4FP5D

Heat-labile enterotoxin ilt-iibb5 s74a mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
98
structure length
98
Chain Sequence
b'GASQFFKDNCNRTTASLVEGVELTKYISDINNNTDGMYVVSSTGGVWRISRAKDYPDNVMTAEMRKIAMAAVLAGMRVNMCASPASSPNVIWAIELEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heat-labile enterotoxin IIB, B chain
publication title Structure-activity correlations of variant forms of the B pentamer of Escherichia coli type II heat-labile enterotoxin LT-IIb with Toll-like receptor 2 binding.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
total genus 24
structure length 98
sequence length 98
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2012-06-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.50 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4fp5D00
1QB5D 4FNFA 5G3LF 4FO2A 5G3LD 4FP5D 1QCBD 1TIID
chains in the Genus database with same CATH superfamily
2EDGA 3TP7A 4A3EB 1WTXA 4LFCQ 3LNNA 3FEWX 3WOFA 4YY3Q 1YITA 1Y1VH 1PH9A 4CKCA 1LTLA 3HOXB 2AQ1B 4BBSH 3TRZA 4TVAB 3CCMA 4JOIC 1JJ2A 1HNXQ 1PMRA 3SK4A 2RBMA 4Z9CB 1XNRL 3S1MB 3NXWA 3VA5A 3CAMA 4LF5Q 3F8TA 4A3JB 4A93G 2BH8A 1JE5A 3CRKC 2JXMB 3U4ZA 2SNMA 1VQJA 2IW3A 4HJ8A 1C48A 1WTHA 2F0LA 3WDNA 4G57A 3J81j 2NB0A 3R2IA 4JBWA 4KKSA 1STBA 4QUCA 1QJOA 2A6ED 3JAME 3V96A 2Q2IA 2CHBD 2CW0C 2IX3A 1VQIA 4C3IB 3CHBD 3HZXA 5BR8Q 5IYCH 1VQCA 3FKIB 1LACA 1XMQL 2O5JC 2NBFA 2J4XA 4GKJQ 3BDLA 3MXUA 2I5HA 2M00A 4A3FG 1CK1A 3CQZH 3IL8A 4DK6C 1HZ9A 1XMOL 2R7ZG 2MGSA 3NWSA 4DR1L 2WB1E 3M7NA 3CP0A 1VQ9A 4Y52H 1CZGA 4YCUA 1SYDA 5TSSA 3OOCA 4G4KA 5JEAH 1HFNA 5E4XA 3FRPB 3A8IE 5AJ3Q 1Y8PB 1V43A 5EJWA 4ZRZA 4IFDG 4DAYA 1XPOA 4ZKBB 4OHJA 5HGQA 1I4QA 3HOVG 2H5XA 5NUCA 5I4DA 2VZAA 1X65A 2R7DA 2K4KA 3PUVA 5C0XH 2A6HD 2K05A 3AYHB 3GTGB 5M3FB 2EVBA 3JAMi 1PYBA 1D5XC 3S24A 3FVQA 4DAYB 5IT9L 4S3SA 2HCIA 2KOLA 2F0IA 2EYLA 1VQKA 3J7YW 5KYLA 1SE4A 1D1KA 3PMFA 1IKLA 2JA6B 3EIVA 3HG9A 1RD9D 3N52A 4QGUA 1EYAA 1MJCA 1LTRD 2MPMA 2DY8A 1F9PA 3T53B 4ABNA 1B9MA 4DGZA 2Z0SA 1LTID 3E6ZX 2FXQA 2YTVA 1WTOA 1WTRA 3S1QH 2XNAC 1XNQQ 1STAA 1PZJD 3I72A 4LF5L 1PVOA 3OIPA 4XT1B 2D0PA 5JPNC 3U4VA 1YHBA 3RLFA 4C3HH 3CPFA 4L8JA 3DM1A 3F2DA 5CV4A 5GAGC 1IBLL 3ULLA 1SRUA 3D4DA 2UXBQ 4JI5L 1HUNA 5GROA 3CC2A 1SJED 1YJ9A 2ZXOA 2EPBA 1RDPD 4IFDI 1WJJA 1ZXTA 3EROA 1XYIA 4NB3A 1TIID 1BO0A 4X65Q 3K57A 3ERSX 3MXNA 4GKJL 5T1GA 5KNCA 2WKCA 1HQMC 2K5DA 2XWBB 4CKBA 2L15A 1ILQA 2Q8RE 4P73A 4A3LG 1RCVD 3OYYA 2N3SA 3MXNB 1H9MA 1PH8A 3HOZG 3IRBA 1MHWC 3FPUB 1Q1BA 3KFUA 4KHPL 3BDCA 3EBEA 4L6TB 5J22A 1HXYD 3I4NG 3T16A 3HRZC 3A7LA 4IUTA 4R4QA 2N8NA 1WTQA 4IPCA 2KBNA 1KHIA 2R6GA 4IUQA 2RKSA 3VR3A 3S2DB 4ME3A 3QOJA 2O5IC 1O7IA 4MN3A 2MO1A 3P75A 1BCPD 5CORA 1OO9B 1JT8A 5FLXc 4GOPA 4IN3A 5IGGA 5CC4A 1MI2A 1J5EL 3OW7A 4DAVA 1SMYC 1M4VA 1TS4A 1X55A 1JOOA 1RL2A 2ZTCA 3PIO3 1STEA 2UUBQ 2PZUA 1PH4A 1F2LA 5LMNW 3HOYH 3GTQB 3M4OH 1EFID 3KBXA 1VQHA 4GOPB 4KN7C 4C3JB 3K0YA 4IO9A 4A3FB 3I7FA 2YV5A 4J15A 4HR7B 2R7ZB 2IL8A 5C3XA 4HIMA 1IL2A 3I91A 3BVMA 2IHFA 2SOBA 4JI0Q 4LF8Q 1UE6A 1LUZA 5DM63 4J8QA 1XNQL 3STBC 3R3OA 1PH7A 4X6AH 2QEXA 3AFQA 1IYJB 2PQEA 2WAQG 5KGUA 4DR6L 1CZWA 2XRQD 3NPPA 3EFXD 5CGKA 3GTMB 2Y0SG 5BN3A 3FHWA 1IW7C 1AZPA 3P20A 3JAMc 4RGOS 3QWNA 5LMUL 3K80C 2QDBA 1HTLD 2CQOA 5DNFA 4Y7NH 4K6DA 1AH9A 1CHPD 1B7YB 4LF9Q 1SYGA 2DUDA 4JV5Q 1V9PA 4KD3A 3L9AX 3BJUA 2MHVA 5IIFA 3DEOA 1MIUA 3H3VC 1FD7D 2A68C 4LFBL 1BBUA 1I3QB 2RA4A 4H7BA 2ZTDA 2F0UA 2KHSA 4JI3Q 4OWWB 1NTGA 1EL0A 1F77A 1B9NA 1MD2D 3EQLC 2D9UA 4WJ4A 1O7LA 2DN8A 2QGQA 1PRTC 5IY0A 1BNZA 1DD2A 1RF2D 1XTDA 3S1NH 3K5OA 1UE1A 3AQQA 2R93G 1Q81C 2EYMA 1W2BA 4JI8Q 1BR9A 1ESFA 1EEFD 1BBXC 4WFN3 1VMPA 2QCPX 1JCKB 2Z6KC 1X3FA 2A69C 1D7QA 1DCZA 4A3CH 2NN6H 2UUBL 4PNYA 4TKOB 3GTKH 4B3RQ 1F2YA 1PDQA 4HN7A 1QE6A 1VQOA 2Q2HA 3K6OA 3PO3H 2ZXRA 1L0XB 4JYAQ 4HTHA 1TWCH 4GZYC 2VUMG 4POGA 2RSNA 3ER0A 1K83B 2ALYB 4A3BH 4F88A 4HCSA 2IJ0A 1VQ5A 3BZCA 3HOZB 3SK8A 2HHHQ 2B63H 1W6KA 2EXZA 2AQ2B 3K5LA 5IP7G 3W3AA 4R4CA 2JYOA 3I4NB 2J0TD 3CKIB 4GNXC 2I0QA 1P16A 2D0OA 3GD7A 1SE2A 4GKKQ 1JJGA 3B6YA 1I6HH 1MSGA 4YHHQ 2R7FA 3OWFA 1NR2A 3E9IA 4A3DB 1VQ7A 2WFWA 3M85A 5CYUA 4PV1C 1EIGA 2JA7G 2UXDQ 4RWSC 1KAAA 1Q46A 1S5BD 4LF9L 2NVYB 4RKBA 5M3MH 4CGYB 2B2TC 1VQDA 4PZ7A 2QDLA 1KD1C 2VW9A 1Z47A 4LUVA 4DUZQ 1K9MC 5K5PA 1EUJA 3PUYA 2RDHA 2A6EC 2NZOA 3X3NA 3MAQA 5C44G 1YVCA 1LV9A 2NVTH 1PH5A 2PNRC 2IY5B 1VS0A 3A74A 2WAQB 3C1EA 3S17H 2C5CA 4HMJA 3I4OA 3W2DA 2Y0SB 4JBKA 1O80A 4JI8L 3J7A5 1PH3A 3GV6A 1DXMA 3WOEA 2UXCL 1A3TA 1TS5A 1A3VA 4K14A 2EY5A 1HHVA 5EBCA 4KKTA 4FF3A 1FJGL 1M90C 1PFSA 4DV5L 1TWAB 3I4MB 3ZYYX 2NWGA 1CT1D 2F0SA 2IHEA 3TP8A 4B3RL 1SNMA 1GO3E 2R92H 2G5DA 4ODGA 1SROA 3EN2A 3K8AA 4IQZA 4WJWA 3CCVA 3S1RB 4OELB 4ILWA 5KEEA 3KF8A 4F87A 4BWGB 3GTOH 4JYAL 3KLWA 2ICIA 4B3TL 1FVIA 1HNWQ 1JR0D 3AFPA 1T5EA 4LF4Q 1BQQT 2HHHL 1Z6HA 2K5QA 1IXRA 1J9OA 1PYWD 3KF8B 2XTIA 1KXLA 3QG1A 1CA5A 2MO0A 1YJNA 1PTOD 5A2QL 3JC66 3K5NA 4LF7Q 2R93B 5FLXL 1CQVA 1QCBD 1SFOH 1LTGD 3AMUA 2Z6BA 1ASYA 4KHZA 4A3JG 3GO5A 2AKWB 3SK5A 4J6HA 1C8CA 4FXDA 1D2BA 2UXDL 4XDXA 5E3FA 4POFA 5BN4A 3GTPB 4XTCS 1STHA 3ULJA 1OXXK 1PLFA 4GLXA 2RSOA 2KENA 2X69A 4FXGC 1X3GA 4FXKC 3FKIG 4KD4A 4X3TA 2FINB 5M5WH 1Y1WH 1E2WA 1FL0A 5FO7B 4KN4C 5I2XA 4Q0FA 1E2VA 1JE4A 4P75A 3TSSA 2WAQE 4IJHA 2E2HB 2K5NA 2K52A 1AE2A 2JA6H 4JK1C 4QJFA 3S15B 2ZTEA 1FR3A 2Y0SE 5HY6A 4RCOA 2AMCB 3LX0A 5I6YA 4DR4Q 2JK8A 1Q90A 2E5LL 1HR0W 3GTJB 3NQTA 4IURA 3JAML 2JA8H 2V1CC 3W1BA 1K28A 5C3WA 4B3MQ 3TP6A 1G291 5FLMG 3KBGA 4KLKA 3UDXA 4TRDA 5C4XG 3PIP3 2JA7B 5D14A 4LUZA 4GLAC 1I50H 4DV6L 3GDEA 3URYA 2UUCL 1BOSA 2EY2A 2B2YC 4G7OC 2IX0A 2NVXB 3SGIA 1K0RA 5M3FG 1F2MA 5K36G 3AB9A 1K0SA 1WVLA 1VQ8A 1BCPC 4UP9A 1XMQQ 5C4JB 4A75A 2V4DA 2JJQA 2XN9C 2FJ2A 5C3EG 3NBIA 5C44B 2MUYA 3RR5A 4A3KG 4LF4L 4RA8A 1J8IA 1XMOQ 1EY6A 1V1QA 1EYGA 4DU9A 1BVSA 1H9KA 4NKLA 3H3VI 1TQOA 3UDFA 1WI5A 2OCEA 2L5TA 3E3XA 5ISRA 4A93H 4ULLA 1N33L 4HJ7A 3VDYA 3PF4A 4QUFA 4BA1I 3S9WA 1F9RA 4PQXA 4QL5A 2B8FA 1L0YB 1TWFH 5EPKA 3SK6A 4A3IG 3M4YA 3H09A 1TWHB 3P7JA 3LWEA 4CDDC 4RKLA 2M2LA 4PZ6A 1EIFA 1STGA 2MJ8A 1E3PA 4QF4A 3K59A 1S5CD 5JVH3 1ZYRD 1LTBD 3SR1A 5IODA 4QQBX 4NXNL 2R7ZH 1I5FA 4F8MA 2KA7A 2BDOA 4DR4L 3OHXC 1GHJA 4MTKA 1Y69U 4HIOA 4YWLA 2I46A 1B3AA 1IYUA 2PQAA 4JBJA 4B3ML 4QY7A 5M5YH 3H0GB 2B2WC 4XIGS 2F0HA 2EYPA 1IBLQ 3HOVH 4KI0A 3OPOA 2E2IH 4JI5Q 1U4RA 4DV0L 5LHY1 2KECA 2PQAB 2LXKA 1QZGA 1C7YA 2JP1A 4ZUIA 2H1EA 1EFWA 3TDQA 1QB5D 1S5DD 1R4QB 4V0BA 4C3JG 4EQPA 1NSNS 4IUVA 1ESRA 1QVCA 1TS2A 1U0LA 4LUOA 1UEBA 1VQAA 4U68A 4MTNA 1AP0A 1I3QH 4GLVB 5D3IB 1SNQA 2LS01 5KNDA 4IPGA 3Q0AA 2G9DA 2B2UC 1JJCB 4JI2L 1AFPA 1EQTA 1PRTB 2RCNA 4UDUC 1VDZA 1UE7A 1YHAA 5CV5A 1EY4A 1SBBB 2RHSB 4ZK9B 4KHPQ 4PMCA 2B29A 3ONAB 2GN5A 1Y1VG 5C4XB 1FNWA 2F0GA 4HJAA 1GVPA 4BBSG 3NWTA 2Z4HA 4M1UB 4Q5VA 1JWMD 1K73C 4EGVA 2HIXA 4H13C 1J5EQ 1WOCA 1STNA 4WRDA 2N49A 4BY7H 1E1TA 1O7YA 3MFYA 2Z4IA 2F0NA 3TMEA 3KLSA 2I07B 3RD4A 1K3BC 1XX8A 5C3EB 5CV6A 3CCLA 1Q7YC 1ICFB 1SMXA 4A3KB 3MVVA 4R4OA 2CQAA 3GTLH 5EKIA 2VQEL 2MQHA 1KTKA 1DONA 1S5FD 1SXTA 5C4HA 1DOLA 2E76C 1HA5A 1HQRD 3HOUH 4DR5L 1X54A 3T56B 5IYCG 4A3LH 2F0FA 5EPLA 1KC8C 2L12A 5IGDA 1OXTA 2NTSA 2KQ3A 3RZDB 4OGQC 2HT1A 2OTLA 3PSIA 1T5XD 2CFMA 4DR6Q 2Q8TA 1SEBD 5LL6X 3FDTA 4AQYL 1X9NA 1TWGB 3K7AH 4A3IB 3S16H 4JVZA 4UP8A 4B08A 1O7ZA 5LMUQ 5FO9B 5JJZA 4H44C 4IOAA 1YHQA 3PUZA 3RN5A 2YU9B 4DUYL 5EKKA 3S2HH 4HEDA 1K8MA 3MA2B 2F0KA 1E7ZA 3PGZA 1RKNA 4A3MH 3T13A 4RG1A 4X3KA 4YCWA 5C0XG 4LFBQ 2NVQB 1V8QA 1KABA 4YWKA 1NBWA 3GV3A 1QNUA 4UAIA 5CBEE 5G3LD 1CTMA 2VB2X 2KHJA 1X56A 1JB3A 2BDNA 3CRLC 2E2JH 5GQOA 5AFWA 5IYBG 3UDGA 1EQQA 3RZOB 5KRUA 3J80E 1N8RC 1YBYA 3CCJA 1VCIA 1VQNA 3S14B 1LABA 1PRTF 2JEBI 5DEHA 1QUQA 1N34Q 3N6RA 1K3RA 4BXXG 4A3DG 2VXWA 2MNAA 1PTOC 3FMCA 3RLOA 3A56A 3VYUA 2AHOB 4L63B 4OWXB 3KUPA 2JA9A 4UP7A 4C2MB 2MP1A 1IKMA 4TSSA 1N32Q 3T4AC 1WCMH 4DV2Q 3CPWA 4C3HG 2JA5H 2F03A 1QUQB 3MFGA 