4FP5D

Heat-labile enterotoxin ilt-iibb5 s74a mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
98
structure length
98
Chain Sequence
GASQFFKDNCNRTTASLVEGVELTKYISDINNNTDGMYVVSSTGGVWRISRAKDYPDNVMTAEMRKIAMAAVLAGMRVNMCASPASSPNVIWAIELEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heat-labile enterotoxin IIB, B chain
publication title Structure-activity correlations of variant forms of the B pentamer of Escherichia coli type II heat-labile enterotoxin LT-IIb with Toll-like receptor 2 binding.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
total genus 24
structure length 98
sequence length 98
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2012-06-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.50 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4fp5D00
1QCBD 4FO2A 1TIID 4FNFA 5G3LD 4FP5D 1QB5D 5G3LF
chains in the Genus database with same CATH superfamily
4X3UA 4BY7G 4KD4A 3V05A 1EOTA 4FP5D 4DUZL 1D5XC 4JI7Q 2E2IH 3T13A 2UUAQ 1EOVA 4A3LH 2ZTCA 4A3JH 3TS2A 1VQNA 5C0XH 3VYUA 4UAIA 2Q8TA 4XTCS 4K2LA 4M1UB 4AH6A 1LTTD 4NXNL 2WAQE 3ICEA 4FF4A 2EYJA 5FJ8G 4XQQA 3CCRA 1WD0A 2GA4B 1NMFA 3TMEA 2MHVA 1ASYA 4NKLA 3T1HQ 2XRSD 1J5EQ 4IUQA 1Y1WB 4V190 5JVH3 3A8IE 2F0HA 3EIVA 4GN3B 1CI3M 4XT1B 4AQYQ 2AHOB 1PH4A 4FXDA 1EY5A 1VQ7A 2N3SA 4MTNA 4DR5L 1EY8A 4PG3A 1GUSA 4ILWA 1SNPA 3H09A 1K8GA 5EPKA 2AWOA 2Z4HA 1ET6A 2A74C 3CCQA 4A75A 3NHHA 3J80i 3G7LA 4FO2A 3LNNA 5EQ0A 3PQIA 5I2YA 1TWAH 4OIKA 2R93B 2NVYH 1F77A 1VQCA 1VQPA 2EXZA 4IUNA 4XDXA 3FP9A 1WTOA 2B8GA 4LFCL 3PSIA 3A7LA 1Y1VB 3KDFA 3MZ5A 5EGTA 1NJIC 2HT1A 4B3RQ 5DAUA 2ES2A 2L15A 4K6DA 1T5XD 4NB3A 5IP7H 2X6GA 2LMCB 2NVTB 1F9RA 5IOCA 3MA2B 1II3A 1PH8A 2NBFA 3K5LA 3I4MB 3ITPA 3KJPA 3MWYW 3H0GG 2CHBD 1I3QB 2N88A 1LT5D 1I94Q 4X65L 4OX9L 4PZ7A 1GM5A 5C4ZA 4JI0L 4LUOA 1V8QA 4JI2Q 1LO5D 3NUCA 2MNAA 1VQDA 3OPOA 5C3EB 3DWQA 4XYOA 1X55A 2VQEL 4OWWB 1WCMG 2KEEA 2QDBA 1B4OA 1QNUA 2KJXA 4B9XA 4LF5L 2PNHA 3J81E 1YITA 1XXGA 4M8AA 2MO1A 2QEJC 2F0WA 5IWAQ 3KUPA 4A3CH 3HOYH 3JAME 2I46A 1KAWA 1AZPA 5CV5A 4JBMA 1MSGA 1ONLA 1BBXC 1TY0A 5IGEA 3NE5B 5CR3A 1RJTA 5M3FH 1VQ4A 3PUYA 1S72A 1N33L 1IW7D 3SK6A 3VR4A 1B8AA 2EPBA 3TP6A 1AW7A 2K05A 2ZTDA 5C44H 1WTQA 1EU3A 4FDBA 3PO3B 3CAMA 4JI5Q 3TEHB 2EDGA 4B3TQ 1STGA 1PH1A 3CC2A 2HUGA 4XQNA 3V96A 1WTXA 1I4HA 3P7JA 5BR8L 3PO2H 1LT3D 4OWXB 1C8CA 1IL8A 1JJGA 1AP0A 5D65A 3I55A 2JA5G 3SE0A 1IYVA 2OQ0A 3P20A 1G2TA 1YBYA 3MVVA 5FLMH 1PYBA 2IX0A 4H02A 4GLAC 4DK3C 2Q2UA 3J80E 4X6AH 4BA1I 1TS2A 2AMCB 3TDQA 1YJWA 4J1MA 4BBSB 1ZYRC 1XPUA 2BA1A 4DR3L 3ER0A 1D8LA 1QJOA 1X3EA 4JG2A 1KDBA 3R2IA 4DV6L 3M7NA 3NQTA 4IUVA 3BJUA 1FVIA 1A2TA 3A5UA 1MGSA 1MJEA 1SMYD 4JC0A 4KY5A 2L9HA 1JICA 4J6HA 3S14B 1VQHA 2CWAA 1EIGA 1S5BD 1CQVA 2F0OA 2KCMA 1STYA 4S3SA 4OELB 2Z9HA 4QJFA 3S24A 2VQFQ 5FOBB 1CQFA 3S15B 1K0SA 5EAYA 2JN4A 1OXUA 2IWHA 4F7XA 1B9NA 4QGUA 4JOIC 2ENBA 2F0VA 3HFZB 4OWTB 5KNBA 1ICWA 3R93A 3DEOA 1TY2A 2F3VA 3J7ZC 2YU9B 2L1BA 2CH4A 3NTIA 2IT1A 3NP8A 1I6HB 1SYCA 1BOSA 2F0QA 3K7AB 3STBC 3G71A 3AB9A 1I4QA 3OHXC 2N49A 4FF1A 3HOZB 3IRBA 4X3TA 4FYDA 1N32Q 4JI7L 2R7ZH 1TWGH 4IUUA 2UUAL 2EOTA 3HGBA 4IJHA 4L63B 2LKVA 3OMGA 5FLXE 5KEEA 4GZYC 4IQZA 1HZBA 4BY7B 4GOPA 1NR4A 2XSCA 3S16H 1AN8A 1A62A 2WKCA 3T1HL 3ZYYX 1J5EL 2HQEA 4K5XA 3QR8A 1BKBA 4RGMA 1TQOA 3FVQA 1KQSA 4DAMA 1JOKA 4AQYL 3A54A 3K57A 1CA6A 2ZXRA 4J15A 1GHKA 3DEPA 1Y8NB 2RCFA 2Q8RE 4RKLA 3WOFA 1PRTB 2JA8G 1XMQQ 1V1OA 4F87A 3UE1A 3L7ZC 1K3BC 1WJJA 2EJFC 4C3HH 3URYA 1SEBD 3T56B 4BXXH 2K52A 1EQRA 2KHIA 5ELNA 4HR7B 2OCEA 5BN5A 2BE5C 3KF8B 3TBIB 1RCVD 4P2CB 2JYOA 3TREA 3C3LA 4KHPQ 3R3OA 1PH2A 4A3IG 1X3PA 4B3RL 5C5LA 1EY4A 1XMOQ 5C4XH 5I4DA 4A3DG 4PMCA 3MXNA 3CF5A 1I5FA 1DYQA 3VYTA 4KV6A 1IYJB 1YJNA 2J0TD 2PZWA 3BS1A 1I94L 4JI4Q 4MTKA 4A3BG 4JI2L 1YNJC 5I9OA 1QZGA 3HOUG 3VR6A 1KHIA 5C0XI 2PMZB 1ILPA 3KYHC 3GTKB 1TWCH 2EYOA 2WINB 5KYIA 1HR0Q 2PW7A 2NVXH 1SYBA 4RKBA 1Y14B 1C9OA 2BCOA 1QNKA 3CQZH 1VQBA 3H0GB 1F9SA 5IWAL 3K5NA 3CCUA 1YVCA 1F9QA 1LV9A 2MPMA 5DNFA 2F0UA 3GTOH 5CORA 2K6AA 2E2HB 1STAA 3H3VC 2RDFA 1QG7A 1SFOB 4RHRA 3GV6A 2VS1A 2Z4IA 4QIWB 1HXYD 2A1AA 4EQPA 1V1PB 2FXQA 1LT6D 2K33A 1J9OA 2VB2X 3BDOA 3I4NG 1HRJA 1QWYA 1Z7TA 4IURA 4LMQD 4PV1C 4GLXA 2K5DA 4JI5L 1PRTC 3NPPA 2AKWB 4B3TL 3E9IA 1PH9A 2X6LA 4IOAA 1SXTA 2K5NA 2NN6H 4B9WA 1OXXK 2PYKA 5IGDA 4EGVA 4HJAA 3GTGB 1HTLD 5JPMC 2DJFC 5M5XB 2OXPA 1KRSA 3HOXG 1Y1WG 2ICIA 5ISRA 1NUCA 2NVQH 2FHTA 3EBEA 3NBHA 2QKIC 3OWFA 1TR5A 3MEHA 5CV7A 2K1BA 4KN7C 1UAPA 3NSWA 4GNXB 1HNWQ 1B70B 2F0DA 5M9OA 1HZ9A 3F2BA 1FNVA 1L1OB 1JB3A 4PZ8A 2EY6A 2R93G 2Q8IB 2C35B 3ULPA 2VUMB 4IFDJ 3RR5A 1KLUD 3GTPB 3N52A 1MHWC 4I65A 1B53A 1BQQT 2M9VA 2VQFL 1B1ZA 3QJYA 1UE6A 4L5TA 5IYBG 1IXRA 1YNXA 5JEAG 1AZQA 5G3LF 1BXTA 1HJPA 5M5YH 4YHHQ 3IAYA 4HJ5A 3KDFB 3NTHA 5HURA 3KFUA 2WB1G 1EQTA 4JBKA 1HZCA 4HSVA 1W6JA 1BUVT 1Q90A 3I3CA 1N32L 4L5QA 3FDTA 3FRPB 2N55A 1U5KA 4FXGC 2NVTH 4YCWA 4X66Q 2K5QA 3KK7A 4N8FA 3M4OH 1PDQA 4L8JA 1O80A 3Q8DA 3I4MH 1I3QH 5D14A 2IPKD 5KIXA 3PIP3 3G4SA 4RMFA 3B6YA 2DGYA 3CW2C 3CXCA 5CMDA 3BYTB 3TSSA 1FD7D 3K5MA 5FO7B 3DMUA 2IHFA 3F2CA 5CGKA 3OSOA 1IL2A 4DV1Q 4C3IH 3CU7A 3JC66 2UXDQ 2PQEA 3A8JE 4K5WA 4JI3Q 1D1KA 4LF9Q 1R9TH 2G9HD 2H4OA 2AQ3B 5IP9G 5JAVA 2MJ8A 3Q6SA 5LL6S 1HFGA 4JCVE 3RZDB 1XMQL 3BZCA 2K01A 2L0CA 3W2DA 1AH9A 1UUPA 2VL6A 4A3EB 3KLSA 1SYGA 3AU7A 3E3XA 2B2UA 5E1FA 3CPFA 4FXKC 1L1OC 1CM9A 1CSQA 4KHPL 1T9HA 1F9PA 1CZWA 3S17B 2JA8B 3N6RA 1XMOL 2QW7A 4ABNA 1PXUA 1IBKQ 2F0MA 4R4OA 2DNEA 5EKIA 1S5FD 1ENFA 1LTBD 1KTKA 5M3MH 2Y0SE 2JE6I 2ZM6Q 4BBSG 2E74C 2L5TA 3BDLA 4A3GG 2R92G 1Q81C 2K5VA 1HR0W 4KJNA 3VA7A 2F4VQ 3CC4A 4JI4L 1X56A 1RODA 2B2YA 2NZHA 3VYSA 5D3IB 4FNFA 4A3IB 2BH2A 3CCSA 1BCPB 2GVBA 1PMRA 3ERSX 1X3FA 2RKSA 3HOWB 2CQOA 5LMNQ 2NUCA 1DCZA 2VXWA 5ELBA 1A8VA 5GQOA 1HR0L 4R4IA 5BN4A 1YNNC 3UE0A 1UEBA 3S14H 1FGBD 3BVMA 3L3OC 2XRQD 1HUNA 4A3BB 4OO1H 3QOJA 3HOUB 1O7YA 1S5ED 3HOZG 3D4RA 4LFAQ 3D4DA 1AE3A 2K03A 3A0JA 5F2DA 1I4GA 4TKOB 4L5RC 2RDGA 4KKTA 1MSHA 1DM0B 4JV5Q 5CV9A 3K7AH 4DV0Q 1VQJA 4ZUIA 2GN5A 1NNXA 4K8JA 5J22A 2K28A 1Y8OB 3GDEA 4LJZC 2VB3X 4C3JH 4C2MH 3J81i 1IBMQ 4ZRZA 3AEVA 3OOCA 2QA4A 4R4QA 3JAMi 1PTOF 4B08A 2XIWA 3S1MH 1U9RA 1VQIA 1EYAA 4O0AA 4CKBA 1W6KA 2CQAA 4P74A 5M5WH 1NY4A 1W2BA 4WJWA 3NENA 3NXWA 3I4NB 1PH6A 4BY7H 2F52A 3I4LA 3VDYA 1YZ6A 4HTHA 4GS3A 3T16A 4TQUS 1A3TA 4KKUA 2JA6H 3NELA 3ND8A 1HNWL 1N36Q 2HD3A 4LF8Q 5C0XG 2Z0SA 2PCFB 1TWFB 2PNRC 3HOVB 3S1NB 3HOXB 1D1IA 4ZQ3A 5LL6X 2IW3A 5FJ8H 1NBWA 4LF7Q 3M7GA 5KRUA 1QVGA 3M9BA 1CHQD 4Q5VA 4HN7A 4DAYA 4AYBE 4C1NK 1BCPC 1FL0A 1K8MA 3I72A 1XNRQ 1HNXQ 3FPPA 4NMZA 3S1QB 5JVG3 4CGYB 2HHHQ 4G4KA 4YHHL 2CW0D 2XWBB 3FHWA 2NZOA 1EFWA 2NYZD 5IYCG 5GAHC 5CV6A 4R4CA 3RLOA 1SE3A 2K75A 3I8ZA 2GVAA 1G8ZD 4H44C 1I6VC 2OT2A 2WACA 4OONA 1ESFA 3MXNB 2HDLA 4X66L 1M8AA 3NEMA 1TU2B 2F0GA 1EZ8A 5D3DA 1EIFA 1SNQA 2O4XA 2E76C 3BVGA 3C1EA 1P8LA 1TS3A 4CJ0B 2F4IA 1E0BA 2FMCA 3RN2A 4FF2A 2WB1B 4LW1A 5C3XA 1U4LA 5T1GA 1E24A 2EY1A 2NN6I 3HKZE 3ZJYC 3Q0AA 1Z47A 1KNAA 1EZ6A 3BYYB 4GN5A 2JA9A 4U68A 1VQEA 1E2ZA 1B7YB 5I2XA 2UUCQ 2KA7A 3P1HA 4Y52H 1EYDA 4DV1L 1TVXA 1JB7A 1HZAA 2UXDL 4A3KG 1LACA 3GTJB 4UP8A 1RF2D 2YV5A 3H0GH 4JI3L 4LF9L 2BA0A 1K83B 1E7ZA 2E2HH 4DK0A 4DR7Q 3C2PA 4JBJA 5C4HA 1STBA 1N8RC 1QB5D 5LMUQ 4ZLTF 2JJQA 4XYQA 1WCMH 1H9KA 3DXJC 1EL0A 3L9AX 1SE4A 2IJ0A 5CYUA 2A68C 3VA5A 2F0PA 2F3WA 4A3CG 1K3RA 4POGA 2E75C 2R6GA 2HDMA 4BY1B 1VF5C 4RWSC 4LWCA 1IBKL 1IYUA 1SYFA 2PMZE 2ID0A 2SOBA 2EYLA 3QIAA 2PQAA 3GTGH 2KUMA 4KLKA 1BNZA 5LMNW 5C4JB 2ZM6L 4IOCA 2JA7H 1STNA 1TKWB 2F4VL 2HQLA 3KLSX 1B44D 1FR3A 3RZOB 3FPUB 1LTGD 3QB3A 1HQRD 2VUMG 1CKNA 1IBLQ 1LUZA 1PFBA 5LMNL 4J8QA 1CFMA 3I70A 3PO2G 3VR2A 1SDFA 3T4AC 3W1GA 3K58A 2CFMA 4A3GB 2R92B 2JA5H 1ESRA 5FLMG 4MZ9A 4ODGA 4DXGA 4A93H 3GTPH 1I4PA 1SMYC 2A6HC 3CP0A 4H0LC 2EYHA 3G6EA 3CHBD 1H9SB 3I4OA 3W5OA 1QOHA 5IT9L 5NUCA 2MGSA 1Q12A 1Q82C 4LFAL 2E2JH 2IY5B 1VQAA 2JXMB 1GKHA 