3MA2B

Complex membrane type-1 matrix metalloproteinase (mt1-mmp) with tissue inhibitor of metalloproteinase-1 (timp-1)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
124
structure length
117
Chain Sequence
CTCAPVHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFDIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITLCSFVAPWNSLSLAQRRGFTKTYTVGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Matrix metalloproteinase-14
publication title The Intrinsic Protein Flexibility of Endogenous Protease Inhibitor TIMP-1 Controls Its Binding Interface and Affects Its Function.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 117
sequence length 124
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3ma2B00
4FXKC 4ILWA 1XWEA 2E2DC 2I07B 2WINB 3MA2B 3OHXC 1OO9B 2QKIC 1BUVT 1D2BA 3FRPB 2XWBB 2A73B 5JPMC 2WIIB 3G6JB 3CU7A 1BQQT 4FXGC 1PXUA 1UAPA 3HS0C 3CKIB 1JB3A 2A74C 1GXDC 3T4AC 2J0TD 5FO7B 3KLSA 5FO8B 1JC7A 1UEAB 2ICEC 3V96A 5FOBB 2XWJB 2B39A 3L3OC 3HRZC 1BR9A 3I70A 5JPNC 2TMPA 5FO9B
chains in the Genus database with same CATH superfamily
1RKNA 4RKBA 1EL0A 4YY3L 3QO2A 3J81c 2RSNA 3S2DB 2PYKA 1PRTF 1F9PA 2N78A 4IJHA 4JBJA 5C44B 4LNQA 3K7AH 2E76C 1HR0Q 2WAQB 3SK5A 4QB4A 2XN9C 1VQ7A 4JI7L 5K36H 2CQAA 1B2TA 1TU2B 1O7IA 1K8AC 1T5XD 1L0YB 2NVQH 2OQ0A 4P71A 4BA2I 1VQFA 1LTGD 3P75A 1YNJD 3J80E 3PF4A 4R4TA 3J80i 1DOLA 3CCRA 1TWCB 2I07B 1B1ZA 2YYZA 3B6YA 4K8JA 5DM73 3PSIA 3UDXA 1SNCA 2HUGA 2O5IC 3EA6A 3RLOA 3DEOA 2ZJRA 1PH9A 5JEAJ 2BA1A 1EEFD 3ER0A 4JG2A 4XDXA 5FLMH 1NUCA 1PFBA 4DV7L 2UXDQ 1EIHA 3T53B 1XXGA 2RDGA 3BZDB 1WTRA 2B2WC 2ZT9C 3HG9A 1VQOA 3C1EA 3L3OC 3I70A 3IRBA 3S15B 4X62L 3T51B 1XPRA 2UXCL 4JV5L 1ENAA 1RL2A 2CVRA 3EVQA 1Q81C 2A19A 4IO9A 1N34L 1EY7A 1CT1D 3LWEA 2VQFL 1EZ6A 2EVBA 1PH7A 4JBMA 1SROA 4KHPQ 2F0DA 3NPPA 3AFQA 4GLVB 3KLWA 5KYIA 4R4OA 1L0WA 4K6LA 2K05A 1J6QA 3HOWG 2LY7A 1G6ZA 4B3MQ 1VDZA 3N52A 4KY6A 4MZ9A 3HFZB 3I73A 3K5LA 1BCPF 1NMGA 3MEFA 4XTCS 4WRDA 3TP7A 1PXUA 4KN7C 3CKIB 3L2PA 4JPBW 3I4NH 1JR0D 4GN3B 4BY7B 1IHZA 1SE2A 1HUMA 5AJ3Q 1PTOH 5C0XG 1XMOL 3CW2C 3SK8A 5JVG3 4UDUC 3S2HB 1UUPA 1W2BA 2A8VA 1Q1BA 4KY5A 1SNDA 2R93B 2B2YA 2WKCA 1L1OA 3K59A 4BXXH 3M3YB 2O4XA 4LFAQ 4DUZQ 4DR5L 1U4PA 4OELB 4L5TA 4NMZA 2NZOA 2K4KA 1BBWA 1O7ZA 1LUZA 3GTJB 1YNJC 1ESFA 2EJMA 2EPBA 4QGUA 3CC4A 4N9PA 2XIWA 2FHTA 5A2QL 3NE5B 2NN6H 4AIMA 5EPKA 2GVAA 3SE0A 5M3FG 2KEEA 1N8RC 5HGQA 1HQMC 1PTOD 4X3UA 2KA7A 2F0EA 1HUNA 1Y8PB 3SR1A 3KBXA 3DWPA 2ZTDA 2QA4A 3DHQA 2EXZA 3KLSA 3M4QA 3C2PA 2JQOA 3C1FA 3RLFA 2QEXA 3RZDH 2PMZB 5IT9E 1I3QH 4DV0L 3H94A 4HJAA 3I4MG 1HFNA 2QGQA 3VA7A 1S3OA 1Y8NB 3M7GA 1EY0A 1EFID 1NSNS 2F1MA 1X3EA 4DN4M 1IBLQ 2E8GA 1CFMA 4XIGS 1ASYA 1SMXA 2L55A 1HH2P 1MD2D 4EQNA 3OWEB 1KL9A 2OT2A 4A3FB 4BBRH 4UAIA 1EZ8A 4GN5A 2A6HD 4OONA 4C1NI 1TWFH 1NAPA 4DV3Q 3MHBA 3BVMA 2I5HA 1WTQA 1ESRA 1Q1EA 4K2KA 5M3MB 2NN6I 5GAHC 4IJLA 1AFPA 4DV2Q 1Q12A 1ENFA 1I4XA 1EQTA 4A3LH 3CPWA 4IUUA 3U9SA 3OW2A 1A8VA 1Q3LA 4HMIA 4LK1C 3NP8A 1N32L 3MFGA 3G6JB 1ET9A 5FLXL 1XTCD 4L5RC 2E2HB 1W6KA 5H1SE 1IBMQ 3N6RA 5G3LF 2O5JC 2NVXB 1ICFB 1NMFA 1YHAA 4WJ4A 4A3KG 2ES2A 1W3SA 2DNEA 2Q8IB 1K8OA 3UDFA 1AW7A 3A7AB 3NBHA 3CCSA 1Q46A 2L11A 3UI2A 3R2TA 4NXNQ 4O42A 5JPMC 4HTHA 1CSQA 2WIIB 5T1GA 2M9VA 4IPCA 1N36Q 1H9KA 3RR5A 3HOZB 3KLSX 3T4AC 1M1KC 4JI2Q 5BR8L 2YU9H 3BZKA 2MUYA 2F4VL 4J8QA 3M4YA 4MHEA 4IUVA 2BDOA 3KJOA 1MIUA 4HIKA 4XQQA 4A3IG 1XWEA 1STEA 3Q0AA 4AYBG 3X3MA 5BN4A 3R93A 2R7ZH 5KNDA 1PTOC 4DAVA 4LF8L 1XNRL 3KJPA 5DM63 1KXLA 5GADC 2MHVA 5DNFA 1DONA 3SK6A 2X6LA 3S1MB 4KHVA 1STGA 1KAWA 5C3EG 4LF9Q 1Y1WH 4GNXB 4HSVA 3HOXG 2IWHA 1SE3A 4CJ0B 4B9XA 3ERSX 3ND9A 1FJGL 3S16H 1NE3A 2PQAA 4DKAC 1JWUD 2A6HC 4RKLA 1CA5A 2HD3A 4A3EH 3CP0A 1HZAA 1G91A 5K36G 1I4GA 2XWJB 2JA9A 2MGSA 3I91A 1ZYRD 2FMCA 2K32A 5M5YB 1SR3A 4RCNA 1FNWA 2IHFA 4X3KA 2EY1A 2E2IH 3PUXA 4ZRZA 2HIXA 3D8GA 2EOTA 1GM5A 2R3ZA 4EVOA 1B3AA 2JA7B 3NBIA 2LS01 4QJFA 1ENCA 2F0PA 3PUVA 3SGIA 4A75A 5FKAC 1GKHA 4J15A 3VR4A 2KVMA 4MN3A 1TIID 3GTQH 5ELBA 1PRTB 4OX9L 4AYBE 1YJWA 4CBVA 1NCVA 3Q6SA 4KD4A 4I7AA 1KRTA 5C4HA 4HIDA 5C4ZA 2ID0A 2XVSA 5FLXc 1FD7D 4KN4C 2C9OA 4P74A 1UEAB 5KEEA 1I94Q 3DWAA 1NR4A 5FOBB 3S14B 1QVFA 4UHVA 1IBKL 2EYLA 4A93H 1I4RA 2DGYA 1AN8A 2KCTA 4KK7A 1GOZA 3TQYA 1CKNA 1VQAA 1QUQB 3TEHB 1QZHA 4KY7A 1CZWA 1WTOA 3T1YL 4JVZA 3IL8A 1VQ4A 1VMPA 2L12A 1SAPA 2CQOA 4GOPA 4F88A 4IFDJ 2RKSA 2A74C 3GTMB 2Q8RE 2VW9A 1B4OA 3NTIA 1Q82C 4LUVA 1WTPA 2AQ1B 5EQ0A 3CAMA 2X6GA 1TVXA 4Q5VA 4NP5A 3F8TA 1TWGH 1CUKA 1WJJA 4KD3A 1L0XB 3CCVA 1JQYD 1OXVA 4JI8Q 1PV4A 4YCWA 1F9SA 3Q8DA 5EKLA 2NVYH 4X66Q 3VYTA 4OEMB 3PIP3 2A1AA 4GNXC 1HFGA 3G6EA 1J8IA 1AEXA 1KD1C 3NTHA 4CJ1B 4BXXG 3OTOL 1PH8A 5HURA 1EIGA 3FVQA 3A5UA 1SRUA 4TVAB 4Y7NH 5NUCA 2WB1E 4Z9CB 3RZOB 3WDNA 3HOYH 1QE6A 3BDLA 1ZYRC 1K73C 1RJTA 2RQXA 3TMEA 1PDQA 2F0IA 4DV1Q 1B3QA 3HOWB 4IFDH 4ZUIA 2NN6G 4TSSA 1HZCA 4C3JH 5I2YA 1OTCA 1FNVA 1VQCA 3KF8B 3JAME 1MKHA 4DR4Q 4GS3A 4JI4L 3H3VH 4DGZA 4K0KL 1DZ1A 1KDCA 1XMQL 1HNWQ 1Y69U 1PHJA 1PMRA 4CGYB 4I7ZC 1JJCB 2OQKA 3J81L 5E3FA 2ATWA 3MXNA 3PO3H 2QKIC 1SJED 1X65A 3PF5A 1DXMA 1X56A 2DUDA 4ZKBB 1YITA 2Y0SG 2JA5H 1H9SA 1BQQT 2P5ZX 4X3TA 4BWGB 4QMGA 4UP9A 3Q23A 1Y1VH 3GTOB 1JMCA 2JN4A 4O1NA 4A3GH 1U4MA 4YHHQ 2Z6KA 1KHIA 4BBRG 1SE4A 5A35A 4HJ8A 3NWTA 4DV5Q 1PRTC 5L37A 4A3MH 5IYBH 1PLFA 5GROA 1DGSA 1ZXTA 3FMCA 3NENA 1PZKD 4IFDI 3T1HL 4ID6A 3OHXC 4DR3L 2KJXA 5CYUA 1G291 4GKKQ 2JEBI 2KOLA 5M3FB 2NVTB 2AWNA 1JE4A 1R4PB 5GAEC 4A3LG 1VQEA 2E5LQ 4DR7Q 3H3VI 2F0OA 3HS0C 2F0NA 1JT8A 1Q8KA 3OMGA 1YNND 4TKOB 1YJNA 2A6ED 4DR2L 3HOVG 4CKCA 3H6MA 2E2JH 1KLGD 2PO4A 2RDHA 2B63H 3I4MB 3BDOA 3BS1A 4JI1Q 5GAGC 2HT1A 3VYUA 1V1PA 3A5ZB 3ERQA 2ASBA 2JA6H 5JOBA 1YHQA 3PCOB 1U9RA 1S5CD 1STHA 3BZCA 1HA5A 3GTPH 4NW2A 4KKSA 1A3VA 1KTKA 2PMZE 3TP5A 4EGVA 1GHJA 3CQZH 2SEBD 1YHBA 1JWSD 3D0FA 3HGBA 1YVCA 1C9OA 1STBA 3PUWA 4LF5L 2LMCB 4DFAA 3E3XA 2JA8G 1Z9FA 1TS4A 1YIJA 2MJ8A 5KIXA 1K8GA 2ENBA 2M00A 1EYAA 3PQIA 1QCBD 4HN7A 4K2LA 3SHLA 2X69A 3E9HA 3X3NA 1SNOA 2B2VC 1QZGA 4F87A 4RHRA 1D1KA 5ELOA 3DM1A 3T56B 3BYTB 2IT1A 1EYGA 2PW7A 3QB3A 2K5DA 4DNRB 4DK6C 3J81i 2RVLA 2N49A 4C3HG 3ULPA 4FO2A 1I50B 1D5XC 1Y1WG 3NQIA 1H9MA 1SDFA 3SVMA 4OWXB 2L1BA 3FPUB 3VYSA 2MP1A 2AUJD 4U68A 4JK1C 1D8LA 1IKMA 3IFTA 1C48A 1DOKA 1EUJA 3GQBA 4H44C 5IP9H 1WCMH 1X32A 1SEBD 4FXGC 5IIFA 1VQNA 3I55A 3HOUG 2FINB 4JI3L 2EY2A 4E6IA 5FO8B 2MO0A 3S2DH 1WTHA 2R92H 5M5XB 4PZ7A 1XX8A 2LSSA 4IUQA 1YNXA 1K9MC 4A3EG 4B3SL 5LL6X 4M8AA 4IUTA 3PV0A 4KI0A 3W5OA 3I8ZA 1OXTA 4GKJL 4A3IB 3D31A 2DNCA 1BVSA 1TWAB 3A8IE 4G4KA 1EWIA 2L0CA 1EWHA 1TWCH 1K83H 4YIJA 3M4OH 3MEHA 1PH1A 1JB3A 4ODGA 4IZ8A 4C2MB 1N33Q 1L1OB 1JC7A 1YNNC 4U673 3GTGH 4HJ9A 2K50A 2PQEA 1VQ8A 2A6EC 3W1GA 4B3RL 5C3EB 1ICWA 3MXUA 5FO9B 1EYDA 1SYEA 2AQ3B 2FJ2A 3HOXB 2HHHL 4NXMQ 2I5MX 3NXWA 4PMWA 1HHVA 1EEID 1VQPA 4DR1Q 2NZHA 3NQTA 2VNUD 4XQNA 1JJ2A 2YTXA 1AE3A 4BY1B 3GTKB 4HJ7A 4IURA 2ZXPA 3W1BA 3S15H 5KNCA 1GUOA 3U58A 2G9HD 2B2WA 5JJIA 2Z0SA 3NSWA 3V96A 1S40A 5K5PA 4X6AH 4DAYA 1VQMA 3HRZC 5FJ8H 3PUZA 4DXFA 1S4ZA 4DK3C 4ZLTF 2F0LA 3URYA 1IKLA 1PYSB 4PNYA 2K14A 2IX3A 3E0EA 4A93G 1XNQQ 4MTNA 2K33A 4NDXA 4A76A 4BBSH 1Y14B 3CU7A 2DY7A 5ISRA 4LF6Q 4OO1I 4A3BB 1B8AA 1D6EC 1TWHB 4RCOA 2F52A 3OWFA 2K03A 2CWAA 2QDLA 5DAUA 5JEAH 2AQ2B 1KLUD 2EYOA 1HR0L 4JI5Q 3UE1A 3GP7A 2KUMA 3S2HH 5FK9C 4DK1A 4ZQ3A 3J7YW 2IW3A 2YTVA 1M8AA 3IKJA 4B08A 2HDMA 2PNHA 2EJGC 1NJIC 2R93H 1NBWA 4NPSA 4K5VA 3VR5A 1D7QA 3PIPA 4JI0L 2OCEA 4LF7Q 2UUAQ 3ND8A 5IYCH 3F2CA 5J3BA 2EYFA 4UY8C 3S17B 1SJHD 1DM0B 3FHWA 4JBKA 5GQOA 3FEWX 1CSPA 3GTJH 4FF2A 2WKDA 4XT3B 4IFDG 3NBHB 2F0JA 3M9BA 1A15A 2R61A 1PVOA 2K01A 4DF7A 1W6JA 3KYHC 1NR2A 4RWSC 2VUMB 5T1IA 1JE5A 2Q8TA 4WORA 2WACA 2QEJC 1TXYA 1E1OA 4HCSA 3PGZA 2F0GA 1G6PA 2AMCB 4KTAA 4DPGA 1X3PA 2UUBL 3DWQA 5KGUA 2K5HA 2B8GA 4KHPL 3RMHA 3NEMA 1L1OC 2JK8A 3I56A 4UPAA 2HIVA 3OOCA 3LNNA 2JA5G 2D9UA 4R9WA 2SOBA 1C7YA 1HQRD 5HY6A 1V9PA 1Y1VG 4B3ML 3A74A 3TZDA 4A3GG 4A3FH 4LF4Q 3J7A5 4QIWB 4A3MG 