2NZOA

Crystal structure of a secretion chaperone csaa from bacillus subtilis in the space group p 32 2 1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
111
structure length
111
Chain Sequence
HMAVIDDFEKLDIRTGTIVKAEEFPEARVPAIKLVIDFGTEIGIKQSSAQITKRYKPEGLINKQVIAVVNFPPRRIAGFKSEVLVLGGIPGQGDVVLLQPDQPVPNGTKIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis of Bacillus subtilis CsaA.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Chaperone
molecule keywords Protein csaA
total genus 20
structure length 111
sequence length 111
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01588 tRNA_bind Putative tRNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2nzoA00
1GKHA 4P73A 4UY8C 2ES2A 5ELOA 3T1YQ 1EUJA 3G48A 4JI3L 4X65Q 4DR5Q 3GD7A 4QL5A 3J7ZC 3TRZA 2UXBL 1IXRA 4DV5L 1QZHA 3HOYG 5HGQA 2CCZA 4JI8Q 4X66Q 5K36G 1Q86C 5IT9c 4GKJQ 5EAYA 1SROA 5GADC 4ALPA 3CQZH 1VCIA 2JJQA 2WP8J 4POFA 1RIPA 2Z6KA 4DV0Q 4JBJA 1G6PA 2NVYH 3CC7A 1NMGA 4EX5A 4BBSG 2JA8H 1EQQA 4JI7L 4UPAA 2K5HA 2JA7H 4P71A 3S16H 3KDFB 3J80c 4LF4L 4GOPB 3RLOA 1WCMG 1Q81C 1Y1VH 4DR1Q 4IO9A 4A3MH 1HNWL 5BR8Q 4A3EH 5J3BA 3I4MG 2KCTA 2V1CC 4LUOA 1YBYA 2Q2TA 1PH1A 4APVA 4O0AA 5C0XI 1YZ6A 2N49A 3SGIA 4A93G 2H5XA 1X65A 5LMUQ 4GN4B 3I56A 1XPRA 1YHBA 1VQIA 3PV0A 5M3MH 2VUMG 1C7YA 1KQSA 1MKHA 2R92G 4DV5Q 2F52A 3L2PA 1BKBA 1L1OB 3PGZA 3T1HQ 4HJ5A 4A4IA 2UU9L 1PH8A 1N34L 2NZHA 5C3EG 5IYBG 1X6OA 3KOJA 2CFMA 5FJ8H 4GNXB 1YHAA 1Q82C 2GN5A 3PCOB 4IPGA 4DR2Q 1FJGL 4A3DG 1A62A 2MQHA 2JA5H 1OXUA 2ZJQA 4QQBX 4L5QA 4BXXG 1CSPA 1SFOH 3S2DH 5C44H 2NN6I 1DGSA 1CKOA 1U0LA 1N33Q 3U58A 5IYDH 1G51A 5C3EH 1J5EQ 2OCEA 2ZTDA 2GVAA 5IP9G 4A3CH 1X56A 2CKZB 3KDFA 4JV5Q 1JJGA 2BH8A 3OW2A 4LF9Q 2LXKA 3M4PA 4K0KQ 1V43A 2ZJRA 4A76A 1TWCH 4JBWA 4GN5A 4UP7A 2N8NA 4GLXA 2JEAI 1I94Q 3PUVA 1G291 1TWGH 4YHHL 2UU9Q 2K5NA 3M7NA 1IBML 2HHHL 3I4NG 2ATWA 1I3QH 5BR8L 4DR4Q 2DUDA 4KHPQ 1LUZA 3AYHB 2BA0A 3F2CA 4YWKA 2VS1A 1R9TH 3ICEA 2WB1G 1XNQL 1WI5A 3M85A 3M9BA 4JI7Q 4X64L 4HJAA 1X3EA 1LTLA 4GLAC 3J80i 1HZAA 1Y14B 1VQ9A 2AWNA 4LF5Q 2R93H 4DV2Q 1JMCA 2I5HA 1MJEA 2E8GA 4A3JG 3U4VA 3PIPA 1NBWA 1WCMH 3J81j 4DV4Q 5GAGC 4DUYQ 3A0JA 2I0QA 4DR5L 4TVAB 5IE8A 4JI6Q 4DK6C 3S2HH 4NXML 2VQFL 3S17H 3CCQA 4KHZA 2HT1A 3F2DA 3CCVA 3HKZE 4DV1Q 1M1KC 5GAHC 3PO3G 1EYGA 1YNXA 4GKKQ 1XPOA 2A1AA 2F4VL 1S3OA 1VS0A 3PUYA 2CQOA 4A3KG 3EIVA 5M3FH 1Y1VG 1Q46A 1K3RA 4JI4L 1M90C 1S40A 3KJOA 1KXLA 1E7ZA 5GROA 4QGUA 4LFAQ 4A3FG 5ELNA 1KIXA 1N36Q 1VQDA 5IYBH 4OX9L 2HIVA 1MIUA 4IPDA 3AEVA 4LW1A 1MJCA 2JEBI 2AWOA 4YCVA 4OXPA 4A75A 2LXJA 2VZAA 2WB1E 4C2MH 4A3GH 2IX0A 3HOUH 2NVQH 1VQ6A 4AYBE 2CWAA 4LFBQ 5LMNW 1Q8KA 1V1QA 5AJ3L 4LFCQ 2F4VQ 1X3FA 4IPCA 3HOZH 1GD7A 1X54A 5IP7G 1I94L 2NVXH 3S1QH 4K0KL 2EQSA 3HOXH 3EN2A 3TS0A 1QVGA 4BBRG 4OX9Q 2VNUD 1N32L 5IY0A 4L5RC 3UDXA 2UUBQ 2VQEL 3I4NH 4DR6L 1D8LA 3E0EA 3HOYH 3HOVH 2I5LX 1TXYA 1C9OA 1OXXK 4PMWA 2XTIA 5IYCG 1I5FA 3KYHC 2VY3A 3CCJA 4GNXC 2PMZE 1HNZL 2YTVA 1PFSA 3K7UC 3CCEA 4DV0L 2GVBA 1VQ5A 2ZTCA 4YCWA 4GS3A 1N34Q 3CCUA 1ASYA 4JI0L 3KFUA 4OO1G 1Y1WH 3CPFA 1KRTA 1VQFA 3I7FA 3KF6B 2N3SA 3F1ZA 4JCVE 1SR3A 1CKMA 4A3KH 3FKIH 5JEAJ 3NELA 5IYCH 1A63A 1PYSB 2HHHQ 1AE2A 2R7FA 1P16A 1VQBA 2EXDA 2KHIA 3E9IA 4QJFA 1YJNA 1K8GA 3OYYA 4GOPA 2K75A 4B3SQ 1BBWA 1L1OA 2WAQE 3UDIA 3H0GG 4IPHA 4B3TL 4HIOA 4A3IH 1VQLA 2YU9H 3F8TA 1L1OC 4JI6L 1Q1BA 3OTOQ 1YHQA 2AKWB 1NY4A 1TWFH 1U5KA 3J7A5 1Q7YC 4OWXB 4BY1H 4DR1L 3CW2C 2R7ZH 1GO3E 3EBEA 4L5TA 1E22A 4HJ8A 3OTOL 4H02A 3G4SA 3M3YH 2FXQA 1UEBA 4LF5L 4PZ7A 5IP7H 3K80C 1HNZQ 1KD1C 1K83H 4XIGS 1HNXL 2OQKA 3CP0A 1HZBA 2Q2UA 2PQAA 1LM0A 4PZ6A 4A3DH 4Y52H 4DK3C 3PSIA 3CC2A 4BXXH 3STBD 1NE3A 4IOCA 3T1HL 3FP9A 1CUKA 4YWLA 1CSQA 5M3FG 3RZDH 1EOVA 1GM5A 4JI5Q 5IYDG 4LFBL 3GTOH 4FDBA 3GTPH 4P72A 1IBLL 4LF7Q 2JE6I 4J15A 2RCNA 1PVOA 1E3PA 3GO5A 1N9WA 3J81c 3CD6A 1D7QA 3RR5A 4IJHA 1Q12A 1HJPA 3PUXA 3S1MH 4LUZA 4JOIA 1L2FA 1N36L 2OQ0A 2JK8A 3BU2A 3I4OA 4RMFA 1PA6A 4JOIC 2VL6A 3HOUG 5IWAQ 2UXCL 3ULJA 2ASBA 4NXNL 3W1GA 1C0AA 2E5LL 4OWWB 1BVSA 3FKIG 4LF4Q 4GKKL 5IP9H 2D0OA 1YVCA 4DUZQ 4HIKA 1VQJA 5M5YH 4B3TQ 2PI2E 4NB3A 2KHJA 2MO0A 1KRSA 1QZGA 2JA5G 1JJCB 2Y0SG 3S1RH 1XMOL 4JI2Q 1K9MC 3GTLH 1X3GA 3AFPA 4GN3B 5E7NA 4OONA 4LFCL 2JA6H 3STBC 1PH6A 1KC8C 2MNAA 3CPWA 2OTLA 4DNIA 4AIMA 1AH9A 5LMNQ 4X65L 2QA4A 4A3LG 3VDYA 1SRUA 2K52A 4KI0A 4R4QA 1YI2A 1HNXQ 3MEFA 2JA9A 1IYJB 1VQKA 2VQFQ 4A93H 1Z9FA 2KENA 3I55A 3RLNA 4O2DA 4JBMA 4JG2A 2N78A 3L7ZC 5M3MG 1KL9A 4JI4Q 4GKJL 4KLKA 5IWAL 1I6HH 4YY3Q 1XMQQ 4NPSA 3A5ZB 1I50H 1UE6A 1VQ4A 3L0OA 4MNOA 1JE5A 3PO2G 3KJPA 3A5UA 3DM3A 2ID0A 4LNQA 2RF4A 1QVCA 3PF4A 1T9HA 2KCMA 2IY5B 4BBSH 2JA8G 4A3IG 2BA1A 1W3SA 2HQLA 2YTXA 5GAEC 3H15A 5LMNL 1IBLQ 1ASZA 4LF7L 2Z6KC 3W5OA 3JC66 4A3MG 1YIJA 3GTQH 4KHPL 4NXNQ 2MO1A 2D0PA 1VQMA 4GNXA 1OTCA 1SE8A 1VQ7A 3K0XA 1L0WA 4JI0Q 3NEMA 1YITA 3D0FA 4A3FH 4DV2L 4IFDI 2UUCL 2I5MX 3HOXG 3TS2A 2Z0SA 4DV6L 3M4OH 2VUMH 1QUQB 1K8AC 1JT8A 2Q2HA 4GOPC 1WOCA 1N8RC 2R92H 2NVTH 1IZ6A 1WFQA 2K50A 3JAMi 1TWAH 4DAYB 1EQRA 4BY7G 1H95A 4C3JH 4WJ3M 1N32Q 3GTJH 2ZM6Q 2UUAQ 2JQOA 1B8AA 4X62Q 4LF9L 5LMUL 3CAMA 4BBRH 1RL2A 4LF6L 4NXMQ 3BZKA 1CKNA 4R4CA 1UE1A 2HIXA 1K73C 5DLQE 1VQ8A 3CCLA 2JA6G 1XMQL 5FLMH 1NMFA 2YTYA 3I2ZA 1J6QA 2ALYB 3RNUA 2AHOB 2L15A 3S15H 1OXSC 1FJGQ 1VQHA 3PO2H 4X6AH 1B70B 1S72A 4B3RL 1P8LA 2B29A 2WFWA 4AYBG 2E2IH 3GTMH 4GLVB 2IT1A 2PNHA 3S1NH 2C35B 4IJLA 4YWMA 3RLFA 3TQYA 3PO3H 4DV3Q 1VQOA 4BY1G 4HIMA 1UE7A 3KLWA 4R4OA 4UP9A 3TEHB 3UDGA 3W1BA 4JYAQ 4JI8L 1EWIA 4LWCA 1A8VA 2ZTEA 1KHIA 4X66L 3H3VI 3HOWH 4DR7L 5M5WH 4DR6Q 3IRBA 2OWOA 1VQGA 2R6GA 4DV7L 2B63H 4IFDG 4OO1I 3TREA 4JI2L 1KAWA 3PIOA 3U4ZA 1XTDA 4JI1L 3UE0A 1A0IA 4TQUS 4LUVA 1PH4A 1IBKL 2PI2A 4Y7NH 3GTKH 2EIFA 1HNWQ 4DR7Q 3HKZG 1PHJA 4BA1I 3GDEA 4JYAL 1XJVA 1HR0Q 4DV3L 2F3IA 2AMCB 5GQOA 4C3IH 1Q1EA 2Y0SE 1TWHH 1EFWA 4EQ5A 3UDFA 4QIWE 1SMXA 5HY6A 3JAMc 2ZJPA 1YJ9A 1X9NA 4HJ9A 4DV6Q 2A8VA 3AFQA 3Q8DA 2UXDQ 2E2JH 5JJLA 3CMAA 3B6YA 3F2BA 3AQQA 1XNQQ 4JC0A 4AQYL 1XPUA 4WJ4A 4P75A 3LGJA 1HR0L 3GTGH 4BA2I 1HH2P 3ER0A 2WAQG 2QGQA 5C4XH 2UUBL 3H3VH 1WYDA 1XNRL 2BH2A 2OTJA 2IX1A 3G6EA 5JEAG 2DGYA 2UXDL 4JI1Q 4POGA 4JV5L 4PG3A 1OXVA 3CCSA 1PYBA 4DUZL 4DR3Q 4IFDJ 3E9HA 2R93G 3FHWA 1BBUA 2XGTA 5C0XJ 5AJ3Q 4B3MQ 1N33L 4R1JA 4DUYL 2K5VA 5H1SE 2UXCQ 3A74A 3ERSX 3CC4A 1PH9A 1Z47A 5C4JH 2NZOA 1WJJA 3NBHB 3HOWG 1FL0A 1PH7A 1SLJA 1PH5A 4DAMA 4A3BG 2R7DA 3PUWA 2CWPA 4DV1L 4HJ7A 2D62A 4LF8Q 1VQNA 1W2BA 2UUCQ 5JJIA 1E1OA 3PUZA 4LFAL 4PZ8A 3RN2A 2RHQB 1FVIA 5FLXc 2QEXA 3S14H 4C3HH 4DPGA 2LSSA 4JI5L 1HZCA 3ZJYC 5JJKA 5M5XH 2A19A 3PF5A 4OWTB 4L5SA 4RG1A 3M4QA 2R7ZG 2UXBQ 4JI3Q 4A3LH 1LYLA 3WWVA 1GVPA 3KF6A 3CF5A 1AE3A 1EIFA 1UE5A 1K0RA 1PH2A 1IBKQ 4LF6Q 1XMOQ 1OXTA 4B3SL 2NN6G 3K8AA 5C0XG 3BZCA 4X62L 1JB7A 4LF8L 4X64Q 4DV7Q 1Y1WG 2ZM6L 2JA7G 1J5EL 2KBNA 1PV4A 2K14A 4R4IA 1V9PA 4DV4L 3RN5A 4A3JH 3RZOH 1JJ2A 1SN8A 3NENA 1VQPA 5C4XG 2B63G 4YHHQ 4P74A 1O7IA 1B7YB 3H0GH 4DR3L 4B3RQ 2Q2IA 4MZ9A 4R4TA 1VQEA 4QY7A 2E2HH 3MXNB 3K7AH 1XNRQ 2YV5A 2PQAB 3J81i 4A3EG 3BJUA 2YYZA 4JBKA 3I4MH 4DKAC 4DR4L 1X55A 2VQEQ 1VQCA 1IBMQ 1QUQA 3S24A 3U50C 1PH3A 4YCUA 4B3ML 3T1YL 4AQYQ 3HOZG 4A3CG 3CCMA 3CXCA 3D31A 3G71A 2VW9A 1IL2A 2B3GA 4A3BH 1FGUA 3CMEA 3ULPA 4UP8A 4DR2L 1E1TA 1NJIC 2UUAL 1NTGA 2RHSB 4ME3A 2MFIA 4XTCS 2IHFA 4A3GG 3ULLA 2E5LQ 3KF8B 1VQAA 3UE1A 5C44G 1QVFA 4YY3L 1E24A 2IHEA 3HKSA 4AH6A 5FLMG 1YEZA 3HOVG 4BY7H 4MTNA 3HFZB 3CCRA 1HR0W 1CKNB 1UWVA 3K81C 5FJ8G 2K4KA 1YJWA 4IOAA 4HIDA 1EIYB 3DLLA 1HZ9A
chains in the Genus database with same CATH superfamily
2QDBA 4P73A 4ZYSA 4QCLA 4DR5Q 4QL5A 3J7ZC 2IW3A 2CCZA 4JI8Q 2AUKA 1Q86C 5IT9c 5EAYA 2WAQB 5GADC 2B2WA 1EIGA 1RIPA 2Z6KA 4IN3A 1NR4A 1TU2B 2KEEA 3OIQA 1G6PA 4EX5A 4JI7L 3A8JE 4LF4L 1BR9A 1PTOH 3OIPA 4N8FA 4BBSB 4A3MH 3CRLC 4A93B 2E2IB 1YBYA 2B8FA 1I4PA 1KDBA 2N49A 3SGIA 5C3EB 2E74C 1XPRA 4GN4B 1I4GA 1GJXA 1YHBA 3PV0A 1HTPA 4KN4C 4NKLA 1MKHA 4K8JA 4OEMB 2R92G 1BKBA 2VUMB 3T1HQ 4A4IA 1STHA 3H0GB 2B2YC 3VYTA 2E2HB 1Q82C 2GN5A 4A3DG 2MQHA 2ZXPA 5KIXA 1SJED 1CSPA 1S5FD 3VR2A 5IYDH 4WJWA 3LNNA 1BOSA 5C3EH 5KNCA 1J5EQ 2ZTDA 5IP9G 2CW0D 1ICFB 4JV5Q 4K0KQ 2LXKA 1V43A 4A76A 3MXUA 3R8BA 4A3DB 2Z1CA 1LTAD 5EPLA 5IODA 3PUVA 1DOKA 2HHHL 1D1IA 3I4NG 1I3QH 5BR8L 2Q8RE 1EY5A 4KK7A 4YWKA 1Y1WB 4FNFA 4ZCKA 2WB1G 1TS4A 2R93H 1QOHA 2KVMA 1JMCA 4BS9A 4R8IA 2K6AA 3NBIA 2E8GA 3R93A 1NBWA 1WCMH 4OIJA 3S2DB 4GZYC 2X69A 5GAGC 3A0JA 2NVQB 1ZYRC 2KECA 4KHZA 4OGQC 3EROA 2HT1A 3FPPA 5J1ZA 4HSPA 4C3HG 5GAHC 3SXHA 4KKTA 1S3OA 1NUCA 1TWGB 3EIVA 3FKIB 5ELEA 1G91A 1M90C 1KXLA 1E7ZA 4QGUA 4CJ2C 4KY6A 4ODGA 1N36Q 2ZT9C 4IPDA 3DWQA 1MSGA 3AEVA 2JEBI 3N52A 2AWOA 4YCVA 2LXJA 4C2MH 5LL6X 3HOUH 4G57A 3P75A 2NVQH 1VQ6A 1AEXA 5C4HA 3NHHA 2F4VQ 2WKCA 5IGBA 4K0KL 5HGTA 1QVGA 3DUZA 4MTKA 4XT3B 2NVYB 4OX9Q 2VNUD 2UUBQ 3BYTB 4R8NA 5EQ0A 1OXXK 2CHBD 2R7ZB 3K5NA 2PMZE 2ZXOA 3K7UC 3CCEA 1EWCA 3SHLA 1ONLA 2K5QA 1VQ5A 4RKBA 4YCWA 3KFUA 1GHJA 3CPFA 4I65A 1K8MA 3C1EA 1SR3A 1TWAB 2F0JA 3QOLA 3NELA 5IYCH 1TS3A 2F0OA 1VQBA 1YJNA 4GOPA 2O4XA 2WAQE 1DOLA 4IPHA 1T5XD 1L1OC 2HD3A 4G7OC 3OTOQ 4F8MA 3P1HA 4DR1L 1SYDA 2R7ZH 3I4NB 3GTKB 4AYBB 4HJ8A 3T53B 1UEBA 2A68D 1KABA 3WDNA 1KLUD 4HCSA 1XYIA 4LF5L 1HNZQ 5A2QL 2Q2UA 5NUCA 1LT4D 5C4XB 4PZ6A 4DK3C 2OF1A 1NE3A 1X3PA 3FP9A 1SNPA 4CDEC 5IYDG 