2NZOA

Crystal structure of a secretion chaperone csaa from bacillus subtilis in the space group p 32 2 1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
111
structure length
111
Chain Sequence
HMAVIDDFEKLDIRTGTIVKAEEFPEARVPAIKLVIDFGTEIGIKQSSAQITKRYKPEGLINKQVIAVVNFPPRRIAGFKSEVLVLGGIPGQGDVVLLQPDQPVPNGTKIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein csaA
publication title Crystallographic analysis of Bacillus subtilis CsaA.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Chaperone
total genus 20
structure length 111
sequence length 111
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01588 tRNA_bind Putative tRNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2nzoA00
3TEHB 2K14A 5GADC 4DUYL 2ZJRA 3PF5A 1JT8A 4LF9L 1MKHA 1Q1EA 3HKSA 5LMUQ 4OXPA 3HOYH 2VQFL 2I5LX 3E9HA 3RLOA 3J81i 3F2DA 2ZJPA 4HIKA 3OW2A 3HKZE 2CKZB 2IHEA 2UXCL 4NXMQ 3CCMA 1EFWA 2OQ0A 3K0XA 2LXJA 1L0WA 1XMQL 2E2JH 2N78A 3PUVA 1YJNA 1J5EQ 4P74A 4EQ5A 4JBKA 4DV4L 3ICEA 3KF8B 4LFCL 4PZ6A 1YHAA 4JV5L 3HOZG 1NMFA 1YHBA 4LUVA 2UXBQ 3RNUA 5JEAJ 3EIVA 4PMWA 3PV0A 5IY0A 4K0KL 4GOPC 5LMNQ 4A3MH 3D0FA 4AIMA 2IT1A 2E8GA 1CSPA 1A8VA 3JAMi 1VQBA 2I0QA 4JI4L 4AH6A 1EYGA 1DGSA 3UDFA 1VQLA 4DV5L 3M7NA 4GN3B 4A3DG 3CPFA 4LUZA 2KCTA 4DK6C 3KJOA 4DV7L 2ID0A 2E5LQ 4YY3Q 2YV5A 4LFAQ 4JI1Q 1ASYA 1XMOL 1YEZA 4A3EH 5E7NA 3WWVA 1I50H 5C3EH 4A3FG 3CCLA 3GTKH 4P72A 3PO2G 2Y0SG 4DNIA 2I5HA 3CCJA 4RMFA 4DR3Q 2N8NA 3S2HH 1JMCA 1Y1VH 4JI8Q 2YTVA 4H02A 4DAYB 4R1JA 2B3GA 4DR1Q 5IYCH 4BBRG 2YTYA 1XTDA 2AKWB 2PNHA 3NEMA 4GS3A 4YCUA 4JI6L 2EIFA 3I4OA 4JI7L 4LFBQ 4DR4L 1KRSA 1AE2A 3J81j 1HR0L 5ELNA 4DR7L 1OXVA 2KBNA 2KHIA 2ZM6Q 4A4IA 3W1GA 3A5UA 4MZ9A 1W2BA 1LM0A 1NTGA 4LWCA 3HOUG 1PFSA 4LF7L 4IFDG 1X54A 2WAQE 1KAWA 5M3MG 1QZHA 3PF4A 4KHZA 1HZBA 3OTOQ 1XPUA 2JA5G 3PO3H 5M5WH 1XNQL 1Q1BA 5M3FG 1IYJB 3CAMA 2NZOA 2JA7G 4YCVA 2K5HA 1HZAA 5IYDH 1OXTA 4GKJL 4NXNQ 4GNXB 4KHPL 4DV3L 2VUMG 4A75A 1HNWL 5GROA 2LSSA 2R6GA 1PH7A 4DV6L 5JJKA 1SROA 2IHFA 3UE1A 1K0RA 1N9WA 1Y14B 5IWAQ 5FLMH 1RL2A 3HOVG 1VQ6A 3S1QH 3PUZA 4A3KG 3CCSA 1YZ6A 4HIOA 2JEBI 1EIYB 3HOWG 2Z6KA 2UUAQ 1PH3A 4NB3A 4JI5L 1UE6A 1VQDA 1VQ9A 1A62A 2QGQA 4HJAA 3IRBA 2HHHQ 2A8VA 1VQPA 4JI0L 1H95A 2DUDA 3BZCA 1NBWA 4LF8L 4WJ4A 1Z47A 2F4VL 4L5QA 4OWXB 4X66L 1XMQQ 4IJLA 1I94L 1VQEA 3UDIA 4BBSH 4JI3L 3HKZG 4DV1L 1WYDA 2HIXA 1IBML 4B3TQ 4A3GH 4IPHA 3M85A 4JV5Q 1HNZQ 2PI2E 1N34L 2K75A 3CMAA 4BXXG 3I2ZA 3CCUA 2CQOA 1I6HH 5FLXc 1EOVA 1U5KA 4HJ8A 2K50A 2VQEL 3VDYA 4DR2Q 3HFZB 1VQFA 3CCQA 3CCRA 2VS1A 1G6PA 1SRUA 1PH6A 1E24A 4LF6Q 1GD7A 2NVQH 4X62L 1EUJA 1JJCB 2Q2UA 5ELOA 3S1MH 3GTMH 5IYBH 5J3BA 4DUZQ 1XPRA 4FDBA 1FJGQ 1S40A 1CKMA 4GNXA 4X65L 2MO1A 3T1YQ 2UUBQ 1C9OA 3BJUA 4R4TA 3RZOH 1VQGA 1SN8A 4DV2L 1UE5A 2ZTCA 1MIUA 5FJ8H 4HIMA 1QVCA 2NZHA 1MJEA 1V1QA 3S1NH 2JA6G 2CWPA 5IYCG 5C0XJ 1I3QH 4A3JH 4LF4L 3HOXH 3BZKA 4MNOA 4JI6Q 4HJ5A 1K83H 4L5TA 3F1ZA 2BH2A 4JYAL 3Q8DA 3K8AA 3RLFA 2XGTA 4QL5A 2B63H 1SFOH 2FXQA 2RHSB 1TWCH 2BA0A 2Q2HA 1TWAH 1Q86C 1VQ8A 4OWTB 4X64Q 4B3SL 3FKIH 4DR7Q 2AHOB 1C0AA 2UUCQ 1Q82C 2Z6KC 3M4QA 4GLVB 2IX0A 1LYLA 3TS0A 3I4NH 4A3BG 3M4PA 3GTQH 4A93H 1LUZA 4JI2Q 4A3LH 1UWVA 2I5MX 3GDEA 2F52A 3LGJA 3K7AH 4BY1G 1KXLA 1OTCA 2JA8H 1PH9A 3H3VH 2R93H 1K73C 2WAQG 4OX9L 4DR5Q 1QVFA 5IYDG 3H15A 1L1OA 4XTCS 3H3VI 3GTPH 3KOJA 2NVYH 4BA2I 2OTJA 1U0LA 3J81c 1CKNA 2JQOA 4KI0A 3CD6A 3S2DH 1PYSB 4DPGA 1WCMH 2R92H 3FHWA 1GM5A 5BR8L 3UDGA 4DR6L 4B3ML 4B3RQ 5IP7G 1FGUA 3PUWA 3AFQA 2E2IH 2N3SA 3KF6A 3NELA 1V9PA 2NVXH 1GO3E 4LF5Q 4GLXA 3KLWA 3ULLA 4YWKA 2QEXA 2EQSA 1VQKA 4DV0L 3G48A 2EXDA 3A5ZB 2A19A 4POFA 4GKKQ 1AH9A 1UE7A 2AMCB 1N8RC 4JI5Q 1N33L 3J80i 4HIDA 3KDFA 3S24A 2KCMA 3ZJYC 5IP9H 1VQCA 4AQYQ 4LW1A 5AJ3L 3H0GH 1IBLL 3JAMc 2R7FA 3CQZH 4A3IG 1BBUA 4L5SA 2Q2TA 3GTLH 2JEAI 4YHHL 1N36L 4GNXC 2UU9L 1XNRL 2ALYB 4DKAC 2YU9H 3W1BA 4JI3Q 1EIFA 3F8TA 1E1TA 1O7IA 4O2DA 1N32Q 3W5OA 4BY7H 4A3CH 3MEFA 1KIXA 2HT1A 4YCWA 1G291 5C44G 5JJLA 2UXDQ 3L2PA 3F2CA 1Y1WH 3T1HQ 1IBKQ 5LMUL 1X3GA 4JCVE 2GN5A 1PV4A 1JJGA 4JBJA 3GTGH 1Q81C 3KFUA 3AQQA 1OXXK 2HIVA 2K52A 3RN5A 4Y7NH 2OCEA 4NXML 1EWIA 1NMGA 2V1CC 3I4MG 4OO1I 2NVTH 2JE6I 3F2BA 1HNXQ 5M5XH 4XIGS 1J5EL 1BKBA 4UP8A 3PUYA 1OXSC 1X65A 1PVOA 2CFMA 2N49A 1PH2A 1MJCA 3G4SA 3HOZH 3GD7A 1X3EA 3NENA 2UXBL 2NN6I 4C2MH 3I7FA 1WI5A 4X6AH 1JE5A 4O0AA 5LMNL 4DUYQ 3CC2A 1R9TH 2CWAA 2R7ZH 4LF9Q 3A74A 2L15A 1BVSA 3J7A5 1L1OC 3PCOB 4UP9A 2VQFQ 3HOYG 1PH1A 1VQ7A 3CC7A 2F3IA 1YITA 1VQAA 3CC4A 2UXCQ 4IJHA 5C4XH 1I5FA 1HR0W 3CMEA 1VQNA 2E5LL 4YY3L 3PIPA 5M5YH 4JI1L 4LFAL 1J6QA 4DV4Q 3RZDH 1EQRA 2BH8A 4A3FH 1D8LA 4IOCA 5GQOA 4LFCQ 1PYBA 2H5XA 3AFPA 3PO2H 2MO0A 1K8GA 3K80C 3S17H 4DR3L 1HZ9A 3K7UC 2JA9A 1WFQA 4UPAA 4JI8L 1XJVA 4K0KQ 4A3MG 3DM3A 1L1OB 2LXKA 4DR1L 5JEAG 4JI4Q 4BBRH 4UP7A 1CKNB 3U4ZA 1JB7A 3S1RH 1GKHA 1YNXA 4DAMA 4WJ3M 4ME3A 4DV5Q 1YIJA 2RCNA 4LFBL 3L7ZC 3S15H 4DV7Q 3KF6B 3B6YA 3ULJA 3PGZA 4JOIA 4KLKA 2QA4A 4A3EG 1XMOQ 1SR3A 1SMXA 2PMZE 4IPDA 5C3EG 2ZM6L 3M4OH 3J7ZC 4IFDJ 2KHJA 5LMNW 4IOAA 2A1AA 3KDFB 1C7YA 1Y1VG 1VQHA 5M3MH 3M9BA 1V43A 1FL0A 4P71A 3STBC 3OTOL 2JA5H 4A76A 3U58A 5M3FH 5H1SE 2JA7H 3CCEA 2ASBA 1Q12A 5IP9G 1PH4A 2YTXA 4AYBE 1FVIA 3BU2A 4NXNL 4JI7Q 5C0XI 1A63A 4DR4Q 2VUMH 1Q7YC 1YI2A 1N36Q 4IPGA 1PHJA 1HR0Q 1VQJA 2AWOA 3GTOH 1VS0A 5IWAL 3SGIA 4OONA 2IY5B 3OYYA 4JG2A 3HOVH 4R4CA 2MQHA 4A3KH 1S72A 4LF7Q 5K36G 2CCZA 1Y1WG 1HZCA 4UY8C 3HOWH 2UUAL 1VQIA 1E1OA 4R4IA 3KJPA 3PO3G 3I56A 2WB1E 3CCVA 4APVA 1XNQQ 4QJFA 2VNUD 2HHHL 3TS2A 1EQQA 4OO1G 1HJPA 4GKJQ 3S16H 5EAYA 3RLNA 1TXYA 3AYHB 1NY4A 2VZAA 1KHIA 2Z0SA 4DV3Q 2ES2A 4KHPQ 3TREA 4TQUS 4JBMA 1IXRA 1HNWQ 1KRTA 3CF5A 4DV6Q 2ZTEA 3ER0A 5GAGC 1VQ4A 2ZJQA 1E3PA 4B3TL 2NN6G 4TVAB 5FLMG 1HNZL 4GN4B 4RG1A 2D62A 1VQ5A 4BXXH 1UE1A 1PH5A 2IX1A 1E22A 4JC0A 1Q46A 2R7ZG 5GAHC 1GVPA 1YJ9A 1YJWA 4DR2L 5C4JH 4QGUA 2RHQB 1OXUA 2KENA 1VCIA 2K4KA 4JI0Q 4PG3A 4LNQA 2XTIA 3EBEA 4LF8Q 4LF6L 2R7DA 4JOIC 3TQYA 4PZ7A 2F4VQ 5C4XG 4X66Q 1SE8A 1I94Q 4JBWA 1IZ6A 4DUZL 4BBSG 4DV1Q 1FJGL 2OWOA 3PIOA 1KQSA 4GLAC 1IBMQ 3GTJH 3T1YL 3ULPA 1QZGA 2UUBL 1Q8KA 1QUQB 2E2HH 4C3HH 4A3GG 1P16A 3RN2A 2YYZA 3G71A 4GOPB 1N34Q 1RIPA 4R4QA 3JC66 3S14H 3UE0A 1E7ZA 1L2FA 3CW2C 2JA6H 4DK3C 2VQEQ 2JK8A 3CPWA 3G6EA 1P8LA 4OWWB 4J15A 4HJ9A 1JJ2A 4X62Q 3AEVA 3J80c 1SLJA 2OQKA 4QY7A 2PQAB 3E9IA 1G51A 5IYBG 1KC8C 3D31A 1KD1C 2VL6A 4X64L 2DGYA 2JJQA 3TRZA 2D0OA 3U4VA 1T9HA 4X65Q 2UUCL 1AE3A 4IPCA 2C35B 4DV2Q 2WP8J 4A3BH 5FJ8G 4JI2L 4EX5A 3STBD 3PUXA 4A3JG 1TWGH 4BY1H 1K3RA 1NJIC 1PA6A 2WFWA 4LF4Q 2PI2A 3FP9A 3HOXG 1A0IA 3L0OA 1B7YB 5C0XG 3I55A 4DR5L 4A3DH 1PH8A 4JYAQ 4NPSA 1TWFH 2Y0SE 3UDXA 2B63G 5JJIA 4QIWE 2MNAA 3KYHC 1YBYA 2VY3A 2ZTDA 1XPOA 4Y52H 1UEBA 2HQLA 4YWLA 4C3JH 2Q2IA 3FKIG 3A0JA 4AYBG 4B3SQ 5IP7H 4B3RL 1B70B 4IO9A 1B8AA 2GVBA 2MFIA 1X3FA 4GN5A 4R4OA 4LF5L 1X9NA 1CSQA 3I4NG 4YWMA 3ERSX 2OTLA 4A93G 3CP0A 4A3LG 5IE8A 5DLQE 1M90C 1QUQA 4GKKL 1BBWA 1NE3A 1TWHH 5IT9c 4LUOA 3RR5A 1KL9A 1X55A 4GOPA 2ATWA 4AQYL 2JA8G 2GVAA 2R93G 1WOCA 2AWNA 2B29A 4OX9Q 4MTNA 4BA1I 4P75A 4A3IH 3MXNB 4HJ7A 3NBHB 3K81C 2WB1G 3M3YH 2VW9A 3GO5A 5HY6A 2R92G 1WCMG 1K9MC 1D7QA 1N32L 5BR8Q 1QVGA 4DR6Q 1VQMA 2D0PA 4B3MQ 4PZ8A 1W3SA 2K5VA 4C3IH 5C44H 2PQAA 3HOUH 1S3OA 2UXDL 4POGA 4P73A 1CUKA 2BA1A 1WJJA 4IFDI 3T1HL 1IBKL 4DV0Q 4ALPA 5GAEC 1X56A 1YHQA 1YVCA 3CXCA 1N33Q 3PSIA 1IBLQ 5AJ3Q 3H0GG 3I4MH 4QQBX 1VQOA 1HH2P 2RF4A 3E0EA 3U50C 4YHHQ 1HNXL 2UU9Q 3EN2A 1IL2A 1XNRQ 3DLLA 5HGQA 1ASZA 4L5RC 4BY7G 4A3CG 1LTLA 1CKOA 1M1KC 1K8AC 1Z9FA 2K5NA 1X6OA
chains in the Genus database with same CATH superfamily
2K14A 4DUYL 4J6HA 1FR3A 3HKSA 5LMUQ 3X3MA 1E2ZA 3F2DA 1SNCA 3OW2A 3HKZE 2CW0C 4NXMQ 1DM0B 3LWEA 1EFWA 1A3VA 4CDCC 3ICEA 4UDUC 1TY0A 4PZ6A 5CBEE 4JV5L 1I6HB 4LUVA 2UXBQ 1CFMA 5JEAJ 4PMWA 4GOPC 2H1EA 4AIMA 1MHWC 1CSPA 5JEAH 1TR5A 3JAMi 2EOTA 2I0QA 3MFGA 4PQXA 1EYGA 1SNPA 3FMCA 3S15B 2RQXA 1TQOA 1VQLA 4DV5L 1TS2A 2A6EC 1EL0A 4U68A 4A3DG 4LUZA 2F0FA 2KCTA 3ONAB 5JVG3 4DV7L 2E5LQ 2CH4A 4QB4A 1NR4A 4JI1Q 3R8BA 1XMOL 2C5CA 1HFGA 1I50H 2BDNA 3SHLA 4DNIA 5IODA 1F9QA 2N8NA 4IQZA 3S2HH 1Y1VH 4JI8Q 4H02A 4ABNA 4DAYB 2B3GA 4DR1Q 1K83B 2KEEA 4BBRG 1S5CD 2B63B 1VF7A 2EIFA 2D2CC 3I4OA 1TWCB 4JI7L 1BCPC 3EJIA 2EYJA 1KRSA 4AYBB 2EE1A 2B8FA 2A69C 2L55A 1B3QA 2KBNA 3T56B 3AU7A 3NHHA 2ZM6Q 2RDHA 3E5SA 1LM0A 4HN7A 5EKIA 3HOUG 5KRUA 1PFSA 4LF7L 1D6EC 3KF8A 5M3MG 3OTOQ 3OWEB 1RHPA 5M5WH 5M3FG 4YCVA 4K2KA 4OO1H 1PRTD 1OXTA 4IUQA 3S2DB 1SDFA 1WCMB 2R92B 3I8ZA 2K05A 2F0HA 4J1MA 2VUMG 1EY9A 1SROA 1U4PA 1Y8NB 5IWAQ 3HOVG 3S1QH 1K3BC 2FFKB 2CVRA 3VR3A 4HIOA 2JEBI 1A3UA 3HOWG 2UUAQ 1SNQA 2QEJC 4JI5L 4HJAA 3IRBA 1EY6A 3JAML 2CW0D 4L5QA 4OWXB 4X66L 4BY7B 4FO2A 4JI3L 5I4DA 5EPLA 4B3TQ 5CR3A 2CQOA 4FNFA 4PMCA 1BF4A 1CA5A 5FLXc 4CBVA 4HJ8A 1STNA 3VDYA 1SAPA 4DR2Q 1VQFA 3CCQA 3CCRA 2VS1A 3QO2A 1Q8IA 1RODA 2K32A 4LF6Q 4NKLA 2P5ZX 2XNAC 3OOCA 1G2TA 3HOZB 5IYBH 1UUPA 3A7LA 3QB3A 2PPBC 2UUBQ 4CHTB 3ITPA 5FO7B 2ZTCA 1ESRA 1GUSA 1QVCA 1Z6HA 3R3OA 2B2YA 2JA6G 3EA6A 2CWPA 1EOTA 5IYCG 3KUPA 1I3QH 2I07B 2M9VA 3HOXH 1F2MA 2KCCA 2O2LD 1BCPD 1GXDC 3RLFA 4QL5A 3PO2B 2Y0SB 2A69D 1TWAH 3TZUA 1EWHA 2WV6D 4G7HC 2WIIB 3IFTA 4XDXA 2Z6KC 4ZCKA 2IX0A 3TS0A 3I4NH 1PXUA 1LUZA 4JI2Q 2SOBA 1UWVA 4A3LH 2I5MX 4M8AA 5TSSA 5FO9B 1PH9A 3H3VH 2R93H 1K73C 3W3AA 5ELFA 5IYDG 