3R93A 1SNOA 1IZ6A 4LAAA 2KJXA 2NZHA 2WACA 4DV4L 5F2DA 4OO1H 1CKMA 3CC7A 4BBRB 3U58A 1MJEA 4KV6A 1EY7A 3DXJC 2B39A 1YNJD 5LL6S 1N36L 4E6IA 2L11A 4RGMA 4K5WA 3K58A 3G6JB 4LNQA 5C0XI 2QILA 1VQEA 1SYCA 4B9XA 3T1HQ 3HP3A 1K8AC 2EY1A 1H9SA 1KNAA 1Y1VB 1WFQA 2ASBA 3V05A 4CDFC 1R9TH 1GJXA 4K6LA 4BBSB 3EVQA 3UI2A 3J80i 1CUKA 1I4XA 4NPSA 2L55A 5GAEC 4X64L 1UWVA 3CCSA 3G4SA 4FF4A 4C1NK 4RHSA 2DJGC 1ONLA 4XXEA 3C2PA 1I94L 2KEDA 1JMCA 2EJMA 3LWUA 1ML0D 3I4MG 1H9SB 3A54A 3E0JA 3VYSA 1HR0L 2P5ZX 1D8LA 2KCCA 5M5XH 4CKEA 1EWHA 1RODA 4JPBW 1QOHA 4MZ9A 5FOBB 4JBMA 1B1ZA 1Q1EA 1UAPA 3QOLA 1L1OA 2EOTA 3UE0A 4O42A 3K5MA 3Q23A 5A35A 2VUMH 2DJFC 3F2CA 3M3YH 5J3BA 1MBYA 3HOYG 4FDBA 3BYTB 2IWHA 1F9QA 4FF2A 3L7ZC 3NTHA 3CQZB 1AZQA 3OW2A 1L1OB 1GOZA 1QWYA 5M9OA 5I6WA 2B2VA 2UXCQ 1N34L 4IJLA 1SNDA 2I5LX 3D0FA 4BY1H 1FJGQ 4DV5Q 1CKNA 1FNVA 2BCOA 4KJNA 5IE8A 3KJPA 1EOVA 3C1FA 4LFAL 3CF5A 1N32L 1UUPA 1U4PA 5FJ8H 4DV2L 1WTVA 4O1NA 4K8IA 2ID0A 1Q8IA 4L5SA 2ATWA 1CKNB 3BVZA 1EY8A 4B3TQ 1NNXA 2L4NA 2A1AA 2X6LA 4EQ5A 3PO2H 3A55A 4KK7A 3VYTA 4RCNA 1PFNA 3DUZA 2AQ3B 5H1SE 3DEPA 1PFMA 2PW5A 2IPKD 4KY5A 3C46A 3T1HL 3H91A 4A3GH 1PTOH 3L0OA 4IFDJ 1ZYRC 1J6QA 2AWOA 5KYIA 2OTJA 4O2DA 1M1KC 3S1QB 3PUXA 4X3SA 4KTAA 3CCQA 4CDCC 3PIOA 1BF4A 1E1OA 1FGBD 1I4PA 4IUNA 2VS1A 4UHVA 1BBWA 2WP8J 2A8VA 3IFTA 4C3HB 1SN8A 4P71A 2WV6D 4JOIA 3D6CA 3OTOL 2F0JA 1O78A 3P1HA 2KEEA 5C4ZA 1CA6A 1OXSC 3HOWH 1SNCA 4P74A 3SEBA 4A3CG 1A6XA 4DR3Q 2QF7A 2Z9HA 3CMEA 4A3EH 4X62Q 3VR6A 3J7AF 3PO3G 4HSPA 2GVAA 1UE5A 4J1MA 5EQ0A 4IOCA 1K8GA 3HOXH 5GADC 2DNEA 2E5LQ 3J80c 4BA2I 1BXTA 2YYZA 4OIJA 2ZJPA 1TXYA 4HJ9A 3VR2A 2EE1A 4A3BG 3S1MH 1EZ6A 2F4VL 1VQLA 3MTSA 4A3JH 4JC0A 3I2ZA 1KDBA 3CXCA 4ZCKA 4DV6Q 3G7LA 2WINB 2UUCQ 5J39A 2RVLA 3M4PA 1U4LA 3F2BA 4RFBA 1JOQA 2ZJQA 3NTIA 1H95A 1EOTA 3HEJA 3J7AV 1Q82C 4FNFA 1CM9A 3G48A 3NBHA 3NUCA 4OEMB 4FP5D 2J7ZA 4C3IH 2A6HC 2PMZB 1CSPA 1L0WA 1Z9FA 3FKIH 1N9WA 2PW7A 3HOYB 3M4OB 4DK3C 1Q86C 2EJFC 3SE0A 1BCPF 1GUTA 1V1OA 2RDGA 3NBHB 4JG2A 4LWCA 3VR5A 1LTSD 4H02A 2NN6I 4DK0A 2BH2A 4GOPC 3CD6A 5D3DA 5IT9c 5I9PA 2QEJC 2FMMA 2N78A 1QVGA 2KCMA 1N33Q 1DZ1A 3H0GG 1Q8KA 5IP9G 4KY6A 4L5RC 4DR2L 1YI2A 3MEHA 1YNND 2E2DC 4DKAC 1XPRA 2VNUD 2K50A 1G8ZD 5FO8B 2EJGC 1YIJA 1AN8A 4APVA 4OX9L 4FYDA 3M7GA 2OQKA 3GTGH 4JI4L 5M3FH 5JPMC 4Y7NB 1U5KA 4ZUJA 1JWSD 5IGBA 4DR3L 4LK1C 1KIXA 2R92G 2CCZA 4X62L 1X6OA 2CKZB 4NXNQ 2OQ0A 4ME5A 1TY0A 1SDFA 2RQXA 1D1IA 4CJ1B 5EGTA 4KKUA 5C5MA 1B44D 5ELBA 4PG3A 1XTCD 4NXMQ 3MHBA 3T51B 2ZJRA 4HJ5A 1I6VC 2KVMA 1GUNA 4RGNA 2UUAQ 3ULPA 1X3EA 2QA4A 5IGCA 4KJOA 1KLGD 3M9BA 5KNBA 1SE3A 4DV0Q 2PMZE 3D3RA 2L9HA 1NY4A 3Q24A 2PCFB 1A62A 1IBKL 2AUJD 3MXPA 2HDLA 1VQMA 2UU9Q 3BYYB 1RTNA 3OSOA 1S3OA 2LSSA 2F0VA 5IWAL 3GTKB 4N9PA 3NSWA 1CHQD 4CDEC 5JJKA 2F52A 1LO5D 1YNXA 2OWOA 4GN3B 3PO3B 3O13A 1EU3A 4HSVA 5EPJA 3RNUA 2NVQH 4JI2Q 4MNOA 3ND9A 1TWCB 4LF6L 5LMNL 2N55A 2F3VA 4EQNA 4OL7A 4QCLA 2L1BA 1PRTD 2PZTA 1PH2A 4XYQA 1Y1WG 4DNIA 1DJRD 1PXUA 4A3BB 4P2CB 4ZKCB 5JJIA 2PYKA 1YNJC 2B63B 1CSQA 5JVG3 2Q2TA 1A3UA 1JORA 3S2DH 5I2YA 3OMCA 3QB3A 2H4OA 1G91A 2A69D 1D5ZC 1GHKA 5IYDG 4OXPA 3V2TA 2GVBA 2K03A 4IPHA 3J7ZC 2JA8G 1I6HB 3CCUA 2K33A 4TQUS 2JN4A 2KUMA 4JW0A 1STYA 1FGUA 1G6PA 2EYHA 1TR5A 4DV3L 2HIVA 4CBVA 1H9JA 3GTQH 3NELA 4XQNA 3RUZA 3FP9A 3TREA 5M3MB 1Q3LA 4C3JH 2F0PA 1XJVA 2RDFA 2VQEQ 4A3FH 3E0EA 1ET9A 1S72A 1JWUD 5FK9C 5T1IA 5E4WC 4DR5Q 4NP5A 3PUWA 3G6EA 1HUMA 2EYOA 3A5ZB 4NXML 1KDCA 2NVTB 4DK1A 1G51A 1HPCA 2IX1A 4DV7L 3L3OC 4AQYQ 2F0MA 2YTYA 5E1FA 3H94A 3MEFA 4DN4M 4IFDH 3DM3A 3KLRA 1EWCA 5C5LA 4AYBG 1QNKA 1EU4A 3D31A 3DWPA 1W3SA 2CH4W 3RMHA 2UUAL 3S17B 1B70B 3GTMH 1MKHA 5ELNA 4K0KQ 1ET6A 1VMCA 4DUYQ 5C6AA 4KHVA 3NEMA 3ITPA 1KNEA 2UU9L 1LYLA 5ELFA 1C4QA 1SJHD 3GP7A 1KAWA 2F0OA 2F4IA 2KCTA 3Q6SA 2R92B 1X3QA 4OIKA 3R8BA 4JI6Q 4BBRG 2XIWA 5EBDA 2JQOA 2F0EA 2Z8LA 3J80L 3SXHA 2Z6KA 5ELOA 3GTOB 3TEHB 1EQRA 4YCVA 1VQ6A 1RTOA 3I73A 1IYVA 1TY2A 2DNCA 3U9OA 3TP5A 1HZCA 1L2FA 4RH6A 1CI3M 4RAUC 3PIPA 3QIAA 1T9HA 2A73B 2ZM6L 5CMDA 1SFOB 1PA6A 4K8JA 1HZAA 1XXGA 3AEVA 5CV8A 4DR7L 1EY9A 1TVXA 3BZKA 2VY3A 3GQBA 3QJYA 4F7XA 1KLUD 1SR3A 4WJ3M 2HDMA 4LW1A 4IALA 2C9OA 2BA0A 2NZ1D 1PTOF 2K14A 3W5OA 2A5HA 4CJ0B 4DV4Q 4GNXA 2AUKA 3RN2A 4NMZA 3A8KE 1DOMA 1GKHA 2AWNA 3I56A 1OTCA 3A8JE 4B3SL 4K5XA 1N36Q 2XSCA 3TZDA 1K83H 1NMFA 1D6EC 1AE3A 4CJ2C 2QW7A 5M5WB 2A19A 1E22A 1Y1WB 3HOZH 1PH6A 4GNXB 2Q2UA 1KDAA 4FO2A 2B2TA 4LFCL 2PI2A 3DWQA 3I4NH 2O2LD 4YY3L 4UY8C 5IYBH 4K5VA 4DA2A 3HKZG 3J81E 3K0XA 1Y8OB 1HNZQ 1EYCA 4PMBA 4XQJA 2CWPA 4BS9A 4IPDA 4X64Q 1G2TA 5JEAG 4AH6A 1SYBA 2OT2A 2JA8B 2F0DA 1HNXL 3QO2A 1I94Q 4BXXH 4A3DH 2E75C 4K0KL 1IL8A 4A76A 4I65A 1HR0Q 3Q22A 2NVYH 1EEID 1I50B 1LTTD 1XPUA 1A2UA 1P8LA 3KYHC 1SYEA 5FKAC 3I8ZA 1NMGA 2K04A 1BDOA 1B8AA 4JI6L 4BY7G 1C0AA 1GUOA 2LXJA 5I9OA 2EYJA 2NUCA 2K1BA 5ELEA 5BR8L 1CFMA 1A15A 4OONA 4DFAA 5BN5A 5IGFA 2BE5D 2F0TA 1S5ED 2GA4B 4DF7A 1OXVA 1WD0A 2EXDA 2K75A 1DOKA 4AYBB 4K2KA 5E7NA 2JEAI 1HFGA 2K5WA 3L2PA 3HOUG 3J81i 2TMPA 3DHQA 1B3QA 4P72A 4MHEA 4PMWA 4ZLTF 5AJ3L 1TWAH 3I4MH 4A93B 5EKLA 1ZEQX 5CR3A 4LFAQ 1HTPA 2D2CC 4PZ8A 5IGEA 4YIJA 3HFZB 3PCOB 3F1ZA 1R4PB 3EA6A 1HH2P 4IUPA 1TWFB 4C1NI 5GAHC 3CMAA 3BZDB 3WWVA 1W6JA 1E2ZA 3S1RH 3NENA 1YNNC 1TKWB 1K8OA 4L5QA 3T1YQ 1LM0A 4IZ8A 4IUUA 3TQYA 1PHJA 5JOBA 4QIWB 2JSOA 3U9SA 1YEZA 1HJPA 2R61A 2SDFA 3UE1A 5KIXA 1Q12A 4A3MG 4QB4A 3DWAA 4V190 4FVMA 3KLSX 1HZBA 3NE5B 1KRSA 2C35B 1HNZL 2R93H 1UEAB 2OEOA 5IT9E 3HKSA 1U9RA 2PI2E 3PQIA 1ZKOA 3MWYW 5M5YB 2F3IA 4DXFA 4ALPA 1MSHA 4X3UA 3GTPH 3TBIB 3HOVB 3OTOQ 1YJWA 1S40A 2E2IB 2UXBL 2L0CA 4I7ZC 1BUVT 2WIIB 3NHHA 3OIQA 1RIPA 1WCMG 4X65L 2YTXA 2FMCA 3NK9A 2JA5G 3TZUA 5J1ZA 2E2HH 4AYBE 1HRJA 3VYRA 5IP7H 4DV1Q 2B2YA 3S15H 4OO1G 1C9OA 1ILPA 2ES2A 1CQFA 3G71A 2MFIA 3BS1A 1Y8NB 1SE8A 4C56C 3HKZB 3GTJH 5JJLA 1A0IA 1PFBA 2F4VQ 2KHIA 2K7VA 2ICEC 1KRTA 2JA7H 2SNSA 3KOJA 4EQOA 5CV7A 4A4IA 1WTPA 4ZAIA 4DNRB 1BCPB 2CW0D 1GM5A 2NVXH 2EIFA 4QIWE 2VL6A 2Q8IB 1F9SA 1EWIA 4AIMA 3A5UA 4BY7B 1JB7A 5C4JH 3T1YL 1ENFA 1H9RA 4KMUC 1SNPA 5C44H 1HCZA 3ERQA 3I70A 3I4LA 1S4ZA 1VQPA 2K5VA 3GTLB 4X66Q 1X3PA 2M9VA 1PZID 3J81c 4R8IA 4HAEA 1NCVA 4L5TA 4DPGA 3AU7A 3CC4A 2K6AA 3HOUB 1A63A 5ELCA 4JI0L 3I3CA 4QMGA 4LF8L 1TU2B 2F1MA 4OO1I 4DR2Q 3X3MA 1NR4A 1VQFA 2VQFQ 4OX9Q 4R9WA 3K7AB 1TWHH 1M8AA 2KCNA 3S16B 1VQBA 1MGSA 2FFKB 4JI7Q 3IAYA 2EZVA 4JI4Q 3TS0A 4DXGA 3PV0A 4WORA 4BY1G 1I4RA 2XGTA 2CWAA 5EAYA 3VA7A 2NN6G 1A8VA 3S2HB 3NQIA 1B53A 2RF4A 3R2TA 2K01A 5FJ8G 1RHPA 1BKBA 2B2WA 2IT1A 4M8AA 3ICEA 4JV5L 3MZ5A 4A3MB 3NP8A 4HIKA 1GUSA 1LT5D 2CH4A 3HKZE 4DV1L 5COYA 1DGSA 4RGTA 3KK7A 3BDOA 2NTTA 3ND8A 1YZ6A 2D5DA 2WKDA 3FPPA 1ENAA 3H15A 2QKIC 3HGBA 4JI3L 4EVOA 1EQVA 1SAPA 2E8GA 3ZJYC 3PO2G 2PNHA 5JEAJ 3OWEB 2B63G 1II3A 2FHTA 1VF7A 1FYCA 3H0GH 2E2JB 3BU2A 3NTKA 4G7ZC 3DMUA 5IP9H 4A3GG 2D62A 2BA1A 3K7UC 1NAPA 1JC7A 2B2UA 2EY6A 1X32A 2K32A 5G3LF 2WB1G 3CCEA 5CV9A 5C0XJ 3F2UA 3E5SA 3Q8DA 1IBKQ 2OF1A 1LTAD 2LKVA 1EZ8A 1G6ZA 1ENCA 1IBMQ 1PH1A 3H3VH 1B50A 5IWAQ 5M3MG 1WCMB 2DGYA 4CHTB 2E74C 2JA5B 1I4GA 3I90A 2R3ZA 2LY7A 1EIHA 4KY7A 1GUWA 1VQ4A 4X66L 5DM73 1ASZA 4LF6Q 5LMNQ 3HOWG 3PF5A 1JQYD 3I55A 1LT3D 1VQGA 1WYDA 1JOKA 5D65A 1LT6D 2HQEA 4A3EG 4ID6A 4XYOA 1DM0B 2HD3A 2NYZD 5FLMH 3UDIA 3IKJA 2RCFA 5C4XH 1TS3A 2LMCB 3HOXG 3D8GA 2HQLA 3W1GA 2VQFL 1R9TB 1SMYD 4R1JA 3EJIA 1JICA 1KQSA 4DAMA 4DNTB 5HURA 4JI7L 4GKKL 1GUGA 1GXDC 5K36H 4R8NA 2EQSA 3KJOA 4YHHL 3CU7A 4DV3Q 4N9TA 2G9HD 3TN2A 2XRSD 4N8X1 3RLNA 3MC0B 1E24A 3A0JA 2HCCA 4R4TA 3SHLA 4XT3B 1A2TA 5C3EH 2SEBD 4HMIA 4JI1Q 2JE6I 4LMQD 4A3KH 2K5HA 3SDZA 4NW2A 5M5XB 4R4IA 4DAPA 1QZHA 4RHRA 4HIDA 3MXGA 1IHZA 2CVRA 1F2ZA 4GN4B 4DUZL 1Z7TA 4C3IG 3STBD 3TS2A 2ZT9C 1XWEA 3E9HA 2VUMB 3D4RA 2BOSA 3M3YB 4N8FA 4DV7Q 1VF5C 4I7AA 4G7HC 1EY0A 3IFDA 4GS3A 3RZDH 2VB3X 4MIUA 2ENBA 4LJZC 1IW7D 3QR8A 3DLLA 1EYDA 1TWGH 2RHQB 5CBAE 1I4HA 3BG3A 1NUCA 1V1PA 3S1NB 2F0WA 4A3IH 2BE5C 1G2SA 2Z1CA 1QG7A 1ICWA 2F0QA 1XNRQ 1TT2A 3D6WA 5IYDH 1L1OC 1U4MA 1B4OA 1AW7A 2PZWA 3BVGA 4BY1B 2XWJB 2YU9H 3KDFA 1QILA 1CKOA 2K28A 1IBML 2DY7A 1V1PB 2X6GA 1WTWA 2A68D 4XQQA 2PO4A 1SYFA 2ZXPA 1E0BA 3CW2C 4O0AA 2OXPA 1LT4D 5HGTA 1RJTA 4ZQ3A 3KDFB 3C3LA 1WD1A 3OMGA 2B2VC 5ELDA 1PYSB 5JAVA 1OXUA 1SSOA 1NE3A 3VR4A 5IOCA 1SLJA 4RMFA 1HNWL 3PO2B 2EYFA 2XVSA 4B9WA 3LGJA 1Y14B 1UNSA 2JA6G 2LFNA 4H0LC 4JCVE 1HA6A 1B2TA 1FNUA 3M4QA 2A74C 3RZOH 4DR1Q 4A3GB 4HCEA 1PTOB 2ZM6Q 4YWMA 3S14H 1PZKD 2I5MX 4UPAA 4OWTB 3KF6A 1PV4A 4LF7L 1LLRD 4U673 4DR7Q 1QVFA 2WB1B 3CCRA 1AEXA 2TSSA 4C2MH 4GN5A 5L37A 2O4XA 1EIYB 4ZYSA 1GD7A 1D5MC 3K81C 1KL9A 3A7AB 3KF6B 5A2QE 4EX5A 1NJIC 4JI1L 4FF1A 5FLXE 5DAUA 4BBRH 1EY5A 3H6MA 4K2LA 4B3SQ 3J81L 2F3WA 3D4WA 5DLQE 2B8GA 2N88A 3U50C 1DYQA 2B3GA 2HUGA 3HOWB 4NDXA 2PPBC 3SVMA 3HS0C