3E5SA 3GTPH 4C1NK 5AFWA 1R4QB 1SYEA 1L0YB 3GO5A 3J81c 1HA6A 1D7QA 2LFNA 2FHTA 3OWFA 2WB1B 2NUCA 3PIP3 2JK8A 3I4OA 1PA6A 1NCVA 5IWAQ 4M1UB 1BVSA 1DOMA 3OMGA 4GKKL 1A2UA 2D0OA 2QILA 1ILPA 1STNA 5M5YH 1QZGA 1JJCB 3S1RH 1K9MC 1V8QA 2Z8LA 3GTLH 1X3GA 2EYOA 3HKZB 3H91A 5E7NA 4DAPA 4LFCL 2E75C 2JA6H 2A6HC 1B50A 1WD0A 2MNAA 3CPWA 4DNIA 3GTQB 4X65L 4NW2A 1KDAA 2QCPX 4IFDH 1JR0D 2NBFA 5IIFA 1D5XC 3A56A 2JA9A 1VQKA 1DONA 1E0BA 1B9MA 4O2DA 2F3VA 4YIJA 1KL9A 3D4RA 2E2DC 1KNAA 5C4JB 1HFNA 1O78A 2L5TA 5M3MB 1I50H 1VQ4A 3L0OA 2I46A 4MNOA 3PO2G 2XRQD 1O7ZA 2HCCA 4CJ0B 3S1MB 5GAEC 1F2ZA 3H15A 1IBLQ 1ASZA 3ERQA 4A3MG 3GTQH 3S9WA 1VQMA 1OTCA 4ZRZA 1PFNA 3NEMA 1YITA 1ZXTA 3D0FA 4A3FH 1ENAA 1XX8A 4IUTA 1G6ZA 2I5MX 1Q90A 2NTSA 3D4DA 5I2YA 3TS2A 2EE1A 4G7HC 2Q2HA 2M9VA 2R92H 1IKLA 3FDTA 4K5VA 5EKLA 3BVGA 1STGA 4LF9L 3CAMA 4BBRH 1QNUA 1JWSD 4S3SA 4NXMQ 2KA7A 3CKIB 3MVVA 1K73C 3RD4A 1VQ8A 3CCLA 4J6HA 3I2ZA 2YTYA 2J4XA 2AHOB 5G3LD 4K6DA 2JA7B 2I07B 1OXSC 2F0EA 1FJGQ 3KF8A 4B3RL 5ELDA 3HOVB 2PNHA 2LMCB 2EY1A 2C35B 2MHVA 4FF1A 3RLFA 3PO3H 5ELCA 4R4OA 4X66L 1F77A 1KHIA 3H3VI 4DR6Q 2LKVA 4RKLA 4RH6A 3TREA 1KAWA 3JAME 1A0IA 4A3KB 4KJNA 1EL0A 2PI2A 1STEA 3GTKH 2AQ1B 1PFMA 3HKZG 1PHJA 2L9HA 4F7XA 4JYAL 1XJVA 1HR0Q 2JXMB 5GQOA 4C3IH 1Q1EA 2XNAC 4V190 4RGMA 4C3JG 1JICA 3UDFA 4QIWE 3JAMc 2ZJPA 1K3BC 4DF7A 3BDCA 4HJ9A 1EY6A 4OELB 2UXDQ 4XQNA 2E2JH 5JJLA 1J9OA 2N55A 3NTIA 1Q8IA 2PZTA 3GTPB 1V1OA 2XSCA 4UHVA 1EY4A 2WAQG 1H9KA 3H3VH 1WYDA 2BH2A 2OTJA 2IX1A 3PO2B 2L55A 4DA2A 4FF4A 2F0QA 2G9DA 5A2QE 4JV5L 3MXPA 5ELFA 4DUZL 1PRTD 4ZQ3A 2SOBA 4DUYL 3ERSX 4NP5A 3J80E 3HOXB 1I6HB 3URYA 3BZDB 3X3MA 1WJJA 4L8JA 1FL0A 2Q8TA 3L9AX 2CWPA 4HJ7A 4LF8Q 4B08A 1W2BA 2XN9C 2UUCQ 1EWHA 4LFAL 4PZ8A 1LTRD 4E6IA 4C3HH 3S14H 2HQEA 1CA6A 2ZXRA 5IGDA 3M4QA 1EEFD 3KF6A 3CF5A 1AE3A 2MGSA 1I6VC 1UE5A 4CDFC 1OXTA 4B3SL 3S1NB 2F0LA 3DEOA 4LF8L 3EVQA 4DV7Q 1Y1WG 5FLXE 4DV4L 2QW7A 4XQJA 1QILA 3BVZA 5DNFA 3OOCA 2X6LA 1WTRA 1B7YB 3H0GH 1E2WA 2Q2IA 3K57A 4NDXA 3MFYA 3OSOA 2MUYA 2E2HH 2V4DA 2DNCA 4JBKA 3I4MH 4YCUA 2JSOA 3NWSA 4H13C 1A3UA 2K32A 1MGSA 1E1TA 1F2LA 1NTGA 4K5XA 4ME3A 2IHFA 3UE1A 1B53A 1TS5A 1PRTB 3I90A 5FLMG 3HOVG 1Y8NB 3NSWA 1EZ6A 1CKNB 5K36H 2A68C 4U68A 4IOAA 4HIDA 5D14A 2KHSA 3I70A 2TMPA 1F9PA 3G48A 4X65Q 3HOUB 2HUGA 3GD7A 3TRZA 4X66Q 1YNND 5K36G 4GKJQ 5CV6A 4ALPA 3CQZH 4EVOA 4L6TB 4DV0Q 4ZLTF 1Y8OB 1HPCA 3J81E 2NVYH 3CC7A 2JA8H 2K5HA 3J80c 1WCMG 5E4WC 5BR8Q 5J3BA 3V96A 2KCTA 2V1CC 3TZUA 2VXWA 4IALA 3JAML 1YZ6A 4KY7A 4I7ZC 1D6EC 3I56A 3KBXA 4XQQA 2VUMG 4U673 1KQSA 1DYQA 2EPBA 4DV5Q 1CM9A 3L2PA 3PGZA 2K5WA 1AN8A 5IT9E 2UU9L 1K8OA 1PH8A 4NMZA 5DEHA 2RBMA 5C3EG 4K6LA 5FO7B 2CFMA 2EXZA 1YHAA 2EY5A 2B2VC 5LHY1 2PW7A 1OXUA 4L5QA 1TIID 4IZ8A 4RWSC 2NN6I 5C44H 4G4KA 1U0LA 2FMCA 1G51A 4A3CH 2A69C 2BH8A 2K04A 1G291 1Y69U 3M7NA 1XXGA 1IW7C 2VS1A 1R9TH 3ICEA 3M9BA 1SE4A 3LWUA 3S14B 1SE2A 4LF5Q 2EYLA 1DJRD 1R4PB 1XTCD 3IFDA 4UAIA 4A3JG 3U4VA 3PIPA 4DFAA 1AZPA 3DEPA 4DUYQ 1WTXA 3HKZE 2XVSA 2L0CA 3D6WA 3PO3G 3K5LA 1EYGA 2OEOA 4RCNA 4GKKQ 5C5MA 3J7AV 2F4VL 1VS0A 3QWNA 3SDZA 2CQOA 4A3KG 5M3FH 1Y1VG 5I6YA 1BQQT 5CC4A 1S40A 2EJFC 4A3FG 2D5DA 3TP8A 1KIXA 5ELNA 4ID6A 5IYBH 2HIVA 4IUNA 4O1NA 3SK4A 3MAQA 1JOKA 3I4MB 2NWGA 1EQVA 1V1PB 1U4PA 2EOTA 1RJTA 3J80L 2Z4HA 1IHZA 1I50B 4LFCQ 1WCMB 3S1QH 1JE4A 2XIWA 3SVMA 3EN2A 1SEBD 4BBRG 1N32L 2WINB 4L5RC 3NBHA 4A3IB 3E0EA 1LABA 3QR8A 2F0IA 1S5DD 1ET9A 5IYCG 1I5FA 1K83B 5I2XA 3ZYYX 1KAAA 1B2TA 4GNXC 3OMCA 1AZQA 4DV0L 4DAYA 1ASYA 3PQIA 2F4IA 3I7FA 3T4AC 1EQTA 5JEAJ 4H0LC 1PYSB 3TDQA 2KHIA 4QJFA 3P7JA 3J81L 1PMRA 1E2VA 2CH4A 4KKSA 1BBWA 4QB4A 4HIOA 4A3IH 1TWHB 1ZEQX 2QEJC 3Q0AA 4MIUA 1NY4A 1U5KA 4BY1H 1TS2A 3CW2C 3EBEA 4L5TA 1E22A 1ZYRD 4XXEA 3OTOL 3G4SA 2R61A 4G7ZC 3SK5A 3MFGA 4PZ7A 2IX3A 1WD1A 4XIGS 5CV8A 1HZBA 3DM1A 2PQAA 4Y52H 1HXYD 1D5ZC 1LTBD 2FFKB 1SDFA 4F87A 3GTOH 2PMZB 4FDBA 4OIKA 1IBLL 1EYCA 1PVOA 3I8ZA 4CJ1B 2Q8IB 1E3PA 1BO0A 1N9WA 1NNXA 3RR5A 1Q12A 2F3WA 3SK6A 1SSOA 3PUXA 4LUZA 4JOIA 1L2FA 5FO8B 2D2CC 5C4ZA 4JOIC 2VL6A 1RHPA 2UXCL 1C0AA 2PNRC 4LF4Q 5CV4A 1CI3M 5DM73 5JVG3 4RHSA 1YVCA 2SNSA 1VQJA 4R9WA 2O5JC 1XWEA 2MO0A 1ESRA 4JI2Q 3AFPA 4OONA 1PH6A 1KC8C 2XWJB 2KUMA 5EKKA 3PO3B 1AH9A 4DXFA 2QA4A 4KV6A 3HGBA 1B44D 1SRUA 2DJGC 1EY9A 4KI0A 1YI2A 2SDFA 1RODA 2VQFQ 4A93H 1Z9FA 3W3AA 2PZUA 4QUFA 1YNJD 3RLNA 1Z6HA 4JBMA 3MXGA 4GKJL 1I6HH 4YY3Q 1IKMA 1XMQQ 4EQPA 3PMFA 1UE6A 5T1IA 2BCOA 1QE6A 3A5UA 2RF4A 2EJGC 3MA2B 3PF4A 1SXTA 1B3AA 3DHQA 5T1GA 2HQLA 2G9HD 4LF7L 1SNQA 2VB3X 4NXNQ 3IFTA 4JPBW 4GNXA 1CZGA 1SE8A 3A8KE 4J1MA 1F9QA 1V1PA 1AW7A 3HEJA 4DV6L 3M4OH 2QDLA 2ICIA 2B2TA 1WOCA 1RKNA 1WFQA 2RKSA 1BCPC 2ZM6Q 5FKAC 4BY7B 2JQOA 4X62Q 3F2UA 1EY8A 3AMUA 1CKNA 2BDNA 4FVMA 2HIXA 1ML0D 5DLQE 1QWYA 1XMQL 5FLMH 3RNUA 1SNOA 1FGBD 2F0VA 1WVLA 3S16B 3J7AF 2RDGA 1S72A 2B29A 2WFWA 3WOFA 4GLVB 2IT1A 3S1NH 4BY1G 1UE7A 4UP9A 3TEHB 3UDGA 3W1BA 1GUWA 4BWGB 5M5WH 3IRBA 2OWOA 2R6GA 1B3QA 2B63H 3NK9A 4JI2L 4JVZA 2FMMA 4TQUS 2AQ3B 1PH4A 1IBKL 3PIO3 4BA1I 3GDEA 1A2TA 4DV3L 1FNVA 4K2KA 2F3IA 4C2MB 1KLGD 1YNNC 5F2DA 3QIAA 2F0TA 2CVRA 1MD2D 3CQZB 4KN7C 1EFWA 5HY6A 3C3LA 2A8VA 5CGKA 3CMAA 2LY7A 3F2BA 3AQQA 4JC0A 5M5XB 4P75A 1LTSD 5C6AA 3LGJA 3GTGH 4BA2I 2JA5B 3ER0A 2QGQA 3TMEA 5C4XH 1SFOB 5E3FA 2KEDA 1F9SA 3G6EA 1B1ZA 2L12A 2UXDL 4JI1Q 4QMGA 4DR3Q 3MWYW 3E9HA 3FPUB 3FHWA 1BBUA 4CDCC 5C0XJ 4B3MQ 4IUUA 4R1JA 5H1SE 3A74A 3H94A 4RGOS 1PH7A 5J39A 1SLJA 1PH5A 1QG7A 4DAMA 4A3BG 2R7DA 4DV1L 2D62A 1FYCA 1H9RA 2K01A 4HTHA 1E1OA 3PUZA 1YNJC 2F0HA 2RHQB 2B2UA 1FVIA 5FLXc 1LACA 3S17B 4K5WA 2LSSA 2PW5A 5DAUA 3ZJYC 1HZCA 3PF5A 4OWTB 4RG1A 2UXBQ 4A3LH 1LYLA 1IBKQ 1EY0A 2PCFB 1K0RA 3TP6A 5C0XG 3NPPA 1A3VA 3S2HB 2ZM6L 3QB3A 1HUMA 2KBNA 1MSHA 1V9PA 3NQTA 4A3JH 2M00A 5IGFA 2J0TD 1R9TB 1SN8A 1VQPA 2DN8A 2XRSD 4YHHQ 1W6KA 2JN4A 3NQIA 4DR3L 4KJOA 4MZ9A 3HP3A 3TZDA 3MXNB 5CV9A 1C4QA 3BJUA 2XWBB 1X55A 1IBMQ 1JOOA 1QUQA 3T1YL 1LT6D 4AQYQ 1TY2A 3D31A 3G71A 2VW9A 1IL2A 2B3GA 1FGUA 1CQFA 4HSVA 2UUAL 1PTOF 2DNEA 3HOZB 2RHSB 5D3DA 4A3GG 2E5LQ 5IGGA 5C44G 2RA4A 5M3FB 4YY3L 3HKSA 4BY7H 4IUQA 3HFZB 3QJYA 5JVH3 1HQRD 3WOEA 5FJ8G 3DLLA 1CTMA 1F9RA 1GKHA 4ZAIA 3O13A 4UY8C 1X32A 2Z6BA 5ELOA 1C48A 1SAPA 4ZUJA 4KTAA 1LV9A 3ND9A 3T51B 1VCIA 4POFA 2CQAA 3CU7A 1LT5D 5K5PA 3D6CA 3M7GA 4BBSG 1IYUA 2JA7H 2IWHA 3KDFB 5CBAE 1STBA 2AQ2B 3K7AB 2WKDA 3RLOA 4GOPB 3MTSA 1Q81C 4DR1Q 4IO9A 1HNWL 4A3EH 2OT2A 1DM0B 2EYPA 4APVA 4O0AA 1TWCB 2HCIA 2H5XA 1X65A 2OXPA 1C8CA 3SK8A 1C7YA 4K2LA 3R2IA 1SYCA 3MHBA 4FYDA 3QOJA 5EPJA 4C1NI 4HJ5A 1BNZA 1PLFA 1GUSA 5IYBG 1X6OA 3NWTA 2K5DA 3PCOB 1CHQD 1CQVA 3S1QB 1A62A 2JA5H 1SFOH 1DGSA 1PRTC 3U58A 2OCEA 2GVAA 2Z4IA 2CKZB 5I9PA 3KDFA 3OW2A 4JBWA 4UP7A 2N8NA 4GLXA 2UU9Q 4YHHL 2K5NA 5KNBA 1IBML 2K1BA 2ATWA 4DR4Q 2DUDA 1PTOB 1LUZA 2BA0A 2N88A 4KHPQ 1SMYC 2F0FA 3KUPA 3LX0A 1WTQA 3GV6A 1O80A 1SBBB 4X64L 1LTLA 3J80i 1ILQA 1VQ9A 1WTPA 4DV2Q 3VYSA 2I5HA 2DJFC 5COYA 1JC7A 2BOSA 1MJEA 1LTTD 2D9UA 3A7LA 3SE0A 4BY1B 5IE8A 4JI6Q 3S2HH 4NXML 4C3HB 2AUJD 5JJZA 3F2DA 2NVXB 5D3IB 1SYFA 4B9XA 4C3IB 4DV1Q 2A6EC 4DK1A 1M1KC 1Y1VB 4FXKC 1XPOA 2A1AA 1K3RA 4JI4L 1IYVA 1BDOA 3K6OA 1HUNA 5HURA 1VQDA 4OX9L 1MIUA 4CDDC 4LW1A 2PPBC 3KK7A 1GOZA 3GTJB 4A75A 4A3GH 2WB1E 5BN3A 4AYBE 2CWAA 4LFBQ 2B2WC 5LMNW 1V1QA 5AJ3L 3L3OC 2NVTB 1I4HA 1X3FA 3NE5B 3TSSA 4ZUIA 3HOZH 1SMYD 1X54A 5IP7G 1PFBA 2NVXH 3HOXH 3TS0A 2EYHA 1CHPD 1TWFB 4HN7A 3VR3A 1PDQA 2X6GA 1ZKOA 4O42A 1TXYA 4JW0A 1C9OA 2SEBD 2XTIA 3CCJA 2VY3A 4RFBA 3S15B 1HNZL 2YTVA 1PFSA 4CGYB 2GVBA 3D8GA 2ZTCA 4JI0L 5BN4A 4RA8A 4OO1G 1VQFA 1EYAA 4DNRB 5EBCA 2N3SA 1GHKA 4JCVE 3F1ZA 2P5ZX 1H9MA 3FKIH 4PMBA 3G6JB 3V05A 2EXDA 1K8GA 1DCZA 3OYYA 3H6MA 2RDHA 4F88A 5BN5A 4B3SQ 1L1OA 3HG9A 1Q1BA 5C3WA 4N9PA 3IL8A 1GO3E 1GUNA 5L37A 1A6XA 1PRTF 4H02A 3K80C 1K83H 3RUZA 1HNXL 3CP0A 2WACA 1LM0A 4BXXH 3STBD 3KLRA 3NP8A 4YWLA 1CSQA 1EOVA 3RMHA 1GM5A 4P72A 4LF7Q 3VYUA 2JE6I 4J15A 2RCNA 1SNMA 1HHVA 1TVXA 1HJPA 3S1MH 2F0GA 3KLSX 3NTHA 4ILWA 3HOUG 2ASBA 4NXNL 3W1GA 2E5LL 1A15A 4DUZQ 2H1EA 4RGNA 3DWAA 2PI2E 3VA5A 4NB3A 3NXWA 1KRSA 2JA5G 4IUPA 3VYRA 1DD2A 4QF4A 5LMNQ 3VDYA 2K52A 4R4QA 1HNXQ 5D65A 4KKUA 5C0XH 1IYJB 2KENA 4JG2A 2N78A 3L7ZC 5M3MG 2A74C 4KLKA 4ULLA 4CHTB 2M2LA 3KBGA 1JE5A 1S5ED 4IUVA 4CKCA 3DM3A 1QVCA 4EQOA 2KCMA 4BBSH 2JA8G 2EY6A 4A3IG 1VF7A 3R2TA 5CMDA 1TQOA 3BS1A 4JK1C 3W5OA 1YIJA 4KHPL 1HTLD 5E1FA 2MO1A 1E2ZA 2D0PA 4RHRA 1VQ7A 1JCKB 3K0XA 4JI0Q 3GTGB 5KRUA 1PZJD 3E3XA 4IFDI 3HOXG 2IPKD 2Z0SA 1S4ZA 5M5YB 2VUMH 1QUQB 1K8AC 4A3BB 5E4XA 5C3XA 1N8RC 4ABNA 2NVTH 1IZ6A 2K50A 2JA6B 3ITPA 2CW0C 1MI2A 3D4WA 1GXDC 4BY7G 4C3JH 5IGEA 2HDMA 1H9JA 5LMUL 1RL2A 4LF6L 3NTKA 3D3RA 3DXJC 2JA6G 1J6QA 5JAVA 4HMIA 2L15A 3S15H 4X3KA 4X6AH 3PO2H 1B70B 3C2PA 1DZ1A 1P8LA 1NAPA 2F0NA 2E2IH 3GTMH 2EYJA 4IJLA 4DV3Q 1VQOA 4HIMA 3EFXD 3KLWA 2ENBA 4LWCA 3TN2A 2ZTEA 3HOWH 4DR7L 1STAA 4DNTB 4A3JB 4DV7L 4IFDG 2G5DA 4A3FB 3UE0A 1J8IA 3U9OA 4OO1H 1HFGA 2GA4B 1LT3D 1B9NA 2CH4W 1AP0A 1D5MC 2AMCB 1TWHH 1HCZA 1SMXA 2K33A 2WV6D 3I73A 4DU9A 1YJ9A 3G7LA 1X9NA 2PQEA 4DV6Q 2WIIB 1RF2D 4BBRB 2DY7A 1XPUA 1HR0L 3Q6SA 1HH2P 5TSSA 5KYIA 1QCBD 3Q24A 1XNRL 1FNWA 4KD4A 5JEAG 2DGYA 1S5BD 1OXVA 4PV1C 1PYBA 2B2VA 3GTOB 4EGVA 1PTOD 2XGTA 1SNDA 4XT1B 2R93B 3CC4A 1PH9A 1Z47A 1O7YA 3RZOB 3MXNA 5JEAH 3PUWA 1JWMD 1VQNA 5JJIA 3GP7A 