4FP5D

Heat-labile enterotoxin ilt-iibb5 s74a mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
98
structure length
98
Chain Sequence
GASQFFKDNCNRTTASLVEGVELTKYISDINNNTDGMYVVSSTGGVWRISRAKDYPDNVMTAEMRKIAMAAVLAGMRVNMCASPASSPNVIWAIELEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-activity correlations of variant forms of the B pentamer of Escherichia coli type II heat-labile enterotoxin LT-IIb with Toll-like receptor 2 binding.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
molecule keywords Heat-labile enterotoxin IIB, B chain
total genus 24
structure length 98
sequence length 98
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2012-06-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.50 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4fp5D00
1QB5D 4FO2A 5G3LF 1QCBD 4FNFA 5G3LD 1TIID 4FP5D
chains in the Genus database with same CATH superfamily
2B2UA 3WWVA 3R3OA 1LT4D 3E9HA 2HDLA 5IWAQ 3UE0A 4R1JA 1TY2A 3OSOA 2MGSA 3F2CA 4A3IH 3SR1A 3GTMB 1QNUA 2Z4IA 1JOKA 2B2VC 2KHJA 4IPCA 3U58A 2I0QA 1Y8PB 4R4CA 4DR5Q 3E6ZX 4LF9L 3M3YB 1MHWC 1GHKA 4A3KG 4K5XA 4DV2Q 1SJHD 1S72A 1F77A 4C1NK 1Q81C 4LUZA 4FNFA 4HJ9A 1RODA 3J7AF 2IHFA 4K5WA 3FPPA 5JVH3 3ER0A 1NMFA 1ONLA 2ZJQA 2TSSA 4BBRH 1XPOA 2FFKB 4Q0FA 2EQSA 1V1OA 3I70A 1LABA 1TKWB 4R4TA 4ULLA 1YNND 1TIID 4IN3A 2GA4B 4DR7L 1UAPA 3GTPH 1S5DD 4KY5A 4DV1Q 3PUWA 4BS9A 1IBKL 1SMYC 4ILWA 3RN2A 4WORA 2NZ1D 4QB4A 1KDAA 3NWTA 2L15A 3PIP3 1WOCA 2NVXH 3PO2G 1KTKA 4DK1A 4LFCQ 1C48A 4V0BA 5FKAC 1EY0A 1HZBA 5FLXE 1I4GA 4PMCA 1I6HB 4A3GB 5C4JB 2CFMA 2JA6G 1FNVA 1WTRA 4OO1G 1U4MA 4YY3L 1AFPA 1B50A 3ND8A 5J3BA 4A3FG 3X3NA 2ID0A 2PPBC 2F3VA 4PQXA 2RF4A 3J7AV 4C3HB 3R2TA 1Z6HA 2PNHA 1S5BD 2MHVA 1TS4A 2KA7A 3H15A 3FHWA 4RWSC 1J9OA 3OMCA 1KQSA 3T51B 1KD1C 2QDLA 2WIIB 1EQQA 3DXJC 3EROA 3OYYA 2F4VQ 1IZ6A 4UP7A 3EVQA 1JB7A 5I2XA 1BCPB 5FJ8G 3I4LA 3PGZA 1K8AC 1Y69U 4XYOA 3TBIB 4RKLA 4CHTB 3I4NG 3SK4A 1ICWA 4GLXA 1SLJA 4IJLA 4DR2Q 1FYCA 4Y7NH 1VQDA 2RHSB 4DR2L 2QCPX 2SNMA 3OW2A 3HOWG 5LMUL 3V05A 4RGNA 1IYJB 4DKAC 3I7FA 2UUCL 1GUSA 3UE1A 2NVXB 3S15H 1OXTA 1PRTF 1SE2A 4B3TQ 4OX9L 1L0WA 2PQAB 3T1YL 1AE3A 1A3UA 4QUFA 1Q12A 3D4RA 1YHQA 2B8FA 5I4DA 3KOJA 2K6AA 4K6DA 2B3GA 1BBUA 5CV4A 4G57A 2ES2A 1C4QA 1LM0A 2BCOA 1N34L 3J7A5 4X65Q 2XWBB 2HIVA 4P74A 1WFQA 2NB0A 3W1GA 5IP7H 4KJNA 4BA1I 2RQXA 3RUZA 1Y1VB 2A69D 2Z8LA 4BBRB 4AIMA 1EEID 4JI3L 2B2WC 4CGYB 1BO0A 1KNEA 2IPKD 4JK1C 3N6RA 2B63G 4J8QA 1ZXTA 4QGUA 4DXFA 3Q0AA 1EL0A 2F3WA 1OO9B 3K81C 4XT3B 1D1IA 5A2QE 3I91A 5IGCA 4NXMQ 2JSOA 2PW5A 1B53A 2AQ3B 2F0NA 1BQQT 1M4VA 1PTOF 5GROA 2B8GA 1STAA 3RMHA 4KD4A 2OTLA 4FXDA 3F2UA 3MFGA 3HKZB 1YHAA 3HOUH 3R2IA 1E0BA 5M3FB 3CC4A 4RMFA 4YWMA 2IY5B 4OWTB 1BUVT 1SNPA 1SNDA 5ELDA 3BS1A 4B3TL 2KUMA 4ZLTF 1OXVA 1DXMA 1VQOA 1DOMA 4MHEA 3L3OC 3NBHA 4CDFC 2SNSA 3FKIG 1K73C 2X6GA 3NXWA 1JE4A 5GQOA 2UXDL 2OXPA 1FR3A 3PO3B 2NTSA 2UUAQ 2Q2IA 4IALA 4A3BH 4LF4L 3NUCA 2F0JA 2PW7A 4DV3Q 1H9JA 4C1NI 2F4IA 3DMUA 1Z7TA 1CZGA 3MTSA 1MIUA 3OWEB 2K05A 3T56B 1VQ9A 4L5SA 3UDIA 3KF6B 3D31A 4FVMA 4DR6Q 1B7YB 2K14A 2XVSA 2R6GA 4H0LC 1VQKA 4JI7L 1W3SA 1NTGA 4XQJA 2JA9A 2I5HA 4LF7Q 3EA6A 1S3OA 2E2IB 5IGFA 3E0EA 3HFZB 1J6QA 4C3HH 1O78A 2V4DA 5ISRA 1FGBD 3GTQB 2UXBQ 3A8KE 5C44B 1XMOL 1E2ZA 3CCMA 4QQBX 2B2YC 3HOZB 5M9OA 4DR3Q 2JEAI 2EXDA 1CSQA 3VR6A 2D0PA 3H3VH 3E9IA 4BY1G 1M90C 5EJWA 4A76A 1TWCB 5LHY1 2ZM6Q 2HQLA 4N8X1 5A2QL 2R3ZA 5D65A 5FOBB 3J80E 2PZUA 4JYAL 1KXLA 3S1QB 1G2SA 5LL6X 3KF8B 2DJFC 2KJXA 4OIJA 4OWXB 3QOJA 1E24A 2EOTA 2WB1G 5C4XB 4XT1B 3KDFA 3ERSX 4JBKA 1PTOD 3S16H 4A3KH 3A54A 2A68C 1Q7YC 1PV4A 2ICEC 3I4MG 1ASZA 2E75C 3FPUB 3V96A 2NYZD 2OCEA 3U9SA 4IPDA 2F0FA 4PZ6A 4UPAA 4WRDA 1VQIA 2OQ0A 1ESRA 1Q3LA 1V43A 1SNOA 3FDTA 4NW2A 4DK3C 3Q22A 2HHHQ 1O80A 1E7ZA 5IGGA 3JAMc 4DV7L 4DAPA 2UU9Q 5CV5A 4LWCA 1CUKA 1TXYA 2VQFL 2AUKA 3GDEA 4KN4C 3RN5A 4GNXC 2ZXRA 1HR0L 3HP3A 2DY8A 1EQTA 2ZTCA 4IOAA 4A3LG 4QIWE 5CYUA 1X55A 4P72A 4JI4Q 1B44D 3KLSX 1EYDA 1LTID 4HSVA 1BNZA 4KHZA 1EIGA 1IL2A 4KI0A 4DPGA 1DD2A 5CV7A 4F88A 1AN8A 4JW0A 3N52A 4IUQA 4BXXH 3MWYW 3K80C 1IW7D 4DA2A 4CKCA 5I2YA 1I5FA 3GTGB 3RZOB 3HOXB 1L1OC 2L0CA 2PNRC 1ET6A 2RVLA 3NSWA 2IJ0A 1QB5D 1HR0Q 5M5XB 4GN5A 2GN5A 4K6LA 4C3IG 2YU9B 5ELEA 2B2TA 4GKJQ 3UDFA 5C3EH 4A3EH 5M5YB 1K83H 3CRKC 1IYVA 3VDYA 3S1NB 3BU2A 3JAME 1LTAD 3SE0A 1RKNA 4CJ0B 3J81j 2QA4A 2JJQA 3CPWA 2UXCL 4NXNQ 1TWHB 4KN7C 4IUUA 2HT1A 4M1UB 3VR4A 1B70B 1DOKA 2ALYB 3R8BA 3I4MB 3T1HL 1HZCA 4DF7A 3BVGA 1NR2A 2NZHA 3MXUA 4OIKA 1EY8A 4ZCKA 1XXGA 2CQAA 5IT9c 1TS2A 4GKJL 1F2MA 2Z9HA 2WP8J 4JG2A 2JA8B 4EVOA 2F52A 1S5FD 4IJHA 1B9MA 1HPCA 4R4QA 1X3GA 4KY7A 4C56C 2VW9A 2HD3A 4AYBB 4APVA 3CC2A 1T5XD 4ME5A 4GN3B 4JI1L 4DAVA 2K01A 4H13C 1XMQL 3CQZB 2HCCA 1BCPC 2DUDA 5EPLA 5GADC 4L5TA 4AYBG 1RHPA 3K6OA 5IT9E 4QMGA 4RAUC 1J5EL 2VZAA 4JI0L 2F0VA 4JI4L 1TQOA 5IYDH 4DR3L 3BDCA 1HUNA 1QJOA 2LXKA 3C1EA 1PYSB 4GNXB 3K5LA 1EY7A 4KLKA 5C5MA 4HJ7A 2F03A 4LF6L 4J6HA 2IX0A 3CCLA 1F9SA 2VQFQ 4I7AA 3CCRA 5BN3A 4X62Q 4JI6Q 1QNKA 4HMIA 4XDXA 5IGBA 2HCIA 3J80i 3T13A 1XNQQ 2R7DA 1BKBA 5M3MH 1SYBA 4YCVA 3GTLB 5E4WC 4DR1Q 5NUCA 4N9PA 1D2BA 1FJGQ 4G7ZC 4IUNA 2NUCA 5IYCH 2NVTH 1HNWL 1ZYRD 3S9WA 2WV6D 1A62A 4JI3Q 4YWLA 1VF7A 3GTKH 2B2TC 2N8NA 4IUPA 1I4XA 1SROA 1TWAB 1CA6A 4HEDA 3M7GA 2EYPA 4A3GH 3KK7A 5G3LF 2VUMB 5M3FH 1QVGA 3K7AB 1K0RA 1GUOA 5C5LA 1IBML 4ME3A 3NQTA 1MD2D 2JA5B 1VQFA 1HUMA 2R7ZH 4PV1C 2K32A 3G6JB 4OWWB 4X3UA 4OO1H 1NCVA 3D0FA 1N33Q 1LO5D 1PA6A 1SMYD 3WDNA 3E5SA 4AYBE 1G2TA 3PO2B 4U673 4A93B 5LMUQ 2K5HA 3H09A 1H9KA 1JJ2A 4H44C 4PMBA 2D0OA 1IHZA 1Y1WG 5IGEA 2QEJC 1KRSA 2LKVA 1EWHA 1TWFH 2JA7G 1CTMA 1JWMD 2AHOB 2VS1A 1MBYA 1CK1A 3O13A 1LTBD 5KYLA 1ILQA 4C3JB 4DAMA 2PQEA 1GOZA 4CKBA 4IPHA 1RL2A 4X62L 4FF2A 4EGVA 4A3IB 3KLSA 3HKZE 3I90A 4A3JG 2B29A 4A3JH 2M2LA 3MA2B 3KBGA 4YHHQ 2D5DA 5E3FA 2RDHA 3S1QH 2B63H 2VB3X 2QW7A 3L9AX 4JI8Q 1Q46A 4WFN3 4DV0Q 2MFIA 4A3CG 4GKKQ 1TY0A 1V1QA 1KDCA 4Y7NB 1D5XC 4TQUS 3SDZA 1EZ6A 2K03A 1M8AA 3ERQA 3M4OB 1B3QA 3HOWB 2Q8TA 4YHHL 4MNOA 1SMXA 2Y0SB 3QJYA 1LT5D 4CKEA 3HOZG 4O2DA 5C44H 1E1OA 4DUZL 4HR7B 2E74C 4ZKBB 3J81i 2N78A 3KLRA 2PZTA 2FHTA 1X3QA 2Z4HA 1VQ7A 4JVZA 5KYIA 3B6YA 5DM73 1SE4A 2B2WA 1YHBA 1PLFA 3QG1A 3S1MB 1TWGB 2KOLA 1JOQA 1YNJC 4JPBW 2A74C 4IO9A 5EGTA 2KCMA 2WKDA 4JI6L 3OIQA 4NPSA 1L1OA 3CC7A 4JI2L 3F8TA 2BE5D 1BVSA 5JEAJ 2R92G 1BCPF 2KCNA 1O7LA 4HTHA 4B9XA 4LF8Q 1VCIA 4IUVA 3KLWA 2XSCA 3I4NH 2F0DA 3NBIA 1W2BA 1KIXA 2VQEL 1MJCA 3A7AB 2NN6I 1NE3A 1EUJA 1VQJA 5I6WA 1GKHA 1LTGD 2JQOA 4GLVB 2BH8A 1MJEA 2Z1CA 3G6EA 2N49A 2XN9C 1J8IA 4BA2I 1EY4A 1UEAB 2XRSD 5IIFA 3HKZG 1GHJA 5GAHC 1N32L 1H9SA 3LNNA 3D4WA 3E0JA 4KV6A 4HIMA 2JA8G 4K0KQ 1ZEQX 3TMEA 4BY1H 5L37A 1D7QA 4FF3A 3C2PA 2L55A 1NJIC 5EAYA 1HQRD 3RLNA 2FINB 2RA4A 4KKUA 4OELB 5IY0A 5I9PA 3MXNB 1V9PA 1TWFB 3BJUA 3T1HQ 2OF1A 3CCVA 3ND9A 2R7FA 5BR8L 4IFDI 1D5ZC 1BDOA 5LMNQ 4C3IB 1L0XB 3HEJA 5IP9H 2F1MA 2H4OA 4ZQ3A 4LF6Q 1PFMA 4DV2L 1H9SB 3NWSA 2K5WA 4IQZA 1CKOA 2I5LX 4DNTB 2KQ3A 2SOBA 5EBCA 4GOPB 3VYRA 4K0KL 2JA5H 5JPMC 1G6ZA 3DWQA 3HOWH 5EBDA 1YITA 2L5TA 5IWAL 1ILPA 3I2ZA 2E2JH 1U4RA 1WD1A 4RGOS 4WJ4A 1TWCH 3AQQA 3DUZA 3U50C 4DUYQ 1WVLA 2F0LA 4GS3A 2BDOA 1L0YB 3KUPA 3MVVA 4QCLA 3FRPB 1WTQA 1NNXA 1YNNC 1ESFA 2EJGC 1PYBA 5FLXc 3EFXD 4Y52H 1VQCA 1N36L 1QILA 4A3DB 4CJ2C 2EYMA 1TS5A 3RNUA 1QG7A 4C3JG 1UE7A 4C3JH 4L8JA 3RLFA 4DV7Q 2PQAA 1PMRA 4KY6A 1HRJA 2ZXOA 3PV0A 2A8VA 1GUWA 4DAYA 1K83B 1JICA 1Y1WB 2F0SA 1HTPA 3J81E 1SYDA 1Y1VG 2FJ2A 1I3QB 2V1CC 2F0UA 1E3PA 2UUBQ 1CKNB 1JWSD 1N32Q 2R93B 4RHSA 5EKLA 3RZDB 5M5XH 1DOLA 4NKLA 3TDQA 3K0YA 4GNXA 1PFBA 5D14A 1U4LA 1TVXA 1BBXC 5KNDA 4BY7H 1KNAA 5EKKA 1I6HH 2YV5A 1CI3M 5JEAG 1UE5A 1PRTD 3TN2A 1YI2A 1X9NA 1JE5A 1JWUD 4HSPA 2KCTA 5C3XA 1IKLA 4R9WA 4ZUIA 3PMFA 1PYWD 1CSPA 1F9RA 3G71A 1T9HA 1PRTC 1Q1BA 5IYBG 2A6ED 1NUCA 4FXGC 4BBSH 2UU9L 4B3ML 3TQYA 1DYQA 3H0GG 3P1HA 1XPUA 2AQ1B 4KHVA 2DN8A 3HRZC 4PNYA 1V1PB 