIA 5C3WA 2VZAA 1EU3A 5FLXc 2F0SA 2CH4W 3SE0A 4JI8L 5KNCA 2CWPA 1UUPA 4IZ8A 3D4DA 1C9OA 2D62A 2UXCQ 2FMMA 3PO2B 4J6HA 4MTKA 1DZ1A 3FDTA 2B8FA 1I50H 2F4VL 3RLNA 2ZTEA 2QCPX 1YHAA 4FXKC 1TWHB 1STEA 2L55A 1JOQA 4J15A 2E2JB 4DK0A 3I4NB 3VA7A 5BN3A 5FLXL 2L1BA 3I70A 3I4MB 4GOPA 2QA4A 1TS3A 3TZUA 1EY4A 3L9AX 1VQ4A 1TWGB 3MAQA 1UAPA 4L8JA 3ERSX 1I94Q 4BY7B 1QE6A 4DNIA 4H44C 2HCCA 4NXMQ 5ELBA 4PZ6A 2F0PA 3FHWA 2WAQE 4DAPA 1B7YB 1IKMA 1JC7A
chains in the Genus database with same CATH topology
2XVSA 4KD4A 2Q8IB 4RA8A 4RAUC 5C5MA 2N55A 4QMGA 3X3NA 4JBWA 3H6MA 2B39A 1NR2A 1EU4A 2G9HD 1AN8A 2F0KA 3HP3A 2LMCB 1XX8A 1GOZA 1STAA 1LO5D 4DF7A 2FINB 2CVRA 5IGBA 1W6JA 1KLUD 1PFMA 3A56A 2KEEA 1Q3LA 2JSOA 3NQTA 1ET9A 4B08A 2IWHA 4DU9A 2SNSA 4H7BA 1EY5A 4HSVA 3CQZB 4PV1C 1QILA 1LTID 2WKDA 4ILWA 4IURA 3K58A 1LTGD 2K5QA 3TDQA 3Q22A 3M4YA 2ENBA 3OIPA 3TSSA 2WAQB 1LTAD 1CHQD 4CKBA 5IGFA 3G7LA 3UI2A 2VUMB 4OIKA 5A2QL 2NN6I 4RGTA 3AU7A 1D5MC 1TKWB 1HHVA 3E0JA 5IT9E 4CGYB 1ICWA 2OT2A 4XQNA 4TRDA 1BUVT 1AW7A 1SBBB 4ZKCB 1AZQA 2JYOA 1E0BA 1DOKA 1TR5A 1HFGA 3NTIA 5DM63 5JVG3 1JWUD 1Y69U 1I4PA 5C4JB 2RDFA 1WTWA 3ND8A 4KJOA 1JOKA 1KAAA 5D3IB 4EVOA 5JVH3 2E2DC 3E5SA 3A7LA 3BDLA 2MUYA 2KHSA 1V43A 1SYFA 1S5CD 1SDFA 2F0JA 5EQ0A 1JWSD 1EIGA 1F9SA 3LNNA 1S5DD 1F9QA 2XRQD 3C46A 2KJXA 2EYLA 2NVTB 2E74C 4RWSC 1QWYA 1DXMA 2NTSA 5M9OA 1V1OA 4ZRZA 2BA1A 4BS9A 1CT1D 4IFDI 2EXZA 1GUWA 3HOVB 2KEDA 3H0GB 5CYUA 2R92B 5IIFA 1LT5D 2NVYB 2KA7A 1UNSA 4CBVA 5M3FB 4IUVA 2RKSA 1Q90A 1SNCA 2BE5C 3V2TA 1CHPD 4OO1I 3W3AA 5C0XI 1ENAA 4UDUC 4G7HC 2F0HA 1M4VA 1BF4A 4EQOA 1U4PA 1TY2A 1I4RA 1DD2A 3PV0A 2Q8RE 4K6DA 4BA2I 3OWEB 3NTKA 1SAPA 5EBCA 5JOBA 3S1QB 2A6HC 1AFPA 1NSNS 1PTOH 1QG7A 2HQEA 1LABA 1BCPF 2A5HA 1G291 2A74C 2LKVA 4FYDA 1L0XB 4IQZA 1T5XD 2B8GA 4EGVA 5CV7A 3K5OA 2ICIA 3DEOA 2PZWA 2J4XA 4C3IB 2PMZB 3GTGB 3HOXB 3FRPB 4WJWA 3D8GA 1EWHA 3BVGA 1LT4D 2K5WA 1WTQA 1D1KA 3N6RA 3BVZA 4X3UA 4K8IA 3U9SA 1D5XC 5EJWA 2HDMA 3FEWX 2C5CA 3WOFA 1EY8A 1WD1A 3GV6A 2WACA 2NN6H 1KNEA 2K01A 2E2IB 2Z4IA 3FKIB 4DN4M 1GUGA 4FF1A 4XYOA 1II3A 2KCNA 3D31A 1LT6D 3PMFA 1TS5A 4FP5D 2EJGC 1WTOA 1XYIA 1NUCA 2BOSA 4IUNA 3HOUB 2MP1A 3T13A 1Y8NB 4QIWB 2WV6D 4GZYC 2PNRC 5K36G 3MA2B 3D4RA 3P7JA 4FVMA 2OEOA 1CFMA 5D3DA 4KHZA 2A6HD 2B2YA 1BXTA 1H9JA 1QOHA 3GD7A 1YNJC 5IGCA 3GV3A 4IALA 3NPPA 5CV6A 3J7AF 1CK1A 3DXJC 3OSOA 4G7ZC 3F2UA 2R6GA 1CTMA 5I2YA 3J7YW 4KKTA 2CW0D 1H9KA 2AQ1B 2EYMA 1STNA 2J0TD 3I4LA 3T53B 3I91A 3L7ZC 3GTJB 4V190 5IT9L 3VR5A 1K8OA 4ZUJA 1H9MA 1XTCD 2DN8A 3TMEA 5EPKA 1FYCA 2BDOA 5E1FA 3MC0B 3M4OB 1SMYD 2MGSA 1BCPD 1EZ8A 2F0WA 3VYUA 1B1ZA 1D5ZC 3MFYA 2DY8A 5I9OA 3SHLA 1JCKB 2K33A 3IL8A 1O7ZA 1V8QA 5CMDA 2F0OA 2JA8B 3K0YA 2F0EA 1C4QA 2L4NA 2PYKA 1G2TA 4KV6A 5CV5A 3A8IE 5EKLA 3D6WA 2F3WA 4IN3A 4XQQA 4EQNA 3HRZC 2IT1A 1S5FD 1F77A 2XWBB 1I4XA 4AYBB 3GO5A 1F9PA 5K36H 1SXTA 1G91A 2KVMA 1TS4A 4DAVA 4K2KA 2CHBD 3GTOB 4DXGA 4RKBA 4C2MB 5JPNC 2F0GA 5AFWA 3P20A 5E4WC 1PRTF 3V05A 5I6WA 3BDOA 1FNWA 3DWQA 2RVLA 2B2WC 3MFGA 1ET6A 3CKIB 2BDNA 2JA6B 4RKLA 4HR7B 1TY0A 1TQOA 2K6AA 1GUSA 3VR2A 4WFN3 3J7AV 1A6XA 3MXPA 1CZGA 1KDBA 4ZAIA 3PUYA 4K2LA 1TIID 1SJED 1ESFA 3X3MA 3S17B 1EZ6A 3GP7A 3M85A 4V0BA 2XWJB 1PRTC 2H4OA 1U4LA 2I46A 3HGBA 2AWNA 2KECA 3J80L 2EYFA 3M3YB 5C3EB 4IUQA 1X3PA 3VR6A 1EEFD 4KK7A 5FO7B 1B9NA 3HG9A 4KY6A 2CQAA 1MI2A 2O5IC 3HS0C 4RCNA 2F0IA 1Z6HA 3OMGA 2RSNA 1WCMB 3EQLC 4DK1A 1EY9A 4R9WA 4X3SA 2AQ2B 3ZYYX 4H13C 4NKLA 1RTOA 3NE5B 1RODA 1IW7D 5COYA 3R2TA 2HDLA 1G6ZA 3TBIB 2Z4HA 1MSGA 3TP6A 4MHEA 2O2LD 4BY1B 3DWPA 1STHA 3WOEA 1HPCA 2RSOA 1B9MA 4FO2A 1LTRD 4PMCA 4X3KA 4PMBA 2Z1CA 3HOYB 3KLRA 1ZXTA 3VYTA 1F2LA 5EKKA 3S14B 1HTPA 1PRTB 3GTPB 1IYUA 3SK4A 2KQ3A 1C8CA 4U673 3SDZA 1AP0A 2V4DA 3SK6A 5CBEE 3K5LA 4LK1C 3KBXA 1SE4A 2B2TA 3VYSA 3K5NA 4LJZC 4IUTA 2SNMA 2F0QA 3W2DA 1PMRA 1F9RA 4HTHA 3R3OA 4J8QA 3VR4A 4KKUA 4K6LA 1SNPA 1V1PB 4HAEA 3R93A 2B2WA 2VB2X 4Y7NB 5HGTA 2EY5A 2F1MA 5CGKA 2K1BA 3S9WA 3RUZA 1SNDA 1B44D 3M7GA 3P75A 3KLSA 4B9XA 2C9OA 4C3JB 3FMCA 3DWAA 3QB3A 4RFBA 4A3JB 2RQXA 1I6HB 1BBXC 4XQJA 1HFNA 3JAME 4XT1B 1YNNC 4A3IB 3P1HA 1PDQA 3K57A 1GXDC 3T4AC 1DOMA 5JEAH 4DA2A 1I6VC 5HURA 5IGEA 4A3FB 2BA0A 5A35A 1FNUA 4QUFA 1HTLD 5D14A 2D9UA 4RGMA 4TSSA 4I7ZC 1SE2A 2FFKB 4C3HG 4O42A 2BCOA 3SR1A 1EWCA 3NWSA 1RJTA 1HUNA 2PZUA 5CORA 2B2UC 4NP5A 1Y1WB 2NTTA 1G2SA 4FF4A 4XXEA 2G9DA 2K05A 4HCEA 4ZK9B 1LTTD 1MGSA 1V1PA 4M8AA 3MXNA 3KBGA 3R8BA 1JR0D 1H9RA 4KD3A 2NYZD 3E6ZX 1G8ZD 1NR4A 4TQUS 2NBFA 2B2YC 1PLFA 3ONAB 2KUMA 1EIHA 2NN6G 4CKEA 5C44B 2A6EC 2L11A 2RA4A 2IW3A 3S15B 1LLRD 3ERQA 4ODGA 4BBSB 2EY2A 2R3ZA 4Z9CB 4FF3A 5CC4A 2VNUD 1SYBA 1JE4A 3K7AB 3URYA 2A68C 2PPBC 4M1UB 2EYOA 1MBYA 3OHXC 1WD0A 5C4HA 3CRKC 1U9RA 4RH6A 1SYCA 1S5ED 5C6AA 1SEBD 5BN4A 3J81E 1TVXA 2Y0SB 3TZDA 4G7OC 2ID0A 3TP7A 1B4OA 1I50B 2EOTA 1HQMC 3QWNA 3QOLA 3U9OA 1FGBD 3MXUA 1EY0A 2EPBA 3NXWA 3EA6A 2QF7A 3QG1A 1IL8A 1O78A 2DY7A 1QNKA 1EL0A 4IFDG 4QF4A 3GTQB 5ELFA 2K32A 5D65A 1HA6A 4K5WA 2RDHA 3N52A 3RZDB 4S3SA 3DEPA 1WTVA 4A93B 1J8IA 4A3MB 2L0CA 4K5VA 3CHBD 1OXUA 4OO1G 2F0TA 5BN5A 2MHVA 5FLXE 1O80A 3EVQA 3K5MA 1SJHD 2F0FA 1KNAA 4C1NI 1A2UA 1RKNA 1GUNA 1RCVD 2XSCA 2F0VA 5M5YB 1STGA 2BE5D 4XDXA 2B2UA 5KGUA 4RHSA 4IFDJ 1AZPA 1NAPA 1QCBD 1Y8OB 2ICEC 3SVMA 3PIO3 5KRUA 5EBDA 4NMZA 5M3MB 1FR3A 4F88A 5TSSA 2R7ZB 5C3XA 1Q1BA 2QDBA 4I65A 4RGOS 5ELCA 1X3QA 5ISRA 5C0XJ 2IJ0A 3C1EA 1L0YB 4ZQ3A 5J22A 2A69C 4HSPA 1SNOA 5IOCA 4ZUIA 5I6YA 4KY5A 3SK5A 1O7YA 3BZDB 1CQFA 1S4ZA 2Q8TA 1TU2B 4IFDH 2F0NA 2WKCA 3JAML 4KKSA 4ZYSA 2F03A 4A3BB 4FXDA 3L3OC 4ABNA 4DFAA 2J7ZA 4KTAA 2EDGA 3RLFA 1HA5A 3C2PA 3OPOA 2WINB 5A2QE 3LX0A 1PTOC 1EFID 4ZLTF 1SYDA 4OO1H 5C0XH 1NCVA 4A3DB 1FD7D 4N9PA 4KN4C 1Z7TA 3HEJA 4BBRB 1ZYRC 4IUPA 5FO9B 2K04A 2EY1A 4HCSA 1VDZA 3I8ZA 2R93B 5E4XA 1OXSC 3PUVA 3H94A 5C4XB 1RTNA 1PZKD 3NTHA 1SE3A 3LWEA 2WP8J 4N9TA 4R8IA 2WIIB 4XIGS 3PUWA 1EQTA 3TN2A 4CJ1B 2B2TC 3T56B 3D3RA 2OF1A 4O1NA 1YNJD 1RDPD 