2NZOA

Crystal structure of a secretion chaperone csaa from bacillus subtilis in the space group p 32 2 1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
111
structure length
111
Chain Sequence
HMAVIDDFEKLDIRTGTIVKAEEFPEARVPAIKLVIDFGTEIGIKQSSAQITKRYKPEGLINKQVIAVVNFPPRRIAGFKSEVLVLGGIPGQGDVVLLQPDQPVPNGTKIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis of Bacillus subtilis CsaA.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Chaperone
molecule keywords Protein csaA
total genus 20
structure length 111
sequence length 111
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01588 tRNA_bind Putative tRNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2nzoA00
2I5MX 1G6PA 5AJ3Q 4A3BH 1AH9A 4QIWE 1MKHA 4BA1I 4A3DG 1PFSA 1MJCA 2JA8G 4IJLA 1J6QA 3FKIH 1SMXA 1ASYA 4HIOA 1CSPA 5GAGC 4OWTB 1JJGA 2K5HA 1X6OA 1I50H 2AWNA 5C4XG 3EIVA 2I5LX 3JC66 4DK6C 4POFA 3J80c 2ZM6L 4DR3Q 1KC8C 1TWHH 4B3TL 2IX1A 4DV0L 2EQSA 2N3SA 4QY7A 1TWGH 2D0OA 5C3EG 1CUKA 2Q2TA 1S40A 4EX5A 1N32Q 4DV4L 1E7ZA 1VQEA 1EYGA 1VQFA 1YBYA 4JG2A 1IBMQ 4DR4L 3TS2A 2UUAQ 1Y1VH 1VQPA 2JQOA 3PUYA 4OWXB 4B3RQ 1IXRA 4A3IG 2ZJQA 3UDGA 5M5WH 4YCVA 4JI2L 1D8LA 4RMFA 1E1TA 4DV5Q 3GD7A 3PGZA 4UP8A 2HIXA 4O2DA 2K5NA 1K0RA 1YVCA 1L1OC 4LUOA 1R9TH 1JJ2A 4JI7L 4P75A 3FHWA 2IX0A 4LF7Q 5M3FG 3S1MH 4X62L 4IOAA 2XGTA 1L0WA 3NELA 5JJLA 2GVBA 2JA6H 5JEAG 5FLMH 3M4OH 1X3EA 3CAMA 2UXDL 4H02A 3RLOA 4JI6Q 4A3FG 4OO1I 3U4ZA 4DUZQ 1A63A 2Z6KC 4JYAQ 4GLAC 3J81c 2UXCL 1UE1A 4B3SL 4DV0Q 4LFAQ 1EFWA 3HOVH 3GTOH 2F4VL 2R93G 2QA4A 4K0KQ 2CFMA 1UE6A 1N9WA 2R6GA 3F2DA 2E2HH 2MQHA 2NN6I 2E5LQ 1E24A 4DR3L 4GOPB 3H3VI 1GKHA 1LM0A 2NZHA 3S1RH 3JAMi 1HZCA 1KRSA 3TEHB 4JI1L 1WCMH 3F2BA 1VQ4A 3NEMA 3T1HL 3PUWA 3UDIA 5IWAL 3F2CA 1WOCA 4JCVE 2CKZB 1S3OA 5IP9H 2VQEQ 2R7DA 4C3HH 4DAYB 1QVCA 2A19A 3AFQA 5IYBG 4BY7G 1JT8A 3HOVG 1DGSA 4GOPC 1VQMA 1KAWA 3FKIG 4DUYL 1I6HH 3L2PA 1N34L 2ZTEA 1NTGA 4PG3A 2JJQA 3J81j 4GLXA 2CQOA 1XTDA 2R92G 4JOIC 4P73A 4X65Q 1XJVA 4B3ML 3HOXH 4DV7L 3S14H 4UPAA 2D0PA 4GKKQ 4X65L 4A3GG 4DR5Q 1CKNB 1Q1BA 1M1KC 1XPOA 1X56A 2E8GA 4YHHL 1OXVA 3PIPA 2F52A 4TVAB 4X62Q 1GVPA 1SE8A 2H5XA 3D31A 3CCJA 3T1YQ 1GO3E 4LF7L 3S16H 1WCMG 4P71A 1PH8A 3H0GH 4GNXA 1PHJA 1VCIA 4JI7Q 1PH4A 3HOYH 1N36L 1K73C 3K7UC 1EWIA 1SN8A 3UDFA 1VQOA 3PUXA 3CCEA 1QUQA 3ULLA 1SROA 2RCNA 1X55A 5IYCG 3U58A 4IPHA 2KHIA 4JI8L 5K36G 4R4CA 4FDBA 2NN6G 3ER0A 2IHFA 4IJHA 4JI1Q 4DK3C 2ES2A 1HR0Q 2HT1A 3H0GG 4GNXB 5J3BA 4A3CH 3PF5A 2BA1A 4PZ8A 4LNQA 4C3JH 2PQAA 3L7ZC 3CF5A 1EIYB 3KJPA 1XNRQ 1OXXK 5EAYA 2AMCB 4KI0A 4C3IH 1PH7A 4A3GH 1LTLA 4WJ3M 1B70B 2BH2A 2OTJA 2ZJPA 3SGIA 4DR2Q 2PQAB 1HR0L 2Q2UA 1TWFH 2WAQE 1XNQQ 2WB1E 2ZTCA 5C0XJ 2JA5G 1A62A 1B8AA 4XIGS 4DKAC 2VW9A 1J5EL 4NXNL 4HIDA 1X3FA 2YV5A 1WYDA 1M90C 1K8AC 2KCMA 2B29A 1YZ6A 1MIUA 2HIVA 4BY7H 4OO1G 1KQSA 2CWPA 3STBD 4HJAA 2UUAL 4LF5Q 4JBWA 3M3YH 1NE3A 3K0XA 2GVAA 3UDXA 1X54A 4DPGA 1C7YA 5JJKA 3M7NA 1WJJA 1K83H 3KOJA 4DR5L 4O0AA 5JJIA 2ZM6Q 5M3FH 3GTKH 1OXUA 3I7FA 3W1BA 4QGUA 3GTLH 4A3LG 2MNAA 1IBKL 2KCTA 1GD7A 4A93H 1JE5A 2WAQG 5H1SE 1VQNA 4LF5L 3K8AA 5C4JH 4HIKA 3E9HA 1YNXA 4A3FH 3M4PA 1PH6A 1Q1EA 2Z0SA 5IWAQ 2BH8A 3CCLA 1N33Q 2OWOA 3HOUG 2MO0A 1P16A 4BXXH 1WFQA 2JK8A 2ID0A 5GADC 3S24A 2CCZA 4BY1H 3Q8DA 2ZJRA 3B6YA 4AH6A 3CCQA 4R4QA 3GTJH 4DV2Q 1XMQQ 1OTCA 5C44H 2WB1G 4YWKA 4GN4B 1VQ9A 1VQLA 3G71A 1Q46A 4JV5L 4BA2I 1HNWL 1QVFA 4DV6L 3A0JA 1QZGA 3CCMA 1K9MC 3VDYA 4J15A 5IP9G 2EIFA 2KBNA 3S15H 4R4OA 3BZCA 1BBWA 1E3PA 1VQBA 3CQZH 4X64Q 4C2MH 4HJ5A 1HZBA 2VY3A 3HOZH 4LFAL 1BBUA 1NMFA 1VQAA 4BY1G 5IE8A 5LMNW 3ICEA 1SRUA 4X66Q 5LMNL 4BBSH 5M3MG 3DLLA 4LF8Q 4A76A 3A5ZB 3HOWH 1LYLA 3RLNA 2YTYA 1SLJA 2UXBQ 4DR6L 3CCRA 3I4NH 4TQUS 1EOVA 1AE3A 1TWCH 3KFUA 2HQLA 2R93H 3M9BA 3MEFA 4KHZA 2NVXH 1EQRA 4DV5L 1HNXL 1X9NA 1U0LA 2VZAA 5M5XH 4L5RC 3CCSA 3PIOA 3T1HQ 1OXTA 2YTVA 2Z6KA 3KDFB 5GAHC 4R1JA 3RZDH 1J5EQ 2IY5B 1Q82C 4MTNA 4JI2Q 4A3EH 2JA6G 1G291 2YYZA 1A8VA 1YIJA 2VUMH 4DR7Q 4DR2L 1VQ6A 4NB3A 4DR1L 4AQYQ 5C0XG 1O7IA 3HFZB 4JC0A 4QJFA 4X66L 5LMNQ 2AWOA 3KF6A 4R4IA 3BU2A 3AEVA 3AYHB 3I2ZA 2Q2HA 2E2IH 1T9HA 1Z9FA 3K80C 1QZHA 2N78A 2Y0SE 1YHQA 3PUZA 2VQFQ 1E22A 1VQJA 4ME3A 1PH3A 4DV6Q 4P74A 2N8NA 5IYDH 2KENA 3CC2A 3J80i 5AJ3L 2XTIA 4A3KG 4NPSA 1SFOH 3KF6B 4YY3Q 1RIPA 2VNUD 2FXQA 3T1YL 3HOZG 4IFDJ 4QQBX 1KIXA 1PYBA 5ELOA 1G51A 4LF4L 1KHIA 3D0FA 3F1ZA 1N36Q 5HGQA 2JE6I 2K5VA 5FLXc 3TRZA 4MZ9A 1BKBA 3MXNB 4DR6Q 1VQIA 4IO9A 1VQ5A 1N33L 1VQCA 4JBMA 1YHBA 4DV7Q 3I4MG 4PZ7A 2LXJA 4B3MQ 4B3RL 3S1QH 1W3SA 4K0KL 3UE0A 5IT9c 2ATWA 3HKSA 5LMUL 4B3SQ 3CXCA 4GKKL 1VQ7A 4A3DH 4JYAL 2UXCQ 3PO3G 1XPUA 4Y52H 2K50A 4GN5A 3ERSX 1W2BA 3RN5A 1N32L 3TREA 1PH5A 1A0IA 4A3LH 1EUJA 1Q12A 5IYCH 1KXLA 3CPWA 3J7A5 1UE5A 3UE1A 2N49A 1V43A 2R7FA 4YCWA 3TS0A 3S2HH 2VQEL 1YJNA 1AE2A 2B63G 3RR5A 4AIMA 1OXSC 3U4VA 1PH9A 1VQKA 2YU9H 1JB7A 3F8TA 4GN3B 5FJ8H 1HNZQ 2A8VA 3PO2G 2VL6A 1CKOA 2ALYB 1XNQL 3DM3A 1C9OA 4YCUA 3G4SA 4A93G 3EN2A 4YWMA 1WI5A 3WWVA 1VQ8A 4DAMA 2OQ0A 3AFPA 2PI2E 4YY3L 4JBKA 2OCEA 5C0XI 4JI4Q 3FP9A 4LWCA 1PV4A 5C44G 5FLMG 3JAMc 3OTOL 2UU9L 2JA5H 3ZJYC 2VUMG 1YITA 1XNRL 3PO2H 3PO3H 3OW2A 2E5LL 4POGA 4A3KH 3TQYA 2AHOB 2WP8J 1L2FA 1CKMA 1YI2A 4GLVB 2Y0SG 1KRTA 1I5FA 3CCUA 1L1OB 4BXXG 1CSQA 1PYSB 2F4VQ 1Q7YC 3GDEA 4LF9L 3STBC 1NY4A 1IBLQ 1FJGQ 1VQGA 4DUZL 3CD6A 1FVIA 1HJPA 2JEBI 4AYBE 4AQYL 4A3JG 3HOWG 1TXYA 2CWAA 2GN5A 5BR8Q 1I94L 4BBRG 3E0EA 4IPGA 2B63H 4Y7NH 2UXDQ 2PI2A 1KD1C 2F3IA 1NBWA 1C0AA 1TWAH 1PVOA 2BA0A 2B3GA 3EBEA 5JEAJ 1XMOQ 2KHJA 3W5OA 4HJ7A 1VQHA 2UUBQ 3A74A 1HZAA 3RN2A 2LSSA 3H3VH 2RF4A 1QVGA 1IBLL 1FJGL 4EQ5A 2QEXA 3I4MH 1P8LA 2K52A 3K81C 4APVA 4IFDI 4DV4Q 2PNHA 2IT1A 3M85A 2AKWB 2NZOA 3PF4A 5GROA 2K14A 4L5TA 1YJ9A 4B3TQ 2V1CC 4A3MG 4A3BG 4X64L 1IL2A 4JBJA 5DLQE 3BZKA 4LW1A 4UY8C 2DGYA 3AQQA 1HNWQ 1ASZA 1N8RC 3HOXG 4OX9Q 1FL0A 3CC4A 2JEAI 1Y14B 2ZTDA 1X3GA 5IYDG 1HZ9A 4BBRH 4OONA 4JI5Q 4JV5Q 3CW2C 4LF6Q 1N34Q 5FJ8G 3CPFA 3CMEA 1EQQA 2LXKA 4JI4L 4R4TA 1NMGA 5GAEC 3CMAA 1YJWA 1BVSA 1Y1WG 1HR0W 3GTGH 1NJIC 4X6AH 2MFIA 1V9PA 2JA8H 5GQOA 5IP7H 2HHHL 4PZ6A 2C35B 1HNZL 4OX9L 3BJUA 3GTQH 3G6EA 3PUVA 4IPCA 4YWLA 1B7YB 2PMZE 3PCOB 4YHHQ 1H95A 3RZOH 2JA7G 5LMUQ 2JA9A 3RLFA 1PA6A 1RL2A 4ALPA 2EXDA 4JI6L 1K3RA 4IOCA 1YEZA 3RNUA 1Y1WH 3I4OA 1IBKQ 4DV1Q 5IYBH 1Q8KA 1Q86C 3NENA 2I5HA 3GTMH 1D7QA 2VS1A 3GTPH 2L15A 4LF4Q 2UUCL 3PV0A 4A3IH 3W1GA 1QUQB 1PH1A 3IRBA 4WJ4A 1JJCB 4DNIA 2UUBL 4HIMA 2YTXA 1UE7A 1FGUA 4RG1A 1KL9A 1GM5A 4OWWB 4MNOA 4GKJL 4JI3Q 2HHHQ 3J7ZC 4NXNQ 2R92H 4A3MH 4GNXC 4KHPL 5M5YH 1Z47A 3CCVA 5HY6A 2RHQB 4KHPQ 2QGQA 5IY0A 3CC7A 2NVYH 2UXBL 4IFDG 1I94Q 1MJEA 1CKNA 5C4XH 2VQFL 4LF6L 4KLKA 2UUCQ 4DR4Q 3CP0A 4NXMQ 3S2DH 4JI0L 3S1NH 2JA7H 3L0OA 1HH2P 3I4NG 1L1OA 1S72A 5E7NA 2K75A 3HKZG 4UP9A 3S17H 3KYHC 1IZ6A 2IHEA 2Q2IA 3KLWA 3KDFA 1E1OA 1U5KA 5M3MH 2OQKA 3KF8B 2R7ZH 4DR1Q 4LUZA 3K7AH 4JI0Q 1VQDA 1HNXQ 4A3JH 4DR7L 4NXML 1K8GA 2E2JH 1UEBA 3OTOQ 2UU9Q 3J81i 4HJ9A 4P72A 2DUDA 4JI8Q 3I56A 2ASBA 3U50C 3H15A 3LGJA 1XMOL 4A3CG 3NBHB 1SR3A 4JI5L 3PSIA 1IYJB 4JOIA 1EIFA 4XTCS 2WFWA 4L5QA 4OXPA 3OYYA 3ULPA 4GKJQ 4HJ8A 4JI3L 5IP7G 2OTLA 2K4KA 4A3EG 4LFBL 4DV1L 2D62A 5BR8L 4LF8L 1Q81C 4PMWA 4LFCL 3HKZE 3I55A 2A1AA 2RHSB 4LFCQ 4QL5A 2I0QA 1LUZA 1IBML 4L5SA 2NVQH 4LF9Q 4IPDA 4DV3Q 1PH2A 3HOYG 1I3QH 1JMCA 1X65A 4LUVA 1YHAA 5ELNA 3KJOA 3A5UA 4DV3L 4GOPA 2NVTH 3ULJA 1VS0A 3E9IA 3G48A 4UP7A 1Y1VG 1XMQL 3GO5A 4GS3A 2R7ZG 4AYBG 1UWVA 4DV2L 4A4IA 1XPRA 2MO1A 1V1QA 4A75A 4BBSG 5C3EH 4LFBQ 4DUYQ 3HOUH 3M4QA
chains in the Genus database with same CATH superfamily
2I46A 3KLSX 1G6PA 1RKNA 4A3DG 1PZKD 1MJCA 1SMXA 1ASYA 3F2UA 3MA2B 2K5HA 5FO8B 1X6OA 1F2YA 5C4XG 4PQXA 2I5LX 2NWGA 4DK6C 1S4ZA 1B1ZA 5ELFA 4DR3Q 4DV0L 5KIXA 2Q2TA 1S40A 4EX5A 4B9WA 1XYIA 4BS9A 1E7ZA 3IKJA 4NMZA 1HA5A 1VQPA 2JQOA 4OWXB 4B3RQ 1QWYA 1SYEA 2R93B 4GZYC 5M5WH 2NVXB 4JI2L 1E1TA 3GD7A 3PGZA 4RH6A 4LUOA 1L1OC 3FHWA 2IX0A 1NCVA 4LF7Q 4X62L 4R8NA 3GTJB 1TWAB 3HZXA 2PW5A 3NELA 3SE0A 5FLMH 1QG7A 2UXDL 3NQTA 3W2DA 3RZOB 4JYAQ 1LACA 2UXCL 3S2DB 5ELBA 3ERQA 4B3SL 3HOVH 3SK8A 2F4VL 4ZK9B 3BVMA 2D5DA 5C4JB 1UE6A 1E2VA 1N9WA 2R6GA 3F2DA 2MQHA 4CJ2C 2E5LQ 2LFNA 1GKHA 3S1RH 1SMYC 2SDFA 3JAMi 1HZCA 1KRSA 1MHWC 4A3MB 1A3UA 1WCMH 5EKKA 3UDIA 2K05A 5IWAL 3F2CA 3VYUA 1WOCA 4JCVE 1S3OA 5IP9H 4C3HH 1QVCA 3AFQA 1JT8A 3HOVG 1DGSA 2EPBA 1KAWA 5FKAC 3S1NB 2ZTEA 2JA8B 4PG3A 1G8ZD 4GLXA 1RD9D 1XTDA 1XJVA 4B3ML 4BBSB 4DV7L 2F0QA 3MXPA 4UPAA 3NWSA 2D0PA 3HGBA 3HOWB 1DM0B 5FO7B 1SYFA 4X62Q 4LF7L 3D31A 4C3JG 1GO3E 4P71A 1PH8A 2JSOA 1VQOA 3CCEA 1QUQA 3QOJA 2ZXOA 3U58A 2KHIA 1EY4A 1Q3LA 4HTHA 2EYFA 5CMDA 2KVMA 4J8QA 3H0GG 4GNXB 5J3BA 2BA1A 4C3JH 3L7ZC 1EIYB 1BR9A 4U673 1XNRQ 1NSNS 1A6XA 5EAYA 3TSSA 1PRTF 5E1FA 3TN2A 1SE2A 4C3IH 5AFWA 1R4PB 1LT6D 3WOFA 1SNPA 4WJ3M 1GUWA 3OOCA 1SFOB 3SGIA 1JOOA 2L1BA 4F87A 4XIGS 1S5CD 4NXNL 4HIDA 1M90C 4BY7H 4OO1G 1EWCA 2RKSA 3STBD 3I91A 4HJAA 1B9MA 4X3UA 4JBWA 3KBGA 3M3YH 3DUZA 1ZYRC 2QDLA 1EL0A 3GTKH 4WORA 3W1BA 4A3LG 1RF2D 1KDBA 1JORA 3ITPA 2WAQG 3C1EA 3GTOB 4LF5L 5I4DA 3K8AA 5C4JH 1EZ6A 3A7LA 1KTKA 3E9HA 1VF5C 4FF1A 1Q1EA 2BH8A 1N33Q 4KMUC 2CH4W 1R9TB 2OWOA 3HOUG 5GADC 2ID0A 1UUPA 2CCZA 4BY1H 2Z9HA 4AH6A 3CCQA 2XN9C 4KY6A 2CHBD 1BQQT 2B2TC 1SSOA 2B2UA 3KBXA 3T16A 3VYTA 1VQLA 3D3RA 2H1EA 3DWAA 4RKBA 1KABA 2G5DA 