4FP5D

Heat-labile enterotoxin ilt-iibb5 s74a mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
98
structure length
98
Chain Sequence
GASQFFKDNCNRTTASLVEGVELTKYISDINNNTDGMYVVSSTGGVWRISRAKDYPDNVMTAEMRKIAMAAVLAGMRVNMCASPASSPNVIWAIELEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Heat-labile enterotoxin IIB, B chain
publication title Structure-activity correlations of variant forms of the B pentamer of Escherichia coli type II heat-labile enterotoxin LT-IIb with Toll-like receptor 2 binding.
pubmed doi rcsb
source organism Escherichia coli
total genus 24
structure length 98
sequence length 98
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2012-06-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.50 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4fp5D00
1TIID 5G3LD 5G3LF 4FP5D 4FO2A 4FNFA 1QCBD 1QB5D
chains in the Genus database with same CATH superfamily
4A3EG 1T9HA 1N32L 5CV4A 3S1QH 1GUOA 1UE1A 5FO9B 1IKMA 3NUCA 2C5CA 1WTXA 3ONAB 4UHVA 3G6EA 2KQ3A 2D62A 3PUVA 5JOBA 1GUSA 3MEHA 2UUBQ 4K0KL 3I2ZA 3D8GA 1C8CA 1LTBD 2AHOB 2FMCA 2VNUD 1YNJC 2A6HD 2JA6H 1S40A 4IUUA 4LF9Q 1DGSA 1JE4A 3VYSA 3NBIA 1G51A 4DR7Q 2FHTA 4XDXA 1WTRA 1N8RC 2K5VA 5K5PA 5C3EG 1WCMH 2VQEQ 4B3MQ 5LL6S 1XPRA 4BXXH 2QW7A 3I4LA 2UUBL 3RD4A 5FLXL 2C9OA 1YITA 1BKBA 5GAGC 1VQ5A 4P74A 5CR3A 2IL8A 2LMCB 4C1NI 3LWUA 2B3GA 2A6ED 4LF9L 2R7ZH 1VQDA 4L5QA 4DR7L 2JEBI 3E9IA 4FNFA 1KRTA 2LXKA 1ENAA 3A8JE 1FGUA 2IJ0A 1AE3A 2OQKA 3M3YH 3J80L 3TREA 4B3ML 5COYA 4C3HB 4YWLA 2VB3X 3EROA 1XMOQ 1WTHA 1B8AA 1H9MA 1M1KC 5T1IA 3HOYH 3C3LA 4B3SQ 4RGNA 2QEXA 1BQQT 2ZXRA 4NDXA 4CJ0B 3TMEA 4K5VA 4P73A 4IUTA 2EY5A 1HUNA 3HG9A 2PO4A 1A0IA 1RDPD 2YV5A 4IO9A 1B7YB 1X6OA 3DM1A 3GTJH 1Q82C 3CW2C 4JV5L 3QO2A 1WTWA 1D6EC 1M8AA 4ALPA 1XMOL 2RHQB 4PMWA 2PZUA 4IALA 3DEPA 4JPBW 3C1FA 4A3EH 4X3KA 5I9OA 4B3SL 2L12A 1QG7A 1K28A 1STNA 4B08A 5EAYA 4A3FB 1I6HH 1L0WA 1FVIA 3I4NG 4I7AA 1PDQA 3TP5A 1SJED 4WJWA 4A3JH 1SE3A 4OX9L 3R2IA 3MXNB 3HOWB 3QOJA 4A3KH 2O5IC 5ELDA 4HIDA 2L15A 2L5TA 3CD6A 1X9NA 5C3EH 5CORA 1VQHA 4DK1A 1NMFA 1PFSA 4DV3Q 2AKWB 3M4QA 4ILWA 5FO8B 2OT2A 4JCVE 1BXTA 1TS4A 1VQEA 1NUCA 5IYCG 3T13A 3DM3A 5AFWA 1W2BA 1NMGA 2EJFC 2FJ2A 3O13A 4GN5A 1LT5D 4X65Q 4KY6A 5I2YA 4OELB 3KOJA 2CW0C 3GV3A 1LTSD 2ZTCA 3CQZB 4QY7A 1IW7C 3CRLC 3QG1A 1NR4A 5D3DA 1Z6HA 4IJHA 4BY1G 3KF8A 4DV3L 3F2BA 1QZGA 3PO3H 1FYCA 1PH9A 2L1BA 5EBCA 1K0RA 4QCLA 1EUJA 2A74C 1WVLA 1XXGA 2H4OA 1WCMB 1HH2P 1KQSA 1FNVA 4TKOB 2E75C 1GUTA 1VQCA 2BH8A 4GS3A 3B6YA 4OO1G 3U9SA 1EY8A 3MAQA 1C4QA 3A5ZB 2KCMA 4XQNA 5ELBA 1PLFA 1E1TA 4OGQC 1Y1VG 4HIMA 4A3IG 4DKAC 2JA7B 2OF1A 5HY6A 2CWAA 1TXYA 5IP9G 2F4IA 4U673 3WWVA 1SSOA 4KY5A 3HOXB 2F0OA 2M9VA 3BJUA 4CDEC 2F0IA 5ELFA 5FLMG 2CVRA 3PUXA 2PMZB 2NZ1D 4IN3A 4DR6Q 1E24A 1I50B 3R2TA 1SYEA 4C3IG 4XT3B 2K75A 1I4RA 1VF5C 1TR5A 1VDZA 1B44D 3GTJB 3BZKA 2KECA 4C2MB 2A69C 2SNMA 3KDFB 1RHPA 4HCSA 4IPHA 4TVAB 2UXDQ 2B8GA 4K8JA 1PA6A 3OTOQ 1OXVA 1TS5A 3RLFA 1SNPA 3HFZB 4A3DG 2GVAA 5IYCH 1B50A 1MSGA 3NHHA 4LUZA 2K28A 4LFCQ 3S15B 1EQQA 3Q24A 1WTOA 3NBHB 3CPFA 3E0JA 3S14H 2PW5A 1LTID 4R4OA 2UXDL 5E1FA 4RKLA 1VMPA 4BY1H 5BN5A 3OTOL 5FJ8G 1F9PA 4A3MG 5HGTA 5M3FG 1L1OA 5KRUA 2RQXA 4V190 4RWSC 3VR2A 1N36L 3X3NA 3S1NH 4G57A 1EOVA 4LFCL 4GLVB 1RTNA 3BZCA 4YHHQ 1VQKA 1U4PA 5E7NA 4P75A 2I46A 4IFDI 1QNKA 1CSPA 3Q0AA 1K8GA 3BDCA 1VMCA 3CP0A 2B63H 2IPKD 1Q12A 3M9BA 4OO1H 4TRDA 2KHJA 2OEOA 3HOZH 1K3RA 4JI5Q 5KYLA 4DV7Q 4XQQA 5ELEA 2F0JA 5HURA 2K1BA 3CCLA 1O80A 4KN7C 2RHSB 5IOCA 2EY2A 1UE6A 3CHBD 5ELOA 2FFKB 2I07B 3T1HQ 3WOFA 4DU9A 1SAPA 1IXRA 3GTKB 3R8BA 4A3IH 4JI3Q 4YHHL 4RA8A 2JE6I 2RSNA 1CHQD 1PFNA 1KNEA 5C0XI 3OPOA 4PZ8A 1I4HA 3VYUA 1YHAA 1F9RA 1F9QA 5IP9H 4IFDJ 1UE7A 4JI8Q 3C1EA 3MA2B 1UNSA 4J1MA 4XQJA 1Q3LA 4XT1B 4DV7L 1CA6A 3RZOH 1C9OA 3EFXD 2P5ZX 5ELNA 3J81L 4C3IH 1E22A 1S3OA 2F0SA 5CV6A 2R7FA 2WKCA 3GD7A 3T1HL 2F3IA 3HOVB 1X65A 5M5XH 4FF2A 5BN3A 4GKJQ 2AMCB 2K5NA 4JI3L 1PZID 2K14A 4RGMA 2VQFQ 4LW1A 1O7IA 4O0AA 4APVA 1VQIA 3EBEA 4I65A 4A3GG 3PUZA 4JI8L 4AYBE 5M5WB 1EYGA 2VL6A 3PO2G 2AUKA 3JAML 1X3FA 2YTXA 4A3DH 2EQSA 1HCZA 2F0KA 4GOPB 1N33L 4G7ZC 4RCOA 3I4NB 1HRJA 2ASBA 2O5JC 1O7YA 2PZWA 2RVLA 1Z9FA 3M4PA 4GKJL 4LFBQ 1LTAD 1TS2A 1ESRA 1CQVA 2VQFL 3GTLH 4HR7B 4X3SA 2JK8A 2F52A 4KMUC 2Z6KA 5E4XA 1Q7YC 2F0NA 2K03A 1EEID 4A93B 4DNTB 1PH6A 3SXHA 2HT1A 4H7BA 5M3FH 3DUZA 1U4LA 3ND9A 3D0FA 4R4QA 1H9SB 1TS3A 3STBD 1HNXQ 1GD7A 2AQ1B 1SJHD 5GADC 1EIYB 4GNXB 2AWNA 2JP1A 4LFBL 1JR0D 4ME3A 4DXGA 1A3TA 2ZT9C 1BCPC 1HJPA 4N9TA 4RG1A 5CV7A 2UXBQ 3H0GB 4LF8Q 5JJIA 3HRZC 1EU3A 1J5EQ 4KTAA 3FKIG 3A8IE 1PH5A 3OHXC 1HTPA 2XGTA 5M5YH 3K5MA 3NTKA 5JEAJ 2TMPA 3CXCA 1HNXL 1Q86C 3HOWG 1AN8A 4RKBA 2A19A 3PIPA 1V1OA 1QUQB 5L37A 3FEWX 3OMCA 2UXBL 4LF8L 3PQIA 1VQBA 2MQHA 3SK4A 1PH2A 2LKVA 2YTVA 1J5EL 5FLXc 1JWSD 5AJ3Q 1KRSA 1TKWB 1PVOA 4LF5Q 3HOUB 4HCEA 3M7GA 3PGZA 1TT2A 3M4OB 1HNWQ 1A2UA 4JI4Q 1MD2D 1Q46A 3A54A 2NVXB 1ENFA 5FO7B 2IW3A 2A8VA 3J80c 1SROA 2Q8TA 3L7ZC 4ZKBB 1Y1VB 3W5OA 3GDEA 4LF7Q 3PF5A 1A8VA 3MZ5A 3K5OA 2Z6KC 4QJFA 5AJ3L 4KN4C 4C3HH 2X6LA 3SK8A 1FJGQ 2A5HA 2F4VQ 4LF5L 2F03A 1CKOA 1IYJB 3EJIA 5D3IB 1YZ6A 1JORA 1BBXC 1WTPA 4K14A 4E6IA 1TVXA 3KF6B 1EWHA 3EA6A 2RDHA 4JBJA 2K6AA 4MTNA 4AIMA 4DA2A 4TSSA 2KUMA 4RHSA 3PIOA 4WORA 1OXSC 2Q8RE 1TU2B 2D5DA 1CZGA 2WKDA 2QCPX 5IYBG 4DAVA 3R3OA 2QF7A 1FJGL 1EYDA 2F4VL 4HJ9A 2IHEA 3IKJA 3VYRA 5K36G 3A5UA 2O2LD 1CQFA 1OXTA 2KJXA 3IL8A 4KHVA 3WOEA 5C5MA 5IGEA 2C35B 3VYTA 1QB5D 4A3FH 3VDYA 3VA5A 1HNZQ 5DM73 1Y8PB 1YNJD 2K04A 4X3TA 4HSPA 4LWCA 3HOXG 2E2JB 4LF6Q 4KKUA 4EGVA 3DWAA 4A4IA 2E74C 1H9RA 5KNCA 1Y1WB 2UXCQ 4KJOA 1QVGA 4DV6Q 1SMYC 5E4WC 4PG3A 2ATWA 2F0MA 4A76A 1IYUA 3S24A 4POFA 3CCQA 4A3MB 1ENCA 3HOWH 2K5QA 1IL8A 2K5DA 4DV0Q 4DV1Q 3FVQA 2Z8LA 2R3ZA 1X54A 5EGTA 1HNZL 3R93A 4KJNA 1WD0A 1EY0A 5CBEE 3BYTB 1O7ZA 4FXKC 1XPOA 5I6WA 4LF6L 3E9HA 4CBVA 3W3AA 2F0PA 2UXCL 4IPGA 2VUMG 3S2DB 4DV6L 2YU9B 5C4XB 1BOSA 1YHBA 4QUFA 4LFAQ 2E2HB 2G5DA 1S5BD 3BU2A 1VQNA 2CHBD 4DV0L 5C3XA 2NUCA 4Q5VA 5M5YB 1X3PA 3CQZH 4CKEA 4DV1L 1VF7A 1ZKOA 2JJQA 3AQQA 1GHKA 2IHFA 3TP7A 1J8IA 1A3UA 1PRTF 4XTCS 1I4QA 2K52A 2I5LX 1VQ9A 4PMCA 3CCVA 1DM0B 1BCPF 1DOLA 1FGBD 3VA7A 1S72A 1EZ8A 2SOBA 4LFAL 2XWBB 1EIGA 4LUOA 4IFDG 3KK7A 4P2CB 4B3RQ 1O78A 1JJ2A 4X3UA 1H95A 1STAA 4UPAA 5A2QL 3SK6A 1D5XC 1GKHA 1RF2D 4DNIA 4WJ4A 4PNYA 4FF4A 1T5EA 4YIJA 1QWYA 3NTHA 2N78A 1ZEQX 3IFDA 5IYBH 4DR2Q 5JPNC 2PQEA 4A3GB 1ASZA 1K9MC 4R8NA 2V4DA 5IYDG 2VZAA 1VQ6A 1SYFA 3G7LA 1WI5A 3E3XA 3PO2B 1W6KA 1EIHA 2ZXOA 5K36H 2O4XA 2UUAQ 1PH8A 4X64Q 4A3BG 5C0XG 4O1NA 4B3RL 2EY1A 4OWXB 4JV5Q 4DN4M 2JA7H 1HA6A 4H02A 1PTOC 2WV6D 2KEDA 5EPJA 2K4KA 5IP7G 1U0LA 5DNFA 3HOXH 1KL9A 3MVVA 1LABA 1S5ED 4JBWA 5IIFA 4HJAA 4OEMB 4DR2L 3CC2A 1I50H 1S4ZA 5DLQE 4N8X1 2D2CC 2B2WA 4J6HA 3DMUA 4K5WA 5JJKA 3T4AC 2OQ0A 4HSVA 2F0QA 3NWTA 2HIXA 2UUAL 4X64L 1I6VC 4GLXA 3HOVG 4HMIA 1LLRD 1EY9A 3I4MG 4JBKA 1JB3A 4OX9Q 4C2MH 3I70A 1AH9A 1K83B 1VQAA 1J6QA 4CJ1B 2ZM6Q 4GN4B 5JAVA 1VCIA 2UU9Q 1NJIC 3P20A 2XSCA 1H9JA 1IBLQ 1JE5A 1JOOA 4QMGA 3CKIB 4BS9A 1V1QA 4UAIA 5M3MB 3CMAA 2CW0D 1HPCA 3CMEA 4F88A 3K7UC 1ILQA 1IW7D 3S15H 2CQAA 1XTCD 1K3BC 4MHEA 2KVMA 3FKIB 4HTHA 1CUKA 2EY6A 2BOSA 3HGBA 3KFUA 1SYCA 3J7AV 4H13C 2PMZE 5IGBA 3E5SA 3PUYA 2PI2E 2ZM6L 3A55A 1B2TA 2F3WA 1TWCB 2UU9L 1MJEA 1IBLL 3GTMH 2EYFA 2L11A 4A93G 3PV0A 5JEAG 3OWEB 4XYQA 2ID0A 3NQTA 2SDFA 2Y0SG 5GAEC 1DYQA 2A1AA 2FMMA 2PPBC 2XRSD 5G3LF 3TS2A 3D4DA 4QIWE 1WTVA 2NVQB 4C1NK 4IFDH 3LX0A 1PFBA 3X3MA 4DR4Q 2XVSA 1SFOB 2EXZA 1UAPA 1I3QB 1BDOA 5D14A 1LT4D 3P7JA 4DNRB 3FHWA 3HP3A 4GKKQ 3BVMA 3H0GG 1A3VA 2F1MA 5CV5A 3EQLC 1HFGA 2JN4A 3UDXA 2MFIA 4R1JA 4FF1A 4B9XA 3V2TA 1K73C 1E2WA 1EYCA 1F2MA 1QVCA 1VQ7A 1XPUA 4IUQA 3H3VC 1VQMA 4IOCA 2B2WC 4A3BH 3K59A 1CKNA 2BA0A 3K57A 1JWMD 3GTKH 3LGJA 4CGYB 3CCEA 2NBFA 2Z4HA 4DR4L 4BWGB 5EBDA 1AZPA 5CV9A 5IP7H 2PW7A 2F0GA 3U50C 4GKKL 4A3LG 1SE2A 5IT9E 3J81c 3VR4A 2JA9A 