3CQZH

Crystal structure of 10 subunit rna polymerase ii in complex with the inhibitor alpha-amanitin
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
145
structure length
116
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKVYYSFGGLLMRLEENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/toxin
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title The RNA Polymerase II Trigger Loop Functions in Substrate Selection and is Directly Targeted by Alpha-Amanitin.
pubmed doi rcsb
total genus 18
structure length 116
sequence length 145
ec nomenclature
pdb deposition date 2008-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3cqzH00
3EBEA 2ASBA 1PH2A 1JJCB 3PCOB 4A3CG 1B70B 3E9HA 1YJNA 2BA1A 1IBLQ 3H0GH 4C3JH 4JYAL 3HOVG 1UE1A 4GN5A 4JCVE 2YTXA 3NEMA 3FP9A 1HZAA 4GLVB 1KQSA 4PMWA 4DV0Q 3CAMA 3DM3A 4P71A 1E1OA 2B29A 4BBSG 2HHHQ 4DV6Q 2K5VA 1VQPA 1EYGA 4JI3L 4A3EH 3S2DH 2EIFA 3MXNB 1YHBA 4A4IA 4LF8Q 2N8NA 4NB3A 2UU9Q 1VQEA 2B3GA 1JJGA 2OWOA 3EIVA 4Y7NH 3J81i 4WJ3M 5JJKA 5LMUQ 3I4MH 2LXKA 4AYBG 2GN5A 2H5XA 2JEBI 3BZKA 4C3HH 4X65L 1Y1WG 2B63H 4A93G 1SLJA 2Z6KC 2DGYA 3OW2A 1VQMA 4DAYB 2LSSA 2JEAI 3ULJA 1GVPA 4X64Q 3H3VH 1X3FA 4DR6L 4PZ8A 1VQIA 4GNXA 3K7AH 2VQFL 2JA7G 1PH3A 1FVIA 4A3KG 1OXSC 4H02A 3PO2H 1RIPA 2UXBQ 5JJLA 4A3CH 2R7ZG 3S14H 1YBYA 1MJCA 3HOVH 4OX9L 1J5EQ 4K0KL 4KHPQ 4DR1Q 4PZ6A 2ZM6L 2PQAA 1VQNA 3FKIH 5M5XH 2Y0SG 1N36Q 3CD6A 1U0LA 3HOUG 4A3LG 2JA5G 4APVA 4R4TA 4B3RL 4JI0L 2NN6I 2ID0A 3MEFA 3TREA 1U5KA 1UE5A 1QVGA 2NVTH 2E2IH 3A74A 2HT1A 2K52A 3Q8DA 1K9MC 4DV4L 3S1RH 4AYBE 1PVOA 1X56A 1NJIC 4BY7G 1X3GA 4DV2L 5EAYA 4C3IH 4OX9Q 4DK3C 5C44H 5C4JH 2ZJPA 4HJ8A 2HIXA 4B3MQ 4K0KQ 2E2HH 2XGTA 3A5ZB 4JC0A 2KENA 2A1AA 1HZ9A 2IHEA 2MNAA 5IYBG 4JV5Q 5JJIA 4PZ7A 1TWAH 3M4PA 1ASZA 1UWVA 1XJVA 4B3TL 5IYCG 3U4VA 2E5LL 1P8LA 1I5FA 2KHJA 4DR4Q 3F2BA 3PO2G 3TS0A 3CQZH 3K81C 4R4IA 1Q86C 3JAMc 5C0XJ 3J81j 4LW1A 1PV4A 3HOWG 1D8LA 3AYHB 4A3KH 2OTJA 4GNXB 1QZGA 2DUDA 1NMGA 3G4SA 4A3FH 2EQSA 2GVBA 3PUWA 4TVAB 4RG1A 2R93G 4GNXC 2KHIA 4DNIA 2ZTEA 2D62A 4X62L 2Q2IA 4ME3A 2Y0SE 4KHZA 1IBML 5FJ8G 3KJOA 1E24A 3UDIA 3T1HL 2K4KA 2RHSB 4NXML 3I56A 3HOYH 1IBKL 3GTQH 1M90C 4B3TQ 2PQAB 2UXDL 3I4NH 4XIGS 2UUCL 4EX5A 3HOUH 3RN5A 2BH2A 1EFWA 4BXXG 4DR3Q 1CKOA 4IPHA 4LWCA 2JK8A 1GM5A 2CQOA 2MO1A 3S17H 1UE7A 2Q2UA 3CF5A 3OTOQ 1SROA 2NZOA 4NXNQ 4BY7H 2JE6I 1B7YB 1TWFH 1YZ6A 3HOXH 4A3JG 1HNWQ 1K83H 4GLAC 4IPDA 3J7A5 2IX0A 2QGQA 4LF5Q 5IYBH 4QJFA 1VS0A 1WOCA 3PUZA 1HNZQ 4JI5Q 4P74A 4A3MG 5IYCH 3CCUA 2L15A 1SFOH 2AMCB 4GN3B 1IBLL 1HNXQ 3J81c 5GAGC 4MNOA 1QUQA 2BA0A 2K5NA 3HOWH 4DV0L 4IPCA 3D31A 4YCWA 1VQ5A 4GKJQ 2R93H 1Q1BA 5M5YH 2CCZA 2HHHL 1SRUA 4DV6L 4A75A 2PI2E 1Y1VH 3W5OA 3CC4A 4DUZL 1E7ZA 1SMXA 4UY8C 5J3BA 2WFWA 3VDYA 2WAQE 1L2FA 2YTYA 3T1YQ 1IL2A 4WJ4A 5HY6A 1YHQA 1HR0Q 1K3RA 1VQHA 2K14A 1S3OA 1WYDA 3ICEA 3RLFA 4XTCS 2I5HA 2ZJQA 1BVSA 3RNUA 1EUJA 3HKZE 5LMUL 3PO3G 3H3VI 2JJQA 2E8GA 4LF9Q 4AIMA 3GTGH 1PYBA 3S1NH 4ALPA 5FLMG 2KBNA 4IOCA 2UUAQ 1Z47A 2RHQB 3IRBA 1XNQQ 1PA6A 1HJPA 4DUZQ 2VUMG 4GOPA 4JI6Q 2EXDA 1Q12A 2NVYH 4MZ9A 1H95A 3G6EA 4X64L 1YJWA 3RN2A 1WCMG 1A0IA 3RZOH 4YY3Q 3ULPA 1YI2A 2CFMA 3CP0A 2VL6A 3KYHC 4AH6A 5IP9G 3CCJA 2YV5A 4UPAA 1J6QA 2WB1G 4O2DA 1GKHA 4POFA 4A3BG 1XPUA 5IE8A 1K8GA 1J5EL 4IJLA 4KHPL 4DR1L 2VNUD 1I3QH 4X6AH 3PIPA 1QUQB 2R7FA 1WI5A 3EN2A 1N36L 4DKAC 3S2HH 4X66Q 5IYDG 4A3DG 3AFQA 3GTKH 2N49A 1EIFA 3JC66 1Q1EA 1YEZA 1Q46A 5GADC 1CUKA 2MO0A 3TRZA 2HQLA 4JI8Q 1HZCA 3HKSA 4JI7L 3GDEA 2OCEA 3GTMH 3PO3H 1IXRA 2Q2TA 2OQ0A 4PG3A 2E2JH 4B3ML 1I6HH 3D0FA 5HGQA 4R1JA 4BA2I 1PH1A 4JV5L 1YIJA 1IYJB 1VQJA 1LYLA 2N78A 3S1QH 4BBSH 4IFDJ 3KLWA 1NTGA 4OONA 4JOIA 3W1BA 1VQAA 4YWKA 1WFQA 4DV3Q 4A76A 1JB7A 2VUMH 3E0EA 4DR4L 4GOPB 2R6GA 5JEAJ 1KRSA 4GOPC 1JE5A 4JI7Q 1UE6A 4LUZA 1TWCH 5IP9H 3S16H 3L0OA 1EQQA 1X6OA 1X3EA 4LF6Q 4A3BH 4OO1I 5IWAQ 2C35B 2NN6G 3BZCA 1VQLA 4AQYL 3M9BA 2AWNA 2F3IA 4HJAA 3PUXA 1Y1WH 1IZ6A 1E22A 4UP8A 4HJ9A 4LF4Q 4LFAL 4DV5Q 2R92G 4A93H 1NBWA 2ALYB 1BKBA 1FL0A 4DR2Q 2JA8G 4A3DH 3U4ZA 1KHIA 1G291 1YJ9A 2F4VQ 3NENA 5ELOA 1XMQQ 4DR3L 4OWXB 2GVAA 1X55A 2JA7H 2N3SA 1T9HA 1N32Q 4L5QA 1VQ8A 2CWPA 2NZHA 2R7ZH 3A5UA 4NXNL 3OTOL 4OXPA 1Q82C 1TWHH 4LF9L 1SE8A 1HNWL 3CMAA 1CKNA 1ASYA 1SN8A 4LFCQ 1I50H 1X9NA 1V9PA 2F52A 4LFAQ 4C2MH 2IY5B 4JG2A 3NBHB 2VW9A 4LF5L 1OXTA 4YCVA 1HNZL 4JI5L 5H1SE 3UE1A 2NVQH 4HJ5A 2CWAA 2YTVA 2JA5H 1A8VA 4A3LH 2RF4A 4DR7Q 4QL5A 2PMZE 4DUYL 1PH7A 1S72A 4JI4L 1YVCA 1HNXL 5GAEC 4TQUS 4JOIC 5C3EG 4HJ7A 1PH8A 3CC2A 2ATWA 3M4OH 4GLXA 4GKJL 1HZBA 4DV7Q 3CCSA 1KAWA 4YWLA 1XNRL 1MIUA 3UE0A 4BBRG 4OWTB 2R7DA 3STBD 1OXXK 3L7ZC 3LGJA 3T1YL 3KDFA 4Y52H 4IFDG 3HOZG 2R92H 5IP7G 1HR0L 1EWIA 3RLOA 3E9IA 4DUYQ 3PF4A 1EIYB 3RLNA 4KLKA 1AE2A 3F2CA 3H0GG 4GS3A 3RR5A 3I55A 4EQ5A 4O0AA 1Q81C 1N8RC 1KRTA 4DV1Q 3RZDH 1OXVA 1LM0A 2VQEQ 2ZTCA 3OYYA 1PH9A 1KD1C 3U50C 5IY0A 5K36G 1VQGA 3M4QA 2UUAL 4IPGA 3CCRA 5C4XG 1CSQA 1UEBA 1XMOL 1XNRQ 1YNXA 2OTLA 2UUBQ 2BH8A 1PH4A 1XNQL 4LF7L 4R4OA 1SR3A 5FJ8H 4A3EG 4JI6L 4LFBQ 1CKNB 4UP7A 3CW2C 1LUZA 4B3SL 4DR5Q 2JA9A 5LMNL 1PH5A 4YY3L 1KC8C 3F8TA 3BJUA 1G51A 4BA1I 2XTIA 2UXCQ 3UDXA 2IHFA 4BXXH 3JAMi 5C0XG 1EQRA 5AJ3L 4GKKQ 3I4MG 1NE3A 3CCMA 5E7NA 2YU9H 2VS1A 1BBWA 2B63G 3ULLA 1XMOQ 3GTOH 2YYZA 4A3JH 3ERSX 2CKZB 4X66L 1I94Q 4KI0A 4LF7Q 3SGIA 2D0OA 1K8AC 1JT8A 1Y14B 4B3SQ 5LMNQ 1KIXA 1C7YA 2JA6G 1VQ4A 2MQHA 3TQYA 3HOZH 4YHHQ 1PFSA 3A0JA 4GN4B 1VCIA 3KDFB 4J15A 4JI8L 3CC7A 4R4CA 3S24A 4A3MH 1OTCA 3PSIA 5AJ3Q 4IO9A 1KXLA 1TXYA 1DGSA 1L1OA 1HH2P 1QVCA 4HIDA 1Q7YC 2RCNA 5DLQE 4BY1G 2Q2HA 3FKIG 5C4XH 2ZJRA 3I4OA 1CKMA 3CPWA 2UU9L 1K73C 1W3SA 1VQDA 4DV3L 1V43A 4HIMA 3AQQA 1AH9A 3M3YH 1QZHA 4HIKA 4AQYQ 4JI2Q 4DAMA 1N9WA 4L5TA 4LUOA 3STBC 4IJHA 5GROA 3UDGA 1HR0W 4A3GG 4JYAQ 2VY3A 1GO3E 1V1QA 4JI1L 2I5LX 2MFIA 5C44G 3I7FA 1JMCA 4LF6L 5IWAL 3CXCA 2LXJA 4LNQA 4JBWA 4DPGA 5FLMH 3GO5A 2AKWB 4LF4L 1RL2A 3K0XA 4DV5L 5M3FG 3WWVA 2KCMA 1NY4A 4DR2L 4JI3Q 3J80i 1M1KC 3CCLA 5M3MG 1VQBA 1A62A 2F4VL 1K0RA 1XMQL 1WCMH 2WB1E 3KF8B 2D0PA 3PV0A 2JA6H 4DK6C 1VQ9A 5LMNW 1N32L 1TWGH 4LUVA 4QY7A 5M5WH 1WJJA 2A8VA 4A3FG 2NVXH 4QGUA 4JI4Q 4QQBX 4L5RC 1N33L 4IOAA 4JI1Q 3GD7A 1FJGQ 1BBUA 4LFCL 1A63A 1L1OB 4X65Q 2PI2A 4BY1H 3HOYG 3S15H 1L1OC 1PYSB 4JBJA 3I2ZA 2HIVA 4YWMA 3I4NG 5IYDH 1MJEA 1AE3A 4POGA 1VQFA 5GQOA 4DR6Q 4DR7L 4OO1G 2VQFQ 2JQOA 1PHJA 1B8AA 1QVFA 1D7QA 2K5HA 1N33Q 3CCEA 4A3GH 4JBMA 4P73A 3PUYA 2I5MX 5IT9c 3HOXG 3BU2A 4DV7L 5BR8L 1VQ6A 2KCTA 1JJ2A 4B3RQ 2ZM6Q 1E1TA 1NMFA 2VZAA 4QIWE 4A3IG 1XPRA 3CCVA 3PGZA 5M3FH 1EOVA 3AEVA 2AHOB 1OXUA 2IT1A 1P16A 2K75A 5M3MH 2A19A 3L2PA 1XPOA 1VQ7A 3GTJH 3H15A 4JI0Q 2UXBL 3W1GA 1VQOA 1FJGL 3K7UC 3K80C 4DV1L 4YCUA 2VQEL 3KF6A 4DV4Q 3KJPA 1YHAA 4DV2Q 1GD7A 1L0WA 4FDBA 5BR8Q 4P72A 1VQCA 2UUBL 1Y1VG 4LFBL 3DLLA 1S40A 1YITA 3S1MH 4DR5L 1MKHA 3CPFA 3HFZB 3UDFA 2JA8H 1X65A 2WAQG 3G48A 2ES2A 2E5LQ 2UXCL 1N34L 5JEAG 4GKKL 1FGUA 1X54A 3FHWA 3J7ZC 3M7NA 2ZTDA 5GAHC 4OWWB 5FLXc 3PUVA 4IFDI 2Z0SA 2FXQA 1C0AA 3HKZG 4UP9A 1VQKA 1XTDA 4X62Q 1IBMQ 1Z9FA 4RMFA 4R4QA 1CSPA 1Q8KA 1KL9A 1I94L 2I0QA 3T1HQ 3ER0A 4NPSA 1LTLA 3M85A 4NXMQ 2WP8J 1IBKQ 2PNHA 3KOJA 4A3IH 4JBKA 2UXDQ 4YHHL 2UUCQ 3NELA 3G71A 3TS2A 1N34Q 2OQKA 3F1ZA 3CMEA 3TEHB 3ZJYC 1C9OA 1G6PA 3GTLH 3K8AA 5C3EH 2Z6KA 3AFPA 4L5SA 2K50A 3CCQA 3U58A 3KF6B 2AWOA 3PIOA 4HIOA 2V1CC 1W2BA 5C0XI 2IX1A 5ELNA 3KFUA 2QEXA 2QA4A 4BBRH 1R9TH 1O7IA 4P75A 3B6YA 1E3PA 3J80c 3PF5A 4MTNA 4LF8L 3F2DA 1PH6A 4JI2L 5IP7H 3GTPH
chains in the Genus database with same CATH superfamily
3EBEA 1EWCA 1PH2A 3KLSX 1B70B 4J1MA 1IKLA 1I4PA 2SNSA 1B9MA 3GTMB 3HOVG 2B2VC 2YTXA 1B44D 2NTTA 2EJMA 4PMWA 1KQSA 3CAMA 1BQQT 3JAME 1QB5D 2A5HA 2B29A 2HHHQ 3EQLC 2B2UA 2CH4W 1IHZA 2ICEC 1JOOA 4V190 1WCMB 3K5LA 2UU9Q 5E1FA 1JJGA 1J9OA 2Z8LA 3J81i 5CV6A 5I4DA 5LMUQ 1Q8IA 2PYKA 4A3BB 3DUZA 2JEBI 4WFN3 3BZKA 2NYZD 5KYLA 2KOLA 1SLJA 1O7ZA 3ULJA 4DR6L 1X3FA 4GNXA 5I9OA 1OXSC 1TS5A 4H02A 3PO2H 2R7ZG 1HTLD 1MJCA 2AUJD 3FKIH 3D4RA 4A3LG 1DONA 4R4TA 1HQRD 1LTBD 1SYCA 4B08A 3GTJB 3A74A 4CBVA 4DV4L 4TSSA 4DV2L 2B2WC 4DK3C 3K5OA 5C4JH 2ZJPA 4B3MQ 2F0TA 1EYDA 3BS1A 1GUWA 1HZ9A 3I3CA 4PQXA 5IYBG 1XWEA 1TWAH 3M4PA 4HSPA 3FPPA 1WD0A 2F0WA 5IYCG 2H4OA 2KHJA 4DR4Q 1RODA 4ZKBB 3CQZH 4R4IA 1Q86C 5C0XJ 2LMCB 3AYHB 1NMGA 2FMCA 2R93G 2GVBA 2D62A 5JVH3 2A69D 4RKLA 2Z1CA 2RHSB 3SK5A 5L37A 1SEBD 4NXML 3HOYH 3GTQH 4B3TQ 2PQAB 3I4NH 2DJFC 1NAPA 2E75C 4OO1H 3P20A 1JE4A 4LWCA 2A6ED 2EPBA 3BVMA 1GM5A 1UE7A 2KUMA 3HOXH 1ESFA 4A3JB 2E74C 4GLAC 1SNCA 3OHXC 3BG3A 1TS4A 4QJFA 3GTPB 3NK9A 1V8QA 2AMCB 3P75A 2WV6D 5KNBA 4EQNA 4C3JB 4XQJA 1QUQA 2K5NA 1XYIA 4IUPA 1F2ZA 4K8JA 1Q3LA 1SNQA 2SDFA 5C4XB 2HHHL 3C46A 2L0CA 3TBIB 1T5XD 1RTOA 3NWTA 4A3EB 2YTYA 1IL2A 1GUSA 2RDHA 3T13A 3M3YB 1HR0Q 3DWPA 5C3XA 1F2MA 1WYDA 2F0GA 5LMUL 2JJQA 4LF9Q 1G2SA 1LT4D 3BYYB 3NBIA 1QCBD 2KBNA 3N52A 1CQVA 1I4GA 1PA6A 4GOPA 1Q12A 4MZ9A 3G6EA 1A0IA 2VL6A 2YV5A 2A69C 4CDDC 2F0VA 2WB1G 2NVXB 1SXTA 1XPUA 1QJOA 5IE8A 1UEAB 1I3QH 2R7FA 1H9SA 2CH4A 3S2HH 4X66Q 2A6EC 5C4HA 3BZDB 1C48A 1IL8A 5GADC 3TRZA 2EJGC 1CUKA 2MO0A 3QOLA 3TN2A 3AU7A 2PZWA 1JCKB 3PO3H 1IXRA 4B3ML 1AN8A 4HMJA 2E2JH 2E2HB 4XT1B 4BA2I 4B9XA 1IYJB 2ZXOA 4BBSH 1NTGA 4OONA 4DV3Q 4YWKA 1WFQA 5M3MB 4DR4L 2D5DA 1S4ZA 1JE5A 1TWCH 2QW7A 3L0OA 2VB3X 1X3EA 2B2TC 