2NZOA

Crystal structure of a secretion chaperone csaa from bacillus subtilis in the space group p 32 2 1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
111
structure length
111
Chain Sequence
HMAVIDDFEKLDIRTGTIVKAEEFPEARVPAIKLVIDFGTEIGIKQSSAQITKRYKPEGLINKQVIAVVNFPPRRIAGFKSEVLVLGGIPGQGDVVLLQPDQPVPNGTKIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Protein csaA
publication title Crystallographic analysis of Bacillus subtilis CsaA.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 20
structure length 111
sequence length 111
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01588 tRNA_bind Putative tRNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2nzoA00
1LM0A 1Y14B 5FLXc 3AYHB 1OXVA 4C2MH 4JI3Q 1SRUA 3EIVA 4DV5Q 4PZ8A 4GNXB 3CC7A 1VQ8A 2K5VA 3PIPA 2FXQA 2ID0A 4GN5A 1C7YA 2YYZA 4JI2Q 5M5YH 2R93G 2NZHA 4DR6L 2EXDA 2ZM6L 4UP9A 2ATWA 2E2IH 1CKNB 2N49A 1N34L 1YVCA 1DGSA 1E3PA 5C0XI 1QVGA 1HNZQ 4LFCQ 1YHAA 2Q2UA 4K0KQ 4C3HH 2UXDQ 5IP9H 1L1OA 3S16H 5FLMG 3GTGH 3GTMH 4YWMA 4OWXB 4R4TA 3HOUG 1X3EA 1VQKA 4KHPQ 2Z6KC 4DV0Q 3BZKA 3Q8DA 5IWAQ 2Q2IA 1L1OC 4QL5A 4DR3Q 1WOCA 1EYGA 2AWNA 2HQLA 1N36Q 1M90C 1J5EL 4PMWA 4IPCA 1XJVA 1PYBA 4JYAQ 4A3CG 2PMZE 3RLOA 3ER0A 1IBML 2JA7G 1Q81C 4NXNL 4JI1L 3RNUA 3ZJYC 2F52A 5ELOA 4HJ5A 3W1GA 2ZJRA 1W2BA 1S40A 5C4XG 1K0RA 3PUZA 3K7AH 3HKZE 2ZTCA 5GAEC 4LF9Q 5DLQE 4POFA 5EAYA 5M5XH 2UUBQ 4X62Q 4UP8A 2R7ZH 3J7A5 2JK8A 3K0XA 4DR2Q 4DV3L 2B29A 4ME3A 1D7QA 1EWIA 2VNUD 4YCVA 1PH6A 2K50A 1HR0L 3PCOB 4AYBG 3HOXH 1EIYB 4DV7Q 3WWVA 2NVXH 2VL6A 4IFDG 4GKJQ 1K73C 1TWCH 1G51A 1VQLA 4AQYQ 1IL2A 2Y0SG 2XTIA 2ZJPA 1KHIA 5C3EH 4DR4Q 2RF4A 1PHJA 4JI4L 2H5XA 4MNOA 3RLFA 3GTPH 4OONA 2PI2E 4NXMQ 2VQEL 2KENA 1N32L 1WCMG 2VUMG 4DAMA 4BY1H 4DV4Q 2ZTDA 1VQOA 4A3DH 1NBWA 2A19A 4A93H 3J81j 3F2BA 4ALPA 3PUWA 1EFWA 4P74A 3I4NH 1VQGA 3B6YA 4X66L 3UDFA 3T1YQ 1VQAA 1K8GA 3HOYH 4BBSH 2AMCB 1TWFH 1PH4A 1NMFA 1FL0A 1KAWA 1Z47A 3CCMA 2UUAL 2F4VL 4HJ9A 4Y7NH 4BBRG 3A5UA 3H0GG 4B3ML 1QUQB 2JA5G 4DKAC 2MO1A 2UXBQ 1JJCB 3F2CA 4GKKL 4YHHQ 2KCMA 1Q46A 3F8TA 4IPDA 2I5HA 1D8LA 2R6GA 1BVSA 1YJNA 1IZ6A 5AJ3Q 1A0IA 3I56A 2R7DA 4XIGS 4GOPA 4LFBL 4JV5Q 4HIKA 2WAQE 1PV4A 4R1JA 2WFWA 3KFUA 2IT1A 4GOPC 4X65L 2JE6I 2E8GA 4JI8L 4DV6Q 1LTLA 4OWTB 2DUDA 2YV5A 4AIMA 1WI5A 1KRTA 4R4OA 1IXRA 4QJFA 1PH8A 1X6OA 4BXXH 2K5NA 1KXLA 1YBYA 1VQ9A 5LMUL 2WB1E 2YTXA 4KLKA 3EN2A 5BR8L 1VS0A 4A76A 2E5LQ 3H3VI 1TWAH 4YCUA 3OTOQ 2BH2A 4JI3L 1EOVA 4DV5L 2IHFA 5GROA 5K36G 4L5RC 3UDXA 3K80C 3HOZH 3L0OA 3E9IA 1IYJB 1K3RA 3GTJH 2JEAI 1W3SA 1OXUA 4X6AH 1L0WA 5HGQA 3S1QH 4LFCL 1S3OA 4A3GG 4B3SQ 4K0KL 3PIOA 1E24A 3M3YH 3CP0A 2OWOA 2D0OA 1UEBA 3PUYA 3RR5A 1QVCA 5IYCG 5GAHC 1SMXA 1B8AA 4H02A 1VQ4A 3HKZG 1PH1A 4KHPL 4JI5L 4DV0L 2NZOA 5IWAL 4DR3L 1Z9FA 4PG3A 1VQNA 3PO3G 4A3IH 2EQSA 1N36L 4OXPA 4JYAL 3KF6A 3GTKH 2YTVA 1YNXA 3OW2A 1XPUA 2BA1A 1VQIA 1IBKQ 3E9HA 3KYHC 2BH8A 2JA6H 4GLVB 5IYDH 3GD7A 1OXXK 4LFAQ 4HIOA 1HNXQ 1O7IA 4LF9L 1GVPA 1YITA 4OWWB 1K9MC 2UUBL 5IP9G 1VQ5A 5H1SE 1PFSA 4GLXA 4YY3Q 3HOWH 3M4PA 3NEMA 3TS2A 3EBEA 1JE5A 1YHQA 1G291 5GADC 2QA4A 4DR2L 4LNQA 2B63H 3STBD 3STBC 1VQ6A 1VQEA 1G6PA 1CSPA 2Z6KA 3RN5A 1KL9A 1X54A 3CW2C 2I5LX 3G48A 2R7FA 1YZ6A 2RHSB 3T1HQ 1Q82C 2DGYA 3M4QA 4GKJL 2K75A 1Y1VG 2CQOA 1QVFA 2MNAA 4AQYL 4A3JH 3PF4A 1VQPA 2OTJA 1HZ9A 3H15A 2LXJA 4IO9A 4R4IA 3FP9A 4IJLA 3CCEA 2A8VA 4DR4L 1C9OA 3UE0A 5JEAJ 3FKIH 5M3MH 1Q86C 4LF6Q 1JT8A 2KBNA 1X3FA 3KF8B 1A8VA 4IPGA 1P8LA 4YWKA 2V1CC 4DK3C 4NXML 4Y52H 1TWHH 1V1QA 2XGTA 3G6EA 3F2DA 2HHHL 4DV4L 2R7ZG 4A3FG 1XNQQ 3DM3A 3AFQA 1U5KA 3KDFB 1WFQA 3M9BA 3RLNA 4JBKA 2QGQA 3M85A 3S2HH 1RL2A 4P75A 1MJEA 3HOXG 5ELNA 3KLWA 1VQMA 2ASBA 4DR7Q 2AHOB 1N9WA 1Y1WG 1X55A 4L5QA 2MQHA 4QIWE 3ERSX 2MFIA 4A3LG 2WAQG 3AFPA 1PH9A 5M3FH 1Q1EA 1AH9A 2ZTEA 2UXBL 1GD7A 1NE3A 2CKZB 4JG2A 3TEHB 5FLMH 3PO2H 1X3GA 4YHHL 1XMOQ 1ASZA 1X56A 3HOUH 2CWPA 3KOJA 3CCRA 2UUCQ 5AJ3L 4BY1G 2QEXA 1A62A 1MKHA 4A3DG 1GKHA 1Q7YC 2R92H 2PQAB 4HIDA 1U0LA 2WB1G 4YCWA 3I4NG 4A3KG 4A3CH 4JV5L 4A93G 1N33L 3HOYG 2I5MX 3U58A 1V9PA 1T9HA 4IFDI 4DV6L 4QGUA 4GLAC 3TQYA 3CPFA 2KHIA 2L15A 4QY7A 3PV0A 4DV1Q 1YJWA 3BZCA 4DUZQ 1V43A 2AWOA 2E5LL 2VQFQ 1HNWQ 4HJ8A 2UU9Q 1VQBA 1XTDA 3OTOL 4LF5L 1FJGL 3L7ZC 5IE8A 1C0AA 5M5WH 2LSSA 3HFZB 2Q2TA 1GO3E 4DUYQ 2VW9A 1Q1BA 1BKBA 1RIPA 3MXNB 2GVBA 3A74A 3CCUA 1LUZA 2JQOA 1L1OB 2OQKA 5C0XJ 2JA8G 3ULLA 1YJ9A 3K7UC 4DV2Q 4B3SL 4A3BH 1KIXA 1PH2A 5LMNQ 4JBWA 1SROA 4BXXG 3DLLA 3TREA 1WCMH 4GNXA 1XMQQ 3G4SA 1HJPA 1BBWA 2NVTH 2NN6G 4B3RQ 2F3IA 4LUOA 1VQCA 3CMEA 2HIXA 4KI0A 4GNXC 1I5FA 1P16A 1CKNA 2JEBI 4L5TA 1QZGA 4P72A 4POGA 4FDBA 4DPGA 3J81c 3GO5A 1JB7A 2B3GA 4JI6Q 3HOZG 1VQHA 1IBKL 1E7ZA 4P73A 4A3EG 1VQJA 3UE1A 2NVQH 4BY7G 2NN6I 1KRSA 5FJ8H 1SFOH 4LFAL 1EUJA 1HNXL 3G71A 4JI2L 1NJIC 2N3SA 3K81C 1PVOA 4YWLA 3LGJA 2CFMA 4JI7Q 3J7ZC 1TXYA 4YY3L 3I55A 2ALYB 4JC0A 4DNIA 4A3MH 4AH6A 1HNZL 3CD6A 3HOVH 3H3VH 4A3IG 4LF7Q 4OO1G 2D0PA 2VZAA 4A75A 1HZAA 2YTYA 1N8RC 3PSIA 2UUAQ 4B3TQ 2C35B 5IP7H 2OQ0A 3PF5A 3ICEA 3U4VA 3K8AA 5IYDG 4IOAA 2IHEA 2K52A 5LMNW 5IY0A 1BBUA 5IYBH 2EIFA 4UPAA 1IBLQ 2N8NA 4NPSA 4IFDJ 4JBMA 3I4MH 2AKWB 4TVAB 4LFBQ 4DR1Q 3W5OA 4LUZA 4O0AA 1UE6A 1LYLA 5GQOA 4X62L 1I6HH 2IX0A 1AE3A 1PH3A 4DR7L 3U50C 1PH7A 3FHWA 1SN8A 4PZ7A 3GTOH 3J81i 2E2HH 1HH2P 4A3JG 4X64Q 2IY5B 2VS1A 2K4KA 4RMFA 4GOPB 4C3IH 5LMUQ 4DV7L 5C44H 3FKIG 3A5ZB 3I7FA 5IYCH 1UE5A 1XMOL 1HZCA 3CC4A 5C0XG 1I94Q 2UUCL 3PO3H 1HZBA 3S14H 2D62A 4MTNA 3HKSA 3CCSA 4LF4Q 3D0FA 4MZ9A 3E0EA 3CAMA 4DR5Q 3UDGA 4BA2I 1XNRQ 2UXCQ 1X9NA 1QUQA 4GN4B 5M3MG 4C3JH 1L2FA 1NMGA 2R93H 4JI0Q 5M3FG 4LWCA 4DV1L 3BU2A 4EQ5A 3AEVA 1MJCA 3CQZH 5E7NA 4HJAA 3T1YL 1K83H 3PO2G 1Q8KA 3U4ZA 4DUZL 3S1RH 1E1TA 3W1BA 4OX9Q 1XPRA 2OTLA 2PNHA 2VQFL 3CF5A 4IOCA 4LW1A 2UU9L 2BA0A 4JI5Q 3S1MH 1HNWL 4UP7A 5C3EG 4L5SA 2R92G 4XTCS 2JA9A 4DUYL 1JJ2A 2HIVA 1CSQA 3I4OA 1Y1VH 4J15A 2KHJA 1YI2A 1B70B 2A1AA 4LUVA 2IX1A 1E22A 2WP8J 4LF8Q 3CXCA 4DV2L 4DR6Q 5JJIA 2JA7H 5LMNL 1A63A 2ZM6Q 2HT1A 3BJUA 5IT9c 1EIFA 2N78A 3TS0A 1XMQL 4BBSG 1X65A 5C4XH 2ES2A 3KF6B 1N34Q 1JMCA 4A3FH 2ZJQA 1UE1A 4B3RL 4QQBX 2RHQB 4LF8L 3I2ZA 1YEZA 4GS3A 2PI2A 1VQDA 1Y1WH 2MO0A 4IJHA 4PZ6A 4JI6L 3S15H 4A3LH 3JAMc 1WJJA 4JBJA 3RZOH 4DAYB 4P71A 1J5EQ 4WJ3M 3RZDH 2I0QA 3PGZA 4A3BG 1IBMQ 4RG1A 1SE8A 1SLJA 5HY6A 4NXNQ 4JI1Q 2GN5A 4JOIA 4O2DA 3SGIA 4JI7L 2HHHQ 3F1ZA 1E1OA 4R4CA 1PYSB 5JJKA 3S1NH 1KC8C 4JOIC 4A3KH 1VQFA 4LF7L 4BA1I 1UE7A 3J80c 2JJQA 2E2JH 3VDYA 2VUMH 3CCLA 3M7NA 4DV3Q 3CC2A 1VQ7A 3MEFA 4B3TL 1H95A 4NB3A 4R4QA 4TQUS 5JEAG 1HR0Q 3UDIA 5FJ8G 1SR3A 5C4JH 1EQQA 3CCVA 3S24A 1I50H 1OXSC 1XPOA 1OTCA 3NELA 3OYYA 1JJGA 4EX5A 1S72A 2VY3A 1IBLL 1EQRA 2LXKA 4BBRH 2CCZA 3D31A 3H0GH 1KQSA 4JCVE 2JA5H 4A3MG 4DR1L 3KJPA 4JI4Q 1R9TH 3HOVG 4GN3B 2UXDL 1PA6A 3KJOA 3CMAA 2CWAA 3ULPA 1NTGA 1KD1C 1N33Q 1J6QA 2GVAA 5GAGC 2VQEQ 4WJ4A 2K5HA 4AYBE 1N32Q 3GTQH 2JA8H 4HIMA 1PH5A 3NBHB 3JC66 5IP7G 3L2PA 3M4OH 3CCJA 4X64L 1B7YB 2Y0SE 4APVA 4X66Q 3JAMi 1K8AC 1I3QH 3S17H 3T1HL 1CKMA 3KDFA 5J3BA 5IYBG 2F4VQ 1CKOA 2OCEA 1I94L 1GM5A 3I4MG 4LF5Q 1FJGQ 2Q2HA 4B3MQ 2JA6G 2K14A 1QZHA 4IPHA 3NENA 2NVYH 1TWGH 4LF4L 3AQQA 2KCTA 1FGUA 1UWVA 4DR5L 3TRZA 4LF6L 4GKKQ 4OO1I 4HJ7A 2RCNA 1XNRL 2UXCL 4UY8C 3HOWG 3J80i 4A3EH 3CCQA 2YU9H 3A0JA 1WYDA 4BY7H 1M1KC 2B63G 5JJLA 1XNQL 1ASYA 1AE2A 4JI0L 4DK6C 1HR0W 3RN2A 1FVIA 4KHZA 1OXTA 4X65Q 1YIJA 5C44G 3IRBA 2PQAA 4JI8Q 3ULJA 4OX9L 3S2DH 3GDEA 4A4IA 3PUXA 4A3GH 2Z0SA 1VCIA 3CPWA 1NY4A 1CUKA 3PUVA 1Q12A 1MIUA 3GTLH 5BR8Q 1YHBA
chains in the Genus database with same CATH superfamily
2DNCA 1PZID 5CORA 4A3FB 3AYHB 5IGDA 3EIVA 4GNXB 4B08A 2R93G 2ID0A 4JI2Q 3I3CA 4K2LA 2ZM6L 2ATWA 3K5LA 4MTKA 2PZWA 1YVCA 1E3PA 5C0XI 1QVGA 3MXNA 2O2LD 5FLMG 4CHTB 1X3EA 4KHPQ 5IWAQ 1L1OC 3S1NB 4RHRA 4A3KB 5L37A 1H9JA 1M90C 3NQTA 1EWHA 4IPCA 4PMWA 1PYBA 4CGYB 4A3CG 1S5FD 2EOTA 1IBML 2K28A 2B2VC 4UDUC 4JI1L 4DXGA 1Q81C 5ELOA 1S40A 2ZJRA 1GUSA 4GZYC 3HGBA 1K0RA 3PUZA 2VB3X 3K7AH 2H4OA 5C4JB 4FP5D 5EAYA 4X62Q 3CRLC 4OIKA 2JK8A 4DR2Q 2JA5B 1AP0A 1EWIA 1K3BC 4YCVA 2K50A 1EIYB 2IX3A 4DV7Q 1BNZA 3WWVA 2VL6A 4IFDG 1G51A 2Y0SG 4NMZA 4DNTB 4PNYA 1LO5D 2H5XA 4ZKCB 3GTPH 5JJZA 2PPBC 2KENA 1DOKA 1WCMG 3MXGA 1EZ6A 4DAMA 4JPBW 4BY1H 1VQOA 4A3DH 4A93H 1TWGB 3PUWA 5IIFA 1VQGA 3B6YA 1K8GA 3UDFA 3T1YQ 3H94A 3K58A 4A3EB 2IW3A 1TWFH 2YU9B 4BY7B 5TSSA 3R2IA 1QUQB 4DKAC 2MO1A 3F2CA 2RDGA 3F8TA 1UNSA 2E74C 1IZ6A 4F88A 5AJ3Q 1S4ZA 3I56A 4XIGS 4LFBL 3GTLB 4GOPC 3HKZB 4XDXA 4X65L 4FF4A 2E2DC 3E5SA 1BXTA 1LTLA 2RBMA 2DUDA 4AIMA 1KRTA 1IXRA 1SSOA 5M5YB 1PH8A 4OL7A 2XSCA 1VQ9A 4KLKA 5KYIA 4F87A 3OTOQ 3C2PA 4C3HB 3S16B 3GTGB 1GJXA 3GTMB 5BN4A 5KNDA 1IYJB 4K6LA 2JEAI 1JWUD 1OXUA 1L0WA 1S3OA 3NQIA 4NDXA 2OWOA 1E0BA 2D0OA 3PUYA 2X6GA 2K32A 1BR9A 2CW0C 1PH1A 2RQXA 4KHPL 5IWAL 3MZ5A 1Z9FA 4PG3A 1VQNA 5M5XB 4OO1H 2EQSA 4OXPA 3NTKA 3KF6A 1YNXA 2NUCA 2BA1A 1TS4A 1V1PB 3E9HA 1STAA 4FF2A 2JA6H 4GLVB 1HTPA 3GD7A 4L63B 5D65A 4OWWB 5I9PA 3DUZA 1VQ5A 1PFSA 2K6AA 4GLXA 4HSPA 4YY3Q 3HOWH 3M4PA 1WTHA 3SDZA 2BDOA 4LNQA 1G291 2F0QA 2QA4A 4DR2L 2B63H 1A3UA 1HA5A 1VQ6A 2F0SA 3J81L 1CSPA 1KL9A 3VR2A 3EJIA 3G48A 1YZ6A 4G57A 4L6TB 1PYWD 3RMHA 2MNAA 2A73B 2MUYA 1HZ9A 4IO9A 4J6HA 2IJ0A 4R4IA 3DWQA 2IL8A 3GV6A 3CCEA 2QDLA 5JEAJ 4ID6A 2NTSA 4BBSB 1JT8A 1X3FA 1RD9D 1A8VA 4YWKA 2K33A 