4XIGS 1U9RA 3BVMA 1YJNA 4QF4A 3PIPA 1SAPA 4X64Q 5C3EB 3PO3G 3OMGA 2KBNA 4CDEC 3H0GB 4R8IA 4A3DG 2X69A 1V8QA 1VDZA 3CAMA 4RCOA 5H1SE 4FP5D 2F0IA 1EIHA 4OEMB 4XXEA 3AB9A 1F2ZA 1EWIA 1IXRA 3K5NA 1AZQA 5M3MG 3MEHA 3BZKA 2UXDQ 1XTCD 1CM9A 3NHHA 2Z6KC 4JYAQ 4GKKL 4K8JA 4DV0L 3DM1A 3GP7A 4IZ8A 4LUOA 3TZDA 2L1BA 1LYLA 5M5WH 2NWGA 3NPPA 1S5CD 5DEHA 1B2TA 2VQEQ 5CBEE 5J1ZA 1PTOC 3AU7A 1RD9D 2EVBA 1C9OA 1GUTA 1SFOH 4DFAA 4GOPA 2EY2A 2DJGC 2CWAA 2E2HH 2K50A 4JI2Q 3K7UC 4DK6C 4J15A 5F2DA 3A0JA 2MNAA 5JJLA 1RTOA 3S2DH 1SYEA 4NP5A 2MO1A 3IL8A 1GM5A 4B3MQ 1K8MA 3I8ZA 5KNCA 2KHSA 4LF4Q 1ICFB 4O1NA 2JK8A 3STBC 1Q90A 3ULPA 4IPGA 3CCJA 2F0HA 1HTLD 3MXPA 1PH9A 3L7ZC 4OHJA 2CW0C 2HUGA 1N34Q 2EY5A 5CORA 4DN4M 1VQ5A 1II3A 4JI0Q 1UE6A 2A6EC 3HOXG 4DNRB 1JCKB 4HMJA 1EQVA 2CH4W 4HAEA 1Y8NB 2PI2E 3DEPA 5C4JH 3TSSA 3J81c 1JC7A 4A4IA 3E3XA 1K8GA 3OIPA 2QILA 3K58A 3G7LA 2NVQB 3TZUA 2LY7A 2UUBL 1LTTD 3K0XA 1T5EA 1SJED 4A3BG 2FMCA 4R4OA 3PF5A 4KTAA 3EIVA 3A7LA 2EPBA 1YIJA 1D1KA 4EQ5A 2E76C 2JYOA 4DR1L 4XTCS 2E2DC 4KKTA 1R9TH 2VNUD 1X3FA 3CCUA 2RDGA 1B8AA 1HH2P 1JB3A 1S4ZA 3H6MA 3S14B 4LJZC 1EYCA 1WTVA 4A3BB 3PO3H 3Q6SA 1VQMA 4HIOA 2YU9H 1BF4A 3S14H 4E6IA 4GZYC 5IYCG 3P20A 3NTHA 2QEXA 3DLLA 2Q8IB 5JJZA 1O7YA 4OXPA 1H95A 1I4HA 4K8IA 3SK6A 4JC0A 5T1GA 3A5UA 3VR5A 1VS0A 3H3VI 4A3GG 1KABA 4IFDH 4DXGA 2BA0A 4L63B 3P75A 3MXGA 1WCMH 1KLGD 5AFWA 1PTOB 1XX8A 1O7IA 1N8RC 2WINB 4U68A 3HOYB 4UP9A 3I55A 4UAIA 5IP7G 3A56A 1SDFA 5ELFA 4G7OC 4HIDA 3W3AA 1A3TA 1HNWQ 3UI2A 4WJ3M 2EXZA 1B1ZA 2EIFA 2I46A 2DY7A 1B3AA 1I4PA 2VB2X 1E1TA 3GV6A 5HGQA 1SRUA 5TSSA 1ENFA 2BH2A 3I3CA 1EFWA 3DEOA 3ZYYX 1X3EA 4LNQA 4DR7Q 2VY3A 3GTOH 1KHIA 3K5MA 1CQFA 4DV6Q 2K5NA 1Q8KA 4BBSG 2K4KA 2KVMA 4A3KB 5EPKA 4UDUC 4IUTA 1AP0A 3NEMA 3CF5A 2H1EA 3EBEA 3S2DB 3DM3A 4RFBA 1KAWA 3CHBD 1JORA 1STGA 1VQ4A 4NDXA 4LFAL 4A3MG 3FP9A 1A8VA 1KRTA 3HOUG 5CMDA 2B2YA 4R8NA 3S1RB 2DGYA 2P5ZX 3A8IE 2Q2HA 1PRTB 5JEAH 1X65A 4YY3Q 1XMQQ 1SSOA 4A75A 4FF1A 4JI1Q 4DV5L 1LT3D 2Q2TA 3S15B 3Q23A 5D3DA 1SR3A 4QY7A 4PG3A 3HOUB 4A3MB 1SNQA 5M5WB 4O0AA 2AWOA 4X66L 4A3JB 2AUJD 5DAUA 2LXJA 2VL6A 3X3MA 2F0GA 1YVCA 4NMZA 3WOEA 1DONA 1IBKQ 1HA5A 3CKIB 2HDMA 2NZOA 5E1FA 1K3RA 1MKHA 2JN4A 1QUQA 1DCZA 2HHHL 2K75A 1CKNA 3RD4A 5BR8Q 3OPOA 5FO8B 2UXCQ 2PO4A 1OXXK 2ZTDA 1BXTA 1GVPA 3CCEA 2E5LQ 1I4RA 4KD3A 5J39A 4XQNA 3VYTA 4POGA 5IE8A 1N36Q 2NVYB 3STBD 2F0MA 2RSOA 3M9BA 4IFDJ 3PIOA 2NN6G 1ENAA 2NVYH 3IAYA 2R93G 3NE5B 4Q5VA 2IT1A 5IP9G 2N55A 1DZ1A 2A5HA 1G291 5EQ0A 3SK8A 1R9TB 3HS0C 4HN7A 1WJJA 1HA6A 1A2TA 3U4ZA 4BY7G 2KEEA 1A2UA 4RHRA 3ZJYC 2XNAC 3IFTA 3HOYH 4C2MH 1KL9A 3HKSA 1PH5A 2JA5G 2IX1A 3CCQA 2ZM6L 2D2CC 4GOPC 4LK1C 4TKOB 1STYA 4A3LH 1CHQD 1P16A 5KNBA 1F2LA 5FLXL 4DR4L 1OXSC 2VUMG 2QF7A 2PCFB 3UDXA 1YEZA 1WYDA 4X6AH 1D5MC 1TU2B 1PZKD 4IURA 2L9HA 2OQKA 4EQPA 5LMNW 1FNUA 1EYGA 1OTCA 1K3BC 3G48A 2LFNA 2O5JC 1CA5A 2O2LD 1LTRD 3SK5A 1EOTA 3KFUA 1PZJD 3GTPB 3TP8A 5C0XG 4QUCA 3CW2C 1I94L 2R93H 3LGJA 2NVTB 4HJ5A 4LF5L 5K36H 1RF2D 1D6EC 2EE1A 4JI7Q 5K36G 2EJFC 4ABNA 4EX5A 2F0QA 4DV3L 1JQYD 1EU4A 3W1BA 2F0WA 3H91A 4B3SL 1O7ZA 1SYGA 5I6YA 3QIAA 4XQQA 4LFBQ 4RA8A 4KK7A 3S1MH 4ZAIA 3M3YH 4DUZQ 1UWVA 5C4XH 3SXHA 3K57A 1YZ6A 1X6OA 3CPFA 4A3DH 1P8LA 2F3IA 3M4QA 3PUXA 3OW7A 2MO0A 2LS01 4PZ8A 2EYFA 3CQZH 3NP8A 1HFNA 1HJPA 3ONAB 3URYA 3S2HB 2A6HD 1SN8A 2AQ2B 3T53B 3TP7A 2WACA 4A3FH 3BZCA 1EIYB 5FK9C 5J22A 1XMOQ 1I50H 1UUPA 2FMMA 2N3SA 4JI5L 2E8GA 3V2TA 1CQVA 2DNCA 4B9WA 1ET9A 5C3WA 3LWUA 3FVQA 5C0XI 4NXML 2BOSA 4P75A 3RR5A 1X3PA 3NTIA 2EYLA 1IYUA 2PZWA 2ZT9C 1YBYA 5GAGC 3AYHB 4MN3A 1KC8C 3NENA 1PFSA 1PH2A 3I72A 4RH6A 1XTDA 4AH6A 2HQEA 3SEBA 3PUVA 2XGTA 2UUAL 2KHIA 4DV4L 3TP6A 4X65L 3F2BA 4OGQC 1A3VA 1UNSA 5CC4A 1QVCA 2LMCB 4DGZA 4MTKA 2ZJRA 1PH8A 1F9PA 3PSIA 3PUYA 3FMCA 2RCFA 1EQRA 1QWYA 4UHVA 5FLMH 3QR8A 1U0LA 1IW7C 4A93H 1QZGA 3MXNA 2EYOA 3M7NA 4JI8L 3EQLC 3W5OA 1AEXA 4L5RC 1GUNA 3GTMH 3A8JE 2K7VA 3J7ZC 1SNMA 1IBMQ 1VQ6A 3AFPA 4IFDG 2L4NA 3TRZA 3ICEA 1SYFA 2OTJA 4PMWA 3BZDB 1MSGA 1WCMB 1RDPD 5IYDG 3PIO3 1PXUA 1PH7A 1CFMA 5JJKA 3CCSA 1VQ8A 2AWNA 2MJ8A 4JOIC 1IKMA 4BXXG 5FO7B 1WTOA 2R7ZG 1NR4A 1X56A 2EY1A 3DHQA 4K2LA 2EZVA 2EYJA 2M00A 4OL7A 5HY6A 1LLRD 5DM63 1VQAA 3OTOQ 1HNZL 4NXNL 1YNJD 1LTSD 1WI5A 1E22A 1QCBD 1MGSA 1WTHA 2WFWA 4RG1A 3BYTB 1VQBA 1Y1VH 3IKJA 4Z9CB 5C4ZA 3FEWX 5FJ8H 4KHPQ 3GTLH 1N33L 1TS3A 3J80L 2K5DA 3WOFA 5C0XJ 1HCZA 4DV4Q 3M4YA 1AW7A 1EY9A 3U9OA 4DAYB 3HG9A 3BYYB 5E4XA 3I56A 4K14A 4G4KA 2NN6H 5JJIA 3K8AA 1VQGA 1HR0W 3KF8A 2E2HB 2CWPA 1DM0B 3GTJB 3DWAA 1QVFA 2G9HD 1STHA 2WAQB 2RBMA 5T1IA 4BY7B 4A3IG 4ZK9B 2RHQB 5FLMG 2QGQA 4CBVA 5BN5A 2ZXPA 3NELA 2IX3A 3PF4A 1TR5A 2L12A 1CHPD 4I7ZC 2WAQG 5JVG3 2A19A 2JA7B 4ZYSA 4FDBA 5JPNC 4N8FA 1I3QH 1V1PA 1VQNA 1QOHA 3D6WA 1L1OB 1N9WA 5GAEC 1IL8A 2YYZA 1W6KA 3LWEA 2RCNA 5KGUA 1PH4A 1M1KC 1Q8IA 3PCOB 1CKMA 2D9UA 4DK0A 3K5OA 2K1BA 1SE8A 4LFBL 3VA7A 1A6XA 3A5ZB 5C3EG 4DR5L 1ZYRC 3S24A 4LF9Q 3G4SA 3A55A 4ODGA 4BBSB 1PH1A 1EY5A 1K8OA 1C8CA 1SXTA 2E5LL 3PO2H 3NQIA 5CV8A 1VF5C 1STBA 1EOVA 5G3LD 2C35B 3PQIA 4LFCL 4B08A 1EZ8A 3BG3A 5M3FG 4AQYQ 2EDGA 1A0IA 2OT2A 2E2JB 3BVZA 2R7ZB 1WTWA 1EYAA 3SVMA 3CRLC 4K2KA 3VYUA 2F0OA 5IODA 2HIXA 3ULLA 1G8ZD 4C2MB 4DR4Q 2IWHA 1LUZA 3TREA 4JV5Q 3J80c 1HZAA 1SYCA 4AQYL 2B2UC 1EEFD 4ZRZA 2WAQE 1C7YA 5C6AA 1TWAH 1YNXA 1RTNA 3C1FA 4POFA 3AEVA 4PZ7A 4ALPA 3T4AC 4C3IH 1NSNS 2Z6KA 1XNRL 3HOVB 3TS0A 4MIUA 4YCUA 1Y1WH 3KF6A 3P7JA 2R92H 1W6JA 4IOCA 2GVBA 2ENBA 2CQOA 2RDFA 3T16A 4C3HG 5ELCA 3RLOA 3OHXC 3HZXA 2PYKA 4H02A 1FD7D 4B3SQ 5I9OA 4JCVE 4FO2A 3S16B 4DNIA 4G7HC 2XTIA 4MTNA 2KEDA 3CU7A 2NVQH 5IOCA 4JV5L 3L2PA 3NBHB 2GVAA 2CVRA 2YTYA 3CP0A 1PDQA 1EFID 1X32A 1EWCA 2F0TA 5BN4A 4LF8L 4HCEA 1B4OA 1NBWA 2J4XA 2CHBD 3MHBA 3I73A 1SE3A 3FKIH 1YJ9A 1MSHA 4S3SA 2I07B 5C4HA 3F1ZA 3I4NB 3CXCA 3PUZA 3QO2A 4LMQD 1PVOA 1A63A 2LSSA 4DUYL 3SHLA 3DWPA 5KRUA 1WCMG 3RZDH 3S2HH 1D8LA 3HOZH 2K5VA 4X3SA 2IL8A 1UEBA 1SBBB 1I6VC 1H9RA 2MQHA 1IBLL 4KJOA 2E2IH 4RCNA 3VYSA 3GTOB 3GD7A 1B9NA 3I4MH 2NBFA 2O5IC 1KAAA 3I4OA 5C0XH 2C5CA 3IFDA 3LX0A 2JE6I 2CCZA 3D6CA 1BR9A 5M5YH 4A3EB 4TRDA 1XNRQ 5LMNL 5CV9A 2D62A 3HOVH 2BE5C 3GQBA 2A73B 4JBJA 1Y8OB 1QZHA 1SFOB 1OXUA 4X3KA 1KLUD 3M4OH 4TSSA 1FVIA 1DJRD 4LUVA 4YCWA 2Y0SE 1ZKOA 2A68D 2J7ZA 3H94A 1LACA 1UE1A 3J7YW 2A1AA 1LV9A 4P73A 4H7BA 1WD0A 3JAMi 4HCSA 2ATWA 2G9DA 1AE2A 4ID6A 2JEBI 1TT2A 1ML0D 3NTKA 1S5ED 3K7AH 2CH4A 3AFQA 2F0EA 1GXDC 4DR6L 2N88A 1ENCA 4GN4B 2O4XA 4FYDA 3J81L 4A3CH 2F4VL 3A74A 1K9MC 2QKIC 1L2FA 4QL5A 5ELNA 3D8GA 1Q82C 4B3RL 3MFYA 3D4DA 2AMCB 4A3EG 2IHEA 2A6HC 2Q2UA 2OEOA 5C4XG 1Q86C 1WTXA 1NAPA 2Z6BA 2R92B 4A93G 1U5KA 5M3MB 3HGBA 1PHJA 2ZTEA 2SDFA 4JOIA 4TVAB 3F2DA 4JBWA 3OWFA 3CMEA 4KHPL 3QWNA 1WTPA 3OTOL 4RKBA 1K0SA 2OWOA 3W2DA 2K5QA 3AMUA 4BY1B 2RSNA 2YTXA 1F2YA 3T1YQ 1DGSA 1SEBD 4KKSA 1JMCA 1GO3E 1E2WA 3MZ5A 4OX9Q 1VMCA 2Q8RE 2JP1A 5JOBA 1LTLA 5AJ3Q 2UUCQ 3CMAA 2K33A 2PI2A 3M4PA 1Y14B 3S17B 3Q24A 1R4PB 1EY6A 3TP5A 2ZJPA 4K5VA 2Y0SG 3FKIB 4A3MH 1I50B 2PMZB 2VUMH 1ASYA 2CKZB 4DV1L 2JA6H 3GTJH 3EJIA 3CD6A 5IGDA 1FJGL 2F0PA 4N9TA 5A35A 3QB3A 4QJFA 1EU3A 3GTKB 1AZPA 1GD7A 1VQPA 3D3RA 5K5PA 1F9QA 1JJCB 2QDBA 5CBAE 1TWGH 5E7NA 4QIWB 4CDCC 3Q8DA 4B3RQ 5DNFA 1PFNA 1AH9A 2FXQA 2B2VA 2EYHA 5ELOA 1GUGA 1JOOA 2B39A 5DLQE 1HNZQ 1JT8A 3HOVG 2G5DA 1QUQB 1R4QB 3MC0B 2M9VA 1PH6A 3NK9A 5CR3A 1JR0D 1SNCA 2R61A 4EQNA 4WJWA 4BBRG 2JA6B 1PH3A 1YJWA 4F7XA 4RGMA 4DU9A 2EY6A 5HGTA 1JJGA 3JAML 1K28A 2A69C 2BDNA 3HOXH 5COYA 1BCPD 1VQEA 3TEHB 4HJ8A 2NTTA 1BOSA 3C3LA 2B63B 5AJ3L 1PTOH 4BWGB 1HXYD 2EJMA 4GLAC 4RGTA 1C0AA 2JA8H 2H5XA 4YIJA 2F0KA 3BDOA 1Z9FA 4I65A 1STEA 1GJXA 5KEEA 4HJAA 1I4QA 2K52A 2XRQD 1QE6A 3UDGA 1A15A 3H0GH 2WKCA 2IW3A 1CT1D 1RIPA 4J1MA 4P2CB 2Z0SA 5KIXA 4CJ1B 2MUYA 5JAVA 3KJOA 1Q1EA 4NB3A 3VA5A 5EPJA 4LAAA 4OO1I 1X54A 2TMPA 1XJVA 1HHVA 4X64L 5LL6S 4UP8A 3SGIA 1H9MA 1Z47A 2K28A 3U4VA 1I94Q 2XWJB 1KDBA 2KCCA 1RJTA 1PZID 2MP1A 1XNQL 2CW0D 1HQMC 2AKWB 3GTGH 3M85A 3RZOH 1STNA 2ICIA 2WB1E 4ZKCB 3C46A 1FL0A 2ASBA 4L5QA 3VR3A 1U4PA 2X6LA 2PMZE 4F8MA 4P71A 4JI5Q 4XYQA 1HNXL 3EN2A 2YTVA 4X66Q 3HOYG 3KYHC 4JBMA 5EKIA 1J5EQ 3KBXA 4A3FB 3MEFA 1FGUA 4V190 1G51A 1XWEA 4X3TA 2JXMB 2VXWA 5CGKA 5CV6A 1VQHA 4OONA 3JC66 1XYIA 2KENA 5D3IB 3KDFB 3QOLA 4EQOA 2J0TD 4DV5Q 3ITPA 4MZ9A 3VR2A 4O42A 3GTQH 2BA1A 3S1RH 5ELBA 1LT6D 2I5MX 2SEBD 1EIFA 1NMGA 4R4IA 4HIKA 4LFAQ 3KJPA 1XPRA 1E2VA 3BDLA 1MI2A 3TS2A 2MPMA 3ULJA 4ZUJA 5HURA 5IYBH 1S40A 1FNWA 1VQLA 1TWHH 4F87A 1G91A 3GO5A 4LW1A 2WB1B 1IBLQ 3OOCA 4KMUC 4DV6L 2L11A 3S1NH 4CDDC 4FF4A 3IRBA 1HFGA 3K59A 4LF5Q 3H3VC 1HZ9A 2XIWA 1RCVD 2JA7H 4UY8C 2RKSA 1VMPA 2K04A 2KECA 5FO9B 1BBWA 4L6TB 3L0OA 1HNXQ 4YWKA 4M8AA 4FXKC 1CZWA 2UXBL 2C9OA 5C44G 3MAQA 1NY4A 3GV3A 5IT9L 3S17H 1G6PA 2DNEA 3R93A 4LF7L