3P75A 2BH8A 5JOBA 3PF5A 4JV5L 4DV0L 1LLRD 3A5ZB 4KY6A 3U58A 4JI6Q 5IYDH 2P5ZX 4ME3A 5I9PA 1ZYRD 1BBUA 5J39A 4P71A 3NK9A 4DAVA 1Q1EA 1Y8PB 2ZT9C 1JE4A 3TQYA 5IT9c 1EYGA 1IBML 5JJLA 4JBWA 3HEJA 1G6PA 3K81C 2Q2HA 5ELEA 2N78A 2DNCA 3T1YQ 5A35A 2B2VC 5IGCA 4C56C 2NTTA 4X62Q 1YI2A 1JOQA 5CV8A 4DR1Q 4DV5Q 3WDNA 3DLLA 4IFDH 1JCKB 4R4TA 3CCMA 2AUJD 2AQ2B 2KHSA 1PTOH 3NBIA 3RLNA 2R7ZG 3GTMH 1CSPA 1RD9D 3OWEB 4IUPA 3HG9A 3MEFA 2PZUA 3HRZC 1B3AA 2DUDA 1N36L 3DUZA 3FKIB 4CDFC 1CA5A 4G57A 1OO9B 4LF8L 3KF6B 1S5CD 2DY8A 1LM0A 2F0IA 4DPGA 2A73B 5JJIA 2F0SA 4A3EG 1G2SA 1J8IA 5IY0A 2JEBI 4K2KA 1I50H 3EN2A 4R1JA 2K5HA 3U9OA 4LF7L 1VQ6A 3RZDH 2KECA 1HPCA 4O1NA 3SGIA 3PMFA 4UP9A 3S2HH 3D0FA 2K14A 1XNRL 3J80c 4OL7A 1HNXL 3KOJA 1WTHA 4KI0A 5IGBA 1ENAA 2HHHL 3S1RH 2MFIA 3I90A 3CCEA 5C5MA 2D9UA 1JOOA 2A69D 1CZGA 3BZKA 3GTQH 1KABA 1QCBD 4KJOA 2F0TA 2JQOA 1XPRA 2JA8H 2AUKA 3OIPA 3D31A 5ELDA 1JWSD 3UDIA 1X65A 4HJ7A 5K36G 4QY7A 5DM63 1SE8A 2ZXOA 2A5HA 4XIGS 2ATWA 3AMUA 4BWGB 3SHLA 4PMBA 3H94A 3HOWG 1JC7A 1KLGD 1EQQA 2I5MX 5COYA 4C1NI 4DV2Q 4R8IA 1TS5A 3TZUA 1WD1A 4QUCA 4A3IH 1EY7A 2J7ZA 4HJ9A 5C4XG 1Q1BA 3TS0A 1XTCD 3IFTA 2PPBC 1KNEA 1TWAB 2SDFA 4HEDA 1GVPA 2NVYB 4A3DH 2UUCL 4HJ8A 3RNUA 3UDXA 3CD6A 4RCOA 4APVA 2AWNA 5AFWA 4DKAC 1VDZA 2L4NA 4A3BH 3CRKC 1X9NA 1XPOA 2C5CA 2NB0A 1DXMA 5IIFA 2RBMA 4IO9A 1K28A 4HMIA 4DR7L 1VQGA 1EU4A 4CDCC 5C6AA 4E6IA 2XGTA 3DHQA 3DM1A 1SJHD 5LMUL 4LF4Q 3FMCA 4Z9CB 3EROA 3A7AB 4A3KB 2ASBA 2KOLA 1YNJD 3CMEA 1VQ5A 2J4XA 2UUBQ 1LTSD 2RHSB 4RG1A 2NZ1D 5KGUA 2JK8A 1NR2A 1H9JA 2DY7A 1WTWA 3U4ZA 5EJWA 1Q46A 3EA6A 4CJ2C 2L55A 4JOIA 1E1TA 1IHZA 2RCNA 5ELOA 4JPBW 2Q2TA 2H5XA 2CKZB 2ZXPA 4DV3Q 1CT1D 3TP5A 1HFNA 4RAUC 3D4WA 5GROA 2RVLA 3X3NA 4XQJA 3HOVG 3K59A 4A3FG 1QE6A 3SK5A 4DNRB 2O2LD 1IBLL 1S4ZA 4PQXA 1LTID 3PIOA 4HCEA 1H9RA 3J7AF 1GHJA 3ND9A 4IZ8A 4OEMB 1M90C 5FK9C 4CJ1B 4EQNA 2B39A 3S1NH 3CPWA 4CDDC 3HOXH 1Y1WH 1VQKA 1PRTF 4L5SA 1PRTD 1PA6A 4DK6C 1D6EC 3KLRA 1FNWA 1DJRD 2KENA 3HS0C 1PV4A 2UU9Q 2ZJRA 1B3QA 1QZHA 1JORA 2KQ3A 3KJOA 3PO2B 2CH4W 1HCZA 1JT8A 5HGTA 2R93H 5E4WC 4JI6L 5J3BA 2D2CC 3M4YA 1LT4D 2A6EC 5EBDA 3U50C 1DONA 3CCVA 5G3LD 1KD1C 3UDGA 1T5EA 1HNZQ 2OTJA 4JW0A 3H91A 2SNMA 1Y1VH 2PW5A 5IYBH 3T1YL 4HSPA 2BOSA 5JEAH 1K8OA 3SK4A 2EYMA 1C4QA 4X62L 1J6QA 4HMJA 1UE5A 4DR1L 4PMWA 1VQ8A 4DV5L 2B2TC 1IKLA 1ML0D 3EFXD 1K9MC 2I5LX 1NTGA 3DWAA 4DR6Q 2KHJA 2QGQA 3GD7A 5I6WA 2B63G 1GUGA 1LABA 3GTLB 3GTJH 5A2QE 3QG1A 5C3EH 2IX1A 3CMAA 1K83H 1KDCA 4UPAA 4IN3A 4B3SQ 3F2DA 1SYEA 2R7ZB 1TWGB 1YEZA 2SEBD 4YWMA 1SR3A 1XYIA 1K0RA 2OWOA 4C3IG 3F2UA 3UDFA 4BY1G 2JEAI 2Y0SG 1AE2A 4JYAQ 2UXBQ 4L6TB 2JP1A 1YJ9A 1N9WA 2EYFA 4YY3Q 5IP9H 2RQXA 4FVMA 3K80C 3S16B 1SROA 1KXLA 2Z6KA 1HA5A 1Z9FA 2K7VA 2D5DA 2PQAB 4KMUC 2EJMA 1GUOA 4CHTB 1BF4A 5IGFA 2XTIA 1QVCA 3PO3H 1RKNA 5A2QL 1U0LA 4UHVA 4DV2L 1HH2P 3RZOH 4CKCA 4C3HB 4U673 4H7BA 3H6MA 1PZJD 4DGZA 4KK7A 4IPHA 3A55A 4JVZA 5M3MG 5T1IA 1M1KC 1F2LA 1PVOA 3WOEA 4IFDI 3R8BA 4BBSH 1DD2A 3KF8A 3Q24A 2I5HA 2R92H 4A3GH 2PI2E 3WWVA 1FNUA 1Q7YC 4K6LA 1E2WA 4R8NA 5IGGA 2MP1A 5C4XB 1KAAA 4UY8C 1I4XA 2TSSA 5CBAE 2EVBA 1F2YA 2YTXA 2CWPA 2VY3A 3BU2A 1EWHA 1V43A 1EIYB 4LF4L 1V9PA 4I7ZC 1OTCA 4A3MG 3S15H 2UUBL 2KEDA 4BBRG 2A8VA 3BDCA 1EY6A 1NMGA 3T51B 4ZCKA 1WTRA 1HUMA 3C1FA 4GLVB 4LF6Q 5KNDA 2B2WA 3S2DB 3OIQA 3E0JA 2R7DA 1GUNA 1M4VA 2WAQG 2YU9H 2ZJQA 1I6HH 1HHVA 2HIXA 1B50A 1YNND 3HOZH 2Z8LA 1TWCB 1KL9A 1R4QB 3RUZA 2NVXB 4RHSA 1AEXA 2RDHA 3CKIB 4DV3L 1XWEA 4Y7NB 4EQOA 2WIIB 3FKIG 1JE5A 3OMCA 1SLJA 2IL8A 1EQVA 1PTOD 4C3JG 3S9WA 4GKKQ 4DR2Q 3GTOB 2CVRA 4GOPB 4EQ5A 1SYDA 3C46A 3H3VH 1TWHB 4YWKA 5JJKA 4YCVA 1RTNA 2BDOA 2SNSA 3TZDA 3D3RA 2E5LQ 4A3LG 4A3JG 4N9TA 2H1EA 2OTLA 5HY6A 2M2LA 1VQ9A 3I73A 3I91A 1R4PB 1RHPA 1PH5A 5JEAJ 1A3UA 2EZVA 4A3FB 1QILA 2JA6G 1MI2A 4KHVA 2UU9L 5AJ3Q 1VMPA 1PLFA 3K8AA 1FYCA 1FJGQ 2G5DA 4WORA 2EXDA 2EQSA 4XT3B 4IALA 3M3YB 2NVQB 2CW0C 4TVAB 1GJXA 1DZ1A 3EQLC 1JQYD 3K0YA 3HKZG 1YHAA 1ZXTA 3FEWX 3PF4A 3AFQA 2WP8J 1HNZL 3PV0A 1MIUA 4GNXA 4G7OC 1E22A 5FO8B 3DM3A 1OXTA 1L1OA 2R3ZA 1UWVA 2ZTEA 5IYCH 4UDUC 1BCPF 2K04A 2KCTA 1BCPD 1OXSC 3MAQA 1EFID 1SJED 2BDNA 1KRTA 3OW2A 3KBGA 1L2FA 2K5WA 1O7ZA 1Z6HA 1UE7A 3PUWA 3CCLA 4DR4Q 4KD3A 5J1ZA 1MD2D 4DR6L 2EY2A 3F1ZA 2L12A 5IP7G 4DXFA 4JI8Q 5M5YB 1X32A 3NTKA 1PH3A 2LS01 2QEXA 3GTKH 3MHBA 4B3SL 2EIFA 2RHQB 3M85A 3G48A 2R7FA 4R9WA 2Z1CA 5KNCA 1NSNS 3M4OB 4GOPC 4GN4B 3M4PA 3Q22A 3EVQA 4JYAL 2B63B 1BVSA 4A3KH 5E7NA 2UXBL 4NDXA 1LTLA 5ELFA 1GUWA 1L0YB 1O78A 4YY3L 5EBCA 1SFOH 4RGNA 1LYLA 1EWCA 1QUQA 1UE1A 2M00A 1PYWD 3K0XA 4LAAA 2UXCQ 3OYYA 3W1BA 4K5VA 3PUXA 2OEOA 3I56A 4K8IA 3ULJA 1EWIA 3HOYG 2YTVA 4K14A 1IW7C 4C3IB 1WVLA 2Y0SB 2QCPX 4IPGA 4UP7A 5JPNC 1D5MC 3TP7A 3VR3A 4ZK9B 3KBXA 1R9TB 1YHBA 2VNUD 3QO2A 5M3FG 2D0OA 3SR1A 5IT9E 3ONAB 1PFSA 1X54A 5M5XH 3NWSA 1I4RA 4ZYSA 2FFKB 4QF4A 3MXUA 4AIMA 1BO0A 1Q86C 3NBHB 5C44G 4BS9A 2N8NA 2EE1A 1NE3A 3ULLA 2A68D 3AFPA 3E9HA 1E2VA 1VF7A 3Q23A 1X3QA 2JA7G 1X6OA 2O5IC 4RFBA 3QWNA 2F0LA 2OQKA 4K0KQ 1EY9A 4QIWE 4I7AA 5GAGC 2WKDA 1P16A 1D7QA 4O42A 2QDLA 2VUMH 3HZXA 4HCSA 1DGSA 1WFQA 3A56A 4CKEA 4F88A 1O7IA 1H95A 3J81L 2K4KA 5M3MB 5ELCA 5DM73 2YTYA 4LFBQ 2FINB 1B2TA 3JAML 2KVMA 4RH6A 1K73C 4A93G 4B3MQ 4LF6L 2EYPA 5CV4A 1CK1A 1A3VA 1B9MA 2V4DA 1A6XA 3J81c 1SNDA 3T53B 3F8TA 3MC0B 1JWUD 2LXJA 3SK8A 3CRLC 3JAMc 4P72A 2A6HD 5IYDG 2G9DA 4A3MB 4BBRB 1X3GA 1N34Q 5C0XJ 1WTPA 4GKKL 4DR2L 1PYSB 3V2TA 1VQFA 2WAQB 1UEAB 3I7FA 4PNYA 4TSSA 1DOMA 1RL2A 3D8GA 2V1CC 4IUTA 3GV3A 1HTPA 3TRZA 1ICFB 4EVOA 3GTLH 1RTOA 4QQBX 2VW9A 2E5LL 3EJIA 3SDZA 3MFGA 1EY0A 4IFDG 4LNQA 4DV7Q 4A76A 3J80L 3STBD 2XN9C 4C3JB 4C2MB 4AYBB 3NQIA 3BG3A 1MKHA 4X64Q 1VQLA 2HCIA 1CUKA 1ZKOA 5AJ3L 2XWJB 3S1MB 1FJGL 4IJLA 1UNSA 2F0EA 5TSSA 2L11A 5M5WB 4A3EH 2E2IB 1S40A 1CHPD 4WRDA 4Q0FA 4A3JB 4LK1C 5LHY1 5H1SE 1MBYA 2B29A 2A69C 2K50A 2Q2IA 4DF7A 1YHQA 1JR0D 1VQOA 1XX8A 2JA6B 1Q3LA 4X3KA 4OO1I 1TIID 2WV6D 1XNQQ 2FMMA 3S17H 3CCJA 4C3HG 1Q8KA 4DFAA 1GO3E 2NWGA 5GAEC 4BXXG 4QMGA 3OTOQ 1G6ZA 4N9PA 3RMHA 4CBVA 2F0JA 4GKJQ 4RA8A 1F2ZA 4NW2A 3LX0A 3HKZB 3MTSA 4DR4L 4DA2A 1A0IA 5FLXL 1D5ZC 3PIPA 5EKLA 1H9MA 5K36H 1DOLA 4JI8L 2QF7A 1YIJA 1EEFD 1L0XB 2LFNA 5E4XA 4JI1Q 3E0EA 1VS0A 1U4RA 2BE5D 2I0QA 3HOWH 2HCCA 4DK1A 2MUYA 2ICEC 5E3FA 1NAPA 2PO4A 1L0WA 2OF1A 2XVSA 5HGQA 2KCNA 5FO9B 5FLXc 3H3VI 1TXYA 1G291 4RGTA 3I2ZA 3E6ZX 4H13C 3HOUH 3SEBA 3ERQA 3KLWA 3MFYA 1VMCA 1RIPA 1SNCA 3PUVA 4WFN3 5IODA 2UXCL 4DV4Q 3S2DH 2CCZA 2Z6BA 1E3PA 3O13A 1D2BA 3R2TA 5GADC 1LTAD 4LUVA 1U4PA 2DN8A 1JJ2A 3K7UC 4DUYQ 5EPLA 4IPDA 4YWLA 4DN4M 4Y7NH 3NWTA 4N8X1 1Q8IA 2KCCA 1JMCA 3UI2A 1PH7A 3PUZA 2Z6KC 2FJ2A 5DEHA 2AQ1B 2B2UC 1S3OA 5JJZA 3I4NH 3GO5A 1A2UA 1GXDC 3HOYB 1CKOA 2B2VA 3PCOB 1TWHH 3U9SA 3AQQA 1WCMB 1EUJA 1VCIA 4G7HC 4LUZA 4A4IA 2NN6G 1ZEQX 4ZKCB 4K0KL 1IKMA 4ZUJA 5M3FB 2PI2A 4HAEA 4NXMQ 1TWFH 5FKAC 3HOVH 3SXHA 4A3FH 3IL8A 4KN4C 4YIJA 1QVFA 5C44B 5BN3A 2B3GA 2B2YC 4DAYB 4DUZQ 2F03A 4XXEA 1ILQA 4RGOS 4TRDA 4FF3A 4LFBL 3HP3A 2JA7B 3M3YH 3K6OA 4WJ4A 2LXKA 3AYHB 1GOZA 1WI5A 4B3ML 1SNOA 3S1QH 1AFPA 4DNTB 1JJCB 4NXNQ 3H15A 3L2PA 2NTSA 1EEID 2O5JC 1A63A 4CDEC 4MN3A 1MJCA 1C0AA 2LSSA 3LWEA 1ET9A 3J7AV 2F0FA 4OXPA 4HIOA 4ZKBB 2JA5B 4MNOA 1RDPD 4A93B 1N34L 1NCVA 4YCUA 2B2WC 3A8KE 4DR5Q 4F8MA 1GUTA 1H9SA 1Y1VG 3J7YW 2E2JB 4EX5A 1STHA 3OW7A 2A6ED 1EIHA 1ENCA 2DJGC 4DV7L 3J7A5 4MHEA 3I4MG 2F0KA 1WYDA 4PZ6A 4LFCQ 3G6JB 4KHZA 3SVMA 2R61A 4OGQC 4X64L 1O7LA 4ME5A 2F3IA 2RSOA 4NP5A 5L37A 4DNIA 4ID6A 4G7ZC 4POFA 2B63H 3GQBA 3MXPA 5EPJA 1BR9A 5C3EG 3TN2A 1QUQB 3M4QA 3TP8A 2RF4A 3X3MA 2QILA 1C48A 1PTOB 5DLQE 1FGUA 3IKJA 3GTMB 2EJGC 1F2MA 2WB1E 1KIXA 4X65Q 4OX9Q 1XNQL 1EYCA 4OHJA 4JI0Q 4JK1C 3GP7A 3VYRA 1XJVA 3BVZA 2I07B 4BY1H 1SN8A 3KF6A 5IE8A 3D6CA 3OTOL 1TT2A 1IZ6A 5I6YA 2MO0A 4DU9A 4QB4A 2VQEQ 1I50B 1SNMA 4GKJL 4X3SA 1ASZA 1G51A 3RD4A 4QCLA 5C4JH 4QL5A 2RA4A 2RSNA 3D6WA 1KC8C 4LF5Q 3LWUA 4BA2I 3S2HB 2F1MA 5C3WA 1Y69U 2VZAA 3RLFA 2HIVA 3PO3G 4GNXC 4ZAIA 3W3AA 1S5DD 3S1RB 4P73A 1CKNB 2EY5A 2E8GA 2D0PA 3IFDA 4P75A 4JI1L 4HIKA 4HIMA 1SMXA 4ULLA 3CC7A 3GTQB 2YYZA 1PHJA 3A74A 1N33Q 1XTDA 2LY7A 2IHEA 2F0NA 3J81j 5EKKA 4OIJA 2K32A 3L0OA 1U4MA 1CTMA 1SE2A 2ALYB 3DWPA 3RN5A 4DAPA 3BZDB 1PFNA 1PFMA 1E1OA 4KKSA 1JWMD 2TMPA 4WJ3M 2PZTA 1LTRD 5K5PA 1SBBB 1BDOA 3MXGA 5CBEE 2X69A 1CKMA 2IX3A 4DV4L 5BR8Q 1SSOA 1WTVA 2A19A 1V1QA 3PIO3 1W3SA 4A3DB 2XNAC 1HQMC 3U4VA 1DOKA 4DUYL 4OO1G 2MQHA 2E2DC 2KBNA 4QUFA 4A3MH 2JSOA 4DR3Q 1KDAA 4ALPA 1VQMA 4BBRH 4V0BA 4DV6Q 2WFWA 4MIUA 4O2DA 1WOCA 4RCNA 1PZKD 3PGZA 4NPSA 3CQZB 5KYLA 1PTOC 1HA6A 3E5SA 1OXVA 1GD7A 3VR5A 1K8AC 1TS4A 3LGJA 4AYBG 1BBWA 4KY7A 4HIDA 4KTAA 2D62A 2B2TA 1SRUA 1G91A 3FKIH 2ZJPA 2C9OA 4NXML 1SAPA 1STEA 3QOLA 4IPCA 1PZID 2B8FA 1A15A 3HKSA 3K5OA 1V1PA 5CC4A 1C7YA