4DK3C 5C0XH 4Y7NB 1W6KA 2CVRA 3P20A 3TZDA 1EU3A 4A3FG 4JBKA 3AFQA 4NKLA 3M85A 1RL2A 4P75A 1MJEA 2L0CA 2PW5A 3U9SA 1Y1WG 1D5ZC 4L5QA 2MFIA 1LT3D 1PH9A 1A3TA 1V8QA 1AH9A 2AQ3B 2CKZB 3PO2H 5AJ3L 1LACA 4BY1G 1EWCA 4A3DG 2UXDQ 1I4XA 4A93G 3RD4A 1E2WA 4A3KG 5M9OA 3U58A 1WTQA 2DY8A 1V9PA 4GLAC 3TQYA 3CPFA 1LTSD 4DUZQ 5A35A 2AWOA 3QG1A 2UU9Q 3S1QB 1QE6A 3OTOL 1Q90A 1R4QB 5M5WH 2LSSA 5FOBB 5EKKA 2HDMA 4KD3A 5D3IB 3W2DA 3VA5A 3K7UC 3GTKB 3Q0AA 3ND8A 4DN4M 4F7XA 5C6AA 3TREA 2NB0A 1XMQQ 3G4SA 2NN6G 5CV4A 2PYKA 2HIXA 5COYA 4GNXC 1I5FA 4QIWB 4RGOS 4FDBA 1K28A 1JB7A 1E7ZA 3ND9A 4A3EG 1ET6A 4FYDA 4BY7G 4K6DA 5KNBA 5IT9L 3G71A 1I6VC 4V0BA 4JI7Q 4YY3L 3I55A 2ALYB 4A3JB 2BOSA 1F9PA 3AMUA 4AH6A 3FKIB 1JR0D 4OO1G 2L11A 3ONAB 2YTYA 3PSIA 3DEPA 4EGVA 5IP7H 1KTKA 3S2HB 3PF5A 2B2UC 5C3XA 3K6OA 4QUCA 1DD2A 2HUGA 1CQVA 2IHEA 5IY0A 1O7ZA 2N8NA 4QMGA 3I72A 3FEWX 1F9RA 2K01A 1DJRD 4C3HG 5K36H 1LYLA 5GQOA 3HOUB 2IX0A 4I65A 3VA7A 3U50C 4KV6A 1RHPA 3TP6A 2EYHA 3GTOH 1HH2P 1SNMA 1SNDA 1WTOA 2IY5B 1QCBD 3P1HA 5EJWA 3A5ZB 4XQJA 5C0XG 2M2LA 2D62A 3CCSA 3HKSA 4N9TA 2CHBD 4ODGA 5CV6A 1FNWA 5EPJA 3NTHA 4MHEA 1NR4A 4JI0Q 3BU2A 1STHA 4HJAA 5I4DA 2AUJD 3SK4A 3PO2G 3SHLA 4DUZL 3S1RH 1E1TA 3W1BA 2UU9L 4OIJA 1KLGD 3MWYW 1ESFA 2NVTB 1Y1VH 2B2YC 4HEDA 1B70B 2A1AA 1S5BD 1XX8A 3MEHA 1Q3LA 4DR6Q 5JJIA 3BJUA 1SNQA 1XMQL 1C8CA 4BBSG 1X65A 2ZJQA 1JMCA 2RHQB 1JCKB 3I2ZA 1YEZA 4HN7A 4GS3A 4CBVA 2CH4W 4DF7A 1HUMA 4A3MB 3S15H 2DJFC 1SMYC 4CKEA 3C1FA 3RZDH 4WJ3M 5I2YA 4RG1A 1DOMA 1WTPA 2GN5A 3GV3A 5JOBA 4JI7L 1E1OA 4R4CA 5JJKA 3VR6A 1B9NA 1UE7A 3J80c 3IAYA 2E2JH 3K0YA 2LS01 3CCLA 3M7NA 3CC2A 1G8ZD 3MEFA 3BYTB 4R4QA 4TQUS 1I6HB 3UDIA 1I50H 5CYUA 5EKLA 4EX5A 1S72A 4BBRH 2PMZB 5DM63 3H0GH 3MFYA 1NTGA 1TU2B 1J6QA 5GAGC 2VQEQ 1N32Q 3GTQH 4CDFC 3VR5A 2JA8H 2ZXRA 5IP7G 4TKOB 1U9RA 1H9SB 4APVA 1I3QH 3T1HL 2SNMA 1CKMA 3KDFA 5J3BA 4ZKBB 1HXYD 1SE2A 1MSHA 1GM5A 2R93B 4LF5Q 1RKNA 4B3MQ 2ENBA 4RAUC 3CQZB 2EPBA 1QZHA 3NENA 2KCTA 4LF6L 3SVMA 1UUPA 3CKIB 1I4GA 3J80i 1RCVD 1M1KC 2I46A 1XNQL 1ASYA 4JI0L 2I07B 2R3ZA 4DK6C 1FVIA 2B2TC 1XWEA 4FNFA 1YIJA 4HMIA 2SNSA 4JI8Q 1B3AA 3GDEA 4A4IA 1DONA 4K5VA 2A68D 5E4XA 1VMCA 1LM0A 1EIHA 5FLXc 1WTXA 4C2MH 4DV5Q 4PZ8A 3TMEA 1CA5A 2K5VA 3PIPA 2FXQA 2F0UA 2NZHA 4DR6L 2IPKD 2E2IH 5ELCA 1CKNB 1XTCD 1EU4A 2EDGA 2N49A 3RZOB 4LFCQ 1D1IA 1EEFD 1L1OA 1B2TA 4QCLA 2Y0SB 4R4TA 3HOUG 1VQKA 3Q8DA 2B2VA 3KLRA 4IUNA 3N52A 1EYGA 3I90A 2G5DA 2F0EA 2PMZE 3TP5A 4RGNA 3RNUA 2F0HA 4G7HC 2ZTCA 4LF9Q 5DLQE 2UUBQ 1MHWC 2R7ZH 1STBA 3GP7A 3K0XA 2B29A 3BYYB 1KDAA 4I7ZC 5AFWA 2NVXH 2QEJC 2KHSA 1VQLA 1CT1D 4AQYQ 1D6EC 1HFGA 1W6JA 3ZYYX 2ZJPA 5C3EH 2RF4A 3S17B 4OONA 2PI2E 2VQEL 1N32L 4DV4Q 3K57A 1KNAA 1NBWA 1TS3A 3KBGA 3J81j 1G2SA 3F2BA 1EFWA 1JICA 1VQAA 1E2ZA 3OHXC 2AMCB 4ME5A 2UUAL 1Z47A 4HJ9A 4BBRG 3F2UA 3H91A 3VYUA 3H0GG 4B3ML 1QJOA 2KCMA 1Q46A 1EY0A 2PZTA 2O5JC 4GOPA 3Q24A 2M9VA 3ITPA 3K5MA 2WAQE 2RA4A 1PV4A 1GUTA 4PV1C 2EE1A 2IT1A 3RUZA 2E8GA 3IKJA 4JI8L 1A2UA 2YV5A 4N8FA 4CDEC 3I70A 4CJ2C 1X6OA 1MI2A 1YBYA 5LMUL 2YTXA 3VYRA 3MVVA 5FO9B 1QB5D 5E1FA 1TWAH 5IGBA 4YCUA 5JEAH 1B4OA 1EOVA 4DV5L 1K83B 2QILA 3K80C 4XYOA 3E9IA 3Q22A 1W3SA 2PNRC 2DNEA 2EY6A 5FO7B 4LFCL 3M3YH 5GAHC 4H02A 1B8AA 3CHBD 3K7AB 4XXEA 4WFN3 4DGZA 2WKCA 4K5WA 4ZK9B 3OW2A 4OEMB 4KKSA 3R3OA 1OXXK 1PFNA 2HCIA 3OMCA 4LFAQ 3SR1A 4LF9L 1Y1WB 2UUBL 5JPMC 3NEMA 3MHBA 2KQ3A 1JE5A 1YHQA 2ZXPA 1U4LA 3STBD 1D2BA 2Z6KA 3C3LA 3RN5A 3GTPB 1X54A 3CW2C 2I5LX 1QNUA 5CGKA 1STYA 4BY1B 3M4QA 4U673 4U68A 2CQOA 4A3DB 4AQYL 4A93B 3PF4A 1VQPA 2LXJA 2EYOA 3FP9A 3HRZC 3UE0A 5M3MH 4N8X1 1TWFB 2KBNA 3LWUA 3KF8B 4IPGA 2V1CC 4ILWA 4Y52H 3VYTA 2R7ZG 2KA7A 3M7GA 5K5PA 4DV4L 2FINB 3G7LA 1HRJA 1U5KA 1ZKOA 3M9BA 3RLNA 2G9DA 3NXWA 2JSOA 1VQMA 2QW7A 2WAQG 5M3FH 2F0WA 1WTVA 2ZTEA 1NE3A 1PTOD 1TY0A 3FMCA 4ZUJA 2RVLA 2E76C 1X56A 1ASZA 2CWPA 2ZT9C 1SYBA 2EZVA 5A2QE 1WTWA 1F77A 2QEXA 1ONLA 2FMCA 4FXKC 1GKHA 2PQAB 1KNEA 4YCWA 4K8IA 5LHY1 1N33L 4F8MA 2I5MX 1T5XD 1T9HA 1BCPF 2EJGC 2KHIA 5CR3A 2HQEA 2A5HA 1V43A 1HNWQ 2Z1CA 3VR4A 1VQBA 1FJGL 3L7ZC 1C0AA 1QILA 4CKCA 2VW9A 1Q1BA 1BKBA 4HSVA 2N55A 5DM73 1F2MA 2OQKA 1O7LA 4KK7A 1Y8OB 1YJ9A 1G91A 1PH2A 5LMNQ 1SROA 4RKLA 3DLLA 3EFXD 4GNXA 5DEHA 2A74C 2RSOA 2JA6B 2F3IA 2F03A 2F0FA 2JYOA 4KI0A 1F2ZA 3ERQA 4IUVA 5C4HA 3I91A 4P72A 1QZGA 4DPGA 3HOWB 3J81c 4O1NA 3BDLA 2B63B 1VQHA 1SYDA 1VQJA 1DCZA 4LFAL 1GOZA 4JI2L 3EQLC 1NJIC 3EROA 4ABNA 4YWLA 1EY9A 2CFMA 1FD7D 1MBYA 4DNIA 1IKMA 1K0SA 3HOVH 1KAAA 2D9UA 1H9RA 4DAPA 1HZAA 1A3VA 1N8RC 1TVXA 4B3TQ 3A54A 4RFBA 3FPUB 3FDTA 3K8AA 2RDFA 2K52A 5LMNW 2TSSA 4IN3A 1IBLQ 1TQOA 4X3SA 3SEBA 3I4MH 4IFDJ 2AKWB 4TVAB 4IUTA 1FR3A 3W5OA 3PO2B 1RODA 4LUZA 4X62L 1PH3A 3E6ZX 1PH7A 1RDPD 3FHWA 1IYVA 1ESRA 3J81i 1SYEA 1LV9A 4X3TA 3QOJA 4X64Q 4IUPA 4HAEA 5CBAE 4DV7L 1EQVA 5IYCH 1TT2A 1HZCA 3CC4A 4KD4A 1I94Q 4UHVA 3OWFA 2BE5D 3PO3H 1HZBA 3S14H 3D4DA 4LF4Q 2L12A 3D0FA 3E0EA 4BA2I 3DWAA 1QUQA 4EVOA 5IODA 1U4PA 3BVGA 1NMGA 4S3SA 5M5WB 5M3FG 3O13A 3AEVA 3A56A 1HCZA 3T1YL 1Q8KA 3U4ZA 2KOLA 2DN8A 2OTLA 2PNHA 4J8QA 5KEEA 1IHZA 4IOCA 4JI5Q 3S1MH 1HNWL 5G3LF 1S5CD 3DWPA 1WD0A 2B2YA 3KUPA 1EFID 1VF7A 3Q6SA 4OHJA 1JJ2A 2HIVA 1CI3M 4J15A 1LTGD 2KHJA 1TKWB 5LL6S 2C9OA 4LUVA 4MIUA 1TS5A 1E22A 1BCPD 2IX1A 1DZ1A 1KABA 5LMNL 3DXJC 5IT9c 3OIQA 3NTIA 4KJOA 5BN3A 5C4XH 3NUCA 4PMBA 3BDOA 1E2VA 2PW7A 5JVH3 2MO0A 4IJHA 4CDDC 1ET9A 3DMUA 4A3LH 4JBJA 4DAYB 1HQMC 4P71A 1NCVA 2D2CC 3PGZA 1PFBA 5HY6A 1SLJA 1SYGA 2HHHQ 4Z9CB 1PYSB 3CRKC 1KC8C 1V1PA 5HGTA 1HQRD 3LX0A 4BA1I 2JJQA 3VDYA 2VUMH 4DV3Q 1B1ZA 1VQ7A 1B44D 4B3TL 3M4YA 3HP3A 3NWSA 1SR3A 1KDCA 1EQQA 3CCVA 1OTCA 1JJGA 3OYYA 3GTOB 2DY7A 3NWTA 1EQRA 3JAME 1IBLL 2CCZA 2O5IC 1AZQA 1JWMD 2F0KA 1R9TH 3HOVG 4GN3B 1PA6A 2GVAA 3NBHB 3M4OH 4ZRZA 4X64L 4X66Q 1XYIA 1JOKA 2B8FA 1K8AC 3DHQA 2SOBA 3SE0A 4J1MA 1TWHB 4WJWA 2K1BA 2IWHA 1I94L 3I4MG 1X3PA 2VB2X 2K03A 2JA6G 2NVYH 4LF4L 4GKKQ 3AQQA 1FGUA 3S1RB 4HJ7A 5D14A 2B2TA 2F0DA 2SDFA 3NE5B 3HOWG 3A0JA 2B63G 4KHZA 1EL0A 1Y1VB 3S2DH 4A3GH 2Z0SA 2EYJA 2A68C 1PTOH 3PUVA 1Q12A 1MIUA 3L9AX 2L55A 2DJGC 1YHBA 4P2CB 5BR8Q 3D6CA 4G4KA 4KY7A 4PQXA 4JI3Q 5EBDA 3CC7A 1VQ8A 2UXDL 4GN5A 2YYZA 2L5TA 4UP9A 4DK0A 3S15B 1I4HA 4M8AA 1EY8A 4IUQA 3X3MA 3RZDB 1HNZQ 5E3FA 2Q2UA 4K0KQ 5G3LD 5IP9H 2WIIB 4YWMA 4OWXB 4DA2A 4DR3Q 2Q2IA 2KVMA 4RHSA 2AWNA 2HQLA 1XJVA 2E2JB 3RLOA 3ER0A 1HTLD 4HJ5A 1W2BA 3TDQA 3IL8A 3W1GA 4DNRB 5C4XG 5GAEC 1I50B 1RF2D 4O42A 4C1NK 1G2TA 4BBRB 3J7A5 3H0GB 3T56B 4DV3L 1A15A 1EIGA 2XRQD 3CU7A 4ME3A 2VNUD 2RSNA 1TS2A 1PH6A 3PCOB 3HOXH 4CJ0B 2B2WC 3GTQB 5T1IA 3KLSX 4GKJQ 1EOTA 1TWCH 2JA8B 1VF5C 1IL2A 1I3QB 5CC4A 1YNJD 4NXMQ 2Q8IB 2VUMG 3R93A 5C5MA 2A19A 3I4NH 1AFPA 1S5ED 4X66L 3HOYH 1L0XB 1O80A 4TRDA 1PH4A 5A2QL 1FL0A 3CCMA 1J9OA 1I4QA 2NYZD 5KNCA 3A5UA 2Z6BA 1F2LA 1DYQA 3KLSA 3L3OC 1MD2D 2UXBQ 1JJCB 4GKKL 4IPDA 3I8ZA 2PZUA 1A0IA 1O7YA 2R7DA 1B9MA 1S5DD 4JV5Q 4HIKA 1PLFA 4FF3A 1ILPA 4G7OC 2JE6I 2G9HD 4C2MB 4HCSA 4OWTB 1BCPB 2HCCA 4R4OA 4QJFA 2EJMA 2QDBA 4BXXH 2K5NA 1KXLA 1PRTF 2E2IB 1I4PA 1K8MA 2WB1E 3H6MA 5C5LA 3T53B 5BR8L 3H3VI 1G6ZA 2E5LQ 4ZQ3A 2BH2A 4JI3L 2IHFA 5GROA 4CKBA 5K36G 4UAIA 4L5RC 1QG7A 3UDXA 3HOZH 1K3RA 3GTJH 1LABA 3EVQA 3W3AA 1ML0D 4A3GG 4B3SQ 1VDZA 4K0KL 4I7AA 3CP0A 3QR8A 4FXGC 1PMRA 4RGMA 1VQ4A 4DR3L 3C46A 4A3IH 1FGBD 3WOEA 2WV6D 2F0PA 2YTVA 1CM9A 2R7ZB 1F9QA 1VQIA 1X32A 1IBKQ 3KYHC 2BH8A 2XRSD 1PDQA 5JPNC 1SJED 1EY4A 1O7IA 1GVPA 1YITA 2NVXB 5IP9G 2R61A 1Z7TA 2WAQB 3TS2A 3EBEA 5GADC 5C3EB 3QIAA 3STBC 1G6PA 1Y8NB 1Q8IA 3D8GA 1CQFA 2RHSB 2AQ1B 2DGYA 4GKJL 1Y1VG 4FXDA 1IW7D 1Y69U 4IJLA 2A8VA 1HUNA 4XT1B 2QF7A 4NXML 1P8LA 4B9WA 1V1QA 2RDHA 3F2DA 1D1KA 5EGTA 2Q8RE 1XXGA 1CZGA 1GXDC 3TSSA 1NUCA 1F9SA 3HOXG 2ASBA 3KLWA 2B39A 4JVZA 2F1MA 1N9WA 2H1EA 2FFKB 3ERSX 2HD3A 2MP1A 3AFPA 2X6LA 4H13C 1SBBB 2UXBL 3TZUA 5FLMH 1PTOC 3G6JB 3TEHB 1II3A 1XMOQ 3KOJA 1JOQA 1H9SA 2EY1A 3CCRA 1H9KA 5EQ0A 1MKHA 1PTOF 2XIWA 4IALA 1Q7YC 1KDBA 2R92H 4JV5L 2WB1G 2OT2A 3I4NG 4A3CH 2JP1A 3HOYG 1TWAB 2X69A 2F3WA 2L15A 4QY7A 1F2YA 2TMPA 4RKBA 5FO8B 4YIJA 1LTAD 5HURA 2E5LL 4IZ8A 4HJ8A 1XTDA 4LF5L 4WRDA 1A6XA 3M3YB 2A6ED 1SYFA 4DUYQ 1JORA 2AUKA 3MXNB 2GVBA 2FHTA 3A74A 1LUZA 3CCUA 1M4VA 3WDNA 1PXUA 1QNKA 1PFMA 2JA8G 4ZUIA 3HS0C 4DV2Q 4B3SL 4A3BH 1H9MA 1KIXA 5CV7A 4JBWA 1L0YB 4BXXG 1WCMH 1PRTD 4RWSC 1VQCA 3CMEA 1P16A 1CKNA 2XWBB 4L5TA 3URYA 3V05A 4POGA 4DK1A 1BDOA 3GO5A 3HOZG 2KUMA 1IBKL 3A55A 3NBIA 4DXFA 2NVQH 2NN6I 1KRSA 2OXPA 1SFOH 1EUJA 3SK5A 3K81C 4LJZC 1LT6D 3LGJA 3J7ZC 2WINB 1TXYA 4JC0A 3OPOA 2E75C 3HEJA 3H3VH 1ENFA 4HTHA 3T16A 4A3IG 2D0PA 3KK7A 4A75A 3JAML 5KRUA 2C35B 3ICEA 3U4VA 4IOAA 4BWGB 2QKIC 1BBUA 4UPAA 4JBMA 5NUCA 5M3FB 2EYLA 4LFBQ 4Q5VA 1ENAA 1FYCA 1SXTA 1UE6A 2AQ2B 1SDFA 3HG9A 3NHHA 1SN8A 5KYLA 2E2HH 1YNND 2VS1A 2K4KA 4RMFA 1HPCA 4C3IH 5C4ZA 5C44H 1XMOL 2BE5C 4NP5A 4KY5A 2QCPX 3UDGA 3UI2A 2CQAA 4C3JH 1L2FA 5EPLA 4AYBB 4LWCA 4FF1A 1MJCA 1NY4A 3SK6A 1K83H 1EY7A 4OX9Q 2FJ2A 1R4PB 3CF5A 3A8JE 4UP7A 4EQOA 3N6RA 3A7AB 5C3EG 2R92G 4XTCS 2JA9A 2A69D 2EY2A 4DUYL 5I6WA 1BOSA 3K59A 1YI2A 1JC7A 4LF8Q 1BCPC 1D5XC 4X3UA 4DV2L 1NR2A 3VR3A 2EJFC 2JA7H 1U4MA 1DOLA 2HT1A 2N78A 3LWEA 4K8JA 2ES2A 3KF6B 4XQQA 1N34Q 4A3FH 3A8IE 4V190 2EYMA 3P7JA 3U9OA 5KGUA 4C1NI 5ISRA 1Y1WH 4PZ6A 5LL6X 3I73A 5I2XA 1JQYD 1QWYA 3HOVB 1Y8PB 2K5WA 3H09A 1J5EQ 3HZXA 2I0QA 4A3BG 1ZYRD 4NXNQ 4TSSA 4O2DA 3SGIA 1C48A 3F1ZA 2ZXOA 2MPMA 3NPPA 3S1NH 2A6HD 4JOIC 4A3KH 4RGTA 4KKUA 5I6YA 5DNFA 2XNAC 3I4MB 5ELDA 3T13A 5JEAG 1HR0Q 4C56C 5C4JH 2Q8TA 3TBIB 1UAPA 1XPOA 1OXSC 3NELA 5I9OA 5FKAC 1LTTD 2VY3A 2CH4A 3PIP3 5JAVA 1STNA 3QB3A 4JCVE 2JA5H 1K8OA 1EY5A 5BN5A 4JI4Q 3J7AV 3ULPA 2CWAA 4ZLTF 4WJ4A 4AYBE 1T5EA 4WORA 3PO3B 2LFNA 1CK1A 3S14B 3KF8A 3MXPA 4DAVA 3J80E 2KCCA 1D5MC 1JE4A 2B2UA 2FMMA 1JWSD 1LLRD 5KIXA 2NN6H 1CKOA 2F4VQ 4QB4A 2NZ1D 3D6WA 4IPHA 1TWGH 4PMCA 1UWVA 3TRZA 1PZJD 2F0TA 2RCNA 3BVZA 4UY8C 3S1MB 4A3EH 3CCQA 2YU9H 4BY7H 5CMDA 1AE2A 1EYCA 1HR0W 2VXWA 4HCEA 3RN2A 2GA4B 4C3IG 5C44G 3QO2A 2PQAA 3ULJA 4OX9L 2F0JA 3D3RA 3PUXA 1SNCA 3OMGA 1VCIA 3CPWA 1CUKA 4RCNA 3GTLH 2K04A 5M3MG 1HFNA 1Y14B 1PRTB 5C4XB 2MHVA 1IL8A 1B53A 1OXVA 4RA8A 2EY5A 1SRUA 4C3JG 1LT4D 4IURA 4LF8L 1C7YA 2C5CA 5M5YH 2EXDA 3BZDB 1N34L 3A7LA 1DGSA 1YHAA 3H3VC 4C3HH 4L8JA 5IGEA 3S16H 3GTGH 4H0LC 5EPKA 3GTMH 3OOCA 3VYSA 3AU7A 2LY7A 4ZAIA 2Z6KC 4DV0Q 3BZKA 4QL5A 4H44C 1WOCA 2J7ZA 1ICWA 1N36Q 1STGA 1JOOA 2F4IA 1J5EL 4JYAQ 1LT5D 1ILQA 2VUMB 5FLXE 5JVG3 2JA7G 4NXNL 3ZJYC 2F52A 1B50A 2N88A 3HKZE 4POFA 2L9HA 5M5XH 4UP8A 1ZEQX 1TR5A 2B2WA 3IFTA 2SEBD 1D7QA 1R9TB 1SAPA 3P75A 2Z4IA 1HR0L 4AYBG 1ZXTA 2J0TD 1K73C 2K05A 2KECA 5FK9C 4E6IA 3OW7A 3M4OB 2XTIA 3MA2B 1KHIA 4KN7C 4DR4Q 3SK8A 1PHJA 3FVQA 4MNOA 5CBEE 4R8IA 4JI4L 3RLFA 1BO0A 1YNJC 2EVBA 3TP8A 3DM1A 1V1OA 2ZTDA 2EXZA 1U4RA 2NVYB 3BDCA 4ALPA 2XWJB 4P74A 1NSNS 5CV9A 3FRPB 4BBSH 1NMFA 1KAWA 2F4VL 4Y7NH 3OIPA 4EQPA 2JA5G 4BS9A 1B3QA 4CDCC 1EYDA 3R2TA 4YHHQ 3S2DB 2OF1A 2I5HA 1D8LA 2R6GA 1BVSA 1YJNA 4A3GB 5J1ZA 3BG3A 2EYFA 3Q23A 5IGFA 2WACA 3KBXA 1PTOB 3J7AF 4R1JA 3X3NA 2WFWA 3KFUA 4HMJA 3C1EA 2XN9C 4DV6Q 1CFMA 1WI5A 3QJYA 5F2DA 1M8AA 1SJHD 4A76A 3EN2A 1VS0A 1GUNA 5EKIA 2Z9HA 1J8IA 3QOLA 4K5XA 4JK1C 1AN8A 1OO9B 1BUVT 2JXMB 3L0OA 5D3DA 5DAUA 1BF4A 4X6AH 5HGQA 3S1QH 1RJTA 2OEOA 1SNOA 3PIOA 1E24A 3NK9A 3EA6A 4NW2A 1UEBA 3RR5A 1QVCA 5IYCG 1SMXA 3V2TA 2CW0D 3HKZG 4JI5L 4DV0L 2NZOA 1HHVA 4K14A 2V4DA 3IFDA 3PO3G 1N36L 4JYAL 3GTKH 2ICIA 1XPUA 1C4QA 1LTID 1GUGA 2F0GA 3MC0B 3K5OA 5IYDH 4HIOA 2F3VA 1HNXQ 3HOXB 1LTRD 1K9MC 1EYAA 1TWCB 2EYPA 5H1SE 4DAYA 1STEA 3MFGA 1VQEA 4IUUA 3I4LA 1TY2A 2KCNA 2R7FA 3T1HQ 1Q82C 1DXMA 1QOHA 5EBCA 2K75A 3AB9A 1RTOA 1X3QA 1QVFA 2OTJA 4A3JH 2WB1B 3I4NB 3H15A 1CZWA 4DU9A 1IW7C 4QUFA 3HOYB 4DR4L 1C9OA 3FKIH 1Q86C 4LF6Q 1EEID 2WKDA 3NP8A 3MTSA 1CTMA 1TWHH 2HHHL 2XGTA 3G6EA 2F0IA 1XNQQ 3DM3A 3KDFB 1WFQA 3S2HH 2QGQA 4ZCKA 2F0NA 5ELNA 4DR7Q 4XT3B 2AHOB 1TIID 1X55A 2MQHA 4QIWE 4A3LG 1Q1EA 1AZPA 3A8KE 5ELFA 1GD7A 2K7VA 4JG2A 3NBHA 1X3GA 4YHHL 3HOUH 2F0LA 2UUCQ 2BCOA 1A62A 1SE3A 2PQEA 4HIDA 1U0LA 2B8GA 1ENCA 1Z6HA 3SXHA 5IOCA 1EZ8A 4IFDI 4DV6L 4G7ZC 4QGUA 4RH6A 4KKTA 3PV0A 4DV1Q 4IQZA 1YJWA 3HOZB 3BZCA 3GTJB 2VQFQ 1VMPA 4OGQC 5IE8A 2A6EC 3HFZB 4KJNA 2Q2TA 1GO3E 2K5DA 1RIPA 2JQOA 2PCFB 2ICEC 1L1OB 5C0XJ 4A3IB 3D4RA 1NAPA 4QF4A 3ULLA 1A2TA 4LK1C 2BDNA 2M00A 1PRTC 1HJPA 1BBWA 2NVTH 4B3RQ 2LKVA 4LUOA 1NNXA 3WOFA 2JEBI 4FO2A 2B3GA 2MJ8A 5IGCA 4JI6Q 4P73A 4KHVA 1GHKA 3UE1A 5FJ8H 1HNXL 2XVSA 5CV5A 2NTTA 2N3SA 3TP7A 1PVOA 2F0MA 1SEBD 4A3MH 1HNZL 3CD6A 2K5QA 4B9XA 4LF7Q 3E0JA 2VZAA 1BBXC 2UUAQ 3J7YW 4KN4C 3MXUA 2OQ0A 1HA6A 5IYDG 3J81E 2RKSA 4X3KA 5IYBH 2EIFA 3LNNA 4NPSA 3PQIA 3J80L 4DR1Q 2D5DA 4O0AA 2MGSA 1IYUA 1I6HH 1AE3A 1CHPD 4DR7L 3QWNA 4XQNA 5ELEA 4PZ7A 2R92B 4N9PA 4A3JG 2Z4HA 1YNNC 4JW0A 3OSOA 4GOPB 5LMUQ 3FKIG 3I7FA 1UE5A 1AEXA 3V96A 3K5NA 3TN2A 2UUCL 3PMFA 2KJXA 4MTNA 2NWGA 4MZ9A 3CAMA 4DR5Q 1UEAB 1XNRQ 2UXCQ 1X9NA 4GN4B 1EQTA 1FNVA 1WTRA 4HR7B 2R93H 1BQQT 1AW7A 4DV1L 4EQ5A 3CQZH 5E7NA 4DFAA 4K2KA 1XPRA 2VQFL 4LW1A 2BA0A 4XYQA 2JN4A 4A3BB 1O78A 3BS1A 1ICFB 4L5SA 3S9WA 1WCMB 2A69C 1CSQA 3I4OA 2O4XA 3NSWA 4KMUC 2WP8J 1GHJA 3CXCA 4LAAA 4H7BA 1A63A 2ZM6Q 3TS0A 1EIFA 2NBFA 4QQBX 2NVQB 4B3RL 1UE1A 1SFOB 5ELBA 2KEDA 4RCOA 1I4RA 5FLXL 4FVMA 1GUWA 2PI2A 1VQDA 1CHQD 4JI6L 4Q0FA 3JAMc 1SE4A 1SMYD 1WJJA 1PZKD 3GQBA 3T51B 3RZOH 2P5ZX 1DM0B 1ZYRC 1IBMQ 4LMQD 1SE8A 4IFDH 4JI1Q 4JOIA 4OELB 1WD1A 3PIO3 2A6HC 5E4WC 2L4NA 1VQFA 4LF7L 5IT9E 1FNUA 1SNPA 1EY6A 4M1UB 3OWEB 1WVLA 1CA6A 1H95A 4KTAA 4NB3A 4ZYSA 5FJ8G 1LTBD 5J39A 3S24A 2J4XA 3FPPA 2E2HB 2L1BA 2LXKA 2F0VA 4MN3A 3D31A 1KQSA 1SYCA 4A3MG 4DR1L 3KJPA 4C3IB 5C44B 3KJOA 3CMAA 1KD1C 3MAQA 1N33Q 1JB3A 2HDLA 2K5HA 5CV8A 4HIMA 1PH5A 3JC66 3L2PA 3BVMA 3CCJA 1B7YB 2Y0SE 5M3MB 3JAMi 1IKLA 2Z8LA 4EQNA 3S17H 4ULLA 4R9WA 3T4AC 4C3JB 5IYBG 1MSGA 2OCEA 3E3XA 1FJGQ 2Q2HA 2K14A 5C3WA 4KY6A 1RTNA 1KLUD 4DR5L 1GUOA 5IGGA 4OO1I 3DEOA 2F0OA 3R8BA 1XNRL 2UXCL 1MGSA 1WYDA 5JJLA 3D4WA 1OXTA 4X65Q 5T1GA 4CJ1B 3IRBA 2LMCB 5J22A 2PO4A 4R8NA 2JA7B 2RCFA 2KEEA
chains in the Genus database with same CATH topology
1LM0A 1Y14B 5FLXc 3AYHB 1OXVA 4C2MH 4JI3Q 1SRUA 3EIVA 4DV5Q 4PZ8A 4GNXB 3CC7A 1VQ8A 2K5VA 3PIPA 2FXQA 2ID0A 4GN5A 1C7YA 2YYZA 4JI2Q 5M5YH 2R93G 2NZHA 4DR6L 2EXDA 2ZM6L 4UP9A 2ATWA 2E2IH 1CKNB 2N49A 1N34L 1YVCA 1DGSA 1E3PA 5C0XI 1QVGA 1HNZQ 4LFCQ 1YHAA 2Q2UA 4K0KQ 4C3HH 2UXDQ 5IP9H 1L1OA 3S16H 5FLMG 3GTGH 3GTMH 4YWMA 4OWXB 4R4TA 3HOUG 1X3EA 1VQKA 4KHPQ 2Z6KC 4DV0Q 3BZKA 3Q8DA 5IWAQ 2Q2IA 1L1OC 4QL5A 4DR3Q 1WOCA 1EYGA 2AWNA 2HQLA 1N36Q 1M90C 1J5EL 4PMWA 4IPCA 1XJVA 1PYBA 4JYAQ 4A3CG 2PMZE 3RLOA 3ER0A 1IBML 2JA7G 1Q81C 4NXNL 4JI1L 3RNUA 3ZJYC 2F52A 5ELOA 4HJ5A 3W1GA 2ZJRA 1W2BA 1S40A 5C4XG 1K0RA 3PUZA 3K7AH 3HKZE 2ZTCA 5GAEC 4LF9Q 5DLQE 4POFA 5EAYA 5M5XH 2UUBQ 4X62Q 4UP8A 2R7ZH 3J7A5 2JK8A 3K0XA 4DR2Q 4DV3L 2B29A 4ME3A 1D7QA 1EWIA 2VNUD 4YCVA 1PH6A 2K50A 1HR0L 3PCOB 4AYBG 3HOXH 1EIYB 4DV7Q 3WWVA 2NVXH 2VL6A 4IFDG 4GKJQ 1K73C 1TWCH 1G51A 1VQLA 4AQYQ 1IL2A 2Y0SG 2XTIA 2ZJPA 1KHIA 5C3EH 4DR4Q 2RF4A 1PHJA 4JI4L 2H5XA 4MNOA 3RLFA 3GTPH 4OONA 2PI2E 4NXMQ 2VQEL 2KENA 1N32L 1WCMG 2VUMG 4DAMA 4BY1H 4DV4Q 2ZTDA 1VQOA 4A3DH 1NBWA 2A19A 4A93H 3J81j 3F2BA 4ALPA 3PUWA 1EFWA 4P74A 3I4NH 1VQGA 3B6YA 4X66L 3UDFA 3T1YQ 1VQAA 1K8GA 3HOYH 4BBSH 2AMCB 1TWFH 1PH4A 1NMFA 1FL0A 1KAWA 1Z47A 3CCMA 2UUAL 2F4VL 4HJ9A 4Y7NH 4BBRG 3A5UA 3H0GG 4B3ML 1QUQB 2JA5G 4DKAC 2MO1A 2UXBQ 1JJCB 3F2CA 4GKKL 4YHHQ 2KCMA 1Q46A 3F8TA 4IPDA 2I5HA 1D8LA 2R6GA 1BVSA 1YJNA 1IZ6A 5AJ3Q 1A0IA 3I56A 2R7DA 4XIGS 4GOPA 4LFBL 4JV5Q 4HIKA 2WAQE 1PV4A 4R1JA 2WFWA 3KFUA 2IT1A 4GOPC 4X65L 2JE6I 2E8GA 4JI8L 4DV6Q 1LTLA 4OWTB 2DUDA 2YV5A 4AIMA 1WI5A 1KRTA 4R4OA 1IXRA 4QJFA 1PH8A 1X6OA 4BXXH 2K5NA 1KXLA 1YBYA 1VQ9A 5LMUL 2WB1E 2YTXA 4KLKA 3EN2A 5BR8L 1VS0A 4A76A 2E5LQ 3H3VI 1TWAH 4YCUA 3OTOQ 2BH2A 4JI3L 1EOVA 4DV5L 2IHFA 5GROA 5K36G 4L5RC 3UDXA 3K80C 3HOZH 3L0OA 3E9IA 1IYJB 1K3RA 3GTJH 2JEAI 1W3SA 1OXUA 4X6AH 1L0WA 5HGQA 3S1QH 4LFCL 1S3OA 4A3GG 4B3SQ 4K0KL 3PIOA 1E24A 3M3YH 3CP0A 2OWOA 2D0OA 1UEBA 3PUYA 3RR5A 1QVCA 5IYCG 5GAHC 1SMXA 1B8AA 4H02A 1VQ4A 3HKZG 1PH1A 4KHPL 4JI5L 4DV0L 2NZOA 5IWAL 4DR3L 1Z9FA 4PG3A 1VQNA 3PO3G 4A3IH 2EQSA 1N36L 4OXPA 4JYAL 3KF6A 3GTKH 2YTVA 1YNXA 3OW2A 1XPUA 2BA1A 1VQIA 1IBKQ 3E9HA 3KYHC 2BH8A 2JA6H 4GLVB 5IYDH 3GD7A 1OXXK 4LFAQ 4HIOA 1HNXQ 1O7IA 4LF9L 1GVPA 1YITA 4OWWB 1K9MC 2UUBL 5IP9G 1VQ5A 5H1SE 1PFSA 4GLXA 4YY3Q 3HOWH 3M4PA 3NEMA 3TS2A 3EBEA 1JE5A 1YHQA 1G291 5GADC 2QA4A 4DR2L 4LNQA 2B63H 3STBD 3STBC 1VQ6A 1VQEA 1G6PA 1CSPA 2Z6KA 3RN5A 1KL9A 1X54A 3CW2C 2I5LX 3G48A 2R7FA 1YZ6A 2RHSB 3T1HQ 1Q82C 2DGYA 3M4QA 4GKJL 2K75A 1Y1VG 2CQOA 1QVFA 2MNAA 4AQYL 4A3JH 3PF4A 1VQPA 2OTJA 1HZ9A 3H15A 2LXJA 4IO9A 4R4IA 3FP9A 4IJLA 3CCEA 2A8VA 4DR4L 1C9OA 3UE0A 5JEAJ 3FKIH 5M3MH 1Q86C 4LF6Q 1JT8A 2KBNA 1X3FA 3KF8B 1A8VA 4IPGA 1P8LA 4YWKA 2V1CC 4DK3C 4NXML 4Y52H 1TWHH 1V1QA 2XGTA 3G6EA 3F2DA 2HHHL 4DV4L 2R7ZG 4A3FG 1XNQQ 3DM3A 3AFQA 1U5KA 3KDFB 1WFQA 3M9BA 3RLNA 4JBKA 2QGQA 3M85A 3S2HH 1RL2A 4P75A 1MJEA 3HOXG 5ELNA 3KLWA 1VQMA 2ASBA 4DR7Q 2AHOB 1N9WA 1Y1WG 1X55A 4L5QA 2MQHA 4QIWE 3ERSX 2MFIA 4A3LG 2WAQG 3AFPA 1PH9A 5M3FH 1Q1EA 1AH9A 2ZTEA 2UXBL 1GD7A 1NE3A 2CKZB 4JG2A 3TEHB 5FLMH 3PO2H 1X3GA 4YHHL 1XMOQ 1ASZA 1X56A 3HOUH 2CWPA 3KOJA 3CCRA 2UUCQ 5AJ3L 4BY1G 2QEXA 1A62A 1MKHA 4A3DG 1GKHA 1Q7YC 2R92H 2PQAB 4HIDA 1U0LA 2WB1G 4YCWA 3I4NG 4A3KG 4A3CH 4JV5L 4A93G 1N33L 3HOYG 2I5MX 3U58A 1V9PA 1T9HA 4IFDI 4DV6L 4QGUA 4GLAC 3TQYA 3CPFA 2KHIA 2L15A 4QY7A 3PV0A 4DV1Q 1YJWA 3BZCA 4DUZQ 1V43A 2AWOA 2E5LL 2VQFQ 1HNWQ 4HJ8A 2UU9Q 1VQBA 1XTDA 3OTOL 4LF5L 1FJGL 3L7ZC 5IE8A 1C0AA 5M5WH 2LSSA 3HFZB 2Q2TA 1GO3E 4DUYQ 2VW9A 1Q1BA 1BKBA 1RIPA 3MXNB 2GVBA 3A74A 3CCUA 1LUZA 2JQOA 1L1OB 2OQKA 5C0XJ 2JA8G 3ULLA 1YJ9A 3K7UC 4DV2Q 4B3SL 4A3BH 1KIXA 1PH2A 5LMNQ 4JBWA 1SROA 4BXXG 3DLLA 3TREA 1WCMH 4GNXA 1XMQQ 3G4SA 1HJPA 1BBWA 2NVTH 2NN6G 4B3RQ 2F3IA 4LUOA 1VQCA 3CMEA 2HIXA 4KI0A 4GNXC 1I5FA 1P16A 1CKNA 2JEBI 4L5TA 1QZGA 4P72A 4POGA 4FDBA 4DPGA 3J81c 3GO5A 1JB7A 2B3GA 4JI6Q 3HOZG 1VQHA 1IBKL 1E7ZA 4P73A 4A3EG 1VQJA 3UE1A 2NVQH 4BY7G 2NN6I 1KRSA 5FJ8H 1SFOH 4LFAL 1EUJA 1HNXL 3G71A 4JI2L 1NJIC 2N3SA 3K81C 1PVOA 4YWLA 3LGJA 2CFMA 4JI7Q 3J7ZC 1TXYA 4YY3L 3I55A 2ALYB 4JC0A 4DNIA 4A3MH 4AH6A 1HNZL 3CD6A 3HOVH 3H3VH 4A3IG 4LF7Q 4OO1G 2D0PA 2VZAA 4A75A 1HZAA 2YTYA 1N8RC 3PSIA 2UUAQ 4B3TQ 2C35B 5IP7H 2OQ0A 3PF5A 3ICEA 3U4VA 3K8AA 5IYDG 4IOAA 2IHEA 2K52A 5LMNW 5IY0A 1BBUA 5IYBH 2EIFA 4UPAA 1IBLQ 2N8NA 4NPSA 4IFDJ 4JBMA 3I4MH 2AKWB 4TVAB 4LFBQ 4DR1Q 3W5OA 4LUZA 4O0AA 1UE6A 1LYLA 5GQOA 4X62L 1I6HH 2IX0A 1AE3A 1PH3A 