1IKLA 4ULLA 4IZ8A 5FKAC 3UDFA 2A69D 3J80i 2K50A 3TP6A 1PFMA 3HOUG 1O7LA 3HOVH 4DAYA 3J81j 2EYJA 4M1UB 2E8GA 2PQAB 1OTCA 3PSIA 4BY7B 5FOBB 1EIFA 3JAMc 1SNOA 4IUPA 4FDBA 2QGQA 5M5WH 1X55A 1KDBA 4C3JG 1KABA 1LV9A 1Y14B 1RJTA 2AQ2B 1EY5A 2HQLA 1HZ9A 3LWEA 3I4NH 1LM0A 3OWFA 2XTIA 4ZCKA 1MIUA 1B3AA 1AP0A 1G2TA 5J39A 1C7YA 1AFPA 1KC8C 4L5SA 1NY4A 4MIUA 4NKLA 4YWMA 4R4IA 3L9AX 1TWGB 3AEVA 1U5KA 3GV6A 1V8QA 3FDTA 2F0EA 1S5DD 5CV8A 1RKNA 4A93H 4FXDA 2ENBA 2B2VA 1FR3A 5JEAH 4DGZA 1PTOF 1JQYD 2X69A 3OOCA 4QIWB 1XTDA 3KYHC 4RH6A 1F2ZA 4KLKA 3G71A 2F3VA 1DONA 2VW9A 4CKBA 5DM63 1X56A 5EKIA 1JMCA 1GJXA 5IGDA 4QQBX 4ZYSA 4BA2I 2RCFA 3GTPB 3PF4A 4K2KA 2R93G 1Q1BA 2VUMB 4RMFA 2GN5A 1N36Q 3ER0A 4J15A 1MBYA 4LUVA 3RNUA 1I4GA 3H0GH 1DD2A 2A68C 3T1YQ 3I90A 1PH4A 3BYYB 4IPCA 1LT6D 1KLUD 3TN2A 2G9HD 1Y1WG 1STYA 4A3CG 4EX5A 3GP7A 1TIID 3GTQB 3GTMB 2Z4IA 1G6ZA 4R9WA 1V9PA 2K5WA 2PNRC 4B3TQ 1TWAH 5IGGA 3LNNA 3VR6A 1C48A 3T1YL 3NBHA 2KCNA 5EQ0A 2KHIA 2L55A 3ULLA 3K5LA 4K2LA 1PZKD 3EN2A 1U4MA 3K81C 4RAUC 3HOUH 5C4XG 1SE4A 3KJOA 1PYBA 4YY3L 1OXUA 3M4OH 3J80E 5LMUQ 1GUNA 4JI7Q 1D5MC 2HD3A 2NVXH 4DUZQ 1WFQA 4A3BB 1Y1VH 1BCPB 1Q8IA 4B3TL 2VXWA 2VB2X 3QJYA 2QDBA 1CM9A 4N9PA 1L0XB 1NSNS 1HQMC 3NTIA 5BN4A 1RL2A 2CWPA 2B2VC 3SK5A 1HA5A 1GM5A 5JJLA 2OCEA 3T51B 2D0OA 5FLMH 3RLNA 2EYLA 5LMUL 4KD4A 4MNOA 1MSHA 1N33Q 1RD9D 5IWAQ 4JI7L 1A62A 3MXUA 2F0HA 4JI0Q 4DUZL 1HZCA 1OXXK 4DUYQ 3OIQA 1CTMA 3I4MB 1TWFH 1GOZA 4HEDA 2JA8G 1SRUA 5C0XJ 4JK1C 1PH1A 4FO2A 5CC4A 5J1ZA 2NVTB 1BCPD 1PYWD 4PQXA 2G9DA 1C0AA 3NEMA 2B2TA 1RODA 1QILA 3G4SA 1JICA 2XRQD 3FPPA 2NWGA 2DGYA 3A7LA 5IWAL 3A8KE 2F0LA 4RGTA 1L1OC 2F0VA 2IT1A 4JI0L 2JA5B 5JJZA 2WIIB 4DUYL 3I8ZA 2E2JH 4WJ3M 3H94A 3N52A 4Q0FA 4OXPA 1B3QA 2Q2IA 1AE2A 1Y1WH 1STGA 4DPGA 1TWHB 3A7AB 1KIXA 4DV2Q 5FJ8H 4YCUA 4A3MH 2NYZD 2Y0SB 1KHIA 2PCFB 1EEFD 1G91A 5ELCA 1PYSB 2I0QA 2SNSA 3HKZB 2Q2HA 4C56C 1SDFA 3DHQA 2LY7A 5D65A 1PRTC 4N8FA 1WJJA 4R4TA 4WRDA 3E0EA 2EVBA 5M3MG 2WAQB 1GVPA 4L5RC 5C4XH 3OW7A 3S2DH 2YU9H 4H0LC 3NP8A 1ICFB 3UDGA 4DV2L 1LO5D 2EIFA 4JYAQ 2E2HH 1ET6A 2DNCA 4KKTA 5C6AA 2CCZA 1HUMA 3SHLA 2H5XA 3KLRA 3J7A5 1HHVA 1M90C 3NWSA 4JW0A 5TSSA 3RZDB 2DN8A 2DNEA 1BO0A 1H9SA 1X3QA 1CFMA 1TY2A 2J4XA 4DV4Q 3P1HA 2OTJA 4DR1Q 4CDCC 4GNXA 1JOQA 2HUGA 3OSOA 1LTGD 1WYDA 1G2SA 1CA5A 2TSSA 4UP7A 3J7YW 1LTRD 1TWAB 2MUYA 4OWTB 2OTLA 3GTOB 5IGCA 4JYAL 5GROA 2E2IB 4OONA 3CCUA 1ESFA 2B2TC 3QIAA 4L6TB 4EQPA 2DJGC 4DR5Q 2K33A 4DAPA 1XMQQ 1SR3A 1EFWA 2KCCA 4DV4L 5EKLA 4K5XA 4DR1L 3CCJA 4A3GH 1PMRA 1QUQA 2FINB 1K0SA 1SNQA 2MO0A 3PO2H 5GQOA 4K6LA 2MJ8A 3TP8A 4C3JB 3U58A 1U9RA 1EOTA 3J81i 1OO9B 1VQJA 4QGUA 2R6GA 2IY5B 3A56A 1F9SA 4DR5L 5LMNW 4ME5A 1XMQL 1SMYD 3MFGA 1CHPD 2EXDA 5I6YA 5KNBA 1KLGD 1BBWA 1R9TB 1V1PA 5I4DA 2ZJRA 1FNUA 3K0YA 1BUVT 3QOLA 1IBKQ 3Q22A 3JAMi 2N8NA 4EQ5A 5EJWA 1TWFB 4DR3Q 2ES2A 4Y7NB 1V43A 3ZYYX 2XNAC 3PCOB 3UE1A 2JXMB 3CPWA 2B2YA 1K83H 5C5LA 1YNNC 4BY7G 3TQYA 5HGQA 3MXPA 3QB3A 1YEZA 2EZVA 2VS1A 3L3OC 4RCNA 2R93B 3EVQA 4O42A 4LF4L 5M3MH 2MHVA 1J9OA 2BE5C 3F2CA 3ITPA 1IBKL 3S16B 2R7ZG 3NK9A 3CCSA 5CYUA 3W1BA 4ZLTF 2RBMA 5IY0A 1YNXA 3S1RB 3FKIH 1N9WA 4DR3L 1HZAA 2Z0SA 3K7AB 4O2DA 4G4KA 5IODA 3ND8A 1PTOB 4CDDC 2EE1A 1SNDA 1TWCH 3A74A 2EJGC 3D6CA 4HJ7A 3TDQA 3ERSX 1HQRD 2K01A 2CKZB 2WFWA 1JCKB 1ZYRC 2MGSA 5C44G 4DK0A 1F2YA 1ZXTA 4XXEA 1UWVA 2NVQH 2CFMA 1PV4A 4MTKA 3DXJC 5EPKA 1YJ9A 1I94Q 1VQFA 1SFOH 3TBIB 3H91A 1L0YB 1T5XD 4BBRB 4QUCA 5C4HA 1I3QH 1D7QA 2I5MX 3I3CA 4ZKCB 1DJRD 3BDOA 5E3FA 4DFAA 2IX3A 3HEJA 3I91A 1X3EA 4JVZA 4IQZA 1FL0A 3RN5A 2N3SA 1PTOD 3NXWA 3S1MB 3BG3A 1IBMQ 5KYIA 2WB1G 1LTLA 2R61A 2HCIA 2I5HA 2IWHA 5KGUA 3VR3A 1I94L 2DJFC 3J81E 1K8AC 3QWNA 4LJZC 1VQPA 1KAAA 4DK3C 1VQOA 2B2YC 3W2DA 3UE0A 3I55A 2K5HA 4A3JG 1ASYA 3A0JA 3NE5B 3S17B 1II3A 3JC66 3DWQA 2WINB 5LMNQ 4A3KG 4ZUJA 1IBML 1JOKA 2JA8B 2CQOA 3G48A 3JAME 2SEBD 4LNQA 2KHSA 3I73A 3I72A 4BY7H 2IX0A 3MXGA 1UUPA 1RCVD 4OIKA 1BVSA 3MHBA 4UDUC 3H15A 1EY7A 3ZJYC 3GTGB 3S2HB 1P8LA 2MPMA 4CDFC 1CK1A 2VY3A 4EQOA 2QDLA 5LMNL 3D31A 2LFNA 5LL6X 1HR0W 1MGSA 3H3VI 2X6GA 4EQNA 1KTKA 4IJLA 2NVYB 3NSWA 2Z9HA 2A73B 2DY8A 2F0FA 1SYDA 4B9WA 1TWGH 2BH2A 5F2DA 1S5CD 3BVGA 3V96A 2VQEL 1TY0A 4CHTB 3ICEA 4QL5A 3C2PA 3PO3G 4ZAIA 4X6AH 2AUJD 1CT1D 2A6HC 2L4NA 3KUPA 3OYYA 1JJCB 4OWWB 3U4VA 5C44H 3Q23A 5FK9C 2KCTA 1H9KA 1STHA 3ULPA 1NBWA 1WTQA 2KENA 3ERQA 3CRKC 1PHJA 2Q2TA 4L63B 2HQEA 4H44C 5T1GA 3GTPH 4NXMQ 2RF4A 2KEEA 2N55A 3FRPB 3S9WA 1HXYD 2VUMH 3U9OA 2R92B 1I4XA 3EIVA 1TQOA 2BDOA 4F87A 1KDCA 1LTTD 2JA5G 1W3SA 4MZ9A 2CH4A 1CI3M 2A6EC 1ICWA 1DCZA 1BNZA 1XNRQ 4IOAA 2Z6BA 4UY8C 4P71A 4PV1C 4G7OC 3NELA 3TZDA 3GTQH 4K6DA 1EWIA 1SNMA 3BZDB 3D4RA 4BBSG 1K8MA 3L0OA 3SDZA 4NXML 1DZ1A 1AZQA 4KHZA 2GVBA 3WDNA 3M7NA 4FF3A 3FPUB 1YJWA 3HKZG 1NTGA 3AYHB 1XX8A 4R4CA 1F77A 1VS0A 2NN6I 2HDMA 3BS1A 1XNRL 1S5FD 5C4JB 4JOIA 2WAQG 1SLJA 4OL7A 2RSOA 3MXNA 2Q8IB 1FNWA 2PNHA 2V1CC 1Q81C 3NENA 3Q8DA 5IYDH 3KF8B 1EY4A 2E5LQ 1X3GA 1CKNB 3S1QB 1EWCA 2B2UA 4M8AA 2CH4W 5C0XH 4DV5Q 4XIGS 2WB1E 2HCCA 4KK7A 2K7VA 1Z7TA 3TSSA 5C4ZA 4IUVA 4LK1C 1D2BA 5J22A 4U68A 4KD3A 2JA6B 5CBAE 2E5LL 4DAYB 1XYIA 1E2VA 1B9NA 4L5TA 2OWOA 1R4PB 2ALYB 4IPDA 1HR0Q 1E0BA 1XWEA 1LUZA 4DV5L 5KIXA 3I4MH 4YWKA 1W6JA 1EY6A 5CMDA 2HIVA 4X65L 1HTLD 1QZHA 2NVTH 3OIPA 4YCVA 1YVCA 2PZTA 1HFNA 2B29A 2A68D 2ZJPA 2IX1A 4S3SA 2BDNA 1SYBA 2B63G 4ZUIA 1CZWA 4OHJA 2R7ZB 4ZRZA 3HOZG 2B39A 2QEJC 2MP1A 2EPBA 2JA5H 2DY7A 4AYBG 1HR0L 5DEHA 3F8TA 2PQAA 4PZ7A 1B1ZA 3M3YB 3HS0C 1IHZA 2N88A 1TWHH 1NR2A 4G7HC 4KV6A 3AMUA 4JOIC 3D4WA 4BBSH 2EYOA 3KBGA 5C44B 2QILA 3OW2A 3HOYB 1D5ZC 3L2PA 1Q90A 3MTSA 3DLLA 4HMJA 3K8AA 3OMGA 4A75A 2B2UC 2PI2A 1EFID 4DAMA 3FMCA 1SN8A 2RDGA 1QCBD 1SBBB 1MKHA 1CSQA 2JEAI 4RFBA 2AWOA 2Z1CA 1ET9A 4JI1Q 4DF7A 5H1SE 2F0TA 3K0XA 1YHQA 5I2XA 2WP8J 2BA1A 1XNQQ 3J7ZC 1EL0A 3RR5A 4A3EB 1SMXA 3KDFA 1NCVA 3RZDH 3MEFA 2E2DC 3ULJA 2WB1B 4YY3Q 4DR6L 1Q1EA 4FVMA 4HIKA 1L1OB 1KNAA 4F7XA 1I6HB 5BR8Q 1QE6A 2EOTA 3FP9A 2R7DA 4UP9A 1PZJD 2OXPA 5CGKA 3M85A 4HAEA 5A2QE 5FLXE 2Y0SE 4XYOA 4A3LH 4GZYC 4A3JB 3URYA 1P16A 4MN3A 3HKZE 4JI1L 3GTOH 2LS01 2E2IH 1SNCA 1XNQL 1FD7D 2DUDA 4ZQ3A 3PIP3 4A3KB 4WFN3 3SR1A 2PYKA 3N6RA 4BBRG 2WAQE 4Y52H 5BR8L 2YYZA 4X62Q 1PRTB 3MWYW 5C3EB 1CKMA 4L8JA 3QR8A 1VQ8A 1EQRA 1Z47A 4RGOS 1SEBD 2EYHA 3W1GA 2BCOA 4C3JH 1MI2A 2K32A 1IZ6A 1JWUD 3BVZA 3AU7A 1LT3D 1U4RA 1B4OA 1AEXA 1M4VA 5JPMC 4KHPQ 1AW7A 3SVMA 1B9MA 3KLSA 4ID6A 4LMQD 2L0CA 2XN9C 1E2ZA 3BDLA 3HKSA 4PZ6A 1R9TH 3TRZA 1G291 1KXLA 2M00A 1QVFA 2EYPA 4X62L 1STBA 1GHJA 3CAMA 3NQIA 3I4OA 1VQ4A 3PO3B 3M4YA 4IURA 3UI2A 3MC0B 5ISRA 2E76C 2ICEC 1F2LA 1PRTD 4ZK9B 4NPSA 4Y7NH 4KHPL 4JI5L 5EPLA 3V05A 4RHRA 3Q6SA 1RTOA 4ODGA 3D6WA 5IT9c 1EU4A 1UE5A 3PIO3 2ZTEA 3DEOA 2R93H 3CU7A 2NTTA 1UEAB 4IUNA 4UP8A 3CCMA 4POGA 3F2DA 2XWJB 4F8MA 1GXDC 2HDLA 3IAYA 3S16H 3T53B 2NZOA 4NW2A 4CJ2C 4QB4A 3RUZA 1ONLA 2JQOA 4AQYQ 2GA4B 3S1RH 1YI2A 3D3RA 4AH6A 1YIJA 1IYVA 3TS0A 2EJMA 1JT8A 4A3CH 3K7AH 3HZXA 3PMFA 1UEBA 4QF4A 4JI2Q 1PTOH 3CC4A 3DWPA 4C3HG 4K8IA 4BBSB 3I7FA 4OIJA 1ILPA 1BBUA 4GN3B 4GOPA 2XIWA 2JSOA 5JVG3 2NB0A 4NB3A 5EKKA 1BF4A 1GUWA 2M2LA 3U4ZA 1D1IA 1X32A 4AQYL 5JVH3 3SE0A 5IE8A 2J0TD 2R92G 1SYGA 1Y8NB 4BBRH 3KLSX 4JI2L 2ZTDA 1DOKA 5A35A 3C46A 1PXUA 4JC0A 3VR5A 4FXGC 2FXQA 3GO5A 2H1EA 5GAHC 4JBMA 5IGFA 3SEBA 3CF5A 2D0PA 3H09A 4HN7A 3S1MH 1N34Q 3KJPA 3T56B 4GLAC 4KI0A 4A3FG 2MNAA 2D9UA 4CKCA 4BA1I 3E6ZX 4V0BA 3S14B 2YTYA 4JI6Q 2MO1A 1LYLA 1A2TA 4EVOA 2HHHQ 1L2FA 1MHWC 1E7ZA 1GO3E 1KAWA 4BY1B 1EQTA 2NN6G 1WD1A 1QJOA 2KBNA 4NMZA 3S17H 2EYMA 1MJCA 1YNND 1YBYA 3AB9A 5KNDA 1PH7A 1EZ6A 1N34L 1Y8OB 4YCWA 1QNUA 2JA8H 4NP5A 3S1NB 1XJVA 1NE3A 4ABNA 1EQVA 1BR9A 3H6MA 1SXTA 2WACA 2BE5D 2NTSA 2ZXPA 2UUCQ 2RCNA 1DXMA 4JI6L 5G3LD 1STEA 2B63B 3STBC 2HHHL 3GTGH 3S2HH 3J7AF 4OO1I 3HOZB 5NUCA 5I9PA 1V1PB 4DK6C 4GOPC 1A6XA 5LHY1 1ML0D 2ICIA 1HZBA 4AYBB 3H3VH 4Z9CB 4JG2A 2F0UA 1EYAA 4LF4Q 1D8LA 2B8FA 1B70B 1JC7A 2NVYH 1JB7A 4PMBA 2JA6G 1NNXA 4A3IB 2KOLA 1ZYRD 1IL2A 2UUCL 2LSSA 2L9HA 1K8OA 1RIPA 1G8ZD 3GQBA 4DXFA 4HJ5A 2ZJQA 3K6OA 1Y69U 1VQGA 3NPPA 4TQUS 3IRBA 3F2UA 1I5FA 3RLOA 3UDIA 3K58A 1WCMG 1I4PA 2RA4A 4LAAA 3CC7A 3AFQA 1WOCA 1YJNA 3RZOB 1HNWL 1R4QB 4X66Q 4R8IA 4JI4L 2KA7A 4BXXG 3RN2A 4C3IB 2AQ3B 3TZUA 1JJGA 4HJ8A 3KF6A 3CCRA 1G6PA 5IT9L 2Q2UA 4GNXC 3K5NA 5M5XB 4LF7L 2R92H 2JYOA 5KEEA 2F0DA 3I56A 1D1KA 2NZHA 4NXNQ 1A15A 3AFPA 1Q8KA 2QA4A 1PH3A 1KDAA 4FYDA 1LACA 3T16A 4A3DB 4P72A 4HIOA 2RDFA 4X66L 2JA7G 3PUWA 1KD1C 2K05A 5J3BA 1E3PA 4KKSA 4FP5D 3RMHA 1N32Q 3HOYG 3TEHB 2QKIC 4NXNL 3GTLB 2F0WA 1QOHA 1A63A 1SE8A 3F1ZA 1NAPA 2EDGA 4KY7A 2NN6H 3IFTA 2J7ZA 3G6JB 3MFYA 1B53A 3P75A 4I7ZC 5C4JH 2RKSA 5M3FB 1GUGA 3KBXA 5M9OA 4K0KQ 1DOMA 3KLWA 2N49A 5C3WA 2LXJA 3K80C 5DAUA 3SGIA 1VQLA 1E1OA 4J8QA