chains in the Genus database with same CATH topology
2B2UA 3R3OA 1LT4D 2HDLA 1TY2A 3OSOA 2MGSA 3SR1A 3GTMB 1QNUA 2Z4IA 1JOKA 2B2VC 1Y8PB 3E6ZX 3M3YB 1GHKA 4K5XA 1SJHD 1F77A 4C1NK 4FNFA 1RODA 3J7AF 4K5WA 3FPPA 5JVH3 1ONLA 2TSSA 2FFKB 4Q0FA 1V1OA 3I70A 1LABA 1TKWB 4ULLA 1YNND 1TIID 4IN3A 2GA4B 1UAPA 1S5DD 4KY5A 3PUWA 4BS9A 1SMYC 4ILWA 4WORA 2NZ1D 4QB4A 1KDAA 3NWTA 3PIP3 1KTKA 4DK1A 1C48A 4V0BA 5FKAC 1EY0A 5FLXE 1I4GA 4PMCA 1I6HB 4A3GB 5C4JB 1FNVA 1WTRA 4OO1G 1U4MA 1AFPA 1B50A 3ND8A 3X3NA 2ID0A 2PPBC 2F3VA 4PQXA 3J7AV 4C3HB 3R2TA 1Z6HA 1S5BD 2MHVA 1TS4A 2KA7A 4RWSC 1J9OA 3OMCA 3T51B 2WIIB 3DXJC 3EROA 3EVQA 5I2XA 1BCPB 3I4LA 1Y69U 4XYOA 3TBIB 4RKLA 4CHTB 3SK4A 1ICWA 1FYCA 2QCPX 2SNMA 3V05A 4RGNA 1GUSA 2NVXB 1OXTA 1PRTF 1SE2A 1A3UA 4QUFA 1Q12A 3D4RA 2B8FA 5I4DA 2K6AA 4K6DA 5CV4A 4G57A 1C4QA 2BCOA 2XWBB 2NB0A 4KJNA 4BA1I 2RQXA 3RUZA 1Y1VB 2A69D 2Z8LA 4BBRB 1EEID 2B2WC 4CGYB 1BO0A 1KNEA 2IPKD 4JK1C 3N6RA 4J8QA 1ZXTA 3Q0AA 4DXFA 1EL0A 2F3WA 1OO9B 4XT3B 1D1IA 5A2QE 3I91A 5IGCA 2JSOA 2PW5A 1B53A 2AQ3B 2F0NA 1BQQT 1M4VA 1PTOF 2B8GA 1STAA 3RMHA 4KD4A 4FXDA 3F2UA 3MFGA 3HKZB 3R2IA 1E0BA 5M3FB 1BUVT 1SNPA 1SNDA 5ELDA 3BS1A 2KUMA 4ZLTF 1OXVA 1DXMA 1DOMA 4MHEA 3L3OC 3NBHA 2SNSA 2X6GA 3NXWA 1JE4A 2OXPA 1FR3A 3PO3B 2NTSA 4IALA 3NUCA 2F0JA 2PW7A 1H9JA 4C1NI 2F4IA 3DMUA 1Z7TA 1CZGA 3MTSA 3OWEB 2K05A 3T56B 3D31A 4FVMA 2XVSA 2R6GA 4H0LC 4XQJA 3EA6A 2E2IB 5IGFA 1O78A 2V4DA 5ISRA 1FGBD 3GTQB 3A8KE 5C44B 1E2ZA 2B2YC 3HOZB 5M9OA 2JEAI 3VR6A 5EJWA 1TWCB 5LHY1 5A2QL 2R3ZA 5D65A 5FOBB 3J80E 2PZUA 3S1QB 1G2SA 5LL6X 2KJXA 4OIJA 3QOJA 2EOTA 5C4XB 4XT1B 1PTOD 3A54A 2A68C 2ICEC 2E75C 3FPUB 3V96A 2NYZD 3U9SA 2F0FA 4WRDA 1ESRA 1Q3LA 1V43A 1SNOA 3FDTA 4NW2A 3Q22A 1O80A 5IGGA 4DAPA 5CV5A 2AUKA 4KN4C 2ZXRA 3HP3A 2DY8A 1EQTA 5CYUA 1B44D 3KLSX 1EYDA 1LTID 4HSVA 1BNZA 4KHZA 1EIGA 4KI0A 1DD2A 5CV7A 4F88A 1AN8A 3N52A 4IUQA 4DA2A 3GTGB 3MWYW 1IW7D 4CKCA 5I2YA 3RZOB 3HOXB 2L0CA 2PNRC 1ET6A 2RVLA 3NSWA 2IJ0A 1QB5D 5M5XB 4K6LA 4C3IG 2YU9B 5ELEA 2B2TA 5M5YB 3CRKC 1IYVA 3S1NB 3JAME 4CJ0B 1LTAD 1RKNA 3SE0A 1TWHB 4KN7C 4IUUA 4M1UB 3VR4A 1DOKA 3R8BA 3I4MB 4DF7A 3BVGA 1NR2A 3MXUA 4OIKA 1EY8A 1XXGA 2CQAA 1TS2A 1F2MA 2WP8J 2JA8B 4EVOA 1S5FD 1B9MA 1HPCA 4KY7A 4C56C 4AYBB 1T5XD 4ME5A 4DAVA 2K01A 4H13C 3CQZB 2HCCA 1BCPC 5EPLA 1RHPA 3K6OA 5IT9E 4QMGA 4RAUC 2F0VA 1TQOA 3BDCA 1HUNA 1QJOA 3C1EA 3K5LA 1EY7A 5C5MA 2F03A 4J6HA 2IX0A 1F9SA 5BN3A 1QNKA 4HMIA 4XDXA 5IGBA 2HCIA 3T13A 1SYBA 3GTLB 5E4WC 5NUCA 4N9PA 1D2BA 4G7ZC 4IUNA 2NUCA 1ZYRD 3S9WA 2WV6D 1VF7A 2B2TC 4IUPA 1I4XA 1TWAB 1CA6A 4HEDA 3M7GA 2EYPA 3KK7A 5G3LF 2VUMB 3K7AB 1GUOA 5C5LA 3NQTA 1MD2D 2JA5B 1HUMA 4PV1C 2K32A 3G6JB 4X3UA 4OO1H 1NCVA 1LO5D 1SMYD 3WDNA 3E5SA 1G2TA 3PO2B 4U673 4A93B 3H09A 1H9KA 4H44C 4PMBA 1IHZA 5IGEA 2QEJC 2LKVA 1EWHA 1CTMA 1JWMD 1MBYA 1CK1A 3O13A 1LTBD 5KYLA 1ILQA 4C3JB 2PQEA 1GOZA 4CKBA 4FF2A 4EGVA 4A3IB 3KLSA 3I90A 2M2LA 3MA2B 3KBGA 2D5DA 5E3FA 2RDHA 2VB3X 3L9AX 4WFN3 1TY0A 1KDCA 4Y7NB 1D5XC 4TQUS 3SDZA 1EZ6A 2K03A 1M8AA 3ERQA 3M4OB 3HOWB 2Q8TA 2Y0SB 3QJYA 1LT5D 4CKEA 4HR7B 2E74C 4ZKBB 3KLRA 2PZTA 2FHTA 1X3QA 2Z4HA 5KYIA 5DM73 1SE4A 2B2WA 1PLFA 3QG1A 3S1MB 1TWGB 2KOLA 1JOQA 1YNJC 2A74C 5EGTA 2WKDA 3OIQA 2BE5D 5JEAJ 1BCPF 2KCNA 1O7LA 4HTHA 4B9XA 1VCIA 4IUVA 2XSCA 2F0DA 3NBIA 3A7AB 2NN6I 5I6WA 1LTGD 2Z1CA 1J8IA 2XN9C 4BA2I 1EY4A 1UEAB 2XRSD 5IIFA 1GHJA 1H9SA 3LNNA 3D4WA 3E0JA 4KV6A 1ZEQX 3TMEA 4FF3A 3C2PA 2L55A 1HQRD 2FINB 2RA4A 4KKUA 5I9PA 1TWFB 2OF1A 3ND9A 4IFDI 1D5ZC 1BDOA 4C3IB 1L0XB 3HEJA 2F1MA 2H4OA 4ZQ3A 1PFMA 1H9SB 3NWSA 2K5WA 4IQZA 4DNTB 2KQ3A 2SOBA 5EBCA 3VYRA 5JPMC 1G6ZA 3DWQA 5EBDA 2L5TA 1ILPA 1U4RA 1WD1A 4RGOS 3DUZA 1WVLA 2F0LA 2BDOA 1L0YB 3KUPA 3MVVA 4QCLA 3FRPB 1WTQA 1YNNC 1ESFA 2EJGC 3EFXD 1QILA 4A3DB 4CJ2C 2EYMA 1TS5A 1QG7A 4C3JG 4L8JA 3RLFA 1PMRA 4KY6A 1HRJA 2ZXOA 3PV0A 1GUWA 4DAYA 1K83B 1JICA 1Y1WB 2F0SA 1HTPA 3J81E 1SYDA 2FJ2A 1I3QB 2F0UA 1JWSD 2R93B 4RHSA 5EKLA 3RZDB 1DOLA 4NKLA 3TDQA 3K0YA 1PFBA 5D14A 1U4LA 1TVXA 1BBXC 5KNDA 1KNAA 5EKKA 1CI3M 5JEAG 1PRTD 3TN2A 1JWUD 4HSPA 5C3XA 1IKLA 4R9WA 4ZUIA 3PMFA 1PYWD 1F9RA 1PRTC 1Q1BA 2A6ED 1NUCA 4FXGC 1DYQA 3P1HA 2AQ1B 3HRZC 2DN8A 4KHVA 4PNYA 1V1PB 4XIGS 1U9RA 3BVMA 4QF4A 1SAPA 5C3EB 3OMGA 4R8IA 3H0GB 2X69A 1V8QA 1VDZA 4RCOA 4FP5D 2F0IA 1EIHA 4XXEA 3AB9A 1F2ZA 3K5NA 1AZQA 3MEHA 1XTCD 1CM9A 3NHHA 4K8JA 3DM1A 3GP7A 4IZ8A 3TZDA 2L1BA 2NWGA 3NPPA 1S5CD 5DEHA 1B2TA 5CBEE 5J1ZA 1PTOC 3AU7A 1RD9D 2EVBA 1GUTA 4DFAA 2EY2A 5F2DA 1RTOA 1SYEA 4NP5A 3IL8A 1K8MA 3I8ZA 5KNCA 2KHSA 4O1NA 1Q90A 2F0HA 1HTLD 3MXPA 3L7ZC 4OHJA 2CW0C 2HUGA 2EY5A 5CORA 4DN4M 1II3A 2A6EC 4DNRB 1JCKB 4HMJA 1EQVA 4HAEA 1Y8NB 3DEPA 3TSSA 1JC7A 3OIPA 2QILA 3K58A 3G7LA 2NVQB 3TZUA 2LY7A 1LTTD 1T5EA 1SJED 2FMCA 4KTAA 3A7LA 2EPBA 1D1KA 2E76C 2JYOA 4XTCS 2E2DC 4KKTA 2VNUD 2RDGA 1JB3A 1S4ZA 3H6MA 3S14B 4LJZC 1EYCA 1WTVA 4A3BB 3Q6SA 1BF4A 4E6IA 4GZYC 3P20A 3NTHA 2Q8IB 5JJZA 1O7YA 1I4HA 4K8IA 3SK6A 5T1GA 3VR5A 1KABA 4IFDH 4DXGA 2BA0A 4L63B 3P75A 3MXGA 1KLGD 5AFWA 1PTOB 1XX8A 2WINB 4U68A 3HOYB 4UAIA 3A56A 1SDFA 5ELFA 4G7OC 3W3AA 1A3TA 3UI2A 2EXZA 1B1ZA 2I46A 2DY7A 1B3AA 1I4PA 2VB2X 3GV6A 5TSSA 1ENFA 3I3CA 3DEOA 3ZYYX 3K5MA 1CQFA 2KVMA 4A3KB 5EPKA 4UDUC 4IUTA 1AP0A 2H1EA 3S2DB 4RFBA 3CHBD 1JORA 1STGA 4NDXA 5CMDA 2B2YA 4R8NA 3S1RB 3A8IE 1PRTB 5JEAH 1SSOA 4FF1A 1LT3D 3S15B 3Q23A 5D3DA 3HOUB 4A3MB 1SNQA 5M5WB 2AWOA 4A3JB 2AUJD 5DAUA 3X3MA 2F0GA 4NMZA 3WOEA 1DONA 1HA5A 3CKIB 2HDMA 5E1FA 1DCZA 3RD4A 3OPOA 5FO8B 2PO4A 1OXXK 1BXTA 1I4RA 4KD3A 5J39A 4XQNA 3VYTA 2NVYB 2F0MA 2RSOA 4IFDJ 2NN6G 1ENAA 3IAYA 3NE5B 4Q5VA 2IT1A 2N55A 1DZ1A 2A5HA 1G291 5EQ0A 3SK8A 1R9TB 3HS0C 4HN7A 1HA6A 1A2TA 2KEEA 1A2UA 4RHRA 2XNAC 3IFTA 2IX1A 2D2CC 4LK1C 4TKOB 1STYA 1CHQD 5KNBA 1F2LA 5FLXL 1OXSC 2QF7A 2PCFB 1D5MC 1TU2B 1PZKD 4IURA 2L9HA 4EQPA 1FNUA 2LFNA 2O5JC 1CA5A 2O2LD 1LTRD 3SK5A 1EOTA 1PZJD 3GTPB 5C0XG 3TP8A 4QUCA 2NVTB 5K36H 1RF2D 1D6EC 2EE1A 5K36G 2EJFC 4ABNA 2F0QA 1JQYD 1EU4A 2F0WA 3H91A 1O7ZA 1SYGA 5I6YA 3QIAA 4XQQA 4RA8A 4KK7A 4ZAIA 3SXHA 3K57A 3PUXA 3OW7A 2LS01 2EYFA 3NP8A 1HFNA 3ONAB 3URYA 3S2HB 2A6HD 3T53B 2AQ2B 3TP7A 2WACA 5FK9C 5J22A 1UUPA 2FMMA 3V2TA 1CQVA 2DNCA 4B9WA 1ET9A 5C3WA 3LWUA 3FVQA 5C0XI 2BOSA 1X3PA 3NTIA 2EYLA 1IYUA 2PZWA 2ZT9C 4MN3A 3I72A 4RH6A 2HQEA 3SEBA 3PUVA 3TP6A 4OGQC 1A3VA 1UNSA 5CC4A 2LMCB 4DGZA 1F9PA 3PUYA 3FMCA 1QWYA 1IW7C 3MXNA 2EYOA 3M7NA 3EQLC 1AEXA 1GUNA 3A8JE 2K7VA 1SNMA 4IFDG 2L4NA 1SYFA 4PMWA 3BZDB 1MSGA 1WCMB 1RDPD 3PIO3 1PXUA 1CFMA 2AWNA 2MJ8A 1IKMA 1WTOA 5FO7B 1NR4A 2EY1A 3DHQA 4K2LA 2EZVA 2EYJA 2M00A 4OL7A 1LLRD 5DM63 1YNJD 1LTSD 1QCBD 1MGSA 3BYTB 3IKJA 4Z9CB 5C4ZA 3FEWX 1TS3A 3J80L 2K5DA 5C0XJ 3WOFA 1HCZA 3M4YA 1AW7A 1EY9A 3U9OA 3HG9A 3BYYB 5E4XA 4K14A 4G4KA 2NN6H 3KF8A 2E2HB 1DM0B 3GTJB 3DWAA 2G9HD 1STHA 2WAQB 2RBMA 5T1IA 4BY7B 4ZK9B 4CBVA 5BN5A 2ZXPA 2IX3A 1TR5A 2L12A 1CHPD 4I7ZC 5JVG3 2JA7B 4ZYSA 5JPNC 1V1PA 1QOHA 3D6WA 1IL8A 2YYZA 1W6KA 3LWEA 5KGUA 1Q8IA 2D9UA 4DK0A 3K5OA 2K1BA 3VA7A 1A6XA 1ZYRC 3A55A 4ODGA 4BBSB 1EY5A 1K8OA 1C8CA 1SXTA 3NQIA 5CV8A 1VF5C 1STBA 5G3LD 4B08A 1EZ8A 3BG3A 2EDGA 