4DR7L 3U50C 1PH7A 3FHWA 1SN8A 4PZ7A 3GTOH 3J81i 2E2HH 1HH2P 4A3JG 4X64Q 2IY5B 2VS1A 2K4KA 4RMFA 4GOPB 4C3IH 5LMUQ 4DV7L 5C44H 3FKIG 3A5ZB 3I7FA 5IYCH 1UE5A 1XMOL 1HZCA 3CC4A 5C0XG 1I94Q 2UUCL 3PO3H 1HZBA 3S14H 2D62A 4MTNA 3HKSA 3CCSA 4LF4Q 3D0FA 4MZ9A 3E0EA 3CAMA 4DR5Q 3UDGA 4BA2I 1XNRQ 2UXCQ 1X9NA 1QUQA 4GN4B 5M3MG 4C3JH 1L2FA 1NMGA 2R93H 4JI0Q 5M3FG 4LWCA 4DV1L 3BU2A 4EQ5A 3AEVA 1MJCA 3CQZH 5E7NA 4HJAA 3T1YL 1K83H 3PO2G 1Q8KA 3U4ZA 4DUZL 3S1RH 1E1TA 3W1BA 4OX9Q 1XPRA 2OTLA 2PNHA 2VQFL 3CF5A 4IOCA 4LW1A 2UU9L 2BA0A 4JI5Q 3S1MH 1HNWL 4UP7A 5C3EG 4L5SA 2R92G 4XTCS 2JA9A 4DUYL 1JJ2A 2HIVA 1CSQA 3I4OA 1Y1VH 4J15A 2KHJA 1YI2A 1B70B 2A1AA 4LUVA 2IX1A 1E22A 2WP8J 4LF8Q 3CXCA 4DV2L 4DR6Q 5JJIA 2JA7H 5LMNL 1A63A 2ZM6Q 2HT1A 3BJUA 5IT9c 1EIFA 2N78A 3TS0A 1XMQL 4BBSG 1X65A 5C4XH 2ES2A 3KF6B 1N34Q 1JMCA 4A3FH 2ZJQA 1UE1A 4B3RL 4QQBX 2RHQB 4LF8L 3I2ZA 1YEZA 4GS3A 2PI2A 1VQDA 1Y1WH 2MO0A 4IJHA 4PZ6A 4JI6L 3S15H 4A3LH 3JAMc 1WJJA 4JBJA 3RZOH 4DAYB 4P71A 1J5EQ 4WJ3M 3RZDH 2I0QA 3PGZA 4A3BG 1IBMQ 4RG1A 1SE8A 1SLJA 5HY6A 4NXNQ 4JI1Q 2GN5A 4JOIA 4O2DA 3SGIA 4JI7L 2HHHQ 3F1ZA 1E1OA 4R4CA 1PYSB 5JJKA 3S1NH 1KC8C 4JOIC 4A3KH 1VQFA 4LF7L 4BA1I 1UE7A 3J80c 2JJQA 2E2JH 3VDYA 2VUMH 3CCLA 3M7NA 4DV3Q 3CC2A 1VQ7A 3MEFA 4B3TL 1H95A 4NB3A 4R4QA 4TQUS 5JEAG 1HR0Q 3UDIA 5FJ8G 1SR3A 5C4JH 1EQQA 3CCVA 3S24A 1I50H 1OXSC 1XPOA 1OTCA 3NELA 3OYYA 1JJGA 4EX5A 1S72A 2VY3A 1IBLL 1EQRA 2LXKA 4BBRH 2CCZA 3D31A 3H0GH 1KQSA 4JCVE 2JA5H 4A3MG 4DR1L 3KJPA 4JI4Q 1R9TH 3HOVG 4GN3B 2UXDL 1PA6A 3KJOA 3CMAA 2CWAA 3ULPA 1NTGA 1KD1C 1N33Q 1J6QA 2GVAA 5GAGC 2VQEQ 4WJ4A 2K5HA 4AYBE 1N32Q 3GTQH 2JA8H 4HIMA 1PH5A 3NBHB 3JC66 5IP7G 3L2PA 3M4OH 3CCJA 4X64L 1B7YB 2Y0SE 4APVA 4X66Q 3JAMi 1K8AC 1I3QH 3S17H 3T1HL 1CKMA 3KDFA 5J3BA 5IYBG 2F4VQ 1CKOA 2OCEA 1I94L 1GM5A 3I4MG 4LF5Q 1FJGQ 2Q2HA 4B3MQ 2JA6G 2K14A 1QZHA 4IPHA 3NENA 2NVYH 1TWGH 4LF4L 3AQQA 2KCTA 1FGUA 1UWVA 4DR5L 3TRZA 4LF6L 4GKKQ 4OO1I 4HJ7A 2RCNA 1XNRL 2UXCL 4UY8C 3HOWG 3J80i 4A3EH 3CCQA 2YU9H 3A0JA 1WYDA 4BY7H 1M1KC 2B63G 5JJLA 1XNQL 1ASYA 1AE2A 4JI0L 4DK6C 1HR0W 3RN2A 1FVIA 4KHZA 1OXTA 4X65Q 1YIJA 5C44G 3IRBA 2PQAA 4JI8Q 3ULJA 4OX9L 3S2DH 3GDEA 4A4IA 3PUXA 4A3GH 2Z0SA 1VCIA 3CPWA 1NY4A 1CUKA 3PUVA 1Q12A 1MIUA 3GTLH 5BR8Q 1YHBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LM0 A;  1Y14 B;  5FLX c;  3AYH B;  1OXV A;  4C2M H;  4JI3 Q;  1SRU A;  3EIV A;  4DV5 Q;  4PZ8 A;  4GNX B;  3CC7 A;  1VQ8 A;  2K5V A;  3PIP A;  2FXQ A;  2ID0 A;  4GN5 A;  1C7Y A;  2YYZ A;  4JI2 Q;  5M5Y H;  2R93 G;  2NZH A;  4DR6 L;  2EXD A;  2ZM6 L;  4UP9 A;  2ATW A;  2E2I H;  1CKN B;  2N49 A;  1N34 L;  1YVC A;  1DGS A;  1E3P A;  5C0X I;  1QVG A;  1HNZ Q;  4LFC Q;  1YHA A;  2Q2U A;  4K0K Q;  4C3H H;  2UXD Q;  5IP9 H;  1L1O A;  3S16 H;  5FLM G;  3GTG H;  3GTM H;  4YWM A;  4OWX B;  4R4T A;  3HOU G;  1X3E A;  1VQK A;  4KHP Q;  2Z6K C;  4DV0 Q;  3BZK A;  3Q8D A;  5IWA Q;  2Q2I A;  1L1O C;  4QL5 A;  4DR3 Q;  1WOC A;  1EYG A;  2AWN A;  2HQL A;  1N36 Q;  1M90 C;  1J5E L;  4PMW A;  4IPC A;  1XJV A;  1PYB A;  4JYA Q;  4A3C G;  2PMZ E;  3RLO A;  3ER0 A;  1IBM L;  2JA7 G;  1Q81 C;  4NXN L;  4JI1 L;  3RNU A;  3ZJY C;  2F52 A;  5ELO A;  4HJ5 A;  3W1G A;  2ZJR A;  1W2B A;  1S40 A;  5C4X G;  1K0R A;  3PUZ A;  3K7A H;  3HKZ E;  2ZTC A;  5GAE C;  4LF9 Q;  5DLQ E;  4POF A;  5EAY A;  5M5X H;  2UUB Q;  4X62 Q;  4UP8 A;  2R7Z H;  3J7A 5;  2JK8 A;  3K0X A;  4DR2 Q;  4DV3 L;  2B29 A;  4ME3 A;  1D7Q A;  1EWI A;  2VNU D;  4YCV A;  1PH6 A;  2K50 A;  1HR0 L;  3PCO B;  4AYB G;  3HOX H;  1EIY B;  4DV7 Q;  3WWV A;  2NVX H;  2VL6 A;  4IFD G;  4GKJ Q;  1K73 C;  1TWC H;  1G51 A;  1VQL A;  4AQY Q;  1IL2 A;  2Y0S G;  2XTI A;  2ZJP A;  1KHI A;  5C3E H;  4DR4 Q;  2RF4 A;  1PHJ A;  4JI4 L;  2H5X A;  4MNO A;  3RLF A;  3GTP H;  4OON A;  2PI2 E;  4NXM Q;  2VQE L;  2KEN A;  1N32 L;  1WCM G;  2VUM G;  4DAM A;  4BY1 H;  4DV4 Q;  2ZTD A;  1VQO A;  4A3D H;  1NBW A;  2A19 A;  4A93 H;  3J81 j;  3F2B A;  4ALP A;  3PUW A;  1EFW A;  4P74 A;  3I4N H;  1VQG A;  3B6Y A;  4X66 L;  3UDF A;  3T1Y Q;  1VQA A;  1K8G A;  3HOY H;  4BBS H;  2AMC B;  1TWF H;  1PH4 A;  1NMF A;  1FL0 A;  1KAW A;  1Z47 A;  3CCM A;  2UUA L;  2F4V L;  4HJ9 A;  4Y7N H;  4BBR G;  3A5U A;  3H0G G;  4B3M L;  1QUQ B;  2JA5 G;  4DKA C;  2MO1 A;  2UXB Q;  1JJC B;  3F2C A;  4GKK L;  4YHH Q;  2KCM A;  1Q46 A;  3F8T A;  4IPD A;  2I5H A;  1D8L A;  2R6G A;  1BVS A;  1YJN A;  1IZ6 A;  5AJ3 Q;  1A0I A;  3I56 A;  2R7D A;  4XIG S;  4GOP A;  4LFB L;  4JV5 Q;  4HIK A;  2WAQ E;  1PV4 A;  4R1J A;  2WFW A;  3KFU A;  2IT1 A;  4GOP C;  4X65 L;  2JE6 I;  2E8G A;  4JI8 L;  4DV6 Q;  1LTL A;  4OWT B;  2DUD A;  2YV5 A;  4AIM A;  1WI5 A;  1KRT A;  4R4O A;  1IXR A;  4QJF A;  1PH8 A;  1X6O A;  4BXX H;  2K5N A;  1KXL A;  1YBY A;  1VQ9 A;  5LMU L;  2WB1 E;  2YTX A;  4KLK A;  3EN2 A;  5BR8 L;  1VS0 A;  4A76 A;  2E5L Q;  3H3V I;  1TWA H;  4YCU A;  3OTO Q;  2BH2 A;  4JI3 L;  1EOV A;  4DV5 L;  2IHF A;  5GRO A;  5K36 G;  4L5R C;  3UDX A;  3K80 C;  3HOZ H;  3L0O A;  3E9I A;  1IYJ B;  1K3R A;  3GTJ H;  2JEA I;  1W3S A;  1OXU A;  4X6A H;  1L0W A;  5HGQ A;  3S1Q H;  4LFC L;  1S3O A;  4A3G G;  4B3S Q;  4K0K L;  3PIO A;  1E24 A;  3M3Y H;  3CP0 A;  2OWO A;  2D0O A;  1UEB A;  3PUY A;  3RR5 A;  1QVC A;  5IYC G;  5GAH C;  1SMX A;  1B8A A;  4H02 A;  1VQ4 A;  3HKZ G;  1PH1 A;  4KHP L;  4JI5 L;  4DV0 L;  2NZO A;  5IWA L;  4DR3 L;  1Z9F A;  4PG3 A;  1VQN A;  3PO3 G;  4A3I H;  2EQS A;  1N36 L;  4OXP A;  4JYA L;  3KF6 A;  3GTK H;  2YTV A;  1YNX A;  3OW2 A;  1XPU A;  2BA1 A;  1VQI A;  1IBK Q;  3E9H A;  3KYH C;  2BH8 A;  2JA6 H;  4GLV B;  5IYD H;  3GD7 A;  1OXX K;  4LFA Q;  4HIO A;  1HNX Q;  1O7I A;  4LF9 L;  1GVP A;  1YIT A;  4OWW B;  1K9M C;  2UUB L;  5IP9 G;  1VQ5 A;  5H1S E;  1PFS A;  4GLX A;  4YY3 Q;  3HOW H;  3M4P A;  3NEM A;  3TS2 A;  3EBE A;  1JE5 A;  1YHQ A;  1G29 1;  5GAD C;  2QA4 A;  4DR2 L;  4LNQ A;  2B63 H;  3STB D;  3STB C;  1VQ6 A;  1VQE A;  1G6P A;  1CSP A;  2Z6K A;  3RN5 A;  1KL9 A;  1X54 A;  3CW2 C;  2I5L X;  3G48 A;  2R7F A;  1YZ6 A;  2RHS B;  3T1H Q;  1Q82 C;  2DGY A;  3M4Q A;  4GKJ L;  2K75 A;  1Y1V G;  2CQO A;  1QVF A;  2MNA A;  4AQY L;  4A3J H;  3PF4 A;  1VQP A;  2OTJ A;  1HZ9 A;  3H15 A;  2LXJ A;  4IO9 A;  4R4I A;  3FP9 A;  4IJL A;  3CCE A;  2A8V A;  4DR4 L;  1C9O A;  3UE0 A;  5JEA J;  3FKI H;  5M3M H;  1Q86 C;  4LF6 Q;  1JT8 A;  2KBN A;  1X3F A;  3KF8 B;  1A8V A;  4IPG A;  1P8L A;  4YWK A;  2V1C C;  4DK3 C;  4NXM L;  4Y52 H;  1TWH H;  1V1Q A;  2XGT A;  3G6E A;  3F2D A;  2HHH L;  4DV4 L;  2R7Z G;  4A3F G;  1XNQ Q;  3DM3 A;  3AFQ A;  1U5K A;  3KDF B;  1WFQ A;  3M9B A;  3RLN A;  4JBK A;  2QGQ A;  3M85 A;  3S2H H;  1RL2 A;  4P75 A;  1MJE A;  3HOX G;  5ELN A;  3KLW A;  1VQM A;  2ASB A;  4DR7 Q;  2AHO B;  1N9W A;  1Y1W G;  1X55 A;  4L5Q A;  2MQH A;  4QIW E;  3ERS X;  2MFI A;  4A3L G;  2WAQ G;  3AFP A;  1PH9 A;  5M3F H;  1Q1E A;  1AH9 A;  2ZTE A;  2UXB L;  1GD7 A;  1NE3 A;  2CKZ B;  4JG2 A;  3TEH B;  5FLM H;  3PO2 H;  1X3G A;  4YHH L;  1XMO Q;  1ASZ A;  1X56 A;  3HOU H;  2CWP A;  3KOJ A;  3CCR A;  2UUC Q;  5AJ3 L;  4BY1 G;  2QEX A;  1A62 A;  1MKH A;  4A3D G;  1GKH A;  1Q7Y C;  2R92 H;  2PQA B;  4HID A;  1U0L A;  2WB1 G;  4YCW A;  3I4N G;  4A3K G;  4A3C H;  4JV5 L;  4A93 G;  1N33 L;  3HOY G;  2I5M X;  3U58 A;  1V9P A;  1T9H A;  4IFD I;  4DV6 L;  4QGU A;  4GLA C;  3TQY A;  3CPF A;  2KHI A;  2L15 A;  4QY7 A;  3PV0 A;  4DV1 Q;  1YJW A;  3BZC A;  4DUZ Q;  1V43 A;  2AWO A;  2E5L L;  2VQF Q;  1HNW Q;  4HJ8 A;  2UU9 Q;  1VQB A;  1XTD A;  3OTO L;  4LF5 L;  1FJG L;  3L7Z C;  5IE8 A;  1C0A A;  5M5W H;  2LSS A;  3HFZ B;  2Q2T A;  1GO3 E;  4DUY Q;  2VW9 A;  1Q1B A;  1BKB A;  1RIP A;  3MXN B;  2GVB A;  3A74 A;  3CCU A;  1LUZ A;  2JQO A;  1L1O B;  2OQK A;  5C0X J;  2JA8 G;  3ULL A;  1YJ9 A;  3K7U C;  4DV2 Q;  4B3S L;  4A3B H;  1KIX A;  1PH2 A;  5LMN Q;  4JBW A;  1SRO A;  4BXX G;  3DLL A;  3TRE A;  1WCM H;  4GNX A;  1XMQ Q;  3G4S A;  1HJP A;  1BBW A;  2NVT H;  2NN6 G;  4B3R Q;  2F3I A;  4LUO A;  1VQC A;  3CME A;  2HIX A;  4KI0 A;  4GNX C;  1I5F A;  1P16 A;  1CKN A;  2JEB I;  4L5T A;  1QZG A;  4P72 A;  4POG A;  4FDB A;  4DPG A;  3J81 c;  3GO5 A;  1JB7 A;  2B3G A;  4JI6 Q;  3HOZ G;  1VQH A;  1IBK L;  1E7Z A;  4P73 A;  4A3E G;  1VQJ A;  3UE1 A;  2NVQ H;  4BY7 G;  2NN6 I;  1KRS A;  5FJ8 H;  1SFO H;  4LFA L;  1EUJ A;  1HNX L;  3G71 A;  4JI2 L;  1NJI C;  2N3S A;  3K81 C;  1PVO A;  4YWL A;  3LGJ A;  2CFM A;  4JI7 Q;  3J7Z C;  1TXY A;  4YY3 L;  3I55 A;  2ALY B;  4JC0 A;  4DNI A;  4A3M H;  4AH6 A;  1HNZ L;  3CD6 A;  3HOV H;  3H3V H;  4A3I G;  4LF7 Q;  4OO1 G;  2D0P A;  2VZA A;  4A75 A;  1HZA A;  2YTY A;  1N8R C;  3PSI A;  2UUA Q;  4B3T Q;  2C35 B;  5IP7 H;  2OQ0 A;  3PF5 A;  3ICE A;  3U4V A;  3K8A A;  5IYD G;  4IOA A;  2IHE A;  2K52 A;  5LMN W;  5IY0 A;  1BBU A;  5IYB H;  2EIF A;  4UPA A;  1IBL Q;  2N8N A;  4NPS A;  4IFD J;  4JBM A;  3I4M H;  2AKW B;  4TVA B;  4LFB Q;  4DR1 Q;  3W5O A;  4LUZ A;  4O0A A;  1UE6 A;  1LYL A;  5GQO A;  4X62 L;  1I6H H;  2IX0 A;  1AE3 A;  1PH3 A;  4DR7 L;  3U50 C;  1PH7 A;  3FHW A;  1SN8 A;  4PZ7 A;  3GTO H;  3J81 i;  2E2H H;  1HH2 P;  4A3J G;  4X64 Q;  2IY5 B;  2VS1 A;  2K4K A;  4RMF A;  4GOP B;  4C3I H;  5LMU Q;  4DV7 L;  5C44 H;  