2NZ1D 1I6VC 1OO9B 2E75C 3ITPA 1LT3D 3R8BA 5M3MH 1H95A 5M5WH 1SMYD 2Z4HA 4N9TA 4AQYQ 1S72A 3KF6A 4POGA 1EYCA 4H7BA 5AJ3L 2GVBA 4MNOA 5C3WA 1VQLA 5I4DA 2CH4A 2PQAB 2PI2E 1LM0A 1GUWA 2PZWA 1RD9D 4EX5A 1HR0W 4A3JG 4FXDA 3AEVA 1HZ9A 4POFA 5C5MA 4L5SA 3FKIH 2UUCQ 2M2LA 5C6AA 1WFQA 1GD7A 1T5EA 4LFAL 2B63G 1G2TA 4DUZL 1VS0A 3KDFB 2JA6G 4HJ5A 2IHEA 1K3BC 3QWNA 2PNRC 2IX0A 5J39A 5LMNQ 1HRJA 4Q0FA 5KNBA 3QJYA 4N8FA 4RGTA 1UE1A 1STNA 2MPMA 4BBRB 2PZUA 1WD1A 1EOVA 1E2VA 3HOZH 3QIAA 5IT9c 1I6HB 5E4XA 2JYOA 3WWVA 2K5NA 1KQSA 3KFUA 4PMBA 4A3DH 2CWPA 2BDNA 1QNKA 1GUSA 2KHJA 2ICIA 2WP8J 5CV8A 2EXDA 3VR2A 4O2DA 1HJPA 3M4PA 5D14A 3ZYYX 5A2QE 4ME5A 4A3CH 2Q2HA 5CMDA 1IBLL 1PYBA 4X64Q 5HGTA 2VQEQ 4PV1C 2F0MA 2HDLA 2F0TA 1R9TB 3F2DA 3HOVB 4H02A 1KNAA 2V4DA 2VS1A 2VY3A 4IUPA 3TZUA 1JWMD 1CKNB 2IPKD 3UDGA 3F2UA 4DV3L 2EYPA 1YJ9A 3L9AX 5IP9G 1WCMG 2N88A 3CCJA 4NKLA 3LGJA 1B53A 4KHZA 4DV2L 4GOPB 4YWKA 1K0RA 4CDEC 1X54A 4IALA 1LTTD 2TMPA 1GVPA 1IXRA 1EY9A 2R92G 1EIFA 2ZTEA 5C4XB 1A2UA 1UE5A 3D6WA 4K14A 1MJCA 4IPGA 2JA8B 1HTLD 1R4QB 4FP5D 2WAQG 3DMUA 1HTPA 5CGKA 1IBML 1SMYC 4ME3A 5J22A 2OF1A 5JJZA 5CR3A 1NTGA 1MJEA 2YV5A 1D5ZC 4DV6Q 3HKZE 1I4PA 1VQ6A 3KLRA 1QVGA 1JOKA 1G51A 3BYYB 2F0QA 5IP7H 4LAAA 1IZ6A 2NBFA 4C3HB 2JA7H 1ET6A 1EY6A 4NXNL 2L15A 3KDFA 5FLXE 1SFOH 1N36L 3M7NA 2NTTA 1STYA 4JI2L 1Q8IA 5CV5A 5ELEA 5FO7B 5BN5A 3SK4A 3H15A 3Q22A 1HNZQ 1WTXA 3HOUB 3R3OA 4C3IB 2UXBQ 4K5XA 5FLMG 1VF7A 1VQHA 2WB1G 4DV4L 4KKUA 1X55A 3G71A 5TSSA 2OWOA 3CF5A 2XTIA 3MZ5A 2E74C 1I5FA 2NTSA 2BH8A 2B2UA 3A7LA 3RLNA 5FJ8G 3LWUA 3CC7A 5IGEA 3S14H 4L8JA 3MXNB 4LF9L 4PMCA 2K28A 3TP8A 1B7YB 3KK7A 3O13A 4BBSG 2CW0C 3MTSA 2K5VA 4A4IA 4DNTB 2ZM6Q 1E1TA 3R2IA 4G7HC 1H9SB 1ZEQX 4ZK9B 3UDIA 2E2IB 1X3GA 1PRTD 2AHOB 4LFBQ 1CHQD 1IL2A 4GLXA 1GJXA 2D62A 3CXCA 4QY7A 5JEAG 4DR6Q 2WAQE 2LXJA 1KDBA 5DEHA 4OIKA 1E3PA 1SLJA 2F3WA 2R7DA 2MNAA 1KAAA 3BDCA 1FGBD 2I46A 1CM9A 5EJWA 4FF4A 1B70B 3I4NG 2R93G 2ZJQA 1FR3A 1CQFA 2Z4IA 4R4IA 3MXGA 1F2MA 3K57A 1J5EQ 1A63A 2BA0A 1XPUA 3FRPB 5IYCG 3DEPA 2G9DA 1O78A 4A93B 5LMUQ 1ML0D 1Z47A 3VYRA 3RZOH 1A2TA 1V1PB 3I3CA 3TS0A 1HNXL 4GOPC 1TR5A 1PTOF 4ZUJA 5LL6S 1AH9A 3QOLA 4HEDA 4JW0A 1CI3M 4ZYSA 1PFSA 2LFNA 4HIMA 1BDOA 4JOIA 4PZ6A 1BOSA 2XNAC 3CC2A 1BCPB 1U4RA 4K5WA 4JI6Q 4DAMA 1BBXC 4TRDA 1PYWD 5COYA 1U4LA 1I94L 1TWGB 1RCVD 2KHSA 3EROA 2F3IA 1TY2A 2CH4W 2GA4B 2NVYB 5IWAQ 1BCPD 1VQGA 1XTDA 2Z6BA 3L7ZC 1V1OA 1AE2A 3P20A 3GTOH 1LTSD 4KLKA 3A8KE 4FNFA 4X65Q 4A3FG 2B2TC 5C5LA 1M4VA 2IL8A 4V0BA 2A73B 1PH3A 1HZBA 1G2SA 4RH6A 3MFYA 4OXPA 1O80A 1SN8A 1J9OA 2R7FA 3OMCA 1E24A 2RSOA 2NVTH 3I4OA 4M1UB 1KNEA 4QUCA 4R4CA 1K3RA 4FXKC 4X3SA 2E2DC 4HAEA 1X3FA 3J7AF 4JI8L 4LFCQ 3PO2H 4X66L 1F9RA 4B3TQ 2AWOA 3FKIG 3H91A 3MAQA 1K0SA 1MSHA 2QILA 2UU9Q 4DK0A 3GO5A 1LTLA 2HQLA 4CDCC 3J81j 3STBD 4DUYQ 3TSSA 5I9OA 3JAMc 2D2CC 5C4JH 1VQKA 3MXPA 4DV1L 2HCCA 3S1RH 3GV3A 4RHSA 1LV9A 4C56C 3TRZA 1U5KA 4DAPA 3H0GH 3NTKA 3OSOA 1NY4A 1EY4A 3J7ZC 2EZVA 2PPBC 4XYQA 1SBBB 5I2XA 2XRQD 1HNWL 1WYDA 4A3DG 1C8CA 3AU7A 4GZYC 1NNXA 3A0JA 3ULLA 1OXUA 4HCEA 4A3CG 3ICEA 3DM3A 1LACA 4A3JB 1LABA 3QOJA 1ASZA 3J80L 4DAYB 1H9JA 3A55A 3RN5A 4ZKCB 3E0JA 4YY3Q 1I50H 2R7ZG 5BN3A 2E2JB 4YHHL 2B63B 2Q2UA 4DV5L 2KHIA 2PI2A 4JCVE 3CMEA 3G4SA 2JA6B 3PIO3 3GTLB 4CHTB 4XXEA 2ZJPA 1CQVA 1VQDA 2L4NA 3D3RA 3J81E 2F0WA 4JI7Q 1LTBD 1BCPC 1I4HA 5E4WC 4BA1I 1DD2A 4GKKL 1HCZA 3CQZB 4YCVA 4UP7A 1SE8A 3K0XA 3DXJC 3P1HA 2E5LL 1JCKB 2F0SA 4A3KB 4DR7L 5M5XH 4WJWA 5G3LD 3S1NB 3TREA 5I9PA 1BBUA 2NVXH 1GXDC 1SNPA 1B9MA 2FFKB 4R8NA 5CORA 2K04A 1DOMA 1B9NA 1AP0A 1MI2A 4KJOA 4DV7Q 3AYHB 1RF2D 1KABA 4JI1L 2EDGA 5C44H 1I4QA 1SNMA 4DA2A 1MHWC 1E0BA 2B3GA 4OL7A 4X62Q 2EJFC 5IP7G 2UXCQ 3MC0B 1XPOA 5D65A 1BUVT 2F0HA 4JV5Q 1SYFA 4AYBB 2BOSA 3K5OA 3OPOA 3W3AA 2RBMA 1EQRA 2K1BA 5IODA 4GLAC 5J1ZA 1LTRD 3CCMA 1N34Q 4JBWA 4N8X1 1PZJD 3HOXH 2V1CC 2VQFQ 3S1QB 1FYCA 3STBC 5I6YA 5CV6A 1MGSA 2ZXOA 1ZKOA 4OO1H 2QF7A 1BF4A 1QG7A 4BY1H 3GDEA 1O7LA 2D0OA 1CA6A 1FGUA 2Q2IA 3CRKC 4EQPA 3V2TA 2R92B 2CFMA 3K7UC 3OIPA 5EPLA 3G7LA 4IQZA 2I5LX 4ULLA 1FL0A 1SYDA 4CDDC 1EOTA 2K5QA 4V190 5IE8A 1YI2A 3EBEA 4QUFA 4IOAA 1BR9A 2K5WA 1K83B 2O2LD 3K7AB 3EN2A 3UE0A 3M4OB 4IN3A 4G7OC 5IGCA 4JI0Q 1K8MA 2WINB 4I65A 2F03A 4HIOA 1XMOQ 4A3BH 5E7NA 3K8AA 3GTGB 1LT4D 1RODA 2NVQB 4J1MA 1TWHH 5LHY1 2NB0A 4MTKA 2KENA 2R6GA 5JVH3 4R4QA 4ZAIA 5ELCA 2C35B 4JYAL 4DR5Q 3D4DA 3QR8A 4FDBA 4B9WA 1EQVA 1A0IA 3KF6B 1UWVA 1WTVA 3I72A 5IT9L 1QILA 2WB1B 3Q24A 3CHBD 4BY7H 3BVGA 3J80c 2IX1A 4C1NK 3A56A 1X6OA 1RIPA 4ABNA 2UUBQ 1HPCA 4CKBA 2D0PA 1HXYD 1N33L 4HR7B 5EAYA 4P2CB 1XJVA 3D4RA 4NB3A 3S17H 1VQBA 1E2ZA 1VQIA 5EKKA 3RNUA 4BBSB 2F3VA 3MWYW 3HP3A 4NXML 3M3YH 4DR1L 4DV0Q 4LMQD 3CPFA 3P7JA 1YZ6A 4OHJA 4YCUA 2RHSB 2J4XA 2VB2X 3HOYG 4P73A 2VUMH 5CBEE 1S5ED 5CV4A 3BVZA 3WOEA 2UXDL 1M90C 2GN5A 2XSCA 5EKIA 3AB9A 4C3JG 3K5NA 4DU9A 1U0LA 1PH6A 1PZID 1D5MC 3I7FA 1TKWB 4R8IA 1PH2A 4LUZA 1XNQL 4BS9A 4G57A 2F0VA 2DY8A 1EU3A 3I4NB 1QVCA 3KOJA 1S5DD 1BXTA 2PCFB 3JC66 5EBCA 4LF6L 1S5FD 1P8LA 4P75A 4G7ZC 1PTOB 1KRSA 2B2YC 1XYIA 1IYVA 3PO3G 3TDQA 4L63B 1N32Q 3W2DA 1E7ZA 2RCNA 2DJFC 3CD6A 2WV6D 5DLQE 2SDFA 4OWTB 1V1QA 1A3UA 1LT6D 2EYHA 4JI5L 5IYBG 1LTAD 1BKBA 5CBAE 5D3IB 2RHQB 3E5SA 5IGFA 1VMCA 3PO2G 1Z6HA 4LF7L 1IW7D 1IYUA 3TBIB 4LJZC 4K6DA 2UUAL 5EGTA 2SNMA 5BR8Q 2F4VQ 2A5HA 4UP8A 1VQ9A 2JEAI 1KIXA 5EBDA 2NYZD 2RCFA 1EWCA 1GO3E 2E2HH 1CZGA 3E6ZX 3RZDB 3AFPA 1D1IA 1SXTA 1I3QB 3U4ZA 2F0UA 4LF8Q 4IPHA 1XNRQ 1LYLA 1GUTA 1BO0A 4H0LC 1VCIA 3EFXD 3H0GG 2JP1A 1I6HH 2FMMA 2Y0SB 3S24A 1OXXK 3HKZG 1DYQA 3K58A 3RD4A 5IY0A 5M5WB 1E22A 1TS5A 4OIJA 5KRUA 5M9OA 2L9HA 1AZQA 1TWFB 5F2DA 2EE1A 2J7ZA 1PFMA 5JAVA 2VL6A 2ZXRA 4EQOA 1FJGQ 2JSOA 1UEBA 1R9TH 3FKIB 3ZJYC 2IY5B 3HOVH 3K5MA 2CW0D 4LF4L 1TS2A 1A62A 1CHPD 3I90A 2Q2TA 2C5CA 4ILWA 3PIOA 1P16A 3D4WA 2L5TA 3S1MH 1F2ZA 1TQOA 2OEOA 2XWBB 4AQYL 3VDYA 4CJ2C 4Y52H 1GHKA 2QCPX 5C4XH 3E9IA 1QJOA 4L5QA 1H9RA 4KV6A 2JA8H 1S5BD 1Q90A 4A3DB 1A3TA 2UUCL 1DCZA 4WJ3M 3U4VA 4AH6A 4DV4Q 1Z7TA 2KCNA 2YU9B 1EIYB 1VQJA 5IGGA 5C44G 2HQEA 2CHBD 1SYCA 4XQJA 5LMNL 4OX9Q 1CKOA 2HCIA 3T16A 1LLRD 3I4LA 4QCLA 1V8QA 1JJGA 3H09A 4C3HH 5KYLA 1RHPA 3D6CA 2MO1A 2R7ZB 1IW7C 5M5YH 1O7YA 3OYYA 1B44D 1C4QA 3CCQA 4IPDA 4OO1G 4BY1G 1K28A 1QWYA 2N55A 4RA8A 1IBKQ 1Y1WB 1VF5C 5AFWA 3HOUH 1RTNA 2WFWA 4C3IH 4ZCKA 4P72A 2IJ0A 1EY5A 3T1YQ 1E2WA 2NUCA 1UE6A 4O0AA 1X3QA 2J0TD 5IYDH 3V05A 4X64L 3OW7A 2VQEL 1WTWA 4RFBA 3S16B 4TQUS 4APVA 2I0QA 2F4IA 4QF4A 4YWMA 2A69D 4XYOA 5IOCA 4A3EB 1T9HA 4A3BG 3HEJA 3TN2A 2ZTCA 3CCLA 2QW7A 1LO5D 4FYDA 1VQ5A 1SFOB 1HNXQ 3JAML 1YEZA 2OTJA 2B39A 3OTOQ 1TS3A 2EYJA 4KMUC 3AMUA 4J6HA 3ONAB 5JJLA 1SNQA 1JORA 2AUKA 3GTMH 2B2UC 2N3SA 1Q7YC 2XGTA 3GTQB 2VB3X 2BH2A 4BY7G 4DV6L 1GUNA 1UAPA 2FXQA 4HMJA 5JJKA 3K80C 1WOCA 2QDBA 4LW1A 2YTYA 3BU2A 3OIQA 2G5DA 5C3XA 2A68D 3NWSA 1C0AA 1F2YA 2ICEC 4IUNA 2DN8A 4RG1A 5IGBA 4F7XA 4JI4Q 2Z8LA 4K0KQ 4KKTA 1EY8A 5LMNW 1XMQQ 2OXPA 1LT5D 1ILQA 5C0XJ 3BG3A 1QOHA 4RGMA 4PZ8A 4RGNA 2EYMA 3WOFA 1ILPA 1DJRD 1Y8OB 3NK9A 1BNZA 4PQXA 4GNXA 5E1FA 5CV9A 1HNZL 1PFNA 2K6AA 2VUMG 2UXBL 3J7AV 2N8NA 1IL8A 3T13A 3HOWH 2XRSD 4DXGA 2VXWA 5ELDA 5CC4A 3KBGA 1SYBA 2EIFA 2PW5A 3IFDA 1G8ZD 4FF3A 4XT1B 3MA2B 3NELA 3EIVA 3GV6A 1X9NA 5IGDA 4ALPA 1ONLA 3I2ZA 1B50A 3T1HQ 2JXMB 4DR3Q 1GUGA 3F1ZA 2B29A 4GN4B 2ZM6L 2NWGA 3SXHA 3CCUA 3GD7A 3KUPA 1PH4A 3TS2A 4HSPA 5C0XH 2F0FA 2ALYB 3RUZA 4LFBL 3QG1A 3A54A 1KC8C 2Z1CA 4LUOA 2K7VA 2K75A 2A69C 2B2TA 4EQ5A 4DR2Q 4JOIC 1WD0A 4DR6L 5EPJA 3K81C 4Y7NB 1SSOA 2KBNA 2H4OA 4FF1A 1TY0A 2D5DA 3JAMi 1F2LA 5I6WA 1V43A 3HOYB 3EQLC 3CMAA 5ELFA 1FVIA 2RDFA 5M3MG 1KDAA 2JJQA 3PUYA 3F2BA 1MSGA 5M3FH 4C3JB 1J5EL 2JE6I 3K6OA 4DNIA 2RF4A 3BJUA 4LF5Q 1RDPD 3C46A 1CKMA 1CK1A 3M85A 3CRLC 2TSSA 3CCEA 5LMUL 3PMFA 3FPPA 4FVMA 1Q86C 1L2FA 4OGQC 5C0XI 1TT2A 3I4MH 4JC0A 3S9WA 1N9WA 2A68C 3K0YA 3PO3B 3AQQA 4WFN3 2BCOA 2Z6KC 3SEBA 1QUQA 4R1JA 4JI6L 1EU4A 2JA5B 2BE5D 2RA4A 1WVLA 1YBYA 3SDZA 1JOOA 1Y1VB 2KCMA 4A3GB 5CV7A 2F0KA 4RGOS 5D3DA 3HOZG 4A3MB 4DR4L 2SNSA 4LWCA 2K52A 4KJNA 4A3JH 3PO2B 1HA6A 2B8FA 5IWAL 1JB7A 3A8JE 4CKEA 2CCZA 4JI3Q 2KCCA 4QIWE 4X65L 2H1EA 2EY5A 2CKZB 3L0OA 2Z9HA 2KECA 4MIUA 1AZPA 2MFIA 1MBYA 3NUCA 4B3SQ 3GTLH 2KEDA 4S3SA 1D2BA 1RTOA 3VR6A 5C4JB 2B2VA 3ULJA 4GKJQ 3S1RB 1F9QA 1JICA 1FNUA 3U50C 3FDTA 4PG3A 4K8IA 1JOQA 3DLLA 3MVVA 4A3KH 3U9OA 5C4XG 3H0GB 3S1NH 1SYGA 3GTPB 3HZXA 4LFCL 3HKZB 4B3TL 4B3RQ 3RN2A 3KF8A 4OWWB 1PH5A 1II3A 3FP9A 2UU9L 2KQ3A 1UNSA 2HHHQ 1EFWA 4RAUC 1WI5A 2Y0SE 1LTID 3VR3A 4DUYL 4IOCA 3VA5A 4CDFC 3C3LA 2H5XA 4A3IH 4QQBX 1TWAH 5JPNC 3HKSA 2LKVA 2PZTA 2VZAA 1IYJB 3S1QH 3IAYA 3EJIA 4C2MH 1EQQA 2DJGC 1QNUA 1CTMA 1UE7A 2MQHA 4QL5A 4F8MA 2JA7G 2OTLA 5C3EH 2LXKA 4RMFA 3NHHA 4L6TB 4C3IG 1A6XA 1QB5D 2AKWB 4YWLA 5ELNA 2EQSA 3DUZA 4H13C 1F77A 1PA6A 3G48A 5IYDG 1STAA 3GTKH 3H3VC 2BE5C 2EY6A 1WCMB 4JYAQ 1OXSC 3LX0A 3TP6A