3SK8A 4QCLA 3A55A 1A3UA 3S2HB 1B2TA 1CZWA 1PYWD 2F0UA 3PUZA 1SSOA 3MWYW 5FK9C 4F87A 1AEXA 2IL8A 3RMHA 2LS01 2A69D 1A15A 5LL6X 2RDGA 2R61A 1WTRA 1ILQA 1TWFB 2LFNA 4FF2A 4OIJA 2F4IA 4FNFA 2EYJA 3H09A 4KJNA 1E2ZA 1LTBD 1GUOA 2PO4A 2NUCA 5FOBB 1H9SB 4ZKBB 1OXXK 1PTOB 1DOLA 3NBHA 3IAYA 1KDCA 3MXGA 4KI0A 1KABA 4PQXA 3PUXA 3OW7A 4G4KA 4DGZA 4PNYA 2O4XA 3Q23A 1RD9D 1LTSD 1CQVA 1B50A 2OXPA 3TP5A 1SYEA 3MZ5A 1RF2D 2A73B 3A54A 3R2IA 5CV9A 2PW5A 5E3FA 2XIWA 2E76C 2ZXPA 3IKJA 4L63B 2F0DA 4ME5A 5DEHA 1DYQA 1STBA 4LMQD 3H91A 1DCZA 3IFTA 3EJIA 1F2YA 4MN3A 1QB5D 5FKAC 5KIXA 1WTXA 1K8MA 1TWCB 3OIQA 2JA7B 5JEAG 5FO8B 1H9SA 1B53A 3TP8A 1C48A 2X6LA 1JICA 2NVQB 2DNEA 3LWUA 2M9VA 2H1EA 3MVVA 2YYZA 2FHTA 1CI3M 4DXFA 3A8KE 5CR3A 3C1FA 1WVLA 3BS1A 3BYYB 3M7NA 1U4MA 1GHJA 5EPJA 3QO2A 3T16A 1RHPA 3Q6SA 2EJMA 1QNUA 4F7XA 5LHY1 1E2WA 2PQEA 1EYAA 1PRTD 5G3LF 4CJ0B 4R8NA 4EQPA 3S1MB 5JEAJ 4DAYA 1F2ZA 1T5EA 2JA5B 2X6GA 2AQ3B 4UAIA 1SYGA 2IX1A 2L9HA 4OGQC 1I4QA 1ML0D 4A3EB 2EE1A 1B3AA 2EYPA 2I07B 4K8JA 3MTSA 5T1IA 2VB3X 2WB1B 1U4RA 2DNCA 4IUUA 2EZVA 1ZKOA 3EFXD 2NB0A 2O5JC 1VMCA 5KEEA 4G57A 2AUKA 3C3LA 1D6EC 3HZXA 2MJ8A 1SFOB 1R4QB 2QKIC 1TS2A 2D2CC 2MPMA 3AMUA 1J9OA 3NQIA 4HN7A 3OWFA 1JQYD 1E2VA 1R4PB 1JORA 4WRDA 1OXTA 1HXYD 4P2CB 1BNZA 1TWAB 1GJXA 3QIAA 4OHJA 3K59A 3ND9A 1Q12A 4MIUA 1VF5C 4C1NK 3I73A 1VF7A 3SXHA 1EEID 5T1GA 3G6JB 5EKIA 1VMPA 5IGGA 4JK1C 5I4DA 1JB3A 5EGTA 1Y8PB 1EY7A 1K83B 4YIJA 4PMWA 5J1ZA 1O7LA 3EROA 3NHHA 1KTKA 2RBMA 5JJZA 5C4ZA 1BDOA 3DUZA 3A8JE 2B2VC 5I9PA 2Z8LA 3GTLB 5EPLA 3RD4A 4HMJA 5G3LD 3H3VC 3S1NB 3S16B 5KYLA 5DAUA 1YNND 2K03A 5KYIA 3OOCA 2B63B 1ILPA 2ZT9C 2HUGA 2L12A 5CV4A 4XT3B 1D2BA 1SNMA 3FPUB 1R9TB 1CM9A 2TSSA 4NW2A 4Q0FA 4NDXA 2XN9C 3I90A 1BQQT 2E2HB 1TT2A 2IX0A 2JXMB 2KCCA 1S5BD 3NK9A 3K6OA 2EJFC 4XYQA 4A3GB 3QJYA 2JE6I 1XXGA 3NP8A 5KNBA 2F0MA 1I3QB 3CRLC 3J80E 5F2DA 3HOZB 2K5DA 4A3KB 2XRSD 3AB9A 3MHBA 2M00A 3WDNA 1EYCA 3V96A 3D6CA 4DNRB 2PCFB 2CW0C 4L6TB 4CHTB 2A6ED 4QB4A 1IHZA 5JPMC 4WORA 1PZJD 5C0XG 5CV8A 3I72A 2IPKD 1OXVA 1QJOA 1SMYC 4C3JG 3QOJA 1BCPC 2XNAC 3KLSX 2A68D 2KOLA 2K28A 1FNVA 5CBAE 1W6KA 1D1IA 4BA1I 1I4GA 2N88A 3SEBA 4B9WA 3GTKB 1EOTA 1ENFA 3GQBA 5DM73 1ESRA 4H0LC 3GTMB 3KF8A 4RGNA 2GA4B 2JP1A 4U68A 2AWOA 2SEBD 4DNTB 1GUTA 2NZ1D 1Y1VB 3O13A 4ID6A 3BYTB 3RZOB 1GHKA 3HKZB 1Q8IA 3I3CA 2QEJC 3Q24A 3VR3A 5LL6S 4RCOA 5JAVA 4C56C 1JWMD 1PTOF 2B2VA 3MEHA 2JEAI 3T51B 1HCZA 1PXUA 3BG3A 1DONA 2L5TA 4F8MA 5KNDA 3S2DB 5M5WB 4CJ2C 3OMCA 5DNFA 4K5XA 2ZXOA 2F3VA 2VXWA 5J39A 1IYVA 4KY7A 1F2MA 1EQVA 1STYA 1BCPB 2EYHA 2FJ2A 1PZID 1UEAB 4X3TA 5M5XB 1A3TA 3FPPA 2EVBA 1PFNA 5C5LA 2QILA 1LV9A 1DM0B 3BVMA 3Q0AA 1I4HA 1HRJA 4CKCA 2PW7A 3KUPA 2SDFA 4KN7C 1HQRD 4HMIA 3NWTA 4TKOB 3KK7A 3DM1A 1ZEQX 4QUCA 2F0LA 3DHQA 5IODA 2JEBI 1SNQA 1Q1EA 3PIP3 1EY6A 2M2LA 1Z47A 3D4WA 2NWGA 4J1MA 3VYRA 4ULLA 4KMUC 1XWEA 2PZTA 5K5PA 2FMCA 2X69A 1X32A 2SOBA 4E6IA 1KDAA 2YU9B 4OL7A 4C3IG 1PFBA 4FXGC 5ELDA 1MD2D 5NUCA 4BWGB 4LAAA 1JOOA 2NVXB 3IFDA 2D5DA 5ELEA 1DJRD 3BDCA 3VA5A 1M8AA 1IW7C 3NUCA 2K7VA 3FVQA 1A2TA 1ENCA 1CA6A 1ONLA 2EY6A 1A3VA 1BOSA 3J81L 1CA5A 3CU7A 4RHRA 4HEDA 4C3HB 1PTOD 1EYDA 1IKLA 1BR9A 2LY7A 1MSHA 2IX3A 1ZYRD 4XTCS 3NSWA 3S1RB 4K14A 2AUJD 1WTPA 3DMUA 1BO0A 1VCIA 2ZXRA 4Q5VA 1KLGD 5I2XA 3PO3B 3HOWB 1HUMA 3ITPA 1LT3D 2TMPA 2HCIA 4KHVA 3A7AB 2E75C 5IGDA 1OO9B 1LACA 3NBIA 5C3WA 1EU3A 2F0SA 3SE0A 5KNCA 4IZ8A 1UUPA 3D4DA 2D62A 2FMMA 3PO2B 4J6HA 1DZ1A 3FDTA 2B8FA 2QCPX 4FXKC 1TWHB 1STEA 2L55A 1JOQA 2E2JB 4DK0A 3I4NB 3VA7A 5BN3A 5FLXL 2L1BA 3I70A 3I4MB 1TS3A 3TZUA 1EY4A 3L9AX 1TWGB 3MAQA 1UAPA 4L8JA 4BY7B 1QE6A 4H44C 2HCCA 5ELBA 2F0PA 4DAPA 1IKMA 1JC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QKI C;  1GXD C;  1OO9 B;  3MA2 B;  3HS0 C;  3T4A C;  5FO8 B;  5FOB B;  1BR9 A;  2XWB B;  3V96 A;  1D2B A;  3I70 A;  5JPN C;  4ILW A;  2WII B;  5FO9 B;  2A73 B;  4FXG C;  3L3O C;  2B39 A;  3KLS A;  1UAP A;  3CKI B;  3FRP B;  1XWE A;  5JPM C;  3HRZ C;  2J0T D;  5FO7 B;  1PXU A;  1BUV T;  2E2D C;  1BQQ T;  2I07 B;  3CU7 A;  3G6J B;  2WIN B;  2XWJ B;  1UEA B;  3OHX C;  2ICE C;  2TMP A;  1JB3 A;  1JC7 A;  2A74 C;  4FXK C; 
#chains in the Genus database with same CATH topology
 1VS0 A;  3GTQ H;  2XVS A;  4KD4 A;  1HR0 Q;  5HGQ A;  2Q8I B;  3I56 A;  4RA8 A;  4RAU C;  5C5M A;  2N55 A;  2VQE Q;  4GLX A;  1PH1 A;  2ASB A;  4QMG A;  3X3N A;  3RZD H;  4JBW A;  3H6M A;  2B39 A;  4DV6 L;  1NR2 A;  1EU4 A;  4A93 H;  2G9H D;  1AN8 A;  2F0K A;  3HP3 A;  2GN5 A;  1J6Q A;  2LMC B;  4A3M H;  1IZ6 A;  1XX8 A;  1GOZ A;  2JA8 G;  1STA A;  1LO5 D;  4DF7 A;  4OWX B;  3CCV A;  4JI0 L;  2FIN B;  3CCU A;  3H3V H;  2CVR A;  5FLM H;  4L5Q A;  5IGB A;  1W6J A;  1KLU D;  1PFM A;  3A56 A;  4DV1 Q;  2KEE A;  2E5L L;  1Q3L A;  1OTC A;  3PF4 A;  1CSP A;  2JSO A;  4R1J A;  2N8N A;  3NQT A;  1ET9 A;  4DK6 C;  5C4X G;  5M5Y H;  2PQA B;  4DR1 L;  1D8L A;  4B08 A;  2IWH A;  4DU9 A;  2SNS A;  1BBU A;  4H7B A;  1EY5 A;  4HSV A;  3CQZ B;  4PV1 C;  3J7A 5;  4X66 L;  1QIL A;  4AYB G;  1LTI D;  3KJO A;  2WKD A;  4ILW A;  2Q2T A;  4IUR A;  3K58 A;  1FJG L;  5M3M H;  1YIJ A;  1LTG D;  4MNO A;  2K5Q A;  2VL6 A;  3TDQ A;  1YVC A;  3Q22 A;  2R7Z H;  5IWA L;  1XNQ L;  1S3O A;  3M4Y A;  3CCQ A;  2UU9 L;  2ENB A;  3OIP A;  3TSS A;  2WAQ B;  4YWL A;  1LTA D;  1CHQ D;  2I5H A;  3D0F A;  4CKB A;  5IGF A;  3G7L A;  3UI2 A;  2VUM B;  3L0O A;  4OIK A;  5A2Q L;  2NN6 I;  4JI8 Q;  4DUY L;  4RGT A;  3AU7 A;  4GKK L;  4DUZ Q;  4YWM A;  1D5M C;  1TKW B;  1HHV A;  3M4Q A;  3UE1 A;  3E0J A;  5IT9 E;  4CGY B;  1ICW A;  2OT2 A;  2JA6 G;  3GDE A;  4XQN A;  4YWK A;  4TRD A;  5AJ3 L;  1BUV T;  1AW7 A;  2F4V Q;  1IBL L;  1SBB B;  4ZKC B;  1AZQ A;  2JYO A;  1E0B A;  1DOK A;  1TR5 A;  1HFG A;  3NTI A;  5DM6 3;  5JVG 3;  4FDB A;  1JWU D;  4UPA A;  5E7N A;  2G5D A;  1Y69 U;  2K50 A;  3NEL A;  1I4P A;  5C4J B;  2RDF A;  1WTW A;  3ND8 A;  4KJO A;  4JG2 A;  