3FKI G;  3A5Z B;  3I7F A;  5IYC H;  1UE5 A;  1XMO L;  1HZC A;  3CC4 A;  5C0X G;  1I94 Q;  2UUC L;  3PO3 H;  1HZB A;  3S14 H;  2D62 A;  4MTN A;  3HKS A;  3CCS A;  4LF4 Q;  3D0F A;  4MZ9 A;  3E0E A;  3CAM A;  4DR5 Q;  3UDG A;  4BA2 I;  1XNR Q;  2UXC Q;  1X9N A;  1QUQ A;  4GN4 B;  5M3M G;  4C3J H;  1L2F A;  1NMG A;  2R93 H;  4JI0 Q;  5M3F G;  4LWC A;  4DV1 L;  3BU2 A;  4EQ5 A;  3AEV A;  1MJC A;  3CQZ H;  5E7N A;  4HJA A;  3T1Y L;  1K83 H;  3PO2 G;  1Q8K A;  3U4Z A;  4DUZ L;  3S1R H;  1E1T A;  3W1B A;  4OX9 Q;  1XPR A;  2OTL A;  2PNH A;  2VQF L;  3CF5 A;  4IOC A;  4LW1 A;  2UU9 L;  2BA0 A;  4JI5 Q;  3S1M H;  1HNW L;  4UP7 A;  5C3E G;  4L5S A;  2R92 G;  4XTC S;  2JA9 A;  4DUY L;  1JJ2 A;  2HIV A;  1CSQ A;  3I4O A;  1Y1V H;  4J15 A;  2KHJ A;  1YI2 A;  1B70 B;  2A1A A;  4LUV A;  2IX1 A;  1E22 A;  2WP8 J;  4LF8 Q;  3CXC A;  4DV2 L;  4DR6 Q;  5JJI A;  2JA7 H;  5LMN L;  1A63 A;  2ZM6 Q;  2HT1 A;  3BJU A;  5IT9 c;  1EIF A;  2N78 A;  3TS0 A;  1XMQ L;  4BBS G;  1X65 A;  5C4X H;  2ES2 A;  3KF6 B;  1N34 Q;  1JMC A;  4A3F H;  2ZJQ A;  1UE1 A;  4B3R L;  4QQB X;  2RHQ B;  4LF8 L;  3I2Z A;  1YEZ A;  4GS3 A;  2PI2 A;  1VQD A;  1Y1W H;  2MO0 A;  4IJH A;  4PZ6 A;  4JI6 L;  3S15 H;  4A3L H;  3JAM c;  1WJJ A;  4JBJ A;  3RZO H;  4DAY B;  4P71 A;  1J5E Q;  4WJ3 M;  3RZD H;  2I0Q A;  3PGZ A;  4A3B G;  1IBM Q;  4RG1 A;  1SE8 A;  1SLJ A;  5HY6 A;  4NXN Q;  4JI1 Q;  2GN5 A;  4JOI A;  4O2D A;  3SGI A;  4JI7 L;  2HHH Q;  3F1Z A;  1E1O A;  4R4C A;  1PYS B;  5JJK A;  3S1N H;  1KC8 C;  4JOI C;  4A3K H;  1VQF A;  4LF7 L;  4BA1 I;  1UE7 A;  3J80 c;  2JJQ A;  2E2J H;  3VDY A;  2VUM H;  3CCL A;  3M7N A;  4DV3 Q;  3CC2 A;  1VQ7 A;  3MEF A;  4B3T L;  1H95 A;  4NB3 A;  4R4Q A;  4TQU S;  5JEA G;  1HR0 Q;  3UDI A;  5FJ8 G;  1SR3 A;  5C4J H;  1EQQ A;  3CCV A;  3S24 A;  1I50 H;  1OXS C;  1XPO A;  1OTC A;  3NEL A;  3OYY A;  1JJG A;  4EX5 A;  1S72 A;  2VY3 A;  1IBL L;  1EQR A;  2LXK A;  4BBR H;  2CCZ A;  3D31 A;  3H0G H;  1KQS A;  4JCV E;  2JA5 H;  4A3M G;  4DR1 L;  3KJP A;  4JI4 Q;  1R9T H;  3HOV G;  4GN3 B;  2UXD L;  1PA6 A;  3KJO A;  3CMA A;  2CWA A;  3ULP A;  1NTG A;  1KD1 C;  1N33 Q;  1J6Q A;  2GVA A;  5GAG C;  2VQE Q;  4WJ4 A;  2K5H A;  4AYB E;  1N32 Q;  3GTQ H;  2JA8 H;  4HIM A;  1PH5 A;  3NBH B;  3JC6 6;  5IP7 G;  3L2P A;  3M4O H;  3CCJ A;  4X64 L;  1B7Y B;  2Y0S E;  4APV A;  4X66 Q;  3JAM i;  1K8A C;  1I3Q H;  3S17 H;  3T1H L;  1CKM A;  3KDF A;  5J3B A;  5IYB G;  2F4V Q;  1CKO A;  2OCE A;  1I94 L;  1GM5 A;  3I4M G;  4LF5 Q;  1FJG Q;  2Q2H A;  4B3M Q;  2JA6 G;  2K14 A;  1QZH A;  4IPH A;  3NEN A;  2NVY H;  1TWG H;  4LF4 L;  3AQQ A;  2KCT A;  1FGU A;  1UWV A;  4DR5 L;  3TRZ A;  4LF6 L;  4GKK Q;  4OO1 I;  4HJ7 A;  2RCN A;  1XNR L;  2UXC L;  4UY8 C;  3HOW G;  3J80 i;  4A3E H;  3CCQ A;  2YU9 H;  3A0J A;  1WYD A;  4BY7 H;  1M1K C;  2B63 G;  5JJL A;  1XNQ L;  1ASY A;  1AE2 A;  4JI0 L;  4DK6 C;  1HR0 W;  3RN2 A;  1FVI A;  4KHZ A;  1OXT A;  4X65 Q;  1YIJ A;  5C44 G;  3IRB A;  2PQA A;  4JI8 Q;  3ULJ A;  4OX9 L;  3S2D H;  3GDE A;  4A4I A;  3PUX A;  4A3G H;  2Z0S A;  1VCI A;  3CPW A;  1NY4 A;  1CUK A;  3PUV A;  1Q12 A;  1MIU A;  3GTL H;  5BR8 Q;  1YHB A; 
#chains in the Genus database with same CATH topology
 2DNC A;  1PZI D;  5COR A;  4A3F B;  3AYH B;  5IGD A;  3EIV A;  4GNX B;  4B08 A;  2R93 G;  2ID0 A;  4JI2 Q;  3I3C A;  4K2L A;  2ZM6 L;  2ATW A;  3K5L A;  4MTK A;  2PZW A;  1YVC A;  1E3P A;  5C0X I;  1QVG A;  3MXN A;  2O2L D;  5FLM G;  4CHT B;  1X3E A;  4KHP Q;  5IWA Q;  1L1O C;  3S1N B;  4RHR A;  4A3K B;  5L37 A;  1H9J A;  1M90 C;  3NQT A;  1EWH A;  4IPC A;  4PMW A;  1PYB A;  4CGY B;  4A3C G;  1S5F D;  2EOT A;  1IBM L;  2K28 A;  2B2V C;  4UDU C;  4JI1 L;  4DXG A;  1Q81 C;  5ELO A;  1S40 A;  2ZJR A;  1GUS A;  4GZY C;  3HGB A;  1K0R A;  3PUZ A;  2VB3 X;  3K7A H;  2H4O A;  5C4J B;  4FP5 D;  5EAY A;  4X62 Q;  3CRL C;  4OIK A;  2JK8 A;  4DR2 Q;  2JA5 B;  1AP0 A;  1EWI A;  1K3B C;  4YCV A;  2K50 A;  1EIY B;  2IX3 A;  4DV7 Q;  1BNZ A;  3WWV A;  2VL6 A;  4IFD G;  1G51 A;  2Y0S G;  4NMZ A;  4DNT B;  4PNY A;  1LO5 D;  2H5X A;  4ZKC B;  3GTP H;  5JJZ A;  2PPB C;  2KEN A;  1DOK A;  1WCM G;  3MXG A;  1EZ6 A;  4DAM A;  4JPB W;  4BY1 H;  1VQO A;  4A3D H;  4A93 H;  1TWG B;  3PUW A;  5IIF A;  1VQG A;  3B6Y A;  1K8G A;  3UDF A;  3T1Y Q;  3H94 A;  3K58 A;  4A3E B;  2IW3 A;  1TWF H;  2YU9 B;  4BY7 B;  5TSS A;  3R2I A;  1QUQ B;  4DKA C;  2MO1 A;  3F2C A;  2RDG A;  3F8T A;  1UNS A;  2E74 C;  1IZ6 A;  4F88 A;  5AJ3 Q;  1S4Z A;  3I56 A;  4XIG S;  4LFB L;  3GTL B;  4GOP C;  3HKZ B;  4XDX A;  4X65 L;  4FF4 A;  2E2D C;  3E5S A;  1BXT A;  1LTL A;  2RBM A;  2DUD A;  4AIM A;  1KRT A;  1IXR A;  1SSO A;  5M5Y B;  1PH8 A;  4OL7 A;  2XSC A;  1VQ9 A;  4KLK A;  5KYI A;  4F87 A;  3OTO Q;  3C2P A;  4C3H B;  3S16 B;  3GTG B;  1GJX A;  3GTM B;  5BN4 A;  5KND A;  1IYJ B;  4K6L A;  2JEA I;  1JWU D;  1OXU A;  1L0W A;  1S3O A;  3NQI A;  4NDX A;  2OWO A;  1E0B A;  2D0O A;  3PUY A;  2X6G A;  2K32 A;  1BR9 A;  2CW0 C;  1PH1 A;  2RQX A;  4KHP L;  5IWA L;  3MZ5 A;  1Z9F A;  4PG3 A;  1VQN A;  5M5X B;  4OO1 H;  2EQS A;  4OXP A;  3NTK A;  3KF6 A;  1YNX A;  2NUC A;  2BA1 A;  1TS4 A;  1V1P B;  3E9H A;  1STA A;  4FF2 A;  2JA6 H;  4GLV B;  1HTP A;  3GD7 A;  4L63 B;  5D65 A;  4OWW B;  5I9P A;  3DUZ A;  1VQ5 A;  1PFS A;  2K6A A;  4GLX A;  4HSP A;  4YY3 Q;  3HOW H;  3M4P A;  1WTH A;  3SDZ A;  2BDO A;  4LNQ A;  1G29 1;  2F0Q A;  2QA4 A;  4DR2 L;  2B63 H;  1A3U A;  1HA5 A;  1VQ6 A;  2F0S A;  3J81 L;  1CSP A;  1KL9 A;  3VR2 A;  3EJI A;  3G48 A;  1YZ6 A;  4G57 A;  4L6T B;  1PYW D;  3RMH A;  2MNA A;  2A73 B;  2MUY A;  1HZ9 A;  4IO9 A;  4J6H A;  2IJ0 A;  4R4I A;  3DWQ A;  2IL8 A;  3GV6 A;  3CCE A;  2QDL A;  5JEA J;  4ID6 A;  2NTS A;  4BBS B;  1JT8 A;  1X3F A;  1RD9 D;  1A8V A;  4YWK A;  2K33 A;  4DK3 C;  5C0X H;  4Y7N B;  1W6K A;  2CVR A;  3P20 A;  3TZD A;  1EU3 A;  4A3F G;  4JBK A;  3AFQ A;  4NKL A;  3M85 A;  1RL2 A;  4P75 A;  1MJE A;  2L0C A;  2PW5 A;  3U9S A;  1Y1W G;  1D5Z C;  4L5Q A;  2MFI A;  1LT3 D;  1PH9 A;  1A3T A;  1V8Q A;  1AH9 A;  2AQ3 B;  2CKZ B;  3PO2 H;  5AJ3 L;  1LAC A;  4BY1 G;  1EWC A;  4A3D G;  2UXD Q;  1I4X A;  4A93 G;  3RD4 A;  1E2W A;  4A3K G;  5M9O A;  3U58 A;  1WTQ A;  2DY8 A;  1V9P A;  4GLA C;  3TQY A;  3CPF A;  1LTS D;  4DUZ Q;  5A35 A;  2AWO A;  3QG1 A;  2UU9 Q;  3S1Q B;  1QE6 A;  3OTO L;  1Q90 A;  1R4Q B;  5M5W H;  2LSS A;  5FOB B;  5EKK A;  2HDM A;  4KD3 A;  5D3I B;  3W2D A;  3VA5 A;  3K7U C;  3GTK B;  3Q0A A;  3ND8 A;  4DN4 M;  4F7X A;  5C6A A;  3TRE A;  2NB0 A;  1XMQ Q;  3G4S A;  2NN6 G;  5CV4 A;  2PYK A;  2HIX A;  5COY A;  4GNX C;  1I5F A;  4QIW B;  4RGO S;  4FDB A;  1K28 A;  1JB7 A;  1E7Z A;  3ND9 A;  4A3E G;  1ET6 A;  4FYD A;  4BY7 G;  4K6D A;  5KNB A;  5IT9 L;  3G71 A;  1I6V C;  4V0B A;  4JI7 Q;  4YY3 L;  3I55 A;  2ALY B;  4A3J B;  2BOS A;  1F9P A;  3AMU A;  4AH6 A;  3FKI B;  1JR0 D;  4OO1 G;  2L11 A;  3ONA B;  2YTY A;  3PSI A;  3DEP A;  4EGV A;  5IP7 H;  1KTK A;  3S2H B;  3PF5 A;  2B2U C;  5C3X A;  3K6O A;  4QUC A;  1DD2 A;  2HUG A;  1CQV A;  2IHE A;  5IY0 A;  1O7Z A;  2N8N A;  4QMG A;  3I72 A;  3FEW X;  1F9R A;  2K01 A;  1DJR D;  4C3H G;  5K36 H;  1LYL A;  5GQO A;  3HOU B;  2IX0 A;  4I65 A;  3VA7 A;  3U50 C;  4KV6 A;  1RHP A;  3TP6 A;  2EYH A;  3GTO H;  1HH2 P;  1SNM A;  1SND A;  1WTO A;  2IY5 B;  1QCB D;  3P1H A;  5EJW A;  3A5Z B;  4XQJ A;  5C0X G;  2M2L A;  2D62 A;  3CCS A;  3HKS A;  4N9T A;  2CHB D;  4ODG A;  5CV6 A;  1FNW A;  5EPJ A;  3NTH A;  4MHE A;  1NR4 A;  4JI0 Q;  3BU2 A;  1STH A;  4HJA A;  5I4D A;  2AUJ D;  3SK4 A;  3PO2 G;  3SHL A;  4DUZ L;  3S1R H;  1E1T A;  3W1B A;  2UU9 L;  4OIJ A;  1KLG D;  3MWY W;  1ESF A;  2NVT B;  1Y1V H;  2B2Y C;  4HED A;  1B70 B;  2A1A A;  1S5B D;  1XX8 A;  3MEH A;  1Q3L A;  4DR6 Q;  5JJI A;  3BJU A;  1SNQ A;  1XMQ L;  1C8C A;  4BBS G;  1X65 A;  2ZJQ A;  1JMC A;  2RHQ B;  1JCK B;  3I2Z A;  1YEZ A;  4HN7 A;  4GS3 A;  4CBV A;  2CH4 W;  4DF7 A;  1HUM A;  4A3M B;  3S15 H;  2DJF C;  1SMY C;  4CKE A;  3C1F A;  3RZD H;  4WJ3 M;  5I2Y A;  4RG1 A;  1DOM A;  1WTP A;  2GN5 A;  3GV3 A;  5JOB A;  4JI7 L;  1E1O A;  4R4C A;  5JJK A;  3VR6 A;  1B9N A;  1UE7 A;  3J80 c;  3IAY A;  2E2J H;  3K0Y A;  2LS0 1;  3CCL A;  3M7N A;  3CC2 A;  1G8Z D;  3MEF A;  3BYT B;  4R4Q A;  4TQU S;  1I6H B;  3UDI A;  1I50 H;  5CYU A;  5EKL A;  4EX5 A;  1S72 A;  4BBR H;  2PMZ B;  5DM6 3;  3H0G H;  3MFY A;  1NTG A;  1TU2 B;  1J6Q A;  5GAG C;  2VQE Q;  1N32 Q;  3GTQ H;  4CDF C;  3VR5 A;  2JA8 H;  2ZXR A;  5IP7 G;  4TKO B;  1U9R A;  1H9S B;  4APV A;  1I3Q H;  3T1H L;  2SNM A;  1CKM A;  3KDF A;  5J3B A;  4ZKB B;  1HXY D;  1SE2 A;  1MSH A;  1GM5 A;  2R93 B;  4LF5 Q;  1RKN A;  4B3M Q;  2ENB A;  4RAU C;  3CQZ B;  2EPB A;  1QZH A;  3NEN A;  2KCT A;  4LF6 L;  3SVM A;  1UUP A;  3CKI B;  1I4G A;  3J80 i;  1RCV D;  1M1K C;  2I46 A;  1XNQ L;  1ASY A;  4JI0 L;  2I07 B;  2R3Z A;  4DK6 C;  1FVI A;  2B2T C;  1XWE A;  4FNF A;  1YIJ A;  4HMI A;  2SNS A;  4JI8 Q;  1B3A A;  3GDE A;  4A4I A;  1DON A;  4K5V A;  2A68 D;  5E4X A;  1VMC A;  1LM0 A;  1EIH A;  5FLX c;  1WTX A;  4C2M H;  4DV5 Q;  4PZ8 A;  3TME A;  1CA5 A;  2K5V A;  3PIP A;  2FXQ A;  2F0U A;  2NZH A;  4DR6 L;  2IPK D;  2E2I H;  