1QVFA 4RA8A 4RWSC 4ZAIA 4DV6L 3S1QB 3NQIA 5ELCA 4L8JA 3VDYA 4J15A 1EQTA 2EIFA 2F4IA 2KBNA 1BBWA 4X64Q 4PV1C 1HZBA 1U4LA 5C3XA 4LFAL 1BBUA 1NMFA 2PYKA 4BY1G 5LMNW 1SRUA 4BBSH 4MN3A 3DLLA 4XQQA 4LF8Q 4A76A 1PTOD 1JE4A 1NR4A 1LYLA 3RLNA 4BBRB 2YTYA 3HOWH 1E2WA 2F0GA 2A6ED 4QB4A 3M9BA 4KHZA 1U0LA 3EQLC 3I4LA 5CV8A 3PIOA 3T1HQ 2YTVA 1ENAA 2Z6KA 3RZDH 2K03A 2MPMA 2NN6H 3EA6A 4A3EH 1EY6A 2JA6G 2VUMH 1SNQA 4NB3A 4X66L 5LMNQ 3GTKB 3AYHB 2E2IH 2F0SA 1A2TA 1I4PA 1GUOA 4ME3A 2EYJA 1I4HA 4OIJA 3TP8A 4LK1C 3T4AC 2Y0SB 3J80i 1DOKA 3T56B 4WRDA 4A3KG 5M5YB 3K5NA 5C44B 3HKZB 4LF4L 1L0XB 4MZ9A 1BKBA 4DR6Q 1ESRA 3OIPA 4IO9A 1VQCA 1VQ5A 1YHBA 1H9RA 3VR3A 1N33L 2LXJA 4M1UB 4K0KL 3S1QH 1I3QB 3UE0A 3HKSA 3K59A 3ERSX 1N32L 3I3CA 2A68D 1KXLA 3OWFA 3J7A5 1UE5A 3UE1A 5C6AA 2J7ZA 1V43A 2DN8A 2R7FA 5LL6S 3S2HH 1YJNA 1AE2A 3K7AB 2KA7A 1VQKA 3PO2G 3I70A 4GN3B 5FJ8H 2ALYB 3VR6A 3ND8A 3DM3A 3G4SA 3C2PA 5ELEA 3AU7A 5C0XI 5IGBA 3D8GA 3FP9A 4K6LA 1TWHB 2JA7B 1S5BD 3JAMc 3ZJYC 1YITA 3PO3H 2E5LL 4A3KH 3TQYA 1PZID 2E74C 3NXWA 4BXXG 4KN7C 2RQXA 1IBLQ 1HJPA 1GUGA 2JEBI 2KOLA 4AQYL 4A3JG 2CWAA 4C3IB 4IPGA 5IGDA 2F3IA 5EPKA 1UNSA 4ZUIA 1PVOA 1NAPA 1HZAA 1SYBA 3RD4A 5IT9E 1FJGL 2QEXA 4BY7B 1S5ED 1D1KA 4IFDI 4DV4Q 3PF4A 1IW7D 4I7AA 4B3TQ 2HDMA 2V1CC 4FNFA 3DWQA 4K6DA 2EJFC 1ET9A 4JBJA 5KGUA 4LW1A 3BZKA 4UY8C 3AQQA 1ASZA 3NPPA 4HCSA 5M3MB 1N8RC 5K5PA 4OX9Q 2HDLA 2ZTDA 5IYDG 1E0BA 5JAVA 1XX8A 3CW2C 1Y8OB 4LF6Q 1YNJC 1DJRD 3CMEA 4G7OC 4R4TA 2B2TA 1YJWA 1BVSA 3GTGH 2B8GA 2CW0C 4X3TA 4X6AH 2ENBA 5IP7H 4PZ6A 3OPOA 2C35B 4H13C 1SE3A 1HNZL 5G3LF 2PMZE 1F2MA 2A6HD 1TS3A 2JA7G 1ZKOA 1KNAA 1PA6A 4ALPA 3RNUA 1WTRA 1IBKQ 4DV1Q 1JC7A 5IYBH 4K5WA 1D7QA 1SBBB 3W1GA 1PH1A 1JJCB 1UAPA 4C2MB 2CH4A 1H9MA 2QGQA 5IY0A 3CC7A 2UXBL 2E76C 1M8AA 1EEFD 2VQFL 1UEAB 2K6AA 4KLKA 1BCPD 3S2DH 1I50B 2RSOA 5JVH3 2JA7H 4IUVA 3I4NG 4K2KA 2KEDA 3HKZG 4XT1B 3PO3B 1HXYD 2Q2IA 5KNCA 4CKEA 4AYBB 3S14B 3KF8B 1TWFB 2R7ZH 2QF7A 1WCMB 4LUZA 2D9UA 5T1IA 3SK6A 4JI0Q 1VQDA 4CDCC 4DR7L 1K8GA 5DNFA 4C3HB 4DFAA 1LTAD 4FVMA 1CHPD 4O1NA 3PSIA 1EIFA 4GKJQ 4HJ8A 1PTOC 1LT3D 2JA6B 4DV1L 2C5CA 3A54A 2NVQH 4IPDA 4LUVA 4GOPA 3SDZA 1VS0A 3E9IA 3G48A 1Y1VG 1GUSA 1UWVA 5IOCA 4J6HA 1V1QA 1W6JA 2PCFB 2TMPA 1AH9A 1GHJA 4QIWE 4BA1I 1EY0A 1F9SA 3L9AX 3O13A 1J6QA 3FKIH 1K0SA 3ZYYX 2F0MA 4HIOA 5GAGC 2M2LA 4FXKC 2AWNA 1H9JA 4POFA 1BDOA 1TWHH 4B3TL 2EQSA 3NTKA 1CA6A 4HR7B 2N3SA 3A8JE 3LNNA 1B50A 5C3EG 4HSVA 1N32Q 2HQEA 3SK4A 5A2QE 1DCZA 2CW0D 3TS2A 1R4QB 2UUAQ 1Y1VH 1F77A 2L12A 1IXRA 2F0EA 1SNDA 5IGFA 2L5TA 1D8LA 5FLXE 4RMFA 4A3IB 1WTXA 4UP8A 2HIXA 3KLSA 1K0RA 1B9NA 4OHJA 4P75A 2KEEA 4H7BA 5M3FG 1J9OA 2XGTA 2PW7A 2Z8LA 1PFNA 2JA6H 5JEAG 2X6GA 1FD7D 3RLOA 4A3FG 3BZDB 3U4ZA 5EBCA 4EGVA 2Z6KC 4DUZQ 4OO1I 4GLAC 1A63A 3A8IE 2A6EC 3GTOH 4K0KQ 5DM73 2F0PA 2E2HH 3C46A 1LABA 4GOPB 1SXTA 3TEHB 2XWJB 5J39A 3T1HL 3TBIB 2MJ8A 4LAAA 2QKIC 4WJWA 5IYBG 4DXGA 1VQMA 3FKIG 1D2BA 3CRLC 1I6HH 1BCPB 2F0JA 3SR1A 5KNDA 3L2PA 2PNRC 1T5EA 2JJQA 4RFBA 1ILQA 3J81j 2CQOA 3DEPA 4P73A 1A2UA 5CR3A 2NVQB 1Y1VB 3EFXD 1M1KC 1X56A 4TVAB 1JICA 1O7ZA 4XDXA 5C4HA 4NW2A 4GNXA 1PHJA 4JI7Q 2PZTA 1ML0D 3PUXA 1X55A 5IYCG 1CM9A 2AUKA 2L55A 2A68C 4JI8L 1VMCA 5K36G 1G91A 4HAEA 2NZ1D 4IJHA 4JI1Q 1GUTA 2RDHA 1SDFA 2ES2A 1HR0Q 2E2IB 2HT1A 4PMBA 3R93A 4A3CH 5ELDA 3HOVB 2J4XA 1OXXK 4DA2A 4A3GH 2BH2A 2ZJPA 2PQAB 3EJIA 2IW3A 2ZTCA 5C0XJ 1WD1A 4C1NK 1B8AA 2VW9A 3I4NB 1X3FA 2KQ3A 1TS5A 1K8AC 4XYQA 1YZ6A 1MIUA 2HIVA 5M5XB 4PMCA 3K0XA 2Z4IA 2NUCA 3K6OA 4DPGA 5FOBB 1WJJA 1K83H 2ZM6Q 4HSPA 2WIIB 3I7FA 4QGUA 2MNAA 1IBKL 3S2HB 3BDLA 4UDUC 3V05A 3GP7A 1TIID 2A6HC 5JVG3 4Q0FA 5HURA 4A3FH 4KKTA 1PH6A 4N8FA 4CGYB 1P16A 1GXDC 4ZUJA 1WFQA 1B53A 3Q8DA 2ZJRA 3B6YA 3GTJH 1XMQQ 3I73A 4MIUA 4ZKBB 1Y69U 2AQ2B 3A0JA 2RSNA 3GTMB 2R3ZA 4HCEA 3HOZH 2FMCA 1VQAA 3ICEA 4G4KA 3MXUA 5M3MG 1F9RA 4OELB 1STNA 4IQZA 1SLJA 2NVYB 2UXBQ 3W3AA 3CCRA 4Q5VA 2R93H 1AE3A 2HQLA 3MEFA 2NVXH 4ZQ3A 3TMEA 5IIFA 4L5RC 3HOYB 2AUJD 1OXTA 4BWGB 1J5EQ 5F2DA 1Q82C 4MTNA 4JI2Q 4F7XA 1YIJA 4DR1L 4AQYQ 2EJMA 5C0XG 1O7IA 2AWOA 3BU2A 1VDZA 2Q2HA 1Z9FA 2N78A 4C3IG 1EEID 1YHQA 4NP5A 4A3JB 4EVOA 2VQFQ 4CDDC 1PH3A 1O7YA 4X3KA 3GTGB 2XTIA 1B4OA 3T1YL 1WTHA 3HOZG 5ELOA 1G51A 1KHIA 2OT2A 1N36Q 4E6IA 1QILA 1G6ZA 1VQIA 4JBMA 4DV7Q 3I4MG 3R3OA 1BNZA 1B2TA 3J80L 3CXCA 4GKKL 1VQ7A 4G7ZC 4A3DH 4JYAL 2UXCQ 5FO9B 2K50A 2MGSA 4GN5A 1QB5D 1GHKA 2JN4A 3HOZB 3OHXC 1EQVA 1A0IA 1EYCA 2K32A 1BBXC 3KK7A 5IYCH 3CPWA 2EY6A 2VQEL 3RR5A 4AIMA 4CDFC 2YU9H 1HFNA 3F8TA 1HNZQ 1G2SA 2VL6A 1XNQL 1SYDA 2A5HA 1V8QA 1C9OA 4YCUA 3MVVA 3NHHA 3EN2A 4XXEA 1WI5A 2OQ0A 3AFPA 2PI2E 2OCEA 3RZDB 3MC0B 4UHVA 2Q8IB 5C44G 1EU4A 2UU9L 1DOMA 2I07B 3H09A 4POGA 3T51B 1H9SA 2J0TD 1YI2A 5KRUA 2Y0SG 1KRTA 3J81L 3CCUA 1PYSB 1RHPA 1Q7YC 1TKWB 1LTID 2G9DA 3STBC 1VQGA 4DUZL 1FVIA 5BR8Q 1CFMA 1JCKB 1I94L 3RUZA 3E0EA 3VR4A 5D14A 2UXDQ 2PI2A 2L0CA 4XQNA 5JEAJ 1XMOQ 3L3OC 2JXMB 2KHJA 2BOSA 3RN2A 1TWCB 3H3VH 1IBLL 5JPMC 4EQ5A 4K2LA 2K52A 4APVA 1NR2A 3A7AB 1JWSD 2PNHA 2IT1A 2R61A 2AKWB 3M85A 4ILWA 2NZOA 3Q23A 1JR0D 5M9OA 3P7JA 4L5TA 5GROA 1CHQD 2F0IA 4JK1C 4A3BG 4X64L 1HNWQ 2VB3X 5DLQE 2DGYA 1TY2A 1PZJD 3CHBD 1Y14B 4DAVA 1STEA 5E3FA 3NWTA 2A69C 3V96A 4OONA 2SNMA 4JI5Q 4JV5Q 4JVZA 1N34Q 5FJ8G 1EQQA 2LXKA 2DY7A 2ZXRA 3D4DA 3NE5B 1PRTB 1QCBD 2IJ0A 4OX9L 4IPCA 4YWLA 2VUMB 3PCOB 5KNBA 1XXGA 4YHHQ 3M4OB 3RZOH 3CRKC 5LMUQ 3A56A 4JI6L 2EXDA 2F0FA 4RGTA 4TRDA 1YEZA 3I4OA 1A15A 3GTMH 1MSGA 2L15A 2WAQB 2UUCL 3PV0A 4A3IH 4LF4Q 3S16B 1F2LA 1MSHA 4DNIA 2YTXA 2OXPA 4OL7A 2SNSA 1GM5A 4GKJL 3S1RB 4F88A 4JI3Q 2HHHQ 4KHPL 4A3MH 1Z47A 1DZ1A 5HY6A 2HD3A 2L9HA 2RHQB 4IALA 1KLGD 4UAIA 1ESFA 3GQBA 1Q90A 3MTSA 4DK1A 1C48A 3HEJA 1CKNA 2EY1A 4DR4Q 1LT4D 3BS1A 1L1OA 4ZLTF 2XRQD 2F0UA 1HHVA 3KYHC 4KHVA 5DEHA 3NBHA 5M3MH 3E6ZX 2ICIA 2O4XA 1EYAA 1DOLA 1STAA 4HMJA 1UEBA 1TY0A 2UU9Q 1Q8IA 3NUCA 5G3LD 1ZXTA 2DUDA 3H0GB 1ET6A 1X3PA 2K5WA 3H15A 1XMOL 1V1PB 2PZUA 2EYHA 3NP8A 4XTCS 3KF8A 2WFWA 2E2DC 5I2XA 1B3QA 3DHQA 1TU2B 4FXDA 3IL8A 2PMZB 5BR8L 2ZXPA 1NUCA 4PMWA 4ID6A 4CKBA 4LFCL 3OIQA 1RTNA 4NDXA 3I55A 2HCIA 5CV4A 1IBML 4DXFA 1I3QH 4C3JB 1JMCA 1YHAA 5ELNA 1SYCA 3DMUA 3KJOA 1LO5D 4RHSA 4DV3L 3ULJA 1EY7A 1XPRA 4FXGC 5EPJA 4N9PA 2K5DA 4BBSG 5AJ3Q 4A3BH 4KV6A 1BF4A 1F9PA 4KJOA 1K28A 1PFSA 1RDPD 3H6MA 2L4NA 4IJLA 2JA8G 2O5JC 2P5ZX 4ZKCB 1JJGA 1I50H 3EIVA 1SYGA 3JC66 3D6WA 3MEHA 4RCOA 4QY7A 1TWGH 2D0OA 1CUKA 4DNTB 3ND9A 2QEJC 5M3FB 1FNVA 1VQEA 1EYGA 1VQFA 1YBYA 4OO1H 3PUYA 4IURA 4Z9CB 2B2WA 4A3IG 4YCVA 4DV5Q 2A73B 2Z4HA 2EJGC 2K5NA 1YVCA 4QUFA 2DJFC 1FR3A 1U4RA 1EY8A 2M9VA 4IOAA 2AQ1B 1PRTD 4LJZC 5JJLA 3CAMA 1JB3A 3N52A 4H02A 5IGGA 1DONA 1UE1A 4K8JA 1WTVA 2R93G 2QA4A 2CFMA 2NB0A 3JAME 1PXUA 2NN6I 5KYIA 1E24A 4DR3L 3H3VI 1QE6A 1V1PA 1PYWD 5DAUA 2XSCA 4A3BB 4K14A 3F2BA 1IYUA 2FHTA 3NEMA 3PUWA 2CKZB 1DYQA 4L6TB 2VQEQ 4KY7A 1ILPA 2A19A 3EVQA 4WFN3 2F03A 5FK9C 1YNND 3K5MA 2EZVA 1SMYD 1U4PA 4JOIC 1FGBD 4KTAA 3Q6SA 1ENCA 2EYMA 4DR5Q 4MTKA 1BCPC 1CKNB 1M4VA 5NUCA 1Q1BA 4C3HG 2E8GA 1CI3M 1OXVA 3PIPA 1GVPA 1YNNC 2H5XA 1JWMD 3CCJA 3T1YQ 3S16H 1PMRA 1WCMG 4I7ZC 1F2ZA 1VCIA 5EJWA 3HOYH 1N36L 3K7UC 1EWIA 1SN8A 4RKLA 3T53B 3TP6A 3J7AV 1SROA 2RCNA 1KLUD 1PTOF 4XT3B 2NN6G 3ER0A 4DK3C 3U9SA 1EZ8A 2QW7A 4RHRA 4LNQA 3CF5A 4KY5A 2RA4A 2TSSA 3CKIB 2AMCB 4KI0A 4ZRZA 3RMHA 1PH7A 3SVMA 5K36H 1LTLA 1KNEA 4DR2Q 1HR0L 2Q2UA 1TWFH 1MGSA 2WB1E 2EYLA 4H0LC 3TDQA 2GA4B 2B39A 4DKAC 5KYLA 1J5EL 2YV5A 1WYDA 2QDBA 2B29A 4NKLA 3I4MB 2CWPA 2A69D 5CBEE 1HPCA 2OEOA 1NE3A 1ONLA 3HP3A 1D5XC 2BDNA 5JJKA 4PNYA 2KUMA 4O0AA 4KK7A 3GTLH 2MHVA 1JOQA 1GD7A 3G6JB 3QJYA 3TZDA 1QOHA 3TP7A 1JE5A 2MUYA 5H1SE 1VQNA 2YU9B 3NBIA 2QILA 5BN5A 3QB3A 4HIKA 1YNXA 1HTLD 3M4PA 2Z0SA 5LHY1 5CC4A 1Y8PB 2MO0A 3WOEA 4CBVA 1HTPA 5JJZA 4R4QA 4V0BA 3MFGA 1OTCA 4RGOS 4YWKA 1STGA 4DU9A 3ONAB 3NTIA 3G71A 1Q46A 4JV5L 2X69A 4IUPA 1Y1WB 2O2LD 1STYA 3C1FA 3CCMA 1Z6HA 5IP9G 3P1HA 4ZCKA 2SEBD 4HJ5A 3BZCA 1E3PA 3CQZH 2OF1A 1TWGB 2PPBC 1NNXA 4X66Q 5LMNL 1ICWA 5EQ0A 4DR6L 2NTSA 3I4NH 5J22A 3X3NA 1FNUA 4CHTB 1EOVA 1TWCH 5CORA 1EY5A 1EQRA 4DV5L 1HUMA 5IGEA 2Z1CA 5M5XH 3QWNA 5BN4A 1HUNA 5GAHC 4R1JA 2IY5B 1CZGA 1L0YB 1A8VA 4C1NI 1PFMA 1VQ6A 1HCZA 3KF6A 3I2ZA 2V4DA 2K28A 2Y0SE 3QOLA 4RGNA 1O7LA 1PTOH 1VQJA 4U68A 4DV6Q 4P74A 3MFYA 2N8NA 3CC2A 4KN4C 1I4XA 3DXJC 1I4GA 5C0XH 3FRPB 4NPSA 4YY3Q 2VNUD 2KCCA 4IFDJ 2VXWA 3GV3A 1KIXA 1PYBA 4ODGA 3C3LA 3TRZA 3F1ZA 3CU7A 2JE6I 2K5VA 5HGQA 5FLXc 3MXNB 2B2VA 4PZ7A 1W3SA 3Q22A 1IKMA 5IT9c 1MD2D 1LTTD 5LMUL 1BUVT 1XPUA 4Y52H 3CQZB 1W2BA 3BYTB 4KD4A 4A3LH 3FPPA 4OGQC 4TSSA 2N49A 3TZUA 4YCWA 3TS0A 1PDQA 1AN8A 2B63G 4S3SA 3BDCA 2IWHA 5CV7A 2A8VA 3AMUA 1CKOA 5EKLA 4YWMA 1EOTA 1VQ8A 3U9OA 2XVSA 1WD0A 4JI4Q 1Z7TA 4LWCA 2K04A 1D5MC 3OW7A 1V1OA 5FLMG 3OTOL 2JA5H 4V190 5IODA 2MP1A 1XNRL 3S17B 3OW2A 1K83B 2WP8J 1BO0A 1CKMA 2NYZD 2JP1A 1L1OB 2F4VQ 4LF9L 2F3VA 3K0YA 1A3TA 4FF4A 1NY4A 2C9OA 1CTMA 1KDCA 1TR5A 4BBRG 1MBYA 2B63H 1I4RA 1XTCD 4Y7NH 2IL8A 1H9SB 3URYA 2K01A 1EIHA 5I9OA 1C0AA 4BY1B 4C56C 1SEBD 4DN4M 2BA0A 3EBEA 4FYDA 4LMQD 4HJ7A 2UUBQ 3FPUB 2LSSA 3V2TA 2RF4A 3FKIB 1QVGA 4YIJA 1LV9A 2F0HA 3I4MH 3BDOA 3PIO3 4N8X1 2K14A 3MAQA 1Y8NB 3BG3A 2KJXA 3VYRA 3HOXG 1FL0A 3CC4A 3HOUB 1X3GA 4BBRH 3A8KE 3J7YW 4KD3A 3HG9A 4TKOB 2BE5D 1NMGA 3HS0C 5GAEC 3CMAA 4A3FB 1HR0W 1LLRD 3VA7A 1NJIC 