4XTCS 2EY2A 2NVYH 1U0LA 4TSSA 4KI0A 1E2VA 5IGDA 1WTOA 2F0IA 1FGBD 4RGNA 5BR8L 4DR6L 1FGUA 3NELA 1V9PA 2F0DA 2NVXH 2JA5B 3J80E 2EJGC 2XWBB 3G48A 2EXDA 4ODGA 3Q24A 3SVMA 2V4DA 3S24A 3ZJYC 5D65A 1VQCA 1SYGA 1GHJA 3GQBA 1BUVT 2Q2TA 3GTLH 4PMBA 3BYTB 3AMUA 4DKAC 2YU9H 1N32Q 4A3CH 1KIXA 2HT1A 4YCWA 1G291 1STAA 2EVBA 4DF7A 1RKNA 2K6AA 1Y1WH 3T1HQ 2L0CA 1X3GA 1CT1D 3T53B 3GTGH 2L5TA 2RDFA 3VR2A 1B2TA 2K52A 3P20A 3HKZB 1EWIA 1NMGA 1AFPA 5M5XH 1PRTF 4IUTA 1J5EL 3M4YA 5IT9E 3PUYA 1X65A 4DXFA 3NQTA 4QCLA 1X3EA 2NN6I 1WI5A 2WACA 1KNEA 1IHZA 4P2CB 4DUYQ 2F0GA 3BVZA 3U9SA 3IAYA 3PCOB 4UP9A 3HOYG 2FMCA 1O7YA 5C4XH 2JSOA 3CMEA 1S5BD 4YY3L 3RUZA 4C3HB 1S4ZA 3RZDH 4IOCA 3S14B 1RCVD 1W6JA 1HZ9A 4A3MG 4EGVA 2ZXPA 4BBRH 1JB7A 3DWPA 1GKHA 3SR1A 4DV5Q 1YIJA 3S15H 4DV7Q 3B6YA 2RDGA 1SNDA 1XMOQ 1SMXA 4ME5A 1DYQA 4DA2A 3M4OH 3LX0A 5LMNW 4K5WA 1SYEA 3HG9A 1VQHA 5M3MH 1V43A 1FL0A 2PZUA 1EEID 2XRQD 4P71A 3STBC 5KNDA 4V190 4A76A 5M3FH 1UNSA 4Q5VA 1PH4A 5C0XH 2JXMB 1WVLA 1FVIA 4RHSA 4JI7Q 4C3JB 2VUMH 1EYAA 5EJWA 1YI2A 2N88A 1Q90A 4IPGA 1BCPF 2IY5B 3HOVH 3L9AX 3A8IE 4LF7Q 5K36G 1F9PA 1DXMA 3HOWH 3V96A 4K6DA 1JOQA 4Q0FA 1RD9D 2WB1E 3CRKC 1KAAA 3WOEA 1O7LA 1PRTB 4APVA 2EYHA 4F88A 4A3IB 3TS2A 2HCCA 3S16H 4WRDA 1TXYA 1NY4A 2Z0SA 4TQUS 1KRTA 4C3IB 5LHY1 4K6LA 1CHPD 2ZTEA 5GAGC 5A2QE 3MXNA 2NN6G 3NBHA 4TVAB 2WINB 2D62A 1VQ5A 1PH5A 2F0QA 2R7ZG 1GVPA 1YJ9A 2LFNA 2NWGA 2KENA 3GTMB 1ENFA 1XXGA 2MUYA 4X66Q 1SE8A 3QWNA 4JBWA 1O80A 4KN4C 3A8JE 3W2DA 3T1YL 1QZGA 5BN3A 4A3GG 1QB5D 2YYZA 4GOPB 5CV7A 1JB3A 1E7ZA 1DONA 3SE0A 3CW2C 2JA6H 2F3VA 4HSVA 5DAUA 1GOZA 2EXZA 4JK1C 3TP7A 4OWWB 2PYKA 4J15A 2VB2X 3J80c 5KGUA 2JJQA 3OPOA 4IZ8A 1T9HA 1RF2D 1AE3A 3MA2B 2C35B 5C4ZA 4PNYA 1ICFB 2SNSA 2LS01 3STBD 4A3JG 1STHA 1TWGH 3K58A 1NJIC 2WFWA 5J22A 4X3UA 1BCPB 4DR5L 1B7YB 1TU2B 1PH8A 1NSNS 1I50B 4NPSA 3UDXA 5JJIA 4QIWE 2MNAA 1YBYA 2OXPA 2VY3A 2HQLA 4X3TA 3S2HB 4IO9A 1Y1VB 1B8AA 2GVBA 1X3FA 2A74C 4R4OA 1X9NA 3BDCA 2X6GA 4CDEC 2B2VA 3CP0A 5DLQE 5ISRA 4ZK9B 3OWFA 1BBWA 4GKKL 1TWHH 5IT9c 4LUOA 3RR5A 2ATWA 2JA8G 1CA6A 5G3LD 2GVAA 4MTNA 3MXNB 4IURA 3NBHB 3I4LA 3OIQA 1JE4A 1SJED 3I3CA 3K81C 4NW2A 5KNCA 2VW9A 4XXEA 5HY6A 3P1HA 1BO0A 1LTGD 5BR8Q 4DR6Q 3DUZA 4RKLA 1JCKB 1S3OA 5M5WB 4POGA 2K33A 3HZXA 2EY6A 1C4QA 5GAEC 2RKSA 5CV8A 5LL6X 1EY7A 3L3OC 3K5OA 1JWMD 3H0GG 4QQBX 2F0SA 2JP1A 1J9OA 1HNXL 3EN2A 3S1QB 1B50A 4RGOS 1CKOA 1X6OA 3BDLA 1SNMA 4H44C 3TEHB 1JT8A 2ZJRA 4F7XA 4LF9L 1MKHA 1Q1EA 3I70A 1O7ZA 3HOYH 3J81i 2ZJPA 1STEA 3FPPA 2GA4B 2UXCL 1ET6A 2LXJA 1L0WA 2E2JH 2F0NA 3FDTA 1J5EQ 4EQ5A 4JBKA 4DV4L 2K28A 2QW7A 4LFCL 1NMFA 5C3XA 2Z6BA 3EIVA 2X69A 3PV0A 4B08A 5IY0A 2KA7A 4K0KL 5IGFA 4A3MH 3D0FA 3MVVA 2HCIA 3TN2A 4FF2A 4GN3B 3CPFA 3KJOA 1D5ZC 2RSOA 4YY3Q 3QOJA 2ZXRA 1YEZA 2G9DA 3CCLA 1D5XC 1CZGA 1I3QB 1LO5D 5L37A 3HOXB 4R1JA 1JWSD 3NTIA 5CV9A 1MSHA 2YTYA 3NEMA 4HTHA 4GZYC 1TWAB 4EVOA 1AE2A 1G91A 1OXVA 3I4NB 4MZ9A 2IPKD 1H9SB 4LWCA 2B39A 5CV6A 5K36H 5E4XA 1U9RA 2E76C 1S5DD 3FEWX 1SXTA 1R4QB 1QZHA 2R93B 4FP5D 4RWSC 1HZBA 1XPUA 2B2TA 1XNQL 1Q1BA 2NVYB 1EIHA 2JA7G 2WB1B 4IALA 4XQQA 1O78A 3J81L 5IGCA 2LSSA 2R6GA 2NVXB 2IHFA 1K0RA 2NN6H 1VQ6A 2E75C 4IUUA 1LT4D 4FF1A 1LTTD 1AN8A 2Z8LA 4NB3A 5EKKA 2QGQA 3GTLB 4QUCA 2A8VA 1H95A 3BZCA 4WJ4A 2YU9B 1Z47A 5G3LF 4IJLA 4EQOA 3GTJB 3UDIA 3MWYW 4DXGA 4A3GH 3OIPA 4BXXG 2K75A 3G6JB 3I2ZA 3K5MA 1R4PB 2F03A 3GTGB 4J8QA 3QG1A 1G6PA 3EVQA 5M5XB 1GD7A 1JJCB 1HA6A 3S1MH 3C3LA 2BCOA 4LJZC 3GTMH 5J3BA 4FDBA 1WTQA 4LMQD 5HGTA 2MO1A 3T1YQ 3RZOH 1C9OA 1EY5A 3BJUA 3ZYYX 3VA7A 2NZHA 1V1QA 3S1NH 2O4XA 4A3JH 5FK9C 5ELDA 4TRDA 5C4XB 1KLGD 2A6HC 4CKCA 4MNOA 3H6MA 4L5TA 4JYAL 3RZDB 2XGTA 2A68C 1SFOH 1QNKA 1VQ8A 1ESFA 4QIWB 2O5IC 4DR7Q 3DEPA 1C0AA 1TVXA 4CKBA 3M4QA 4RA8A 4E6IA 4BBRB 3M4PA 3GTQH 1DD2A 5CV5A 3X3NA 3K7AH 4BY1G 5T1GA 3TP8A 2JA8H 1S5ED 2WAQG 4DR5Q 1QVFA 1L1OA 3M4OB 2NTSA 3CD6A 3D4DA 3E6ZX 3FHWA 3HOUB 5A35A 3UDGA 1F77A 3LWUA 1QILA 5M3MB 2PMZB 3KF6A 1GO3E 4HCEA 5M3FB 4YWKA 2QEXA 2EQSA 3NE5B 2A19A 4POFA 4GKKQ 1AH9A 2QCPX 2VUMB 5IP9H 3NWSA 2F0UA 5AJ3L 3H0GH 1IBLL 1YNJC 1F2LA 2R7FA 3CQZH 4L5SA 5KYIA 2JEAI 4GNXC 1VMCA 4LK1C 3HOVB 3W1BA 3F8TA 4O2DA 4RCNA 3HOWB 5C44G 5I9PA 1IYVA 2EDGA 2F0OA 3TP5A 2MGSA 4K8JA 4DNTB 5K5PA 2HDLA 3S16B 2PCFB 2PZTA 3KFUA 3AQQA 2HIVA 3I4MG 4Y7NH 2ZXOA 2V1CC 1I4RA 2JE6I 3N6RA 1HNXQ 4ZUIA 1BKBA 4UP8A 1LT6D 3G4SA 2AQ3B 1B1ZA 1JE5A 2XSCA 3D4WA 5LMNL 1R9TH 2CWAA 1AZQA 4L63B 4LF9Q 3A74A 1BVSA 1I4XA 2G5DA 2A6HD 2AUJD 1YITA 1VQAA 2K04A 1ZEQX 4IJHA 2UXCQ 3D6CA 1I5FA 3P75A 1WTRA 2A68D 3PIPA 5M5YH 4LFAL 1H9KA 4DV4Q 3TP6A 1D8LA 5GQOA 4ZKCB 4LFCQ 1PYBA 3K80C 2JA6B 1SBBB 1WFQA 4UPAA 4K0KQ 5FOBB 1L1OB 1S5FD 4XYOA 4UP7A 3U4ZA 1SJHD 3EROA 1E2WA 1HXYD 4WORA 3R2TA 4I7AA 1T5EA 5CYUA 4LFBL 2I46A 3KF6B 1F9RA 2F0JA 4KLKA 2QA4A 2Q8IB 4IPDA 1PZKD 2EPBA 2KHJA 3IL8A 5CORA 3OHXC 4N9TA 1TWGB 4JPBW 3M9BA 4K2LA 3D8GA 1Y69U 2E2DC 2B2UA 2JA7H 1QWYA 2IX3A 1YNJD 3S9WA 3GV6A 4KN7C 1N36Q 5J1ZA 1MD2D 4R8NA 3GTOH 1TS4A 2AWOA 1CK1A 1ML0D 3OYYA 4JG2A 3U9OA 2MQHA 2XRSD 1S72A 4CJ0B 5F2DA 1TWHB 5EPKA 4G4KA 3ERQA 1SE3A 3PO3G 3I56A 1XNQQ 1EY0A 1RTNA 1SE4A 2VZAA 1KHIA 2SNMA 3J7AF 3R2IA 2F0WA 2ZJQA 1VQ4A 3DXJC 2PO4A 5FLMG 1HNZL 3NP8A 2B2VC 2KJXA 4RG1A 5EBCA 5DEHA 2EYFA 4BXXH 1EFID 1UE1A 1E22A 2IWHA 4WFN3 4QMGA 1HCZA 4KY5A 2Q8RE 4QGUA 2RHQB 1G6ZA 1FYCA 1ENCA 1VCIA 2F0TA 2K4KA 3TZDA 4JOIC 3TQYA 1MI2A 4PZ7A 4BBSG 1FJGL 2OWOA 3PIOA 1KQSA 4GLAC 3GTJH 1QUQB 3RN2A 1V8QA 1RIPA 1BQQT 1JWUD 3JC66 3HOYB 4U673 3I73A 3SK6A 1IW7C 2JK8A 2E2JB 1A15A 1WTVA 4CDDC 3NTKA 4KJOA 1SLJA 1KABA 2Z1CA 3D31A 3BG3A 2VL6A 4X64L 2B2WC 4DAPA 3TRZA 2D0OA 4HEDA 2EY5A 4A3MB 2K01A 2LMCB 5M9OA 3H94A 2PW7A 2VXWA 3PUXA 4BY1H 4OIJA 4CJ2C 1K3RA 1PA6A 3FP9A 2DY7A 3I55A 3Q6SA 4A3DH 4JYAQ 5CBAE 3KYHC 2JYOA 1UEBA 4B3RL 3FKIG 1B70B 1FNWA 3A8KE 1EWCA 4OGQC 1UAPA 3I91A 1BDOA 3K57A 3NWTA 5EPJA 4YWMA 4A93G 3CU7A 4LAAA 1NE3A 5C5LA 3RMHA 1A2TA 4GOPA 1KL9A 3I90A 1H9MA 1RDPD 1ZKOA 4XT3B 4AQYL 1WOCA 2B29A 4P75A 4FXDA 4KY7A 3M3YH 1NNXA 1QVGA 2JN4A 3A56A 4PZ8A 1FD7D 1KNAA 5C44H 3HOUH 2UXDL 4P73A 4G7OC 1WJJA 4IFDI 4IUNA 1IBKL 2OEOA 1YHQA 1LTSD 3PSIA 4V0BA 4NMZA 3Q22A 5JPMC 5AJ3Q 1IBLQ 3I4MH 3RD4A 1HH2P 4OEMB 2MJ8A 3DLLA 1ASZA 2R7ZB 1CM9A 2QDBA 4FXGC 3T16A 2MHVA 2DY8A 5GADC 4OXPA 1IW7D 4PV1C 3SK4A 3RLOA 2CKZB 5I2YA 3IFDA 1GUOA 3CCMA 4C56C 2OQ0A 3K0XA 4A3GB 4KMUC 1YJNA 2ICIA 4P74A 3VYTA 1XX8A 1HTPA 5C3WA 1H9JA 1YHBA 1QOHA 4X3KA 3JAME 3RNUA 1UEAB 3A55A 1I4PA 5FLXL 5LMNQ 1RTOA 2IT1A 2E8GA 1A8VA 4AH6A 5CGKA 1J8IA 1Z7TA 3E0JA 3S1MB 2K1BA 3M7NA 1H9RA 2DJGC 2KECA 2YV5A 3RZOB 4LFAQ 1ASYA 1AW7A 4L8JA 4WJWA 3WWVA 1CHQD 4A3FG 3GTKH 3CCJA 2I5HA 3S1NB 3WOFA 4A3JB 2XVSA 1V1OA 2YTVA 1G2SA 5IYCH 2PNHA 4YCUA 1SFOB 1LV9A 4LFBQ 4DR4L 1PYWD 3J81j 3URYA 5ELNA 4DR7L 4A4IA 2FINB 3A5UA 3GTQB 1W2BA 1HUNA 4IFDG 1CI3M 1X54A 2WAQE 3K7AB 1KAWA 2JA8B 4G7ZC 3PF4A 4KHZA 1X32A 3PO3H 1IYJB 2K5HA 2N55A 5IYDH 1B9NA 5D3IB 4KHPL 4GNXB 4FYDA 1V1PB 1PH7A 5JJKA 4FF3A 1N9WA 1Y14B 5FLMH 1KDBA 4C1NK 2M2LA 4A3KG 3CCSA 1YZ6A 4NDXA 1GHKA 3MXUA 3K5LA 1I4GA 2Z6KA 1PH3A 3H0GB 1TY2A 1UE6A 3CQZB 4JI0L 1NBWA 4LF8L 2F4VL 1CTMA 1XMQQ 1VQEA 2XIWA 4BBSH 4DV1L 1WYDA 4DNRB 4BS9A 1IBML 2EJMA 4IPHA 4XQNA 4RFBA 1HNZQ 1EYDA 2PI2E 4H13C 1N34L 3CMAA 3CCUA 1PMRA 1DJRD 1EOVA 1GUGA 1U5KA 2PNRC 2RA4A 2VQEL 1EZ8A 4Y7NB 1H9SA 2EY1A 4KTAA 5JJZA 1VDZA 3KLSA 5D14A 1SRUA 1PH6A 5IIFA 4XYQA 2HUGA 4MN3A 4ZKBB 4X62L 2NVQH 2Q2UA 3TSSA 1EY4A 1FJGQ 1S40A 2QDLA 2E74C 5CV4A 1TS3A 1EY8A 2K5QA 4X65L 1R9TB 1F2ZA 1SE2A 1VQGA 2NUCA 1SN8A 4R4TA 1UE5A 4HIMA 2EYMA 1MJEA 1ZYRC 5E4WC 3HRZC 1FNVA 4LF4L 4JI6Q 1D1KA 4HJ5A 5M5YB 1X3PA 3F1ZA 2F4IA 2BH2A 3K8AA 2KEDA 4B9XA 3DM1A 5JPNC 2FXQA 2RHSB 2BA0A 2Q2HA 1Q86C 4X64Q 4B3SL 3FKIH 4RKBA 2KOLA 1Q82C 4G57A 4KJNA 4A3BG 1IYUA 2ZT9C 4A93H 3GDEA 3LNNA 3LGJA 1OTCA 4OX9L 3H15A 3H3VI 3GTPH 3KOJA 2OTJA 4BA2I 1D2BA 1CKNA 1STGA 3BVMA 2X6LA 1PYSB 4DPGA 4FF4A 1GM5A 5JOBA 4B3RQ 2NB0A 2E2IH 3C1FA 5I9OA 1RJTA 4GLXA 3T51B 3UI2A 2JA7B 3SK5A 4DV0L 3A5ZB 1N8RC 1N33L 3J80i 1LT5D 3KDFA 4XT1B 4O1NA 4AQYQ 4HMJA 4LW1A 1WTWA 3JAMc 2K5WA 3VYSA 4MIUA 3DEOA 2F1MA 5CMDA 3GTOB 1N36L 2UU9L 3NPPA 2ALYB 1EIFA 2F0EA 1O7IA 3W5OA 3MEFA 2B2YC 2UXDQ 1STBA 1TT2A 2F3WA 3F2CA 2B2UC 1IBKQ 2GN5A 1JJGA 4JBJA 1Q81C 1WD0A 4R9WA 2OCEA 2WKDA 2NVTH 1Q3LA 4RCOA 1G8ZD 1F2YA 3QR8A 4RH6A 1VMPA 1OXSC 1EZ6A 1PVOA 1PH2A 3NK9A 3GD7A 1ILPA 4C2MH 3I7FA 1BXTA 2L1BA 2R7ZH 1ZYRD 2L15A 2MP1A 2WKCA 3FVQA 1LLRD 1PH1A 1VQ7A 1EQVA 4L6TB 2C9OA 1VQNA 4ULLA 3HGBA 1J6QA 2CQAA 1EQRA 2BH8A 4A3FH 1LTRD 2H5XA 3AFPA 1HFNA 3S17H 4DR3L 4N8FA 2JA9A 4RGTA 1CKNB 3S1RH 1YNXA 4M1UB 4WJ3M 1DZ1A 4ME3A 3CRLC 2A73B 4QF4A 3J80L 5EGTA 2L11A 3ULJA 3K6OA 3PGZA 4A3EG 4K5XA 1SR3A 5C3EG 4O42A 5E3FA 4IFDJ 3J7ZC 1DOLA 3P7JA 1F9SA 3TDQA 3KDFB 1C7YA 1JR0D 4BY1B 3DWAA 2WAQB 4FVMA 3MC0B 4A3DB 4K14A 4OELB 2ICEC 3CCEA 3FPUB 1K28A 1EYCA 2YTXA 1PFMA 1U4RA 4NXNL 2VB3X 5C0XI 1B3AA 1TIID 4DR4Q 1A63A 1NUCA 2EJFC 4KY6A 3KLSX 2F0LA 2F0MA 3SGIA 3CHBD 4N8X1 5ELCA 1U4LA 4A3KH 1EIGA 1Y1WG 1HZCA 1TKWB 4UY8C 1X3QA 3KJPA 4N9PA 5IT9L 3CCVA 1A6XA 4QJFA 2HHHL 3M3YB 1HJPA 1A3TA 5EAYA 3RLNA 4DGZA 4KHPQ 3H09A 1JORA 2ES2A 3EQLC 3D6WA 4CGYB 1AP0A 4JBMA 1IXRA 3DMUA 5C44B 1IKLA 1HA5A 3NQIA 3DWQA 2IX1A 3H91A 5C5MA 1XYIA 1YJWA 1TS5A 5C4JH 3I4MB 1ENAA 4ILWA 4KKSA 1OXUA 2F0VA 4JI0Q 4PG3A 4LNQA 4LF8Q 1HTLD 