chains in the Genus database with same CATH topology
1RKNA 4RKBA 1EL0A 3QO2A 2RSNA 3S2DB 2PYKA 1PRTF 1F9PA 5C44B 2E76C 2WAQB 3SK5A 4QB4A 2XN9C 5K36H 2CQAA 1B2TA 1TU2B 1T5XD 1L0YB 4BA2I 1LTGD 3P75A 1YNJD 3J80E 1DOLA 1TWCB 2I07B 1B1ZA 2YYZA 4K8JA 5DM73 1SNCA 2HUGA 2O5IC 3EA6A 3DEOA 5JEAJ 2BA1A 1EEFD 4XDXA 1NUCA 1PFBA 1EIHA 3T53B 1XXGA 2RDGA 3BZDB 1WTRA 2B2WC 2ZT9C 3HG9A 3C1EA 3L3OC 3I70A 3S15B 3T51B 1ENAA 2CVRA 3EVQA 1EY7A 1CT1D 3LWEA 1EZ6A 2EVBA 2F0DA 3NPPA 5KYIA 4K6LA 2K05A 2LY7A 1G6ZA 1VDZA 3N52A 4KY6A 3I73A 3K5LA 1BCPF 4XTCS 4WRDA 3TP7A 1PXUA 4KN7C 3CKIB 4BY7B 1JR0D 1IHZA 1SE2A 1HUMA 1PTOH 5C0XG 3SK8A 5JVG3 4UDUC 3S2HB 1UUPA 1Q1BA 4KY5A 1SNDA 2R93B 2B2YA 2WKCA 3K59A 3M3YB 2O4XA 1U4PA 4NMZA 1O7ZA 3GTJB 1YNJC 1ESFA 2EJMA 2EPBA 4N9PA 2XIWA 2FHTA 5A2QL 3NE5B 2NN6H 5EPKA 3SE0A 2KEEA 1HQMC 1PTOD 4X3UA 2KA7A 2F0EA 1HUNA 1Y8PB 3SR1A 3KBXA 3DWPA 3DHQA 2EXZA 3KLSA 3C2PA 3C1FA 3RLFA 2PMZB 5IT9E 3H94A 1HFNA 3VA7A 1Y8NB 3M7GA 1EY0A 1EFID 1NSNS 2F1MA 4DN4M 1CFMA 4XIGS 2L55A 1MD2D 4EQNA 3OWEB 2OT2A 4A3FB 4UAIA 1EZ8A 2A6HD 4C1NI 1NAPA 3MHBA 3BVMA 1WTQA 1ESRA 1Q1EA 4K2KA 5M3MB 2NN6I 1AFPA 1Q12A 1ENFA 1I4XA 1EQTA 4IUUA 3U9SA 1Q3LA 4HMIA 4LK1C 3NP8A 3MFGA 3G6JB 1ET9A 5FLXL 1XTCD 2E2HB 1W6KA 3N6RA 5G3LF 2O5JC 2NVXB 2DNEA 2Q8IB 1K8OA 1AW7A 3A7AB 3NBHA 2L11A 3UI2A 3R2TA 4O42A 5JPMC 4HTHA 2WIIB 5T1GA 2M9VA 1H9KA 3HOZB 3KLSX 3T4AC 2MUYA 4J8QA 3M4YA 4MHEA 4IUVA 2BDOA 4XQQA 1XWEA 1STEA 3Q0AA 3X3MA 5BN4A 3R93A 5KNDA 1PTOC 4DAVA 5DM63 2MHVA 5DNFA 1DONA 3SK6A 2X6LA 3S1MB 4KHVA 1STGA 4HSVA 2IWHA 1SE3A 4CJ0B 4B9XA 3ND9A 1JWUD 2A6HC 4RKLA 1CA5A 1G91A 5K36G 1I4GA 2XWJB 2MGSA 3I91A 1ZYRD 2FMCA 2K32A 5M5YB 4RCNA 1FNWA 4X3KA 2EY1A 3PUXA 4ZRZA 3D8GA 2EOTA 2R3ZA 4EVOA 1B3AA 2JA7B 3NBIA 2LS01 1ENCA 2F0PA 3PUVA 5FKAC 3VR4A 2KVMA 4MN3A 1TIID 5ELBA 1PRTB 4CBVA 1NCVA 3Q6SA 4KD4A 5C4HA 5C4ZA 2ID0A 2XVSA 1FD7D 4KN4C 2C9OA 5KEEA 1UEAB 3DWAA 1NR4A 5FOBB 3S14B 2EYLA 1I4RA 1AN8A 4KK7A 1GOZA 4KY7A 1CZWA 1WTOA 3IL8A 1VMPA 2L12A 1SAPA 4F88A 4IFDJ 2RKSA 2A74C 3GTMB 2Q8RE 1B4OA 3NTIA 1WTPA 2AQ1B 5EQ0A 2X6GA 1TVXA 4Q5VA 4NP5A 4KD3A 1L0XB 1JQYD 1OXVA 1F9SA 5EKLA 3VYTA 3PIP3 1HFGA 1J8IA 1AEXA 3NTHA 4CJ1B 5HURA 1EIGA 3FVQA 5NUCA 4Z9CB 3RZOB 3WDNA 1QE6A 3BDLA 1ZYRC 1RJTA 2RQXA 3TMEA 1PDQA 2F0IA 3HOWB 4IFDH 4ZUIA 2NN6G 4TSSA 5I2YA 1FNVA 3JAME 1DZ1A 4DGZA 1KDCA 1Y69U 1PMRA 4CGYB 4I7ZC 3J81L 5E3FA 3MXNA 2QKIC 1SJED 1DXMA 4ZKBB 1H9SA 1BQQT 4X3TA 4BWGB 4QMGA 3Q23A 3GTOB 4O1NA 1U4MA 1SE4A 5A35A 3NWTA 1PRTC 1PLFA 1ZXTA 3FMCA 1PZKD 4IFDI 4ID6A 3OHXC 2KJXA 5CYUA 1G291 2NVTB 2JEBI 2KOLA 5M3FB 2AWNA 1JE4A 1R4PB 2F0OA 3HS0C 2F0NA 3OMGA 1YNND 4TKOB 2A6ED 4CKCA 3H6MA 1KLGD 2PO4A 2RDHA 3I4MB 3BDOA 3BS1A 3VYUA 1V1PA 3ERQA 5JOBA 1U9RA 1S5CD 1STHA 1HA5A 4NW2A 4KKSA 1A3VA 1KTKA 3TP5A 4EGVA 1GHJA 2SEBD 1JWSD 3HGBA 1STBA 3PUWA 2LMCB 4DFAA 1TS4A 2MJ8A 5KIXA 2ENBA 2M00A 1EYAA 1QCBD 4HN7A 4K2LA 3SHLA 2X69A 3X3NA 1SNOA 2B2VC 4F87A 4RHRA 1D1KA 3DM1A 3T56B 3BYTB 2IT1A 2PW7A 3QB3A 2K5DA 4DNRB 2RVLA 4C3HG 4FO2A 1I50B 1D5XC 3NQIA 1H9MA 1SDFA 3SVMA 2L1BA 3FPUB 3VYSA 2MP1A 2AUJD 4U68A 4JK1C 1IKMA 3IFTA 1C48A 1DOKA 3GQBA 4H44C 1X32A 1SEBD 4FXGC 5IIFA 2FINB 2EY2A 4E6IA 5FO8B 5M5XB 1XX8A 4IUQA 5LL6X 4M8AA 4IUTA 3PV0A 4KI0A 3I8ZA 1OXTA 4A3IB 3D31A 2DNCA 1TWAB 3A8IE 4G4KA 2L0CA 1EWHA 4YIJA 3MEHA 1JB3A 4ODGA 4IZ8A 4C2MB 1JC7A 1YNNC 4U673 2PQEA 2A6EC 5C3EB 1ICWA 3MXUA 5FO9B 1EYDA 1SYEA 2AQ3B 2FJ2A 3HOXB 3NXWA 4PMWA 1HHVA 1EEID 3NQTA 2VNUD 4XQNA 4BY1B 3GTKB 4IURA 2ZXPA 5KNCA 1GUOA 2G9HD 2B2WA 3NSWA 3V96A 5K5PA 4DAYA 3HRZC 3PUZA 4DXFA 1S4ZA 4ZLTF 2F0LA 3URYA 1IKLA 4PNYA 2IX3A 2K33A 4NDXA 3CU7A 2DY7A 5ISRA 4OO1I 4A3BB 1D6EC 1TWHB 4RCOA 3OWFA 2K03A 5JEAH 5DAUA 2AQ2B 1KLUD 2EYOA 3GP7A 2KUMA 5FK9C 4DK1A 4ZQ3A 3J7YW 2IW3A 1M8AA 3IKJA 4B08A 2HDMA 2EJGC 4K5VA 3VR5A 3ND8A 2EYFA 3S17B 1SJHD 1DM0B 3FEWX 4FF2A 2WKDA 4XT3B 4IFDG 2F0JA 1A15A 2R61A 2K01A 4DF7A 1W6JA 1NR2A 4RWSC 2VUMB 5T1IA 2Q8TA 4WORA 2WACA 2QEJC 4HCSA 2F0GA 4KTAA 1X3PA 3DWQA 5KGUA 2B8GA 3RMHA 3OOCA 3LNNA 2D9UA 4R9WA 2SOBA 1HQRD 3TZDA 4QIWB 2NZ1D 1I6VC 1OO9B 2E75C 3ITPA 1LT3D 3R8BA 1SMYD 2Z4HA 4N9TA 1EYCA 4H7BA 5C3WA 5I4DA 1GUWA 2PZWA 1RD9D 4FXDA 5C5MA 2M2LA 5C6AA 1T5EA 1G2TA 3QWNA 2PNRC 2IX0A 5J39A 1HRJA 4Q0FA 5KNBA 3QJYA 4RGTA 1STNA 2MPMA 4BBRB 2PZUA 1WD1A 1E2VA 3QIAA 1I6HB 5E4XA 2JYOA 4PMBA 2BDNA 1QNKA 1GUSA 2ICIA 2WP8J 5CV8A 3VR2A 3ZYYX 5D14A 5A2QE 4ME5A 5CMDA 5HGTA 4PV1C 2F0MA 2HDLA 2F0TA 1R9TB 3HOVB 1KNAA 2V4DA 4IUPA 3TZUA 1JWMD 2IPKD 3F2UA 2EYPA 3L9AX 2N88A 4NKLA 1B53A 4KHZA 4IALA 1LTTD 2TMPA 1EY9A 5C4XB 1A2UA 3D6WA 4K14A 2JA8B 1HTLD 1R4QB 4FP5D 3DMUA 1HTPA 5CGKA 1SMYC 5J22A 2OF1A 5JJZA 5CR3A 1D5ZC 1I4PA 3KLRA 1JOKA 3BYYB 2F0QA 4LAAA 2NBFA 4C3HB 1ET6A 1EY6A 5FLXE 3M7NA 2NTTA 1STYA 1Q8IA 5CV5A 5ELEA 5FO7B 5BN5A 3SK4A 3Q22A 1WTXA 3HOUB 3R3OA 4C3IB 4K5XA 1VF7A 4KKUA 5TSSA 3MZ5A 2E74C 2NTSA 3A7LA 2B2UA 3LWUA 5IGEA 4L8JA 4PMCA 2K28A 3TP8A 3KK7A 3O13A 2CW0C 3MTSA 4DNTB 3R2IA 4G7HC 1H9SB 1ZEQX 4ZK9B 2E2IB 1PRTD 1CHQD 1GJXA 2D62A 5JEAG 1KDBA 5DEHA 4OIKA 2F3WA 1KAAA 3BDCA 1FGBD 2I46A 1CM9A 5EJWA 4FF4A 1FR3A 1CQFA 2Z4IA 3MXGA 1F2MA 3K57A 2BA0A 3FRPB 3DEPA 2G9DA 1O78A 4A93B 1ML0D 1Z47A 3VYRA 1A2TA 1V1PB 3I3CA 1TR5A 1PTOF 4ZUJA 5LL6S 3QOLA 4HEDA 1CI3M 4ZYSA 2LFNA 1BDOA 1BOSA 2XNAC 1BCPB 1U4RA 4K5WA 1BBXC 4TRDA 1PYWD 5COYA 1U4LA 1TWGB 1RCVD 2KHSA 3EROA 1TY2A 2GA4B 2NVYB 1BCPD 3L7ZC 1V1OA 3P20A 1LTSD 3A8KE 4FNFA 2B2TC 5C5LA 1M4VA 2IL8A 4V0BA 2A73B 1G2SA 4RH6A 3MFYA 1O80A 1J9OA 3OMCA 2RSOA 4M1UB 1KNEA 4QUCA 4FXKC 4X3SA 2E2DC 4HAEA 3J7AF 1F9RA 2AWOA 3H91A 3MAQA 1MSHA 2QILA 4DK0A 3GO5A 3TSSA 5I9OA 2D2CC 3MXPA 2HCCA 3GV3A 4RHSA 1LV9A 4C56C 4DAPA 3NTKA 3OSOA 1EY4A 2EZVA 2PPBC 4XYQA 1SBBB 5I2XA 2XRQD 1C8CA 3AU7A 4GZYC 1OXUA 4HCEA 1LACA 4A3JB 1LABA 3QOJA 3J80L 1H9JA 3A55A 4ZKCB 3E0JA 2E2JB 5BN3A 2B63B 2JA6B 3PIO3 3GTLB 4CHTB 4XXEA 1CQVA 3D3RA 2L4NA 3J81E 2F0WA 1LTBD 1BCPC 1I4HA 5E4WC 4BA1I 1DD2A 1HCZA 3CQZB 3P1HA 3DXJC 1JCKB 2F0SA 4A3KB 4WJWA 5G3LD 3S1NB 5I9PA 1GXDC 1SNPA 1B9MA 2FFKB 4R8NA 5CORA 2K04A 1DOMA 1B9NA 1AP0A 1MI2A 4KJOA 1RF2D 1KABA 2EDGA 1I4QA 1SNMA 4DA2A 1E0BA 4OL7A 2EJFC 3MC0B 5D65A 1BUVT 2F0HA 1SYFA 4AYBB 2BOSA 3K5OA 3OPOA 3W3AA 2RBMA 2K1BA 5IODA 5J1ZA 1LTRD 4JBWA 1PZJD 3S1QB 1FYCA 5I6YA 5CV6A 1MGSA 2ZXOA 1ZKOA 4OO1H 2QF7A 1BF4A 1QG7A 1O7LA 1CA6A 3CRKC 4EQPA 3V2TA 2R92B 3OIPA 5EPLA 3G7LA 4IQZA 4ULLA 1SYDA 1EOTA 2K5QA 4V190 4QUFA 1BR9A 2K5WA 1K83B 2O2LD 3K7AB 3M4OB 4G7OC 4IN3A 5IGCA 1K8MA 2WINB 4I65A 2F03A 3GTGB 1LT4D 1RODA 2NVQB 4J1MA 5LHY1 2NB0A 2R6GA 5JVH3 4ZAIA 5ELCA 3D4DA 4B9WA 1EQVA 1WTVA 3I72A 5IT9L 1QILA 2WB1B 3Q24A 3CHBD 3BVGA 2IX1A 4C1NK 3A56A 4ABNA 1HPCA 4CKBA 1HXYD 4HR7B 4P2CB 3D4RA 1E2ZA 5EKKA 4BBSB 2F3VA 3MWYW 3HP3A 4LMQD 3P7JA 4OHJA 2J4XA 2VB2X 5CBEE 1S5ED 5CV4A 3BVZA 3WOEA 2XSCA 5EKIA 3AB9A 4C3JG 3K5NA 4DU9A 1PZID 1D5MC 1TKWB 4R8IA 4BS9A 4G57A 2F0VA 2DY8A 1EU3A 3I4NB 1S5DD 1BXTA 2PCFB 5EBCA 1S5FD 4G7ZC 1PTOB 2B2YC 1XYIA 1IYVA 3TDQA 4L63B 3W2DA 2WV6D 2SDFA 1A3UA 1LT6D 2EYHA 1LTAD 5CBAE 5D3IB 3E5SA 5IGFA 1VMCA 1Z6HA 1IW7D 1IYUA 3TBIB 4LJZC 4K6DA 5EGTA 2SNMA 2A5HA 2JEAI 5EBDA 2NYZD 1EWCA 1CZGA 