4JVZ A;  1JOK A;  1KAA A;  4A3B H;  2GVA A;  1A62 A;  5D3I B;  3G6E A;  4EVO A;  1E1O A;  2PQA A;  5JVH 3;  2E2D C;  3E5S A;  4NXN L;  3A7L A;  3BDL A;  1YEZ A;  1UWV A;  2MUY A;  2KHS A;  1V43 A;  1SYF A;  3CCM A;  4LF6 L;  1S5C D;  2OWO A;  1SDF A;  2F0J A;  5C3E G;  5EQ0 A;  1JWS D;  1EIG A;  1F9S A;  3LNN A;  4DV6 Q;  1B70 B;  4A3D H;  4APV A;  5FJ8 H;  4BBR H;  1S5D D;  1F9Q A;  4DV3 L;  2XRQ D;  2R93 H;  3C46 A;  2KJX A;  2OQK A;  4JBJ A;  2EYL A;  5C4X H;  4JI0 Q;  2NVT B;  2E74 C;  4RWS C;  1QWY A;  3RR5 A;  3CME A;  1DXM A;  2NTS A;  1WCM G;  5M9O A;  1V1O A;  3PQI A;  1YJN A;  4ZRZ A;  2BA1 A;  2WFW A;  4BS9 A;  2E5L Q;  1CT1 D;  4IFD I;  2R7D A;  2EXZ A;  1GUW A;  1K0R A;  3HOV B;  2KED A;  2AHO B;  3H0G B;  3OTO L;  4DR1 Q;  5CYU A;  2R92 B;  5IIF A;  4OWT B;  5DLQ E;  1LT5 D;  1IBM L;  2NVY B;  1M90 C;  2KA7 A;  3WWV A;  3ULP A;  3I7F A;  1JMC A;  1UNS A;  2MNA A;  4DV4 L;  4CBV A;  5M3F B;  3S2H H;  4IUV A;  2RKS A;  4LFB L;  1Q90 A;  1BVS A;  1FJG Q;  5IYC G;  4BY1 G;  1SNC A;  2BE5 C;  3U50 C;  3V2T A;  1CHP D;  4OO1 I;  3W3A A;  5C0X I;  5IWA Q;  1ENA A;  2UU9 Q;  4UDU C;  4G7H C;  2F0H A;  1M4V A;  1BF4 A;  1TWF H;  1U4P A;  2OQ0 A;  4DK3 C;  4EQO A;  3HOY G;  3AFP A;  1TY2 A;  1PH9 A;  1I4R A;  1DD2 A;  1L1O C;  3PV0 A;  4QY7 A;  4UP9 A;  2Q8R E;  4K6D A;  4BA2 I;  3OWE B;  2ZTD A;  4UY8 C;  3NTK A;  1SAP A;  1IBK L;  4DUY Q;  4GKK Q;  4YCU A;  5EBC A;  5JOB A;  3S1Q B;  1QVF A;  2A6H C;  1AFP A;  1NSN S;  4GN3 B;  1PTO H;  5JJI A;  1EQQ A;  4L5S A;  1QG7 A;  2HQE A;  4GN4 B;  1LAB A;  3L2P A;  1IBL Q;  4N8X 1;  1BCP F;  2A5H A;  4QIW E;  1G29 1;  2A74 C;  2LKV A;  4FYD A;  2IHE A;  3HKZ E;  1L0X B;  4IQZ A;  1T5X D;  1VQ8 A;  1KRS A;  2B8G A;  4EGV A;  2N78 A;  4R4I A;  5CV7 A;  4EQ5 A;  1KQS A;  3K5O A;  2ICI A;  1WI5 A;  2ALY B;  3DEO A;  2PZW A;  4X64 L;  2J4X A;  4C3I B;  3U58 A;  2PMZ B;  5IP7 G;  3GTG B;  3HOX B;  4DR4 L;  3FRP B;  4LF5 L;  4A3E G;  4WJW A;  1YJW A;  3UDX A;  3D8G A;  1EWH A;  3BVG A;  1LT4 D;  4NXN Q;  2K5W A;  1WTQ A;  1HNZ L;  1D1K A;  4CDF C;  3N6R A;  3BVZ A;  4LF6 Q;  4X3U A;  1IXR A;  4K8I A;  3U9S A;  1E22 A;  1D5X C;  5EJW A;  4DV2 Q;  2HDM A;  4R4O A;  3FEW X;  2C5C A;  3WOF A;  1GD7 A;  1EY8 A;  1WD1 A;  3GV6 A;  4LF7 L;  2WAC A;  4DV3 Q;  2NN6 H;  4A3I G;  1KNE A;  2NZH A;  2DUD A;  2K01 A;  2E2I B;  2Z4I A;  3FKI B;  1IL2 A;  1KL9 A;  4DN4 M;  1GUG A;  4NB3 A;  1MJE A;  4FF1 A;  1VQD A;  4XYO A;  1II3 A;  2KCN A;  1TWC H;  3D31 A;  1LT6 D;  3PMF A;  2JA7 H;  1TS5 A;  4FP5 D;  2EJG C;  1L1O B;  1WTO A;  1XYI A;  1NUC A;  2BOS A;  4IUN A;  3HOU B;  4X6A H;  2NVQ H;  3OTO Q;  3I55 A;  4DV5 L;  2MP1 A;  4JW0 A;  3T13 A;  1SR3 A;  1GO3 E;  1H95 A;  4CDD C;  1Y8N B;  4QIW B;  1ASZ A;  2WV6 D;  1IBM Q;  4GZY C;  2PNR C;  5BR8 L;  4IPC A;  5K36 G;  3MA2 B;  3E9H A;  4DV4 Q;  5GAD C;  1Y1W G;  4QJF A;  4LFB Q;  2D0P A;  3D4R A;  3P7J A;  1X65 A;  2OEO A;  4FVM A;  1CFM A;  5D3D A;  4KHZ A;  2A6H D;  2B2Y A;  2ZJR A;  1BXT A;  4PZ7 A;  4DV7 L;  4IPD A;  4LF4 Q;  4HJ7 A;  5IY0 A;  4B3M L;  1C7Y A;  1H9J A;  1QOH A;  3STB C;  1PH2 A;  3GD7 A;  1YNJ C;  5IGC A;  3GV3 A;  4IAL A;  5IT9 c;  3NPP A;  5CV6 A;  3J7A F;  1CK1 A;  3DXJ C;  3OSO A;  4LWC A;  4G7Z C;  3F2U A;  2R6G A;  3I2Z A;  1CTM A;  4PZ8 A;  2BH8 A;  5I2Y A;  3J7Y W;  4KKT A;  1IBK Q;  3S1M H;  4AYB E;  2MFI A;  2JA5 H;  5C44 G;  2CW0 D;  1H9K A;  1X55 A;  2AQ1 B;  2EYM A;  1YBY A;  1STN A;  1YNX A;  2J0T D;  4H02 A;  3I4L A;  2P5Z X;  3T53 B;  4LUO A;  3I91 A;  3L7Z C;  3GTJ B;  4V19 0;  5IT9 L;  1XJV A;  3VR5 A;  1K8O A;  4A3E H;  4ZUJ A;  1H9M A;  1XTC D;  2DN8 A;  3TME A;  4BBS G;  5EPK A;  1P16 A;  3IRB A;  1FYC A;  2BDO A;  5E1F A;  3MC0 B;  3M4O B;  1L1O A;  4X64 Q;  1SMY D;  1PV4 A;  1JJ2 A;  4YCW A;  2MGS A;  1BCP D;  3TRE A;  1EZ8 A;  4DR4 Q;  1N32 L;  2F0W A;  3VYU A;  1B1Z A;  1D5Z C;  3UDI A;  3MFY A;  3RLO A;  2DY8 A;  5I9O A;  4YY3 L;  3SHL A;  1JCK B;  1YHQ A;  2K33 A;  3IL8 A;  1O7Z A;  1V8Q A;  5CMD A;  2F0O A;  1X3E A;  1KIX A;  1HNZ Q;  2VW9 A;  4OX9 L;  2JA8 B;  3K0Y A;  2F0E A;  1C4Q A;  4B3R L;  2L4N A;  1E3P A;  2PYK A;  1Q8K A;  1SFO H;  1G2T A;  2Y0S G;  4KV6 A;  5CV5 A;  3A8I E;  5EKL A;  2HQL A;  3D6W A;  1K3B C;  2F3W A;  4IN3 A;  4XQQ A;  4EQN A;  3HRZ C;  4LF7 Q;  3CW2 C;  4JPB W;  3K81 C;  1HJP A;  1K8A C;  2IT1 A;  1S5F D;  1F77 A;  4YCV A;  4LF8 L;  1SMX A;  4RG1 A;  1X56 A;  1Q81 C;  2XWB B;  3EBE A;  1NJI C;  1I4X A;  4AYB B;  2ZJQ A;  3GO5 A;  1TWA H;  1F9P A;  5K36 H;  1SXT A;  1G91 A;  2KVM A;  2KCM A;  1TS4 A;  4DAV A;  1SRO A;  4K2K A;  2CHB D;  4DV5 Q;  3VDY A;  3GTO B;  1X54 A;  3HOZ G;  4DXG A;  4RKB A;  4C2M B;  5JPN C;  5BR8 Q;  1X3G A;  2F0G A;  5AFW A;  3FP9 A;  1NTG A;  3P20 A;  1BBW A;  5E4W C;  1PRT F;  3V05 A;  5I6W A;  2EQS A;  1VQP A;  4A93 G;  3BDO A;  1FNW A;  1K83 H;  3DWQ A;  5H1S E;  2RVL A;  2B2W C;  4AQY Q;  3MFG A;  1ET6 A;  2JQO A;  3CKI B;  4DV7 Q;  2BDN A;  2JA6 B;  4RKL A;  4HR7 B;  1TY0 A;  1TQO A;  2K6A A;  1GUS A;  3PIP A;  3CC4 A;  5FLM G;  2AMC B;  3VR2 A;  4AIM A;  4WFN 3;  3CCE A;  2VQF L;  5JJK A;  3J7A V;  1E24 A;  1A6X A;  3J80 c;  3MXP A;  1CZG A;  1KDB A;  4ZAI A;  3PUY A;  1KD1 C;  4K2L A;  1TII D;  1SJE D;  3GTL H;  1N34 Q;  5J3B A;  4P71 A;  1ESF A;  1KRT A;  3TQY A;  3X3M A;  3S17 B;  4GN5 A;  1EZ6 A;  3GP7 A;  3M85 A;  3T1Y L;  4V0B A;  2XWJ B;  1FVI A;  3S1N H;  3S16 H;  1QVG A;  1PRT C;  2H4O A;  1U4L A;  2I46 A;  3HGB A;  2AWN A;  2KEC A;  2Z6B A;  3J80 L;  2Q2U A;  4JI2 L;  1KAW A;  1K73 C;  2B63 H;  2R7Z G;  2EYF A;  3M3Y B;  1M1K C;  5C3E B;  1VQE A;  4IUQ A;  1X3P A;  3VR6 A;  1EEF D;  1CUK A;  4KK7 A;  1Y1V G;  1R9T H;  3J81 j;  5FO7 B;  1A0I A;  1B9N A;  3HG9 A;  4KY6 A;  4YY3 Q;  4JOI A;  4DAM A;  4HIK A;  2CQA A;  2OTL A;  1MI2 A;  2YV5 A;  4OX9 Q;  4B3R Q;  1X9N