2M00A 2R7DA 2F4VQ 5C4XG 4ZUJA 3KBXA 1IZ6A 4DUZL 4DV1Q 2PQEA 1LT3D 2MPMA 1IBMQ 1Q8KA 4CJ1B 1SMYD 2NTTA 2E2HH 1P16A 4DK1A 2OF1A 1N34Q 3UE0A 3MXPA 2VQEQ 5ELBA 1WTPA 4XQJA 4MHEA 4ZRZA 4HJ9A 4X62Q 3AEVA 4QY7A 2PQAB 4RAUC 3U4VA 4X65Q 2UUCL 1Y8PB 4IPCA 2WP8J 4A3BH 1CQVA 3QJYA 3TMEA 5FJ8G 1PDQA 4EX5A 4MTKA 1AEXA 2LY7A 4LF4Q 2HDMA 3GP7A 5BN4A 2AQ1B 2K5DA 5C0XG 3SK8A 3NBIA 1XWEA 3GTKB 1TWFH 2B63G 2ZTDA 4Y52H 4YWLA 3Q0AA 2Q2IA 4AYBG 4B3SQ 4RHRA 1FNUA 4GN5A 4LF5L 1M4VA 4DAVA 1WTXA 4Z9CB 1LTID 3D3RA 3ERSX 2OTLA 5IE8A 1M90C 1QUQA 1D1IA 5A2QL 1X55A 2J7ZA 2AWNA 4OX9Q 4BA1I 1Y8OB 4HJ7A 4OHJA 3N52A 4IN3A 1HRJA 5EKLA 1WCMG 4R8IA 1K9MC 2R92G 3SDZA 2D0PA 1VQMA 1W3SA 2K5VA 1XTCD 2HQEA 3PO3B 2BA1A 4HMIA 4DV0Q 1NR2A 2R3ZA 4I65A 1YVCA 1ZXTA 1N33Q 2A6ED 4JVZA 2RCFA 1VQOA 2R61A 3E0EA 2UU9Q 5I2XA 1E0BA 1STYA 4BY7G 5FKAC 1LTLA 2TSSA 1EU4A 5KEEA 2K5NA 1M1KC 1IKMA 3J81E 3PF5A 3NXWA 2J0TD 3M7GA 2VQFL 2I5LX 3E9HA 4HIKA 1I6VC 5C4HA 1MGSA 2IHEA 4BBSB 1PFNA 1XMQL 1HQMC 2N78A 3PUVA 1DOKA 4HR7B 4JW0A 4F8MA 3KF8B 3VYUA 1YHAA 3HOZG 3BYYB 4B9WA 3BZDB 4HCSA 1BNZA 1VQBA 4JI4L 1MBYA 4K5VA 2NVQB 1SNOA 1DGSA 3UDFA 5D3DA 3PQIA 1B4OA 1JICA 3PIP3 3A54A 4DK6C 1CZWA 2ID0A 4A3EH 5E7NA 5C3EH 2NZ1D 1WD1A 4P72A 3PO2G 2Y0SG 1GJXA 1QE6A 4RMFA 4DR3Q 4ZLTF 2DNEA 1JMCA 1QJOA 2RBMA 3H3VC 1EU3A 4H0LC 1B44D 1XTDA 2AKWB 2EYLA 4GS3A 1PTOH 4JI6L 3GV3A 3FKIB 2AUKA 2Q8TA 1HR0L 3BDOA 4ZQ3A 2KHIA 2B8GA 3SXHA 3W1GA 5DM63 4A93B 2PW5A 1NTGA 1YNNC 5IOCA 4K8IA 5I6YA 2IJ0A 1HHVA 2JA5G 1PTOC 3GTPB 2KVMA 3CAMA 2NZOA 1QNUA 1HZAA 4GKJL 4NXNQ 1PZID 1L0XB 4DV3L 1C48A 3QOLA 4A75A 5GROA 1HNWL 4OIKA 4DV6L 2TMPA 3CKIB 2E2IB 3UE1A 4KV6A 1D5MC 1RL2A 2RSNA 3PUZA 2EYOA 5HURA 1EIYB 1HUMA 5IGGA 1VQ9A 1VQDA 4FXKC 3VR4A 1A62A 2RVLA 2HHHQ 3HEJA 1VQPA 1SYBA 2DUDA 1MSGA 2XWJB 1PZJD 1HPCA 1EQTA 3KK7A 1I94L 2A5HA 5FO8B 3HKZG 1LTAD 2HIXA 3M85A 4JV5Q 1DCZA 3J7AV 1JC7A 1I6HH 4QUFA 2K50A 3HFZB 3MFYA 2NBFA 2NVTB 3BVGA 4KHVA 1E24A 1PFBA 1EUJA 5IGEA 2KHSA 5ELOA 5EQ0A 3PIO3 4DUZQ 1XPRA 1PLFA 4C2MB 2IL8A 2IW3A 1CKMA 4GNXA 1V1PA 4C3HG 4DV2L 3WDNA 2B2TC 1MIUA 5ELEA 5FJ8H 3FRPB 5DNFA 5I6WA 4ZAIA 3VR5A 5C0XJ 2Z4IA 3KLRA 3OSOA 3BZKA 3VR6A 1K83H 4X3SA 2O5JC 3Q8DA 4A3FB 4CDFC 2B63H 3MZ5A 1LTBD 3C46A 1M8AA 1TWCH 3V2TA 1GUNA 2L4NA 4DFAA 4OWTB 3S17B 4KD4A 4DU9A 2AHOB 2UUCQ 1I4QA 3MTSA 2CHBD 4GLVB 1LYLA 1YNND 3D4RA 3S1RB 4KKUA 1KDCA 1I4HA 2F52A 1PTOD 3VYRA 1KXLA 3I72A 3T13A 2BE5C 1B53A 4KD3A 3K59A 3J81c 4EQPA 2JQOA 1SSOA 5BN5A 3S2DH 2R92H 1WCMH 1K8MA 4ID6A 4C3JG 3OW7A 4B3ML 5IP7G 1JOKA 2QF7A 3PUWA 3AFQA 2N3SA 2FHTA 4LF5Q 3KLWA 3ULLA 4YIJA 1ICWA 1VQKA 3Q23A 1UE7A 2AMCB 4JI5Q 4HIDA 4F87A 4KKTA 1W6KA 2KCMA 2QKIC 1B9MA 3VA5A 5DM73 3KBGA 4DN4M 4A3IG 1BBUA 2ENBA 4YHHL 3V05A 1XNRL 1KTKA 2SDFA 4A3KB 4IUPA 4JI3Q 1E1TA 2BOSA 2F0KA 4BY7H 5EBDA 1BOSA 4C3IG 5KIXA 5JJLA 3L2PA 1KDAA 2D9UA 5KYLA 5LMUL 4JCVE 2K03A 1PV4A 1OXXK 1A2UA 1AZPA 2PZWA 3RN5A 4NXML 4OO1I 3F2BA 3IKJA 4XIGS 5LL6S 4BWGB 4C1NI 1GUTA 2CFMA 2N49A 1MJCA 3HOZH 2EZVA 3NENA 2UXBL 5C4JB 4X6AH 4O0AA 2G9HD 3CC2A 5T1IA 3J7A5 1L1OC 4UAIA 2VQFQ 1LACA 3CC7A 2F3IA 3CC4A 1HR0W 2E5LL 3O13A 2KCNA 2E2HB 2BDOA 4JI1L 5JVH3 3NSWA 3TBIB 1KLUD 1BBXC 3PO2H 2MO0A 5JAVA 1K8GA 1SYCA 3DHQA 3C1EA 3K7UC 4JI8L 1K0SA 1XJVA 3DM3A 2KQ3A 2LXKA 4UHVA 1ONLA 5JEAG 4DR1L 4JI4Q 2L12A 5NUCA 4DAMA 2BE5D 2RCNA 3L7ZC 2EYPA 4JOIA 1BR9A 4A3BB 2PMZE 2ZM6L 3K0YA 5E1FA 3E3XA 2DJFC 2FJ2A 2A1AA 2FMMA 3QIAA 3SEBA 2F0PA 3A7AB 1Y1VG 3OTOL 2D5DA 5AFWA 2JA5H 3U58A 1LABA 5H1SE 2ASBA 1TWFB 1Q12A 4S3SA 5IP9G 1JOOA 1ET9A 4AYBE 1VF5C 3BU2A 1L0YB 3K5NA 1ILQA 3NUCA 5J39A 1Q7YC 3G7LA 3ND8A 1PHJA 1VQJA 1HR0Q 2HD3A 1VS0A 4HSPA 5IWAL 4OONA 2Z4HA 4R4CA 2B2WA 2CCZA 3BS1A 3PMFA 2UUAL 1VQIA 1E1OA 4R4IA 3MHBA 4OL7A 4CKEA 2VNUD 1EQQA 4OO1G 1PTOF 4GKJQ 3AYHB 4DV3Q 3TREA 1HNWQ 3CF5A 4DV6Q 1NAPA 1SYDA 3ER0A 4B3TL 1E3PA 2K7VA 4GN4B 5KNBA 1U4MA 1Q46A 3ND9A 4JC0A 5GAHC 4H7BA 4DR2L 3J7YW 2H4OA 2XTIA 3AB9A 3EBEA 4LF6L 2CH4W 1II3A 1SEBD 1I94Q 3EFXD 2UUBL 3ULPA 3R93A 1C8CA 4C3HH 1JQYD 3G71A 4R4QA 3S14H 2SEBD 3OMGA 1L2FA 2Z9HA 4EQNA 4DK3C 2DN8A 3OMCA 3CPWA 3G6EA 1P8LA 1JJ2A 4I7ZC 2OQKA 3E9IA 1IL8A 1G51A 1HQRD 4IUVA 5IYBG 1KC8C 1KD1C 2DGYA 4DV2Q 4DK0A 2KUMA 5CC4A 4JI2L 2OT2A 2AQ2B 2PI2A 3HOXG 2NYZD 3HS0C 1A0IA 3L0OA 1CQFA 5IGBA 4A3EB 5C3EB 1DOMA 2Y0SE 5FLXE 1XPOA 5COYA 4C3JH 1OO9B 3MEHA 3A0JA 5IP7H 4KK7A 1SMYC 4ZYSA 1T5XD 2MFIA 2J4XA 1QCBD 2L9HA 1CSQA 4NP5A 3I4NG 1PTOB 4A3LG 4TKOB 2QILA 1WTHA 3HP3A 4DAYA 2R93G 3NTHA 4A3IH 2WB1G 3GO5A 3MXGA 1D7QA 3MAQA 1N32L 4B3MQ 5C6AA 1Y1WB 4C3IH 3C2PA 2XN9C 2PQAA 1EEFD 4HAEA 1QG7A 4IFDH 1K8OA 1CUKA 3T4AC 3T1HL 1SYFA 4ALPA 1NCVA 1X56A 3CXCA 2LKVA 2DNCA 1PRTC 4IOAA 2RF4A 3U50C 4YHHQ 1IL2A 1XNRQ 3F2UA 5HGQA 4RGMA 4L5RC 4A3CG 1GUWA 1K8AC 1Z9FA
chains in the Genus database with same CATH topology
3TEHB 2K14A 5GADC 4DUYL 2ZJRA 3PF5A 1JT8A 4LF9L 1MKHA 1Q1EA 3HKSA 5LMUQ 4OXPA 3HOYH 2VQFL 2I5LX 3E9HA 3RLOA 3J81i 3F2DA 2ZJPA 4HIKA 3OW2A 3HKZE 2CKZB 2IHEA 2UXCL 4NXMQ 3CCMA 1EFWA 2OQ0A 3K0XA 2LXJA 1L0WA 1XMQL 2E2JH 2N78A 3PUVA 1YJNA 1J5EQ 4P74A 4EQ5A 4JBKA 4DV4L 3ICEA 3KF8B 4LFCL 4PZ6A 1YHAA 4JV5L 3HOZG 1NMFA 1YHBA 4LUVA 2UXBQ 3RNUA 5JEAJ 3EIVA 4PMWA 3PV0A 5IY0A 4K0KL 4GOPC 5LMNQ 4A3MH 3D0FA 4AIMA 2IT1A 2E8GA 1CSPA 1A8VA 3JAMi 1VQBA 2I0QA 4JI4L 4AH6A 1EYGA 1DGSA 3UDFA 1VQLA 4DV5L 3M7NA 4GN3B 4A3DG 3CPFA 4LUZA 2KCTA 4DK6C 3KJOA 4DV7L 2ID0A 2E5LQ 4YY3Q 2YV5A 4LFAQ 4JI1Q 1ASYA 1XMOL 1YEZA 4A3EH 5E7NA 3WWVA 1I50H 5C3EH 4A3FG 3CCLA 3GTKH 4P72A 3PO2G 2Y0SG 4DNIA 2I5HA 3CCJA 4RMFA 4DR3Q 2N8NA 3S2HH 1JMCA 1Y1VH 4JI8Q 2YTVA 4H02A 4DAYB 4R1JA 2B3GA 4DR1Q 5IYCH 4BBRG 2YTYA 1XTDA 2AKWB 2PNHA 3NEMA 4GS3A 4YCUA 4JI6L 2EIFA 3I4OA 4JI7L 4LFBQ 4DR4L 1KRSA 1AE2A 3J81j 1HR0L 5ELNA 4DR7L 1OXVA 2KBNA 2KHIA 2ZM6Q 4A4IA 3W1GA 3A5UA 4MZ9A 1W2BA 1LM0A 1NTGA 4LWCA 3HOUG 1PFSA 4LF7L 4IFDG 1X54A 2WAQE 1KAWA 5M3MG 1QZHA 3PF4A 4KHZA 1HZBA 3OTOQ 1XPUA 2JA5G 3PO3H 5M5WH 1XNQL 1Q1BA 5M3FG 1IYJB 3CAMA 2NZOA 2JA7G 4YCVA 2K5HA 1HZAA 5IYDH 1OXTA 4GKJL 4NXNQ 4GNXB 4KHPL 4DV3L 2VUMG 4A75A 1HNWL 5GROA 2LSSA 2R6GA 1PH7A 4DV6L 5JJKA 1SROA 2IHFA 3UE1A 1K0RA 1N9WA 1Y14B 5IWAQ 5FLMH 1RL2A 3HOVG 1VQ6A 3S1QH 3PUZA 4A3KG 3CCSA 1YZ6A 4HIOA 2JEBI 1EIYB 3HOWG 2Z6KA 2UUAQ 1PH3A 4NB3A 4JI5L 1UE6A 1VQDA 1VQ9A 1A62A 2QGQA 4HJAA 3IRBA 2HHHQ 2A8VA 1VQPA 4JI0L 1H95A 2DUDA 3BZCA 1NBWA 4LF8L 4WJ4A 1Z47A 2F4VL 4L5QA 4OWXB 4X66L 1XMQQ 4IJLA 1I94L 1VQEA 3UDIA 4BBSH 4JI3L 3HKZG 4DV1L 1WYDA 2HIXA 1IBML 4B3TQ 4A3GH 4IPHA 3M85A 4JV5Q 1HNZQ 2PI2E 1N34L 2K75A 3CMAA 4BXXG 3I2ZA 3CCUA 2CQOA 1I6HH 5FLXc 1EOVA 1U5KA 4HJ8A 2K50A 2VQEL 3VDYA 4DR2Q 3HFZB 1VQFA 3CCQA 3CCRA 2VS1A 1G6PA 1SRUA 1PH6A 1E24A 4LF6Q 1GD7A 2NVQH 4X62L 1EUJA 1JJCB 2Q2UA 5ELOA 3S1MH 3GTMH 5IYBH 5J3BA 4DUZQ 1XPRA 4FDBA 1FJGQ 1S40A 1CKMA 4GNXA 4X65L 2MO1A 3T1YQ 2UUBQ 1C9OA 3BJUA 4R4TA 3RZOH 1VQGA 1SN8A 4DV2L 1UE5A 2ZTCA 1MIUA 5FJ8H 4HIMA 1QVCA 2NZHA 1MJEA 1V1QA 3S1NH 2JA6G 2CWPA 5IYCG 5C0XJ 1I3QH 4A3JH 4LF4L 3HOXH 3BZKA 4MNOA 4JI6Q 4HJ5A 1K83H 4L5TA 3F1ZA 2BH2A 4JYAL 3Q8DA 3K8AA 3RLFA 2XGTA 4QL5A 2B63H 1SFOH 2FXQA 2RHSB 1TWCH 2BA0A 2Q2HA 1TWAH 1Q86C 1VQ8A 4OWTB 4X64Q 4B3SL 3FKIH 4DR7Q 2AHOB 1C0AA 2UUCQ 1Q82C 2Z6KC 3M4QA 4GLVB 2IX0A 1LYLA 3TS0A 3I4NH 4A3BG 3M4PA 3GTQH 4A93H 1LUZA 4JI2Q 4A3LH 1UWVA 2I5MX 3GDEA 2F52A 3LGJA 3K7AH 4BY1G 1KXLA 1OTCA 2JA8H 1PH9A 3H3VH 2R93H 1K73C 2WAQG 4OX9L 4DR5Q 1QVFA 5IYDG 3H15A 1L1OA 4XTCS 3H3VI 3GTPH 3KOJA 2NVYH 4BA2I 2OTJA 1U0LA 3J81c 1CKNA 2JQOA 4KI0A 3CD6A 3S2DH 1PYSB 4DPGA 1WCMH 2R92H 3FHWA 1GM5A 5BR8L 3UDGA 4DR6L 4B3ML 4B3RQ 5IP7G 1FGUA 3PUWA 3AFQA 2E2IH 2N3SA 3KF6A 3NELA 1V9PA 2NVXH 1GO3E 4LF5Q 4GLXA 3KLWA 3ULLA 4YWKA 2QEXA 2EQSA 1VQKA 4DV0L 3G48A 2EXDA 3A5ZB 2A19A 4POFA 4GKKQ 1AH9A 1UE7A 2AMCB 1N8RC 4JI5Q 1N33L 3J80i 4HIDA 3KDFA 3S24A 2KCMA 3ZJYC 5IP9H 1VQCA 4AQYQ 4LW1A 5AJ3L 3H0GH 1IBLL 3JAMc 2R7FA 3CQZH 4A3IG 1BBUA 4L5SA 2Q2TA 3GTLH 2JEAI 4YHHL 1N36L 4GNXC 2UU9L 1XNRL 2ALYB 4DKAC 2YU9H 3W1BA 4JI3Q 1EIFA 3F8TA 1E1TA 1O7IA 4O2DA 1N32Q 3W5OA 4BY7H 4A3CH 3MEFA 1KIXA 2HT1A 4YCWA 1G291 5C44G 5JJLA 2UXDQ 3L2PA 3F2CA 1Y1WH 3T1HQ 1IBKQ 5LMUL 1X3GA 4JCVE 2GN5A 1PV4A 1JJGA 4JBJA 3GTGH 1Q81C 3KFUA 3AQQA 1OXXK 2HIVA 2K52A 3RN5A 4Y7NH 2OCEA 4NXML 1EWIA 1NMGA 2V1CC 3I4MG 4OO1I 2NVTH 2JE6I 3F2BA 1HNXQ 5M5XH 4XIGS 1J5EL 1BKBA 4UP8A 3PUYA 1OXSC 1X65A 1PVOA 2CFMA 2N49A 1PH2A 1MJCA 3G4SA 3HOZH 3GD7A 1X3EA 3NENA 2UXBL 2NN6I 4C2MH 3I7FA 1WI5A 4X6AH 1JE5A 4O0AA 5LMNL 4DUYQ 3CC2A 1R9TH 2CWAA 2R7ZH 4LF9Q 3A74A 2L15A 1BVSA 3J7A5 1L1OC 3PCOB 4UP9A 2VQFQ 3HOYG 1PH1A 1VQ7A 3CC7A 2F3IA 1YITA 1VQAA 3CC4A 2UXCQ 4IJHA 5C4XH 1I5FA 1HR0W 3CMEA 1VQNA 2E5LL 4YY3L 3PIPA 5M5YH 4JI1L 4LFAL 1J6QA 4DV4Q 3RZDH 1EQRA 2BH8A 4A3FH 1D8LA 4IOCA 5GQOA 4LFCQ 1PYBA 2H5XA 3AFPA 3PO2H 2MO0A 1K8GA 3K80C 3S17H 4DR3L 1HZ9A 3K7UC 2JA9A 1WFQA 4UPAA 4JI8L 1XJVA 4K0KQ 4A3MG 3DM3A 1L1OB 2LXKA 4DR1L 5JEAG 4JI4Q 4BBRH 4UP7A 1CKNB 3U4ZA 1JB7A 3S1RH 1GKHA 1YNXA 4DAMA 4WJ3M 4ME3A 4DV5Q 1YIJA 2RCNA 4LFBL 3L7ZC 3S15H 4DV7Q 3KF6B 3B6YA 3ULJA 3PGZA 4JOIA 4KLKA 2QA4A 4A3EG 1XMOQ 1SR3A 1SMXA 2PMZE 4IPDA 5C3EG 2ZM6L 3M4OH 3J7ZC 4IFDJ 2KHJA 5LMNW 4IOAA 2A1AA 3KDFB 1C7YA 1Y1VG 1VQHA 5M3MH 3M9BA 1V43A 1FL0A 4P71A 3STBC 3OTOL 2JA5H 4A76A 3U58A 5M3FH 5H1SE 2JA7H 3CCEA 2ASBA 1Q12A 5IP9G 1PH4A 2YTXA 4AYBE 1FVIA 3BU2A 4NXNL 4JI7Q 5C0XI 1A63A 4DR4Q 2VUMH 1Q7YC 