2OT2A 2E2JB 3BVZA 2R7ZB 1WTWA 1EYAA 3SVMA 3CRLC 4K2KA 3VYUA 2F0OA 5IODA 1G8ZD 4C2MB 2IWHA 1SYCA 2B2UC 1EEFD 4ZRZA 5C6AA 1RTNA 3C1FA 3T4AC 1NSNS 3HOVB 4MIUA 3P7JA 1W6JA 2ENBA 4C3HG 2RDFA 3T16A 5ELCA 3OHXC 3HZXA 2PYKA 1FD7D 5I9OA 4FO2A 3S16B 4G7HC 2KEDA 3CU7A 5IOCA 2CVRA 1PDQA 1EFID 1X32A 1EWCA 2F0TA 5BN4A 4HCEA 1B4OA 2J4XA 2CHBD 3MHBA 3I73A 1SE3A 1MSHA 4S3SA 2I07B 5C4HA 3I4NB 3PUZA 3QO2A 4LMQD 3SHLA 3DWPA 5KRUA 4X3SA 2IL8A 1SBBB 1I6VC 1H9RA 4KJOA 4RCNA 3VYSA 3GTOB 3GD7A 1B9NA 2NBFA 2O5IC 1KAAA 5C0XH 2C5CA 3IFDA 3LX0A 2JE6I 3D6CA 1BR9A 4A3EB 4TRDA 5CV9A 2D62A 2BE5C 3GQBA 2A73B 1Y8OB 1SFOB 1OXUA 4X3KA 1KLUD 4TSSA 1DJRD 1ZKOA 2A68D 2J7ZA 3H94A 1LACA 3J7YW 1LV9A 4H7BA 1WD0A 4HCSA 2G9DA 4ID6A 2JEBI 1TT2A 1ML0D 3NTKA 1S5ED 2F0EA 1GXDC 2N88A 1ENCA 2O4XA 4FYDA 3J81L 2QKIC 3D8GA 3MFYA 3D4DA 2A6HC 2OEOA 1WTXA 1NAPA 2R92B 5M3MB 3HGBA 2SDFA 4JBWA 3OWFA 3QWNA 1WTPA 4RKBA 3W2DA 2K5QA 3AMUA 4BY1B 2RSNA 1F2YA 1SEBD 4KKSA 1E2WA 3MZ5A 1VMCA 2Q8RE 2JP1A 5JOBA 2K33A 3S17B 3Q24A 1R4PB 1EY6A 3TP5A 4K5VA 3FKIB 1I50B 2PMZB 3EJIA 5IGDA 2F0PA 4N9TA 5A35A 3QB3A 1EU3A 3GTKB 1AZPA 3D3RA 5K5PA 1F9QA 2QDBA 5CBAE 4QIWB 5DNFA 1PFNA 2B2VA 2EYHA 1GUGA 1JOOA 2B39A 1R4QB 3MC0B 2M9VA 3NK9A 5CR3A 1JR0D 1SNCA 2R61A 4EQNA 4WJWA 2JA6B 4F7XA 4RGMA 4DU9A 2EY6A 5HGTA 3JAML 2BDNA 2A69C 5COYA 1BCPD 2NTTA 1BOSA 3C3LA 2B63B 4BWGB 1PTOH 1HXYD 2EJMA 4RGTA 4YIJA 2F0KA 3BDOA 4I65A 1STEA 1GJXA 5KEEA 1I4QA 2XRQD 1QE6A 1A15A 2WKCA 2IW3A 1CT1D 4J1MA 4P2CB 5KIXA 4CJ1B 2MUYA 5JAVA 1Q1EA 3VA5A 5EPJA 4LAAA 4OO1I 2TMPA 1HHVA 5LL6S 1H9MA 1Z47A 2K28A 2XWJB 1KDBA 2KCCA 1RJTA 1PZID 2MP1A 2CW0D 1HQMC 3M85A 1STNA 2ICIA 4ZKCB 3C46A 3VR3A 1U4PA 2X6LA 4F8MA 4XYQA 5EKIA 3KBXA 4A3FB 4V190 1XWEA 4X3TA 2JXMB 5CGKA 2VXWA 5CV6A 1XYIA 5D3IB 3QOLA 4EQOA 2J0TD 3ITPA 3VR2A 4O42A 2BA1A 5ELBA 1LT6D 2SEBD 1E2VA 3BDLA 1MI2A 2MPMA 4ZUJA 5HURA 1FNWA 4F87A 1G91A 3GO5A 2WB1B 3OOCA 4KMUC 2L11A 4FF4A 1HFGA 3K59A 3H3VC 2XIWA 1RCVD 2RKSA 1VMPA 2K04A 2KECA 5FO9B 4L6TB 4M8AA 4FXKC 1CZWA 2C9OA 3MAQA 3GV3A 5IT9L 2DNEA 3R93A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QB5 D;  4FO2 A;  5G3L F;  1QCB D;  4FNF A;  5G3L D;  1TII D;  4FP5 D; 
#chains in the Genus database with same CATH topology
 2B2U A;  3WWV A;  3R3O A;  1LT4 D;  3E9H A;  2HDL A;  5IWA Q;  3UE0 A;  4R1J A;  1TY2 A;  3OSO A;  2MGS A;  3F2C A;  4A3I H;  3SR1 A;  3GTM B;  1QNU A;  2Z4I A;  1JOK A;  2B2V C;  2KHJ A;  4IPC A;  3U58 A;  2I0Q A;  1Y8P B;  4R4C A;  4DR5 Q;  3E6Z X;  4LF9 L;  3M3Y B;  1MHW C;  1GHK A;  4A3K G;  4K5X A;  4DV2 Q;  1SJH D;  1S72 A;  1F77 A;  4C1N K;  1Q81 C;  4LUZ A;  4FNF A;  4HJ9 A;  1ROD A;  3J7A F;  2IHF A;  4K5W A;  3FPP A;  5JVH 3;  3ER0 A;  1NMF A;  1ONL A;  2ZJQ A;  2TSS A;  4BBR H;  1XPO A;  2FFK B;  4Q0F A;  2EQS A;  1V1O A;  3I70 A;  1LAB A;  1TKW B;  4R4T A;  4ULL A;  1YNN D;  1TII D;  4IN3 A;  2GA4 B;  4DR7 L;  1UAP A;  3GTP H;  1S5D D;  4KY5 A;  4DV1 Q;  3PUW A;  4BS9 A;  1IBK L;  1SMY C;  4ILW A;  3RN2 A;  4WOR A;  2NZ1 D;  4QB4 A;  1KDA A;  3NWT A;  2L15 A;  3PIP 3;  1WOC A;  2NVX H;  3PO2 G;  1KTK A;  4DK1 A;  4LFC Q;  1C48 A;  4V0B A;  5FKA C;  1EY0 A;  1HZB A;  5FLX E;  1I4G A;  4PMC A;  1I6H B;  4A3G B;  5C4J B;  2CFM A;  2JA6 G;  1FNV A;  1WTR A;  4OO1 G;  1U4M A;  4YY3 L;  1AFP A;  1B50 A;  3ND8 A;  5J3B A;  4A3F G;  3X3N A;  2ID0 A;  2PPB C;  2F3V A;  4PQX A;  2RF4 A;  3J7A V;  4C3H B;  3R2T A;  1Z6H A;  2PNH A;  1S5B D;  2MHV A;  1TS4 A;  2KA7 A;  3H15 A;  3FHW A;  4RWS C;  1J9O A;  3OMC A;  1KQS A;  3T51 B;  1KD1 C;  2QDL A;  2WII B;  1EQQ A;  3DXJ C;  3ERO A;  3OYY A;  2F4V Q;  1IZ6 A;  4UP7 A;  3EVQ A;  1JB7 A;  5I2X A;  1BCP B;  5FJ8 G;  3I4L A;  3PGZ A;  1K8A C;  1Y69 U;  4XYO A;  3TBI B;  4RKL A;  4CHT B;  3I4N G;  3SK4 A;  1ICW A;  4GLX A;  1SLJ A;  4IJL A;  4DR2 Q;  1FYC A;  4Y7N H;  1VQD A;  2RHS B;  4DR2 L;  2QCP X;  2SNM A;  3OW2 A;  3HOW G;  5LMU L;  3V05 A;  4RGN A;  1IYJ B;  4DKA C;  3I7F A;  2UUC L;  1GUS A;  3UE1 A;  2NVX B;  3S15 H;  1OXT A;  1PRT F;  1SE2 A;  4B3T Q;  4OX9 L;  1L0W A;  2PQA B;  3T1Y L;  1AE3 A;  1A3U A;  4QUF A;  1Q12 A;  3D4R A;  1YHQ A;  2B8F A;  5I4D A;  3KOJ A;  2K6A A;  4K6D A;  2B3G A;  1BBU A;  5CV4 A;  4G57 A;  2ES2 A;  1C4Q A;  1LM0 A;  2BCO A;  1N34 L;  3J7A 5;  4X65 Q;  2XWB B;  2HIV A;  4P74 A;  1WFQ A;  2NB0 A;  3W1G A;  5IP7 H;  4KJN A;  4BA1 I;  2RQX A;  3RUZ A;  1Y1V B;  2A69 D;  2Z8L A;  4BBR B;  4AIM A;  1EEI D;  4JI3 L;  2B2W C;  4CGY B;  1BO0 A;  1KNE A;  2IPK D;  4JK1 C;  3N6R A;  2B63 G;  4J8Q A;  1ZXT A;  4QGU A;  4DXF A;  3Q0A A;  1EL0 A;  2F3W A;  1OO9 B;  3K81 C;  4XT3 B;  1D1I A;  5A2Q E;  3I91 A;  5IGC A;  4NXM Q;  2JSO A;  2PW5 A;  1B53 A;  2AQ3 B;  2F0N A;  1BQQ T;  1M4V A;  1PTO F;  5GRO A;  2B8G A;  1STA A;  3RMH A;  4KD4 A;  2OTL A;  4FXD A;  3F2U A;  3MFG A;  3HKZ B;  1YHA A;  3HOU H;  3R2I A;  1E0B A;  5M3F B;  3CC4 A;  4RMF A;  4YWM A;  2IY5 B;  4OWT B;  1BUV T;  1SNP A;  1SND A;  5ELD A;  3BS1 A;  4B3T L;  2KUM A;  4ZLT F;  1OXV A;  1DXM A;  1VQO A;  1DOM A;  4MHE A;  3L3O C;  3NBH A;  4CDF C;  2SNS A;  3FKI G;  1K73 C;  2X6G A;  3NXW A;  1JE4 A;  5GQO A;  2UXD L;  2OXP A;  1FR3 A;  3PO3 B;  2NTS A;  2UUA Q;  2Q2I A;  4IAL A;  4A3B H;  4LF4 L;  3NUC A;  2F0J A;  2PW7 A;  4DV3 Q;  1H9J A;  4C1N I;  2F4I A;  3DMU A;  1Z7T A;  1CZG A;  3MTS A;  1MIU A;  3OWE B;  2K05 A;  3T56 B;  1VQ9 A;  4L5S A;  3UDI A;  3KF6 B;  3D31 A;  4FVM A;  4DR6 Q;  1B7Y B;  2K14 A;  2XVS A;  2R6G A;  4H0L C;  1VQK A;  4JI7 L;  1W3S A;  1NTG A;  4XQJ A;  2JA9 A;  2I5H A;  4LF7 Q;  3EA6 A;  1S3O A;  2E2I B;  5IGF A;  3E0E A;  3HFZ B;  1J6Q A;  4C3H H;  1O78 A;  2V4D A;  5ISR A;  1FGB D;  3GTQ B;  2UXB Q;  3A8K E;  5C44 B;  1XMO L;  1E2Z A;  3CCM A;  4QQB X;  2B2Y C;  3HOZ B;  5M9O A;  4DR3 Q;  2JEA I;  2EXD A;  1CSQ A;  3VR6 A;  2D0P A;  3H3V H;  3E9I A;  4BY1 G;  1M90 C;  5EJW A;  4A76 A;  1TWC B;  5LHY 1;  2ZM6 Q;  2HQL A;  4N8X 1;  5A2Q L;  2R3Z A;  5D65 A;  5FOB B;  3J80 E;  2PZU A;  4JYA L;  1KXL A;  3S1Q B;  1G2S A;  5LL6 X;  3KF8 B;  2DJF C;  2KJX A;  4OIJ A;  4OWX B;  3QOJ A;  1E24 A;  2EOT A;  2WB1 G;  5C4X B;  4XT1 B;  3KDF A;  3ERS X;  4JBK A;  1PTO D;  3S16 H;  4A3K H;  3A54 A;  2A68 C;  1Q7Y C;  1PV4 A;  2ICE C;  3I4M G;  1ASZ A;  2E75 C;  3FPU B;  3V96 A;  2NYZ D;  2OCE A;  3U9S A;  4IPD A;  2F0F A;  4PZ6 A;  4UPA A;  4WRD A;  1VQI A;  2OQ0 A;  1ESR A;  1Q3L A;  1V43 A;  1SNO A;  3FDT A;  4NW2 A;  4DK3 C;  3Q22 A;  2HHH Q;  1O80 A;  1E7Z A;  5IGG A;  3JAM c;  4DV7 L;  4DAP A;  2UU9 Q;  5CV5 A;  4LWC A;  1CUK A;  1TXY A;  2VQF L;  2AUK A;  3GDE A;  4KN4 C;  3RN5 A;  4GNX C;  2ZXR A;  1HR0 L;  3HP3 A;  2DY8 A;  1EQT A;  2ZTC A;  4IOA A;  4A3L G;  4QIW E;  5CYU A;  1X55 A;  4P72 A;  4JI4 Q;  1B44 D;  3KLS X;  1EYD A;  1LTI D;  4HSV A;  1BNZ A;  4KHZ A;  1EIG A;  1IL2 A;  4KI0 A;  4DPG A;  1DD2 A;  5CV7 A;  4F88 A;  1AN8 A;  4JW0 A;  3N52 A;  4IUQ A;  4BXX H;  3MWY W;  3K80 C;  1IW7 D;  4DA2 A;  4CKC A;  5I2Y A;  1I5F A;  3GTG B;  3RZO B;  3HOX B;  1L1O C;  2L0C A;  2PNR C;  1ET6 A;  2RVL A;  3NSW A;  2IJ0 A;  1QB5 D;  1HR0 Q;  5M5X B;  4GN5 A;  2GN5 A;  4K6L A;  4C3I G;  2YU9 B;  5ELE A;  2B2T A;  4GKJ Q;  3UDF A;  5C3E H;  4A3E H;  5M5Y B;  1K83 H;  3CRK C;  1IYV A;  3VDY A;  3S1N B;  3BU2 A;  3JAM E;  1LTA D;  3SE0 A;  1RKN A;  4CJ0 B;  3J81 j;  2QA4 A;  2JJQ A;  3CPW A;  2UXC L;  4NXN Q;  1TWH B;  4KN7 C;  4IUU A;  2HT1 A;  4M1U B;  3VR4 A;  1B70 B;  1DOK A;  2ALY B;  3R8B A;  3I4M B;  3T1H L;  1HZC A;  4DF7 A;  3BVG A;  1NR2 A;  2NZH A;  3MXU A;  4OIK A;  1EY8 A;  4ZCK A;  1XXG A;  2CQA A;  5IT9 c;  1TS2 A;  4GKJ L;  1F2M A;  2Z9H A;  2WP8 J;  4JG2 A;  2JA8 B;  4EVO A;  2F52 A;  1S5F D;  4IJH A;  1B9M A;  1HPC A;  4R4Q A;  1X3G A;  4KY7 A;  4C56 C;  2VW9 A;  2HD3 A;  4AYB B;  4APV A;  3CC2 A;  1T5X D;  4ME5 A;  4GN3 B;  4JI1 L;  4DAV