2NZOA

Crystal structure of a secretion chaperone csaa from bacillus subtilis in the space group p 32 2 1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
111
structure length
111
Chain Sequence
HMAVIDDFEKLDIRTGTIVKAEEFPEARVPAIKLVIDFGTEIGIKQSSAQITKRYKPEGLINKQVIAVVNFPPRRIAGFKSEVLVLGGIPGQGDVVLLQPDQPVPNGTKIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein csaA
publication title Crystallographic analysis of Bacillus subtilis CsaA.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Chaperone
total genus 20
structure length 111
sequence length 111
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01588 tRNA_bind Putative tRNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2nzoA00
2CWPA 1Y1VG 2QGQA 4L5TA 4DR3L 2BH2A 1XPUA 4A93G 1Q12A 3JAMi 4DV7L 4LF6Q 1A62A 5JJKA 2KHJA 2WAQG 5IP7G 1VQKA 1OXVA 4AYBE 4AYBG 3CPWA 2HHHQ 1KIXA 4A3GG 5C4JH 2HQLA 4DR5L 2K5VA 1YJNA 1G51A 1XPOA 1B70B 5K36G 3UE1A 4GKKL 2KCMA 4DV2Q 4IPCA 1HJPA 4B3TL 2K52A 1SR3A 5IWAQ 4GNXC 5M3MH 1HNZL 4BBRG 4LFCL 3IRBA 3RR5A 2VNUD 4DR6L 4C3HH 1GM5A 1YJ9A 4WJ4A 5GAHC 4H02A 1PYBA 4YY3Q 4OWWB 1OXTA 4HJ5A 2E2HH 1VQGA 5J3BA 4DV3L 3I7FA 1PA6A 4JI1L 4A3BH 2R7ZH 4BY7G 1IYJB 1EUJA 4GNXA 2PQAA 1KXLA 4EX5A 3PGZA 1SMXA 1D8LA 3TS0A 1UE6A 3K80C 3PSIA 4TVAB 4GKKQ 2DGYA 3HOVG 4AQYQ 5C0XJ 1K9MC 4MZ9A 4UP7A 3RN5A 2VY3A 3W1GA 1VQBA 4QQBX 3AFQA 3PIPA 5LMNW 1SN8A 3ULLA 1A8VA 3HOXH 2ATWA 4RG1A 3AEVA 4R4OA 2MNAA 1CKOA 4HJ7A 1FGUA 1VQOA 1HNXL 4NB3A 4DV3Q 4LFBL 4DPGA 2Q2TA 1OTCA 3MEFA 2F3IA 1YHQA 1G291 2F52A 4EQ5A 2JEBI 2JQOA 3ERSX 3KLWA 1VQIA 2ZJPA 4X62Q 1L1OC 3MXNB 3TS2A 4JI6L 3CCEA 3J7A5 2ZTEA 1Q1BA 3T1YQ 5C3EH 5C0XG 3CC7A 2UU9L 1OXSC 1EIFA 2ZM6L 1ASZA 4J15A 4A3BG 2R7ZG 4YWKA 1TWGH 1QVGA 5AJ3L 1JT8A 2NN6G 2JA6H 2NVYH 4DV4L 1XNRQ 3CCUA 1L1OA 1X55A 1SFOH 1J5EL 2E2IH 4MTNA 3PO3H 3HOXG 2IHEA 2PNHA 4NXNQ 2E8GA 1VQ7A 1IBML 3U50C 3HKZG 4JI0L 1UEBA 3RZDH 1XJVA 4LF5L 1E7ZA 3F2BA 2UU9Q 1GVPA 2ID0A 1E1OA 4KLKA 3SGIA 5E7NA 3U4VA 5M3FH 2VUMH 4KHZA 2WB1E 2WB1G 2BA0A 3GTGH 5IP9H 1QVFA 4DUZL 1CKNB 2GN5A 2YTYA 3FKIH 4JCVE 3I4MG 2IT1A 2N78A 1K0RA 4IPHA 2QA4A 3WWVA 2Y0SE 4A4IA 1JB7A 3GTQH 1PHJA 1JE5A 4RMFA 5JEAG 3PUXA 5C3EG 2Q2HA 4JI5Q 2B63H 1X3EA 3HFZB 3RLNA 3STBD 5C0XI 1KAWA 1NMFA 3EBEA 4XTCS 1VQ6A 3H0GH 1B7YB 4JI2Q 1EQQA 1FJGL 1N36Q 1NMGA 1S72A 1GO3E 3RLOA 3A74A 1X9NA 4POFA 5LMUL 4IJLA 3CD6A 3L7ZC 1N32L 1I3QH 1I5FA 4DV0Q 1Y1WH 4IFDG 1D7QA 1QUQB 4DUYL 4BA2I 5M5WH 1EYGA 2NVXH 2LXKA 4OO1G 1MKHA 2EQSA 3STBC 1XMQQ 1UE5A 3K7UC 3A0JA 2D0OA 1LUZA 1S3OA 1V9PA 1E24A 4NPSA 4K0KL 4A3LH 5IP9G 4LFAL 3T1HQ 2JK8A 3H15A 4OWXB 3NEMA 1Q1EA 3OW2A 1IL2A 4UY8C 1JMCA 3CMAA 2B63G 4DV6Q 1HZCA 4A3FG 2N3SA 4JBJA 5IYCH 1E22A 5C4XG 1HZAA 1X56A 2ZTDA 3BZKA 4O2DA 4GNXB 2PQAB 1KL9A 3A5ZB 1UE7A 4HJ8A 3LGJA 3S2DH 4IJHA 5M5YH 2PMZE 2K5HA 4IPDA 2NVQH 4A3IG 2UUAQ 5M5XH 2UUBQ 1KRSA 1AE2A 4A3CG 3K7AH 4GKJQ 1CKNA 3UE0A 2HHHL 3M3YH 1OXXK 2IX0A 3ZJYC 1KHIA 2K14A 1EQRA 1YVCA 3K81C 4PZ7A 3PIOA 4DV2L 1WOCA 5GAGC 4A3LG 1W3SA 3F1ZA 4MNOA 3L0OA 5H1SE 1NTGA 3CPFA 3HKSA 3ICEA 3S14H 3E0EA 2UXCL 2H5XA 1FVIA 4YY3L 1M1KC 5IYCG 1VQ9A 4B3MQ 3HOUH 4HIKA 3S1NH 1VQDA 1TWFH 4JYAQ 2XGTA 2KBNA 4DR2L 1G6PA 1QUQA 1HZ9A 1HR0W 1E3PA 4LF4L 2GVBA 2IHFA 4NXMQ 2Z6KC 3J80c 1Q86C 4B3SQ 4DR1Q 1L1OB 4AQYL 4UP8A 2Q2IA 2Z0SA 1H95A 1PH4A 3I55A 3PUWA 1K8AC 3RLFA 2N8NA 1VQPA 4YWMA 1Z47A 3E9IA 4QIWE 4GLXA 2UXCQ 3E9HA 3HOZG 1Q46A 4A75A 2Z6KA 1PFSA 4PZ6A 3J80i 3J81j 5FJ8G 2OQKA 1JJGA 4DR2Q 2HT1A 3W1BA 1N34Q 3HOWH 4LF4Q 3D0FA 4YCVA 4X62L 4DAMA 2D0PA 2AWOA 1L0WA 2KCTA 2AHOB 2JJQA 3UDXA 4APVA 3T1YL 1VQAA 1VQEA 4YHHQ 4IOCA 1YHBA 1A0IA 4C3IH 1X54A 1XNRL 2R7FA 3W5OA 4GLVB 5M3MG 1J6QA 5LMNQ 4C2MH 1JJCB 1YBYA 2XTIA 3S17H 1VQCA 4NXNL 2K75A 1NBWA 4LUVA 2KENA 1YEZA 5IYBH 1C0AA 3KFUA 1ASYA 5JJIA 1N9WA 1BVSA 1VQHA 3HOWG 4L5RC 2NZOA 5EAYA 2JA9A 1NY4A 3I2ZA 4YCWA 4A3EH 1YI2A 1K83H 3CCJA 3CCQA 4JI5L 1QZGA 5JEAJ 2OTJA 3G48A 2R93H 5IE8A 4X66Q 1P16A 1XNQQ 3CC4A 1LYLA 4JI2L 3I4OA 1N36L 1EFWA 3I4NH 1YITA 1VCIA 4OWTB 4GOPC 1I94Q 4DK6C 2CCZA 5IT9c 4R4CA 4DV0L 3EN2A 1LM0A 3AQQA 4LUOA 4X65Q 2B29A 1W2BA 5HGQA 4IFDJ 4Y52H 3RZOH 2EIFA 3HOYH 3F2DA 3GDEA 3JC66 1O7IA 2Y0SG 4YCUA 3J7ZC 4DV1Q 3KYHC 1XMQL 4OX9Q 4ALPA 1WYDA 5IYBG 4PMWA 4YWLA 1AE3A 2A1AA 1UWVA 1TWAH 4GOPA 4A3KH 3NBHB 1BBWA 4BA1I 3T1HL 2K50A 4A3MH 2JA6G 2NN6I 3S24A 2JA7H 2AWNA 3K8AA 1C7YA 1YJWA 4JI4L 1VQNA 4DR7Q 3PUVA 2OTLA 1RIPA 2VZAA 3FHWA 2KHIA 4DV6L 2A8VA 4C3JH 1HNWQ 3H3VH 4GN4B 2UUCL 2ASBA 2RHSB 1N33Q 3PO3G 2VQEQ 4P72A 4FDBA 4DR4Q 3AYHB 1Q81C 2I5MX 2VW9A 2ALYB 1PH6A 2UXDQ 4JOIC 4L5QA 5M3FG 1VQMA 2VUMG 1BKBA 1WCMH 3KF6B 2E2JH 4LF9Q 3I56A 2D62A 4LW1A 1S40A 2UUAL 2UUBL 3FKIG 4GKJL 1SLJA 4QL5A 4JI4Q 2JA8H 4R4TA 2JE6I 1XMOQ 3GD7A 4JV5Q 3PUZA 2UUCQ 4JOIA 5GAEC 3H0GG 3L2PA 4R1JA 4A3MG 1YZ6A 4IPGA 4O0AA 2VQFQ 3CCMA 1KQSA 2DUDA 2YU9H 1EOVA 2R6GA 4B3ML 1Y1WG 4JYAL 1KC8C 4AIMA 3TQYA 5FLMH 4JI3Q 4LNQA 3TRZA 3CCVA 4IFDI 2K4KA 3CCRA 4NXML 4OO1I 1L2FA 3M7NA 4X64Q 2UXBQ 2V1CC 4DR1L 4B3SL 1C9OA 1WCMG 4ME3A 2IX1A 4A93H 4UP9A 1BBUA 3CQZH 4AH6A 4LF7Q 3PO2H 3B6YA 3TREA 5IP7H 2JA8G 3S2HH 2ES2A 3BJUA 3OTOQ 1RL2A 1AH9A 1U5KA 1V43A 1CSPA 3ULJA 1Z9FA 2WP8J 1MJEA 3GTOH 4HJAA 3OYYA 2R92H 3ER0A 2JEAI 3GTPH 1N34L 2YTVA 3RNUA 4BY1H 3M85A 2HIVA 2F4VQ 1VS0A 3PF5A 4OXPA 4A3DH 2MO1A 3KF6A 3UDGA 1HR0Q 4YHHL 3H3VI 4B3RQ 1MIUA 3CXCA 4P71A 1N8RC 1T9HA 3K0XA 4DKAC 3S1MH 1UE1A 3PF4A 1VQ8A 1PH8A 5BR8L 3CP0A 2GVAA 1XTDA 2CKZB 1TWCH 2PI2E 5LMNL 4HIDA 4JBKA 2C35B 3HOVH 3M4OH 3PO2G 3Q8DA 2WAQE 4LF8Q 1CSQA 4BBSH 4KHPQ 4JC0A 4HIOA 1K73C 5IYDH 3HOUG 2BH8A 2YYZA 4JBWA 4QY7A 4GOPB 4LWCA 3PV0A 2FXQA 1XPRA 2E5LQ 2R92G 3KDFA 1EWIA 5ELNA 4BY1G 5BR8Q 2NZHA 1IXRA 1HZBA 4WJ3M 5GADC 4DR3Q 4A3DG 4R4QA 1CKMA 3CW2C 3PCOB 1Q7YC 4X66L 4DV7Q 1K8GA 4DNIA 2Q2UA 1XNQL 1CUKA 4HJ9A 1PVOA 4GN5A 3KJOA 3G4SA 1LTLA 1WFQA 3CMEA 4DR5Q 5JJLA 1E1TA 3M4PA 1YNXA 4KI0A 1PV4A 1I94L 1VQLA 4DK3C 3TEHB 1V1QA 4X6AH 4B3TQ 4BBSG 4X65L 1VQ4A 1HNZQ 4LFCQ 3GTMH 1I50H 3S15H 4R4IA 1KRTA 1SROA 3M9BA 4DR6Q 2I0QA 4DV1L 5IYDG 2AMCB 4OX9L 1MJCA 1PH2A 3U58A 1GKHA 1M90C 2IY5B 1NE3A 4JI1Q 2B3GA 4HIMA 3CAMA 4A3JH 3EIVA 4DR7L 2AKWB 2PI2A 2ZTCA 3I4MH 2WFWA 4P75A 2ZJRA 3DM3A 1GD7A 3GTKH 1HNWL 3VDYA 1PH3A 3F8TA 2OQ0A 1N33L 2I5HA 2A19A 4GS3A 2VQEL 4TQUS 4DR4L 5GROA 1P8LA 2K5NA 3RN2A 3FP9A 4JG2A 2VS1A 4Y7NH 1Q82C 2UXDL 2I5LX 3CCLA 1WJJA 2BA1A 2YV5A 4LF9L 4OONA 1HNXQ 3KOJA 2CFMA 4LFBQ 1A63A 2YTXA 2RCNA 3BU2A 4JI7Q 4PZ8A 1VQFA 3J81c 4A3EG 2MO0A 3ULPA 1XMOL 2L15A 2R7DA 3HKZE 2QEXA 4JI6Q 1PYSB 4POGA 1X65A 1VQ5A 4JV5L 2R93G 2ZM6Q 1U0LA 2OCEA 3U4ZA 1SE8A 3AFPA 4A3JG 5AJ3Q 3CF5A 2VQFL 4DV4Q 3I4NG 3KF8B 1EIYB 3J81i 1NJIC 4BXXH 2RF4A 5FLXc 3F2CA 4A3FH 4DV5L 1R9TH 1WI5A 2LSSA 4JI3L 5HY6A 5C4XH 1J5EQ 4JBMA 3HOYG 3CC2A 4GN3B 5IY0A 1X6OA 4X64L 1IBMQ 4JI0Q 2UXBL 4P74A 4LF5Q 1PH9A 4P73A 2VL6A 4UPAA 4JI8L 4A3KG 1YHAA 4LF7L 1PH7A 3D31A 5ELOA 4A3IH 1IBKL 2JA7G 4A3CH 3GTLH 4DUZQ 4IOAA 1IZ6A 2MQHA 1PH5A 2JA5H 3OTOL 3BZCA 2LXJA 3G71A 3DLLA 5C44H 4DV5Q 3UDIA 4DAYB 3S16H 3KDFB 3A5UA 3G6EA 3GTJH 1JJ2A 1TWHH 3UDFA 2EXDA 4JI7L 2HIXA 4IO9A 3PUYA 3NENA 3KJPA 3CCSA 1Y1VH 4PG3A 4L5SA 1FJGQ 2F4VL 1VQJA 4BXXG 1IBLL 1B8AA 4JI8Q 2ZJQA 1HR0L 1FL0A 5LMUQ 4B3RL 1N32Q 2OWOA 3S1RH 1QVCA 1IBKQ 2NVTH 1K3RA 4DUYQ 2N49A 1TXYA 1I6HH 1PH1A 4A3GH 2CWAA 1X3GA 1OXUA 4QJFA 4LF6L 4K0KQ 1X3FA 4KHPL 4GLAC 4LFAQ 4LF8L 1Y14B 4BBRH 1Q8KA 4LUZA 1HH2P 3JAMc 3GO5A 3M4QA 2JA5G 2MFIA 1IBLQ 3S1QH 1SRUA 5GQOA 5C44G 3NELA 4A76A 3HOZH 5FLMG 2E5LL 4QGUA 5DLQE 1DGSA 5FJ8H 5IWAL 1QZHA 1KD1C 4BY7H 1YIJA 4XIGS 2CQOA 2RHQB
chains in the Genus database with same CATH superfamily
1DOKA 1A3UA 1GUGA 3JAMi 1I6HB 2EYJA 4DV7L 1JWMD 2WAQG 5IP7G 1OXVA 3NXWA 1STYA 2HDLA 4AYBG 4HR7B 4DR5L 1YNND 2K5VA 4F87A 3T56B 1YJNA 1G51A 5IT9E 1B70B 2MP1A 1XPOA 1GJXA 4DF7A 4IPCA 1ET6A 2K52A 4GNXC 3S1QB 3IRBA 3W3AA 4DR6L 1YJ9A 3HOZB 2OXPA 5GAHC 1BOSA 1OXTA 4HJ5A 5J3BA 4BY7G 2KA7A 2R7ZH 1QJOA 3D4RA 4ZAIA 4GKKQ 3KLSA 2DGYA 4AQYQ 2G9DA 2F0KA 3RN5A 3ND8A 1CK1A 5IOCA 4RG1A 3I90A 2MNAA 1STHA 1MSGA 3OIPA 2MUYA 4NB3A 1YHQA 3DUZA 4EQ5A 4JI7L 2JEBI 2JQOA 3ERSX 4X62Q 1L1OC 2E2HB 1L0YB 5C4HA 4JI6L 3NBIA 3OW7A 3J7A5 2ZTEA 4A3BB 4RHSA 3T1YQ 3SXHA 1ZYRC 1HXYD 2G9HD 3C2PA 3BS1A 1TWGH 5KIXA 5AJ3L 5LL6X 1JT8A 4DV4L 5BN3A 4ZCKA 1JWSD 2F0WA 3HOXB 4FF3A 2E2IH 2L12A 4MTNA 3PO3H 1GHJA 2KJXA 2IHEA 1FNWA 2PNHA 4CDEC 1VQ7A 3TDQA 3HKZG 1E7ZA 4RKBA 1GVPA 5E7NA 3CHBD 5I9OA 4KHZA 3FKIH 4JCVE 3I4MG 1K0RA 1V8QA 3WWVA 3NTIA 1I4RA 4RMFA 5C3EG 2JA6B 2Q2HA 2NVYB 3STBD 1KAWA 1NMFA 3EBEA 4IUUA 1FJGL 1SFOB 1ML0D 1SYBA 3A74A 4IJLA 5KNCA 2HD3A 1D7QA 4K6LA 2WACA 5M5WH 4UAIA 4OO1G 1UE5A 2SNMA 3A0JA 3H09A 5EPJA 3MAQA 5IP9G 1HQMC 4KJNA 4C1NI 3J80L 3GTQB 3H15A 1MHWC 1JMCA 2B63G 2QDBA 4DV6Q 1VDZA 4JBJA 1A2TA 3O13A 5C4XG 1HZAA 1X56A 3I4LA 2PQAB 1KL9A 2EJGC 1UE7A 3VA7A 2EYOA 1I3QB 3J7YW 3S2DH 3P1HA 4IPDA 2NVXB 1B2TA 3T53B 4A3IG 2UUBQ 1UUPA 2R3ZA 3UE0A 5E4XA 2BE5C 1OXXK 2IX0A 4U68A 1YVCA 3SDZA 1EY8A 5KNDA 4MNOA 1HRJA 1NTGA 3CPFA 4DU9A 2BDOA 1F9QA 2UXCL 2NVTB 1VQ9A 3GV3A 1H9SA 4JYAQ 1TWFH 4MIUA 1HR0W 1SNMA 5M5YB 4LF4L 1Q86C 2F0TA 4MHEA 1SEBD 1TU2B 5A2QL 4AQYL 3M3YB 2Q2IA 5J22A 3H3VC 1H95A 5COYA 1VQPA 1RHPA 1Z47A 2M2LA 3E9HA 1PZID 3HOZG 1Q46A 3J81j 1EWHA 1HTLD 2OQKA 4DR2Q 1RJTA 3VYSA 3HOWH 1N34Q 2NYZD 3D0FA 4X62L 4DAMA 3K5OA 5IT9L 4H13C 1STBA 3NP8A 5CBEE 