2JA8H 3LX0A 1HA6A 3NTHA 3VR2A 3BJUA 5FLXL 1B44D 3PUVA 1B7YB 3Q0AA 1C8CA 5IT9L 2JA9A 3RLFA 5HGTA 2EY5A 1Y1WH 4HMIA 4FF3A 4DAYA 1Q8KA 1DXMA 3M7GA 2ZT9C 2VS1A 3GTPH 1VMPA 1WTQA 3DM1A 4EQNA 1BCPF 1QUQB 1U9RA 1RCVD 2F0LA 2UUBL 2B63B 4HIMA 1UE7A 1FGUA 4OWWB 5C3EB 3S1MB 4NXNQ 2R92H 4GNXC 5M5YH 3CCVA 2NVYH 3SK5A 1LT5D 4QUCA 5A35A 3NK9A 2LKVA 4LF6L 4NXMQ 1EFID 3WDNA 3S1NH 4DNRB 1YNJD 1HH2P 2XNAC 1IKLA 1CQVA 5JOBA 5E7NA 2JA5B 3S17H 3KDFA 3EROA 1E1OA 1O80A 3UI2A 4IN3A 1U4MA 4KKUA 4DR1Q 4O42A 3K7AH 1HNXQ 4A3JH 2E2JH 1PTOB 5CV5A 3M4YA 3QG1A 3OTOQ 1D6EC 4HJ9A 4JI8Q 2CQAA 2FINB 3LGJA 2EVBA 3NBHB 1SR3A 1JWUD 1OO9B 1E2ZA 2D2CC 1K8OA 3OYYA 3ULPA 4CJ0B 2BDOA 5IP7G 2OTLA 1LTSD 2N55A 4LFBL 1G2TA 4CDEC 3MXNA 5ISRA 4LFCQ 4QL5A 1LUZA 4L63B 3J7AF 4LF9Q 2B2YC 4DV3Q 1PH2A 1X65A 2NVTH 1GJXA 3D4RA 1XMQL 1RODA 2R7ZG 4A3GB 4AYBG 4DV2L 3H3VC 1C4QA 2WKDA 4A4IA 2MO1A 1SNOA 4A75A 4FF2A 2B2WC 5C3EH 4DUYQ 2RVLA 3HOUH 3PO3G 2IX3A 2R92B 2I5MX 1MKHA 1JOKA 3VR5A 3FEWX 1QJOA 2PQEA 1A3VA 1CSPA 3KLRA 4OWTB 1CQFA 5J1ZA 4IUUA 5CV6A 2FMMA 3D6CA 5JEAH 1KC8C 2IX1A 3J80c 2ZM6L 4QIWB 3M3YB 1ICFB 1ZEQX 1IL8A 4DV4L 5C3WA 1CK1A 4G57A 4MHEA 4DR4L 1KDAA 4JG2A 1IBMQ 1CZWA 1B3AA 1AEXA 4JW0A 3OMGA 2ZJQA 2E2JB 1W6KA 3KUPA 3UDGA 3GTPB 1WVLA 2EXZA 1FYCA 4O2DA 1JJ2A 4JI7L 3X3MA 1R9TH 1J8IA 2EOTA 4HN7A 1SJHD 3S1MH 3TP5A 5EGTA 1II3A 1L0WA 4OEMB 5KEEA 4IZ8A 2XRSD 2GVBA 3QR8A 3M4OH 1X3EA 5C4XB 4JI6Q 3GTLB 3J81c 2KECA 4DV0Q 4LFAQ 3K5LA 1EFWA 1IHZA 1TVXA 4IFDH 4RCNA 2PZWA 2HUGA 1LM0A 2NZHA 3VA5A 4RGMA 4EQPA 1HRJA 5JPNC 4JI1L 2WACA 1VQ4A 4X3SA 2R7DA 3QIAA 4QMGA 4DAYB 4BY7G 4GOPC 2B8FA 4DUYL 2F0NA 3G7LA 1N34L 3JAML 2F0KA 2O5IC 1NTGA 4A3EB 2F0WA 5CGKA 1QNKA 2R92G 4X65Q 3HOXH 3S14H 1PRTC 4GKKQ 4X65L 4N9TA 4A3GG 2R7ZB 1XPOA 3PMFA 4YHHL 2F52A 3SHLA 1SE8A 4K8IA 5DM63 3H0GH 1PH4A 1K73C 4KJNA 3P20A 3UDFA 1PLFA 3J80E 1CA5A 3ULLA 1MI2A 2DNEA 4IPHA 4R4CA 4FDBA 4FO2A 2IHFA 2NTTA 2WKCA 3PF5A 1HQMC 4PZ8A 2PQAA 1GUNA 3KJPA 1H9KA 3S15B 3T13A 1B70B 2OTJA 1IW7C 2WAQE 1XNQQ 5TSSA 2JA5G 1A62A 4FP5D 5CBAE 3N6RA 2EE1A 2KCMA 4XQJA 2VB2X 1RJTA 1KQSA 5I6WA 2UUAL 4LF5Q 4HEDA 3BYYB 2GVAA 3UDXA 1X54A 2BE5C 1C7YA 3M7NA 4A3KB 3KOJA 4DR5L 5JJIA 5M3FH 1OXUA 2EY2A 3LWEA 5CYUA 1WTPA 4I65A 2KCTA 4A93H 1EIGA 1RTOA 2F0OA 1SNMA 4K5VA 3MHBA 1AZPA 5CV9A 2LY7A 5LL6X 3CCLA 5IWAQ 3OSOA 3SXHA 1DD2A 5T1GA 4BXXH 2DY8A 2JK8A 3S24A 5BN3A 1X3QA 4DV2Q 1IYVA 2B2UC 1FNWA 4IUQA 3S9WA 5C44H 2WB1G 4GN4B 1VQ9A 3K58A 4BA2I 1HNWL 2Z6BA 1QZGA 3IFTA 1K9MC 3S15H 4QF4A 3OMCA 1VQBA 4R4OA 1I4QA 4C2MH 2VY3A 5IE8A 4IUNA 3HOXB 3A5ZB 4TQUS 2RDFA 4ZYSA 3KFUA 1AP0A 4DK0A 1HNXL 4OIKA 1X9NA 2VZAA 3CCSA 1SJED 1AW7A 2WV6D 3IAYA 1I6HB 3KDFB 3IFDA 1KAAA 1G291 2YYZA 4DR7Q 2EDGA 4DR2L 5C5MA 3AB9A 3HFZB 4JC0A 4QJFA 4R4IA 3AEVA 1T9HA 3K80C 1QZHA 3PIP3 4A93B 4F8MA 5I2YA 3PUZA 2KCNA 1E22A 3E5SA 5IYDH 2KENA 2L11A 4ABNA 5AJ3L 1SFOH 3KF6B 1BOSA 1K8MA 2EYOA 1RIPA 2FXQA 3D4WA 3FVQA 4QQBX 3D0FA 2DNCA 2F1MA 4B3RL 2LS01 4EQOA 4B3MQ 3I72A 2B2VC 2ATWA 4XYOA 3SEBA 4B3SQ 3BVZA 1X32A 2E75C 2G9HD 2F0DA 3RN5A 3TREA 1LTRD 1PH5A 1EUJA 1Q12A 2N88A 4ULLA 2KHSA 2HCCA 1XWEA 2FFKB 3R2TA 2Q8RE 2F0TA 1OXSC 3U4VA 3PQIA 1PH9A 1EY9A 1JB7A 2JYOA 5I6YA 4M8AA 2LMCB 4A93G 5E4WC 3H94A 3WWVA 4QCLA 4DAMA 4YY3L 4JBKA 3HRZC 2K33A 2RDGA 1PV4A 3BVGA 4R9WA 2WINB 5C5LA 3GTQB 2VUMG 3PO2H 5C4ZA 2AHOB 1L2FA 2DJGC 1AFPA 3MZ5A 4GLVB 1I5FA 1CSQA 3GDEA 2F3WA 1FJGQ 5COYA 3CD6A 5M5WB 4AYBE 3HOWG 1TXYA 2GN5A 1K3BC 3H91A 1S5DD 1KD1C 2RCFA 5D65A 1NBWA 1TWAH 1VF7A 2B3GA 3FMCA 4B08A 3W5OA 1VQHA 2AQ3B 3A74A 2B2YA 1STHA 4RAUC 2FJ2A 1P8LA 2K5QA 3K81C 2K7VA 1YJ9A 1S5FD 2WB1B 3P75A 2NVTB 1SE4A 4A3MG 1IL2A 2IPKD 3I90A 2H4OA 2RBMA 3I8ZA 3R8BA 5IGCA 1STBA 4G7HC 2JEAI 3E3XA 2NBFA 1HZ9A 5EPLA 5A2QL 1EU3A 3CPFA 1GOZA 2Q8TA 4JI4L 1SNCA 1O78A 3R2IA 1Y1WG 4R8IA 2MFIA 3DEOA 1V9PA 3VYSA 5GQOA 2HHHL 5EKIA 2CVRA 3GTQH 1AZQA 1HQRD 3G6EA 2BCOA 3GV6A 1H95A 3QO2A 1RL2A 1K3RA 4IOCA 1EWHA 1Q86C 3NENA 2I5HA 4H44C 3IRBA 4DF7A 4WJ4A 2E2HB 2SOBA 1LTBD 4Y7NB 4P2CB 4ME5A 1KL9A 2EYPA 4RG1A 4MNOA 1ZYRD 2K1BA 3J7ZC 5E4XA 4KKSA 4KHPQ 3J81E 4IFDG 1I94Q 1TQOA 1MJEA 3K57A 5C4XH 2UUCQ 2QCPX 3CP0A 1SAPA 3MWYW 4JI0L 2X6LA 2F0VA 3L0OA 1D5ZC 4A3DB 4DAPA 1S72A 2K75A 4UP9A 3PO2B 1IZ6A 2IHEA 1BXTA 1ENFA 3KLWA 4DGZA 1U5KA 4IUTA 2OQKA 1TS2A 1I6VC 1TT2A 4NXML 2PO4A 4JPBW 3J81i 1JQYD 1F9QA 1LTGD 4P72A 5I9PA 3I56A 2ASBA 5EBDA 3A55A 3U50C 4A3CG 2M00A 1TS4A 3E0JA 2XWBB 4JI5L 3Q24A 1IYJB 4JOIA 4L5QA 2A74C 4OXPA 3K5OA 2ICEC 1WTWA 4JI3L 2K4KA 3OWEB 4A3EG 1T5XD 4K5XA 4CKCA 2D62A 4LF8L 4J1MA 1Q81C 1QNUA 1HFGA 3NSWA 3HKZE 1PFBA 1EYDA 2A1AA 2RHSB 1WTOA 2I0QA 4L5SA 3MXGA 3DWPA 3FDTA 3HOYG 5D3DA 3A5UA 4UP7A 3LWUA 3GO5A 1CT1D 4GS3A 5L37A 5D3IB 1D1IA 4B9XA 4CJ1B 4LFBQ 3M4QA 2XIWA
chains in the Genus database with same CATH topology
2I5MX 1G6PA 5AJ3Q 4A3BH 1AH9A 4QIWE 1MKHA 4BA1I 4A3DG 1PFSA 1MJCA 2JA8G 4IJLA 1J6QA 3FKIH 1SMXA 1ASYA 4HIOA 1CSPA 5GAGC 4OWTB 1JJGA 2K5HA 1X6OA 1I50H 2AWNA 5C4XG 3EIVA 2I5LX 3JC66 4DK6C 4POFA 3J80c 2ZM6L 4DR3Q 1KC8C 1TWHH 4B3TL 2IX1A 4DV0L 2EQSA 2N3SA 4QY7A 1TWGH 2D0OA 5C3EG 1CUKA 2Q2TA 1S40A 4EX5A 1N32Q 4DV4L 1E7ZA 1VQEA 1EYGA 1VQFA 1YBYA 4JG2A 1IBMQ 4DR4L 3TS2A 2UUAQ 1Y1VH 1VQPA 2JQOA 3PUYA 4OWXB 4B3RQ 1IXRA 4A3IG 2ZJQA 3UDGA 5M5WH 4YCVA 4JI2L 1D8LA 4RMFA 1E1TA 4DV5Q 3GD7A 3PGZA 4UP8A 2HIXA 4O2DA 2K5NA 1K0RA 1YVCA 1L1OC 4LUOA 1R9TH 1JJ2A 4JI7L 4P75A 3FHWA 2IX0A 4LF7Q 5M3FG 3S1MH 4X62L 4IOAA 2XGTA 1L0WA 3NELA 5JJLA 2GVBA 2JA6H 5JEAG 5FLMH 3M4OH 1X3EA 3CAMA 2UXDL 4H02A 3RLOA 4JI6Q 4A3FG 4OO1I 3U4ZA 4DUZQ 1A63A 2Z6KC 4JYAQ 4GLAC 3J81c 2UXCL 1UE1A 4B3SL 4DV0Q 4LFAQ 1EFWA 3HOVH 3GTOH 2F4VL 2R93G 2QA4A 4K0KQ 2CFMA 1UE6A 1N9WA 2R6GA 3F2DA 2E2HH 2MQHA 2NN6I 2E5LQ 1E24A 4DR3L 4GOPB 3H3VI 1GKHA 1LM0A 2NZHA 3S1RH 3JAMi 1HZCA 1KRSA 3TEHB 4JI1L 1WCMH 3F2BA 1VQ4A 3NEMA 3T1HL 3PUWA 3UDIA 5IWAL 3F2CA 1WOCA 4JCVE 2CKZB 1S3OA 5IP9H 2VQEQ 2R7DA 4C3HH 4DAYB 1QVCA 2A19A 3AFQA 5IYBG 4BY7G 1JT8A 3HOVG 1DGSA 4GOPC 1VQMA 1KAWA 3FKIG 4DUYL 1I6HH 3L2PA 1N34L 2ZTEA 1NTGA 4PG3A 2JJQA 3J81j 4GLXA 2CQOA 1XTDA 2R92G 4JOIC 4P73A 4X65Q 1XJVA 4B3ML 3HOXH 4DV7L 3S14H 4UPAA 2D0PA 4GKKQ 4X65L 4A3GG 4DR5Q 1CKNB 1Q1BA 1M1KC 1XPOA 1X56A 2E8GA 4YHHL 1OXVA 3PIPA 2F52A 4TVAB 4X62Q 1GVPA 1SE8A 2H5XA 3D31A 3CCJA 3T1YQ 1GO3E 4LF7L 3S16H 1WCMG 4P71A 1PH8A 3H0GH 4GNXA 1PHJA 1VCIA 4JI7Q 1PH4A 3HOYH 1N36L 1K73C 3K7UC 1EWIA 1SN8A 3UDFA 1VQOA 3PUXA 3CCEA 1QUQA 3ULLA 1SROA 2RCNA 1X55A 5IYCG 3U58A 4IPHA 2KHIA 4JI8L 5K36G 4R4CA 4FDBA 2NN6G 3ER0A 2IHFA 4IJHA 4JI1Q 4DK3C 2ES2A 1HR0Q 2HT1A 3H0GG 4GNXB 5J3BA 4A3CH 3PF5A 2BA1A 4PZ8A 4LNQA 4C3JH 2PQAA 3L7ZC 3CF5A 1EIYB 3KJPA 1XNRQ 1OXXK 5EAYA 2AMCB 4KI0A 4C3IH 1PH7A 4A3GH 1LTLA 4WJ3M 1B70B 2BH2A 2OTJA 2ZJPA 3SGIA 4DR2Q 2PQAB 1HR0L 2Q2UA 1TWFH 2WAQE 1XNQQ 2WB1E 2ZTCA 5C0XJ 2JA5G 1A62A 1B8AA 4XIGS 4DKAC 2VW9A 1J5EL 4NXNL 4HIDA 1X3FA 2YV5A 1WYDA 1M90C 1K8AC 2KCMA 2B29A 1YZ6A 1MIUA 2HIVA 4BY7H 4OO1G 1KQSA 2CWPA 3STBD 4HJAA 2UUAL 4LF5Q 4JBWA 3M3YH 1NE3A 3K0XA 2GVAA 3UDXA 1X54A 4DPGA 1C7YA 5JJKA 3M7NA 1WJJA 1K83H 3KOJA 4DR5L 4O0AA 5JJIA 2ZM6Q 5M3FH 3GTKH 1OXUA 3I7FA 3W1BA 4QGUA 3GTLH 4A3LG 2MNAA 1IBKL 2KCTA 1GD7A 4A93H 1JE5A 2WAQG 5H1SE 1VQNA 4LF5L 3K8AA 5C4JH 4HIKA 3E9HA 1YNXA 4A3FH 3M4PA 1PH6A 1Q1EA 2Z0SA 5IWAQ 2BH8A 3CCLA 1N33Q 2OWOA 3HOUG 2MO0A 1P16A 4BXXH 1WFQA 2JK8A 2ID0A 5GADC 3S24A 2CCZA 4BY1H 3Q8DA 2ZJRA 3B6YA 4AH6A 3CCQA 4R4QA 3GTJH 4DV2Q 1XMQQ 1OTCA 5C44H 2WB1G 4YWKA 4GN4B 1VQ9A 1VQLA 3G71A 1Q46A 4JV5L 4BA2I 1HNWL 1QVFA 4DV6L 3A0JA 1QZGA 3CCMA 1K9MC 3VDYA 4J15A 5IP9G 2EIFA 2KBNA 3S15H 4R4OA 3BZCA 1BBWA 1E3PA 1VQBA 3CQZH 4X64Q 4C2MH 4HJ5A 1HZBA 2VY3A 3HOZH 4LFAL 1BBUA 1NMFA 1VQAA 4BY1G 5IE8A 5LMNW 3ICEA 1SRUA 4X66Q 5LMNL 4BBSH 5M3MG 3DLLA 4LF8Q 4A76A 3A5ZB 3HOWH 1LYLA 3RLNA 2YTYA 1SLJA 2UXBQ 4DR6L 3CCRA 3I4NH 4TQUS 1EOVA 1AE3A 1TWCH 3KFUA 2HQLA 2R93H 3M9BA 3MEFA 4KHZA 2NVXH 1EQRA 4DV5L 1HNXL 1X9NA 1U0LA 2VZAA 5M5XH 4L5RC 3CCSA 3PIOA 3T1HQ 1OXTA 2YTVA 2Z6KA 3KDFB 5GAHC 4R1JA 3RZDH 1J5EQ 2IY5B 1Q82C 4MTNA 4JI2Q 4A3EH 2JA6G 1G291 2YYZA 1A8VA 1YIJA 2VUMH 4DR7Q 4DR2L 1VQ6A 4NB3A 4DR1L 4AQYQ 5C0XG 1O7IA 3HFZB 4JC0A 4QJFA 4X66L 5LMNQ 2AWOA 3KF6A 4R4IA 3BU2A 3AEVA 3AYHB 3I2ZA 2Q2HA 2E2IH 1T9HA 1Z9FA 3K80C 1QZHA 2N78A 2Y0SE 1YHQA 3PUZA 2VQFQ 1E22A 1VQJA 4ME3A 1PH3A 4DV6Q 4P74A 2N8NA 5IYDH 2KENA 3CC2A 3J80i 5AJ3L 2XTIA 4A3KG 4NPSA 1SFOH 3KF6B 4YY3Q 1RIPA 2VNUD 2FXQA 3T1YL 3HOZG 4IFDJ 4QQBX 1KIXA 1PYBA 5ELOA 1G51A 4LF4L 1KHIA 3D0FA 3F1ZA 1N36Q 5HGQA 2JE6I 2K5VA 5FLXc 3TRZA 4MZ9A 1BKBA 3MXNB 4DR6Q 1VQIA 4IO9A 1VQ5A 1N33L 1VQCA 4JBMA 1YHBA 4DV7Q 3I4MG 4PZ7A 2LXJA 4B3MQ 4B3RL 3S1QH 1W3SA 4K0KL 3UE0A 5IT9c 2ATWA 3HKSA 5LMUL 4B3SQ 3CXCA 4GKKL 1VQ7A 4A3DH 4JYAL 2UXCQ 3PO3G 1XPUA 4Y52H 2K50A 4GN5A 3ERSX 1W2BA 3RN5A 1N32L 3TREA 1PH5A 1A0IA 4A3LH 1EUJA 1Q12A 5IYCH 1KXLA 3CPWA 3J7A5 1UE5A 3UE1A 2N49A 1V43A 2R7FA 4YCWA 3TS0A 3S2HH 2VQEL 1YJNA 1AE2A 2B63G 3RR5A 4AIMA 1OXSC 3U4VA 1PH9A 1VQKA 2YU9H 1JB7A 3F8TA 4GN3B 5FJ8H 1HNZQ 2A8VA 3PO2G 2VL6A 1CKOA 2ALYB 1XNQL 3DM3A 1C9OA 4YCUA 3G4SA 4A93G 3EN2A 4YWMA 1WI5A 3WWVA 1VQ8A 4DAMA 2OQ0A 3AFPA 2PI2E 4YY3L 4JBKA 2OCEA 5C0XI 4JI4Q 3FP9A 4LWCA 1PV4A 5C44G 5FLMG 3JAMc 3OTOL 2UU9L 2JA5H 3ZJYC 2VUMG 1YITA 1XNRL 3PO2H 3PO3H 3OW2A 2E5LL 4POGA 4A3KH 3TQYA 2AHOB 2WP8J 1L2FA 1CKMA 1YI2A 4GLVB 2Y0SG 1KRTA 1I5FA 3CCUA 