1F9RA 4S3SA 4HEDA 4OO1I 1Y1WH 3J7AF 3PUXA 4UP8A 4LFAL 3PIP3 3S1MB 1NBWA 1BKBA 1TQOA 2JA8G 4A3DH 1VMPA 3U4ZA 2F03A 3DWQA 2JA7H 1T9HA 2K01A 4L5QA 1VQ8A 2MUYA 2LS01 4TKOB 1Q82C 1SE8A 3TMEA 4EGVA 2IY5B 4R8IA 2VW9A 2V4DA 1OXTA 4YCVA 5H1SE 3R2TA 2JA5H 2CWAA 1A6XA 4QL5A 4DUYL 4IN3A 4JI4L 1YVCA 4TQUS 5C3EG 3I90A 5G3LD 1PH8A 3M4OH 1NR4A 3AB9A 1U4RA 4CHTB 2K05A 4BBRG 2MHVA 2K03A 2NTSA 2PW5A 1HR0L 1NNXA 1Q81C 3H0GB 2XRQD 5C6AA 3I55A 4LF9L 2RVLA 2VQEQ 2ZTCA 1TKWB 3PMFA 3U50C 3M4QA 1CSQA 3HP3A 5A2QL 2G5DA 1SR3A 4LFBQ 1EYAA 4DN4M 1LUZA 2JA9A 5FO9B 1STHA 1MGSA 3VA5A 4XQQA 4BA1I 2XTIA 4BXXH 1EEFD 1SE2A 3CCMA 2AQ1B 2VS1A 3IFTA 2YU9H 1S5ED 3MXPA 1EY4A 2YYZA 2B2YC 4X66L 4LF7Q 3SGIA 3KF8A 2D0OA 4B3SQ 5LMNQ 4KKTA 3TQYA 2K7VA 3OPOA 5J22A 5EGTA 1PFSA 3HOZH 2XN9C 4J15A 3KDFB 2K04A 2I46A 1TXYA 1L1OA 1HH2P 3HOVB 4E6IA 3KUPA 1U4LA 4CDCC 3FKIG 3ND9A 3I4OA 1L0XB 1HHVA 1PRTB 1VQDA 4DV3L 4HIMA 4FF3A 1AH9A 4HIKA 1STGA 4JI2Q 2NVTB 2E2IB 5T1GA 1FGBD 1DD2A 5C0XH 4JYAQ 5ELCA 2ICIA 5FLXL 4IUNA 3CXCA 1ENFA 3GO5A 5FLMH 1WTWA 3M7GA 3MVVA 1M1KC 1NUCA 1VQBA 1A62A 1T5EA 4O42A 5JOBA 2OT2A 1ESRA 4DK6C 4LUVA 1EZ6A 3Q24A 2R7ZB 4X3TA 4HTHA 1N33L 4IOAA 5CC4A 1BR9A 2PI2A 4BY1H 4CJ1B 3HOYG 3S15H 5ELDA 1RCVD 3I2ZA 2IJ0A 4CGYB 3I4NG 5IYDH 4POGA 3NXWA 2HUGA 3I8ZA 4OO1G 1JOKA 1X3PA 4XYQA 3S17B 3NP8A 2K5HA 3VYUA 3HOXG 2I5MX 3VYRA 1K83B 2D2CC 3D4WA 1ILPA 4QIWE 3LX0A 1XPRA 4FO2A 3AEVA 2AHOB 1OXUA 2K75A 1P16A 2K32A 2K5DA 2QKIC 1ZXTA 1XPOA 1SFOB 1VQ7A 5I9PA 4B3RQ 4K5VA 2VQEL 4M1UB 4H7BA 1HTPA 3BDLA 2R93B 5BR8Q 1B53A 4FXKC 4BS9A 2NN6H 4LFBL 3I4LA 3NE5B 3DLLA 4QCLA 2KJXA 4XQNA 2Z4IA 2E5LQ 3CRLC 3GP7A 1FGUA 1X54A 3FHWA 4EQOA 2ZTDA 5FLXc 1I4QA 1EY9A 2ZXRA 1C0AA 1EOTA 2R61A 1Z9FA 2RDFA 4RMFA 5A2QE 3T1HQ 1LTLA 1C8CA 2WP8J 3VA7A 2BDOA 3C3LA 3V2TA 2UXDQ 1TU2B 3TS2A 2MP1A 3CMEA 2VB2X 3ZJYC 3T56B 3TSSA 1EY5A 2EXZA 1A2TA 3CCQA 1ML0D 3VR2A 3KF6B 3PIOA 1W2BA 5C0XI 4KJOA 2QEXA 4DU9A 2BOSA 3PF5A 5IGGA 3F2DA 1PH6A 4JI2L 1CT1D 2ASBA 1JJCB 1JORA 1HA6A 1RKNA 3ZYYX 5DM63 4JYAL 1PYWD 4JCVE 5CBAE 3NEMA 3FP9A 3BDCA 3R93A 5KEEA 3DM3A 5K36H 3A55A 2F0UA 3E5SA 4BBSG 4DV6Q 2K5VA 2I07B 1G8ZD 1SE4A 4C56C 1CZWA 2PO4A 3MXNB 4LF8Q 4RWSC 2B3GA 2F1MA 3BDOA 2LKVA 3EIVA 4Y7NH 2O2LD 5JJKA 2WB1B 4C3IG 1DXMA 4KD3A 3I4MH 2LXKA 4AYBG 1ZEQX 2GN5A 2H5XA 2WKCA 1QNKA 4DXFA 4C3HH 1Y1WG 1HUNA 4LAAA 2DGYA 3OW2A 1EY6A 4DAYB 2LSSA 1F9PA 4X64Q 1FNWA 2JA7G 1PH3A 4KTAA 1RIPA 4ODGA 1ILQA 1KDAA 2K28A 3NSWA 4A3CH 3S14H 2RBMA 2L4NA 1STYA 3J81L 4OX9L 1J5EQ 1I50B 4KHPQ 4DR1Q 4PZ6A 1LT5D 2PQAA 4C2MB 5M5XH 4KMUC 2Q8TA 3HOUG 2JA5G 4APVA 3R3OA 2OF1A 4B3RL 2NN6I 2B2UC 2HT1A 1ET6A 3S1RH 4BY7G 1X3GA 1ICWA 2XGTA 3BVGA 4JC0A 2KENA 2IHEA 4JV5Q 1II3A 1UWVA 3NTIA 1XJVA 3HS0C 2L9HA 2JA8B 4RAUC 3U4VA 2E5LL 1I5FA 4RGTA 3JAMc 1PV4A 3J81j 4LW1A 4A3KH 4PNYA 2DUDA 3PUWA 4TVAB 4GNXC 2KHIA 2K5QA 3K5NA 2Q2IA 2QCPX 2Y0SE 1DZ1A 4N8X1 3T1HL 2K4KA 4DNTB 3K6OA 1CK1A 2A74C 4ILWA 3BVZA 2UXDL 4L63B 4DXGA 4XIGS 3RN5A 1QG7A 4MHEA 5EPLA 1EFWA 4BXXG 1TVXA 1JICA 4IPHA 3K59A 2VXWA 2CQOA 2MO1A 5C3EB 3FDTA 2NZOA 1B7YB 3GTOB 4RH6A 3J7A5 2R3ZA 1U4PA 1QILA 2QGQA 3NHHA 4BBRB 1R9TB 1EIHA 4LF5Q 4I65A 1VS0A 4K2KA 1Y8NB 1WOCA 3PUZA 4NP5A 3CCUA 1TIID 1KDBA 1SJED 1CM9A 1HNXQ 3J81c 5CV9A 2BA0A 3HOWH 4IPCA 1R4PB 4CJ2C 2O5IC 1WTOA 4DV6L 4A75A 2N55A 2PI2E 1Y1VH 3W5OA 3CC4A 1E7ZA 1SMXA 4UY8C 3J7AV 1L2FA 3W3AA 5HY6A 1LTSD 1K3RA 1UAPA 2I5HA 2ZJQA 1BVSA 1WTRA 1S5CD 2E8GA 3GTGH 4AIMA 3LNNA 4UDUC 4RCNA 5FLMG 2UUAQ 1TY0A 3IRBA 5JVG3 4K6DA 2VUMG 1HJPA 1Y8OB 4X64L 1YJWA 3RZOH 4YY3Q 3ULPA 3OWFA 1K0SA 2CFMA 3CP0A 5CV4A 5IP9G 3CCJA 1A15A 5M5WB 4UPAA 1J6QA 2J0TD 1GKHA 2L55A 3QB3A 2RKSA 1J5EL 4IJLA 4KHPL 2NB0A 4DR1L 3A8KE 1LTGD 3L9AX 1WI5A 3FKIB 4IQZA 5IYDG 3OIPA 2JSOA 3S9WA 4X3KA 2K1BA 1STBA 1EIFA 3JC66 1WVLA 1HRJA 1U4MA 3D6WA 4JI8Q 1HZCA 3HKSA 2JP1A 1MD2D 4JI7L 3GTMH 4G7ZC 3ONAB 1WTHA 1FR3A 2OQ0A 3WDNA 4R1JA 3J81E 3K5MA 2FINB 4JV5L 1VQJA 1TWAB 2N78A 4HAEA 5CR3A 5KYIA 1VF7A 4JOIA 3W1BA 1VQAA 5JEAJ 1KRSA 5BN4A 1JB3A 4GOPC 5D3IB 5HURA 4A3BH 2C35B 2NN6G 2B39A 1BCPB 3HOYB 2Q8IB 2AQ2B 4DV5Q 2PPBC 2R92G 2ALYB 3MC0B 1EZ8A 2IW3A 3I4NB 1PMRA 1G291 3ND8A 1XMQQ 1X55A 1HXYD 2N3SA 3NQIA 1GXDC 4TRDA 4OXPA 1MI2A 1BNZA 3HOXB 3R8BA 1TS3A 1ASYA 1SN8A 2F52A 4LFAQ 4JG2A 4LF5L 3Q22A 5FO8B 3OMCA 1LV9A 5KIXA 2NVQH 4HJ5A 2YTVA 2RF4A 4DR7Q 1S72A 1HNXL 2D9UA 5GAEC 2ATWA 3D4DA 4GLXA 1O78A 3CCSA 3G7LA 1H9RA 4OWTB 2R7DA 1WTXA 1OXXK 2JYOA 3KDFA 1LLRD 5EJWA 4HMIA 2L5TA 4DUYQ 3PF4A 1S5DD 3F2CA 1N8RC 3RR5A 4JI4Q 4I7AA 1FJGQ 2HCIA 4DV1Q 1LM0A 3KK7A 1PH9A 2EYFA 1SNPA 2MPMA 5IY0A 5K36G 2UUAL 3CCRA 3K58A 1UEBA 1XMOL 3OIQA 2OTLA 5FJ8H 3S2DB 5ISRA 3CW2C 1MSHA 1PH5A 4YY3L 1KC8C 4F8MA 4IURA 3UDXA 4QUFA 5AJ3L 4GKKQ 2RSOA 3I4MG 3P7JA 5FOBB 2J4XA 4C3HG 3X3NA 4A3JH 3ERSX 2CKZB 4DAPA 3D6CA 1S5FD 2JXMB 2EYHA 1Y14B 5EBDA 1IW7C 3EVQA 3FRPB 2JA6G 1VQ4A 3MHBA 4JI8L 3CC7A 4V0BA 4A3MH 3WOFA 3S24A 1OTCA 2Z6BA 1KXLA 4H44C 2RCNA 1Q7YC 2Z4HA 2NWGA 4OELB 2Q2HA 5C4XH 2ZJRA 4BBSB 1FNUA 1K73C 1DCZA 3V05A 1ENAA 3M3YH 4UAIA 3MFGA 2ZT9C 1N9WA 4L5TA 4LUOA 5GROA 3A54A 4A3GG 1SBBB 3H6MA 4C3IB 4JI1L 5C44B 1TR5A 4AYBB 1IKMA 2LXJA 4DV5L 1XX8A 2N88A 3WWVA 2KCMA 5C5LA 5M3FG 3PIO3 3UI2A 4JI3Q 3J80i 1SSOA 4WJWA 1K0RA 1XMQL 5E4XA 1CI3M 2JA7B 3KBXA 5LMNW 1WJJA 2A8VA 1LT6D 3QWNA 4A3FB 2A68D 2NVXH 1IYVA 3T53B 3DWAA 4X65Q 1QWYA 4JK1C 4K5XA 1L1OC 1PYSB 3IAYA 2HIVA 4YWMA 1RTNA 3HOUB 1VQFA 5GQOA 2JA5B 4DR7L 1PFNA 1YNJC 4OHJA 2VQFQ 3QOJA 4FYDA 3J80E 1Y8PB 1N33Q 4BY7B 3HZXA 1TWFB 3SXHA 3BU2A 1SYEA 1VQ6A 1JJ2A 1B3AA 3I70A 4ZAIA 2X6LA 4A3IG 3PGZA 3FEWX 4KN7C 4NKLA 2IT1A 5IGCA 5M3MH 3L2PA 4JI0Q 1SNOA 4XT3B 1VQOA 1FJGL 3K7UC 3K80C 4DV1L 4G57A 3KF6A 3KJPA 2ZXPA 3V96A 5CYUA 2F0EA 5CGKA 3RD4A 4FDBA 1Y1VG 4EVOA 1S40A 3S1MH 2EYPA 1RJTA 1X65A 1BXTA 1N34L 1R4QB 4HCEA 4GKKL 3T16A 1E2WA 1SE3A 3M7NA 2KHSA 4IFDI 1QE6A 1LTTD 4UP9A 2YU9B 2F0JA 3H91A 3G6JB 3MXNA 1CSPA 1KL9A 3VYTA 1SJHD 2NVYB 1E2VA 2A68C 1XXGA 3K57A 1IBKQ 3KOJA 4XYOA 1NSNS 4NW2A 2TMPA 3X3MA 2OQKA 2GA4B 5I6YA 1ET9A 2Z6KA 3RMHA 4B9WA 5KNCA 4L5SA 4I7ZC 4ME5A 2AWOA 4HIOA 4DAYA 2BE5D 2IX1A 5ELNA 1O7IA 2PQEA 3B6YA 1E3PA 2HDLA 1D2BA 4MTNA 2IPKD 5IP7H 5C5MA 1PZKD 3PO2G 3PCOB 3DEPA 2QDLA 4OGQC 3NTHA 3E9HA 5JEAH 1O7YA 1HA5A 2BA1A 2NZ1D 3H0GH 1EU4A 1PTOB 1UE1A 5C3WA 4GLVB 3CRKC 4RCOA 2HD3A 4J6HA 1VQPA 2VUMB 4JI3L 4N9PA 1AZQA 2N8NA 2L12A 2QDBA 1VQEA 2OWOA 3S16B 2F4IA 3NQTA 4FP5D 3TP5A 5CV5A 3HRZC 4X65L 2B63H 2IL8A 4IUQA 1GUNA 4JPBW 2RA4A 2XRSD 4J8QA 4KN4C 2JEAI 2F3WA 4N8FA 3K7AH 2EY1A 2VQFL 5JJLA 5DAUA 2B8GA 2WACA 1YBYA 2F0KA 2SNMA 3HOVH 4K0KL 1GHJA 1VQNA 1EWHA 1G2TA 4IUUA 1FNVA 1N36Q 1G91A 1CZGA 4JI0L 2ID0A 3MEFA 1EIGA 1U5KA 1QVGA 2BE5C 2NVTH 2E2IH 1JWUD 2K52A 3Q8DA 4ZLTF 1K9MC 1PVOA 1X56A 1JQYD 1TT2A 3D3RA 4K5WA 5EAYA 4OX9Q 4HJ8A 2HIXA 3TZDA 5JJIA 2R92B 3Q0AA 3A7LA 4R9WA 1EY8A 1S5BD 1SYGA 4Q5VA 3TS0A 3RZDB 2OTJA 4FF2A 1D8LA 1EU3A 3EROA 1QZGA 3U9SA 4RKBA 1UNSA 5JPNC 2EQSA 4RG1A 4ME3A 4KHZA 5FJ8G 1FYCA 1E24A 3UDIA 3KJOA 5ELEA 2PNRC 4ZK9B 3I56A 1IBKL 2MJ8A 4EX5A 2BH2A 1M4VA 4RHSA 4DR3Q 3F2UA 1K28A 1CKOA 2OEOA 3VR6A 2JK8A 1FD7D 3A7AB 1VF5C 3VR4A 3S17H 3CF5A 4NXNQ 2L11A 1JWMD 4A3JG 1HNWQ 1K83H 4WRDA 1K3BC 1XTCD 2IX0A 2A73B 4KV6A 1AZPA 5IYBH 5IGFA 4JI5Q 3T51B 4P74A 4A3MG 5IYCH 2L15A 4ZYSA 1SFOH 3H94A 2DNEA 2F0OA 5GAGC 4FVMA 3D31A 4YCWA 4GKJQ 2R93H 3GV3A 5M5YH 4OIJA 2EYJA 2XSCA 4DUZL 5DEHA 3VDYA 2WAQE 4WJ4A 2O4XA 3P1HA 5BN3A 4XDXA 1YHQA 1ENCA 2K14A 1S3OA 2KECA 1EUJA 1DYQA 3HKZE 1O7LA 3PO3G 2EVBA 1PYBA 3I4MB 3S1NH 4IOCA 2EDGA 4KKUA 4C3HB 4HSVA 2RHQB 2OXPA 2JA6B 1GHKA 1PXUA 1YI2A 1A3TA 3KYHC 2EE1A 1TWGB 4AH6A 2F0IA 5E4WC 2NUCA 3BYTB 2F0SA 4O2DA 3ERQA 4MIUA 4X6AH 3PIPA 3LWEA 5EKKA 1V1PB 1BDOA 1N36L 4DKAC 1D6EC 3U9OA 4A3DG 3MTSA 3GTKH 2N49A 5KRUA 1BOSA 1YEZA 1CQFA 1Q46A 2EYLA 3R2IA 1Z6HA 2HQLA 3MWYW 2P5ZX 3GDEA 3S1RB 2L1BA 4RGOS 5CBEE 4A3GB 2PZTA 1B4OA 1I6HH 3D0FA 1Y69U 5C4ZA 1YIJA 4CDEC 1LYLA 3S1QH 1WTVA 3KLWA 5M3FB 4IFDJ 4ZCKA 4MN3A 4N9TA 4JI7Q 1UE6A 4LUZA 1DOKA 1EQQA 1SAPA 1W6JA 1DOMA 1X6OA 2AUKA 2KA7A 4RA8A 3FVQA 4LF6Q 2EZVA 5IWAQ 4HJAA 2F3IA 4LF4Q 3DEOA 3IL8A 4A93H 4HN7A 4DR2Q 1JWSD 1GUTA 1KHIA 2EJFC 4ZQ3A 2F4VQ 5ELOA 1EQTA 2RCFA 4DR3L 1QNUA 2GVAA 1X32A 4HR7B 3GQBA 1TY2A 3DHQA 3MXUA 4NXNL 5HGTA 4IALA 1TWHH 3MZ5A 1HNWL 1AP0A 4LFCQ 1I50H 1V9PA 4C2MH 2B8FA 2FMMA 3NBHB 4G4KA 4A3IB 4ZUJA 4JI5L 2E76C 1SNMA 5EKLA 1A8VA 2PMZE 1PH7A 1UUPA 3GTLB 5LL6X 4JOIC 4HJ7A 3CC2A 1CA5A 4K6LA 4RGNA 4GKJL 5EQ0A 3OOCA 1PRTD 1KAWA 2QF7A 4YWLA 2SOBA 1XNRL 1Y1VB 5JAVA 4Y52H 3HOZG 1BBXC 5IP7G 1EWIA 1EIYB 2CHBD 4DK0A 2EYMA 3H0GG 4GS3A 4O0AA 3SVMA 3GTGB 1OXVA 3OYYA 1SYDA 1GJXA 2EY6A 1STNA 4IPGA 2Z9HA 1B3QA 2QILA 3HGBA 3QO2A 1YNXA 4WJ3M 1PH4A 4HCSA 1CKNB 4UP7A 1ZYRD 4DR5Q 2KVMA 1G51A 1D5XC 2UXCQ 3JAMi 5C0XG 1EQRA 1ZKOA 1NE3A 2CQAA 2NBFA 2XIWA 1BBWA 3SEBA 2B63G 3ULLA 1XMOQ 4DFAA 3GTOH 4KY5A 1KNAA 1I94Q 1MBYA 1AW7A 3QG1A 5J39A 1J8IA 2IX3A 1C7YA 3HEJA 2MQHA 1BO0A 2XVSA 4GN4B 3PO2B 5CV7A 3DMUA 5AJ3Q 2EY5A 4DA2A 1DGSA 1QVCA 4HIDA 1EY0A 1E2ZA 1PTOC 4BY1G 2AQ3B 1LTID 3CPWA 2DY8A 1CA6A 1KNEA 2EYOA 1CTMA 5I2YA 1PRTC 1QZHA 2G9HD 3QIAA 3M4YA 4FXGC 3CKIB 3H09A 4DAMA 1HR0W 1I4RA 2VY3A 1V1QA 2I5LX 2MFIA 3IKJA 5C4JB 1JMCA 4LF6L 5IWAL 4JBWA 3VR3A 5CORA 4RHRA 2AKWB 4LF4L 1RL2A 4ZRZA 4DGZA 1NY4A 4DR2L 2F4VL 3CQZB 1WCMH 3PV0A 2KCNA 4G7HC 1VQ9A 4QY7A 5M5WH 2XWBB 5IGEA 