2AHOB 2JJQA 5CYUA 3T1YL 3H6MA 1VQEA 4G7OC 2TMPA 3MFGA 4IOCA 4R9WA 1YHBA 1A0IA 1EL0A 1STNA 2B2YA 3LWEA 1SYCA 1DOLA 1Q3LA 1B50A 4EGVA 5CV8A 1C0AA 1TKWB 2RA4A 1N9WA 1BVSA 4P2CB 2RDGA 1NY4A 3I2ZA 2L1BA 4YCWA 1YI2A 1XXGA 1RD9D 4C3IB 2OTJA 1XTCD 4E6IA 1P16A 2MPMA 4KKUA 1SNDA 3A7AB 4C2MB 5EKIA 3I4NH 2F0QA 1E2ZA 5JVH3 5T1IA 3S17B 4KD4A 2K7VA 3EN2A 2J0TD 2B29A 1W2BA 2EIFA 4YCUA 2E2DC 3BYTB 3GP7A 3P20A 4ALPA 1AZQA 4PMWA 1LV9A 3EROA 3FPUB 4GOPA 2JA6G 2FINB 1I4QA 2NN6I 2A5HA 2VZAA 4KY7A 4DV6L 2A8VA 1D5ZC 3MWYW 2HCCA 3BVZA 2I5MX 2VW9A 2UXDQ 3NK9A 4L5QA 2EYPA 3HOYB 1SBBB 4LW1A 2UUBL 4N9PA 5EJWA 1PRTB 2IW3A 4QL5A 2L11A 4R4TA 5JJZA 2QCPX 2HUGA 4A3MB 2JA7B 2UUCQ 4JOIA 5GAEC 5G3LF 1PFBA 1AFPA 3CCMA 2DUDA 1TS4A 2OEOA 4C3JG 4JYAL 5C3XA 1NSNS 4H7BA 4LNQA 1L2FA 3HG9A 1JQYD 2CVRA 2E76C 1MGSA 1DJRD 1LLRD 3X3MA 4ME3A 2IX1A 3CQZH 4AH6A 4G57A 3NBHA 5IGCA 5IP7H 2JA8G 4BS9A 3H94A 2ES2A 5I6YA 1RL2A 4IQZA 1MJEA 1CSPA 3OOCA 2YU9B 1N34L 1V1PB 2RKSA 5FOBB 1F9RA 2HIVA 2PPBC 4A3DH 2PZUA 1PTOB 2B8FA 3K0XA 2B2WA 1WTXA 5BR8L 3S2HB 1EZ6A 1XTDA 4JBKA 3PO2G 4KHPQ 1CSQA 1ICFB 1K8OA 2R92B 1BBXC 5IYDH 1LO5D 2YYZA 4JBWA 4BY1B 4XQQA 2H1EA 2E5LQ 2K32A 4IUPA 3SHLA 2TSSA 3S1MB 3VA5A 3A55A 3HZXA 3BYYB 3CW2C 3PCOB 2Q2UA 1CUKA 1U4MA 3KJOA 3MTSA 1AW7A 1WFQA 3HOVB 1PV4A 3TEHB 3WOFA 2PW7A 4BBSG 4KKSA 4LFCQ 3S15H 1KRTA 1SROA 1L0XB 1ZEQX 5I2YA 4DAVA 2I0QA 3NE5B 2AMCB 4I65A 3D3RA 3U58A 1M90C 2IY5B 1G8ZD 3CAMA 3RUZA 3K57A 1BCPD 2PI2A 2ZTCA 3DXJC 3I4MH 2RQXA 5DM63 2OQ0A 2I5HA 2ZXRA 2K05A 4V190 1BDOA 4G7ZC 4Q0FA 4WRDA 4JG2A 2UXDL 1Q82C 2I5LX 3CCLA 1WJJA 2YV5A 2SOBA 2CFMA 4LFBQ 2QF7A 3EA6A 2F3VA 3BU2A 2X6GA 1A2UA 4PZ8A 2MO0A 1RDPD 4DNTB 3KLSX 1IW7C 3P75A 5ISRA 3IFDA 3EQLC 3MXGA 1IL8A 1U0LA 1SE8A 3NSWA 4A3JG 3CF5A 2QEJC 1KDCA 2RSNA 4BXXH 2RF4A 1Y8PB 2F0OA 3F2CA 3DEPA 4Y7NB 1TT2A 4DV5L 1R9TH 1J9OA 5C4XH 4JBMA 3HOYG 2OF1A 5IY0A 3OHXC 5FO8B 1B53A 3W2DA 4P74A 2RVLA 2VXWA 1LTGD 1YHAA 2JA7G 4A3IH 4ME5A 4DUZQ 1S5CD 2MQHA 1SNQA 2ENBA 3G71A 1T5EA 2CH4A 4L6TB 3K6OA 3CCSA 4PG3A 4S3SA 2A69D 2OWOA 1IBKQ 1K3RA 3MVVA 1EEFD 1TXYA 1I6HH 1F2YA 2DNEA 1K8MA 3ND9A 4ID6A 1OXUA 4FXKC 4KHPL 4GLAC 4LFAQ 1Y14B 4IN3A 1Q8KA 3KF8A 3S16B 3S1QH 2MFIA 3GTJB 5GQOA 4HAEA 5C44G 3HOZH 2E5LL 1LACA 2P5ZX 5IWAL 1VF7A 4UDUC 1QCBD 5EKLA 3KBGA 2CWPA 1Y1VG 4H0LC 4AYBB 1A62A 2KHJA 1XYIA 4AYBE 4A3GG 1NNXA 1EY0A 4OEMB 5K36G 1HJPA 4ZRZA 1RKNA 2L0CA 4LFCL 4BBRG 5FO9B 1GM5A 4QUFA 4BY7B 3NUCA 4YY3Q 2F0FA 2E2HH 4A3BH 3SK5A 1WTWA 1IYJB 1EUJA 1NCVA 2PQAA 2JXMB 3TS0A 5DM73 3HOVG 5ELDA 5IGFA 4FP5D 5C4JB 4K8IA 1LTID 5C5LA 4QQBX 3AFQA 1ZYRD 5LMNW 3AEVA 3HOXH 1A8VA 3BDCA 5M3MB 3QG1A 4HJ7A 5CV5A 4PMCA 4LFBL 1K3BC 2BCOA 1O78A 4HMIA 2LKVA 4C3HG 3KLWA 1VQIA 3MXNB 4Q5VA 5AFWA 1Q1BA 5JEAH 1DXMA 1SNOA 3IKJA 1QVGA 2NN6G 2JA6H 2NVYH 1HHVA 4UHVA 1Z6HA 5TSSA 1ESFA 1SFOH 2FMCA 4WJWA 4ULLA 1U4LA 4RGMA 4IFDH 2RCFA 1ZXTA 2E8GA 4PNYA 4V0BA 3SGIA 3RZOB 4KLKA 1M8AA 2PZTA 2BA0A 2E74C 2XIWA 1QVFA 4DUZL 5C3EB 1JWUD 2IT1A 2CHBD 1JB7A 3GTQH 3HFZB 5C0XI 2XSCA 1TS3A 4XTCS 1KDBA 1EQQA 1S4ZA 3RLOA 2WV6D 1JOQA 4POFA 2NTTA 1I3QH 4DV0Q 1BNZA 5M3FB 2NVXH 2VUMB 2EQSA 2O5IC 3SR1A 1H9RA 1V9PA 3MFYA 4A3LH 4LFAL 3T1HQ 2B63B 3LWUA 3NEMA 1B4OA 4R8IA 4OL7A 2JSOA 2BE5D 1DCZA 2K03A 4NDXA 5IYCH 1E22A 2B2UA 4O2DA 3LGJA 1GUTA 4A3IB 1Y1WB 2DJGC 5M5YH 1G91A 3QOJA 5JOBA 2F0SA 1TY0A 1CKNA 3BZDB 3M3YH 4HSVA 4MTKA 3EVQA 3UI2A 1KHIA 3ZJYC 1EQRA 4PZ7A 1WOCA 3D8GA 4QF4A 3RMHA 5LHY1 3SE0A 4RWSC 2SNSA 2B2TA 4JW0A 3M4YA 4YY3L 3EJIA 1QUQA 3LNNA 1E3PA 2IHFA 3J80c 3TP6A 3R3OA 2Z6BA 4JPBW 2K01A 3CRKC 3I55A 1PH4A 5CGKA 2F0HA 3E9IA 2UXCQ 2FJ2A 2IL8A 3H91A 2KOLA 2Z6KA 2RDHA 5FJ8G 3S14B 3J81E 4LF4Q 4YCVA 2B2YC 1D1IA 2D0PA 5HGTA 2AWOA 4APVA 3I91A 3K5LA 1EYCA 4FO2A 1WD1A 4C3IH 1HCZA 5FLXE 2KUMA 5M3MG 1J6QA 4C2MH 3S17H 1VQCA 2K75A 3A8IE 1FNUA 4LUVA 2F0EA 1R4QB 2KENA 3FDTA 3KFUA 5JJIA 3AB9A 1VQHA 4HTHA 4L5RC 2NZOA 1V1PA 3CCQA 1M4VA 5I4DA 3TSSA 1XNQQ 2VB2X 1LYLA 3U9SA 4N8X1 1EFWA 2QKIC 4GOPC 4OWTB 2F0IA 4LK1C 1I94Q 5IT9c 4R4CA 4DV0L 4FF4A 3AQQA 4X65Q 5HGQA 3E5SA 4HN7A 3HOYH 3J7ZC 1O7IA 4DV1Q 5D65A 4IUTA 4OX9Q 5IYBG 4ZUIA 4HMJA 1CM9A 1AE3A 3BVGA 4A3EB 1UWVA 1HA5A 1K83B 2AUKA 2F0LA 3T1HL 5EKKA 3JAME 4A3MH 2JA7H 2AWNA 3HEJA 4XYOA 1C7YA 4DR7Q 2R93B 1RIPA 3FHWA 2QDLA 2KHIA 1K0SA 4GN4B 2ASBA 2JP1A 3HP3A 3Q23A 2VQEQ 4P72A 4FDBA 1EQVA 1Q81C 2ALYB 1PH6A 1RTNA 5HURA 4JOIC 5M3FG 2VUMG 3MA2B 4HSPA 1BKBA 1JR0D 3KF6B 4IUQA 5I2XA 3I56A 2D62A 1S40A 4FF1A 2I07B 2XNAC 1LTAD 1TWAB 2FMMA 4U673 1XMOQ 2EYHA 3PUZA 4NKLA 2F0UA 3L2PA 4R1JA 3BDLA 4C3JB 2VQFQ 3DWQA 5G3LD 1KQSA 1FD7D 2EVBA 2EXZA 2YU9H 1EOVA 3ITPA 4KKTA 1ENFA 4K14A 1Y1WG 1HQRD 4F88A 3T13A 4AIMA 3CCVA 2K4KA 1PTOH 3CCRA 1CZWA 2E2JB 2HDMA 2UXBQ 4RFBA 3VR6A 1WCMG 2JA8B 1CQFA 3TREA 3S2HH 1I4HA 3BJUA 4KHVA 3OTOQ 2SEBD 1AH9A 1U5KA 3ULJA 2B2WC 1Z9FA 2WP8J 4KN7C 3OYYA 2R92H 3ER0A 3V96A 1KABA 4BY1H 2GA4B 3MXUA 1GOZA 2KCNA 1MIUA 3CXCA 2B2VA 4P71A 3S1MH 2NBFA 1J8IA 1RCVD 3PF4A 4A93B 1FR3A 2J7ZA 3PO2B 3CP0A 4FXGC 3ZYYX 4RCNA 2CKZB 3HOVH 2A74C 1PMRA 1CHPD 2SDFA 2AQ3B 4LF8Q 1WVLA 1K73C 1S5ED 4CDFC 4LWCA 3PV0A 1EWIA 5BR8Q 2NZHA 1IXRA 1EQTA 1HZBA 4RGNA 2EE1A 3GQBA 2N88A 1ZKOA 3QO2A 1XNQL 1PVOA 1LTLA 3M4OB 3CMEA 4BBSB 3DWPA 4KI0A 1I94L 4X6AH 4X65L 1HNZQ 2PCFB 5FLXL 4R4IA 2F0DA 4DV1L 4G7HC 4OX9L 1PH2A 1GKHA 3V2TA 4C1NK 5L37A 4LAAA 1NE3A 1ENCA 4DR7L 2AKWB 4O42A 1AP0A 4P75A 3TP7A 2ZJRA 1GD7A 3VDYA 1O7YA 5FO7B 1PH3A 2B39A 1EOTA 1IW7D 2VQEL 1P8LA 2K5NA 3OMCA 4Y7NH 5LL6S 1F2LA 1DZ1A 2ZXPA 4OONA 1HNXQ 1F9SA 4CKEA 1STAA 4A3EG 1VQFA 3ULPA 3MXPA 3A8JE 2NTSA 1XMOL 2QEXA 2R93G 1TIID 1X65A 3K0YA 2IWHA 4A3JB 1VQ5A 3FEWX 3DM1A 3U4ZA 2PNRC 3GTKB 1DD2A 3DHQA 4CJ0B 2VQFL 1XX8A 2CQAA 2XRQD 2NZ1D 2LMCB 3JAML 2LSSA 1SYDA 1QILA 1B3QA 4KY5A 1IYVA 4JI0Q 2CH4W 2UXBL 4JI8L 3FVQA 1TY2A 3K5MA 3D31A 4EVOA 4IOAA 4RAUC 4EQPA 3MXNA 3OTOL 1B9MA 2XVSA 4DV5Q 3UDIA 4DAYB 3S16H 3KDFB 3KK7A 3GTJH 1EIHA 3KJPA 4IUVA 1IBLL 1FL0A 1UAPA 5C5MA 2N49A 3VYRA 1PH1A 4XDXA 3MEHA 3PQIA 1HFGA 3OWEB 4KTAA 4ZKBB 3GTLB 3KBXA 4LF6L 4K0KQ 1X3FA 4LF8L 2K5WA 1GUWA 5C44B 4CKBA 2JA5G 3J7AF 1TWHB 3NELA 4QGUA 1Y1VB 1QZHA 5FJ8H 4BY7H 3NTKA 4CGYB 5IGDA 2BH2A 4A93G 1Q12A 1WD0A 4A3GB 5JJKA 2HHHQ 2PQEA 1KIXA 1TQOA 5C4JH 2HQLA 1Y8OB 4BBRB 4XT1B 1QWYA 2KCMA 1SR3A 5IWAQ 5M3MH 1HNZL 2O2LD 3RR5A 2VNUD 3L9AX 2PW5A 2KEDA 1II3A 1A3VA 2PYKA 4H02A 5C4ZA 2F3WA 4RGTA 4DV3L 3I7FA 1PA6A 2DN8A 1BCPB 4QUCA 4EX5A 3TP5A 1UE6A 1LTTD 3PSIA 5C0XJ 1K9MC 4MZ9A 1VQBA 3PIPA 2L9HA 1SN8A 3ULLA 4R4OA 1E0BA 2KEEA 1CKOA 1EU4A 1KTKA 1VQOA 2D5DA 4C3HB 1HNXL 4DPGA 5T1GA 2Q2TA 3E0JA 3MEFA 3RZOH 1IKLA 2ZJPA 3HRZC 5M9OA 5KRUA 3TS2A 4ABNA 2I46A 5JAVA 5C3EH 3CC7A 2UU9L 1OXSC 1AEXA 1ASZA 4J15A 2R7ZG 4NMZA 1XNRQ 1EYAA 3CCUA 1KLGD 3K59A 1X55A 1H9KA 4OIJA 3RD4A 3HGBA 4NXNQ 3GV6A 5IGBA 3D4WA 3U50C 4JI0L 4OO1H 1G6ZA 1XJVA 2ID0A 1E1OA 1FNVA 3DMUA 5M3FH 2VUMH 3G6JB 2IJ0A 2WB1G 5IP9H 2Y0SB 3EFXD 2YTYA 4OIKA 5CBAE 1KNAA 4IPHA 1BUVT 2WINB 2J4XA 4JK1C 1WTQA 2DJFC 2Y0SE 4A4IA 2B63H 3QJYA 1VMCA 3MHBA 1TS2A 1VQ6A 1HUNA 1B7YB 2K5QA 4JI2Q 4KD3A 1SJED 3OPOA 1S72A 1GO3E 2RDFA 3L7ZC 4Z9CB 1I5FA 4DK1A 1Y1WH 3RZDB 1SXTA 2ZT9C 1EYGA 3GTGB 1XMQQ 3K7UC 3VR4A 3NPPA 2B2UC 1LUZA 1S3OA 1E24A 4NPSA 4K0KL 1H9JA 1JE4A 1NR4A 2JK8A 2A6HD 1Q1EA 4F8MA 1CA6A 3CMAA 3H0GB 4OGQC 2AQ2B 3R93A 4GNXB 4KV6A 1CQVA 3A5ZB 2PMZB 4HJ8A 4IJHA 3A7LA 1SDFA 2PMZE 2K5HA 1JB3A 2UUAQ 4A3CG 4GKJQ 2HHHL 2ICIA 1A15A 2B2TC 5IGEA 4IZ8A 1EY6A 2K14A 5BN5A 5KNBA 3PIOA 3F1ZA 3L0OA 1SNCA 5H1SE 3SK4A 3HKSA 3ICEA 3S14H 1HFNA 1KLUD 2H5XA 1M1KC 2PO4A 1PRTC 2KBNA 2NVQB 2GVBA 5F2DA 2Z6KC 5M5XB 1XWEA 1L1OB 3K7AB 4B08A 4UP8A 1EY4A 2A68C 1S5FD 1K8AC 4TSSA 3RLFA 2N8NA 4YWMA 4GLXA 3K58A 1CTMA 3J80i 1PFSA 2JYOA 4NP5A 1RF2D 1RODA 3QWNA 5JPNC 3HOUB 3S1NB 1STEA 1L0WA 5J39A 1PTOF 2KCTA 3NWTA 4K5XA 5D14A 4EQOA 3CKIB 4YHHQ 2WIIB 2L55A 2HCIA 1X54A 1BXTA 1XNRL 2R7FA 4GLVB 2BDNA 1DOMA 1HPCA 1YBYA 2XTIA 1Z7TA 4NXNL 1LTRD 1PYWD 2IPKD 1PTOC 2Z4HA 2C9OA 4KMUC 1Y8NB 3TP8A 5DAUA 1DONA 1K28A 3HOWG 5EAYA 2JA9A 5KGUA 4A3EH 1K83H 1SMYC 2R93H 2Q8IB 4X66Q 5EPKA 4JI2L 3I4OA 2KQ3A 1YITA 3QR8A 4DK6C 3R2IA 1LM0A 1CT1D 3GDEA 5ELBA 3JC66 2Y0SG 3MZ5A 1D6EC 1XMQL 1WYDA 2X69A 4YWLA 2F0PA 2F0GA 1TWAH 3DWAA 1BBWA 3NBHB 3NWSA 4O1NA 3S24A 4JI4L 3WDNA 4RH6A 4C3JH 2RHSB 2NB0A 3I8ZA 2LY7A 4DR4Q 2Z4IA 1PZKD 5IIFA 4K2KA 1VQMA 2E2JH 1AN8A 5D3DA 2QW7A 2UUAL 1RTOA 1QNKA 2X6LA 4HCEA 1LT6D 4GKJL 1SLJA 2JA8H 2JE6I 1D5XC 4A3KB 2EZVA 1X3PA 4KK7A 2K04A 3H0GG 1C48A 4QB4A 1JOKA 2R6GA 3KLRA 4ZLTF 1KC8C 2A6HC 4IFDI 1WCMB 2NWGA 3M7NA 4X64Q 1C9OA 3PIP3 1GXDC 1GUOA 4CDCC 1BBUA 1WTOA 4A93H 3PO2H 2O5JC 5DNFA 2V4DA 2B2VC 1ILPA 3Q24A 2B8GA 3I73A 4NW2A 2MHVA 1CFMA 2F4VQ 1VS0A 3PF5A 1DYQA 3BDOA 4N9TA 3UDGA 1HR0Q 4YHHL 1N8RC 4DKAC 5A2QE 1VQ8A 3A54A 3FPPA 3M4OH 2PI2E 4HIDA 4BBSH 3GTOB 4R8NA 3HOUG 3GTPB 3I3CA 2FXQA 4DAYA 3KDFA 1PFMA 2L5TA 5ELNA 1D2BA 4RKLA 5E3FA 5GADC 2CW0C 4DR3Q 4A3DG 1TS5A 3OMGA 1CKMA 4X66L 1K8GA 1WTPA 4HJ9A 1IYUA 4GZYC 2LFNA 4DXFA 4GN5A 3VR2A 1TWCB 5JJLA 1E1TA 1VQLA 4B3TQ 1TVXA 3QOLA 1VQ4A 2EJMA 3M9BA 5IYDG 3K5NA 4DGZA 1HUMA 2K28A 4BWGB 1D5MC 3Q0AA 5E1FA 4K6DA 4JI1Q 2B3GA 1MBYA 4HIMA 4A3JH 1JC7A 2N55A 5DEHA 2WFWA 4H44C 4WORA 2KHSA 3WOEA 3GTKH 2A73B 3F8TA 2A19A 3A8KE 2JN4A 4DR4L 5GROA 4TKOB 3FP9A 5EGTA 4RHRA 3GTMB 2BA1A 1I50B 4OELB 3KOJA 2XWJB 5ELCA 1A63A 1YNJC 3PIO3 2RCNA 3IAYA 3J81c 