chains in the Genus database with same CATH topology
5CV4A 1IKMA 1GUOA 5FO9B 3NUCA 2C5CA 1WTXA 3ONAB 2KQ3A 2D62A 3PUVA 5JOBA 1GUSA 3MEHA 3D8GA 1C8CA 1LTBD 2FMCA 2VNUD 1YNJC 2A6HD 4IUUA 1JE4A 3VYSA 3NBIA 2FHTA 4XDXA 1WTRA 5K5PA 5LL6S 3I4LA 3RD4A 5FLXL 2C9OA 5CR3A 2IL8A 2LMCB 4C1NI 3LWUA 2A6ED 2JEBI 4FNFA 1ENAA 3A8JE 2IJ0A 3J80L 5COYA 4C3HB 2VB3X 3EROA 1H9MA 5T1IA 3C3LA 4RGNA 1BQQT 2ZXRA 4NDXA 4CJ0B 3TMEA 4K5VA 4IUTA 2EY5A 1HUNA 3HG9A 2PO4A 1RDPD 3DM1A 3QO2A 1WTWA 1D6EC 1M8AA 4PMWA 2PZUA 4IALA 3DEPA 3C1FA 4X3KA 5I9OA 2L12A 1QG7A 1STNA 4B08A 4A3FB 1PDQA 3TP5A 1SJED 4WJWA 1SE3A 3R2IA 3HOWB 3QOJA 2O5IC 5ELDA 2L5TA 5CORA 4DK1A 4ILWA 5FO8B 2OT2A 1BXTA 1TS4A 1NUCA 3T13A 5AFWA 2EJFC 2FJ2A 3O13A 1LT5D 4KY6A 5I2YA 2CW0C 3GV3A 1LTSD 3CQZB 1IW7C 3CRLC 3QG1A 1NR4A 5D3DA 1Z6HA 3KF8A 1FYCA 2L1BA 5EBCA 4QCLA 2A74C 1WVLA 1XXGA 2H4OA 1WCMB 1FNVA 4TKOB 2E75C 1GUTA 4OO1G 3U9SA 1EY8A 3MAQA 1C4QA 4XQNA 5ELBA 1PLFA 4OGQC 2JA7B 2OF1A 2F4IA 4U673 1SSOA 4KY5A 3HOXB 2F0OA 2M9VA 2F0IA 5ELFA 2CVRA 3PUXA 2PMZB 2NZ1D 4IN3A 1I50B 3R2TA 1SYEA 4C3IG 4XT3B 1I4RA 1VF5C 1TR5A 1VDZA 1B44D 3GTJB 2KECA 4C2MB 2A69C 2SNMA 1RHPA 4HCSA 2B8GA 4K8JA 1OXVA 1TS5A 3RLFA 1SNPA 1B50A 1MSGA 3NHHA 2K28A 3S15B 3Q24A 1WTOA 3E0JA 2PW5A 1LTID 5E1FA 4RKLA 1VMPA 5BN5A 1F9PA 5HGTA 5KRUA 2RQXA 4V190 4RWSC 3VR2A 3X3NA 4G57A 1RTNA 1U4PA 4IFDI 2I46A 1QNKA 3Q0AA 3BDCA 1VMCA 2IPKD 1Q12A 4OO1H 4TRDA 2OEOA 5KYLA 4XQQA 5ELEA 2F0JA 5HURA 2K1BA 1O80A 4KN7C 5IOCA 2EY2A 3CHBD 2FFKB 2I07B 3WOFA 4DU9A 1SAPA 3GTKB 3R8BA 4RA8A 2JE6I 2RSNA 1CHQD 1PFNA 1KNEA 5C0XI 3OPOA 1I4HA 3VYUA 1F9RA 1F9QA 4IFDJ 3C1EA 3MA2B 1UNSA 4J1MA 4XQJA 1Q3LA 4XT1B 1CA6A 3EFXD 3J81L 2F0SA 5CV6A 2WKCA 3GD7A 3HOVB 4FF2A 5BN3A 1PZID 4RGMA 4I65A 3PUZA 5M5WB 2AUKA 3JAML 1HCZA 2F0KA 4G7ZC 4RCOA 3I4NB 1HRJA 2O5JC 1O7YA 2PZWA 2RVLA 1LTAD 1TS2A 1ESRA 1CQVA 4HR7B 4X3SA 4KMUC 5E4XA 2F0NA 2K03A 1EEID 4A93B 4DNTB 3SXHA 4H7BA 3DUZA 1U4LA 3ND9A 1H9SB 1TS3A 2AQ1B 1SJHD 2AWNA 2JP1A 1JR0D 4DXGA 1A3TA 2ZT9C 1BCPC 4N9TA 5CV7A 3H0GB 3HRZC 1EU3A 4KTAA 3A8IE 3OHXC 1HTPA 3K5MA 3NTKA 5JEAJ 2TMPA 1AN8A 4RKBA 1V1OA 3FEWX 3OMCA 3SK4A 2LKVA 1JWSD 1TKWB 3HOUB 4HCEA 3M7GA 1TT2A 3M4OB 1A2UA 1MD2D 3A54A 2NVXB 1ENFA 5FO7B 2IW3A 2Q8TA 3L7ZC 4ZKBB 1Y1VB 3MZ5A 3K5OA 4KN4C 2X6LA 3SK8A 2A5HA 2F03A 3EJIA 5D3IB 1JORA 1BBXC 1WTPA 4K14A 4E6IA 1TVXA 1EWHA 3EA6A 2RDHA 2K6AA 4DA2A 4TSSA 2KUMA 4RHSA 4WORA 1OXSC 2Q8RE 1TU2B 2D5DA 1CZGA 2WKDA 2QCPX 4DAVA 3R3OA 2QF7A 1EYDA 3IKJA 3VYRA 5K36G 2O2LD 1CQFA 1OXTA 2KJXA 3IL8A 4KHVA 3WOEA 5C5MA 5IGEA 3VYTA 1QB5D 3VA5A 5DM73 1Y8PB 1YNJD 2K04A 4X3TA 4HSPA 2E2JB 4KKUA 4EGVA 3DWAA 5KNCA 2E74C 1H9RA 1Y1WB 4KJOA 1SMYC 5E4WC 2F0MA 1IYUA 4A3MB 1ENCA 2K5QA 1IL8A 2K5DA 3FVQA 2Z8LA 2R3ZA 5EGTA 3R93A 4KJNA 1WD0A 1EY0A 5CBEE 3BYTB 1O7ZA 4FXKC 5I6WA 4CBVA 3W3AA 2F0PA 5C4XB 3S2DB 2YU9B 1BOSA 4QUFA 2E2HB 1S5BD 2CHBD 5C3XA 2NUCA 4Q5VA 5M5YB 1X3PA 4CKEA 1VF7A 1ZKOA 1GHKA 3TP7A 1J8IA 1A3UA 1PRTF 4XTCS 1I4QA 4PMCA 1DM0B 1BCPF 1DOLA 1FGBD 3VA7A 1EZ8A 2SOBA 2XWBB 1EIGA 4IFDG 3KK7A 4P2CB 1O78A 4X3UA 1STAA 5A2QL 3SK6A 1D5XC 1RF2D 4PNYA 4FF4A 1T5EA 4YIJA 1QWYA 3NTHA 3IFDA 1ZEQX 5JPNC 2PQEA 4A3GB 4R8NA 2V4DA 1SYFA 3G7LA 3PO2B 1EIHA 1W6KA 2ZXOA 5K36H 2O4XA 5C0XG 4O1NA 2EY1A 4DN4M 1HA6A 1PTOC 2WV6D 2KEDA 5EPJA 5DNFA 3MVVA 1LABA 1S5ED 4JBWA 5IIFA 1S4ZA 2D2CC 2B2WA 4J6HA 3DMUA 4K5WA 3T4AC 4HSVA 2F0QA 3NWTA 1I6VC 4HMIA 1LLRD 1EY9A 1JB3A 3I70A 1K83B 4CJ1B 5JAVA 1VCIA 3P20A 2XSCA 1H9JA 1JOOA 4QMGA 3CKIB 4BS9A 4UAIA 5M3MB 2CW0D 1HPCA 4F88A 1ILQA 1IW7D 2CQAA 1XTCD 4MHEA 2KVMA 3FKIB 4HTHA 2EY6A 2BOSA 3HGBA 1SYCA 3J7AV 4H13C 5IGBA 3E5SA 3PUYA 3A55A 1B2TA 2F3WA 1TWCB 2EYFA 2L11A 3PV0A 5JEAG 3OWEB 4XYQA 2ID0A 3NQTA 2SDFA 1DYQA 2FMMA 2PPBC 2XRSD 5G3LF 2NVQB 3D4DA 1WTVA 4C1NK 4IFDH 3LX0A 1PFBA 3X3MA 2XVSA 1SFOB 2EXZA 1UAPA 1I3QB 1BDOA 4DNRB 1LT4D 3P7JA 5D14A 3HP3A 3BVMA 1A3VA 2F1MA 5CV5A 3EQLC 1HFGA 4FF1A 4B9XA 3V2TA 1E2WA 1EYCA 1F2MA 4IUQA 3H3VC 2B2WC 3K59A 2BA0A 3K57A 1JWMD 4CGYB 2NBFA 2Z4HA 4BWGB 5EBDA 1AZPA 5CV9A 2PW7A 2F0GA 1SE2A 5IT9E 3VR4A 1IKLA 4ULLA 4IZ8A 5FKAC 2A69D 3TP6A 1PFMA 1O7LA 4DAYA 2EYJA 4M1UB 4BY7B 5FOBB 1SNOA 4IUPA 1KDBA 4C3JG 1KABA 1LV9A 1RJTA 2AQ2B 1EY5A 3LWEA 3OWFA 1B3AA 1AP0A 1G2TA 5J39A 1AFPA 4NKLA 4MIUA 1TWGB 3L9AX 3GV6A 1V8QA 3FDTA 2F0EA 1S5DD 5CV8A 1RKNA 4FXDA 2ENBA 2B2VA 1FR3A 5JEAH 4DGZA 1PTOF 1JQYD 2X69A 3OOCA 4QIWB 4RH6A 1F2ZA 2F3VA 1DONA 4CKBA 5DM63 5EKIA 1GJXA 5IGDA 4ZYSA 4BA2I 3GTPB 4K2KA 1Q1BA 2VUMB 1MBYA 1I4GA 1DD2A 2A68C 3I90A 3BYYB 1LT6D 1KLUD 3TN2A 2G9HD 1STYA 3GP7A 1TIID 3GTQB 3GTMB 2Z4IA 1G6ZA 4R9WA 2K5WA 2PNRC 5IGGA 3LNNA 3VR6A 1C48A 3NBHA 2KCNA 5EQ0A 2L55A 3K5LA 4K2LA 1PZKD 1U4MA 4RAUC 1SE4A 1OXUA 3J80E 1GUNA 1D5MC 4A3BB 1BCPB 1Q8IA 2VXWA 2VB2X 3QJYA 2QDBA 1CM9A 4N9PA 1L0XB 1NSNS 1HQMC 3NTIA 5BN4A 2B2VC 3SK5A 1HA5A 3T51B 2EYLA 4KD4A 1MSHA 1RD9D 3MXUA 2F0HA 1OXXK 3OIQA 1CTMA 3I4MB 1GOZA 4HEDA 5C0XJ 4JK1C 4FO2A 5CC4A 5J1ZA 2NVTB 1BCPD 1PYWD 4PQXA 2G9DA 2B2TA 1RODA 1QILA 1JICA 2XRQD 3FPPA 2NWGA 3A7LA 3A8KE 2F0LA 4RGTA 2F0VA 2IT1A 2JA5B 5JJZA 2WIIB 3I8ZA 3H94A 3N52A 4Q0FA 1STGA 1TWHB 3A7AB 2NYZD 2Y0SB 2PCFB 1EEFD 1G91A 5ELCA 2SNSA 3HKZB 4C56C 1SDFA 3DHQA 2LY7A 5D65A 1PRTC 4WRDA 2EVBA 2WAQB 3OW7A 4H0LC 3NP8A 1LO5D 1ET6A 2DNCA 4KKTA 5C6AA 1HUMA 3SHLA 3KLRA 1HHVA 3NWSA 5TSSA 3RZDB 2DN8A 2DNEA 1BO0A 1H9SA 1X3QA 1CFMA 1TY2A 2J4XA 3P1HA 1JOQA 2HUGA 3OSOA 1LTGD 1G2SA 1CA5A 2TSSA 3J7YW 1LTRD 1TWAB 2MUYA 3GTOB 5IGCA 2E2IB 1ESFA 2B2TC 3QIAA 4L6TB 4EQPA 2K33A 4DAPA 2KCCA 5EKLA 4K5XA 1PMRA 2FINB 1SNQA 4K6LA 2MJ8A 3TP8A 4C3JB 1U9RA 1EOTA 1OO9B 2R6GA 3A56A 1F9SA 4ME5A 1SMYD 3MFGA 1CHPD 5I6YA 5KNBA 1KLGD 1R9TB 1V1PA 5I4DA 1FNUA 3K0YA 1BUVT 3QOLA 3Q22A 5EJWA 1TWFB 4Y7NB 1V43A 3ZYYX 2XNAC 2JXMB 2B2YA 5C5LA 1YNNC 3MXPA 3QB3A 2EZVA 3L3OC 4RCNA 2R93B 3EVQA 4O42A 2MHVA 1J9OA 2BE5C 3ITPA 3S16B 3NK9A 5CYUA 4ZLTF 2RBMA 3S1RB 3K7AB 4G4KA 5IODA 3ND8A 1PTOB 2EE1A 1SNDA 2EJGC 3D6CA 3TDQA 1HQRD 2K01A 1JCKB 1ZYRC 2MGSA 4DK0A 1F2YA 1ZXTA 4XXEA 3DXJC 5EPKA 3TBIB 3H91A 1L0YB 1T5XD 4BBRB 4QUCA 5C4HA 3I3CA 4ZKCB 1DJRD 3BDOA 5E3FA 4DFAA 2IX3A 3HEJA 3I91A 4IQZA 1PTOD 3NXWA 3S1MB 3BG3A 5KYIA 2R61A 2HCIA 2IWHA 5KGUA 3VR3A 3J81E 3QWNA 4LJZC 1KAAA 2B2YC 3W2DA 3NE5B 3S17B 1II3A 3DWQA 2WINB 4ZUJA 1JOKA 2JA8B 3JAME 2SEBD 2KHSA 3I73A 3I72A 2IX0A 3MXGA 1UUPA 1RCVD 4OIKA 3MHBA 4UDUC 1EY7A 3GTGB 3S2HB 2MPMA 1CK1A 4EQOA 3D31A 2LFNA 5LL6X 1MGSA 2X6GA 4EQNA 1KTKA 2A73B 2NVYB 3NSWA 2DY8A 2F0FA 1SYDA 4B9WA 5F2DA 1S5CD 3BVGA 3V96A 1TY0A 4CHTB 3C2PA 4ZAIA 2AUJD 1CT1D 2A6HC 2L4NA 3KUPA 3Q23A 5FK9C 1H9KA 1STHA 1WTQA 3ERQA 3CRKC 4L63B 2HQEA 4H44C 5T1GA 2KEEA 2N55A 3FRPB 3S9WA 1HXYD 2R92B 3U9OA 1I4XA 1TQOA 2BDOA 4F87A 1KDCA 1LTTD 1CI3M 2A6EC 1ICWA 1DCZA 1BNZA 4PV1C 4G7OC 3TZDA 4K6DA 1SNMA 3BZDB 3D4RA 1K8MA 1DZ1A 3SDZA 1AZQA 4KHZA 3WDNA 3M7NA 4FF3A 3FPUB 1XX8A 1F77A 2NN6I 2HDMA 3BS1A 1S5FD 5C4JB 4OL7A 2RSOA 3MXNA 2Q8IB 1FNWA 1EY4A 3S1QB 1EWCA 2B2UA 4M8AA 5C0XH 4XIGS 2HCCA 4KK7A 2K7VA 1Z7TA 3TSSA 5C4ZA 4IUVA 4LK1C 1D2BA 5J22A 4U68A 4KD3A 2JA6B 5CBAE 1XYIA 1E2VA 1B9NA 1R4PB 1E0BA 1XWEA 5KIXA 1W6JA 1EY6A 5CMDA 