1ZYRC 5ELFA 4QQBX 4L5RC 4JI1Q 1SDFA 3GD7A 1LACA 1BBUA 4LFCL 1A63A 1Z7TA 1GUOA 3GTQB 3NPPA 3NUCA 2RSNA 2NVQB 5IIFA 5AFWA 4KY6A 4RFBA 3J80L 1AFPA 1D1KA 1A3UA 1B8AA 1RF2D 2HDMA 4U673 1QVFA 3CCEA 1IW7D 3PUYA 1H9KA 2ZM6Q 1E1TA 1NMFA 2VZAA 2LFNA 2X6GA 1G6ZA 5K5PA 2ENBA 2A19A 3GTJH 3H15A 4R8NA 4WORA 4YCUA 1PTOF 1EY7A 4F88A 4F87A 1GD7A 1L0WA 1VQCA 1H9MA 1F9SA 1YITA 1WTQA 1PRTF 4DR5L 2FHTA 2B2VA 3HFZB 1YNND 2WAQG 3G48A 4L6TB 2ES2A 4QB4A 2UXCL 4KK7A 3J7ZC 2K6AA 3NTKA 5GAHC 4OWWB 3VYSA 3PUVA 3QR8A 2Z0SA 3E3XA 2FXQA 3HKZG 3A8IE 1VQKA 1XTDA 4X62Q 1IBMQ 1I94L 1Q8KA 2XWJB 2I0QA 3FMCA 4NPSA 5A35A 4JBKA 2UUCQ 3RUZA 3G71A 4A3MB 2O5JC 1N34Q 1EFID 3F1ZA 1G6PA 1C9OA 2C5CA 1H9JA 4X3SA 2M9VA 1PZID 1I3QB 1YNJD 5DNFA 1PDQA 3U58A 5T1IA 2X69A 1STEA 2V1CC 4KHVA 5I2XA 3S2HB 3C1FA 2QA4A 2KCCA 2F0LA 3J80c 4IFDH 1MSGA 2UU9L 3GTPH 1PFMA 4A3CG 1A2UA 1I4HA 1YJNA 1IBLQ 3PO3B 4C3JH 4GN5A 5IODA 5F2DA 1LT3D 1HZAA 2E2JB 4DV0Q 3WOEA 4P71A 1E1OA 2F0HA 4QF4A 4JW0A 1HUMA 2F0NA 1BUVT 1EYGA 3Q6SA 2PW7A 4A3EH 3S2DH 2EIFA 4A4IA 1YHBA 2DY7A 4NB3A 2B2WA 3EJIA 2WIIB 3IFDA 4CKCA 1TWCB 4IZ8A 4ULLA 2WINB 1JC7A 2A6HD 3CHBD 1PFBA 5JJZA 2QEJC 1YNNC 1B50A 3MAQA 1Y1WB 4A93G 4PMCA 2Z6KC 4A3DB 1VQMA 2M00A 3H3VH 1GVPA 4PZ8A 1VQIA 1FVIA 4A3KG 1KTKA 4FF4A 1STAA 5EPKA 2ZM6L 2K5WA 2Y0SG 3CD6A 1U0LA 1NR2A 5D14A 2FFKB 4PMBA 3TREA 1UE5A 2BDNA 3M4OB 4ABNA 4AYBE 1NJIC 2F0PA 4C3IH 1F9QA 5C44H 4K0KQ 2E2HH 4G7OC 2MNAA 1IYUA 3A5ZB 1F2YA 2A1AA 4PZ7A 1ASZA 4B3TL 1EEID 1P8LA 3CU7A 3F2BA 1VDZA 3K81C 3HOWG 3D8GA 4IUVA 1KDCA 2J7ZA 4EQPA 4GNXB 3SHLA 3G4SA 4A3FH 1ICFB 1W6KA 2C9OA 4DNIA 2ZTEA 4X62L 2IWHA 1IBML 2KQ3A 3I73A 2DNCA 3MXGA 2A6HC 2PZUA 1M90C 2UUCL 2SEBD 1HCZA 3HOUH 4C1NI 5IOCA 2Q2UA 5D3DA 1SROA 3OTOQ 4BY7H 2JE6I 1A3VA 1TWFH 1YZ6A 3OMGA 1KLGD 3OSOA 4IPDA 1RDPD 5M9OA 3E0JA 2CVRA 3DXJC 2KEEA 3HOZB 1HNZQ 3W2DA 4GN3B 2WKDA 1DOLA 1IBLL 3TP7A 4MNOA 1V1PA 3Q23A 3NWSA 4DV0L 5ELBA 1VQ5A 3OWEB 1Q1BA 2CCZA 1SRUA 1RHPA 4P2CB 4LJZC 5J3BA 2WFWA 3T1YQ 4FNFA 1VQHA 3ICEA 2LY7A 3SK6A 1U9RA 3RLFA 4XTCS 1LTAD 3RNUA 3H3VI 4M8AA 5BN5A 1BCPD 1CFMA 1SNDA 4ALPA 3KLRA 1EQVA 2B63B 1Z47A 1XNQQ 3N6RA 4DUZQ 4JI6Q 4ID6A 2EXDA 2NVYH 3I91A 1LO5D 4X3UA 4NDXA 3RN2A 1WCMG 3K7AB 2B2TA 4LK1C 4POFA 4A3BG 1K8GA 2VNUD 1O80A 3AMUA 3A56A 4BY1B 1QUQB 1TS2A 3S15B 3EN2A 4K8IA 3AFQA 1D1IA 1Q1EA 4CDFC 3T4AC 1F2LA 1EL0A 2OCEA 1PTOH 5DM73 2Q2TA 1ONLA 4PG3A 3NBHA 3TP6A 1VMCA 5HGQA 1PH1A 1L0YB 3LWUA 2CW0D 1B2TA 5EPJA 4A76A 2VUMH 1DM0B 1JB7A 4QIWB 4CKBA 3E0EA 1V1OA 4GOPB 2R6GA 4NMZA 4OEMB 3KLSA 1PZJD 4FF1A 5IP9H 3S16H 1GOZA 3BZCA 1VQLA 4ZKCB 3M9BA 2AWNA 1IZ6A 1E22A 4HJ9A 1BCPC 1FL0A 4UHVA 1H9SB 1YJ9A 2RDGA 3NENA 4OWXB 3FPUB 1N32Q 4KY7A 2CWPA 2NZHA 2R7ZH 3A5UA 1X3QA 5FKAC 3OTOL 3CMAA 1CKNA 3MEHA 1X9NA 1HFGA 4C1NK 2H1EA 1HNZL 3UE1A 4A3LH 1SMYD 2B2YA 1I6VC 1D5MC 1PLFA 4JVZA 1HZBA 4DV7Q 3VR5A 4FXDA 5M5YB 1MIUA 3UE0A 4OIKA 5G3LF 3ITPA 4MTKA 3STBD 5TSSA 3L7ZC 3LGJA 3T1YL 4IFDG 5CV8A 2R92H 3RLOA 2WAQB 3E9IA 3RLNA 4KLKA 3A8JE 1AE2A 2UXBQ 4C3JG 1H95A 4EQ5A 4QUCA 1KRTA 2CW0C 3RZDH 1RD9D 3S1NB 1KD1C 1JR0D 1VQGA 3HKZB 4DF7A 5C4XG 1XNRQ 3J7YW 2UUBQ 1BF4A 2BH8A 1XNQL 2K33A 4R4OA 1MHWC 4A3EG 4JI6L 4LF7L 1DJRD 3OW7A 4B3SL 3C2PA 3SK4A 5LMNL 3F8TA 3BJUA 3TZUA 5J1ZA 3TP8A 4Y7NB 2IHFA 1QOHA 1NCVA 4K2LA 5E7NA 1HQMC 1LABA 2G9DA 5IT9L 3HG9A 1BCPF 4KI0A 1K8AC 1JT8A 1M8AA 5CMDA 3GTKB 1K8OA 1KIXA 5IGDA 3H3VC 5D65A 4YHHQ 3A0JA 1VCIA 4R4CA 3PSIA 4IO9A 3S14B 1HPCA 3JAML 5DLQE 1SMYC 1I6HB 2F0MA 5M5XB 2HCCA 5JPMC 4DK1A 1CKMA 3S1QB 5KNDA 1W3SA 3EA6A 1V43A 5I6WA 3AQQA 4CJ0B 3URYA 4AQYQ 4QMGA 4RGMA 5E3FA 3GV6A 3STBC 4IJHA 3UDGA 2F3VA 1GO3E 5C44G 4LNQA 3I7FA 4O1NA 5FO7B 1OO9B 4DPGA 3L3OC 5FLXE 3K0XA 1LTRD 4YIJA 4A93B 2FJ2A 1KABA 5NUCA 4DAVA 2JN4A 1Q90A 3CCLA 2MGSA 3KBGA 5M3MG 1AEXA 2WB1E 3KF8B 1CHPD 2D0PA 3QJYA 1D5ZC 1C4QA 2F0QA 2TSSA 4H0LC 2JA6H 1N32L 4A3KB 1TWGH 2DN8A 1I4XA 4A3FG 1HFNA 4QGUA 2PCFB 4PV1C 5EKIA 5IGBA 1TWHB 4GZYC 2BCOA 1WTPA 1L1OB 4JBJA 2Y0SB 2M2LA 4Q0FA 1MJEA 1AE3A 2EY2A 4DR6Q 1JOQA 2KEDA 2JQOA 1E0BA 1PHJA 3EFXD 1D7QA 2XNAC 4KKSA 3E6ZX 2PMZB 3SDZA 4CKEA 4A3GH 4JBMA 4P73A 5IT9c 4DV7L 5BR8L 5EBCA 1GUGA 3SK8A 2E2DC 2KCTA 4XXEA 3I72A 3O13A 1KLUD 2EOTA 4K14A 4U68A 4KD4A 3CCVA 5M3FH 1EOVA 3K0YA 1B1ZA 1PTOD 5LL6S 2UXBL 5FK9C 3W1GA 1EYCA 3PQIA 4Z9CB 3HOWB 4DV4Q 3MA2B 1YHAA 4DV2Q 4IUTA 3C1EA 4P72A 2UUBL 2Q8RE 4KJNA 1KAAA 1CHQD 3SE0A 4F7XA 1F77A 1MKHA 3CPFA 3UDFA 2JA8H 5JEAG 1SYBA 5KGUA 3SR1A 4R4QA 5LHY1 2HQEA 3ER0A 5COYA 3M85A 4NXMQ 2PNHA 1SYFA 3RZOB 4A3IH 4YHHL 4LMQD 3NELA 3DM1A 4OL7A 3TDQA 2F0DA 3TEHB 1K8MA 3GTLH 3K8AA 3MFYA 3AFPA 5C3EH 4DNRB 2K50A 1B9NA 2RQXA 4ZUIA 3KFUA 4L8JA 5IT9E 4BBRH 4BWGB 1R9TH 2F0FA 4P75A 1WD1A 4H13C 4LF8L 4AQYL 2DJGC
chains in the Genus database with same CATH topology
3EBEA 2ASBA 1PH2A 1JJCB 3PCOB 4A3CG 1B70B 3E9HA 1YJNA 2BA1A 1IBLQ 3H0GH 4C3JH 4JYAL 3HOVG 1UE1A 4GN5A 4JCVE 2YTXA 3NEMA 3FP9A 1HZAA 4GLVB 1KQSA 4PMWA 4DV0Q 3CAMA 3DM3A 4P71A 1E1OA 2B29A 4BBSG 2HHHQ 4DV6Q 2K5VA 1VQPA 1EYGA 4JI3L 4A3EH 3S2DH 2EIFA 3MXNB 1YHBA 4A4IA 4LF8Q 2N8NA 4NB3A 2UU9Q 1VQEA 2B3GA 1JJGA 2OWOA 3EIVA 4Y7NH 3J81i 4WJ3M 5JJKA 5LMUQ 3I4MH 2LXKA 4AYBG 2GN5A 2H5XA 2JEBI 3BZKA 4C3HH 4X65L 1Y1WG 2B63H 4A93G 1SLJA 2Z6KC 2DGYA 3OW2A 1VQMA 4DAYB 2LSSA 2JEAI 3ULJA 1GVPA 4X64Q 3H3VH 1X3FA 4DR6L 4PZ8A 1VQIA 4GNXA 3K7AH 2VQFL 2JA7G 1PH3A 1FVIA 4A3KG 1OXSC 4H02A 3PO2H 1RIPA 2UXBQ 5JJLA 4A3CH 2R7ZG 3S14H 1YBYA 1MJCA 3HOVH 4OX9L 1J5EQ 4K0KL 4KHPQ 4DR1Q 4PZ6A 2ZM6L 2PQAA 1VQNA 3FKIH 5M5XH 2Y0SG 1N36Q 3CD6A 1U0LA 3HOUG 4A3LG 2JA5G 4APVA 4R4TA 4B3RL 4JI0L 2NN6I 2ID0A 3MEFA 3TREA 1U5KA 1UE5A 1QVGA 2NVTH 2E2IH 3A74A 2HT1A 2K52A 3Q8DA 1K9MC 4DV4L 3S1RH 4AYBE 1PVOA 1X56A 1NJIC 4BY7G 1X3GA 4DV2L 5EAYA 4C3IH 4OX9Q 4DK3C 5C44H 5C4JH 2ZJPA 4HJ8A 2HIXA 4B3MQ 4K0KQ 2E2HH 2XGTA 3A5ZB 4JC0A 2KENA 2A1AA 1HZ9A 2IHEA 2MNAA 5IYBG 4JV5Q 5JJIA 4PZ7A 1TWAH 3M4PA 1ASZA 1UWVA 1XJVA 4B3TL 5IYCG 3U4VA 2E5LL 1P8LA 1I5FA 2KHJA 4DR4Q 3F2BA 3PO2G 3TS0A 3CQZH 3K81C 4R4IA 1Q86C 3JAMc 5C0XJ 3J81j 4LW1A 1PV4A 3HOWG 1D8LA 3AYHB 4A3KH 2OTJA 4GNXB 1QZGA 2DUDA 1NMGA 3G4SA 4A3FH 2EQSA 2GVBA 3PUWA 4TVAB 4RG1A 2R93G 4GNXC 2KHIA 4DNIA 2ZTEA 2D62A 4X62L 2Q2IA 4ME3A 2Y0SE 4KHZA 1IBML 5FJ8G 3KJOA 1E24A 3UDIA 3T1HL 2K4KA 2RHSB 4NXML 3I56A 3HOYH 1IBKL 3GTQH 1M90C 4B3TQ 2PQAB 2UXDL 3I4NH 4XIGS 2UUCL 4EX5A 3HOUH 3RN5A 2BH2A 1EFWA 4BXXG 4DR3Q 1CKOA 4IPHA 4LWCA 2JK8A 1GM5A 2CQOA 2MO1A 3S17H 1UE7A 2Q2UA 3CF5A 3OTOQ 1SROA 2NZOA 4NXNQ 4BY7H 2JE6I 1B7YB 1TWFH 1YZ6A 3HOXH 4A3JG 1HNWQ 1K83H 4GLAC 4IPDA 3J7A5 2IX0A 2QGQA 4LF5Q 5IYBH 4QJFA 1VS0A 1WOCA 3PUZA 1HNZQ 4JI5Q 4P74A 4A3MG 5IYCH 3CCUA 2L15A 1SFOH 2AMCB 4GN3B 1IBLL 1HNXQ 3J81c 5GAGC 4MNOA 1QUQA 2BA0A 2K5NA 3HOWH 4DV0L 4IPCA 3D31A 4YCWA 1VQ5A 4GKJQ 2R93H 1Q1BA 5M5YH 2CCZA 2HHHL 1SRUA 4DV6L 4A75A 2PI2E 1Y1VH 3W5OA 3CC4A 4DUZL 1E7ZA 1SMXA 4UY8C 5J3BA 2WFWA 3VDYA 2WAQE 1L2FA 2YTYA 3T1YQ 1IL2A 4WJ4A 5HY6A 1YHQA 1HR0Q 1K3RA 1VQHA 2K14A 1S3OA 1WYDA 3ICEA 3RLFA 4XTCS 2I5HA 2ZJQA 1BVSA 3RNUA 1EUJA 3HKZE 5LMUL 3PO3G 3H3VI 2JJQA 2E8GA 4LF9Q 4AIMA 3GTGH 1PYBA 3S1NH 4ALPA 5FLMG 2KBNA 4IOCA 2UUAQ 1Z47A 2RHQB 3IRBA 1XNQQ 1PA6A 1HJPA 4DUZQ 2VUMG 4GOPA 4JI6Q 2EXDA 1Q12A 2NVYH 4MZ9A 1H95A 3G6EA 4X64L 1YJWA 3RN2A 1WCMG 1A0IA 3RZOH 4YY3Q 3ULPA 1YI2A 2CFMA 3CP0A 2VL6A 3KYHC 4AH6A 5IP9G 3CCJA 2YV5A 4UPAA 1J6QA 2WB1G 4O2DA 1GKHA 4POFA 4A3BG 1XPUA 5IE8A 1K8GA 1J5EL 4IJLA 4KHPL 4DR1L 2VNUD 1I3QH 4X6AH 3PIPA 1QUQB 2R7FA 1WI5A 3EN2A 1N36L 4DKAC 3S2HH 4X66Q 5IYDG 4A3DG 3AFQA 3GTKH 2N49A 1EIFA 3JC66 1Q1EA 1YEZA 1Q46A 5GADC 1CUKA 2MO0A 3TRZA 2HQLA 4JI8Q 1HZCA 3HKSA 4JI7L 3GDEA 2OCEA 3GTMH 3PO3H 1IXRA 2Q2TA 2OQ0A 4PG3A 2E2JH 4B3ML 1I6HH 3D0FA 5HGQA 4R1JA 4BA2I 1PH1A 4JV5L 1YIJA 1IYJB 1VQJA 1LYLA 2N78A 3S1QH 4BBSH 4IFDJ 3KLWA 1NTGA 4OONA 4JOIA 3W1BA 1VQAA 4YWKA 1WFQA 4DV3Q 4A76A 1JB7A 2VUMH 3E0EA 4DR4L 4GOPB 2R6GA 5JEAJ 1KRSA 4GOPC 1JE5A 4JI7Q 1UE6A 4LUZA 1TWCH 5IP9H 3S16H 3L0OA 1EQQA 1X6OA 1X3EA 4LF6Q 4A3BH 4OO1I 5IWAQ 2C35B 2NN6G 3BZCA 1VQLA 4AQYL 3M9BA 2AWNA 2F3IA 4HJAA 3PUXA 1Y1WH 1IZ6A 1E22A 4UP8A 4HJ9A 4LF4Q 4LFAL 4DV5Q 2R92G 4A93H 1NBWA 2ALYB 1BKBA 1FL0A 4DR2Q 2JA8G 4A3DH 3U4ZA 1KHIA 1G291 1YJ9A 2F4VQ 3NENA 5ELOA 1XMQQ 4DR3L 4OWXB 2GVAA 1X55A 2JA7H 2N3SA 1T9HA 1N32Q 4L5QA 1VQ8A 2CWPA 2NZHA 2R7ZH 3A5UA 4NXNL 3OTOL 4OXPA 1Q82C 1TWHH 4LF9L 1SE8A 1HNWL 3CMAA 1CKNA 1ASYA 1SN8A 4LFCQ 1I50H 1X9NA 1V9PA 2F52A 4LFAQ 4C2MH 2IY5B 4JG2A 3NBHB 2VW9A 4LF5L 1OXTA 4YCVA 1HNZL 4JI5L 5H1SE 3UE1A 2NVQH 4HJ5A 2CWAA 2YTVA 2JA5H 1A8VA 4A3LH 2RF4A 4DR7Q 4QL5A 2PMZE 4DUYL 1PH7A 1S72A 4JI4L 1YVCA 1HNXL 5GAEC 4TQUS 4JOIC 5C3EG 4HJ7A 1PH8A 3CC2A 2ATWA 3M4OH 4GLXA 4GKJL 1HZBA 4DV7Q 3CCSA 1KAWA 4YWLA 1XNRL 1MIUA 3UE0A 4BBRG 4OWTB 2R7DA 3STBD 1OXXK 3L7ZC 3LGJA 3T1YL 3KDFA 4Y52H 4IFDG 3HOZG 2R92H 5IP7G 1HR0L 1EWIA 3RLOA 3E9IA 4DUYQ 3PF4A 1EIYB 3RLNA 4KLKA 1AE2A 3F2CA 3H0GG 4GS3A 3RR5A 3I55A 4EQ5A 4O0AA 1Q81C 1N8RC 1KRTA 4DV1Q 3RZDH 1OXVA 1LM0A 2VQEQ 2ZTCA 3OYYA 1PH9A 1KD1C 3U50C 5IY0A 5K36G 1VQGA 3M4QA 2UUAL 4IPGA 3CCRA 5C4XG 1CSQA 1UEBA 1XMOL 1XNRQ 1YNXA 2OTLA 2UUBQ 2BH8A 1PH4A 1XNQL 4LF7L 4R4OA 1SR3A 5FJ8H 4A3EG 4JI6L 4LFBQ 1CKNB 4UP7A 3CW2C 1LUZA 4B3SL 4DR5Q 2JA9A 5LMNL 1PH5A 4YY3L 1KC8C 3F8TA 3BJUA 1G51A 4BA1I 2XTIA 2UXCQ 3UDXA 2IHFA 4BXXH 3JAMi 5C0XG 1EQRA 5AJ3L 4GKKQ 3I4MG 1NE3A 3CCMA 5E7NA 2YU9H 