1DXMA 5JJKA 4EQNA 2A19A 5M5XH 4XDXA 4L5SA 3IKJA 1EU3A 1I4RA 1GVPA 1SYBA 1EIFA 1RD9D 4LF6Q 1XMOQ 1Y8PB 2NN6G 3BZCA 5I6WA 1FR3A 3GQBA 3E6ZX 1SE3A 2RSOA 5C5LA 1PV4A 3RN5A 3RZOH 1BCPF 1JJ2A 2B8GA 4I7AA 3HZXA 3NENA 2VB2X 4L63B 3H09A 4B3RQ 3AB9A 5CORA 3FEWX 4FF2A 4WORA 1VQEA 2E76C 1XNRQ 2H4OA 2PQAB 2YYZA 4DKAC 1VQCA 4B3ML 3S24A 1CT1D 5JPNC 4C3IG 1ENFA 4B9WA 4HCEA 3CCMA 3CXCA 2EY2A 4A3BH 4DR2L 1NJIC 3QO2A 2J7ZA 2PYKA 4PQXA 4OL7A 3LWEA 3KF8B 1U9RA 1VQAA 4C3JB 3TP7A 2IHEA 4AH6A 1YEZA 1TY0A 4MTNA 3M4OB 2KCCA 3CCRA 1HR0W 3K81C 1EIYB 1HZ9A 2F0UA 2F1MA 2ES2A 4DGZA 3T1YQ 1EUJA 4JI3L 3K5MA 2UXBL 1IXRA 4DV5L 1QZHA 4CKEA 5HGQA 3HOYG 1EU4A 2B39A 1RCVD 1SROA 1GUOA 3GTLB 1EIHA 3GTMB 2O2LD 2JJQA 2MJ8A 2WP8J 3N6RA 1VMPA 4JBJA 1NMGA 3C46A 1EQQA 4UPAA 1HA5A 3HOWB 4P71A 3S16H 5I4DA 2F0SA 2B2YA 1EFID 1Y1VH 1PXUA 3I4MG 1SYGA 4LUOA 2Q2TA 1PH1A 3T56B 5C0XI 4A93G 2TSSA 5LMUQ 3M3YB 1IW7D 1X3QA 3DWPA 1VQIA 1U4LA 5M3MH 4PNYA 2F0PA 2F52A 1L1OB 1PZID 3BDLA 4TRDA 1N34L 2NZHA 2IJ0A 2A69D 3KOJA 5FJ8H 5IOCA 5CBEE 4GNXB 5KEEA 4IPGA 4DR2Q 5EGTA 4QIWB 5CV7A 5EKIA 1FJGL 4QQBX 2ZJQA 4BXXG 5CYUA 1PTOC 3S2DH 1CKOA 3Q23A 1N33Q 3NUCA 1CA5A 1D2BA 1X56A 4DXGA 1A3TA 1JJGA 4LF9Q 2F0DA 3M4PA 1NR2A 4H7BA 2ZJRA 1TWCH 4GN5A 3P20A 2JEAI 1I94Q 1G2TA 1TWGH 3VR6A 2DY8A 3Q22A 1BBXC 3AYHB 3F2CA 4MHEA 2RQXA 1XNQL 1WI5A 3M85A 4JI7Q 4HJAA 1X3EA 2QF7A 5I9OA 1F2YA 1EEID 4GLAC 5FK9C 1HZAA 1Y14B 5M5WB 2AWNA 3K0YA 2B63B 3V2TA 2MP1A 4FF3A 1U4MA 3J81j 4DV4Q 2L4NA 2I0QA 2SNMA 4DR5L 4TVAB 4DK6C 1VMCA 2VQFL 3S17H 3CCQA 2BE5C 1JOQA 3OHXC 3CCVA 1QJOA 1TR5A 2QKIC 4UDUC 1YNXA 1ENCA 5KGUA 3PUYA 5EBDA 1WTOA 3QG1A 1Q46A 1I4QA 3OPOA 1VDZA 2KCNA 3KJOA 3HOYB 5GROA 4LFAQ 3MEHA 1HQMC 3R3OA 2Y0SB 3IAYA 1MJCA 4OXPA 3HRZC 2VZAA 4K14A 1PYWD 2IX0A 3I3CA 1PZKD 1Q8KA 1CZWA 4IQZA 4TSSA 4IPCA 1GD7A 1I94L 1H9SA 2EYFA 1KNEA 4LAAA 1LTID 2EQSA 1UNSA 4IURA 3EA6A 1G8ZD 1LTGD 5IY0A 3UDXA 2VQEL 3I4NH 4DR6L 1IL8A 1D8LA 3HOYH 3HOVH 2I5LX 1QNKA 4A3MB 2A73B 1S5CD 4PMWA 3UI2A 2ICEC 3KYHC 3ND8A 1L0XB 3KLSA 4MN3A 1CK1A 1RTNA 1EYDA 1I3QB 1N34Q 2KJXA 4GS3A 3CCUA 1Y1WH 1KRTA 3KF6B 1CKMA 1Z7TA 4A3KH 4HMJA 3H3VC 1A63A 2HHHQ 1D1KA 1AE2A 2R7FA 1P16A 1QB5D 3E9IA 1BXTA 4LK1C 2K75A 5FOBB 2LS01 3UDIA 4DAVA 3EQLC 3H0GG 4B3TL 1LLRD 1VQLA 2F0KA 2YU9H 3F8TA 4JI6L 3A7AB 1YHQA 2AKWB 1TWFH 3J7A5 1Q7YC 4OWXB 1H9SB 3VA7A 2EVBA 1SNCA 4V0BA 5CV5A 1M4VA 2A5HA 2FXQA 2Z9HA 3VR4A 5EJWA 3M3YH 5IP7H 4N8X1 3S1RB 1RDPD 1T5EA 1KD1C 1TKWB 2OQKA 4A3DH 4A3EB 1RTOA 3PSIA 3CC2A 1WTVA 5EPKA 4IOCA 3HS0C 3T1HL 1CUKA 3X3NA 5M3FG 3RZDH 2F0MA 4JI5Q 4LFBL 1F2MA 5G3LF 2PZWA 1OO9B 5M9OA 4PMCA 3CD6A 4IJHA 4J8QA 1N36L 2OQ0A 4N9TA 3BU2A 4RMFA 5ISRA 2EJMA 1B4OA 4LJZC 2O5IC 3ULJA 2K28A 4OWWB 3FKIG 1UUPA 4K8IA 5LL6S 4XYQA 5IP9H 1GUGA 4HIKA 4B3TQ 4ZKCB 2KHJA 1GUTA 1UAPA 2NN6H 2Y0SG 1XMOL 4GN3B 3RZDB 3STBC 3BG3A 4LMQD 2OTLA 5J22A 4AIMA 1II3A 1WTHA 5A35A 5FLXL 3K59A 4A3LG 4RCOA 1NSNS 3FMCA 4QUCA 3MEFA 2JYOA 4Q0FA 3I55A 2NB0A 4JI4Q 1STYA 5IWAL 4NPSA 3A5ZB 3KJPA 4LNQA 2JA8B 2ID0A 3TBIB 2A6HD 5FO9B 1T9HA 2IY5B 1M8AA 4RAUC 2BA1A 4P2CB 1W3SA 2YTXA 2JP1A 5LMNL 4X3TA 4KY5A 2Z6KC 4KMUC 3JC66 1FNUA 3CRKC 2L1BA 2RCFA 5KNDA 1L0WA 2K05A 4DK0A 3OW7A 3K58A 4DV2L 1EY7A 4HAEA 4HR7B 2MPMA 1BCPD 3GV3A 2UUCL 4FP5D 1JT8A 1U4RA 4GOPC 3I91A 2F03A 4KHVA 2A6ED 4XYOA 2B2TC 1CFMA 4C56C 3JAMi 1WTWA 3TP5A 1TWAH 4DAYB 1EQRA 1H95A 3MC0B 4WJ3M 1N32Q 3BVMA 3GTJH 2UUAQ 1B8AA 3MZ5A 2KQ3A 5DM63 3BZKA 4H44C 4R4CA 3I72A 1UEAB 1UE1A 1JB3A 5JPMC 1JQYD 1NMFA 2F0WA 4FXDA 2ALYB 5JOBA 4CKBA 1ET6A 3A8IE 4RGTA 3VR5A 1VQHA 1KDCA 2FINB 4AYBG 1JORA 4YWMA 3TQYA 4JYAQ 4JI8L 1EWIA 4ME5A 1A8VA 2EDGA 1VQGA 2BE5D 2EZVA 3A55A 2FJ2A 4OO1I 2YU9B 3U9SA 3PIOA 3U4ZA 1XTDA 2RSNA 4JI1L 4LUVA 3I4LA 1AFPA 4Y7NH 2EIFA 3DMUA 1HNWQ 4DR7Q 4FXGC 1BF4A 3T13A 1K0SA 4M8AA 3K5OA 3C1FA 4A3GB 2Y0SE 5CR3A 5C44B 4EQ5A 1SJHD 2EYMA 1EOTA 2BDOA 3AFQA 3Q8DA 2NTTA 3FRPB 1EZ8A 3J7YW 3B6YA 1XNQQ 1HRJA 4AQYL 1LO5D 4WJ4A 2UUBL 4DN4M 4CBVA 2IL8A 2RVLA 4POGA 4Y7NB 4PG3A 2R92B 3CCSA 4IFDJ 5IT9L 3BDOA 2R3ZA 2R93G 4TKOB 5AJ3Q 1N33L 2K5VA 2UXCQ 2NZ1D 1FD7D 5KYLA 2K03A 5C4JH 4Z9CB 2NZOA 3NBHB 1MHWC 3HOWG 3FVQA 2HDLA 1VF5C 1Q3LA 3RN2A 3A54A 2QEXA 4DPGA 3M4YA 2NYZD 2B2UC 4JI5L 3ONAB 2R7ZG 2K7VA 4JI3Q 3CHBD 3WWVA 1PH2A 3K8AA 3EJIA 4X62L 1ICWA 1JB7A 5IGCA 4X64Q 1MBYA 2JA7G 1J5EL 2K14A 4R4IA 1W6JA 3W2DA 2PO4A 5C4XG 3SEBA 4X3UA 2B63G 1I4XA 4P74A 1O7IA 4Q5VA 1KTKA 4HEDA 3BYYB 4R4TA 2C5CA 4QY7A 1ESFA 3K7AH 2YV5A 4WRDA 3J81i 4DR4L 4A3EG 2KOLA 2VQEQ 1JWUD 3E0JA 3U50C 1PH3A 4A3CG 3HOZG 2E2JB 1TT2A 3AU7A 4X3SA 3CMEA 3ULPA 4UP8A 2RDFA 1BCPB 4WFN3 2C9OA 2MFIA 4KD3A 4XTCS 1K28A 3ULLA 4OHJA 2L11A 1BUVT 1QVFA 1E24A 4FO2A 3SR1A 4ZKBB 5ELBA 1O7LA 1UWVA 3T16A 2K4KA 4ZK9B 1YJWA 3OWEB 1G2SA
chains in the Genus database with same CATH topology
1GKHA 4P73A 4UY8C 2ES2A 5ELOA 3T1YQ 1EUJA 3G48A 4JI3L 4X65Q 4DR5Q 3GD7A 4QL5A 3J7ZC 3TRZA 2UXBL 1IXRA 4DV5L 1QZHA 3HOYG 5HGQA 2CCZA 4JI8Q 4X66Q 5K36G 1Q86C 5IT9c 4GKJQ 5EAYA 1SROA 5GADC 4ALPA 3CQZH 1VCIA 2JJQA 2WP8J 4POFA 1RIPA 2Z6KA 4DV0Q 4JBJA 1G6PA 2NVYH 3CC7A 1NMGA 4EX5A 4BBSG 2JA8H 1EQQA 4JI7L 4UPAA 2K5HA 2JA7H 4P71A 3S16H 3KDFB 3J80c 4LF4L 4GOPB 3RLOA 1WCMG 1Q81C 1Y1VH 4DR1Q 4IO9A 4A3MH 1HNWL 5BR8Q 4A3EH 5J3BA 3I4MG 2KCTA 2V1CC 4LUOA 1YBYA 2Q2TA 1PH1A 4APVA 4O0AA 5C0XI 1YZ6A 2N49A 3SGIA 4A93G 2H5XA 1X65A 5LMUQ 4GN4B 3I56A 1XPRA 1YHBA 1VQIA 3PV0A 5M3MH 2VUMG 1C7YA 1KQSA 1MKHA 2R92G 4DV5Q 2F52A 3L2PA 1BKBA 1L1OB 3PGZA 3T1HQ 4HJ5A 4A4IA 2UU9L 1PH8A 1N34L 2NZHA 5C3EG 5IYBG 1X6OA 3KOJA 2CFMA 5FJ8H 4GNXB 1YHAA 1Q82C 2GN5A 3PCOB 4IPGA 4DR2Q 1FJGL 4A3DG 1A62A 2MQHA 2JA5H 1OXUA 2ZJQA 4QQBX 4L5QA 4BXXG 1CSPA 1SFOH 3S2DH 5C44H 2NN6I 1DGSA 1CKOA 1U0LA 1N33Q 3U58A 5IYDH 1G51A 5C3EH 1J5EQ 2OCEA 2ZTDA 2GVAA 5IP9G 4A3CH 1X56A 2CKZB 3KDFA 4JV5Q 1JJGA 2BH8A 3OW2A 4LF9Q 2LXKA 3M4PA 4K0KQ 1V43A 2ZJRA 4A76A 1TWCH 4JBWA 4GN5A 4UP7A 2N8NA 4GLXA 2JEAI 1I94Q 3PUVA 1G291 1TWGH 4YHHL 2UU9Q 2K5NA 3M7NA 1IBML 2HHHL 3I4NG 2ATWA 1I3QH 5BR8L 4DR4Q 2DUDA 4KHPQ 1LUZA 3AYHB 2BA0A 3F2CA 4YWKA 2VS1A 1R9TH 3ICEA 2WB1G 1XNQL 1WI5A 3M85A 3M9BA 4JI7Q 4X64L 4HJAA 1X3EA 1LTLA 4GLAC 3J80i 1HZAA 1Y14B 1VQ9A 2AWNA 4LF5Q 2R93H 4DV2Q 1JMCA 2I5HA 1MJEA 2E8GA 4A3JG 3U4VA 3PIPA 1NBWA 1WCMH 3J81j 4DV4Q 5GAGC 4DUYQ 3A0JA 2I0QA 4DR5L 4TVAB 5IE8A 4JI6Q 4DK6C 3S2HH 4NXML 2VQFL 3S17H 3CCQA 4KHZA 2HT1A 3F2DA 3CCVA 3HKZE 4DV1Q 1M1KC 5GAHC 3PO3G 1EYGA 1YNXA 4GKKQ 1XPOA 2A1AA 2F4VL 1S3OA 1VS0A 3PUYA 2CQOA 4A3KG 3EIVA 5M3FH 1Y1VG 1Q46A 1K3RA 4JI4L 1M90C 1S40A 3KJOA 1KXLA 1E7ZA 5GROA 4QGUA 4LFAQ 4A3FG 5ELNA 1KIXA 1N36Q 1VQDA 5IYBH 4OX9L 2HIVA 1MIUA 4IPDA 3AEVA 4LW1A 1MJCA 2JEBI 2AWOA 4YCVA 4OXPA 4A75A 2LXJA 2VZAA 2WB1E 4C2MH 4A3GH 2IX0A 3HOUH 2NVQH 1VQ6A 4AYBE 2CWAA 4LFBQ 5LMNW 1Q8KA 1V1QA 5AJ3L 4LFCQ 2F4VQ 1X3FA 4IPCA 3HOZH 1GD7A 1X54A 5IP7G 1I94L 2NVXH 3S1QH 4K0KL 2EQSA 3HOXH 3EN2A 3TS0A 1QVGA 4BBRG 4OX9Q 2VNUD 1N32L 5IY0A 4L5RC 3UDXA 2UUBQ 2VQEL 3I4NH 4DR6L 1D8LA 3E0EA 3HOYH 3HOVH 2I5LX 1TXYA 1C9OA 1OXXK 4PMWA 2XTIA 5IYCG 1I5FA 3KYHC 2VY3A 3CCJA 4GNXC 2PMZE 1HNZL 2YTVA 1PFSA 3K7UC 3CCEA 4DV0L 2GVBA 1VQ5A 2ZTCA 4YCWA 4GS3A 1N34Q 3CCUA 1ASYA 4JI0L 3KFUA 4OO1G 1Y1WH 3CPFA 1KRTA 1VQFA 3I7FA 3KF6B 2N3SA 3F1ZA 4JCVE 1SR3A 1CKMA 4A3KH 3FKIH 5JEAJ 3NELA 5IYCH 1A63A 1PYSB 2HHHQ 1AE2A 2R7FA 1P16A 1VQBA 2EXDA 2KHIA 3E9IA 4QJFA 1YJNA 1K8GA 3OYYA 4GOPA 2K75A 4B3SQ 1BBWA 1L1OA 2WAQE 3UDIA 3H0GG 4IPHA 4B3TL 4HIOA 4A3IH 1VQLA 2YU9H 3F8TA 1L1OC 4JI6L 1Q1BA 3OTOQ 1YHQA 2AKWB 1NY4A 1TWFH 1U5KA 3J7A5 1Q7YC 4OWXB 4BY1H 4DR1L 3CW2C 2R7ZH 1GO3E 3EBEA 4L5TA 1E22A 4HJ8A 3OTOL 4H02A 3G4SA 3M3YH 2FXQA 1UEBA 4LF5L 4PZ7A 5IP7H 3K80C 1HNZQ 1KD1C 1K83H 4XIGS 1HNXL 2OQKA 3CP0A 1HZBA 2Q2UA 2PQAA 1LM0A 4PZ6A 4A3DH 4Y52H 4DK3C 3PSIA 3CC2A 4BXXH 3STBD 1NE3A 4IOCA 3T1HL 3FP9A 1CUKA 4YWLA 1CSQA 5M3FG 3RZDH 1EOVA 1GM5A 4JI5Q 5IYDG 4LFBL 3GTOH 4FDBA 3GTPH 4P72A 1IBLL 4LF7Q 2JE6I 4J15A 2RCNA 1PVOA 1E3PA 3GO5A 1N9WA 3J81c 3CD6A 1D7QA 3RR5A 4IJHA 1Q12A 1HJPA 3PUXA 3S1MH 4LUZA 4JOIA 1L2FA 1N36L 2OQ0A 2JK8A 3BU2A 3I4OA 4RMFA 1PA6A 4JOIC 2VL6A 3HOUG 5IWAQ 2UXCL 3ULJA 2ASBA 4NXNL 3W1GA 1C0AA 2E5LL 4OWWB 1BVSA 3FKIG 4LF4Q 4GKKL 5IP9H 2D0OA 1YVCA 4DUZQ 4HIKA 1VQJA 5M5YH 4B3TQ 2PI2E 4NB3A 2KHJA 2MO0A 1KRSA 1QZGA 2JA5G 1JJCB 2Y0SG 3S1RH 1XMOL 4JI2Q 1K9MC 3GTLH 1X3GA 3AFPA 4GN3B 5E7NA 4OONA 4LFCL 2JA6H 3STBC 1PH6A 1KC8C 2MNAA 3CPWA 2OTLA 4DNIA 4AIMA 1AH9A 5LMNQ 4X65L 2QA4A 4A3LG 3VDYA 1SRUA 2K52A 4KI0A 4R4QA 1YI2A 1HNXQ 3MEFA 2JA9A 1IYJB 1VQKA 2VQFQ 4A93H 1Z9FA 2KENA 3I55A 3RLNA 4O2DA 4JBMA 4JG2A 2N78A 3L7ZC 5M3MG 1KL9A 4JI4Q 4GKJL 4KLKA 5IWAL 1I6HH 4YY3Q 1XMQQ 4NPSA 3A5ZB 1I50H 1UE6A 1VQ4A 3L0OA 4MNOA 1JE5A 3PO2G 3KJPA 3A5UA 3DM3A 2ID0A 4LNQA 2RF4A 1QVCA 3PF4A 1T9HA 2KCMA 2IY5B 4BBSH 2JA8G 4A3IG 2BA1A 1W3SA 2HQLA 2YTXA 5GAEC 3H15A 5LMNL 1IBLQ 1ASZA 4LF7L 2Z6KC 3W5OA 3JC66 4A3MG 1YIJA 3GTQH 4KHPL 4NXNQ 2MO1A 2D0PA 1VQMA 4GNXA 1OTCA 1SE8A 1VQ7A 3K0XA 1L0WA 4JI0Q 3NEMA 1YITA 3D0FA 4A3FH 4DV2L 4IFDI 2UUCL 2I5MX 3HOXG 3TS2A 2Z0SA 4DV6L 3M4OH 2VUMH 1QUQB 1K8AC 1JT8A 2Q2HA 4GOPC 1WOCA 1N8RC 2R92H 2NVTH 1IZ6A 1WFQA 2K50A 3JAMi 1TWAH 4DAYB 1EQRA 4BY7G 1H95A 4C3JH 4WJ3M 1N32Q 3GTJH 2ZM6Q 2UUAQ 2JQOA 1B8AA 4X62Q 4LF9L 5LMUL 3CAMA 4BBRH 1RL2A 4LF6L 4NXMQ 3BZKA 1CKNA 4R4CA 1UE1A 2HIXA 1K73C 5DLQE 1VQ8A 3CCLA 2JA6G 1XMQL 5FLMH 1NMFA 2YTYA 