1HTLD 3OIPA 2PZTA 1HFNA 2A68D 2IX1A 4S3SA 2BDNA 1SYBA 4ZUIA 1CZWA 4OHJA 2R7ZB 4ZRZA 2B39A 2QEJC 2MP1A 2EPBA 2DY7A 5DEHA 1B1ZA 3M3YB 3HS0C 1IHZA 2N88A 1NR2A 4G7HC 4KV6A 3AMUA 3D4WA 2EYOA 3KBGA 5C44B 2QILA 3HOYB 1D5ZC 1Q90A 3MTSA 4HMJA 3OMGA 2B2UC 1EFID 3FMCA 2RDGA 1QCBD 1SBBB 2JEAI 4RFBA 2AWOA 2Z1CA 1ET9A 4DF7A 2F0TA 5I2XA 2WP8J 2BA1A 1EL0A 4A3EB 1NCVA 2E2DC 2WB1B 1Q1EA 4FVMA 1KNAA 4F7XA 1I6HB 1QE6A 2EOTA 1PZJD 2OXPA 5CGKA 3M85A 4HAEA 5A2QE 5FLXE 4XYOA 4GZYC 4A3JB 3URYA 4MN3A 2LS01 1SNCA 1FD7D 4ZQ3A 3PIP3 4A3KB 4WFN3 3SR1A 2PYKA 3N6RA 2YYZA 1PRTB 3MWYW 5C3EB 4L8JA 1Z47A 4RGOS 1SEBD 2EYHA 2BCOA 1MI2A 2K32A 1JWUD 3BVZA 3AU7A 1LT3D 1U4RA 1B4OA 1AEXA 1M4VA 5JPMC 1AW7A 3SVMA 1B9MA 3KLSA 4ID6A 4LMQD 2L0CA 2XN9C 1E2ZA 3BDLA 1G291 2M00A 2EYPA 1STBA 1GHJA 3NQIA 3PO3B 3M4YA 4IURA 3UI2A 3MC0B 5ISRA 2E76C 2ICEC 1F2LA 1PRTD 4ZK9B 5EPLA 3V05A 4RHRA 3Q6SA 1RTOA 4ODGA 3D6WA 1EU4A 3PIO3 3DEOA 3CU7A 2NTTA 1UEAB 4IUNA 2XWJB 4F8MA 1GXDC 2HDLA 3IAYA 3T53B 4NW2A 4CJ2C 4QB4A 3RUZA 1ONLA 2GA4B 3D3RA 1IYVA 2EJMA 3HZXA 3PMFA 4QF4A 1PTOH 3DWPA 4C3HG 4K8IA 4BBSB 4OIJA 1ILPA 2XIWA 2JSOA 5JVG3 2NB0A 5EKKA 1BF4A 1GUWA 2M2LA 1D1IA 1X32A 5JVH3 3SE0A 2J0TD 1SYGA 1Y8NB 3KLSX 1DOKA 5A35A 3C46A 1PXUA 3VR5A 4FXGC 3GO5A 2H1EA 5IGFA 3SEBA 3H09A 4HN7A 3T56B 4KI0A 2D9UA 4CKCA 4BA1I 3E6ZX 4V0BA 3S14B 1A2TA 4EVOA 4BY1B 1EQTA 2NN6G 1WD1A 1QJOA 4NMZA 2EYMA 1YNND 3AB9A 5KNDA 1EZ6A 1Y8OB 1QNUA 4NP5A 3S1NB 4ABNA 1EQVA 1BR9A 3H6MA 1SXTA 2WACA 2BE5D 2NTSA 2ZXPA 1DXMA 5G3LD 1STEA 2B63B 3J7AF 4OO1I 3HOZB 5NUCA 5I9PA 1V1PB 1A6XA 5LHY1 1ML0D 2ICIA 4AYBB 4Z9CB 2F0UA 1EYAA 2B8FA 1JC7A 4PMBA 4A3IB 2KOLA 1ZYRD 2L9HA 1K8OA 1G8ZD 3GQBA 4DXFA 3K6OA 1Y69U 3NPPA 4TQUS 3F2UA 3K58A 1I4PA 2RA4A 4LAAA 3RZOB 1R4QB 4R8IA 2KA7A 4C3IB 2AQ3B 3TZUA 5IT9L 3K5NA 5M5XB 2JYOA 5KEEA 2F0DA 1D1KA 1A15A 1KDAA 4FYDA 1LACA 3T16A 4A3DB 2RDFA 3PUWA 2K05A 4KKSA 4FP5D 3RMHA 2QKIC 3GTLB 2F0WA 1QOHA 1NAPA 2EDGA 4KY7A 2NN6H 3IFTA 2J7ZA 3G6JB 3MFYA 1B53A 3P75A 4I7ZC 2RKSA 5M3FB 1GUGA 3KBXA 5M9OA 1DOMA 5C3WA 5DAUA 4J8QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TII D;  5G3L D;  5G3L F;  4FP5 D;  4FO2 A;  4FNF A;  1QCB D;  1QB5 D; 
#chains in the Genus database with same CATH topology
 4A3E G;  1T9H A;  1N32 L;  5CV4 A;  3S1Q H;  1GUO A;  1UE1 A;  5FO9 B;  1IKM A;  3NUC A;  2C5C A;  1WTX A;  3ONA B;  4UHV A;  3G6E A;  2KQ3 A;  2D62 A;  3PUV A;  5JOB A;  1GUS A;  3MEH A;  2UUB Q;  4K0K L;  3I2Z A;  3D8G A;  1C8C A;  1LTB D;  2AHO B;  2FMC A;  2VNU D;  1YNJ C;  2A6H D;  2JA6 H;  1S40 A;  4IUU A;  4LF9 Q;  1DGS A;  1JE4 A;  3VYS A;  3NBI A;  1G51 A;  4DR7 Q;  2FHT A;  4XDX A;  1WTR A;  1N8R C;  2K5V A;  5K5P A;  5C3E G;  1WCM H;  2VQE Q;  4B3M Q;  5LL6 S;  1XPR A;  4BXX H;  2QW7 A;  3I4L A;  2UUB L;  3RD4 A;  5FLX L;  2C9O A;  1YIT A;  1BKB A;  5GAG C;  1VQ5 A;  4P74 A;  5CR3 A;  2IL8 A;  2LMC B;  4C1N I;  3LWU A;  2B3G A;  2A6E D;  4LF9 L;  2R7Z H;  1VQD A;  4L5Q A;  4DR7 L;  2JEB I;  3E9I A;  4FNF A;  1KRT A;  2LXK A;  1ENA A;  3A8J E;  1FGU A;  2IJ0 A;  1AE3 A;  2OQK A;  3M3Y H;  3J80 L;  3TRE A;  4B3M L;  5COY A;  4C3H B;  4YWL A;  2VB3 X;  3ERO A;  1XMO Q;  1WTH A;  1B8A A;  1H9M A;  1M1K C;  5T1I A;  3HOY H;  3C3L A;  4B3S Q;  4RGN A;  2QEX A;  1BQQ T;  2ZXR A;  4NDX A;  4CJ0 B;  3TME A;  4K5V A;  4P73 A;  4IUT A;  2EY5 A;  1HUN A;  3HG9 A;  2PO4 A;  1A0I A;  1RDP D;  2YV5 A;  4IO9 A;  1B7Y B;  1X6O A;  3DM1 A;  3GTJ H;  1Q82 C;  3CW2 C;  4JV5 L;  3QO2 A;  1WTW A;  1D6E C;  1M8A A;  4ALP A;  1XMO L;  2RHQ B;  4PMW A;  2PZU A;  4IAL A;  3DEP A;  4JPB W;  3C1F A;  4A3E H;  4X3K A;  5I9O A;  4B3S L;  2L12 A;  1QG7 A;  1K28 A;  1STN A;  4B08 A;  5EAY A;  4A3F B;  1I6H H;  1L0W A;  1FVI A;  3I4N G;  4I7A A;  1PDQ A;  3TP5 A;  1SJE D;  4WJW A;  4A3J H;  1SE3 A;  4OX9 L;  3R2I A;  3MXN B;  3HOW B;  3QOJ A;  4A3K H;  2O5I C;  5ELD A;  4HID A;  2L15 A;  2L5T A;  3CD6 A;  1X9N A;  5C3E H;  5COR A;  1VQH A;  4DK1 A;  1NMF A;  1PFS A;  4DV3 Q;  2AKW B;  3M4Q A;  4ILW A;  5FO8 B;  2OT2 A;  4JCV E;  1BXT A;  1TS4 A;  1VQE A;  1NUC A;  5IYC G;  3T13 A;  3DM3 A;  5AFW A;  1W2B A;  1NMG A;  2EJF C;  2FJ2 A;  3O13 A;  4GN5 A;  1LT5 D;  4X65 Q;  4KY6 A;  5I2Y A;  4OEL B;  3KOJ A;  2CW0 C;  3GV3 A;  1LTS D;  2ZTC A;  3CQZ B;  4QY7 A;  1IW7 C;  3CRL C;  3QG1 A;  1NR4 A;  5D3D A;  1Z6H A;  4IJH A;  4BY1 G;  3KF8 A;  4DV3 L;  3F2B A;  1QZG A;  3PO3 H;  1FYC A;  1PH9 A;  2L1B A;  5EBC A;  1K0R A;  4QCL A;  1EUJ A;  2A74 C;  1WVL A;  1XXG A;  2H4O A;  1WCM B;  1HH2 P;  1KQS A;  1FNV A;  4TKO B;  2E75 C;  1GUT A;  1VQC A;  2BH8 A;  4GS3 A;  3B6Y A;  4OO1 G;  3U9S A;  1EY8 A;  3MAQ A;  1C4Q A;  3A5Z B;  2KCM A;  4XQN A;  5ELB A;  1PLF A;  1E1T A;  4OGQ C;  1Y1V G;  4HIM A;  4A3I G;  4DKA C;  2JA7 B;  2OF1 A;  5HY6 A;  2CWA A;  1TXY A;  5IP9 G;  2F4I A;  4U67 3;  3WWV A;  1SSO A;  4KY5 A;  3HOX B;  2F0O A;  2M9V A;  3BJU A;  4CDE C;  2F0I A;  5ELF A;  5FLM G;  2CVR A;  3PUX A;  2PMZ B;  2NZ1 D;  4IN3 A;  4DR6 Q;  1E24 A;  1I50 B;  3R2T A;  1SYE A;  4C3I G;  4XT3 B;  2K75 A;  1I4R A;  1VF5 C;  1TR5 A;  1VDZ A;  1B44 D;  3GTJ B;  3BZK A;  2KEC A;  4C2M B;  2A69 C;  2SNM A;  3KDF B;  1RHP A;  4HCS A;  4IPH A;  4TVA B;  2UXD Q;  2B8G A;  4K8J A;  1PA6 A;  3OTO Q;  1OXV A;  1TS5 A;  3RLF A;  1SNP A;  3HFZ B;  4A3D G;  2GVA A;  5IYC H;  1B50 A;  1MSG A;  3NHH A;  4LUZ A;  2K28 A;  4LFC Q;  3S15 B;  1EQQ A;  3Q24 A;  1WTO A;  3NBH B;  3CPF A;  3E0J A;  3S14 H;  2PW5 A;  1LTI D;  4R4O A;  2UXD L;  5E1F A;  4RKL A;  1VMP A;  4BY1 H;  5BN5 A;  3OTO L;  5FJ8 G;  1F9P A;  4A3M G;  5HGT A;  5M3F G;  1L1O A;  5KRU A;  2RQX A;  4V19 0;  4RWS C;  3VR2 A;  1N36 L;  3X3N A;  3S1N H;  4G57 A;  1EOV A;  4LFC L;  4GLV B;  1RTN A;  3BZC A;  4YHH Q;  1VQK A;  1U4P A;  5E7N A;  4P75 A;  2I46 A;  4IFD I;  1QNK A;  1CSP A;  3Q0A A;  1K8G A;  3BDC A;  1VMC A;  3CP0 A;  2B63 H;  2IPK D;  1Q12 A;  3M9B A;  4OO1 H;  4TRD A;  2KHJ A;  2OEO A;  3HOZ H;  1K3R A;  4JI5 Q;  5KYL A;  4DV7 Q;  4XQQ A;  5ELE A;  2F0J A;  5HUR A;  2K1B A;  3CCL A;  1O80 A;  4KN7 C;  2RHS B;  5IOC A;  2EY2 A;  1UE6 A;  3CHB D;  5ELO A;  2FFK B;  2I07 B;  3T1H Q;  3WOF A;  4DU9 A;  1SAP A;  1IXR A;  3GTK B;  3R8B A;  4A3I H;  4JI3 Q;  4YHH L;  4RA8 A;  2JE6 I;  2RSN A;  1CHQ D;  1PFN A;  1KNE A;  5C0X I;  3OPO A;  4PZ8 A;  1I4H A;  3VYU A;  1YHA A;  1F9R A;  1F9Q A;  5IP9 H;  4IFD J;  1UE7 A;  4JI8 Q;  3C1E A;  3MA2 B;  1UNS A;  4J1M A;  4XQJ A;  1Q3L A;  4XT1 B;  4DV7 L;  1CA6 A;  3RZO H;  1C9O A;  3EFX D;  2P5Z X;  5ELN A;  3J81 L;  4C3I H;  1E22 A;  1S3O A;  2F0S A;  5CV6 A;  2R7F A;  2WKC A;  3GD7 A;  3T1H L;  2F3I A;  3HOV B;  1X65 A;  5M5X H;  4FF2 A;  5BN3 A;  4GKJ Q;  2AMC B;  2K5N A;  4JI3 L;  1PZI D;  2K14 A;  4RGM A;  2VQF Q;  4LW1 A;  1O7I A;  4O0A A;  4APV A;  1VQI A;  3EBE A;  4I65 A;  4A3G G;  3PUZ A;  4JI8 L;  4AYB E;  5M5W B;  1EYG A;  2VL6 A;  3PO2 G;  2AUK A;  3JAM L;  1X3F A;  2YTX A;  4A3D H;  2EQS A;  1HCZ A;  2F0K A;  4GOP B;  1N33 L;  4G7Z C;  4RCO A;  3I4N B;  1HRJ A;  2ASB A;  2O5J C;  1O7Y A;  2PZW A;  2RVL A;  1Z9F A;  3M4P A;  4GKJ L;  4LFB Q;  1LTA D;  1TS2 A;  1ESR A;  1CQV A;  2VQF L;  3GTL H;  4HR7 B;  4X3S A;  2JK8 A;  2F52 A;  4KMU C;  2Z6K A;  5E4X A;  1Q7Y C;  2F0N A;  2K03 A;  1EEI D;  4A93 B;  4DNT B;  1PH6 A;  3SXH A;  2HT1 A;  4H7B A;  5M3F H;  3DUZ A;  1U4L A;  3ND9 A;  3D0F A;  4R4Q A;  1H9S B;  1TS3 A;  3STB D;  1HNX Q;  1GD7 A;  2AQ1 B;  1SJH D;  5GAD C;  1EIY B;  4GNX B;  2AWN A;  2JP1 A;  4LFB L;  1JR0 D;  4ME3 A;  4DXG A;  1A3T A;  2ZT9 C;  1BCP C;  1HJP A;  4N9T A;  4RG1 A;  5CV7 A;  2UXB Q;  3H0G B;  4LF8 Q;  5JJI A;  3HRZ C;  1EU3 A;  1J5E Q;  4KTA A;  3FKI G;  3A8I E;  1PH5 A;  3OHX C;  1HTP A;  2XGT A;  5M5Y H;  3K5M A;  3NTK A;  5JEA J;  2TMP A;  3CXC A;  1HNX L;  1Q86 C;  3HOW G;  1AN8 A;  4RKB A;  2A19 A;  3PIP A;  1V1O