chains in the Genus database with same CATH topology
2EDGA 3TP7A 4A3EB 1WTXA 3LNNA 3FEWX 3WOFA 4CKCA 3HOXB 2AQ1B 1PMRA 3SK4A 2RBMA 4Z9CB 3S1MB 3NXWA 3VA5A 4A3JB 3CRKC 2JXMB 2SNMA 2IW3A 1C48A 2F0LA 3WDNA 4G57A 2NB0A 3R2IA 4JBWA 4KKSA 1STBA 4QUCA 1QJOA 2A6ED 3JAME 3V96A 2CHBD 2CW0C 2IX3A 4C3IB 3CHBD 3HZXA 3FKIB 1LACA 2O5JC 2NBFA 2J4XA 3BDLA 3MXUA 2M00A 1CK1A 3IL8A 2MGSA 3NWSA 3M7NA 1CZGA 1SYDA 5TSSA 3OOCA 4G4KA 5JEAH 1HFNA 5E4XA 3FRPB 3A8IE 1Y8PB 1V43A 5EJWA 4ZRZA 4IFDG 4DAYA 4ZKBB 4OHJA 1I4QA 5NUCA 5I4DA 3PUVA 5C0XH 2A6HD 2K05A 3GTGB 5M3FB 2EVBA 1D5XC 3FVQA 5IT9L 4S3SA 2HCIA 2KOLA 2F0IA 2EYLA 3J7YW 5KYLA 1SE4A 1D1KA 3PMFA 1IKLA 2JA6B 3N52A 3HG9A 1RD9D 1EYAA 1LTRD 2MPMA 2DY8A 1F9PA 3T53B 4ABNA 1B9MA 4DGZA 1LTID 3E6ZX 1WTOA 1WTRA 2XNAC 1STAA 1PZJD 3I72A 3OIPA 4XT1B 5JPNC 3RLFA 4L8JA 3DM1A 5CV4A 3D4DA 1HUNA 1SJED 2ZXOA 2EPBA 1RDPD 4IFDI 1ZXTA 3EROA 1XYIA 1TIID 1BO0A 3K57A 3MXNA 5T1GA 5KNCA 2WKCA 1HQMC 2K5DA 2XWBB 4CKBA 1ILQA 2Q8RE 1RCVD 1H9MA 3FPUB 1Q1BA 3BDCA 4L6TB 5J22A 1HXYD 3T16A 3HRZC 3A7LA 4IUTA 1WTQA 2R6GA 4IUQA 2RKSA 3VR3A 3S2DB 3QOJA 2O5IC 4MN3A 3P75A 5CORA 1BCPD 1OO9B 4IN3A 5IGGA 5CC4A 1MI2A 3OW7A 4DAVA 1SMYC 1M4VA 1TS4A 3PIO3 1JOOA 1STEA 2PZUA 1F2LA 3GTQB 1EFID 3KBXA 4KN7C 4C3JB 3K0YA 4A3FB 4HR7B 2R7ZB 2IL8A 5C3XA 3I91A 3BVMA 2SOBA 5DM63 4J8QA 3R3OA 2PQEA 5KGUA 1CZWA 2XRQD 3NPPA 3EFXD 5CGKA 3GTMB 5BN3A 1IW7C 1AZPA 3P20A 4RGOS 3QWNA 2QDBA 1HTLD 5DNFA 4K6DA 1CHPD 1SYGA 4KD3A 3L9AX 2MHVA 5IIFA 3DEOA 3H3VC 1FD7D 2A68C 1I3QB 2RA4A 4H7BA 2F0UA 2KHSA 1EL0A 1F77A 1B9NA 1MD2D 3EQLC 2D9UA 1O7LA 2DN8A 1PRTC 1BNZA 1DD2A 1RF2D 3K5OA 2EYMA 1BR9A 1ESFA 1EEFD 1BBXC 4WFN3 1VMPA 2QCPX 1JCKB 2A69C 1DCZA 2NN6H 4PNYA 4TKOB 1F2YA 1PDQA 4HN7A 1QE6A 3K6OA 2ZXRA 1L0XB 4HTHA 4GZYC 2RSNA 1K83B 4F88A 4HCSA 2IJ0A 3HOZB 3SK8A 1W6KA 2EXZA 2AQ2B 3K5LA 3W3AA 2JYOA 3I4NB 2J0TD 3CKIB 3GD7A 1SE2A 1MSGA 3OWFA 1NR2A 4A3DB 3M85A 5CYUA 4PV1C 1EIGA 4RWSC 1KAAA 1S5BD 2NVYB 4RKBA 4CGYB 2B2TC 1Z47A 5K5PA 3PUYA 2RDHA 2A6EC 3X3NA 3MAQA 1LV9A 2PNRC 3C1EA 2WAQB 2C5CA 4HMJA 3W2DA 2Y0SB 1O80A 3GV6A 1DXMA 3WOEA 1A3TA 1TS5A 1A3VA 4K14A 2EY5A 1HHVA 5EBCA 4KKTA 4FF3A 1TWAB 3I4MB 3ZYYX 2NWGA 1CT1D 2F0SA 3TP8A 1SNMA 4ODGA 4IQZA 4WJWA 3S1RB 4ILWA 5KEEA 3KF8A 4F87A 4BWGB 2ICIA 1JR0D 1T5EA 1BQQT 1Z6HA 2K5QA 1J9OA 1PYWD 3QG1A 1CA5A 1PTOD 5A2QL 3K5NA 2R93B 5FLXL 1CQVA 1QCBD 1LTGD 3AMUA 4KHZA 3GO5A 3SK5A 4J6HA 1C8CA 4FXDA 1D2BA 4XDXA 5E3FA 5BN4A 3GTPB 4XTCS 1STHA 1OXXK 1PLFA 2RSOA 2X69A 4FXGC 4FXKC 4KD4A 4X3TA 2FINB 1E2WA 5FO7B 4KN4C 5I2XA 4Q0FA 1E2VA 1JE4A 3TSSA 2E2HB 4JK1C 3S15B 1FR3A 4RCOA 3LX0A 5I6YA 1Q90A 3GTJB 3NQTA 4IURA 3JAML 5C3WA 3TP6A 1G291 3KBGA 4TRDA 3PIP3 2JA7B 5D14A 3URYA 1BOSA 2EY2A 2B2YC 4G7OC 2IX0A 2NVXB 1F2MA 5K36G 3AB9A 1WVLA 1BCPC 5C4JB 2V4DA 2XN9C 2FJ2A 3NBIA 5C44B 2MUYA 4RA8A 1J8IA 1EY6A 4DU9A 1H9KA 4NKLA 1TQOA 2L5TA 5ISRA 4ULLA 4QUFA 4BA1I 3S9WA 1F9RA 4PQXA 5EPKA 2B8FA 1L0YB 3SK6A 3M4YA 3H09A 1TWHB 3P7JA 3LWEA 4RKLA 2M2LA 1STGA 2MJ8A 4QF4A 3K59A 1S5CD 5JVH3 1ZYRD 1LTBD 3SR1A 5IODA 4F8MA 2KA7A 2BDOA 3OHXC 1GHJA 1Y69U 2I46A 1B3AA 1IYUA 3H0GB 2B2WC 4XIGS 2F0HA 2EYPA 4KI0A 3OPOA 1U4RA 5LHY1 2KECA 2JP1A 4ZUIA 2H1EA 3TDQA 1QB5D 1S5DD 1R4QB 4V0BA 4C3JG 4EQPA 1NSNS 4IUVA 1ESRA 1TS2A 4U68A 1AP0A 5D3IB 1SNQA 2LS01 5KNDA 3Q0AA 2G9DA 2B2UC 1AFPA 1EQTA 1PRTB 4UDUC 1VDZA 5CV5A 1EY4A 1SBBB 4ZK9B 4PMCA 3ONAB 5C4XB 1FNWA 2F0GA 3NWTA 2Z4HA 4M1UB 4Q5VA 1JWMD 4EGVA 4H13C 1STNA 4WRDA 1O7YA 3MFYA 2Z4IA 2F0NA 3TMEA 3KLSA 2I07B 3RD4A 1XX8A 5C3EB 5CV6A 4A3KB 3MVVA 2CQAA 5EKIA 1DONA 1KTKA 1S5FD 1SXTA 5C4HA 1DOLA 2E76C 1HA5A 1HQRD 3T56B 2F0FA 5EPLA 2L12A 5IGDA 1OXTA 2NTSA 2KQ3A 3RZDB 4OGQC 1T5XD 2Q8TA 1SEBD 5LL6X 3FDTA 1TWGB 4A3IB 4B08A 1O7ZA 5FO9B 5JJZA 4H44C 3PUZA 2YU9B 5EKKA 4HEDA 1K8MA 3MA2B 2F0KA 1RKNA 3T13A 4X3KA 5C0XG 2NVQB 1V8QA 1KABA 3GV3A 1QNUA 4UAIA 5CBEE 5G3LD 1CTMA 2VB2X 1JB3A 2BDNA 3CRLC 5AFWA 3RZOB 5KRUA 3J80E 1VCIA 3S14B 1LABA 1PRTF 2JEBI 5DEHA 3N6RA 2VXWA 1PTOC 3FMCA 3A56A 3VYUA 4L63B 3KUPA 4C2MB 2MP1A 1IKMA 4TSSA 3T4AC 4C3HG 2F03A 3R93A 3MFGA 1SNOA 4LAAA 2KJXA 2WACA 5F2DA 4OO1H 4BBRB 4KV6A 1EY7A 3DXJC 2B39A 1YNJD 5LL6S 4E6IA 2L11A 4RGMA 4K5WA 3K58A 3G6JB 5C0XI 2QILA 1SYCA 4B9XA 3HP3A 2EY1A 1H9SA 1KNAA 1Y1VB 3V05A 1GJXA 4K6LA 4BBSB 3EVQA 3UI2A 1I4XA 2L55A 4FF4A 4C1NK 4RHSA 1ONLA 4XXEA 3C2PA 2KEDA 2EJMA 1ML0D 3LWUA 1H9SB 3A54A 3E0JA 3VYSA 2KCCA 4CKEA 1EWHA 1RODA 1QOHA 5FOBB 1B1ZA 1Q1EA 1UAPA 3QOLA 2EOTA 4O42A 3K5MA 3Q23A 5A35A 1MBYA 3BYTB 2IWHA 1F9QA 4FF2A 3L7ZC 3NTHA 3CQZB 1AZQA 1GOZA 1QWYA 5M9OA 5I6WA 2B2VA 1SNDA 1FNVA 2BCOA 4KJNA 3C1FA 1UUPA 1U4PA 1WTVA 4O1NA 4K8IA 2ID0A 1Q8IA 3BVZA 1EY8A 2L4NA 2X6LA 3A55A 4KK7A 3VYTA 4RCNA 1PFNA 3DUZA 2AQ3B 3DEPA 1PFMA 2PW5A 2IPKD 4KY5A 3C46A 3H91A 1PTOH 4IFDJ 1ZYRC 2AWOA 5KYIA 3S1QB 3PUXA 4X3SA 4KTAA 1BF4A 1FGBD 1I4PA 4IUNA 2WP8J 3IFTA 4C3HB 2WV6D 3D6CA 2F0JA 1O78A 3P1HA 2KEEA 5C4ZA 1CA6A 1OXSC 1SNCA 3SEBA 1A6XA 2QF7A 3VR6A 3J7AF 4HSPA 4J1MA 5EQ0A 2DNEA 4BA2I 1BXTA 2YYZA 4OIJA 3VR2A 2EE1A 1EZ6A 3MTSA 1KDBA 3G7LA 2WINB 5J39A 2RVLA 1U4LA 4RFBA 1JOQA 3NTIA 1EOTA 3HEJA 3J7AV 4FNFA 1CM9A 3NBHA 3NUCA 4FP5D 2J7ZA 2A6HC 2PMZB 2PW7A 3HOYB 3M4OB 2EJFC 3SE0A 1BCPF 1GUTA 1V1OA 2RDGA 3VR5A 1LTSD 2NN6I 4DK0A 5D3DA 5I9PA 2QEJC 2FMMA 1DZ1A 4KY6A 3MEHA 1YNND 2E2DC 2VNUD 1G8ZD 5FO8B 2EJGC 1AN8A 4FYDA 3M7GA 5JPMC 4Y7NB 4ZUJA 1JWSD 5IGBA 4LK1C 4ME5A 1TY0A 1SDFA 2RQXA 1D1IA 4CJ1B 5EGTA 4KKUA 5C5MA 1B44D 5ELBA 1XTCD 3MHBA 3T51B 1I6VC 2KVMA 1GUNA 4RGNA 5IGCA 4KJOA 1KLGD 5KNBA 1SE3A 3D3RA 2L9HA 3Q24A 2PCFB 2AUJD 3MXPA 2HDLA 3BYYB 1RTNA 3OSOA 2F0VA 3GTKB 4N9PA 3NSWA 1CHQD 1LO5D 3PO3B 3O13A 1EU3A 4HSVA 5EPJA 3ND9A 1TWCB 2N55A 2F3VA 4EQNA 4OL7A 4QCLA 2L1BA 1PRTD 2PZTA 4XYQA 1DJRD 1PXUA 4A3BB 4P2CB 4ZKCB 2PYKA 1YNJC 2B63B 5JVG3 1A3UA 1JORA 5I2YA 3OMCA 3QB3A 2H4OA 1G91A 2A69D 1D5ZC 1GHKA 3V2TA 2K03A 1I6HB 2K33A 4TQUS 2KUMA 1STYA 2EYHA 1TR5A 4CBVA 1H9JA 4XQNA 3RUZA 5M3MB 1Q3LA 2F0PA 2RDFA 1ET9A 1JWUD 5FK9C 5T1IA 5E4WC 4NP5A 3PUWA 1HUMA 2EYOA 1KDCA 2NVTB 4DK1A 1HPCA 2IX1A 3L3OC 2F0MA 5E1FA 3H94A 4DN4M 4IFDH 3KLRA 1EWCA 5C5LA 1QNKA 1EU4A 3RMHA 3D31A 3DWPA 3S17B 1ET6A 1VMCA 5C6AA 4KHVA 3ITPA 1KNEA 5ELFA 1C4QA 1SJHD 3GP7A 2F0OA 2F4IA 2R92B 3Q6SA 1X3QA 4OIKA 3R8BA 2XIWA 5EBDA 2F0EA 2Z8LA 3J80L 3SXHA 3GTOB 1RTOA 3I73A 1IYVA 1TY2A 2DNCA 3U9OA 3TP5A 4RH6A 1CI3M 4RAUC 3QIAA 2A73B 5CMDA 1SFOB 4K8JA 1XXGA 5CV8A 1EY9A 1TVXA 4F7XA 3GQBA 3QJYA 1KLUD 2HDMA 4IALA 2C9OA 2BA0A 2NZ1D 1PTOF 4CJ0B 2A5HA 2AUKA 4NMZA 3A8KE 1DOMA 2AWNA 3A8JE 4K5XA 2XSCA 3TZDA 1D6EC 4CJ2C 5M5WB 1Y1WB 1KDAA 4FO2A 2B2TA 3DWQA 2O2LD 4K5VA 4DA2A 3J81E 1Y8OB 1EYCA 4PMBA 4XQJA 4BS9A 1G2TA 5JEAG 1SYBA 2OT2A 2JA8B 2F0DA 3QO2A 2E75C 1IL8A 4I65A 3Q22A 1EEID 1I50B 1LTTD 1A2UA 1SYEA 5FKAC 3I8ZA 2K04A 1BDOA 1GUOA 5I9OA 2EYJA 2NUCA 2K1BA 5ELEA 1CFMA 1A15A 4DFAA 5BN5A 5IGFA 2BE5D 2F0TA 1S5ED 2GA4B 4DF7A 1OXVA 1WD0A 1DOKA 4AYBB 4K2KA 2JEAI 1HFGA 2K5WA 2TMPA 3DHQA 4MHEA 4PMWA 4ZLTF 4A93B 5EKLA 1ZEQX 5CR3A 1HTPA 2D2CC 5IGEA 4YIJA 1R4PB 3EA6A 4IUPA 1TWFB 4C1NI 3BZDB 1W6JA 1E2ZA 1YNNC 1TKWB 1K8OA 4IZ8A 4IUUA 5JOBA 4QIWB 2JSOA 