A;  2O5I C;  3HS0 C;  2E2H H;  3CPW A;  4RCN A;  2F0I A;  1Z6H A;  3OMG A;  2RSN A;  1CSQ A;  1WCM B;  3EQL C;  1N33 L;  2CFM A;  4DK1 A;  1VQC A;  1EY9 A;  4R9W A;  3PGZ A;  4X3S A;  4A3G H;  2AQ2 B;  3ZYY X;  4H13 C;  4NKL A;  2K4K A;  3A74 A;  3K7U C;  1I3Q H;  1RTO A;  2A8V A;  3NE5 B;  1ROD A;  1IW7 D;  5COY A;  3R2T A;  2Z9H A;  2HDL A;  1G6Z A;  3HOZ H;  4LUZ A;  3TBI B;  2Z4H A;  4A3K H;  4A3B G;  1MSG A;  4GKJ Q;  3TP6 A;  4MHE A;  2O2L D;  5IYD H;  4BY1 B;  2KEN A;  3DWP A;  1STH A;  3WOE A;  1HPC A;  2RSO A;  1VQ6 A;  4BXX G;  1B9M A;  3BZK A;  4FO2 A;  1LTR D;  4PMC A;  4X3K A;  4PMB A;  2Z1C A;  3HOY B;  3KLR A;  1ZXT A;  1YJ9 A;  3VYT A;  1F2L A;  5EKK A;  4A3D G;  3S14 B;  2HHH L;  2YTY A;  4LW1 A;  2UUC L;  1HTP A;  1PRT B;  2RF4 A;  5FJ8 G;  4BBR G;  4DR5 Q;  3GTP B;  1YIT A;  4K0K L;  2R93 G;  1IYU A;  3SK4 A;  3M9B A;  2KQ3 A;  1U5K A;  1C8C A;  4U67 3;  3SDZ A;  2IHF A;  1AP0 A;  4ZCK A;  2V4D A;  3SK6 A;  5CBE E;  3K5L A;  4LK1 C;  3KBX A;  1GM5 A;  1SE4 A;  1SN8 A;  4GNX C;  1RIP A;  4A3C H;  2B2T A;  3VYS A;  3K5N A;  4LJZ C;  4QQB X;  4IUT A;  2SNM A;  3J7Z C;  2F0Q A;  3W2D A;  1PMR A;  1F9R A;  4HTH A;  3TS0 A;  3GTK H;  1EQR A;  3R3O A;  1HZC A;  4J8Q A;  3VR4 A;  4KKU A;  3TS2 A;  4UP7 A;  3TRZ A;  4K6L A;  1SNP A;  4LFC L;  3GTM H;  1V1P B;  3T1Y Q;  4HAE A;  3R93 A;  1ASY A;  2B2W A;  5GAE C;  1HZ9 A;  1AE2 A;  1PYS B;  4P73 A;  2VB2 X;  3MXN B;  1Y1V H;  4Y7N B;  1B8A A;  3ULL A;  2EY5 A;  5HGT A;  1SE8 A;  2F1M A;  2K1B A;  5CGK A;  3S9W A;  3RZO H;  4JI2 Q;  3RUZ A;  1SND A;  1B44 D;  3M7G A;  3M4P A;  3P75 A;  3KLS A;  4B9X A;  2C9O A;  4C3J B;  1XNR L;  3FMC A;  4R4T A;  3DWA A;  3QB3 A;  4RFB A;  4A3J B;  2RQX A;  3A5U A;  1I6H B;  5IP9 G;  1BBX C;  4XQJ A;  2UXB L;  4QGU A;  1HFN A;  3JAM E;  4XT1 B;  1YNN C;  4A3I B;  3CCJ A;  1DGS A;  3P1H A;  1PDQ A;  1QVC A;  3K57 A;  1GXD C;  3KF6 B;  3T4A C;  3S2D H;  1DOM A;  5M5W H;  4GLA C;  1NNX A;  2E8G A;  1Q46 A;  2LXK A;  5JEA H;  4DA2 A;  1N33 Q;  4OEM B;  1HNX L;  1I6V C;  1V1Q A;  1N9W A;  3NEN A;  5HUR A;  2OTJ A;  1QUQ B;  5IGE A;  4A3F B;  2BA0 A;  5A35 A;  4A75 A;  1FNU A;  4QUF A;  4JI7 L;  1HTL D;  2D9U A;  4RGM A;  4TSS A;  5D14 A;  4I7Z C;  1JE5 A;  1SE2 A;  2FFK B;  4C3H G;  4O42 A;  2BCO A;  3SR1 A;  1EWC A;  3NWS A;  1RJT A;  4BXX H;  1HUN A;  2PZU A;  5M5X H;  5COR A;  2B2U C;  4NP5 A;  4GNX B;  1Y1W B;  4P74 A;  2NTT A;  2Y0S E;  1G2S A;  4FF4 A;  4XXE A;  2G9D A;  2K05 A;  4HCE A;  4ZK9 B;  1LTT D;  3PO3 G;  1MGS A;  3HOW G;  1V1P A;  3JAM i;  4M8A A;  3MXN A;  3KBG A;  3R8B A;  2RHQ B;  1JR0 D;  2LSS A;  1H9R A;  4KD3 A;  2NYZ D;  3E6Z X;  1G8Z D;  1NR4 A;  4TQU S;  2NBF A;  2HHH Q;  2B2Y C;  1PLF A;  3ONA B;  2KUM A;  2XGT A;  1EIH A;  3K0X A;  1VQ9 A;  2Q2I A;  2NN6 G;  4K0K Q;  4CKE A;  5C44 B;  2A6E C;  1PH5 A;  2PMZ E;  1Q86 C;  2L11 A;  2RA4 A;  1ICF B;  2IW3 A;  3S15 B;  2Z6K A;  2JA7 G;  1LLR D;  4L5R C;  3ERQ A;  5IYB H;  1WOC A;  3KF6 A;  4ODG A;  4OXP A;  4BBS B;  3F2C A;  3AQQ A;  3W1B A;  4X66 Q;  2EY2 A;  2R3Z A;  1Q7Y C;  4Z9C B;  4FF3 A;  2GVB A;  5CC4 A;  2VNU D;  1VQH A;  1SYB A;  1JE4 A;  3B6Y A;  3K7A B;  3URY A;  2YU9 H;  1QUQ A;  2A68 C;  3MEF A;  1JJC B;  2PPB C;  2F3I A;  4M1U B;  1XNQ Q;  2EYO A;  1MBY A;  3LGJ A;  3OHX C;  2NVX H;  1WD0 A;  5C4H A;  3CRK C;  3E9I A;  5IP9 H;  1U9R A;  4RH6 A;  1SYC A;  1S5E D;  5C6A A;  1SEB D;  5BN4 A;  4GNX A;  3J81 E;  1TVX A;  2Y0S B;  3TZD A;  4G7O C;  2ID0 A;  3TP7 A;  1B4O A;  1U0L A;  1S40 A;  4HIM A;  1LUZ A;  1I50 B;  2EOT A;  1XNR Q;  1D7Q A;  1PH6 A;  1HQM C;  4DV0 L;  3QWN A;  5AJ3 Q;  4NPS A;  3QOL A;  3U9O A;  1FGB D;  3MXU A;  1EY0 A;  2EPB A;  2JA5 G;  3NXW A;  4C3H H;  4IPH A;  3EA6 A;  4HJ5 A;  2QF7 A;  3QG1 A;  4HIO A;  1HNX Q;  1IL8 A;  2EIF A;  1O78 A;  1K3R A;  2DY7 A;  1QNK A;  1EL0 A;  2PNH A;  4IFD G;  4QF4 A;  3GTQ B;  2UUB L;  3S1R H;  5ELF A;  2K32 A;  5D65 A;  1HA6 A;  3U4V A;  4K5W A;  1PH4 A;  1NMG A;  3CCS A;  2RDH A;  1HH2 P;  3N52 A;  3PO3 H;  3HOW H;  3RZD B;  2WB1 G;  4S3S A;  4DKA C;  3DEP A;  5LMU L;  3HKS A;  1WTV A;  4A93 B;  3KYH C;  1J8I A;  2MO0 A;  1KC8 C;  4A3M B;  2L0C A;  4K5V A;  3CHB D;  4R4Q A;  1OXU A;  4OO1 G;  2F0T A;  5BN5 A;  2MHV A;  3PO2 H;  5FLX E;  4B3S L;  1O80 A;  3EVQ A;  3PSI A;  1AE3 A;  3K5M A;  2B3G A;  1SJH D;  2F0F A;  2AKW B;  4X65 L;  1X6O A;  1KNA A;  1XMQ L;  3NEM A;  4C1N I;  1A2U A;  1RKN A;  3CP0 A;  1TWH H;  1GUN A;  1RCV D;  2XSC A;  2E2J H;  2F0V A;  3I4N H;  3G4S A;  5M5Y B;  2YTV A;  1STG A;  2BE5 D;  4XDX A;  1VQ5 A;  2B2U A;  4QL5 A;  5KGU A;  3I4M H;  4RHS A;  4IFD J;  1AZP A;  1NAP A;  1QCB D;  1N8R C;  1TWG H;  1VQF A;  1Y8O B;  4BY7 H;  2ICE C;  2PI2 E;  3SVM A;  3T1H L;  5L37 A;  5LMN W;  3PIO 3;  5KRU A;  5EBD A;  2IY5 B;  4NMZ A;  5M3M B;  1FR3 A;  4F88 A;  5TSS A;  3CXC A;  2R7Z B;  5C3X A;  2QDL A;  2I5M X;  2Q2H A;  1Q1B A;  4CDC C;  1MJC A;  2QGQ A;  4JC0 A;  3H15 A;  2QDB A;  3K80 C;  5IE8 A;  4I65 A;  3KFU A;  4RGO S;  2LXJ A;  5ELC A;  1X3Q A;  4WJ3 M;  2HIX A;  5ISR A;  5C0X J;  3CCL A;  2IJ0 A;  4WJ4 A;  3JAM c;  1EFW A;  3C1E A;  1L0Y B;  4ZQ3 A;  5J22 A;  2A69 C;  4HSP A;  1SNO A;  5IOC A;  4ZUI A;  3F1Z A;  5I6Y A;  4JOI C;  4KY5 A;  3SK5 A;  4JI6 L;  1O7Y A;  2DJF C;  3BZD B;  1CQF A;  2ATW A;  1S4Z A;  2Q8T A;  4DR7 L;  1VQB A;  1TU2 B;  4IFD H;  2F0N A;  2WKC A;  3JAM L;  3E3X A;  4KKS A;  4ZYS A;  2ZM6 L;  3CQZ H;  2F03 A;  4A3B B;  2YTX A;  4FXD A;  4HJA A;  3L3O C;  1P8L A;  2ZTC A;  1XPU A;  4ABN A;  1JB7 A;  4DFA A;  2J7Z A;  3PCO B;  1BKB A;  4KTA A;  2EDG A;  2CCZ A;  3JC6 6;  3RLF A;  1UE5 A;  4LF5 Q;  1HA5 A;  3C2P A;  2UUB Q;  3OPO A;  2WIN B;  5A2Q E;  3LX0 A;  1LM0 A;  2B63 G;  1PTO C;  3EIV A;  3UDG A;  1EFI D;  4ZLT F;  1SYD A;  2K5H A;  4OO1 H;  1I5F A;  5C0X H;  5LMU Q;  1NCV A;  