1L1OB 4BXXG 1CSQA 1PYSB 2F4VQ 1Q7YC 3GDEA 4LF9L 3STBC 1NY4A 1IBLQ 1FJGQ 1VQGA 4DUZL 3CD6A 1FVIA 1HJPA 2JEBI 4AYBE 4AQYL 4A3JG 3HOWG 1TXYA 2CWAA 2GN5A 5BR8Q 1I94L 4BBRG 3E0EA 4IPGA 2B63H 4Y7NH 2UXDQ 2PI2A 1KD1C 2F3IA 1NBWA 1C0AA 1TWAH 1PVOA 2BA0A 2B3GA 3EBEA 5JEAJ 1XMOQ 2KHJA 3W5OA 4HJ7A 1VQHA 2UUBQ 3A74A 1HZAA 3RN2A 2LSSA 3H3VH 2RF4A 1QVGA 1IBLL 1FJGL 4EQ5A 2QEXA 3I4MH 1P8LA 2K52A 3K81C 4APVA 4IFDI 4DV4Q 2PNHA 2IT1A 3M85A 2AKWB 2NZOA 3PF4A 5GROA 2K14A 4L5TA 1YJ9A 4B3TQ 2V1CC 4A3MG 4A3BG 4X64L 1IL2A 4JBJA 5DLQE 3BZKA 4LW1A 4UY8C 2DGYA 3AQQA 1HNWQ 1ASZA 1N8RC 3HOXG 4OX9Q 1FL0A 3CC4A 2JEAI 1Y14B 2ZTDA 1X3GA 5IYDG 1HZ9A 4BBRH 4OONA 4JI5Q 4JV5Q 3CW2C 4LF6Q 1N34Q 5FJ8G 3CPFA 3CMEA 1EQQA 2LXKA 4JI4L 4R4TA 1NMGA 5GAEC 3CMAA 1YJWA 1BVSA 1Y1WG 1HR0W 3GTGH 1NJIC 4X6AH 2MFIA 1V9PA 2JA8H 5GQOA 5IP7H 2HHHL 4PZ6A 2C35B 1HNZL 4OX9L 3BJUA 3GTQH 3G6EA 3PUVA 4IPCA 4YWLA 1B7YB 2PMZE 3PCOB 4YHHQ 1H95A 3RZOH 2JA7G 5LMUQ 2JA9A 3RLFA 1PA6A 1RL2A 4ALPA 2EXDA 4JI6L 1K3RA 4IOCA 1YEZA 3RNUA 1Y1WH 3I4OA 1IBKQ 4DV1Q 5IYBH 1Q8KA 1Q86C 3NENA 2I5HA 3GTMH 1D7QA 2VS1A 3GTPH 2L15A 4LF4Q 2UUCL 3PV0A 4A3IH 3W1GA 1QUQB 1PH1A 3IRBA 4WJ4A 1JJCB 4DNIA 2UUBL 4HIMA 2YTXA 1UE7A 1FGUA 4RG1A 1KL9A 1GM5A 4OWWB 4MNOA 4GKJL 4JI3Q 2HHHQ 3J7ZC 4NXNQ 2R92H 4A3MH 4GNXC 4KHPL 5M5YH 1Z47A 3CCVA 5HY6A 2RHQB 4KHPQ 2QGQA 5IY0A 3CC7A 2NVYH 2UXBL 4IFDG 1I94Q 1MJEA 1CKNA 5C4XH 2VQFL 4LF6L 4KLKA 2UUCQ 4DR4Q 3CP0A 4NXMQ 3S2DH 4JI0L 3S1NH 2JA7H 3L0OA 1HH2P 3I4NG 1L1OA 1S72A 5E7NA 2K75A 3HKZG 4UP9A 3S17H 3KYHC 1IZ6A 2IHEA 2Q2IA 3KLWA 3KDFA 1E1OA 1U5KA 5M3MH 2OQKA 3KF8B 2R7ZH 4DR1Q 4LUZA 3K7AH 4JI0Q 1VQDA 1HNXQ 4A3JH 4DR7L 4NXML 1K8GA 2E2JH 1UEBA 3OTOQ 2UU9Q 3J81i 4HJ9A 4P72A 2DUDA 4JI8Q 3I56A 2ASBA 3U50C 3H15A 3LGJA 1XMOL 4A3CG 3NBHB 1SR3A 4JI5L 3PSIA 1IYJB 4JOIA 1EIFA 4XTCS 2WFWA 4L5QA 4OXPA 3OYYA 3ULPA 4GKJQ 4HJ8A 4JI3L 5IP7G 2OTLA 2K4KA 4A3EG 4LFBL 4DV1L 2D62A 5BR8L 4LF8L 1Q81C 4PMWA 4LFCL 3HKZE 3I55A 2A1AA 2RHSB 4LFCQ 4QL5A 2I0QA 1LUZA 1IBML 4L5SA 2NVQH 4LF9Q 4IPDA 4DV3Q 1PH2A 3HOYG 1I3QH 1JMCA 1X65A 4LUVA 1YHAA 5ELNA 3KJOA 3A5UA 4DV3L 4GOPA 2NVTH 3ULJA 1VS0A 3E9IA 3G48A 4UP7A 1Y1VG 1XMQL 3GO5A 4GS3A 2R7ZG 4AYBG 1UWVA 4DV2L 4A4IA 1XPRA 2MO1A 1V1QA 4A75A 4BBSG 5C3EH 4LFBQ 4DUYQ 3HOUH 3M4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I5M X;  1G6P A;  5AJ3 Q;  4A3B H;  1AH9 A;  4QIW E;  1MKH A;  4BA1 I;  4A3D G;  1PFS A;  1MJC A;  2JA8 G;  4IJL A;  1J6Q A;  3FKI H;  1SMX A;  1ASY A;  4HIO A;  1CSP A;  5GAG C;  4OWT B;  1JJG A;  2K5H A;  1X6O A;  1I50 H;  2AWN A;  5C4X G;  3EIV A;  2I5L X;  3JC6 6;  4DK6 C;  4POF A;  3J80 c;  2ZM6 L;  4DR3 Q;  1KC8 C;  1TWH H;  4B3T L;  2IX1 A;  4DV0 L;  2EQS A;  2N3S A;  4QY7 A;  1TWG H;  2D0O A;  5C3E G;  1CUK A;  2Q2T A;  1S40 A;  4EX5 A;  1N32 Q;  4DV4 L;  1E7Z A;  1VQE A;  1EYG A;  1VQF A;  1YBY A;  4JG2 A;  1IBM Q;  4DR4 L;  3TS2 A;  2UUA Q;  1Y1V H;  1VQP A;  2JQO A;  3PUY A;  4OWX B;  4B3R Q;  1IXR A;  4A3I G;  2ZJQ A;  3UDG A;  5M5W H;  4YCV A;  4JI2 L;  1D8L A;  4RMF A;  1E1T A;  4DV5 Q;  3GD7 A;  3PGZ A;  4UP8 A;  2HIX A;  4O2D A;  2K5N A;  1K0R A;  1YVC A;  1L1O C;  4LUO A;  1R9T H;  1JJ2 A;  4JI7 L;  4P75 A;  3FHW A;  2IX0 A;  4LF7 Q;  5M3F G;  3S1M H;  4X62 L;  4IOA A;  2XGT A;  1L0W A;  3NEL A;  5JJL A;  2GVB A;  2JA6 H;  5JEA G;  5FLM H;  3M4O H;  1X3E A;  3CAM A;  2UXD L;  4H02 A;  3RLO A;  4JI6 Q;  4A3F G;  4OO1 I;  3U4Z A;  4DUZ Q;  1A63 A;  2Z6K C;  4JYA Q;  4GLA C;  3J81 c;  2UXC L;  1UE1 A;  4B3S L;  4DV0 Q;  4LFA Q;  1EFW A;  3HOV H;  3GTO H;  2F4V L;  2R93 G;  2QA4 A;  4K0K Q;  2CFM A;  1UE6 A;  1N9W A;  2R6G A;  3F2D A;  2E2H H;  2MQH A;  2NN6 I;  2E5L Q;  1E24 A;  4DR3 L;  4GOP B;  3H3V I;  1GKH A;  1LM0 A;  2NZH A;  3S1R H;  3JAM i;  1HZC A;  1KRS A;  3TEH B;  4JI1 L;  1WCM H;  3F2B A;  1VQ4 A;  3NEM A;  3T1H L;  3PUW A;  3UDI A;  5IWA L;  3F2C A;  1WOC A;  4JCV E;  2CKZ B;  1S3O A;  5IP9 H;  2VQE Q;  2R7D A;  4C3H H;  4DAY B;  1QVC A;  2A19 A;  3AFQ A;  5IYB G;  4BY7 G;  1JT8 A;  3HOV G;  1DGS A;  4GOP C;  1VQM A;  1KAW A;  3FKI G;  4DUY L;  1I6H H;  3L2P A;  1N34 L;  2ZTE A;  1NTG A;  4PG3 A;  2JJQ A;  3J81 j;  4GLX A;  2CQO A;  1XTD A;  2R92 G;  4JOI C;  4P73 A;  4X65 Q;  1XJV A;  4B3M L;  3HOX H;  4DV7 L;  3S14 H;  4UPA A;  2D0P A;  4GKK Q;  4X65 L;  4A3G G;  4DR5 Q;  1CKN B;  1Q1B A;  1M1K C;  1XPO A;  1X56 A;  2E8G A;  4YHH L;  1OXV A;  3PIP A;  2F52 A;  4TVA B;  4X62 Q;  1GVP A;  1SE8 A;  2H5X A;  3D31 A;  3CCJ A;  3T1Y Q;  1GO3 E;  4LF7 L;  3S16 H;  1WCM G;  4P71 A;  1PH8 A;  3H0G H;  4GNX A;  1PHJ A;  1VCI A;  4JI7 Q;  1PH4 A;  3HOY H;  1N36 L;  1K73 C;  3K7U C;  1EWI A;  1SN8 A;  3UDF A;  1VQO A;  3PUX A;  3CCE A;  1QUQ A;  3ULL A;  1SRO A;  2RCN A;  1X55 A;  5IYC G;  3U58 A;  4IPH A;  2KHI A;  4JI8 L;  5K36 G;  4R4C A;  4FDB A;  2NN6 G;  3ER0 A;  2IHF A;  4IJH A;  4JI1 Q;  4DK3 C;  2ES2 A;  1HR0 Q;  2HT1 A;  3H0G G;  4GNX B;  5J3B A;  4A3C H;  3PF5 A;  2BA1 A;  4PZ8 A;  4LNQ A;  4C3J H;  2PQA A;  3L7Z C;  3CF5 A;  1EIY B;  3KJP A;  1XNR Q;  1OXX K;  5EAY A;  2AMC B;  4KI0 A;  4C3I H;  1PH7 A;  4A3G H;  1LTL A;  4WJ3 M;  1B70 B;  2BH2 A;  2OTJ A;  2ZJP A;  3SGI A;  4DR2 Q;  2PQA B;  1HR0 L;  2Q2U A;  1TWF H;  2WAQ E;  1XNQ Q;  2WB1 E;  2ZTC A;  5C0X J;  2JA5 G;  1A62 A;  1B8A A;  4XIG S;  4DKA C;  2VW9 A;  1J5E L;  4NXN L;  4HID A;  1X3F A;  2YV5 A;  1WYD A;  1M90 C;  1K8A C;  2KCM A;  2B29 A;  1YZ6 A;  1MIU A;  2HIV A;  4BY7 H;  4OO1 G;  1KQS A;  2CWP A;  3STB D;  4HJA A;  2UUA L;  4LF5 Q;  4JBW A;  3M3Y H;  1NE3 A;  3K0X A;  2GVA A;  3UDX A;  1X54 A;  4DPG A;  1C7Y A;  5JJK A;  3M7N A;  1WJJ A;  1K83 H;  3KOJ A;  4DR5 L;  4O0A A;  5JJI A;  2ZM6 Q;  5M3F H;  3GTK H;  1OXU A;  3I7F A;  3W1B A;  4QGU A;  3GTL H;  4A3L G;  2MNA A;  1IBK L;  2KCT A;  1GD7 A;  4A93 H;  1JE5 A;  2WAQ G;  5H1S E;  1VQN A;  4LF5 L;  3K8A A;  5C4J H;  4HIK A;  3E9H A;  1YNX A;  4A3F H;  3M4P A;  1PH6 A;  1Q1E A;  2Z0S A;  5IWA Q;  2BH8 A;  3CCL A;  1N33 Q;  2OWO A;  3HOU G;  2MO0 A;  1P16 A;  4BXX H;  1WFQ A;  2JK8 A;  2ID0 A;  5GAD C;  3S24 A;  2CCZ A;  4BY1 H;  3Q8D A;  2ZJR A;  3B6Y A;  4AH6 A;  3CCQ A;  4R4Q A;  3GTJ H;  4DV2 Q;  1XMQ Q;  1OTC A;  5C44 H;  2WB1 G;  4YWK A;  4GN4 B;  1VQ9 A;  1VQL A;  3G71 A;  1Q46 A;  4JV5 L;  4BA2 I;  1HNW L;  1QVF A;  4DV6 L;  3A0J A;  1QZG A;  3CCM A;  1K9M C;  3VDY A;  4J15 A;  5IP9 G;  2EIF A;  2KBN A;  3S15 H;  4R4O A;  3BZC A;  1BBW A;  1E3P A;  1VQB A;  3CQZ H;  4X64 Q;  4C2M H;  4HJ5 A;  1HZB A;  2VY3 A;  3HOZ H;  4LFA L;  1BBU A;  1NMF A;  1VQA A;  4BY1 G;  5IE8 A;  5LMN W;  3ICE A;  1SRU A;  4X66 Q;  5LMN L;  4BBS H;  5M3M G;  3DLL A;  4LF8 Q;  4A76 A;  3A5Z B;  3HOW H;  1LYL A;  3RLN A;  2YTY A;  1SLJ A;  2UXB Q;  4DR6 L;  3CCR A;  3I4N H;  4TQU S;  1EOV A;  1AE3 A;  1TWC H;  3KFU A;  2HQL A;  2R93 H;  3M9B A;  3MEF A;  4KHZ A;  2NVX H;  1EQR A;  4DV5 L;  1HNX L;  1X9N A;  1U0L A;  2VZA A;  5M5X H;  4L5R C;  3CCS A;  3PIO A;  3T1H Q;  1OXT A;  2YTV A;  2Z6K A;  3KDF B;  5GAH C;  4R1J A;  3RZD H;  1J5E Q;  2IY5 B;  1Q82 C;  4MTN A;  4JI2 Q;  4A3E H;  2JA6 G;  1G29 1;  2YYZ A;  1A8V A;  1YIJ A;  2VUM H;  4DR7 Q;  4DR2 L;  1VQ6 A;  4NB3 A;  4DR1 L;  4AQY Q;  5C0X G;  1O7I A;  3HFZ B;  4JC0 A;  4QJF A;  4X66 L;  5LMN Q;  2AWO A;  3KF6 A;  4R4I A;  3BU2 A;  3AEV A;  3AYH B;  3I2Z A;  2Q2H A;  2E2I H;  1T9H A;  1Z9F A;  3K80 C;  1QZH A;  2N78 A;  2Y0S E;  1YHQ A;  3PUZ A;  2VQF Q;  1E22 A;  1VQJ A;  4ME3 A;  1PH3 A;  4DV6 Q;  4P74 A;  2N8N A;  5IYD H;  2KEN A;  3CC2 A;  3J80 i;  5AJ3 L;  2XTI A;  4A3K G;  4NPS A;  1SFO H;  3KF6 B;  4YY3 Q;  1RIP A;  2VNU D;  2FXQ A;  3T1Y L;  3HOZ G;  4IFD J;  4QQB X;  1KIX A;  1PYB A;  5ELO A;  1G51 A;  4LF4 L;  1KHI A;  3D0F A;  3F1Z A;  1N36 Q;  5HGQ A;  2JE6 I;  2K5V A;  5FLX c;  3TRZ A;  4MZ9 A;  1BKB A;  3MXN B;  4DR6 Q;  1VQI A;  4IO9 A;  1VQ5 A;  1N33 L;  1VQC A;  4JBM A;  1YHB A;  4DV7 Q;  3I4M G;  4PZ7 A;  2LXJ A;  4B3M Q;  4B3R L;  3S1Q H;  1W3S A;  4K0K L;  3UE0 A;  5IT9 c;  2ATW A;  3HKS A;  5LMU L;  4B3S Q;  3CXC A;  4GKK L;  1VQ7 A;  4A3D H;  4JYA L;  2UXC Q;  3PO3 G;  1XPU A;  4Y52 H;  2K50 A;  4GN5 A;  3ERS X;  1W2B A;  3RN5 A;  1N32 L;  3TRE A;  1PH5 A;  1A0I A;  4A3L H;  1EUJ A;  1Q12 A;  5IYC H;  1KXL A;  3CPW A;  3J7A 5;  1UE5 A;  3UE1 A;  2N49 A;  1V43 A;  2R7F A;  4YCW A;  3TS0 A;  3S2H H;  2VQE L;  1YJN A;  1AE2 A;  2B63 G;  3RR5 A;  4AIM A;  1OXS C;  3U4V A;  1PH9 A;  1VQK A;  2YU9 H;  1JB7 A;  3F8T A;  4GN3 B;  5FJ8 H;  1HNZ Q;  2A8V A;  3PO2 G;  2VL6 A;  1CKO A;  2ALY B;  1XNQ L;  3DM3 A;  1C9O A;  4YCU A;  3G4S A;  4A93 G;  3EN2 A;  4YWM A;  1WI5 A;  3WWV A;  1VQ8 A;  4DAM A;  2OQ0 A;  3AFP A;  2PI2 E;  4YY3 L;  4JBK A;  2OCE A;  5C0X I;  4JI4 Q;  3FP9 A;  4LWC A;  1PV4 A;  5C44 G;  5FLM G;  3JAM c;  3OTO L;  2UU9 L;  2JA5 H;  3ZJY C;  2VUM G;  1YIT A;  1XNR L;  3PO2 H;  3PO3 H;  3OW2 A;  2E5L L;  4POG A;  4A3K H;  3TQY A;  2AHO B;  2WP8 J;  1L2F A;  1CKM A;  1YI2 A;  4GLV B;  2Y0S G;  1KRT A;  1I5F A;  3CCU A;  1L1O B;  4BXX G;  1CSQ A;  1PYS B;  2F4V Q;  1Q7Y C;  3GDE A;  4LF9 L;  3STB C;  1NY4 A;  1IBL Q;  1FJG Q;  1VQG A;  4DUZ L;  3CD6 A;  1FVI A;  1HJP A;  2JEB I;  4AYB E;  4AQY L;  4A3J G;  3HOW