3E6ZX 3RZDB 1D1IA 1SXTA 1I3QB 2F0UA 1GUTA 1BO0A 4H0LC 1VCIA 3EFXD 2JP1A 2FMMA 2Y0SB 1OXXK 1DYQA 3K58A 3RD4A 5M5WB 1TS5A 4OIJA 5KRUA 5M9OA 2L9HA 1AZQA 1TWFB 5F2DA 2EE1A 2J7ZA 1PFMA 5JAVA 2ZXRA 4EQOA 2JSOA 3FKIB 3K5MA 2CW0D 1TS2A 1CHPD 3I90A 2C5CA 4ILWA 3D4WA 2L5TA 1F2ZA 1TQOA 2OEOA 2XWBB 4CJ2C 1GHKA 2QCPX 1QJOA 1H9RA 4KV6A 1S5BD 1Q90A 4A3DB 1A3TA 1DCZA 1Z7TA 2KCNA 2YU9B 5IGGA 2HQEA 2CHBD 1SYCA 4XQJA 2HCIA 3T16A 1LLRD 3I4LA 4QCLA 1V8QA 3H09A 5KYLA 1RHPA 3D6CA 2R7ZB 1IW7C 1O7YA 1B44D 1C4QA 4OO1G 1QWYA 2N55A 4RA8A 1Y1WB 1VF5C 5AFWA 1RTNA 2IJ0A 1EY5A 1E2WA 2NUCA 1X3QA 2J0TD 3V05A 3OW7A 1WTWA 4RFBA 3S16B 4TQUS 2F4IA 4QF4A 2A69D 4XYOA 5IOCA 4A3EB 3HEJA 3TN2A 1LO5D 4FYDA 1SFOB 3JAML 2B39A 1TS3A 2EYJA 4KMUC 3AMUA 4J6HA 3ONAB 1SNQA 1JORA 2AUKA 2B2UC 3GTQB 2VB3X 1GUNA 1UAPA 4HMJA 2QDBA 3OIQA 5C3XA 2A68D 3NWSA 1F2YA 2ICEC 4IUNA 2DN8A 5IGBA 4F7XA 2Z8LA 4KKTA 1EY8A 2OXPA 1LT5D 1ILQA 5C0XJ 3BG3A 1QOHA 4RGMA 4RGNA 2EYMA 3WOFA 1ILPA 1DJRD 1Y8OB 3NK9A 1BNZA 4PQXA 5E1FA 5CV9A 1PFNA 2K6AA 3J7AV 1IL8A 3T13A 2XRSD 4DXGA 2VXWA 5ELDA 5CC4A 3KBGA 1SYBA 2PW5A 3IFDA 4FF3A 1G8ZD 4XT1B 3MA2B 3GV6A 5IGDA 1ONLA 1B50A 2JXMB 1GUGA 2NWGA 3SXHA 3GD7A 3KUPA 4HSPA 5C0XH 2F0FA 3RUZA 3QG1A 3A54A 2Z1CA 2K7VA 2A69C 2B2TA 1WD0A 5EPJA 4Y7NB 1SSOA 2H4OA 4FF1A 1TY0A 2D5DA 1F2LA 5I6WA 1V43A 3HOYB 3EQLC 5ELFA 2RDFA 1KDAA 3PUYA 1MSGA 4C3JB 2JE6I 3K6OA 1RDPD 3C46A 1CK1A 3M85A 3CRLC 2TSSA 3PMFA 3FPPA 4FVMA 4OGQC 5C0XI 1TT2A 3S9WA 2A68C 3K0YA 3PO3B 4WFN3 2BCOA 3SEBA 1EU4A 2JA5B 2BE5D 2RA4A 1WVLA 3SDZA 1JOOA 1Y1VB 4A3GB 5CV7A 2F0KA 4RGOS 5D3DA 4A3MB 2SNSA 4KJNA 3PO2B 1HA6A 2B8FA 3A8JE 4CKEA 2KCCA 2H1EA 2EY5A 4MIUA 2KECA 1AZPA 1MBYA 3NUCA 2KEDA 4S3SA 1D2BA 1RTOA 3VR6A 5C4JB 2B2VA 3S1RB 1F9QA 1JICA 1FNUA 3FDTA 4K8IA 1JOQA 3MVVA 3U9OA 3H0GB 1SYGA 3GTPB 3HZXA 3HKZB 3KF8A 1II3A 2KQ3A 1UNSA 4RAUC 1LTID 3VR3A 3VA5A 3C3LA 5JPNC 2LKVA 2PZTA 3IAYA 3EJIA 1QNUA 1CTMA 4F8MA 3NHHA 4L6TB 4C3IG 1A6XA 1QB5D 3DUZA 4H13C 1F77A 1STAA 3H3VC 2BE5C 2EY6A 1WCMB 1OXSC 3LX0A 3TP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FXK C;  4ILW A;  1XWE A;  2E2D C;  2I07 B;  2WIN B;  3MA2 B;  3OHX C;  1OO9 B;  2QKI C;  1BUV T;  1D2B A;  3FRP B;  2XWB B;  2A73 B;  5JPM C;  2WII B;  3G6J B;  3CU7 A;  1BQQ T;  4FXG C;  1PXU A;  1UAP A;  3HS0 C;  3CKI B;  1JB3 A;  2A74 C;  1GXD C;  3T4A C;  2J0T D;  5FO7 B;  3KLS A;  5FO8 B;  1JC7 A;  1UEA B;  2ICE C;  3V96 A;  5FOB B;  2XWJ B;  2B39 A;  3L3O C;  3HRZ C;  1BR9 A;  3I70 A;  5JPN C;  2TMP A;  5FO9 B; 
#chains in the Genus database with same CATH topology
 1RKN A;  4RKB A;  1EL0 A;  4YY3 L;  3QO2 A;  3J81 c;  2RSN A;  3S2D B;  2PYK A;  1PRT F;  1F9P A;  2N78 A;  4IJH A;  4JBJ A;  5C44 B;  4LNQ A;  3K7A H;  2E76 C;  1HR0 Q;  2WAQ B;  3SK5 A;  4QB4 A;  2XN9 C;  1VQ7 A;  4JI7 L;  5K36 H;  2CQA A;  1B2T A;  1TU2 B;  1O7I A;  1K8A C;  1T5X D;  1L0Y B;  2NVQ H;  2OQ0 A;  4P71 A;  4BA2 I;  1VQF A;  1LTG D;  3P75 A;  1YNJ D;  3J80 E;  3PF4 A;  4R4T A;  3J80 i;  1DOL A;  3CCR A;  1TWC B;  2I07 B;  1B1Z A;  2YYZ A;  3B6Y A;  4K8J A;  5DM7 3;  3PSI A;  3UDX A;  1SNC A;  2HUG A;  2O5I C;  3EA6 A;  3RLO A;  3DEO A;  2ZJR A;  1PH9 A;  5JEA J;  2BA1 A;  1EEF D;  3ER0 A;  4JG2 A;  4XDX A;  5FLM H;  1NUC A;  1PFB A;  4DV7 L;  2UXD Q;  1EIH A;  3T53 B;  1XXG A;  2RDG A;  3BZD B;  1WTR A;  2B2W C;  2ZT9 C;  3HG9 A;  1VQO A;  3C1E A;  3L3O C;  3I70 A;  3IRB A;  3S15 B;  4X62 L;  3T51 B;  1XPR A;  2UXC L;  4JV5 L;  1ENA A;  1RL2 A;  2CVR A;  3EVQ A;  1Q81 C;  2A19 A;  4IO9 A;  1N34 L;  1EY7 A;  1CT1 D;  3LWE A;  2VQF L;  1EZ6 A;  2EVB A;  1PH7 A;  4JBM A;  1SRO A;  4KHP Q;  2F0D A;  3NPP A;  3AFQ A;  4GLV B;  3KLW A;  5KYI A;  4R4O A;  1L0W A;  4K6L A;  2K05 A;  1J6Q A;  3HOW G;  2LY7 A;  1G6Z A;  4B3M Q;  1VDZ A;  3N52 A;  4KY6 A;  4MZ9 A;  3HFZ B;  3I73 A;  3K5L A;  1BCP F;  1NMG A;  3MEF A;  4XTC S;  4WRD A;  3TP7 A;  1PXU A;  4KN7 C;  3CKI B;  3L2P A;  4JPB W;  3I4N H;  1JR0 D;  4GN3 B;  4BY7 B;  1IHZ A;  1SE2 A;  1HUM A;  5AJ3 Q;  1PTO H;  5C0X G;  1XMO L;  3CW2 C;  3SK8 A;  5JVG 3;  4UDU C;  3S2H B;  1UUP A;  1W2B A;  2A8V A;  1Q1B A;  4KY5 A;  1SND A;  2R93 B;  2B2Y A;  2WKC A;  1L1O A;  3K59 A;  4BXX H;  3M3Y B;  2O4X A;  4LFA Q;  4DUZ Q;  4DR5 L;  1U4P A;  4OEL B;  4L5T A;  4NMZ A;  2NZO A;  2K4K A;  1BBW A;  1O7Z A;  1LUZ A;  3GTJ B;  1YNJ C;  1ESF A;  2EJM A;  2EPB A;  4QGU A;  3CC4 A;  4N9P A;  2XIW A;  2FHT A;  5A2Q L;  3NE5 B;  2NN6 H;  4AIM A;  5EPK A;  2GVA A;  3SE0 A;  5M3F G;  2KEE A;  1N8R C;  5HGQ A;  1HQM C;  1PTO D;  4X3U A;  2KA7 A;  2F0E A;  1HUN A;  1Y8P B;  3SR1 A;  3KBX A;  3DWP A;  2ZTD A;  2QA4 A;  3DHQ A;  2EXZ A;  3KLS A;  3M4Q A;  3C2P A;  2JQO A;  3C1F A;  3RLF A;  2QEX A;  3RZD H;  2PMZ B;  5IT9 E;  1I3Q H;  4DV0 L;  3H94 A;  4HJA A;  3I4M G;  1HFN A;  2QGQ A;  3VA7 A;  1S3O A;  1Y8N B;  3M7G A;  1EY0 A;  1EFI D;  1NSN S;  2F1M A;  1X3E A;  4DN4 M;  1IBL Q;  2E8G A;  1CFM A;  4XIG S;  1ASY A;  1SMX A;  2L55 A;  1HH2 P;  1MD2 D;  4EQN A;  3OWE B;  1KL9 A;  2OT2 A;  4A3F B;  4BBR H;  4UAI A;  1EZ8 A;  4GN5 A;  2A6H D;  4OON A;  4C1N I;  1TWF H;  1NAP A;  4DV3 Q;  3MHB A;  3BVM A;  2I5H A;  1WTQ A;  1ESR A;  1Q1E A;  4K2K A;  5M3M B;  2NN6 I;  5GAH C;  4IJL A;  1AFP A;  4DV2 Q;  1Q12 A;  1ENF A;  1I4X A;  1EQT A;  4A3L H;  3CPW A;  4IUU A;  3U9S A;  3OW2 A;  1A8V A;  1Q3L A;  4HMI A;  4LK1 C;  3NP8 A;  1N32 L;  3MFG A;  3G6J B;  1ET9 A;  5FLX L;  1XTC D;  4L5R C;  2E2H B;  1W6K A;  5H1S E;  1IBM Q;  3N6R A;  5G3L F;  2O5J C;  2NVX B;  1ICF B;  1NMF A;  1YHA A;  4WJ4 A;  4A3K G;  2ES2 A;  1W3S A;  2DNE A;  2Q8I B;  1K8O A;  3UDF A;  1AW7 A;  3A7A B;  3NBH A;  3CCS A;  1Q46 A;  2L11 A;  3UI2 A;  3R2T A;  4NXN Q;  4O42 A;  5JPM C;  4HTH A;  1CSQ A;  2WII B;  5T1G A;  2M9V A;  4IPC A;  1N36 Q;  1H9K A;  3RR5 A;  3HOZ B;  3KLS X;  3T4A C;  1M1K C;  4JI2 Q;  5BR8 L;  2YU9 H;  3BZK A;  2MUY A;  2F4V L;  4J8Q A;  3M4Y A;  4MHE A;  4IUV A;  2BDO A;  3KJO A;  1MIU A;  4HIK A;  4XQQ A;  4A3I G;  1XWE A;  1STE A;  3Q0A A;  4AYB G;  3X3M A;  5BN4 A;  3R93 A;  2R7Z H;  5KND A;  1PTO C;  4DAV A;  4LF8 L;  1XNR L;  3KJP A;  5DM6 3;  1KXL A;  5GAD C;  2MHV A;  5DNF A;  1DON A;  3SK6 A;  2X6L A;  3S1M B;  4KHV A;  1STG A;  1KAW A;  5C3E G;  4LF9 Q;  1Y1W H;  4GNX B;  4HSV A;  3HOX G;  2IWH A;  1SE3 A;  4CJ0 B;  4B9X A;  3ERS X;  3ND9 A;  1FJG L;  3S16 H;  1NE3 A;  2PQA A;  4DKA C;  1JWU D;  2A6H C;  4RKL A;  1CA5 A;  2HD3 A;  4A3E H;  3CP0 A;  1HZA A;  1G91 A;  5K36 G;  1I4G A;  2XWJ B;  2JA9 A;  2MGS A;  3I91 A;  1ZYR D;  2FMC A;  2K32 A;  5M5Y B;  1SR3 A;  4RCN A;  1FNW A;  2IHF A;  4X3K A;  2EY1 A;  2E2I H;  3PUX A;  4ZRZ A;  2HIX A;  3D8G A;  2EOT A;  1GM5 A;  2R3Z A;  4EVO A;  1B3A A;  2JA7 B;  3NBI A;  2LS0 1;  4QJF A;  1ENC A;  2F0P A;  3PUV A;  3SGI A;  4A75 A;  5FKA C;  1GKH A;  4J15 A;  3VR4 A;  2KVM A;  4MN3 A;  1TII D;  3GTQ H;  5ELB A;  1PRT B;  4OX9 L;  4AYB E;  1YJW A;  4CBV A;  1NCV A;  3Q6S A;  4KD4 A;  4I7A A;  1KRT A;  5C4H A;  4HID A;  5C4Z A;  2ID0 A;  2XVS A;  5FLX c;  1FD7 D;  4KN4 C;  2C9O A;  4P74 A;  1UEA B;  5KEE A;  1I94 Q;  3DWA A;  1NR4 A;  5FOB B;  3S14 B;  1QVF A;  4UHV A;  1IBK L;  2EYL A;  4A93 H;  1I4R A;  2DGY A;  1AN8 A;  2KCT A;  4KK7 A;  1GOZ A;  3TQY A;  1CKN A;  1VQA A;  1QUQ B;  3TEH B;  1QZH A;  4KY7 A;  1CZW A;  1WTO A;  3T1Y L;  4JVZ A;  3IL8 A;  1VQ4 A;  1VMP A;  2L12 A;  1SAP A;  2CQO A;  4GOP A;  4F88 A;  4IFD J;  2RKS A;  2A74 C;  3GTM B;  2Q8R E;  2VW9 A;  1B4O A;  3NTI A;  1Q82 C;  4LUV A;  1WTP A;  2AQ1 B;  5EQ0 A;  3CAM A;  2X6G A;  1TVX A;  4Q5V A;  4NP5 A;  3F8T A;  1TWG H;  1CUK A;  1WJJ A;  4KD3 A;  1L0X B;  3CCV A;  1JQY D;  1OXV A;  4JI8 Q;  1PV4 A;  4YCW A;  1F9S A;  3Q8D A;  5EKL A;  2NVY H;  4X66 Q;  3VYT A;  4OEM B;  3PIP 3;  2A1A A;  4GNX C;  1HFG A;  3G6E A;  1J8I A;  1AEX A;  1KD1 C;  3NTH A;  4CJ1 B;  4BXX G;  3OTO L;  1PH8 A;  5HUR A;  1EIG A;  3FVQ A;  3A5U A;  1SRU A;  4TVA B;  4Y7N H;  5NUC A;  2WB1 E;  4Z9C B;  3RZO B;  3WDN A;  3HOY H;  1QE6 A;  3BDL A;  1ZYR C;  1K73 C;  1RJT A;  2RQX A;  3TME A;  1PDQ A;  2F0I A;  4DV1 Q;  1B3Q A;  3HOW B;  4IFD H;  4ZUI A;  2NN6 G;  4TSS A;  1HZC A;  4C3J H;  5I2Y A;  1OTC A;  1FNV A;  1VQC A;  3KF8 B;  3JAM E;  1MKH A;  4DR4 Q;  4GS3 A;  4JI4 L;  3H3V H;  4DGZ A;  4K0K L;  1DZ1 A;  1KDC A;  1XMQ L;  1HNW Q;  1Y69 U;  1PHJ A;  1PMR A;  4CGY B;  4I7Z C;  1JJC B;  2OQK A;  3J81 L;  5E3F A;  2ATW A;  3MXN A;  3PO3 H;  2QKI C;  1SJE D;  1X65 A;  3PF5 A;  1DXM A;  1X56 A;  2DUD A;  4ZKB B;  1YIT A;  2Y0S G;  2JA5 H;  1H9S A;  1BQQ T;  2P5Z X;  4X3T A;  4BWG B;  4QMG A;  4UP9 A;  3Q23 A;  1Y1V H;  3GTO B;  1JMC A;  2JN4 A;  4O1N A;  4A3G H;  1U4M A;  4YHH Q;  2Z6K A;  1KHI A;  4BBR G;  1SE4 A;  5A35 A;  4HJ8 A;  3NWT A;  4DV5 Q;  1PRT C;  5L37 A;  4A3M H;  5IYB H;  1PLF A;  5GRO A;  1DGS A;  1ZXT A;  3FMC A;  3NEN A;  1PZK D;  4IFD I;  3T1H L;  4ID6 A;  3OHX C;  4DR3 L;  2KJX A;  5CYU A;  1G29 1;  4GKK Q;  2JEB I;  2KOL A;  5M3F B;  2NVT B;  2AWN A;  1JE4 A;  1R4P B;  5GAE C;  4A3L G;  1VQE A;  2E5L Q;  4DR7 Q;  3H3V I;  2F0O A;  3HS0 C;  2F0N A;  1JT8 A;  1Q8K A;  3OMG A;  1YNN D;  4TKO B;  1YJN A;  2A6E D;  4DR2 L;  3HOV G;  4CKC A;  3H6M A;  2E2J H;  1KLG D;  2PO4 A;  2RDH A;  2B63 H;  3I4M B;  3BDO A;  3BS1 A;  4JI1 Q;  5GAG C;  2HT1 A;  3VYU A;  1V1P A;  3A5Z B;  3ERQ A;  2ASB A;  2JA6 H;  5JOB A;  1YHQ A;  3PCO B;  1U9R A;  1S5C D;  1STH A;  3BZC A;  1HA5 A;  3GTP H;  4NW2 A;  4KKS A;  1A3V A;  1KTK A;  2PMZ E;  3TP5 A;  4EGV A;  1GHJ A;  3CQZ H;  2SEB D;  1YHB A;  1JWS D;  3D0F A;  3HGB A;  1YVC A;  1C9O A;  1STB A;  3PUW A;  4LF5 L;  2LMC B;  4DFA A;  3E3X A;  2JA8 G;  1Z9F A;  1TS4 A;  1YIJ A;  2MJ8 A;  5KIX A;  1K8G A;  2ENB A;  2M00 A;  1EYA A;  3PQI A;  1QCB D;  4HN7 A;  4K2L A;  3SHL A;  2X69 A;  3E9H A;  3X3N A;  1SNO A;  2B2V C;  1QZG A;  4F87 A;  4RHR A;  1D1K A;  5ELO A;  3DM1 A;  3T56 B;  3BYT B;  2IT1 A;  1EYG A;  2PW7 A;  3QB3 A;  2K5D A;  4DNR B;  4DK6 C;  3J81 i;  2RVL A;  2N49 A;  4C3H G;  3ULP A;  4FO2 A;  1I50 B;  1D5X C;  1Y1W G;  3NQI A;  1H9M A;  1SDF A;  3SVM A;  4OWX B;  2L1B A;  3FPU B;  3VYS A;  2MP1 A;  2AUJ D;  4U68 A;  4JK1 C;  1D8L A;  1IKM A;  3IFT A;  1C48 A;  1DOK A;  1EUJ A;  3GQB A;  4H44 C;  5IP9 H;  1WCM H;  1X32 A;  1SEB D;  4FXG C;  5IIF A;  1VQN A;  3I55 A;  3HOU G;  2FIN B;  4JI3 L;  2EY2 A;  4E6I A;  5FO8 B;  2MO0 A;  3S2D H;  1WTH A;  2R92 H;  5M5X B;  4PZ7 A;  1XX8 A;  2LSS A;  4IUQ A;  1YNX A;  1K9M C;  4A3E G;  4B3S L;  5LL6 X;  4M8A A;  4IUT A;  3PV0 A;  4KI0 A;  3W5O A;  3I8Z A;  1OXT A;  4GKJ L;  4A3I B;  3D31 A;  2DNC A;  1BVS A;  1TWA B;  3A8I E;  4G4K A;  1EWI A;  2L0C A;  1EWH A;  1TWC H;  1K83 H;  4YIJ A;  3M4O H;  3MEH A;  1PH1 A;  1JB3 A;  4ODG A;  4IZ8 A;  4C2M B;  1N33 Q;  1L1O B;  1JC7 A;  1YNN C;  4U67 3;  3GTG H;  4HJ9 A;  2K50 A;  2PQE A;  1VQ8 A;  2A6E C;  3W1G A;  4B3R L;  5C3E B;  1ICW A;  3MXU A;  5FO9 B;  1EYD A;  1SYE A;  2AQ3 B;  2FJ2 A;  3HOX B;  2HHH L;  4NXM Q;  2I5M X;  3NXW A;  4PMW A;  1HHV A;  1EEI D;  1VQP A;  4DR1 Q;  2NZH A;  3NQT A;  2VNU D;  4XQN A;  1JJ2 A;  2YTX A;  1AE3 A;  4BY1 B;  3GTK B;  4HJ7 A;  4IUR A;  2ZXP A;  3W1B A;  3S15 H;  5KNC A;  1GUO A;  3U58 A;  2G9H D;  2B2W A;  5JJI A;  2Z0S A;  3NSW A;  3V96 A;  1S40 A;  5K5P A;  4X6A H;  4DAY A;  1VQM A;  3HRZ C;  5FJ8 H;  3PUZ A;  4DXF A;  1S4Z A;  4DK3 C;  4ZLT F;  2F0L A;  3URY A;  1IKL A;  1PYS B;  4PNY A;  2K14 A;  2IX3 A;  3E0E A;  4A93 G;  1XNQ Q;  4MTN A;  2K33 A;  4NDX A;  4A76 A;  4BBS H;  1Y14 B;  3CU7 A;  2DY7 A;  5ISR A;  4LF6 Q;  4OO1 I;  4A3B B;  1B8A A;  1D6E C;  1TWH B;  4RCO A;  2F52 A;  3OWF A;  2K03 A;  2CWA A;  2QDL A;  5DAU A;  5JEA H;  2AQ2 B;  1KLU D;  2EYO A;  1HR0 L;  4JI5 Q;  3UE1 A;  3GP7 A;  2KUM A;  3S2H H;  5FK9 C;  4DK1 A;  4ZQ3 A;  3J7Y W;  2IW3 A;  2YTV A;  1M8A A;  3IKJ A;  4B08 A;  2HDM A;  2PNH A;  2EJG C;  1NJI C;  2R93 H;  1NBW A;  4NPS A;  4K5V A;  3VR5 A;  1D7Q A;  3PIP A;  4JI0 L;  2OCE A;  4LF7 Q;  2UUA Q;  3ND8 A;  5IYC H;  3F2C A;  5J3B A;  2EYF A;  4UY8 C;  3S17 B;  1SJH D;  1DM0 B;  3FHW A;  4JBK A;  5GQO A;  3FEW X;  1CSP A;  3GTJ H;  4FF2 A;  2WKD A;  4XT3 B;  4IFD G;  3NBH B;  2F0J A;  3M9B A;  1A15 A;  2R61 A;  1PVO A;  2K01 A;  4DF7 A;  1W6J A;  3KYH C;  1NR2 A;  4RWS C;  2VUM B;  5T1I A;  1JE5 A;  2Q8T A;  4WOR A;  2WAC A;  2QEJ C;  1TXY A;  1E1O A;  4HCS A;  3PGZ A;  2F0G A;  1G6P A;  2AMC B;  4KTA A;  4DPG A;  1X3P A;  2UUB L;  3DWQ A;  5KGU A;  2K5H A;  2B8G A;  4KHP L;  3RMH A;  3NEM A;  1L1O C;  2JK8 A;  3I56 A;  4UPA A;  2HIV A;  3OOC A;  3LNN A;  2JA5 G;  2D9U A;  4R9W A;  2SOB A;  1C7Y A;  1HQR D;  5HY6 A;  1V9P A;  1Y1V G;  4B3M L;  3A74 A;  3TZD A;  4A3G G;  4A3F H;  4LF4 Q;  3J7A 5;  4QIW B;  4A3M G;  2NZ1 D;  1I6V C;  1OO9 B;  2E75 C;  3ITP A;  1LT3 D;  3R8B A;  5M3M H;  1H95 A;  5M5W H;  1SMY D;  2Z4H A;  4N9T A;  4AQY Q;  1S72 A;  3KF6 A;  4POG A;  1EYC A;  4H7B A;  5AJ3 L;  2GVB A;  4MNO A;  5C3W A;  1VQL A;  5I4D A;  2CH4 A;  2PQA B;  2PI2 E;  1LM0 A;  1GUW A;  2PZW A;  1RD9 D;  4EX5 A;  1HR0 W;  4A3J G;  4FXD A;  3AEV A;  1HZ9 A;  4POF A;  5C5M A;  4L5S A;  3FKI H;  2UUC Q;  2M2L A;  5C6A A;  1WFQ A;  1GD7 A;  1T5E A;  4LFA L;  2B63 G;  1G2T A;  4DUZ L;  1VS0 A;  3KDF B;  2JA6 G;  4HJ5 A;  2IHE A;  1K3B C;  3QWN A;  2PNR C;  2IX0 A;  5J39 A;  5LMN Q;  1HRJ A;  4Q0F A;  5KNB A;  3QJY A;  4N8F A;  4RGT A;  1UE1 A;  1STN A;  2MPM A;  4BBR B;  2PZU A;  1WD1 A;  1EOV A;  1E2V A;  3HOZ H;  3QIA A;  5IT9 c;  1I6H B;  5E4X A;  2JYO A;  3WWV A;  2K5N A;  1KQS A;  3KFU A;  4PMB A;  4A3D H;  2CWP A;  2BDN A;  1QNK A;  1GUS A;  2KHJ A;  2ICI A;  2WP8 J;  5CV8 A;  2EXD A;  3VR2 A;  4O2D A;  1HJP A;  3M4P A;  5D14 A;  3ZYY X;  5A2Q E;  4ME5 A;  4A3C H;  2Q2H A;  5CMD A;  1IBL L;  1PYB A;  4X64 Q;  5HGT A;  2VQE Q;  4PV1 C;  2F0M A;  2HDL A;  2F0T A;  1R9T B;  3F2D A;  3HOV B;  4H02 A;  1KNA A;  2V4D A;  2VS1 A;  2VY3 A;  4IUP A;  3TZU A;  1JWM D;  1CKN B;  2IPK D;  3UDG A;  3F2U A;  4DV3 L;  2EYP A;  1YJ9 A;  3L9A X;  5IP9 G;  1WCM G;  2N88 A;  3CCJ A;  4NKL A;  3LGJ A;  1B53 A;  4KHZ A;  4DV2 L;  4GOP B;  4YWK A;  1K0R A;  4CDE C;  1X54 A;  4IAL A;  1LTT D;  2TMP A;  1GVP A;  1IXR A;  1EY9 A;  2R92 G;  1EIF A;  2ZTE A;  5C4X B;  1A2U A;  1UE5 A;  3D6W A;  4K14 A;  1MJC A;  4IPG A;  2JA8 B;  1HTL D;  1R4Q B;  4FP5 D;  2WAQ G;  3DMU A;  1HTP A;  5CGK A;  1IBM L;  1SMY C;  4ME3 A;  5J22 A;  2OF1 A;  5JJZ A;  5CR3 A;  1NTG A;  1MJE A;  2YV5 A;  1D5Z C;  4DV6 Q;  3HKZ E;  1I4P A;  1VQ6 A;  3KLR A;  1QVG A;  1JOK A;  1G51 A;  3BYY B;  2F0Q A;  5IP7 H;  4LAA A;  1IZ6 A;  2NBF A;  4C3H B;  2JA7 H;  1ET6 A;  1EY6 A;  4NXN L;  2L15 A;  3KDF A;  5FLX E;  1SFO H;  1N36 L;  3M7N A;  2NTT A;  1STY A;  4JI2 L;  1Q8I A;  5CV5 A;  5ELE A;  5FO7 B;  5BN5 A;  3SK4 A;  3H15 A;  3Q22 A;  1HNZ Q;  1WTX A;  3HOU B;  3R3O A;  4C3I B;  2UXB Q;  4K5X A;  5FLM G;  1VF7 A;  1VQH A;  2WB1 G;  4DV4 L;  4KKU A;  1X55 A;  3G71 A;  5TSS A;  2OWO A;  3CF5 A;  2XTI A;  3MZ5 A;  2E74 C;  1I5F A;  2NTS A;  2BH8 A;  2B2U A;  3A7L A;  3RLN A;  5FJ8 G;  3LWU A;  3CC7 A;  5IGE A;  3S14 H;  4L8J A;  3MXN B;  4LF9 L;  4PMC A;  2K28 A;  3TP8 A;  1B7Y B;  3KK7 A;  3O13 A;  4BBS G;  2CW0 C;  3MTS A;  2K5V A;  4A4I A;  4DNT B;  2ZM6 Q;  1E1T A;  3R2I A;  4G7H C;  1H9S B;  1ZEQ X;  4ZK9 B;  3UDI A;  2E2I B;  1X3G A;  1PRT D;  2AHO B;  4LFB Q;  1CHQ D;  1IL2 A;  4GLX A;  1GJX A;  2D62 A;  3CXC A;  4QY7 A;  5JEA G;  4DR6 Q;  2WAQ E;  2LXJ A;  1KDB A;  5DEH A;  4OIK A;  1E3P A;  1SLJ A;  2F3W A;  2R7D A;  2MNA A;  1KAA A;  3BDC A;  1FGB D;  2I46 A;  1CM9 A;  5EJW A;  4FF4 A;  1B70 B;  3I4N G;  2R93 G;  2ZJQ A;  1FR3 A;  1CQF A;  2Z4I A;  4R4I A;  3MXG A;  1F2M A;  3K57 A;  1J5E Q;  1A63 A;  2BA0 A;  1XPU A;  3FRP B;  5IYC G;  3DEP A;  