A;  1QUQ B;  5L37 A;  3FEW X;  3OMC A;  2UXB L;  4LF8 L;  3PQI A;  1VQB A;  2MQH A;  3SK4 A;  1PH2 A;  2LKV A;  2YTV A;  1J5E L;  5FLX c;  1JWS D;  5AJ3 Q;  1KRS A;  1TKW B;  1PVO A;  4LF5 Q;  3HOU B;  4HCE A;  3M7G A;  3PGZ A;  1TT2 A;  3M4O B;  1HNW Q;  1A2U A;  4JI4 Q;  1MD2 D;  1Q46 A;  3A54 A;  2NVX B;  1ENF A;  5FO7 B;  2IW3 A;  2A8V A;  3J80 c;  1SRO A;  2Q8T A;  3L7Z C;  4ZKB B;  1Y1V B;  3W5O A;  3GDE A;  4LF7 Q;  3PF5 A;  1A8V A;  3MZ5 A;  3K5O A;  2Z6K C;  4QJF A;  5AJ3 L;  4KN4 C;  4C3H H;  2X6L A;  3SK8 A;  1FJG Q;  2A5H A;  2F4V Q;  4LF5 L;  2F03 A;  1CKO A;  1IYJ B;  3EJI A;  5D3I B;  1YZ6 A;  1JOR A;  1BBX C;  1WTP A;  4K14 A;  4E6I A;  1TVX A;  3KF6 B;  1EWH A;  3EA6 A;  2RDH A;  4JBJ A;  2K6A A;  4MTN A;  4AIM A;  4DA2 A;  4TSS A;  2KUM A;  4RHS A;  3PIO A;  4WOR A;  1OXS C;  2Q8R E;  1TU2 B;  2D5D A;  1CZG A;  2WKD A;  2QCP X;  5IYB G;  4DAV A;  3R3O A;  2QF7 A;  1FJG L;  1EYD A;  2F4V L;  4HJ9 A;  2IHE A;  3IKJ A;  3VYR A;  5K36 G;  3A5U A;  2O2L D;  1CQF A;  1OXT A;  2KJX A;  3IL8 A;  4KHV A;  3WOE A;  5C5M A;  5IGE A;  2C35 B;  3VYT A;  1QB5 D;  4A3F H;  3VDY A;  3VA5 A;  1HNZ Q;  5DM7 3;  1Y8P B;  1YNJ D;  2K04 A;  4X3T A;  4HSP A;  4LWC A;  3HOX G;  2E2J B;  4LF6 Q;  4KKU A;  4EGV A;  3DWA A;  4A4I A;  2E74 C;  1H9R A;  5KNC A;  1Y1W B;  2UXC Q;  4KJO A;  1QVG A;  4DV6 Q;  1SMY C;  5E4W C;  4PG3 A;  2ATW A;  2F0M A;  4A76 A;  1IYU A;  3S24 A;  4POF A;  3CCQ A;  4A3M B;  1ENC A;  3HOW H;  2K5Q A;  1IL8 A;  2K5D A;  4DV0 Q;  4DV1 Q;  3FVQ A;  2Z8L A;  2R3Z A;  1X54 A;  5EGT A;  1HNZ L;  3R93 A;  4KJN A;  1WD0 A;  1EY0 A;  5CBE E;  3BYT B;  1O7Z A;  4FXK C;  1XPO A;  5I6W A;  4LF6 L;  3E9H A;  4CBV A;  3W3A A;  2F0P A;  2UXC L;  4IPG A;  2VUM G;  3S2D B;  4DV6 L;  2YU9 B;  5C4X B;  1BOS A;  1YHB A;  4QUF A;  4LFA Q;  2E2H B;  2G5D A;  1S5B D;  3BU2 A;  1VQN A;  2CHB D;  4DV0 L;  5C3X A;  2NUC A;  4Q5V A;  5M5Y B;  1X3P A;  3CQZ H;  4CKE A;  4DV1 L;  1VF7 A;  1ZKO A;  2JJQ A;  3AQQ A;  1GHK A;  2IHF A;  3TP7 A;  1J8I A;  1A3U A;  1PRT F;  4XTC S;  1I4Q A;  2K52 A;  2I5L X;  1VQ9 A;  4PMC A;  3CCV A;  1DM0 B;  1BCP F;  1DOL A;  1FGB D;  3VA7 A;  1S72 A;  1EZ8 A;  2SOB A;  4LFA L;  2XWB B;  1EIG A;  4LUO A;  4IFD G;  3KK7 A;  4P2C B;  4B3R Q;  1O78 A;  1JJ2 A;  4X3U A;  1H95 A;  1STA A;  4UPA A;  5A2Q L;  3SK6 A;  1D5X C;  1GKH A;  1RF2 D;  4DNI A;  4WJ4 A;  4PNY A;  4FF4 A;  1T5E A;  4YIJ A;  1QWY A;  3NTH A;  2N78 A;  1ZEQ X;  3IFD A;  5IYB H;  4DR2 Q;  5JPN C;  2PQE A;  4A3G B;  1ASZ A;  1K9M C;  4R8N A;  2V4D A;  5IYD G;  2VZA A;  1VQ6 A;  1SYF A;  3G7L A;  1WI5 A;  3E3X A;  3PO2 B;  1W6K A;  1EIH A;  2ZXO A;  5K36 H;  2O4X A;  2UUA Q;  1PH8 A;  4X64 Q;  4A3B G;  5C0X G;  4O1N A;  4B3R L;  2EY1 A;  4OWX B;  4JV5 Q;  4DN4 M;  2JA7 H;  1HA6 A;  4H02 A;  1PTO C;  2WV6 D;  2KED A;  5EPJ A;  2K4K A;  5IP7 G;  1U0L A;  5DNF A;  3HOX H;  1KL9 A;  3MVV A;  1LAB A;  1S5E D;  4JBW A;  5IIF A;  4HJA A;  4OEM B;  4DR2 L;  3CC2 A;  1I50 H;  1S4Z A;  5DLQ E;  4N8X 1;  2D2C C;  2B2W A;  4J6H A;  3DMU A;  4K5W A;  5JJK A;  3T4A C;  2OQ0 A;  4HSV A;  2F0Q A;  3NWT A;  2HIX A;  2UUA L;  4X64 L;  1I6V C;  4GLX A;  3HOV G;  4HMI A;  1LLR D;  1EY9 A;  3I4M G;  4JBK A;  1JB3 A;  4OX9 Q;  4C2M H;  3I70 A;  1AH9 A;  1K83 B;  1VQA A;  1J6Q A;  4CJ1 B;  2ZM6 Q;  4GN4 B;  5JAV A;  1VCI A;  2UU9 Q;  1NJI C;  3P20 A;  2XSC A;  1H9J A;  1IBL Q;  1JE5 A;  1JOO A;  4QMG A;  3CKI B;  4BS9 A;  1V1Q A;  4UAI A;  5M3M B;  3CMA A;  2CW0 D;  1HPC A;  3CME A;  4F88 A;  3K7U C;  1ILQ A;  1IW7 D;  3S15 H;  2CQA A;  1XTC D;  1K3B C;  4MHE A;  2KVM A;  3FKI B;  4HTH A;  1CUK A;  2EY6 A;  2BOS A;  3HGB A;  3KFU A;  1SYC A;  3J7A V;  4H13 C;  2PMZ E;  5IGB A;  3E5S A;  3PUY A;  2PI2 E;  2ZM6 L;  3A55 A;  1B2T A;  2F3W A;  1TWC B;  2UU9 L;  1MJE A;  1IBL L;  3GTM H;  2EYF A;  2L11 A;  4A93 G;  3PV0 A;  5JEA G;  3OWE B;  4XYQ A;  2ID0 A;  3NQT A;  2SDF A;  2Y0S G;  5GAE C;  1DYQ A;  2A1A A;  2FMM A;  2PPB C;  2XRS D;  5G3L F;  3TS2 A;  3D4D A;  4QIW E;  1WTV A;  2NVQ B;  4C1N K;  4IFD H;  3LX0 A;  1PFB A;  3X3M A;  4DR4 Q;  2XVS A;  1SFO B;  2EXZ A;  1UAP A;  1I3Q B;  1BDO A;  5D14 A;  1LT4 D;  3P7J A;  4DNR B;  3FHW A;  3HP3 A;  4GKK Q;  3BVM A;  3H0G G;  1A3V A;  2F1M A;  5CV5 A;  3EQL C;  1HFG A;  2JN4 A;  3UDX A;  2MFI A;  4R1J A;  4FF1 A;  4B9X A;  3V2T A;  1K73 C;  1E2W A;  1EYC A;  1F2M A;  1QVC A;  1VQ7 A;  1XPU A;  4IUQ A;  3H3V C;  1VQM A;  4IOC A;  2B2W C;  4A3B H;  3K59 A;  1CKN A;  2BA0 A;  3K57 A;  1JWM D;  3GTK H;  3LGJ A;  4CGY B;  3CCE A;  2NBF A;  2Z4H A;  4DR4 L;  4BWG B;  5EBD A;  1AZP A;  5CV9 A;  5IP7 H;  2PW7 A;  2F0G A;  3U50 C;  4GKK L;  4A3L G;  1SE2 A;  5IT9 E;  3J81 c;  3VR4 A;  2JA9 A;  1IKL A;  4ULL A;  4IZ8 A;  5FKA C;  3UDF A;  2A69 D;  3J80 i;  2K50 A;  3TP6 A;  1PFM A;  3HOU G;  1O7L A;  3HOV H;  4DAY A;  3J81 j;  2EYJ A;  4M1U B;  2E8G A;  2PQA B;  1OTC A;  3PSI A;  4BY7 B;  5FOB B;  1EIF A;  3JAM c;  1SNO A;  4IUP A;  4FDB A;  2QGQ A;  5M5W H;  1X55 A;  1KDB A;  4C3J G;  1KAB A;  1LV9 A;  1Y14 B;  1RJT A;  2AQ2 B;  1EY5 A;  2HQL A;  1HZ9 A;  3LWE A;  3I4N H;  1LM0 A;  3OWF A;  2XTI A;  4ZCK A;  1MIU A;  1B3A A;  1AP0 A;  1G2T A;  5J39 A;  1C7Y A;  1AFP A;  1KC8 C;  4L5S A;  1NY4 A;  4MIU A;  4NKL A;  4YWM A;  4R4I A;  3L9A X;  1TWG B;  3AEV A;  1U5K A;  3GV6 A;  1V8Q A;  3FDT A;  2F0E A;  1S5D D;  5CV8 A;  1RKN A;  4A93 H;  4FXD A;  2ENB A;  2B2V A;  1FR3 A;  5JEA H;  4DGZ A;  1PTO F;  1JQY D;  2X69 A;  3OOC A;  4QIW B;  1XTD A;  3KYH C;  4RH6 A;  1F2Z A;  4KLK A;  3G71 A;  2F3V A;  1DON A;  2VW9 A;  4CKB A;  5DM6 3;  1X56 A;  5EKI A;  1JMC A;  1GJX A;  5IGD A;  4QQB X;  4ZYS A;  4BA2 I;  2RCF A;  3GTP B;  3PF4 A;  4K2K A;  2R93 G;  1Q1B A;  2VUM B;  4RMF A;  2GN5 A;  1N36 Q;  3ER0 A;  4J15 A;  1MBY A;  4LUV A;  3RNU A;  1I4G A;  3H0G H;  1DD2 A;  2A68 C;  3T1Y Q;  3I90 A;  1PH4 A;  3BYY B;  4IPC A;  1LT6 D;  1KLU D;  3TN2 A;  2G9H D;  1Y1W G;  1STY A;  4A3C G;  4EX5 A;  3GP7 A;  1TII D;  3GTQ B;  3GTM B;  2Z4I A;  1G6Z A;  4R9W A;  1V9P A;  2K5W A;  2PNR C;  4B3T Q;  1TWA H;  5IGG A;  3LNN A;  3VR6 A;  1C48 A;  3T1Y L;  3NBH A;  2KCN A;  5EQ0 A;  2KHI A;  2L55 A;  3ULL A;  3K5L A;  4K2L A;  1PZK D;  3EN2 A;  1U4M A;  3K81 C;  4RAU C;  3HOU H;  5C4X G;  1SE4 A;  3KJO A;  1PYB A;  4YY3 L;  1OXU A;  3M4O H;  3J80 E;  5LMU Q;  1GUN A;  4JI7 Q;  1D5M C;  2HD3 A;  2NVX H;  4DUZ Q;  1WFQ A;  4A3B B;  1Y1V H;  1BCP B;  1Q8I A;  4B3T L;  2VXW A;  2VB2 X;  3QJY A;  2QDB A;  1CM9 A;  4N9P A;  1L0X B;  1NSN S;  1HQM C;  3NTI A;  5BN4 A;  1RL2 A;  2CWP A;  2B2V C;  3SK5 A;  1HA5 A;  1GM5 A;  5JJL A;  2OCE A;  3T51 B;  2D0O A;  5FLM H;  3RLN A;  2EYL A;  5LMU L;  4KD4 A;  4MNO A;  1MSH A;  1N33 Q;  1RD9 D;  5IWA Q;  4JI7 L;  1A62 A;  3MXU A;  2F0H A;  4JI0 Q;  4DUZ L;  1HZC A;  1OXX K;  4DUY Q;  3OIQ A;  1CTM A;  3I4M B;  1TWF H;  1GOZ A;  4HED A;  2JA8 G;  1SRU A;  5C0X J;  4JK1 C;  1PH1 A;  4FO2 A;  5CC4 A;  5J1Z A;  2NVT B;  1BCP D;  1PYW D;  4PQX A;  2G9D A;  1C0A A;  3NEM A;  2B2T A;  1ROD A;  1QIL A;  3G4S A;  1JIC A;  2XRQ D;  3FPP A;  2NWG A;  2DGY A;  3A7L A;  5IWA L;  3A8K E;  2F0L A;  4RGT A;  1L1O C;  2F0V A;  2IT1 A;  4JI0 L;  2JA5 B;  5JJZ A;  2WII B;  4DUY L;  3I8Z A;  2E2J H;  4WJ3 M;  3H94 A;  3N52 A;  4Q0F A;  4OXP A;  1B3Q A;  2Q2I A;  1AE2 A;  1Y1W H;  1STG A;  4DPG A;  1TWH B;  3A7A B;  1KIX A;  4DV2 Q;  5FJ8 H;  4YCU A;  4A3M H;  2NYZ D;  2Y0S B;  1KHI A;  2PCF B;  1EEF D;  1G91 A;  5ELC A;  1PYS B;  2I0Q A;  2SNS A;  3HKZ B;  2Q2H A;  4C56 C;  1SDF A;  3DHQ A;  2LY7 A;  5D65 A;  1PRT C;  4N8F A;  1WJJ A;  4R4T A;  4WRD A;  3E0E A;  2EVB A;  5M3M G;  2WAQ B;  1GVP A;  4L5R C;  5C4X H;  3OW7 A;  3S2D H;  2YU9 H;  4H0L C;  3NP8 A;  1ICF B;  3UDG A;  4DV2 L;  1LO5 D;  2EIF A;  4JYA Q;  2E2H