chains in the Genus database with same CATH topology
4X3UA 4KD4A 3V05A 1EOTA 4FP5D 1D5XC 3T13A 5C0XH 3VYUA 4UAIA 2Q8TA 4XTCS 4K2LA 4M1UB 1LTTD 4FF4A 2EYJA 4XQQA 1WD0A 2GA4B 3TMEA 2MHVA 4NKLA 2XRSD 4IUQA 1Y1WB 4V190 5JVH3 3A8IE 2F0HA 4FXDA 1CI3M 4XT1B 1EY5A 1EY8A 1GUSA 4ILWA 1SNPA 3H09A 5EPKA 2AWOA 2Z4HA 1ET6A 2A74C 3NHHA 3G7LA 4FO2A 3LNNA 5EQ0A 5I2YA 4OIKA 2R93B 1F77A 2EXZA 4IUNA 4XDXA 1WTOA 2B8GA 3A7LA 1Y1VB 3MZ5A 5EGTA 5DAUA 4K6DA 1T5XD 2X6GA 2LMCB 2NVTB 1F9RA 5IOCA 3MA2B 1II3A 2NBFA 3K5LA 3I4MB 3ITPA 3MWYW 2CHBD 1I3QB 2N88A 1LT5D 5C4ZA 1V8QA 1LO5D 3NUCA 3OPOA 5C3EB 3DWQA 4XYOA 2KEEA 2QDBA 1B4OA 1QNUA 2KJXA 4B9XA 3J81E 1XXGA 4M8AA 2QEJC 2F0WA 3KUPA 3JAME 2I46A 1AZPA 5CV5A 1MSGA 1ONLA 1BBXC 1TY0A 5IGEA 3NE5B 5CR3A 1RJTA 3PUYA 1IW7D 3SK6A 3VR4A 2EPBA 3TP6A 1AW7A 2K05A 1WTQA 1EU3A 3PO3B 2EDGA 1STGA 2HUGA 4XQNA 3V96A 1WTXA 1I4HA 3P7JA 1LT3D 1C8CA 1IL8A 1AP0A 5D65A 3SE0A 1IYVA 3P20A 1G2TA 3MVVA 2IX0A 3J80E 4BA1I 1TS2A 3TDQA 4BBSB 4J1MA 1ZYRC 2BA1A 1QJOA 1KDBA 3R2IA 3M7NA 3NQTA 4IUVA 1A2TA 1MGSA 1SMYD 4KY5A 2L9HA 1JICA 4J6HA 3S14B 1EIGA 1S5BD 1CQVA 2F0OA 1STYA 4S3SA 5FOBB 1CQFA 3S15B 1OXUA 2IWHA 4F7XA 1B9NA 2ENBA 2F0VA 5KNBA 1ICWA 3R93A 3DEOA 1TY2A 2F3VA 2YU9B 2L1BA 3NP8A 3NTIA 2IT1A 1I6HB 1SYCA 1BOSA 2F0QA 3K7AB 3AB9A 1I4QA 3OHXC 4FF1A 3HOZB 4FYDA 4X3TA 4IUUA 2EOTA 3HGBA 4L63B 2LKVA 3OMGA 5FLXE 5KEEA 4GZYC 4IQZA 4BY7B 1NR4A 2XSCA 1AN8A 2WKCA 3ZYYX 2HQEA 4K5XA 4RGMA 1TQOA 3FVQA 1JOKA 3A54A 3K57A 1CA6A 2ZXRA 1GHKA 3DEPA 1Y8NB 2Q8RE 4RKLA 3WOFA 1PRTB 1V1OA 4F87A 3L7ZC 2EJFC 3URYA 1SEBD 3T56B 4HR7B 5BN5A 2BE5C 3TBIB 1RCVD 4P2CB 2JYOA 3C3LA 3R3OA 1X3PA 5C5LA 1EY4A 5I4DA 4PMCA 3MXNA 1DYQA 3VYTA 4KV6A 2J0TD 2PZWA 3BS1A 1YNJC 5I9OA 3VR6A 5C0XI 2PMZB 1ILPA 3GTKB 2EYOA 2WINB 5KYIA 2PW7A 1SYBA 4RKBA 2BCOA 1QNKA 3H0GB 1F9SA 3K5NA 1F9QA 1LV9A 2MPMA 5DNFA 2F0UA 5CORA 2K6AA 2E2HB 1STAA 3H3VC 2RDFA 1QG7A 1SFOB 4RHRA 3GV6A 2Z4IA 4QIWB 1HXYD 4EQPA 1V1PB 1LT6D 2K33A 1J9OA 2VB2X 3BDOA 1HRJA 1QWYA 1Z7TA 4IURA 4LMQD 4PV1C 2K5DA 1PRTC 3NPPA 2X6LA 1SXTA 2NN6H 4B9WA 1OXXK 5IGDA 2PYKA 4EGVA 3GTGB 1HTLD 5JPMC 5M5XB 2OXPA 2ICIA 5ISRA 1NUCA 2FHTA 3NBHA 2QKIC 3OWFA 1TR5A 3MEHA 5CV7A 2K1BA 4KN7C 1UAPA 3NSWA 2F0DA 5M9OA 1FNVA 1JB3A 2EY6A 2Q8IB 2VUMB 4IFDJ 1KLUD 3GTPB 3N52A 4I65A 1B53A 1BQQT 2M9VA 1B1ZA 3QJYA 5JEAG 1AZQA 5G3LF 1BXTA 3IAYA 3NTHA 5HURA 1EQTA 4HSVA 1W6JA 1BUVT 1Q90A 3I3CA 3FDTA 3FRPB 2N55A 4FXGC 2K5QA 3KK7A 1PDQA 4L8JA 1O80A 5D14A 2IPKD 5KIXA 3PIP3 5CMDA 3BYTB 3TSSA 1FD7D 3K5MA 5FO7B 3DMUA 5CGKA 3OSOA 3CU7A 2PQEA 3A8JE 4K5WA 1D1KA 2G9HD 2H4OA 2AQ3B 5JAVA 2MJ8A 3Q6SA 5LL6S 1HFGA 3RZDB 2K01A 2L0CA 3W2DA 1UUPA 4A3EB 3KLSA 1SYGA 3AU7A 2B2UA 5E1FA 4FXKC 1CM9A 1F9PA 1CZWA 3S17B 2JA8B 3N6RA 4ABNA 1PXUA 2F0MA 2DNEA 5EKIA 1S5FD 1ENFA 1LTBD 1KTKA 2JE6I 2E74C 2L5TA 3BDLA 4KJNA 3VA7A 1RODA 2B2YA 3VYSA 5D3IB 4FNFA 4A3IB 1BCPB 1PMRA 2RKSA 3HOWB 2NUCA 1DCZA 2VXWA 5ELBA 5BN4A 1YNNC 1FGBD 3BVMA 3L3OC 2XRQD 1HUNA 4A3BB 4OO1H 3QOJA 3HOUB 1O7YA 1S5ED 3D4RA 3D4DA 2K03A 5F2DA 1I4GA 4TKOB 2RDGA 4KKTA 1MSHA 1DM0B 5CV9A 4ZUIA 4K8JA 5J22A 2K28A 1Y8OB 4LJZC 2VB3X 4ZRZA 3OOCA 1PTOF 4B08A 2XIWA 1U9RA 4CKBA 1EYAA 1W6KA 2CQAA 4WJWA 3NXWA 3I4NB 3I4LA 4HTHA 3T16A 4TQUS 1A3TA 4KKUA 3ND8A 5C0XG 2PCFB 1TWFB 2PNRC 3HOVB 3S1NB 3HOXB 1D1IA 4ZQ3A 5LL6X 2IW3A 3M7GA 5KRUA 1CHQD 4Q5VA 4HN7A 4DAYA 4C1NK 1BCPC 1K8MA 3I72A 3FPPA 4NMZA 3S1QB 5JVG3 4CGYB 4G4KA 2CW0D 2XWBB 2NYZD 5CV6A 1SE3A 3I8ZA 1G8ZD 4H44C 1I6VC 2OT2A 2WACA 1ESFA 2HDLA 1M8AA 1TU2B 2F0GA 1EZ8A 5D3DA 1SNQA 2O4XA 2E76C 3BVGA 3C1EA 1TS3A 4CJ0B 2F4IA 1E0BA 2FMCA 4FF2A 2WB1B 5C3XA 1U4LA 5T1GA 2EY1A 2NN6I 3Q0AA 1Z47A 1KNAA 1EZ6A 3BYYB 4U68A 1E2ZA 5I2XA 2KA7A 3P1HA 1EYDA 1TVXA 1LACA 3GTJB 1RF2D 2BA0A 1K83B 4DK0A 3C2PA 5C4HA 1STBA 1QB5D 4ZLTF 4XYQA 1H9KA 3DXJC 1EL0A 3L9AX 1SE4A 2IJ0A 5CYUA 2A68C 3VA5A 2F0PA 2F3WA 2E75C 2R6GA 2HDMA 4BY1B 1VF5C 4RWSC 1IYUA 1SYFA 2ID0A 2SOBA 2EYLA 3QIAA 2KUMA 1BNZA 5C4JB 1STNA 1TKWB 3KLSX 1B44D 1FR3A 3RZOB 3FPUB 1LTGD 3QB3A 1HQRD 1PFBA 4J8QA 1CFMA 3I70A 3VR2A 1SDFA 3T4AC 3K58A 4A3GB 2R92B 1ESRA 4DXGA 4ODGA 1I4PA 1SMYC 2A6HC 4H0LC 2EYHA 3CHBD 1H9SB 1QOHA 5IT9L 5NUCA 2MGSA 1Q12A 2JXMB 3P75A 5JOBA 1LLRD 4KY6A 5I9PA 1ZYRD 5J39A 3NK9A 4DAVA 1Q1EA 1Y8PB 2ZT9C 1JE4A 4JBWA 3HEJA 5ELEA 2DNCA 5A35A 2B2VC 5IGCA 4C56C 2NTTA 1JOQA 5CV8A 3WDNA 4IFDH 1JCKB 2AUJD 2AQ2B 2KHSA 1PTOH 3NBIA 3OWEB 1RD9D 4IUPA 3HG9A 2PZUA 3HRZC 1B3AA 3DUZA 3FKIB 1CA5A 4G57A 1OO9B 1S5CD 2DY8A 2F0IA 2A73B 2F0SA 1G2SA 1J8IA 2JEBI 4K2KA 3U9OA 2KECA 1HPCA 4O1NA 3PMFA 4OL7A 5IGBA 4KI0A 1ENAA 3I90A 5C5MA 2D9UA 1JOOA 2A69D 1CZGA 1KABA 1QCBD 4KJOA 2F0TA 2AUKA 3OIPA 3D31A 5ELDA 1JWSD 5K36G 5DM63 2ZXOA 2A5HA 4XIGS 3AMUA 4BWGB 3SHLA 4PMBA 3H94A 1JC7A 1KLGD 5COYA 4C1NI 4R8IA 1TS5A 3TZUA 1WD1A 4QUCA 1EY7A 2J7ZA 1Q1BA 1XTCD 3IFTA 2PPBC 1KNEA 1TWAB 2SDFA 4HEDA 2NVYB 4RCOA 2AWNA 5AFWA 1VDZA 2L4NA 3CRKC 2C5CA 2NB0A 1DXMA 5IIFA 2RBMA 4HMIA 1EU4A 5C6AA 4E6IA 3DHQA 3DM1A 1SJHD 3FMCA 4Z9CB 3EROA 3A7AB 4A3KB 2KOLA 1YNJD 2J4XA 1LTSD 2NZ1D 5KGUA 1NR2A 1H9JA 2DY7A 1WTWA 5EJWA 3EA6A 4CJ2C 2L55A 1IHZA 2ZXPA 1CT1D 3TP5A 1HFNA 4RAUC 3D4WA 2RVLA 3X3NA 4XQJA 3K59A 1QE6A 3SK5A 4DNRB 2O2LD 1S4ZA 4PQXA 1LTID 4HCEA 1H9RA 3J7AF 1GHJA 3ND9A 4IZ8A 5FK9C 4CJ1B 4EQNA 2B39A 1PRTF 1PRTD 1D6EC 3KLRA 1FNWA 1DJRD 3HS0C 1JORA 2KQ3A 3PO2B 1HCZA 5HGTA 5E4WC 2D2CC 3M4YA 1LT4D 2A6EC 5EBDA 1DONA 5G3LD 1T5EA 3H91A 2SNMA 2PW5A 4HSPA 2BOSA 5JEAH 1K8OA 3SK4A 2EYMA 1C4QA 4HMJA 4PMWA 2B2TC 1IKLA 1ML0D 3EFXD 3DWAA 3GD7A 5I6WA 1GUGA 1LABA 3GTLB 5A2QE 3QG1A 2IX1A 1KDCA 4IN3A 1SYEA 2R7ZB 1TWGB 2SEBD 1XYIA 4C3IG 3F2UA 2JEAI 4L6TB 2JP1A 2EYFA 2RQXA 4FVMA 3S16B 1HA5A 2K7VA 2D5DA 4KMUC 2EJMA 1GUOA 4CHTB 1BF4A 5IGFA 1RKNA 5A2QL 4CKCA 4C3HB 4U673 4H7BA 3H6MA 1PZJD 4DGZA 4KK7A 3A55A 5T1IA 1F2LA 3WOEA 4IFDI 3R8BA 1DD2A 3KF8A 3Q24A 1FNUA 4K6LA 1E2WA 4R8NA 5IGGA 2MP1A 5C4XB 1KAAA 1I4XA 2TSSA 5CBAE 2EVBA 1F2YA 1EWHA 1V43A 4I7ZC 2KEDA 3BDCA 1EY6A 3T51B 1WTRA 1HUMA 3C1FA 5KNDA 2B2WA 3S2DB 3OIQA 3E0JA 1GUNA 1M4VA 1HHVA 1B50A 1YNND 2Z8LA 1TWCB 1R4QB 3RUZA 2NVXB 4RHSA 1AEXA 2RDHA 3CKIB 1XWEA 4Y7NB 4EQOA 2WIIB 3OMCA 2IL8A 1EQVA 1PTOD 4C3JG 3S9WA 3GTOB 2CVRA 1SYDA 3C46A 1TWHB 1RTNA 2BDOA 2SNSA 3TZDA 3D3RA 4N9TA 2H1EA 2M2LA 3I73A 3I91A 1R4PB 1RHPA 5JEAJ 1A3UA 2EZVA 4A3FB 1QILA 1MI2A 4KHVA 1VMPA 1PLFA 1FYCA 4WORA 4XT3B 3M3YB 4IALA 2NVQB 2CW0C 1GJXA 1DZ1A 3EQLC 1JQYD 3K0YA 1ZXTA 3FEWX 2WP8J 3PV0A 4G7OC 5FO8B 1OXTA 2R3ZA 4UDUC 1BCPF 2K04A 1BCPD 1OXSC 3MAQA 1EFID 1SJED 2BDNA 3KBGA 2K5WA 1O7ZA 1Z6HA 3PUWA 4KD3A 5J1ZA 1MD2D 2EY2A 2L12A 4DXFA 5M5YB 1X32A 3NTKA 2LS01 3MHBA 3M85A 4R9WA 2Z1CA 5KNCA 1NSNS 3M4OB 3Q22A 3EVQA 2B63B 4NDXA 5ELFA 1GUWA 1L0YB 1O78A 5EBCA 4RGNA 4LAAA 1EWCA 2M00A 1PYWD 4K5VA 3PUXA 2OEOA 4K8IA 4K14A 1IW7C 4C3IB 1WVLA 2Y0SB 2QCPX 5JPNC 1D5MC 3TP7A 3VR3A 4ZK9B 3KBXA 1R9TB 2VNUD 3QO2A 3SR1A 5IT9E 3ONAB 3NWSA 1I4RA 4ZYSA 2FFKB 4QF4A 3MXUA 1BO0A 4BS9A 2EE1A 2A68D 1E2VA 1VF7A 3Q23A 1X3QA 2O5IC 4RFBA 3QWNA 2F0LA 1EY9A 2WKDA 4O42A 3HZXA 4HCSA 3A56A 4F88A 4CKEA 3J81L 5M3MB 5ELCA 5DM73 2FINB 1B2TA 3JAML 2KVMA 4RH6A 2EYPA 5CV4A 