1YI2A 1N36Q 4IPGA 1PHJA 1HR0Q 1VQJA 2AWOA 3GTOH 1VS0A 5IWAL 3SGIA 4OONA 2IY5B 3OYYA 4JG2A 3HOVH 4R4CA 2MQHA 4A3KH 1S72A 4LF7Q 5K36G 2CCZA 1Y1WG 1HZCA 4UY8C 3HOWH 2UUAL 1VQIA 1E1OA 4R4IA 3KJPA 3PO3G 3I56A 2WB1E 3CCVA 4APVA 1XNQQ 4QJFA 2VNUD 2HHHL 3TS2A 1EQQA 4OO1G 1HJPA 4GKJQ 3S16H 5EAYA 3RLNA 1TXYA 3AYHB 1NY4A 2VZAA 1KHIA 2Z0SA 4DV3Q 2ES2A 4KHPQ 3TREA 4TQUS 4JBMA 1IXRA 1HNWQ 1KRTA 3CF5A 4DV6Q 2ZTEA 3ER0A 5GAGC 1VQ4A 2ZJQA 1E3PA 4B3TL 2NN6G 4TVAB 5FLMG 1HNZL 4GN4B 4RG1A 2D62A 1VQ5A 4BXXH 1UE1A 1PH5A 2IX1A 1E22A 4JC0A 1Q46A 2R7ZG 5GAHC 1GVPA 1YJ9A 1YJWA 4DR2L 5C4JH 4QGUA 2RHQB 1OXUA 2KENA 1VCIA 2K4KA 4JI0Q 4PG3A 4LNQA 2XTIA 3EBEA 4LF8Q 4LF6L 2R7DA 4JOIC 3TQYA 4PZ7A 2F4VQ 5C4XG 4X66Q 1SE8A 1I94Q 4JBWA 1IZ6A 4DUZL 4BBSG 4DV1Q 1FJGL 2OWOA 3PIOA 1KQSA 4GLAC 1IBMQ 3GTJH 3T1YL 3ULPA 1QZGA 2UUBL 1Q8KA 1QUQB 2E2HH 4C3HH 4A3GG 1P16A 3RN2A 2YYZA 3G71A 4GOPB 1N34Q 1RIPA 4R4QA 3JC66 3S14H 3UE0A 1E7ZA 1L2FA 3CW2C 2JA6H 4DK3C 2VQEQ 2JK8A 3CPWA 3G6EA 1P8LA 4OWWB 4J15A 4HJ9A 1JJ2A 4X62Q 3AEVA 3J80c 1SLJA 2OQKA 4QY7A 2PQAB 3E9IA 1G51A 5IYBG 1KC8C 3D31A 1KD1C 2VL6A 4X64L 2DGYA 2JJQA 3TRZA 2D0OA 3U4VA 1T9HA 4X65Q 2UUCL 1AE3A 4IPCA 2C35B 4DV2Q 2WP8J 4A3BH 5FJ8G 4JI2L 4EX5A 3STBD 3PUXA 4A3JG 1TWGH 4BY1H 1K3RA 1NJIC 1PA6A 2WFWA 4LF4Q 2PI2A 3FP9A 3HOXG 1A0IA 3L0OA 1B7YB 5C0XG 3I55A 4DR5L 4A3DH 1PH8A 4JYAQ 4NPSA 1TWFH 2Y0SE 3UDXA 2B63G 5JJIA 4QIWE 2MNAA 3KYHC 1YBYA 2VY3A 2ZTDA 1XPOA 4Y52H 1UEBA 2HQLA 4YWLA 4C3JH 2Q2IA 3FKIG 3A0JA 4AYBG 4B3SQ 5IP7H 4B3RL 1B70B 4IO9A 1B8AA 2GVBA 2MFIA 1X3FA 4GN5A 4R4OA 4LF5L 1X9NA 1CSQA 3I4NG 4YWMA 3ERSX 2OTLA 4A93G 3CP0A 4A3LG 5IE8A 5DLQE 1M90C 1QUQA 4GKKL 1BBWA 1NE3A 1TWHH 5IT9c 4LUOA 3RR5A 1KL9A 1X55A 4GOPA 2ATWA 4AQYL 2JA8G 2GVAA 2R93G 1WOCA 2AWNA 2B29A 4OX9Q 4MTNA 4BA1I 4P75A 4A3IH 3MXNB 4HJ7A 3NBHB 3K81C 2WB1G 3M3YH 2VW9A 3GO5A 5HY6A 2R92G 1WCMG 1K9MC 1D7QA 1N32L 5BR8Q 1QVGA 4DR6Q 1VQMA 2D0PA 4B3MQ 4PZ8A 1W3SA 2K5VA 4C3IH 5C44H 2PQAA 3HOUH 1S3OA 2UXDL 4POGA 4P73A 1CUKA 2BA1A 1WJJA 4IFDI 3T1HL 1IBKL 4DV0Q 4ALPA 5GAEC 1X56A 1YHQA 1YVCA 3CXCA 1N33Q 3PSIA 1IBLQ 5AJ3Q 3H0GG 3I4MH 4QQBX 1VQOA 1HH2P 2RF4A 3E0EA 3U50C 4YHHQ 1HNXL 2UU9Q 3EN2A 1IL2A 1XNRQ 3DLLA 5HGQA 1ASZA 4L5RC 4BY7G 4A3CG 1LTLA 1CKOA 1M1KC 1K8AC 1Z9FA 2K5NA 1X6OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TEH B;  2K14 A;  5GAD C;  4DUY L;  2ZJR A;  3PF5 A;  1JT8 A;  4LF9 L;  1MKH A;  1Q1E A;  3HKS A;  5LMU Q;  4OXP A;  3HOY H;  2VQF L;  2I5L X;  3E9H A;  3RLO A;  3J81 i;  3F2D A;  2ZJP A;  4HIK A;  3OW2 A;  3HKZ E;  2CKZ B;  2IHE A;  2UXC L;  4NXM Q;  3CCM A;  1EFW A;  2OQ0 A;  3K0X A;  2LXJ A;  1L0W A;  1XMQ L;  2E2J H;  2N78 A;  3PUV A;  1YJN A;  1J5E Q;  4P74 A;  4EQ5 A;  4JBK A;  4DV4 L;  3ICE A;  3KF8 B;  4LFC L;  4PZ6 A;  1YHA A;  4JV5 L;  3HOZ G;  1NMF A;  1YHB A;  4LUV A;  2UXB Q;  3RNU A;  5JEA J;  3EIV A;  4PMW A;  3PV0 A;  5IY0 A;  4K0K L;  4GOP C;  5LMN Q;  4A3M H;  3D0F A;  4AIM A;  2IT1 A;  2E8G A;  1CSP A;  1A8V A;  3JAM i;  1VQB A;  2I0Q A;  4JI4 L;  4AH6 A;  1EYG A;  1DGS A;  3UDF A;  1VQL A;  4DV5 L;  3M7N A;  4GN3 B;  4A3D G;  3CPF A;  4LUZ A;  2KCT A;  4DK6 C;  3KJO A;  4DV7 L;  2ID0 A;  2E5L Q;  4YY3 Q;  2YV5 A;  4LFA Q;  4JI1 Q;  1ASY A;  1XMO L;  1YEZ A;  4A3E H;  5E7N A;  3WWV A;  1I50 H;  5C3E H;  4A3F G;  3CCL A;  3GTK H;  4P72 A;  3PO2 G;  2Y0S G;  4DNI A;  2I5H A;  3CCJ A;  4RMF A;  4DR3 Q;  2N8N A;  3S2H H;  1JMC A;  1Y1V H;  4JI8 Q;  2YTV A;  4H02 A;  4DAY B;  4R1J A;  2B3G A;  4DR1 Q;  5IYC H;  4BBR G;  2YTY A;  1XTD A;  2AKW B;  2PNH A;  3NEM A;  4GS3 A;  4YCU A;  4JI6 L;  2EIF A;  3I4O A;  4JI7 L;  4LFB Q;  4DR4 L;  1KRS A;  1AE2 A;  3J81 j;  1HR0 L;  5ELN A;  4DR7 L;  1OXV A;  2KBN A;  2KHI A;  2ZM6 Q;  4A4I A;  3W1G A;  3A5U A;  4MZ9 A;  1W2B A;  1LM0 A;  1NTG A;  4LWC A;  3HOU G;  1PFS A;  4LF7 L;  4IFD G;  1X54 A;  2WAQ E;  1KAW A;  5M3M G;  1QZH A;  3PF4 A;  4KHZ A;  1HZB A;  3OTO Q;  1XPU A;  2JA5 G;  3PO3 H;  5M5W H;  1XNQ L;  1Q1B A;  5M3F G;  1IYJ B;  3CAM A;  2NZO A;  2JA7 G;  4YCV A;  2K5H A;  1HZA A;  5IYD H;  1OXT A;  4GKJ L;  4NXN Q;  4GNX B;  4KHP L;  4DV3 L;  2VUM G;  4A75 A;  1HNW L;  5GRO A;  2LSS A;  2R6G A;  1PH7 A;  4DV6 L;  5JJK A;  1SRO A;  2IHF A;  3UE1 A;  1K0R A;  1N9W A;  1Y14 B;  5IWA Q;  5FLM H;  1RL2 A;  3HOV G;  1VQ6 A;  3S1Q H;  3PUZ A;  4A3K G;  3CCS A;  1YZ6 A;  4HIO A;  2JEB I;  1EIY B;  3HOW G;  2Z6K A;  2UUA Q;  1PH3 A;  4NB3 A;  4JI5 L;  1UE6 A;  1VQD A;  1VQ9 A;  1A62 A;  2QGQ A;  4HJA A;  3IRB A;  2HHH Q;  2A8V A;  1VQP A;  4JI0 L;  1H95 A;  2DUD A;  3BZC A;  1NBW A;  4LF8 L;  4WJ4 A;  1Z47 A;  2F4V L;  4L5Q A;  4OWX B;  4X66 L;  1XMQ Q;  4IJL A;  1I94 L;  1VQE A;  3UDI A;  4BBS H;  4JI3 L;  3HKZ G;  4DV1 L;  1WYD A;  2HIX A;  1IBM L;  4B3T Q;  4A3G H;  4IPH A;  3M85 A;  4JV5 Q;  1HNZ Q;  2PI2 E;  1N34 L;  2K75 A;  3CMA A;  4BXX G;  3I2Z A;  3CCU A;  2CQO A;  1I6H H;  5FLX c;  1EOV A;  1U5K A;  4HJ8 A;  2K50 A;  2VQE L;  3VDY A;  4DR2 Q;  3HFZ B;  1VQF A;  3CCQ A;  3CCR A;  2VS1 A;  1G6P A;  1SRU A;  1PH6 A;  1E24 A;  4LF6 Q;  1GD7 A;  2NVQ H;  4X62 L;  1EUJ A;  1JJC B;  2Q2U A;  5ELO A;  3S1M H;  3GTM H;  5IYB H;  5J3B A;  4DUZ Q;  1XPR A;  4FDB A;  1FJG Q;  1S40 A;  1CKM A;  4GNX A;  4X65 L;  2MO1 A;  3T1Y Q;  2UUB Q;  1C9O A;  3BJU A;  4R4T A;  3RZO H;  1VQG A;  1SN8 A;  4DV2 L;  1UE5 A;  2ZTC A;  1MIU A;  5FJ8 H;  4HIM A;  1QVC A;  2NZH A;  1MJE A;  1V1Q A;  3S1N H;  2JA6 G;  2CWP A;  5IYC G;  5C0X J;  1I3Q H;  4A3J H;  4LF4 L;  3HOX H;  3BZK A;  4MNO A;  4JI6 Q;  4HJ5 A;  1K83 H;  4L5T A;  3F1Z A;  2BH2 A;  4JYA L;  3Q8D A;  3K8A A;  3RLF A;  2XGT A;  4QL5 A;  2B63 H;  1SFO H;  2FXQ A;  2RHS B;  1TWC H;  2BA0 A;  2Q2H A;  1TWA H;  1Q86 C;  1VQ8 A;  4OWT B;  4X64 Q;  4B3S L;  3FKI H;  4DR7 Q;  2AHO B;  1C0A A;  2UUC Q;  1Q82 C;  2Z6K C;  3M4Q A;  4GLV B;  2IX0 A;  1LYL A;  3TS0 A;  3I4N H;  4A3B G;  3M4P A;  3GTQ H;  4A93 H;  1LUZ A;  4JI2 Q;  4A3L H;  1UWV A;  2I5M X;  3GDE A;  2F52 A;  3LGJ A;  3K7A H;  4BY1 G;  1KXL A;  1OTC A;  2JA8 H;  1PH9 A;  3H3V H;  2R93 H;  1K73 C;  2WAQ G;  4OX9 L;  4DR5 Q;  1QVF A;  5IYD G;  3H15 A;  1L1O A;  4XTC S;  3H3V I;  3GTP H;  3KOJ A;  2NVY H;  4BA2 I;  2OTJ A;  1U0L A;  3J81 c;  1CKN A;  2JQO A;  4KI0 A;  3CD6 A;  3S2D H;  1PYS B;  4DPG A;  1WCM H;  2R92 H;  3FHW A;  1GM5 A;  5BR8 L;  3UDG A;  4DR6 L;  4B3M L;  4B3R Q;  5IP7 G;  1FGU A;  3PUW A;  3AFQ A;  2E2I H;  2N3S A;  3KF6 A;  3NEL A;  1V9P A;  2NVX H;  1GO3 E;  4LF5 Q;  4GLX A;  3KLW A;  3ULL A;  4YWK A;  2QEX A;  2EQS A;  1VQK A;  4DV0 L;  3G48 A;  2EXD A;  3A5Z B;  2A19 A;  4POF A;  4GKK Q;  1AH9 A;  1UE7 A;  2AMC B;  1N8R C;  4JI5 Q;  1N33 L;  3J80 i;  4HID A;  3KDF A;  3S24 A;  2KCM A;  3ZJY C;  5IP9 H;  1VQC A;  4AQY Q;  4LW1 A;  5AJ3 L;  3H0G H;  1IBL L;  3JAM c;  2R7F A;  3CQZ H;  4A3I G;  1BBU A;  4L5S A;  2Q2T A;  3GTL H;  2JEA I;  4YHH L;  1N36 L;  4GNX C;  2UU9 L;  1XNR L;  2ALY B;  4DKA C;  2YU9 H;  3W1B A;  4JI3 Q;  1EIF A;  3F8T A;  1E1T A;  1O7I A;  4O2D A;  1N32 Q;  3W5O A;  4BY7 H;  4A3C H;  3MEF A;  1KIX A;  2HT1 A;  4YCW A;  1G29 1;  5C44 G;  5JJL A;  2UXD Q;  3L2P A;  3F2C A;  1Y1W H;  3T1H Q;  1IBK Q;  5LMU L;  1X3G A;  4JCV E;  2GN5 A;  1PV4 A;  1JJG A;  4JBJ A;  3GTG H;  1Q81 C;  3KFU A;  3AQQ A;  1OXX K;  2HIV A;  2K52 A;  3RN5 A;  4Y7N H;  2OCE A;  4NXM L;  1EWI A;  1NMG A;  2V1C C;  3I4M G;  4OO1 I;  2NVT H;  2JE6 I;  3F2B A;  1HNX Q;  5M5X H;  4XIG S;  1J5E L;  1BKB A;  4UP8 A;  3PUY A;  1OXS C;  1X65 A;  1PVO A;  2CFM A;  2N49 A;  1PH2 A;  1MJC A;  3G4S A;  3HOZ H;  3GD7 A;  1X3E A;  3NEN A;  2UXB L;  2NN6 I;  4C2M H;  3I7F A;  1WI5 A;  4X6A H;  1JE5 A;  4O0A A;  5LMN L;  4DUY Q;  3CC2 A;  1R9T H;  2CWA A;  2R7Z H;  4LF9 Q;  3A74 A;  2L15 A;  1BVS A;  3J7A 5;  1L1O C;  3PCO B;  4UP9 A;  2VQF Q;  3HOY G;  1PH1 A;  1VQ7 A;  3CC7 A;  2F3I A;  1YIT A;  1VQA A;  3CC4 A;  2UXC Q;  4IJH A;  5C4X H;  1I5F A;  1HR0 W;  3CME A;  1VQN A;  2E5L L;  4YY3 L;  3PIP A;  5M5Y H;  4JI1 L;  4LFA L;  1J6Q A;  4DV4 Q;  3RZD H;  1EQR A;  2BH8 A;  4A3F H;  1D8L A;  4IOC A;  5GQO A;  4LFC Q;  1PYB A;  2H5X A;  3AFP A;  3PO2 H;  2MO0 A;  1K8G A;  3K80 C;  3S17 H;  4DR3 L;  1HZ9 A;  3K7U C;  2JA9 A;  1WFQ A;  4UPA A;  4JI8 L;  1XJV A;  4K0K Q;  4A3M G;  3DM3 A;  1L1O B;  2LXK A;  4DR1 L;  5JEA G;  4JI4 Q;  4BBR H;  4UP7 A;  1CKN B;  3U4Z A;  1JB7 A;  3S1R H;  1GKH A;  1YNX A;  4DAM A;  4WJ3 M;  4ME3 A;  4DV5 Q;  1YIJ A;  2RCN A;  4LFB L;  3L7Z C;  3S15 H;  4DV7 Q;  3KF6 B;  3B6Y A;  3ULJ A;  3PGZ A;  4JOI A;  4KLK A;  2QA4 A;  4A3E G;  1XMO Q;  1SR3 A;  1SMX A;  2PMZ E;  4IPD A;  5C3E G;  2ZM6 L;  3M4O H;  3J7Z C;  4IFD J;  2KHJ A;  5LMN W;  4IOA A;  2A1A A;  3KDF B;  1C7Y A;  1Y1V G;  1VQH A;  5M3M H;  3M9B A;  1V43 A;  1FL0 A;  4P71 A;  3STB C;  3OTO L;  2JA5 H;  4A76 A;  3U58 A;  5M3F H;  5H1S E;  2JA7 H;  3CCE A;  2ASB A;  1Q12 A;  5IP9 G;  1PH4 A;  2YTX A;  4AYB E;  1FVI A;  3BU2 A;  4NXN L;  4JI7 Q;  5C0X I;  1A63 A;  4DR4 Q;  2VUM H;  1Q7Y C;  1YI2 A;  1N36 Q;  4IPG A;  1PHJ A;  1HR0 Q;  1VQJ A;  2AWO A;  3GTO H;  1VS0 A;  5IWA L;  3SGI A;  4OON A;  2IY5 B;  3OYY A;  4JG2 A;  3HOV H;  4R4C A;  2MQH A;  4A3K H;  1S72 A;  4LF7 Q;  