5ELC A;  1CKN B;  1XTC D;  1EU4 A;  2EDG A;  2N49 A;  3RZO B;  4LFC Q;  1D1I A;  1EEF D;  1L1O A;  1B2T A;  4QCL A;  2Y0S B;  4R4T A;  3HOU G;  1VQK A;  3Q8D A;  2B2V A;  3KLR A;  4IUN A;  3N52 A;  1EYG A;  3I90 A;  2G5D A;  2F0E A;  2PMZ E;  3TP5 A;  4RGN A;  3RNU A;  2F0H A;  4G7H C;  2ZTC A;  4LF9 Q;  5DLQ E;  2UUB Q;  1MHW C;  2R7Z H;  1STB A;  3GP7 A;  3K0X A;  2B29 A;  3BYY B;  1KDA A;  4I7Z C;  5AFW A;  2NVX H;  2QEJ C;  2KHS A;  1VQL A;  1CT1 D;  4AQY Q;  1D6E C;  1HFG A;  1W6J A;  3ZYY X;  2ZJP A;  5C3E H;  2RF4 A;  3S17 B;  4OON A;  2PI2 E;  2VQE L;  1N32 L;  4DV4 Q;  3K57 A;  1KNA A;  1NBW A;  1TS3 A;  3KBG A;  3J81 j;  1G2S A;  3F2B A;  1EFW A;  1JIC A;  1VQA A;  1E2Z A;  3OHX C;  2AMC B;  4ME5 A;  2UUA L;  1Z47 A;  4HJ9 A;  4BBR G;  3F2U A;  3H91 A;  3VYU A;  3H0G G;  4B3M L;  1QJO A;  2KCM A;  1Q46 A;  1EY0 A;  2PZT A;  2O5J C;  4GOP A;  3Q24 A;  2M9V A;  3ITP A;  3K5M A;  2WAQ E;  2RA4 A;  1PV4 A;  1GUT A;  4PV1 C;  2EE1 A;  2IT1 A;  3RUZ A;  2E8G A;  3IKJ A;  4JI8 L;  1A2U A;  2YV5 A;  4N8F A;  4CDE C;  3I70 A;  4CJ2 C;  1X6O A;  1MI2 A;  1YBY A;  5LMU L;  2YTX A;  3VYR A;  3MVV A;  5FO9 B;  1QB5 D;  5E1F A;  1TWA H;  5IGB A;  4YCU A;  5JEA H;  1B4O A;  1EOV A;  4DV5 L;  1K83 B;  2QIL A;  3K80 C;  4XYO A;  3E9I A;  3Q22 A;  1W3S A;  2PNR C;  2DNE A;  2EY6 A;  5FO7 B;  4LFC L;  3M3Y H;  5GAH C;  4H02 A;  1B8A A;  3CHB D;  3K7A B;  4XXE A;  4WFN 3;  4DGZ A;  2WKC A;  4K5W A;  4ZK9 B;  3OW2 A;  4OEM B;  4KKS A;  3R3O A;  1OXX K;  1PFN A;  2HCI A;  3OMC A;  4LFA Q;  3SR1 A;  4LF9 L;  1Y1W B;  2UUB L;  5JPM C;  3NEM A;  3MHB A;  2KQ3 A;  1JE5 A;  1YHQ A;  2ZXP A;  1U4L A;  3STB D;  1D2B A;  2Z6K A;  3C3L A;  3RN5 A;  3GTP B;  1X54 A;  3CW2 C;  2I5L X;  1QNU A;  5CGK A;  1STY A;  4BY1 B;  3M4Q A;  4U67 3;  4U68 A;  2CQO A;  4A3D B;  4AQY L;  4A93 B;  3PF4 A;  1VQP A;  2LXJ A;  2EYO A;  3FP9 A;  3HRZ C;  3UE0 A;  5M3M H;  4N8X 1;  1TWF B;  2KBN A;  3LWU A;  3KF8 B;  4IPG A;  2V1C C;  4ILW A;  4Y52 H;  3VYT A;  2R7Z G;  2KA7 A;  3M7G A;  5K5P A;  4DV4 L;  2FIN B;  3G7L A;  1HRJ A;  1U5K A;  1ZKO A;  3M9B A;  3RLN A;  2G9D A;  3NXW A;  2JSO A;  1VQM A;  2QW7 A;  2WAQ G;  5M3F H;  2F0W A;  1WTV A;  2ZTE A;  1NE3 A;  1PTO D;  1TY0 A;  3FMC A;  4ZUJ A;  2RVL A;  2E76 C;  1X56 A;  1ASZ A;  2CWP A;  2ZT9 C;  1SYB A;  2EZV A;  5A2Q E;  1WTW A;  1F77 A;  2QEX A;  1ONL A;  2FMC A;  4FXK C;  1GKH A;  2PQA B;  1KNE A;  4YCW A;  4K8I A;  5LHY 1;  1N33 L;  4F8M A;  2I5M X;  1T5X D;  1T9H A;  1BCP F;  2EJG C;  2KHI A;  5CR3 A;  2HQE A;  2A5H A;  1V43 A;  1HNW Q;  2Z1C A;  3VR4 A;  1VQB A;  1FJG L;  3L7Z C;  1C0A A;  1QIL A;  4CKC A;  2VW9 A;  1Q1B A;  1BKB A;  4HSV A;  2N55 A;  5DM7 3;  1F2M A;  2OQK A;  1O7L A;  4KK7 A;  1Y8O B;  1YJ9 A;  1G91 A;  1PH2 A;  5LMN Q;  1SRO A;  4RKL A;  3DLL A;  3EFX D;  4GNX A;  5DEH A;  2A74 C;  2RSO A;  2JA6 B;  2F3I A;  2F03 A;  2F0F A;  2JYO A;  4KI0 A;  1F2Z A;  3ERQ A;  4IUV A;  5C4H A;  3I91 A;  4P72 A;  1QZG A;  4DPG A;  3HOW B;  3J81 c;  4O1N A;  3BDL A;  2B63 B;  1VQH A;  1SYD A;  1VQJ A;  1DCZ A;  4LFA L;  1GOZ A;  4JI2 L;  3EQL C;  1NJI C;  3ERO A;  4ABN A;  4YWL A;  1EY9 A;  2CFM A;  1FD7 D;  1MBY A;  4DNI A;  1IKM A;  1K0S A;  3HOV H;  1KAA A;  2D9U A;  1H9R A;  4DAP A;  1HZA A;  1A3V A;  1N8R C;  1TVX A;  4B3T Q;  3A54 A;  4RFB A;  3FPU B;  3FDT A;  3K8A A;  2RDF A;  2K52 A;  5LMN W;  2TSS A;  4IN3 A;  1IBL Q;  1TQO A;  4X3S A;  3SEB A;  3I4M H;  4IFD J;  2AKW B;  4TVA B;  4IUT A;  1FR3 A;  3W5O A;  3PO2 B;  1ROD A;  4LUZ A;  4X62 L;  1PH3 A;  3E6Z X;  1PH7 A;  1RDP D;  3FHW A;  1IYV A;  1ESR A;  3J81 i;  1SYE A;  1LV9 A;  4X3T A;  3QOJ A;  4X64 Q;  4IUP A;  4HAE A;  5CBA E;  4DV7 L;  1EQV A;  5IYC H;  1TT2 A;  1HZC A;  3CC4 A;  4KD4 A;  1I94 Q;  4UHV A;  3OWF A;  2BE5 D;  3PO3 H;  1HZB A;  3S14 H;  3D4D A;  4LF4 Q;  2L12 A;  3D0F A;  3E0E A;  4BA2 I;  3DWA A;  1QUQ A;  4EVO A;  5IOD A;  1U4P A;  3BVG A;  1NMG A;  4S3S A;  5M5W B;  5M3F G;  3O13 A;  3AEV A;  3A56 A;  1HCZ A;  3T1Y L;  1Q8K A;  3U4Z A;  2KOL A;  2DN8 A;  2OTL A;  2PNH A;  4J8Q A;  5KEE A;  1IHZ A;  4IOC A;  4JI5 Q;  3S1M H;  1HNW L;  5G3L F;  1S5C D;  3DWP A;  1WD0 A;  2B2Y A;  3KUP A;  1EFI D;  1VF7 A;  3Q6S A;  4OHJ A;  1JJ2 A;  2HIV A;  1CI3 M;  4J15 A;  1LTG D;  2KHJ A;  1TKW B;  5LL6 S;  2C9O A;  4LUV A;  4MIU A;  1TS5 A;  1E22 A;  1BCP D;  2IX1 A;  1DZ1 A;  1KAB A;  5LMN L;  3DXJ C;  5IT9 c;  3OIQ A;  3NTI A;  4KJO A;  5BN3 A;  5C4X H;  3NUC A;  4PMB A;  3BDO A;  1E2V A;  2PW7 A;  5JVH 3;  2MO0 A;  4IJH A;  4CDD C;  1ET9 A;  3DMU A;  4A3L H;  4JBJ A;  4DAY B;  1HQM C;  4P71 A;  1NCV A;  2D2C C;  3PGZ A;  1PFB A;  5HY6 A;  1SLJ A;  1SYG A;  2HHH Q;  4Z9C B;  1PYS B;  3CRK C;  1KC8 C;  1V1P A;  5HGT A;  1HQR D;  3LX0 A;  4BA1 I;  2JJQ A;  3VDY A;  2VUM H;  4DV3 Q;  1B1Z A;  1VQ7 A;  1B44 D;  4B3T L;  3M4Y A;  3HP3 A;  3NWS A;  1SR3 A;  1KDC A;  1EQQ A;  3CCV A;  1OTC A;  1JJG A;  3OYY A;  3GTO B;  2DY7 A;  3NWT A;  1EQR A;  3JAM E;  1IBL L;  2CCZ A;  2O5I C;  1AZQ A;  1JWM D;  2F0K A;  1R9T H;  3HOV G;  4GN3 B;  1PA6 A;  2GVA A;  3NBH B;  3M4O H;  4ZRZ A;  4X64 L;  4X66 Q;  1XYI A;  1JOK A;  2B8F A;  1K8A C;  3DHQ A;  2SOB A;  3SE0 A;  4J1M A;  1TWH B;  4WJW A;  2K1B A;  2IWH A;  1I94 L;  3I4M G;  1X3P A;  2VB2 X;  2K03 A;  2JA6 G;  2NVY H;  4LF4 L;  4GKK Q;  3AQQ A;  1FGU A;  3S1R B;  4HJ7 A;  5D14 A;  2B2T A;  2F0D A;  2SDF A;  3NE5 B;  3HOW G;  3A0J A;  2B63 G;  4KHZ A;  1EL0 A;  1Y1V B;  3S2D H;  4A3G H;  2Z0S A;  2EYJ A;  2A68 C;  1PTO H;  3PUV A;  1Q12 A;  1MIU A;  3L9A X;  2L55 A;  2DJG C;  1YHB A;  4P2C B;  5BR8 Q;  3D6C A;  4G4K A;  4KY7 A;  4PQX A;  4JI3 Q;  5EBD A;  3CC7 A;  1VQ8 A;  2UXD L;  4GN5 A;  2YYZ A;  2L5T A;  4UP9 A;  4DK0 A;  3S15 B;  1I4H A;  4M8A A;  1EY8 A;  4IUQ A;  3X3M A;  3RZD B;  1HNZ Q;  5E3F A;  2Q2U A;  4K0K Q;  5G3L D;  5IP9 H;  2WII B;  4YWM A;  4OWX B;  4DA2 A;  4DR3 Q;  2Q2I A;  2KVM A;  4RHS A;  2AWN A;  2HQL A;  1XJV A;  2E2J B;  3RLO A;  3ER0 A;  1HTL D;  4HJ5 A;  1W2B A;  3TDQ A;  3IL8 A;  3W1G A;  4DNR B;  5C4X G;  5GAE C;  1I50 B;  1RF2 D;  4O42 A;  4C1N K;  1G2T A;  4BBR B;  3J7A 5;  3H0G B;  3T56 B;  4DV3 L;  1A15 A;  1EIG A;  2XRQ D;  3CU7 A;  4ME3 A;  2VNU D;  2RSN A;  1TS2 A;  1PH6 A;  3PCO B;  3HOX H;  4CJ0 B;  2B2W C;  3GTQ B;  5T1I A;  3KLS X;  4GKJ Q;  1EOT A;  1TWC H;  2JA8 B;  1VF5 C;  1IL2 A;  1I3Q B;  5CC4 A;  1YNJ D;  4NXM Q;  2Q8I B;  2VUM G;  3R93 A;  5C5M A;  2A19 A;  3I4N H;  1AFP A;  1S5E D;  4X66 L;  3HOY H;  1L0X B;  1O80 A;  4TRD A;  1PH4 A;  5A2Q L;  1FL0 A;  3CCM A;  1J9O A;  1I4Q A;  2NYZ D;  5KNC A;  3A5U A;  2Z6B A;  1F2L A;  1DYQ A;  3KLS A;  3L3O C;  1MD2 D;  2UXB Q;  1JJC B;  4GKK L;  4IPD A;  3I8Z A;  2PZU A;  1A0I A;  1O7Y A;  2R7D A;  1B9M A;  1S5D D;  4JV5 Q;  4HIK A;  1PLF A;  4FF3 A;  1ILP A;  4G7O C;  2JE6 I;  2G9H D;  4C2M B;  4HCS A;  4OWT B;  1BCP B;  2HCC A;  4R4O A;  4QJF A;  2EJM A;  2QDB A;  4BXX H;  2K5N A;  1KXL A;  1PRT F;  2E2I B;  1I4P A;  1K8M A;  2WB1 E;  3H6M A;  5C5L A;  3T53 B;  5BR8 L;  3H3V I;  1G6Z A;  2E5L Q;  4ZQ3 A;  2BH2 A;  4JI3 L;  2IHF A;  5GRO A;  4CKB A;  5K36 G;  4UAI A;  4L5R C;  1QG7 A;  3UDX A;  3HOZ H;  1K3R A;  3GTJ H;  1LAB A;  3EVQ A;  3W3A A;  1ML0 D;  4A3G G;  4B3S Q;  1VDZ A;  4K0K L;  4I7A A;  3CP0 A;  3QR8 A;  4FXG C;  1PMR A;  4RGM A;  1VQ4 A;  4DR3 L;  3C46 A;  4A3I H;  1FGB D;  3WOE A;  2WV6 D;  2F0P A;  2YTV A;  1CM9 A;  2R7Z B;  1F9Q A;  1VQI A;  1X32 A;  1IBK Q;  3KYH C;  2BH8 A;  2XRS D;  1PDQ A;  5JPN C;  1SJE D;  1EY4 A;  1O7I A;  1GVP A;  1YIT A;  2NVX B;  5IP9 G;  2R61 A;  1Z7T A;  2WAQ B;  3TS2 A;  3EBE A;  5GAD C;  5C3E B;  3QIA A;  3STB C;  1G6P A;  1Y8N B;  1Q8I A;  3D8G A;  1CQF A;  2RHS B;  2AQ1 B;  2DGY A;  4GKJ L;  1Y1V G;  4FXD A;  1IW7 D;  1Y69 U;  4IJL A;  2A8V A;  1HUN A;  4XT1 B;  2QF7 A;  4NXM L;  1P8L A;  4B9W A;  1V1Q A;  2RDH A;  3F2D A;  1D1K A;  5EGT A;  2Q8R E;  1XXG A;  1CZG A;  1GXD C;  3TSS A;  1NUC A;  1F9S A;  3HOX G;  2ASB A;  3KLW A;  2B39 A;  4JVZ A;  2F1M A;  1N9W A;  2H1E A;  2FFK B;  3ERS X;  2HD3 A;  2MP1 A;  3AFP A;  2X6L A;  4H13 C;  1SBB B;  2UXB L;  3TZU A;  5FLM H;  1PTO C;  3G6J B;  3TEH B;  1II3 A;  1XMO Q;  3KOJ A;  1JOQ A;  1H9S A;  2EY1 A;  3CCR A;  1H9K A;  5EQ0 A;  1MKH A;  1PTO F;  2XIW A;  4IAL A;  1Q7Y C;  1KDB A;  2R92 H;  4JV5 L;  2WB1 G;  2OT2 A;  3I4N G;  4A3C H;  2JP1 A;  3HOY G;  1TWA B;  2X69 A;  2F3W A;  2L15 A;  4QY7 A;  1F2Y A;  2TMP A;  4RKB A;  5FO8 B;  4YIJ A;  1LTA D;  5HUR A;  2E5L L;  4IZ8 A;  4HJ8 A;  1XTD A;  4LF5 L;  4WRD A;  1A6X A;  3M3Y B;  2A6E D;  1SYF A;  4DUY Q;  1JOR A;  2AUK A;  3MXN B;  2GVB A;  2FHT A;  3A74 A;  1LUZ A;  3CCU A;  1M4V A;  3WDN A;  1PXU A;  1QNK A;  1PFM A;  2JA8 G;  4ZUI A;  3HS0 C;  4DV2 Q;  4B3S L;  4A3B H;  1H9M A;  1KIX A;  5CV7 A;  4JBW A;  1L0Y B;  4BXX G;  1WCM H;  1PRT D;  4RWS C;  1VQC A;  3CME A;  1P16 A;  1CKN A;  2XWB B;  4L5T A;  3URY A;  3V05 A;  4POG A;  4DK1 A;  1BDO A;  3GO5 A;  3HOZ G;  2KUM A;  1IBK L;  3A55 A;  3NBI A;  4DXF A;  2NVQ H;  2NN6 I;  1KRS A;  2OXP A;  1SFO H;  1EUJ A;  3SK5 A;  3K81 C;  4LJZ C;  1LT6 D;  3LGJ A;  3J7Z C;  2WIN