1CK1A 1A3VA 1B9MA 2V4DA 1A6XA 1SNDA 3T53B 3MC0B 1JWUD 3SK8A 3CRLC 2A6HD 2G9DA 4A3MB 4BBRB 5C0XJ 1WTPA 3V2TA 2WAQB 1UEAB 4PNYA 4TSSA 1DOMA 3D8GA 4IUTA 3GV3A 1HTPA 4EVOA 1RTOA 3EJIA 3SDZA 3MFGA 1EY0A 4IFDG 3J80L 2XN9C 4C3JB 4C2MB 4AYBB 3NQIA 3BG3A 2HCIA 1ZKOA 2XWJB 3S1MB 1UNSA 2F0EA 5TSSA 2L11A 5M5WB 2E2IB 1CHPD 4WRDA 4Q0FA 4A3JB 4LK1C 5LHY1 1MBYA 2A69C 4DF7A 1JR0D 1XX8A 2JA6B 1Q3LA 4X3KA 4OO1I 1TIID 2WV6D 2FMMA 4C3HG 4DFAA 2NWGA 4QMGA 1G6ZA 4N9PA 3RMHA 4CBVA 2F0JA 4RA8A 1F2ZA 4NW2A 3LX0A 3HKZB 3MTSA 4DA2A 5FLXL 1D5ZC 5EKLA 1H9MA 5K36H 1DOLA 2QF7A 1EEFD 1L0XB 2LFNA 5E4XA 1U4RA 2BE5D 2HCCA 4DK1A 2MUYA 2ICEC 5E3FA 1NAPA 2PO4A 2OF1A 2XVSA 2KCNA 5FO9B 1G291 4RGTA 3E6ZX 4H13C 3SEBA 3ERQA 3MFYA 1VMCA 1SNCA 3PUVA 4WFN3 5IODA 3O13A 1D2BA 3R2TA 1LTAD 1U4PA 2DN8A 5EPLA 4DN4M 3NWTA 1Q8IA 2KCCA 3UI2A 3PUZA 2FJ2A 5DEHA 2AQ1B 2B2UC 5JJZA 3GO5A 1A2UA 1GXDC 3HOYB 2B2VA 3U9SA 1WCMB 1VCIA 4G7HC 2NN6G 1ZEQX 4ZKCB 1IKMA 4ZUJA 5M3FB 4HAEA 5FKAC 3SXHA 3IL8A 4KN4C 4YIJA 5C44B 5BN3A 2B2YC 2F03A 4XXEA 1ILQA 4RGOS 4TRDA 4FF3A 3HP3A 2JA7B 3K6OA 1GOZA 1SNOA 1AFPA 4DNTB 2NTSA 1EEID 2O5JC 4MN3A 3LWEA 1ET9A 3J7AV 2F0FA 4ZKBB 2JA5B 1RDPD 4A93B 1NCVA 2B2WC 3A8KE 4F8MA 1GUTA 1H9SA 3J7YW 2E2JB 1STHA 3OW7A 2A6ED 1EIHA 1ENCA 4MHEA 2F0KA 3G6JB 4KHZA 3SVMA 2R61A 4OGQC 1O7LA 4ME5A 2RSOA 4NP5A 4ID6A 4G7ZC 3GQBA 3MXPA 5EPJA 1BR9A 3TN2A 3TP8A 3X3MA 2QILA 1C48A 1PTOB 3IKJA 3GTMB 2EJGC 1F2MA 1EYCA 4OHJA 4JK1C 3VYRA 3GP7A 3BVZA 2I07B 3D6CA 1TT2A 5I6YA 4DU9A 4QB4A 1I50B 1SNMA 4X3SA 3RD4A 4QCLA 2RA4A 2RSNA 3D6WA 4BA2I 3LWUA 3S2HB 2F1MA 5C3WA 1Y69U 3RLFA 4ZAIA 3W3AA 1S5DD 3S1RB 2EY5A 3IFDA 4ULLA 3GTQB 2YYZA 2LY7A 2F0NA 5EKKA 4OIJA 2K32A 1U4MA 1CTMA 1SE2A 3DWPA 4DAPA 3BZDB 1PFNA 1PFMA 4KKSA 1JWMD 2TMPA 2PZTA 1LTRD 5K5PA 1SBBB 1BDOA 3MXGA 5CBEE 2X69A 2IX3A 1SSOA 1WTVA 3PIO3 4A3DB 2XNAC 1HQMC 1DOKA 4OO1G 2E2DC 4QUFA 2JSOA 1KDAA 4V0BA 4MIUA 4RCNA 1PZKD 3CQZB 5KYLA 1PTOC 1HA6A 3E5SA 1OXVA 3VR5A 1TS4A 4KY7A 4KTAA 2D62A 2B2TA 1G91A 2C9OA 1SAPA 1STEA 3QOLA 1PZID 2B8FA 1A15A 3K5OA 5CC4A 1V1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QCB D;  4FO2 A;  1TII D;  4FNF A;  5G3L D;  4FP5 D;  1QB5 D;  5G3L F; 
#chains in the Genus database with same CATH topology
 4X3U A;  4BY7 G;  4KD4 A;  3V05 A;  1EOT A;  4FP5 D;  4DUZ L;  1D5X C;  4JI7 Q;  2E2I H;  3T13 A;  2UUA Q;  1EOV A;  4A3L H;  2ZTC A;  4A3J H;  3TS2 A;  1VQN A;  5C0X H;  3VYU A;  4UAI A;  2Q8T A;  4XTC S;  4K2L A;  4M1U B;  4AH6 A;  1LTT D;  4NXN L;  2WAQ E;  3ICE A;  4FF4 A;  2EYJ A;  5FJ8 G;  4XQQ A;  3CCR A;  1WD0 A;  2GA4 B;  1NMF A;  3TME A;  2MHV A;  1ASY A;  4NKL A;  3T1H Q;  2XRS D;  1J5E Q;  4IUQ A;  1Y1W B;  4V19 0;  5JVH 3;  3A8I E;  2F0H A;  3EIV A;  4GN3 B;  1CI3 M;  4XT1 B;  4AQY Q;  2AHO B;  1PH4 A;  4FXD A;  1EY5 A;  1VQ7 A;  2N3S A;  4MTN A;  4DR5 L;  1EY8 A;  4PG3 A;  1GUS A;  4ILW A;  1SNP A;  3H09 A;  1K8G A;  5EPK A;  2AWO A;  2Z4H A;  1ET6 A;  2A74 C;  3CCQ A;  4A75 A;  3NHH A;  3J80 i;  3G7L A;  4FO2 A;  3LNN A;  5EQ0 A;  3PQI A;  5I2Y A;  1TWA H;  4OIK A;  2R93 B;  2NVY H;  1F77 A;  1VQC A;  1VQP A;  2EXZ A;  4IUN A;  4XDX A;  3FP9 A;  1WTO A;  2B8G A;  4LFC L;  3PSI A;  3A7L A;  1Y1V B;  3KDF A;  3MZ5 A;  5EGT A;  1NJI C;  2HT1 A;  4B3R Q;  5DAU A;  2ES2 A;  2L15 A;  4K6D A;  1T5X D;  4NB3 A;  5IP7 H;  2X6G A;  2LMC B;  2NVT B;  1F9R A;  5IOC A;  3MA2 B;  1II3 A;  1PH8 A;  2NBF A;  3K5L A;  3I4M B;  3ITP A;  3KJP A;  3MWY W;  3H0G G;  2CHB D;  1I3Q B;  2N88 A;  1LT5 D;  1I94 Q;  4X65 L;  4OX9 L;  4PZ7 A;  1GM5 A;  5C4Z A;  4JI0 L;  4LUO A;  1V8Q A;  4JI2 Q;  1LO5 D;  3NUC A;  2MNA A;  1VQD A;  3OPO A;  5C3E B;  3DWQ A;  4XYO A;  1X55 A;  2VQE L;  4OWW B;  1WCM G;  2KEE A;  2QDB A;  1B4O A;  1QNU A;  2KJX A;  4B9X A;  4LF5 L;  2PNH A;  3J81 E;  1YIT A;  1XXG A;  4M8A A;  2MO1 A;  2QEJ C;  2F0W A;  5IWA Q;  3KUP A;  4A3C H;  3HOY H;  3JAM E;  2I46 A;  1KAW A;  1AZP A;  5CV5 A;  4JBM A;  1MSG A;  1ONL A;  1BBX C;  1TY0 A;  5IGE A;  3NE5 B;  5CR3 A;  1RJT A;  5M3F H;  1VQ4 A;  3PUY A;  1S72 A;  1N33 L;  1IW7 D;  3SK6 A;  3VR4 A;  1B8A A;  2EPB A;  3TP6 A;  1AW7 A;  2K05 A;  2ZTD A;  5C44 H;  1WTQ A;  1EU3 A;  4FDB A;  3PO3 B;  3CAM A;  4JI5 Q;  3TEH B;  2EDG A;  4B3T Q;  1STG A;  1PH1 A;  3CC2 A;  2HUG A;  4XQN A;  3V96 A;  1WTX A;  1I4H A;  3P7J A;  5BR8 L;  3PO2 H;  1LT3 D;  4OWX B;  1C8C A;  1IL8 A;  1JJG A;  1AP0 A;  5D65 A;  3I55 A;  2JA5 G;  3SE0 A;  1IYV A;  2OQ0 A;  3P20 A;  1G2T A;  1YBY A;  3MVV A;  5FLM H;  1PYB A;  2IX0 A;  4H02 A;  4GLA C;  4DK3 C;  2Q2U A;  3J80 E;  4X6A H;  4BA1 I;  1TS2 A;  2AMC B;  3TDQ A;  1YJW A;  4J1M A;  4BBS B;  1ZYR C;  1XPU A;  2BA1 A;  4DR3 L;  3ER0 A;  1D8L A;  1QJO A;  1X3E A;  4JG2 A;  1KDB A;  3R2I A;  4DV6 L;  3M7N A;  3NQT A;  4IUV A;  3BJU A;  1FVI A;  1A2T A;  3A5U A;  1MGS A;  1MJE A;  1SMY D;  4JC0 A;  4KY5 A;  2L9H A;  1JIC A;  4J6H A;  3S14 B;  1VQH A;  2CWA A;  1EIG A;  1S5B D;  1CQV A;  2F0O A;  2KCM A;  1STY A;  4S3S A;  4OEL B;  2Z9H A;  4QJF A;  3S24 A;  2VQF Q;  5FOB B;  1CQF A;  3S15 B;  1K0S A;  5EAY A;  2JN4 A;  1OXU A;  2IWH A;  4F7X A;  1B9N A;  4QGU A;  4JOI C;  2ENB A;  2F0V A;  3HFZ B;  4OWT B;  5KNB A;  1ICW A;  3R93 A;  3DEO A;  1TY2 A;  2F3V A;  3J7Z C;  2YU9 B;  2L1B A;  2CH4 A;  3NTI A;  2IT1 A;  3NP8 A;  1I6H B;  1SYC A;  1BOS A;  2F0Q A;  3K7A B;  3STB C;  3G71 A;  3AB9 A;  1I4Q A;  3OHX C;  2N49 A;  4FF1 A;  3HOZ B;  3IRB A;  4X3T A;  4FYD A;  1N32 Q;  4JI7 L;  2R7Z H;  1TWG H;  4IUU A;  2UUA L;  2EOT A;  3HGB A;  4IJH A;  4L63 B;  2LKV A;  3OMG A;  5FLX E;  5KEE A;  4GZY C;  4IQZ A;  1HZB A;  4BY7 B;  4GOP A;  1NR4 A;  2XSC A;  3S16 H;  1AN8 A;  1A62 A;  2WKC A;  3T1H L;  3ZYY X;  1J5E L;  2HQE A;  4K5X A;  3QR8 A;  1BKB A;  4RGM A;  1TQO A;  3FVQ A;  1KQS A;  4DAM A;  1JOK A;  4AQY L;  3A54 A;  3K57 A;  1CA6 A;  2ZXR A;  4J15 A;  1GHK A;  3DEP A;  1Y8N B;  2RCF A;  2Q8R E;  4RKL A;  3WOF A;  1PRT B;  2JA8 G;  1XMQ Q;  1V1O A;  4F87 A;  3UE1 A;  3L7Z C;  1K3B C;  1WJJ A;  2EJF C;  4C3H H;  3URY A;  1SEB D;  3T56 B;  4BXX H;  2K52 A;  1EQR A;  2KHI A;  5ELN A;  4HR7 B;  2OCE A;  5BN5 A;  2BE5 C;  3KF8 B;  3TBI B;  1RCV D;  4P2C B;  2JYO A;  3TRE A;  3C3L A;  4KHP Q;  3R3O A;  1PH2 A;  4A3I G;  1X3P A;  4B3R L;  5C5L A;  1EY4 A;  1XMO Q;  5C4X H;  5I4D A;  4A3D G;  4PMC A;  3MXN A;  3CF5 A;  1I5F A;  1DYQ A;  3VYT A;  4KV6 A;  1IYJ B;  1YJN A;  2J0T D;  2PZW A;  3BS1 A;  1I94 L;  4JI4 Q;  4MTK A;  4A3B G;  4JI2 L;  1YNJ C;  5I9O A;  1QZG A;  3HOU G;  3VR6 A;  1KHI A;  5C0X I;  2PMZ B;  1ILP A;  3KYH C;  3GTK B;  1TWC H;  2EYO A;  2WIN B;  5KYI A;  1HR0 Q;  2PW7 A;  2NVX H;  1SYB A;  4RKB A;  1Y14 B;  1C9O A;  2BCO A;  1QNK A;  3CQZ H;  1VQB A;  3H0G B;  1F9S A;  5IWA L;  3K5N A;  3CCU A;  1YVC A;  1F9Q A;  1LV9 A;  2MPM A;  5DNF A;  2F0U A;  3GTO H;  5COR A;  2K6A A;  2E2H B;  1STA A;  3H3V C;  2RDF A;  1QG7 A;  1SFO B;  4RHR A;  3GV6 A;  2VS1 A;  2Z4I A;  4QIW B;  1HXY D;  2A1A A;  4EQP A;  1V1P B;  2FXQ A;  1LT6 D;  2K33 A;  1J9O A;  2VB2 X;  3BDO A;  3I4N G;  1HRJ A;  1QWY A;  1Z7T A;  4IUR A;  4LMQ D;  4PV1 C;  4GLX A;  2K5D A;  4JI5 L;  1PRT C;  3NPP A;  2AKW B;  4B3T L;  3E9I A;  1PH9 A;  2X6L A;  4IOA A;  1SXT A;  2K5N A;  2NN6 H;  4B9W A;  1OXX K;  2PYK A;  5IGD A;  4EGV A;  4HJA A;  3GTG B;  1HTL D;  5JPM C;  2DJF C;  5M5X B;  2OXP A;  1KRS A;  3HOX G;  1Y1W G;  2ICI A;  5ISR A;  1NUC A;  2NVQ H;  2FHT A;  3EBE A;  3NBH A;  2QKI C;  3OWF A;  1TR5 A;  3MEH A;  5CV7 A;  2K1B A;  4KN7 C;  1UAP A;  3NSW A;  4GNX B;  1HNW Q;  1B70 B;  2F0D A;  5M9O A;  1HZ9 A;  3F2B A;  1FNV A;  1L1O B;  1JB3 A;  4PZ8 A;  2EY6 A;  2R93 G;  2Q8I B;  2C35 B;  3ULP A;  2VUM B;  4IFD J;  3RR5 A;  1KLU D;  3GTP B;  3N52 A;  1MHW C;  4I65 A;  1B53 A;  1BQQ T;  2M9V A;  2VQF L;  1B1Z A;  3QJY A;  1UE6 A;  4L5T A;  5IYB G;  1IXR A;  