5K36 G;  2CCZ A;  1Y1W G;  1HZC A;  4UY8 C;  3HOW H;  2UUA L;  1VQI A;  1E1O A;  4R4I A;  3KJP A;  3PO3 G;  3I56 A;  2WB1 E;  3CCV A;  4APV A;  1XNQ Q;  4QJF A;  2VNU D;  2HHH L;  3TS2 A;  1EQQ A;  4OO1 G;  1HJP A;  4GKJ Q;  3S16 H;  5EAY A;  3RLN A;  1TXY A;  3AYH B;  1NY4 A;  2VZA A;  1KHI A;  2Z0S A;  4DV3 Q;  2ES2 A;  4KHP Q;  3TRE A;  4TQU S;  4JBM A;  1IXR A;  1HNW Q;  1KRT A;  3CF5 A;  4DV6 Q;  2ZTE A;  3ER0 A;  5GAG C;  1VQ4 A;  2ZJQ A;  1E3P A;  4B3T L;  2NN6 G;  4TVA B;  5FLM G;  1HNZ L;  4GN4 B;  4RG1 A;  2D62 A;  1VQ5 A;  4BXX H;  1UE1 A;  1PH5 A;  2IX1 A;  1E22 A;  4JC0 A;  1Q46 A;  2R7Z G;  5GAH C;  1GVP A;  1YJ9 A;  1YJW A;  4DR2 L;  5C4J H;  4QGU A;  2RHQ B;  1OXU A;  2KEN A;  1VCI A;  2K4K A;  4JI0 Q;  4PG3 A;  4LNQ A;  2XTI A;  3EBE A;  4LF8 Q;  4LF6 L;  2R7D A;  4JOI C;  3TQY A;  4PZ7 A;  2F4V Q;  5C4X G;  4X66 Q;  1SE8 A;  1I94 Q;  4JBW A;  1IZ6 A;  4DUZ L;  4BBS G;  4DV1 Q;  1FJG L;  2OWO A;  3PIO A;  1KQS A;  4GLA C;  1IBM Q;  3GTJ H;  3T1Y L;  3ULP A;  1QZG A;  2UUB L;  1Q8K A;  1QUQ B;  2E2H H;  4C3H H;  4A3G G;  1P16 A;  3RN2 A;  2YYZ A;  3G71 A;  4GOP B;  1N34 Q;  1RIP A;  4R4Q A;  3JC6 6;  3S14 H;  3UE0 A;  1E7Z A;  1L2F A;  3CW2 C;  2JA6 H;  4DK3 C;  2VQE Q;  2JK8 A;  3CPW A;  3G6E A;  1P8L A;  4OWW B;  4J15 A;  4HJ9 A;  1JJ2 A;  4X62 Q;  3AEV A;  3J80 c;  1SLJ A;  2OQK A;  4QY7 A;  2PQA B;  3E9I A;  1G51 A;  5IYB G;  1KC8 C;  3D31 A;  1KD1 C;  2VL6 A;  4X64 L;  2DGY A;  2JJQ A;  3TRZ A;  2D0O A;  3U4V A;  1T9H A;  4X65 Q;  2UUC L;  1AE3 A;  4IPC A;  2C35 B;  4DV2 Q;  2WP8 J;  4A3B H;  5FJ8 G;  4JI2 L;  4EX5 A;  3STB D;  3PUX A;  4A3J G;  1TWG H;  4BY1 H;  1K3R A;  1NJI C;  1PA6 A;  2WFW A;  4LF4 Q;  2PI2 A;  3FP9 A;  3HOX G;  1A0I A;  3L0O A;  1B7Y B;  5C0X G;  3I55 A;  4DR5 L;  4A3D H;  1PH8 A;  4JYA Q;  4NPS A;  1TWF H;  2Y0S E;  3UDX A;  2B63 G;  5JJI A;  4QIW E;  2MNA A;  3KYH C;  1YBY A;  2VY3 A;  2ZTD A;  1XPO A;  4Y52 H;  1UEB A;  2HQL A;  4YWL A;  4C3J H;  2Q2I A;  3FKI G;  3A0J A;  4AYB G;  4B3S Q;  5IP7 H;  4B3R L;  1B70 B;  4IO9 A;  1B8A A;  2GVB A;  2MFI A;  1X3F A;  4GN5 A;  4R4O A;  4LF5 L;  1X9N A;  1CSQ A;  3I4N G;  4YWM A;  3ERS X;  2OTL A;  4A93 G;  3CP0 A;  4A3L G;  5IE8 A;  5DLQ E;  1M90 C;  1QUQ A;  4GKK L;  1BBW A;  1NE3 A;  1TWH H;  5IT9 c;  4LUO A;  3RR5 A;  1KL9 A;  1X55 A;  4GOP A;  2ATW A;  4AQY L;  2JA8 G;  2GVA A;  2R93 G;  1WOC A;  2AWN A;  2B29 A;  4OX9 Q;  4MTN A;  4BA1 I;  4P75 A;  4A3I H;  3MXN B;  4HJ7 A;  3NBH B;  3K81 C;  2WB1 G;  3M3Y H;  2VW9 A;  3GO5 A;  5HY6 A;  2R92 G;  1WCM G;  1K9M C;  1D7Q A;  1N32 L;  5BR8 Q;  1QVG A;  4DR6 Q;  1VQM A;  2D0P A;  4B3M Q;  4PZ8 A;  1W3S A;  2K5V A;  4C3I H;  5C44 H;  2PQA A;  3HOU H;  1S3O A;  2UXD L;  4POG A;  4P73 A;  1CUK A;  2BA1 A;  1WJJ A;  4IFD I;  3T1H L;  1IBK L;  4DV0 Q;  4ALP A;  5GAE C;  1X56 A;  1YHQ A;  1YVC A;  3CXC A;  1N33 Q;  3PSI A;  1IBL Q;  5AJ3 Q;  3H0G G;  3I4M H;  4QQB X;  1VQO A;  1HH2 P;  2RF4 A;  3E0E A;  3U50 C;  4YHH Q;  1HNX L;  2UU9 Q;  3EN2 A;  1IL2 A;  1XNR Q;  3DLL A;  5HGQ A;  1ASZ A;  4L5R C;  4BY7 G;  4A3C G;  1LTL A;  1CKO A;  1M1K C;  1K8A C;  1Z9F A;  2K5N A;  1X6O A; 
#chains in the Genus database with same CATH topology
 2K14 A;  4DUY L;  4J6H A;  1FR3 A;  3HKS A;  5LMU Q;  3X3M A;  1E2Z A;  3F2D A;  1SNC A;  3OW2 A;  3HKZ E;  2CW0 C;  4NXM Q;  1DM0 B;  3LWE A;  1EFW A;  1A3V A;  4CDC C;  3ICE A;  4UDU C;  1TY0 A;  4PZ6 A;  5CBE E;  4JV5 L;  1I6H B;  4LUV A;  2UXB Q;  1CFM A;  5JEA J;  4PMW A;  4GOP C;  2H1E A;  4AIM A;  1MHW C;  1CSP A;  5JEA H;  1TR5 A;  3JAM i;  2EOT A;  2I0Q A;  3MFG A;  4PQX A;  1EYG A;  1SNP A;  3FMC A;  3S15 B;  2RQX A;  1TQO A;  1VQL A;  4DV5 L;  1TS2 A;  2A6E C;  1EL0 A;  4U68 A;  4A3D G;  4LUZ A;  2F0F A;  2KCT A;  3ONA B;  5JVG 3;  4DV7 L;  2E5L Q;  2CH4 A;  4QB4 A;  1NR4 A;  4JI1 Q;  3R8B A;  1XMO L;  2C5C A;  1HFG A;  1I50 H;  2BDN A;  3SHL A;  4DNI A;  5IOD A;  1F9Q A;  2N8N A;  4IQZ A;  3S2H H;  1Y1V H;  4JI8 Q;  4H02 A;  4ABN A;  4DAY B;  2B3G A;  4DR1 Q;  1K83 B;  2KEE A;  4BBR G;  1S5C D;  2B63 B;  1VF7 A;  2EIF A;  2D2C C;  3I4O A;  1TWC B;  4JI7 L;  1BCP C;  3EJI A;  2EYJ A;  1KRS A;  4AYB B;  2EE1 A;  2B8F A;  2A69 C;  2L55 A;  1B3Q A;  2KBN A;  3T56 B;  3AU7 A;  3NHH A;  2ZM6 Q;  2RDH A;  3E5S A;  1LM0 A;  4HN7 A;  5EKI A;  3HOU G;  5KRU A;  1PFS A;  4LF7 L;  1D6E C;  3KF8 A;  5M3M G;  3OTO Q;  3OWE B;  1RHP A;  5M5W H;  5M3F G;  4YCV A;  4K2K A;  4OO1 H;  1PRT D;  1OXT A;  4IUQ A;  3S2D B;  1SDF A;  1WCM B;  2R92 B;  3I8Z A;  2K05 A;  2F0H A;  4J1M A;  2VUM G;  1EY9 A;  1SRO A;  1U4P A;  1Y8N B;  5IWA Q;  3HOV G;  3S1Q H;  1K3B C;  2FFK B;  2CVR A;  3VR3 A;  4HIO A;  2JEB I;  1A3U A;  3HOW G;  2UUA Q;  1SNQ A;  2QEJ C;  4JI5 L;  4HJA A;  3IRB A;  1EY6 A;  3JAM L;  2CW0 D;  4L5Q A;  4OWX B;  4X66 L;  4BY7 B;  4FO2 A;  4JI3 L;  5I4D A;  5EPL A;  4B3T Q;  5CR3 A;  2CQO A;  4FNF A;  4PMC A;  1BF4 A;  1CA5 A;  5FLX c;  4CBV A;  4HJ8 A;  1STN A;  3VDY A;  1SAP A;  4DR2 Q;  1VQF A;  3CCQ A;  3CCR A;  2VS1 A;  3QO2 A;  1Q8I A;  1ROD A;  2K32 A;  4LF6 Q;  4NKL A;  2P5Z X;  2XNA C;  3OOC A;  1G2T A;  3HOZ B;  5IYB H;  1UUP A;  3A7L A;  3QB3 A;  2PPB C;  2UUB Q;  4CHT B;  3ITP A;  5FO7 B;  2ZTC A;  1ESR A;  1GUS A;  1QVC A;  1Z6H A;  3R3O A;  2B2Y A;  2JA6 G;  3EA6 A;  2CWP A;  1EOT A;  5IYC G;  3KUP A;  1I3Q H;  2I07 B;  2M9V A;  3HOX H;  1F2M A;  2KCC A;  2O2L D;  1BCP D;  1GXD C;  3RLF A;  4QL5 A;  3PO2 B;  2Y0S B;  2A69 D;  1TWA H;  3TZU A;  1EWH A;  2WV6 D;  4G7H C;  2WII B;  3IFT A;  4XDX A;  2Z6K C;  4ZCK A;  2IX0 A;  3TS0 A;  3I4N H;  1PXU A;  1LUZ A;  4JI2 Q;  2SOB A;  1UWV A;  4A3L H;  2I5M X;  4M8A A;  5TSS A;  5FO9 B;  1PH9 A;  3H3V H;  2R93 H;  1K73 C;  3W3A A;  5ELF A;  5IYD G;  4XTC S;  2EY2 A;  2NVY H;  1U0L A;  4TSS A;  4KI0 A;  1E2V A;  5IGD A;  1WTO A;  2F0I A;  1FGB D;  4RGN A;  5BR8 L;  4DR6 L;  1FGU A;  3NEL A;  1V9P A;  2F0D A;  2NVX H;  2JA5 B;  3J80 E;  2EJG C;  2XWB B;  3G48 A;  2EXD A;  4ODG A;  3Q24 A;  3SVM A;  2V4D A;  3S24 A;  3ZJY C;  5D65 A;  1VQC A;  1SYG A;  1GHJ A;  3GQB A;  1BUV T;  2Q2T A;  3GTL H;  4PMB A;  3BYT B;  3AMU A;  4DKA C;  2YU9 H;  1N32 Q;  4A3C H;  1KIX A;  2HT1 A;  4YCW A;  1G29 1;  1STA A;  2EVB A;  4DF7 A;  1RKN A;  2K6A A;  1Y1W H;  3T1H Q;  2L0C A;  1X3G A;  1CT1 D;  3T53 B;  3GTG H;  2L5T A;  2RDF A;  3VR2 A;  1B2T A;  2K52 A;  3P20 A;  3HKZ B;  1EWI A;  1NMG A;  1AFP A;  5M5X H;  1PRT F;  4IUT A;  1J5E L;  3M4Y A;  5IT9 E;  3PUY A;  1X65 A;  4DXF A;  3NQT A;  4QCL A;  1X3E A;  2NN6 I;  1WI5 A;  2WAC A;  1KNE A;  1IHZ A;  4P2C B;  4DUY Q;  2F0G A;  3BVZ A;  3U9S A;  3IAY A;  3PCO B;  4UP9 A;  3HOY G;  2FMC A;  1O7Y A;  5C4X H;  2JSO A;  3CME A;  1S5B D;  4YY3 L;  3RUZ A;  4C3H B;  1S4Z A;  3RZD H;  4IOC A;  3S14 B;  1RCV D;  1W6J A;  1HZ9 A;  4A3M G;  4EGV A;  2ZXP A;  4BBR H;  1JB7 A;  3DWP A;  1GKH A;  3SR1 A;  4DV5 Q;  1YIJ A;  3S15 H;  4DV7 Q;  3B6Y A;  2RDG A;  1SND A;  1XMO Q;  1SMX A;  4ME5 A;  1DYQ A;  4DA2 A;  3M4O H;  3LX0 A;  5LMN W;  4K5W A;  1SYE A;  3HG9 A;  1VQH A;  5M3M H;  1V43 A;  1FL0 A;  2PZU A;  1EEI D;  2XRQ D;  4P71 A;  3STB C;  5KND A;  4V19 0;  4A76 A;  5M3F H;  1UNS A;  4Q5V A;  1PH4 A;  5C0X H;  2JXM B;  1WVL A;  1FVI A;  4RHS A;  4JI7 Q;  4C3J B;  2VUM H;  1EYA A;  5EJW A;  1YI2 A;  2N88 A;  1Q90 A;  4IPG A;  1BCP F;  2IY5 B;  3HOV H;  3L9A X;  3A8I E;  4LF7 Q;  5K36 G;  1F9P A;  1DXM A;  3HOW H;  3V96 A;  4K6D A;  1JOQ A;  4Q0F A;  1RD9 D;  2WB1 E;  3CRK C;  1KAA A;  3WOE A;  1O7L A;  1PRT B;  4APV A;  2EYH A;  4F88 A;  4A3I B;  3TS2 A;  2HCC A;  3S16 H;  4WRD A;  1TXY A;  1NY4 A;  2Z0S A;  4TQU S;  1KRT A;  4C3I B;  5LHY 1;  4K6L A;  1CHP D;  2ZTE A;  5GAG C;  5A2Q E;  3MXN A;  2NN6 G;  3NBH A;  4TVA B;  2WIN B;  2D62 A;  1VQ5 A;  1PH5 A;  2F0Q A;  2R7Z G;  1GVP A;  1YJ9 A;  2LFN A;  2NWG A;  2KEN A;  3GTM B;  1ENF A;  1XXG A;  2MUY A;  4X66 Q;  1SE8 A;  3QWN A;  4JBW A;  1O80 A;  4KN4 C;  3A8J E;  3W2D A;  3T1Y L;  1QZG A;  5BN3 A;  4A3G G;  1QB5 D;  2YYZ A;  4GOP B;  5CV7 A;  1JB3 A;  1E7Z A;  1DON A;  3SE0 A;  3CW2 C;  2JA6 H;  2F3V A;  4HSV A;  5DAU A;  1GOZ A;  2EXZ A;  4JK1 C;  3TP7 A;  4OWW B;  2PYK A;  4J15 A;  2VB2 X;  3J80 c;  5KGU A;  2JJQ A;  3OPO A;  4IZ8 A;  1T9H A;  1RF2 D;  1AE3 A;  3MA2 B;  2C35 B;  5C4Z A;  4PNY A;  1ICF B;  2SNS A;  2LS0 1;  3STB D;  4A3J G;  1STH A;  1TWG H;  3K58 A;  1NJI C;  2WFW A;  5J22 A;  4X3U A;  1BCP B;  4DR5 L;  1B7Y B;  1TU2 B;  1PH8 A;  1NSN S;  1I50 B;  4NPS A;  3UDX A;  5JJI A;  4QIW E;  2MNA A;  1YBY A;  2OXP A;  2VY3 A;  2HQL A;  4X3T A;  3S2H B;  4IO9 A;  1Y1V B;  1B8A A;  2GVB A;  1X3F A;  2A74 C;  4R4O A;  1X9N A;  3BDC A;  2X6G A;  4CDE C;  2B2V A;  3CP0 A;  5DLQ E;  5ISR A;  4ZK9 B;  3OWF A;  1BBW A;  4GKK L;  1TWH H;  5IT9 c;  4LUO A;  3RR5 A;  2ATW A;  2JA8 G;  1CA6 A;  5G3L D;  2GVA A;  4MTN A;  3MXN B;  4IUR A;  3NBH B;  3I4L A;  3OIQ A;  1JE4 A;  1SJE D;  3I3C A;  3K81 C;  4NW2 A;  5KNC A;  2VW9 A;  4XXE A;  5HY6 A;  3P1H A;  1BO0 A;  1LTG D;  5BR8 Q;  4DR6 Q;  3DUZ A;  4RKL A;  1JCK B;  1S3O A;  5M5W B;  4POG A;  2K33 A;  3HZX A;  2EY6 A;  1C4Q A;  5GAE C;  2RKS A;  5CV8 