3U9SA 2SDFA 2R61A 5KIXA 1Q12A 4QB4A 3DWAA 4V190 4FVMA 3KLSX 3NE5B 1UEAB 2OEOA 5IT9E 1U9RA 1ZKOA 3MWYW 5M5YB 4DXFA 1MSHA 4X3UA 3TBIB 3HOVB 2E2IB 2L0CA 4I7ZC 1BUVT 2WIIB 3NHHA 3OIQA 2FMCA 3NK9A 3TZUA 5J1ZA 1HRJA 3VYRA 2B2YA 4OO1G 1ILPA 1CQFA 3BS1A 1Y8NB 4C56C 3HKZB 1PFBA 2K7VA 2ICEC 2SNSA 4EQOA 5CV7A 1WTPA 4ZAIA 4DNRB 1BCPB 2CW0D 2Q8IB 1F9SA 4BY7B 1ENFA 1H9RA 4KMUC 1SNPA 1HCZA 3ERQA 3I70A 3I4LA 1S4ZA 3GTLB 1X3PA 2M9VA 1PZID 4R8IA 4HAEA 1NCVA 3AU7A 2K6AA 3HOUB 5ELCA 3I3CA 4QMGA 1TU2B 2F1MA 4OO1I 3X3MA 1NR4A 4R9WA 3K7AB 1M8AA 2KCNA 3S16B 1MGSA 2FFKB 3IAYA 2EZVA 4DXGA 3PV0A 4WORA 1I4RA 3VA7A 2NN6G 3S2HB 3NQIA 1B53A 3R2TA 2K01A 1RHPA 2B2WA 2IT1A 4M8AA 3MZ5A 4A3MB 3NP8A 1GUSA 1LT5D 5COYA 4RGTA 3KK7A 3BDOA 2NTTA 3ND8A 2D5DA 2WKDA 3FPPA 1ENAA 2QKIC 3HGBA 4EVOA 1EQVA 1SAPA 5JEAJ 3OWEB 1II3A 2FHTA 1VF7A 1FYCA 2E2JB 3NTKA 4G7ZC 3DMUA 2D62A 2BA1A 1NAPA 1JC7A 2B2UA 2EY6A 1X32A 2K32A 5G3LF 5CV9A 5C0XJ 3F2UA 3E5SA 2OF1A 1LTAD 2LKVA 1EZ8A 1G6ZA 1ENCA 1B50A 1WCMB 4CHTB 2E74C 2JA5B 1I4GA 3I90A 2R3ZA 2LY7A 1EIHA 4KY7A 1GUWA 5DM73 1JQYD 1LT3D 1JOKA 5D65A 1LT6D 2HQEA 4ID6A 4XYOA 1DM0B 2NYZD 3IKJA 1TS3A 2LMCB 3D8GA 1R9TB 1SMYD 3EJIA 1JICA 4DNTB 5HURA 1GUGA 1GXDC 5K36H 4R8NA 3CU7A 4N9TA 2G9HD 3TN2A 2XRSD 3MC0B 2HCCA 3SHLA 4XT3B 1A2TA 2SEBD 4HMIA 2JE6I 4LMQD 3SDZA 4NW2A 5M5XB 4DAPA 4RHRA 3MXGA 1IHZA 2CVRA 1F2ZA 1Z7TA 4C3IG 2ZT9C 1XWEA 2VUMB 3D4RA 2BOSA 3M3YB 1VF5C 4G7HC 1EY0A 3IFDA 2VB3X 4MIUA 2ENBA 4LJZC 1IW7D 1EYDA 5CBAE 1I4HA 3BG3A 1NUCA 1V1PA 3S1NB 2F0WA 2BE5C 1G2SA 2Z1CA 1QG7A 1ICWA 2F0QA 1TT2A 3D6WA 1U4MA 1B4OA 1AW7A 2PZWA 3BVGA 4BY1B 2XWJB 1QILA 2K28A 2DY7A 1V1PB 2X6GA 1WTWA 2A68D 4XQQA 2PO4A 1SYFA 2ZXPA 1E0BA 2OXPA 1LT4D 5HGTA 1RJTA 4ZQ3A 3C3LA 1WD1A 3OMGA 2B2VC 5ELDA 5JAVA 1OXUA 1SSOA 5IOCA 3VR4A 3PO2B 2EYFA 2XVSA 4B9WA 1UNSA 2LFNA 4H0LC 1HA6A 1B2TA 1FNUA 2A74C 4A3GB 4HCEA 1PTOB 1PZKD 1LLRD 4U673 2WB1B 1AEXA 2TSSA 2O4XA 4ZYSA 1D5MC 3A7AB 5A2QE 4FF1A 5FLXE 5DAUA 1EY5A 3H6MA 4K2LA 3J81L 2F3WA 3D4WA 2B8GA 2N88A 1DYQA 2HUGA 3HOWB 4NDXA 2PPBC 3SVMA 3HS0C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QB5 D;  4FNF A;  5G3L F;  4FO2 A;  5G3L D;  4FP5 D;  1QCB D;  1TII D; 
#chains in the Genus database with same CATH topology
 2EDG A;  3TP7 A;  4A3E B;  1WTX A;  4LFC Q;  3LNN A;  3FEW X;  3WOF A;  4YY3 Q;  1YIT A;  1Y1V H;  1PH9 A;  4CKC A;  1LTL A;  3HOX B;  2AQ1 B;  4BBS H;  3TRZ A;  4TVA B;  3CCM A;  4JOI C;  1JJ2 A;  1HNX Q;  1PMR A;  3SK4 A;  2RBM A;  4Z9C B;  1XNR L;  3S1M B;  3NXW A;  3VA5 A;  3CAM A;  4LF5 Q;  3F8T A;  4A3J B;  4A93 G;  2BH8 A;  1JE5 A;  3CRK C;  2JXM B;  3U4Z A;  2SNM A;  1VQJ A;  2IW3 A;  4HJ8 A;  1C48 A;  1WTH A;  2F0L A;  3WDN A;  4G57 A;  3J81 j;  2NB0 A;  3R2I A;  4JBW A;  4KKS A;  1STB A;  4QUC A;  1QJO A;  2A6E D;  3JAM E;  3V96 A;  2Q2I A;  2CHB D;  2CW0 C;  2IX3 A;  1VQI A;  4C3I B;  3CHB D;  3HZX A;  5BR8 Q;  5IYC H;  1VQC A;  3FKI B;  1LAC A;  1XMQ L;  2O5J C;  2NBF A;  2J4X A;  4GKJ Q;  3BDL A;  3MXU A;  2I5H A;  2M00 A;  4A3F G;  1CK1 A;  3CQZ H;  3IL8 A;  4DK6 C;  1HZ9 A;  1XMO L;  2R7Z G;  2MGS A;  3NWS A;  4DR1 L;  2WB1 E;  3M7N A;  3CP0 A;  1VQ9 A;  4Y52 H;  1CZG A;  4YCU A;  1SYD A;  5TSS A;  3OOC A;  4G4K A;  5JEA H;  1HFN A;  5E4X A;  3FRP B;  3A8I E;  5AJ3 Q;  1Y8P B;  1V43 A;  5EJW A;  4ZRZ A;  4IFD G;  4DAY A;  1XPO A;  4ZKB B;  4OHJ A;  5HGQ A;  1I4Q A;  3HOV G;  2H5X A;  5NUC A;  5I4D A;  2VZA A;  1X65 A;  2R7D A;  2K4K A;  3PUV A;  5C0X H;  2A6H D;  2K05 A;  3AYH B;  3GTG B;  5M3F B;  2EVB A;  3JAM i;  1PYB A;  1D5X C;  3S24 A;  3FVQ A;  4DAY B;  5IT9 L;  4S3S A;  2HCI A;  2KOL A;  2F0I A;  2EYL A;  1VQK A;  3J7Y W;  5KYL A;  1SE4 A;  1D1K A;  3PMF A;  1IKL A;  2JA6 B;  3EIV A;  3HG9 A;  1RD9 D;  3N52 A;  4QGU A;  1EYA A;  1MJC A;  1LTR D;  2MPM A;  2DY8 A;  1F9P A;  3T53 B;  4ABN A;  1B9M A;  4DGZ A;  2Z0S A;  1LTI D;  3E6Z X;  2FXQ A;  2YTV A;  1WTO A;  1WTR A;  3S1Q H;  2XNA C;  1XNQ Q;  1STA A;  1PZJ D;  3I72 A;  4LF5 L;  1PVO A;  3OIP A;  4XT1 B;  2D0P A;  5JPN C;  3U4V A;  1YHB A;  3RLF A;  4C3H H;  3CPF A;  4L8J A;  3DM1 A;  3F2D A;  5CV4 A;  5GAG C;  1IBL L;  3ULL A;  1SRU A;  3D4D A;  2UXB Q;  4JI5 L;  1HUN A;  5GRO A;  3CC2 A;  1SJE D;  1YJ9 A;  2ZXO A;  2EPB A;  1RDP D;  4IFD I;  1WJJ A;  1ZXT A;  3ERO A;  1XYI A;  4NB3 A;  1TII D;  1BO0 A;  4X65 Q;  3K57 A;  3ERS X;  3MXN A;  4GKJ L;  5T1G A;  5KNC A;  2WKC A;  1HQM C;  2K5D A;  2XWB B;  4CKB A;  2L15 A;  1ILQ A;  2Q8R E;  4P73 A;  4A3L G;  1RCV D;  3OYY A;  2N3S A;  3MXN B;  1H9M A;  1PH8 A;  3HOZ G;  3IRB A;  1MHW C;  3FPU B;  1Q1B A;  3KFU A;  4KHP L;  3BDC A;  3EBE A;  4L6T B;  5J22 A;  1HXY D;  3I4N G;  3T16 A;  3HRZ C;  3A7L A;  4IUT A;  4R4Q A;  2N8N A;  1WTQ A;  4IPC A;  2KBN A;  1KHI A;  2R6G A;  4IUQ A;  2RKS A;  3VR3 A;  3S2D B;  4ME3 A;  3QOJ A;  2O5I C;  1O7I A;  4MN3 A;  2MO1 A;  3P75 A;  1BCP D;  5COR A;  1OO9 B;  1JT8 A;  5FLX c;  4GOP A;  4IN3 A;  5IGG A;  5CC4 A;  1MI2 A;  1J5E L;  3OW7 A;  4DAV A;  1SMY C;  1M4V A;  1TS4 A;  1X55 A;  1JOO A;  1RL2 A;  2ZTC A;  3PIO 3;  1STE A;  2UUB Q;  2PZU A;  1PH4 A;  1F2L A;  5LMN W;  3HOY H;  3GTQ B;  3M4O H;  1EFI D;  3KBX A;  1VQH A;  4GOP B;  4KN7 C;  4C3J B;  3K0Y A;  4IO9 A;  4A3F B;  3I7F A;  2YV5 A;  4J15 A;  4HR7 B;  2R7Z B;  2IL8 A;  5C3X A;  4HIM A;  1IL2 A;  3I91 A;  3BVM A;  2IHF A;  2SOB A;  4JI0 Q;  4LF8 Q;  1UE6 A;  1LUZ A;  5DM6 3;  4J8Q A;  1XNQ L;  3STB C;  3R3O A;  1PH7 A;  4X6A H;  2QEX A;  3AFQ A;  1IYJ B;  2PQE A;  2WAQ G;  5KGU A;  4DR6 L;  1CZW A;  2XRQ D;  3NPP A;  3EFX D;  5CGK A;  3GTM B;  2Y0S G;  5BN3 A;  3FHW A;  1IW7 C;  1AZP A;  3P20 A;  3JAM c;  4RGO S;  3QWN A;  5LMU L;  3K80 C;  2QDB A;  1HTL D;  2CQO A;  5DNF A;  4Y7N H;  4K6D A;  1AH9 A;  1CHP D;  1B7Y B;  4LF9 Q;  1SYG A;  2DUD A;  4JV5 Q;  1V9P A;  4KD3 A;  3L9A X;  3BJU A;  2MHV A;  5IIF A;  3DEO A;  1MIU A;  3H3V C;  1FD7 D;  2A68 C;  4LFB L;  1BBU A;  1I3Q B;  2RA4 A;  4H7B A;  2ZTD A;  2F0U A;  2KHS A;  4JI3 Q;  4OWW B;  1NTG A;  1EL0 A;  1F77 A;  1B9N A;  1MD2 D;  3EQL C;  2D9U A;  4WJ4 A;  1O7L A;  2DN8 A;  2QGQ A;  1PRT C;  5IY0 A;  1BNZ A;  1DD2 A;  1RF2 D;  1XTD A;  3S1N H;  3K5O A;  1UE1 A;  3AQQ A;  2R93 G;  1Q81 C;  2EYM A;  1W2B A;  4JI8 Q;  1BR9 A;  1ESF A;  1EEF D;  1BBX C;  4WFN 3;  1VMP A;  2QCP X;  1JCK B;  2Z6K C;  1X3F A;  2A69 C;  1D7Q A;  1DCZ A;  4A3C H;  2NN6 H;  2UUB L;  4PNY A;  4TKO B;  3GTK H;  4B3R Q;  1F2Y A;  1PDQ A;  4HN7 A;  1QE6 A;  1VQO A;  2Q2H A;  3K6O A;  3PO3 H;  2ZXR A;  1L0X B;  4JYA Q;  4HTH A;  1TWC H;  4GZY C;  2VUM G;  4POG A;  2RSN A;  3ER0 A;  1K83 B;  2ALY B;  4A3B H;  4F88 A;  4HCS A;  2IJ0 A;  1VQ5 A;  3BZC A;  3HOZ B;  3SK8 A;  2HHH Q;  2B63 H;  1W6K A;  2EXZ A;  2AQ2 B;  3K5L A;  5IP7 G;  3W3A A;  4R4C A;  2JYO A;  3I4N B;  2J0T D;  3CKI B;  4GNX C;  2I0Q A;  1P16 A;  2D0O A;  3GD7 A;  1SE2 A;  4GKK Q;  1JJG A;  3B6Y A;  1I6H H;  1MSG A;  4YHH Q;  2R7F A;  3OWF A;  1NR2 A;  3E9I A;  4A3D B;  1VQ7 A;  2WFW A;  3M85 A;  5CYU A;  4PV1 C;  1EIG A;  2JA7 G;  2UXD Q;  4RWS C;  1KAA A;  1Q46 A;  1S5B D;  4LF9 L;  2NVY B;  4RKB A;  5M3M H;  4CGY B;  2B2T C;  1VQD A;  4PZ7 A;  2QDL A;  1KD1 C;  2VW9 A;  1Z47 A;  4LUV A;  4DUZ Q;  1K9M C;  5K5P A;  1EUJ A;  3PUY A;  2RDH A;  2A6E C;  2NZO A;  3X3N A;  3MAQ A;  5C44 G;  1YVC A;  1LV9 A;  2NVT H;  1PH5 A;  2PNR C;  2IY5 B;  1VS0 A;  3A74 A;  2WAQ B;  3C1E A;  3S17 H;  2C5C A;  4HMJ A;  3I4O A;  3W2D A;  2Y0S B;  4JBK A;  1O80 A;  4JI8 L;  3J7A 5;  1PH3 A;  3GV6 A;  1DXM A;  3WOE A;  2UXC L;  1A3T A;  1TS5 A;  1A3V A;  4K14 A;  2EY5 A;  1HHV A;  5EBC A;  4KKT A;  4FF3 A;  1FJG L;  1M90 C;  1PFS A;  4DV5 L;  1TWA B;  3I4M B;  3ZYY X;  2NWG A;  1CT1 D;  2F0S A;  2IHE A;  3TP8 A;  4B3R L;  1SNM A;  1GO3 E;  2R92 H;  2G5D A;  4ODG A;  1SRO A;  3EN2 A;  3K8A A;  4IQZ A;  4WJW A;  3CCV A;  