4A3D B;  2KBN A;  1FD7 D;  2A1A A;  4KN4 C;  4N9P A;  1Z7T A;  3HEJ A;  4BBR B;  1ZYR C;  4IUP A;  5FO9 B;  1VQG A;  3NBH B;  2VUM H;  2K04 A;  2EY1 A;  4HCS A;  1VDZ A;  3I8Z A;  2R93 B;  2R7F A;  5E4X A;  2CKZ B;  1NE3 A;  1OXS C;  3PUV A;  3H94 A;  5C4X B;  4B3S Q;  1RTN A;  1UEB A;  1PZK D;  3NTH A;  1SE3 A;  3LWE A;  2CWA A;  2WP8 J;  1EYG A;  4N9T A;  4IOC A;  4X65 Q;  2A19 A;  1HZB A;  4R8I A;  3ZJY C;  1XMQ Q;  1UE7 A;  4A3G G;  2WII B;  4XIG S;  2KHI A;  3PUW A;  1I94 L;  1EQT A;  3ER0 A;  4L5T A;  3TN2 A;  4CJ1 B;  2B2T C;  3T56 B;  3D3R A;  5C4J H;  2OF1 A;  1O7I A;  3STB D;  4O1N A;  1YNJ D;  1RDP D;  3SK8 A;  1KHI A;  4QCL A;  3A55 A;  1A3U A;  3S2H B;  1B2T A;  1CZW A;  4A3K G;  1PYW D;  2F0U A;  3PUZ A;  1SSO A;  4DR3 L;  3MWY W;  5FK9 C;  2ZJP A;  4JI4 L;  3EN2 A;  5IYD G;  2VQE L;  4F87 A;  1AEX A;  2IL8 A;  3RMH A;  1TXY A;  2A69 D;  2LS0 1;  1A15 A;  5LL6 X;  2RDG A;  3A0J A;  2R61 A;  2BH2 A;  1WTR A;  2UUA L;  1ILQ A;  4JYA L;  1TWF B;  2LFN A;  4FF2 A;  4OIJ A;  4B3M Q;  2F4I A;  2MO1 A;  4FNF A;  2EYJ A;  2PI2 A;  3H09 A;  4KJN A;  1E2Z A;  1LTB D;  3BU2 A;  1GUO A;  2PO4 A;  1PH7 A;  2NUC A;  1QZH A;  5FOB B;  3HFZ B;  1H9S B;  2N49 A;  4ZKB B;  1OXX K;  1PTO B;  1DOL A;  2RCN A;  3DM3 A;  2NVT H;  1GVP A;  4JI5 L;  3NBH A;  3IAY A;  1E1T A;  1KDC A;  3MXG A;  4JI6 Q;  4KI0 A;  4A3C G;  1KAB A;  3OYY A;  3PUX A;  4PQX A;  3OW7 A;  3PF5 A;  1W2B A;  4G4K A;  4DGZ A;  4DR7 Q;  3HOV H;  3H0G H;  4I7A A;  4PNY A;  2R92 H;  2O4X A;  3Q23 A;  1RD9 D;  3CC7 A;  1LTS D;  2NVY H;  4LUV A;  1CQV A;  1B50 A;  2OXP A;  2ZM6 Q;  3TP5 A;  1SYE A;  4Y52 H;  3MZ5 A;  1RF2 D;  2ES2 A;  2A73 B;  3A54 A;  3R2I A;  5CV9 A;  2I5L X;  1C0A A;  2PW5 A;  1N32 Q;  5E3F A;  1QZG A;  2XIW A;  2E76 C;  2ZXP A;  3IKJ A;  4L63 B;  2RHS B;  2F0D A;  4ME5 A;  1HNW L;  3HKZ G;  5DEH A;  1XTD A;  4LF9 L;  3CCR A;  4DAY B;  1DYQ A;  2DJG C;  1STB A;  4LMQ D;  4JBM A;  3H91 A;  1DCZ A;  3IFT A;  3EJI A;  4DUZ L;  4ME3 A;  1F2Y A;  4MN3 A;  1QB5 D;  5FKA C;  5KIX A;  5JJL A;  1WTX A;  3S1Q H;  1K8M A;  1J5E L;  1TWC B;  2JN4 A;  3OIQ A;  2JA7 B;  5JEA G;  5FO8 B;  4LF8 Q;  1H9S A;  1B53 A;  2WB1 E;  2JK8 A;  3G48 A;  3TP8 A;  4EX5 A;  1C48 A;  2X6L A;  4LFA L;  1JIC A;  2NVQ B;  2DNE A;  3LWU A;  2M9V A;  2Z6K C;  2MQH A;  3F8T A;  4C3I H;  3KLW A;  1Y14 B;  1YZ6 A;  3GTG H;  4UP8 A;  3HOX H;  2H1E A;  1T9H A;  3MVV A;  2YYZ A;  4HID A;  1MIU A;  4JI4 Q;  2FHT A;  4DR3 Q;  1CI3 M;  4DXF A;  3ULJ A;  1EWI A;  3A8K E;  5CR3 A;  3C1F A;  1WVL A;  3BS1 A;  3BYY B;  3M7N A;  1FGU A;  2UUA Q;  1U4M A;  4JYA Q;  1GHJ A;  5EPJ A;  4POF A;  3QO2 A;  3T16 A;  1RHP A;  3F2D A;  3Q6S A;  2EJM A;  4YHH L;  1QNU A;  4F7X A;  5LHY 1;  1E2W A;  2PQE A;  1EYA A;  1PRT D;  5G3L F;  4CJ0 B;  4R8N A;  2I0Q A;  4EQP A;  2VQF Q;  3SGI A;  3S1M B;  5JEA J;  4DAY A;  1F2Z A;  4IPG A;  1T5E A;  1WYD A;  2L15 A;  2EXD A;  2JA5 B;  2XTI A;  4N8F A;  2E2I H;  3FKI H;  4A3L H;  2X6G A;  4JI5 Q;  2AQ3 B;  4UAI A;  3AEV A;  1SYG A;  2IX1 A;  4JI1 L;  1FL0 A;  2L9H A;  4JV5 L;  2Z0S A;  4OGQ C;  5IYB G;  4X62 L;  1I4Q A;  1ML0 D;  4A3E B;  1PA6 A;  2EE1 A;  1B3A A;  2EYP A;  2I07 B;  4K8J A;  3MTS A;  1CKO A;  3HOU H;  5T1I A;  2VB3 X;  4DR6 L;  2QW7 A;  2D0O A;  1XPR A;  2WB1 B;  2DGY A;  1U4R A;  4CDE C;  2DNC A;  1SLJ A;  4TVA B;  4IUU A;  2EZV A;  1HR0 W;  3W1G A;  1ZKO A;  3EFX D;  1K0S A;  4LNQ A;  2V1C C;  2NB0 A;  2O5J C;  1VMC A;  5KEE A;  4G57 A;  2AUK A;  3C3L A;  1D6E C;  3HZX A;  2VY3 A;  2MJ8 A;  1SFO B;  1HNW Q;  2FXQ A;  4HJ9 A;  4LF9 Q;  1R4Q B;  2QKI C;  1XMO L;  1TS2 A;  2D2C C;  2MPM A;  3AMU A;  1J9O A;  4O2D A;  3NQI A;  4HN7 A;  2HIV A;  1EOV A;  4IJH A;  2K75 A;  3OWF A;  1JQY D;  1E2V A;  5LMN L;  1R4P B;  1JOR A;  1J5E Q;  4WRD A;  1OXT A;  1V9P A;  1LTL A;  1HXY D;  4P2C B;  2QEX A;  1BNZ A;  1TWA B;  1GJX A;  3GTJ H;  4JI3 L;  3QIA A;  4OHJ A;  3K59 A;  3ND9 A;  1Q12 A;  4MIU A;  1VF5 C;  4C1N K;  4LFA Q;  3I73 A;  4PG3 A;  3BZC A;  1VF7 A;  3SXH A;  1EEI D;  3M4O H;  1VQO A;  3KOJ A;  5T1G A;  3G6J B;  5EKI A;  1PH3 A;  1VMP A;  5IGG A;  3K8A A;  4JK1 C;  5I4D A;  4OEL B;  1JB3 A;  5EGT A;  1Y8P B;  1EY7 A;  1K83 B;  4ALP A;  1AH9 A;  2JA8 H;  2KCT A;  4YIJ A;  2UUC Q;  4DV2 L;  4PMW A;  1LYL A;  5J1Z A;  3PO2 G;  1O7L A;  3ERO A;  3NHH A;  1KTK A;  4YHH Q;  2UXD L;  2RBM A;  3OW2 A;  4DR2 L;  4UHV A;  1KXL A;  5JJZ A;  3E0E A;  5C4Z A;  3ICE A;  1BDO A;  3DUZ A;  3TEH B;  3A8J E;  3I4N G;  2B2V C;  5I9P A;  1VQN A;  2Z8L A;  5GAH C;  3I4M G;  1EIY B;  3GTL B;  5EPL A;  1YHB A;  1SRU A;  3W5O A;  2HT1 A;  3RD4 A;  4HMJ A;  3BJU A;  4JI1 Q;  4JV5 Q;  1GKH A;  4BY7 G;  5G3L D;  3H3V C;  4P75 A;  3S1N B;  3S16 B;  4X62 Q;  4LFC Q;  5KYL A;  1PFS A;  5DAU A;  1YNN D;  2K03 A;  1L0W A;  5KYI A;  3CD6 A;  3OOC A;  4DR6 Q;  2B63 B;  3GTO H;  1ILP A;  2ZT9 C;  2HUG A;  2L12 A;  5CV4 A;  4XT3 B;  4C2M H;  1D2B A;  1SNM A;  3FPU B;  1X3F A;  1R9T B;  3I4O A;  1JT8 A;  2K52 A;  1N36 L;  1CM9 A;  2HD3 A;  2TSS A;  4LF4 L;  2CH4 A;  4NW2 A;  4KHP L;  2F52 A;  4Q0F A;  4NDX A;  3UE0 A;  4POG A;  2XN9 C;  3I90 A;  1BQQ T;  1VQA A;  4B3T L;  2UXB Q;  2E2H B;  1HZA A;  1W3S A;  2JA6 H;  1TT2 A;  2IX0 A;  2JXM B;  1XMO Q;  2KCC A;  1S5B D;  3NK9 A;  3K6O A;  1EUJ A;  2EJF C;  3CMA A;  4XYQ A;  1L2F A;  4A3G B;  3QJY A;  3KF8 B;  2JE6 I;  1XXG A;  3NP8 A;  5KNB A;  2F0M A;  1I3Q B;  3CRL C;  3J80 E;  5LMN Q;  5F2D A;  4JI7 Q;  5HY6 A;  3U4Z A;  1NMF A;  3HOZ B;  2K5D A;  3S17 H;  4A3K B;  2XRS D;  3AB9 A;  3MHB A;  1UE1 A;  4JI3 Q;  2M00 A;  3WDN A;  1EYC A;  3V96 A;  4AH6 A;  3J81 i;  3D6C A;  3KDF B;  1PH8 A;  4DNR B;  2PCF B;  2N3S A;  1YI2 A;  2CW0 C;  4L6T B;  4CHT B;  3UDF A;  2A6E D;  4QB4 A;  1IHZ A;  5JPM C;  4WOR A;  3M3Y H;  5C3E H;  1PZJ D;  4OON A;  2WAQ G;  5C0X G;  5GQO A;  3AYH