3I2ZA 1J6QA 2ALYB 3RNUA 2AHOB 2L15A 3S15H 1OXSC 1FJGQ 1VQHA 3PO2H 4X6AH 1B70B 1S72A 4B3RL 1P8LA 2B29A 2WFWA 4AYBG 2E2IH 3GTMH 4GLVB 2IT1A 2PNHA 3S1NH 2C35B 4IJLA 4YWMA 3RLFA 3TQYA 3PO3H 4DV3Q 1VQOA 4BY1G 4HIMA 1UE7A 3KLWA 4R4OA 4UP9A 3TEHB 3UDGA 3W1BA 4JYAQ 4JI8L 1EWIA 4LWCA 1A8VA 2ZTEA 1KHIA 4X66L 3H3VI 3HOWH 4DR7L 5M5WH 4DR6Q 3IRBA 2OWOA 1VQGA 2R6GA 4DV7L 2B63H 4IFDG 4OO1I 3TREA 4JI2L 1KAWA 3PIOA 3U4ZA 1XTDA 4JI1L 3UE0A 1A0IA 4TQUS 4LUVA 1PH4A 1IBKL 2PI2A 4Y7NH 3GTKH 2EIFA 1HNWQ 4DR7Q 3HKZG 1PHJA 4BA1I 3GDEA 4JYAL 1XJVA 1HR0Q 4DV3L 2F3IA 2AMCB 5GQOA 4C3IH 1Q1EA 2Y0SE 1TWHH 1EFWA 4EQ5A 3UDFA 4QIWE 1SMXA 5HY6A 3JAMc 2ZJPA 1YJ9A 1X9NA 4HJ9A 4DV6Q 2A8VA 3AFQA 3Q8DA 2UXDQ 2E2JH 5JJLA 3CMAA 3B6YA 3F2BA 3AQQA 1XNQQ 4JC0A 4AQYL 1XPUA 4WJ4A 4P75A 3LGJA 1HR0L 3GTGH 4BA2I 1HH2P 3ER0A 2WAQG 2QGQA 5C4XH 2UUBL 3H3VH 1WYDA 1XNRL 2BH2A 2OTJA 2IX1A 3G6EA 5JEAG 2DGYA 2UXDL 4JI1Q 4POGA 4JV5L 4PG3A 1OXVA 3CCSA 1PYBA 4DUZL 4DR3Q 4IFDJ 3E9HA 2R93G 3FHWA 1BBUA 2XGTA 5C0XJ 5AJ3Q 4B3MQ 1N33L 4R1JA 4DUYL 2K5VA 5H1SE 2UXCQ 3A74A 3ERSX 3CC4A 1PH9A 1Z47A 5C4JH 2NZOA 1WJJA 3NBHB 3HOWG 1FL0A 1PH7A 1SLJA 1PH5A 4DAMA 4A3BG 2R7DA 3PUWA 2CWPA 4DV1L 4HJ7A 2D62A 4LF8Q 1VQNA 1W2BA 2UUCQ 5JJIA 1E1OA 3PUZA 4LFAL 4PZ8A 3RN2A 2RHQB 1FVIA 5FLXc 2QEXA 3S14H 4C3HH 4DPGA 2LSSA 4JI5L 1HZCA 3ZJYC 5JJKA 5M5XH 2A19A 3PF5A 4OWTB 4L5SA 4RG1A 3M4QA 2R7ZG 2UXBQ 4JI3Q 4A3LH 1LYLA 3WWVA 1GVPA 3KF6A 3CF5A 1AE3A 1EIFA 1UE5A 1K0RA 1PH2A 1IBKQ 4LF6Q 1XMOQ 1OXTA 4B3SL 2NN6G 3K8AA 5C0XG 3BZCA 4X62L 1JB7A 4LF8L 4X64Q 4DV7Q 1Y1WG 2ZM6L 2JA7G 1J5EL 2KBNA 1PV4A 2K14A 4R4IA 1V9PA 4DV4L 3RN5A 4A3JH 3RZOH 1JJ2A 1SN8A 3NENA 1VQPA 5C4XG 2B63G 4YHHQ 4P74A 1O7IA 1B7YB 3H0GH 4DR3L 4B3RQ 2Q2IA 4MZ9A 4R4TA 1VQEA 4QY7A 2E2HH 3MXNB 3K7AH 1XNRQ 2YV5A 2PQAB 3J81i 4A3EG 3BJUA 2YYZA 4JBKA 3I4MH 4DKAC 4DR4L 1X55A 2VQEQ 1VQCA 1IBMQ 1QUQA 3S24A 3U50C 1PH3A 4YCUA 4B3ML 3T1YL 4AQYQ 3HOZG 4A3CG 3CCMA 3CXCA 3D31A 3G71A 2VW9A 1IL2A 2B3GA 4A3BH 1FGUA 3CMEA 3ULPA 4UP8A 4DR2L 1E1TA 1NJIC 2UUAL 1NTGA 2RHSB 4ME3A 2MFIA 4XTCS 2IHFA 4A3GG 3ULLA 2E5LQ 3KF8B 1VQAA 3UE1A 5C44G 1QVFA 4YY3L 1E24A 2IHEA 3HKSA 4AH6A 5FLMG 1YEZA 3HOVG 4BY7H 4MTNA 3HFZB 3CCRA 1HR0W 1CKNB 1UWVA 3K81C 5FJ8G 2K4KA 1YJWA 4IOAA 4HIDA 1EIYB 3DLLA 1HZ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GKH A;  4P73 A;  4UY8 C;  2ES2 A;  5ELO A;  3T1Y Q;  1EUJ A;  3G48 A;  4JI3 L;  4X65 Q;  4DR5 Q;  3GD7 A;  4QL5 A;  3J7Z C;  3TRZ A;  2UXB L;  1IXR A;  4DV5 L;  1QZH A;  3HOY G;  5HGQ A;  2CCZ A;  4JI8 Q;  4X66 Q;  5K36 G;  1Q86 C;  5IT9 c;  4GKJ Q;  5EAY A;  1SRO A;  5GAD C;  4ALP A;  3CQZ H;  1VCI A;  2JJQ A;  2WP8 J;  4POF A;  1RIP A;  2Z6K A;  4DV0 Q;  4JBJ A;  1G6P A;  2NVY H;  3CC7 A;  1NMG A;  4EX5 A;  4BBS G;  2JA8 H;  1EQQ A;  4JI7 L;  4UPA A;  2K5H A;  2JA7 H;  4P71 A;  3S16 H;  3KDF B;  3J80 c;  4LF4 L;  4GOP B;  3RLO A;  1WCM G;  1Q81 C;  1Y1V H;  4DR1 Q;  4IO9 A;  4A3M H;  1HNW L;  5BR8 Q;  4A3E H;  5J3B A;  3I4M G;  2KCT A;  2V1C C;  4LUO A;  1YBY A;  2Q2T A;  1PH1 A;  4APV A;  4O0A A;  5C0X I;  1YZ6 A;  2N49 A;  3SGI A;  4A93 G;  2H5X A;  1X65 A;  5LMU Q;  4GN4 B;  3I56 A;  1XPR A;  1YHB A;  1VQI A;  3PV0 A;  5M3M H;  2VUM G;  1C7Y A;  1KQS A;  1MKH A;  2R92 G;  4DV5 Q;  2F52 A;  3L2P A;  1BKB A;  1L1O B;  3PGZ A;  3T1H Q;  4HJ5 A;  4A4I A;  2UU9 L;  1PH8 A;  1N34 L;  2NZH A;  5C3E G;  5IYB G;  1X6O A;  3KOJ A;  2CFM A;  5FJ8 H;  4GNX B;  1YHA A;  1Q82 C;  2GN5 A;  3PCO B;  4IPG A;  4DR2 Q;  1FJG L;  4A3D G;  1A62 A;  2MQH A;  2JA5 H;  1OXU A;  2ZJQ A;  4QQB X;  4L5Q A;  4BXX G;  1CSP A;  1SFO H;  3S2D H;  5C44 H;  2NN6 I;  1DGS A;  1CKO A;  1U0L A;  1N33 Q;  3U58 A;  5IYD H;  1G51 A;  5C3E H;  1J5E Q;  2OCE A;  2ZTD A;  2GVA A;  5IP9 G;  4A3C H;  1X56 A;  2CKZ B;  3KDF A;  4JV5 Q;  1JJG A;  2BH8 A;  3OW2 A;  4LF9 Q;  2LXK A;  3M4P A;  4K0K Q;  1V43 A;  2ZJR A;  4A76 A;  1TWC H;  4JBW A;  4GN5 A;  4UP7 A;  2N8N A;  4GLX A;  2JEA I;  1I94 Q;  3PUV A;  1G29 1;  1TWG H;  4YHH L;  2UU9 Q;  2K5N A;  3M7N A;  1IBM L;  2HHH L;  3I4N G;  2ATW A;  1I3Q H;  5BR8 L;  4DR4 Q;  2DUD A;  4KHP Q;  1LUZ A;  3AYH B;  2BA0 A;  3F2C A;  4YWK A;  2VS1 A;  1R9T H;  3ICE A;  2WB1 G;  1XNQ L;  1WI5 A;  3M85 A;  3M9B A;  4JI7 Q;  4X64 L;  4HJA A;  1X3E A;  1LTL A;  4GLA C;  3J80 i;  1HZA A;  1Y14 B;  1VQ9 A;  2AWN A;  4LF5 Q;  2R93 H;  4DV2 Q;  1JMC A;  2I5H A;  1MJE A;  2E8G A;  4A3J G;  3U4V A;  3PIP A;  1NBW A;  1WCM H;  3J81 j;  4DV4 Q;  5GAG C;  4DUY Q;  3A0J A;  2I0Q A;  4DR5 L;  4TVA B;  5IE8 A;  4JI6 Q;  4DK6 C;  3S2H H;  4NXM L;  2VQF L;  3S17 H;  3CCQ A;  4KHZ A;  2HT1 A;  3F2D A;  3CCV A;  3HKZ E;  4DV1 Q;  1M1K C;  5GAH C;  3PO3 G;  1EYG A;  1YNX A;  4GKK Q;  1XPO A;  2A1A A;  2F4V L;  1S3O A;  1VS0 A;  3PUY A;  2CQO A;  4A3K G;  3EIV A;  5M3F H;  1Y1V G;  1Q46 A;  1K3R A;  4JI4 L;  1M90 C;  1S40 A;  3KJO A;  1KXL A;  1E7Z A;  5GRO A;  4QGU A;  4LFA Q;  4A3F G;  5ELN A;  1KIX A;  1N36 Q;  1VQD A;  5IYB H;  4OX9 L;  2HIV A;  1MIU A;  4IPD A;  3AEV A;  4LW1 A;  1MJC A;  2JEB I;  2AWO A;  4YCV A;  4OXP A;  4A75 A;  2LXJ A;  2VZA A;  2WB1 E;  4C2M H;  4A3G H;  2IX0 A;  3HOU H;  2NVQ H;  1VQ6 A;  4AYB E;  2CWA A;  4LFB Q;  5LMN W;  1Q8K A;  1V1Q A;  5AJ3 L;  4LFC Q;  2F4V Q;  1X3F A;  4IPC A;  3HOZ H;  1GD7 A;  1X54 A;  5IP7 G;  1I94 L;  2NVX H;  3S1Q H;  4K0K L;  2EQS A;  3HOX H;  3EN2 A;  3TS0 A;  1QVG A;  4BBR G;  4OX9 Q;  2VNU D;  1N32 L;  5IY0 A;  4L5R C;  3UDX A;  2UUB Q;  2VQE L;  3I4N H;  4DR6 L;  1D8L A;  3E0E A;  3HOY H;  3HOV H;  2I5L X;  1TXY A;  1C9O A;  1OXX K;  4PMW A;  2XTI A;  5IYC G;  1I5F A;  3KYH C;  2VY3 A;  3CCJ A;  4GNX C;  2PMZ E;  1HNZ L;  2YTV A;  1PFS A;  3K7U C;  3CCE A;  4DV0 L;  2GVB A;  1VQ5 A;  2ZTC A;  4YCW A;  4GS3 A;  1N34 Q;  3CCU A;  1ASY A;  4JI0 L;  3KFU A;  4OO1 G;  1Y1W H;  3CPF A;  1KRT A;  1VQF A;  3I7F A;  3KF6 B;  2N3S A;  3F1Z A;  4JCV E;  1SR3 A;  1CKM A;  4A3K H;  3FKI H;  5JEA J;  3NEL A;  5IYC H;  1A63 A;  1PYS B;  2HHH Q;  1AE2 A;  2R7F A;  1P16 A;  1VQB A;  2EXD A;  2KHI A;  3E9I A;  4QJF A;  1YJN A;  1K8G A;  3OYY A;  4GOP A;  2K75 A;  4B3S Q;  1BBW A;  1L1O A;  2WAQ E;  3UDI A;  3H0G G;  4IPH A;  4B3T L;  4HIO A;  4A3I H;  1VQL A;  2YU9 H;  3F8T A;  1L1O C;  4JI6 L;  1Q1B A;  3OTO Q;  1YHQ A;  2AKW B;  1NY4 A;  1TWF H;  1U5K A;  3J7A 5;  1Q7Y C;  4OWX B;  4BY1 H;  4DR1 L;  3CW2 C;  2R7Z H;  1GO3 E;  3EBE A;  4L5T A;  1E22 A;  4HJ8 A;  3OTO L;  4H02 A;  3G4S A;  3M3Y H;  2FXQ A;  1UEB A;  4LF5 L;  4PZ7 A;  5IP7 H;  3K80 C;  1HNZ Q;  1KD1 C;  1K83 H;  4XIG S;  1HNX L;  2OQK A;  3CP0 A;  1HZB A;  2Q2U A;  2PQA A;  1LM0 A;  4PZ6 A;  4A3D H;  4Y52 H;  4DK3 C;  3PSI A;  3CC2 A;  4BXX H;  3STB D;  1NE3 A;  4IOC A;  3T1H L;  3FP9 A;  1CUK A;  4YWL A;  1CSQ A;  5M3F G;  3RZD H;  1EOV A;  1GM5 A;  4JI5 Q;  5IYD G;  4LFB L;  3GTO H;  4FDB A;  3GTP H;  4P72 A;  1IBL L;  4LF7 Q;  2JE6 I;  4J15 A;  2RCN A;  1PVO A;  1E3P A;  3GO5 A;  1N9W A;  3J81 c;  3CD6 A;  1D7Q A;  3RR5 A;  4IJH A;  1Q12 A;  1HJP A;  3PUX A;  3S1M H;  4LUZ A;  4JOI A;  1L2F A;  1N36 L;  2OQ0 A;  2JK8 A;  3BU2 A;  3I4O A;  4RMF A;  1PA6 A;  4JOI C;  2VL6 A;  3HOU G;  5IWA Q;  2UXC L;  3ULJ A;  2ASB A;  4NXN L;  3W1G A;  1C0A A;  2E5L L;  4OWW B;  1BVS A;  3FKI G;  4LF4 Q;  4GKK L;  5IP9 H;  2D0O A;  1YVC A;  4DUZ Q;  4HIK A;  1VQJ A;  5M5Y H;  4B3T Q;  2PI2 E;  4NB3 A;  2KHJ A;  2MO0 A;  1KRS A;  1QZG A;  2JA5 G;  1JJC B;  2Y0S G;  3S1R H;  1XMO L;  4JI2 Q;  1K9M C;  3GTL H;  1X3G A;  3AFP A;  4GN3 B;  5E7N A;  4OON A;  4LFC L;  2JA6 H;  3STB C;  1PH6 A;  1KC8 C;  2MNA A;  3CPW A;  2OTL A;  4DNI A;  4AIM A;  1AH9 A;  5LMN Q;  4X65 L;  2QA4 A;  4A3L G;  3VDY A;  1SRU A;  2K52 A;  4KI0 A;  4R4Q A;  1YI2 A;  1HNX Q;  3MEF A;  2JA9 A;  1IYJ B;  1VQK A;  2VQF Q;  4A93 H;  1Z9F A;  2KEN A;  3I55 A;  3RLN A;  4O2D A;  4JBM A;  4JG2 A;  2N78 A;  3L7Z C;  5M3M G;  1KL9 A;  4JI4 Q;  4GKJ L;  4KLK A;  5IWA L;  1I6H H;  4YY3 Q;  1XMQ Q;  4NPS A;  3A5Z B;  1I50 H;  1UE6 A;  1VQ4 A;  3L0O A;  4MNO A;  1JE5 A;  3PO2 G;  3KJP A;  3A5U A;  3DM3 A;  2ID0 A;  4LNQ A;  2RF4 A;  1QVC A;  3PF4 A;  1T9H A;  2KCM A;  2IY5 B;  4BBS H;  2JA8 G;  4A3I G;  2BA1 A;  1W3S A;  2HQL A;  2YTX A;  5GAE C;  3H15 A;  5LMN L;  1IBL Q;  1ASZ A;  4LF7 L;  2Z6K C;  3W5O A;  3JC6 6;  4A3M G;  1YIJ A;  3GTQ H;  4KHP L;  4NXN Q;  2MO1 A;  2D0P A;  1VQM A;  4GNX A;  1OTC A;  1SE8 A;  1VQ7 A;  3K0X A;  1L0W A;  4JI0 Q;  3NEM A;  1YIT A;  3D0F A;  4A3F H;  4DV2 L;  4IFD I;  2UUC L;  2I5M X;  3HOX G;  3TS2 A;  2Z0S A;  4DV6 L;  3M4O H;  2VUM H;  1QUQ B;  1K8A C;  1JT8 A;  2Q2H A;  4GOP C;  1WOC A;  1N8R C;  2R92 H;  2NVT H;  1IZ6 A;  1WFQ A;  2K50 A;  3JAM i;  1TWA H;  4DAY B;  1EQR A;  4BY7 G;  1H95 A;  4C3J H;  4WJ3 M;  1N32 Q;  3GTJ H;  2ZM6 Q;  2UUA Q;  2JQO A;  1B8A A;  4X62 Q;  4LF9 L;  5LMU L;  3CAM A;  4BBR H;  1RL2 A;  4LF6 L;  4NXM Q;  3BZK A;  1CKN A;  4R4C A;  1UE1 A;  2HIX A;  1K73 C;  5DLQ E;  1VQ8 A;  3CCL A;  2JA6 G;  1XMQ L;  5FLM H;  1NMF A;  2YTY A;  3I2Z A;  1J6Q A;  2ALY B;  3RNU A;  2AHO B;  2L15 A;  3S15 H;  1OXS C;  1FJG Q;  1VQH A;  3PO2 H;  4X6A H;  1B70 B;  1S72 A;  4B3R L;  1P8L A;  2B29 A;  2WFW A;  4AYB G;  2E2I H;  3GTM H;  4GLV