3S1R B;  4OEL B;  4ILW A;  5KEE A;  3KF8 A;  4F87 A;  4BWG B;  3GTO H;  4JYA L;  3KLW A;  2ICI A;  4B3T L;  1FVI A;  1HNW Q;  1JR0 D;  3AFP A;  1T5E A;  4LF4 Q;  1BQQ T;  2HHH L;  1Z6H A;  2K5Q A;  1IXR A;  1J9O A;  1PYW D;  3KF8 B;  2XTI A;  1KXL A;  3QG1 A;  1CA5 A;  2MO0 A;  1YJN A;  1PTO D;  5A2Q L;  3JC6 6;  3K5N A;  4LF7 Q;  2R93 B;  5FLX L;  1CQV A;  1QCB D;  1SFO H;  1LTG D;  3AMU A;  2Z6B A;  1ASY A;  4KHZ A;  4A3J G;  3GO5 A;  2AKW B;  3SK5 A;  4J6H A;  1C8C A;  4FXD A;  1D2B A;  2UXD L;  4XDX A;  5E3F A;  4POF A;  5BN4 A;  3GTP B;  4XTC S;  1STH A;  3ULJ A;  1OXX K;  1PLF A;  4GLX A;  2RSO A;  2KEN A;  2X69 A;  4FXG C;  1X3G A;  4FXK C;  3FKI G;  4KD4 A;  4X3T A;  2FIN B;  5M5W H;  1Y1W H;  1E2W A;  1FL0 A;  5FO7 B;  4KN4 C;  5I2X A;  4Q0F A;  1E2V A;  1JE4 A;  4P75 A;  3TSS A;  2WAQ E;  4IJH A;  2E2H B;  2K5N A;  2K52 A;  1AE2 A;  2JA6 H;  4JK1 C;  4QJF A;  3S15 B;  2ZTE A;  1FR3 A;  2Y0S E;  5HY6 A;  4RCO A;  2AMC B;  3LX0 A;  5I6Y A;  4DR4 Q;  2JK8 A;  1Q90 A;  2E5L L;  1HR0 W;  3GTJ B;  3NQT A;  4IUR A;  3JAM L;  2JA8 H;  2V1C C;  3W1B A;  1K28 A;  5C3W A;  4B3M Q;  3TP6 A;  1G29 1;  5FLM G;  3KBG A;  4KLK A;  3UDX A;  4TRD A;  5C4X G;  3PIP 3;  2JA7 B;  5D14 A;  4LUZ A;  4GLA C;  1I50 H;  4DV6 L;  3GDE A;  3URY A;  2UUC L;  1BOS A;  2EY2 A;  2B2Y C;  4G7O C;  2IX0 A;  2NVX B;  3SGI A;  1K0R A;  5M3F G;  1F2M A;  5K36 G;  3AB9 A;  1K0S A;  1WVL A;  1VQ8 A;  1BCP C;  4UP9 A;  1XMQ Q;  5C4J B;  4A75 A;  2V4D A;  2JJQ A;  2XN9 C;  2FJ2 A;  5C3E G;  3NBI A;  5C44 B;  2MUY A;  3RR5 A;  4A3K G;  4LF4 L;  4RA8 A;  1J8I A;  1XMO Q;  1EY6 A;  1V1Q A;  1EYG A;  4DU9 A;  1BVS A;  1H9K A;  4NKL A;  3H3V I;  1TQO A;  3UDF A;  1WI5 A;  2OCE A;  2L5T A;  3E3X A;  5ISR A;  4A93 H;  4ULL A;  1N33 L;  4HJ7 A;  3VDY A;  3PF4 A;  4QUF A;  4BA1 I;  3S9W A;  1F9R A;  4PQX A;  4QL5 A;  2B8F A;  1L0Y B;  1TWF H;  5EPK A;  3SK6 A;  4A3I G;  3M4Y A;  3H09 A;  1TWH B;  3P7J A;  3LWE A;  4CDD C;  4RKL A;  2M2L A;  4PZ6 A;  1EIF A;  1STG A;  2MJ8 A;  1E3P A;  4QF4 A;  3K59 A;  1S5C D;  5JVH 3;  1ZYR D;  1LTB D;  3SR1 A;  5IOD A;  4QQB X;  4NXN L;  2R7Z H;  1I5F A;  4F8M A;  2KA7 A;  2BDO A;  4DR4 L;  3OHX C;  1GHJ A;  4MTK A;  1Y69 U;  4HIO A;  4YWL A;  2I46 A;  1B3A A;  1IYU A;  2PQA A;  4JBJ A;  4B3M L;  4QY7 A;  5M5Y H;  3H0G B;  2B2W C;  4XIG S;  2F0H A;  2EYP A;  1IBL Q;  3HOV H;  4KI0 A;  3OPO A;  2E2I H;  4JI5 Q;  1U4R A;  4DV0 L;  5LHY 1;  2KEC A;  2PQA B;  2LXK A;  1QZG A;  1C7Y A;  2JP1 A;  4ZUI A;  2H1E A;  1EFW A;  3TDQ A;  1QB5 D;  1S5D D;  1R4Q B;  4V0B A;  4C3J G;  4EQP A;  1NSN S;  4IUV A;  1ESR A;  1QVC A;  1TS2 A;  1U0L A;  4LUO A;  1UEB A;  1VQA A;  4U68 A;  4MTN A;  1AP0 A;  1I3Q H;  4GLV B;  5D3I B;  1SNQ A;  2LS0 1;  5KND A;  4IPG A;  3Q0A A;  2G9D A;  2B2U C;  1JJC B;  4JI2 L;  1AFP A;  1EQT A;  1PRT B;  2RCN A;  4UDU C;  1VDZ A;  1UE7 A;  1YHA A;  5CV5 A;  1EY4 A;  1SBB B;  2RHS B;  4ZK9 B;  4KHP Q;  4PMC A;  2B29 A;  3ONA B;  2GN5 A;  1Y1V G;  5C4X B;  1FNW A;  2F0G A;  4HJA A;  1GVP A;  4BBS G;  3NWT A;  2Z4H A;  4M1U B;  4Q5V A;  1JWM D;  1K73 C;  4EGV A;  2HIX A;  4H13 C;  1J5E Q;  1WOC A;  1STN A;  4WRD A;  2N49 A;  4BY7 H;  1E1T A;  1O7Y A;  3MFY A;  2Z4I A;  2F0N A;  3TME A;  3KLS A;  2I07 B;  3RD4 A;  1K3B C;  1XX8 A;  5C3E B;  5CV6 A;  3CCL A;  1Q7Y C;  1ICF B;  1SMX A;  4A3K B;  3MVV A;  4R4O A;  2CQA A;  3GTL H;  5EKI A;  2VQE L;  2MQH A;  1KTK A;  1DON A;  1S5F D;  1SXT A;  5C4H A;  1DOL A;  2E76 C;  1HA5 A;  1HQR D;  3HOU H;  4DR5 L;  1X54 A;  3T56 B;  5IYC G;  4A3L H;  2F0F A;  5EPL A;  1KC8 C;  2L12 A;  5IGD A;  1OXT A;  2NTS A;  2KQ3 A;  3RZD B;  4OGQ C;  2HT1 A;  2OTL A;  3PSI A;  1T5X D;  2CFM A;  4DR6 Q;  2Q8T A;  1SEB D;  5LL6 X;  3FDT A;  4AQY L;  1X9N A;  1TWG B;  3K7A H;  4A3I B;  3S16 H;  4JVZ A;  4UP8 A;  4B08 A;  1O7Z A;  5LMU Q;  5FO9 B;  5JJZ A;  4H44 C;  4IOA A;  1YHQ A;  3PUZ A;  3RN5 A;  2YU9 B;  4DUY L;  5EKK A;  3S2H H;  4HED A;  1K8M A;  3MA2 B;  2F0K A;  1E7Z A;  3PGZ A;  1RKN A;  4A3M H;  3T13 A;  4RG1 A;  4X3K A;  4YCW A;  5C0X G;  4LFB Q;  2NVQ B;  1V8Q A;  1KAB A;  4YWK A;  1NBW A;  3GV3 A;  1QNU A;  4UAI A;  5CBE E;  5G3L D;  1CTM A;  2VB2 X;  2KHJ A;  1X56 A;  1JB3 A;  2BDN A;  3CRL C;  2E2J H;  5GQO A;  5AFW A;  5IYB G;  3UDG A;  1EQQ A;  3RZO B;  5KRU A;  3J80 E;  1N8R C;  1YBY A;  3CCJ A;  1VCI A;  1VQN A;  3S14 B;  1LAB A;  1PRT F;  2JEB I;  5DEH A;  1QUQ A;  1N34 Q;  3N6R A;  1K3R A;  4BXX G;  4A3D G;  2VXW A;  2MNA A;  1PTO C;  3FMC A;  3RLO A;  3A56 A;  3VYU A;  2AHO B;  4L63 B;  4OWX B;  3KUP A;  2JA9 A;  4UP7 A;  4C2M B;  2MP1 A;  1IKM A;  4TSS A;  1N32 Q;  3T4A C;  1WCM H;  4DV2 Q;  3CPW A;  4C3H G;  2JA5 H;  2F03 A;  1QUQ B;  3MFG A;  3R93 A;  1SNO A;  1IZ6 A;  4LAA A;  2KJX A;  2NZH A;  2WAC A;  4DV4 L;  5F2D A;  4OO1 H;  1CKM A;  3CC7 A;  4BBR B;  3U58 A;  1MJE A;  4KV6 A;  1EY7 A;  3DXJ C;  2B39 A;  1YNJ D;  5LL6 S;  1N36 L;  4E6I A;  2L11 A;  4RGM A;  4K5W A;  3K58 A;  3G6J B;  4LNQ A;  5C0X I;  2QIL A;  1VQE A;  1SYC A;  4B9X A;  3T1H Q;  3HP3 A;  1K8A C;  2EY1 A;  1H9S A;  1KNA A;  1Y1V B;  1WFQ A;  2ASB A;  3V05 A;  4CDF C;  1R9T H;  1GJX A;  4K6L A;  4BBS B;  3EVQ A;  3UI2 A;  3J80 i;  1CUK A;  1I4X A;  4NPS A;  2L55 A;  5GAE C;  4X64 L;  1UWV A;  3CCS A;  3G4S A;  4FF4 A;  4C1N K;  4RHS A;  2DJG C;  1ONL A;  4XXE A;  3C2P A;  1I94 L;  2KED A;  1JMC A;  2EJM A;  3LWU A;  1ML0 D;  3I4M G;  1H9S B;  3A54 A;  3E0J A;  3VYS A;  1HR0 L;  2P5Z X;  1D8L A;  2KCC A;  5M5X H;  4CKE A;  1EWH A;  1ROD A;  4JPB W;  1QOH A;  4MZ9 A;  5FOB B;  4JBM A;  1B1Z A;  1Q1E A;  1UAP A;  3QOL A;  1L1O A;  2EOT A;  3UE0 A;  4O42 A;  3K5M A;  3Q23 A;  5A35 A;  2VUM H;  2DJF C;  3F2C A;  3M3Y H;  5J3B A;  1MBY A;  3HOY G;  4FDB A;  3BYT B;  2IWH A;  1F9Q A;  4FF2 A;  3L7Z C;  3NTH A;  3CQZ B;  1AZQ A;  3OW2 A;  1L1O B;  1GOZ A;  1QWY A;  5M9O A;  5I6W A;  2B2V A;  2UXC Q;  1N34 L;  4IJL A;  1SND A;  2I5L X;  3D0F A;  4BY1 H;  1FJG Q;  4DV5 Q;  1CKN A;  1FNV A;  2BCO A;  4KJN A;  5IE8 A;  3KJP A;  1EOV A;  3C1F A;  4LFA L;  3CF5 A;  1N32 L;  1UUP A;  1U4P A;  5FJ8 H;  4DV2 L;  1WTV A;  4O1N A;  4K8I A;  2ID0 A;  1Q8I A;  4L5S A;  2ATW A;  1CKN B;  3BVZ A;  1EY8 A;  4B3T Q;  1NNX A;  2L4N A;  2A1A A;  2X6L A;  4EQ5 A;  3PO2 H;  3A55 A;  4KK7 A;  3VYT A;  4RCN A;  1PFN A;  3DUZ A;  2AQ3 B;  5H1S E;  3DEP A;  1PFM A;  2PW5 A;  2IPK D;  4KY5 A;  3C46 A;  3T1H L;  3H91 A;  4A3G H;  1PTO H;  3L0O A;  4IFD J;  1ZYR C;  1J6Q A;  2AWO A;  5KYI A;  2OTJ A;  4O2D A;  1M1K C;  3S1Q B;  3PUX A;  4X3S A;  4KTA A;  3CCQ A;  4CDC C;  3PIO A;  1BF4 A;  1E1O A;  1FGB D;  1I4P A;  4IUN A;  2VS1 A;  4UHV A;  1BBW A;  2WP8 J;  2A8V A;  3IFT A;  4C3H B;  1SN8 A;  4P71 A;  2WV6 D;  4JOI A;  3D6C A;  3OTO L;  2F0J A;  1O78 A;  3P1H A;  2KEE A;  5C4Z A;  1CA6 A;  1OXS C;  3HOW H;  1SNC A;  4P74 A;  3SEB A;  4A3C G;  1A6X A;  4DR3 Q;  2QF7 A;  2Z9H A;  3CME A;  4A3E H;  4X62 Q;  3VR6 A;  3J7A F;  3PO3 G;  4HSP A;  2GVA A;  1UE5 A;  4J1M A;  5EQ0 A;  4IOC A;  1K8G A;  3HOX H;  5GAD C;  2DNE A;  2E5L Q;  3J80 c;  4BA2 I;  1BXT A;  2YYZ A;  4OIJ A;  2ZJP A;  1TXY A;  4HJ9 A;  3VR2 A;  2EE1 A;  4A3B G;  3S1M H;  1EZ6 A;  2F4V L;  1VQL A;  3MTS A;  4A3J H;  4JC0 A;  3I2Z A;  1KDB A;  3CXC A;  4ZCK A;  4DV6 Q;  3G7L A;  2WIN B;  2UUC Q;  5J39 A;  2RVL A;  3M4P A;  1U4L A;  3F2B A;  4RFB A;  1JOQ A;  2ZJQ A;  3NTI A;  1H95 A;  1EOT A;  3HEJ A;  3J7A V;  1Q82 C;  4FNF A;  1CM9 A;  3G48 A;  3NBH A;  3NUC A;  4OEM B;  4FP5 D;  2J7Z A;  4C3I H;  2A6H C;  2PMZ B;  1CSP A;  1L0W A;  1Z9F A;  3FKI H;  1N9W A;  2PW7 A;  3HOY B;  3M4O B;  4DK3 C;  1Q86 C;  2EJF C;  3SE0 A;  1BCP F;  1GUT A;  1V1O A;  2RDG A;  3NBH B;  4JG2 A;  4LWC A;  3VR5 A;  1LTS D;  4H02 A;  2NN6 I;  4DK0 A;  2BH2 A;  4GOP C;  3CD6 A;  5D3D