1CZGA 1NUCA 2R7DA 1U4PA 2D2CC 2ZM6Q 1PLFA 2OCEA 1B44D 1F9PA 1A6XA 3KF8B 1F77A 1NJIC 3V05A 5FLXc 1ET9A 2M00A 1J5EQ 1WI5A 4GN3B 1D1KA 1EFID 2ICEC 1X6OA 3SK6A 4XXEA 3MC0B 4X64L 1I4XA 1IBMQ 4LF5Q 1PH9A 2EJFC 4A3KG 4DA2A 4FYDA 1A3TA 4A3CH 3GTLH 4YIJA 2EYLA 1EEID 3CU7A 1IZ6A 4QMGA 1PH5A 3KUPA 4CDDC 1EY5A 1EY9A 4L8JA 5C44H 2FHTA 3TBIB 4CKCA 5IGGA 1JOOA 1LABA 3G6EA 3T51B 1TWHH 3UDFA 2EXDA 2HQEA 2HIXA 4IO9A 4A3FB 2F4VL 1Y1VH 4BXXG 1VQJA 1B8AA 4JI8Q 1HR0L 5LMUQ 1N32Q 1KNEA 1QVCA 3TMEA 4DUYQ 1JICA 4A3GH 2CWAA 4KN4C 1I4PA 5K36H 3OSOA 1X3GA 1NAPA 2JA5B 4BBRH 1HH2P 3T16A 3JAMc 3GO5A 1IBLQ 1SRUA 4DAPA 4A76A 5FLMG 1DGSA 2R61A 2QGQA 4L5TA 4DR3L 3S1RB 2Q8RE 1XPUA 2EOTA 1E2WA 4X3TA 4LJZC 4LF6Q 5EBDA 1AZPA 1VQKA 4L63B 5CORA 5I6WA 3CPWA 1MD2D 3AMUA 2C5CA 1SNPA 3UE1A 4GKKL 4DV2Q 4B3TL 5IODA 2K1BA 4C3HH 4WJ4A 4MN3A 5CV7A 1O7LA 2DY8A 1U4RA 1PYBA 3J81L 4OWWB 2KCCA 1LTBD 1VQGA 2XRSD 4JI1L 3F2UA 1YNNC 4GNXA 1KXLA 2NN6H 3PGZA 1SMXA 1D8LA 3FMCA 3C46A 3K80C 4TVAB 2F1MA 4K2LA 1CA5A 4XQNA 1SJHD 4UP7A 2VY3A 3W1GA 5JPMC 2O4XA 2EDGA 2Z9HA 2ATWA 1FGUA 2M9VA 4CHTB 1PFNA 4DV3Q 1OTCA 2BOSA 4J1MA 2F3IA 1VQNA 1G291 2F52A 3CCEA 4FF2A 2R7ZB 1QE6A 4EQNA 5C0XG 1EIFA 5KYLA 2ZM6L 4A3BG 1QNUA 4YWKA 3I70A 4PMBA 4B9WA 2QILA 1SYGA 1L1OA 1O7ZA 1PZJD 4HEDA 4J8QA 1IKMA 1J5EL 3HOXG 2K6AA 1IBML 1UEBA 2WB1B 3RZDH 4LF5L 3F2BA 2UU9Q 1C4QA 2G5DA 3ERQA 3U4VA 2WB1E 3GTGH 1ONLA 1CKNB 2GN5A 5FK9C 2N78A 1W6KA 2QA4A 3URYA 4PQXA 1PHJA 1JE5A 1TWGB 5JEAG 3PUXA 4JI5Q 1X3EA 3RLNA 1B3AA 3C1EA 2D9UA 3H0GH 4XYQA 1N36Q 1NMGA 1BR9A 1MSHA 2FFKB 3PMFA 2E2IB 5KYIA 1X9NA 3PO3B 2ZXOA 4X3SA 5LMUL 3CD6A 1N32L 4IUNA 2F03A 4J6HA 4IFDG 5CR3A 1WTRA 1QUQB 4DUYL 4BA2I 5BN4A 2LXKA 1MKHA 4DNRB 3STBC 1SYFA 2D0OA 2MGSA 3FKIB 1S5BD 3S9WA 2WKDA 4B9XA 5CC4A 3NHHA 4OWXB 3OW2A 1IL2A 4UY8C 1HZCA 4A3FG 2DNCA 2N3SA 4IALA 4JVZA 1H9MA 2ZTDA 3BZKA 3NQTA 3C1FA 1F2ZA 5EBCA 3J7AV 2NVQH 1X32A 2A6ED 5M5WB 1LT5D 3TZUA 5M5XH 1KRSA 1AE2A 3K7AH 1SSOA 1PRTD 4ZKCB 1F2MA 3K81C 4DV2L 5GAGC 4A3LG 1W3SA 1EY7A 4C56C 1PXUA 2A68D 2F0VA 2IX3A 3E0EA 1FVIA 3HOUH 5IYCG 4B3MQ 3S1NH 4HIKA 1VQDA 2XWBB 3S2DB 2XGTA 4DR2L 1G6PA 1HZ9A 1DM0B 2RSOA 4NXMQ 3BVMA 2EYFA 2F0MA 4B3SQ 4DR1Q 4KY6A 2Z0SA 4QIWB 2Q8TA 4TRDA 3PUWA 4IURA 5KEEA 4QIWE 2F4IA 4A75A 2RBMA 4PZ6A 1WTVA 1JJGA 2KVMA 1BQQT 3W1BA 2HT1A 1W6JA 2MJ8A 1TWFB 2EY1A 3UDXA 1VQAA 3AU7A 1GUSA 1SAPA 1PTOD 3OWFA 1EU3A 3W5OA 2K33A 2XN9C 5LMNQ 4X3UA 1JJCB 1STGA 5CV4A 1SMYD 4HCSA 3SVMA 4ZQ3A 1NBWA 5EPLA 3HOWB 1YEZA 5IYBH 3A56A 3ONAB 1ASYA 3OIQA 1CI3M 3BG3A 1ICWA 5CV6A 3CCJA 1KDAA 3IFTA 5JVG3 4JI5L 1QZGA 5JEAJ 2EYMA 3G48A 5IE8A 5CMDA 3CC4A 4C3IG 1N36L 4N8FA 4PV1C 1I6VC 1VCIA 1LT3D 1LTSD 2CCZA 4LUOA 4IFDJ 4Y52H 3NTHA 3F2DA 4CJ2C 3KYHC 4CBVA 2A1AA 5CV9A 4A3KH 1GHKA 1EWCA 1FGBD 3LX0A 2K50A 4BA1I 4WFN3 5C6AA 3K8AA 1YJWA 2E75C 1R4PB 3PUVA 3SEBA 2OTLA 1LT4D 1VF5C 1HNWQ 3H3VH 1JCKB 1H9SB 3M7GA 4ODGA 3U9OA 2UUCL 1N33Q 4QCLA 1G2TA 1SE4A 3PO3G 3I4NB 3AYHB 2F0NA 3DEOA 2K5DA 4I7ZC 1UNSA 1V1OA 1WCMH 4ZYSA 4LF9Q 3FKIG 4JI4Q 1O80A 4M1UB 1SE2A 3GD7A 4JV5Q 3VYTA 4A3MG 1YZ6A 4IPGA 3QB3A 4O0AA 3D6WA 3D4DA 2PZWA 4B3ML 4KJOA 1U9RA 1PRTF 4G4KA 3TRZA 3TQYA 5FLMH 4JI3Q 4NXML 4OO1I 3TN2A 2V1CC 4DR1L 4B3SL 3TZDA 4UP9A 4LF7Q 4ZK9B 5I9PA 3IL8A 3B6YA 5A35A 2A6EC 2LS01 1WTHA 3GTOH 1V43A 2VB3X 4HJAA 5NUCA 2JEAI 3GTPH 2YTVA 3RNUA 1UEAB 3M85A 1G2SA 4CJ1B 1B1ZA 3NQIA 1X3QA 4OXPA 3I72A 2MO1A 5E4WC 3KF6A 1QG7A 4B3RQ 3H3VI 2F0JA 4M8AA 1T9HA 1UE1A 1PH8A 1FYCA 3CQZB 4FVMA 2GVAA 2WAQB 4RGOS 2CW0D 1TWCH 5LMNL 2C35B 3Q8DA 2WAQE 4JC0A 1Q8IA 4HIOA 3T4AC 5ELFA 3E6ZX 3X3NA 2BH8A 4QY7A 4XT3B 4GOPB 2R92G 2DY7A 1XPRA 2Z8LA 3G7LA 4A3DB 4BY1G 4ZUJA 5FKAC 4WJ3M 3CRLC 3R2TA 4X3KA 3P7JA 1MI2A 5ELEA 4R4QA 1Q7YC 1TR5A 1HTPA 2H4OA 5C0XH 2OT2A 4DNIA 4DV7Q 5K5PA 3G4SA 5EQ0A 4DR5Q 3M4PA 1YNXA 4DK3C 1V1QA 1Y69U 4K5VA 4DK0A 3GTMH 1I50H 4DR6Q 3N52A 1MJCA 1OO9B 3QIAA 1ILQA 4RCOA 1BCPF 1ENAA 4LMQD 3EIVA 4F7XA 2KECA 1PDQA 1YNJD 4RA8A 5J1ZA 1BO0A 3DM3A 1SYEA 1HNWL 1N33L 1I4GA 1JORA 4GS3A 4TQUS 4ILWA 3RN2A 4FXDA 2VS1A 2AQ1B 4FNFA 2WKCA 3R8BA 3Q22A 3S15B 4LF9L 1BCPC 5C3WA 2YTXA 3HKZB 1C8CA 4JI7Q 1EIGA 2L15A 3HKZE 2EY5A 4JI6Q 4POGA 1PYSB 4JV5L 1S5DD 3I4MB 3VYUA 4DN4M 3AFPA 1T5XD 5AJ3Q 4DV4Q 3I4NG 3L3OC 1IHZA 1EIYB 2L4NA 3J81i 1E2VA 3HS0C 4A3FH 4JI3L 2Z1CA 5HY6A 3CC2A 3J80E 4XQJA 1Q90A 2AUJD 3SK8A 5D3IB 3C3LA 3N6RA 1B9NA 1QB5D 2VL6A 4P73A 4UPAA 1HA6A 4LF7L 1PH7A 1IBKL 5ELOA 1SE3A 4I7AA 1CHQD 2EPBA 1GUNA 1VMPA 1EYDA 2JA5H 3VR3A 3Q6SA 2EY2A 3BZCA 2LXJA 4DXGA 3DLLA 3A5UA 1JJ2A 4L5SA 1FJGQ 3PUYA 3NENA 1R9TB 5C4XB 2ZJQA 4B3RL 3FRPB 3D6CA 3S1RH 2NVTH 1NR2A 1KAAA 3E3XA 4OHJA 2EY6A 1QOHA 4QJFA 4LUZA 3VR5A 2A69C 1EZ8A 2NUCA 4K5WA 3M4QA 1ESRA 1BF4A 4DFAA 5DLQE 1KD1C 4K8JA 1YIJA 4XIGS 2CQOA 2RHQB
chains in the Genus database with same CATH topology
2CWPA 1Y1VG 2QGQA 4L5TA 4DR3L 2BH2A 1XPUA 4A93G 1Q12A 3JAMi 4DV7L 4LF6Q 1A62A 5JJKA 2KHJA 2WAQG 5IP7G 1VQKA 1OXVA 4AYBE 4AYBG 3CPWA 2HHHQ 1KIXA 4A3GG 5C4JH 2HQLA 4DR5L 2K5VA 1YJNA 1G51A 1XPOA 1B70B 5K36G 3UE1A 4GKKL 2KCMA 4DV2Q 4IPCA 1HJPA 4B3TL 2K52A 1SR3A 5IWAQ 4GNXC 5M3MH 1HNZL 4BBRG 4LFCL 3IRBA 3RR5A 2VNUD 4DR6L 4C3HH 1GM5A 1YJ9A 4WJ4A 5GAHC 4H02A 1PYBA 4YY3Q 4OWWB 1OXTA 4HJ5A 2E2HH 1VQGA 5J3BA 4DV3L 3I7FA 1PA6A 4JI1L 4A3BH 2R7ZH 4BY7G 1IYJB 1EUJA 4GNXA 2PQAA 1KXLA 4EX5A 3PGZA 1SMXA 1D8LA 3TS0A 1UE6A 3K80C 3PSIA 4TVAB 4GKKQ 2DGYA 3HOVG 4AQYQ 5C0XJ 1K9MC 4MZ9A 4UP7A 3RN5A 2VY3A 3W1GA 1VQBA 4QQBX 3AFQA 3PIPA 5LMNW 1SN8A 3ULLA 1A8VA 3HOXH 2ATWA 4RG1A 3AEVA 4R4OA 2MNAA 1CKOA 4HJ7A 1FGUA 1VQOA 1HNXL 4NB3A 4DV3Q 4LFBL 4DPGA 2Q2TA 1OTCA 3MEFA 2F3IA 1YHQA 1G291 2F52A 4EQ5A 2JEBI 2JQOA 3ERSX 3KLWA 1VQIA 2ZJPA 4X62Q 1L1OC 3MXNB 3TS2A 4JI6L 3CCEA 3J7A5 2ZTEA 1Q1BA 3T1YQ 5C3EH 5C0XG 3CC7A 2UU9L 1OXSC 1EIFA 2ZM6L 1ASZA 4J15A 4A3BG 2R7ZG 4YWKA 1TWGH 1QVGA 5AJ3L 1JT8A 2NN6G 2JA6H 2NVYH 4DV4L 1XNRQ 3CCUA 1L1OA 1X55A 1SFOH 1J5EL 2E2IH 4MTNA 3PO3H 3HOXG 2IHEA 2PNHA 4NXNQ 2E8GA 1VQ7A 1IBML 3U50C 3HKZG 4JI0L 1UEBA 3RZDH 1XJVA 4LF5L 1E7ZA 3F2BA 2UU9Q 1GVPA 2ID0A 1E1OA 4KLKA 3SGIA 5E7NA 3U4VA 5M3FH 2VUMH 4KHZA 2WB1E 2WB1G 2BA0A 3GTGH 5IP9H 1QVFA 4DUZL 1CKNB 2GN5A 2YTYA 3FKIH 4JCVE 3I4MG 2IT1A 2N78A 1K0RA 4IPHA 2QA4A 3WWVA 2Y0SE 4A4IA 1JB7A 3GTQH 1PHJA 1JE5A 4RMFA 5JEAG 3PUXA 5C3EG 2Q2HA 4JI5Q 2B63H 1X3EA 3HFZB 3RLNA 3STBD 5C0XI 1KAWA 1NMFA 3EBEA 4XTCS 1VQ6A 3H0GH 1B7YB 4JI2Q 1EQQA 1FJGL 1N36Q 1NMGA 1S72A 1GO3E 3RLOA 3A74A 1X9NA 4POFA 5LMUL 4IJLA 3CD6A 3L7ZC 1N32L 1I3QH 1I5FA 4DV0Q 1Y1WH 4IFDG 1D7QA 1QUQB 4DUYL 4BA2I 5M5WH 1EYGA 2NVXH 2LXKA 4OO1G 1MKHA 2EQSA 3STBC 1XMQQ 1UE5A 3K7UC 3A0JA 2D0OA 1LUZA 1S3OA 1V9PA 1E24A 4NPSA 4K0KL 4A3LH 5IP9G 4LFAL 3T1HQ 2JK8A 3H15A 4OWXB 3NEMA 1Q1EA 3OW2A 1IL2A 4UY8C 1JMCA 3CMAA 2B63G 4DV6Q 1HZCA 4A3FG 2N3SA 4JBJA 5IYCH 1E22A 5C4XG 1HZAA 1X56A 2ZTDA 3BZKA 4O2DA 4GNXB 2PQAB 1KL9A 3A5ZB 1UE7A 4HJ8A 3LGJA 3S2DH 4IJHA 5M5YH 2PMZE 2K5HA 4IPDA 2NVQH 4A3IG 2UUAQ 5M5XH 2UUBQ 1KRSA 1AE2A 4A3CG 3K7AH 4GKJQ 1CKNA 3UE0A 2HHHL 3M3YH 1OXXK 2IX0A 3ZJYC 1KHIA 2K14A 1EQRA 1YVCA 3K81C 4PZ7A 3PIOA 4DV2L 1WOCA 5GAGC 4A3LG 1W3SA 3F1ZA 4MNOA 3L0OA 5H1SE 1NTGA 3CPFA 3HKSA 3ICEA 3S14H 3E0EA 2UXCL 2H5XA 1FVIA 4YY3L 1M1KC 5IYCG 1VQ9A 4B3MQ 3HOUH 4HIKA 3S1NH 1VQDA 1TWFH 4JYAQ 2XGTA 2KBNA 4DR2L 1G6PA 1QUQA 1HZ9A 1HR0W 1E3PA 4LF4L 2GVBA 2IHFA 4NXMQ 2Z6KC 3J80c 1Q86C 4B3SQ 4DR1Q 1L1OB 4AQYL 4UP8A 2Q2IA 2Z0SA 1H95A 1PH4A 3I55A 3PUWA 1K8AC 3RLFA 2N8NA 1VQPA 4YWMA 1Z47A 3E9IA 4QIWE 4GLXA 2UXCQ 3E9HA 3HOZG 1Q46A 4A75A 2Z6KA 1PFSA 4PZ6A 3J80i 3J81j 5FJ8G 2OQKA 1JJGA 4DR2Q 2HT1A 3W1BA 1N34Q 3HOWH 4LF4Q 3D0FA 4YCVA 4X62L 4DAMA 2D0PA 2AWOA 1L0WA 2KCTA 2AHOB 2JJQA 3UDXA 4APVA 3T1YL 1VQAA 1VQEA 4YHHQ 4IOCA 1YHBA 1A0IA 4C3IH 1X54A 1XNRL 2R7FA 3W5OA 4GLVB 5M3MG 1J6QA 5LMNQ 4C2MH 1JJCB 1YBYA 2XTIA 3S17H 1VQCA 4NXNL 2K75A 1NBWA 4LUVA 2KENA 1YEZA 5IYBH 1C0AA 3KFUA 1ASYA 5JJIA 1N9WA 1BVSA 1VQHA 3HOWG 4L5RC 2NZOA 5EAYA 2JA9A 1NY4A 3I2ZA 4YCWA 4A3EH 1YI2A 1K83H 3CCJA 3CCQA 4JI5L 1QZGA 5JEAJ 2OTJA 3G48A 2R93H 5IE8A 4X66Q 1P16A 1XNQQ 3CC4A 1LYLA 4JI2L 3I4OA 1N36L 1EFWA 3I4NH 1YITA 1VCIA 4OWTB 4GOPC 1I94Q 4DK6C 2CCZA 5IT9c 4R4CA 4DV0L 3EN2A 1LM0A 3AQQA 4LUOA 4X65Q 2B29A 1W2BA 5HGQA 4IFDJ 4Y52H 3RZOH 2EIFA 3HOYH 3F2DA 3GDEA 3JC66 1O7IA 2Y0SG 4YCUA 3J7ZC 4DV1Q 3KYHC 1XMQL 4OX9Q 4ALPA 1WYDA 5IYBG 4PMWA 4YWLA 1AE3A 2A1AA 1UWVA 1TWAH 4GOPA 4A3KH 3NBHB 1BBWA 4BA1I 3T1HL 2K50A 4A3MH 2JA6G 2NN6I 3S24A 2JA7H 2AWNA 3K8AA 1C7YA 1YJWA 4JI4L 1VQNA 4DR7Q 3PUVA 2OTLA 1RIPA 2VZAA 3FHWA 2KHIA 4DV6L 2A8VA 4C3JH 1HNWQ 3H3VH 4GN4B 2UUCL 2ASBA 2RHSB 1N33Q 3PO3G 2VQEQ 4P72A 4FDBA 4DR4Q 3AYHB 1Q81C 2I5MX 2VW9A 2ALYB 1PH6A 2UXDQ 4JOIC 4L5QA 5M3FG 1VQMA 2VUMG 1BKBA 1WCMH 3KF6B 2E2JH 4LF9Q 3I56A 2D62A 4LW1A 1S40A 2UUAL 2UUBL 3FKIG 4GKJL 1SLJA 4QL5A 4JI4Q 2JA8H 4R4TA 2JE6I 1XMOQ 3GD7A 4JV5Q 3PUZA 2UUCQ 4JOIA 5GAEC 3H0GG 3L2PA 4R1JA 4A3MG 1YZ6A 4IPGA 4O0AA 2VQFQ 3CCMA 1KQSA 2DUDA 2YU9H 1EOVA 2R6GA 4B3ML 1Y1WG 4JYAL 1KC8C 4AIMA 3TQYA 5FLMH 4JI3Q 4LNQA 3TRZA 3CCVA 4IFDI 2K4KA 3CCRA 4NXML 4OO1I 1L2FA 3M7NA 4X64Q 2UXBQ 2V1CC 4DR1L 4B3SL 1C9OA 1WCMG 4ME3A 2IX1A 4A93H 4UP9A 1BBUA 3CQZH 4AH6A 4LF7Q 3PO2H 3B6YA 3TREA 5IP7H 2JA8G 3S2HH 2ES2A 3BJUA 3OTOQ 1RL2A 1AH9A 1U5KA 1V43A 1CSPA 3ULJA 1Z9FA 2WP8J 1MJEA 3GTOH 4HJAA 3OYYA 2R92H 3ER0A 2JEAI 3GTPH 1N34L 2YTVA 3RNUA 4BY1H 3M85A 2HIVA 2F4VQ 