2G9D A;  1O78 A;  4A93 B;  5LMU Q;  1ML0 D;  1Z47 A;  3VYR A;  3RZO H;  1A2T A;  1V1P B;  3I3C A;  3TS0 A;  1HNX L;  4GOP C;  1TR5 A;  1PTO F;  4ZUJ A;  5LL6 S;  1AH9 A;  3QOL A;  4HED A;  4JW0 A;  1CI3 M;  4ZYS A;  1PFS A;  2LFN A;  4HIM A;  1BDO A;  4JOI A;  4PZ6 A;  1BOS A;  2XNA C;  3CC2 A;  1BCP B;  1U4R A;  4K5W A;  4JI6 Q;  4DAM A;  1BBX C;  4TRD A;  1PYW D;  5COY A;  1U4L A;  1I94 L;  1TWG B;  1RCV D;  2KHS A;  3ERO A;  2F3I A;  1TY2 A;  2CH4 W;  2GA4 B;  2NVY B;  5IWA Q;  1BCP D;  1VQG A;  1XTD A;  2Z6B A;  3L7Z C;  1V1O A;  1AE2 A;  3P20 A;  3GTO H;  1LTS D;  4KLK A;  3A8K E;  4FNF A;  4X65 Q;  4A3F G;  2B2T C;  5C5L A;  1M4V A;  2IL8 A;  4V0B A;  2A73 B;  1PH3 A;  1HZB A;  1G2S A;  4RH6 A;  3MFY A;  4OXP A;  1O80 A;  1SN8 A;  1J9O A;  2R7F A;  3OMC A;  1E24 A;  2RSO A;  2NVT H;  3I4O A;  4M1U B;  1KNE A;  4QUC A;  4R4C A;  1K3R A;  4FXK C;  4X3S A;  2E2D C;  4HAE A;  1X3F A;  3J7A F;  4JI8 L;  4LFC Q;  3PO2 H;  4X66 L;  1F9R A;  4B3T Q;  2AWO A;  3FKI G;  3H91 A;  3MAQ A;  1K0S A;  1MSH A;  2QIL A;  2UU9 Q;  4DK0 A;  3GO5 A;  1LTL A;  2HQL A;  4CDC C;  3J81 j;  3STB D;  4DUY Q;  3TSS A;  5I9O A;  3JAM c;  2D2C C;  5C4J H;  1VQK A;  3MXP A;  4DV1 L;  2HCC A;  3S1R H;  3GV3 A;  4RHS A;  1LV9 A;  4C56 C;  3TRZ A;  1U5K A;  4DAP A;  3H0G H;  3NTK A;  3OSO A;  1NY4 A;  1EY4 A;  3J7Z C;  2EZV A;  2PPB C;  4XYQ A;  1SBB B;  5I2X A;  2XRQ D;  1HNW L;  1WYD A;  4A3D G;  1C8C A;  3AU7 A;  4GZY C;  1NNX A;  3A0J A;  3ULL A;  1OXU A;  4HCE A;  4A3C G;  3ICE A;  3DM3 A;  1LAC A;  4A3J B;  1LAB A;  3QOJ A;  1ASZ A;  3J80 L;  4DAY B;  1H9J A;  3A55 A;  3RN5 A;  4ZKC B;  3E0J A;  4YY3 Q;  1I50 H;  2R7Z G;  5BN3 A;  2E2J B;  4YHH L;  2B63 B;  2Q2U A;  4DV5 L;  2KHI A;  2PI2 A;  4JCV E;  3CME A;  3G4S A;  2JA6 B;  3PIO 3;  3GTL B;  4CHT B;  4XXE A;  2ZJP A;  1CQV A;  1VQD A;  2L4N A;  3D3R A;  3J81 E;  2F0W A;  4JI7 Q;  1LTB D;  1BCP C;  1I4H A;  5E4W C;  4BA1 I;  1DD2 A;  4GKK L;  1HCZ A;  3CQZ B;  4YCV A;  4UP7 A;  1SE8 A;  3K0X A;  3DXJ C;  3P1H A;  2E5L L;  1JCK B;  2F0S A;  4A3K B;  4DR7 L;  5M5X H;  4WJW A;  5G3L D;  3S1N B;  3TRE A;  5I9P A;  1BBU A;  2NVX H;  1GXD C;  1SNP A;  1B9M A;  2FFK B;  4R8N A;  5COR A;  2K04 A;  1DOM A;  1B9N A;  1AP0 A;  1MI2 A;  4KJO A;  4DV7 Q;  3AYH B;  1RF2 D;  1KAB A;  4JI1 L;  2EDG A;  5C44 H;  1I4Q A;  1SNM A;  4DA2 A;  1MHW C;  1E0B A;  2B3G A;  4OL7 A;  4X62 Q;  2EJF C;  5IP7 G;  2UXC Q;  3MC0 B;  1XPO A;  5D65 A;  1BUV T;  2F0H A;  4JV5 Q;  1SYF A;  4AYB B;  2BOS A;  3K5O A;  3OPO A;  3W3A A;  2RBM A;  1EQR A;  2K1B A;  5IOD A;  4GLA C;  5J1Z A;  1LTR D;  3CCM A;  1N34 Q;  4JBW A;  4N8X 1;  1PZJ D;  3HOX H;  2V1C C;  2VQF Q;  3S1Q B;  1FYC A;  3STB C;  5I6Y A;  5CV6 A;  1MGS A;  2ZXO A;  1ZKO A;  4OO1 H;  2QF7 A;  1BF4 A;  1QG7 A;  4BY1 H;  3GDE A;  1O7L A;  2D0O A;  1CA6 A;  1FGU A;  2Q2I A;  3CRK C;  4EQP A;  3V2T A;  2R92 B;  2CFM A;  3K7U C;  3OIP A;  5EPL A;  3G7L A;  4IQZ A;  2I5L X;  4ULL A;  1FL0 A;  1SYD A;  4CDD C;  1EOT A;  2K5Q A;  4V19 0;  5IE8 A;  1YI2 A;  3EBE A;  4QUF A;  4IOA A;  1BR9 A;  2K5W A;  1K83 B;  2O2L D;  3K7A B;  3EN2 A;  3UE0 A;  3M4O B;  4IN3 A;  4G7O C;  5IGC A;  4JI0 Q;  1K8M A;  2WIN B;  4I65 A;  2F03 A;  4HIO A;  1XMO Q;  4A3B H;  5E7N A;  3K8A A;  3GTG B;  1LT4 D;  1ROD A;  2NVQ B;  4J1M A;  1TWH H;  5LHY 1;  2NB0 A;  4MTK A;  2KEN A;  2R6G A;  5JVH 3;  4R4Q A;  4ZAI A;  5ELC A;  2C35 B;  4JYA L;  4DR5 Q;  3D4D A;  3QR8 A;  4FDB A;  4B9W A;  1EQV A;  1A0I A;  3KF6 B;  1UWV A;  1WTV A;  3I72 A;  5IT9 L;  1QIL A;  2WB1 B;  3Q24 A;  3CHB D;  4BY7 H;  3BVG A;  3J80 c;  2IX1 A;  4C1N K;  3A56 A;  1X6O A;  1RIP A;  4ABN A;  2UUB Q;  1HPC A;  4CKB A;  2D0P A;  1HXY D;  1N33 L;  4HR7 B;  5EAY A;  4P2C B;  1XJV A;  3D4R A;  4NB3 A;  3S17 H;  1VQB A;  1E2Z A;  1VQI A;  5EKK A;  3RNU A;  4BBS B;  2F3V A;  3MWY W;  3HP3 A;  4NXM L;  3M3Y H;  4DR1 L;  4DV0 Q;  4LMQ D;  3CPF A;  3P7J A;  1YZ6 A;  4OHJ A;  4YCU A;  2RHS B;  2J4X A;  2VB2 X;  3HOY G;  4P73 A;  2VUM H;  5CBE E;  1S5E D;  5CV4 A;  3BVZ A;  3WOE A;  2UXD L;  1M90 C;  2GN5 A;  2XSC A;  5EKI A;  3AB9 A;  4C3J G;  3K5N A;  4DU9 A;  1U0L A;  1PH6 A;  1PZI D;  1D5M C;  3I7F A;  1TKW B;  4R8I A;  1PH2 A;  4LUZ A;  1XNQ L;  4BS9 A;  4G57 A;  2F0V A;  2DY8 A;  1EU3 A;  3I4N B;  1QVC A;  3KOJ A;  1S5D D;  1BXT A;  2PCF B;  3JC6 6;  5EBC A;  4LF6 L;  1S5F D;  1P8L A;  4P75 A;  4G7Z C;  1PTO B;  1KRS A;  2B2Y C;  1XYI A;  1IYV A;  3PO3 G;  3TDQ A;  4L63 B;  1N32 Q;  3W2D A;  1E7Z A;  2RCN A;  2DJF C;  3CD6 A;  2WV6 D;  5DLQ E;  2SDF A;  4OWT B;  1V1Q A;  1A3U A;  1LT6 D;  2EYH A;  4JI5 L;  5IYB G;  1LTA D;  1BKB A;  5CBA E;  5D3I B;  2RHQ B;  3E5S A;  5IGF A;  1VMC A;  3PO2 G;  1Z6H A;  4LF7 L;  1IW7 D;  1IYU A;  3TBI B;  4LJZ C;  4K6D A;  2UUA L;  5EGT A;  2SNM A;  5BR8 Q;  2F4V Q;  2A5H A;  4UP8 A;  1VQ9 A;  2JEA I;  1KIX A;  5EBD A;  2NYZ D;  2RCF A;  1EWC A;  1GO3 E;  2E2H H;  1CZG A;  3E6Z X;  3RZD B;  3AFP A;  1D1I A;  1SXT A;  1I3Q B;  3U4Z A;  2F0U A;  4LF8 Q;  4IPH A;  1XNR Q;  1LYL A;  1GUT A;  1BO0 A;  4H0L C;  1VCI A;  3EFX D;  3H0G G;  2JP1 A;  1I6H H;  2FMM A;  2Y0S B;  3S24 A;  1OXX K;  3HKZ G;  1DYQ A;  3K58 A;  3RD4 A;  5IY0 A;  5M5W B;  1E22 A;  1TS5 A;  4OIJ A;  5KRU A;  5M9O A;  2L9H A;  1AZQ A;  1TWF B;  5F2D A;  2EE1 A;  2J7Z A;  1PFM A;  5JAV A;  2VL6 A;  2ZXR A;  4EQO A;  1FJG Q;  2JSO A;  1UEB A;  1R9T H;  3FKI B;  3ZJY C;  2IY5 B;  3HOV H;  3K5M A;  2CW0 D;  4LF4 L;  1TS2 A;  1A62 A;  1CHP D;  3I90 A;  2Q2T A;  2C5C A;  4ILW A;  3PIO A;  1P16 A;  3D4W A;  2L5T A;  3S1M H;  1F2Z A;  1TQO A;  2OEO A;  2XWB B;  4AQY L;  3VDY A;  4CJ2 C;  4Y52 H;  1GHK A;  2QCP X;  5C4X H;  3E9I A;  1QJO A;  4L5Q A;  1H9R A;  4KV6 A;  2JA8 H;  1S5B D;  1Q90 A;  4A3D B;  1A3T A;  2UUC L;  1DCZ A;  4WJ3 M;  3U4V A;  4AH6 A;  4DV4 Q;  1Z7T A;  2KCN A;  2YU9 B;  1EIY B;  1VQJ A;  5IGG A;  5C44 G;  2HQE A;  2CHB D;  1SYC A;  4XQJ A;  5LMN L;  4OX9 Q;  1CKO A;  2HCI A;  3T16 A;  1LLR D;  3I4L A;  4QCL A;  1V8Q A;  1JJG A;  3H09 A;  4C3H H;  5KYL A;  1RHP A;  3D6C A;  2MO1 A;  2R7Z B;  1IW7 C;  5M5Y H;  1O7Y A;  3OYY A;  1B44 D;  1C4Q A;  3CCQ A;  4IPD A;  4OO1 G;  4BY1 G;  1K28 A;  1QWY A;  2N55 A;  4RA8 A;  1IBK Q;  1Y1W B;  1VF5 C;  5AFW A;  3HOU H;  1RTN A;  2WFW A;  4C3I H;  4ZCK A;  4P72 A;  2IJ0 A;  1EY5 A;  3T1Y Q;  1E2W A;  2NUC A;  1UE6 A;  4O0A A;  1X3Q A;  2J0T D;  5IYD H;  3V05 A;  4X64 L;  3OW7 A;  2VQE L;  1WTW A;  4RFB A;  3S16 B;  4TQU S;  4APV A;  2I0Q A;  2F4I A;  4QF4 A;  4YWM A;  2A69 D;  4XYO A;  5IOC A;  4A3E B;  1T9H A;  4A3B G;  3HEJ A;  3TN2 A;  2ZTC A;  3CCL A;  2QW7 A;  1LO5 D;  4FYD A;  1VQ5 A;  1SFO B;  1HNX Q;  3JAM L;  1YEZ A;  2OTJ A;  2B39 A;  3OTO Q;  1TS3 A;  2EYJ A;  4KMU C;  3AMU A;  4J6H A;  3ONA B;  5JJL A;  1SNQ A;  1JOR A;  2AUK A;  3GTM H;  2B2U C;  2N3S A;  1Q7Y C;  2XGT A;  3GTQ B;  2VB3 X;  2BH2 A;  4BY7 G;  4DV6 L;  1GUN A;  1UAP A;  2FXQ A;  4HMJ A;  5JJK A;  3K80 C;  1WOC A;  2QDB A;  4LW1 A;  2YTY A;  3BU2 A;  3OIQ A;  2G5D A;  5C3X A;  2A68 D;  3NWS A;  1C0A A;  1F2Y A;  2ICE C;  4IUN A;  2DN8 A;  4RG1 A;  5IGB A;  4F7X A;  4JI4 Q;  2Z8L A;  4K0K Q;  4KKT A;  1EY8 A;  5LMN W;  1XMQ Q;  2OXP A;  1LT5 D;  1ILQ A;  5C0X J;  3BG3 A;  1QOH A;  4RGM A;  4PZ8 A;  4RGN A;  2EYM A;  3WOF A;  1ILP A;  1DJR D;  1Y8O B;  3NK9 A;  1BNZ A;  4PQX A;  4GNX A;  5E1F A;  5CV9 A;  1HNZ L;  1PFN A;  2K6A A;  2VUM G;  2UXB L;  3J7A V;  2N8N A;  1IL8 A;  3T13 A;  3HOW H;  2XRS D;  4DXG A;  2VXW A;  5ELD A;  5CC4 A;  3KBG A;  1SYB A;  2EIF A;  2PW5 A;  3IFD A;  1G8Z D;  4FF3 A;  4XT1 B;  3MA2 B;  3NEL A;  3EIV A;  3GV6 A;  1X9N A;  5IGD A;  4ALP A;  1ONL A;  3I2Z A;  1B50 A;  3T1H Q;  2JXM B;  4DR3 Q;  1GUG A;  3F1Z A;  2B29 A;  4GN4 B;  2ZM6 L;  2NWG A;  3SXH A;  3CCU A;  3GD7 A;  3KUP A;  1PH4 A;  3TS2 A;  4HSP A;  5C0X H;  2F0F A;  2ALY