A;  2K01 A;  4H13 C;  1XMQ L;  3CQZ B;  2HCC A;  1BCP C;  2DUD A;  5EPL A;  5GAD C;  4L5T A;  4AYB G;  1RHP A;  3K6O A;  5IT9 E;  4QMG A;  4RAU C;  1J5E L;  2VZA A;  4JI0 L;  2F0V A;  4JI4 L;  1TQO A;  5IYD H;  4DR3 L;  3BDC A;  1HUN A;  1QJO A;  2LXK A;  3C1E A;  1PYS B;  4GNX B;  3K5L A;  1EY7 A;  4KLK A;  5C5M A;  4HJ7 A;  2F03 A;  4LF6 L;  4J6H A;  2IX0 A;  3CCL A;  1F9S A;  2VQF Q;  4I7A A;  3CCR A;  5BN3 A;  4X62 Q;  4JI6 Q;  1QNK A;  4HMI A;  4XDX A;  5IGB A;  2HCI A;  3J80 i;  3T13 A;  1XNQ Q;  2R7D A;  1BKB A;  5M3M H;  1SYB A;  4YCV A;  3GTL B;  5E4W C;  4DR1 Q;  5NUC A;  4N9P A;  1D2B A;  1FJG Q;  4G7Z C;  4IUN A;  2NUC A;  5IYC H;  2NVT H;  1HNW L;  1ZYR D;  3S9W A;  2WV6 D;  1A62 A;  4JI3 Q;  4YWL A;  1VF7 A;  3GTK H;  2B2T C;  2N8N A;  4IUP A;  1I4X A;  1SRO A;  1TWA B;  1CA6 A;  4HED A;  3M7G A;  2EYP A;  4A3G H;  3KK7 A;  5G3L F;  2VUM B;  5M3F H;  1QVG A;  3K7A B;  1K0R A;  1GUO A;  5C5L A;  1IBM L;  4ME3 A;  3NQT A;  1MD2 D;  2JA5 B;  1VQF A;  1HUM A;  2R7Z H;  4PV1 C;  2K32 A;  3G6J B;  4OWW B;  4X3U A;  4OO1 H;  1NCV A;  3D0F A;  1N33 Q;  1LO5 D;  1PA6 A;  1SMY D;  3WDN A;  3E5S A;  4AYB E;  1G2T A;  3PO2 B;  4U67 3;  4A93 B;  5LMU Q;  2K5H A;  3H09 A;  1H9K A;  1JJ2 A;  4H44 C;  4PMB A;  2D0O A;  1IHZ A;  1Y1W G;  5IGE A;  2QEJ C;  1KRS A;  2LKV A;  1EWH A;  1TWF H;  2JA7 G;  1CTM A;  1JWM D;  2AHO B;  2VS1 A;  1MBY A;  1CK1 A;  3O13 A;  1LTB D;  5KYL A;  1ILQ A;  4C3J B;  4DAM A;  2PQE A;  1GOZ A;  4CKB A;  4IPH A;  1RL2 A;  4X62 L;  4FF2 A;  4EGV A;  4A3I B;  3KLS A;  3HKZ E;  3I90 A;  4A3J G;  2B29 A;  4A3J H;  2M2L A;  3MA2 B;  3KBG A;  4YHH Q;  2D5D A;  5E3F A;  2RDH A;  3S1Q H;  2B63 H;  2VB3 X;  2QW7 A;  3L9A X;  4JI8 Q;  1Q46 A;  4WFN 3;  4DV0 Q;  2MFI A;  4A3C G;  4GKK Q;  1TY0 A;  1V1Q A;  1KDC A;  4Y7N B;  1D5X C;  4TQU S;  3SDZ A;  1EZ6 A;  2K03 A;  1M8A A;  3ERQ A;  3M4O B;  1B3Q A;  3HOW B;  2Q8T A;  4YHH L;  4MNO A;  1SMX A;  2Y0S B;  3QJY A;  1LT5 D;  4CKE A;  3HOZ G;  4O2D A;  5C44 H;  1E1O A;  4DUZ L;  4HR7 B;  2E74 C;  4ZKB B;  3J81 i;  2N78 A;  3KLR A;  2PZT A;  2FHT A;  1X3Q A;  2Z4H A;  1VQ7 A;  4JVZ A;  5KYI A;  3B6Y A;  5DM7 3;  1SE4 A;  2B2W A;  1YHB A;  1PLF A;  3QG1 A;  3S1M B;  1TWG B;  2KOL A;  1JOQ A;  1YNJ C;  4JPB W;  2A74 C;  4IO9 A;  5EGT A;  2KCM A;  2WKD A;  4JI6 L;  3OIQ A;  4NPS A;  1L1O A;  3CC7 A;  4JI2 L;  3F8T A;  2BE5 D;  1BVS A;  5JEA J;  2R92 G;  1BCP F;  2KCN A;  1O7L A;  4HTH A;  4B9X A;  4LF8 Q;  1VCI A;  4IUV A;  3KLW A;  2XSC A;  3I4N H;  2F0D A;  3NBI A;  1W2B A;  1KIX A;  2VQE L;  1MJC A;  3A7A B;  2NN6 I;  1NE3 A;  1EUJ A;  1VQJ A;  5I6W A;  1GKH A;  1LTG D;  2JQO A;  4GLV B;  2BH8 A;  1MJE A;  2Z1C A;  3G6E A;  2N49 A;  2XN9 C;  1J8I A;  4BA2 I;  1EY4 A;  1UEA B;  2XRS D;  5IIF A;  3HKZ G;  1GHJ A;  5GAH C;  1N32 L;  1H9S A;  3LNN A;  3D4W A;  3E0J A;  4KV6 A;  4HIM A;  2JA8 G;  4K0K Q;  1ZEQ X;  3TME A;  4BY1 H;  5L37 A;  1D7Q A;  4FF3 A;  3C2P A;  2L55 A;  1NJI C;  5EAY A;  1HQR D;  3RLN A;  2FIN B;  2RA4 A;  4KKU A;  4OEL B;  5IY0 A;  5I9P A;  3MXN B;  1V9P A;  1TWF B;  3BJU A;  3T1H Q;  2OF1 A;  3CCV A;  3ND9 A;  2R7F A;  5BR8 L;  4IFD I;  1D5Z C;  1BDO A;  5LMN Q;  4C3I B;  1L0X B;  3HEJ A;  5IP9 H;  2F1M A;  2H4O A;  4ZQ3 A;  4LF6 Q;  1PFM A;  4DV2 L;  1H9S B;  3NWS A;  2K5W A;  4IQZ A;  1CKO A;  2I5L X;  4DNT B;  2KQ3 A;  2SOB A;  5EBC A;  4GOP B;  3VYR A;  4K0K L;  2JA5 H;  5JPM C;  1G6Z A;  3DWQ A;  3HOW H;  5EBD A;  1YIT A;  2L5T A;  5IWA L;  1ILP A;  3I2Z A;  2E2J H;  1U4R A;  1WD1 A;  4RGO S;  4WJ4 A;  1TWC H;  3AQQ A;  3DUZ A;  3U50 C;  4DUY Q;  1WVL A;  2F0L A;  4GS3 A;  2BDO A;  1L0Y B;  3KUP A;  3MVV A;  4QCL A;  3FRP B;  1WTQ A;  1NNX A;  1YNN C;  1ESF A;  2EJG C;  1PYB A;  5FLX c;  3EFX D;  4Y52 H;  1VQC A;  1N36 L;  1QIL A;  4A3D B;  4CJ2 C;  2EYM A;  1TS5 A;  3RNU A;  1QG7 A;  4C3J G;  1UE7 A;  4C3J H;  4L8J A;  3RLF A;  4DV7 Q;  2PQA A;  1PMR A;  4KY6 A;  1HRJ A;  2ZXO A;  3PV0 A;  2A8V A;  1GUW A;  4DAY A;  1K83 B;  1JIC A;  1Y1W B;  2F0S A;  1HTP A;  3J81 E;  1SYD A;  1Y1V G;  2FJ2 A;  1I3Q B;  2V1C C;  2F0U A;  1E3P A;  2UUB Q;  1CKN B;  1JWS D;  1N32 Q;  2R93 B;  4RHS A;  5EKL A;  3RZD B;  5M5X H;  1DOL A;  4NKL A;  3TDQ A;  3K0Y A;  4GNX A;  1PFB A;  5D14 A;  1U4L A;  1TVX A;  1BBX C;  5KND A;  4BY7 H;  1KNA A;  5EKK A;  1I6H H;  2YV5 A;  1CI3 M;  5JEA G;  1UE5 A;  1PRT D;  3TN2 A;  1YI2 A;  1X9N A;  1JE5 A;  1JWU D;  4HSP A;  2KCT A;  5C3X A;  1IKL A;  4R9W A;  4ZUI A;  3PMF A;  1PYW D;  1CSP A;  1F9R A;  3G71 A;  1T9H A;  1PRT C;  1Q1B A;  5IYB G;  2A6E D;  1NUC A;  4FXG C;  4BBS H;  2UU9 L;  4B3M L;  3TQY A;  1DYQ A;  3H0G G;  3P1H A;  1XPU A;  2AQ1 B;  4KHV A;  2DN8 A;  3HRZ C;  4PNY A;  1V1P B;  4XIG S;  1U9R A;  3BVM A;  1YJN A;  4QF4 A;  3PIP A;  1SAP A;  4X64 Q;  5C3E B;  3PO3 G;  3OMG A;  2KBN A;  4CDE C;  3H0G B;  4R8I A;  4A3D G;  2X69 A;  1V8Q A;  1VDZ A;  3CAM A;  4RCO A;  5H1S E;  4FP5 D;  2F0I A;  1EIH A;  4OEM B;  4XXE A;  3AB9 A;  1F2Z A;  1EWI A;  1IXR A;  3K5N A;  1AZQ A;  5M3M G;  3MEH A;  3BZK A;  2UXD Q;  1XTC D;  1CM9 A;  3NHH A;  2Z6K C;  4JYA Q;  4GKK L;  4K8J A;  4DV0 L;  3DM1 A;  3GP7 A;  4IZ8 A;  4LUO A;  3TZD A;  2L1B A;  1LYL A;  5M5W H;  2NWG A;  3NPP A;  1S5C D;  5DEH A;  1B2T A;  2VQE Q;  5CBE E;  5J1Z A;  1PTO C;  3AU7 A;  1RD9 D;  2EVB A;  1C9O A;  1GUT A;  1SFO H;  4DFA A;  4GOP A;  2EY2 A;  2DJG C;  2CWA A;  2E2H H;  2K50 A;  4JI2 Q;  3K7U C;  4DK6 C;  4J15 A;  5F2D A;  3A0J A;  2MNA A;  5JJL A;  1RTO A;  3S2D H;  1SYE A;  4NP5 A;  2MO1 A;  3IL8 A;  1GM5 A;  4B3M Q;  1K8M A;  3I8Z A;  5KNC A;  2KHS A;  4LF4 Q;  1ICF B;  4O1N A;  2JK8 A;  3STB C;  1Q90 A;  3ULP A;  4IPG A;  3CCJ A;  2F0H A;  1HTL D;  3MXP A;  1PH9 A;  3L7Z C;  4OHJ A;  2CW0 C;  2HUG A;  1N34 Q;  2EY5 A;  5COR A;  4DN4 M;  1VQ5 A;  1II3 A;  4JI0 Q;  1UE6 A;  2A6E C;  3HOX G;  4DNR B;  1JCK B;  4HMJ A;  1EQV A;  2CH4 W;  4HAE A;  1Y8N B;  2PI2 E;  3DEP A;  5C4J H;  3TSS A;  3J81 c;  1JC7 A;  4A4I A;  3E3X A;  1K8G A;  3OIP A;  2QIL A;  3K58 A;  3G7L A;  2NVQ B;  3TZU A;  2LY7 A;  2UUB L;  1LTT D;  3K0X A;  1T5E A;  1SJE D;  4A3B G;  2FMC A;  4R4O A;  3PF5 A;  4KTA A;  3EIV A;  3A7L A;  2EPB A;  1YIJ A;  1D1K A;  4EQ5 A;  2E76 C;  2JYO A;  4DR1 L;  4XTC S;  2E2D C;  4KKT A;  1R9T H;  2VNU D;  1X3F A;  3CCU A;  2RDG A;  1B8A A;  1HH2 P;  1JB3 A;  1S4Z A;  3H6M A;  3S14 B;  4LJZ C;  1EYC A;  1WTV A;  4A3B B;  3PO3 H;  3Q6S A;  1VQM A;  4HIO A;  2YU9 H;  1BF4 A;  3S14 H;  4E6I A;  4GZY C;  5IYC G;  3P20 A;  3NTH A;  2QEX A;  3DLL A;  2Q8I B;  5JJZ A;  1O7Y A;  4OXP A;  1H95 A;  1I4H A;  4K8I A;  3SK6 A;  4JC0 A;  5T1G A;  3A5U A;  3VR5 A;  1VS0 A;  3H3V I;  4A3G G;  1KAB A;  4IFD H;  4DXG A;  2BA0 A;  4L63 B;  3P75 A;  3MXG A;  1WCM H;  1KLG D;  5AFW A;  1PTO B;  1XX8 A;  1O7I A;  1N8R C;  2WIN B;  4U68 A;  3HOY B;  4UP9 A;  3I55 A;  4UAI A;  5IP7 G;  3A56 A;  1SDF A;  5ELF A;  4G7O C;  4HID A;  3W3A A;  1A3T A;  1HNW Q;  3UI2 A;  4WJ3 M;  2EXZ A;  1B1Z A;  2EIF A;  2I46 A;  2DY7 A;  1B3A A;  1I4P A;  2VB2 X;  1E1T A;  3GV6 A;  5HGQ A;  1SRU A;  5TSS A;  1ENF A;  2BH2 A;  3I3C A;  1EFW A;  3DEO A;  3ZYY X;  1X3E A;  4LNQ A;  4DR7 Q;  2VY3 A;  3GTO H;  1KHI A;  3K5M A;  1CQF A;  4DV6 Q;  2K5N A;  1Q8K A;  4BBS G;  2K4K A;  2KVM A;  4A3K B;  5EPK A;  4UDU C;  4IUT A;  1AP0 A;  3NEM A;  3CF5 A;  2H1E A;  3EBE A;  3S2D B;  3DM3 A;  4RFB A;  1KAW A;  3CHB D;  1JOR A;  1STG A;  1VQ4 A;  4NDX A;  4LFA L;  4A3M G;  3FP9 A;  1A8V A;  1KRT A;  3HOU G;  5CMD A;  2B2Y A;  4R8N A;  3S1R B;  2DGY A;  2P5Z X;  3A8I E;  2Q2H A;  1PRT B;  5JEA H;  1X65 A;  4YY3 Q;  1XMQ Q;  1SSO A;  4A75 A;  4FF1 A;  4JI1 Q;  4DV5 L;  1LT3 D;  2Q2T A;  3S15 B;  3Q23 A;  5D3D A;  1SR3 A;  4QY7 A;  4PG3 A;  3HOU B;  4A3M B;  1SNQ A;  5M5W B;  4O0A A;  