A;  5LL6 X;  1EY7 A;  3L3O C;  3K5O A;  1JWM D;  3H0G G;  4QQB X;  2F0S A;  2JP1 A;  1J9O A;  1HNX L;  3EN2 A;  3S1Q B;  1B50 A;  4RGO S;  1CKO A;  1X6O A;  3BDL A;  1SNM A;  4H44 C;  3TEH B;  1JT8 A;  2ZJR A;  4F7X A;  4LF9 L;  1MKH A;  1Q1E A;  3I70 A;  1O7Z A;  3HOY H;  3J81 i;  2ZJP A;  1STE A;  3FPP A;  2GA4 B;  2UXC L;  1ET6 A;  2LXJ A;  1L0W A;  2E2J H;  2F0N A;  3FDT A;  1J5E Q;  4EQ5 A;  4JBK A;  4DV4 L;  2K28 A;  2QW7 A;  4LFC L;  1NMF A;  5C3X A;  2Z6B A;  3EIV A;  2X69 A;  3PV0 A;  4B08 A;  5IY0 A;  2KA7 A;  4K0K L;  5IGF A;  4A3M H;  3D0F A;  3MVV A;  2HCI A;  3TN2 A;  4FF2 A;  4GN3 B;  3CPF A;  3KJO A;  1D5Z C;  2RSO A;  4YY3 Q;  3QOJ A;  2ZXR A;  1YEZ A;  2G9D A;  3CCL A;  1D5X C;  1CZG A;  1I3Q B;  1LO5 D;  5L37 A;  3HOX B;  4R1J A;  1JWS D;  3NTI A;  5CV9 A;  1MSH A;  2YTY A;  3NEM A;  4HTH A;  4GZY C;  1TWA B;  4EVO A;  1AE2 A;  1G91 A;  1OXV A;  3I4N B;  4MZ9 A;  2IPK D;  1H9S B;  4LWC A;  2B39 A;  5CV6 A;  5K36 H;  5E4X A;  1U9R A;  2E76 C;  1S5D D;  3FEW X;  1SXT A;  1R4Q B;  1QZH A;  2R93 B;  4FP5 D;  4RWS C;  1HZB A;  1XPU A;  2B2T A;  1XNQ L;  1Q1B A;  2NVY B;  1EIH A;  2JA7 G;  2WB1 B;  4IAL A;  4XQQ A;  1O78 A;  3J81 L;  5IGC A;  2LSS A;  2R6G A;  2NVX B;  2IHF A;  1K0R A;  2NN6 H;  1VQ6 A;  2E75 C;  4IUU A;  1LT4 D;  4FF1 A;  1LTT D;  1AN8 A;  2Z8L A;  4NB3 A;  5EKK A;  2QGQ A;  3GTL B;  4QUC A;  2A8V A;  1H95 A;  3BZC A;  4WJ4 A;  2YU9 B;  1Z47 A;  5G3L F;  4IJL A;  4EQO A;  3GTJ B;  3UDI A;  3MWY W;  4DXG A;  4A3G H;  3OIP A;  4BXX G;  2K75 A;  3G6J B;  3I2Z A;  3K5M A;  1R4P B;  2F03 A;  3GTG B;  4J8Q A;  3QG1 A;  1G6P A;  3EVQ A;  5M5X B;  1GD7 A;  1JJC B;  1HA6 A;  3S1M H;  3C3L A;  2BCO A;  4LJZ C;  3GTM H;  5J3B A;  4FDB A;  1WTQ A;  4LMQ D;  5HGT A;  2MO1 A;  3T1Y Q;  3RZO H;  1C9O A;  1EY5 A;  3BJU A;  3ZYY X;  3VA7 A;  2NZH A;  1V1Q A;  3S1N H;  2O4X A;  4A3J H;  5FK9 C;  5ELD A;  4TRD A;  5C4X B;  1KLG D;  2A6H C;  4CKC A;  4MNO A;  3H6M A;  4L5T A;  4JYA L;  3RZD B;  2XGT A;  2A68 C;  1SFO H;  1QNK A;  1VQ8 A;  1ESF A;  4QIW B;  2O5I C;  4DR7 Q;  3DEP A;  1C0A A;  1TVX A;  4CKB A;  3M4Q A;  4RA8 A;  4E6I A;  4BBR B;  3M4P A;  3GTQ H;  1DD2 A;  5CV5 A;  3X3N A;  3K7A H;  4BY1 G;  5T1G A;  3TP8 A;  2JA8 H;  1S5E D;  2WAQ G;  4DR5 Q;  1QVF A;  1L1O A;  3M4O B;  2NTS A;  3CD6 A;  3D4D A;  3E6Z X;  3FHW A;  3HOU B;  5A35 A;  3UDG A;  1F77 A;  3LWU A;  1QIL A;  5M3M B;  2PMZ B;  3KF6 A;  1GO3 E;  4HCE A;  5M3F B;  4YWK A;  2QEX A;  2EQS A;  3NE5 B;  2A19 A;  4POF A;  4GKK Q;  1AH9 A;  2QCP X;  2VUM B;  5IP9 H;  3NWS A;  2F0U A;  5AJ3 L;  3H0G H;  1IBL L;  1YNJ C;  1F2L A;  2R7F A;  3CQZ H;  4L5S A;  5KYI A;  2JEA I;  4GNX C;  1VMC A;  4LK1 C;  3HOV B;  3W1B A;  3F8T A;  4O2D A;  4RCN A;  3HOW B;  5C44 G;  5I9P A;  1IYV A;  2EDG A;  2F0O A;  3TP5 A;  2MGS A;  4K8J A;  4DNT B;  5K5P A;  2HDL A;  3S16 B;  2PCF B;  2PZT A;  3KFU A;  3AQQ A;  2HIV A;  3I4M G;  4Y7N H;  2ZXO A;  2V1C C;  1I4R A;  2JE6 I;  3N6R A;  1HNX Q;  4ZUI A;  1BKB A;  4UP8 A;  1LT6 D;  3G4S A;  2AQ3 B;  1B1Z A;  1JE5 A;  2XSC A;  3D4W A;  5LMN L;  1R9T H;  2CWA A;  1AZQ A;  4L63 B;  4LF9 Q;  3A74 A;  1BVS A;  1I4X A;  2G5D A;  2A6H D;  2AUJ D;  1YIT A;  1VQA A;  2K04 A;  1ZEQ X;  4IJH A;  2UXC Q;  3D6C A;  1I5F A;  3P75 A;  1WTR A;  2A68 D;  3PIP A;  5M5Y H;  4LFA L;  1H9K A;  4DV4 Q;  3TP6 A;  1D8L A;  5GQO A;  4ZKC B;  4LFC Q;  1PYB A;  3K80 C;  2JA6 B;  1SBB B;  1WFQ A;  4UPA A;  4K0K Q;  5FOB B;  1L1O B;  1S5F D;  4XYO A;  4UP7 A;  3U4Z A;  1SJH D;  3ERO A;  1E2W A;  1HXY D;  4WOR A;  3R2T A;  4I7A A;  1T5E A;  5CYU A;  4LFB L;  2I46 A;  3KF6 B;  1F9R A;  2F0J A;  4KLK A;  2QA4 A;  2Q8I B;  4IPD A;  1PZK D;  2EPB A;  2KHJ A;  3IL8 A;  5COR A;  3OHX C;  4N9T A;  1TWG B;  4JPB W;  3M9B A;  4K2L A;  3D8G A;  1Y69 U;  2E2D C;  2B2U A;  2JA7 H;  1QWY A;  2IX3 A;  1YNJ D;  3S9W A;  3GV6 A;  4KN7 C;  1N36 Q;  5J1Z A;  1MD2 D;  4R8N A;  3GTO H;  1TS4 A;  2AWO A;  1CK1 A;  1ML0 D;  3OYY A;  4JG2 A;  3U9O A;  2MQH A;  2XRS D;  1S72 A;  4CJ0 B;  5F2D A;  1TWH B;  5EPK A;  4G4K A;  3ERQ A;  1SE3 A;  3PO3 G;  3I56 A;  1XNQ Q;  1EY0 A;  1RTN A;  1SE4 A;  2VZA A;  1KHI A;  2SNM A;  3J7A F;  3R2I A;  2F0W A;  2ZJQ A;  1VQ4 A;  3DXJ C;  2PO4 A;  5FLM G;  1HNZ L;  3NP8 A;  2B2V C;  2KJX A;  4RG1 A;  5EBC A;  5DEH A;  2EYF A;  4BXX H;  1EFI D;  1UE1 A;  1E22 A;  2IWH A;  4WFN 3;  4QMG A;  1HCZ A;  4KY5 A;  2Q8R E;  4QGU A;  2RHQ B;  1G6Z A;  1FYC A;  1ENC A;  1VCI A;  2F0T A;  2K4K A;  3TZD A;  4JOI C;  3TQY A;  1MI2 A;  4PZ7 A;  4BBS G;  1FJG L;  2OWO A;  3PIO A;  1KQS A;  4GLA C;  3GTJ H;  1QUQ B;  3RN2 A;  1V8Q A;  1RIP A;  1BQQ T;  1JWU D;  3JC6 6;  3HOY B;  4U67 3;  3I73 A;  3SK6 A;  1IW7 C;  2JK8 A;  2E2J B;  1A15 A;  1WTV A;  4CDD C;  3NTK A;  4KJO A;  1SLJ A;  1KAB A;  2Z1C A;  3D31 A;  3BG3 A;  2VL6 A;  4X64 L;  2B2W C;  4DAP A;  3TRZ A;  2D0O A;  4HED A;  2EY5 A;  4A3M B;  2K01 A;  2LMC B;  5M9O A;  3H94 A;  2PW7 A;  2VXW A;  3PUX A;  4BY1 H;  4OIJ A;  4CJ2 C;  1K3R A;  1PA6 A;  3FP9 A;  2DY7 A;  3I55 A;  3Q6S A;  4A3D H;  4JYA Q;  5CBA E;  3KYH C;  2JYO A;  1UEB A;  4B3R L;  3FKI G;  1B70 B;  1FNW A;  3A8K E;  1EWC A;  4OGQ C;  1UAP A;  3I91 A;  1BDO A;  3K57 A;  3NWT A;  5EPJ A;  4YWM A;  4A93 G;  3CU7 A;  4LAA A;  1NE3 A;  5C5L A;  3RMH A;  1A2T A;  4GOP A;  1KL9 A;  3I90 A;  1H9M A;  1RDP D;  1ZKO A;  4XT3 B;  4AQY L;  1WOC A;  2B29 A;  4P75 A;  4FXD A;  4KY7 A;  3M3Y H;  1NNX A;  1QVG A;  2JN4 A;  3A56 A;  4PZ8 A;  1FD7 D;  1KNA A;  5C44 H;  3HOU H;  2UXD L;  4P73 A;  4G7O C;  1WJJ A;  4IFD I;  4IUN A;  1IBK L;  2OEO A;  1YHQ A;  1LTS D;  3PSI A;  4V0B A;  4NMZ A;  3Q22 A;  5JPM C;  5AJ3 Q;  1IBL Q;  3I4M H;  3RD4 A;  1HH2 P;  4OEM B;  2MJ8 A;  3DLL A;  1ASZ A;  2R7Z B;  1CM9 A;  2QDB A;  4FXG C;  3T16 A;  2MHV A;  2DY8 A;  5GAD C;  4OXP A;  1IW7 D;  4PV1 C;  3SK4 A;  3RLO A;  2CKZ B;  5I2Y A;  3IFD A;  1GUO A;  3CCM A;  4C56 C;  2OQ0 A;  3K0X A;  4A3G B;  4KMU C;  1YJN A;  2ICI A;  4P74 A;  3VYT A;  1XX8 A;  1HTP A;  5C3W A;  1H9J A;  1YHB A;  1QOH A;  4X3K A;  3JAM E;  3RNU A;  1UEA B;  3A55 A;  1I4P A;  5FLX L;  5LMN Q;  1RTO A;  2IT1 A;  2E8G A;  1A8V A;  4AH6 A;  5CGK A;  1J8I A;  1Z7T A;  3E0J A;  3S1M B;  2K1B A;  3M7N A;  1H9R A;  2DJG C;  2KEC A;  2YV5 A;  3RZO B;  4LFA Q;  1ASY A;  1AW7 A;  4L8J A;  4WJW A;  3WWV A;  1CHQ D;  4A3F G;  3GTK H;  3CCJ A;  2I5H A;  3S1N B;  3WOF A;  4A3J B;  2XVS A;  1V1O A;  2YTV A;  1G2S A;  5IYC H;  2PNH A;  4YCU A;  1SFO B;  1LV9 A;  4LFB Q;  4DR4 L;  1PYW D;  3J81 j;  3URY A;  5ELN A;  4DR7 L;  4A4I A;  2FIN B;  3A5U A;  3GTQ B;  1W2B A;  1HUN A;  4IFD G;  1CI3 M;  1X54 A;  2WAQ E;  3K7A B;  1KAW A;  2JA8 B;  4G7Z C;  3PF4 A;  4KHZ A;  1X32 A;  3PO3 H;  1IYJ B;  2K5H A;  2N55 A;  5IYD H;  1B9N A;  5D3I B;  4KHP L;  4GNX B;  4FYD A;  1V1P B;  1PH7 A;  5JJK A;  4FF3 A;  1N9W A;  1Y14 B;  5FLM H;  1KDB A;  4C1N K;  2M2L A;  4A3K G;  3CCS A;  1YZ6 A;  4NDX A;  1GHK A;  3MXU A;  3K5L A;  1I4G A;  2Z6K A;  1PH3 A;  3H0G B;  1TY2 A;  1UE6 A;  3CQZ B;  4JI0 L;  1NBW A;  4LF8 L;  2F4V L;  1CTM A;  1XMQ Q;  1VQE A;  2XIW A;  4BBS H;  4DV1 L;  1WYD A;  4DNR B;  4BS9 A;  1IBM L;  2EJM A;  4IPH A;  4XQN A;  4RFB A;  1HNZ Q;  1EYD A;  2PI2 E;  4H13 C;  1N34 L;  3CMA A;  3CCU A;  1PMR A;  1DJR D;  1EOV A;  1GUG A;  1U5K A;  2PNR C;  2RA4 A;  2VQE L;  1EZ8 A;  4Y7N B;  1H9S A;  2EY1 A;  4KTA A;  5JJZ A;  1VDZ A;  3KLS A;  5D14 A;  1SRU A;  1PH6 A;  5IIF A;  4XYQ A;  2HUG A;  4MN3 A;  4ZKB B;  4X62 L;  2NVQ H;  2Q2U A;  3TSS A;  1EY4 A;  1FJG Q;  1S40 A;  2QDL A;  2E74 C;  5CV4 A;  1TS3 A;  1EY8 A;  2K5Q A;  4X65 L;  1R9T B;  1F2Z A;  1SE2 A;  1VQG A;  2NUC A;  1SN8 A;  4R4T A;  1UE5 A;  4HIM A;  2EYM A;  1MJE A;  1ZYR C;  5E4W C;  3HRZ C;  1FNV A;  4LF4 L;  4JI6 Q;  1D1K A;  4HJ5 A;  5M5Y B;  1X3P A;  3F1Z A;  2F4I A;  2BH2 A;  3K8A A;  2KED A;  4B9X A;  3DM1 A;  5JPN C;  2FXQ A;  2RHS B;  2BA0 A;  2Q2H A;  1Q86 C;  4X64 Q;  4B3S L;  3FKI H;  4RKB A;  2KOL A;  1Q82 C;  4G57 A;  4KJN A;  4A3B G;  1IYU A;  2ZT9 C;  4A93 H;  3GDE A;  3LNN A;  3LGJ A;  1OTC A;  4OX9 L;  3H15 A;  3H3V I;  3GTP H;  3KOJ A;  2OTJ A;  4BA2 I;  1D2B A;  1CKN A;  1STG A;  3BVM A;  2X6L A;  1PYS B;  4DPG A;  4FF4 A;  1GM5 A;  5JOB A;  4B3R Q;  2NB0 A;  2E2I H;  3C1F A;  5I9O A;  1RJT A;  4GLX A;  3T51 B;  3UI2 A;  2JA7 B;  3SK5 A;  4DV0 L;  3A5Z B;  1N8R C;  1N33 L;  3J80 i;  1LT5 D;  3KDF A;  4XT1 B;  4O1N A;  4AQY Q;  4HMJ A;  4LW1 A;  1WTW A;  3JAM c;  2K5W A;  3VYS A;  4MIU A;  3DEO A;  2F1M A;  5CMD A;  3GTO B;  1N36 L;  2UU9 L;  3NPP A;  2ALY B;  1EIF A;  2F0E A;  1O7I A;  3W5O A;  3MEF A;  2B2Y C;  2UXD Q;  1STB A;  1TT2 A;  2F3W A;  3F2C A;  2B2U C;  1IBK Q;  2GN5 A;  1JJG A;  4JBJ A;  1Q81 C;  1WD0 A;  4R9W A;  2OCE A;  2WKD A;  2NVT H;  1Q3L A;  4RCO A;  1G8Z D;  1F2Y A;  3QR8 A;  4RH6 A;  1VMP A;  1OXS C;  1EZ6 A;  1PVO A;  1PH2 A;  3NK9 A;  3GD7 A;  1ILP A;  4C2M H;  3I7F A;  1BXT A;  2L1B A;  2R7Z H;  1ZYR D;  2L15 A;  2MP1 A;  2WKC A;  3FVQ A;  1LLR D;  1PH1 A;  1VQ7 A;  1EQV A;  4L6T B;  2C9O A;  1VQN A;  4ULL A;  3HGB A;  1J6Q A;  2CQA A;  1EQR A;  2BH8 A;  4A3F H;  1LTR D;  