A;  5IT9 c;  5I9P A;  2QEJ C;  2FMM A;  2N78 A;  1QVG A;  2KCM A;  1N33 Q;  1DZ1 A;  3H0G G;  1Q8K A;  5IP9 G;  4KY6 A;  4L5R C;  4DR2 L;  1YI2 A;  3MEH A;  1YNN D;  2E2D C;  4DKA C;  1XPR A;  2VNU D;  2K50 A;  1G8Z D;  5FO8 B;  2EJG C;  1YIJ A;  1AN8 A;  4APV A;  4OX9 L;  4FYD A;  3M7G A;  2OQK A;  3GTG H;  4JI4 L;  5M3F H;  5JPM C;  4Y7N B;  1U5K A;  4ZUJ A;  1JWS D;  5IGB A;  4DR3 L;  4LK1 C;  1KIX A;  2R92 G;  2CCZ A;  4X62 L;  1X6O A;  2CKZ B;  4NXN Q;  2OQ0 A;  4ME5 A;  1TY0 A;  1SDF A;  2RQX A;  1D1I A;  4CJ1 B;  5EGT A;  4KKU A;  5C5M A;  1B44 D;  5ELB A;  4PG3 A;  1XTC D;  4NXM Q;  3MHB A;  3T51 B;  2ZJR A;  4HJ5 A;  1I6V C;  2KVM A;  1GUN A;  4RGN A;  2UUA Q;  3ULP A;  1X3E A;  2QA4 A;  5IGC A;  4KJO A;  1KLG D;  3M9B A;  5KNB A;  1SE3 A;  4DV0 Q;  2PMZ E;  3D3R A;  2L9H A;  1NY4 A;  3Q24 A;  2PCF B;  1A62 A;  1IBK L;  2AUJ D;  3MXP A;  2HDL A;  1VQM A;  2UU9 Q;  3BYY B;  1RTN A;  3OSO A;  1S3O A;  2LSS A;  2F0V A;  5IWA L;  3GTK B;  4N9P A;  3NSW A;  1CHQ D;  4CDE C;  5JJK A;  2F52 A;  1LO5 D;  1YNX A;  2OWO A;  4GN3 B;  3PO3 B;  3O13 A;  1EU3 A;  4HSV A;  5EPJ A;  3RNU A;  2NVQ H;  4JI2 Q;  4MNO A;  3ND9 A;  1TWC B;  4LF6 L;  5LMN L;  2N55 A;  2F3V A;  4EQN A;  4OL7 A;  4QCL A;  2L1B A;  1PRT D;  2PZT A;  1PH2 A;  4XYQ A;  1Y1W G;  4DNI A;  1DJR D;  1PXU A;  4A3B B;  4P2C B;  4ZKC B;  5JJI A;  2PYK A;  1YNJ C;  2B63 B;  1CSQ A;  5JVG 3;  2Q2T A;  1A3U A;  1JOR A;  3S2D H;  5I2Y A;  3OMC A;  3QB3 A;  2H4O A;  1G91 A;  2A69 D;  1D5Z C;  1GHK A;  5IYD G;  4OXP A;  3V2T A;  2GVB A;  2K03 A;  4IPH A;  3J7Z C;  2JA8 G;  1I6H B;  3CCU A;  2K33 A;  4TQU S;  2JN4 A;  2KUM A;  4JW0 A;  1STY A;  1FGU A;  1G6P A;  2EYH A;  1TR5 A;  4DV3 L;  2HIV A;  4CBV A;  1H9J A;  3GTQ H;  3NEL A;  4XQN A;  3RUZ A;  3FP9 A;  3TRE A;  5M3M B;  1Q3L A;  4C3J H;  2F0P A;  1XJV A;  2RDF A;  2VQE Q;  4A3F H;  3E0E A;  1ET9 A;  1S72 A;  1JWU D;  5FK9 C;  5T1I A;  5E4W C;  4DR5 Q;  4NP5 A;  3PUW A;  3G6E A;  1HUM A;  2EYO A;  3A5Z B;  4NXM L;  1KDC A;  2NVT B;  4DK1 A;  1G51 A;  1HPC A;  2IX1 A;  4DV7 L;  3L3O C;  4AQY Q;  2F0M A;  2YTY A;  5E1F A;  3H94 A;  3MEF A;  4DN4 M;  4IFD H;  3DM3 A;  3KLR A;  1EWC A;  5C5L A;  4AYB G;  1QNK A;  1EU4 A;  3D31 A;  3DWP A;  1W3S A;  2CH4 W;  3RMH A;  2UUA L;  3S17 B;  1B70 B;  3GTM H;  1MKH A;  5ELN A;  4K0K Q;  1ET6 A;  1VMC A;  4DUY Q;  5C6A A;  4KHV A;  3NEM A;  3ITP A;  1KNE A;  2UU9 L;  1LYL A;  5ELF A;  1C4Q A;  1SJH D;  3GP7 A;  1KAW A;  2F0O A;  2F4I A;  2KCT A;  3Q6S A;  2R92 B;  1X3Q A;  4OIK A;  3R8B A;  4JI6 Q;  4BBR G;  2XIW A;  5EBD A;  2JQO A;  2F0E A;  2Z8L A;  3J80 L;  3SXH A;  2Z6K A;  5ELO A;  3GTO B;  3TEH B;  1EQR A;  4YCV A;  1VQ6 A;  1RTO A;  3I73 A;  1IYV A;  1TY2 A;  2DNC A;  3U9O A;  3TP5 A;  1HZC A;  1L2F A;  4RH6 A;  1CI3 M;  4RAU C;  3PIP A;  3QIA A;  1T9H A;  2A73 B;  2ZM6 L;  5CMD A;  1SFO B;  1PA6 A;  4K8J A;  1HZA A;  1XXG A;  3AEV A;  5CV8 A;  4DR7 L;  1EY9 A;  1TVX A;  3BZK A;  2VY3 A;  3GQB A;  3QJY A;  4F7X A;  1KLU D;  1SR3 A;  4WJ3 M;  2HDM A;  4LW1 A;  4IAL A;  2C9O A;  2BA0 A;  2NZ1 D;  1PTO F;  2K14 A;  3W5O A;  2A5H A;  4CJ0 B;  4DV4 Q;  4GNX A;  2AUK A;  3RN2 A;  4NMZ A;  3A8K E;  1DOM A;  1GKH A;  2AWN A;  3I56 A;  1OTC A;  3A8J E;  4B3S L;  4K5X A;  1N36 Q;  2XSC A;  3TZD A;  1K83 H;  1NMF A;  1D6E C;  1AE3 A;  4CJ2 C;  2QW7 A;  5M5W B;  2A19 A;  1E22 A;  1Y1W B;  3HOZ H;  1PH6 A;  4GNX B;  2Q2U A;  1KDA A;  4FO2 A;  2B2T A;  4LFC L;  2PI2 A;  3DWQ A;  3I4N H;  2O2L D;  4YY3 L;  4UY8 C;  5IYB H;  4K5V A;  4DA2 A;  3HKZ G;  3J81 E;  3K0X A;  1Y8O B;  1HNZ Q;  1EYC A;  4PMB A;  4XQJ A;  2CWP A;  4BS9 A;  4IPD A;  4X64 Q;  1G2T A;  5JEA G;  4AH6 A;  1SYB A;  2OT2 A;  2JA8 B;  2F0D A;  1HNX L;  3QO2 A;  1I94 Q;  4BXX H;  4A3D H;  2E75 C;  4K0K L;  1IL8 A;  4A76 A;  4I65 A;  1HR0 Q;  3Q22 A;  2NVY H;  1EEI D;  1I50 B;  1LTT D;  1XPU A;  1A2U A;  1P8L A;  3KYH C;  1SYE A;  5FKA C;  3I8Z A;  1NMG A;  2K04 A;  1BDO A;  1B8A A;  4JI6 L;  4BY7 G;  1C0A A;  1GUO A;  2LXJ A;  5I9O A;  2EYJ A;  2NUC A;  2K1B A;  5ELE A;  5BR8 L;  1CFM A;  1A15 A;  4OON A;  4DFA A;  5BN5 A;  5IGF A;  2BE5 D;  2F0T A;  1S5E D;  2GA4 B;  4DF7 A;  1OXV A;  1WD0 A;  2EXD A;  2K75 A;  1DOK A;  4AYB B;  4K2K A;  5E7N A;  2JEA I;  1HFG A;  2K5W A;  3L2P A;  3HOU G;  3J81 i;  2TMP A;  3DHQ A;  1B3Q A;  4P72 A;  4MHE A;  4PMW A;  4ZLT F;  5AJ3 L;  1TWA H;  3I4M H;  4A93 B;  5EKL A;  1ZEQ X;  5CR3 A;  4LFA Q;  1HTP A;  2D2C C;  4PZ8 A;  5IGE A;  4YIJ A;  3HFZ B;  3PCO B;  3F1Z A;  1R4P B;  3EA6 A;  1HH2 P;  4IUP A;  1TWF B;  4C1N I;  5GAH C;  3CMA A;  3BZD B;  3WWV A;  1W6J A;  1E2Z A;  3S1R H;  3NEN A;  1YNN C;  1TKW B;  1K8O A;  4L5Q A;  3T1Y Q;  1LM0 A;  4IZ8 A;  4IUU A;  3TQY A;  1PHJ A;  5JOB A;  4QIW B;  2JSO A;  3U9S A;  1YEZ A;  1HJP A;  2R61 A;  2SDF A;  3UE1 A;  5KIX A;  1Q12 A;  4A3M G;  4QB4 A;  3DWA A;  4V19 0;  4FVM A;  3KLS X;  1HZB A;  3NE5 B;  1KRS A;  2C35 B;  1HNZ L;  2R93 H;  1UEA B;  2OEO A;  5IT9 E;  3HKS A;  1U9R A;  2PI2 E;  3PQI A;  1ZKO A;  3MWY W;  5M5Y B;  2F3I A;  4DXF A;  4ALP A;  1MSH A;  4X3U A;  3GTP H;  3TBI B;  3HOV B;  3OTO Q;  1YJW A;  1S40 A;  2E2I B;  2UXB L;  2L0C A;  4I7Z C;  1BUV T;  2WII B;  3NHH A;  3OIQ A;  1RIP A;  1WCM G;  4X65 L;  2YTX A;  2FMC A;  3NK9 A;  2JA5 G;  3TZU A;  5J1Z A;  2E2H H;  4AYB E;  1HRJ A;  3VYR A;  5IP7 H;  4DV1 Q;  2B2Y A;  3S15 H;  4OO1 G;  1C9O A;  1ILP A;  2ES2 A;  1CQF A;  3G71 A;  2MFI A;  3BS1 A;  1Y8N B;  1SE8 A;  4C56 C;  3HKZ B;  3GTJ H;  5JJL A;  1A0I A;  1PFB A;  2F4V Q;  2KHI A;  2K7V A;  2ICE C;  1KRT A;  2JA7 H;  2SNS A;  3KOJ A;  4EQO A;  5CV7 A;  4A4I A;  1WTP A;  4ZAI A;  4DNR B;  1BCP B;  2CW0 D;  1GM5 A;  2NVX H;  2EIF A;  4QIW E;  2VL6 A;  2Q8I B;  1F9S A;  1EWI A;  4AIM A;  3A5U A;  4BY7 B;  1JB7 A;  5C4J H;  3T1Y L;  1ENF A;  1H9R A;  4KMU C;  1SNP A;  5C44 H;  1HCZ A;  3ERQ A;  3I70 A;  3I4L A;  1S4Z A;  1VQP A;  2K5V A;  3GTL B;  4X66 Q;  1X3P A;  2M9V A;  1PZI D;  3J81 c;  4R8I A;  4HAE A;  1NCV A;  4L5T A;  4DPG A;  3AU7 A;  3CC4 A;  2K6A A;  3HOU B;  1A63 A;  5ELC A;  4JI0 L;  3I3C A;  4QMG A;  4LF8 L;  1TU2 B;  2F1M A;  4OO1 I;  4DR2 Q;  3X3M A;  1NR4 A;  1VQF A;  2VQF Q;  4OX9 Q;  4R9W A;  3K7A B;  1TWH H;  1M8A A;  2KCN A;  3S16 B;  1VQB A;  1MGS A;  2FFK B;  4JI7 Q;  3IAY A;  2EZV A;  4JI4 Q;  3TS0 A;  4DXG A;  3PV0 A;  4WOR A;  4BY1 G;  1I4R A;  2XGT A;  2CWA A;  5EAY A;  3VA7 A;  2NN6 G;  1A8V A;  3S2H B;  3NQI A;  1B53 A;  2RF4 A;  3R2T A;  2K01 A;  5FJ8 G;  1RHP A;  1BKB A;  2B2W A;  2IT1 A;  4M8A A;  3ICE A;  4JV5 L;  3MZ5 A;  4A3M B;  3NP8 A;  4HIK A;  1GUS A;  1LT5 D;  2CH4 A;  3HKZ E;  4DV1 L;  5COY A;  1DGS A;  4RGT A;  3KK7 A;  3BDO A;  2NTT A;  3ND8 A;  1YZ6 A;  2D5D A;  2WKD A;  3FPP A;  1ENA A;  3H15 A;  2QKI C;  3HGB A;  4JI3 L;  4EVO A;  1EQV A;  1SAP A;  2E8G A;  3ZJY C;  3PO2 G;  2PNH A;  5JEA J;  3OWE B;  2B63 G;  1II3 A;  2FHT A;  1VF7 A;  1FYC A;  3H0G H;  2E2J B;  3BU2 A;  3NTK A;  4G7Z C;  3DMU A;  5IP9 H;  4A3G G;  2D62 A;  2BA1 A;  3K7U C;  1NAP A;  1JC7 A;  2B2U A;  2EY6 A;  1X32 A;  2K32 A;  5G3L F;  2WB1 G;  3CCE A;  5CV9 A;  5C0X J;  3F2U A;  3E5S A;  3Q8D A;  1IBK Q;  2OF1 A;  1LTA D;  2LKV A;  1EZ8 A;  1G6Z A;  1ENC A;  1IBM Q;  1PH1 A;  3H3V H;  1B50 A;  5IWA Q;  5M3M G;  1WCM B;  2DGY A;  4CHT B;  2E74 C;  2JA5 B;  1I4G A;  3I90 A;  2R3Z A;  2LY7 A;  1EIH A;  4KY7 A;  1GUW A;  1VQ4 A;  4X66 L;  5DM7 3;  1ASZ A;  4LF6 Q;  5LMN Q;  3HOW G;  3PF5 A;  1JQY D;  3I55 A;  1LT3 D;  1VQG A;  1WYD A;  1JOK A;  5D65 A;  1LT6 D;  2HQE A;  4A3E G;  4ID6 A;  4XYO A;  1DM0 B;  2HD3 A;  2NYZ D;  5FLM H;  3UDI A;  3IKJ A;  2RCF A;  5C4X H;  1TS3 A;  2LMC B;  3HOX G;  3D8G A;  2HQL A;  3W1G A;  2VQF L;  1R9T B;  1SMY D;  4R1J A;  3EJI A;  1JIC A;  1KQS A;  4DAM A;  4DNT B;  