2VS1A 1BBWA 2B63G 3ULLA 1XMOQ 3GTOH 2YYZA 4A3JH 3ERSX 2CKZB 4X66L 1I94Q 4KI0A 4LF7Q 3SGIA 2D0OA 1K8AC 1JT8A 1Y14B 4B3SQ 5LMNQ 1KIXA 1C7YA 2JA6G 1VQ4A 2MQHA 3TQYA 3HOZH 4YHHQ 1PFSA 3A0JA 4GN4B 1VCIA 3KDFB 4J15A 4JI8L 3CC7A 4R4CA 3S24A 4A3MH 1OTCA 3PSIA 5AJ3Q 4IO9A 1KXLA 1TXYA 1DGSA 1L1OA 1HH2P 1QVCA 4HIDA 1Q7YC 2RCNA 5DLQE 4BY1G 2Q2HA 3FKIG 5C4XH 2ZJRA 3I4OA 1CKMA 3CPWA 2UU9L 1K73C 1W3SA 1VQDA 4DV3L 1V43A 4HIMA 3AQQA 1AH9A 3M3YH 1QZHA 4HIKA 4AQYQ 4JI2Q 4DAMA 1N9WA 4L5TA 4LUOA 3STBC 4IJHA 5GROA 3UDGA 1HR0W 4A3GG 4JYAQ 2VY3A 1GO3E 1V1QA 4JI1L 2I5LX 2MFIA 5C44G 3I7FA 1JMCA 4LF6L 5IWAL 3CXCA 2LXJA 4LNQA 4JBWA 4DPGA 5FLMH 3GO5A 2AKWB 4LF4L 1RL2A 3K0XA 4DV5L 5M3FG 3WWVA 2KCMA 1NY4A 4DR2L 4JI3Q 3J80i 1M1KC 3CCLA 5M3MG 1VQBA 1A62A 2F4VL 1K0RA 1XMQL 1WCMH 2WB1E 3KF8B 2D0PA 3PV0A 2JA6H 4DK6C 1VQ9A 5LMNW 1N32L 1TWGH 4LUVA 4QY7A 5M5WH 1WJJA 2A8VA 4A3FG 2NVXH 4QGUA 4JI4Q 4QQBX 4L5RC 1N33L 4IOAA 4JI1Q 3GD7A 1FJGQ 1BBUA 4LFCL 1A63A 1L1OB 4X65Q 2PI2A 4BY1H 3HOYG 3S15H 1L1OC 1PYSB 4JBJA 3I2ZA 2HIVA 4YWMA 3I4NG 5IYDH 1MJEA 1AE3A 4POGA 1VQFA 5GQOA 4DR6Q 4DR7L 4OO1G 2VQFQ 2JQOA 1PHJA 1B8AA 1QVFA 1D7QA 2K5HA 1N33Q 3CCEA 4A3GH 4JBMA 4P73A 3PUYA 2I5MX 5IT9c 3HOXG 3BU2A 4DV7L 5BR8L 1VQ6A 2KCTA 1JJ2A 4B3RQ 2ZM6Q 1E1TA 1NMFA 2VZAA 4QIWE 4A3IG 1XPRA 3CCVA 3PGZA 5M3FH 1EOVA 3AEVA 2AHOB 1OXUA 2IT1A 1P16A 2K75A 5M3MH 2A19A 3L2PA 1XPOA 1VQ7A 3GTJH 3H15A 4JI0Q 2UXBL 3W1GA 1VQOA 1FJGL 3K7UC 3K80C 4DV1L 4YCUA 2VQEL 3KF6A 4DV4Q 3KJPA 1YHAA 4DV2Q 1GD7A 1L0WA 4FDBA 5BR8Q 4P72A 1VQCA 2UUBL 1Y1VG 4LFBL 3DLLA 1S40A 1YITA 3S1MH 4DR5L 1MKHA 3CPFA 3HFZB 3UDFA 2JA8H 1X65A 2WAQG 3G48A 2ES2A 2E5LQ 2UXCL 1N34L 5JEAG 4GKKL 1FGUA 1X54A 3FHWA 3J7ZC 3M7NA 2ZTDA 5GAHC 4OWWB 5FLXc 3PUVA 4IFDI 2Z0SA 2FXQA 1C0AA 3HKZG 4UP9A 1VQKA 1XTDA 4X62Q 1IBMQ 1Z9FA 4RMFA 4R4QA 1CSPA 1Q8KA 1KL9A 1I94L 2I0QA 3T1HQ 3ER0A 4NPSA 1LTLA 3M85A 4NXMQ 2WP8J 1IBKQ 2PNHA 3KOJA 4A3IH 4JBKA 2UXDQ 4YHHL 2UUCQ 3NELA 3G71A 3TS2A 1N34Q 2OQKA 3F1ZA 3CMEA 3TEHB 3ZJYC 1C9OA 1G6PA 3GTLH 3K8AA 5C3EH 2Z6KA 3AFPA 4L5SA 2K50A 3CCQA 3U58A 3KF6B 2AWOA 3PIOA 4HIOA 2V1CC 1W2BA 5C0XI 2IX1A 5ELNA 3KFUA 2QEXA 2QA4A 4BBRH 1R9TH 1O7IA 4P75A 3B6YA 1E3PA 3J80c 3PF5A 4MTNA 4LF8L 3F2DA 1PH6A 4JI2L 5IP7H 3GTPH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EBE A;  2ASB A;  1PH2 A;  1JJC B;  3PCO B;  4A3C G;  1B70 B;  3E9H A;  1YJN A;  2BA1 A;  1IBL Q;  3H0G H;  4C3J H;  4JYA L;  3HOV G;  1UE1 A;  4GN5 A;  4JCV E;  2YTX A;  3NEM A;  3FP9 A;  1HZA A;  4GLV B;  1KQS A;  4PMW A;  4DV0 Q;  3CAM A;  3DM3 A;  4P71 A;  1E1O A;  2B29 A;  4BBS G;  2HHH Q;  4DV6 Q;  2K5V A;  1VQP A;  1EYG A;  4JI3 L;  4A3E H;  3S2D H;  2EIF A;  3MXN B;  1YHB A;  4A4I A;  4LF8 Q;  2N8N A;  4NB3 A;  2UU9 Q;  1VQE A;  2B3G A;  1JJG A;  2OWO A;  3EIV A;  4Y7N H;  3J81 i;  4WJ3 M;  5JJK A;  5LMU Q;  3I4M H;  2LXK A;  4AYB G;  2GN5 A;  2H5X A;  2JEB I;  3BZK A;  4C3H H;  4X65 L;  1Y1W G;  2B63 H;  4A93 G;  1SLJ A;  2Z6K C;  2DGY A;  3OW2 A;  1VQM A;  4DAY B;  2LSS A;  2JEA I;  3ULJ A;  1GVP A;  4X64 Q;  3H3V H;  1X3F A;  4DR6 L;  4PZ8 A;  1VQI A;  4GNX A;  3K7A H;  2VQF L;  2JA7 G;  1PH3 A;  1FVI A;  4A3K G;  1OXS C;  4H02 A;  3PO2 H;  1RIP A;  2UXB Q;  5JJL A;  4A3C H;  2R7Z G;  3S14 H;  1YBY A;  1MJC A;  3HOV H;  4OX9 L;  1J5E Q;  4K0K L;  4KHP Q;  4DR1 Q;  4PZ6 A;  2ZM6 L;  2PQA A;  1VQN A;  3FKI H;  5M5X H;  2Y0S G;  1N36 Q;  3CD6 A;  1U0L A;  3HOU G;  4A3L G;  2JA5 G;  4APV A;  4R4T A;  4B3R L;  4JI0 L;  2NN6 I;  2ID0 A;  3MEF A;  3TRE A;  1U5K A;  1UE5 A;  1QVG A;  2NVT H;  2E2I H;  3A74 A;  2HT1 A;  2K52 A;  3Q8D A;  1K9M C;  4DV4 L;  3S1R H;  4AYB E;  1PVO A;  1X56 A;  1NJI C;  4BY7 G;  1X3G A;  4DV2 L;  5EAY A;  4C3I H;  4OX9 Q;  4DK3 C;  5C44 H;  5C4J H;  2ZJP A;  4HJ8 A;  2HIX A;  4B3M Q;  4K0K Q;  2E2H H;  2XGT A;  3A5Z B;  4JC0 A;  2KEN A;  2A1A A;  1HZ9 A;  2IHE A;  2MNA A;  5IYB G;  4JV5 Q;  5JJI A;  4PZ7 A;  1TWA H;  3M4P A;  1ASZ A;  1UWV A;  1XJV A;  4B3T L;  5IYC G;  3U4V A;  2E5L L;  1P8L A;  1I5F A;  2KHJ A;  4DR4 Q;  3F2B A;  3PO2 G;  3TS0 A;  3CQZ H;  3K81 C;  4R4I A;  1Q86 C;  3JAM c;  5C0X J;  3J81 j;  4LW1 A;  1PV4 A;  3HOW G;  1D8L A;  3AYH B;  4A3K H;  2OTJ A;  4GNX B;  1QZG A;  2DUD A;  1NMG A;  3G4S A;  4A3F H;  2EQS A;  2GVB A;  3PUW A;  4TVA B;  4RG1 A;  2R93 G;  4GNX C;  2KHI A;  4DNI A;  2ZTE A;  2D62 A;  4X62 L;  2Q2I A;  4ME3 A;  2Y0S E;  4KHZ A;  1IBM L;  5FJ8 G;  3KJO A;  1E24 A;  3UDI A;  3T1H L;  2K4K A;  2RHS B;  4NXM L;  3I56 A;  3HOY H;  1IBK L;  3GTQ H;  1M90 C;  4B3T Q;  2PQA B;  2UXD L;  3I4N H;  4XIG S;  2UUC L;  4EX5 A;  3HOU H;  3RN5 A;  2BH2 A;  1EFW A;  4BXX G;  4DR3 Q;  1CKO A;  4IPH A;  4LWC A;  2JK8 A;  1GM5 A;  2CQO A;  2MO1 A;  3S17 H;  1UE7 A;  2Q2U A;  3CF5 A;  3OTO Q;  1SRO A;  2NZO A;  4NXN Q;  4BY7 H;  2JE6 I;  1B7Y B;  1TWF H;  1YZ6 A;  3HOX H;  4A3J G;  1HNW Q;  1K83 H;  4GLA C;  4IPD A;  3J7A 5;  2IX0 A;  2QGQ A;  4LF5 Q;  5IYB H;  4QJF A;  1VS0 A;  1WOC A;  3PUZ A;  1HNZ Q;  4JI5 Q;  4P74 A;  4A3M G;  5IYC H;  3CCU A;  2L15 A;  1SFO H;  2AMC B;  4GN3 B;  1IBL L;  1HNX Q;  3J81 c;  5GAG C;  4MNO A;  1QUQ A;  2BA0 A;  2K5N A;  3HOW H;  4DV0 L;  4IPC A;  3D31 A;  4YCW A;  1VQ5 A;  4GKJ Q;  2R93 H;  1Q1B A;  5M5Y H;  2CCZ A;  2HHH L;  1SRU A;  4DV6 L;  4A75 A;  2PI2 E;  1Y1V H;  3W5O A;  3CC4 A;  4DUZ L;  1E7Z A;  1SMX A;  4UY8 C;  5J3B A;  2WFW A;  3VDY A;  2WAQ E;  1L2F A;  2YTY A;  3T1Y Q;  1IL2 A;  4WJ4 A;  5HY6 A;  1YHQ A;  1HR0 Q;  1K3R A;  1VQH A;  2K14 A;  1S3O A;  1WYD A;  3ICE A;  3RLF A;  4XTC S;  2I5H A;  2ZJQ A;  1BVS A;  3RNU A;  1EUJ A;  3HKZ E;  5LMU L;  3PO3 G;  3H3V I;  2JJQ A;  2E8G A;  4LF9 Q;  4AIM A;  3GTG H;  1PYB A;  3S1N H;  4ALP A;  5FLM G;  2KBN A;  4IOC A;  2UUA Q;  1Z47 A;  2RHQ B;  3IRB A;  1XNQ Q;  1PA6 A;  1HJP A;  4DUZ Q;  2VUM G;  4GOP A;  4JI6 Q;  2EXD A;  1Q12 A;  2NVY H;  4MZ9 A;  1H95 A;  3G6E A;  4X64 L;  1YJW A;  3RN2 A;  1WCM G;  1A0I A;  3RZO H;  4YY3 Q;  3ULP A;  1YI2 A;  2CFM A;  3CP0 A;  2VL6 A;  3KYH C;  4AH6 A;  5IP9 G;  3CCJ A;  2YV5 A;  4UPA A;  1J6Q A;  2WB1 G;  4O2D A;  1GKH A;  4POF A;  4A3B G;  1XPU A;  5IE8 A;  1K8G A;  1J5E L;  4IJL A;  4KHP L;  4DR1 L;  2VNU D;  1I3Q H;  4X6A H;  3PIP A;  1QUQ B;  2R7F A;  1WI5 A;  3EN2 A;  1N36 L;  4DKA C;  3S2H H;  4X66 Q;  5IYD G;  4A3D G;  3AFQ A;  3GTK H;  2N49 A;  1EIF A;  3JC6 6;  1Q1E A;  1YEZ A;  1Q46 A;  5GAD C;  1CUK A;  2MO0 A;  3TRZ A;  2HQL A;  4JI8 Q;  1HZC A;  3HKS A;  4JI7 L;  3GDE A;  2OCE A;  3GTM H;  3PO3 H;  1IXR A;  2Q2T A;  2OQ0 A;  4PG3 A;  2E2J H;  4B3M L;  1I6H H;  3D0F A;  5HGQ A;  4R1J A;  4BA2 I;  1PH1 A;  4JV5 L;  1YIJ A;  1IYJ B;  1VQJ A;  1LYL A;  2N78 A;  3S1Q H;  4BBS H;  4IFD J;  3KLW A;  1NTG A;  4OON A;  4JOI A;  3W1B A;  1VQA A;  4YWK A;  1WFQ A;  4DV3 Q;  4A76 A;  1JB7 A;  2VUM H;  3E0E A;  4DR4 L;  4GOP B;  2R6G A;  5JEA J;  1KRS A;  4GOP C;  1JE5 A;  4JI7 Q;  1UE6 A;  4LUZ A;  1TWC H;  5IP9 H;  3S16 H;  3L0O A;  1EQQ A;  1X6O A;  1X3E A;  4LF6 Q;  4A3B H;  4OO1 I;  5IWA Q;  2C35 B;  2NN6 G;  3BZC A;  1VQL A;  4AQY L;  3M9B A;  2AWN A;  2F3I A;  4HJA A;  3PUX A;  1Y1W H;  1IZ6 A;  1E22 A;  4UP8 A;  4HJ9 A;  4LF4 Q;  4LFA L;  4DV5 Q;  2R92 G;  4A93 H;  1NBW A;  2ALY B;  1BKB A;  1FL0 A;  4DR2 Q;  2JA8 G;  4A3D H;  3U4Z A;  1KHI A;  1G29 1;  1YJ9 A;  2F4V Q;  3NEN A;  5ELO A;  1XMQ Q;  4DR3 L;  4OWX B;  2GVA A;  1X55 A;  2JA7 H;  2N3S A;  1T9H A;  1N32 Q;  4L5Q A;  1VQ8 A;  2CWP A;  2NZH A;  2R7Z H;  3A5U A;  4NXN L;  3OTO L;  4OXP A;  1Q82 C;  1TWH H;  4LF9 L;  1SE8 A;  1HNW L;  3CMA A;  1CKN A;  1ASY A;  1SN8 A;  4LFC Q;  1I50 H;  1X9N A;  1V9P A;  2F52 A;  4LFA Q;  4C2M H;  2IY5 B;  4JG2 A;  3NBH B;  2VW9 A;  4LF5 L;  1OXT A;  4YCV A;  1HNZ L;  4JI5 L;  5H1S E;  3UE1 A;  2NVQ H;  4HJ5 A;  2CWA A;  2YTV A;  2JA5 H;  1A8V A;  4A3L H;  2RF4 A;  4DR7 Q;  4QL5 A;  2PMZ E;  4DUY L;  1PH7 A;  1S72 A;  4JI4 L;  1YVC A;  1HNX L;  5GAE C;  4TQU S;  4JOI C;  5C3E G;  4HJ7 A;  1PH8 A;  3CC2 A;  2ATW A;  3M4O H;  4GLX A;  4GKJ L;  1HZB A;  4DV7 Q;  3CCS A;  1KAW A;  4YWL A;  1XNR L;  1MIU A;  3UE0 A;  4BBR G;  4OWT B;  2R7D A;  3STB D;  1OXX K;  3L7Z C;  3LGJ A;  3T1Y L;  3KDF A;  4Y52 H;  4IFD G;  3HOZ G;  2R92 H;  5IP7 G;  1HR0 L;  1EWI A;  3RLO A;  3E9I A;  4DUY Q;  3PF4 A;  1EIY B;  3RLN A;  4KLK A;  1AE2 A;  3F2C A;  3H0G G;  4GS3 A;  3RR5 A;  3I55 A;  4EQ5 A;  4O0A A;  1Q81 C;  1N8R C;  1KRT A;  4DV1 Q;  3RZD H;  1OXV A;  1LM0 A;  2VQE Q;  2ZTC A;  3OYY A;  1PH9 A;  1KD1 C;  3U50 C;  5IY0 A;  5K36 G;  1VQG A;  3M4Q A;  2UUA L;  4IPG A;  3CCR A;  5C4X G;  1CSQ A;  1UEB A;  1XMO L;  1XNR Q;  1YNX A;  2OTL A;  2UUB Q;  2BH8 A;  1PH4 A;  1XNQ L;  4LF7 L;  4R4O A;  1SR3 A;  5FJ8 H;  4A3E G;  4JI6 L;  4LFB Q;  1CKN B;  4UP7 A;  3CW2 C;  1LUZ A;  4B3S L;  4DR5 Q;  2JA9 A;  5LMN L;  1PH5 A;  4YY3 L;  1KC8 C;  3F8T A;  3BJU A;  1G51 A;  4BA1 I;  2XTI A;  2UXC Q;  3UDX A;  2IHF A;  4BXX H;  3JAM i;  5C0X G;  1EQR A;  5AJ3 L;  4GKK Q;  3I4M G;  1NE3 A;  3CCM A;  5E7N A;  2YU9 H;  2VS1 A;  1BBW A;  2B63 G;  3ULL A;  1XMO Q;  3GTO H;  2YYZ A;  4A3J H;  3ERS X;  2CKZ B;  4X66 L;  1I94 Q;  4KI0 A;  4LF7 Q;  3SGI A;  2D0O A;  1K8A C;  1JT8 A;  1Y14 B;  