2AWO A;  4X66 L;  4A3J B;  2AUJ D;  5DAU A;  2LXJ A;  2VL6 A;  3X3M A;  2F0G A;  1YVC A;  4NMZ A;  3WOE A;  1DON A;  1IBK Q;  1HA5 A;  3CKI B;  2HDM A;  2NZO A;  5E1F A;  1K3R A;  1MKH A;  2JN4 A;  1QUQ A;  1DCZ A;  2HHH L;  2K75 A;  1CKN A;  3RD4 A;  5BR8 Q;  3OPO A;  5FO8 B;  2UXC Q;  2PO4 A;  1OXX K;  2ZTD A;  1BXT A;  1GVP A;  3CCE A;  2E5L Q;  1I4R A;  4KD3 A;  5J39 A;  4XQN A;  3VYT A;  4POG A;  5IE8 A;  1N36 Q;  2NVY B;  3STB D;  2F0M A;  2RSO A;  3M9B A;  4IFD J;  3PIO A;  2NN6 G;  1ENA A;  2NVY H;  3IAY A;  2R93 G;  3NE5 B;  4Q5V A;  2IT1 A;  5IP9 G;  2N55 A;  1DZ1 A;  2A5H A;  1G29 1;  5EQ0 A;  3SK8 A;  1R9T B;  3HS0 C;  4HN7 A;  1WJJ A;  1HA6 A;  1A2T A;  3U4Z A;  4BY7 G;  2KEE A;  1A2U A;  4RHR A;  3ZJY C;  2XNA C;  3IFT A;  3HOY H;  4C2M H;  1KL9 A;  3HKS A;  1PH5 A;  2JA5 G;  2IX1 A;  3CCQ A;  2ZM6 L;  2D2C C;  4GOP C;  4LK1 C;  4TKO B;  1STY A;  4A3L H;  1CHQ D;  1P16 A;  5KNB A;  1F2L A;  5FLX L;  4DR4 L;  1OXS C;  2VUM G;  2QF7 A;  2PCF B;  3UDX A;  1YEZ A;  1WYD A;  4X6A H;  1D5M C;  1TU2 B;  1PZK D;  4IUR A;  2L9H A;  2OQK A;  4EQP A;  5LMN W;  1FNU A;  1EYG A;  1OTC A;  1K3B C;  3G48 A;  2LFN A;  2O5J C;  1CA5 A;  2O2L D;  1LTR D;  3SK5 A;  1EOT A;  3KFU A;  1PZJ D;  3GTP B;  3TP8 A;  5C0X G;  4QUC A;  3CW2 C;  1I94 L;  2R93 H;  3LGJ A;  2NVT B;  4HJ5 A;  4LF5 L;  5K36 H;  1RF2 D;  1D6E C;  2EE1 A;  4JI7 Q;  5K36 G;  2EJF C;  4ABN A;  4EX5 A;  2F0Q A;  4DV3 L;  1JQY D;  1EU4 A;  3W1B A;  2F0W A;  3H91 A;  4B3S L;  1O7Z A;  1SYG A;  5I6Y A;  3QIA A;  4XQQ A;  4LFB Q;  4RA8 A;  4KK7 A;  3S1M H;  4ZAI A;  3M3Y H;  4DUZ Q;  1UWV A;  5C4X H;  3SXH A;  3K57 A;  1YZ6 A;  1X6O A;  3CPF A;  4A3D H;  1P8L A;  2F3I A;  3M4Q A;  3PUX A;  3OW7 A;  2MO0 A;  2LS0 1;  4PZ8 A;  2EYF A;  3CQZ H;  3NP8 A;  1HFN A;  1HJP A;  3ONA B;  3URY A;  3S2H B;  2A6H D;  1SN8 A;  2AQ2 B;  3T53 B;  3TP7 A;  2WAC A;  4A3F H;  3BZC A;  1EIY B;  5FK9 C;  5J22 A;  1XMO Q;  1I50 H;  1UUP A;  2FMM A;  2N3S A;  4JI5 L;  2E8G A;  3V2T A;  1CQV A;  2DNC A;  4B9W A;  1ET9 A;  5C3W A;  3LWU A;  3FVQ A;  5C0X I;  4NXM L;  2BOS A;  4P75 A;  3RR5 A;  1X3P A;  3NTI A;  2EYL A;  1IYU A;  2PZW A;  2ZT9 C;  1YBY A;  5GAG C;  3AYH B;  4MN3 A;  1KC8 C;  3NEN A;  1PFS A;  1PH2 A;  3I72 A;  4RH6 A;  1XTD A;  4AH6 A;  2HQE A;  3SEB A;  3PUV A;  2XGT A;  2UUA L;  2KHI A;  4DV4 L;  3TP6 A;  4X65 L;  3F2B A;  4OGQ C;  1A3V A;  1UNS A;  5CC4 A;  1QVC A;  2LMC B;  4DGZ A;  4MTK A;  2ZJR A;  1PH8 A;  1F9P A;  3PSI A;  3PUY A;  3FMC A;  2RCF A;  1EQR A;  1QWY A;  4UHV A;  5FLM H;  3QR8 A;  1U0L A;  1IW7 C;  4A93 H;  1QZG A;  3MXN A;  2EYO A;  3M7N A;  4JI8 L;  3EQL C;  3W5O A;  1AEX A;  4L5R C;  1GUN A;  3GTM H;  3A8J E;  2K7V A;  3J7Z C;  1SNM A;  1IBM Q;  1VQ6 A;  3AFP A;  4IFD G;  2L4N A;  3TRZ A;  3ICE A;  1SYF A;  2OTJ A;  4PMW A;  3BZD B;  1MSG A;  1WCM B;  1RDP D;  5IYD G;  3PIO 3;  1PXU A;  1PH7 A;  1CFM A;  5JJK A;  3CCS A;  1VQ8 A;  2AWN A;  2MJ8 A;  4JOI C;  1IKM A;  4BXX G;  5FO7 B;  1WTO A;  2R7Z G;  1NR4 A;  1X56 A;  2EY1 A;  3DHQ A;  4K2L A;  2EZV A;  2EYJ A;  2M00 A;  4OL7 A;  5HY6 A;  1LLR D;  5DM6 3;  1VQA A;  3OTO Q;  1HNZ L;  4NXN L;  1YNJ D;  1LTS D;  1WI5 A;  1E22 A;  1QCB D;  1MGS A;  1WTH A;  2WFW A;  4RG1 A;  3BYT B;  1VQB A;  1Y1V H;  3IKJ A;  4Z9C B;  5C4Z A;  3FEW X;  5FJ8 H;  4KHP Q;  3GTL H;  1N33 L;  1TS3 A;  3J80 L;  2K5D A;  3WOF A;  5C0X J;  1HCZ A;  4DV4 Q;  3M4Y A;  1AW7 A;  1EY9 A;  3U9O A;  4DAY B;  3HG9 A;  3BYY B;  5E4X A;  3I56 A;  4K14 A;  4G4K A;  2NN6 H;  5JJI A;  3K8A A;  1VQG A;  1HR0 W;  3KF8 A;  2E2H B;  2CWP A;  1DM0 B;  3GTJ B;  3DWA A;  1QVF A;  2G9H D;  1STH A;  2WAQ B;  2RBM A;  5T1I A;  4BY7 B;  4A3I G;  4ZK9 B;  2RHQ B;  5FLM G;  2QGQ A;  4CBV A;  5BN5 A;  2ZXP A;  3NEL A;  2IX3 A;  3PF4 A;  1TR5 A;  2L12 A;  1CHP D;  4I7Z C;  2WAQ G;  5JVG 3;  2A19 A;  2JA7 B;  4ZYS A;  4FDB A;  5JPN C;  4N8F A;  1I3Q H;  1V1P A;  1VQN A;  1QOH A;  3D6W A;  1L1O B;  1N9W A;  5GAE C;  1IL8 A;  2YYZ A;  1W6K A;  3LWE A;  2RCN A;  5KGU A;  1PH4 A;  1M1K C;  1Q8I A;  3PCO B;  1CKM A;  2D9U A;  4DK0 A;  3K5O A;  2K1B A;  1SE8 A;  4LFB L;  3VA7 A;  1A6X A;  3A5Z B;  5C3E G;  4DR5 L;  1ZYR C;  3S24 A;  4LF9 Q;  3G4S A;  3A55 A;  4ODG A;  4BBS B;  1PH1 A;  1EY5 A;  1K8O A;  1C8C A;  1SXT A;  2E5L L;  3PO2 H;  3NQI A;  5CV8 A;  1VF5 C;  1STB A;  1EOV A;  5G3L D;  2C35 B;  3PQI A;  4LFC L;  4B08 A;  1EZ8 A;  3BG3 A;  5M3F G;  4AQY Q;  2EDG A;  1A0I A;  2OT2 A;  2E2J B;  3BVZ A;  2R7Z B;  1WTW A;  1EYA A;  3SVM A;  3CRL C;  4K2K A;  3VYU A;  2F0O A;  5IOD A;  2HIX A;  3ULL A;  1G8Z D;  4C2M B;  4DR4 Q;  2IWH A;  1LUZ A;  3TRE A;  4JV5 Q;  3J80 c;  1HZA A;  1SYC A;  4AQY L;  2B2U C;  1EEF D;  4ZRZ A;  2WAQ E;  1C7Y A;  5C6A A;  1TWA H;  1YNX A;  1RTN A;  3C1F A;  4POF A;  3AEV A;  4PZ7 A;  4ALP A;  3T4A C;  4C3I H;  1NSN S;  2Z6K A;  1XNR L;  3HOV B;  3TS0 A;  4MIU A;  4YCU A;  1Y1W H;  3KF6 A;  3P7J A;  2R92 H;  1W6J A;  4IOC A;  2GVB A;  2ENB A;  2CQO A;  2RDF A;  3T16 A;  4C3H G;  5ELC A;  3RLO A;  3OHX C;  3HZX A;  2PYK A;  4H02 A;  1FD7 D;  4B3S Q;  5I9O A;  4JCV E;  4FO2 A;  3S16 B;  4DNI A;  4G7H C;  2XTI A;  4MTN A;  2KED A;  3CU7 A;  2NVQ H;  5IOC A;  4JV5 L;  3L2P A;  3NBH B;  2GVA A;  2CVR A;  2YTY A;  3CP0 A;  1PDQ A;  1EFI D;  1X32 A;  1EWC A;  2F0T A;  5BN4 A;  4LF8 L;  4HCE A;  1B4O A;  1NBW A;  2J4X A;  2CHB D;  3MHB A;  3I73 A;  1SE3 A;  3FKI H;  1YJ9 A;  1MSH A;  4S3S A;  2I07 B;  5C4H A;  3F1Z A;  3I4N B;  3CXC A;  3PUZ A;  3QO2 A;  4LMQ D;  1PVO A;  1A63 A;  2LSS A;  4DUY L;  3SHL A;  3DWP A;  5KRU A;  1WCM G;  3RZD H;  3S2H H;  1D8L A;  3HOZ H;  2K5V A;  4X3S A;  2IL8 A;  1UEB A;  1SBB B;  1I6V C;  1H9R A;  2MQH A;  1IBL L;  4KJO A;  2E2I H;  4RCN A;  3VYS A;  3GTO B;  3GD7 A;  1B9N A;  3I4M H;  2NBF A;  2O5I C;  1KAA A;  3I4O A;  5C0X H;  2C5C A;  3IFD A;  3LX0 A;  2JE6 I;  2CCZ A;  3D6C A;  1BR9 A;  5M5Y H;  4A3E B;  4TRD A;  1XNR Q;  5LMN L;  5CV9 A;  2D62 A;  3HOV H;  2BE5 C;  3GQB A;  2A73 B;  4JBJ A;  1Y8O B;  1QZH A;  1SFO B;  1OXU A;  4X3K A;  1KLU D;  3M4O H;  4TSS A;  1FVI A;  1DJR D;  4LUV A;  4YCW A;  2Y0S E;  1ZKO A;  2A68 D;  2J7Z A;  3H94 A;  1LAC A;  1UE1 A;  3J7Y W;  2A1A A;  1LV9 A;  4P73 A;  4H7B A;  1WD0 A;  3JAM i;  4HCS A;  2ATW A;  2G9D A;  1AE2 A;  4ID6 A;  2JEB I;  1TT2 A;  1ML0 D;  3NTK A;  1S5E D;  3K7A H;  2CH4 A;  3AFQ A;  2F0E A;  1GXD C;  4DR6 L;  2N88 A;  1ENC A;  4GN4 B;  2O4X A;  4FYD A;  3J81 L;  4A3C H;  2F4V L;  3A74 A;  1K9M C;  2QKI C;  1L2F A;  4QL5 A;  5ELN A;  3D8G A;  1Q82 C;  4B3R L;  3MFY A;  3D4D A;  2AMC B;  4A3E G;  2IHE A;  2A6H C;  2Q2U A;  2OEO A;  5C4X G;  1Q86 C;  1WTX A;  1NAP A;  2Z6B A;  2R92 B;  4A93 G;  1U5K A;  5M3M B;  3HGB A;  1PHJ A;  2ZTE A;  2SDF A;  4JOI A;  4TVA B;  3F2D A;  4JBW A;  3OWF A;  3CME A;  4KHP L;  3QWN A;  1WTP A;  3OTO L;  4RKB A;  1K0S A;  2OWO A;  3W2D A;  2K5Q A;  3AMU A;  4BY1 B;  2RSN A;  2YTX A;  1F2Y A;  3T1Y Q;  1DGS A;  1SEB D;  4KKS A;  1JMC A;  1GO3 E;  1E2W A;  3MZ5 A;  4OX9 Q;  1VMC A;  2Q8R E;  2JP1 A;  5JOB A;  1LTL A;  5AJ3 Q;  2UUC Q;  3CMA A;  2K33 A;  2PI2 A;  3M4P A;  1Y14 B;  3S17 B;  3Q24 A;  1R4P B;  1EY6 A;  3TP5 A;  2ZJP A;  4K5V A;  2Y0S G;  3FKI B;  4A3M H;  1I50 B;  2PMZ B;  2VUM H;  1ASY A;  2CKZ B;  4DV1 L;  2JA6 H;  3GTJ H;  3EJI A;  3CD6 A;  5IGD A;  1FJG L;  2F0P A;  4N9T A;  5A35 A;  3QB3 A;  4QJF A;  1EU3 A;  3GTK B;  1AZP A;  1GD7 A;  1VQP A;  3D3R A;  5K5P A;  1F9Q A;  1JJC B;  2QDB A;  5CBA E;  1TWG H;  5E7N A;  4QIW B;  4CDC C;  3Q8D A;  4B3R Q;  5DNF A;  1PFN A;  1AH9 A;  2FXQ A;  2B2V A;  2EYH A;  5ELO A;  1GUG A;  1JOO A;  2B39 A;  5DLQ E;  1HNZ Q;  1JT8 A;  3HOV G;  2G5D A;  1QUQ B;  1R4Q B;  3MC0 B;  2M9V A;  1PH6 A;  3NK9 A;  5CR3 A;  1JR0 D;  1SNC A;  2R61 A;  4EQN A;  4WJW A;  4BBR