G;  1TXY A;  2CWA A;  2GN5 A;  5BR8 Q;  1I94 L;  4BBR G;  3E0E A;  4IPG A;  2B63 H;  4Y7N H;  2UXD Q;  2PI2 A;  1KD1 C;  2F3I A;  1NBW A;  1C0A A;  1TWA H;  1PVO A;  2BA0 A;  2B3G A;  3EBE A;  5JEA J;  1XMO Q;  2KHJ A;  3W5O A;  4HJ7 A;  1VQH A;  2UUB Q;  3A74 A;  1HZA A;  3RN2 A;  2LSS A;  3H3V H;  2RF4 A;  1QVG A;  1IBL L;  1FJG L;  4EQ5 A;  2QEX A;  3I4M H;  1P8L A;  2K52 A;  3K81 C;  4APV A;  4IFD I;  4DV4 Q;  2PNH A;  2IT1 A;  3M85 A;  2AKW B;  2NZO A;  3PF4 A;  5GRO A;  2K14 A;  4L5T A;  1YJ9 A;  4B3T Q;  2V1C C;  4A3M G;  4A3B G;  4X64 L;  1IL2 A;  4JBJ A;  5DLQ E;  3BZK A;  4LW1 A;  4UY8 C;  2DGY A;  3AQQ A;  1HNW Q;  1ASZ A;  1N8R C;  3HOX G;  4OX9 Q;  1FL0 A;  3CC4 A;  2JEA I;  1Y14 B;  2ZTD A;  1X3G A;  5IYD G;  1HZ9 A;  4BBR H;  4OON A;  4JI5 Q;  4JV5 Q;  3CW2 C;  4LF6 Q;  1N34 Q;  5FJ8 G;  3CPF A;  3CME A;  1EQQ A;  2LXK A;  4JI4 L;  4R4T A;  1NMG A;  5GAE C;  3CMA A;  1YJW A;  1BVS A;  1Y1W G;  1HR0 W;  3GTG H;  1NJI C;  4X6A H;  2MFI A;  1V9P A;  2JA8 H;  5GQO A;  5IP7 H;  2HHH L;  4PZ6 A;  2C35 B;  1HNZ L;  4OX9 L;  3BJU A;  3GTQ H;  3G6E A;  3PUV A;  4IPC A;  4YWL A;  1B7Y B;  2PMZ E;  3PCO B;  4YHH Q;  1H95 A;  3RZO H;  2JA7 G;  5LMU Q;  2JA9 A;  3RLF A;  1PA6 A;  1RL2 A;  4ALP A;  2EXD A;  4JI6 L;  1K3R A;  4IOC A;  1YEZ A;  3RNU A;  1Y1W H;  3I4O A;  1IBK Q;  4DV1 Q;  5IYB H;  1Q8K A;  1Q86 C;  3NEN A;  2I5H A;  3GTM H;  1D7Q A;  2VS1 A;  3GTP H;  2L15 A;  4LF4 Q;  2UUC L;  3PV0 A;  4A3I H;  3W1G A;  1QUQ B;  1PH1 A;  3IRB A;  4WJ4 A;  1JJC B;  4DNI A;  2UUB L;  4HIM A;  2YTX A;  1UE7 A;  1FGU A;  4RG1 A;  1KL9 A;  1GM5 A;  4OWW B;  4MNO A;  4GKJ L;  4JI3 Q;  2HHH Q;  3J7Z C;  4NXN Q;  2R92 H;  4A3M H;  4GNX C;  4KHP L;  5M5Y H;  1Z47 A;  3CCV A;  5HY6 A;  2RHQ B;  4KHP Q;  2QGQ A;  5IY0 A;  3CC7 A;  2NVY H;  2UXB L;  4IFD G;  1I94 Q;  1MJE A;  1CKN A;  5C4X H;  2VQF L;  4LF6 L;  4KLK A;  2UUC Q;  4DR4 Q;  3CP0 A;  4NXM Q;  3S2D H;  4JI0 L;  3S1N H;  2JA7 H;  3L0O A;  1HH2 P;  3I4N G;  1L1O A;  1S72 A;  5E7N A;  2K75 A;  3HKZ G;  4UP9 A;  3S17 H;  3KYH C;  1IZ6 A;  2IHE A;  2Q2I A;  3KLW A;  3KDF A;  1E1O A;  1U5K A;  5M3M H;  2OQK A;  3KF8 B;  2R7Z H;  4DR1 Q;  4LUZ A;  3K7A H;  4JI0 Q;  1VQD A;  1HNX Q;  4A3J H;  4DR7 L;  4NXM L;  1K8G A;  2E2J H;  1UEB A;  3OTO Q;  2UU9 Q;  3J81 i;  4HJ9 A;  4P72 A;  2DUD A;  4JI8 Q;  3I56 A;  2ASB A;  3U50 C;  3H15 A;  3LGJ A;  1XMO L;  4A3C G;  3NBH B;  1SR3 A;  4JI5 L;  3PSI A;  1IYJ B;  4JOI A;  1EIF A;  4XTC S;  2WFW A;  4L5Q A;  4OXP A;  3OYY A;  3ULP A;  4GKJ Q;  4HJ8 A;  4JI3 L;  5IP7 G;  2OTL A;  2K4K A;  4A3E G;  4LFB L;  4DV1 L;  2D62 A;  5BR8 L;  4LF8 L;  1Q81 C;  4PMW A;  4LFC L;  3HKZ E;  3I55 A;  2A1A A;  2RHS B;  4LFC Q;  4QL5 A;  2I0Q A;  1LUZ A;  1IBM L;  4L5S A;  2NVQ H;  4LF9 Q;  4IPD A;  4DV3 Q;  1PH2 A;  3HOY G;  1I3Q H;  1JMC A;  1X65 A;  4LUV A;  1YHA A;  5ELN A;  3KJO A;  3A5U A;  4DV3 L;  4GOP A;  2NVT H;  3ULJ A;  1VS0 A;  3E9I A;  3G48 A;  4UP7 A;  1Y1V G;  1XMQ L;  3GO5 A;  4GS3 A;  2R7Z G;  4AYB G;  1UWV A;  4DV2 L;  4A4I A;  1XPR A;  2MO1 A;  1V1Q A;  4A75 A;  4BBS G;  5C3E H;  4LFB Q;  4DUY Q;  3HOU H;  3M4Q A; 
#chains in the Genus database with same CATH topology
 2I46 A;  3KLS X;  1G6P A;  1RKN A;  4A3D G;  1PZK D;  1MJC A;  1SMX A;  1ASY A;  3F2U A;  3MA2 B;  2K5H A;  5FO8 B;  1X6O A;  1F2Y A;  5C4X G;  4PQX A;  2I5L X;  2NWG A;  4DK6 C;  1S4Z A;  1B1Z A;  5ELF A;  4DR3 Q;  4DV0 L;  5KIX A;  2Q2T A;  1S40 A;  4EX5 A;  4B9W A;  1XYI A;  4BS9 A;  1E7Z A;  3IKJ A;  4NMZ A;  1HA5 A;  1VQP A;  2JQO A;  4OWX B;  4B3R Q;  1QWY A;  1SYE A;  2R93 B;  4GZY C;  5M5W H;  2NVX B;  4JI2 L;  1E1T A;  3GD7 A;  3PGZ A;  4RH6 A;  4LUO A;  1L1O C;  3FHW A;  2IX0 A;  1NCV A;  4LF7 Q;  4X62 L;  4R8N A;  3GTJ B;  1TWA B;  3HZX A;  2PW5 A;  3NEL A;  3SE0 A;  5FLM H;  1QG7 A;  2UXD L;  3NQT A;  3W2D A;  3RZO B;  4JYA Q;  1LAC A;  2UXC L;  3S2D B;  5ELB A;  3ERQ A;  4B3S L;  3HOV H;  3SK8 A;  2F4V L;  4ZK9 B;  3BVM A;  2D5D A;  5C4J B;  1UE6 A;  1E2V A;  1N9W A;  2R6G A;  3F2D A;  2MQH A;  4CJ2 C;  2E5L Q;  2LFN A;  1GKH A;  3S1R H;  1SMY C;  2SDF A;  3JAM i;  1HZC A;  1KRS A;  1MHW C;  4A3M B;  1A3U A;  1WCM H;  5EKK A;  3UDI A;  2K05 A;  5IWA L;  3F2C A;  3VYU A;  1WOC A;  4JCV E;  1S3O A;  5IP9 H;  4C3H H;  1QVC A;  3AFQ A;  1JT8 A;  3HOV G;  1DGS A;  2EPB A;  1KAW A;  5FKA C;  3S1N B;  2ZTE A;  2JA8 B;  4PG3 A;  1G8Z D;  4GLX A;  1RD9 D;  1XTD A;  1XJV A;  4B3M L;  4BBS B;  4DV7 L;  2F0Q A;  3MXP A;  4UPA A;  3NWS A;  2D0P A;  3HGB A;  3HOW B;  1DM0 B;  5FO7 B;  1SYF A;  4X62 Q;  4LF7 L;  3D31 A;  4C3J G;  1GO3 E;  4P71 A;  1PH8 A;  2JSO A;  1VQO A;  3CCE A;  1QUQ A;  3QOJ A;  2ZXO A;  3U58 A;  2KHI A;  1EY4 A;  1Q3L A;  4HTH A;  2EYF A;  5CMD A;  2KVM A;  4J8Q A;  3H0G G;  4GNX B;  5J3B A;  2BA1 A;  4C3J H;  3L7Z C;  1EIY B;  1BR9 A;  4U67 3;  1XNR Q;  1NSN S;  1A6X A;  5EAY A;  3TSS A;  1PRT F;  5E1F A;  3TN2 A;  1SE2 A;  4C3I H;  5AFW A;  1R4P B;  1LT6 D;  3WOF A;  1SNP A;  4WJ3 M;  1GUW A;  3OOC A;  1SFO B;  3SGI A;  1JOO A;  2L1B A;  4F87 A;  4XIG S;  1S5C D;  4NXN L;  4HID A;  1M90 C;  4BY7 H;  4OO1 G;  1EWC A;  2RKS A;  3STB D;  3I91 A;  4HJA A;  1B9M A;  4X3U A;  4JBW A;  3KBG A;  3M3Y H;  3DUZ A;  1ZYR C;  2QDL A;  1EL0 A;  3GTK H;  4WOR A;  3W1B A;  4A3L G;  1RF2 D;  1KDB A;  1JOR A;  3ITP A;  2WAQ G;  3C1E A;  3GTO B;  4LF5 L;  5I4D A;  3K8A A;  5C4J H;  1EZ6 A;  3A7L A;  1KTK A;  3E9H A;  1VF5 C;  4FF1 A;  1Q1E A;  2BH8 A;  1N33 Q;  4KMU C;  2CH4 W;  1R9T B;  2OWO A;  3HOU G;  5GAD C;  2ID0 A;  1UUP A;  2CCZ A;  4BY1 H;  2Z9H A;  4AH6 A;  3CCQ A;  2XN9 C;  4KY6 A;  2CHB D;  1BQQ T;  2B2T C;  1SSO A;  2B2U A;  3KBX A;  3T16 A;  3VYT A;  1VQL A;  3D3R A;  2H1E A;  3DWA A;  4RKB A;  1KAB A;  2G5D A;  1QVF A;  4RA8 A;  4RWS C;  4ZAI A;  4DV6 L;  3S1Q B;  3NQI A;  5ELC A;  4L8J A;  3VDY A;  4J15 A;  1EQT A;  2EIF A;  2F4I A;  2KBN A;  1BBW A;  4X64 Q;  4PV1 C;  1HZB A;  1U4L A;  5C3X A;  4LFA L;  1BBU A;  1NMF A;  2PYK A;  4BY1 G;  5LMN W;  1SRU A;  4BBS H;  4MN3 A;  3DLL A;  4XQQ A;  4LF8 Q;  4A76 A;  1PTO D;  1JE4 A;  1NR4 A;  1LYL A;  3RLN A;  4BBR B;  2YTY A;  3HOW H;  1E2W A;  2F0G A;  2A6E D;  4QB4 A;  3M9B A;  4KHZ A;  1U0L A;  3EQL C;  3I4L A;  5CV8 A;  3PIO A;  3T1H Q;  2YTV A;  1ENA A;  2Z6K A;  3RZD H;  2K03 A;  2MPM A;  2NN6 H;  3EA6 A;  4A3E H;  1EY6 A;  2JA6 G;  2VUM H;  1SNQ A;  4NB3 A;  4X66 L;  5LMN Q;  3GTK B;  3AYH B;  2E2I H;  2F0S A;  1A2T A;  1I4P A;  1GUO A;  4ME3 A;  2EYJ A;  1I4H A;  4OIJ A;  3TP8 A;  4LK1 C;  3T4A C;  2Y0S B;  3J80 i;  1DOK A;  3T56 B;  4WRD A;  4A3K G;  5M5Y B;  3K5N A;  5C44 B;  3HKZ B;  4LF4 L;  1L0X B;  4MZ9 A;  1BKB A;  4DR6 Q;  1ESR A;  3OIP A;  4IO9 A;  1VQC A;  1VQ5 A;  1YHB A;  1H9R A;  3VR3 A;  1N33 L;  2LXJ A;  4M1U B;  4K0K L;  3S1Q H;  1I3Q B;  3UE0 A;  3HKS A;  3K59 A;  3ERS X;  1N32 L;  3I3C A;  2A68 D;  1KXL A;  3OWF A;  3J7A 5;  1UE5 A;  3UE1 A;  5C6A A;  2J7Z A;  1V43 A;  2DN8 A;  2R7F A;  5LL6 S;  3S2H H;  1YJN A;  1AE2 A;  3K7A B;  2KA7 A;  1VQK A;  3PO2 G;  3I70 A;  4GN3 B;  5FJ8 H;  2ALY B;  3VR6 A;  3ND8 A;  3DM3 A;  3G4S A;  3C2P A;  5ELE A;  3AU7 A;  5C0X I;  5IGB A;  3D8G A;  3FP9 A;  4K6L A;  1TWH B;  2JA7 B;  1S5B D;  3JAM c;  3ZJY C;  1YIT A;  3PO3 H;  2E5L L;  4A3K H;  3TQY A;  1PZI D;  2E74 C;  3NXW A;  4BXX G;  4KN7 C;  2RQX A;  1IBL Q;  1HJP A;  1GUG A;  2JEB I;  2KOL A;  4AQY L;  4A3J G;  2CWA A;  4C3I B;  4IPG A;  5IGD A;  2F3I A;  5EPK A;  1UNS A;  4ZUI A;  1PVO A;  1NAP A;  1HZA A;  1SYB A;  3RD4 A;  5IT9 E;  1FJG L;  2QEX A;  4BY7 B;  1S5E D;  1D1K A;  4IFD I;  4DV4 Q;  3PF4 A;  1IW7 D;  4I7A A;  4B3T Q;  2HDM A;  2V1C C;  4FNF A;  3DWQ A;  4K6D A;  2EJF C;  1ET9 A;  4JBJ A;  5KGU A;  4LW1 A;  3BZK A;  4UY8 C;  3AQQ A;  1ASZ A;  3NPP A;  4HCS A;  5M3M B;  1N8R C;  5K5P A;  4OX9 Q;  2HDL A;  2ZTD A;  5IYD G;  1E0B A;  5JAV A;  1XX8 A;  3CW2 C;  1Y8O B;  4LF6 Q;  1YNJ C;  1DJR D;  3CME A;  4G7O C;  4R4T A;  2B2T A;  1YJW A;  1BVS A;  3GTG H;  2B8G A;  2CW0 C;  4X3T A;  4X6A H;  2ENB A;  5IP7 H;  4PZ6 A;  3OPO A;  2C35 B;  4H13 C;  1SE3 A;  1HNZ L;  5G3L F;  2PMZ E;  1F2M A;  2A6H D;  1TS3 A;  2JA7 G;  1ZKO A;  1KNA A;  1PA6 A;  4ALP A;  3RNU A;  1WTR A;  1IBK Q;  4DV1 Q;  1JC7 A;  5IYB H;  4K5W A;  1D7Q A;  1SBB B;  3W1G A;  1PH1 A;  1JJC B;  1UAP A;  4C2M B;  2CH4 A;  1H9M A;  2QGQ A;  5IY0 A;  3CC7 A;  2UXB L;  2E76 C;  1M8A A;  1EEF D;  2VQF L;  1UEA B;  2K6A A;  4KLK A;  1BCP D;  3S2D H;  1I50 B;  2RSO A;  5JVH 3;  2JA7 H;  4IUV A;  3I4N G;  4K2K A;  2KED A;  3HKZ G;  4XT1 B;  3PO3 B;  1HXY D;  2Q2I A;  5KNC A;  4CKE A;  4AYB B;  3S14 B;  3KF8 B;  1TWF B;  2R7Z H;  2QF7 A;  1WCM B;  4LUZ A;  2D9U A;  5T1I A;  3SK6 A;  4JI0 Q;  1VQD A;  4CDC C;  4DR7 L;  1K8G A;  5DNF A;  4C3H B;  4DFA A;  1LTA D;  4FVM A;  1CHP D;  4O1N A;  3PSI A;  1EIF A;  4GKJ Q;  4HJ8 A;  1PTO C;  1LT3 D;  2JA6 B;  4DV1 L;  2C5C A;  3A54 A;  2NVQ H;  4IPD A;  4LUV A;  4GOP A;  3SDZ A;  1VS0 A;  3E9I A;  3G48 A;  1Y1V G;  1GUS A;  1UWV A;  5IOC A;  4J6H A;  1V1Q A;  1W6J A;  2PCF B;  2TMP A;  1AH9 A;  1GHJ A;  4QIW E;  4BA1 I;  1EY0 A;  1F9S A;  3L9A X;  3O13 