1YNX A;  5JEA G;  1AZQ A;  5G3L F;  1BXT A;  1HJP A;  5M5Y H;  4YHH Q;  3IAY A;  4HJ5 A;  3KDF B;  3NTH A;  5HUR A;  3KFU A;  2WB1 G;  1EQT A;  4JBK A;  1HZC A;  4HSV A;  1W6J A;  1BUV T;  1Q90 A;  3I3C A;  1N32 L;  4L5Q A;  3FDT A;  3FRP B;  2N55 A;  1U5K A;  4FXG C;  2NVT H;  4YCW A;  4X66 Q;  2K5Q A;  3KK7 A;  4N8F A;  3M4O H;  1PDQ A;  4L8J A;  1O80 A;  3Q8D A;  3I4M H;  1I3Q H;  5D14 A;  2IPK D;  5KIX A;  3PIP 3;  3G4S A;  4RMF A;  3B6Y A;  2DGY A;  3CW2 C;  3CXC A;  5CMD A;  3BYT B;  3TSS A;  1FD7 D;  3K5M A;  5FO7 B;  3DMU A;  2IHF A;  3F2C A;  5CGK A;  3OSO A;  1IL2 A;  4DV1 Q;  4C3I H;  3CU7 A;  3JC6 6;  2UXD Q;  2PQE A;  3A8J E;  4K5W A;  4JI3 Q;  1D1K A;  4LF9 Q;  1R9T H;  2G9H D;  2H4O A;  2AQ3 B;  5IP9 G;  5JAV A;  2MJ8 A;  3Q6S A;  5LL6 S;  1HFG A;  4JCV E;  3RZD B;  1XMQ L;  3BZC A;  2K01 A;  2L0C A;  3W2D A;  1AH9 A;  1UUP A;  2VL6 A;  4A3E B;  3KLS A;  1SYG A;  3AU7 A;  3E3X A;  2B2U A;  5E1F A;  3CPF A;  4FXK C;  1L1O C;  1CM9 A;  1CSQ A;  4KHP L;  1T9H A;  1F9P A;  1CZW A;  3S17 B;  2JA8 B;  3N6R A;  1XMO L;  2QW7 A;  4ABN A;  1PXU A;  1IBK Q;  2F0M A;  4R4O A;  2DNE A;  5EKI A;  1S5F D;  1ENF A;  1LTB D;  1KTK A;  5M3M H;  2Y0S E;  2JE6 I;  2ZM6 Q;  4BBS G;  2E74 C;  2L5T A;  3BDL A;  4A3G G;  2R92 G;  1Q81 C;  2K5V A;  1HR0 W;  4KJN A;  3VA7 A;  2F4V Q;  3CC4 A;  4JI4 L;  1X56 A;  1ROD A;  2B2Y A;  2NZH A;  3VYS A;  5D3I B;  4FNF A;  4A3I B;  2BH2 A;  3CCS A;  1BCP B;  2GVB A;  1PMR A;  3ERS X;  1X3F A;  2RKS A;  3HOW B;  2CQO A;  5LMN Q;  2NUC A;  1DCZ A;  2VXW A;  5ELB A;  1A8V A;  5GQO A;  1HR0 L;  4R4I A;  5BN4 A;  1YNN C;  3UE0 A;  1UEB A;  3S14 H;  1FGB D;  3BVM A;  3L3O C;  2XRQ D;  1HUN A;  4A3B B;  4OO1 H;  3QOJ A;  3HOU B;  1O7Y A;  1S5E D;  3HOZ G;  3D4R A;  4LFA Q;  3D4D A;  1AE3 A;  2K03 A;  3A0J A;  5F2D A;  1I4G A;  4TKO B;  4L5R C;  2RDG A;  4KKT A;  1MSH A;  1DM0 B;  4JV5 Q;  5CV9 A;  3K7A H;  4DV0 Q;  1VQJ A;  4ZUI A;  2GN5 A;  1NNX A;  4K8J A;  5J22 A;  2K28 A;  1Y8O B;  3GDE A;  4LJZ C;  2VB3 X;  4C3J H;  4C2M H;  3J81 i;  1IBM Q;  4ZRZ A;  3AEV A;  3OOC A;  2QA4 A;  4R4Q A;  3JAM i;  1PTO F;  4B08 A;  2XIW A;  3S1M H;  1U9R A;  1VQI A;  1EYA A;  4O0A A;  4CKB A;  1W6K A;  2CQA A;  4P74 A;  5M5W H;  1NY4 A;  1W2B A;  4WJW A;  3NEN A;  3NXW A;  3I4N B;  1PH6 A;  4BY7 H;  2F52 A;  3I4L A;  3VDY A;  1YZ6 A;  4HTH A;  4GS3 A;  3T16 A;  4TQU S;  1A3T A;  4KKU A;  2JA6 H;  3NEL A;  3ND8 A;  1HNW L;  1N36 Q;  2HD3 A;  4LF8 Q;  5C0X G;  2Z0S A;  2PCF B;  1TWF B;  2PNR C;  3HOV B;  3S1N B;  3HOX B;  1D1I A;  4ZQ3 A;  5LL6 X;  2IW3 A;  5FJ8 H;  1NBW A;  4LF7 Q;  3M7G A;  5KRU A;  1QVG A;  3M9B A;  1CHQ D;  4Q5V A;  4HN7 A;  4DAY A;  4AYB E;  4C1N K;  1BCP C;  1FL0 A;  1K8M A;  3I72 A;  1XNR Q;  1HNX Q;  3FPP A;  4NMZ A;  3S1Q B;  5JVG 3;  4CGY B;  2HHH Q;  4G4K A;  4YHH L;  2CW0 D;  2XWB B;  3FHW A;  2NZO A;  1EFW A;  2NYZ D;  5IYC G;  5GAH C;  5CV6 A;  4R4C A;  3RLO A;  1SE3 A;  2K75 A;  3I8Z A;  2GVA A;  1G8Z D;  4H44 C;  1I6V C;  2OT2 A;  2WAC A;  4OON A;  1ESF A;  3MXN B;  2HDL A;  4X66 L;  1M8A A;  3NEM A;  1TU2 B;  2F0G A;  1EZ8 A;  5D3D A;  1EIF A;  1SNQ A;  2O4X A;  2E76 C;  3BVG A;  3C1E A;  1P8L A;  1TS3 A;  4CJ0 B;  2F4I A;  1E0B A;  2FMC A;  3RN2 A;  4FF2 A;  2WB1 B;  4LW1 A;  5C3X A;  1U4L A;  5T1G A;  1E24 A;  2EY1 A;  2NN6 I;  3HKZ E;  3ZJY C;  3Q0A A;  1Z47 A;  1KNA A;  1EZ6 A;  3BYY B;  4GN5 A;  2JA9 A;  4U68 A;  1VQE A;  1E2Z A;  1B7Y B;  5I2X A;  2UUC Q;  2KA7 A;  3P1H A;  4Y52 H;  1EYD A;  4DV1 L;  1TVX A;  1JB7 A;  1HZA A;  2UXD L;  4A3K G;  1LAC A;  3GTJ B;  4UP8 A;  1RF2 D;  2YV5 A;  3H0G H;  4JI3 L;  4LF9 L;  2BA0 A;  1K83 B;  1E7Z A;  2E2H H;  4DK0 A;  4DR7 Q;  3C2P A;  4JBJ A;  5C4H A;  1STB A;  1N8R C;  1QB5 D;  5LMU Q;  4ZLT F;  2JJQ A;  4XYQ A;  1WCM H;  1H9K A;  3DXJ C;  1EL0 A;  3L9A X;  1SE4 A;  2IJ0 A;  5CYU A;  2A68 C;  3VA5 A;  2F0P A;  2F3W A;  4A3C G;  1K3R A;  4POG A;  2E75 C;  2R6G A;  2HDM A;  4BY1 B;  1VF5 C;  4RWS C;  4LWC A;  1IBK L;  1IYU A;  1SYF A;  2PMZ E;  2ID0 A;  2SOB A;  2EYL A;  3QIA A;  2PQA A;  3GTG H;  2KUM A;  4KLK A;  1BNZ A;  5LMN W;  5C4J B;  2ZM6 L;  4IOC A;  2JA7 H;  1STN A;  1TKW B;  2F4V L;  2HQL A;  3KLS X;  1B44 D;  1FR3 A;  3RZO B;  3FPU B;  1LTG D;  3QB3 A;  1HQR D;  2VUM G;  1CKN A;  1IBL Q;  1LUZ A;  1PFB A;  5LMN L;  4J8Q A;  1CFM A;  3I70 A;  3PO2 G;  3VR2 A;  1SDF A;  3T4A C;  3W1G A;  3K58 A;  2CFM A;  4A3G B;  2R92 B;  2JA5 H;  1ESR A;  5FLM G;  4MZ9 A;  4ODG A;  4DXG A;  4A93 H;  3GTP H;  1I4P A;  1SMY C;  2A6H C;  3CP0 A;  4H0L C;  2EYH A;  3G6E A;  3CHB D;  1H9S B;  3I4O A;  3W5O A;  1QOH A;  5IT9 L;  5NUC A;  2MGS A;  1Q12 A;  1Q82 C;  4LFA L;  2E2J H;  2IY5 B;  1VQA A;  2JXM B;  1GKH A;  3P75 A;  2BH8 A;  5JOB A;  3PF5 A;  4JV5 L;  4DV0 L;  1LLR D;  3A5Z B;  4KY6 A;  3U58 A;  4JI6 Q;  5IYD H;  2P5Z X;  4ME3 A;  5I9P A;  1ZYR D;  1BBU A;  5J39 A;  4P71 A;  3NK9 A;  4DAV A;  1Q1E A;  1Y8P B;  2ZT9 C;  1JE4 A;  3TQY A;  5IT9 c;  1EYG A;  1IBM L;  5JJL A;  4JBW A;  3HEJ A;  1G6P A;  3K81 C;  2Q2H A;  5ELE A;  2N78 A;  2DNC A;  3T1Y Q;  5A35 A;  2B2V C;  5IGC A;  4C56 C;  2NTT A;  4X62 Q;  1YI2 A;  1JOQ A;  5CV8 A;  4DR1 Q;  4DV5 Q;  3WDN A;  3DLL A;  4IFD H;  1JCK B;  4R4T A;  3CCM A;  2AUJ D;  2AQ2 B;  2KHS A;  1PTO H;  3NBI A;  3RLN A;  2R7Z G;  3GTM H;  1CSP A;  1RD9 D;  3OWE B;  4IUP A;  3HG9 A;  3MEF A;  2PZU A;  3HRZ C;  1B3A A;  2DUD A;  1N36 L;  3DUZ A;  3FKI B;  4CDF C;  1CA5 A;  4G57 A;  1OO9 B;  4LF8 L;  3KF6 B;  1S5C D;  2DY8 A;  1LM0 A;  2F0I A;  4DPG A;  2A73 B;  5JJI A;  2F0S A;  4A3E G;  1G2S A;  1J8I A;  5IY0 A;  2JEB I;  4K2K A;  1I50 H;  3EN2 A;  4R1J A;  2K5H A;  3U9O A;  4LF7 L;  1VQ6 A;  3RZD H;  2KEC A;  1HPC A;  4O1N A;  3SGI A;  3PMF A;  4UP9 A;  3S2H H;  3D0F A;  2K14 A;  1XNR L;  3J80 c;  4OL7 A;  1HNX L;  3KOJ A;  1WTH A;  4KI0 A;  5IGB A;  1ENA A;  2HHH L;  3S1R H;  2MFI A;  3I90 A;  3CCE A;  5C5M A;  2D9U A;  1JOO A;  2A69 D;  1CZG A;  3BZK A;  3GTQ H;  1KAB A;  1QCB D;  4KJO A;  2F0T A;  2JQO A;  1XPR A;  2JA8 H;  2AUK A;  3OIP A;  3D31 A;  5ELD A;  1JWS D;  3UDI A;  1X65 A;  4HJ7 A;  5K36 G;  4QY7 A;  5DM6 3;  1SE8 A;  2ZXO A;  2A5H A;  4XIG S;  2ATW A;  3AMU A;  4BWG B;  3SHL A;  4PMB A;  3H94 A;  3HOW G;  1JC7 A;  1KLG D;  1EQQ A;  2I5M X;  5COY A;  4C1N I;  4DV2 Q;  4R8I A;  1TS5 A;  3TZU A;  1WD1 A;  4QUC A;  4A3I H;  1EY7 A;  2J7Z A;  4HJ9 A;  5C4X G;  1Q1B A;  3TS0 A;  1XTC D;  3IFT A;  2PPB C;  1KNE A;  1TWA B;  2SDF A;  4HED A;  1GVP A;  2NVY B;  4A3D H;  2UUC L;  4HJ8 A;  3RNU A;  3UDX A;  3CD6 A;  4RCO A;  4APV A;  2AWN A;  5AFW A;  4DKA C;  1VDZ A;  2L4N A;  4A3B H;  3CRK C;  1X9N A;  1XPO A;  2C5C A;  2NB0 A;  1DXM A;  5IIF A;  2RBM A;  4IO9 A;  1K28 A;  4HMI A;  4DR7 L;  1VQG A;  1EU4 A;  4CDC C;  5C6A A;  4E6I A;  2XGT A;  3DHQ A;  3DM1 A;  1SJH D;  5LMU L;  4LF4 Q;  3FMC A;  4Z9C B;  3ERO A;  3A7A B;  4A3K B;  2ASB A;  2KOL A;  1YNJ D;  3CME A;  1VQ5 A;  2J4X A;  2UUB Q;  1LTS D;  2RHS B;  4RG1 A;  2NZ1 D;  5KGU A;  2JK8 A;  1NR2 A;  1H9J A;  2DY7 A;  1WTW A;  3U4Z A;  5EJW A;  1Q46 A;  3EA6 A;  4CJ2 C;  2L55 A;  4JOI A;  1E1T A;  1IHZ A;  2RCN A;  5ELO A;  4JPB W;  2Q2T A;  2H5X A;  2CKZ B;  2ZXP A;  4DV3 Q;  1CT1 D;  3TP5 A;  1HFN A;  4RAU C;  3D4W A;  5GRO A;  2RVL A;  3X3N A;  4XQJ A;  3HOV G;  3K59 A;  4A3F G;  1QE6 A;  3SK5 A;  4DNR B;  2O2L D;  1IBL L;  1S4Z A;  4PQX A;  1LTI D;  3PIO A;  4HCE A;  1H9R A;  3J7A F;  1GHJ A;  3ND9 A;  4IZ8 A;  4OEM B;  1M90 C;  5FK9 C;  4CJ1 B;  4EQN A;  2B39 A;  3S1N H;  3CPW A;  4CDD C;  3HOX H;  1Y1W H;  1VQK A;  1PRT F;  4L5S A;  1PRT D;  1PA6 A;  4DK6 C;  1D6E C;  3KLR A;  1FNW A;  1DJR D;  2KEN A;  3HS0 C;  1PV4 A;  2UU9 Q;  2ZJR A;  1B3Q A;  1QZH A;  1JOR A;  2KQ3 A;  3KJO A;  3PO2 B;  2CH4 W;  1HCZ A;  1JT8 A;  5HGT