B;  3RUZ A;  4LFB L;  3QG1 A;  3A54 A;  1KC8 C;  2Z1C A;  4LUO A;  2K7V A;  2K75 A;  2A69 C;  2B2T A;  4EQ5 A;  4DR2 Q;  4JOI C;  1WD0 A;  4DR6 L;  5EPJ A;  3K81 C;  4Y7N B;  1SSO A;  2KBN A;  2H4O A;  4FF1 A;  1TY0 A;  2D5D A;  3JAM i;  1F2L A;  5I6W A;  1V43 A;  3HOY B;  3EQL C;  3CMA A;  5ELF A;  1FVI A;  2RDF A;  5M3M G;  1KDA A;  2JJQ A;  3PUY A;  3F2B A;  1MSG A;  5M3F H;  4C3J B;  1J5E L;  2JE6 I;  3K6O A;  4DNI A;  2RF4 A;  3BJU A;  4LF5 Q;  1RDP D;  3C46 A;  1CKM A;  1CK1 A;  3M85 A;  3CRL C;  2TSS A;  3CCE A;  5LMU L;  3PMF A;  3FPP A;  4FVM A;  1Q86 C;  1L2F A;  4OGQ C;  5C0X I;  1TT2 A;  3I4M H;  4JC0 A;  3S9W A;  1N9W A;  2A68 C;  3K0Y A;  3PO3 B;  3AQQ A;  4WFN 3;  2BCO A;  2Z6K C;  3SEB A;  1QUQ A;  4R1J A;  4JI6 L;  1EU4 A;  2JA5 B;  2BE5 D;  2RA4 A;  1WVL A;  1YBY A;  3SDZ A;  1JOO A;  1Y1V B;  2KCM A;  4A3G B;  5CV7 A;  2F0K A;  4RGO S;  5D3D A;  3HOZ G;  4A3M B;  4DR4 L;  2SNS A;  4LWC A;  2K52 A;  4KJN A;  4A3J H;  3PO2 B;  1HA6 A;  2B8F A;  5IWA L;  1JB7 A;  3A8J E;  4CKE A;  2CCZ A;  4JI3 Q;  2KCC A;  4QIW E;  4X65 L;  2H1E A;  2EY5 A;  2CKZ B;  3L0O A;  2Z9H A;  2KEC A;  4MIU A;  1AZP A;  2MFI A;  1MBY A;  3NUC A;  4B3S Q;  3GTL H;  2KED A;  4S3S A;  1D2B A;  1RTO A;  3VR6 A;  5C4J B;  2B2V A;  3ULJ A;  4GKJ Q;  3S1R B;  1F9Q A;  1JIC A;  1FNU A;  3U50 C;  3FDT A;  4PG3 A;  4K8I A;  1JOQ A;  3DLL A;  3MVV A;  4A3K H;  3U9O A;  5C4X G;  3H0G B;  3S1N H;  1SYG A;  3GTP B;  3HZX A;  4LFC L;  3HKZ B;  4B3T L;  4B3R Q;  3RN2 A;  3KF8 A;  4OWW B;  1PH5 A;  1II3 A;  3FP9 A;  2UU9 L;  2KQ3 A;  1UNS A;  2HHH Q;  1EFW A;  4RAU C;  1WI5 A;  2Y0S E;  1LTI D;  3VR3 A;  4DUY L;  4IOC A;  3VA5 A;  4CDF C;  3C3L A;  2H5X A;  4A3I H;  4QQB X;  1TWA H;  5JPN C;  3HKS A;  2LKV A;  2PZT A;  2VZA A;  1IYJ B;  3S1Q H;  3IAY A;  3EJI A;  4C2M H;  1EQQ A;  2DJG C;  1QNU A;  1CTM A;  1UE7 A;  2MQH A;  4QL5 A;  4F8M A;  2JA7 G;  2OTL A;  5C3E H;  2LXK A;  4RMF A;  3NHH A;  4L6T B;  4C3I G;  1A6X A;  1QB5 D;  2AKW B;  4YWL A;  5ELN A;  2EQS A;  3DUZ A;  4H13 C;  1F77 A;  1PA6 A;  3G48 A;  5IYD G;  1STA A;  3GTK H;  3H3V C;  2BE5 C;  2EY6 A;  1WCM B;  4JYA Q;  1OXS C;  3LX0 A;  3TP6 A; 
#chains in the Genus database with same CATH homology
 1RKN A;  4RKB A;  1EL0 A;  3QO2 A;  2RSN A;  3S2D B;  2PYK A;  1PRT F;  1F9P A;  5C44 B;  2E76 C;  2WAQ B;  3SK5 A;  4QB4 A;  2XN9 C;  5K36 H;  2CQA A;  1B2T A;  1TU2 B;  1T5X D;  1L0Y B;  4BA2 I;  1LTG D;  3P75 A;  1YNJ D;  3J80 E;  1DOL A;  1TWC B;  2I07 B;  1B1Z A;  2YYZ A;  4K8J A;  5DM7 3;  1SNC A;  2HUG A;  2O5I C;  3EA6 A;  3DEO A;  5JEA J;  2BA1 A;  1EEF D;  4XDX A;  1NUC A;  1PFB A;  1EIH A;  3T53 B;  1XXG A;  2RDG A;  3BZD B;  1WTR A;  2B2W C;  2ZT9 C;  3HG9 A;  3C1E A;  3L3O C;  3I70 A;  3S15 B;  3T51 B;  1ENA A;  2CVR A;  3EVQ A;  1EY7 A;  1CT1 D;  3LWE A;  1EZ6 A;  2EVB A;  2F0D A;  3NPP A;  5KYI A;  4K6L A;  2K05 A;  2LY7 A;  1G6Z A;  1VDZ A;  3N52 A;  4KY6 A;  3I73 A;  3K5L A;  1BCP F;  4XTC S;  4WRD A;  3TP7 A;  1PXU A;  4KN7 C;  3CKI B;  4BY7 B;  1JR0 D;  1IHZ A;  1SE2 A;  1HUM A;  1PTO H;  5C0X G;  3SK8 A;  5JVG 3;  4UDU C;  3S2H B;  1UUP A;  1Q1B A;  4KY5 A;  1SND A;  2R93 B;  2B2Y A;  2WKC A;  3K59 A;  3M3Y B;  2O4X A;  1U4P A;  4NMZ A;  1O7Z A;  3GTJ B;  1YNJ C;  1ESF A;  2EJM A;  2EPB A;  4N9P A;  2XIW A;  2FHT A;  5A2Q L;  3NE5 B;  2NN6 H;  5EPK A;  3SE0 A;  2KEE A;  1HQM C;  1PTO D;  4X3U A;  2KA7 A;  2F0E A;  1HUN A;  1Y8P B;  3SR1 A;  3KBX A;  3DWP A;  3DHQ A;  2EXZ A;  3KLS A;  3C2P A;  3C1F A;  3RLF A;  2PMZ B;  5IT9 E;  3H94 A;  1HFN A;  3VA7 A;  1Y8N B;  3M7G A;  1EY0 A;  1EFI D;  1NSN S;  2F1M A;  4DN4 M;  1CFM A;  4XIG S;  2L55 A;  1MD2 D;  4EQN A;  3OWE B;  2OT2 A;  4A3F B;  4UAI A;  1EZ8 A;  2A6H D;  4C1N I;  1NAP A;  3MHB A;  3BVM A;  1WTQ A;  1ESR A;  1Q1E A;  4K2K A;  5M3M B;  2NN6 I;  1AFP A;  1Q12 A;  1ENF A;  1I4X A;  1EQT A;  4IUU A;  3U9S A;  1Q3L A;  4HMI A;  4LK1 C;  3NP8 A;  3MFG A;  3G6J B;  1ET9 A;  5FLX L;  1XTC D;  2E2H B;  1W6K A;  3N6R A;  5G3L F;  2O5J C;  2NVX B;  2DNE A;  2Q8I B;  1K8O A;  1AW7 A;  3A7A B;  3NBH A;  2L11 A;  3UI2 A;  3R2T A;  4O42 A;  5JPM C;  4HTH A;  2WII B;  5T1G A;  2M9V A;  1H9K A;  3HOZ B;  3KLS X;  3T4A C;  2MUY A;  4J8Q A;  3M4Y A;  4MHE A;  4IUV A;  2BDO A;  4XQQ A;  1XWE A;  1STE A;  3Q0A A;  3X3M A;  5BN4 A;  3R93 A;  5KND A;  1PTO C;  4DAV A;  5DM6 3;  2MHV A;  5DNF A;  1DON A;  3SK6 A;  2X6L A;  3S1M B;  4KHV A;  1STG A;  4HSV A;  2IWH A;  1SE3 A;  4CJ0 B;  4B9X A;  3ND9 A;  1JWU D;  2A6H C;  4RKL A;  1CA5 A;  1G91 A;  5K36 G;  1I4G A;  2XWJ B;  2MGS A;  3I91 A;  1ZYR D;  2FMC A;  2K32 A;  5M5Y B;  4RCN A;  1FNW A;  4X3K A;  2EY1 A;  3PUX A;  4ZRZ A;  3D8G A;  2EOT A;  2R3Z A;  4EVO A;  1B3A A;  2JA7 B;  3NBI A;  2LS0 1;  1ENC A;  2F0P A;  3PUV A;  5FKA C;  3VR4 A;  2KVM A;  4MN3 A;  1TII D;  5ELB A;  1PRT B;  4CBV A;  1NCV A;  3Q6S A;  4KD4 A;  5C4H A;  5C4Z A;  2ID0 A;  2XVS A;  1FD7 D;  4KN4 C;  2C9O A;  5KEE A;  1UEA B;  3DWA A;  1NR4 A;  5FOB B;  3S14 B;  2EYL A;  1I4R A;  1AN8 A;  4KK7 A;  1GOZ A;  4KY7 A;  1CZW A;  1WTO A;  3IL8 A;  1VMP A;  2L12 A;  1SAP A;  4F88 A;  4IFD J;  2RKS A;  2A74 C;  3GTM B;  2Q8R E;  1B4O A;  3NTI A;  1WTP A;  2AQ1 B;  5EQ0 A;  2X6G A;  1TVX A;  4Q5V A;  4NP5 A;  4KD3 A;  1L0X B;  1JQY D;  1OXV A;  1F9S A;  5EKL A;  3VYT A;  3PIP 3;  1HFG A;  1J8I A;  1AEX A;  3NTH A;  4CJ1 B;  5HUR A;  1EIG A;  3FVQ A;  5NUC A;  4Z9C B;  3RZO B;  3WDN A;  1QE6 A;  3BDL A;  1ZYR C;  1RJT A;  2RQX A;  3TME A;  1PDQ A;  2F0I A;  3HOW B;  4IFD H;  4ZUI A;  2NN6 G;  4TSS A;  5I2Y A;  1FNV A;  3JAM E;  1DZ1 A;  4DGZ A;  1KDC A;  1Y69 U;  1PMR A;  4CGY B;  4I7Z C;  3J81 L;  5E3F A;  3MXN A;  2QKI C;  1SJE D;  1DXM A;  4ZKB B;  1H9S A;  1BQQ T;  4X3T A;  4BWG B;  4QMG A;  3Q23 A;  3GTO B;  4O1N A;  1U4M A;  1SE4 A;  5A35 A;  3NWT A;  1PRT C;  1PLF A;  1ZXT A;  3FMC A;  1PZK D;  4IFD I;  4ID6 A;  3OHX C;  2KJX A;  5CYU A;  1G29 1;  2NVT B;  2JEB I;  2KOL A;  5M3F B;  2AWN A;  1JE4 A;  1R4P B;  2F0O A;  3HS0 C;  2F0N A;  3OMG A;  1YNN D;  4TKO B;  2A6E D;  4CKC A;  3H6M A;  1KLG D;  2PO4 A;  2RDH A;  3I4M B;  3BDO A;  3BS1 A;  3VYU A;  1V1P A;  3ERQ A;  5JOB A;  1U9R A;  1S5C D;  1STH A;  1HA5 A;  4NW2 A;  4KKS A;  1A3V A;  1KTK A;  3TP5 A;  4EGV A;  1GHJ A;  2SEB D;  1JWS D;  3HGB A;  1STB A;  3PUW A;  2LMC B;  4DFA A;  1TS4 A;  2MJ8 A;  5KIX A;  2ENB A;  2M00 A;  1EYA A;  1QCB D;  4HN7 A;  4K2L A;  3SHL A;  2X69 A;  3X3N A;  1SNO A;  2B2V C;  4F87 A;  4RHR A;  1D1K A;  3DM1 A;  3T56 B;  3BYT B;  2IT1 A;  2PW7 A;  3QB3 A;  2K5D A;  4DNR B;  2RVL A;  4C3H G;  4FO2 A;  1I50 B;  1D5X C;  3NQI A;  1H9M A;  1SDF A;  3SVM A;  2L1B A;  3FPU B;  3VYS A;  2MP1 A;  2AUJ D;  4U68 A;  4JK1 C;  1IKM A;  3IFT A;  1C48 A;  1DOK A;  3GQB A;  4H44 C;  1X32 A;  1SEB D;  4FXG C;  5IIF A;  2FIN B;  2EY2 A;  4E6I A;  5FO8 B;  5M5X B;  1XX8 A;  4IUQ A;  5LL6 X;  4M8A A;  4IUT A;  3PV0 A;  4KI0 A;  3I8Z A;  1OXT A;  4A3I B;  3D31 A;  2DNC A;  1TWA B;  3A8I E;  4G4K A;  2L0C A;  1EWH A;  4YIJ A;  3MEH A;  1JB3 A;  4ODG A;  4IZ8 A;  4C2M B;  1JC7 A;  1YNN C;  4U67 3;  2PQE A;  2A6E C;  5C3E B;  1ICW A;  3MXU A;  5FO9 B;  1EYD A;  1SYE A;  2AQ3 B;  2FJ2 A;  3HOX B;  3NXW A;  4PMW A;  1HHV A;  1EEI D;  3NQT A;  2VNU D;  4XQN A;  4BY1 B;  3GTK B;  4IUR A;  2ZXP A;  5KNC A;  1GUO A;  2G9H D;  2B2W A;  3NSW A;  3V96 A;  5K5P A;  4DAY A;  3HRZ C;  3PUZ A;  4DXF A;  1S4Z A;  4ZLT F;  2F0L A;  3URY A;  1IKL A;  4PNY A;  2IX3 A;  2K33 A;  4NDX A;  3CU7 A;  2DY7 A;  5ISR A;  4OO1 I;  4A3B B;  1D6E C;  1TWH B;  4RCO A;  3OWF A;  2K03 A;  5JEA H;  5DAU A;  2AQ2 B;  1KLU D;  2EYO A;  3GP7 A;  2KUM A;  5FK9 C;  4DK1 A;  4ZQ3 A;  3J7Y W;  2IW3 A;  1M8A A;  3IKJ A;  4B08 A;  2HDM A;  2EJG C;  4K5V A;  3VR5 A;  3ND8 A;  2EYF A;  3S17 B;  1SJH D;  1DM0 B;  3FEW X;  4FF2 A;  2WKD A;  4XT3 B;  