H;  1ET6 A;  2DNC A;  4KKT A;  5C6A A;  2CCZ A;  1HUM A;  3SHL A;  2H5X A;  3KLR A;  3J7A 5;  1HHV A;  1M90 C;  3NWS A;  4JW0 A;  5TSS A;  3RZD B;  2DN8 A;  2DNE A;  1BO0 A;  1H9S A;  1X3Q A;  1CFM A;  1TY2 A;  2J4X A;  4DV4 Q;  3P1H A;  2OTJ A;  4DR1 Q;  4CDC C;  4GNX A;  1JOQ A;  2HUG A;  3OSO A;  1LTG D;  1WYD A;  1G2S A;  1CA5 A;  2TSS A;  4UP7 A;  3J7Y W;  1LTR D;  1TWA B;  2MUY A;  4OWT B;  2OTL A;  3GTO B;  5IGC A;  4JYA L;  5GRO A;  2E2I B;  4OON A;  3CCU A;  1ESF A;  2B2T C;  3QIA A;  4L6T B;  4EQP A;  2DJG C;  4DR5 Q;  2K33 A;  4DAP A;  1XMQ Q;  1SR3 A;  1EFW A;  2KCC A;  4DV4 L;  5EKL A;  4K5X A;  4DR1 L;  3CCJ A;  4A3G H;  1PMR A;  1QUQ A;  2FIN B;  1K0S A;  1SNQ A;  2MO0 A;  3PO2 H;  5GQO A;  4K6L A;  2MJ8 A;  3TP8 A;  4C3J B;  3U58 A;  1U9R A;  1EOT A;  3J81 i;  1OO9 B;  1VQJ A;  4QGU A;  2R6G A;  2IY5 B;  3A56 A;  1F9S A;  4DR5 L;  5LMN W;  4ME5 A;  1XMQ L;  1SMY D;  3MFG A;  1CHP D;  2EXD A;  5I6Y A;  5KNB A;  1KLG D;  1BBW A;  1R9T B;  1V1P A;  5I4D A;  2ZJR A;  1FNU A;  3K0Y A;  1BUV T;  3QOL A;  1IBK Q;  3Q22 A;  3JAM i;  2N8N A;  4EQ5 A;  5EJW A;  1TWF B;  4DR3 Q;  2ES2 A;  4Y7N B;  1V43 A;  3ZYY X;  2XNA C;  3PCO B;  3UE1 A;  2JXM B;  3CPW A;  2B2Y A;  1K83 H;  5C5L A;  1YNN C;  4BY7 G;  3TQY A;  5HGQ A;  3MXP A;  3QB3 A;  1YEZ A;  2EZV A;  2VS1 A;  3L3O C;  4RCN A;  2R93 B;  3EVQ A;  4O42 A;  4LF4 L;  5M3M H;  2MHV A;  1J9O A;  2BE5 C;  3F2C A;  3ITP A;  1IBK L;  3S16 B;  2R7Z G;  3NK9 A;  3CCS A;  5CYU A;  3W1B A;  4ZLT F;  2RBM A;  5IY0 A;  1YNX A;  3S1R B;  3FKI H;  1N9W A;  4DR3 L;  1HZA A;  2Z0S A;  3K7A B;  4O2D A;  4G4K A;  5IOD A;  3ND8 A;  1PTO B;  4CDD C;  2EE1 A;  1SND A;  1TWC H;  3A74 A;  2EJG C;  3D6C A;  4HJ7 A;  3TDQ A;  3ERS X;  1HQR D;  2K01 A;  2CKZ B;  2WFW A;  1JCK B;  1ZYR C;  2MGS A;  5C44 G;  4DK0 A;  1F2Y A;  1ZXT A;  4XXE A;  1UWV A;  2NVQ H;  2CFM A;  1PV4 A;  4MTK A;  3DXJ C;  5EPK A;  1YJ9 A;  1I94 Q;  1VQF A;  1SFO H;  3TBI B;  3H91 A;  1L0Y B;  1T5X D;  4BBR B;  4QUC A;  5C4H A;  1I3Q H;  1D7Q A;  2I5M X;  3I3C A;  4ZKC B;  1DJR D;  3BDO A;  5E3F A;  4DFA A;  2IX3 A;  3HEJ A;  3I91 A;  1X3E A;  4JVZ A;  4IQZ A;  1FL0 A;  3RN5 A;  2N3S A;  1PTO D;  3NXW A;  3S1M B;  3BG3 A;  1IBM Q;  5KYI A;  2WB1 G;  1LTL A;  2R61 A;  2HCI A;  2I5H A;  2IWH A;  5KGU A;  3VR3 A;  1I94 L;  2DJF C;  3J81 E;  1K8A C;  3QWN A;  4LJZ C;  1VQP A;  1KAA A;  4DK3 C;  1VQO A;  2B2Y C;  3W2D A;  3UE0 A;  3I55 A;  2K5H A;  4A3J G;  1ASY A;  3A0J A;  3NE5 B;  3S17 B;  1II3 A;  3JC6 6;  3DWQ A;  2WIN B;  5LMN Q;  4A3K G;  4ZUJ A;  1IBM L;  1JOK A;  2JA8 B;  2CQO A;  3G48 A;  3JAM E;  2SEB D;  4LNQ A;  2KHS A;  3I73 A;  3I72 A;  4BY7 H;  2IX0 A;  3MXG A;  1UUP A;  1RCV D;  4OIK A;  1BVS A;  3MHB A;  4UDU C;  3H15 A;  1EY7 A;  3ZJY C;  3GTG B;  3S2H B;  1P8L A;  2MPM A;  4CDF C;  1CK1 A;  2VY3 A;  4EQO A;  2QDL A;  5LMN L;  3D31 A;  2LFN A;  5LL6 X;  1HR0 W;  1MGS A;  3H3V I;  2X6G A;  4EQN A;  1KTK A;  4IJL A;  2NVY B;  3NSW A;  2Z9H A;  2A73 B;  2DY8 A;  2F0F A;  1SYD A;  4B9W A;  1TWG H;  2BH2 A;  5F2D A;  1S5C D;  3BVG A;  3V96 A;  2VQE L;  1TY0 A;  4CHT B;  3ICE A;  4QL5 A;  3C2P A;  3PO3 G;  4ZAI A;  4X6A H;  2AUJ D;  1CT1 D;  2A6H C;  2L4N A;  3KUP A;  3OYY A;  1JJC B;  4OWW B;  3U4V A;  5C44 H;  3Q23 A;  5FK9 C;  2KCT A;  1H9K A;  1STH A;  3ULP A;  1NBW A;  1WTQ A;  2KEN A;  3ERQ A;  3CRK C;  1PHJ A;  2Q2T A;  4L63 B;  2HQE A;  4H44 C;  5T1G A;  3GTP H;  4NXM Q;  2RF4 A;  2KEE A;  2N55 A;  3FRP B;  3S9W A;  1HXY D;  2VUM H;  3U9O A;  2R92 B;  1I4X A;  3EIV A;  1TQO A;  2BDO A;  4F87 A;  1KDC A;  1LTT D;  2JA5 G;  1W3S A;  4MZ9 A;  2CH4 A;  1CI3 M;  2A6E C;  1ICW A;  1DCZ A;  1BNZ A;  1XNR Q;  4IOA A;  2Z6B A;  4UY8 C;  4P71 A;  4PV1 C;  4G7O C;  3NEL A;  3TZD A;  3GTQ H;  4K6D A;  1EWI A;  1SNM A;  3BZD B;  3D4R A;  4BBS G;  1K8M A;  3L0O A;  3SDZ A;  4NXM L;  1DZ1 A;  1AZQ A;  4KHZ A;  2GVB A;  3WDN A;  3M7N A;  4FF3 A;  3FPU B;  1YJW A;  3HKZ G;  1NTG A;  3AYH B;  1XX8 A;  4R4C A;  1F77 A;  1VS0 A;  2NN6 I;  2HDM A;  3BS1 A;  1XNR L;  1S5F D;  5C4J B;  4JOI A;  2WAQ G;  1SLJ A;  4OL7 A;  2RSO A;  3MXN A;  2Q8I B;  1FNW A;  2PNH A;  2V1C C;  1Q81 C;  3NEN A;  3Q8D A;  5IYD H;  3KF8 B;  1EY4 A;  2E5L Q;  1X3G A;  1CKN B;  3S1Q B;  1EWC A;  2B2U A;  4M8A A;  2CH4 W;  5C0X H;  4DV5 Q;  4XIG S;  2WB1 E;  2HCC A;  4KK7 A;  2K7V A;  1Z7T A;  3TSS A;  5C4Z A;  4IUV A;  4LK1 C;  1D2B A;  5J22 A;  4U68 A;  4KD3 A;  2JA6 B;  5CBA E;  2E5L L;  4DAY B;  1XYI A;  1E2V A;  1B9N A;  4L5T A;  2OWO A;  1R4P B;  2ALY B;  4IPD A;  1HR0 Q;  1E0B A;  1XWE A;  1LUZ A;  4DV5 L;  5KIX A;  3I4M H;  4YWK A;  1W6J A;  1EY6 A;  5CMD A;  2HIV A;  4X65 L;  1HTL D;  1QZH A;  2NVT H;  3OIP A;  4YCV A;  1YVC A;  2PZT A;  1HFN A;  2B29 A;  2A68 D;  2ZJP A;  2IX1 A;  4S3S A;  2BDN A;  1SYB A;  2B63 G;  4ZUI A;  1CZW A;  4OHJ A;  2R7Z B;  4ZRZ A;  3HOZ G;  2B39 A;  2QEJ C;  2MP1 A;  2EPB A;  2JA5 H;  2DY7 A;  4AYB G;  1HR0 L;  5DEH A;  3F8T A;  2PQA A;  4PZ7 A;  1B1Z A;  3M3Y B;  3HS0 C;  1IHZ A;  2N88 A;  1TWH H;  1NR2 A;  4G7H C;  4KV6 A;  3AMU A;  4JOI C;  3D4W A;  4BBS H;  2EYO A;  3KBG A;  5C44 B;  2QIL A;  3OW2 A;  3HOY B;  1D5Z C;  3L2P A;  1Q90 A;  3MTS A;  3DLL A;  4HMJ A;  3K8A A;  3OMG A;  4A75 A;  2B2U C;  2PI2 A;  1EFI D;  4DAM A;  3FMC A;  1SN8 A;  2RDG A;  1QCB D;  1SBB B;  1MKH A;  1CSQ A;  2JEA I;  4RFB A;  2AWO A;  2Z1C A;  1ET9 A;  4JI1 Q;  4DF7 A;  5H1S E;  2F0T A;  3K0X A;  1YHQ A;  5I2X A;  2WP8 J;  2BA1 A;  1XNQ Q;  3J7Z C;  1EL0 A;  3RR5 A;  4A3E B;  1SMX A;  3KDF A;  1NCV A;  3RZD H;  3MEF A;  2E2D C;  3ULJ A;  2WB1 B;  4YY3 Q;  4DR6 L;  1Q1E A;  4FVM A;  4HIK A;  1L1O B;  1KNA A;  4F7X A;  1I6H B;  5BR8 Q;  1QE6 A;  2EOT A;  3FP9 A;  2R7D A;  4UP9 A;  1PZJ D;  2OXP A;  5CGK A;  3M85 A;  4HAE A;  5A2Q E;  5FLX E;  2Y0S E;  4XYO A;  4A3L H;  4GZY C;  4A3J B;  3URY A;  1P16 A;  4MN3 A;  3HKZ E;  4JI1 L;  3GTO H;  2LS0 1;  2E2I H;  1SNC A;  1XNQ L;  1FD7 D;  2DUD A;  4ZQ3 A;  3PIP 3;  4A3K B;  4WFN 3;  3SR1 A;  2PYK A;  3N6R A;  4BBR G;  2WAQ E;  4Y52 H;  5BR8 L;  2YYZ A;  4X62 Q;  1PRT B;  3MWY W;  5C3E B;  1CKM A;  4L8J A;  3QR8 A;  1VQ8 A;  1EQR A;  1Z47 A;  4RGO S;  1SEB D;  2EYH A;  3W1G A;  2BCO A;  4C3J H;  1MI2 A;  2K32 A;  1IZ6 A;  1JWU D;  3BVZ A;  3AU7 A;  1LT3 D;  1U4R A;  1B4O A;  1AEX A;  1M4V A;  5JPM C;  4KHP Q;  1AW7 A;  3SVM A;  1B9M A;  3KLS A;  4ID6 A;  4LMQ D;  2L0C A;  2XN9 C;  1E2Z A;  3BDL A;  3HKS A;  4PZ6 A;  1R9T H;  3TRZ A;  1G29 1;  1KXL A;  2M00 A;  1QVF A;  2EYP A;  4X62 L;  1STB A;  1GHJ A;  3CAM A;  3NQI A;  3I4O A;  1VQ4 A;  3PO3 B;  3M4Y A;  4IUR A;  3UI2 A;  3MC0 B;  5ISR A;  2E76 C;  2ICE C;  1F2L A;  1PRT D;  4ZK9 B;  4NPS A;  4Y7N H;  4KHP L;  4JI5 L;  5EPL A;  3V05 A;  4RHR A;  3Q6S A;  1RTO A;  4ODG A;  3D6W A;  5IT9 c;  1EU4 A;  1UE5 A;  3PIO 3;  2ZTE A;  3DEO A;  2R93 H;  3CU7 A;  2NTT A;  1UEA B;  4IUN A;  4UP8 A;  3CCM A;  4POG A;  3F2D A;  2XWJ B;  4F8M A;  1GXD C;  2HDL A;  3IAY A;  3S16 H;  3T53 B;  2NZO A;  4NW2 A;  4CJ2 C;  4QB4 A;  3RUZ A;  1ONL A;  2JQO A;  4AQY Q;  2GA4 B;  3S1R H;  1YI2 A;  3D3R A;  4AH6 A;  1YIJ A;  1IYV A;  3TS0 A;  2EJM A;  1JT8 A;  4A3C H;  3K7A H;  3HZX A;  3PMF A;  1UEB A;  4QF4 A;  4JI2 Q;  1PTO H;  3CC4 A;  3DWP A;  4C3H G;  4K8I A;  4BBS B;  3I7F A;  4OIJ A;  1ILP A;  1BBU A;  4GN3 B;  4GOP A;  2XIW A;  2JSO A;  5JVG 3;  2NB0 A;  4NB3 A;  5EKK A;  1BF4 A;  1GUW A;  2M2L A;  3U4Z A;  1D1I A;  1X32 A;  4AQY L;  5JVH 3;  3SE0 A;  5IE8 A;  2J0T D;  2R92 G;  1SYG A;  1Y8N B;  4BBR H;  3KLS X;  4JI2 L;  2ZTD A;  1DOK A;  5A35 A;  3C46 A;  1PXU A;  4JC0 A;  3VR5 A;  4FXG C;  2FXQ A;  3GO5 A;  2H1E A;  5GAH C;  4JBM A;  5IGF A;  3SEB A;  3CF5 A;  2D0P A;  3H09 A;  4HN7 A;  3S1M H;  1N34 Q;  3KJP A;  3T56 B;  4GLA C;  4KI0 A;  