A;  2R93 H;  5E4W C;  4JI6 L;  5J3B A;  2D2C C;  3M4Y A;  1LT4 D;  2A6E C;  5EBD A;  3U50 C;  1DON A;  3CCV A;  5G3L D;  1KD1 C;  3UDG A;  1T5E A;  1HNZ Q;  2OTJ A;  4JW0 A;  3H91 A;  2SNM A;  1Y1V H;  2PW5 A;  5IYB H;  3T1Y L;  4HSP A;  2BOS A;  5JEA H;  1K8O A;  3SK4 A;  2EYM A;  1C4Q A;  4X62 L;  1J6Q A;  4HMJ A;  1UE5 A;  4DR1 L;  4PMW A;  1VQ8 A;  4DV5 L;  2B2T C;  1IKL A;  1ML0 D;  3EFX D;  1K9M C;  2I5L X;  1NTG A;  3DWA A;  4DR6 Q;  2KHJ A;  2QGQ A;  3GD7 A;  5I6W A;  2B63 G;  1GUG A;  1LAB A;  3GTL B;  3GTJ H;  5A2Q E;  3QG1 A;  5C3E H;  2IX1 A;  3CMA A;  1K83 H;  1KDC A;  4UPA A;  4IN3 A;  4B3S Q;  3F2D A;  1SYE A;  2R7Z B;  1TWG B;  1YEZ A;  2SEB D;  4YWM A;  1SR3 A;  1XYI A;  1K0R A;  2OWO A;  4C3I G;  3F2U A;  3UDF A;  4BY1 G;  2JEA I;  2Y0S G;  1AE2 A;  4JYA Q;  2UXB Q;  4L6T B;  2JP1 A;  1YJ9 A;  1N9W A;  2EYF A;  4YY3 Q;  5IP9 H;  2RQX A;  4FVM A;  3K80 C;  3S16 B;  1SRO A;  1KXL A;  2Z6K A;  1HA5 A;  1Z9F A;  2K7V A;  2D5D A;  2PQA B;  4KMU C;  2EJM A;  1GUO A;  4CHT B;  1BF4 A;  5IGF A;  2XTI A;  1QVC A;  3PO3 H;  1RKN A;  5A2Q L;  1U0L A;  4UHV A;  4DV2 L;  1HH2 P;  3RZO H;  4CKC A;  4C3H B;  4U67 3;  4H7B A;  3H6M A;  1PZJ D;  4DGZ A;  4KK7 A;  4IPH A;  3A55 A;  4JVZ A;  5M3M G;  5T1I A;  1M1K C;  1F2L A;  1PVO A;  3WOE A;  4IFD I;  3R8B A;  4BBS H;  1DD2 A;  3KF8 A;  3Q24 A;  2I5H A;  2R92 H;  4A3G H;  2PI2 E;  3WWV A;  1FNU A;  1Q7Y C;  4K6L A;  1E2W A;  4R8N A;  5IGG A;  2MP1 A;  5C4X B;  1KAA A;  4UY8 C;  1I4X A;  2TSS A;  5CBA E;  2EVB A;  1F2Y A;  2YTX A;  2CWP A;  2VY3 A;  3BU2 A;  1EWH A;  1V43 A;  1EIY B;  4LF4 L;  1V9P A;  4I7Z C;  1OTC A;  4A3M G;  3S15 H;  2UUB L;  2KED A;  4BBR G;  2A8V A;  3BDC A;  1EY6 A;  1NMG A;  3T51 B;  4ZCK A;  1WTR A;  1HUM A;  3C1F A;  4GLV B;  4LF6 Q;  5KND A;  2B2W A;  3S2D B;  3OIQ A;  3E0J A;  2R7D A;  1GUN A;  1M4V A;  2WAQ G;  2YU9 H;  2ZJQ A;  1I6H H;  1HHV A;  2HIX A;  1B50 A;  1YNN D;  3HOZ H;  2Z8L A;  1TWC B;  1KL9 A;  1R4Q B;  3RUZ A;  2NVX B;  4RHS A;  1AEX A;  2RDH A;  3CKI B;  4DV3 L;  1XWE A;  4Y7N B;  4EQO A;  2WII B;  3FKI G;  1JE5 A;  3OMC A;  1SLJ A;  2IL8 A;  1EQV A;  1PTO D;  4C3J G;  3S9W A;  4GKK Q;  4DR2 Q;  3GTO B;  2CVR A;  4GOP B;  4EQ5 A;  1SYD A;  3C46 A;  3H3V H;  1TWH B;  4YWK A;  5JJK A;  4YCV A;  1RTN A;  2BDO A;  2SNS A;  3TZD A;  3D3R A;  2E5L Q;  4A3L G;  4A3J G;  4N9T A;  2H1E A;  2OTL A;  5HY6 A;  2M2L A;  1VQ9 A;  3I73 A;  3I91 A;  1R4P B;  1RHP A;  1PH5 A;  5JEA J;  1A3U A;  2EZV A;  4A3F B;  1QIL A;  2JA6 G;  1MI2 A;  4KHV A;  2UU9 L;  5AJ3 Q;  1VMP A;  1PLF A;  3K8A A;  1FYC A;  1FJG Q;  2G5D A;  4WOR A;  2EXD A;  2EQS A;  4XT3 B;  4IAL A;  3M3Y B;  2NVQ B;  2CW0 C;  4TVA B;  1GJX A;  1DZ1 A;  3EQL C;  1JQY D;  3K0Y A;  3HKZ G;  1YHA A;  1ZXT A;  3FEW X;  3PF4 A;  3AFQ A;  2WP8 J;  1HNZ L;  3PV0 A;  1MIU A;  4GNX A;  4G7O C;  1E22 A;  5FO8 B;  3DM3 A;  1OXT A;  1L1O A;  2R3Z A;  1UWV A;  2ZTE A;  5IYC H;  4UDU C;  1BCP F;  2K04 A;  2KCT A;  1BCP D;  1OXS C;  3MAQ A;  1EFI D;  1SJE D;  2BDN A;  1KRT A;  3OW2 A;  3KBG A;  1L2F A;  2K5W A;  1O7Z A;  1Z6H A;  1UE7 A;  3PUW A;  3CCL A;  4DR4 Q;  4KD3 A;  5J1Z A;  1MD2 D;  4DR6 L;  2EY2 A;  3F1Z A;  2L12 A;  5IP7 G;  4DXF A;  4JI8 Q;  5M5Y B;  1X32 A;  3NTK A;  1PH3 A;  2LS0 1;  2QEX A;  3GTK H;  3MHB A;  4B3S L;  2EIF A;  2RHQ B;  3M85 A;  3G48 A;  2R7F A;  4R9W A;  2Z1C A;  5KNC A;  1NSN S;  3M4O B;  4GOP C;  4GN4 B;  3M4P A;  3Q22 A;  3EVQ A;  4JYA L;  2B63 B;  1BVS A;  4A3K H;  5E7N A;  2UXB L;  4NDX A;  1LTL A;  5ELF A;  1GUW A;  1L0Y B;  1O78 A;  4YY3 L;  5EBC A;  1SFO H;  4RGN A;  1LYL A;  1EWC A;  1QUQ A;  1UE1 A;  2M00 A;  1PYW D;  3K0X A;  4LAA A;  2UXC Q;  3OYY A;  3W1B A;  4K5V A;  3PUX A;  2OEO A;  3I56 A;  4K8I A;  3ULJ A;  1EWI A;  3HOY G;  2YTV A;  4K14 A;  1IW7 C;  4C3I B;  1WVL A;  2Y0S B;  2QCP X;  4IPG A;  4UP7 A;  5JPN C;  1D5M C;  3TP7 A;  3VR3 A;  4ZK9 B;  3KBX A;  1R9T B;  1YHB A;  2VNU D;  3QO2 A;  5M3F G;  2D0O A;  3SR1 A;  5IT9 E;  3ONA B;  1PFS A;  1X54 A;  5M5X H;  3NWS A;  1I4R A;  4ZYS A;  2FFK B;  4QF4 A;  3MXU A;  4AIM A;  1BO0 A;  1Q86 C;  3NBH B;  5C44 G;  4BS9 A;  2N8N A;  2EE1 A;  1NE3 A;  3ULL A;  2A68 D;  3AFP A;  3E9H A;  1E2V A;  1VF7 A;  3Q23 A;  1X3Q A;  2JA7 G;  1X6O A;  2O5I C;  4RFB A;  3QWN A;  2F0L A;  2OQK A;  4K0K Q;  1EY9 A;  4QIW E;  4I7A A;  5GAG C;  2WKD A;  1P16 A;  1D7Q A;  4O42 A;  2QDL A;  2VUM H;  3HZX A;  4HCS A;  1DGS A;  1WFQ A;  3A56 A;  4CKE A;  4F88 A;  1O7I A;  1H95 A;  3J81 L;  2K4K A;  5M3M B;  5ELC A;  5DM7 3;  2YTY A;  4LFB Q;  2FIN B;  1B2T A;  3JAM L;  2KVM A;  4RH6 A;  1K73 C;  4A93 G;  4B3M Q;  4LF6 L;  2EYP A;  5CV4 A;  1CK1 A;  1A3V A;  1B9M A;  2V4D A;  1A6X A;  3J81 c;  1SND A;  3T53 B;  3F8T A;  3MC0 B;  1JWU D;  2LXJ A;  3SK8 A;  3CRL C;  3JAM c;  4P72 A;  2A6H D;  5IYD G;  2G9D A;  4A3M B;  4BBR B;  1X3G A;  1N34 Q;  5C0X J;  1WTP A;  4GKK L;  4DR2 L;  1PYS B;  3V2T A;  1VQF A;  2WAQ B;  1UEA B;  3I7F A;  4PNY A;  4TSS A;  1DOM A;  1RL2 A;  3D8G A;  2V1C C;  4IUT A;  3GV3 A;  1HTP A;  3TRZ A;  1ICF B;  4EVO A;  3GTL H;  1RTO A;  4QQB X;  2VW9 A;  2E5L L;  3EJI A;  3SDZ A;  3MFG A;  1EY0 A;  4IFD G;  4LNQ A;  4DV7 Q;  4A76 A;  3J80 L;  3STB D;  2XN9 C;  4C3J B;  4C2M B;  4AYB B;  3NQI A;  3BG3 A;  1MKH A;  4X64 Q;  1VQL A;  2HCI A;  1CUK A;  1ZKO A;  5AJ3 L;  2XWJ B;  3S1M B;  1FJG L;  4IJL A;  1UNS A;  2F0E A;  5TSS A;  2L11 A;  5M5W B;  4A3E H;  2E2I B;  1S40 A;  1CHP D;  4WRD A;  4Q0F A;  4A3J B;  4LK1 C;  5LHY 1;  5H1S E;  1MBY A;  2B29 A;  2A69 C;  2K50 A;  2Q2I A;  4DF7 A;  1YHQ A;  1JR0 D;  1VQO A;  1XX8 A;  2JA6 B;  1Q3L A;  4X3K A;  4OO1 I;  1TII D;  2WV6 D;  1XNQ Q;  2FMM A;  3S17 H;  3CCJ A;  4C3H G;  1Q8K A;  4DFA A;  1GO3 E;  2NWG A;  5GAE C;  4BXX G;  4QMG A;  3OTO Q;  1G6Z A;  4N9P A;  3RMH A;  4CBV A;  2F0J A;  4GKJ Q;  4RA8 A;  1F2Z A;  4NW2 A;  3LX0 A;  3HKZ B;  3MTS A;  4DR4 L;  4DA2 A;  1A0I A;  5FLX L;  1D5Z C;  3PIP A;  5EKL A;  1H9M A;  5K36 H;  1DOL A;  4JI8 L;  2QF7 A;  1YIJ A;  1EEF D;  1L0X B;  2LFN A;  5E4X A;  4JI1 Q;  3E0E A;  1VS0 A;  1U4R A;  2BE5 D;  2I0Q A;  3HOW H;  2HCC A;  4DK1 A;  2MUY A;  2ICE C;  5E3F A;  1NAP A;  2PO4 A;  1L0W A;  2OF1 A;  2XVS A;  5HGQ A;  2KCN A;  5FO9 B;  5FLX c;  3H3V I;  1TXY A;  1G29 1;  4RGT A;  3I2Z A;  3E6Z X;  4H13 C;  3HOU H;  3SEB A;  3ERQ A;  3KLW A;  3MFY A;  1VMC A;  1RIP A;  1SNC A;  3PUV A;  4WFN 3;  5IOD A;  2UXC L;  4DV4 Q;  3S2D H;  2CCZ A;  2Z6B A;  1E3P A;  3O13 A;  1D2B A;  3R2T A;  5GAD C;  1LTA D;  4LUV A;  1U4P A;  2DN8 A;  1JJ2 A;  3K7U C;  4DUY Q;  5EPL A;  4IPD A;  4YWL A;  4DN4 M;  4Y7N H;  3NWT A;  4N8X 1;  1Q8I A;  2KCC A;  1JMC A;  3UI2 A;  1PH7 A;  3PUZ A;  2Z6K C;  2FJ2 A;  5DEH A;  2AQ1 B;  2B2U C;  1S3O A;  5JJZ A;  3I4N H;  3GO5 A;  1A2U A;  1GXD C;  3HOY B;  1CKO A;  2B2V A;  3PCO B;  1TWH H;  3U9S A;  3AQQ A;  1WCM B;  1EUJ A;  1VCI A;  4G7H C;  4LUZ A;  4A4I A;  2NN6 G;  1ZEQ X;  4ZKC B;  4K0K L;  1IKM A;  4ZUJ A;  5M3F B;  2PI2 A;  4HAE A;  4NXM Q;  1TWF H;  5FKA C;  3HOV H;  3SXH A;  4A3F H;  3IL8 A;  4KN4 C;  4YIJ A;  1QVF A;  5C44 B;  5BN3 A;  2B3G A;  2B2Y C;  4DAY B;  4DUZ Q;  2F03 A;  4XXE A;  1ILQ A;  4RGO S;  4TRD A;  4FF3 A;  4LFB L;  3HP3 A;  2JA7 B;  3M3Y H;  3K6O A;  4WJ4 A;  2LXK A;  3AYH B;  1GOZ A;  1WI5 A;  4B3M L;  1SNO A;  3S1Q H;  1AFP A;  4DNT B;  1JJC B;  4NXN Q;  3H15 A;  3L2P A;  2NTS A;  1EEI D;  2O5J C;  1A63 A;  4CDE C;  4MN3 A;  1MJC A;  1C0A A;  2LSS A;  3LWE A;  1ET9 A;  3J7A V;  2F0F A;  4OXP A;  4HIO A;  4ZKB B;  2JA5 B;  4MNO A;  1RDP D;  4A93 B;  1N34 L;  1NCV A;  4YCU A;  2B2W C;  3A8K E;  4DR5 Q;  4F8M A;  1GUT A;  1H9S A;  1Y1V G;  3J7Y W;  2E2J B;  4EX5 A;  1STH A;  3OW7 A;  2A6E D;  1EIH A;  1ENC A;  2DJG C;  4DV7 L;  3J7A 5;  4MHE A;  3I4M G;  2F0K A;  