4B3S Q;  5LMN Q;  1KIX A;  1C7Y A;  2JA6 G;  1VQ4 A;  2MQH A;  3TQY A;  3HOZ H;  4YHH Q;  1PFS A;  3A0J A;  4GN4 B;  1VCI A;  3KDF B;  4J15 A;  4JI8 L;  3CC7 A;  4R4C A;  3S24 A;  4A3M H;  1OTC A;  3PSI A;  5AJ3 Q;  4IO9 A;  1KXL A;  1TXY A;  1DGS A;  1L1O A;  1HH2 P;  1QVC A;  4HID A;  1Q7Y C;  2RCN A;  5DLQ E;  4BY1 G;  2Q2H A;  3FKI G;  5C4X H;  2ZJR A;  3I4O A;  1CKM A;  3CPW A;  2UU9 L;  1K73 C;  1W3S A;  1VQD A;  4DV3 L;  1V43 A;  4HIM A;  3AQQ A;  1AH9 A;  3M3Y H;  1QZH A;  4HIK A;  4AQY Q;  4JI2 Q;  4DAM A;  1N9W A;  4L5T A;  4LUO A;  3STB C;  4IJH A;  5GRO A;  3UDG A;  1HR0 W;  4A3G G;  4JYA Q;  2VY3 A;  1GO3 E;  1V1Q A;  4JI1 L;  2I5L X;  2MFI A;  5C44 G;  3I7F A;  1JMC A;  4LF6 L;  5IWA L;  3CXC A;  2LXJ A;  4LNQ A;  4JBW A;  4DPG A;  5FLM H;  3GO5 A;  2AKW B;  4LF4 L;  1RL2 A;  3K0X A;  4DV5 L;  5M3F G;  3WWV A;  2KCM A;  1NY4 A;  4DR2 L;  4JI3 Q;  3J80 i;  1M1K C;  3CCL A;  5M3M G;  1VQB A;  1A62 A;  2F4V L;  1K0R A;  1XMQ L;  1WCM H;  2WB1 E;  3KF8 B;  2D0P A;  3PV0 A;  2JA6 H;  4DK6 C;  1VQ9 A;  5LMN W;  1N32 L;  1TWG H;  4LUV A;  4QY7 A;  5M5W H;  1WJJ A;  2A8V A;  4A3F G;  2NVX H;  4QGU A;  4JI4 Q;  4QQB X;  4L5R C;  1N33 L;  4IOA A;  4JI1 Q;  3GD7 A;  1FJG Q;  1BBU A;  4LFC L;  1A63 A;  1L1O B;  4X65 Q;  2PI2 A;  4BY1 H;  3HOY G;  3S15 H;  1L1O C;  1PYS B;  4JBJ A;  3I2Z A;  2HIV A;  4YWM A;  3I4N G;  5IYD H;  1MJE A;  1AE3 A;  4POG A;  1VQF A;  5GQO A;  4DR6 Q;  4DR7 L;  4OO1 G;  2VQF Q;  2JQO A;  1PHJ A;  1B8A A;  1QVF A;  1D7Q A;  2K5H A;  1N33 Q;  3CCE A;  4A3G H;  4JBM A;  4P73 A;  3PUY A;  2I5M X;  5IT9 c;  3HOX G;  3BU2 A;  4DV7 L;  5BR8 L;  1VQ6 A;  2KCT A;  1JJ2 A;  4B3R Q;  2ZM6 Q;  1E1T A;  1NMF A;  2VZA A;  4QIW E;  4A3I G;  1XPR A;  3CCV A;  3PGZ A;  5M3F H;  1EOV A;  3AEV A;  2AHO B;  1OXU A;  2IT1 A;  1P16 A;  2K75 A;  5M3M H;  2A19 A;  3L2P A;  1XPO A;  1VQ7 A;  3GTJ H;  3H15 A;  4JI0 Q;  2UXB L;  3W1G A;  1VQO A;  1FJG L;  3K7U C;  3K80 C;  4DV1 L;  4YCU A;  2VQE L;  3KF6 A;  4DV4 Q;  3KJP A;  1YHA A;  4DV2 Q;  1GD7 A;  1L0W A;  4FDB A;  5BR8 Q;  4P72 A;  1VQC A;  2UUB L;  1Y1V G;  4LFB L;  3DLL A;  1S40 A;  1YIT A;  3S1M H;  4DR5 L;  1MKH A;  3CPF A;  3HFZ B;  3UDF A;  2JA8 H;  1X65 A;  2WAQ G;  3G48 A;  2ES2 A;  2E5L Q;  2UXC L;  1N34 L;  5JEA G;  4GKK L;  1FGU A;  1X54 A;  3FHW A;  3J7Z C;  3M7N A;  2ZTD A;  5GAH C;  4OWW B;  5FLX c;  3PUV A;  4IFD I;  2Z0S A;  2FXQ A;  1C0A A;  3HKZ G;  4UP9 A;  1VQK A;  1XTD A;  4X62 Q;  1IBM Q;  1Z9F A;  4RMF A;  4R4Q A;  1CSP A;  1Q8K A;  1KL9 A;  1I94 L;  2I0Q A;  3T1H Q;  3ER0 A;  4NPS A;  1LTL A;  3M85 A;  4NXM Q;  2WP8 J;  1IBK Q;  2PNH A;  3KOJ A;  4A3I H;  4JBK A;  2UXD Q;  4YHH L;  2UUC Q;  3NEL A;  3G71 A;  3TS2 A;  1N34 Q;  2OQK A;  3F1Z A;  3CME A;  3TEH B;  3ZJY C;  1C9O A;  1G6P A;  3GTL H;  3K8A A;  5C3E H;  2Z6K A;  3AFP A;  4L5S A;  2K50 A;  3CCQ A;  3U58 A;  3KF6 B;  2AWO A;  3PIO A;  4HIO A;  2V1C C;  1W2B A;  5C0X I;  2IX1 A;  5ELN A;  3KFU A;  2QEX A;  2QA4 A;  4BBR H;  1R9T H;  1O7I A;  4P75 A;  3B6Y A;  1E3P A;  3J80 c;  3PF5 A;  4MTN A;  4LF8 L;  3F2D A;  1PH6 A;  4JI2 L;  5IP7 H;  3GTP H; 
#chains in the Genus database with same CATH topology
 3EBE A;  1EWC A;  1PH2 A;  3KLS X;  1B70 B;  4J1M A;  1IKL A;  1I4P A;  2SNS A;  1B9M A;  3GTM B;  3HOV G;  2B2V C;  2YTX A;  1B44 D;  2NTT A;  2EJM A;  4PMW A;  1KQS A;  3CAM A;  1BQQ T;  3JAM E;  1QB5 D;  2A5H A;  2B29 A;  2HHH Q;  3EQL C;  2B2U A;  2CH4 W;  1IHZ A;  2ICE C;  1JOO A;  4V19 0;  1WCM B;  3K5L A;  2UU9 Q;  5E1F A;  1JJG A;  1J9O A;  2Z8L A;  3J81 i;  5CV6 A;  5I4D A;  5LMU Q;  1Q8I A;  2PYK A;  4A3B B;  3DUZ A;  2JEB I;  4WFN 3;  3BZK A;  2NYZ D;  5KYL A;  2KOL A;  1SLJ A;  1O7Z A;  3ULJ A;  4DR6 L;  1X3F A;  4GNX A;  5I9O A;  1OXS C;  1TS5 A;  4H02 A;  3PO2 H;  2R7Z G;  1HTL D;  1MJC A;  2AUJ D;  3FKI H;  3D4R A;  4A3L G;  1DON A;  4R4T A;  1HQR D;  1LTB D;  1SYC A;  4B08 A;  3GTJ B;  3A74 A;  4CBV A;  4DV4 L;  4TSS A;  4DV2 L;  2B2W C;  4DK3 C;  3K5O A;  5C4J H;  2ZJP A;  4B3M Q;  2F0T A;  1EYD A;  3BS1 A;  1GUW A;  1HZ9 A;  3I3C A;  4PQX A;  5IYB G;  1XWE A;  1TWA H;  3M4P A;  4HSP A;  3FPP A;  1WD0 A;  2F0W A;  5IYC G;  2H4O A;  2KHJ A;  4DR4 Q;  1ROD A;  4ZKB B;  3CQZ H;  4R4I A;  1Q86 C;  5C0X J;  2LMC B;  3AYH B;  1NMG A;  2FMC A;  2R93 G;  2GVB A;  2D62 A;  5JVH 3;  2A69 D;  4RKL A;  2Z1C A;  2RHS B;  3SK5 A;  5L37 A;  1SEB D;  4NXM L;  3HOY H;  3GTQ H;  4B3T Q;  2PQA B;  3I4N H;  2DJF C;  1NAP A;  2E75 C;  4OO1 H;  3P20 A;  1JE4 A;  4LWC A;  2A6E D;  2EPB A;  3BVM A;  1GM5 A;  1UE7 A;  2KUM A;  3HOX H;  1ESF A;  4A3J B;  2E74 C;  4GLA C;  1SNC A;  3OHX C;  3BG3 A;  1TS4 A;  4QJF A;  3GTP B;  3NK9 A;  1V8Q A;  2AMC B;  3P75 A;  2WV6 D;  5KNB A;  4EQN A;  4C3J B;  4XQJ A;  1QUQ A;  2K5N A;  1XYI A;  4IUP A;  1F2Z A;  4K8J A;  1Q3L A;  1SNQ A;  2SDF A;  5C4X B;  2HHH L;  3C46 A;  2L0C A;  3TBI B;  1T5X D;  1RTO A;  3NWT A;  4A3E B;  2YTY A;  1IL2 A;  1GUS A;  2RDH A;  3T13 A;  3M3Y B;  1HR0 Q;  3DWP A;  5C3X A;  1F2M A;  1WYD A;  2F0G A;  5LMU L;  2JJQ A;  4LF9 Q;  1G2S A;  1LT4 D;  3BYY B;  3NBI A;  1QCB D;  2KBN A;  3N52 A;  1CQV A;  1I4G A;  1PA6 A;  4GOP A;  1Q12 A;  4MZ9 A;  3G6E A;  1A0I A;  2VL6 A;  2YV5 A;  2A69 C;  4CDD C;  2F0V A;  2WB1 G;  2NVX B;  1SXT A;  1XPU A;  1QJO A;  5IE8 A;  1UEA B;  1I3Q H;  2R7F A;  1H9S A;  2CH4 A;  3S2H H;  4X66 Q;  2A6E C;  5C4H A;  3BZD B;  1C48 A;  1IL8 A;  5GAD C;  3TRZ A;  2EJG C;  1CUK A;  2MO0 A;  3QOL A;  3TN2 A;  3AU7 A;  2PZW A;  1JCK B;  3PO3 H;  1IXR A;  4B3M L;  1AN8 A;  4HMJ A;  2E2J H;  2E2H B;  4XT1 B;  4BA2 I;  4B9X A;  1IYJ B;  2ZXO A;  4BBS H;  1NTG A;  4OON A;  4DV3 Q;  4YWK A;  1WFQ A;  5M3M B;  4DR4 L;  2D5D A;  1S4Z A;  1JE5 A;  1TWC H;  2QW7 A;  3L0O A;  2VB3 X;  1X3E A;  2B2T C;  1F9R A;  4S3S A;  4HED A;  4OO1 I;  1Y1W H;  3J7A F;  3PUX A;  4UP8 A;  4LFA L;  3PIP 3;  3S1M B;  1NBW A;  1BKB A;  1TQO A;  2JA8 G;  4A3D H;  1VMP A;  3U4Z A;  2F03 A;  3DWQ A;  2JA7 H;  1T9H A;  2K01 A;  4L5Q A;  1VQ8 A;  2MUY A;  2LS0 1;  4TKO B;  1Q82 C;  1SE8 A;  3TME A;  4EGV A;  2IY5 B;  4R8I A;  2VW9 A;  2V4D A;  1OXT A;  4YCV A;  5H1S E;  3R2T A;  2JA5 H;  2CWA A;  1A6X A;  4QL5 A;  4DUY L;  4IN3 A;  4JI4 L;  1YVC A;  4TQU S;  5C3E G;  3I90 A;  5G3L D;  1PH8 A;  3M4O H;  1NR4 A;  3AB9 A;  1U4R A;  4CHT B;  2K05 A;  4BBR G;  2MHV A;  2K03 A;  2NTS A;  2PW5 A;  1HR0 L;  1NNX A;  1Q81 C;  3H0G B;  2XRQ D;  5C6A A;  3I55 A;  4LF9 L;  2RVL A;  2VQE Q;  2ZTC A;  1TKW B;  3PMF A;  3U50 C;  3M4Q A;  1CSQ A;  3HP3 A;  5A2Q L;  2G5D A;  1SR3 A;  4LFB Q;  1EYA A;  4DN4 M;  1LUZ A;  2JA9 A;  5FO9 B;  1STH A;  1MGS A;  3VA5 A;  4XQQ A;  4BA1 I;  2XTI A;  4BXX H;  1EEF D;  1SE2 A;  3CCM A;  2AQ1 B;  2VS1 A;  3IFT A;  2YU9 H;  1S5E D;  3MXP A;  1EY4 A;  2YYZ A;  2B2Y C;  4X66 L;  4LF7 Q;  3SGI A;  3KF8 A;  2D0O A;  4B3S Q;  5LMN Q;  4KKT A;  3TQY A;  2K7V A;  3OPO A;  5J22 A;  5EGT A;  1PFS A;  3HOZ H;  2XN9 C;  4J15 A;  3KDF B;  2K04 A;  2I46 A;  1TXY A;  1L1O A;  1HH2 P;  3HOV B;  4E6I A;  3KUP A;  1U4L A;  4CDC C;  3FKI G;  3ND9 A;  3I4O A;  1L0X B;  1HHV A;  1PRT B;  1VQD A;  4DV3 L;  4HIM A;  4FF3 A;  1AH9 A;  4HIK A;  1STG A;  4JI2 Q;  2NVT B;  2E2I B;  5T1G A;  1FGB D;  1DD2 A;  5C0X H;  4JYA Q;  5ELC A;  2ICI A;  5FLX L;  4IUN A;  3CXC A;  1ENF A;  3GO5 A;  5FLM H;  1WTW A;  3M7G A;  3MVV A;  1M1K C;  1NUC A;  1VQB A;  1A62 A;  1T5E A;  4O42 A;  5JOB A;  2OT2 A;  1ESR A;  4DK6 C;  4LUV A;  1EZ6 A;  3Q24 A;  2R7Z B;  4X3T A;  4HTH A;  1N33 L;  4IOA A;  5CC4 A;  1BR9 A;  2PI2 A;  4BY1 H;  4CJ1 B;  3HOY G;  3S15 H;  5ELD A;  1RCV D;  3I2Z A;  2IJ0 A;  4CGY B;  3I4N G;  5IYD H;  4POG A;  3NXW A;  2HUG A;  3I8Z A;  4OO1 G;  1JOK A;  1X3P A;  4XYQ A;  3S17 B;  3NP8 A;  2K5H A;  3VYU A;  3HOX G;  2I5M X;  3VYR A;  1K83 B;  2D2C C;  3D4W A;  1ILP A;  4QIW E;  3LX0 A;  1XPR A;  4FO2 A;  3AEV A;  2AHO B;  1OXU A;  2K75 A;  1P16 A;  2K32 A;  2K5D A;  2QKI C;  1ZXT A;  1XPO A;  1SFO B;  1VQ7 A;  5I9P A;  4B3R Q;  4K5V A;  2VQE L;  4M1U B;  4H7B A;  1HTP A;  3BDL A;  2R93 B;  5BR8 Q;  1B53 A;  4FXK C;  4BS9 A;  2NN6 H;  4LFB L;  3I4L A;  3NE5 B;  3DLL A;  4QCL A;  2KJX A;  4XQN A;  2Z4I A;  2E5L Q;  3CRL C;  3GP7 A;  1FGU A;  1X54 A;  3FHW A;  4EQO A;  2ZTD A;  5FLX c;  1I4Q A;  1EY9 A;  2ZXR A;  1C0A A;  1EOT A;  2R61 A;  1Z9F A;  2RDF A;  4RMF A;  5A2Q E;  3T1H Q;  1LTL A;  1C8C A;  2WP8 J;  3VA7 A;  2BDO A;  3C3L A;  3V2T A;  2UXD Q;  1TU2 B;  3TS2 A;  2MP1 A;  3CME A;  2VB2 X;  3ZJY C;  3T56 B;  3TSS A;  1EY5 A;  2EXZ A;  1A2T A;  3CCQ A;  1ML0 D;  3VR2 A;  3KF6 B;  3PIO A;  1W2B A;  5C0X I;  4KJO A;  2QEX A;  4DU9 A;  2BOS A;  3PF5 A;  5IGG A;  3F2D A;  1PH6 A;  4JI2 L;  1CT1 D;  2ASB A;  1JJC B;  1JOR A;  1HA6 A;  1RKN A;  3ZYY X;  5DM6 3;  4JYA L;  1PYW D;  4JCV E;  5CBA E;  3NEM A;  3FP9 A;  3BDC A;  3R93 A;  5KEE A;  3DM3 A;  5K36 H;  3A55 A;  2F0U A;  3E5S A;  4BBS G;  4DV6 Q;  2K5V A;  2I07 B;  1G8Z D;  1SE4 A;  4C56 C;  1CZW A;  2PO4 A;  3MXN B;  4LF8 Q;  4RWS C;  2B3G A;  2F1M A;  3BDO A;  2LKV A;  3EIV A;  4Y7N H;  2O2L D;  5JJK A;  2WB1 B;  4C3I G;  1DXM A;  4KD3 A;  3I4M H;  2LXK