4IFD G;  2F0J A;  1A15 A;  2R61 A;  2K01 A;  4DF7 A;  1W6J A;  1NR2 A;  4RWS C;  2VUM B;  5T1I A;  2Q8T A;  4WOR A;  2WAC A;  2QEJ C;  4HCS A;  2F0G A;  4KTA A;  1X3P A;  3DWQ A;  5KGU A;  2B8G A;  3RMH A;  3OOC A;  3LNN A;  2D9U A;  4R9W A;  2SOB A;  1HQR D;  3TZD A;  4QIW B;  2NZ1 D;  1I6V C;  1OO9 B;  2E75 C;  3ITP A;  1LT3 D;  3R8B A;  1SMY D;  2Z4H A;  4N9T A;  1EYC A;  4H7B A;  5C3W A;  5I4D A;  1GUW A;  2PZW A;  1RD9 D;  4FXD A;  5C5M A;  2M2L A;  5C6A A;  1T5E A;  1G2T A;  3QWN A;  2PNR C;  2IX0 A;  5J39 A;  1HRJ A;  4Q0F A;  5KNB A;  3QJY A;  4RGT A;  1STN A;  2MPM A;  4BBR B;  2PZU A;  1WD1 A;  1E2V A;  3QIA A;  1I6H B;  5E4X A;  2JYO A;  4PMB A;  2BDN A;  1QNK A;  1GUS A;  2ICI A;  2WP8 J;  5CV8 A;  3VR2 A;  3ZYY X;  5D14 A;  5A2Q E;  4ME5 A;  5CMD A;  5HGT A;  4PV1 C;  2F0M A;  2HDL A;  2F0T A;  1R9T B;  3HOV B;  1KNA A;  2V4D A;  4IUP A;  3TZU A;  1JWM D;  2IPK D;  3F2U A;  2EYP A;  3L9A X;  2N88 A;  4NKL A;  1B53 A;  4KHZ A;  4IAL A;  1LTT D;  2TMP A;  1EY9 A;  5C4X B;  1A2U A;  3D6W A;  4K14 A;  2JA8 B;  1HTL D;  1R4Q B;  4FP5 D;  3DMU A;  1HTP A;  5CGK A;  1SMY C;  5J22 A;  2OF1 A;  5JJZ A;  5CR3 A;  1D5Z C;  1I4P A;  3KLR A;  1JOK A;  3BYY B;  2F0Q A;  4LAA A;  2NBF A;  4C3H B;  1ET6 A;  1EY6 A;  5FLX E;  3M7N A;  2NTT A;  1STY A;  1Q8I A;  5CV5 A;  5ELE A;  5FO7 B;  5BN5 A;  3SK4 A;  3Q22 A;  1WTX A;  3HOU B;  3R3O A;  4C3I B;  4K5X A;  1VF7 A;  4KKU A;  5TSS A;  3MZ5 A;  2E74 C;  2NTS A;  3A7L A;  2B2U A;  3LWU A;  5IGE A;  4L8J A;  4PMC A;  2K28 A;  3TP8 A;  3KK7 A;  3O13 A;  2CW0 C;  3MTS A;  4DNT B;  3R2I A;  4G7H C;  1H9S B;  1ZEQ X;  4ZK9 B;  2E2I B;  1PRT D;  1CHQ D;  1GJX A;  2D62 A;  5JEA G;  1KDB A;  5DEH A;  4OIK A;  2F3W A;  1KAA A;  3BDC A;  1FGB D;  2I46 A;  1CM9 A;  5EJW A;  4FF4 A;  1FR3 A;  1CQF A;  2Z4I A;  3MXG A;  1F2M A;  3K57 A;  2BA0 A;  3FRP B;  3DEP A;  2G9D A;  1O78 A;  4A93 B;  1ML0 D;  1Z47 A;  3VYR A;  1A2T A;  1V1P B;  3I3C A;  1TR5 A;  1PTO F;  4ZUJ A;  5LL6 S;  3QOL A;  4HED A;  1CI3 M;  4ZYS A;  2LFN A;  1BDO A;  1BOS A;  2XNA C;  1BCP B;  1U4R A;  4K5W A;  1BBX C;  4TRD A;  1PYW D;  5COY A;  1U4L A;  1TWG B;  1RCV D;  2KHS A;  3ERO A;  1TY2 A;  2GA4 B;  2NVY B;  1BCP D;  3L7Z C;  1V1O A;  3P20 A;  1LTS D;  3A8K E;  4FNF A;  2B2T C;  5C5L A;  1M4V A;  2IL8 A;  4V0B A;  2A73 B;  1G2S A;  4RH6 A;  3MFY A;  1O80 A;  1J9O A;  3OMC A;  2RSO A;  4M1U B;  1KNE A;  4QUC A;  4FXK C;  4X3S A;  2E2D C;  4HAE A;  3J7A F;  1F9R A;  2AWO A;  3H91 A;  3MAQ A;  1MSH A;  2QIL A;  4DK0 A;  3GO5 A;  3TSS A;  5I9O A;  2D2C C;  3MXP A;  2HCC A;  3GV3 A;  4RHS A;  1LV9 A;  4C56 C;  4DAP A;  3NTK A;  3OSO A;  1EY4 A;  2EZV A;  2PPB C;  4XYQ A;  1SBB B;  5I2X A;  2XRQ D;  1C8C A;  3AU7 A;  4GZY C;  1OXU A;  4HCE A;  1LAC A;  4A3J B;  1LAB A;  3QOJ A;  3J80 L;  1H9J A;  3A55 A;  4ZKC B;  3E0J A;  2E2J B;  5BN3 A;  2B63 B;  2JA6 B;  3PIO 3;  3GTL B;  4CHT B;  4XXE A;  1CQV A;  3D3R A;  2L4N A;  3J81 E;  2F0W A;  1LTB D;  1BCP C;  1I4H A;  5E4W C;  4BA1 I;  1DD2 A;  1HCZ A;  3CQZ B;  3P1H A;  3DXJ C;  1JCK B;  2F0S A;  4A3K B;  4WJW A;  5G3L D;  3S1N B;  5I9P A;  1GXD C;  1SNP A;  1B9M A;  2FFK B;  4R8N A;  5COR A;  2K04 A;  1DOM A;  1B9N A;  1AP0 A;  1MI2 A;  4KJO A;  1RF2 D;  1KAB A;  2EDG A;  1I4Q A;  1SNM A;  4DA2 A;  1E0B A;  4OL7 A;  2EJF C;  3MC0 B;  5D65 A;  1BUV T;  2F0H A;  1SYF A;  4AYB B;  2BOS A;  3K5O A;  3OPO A;  3W3A A;  2RBM A;  2K1B A;  5IOD A;  5J1Z A;  1LTR D;  4JBW A;  1PZJ D;  3S1Q B;  1FYC A;  5I6Y A;  5CV6 A;  1MGS A;  2ZXO A;  1ZKO A;  4OO1 H;  2QF7 A;  1BF4 A;  1QG7 A;  1O7L A;  1CA6 A;  3CRK C;  4EQP A;  3V2T A;  2R92 B;  3OIP A;  5EPL A;  3G7L A;  4IQZ A;  4ULL A;  1SYD A;  1EOT A;  2K5Q A;  4V19 0;  4QUF A;  1BR9 A;  2K5W A;  1K83 B;  2O2L D;  3K7A B;  3M4O B;  4G7O C;  4IN3 A;  5IGC A;  1K8M A;  2WIN B;  4I65 A;  2F03 A;  3GTG B;  1LT4 D;  1ROD A;  2NVQ B;  4J1M A;  5LHY 1;  2NB0 A;  2R6G A;  5JVH 3;  4ZAI A;  5ELC A;  3D4D A;  4B9W A;  1EQV A;  1WTV A;  3I72 A;  5IT9 L;  1QIL A;  2WB1 B;  3Q24 A;  3CHB D;  3BVG A;  2IX1 A;  4C1N K;  3A56 A;  4ABN A;  1HPC A;  4CKB A;  1HXY D;  4HR7 B;  4P2C B;  3D4R A;  1E2Z A;  5EKK A;  4BBS B;  2F3V A;  3MWY W;  3HP3 A;  4LMQ D;  3P7J A;  4OHJ A;  2J4X A;  2VB2 X;  5CBE E;  1S5E D;  5CV4 A;  3BVZ A;  3WOE A;  2XSC A;  5EKI A;  3AB9 A;  4C3J G;  3K5N A;  4DU9 A;  1PZI D;  1D5M C;  1TKW B;  4R8I A;  4BS9 A;  4G57 A;  2F0V A;  2DY8 A;  1EU3 A;  3I4N B;  1S5D D;  1BXT A;  2PCF B;  5EBC A;  1S5F D;  4G7Z C;  1PTO B;  2B2Y C;  1XYI A;  1IYV A;  3TDQ A;  4L63 B;  3W2D A;  2WV6 D;  2SDF A;  1A3U A;  1LT6 D;  2EYH A;  1LTA D;  5CBA E;  5D3I B;  3E5S A;  5IGF A;  1VMC A;  1Z6H A;  1IW7 D;  1IYU A;  3TBI B;  4LJZ C;  4K6D A;  5EGT A;  2SNM A;  2A5H A;  2JEA I;  5EBD A;  2NYZ D;  1EWC A;  1CZG A;  3E6Z X;  3RZD B;  1D1I A;  1SXT A;  1I3Q B;  2F0U A;  1GUT A;  1BO0 A;  4H0L C;  1VCI A;  3EFX D;  2JP1 A;  2FMM A;  2Y0S B;  1OXX K;  1DYQ A;  3K58 A;  3RD4 A;  5M5W B;  1TS5 A;  4OIJ A;  5KRU A;  5M9O A;  2L9H A;  1AZQ A;  1TWF B;  5F2D A;  2EE1 A;  2J7Z A;  1PFM A;  5JAV A;  2ZXR A;  4EQO A;  2JSO A;  3FKI B;  3K5M A;  2CW0 D;  1TS2 A;  1CHP D;  3I90 A;  2C5C A;  4ILW A;  3D4W A;  2L5T A;  1F2Z A;  1TQO A;  2OEO A;  2XWB B;  4CJ2 C;  1GHK A;  2QCP X;  1QJO A;  1H9R A;  4KV6 A;  1S5B D;  1Q90 A;  4A3D B;  1A3T A;  1DCZ A;  1Z7T A;  2KCN A;  2YU9 B;  5IGG A;  2HQE A;  2CHB D;  1SYC A;  4XQJ A;  2HCI A;  3T16 A;  1LLR D;  3I4L A;  4QCL A;  1V8Q A;  3H09 A;  5KYL A;  1RHP A;  3D6C A;  2R7Z B;  1IW7 C;  1O7Y A;  1B44 D;  1C4Q A;  4OO1 G;  1QWY A;  2N55 A;  4RA8 A;  1Y1W B;  1VF5 C;  5AFW A;  1RTN A;  2IJ0 A;  1EY5 A;  1E2W A;  2NUC A;  1X3Q A;  2J0T D;  3V05 A;  3OW7 A;  1WTW A;  4RFB A;  3S16 B;  4TQU S;  2F4I A;  4QF4 A;  2A69 D;  4XYO A;  5IOC A;  4A3E B;  3HEJ A;  3TN2 A;  1LO5 D;  4FYD A;  1SFO B;  3JAM L;  2B39 A;  1TS3 A;  2EYJ A;  4KMU C;  3AMU A;  4J6H A;  3ONA B;  1SNQ A;  1JOR A;  2AUK A;  2B2U C;  3GTQ B;  2VB3 X;  1GUN A;  1UAP A;  4HMJ A;  2QDB A;  3OIQ A;  5C3X A;  2A68 D;  3NWS A;  1F2Y A;  2ICE C;  4IUN A;  2DN8 A;  5IGB A;  4F7X A;  2Z8L A;  4KKT A;  1EY8 A;  2OXP A;  1LT5 D;  1ILQ A;  5C0X J;  3BG3 A;  1QOH A;  4RGM A;  4RGN A;  2EYM A;  3WOF A;  1ILP A;  1DJR D;  1Y8O B;  3NK9 A;  1BNZ A;  4PQX A;  5E1F A;  5CV9 A;  1PFN A;  2K6A A;  3J7A V;  1IL8 A;  3T13 A;  2XRS D;  4DXG A;  2VXW A;  5ELD A;  5CC4 A;  3KBG A;  1SYB A;  2PW5 A;  3IFD A;  4FF3 A;  1G8Z D;  4XT1 B;  3MA2 B;  3GV6 A;  5IGD A;  1ONL A;  1B50 A;  2JXM B;  1GUG A;  2NWG A;  3SXH A;  3GD7 A;  3KUP A;  4HSP A;  5C0X H;  2F0F A;  3RUZ A;  3QG1 A;  3A54 A;  2Z1C A;  2K7V A;  2A69 C;  2B2T A;  1WD0 A;  5EPJ A;  4Y7N B;  1SSO A;  2H4O A;  4FF1 A;  1TY0 A;  2D5D A;  1F2L A;  5I6W A;  1V43 A;  3HOY B;  3EQL C;  5ELF A;  2RDF A;  1KDA A;  3PUY A;  1MSG A;  4C3J B;  2JE6 I;  3K6O A;  1RDP D;  3C46 A;  1CK1 A;  3M85 A;  3CRL C;  2TSS A;  3PMF A;  3FPP A;  4FVM A;  4OGQ C;  5C0X I;  1TT2 A;  3S9W A;  2A68 C;  3K0Y A;  3PO3 B;  4WFN 3;  2BCO A;  3SEB A;  1EU4 A;  2JA5 B;  2BE5 D;  2RA4 A;  1WVL A;  3SDZ A;  1JOO A;  1Y1V B;  4A3G B;  5CV7 A;  2F0K A;  4RGO S;  5D3D A;  4A3M B;  2SNS A;  4KJN A;  3PO2 B;  1HA6 A;  2B8F A;  3A8J E;  4CKE A;  2KCC A;  2H1E A;  2EY5 A;  4MIU A;  2KEC A;  1AZP A;  1MBY A;  3NUC A;  2KED A;  4S3S A;  1D2B A;  1RTO A;  3VR6 A;  5C4J B;  2B2V A;  3S1R B;  1F9Q A;  1JIC A;  1FNU A;  3FDT A;  4K8I A;  1JOQ A;  3MVV A;  3U9O A;  3H0G B;  1SYG A;  3GTP B;  3HZX A;  3HKZ B;  3KF8 A;  1II3 A;  2KQ3 A;  1UNS A;  4RAU C;  1LTI D;  3VR3 A;  3VA5 A;  3C3L A;  5JPN C;  2LKV A;  2PZT A;  3IAY A;  3EJI A;  1QNU A;  1CTM A;  4F8M A;  3NHH A;  4L6T B;  4C3I G;  1A6X A;  1QB5 D;  3DUZ A;  4H13 C;  1F77 A;  1STA A;  3H3V C;  2BE5 C;  2EY6 A;  1WCM B;  1OXS C;  3LX0 A;  3TP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...