A;  1J6Q A;  3FKI H;  1K0S A;  3ZYY X;  2F0M A;  4HIO A;  5GAG C;  2M2L A;  4FXK C;  2AWN A;  1H9J A;  4POF A;  1BDO A;  1TWH H;  4B3T L;  2EQS A;  3NTK A;  1CA6 A;  4HR7 B;  2N3S A;  3A8J E;  3LNN A;  1B50 A;  5C3E G;  4HSV A;  1N32 Q;  2HQE A;  3SK4 A;  5A2Q E;  1DCZ A;  2CW0 D;  3TS2 A;  1R4Q B;  2UUA Q;  1Y1V H;  1F77 A;  2L12 A;  1IXR A;  2F0E A;  1SND A;  5IGF A;  2L5T A;  1D8L A;  5FLX E;  4RMF A;  4A3I B;  1WTX A;  4UP8 A;  2HIX A;  3KLS A;  1K0R A;  1B9N A;  4OHJ A;  4P75 A;  2KEE A;  4H7B A;  5M3F G;  1J9O A;  2XGT A;  2PW7 A;  2Z8L A;  1PFN A;  2JA6 H;  5JEA G;  2X6G A;  1FD7 D;  3RLO A;  4A3F G;  3BZD B;  3U4Z A;  5EBC A;  4EGV A;  2Z6K C;  4DUZ Q;  4OO1 I;  4GLA C;  1A63 A;  3A8I E;  2A6E C;  3GTO H;  4K0K Q;  5DM7 3;  2F0P A;  2E2H H;  3C46 A;  1LAB A;  4GOP B;  1SXT A;  3TEH B;  2XWJ B;  5J39 A;  3T1H L;  3TBI B;  2MJ8 A;  4LAA A;  2QKI C;  4WJW A;  5IYB G;  4DXG A;  1VQM A;  3FKI G;  1D2B A;  3CRL C;  1I6H H;  1BCP B;  2F0J A;  3SR1 A;  5KND A;  3L2P A;  2PNR C;  1T5E A;  2JJQ A;  4RFB A;  1ILQ A;  3J81 j;  2CQO A;  3DEP A;  4P73 A;  1A2U A;  5CR3 A;  2NVQ B;  1Y1V B;  3EFX D;  1M1K C;  1X56 A;  4TVA B;  1JIC A;  1O7Z A;  4XDX A;  5C4H A;  4NW2 A;  4GNX A;  1PHJ A;  4JI7 Q;  2PZT A;  1ML0 D;  3PUX A;  1X55 A;  5IYC G;  1CM9 A;  2AUK A;  2L55 A;  2A68 C;  4JI8 L;  1VMC A;  5K36 G;  1G91 A;  4HAE A;  2NZ1 D;  4IJH A;  4JI1 Q;  1GUT A;  2RDH A;  1SDF A;  2ES2 A;  1HR0 Q;  2E2I B;  2HT1 A;  4PMB A;  3R93 A;  4A3C H;  5ELD A;  3HOV B;  2J4X A;  1OXX K;  4DA2 A;  4A3G H;  2BH2 A;  2ZJP A;  2PQA B;  3EJI A;  2IW3 A;  2ZTC A;  5C0X J;  1WD1 A;  4C1N K;  1B8A A;  2VW9 A;  3I4N B;  1X3F A;  2KQ3 A;  1TS5 A;  1K8A C;  4XYQ A;  1YZ6 A;  1MIU A;  2HIV A;  5M5X B;  4PMC A;  3K0X A;  2Z4I A;  2NUC A;  3K6O A;  4DPG A;  5FOB B;  1WJJ A;  1K83 H;  2ZM6 Q;  4HSP A;  2WII B;  3I7F A;  4QGU A;  2MNA A;  1IBK L;  3S2H B;  3BDL A;  4UDU C;  3V05 A;  3GP7 A;  1TII D;  2A6H C;  5JVG 3;  4Q0F A;  5HUR A;  4A3F H;  4KKT A;  1PH6 A;  4N8F A;  4CGY B;  1P16 A;  1GXD C;  4ZUJ A;  1WFQ A;  1B53 A;  3Q8D A;  2ZJR A;  3B6Y A;  3GTJ H;  1XMQ Q;  3I73 A;  4MIU A;  4ZKB B;  1Y69 U;  2AQ2 B;  3A0J A;  2RSN A;  3GTM B;  2R3Z A;  4HCE A;  3HOZ H;  2FMC A;  1VQA A;  3ICE A;  4G4K A;  3MXU A;  5M3M G;  1F9R A;  4OEL B;  1STN A;  4IQZ A;  1SLJ A;  2NVY B;  2UXB Q;  3W3A A;  3CCR A;  4Q5V A;  2R93 H;  1AE3 A;  2HQL A;  3MEF A;  2NVX H;  4ZQ3 A;  3TME A;  5IIF A;  4L5R C;  3HOY B;  2AUJ D;  1OXT A;  4BWG B;  1J5E Q;  5F2D A;  1Q82 C;  4MTN A;  4JI2 Q;  4F7X A;  1YIJ A;  4DR1 L;  4AQY Q;  2EJM A;  5C0X G;  1O7I A;  2AWO A;  3BU2 A;  1VDZ A;  2Q2H A;  1Z9F A;  2N78 A;  4C3I G;  1EEI D;  1YHQ A;  4NP5 A;  4A3J B;  4EVO A;  2VQF Q;  4CDD C;  1PH3 A;  1O7Y A;  4X3K A;  3GTG B;  2XTI A;  1B4O A;  3T1Y L;  1WTH A;  3HOZ G;  5ELO A;  1G51 A;  1KHI A;  2OT2 A;  1N36 Q;  4E6I A;  1QIL A;  1G6Z A;  1VQI A;  4JBM A;  4DV7 Q;  3I4M G;  3R3O A;  1BNZ A;  1B2T A;  3J80 L;  3CXC A;  4GKK L;  1VQ7 A;  4G7Z C;  4A3D H;  4JYA L;  2UXC Q;  5FO9 B;  2K50 A;  2MGS A;  4GN5 A;  1QB5 D;  1GHK A;  2JN4 A;  3HOZ B;  3OHX C;  1EQV A;  1A0I A;  1EYC A;  2K32 A;  1BBX C;  3KK7 A;  5IYC H;  3CPW A;  2EY6 A;  2VQE L;  3RR5 A;  4AIM A;  4CDF C;  2YU9 H;  1HFN A;  3F8T A;  1HNZ Q;  1G2S A;  2VL6 A;  1XNQ L;  1SYD A;  2A5H A;  1V8Q A;  1C9O A;  4YCU A;  3MVV A;  3NHH A;  3EN2 A;  4XXE A;  1WI5 A;  2OQ0 A;  3AFP A;  2PI2 E;  2OCE A;  3RZD B;  3MC0 B;  4UHV A;  2Q8I B;  5C44 G;  1EU4 A;  2UU9 L;  1DOM A;  2I07 B;  3H09 A;  4POG A;  3T51 B;  1H9S A;  2J0T D;  1YI2 A;  5KRU A;  2Y0S G;  1KRT A;  3J81 L;  3CCU A;  1PYS B;  1RHP A;  1Q7Y C;  1TKW B;  1LTI D;  2G9D A;  3STB C;  1VQG A;  4DUZ L;  1FVI A;  5BR8 Q;  1CFM A;  1JCK B;  1I94 L;  3RUZ A;  3E0E A;  3VR4 A;  5D14 A;  2UXD Q;  2PI2 A;  2L0C A;  4XQN A;  5JEA J;  1XMO Q;  3L3O C;  2JXM B;  2KHJ A;  2BOS A;  3RN2 A;  1TWC B;  3H3V H;  1IBL L;  5JPM C;  4EQ5 A;  4K2L A;  2K52 A;  4APV A;  1NR2 A;  3A7A B;  1JWS D;  2PNH A;  2IT1 A;  2R61 A;  2AKW B;  3M85 A;  4ILW A;  2NZO A;  3Q23 A;  1JR0 D;  5M9O A;  3P7J A;  4L5T A;  5GRO A;  1CHQ D;  2F0I A;  4JK1 C;  4A3B G;  4X64 L;  1HNW Q;  2VB3 X;  5DLQ E;  2DGY A;  1TY2 A;  1PZJ D;  3CHB D;  1Y14 B;  4DAV A;  1STE A;  5E3F A;  3NWT A;  2A69 C;  3V96 A;  4OON A;  2SNM A;  4JI5 Q;  4JV5 Q;  4JVZ A;  1N34 Q;  5FJ8 G;  1EQQ A;  2LXK A;  2DY7 A;  2ZXR A;  3D4D A;  3NE5 B;  1PRT B;  1QCB D;  2IJ0 A;  4OX9 L;  4IPC A;  4YWL A;  2VUM B;  3PCO B;  5KNB A;  1XXG A;  4YHH Q;  3M4O B;  3RZO H;  3CRK C;  5LMU Q;  3A56 A;  4JI6 L;  2EXD A;  2F0F A;  4RGT A;  4TRD A;  1YEZ A;  3I4O A;  1A15 A;  3GTM H;  1MSG A;  2L15 A;  2WAQ B;  2UUC L;  3PV0 A;  4A3I H;  4LF4 Q;  3S16 B;  1F2L A;  1MSH A;  4DNI A;  2YTX A;  2OXP A;  4OL7 A;  2SNS A;  1GM5 A;  4GKJ L;  3S1R B;  4F88 A;  4JI3 Q;  2HHH Q;  4KHP L;  4A3M H;  1Z47 A;  1DZ1 A;  5HY6 A;  2HD3 A;  2L9H A;  2RHQ B;  4IAL A;  1KLG D;  4UAI A;  1ESF A;  3GQB A;  1Q90 A;  3MTS A;  4DK1 A;  1C48 A;  3HEJ A;  1CKN A;  2EY1 A;  4DR4 Q;  1LT4 D;  3BS1 A;  1L1O A;  4ZLT F;  2XRQ D;  2F0U A;  1HHV A;  3KYH C;  4KHV A;  5DEH A;  3NBH A;  5M3M H;  3E6Z X;  2ICI A;  2O4X A;  1EYA A;  1DOL A;  1STA A;  4HMJ A;  1UEB A;  1TY0 A;  2UU9 Q;  1Q8I A;  3NUC A;  5G3L D;  1ZXT A;  2DUD A;  3H0G B;  1ET6 A;  1X3P A;  2K5W A;  3H15 A;  1XMO L;  1V1P B;  2PZU A;  2EYH A;  3NP8 A;  4XTC S;  3KF8 A;  2WFW A;  2E2D C;  5I2X A;  1B3Q A;  3DHQ A;  1TU2 B;  4FXD A;  3IL8 A;  2PMZ B;  5BR8 L;  2ZXP A;  1NUC A;  4PMW A;  4ID6 A;  4CKB A;  4LFC L;  3OIQ A;  1RTN A;  4NDX A;  3I55 A;  2HCI A;  5CV4 A;  1IBM L;  4DXF A;  1I3Q H;  4C3J B;  1JMC A;  1YHA A;  5ELN A;  1SYC A;  3DMU A;  3KJO A;  1LO5 D;  4RHS A;  4DV3 L;  3ULJ A;  1EY7 A;  1XPR A;  4FXG C;  5EPJ A;  4N9P A;  2K5D A;  4BBS G;  5AJ3 Q;  4A3B H;  4KV6 A;  1BF4 A;  1F9P A;  4KJO A;  1K28 A;  1PFS A;  1RDP D;  3H6M A;  2L4N A;  4IJL A;  2JA8 G;  2O5J C;  2P5Z X;  4ZKC B;  1JJG A;  1I50 H;  3EIV A;  1SYG A;  3JC6 6;  3D6W A;  3MEH A;  4RCO A;  4QY7 A;  1TWG H;  2D0O A;  1CUK A;  4DNT B;  3ND9 A;  2QEJ C;  5M3F B;  1FNV A;  1VQE A;  1EYG A;  1VQF A;  1YBY A;  4OO1 H;  3PUY A;  4IUR A;  4Z9C B;  2B2W A;  4A3I G;  4YCV A;  4DV5 Q;  2A73 B;  2Z4H A;  2EJG C;  2K5N A;  1YVC A;  4QUF A;  2DJF C;  1FR3 A;  1U4R A;  1EY8 A;  2M9V A;  4IOA A;  2AQ1 B;  1PRT D;  4LJZ C;  5JJL A;  3CAM A;  1JB3 A;  3N52 A;  4H02 A;  5IGG A;  1DON A;  1UE1 A;  4K8J A;  1WTV A;  2R93 G;  2QA4 A;  2CFM A;  2NB0 A;  3JAM E;  1PXU A;  2NN6 I;  5KYI A;  1E24 A;  4DR3 L;  3H3V I;  1QE6 A;  1V1P A;  1PYW D;  5DAU A;  2XSC A;  4A3B B;  4K14 A;  3F2B A;  1IYU A;  2FHT A;  3NEM A;  3PUW A;  2CKZ B;  1DYQ A;  4L6T B;  2VQE Q;  4KY7 A;  1ILP A;  2A19 A;  3EVQ A;  4WFN 3;  2F03 A;  5FK9 C;  1YNN D;  3K5M A;  2EZV A;  1SMY D;  1U4P A;  4JOI C;  1FGB D;  4KTA A;  3Q6S A;  1ENC A;  2EYM A;  4DR5 Q;  4MTK A;  1BCP C;  1CKN B;  1M4V A;  5NUC A;  1Q1B A;  4C3H G;  2E8G A;  1CI3 M;  1OXV A;  3PIP A;  1GVP A;  1YNN C;  2H5X A;  1JWM D;  3CCJ A;  3T1Y Q;  3S16 H;  1PMR A;  1WCM G;  4I7Z C;  1F2Z A;  1VCI A;  5EJW A;  3HOY H;  1N36 L;  3K7U C;  1EWI A;  1SN8 A;  4RKL A;  3T53 B;  3TP6 A;  3J7A V;  1SRO A;  2RCN A;  1KLU D;  1PTO F;  4XT3 B;  2NN6 G;  3ER0 A;  4DK3 C;  3U9S A;  1EZ8 A;  2QW7 A;  4RHR A;  4LNQ A;  3CF5 A;  4KY5 A;  2RA4 A;  2TSS A;  3CKI B;  2AMC B;  4KI0 A;  4ZRZ A;  3RMH A;  1PH7 A;  3SVM A;  5K36 H;  1LTL A;  1KNE A;  4DR2 Q;  1HR0 L;  2Q2U A;  1TWF H;  1MGS A;  2WB1 E;  2EYL A;  4H0L C;  3TDQ A;  2GA4 B;  2B39 A;  4DKA C;  5KYL A;  1J5E L;  2YV5 A;  1WYD A;  2QDB A;  2B29 A;  4NKL A;  3I4M B;  2CWP A;  2A69 D;  5CBE E;  1HPC A;  2OEO A;  1NE3 A;  1ONL A;  3HP3 A;  1D5X C;  2BDN A;  5JJK A;  4PNY A;  2KUM A;  4O0A A;  4KK7 A;  3GTL H;  2MHV A;  1JOQ A;  1GD7 A;  3G6J B;  3QJY A;  3TZD A;  1QOH A;  3TP7 A;  1JE5 A;  2MUY A;  5H1S E;  1VQN A;  2YU9 B;  3NBI A;  2QIL A;  5BN5 A;  3QB3 A;  4HIK A;  1YNX A;  1HTL D;  3M4P A;  2Z0S A;  5LHY 1;  5CC4 A;  1Y8P B;  2MO0 A;  3WOE A;  4CBV A;  1HTP A;  5JJZ A;  4R4Q A;  4V0B A;  3MFG A;  1OTC A;  4RGO S;  4YWK A;  1STG A;  4DU9 A;  3ONA B;  3NTI A;  3G71 A;  1Q46 A;  4JV5 L;  2X69 A;  4IUP A;  1Y1W B;  2O2L D;  1STY A;  3C1F A;  3CCM A;  1Z6H A;  5IP9 G;  3P1H A;  4ZCK A;  2SEB D;  4HJ5 A;  3BZC A;  1E3P A;  3CQZ H;  2OF1 A;  1TWG B;  2PPB C;  1NNX A;  4X66 Q;  5LMN L;  1ICW A;  5EQ0 A;  4DR6 L;  2NTS A;  3I4N H;  5J22 A;  3X3N A;  1FNU A;  4CHT B;  1EOV A;  1TWC H;  5COR A;  1EY5 A;  1EQR A;  4DV5 L;  1HUM A;  5IGE A;  2Z1C A;  5M5X H;  3QWN A;  5BN4 A;  1HUN A;  5GAH C;  4R1J A;  2IY5 B;  1CZG A;  1L0Y B;  1A8V A;  4C1N I;  1PFM A;  1VQ6 A;  1HCZ A;  3KF6 A;  3I2Z A;  2V4D A;  2K28 A;  2Y0S E;  3QOL A;  4RGN A;  1O7L A;  1PTO H;  1VQJ A;  4U68 A;  4DV6 Q;  4P74 A;  3MFY A;  2N8N A;  3CC2 A;  4KN4 C;  1I4X A;  3DXJ C;  1I4G A;  5C0X H;  3FRP B;  4NPS A;  4YY3 Q;  2VNU D;  2KCC A;  4IFD J;  2VXW A;  3GV3 A;  1KIX A;  1PYB A;  4ODG A;  3C3L A;  3TRZ A;  3F1Z A;  3CU7 A;  2JE6 I;  2K5V A;  5HGQ A;  5FLX c;  3MXN B;  2B2V A;  4PZ7 A;  1W3S A;  3Q22 A;  1IKM A;  5IT9 c;  1MD2 D;  1LTT D;  5LMU L;  1BUV