A;  4AYB G;  1ZEQ X;  2GN5 A;  2H5X A;  2WKC A;  1QNK A;  4DXF A;  4C3H H;  1Y1W G;  1HUN A;  4LAA A;  2DGY A;  3OW2 A;  1EY6 A;  4DAY B;  2LSS A;  1F9P A;  4X64 Q;  1FNW A;  2JA7 G;  1PH3 A;  4KTA A;  1RIP A;  4ODG A;  1ILQ A;  1KDA A;  2K28 A;  3NSW A;  4A3C H;  3S14 H;  2RBM A;  2L4N A;  1STY A;  3J81 L;  4OX9 L;  1J5E Q;  1I50 B;  4KHP Q;  4DR1 Q;  4PZ6 A;  1LT5 D;  2PQA A;  4C2M B;  5M5X H;  4KMU C;  2Q8T A;  3HOU G;  2JA5 G;  4APV A;  3R3O A;  2OF1 A;  4B3R L;  2NN6 I;  2B2U C;  2HT1 A;  1ET6 A;  3S1R H;  4BY7 G;  1X3G A;  1ICW A;  2XGT A;  3BVG A;  4JC0 A;  2KEN A;  2IHE A;  4JV5 Q;  1II3 A;  1UWV A;  3NTI A;  1XJV A;  3HS0 C;  2L9H A;  2JA8 B;  4RAU C;  3U4V A;  2E5L L;  1I5F A;  4RGT A;  3JAM c;  1PV4 A;  3J81 j;  4LW1 A;  4A3K H;  4PNY A;  2DUD A;  3PUW A;  4TVA B;  4GNX C;  2KHI A;  2K5Q A;  3K5N A;  2Q2I A;  2QCP X;  2Y0S E;  1DZ1 A;  4N8X 1;  3T1H L;  2K4K A;  4DNT B;  3K6O A;  1CK1 A;  2A74 C;  4ILW A;  3BVZ A;  2UXD L;  4L63 B;  4DXG A;  4XIG S;  3RN5 A;  1QG7 A;  4MHE A;  5EPL A;  1EFW A;  4BXX G;  1TVX A;  1JIC A;  4IPH A;  3K59 A;  2VXW A;  2CQO A;  2MO1 A;  5C3E B;  3FDT A;  2NZO A;  1B7Y B;  3GTO B;  4RH6 A;  3J7A 5;  2R3Z A;  1U4P A;  1QIL A;  2QGQ A;  3NHH A;  4BBR B;  1R9T B;  1EIH A;  4LF5 Q;  4I65 A;  1VS0 A;  4K2K A;  1Y8N B;  1WOC A;  3PUZ A;  4NP5 A;  3CCU A;  1TII D;  1KDB A;  1SJE D;  1CM9 A;  1HNX Q;  3J81 c;  5CV9 A;  2BA0 A;  3HOW H;  4IPC A;  1R4P B;  4CJ2 C;  2O5I C;  1WTO A;  4DV6 L;  4A75 A;  2N55 A;  2PI2 E;  1Y1V H;  3W5O A;  3CC4 A;  1E7Z A;  1SMX A;  4UY8 C;  3J7A V;  1L2F A;  3W3A A;  5HY6 A;  1LTS D;  1K3R A;  1UAP A;  2I5H A;  2ZJQ A;  1BVS A;  1WTR A;  1S5C D;  2E8G A;  3GTG H;  4AIM A;  3LNN A;  4UDU C;  4RCN A;  5FLM G;  2UUA Q;  1TY0 A;  3IRB A;  5JVG 3;  4K6D A;  2VUM G;  1HJP A;  1Y8O B;  4X64 L;  1YJW A;  3RZO H;  4YY3 Q;  3ULP A;  3OWF A;  1K0S A;  2CFM A;  3CP0 A;  5CV4 A;  5IP9 G;  3CCJ A;  1A15 A;  5M5W B;  4UPA A;  1J6Q A;  2J0T D;  1GKH A;  2L55 A;  3QB3 A;  2RKS A;  1J5E L;  4IJL A;  4KHP L;  2NB0 A;  4DR1 L;  3A8K E;  1LTG D;  3L9A X;  1WI5 A;  3FKI B;  4IQZ A;  5IYD G;  3OIP A;  2JSO A;  3S9W A;  4X3K A;  2K1B A;  1STB A;  1EIF A;  3JC6 6;  1WVL A;  1HRJ A;  1U4M A;  3D6W A;  4JI8 Q;  1HZC A;  3HKS A;  2JP1 A;  1MD2 D;  4JI7 L;  3GTM H;  4G7Z C;  3ONA B;  1WTH A;  1FR3 A;  2OQ0 A;  3WDN A;  4R1J A;  3J81 E;  3K5M A;  2FIN B;  4JV5 L;  1VQJ A;  1TWA B;  2N78 A;  4HAE A;  5CR3 A;  5KYI A;  1VF7 A;  4JOI A;  3W1B A;  1VQA A;  5JEA J;  1KRS A;  5BN4 A;  1JB3 A;  4GOP C;  5D3I B;  5HUR A;  4A3B H;  2C35 B;  2NN6 G;  2B39 A;  1BCP B;  3HOY B;  2Q8I B;  2AQ2 B;  4DV5 Q;  2PPB C;  2R92 G;  2ALY B;  3MC0 B;  1EZ8 A;  2IW3 A;  3I4N B;  1PMR A;  1G29 1;  3ND8 A;  1XMQ Q;  1X55 A;  1HXY D;  2N3S A;  3NQI A;  1GXD C;  4TRD A;  4OXP A;  1MI2 A;  1BNZ A;  3HOX B;  3R8B A;  1TS3 A;  1ASY A;  1SN8 A;  2F52 A;  4LFA Q;  4JG2 A;  4LF5 L;  3Q22 A;  5FO8 B;  3OMC A;  1LV9 A;  5KIX A;  2NVQ H;  4HJ5 A;  2YTV A;  2RF4 A;  4DR7 Q;  1S72 A;  1HNX L;  2D9U A;  5GAE C;  2ATW A;  3D4D A;  4GLX A;  1O78 A;  3CCS A;  3G7L A;  1H9R A;  4OWT B;  2R7D A;  1WTX A;  1OXX K;  2JYO A;  3KDF A;  1LLR D;  5EJW A;  4HMI A;  2L5T A;  4DUY Q;  3PF4 A;  1S5D D;  3F2C A;  1N8R C;  3RR5 A;  4JI4 Q;  4I7A A;  1FJG Q;  2HCI A;  4DV1 Q;  1LM0 A;  3KK7 A;  1PH9 A;  2EYF A;  1SNP A;  2MPM A;  5IY0 A;  5K36 G;  2UUA L;  3CCR A;  3K58 A;  1UEB A;  1XMO L;  3OIQ A;  2OTL A;  5FJ8 H;  3S2D B;  5ISR A;  3CW2 C;  1MSH A;  1PH5 A;  4YY3 L;  1KC8 C;  4F8M A;  4IUR A;  3UDX A;  4QUF A;  5AJ3 L;  4GKK Q;  2RSO A;  3I4M G;  3P7J A;  5FOB B;  2J4X A;  4C3H G;  3X3N A;  4A3J H;  3ERS X;  2CKZ B;  4DAP A;  3D6C A;  1S5F D;  2JXM B;  2EYH A;  1Y14 B;  5EBD A;  1IW7 C;  3EVQ A;  3FRP B;  2JA6 G;  1VQ4 A;  3MHB A;  4JI8 L;  3CC7 A;  4V0B A;  4A3M H;  3WOF A;  3S24 A;  1OTC A;  2Z6B A;  1KXL A;  4H44 C;  2RCN A;  1Q7Y C;  2Z4H A;  2NWG A;  4OEL B;  2Q2H A;  5C4X H;  2ZJR A;  4BBS B;  1FNU A;  1K73 C;  1DCZ A;  3V05 A;  1ENA A;  3M3Y H;  4UAI A;  3MFG A;  2ZT9 C;  1N9W A;  4L5T A;  4LUO A;  5GRO A;  3A54 A;  4A3G G;  1SBB B;  3H6M A;  4C3I B;  4JI1 L;  5C44 B;  1TR5 A;  4AYB B;  1IKM A;  2LXJ A;  4DV5 L;  1XX8 A;  2N88 A;  3WWV A;  2KCM A;  5C5L A;  5M3F G;  3PIO 3;  3UI2 A;  4JI3 Q;  3J80 i;  1SSO A;  4WJW A;  1K0R A;  1XMQ L;  5E4X A;  1CI3 M;  2JA7 B;  3KBX A;  5LMN W;  1WJJ A;  2A8V A;  1LT6 D;  3QWN A;  4A3F B;  2A68 D;  2NVX H;  1IYV A;  3T53 B;  3DWA A;  4X65 Q;  1QWY A;  4JK1 C;  4K5X A;  1L1O C;  1PYS B;  3IAY A;  2HIV A;  4YWM A;  1RTN A;  3HOU B;  1VQF A;  5GQO A;  2JA5 B;  4DR7 L;  1PFN A;  1YNJ C;  4OHJ A;  2VQF Q;  3QOJ A;  4FYD A;  3J80 E;  1Y8P B;  1N33 Q;  4BY7 B;  3HZX A;  1TWF B;  3SXH A;  3BU2 A;  1SYE A;  1VQ6 A;  1JJ2 A;  1B3A A;  3I70 A;  4ZAI A;  2X6L A;  4A3I G;  3PGZ A;  3FEW X;  4KN7 C;  4NKL A;  2IT1 A;  5IGC A;  5M3M H;  3L2P A;  4JI0 Q;  1SNO A;  4XT3 B;  1VQO A;  1FJG L;  3K7U C;  3K80 C;  4DV1 L;  4G57 A;  3KF6 A;  3KJP A;  2ZXP A;  3V96 A;  5CYU A;  2F0E A;  5CGK A;  3RD4 A;  4FDB A;  1Y1V G;  4EVO A;  1S40 A;  3S1M H;  2EYP A;  1RJT A;  1X65 A;  1BXT A;  1N34 L;  1R4Q B;  4HCE A;  4GKK L;  3T16 A;  1E2W A;  1SE3 A;  3M7N A;  2KHS A;  4IFD I;  1QE6 A;  1LTT D;  4UP9 A;  2YU9 B;  2F0J A;  3H91 A;  3G6J B;  3MXN A;  1CSP A;  1KL9 A;  3VYT A;  1SJH D;  2NVY B;  1E2V A;  2A68 C;  1XXG A;  3K57 A;  1IBK Q;  3KOJ A;  4XYO A;  1NSN S;  4NW2 A;  2TMP A;  3X3M A;  2OQK A;  2GA4 B;  5I6Y A;  1ET9 A;  2Z6K A;  3RMH A;  4B9W A;  5KNC A;  4L5S A;  4I7Z C;  4ME5 A;  2AWO A;  4HIO A;  4DAY A;  2BE5 D;  2IX1 A;  5ELN A;  1O7I A;  2PQE A;  3B6Y A;  1E3P A;  2HDL A;  1D2B A;  4MTN A;  2IPK D;  5IP7 H;  5C5M A;  1PZK D;  3PO2 G;  3PCO B;  3DEP A;  2QDL A;  4OGQ C;  3NTH A;  3E9H A;  5JEA H;  1O7Y A;  1HA5 A;  2BA1 A;  2NZ1 D;  3H0G H;  1EU4 A;  1PTO B;  1UE1 A;  5C3W A;  4GLV B;  3CRK C;  4RCO A;  2HD3 A;  4J6H A;  1VQP A;  2VUM B;  4JI3 L;  4N9P A;  1AZQ A;  2N8N A;  2L12 A;  2QDB A;  1VQE A;  2OWO A;  3S16 B;  2F4I A;  3NQT A;  4FP5 D;  3TP5 A;  5CV5 A;  3HRZ C;  4X65 L;  2B63 H;  2IL8 A;  4IUQ A;  1GUN A;  4JPB W;  2RA4 A;  2XRS D;  4J8Q A;  4KN4 C;  2JEA I;  2F3W A;  4N8F A;  3K7A H;  2EY1 A;  2VQF L;  5JJL A;  5DAU A;  2B8G A;  2WAC A;  1YBY A;  2F0K A;  2SNM A;  3HOV H;  4K0K L;  1GHJ A;  1VQN A;  1EWH A;  1G2T A;  4IUU A;  1FNV A;  1N36 Q;  1G91 A;  1CZG A;  4JI0 L;  2ID0 A;  3MEF A;  1EIG A;  1U5K A;  1QVG A;  2BE5 C;  2NVT H;  2E2I H;  1JWU D;  2K52 A;  3Q8D A;  4ZLT F;  1K9M C;  1PVO A;  1X56 A;  1JQY D;  1TT2 A;  3D3R A;  4K5W A;  5EAY A;  4OX9 Q;  4HJ8 A;  2HIX A;  3TZD A;  5JJI A;  2R92 B;  3Q0A A;  3A7L A;  4R9W A;  1EY8 A;  1S5B D;  1SYG A;  4Q5V A;  3TS0 A;  3RZD B;  2OTJ A;  4FF2 A;  1D8L A;  1EU3 A;  3ERO A;  1QZG A;  3U9S A;  4RKB A;  1UNS A;  5JPN C;  2EQS A;  4RG1 A;  4ME3 A;  4KHZ A;  5FJ8 G;  1FYC A;  1E24 A;  3UDI A;  3KJO A;  5ELE A;  2PNR C;  4ZK9 B;  3I56 A;  1IBK L;  2MJ8 A;  4EX5 A;  2BH2 A;  1M4V A;  4RHS A;  4DR3 Q;  3F2U A;  1K28 A;  1CKO A;  2OEO A;  3VR6 A;  2JK8 A;  1FD7 D;  3A7A B;  1VF5 C;  3VR4 A;  3S17 H;  3CF5 A;  4NXN Q;  2L11 A;  1JWM D;  4A3J G;  1HNW Q;  1K83 H;  4WRD A;  1K3B C;  1XTC D;  2IX0 A;  2A73 B;  4KV6 A;  1AZP A;  5IYB H;  5IGF A;  4JI5 Q;  3T51 B;  4P74 A;  4A3M G;  5IYC H;  2L15 A;  4ZYS A;  1SFO H;  3H94 A;  2DNE A;  2F0O A;  5GAG C;  4FVM A;  3D31 A;  4YCW A;  4GKJ Q;  2R93 H;  3GV3 A;  5M5Y H;  4OIJ A;  2EYJ A;  2XSC A;  4DUZ L;  5DEH A;  3VDY A;  2WAQ E;  4WJ4 A;  2O4X A;  3P1H A;  5BN3 A;  4XDX A;  1YHQ A;  1ENC A;  2K14 A;  1S3O A;  2KEC A;  1EUJ A;  1DYQ A;  3HKZ E;  1O7L A;  3PO3 G;  2EVB A;  1PYB A;  3I4M B;  3S1N H;  4IOC A;  2EDG A;  4KKU A;  4C3H B;  4HSV A;  2RHQ B;  2OXP A;  2JA6 B;  1GHK A;  1PXU A;  1YI2 A;  1A3T A;  3KYH C;  2EE1 A;  1TWG B;  4AH6 A;  2F0I A;  5E4W C;  2NUC A;  3BYT B;  2F0S A;  4O2D A;  3ERQ A;  4MIU A;  4X6A H;  3PIP A;  3LWE A;  5EKK A;  1V1P B;  1BDO A;  1N36 L;  4DKA C;  1D6E C;  3U9O A;  4A3D G;  3MTS A;  3GTK H;  2N49 A;  5KRU A;  1BOS A;  1YEZ A;  1CQF A;  1Q46 A;  2EYL A;  3R2I A;  1Z6H A;  2HQL A;  3MWY W;  2P5Z X;  3GDE A;  3S1R B;  2L1B A;  4RGO S;  5CBE E;  4A3G B;  2PZT A;  1B4O A;  1I6H H;  3D0F A;  1Y69 U;  5C4Z A;  1YIJ A;  4CDE C;  1LYL A;  3S1Q H;  1WTV A;  3KLW A;  5M3F B;  4IFD J;  4ZCK A;  4MN3 A;  4N9T A;  4JI7 Q;  1UE6 A;  4LUZ A;  1DOK A;  1EQQ A;  1SAP A;  1W6J A;  1DOM A;  1X6O A;  2AUK A;  2KA7 A;  4RA8 A;  3FVQ A;  4LF6 Q;  2EZV A;  5IWA Q;  4HJA A;  2F3I A;  4LF4 Q;  3DEO A;  3IL8 A;  4A93 H;  4HN7 A;  4DR2 Q;  1JWS D;  1GUT A;  1KHI A;  2EJF C;  4ZQ3 A;  2F4V Q;  5ELO A;  1EQT A;  2RCF A;  4DR3 L;  1QNU A;  2GVA A;  1X32 A;  4HR7 B;  3GQB A;  1TY2 A;  3DHQ A;  3MXU A;  4NXN L;  5HGT A;  4IAL A;  1TWH H;  3MZ5 A;  1HNW L;  1AP0 A;  4LFC Q;  1I50 H;  1V9P A;  4C2M H;  2B8F A;  2FMM A;  3NBH B;  4G4K A;  4A3I B;  4ZUJ A;  4JI5 L;  2E76 C;  1SNM A;  5EKL A;  1A8V A;  2PMZ E;  1PH7 A;  1UUP A;  3GTL B;  5LL6 X;  4JOI C;  4HJ7 A;  3CC2 A;  1CA5 A;  4K6L A;  4RGN A;  4GKJ L;  5EQ0 A;  3OOC A;  1PRT D;  1KAW A;  2QF7 A;  4YWL A;  2SOB A;  1XNR L;  1Y1V B;  5JAV A;  4Y52 