1VS0A 3PF5A 4OXPA 4A3DH 2MO1A 3KF6A 3UDGA 1HR0Q 4YHHL 3H3VI 4B3RQ 1MIUA 3CXCA 4P71A 1N8RC 1T9HA 3K0XA 4DKAC 3S1MH 1UE1A 3PF4A 1VQ8A 1PH8A 5BR8L 3CP0A 2GVAA 1XTDA 2CKZB 1TWCH 2PI2E 5LMNL 4HIDA 4JBKA 2C35B 3HOVH 3M4OH 3PO2G 3Q8DA 2WAQE 4LF8Q 1CSQA 4BBSH 4KHPQ 4JC0A 4HIOA 1K73C 5IYDH 3HOUG 2BH8A 2YYZA 4JBWA 4QY7A 4GOPB 4LWCA 3PV0A 2FXQA 1XPRA 2E5LQ 2R92G 3KDFA 1EWIA 5ELNA 4BY1G 5BR8Q 2NZHA 1IXRA 1HZBA 4WJ3M 5GADC 4DR3Q 4A3DG 4R4QA 1CKMA 3CW2C 3PCOB 1Q7YC 4X66L 4DV7Q 1K8GA 4DNIA 2Q2UA 1XNQL 1CUKA 4HJ9A 1PVOA 4GN5A 3KJOA 3G4SA 1LTLA 1WFQA 3CMEA 4DR5Q 5JJLA 1E1TA 3M4PA 1YNXA 4KI0A 1PV4A 1I94L 1VQLA 4DK3C 3TEHB 1V1QA 4X6AH 4B3TQ 4BBSG 4X65L 1VQ4A 1HNZQ 4LFCQ 3GTMH 1I50H 3S15H 4R4IA 1KRTA 1SROA 3M9BA 4DR6Q 2I0QA 4DV1L 5IYDG 2AMCB 4OX9L 1MJCA 1PH2A 3U58A 1GKHA 1M90C 2IY5B 1NE3A 4JI1Q 2B3GA 4HIMA 3CAMA 4A3JH 3EIVA 4DR7L 2AKWB 2PI2A 2ZTCA 3I4MH 2WFWA 4P75A 2ZJRA 3DM3A 1GD7A 3GTKH 1HNWL 3VDYA 1PH3A 3F8TA 2OQ0A 1N33L 2I5HA 2A19A 4GS3A 2VQEL 4TQUS 4DR4L 5GROA 1P8LA 2K5NA 3RN2A 3FP9A 4JG2A 2VS1A 4Y7NH 1Q82C 2UXDL 2I5LX 3CCLA 1WJJA 2BA1A 2YV5A 4LF9L 4OONA 1HNXQ 3KOJA 2CFMA 4LFBQ 1A63A 2YTXA 2RCNA 3BU2A 4JI7Q 4PZ8A 1VQFA 3J81c 4A3EG 2MO0A 3ULPA 1XMOL 2L15A 2R7DA 3HKZE 2QEXA 4JI6Q 1PYSB 4POGA 1X65A 1VQ5A 4JV5L 2R93G 2ZM6Q 1U0LA 2OCEA 3U4ZA 1SE8A 3AFPA 4A3JG 5AJ3Q 3CF5A 2VQFL 4DV4Q 3I4NG 3KF8B 1EIYB 3J81i 1NJIC 4BXXH 2RF4A 5FLXc 3F2CA 4A3FH 4DV5L 1R9TH 1WI5A 2LSSA 4JI3L 5HY6A 5C4XH 1J5EQ 4JBMA 3HOYG 3CC2A 4GN3B 5IY0A 1X6OA 4X64L 1IBMQ 4JI0Q 2UXBL 4P74A 4LF5Q 1PH9A 4P73A 2VL6A 4UPAA 4JI8L 4A3KG 1YHAA 4LF7L 1PH7A 3D31A 5ELOA 4A3IH 1IBKL 2JA7G 4A3CH 3GTLH 4DUZQ 4IOAA 1IZ6A 2MQHA 1PH5A 2JA5H 3OTOL 3BZCA 2LXJA 3G71A 3DLLA 5C44H 4DV5Q 3UDIA 4DAYB 3S16H 3KDFB 3A5UA 3G6EA 3GTJH 1JJ2A 1TWHH 3UDFA 2EXDA 4JI7L 2HIXA 4IO9A 3PUYA 3NENA 3KJPA 3CCSA 1Y1VH 4PG3A 4L5SA 1FJGQ 2F4VL 1VQJA 4BXXG 1IBLL 1B8AA 4JI8Q 2ZJQA 1HR0L 1FL0A 5LMUQ 4B3RL 1N32Q 2OWOA 3S1RH 1QVCA 1IBKQ 2NVTH 1K3RA 4DUYQ 2N49A 1TXYA 1I6HH 1PH1A 4A3GH 2CWAA 1X3GA 1OXUA 4QJFA 4LF6L 4K0KQ 1X3FA 4KHPL 4GLAC 4LFAQ 4LF8L 1Y14B 4BBRH 1Q8KA 4LUZA 1HH2P 3JAMc 3GO5A 3M4QA 2JA5G 2MFIA 1IBLQ 3S1QH 1SRUA 5GQOA 5C44G 3NELA 4A76A 3HOZH 5FLMG 2E5LL 4QGUA 5DLQE 1DGSA 5FJ8H 5IWAL 1QZHA 1KD1C 4BY7H 1YIJA 4XIGS 2CQOA 2RHQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CWP A;  1Y1V G;  2QGQ A;  4L5T A;  4DR3 L;  2BH2 A;  1XPU A;  4A93 G;  1Q12 A;  3JAM i;  4DV7 L;  4LF6 Q;  1A62 A;  5JJK A;  2KHJ A;  2WAQ G;  5IP7 G;  1VQK A;  1OXV A;  4AYB E;  4AYB G;  3CPW A;  2HHH Q;  1KIX A;  4A3G G;  5C4J H;  2HQL A;  4DR5 L;  2K5V A;  1YJN A;  1G51 A;  1XPO A;  1B70 B;  5K36 G;  3UE1 A;  4GKK L;  2KCM A;  4DV2 Q;  4IPC A;  1HJP A;  4B3T L;  2K52 A;  1SR3 A;  5IWA Q;  4GNX C;  5M3M H;  1HNZ L;  4BBR G;  4LFC L;  3IRB A;  3RR5 A;  2VNU D;  4DR6 L;  4C3H H;  1GM5 A;  1YJ9 A;  4WJ4 A;  5GAH C;  4H02 A;  1PYB A;  4YY3 Q;  4OWW B;  1OXT A;  4HJ5 A;  2E2H H;  1VQG A;  5J3B A;  4DV3 L;  3I7F A;  1PA6 A;  4JI1 L;  4A3B H;  2R7Z H;  4BY7 G;  1IYJ B;  1EUJ A;  4GNX A;  2PQA A;  1KXL A;  4EX5 A;  3PGZ A;  1SMX A;  1D8L A;  3TS0 A;  1UE6 A;  3K80 C;  3PSI A;  4TVA B;  4GKK Q;  2DGY A;  3HOV G;  4AQY Q;  5C0X J;  1K9M C;  4MZ9 A;  4UP7 A;  3RN5 A;  2VY3 A;  3W1G A;  1VQB A;  4QQB X;  3AFQ A;  3PIP A;  5LMN W;  1SN8 A;  3ULL A;  1A8V A;  3HOX H;  2ATW A;  4RG1 A;  3AEV A;  4R4O A;  2MNA A;  1CKO A;  4HJ7 A;  1FGU A;  1VQO A;  1HNX L;  4NB3 A;  4DV3 Q;  4LFB L;  4DPG A;  2Q2T A;  1OTC A;  3MEF A;  2F3I A;  1YHQ A;  1G29 1;  2F52 A;  4EQ5 A;  2JEB I;  2JQO A;  3ERS X;  3KLW A;  1VQI A;  2ZJP A;  4X62 Q;  1L1O C;  3MXN B;  3TS2 A;  4JI6 L;  3CCE A;  3J7A 5;  2ZTE A;  1Q1B A;  3T1Y Q;  5C3E H;  5C0X G;  3CC7 A;  2UU9 L;  1OXS C;  1EIF A;  2ZM6 L;  1ASZ A;  4J15 A;  4A3B G;  2R7Z G;  4YWK A;  1TWG H;  1QVG A;  5AJ3 L;  1JT8 A;  2NN6 G;  2JA6 H;  2NVY H;  4DV4 L;  1XNR Q;  3CCU A;  1L1O A;  1X55 A;  1SFO H;  1J5E L;  2E2I H;  4MTN A;  3PO3 H;  3HOX G;  2IHE A;  2PNH A;  4NXN Q;  2E8G A;  1VQ7 A;  1IBM L;  3U50 C;  3HKZ G;  4JI0 L;  1UEB A;  3RZD H;  1XJV A;  4LF5 L;  1E7Z A;  3F2B A;  2UU9 Q;  1GVP A;  2ID0 A;  1E1O A;  4KLK A;  3SGI A;  5E7N A;  3U4V A;  5M3F H;  2VUM H;  4KHZ A;  2WB1 E;  2WB1 G;  2BA0 A;  3GTG H;  5IP9 H;  1QVF A;  4DUZ L;  1CKN B;  2GN5 A;  2YTY A;  3FKI H;  4JCV E;  3I4M G;  2IT1 A;  2N78 A;  1K0R A;  4IPH A;  2QA4 A;  3WWV A;  2Y0S E;  4A4I A;  1JB7 A;  3GTQ H;  1PHJ A;  1JE5 A;  4RMF A;  5JEA G;  3PUX A;  5C3E G;  2Q2H A;  4JI5 Q;  2B63 H;  1X3E A;  3HFZ B;  3RLN A;  3STB D;  5C0X I;  1KAW A;  1NMF A;  3EBE A;  4XTC S;  1VQ6 A;  3H0G H;  1B7Y B;  4JI2 Q;  1EQQ A;  1FJG L;  1N36 Q;  1NMG A;  1S72 A;  1GO3 E;  3RLO A;  3A74 A;  1X9N A;  4POF A;  5LMU L;  4IJL A;  3CD6 A;  3L7Z C;  1N32 L;  1I3Q H;  1I5F A;  4DV0 Q;  1Y1W H;  4IFD G;  1D7Q A;  1QUQ B;  4DUY L;  4BA2 I;  5M5W H;  1EYG A;  2NVX H;  2LXK A;  4OO1 G;  1MKH A;  2EQS A;  3STB C;  1XMQ Q;  1UE5 A;  3K7U C;  3A0J A;  2D0O A;  1LUZ A;  1S3O A;  1V9P A;  1E24 A;  4NPS A;  4K0K L;  4A3L H;  5IP9 G;  4LFA L;  3T1H Q;  2JK8 A;  3H15 A;  4OWX B;  3NEM A;  1Q1E A;  3OW2 A;  1IL2 A;  4UY8 C;  1JMC A;  3CMA A;  2B63 G;  4DV6 Q;  1HZC A;  4A3F G;  2N3S A;  4JBJ A;  5IYC H;  1E22 A;  5C4X G;  1HZA A;  1X56 A;  2ZTD A;  3BZK A;  4O2D A;  4GNX B;  2PQA B;  1KL9 A;  3A5Z B;  1UE7 A;  4HJ8 A;  3LGJ A;  3S2D H;  4IJH A;  5M5Y H;  2PMZ E;  2K5H A;  4IPD A;  2NVQ H;  4A3I G;  2UUA Q;  5M5X H;  2UUB Q;  1KRS A;  1AE2 A;  4A3C G;  3K7A H;  4GKJ Q;  1CKN A;  3UE0 A;  2HHH L;  3M3Y H;  1OXX K;  2IX0 A;  3ZJY C;  1KHI A;  2K14 A;  1EQR A;  1YVC A;  3K81 C;  4PZ7 A;  3PIO A;  4DV2 L;  1WOC A;  5GAG C;  4A3L G;  1W3S A;  3F1Z A;  4MNO A;  3L0O A;  5H1S E;  1NTG A;  3CPF A;  3HKS A;  3ICE A;  3S14 H;  3E0E A;  2UXC L;  2H5X A;  1FVI A;  4YY3 L;  1M1K C;  5IYC G;  1VQ9 A;  4B3M Q;  3HOU H;  4HIK A;  3S1N H;  1VQD A;  1TWF H;  4JYA Q;  2XGT A;  2KBN A;  4DR2 L;  1G6P A;  1QUQ A;  1HZ9 A;  1HR0 W;  1E3P A;  4LF4 L;  2GVB A;  2IHF A;  4NXM Q;  2Z6K C;  3J80 c;  1Q86 C;  4B3S Q;  4DR1 Q;  1L1O B;  4AQY L;  4UP8 A;  2Q2I A;  2Z0S A;  1H95 A;  1PH4 A;  3I55 A;  3PUW A;  1K8A C;  3RLF A;  2N8N A;  1VQP A;  4YWM A;  1Z47 A;  3E9I A;  4QIW E;  4GLX A;  2UXC Q;  3E9H A;  3HOZ G;  1Q46 A;  4A75 A;  2Z6K A;  1PFS A;  4PZ6 A;  3J80 i;  3J81 j;  5FJ8 G;  2OQK A;  1JJG A;  4DR2 Q;  2HT1 A;  3W1B A;  1N34 Q;  3HOW H;  4LF4 Q;  3D0F A;  4YCV A;  4X62 L;  4DAM A;  2D0P A;  2AWO A;  1L0W A;  2KCT A;  2AHO B;  2JJQ A;  3UDX A;  4APV A;  3T1Y L;  1VQA A;  1VQE A;  4YHH Q;  4IOC A;  1YHB A;  1A0I A;  4C3I H;  1X54 A;  1XNR L;  2R7F A;  3W5O A;  4GLV B;  5M3M G;  1J6Q A;  5LMN Q;  4C2M H;  1JJC B;  1YBY A;  2XTI A;  3S17 H;  1VQC A;  4NXN L;  2K75 A;  1NBW A;  4LUV A;  2KEN A;  1YEZ A;  5IYB H;  1C0A A;  3KFU A;  1ASY A;  5JJI A;  1N9W A;  1BVS A;  1VQH A;  3HOW G;  4L5R C;  2NZO A;  5EAY A;  2JA9 A;  1NY4 A;  3I2Z A;  4YCW A;  4A3E H;  1YI2 A;  1K83 H;  3CCJ A;  3CCQ A;  4JI5 L;  1QZG A;  5JEA J;  2OTJ A;  3G48 A;  2R93 H;  5IE8 A;  4X66 Q;  1P16 A;  1XNQ Q;  3CC4 A;  1LYL A;  4JI2 L;  3I4O A;  1N36 L;  1EFW A;  3I4N H;  1YIT A;  1VCI A;  4OWT B;  4GOP C;  1I94 Q;  4DK6 C;  2CCZ A;  5IT9 c;  4R4C A;  4DV0 L;  3EN2 A;  1LM0 A;  3AQQ A;  4LUO A;  4X65 Q;  2B29 A;  1W2B A;  5HGQ A;  4IFD J;  4Y52 H;  3RZO H;  2EIF A;  3HOY H;  3F2D A;  3GDE A;  3JC6 6;  1O7I A;  2Y0S G;  4YCU A;  3J7Z C;  4DV1 Q;  3KYH C;  1XMQ L;  4OX9 Q;  4ALP A;  1WYD A;  5IYB G;  4PMW A;  4YWL A;  1AE3 A;  2A1A A;  1UWV A;  1TWA H;  4GOP A;  4A3K H;  3NBH B;  1BBW A;  4BA1 I;  3T1H L;  2K50 A;  4A3M H;  2JA6 G;  2NN6 I;  3S24 A;  2JA7 H;  2AWN A;  3K8A A;  1C7Y A;  1YJW A;  4JI4 L;  1VQN A;  4DR7 Q;  3PUV A;  2OTL A;  1RIP A;  2VZA A;  3FHW A;  2KHI A;  4DV6 L;  2A8V A;  4C3J H;  1HNW Q;  3H3V H;  4GN4 B;  2UUC L;  2ASB A;  2RHS B;  1N33 Q;  3PO3 G;  2VQE Q;  4P72 A;  4FDB A;  4DR4 Q;  3AYH B;  1Q81 C;  2I5M X;  2VW9 A;  2ALY B;  1PH6 A;  2UXD Q;  4JOI C;  4L5Q A;  5M3F G;  1VQM A;  2VUM G;  1BKB A;  1WCM H;  3KF6 B;  2E2J H;  4LF9 Q;  3I56 A;  2D62 A;  4LW1 A;  1S40 A;  2UUA L;  2UUB L;  3FKI G;  4GKJ L;  1SLJ A;  4QL5 A;  4JI4 Q;  2JA8 H;  4R4T A;  2JE6 I;  1XMO Q;  3GD7 A;  4JV5 Q;  3PUZ A;  2UUC Q;  4JOI A;  5GAE C;  3H0G G;  3L2P A;  4R1J A;  4A3M G;  1YZ6 A;  4IPG A;  4O0A A;  2VQF Q;  3CCM A;  1KQS A;  2DUD A;  2YU9 H;  1EOV A;  2R6G A;  4B3M L;  1Y1W G;  4JYA L;  1KC8 C;  4AIM A;  3TQY A;  5FLM H;  4JI3 Q;  4LNQ A;  3TRZ A;  3CCV A;  4IFD I;  2K4K A;  3CCR A;  4NXM L;  4OO1 I;  1L2F A;  3M7N A;  4X64 Q;  2UXB Q;  2V1C C;  4DR1 L;  4B3S L;  1C9O A;  1WCM G;  4ME3 A;  2IX1 A;  4A93 H;  4UP9 A;  1BBU A;  3CQZ H;  4AH6 A;  4LF7 Q;  3PO2 H;  3B6Y A;  3TRE A;  5IP7 H;  2JA8 G;  3S2H H;  2ES2 A;  3BJU A;  3OTO Q;  1RL2 A;  1AH9 A;  1U5K A;  1V43 A;  1CSP A;  3ULJ A;  1Z9F A;  2WP8 J;  1MJE A;  3GTO H;  4HJA A;  3OYY A;  2R92 H;  3ER0 A;  2JEA I;  3GTP H;  1N34 L;  2YTV A;  3RNU A;  4BY1 H;  3M85 A;  2HIV A;  2F4V Q;  1VS0 A;  3PF5 A;  4OXP A;  4A3D H;  2MO1 A;  3KF6 A;  3UDG A;  1HR0 Q;  4YHH L;  3H3V I;  4B3R Q;  1MIU A;  3CXC A;  4P71 A;  1N8R C;  1T9H A;  3K0X A;  4DKA C;  3S1M H;  1UE1 A;  3PF4 A;  