5HUR A;  4JI7 L;  4GKK L;  1GUG A;  1GXD C;  5K36 H;  4R8N A;  2EQS A;  3KJO A;  4YHH L;  3CU7 A;  4DV3 Q;  4N9T A;  2G9H D;  3TN2 A;  2XRS D;  4N8X 1;  3RLN A;  3MC0 B;  1E24 A;  3A0J A;  2HCC A;  4R4T A;  3SHL A;  4XT3 B;  1A2T A;  5C3E H;  2SEB D;  4HMI A;  4JI1 Q;  2JE6 I;  4LMQ D;  4A3K H;  2K5H A;  3SDZ A;  4NW2 A;  5M5X B;  4R4I A;  4DAP A;  1QZH A;  4RHR A;  4HID A;  3MXG A;  1IHZ A;  2CVR A;  1F2Z A;  4GN4 B;  4DUZ L;  1Z7T A;  4C3I G;  3STB D;  3TS2 A;  2ZT9 C;  1XWE A;  3E9H A;  2VUM B;  3D4R A;  2BOS A;  3M3Y B;  4N8F A;  4DV7 Q;  1VF5 C;  4I7A A;  4G7H C;  1EY0 A;  3IFD A;  4GS3 A;  3RZD H;  2VB3 X;  4MIU A;  2ENB A;  4LJZ C;  1IW7 D;  3QR8 A;  3DLL A;  1EYD A;  1TWG H;  2RHQ B;  5CBA E;  1I4H A;  3BG3 A;  1NUC A;  1V1P A;  3S1N B;  2F0W A;  4A3I H;  2BE5 C;  1G2S A;  2Z1C A;  1QG7 A;  1ICW A;  2F0Q A;  1XNR Q;  1TT2 A;  3D6W A;  5IYD H;  1L1O C;  1U4M A;  1B4O A;  1AW7 A;  2PZW A;  3BVG A;  4BY1 B;  2XWJ B;  2YU9 H;  3KDF A;  1QIL A;  1CKO A;  2K28 A;  1IBM L;  2DY7 A;  1V1P B;  2X6G A;  1WTW A;  2A68 D;  4XQQ A;  2PO4 A;  1SYF A;  2ZXP A;  1E0B A;  3CW2 C;  4O0A A;  2OXP A;  1LT4 D;  5HGT A;  1RJT A;  4ZQ3 A;  3KDF B;  3C3L A;  1WD1 A;  3OMG A;  2B2V C;  5ELD A;  1PYS B;  5JAV A;  1OXU A;  1SSO A;  1NE3 A;  3VR4 A;  5IOC A;  1SLJ A;  4RMF A;  1HNW L;  3PO2 B;  2EYF A;  2XVS A;  4B9W A;  3LGJ A;  1Y14 B;  1UNS A;  2JA6 G;  2LFN A;  4H0L C;  4JCV E;  1HA6 A;  1B2T A;  1FNU A;  3M4Q A;  2A74 C;  3RZO H;  4DR1 Q;  4A3G B;  4HCE A;  1PTO B;  2ZM6 Q;  4YWM A;  3S14 H;  1PZK D;  2I5M X;  4UPA A;  4OWT B;  3KF6 A;  1PV4 A;  4LF7 L;  1LLR D;  4U67 3;  4DR7 Q;  1QVF A;  2WB1 B;  3CCR A;  1AEX A;  2TSS A;  4C2M H;  4GN5 A;  5L37 A;  2O4X A;  1EIY B;  4ZYS A;  1GD7 A;  1D5M C;  3K81 C;  1KL9 A;  3A7A B;  3KF6 B;  5A2Q E;  4EX5 A;  1NJI C;  4JI1 L;  4FF1 A;  5FLX E;  5DAU A;  4BBR H;  1EY5 A;  3H6M A;  4K2L A;  4B3S Q;  3J81 L;  2F3W A;  3D4W A;  5DLQ E;  2B8G A;  2N88 A;  3U50 C;  1DYQ A;  2B3G A;  2HUG A;  3HOW B;  4NDX A;  2PPB C;  3SVM A;  3HS0 C; 
#chains in the Genus database with same CATH homology
 2EDG A;  3TP7 A;  4A3E B;  1WTX A;  3LNN A;  3FEW X;  3WOF A;  4CKC A;  3HOX B;  2AQ1 B;  1PMR A;  3SK4 A;  2RBM A;  4Z9C B;  3S1M B;  3NXW A;  3VA5 A;  4A3J B;  3CRK C;  2JXM B;  2SNM A;  2IW3 A;  1C48 A;  2F0L A;  3WDN A;  4G57 A;  2NB0 A;  3R2I A;  4JBW A;  4KKS A;  1STB A;  4QUC A;  1QJO A;  2A6E D;  3JAM E;  3V96 A;  2CHB D;  2CW0 C;  2IX3 A;  4C3I B;  3CHB D;  3HZX A;  3FKI B;  1LAC A;  2O5J C;  2NBF A;  2J4X A;  3BDL A;  3MXU A;  2M00 A;  1CK1 A;  3IL8 A;  2MGS A;  3NWS A;  3M7N A;  1CZG A;  1SYD A;  5TSS A;  3OOC A;  4G4K A;  5JEA H;  1HFN A;  5E4X A;  3FRP B;  3A8I E;  1Y8P B;  1V43 A;  5EJW A;  4ZRZ A;  4IFD G;  4DAY A;  4ZKB B;  4OHJ A;  1I4Q A;  5NUC A;  5I4D A;  3PUV A;  5C0X H;  2A6H D;  2K05 A;  3GTG B;  5M3F B;  2EVB A;  1D5X C;  3FVQ A;  5IT9 L;  4S3S A;  2HCI A;  2KOL A;  2F0I A;  2EYL A;  3J7Y W;  5KYL A;  1SE4 A;  1D1K A;  3PMF A;  1IKL A;  2JA6 B;  3N52 A;  3HG9 A;  1RD9 D;  1EYA A;  1LTR D;  2MPM A;  2DY8 A;  1F9P A;  3T53 B;  4ABN A;  1B9M A;  4DGZ A;  1LTI D;  3E6Z X;  1WTO A;  1WTR A;  2XNA C;  1STA A;  1PZJ D;  3I72 A;  3OIP A;  4XT1 B;  5JPN C;  3RLF A;  4L8J A;  3DM1 A;  5CV4 A;  3D4D A;  1HUN A;  1SJE D;  2ZXO A;  2EPB A;  1RDP D;  4IFD I;  1ZXT A;  3ERO A;  1XYI A;  1TII D;  1BO0 A;  3K57 A;  3MXN A;  5T1G A;  5KNC A;  2WKC A;  1HQM C;  2K5D A;  2XWB B;  4CKB A;  1ILQ A;  2Q8R E;  1RCV D;  1H9M A;  3FPU B;  1Q1B A;  3BDC A;  4L6T B;  5J22 A;  1HXY D;  3T16 A;  3HRZ C;  3A7L A;  4IUT A;  1WTQ A;  2R6G A;  4IUQ A;  2RKS A;  3VR3 A;  3S2D B;  3QOJ A;  2O5I C;  4MN3 A;  3P75 A;  5COR A;  1BCP D;  1OO9 B;  4IN3 A;  5IGG A;  5CC4 A;  1MI2 A;  3OW7 A;  4DAV A;  1SMY C;  1M4V A;  1TS4 A;  3PIO 3;  1JOO A;  1STE A;  2PZU A;  1F2L A;  3GTQ B;  1EFI D;  3KBX A;  4KN7 C;  4C3J B;  3K0Y A;  4A3F B;  4HR7 B;  2R7Z B;  2IL8 A;  5C3X A;  3I91 A;  3BVM A;  2SOB A;  5DM6 3;  4J8Q A;  3R3O A;  2PQE A;  5KGU A;  1CZW A;  2XRQ D;  3NPP A;  3EFX D;  5CGK A;  3GTM B;  5BN3 A;  1IW7 C;  1AZP A;  3P20 A;  4RGO S;  3QWN A;  2QDB A;  1HTL D;  5DNF A;  4K6D A;  1CHP D;  1SYG A;  4KD3 A;  3L9A X;  2MHV A;  5IIF A;  3DEO A;  3H3V C;  1FD7 D;  2A68 C;  1I3Q B;  2RA4 A;  4H7B A;  2F0U A;  2KHS A;  1EL0 A;  1F77 A;  1B9N A;  1MD2 D;  3EQL C;  2D9U A;  1O7L A;  2DN8 A;  1PRT C;  1BNZ A;  1DD2 A;  1RF2 D;  3K5O A;  2EYM A;  1BR9 A;  1ESF A;  1EEF D;  1BBX C;  4WFN 3;  1VMP A;  2QCP X;  1JCK B;  2A69 C;  1DCZ A;  2NN6 H;  4PNY A;  4TKO B;  1F2Y A;  1PDQ A;  4HN7 A;  1QE6 A;  3K6O A;  2ZXR A;  1L0X B;  4HTH A;  4GZY C;  2RSN A;  1K83 B;  4F88 A;  4HCS A;  2IJ0 A;  3HOZ B;  3SK8 A;  1W6K A;  2EXZ A;  2AQ2 B;  3K5L A;  3W3A A;  2JYO A;  3I4N B;  2J0T D;  3CKI B;  3GD7 A;  1SE2 A;  1MSG A;  3OWF A;  1NR2 A;  4A3D B;  3M85 A;  5CYU A;  4PV1 C;  1EIG A;  4RWS C;  1KAA A;  1S5B D;  2NVY B;  4RKB A;  4CGY B;  2B2T C;  1Z47 A;  5K5P A;  3PUY A;  2RDH A;  2A6E C;  3X3N A;  3MAQ A;  1LV9 A;  2PNR C;  3C1E A;  2WAQ B;  2C5C A;  4HMJ A;  3W2D A;  2Y0S B;  1O80 A;  3GV6 A;  1DXM A;  3WOE A;  1A3T A;  1TS5 A;  1A3V A;  4K14 A;  2EY5 A;  1HHV A;  5EBC A;  4KKT A;  4FF3 A;  1TWA B;  3I4M B;  3ZYY X;  2NWG A;  1CT1 D;  2F0S A;  3TP8 A;  1SNM A;  4ODG A;  4IQZ A;  4WJW A;  3S1R B;  4ILW A;  5KEE A;  3KF8 A;  4F87 A;  4BWG B;  2ICI A;  1JR0 D;  1T5E A;  1BQQ T;  1Z6H A;  2K5Q A;  1J9O A;  1PYW D;  3QG1 A;  1CA5 A;  1PTO D;  5A2Q L;  3K5N A;  2R93 B;  5FLX L;  1CQV A;  1QCB D;  1LTG D;  3AMU A;  4KHZ A;  3GO5 A;  3SK5 A;  4J6H A;  1C8C A;  4FXD A;  1D2B A;  4XDX A;  5E3F A;  5BN4 A;  3GTP B;  4XTC S;  1STH A;  1OXX K;  1PLF A;  2RSO A;  2X69 A;  4FXG C;  4FXK C;  4KD4 A;  4X3T A;  2FIN B;  1E2W A;  5FO7 B;  4KN4 C;  5I2X A;  4Q0F A;  1E2V A;  1JE4 A;  3TSS A;  2E2H B;  4JK1 C;  3S15 B;  1FR3 A;  4RCO A;  3LX0 A;  5I6Y A;  1Q90 A;  3GTJ B;  3NQT A;  4IUR A;  3JAM L;  5C3W A;  3TP6 A;  1G29 1;  3KBG A;  4TRD A;  3PIP 3;  2JA7 B;  5D14 A;  3URY A;  1BOS A;  2EY2 A;  2B2Y C;  4G7O C;  2IX0 A;  2NVX B;  1F2M A;  5K36 G;  3AB9 A;  1WVL A;  1BCP C;  5C4J B;  2V4D A;  2XN9 C;  2FJ2 A;  3NBI A;  5C44 B;  2MUY A;  4RA8 A;  1J8I A;  1EY6 A;  4DU9 A;  1H9K A;  4NKL A;  1TQO A;  2L5T A;  5ISR A;  4ULL A;  4QUF A;  4BA1 I;  3S9W A;  1F9R A;  4PQX A;  5EPK A;  2B8F A;  1L0Y B;  3SK6 A;  3M4Y A;  3H09 A;  1TWH B;  3P7J A;  3LWE A;  4RKL A;  2M2L A;  1STG A;  2MJ8 A;  4QF4 A;  3K59 A;  1S5C D;  5JVH 3;  1ZYR D;  1LTB D;  3SR1 A;  5IOD A;  4F8M A;  2KA7 A;  2BDO A;  3OHX C;  1GHJ A;  1Y69 U;  2I46 A;  1B3A A;  1IYU A;  3H0G B;  2B2W C;  4XIG S;  2F0H A;  2EYP A;  4KI0 A;  3OPO A;  1U4R A;  5LHY 1;  2KEC A;  2JP1 A;  4ZUI A;  2H1E A;  3TDQ A;  1QB5 D;  1S5D D;  1R4Q B;  4V0B A;  4C3J G;  4EQP A;  1NSN S;  4IUV A;  1ESR A;  1TS2 A;  4U68 A;  1AP0 A;  5D3I B;  1SNQ A;  2LS0 1;  5KND A;  3Q0A A;  2G9D A;  2B2U C;  1AFP A;  1EQT A;  1PRT B;  4UDU C;  1VDZ A;  5CV5 A;  1EY4 A;  1SBB B;  4ZK9 B;  4PMC A;  3ONA B;  5C4X B;  1FNW A;  2F0G A;  3NWT A;  2Z4H A;  4M1U B;  4Q5V A;  1JWM D;  4EGV A;  4H13 C;  1STN A;  4WRD A;  1O7Y A;  3MFY A;  2Z4I A;  2F0N A;  3TME A;  3KLS A;  2I07 B;  3RD4 A;  1XX8 A;  5C3E B;  5CV6 A;  4A3K B;  3MVV A;  2CQA A;  5EKI A;  1DON A;  1KTK A;  1S5F D;  1SXT A;  5C4H A;  1DOL A;  2E76 C;  1HA5 A;  1HQR D;  3T56 B;  2F0F A;  5EPL A;  2L12 A;  5IGD A;  1OXT A;  2NTS A;  2KQ3 A;  3RZD B;  4OGQ C;  1T5X D;  2Q8T A;  1SEB D;  5LL6 X;  3FDT A;  1TWG B;  4A3I B;  4B08 A;  1O7Z A;  5FO9 B;  5JJZ A;  4H44 C;  3PUZ A;  2YU9 B;  5EKK A;  4HED A;  1K8M A;  3MA2 B;  2F0K A;  1RKN A;  3T13 A;  4X3K A;  5C0X G;  2NVQ B;  1V8Q A;  1KAB A;  3GV3 A;  1QNU A;  4UAI A;  5CBE E;  5G3L D;  1CTM A;  2VB2 X;  1JB3 A;  2BDN A;  3CRL C;  5AFW A;  3RZO B;  5KRU