B;  2VUM G;  5CV8 A;  3I72 A;  3KJP A;  2IPK D;  1OXV A;  1QJO A;  1SMY C;  3AFQ A;  4C3J G;  3QOJ A;  1BCP C;  2XNA C;  1VQI A;  3KLS X;  4A4I A;  4A3J G;  2A68 D;  2KOL A;  1WCM H;  4GLV B;  3J80 i;  2K28 A;  1FNV A;  2UXD Q;  5CBA E;  1W6K A;  4GS3 A;  1D1I A;  4DR2 Q;  3CPF A;  4BA1 I;  1I4G A;  2N88 A;  1RL2 A;  3SEB A;  4B9W A;  4A76 A;  3GTK B;  1EOT A;  2C35 B;  1ENF A;  1IYJ B;  3GQB A;  5DM7 3;  1A63 A;  1ESR A;  4H0L C;  3GTM B;  3KF8 A;  4RGN A;  2GA4 B;  2JP1 A;  4U68 A;  4A3F G;  2AWO A;  2SEB D;  2NZO A;  4DNT B;  1GUT A;  2NZ1 D;  5IYC H;  4BY1 H;  1Y1V B;  3O13 A;  3QR8 A;  3CC2 A;  4ID6 A;  3BYT B;  4JCV E;  3RZO B;  1GHK A;  3HKZ B;  1Z9F A;  1Q8I A;  3I3C A;  2QEJ C;  3Q24 A;  1WFQ A;  4HJ8 A;  3HOY H;  4R4C A;  5LL6 S;  3VR3 A;  2JA9 A;  4RCO A;  1K28 A;  3KDF A;  5JAV A;  1PTO F;  1JWM D;  4C56 C;  3G71 A;  4AQY L;  1N36 Q;  2B2V A;  3S14 H;  3MEH A;  1NBW A;  2JEA I;  3T51 B;  1K9M C;  1HCZ A;  4RMF A;  3GTP H;  4KHP Q;  2VS1 A;  1WTH A;  1PXU A;  3BG3 A;  4DV0 Q;  1DON A;  4IO9 A;  4B3T Q;  2L5T A;  4F8M A;  1B3Q A;  5KND A;  3S2D B;  1Q82 C;  5M5W B;  4CJ2 C;  4JBK A;  1MKH A;  5GRO A;  3RN2 A;  3OMC A;  3RNU A;  5DNF A;  1EIF A;  4K5X A;  2ZXO A;  1CKN B;  4O0A A;  5GAG C;  3RN5 A;  2F3V A;  5ELO A;  1N34 L;  1UE6 A;  1VQ7 A;  3F2B A;  1VQM A;  2VXW A;  5J39 A;  1PYB A;  3HOV G;  1IYV A;  4KY7 A;  1F2M A;  3H0G G;  5EAY A;  2R92 G;  1EQV A;  3PIO A;  1STY A;  1BCP B;  2EYH A;  5IP7 H;  2FJ2 A;  1PZI D;  1UEA B;  4X3T A;  5M5X B;  1A3T A;  3FPP A;  2EVB A;  1PFN A;  5C5L A;  4GOP C;  2QIL A;  1LV9 A;  1DM0 B;  3S24 A;  1WJJ A;  5M3F G;  3BVM A;  3Q0A A;  1I4H A;  4Y7N H;  1HRJ A;  4CKC A;  2PW7 A;  3KUP A;  2SDF A;  4KN7 C;  1HQR D;  3Q8D A;  5ELN A;  4HMI A;  2UXC L;  3NWT A;  4P72 A;  4TKO B;  3KK7 A;  3H3V I;  3DM1 A;  1ZEQ X;  4QUC A;  2F0L A;  3DHQ A;  5IOD A;  2JEB I;  4C3J H;  1VQJ A;  1SNQ A;  4A3J H;  1Q1E A;  1VQL A;  2RCF A;  1I6H H;  3PIP 3;  1EY6 A;  2M2L A;  1Z47 A;  4A3I H;  3D4W A;  1CKM A;  2NWG A;  4J1M A;  4KLK A;  3VYR A;  4ULL A;  4KMU C;  1XWE A;  2KHJ A;  2PZT A;  4DPG A;  4NXM L;  5K5P A;  2FMC A;  2X69 A;  4A3F H;  4IJL A;  3CF5 A;  1X32 A;  3T1H Q;  2SOB A;  4E6I A;  1HR0 L;  1KDA A;  1PVO A;  2CQO A;  4OL7 A;  2YU9 B;  4GKJ L;  1CKN A;  2B29 A;  4C3I G;  1PFB A;  4MZ9 A;  4FXG C;  5ELD A;  1MD2 D;  5NUC A;  4BWG B;  4LAA A;  3HOX G;  1JOO A;  2NVX B;  1Y1W H;  3IFD A;  3DLL A;  3J81 c;  2D5D A;  1K8G A;  1PHJ A;  5ELE A;  1DJR D;  3BDC A;  1XPO A;  3VA5 A;  1M8A A;  1A8V A;  2H5X A;  1IW7 C;  3CAM A;  3A5Z B;  3NUC A;  2K7V A;  2OCE A;  3FVQ A;  1A2T A;  1ENC A;  1E7Z A;  4DR5 L;  1CA6 A;  1ONL A;  4GOP B;  4OWW B;  4IOA A;  4DV1 L;  2EY6 A;  4A3M G;  1A3V A;  1BOS A;  3J81 L;  1CA5 A;  3CU7 A;  5C44 H;  4RHR A;  1G51 A;  4HED A;  3FKI G;  4C3H B;  1PTO D;  4A3L G;  1EYD A;  3S15 H;  1IKL A;  1S72 A;  1BR9 A;  2LY7 A;  1MSH A;  2IX3 A;  1ZYR D;  1VQK A;  4BBS H;  1MHW C;  3NSW A;  4XTC S;  3S1R B;  4K14 A;  5M3F H;  2AUJ D;  4MTN A;  3HOU G;  1NY4 A;  2K14 A;  1G6P A;  1WTP A;  3DMU A;  1BO0 A;  1VCI A;  2K5V A;  2ZXR A;  4Q5V A;  1KLG D;  5I2X A;  3K7A H;  3PO3 B;  3HOW B;  1HUM A;  2JJQ A;  1LT3 D;  2K5N A;  3ITP A;  2TMP A;  2HCI A;  1JJG A;  4KHV A;  3A7A B;  2E75 C;  5IGD A;  1OO9 B;  5M3M G;  1LAC A;  3NBI A;  5C3W A;  2VZA A;  1EU3 A;  5FLX c;  2F0S A;  2CH4 W;  3SE0 A;  4JI8 L;  5KNC A;  2CWP A;  1UUP A;  4IZ8 A;  3D4D A;  1C9O A;  2D62 A;  2UXC Q;  2FMM A;  3PO2 B;  4J6H A;  4MTK A;  1DZ1 A;  3FDT A;  2B8F A;  1I50 H;  2F4V L;  3RLN A;  2ZTE A;  2QCP X;  1YHA A;  4FXK C;  1TWH B;  1STE A;  2L55 A;  1JOQ A;  4J15 A;  2E2J B;  4DK0 A;  3I4N B;  3VA7 A;  5BN3 A;  5FLX L;  2L1B A;  3I70 A;  3I4M B;  4GOP A;  2QA4 A;  1TS3 A;  3TZU A;  1EY4 A;  3L9A X;  1VQ4 A;  1TWG B;  3MAQ A;  1UAP A;  4L8J A;  3ERS X;  1I94 Q;  4BY7 B;  1QE6 A;  4DNI A;  4H44 C;  2HCC A;  4NXM Q;  5ELB A;  4PZ6 A;  2F0P A;  3FHW A;  2WAQ E;  4DAP A;  1B7Y B;  1IKM A;  1JC7 A; 
#chains in the Genus database with same CATH homology
 2XVS A;  4KD4 A;  2Q8I B;  4RA8 A;  4RAU C;  5C5M A;  2N55 A;  4QMG A;  3X3N A;  4JBW A;  3H6M A;  2B39 A;  1NR2 A;  1EU4 A;  2G9H D;  1AN8 A;  2F0K A;  3HP3 A;  2LMC B;  1XX8 A;  1GOZ A;  1STA A;  1LO5 D;  4DF7 A;  2FIN B;  2CVR A;  5IGB A;  1W6J A;  1KLU D;  1PFM A;  3A56 A;  2KEE A;  1Q3L A;  2JSO A;  3NQT A;  1ET9 A;  4B08 A;  2IWH A;  4DU9 A;  2SNS A;  4H7B A;  1EY5 A;  4HSV A;  3CQZ B;  4PV1 C;  1QIL A;  1LTI D;  2WKD A;  4ILW A;  4IUR A;  3K58 A;  1LTG D;  2K5Q A;  3TDQ A;  3Q22 A;  3M4Y A;  2ENB A;  3OIP A;  3TSS A;  2WAQ B;  1LTA D;  1CHQ D;  4CKB A;  5IGF A;  3G7L A;  3UI2 A;  2VUM B;  4OIK A;  5A2Q L;  2NN6 I;  4RGT A;  3AU7 A;  1D5M C;  1TKW B;  1HHV A;  3E0J A;  5IT9 E;  4CGY B;  1ICW A;  2OT2 A;  4XQN A;  4TRD A;  1BUV T;  1AW7 A;  1SBB B;  4ZKC B;  1AZQ A;  2JYO A;  1E0B A;  1DOK A;  1TR5 A;  1HFG A;  3NTI A;  5DM6 3;  5JVG 3;  1JWU D;  1Y69 U;  1I4P A;  5C4J B;  2RDF A;  1WTW A;  3ND8 A;  4KJO A;  1JOK A;  1KAA A;  5D3I B;  4EVO A;  5JVH 3;  2E2D C;  3E5S A;  3A7L A;  3BDL A;  2MUY A;  2KHS A;  1V43 A;  1SYF A;  1S5C D;  1SDF A;  2F0J A;  5EQ0 A;  1JWS D;  1EIG A;  1F9S A;  3LNN A;  1S5D D;  1F9Q A;  2XRQ D;  3C46 A;  2KJX A;  2EYL A;  2NVT B;  2E74 C;  4RWS C;  1QWY A;  1DXM A;  2NTS A;  5M9O A;  1V1O A;  4ZRZ A;  2BA1 A;  4BS9 A;  1CT1 D;  4IFD I;  2EXZ A;  1GUW A;  3HOV B;  2KED A;  3H0G B;  5CYU A;  2R92 B;  5IIF A;  1LT5 D;  2NVY B;  2KA7 A;  1UNS A;  4CBV A;  5M3F B;  4IUV A;  2RKS A;  1Q90 A;  1SNC A;  2BE5 C;  3V2T A;  1CHP D;  4OO1 I;  3W3A A;  5C0X I;  1ENA A;  4UDU C;  4G7H C;  2F0H A;  1M4V A;  1BF4 A;  4EQO A;  1U4P A;  1TY2 A;  1I4R A;  1DD2 A;  3PV0 A;  2Q8R E;  4K6D A;  4BA2 I;  3OWE B;  3NTK A;  1SAP A;  5EBC A;  5JOB A;  3S1Q B;  2A6H C;  1AFP A;  1NSN S;  1PTO H;  1QG7 