1VQ8 A;  1PH8 A;  5BR8 L;  3CP0 A;  2GVA A;  1XTD A;  2CKZ B;  1TWC H;  2PI2 E;  5LMN L;  4HID A;  4JBK A;  2C35 B;  3HOV H;  3M4O H;  3PO2 G;  3Q8D A;  2WAQ E;  4LF8 Q;  1CSQ A;  4BBS H;  4KHP Q;  4JC0 A;  4HIO A;  1K73 C;  5IYD H;  3HOU G;  2BH8 A;  2YYZ A;  4JBW A;  4QY7 A;  4GOP B;  4LWC A;  3PV0 A;  2FXQ A;  1XPR A;  2E5L Q;  2R92 G;  3KDF A;  1EWI A;  5ELN A;  4BY1 G;  5BR8 Q;  2NZH A;  1IXR A;  1HZB A;  4WJ3 M;  5GAD C;  4DR3 Q;  4A3D G;  4R4Q A;  1CKM A;  3CW2 C;  3PCO B;  1Q7Y C;  4X66 L;  4DV7 Q;  1K8G A;  4DNI A;  2Q2U A;  1XNQ L;  1CUK A;  4HJ9 A;  1PVO A;  4GN5 A;  3KJO A;  3G4S A;  1LTL A;  1WFQ A;  3CME A;  4DR5 Q;  5JJL A;  1E1T A;  3M4P A;  1YNX A;  4KI0 A;  1PV4 A;  1I94 L;  1VQL A;  4DK3 C;  3TEH B;  1V1Q A;  4X6A H;  4B3T Q;  4BBS G;  4X65 L;  1VQ4 A;  1HNZ Q;  4LFC Q;  3GTM H;  1I50 H;  3S15 H;  4R4I A;  1KRT A;  1SRO A;  3M9B A;  4DR6 Q;  2I0Q A;  4DV1 L;  5IYD G;  2AMC B;  4OX9 L;  1MJC A;  1PH2 A;  3U58 A;  1GKH A;  1M90 C;  2IY5 B;  1NE3 A;  4JI1 Q;  2B3G A;  4HIM A;  3CAM A;  4A3J H;  3EIV A;  4DR7 L;  2AKW B;  2PI2 A;  2ZTC A;  3I4M H;  2WFW A;  4P75 A;  2ZJR A;  3DM3 A;  1GD7 A;  3GTK H;  1HNW L;  3VDY A;  1PH3 A;  3F8T A;  2OQ0 A;  1N33 L;  2I5H A;  2A19 A;  4GS3 A;  2VQE L;  4TQU S;  4DR4 L;  5GRO A;  1P8L A;  2K5N A;  3RN2 A;  3FP9 A;  4JG2 A;  2VS1 A;  4Y7N H;  1Q82 C;  2UXD L;  2I5L X;  3CCL A;  1WJJ A;  2BA1 A;  2YV5 A;  4LF9 L;  4OON A;  1HNX Q;  3KOJ A;  2CFM A;  4LFB Q;  1A63 A;  2YTX A;  2RCN A;  3BU2 A;  4JI7 Q;  4PZ8 A;  1VQF A;  3J81 c;  4A3E G;  2MO0 A;  3ULP A;  1XMO L;  2L15 A;  2R7D A;  3HKZ E;  2QEX A;  4JI6 Q;  1PYS B;  4POG A;  1X65 A;  1VQ5 A;  4JV5 L;  2R93 G;  2ZM6 Q;  1U0L A;  2OCE A;  3U4Z A;  1SE8 A;  3AFP A;  4A3J G;  5AJ3 Q;  3CF5 A;  2VQF L;  4DV4 Q;  3I4N G;  3KF8 B;  1EIY B;  3J81 i;  1NJI C;  4BXX H;  2RF4 A;  5FLX c;  3F2C A;  4A3F H;  4DV5 L;  1R9T H;  1WI5 A;  2LSS A;  4JI3 L;  5HY6 A;  5C4X H;  1J5E Q;  4JBM A;  3HOY G;  3CC2 A;  4GN3 B;  5IY0 A;  1X6O A;  4X64 L;  1IBM Q;  4JI0 Q;  2UXB L;  4P74 A;  4LF5 Q;  1PH9 A;  4P73 A;  2VL6 A;  4UPA A;  4JI8 L;  4A3K G;  1YHA A;  4LF7 L;  1PH7 A;  3D31 A;  5ELO A;  4A3I H;  1IBK L;  2JA7 G;  4A3C H;  3GTL H;  4DUZ Q;  4IOA A;  1IZ6 A;  2MQH A;  1PH5 A;  2JA5 H;  3OTO L;  3BZC A;  2LXJ A;  3G71 A;  3DLL A;  5C44 H;  4DV5 Q;  3UDI A;  4DAY B;  3S16 H;  3KDF B;  3A5U A;  3G6E A;  3GTJ H;  1JJ2 A;  1TWH H;  3UDF A;  2EXD A;  4JI7 L;  2HIX A;  4IO9 A;  3PUY A;  3NEN A;  3KJP A;  3CCS A;  1Y1V H;  4PG3 A;  4L5S A;  1FJG Q;  2F4V L;  1VQJ A;  4BXX G;  1IBL L;  1B8A A;  4JI8 Q;  2ZJQ A;  1HR0 L;  1FL0 A;  5LMU Q;  4B3R L;  1N32 Q;  2OWO A;  3S1R H;  1QVC A;  1IBK Q;  2NVT H;  1K3R A;  4DUY Q;  2N49 A;  1TXY A;  1I6H H;  1PH1 A;  4A3G H;  2CWA A;  1X3G A;  1OXU A;  4QJF A;  4LF6 L;  4K0K Q;  1X3F A;  4KHP L;  4GLA C;  4LFA Q;  4LF8 L;  1Y14 B;  4BBR H;  1Q8K A;  4LUZ A;  1HH2 P;  3JAM c;  3GO5 A;  3M4Q A;  2JA5 G;  2MFI A;  1IBL Q;  3S1Q H;  1SRU A;  5GQO A;  5C44 G;  3NEL A;  4A76 A;  3HOZ H;  5FLM G;  2E5L L;  4QGU A;  5DLQ E;  1DGS A;  5FJ8 H;  5IWA L;  1QZH A;  1KD1 C;  4BY7 H;  1YIJ A;  4XIG S;  2CQO A;  2RHQ B; 
#chains in the Genus database with same CATH topology
 1DOK A;  1A3U A;  1GUG A;  3JAM i;  1I6H B;  2EYJ A;  4DV7 L;  1JWM D;  2WAQ G;  5IP7 G;  1OXV A;  3NXW A;  1STY A;  2HDL A;  4AYB G;  4HR7 B;  4DR5 L;  1YNN D;  2K5V A;  4F87 A;  3T56 B;  1YJN A;  1G51 A;  5IT9 E;  1B70 B;  2MP1 A;  1XPO A;  1GJX A;  4DF7 A;  4IPC A;  1ET6 A;  2K52 A;  4GNX C;  3S1Q B;  3IRB A;  3W3A A;  4DR6 L;  1YJ9 A;  3HOZ B;  2OXP A;  5GAH C;  1BOS A;  1OXT A;  4HJ5 A;  5J3B A;  4BY7 G;  2KA7 A;  2R7Z H;  1QJO A;  3D4R A;  4ZAI A;  4GKK Q;  3KLS A;  2DGY A;  4AQY Q;  2G9D A;  2F0K A;  3RN5 A;  3ND8 A;  1CK1 A;  5IOC A;  4RG1 A;  3I90 A;  2MNA A;  1STH A;  1MSG A;  3OIP A;  2MUY A;  4NB3 A;  1YHQ A;  3DUZ A;  4EQ5 A;  4JI7 L;  2JEB I;  2JQO A;  3ERS X;  4X62 Q;  1L1O C;  2E2H B;  1L0Y B;  5C4H A;  4JI6 L;  3NBI A;  3OW7 A;  3J7A 5;  2ZTE A;  4A3B B;  4RHS A;  3T1Y Q;  3SXH A;  1ZYR C;  1HXY D;  2G9H D;  3C2P A;  3BS1 A;  1TWG H;  5KIX A;  5AJ3 L;  5LL6 X;  1JT8 A;  4DV4 L;  5BN3 A;  4ZCK A;  1JWS D;  2F0W A;  3HOX B;  4FF3 A;  2E2I H;  2L12 A;  4MTN A;  3PO3 H;  1GHJ A;  2KJX A;  2IHE A;  1FNW A;  2PNH A;  4CDE C;  1VQ7 A;  3TDQ A;  3HKZ G;  1E7Z A;  4RKB A;  1GVP A;  5E7N A;  3CHB D;  5I9O A;  4KHZ A;  3FKI H;  4JCV E;  3I4M G;  1K0R A;  1V8Q A;  3WWV A;  3NTI A;  1I4R A;  4RMF A;  5C3E G;  2JA6 B;  2Q2H A;  2NVY B;  3STB D;  1KAW A;  1NMF A;  3EBE A;  4IUU A;  1FJG L;  1SFO B;  1ML0 D;  1SYB A;  3A74 A;  4IJL A;  5KNC A;  2HD3 A;  1D7Q A;  4K6L A;  2WAC A;  5M5W H;  4UAI A;  4OO1 G;  1UE5 A;  2SNM A;  3A0J A;  3H09 A;  5EPJ A;  3MAQ A;  5IP9 G;  1HQM C;  4KJN A;  4C1N I;  3J80 L;  3GTQ B;  3H15 A;  1MHW C;  1JMC A;  2B63 G;  2QDB A;  4DV6 Q;  1VDZ A;  4JBJ A;  1A2T A;  3O13 A;  5C4X G;  1HZA A;  1X56 A;  3I4L A;  2PQA B;  1KL9 A;  2EJG C;  1UE7 A;  3VA7 A;  2EYO A;  1I3Q B;  3J7Y W;  3S2D H;  3P1H A;  4IPD A;  2NVX B;  1B2T A;  3T53 B;  4A3I G;  2UUB Q;  1UUP A;  2R3Z A;  3UE0 A;  5E4X A;  2BE5 C;  1OXX K;  2IX0 A;  4U68 A;  1YVC A;  3SDZ A;  1EY8 A;  5KND A;  4MNO A;  1HRJ A;  1NTG A;  3CPF A;  4DU9 A;  2BDO A;  1F9Q A;  2UXC L;  2NVT B;  1VQ9 A;  3GV3 A;  1H9S A;  4JYA Q;  1TWF H;  4MIU A;  1HR0 W;  1SNM A;  5M5Y B;  4LF4 L;  1Q86 C;  2F0T A;  4MHE A;  1SEB D;  1TU2 B;  5A2Q L;  4AQY L;  3M3Y B;  2Q2I A;  5J22 A;  3H3V C;  1H95 A;  5COY A;  1VQP A;  1RHP A;  1Z47 A;  2M2L A;  3E9H A;  1PZI D;  3HOZ G;  1Q46 A;  3J81 j;  1EWH A;  1HTL D;  2OQK A;  4DR2 Q;  1RJT A;  3VYS A;  3HOW H;  1N34 Q;  2NYZ D;  3D0F A;  4X62 L;  4DAM A;  3K5O A;  5IT9 L;  4H13 C;  1STB A;  3NP8 A;  5CBE E;  2AHO B;  2JJQ A;  5CYU A;  3T1Y L;  3H6M A;  1VQE A;  4G7O C;  2TMP A;  3MFG A;  4IOC A;  4R9W A;  1YHB A;  1A0I A;  1EL0 A;  1STN A;  2B2Y A;  3LWE A;  1SYC A;  1DOL A;  1Q3L A;  1B50 A;  4EGV A;  5CV8 A;  1C0A A;  1TKW B;  2RA4 A;  1N9W A;  1BVS A;  4P2C B;  2RDG A;  1NY4 A;  3I2Z A;  2L1B A;  4YCW A;  1YI2 A;  1XXG A;  1RD9 D;  4C3I B;  2OTJ A;  1XTC D;  4E6I A;  1P16 A;  2MPM A;  4KKU A;  1SND A;  3A7A B;  4C2M B;  5EKI A;  3I4N H;  2F0Q A;  1E2Z A;  5JVH 3;  5T1I A;  3S17 B;  4KD4 A;  2K7V A;  3EN2 A;  2J0T D;  2B29 A;  1W2B A;  2EIF A;  4YCU A;  2E2D C;  3BYT B;  3GP7 A;  3P20 A;  4ALP A;  1AZQ A;  4PMW A;  1LV9 A;  3ERO A;  3FPU B;  4GOP A;  2JA6 G;  2FIN B;  1I4Q A;  2NN6 I;  2A5H A;  2VZA A;  4KY7 A;  4DV6 L;  2A8V A;  1D5Z C;  3MWY W;  2HCC A;  3BVZ A;  2I5M X;  2VW9 A;  2UXD Q;  3NK9 A;  4L5Q A;  2EYP A;  3HOY B;  1SBB B;  4LW1 A;  2UUB L;  4N9P A;  5EJW A;  1PRT B;  2IW3 A;  4QL5 A;  2L11 A;  4R4T A;  5JJZ A;  2QCP X;  2HUG A;  4A3M B;  2JA7 B;  2UUC Q;  4JOI A;  5GAE C;  5G3L F;  1PFB A;  1AFP A;  3CCM A;  2DUD A;  1TS4 A;  2OEO A;  4C3J G;  4JYA L;  5C3X A;  1NSN S;  4H7B A;  4LNQ A;  1L2F A;  3HG9 A;  1JQY D;  2CVR A;  2E76 C;  1MGS A;  1DJR D;  1LLR D;  3X3M A;  4ME3 A;  2IX1 A;  3CQZ H;  4AH6 A;  4G57 A;  3NBH A;  5IGC A;  5IP7 H;  2JA8 G;  4BS9 A;  3H94 A;  2ES2 A;  5I6Y A;  1RL2 A;  4IQZ A;  1MJE A;  1CSP A;  3OOC A;  2YU9 B;  1N34 L;  1V1P B;  2RKS A;  5FOB B;  1F9R A;  2HIV A;  2PPB C;  4A3D H;  2PZU A;  1PTO B;  2B8F A;  3K0X A;  2B2W A;  1WTX A;  5BR8 L;  3S2H B;  1EZ6 A;  1XTD A;  4JBK A;  3PO2 G;  4KHP Q;  1CSQ A;  1ICF B;  1K8O A;  2R92 B;  1BBX C;  5IYD H;  1LO5 D;  2YYZ A;  4JBW A;  4BY1 B;  4XQQ A;  2H1E A;  2E5L Q;  2K32 A;  4IUP A;  3SHL A;  2TSS A;  3S1M B;  3VA5 A;  3A55 A;  3HZX A;  3BYY B;  3CW2 C;  3PCO B;  2Q2U A;  1CUK A;  1U4M A;  3KJO A;  3MTS A;  1AW7 A;  1WFQ A;  3HOV B;  1PV4 A;  3TEH B;  3WOF A;  2PW7 A;  4BBS G;  4KKS A;  4LFC Q;  3S15 H;  1KRT A;  1SRO A;  1L0X B;  1ZEQ X;  5I2Y A;  4DAV A;  2I0Q A;  3NE5 B;  2AMC B;  4I65 A;  3D3R A;  3U58 A;  1M90 C;  2IY5 B;  1G8Z D;  3CAM A;  3RUZ A;  3K57 A;  1BCP D;  2PI2 A;  2ZTC A;  3DXJ C;  3I4M H;  2RQX A;  5DM6 3;  2OQ0 A;  2I5H A;  2ZXR A;  2K05 A;  4V19 0;  1BDO A;  4G7Z C;  4Q0F A;  4WRD A;  4JG2 A;  2UXD L;  1Q82 C;  2I5L X;  3CCL A;  1WJJ A;  2YV5 A;  2SOB A;  2CFM A;  4LFB Q;  2QF7 A;  3EA6 A;  2F3V A;  3BU2 A;  2X6G A;  1A2U A;  4PZ8 A;  2MO0 A;  1RDP D;  4DNT B;  3KLS X;  1IW7 C;  3P75 A;  5ISR A;  3IFD A;  3EQL C;  3MXG A;  1IL8 A;  1U0L A;  1SE8 A;  3NSW A;  4A3J G;  3CF5 A;  2QEJ C;  1KDC A;  2RSN A;  4BXX H;  2RF4 A;  1Y8P B;  2F0O A;  3F2C A;  3DEP A;  4Y7N B;  1TT2 A;  4DV5 L;  1R9T H;  1J9O A;  5C4X H;  4JBM A;  3HOY G;  2OF1 A;  5IY0 A;  3OHX C;  5FO8 B;  1B53 A;  3W2D A;  4P74 A;  2RVL A;  2VXW A;  1LTG D;  1YHA A;  2JA7 G;  4A3I H;  4ME5 A;  4DUZ Q;  1S5C D;  2MQH A;  1SNQ A;  2ENB A;  3G71 A;  1T5E A;  2CH4 A;  4L6T B;  3K6O A;  3CCS A;  4PG3 A;  4S3S A;  2A69 D;  2OWO A;  1IBK Q;  1K3R A;  3MVV A;  1EEF D;  1TXY A;  1I6H H;  1F2Y A;  2DNE A;  1K8M A;  3ND9 A;  4ID6 A;  1OXU A;  4FXK C;  4KHP L;  4GLA C;  4LFA Q;  1Y14 B;  4IN3 A;  1Q8K A;  3KF8 A;  3S16 B;  3S1Q H;  2MFI A;  3GTJ B;  5GQO A;  4HAE A;  5C44 G;  3HOZ H;  2E5L L;  1LAC A;  2P5Z X;  5IWA L;  1VF7 A;  4UDU C;  1QCB D;  5EKL A;  3KBG A;  2CWP A;  1Y1V G;  4H0L C;  4AYB B;  1A62 A;  2KHJ A;  1XYI A;  4AYB E;  4A3G G;  1NNX A;  1EY0 A;  4OEM B;  5K36 G;  1HJP A;  4ZRZ A;  1RKN A;  2L0C A;  4LFC L;  4BBR G;  5FO9 B;  1GM5 A;  4QUF A;  4BY7 B;  3NUC A;  4YY3 Q;  2F0F A;  2E2H H;  4A3B H;  3SK5 A;  1WTW A;  1IYJ B;  1EUJ A;  1NCV A;  2PQA A;  2JXM B;  3TS0 A;  5DM7 3;  3HOV G;  5ELD A;  5IGF A;  4FP5 D;  5C4J B;  4K8I A;  1LTI D;  5C5L A;  4QQB X;  3AFQ A;  1ZYR D;  5LMN W;  3AEV A;  3HOX H;  1A8V A;  3BDC A;  5M3M B;  3QG1 A;  4HJ7 A;  5CV5 A;  4PMC A;  4LFB L;  1K3B C;  2BCO A;  1O78 A;  4HMI A;  2LKV A;  4C3H G;  3KLW A;  1VQI A;  3MXN B;  4Q5V A;  5AFW A;  1Q1B A;  5JEA H;  1DXM A;  1SNO A;  3IKJ A;  1QVG A;  2NN6 G;  2JA6 H;  2NVY H;  1HHV A;  4UHV A;  1Z6H A;  5TSS A;  1ESF A;  1SFO H;  2FMC A;  4WJW A;  4ULL A;  1U4L A;  4RGM A;  4IFD H;  2RCF A;  1ZXT A;  2E8G A;  4PNY A;  4V0B A;  3SGI A;  3RZO B;  4KLK A;  1M8A A;  2PZT A;  2BA0 A;  2E74 C;  2XIW A;  1QVF A;  4DUZ L;  5C3E B;  1JWU D;  2IT1 A;  2CHB D;  1JB7 A;  3GTQ H;  3HFZ B;  5C0X I;  2XSC A;  1TS3 A;  4XTC S;  1KDB A;  1EQQ A;  1S4Z A;  3RLO A;  2WV6 D;  1JOQ A;  4POF A;  2NTT A;  1I3Q H;  4DV0 Q;  1BNZ A;  5M3F B;  2NVX H;  2VUM B;  2EQS A;  2O5I C;  3SR1 A;  1H9R A;  1V9P A;  3MFY A;  4A3L H;  4LFA L;  3T1H Q;  2B63 B;  3LWU A;  3NEM A;  1B4O A;  4R8I A;  4OL7 A;  2JSO A;  2BE5 D;  1DCZ A;  2K03 A;  4NDX A;  5IYC H;  1E22 A;  2B2U A;  4O2D A;  3LGJ A;  1GUT A;  4A3I B;  1Y1W B;  2DJG C;  5M5Y H;  1G91 A;  3QOJ A;  5JOB A;  2F0S A;  1TY0 A;  1CKN A;  3BZD B;  3M3Y H;  4HSV A;  4MTK A;  3EVQ A;  3UI2 A;  1KHI A;  3ZJY C;  1EQR A;  4PZ7 A;  1WOC A;  3D8G A;  4QF4 A;  3RMH A;  5LHY 1;  3SE0 A;  4RWS C;  2SNS A;  2B2T A;  4JW0 A;  3M4Y A;  4YY3 L;  3EJI A;  1QUQ A;  3LNN A;  1E3P A;  2IHF A;  3J80 c;  3TP6 A;  3R3O A;  2Z6B A;  4JPB W;  2K01 A;  3CRK C;  3I55 A;  1PH4 A;  5CGK A;  2F0H A;  3E9I A;  2UXC Q;  2FJ2 A;  2IL8 A;  3H91 A;  2KOL A;  2Z6K A;  2RDH A;  5FJ8 G;  3S14 B;  3J81 E;  4LF4 Q;  4YCV A;  2B2Y C;  1D1I A;  2D0P A;  5HGT A;  2AWO A;  4APV A;  3I91 A;  3K5L A;  1EYC A;  4FO2 A;  1WD1 A;  4C3I H;  1HCZ A;  5FLX E;  2KUM A;  5M3M G;  1J6Q A;  4C2M H;  3S17 H;  1VQC A;  2K75 A;  3A8I E;  1FNU A;  4LUV A;  2F0E A;  1R4Q B;  2KEN A;  3FDT A;  3KFU A;  5JJI A;  3AB9 A;  1VQH A;  4HTH A;  4L5R C;  2NZO A;  1V1P A;  3CCQ A;  1M4V A;  5I4D A;  3TSS A;  1XNQ Q;  2VB2 X;  1LYL A;  3U9S A;  4N8X 1;  1EFW A;  2QKI C;  4GOP C;  4OWT B;  2F0I A;  4LK1 C;  1I94 Q;  5IT9 c;  4R4C A;  4DV0 L;  4FF4 A;  3AQQ A;  4X65 Q;  5HGQ A;  3E5S A;  4HN7 A;  3HOY H;  3J7Z C;  1O7I A;  4DV1 Q;  5D65 A;  4IUT A;  4OX9 Q;  5IYB G;  4ZUI A;  4HMJ A;  1CM9 A;  1AE3 A;  3BVG A;  4A3E B;  1UWV A;  1HA5 A;  1K83 B;  2AUK A;  2F0L A;  3T1H L;  5EKK A;  3JAM E;  4A3M H;  2JA7 H;  2AWN A;  3HEJ A;  4XYO A;  1C7Y A;  4DR7 Q;  2R93 B;  1RIP A;  3FHW A;  2QDL A;  2KHI A;  1K0S A;  4GN4 B;  2ASB A;  2JP1 A;  3HP3 A;  3Q23 A;  2VQE Q;  4P72 A;  4FDB A;  1EQV A;  1Q81 C;  2ALY B;  1PH6 A;  1RTN A;  5HUR A;  4JOI C;  5M3F G;  2VUM G;  3MA2 B;  4HSP A;  1BKB A;  1JR0 D;  3KF6 B;  4IUQ A;  5I2X A;  3I56 A;  2D62 A;  1S40 A;  4FF1 A;  2I07 B;  2XNA C;  1LTA D;  1TWA B;  2FMM A;  4U67 3;  1XMO Q;  2EYH A;  3PUZ A;  4NKL A;  2F0U A;  3L2P A;  4R1J A;  3BDL A;  4C3J B;  2VQF Q;  3DWQ A;  5G3L D;  1KQS A;  1FD7 D;  2EVB A;  2EXZ A;  2YU9 H;  1EOV A;  3ITP A;  4KKT A;  1ENF A;  4K14 A;  1Y1W G;  1HQR D;  4F88 A;  3T13 A;  4AIM A;  3CCV A;  2K4K A;  1PTO H;  3CCR A;  1CZW A;  2E2J B;  2HDM A;  2UXB Q;  4RFB A;  3VR6 A;  1WCM G;  2JA8 B;  1CQF A;  3TRE A;  3S2H H;  1I4H A;  3BJU A;  4KHV A;  3OTO Q;  2SEB D;  1AH9 A;  1U5K A;  3ULJ A;  2B2W C;  1Z9F A;  2WP8 J;  4KN7 C;  3OYY A;  2R92 H;  3ER0 A;  3V96 A;  1KAB A;  4BY1 H;  2GA4 B;  3MXU A;  1GOZ A;  2KCN A;  1MIU A;  3CXC A;  2B2V A;  4P71 A;  3S1M H;  2NBF A;  1J8I A;  1RCV D;  3PF4 A;  4A93 B;  1FR3 A;  2J7Z A;  3PO2 B;  3CP0 A;  4FXG C;  3ZYY X;  4RCN A;  2CKZ B;  3HOV H;  2A74 C;  1PMR A;  1CHP D;  2SDF A;  2AQ3 B;  4LF8 Q;  1WVL A;  1K73 C;  1S5E D;  4CDF C;  4LWC A;  3PV0 A;  1EWI A;  5BR8 Q;  2NZH A;  1IXR A;  1EQT A;  1HZB A;  4RGN A;  2EE1 A;  3GQB A;  2N88 A;  1ZKO A;  3QO2 A;  1XNQ L;  1PVO A;  1LTL A;  3M4O B;  3CME A;  4BBS B;  3DWP A;  4KI0 A;  1I94 L;  4X6A H;  4X65 L;  1HNZ Q;  2PCF B;  5FLX L;  4R4I A;  2F0D A;  4DV1 L;  4G7H C;  4OX9 L;  1PH2 A;  1GKH A;  3V2T A;  4C1N K;  5L37 A;  4LAA A;  1NE3 A;  1ENC A;  4DR7 L;  2AKW B;  4O42 A;  1AP0 A;  4P75 A;  3TP7 A;  2ZJR A;  1GD7 A;  3VDY A;  1O7Y A;  5FO7 B;  1PH3 A;  2B39 A;  1EOT A;  1IW7 D;  2VQE L;  1P8L A;  2K5N A;  3OMC A;  4Y7N H;  5LL6 S;  1F2L A;  1DZ1 A;  2ZXP A;  4OON A;  1HNX Q;  1F9S A;  4CKE A;  1STA A;  4A3E G;  1VQF A;  3ULP A;  3MXP A;  3A8J E;  2NTS A;  1XMO L;  2QEX A;  2R93 G;  1TII D;  1X65 A;  3K0Y A;  2IWH A;  4A3J B;  1VQ5 A;  3FEW X;  3DM1 A;  3U4Z A;  2PNR C;  3GTK B;  1DD2 A;  3DHQ A;  4CJ0 B;  2VQF L;  1XX8 A;  2CQA A;  2XRQ D;  2NZ1 D;  2LMC B;  3JAM L;  2LSS A;  1SYD A;  1QIL A;  1B3Q A;  4KY5 A;  1IYV A;  4JI0 Q;  2CH4 W;  2UXB L;  4JI8 L;  3FVQ A;  1TY2 A;  3K5M A;  3D31 A;  4EVO A;  4IOA A;  4RAU C;  4EQP A;  3MXN A;  3OTO L;  1B9M A;  2XVS A;  4DV5 Q;  3UDI A;  4DAY B;  3S16 H;  3KDF B;  3KK7 A;  3GTJ H;  1EIH A;  3KJP A;  4IUV A;  1IBL L;  1FL0 A;  1UAP A;  5C5M A;  2N49 A;  3VYR A;  1PH1 A;  4XDX A;  3MEH A;  3PQI A;  1HFG A;  3OWE B;  4KTA A;  4ZKB B;  3GTL B;  3KBX A;  4LF6 L;  4K0K Q;  1X3F A;  4LF8 L;  2K5W A;  1GUW A;  5C44 B;  4CKB A;  2JA5 G;  3J7A F;  1TWH B;  3NEL A;  4QGU A;  1Y1V B;  1QZH A;  5FJ8 H;  4BY7 H;  3NTK A;  4CGY B;  5IGD A;  2BH2 A;  4A93 G;  1Q12 A;  1WD0 A;  4A3G B;  5JJK A;  2HHH Q;  2PQE A;  1KIX A;  1TQO A;  5C4J H;  2HQL A;  1Y8O B;  4BBR B;  4XT1 B;  1QWY A;  2KCM A;  1SR3 A;  5IWA Q;  5M3M H;  1HNZ L;  2O2L D;  3RR5 A;  2VNU D;  3L9A X;  2PW5 A;  2KED A;  1II3 A;  1A3V A;  2PYK A;  4H02 A;  5C4Z A;  2F3W A;  4RGT A;  4DV3 L;  3I7F A;  1PA6 A;  2DN8 A;  1BCP B;  4QUC A;  4EX5 A;  3TP5 A;  1UE6 A;  1LTT D;  3PSI A;  5C0X J;  1K9M C;  4MZ9 A;  1VQB A;  3PIP A;  2L9H A;  1SN8 A;  3ULL A;  4R4O A;  1E0B A;  2KEE A;  1CKO A;  1EU4 A;  1KTK A;  1VQO A;  2D5D A;  4C3H B;  1HNX L;  4DPG A;  5T1G A;  2Q2T A;  3E0J A;  3MEF A;  3RZO H;  1IKL A;  2ZJP A;  3HRZ C;  5M9O A;  5KRU A;  3TS2 A;  4ABN A;  2I46 A;  5JAV A;  5C3E H;  3CC7 A;  2UU9 L;  1OXS C;  1AEX A;  1ASZ A;  4J15 A;  2R7Z G;  4NMZ A;  1XNR Q;  1EYA A;  3CCU A;  1KLG D;  3K59 A;  1X55 A;  1H9K A;  4OIJ A;  3RD4 A;  3HGB A;  4NXN Q;  3GV6 A;  5IGB A;  3D4W A;  3U50 C;  4JI0 L;  4OO1 H;  1G6Z A;  1XJV A;  2ID0 A;  1E1O A;  1FNV A;  3DMU A;  5M3F H;  2VUM H;  3G6J B;  2IJ0 A;  2WB1 G;  5IP9 H;  2Y0S B;  3EFX D;  2YTY A;  4OIK A;  5CBA E;  1KNA A;  4IPH A;  1BUV T;  2WIN B;  2J4X A;  4JK1 C;  1WTQ A;  2DJF C;  2Y0S E;  4A4I A;  2B63 H;  3QJY A;  1VMC A;  3MHB A;  1TS2 A;  1VQ6 A;  1HUN A;  1B7Y B;  2K5Q A;  4JI2 Q;  4KD3 A;  1SJE D;  3OPO A;  1S72 A;  1GO3 E;  2RDF A;  3L7Z C;  4Z9C B;  1I5F A;  4DK1 A;  1Y1W H;  3RZD B;  1SXT A;  2ZT9 C;  1EYG A;  3GTG B;  1XMQ Q;  3K7U C;  3VR4 A;  3NPP A;  2B2U C;  1LUZ A;  1S3O A;  1E24 A;  4NPS A;  4K0K L;  1H9J A;  1JE4 A;  1NR4 A;  2JK8 A;  2A6H D;  1Q1E A;  4F8M A;  1CA6 A;  3CMA A;  3H0G B;  4OGQ C;  2AQ2 B;  3R93 A;  4GNX B;  4KV6 A;  1CQV A;  3A5Z B;  2PMZ B;  4HJ8 A;  4IJH A;  3A7L A;  1SDF A;  2PMZ E;  2K5H A;  1JB3 A;  2UUA Q;  4A3C G;  4GKJ Q;  2HHH L;  2ICI A;  1A15 A;  2B2T C;  5IGE A;  4IZ8 A;  1EY6 A;  2K14 A;  5BN5 A;  5KNB A;  3PIO A;  3F1Z A;  3L0O A;  1SNC A;  5H1S E;  3SK4 A;  3HKS A;  3ICE A;  3S14 H;  1HFN A;  1KLU D;  2H5X A;  1M1K C;  2PO4 A;  1PRT C;  2KBN A;  2NVQ B;  2GVB A;  5F2D A;  2Z6K C;  5M5X B;  1XWE A;  1L1O B;  3K7A B;  4B08 A;  4UP8 A;  1EY4 A;  2A68 C;  1S5F D;  1K8A C;  4TSS A;  3RLF A;  2N8N A;  4YWM A;  4GLX A;  3K58 A;  1CTM A;  3J80 i;  1PFS A;  2JYO A;  4NP5 A;  1RF2 D;  1ROD A;  3QWN A;  5JPN C;  3HOU B;  3S1N B;  1STE A;  1L0W A;  5J39 A;  1PTO F;  2KCT A;  3NWT A;  4K5X A;  5D14 A;  4EQO A;  3CKI B;  4YHH Q;  2WII B;  2L55 A;  2HCI A;  1X54 A;  1BXT A;  1XNR L;  2R7F A;  4GLV B;  2BDN A;  1DOM A;  1HPC A;  1YBY A;  2XTI A;  1Z7T A;  4NXN L;  1LTR D;  1PYW D;  2IPK D;  1PTO C;  2Z4H A;  2C9O A;  4KMU C;  1Y8N B;  3TP8 A;  5DAU A;  1DON A;  1K28 A;  3HOW G;  5EAY A;  2JA9 A;  5KGU A;  4A3E H;  1K83 H;  1SMY C;  2R93 H;  2Q8I B;  4X66 Q;  5EPK A;  4JI2 L;  3I4O A;  2KQ3 A;  1YIT A;  3QR8 A;  4DK6 C;  3R2I A;  1LM0 A;  1CT1 D;  3GDE A;  5ELB A;  3JC6 6;  2Y0S G;  3MZ5 A;  1D6E C;  1XMQ L;  1WYD A;  2X69 A;  4YWL A;  2F0P A;  2F0G A;  1TWA H;  3DWA A;  1BBW A;  3NBH B;  3NWS A;  4O1N A;  3S24 A;  4JI4 L;  3WDN A;  4RH6 A;  4C3J H;  2RHS B;  2NB0 A;  3I8Z A;  2LY7 A;  4DR4 Q;  2Z4I A;  1PZK D;  5IIF A;  4K2K A;  1VQM A;  2E2J H;  1AN8 A;  5D3D A;  2QW7 A;  2UUA L;  1RTO A;  1QNK A;  2X6L A;  4HCE A;  1LT6 D;  4GKJ L;  1SLJ A;  2JA8 H;  2JE6 I;  1D5X C;  4A3K B;  2EZV A;  1X3P A;  4KK7 A;  2K04 A;  3H0G G;  1C48 A;  4QB4 A;  1JOK A;  2R6G A;  3KLR A;  4ZLT F;  1KC8 C;  2A6H C;  4IFD I;  1WCM B;  2NWG A;  3M7N A;  4X64 Q;  1C9O A;  