A;  3J80 E;  1VCI A;  3S14 B;  1LAB A;  1PRT F;  2JEB I;  5DEH A;  3N6R A;  2VXW A;  1PTO C;  3FMC A;  3A56 A;  3VYU A;  4L63 B;  3KUP A;  4C2M B;  2MP1 A;  1IKM A;  4TSS A;  3T4A C;  4C3H G;  2F03 A;  3R93 A;  3MFG A;  1SNO A;  4LAA A;  2KJX A;  2WAC A;  5F2D A;  4OO1 H;  4BBR B;  4KV6 A;  1EY7 A;  3DXJ C;  2B39 A;  1YNJ D;  5LL6 S;  4E6I A;  2L11 A;  4RGM A;  4K5W A;  3K58 A;  3G6J B;  5C0X I;  2QIL A;  1SYC A;  4B9X A;  3HP3 A;  2EY1 A;  1H9S A;  1KNA A;  1Y1V B;  3V05 A;  1GJX A;  4K6L A;  4BBS B;  3EVQ A;  3UI2 A;  1I4X A;  2L55 A;  4FF4 A;  4C1N K;  4RHS A;  1ONL A;  4XXE A;  3C2P A;  2KED A;  2EJM A;  1ML0 D;  3LWU A;  1H9S B;  3A54 A;  3E0J A;  3VYS A;  2KCC A;  4CKE A;  1EWH A;  1ROD A;  1QOH A;  5FOB B;  1B1Z A;  1Q1E A;  1UAP A;  3QOL A;  2EOT A;  4O42 A;  3K5M A;  3Q23 A;  5A35 A;  1MBY A;  3BYT B;  2IWH A;  1F9Q A;  4FF2 A;  3L7Z C;  3NTH A;  3CQZ B;  1AZQ A;  1GOZ A;  1QWY A;  5M9O A;  5I6W A;  2B2V A;  1SND A;  1FNV A;  2BCO A;  4KJN A;  3C1F A;  1UUP A;  1U4P A;  1WTV A;  4O1N A;  4K8I A;  2ID0 A;  1Q8I A;  3BVZ A;  1EY8 A;  2L4N A;  2X6L A;  3A55 A;  4KK7 A;  3VYT A;  4RCN A;  1PFN A;  3DUZ A;  2AQ3 B;  3DEP A;  1PFM A;  2PW5 A;  2IPK D;  4KY5 A;  3C46 A;  3H91 A;  1PTO H;  4IFD J;  1ZYR C;  2AWO A;  5KYI A;  3S1Q B;  3PUX A;  4X3S A;  4KTA A;  1BF4 A;  1FGB D;  1I4P A;  4IUN A;  2WP8 J;  3IFT A;  4C3H B;  2WV6 D;  3D6C A;  2F0J A;  1O78 A;  3P1H A;  2KEE A;  5C4Z A;  1CA6 A;  1OXS C;  1SNC A;  3SEB A;  1A6X A;  2QF7 A;  3VR6 A;  3J7A F;  4HSP A;  4J1M A;  5EQ0 A;  2DNE A;  4BA2 I;  1BXT A;  2YYZ A;  4OIJ A;  3VR2 A;  2EE1 A;  1EZ6 A;  3MTS A;  1KDB A;  3G7L A;  2WIN B;  5J39 A;  2RVL A;  1U4L A;  4RFB A;  1JOQ A;  3NTI A;  1EOT A;  3HEJ A;  3J7A V;  4FNF A;  1CM9 A;  3NBH A;  3NUC A;  4FP5 D;  2J7Z A;  2A6H C;  2PMZ B;  2PW7 A;  3HOY B;  3M4O B;  2EJF C;  3SE0 A;  1BCP F;  1GUT A;  1V1O A;  2RDG A;  3VR5 A;  1LTS D;  2NN6 I;  4DK0 A;  5D3D A;  5I9P A;  2QEJ C;  2FMM A;  1DZ1 A;  4KY6 A;  3MEH A;  1YNN D;  2E2D C;  2VNU D;  1G8Z D;  5FO8 B;  2EJG C;  1AN8 A;  4FYD A;  3M7G A;  5JPM C;  4Y7N B;  4ZUJ A;  1JWS D;  5IGB A;  4LK1 C;  4ME5 A;  1TY0 A;  1SDF A;  2RQX A;  1D1I A;  4CJ1 B;  5EGT A;  4KKU A;  5C5M A;  1B44 D;  5ELB A;  1XTC D;  3MHB A;  3T51 B;  1I6V C;  2KVM A;  1GUN A;  4RGN A;  5IGC A;  4KJO A;  1KLG D;  5KNB A;  1SE3 A;  3D3R A;  2L9H A;  3Q24 A;  2PCF B;  2AUJ D;  3MXP A;  2HDL A;  3BYY B;  1RTN A;  3OSO A;  2F0V A;  3GTK B;  4N9P A;  3NSW A;  1CHQ D;  1LO5 D;  3PO3 B;  3O13 A;  1EU3 A;  4HSV A;  5EPJ A;  3ND9 A;  1TWC B;  2N55 A;  2F3V A;  4EQN A;  4OL7 A;  4QCL A;  2L1B A;  1PRT D;  2PZT A;  4XYQ A;  1DJR D;  1PXU A;  4A3B B;  4P2C B;  4ZKC B;  2PYK A;  1YNJ C;  2B63 B;  5JVG 3;  1A3U A;  1JOR A;  5I2Y A;  3OMC A;  3QB3 A;  2H4O A;  1G91 A;  2A69 D;  1D5Z C;  1GHK A;  3V2T A;  2K03 A;  1I6H B;  2K33 A;  4TQU S;  2KUM A;  1STY A;  2EYH A;  1TR5 A;  4CBV A;  1H9J A;  4XQN A;  3RUZ A;  5M3M B;  1Q3L A;  2F0P A;  2RDF A;  1ET9 A;  1JWU D;  5FK9 C;  5T1I A;  5E4W C;  4NP5 A;  3PUW A;  1HUM A;  2EYO A;  1KDC A;  2NVT B;  4DK1 A;  1HPC A;  2IX1 A;  3L3O C;  2F0M A;  5E1F A;  3H94 A;  4DN4 M;  4IFD H;  3KLR A;  1EWC A;  5C5L A;  1QNK A;  1EU4 A;  3RMH A;  3D31 A;  3DWP A;  3S17 B;  1ET6 A;  1VMC A;  5C6A A;  4KHV A;  3ITP A;  1KNE A;  5ELF A;  1C4Q A;  1SJH D;  3GP7 A;  2F0O A;  2F4I A;  2R92 B;  3Q6S A;  1X3Q A;  4OIK A;  3R8B A;  2XIW A;  5EBD A;  2F0E A;  2Z8L A;  3J80 L;  3SXH A;  3GTO B;  1RTO A;  3I73 A;  1IYV A;  1TY2 A;  2DNC A;  3U9O A;  3TP5 A;  4RH6 A;  1CI3 M;  4RAU C;  3QIA A;  2A73 B;  5CMD A;  1SFO B;  4K8J A;  1XXG A;  5CV8 A;  1EY9 A;  1TVX A;  4F7X A;  3GQB A;  3QJY A;  1KLU D;  2HDM A;  4IAL A;  2C9O A;  2BA0 A;  2NZ1 D;  1PTO F;  4CJ0 B;  2A5H A;  2AUK A;  4NMZ A;  3A8K E;  1DOM A;  2AWN A;  3A8J E;  4K5X A;  2XSC A;  3TZD A;  1D6E C;  4CJ2 C;  5M5W B;  1Y1W B;  1KDA A;  4FO2 A;  2B2T A;  3DWQ A;  2O2L D;  4K5V A;  4DA2 A;  3J81 E;  1Y8O B;  1EYC A;  4PMB A;  4XQJ A;  4BS9 A;  1G2T A;  5JEA G;  1SYB A;  2OT2 A;  2JA8 B;  2F0D A;  3QO2 A;  2E75 C;  1IL8 A;  4I65 A;  3Q22 A;  1EEI D;  1I50 B;  1LTT D;  1A2U A;  1SYE A;  5FKA C;  3I8Z A;  2K04 A;  1BDO A;  1GUO A;  5I9O A;  2EYJ A;  2NUC A;  2K1B A;  5ELE A;  1CFM A;  1A15 A;  4DFA A;  5BN5 A;  5IGF A;  2BE5 D;  2F0T A;  1S5E D;  2GA4 B;  4DF7 A;  1OXV A;  1WD0 A;  1DOK A;  4AYB B;  4K2K A;  2JEA I;  1HFG A;  2K5W A;  2TMP A;  3DHQ A;  4MHE A;  4PMW A;  4ZLT F;  4A93 B;  5EKL A;  1ZEQ X;  5CR3 A;  1HTP A;  2D2C C;  5IGE A;  4YIJ A;  1R4P B;  3EA6 A;  4IUP A;  1TWF B;  4C1N I;  3BZD B;  1W6J A;  1E2Z A;  1YNN C;  1TKW B;  1K8O A;  4IZ8 A;  4IUU A;  5JOB A;  4QIW B;  2JSO A;  3U9S A;  2SDF A;  2R61 A;  5KIX A;  1Q12 A;  4QB4 A;  3DWA A;  4V19 0;  4FVM A;  3KLS X;  3NE5 B;  1UEA B;  2OEO A;  5IT9 E;  1U9R A;  1ZKO A;  3MWY W;  5M5Y B;  4DXF A;  1MSH A;  4X3U A;  3TBI B;  3HOV B;  2E2I B;  2L0C A;  4I7Z C;  1BUV T;  2WII B;  3NHH A;  3OIQ A;  2FMC A;  3NK9 A;  3TZU A;  5J1Z A;  1HRJ A;  3VYR A;  2B2Y A;  4OO1 G;  1ILP A;  1CQF A;  3BS1 A;  1Y8N B;  4C56 C;  3HKZ B;  1PFB A;  2K7V A;  2ICE C;  2SNS A;  4EQO A;  5CV7 A;  1WTP A;  4ZAI A;  4DNR B;  1BCP B;  2CW0 D;  2Q8I B;  1F9S A;  4BY7 B;  1ENF A;  1H9R A;  4KMU C;  1SNP A;  1HCZ A;  3ERQ A;  3I70 A;  3I4L A;  1S4Z A;  3GTL B;  1X3P A;  2M9V A;  1PZI D;  4R8I A;  4HAE A;  1NCV A;  3AU7 A;  2K6A A;  3HOU B;  5ELC A;  3I3C A;  4QMG A;  1TU2 B;  2F1M A;  4OO1 I;  3X3M A;  1NR4 A;  4R9W A;  3K7A B;  1M8A A;  2KCN A;  3S16 B;  1MGS A;  2FFK B;  3IAY A;  2EZV A;  4DXG A;  3PV0 A;  4WOR A;  1I4R A;  3VA7 A;  2NN6 G;  3S2H B;  3NQI A;  1B53 A;  3R2T A;  2K01 A;  1RHP A;  2B2W A;  2IT1 A;  4M8A A;  3MZ5 A;  4A3M B;  3NP8 A;  1GUS A;  1LT5 D;  5COY A;  4RGT A;  3KK7 A;  3BDO A;  2NTT A;  3ND8 A;  2D5D A;  2WKD A;  3FPP A;  1ENA A;  2QKI C;  3HGB A;  4EVO A;  1EQV A;  1SAP A;  5JEA J;  3OWE B;  1II3 A;  2FHT A;  1VF7 A;  1FYC A;  2E2J B;  3NTK A;  4G7Z C;  3DMU A;  2D62 A;  2BA1 A;  1NAP A;  1JC7 A;  2B2U A;  2EY6 A;  1X32 A;  2K32 A;  5G3L F;  5CV9 A;  5C0X J;  3F2U A;  3E5S A;  2OF1 A;  1LTA D;  2LKV A;  1EZ8 A;  1G6Z A;  1ENC A;  1B50 A;  1WCM B;  4CHT B;  2E74 C;  2JA5 B;  1I4G A;  3I90 A;  2R3Z A;  2LY7 A;  1EIH A;  4KY7 A;  1GUW A;  5DM7 3;  1JQY D;  1LT3 D;  1JOK A;  5D65 A;  1LT6 D;  2HQE A;  4ID6 A;  4XYO A;  1DM0 B;  2NYZ D;  3IKJ A;  1TS3 A;  2LMC B;  3D8G A;  1R9T B;  1SMY D;  3EJI A;  1JIC A;  4DNT B;  5HUR A;  1GUG A;  1GXD C;  5K36 H;  4R8N A;  3CU7 A;  4N9T A;  2G9H D;  3TN2 A;  2XRS D;  3MC0 B;  2HCC A;  3SHL A;  4XT3 B;  1A2T A;  2SEB D;  4HMI A;  2JE6 I;  4LMQ D;  3SDZ A;  4NW2 A;  5M5X B;  4DAP A;  4RHR A;  3MXG A;  1IHZ A;  2CVR A;  1F2Z A;  1Z7T A;  4C3I G;  2ZT9 C;  1XWE A;  2VUM B;  3D4R A;  2BOS A;  3M3Y B;  1VF5 C;  4G7H C;  1EY0 A;  3IFD A;  2VB3 X;  4MIU A;  2ENB A;  4LJZ C;  1IW7 D;  1EYD A;  5CBA E;  1I4H A;  3BG3 A;  1NUC A;  1V1P A;  3S1N B;  2F0W A;  2BE5 C;  1G2S A;  2Z1C A;  1QG7 A;  1ICW A;  2F0Q A;  1TT2 A;  3D6W A;  1U4M A;  1B4O A;  1AW7 A;  2PZW A;  3BVG A;  4BY1 B;  2XWJ B;  1QIL A;  2K28 A;  2DY7 A;  1V1P B;  2X6G A;  1WTW A;  2A68 D;  4XQQ A;  2PO4 A;  1SYF A;  2ZXP A;  1E0B A;  2OXP A;  1LT4 D;  5HGT A;  1RJT A;  4ZQ3 A;  3C3L A;  1WD1 A;  3OMG A;  2B2V C;  5ELD A;  5JAV A;  1OXU A;  1SSO A;  5IOC A;  3VR4 A;  3PO2 B;  2EYF A;  2XVS A;  4B9W A;  1UNS A;  2LFN A;  4H0L C;  1HA6 A;  1B2T A;  1FNU A;  2A74 C;  4A3G B;  4HCE A;  1PTO B;  1PZK D;  1LLR D;  4U67 3;  2WB1 B;  1AEX A;  2TSS A;  2O4X A;  4ZYS A;  1D5M C;  3A7A B;  5A2Q E;  4FF1 A;  5FLX E;  5DAU A;  1EY5 A;  3H6M A;  4K2L A;  3J81 L;  2F3W A;  3D4W A;  2B8G A;  2N88 A;  1DYQ A;  2HUG A;  3HOW B;  4NDX A;  2PPB C;  3SVM A;  3HS0 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...