1WYD A;  4PZ6 A;  4LFC Q;  3G6J B;  4KHZ A;  3SVM A;  2R61 A;  4OGQ C;  4X64 L;  1O7L A;  4ME5 A;  2F3I A;  2RSO A;  4NP5 A;  5L37 A;  4DNI A;  4ID6 A;  4G7Z C;  4POF A;  2B63 H;  3GQB A;  3MXP A;  5EPJ A;  1BR9 A;  5C3E G;  3TN2 A;  1QUQ B;  3M4Q A;  3TP8 A;  2RF4 A;  3X3M A;  2QIL A;  1C48 A;  1PTO B;  5DLQ E;  1FGU A;  3IKJ A;  3GTM B;  2EJG C;  1F2M A;  2WB1 E;  1KIX A;  4X65 Q;  4OX9 Q;  1XNQ L;  1EYC A;  4OHJ A;  4JI0 Q;  4JK1 C;  3GP7 A;  3VYR A;  1XJV A;  3BVZ A;  2I07 B;  4BY1 H;  1SN8 A;  3KF6 A;  5IE8 A;  3D6C A;  3OTO L;  1TT2 A;  1IZ6 A;  5I6Y A;  2MO0 A;  4DU9 A;  4QB4 A;  2VQE Q;  1I50 B;  1SNM A;  4GKJ L;  4X3S A;  1ASZ A;  1G51 A;  3RD4 A;  4QCL A;  5C4J H;  4QL5 A;  2RA4 A;  2RSN A;  3D6W A;  1KC8 C;  4LF5 Q;  3LWU A;  4BA2 I;  3S2H B;  2F1M A;  5C3W A;  1Y69 U;  2VZA A;  3RLF A;  2HIV A;  3PO3 G;  4GNX C;  4ZAI A;  3W3A A;  1S5D D;  3S1R B;  4P73 A;  1CKN B;  2EY5 A;  2E8G A;  2D0P A;  3IFD A;  4P75 A;  4JI1 L;  4HIK A;  4HIM A;  1SMX A;  4ULL A;  3CC7 A;  3GTQ B;  2YYZ A;  1PHJ A;  3A74 A;  1N33 Q;  1XTD A;  2LY7 A;  2IHE A;  2F0N A;  3J81 j;  5EKK A;  4OIJ A;  2K32 A;  3L0O A;  1U4M A;  1CTM A;  1SE2 A;  2ALY B;  3DWP A;  3RN5 A;  4DAP A;  3BZD B;  1PFN A;  1PFM A;  1E1O A;  4KKS A;  1JWM D;  2TMP A;  4WJ3 M;  2PZT A;  1LTR D;  5K5P A;  1SBB B;  1BDO A;  3MXG A;  5CBE E;  2X69 A;  1CKM A;  2IX3 A;  4DV4 L;  5BR8 Q;  1SSO A;  1WTV A;  2A19 A;  1V1Q A;  3PIO 3;  1W3S A;  4A3D B;  2XNA C;  1HQM C;  3U4V A;  1DOK A;  4DUY L;  4OO1 G;  2MQH A;  2E2D C;  2KBN A;  4QUF A;  4A3M H;  2JSO A;  4DR3 Q;  1KDA A;  4ALP A;  1VQM A;  4BBR H;  4V0B A;  4DV6 Q;  2WFW A;  4MIU A;  4O2D A;  1WOC A;  4RCN A;  1PZK D;  3PGZ A;  4NPS A;  3CQZ B;  5KYL A;  1PTO C;  1HA6 A;  3E5S A;  1OXV A;  1GD7 A;  3VR5 A;  1K8A C;  1TS4 A;  3LGJ A;  4AYB G;  1BBW A;  4KY7 A;  4HID A;  4KTA A;  2D62 A;  2B2T A;  1SRU A;  1G91 A;  3FKI H;  2ZJP A;  2C9O A;  4NXM L;  1SAP A;  1STE A;  3QOL A;  4IPC A;  1PZI D;  2B8F A;  1A15 A;  3HKS A;  3K5O A;  1V1P A;  5CC4 A;  1C7Y A; 
#chains in the Genus database with same CATH homology
 4X3U A;  4KD4 A;  3V05 A;  1EOT A;  4FP5 D;  1D5X C;  3T13 A;  5C0X H;  3VYU A;  4UAI A;  2Q8T A;  4XTC S;  4K2L A;  4M1U B;  1LTT D;  4FF4 A;  2EYJ A;  4XQQ A;  1WD0 A;  2GA4 B;  3TME A;  2MHV A;  4NKL A;  2XRS D;  4IUQ A;  1Y1W B;  4V19 0;  5JVH 3;  3A8I E;  2F0H A;  4FXD A;  1CI3 M;  4XT1 B;  1EY5 A;  1EY8 A;  1GUS A;  4ILW A;  1SNP A;  3H09 A;  5EPK A;  2AWO A;  2Z4H A;  1ET6 A;  2A74 C;  3NHH A;  3G7L A;  4FO2 A;  3LNN A;  5EQ0 A;  5I2Y A;  4OIK A;  2R93 B;  1F77 A;  2EXZ A;  4IUN A;  4XDX A;  1WTO A;  2B8G A;  3A7L A;  1Y1V B;  3MZ5 A;  5EGT A;  5DAU A;  4K6D A;  1T5X D;  2X6G A;  2LMC B;  2NVT B;  1F9R A;  5IOC A;  3MA2 B;  1II3 A;  2NBF A;  3K5L A;  3I4M B;  3ITP A;  3MWY W;  2CHB D;  1I3Q B;  2N88 A;  1LT5 D;  5C4Z A;  1V8Q A;  1LO5 D;  3NUC A;  3OPO A;  5C3E B;  3DWQ A;  4XYO A;  2KEE A;  2QDB A;  1B4O A;  1QNU A;  2KJX A;  4B9X A;  3J81 E;  1XXG A;  4M8A A;  2QEJ C;  2F0W A;  3KUP A;  3JAM E;  2I46 A;  1AZP A;  5CV5 A;  1MSG A;  1ONL A;  1BBX C;  1TY0 A;  5IGE A;  3NE5 B;  5CR3 A;  1RJT A;  3PUY A;  1IW7 D;  3SK6 A;  3VR4 A;  2EPB A;  3TP6 A;  1AW7 A;  2K05 A;  1WTQ A;  1EU3 A;  3PO3 B;  2EDG A;  1STG A;  2HUG A;  4XQN A;  3V96 A;  1WTX A;  1I4H A;  3P7J A;  1LT3 D;  1C8C A;  1IL8 A;  1AP0 A;  5D65 A;  3SE0 A;  1IYV A;  3P20 A;  1G2T A;  3MVV A;  2IX0 A;  3J80 E;  4BA1 I;  1TS2 A;  3TDQ A;  4BBS B;  4J1M A;  1ZYR C;  2BA1 A;  1QJO A;  1KDB A;  3R2I A;  3M7N A;  3NQT A;  4IUV A;  1A2T A;  1MGS A;  1SMY D;  4KY5 A;  2L9H A;  1JIC A;  4J6H A;  3S14 B;  1EIG A;  1S5B D;  1CQV A;  2F0O A;  1STY A;  4S3S A;  5FOB B;  1CQF A;  3S15 B;  1OXU A;  2IWH A;  4F7X A;  1B9N A;  2ENB A;  2F0V A;  5KNB A;  1ICW A;  3R93 A;  3DEO A;  1TY2 A;  2F3V A;  2YU9 B;  2L1B A;  3NP8 A;  3NTI A;  2IT1 A;  1I6H B;  1SYC A;  1BOS A;  2F0Q A;  3K7A B;  3AB9 A;  1I4Q A;  3OHX C;  4FF1 A;  3HOZ B;  4FYD A;  4X3T A;  4IUU A;  2EOT A;  3HGB A;  4L63 B;  2LKV A;  3OMG A;  5FLX E;  5KEE A;  4GZY C;  4IQZ A;  4BY7 B;  1NR4 A;  2XSC A;  1AN8 A;  2WKC A;  3ZYY X;  2HQE A;  4K5X A;  4RGM A;  1TQO A;  3FVQ A;  1JOK A;  3A54 A;  3K57 A;  1CA6 A;  2ZXR A;  1GHK A;  3DEP A;  1Y8N B;  2Q8R E;  4RKL A;  3WOF A;  1PRT B;  1V1O A;  4F87 A;  3L7Z C;  2EJF C;  3URY A;  1SEB D;  3T56 B;  4HR7 B;  5BN5 A;  2BE5 C;  3TBI B;  1RCV D;  4P2C B;  2JYO A;  3C3L A;  3R3O A;  1X3P A;  5C5L A;  1EY4 A;  5I4D A;  4PMC A;  3MXN A;  1DYQ A;  3VYT A;  4KV6 A;  2J0T D;  2PZW A;  3BS1 A;  1YNJ C;  5I9O A;  3VR6 A;  5C0X I;  2PMZ B;  1ILP A;  3GTK B;  2EYO A;  2WIN B;  5KYI A;  2PW7 A;  1SYB A;  4RKB A;  2BCO A;  1QNK A;  3H0G B;  1F9S A;  3K5N A;  1F9Q A;  1LV9 A;  2MPM A;  5DNF A;  2F0U A;  5COR A;  2K6A A;  2E2H B;  1STA A;  3H3V C;  2RDF A;  1QG7 A;  1SFO B;  4RHR A;  3GV6 A;  2Z4I A;  4QIW B;  1HXY D;  4EQP A;  1V1P B;  1LT6 D;  2K33 A;  1J9O A;  2VB2 X;  3BDO A;  1HRJ A;  1QWY A;  1Z7T A;  4IUR A;  4LMQ D;  4PV1 C;  2K5D A;  1PRT C;  3NPP A;  2X6L A;  1SXT A;  2NN6 H;  4B9W A;  1OXX K;  5IGD A;  2PYK A;  4EGV A;  3GTG B;  1HTL D;  5JPM C;  5M5X B;  2OXP A;  2ICI A;  5ISR A;  1NUC A;  2FHT A;  3NBH A;  2QKI C;  3OWF A;  1TR5 A;  3MEH A;  5CV7 A;  2K1B A;  4KN7 C;  1UAP A;  3NSW A;  2F0D A;  5M9O A;  1FNV A;  1JB3 A;  2EY6 A;  2Q8I B;  2VUM B;  4IFD J;  1KLU D;  3GTP B;  3N52 A;  4I65 A;  1B53 A;  1BQQ T;  2M9V A;  1B1Z A;  3QJY A;  5JEA G;  1AZQ A;  5G3L F;  1BXT A;  3IAY A;  3NTH A;  5HUR A;  1EQT A;  4HSV A;  1W6J A;  1BUV T;  1Q90 A;  3I3C A;  3FDT A;  3FRP B;  2N55 A;  4FXG C;  2K5Q A;  3KK7 A;  1PDQ A;  4L8J A;  1O80 A;  5D14 A;  2IPK D;  5KIX A;  3PIP 3;  5CMD A;  3BYT B;  3TSS A;  1FD7 D;  3K5M A;  5FO7 B;  3DMU A;  5CGK A;  3OSO A;  3CU7 A;  2PQE A;  3A8J E;  4K5W A;  1D1K A;  2G9H D;  2H4O A;  2AQ3 B;  5JAV A;  2MJ8 A;  3Q6S A;  5LL6 S;  1HFG A;  3RZD B;  2K01 A;  2L0C A;  3W2D A;  1UUP A;  4A3E B;  3KLS A;  1SYG A;  3AU7 A;  2B2U A;  5E1F A;  4FXK C;  1CM9 A;  1F9P A;  1CZW A;  3S17 B;  2JA8 B;  3N6R A;  4ABN A;  1PXU A;  2F0M A;  2DNE A;  5EKI A;  1S5F D;  1ENF A;  1LTB D;  1KTK A;  2JE6 I;  2E74 C;  2L5T A;  3BDL A;  4KJN A;  3VA7 A;  1ROD A;  2B2Y A;  3VYS A;  5D3I B;  4FNF A;  4A3I B;  1BCP B;  1PMR A;  2RKS A;  3HOW B;  2NUC A;  1DCZ A;  2VXW A;  5ELB A;  5BN4 A;  1YNN C;  1FGB D;  3BVM A;  3L3O C;  2XRQ D;  1HUN A;  4A3B B;  4OO1 H;  3QOJ A;  3HOU B;  1O7Y A;  1S5E D;  3D4R A;  3D4D A;  2K03 A;  5F2D A;  1I4G A;  4TKO B;  2RDG A;  4KKT A;  1MSH A;  1DM0 B;  5CV9 A;  4ZUI A;  4K8J A;  5J22 A;  2K28 A;  1Y8O B;  4LJZ C;  2VB3 X;  4ZRZ A;  3OOC A;  1PTO F;  4B08 A;  2XIW A;  1U9R A;  4CKB A;  1EYA A;  1W6K A;  2CQA A;  4WJW A;  3NXW A;  3I4N B;  3I4L A;  4HTH A;  3T16 A;  4TQU S;  1A3T A;  4KKU A;  3ND8 A;  5C0X G;  2PCF B;  1TWF B;  2PNR C;  3HOV B;  3S1N B;  3HOX B;  1D1I A;  4ZQ3 A;  5LL6 X;  2IW3 A;  3M7G A;  5KRU A;  1CHQ D;  4Q5V A;  4HN7 A;  4DAY A;  4C1N K;  1BCP C;  1K8M A;  3I72 A;  3FPP A;  4NMZ A;  3S1Q B;  5JVG 3;  4CGY B;  4G4K A;  2CW0 D;  2XWB B;  2NYZ D;  5CV6 A;  1SE3 A;  3I8Z A;  1G8Z D;  4H44 C;  1I6V C;  2OT2 A;  2WAC A;  1ESF A;  2HDL A;  1M8A A;  1TU2 B;  2F0G A;  1EZ8 A;  5D3D A;  1SNQ A;  2O4X A;  2E76 C;  3BVG A;  3C1E A;  1TS3 A;  4CJ0 B;  2F4I A;  1E0B A;  2FMC A;  4FF2 A;  2WB1 B;  5C3X A;  1U4L A;  5T1G A;  2EY1 A;  2NN6 I;  3Q0A A;  1Z47 A;  1KNA A;  1EZ6 A;  3BYY B;  4U68 A;  1E2Z A;  5I2X A;  2KA7 A;  3P1H A;  1EYD A;  1TVX A;  1LAC A;  3GTJ B;  1RF2 D;  2BA0 A;  1K83 B;  4DK0 A;  3C2P A;  5C4H A;  1STB A;  1QB5 D;  4ZLT F;  4XYQ A;  1H9K A;  3DXJ C;  1EL0 A;  3L9A X;  1SE4 A;  2IJ0 A;  5CYU A;  2A68 C;  3VA5 A;  2F0P A;  2F3W A;  2E75 C;  2R6G A;  2HDM A;  4BY1 B;  1VF5 C;  4RWS C;  1IYU A;  1SYF A;  2ID0 A;  