B;  1TXY A;  4JC0 A;  3OPO A;  2E75 C;  3HEJ A;  3H3V H;  1ENF A;  4HTH A;  3T16 A;  4A3I G;  2D0P A;  3KK7 A;  4A75 A;  3JAM L;  5KRU A;  2C35 B;  3ICE A;  3U4V A;  4IOA A;  4BWG B;  2QKI C;  1BBU A;  4UPA A;  4JBM A;  5NUC A;  5M3F B;  2EYL A;  4LFB Q;  4Q5V A;  1ENA A;  1FYC A;  1SXT A;  1UE6 A;  2AQ2 B;  1SDF A;  3HG9 A;  3NHH A;  1SN8 A;  5KYL A;  2E2H H;  1YNN D;  2VS1 A;  2K4K A;  4RMF A;  1HPC A;  4C3I H;  5C4Z A;  5C44 H;  1XMO L;  2BE5 C;  4NP5 A;  4KY5 A;  2QCP X;  3UDG A;  3UI2 A;  2CQA A;  4C3J H;  1L2F A;  5EPL A;  4AYB B;  4LWC A;  4FF1 A;  1MJC A;  1NY4 A;  3SK6 A;  1K83 H;  1EY7 A;  4OX9 Q;  2FJ2 A;  1R4P B;  3CF5 A;  3A8J E;  4UP7 A;  4EQO A;  3N6R A;  3A7A B;  5C3E G;  2R92 G;  4XTC S;  2JA9 A;  2A69 D;  2EY2 A;  4DUY L;  5I6W A;  1BOS A;  3K59 A;  1YI2 A;  1JC7 A;  4LF8 Q;  1BCP C;  1D5X C;  4X3U A;  4DV2 L;  1NR2 A;  3VR3 A;  2EJF C;  2JA7 H;  1U4M A;  1DOL A;  2HT1 A;  2N78 A;  3LWE A;  4K8J A;  2ES2 A;  3KF6 B;  4XQQ A;  1N34 Q;  4A3F H;  3A8I E;  4V19 0;  2EYM A;  3P7J A;  3U9O A;  5KGU A;  4C1N I;  5ISR A;  1Y1W H;  4PZ6 A;  5LL6 X;  3I73 A;  5I2X A;  1JQY D;  1QWY A;  3HOV B;  1Y8P B;  2K5W A;  3H09 A;  1J5E Q;  3HZX A;  2I0Q A;  4A3B G;  1ZYR D;  4NXN Q;  4TSS A;  4O2D A;  3SGI A;  1C48 A;  3F1Z A;  2ZXO A;  2MPM A;  3NPP A;  3S1N H;  2A6H D;  4JOI C;  4A3K H;  4RGT A;  4KKU A;  5I6Y A;  5DNF A;  2XNA C;  3I4M B;  5ELD A;  3T13 A;  5JEA G;  1HR0 Q;  4C56 C;  5C4J H;  2Q8T A;  3TBI B;  1UAP A;  1XPO A;  1OXS C;  3NEL A;  5I9O A;  5FKA C;  1LTT D;  2VY3 A;  2CH4 A;  3PIP 3;  5JAV A;  1STN A;  3QB3 A;  4JCV E;  2JA5 H;  1K8O A;  1EY5 A;  5BN5 A;  4JI4 Q;  3J7A V;  3ULP A;  2CWA A;  4ZLT F;  4WJ4 A;  4AYB E;  1T5E A;  4WOR A;  3PO3 B;  2LFN A;  1CK1 A;  3S14 B;  3KF8 A;  3MXP A;  4DAV A;  3J80 E;  2KCC A;  1D5M C;  1JE4 A;  2B2U A;  2FMM A;  1JWS D;  1LLR D;  5KIX A;  2NN6 H;  1CKO A;  2F4V Q;  4QB4 A;  2NZ1 D;  3D6W A;  4IPH A;  1TWG H;  4PMC A;  1UWV A;  3TRZ A;  1PZJ D;  2F0T A;  2RCN A;  3BVZ A;  4UY8 C;  3S1M B;  4A3E H;  3CCQ A;  2YU9 H;  4BY7 H;  5CMD A;  1AE2 A;  1EYC A;  1HR0 W;  2VXW A;  4HCE A;  3RN2 A;  2GA4 B;  4C3I G;  5C44 G;  3QO2 A;  2PQA A;  3ULJ A;  4OX9 L;  2F0J A;  3D3R A;  3PUX A;  1SNC A;  3OMG A;  1VCI A;  3CPW A;  1CUK A;  4RCN A;  3GTL H;  2K04 A;  5M3M G;  1HFN A;  1Y14 B;  1PRT B;  5C4X B;  2MHV A;  1IL8 A;  1B53 A;  1OXV A;  4RA8 A;  2EY5 A;  1SRU A;  4C3J G;  1LT4 D;  4IUR A;  4LF8 L;  1C7Y A;  2C5C A;  5M5Y H;  2EXD A;  3BZD B;  1N34 L;  3A7L A;  1DGS A;  1YHA A;  3H3V C;  4C3H H;  4L8J A;  5IGE A;  3S16 H;  3GTG H;  4H0L C;  5EPK A;  3GTM H;  3OOC A;  3VYS A;  3AU7 A;  2LY7 A;  4ZAI A;  2Z6K C;  4DV0 Q;  3BZK A;  4QL5 A;  4H44 C;  1WOC A;  2J7Z A;  1ICW A;  1N36 Q;  1STG A;  1JOO A;  2F4I A;  1J5E L;  4JYA Q;  1LT5 D;  1ILQ A;  2VUM B;  5FLX E;  5JVG 3;  2JA7 G;  4NXN L;  3ZJY C;  2F52 A;  1B50 A;  2N88 A;  3HKZ E;  4POF A;  2L9H A;  5M5X H;  4UP8 A;  1ZEQ X;  1TR5 A;  2B2W A;  3IFT A;  2SEB D;  1D7Q A;  1R9T B;  1SAP A;  3P75 A;  2Z4I A;  1HR0 L;  4AYB G;  1ZXT A;  2J0T D;  1K73 C;  2K05 A;  2KEC A;  5FK9 C;  4E6I A;  3OW7 A;  3M4O B;  2XTI A;  3MA2 B;  1KHI A;  4KN7 C;  4DR4 Q;  3SK8 A;  1PHJ A;  3FVQ A;  4MNO A;  5CBE E;  4R8I A;  4JI4 L;  3RLF A;  1BO0 A;  1YNJ C;  2EVB A;  3TP8 A;  3DM1 A;  1V1O A;  2ZTD A;  2EXZ A;  1U4R A;  2NVY B;  3BDC A;  4ALP A;  2XWJ B;  4P74 A;  1NSN S;  5CV9 A;  3FRP B;  4BBS H;  1NMF A;  1KAW A;  2F4V L;  4Y7N H;  3OIP A;  4EQP A;  2JA5 G;  4BS9 A;  1B3Q A;  4CDC C;  1EYD A;  3R2T A;  4YHH Q;  3S2D B;  2OF1 A;  2I5H A;  1D8L A;  2R6G A;  1BVS A;  1YJN A;  4A3G B;  5J1Z A;  3BG3 A;  2EYF A;  3Q23 A;  5IGF A;  2WAC A;  3KBX A;  1PTO B;  3J7A F;  4R1J A;  3X3N A;  2WFW A;  3KFU A;  4HMJ A;  3C1E A;  2XN9 C;  4DV6 Q;  1CFM A;  1WI5 A;  3QJY A;  5F2D A;  1M8A A;  1SJH D;  4A76 A;  3EN2 A;  1VS0 A;  1GUN A;  5EKI A;  2Z9H A;  1J8I A;  3QOL A;  4K5X A;  4JK1 C;  1AN8 A;  1OO9 B;  1BUV T;  2JXM B;  3L0O A;  5D3D A;  5DAU A;  1BF4 A;  4X6A H;  5HGQ A;  3S1Q H;  1RJT A;  2OEO A;  1SNO A;  3PIO A;  1E24 A;  3NK9 A;  3EA6 A;  4NW2 A;  1UEB A;  3RR5 A;  1QVC A;  5IYC G;  1SMX A;  3V2T A;  2CW0 D;  3HKZ G;  4JI5 L;  4DV0 L;  2NZO A;  1HHV A;  4K14 A;  2V4D A;  3IFD A;  3PO3 G;  1N36 L;  4JYA L;  3GTK H;  2ICI A;  1XPU A;  1C4Q A;  1LTI D;  1GUG A;  2F0G A;  3MC0 B;  3K5O A;  5IYD H;  4HIO A;  2F3V A;  1HNX Q;  3HOX B;  1LTR D;  1K9M C;  1EYA A;  1TWC B;  2EYP A;  5H1S E;  4DAY A;  1STE A;  3MFG A;  1VQE A;  4IUU A;  3I4L A;  1TY2 A;  2KCN A;  2R7F A;  3T1H Q;  1Q82 C;  1DXM A;  1QOH A;  5EBC A;  2K75 A;  3AB9 A;  1RTO A;  1X3Q A;  1QVF A;  2OTJ A;  4A3J H;  2WB1 B;  3I4N B;  3H15 A;  1CZW A;  4DU9 A;  1IW7 C;  4QUF A;  3HOY B;  4DR4 L;  1C9O A;  3FKI H;  1Q86 C;  4LF6 Q;  1EEI D;  2WKD A;  3NP8 A;  3MTS A;  1CTM A;  1TWH H;  2HHH L;  2XGT A;  3G6E A;  2F0I A;  1XNQ Q;  3DM3 A;  3KDF B;  1WFQ A;  3S2H H;  2QGQ A;  4ZCK A;  2F0N A;  5ELN A;  4DR7 Q;  4XT3 B;  2AHO B;  1TII D;  1X55 A;  2MQH A;  4QIW E;  4A3L G;  1Q1E A;  1AZP A;  3A8K E;  5ELF A;  1GD7 A;  2K7V A;  4JG2 A;  3NBH A;  1X3G A;  4YHH L;  3HOU H;  2F0L A;  2UUC Q;  2BCO A;  1A62 A;  1SE3 A;  2PQE A;  4HID A;  1U0L A;  2B8G A;  1ENC A;  1Z6H A;  3SXH A;  5IOC A;  1EZ8 A;  4IFD I;  4DV6 L;  4G7Z C;  4QGU A;  4RH6 A;  4KKT A;  3PV0 A;  4DV1 Q;  4IQZ A;  1YJW A;  3HOZ B;  3BZC A;  3GTJ B;  2VQF Q;  1VMP A;  4OGQ C;  5IE8 A;  2A6E C;  3HFZ B;  4KJN A;  2Q2T A;  1GO3 E;  2K5D A;  1RIP A;  2JQO A;  2PCF B;  2ICE C;  1L1O B;  5C0X J;  4A3I B;  3D4R A;  1NAP A;  4QF4 A;  3ULL A;  1A2T A;  4LK1 C;  2BDN A;  2M00 A;  1PRT C;  1HJP A;  1BBW A;  2NVT H;  4B3R Q;  2LKV A;  4LUO A;  1NNX A;  3WOF A;  2JEB I;  4FO2 A;  2B3G A;  2MJ8 A;  5IGC A;  4JI6 Q;  4P73 A;  4KHV A;  1GHK A;  3UE1 A;  5FJ8 H;  1HNX L;  2XVS A;  5CV5 A;  2NTT A;  2N3S A;  3TP7 A;  1PVO A;  2F0M A;  1SEB D;  4A3M H;  1HNZ L;  3CD6 A;  2K5Q A;  4B9X A;  4LF7 Q;  3E0J A;  2VZA A;  1BBX C;  2UUA Q;  3J7Y W;  4KN4 C;  3MXU A;  2OQ0 A;  1HA6 A;  5IYD G;  3J81 E;  2RKS A;  4X3K A;  5IYB H;  2EIF A;  3LNN A;  4NPS A;  3PQI A;  3J80 L;  4DR1 Q;  2D5D A;  4O0A A;  2MGS A;  1IYU A;  1I6H H;  1AE3 A;  1CHP D;  4DR7 L;  3QWN A;  4XQN A;  5ELE A;  4PZ7 A;  2R92 B;  4N9P A;  4A3J G;  2Z4H A;  1YNN C;  4JW0 A;  3OSO A;  4GOP B;  5LMU Q;  3FKI G;  3I7F A;  1UE5 A;  1AEX A;  3V96 A;  3K5N A;  3TN2 A;  2UUC L;  3PMF A;  2KJX A;  4MTN A;  2NWG A;  4MZ9 A;  3CAM A;  4DR5 Q;  1UEA B;  1XNR Q;  2UXC Q;  1X9N A;  4GN4 B;  1EQT A;  1FNV A;  1WTR A;  4HR7 B;  2R93 H;  1BQQ T;  1AW7 A;  4DV1 L;  4EQ5 A;  3CQZ H;  5E7N A;  4DFA A;  4K2K A;  1XPR A;  2VQF L;  4LW1 A;  2BA0 A;  4XYQ A;  2JN4 A;  4A3B B;  1O78 A;  3BS1 A;  1ICF B;  4L5S A;  3S9W A;  1WCM B;  2A69 C;  1CSQ A;  3I4O A;  2O4X A;  3NSW A;  4KMU C;  2WP8 J;  1GHJ A;  3CXC A;  4LAA A;  4H7B A;  1A63 A;  2ZM6 Q;  3TS0 A;  1EIF A;  2NBF A;  4QQB X;  2NVQ B;  4B3R L;  1UE1 A;  1SFO B;  5ELB A;  2KED A;  4RCO A;  1I4R A;  5FLX L;  4FVM A;  1GUW A;  2PI2 A;  1VQD A;  1CHQ D;  4JI6 L;  4Q0F A;  3JAM c;  1SE4 A;  1SMY D;  1WJJ A;  1PZK D;  3GQB A;  3T51 B;  3RZO H;  2P5Z X;  1DM0 B;  1ZYR C;  1IBM Q;  4LMQ D;  1SE8 A;  4IFD H;  4JI1 Q;  4JOI A;  4OEL B;  1WD1 A;  3PIO 3;  2A6H C;  5E4W C;  2L4N A;  1VQF A;  4LF7 L;  5IT9 E;  1FNU A;  1SNP A;  1EY6 A;  4M1U B;  3OWE B;  1WVL A;  1CA6 A;  1H95 A;  4KTA A;  4NB3 A;  4ZYS A;  5FJ8 G;  1LTB D;  5J39 A;  3S24 A;  2J4X A;  3FPP A;  2E2H B;  2L1B A;  2LXK A;  2F0V A;  4MN3 A;  3D31 A;  1KQS A;  1SYC A;  4A3M G;  4DR1 L;  3KJP A;  4C3I B;  5C44 B;  3KJO A;  3CMA A;  1KD1 C;  3MAQ A;  1N33 Q;  1JB3 A;  2HDL A;  2K5H A;  5CV8 A;  4HIM A;  1PH5 A;  3JC6 6;  3L2P A;  3BVM A;  3CCJ A;  1B7Y B;  2Y0S E;  5M3M B;  3JAM i;  1IKL A;  2Z8L A;  4EQN A;  3S17 H;  4ULL A;  4R9W A;  3T4A C;  4C3J B;  5IYB G;  1MSG A;  2OCE A;  3E3X A;  1FJG Q;  2Q2H A;  2K14 A;  5C3W A;  4KY6 A;  1RTN A;  1KLU D;  4DR5 L;  1GUO A;  5IGG A;  4OO1 I;  3DEO A;  2F0O A;  3R8B A;  1XNR L;  2UXC L;  1MGS A;  1WYD A;  5JJL A;  3D4W A;  1OXT A;  4X65 Q;  5T1G A;  4CJ1 B;  3IRB A;  2LMC B;  5J22 A;  2PO4 A;  4R8N A;  2JA7 B;  2RCF A;  2KEE A; 
#chains in the Genus database with same CATH homology