H;  3HOZ G;  1BBX C;  5IP7 G;  1EWI A;  1EIY B;  2CHB D;  4DK0 A;  2EYM A;  3H0G G;  4GS3 A;  4O0A A;  3SVM A;  3GTG B;  1OXV A;  3OYY A;  1SYD A;  1GJX A;  2EY6 A;  1STN A;  4IPG A;  2Z9H A;  1B3Q A;  2QIL A;  3HGB A;  3QO2 A;  1YNX A;  4WJ3 M;  1PH4 A;  4HCS A;  1CKN B;  4UP7 A;  1ZYR D;  4DR5 Q;  2KVM A;  1G51 A;  1D5X C;  2UXC Q;  3JAM i;  5C0X G;  1EQR A;  1ZKO A;  1NE3 A;  2CQA A;  2NBF A;  2XIW A;  1BBW A;  3SEB A;  2B63 G;  3ULL A;  1XMO Q;  4DFA A;  3GTO H;  4KY5 A;  1KNA A;  1I94 Q;  1MBY A;  1AW7 A;  3QG1 A;  5J39 A;  1J8I A;  2IX3 A;  1C7Y A;  3HEJ A;  2MQH A;  1BO0 A;  2XVS A;  4GN4 B;  3PO2 B;  5CV7 A;  3DMU A;  5AJ3 Q;  2EY5 A;  4DA2 A;  1DGS A;  1QVC A;  4HID A;  1EY0 A;  1E2Z A;  1PTO C;  4BY1 G;  2AQ3 B;  1LTI D;  3CPW A;  2DY8 A;  1CA6 A;  1KNE A;  2EYO A;  1CTM A;  5I2Y A;  1PRT C;  1QZH A;  2G9H D;  3QIA A;  3M4Y A;  4FXG C;  3CKI B;  3H09 A;  4DAM A;  1HR0 W;  1I4R A;  2VY3 A;  1V1Q A;  2I5L X;  2MFI A;  3IKJ A;  5C4J B;  1JMC A;  4LF6 L;  5IWA L;  4JBW A;  3VR3 A;  5COR A;  4RHR A;  2AKW B;  4LF4 L;  1RL2 A;  4ZRZ A;  4DGZ A;  1NY4 A;  4DR2 L;  2F4V L;  3CQZ B;  1WCM H;  3PV0 A;  2KCN A;  4G7H C;  1VQ9 A;  4QY7 A;  5M5W H;  2XWB B;  5IGE A;  1ZYR C;  5ELF A;  4QQB X;  4L5R C;  4JI1 Q;  1SDF A;  3GD7 A;  1LAC A;  1BBU A;  4LFC L;  1A63 A;  1Z7T A;  1GUO A;  3GTQ B;  3NPP A;  3NUC A;  2RSN A;  2NVQ B;  5IIF A;  5AFW A;  4KY6 A;  4RFB A;  3J80 L;  1AFP A;  1D1K A;  1A3U A;  1B8A A;  1RF2 D;  2HDM A;  4U67 3;  1QVF A;  3CCE A;  1IW7 D;  3PUY A;  1H9K A;  2ZM6 Q;  1E1T A;  1NMF A;  2VZA A;  2LFN A;  2X6G A;  1G6Z A;  5K5P A;  2ENB A;  2A19 A;  3GTJ H;  3H15 A;  4R8N A;  4WOR A;  4YCU A;  1PTO F;  1EY7 A;  4F88 A;  4F87 A;  1GD7 A;  1L0W A;  1VQC A;  1H9M A;  1F9S A;  1YIT A;  1WTQ A;  1PRT F;  4DR5 L;  2FHT A;  2B2V A;  3HFZ B;  1YNN D;  2WAQ G;  3G48 A;  4L6T B;  2ES2 A;  4QB4 A;  2UXC L;  4KK7 A;  3J7Z C;  2K6A A;  3NTK A;  5GAH C;  4OWW B;  3VYS A;  3PUV A;  3QR8 A;  2Z0S A;  3E3X A;  2FXQ A;  3HKZ G;  3A8I E;  1VQK A;  1XTD A;  4X62 Q;  1IBM Q;  1I94 L;  1Q8K A;  2XWJ B;  2I0Q A;  3FMC A;  4NPS A;  5A35 A;  4JBK A;  2UUC Q;  3RUZ A;  3G71 A;  4A3M B;  2O5J C;  1N34 Q;  1EFI D;  3F1Z A;  1G6P A;  1C9O A;  2C5C A;  1H9J A;  4X3S A;  2M9V A;  1PZI D;  1I3Q B;  1YNJ D;  5DNF A;  1PDQ A;  3U58 A;  5T1I A;  2X69 A;  1STE A;  2V1C C;  4KHV A;  5I2X A;  3S2H B;  3C1F A;  2QA4 A;  2KCC A;  2F0L A;  3J80 c;  4IFD H;  1MSG A;  2UU9 L;  3GTP H;  1PFM A;  4A3C G;  1A2U A;  1I4H A;  1YJN A;  1IBL Q;  3PO3 B;  4C3J H;  4GN5 A;  5IOD A;  5F2D A;  1LT3 D;  1HZA A;  2E2J B;  4DV0 Q;  3WOE A;  4P71 A;  1E1O A;  2F0H A;  4QF4 A;  4JW0 A;  1HUM A;  2F0N A;  1BUV T;  1EYG A;  3Q6S A;  2PW7 A;  4A3E H;  3S2D H;  2EIF A;  4A4I A;  1YHB A;  2DY7 A;  4NB3 A;  2B2W A;  3EJI A;  2WII B;  3IFD A;  4CKC A;  1TWC B;  4IZ8 A;  4ULL A;  2WIN B;  1JC7 A;  2A6H D;  3CHB D;  1PFB A;  5JJZ A;  2QEJ C;  1YNN C;  1B50 A;  3MAQ A;  1Y1W B;  4A93 G;  4PMC A;  2Z6K C;  4A3D B;  1VQM A;  2M00 A;  3H3V H;  1GVP A;  4PZ8 A;  1VQI A;  1FVI A;  4A3K G;  1KTK A;  4FF4 A;  1STA A;  5EPK A;  2ZM6 L;  2K5W A;  2Y0S G;  3CD6 A;  1U0L A;  1NR2 A;  5D14 A;  2FFK B;  4PMB A;  3TRE A;  1UE5 A;  2BDN A;  3M4O B;  4ABN A;  4AYB E;  1NJI C;  2F0P A;  4C3I H;  1F9Q A;  5C44 H;  4K0K Q;  2E2H H;  4G7O C;  2MNA A;  1IYU A;  3A5Z B;  1F2Y A;  2A1A A;  4PZ7 A;  1ASZ A;  4B3T L;  1EEI D;  1P8L A;  3CU7 A;  3F2B A;  1VDZ A;  3K81 C;  3HOW G;  3D8G A;  4IUV A;  1KDC A;  2J7Z A;  4EQP A;  4GNX B;  3SHL A;  3G4S A;  4A3F H;  1ICF B;  1W6K A;  2C9O A;  4DNI A;  2ZTE A;  4X62 L;  2IWH A;  1IBM L;  2KQ3 A;  3I73 A;  2DNC A;  3MXG A;  2A6H C;  2PZU A;  1M90 C;  2UUC L;  2SEB D;  1HCZ A;  3HOU H;  4C1N I;  5IOC A;  2Q2U A;  5D3D A;  1SRO A;  3OTO Q;  4BY7 H;  2JE6 I;  1A3V A;  1TWF H;  1YZ6 A;  3OMG A;  1KLG D;  3OSO A;  4IPD A;  1RDP D;  5M9O A;  3E0J A;  2CVR A;  3DXJ C;  2KEE A;  3HOZ B;  1HNZ Q;  3W2D A;  4GN3 B;  2WKD A;  1DOL A;  1IBL L;  3TP7 A;  4MNO A;  1V1P A;  3Q23 A;  3NWS A;  4DV0 L;  5ELB A;  1VQ5 A;  3OWE B;  1Q1B A;  2CCZ A;  1SRU A;  1RHP A;  4P2C B;  4LJZ C;  5J3B A;  2WFW A;  3T1Y Q;  4FNF A;  1VQH A;  3ICE A;  2LY7 A;  3SK6 A;  1U9R A;  3RLF A;  4XTC S;  1LTA D;  3RNU A;  3H3V I;  4M8A A;  5BN5 A;  1BCP D;  1CFM A;  1SND A;  4ALP A;  3KLR A;  1EQV A;  2B63 B;  1Z47 A;  1XNQ Q;  3N6R A;  4DUZ Q;  4JI6 Q;  4ID6 A;  2EXD A;  2NVY H;  3I91 A;  1LO5 D;  4X3U A;  4NDX A;  3RN2 A;  1WCM G;  3K7A B;  2B2T A;  4LK1 C;  4POF A;  4A3B G;  1K8G A;  2VNU D;  1O80 A;  3AMU A;  3A56 A;  4BY1 B;  1QUQ B;  1TS2 A;  3S15 B;  3EN2 A;  4K8I A;  3AFQ A;  1D1I A;  1Q1E A;  4CDF C;  3T4A C;  1F2L A;  1EL0 A;  2OCE A;  1PTO H;  5DM7 3;  2Q2T A;  1ONL A;  4PG3 A;  3NBH A;  3TP6 A;  1VMC A;  5HGQ A;  1PH1 A;  1L0Y B;  3LWU A;  2CW0 D;  1B2T A;  5EPJ A;  4A76 A;  2VUM H;  1DM0 B;  1JB7 A;  4QIW B;  4CKB A;  3E0E A;  1V1O A;  4GOP B;  2R6G A;  4NMZ A;  4OEM B;  3KLS A;  1PZJ D;  4FF1 A;  5IP9 H;  3S16 H;  1GOZ A;  3BZC A;  1VQL A;  4ZKC B;  3M9B A;  2AWN A;  1IZ6 A;  1E22 A;  4HJ9 A;  1BCP C;  1FL0 A;  4UHV A;  1H9S B;  1YJ9 A;  2RDG A;  3NEN A;  4OWX B;  3FPU B;  1N32 Q;  4KY7 A;  2CWP A;  2NZH A;  2R7Z H;  3A5U A;  1X3Q A;  5FKA C;  3OTO L;  3CMA A;  1CKN A;  3MEH A;  1X9N A;  1HFG A;  4C1N K;  2H1E A;  1HNZ L;  3UE1 A;  4A3L H;  1SMY D;  2B2Y A;  1I6V C;  1D5M C;  1PLF A;  4JVZ A;  1HZB A;  4DV7 Q;  3VR5 A;  4FXD A;  5M5Y B;  1MIU A;  3UE0 A;  4OIK A;  5G3L F;  3ITP A;  4MTK A;  3STB D;  5TSS A;  3L7Z C;  3LGJ A;  3T1Y L;  4IFD G;  5CV8 A;  2R92 H;  3RLO A;  2WAQ B;  3E9I A;  3RLN A;  4KLK A;  3A8J E;  1AE2 A;  2UXB Q;  4C3J G;  1H95 A;  4EQ5 A;  4QUC A;  1KRT A;  2CW0 C;  3RZD H;  1RD9 D;  3S1N B;  1KD1 C;  1JR0 D;  1VQG A;  3HKZ B;  4DF7 A;  5C4X G;  1XNR Q;  3J7Y W;  2UUB Q;  1BF4 A;  2BH8 A;  1XNQ L;  2K33 A;  4R4O A;  1MHW C;  4A3E G;  4JI6 L;  4LF7 L;  1DJR D;  3OW7 A;  4B3S L;  3C2P A;  3SK4 A;  5LMN L;  3F8T A;  3BJU A;  3TZU A;  5J1Z A;  3TP8 A;  4Y7N B;  2IHF A;  1QOH A;  1NCV A;  4K2L A;  5E7N A;  1HQM C;  1LAB A;  2G9D A;  5IT9 L;  3HG9 A;  1BCP F;  4KI0 A;  1K8A C;  1JT8 A;  1M8A A;  5CMD A;  3GTK B;  1K8O A;  1KIX A;  5IGD A;  3H3V C;  5D65 A;  4YHH Q;  3A0J A;  1VCI A;  4R4C A;  3PSI A;  4IO9 A;  3S14 B;  1HPC A;  3JAM L;  5DLQ E;  1SMY C;  1I6H B;  2F0M A;  5M5X B;  2HCC A;  5JPM C;  4DK1 A;  1CKM A;  3S1Q B;  5KND A;  1W3S A;  3EA6 A;  1V43 A;  5I6W A;  3AQQ A;  4CJ0 B;  3URY A;  4AQY Q;  4QMG A;  4RGM A;  5E3F A;  3GV6 A;  3STB C;  4IJH A;  3UDG A;  2F3V A;  1GO3 E;  5C44 G;  4LNQ A;  3I7F A;  4O1N A;  5FO7 B;  1OO9 B;  4DPG A;  3L3O C;  5FLX E;  3K0X A;  1LTR D;  4YIJ A;  4A93 B;  2FJ2 A;  1KAB A;  5NUC A;  4DAV A;  2JN4 A;  1Q90 A;  3CCL A;  2MGS A;  3KBG A;  5M3M G;  1AEX A;  2WB1 E;  3KF8 B;  1CHP D;  2D0P A;  3QJY A;  1D5Z C;  1C4Q A;  2F0Q A;  2TSS A;  4H0L C;  2JA6 H;  1N32 L;  4A3K B;  1TWG H;  2DN8 A;  1I4X A;  4A3F G;  1HFN A;  4QGU A;  2PCF B;  4PV1 C;  5EKI A;  5IGB A;  1TWH B;  4GZY C;  2BCO A;  1WTP A;  1L1O B;  4JBJ A;  2Y0S B;  2M2L A;  4Q0F A;  1MJE A;  1AE3 A;  2EY2 A;  4DR6 Q;  1JOQ A;  2KED A;  2JQO A;  1E0B A;  1PHJ A;  3EFX D;  1D7Q A;  2XNA C;  4KKS A;  3E6Z X;  2PMZ B;  3SDZ A;  4CKE A;  4A3G H;  4JBM A;  4P73 A;  5IT9 c;  4DV7 L;  5BR8 L;  5EBC A;  1GUG A;  3SK8 A;  2E2D C;  2KCT A;  4XXE A;  3I72 A;  3O13 A;  1KLU D;  2EOT A;  4K14 A;  4U68 A;  4KD4 A;  3CCV A;  5M3F H;  1EOV A;  3K0Y A;  1B1Z A;  1PTO D;  5LL6 S;  2UXB L;  5FK9 C;  3W1G A;  1EYC A;  3PQI A;  4Z9C B;  3HOW B;  4DV4 Q;  3MA2 B;  1YHA A;  4DV2 Q;  4IUT A;  3C1E A;  4P72 A;  2UUB L;  2Q8R E;  4KJN A;  1KAA A;  1CHQ D;  3SE0 A;  4F7X A;  1F77 A;  1MKH A;  3CPF A;  3UDF A;  2JA8 H;  5JEA G;  1SYB A;  5KGU A;  3SR1 A;  4R4Q A;  5LHY 1;  2HQE A;  3ER0 A;  5COY A;  3M85 A;  4NXM Q;  2PNH A;  1SYF A;  3RZO B;  4A3I H;  4YHH L;  4LMQ D;  3NEL A;  3DM1 A;  4OL7 A;  3TDQ A;  2F0D A;  3TEH B;  1K8M A;  3GTL H;  3K8A A;  3MFY A;  3AFP A;  5C3E H;  4DNR B;  2K50 A;  1B9N A;  2RQX A;  4ZUI A;  3KFU A;  4L8J A;  5IT9 E;  4BBR H;  4BWG B;  1R9T H;  2F0F A;  4P75 A;  1WD1 A;  4H13 C;  4LF8 L;  4AQY L;  2DJG C; 
#chains in the Genus database with same CATH homology