2SOB A;  2EYL A;  3QIA A;  2KUM A;  1BNZ A;  5C4J B;  1STN A;  1TKW B;  3KLS X;  1B44 D;  1FR3 A;  3RZO B;  3FPU B;  1LTG D;  3QB3 A;  1HQR D;  1PFB A;  4J8Q A;  1CFM A;  3I70 A;  3VR2 A;  1SDF A;  3T4A C;  3K58 A;  4A3G B;  2R92 B;  1ESR A;  4DXG A;  4ODG A;  1I4P A;  1SMY C;  2A6H C;  4H0L C;  2EYH A;  3CHB D;  1H9S B;  1QOH A;  5IT9 L;  5NUC A;  2MGS A;  1Q12 A;  2JXM B;  3P75 A;  5JOB A;  1LLR D;  4KY6 A;  5I9P A;  1ZYR D;  5J39 A;  3NK9 A;  4DAV A;  1Q1E A;  1Y8P B;  2ZT9 C;  1JE4 A;  4JBW A;  3HEJ A;  5ELE A;  2DNC A;  5A35 A;  2B2V C;  5IGC A;  4C56 C;  2NTT A;  1JOQ A;  5CV8 A;  3WDN A;  4IFD H;  1JCK B;  2AUJ D;  2AQ2 B;  2KHS A;  1PTO H;  3NBI A;  3OWE B;  1RD9 D;  4IUP A;  3HG9 A;  2PZU A;  3HRZ C;  1B3A A;  3DUZ A;  3FKI B;  1CA5 A;  4G57 A;  1OO9 B;  1S5C D;  2DY8 A;  2F0I A;  2A73 B;  2F0S A;  1G2S A;  1J8I A;  2JEB I;  4K2K A;  3U9O A;  2KEC A;  1HPC A;  4O1N A;  3PMF A;  4OL7 A;  5IGB A;  4KI0 A;  1ENA A;  3I90 A;  5C5M A;  2D9U A;  1JOO A;  2A69 D;  1CZG A;  1KAB A;  1QCB D;  4KJO A;  2F0T A;  2AUK A;  3OIP A;  3D31 A;  5ELD A;  1JWS D;  5K36 G;  5DM6 3;  2ZXO A;  2A5H A;  4XIG S;  3AMU A;  4BWG B;  3SHL A;  4PMB A;  3H94 A;  1JC7 A;  1KLG D;  5COY A;  4C1N I;  4R8I A;  1TS5 A;  3TZU A;  1WD1 A;  4QUC A;  1EY7 A;  2J7Z A;  1Q1B A;  1XTC D;  3IFT A;  2PPB C;  1KNE A;  1TWA B;  2SDF A;  4HED A;  2NVY B;  4RCO A;  2AWN A;  5AFW A;  1VDZ A;  2L4N A;  3CRK C;  2C5C A;  2NB0 A;  1DXM A;  5IIF A;  2RBM A;  4HMI A;  1EU4 A;  5C6A A;  4E6I A;  3DHQ A;  3DM1 A;  1SJH D;  3FMC A;  4Z9C B;  3ERO A;  3A7A B;  4A3K B;  2KOL A;  1YNJ D;  2J4X A;  1LTS D;  2NZ1 D;  5KGU A;  1NR2 A;  1H9J A;  2DY7 A;  1WTW A;  5EJW A;  3EA6 A;  4CJ2 C;  2L55 A;  1IHZ A;  2ZXP A;  1CT1 D;  3TP5 A;  1HFN A;  4RAU C;  3D4W A;  2RVL A;  3X3N A;  4XQJ A;  3K59 A;  1QE6 A;  3SK5 A;  4DNR B;  2O2L D;  1S4Z A;  4PQX A;  1LTI D;  4HCE A;  1H9R A;  3J7A F;  1GHJ A;  3ND9 A;  4IZ8 A;  5FK9 C;  4CJ1 B;  4EQN A;  2B39 A;  1PRT F;  1PRT D;  1D6E C;  3KLR A;  1FNW A;  1DJR D;  3HS0 C;  1JOR A;  2KQ3 A;  3PO2 B;  1HCZ A;  5HGT A;  5E4W C;  2D2C C;  3M4Y A;  1LT4 D;  2A6E C;  5EBD A;  1DON A;  5G3L D;  1T5E A;  3H91 A;  2SNM A;  2PW5 A;  4HSP A;  2BOS A;  5JEA H;  1K8O A;  3SK4 A;  2EYM A;  1C4Q A;  4HMJ A;  4PMW A;  2B2T C;  1IKL A;  1ML0 D;  3EFX D;  3DWA A;  3GD7 A;  5I6W A;  1GUG A;  1LAB A;  3GTL B;  5A2Q E;  3QG1 A;  2IX1 A;  1KDC A;  4IN3 A;  1SYE A;  2R7Z B;  1TWG B;  2SEB D;  1XYI A;  4C3I G;  3F2U A;  2JEA I;  4L6T B;  2JP1 A;  2EYF A;  2RQX A;  4FVM A;  3S16 B;  1HA5 A;  2K7V A;  2D5D A;  4KMU C;  2EJM A;  1GUO A;  4CHT B;  1BF4 A;  5IGF A;  1RKN A;  5A2Q L;  4CKC A;  4C3H B;  4U67 3;  4H7B A;  3H6M A;  1PZJ D;  4DGZ A;  4KK7 A;  3A55 A;  5T1I A;  1F2L A;  3WOE A;  4IFD I;  3R8B A;  1DD2 A;  3KF8 A;  3Q24 A;  1FNU A;  4K6L A;  1E2W A;  4R8N A;  5IGG A;  2MP1 A;  5C4X B;  1KAA A;  1I4X A;  2TSS A;  5CBA E;  2EVB A;  1F2Y A;  1EWH A;  1V43 A;  4I7Z C;  2KED A;  3BDC A;  1EY6 A;  3T51 B;  1WTR A;  1HUM A;  3C1F A;  5KND A;  2B2W A;  3S2D B;  3OIQ A;  3E0J A;  1GUN A;  1M4V A;  1HHV A;  1B50 A;  1YNN D;  2Z8L A;  1TWC B;  1R4Q B;  3RUZ A;  2NVX B;  4RHS A;  1AEX A;  2RDH A;  3CKI B;  1XWE A;  4Y7N B;  4EQO A;  2WII B;  3OMC A;  2IL8 A;  1EQV A;  1PTO D;  4C3J G;  3S9W A;  3GTO B;  2CVR A;  1SYD A;  3C46 A;  1TWH B;  1RTN A;  2BDO A;  2SNS A;  3TZD A;  3D3R A;  4N9T A;  2H1E A;  2M2L A;  3I73 A;  3I91 A;  1R4P B;  1RHP A;  5JEA J;  1A3U A;  2EZV A;  4A3F B;  1QIL A;  1MI2 A;  4KHV A;  1VMP A;  1PLF A;  1FYC A;  4WOR A;  4XT3 B;  3M3Y B;  4IAL A;  2NVQ B;  2CW0 C;  1GJX A;  1DZ1 A;  3EQL C;  1JQY D;  3K0Y A;  1ZXT A;  3FEW X;  2WP8 J;  3PV0 A;  4G7O C;  5FO8 B;  1OXT A;  2R3Z A;  4UDU C;  1BCP F;  2K04 A;  1BCP D;  1OXS C;  3MAQ A;  1EFI D;  1SJE D;  2BDN A;  3KBG A;  2K5W A;  1O7Z A;  1Z6H A;  3PUW A;  4KD3 A;  5J1Z A;  1MD2 D;  2EY2 A;  2L12 A;  4DXF A;  5M5Y B;  1X32 A;  3NTK A;  2LS0 1;  3MHB A;  3M85 A;  4R9W A;  2Z1C A;  5KNC A;  1NSN S;  3M4O B;  3Q22 A;  3EVQ A;  2B63 B;  4NDX A;  5ELF A;  1GUW A;  1L0Y B;  1O78 A;  5EBC A;  4RGN A;  4LAA A;  1EWC A;  2M00 A;  1PYW D;  4K5V A;  3PUX A;  2OEO A;  4K8I A;  4K14 A;  1IW7 C;  4C3I B;  1WVL A;  2Y0S B;  2QCP X;  5JPN C;  1D5M C;  3TP7 A;  3VR3 A;  4ZK9 B;  3KBX A;  1R9T B;  2VNU D;  3QO2 A;  3SR1 A;  5IT9 E;  3ONA B;  3NWS A;  1I4R A;  4ZYS A;  2FFK B;  4QF4 A;  3MXU A;  1BO0 A;  4BS9 A;  2EE1 A;  2A68 D;  1E2V A;  1VF7 A;  3Q23 A;  1X3Q A;  2O5I C;  4RFB A;  3QWN A;  2F0L A;  1EY9 A;  2WKD A;  4O42 A;  3HZX A;  4HCS A;  3A56 A;  4F88 A;  4CKE A;  3J81 L;  5M3M B;  5ELC A;  5DM7 3;  2FIN B;  1B2T A;  3JAM L;  2KVM A;  4RH6 A;  2EYP A;  5CV4 A;  1CK1 A;  1A3V A;  1B9M A;  2V4D A;  1A6X A;  1SND A;  3T53 B;  3MC0 B;  1JWU D;  3SK8 A;  3CRL C;  2A6H D;  2G9D A;  4A3M B;  4BBR B;  5C0X J;  1WTP A;  3V2T A;  2WAQ B;  1UEA B;  4PNY A;  4TSS A;  1DOM A;  3D8G A;  4IUT A;  3GV3 A;  1HTP A;  4EVO A;  1RTO A;  3EJI A;  3SDZ A;  3MFG A;  1EY0 A;  4IFD G;  3J80 L;  2XN9 C;  4C3J B;  4C2M B;  4AYB B;  3NQI A;  3BG3 A;  2HCI A;  1ZKO A;  2XWJ B;  3S1M B;  1UNS A;  2F0E A;  5TSS A;  2L11 A;  5M5W B;  2E2I B;  1CHP D;  4WRD A;  4Q0F A;  4A3J B;  4LK1 C;  5LHY 1;  1MBY A;  2A69 C;  4DF7 A;  1JR0 D;  1XX8 A;  2JA6 B;  1Q3L A;  4X3K A;  4OO1 I;  1TII D;  2WV6 D;  2FMM A;  4C3H G;  4DFA A;  2NWG A;  4QMG A;  1G6Z A;  4N9P A;  3RMH A;  4CBV A;  2F0J A;  4RA8 A;  1F2Z A;  4NW2 A;  3LX0 A;  3HKZ B;  3MTS A;  4DA2 A;  5FLX L;  1D5Z C;  5EKL A;  1H9M A;  5K36 H;  1DOL A;  2QF7 A;  1EEF D;  1L0X B;  2LFN A;  5E4X A;  1U4R A;  2BE5 D;  2HCC A;  4DK1 A;  2MUY A;  2ICE C;  5E3F A;  1NAP A;  2PO4 A;  2OF1 A;  2XVS A;  2KCN A;  5FO9 B;  1G29 1;  4RGT A;  3E6Z X;  4H13 C;  3SEB A;  3ERQ A;  3MFY A;  1VMC A;  1SNC A;  3PUV A;  4WFN 3;  5IOD A;  3O13 A;  1D2B A;  3R2T A;  1LTA D;  1U4P A;  2DN8 A;  5EPL A;  4DN4 M;  3NWT A;  1Q8I A;  2KCC A;  3UI2 A;  3PUZ A;  2FJ2 A;  5DEH A;  2AQ1 B;  2B2U C;  5JJZ A;  3GO5 A;  1A2U A;  1GXD C;  3HOY B;  2B2V A;  3U9S A;  1WCM B;  1VCI A;  4G7H C;  2NN6 G;  1ZEQ X;  4ZKC B;  1IKM A;  4ZUJ A;  5M3F B;  4HAE A;  5FKA C;  3SXH A;  3IL8 A;  4KN4 C;  4YIJ A;  5C44 B;  5BN3 A;  2B2Y C;  2F03 A;  4XXE A;  1ILQ A;  4RGO S;  4TRD A;  4FF3 A;  3HP3 A;  2JA7 B;  3K6O A;  1GOZ A;  1SNO A;  1AFP A;  4DNT B;  2NTS A;  1EEI D;  2O5J C;  4MN3 A;  3LWE A;  1ET9 A;  3J7A V;  2F0F A;  4ZKB B;  2JA5 B;  1RDP D;  4A93 B;  1NCV A;  2B2W C;  3A8K E;  4F8M A;  1GUT A;  1H9S A;  3J7Y W;  2E2J B;  1STH A;  3OW7 A;  2A6E D;  1EIH A;  1ENC A;  4MHE A;  2F0K A;  3G6J B;  4KHZ A;  3SVM A;  2R61 A;  4OGQ C;  1O7L A;  4ME5 A;  2RSO A;  4NP5 A;  4ID6 A;  4G7Z C;  3GQB A;  3MXP A;  5EPJ A;  1BR9 A;  3TN2 A;  3TP8 A;  3X3M A;  2QIL A;  1C48 A;  1PTO B;  3IKJ A;  3GTM B;  2EJG C;  1F2M A;  1EYC A;  4OHJ A;  4JK1 C;  3VYR A;  3GP7 A;  3BVZ A;  2I07 B;  3D6C A;  1TT2 A;  5I6Y A;  4DU9 A;  4QB4 A;  1I50 B;  1SNM A;  4X3S A;  3RD4 A;  4QCL A;  2RA4 A;  2RSN A;  3D6W A;  4BA2 I;  3LWU A;  3S2H B;  2F1M A;  5C3W A;  1Y69 U;  3RLF A;  4ZAI A;  3W3A A;  1S5D D;  3S1R B;  2EY5 A;  3IFD A;  4ULL A;  3GTQ B;  2YYZ A;  2LY7 A;  2F0N A;  5EKK A;  4OIJ A;  2K32 A;  1U4M A;  1CTM A;  1SE2 A;  3DWP A;  4DAP A;  3BZD B;  1PFN A;  1PFM A;  4KKS A;  1JWM D;  2TMP A;  2PZT A;  1LTR D;  5K5P A;  1SBB B;  1BDO A;  3MXG A;  5CBE E;  2X69 A;  2IX3 A;  1SSO A;  1WTV A;  3PIO 3;  4A3D B;  2XNA C;  1HQM C;  1DOK A;  4OO1 G;  2E2D C;  4QUF A;  2JSO A;  1KDA A;  4V0B A;  4MIU A;  4RCN A;  1PZK D;  3CQZ B;  5KYL A;  1PTO C;  1HA6 A;  3E5S A;  1OXV A;  3VR5 A;  1TS4 A;  4KY7 A;  4KTA A;  2D62 A;  2B2T A;  1G91 A;  2C9O A;  1SAP A;  1STE A;  3QOL A;  1PZI D;  2B8F A;  1A15 A;  3K5O A;  5CC4 A;  1V1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...