T;  1XPU A;  4Y52 H;  3CQZ B;  1W2B A;  3BYT B;  4KD4 A;  4A3L H;  3FPP A;  4OGQ C;  4TSS A;  2N49 A;  3TZU A;  4YCW A;  3TS0 A;  1PDQ A;  1AN8 A;  2B63 G;  4S3S A;  3BDC A;  2IWH A;  5CV7 A;  2A8V A;  3AMU A;  1CKO A;  5EKL A;  4YWM A;  1EOT A;  1VQ8 A;  3U9O A;  2XVS A;  1WD0 A;  4JI4 Q;  1Z7T A;  4LWC A;  2K04 A;  1D5M C;  3OW7 A;  1V1O A;  5FLM G;  3OTO L;  2JA5 H;  4V19 0;  5IOD A;  2MP1 A;  1XNR L;  3S17 B;  3OW2 A;  1K83 B;  2WP8 J;  1BO0 A;  1CKM A;  2NYZ D;  2JP1 A;  1L1O B;  2F4V Q;  4LF9 L;  2F3V A;  3K0Y A;  1A3T A;  4FF4 A;  1NY4 A;  2C9O A;  1CTM A;  1KDC A;  1TR5 A;  4BBR G;  1MBY A;  2B63 H;  1I4R A;  1XTC D;  4Y7N H;  2IL8 A;  1H9S B;  3URY A;  2K01 A;  1EIH A;  5I9O A;  1C0A A;  4BY1 B;  4C56 C;  1SEB D;  4DN4 M;  2BA0 A;  3EBE A;  4FYD A;  4LMQ D;  4HJ7 A;  2UUB Q;  3FPU B;  2LSS A;  3V2T A;  2RF4 A;  3FKI B;  1QVG A;  4YIJ A;  1LV9 A;  2F0H A;  3I4M H;  3BDO A;  3PIO 3;  4N8X 1;  2K14 A;  3MAQ A;  1Y8N B;  3BG3 A;  2KJX A;  3VYR A;  3HOX G;  1FL0 A;  3CC4 A;  3HOU B;  1X3G A;  4BBR H;  3A8K E;  3J7Y W;  4KD3 A;  3HG9 A;  4TKO B;  2BE5 D;  1NMG A;  3HS0 C;  5GAE C;  3CMA A;  4A3F B;  1HR0 W;  1LLR D;  3VA7 A;  1NJI C;  2JA8 H;  3LX0 A;  1HA6 A;  3NTH A;  3VR2 A;  3BJU A;  5FLX L;  1B44 D;  3PUV A;  1B7Y B;  3Q0A A;  1C8C A;  5IT9 L;  2JA9 A;  3RLF A;  5HGT A;  2EY5 A;  1Y1W H;  4HMI A;  4FF3 A;  4DAY A;  1Q8K A;  1DXM A;  3M7G A;  2ZT9 C;  2VS1 A;  3GTP H;  1VMP A;  1WTQ A;  3DM1 A;  4EQN A;  1BCP F;  1QUQ B;  1U9R A;  1RCV D;  2F0L A;  2UUB L;  2B63 B;  4HIM A;  1UE7 A;  1FGU A;  4OWW B;  5C3E B;  3S1M B;  4NXN Q;  2R92 H;  4GNX C;  5M5Y H;  3CCV A;  2NVY H;  3SK5 A;  1LT5 D;  4QUC A;  5A35 A;  3NK9 A;  2LKV A;  4LF6 L;  4NXM Q;  1EFI D;  3WDN A;  3S1N H;  4DNR B;  1YNJ D;  1HH2 P;  2XNA C;  1IKL A;  1CQV A;  5JOB A;  5E7N A;  2JA5 B;  3S17 H;  3KDF A;  3ERO A;  1E1O A;  1O80 A;  3UI2 A;  4IN3 A;  1U4M A;  4KKU A;  4DR1 Q;  4O42 A;  3K7A H;  1HNX Q;  4A3J H;  2E2J H;  1PTO B;  5CV5 A;  3M4Y A;  3QG1 A;  3OTO Q;  1D6E C;  4HJ9 A;  4JI8 Q;  2CQA A;  2FIN B;  3LGJ A;  2EVB A;  3NBH B;  1SR3 A;  1JWU D;  1OO9 B;  1E2Z A;  2D2C C;  1K8O A;  3OYY A;  3ULP A;  4CJ0 B;  2BDO A;  5IP7 G;  2OTL A;  1LTS D;  2N55 A;  4LFB L;  1G2T A;  4CDE C;  3MXN A;  5ISR A;  4LFC Q;  4QL5 A;  1LUZ A;  4L63 B;  3J7A F;  4LF9 Q;  2B2Y C;  4DV3 Q;  1PH2 A;  1X65 A;  2NVT H;  1GJX A;  3D4R A;  1XMQ L;  1ROD A;  2R7Z G;  4A3G B;  4AYB G;  4DV2 L;  3H3V C;  1C4Q A;  2WKD A;  4A4I A;  2MO1 A;  1SNO A;  4A75 A;  4FF2 A;  2B2W C;  5C3E H;  4DUY Q;  2RVL A;  3HOU H;  3PO3 G;  2IX3 A;  2R92 B;  2I5M X;  1MKH A;  1JOK A;  3VR5 A;  3FEW X;  1QJO A;  2PQE A;  1A3V A;  1CSP A;  3KLR A;  4OWT B;  1CQF A;  5J1Z A;  4IUU A;  5CV6 A;  2FMM A;  3D6C A;  5JEA H;  1KC8 C;  2IX1 A;  3J80 c;  2ZM6 L;  4QIW B;  3M3Y B;  1ICF B;  1ZEQ X;  1IL8 A;  4DV4 L;  5C3W A;  1CK1 A;  4G57 A;  4MHE A;  4DR4 L;  1KDA A;  4JG2 A;  1IBM Q;  1CZW A;  1B3A A;  1AEX A;  4JW0 A;  3OMG A;  2ZJQ A;  2E2J B;  1W6K A;  3KUP A;  3UDG A;  3GTP B;  1WVL A;  2EXZ A;  1FYC A;  4O2D A;  1JJ2 A;  4JI7 L;  3X3M A;  1R9T H;  1J8I A;  2EOT A;  4HN7 A;  1SJH D;  3S1M H;  3TP5 A;  5EGT A;  1II3 A;  1L0W A;  4OEM B;  5KEE A;  4IZ8 A;  2XRS D;  2GVB A;  3QR8 A;  3M4O H;  1X3E A;  5C4X B;  4JI6 Q;  3GTL B;  3J81 c;  2KEC A;  4DV0 Q;  4LFA Q;  3K5L A;  1EFW A;  1IHZ A;  1TVX A;  4IFD H;  4RCN A;  2PZW A;  2HUG A;  1LM0 A;  2NZH A;  3VA5 A;  4RGM A;  4EQP A;  1HRJ A;  5JPN C;  4JI1 L;  2WAC A;  1VQ4 A;  4X3S A;  2R7D A;  3QIA A;  4QMG A;  4DAY B;  4BY7 G;  4GOP C;  2B8F A;  4DUY L;  2F0N A;  3G7L A;  1N34 L;  3JAM L;  2F0K A;  2O5I C;  1NTG A;  4A3E B;  2F0W A;  5CGK A;  1QNK A;  2R92 G;  4X65 Q;  3HOX H;  3S14 H;  1PRT C;  4GKK Q;  4X65 L;  4N9T A;  4A3G G;  2R7Z B;  1XPO A;  3PMF A;  4YHH L;  2F52 A;  3SHL A;  1SE8 A;  4K8I A;  5DM6 3;  3H0G H;  1PH4 A;  1K73 C;  4KJN A;  3P20 A;  3UDF A;  1PLF A;  3J80 E;  1CA5 A;  3ULL A;  1MI2 A;  2DNE A;  4IPH A;  4R4C A;  4FDB A;  4FO2 A;  2IHF A;  2NTT A;  2WKC A;  3PF5 A;  1HQM C;  4PZ8 A;  2PQA A;  1GUN A;  3KJP A;  1H9K A;  3S15 B;  3T13 A;  1B70 B;  2OTJ A;  1IW7 C;  2WAQ E;  1XNQ Q;  5TSS A;  2JA5 G;  1A62 A;  4FP5 D;  5CBA E;  3N6R A;  2EE1 A;  2KCM A;  4XQJ A;  2VB2 X;  1RJT A;  1KQS A;  5I6W A;  2UUA L;  4LF5 Q;  4HED A;  3BYY B;  2GVA A;  3UDX A;  1X54 A;  2BE5 C;  1C7Y A;  3M7N A;  4A3K B;  3KOJ A;  4DR5 L;  5JJI A;  5M3F H;  1OXU A;  2EY2 A;  3LWE A;  5CYU A;  1WTP A;  4I65 A;  2KCT A;  4A93 H;  1EIG A;  1RTO A;  2F0O A;  1SNM A;  4K5V A;  3MHB A;  1AZP A;  5CV9 A;  2LY7 A;  5LL6 X;  3CCL A;  5IWA Q;  3OSO A;  3SXH A;  1DD2 A;  5T1G A;  4BXX H;  2DY8 A;  2JK8 A;  3S24 A;  5BN3 A;  1X3Q A;  4DV2 Q;  1IYV A;  2B2U C;  1FNW A;  4IUQ A;  3S9W A;  5C44 H;  2WB1 G;  4GN4 B;  1VQ9 A;  3K58 A;  4BA2 I;  1HNW L;  2Z6B A;  1QZG A;  3IFT A;  1K9M C;  3S15 H;  4QF4 A;  3OMC A;  1VQB A;  4R4O A;  1I4Q A;  4C2M H;  2VY3 A;  5IE8 A;  4IUN A;  3HOX B;  3A5Z B;  4TQU S;  2RDF A;  4ZYS A;  3KFU A;  1AP0 A;  4DK0 A;  1HNX L;  4OIK A;  1X9N A;  2VZA A;  3CCS A;  1SJE D;  1AW7 A;  2WV6 D;  3IAY A;  1I6H B;  3KDF B;  3IFD A;  1KAA A;  1G29 1;  2YYZ A;  4DR7 Q;  2EDG A;  4DR2 L;  5C5M A;  3AB9 A;  3HFZ B;  4JC0 A;  4QJF A;  4R4I A;  3AEV A;  1T9H A;  3K80 C;  1QZH A;  3PIP 3;  4A93 B;  4F8M A;  5I2Y A;  3PUZ A;  2KCN A;  1E22 A;  3E5S A;  5IYD H;  2KEN A;  2L11 A;  4ABN A;  5AJ3 L;  1SFO H;  3KF6 B;  1BOS A;  1K8M A;  2EYO A;  1RIP A;  2FXQ A;  3D4W A;  3FVQ A;  4QQB X;  3D0F A;  2DNC A;  2F1M A;  4B3R L;  2LS0 1;  4EQO A;  4B3M Q;  3I72 A;  2B2V C;  2ATW A;  4XYO A;  3SEB A;  4B3S Q;  3BVZ A;  1X32 A;  2E75 C;  2G9H D;  2F0D A;  3RN5 A;  3TRE A;  1LTR D;  1PH5 A;  1EUJ A;  1Q12 A;  2N88 A;  4ULL A;  2KHS A;  2HCC A;  1XWE A;  2FFK B;  3R2T A;  2Q8R E;  2F0T A;  1OXS C;  3U4V A;  3PQI A;  1PH9 A;  1EY9 A;  1JB7 A;  2JYO A;  5I6Y A;  4M8A A;  2LMC B;  4A93 G;  5E4W C;  3H94 A;  3WWV A;  4QCL A;  4DAM A;  4YY3 L;  4JBK A;  3HRZ C;  2K33 A;  2RDG A;  1PV4 A;  3BVG A;  4R9W A;  2WIN B;  5C5L A;  3GTQ B;  2VUM G;  3PO2 H;  5C4Z A;  2AHO B;  1L2F A;  2DJG C;  1AFP A;  3MZ5 A;  4GLV B;  1I5F A;  1CSQ A;  3GDE A;  2F3W A;  1FJG Q;  5COY A;  3CD6 A;  5M5W B;  4AYB E;  3HOW G;  1TXY A;  2GN5 A;  1K3B C;  3H91 A;  1S5D D;  1KD1 C;  2RCF A;  5D65 A;  1NBW A;  1TWA H;  1VF7 A;  2B3G A;  3FMC A;  4B08 A;  3W5O A;  1VQH A;  2AQ3 B;  3A74 A;  2B2Y A;  1STH A;  4RAU C;  2FJ2 A;  1P8L A;  2K5Q A;  3K81 C;  2K7V A;  1YJ9 A;  1S5F D;  2WB1 B;  3P75 A;  2NVT B;  1SE4 A;  4A3M G;  1IL2 A;  2IPK D;  3I90 A;  2H4O A;  2RBM A;  3I8Z A;  3R8B A;  5IGC A;  1STB A;  4G7H C;  2JEA I;  3E3X A;  2NBF A;  1HZ9 A;  5EPL A;  5A2Q L;  1EU3 A;  3CPF A;  1GOZ A;  2Q8T A;  4JI4 L;  1SNC A;  1O78 A;  3R2I A;  1Y1W G;  4R8I A;  2MFI A;  3DEO A;  1V9P A;  3VYS A;  5GQO A;  2HHH L;  5EKI A;  2CVR A;  3GTQ H;  1AZQ A;  1HQR D;  3G6E A;  2BCO A;  3GV6 A;  1H95 A;  3QO2 A;  1RL2 A;  1K3R A;  4IOC A;  1EWH A;  1Q86 C;  3NEN A;  2I5H A;  4H44 C;  3IRB A;  4DF7 A;  4WJ4 A;  2E2H B;  2SOB A;  1LTB D;  4Y7N B;  4P2C B;  4ME5 A;  1KL9 A;  2EYP A;  4RG1 A;  4MNO A;  1ZYR D;  2K1B A;  3J7Z C;  5E4X A;  4KKS A;  4KHP Q;  3J81 E;  4IFD G;  1I94 Q;  1TQO A;  1MJE A;  3K57 A;  5C4X H;  2UUC Q;  2QCP X;  3CP0 A;  1SAP A;  3MWY W;  4JI0 L;  2X6L A;  2F0V A;  3L0O A;  1D5Z C;  4A3D B;  4DAP A;  1S72 A;  2K75 A;  4UP9 A;  3PO2 B;  1IZ6 A;  2IHE A;  1BXT A;  1ENF A;  3KLW A;  4DGZ A;  1U5K A;  4IUT A;  2OQK A;  1TS2 A;  1I6V C;  1TT2 A;  4NXM L;  2PO4 A;  4JPB W;  3J81 i;  1JQY D;  1F9Q A;  1LTG D;  4P72 A;  5I9P A;  3I56 A;  2ASB A;  5EBD A;  3A55 A;  3U50 C;  4A3C G;  2M00 A;  1TS4 A;  3E0J A;  2XWB B;  4JI5 L;  3Q24 A;  1IYJ B;  4JOI A;  4L5Q A;  2A74 C;  4OXP A;  3K5O A;  2ICE C;  1WTW A;  4JI3 L;  2K4K A;  3OWE B;  4A3E G;  1T5X D;  4K5X A;  4CKC A;  2D62 A;  4LF8 L;  4J1M A;  1Q81 C;  1QNU A;  1HFG A;  3NSW A;  3HKZ E;  1PFB A;  1EYD A;  2A1A A;  2RHS B;  1WTO A;  2I0Q A;  4L5S A;  3MXG A;  3DWP A;  3FDT A;  3HOY G;  5D3D A;  3A5U A;  4UP7 A;  3LWU A;  3GO5 A;  1CT1 D;  4GS3 A;  5L37 A;  5D3I B;  1D1I A;  4B9X A;  4CJ1 B;  4LFB Q;  3M4Q A;  2XIW A; 
#chains in the Genus database with same CATH homology