B;  2IT1 A;  2PNH A;  3S1N H;  2C35 B;  4IJL A;  4YWM A;  3RLF A;  3TQY A;  3PO3 H;  4DV3 Q;  1VQO A;  4BY1 G;  4HIM A;  1UE7 A;  3KLW A;  4R4O A;  4UP9 A;  3TEH B;  3UDG A;  3W1B A;  4JYA Q;  4JI8 L;  1EWI A;  4LWC A;  1A8V A;  2ZTE A;  1KHI A;  4X66 L;  3H3V I;  3HOW H;  4DR7 L;  5M5W H;  4DR6 Q;  3IRB A;  2OWO A;  1VQG A;  2R6G A;  4DV7 L;  2B63 H;  4IFD G;  4OO1 I;  3TRE A;  4JI2 L;  1KAW A;  3PIO A;  3U4Z A;  1XTD A;  4JI1 L;  3UE0 A;  1A0I A;  4TQU S;  4LUV A;  1PH4 A;  1IBK L;  2PI2 A;  4Y7N H;  3GTK H;  2EIF A;  1HNW Q;  4DR7 Q;  3HKZ G;  1PHJ A;  4BA1 I;  3GDE A;  4JYA L;  1XJV A;  1HR0 Q;  4DV3 L;  2F3I A;  2AMC B;  5GQO A;  4C3I H;  1Q1E A;  2Y0S E;  1TWH H;  1EFW A;  4EQ5 A;  3UDF A;  4QIW E;  1SMX A;  5HY6 A;  3JAM c;  2ZJP A;  1YJ9 A;  1X9N A;  4HJ9 A;  4DV6 Q;  2A8V A;  3AFQ A;  3Q8D A;  2UXD Q;  2E2J H;  5JJL A;  3CMA A;  3B6Y A;  3F2B A;  3AQQ A;  1XNQ Q;  4JC0 A;  4AQY L;  1XPU A;  4WJ4 A;  4P75 A;  3LGJ A;  1HR0 L;  3GTG H;  4BA2 I;  1HH2 P;  3ER0 A;  2WAQ G;  2QGQ A;  5C4X H;  2UUB L;  3H3V H;  1WYD A;  1XNR L;  2BH2 A;  2OTJ A;  2IX1 A;  3G6E A;  5JEA G;  2DGY A;  2UXD L;  4JI1 Q;  4POG A;  4JV5 L;  4PG3 A;  1OXV A;  3CCS A;  1PYB A;  4DUZ L;  4DR3 Q;  4IFD J;  3E9H A;  2R93 G;  3FHW A;  1BBU A;  2XGT A;  5C0X J;  5AJ3 Q;  4B3M Q;  1N33 L;  4R1J A;  4DUY L;  2K5V A;  5H1S E;  2UXC Q;  3A74 A;  3ERS X;  3CC4 A;  1PH9 A;  1Z47 A;  5C4J H;  2NZO A;  1WJJ A;  3NBH B;  3HOW G;  1FL0 A;  1PH7 A;  1SLJ A;  1PH5 A;  4DAM A;  4A3B G;  2R7D A;  3PUW A;  2CWP A;  4DV1 L;  4HJ7 A;  2D62 A;  4LF8 Q;  1VQN A;  1W2B A;  2UUC Q;  5JJI A;  1E1O A;  3PUZ A;  4LFA L;  4PZ8 A;  3RN2 A;  2RHQ B;  1FVI A;  5FLX c;  2QEX A;  3S14 H;  4C3H H;  4DPG A;  2LSS A;  4JI5 L;  1HZC A;  3ZJY C;  5JJK A;  5M5X H;  2A19 A;  3PF5 A;  4OWT B;  4L5S A;  4RG1 A;  3M4Q A;  2R7Z G;  2UXB Q;  4JI3 Q;  4A3L H;  1LYL A;  3WWV A;  1GVP A;  3KF6 A;  3CF5 A;  1AE3 A;  1EIF A;  1UE5 A;  1K0R A;  1PH2 A;  1IBK Q;  4LF6 Q;  1XMO Q;  1OXT A;  4B3S L;  2NN6 G;  3K8A A;  5C0X G;  3BZC A;  4X62 L;  1JB7 A;  4LF8 L;  4X64 Q;  4DV7 Q;  1Y1W G;  2ZM6 L;  2JA7 G;  1J5E L;  2KBN A;  1PV4 A;  2K14 A;  4R4I A;  1V9P A;  4DV4 L;  3RN5 A;  4A3J H;  3RZO H;  1JJ2 A;  1SN8 A;  3NEN A;  1VQP A;  5C4X G;  2B63 G;  4YHH Q;  4P74 A;  1O7I A;  1B7Y B;  3H0G H;  4DR3 L;  4B3R Q;  2Q2I A;  4MZ9 A;  4R4T A;  1VQE A;  4QY7 A;  2E2H H;  3MXN B;  3K7A H;  1XNR Q;  2YV5 A;  2PQA B;  3J81 i;  4A3E G;  3BJU A;  2YYZ A;  4JBK A;  3I4M H;  4DKA C;  4DR4 L;  1X55 A;  2VQE Q;  1VQC A;  1IBM Q;  1QUQ A;  3S24 A;  3U50 C;  1PH3 A;  4YCU A;  4B3M L;  3T1Y L;  4AQY Q;  3HOZ G;  4A3C G;  3CCM A;  3CXC A;  3D31 A;  3G71 A;  2VW9 A;  1IL2 A;  2B3G A;  4A3B H;  1FGU A;  3CME A;  3ULP A;  4UP8 A;  4DR2 L;  1E1T A;  1NJI C;  2UUA L;  1NTG A;  2RHS B;  4ME3 A;  2MFI A;  4XTC S;  2IHF A;  4A3G G;  3ULL A;  2E5L Q;  3KF8 B;  1VQA A;  3UE1 A;  5C44 G;  1QVF A;  4YY3 L;  1E24 A;  2IHE A;  3HKS A;  4AH6 A;  5FLM G;  1YEZ A;  3HOV G;  4BY7 H;  4MTN A;  3HFZ B;  3CCR A;  1HR0 W;  1CKN B;  1UWV A;  3K81 C;  5FJ8 G;  2K4K A;  1YJW A;  4IOA A;  4HID A;  1EIY B;  3DLL A;  1HZ9 A; 
#chains in the Genus database with same CATH topology
 2QDB A;  4P73 A;  4ZYS A;  4QCL A;  4DR5 Q;  4QL5 A;  3J7Z C;  2IW3 A;  2CCZ A;  4JI8 Q;  2AUK A;  1Q86 C;  5IT9 c;  5EAY A;  2WAQ B;  5GAD C;  2B2W A;  1EIG A;  1RIP A;  2Z6K A;  4IN3 A;  1NR4 A;  1TU2 B;  2KEE A;  3OIQ A;  1G6P A;  4EX5 A;  4JI7 L;  3A8J E;  4LF4 L;  1BR9 A;  1PTO H;  3OIP A;  4N8F A;  4BBS B;  4A3M H;  3CRL C;  4A93 B;  2E2I B;  1YBY A;  2B8F A;  1I4P A;  1KDB A;  2N49 A;  3SGI A;  5C3E B;  2E74 C;  1XPR A;  4GN4 B;  1I4G A;  1GJX A;  1YHB A;  3PV0 A;  1HTP A;  4KN4 C;  4NKL A;  1MKH A;  4K8J A;  4OEM B;  2R92 G;  1BKB A;  2VUM B;  3T1H Q;  4A4I A;  1STH A;  3H0G B;  2B2Y C;  3VYT A;  2E2H B;  1Q82 C;  2GN5 A;  4A3D G;  2MQH A;  2ZXP A;  5KIX A;  1SJE D;  1CSP A;  1S5F D;  3VR2 A;  5IYD H;  4WJW A;  3LNN A;  1BOS A;  5C3E H;  5KNC A;  1J5E Q;  2ZTD A;  5IP9 G;  2CW0 D;  1ICF B;  4JV5 Q;  4K0K Q;  2LXK A;  1V43 A;  4A76 A;  3MXU A;  3R8B A;  4A3D B;  2Z1C A;  1LTA D;  5EPL A;  5IOD A;  3PUV A;  1DOK A;  2HHH L;  1D1I A;  3I4N G;  1I3Q H;  5BR8 L;  2Q8R E;  1EY5 A;  4KK7 A;  4YWK A;  1Y1W B;  4FNF A;  4ZCK A;  2WB1 G;  1TS4 A;  2R93 H;  1QOH A;  2KVM A;  1JMC A;  4BS9 A;  4R8I A;  2K6A A;  3NBI A;  2E8G A;  3R93 A;  1NBW A;  1WCM H;  4OIJ A;  3S2D B;  4GZY C;  2X69 A;  5GAG C;  3A0J A;  2NVQ B;  1ZYR C;  2KEC A;  4KHZ A;  4OGQ C;  3ERO A;  2HT1 A;  3FPP A;  5J1Z A;  4HSP A;  4C3H G;  5GAH C;  3SXH A;  4KKT A;  1S3O A;  1NUC A;  1TWG B;  3EIV A;  3FKI B;  5ELE A;  1G91 A;  1M90 C;  1KXL A;  1E7Z A;  4QGU A;  4CJ2 C;  4KY6 A;  4ODG A;  1N36 Q;  2ZT9 C;  4IPD A;  3DWQ A;  1MSG A;  3AEV A;  2JEB I;  3N52 A;  2AWO A;  4YCV A;  2LXJ A;  4C2M H;  5LL6 X;  3HOU H;  4G57 A;  3P75 A;  2NVQ H;  1VQ6 A;  1AEX A;  5C4H A;  3NHH A;  2F4V Q;  2WKC A;  5IGB A;  4K0K L;  5HGT A;  1QVG A;  3DUZ A;  4MTK A;  4XT3 B;  2NVY B;  4OX9 Q;  2VNU D;  2UUB Q;  3BYT B;  4R8N A;  5EQ0 A;  1OXX K;  2CHB D;  2R7Z B;  3K5N A;  2PMZ E;  2ZXO A;  3K7U C;  3CCE A;  1EWC A;  3SHL A;  1ONL A;  2K5Q A;  1VQ5 A;  4RKB A;  4YCW A;  3KFU A;  1GHJ A;  3CPF A;  4I65 A;  1K8M A;  3C1E A;  1SR3 A;  1TWA B;  2F0J A;  3QOL A;  3NEL A;  5IYC H;  1TS3 A;  2F0O A;  1VQB A;  1YJN A;  4GOP A;  2O4X A;  2WAQ E;  1DOL A;  4IPH A;  1T5X D;  1L1O C;  2HD3 A;  4G7O C;  3OTO Q;  4F8M A;  3P1H A;  4DR1 L;  1SYD A;  2R7Z H;  3I4N B;  3GTK B;  4AYB B;  4HJ8 A;  3T53 B;  1UEB A;  2A68 D;  1KAB A;  3WDN A;  1KLU D;  4HCS A;  1XYI A;  4LF5 L;  1HNZ Q;  5A2Q L;  2Q2U A;  5NUC A;  1LT4 D;  5C4X B;  4PZ6 A;  4DK3 C;  2OF1 A;  1NE3 A;  1X3P A;  3FP9 A;  1SNP A;  4CDE C;  5IYD G;  3E5S A;  3GTP H;  4C1N K;  5AFW A;  1R4Q B;  1SYE A;  1L0Y B;  3GO5 A;  3J81 c;  1HA6 A;  1D7Q A;  2LFN A;  2FHT A;  3OWF A;  2WB1 B;  2NUC A;  3PIP 3;  2JK8 A;  3I4O A;  1PA6 A;  1NCV A;  5IWA Q;  4M1U B;  1BVS A;  1DOM A;  3OMG A;  4GKK L;  1A2U A;  2D0O A;  2QIL A;  1ILP A;  1STN A;  5M5Y H;  1QZG A;  1JJC B;  3S1R H;  1K9M C;  1V8Q A;  2Z8L A;  3GTL H;  1X3G A;  2EYO A;  3HKZ B;  3H91 A;  5E7N A;  4DAP A;  4LFC L;  2E75 C;  2JA6 H;  2A6H C;  1B50 A;  1WD0 A;  2MNA A;  3CPW A;  4DNI A;  3GTQ B;  4X65 L;  4NW2 A;  1KDA A;  2QCP X;  4IFD H;  1JR0 D;  2NBF A;  5IIF A;  1D5X C;  3A56 A;  2JA9 A;  1VQK A;  1DON A;  1E0B A;  1B9M A;  4O2D A;  2F3V A;  4YIJ A;  1KL9 A;  3D4R A;  2E2D C;  1KNA A;  5C4J B;  1HFN A;  1O78 A;  2L5T A;  5M3M B;  1I50 H;  1VQ4 A;  3L0O A;  2I46 A;  4MNO A;  3PO2 G;  2XRQ D;  1O7Z A;  2HCC A;  4CJ0 B;  3S1M B;  5GAE C;  1F2Z A;  3H15 A;  1IBL Q;  1ASZ A;  3ERQ A;  4A3M G;  3GTQ H;  3S9W A;  1VQM A;  1OTC A;  4ZRZ A;  1PFN A;  3NEM A;  1YIT A;  1ZXT A;  3D0F A;  4A3F H;  1ENA A;  1XX8 A;  4IUT A;  1G6Z A;  2I5M X;  1Q90 A;  2NTS A;  3D4D A;  5I2Y A;  3TS2 A;  2EE1 A;  4G7H C;  2Q2H A;  2M9V A;  2R92 H;  1IKL A;  3FDT A;  4K5V A;  5EKL A;  3BVG A;  1STG A;  4LF9 L;  3CAM A;  4BBR H;  1QNU A;  1JWS D;  4S3S A;  4NXM Q;  2KA7 A;  3CKI B;  3MVV A;  1K73 C;  3RD4 A;  1VQ8 A;  3CCL A;  4J6H A;  3I2Z A;  2YTY A;  2J4X A;  2AHO B;  5G3L D;  4K6D A;  2JA7 B;  2I07 B;  1OXS C;  2F0E A;  1FJG Q;  3KF8 A;  4B3R L;  5ELD A;  3HOV B;  2PNH A;  2LMC B;  2EY1 A;  2C35 B;  2MHV A;  4FF1 A;  3RLF A;  3PO3 H;  5ELC A;  4R4O A;  4X66 L;  1F77 A;  1KHI A;  3H3V I;  4DR6 Q;  2LKV A;  4RKL A;  4RH6 A;  3TRE A;  1KAW A;  3JAM E;  1A0I A;  4A3K B;  4KJN A;  1EL0 A;  2PI2 A;  1STE A;  3GTK H;  2AQ1 B;  1PFM A;  3HKZ G;  1PHJ A;  2L9H A;  4F7X A;  4JYA L;  1XJV A;  1HR0 Q;  2JXM B;  5GQO A;  4C3I H;  1Q1E A;  2XNA C;  4V19 0;  4RGM A;  4C3J G;  1JIC A;  3UDF A;  4QIW E;  3JAM c;  2ZJP A;  1K3B C;  4DF7 A;  3BDC A;  4HJ9 A;  1EY6 A;  4OEL B;  2UXD Q;  4XQN A;  2E2J H;  5JJL A;  1J9O A;  2N55 A;  3NTI A;  1Q8I A;  2PZT A;  3GTP B;  1V1O A;  2XSC A;  4UHV A;  1EY4 A;  2WAQ G;  1H9K A;  3H3V H;  1WYD A;  2BH2 A;  2OTJ A;  2IX1 A;  3PO2 B;  2L55 A;  4DA2 A;  4FF4 A;  2F0Q A;  2G9D A;  5A2Q E;  4JV5 L;  3MXP A;  5ELF A;  4DUZ L;  1PRT D;  4ZQ3 A;  2SOB A;  4DUY L;  3ERS X;  4NP5 A;  3J80 E;  3HOX B;  1I6H B;  3URY A;  3BZD B;  3X3M A;  1WJJ A;  4L8J A;  1FL0 A;  2Q8T A;  3L9A X;  2CWP A;  4HJ7 A;  4LF8 Q;  4B08 A;  1W2B A;  2XN9 C;  2UUC Q;  1EWH A;  4LFA L;  4PZ8 A;  1LTR D;  4E6I A;  4C3H H;  3S14 H;  2HQE A;  1CA6 A;  2ZXR A;  5IGD A;  3M4Q A;  1EEF D;  3KF6 A;  3CF5 A;  1AE3 A;  2MGS A;  1I6V C;  1UE5 A;  4CDF C;  1OXT A;  4B3S L;  3S1N B;  2F0L A;  3DEO A;  4LF8 L;  3EVQ A;  4DV7 Q;  1Y1W G;  5FLX E;  4DV4 L;  2QW7 A;  4XQJ A;  1QIL A;  3BVZ A;  5DNF A;  3OOC A;  2X6L A;  1WTR A;  1B7Y B;  3H0G H;  1E2W A;  2Q2I A;  3K57 A;  4NDX A;  3MFY A;  3OSO A;  2MUY A;  2E2H H;  2V4D A;  2DNC A;  4JBK A;  3I4M H;  4YCU A;  2JSO A;  3NWS A;  4H13 C;  1A3U A;  2K32 A;  1MGS A;  1E1T A;  1F2L A;  1NTG A;  4K5X A;  4ME3 A;  2IHF A;  3UE1 A;  1B53 A;  1TS5 A;  1PRT B;  3I90 A;  5FLM G;  3HOV G;  1Y8N B;  3NSW A;  1EZ6 A;  1CKN B;  5K36 H;  2A68 C;  4U68 A;  4IOA A;  4HID A;  5D14 A;  2KHS A;  3I70 A;  2TMP A;  1F9P A;  3G48 A;  4X65 