2H5X A;  3AFP A;  1HFN A;  3S17 H;  4DR3 L;  4N8F A;  2JA9 A;  4RGT A;  1CKN B;  3S1R H;  1YNX A;  4M1U B;  4WJ3 M;  1DZ1 A;  4ME3 A;  3CRL C;  2A73 B;  4QF4 A;  3J80 L;  5EGT A;  2L11 A;  3ULJ A;  3K6O A;  3PGZ A;  4A3E G;  4K5X A;  1SR3 A;  5C3E G;  4O42 A;  5E3F A;  4IFD J;  3J7Z C;  1DOL A;  3P7J A;  1F9S A;  3TDQ A;  3KDF B;  1C7Y A;  1JR0 D;  4BY1 B;  3DWA A;  2WAQ B;  4FVM A;  3MC0 B;  4A3D B;  4K14 A;  4OEL B;  2ICE C;  3CCE A;  3FPU B;  1K28 A;  1EYC A;  2YTX A;  1PFM A;  1U4R A;  4NXN L;  2VB3 X;  5C0X I;  1B3A A;  1TII D;  4DR4 Q;  1A63 A;  1NUC A;  2EJF C;  4KY6 A;  3KLS X;  2F0L A;  2F0M A;  3SGI A;  3CHB D;  4N8X 1;  5ELC A;  1U4L A;  4A3K H;  1EIG A;  1Y1W G;  1HZC A;  1TKW B;  4UY8 C;  1X3Q A;  3KJP A;  4N9P A;  5IT9 L;  3CCV A;  1A6X A;  4QJF A;  2HHH L;  3M3Y B;  1HJP A;  1A3T A;  5EAY A;  3RLN A;  4DGZ A;  4KHP Q;  3H09 A;  1JOR A;  2ES2 A;  3EQL C;  3D6W A;  4CGY B;  1AP0 A;  4JBM A;  1IXR A;  3DMU A;  5C44 B;  1IKL A;  1HA5 A;  3NQI A;  3DWQ A;  2IX1 A;  3H91 A;  5C5M A;  1XYI A;  1YJW A;  1TS5 A;  5C4J H;  3I4M B;  1ENA A;  4ILW A;  4KKS A;  1OXU A;  2F0V A;  4JI0 Q;  4PG3 A;  4LNQ A;  4LF8 Q;  1HTL D;  2M00 A;  2R7D A;  2F4V Q;  5C4X G;  4ZUJ A;  3KBX A;  1IZ6 A;  4DUZ L;  4DV1 Q;  2PQE A;  1LT3 D;  2MPM A;  1IBM Q;  1Q8K A;  4CJ1 B;  1SMY D;  2NTT A;  2E2H H;  1P16 A;  4DK1 A;  2OF1 A;  1N34 Q;  3UE0 A;  3MXP A;  2VQE Q;  5ELB A;  1WTP A;  4XQJ A;  4MHE A;  4ZRZ A;  4HJ9 A;  4X62 Q;  3AEV A;  4QY7 A;  2PQA B;  4RAU C;  3U4V A;  4X65 Q;  2UUC L;  1Y8P B;  4IPC A;  2WP8 J;  4A3B H;  1CQV A;  3QJY A;  3TME A;  5FJ8 G;  1PDQ A;  4EX5 A;  4MTK A;  1AEX A;  2LY7 A;  4LF4 Q;  2HDM A;  3GP7 A;  5BN4 A;  2AQ1 B;  2K5D A;  5C0X G;  3SK8 A;  3NBI A;  1XWE A;  3GTK B;  1TWF H;  2B63 G;  2ZTD A;  4Y52 H;  4YWL A;  3Q0A A;  2Q2I A;  4AYB G;  4B3S Q;  4RHR A;  1FNU A;  4GN5 A;  4LF5 L;  1M4V A;  4DAV A;  1WTX A;  4Z9C B;  1LTI D;  3D3R A;  3ERS X;  2OTL A;  5IE8 A;  1M90 C;  1QUQ A;  1D1I A;  5A2Q L;  1X55 A;  2J7Z A;  2AWN A;  4OX9 Q;  4BA1 I;  1Y8O B;  4HJ7 A;  4OHJ A;  3N52 A;  4IN3 A;  1HRJ A;  5EKL A;  1WCM G;  4R8I A;  1K9M C;  2R92 G;  3SDZ A;  2D0P A;  1VQM A;  1W3S A;  2K5V A;  1XTC D;  2HQE A;  3PO3 B;  2BA1 A;  4HMI A;  4DV0 Q;  1NR2 A;  2R3Z A;  4I65 A;  1YVC A;  1ZXT A;  1N33 Q;  2A6E D;  4JVZ A;  2RCF A;  1VQO A;  2R61 A;  3E0E A;  2UU9 Q;  5I2X A;  1E0B A;  1STY A;  4BY7 G;  5FKA C;  1LTL A;  2TSS A;  1EU4 A;  5KEE A;  2K5N A;  1M1K C;  1IKM A;  3J81 E;  3PF5 A;  3NXW A;  2J0T D;  3M7G A;  2VQF L;  2I5L X;  3E9H A;  4HIK A;  1I6V C;  5C4H A;  1MGS A;  2IHE A;  4BBS B;  1PFN A;  1XMQ L;  1HQM C;  2N78 A;  3PUV A;  1DOK A;  4HR7 B;  4JW0 A;  4F8M A;  3KF8 B;  3VYU A;  1YHA A;  3HOZ G;  3BYY B;  4B9W A;  3BZD B;  4HCS A;  1BNZ A;  1VQB A;  4JI4 L;  1MBY A;  4K5V A;  2NVQ B;  1SNO A;  1DGS A;  3UDF A;  5D3D A;  3PQI A;  1B4O A;  1JIC A;  3PIP 3;  3A54 A;  4DK6 C;  1CZW A;  2ID0 A;  4A3E H;  5E7N A;  5C3E H;  2NZ1 D;  1WD1 A;  4P72 A;  3PO2 G;  2Y0S G;  1GJX A;  1QE6 A;  4RMF A;  4DR3 Q;  4ZLT F;  2DNE A;  1JMC A;  1QJO A;  2RBM A;  3H3V C;  1EU3 A;  4H0L C;  1B44 D;  1XTD A;  2AKW B;  2EYL A;  4GS3 A;  1PTO H;  4JI6 L;  3GV3 A;  3FKI B;  2AUK A;  2Q8T A;  1HR0 L;  3BDO A;  4ZQ3 A;  2KHI A;  2B8G A;  3SXH A;  3W1G A;  5DM6 3;  4A93 B;  2PW5 A;  1NTG A;  1YNN C;  5IOC A;  4K8I A;  5I6Y A;  2IJ0 A;  1HHV A;  2JA5 G;  1PTO C;  3GTP B;  2KVM A;  3CAM A;  2NZO A;  1QNU A;  1HZA A;  4GKJ L;  4NXN Q;  1PZI D;  1L0X B;  4DV3 L;  1C48 A;  3QOL A;  4A75 A;  5GRO A;  1HNW L;  4OIK A;  4DV6 L;  2TMP A;  3CKI B;  2E2I B;  3UE1 A;  4KV6 A;  1D5M C;  1RL2 A;  2RSN A;  3PUZ A;  2EYO A;  5HUR A;  1EIY B;  1HUM A;  5IGG A;  1VQ9 A;  1VQD A;  4FXK C;  3VR4 A;  1A62 A;  2RVL A;  2HHH Q;  3HEJ A;  1VQP A;  1SYB A;  2DUD A;  1MSG A;  2XWJ B;  1PZJ D;  1HPC A;  1EQT A;  3KK7 A;  1I94 L;  2A5H A;  5FO8 B;  3HKZ G;  1LTA D;  2HIX A;  3M85 A;  4JV5 Q;  1DCZ A;  3J7A V;  1JC7 A;  1I6H H;  4QUF A;  2K50 A;  3HFZ B;  3MFY A;  2NBF A;  2NVT B;  3BVG A;  4KHV A;  1E24 A;  1PFB A;  1EUJ A;  5IGE A;  2KHS A;  5ELO A;  5EQ0 A;  3PIO 3;  4DUZ Q;  1XPR A;  1PLF A;  4C2M B;  2IL8 A;  2IW3 A;  1CKM A;  4GNX A;  1V1P A;  4C3H G;  4DV2 L;  3WDN A;  2B2T C;  1MIU A;  5ELE A;  5FJ8 H;  3FRP B;  5DNF A;  5I6W A;  4ZAI A;  3VR5 A;  5C0X J;  2Z4I A;  3KLR A;  3OSO A;  3BZK A;  3VR6 A;  1K83 H;  4X3S A;  2O5J C;  3Q8D A;  4A3F B;  4CDF C;  2B63 H;  3MZ5 A;  1LTB D;  3C46 A;  1M8A A;  1TWC H;  3V2T A;  1GUN A;  2L4N A;  4DFA A;  4OWT B;  3S17 B;  4KD4 A;  4DU9 A;  2AHO B;  2UUC Q;  1I4Q A;  3MTS A;  2CHB D;  4GLV B;  1LYL A;  1YNN D;  3D4R A;  3S1R B;  4KKU A;  1KDC A;  1I4H A;  2F52 A;  1PTO D;  3VYR A;  1KXL A;  3I72 A;  3T13 A;  2BE5 C;  1B53 A;  4KD3 A;  3K59 A;  3J81 c;  4EQP A;  2JQO A;  1SSO A;  5BN5 A;  3S2D H;  2R92 H;  1WCM H;  1K8M A;  4ID6 A;  4C3J G;  3OW7 A;  4B3M L;  5IP7 G;  1JOK A;  2QF7 A;  3PUW A;  3AFQ A;  2N3S A;  2FHT A;  4LF5 Q;  3KLW A;  3ULL A;  4YIJ A;  1ICW A;  1VQK A;  3Q23 A;  1UE7 A;  2AMC B;  4JI5 Q;  4HID A;  4F87 A;  4KKT A;  1W6K A;  2KCM A;  2QKI C;  1B9M A;  3VA5 A;  5DM7 3;  3KBG A;  4DN4 M;  4A3I G;  1BBU A;  2ENB A;  4YHH L;  3V05 A;  1XNR L;  1KTK A;  2SDF A;  4A3K B;  4IUP A;  4JI3 Q;  1E1T A;  2BOS A;  2F0K A;  4BY7 H;  5EBD A;  1BOS A;  4C3I G;  5KIX A;  5JJL A;  3L2P A;  1KDA A;  2D9U A;  5KYL A;  5LMU L;  4JCV E;  2K03 A;  1PV4 A;  1OXX K;  1A2U A;  1AZP A;  2PZW A;  3RN5 A;  4NXM L;  4OO1 I;  3F2B A;  3IKJ A;  4XIG S;  5LL6 S;  4BWG B;  4C1N I;  1GUT A;  2CFM A;  2N49 A;  1MJC A;  3HOZ H;  2EZV A;  3NEN A;  2UXB L;  5C4J B;  4X6A H;  4O0A A;  2G9H D;  3CC2 A;  5T1I A;  3J7A 5;  1L1O C;  4UAI A;  2VQF Q;  1LAC A;  3CC7 A;  2F3I A;  3CC4 A;  1HR0 W;  2E5L L;  3O13 A;  2KCN A;  2E2H B;  2BDO A;  4JI1 L;  5JVH 3;  3NSW A;  3TBI B;  1KLU D;  1BBX C;  3PO2 H;  2MO0 A;  5JAV A;  1K8G A;  1SYC A;  3DHQ A;  3C1E A;  3K7U C;  4JI8 L;  1K0S A;  1XJV A;  3DM3 A;  2KQ3 A;  2LXK A;  4UHV A;  1ONL A;  5JEA G;  4DR1 L;  4JI4 Q;  2L12 A;  5NUC A;  4DAM A;  2BE5 D;  2RCN A;  3L7Z C;  2EYP A;  4JOI A;  1BR9 A;  4A3B B;  2PMZ E;  2ZM6 L;  3K0Y A;  5E1F A;  3E3X A;  2DJF C;  2FJ2 A;  2A1A A;  2FMM A;  3QIA A;  3SEB A;  2F0P A;  3A7A B;  1Y1V G;  3OTO L;  2D5D A;  5AFW A;  2JA5 H;  3U58 A;  1LAB A;  5H1S E;  2ASB A;  1TWF B;  1Q12 A;  4S3S A;  5IP9 G;  1JOO A;  1ET9 A;  4AYB E;  1VF5 C;  3BU2 A;  1L0Y B;  3K5N A;  1ILQ A;  3NUC A;  5J39 A;  1Q7Y C;  3G7L A;  3ND8 A;  1PHJ A;  1VQJ A;  1HR0 Q;  2HD3 A;  1VS0 A;  4HSP A;  5IWA L;  4OON A;  2Z4H A;  4R4C A;  2B2W A;  2CCZ A;  3BS1 A;  3PMF A;  2UUA L;  1VQI A;  1E1O A;  4R4I A;  3MHB A;  4OL7 A;  4CKE A;  2VNU D;  1EQQ A;  4OO1 G;  1PTO F;  4GKJ Q;  3AYH B;  4DV3 Q;  3TRE A;  1HNW Q;  3CF5 A;  4DV6 Q;  1NAP A;  1SYD A;  3ER0 A;  4B3T L;  1E3P A;  2K7V A;  4GN4 B;  5KNB A;  1U4M A;  1Q46 A;  3ND9 A;  4JC0 A;  5GAH C;  4H7B A;  4DR2 L;  3J7Y W;  2H4O A;  2XTI A;  3AB9 A;  3EBE A;  4LF6 L;  2CH4 W;  1II3 A;  1SEB D;  1I94 Q;  3EFX D;  2UUB L;  3ULP A;  3R93 A;  1C8C A;  4C3H H;  1JQY D;  3G71 A;  4R4Q A;  3S14 H;  2SEB D;  3OMG A;  1L2F A;  2Z9H A;  4EQN A;  4DK3 C;  2DN8 A;  3OMC A;  3CPW A;  3G6E A;  1P8L A;  1JJ2 A;  4I7Z C;  2OQK A;  3E9I A;  1IL8 A;  1G51 A;  1HQR D;  4IUV A;  5IYB G;  1KC8 C;  1KD1 C;  2DGY A;  4DV2 Q;  4DK0 A;  2KUM A;  5CC4 A;  4JI2 L;  2OT2 A;  2AQ2 B;  2PI2 A;  3HOX G;  2NYZ D;  3HS0 C;  1A0I A;  3L0O A;  1CQF A;  5IGB A;  4A3E B;  5C3E B;  1DOM A;  2Y0S E;  5FLX E;  1XPO A;  5COY A;  4C3J H;  1OO9 B;  3MEH A;  3A0J A;  5IP7 H;  4KK7 A;  1SMY C;  4ZYS A;  1T5X D;  2MFI A;  2J4X A;  1QCB D;  2L9H A;  1CSQ A;  4NP5 A;  3I4N G;  1PTO B;  4A3L G;  4TKO B;  2QIL A;  1WTH A;  3HP3 A;  4DAY A;  2R93 G;  3NTH A;  4A3I H;  2WB1 G;  3GO5 A;  3MXG A;  1D7Q A;  3MAQ A;  1N32 L;  4B3M Q;  5C6A A;  1Y1W B;  4C3I H;  3C2P A;  2XN9 C;  2PQA A;  1EEF D;  4HAE A;  1QG7 A;  4IFD H;  1K8O A;  1CUK A;  3T4A C;  3T1H L;  1SYF A;  4ALP A;  1NCV A;  1X56 A;  3CXC A;  2LKV A;  2DNC A;  1PRT C;  4IOA A;  2RF4 A;  3U50 C;  4YHH Q;  1IL2 A;  1XNR Q;  3F2U A;  5HGQ A;  4RGM A;  4L5R C;  4A3C G;  1GUW A;  1K8A C;  1Z9F A; 
#chains in the Genus database with same CATH homology