 3EBE A;  2ASB A;  1PH2 A;  1JJC B;  3PCO B;  4A3C G;  1B70 B;  3E9H A;  1YJN A;  2BA1 A;  1IBL Q;  3H0G H;  4C3J H;  4JYA L;  3HOV G;  1UE1 A;  4GN5 A;  4JCV E;  2YTX A;  3NEM A;  3FP9 A;  1HZA A;  4GLV B;  1KQS A;  4PMW A;  4DV0 Q;  3CAM A;  3DM3 A;  4P71 A;  1E1O A;  2B29 A;  4BBS G;  2HHH Q;  4DV6 Q;  2K5V A;  1VQP A;  1EYG A;  4JI3 L;  4A3E H;  3S2D H;  2EIF A;  3MXN B;  1YHB A;  4A4I A;  4LF8 Q;  2N8N A;  4NB3 A;  2UU9 Q;  1VQE A;  2B3G A;  1JJG A;  2OWO A;  3EIV A;  4Y7N H;  3J81 i;  4WJ3 M;  5JJK A;  5LMU Q;  3I4M H;  2LXK A;  4AYB G;  2GN5 A;  2H5X A;  2JEB I;  3BZK A;  4C3H H;  4X65 L;  1Y1W G;  2B63 H;  4A93 G;  1SLJ A;  2Z6K C;  2DGY A;  3OW2 A;  1VQM A;  4DAY B;  2LSS A;  2JEA I;  3ULJ A;  1GVP A;  4X64 Q;  3H3V H;  1X3F A;  4DR6 L;  4PZ8 A;  1VQI A;  4GNX A;  3K7A H;  2VQF L;  2JA7 G;  1PH3 A;  1FVI A;  4A3K G;  1OXS C;  4H02 A;  3PO2 H;  1RIP A;  2UXB Q;  5JJL A;  4A3C H;  2R7Z G;  3S14 H;  1YBY A;  1MJC A;  3HOV H;  4OX9 L;  1J5E Q;  4K0K L;  4KHP Q;  4DR1 Q;  4PZ6 A;  2ZM6 L;  2PQA A;  1VQN A;  3FKI H;  5M5X H;  2Y0S G;  1N36 Q;  3CD6 A;  1U0L A;  3HOU G;  4A3L G;  2JA5 G;  4APV A;  4R4T A;  4B3R L;  4JI0 L;  2NN6 I;  2ID0 A;  3MEF A;  3TRE A;  1U5K A;  1UE5 A;  1QVG A;  2NVT H;  2E2I H;  3A74 A;  2HT1 A;  2K52 A;  3Q8D A;  1K9M C;  4DV4 L;  3S1R H;  4AYB E;  1PVO A;  1X56 A;  1NJI C;  4BY7 G;  1X3G A;  4DV2 L;  5EAY A;  4C3I H;  4OX9 Q;  4DK3 C;  5C44 H;  5C4J H;  2ZJP A;  4HJ8 A;  2HIX A;  4B3M Q;  4K0K Q;  2E2H H;  2XGT A;  3A5Z B;  4JC0 A;  2KEN A;  2A1A A;  1HZ9 A;  2IHE A;  2MNA A;  5IYB G;  4JV5 Q;  5JJI A;  4PZ7 A;  1TWA H;  3M4P A;  1ASZ A;  1UWV A;  1XJV A;  4B3T L;  5IYC G;  3U4V A;  2E5L L;  1P8L A;  1I5F A;  2KHJ A;  4DR4 Q;  3F2B A;  3PO2 G;  3TS0 A;  3CQZ H;  3K81 C;  4R4I A;  1Q86 C;  3JAM c;  5C0X J;  3J81 j;  4LW1 A;  1PV4 A;  3HOW G;  1D8L A;  3AYH B;  4A3K H;  2OTJ A;  4GNX B;  1QZG A;  2DUD A;  1NMG A;  3G4S A;  4A3F H;  2EQS A;  2GVB A;  3PUW A;  4TVA B;  4RG1 A;  2R93 G;  4GNX C;  2KHI A;  4DNI A;  2ZTE A;  2D62 A;  4X62 L;  2Q2I A;  4ME3 A;  2Y0S E;  4KHZ A;  1IBM L;  5FJ8 G;  3KJO A;  1E24 A;  3UDI A;  3T1H L;  2K4K A;  2RHS B;  4NXM L;  3I56 A;  3HOY H;  1IBK L;  3GTQ H;  1M90 C;  4B3T Q;  2PQA B;  2UXD L;  3I4N H;  4XIG S;  2UUC L;  4EX5 A;  3HOU H;  3RN5 A;  2BH2 A;  1EFW A;  4BXX G;  4DR3 Q;  1CKO A;  4IPH A;  4LWC A;  2JK8 A;  1GM5 A;  2CQO A;  2MO1 A;  3S17 H;  1UE7 A;  2Q2U A;  3CF5 A;  3OTO Q;  1SRO A;  2NZO A;  4NXN Q;  4BY7 H;  2JE6 I;  1B7Y B;  1TWF H;  1YZ6 A;  3HOX H;  4A3J G;  1HNW Q;  1K83 H;  4GLA C;  4IPD A;  3J7A 5;  2IX0 A;  2QGQ A;  4LF5 Q;  5IYB H;  4QJF A;  1VS0 A;  1WOC A;  3PUZ A;  1HNZ Q;  4JI5 Q;  4P74 A;  4A3M G;  5IYC H;  3CCU A;  2L15 A;  1SFO H;  2AMC B;  4GN3 B;  1IBL L;  1HNX Q;  3J81 c;  5GAG C;  4MNO A;  1QUQ A;  2BA0 A;  2K5N A;  3HOW H;  4DV0 L;  4IPC A;  3D31 A;  4YCW A;  1VQ5 A;  4GKJ Q;  2R93 H;  1Q1B A;  5M5Y H;  2CCZ A;  2HHH L;  1SRU A;  4DV6 L;  4A75 A;  2PI2 E;  1Y1V H;  3W5O A;  3CC4 A;  4DUZ L;  1E7Z A;  1SMX A;  4UY8 C;  5J3B A;  2WFW A;  3VDY A;  2WAQ E;  1L2F A;  2YTY A;  3T1Y Q;  1IL2 A;  4WJ4 A;  5HY6 A;  1YHQ A;  1HR0 Q;  1K3R A;  1VQH A;  2K14 A;  1S3O A;  1WYD A;  3ICE A;  3RLF A;  4XTC S;  2I5H A;  2ZJQ A;  1BVS A;  3RNU A;  1EUJ A;  3HKZ E;  5LMU L;  3PO3 G;  3H3V I;  2JJQ A;  2E8G A;  4LF9 Q;  4AIM A;  3GTG H;  1PYB A;  3S1N H;  4ALP A;  5FLM G;  2KBN A;  4IOC A;  2UUA Q;  1Z47 A;  2RHQ B;  3IRB A;  1XNQ Q;  1PA6 A;  1HJP A;  4DUZ Q;  2VUM G;  4GOP A;  4JI6 Q;  2EXD A;  1Q12 A;  2NVY H;  4MZ9 A;  1H95 A;  3G6E A;  4X64 L;  1YJW A;  3RN2 A;  1WCM G;  1A0I A;  3RZO H;  4YY3 Q;  3ULP A;  1YI2 A;  2CFM A;  3CP0 A;  2VL6 A;  3KYH C;  4AH6 A;  5IP9 G;  3CCJ A;  2YV5 A;  4UPA A;  1J6Q A;  2WB1 G;  4O2D A;  1GKH A;  4POF A;  4A3B G;  1XPU A;  5IE8 A;  1K8G A;  1J5E L;  4IJL A;  4KHP L;  4DR1 L;  2VNU D;  1I3Q H;  4X6A H;  3PIP A;  1QUQ B;  2R7F A;  1WI5 A;  3EN2 A;  1N36 L;  4DKA C;  3S2H H;  4X66 Q;  5IYD G;  4A3D G;  3AFQ A;  3GTK H;  2N49 A;  1EIF A;  3JC6 6;  1Q1E A;  1YEZ A;  1Q46 A;  5GAD C;  1CUK A;  2MO0 A;  3TRZ A;  2HQL A;  4JI8 Q;  1HZC A;  3HKS A;  4JI7 L;  3GDE A;  2OCE A;  3GTM H;  3PO3 H;  1IXR A;  2Q2T A;  2OQ0 A;  4PG3 A;  2E2J H;  4B3M L;  1I6H H;  3D0F A;  5HGQ A;  4R1J A;  4BA2 I;  1PH1 A;  4JV5 L;  1YIJ A;  1IYJ B;  1VQJ A;  1LYL A;  2N78 A;  3S1Q H;  4BBS H;  4IFD J;  3KLW A;  1NTG A;  4OON A;  4JOI A;  3W1B A;  1VQA A;  4YWK A;  1WFQ A;  4DV3 Q;  4A76 A;  1JB7 A;  2VUM H;  3E0E A;  4DR4 L;  4GOP B;  2R6G A;  5JEA J;  1KRS A;  4GOP C;  1JE5 A;  4JI7 Q;  1UE6 A;  4LUZ A;  1TWC H;  5IP9 H;  3S16 H;  3L0O A;  1EQQ A;  1X6O A;  1X3E A;  4LF6 Q;  4A3B H;  4OO1 I;  5IWA Q;  2C35 B;  2NN6 G;  3BZC A;  1VQL A;  4AQY L;  3M9B A;  2AWN A;  2F3I A;  4HJA A;  3PUX A;  1Y1W H;  1IZ6 A;  1E22 A;  4UP8 A;  4HJ9 A;  4LF4 Q;  4LFA L;  4DV5 Q;  2R92 G;  4A93 H;  1NBW A;  2ALY B;  1BKB A;  1FL0 A;  4DR2 Q;  2JA8 G;  4A3D H;  3U4Z A;  1KHI A;  1G29 1;  1YJ9 A;  2F4V Q;  3NEN A;  5ELO A;  1XMQ Q;  4DR3 L;  4OWX B;  2GVA A;  1X55 A;  2JA7 H;  2N3S A;  1T9H A;  1N32 Q;  4L5Q A;  1VQ8 A;  2CWP A;  2NZH A;  2R7Z H;  3A5U A;  4NXN L;  3OTO L;  4OXP A;  1Q82 C;  1TWH H;  4LF9 L;  1SE8 A;  1HNW L;  3CMA A;  1CKN A;  1ASY A;  1SN8 A;  4LFC Q;  1I50 H;  1X9N A;  1V9P A;  2F52 A;  4LFA Q;  4C2M H;  2IY5 B;  4JG2 A;  3NBH B;  2VW9 A;  4LF5 L;  1OXT A;  4YCV A;  1HNZ L;  4JI5 L;  5H1S E;  3UE1 A;  2NVQ H;  4HJ5 A;  2CWA A;  2YTV A;  2JA5 H;  1A8V A;  4A3L H;  2RF4 A;  4DR7 Q;  4QL5 A;  2PMZ E;  4DUY L;  1PH7 A;  1S72 A;  4JI4 L;  1YVC A;  1HNX L;  5GAE C;  4TQU S;  4JOI C;  5C3E G;  4HJ7 A;  1PH8 A;  3CC2 A;  2ATW A;  3M4O H;  4GLX A;  4GKJ L;  1HZB A;  4DV7 Q;  3CCS A;  1KAW A;  4YWL A;  1XNR L;  1MIU A;  3UE0 A;  4BBR G;  4OWT B;  2R7D A;  3STB D;  1OXX K;  3L7Z C;  3LGJ A;  3T1Y L;  3KDF A;  4Y52 H;  4IFD G;  3HOZ G;  2R92 H;  5IP7 G;  1HR0 L;  1EWI A;  3RLO A;  3E9I A;  4DUY Q;  3PF4 A;  1EIY B;  3RLN A;  4KLK A;  1AE2 A;  3F2C A;  3H0G G;  4GS3 A;  3RR5 A;  3I55 A;  4EQ5 A;  4O0A A;  1Q81 C;  1N8R C;  1KRT A;  4DV1 Q;  3RZD H;  1OXV A;  1LM0 A;  2VQE Q;  2ZTC A;  3OYY A;  1PH9 A;  1KD1 C;  3U50 C;  5IY0 A;  5K36 G;  1VQG A;  3M4Q A;  2UUA L;  4IPG A;  3CCR A;  5C4X G;  1CSQ A;  1UEB A;  1XMO L;  1XNR Q;  1YNX A;  2OTL A;  2UUB Q;  2BH8 A;  1PH4 A;  1XNQ L;  4LF7 L;  4R4O A;  1SR3 A;  5FJ8 H;  4A3E G;  4JI6 L;  4LFB Q;  1CKN B;  4UP7 A;  3CW2 C;  1LUZ A;  4B3S L;  4DR5 Q;  2JA9 A;  5LMN L;  1PH5 A;  4YY3 L;  1KC8 C;  3F8T A;  3BJU A;  1G51 A;  4BA1 I;  2XTI A;  2UXC Q;  3UDX A;  2IHF A;  4BXX H;  3JAM i;  5C0X G;  1EQR A;  5AJ3 L;  4GKK Q;  3I4M G;  1NE3 A;  3CCM A;  5E7N A;  2YU9 H;  2VS1 A;  1BBW A;  2B63 G;  3ULL A;  1XMO Q;  3GTO H;  2YYZ A;  4A3J H;  3ERS X;  2CKZ B;  4X66 L;  1I94 Q;  4KI0 A;  4LF7 Q;  3SGI A;  2D0O A;  1K8A C;  1JT8 A;  1Y14 B;  4B3S Q;  5LMN Q;  1KIX A;  1C7Y A;  2JA6 G;  1VQ4 A;  2MQH A;  3TQY A;  3HOZ H;  4YHH Q;  1PFS A;  3A0J A;  4GN4 B;  1VCI A;  3KDF B;  4J15 A;  4JI8 L;  3CC7 A;  4R4C A;  3S24 A;  4A3M H;  1OTC A;  3PSI A;  5AJ3 Q;  4IO9 A;  1KXL A;  1TXY A;  1DGS A;  1L1O A;  1HH2 P;  1QVC A;  4HID A;  1Q7Y C;  2RCN A;  5DLQ E;  4BY1 G;  2Q2H A;  3FKI G;  5C4X H;  2ZJR A;  3I4O A;  1CKM A;  3CPW A;  2UU9 L;  1K73 C;  1W3S A;  1VQD A;  4DV3 L;  1V43 A;  4HIM A;  3AQQ A;  1AH9 A;  3M3Y H;  1QZH A;  4HIK A;  4AQY Q;  4JI2 Q;  4DAM A;  1N9W A;  4L5T A;  4LUO A;  3STB C;  4IJH A;  5GRO A;  3UDG A;  1HR0 W;  4A3G G;  4JYA Q;  2VY3 A;  1GO3 E;  1V1Q A;  4JI1 L;  2I5L X;  2MFI A;  5C44 G;  3I7F A;  1JMC A;  4LF6 L;  5IWA L;  3CXC A;  2LXJ A;  4LNQ A;  4JBW A;  4DPG A;  5FLM H;  3GO5 A;  2AKW B;  4LF4 L;  1RL2 A;  3K0X A;  4DV5 L;  5M3F G;  3WWV A;  2KCM A;  1NY4 A;  4DR2 L;  4JI3 Q;  3J80 i;  1M1K C;  3CCL A;  5M3M G;  1VQB A;  1A62 A;  2F4V L;  1K0R A;  1XMQ L;  1WCM H;  2WB1 E;  3KF8 B;  2D0P A;  3PV0 A;  2JA6 H;  4DK6 C;  1VQ9 A;  5LMN W;  1N32 L;  1TWG H;  4LUV A;  4QY7 A;  5M5W H;  1WJJ A;  2A8V A;  4A3F G;  2NVX H;  4QGU A;  4JI4 Q;  4QQB X;  4L5R C;  1N33 L;  4IOA A;  4JI1 Q;  3GD7 A;  1FJG Q;  1BBU A;  4LFC L;  1A63 A;  1L1O B;  4X65 Q;  2PI2 A;  4BY1 H;  3HOY G;  3S15 H;  1L1O C;  1PYS B;  4JBJ A;  3I2Z A;  2HIV A;  4YWM A;  3I4N G;  5IYD H;  1MJE A;  1AE3 A;  4POG A;  1VQF A;  5GQO A;  4DR6 Q;  4DR7 L;  4OO1 G;  2VQF Q;  2JQO A;  1PHJ A;  1B8A A;  1QVF A;  1D7Q A;  2K5H A;  1N33 Q;  3CCE A;  4A3G H;  4JBM A;  4P73 A;  3PUY A;  2I5M X;  5IT9 c;  3HOX G;  3BU2 A;  4DV7 L;  5BR8 L;  1VQ6 A;  2KCT A;  1JJ2 A;  4B3R Q;  2ZM6 Q;  1E1T A;  1NMF A;  2VZA A;  4QIW E;  4A3I G;  1XPR A;  3CCV A;  3PGZ A;  5M3F H;  1EOV A;  3AEV A;  2AHO B;  1OXU A;  2IT1 A;  1P16 A;  2K75 A;  5M3M H;  2A19 A;  3L2P A;  1XPO A;  1VQ7 A;  3GTJ H;  3H15 A;  4JI0 Q;  2UXB L;  3W1G A;  1VQO A;  1FJG L;  3K7U C;  3K80 C;  4DV1 L;  4YCU A;  2VQE L;  3KF6 A;  4DV4 Q;  3KJP A;  1YHA A;  4DV2 Q;  1GD7 A;  1L0W A;  4FDB A;  5BR8 Q;  4P72 A;  1VQC A;  2UUB L;  1Y1V G;  4LFB L;  3DLL A;  1S40 A;  1YIT A;  3S1M H;  4DR5 L;  1MKH A;  3CPF A;  3HFZ B;  3UDF A;  2JA8 H;  1X65 A;  2WAQ G;  3G48 A;  2ES2 A;  2E5L Q;  2UXC L;  1N34 L;  5JEA G;  4GKK L;  1FGU A;  1X54 A;  3FHW A;  3J7Z C;  3M7N A;  2ZTD A;  5GAH C;  4OWW B;  5FLX c;  3PUV A;  4IFD I;  2Z0S A;  2FXQ A;  1C0A A;  3HKZ G;  4UP9 A;  1VQK A;  1XTD A;  4X62 Q;  1IBM Q;  1Z9F A;  4RMF A;  4R4Q A;  1CSP A;  1Q8K A;  1KL9 A;  1I94 L;  2I0Q A;  3T1H Q;  3ER0 A;  4NPS A;  1LTL A;  3M85 A;  4NXM Q;  2WP8 J;  1IBK Q;  2PNH A;  3KOJ A;  4A3I H;  4JBK A;  2UXD Q;  4YHH L;  2UUC Q;  3NEL A;  3G71 A;  3TS2 A;  1N34 Q;  2OQK A;  3F1Z A;  3CME A;  3TEH B;  3ZJY C;  1C9O A;  1G6P A;  3GTL H;  3K8A A;  5C3E H;  2Z6K A;  3AFP A;  4L5S A;  2K50 A;  3CCQ A;  3U58 A;  3KF6 B;  2AWO A;  3PIO A;  4HIO A;  2V1C C;  1W2B A;  5C0X I;  2IX1 A;  5ELN A;  3KFU A;  2QEX A;  2QA4 A;  4BBR H;  1R9T H;  1O7I A;  4P75 A;  3B6Y A;  1E3P A;  3J80 c;  3PF5 A;  4MTN A;  4LF8 L;  3F2D A;  1PH6 A;  4JI2 L;  5IP7 H;  3GTP H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...