 1LM0 A;  1Y14 B;  5FLX c;  3AYH B;  1OXV A;  4C2M H;  4JI3 Q;  1SRU A;  3EIV A;  4DV5 Q;  4PZ8 A;  4GNX B;  3CC7 A;  1VQ8 A;  2K5V A;  3PIP A;  2FXQ A;  2ID0 A;  4GN5 A;  1C7Y A;  2YYZ A;  4JI2 Q;  5M5Y H;  2R93 G;  2NZH A;  4DR6 L;  2EXD A;  2ZM6 L;  4UP9 A;  2ATW A;  2E2I H;  1CKN B;  2N49 A;  1N34 L;  1YVC A;  1DGS A;  1E3P A;  5C0X I;  1QVG A;  1HNZ Q;  4LFC Q;  1YHA A;  2Q2U A;  4K0K Q;  4C3H H;  2UXD Q;  5IP9 H;  1L1O A;  3S16 H;  5FLM G;  3GTG H;  3GTM H;  4YWM A;  4OWX B;  4R4T A;  3HOU G;  1X3E A;  1VQK A;  4KHP Q;  2Z6K C;  4DV0 Q;  3BZK A;  3Q8D A;  5IWA Q;  2Q2I A;  1L1O C;  4QL5 A;  4DR3 Q;  1WOC A;  1EYG A;  2AWN A;  2HQL A;  1N36 Q;  1M90 C;  1J5E L;  4PMW A;  4IPC A;  1XJV A;  1PYB A;  4JYA Q;  4A3C G;  2PMZ E;  3RLO A;  3ER0 A;  1IBM L;  2JA7 G;  1Q81 C;  4NXN L;  4JI1 L;  3RNU A;  3ZJY C;  2F52 A;  5ELO A;  4HJ5 A;  3W1G A;  2ZJR A;  1W2B A;  1S40 A;  5C4X G;  1K0R A;  3PUZ A;  3K7A H;  3HKZ E;  2ZTC A;  5GAE C;  4LF9 Q;  5DLQ E;  4POF A;  5EAY A;  5M5X H;  2UUB Q;  4X62 Q;  4UP8 A;  2R7Z H;  3J7A 5;  2JK8 A;  3K0X A;  4DR2 Q;  4DV3 L;  2B29 A;  4ME3 A;  1D7Q A;  1EWI A;  2VNU D;  4YCV A;  1PH6 A;  2K50 A;  1HR0 L;  3PCO B;  4AYB G;  3HOX H;  1EIY B;  4DV7 Q;  3WWV A;  2NVX H;  2VL6 A;  4IFD G;  4GKJ Q;  1K73 C;  1TWC H;  1G51 A;  1VQL A;  4AQY Q;  1IL2 A;  2Y0S G;  2XTI A;  2ZJP A;  1KHI A;  5C3E H;  4DR4 Q;  2RF4 A;  1PHJ A;  4JI4 L;  2H5X A;  4MNO A;  3RLF A;  3GTP H;  4OON A;  2PI2 E;  4NXM Q;  2VQE L;  2KEN A;  1N32 L;  1WCM G;  2VUM G;  4DAM A;  4BY1 H;  4DV4 Q;  2ZTD A;  1VQO A;  4A3D H;  1NBW A;  2A19 A;  4A93 H;  3J81 j;  3F2B A;  4ALP A;  3PUW A;  1EFW A;  4P74 A;  3I4N H;  1VQG A;  3B6Y A;  4X66 L;  3UDF A;  3T1Y Q;  1VQA A;  1K8G A;  3HOY H;  4BBS H;  2AMC B;  1TWF H;  1PH4 A;  1NMF A;  1FL0 A;  1KAW A;  1Z47 A;  3CCM A;  2UUA L;  2F4V L;  4HJ9 A;  4Y7N H;  4BBR G;  3A5U A;  3H0G G;  4B3M L;  1QUQ B;  2JA5 G;  4DKA C;  2MO1 A;  2UXB Q;  1JJC B;  3F2C A;  4GKK L;  4YHH Q;  2KCM A;  1Q46 A;  3F8T A;  4IPD A;  2I5H A;  1D8L A;  2R6G A;  1BVS A;  1YJN A;  1IZ6 A;  5AJ3 Q;  1A0I A;  3I56 A;  2R7D A;  4XIG S;  4GOP A;  4LFB L;  4JV5 Q;  4HIK A;  2WAQ E;  1PV4 A;  4R1J A;  2WFW A;  3KFU A;  2IT1 A;  4GOP C;  4X65 L;  2JE6 I;  2E8G A;  4JI8 L;  4DV6 Q;  1LTL A;  4OWT B;  2DUD A;  2YV5 A;  4AIM A;  1WI5 A;  1KRT A;  4R4O A;  1IXR A;  4QJF A;  1PH8 A;  1X6O A;  4BXX H;  2K5N A;  1KXL A;  1YBY A;  1VQ9 A;  5LMU L;  2WB1 E;  2YTX A;  4KLK A;  3EN2 A;  5BR8 L;  1VS0 A;  4A76 A;  2E5L Q;  3H3V I;  1TWA H;  4YCU A;  3OTO Q;  2BH2 A;  4JI3 L;  1EOV A;  4DV5 L;  2IHF A;  5GRO A;  5K36 G;  4L5R C;  3UDX A;  3K80 C;  3HOZ H;  3L0O A;  3E9I A;  1IYJ B;  1K3R A;  3GTJ H;  2JEA I;  1W3S A;  1OXU A;  4X6A H;  1L0W A;  5HGQ A;  3S1Q H;  4LFC L;  1S3O A;  4A3G G;  4B3S Q;  4K0K L;  3PIO A;  1E24 A;  3M3Y H;  3CP0 A;  2OWO A;  2D0O A;  1UEB A;  3PUY A;  3RR5 A;  1QVC A;  5IYC G;  5GAH C;  1SMX A;  1B8A A;  4H02 A;  1VQ4 A;  3HKZ G;  1PH1 A;  4KHP L;  4JI5 L;  4DV0 L;  2NZO A;  5IWA L;  4DR3 L;  1Z9F A;  4PG3 A;  1VQN A;  3PO3 G;  4A3I H;  2EQS A;  1N36 L;  4OXP A;  4JYA L;  3KF6 A;  3GTK H;  2YTV A;  1YNX A;  3OW2 A;  1XPU A;  2BA1 A;  1VQI A;  1IBK Q;  3E9H A;  3KYH C;  2BH8 A;  2JA6 H;  4GLV B;  5IYD H;  3GD7 A;  1OXX K;  4LFA Q;  4HIO A;  1HNX Q;  1O7I A;  4LF9 L;  1GVP A;  1YIT A;  4OWW B;  1K9M C;  2UUB L;  5IP9 G;  1VQ5 A;  5H1S E;  1PFS A;  4GLX A;  4YY3 Q;  3HOW H;  3M4P A;  3NEM A;  3TS2 A;  3EBE A;  1JE5 A;  1YHQ A;  1G29 1;  5GAD C;  2QA4 A;  4DR2 L;  4LNQ A;  2B63 H;  3STB D;  3STB C;  1VQ6 A;  1VQE A;  1G6P A;  1CSP A;  2Z6K A;  3RN5 A;  1KL9 A;  1X54 A;  3CW2 C;  2I5L X;  3G48 A;  2R7F A;  1YZ6 A;  2RHS B;  3T1H Q;  1Q82 C;  2DGY A;  3M4Q A;  4GKJ L;  2K75 A;  1Y1V G;  2CQO A;  1QVF A;  2MNA A;  4AQY L;  4A3J H;  3PF4 A;  1VQP A;  2OTJ A;  1HZ9 A;  3H15 A;  2LXJ A;  4IO9 A;  4R4I A;  3FP9 A;  4IJL A;  3CCE A;  2A8V A;  4DR4 L;  1C9O A;  3UE0 A;  5JEA J;  3FKI H;  5M3M H;  1Q86 C;  4LF6 Q;  1JT8 A;  2KBN A;  1X3F A;  3KF8 B;  1A8V A;  4IPG A;  1P8L A;  4YWK A;  2V1C C;  4DK3 C;  4NXM L;  4Y52 H;  1TWH H;  1V1Q A;  2XGT A;  3G6E A;  3F2D A;  2HHH L;  4DV4 L;  2R7Z G;  4A3F G;  1XNQ Q;  3DM3 A;  3AFQ A;  1U5K A;  3KDF B;  1WFQ A;  3M9B A;  3RLN A;  4JBK A;  2QGQ A;  3M85 A;  3S2H H;  1RL2 A;  4P75 A;  1MJE A;  3HOX G;  5ELN A;  3KLW A;  1VQM A;  2ASB A;  4DR7 Q;  2AHO B;  1N9W A;  1Y1W G;  1X55 A;  4L5Q A;  2MQH A;  4QIW E;  3ERS X;  2MFI A;  4A3L G;  2WAQ G;  3AFP A;  1PH9 A;  5M3F H;  1Q1E A;  1AH9 A;  2ZTE A;  2UXB L;  1GD7 A;  1NE3 A;  2CKZ B;  4JG2 A;  3TEH B;  5FLM H;  3PO2 H;  1X3G A;  4YHH L;  1XMO Q;  1ASZ A;  1X56 A;  3HOU H;  2CWP A;  3KOJ A;  3CCR A;  2UUC Q;  5AJ3 L;  4BY1 G;  2QEX A;  1A62 A;  1MKH A;  4A3D G;  1GKH A;  1Q7Y C;  2R92 H;  2PQA B;  4HID A;  1U0L A;  2WB1 G;  4YCW A;  3I4N G;  4A3K G;  4A3C H;  4JV5 L;  4A93 G;  1N33 L;  3HOY G;  2I5M X;  3U58 A;  1V9P A;  1T9H A;  4IFD I;  4DV6 L;  4QGU A;  4GLA C;  3TQY A;  3CPF A;  2KHI A;  2L15 A;  4QY7 A;  3PV0 A;  4DV1 Q;  1YJW A;  3BZC A;  4DUZ Q;  1V43 A;  2AWO A;  2E5L L;  2VQF Q;  1HNW Q;  4HJ8 A;  2UU9 Q;  1VQB A;  1XTD A;  3OTO L;  4LF5 L;  1FJG L;  3L7Z C;  5IE8 A;  1C0A A;  5M5W H;  2LSS A;  3HFZ B;  2Q2T A;  1GO3 E;  4DUY Q;  2VW9 A;  1Q1B A;  1BKB A;  1RIP A;  3MXN B;  2GVB A;  3A74 A;  3CCU A;  1LUZ A;  2JQO A;  1L1O B;  2OQK A;  5C0X J;  2JA8 G;  3ULL A;  1YJ9 A;  3K7U C;  4DV2 Q;  4B3S L;  4A3B H;  1KIX A;  1PH2 A;  5LMN Q;  4JBW A;  1SRO A;  4BXX G;  3DLL A;  3TRE A;  1WCM H;  4GNX A;  1XMQ Q;  3G4S A;  1HJP A;  1BBW A;  2NVT H;  2NN6 G;  4B3R Q;  2F3I A;  4LUO A;  1VQC A;  3CME A;  2HIX A;  4KI0 A;  4GNX C;  1I5F A;  1P16 A;  1CKN A;  2JEB I;  4L5T A;  1QZG A;  4P72 A;  4POG A;  4FDB A;  4DPG A;  3J81 c;  3GO5 A;  1JB7 A;  2B3G A;  4JI6 Q;  3HOZ G;  1VQH A;  1IBK L;  1E7Z A;  4P73 A;  4A3E G;  1VQJ A;  3UE1 A;  2NVQ H;  4BY7 G;  2NN6 I;  1KRS A;  5FJ8 H;  1SFO H;  4LFA L;  1EUJ A;  1HNX L;  3G71 A;  4JI2 L;  1NJI C;  2N3S A;  3K81 C;  1PVO A;  4YWL A;  3LGJ A;  2CFM A;  4JI7 Q;  3J7Z C;  1TXY A;  4YY3 L;  3I55 A;  2ALY B;  4JC0 A;  4DNI A;  4A3M H;  4AH6 A;  1HNZ L;  3CD6 A;  3HOV H;  3H3V H;  4A3I G;  4LF7 Q;  4OO1 G;  2D0P A;  2VZA A;  4A75 A;  1HZA A;  2YTY A;  1N8R C;  3PSI A;  2UUA Q;  4B3T Q;  2C35 B;  5IP7 H;  2OQ0 A;  3PF5 A;  3ICE A;  3U4V A;  3K8A A;  5IYD G;  4IOA A;  2IHE A;  2K52 A;  5LMN W;  5IY0 A;  1BBU A;  5IYB H;  2EIF A;  4UPA A;  1IBL Q;  2N8N A;  4NPS A;  4IFD J;  4JBM A;  3I4M H;  2AKW B;  4TVA B;  4LFB Q;  4DR1 Q;  3W5O A;  4LUZ A;  4O0A A;  1UE6 A;  1LYL A;  5GQO A;  4X62 L;  1I6H H;  2IX0 A;  1AE3 A;  1PH3 A;  4DR7 L;  3U50 C;  1PH7 A;  3FHW A;  1SN8 A;  4PZ7 A;  3GTO H;  3J81 i;  2E2H H;  1HH2 P;  4A3J G;  4X64 Q;  2IY5 B;  2VS1 A;  2K4K A;  4RMF A;  4GOP B;  4C3I H;  5LMU Q;  4DV7 L;  5C44 H;  3FKI G;  3A5Z B;  3I7F A;  5IYC H;  1UE5 A;  1XMO L;  1HZC A;  3CC4 A;  5C0X G;  1I94 Q;  2UUC L;  3PO3 H;  1HZB A;  3S14 H;  2D62 A;  4MTN A;  3HKS A;  3CCS A;  4LF4 Q;  3D0F A;  4MZ9 A;  3E0E A;  3CAM A;  4DR5 Q;  3UDG A;  4BA2 I;  1XNR Q;  2UXC Q;  1X9N A;  1QUQ A;  4GN4 B;  5M3M G;  4C3J H;  1L2F A;  1NMG A;  2R93 H;  4JI0 Q;  5M3F G;  4LWC A;  4DV1 L;  3BU2 A;  4EQ5 A;  3AEV A;  1MJC A;  3CQZ H;  5E7N A;  4HJA A;  3T1Y L;  1K83 H;  3PO2 G;  1Q8K A;  3U4Z A;  4DUZ L;  3S1R H;  1E1T A;  3W1B A;  4OX9 Q;  1XPR A;  2OTL A;  2PNH A;  2VQF L;  3CF5 A;  4IOC A;  4LW1 A;  2UU9 L;  2BA0 A;  4JI5 Q;  3S1M H;  1HNW L;  4UP7 A;  5C3E G;  4L5S A;  2R92 G;  4XTC S;  2JA9 A;  4DUY L;  1JJ2 A;  2HIV A;  1CSQ A;  3I4O A;  1Y1V H;  4J15 A;  2KHJ A;  1YI2 A;  1B70 B;  2A1A A;  4LUV A;  2IX1 A;  1E22 A;  2WP8 J;  4LF8 Q;  3CXC A;  4DV2 L;  4DR6 Q;  5JJI A;  2JA7 H;  5LMN L;  1A63 A;  2ZM6 Q;  2HT1 A;  3BJU A;  5IT9 c;  1EIF A;  2N78 A;  3TS0 A;  1XMQ L;  4BBS G;  1X65 A;  5C4X H;  2ES2 A;  3KF6 B;  1N34 Q;  1JMC A;  4A3F H;  2ZJQ A;  1UE1 A;  4B3R L;  4QQB X;  2RHQ B;  4LF8 L;  3I2Z A;  1YEZ A;  4GS3 A;  2PI2 A;  1VQD A;  1Y1W H;  2MO0 A;  4IJH A;  4PZ6 A;  4JI6 L;  3S15 H;  4A3L H;  3JAM c;  1WJJ A;  4JBJ A;  3RZO H;  4DAY B;  4P71 A;  1J5E Q;  4WJ3 M;  3RZD H;  2I0Q A;  3PGZ A;  4A3B G;  1IBM Q;  4RG1 A;  1SE8 A;  1SLJ A;  5HY6 A;  4NXN Q;  4JI1 Q;  2GN5 A;  4JOI A;  4O2D A;  3SGI A;  4JI7 L;  2HHH Q;  3F1Z A;  1E1O A;  4R4C A;  1PYS B;  5JJK A;  3S1N H;  1KC8 C;  4JOI C;  4A3K H;  1VQF A;  4LF7 L;  4BA1 I;  1UE7 A;  3J80 c;  2JJQ A;  2E2J H;  3VDY A;  2VUM H;  3CCL A;  3M7N A;  4DV3 Q;  3CC2 A;  1VQ7 A;  3MEF A;  4B3T L;  1H95 A;  4NB3 A;  4R4Q A;  4TQU S;  5JEA G;  1HR0 Q;  3UDI A;  5FJ8 G;  1SR3 A;  5C4J H;  1EQQ A;  3CCV A;  3S24 A;  1I50 H;  1OXS C;  1XPO A;  1OTC A;  3NEL A;  3OYY A;  1JJG A;  4EX5 A;  1S72 A;  2VY3 A;  1IBL L;  1EQR A;  2LXK A;  4BBR H;  2CCZ A;  3D31 A;  3H0G H;  1KQS A;  4JCV E;  2JA5 H;  4A3M G;  4DR1 L;  3KJP A;  4JI4 Q;  1R9T H;  3HOV G;  4GN3 B;  2UXD L;  1PA6 A;  3KJO A;  3CMA A;  2CWA A;  3ULP A;  1NTG A;  1KD1 C;  1N33 Q;  1J6Q A;  2GVA A;  5GAG C;  2VQE Q;  4WJ4 A;  2K5H A;  4AYB E;  1N32 Q;  3GTQ H;  2JA8 H;  4HIM A;  1PH5 A;  3NBH B;  3JC6 6;  5IP7 G;  3L2P A;  3M4O H;  3CCJ A;  4X64 L;  1B7Y B;  2Y0S E;  4APV A;  4X66 Q;  3JAM i;  1K8A C;  1I3Q H;  3S17 H;  3T1H L;  1CKM A;  3KDF A;  5J3B A;  5IYB G;  2F4V Q;  1CKO A;  2OCE A;  1I94 L;  1GM5 A;  3I4M G;  4LF5 Q;  1FJG Q;  2Q2H A;  4B3M Q;  2JA6 G;  2K14 A;  1QZH A;  4IPH A;  3NEN A;  2NVY H;  1TWG H;  4LF4 L;  3AQQ A;  2KCT A;  1FGU A;  1UWV A;  4DR5 L;  3TRZ A;  4LF6 L;  4GKK Q;  4OO1 I;  4HJ7 A;  2RCN A;  1XNR L;  2UXC L;  4UY8 C;  3HOW G;  3J80 i;  4A3E H;  3CCQ A;  2YU9 H;  3A0J A;  1WYD A;  4BY7 H;  1M1K C;  2B63 G;  5JJL A;  1XNQ L;  1ASY A;  1AE2 A;  4JI0 L;  4DK6 C;  1HR0 W;  3RN2 A;  1FVI A;  4KHZ A;  1OXT A;  4X65 Q;  1YIJ A;  5C44 G;  3IRB A;  2PQA A;  4JI8 Q;  3ULJ A;  4OX9 L;  3S2D H;  3GDE A;  4A4I A;  3PUX A;  4A3G H;  2Z0S A;  1VCI A;  3CPW A;  1NY4 A;  1CUK A;  3PUV A;  1Q12 A;  1MIU A;  3GTL H;  5BR8 Q;  1YHB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...