Q;  3HOU B;  2HUG A;  3GD7 A;  3TRZ A;  4X66 Q;  1YNN D;  5K36 G;  4GKJ Q;  5CV6 A;  4ALP A;  3CQZ H;  4EVO A;  4L6T B;  4DV0 Q;  4ZLT F;  1Y8O B;  1HPC A;  3J81 E;  2NVY H;  3CC7 A;  2JA8 H;  2K5H A;  3J80 c;  1WCM G;  5E4W C;  5BR8 Q;  5J3B A;  3V96 A;  2KCT A;  2V1C C;  3TZU A;  2VXW A;  4IAL A;  3JAM L;  1YZ6 A;  4KY7 A;  4I7Z C;  1D6E C;  3I56 A;  3KBX A;  4XQQ A;  2VUM G;  4U67 3;  1KQS A;  1DYQ A;  2EPB A;  4DV5 Q;  1CM9 A;  3L2P A;  3PGZ A;  2K5W A;  1AN8 A;  5IT9 E;  2UU9 L;  1K8O A;  1PH8 A;  4NMZ A;  5DEH A;  2RBM A;  5C3E G;  4K6L A;  5FO7 B;  2CFM A;  2EXZ A;  1YHA A;  2EY5 A;  2B2V C;  5LHY 1;  2PW7 A;  1OXU A;  4L5Q A;  1TII D;  4IZ8 A;  4RWS C;  2NN6 I;  5C44 H;  4G4K A;  1U0L A;  2FMC A;  1G51 A;  4A3C H;  2A69 C;  2BH8 A;  2K04 A;  1G29 1;  1Y69 U;  3M7N A;  1XXG A;  1IW7 C;  2VS1 A;  1R9T H;  3ICE A;  3M9B A;  1SE4 A;  3LWU A;  3S14 B;  1SE2 A;  4LF5 Q;  2EYL A;  1DJR D;  1R4P B;  1XTC D;  3IFD A;  4UAI A;  4A3J G;  3U4V A;  3PIP A;  4DFA A;  1AZP A;  3DEP A;  4DUY Q;  1WTX A;  3HKZ E;  2XVS A;  2L0C A;  3D6W A;  3PO3 G;  3K5L A;  1EYG A;  2OEO A;  4RCN A;  4GKK Q;  5C5M A;  3J7A V;  2F4V L;  1VS0 A;  3QWN A;  3SDZ A;  2CQO A;  4A3K G;  5M3F H;  1Y1V G;  5I6Y A;  1BQQ T;  5CC4 A;  1S40 A;  2EJF C;  4A3F G;  2D5D A;  3TP8 A;  1KIX A;  5ELN A;  4ID6 A;  5IYB H;  2HIV A;  4IUN A;  4O1N A;  3SK4 A;  3MAQ A;  1JOK A;  3I4M B;  2NWG A;  1EQV A;  1V1P B;  1U4P A;  2EOT A;  1RJT A;  3J80 L;  2Z4H A;  1IHZ A;  1I50 B;  4LFC Q;  1WCM B;  3S1Q H;  1JE4 A;  2XIW A;  3SVM A;  3EN2 A;  1SEB D;  4BBR G;  1N32 L;  2WIN B;  4L5R C;  3NBH A;  4A3I B;  3E0E A;  1LAB A;  3QR8 A;  2F0I A;  1S5D D;  1ET9 A;  5IYC G;  1I5F A;  1K83 B;  5I2X A;  3ZYY X;  1KAA A;  1B2T A;  4GNX C;  3OMC A;  1AZQ A;  4DV0 L;  4DAY A;  1ASY A;  3PQI A;  2F4I A;  3I7F A;  3T4A C;  1EQT A;  5JEA J;  4H0L C;  1PYS B;  3TDQ A;  2KHI A;  4QJF A;  3P7J A;  3J81 L;  1PMR A;  1E2V A;  2CH4 A;  4KKS A;  1BBW A;  4QB4 A;  4HIO A;  4A3I H;  1TWH B;  1ZEQ X;  2QEJ C;  3Q0A A;  4MIU A;  1NY4 A;  1U5K A;  4BY1 H;  1TS2 A;  3CW2 C;  3EBE A;  4L5T A;  1E22 A;  1ZYR D;  4XXE A;  3OTO L;  3G4S A;  2R61 A;  4G7Z C;  3SK5 A;  3MFG A;  4PZ7 A;  2IX3 A;  1WD1 A;  4XIG S;  5CV8 A;  1HZB A;  3DM1 A;  2PQA A;  4Y52 H;  1HXY D;  1D5Z C;  1LTB D;  2FFK B;  1SDF A;  4F87 A;  3GTO H;  2PMZ B;  4FDB A;  4OIK A;  1IBL L;  1EYC A;  1PVO A;  3I8Z A;  4CJ1 B;  2Q8I B;  1E3P A;  1BO0 A;  1N9W A;  1NNX A;  3RR5 A;  1Q12 A;  2F3W A;  3SK6 A;  1SSO A;  3PUX A;  4LUZ A;  4JOI A;  1L2F A;  5FO8 B;  2D2C C;  5C4Z A;  4JOI C;  2VL6 A;  1RHP A;  2UXC L;  1C0A A;  2PNR C;  4LF4 Q;  5CV4 A;  1CI3 M;  5DM7 3;  5JVG 3;  4RHS A;  1YVC A;  2SNS A;  1VQJ A;  4R9W A;  2O5J C;  1XWE A;  2MO0 A;  1ESR A;  4JI2 Q;  3AFP A;  4OON A;  1PH6 A;  1KC8 C;  2XWJ B;  2KUM A;  5EKK A;  3PO3 B;  1AH9 A;  4DXF A;  2QA4 A;  4KV6 A;  3HGB A;  1B44 D;  1SRU A;  2DJG C;  1EY9 A;  4KI0 A;  1YI2 A;  2SDF A;  1ROD A;  2VQF Q;  4A93 H;  1Z9F A;  3W3A A;  2PZU A;  4QUF A;  1YNJ D;  3RLN A;  1Z6H A;  4JBM A;  3MXG A;  4GKJ L;  1I6H H;  4YY3 Q;  1IKM A;  1XMQ Q;  4EQP A;  3PMF A;  1UE6 A;  5T1I A;  2BCO A;  1QE6 A;  3A5U A;  2RF4 A;  2EJG C;  3MA2 B;  3PF4 A;  1SXT A;  1B3A A;  3DHQ A;  5T1G A;  2HQL A;  2G9H D;  4LF7 L;  1SNQ A;  2VB3 X;  4NXN Q;  3IFT A;  4JPB W;  4GNX A;  1CZG A;  1SE8 A;  3A8K E;  4J1M A;  1F9Q A;  1V1P A;  1AW7 A;  3HEJ A;  4DV6 L;  3M4O H;  2QDL A;  2ICI A;  2B2T A;  1WOC A;  1RKN A;  1WFQ A;  2RKS A;  1BCP C;  2ZM6 Q;  5FKA C;  4BY7 B;  2JQO A;  4X62 Q;  3F2U A;  1EY8 A;  3AMU A;  1CKN A;  2BDN A;  4FVM A;  2HIX A;  1ML0 D;  5DLQ E;  1QWY A;  1XMQ L;  5FLM H;  3RNU A;  1SNO A;  1FGB D;  2F0V A;  1WVL A;  3S16 B;  3J7A F;  2RDG A;  1S72 A;  2B29 A;  2WFW A;  3WOF A;  4GLV B;  2IT1 A;  3S1N H;  4BY1 G;  1UE7 A;  4UP9 A;  3TEH B;  3UDG A;  3W1B A;  1GUW A;  4BWG B;  5M5W H;  3IRB A;  2OWO A;  2R6G A;  1B3Q A;  2B63 H;  3NK9 A;  4JI2 L;  4JVZ A;  2FMM A;  4TQU S;  2AQ3 B;  1PH4 A;  1IBK L;  3PIO 3;  4BA1 I;  3GDE A;  1A2T A;  4DV3 L;  1FNV A;  4K2K A;  2F3I A;  4C2M B;  1KLG D;  1YNN C;  5F2D A;  3QIA A;  2F0T A;  2CVR A;  1MD2 D;  3CQZ B;  4KN7 C;  1EFW A;  5HY6 A;  3C3L A;  2A8V A;  5CGK A;  3CMA A;  2LY7 A;  3F2B A;  3AQQ A;  4JC0 A;  5M5X B;  4P75 A;  1LTS D;  5C6A A;  3LGJ A;  3GTG H;  4BA2 I;  2JA5 B;  3ER0 A;  2QGQ A;  3TME A;  5C4X H;  1SFO B;  5E3F A;  2KED A;  1F9S A;  3G6E A;  1B1Z A;  2L12 A;  2UXD L;  4JI1 Q;  4QMG A;  4DR3 Q;  3MWY W;  3E9H A;  3FPU B;  3FHW A;  1BBU A;  4CDC C;  5C0X J;  4B3M Q;  4IUU A;  4R1J A;  5H1S E;  3A74 A;  3H94 A;  4RGO S;  1PH7 A;  5J39 A;  1SLJ A;  1PH5 A;  1QG7 A;  4DAM A;  4A3B G;  2R7D A;  4DV1 L;  2D62 A;  1FYC A;  1H9R A;  2K01 A;  4HTH A;  1E1O A;  3PUZ A;  1YNJ C;  2F0H A;  2RHQ B;  2B2U A;  1FVI A;  5FLX c;  1LAC A;  3S17 B;  4K5W A;  2LSS A;  2PW5 A;  5DAU A;  3ZJY C;  1HZC A;  3PF5 A;  4OWT B;  4RG1 A;  2UXB Q;  4A3L H;  1LYL A;  1IBK Q;  1EY0 A;  2PCF B;  1K0R A;  3TP6 A;  5C0X G;  3NPP A;  1A3V A;  3S2H B;  2ZM6 L;  3QB3 A;  1HUM A;  2KBN A;  1MSH A;  1V9P A;  3NQT A;  4A3J H;  2M00 A;  5IGF A;  2J0T D;  1R9T B;  1SN8 A;  1VQP A;  2DN8 A;  2XRS D;  4YHH Q;  1W6K A;  2JN4 A;  3NQI A;  4DR3 L;  4KJO A;  4MZ9 A;  3HP3 A;  3TZD A;  3MXN B;  5CV9 A;  1C4Q A;  3BJU A;  2XWB B;  1X55 A;  1IBM Q;  1JOO A;  1QUQ A;  3T1Y L;  1LT6 D;  4AQY Q;  1TY2 A;  3D31 A;  3G71 A;  2VW9 A;  1IL2 A;  2B3G A;  1FGU A;  1CQF A;  4HSV A;  2UUA L;  1PTO F;  2DNE A;  3HOZ B;  2RHS B;  5D3D A;  4A3G G;  2E5L Q;  5IGG A;  5C44 G;  2RA4 A;  5M3F B;  4YY3 L;  3HKS A;  4BY7 H;  4IUQ A;  3HFZ B;  3QJY A;  5JVH 3;  1HQR D;  3WOE A;  5FJ8 G;  3DLL A;  1CTM A;  1F9R A;  1GKH A;  4ZAI A;  3O13 A;  4UY8 C;  1X32 A;  2Z6B A;  5ELO A;  1C48 A;  1SAP A;  4ZUJ A;  4KTA A;  1LV9 A;  3ND9 A;  3T51 B;  1VCI A;  4POF A;  2CQA A;  3CU7 A;  1LT5 D;  5K5P A;  3D6C A;  3M7G A;  4BBS G;  1IYU A;  2JA7 H;  2IWH A;  3KDF B;  5CBA E;  1STB A;  2AQ2 B;  3K7A B;  2WKD A;  3RLO A;  4GOP B;  3MTS A;  1Q81 C;  4DR1 Q;  4IO9 A;  1HNW L;  4A3E H;  2OT2 A;  1DM0 B;  2EYP A;  4APV A;  4O0A A;  1TWC B;  2HCI A;  2H5X A;  1X65 A;  2OXP A;  1C8C A;  3SK8 A;  1C7Y A;  4K2L A;  3R2I A;  1SYC A;  3MHB A;  4FYD A;  3QOJ A;  5EPJ A;  4C1N I;  4HJ5 A;  1BNZ A;  1PLF A;  1GUS A;  5IYB G;  1X6O A;  3NWT A;  2K5D A;  3PCO B;  1CHQ D;  1CQV A;  3S1Q B;  1A62 A;  2JA5 H;  1SFO H;  1DGS A;  1PRT C;  3U58 A;  2OCE A;  2GVA A;  2Z4I A;  2CKZ B;  5I9P A;  3KDF A;  3OW2 A;  4JBW A;  4UP7 A;  2N8N A;  4GLX A;  2UU9 Q;  4YHH L;  2K5N A;  5KNB A;  1IBM L;  2K1B A;  2ATW A;  4DR4 Q;  2DUD A;  1PTO B;  1LUZ A;  2BA0 A;  2N88 A;  4KHP Q;  1SMY C;  2F0F A;  3KUP A;  3LX0 A;  1WTQ A;  3GV6 A;  1O80 A;  1SBB B;  4X64 L;  1LTL A;  3J80 i;  1ILQ A;  1VQ9 A;  1WTP A;  4DV2 Q;  3VYS A;  2I5H A;  2DJF C;  5COY A;  1JC7 A;  2BOS A;  1MJE A;  1LTT D;  2D9U A;  3A7L A;  3SE0 A;  4BY1 B;  5IE8 A;  4JI6 Q;  3S2H H;  4NXM L;  4C3H B;  2AUJ D;  5JJZ A;  3F2D A;  2NVX B;  5D3I B;  1SYF A;  4B9X A;  4C3I B;  4DV1 Q;  2A6E C;  4DK1 A;  1M1K C;  1Y1V B;  4FXK C;  1XPO A;  2A1A A;  1K3R A;  4JI4 L;  1IYV A;  1BDO A;  3K6O A;  1HUN A;  5HUR A;  1VQD A;  4OX9 L;  1MIU A;  4CDD C;  4LW1 A;  2PPB C;  3KK7 A;  1GOZ A;  3GTJ B;  4A75 A;  4A3G H;  2WB1 E;  5BN3 A;  4AYB E;  2CWA A;  4LFB Q;  2B2W C;  5LMN W;  1V1Q A;  5AJ3 L;  3L3O C;  2NVT B;  1I4H A;  1X3F A;  3NE5 B;  3TSS A;  4ZUI A;  3HOZ H;  1SMY D;  1X54 A;  5IP7 G;  1PFB A;  2NVX H;  3HOX H;  3TS0 A;  2EYH A;  1CHP D;  1TWF B;  4HN7 A;  3VR3 A;  1PDQ A;  2X6G A;  1ZKO A;  4O42 A;  1TXY A;  4JW0 A;  1C9O A;  2SEB D;  2XTI A;  3CCJ A;  2VY3 A;  4RFB A;  3S15 B;  1HNZ L;  2YTV A;  1PFS A;  4CGY B;  2GVB A;  3D8G A;  2ZTC A;  4JI0 L;  5BN4 A;  4RA8 A;  4OO1 G;  1VQF A;  1EYA A;  4DNR B;  5EBC A;  2N3S A;  1GHK A;  4JCV E;  3F1Z A;  2P5Z X;  1H9M A;  3FKI H;  4PMB A;  3G6J B;  3V05 A;  2EXD A;  1K8G A;  1DCZ A;  3OYY A;  3H6M A;  2RDH A;  4F88 A;  5BN5 A;  4B3S Q;  1L1O A;  3HG9 A;  1Q1B A;  5C3W A;  4N9P A;  3IL8 A;  1GO3 E;  1GUN A;  5L37 A;  1A6X A;  1PRT F;  4H02 A;  3K80 C;  1K83 H;  3RUZ A;  1HNX L;  3CP0 A;  2WAC A;  1LM0 A;  4BXX H;  3STB D;  3KLR A;  3NP8 A;  4YWL A;  1CSQ A;  1EOV A;  3RMH A;  1GM5 A;  4P72 A;  4LF7 Q;  3VYU A;  2JE6 I;  4J15 A;  2RCN A;  1SNM A;  1HHV A;  1TVX A;  1HJP A;  3S1M H;  2F0G A;  3KLS X;  3NTH A;  4ILW A;  3HOU G;  2ASB A;  4NXN L;  3W1G A;  2E5L L;  1A15 A;  4DUZ Q;  2H1E A;  4RGN A;  3DWA A;  2PI2 E;  3VA5 A;  4NB3 A;  3NXW A;  1KRS A;  2JA5 G;  4IUP A;  3VYR A;  1DD2 A;  4QF4 A;  5LMN Q;  3VDY A;  2K52 A;  4R4Q A;  1HNX Q;  5D65 A;  4KKU A;  5C0X H;  1IYJ B;  2KEN A;  4JG2 A;  2N78 A;  3L7Z C;  5M3M G;  2A74 C;  4KLK A;  4ULL A;  4CHT B;  2M2L A;  3KBG A;  1JE5 A;  1S5E D;  4IUV A;  4CKC A;  3DM3 A;  1QVC A;  4EQO A;  2KCM A;  4BBS H;  2JA8 G;  2EY6 A;  4A3I G;  1VF7 A;  3R2T A;  5CMD A;  1TQO A;  3BS1 A;  4JK1 C;  3W5O A;  1YIJ A;  4KHP L;  1HTL D;  5E1F A;  2MO1 A;  1E2Z A;  2D0P A;  4RHR A;  1VQ7 A;  1JCK B;  3K0X A;  4JI0 Q;  3GTG B;  5KRU A;  1PZJ D;  3E3X A;  4IFD I;  3HOX G;  2IPK D;  2Z0S A;  1S4Z A;  5M5Y B;  2VUM H;  1QUQ B;  1K8A C;  4A3B B;  5E4X A;  5C3X A;  1N8R C;  4ABN A;  2NVT H;  1IZ6 A;  2K50 A;  2JA6 B;  3ITP A;  2CW0 C;  1MI2 A;  3D4W A;  1GXD C;  4BY7 G;  4C3J H;  5IGE A;  2HDM A;  1H9J A;  5LMU L;  1RL2 A;  4LF6 L;  3NTK A;  3D3R A;  3DXJ C;  2JA6 G;  1J6Q A;  5JAV A;  4HMI A;  2L15 A;  3S15 H;  4X3K A;  4X6A H;  3PO2 H;  1B70 B;  3C2P A;  1DZ1 A;  1P8L A;  1NAP A;  2F0N A;  2E2I H;  3GTM H;  2EYJ A;  4IJL A;  4DV3 Q;  1VQO A;  4HIM A;  3EFX D;  3KLW A;  2ENB A;  4LWC A;  3TN2 A;  2ZTE A;  3HOW H;  4DR7 L;  1STA A;  4DNT B;  4A3J B;  4DV7 L;  4IFD G;  2G5D A;  4A3F B;  3UE0 A;  1J8I A;  3U9O A;  4OO1 H;  1HFG A;  2GA4 B;  1LT3 D;  1B9N A;  2CH4 W;  1AP0 A;  1D5M C;  2AMC B;  1TWH H;  1HCZ A;  1SMX A;  2K33 A;  2WV6 D;  3I73 A;  4DU9 A;  1YJ9 A;  3G7L A;  1X9N A;  2PQE A;  4DV6 Q;  2WII B;  1RF2 D;  4BBR B;  2DY7 A;  1XPU A;  1HR0 L;  3Q6S A;  1HH2 P;  5TSS A;  5KYI A;  1QCB D;  3Q24 A;  1XNR L;  1FNW A;  4KD4 A;  5JEA G;  2DGY A;  1S5B D;  1OXV A;  4PV1 C;  1PYB A;  2B2V A;  3GTO B;  4EGV A;  1PTO D;  2XGT A;  1SND A;  4XT1 B;  2R93 B;  3CC4 A;  1PH9 A;  1Z47 A;  1O7Y A;  3RZO B;  3MXN A;  5JEA H;  3PUW A;  1JWM D;  1VQN A;  5JJI A;  3GP7 A;  1DXM A;  5JJK A;  4EQN A;  2A19 A;  5M5X H;  4XDX A;  4L5S A;  3IKJ A;  1EU3 A;  1I4R A;  1GVP A;  1SYB A;  1EIF A;  1RD9 D;  4LF6 Q;  1XMO Q;  1Y8P B;  2NN6 G;  3BZC A;  5I6W A;  1FR3 A;  3GQB A;  3E6Z X;  1SE3 A;  2RSO A;  5C5L A;  1PV4 A;  3RN5 A;  3RZO H;  1BCP F;  1JJ2 A;  2B8G A;  4I7A A;  3HZX A;  3NEN A;  2VB2 X;  4L63 B;  3H09 A;  4B3R Q;  3AB9 A;  5COR A;  3FEW X;  4FF2 A;  4WOR A;  1VQE A;  2E76 C;  1XNR Q;  2H4O A;  2PQA B;  2YYZ A;  4DKA C;  1VQC A;  4B3M L;  3S24 A;  1CT1 D;  5JPN C;  4C3I G;  1ENF A;  4B9W A;  4HCE A;  3CCM A;  3CXC A;  2EY2 A;  4A3B H;  4DR2 L;  1NJI C;  3QO2 A;  2J7Z A;  2PYK A;  4PQX A;  4OL7 A;  3LWE A;  3KF8 B;  1U9R A;  1VQA A;  4C3J B;  3TP7 A;  2IHE A;  4AH6 A;  1YEZ A;  1TY0 A;  4MTN A;  3M4O B;  2KCC A;  3CCR A;  1HR0 W;  3K81 C;  1EIY B;  1HZ9 A;  2F0U A;  2F1M A;  2ES2 A;  4DGZ A;  3T1Y Q;  1EUJ A;  4JI3 L;  3K5M A;  2UXB L;  1IXR A;  4DV5 L;  1QZH A;  4CKE A;  5HGQ A;  3HOY G;  1EU4 A;  2B39 A;  1RCV D;  1SRO A;  1GUO A;  3GTL B;  1EIH A;  3GTM B;  2O2L D;  2JJQ A;  2MJ8 A;  2WP8 J;  3N6R A;  1VMP A;  4JBJ A;  1NMG A;  3C46 A;  1EQQ A;  4UPA A;  1HA5 A;  3HOW B;  4P71 A;  3S16 H;  5I4D A;  2F0S A;  2B2Y A;  1EFI D;  1Y1V H;  1PXU A;  3I4M G;  1SYG A;  4LUO A;  2Q2T A;  1PH1 A;  3T56 B;  5C0X I;  4A93 G;  2TSS A;  5LMU Q;  3M3Y B;  1IW7 D;  1X3Q A;  3DWP A;  1VQI A;  1U4L A;  5M3M H;  4PNY A;  2F0P A;  2F52 A;  1L1O B;  1PZI D;  3BDL A;  4TRD A;  1N34 L;  2NZH A;  2IJ0 A;  2A69 D;  3KOJ A;  5FJ8 H;  5IOC A;  5CBE E;  4GNX B;  5KEE A;  4IPG A;  4DR2 Q;  5EGT A;  4QIW B;  5CV7 A;  5EKI A;  1FJG L;  4QQB X;  2ZJQ A;  4BXX G;  5CYU A;  1PTO C;  3S2D H;  1CKO A;  3Q23 A;  1N33 Q;  3NUC A;  1CA5 A;  1D2B A;  1X56 A;  4DXG A;  1A3T A;  1JJG A;  4LF9 Q;  2F0D A;  3M4P A;  1NR2 A;  4H7B A;  2ZJR A;  1TWC H;  4GN5 A;  3P20 A;  2JEA I;  1I94 Q;  1G2T A;  1TWG H;  3VR6 A;  2DY8 A;  3Q22 A;  1BBX C;  3AYH B;  3F2C A;  4MHE A;  2RQX A;  1XNQ L;  1WI5 A;  3M85 A;  4JI7 Q;  4HJA A;  1X3E A;  2QF7 A;  5I9O A;  1F2Y A;  1EEI D;  4GLA C;  5FK9 C;  1HZA A;  1Y14 B;  5M5W B;  2AWN A;  3K0Y A;  2B63 B;  3V2T A;  2MP1 A;  4FF3 A;  1U4M A;  3J81 j;  4DV4 Q;  2L4N A;  2I0Q A;  2SNM A;  4DR5 L;  4TVA B;  4DK6 C;  1VMC A;  2VQF L;  3S17 H;  3CCQ A;  2BE5 C;  1JOQ A;  3OHX C;  3CCV A;  1QJO A;  1TR5 A;  2QKI C;  4UDU C;  1YNX A;  1ENC A;  5KGU A;  3PUY A;  5EBD A;  1WTO A;  3QG1 A;  1Q46 A;  1I4Q A;  3OPO A;  1VDZ A;  2KCN A;  3KJO A;  3HOY B;  5GRO A;  4LFA Q;  3MEH A;  1HQM C;  3R3O A;  2Y0S B;  3IAY A;  1MJC A;  4OXP A;  3HRZ C;  2VZA A;  4K14 A;  1PYW D;  2IX0 A;  3I3C A;  1PZK D;  1Q8K A;  1CZW A;  4IQZ A;  4TSS A;  4IPC A;  1GD7 A;  1I94 L;  1H9S A;  2EYF A;  1KNE A;  4LAA A;  1LTI D;  2EQS A;  1UNS A;  4IUR A;  3EA6 A;  1G8Z D;  1LTG D;  5IY0 A;  3UDX A;  2VQE L;  3I4N H;  4DR6 L;  1IL8 A;  1D8L A;  3HOY H;  3HOV H;  2I5L X;  1QNK A;  4A3M B;  2A73 B;  1S5C D;  4PMW A;  3UI2 A;  2ICE C;  3KYH C;  3ND8 A;  1L0X B;  3KLS A;  4MN3 A;  1CK1 A;  1RTN A;  1EYD A;  1I3Q B;  1N34 Q;  2KJX A;  4GS3 A;  3CCU A;  1Y1W H;  1KRT A;  3KF6 B;  1CKM A;  1Z7T A;  4A3K H;  4HMJ A;  3H3V C;  1A63 A;  2HHH Q;  1D1K A;  1AE2 A;  2R7F A;  1P16 A;  1QB5 D;  3E9I A;  1BXT A;  4LK1 C;  2K75 A;  5FOB B;  2LS0 1;  3UDI A;  4DAV A;  3EQL C;  3H0G G;  4B3T L;  1LLR D;  1VQL A;  2F0K A;  2YU9 H;  3F8T A;  4JI6 L;  3A7A B;  1YHQ A;  2AKW B;  1TWF H;  3J7A 5;  1Q7Y C;  4OWX B;  1H9S B;  3VA7 A;  2EVB A;  1SNC A;  4V0B A;  5CV5 A;  1M4V A;  2A5H A;  2FXQ A;  2Z9H A;  3VR4 A;  5EJW A;  3M3Y H;  5IP7 H;  4N8X 1;  3S1R B;  1RDP D;  1T5E A;  1KD1 C;  1TKW B;  2OQK A;  4A3D H;  4A3E B;  1RTO A;  3PSI A;  3CC2 A;  1WTV A;  5EPK A;  4IOC A;  3HS0 C;  3T1H L;  1CUK A;  3X3N A;  5M3F G;  3RZD H;  2F0M A;  4JI5 Q;  4LFB L;  1F2M A;  5G3L F;  2PZW A;  1OO9 B;  5M9O A;  4PMC A;  3CD6 A;  4IJH A;  4J8Q A;  1N36 L;  2OQ0 A;  4N9T A;  3BU2 A;  4RMF A;  5ISR A;  2EJM A;  1B4O A;  4LJZ C;  2O5I C;  3ULJ A;  2K28 A;  4OWW B;  3FKI G;  1UUP A;  4K8I A;  5LL6 S;  4XYQ A;  5IP9 H;  1GUG A;  4HIK A;  4B3T Q;  4ZKC B;  2KHJ A;  1GUT A;  1UAP A;  2NN6 H;  2Y0S G;  1XMO L;  4GN3 B;  3RZD B;  3STB C;  3BG3 A;  4LMQ D;  2OTL A;  5J22 A;  4AIM A;  1II3 A;  1WTH A;  5A35 A;  5FLX L;  3K59 A;  4A3L G;  4RCO A;  1NSN S;  3FMC A;  4QUC A;  3MEF A;  2JYO A;  4Q0F A;  3I55 A;  2NB0 A;  4JI4 Q;  1STY A;  5IWA L;  4NPS A;  3A5Z B;  3KJP A;  4LNQ A;  2JA8 B;  2ID0 A;  3TBI B;  2A6H D;  5FO9 B;  1T9H A;  2IY5 B;  1M8A A;  4RAU C;  2BA1 A;  4P2C B;  1W3S A;  2YTX A;  2JP1 A;  5LMN L;  4X3T A;  4KY5 A;  2Z6K C;  4KMU C;  3JC6 6;  1FNU A;  3CRK C;  2L1B A;  2RCF A;  5KND A;  1L0W A;  2K05 A;  4DK0 A;  3OW7 A;  3K58 A;  4DV2 L;  1EY7 A;  4HAE A;  4HR7 B;  2MPM A;  1BCP D;  3GV3 A;  2UUC L;  4FP5 D;  1JT8 A;  1U4R A;  4GOP C;  3I91 A;  2F03 A;  4KHV A;  2A6E D;  4XYO A;  2B2T C;  1CFM A;  4C56 C;  3JAM i;  1WTW A;  3TP5 A;  1TWA H;  4DAY B;  1EQR A;  1H95 A;  3MC0 B;  4WJ3 M;  1N32 Q;  3BVM A;  3GTJ H;  2UUA Q;  1B8A A;  3MZ5 A;  2KQ3 A;  5DM6 3;  3BZK A;  4H44 C;  4R4C A;  3I72 A;  1UEA B;  1UE1 A;  1JB3 A;  5JPM C;  1JQY D;  1NMF A;  2F0W A;  4FXD A;  2ALY B;  5JOB A;  4CKB A;  1ET6 A;  3A8I E;  4RGT A;  3VR5 A;  1VQH A;  1KDC A;  2FIN B;  4AYB G;  1JOR A;  4YWM A;  3TQY A;  4JYA Q;  4JI8 L;  1EWI A;  4ME5 A;  1A8V A;  2EDG A;  1VQG A;  2BE5 D;  2EZV A;  3A55 A;  2FJ2 A;  4OO1 I;  2YU9 B;  3U9S A;  3PIO A;  3U4Z A;  1XTD A;  2RSN A;  4JI1 L;  4LUV A;  3I4L A;  1AFP A;  4Y7N H;  2EIF A;  3DMU A;  1HNW Q;  4DR7 Q;  4FXG C;  1BF4 A;  3T13 A;  1K0S A;  4M8A A;  3K5O A;  3C1F A;  4A3G B;  2Y0S E;  5CR3 A;  5C44 B;  4EQ5 A;  1SJH D;  2EYM A;  1EOT A;  2BDO A;  3AFQ A;  3Q8D A;  2NTT A;  3FRP B;  1EZ8 A;  3J7Y W;  3B6Y A;  1XNQ Q;  1HRJ A;  4AQY L;  1LO5 D;  4WJ4 A;  2UUB L;  4DN4 M;  4CBV A;  2IL8 A;  2RVL A;  4POG A;  4Y7N B;  4PG3 A;  2R92 B;  3CCS A;  4IFD J;  5IT9 L;  3BDO A;  2R3Z A;  2R93 G;  4TKO B;  5AJ3 Q;  1N33 L;  2K5V A;  2UXC Q;  2NZ1 D;  1FD7 D;  5KYL A;  2K03 A;  5C4J H;  4Z9C B;  2NZO A;  3NBH B;  1MHW C;  3HOW G;  3FVQ A;  2HDL A;  1VF5 C;  1Q3L A;  3RN2 A;  3A54 A;  2QEX A;  4DPG A;  3M4Y A;  2NYZ D;  2B2U C;  4JI5 L;  3ONA B;  2R7Z G;  2K7V A;  4JI3 Q;  3CHB D;  3WWV A;  1PH2 A;  3K8A A;  3EJI A;  4X62 L;  1ICW A;  1JB7 A;  5IGC A;  4X64 Q;  1MBY A;  2JA7 G;  1J5E L;  2K14 A;  4R4I A;  1W6J A;  3W2D A;  2PO4 A;  5C4X G;  3SEB A;  4X3U A;  2B63 G;  1I4X A;  4P74 A;  1O7I A;  4Q5V A;  1KTK A;  4HED A;  3BYY B;  4R4T A;  2C5C A;  4QY7 A;  1ESF A;  3K7A H;  2YV5 A;  4WRD A;  3J81 i;  4DR4 L;  4A3E G;  2KOL A;  2VQE Q;  1JWU D;  3E0J A;  3U50 C;  1PH3 A;  4A3C G;  3HOZ G;  2E2J B;  1TT2 A;  3AU7 A;  4X3S A;  3CME A;  3ULP A;  4UP8 A;  2RDF A;  1BCP B;  4WFN 3;  2C9O A;  2MFI A;  4KD3 A;  4XTC S;  1K28 A;  3ULL A;  4OHJ A;  2L11 A;  1BUV T;  1QVF A;  1E24 A;  4FO2 A;  3SR1 A;  4ZKB B;  5ELB A;  1O7L A;  1UWV A;  3T16 A;  2K4K A;  4ZK9 B;  1YJW A;  3OWE B;  1G2S A; 
#chains in the Genus database with same CATH homology