4A3F G;  2MNA A;  2D9U A;  4CKC A;  4BA1 I;  3E6Z X;  4V0B A;  3S14 B;  2YTY A;  4JI6 Q;  2MO1 A;  1LYL A;  1A2T A;  4EVO A;  2HHH Q;  1L2F A;  1MHW C;  1E7Z A;  1GO3 E;  1KAW A;  4BY1 B;  1EQT A;  2NN6 G;  1WD1 A;  1QJO A;  2KBN A;  4NMZ A;  3S17 H;  2EYM A;  1MJC A;  1YNN D;  1YBY A;  3AB9 A;  5KND A;  1PH7 A;  1EZ6 A;  1N34 L;  1Y8O B;  4YCW A;  1QNU A;  2JA8 H;  4NP5 A;  3S1N B;  1XJV A;  1NE3 A;  4ABN A;  1EQV A;  1BR9 A;  3H6M A;  1SXT A;  2WAC A;  2BE5 D;  2NTS A;  2ZXP A;  2UUC Q;  2RCN A;  1DXM A;  4JI6 L;  5G3L D;  1STE A;  2B63 B;  3STB C;  2HHH L;  3GTG H;  3S2H H;  3J7A F;  4OO1 I;  3HOZ B;  5NUC A;  5I9P A;  1V1P B;  4DK6 C;  4GOP C;  1A6X A;  5LHY 1;  1ML0 D;  2ICI A;  1HZB A;  4AYB B;  3H3V H;  4Z9C B;  4JG2 A;  2F0U A;  1EYA A;  4LF4 Q;  1D8L A;  2B8F A;  1B70 B;  1JC7 A;  2NVY H;  1JB7 A;  4PMB A;  2JA6 G;  1NNX A;  4A3I B;  2KOL A;  1ZYR D;  1IL2 A;  2UUC L;  2LSS A;  2L9H A;  1K8O A;  1RIP A;  1G8Z D;  3GQB A;  4DXF A;  4HJ5 A;  2ZJQ A;  3K6O A;  1Y69 U;  1VQG A;  3NPP A;  4TQU S;  3IRB A;  3F2U A;  1I5F A;  3RLO A;  3UDI A;  3K58 A;  1WCM G;  1I4P A;  2RA4 A;  4LAA A;  3CC7 A;  3AFQ A;  1WOC A;  1YJN A;  3RZO B;  1HNW L;  1R4Q B;  4X66 Q;  4R8I A;  4JI4 L;  2KA7 A;  4BXX G;  3RN2 A;  4C3I B;  2AQ3 B;  3TZU A;  1JJG A;  4HJ8 A;  3KF6 A;  3CCR A;  1G6P A;  5IT9 L;  2Q2U A;  4GNX C;  3K5N A;  5M5X B;  4LF7 L;  2R92 H;  2JYO A;  5KEE A;  2F0D A;  3I56 A;  1D1K A;  2NZH A;  4NXN Q;  1A15 A;  3AFP A;  1Q8K A;  2QA4 A;  1PH3 A;  1KDA A;  4FYD A;  1LAC A;  3T16 A;  4A3D B;  4P72 A;  4HIO A;  2RDF A;  4X66 L;  2JA7 G;  3PUW A;  1KD1 C;  2K05 A;  5J3B A;  1E3P A;  4KKS A;  4FP5 D;  3RMH A;  1N32 Q;  3HOY G;  3TEH B;  2QKI C;  4NXN L;  3GTL B;  2F0W A;  1QOH A;  1A63 A;  1SE8 A;  3F1Z A;  1NAP A;  2EDG A;  4KY7 A;  2NN6 H;  3IFT A;  2J7Z A;  3G6J B;  3MFY A;  1B53 A;  3P75 A;  4I7Z C;  5C4J H;  2RKS A;  5M3F B;  1GUG A;  3KBX A;  5M9O A;  4K0K Q;  1DOM A;  3KLW A;  2N49 A;  5C3W A;  2LXJ A;  3K80 C;  5DAU A;  3SGI A;  1VQL A;  1E1O A;  4J8Q A; 
#chains in the Genus database with same CATH homology
 5CV4 A;  1IKM A;  1GUO A;  5FO9 B;  3NUC A;  2C5C A;  1WTX A;  3ONA B;  2KQ3 A;  2D62 A;  3PUV A;  5JOB A;  1GUS A;  3MEH A;  3D8G A;  1C8C A;  1LTB D;  2FMC A;  2VNU D;  1YNJ C;  2A6H D;  4IUU A;  1JE4 A;  3VYS A;  3NBI A;  2FHT A;  4XDX A;  1WTR A;  5K5P A;  5LL6 S;  3I4L A;  3RD4 A;  5FLX L;  2C9O A;  5CR3 A;  2IL8 A;  2LMC B;  4C1N I;  3LWU A;  2A6E D;  2JEB I;  4FNF A;  1ENA A;  3A8J E;  2IJ0 A;  3J80 L;  5COY A;  4C3H B;  2VB3 X;  3ERO A;  1H9M A;  5T1I A;  3C3L A;  4RGN A;  1BQQ T;  2ZXR A;  4NDX A;  4CJ0 B;  3TME A;  4K5V A;  4IUT A;  2EY5 A;  1HUN A;  3HG9 A;  2PO4 A;  1RDP D;  3DM1 A;  3QO2 A;  1WTW A;  1D6E C;  1M8A A;  4PMW A;  2PZU A;  4IAL A;  3DEP A;  3C1F A;  4X3K A;  5I9O A;  2L12 A;  1QG7 A;  1STN A;  4B08 A;  4A3F B;  1PDQ A;  3TP5 A;  1SJE D;  4WJW A;  1SE3 A;  3R2I A;  3HOW B;  3QOJ A;  2O5I C;  5ELD A;  2L5T A;  5COR A;  4DK1 A;  4ILW A;  5FO8 B;  2OT2 A;  1BXT A;  1TS4 A;  1NUC A;  3T13 A;  5AFW A;  2EJF C;  2FJ2 A;  3O13 A;  1LT5 D;  4KY6 A;  5I2Y A;  2CW0 C;  3GV3 A;  1LTS D;  3CQZ B;  1IW7 C;  3CRL C;  3QG1 A;  1NR4 A;  5D3D A;  1Z6H A;  3KF8 A;  1FYC A;  2L1B A;  5EBC A;  4QCL A;  2A74 C;  1WVL A;  1XXG A;  2H4O A;  1WCM B;  1FNV A;  4TKO B;  2E75 C;  1GUT A;  4OO1 G;  3U9S A;  1EY8 A;  3MAQ A;  1C4Q A;  4XQN A;  5ELB A;  1PLF A;  4OGQ C;  2JA7 B;  2OF1 A;  2F4I A;  4U67 3;  1SSO A;  4KY5 A;  3HOX B;  2F0O A;  2M9V A;  2F0I A;  5ELF A;  2CVR A;  3PUX A;  2PMZ B;  2NZ1 D;  4IN3 A;  1I50 B;  3R2T A;  1SYE A;  4C3I G;  4XT3 B;  1I4R A;  1VF5 C;  1TR5 A;  1VDZ A;  1B44 D;  3GTJ B;  2KEC A;  4C2M B;  2A69 C;  2SNM A;  1RHP A;  4HCS A;  2B8G A;  4K8J A;  1OXV A;  1TS5 A;  3RLF A;  1SNP A;  1B50 A;  1MSG A;  3NHH A;  2K28 A;  3S15 B;  3Q24 A;  1WTO A;  3E0J A;  2PW5 A;  1LTI D;  5E1F A;  4RKL A;  1VMP A;  5BN5 A;  1F9P A;  5HGT A;  5KRU A;  2RQX A;  4V19 0;  4RWS C;  3VR2 A;  3X3N A;  4G57 A;  1RTN A;  1U4P A;  4IFD I;  2I46 A;  1QNK A;  3Q0A A;  3BDC A;  1VMC A;  2IPK D;  1Q12 A;  4OO1 H;  4TRD A;  2OEO A;  5KYL A;  4XQQ A;  5ELE A;  2F0J A;  5HUR A;  2K1B A;  1O80 A;  4KN7 C;  5IOC A;  2EY2 A;  3CHB D;  2FFK B;  2I07 B;  3WOF A;  4DU9 A;  1SAP A;  3GTK B;  3R8B A;  4RA8 A;  2JE6 I;  2RSN A;  1CHQ D;  1PFN A;  1KNE A;  5C0X I;  3OPO A;  1I4H A;  3VYU A;  1F9R A;  1F9Q A;  4IFD J;  3C1E A;  3MA2 B;  1UNS A;  4J1M A;  4XQJ A;  1Q3L A;  4XT1 B;  1CA6 A;  3EFX D;  3J81 L;  2F0S A;  5CV6 A;  2WKC A;  3GD7 A;  3HOV B;  4FF2 A;  5BN3 A;  1PZI D;  4RGM A;  4I65 A;  3PUZ A;  5M5W B;  2AUK A;  3JAM L;  1HCZ A;  2F0K A;  4G7Z C;  4RCO A;  3I4N B;  1HRJ A;  2O5J C;  1O7Y A;  2PZW A;  2RVL A;  1LTA D;  1TS2 A;  1ESR A;  1CQV A;  4HR7 B;  4X3S A;  4KMU C;  5E4X A;  2F0N A;  2K03 A;  1EEI D;  4A93 B;  4DNT B;  3SXH A;  4H7B A;  3DUZ A;  1U4L A;  3ND9 A;  1H9S B;  1TS3 A;  2AQ1 B;  1SJH D;  2AWN A;  2JP1 A;  1JR0 D;  4DXG A;  1A3T A;  2ZT9 C;  1BCP C;  4N9T A;  5CV7 A;  3H0G B;  3HRZ C;  1EU3 A;  4KTA A;  3A8I E;  3OHX C;  1HTP A;  3K5M A;  3NTK A;  5JEA J;  2TMP A;  1AN8 A;  4RKB A;  1V1O A;  3FEW X;  3OMC A;  3SK4 A;  2LKV A;  1JWS D;  1TKW B;  3HOU B;  4HCE A;  3M7G A;  1TT2 A;  3M4O B;  1A2U A;  1MD2 D;  3A54 A;  2NVX B;  1ENF A;  5FO7 B;  2IW3 A;  2Q8T A;  3L7Z C;  4ZKB B;  1Y1V B;  3MZ5 A;  3K5O A;  4KN4 C;  2X6L A;  3SK8 A;  2A5H A;  2F03 A;  3EJI A;  5D3I B;  1JOR A;  1BBX C;  1WTP A;  4K14 A;  4E6I A;  1TVX A;  1EWH A;  3EA6 A;  2RDH A;  2K6A A;  4DA2 A;  4TSS A;  2KUM A;  4RHS A;  4WOR A;  1OXS C;  2Q8R E;  1TU2 B;  2D5D A;  1CZG A;  2WKD A;  2QCP X;  4DAV A;  3R3O A;  2QF7 A;  1EYD A;  3IKJ A;  3VYR A;  5K36 G;  2O2L D;  1CQF A;  1OXT A;  2KJX A;  3IL8 A;  4KHV A;  3WOE A;  5C5M A;  5IGE A;  3VYT A;  1QB5 D;  3VA5 A;  5DM7 3;  1Y8P B;  1YNJ D;  2K04 A;  4X3T A;  4HSP A;  2E2J B;  4KKU A;  4EGV A;  3DWA A;  5KNC A;  2E74 C;  1H9R A;  1Y1W B;  4KJO A;  1SMY C;  5E4W C;  2F0M A;  1IYU A;  4A3M B;  1ENC A;  2K5Q A;  1IL8 A;  2K5D A;  3FVQ A;  2Z8L A;  2R3Z A;  5EGT A;  3R93 A;  4KJN A;  1WD0 A;  1EY0 A;  5CBE E;  3BYT B;  1O7Z A;  4FXK C;  5I6W A;  4CBV A;  3W3A A;  2F0P A;  5C4X B;  3S2D B;  2YU9 B;  1BOS A;  4QUF A;  2E2H B;  1S5B D;  2CHB D;  5C3X A;  2NUC A;  4Q5V A;  5M5Y B;  1X3P A;  4CKE A;  1VF7 A;  1ZKO A;  1GHK A;  3TP7 A;  1J8I A;  1A3U A;  1PRT F;  4XTC S;  1I4Q A;  4PMC A;  1DM0 B;  1BCP F;  1DOL A;  1FGB D;  3VA7 A;  1EZ8 A;  2SOB A;  2XWB B;  1EIG A;  4IFD G;  3KK7 A;  4P2C B;  1O78 A;  4X3U A;  1STA A;  5A2Q L;  3SK6 A;  1D5X C;  1RF2 D;  4PNY A;  4FF4 A;  1T5E A;  4YIJ A;  1QWY A;  3NTH A;  3IFD A;  1ZEQ X;  5JPN C;  2PQE A;  4A3G B;  4R8N A;  2V4D A;  1SYF A;  3G7L A;  3PO2 B;  1EIH A;  1W6K A;  2ZXO A;  5K36 H;  2O4X A;  5C0X G;  4O1N A;  2EY1 A;  4DN4 M;  1HA6 A;  1PTO C;  2WV6 D;  2KED A;  5EPJ A;  5DNF A;  3MVV A;  1LAB A;  1S5E D;  4JBW A;  5IIF A;  1S4Z A;  2D2C C;  2B2W A;  4J6H A;  3DMU A;  4K5W A;  3T4A C;  4HSV A;  2F0Q A;  3NWT A;  1I6V C;  4HMI A;  1LLR D;  1EY9 A;  1JB3 A;  3I70 A;  1K83 B;  4CJ1 B;  5JAV A;  1VCI A;  3P20 A;  2XSC A;  1H9J A;  1JOO A;  4QMG A;  3CKI B;  4BS9 A;  4UAI A;  5M3M B;  2CW0 D;  1HPC A;  4F88 A;  1ILQ A;  1IW7 D;  2CQA A;  1XTC D;  4MHE A;  2KVM A;  3FKI B;  4HTH A;  2EY6 A;  2BOS A;  3HGB A;  1SYC A;  3J7A V;  4H13 C;  5IGB A;  3E5S A;  3PUY A;  3A55 A;  1B2T A;  2F3W A;  1TWC B;  2EYF A;  2L11 A;  3PV0 A;  5JEA G;  3OWE B;  4XYQ A;  2ID0 A;  3NQT A;  2SDF A;  1DYQ A;  2FMM A;  2PPB C;  2XRS D;  5G3L F;  2NVQ B;  3D4D A;  1WTV A;  4C1N K;  4IFD H;  3LX0 A;  1PFB A;  3X3M A;  2XVS A;  1SFO B;  2EXZ A;  1UAP A;  1I3Q B;  1BDO A;  4DNR B;  1LT4 D;  3P7J A;  5D14 A;  3HP3 A;  3BVM A;  1A3V A;  2F1M A;  5CV5 A;  3EQL C;  1HFG A;  4FF1 A;  