G;  2JA6 B;  1PH3 A;  1YJW A;  4F7X A;  4RGM A;  4DU9 A;  2EY6 A;  5HGT A;  1JJG A;  3JAM L;  1K28 A;  2A69 C;  2BDN A;  3HOX H;  5COY A;  1BCP D;  1VQE A;  3TEH B;  4HJ8 A;  2NTT A;  1BOS A;  3C3L A;  2B63 B;  5AJ3 L;  1PTO H;  4BWG B;  1HXY D;  2EJM A;  4GLA C;  4RGT A;  1C0A A;  2JA8 H;  2H5X A;  4YIJ A;  2F0K A;  3BDO A;  1Z9F A;  4I65 A;  1STE A;  1GJX A;  5KEE A;  4HJA A;  1I4Q A;  2K52 A;  2XRQ D;  1QE6 A;  3UDG A;  1A15 A;  3H0G H;  2WKC A;  2IW3 A;  1CT1 D;  1RIP A;  4J1M A;  4P2C B;  2Z0S A;  5KIX A;  4CJ1 B;  2MUY A;  5JAV A;  3KJO A;  1Q1E A;  4NB3 A;  3VA5 A;  5EPJ A;  4LAA A;  4OO1 I;  1X54 A;  2TMP A;  1XJV A;  1HHV A;  4X64 L;  5LL6 S;  4UP8 A;  3SGI A;  1H9M A;  1Z47 A;  2K28 A;  3U4V A;  1I94 Q;  2XWJ B;  1KDB A;  2KCC A;  1RJT A;  1PZI D;  2MP1 A;  1XNQ L;  2CW0 D;  1HQM C;  2AKW B;  3GTG H;  3M85 A;  3RZO H;  1STN A;  2ICI A;  2WB1 E;  4ZKC B;  3C46 A;  1FL0 A;  2ASB A;  4L5Q A;  3VR3 A;  1U4P A;  2X6L A;  2PMZ E;  4F8M A;  4P71 A;  4JI5 Q;  4XYQ A;  1HNX L;  3EN2 A;  2YTV A;  4X66 Q;  3HOY G;  3KYH C;  4JBM A;  5EKI A;  1J5E Q;  3KBX A;  4A3F B;  3MEF A;  1FGU A;  4V19 0;  1G51 A;  1XWE A;  4X3T A;  2JXM B;  2VXW A;  5CGK A;  5CV6 A;  1VQH A;  4OON A;  3JC6 6;  1XYI A;  2KEN A;  5D3I B;  3KDF B;  3QOL A;  4EQO A;  2J0T D;  4DV5 Q;  3ITP A;  4MZ9 A;  3VR2 A;  4O42 A;  3GTQ H;  2BA1 A;  3S1R H;  5ELB A;  1LT6 D;  2I5M X;  2SEB D;  1EIF A;  1NMG A;  4R4I A;  4HIK A;  4LFA Q;  3KJP A;  1XPR A;  1E2V A;  3BDL A;  1MI2 A;  3TS2 A;  2MPM A;  3ULJ A;  4ZUJ A;  5HUR A;  5IYB H;  1S40 A;  1FNW A;  1VQL A;  1TWH H;  4F87 A;  1G91 A;  3GO5 A;  4LW1 A;  2WB1 B;  1IBL Q;  3OOC A;  4KMU C;  4DV6 L;  2L11 A;  3S1N H;  4CDD C;  4FF4 A;  3IRB A;  1HFG A;  3K59 A;  4LF5 Q;  3H3V C;  1HZ9 A;  2XIW A;  1RCV D;  2JA7 H;  4UY8 C;  2RKS A;  1VMP A;  2K04 A;  2KEC A;  5FO9 B;  1BBW A;  4L6T B;  3L0O A;  1HNX Q;  4YWK A;  4M8A A;  4FXK C;  1CZW A;  2UXB L;  2C9O A;  5C44 G;  3MAQ A;  1NY4 A;  3GV3 A;  5IT9 L;  3S17 H;  1G6P A;  2DNE A;  3R93 A;  4LF7 L; 
#chains in the Genus database with same CATH homology
 2B2U A;  3R3O A;  1LT4 D;  2HDL A;  1TY2 A;  3OSO A;  2MGS A;  3SR1 A;  3GTM B;  1QNU A;  2Z4I A;  1JOK A;  2B2V C;  1Y8P B;  3E6Z X;  3M3Y B;  1GHK A;  4K5X A;  1SJH D;  1F77 A;  4C1N K;  4FNF A;  1ROD A;  3J7A F;  4K5W A;  3FPP A;  5JVH 3;  1ONL A;  2TSS A;  2FFK B;  4Q0F A;  1V1O A;  3I70 A;  1LAB A;  1TKW B;  4ULL A;  1YNN D;  1TII D;  4IN3 A;  2GA4 B;  1UAP A;  1S5D D;  4KY5 A;  3PUW A;  4BS9 A;  1SMY C;  4ILW A;  4WOR A;  2NZ1 D;  4QB4 A;  1KDA A;  3NWT A;  3PIP 3;  1KTK A;  4DK1 A;  1C48 A;  4V0B A;  5FKA C;  1EY0 A;  5FLX E;  1I4G A;  4PMC A;  1I6H B;  4A3G B;  5C4J B;  1FNV A;  1WTR A;  4OO1 G;  1U4M A;  1AFP A;  1B50 A;  3ND8 A;  3X3N A;  2ID0 A;  2PPB C;  2F3V A;  4PQX A;  3J7A V;  4C3H B;  3R2T A;  1Z6H A;  1S5B D;  2MHV A;  1TS4 A;  2KA7 A;  4RWS C;  1J9O A;  3OMC A;  3T51 B;  2WII B;  3DXJ C;  3ERO A;  3EVQ A;  5I2X A;  1BCP B;  3I4L A;  1Y69 U;  4XYO A;  3TBI B;  4RKL A;  4CHT B;  3SK4 A;  1ICW A;  1FYC A;  2QCP X;  2SNM A;  3V05 A;  4RGN A;  1GUS A;  2NVX B;  1OXT A;  1PRT F;  1SE2 A;  1A3U A;  4QUF A;  1Q12 A;  3D4R A;  2B8F A;  5I4D A;  2K6A A;  4K6D A;  5CV4 A;  4G57 A;  1C4Q A;  2BCO A;  2XWB B;  2NB0 A;  4KJN A;  4BA1 I;  2RQX A;  3RUZ A;  1Y1V B;  2A69 D;  2Z8L A;  4BBR B;  1EEI D;  2B2W C;  4CGY B;  1BO0 A;  1KNE A;  2IPK D;  4JK1 C;  3N6R A;  4J8Q A;  1ZXT A;  3Q0A A;  4DXF A;  1EL0 A;  2F3W A;  1OO9 B;  4XT3 B;  1D1I A;  5A2Q E;  3I91 A;  5IGC A;  2JSO A;  2PW5 A;  1B53 A;  2AQ3 B;  2F0N A;  1BQQ T;  1M4V A;  1PTO F;  2B8G A;  1STA A;  3RMH A;  4KD4 A;  4FXD A;  3F2U A;  3MFG A;  3HKZ B;  3R2I A;  1E0B A;  5M3F B;  1BUV T;  1SNP A;  1SND A;  5ELD A;  3BS1 A;  2KUM A;  4ZLT F;  1OXV A;  1DXM A;  1DOM A;  4MHE A;  3L3O C;  3NBH A;  2SNS A;  2X6G A;  3NXW A;  1JE4 A;  2OXP A;  1FR3 A;  3PO3 B;  2NTS A;  4IAL A;  3NUC A;  2F0J A;  2PW7 A;  1H9J A;  4C1N I;  2F4I A;  3DMU A;  1Z7T A;  1CZG A;  3MTS A;  3OWE B;  2K05 A;  3T56 B;  3D31 A;  4FVM A;  2XVS A;  2R6G A;  4H0L C;  4XQJ A;  3EA6 A;  2E2I B;  5IGF A;  1O78 A;  2V4D A;  5ISR A;  1FGB D;  3GTQ B;  3A8K E;  5C44 B;  1E2Z A;  2B2Y C;  3HOZ B;  5M9O A;  2JEA I;  3VR6 A;  5EJW A;  1TWC B;  5LHY 1;  5A2Q L;  2R3Z A;  5D65 A;  5FOB B;  3J80 E;  2PZU A;  3S1Q B;  1G2S A;  5LL6 X;  2KJX A;  4OIJ A;  3QOJ A;  2EOT A;  5C4X B;  4XT1 B;  1PTO D;  3A54 A;  2A68 C;  2ICE C;  2E75 C;  3FPU B;  3V96 A;  2NYZ D;  3U9S A;  2F0F A;  4WRD A;  1ESR A;  1Q3L A;  1V43 A;  1SNO A;  3FDT A;  4NW2 A;  3Q22 A;  1O80 A;  5IGG A;  4DAP A;  5CV5 A;  2AUK A;  4KN4 C;  2ZXR A;  3HP3 A;  2DY8 A;  1EQT A;  5CYU A;  1B44 D;  3KLS X;  1EYD A;  1LTI D;  4HSV A;  1BNZ A;  4KHZ A;  1EIG A;  4KI0 A;  1DD2 A;  5CV7 A;  4F88 A;  1AN8 A;  3N52 A;  4IUQ A;  4DA2 A;  3GTG B;  3MWY W;  1IW7 D;  4CKC A;  5I2Y A;  3RZO B;  3HOX B;  2L0C A;  2PNR C;  1ET6 A;  2RVL A;  3NSW A;  2IJ0 A;  1QB5 D;  5M5X B;  4K6L A;  4C3I G;  2YU9 B;  5ELE A;  2B2T A;  5M5Y B;  3CRK C;  1IYV A;  3S1N B;  3JAM E;  4CJ0 B;  1LTA D;  1RKN A;  3SE0 A;  1TWH B;  4KN7 C;  4IUU A;  4M1U B;  3VR4 A;  1DOK A;  3R8B A;  3I4M B;  4DF7 A;  3BVG A;  1NR2 A;  3MXU A;  4OIK A;  1EY8 A;  1XXG A;  2CQA A;  1TS2 A;  1F2M A;  2WP8 J;  2JA8 B;  4EVO A;  1S5F D;  1B9M A;  1HPC A;  4KY7 A;  4C56 C;  4AYB B;  1T5X D;  4ME5 A;  4DAV A;  2K01 A;  4H13 C;  3CQZ B;  2HCC A;  1BCP C;  5EPL A;  1RHP A;  3K6O A;  5IT9 E;  4QMG A;  4RAU C;  2F0V A;  1TQO A;  3BDC A;  1HUN A;  1QJO A;  3C1E A;  3K5L A;  1EY7 A;  5C5M A;  2F03 A;  4J6H A;  2IX0 A;  1F9S A;  5BN3 A;  1QNK A;  4HMI A;  4XDX A;  5IGB A;  2HCI A;  3T13 A;  1SYB A;  3GTL B;  5E4W C;  5NUC A;  4N9P A;  1D2B A;  4G7Z C;  4IUN A;  2NUC A;  1ZYR D;  3S9W A;  2WV6 D;  1VF7 A;  2B2T C;  4IUP A;  1I4X A;  1TWA B;  1CA6 A;  4HED A;  3M7G A;  2EYP A;  3KK7 A;  5G3L F;  2VUM B;  3K7A B;  1GUO A;  5C5L A;  3NQT A;  1MD2 D;  2JA5 B;  1HUM A;  4PV1 C;  2K32 A;  3G6J B;  4X3U A;  4OO1 H;  1NCV A;  1LO5 D;  1SMY D;  3WDN A;  3E5S A;  1G2T A;  3PO2 B;  4U67 3;  4A93 B;  3H09 A;  1H9K A;  4H44 C;  4PMB A;  1IHZ A;  5IGE A;  2QEJ C;  2LKV A;  1EWH A;  1CTM A;  1JWM D;  1MBY A;  1CK1 A;  3O13 A;  1LTB D;  5KYL A;  1ILQ A;  4C3J B;  2PQE A;  1GOZ A;  4CKB A;  4FF2 A;  4EGV A;  4A3I B;  3KLS A;  3I90 A;  2M2L A;  3MA2 B;  3KBG A;  2D5D A;  5E3F A;  2RDH A;  2VB3 X;  3L9A X;  4WFN 3;  1TY0 A;  1KDC A;  4Y7N B;  1D5X C;  4TQU S;  3SDZ A;  1EZ6 A;  2K03 A;  1M8A A;  3ERQ A;  3M4O B;  3HOW B;  2Q8T A;  2Y0S B;  3QJY A;  1LT5 D;  4CKE A;  4HR7 B;  2E74 C;  4ZKB B;  3KLR A;  2PZT A;  2FHT A;  1X3Q A;  2Z4H A;  5KYI A;  5DM7 3;  1SE4 A;  2B2W A;  1PLF A;  3QG1 A;  3S1M B;  1TWG B;  2KOL A;  1JOQ A;  1YNJ C;  2A74 C;  5EGT A;  2WKD A;  3OIQ A;  2BE5 D;  5JEA J;  1BCP F;  2KCN A;  1O7L A;  4HTH A;  4B9X A;  1VCI A;  4IUV A;  2XSC A;  2F0D A;  3NBI A;  3A7A B;  2NN6 I;  5I6W A;  1LTG D;  2Z1C A;  1J8I A;  2XN9 C;  4BA2 I;  1EY4 A;  1UEA B;  2XRS D;  5IIF A;  1GHJ A;  1H9S A;  3LNN A;  3D4W A;  3E0J A;  4KV6 A;  1ZEQ X;  3TME A;  4FF3 A;  3C2P A;  2L55 A;  1HQR D;  2FIN B;  2RA4 A;  4KKU A;  5I9P A;  1TWF B;  2OF1 A;  3ND9 A;  4IFD I;  1D5Z C;  1BDO A;  4C3I B;  1L0X B;  3HEJ A;  2F1M A;  2H4O A;  4ZQ3 A;  1PFM A;  1H9S B;  3NWS A;  2K5W A;  4IQZ A;  4DNT B;  2KQ3 A;  2SOB A;  5EBC A;  3VYR A;  5JPM C;  1G6Z A;  3DWQ A;  5EBD A;  2L5T A;  1ILP A;  1U4R A;  1WD1 A;  4RGO S;  3DUZ A;  1WVL A;  2F0L A;  2BDO A;  1L0Y B;  3KUP A;  3MVV A;  4QCL A;  3FRP B;  1WTQ A;  1YNN C;  1ESF A;  2EJG C;  3EFX D;  1QIL A;  4A3D B;  4CJ2 C;  2EYM A;  1TS5 A;  1QG7 A;  4C3J G;  4L8J A;  3RLF A;  1PMR A;  4KY6 A;  1HRJ A;  2ZXO A;  3PV0 A;  1GUW A;  4DAY A;  1K83 B;  1JIC A;  1Y1W B;  2F0S A;  1HTP A;  3J81 E;  1SYD A;  2FJ2 