 3TEH B;  2K14 A;  5GAD C;  4DUY L;  2ZJR A;  3PF5 A;  1JT8 A;  4LF9 L;  1MKH A;  1Q1E A;  3HKS A;  5LMU Q;  4OXP A;  3HOY H;  2VQF L;  2I5L X;  3E9H A;  3RLO A;  3J81 i;  3F2D A;  2ZJP A;  4HIK A;  3OW2 A;  3HKZ E;  2CKZ B;  2IHE A;  2UXC L;  4NXM Q;  3CCM A;  1EFW A;  2OQ0 A;  3K0X A;  2LXJ A;  1L0W A;  1XMQ L;  2E2J H;  2N78 A;  3PUV A;  1YJN A;  1J5E Q;  4P74 A;  4EQ5 A;  4JBK A;  4DV4 L;  3ICE A;  3KF8 B;  4LFC L;  4PZ6 A;  1YHA A;  4JV5 L;  3HOZ G;  1NMF A;  1YHB A;  4LUV A;  2UXB Q;  3RNU A;  5JEA J;  3EIV A;  4PMW A;  3PV0 A;  5IY0 A;  4K0K L;  4GOP C;  5LMN Q;  4A3M H;  3D0F A;  4AIM A;  2IT1 A;  2E8G A;  1CSP A;  1A8V A;  3JAM i;  1VQB A;  2I0Q A;  4JI4 L;  4AH6 A;  1EYG A;  1DGS A;  3UDF A;  1VQL A;  4DV5 L;  3M7N A;  4GN3 B;  4A3D G;  3CPF A;  4LUZ A;  2KCT A;  4DK6 C;  3KJO A;  4DV7 L;  2ID0 A;  2E5L Q;  4YY3 Q;  2YV5 A;  4LFA Q;  4JI1 Q;  1ASY A;  1XMO L;  1YEZ A;  4A3E H;  5E7N A;  3WWV A;  1I50 H;  5C3E H;  4A3F G;  3CCL A;  3GTK H;  4P72 A;  3PO2 G;  2Y0S G;  4DNI A;  2I5H A;  3CCJ A;  4RMF A;  4DR3 Q;  2N8N A;  3S2H H;  1JMC A;  1Y1V H;  4JI8 Q;  2YTV A;  4H02 A;  4DAY B;  4R1J A;  2B3G A;  4DR1 Q;  5IYC H;  4BBR G;  2YTY A;  1XTD A;  2AKW B;  2PNH A;  3NEM A;  4GS3 A;  4YCU A;  4JI6 L;  2EIF A;  3I4O A;  4JI7 L;  4LFB Q;  4DR4 L;  1KRS A;  1AE2 A;  3J81 j;  1HR0 L;  5ELN A;  4DR7 L;  1OXV A;  2KBN A;  2KHI A;  2ZM6 Q;  4A4I A;  3W1G A;  3A5U A;  4MZ9 A;  1W2B A;  1LM0 A;  1NTG A;  4LWC A;  3HOU G;  1PFS A;  4LF7 L;  4IFD G;  1X54 A;  2WAQ E;  1KAW A;  5M3M G;  1QZH A;  3PF4 A;  4KHZ A;  1HZB A;  3OTO Q;  1XPU A;  2JA5 G;  3PO3 H;  5M5W H;  1XNQ L;  1Q1B A;  5M3F G;  1IYJ B;  3CAM A;  2NZO A;  2JA7 G;  4YCV A;  2K5H A;  1HZA A;  5IYD H;  1OXT A;  4GKJ L;  4NXN Q;  4GNX B;  4KHP L;  4DV3 L;  2VUM G;  4A75 A;  1HNW L;  5GRO A;  2LSS A;  2R6G A;  1PH7 A;  4DV6 L;  5JJK A;  1SRO A;  2IHF A;  3UE1 A;  1K0R A;  1N9W A;  1Y14 B;  5IWA Q;  5FLM H;  1RL2 A;  3HOV G;  1VQ6 A;  3S1Q H;  3PUZ A;  4A3K G;  3CCS A;  1YZ6 A;  4HIO A;  2JEB I;  1EIY B;  3HOW G;  2Z6K A;  2UUA Q;  1PH3 A;  4NB3 A;  4JI5 L;  1UE6 A;  1VQD A;  1VQ9 A;  1A62 A;  2QGQ A;  4HJA A;  3IRB A;  2HHH Q;  2A8V A;  1VQP A;  4JI0 L;  1H95 A;  2DUD A;  3BZC A;  1NBW A;  4LF8 L;  4WJ4 A;  1Z47 A;  2F4V L;  4L5Q A;  4OWX B;  4X66 L;  1XMQ Q;  4IJL A;  1I94 L;  1VQE A;  3UDI A;  4BBS H;  4JI3 L;  3HKZ G;  4DV1 L;  1WYD A;  2HIX A;  1IBM L;  4B3T Q;  4A3G H;  4IPH A;  3M85 A;  4JV5 Q;  1HNZ Q;  2PI2 E;  1N34 L;  2K75 A;  3CMA A;  4BXX G;  3I2Z A;  3CCU A;  2CQO A;  1I6H H;  5FLX c;  1EOV A;  1U5K A;  4HJ8 A;  2K50 A;  2VQE L;  3VDY A;  4DR2 Q;  3HFZ B;  1VQF A;  3CCQ A;  3CCR A;  2VS1 A;  1G6P A;  1SRU A;  1PH6 A;  1E24 A;  4LF6 Q;  1GD7 A;  2NVQ H;  4X62 L;  1EUJ A;  1JJC B;  2Q2U A;  5ELO A;  3S1M H;  3GTM H;  5IYB H;  5J3B A;  4DUZ Q;  1XPR A;  4FDB A;  1FJG Q;  1S40 A;  1CKM A;  4GNX A;  4X65 L;  2MO1 A;  3T1Y Q;  2UUB Q;  1C9O A;  3BJU A;  4R4T A;  3RZO H;  1VQG A;  1SN8 A;  4DV2 L;  1UE5 A;  2ZTC A;  1MIU A;  5FJ8 H;  4HIM A;  1QVC A;  2NZH A;  1MJE A;  1V1Q A;  3S1N H;  2JA6 G;  2CWP A;  5IYC G;  5C0X J;  1I3Q H;  4A3J H;  4LF4 L;  3HOX H;  3BZK A;  4MNO A;  4JI6 Q;  4HJ5 A;  1K83 H;  4L5T A;  3F1Z A;  2BH2 A;  4JYA L;  3Q8D A;  3K8A A;  3RLF A;  2XGT A;  4QL5 A;  2B63 H;  1SFO H;  2FXQ A;  2RHS B;  1TWC H;  2BA0 A;  2Q2H A;  1TWA H;  1Q86 C;  1VQ8 A;  4OWT B;  4X64 Q;  4B3S L;  3FKI H;  4DR7 Q;  2AHO B;  1C0A A;  2UUC Q;  1Q82 C;  2Z6K C;  3M4Q A;  4GLV B;  2IX0 A;  1LYL A;  3TS0 A;  3I4N H;  4A3B G;  3M4P A;  3GTQ H;  4A93 H;  1LUZ A;  4JI2 Q;  4A3L H;  1UWV A;  2I5M X;  3GDE A;  2F52 A;  3LGJ A;  3K7A H;  4BY1 G;  1KXL A;  1OTC A;  2JA8 H;  1PH9 A;  3H3V H;  2R93 H;  1K73 C;  2WAQ G;  4OX9 L;  4DR5 Q;  1QVF A;  5IYD G;  3H15 A;  1L1O A;  4XTC S;  3H3V I;  3GTP H;  3KOJ A;  2NVY H;  4BA2 I;  2OTJ A;  1U0L A;  3J81 c;  1CKN A;  2JQO A;  4KI0 A;  3CD6 A;  3S2D H;  1PYS B;  4DPG A;  1WCM H;  2R92 H;  3FHW A;  1GM5 A;  5BR8 L;  3UDG A;  4DR6 L;  4B3M L;  4B3R Q;  5IP7 G;  1FGU A;  3PUW A;  3AFQ A;  2E2I H;  2N3S A;  3KF6 A;  3NEL A;  1V9P A;  2NVX H;  1GO3 E;  4LF5 Q;  4GLX A;  3KLW A;  3ULL A;  4YWK A;  2QEX A;  2EQS A;  1VQK A;  4DV0 L;  3G48 A;  2EXD A;  3A5Z B;  2A19 A;  4POF A;  4GKK Q;  1AH9 A;  1UE7 A;  2AMC B;  1N8R C;  4JI5 Q;  1N33 L;  3J80 i;  4HID A;  3KDF A;  3S24 A;  2KCM A;  3ZJY C;  5IP9 H;  1VQC A;  4AQY Q;  4LW1 A;  5AJ3 L;  3H0G H;  1IBL L;  3JAM c;  2R7F A;  3CQZ H;  4A3I G;  1BBU A;  4L5S A;  2Q2T A;  3GTL H;  2JEA I;  4YHH L;  1N36 L;  4GNX C;  2UU9 L;  1XNR L;  2ALY B;  4DKA C;  2YU9 H;  3W1B A;  4JI3 Q;  1EIF A;  3F8T A;  1E1T A;  1O7I A;  4O2D A;  1N32 Q;  3W5O A;  4BY7 H;  4A3C H;  3MEF A;  1KIX A;  2HT1 A;  4YCW A;  1G29 1;  5C44 G;  5JJL A;  2UXD Q;  3L2P A;  3F2C A;  1Y1W H;  3T1H Q;  1IBK Q;  5LMU L;  1X3G A;  4JCV E;  2GN5 A;  1PV4 A;  1JJG A;  4JBJ A;  3GTG H;  1Q81 C;  3KFU A;  3AQQ A;  1OXX K;  2HIV A;  2K52 A;  3RN5 A;  4Y7N H;  2OCE A;  4NXM L;  1EWI A;  1NMG A;  2V1C C;  3I4M G;  4OO1 I;  2NVT H;  2JE6 I;  3F2B A;  1HNX Q;  5M5X H;  4XIG S;  1J5E L;  1BKB A;  4UP8 A;  3PUY A;  1OXS C;  1X65 A;  1PVO A;  2CFM A;  2N49 A;  1PH2 A;  1MJC A;  3G4S A;  3HOZ H;  3GD7 A;  1X3E A;  3NEN A;  2UXB L;  2NN6 I;  4C2M H;  3I7F A;  1WI5 A;  4X6A H;  1JE5 A;  4O0A A;  5LMN L;  4DUY Q;  3CC2 A;  1R9T H;  2CWA A;  2R7Z H;  4LF9 Q;  3A74 A;  2L15 A;  1BVS A;  3J7A 5;  1L1O C;  3PCO B;  4UP9 A;  2VQF Q;  3HOY G;  1PH1 A;  1VQ7 A;  3CC7 A;  2F3I A;  1YIT A;  1VQA A;  3CC4 A;  2UXC Q;  4IJH A;  5C4X H;  1I5F A;  1HR0 W;  3CME A;  1VQN A;  2E5L L;  4YY3 L;  3PIP A;  5M5Y H;  4JI1 L;  4LFA L;  1J6Q A;  4DV4 Q;  3RZD H;  1EQR A;  2BH8 A;  4A3F H;  1D8L A;  4IOC A;  5GQO A;  4LFC Q;  1PYB A;  2H5X A;  3AFP A;  3PO2 H;  2MO0 A;  1K8G A;  3K80 C;  3S17 H;  4DR3 L;  1HZ9 A;  3K7U C;  2JA9 A;  1WFQ A;  4UPA A;  4JI8 L;  1XJV A;  4K0K Q;  4A3M G;  3DM3 A;  1L1O B;  2LXK A;  4DR1 L;  5JEA G;  4JI4 Q;  4BBR H;  4UP7 A;  1CKN B;  3U4Z A;  1JB7 A;  3S1R H;  1GKH A;  1YNX A;  4DAM A;  4WJ3 M;  4ME3 A;  4DV5 Q;  1YIJ A;  2RCN A;  4LFB L;  3L7Z C;  3S15 H;  4DV7 Q;  3KF6 B;  3B6Y A;  3ULJ A;  3PGZ A;  4JOI A;  4KLK A;  2QA4 A;  4A3E G;  1XMO Q;  1SR3 A;  1SMX A;  2PMZ E;  4IPD A;  5C3E G;  2ZM6 L;  3M4O H;  3J7Z C;  4IFD J;  2KHJ A;  5LMN W;  4IOA A;  2A1A A;  3KDF B;  1C7Y A;  1Y1V G;  1VQH A;  5M3M H;  3M9B A;  1V43 A;  1FL0 A;  4P71 A;  3STB C;  3OTO L;  2JA5 H;  4A76 A;  3U58 A;  5M3F H;  5H1S E;  2JA7 H;  3CCE A;  2ASB A;  1Q12 A;  5IP9 G;  1PH4 A;  2YTX A;  4AYB E;  1FVI A;  3BU2 A;  4NXN L;  4JI7 Q;  5C0X I;  1A63 A;  4DR4 Q;  2VUM H;  1Q7Y C;  1YI2 A;  1N36 Q;  4IPG A;  1PHJ A;  1HR0 Q;  1VQJ A;  2AWO A;  3GTO H;  1VS0 A;  5IWA L;  3SGI A;  4OON A;  2IY5 B;  3OYY A;  4JG2 A;  3HOV H;  4R4C A;  2MQH A;  4A3K H;  1S72 A;  4LF7 Q;  5K36 G;  2CCZ A;  1Y1W G;  1HZC A;  4UY8 C;  3HOW H;  2UUA L;  1VQI A;  1E1O A;  4R4I A;  3KJP A;  3PO3 G;  3I56 A;  2WB1 E;  3CCV A;  4APV A;  1XNQ Q;  4QJF A;  2VNU D;  2HHH L;  3TS2 A;  1EQQ A;  4OO1 G;  1HJP A;  4GKJ Q;  3S16 H;  5EAY A;  3RLN A;  1TXY A;  3AYH B;  1NY4 A;  2VZA A;  1KHI A;  2Z0S A;  4DV3 Q;  2ES2 A;  4KHP Q;  3TRE A;  4TQU S;  4JBM A;  1IXR A;  1HNW Q;  1KRT A;  3CF5 A;  4DV6 Q;  2ZTE A;  3ER0 A;  5GAG C;  1VQ4 A;  2ZJQ A;  1E3P A;  4B3T L;  2NN6 G;  4TVA B;  5FLM G;  1HNZ L;  4GN4 B;  4RG1 A;  2D62 A;  1VQ5 A;  4BXX H;  1UE1 A;  1PH5 A;  2IX1 A;  1E22 A;  4JC0 A;  1Q46 A;  2R7Z G;  5GAH C;  1GVP A;  1YJ9 A;  1YJW A;  4DR2 L;  5C4J H;  4QGU A;  2RHQ B;  1OXU A;  2KEN A;  1VCI A;  2K4K A;  4JI0 Q;  4PG3 A;  4LNQ A;  2XTI A;  3EBE A;  4LF8 Q;  4LF6 L;  2R7D A;  4JOI C;  3TQY A;  4PZ7 A;  2F4V Q;  5C4X G;  4X66 Q;  1SE8 A;  1I94 Q;  4JBW A;  1IZ6 A;  4DUZ L;  4BBS G;  4DV1 Q;  1FJG L;  2OWO A;  3PIO A;  1KQS A;  4GLA C;  1IBM Q;  3GTJ H;  3T1Y L;  3ULP A;  1QZG A;  2UUB L;  1Q8K A;  1QUQ B;  2E2H H;  4C3H H;  4A3G G;  1P16 A;  3RN2 A;  2YYZ A;  3G71 A;  4GOP B;  1N34 Q;  1RIP A;  4R4Q A;  3JC6 6;  3S14 H;  3UE0 A;  1E7Z A;  1L2F A;  3CW2 C;  2JA6 H;  4DK3 C;  2VQE Q;  2JK8 A;  3CPW A;  3G6E A;  1P8L A;  4OWW B;  4J15 A;  4HJ9 A;  1JJ2 A;  4X62 Q;  3AEV A;  3J80 c;  1SLJ A;  2OQK A;  4QY7 A;  2PQA B;  3E9I A;  1G51 A;  5IYB G;  1KC8 C;  3D31 A;  1KD1 C;  2VL6 A;  4X64 L;  2DGY A;  2JJQ A;  3TRZ A;  2D0O A;  3U4V A;  1T9H A;  4X65 Q;  2UUC L;  1AE3 A;  4IPC A;  2C35 B;  4DV2 Q;  2WP8 J;  4A3B H;  5FJ8 G;  4JI2 L;  4EX5 A;  3STB D;  3PUX A;  4A3J G;  1TWG H;  4BY1 H;  1K3R A;  1NJI C;  1PA6 A;  2WFW A;  4LF4 Q;  2PI2 A;  3FP9 A;  3HOX G;  1A0I A;  3L0O A;  1B7Y B;  5C0X G;  3I55 A;  4DR5 L;  4A3D H;  1PH8 A;  4JYA Q;  4NPS A;  1TWF H;  2Y0S E;  3UDX A;  2B63 G;  5JJI A;  4QIW E;  2MNA A;  3KYH C;  1YBY A;  2VY3 A;  2ZTD A;  1XPO A;  4Y52 H;  1UEB A;  2HQL A;  4YWL A;  4C3J H;  2Q2I A;  3FKI G;  3A0J A;  4AYB G;  4B3S Q;  5IP7 H;  4B3R L;  1B70 B;  4IO9 A;  1B8A A;  2GVB A;  2MFI A;  1X3F A;  4GN5 A;  4R4O A;  4LF5 L;  1X9N A;  1CSQ A;  3I4N G;  4YWM A;  3ERS X;  2OTL A;  4A93 G;  3CP0 A;  4A3L G;  5IE8 A;  5DLQ E;  1M90 C;  1QUQ A;  4GKK L;  1BBW A;  1NE3 A;  1TWH H;  5IT9 c;  4LUO A;  3RR5 A;  1KL9 A;  1X55 A;  4GOP A;  2ATW A;  4AQY L;  2JA8 G;  2GVA A;  2R93 G;  1WOC A;  2AWN A;  2B29 A;  4OX9 Q;  4MTN A;  4BA1 I;  4P75 A;  4A3I H;  3MXN B;  4HJ7 A;  3NBH B;  3K81 C;  2WB1 G;  3M3Y H;  2VW9 A;  3GO5 A;  5HY6 A;  2R92 G;  1WCM G;  1K9M C;  1D7Q A;  1N32 L;  5BR8 Q;  1QVG A;  4DR6 Q;  1VQM A;  2D0P A;  4B3M Q;  4PZ8 A;  1W3S A;  2K5V A;  4C3I H;  5C44 H;  2PQA A;  3HOU H;  1S3O A;  2UXD L;  4POG A;  4P73 A;  1CUK A;  2BA1 A;  1WJJ A;  4IFD I;  3T1H L;  1IBK L;  4DV0 Q;  4ALP A;  5GAE C;  1X56 A;  1YHQ A;  1YVC A;  3CXC A;  1N33 Q;  3PSI A;  1IBL Q;  5AJ3 Q;  3H0G G;  3I4M H;  4QQB X;  1VQO A;  1HH2 P;  2RF4 A;  3E0E A;  3U50 C;  4YHH Q;  1HNX L;  2UU9 Q;  3EN2 A;  1IL2 A;  1XNR Q;  3DLL A;  5HGQ A;  1ASZ A;  4L5R C;  4BY7 G;  4A3C G;  1LTL A;  1CKO A;  1M1K C;  1K8A C;  1Z9F A;  2K5N A;  1X6O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...