3PIP 3;  1GXD C;  1GUO A;  4CDC C;  1BBU A;  1WTO A;  4A93 H;  3PO2 H;  2O5J C;  5DNF A;  2V4D A;  2B2V C;  1ILP A;  3Q24 A;  2B8G A;  3I73 A;  4NW2 A;  2MHV A;  1CFM A;  2F4V Q;  1VS0 A;  3PF5 A;  1DYQ A;  3BDO A;  4N9T A;  3UDG A;  1HR0 Q;  4YHH L;  1N8R C;  4DKA C;  5A2Q E;  1VQ8 A;  3A54 A;  3FPP A;  3M4O H;  2PI2 E;  4HID A;  4BBS H;  3GTO B;  4R8N A;  3HOU G;  3GTP B;  3I3C A;  2FXQ A;  4DAY A;  3KDF A;  1PFM A;  2L5T A;  5ELN A;  1D2B A;  4RKL A;  5E3F A;  5GAD C;  2CW0 C;  4DR3 Q;  4A3D G;  1TS5 A;  3OMG A;  1CKM A;  4X66 L;  1K8G A;  1WTP A;  4HJ9 A;  1IYU A;  4GZY C;  2LFN A;  4DXF A;  4GN5 A;  3VR2 A;  1TWC B;  5JJL A;  1E1T A;  1VQL A;  4B3T Q;  1TVX A;  3QOL A;  1VQ4 A;  2EJM A;  3M9B A;  5IYD G;  3K5N A;  4DGZ A;  1HUM A;  2K28 A;  4BWG B;  1D5M C;  3Q0A A;  5E1F A;  4K6D A;  4JI1 Q;  2B3G A;  1MBY A;  4HIM A;  4A3J H;  1JC7 A;  2N55 A;  5DEH A;  2WFW A;  4H44 C;  4WOR A;  2KHS A;  3WOE A;  3GTK H;  2A73 B;  3F8T A;  2A19 A;  3A8K E;  2JN4 A;  4DR4 L;  5GRO A;  4TKO B;  3FP9 A;  5EGT A;  4RHR A;  3GTM B;  2BA1 A;  1I50 B;  4OEL B;  3KOJ A;  2XWJ B;  5ELC A;  1A63 A;  1YNJ C;  3PIO 3;  2RCN A;  3IAY A;  3J81 c;  1CZG A;  1NUC A;  2R7D A;  1U4P A;  2D2C C;  2ZM6 Q;  1PLF A;  2OCE A;  1B44 D;  1F9P A;  1A6X A;  3KF8 B;  1F77 A;  1NJI C;  3V05 A;  5FLX c;  1ET9 A;  2M00 A;  1J5E Q;  1WI5 A;  4GN3 B;  1D1K A;  1EFI D;  2ICE C;  1X6O A;  3SK6 A;  4XXE A;  3MC0 B;  4X64 L;  1I4X A;  1IBM Q;  4LF5 Q;  1PH9 A;  2EJF C;  4A3K G;  4DA2 A;  4FYD A;  1A3T A;  4A3C H;  3GTL H;  4YIJ A;  2EYL A;  1EEI D;  3CU7 A;  1IZ6 A;  4QMG A;  1PH5 A;  3KUP A;  4CDD C;  1EY5 A;  1EY9 A;  4L8J A;  5C44 H;  2FHT A;  3TBI B;  4CKC A;  5IGG A;  1JOO A;  1LAB A;  3G6E A;  3T51 B;  1TWH H;  3UDF A;  2EXD A;  2HQE A;  2HIX A;  4IO9 A;  4A3F B;  2F4V L;  1Y1V H;  4BXX G;  1VQJ A;  1B8A A;  4JI8 Q;  1HR0 L;  5LMU Q;  1N32 Q;  1KNE A;  1QVC A;  3TME A;  4DUY Q;  1JIC A;  4A3G H;  2CWA A;  4KN4 C;  1I4P A;  5K36 H;  3OSO A;  1X3G A;  1NAP A;  2JA5 B;  4BBR H;  1HH2 P;  3T16 A;  3JAM c;  3GO5 A;  1IBL Q;  1SRU A;  4DAP A;  4A76 A;  5FLM G;  1DGS A;  2R61 A;  2QGQ A;  4L5T A;  4DR3 L;  3S1R B;  2Q8R E;  1XPU A;  2EOT A;  1E2W A;  4X3T A;  4LJZ C;  4LF6 Q;  5EBD A;  1AZP A;  1VQK A;  4L63 B;  5COR A;  5I6W A;  3CPW A;  1MD2 D;  3AMU A;  2C5C A;  1SNP A;  3UE1 A;  4GKK L;  4DV2 Q;  4B3T L;  5IOD A;  2K1B A;  4C3H H;  4WJ4 A;  4MN3 A;  5CV7 A;  1O7L A;  2DY8 A;  1U4R A;  1PYB A;  3J81 L;  4OWW B;  2KCC A;  1LTB D;  1VQG A;  2XRS D;  4JI1 L;  3F2U A;  1YNN C;  4GNX A;  1KXL A;  2NN6 H;  3PGZ A;  1SMX A;  1D8L A;  3FMC A;  3C46 A;  3K80 C;  4TVA B;  2F1M A;  4K2L A;  1CA5 A;  4XQN A;  1SJH D;  4UP7 A;  2VY3 A;  3W1G A;  5JPM C;  2O4X A;  2EDG A;  2Z9H A;  2ATW A;  1FGU A;  2M9V A;  4CHT B;  1PFN A;  4DV3 Q;  1OTC A;  2BOS A;  4J1M A;  2F3I A;  1VQN A;  1G29 1;  2F52 A;  3CCE A;  4FF2 A;  2R7Z B;  1QE6 A;  4EQN A;  5C0X G;  1EIF A;  5KYL A;  2ZM6 L;  4A3B G;  1QNU A;  4YWK A;  3I70 A;  4PMB A;  4B9W A;  2QIL A;  1SYG A;  1L1O A;  1O7Z A;  1PZJ D;  4HED A;  4J8Q A;  1IKM A;  1J5E L;  3HOX G;  2K6A A;  1IBM L;  1UEB A;  2WB1 B;  3RZD H;  4LF5 L;  3F2B A;  2UU9 Q;  1C4Q A;  2G5D A;  3ERQ A;  3U4V A;  2WB1 E;  3GTG H;  1ONL A;  1CKN B;  2GN5 A;  5FK9 C;  2N78 A;  1W6K A;  2QA4 A;  3URY A;  4PQX A;  1PHJ A;  1JE5 A;  1TWG B;  5JEA G;  3PUX A;  4JI5 Q;  1X3E A;  3RLN A;  1B3A A;  3C1E A;  2D9U A;  3H0G H;  4XYQ A;  1N36 Q;  1NMG A;  1BR9 A;  1MSH A;  2FFK B;  3PMF A;  2E2I B;  5KYI A;  1X9N A;  3PO3 B;  2ZXO A;  4X3S A;  5LMU L;  3CD6 A;  1N32 L;  4IUN A;  2F03 A;  4J6H A;  4IFD G;  5CR3 A;  1WTR A;  1QUQ B;  4DUY L;  4BA2 I;  5BN4 A;  2LXK A;  1MKH A;  4DNR B;  3STB C;  1SYF A;  2D0O A;  2MGS A;  3FKI B;  1S5B D;  3S9W A;  2WKD A;  4B9X A;  5CC4 A;  3NHH A;  4OWX B;  3OW2 A;  1IL2 A;  4UY8 C;  1HZC A;  4A3F G;  2DNC A;  2N3S A;  4IAL A;  4JVZ A;  1H9M A;  2ZTD A;  3BZK A;  3NQT A;  3C1F A;  1F2Z A;  5EBC A;  3J7A V;  2NVQ H;  1X32 A;  2A6E D;  5M5W B;  1LT5 D;  3TZU A;  5M5X H;  1KRS A;  1AE2 A;  3K7A H;  1SSO A;  1PRT D;  4ZKC B;  1F2M A;  3K81 C;  4DV2 L;  5GAG C;  4A3L G;  1W3S A;  1EY7 A;  4C56 C;  1PXU A;  2A68 D;  2F0V A;  2IX3 A;  3E0E A;  1FVI A;  3HOU H;  5IYC G;  4B3M Q;  3S1N H;  4HIK A;  1VQD A;  2XWB B;  3S2D B;  2XGT A;  4DR2 L;  1G6P A;  1HZ9 A;  1DM0 B;  2RSO A;  4NXM Q;  3BVM A;  2EYF A;  2F0M A;  4B3S Q;  4DR1 Q;  4KY6 A;  2Z0S A;  4QIW B;  2Q8T A;  4TRD A;  3PUW A;  4IUR A;  5KEE A;  4QIW E;  2F4I A;  4A75 A;  2RBM A;  4PZ6 A;  1WTV A;  1JJG A;  2KVM A;  1BQQ T;  3W1B A;  2HT1 A;  1W6J A;  2MJ8 A;  1TWF B;  2EY1 A;  3UDX A;  1VQA A;  3AU7 A;  1GUS A;  1SAP A;  1PTO D;  3OWF A;  1EU3 A;  3W5O A;  2K33 A;  2XN9 C;  5LMN Q;  4X3U A;  1JJC B;  1STG A;  5CV4 A;  1SMY D;  4HCS A;  3SVM A;  4ZQ3 A;  1NBW A;  5EPL A;  3HOW B;  1YEZ A;  5IYB H;  3A56 A;  3ONA B;  1ASY A;  3OIQ A;  1CI3 M;  3BG3 A;  1ICW A;  5CV6 A;  3CCJ A;  1KDA A;  3IFT A;  5JVG 3;  4JI5 L;  1QZG A;  5JEA J;  2EYM A;  3G48 A;  5IE8 A;  5CMD A;  3CC4 A;  4C3I G;  1N36 L;  4N8F A;  4PV1 C;  1I6V C;  1VCI A;  1LT3 D;  1LTS D;  2CCZ A;  4LUO A;  4IFD J;  4Y52 H;  3NTH A;  3F2D A;  4CJ2 C;  3KYH C;  4CBV A;  2A1A A;  5CV9 A;  4A3K H;  1GHK A;  1EWC A;  1FGB D;  3LX0 A;  2K50 A;  4BA1 I;  4WFN 3;  5C6A A;  3K8A A;  1YJW A;  2E75 C;  1R4P B;  3PUV A;  3SEB A;  2OTL A;  1LT4 D;  1VF5 C;  1HNW Q;  3H3V H;  1JCK B;  1H9S B;  3M7G A;  4ODG A;  3U9O A;  2UUC L;  1N33 Q;  4QCL A;  1G2T A;  1SE4 A;  3PO3 G;  3I4N B;  3AYH B;  2F0N A;  3DEO A;  2K5D A;  4I7Z C;  1UNS A;  1V1O A;  1WCM H;  4ZYS A;  4LF9 Q;  3FKI G;  4JI4 Q;  1O80 A;  4M1U B;  1SE2 A;  3GD7 A;  4JV5 Q;  3VYT A;  4A3M G;  1YZ6 A;  4IPG A;  3QB3 A;  4O0A A;  3D6W A;  3D4D A;  2PZW A;  4B3M L;  4KJO A;  1U9R A;  1PRT F;  4G4K A;  3TRZ A;  3TQY A;  5FLM H;  4JI3 Q;  4NXM L;  4OO1 I;  3TN2 A;  2V1C C;  4DR1 L;  4B3S L;  3TZD A;  4UP9 A;  4LF7 Q;  4ZK9 B;  5I9P A;  3IL8 A;  3B6Y A;  5A35 A;  2A6E C;  2LS0 1;  1WTH A;  3GTO H;  1V43 A;  2VB3 X;  4HJA A;  5NUC A;  2JEA I;  3GTP H;  2YTV A;  3RNU A;  1UEA B;  3M85 A;  1G2S A;  4CJ1 B;  1B1Z A;  3NQI A;  1X3Q A;  4OXP A;  3I72 A;  2MO1 A;  5E4W C;  3KF6 A;  1QG7 A;  4B3R Q;  3H3V I;  2F0J A;  4M8A A;  1T9H A;  1UE1 A;  1PH8 A;  1FYC A;  3CQZ B;  4FVM A;  2GVA A;  2WAQ B;  4RGO S;  2CW0 D;  1TWC H;  5LMN L;  2C35 B;  3Q8D A;  2WAQ E;  4JC0 A;  1Q8I A;  4HIO A;  3T4A C;  5ELF A;  3E6Z X;  3X3N A;  2BH8 A;  4QY7 A;  4XT3 B;  4GOP B;  2R92 G;  2DY7 A;  1XPR A;  2Z8L A;  3G7L A;  4A3D B;  4BY1 G;  4ZUJ A;  5FKA C;  4WJ3 M;  3CRL C;  3R2T A;  4X3K A;  3P7J A;  1MI2 A;  5ELE A;  4R4Q A;  1Q7Y C;  1TR5 A;  1HTP A;  2H4O A;  5C0X H;  2OT2 A;  4DNI A;  4DV7 Q;  5K5P A;  3G4S A;  5EQ0 A;  4DR5 Q;  3M4P A;  1YNX A;  4DK3 C;  1V1Q A;  1Y69 U;  4K5V A;  4DK0 A;  3GTM H;  1I50 H;  4DR6 Q;  3N52 A;  1MJC A;  1OO9 B;  3QIA A;  1ILQ A;  4RCO A;  1BCP F;  1ENA A;  4LMQ D;  3EIV A;  4F7X A;  2KEC A;  1PDQ A;  1YNJ D;  4RA8 A;  5J1Z A;  1BO0 A;  3DM3 A;  1SYE A;  1HNW L;  1N33 L;  1I4G A;  1JOR A;  4GS3 A;  4TQU S;  4ILW A;  3RN2 A;  4FXD A;  2VS1 A;  2AQ1 B;  4FNF A;  2WKC A;  3R8B A;  3Q22 A;  3S15 B;  4LF9 L;  1BCP C;  5C3W A;  2YTX A;  3HKZ B;  1C8C A;  4JI7 Q;  1EIG A;  2L15 A;  3HKZ E;  2EY5 A;  4JI6 Q;  4POG A;  1PYS B;  4JV5 L;  1S5D D;  3I4M B;  3VYU A;  4DN4 M;  3AFP A;  1T5X D;  5AJ3 Q;  4DV4 Q;  3I4N G;  3L3O C;  1IHZ A;  1EIY B;  2L4N A;  3J81 i;  1E2V A;  3HS0 C;  4A3F H;  4JI3 L;  2Z1C A;  5HY6 A;  3CC2 A;  3J80 E;  4XQJ A;  1Q90 A;  2AUJ D;  3SK8 A;  5D3I B;  3C3L A;  3N6R A;  1B9N A;  1QB5 D;  2VL6 A;  4P73 A;  4UPA A;  1HA6 A;  4LF7 L;  1PH7 A;  1IBK L;  5ELO A;  1SE3 A;  4I7A A;  1CHQ D;  2EPB A;  1GUN A;  1VMP A;  1EYD A;  2JA5 H;  3VR3 A;  3Q6S A;  2EY2 A;  3BZC A;  2LXJ A;  4DXG A;  3DLL A;  3A5U A;  1JJ2 A;  4L5S A;  1FJG Q;  3PUY A;  3NEN A;  1R9T B;  5C4X B;  2ZJQ A;  4B3R L;  3FRP B;  3D6C A;  3S1R H;  2NVT H;  1NR2 A;  1KAA A;  3E3X A;  4OHJ A;  2EY6 A;  1QOH A;  4QJF A;  4LUZ A;  3VR5 A;  2A69 C;  1EZ8 A;  2NUC A;  4K5W A;  3M4Q A;  1ESR A;  1BF4 A;  4DFA A;  5DLQ E;  1KD1 C;  4K8J A;  1YIJ A;  4XIG S;  2CQO A;  2RHQ B; 
#chains in the Genus database with same CATH homology