4B9X A;  3V2T A;  1E2W A;  1EYC A;  1F2M A;  4IUQ A;  3H3V C;  2B2W C;  3K59 A;  2BA0 A;  3K57 A;  1JWM D;  4CGY B;  2NBF A;  2Z4H A;  4BWG B;  5EBD A;  1AZP A;  5CV9 A;  2PW7 A;  2F0G A;  1SE2 A;  5IT9 E;  3VR4 A;  1IKL A;  4ULL A;  4IZ8 A;  5FKA C;  2A69 D;  3TP6 A;  1PFM A;  1O7L A;  4DAY A;  2EYJ A;  4M1U B;  4BY7 B;  5FOB B;  1SNO A;  4IUP A;  1KDB A;  4C3J G;  1KAB A;  1LV9 A;  1RJT A;  2AQ2 B;  1EY5 A;  3LWE A;  3OWF A;  1B3A A;  1AP0 A;  1G2T A;  5J39 A;  1AFP A;  4NKL A;  4MIU A;  1TWG B;  3L9A X;  3GV6 A;  1V8Q A;  3FDT A;  2F0E A;  1S5D D;  5CV8 A;  1RKN A;  4FXD A;  2ENB A;  2B2V A;  1FR3 A;  5JEA H;  4DGZ A;  1PTO F;  1JQY D;  2X69 A;  3OOC A;  4QIW B;  4RH6 A;  1F2Z A;  2F3V A;  1DON A;  4CKB A;  5DM6 3;  5EKI A;  1GJX A;  5IGD A;  4ZYS A;  4BA2 I;  3GTP B;  4K2K A;  1Q1B A;  2VUM B;  1MBY A;  1I4G A;  1DD2 A;  2A68 C;  3I90 A;  3BYY B;  1LT6 D;  1KLU D;  3TN2 A;  2G9H D;  1STY A;  3GP7 A;  1TII D;  3GTQ B;  3GTM B;  2Z4I A;  1G6Z A;  4R9W A;  2K5W A;  2PNR C;  5IGG A;  3LNN A;  3VR6 A;  1C48 A;  3NBH A;  2KCN A;  5EQ0 A;  2L55 A;  3K5L A;  4K2L A;  1PZK D;  1U4M A;  4RAU C;  1SE4 A;  1OXU A;  3J80 E;  1GUN A;  1D5M C;  4A3B B;  1BCP B;  1Q8I A;  2VXW A;  2VB2 X;  3QJY A;  2QDB A;  1CM9 A;  4N9P A;  1L0X B;  1NSN S;  1HQM C;  3NTI A;  5BN4 A;  2B2V C;  3SK5 A;  1HA5 A;  3T51 B;  2EYL A;  4KD4 A;  1MSH A;  1RD9 D;  3MXU A;  2F0H A;  1OXX K;  3OIQ A;  1CTM A;  3I4M B;  1GOZ A;  4HED A;  5C0X J;  4JK1 C;  4FO2 A;  5CC4 A;  5J1Z A;  2NVT B;  1BCP D;  1PYW D;  4PQX A;  2G9D A;  2B2T A;  1ROD A;  1QIL A;  1JIC A;  2XRQ D;  3FPP A;  2NWG A;  3A7L A;  3A8K E;  2F0L A;  4RGT A;  2F0V A;  2IT1 A;  2JA5 B;  5JJZ A;  2WII B;  3I8Z A;  3H94 A;  3N52 A;  4Q0F A;  1STG A;  1TWH B;  3A7A B;  2NYZ D;  2Y0S B;  2PCF B;  1EEF D;  1G91 A;  5ELC A;  2SNS A;  3HKZ B;  4C56 C;  1SDF A;  3DHQ A;  2LY7 A;  5D65 A;  1PRT C;  4WRD A;  2EVB A;  2WAQ B;  3OW7 A;  4H0L C;  3NP8 A;  1LO5 D;  1ET6 A;  2DNC A;  4KKT A;  5C6A A;  1HUM A;  3SHL A;  3KLR A;  1HHV A;  3NWS A;  5TSS A;  3RZD B;  2DN8 A;  2DNE A;  1BO0 A;  1H9S A;  1X3Q A;  1CFM A;  1TY2 A;  2J4X A;  3P1H A;  1JOQ A;  2HUG A;  3OSO A;  1LTG D;  1G2S A;  1CA5 A;  2TSS A;  3J7Y W;  1LTR D;  1TWA B;  2MUY A;  3GTO B;  5IGC A;  2E2I B;  1ESF A;  2B2T C;  3QIA A;  4L6T B;  4EQP A;  2K33 A;  4DAP A;  2KCC A;  5EKL A;  4K5X A;  1PMR A;  2FIN B;  1SNQ A;  4K6L A;  2MJ8 A;  3TP8 A;  4C3J B;  1U9R A;  1EOT A;  1OO9 B;  2R6G A;  3A56 A;  1F9S A;  4ME5 A;  1SMY D;  3MFG A;  1CHP D;  5I6Y A;  5KNB A;  1KLG D;  1R9T B;  1V1P A;  5I4D A;  1FNU A;  3K0Y A;  1BUV T;  3QOL A;  3Q22 A;  5EJW A;  1TWF B;  4Y7N B;  1V43 A;  3ZYY X;  2XNA C;  2JXM B;  2B2Y A;  5C5L A;  1YNN C;  3MXP A;  3QB3 A;  2EZV A;  3L3O C;  4RCN A;  2R93 B;  3EVQ A;  4O42 A;  2MHV A;  1J9O A;  2BE5 C;  3ITP A;  3S16 B;  3NK9 A;  5CYU A;  4ZLT F;  2RBM A;  3S1R B;  3K7A B;  4G4K A;  5IOD A;  3ND8 A;  1PTO B;  2EE1 A;  1SND A;  2EJG C;  3D6C A;  3TDQ A;  1HQR D;  2K01 A;  1JCK B;  1ZYR C;  2MGS A;  4DK0 A;  1F2Y A;  1ZXT A;  4XXE A;  3DXJ C;  5EPK A;  3TBI B;  3H91 A;  1L0Y B;  1T5X D;  4BBR B;  4QUC A;  5C4H A;  3I3C A;  4ZKC B;  1DJR D;  3BDO A;  5E3F A;  4DFA A;  2IX3 A;  3HEJ A;  3I91 A;  4IQZ A;  1PTO D;  3NXW A;  3S1M B;  3BG3 A;  5KYI A;  2R61 A;  2HCI A;  2IWH A;  5KGU A;  3VR3 A;  3J81 E;  3QWN A;  4LJZ C;  1KAA A;  2B2Y C;  3W2D A;  3NE5 B;  3S17 B;  1II3 A;  3DWQ A;  2WIN B;  4ZUJ A;  1JOK A;  2JA8 B;  3JAM E;  2SEB D;  2KHS A;  3I73 A;  3I72 A;  2IX0 A;  3MXG A;  1UUP A;  1RCV D;  4OIK A;  3MHB A;  4UDU C;  1EY7 A;  3GTG B;  3S2H B;  2MPM A;  1CK1 A;  4EQO A;  3D31 A;  2LFN A;  5LL6 X;  1MGS A;  2X6G A;  4EQN A;  1KTK A;  2A73 B;  2NVY B;  3NSW A;  2DY8 A;  2F0F A;  1SYD A;  4B9W A;  5F2D A;  1S5C D;  3BVG A;  3V96 A;  1TY0 A;  4CHT B;  3C2P A;  4ZAI A;  2AUJ D;  1CT1 D;  2A6H C;  2L4N A;  3KUP A;  3Q23 A;  5FK9 C;  1H9K A;  1STH A;  1WTQ A;  3ERQ A;  3CRK C;  4L63 B;  2HQE A;  4H44 C;  5T1G A;  2KEE A;  2N55 A;  3FRP B;  3S9W A;  1HXY D;  2R92 B;  3U9O A;  1I4X A;  1TQO A;  2BDO A;  4F87 A;  1KDC A;  1LTT D;  1CI3 M;  2A6E C;  1ICW A;  1DCZ A;  1BNZ A;  4PV1 C;  4G7O C;  3TZD A;  4K6D A;  1SNM A;  3BZD B;  3D4R A;  1K8M A;  1DZ1 A;  3SDZ A;  1AZQ A;  4KHZ A;  3WDN A;  3M7N A;  4FF3 A;  3FPU B;  1XX8 A;  1F77 A;  2NN6 I;  2HDM A;  3BS1 A;  1S5F D;  5C4J B;  4OL7 A;  2RSO A;  3MXN A;  2Q8I B;  1FNW A;  1EY4 A;  3S1Q B;  1EWC A;  2B2U A;  4M8A A;  5C0X H;  4XIG S;  2HCC A;  4KK7 A;  2K7V A;  1Z7T A;  3TSS A;  5C4Z A;  4IUV A;  4LK1 C;  1D2B A;  5J22 A;  4U68 A;  4KD3 A;  2JA6 B;  5CBA E;  1XYI A;  1E2V A;  1B9N A;  1R4P B;  1E0B A;  1XWE A;  5KIX A;  1W6J A;  1EY6 A;  5CMD A;  1HTL D;  3OIP A;  2PZT A;  1HFN A;  2A68 D;  2IX1 A;  4S3S A;  2BDN A;  1SYB A;  4ZUI A;  1CZW A;  4OHJ A;  2R7Z B;  4ZRZ A;  2B39 A;  2QEJ C;  2MP1 A;  2EPB A;  2DY7 A;  5DEH A;  1B1Z A;  3M3Y B;  3HS0 C;  1IHZ A;  2N88 A;  1NR2 A;  4G7H C;  4KV6 A;  3AMU A;  3D4W A;  2EYO A;  3KBG A;  5C44 B;  2QIL A;  3HOY B;  1D5Z C;  1Q90 A;  3MTS A;  4HMJ A;  3OMG A;  2B2U C;  1EFI D;  3FMC A;  2RDG A;  1QCB D;  1SBB B;  2JEA I;  4RFB A;  2AWO A;  2Z1C A;  1ET9 A;  4DF7 A;  2F0T A;  5I2X A;  2WP8 J;  2BA1 A;  1EL0 A;  4A3E B;  1NCV A;  2E2D C;  2WB1 B;  1Q1E A;  4FVM A;  1KNA A;  4F7X A;  1I6H B;  1QE6 A;  2EOT A;  1PZJ D;  2OXP A;  5CGK A;  3M85 A;  4HAE A;  5A2Q E;  5FLX E;  4XYO A;  4GZY C;  4A3J B;  3URY A;  4MN3 A;  2LS0 1;  1SNC A;  1FD7 D;  4ZQ3 A;  3PIP 3;  4A3K B;  4WFN 3;  3SR1 A;  2PYK A;  3N6R A;  2YYZ A;  1PRT B;  3MWY W;  5C3E B;  4L8J A;  1Z47 A;  4RGO S;  1SEB D;  2EYH A;  2BCO A;  1MI2 A;  2K32 A;  1JWU D;  3BVZ A;  3AU7 A;  1LT3 D;  1U4R A;  1B4O A;  1AEX A;  1M4V A;  5JPM C;  1AW7 A;  3SVM A;  1B9M A;  3KLS A;  4ID6 A;  4LMQ D;  2L0C A;  2XN9 C;  1E2Z A;  3BDL A;  1G29 1;  2M00 A;  2EYP A;  1STB A;  1GHJ A;  3NQI A;  3PO3 B;  3M4Y A;  4IUR A;  3UI2 A;  3MC0 B;  5ISR A;  2E76 C;  2ICE C;  1F2L A;  1PRT D;  4ZK9 B;  5EPL A;  3V05 A;  4RHR A;  3Q6S A;  1RTO A;  4ODG A;  3D6W A;  1EU4 A;  3PIO 3;  3DEO A;  3CU7 A;  2NTT A;  1UEA B;  4IUN A;  2XWJ B;  4F8M A;  1GXD C;  2HDL A;  3IAY A;  3T53 B;  4NW2 A;  4CJ2 C;  4QB4 A;  3RUZ A;  1ONL A;  2GA4 B;  3D3R A;  1IYV A;  2EJM A;  3HZX A;  3PMF A;  4QF4 A;  1PTO H;  3DWP A;  4C3H G;  4K8I A;  4BBS B;  4OIJ A;  1ILP A;  2XIW A;  2JSO A;  5JVG 3;  2NB0 A;  5EKK A;  1BF4 A;  1GUW A;  2M2L A;  1D1I A;  1X32 A;  5JVH 3;  3SE0 A;  2J0T D;  1SYG A;  1Y8N B;  3KLS X;  1DOK A;  5A35 A;  3C46 A;  1PXU A;  3VR5 A;  4FXG C;  3GO5 A;  2H1E A;  5IGF A;  3SEB A;  3H09 A;  4HN7 A;  3T56 B;  4KI0 A;  2D9U A;  4CKC A;  4BA1 I;  3E6Z X;  4V0B A;  3S14 B;  1A2T A;  4EVO A;  4BY1 B;  1EQT A;  2NN6 G;  1WD1 A;  1QJO A;  4NMZ A;  2EYM A;  1YNN D;  3AB9 A;  5KND A;  1EZ6 A;  1Y8O B;  1QNU A;  4NP5 A;  3S1N B;  4ABN A;  1EQV A;  1BR9 A;  3H6M A;  1SXT A;  2WAC A;  2BE5 D;  2NTS A;  2ZXP A;  1DXM A;  5G3L D;  1STE A;  2B63 B;  3J7A F;  4OO1 I;  3HOZ B;  5NUC A;  5I9P A;  1V1P B;  1A6X A;  5LHY 1;  1ML0 D;  2ICI A;  4AYB B;  4Z9C B;  2F0U A;  1EYA A;  2B8F A;  1JC7 A;  4PMB A;  4A3I B;  2KOL A;  1ZYR D;  2L9H A;  1K8O A;  1G8Z D;  3GQB A;  4DXF A;  3K6O A;  1Y69 U;  3NPP A;  4TQU S;  3F2U A;  3K58 A;  1I4P A;  2RA4 A;  4LAA A;  3RZO B;  1R4Q B;  4R8I A;  2KA7 A;  4C3I B;  2AQ3 B;  3TZU A;  5IT9 L;  3K5N A;  5M5X B;  2JYO A;  5KEE A;  2F0D A;  1D1K A;  1A15 A;  1KDA A;  4FYD A;  1LAC A;  3T16 A;  4A3D B;  2RDF A;  3PUW A;  2K05 A;  4KKS A;  4FP5 D;  3RMH A;  2QKI C;  3GTL B;  2F0W A;  1QOH A;  1NAP A;  2EDG A;  4KY7 A;  2NN6 H;  3IFT A;  2J7Z A;  3G6J B;  3MFY A;  1B53 A;  3P75 A;  4I7Z C;  2RKS A;  5M3F B;  1GUG A;  3KBX A;  5M9O A;  1DOM A;  5C3W A;  5DAU A;  4J8Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...