 1GKH A;  4P73 A;  4UY8 C;  2ES2 A;  5ELO A;  3T1Y Q;  1EUJ A;  3G48 A;  4JI3 L;  4X65 Q;  4DR5 Q;  3GD7 A;  4QL5 A;  3J7Z C;  3TRZ A;  2UXB L;  1IXR A;  4DV5 L;  1QZH A;  3HOY G;  5HGQ A;  2CCZ A;  4JI8 Q;  4X66 Q;  5K36 G;  1Q86 C;  5IT9 c;  4GKJ Q;  5EAY A;  1SRO A;  5GAD C;  4ALP A;  3CQZ H;  1VCI A;  2JJQ A;  2WP8 J;  4POF A;  1RIP A;  2Z6K A;  4DV0 Q;  4JBJ A;  1G6P A;  2NVY H;  3CC7 A;  1NMG A;  4EX5 A;  4BBS G;  2JA8 H;  1EQQ A;  4JI7 L;  4UPA A;  2K5H A;  2JA7 H;  4P71 A;  3S16 H;  3KDF B;  3J80 c;  4LF4 L;  4GOP B;  3RLO A;  1WCM G;  1Q81 C;  1Y1V H;  4DR1 Q;  4IO9 A;  4A3M H;  1HNW L;  5BR8 Q;  4A3E H;  5J3B A;  3I4M G;  2KCT A;  2V1C C;  4LUO A;  1YBY A;  2Q2T A;  1PH1 A;  4APV A;  4O0A A;  5C0X I;  1YZ6 A;  2N49 A;  3SGI A;  4A93 G;  2H5X A;  1X65 A;  5LMU Q;  4GN4 B;  3I56 A;  1XPR A;  1YHB A;  1VQI A;  3PV0 A;  5M3M H;  2VUM G;  1C7Y A;  1KQS A;  1MKH A;  2R92 G;  4DV5 Q;  2F52 A;  3L2P A;  1BKB A;  1L1O B;  3PGZ A;  3T1H Q;  4HJ5 A;  4A4I A;  2UU9 L;  1PH8 A;  1N34 L;  2NZH A;  5C3E G;  5IYB G;  1X6O A;  3KOJ A;  2CFM A;  5FJ8 H;  4GNX B;  1YHA A;  1Q82 C;  2GN5 A;  3PCO B;  4IPG A;  4DR2 Q;  1FJG L;  4A3D G;  1A62 A;  2MQH A;  2JA5 H;  1OXU A;  2ZJQ A;  4QQB X;  4L5Q A;  4BXX G;  1CSP A;  1SFO H;  3S2D H;  5C44 H;  2NN6 I;  1DGS A;  1CKO A;  1U0L A;  1N33 Q;  3U58 A;  5IYD H;  1G51 A;  5C3E H;  1J5E Q;  2OCE A;  2ZTD A;  2GVA A;  5IP9 G;  4A3C H;  1X56 A;  2CKZ B;  3KDF A;  4JV5 Q;  1JJG A;  2BH8 A;  3OW2 A;  4LF9 Q;  2LXK A;  3M4P A;  4K0K Q;  1V43 A;  2ZJR A;  4A76 A;  1TWC H;  4JBW A;  4GN5 A;  4UP7 A;  2N8N A;  4GLX A;  2JEA I;  1I94 Q;  3PUV A;  1G29 1;  1TWG H;  4YHH L;  2UU9 Q;  2K5N A;  3M7N A;  1IBM L;  2HHH L;  3I4N G;  2ATW A;  1I3Q H;  5BR8 L;  4DR4 Q;  2DUD A;  4KHP Q;  1LUZ A;  3AYH B;  2BA0 A;  3F2C A;  4YWK A;  2VS1 A;  1R9T H;  3ICE A;  2WB1 G;  1XNQ L;  1WI5 A;  3M85 A;  3M9B A;  4JI7 Q;  4X64 L;  4HJA A;  1X3E A;  1LTL A;  4GLA C;  3J80 i;  1HZA A;  1Y14 B;  1VQ9 A;  2AWN A;  4LF5 Q;  2R93 H;  4DV2 Q;  1JMC A;  2I5H A;  1MJE A;  2E8G A;  4A3J G;  3U4V A;  3PIP A;  1NBW A;  1WCM H;  3J81 j;  4DV4 Q;  5GAG C;  4DUY Q;  3A0J A;  2I0Q A;  4DR5 L;  4TVA B;  5IE8 A;  4JI6 Q;  4DK6 C;  3S2H H;  4NXM L;  2VQF L;  3S17 H;  3CCQ A;  4KHZ A;  2HT1 A;  3F2D A;  3CCV A;  3HKZ E;  4DV1 Q;  1M1K C;  5GAH C;  3PO3 G;  1EYG A;  1YNX A;  4GKK Q;  1XPO A;  2A1A A;  2F4V L;  1S3O A;  1VS0 A;  3PUY A;  2CQO A;  4A3K G;  3EIV A;  5M3F H;  1Y1V G;  1Q46 A;  1K3R A;  4JI4 L;  1M90 C;  1S40 A;  3KJO A;  1KXL A;  1E7Z A;  5GRO A;  4QGU A;  4LFA Q;  4A3F G;  5ELN A;  1KIX A;  1N36 Q;  1VQD A;  5IYB H;  4OX9 L;  2HIV A;  1MIU A;  4IPD A;  3AEV A;  4LW1 A;  1MJC A;  2JEB I;  2AWO A;  4YCV A;  4OXP A;  4A75 A;  2LXJ A;  2VZA A;  2WB1 E;  4C2M H;  4A3G H;  2IX0 A;  3HOU H;  2NVQ H;  1VQ6 A;  4AYB E;  2CWA A;  4LFB Q;  5LMN W;  1Q8K A;  1V1Q A;  5AJ3 L;  4LFC Q;  2F4V Q;  1X3F A;  4IPC A;  3HOZ H;  1GD7 A;  1X54 A;  5IP7 G;  1I94 L;  2NVX H;  3S1Q H;  4K0K L;  2EQS A;  3HOX H;  3EN2 A;  3TS0 A;  1QVG A;  4BBR G;  4OX9 Q;  2VNU D;  1N32 L;  5IY0 A;  4L5R C;  3UDX A;  2UUB Q;  2VQE L;  3I4N H;  4DR6 L;  1D8L A;  3E0E A;  3HOY H;  3HOV H;  2I5L X;  1TXY A;  1C9O A;  1OXX K;  4PMW A;  2XTI A;  5IYC G;  1I5F A;  3KYH C;  2VY3 A;  3CCJ A;  4GNX C;  2PMZ E;  1HNZ L;  2YTV A;  1PFS A;  3K7U C;  3CCE A;  4DV0 L;  2GVB A;  1VQ5 A;  2ZTC A;  4YCW A;  4GS3 A;  1N34 Q;  3CCU A;  1ASY A;  4JI0 L;  3KFU A;  4OO1 G;  1Y1W H;  3CPF A;  1KRT A;  1VQF A;  3I7F A;  3KF6 B;  2N3S A;  3F1Z A;  4JCV E;  1SR3 A;  1CKM A;  4A3K H;  3FKI H;  5JEA J;  3NEL A;  5IYC H;  1A63 A;  1PYS B;  2HHH Q;  1AE2 A;  2R7F A;  1P16 A;  1VQB A;  2EXD A;  2KHI A;  3E9I A;  4QJF A;  1YJN A;  1K8G A;  3OYY A;  4GOP A;  2K75 A;  4B3S Q;  1BBW A;  1L1O A;  2WAQ E;  3UDI A;  3H0G G;  4IPH A;  4B3T L;  4HIO A;  4A3I H;  1VQL A;  2YU9 H;  3F8T A;  1L1O C;  4JI6 L;  1Q1B A;  3OTO Q;  1YHQ A;  2AKW B;  1NY4 A;  1TWF H;  1U5K A;  3J7A 5;  1Q7Y C;  4OWX B;  4BY1 H;  4DR1 L;  3CW2 C;  2R7Z H;  1GO3 E;  3EBE A;  4L5T A;  1E22 A;  4HJ8 A;  3OTO L;  4H02 A;  3G4S A;  3M3Y H;  2FXQ A;  1UEB A;  4LF5 L;  4PZ7 A;  5IP7 H;  3K80 C;  1HNZ Q;  1KD1 C;  1K83 H;  4XIG S;  1HNX L;  2OQK A;  3CP0 A;  1HZB A;  2Q2U A;  2PQA A;  1LM0 A;  4PZ6 A;  4A3D H;  4Y52 H;  4DK3 C;  3PSI A;  3CC2 A;  4BXX H;  3STB D;  1NE3 A;  4IOC A;  3T1H L;  3FP9 A;  1CUK A;  4YWL A;  1CSQ A;  5M3F G;  3RZD H;  1EOV A;  1GM5 A;  4JI5 Q;  5IYD G;  4LFB L;  3GTO H;  4FDB A;  3GTP H;  4P72 A;  1IBL L;  4LF7 Q;  2JE6 I;  4J15 A;  2RCN A;  1PVO A;  1E3P A;  3GO5 A;  1N9W A;  3J81 c;  3CD6 A;  1D7Q A;  3RR5 A;  4IJH A;  1Q12 A;  1HJP A;  3PUX A;  3S1M H;  4LUZ A;  4JOI A;  1L2F A;  1N36 L;  2OQ0 A;  2JK8 A;  3BU2 A;  3I4O A;  4RMF A;  1PA6 A;  4JOI C;  2VL6 A;  3HOU G;  5IWA Q;  2UXC L;  3ULJ A;  2ASB A;  4NXN L;  3W1G A;  1C0A A;  2E5L L;  4OWW B;  1BVS A;  3FKI G;  4LF4 Q;  4GKK L;  5IP9 H;  2D0O A;  1YVC A;  4DUZ Q;  4HIK A;  1VQJ A;  5M5Y H;  4B3T Q;  2PI2 E;  4NB3 A;  2KHJ A;  2MO0 A;  1KRS A;  1QZG A;  2JA5 G;  1JJC B;  2Y0S G;  3S1R H;  1XMO L;  4JI2 Q;  1K9M C;  3GTL H;  1X3G A;  3AFP A;  4GN3 B;  5E7N A;  4OON A;  4LFC L;  2JA6 H;  3STB C;  1PH6 A;  1KC8 C;  2MNA A;  3CPW A;  2OTL A;  4DNI A;  4AIM A;  1AH9 A;  5LMN Q;  4X65 L;  2QA4 A;  4A3L G;  3VDY A;  1SRU A;  2K52 A;  4KI0 A;  4R4Q A;  1YI2 A;  1HNX Q;  3MEF A;  2JA9 A;  1IYJ B;  1VQK A;  2VQF Q;  4A93 H;  1Z9F A;  2KEN A;  3I55 A;  3RLN A;  4O2D A;  4JBM A;  4JG2 A;  2N78 A;  3L7Z C;  5M3M G;  1KL9 A;  4JI4 Q;  4GKJ L;  4KLK A;  5IWA L;  1I6H H;  4YY3 Q;  1XMQ Q;  4NPS A;  3A5Z B;  1I50 H;  1UE6 A;  1VQ4 A;  3L0O A;  4MNO A;  1JE5 A;  3PO2 G;  3KJP A;  3A5U A;  3DM3 A;  2ID0 A;  4LNQ A;  2RF4 A;  1QVC A;  3PF4 A;  1T9H A;  2KCM A;  2IY5 B;  4BBS H;  2JA8 G;  4A3I G;  2BA1 A;  1W3S A;  2HQL A;  2YTX A;  5GAE C;  3H15 A;  5LMN L;  1IBL Q;  1ASZ A;  4LF7 L;  2Z6K C;  3W5O A;  3JC6 6;  4A3M G;  1YIJ A;  3GTQ H;  4KHP L;  4NXN Q;  2MO1 A;  2D0P A;  1VQM A;  4GNX A;  1OTC A;  1SE8 A;  1VQ7 A;  3K0X A;  1L0W A;  4JI0 Q;  3NEM A;  1YIT A;  3D0F A;  4A3F H;  4DV2 L;  4IFD I;  2UUC L;  2I5M X;  3HOX G;  3TS2 A;  2Z0S A;  4DV6 L;  3M4O H;  2VUM H;  1QUQ B;  1K8A C;  1JT8 A;  2Q2H A;  4GOP C;  1WOC A;  1N8R C;  2R92 H;  2NVT H;  1IZ6 A;  1WFQ A;  2K50 A;  3JAM i;  1TWA H;  4DAY B;  1EQR A;  4BY7 G;  1H95 A;  4C3J H;  4WJ3 M;  1N32 Q;  3GTJ H;  2ZM6 Q;  2UUA Q;  2JQO A;  1B8A A;  4X62 Q;  4LF9 L;  5LMU L;  3CAM A;  4BBR H;  1RL2 A;  4LF6 L;  4NXM Q;  3BZK A;  1CKN A;  4R4C A;  1UE1 A;  2HIX A;  1K73 C;  5DLQ E;  1VQ8 A;  3CCL A;  2JA6 G;  1XMQ L;  5FLM H;  1NMF A;  2YTY A;  3I2Z A;  1J6Q A;  2ALY B;  3RNU A;  2AHO B;  2L15 A;  3S15 H;  1OXS C;  1FJG Q;  1VQH A;  3PO2 H;  4X6A H;  1B70 B;  1S72 A;  4B3R L;  1P8L A;  2B29 A;  2WFW A;  4AYB G;  2E2I H;  3GTM H;  4GLV B;  2IT1 A;  2PNH A;  3S1N H;  2C35 B;  4IJL A;  4YWM A;  3RLF A;  3TQY A;  3PO3 H;  4DV3 Q;  1VQO A;  4BY1 G;  4HIM A;  1UE7 A;  3KLW A;  4R4O A;  4UP9 A;  3TEH B;  3UDG A;  3W1B A;  4JYA Q;  4JI8 L;  1EWI A;  4LWC A;  1A8V A;  2ZTE A;  1KHI A;  4X66 L;  3H3V I;  3HOW H;  4DR7 L;  5M5W H;  4DR6 Q;  3IRB A;  2OWO A;  1VQG A;  2R6G A;  4DV7 L;  2B63 H;  4IFD G;  4OO1 I;  3TRE A;  4JI2 L;  1KAW A;  3PIO A;  3U4Z A;  1XTD A;  4JI1 L;  3UE0 A;  1A0I A;  4TQU S;  4LUV A;  1PH4 A;  1IBK L;  2PI2 A;  4Y7N H;  3GTK H;  2EIF A;  1HNW Q;  4DR7 Q;  3HKZ G;  1PHJ A;  4BA1 I;  3GDE A;  4JYA L;  1XJV A;  1HR0 Q;  4DV3 L;  2F3I A;  2AMC B;  5GQO A;  4C3I H;  1Q1E A;  2Y0S E;  1TWH H;  1EFW A;  4EQ5 A;  3UDF A;  4QIW E;  1SMX A;  5HY6 A;  3JAM c;  2ZJP A;  1YJ9 A;  1X9N A;  4HJ9 A;  4DV6 Q;  2A8V A;  3AFQ A;  3Q8D A;  2UXD Q;  2E2J H;  5JJL A;  3CMA A;  3B6Y A;  3F2B A;  3AQQ A;  1XNQ Q;  4JC0 A;  4AQY L;  1XPU A;  4WJ4 A;  4P75 A;  3LGJ A;  1HR0 L;  3GTG H;  4BA2 I;  1HH2 P;  3ER0 A;  2WAQ G;  2QGQ A;  5C4X H;  2UUB L;  3H3V H;  1WYD A;  1XNR L;  2BH2 A;  2OTJ A;  2IX1 A;  3G6E A;  5JEA G;  2DGY A;  2UXD L;  4JI1 Q;  4POG A;  4JV5 L;  4PG3 A;  1OXV A;  3CCS A;  1PYB A;  4DUZ L;  4DR3 Q;  4IFD J;  3E9H A;  2R93 G;  3FHW A;  1BBU A;  2XGT A;  5C0X J;  5AJ3 Q;  4B3M Q;  1N33 L;  4R1J A;  4DUY L;  2K5V A;  5H1S E;  2UXC Q;  3A74 A;  3ERS X;  3CC4 A;  1PH9 A;  1Z47 A;  5C4J H;  2NZO A;  1WJJ A;  3NBH B;  3HOW G;  1FL0 A;  1PH7 A;  1SLJ A;  1PH5 A;  4DAM A;  4A3B G;  2R7D A;  3PUW A;  2CWP A;  4DV1 L;  4HJ7 A;  2D62 A;  4LF8 Q;  1VQN A;  1W2B A;  2UUC Q;  5JJI A;  1E1O A;  3PUZ A;  4LFA L;  4PZ8 A;  3RN2 A;  2RHQ B;  1FVI A;  5FLX c;  2QEX A;  3S14 H;  4C3H H;  4DPG A;  2LSS A;  4JI5 L;  1HZC A;  3ZJY C;  5JJK A;  5M5X H;  2A19 A;  3PF5 A;  4OWT B;  4L5S A;  4RG1 A;  3M4Q A;  2R7Z G;  2UXB Q;  4JI3 Q;  4A3L H;  1LYL A;  3WWV A;  1GVP A;  3KF6 A;  3CF5 A;  1AE3 A;  1EIF A;  1UE5 A;  1K0R A;  1PH2 A;  1IBK Q;  4LF6 Q;  1XMO Q;  1OXT A;  4B3S L;  2NN6 G;  3K8A A;  5C0X G;  3BZC A;  4X62 L;  1JB7 A;  4LF8 L;  4X64 Q;  4DV7 Q;  1Y1W G;  2ZM6 L;  2JA7 G;  1J5E L;  2KBN A;  1PV4 A;  2K14 A;  4R4I A;  1V9P A;  4DV4 L;  3RN5 A;  4A3J H;  3RZO H;  1JJ2 A;  1SN8 A;  3NEN A;  1VQP A;  5C4X G;  2B63 G;  4YHH Q;  4P74 A;  1O7I A;  1B7Y B;  3H0G H;  4DR3 L;  4B3R Q;  2Q2I A;  4MZ9 A;  4R4T A;  1VQE A;  4QY7 A;  2E2H H;  3MXN B;  3K7A H;  1XNR Q;  2YV5 A;  2PQA B;  3J81 i;  4A3E G;  3BJU A;  2YYZ A;  4JBK A;  3I4M H;  4DKA C;  4DR4 L;  1X55 A;  2VQE Q;  1VQC A;  1IBM Q;  1QUQ A;  3S24 A;  3U50 C;  1PH3 A;  4YCU A;  4B3M L;  3T1Y L;  4AQY Q;  3HOZ G;  4A3C G;  3CCM A;  3CXC A;  3D31 A;  3G71 A;  2VW9 A;  1IL2 A;  2B3G A;  4A3B H;  1FGU A;  3CME A;  3ULP A;  4UP8 A;  4DR2 L;  1E1T A;  1NJI C;  2UUA L;  1NTG A;  2RHS B;  4ME3 A;  2MFI A;  4XTC S;  2IHF A;  4A3G G;  3ULL A;  2E5L Q;  3KF8 B;  1VQA A;  3UE1 A;  5C44 G;  1QVF A;  4YY3 L;  1E24 A;  2IHE A;  3HKS A;  4AH6 A;  5FLM G;  1YEZ A;  3HOV G;  4BY7 H;  4MTN A;  3HFZ B;  3CCR A;  1HR0 W;  1CKN B;  1UWV A;  3K81 C;  5FJ8 G;  2K4K A;  1YJW A;  4IOA A;  4HID A;  1EIY B;  3DLL A;  1HZ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...