 2CWP A;  1Y1V G;  2QGQ A;  4L5T A;  4DR3 L;  2BH2 A;  1XPU A;  4A93 G;  1Q12 A;  3JAM i;  4DV7 L;  4LF6 Q;  1A62 A;  5JJK A;  2KHJ A;  2WAQ G;  5IP7 G;  1VQK A;  1OXV A;  4AYB E;  4AYB G;  3CPW A;  2HHH Q;  1KIX A;  4A3G G;  5C4J H;  2HQL A;  4DR5 L;  2K5V A;  1YJN A;  1G51 A;  1XPO A;  1B70 B;  5K36 G;  3UE1 A;  4GKK L;  2KCM A;  4DV2 Q;  4IPC A;  1HJP A;  4B3T L;  2K52 A;  1SR3 A;  5IWA Q;  4GNX C;  5M3M H;  1HNZ L;  4BBR G;  4LFC L;  3IRB A;  3RR5 A;  2VNU D;  4DR6 L;  4C3H H;  1GM5 A;  1YJ9 A;  4WJ4 A;  5GAH C;  4H02 A;  1PYB A;  4YY3 Q;  4OWW B;  1OXT A;  4HJ5 A;  2E2H H;  1VQG A;  5J3B A;  4DV3 L;  3I7F A;  1PA6 A;  4JI1 L;  4A3B H;  2R7Z H;  4BY7 G;  1IYJ B;  1EUJ A;  4GNX A;  2PQA A;  1KXL A;  4EX5 A;  3PGZ A;  1SMX A;  1D8L A;  3TS0 A;  1UE6 A;  3K80 C;  3PSI A;  4TVA B;  4GKK Q;  2DGY A;  3HOV G;  4AQY Q;  5C0X J;  1K9M C;  4MZ9 A;  4UP7 A;  3RN5 A;  2VY3 A;  3W1G A;  1VQB A;  4QQB X;  3AFQ A;  3PIP A;  5LMN W;  1SN8 A;  3ULL A;  1A8V A;  3HOX H;  2ATW A;  4RG1 A;  3AEV A;  4R4O A;  2MNA A;  1CKO A;  4HJ7 A;  1FGU A;  1VQO A;  1HNX L;  4NB3 A;  4DV3 Q;  4LFB L;  4DPG A;  2Q2T A;  1OTC A;  3MEF A;  2F3I A;  1YHQ A;  1G29 1;  2F52 A;  4EQ5 A;  2JEB I;  2JQO A;  3ERS X;  3KLW A;  1VQI A;  2ZJP A;  4X62 Q;  1L1O C;  3MXN B;  3TS2 A;  4JI6 L;  3CCE A;  3J7A 5;  2ZTE A;  1Q1B A;  3T1Y Q;  5C3E H;  5C0X G;  3CC7 A;  2UU9 L;  1OXS C;  1EIF A;  2ZM6 L;  1ASZ A;  4J15 A;  4A3B G;  2R7Z G;  4YWK A;  1TWG H;  1QVG A;  5AJ3 L;  1JT8 A;  2NN6 G;  2JA6 H;  2NVY H;  4DV4 L;  1XNR Q;  3CCU A;  1L1O A;  1X55 A;  1SFO H;  1J5E L;  2E2I H;  4MTN A;  3PO3 H;  3HOX G;  2IHE A;  2PNH A;  4NXN Q;  2E8G A;  1VQ7 A;  1IBM L;  3U50 C;  3HKZ G;  4JI0 L;  1UEB A;  3RZD H;  1XJV A;  4LF5 L;  1E7Z A;  3F2B A;  2UU9 Q;  1GVP A;  2ID0 A;  1E1O A;  4KLK A;  3SGI A;  5E7N A;  3U4V A;  5M3F H;  2VUM H;  4KHZ A;  2WB1 E;  2WB1 G;  2BA0 A;  3GTG H;  5IP9 H;  1QVF A;  4DUZ L;  1CKN B;  2GN5 A;  2YTY A;  3FKI H;  4JCV E;  3I4M G;  2IT1 A;  2N78 A;  1K0R A;  4IPH A;  2QA4 A;  3WWV A;  2Y0S E;  4A4I A;  1JB7 A;  3GTQ H;  1PHJ A;  1JE5 A;  4RMF A;  5JEA G;  3PUX A;  5C3E G;  2Q2H A;  4JI5 Q;  2B63 H;  1X3E A;  3HFZ B;  3RLN A;  3STB D;  5C0X I;  1KAW A;  1NMF A;  3EBE A;  4XTC S;  1VQ6 A;  3H0G H;  1B7Y B;  4JI2 Q;  1EQQ A;  1FJG L;  1N36 Q;  1NMG A;  1S72 A;  1GO3 E;  3RLO A;  3A74 A;  1X9N A;  4POF A;  5LMU L;  4IJL A;  3CD6 A;  3L7Z C;  1N32 L;  1I3Q H;  1I5F A;  4DV0 Q;  1Y1W H;  4IFD G;  1D7Q A;  1QUQ B;  4DUY L;  4BA2 I;  5M5W H;  1EYG A;  2NVX H;  2LXK A;  4OO1 G;  1MKH A;  2EQS A;  3STB C;  1XMQ Q;  1UE5 A;  3K7U C;  3A0J A;  2D0O A;  1LUZ A;  1S3O A;  1V9P A;  1E24 A;  4NPS A;  4K0K L;  4A3L H;  5IP9 G;  4LFA L;  3T1H Q;  2JK8 A;  3H15 A;  4OWX B;  3NEM A;  1Q1E A;  3OW2 A;  1IL2 A;  4UY8 C;  1JMC A;  3CMA A;  2B63 G;  4DV6 Q;  1HZC A;  4A3F G;  2N3S A;  4JBJ A;  5IYC H;  1E22 A;  5C4X G;  1HZA A;  1X56 A;  2ZTD A;  3BZK A;  4O2D A;  4GNX B;  2PQA B;  1KL9 A;  3A5Z B;  1UE7 A;  4HJ8 A;  3LGJ A;  3S2D H;  4IJH A;  5M5Y H;  2PMZ E;  2K5H A;  4IPD A;  2NVQ H;  4A3I G;  2UUA Q;  5M5X H;  2UUB Q;  1KRS A;  1AE2 A;  4A3C G;  3K7A H;  4GKJ Q;  1CKN A;  3UE0 A;  2HHH L;  3M3Y H;  1OXX K;  2IX0 A;  3ZJY C;  1KHI A;  2K14 A;  1EQR A;  1YVC A;  3K81 C;  4PZ7 A;  3PIO A;  4DV2 L;  1WOC A;  5GAG C;  4A3L G;  1W3S A;  3F1Z A;  4MNO A;  3L0O A;  5H1S E;  1NTG A;  3CPF A;  3HKS A;  3ICE A;  3S14 H;  3E0E A;  2UXC L;  2H5X A;  1FVI A;  4YY3 L;  1M1K C;  5IYC G;  1VQ9 A;  4B3M Q;  3HOU H;  4HIK A;  3S1N H;  1VQD A;  1TWF H;  4JYA Q;  2XGT A;  2KBN A;  4DR2 L;  1G6P A;  1QUQ A;  1HZ9 A;  1HR0 W;  1E3P A;  4LF4 L;  2GVB A;  2IHF A;  4NXM Q;  2Z6K C;  3J80 c;  1Q86 C;  4B3S Q;  4DR1 Q;  1L1O B;  4AQY L;  4UP8 A;  2Q2I A;  2Z0S A;  1H95 A;  1PH4 A;  3I55 A;  3PUW A;  1K8A C;  3RLF A;  2N8N A;  1VQP A;  4YWM A;  1Z47 A;  3E9I A;  4QIW E;  4GLX A;  2UXC Q;  3E9H A;  3HOZ G;  1Q46 A;  4A75 A;  2Z6K A;  1PFS A;  4PZ6 A;  3J80 i;  3J81 j;  5FJ8 G;  2OQK A;  1JJG A;  4DR2 Q;  2HT1 A;  3W1B A;  1N34 Q;  3HOW H;  4LF4 Q;  3D0F A;  4YCV A;  4X62 L;  4DAM A;  2D0P A;  2AWO A;  1L0W A;  2KCT A;  2AHO B;  2JJQ A;  3UDX A;  4APV A;  3T1Y L;  1VQA A;  1VQE A;  4YHH Q;  4IOC A;  1YHB A;  1A0I A;  4C3I H;  1X54 A;  1XNR L;  2R7F A;  3W5O A;  4GLV B;  5M3M G;  1J6Q A;  5LMN Q;  4C2M H;  1JJC B;  1YBY A;  2XTI A;  3S17 H;  1VQC A;  4NXN L;  2K75 A;  1NBW A;  4LUV A;  2KEN A;  1YEZ A;  5IYB H;  1C0A A;  3KFU A;  1ASY A;  5JJI A;  1N9W A;  1BVS A;  1VQH A;  3HOW G;  4L5R C;  2NZO A;  5EAY A;  2JA9 A;  1NY4 A;  3I2Z A;  4YCW A;  4A3E H;  1YI2 A;  1K83 H;  3CCJ A;  3CCQ A;  4JI5 L;  1QZG A;  5JEA J;  2OTJ A;  3G48 A;  2R93 H;  5IE8 A;  4X66 Q;  1P16 A;  1XNQ Q;  3CC4 A;  1LYL A;  4JI2 L;  3I4O A;  1N36 L;  1EFW A;  3I4N H;  1YIT A;  1VCI A;  4OWT B;  4GOP C;  1I94 Q;  4DK6 C;  2CCZ A;  5IT9 c;  4R4C A;  4DV0 L;  3EN2 A;  1LM0 A;  3AQQ A;  4LUO A;  4X65 Q;  2B29 A;  1W2B A;  5HGQ A;  4IFD J;  4Y52 H;  3RZO H;  2EIF A;  3HOY H;  3F2D A;  3GDE A;  3JC6 6;  1O7I A;  2Y0S G;  4YCU A;  3J7Z C;  4DV1 Q;  3KYH C;  1XMQ L;  4OX9 Q;  4ALP A;  1WYD A;  5IYB G;  4PMW A;  4YWL A;  1AE3 A;  2A1A A;  1UWV A;  1TWA H;  4GOP A;  4A3K H;  3NBH B;  1BBW A;  4BA1 I;  3T1H L;  2K50 A;  4A3M H;  2JA6 G;  2NN6 I;  3S24 A;  2JA7 H;  2AWN A;  3K8A A;  1C7Y A;  1YJW A;  4JI4 L;  1VQN A;  4DR7 Q;  3PUV A;  2OTL A;  1RIP A;  2VZA A;  3FHW A;  2KHI A;  4DV6 L;  2A8V A;  4C3J H;  1HNW Q;  3H3V H;  4GN4 B;  2UUC L;  2ASB A;  2RHS B;  1N33 Q;  3PO3 G;  2VQE Q;  4P72 A;  4FDB A;  4DR4 Q;  3AYH B;  1Q81 C;  2I5M X;  2VW9 A;  2ALY B;  1PH6 A;  2UXD Q;  4JOI C;  4L5Q A;  5M3F G;  1VQM A;  2VUM G;  1BKB A;  1WCM H;  3KF6 B;  2E2J H;  4LF9 Q;  3I56 A;  2D62 A;  4LW1 A;  1S40 A;  2UUA L;  2UUB L;  3FKI G;  4GKJ L;  1SLJ A;  4QL5 A;  4JI4 Q;  2JA8 H;  4R4T A;  2JE6 I;  1XMO Q;  3GD7 A;  4JV5 Q;  3PUZ A;  2UUC Q;  4JOI A;  5GAE C;  3H0G G;  3L2P A;  4R1J A;  4A3M G;  1YZ6 A;  4IPG A;  4O0A A;  2VQF Q;  3CCM A;  1KQS A;  2DUD A;  2YU9 H;  1EOV A;  2R6G A;  4B3M L;  1Y1W G;  4JYA L;  1KC8 C;  4AIM A;  3TQY A;  5FLM H;  4JI3 Q;  4LNQ A;  3TRZ A;  3CCV A;  4IFD I;  2K4K A;  3CCR A;  4NXM L;  4OO1 I;  1L2F A;  3M7N A;  4X64 Q;  2UXB Q;  2V1C C;  4DR1 L;  4B3S L;  1C9O A;  1WCM G;  4ME3 A;  2IX1 A;  4A93 H;  4UP9 A;  1BBU A;  3CQZ H;  4AH6 A;  4LF7 Q;  3PO2 H;  3B6Y A;  3TRE A;  5IP7 H;  2JA8 G;  3S2H H;  2ES2 A;  3BJU A;  3OTO Q;  1RL2 A;  1AH9 A;  1U5K A;  1V43 A;  1CSP A;  3ULJ A;  1Z9F A;  2WP8 J;  1MJE A;  3GTO H;  4HJA A;  3OYY A;  2R92 H;  3ER0 A;  2JEA I;  3GTP H;  1N34 L;  2YTV A;  3RNU A;  4BY1 H;  3M85 A;  2HIV A;  2F4V Q;  1VS0 A;  3PF5 A;  4OXP A;  4A3D H;  2MO1 A;  3KF6 A;  3UDG A;  1HR0 Q;  4YHH L;  3H3V I;  4B3R Q;  1MIU A;  3CXC A;  4P71 A;  1N8R C;  1T9H A;  3K0X A;  4DKA C;  3S1M H;  1UE1 A;  3PF4 A;  1VQ8 A;  1PH8 A;  5BR8 L;  3CP0 A;  2GVA A;  1XTD A;  2CKZ B;  1TWC H;  2PI2 E;  5LMN L;  4HID A;  4JBK A;  2C35 B;  3HOV H;  3M4O H;  3PO2 G;  3Q8D A;  2WAQ E;  4LF8 Q;  1CSQ A;  4BBS H;  4KHP Q;  4JC0 A;  4HIO A;  1K73 C;  5IYD H;  3HOU G;  2BH8 A;  2YYZ A;  4JBW A;  4QY7 A;  4GOP B;  4LWC A;  3PV0 A;  2FXQ A;  1XPR A;  2E5L Q;  2R92 G;  3KDF A;  1EWI A;  5ELN A;  4BY1 G;  5BR8 Q;  2NZH A;  1IXR A;  1HZB A;  4WJ3 M;  5GAD C;  4DR3 Q;  4A3D G;  4R4Q A;  1CKM A;  3CW2 C;  3PCO B;  1Q7Y C;  4X66 L;  4DV7 Q;  1K8G A;  4DNI A;  2Q2U A;  1XNQ L;  1CUK A;  4HJ9 A;  1PVO A;  4GN5 A;  3KJO A;  3G4S A;  1LTL A;  1WFQ A;  3CME A;  4DR5 Q;  5JJL A;  1E1T A;  3M4P A;  1YNX A;  4KI0 A;  1PV4 A;  1I94 L;  1VQL A;  4DK3 C;  3TEH B;  1V1Q A;  4X6A H;  4B3T Q;  4BBS G;  4X65 L;  1VQ4 A;  1HNZ Q;  4LFC Q;  3GTM H;  1I50 H;  3S15 H;  4R4I A;  1KRT A;  1SRO A;  3M9B A;  4DR6 Q;  2I0Q A;  4DV1 L;  5IYD G;  2AMC B;  4OX9 L;  1MJC A;  1PH2 A;  3U58 A;  1GKH A;  1M90 C;  2IY5 B;  1NE3 A;  4JI1 Q;  2B3G A;  4HIM A;  3CAM A;  4A3J H;  3EIV A;  4DR7 L;  2AKW B;  2PI2 A;  2ZTC A;  3I4M H;  2WFW A;  4P75 A;  2ZJR A;  3DM3 A;  1GD7 A;  3GTK H;  1HNW L;  3VDY A;  1PH3 A;  3F8T A;  2OQ0 A;  1N33 L;  2I5H A;  2A19 A;  4GS3 A;  2VQE L;  4TQU S;  4DR4 L;  5GRO A;  1P8L A;  2K5N A;  3RN2 A;  3FP9 A;  4JG2 A;  2VS1 A;  4Y7N H;  1Q82 C;  2UXD L;  2I5L X;  3CCL A;  1WJJ A;  2BA1 A;  2YV5 A;  4LF9 L;  4OON A;  1HNX Q;  3KOJ A;  2CFM A;  4LFB Q;  1A63 A;  2YTX A;  2RCN A;  3BU2 A;  4JI7 Q;  4PZ8 A;  1VQF A;  3J81 c;  4A3E G;  2MO0 A;  3ULP A;  1XMO L;  2L15 A;  2R7D A;  3HKZ E;  2QEX A;  4JI6 Q;  1PYS B;  4POG A;  1X65 A;  1VQ5 A;  4JV5 L;  2R93 G;  2ZM6 Q;  1U0L A;  2OCE A;  3U4Z A;  1SE8 A;  3AFP A;  4A3J G;  5AJ3 Q;  3CF5 A;  2VQF L;  4DV4 Q;  3I4N G;  3KF8 B;  1EIY B;  3J81 i;  1NJI C;  4BXX H;  2RF4 A;  5FLX c;  3F2C A;  4A3F H;  4DV5 L;  1R9T H;  1WI5 A;  2LSS A;  4JI3 L;  5HY6 A;  5C4X H;  1J5E Q;  4JBM A;  3HOY G;  3CC2 A;  4GN3 B;  5IY0 A;  1X6O A;  4X64 L;  1IBM Q;  4JI0 Q;  2UXB L;  4P74 A;  4LF5 Q;  1PH9 A;  4P73 A;  2VL6 A;  4UPA A;  4JI8 L;  4A3K G;  1YHA A;  4LF7 L;  1PH7 A;  3D31 A;  5ELO A;  4A3I H;  1IBK L;  2JA7 G;  4A3C H;  3GTL H;  4DUZ Q;  4IOA A;  1IZ6 A;  2MQH A;  1PH5 A;  2JA5 H;  3OTO L;  3BZC A;  2LXJ A;  3G71 A;  3DLL A;  5C44 H;  4DV5 Q;  3UDI A;  4DAY B;  3S16 H;  3KDF B;  3A5U A;  3G6E A;  3GTJ H;  1JJ2 A;  1TWH H;  3UDF A;  2EXD A;  4JI7 L;  2HIX A;  4IO9 A;  3PUY A;  3NEN A;  3KJP A;  3CCS A;  1Y1V H;  4PG3 A;  4L5S A;  1FJG Q;  2F4V L;  1VQJ A;  4BXX G;  1IBL L;  1B8A A;  4JI8 Q;  2ZJQ A;  1HR0 L;  1FL0 A;  5LMU Q;  4B3R L;  1N32 Q;  2OWO A;  3S1R H;  1QVC A;  1IBK Q;  2NVT H;  1K3R A;  4DUY Q;  2N49 A;  1TXY A;  1I6H H;  1PH1 A;  4A3G H;  2CWA A;  1X3G A;  1OXU A;  4QJF A;  4LF6 L;  4K0K Q;  1X3F A;  4KHP L;  4GLA C;  4LFA Q;  4LF8 L;  1Y14 B;  4BBR H;  1Q8K A;  4LUZ A;  1HH2 P;  3JAM c;  3GO5 A;  3M4Q A;  2JA5 G;  2MFI A;  1IBL Q;  3S1Q H;  1SRU A;  5GQO A;  5C44 G;  3NEL A;  4A76 A;  3HOZ H;  5FLM G;  2E5L L;  4QGU A;  5DLQ E;  1DGS A;  5FJ8 H;  5IWA L;  1QZH A;  1KD1 C;  4BY7 H;  1YIJ A;  4XIG S;  2CQO A;  2RHQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...