A;  2HQE A;  1LAB A;  1BCP F;  2A5H A;  1G29 1;  2A74 C;  2LKV A;  4FYD A;  1L0X B;  4IQZ A;  1T5X D;  2B8G A;  4EGV A;  5CV7 A;  3K5O A;  2ICI A;  3DEO A;  2PZW A;  2J4X A;  4C3I B;  2PMZ B;  3GTG B;  3HOX B;  3FRP B;  4WJW A;  3D8G A;  1EWH A;  3BVG A;  1LT4 D;  2K5W A;  1WTQ A;  1D1K A;  3N6R A;  3BVZ A;  4X3U A;  4K8I A;  3U9S A;  1D5X C;  5EJW A;  2HDM A;  3FEW X;  2C5C A;  3WOF A;  1EY8 A;  1WD1 A;  3GV6 A;  2WAC A;  2NN6 H;  1KNE A;  2K01 A;  2E2I B;  2Z4I A;  3FKI B;  4DN4 M;  1GUG A;  4FF1 A;  4XYO A;  1II3 A;  2KCN A;  3D31 A;  1LT6 D;  3PMF A;  1TS5 A;  4FP5 D;  2EJG C;  1WTO A;  1XYI A;  1NUC A;  2BOS A;  4IUN A;  3HOU B;  2MP1 A;  3T13 A;  1Y8N B;  4QIW B;  2WV6 D;  4GZY C;  2PNR C;  5K36 G;  3MA2 B;  3D4R A;  3P7J A;  4FVM A;  2OEO A;  1CFM A;  5D3D A;  4KHZ A;  2A6H D;  2B2Y A;  1BXT A;  1H9J A;  1QOH A;  3GD7 A;  1YNJ C;  5IGC A;  3GV3 A;  4IAL A;  3NPP A;  5CV6 A;  3J7A F;  1CK1 A;  3DXJ C;  3OSO A;  4G7Z C;  3F2U A;  2R6G A;  1CTM A;  5I2Y A;  3J7Y W;  4KKT A;  2CW0 D;  1H9K A;  2AQ1 B;  2EYM A;  1STN A;  2J0T D;  3I4L A;  3T53 B;  3I91 A;  3L7Z C;  3GTJ B;  4V19 0;  5IT9 L;  3VR5 A;  1K8O A;  4ZUJ A;  1H9M A;  1XTC D;  2DN8 A;  3TME A;  5EPK A;  1FYC A;  2BDO A;  5E1F A;  3MC0 B;  3M4O B;  1SMY D;  2MGS A;  1BCP D;  1EZ8 A;  2F0W A;  3VYU A;  1B1Z A;  1D5Z C;  3MFY A;  2DY8 A;  5I9O A;  3SHL A;  1JCK B;  2K33 A;  3IL8 A;  1O7Z A;  1V8Q A;  5CMD A;  2F0O A;  2JA8 B;  3K0Y A;  2F0E A;  1C4Q A;  2L4N A;  2PYK A;  1G2T A;  4KV6 A;  5CV5 A;  3A8I E;  5EKL A;  3D6W A;  2F3W A;  4IN3 A;  4XQQ A;  4EQN A;  3HRZ C;  2IT1 A;  1S5F D;  1F77 A;  2XWB B;  1I4X A;  4AYB B;  3GO5 A;  1F9P A;  5K36 H;  1SXT A;  1G91 A;  2KVM A;  1TS4 A;  4DAV A;  4K2K A;  2CHB D;  3GTO B;  4DXG A;  4RKB A;  4C2M B;  5JPN C;  2F0G A;  5AFW A;  3P20 A;  5E4W C;  1PRT F;  3V05 A;  5I6W A;  3BDO A;  1FNW A;  3DWQ A;  2RVL A;  2B2W C;  3MFG A;  1ET6 A;  3CKI B;  2BDN A;  2JA6 B;  4RKL A;  4HR7 B;  1TY0 A;  1TQO A;  2K6A A;  1GUS A;  3VR2 A;  4WFN 3;  3J7A V;  1A6X A;  3MXP A;  1CZG A;  1KDB A;  4ZAI A;  3PUY A;  4K2L A;  1TII D;  1SJE D;  1ESF A;  3X3M A;  3S17 B;  1EZ6 A;  3GP7 A;  3M85 A;  4V0B A;  2XWJ B;  1PRT C;  2H4O A;  1U4L A;  2I46 A;  3HGB A;  2AWN A;  2KEC A;  3J80 L;  2EYF A;  3M3Y B;  5C3E B;  4IUQ A;  1X3P A;  3VR6 A;  1EEF D;  4KK7 A;  5FO7 B;  1B9N A;  3HG9 A;  4KY6 A;  2CQA A;  1MI2 A;  2O5I C;  3HS0 C;  4RCN A;  2F0I A;  1Z6H A;  3OMG A;  2RSN A;  1WCM B;  3EQL C;  4DK1 A;  1EY9 A;  4R9W A;  4X3S A;  2AQ2 B;  3ZYY X;  4H13 C;  4NKL A;  1RTO A;  3NE5 B;  1ROD A;  1IW7 D;  5COY A;  3R2T A;  2HDL A;  1G6Z A;  3TBI B;  2Z4H A;  1MSG A;  3TP6 A;  4MHE A;  2O2L D;  4BY1 B;  3DWP A;  1STH A;  3WOE A;  1HPC A;  2RSO A;  1B9M A;  4FO2 A;  1LTR D;  4PMC A;  4X3K A;  4PMB A;  2Z1C A;  3HOY B;  3KLR A;  1ZXT A;  3VYT A;  1F2L A;  5EKK A;  3S14 B;  1HTP A;  1PRT B;  3GTP B;  1IYU A;  3SK4 A;  2KQ3 A;  1C8C A;  4U67 3;  3SDZ A;  1AP0 A;  2V4D A;  3SK6 A;  5CBE E;  3K5L A;  4LK1 C;  3KBX A;  1SE4 A;  2B2T A;  3VYS A;  3K5N A;  4LJZ C;  4IUT A;  2SNM A;  2F0Q A;  3W2D A;  1PMR A;  1F9R A;  4HTH A;  3R3O A;  4J8Q A;  3VR4 A;  4KKU A;  4K6L A;  1SNP A;  1V1P B;  4HAE A;  3R93 A;  2B2W A;  2VB2 X;  4Y7N B;  5HGT A;  2EY5 A;  2F1M A;  5CGK A;  2K1B A;  3S9W A;  3RUZ A;  1SND A;  1B44 D;  3M7G A;  3P75 A;  3KLS A;  4B9X A;  2C9O A;  4C3J B;  3FMC A;  3DWA A;  3QB3 A;  4RFB A;  4A3J B;  2RQX A;  1I6H B;  1BBX C;  4XQJ A;  1HFN A;  3JAM E;  4XT1 B;  1YNN C;  4A3I B;  3P1H A;  1PDQ A;  3K57 A;  1GXD C;  3T4A C;  1DOM A;  5JEA H;  4DA2 A;  1I6V C;  5HUR A;  5IGE A;  4A3F B;  2BA0 A;  5A35 A;  1FNU A;  4QUF A;  1HTL D;  5D14 A;  2D9U A;  4RGM A;  4TSS A;  4I7Z C;  1SE2 A;  2FFK B;  4C3H G;  4O42 A;  2BCO A;  3SR1 A;  1EWC A;  3NWS A;  1RJT A;  1HUN A;  2PZU A;  5COR A;  2B2U C;  4NP5 A;  1Y1W B;  2NTT A;  1G2S A;  4FF4 A;  4XXE A;  2G9D A;  2K05 A;  4HCE A;  4ZK9 B;  1LTT D;  1MGS A;  1V1P A;  4M8A A;  3MXN A;  3KBG A;  3R8B A;  1JR0 D;  1H9R A;  4KD3 A;  2NYZ D;  3E6Z X;  1G8Z D;  1NR4 A;  4TQU S;  2NBF A;  2B2Y C;  1PLF A;  3ONA B;  2KUM A;  1EIH A;  2NN6 G;  4CKE A;  5C44 B;  2A6E C;  2L11 A;  2RA4 A;  2IW3 A;  3S15 B;  1LLR D;  3ERQ A;  4ODG A;  4BBS B;  2EY2 A;  2R3Z A;  4Z9C B;  4FF3 A;  5CC4 A;  2VNU D;  1SYB A;  1JE4 A;  3K7A B;  3URY A;  2A68 C;  2PPB C;  4M1U B;  2EYO A;  1MBY A;  3OHX C;  1WD0 A;  5C4H A;  3CRK C;  1U9R A;  4RH6 A;  1SYC A;  1S5E D;  5C6A A;  1SEB D;  5BN4 A;  3J81 E;  1TVX A;  2Y0S B;  3TZD A;  4G7O C;  2ID0 A;  3TP7 A;  1B4O A;  1I50 B;  2EOT A;  1HQM C;  3QWN A;  3QOL A;  3U9O A;  1FGB D;  3MXU A;  1EY0 A;  2EPB A;  3NXW A;  3EA6 A;  2QF7 A;  3QG1 A;  1IL8 A;  1O78 A;  2DY7 A;  1QNK A;  1EL0 A;  4IFD G;  4QF4 A;  3GTQ B;  5ELF A;  2K32 A;  5D65 A;  1HA6 A;  4K5W A;  2RDH A;  3N52 A;  3RZD B;  4S3S A;  3DEP A;  1WTV A;  4A93 B;  1J8I A;  4A3M B;  2L0C A;  4K5V A;  3CHB D;  1OXU A;  4OO1 G;  2F0T A;  5BN5 A;  2MHV A;  5FLX E;  1O80 A;  3EVQ A;  3K5M A;  1SJH D;  2F0F A;  1KNA A;  4C1N I;  1A2U A;  1RKN A;  1GUN A;  1RCV D;  2XSC A;  2F0V A;  5M5Y B;  1STG A;  2BE5 D;  4XDX A;  2B2U A;  5KGU A;  4RHS A;  4IFD J;  1AZP A;  1NAP A;  1QCB D;  1Y8O B;  2ICE C;  3SVM A;  3PIO 3;  5KRU A;  5EBD A;  4NMZ A;  5M3M B;  1FR3 A;  4F88 A;  5TSS A;  2R7Z B;  5C3X A;  1Q1B A;  2QDB A;  4I65 A;  4RGO S;  5ELC A;  1X3Q A;  5ISR A;  5C0X J;  2IJ0 A;  3C1E A;  1L0Y B;  4ZQ3 A;  5J22 A;  2A69 C;  4HSP A;  1SNO A;  5IOC A;  4ZUI A;  5I6Y A;  4KY5 A;  3SK5 A;  1O7Y A;  3BZD B;  1CQF A;  1S4Z A;  2Q8T A;  1TU2 B;  4IFD H;  2F0N A;  2WKC A;  3JAM L;  4KKS A;  4ZYS A;  2F03 A;  4A3B B;  4FXD A;  3L3O C;  4ABN A;  4DFA A;  2J7Z A;  4KTA A;  2EDG A;  3RLF A;  1HA5 A;  3C2P A;  3OPO A;  2WIN B;  5A2Q E;  3LX0 A;  1PTO C;  1EFI D;  4ZLT F;  1SYD A;  4OO1 H;  5C0X H;  1NCV A;  4A3D B;  