A;  1I3Q B;  2F0U A;  1JWS D;  2R93 B;  4RHS A;  5EKL A;  3RZD B;  1DOL A;  4NKL A;  3TDQ A;  3K0Y A;  1PFB A;  5D14 A;  1U4L A;  1TVX A;  1BBX C;  5KND A;  1KNA A;  5EKK A;  1CI3 M;  5JEA G;  1PRT D;  3TN2 A;  1JWU D;  4HSP A;  5C3X A;  1IKL A;  4R9W A;  4ZUI A;  3PMF A;  1PYW D;  1F9R A;  1PRT C;  1Q1B A;  2A6E D;  1NUC A;  4FXG C;  1DYQ A;  3P1H A;  2AQ1 B;  3HRZ C;  2DN8 A;  4KHV A;  4PNY A;  1V1P B;  4XIG S;  1U9R A;  3BVM A;  4QF4 A;  1SAP A;  5C3E B;  3OMG A;  4R8I A;  3H0G B;  2X69 A;  1V8Q A;  1VDZ A;  4RCO A;  4FP5 D;  2F0I A;  1EIH A;  4XXE A;  3AB9 A;  1F2Z A;  3K5N A;  1AZQ A;  3MEH A;  1XTC D;  1CM9 A;  3NHH A;  4K8J A;  3DM1 A;  3GP7 A;  4IZ8 A;  3TZD A;  2L1B A;  2NWG A;  3NPP A;  1S5C D;  5DEH A;  1B2T A;  5CBE E;  5J1Z A;  1PTO C;  3AU7 A;  1RD9 D;  2EVB A;  1GUT A;  4DFA A;  2EY2 A;  5F2D A;  1RTO A;  1SYE A;  4NP5 A;  3IL8 A;  1K8M A;  3I8Z A;  5KNC A;  2KHS A;  4O1N A;  1Q90 A;  2F0H A;  1HTL D;  3MXP A;  3L7Z C;  4OHJ A;  2CW0 C;  2HUG A;  2EY5 A;  5COR A;  4DN4 M;  1II3 A;  2A6E C;  4DNR B;  1JCK B;  4HMJ A;  1EQV A;  4HAE A;  1Y8N B;  3DEP A;  3TSS A;  1JC7 A;  3OIP A;  2QIL A;  3K58 A;  3G7L A;  2NVQ B;  3TZU A;  2LY7 A;  1LTT D;  1T5E A;  1SJE D;  2FMC A;  4KTA A;  3A7L A;  2EPB A;  1D1K A;  2E76 C;  2JYO A;  4XTC S;  2E2D C;  4KKT A;  2VNU D;  2RDG A;  1JB3 A;  1S4Z A;  3H6M A;  3S14 B;  4LJZ C;  1EYC A;  1WTV A;  4A3B B;  3Q6S A;  1BF4 A;  4E6I A;  4GZY C;  3P20 A;  3NTH A;  2Q8I B;  5JJZ A;  1O7Y A;  1I4H A;  4K8I A;  3SK6 A;  5T1G A;  3VR5 A;  1KAB A;  4IFD H;  4DXG A;  2BA0 A;  4L63 B;  3P75 A;  3MXG A;  1KLG D;  5AFW A;  1PTO B;  1XX8 A;  2WIN B;  4U68 A;  3HOY B;  4UAI A;  3A56 A;  1SDF A;  5ELF A;  4G7O C;  3W3A A;  1A3T A;  3UI2 A;  2EXZ A;  1B1Z A;  2I46 A;  2DY7 A;  1B3A A;  1I4P A;  2VB2 X;  3GV6 A;  5TSS A;  1ENF A;  3I3C A;  3DEO A;  3ZYY X;  3K5M A;  1CQF A;  2KVM A;  4A3K B;  5EPK A;  4UDU C;  4IUT A;  1AP0 A;  2H1E A;  3S2D B;  4RFB A;  3CHB D;  1JOR A;  1STG A;  4NDX A;  5CMD A;  2B2Y A;  4R8N A;  3S1R B;  3A8I E;  1PRT B;  5JEA H;  1SSO A;  4FF1 A;  1LT3 D;  3S15 B;  3Q23 A;  5D3D A;  3HOU B;  4A3M B;  1SNQ A;  5M5W B;  2AWO A;  4A3J B;  2AUJ D;  5DAU A;  3X3M A;  2F0G A;  4NMZ A;  3WOE A;  1DON A;  1HA5 A;  3CKI B;  2HDM A;  5E1F A;  1DCZ A;  3RD4 A;  3OPO A;  5FO8 B;  2PO4 A;  1OXX K;  1BXT A;  1I4R A;  4KD3 A;  5J39 A;  4XQN A;  3VYT A;  2NVY B;  2F0M A;  2RSO A;  4IFD J;  2NN6 G;  1ENA A;  3IAY A;  3NE5 B;  4Q5V A;  2IT1 A;  2N55 A;  1DZ1 A;  2A5H A;  1G29 1;  5EQ0 A;  3SK8 A;  1R9T B;  3HS0 C;  4HN7 A;  1HA6 A;  1A2T A;  2KEE A;  1A2U A;  4RHR A;  2XNA C;  3IFT A;  2IX1 A;  2D2C C;  4LK1 C;  4TKO B;  1STY A;  1CHQ D;  5KNB A;  1F2L A;  5FLX L;  1OXS C;  2QF7 A;  2PCF B;  1D5M C;  1TU2 B;  1PZK D;  4IUR A;  2L9H A;  4EQP A;  1FNU A;  2LFN A;  2O5J C;  1CA5 A;  2O2L D;  1LTR D;  3SK5 A;  1EOT A;  1PZJ D;  3GTP B;  5C0X G;  3TP8 A;  4QUC A;  2NVT B;  5K36 H;  1RF2 D;  1D6E C;  2EE1 A;  5K36 G;  2EJF C;  4ABN A;  2F0Q A;  1JQY D;  1EU4 A;  2F0W A;  3H91 A;  1O7Z A;  1SYG A;  5I6Y A;  3QIA A;  4XQQ A;  4RA8 A;  4KK7 A;  4ZAI A;  3SXH A;  3K57 A;  3PUX A;  3OW7 A;  2LS0 1;  2EYF A;  3NP8 A;  1HFN A;  3ONA B;  3URY A;  3S2H B;  2A6H D;  3T53 B;  2AQ2 B;  3TP7 A;  2WAC A;  5FK9 C;  5J22 A;  1UUP A;  2FMM A;  3V2T A;  1CQV A;  2DNC A;  4B9W A;  1ET9 A;  5C3W A;  3LWU A;  3FVQ A;  5C0X I;  2BOS A;  1X3P A;  3NTI A;  2EYL A;  1IYU A;  2PZW A;  2ZT9 C;  4MN3 A;  3I72 A;  4RH6 A;  2HQE A;  3SEB A;  3PUV A;  3TP6 A;  4OGQ C;  1A3V A;  1UNS A;  5CC4 A;  2LMC B;  4DGZ A;  1F9P A;  3PUY A;  3FMC A;  1QWY A;  1IW7 C;  3MXN A;  2EYO A;  3M7N A;  3EQL C;  1AEX A;  1GUN A;  3A8J E;  2K7V A;  1SNM A;  4IFD G;  2L4N A;  1SYF A;  4PMW A;  3BZD B;  1MSG A;  1WCM B;  1RDP D;  3PIO 3;  1PXU A;  1CFM A;  2AWN A;  2MJ8 A;  1IKM A;  1WTO A;  5FO7 B;  1NR4 A;  2EY1 A;  3DHQ A;  4K2L A;  2EZV A;  2EYJ A;  2M00 A;  4OL7 A;  1LLR D;  5DM6 3;  1YNJ D;  1LTS D;  1QCB D;  1MGS A;  3BYT B;  3IKJ A;  4Z9C B;  5C4Z A;  3FEW X;  1TS3 A;  3J80 L;  2K5D A;  5C0X J;  3WOF A;  1HCZ A;  3M4Y A;  1AW7 A;  1EY9 A;  3U9O A;  3HG9 A;  3BYY B;  5E4X A;  4K14 A;  4G4K A;  2NN6 H;  3KF8 A;  2E2H B;  1DM0 B;  3GTJ B;  3DWA A;  2G9H D;  1STH A;  2WAQ B;  2RBM A;  5T1I A;  4BY7 B;  4ZK9 B;  4CBV A;  5BN5 A;  2ZXP A;  2IX3 A;  1TR5 A;  2L12 A;  1CHP D;  4I7Z C;  5JVG 3;  2JA7 B;  4ZYS A;  5JPN C;  1V1P A;  1QOH A;  3D6W A;  1IL8 A;  2YYZ A;  1W6K A;  3LWE A;  5KGU A;  1Q8I A;  2D9U A;  4DK0 A;  3K5O A;  2K1B A;  3VA7 A;  1A6X A;  1ZYR C;  3A55 A;  4ODG A;  4BBS B;  1EY5 A;  1K8O A;  1C8C A;  1SXT A;  3NQI A;  5CV8 A;  1VF5 C;  1STB A;  5G3L D;  4B08 A;  1EZ8 A;  3BG3 A;  2EDG A;  2OT2 A;  2E2J B;  3BVZ A;  2R7Z B;  1WTW A;  1EYA A;  3SVM A;  3CRL C;  4K2K A;  3VYU A;  2F0O A;  5IOD A;  1G8Z D;  4C2M B;  2IWH A;  1SYC A;  2B2U C;  1EEF D;  4ZRZ A;  5C6A A;  1RTN A;  3C1F A;  3T4A C;  1NSN S;  3HOV B;  4MIU A;  3P7J A;  1W6J A;  2ENB A;  4C3H G;  2RDF A;  3T16 A;  5ELC A;  3OHX C;  3HZX A;  2PYK A;  1FD7 D;  5I9O A;  4FO2 A;  3S16 B;  4G7H C;  2KED A;  3CU7 A;  5IOC A;  2CVR A;  1PDQ A;  1EFI D;  1X32 A;  1EWC A;  2F0T A;  5BN4 A;  4HCE A;  1B4O A;  2J4X A;  2CHB D;  3MHB A;  3I73 A;  1SE3 A;  1MSH A;  4S3S A;  2I07 B;  5C4H A;  3I4N B;  3PUZ A;  3QO2 A;  4LMQ D;  3SHL A;  3DWP A;  5KRU A;  4X3S A;  2IL8 A;  1SBB B;  1I6V C;  1H9R A;  4KJO A;  4RCN A;  3VYS A;  3GTO B;  3GD7 A;  1B9N A;  2NBF A;  2O5I C;  1KAA A;  5C0X H;  2C5C A;  3IFD A;  3LX0 A;  2JE6 I;  3D6C A;  1BR9 A;  4A3E B;  4TRD A;  5CV9 A;  2D62 A;  2BE5 C;  3GQB A;  2A73 B;  1Y8O B;  1SFO B;  1OXU A;  4X3K A;  1KLU D;  4TSS A;  1DJR D;  1ZKO A;  2A68 D;  2J7Z A;  3H94 A;  1LAC A;  3J7Y W;  1LV9 A;  4H7B A;  1WD0 A;  4HCS A;  2G9D A;  4ID6 A;  2JEB I;  1TT2 A;  1ML0 D;  3NTK A;  1S5E D;  2F0E A;  1GXD C;  2N88 A;  1ENC A;  2O4X A;  4FYD A;  3J81 L;  2QKI C;  3D8G A;  3MFY A;  3D4D A;  2A6H C;  2OEO A;  1WTX A;  1NAP A;  2R92 B;  5M3M B;  3HGB A;  2SDF A;  4JBW A;  3OWF A;  3QWN A;  1WTP A;  4RKB A;  3W2D A;  2K5Q A;  3AMU A;  4BY1 B;  2RSN A;  1F2Y A;  1SEB D;  4KKS A;  1E2W A;  3MZ5 A;  1VMC A;  2Q8R E;  2JP1 A;  5JOB A;  2K33 A;  3S17 B;  3Q24 A;  1R4P B;  1EY6 A;  3TP5 A;  4K5V A;  3FKI B;  1I50 B;  2PMZ B;  3EJI A;  5IGD A;  2F0P A;  4N9T A;  5A35 A;  3QB3 A;  1EU3 A;  3GTK B;  1AZP A;  3D3R A;  5K5P A;  1F9Q A;  2QDB A;  5CBA E;  4QIW B;  5DNF A;  1PFN A;  2B2V A;  2EYH A;  1GUG A;  1JOO A;  2B39 A;  1R4Q B;  3MC0 B;  2M9V A;  3NK9 A;  5CR3 A;  1JR0 D;  1SNC A;  2R61 A;  4EQN A;  4WJW A;  2JA6 B;  4F7X A;  4RGM A;  4DU9 A;  2EY6 A;  5HGT A;  3JAM L;  2BDN A;  2A69 C;  5COY A;  1BCP D;  2NTT A;  1BOS A;  3C3L A;  2B63 B;  4BWG B;  1PTO H;  1HXY D;  2EJM A;  4RGT A;  4YIJ A;  2F0K A;  3BDO A;  4I65 A;  1STE A;  1GJX A;  5KEE A;  1I4Q A;  2XRQ D;  1QE6 A;  1A15 A;  2WKC A;  2IW3 A;  1CT1 D;  4J1M A;  4P2C B;  5KIX A;  4CJ1 B;  2MUY A;  5JAV A;  1Q1E A;  3VA5 A;  5EPJ A;  4LAA A;  4OO1 I;  2TMP A;  1HHV A;  5LL6 S;  1H9M A;  1Z47 A;  2K28 A;  2XWJ B;  1KDB A;  2KCC A;  1RJT A;  1PZI D;  2MP1 A;  2CW0 D;  1HQM C;  3M85 A;  1STN A;  2ICI A;  4ZKC B;  3C46 A;  3VR3 A;  1U4P A;  2X6L A;  4F8M A;  4XYQ A;  5EKI A;  3KBX A;  4A3F B;  4V19 0;  1XWE A;  4X3T A;  2JXM B;  5CGK A;  2VXW A;  5CV6 A;  1XYI A;  5D3I B;  3QOL A;  4EQO A;  2J0T D;  3ITP A;  3VR2 A;  4O42 A;  2BA1 A;  5ELB A;  1LT6 D;  2SEB D;  1E2V A;  3BDL A;  1MI2 A;  2MPM A;  4ZUJ A;  5HUR A;  1FNW A;  4F87 A;  1G91 A;  3GO5 A;  2WB1 B;  3OOC A;  4KMU C;  2L11 A;  4FF4 A;  1HFG A;  3K59 A;  3H3V C;  2XIW A;  1RCV D;  2RKS A;  1VMP A;  2K04 A;  2KEC A;  5FO9 B;  4L6T B;  4M8A A;  4FXK C;  1CZW A;  2C9O A;  3MAQ A;  3GV3 A;  5IT9 L;  2DNE A;  3R93 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...