 2I5M X;  1G6P A;  5AJ3 Q;  4A3B H;  1AH9 A;  4QIW E;  1MKH A;  4BA1 I;  4A3D G;  1PFS A;  1MJC A;  2JA8 G;  4IJL A;  1J6Q A;  3FKI H;  1SMX A;  1ASY A;  4HIO A;  1CSP A;  5GAG C;  4OWT B;  1JJG A;  2K5H A;  1X6O A;  1I50 H;  2AWN A;  5C4X G;  3EIV A;  2I5L X;  3JC6 6;  4DK6 C;  4POF A;  3J80 c;  2ZM6 L;  4DR3 Q;  1KC8 C;  1TWH H;  4B3T L;  2IX1 A;  4DV0 L;  2EQS A;  2N3S A;  4QY7 A;  1TWG H;  2D0O A;  5C3E G;  1CUK A;  2Q2T A;  1S40 A;  4EX5 A;  1N32 Q;  4DV4 L;  1E7Z A;  1VQE A;  1EYG A;  1VQF A;  1YBY A;  4JG2 A;  1IBM Q;  4DR4 L;  3TS2 A;  2UUA Q;  1Y1V H;  1VQP A;  2JQO A;  3PUY A;  4OWX B;  4B3R Q;  1IXR A;  4A3I G;  2ZJQ A;  3UDG A;  5M5W H;  4YCV A;  4JI2 L;  1D8L A;  4RMF A;  1E1T A;  4DV5 Q;  3GD7 A;  3PGZ A;  4UP8 A;  2HIX A;  4O2D A;  2K5N A;  1K0R A;  1YVC A;  1L1O C;  4LUO A;  1R9T H;  1JJ2 A;  4JI7 L;  4P75 A;  3FHW A;  2IX0 A;  4LF7 Q;  5M3F G;  3S1M H;  4X62 L;  4IOA A;  2XGT A;  1L0W A;  3NEL A;  5JJL A;  2GVB A;  2JA6 H;  5JEA G;  5FLM H;  3M4O H;  1X3E A;  3CAM A;  2UXD L;  4H02 A;  3RLO A;  4JI6 Q;  4A3F G;  4OO1 I;  3U4Z A;  4DUZ Q;  1A63 A;  2Z6K C;  4JYA Q;  4GLA C;  3J81 c;  2UXC L;  1UE1 A;  4B3S L;  4DV0 Q;  4LFA Q;  1EFW A;  3HOV H;  3GTO H;  2F4V L;  2R93 G;  2QA4 A;  4K0K Q;  2CFM A;  1UE6 A;  1N9W A;  2R6G A;  3F2D A;  2E2H H;  2MQH A;  2NN6 I;  2E5L Q;  1E24 A;  4DR3 L;  4GOP B;  3H3V I;  1GKH A;  1LM0 A;  2NZH A;  3S1R H;  3JAM i;  1HZC A;  1KRS A;  3TEH B;  4JI1 L;  1WCM H;  3F2B A;  1VQ4 A;  3NEM A;  3T1H L;  3PUW A;  3UDI A;  5IWA L;  3F2C A;  1WOC A;  4JCV E;  2CKZ B;  1S3O A;  5IP9 H;  2VQE Q;  2R7D A;  4C3H H;  4DAY B;  1QVC A;  2A19 A;  3AFQ A;  5IYB G;  4BY7 G;  1JT8 A;  3HOV G;  1DGS A;  4GOP C;  1VQM A;  1KAW A;  3FKI G;  4DUY L;  1I6H H;  3L2P A;  1N34 L;  2ZTE A;  1NTG A;  4PG3 A;  2JJQ A;  3J81 j;  4GLX A;  2CQO A;  1XTD A;  2R92 G;  4JOI C;  4P73 A;  4X65 Q;  1XJV A;  4B3M L;  3HOX H;  4DV7 L;  3S14 H;  4UPA A;  2D0P A;  4GKK Q;  4X65 L;  4A3G G;  4DR5 Q;  1CKN B;  1Q1B A;  1M1K C;  1XPO A;  1X56 A;  2E8G A;  4YHH L;  1OXV A;  3PIP A;  2F52 A;  4TVA B;  4X62 Q;  1GVP A;  1SE8 A;  2H5X A;  3D31 A;  3CCJ A;  3T1Y Q;  1GO3 E;  4LF7 L;  3S16 H;  1WCM G;  4P71 A;  1PH8 A;  3H0G H;  4GNX A;  1PHJ A;  1VCI A;  4JI7 Q;  1PH4 A;  3HOY H;  1N36 L;  1K73 C;  3K7U C;  1EWI A;  1SN8 A;  3UDF A;  1VQO A;  3PUX A;  3CCE A;  1QUQ A;  3ULL A;  1SRO A;  2RCN A;  1X55 A;  5IYC G;  3U58 A;  4IPH A;  2KHI A;  4JI8 L;  5K36 G;  4R4C A;  4FDB A;  2NN6 G;  3ER0 A;  2IHF A;  4IJH A;  4JI1 Q;  4DK3 C;  2ES2 A;  1HR0 Q;  2HT1 A;  3H0G G;  4GNX B;  5J3B A;  4A3C H;  3PF5 A;  2BA1 A;  4PZ8 A;  4LNQ A;  4C3J H;  2PQA A;  3L7Z C;  3CF5 A;  1EIY B;  3KJP A;  1XNR Q;  1OXX K;  5EAY A;  2AMC B;  4KI0 A;  4C3I H;  1PH7 A;  4A3G H;  1LTL A;  4WJ3 M;  1B70 B;  2BH2 A;  2OTJ A;  2ZJP A;  3SGI A;  4DR2 Q;  2PQA B;  1HR0 L;  2Q2U A;  1TWF H;  2WAQ E;  1XNQ Q;  2WB1 E;  2ZTC A;  5C0X J;  2JA5 G;  1A62 A;  1B8A A;  4XIG S;  4DKA C;  2VW9 A;  1J5E L;  4NXN L;  4HID A;  1X3F A;  2YV5 A;  1WYD A;  1M90 C;  1K8A C;  2KCM A;  2B29 A;  1YZ6 A;  1MIU A;  2HIV A;  4BY7 H;  4OO1 G;  1KQS A;  2CWP A;  3STB D;  4HJA A;  2UUA L;  4LF5 Q;  4JBW A;  3M3Y H;  1NE3 A;  3K0X A;  2GVA A;  3UDX A;  1X54 A;  4DPG A;  1C7Y A;  5JJK A;  3M7N A;  1WJJ A;  1K83 H;  3KOJ A;  4DR5 L;  4O0A A;  5JJI A;  2ZM6 Q;  5M3F H;  3GTK H;  1OXU A;  3I7F A;  3W1B A;  4QGU A;  3GTL H;  4A3L G;  2MNA A;  1IBK L;  2KCT A;  1GD7 A;  4A93 H;  1JE5 A;  2WAQ G;  5H1S E;  1VQN A;  4LF5 L;  3K8A A;  5C4J H;  4HIK A;  3E9H A;  1YNX A;  4A3F H;  3M4P A;  1PH6 A;  1Q1E A;  2Z0S A;  5IWA Q;  2BH8 A;  3CCL A;  1N33 Q;  2OWO A;  3HOU G;  2MO0 A;  1P16 A;  4BXX H;  1WFQ A;  2JK8 A;  2ID0 A;  5GAD C;  3S24 A;  2CCZ A;  4BY1 H;  3Q8D A;  2ZJR A;  3B6Y A;  4AH6 A;  3CCQ A;  4R4Q A;  3GTJ H;  4DV2 Q;  1XMQ Q;  1OTC A;  5C44 H;  2WB1 G;  4YWK A;  4GN4 B;  1VQ9 A;  1VQL A;  3G71 A;  1Q46 A;  4JV5 L;  4BA2 I;  1HNW L;  1QVF A;  4DV6 L;  3A0J A;  1QZG A;  3CCM A;  1K9M C;  3VDY A;  4J15 A;  5IP9 G;  2EIF A;  2KBN A;  3S15 H;  4R4O A;  3BZC A;  1BBW A;  1E3P A;  1VQB A;  3CQZ H;  4X64 Q;  4C2M H;  4HJ5 A;  1HZB A;  2VY3 A;  3HOZ H;  4LFA L;  1BBU A;  1NMF A;  1VQA A;  4BY1 G;  5IE8 A;  5LMN W;  3ICE A;  1SRU A;  4X66 Q;  5LMN L;  4BBS H;  5M3M G;  3DLL A;  4LF8 Q;  4A76 A;  3A5Z B;  3HOW H;  1LYL A;  3RLN A;  2YTY A;  1SLJ A;  2UXB Q;  4DR6 L;  3CCR A;  3I4N H;  4TQU S;  1EOV A;  1AE3 A;  1TWC H;  3KFU A;  2HQL A;  2R93 H;  3M9B A;  3MEF A;  4KHZ A;  2NVX H;  1EQR A;  4DV5 L;  1HNX L;  1X9N A;  1U0L A;  2VZA A;  5M5X H;  4L5R C;  3CCS A;  3PIO A;  3T1H Q;  1OXT A;  2YTV A;  2Z6K A;  3KDF B;  5GAH C;  4R1J A;  3RZD H;  1J5E Q;  2IY5 B;  1Q82 C;  4MTN A;  4JI2 Q;  4A3E H;  2JA6 G;  1G29 1;  2YYZ A;  1A8V A;  1YIJ A;  2VUM H;  4DR7 Q;  4DR2 L;  1VQ6 A;  4NB3 A;  4DR1 L;  4AQY Q;  5C0X G;  1O7I A;  3HFZ B;  4JC0 A;  4QJF A;  4X66 L;  5LMN Q;  2AWO A;  3KF6 A;  4R4I A;  3BU2 A;  3AEV A;  3AYH B;  3I2Z A;  2Q2H A;  2E2I H;  1T9H A;  1Z9F A;  3K80 C;  1QZH A;  2N78 A;  2Y0S E;  1YHQ A;  3PUZ A;  2VQF Q;  1E22 A;  1VQJ A;  4ME3 A;  1PH3 A;  4DV6 Q;  4P74 A;  2N8N A;  5IYD H;  2KEN A;  3CC2 A;  3J80 i;  5AJ3 L;  2XTI A;  4A3K G;  4NPS A;  1SFO H;  3KF6 B;  4YY3 Q;  1RIP A;  2VNU D;  2FXQ A;  3T1Y L;  3HOZ G;  4IFD J;  4QQB X;  1KIX A;  1PYB A;  5ELO A;  1G51 A;  4LF4 L;  1KHI A;  3D0F A;  3F1Z A;  1N36 Q;  5HGQ A;  2JE6 I;  2K5V A;  5FLX c;  3TRZ A;  4MZ9 A;  1BKB A;  3MXN B;  4DR6 Q;  1VQI A;  4IO9 A;  1VQ5 A;  1N33 L;  1VQC A;  4JBM A;  1YHB A;  4DV7 Q;  3I4M G;  4PZ7 A;  2LXJ A;  4B3M Q;  4B3R L;  3S1Q H;  1W3S A;  4K0K L;  3UE0 A;  5IT9 c;  2ATW A;  3HKS A;  5LMU L;  4B3S Q;  3CXC A;  4GKK L;  1VQ7 A;  4A3D H;  4JYA L;  2UXC Q;  3PO3 G;  1XPU A;  4Y52 H;  2K50 A;  4GN5 A;  3ERS X;  1W2B A;  3RN5 A;  1N32 L;  3TRE A;  1PH5 A;  1A0I A;  4A3L H;  1EUJ A;  1Q12 A;  5IYC H;  1KXL A;  3CPW A;  3J7A 5;  1UE5 A;  3UE1 A;  2N49 A;  1V43 A;  2R7F A;  4YCW A;  3TS0 A;  3S2H H;  2VQE L;  1YJN A;  1AE2 A;  2B63 G;  3RR5 A;  4AIM A;  1OXS C;  3U4V A;  1PH9 A;  1VQK A;  2YU9 H;  1JB7 A;  3F8T A;  4GN3 B;  5FJ8 H;  1HNZ Q;  2A8V A;  3PO2 G;  2VL6 A;  1CKO A;  2ALY B;  1XNQ L;  3DM3 A;  1C9O A;  4YCU A;  3G4S A;  4A93 G;  3EN2 A;  4YWM A;  1WI5 A;  3WWV A;  1VQ8 A;  4DAM A;  2OQ0 A;  3AFP A;  2PI2 E;  4YY3 L;  4JBK A;  2OCE A;  5C0X I;  4JI4 Q;  3FP9 A;  4LWC A;  1PV4 A;  5C44 G;  5FLM G;  3JAM c;  3OTO L;  2UU9 L;  2JA5 H;  3ZJY C;  2VUM G;  1YIT A;  1XNR L;  3PO2 H;  3PO3 H;  3OW2 A;  2E5L L;  4POG A;  4A3K H;  3TQY A;  2AHO B;  2WP8 J;  1L2F A;  1CKM A;  1YI2 A;  4GLV B;  2Y0S G;  1KRT A;  1I5F A;  3CCU A;  1L1O B;  4BXX G;  1CSQ A;  1PYS B;  2F4V Q;  1Q7Y C;  3GDE A;  4LF9 L;  3STB C;  1NY4 A;  1IBL Q;  1FJG Q;  1VQG A;  4DUZ L;  3CD6 A;  1FVI A;  1HJP A;  2JEB I;  4AYB E;  4AQY L;  4A3J G;  3HOW G;  1TXY A;  2CWA A;  2GN5 A;  5BR8 Q;  1I94 L;  4BBR G;  3E0E A;  4IPG A;  2B63 H;  4Y7N H;  2UXD Q;  2PI2 A;  1KD1 C;  2F3I A;  1NBW A;  1C0A A;  1TWA H;  1PVO A;  2BA0 A;  2B3G A;  3EBE A;  5JEA J;  1XMO Q;  2KHJ A;  3W5O A;  4HJ7 A;  1VQH A;  2UUB Q;  3A74 A;  1HZA A;  3RN2 A;  2LSS A;  3H3V H;  2RF4 A;  1QVG A;  1IBL L;  1FJG L;  4EQ5 A;  2QEX A;  3I4M H;  1P8L A;  2K52 A;  3K81 C;  4APV A;  4IFD I;  4DV4 Q;  2PNH A;  2IT1 A;  3M85 A;  2AKW B;  2NZO A;  3PF4 A;  5GRO A;  2K14 A;  4L5T A;  1YJ9 A;  4B3T Q;  2V1C C;  4A3M G;  4A3B G;  4X64 L;  1IL2 A;  4JBJ A;  5DLQ E;  3BZK A;  4LW1 A;  4UY8 C;  2DGY A;  3AQQ A;  1HNW Q;  1ASZ A;  1N8R C;  3HOX G;  4OX9 Q;  1FL0 A;  3CC4 A;  2JEA I;  1Y14 B;  2ZTD A;  1X3G A;  5IYD G;  1HZ9 A;  4BBR H;  4OON A;  4JI5 Q;  4JV5 Q;  3CW2 C;  4LF6 Q;  1N34 Q;  5FJ8 G;  3CPF A;  3CME A;  1EQQ A;  2LXK A;  4JI4 L;  4R4T A;  1NMG A;  5GAE C;  3CMA A;  1YJW A;  1BVS A;  1Y1W G;  1HR0 W;  3GTG H;  1NJI C;  4X6A H;  2MFI A;  1V9P A;  2JA8 H;  5GQO A;  5IP7 H;  2HHH L;  4PZ6 A;  2C35 B;  1HNZ L;  4OX9 L;  3BJU A;  3GTQ H;  3G6E A;  3PUV A;  4IPC A;  4YWL A;  1B7Y B;  2PMZ E;  3PCO B;  4YHH Q;  1H95 A;  3RZO H;  2JA7 G;  5LMU Q;  2JA9 A;  3RLF A;  1PA6 A;  1RL2 A;  4ALP A;  2EXD A;  4JI6 L;  1K3R A;  4IOC A;  1YEZ A;  3RNU A;  1Y1W H;  3I4O A;  1IBK Q;  4DV1 Q;  5IYB H;  1Q8K A;  1Q86 C;  3NEN A;  2I5H A;  3GTM H;  1D7Q A;  2VS1 A;  3GTP H;  2L15 A;  4LF4 Q;  2UUC L;  3PV0 A;  4A3I H;  3W1G A;  1QUQ B;  1PH1 A;  3IRB A;  4WJ4 A;  1JJC B;  4DNI A;  2UUB L;  4HIM A;  2YTX A;  1UE7 A;  1FGU A;  4RG1 A;  1KL9 A;  1GM5 A;  4OWW B;  4MNO A;  4GKJ L;  4JI3 Q;  2HHH Q;  3J7Z C;  4NXN Q;  2R92 H;  4A3M H;  4GNX C;  4KHP L;  5M5Y H;  1Z47 A;  3CCV A;  5HY6 A;  2RHQ B;  4KHP Q;  2QGQ A;  5IY0 A;  3CC7 A;  2NVY H;  2UXB L;  4IFD G;  1I94 Q;  1MJE A;  1CKN A;  5C4X H;  2VQF L;  4LF6 L;  4KLK A;  2UUC Q;  4DR4 Q;  3CP0 A;  4NXM Q;  3S2D H;  4JI0 L;  3S1N H;  2JA7 H;  3L0O A;  1HH2 P;  3I4N G;  1L1O A;  1S72 A;  5E7N A;  2K75 A;  3HKZ G;  4UP9 A;  3S17 H;  3KYH C;  1IZ6 A;  2IHE A;  2Q2I A;  3KLW A;  3KDF A;  1E1O A;  1U5K A;  5M3M H;  2OQK A;  3KF8 B;  2R7Z H;  4DR1 Q;  4LUZ A;  3K7A H;  4JI0 Q;  1VQD A;  1HNX Q;  4A3J H;  4DR7 L;  4NXM L;  1K8G A;  2E2J H;  1UEB A;  3OTO Q;  2UU9 Q;  3J81 i;  4HJ9 A;  4P72 A;  2DUD A;  4JI8 Q;  3I56 A;  2ASB A;  3U50 C;  3H15 A;  3LGJ A;  1XMO L;  4A3C G;  3NBH B;  1SR3 A;  4JI5 L;  3PSI A;  1IYJ B;  4JOI A;  1EIF A;  4XTC S;  2WFW A;  4L5Q A;  4OXP A;  3OYY A;  3ULP A;  4GKJ Q;  4HJ8 A;  4JI3 L;  5IP7 G;  2OTL A;  2K4K A;  4A3E G;  4LFB L;  4DV1 L;  2D62 A;  5BR8 L;  4LF8 L;  1Q81 C;  4PMW A;  4LFC L;  3HKZ E;  3I55 A;  2A1A A;  2RHS B;  4LFC Q;  4QL5 A;  2I0Q A;  1LUZ A;  1IBM L;  4L5S A;  2NVQ H;  4LF9 Q;  4IPD A;  4DV3 Q;  1PH2 A;  3HOY G;  1I3Q H;  1JMC A;  1X65 A;  4LUV A;  1YHA A;  5ELN A;  3KJO A;  3A5U A;  4DV3 L;  4GOP A;  2NVT H;  3ULJ A;  1VS0 A;  3E9I A;  3G48 A;  4UP7 A;  1Y1V G;  1XMQ L;  3GO5 A;  4GS3 A;  2R7Z G;  4AYB G;  1UWV A;  4DV2 L;  4A4I A;  1XPR A;  2MO1 A;  1V1Q A;  4A75 A;  4BBS G;  5C3E H;  4LFB Q;  4DUY Q;  3HOU H;  3M4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...