1FD7 D;  4N9P A;  4KN4 C;  1Z7T A;  3HEJ A;  4BBR B;  1ZYR C;  4IUP A;  5FO9 B;  2K04 A;  2EY1 A;  4HCS A;  1VDZ A;  3I8Z A;  2R93 B;  5E4X A;  1OXS C;  3PUV A;  3H94 A;  5C4X B;  1RTN A;  1PZK D;  3NTH A;  1SE3 A;  3LWE A;  2WP8 J;  4N9T A;  4R8I A;  2WII B;  4XIG S;  3PUW A;  1EQT A;  3TN2 A;  4CJ1 B;  2B2T C;  3T56 B;  3D3R A;  2OF1 A;  4O1N A;  1YNJ D;  1RDP D;  3SK8 A;  4QCL A;  3A55 A;  1A3U A;  3S2H B;  1B2T A;  1CZW A;  1PYW D;  2F0U A;  3PUZ A;  1SSO A;  3MWY W;  5FK9 C;  4F87 A;  1AEX A;  2IL8 A;  3RMH A;  2LS0 1;  2A69 D;  1A15 A;  5LL6 X;  2RDG A;  2R61 A;  1WTR A;  1ILQ A;  1TWF B;  2LFN A;  4FF2 A;  4OIJ A;  2F4I A;  4FNF A;  2EYJ A;  3H09 A;  4KJN A;  1E2Z A;  1LTB D;  1GUO A;  2PO4 A;  2NUC A;  5FOB B;  1H9S B;  4ZKB B;  1OXX K;  1PTO B;  1DOL A;  3NBH A;  3IAY A;  1KDC A;  3MXG A;  4KI0 A;  1KAB A;  4PQX A;  3PUX A;  3OW7 A;  4G4K A;  4DGZ A;  4PNY A;  2O4X A;  3Q23 A;  1RD9 D;  1LTS D;  1CQV A;  1B50 A;  2OXP A;  3TP5 A;  1SYE A;  3MZ5 A;  1RF2 D;  2A73 B;  3A54 A;  3R2I A;  5CV9 A;  2PW5 A;  5E3F A;  2XIW A;  2E76 C;  2ZXP A;  3IKJ A;  4L63 B;  2F0D A;  4ME5 A;  5DEH A;  1DYQ A;  1STB A;  4LMQ D;  3H91 A;  1DCZ A;  3IFT A;  3EJI A;  1F2Y A;  4MN3 A;  1QB5 D;  5FKA C;  5KIX A;  1WTX A;  1K8M A;  1TWC B;  3OIQ A;  2JA7 B;  5JEA G;  5FO8 B;  1H9S A;  1B53 A;  3TP8 A;  1C48 A;  2X6L A;  1JIC A;  2NVQ B;  2DNE A;  3LWU A;  2M9V A;  2H1E A;  3MVV A;  2YYZ A;  2FHT A;  1CI3 M;  4DXF A;  3A8K E;  5CR3 A;  3C1F A;  1WVL A;  3BS1 A;  3BYY B;  3M7N A;  1U4M A;  1GHJ A;  5EPJ A;  3QO2 A;  3T16 A;  1RHP A;  3Q6S A;  2EJM A;  1QNU A;  4F7X A;  5LHY 1;  1E2W A;  2PQE A;  1EYA A;  1PRT D;  5G3L F;  4CJ0 B;  4R8N A;  4EQP A;  3S1M B;  5JEA J;  4DAY A;  1F2Z A;  1T5E A;  2JA5 B;  2X6G A;  2AQ3 B;  4UAI A;  1SYG A;  2IX1 A;  2L9H A;  4OGQ C;  1I4Q A;  1ML0 D;  4A3E B;  2EE1 A;  1B3A A;  2EYP A;  2I07 B;  4K8J A;  3MTS A;  5T1I A;  2VB3 X;  2WB1 B;  1U4R A;  2DNC A;  4IUU A;  2EZV A;  1ZKO A;  3EFX D;  2NB0 A;  2O5J C;  1VMC A;  5KEE A;  4G57 A;  2AUK A;  3C3L A;  1D6E C;  3HZX A;  2MJ8 A;  1SFO B;  1R4Q B;  2QKI C;  1TS2 A;  2D2C C;  2MPM A;  3AMU A;  1J9O A;  3NQI A;  4HN7 A;  3OWF A;  1JQY D;  1E2V A;  1R4P B;  1JOR A;  4WRD A;  1OXT A;  1HXY D;  4P2C B;  1BNZ A;  1TWA B;  1GJX A;  3QIA A;  4OHJ A;  3K59 A;  3ND9 A;  1Q12 A;  4MIU A;  1VF5 C;  4C1N K;  3I73 A;  1VF7 A;  3SXH A;  1EEI D;  5T1G A;  3G6J B;  5EKI A;  1VMP A;  5IGG A;  4JK1 C;  5I4D A;  1JB3 A;  5EGT A;  1Y8P B;  1EY7 A;  1K83 B;  4YIJ A;  4PMW A;  5J1Z A;  1O7L A;  3ERO A;  3NHH A;  1KTK A;  2RBM A;  5JJZ A;  5C4Z A;  1BDO A;  3DUZ A;  3A8J E;  2B2V C;  5I9P A;  2Z8L A;  3GTL B;  5EPL A;  3RD4 A;  4HMJ A;  5G3L D;  3H3V C;  3S1N B;  3S16 B;  5KYL A;  5DAU A;  1YNN D;  2K03 A;  5KYI A;  3OOC A;  2B63 B;  1ILP A;  2ZT9 C;  2HUG A;  2L12 A;  5CV4 A;  4XT3 B;  1D2B A;  1SNM A;  3FPU B;  1R9T B;  1CM9 A;  2TSS A;  4NW2 A;  4Q0F A;  4NDX A;  2XN9 C;  3I90 A;  1BQQ T;  2E2H B;  1TT2 A;  2IX0 A;  2JXM B;  2KCC A;  1S5B D;  3NK9 A;  3K6O A;  2EJF C;  4XYQ A;  4A3G B;  3QJY A;  2JE6 I;  1XXG A;  3NP8 A;  5KNB A;  2F0M A;  1I3Q B;  3CRL C;  3J80 E;  5F2D A;  3HOZ B;  2K5D A;  4A3K B;  2XRS D;  3AB9 A;  3MHB A;  2M00 A;  3WDN A;  1EYC A;  3V96 A;  3D6C A;  4DNR B;  2PCF B;  2CW0 C;  4L6T B;  4CHT B;  2A6E D;  4QB4 A;  1IHZ A;  5JPM C;  4WOR A;  1PZJ D;  5C0X G;  5CV8 A;  3I72 A;  2IPK D;  1OXV A;  1QJO A;  1SMY C;  4C3J G;  3QOJ A;  1BCP C;  2XNA C;  3KLS X;  2A68 D;  2KOL A;  2K28 A;  1FNV A;  5CBA E;  1W6K A;  1D1I A;  4BA1 I;  1I4G A;  2N88 A;  3SEB A;  4B9W A;  3GTK B;  1EOT A;  1ENF A;  3GQB A;  5DM7 3;  1ESR A;  4H0L C;  3GTM B;  3KF8 A;  4RGN A;  2GA4 B;  2JP1 A;  4U68 A;  2AWO A;  2SEB D;  4DNT B;  1GUT A;  2NZ1 D;  1Y1V B;  3O13 A;  4ID6 A;  3BYT B;  3RZO B;  1GHK A;  3HKZ B;  1Q8I A;  3I3C A;  2QEJ C;  3Q24 A;  3VR3 A;  5LL6 S;  4RCO A;  5JAV A;  4C56 C;  1JWM D;  1PTO F;  2B2V A;  3MEH A;  2JEA I;  3T51 B;  1HCZ A;  1PXU A;  3BG3 A;  1DON A;  2L5T A;  4F8M A;  5KND A;  3S2D B;  5M5W B;  4CJ2 C;  3OMC A;  5DNF A;  4K5X A;  2ZXO A;  2F3V A;  2VXW A;  5J39 A;  1IYV A;  4KY7 A;  1F2M A;  1EQV A;  1STY A;  1BCP B;  2EYH A;  2FJ2 A;  1PZI D;  1UEA B;  4X3T A;  5M5X B;  1A3T A;  3FPP A;  2EVB A;  1PFN A;  5C5L A;  2QIL A;  1LV9 A;  1DM0 B;  3BVM A;  3Q0A A;  1I4H A;  1HRJ A;  4CKC A;  2PW7 A;  3KUP A;  2SDF A;  4KN7 C;  1HQR D;  4HMI A;  3NWT A;  4TKO B;  3KK7 A;  3DM1 A;  1ZEQ X;  4QUC A;  2F0L A;  3DHQ A;  5IOD A;  2JEB I;  1SNQ A;  1Q1E A;  3PIP 3;  1EY6 A;  2M2L A;  1Z47 A;  3D4W A;  2NWG A;  4J1M A;  3VYR A;  4ULL A;  4KMU C;  1XWE A;  2PZT A;  5K5P A;  2FMC A;  2X69 A;  1X32 A;  2SOB A;  4E6I A;  1KDA A;  2YU9 B;  4OL7 A;  4C3I G;  1PFB A;  4FXG C;  5ELD A;  1MD2 D;  5NUC A;  4BWG B;  4LAA A;  1JOO A;  2NVX B;  3IFD A;  2D5D A;  5ELE A;  1DJR D;  3BDC A;  3VA5 A;  1M8A A;  1IW7 C;  3NUC A;  2K7V A;  3FVQ A;  1A2T A;  1ENC A;  1CA6 A;  1ONL A;  2EY6 A;  1A3V A;  1BOS A;  3J81 L;  1CA5 A;  3CU7 A;  4RHR A;  4HED A;  4C3H B;  1PTO D;  1EYD A;  1IKL A;  1BR9 A;  2LY7 A;  1MSH A;  2IX3 A;  1ZYR D;  4XTC S;  3NSW A;  3S1R B;  4K14 A;  2AUJ D;  1WTP A;  3DMU A;  1BO0 A;  1VCI A;  2ZXR A;  4Q5V A;  1KLG D;  5I2X A;  3PO3 B;  3HOW B;  1HUM A;  3ITP A;  1LT3 D;  2TMP A;  2HCI A;  4KHV A;  3A7A B;  2E75 C;  5IGD A;  1OO9 B;  1LAC A;  3NBI A;  5C3W A;  1EU3 A;  2F0S A;  3SE0 A;  5KNC A;  4IZ8 A;  1UUP A;  3D4D A;  2D62 A;  2FMM A;  3PO2 B;  4J6H A;  1DZ1 A;  3FDT A;  2B8F A;  2QCP X;  4FXK C;  1TWH B;  1STE A;  2L55 A;  1JOQ A;  2E2J B;  4DK0 A;  3I4N B;  3VA7 A;  5BN3 A;  5FLX L;  2L1B A;  3I70 A;  3I4M B;  1TS3 A;  3TZU A;  1EY4 A;  3L9A X;  1TWG B;  3MAQ A;  1UAP A;  4L8J A;  4BY7 B;  1QE6 A;  4H44 C;  2HCC A;  5ELB A;  2F0P A;  4DAP A;  1IKM A;  1JC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...