4FP5D

Heat-labile enterotoxin ilt-iibb5 s74a mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
98
structure length
98
Chain Sequence
GASQFFKDNCNRTTASLVEGVELTKYISDINNNTDGMYVVSSTGGVWRISRAKDYPDNVMTAEMRKIAMAAVLAGMRVNMCASPASSPNVIWAIELEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heat-labile enterotoxin IIB, B chain
publication title Structure-activity correlations of variant forms of the B pentamer of Escherichia coli type II heat-labile enterotoxin LT-IIb with Toll-like receptor 2 binding.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
total genus 24
structure length 98
sequence length 98
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2012-06-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.50 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4fp5D00
5G3LD 1QCBD 5G3LF 1QB5D 1TIID 4FNFA 4FP5D 4FO2A
chains in the Genus database with same CATH superfamily
4PMBA 2F0DA 3GTQB 1EIGA 1HR0L 1FVIA 4F7XA 2EYHA 4HSVA 1NSNS 4DK0A 1IL2A 1SXTA 5KNCA 1PH7A 2BA0A 4UDUC 3T1HL 2D62A 4A3JG 3KDFB 4A93G 4ZKBB 1MSGA 1I3QB 1YEZA 1ZKOA 5KEEA 4DUYQ 2KCMA 2A8VA 3BVGA 4EQ5A 1TS3A 2F0TA 1PRTF 2I5MX 4MIUA 3RNUA 1CFMA 4ZUJA 1G6ZA 1QUQA 1AE2A 3EROA 2CWPA 1HZAA 4E6IA 2KBNA 3PGZA 1B4OA 2EJMA 5D65A 1E24A 4HAEA 5IIFA 2DY7A 4QGUA 2B2UA 2MUYA 4JW0A 3M7NA 1STNA 4P71A 1V43A 3G7LA 4QUFA 4OHJA 1FGUA 1KTKA 3D0FA 1SFOB 4TSSA 3GTJH 1W6KA 1S4ZA 2KUMA 4KN4C 2K5HA 2HCCA 3BDOA 3A55A 3MXNB 1A15A 5C44B 2PMZE 5M9OA 3RZOH 4PZ7A 2R92G 5EBCA 2NVXH 3MEHA 2X6LA 3F1ZA 4G7ZC 3M4OH 3I2ZA 4A3BH 1N34L 4B08A 1TU2B 4DV6Q 1XTCD 3PO3G 5FLMG 4MNOA 3GTOB 4LJZC 1M4VA 1SYBA 1BO0A 1MJCA 2WV6D 1S40A 1QE6A 2TMPA 2FXQA 2B2TA 5CV8A 2B2VC 5CC4A 5DNFA 3GTKH 1A2TA 1NR2A 5E7NA 1U4MA 4K5XA 1TWFB 3TP8A 4B3MQ 4NXNQ 3A56A 2KVMA 1DONA 4QMGA 5GADC 2YTYA 2M00A 3H6MA 4MHEA 5J1ZA 1XMQL 3ITPA 1S5CD 2OQKA 4KTAA 4DAVA 4K2LA 3CF5A 3D6CA 1TWCB 2E2HH 2NN6G 1WCMG 4OIJA 3E0EA 4DAYB 1SROA 5JJKA 1I5FA 4FF1A 3OYYA 2A69D 4LFAQ 3U9SA 5JJZA 4A3KG 1JE5A 1NTGA 1SNPA 2OCEA 4KJNA 3TDQA 4XT3B 5FJ8H 4U68A 5BN3A 3S9WA 1ET9A 1TWHB 2KOLA 3G71A 1FGBD 3OMCA 1BQQT 1DOMA 3J80c 1VQ6A 2XN9C 1SSOA 3LGJA 2EZVA 5IP9G 4YCVA 2QA4A 3E3XA 4ZLTF 3MAQA 1PH5A 3CKIB 1E1OA 3BG3A 4F88A 5C44G 1YHBA 1S5BD 4DV0Q 4GNXA 1YI2A 1JWMD 5C4ZA 4JV5L 1TS4A 4BBRH 1MJEA 1SLJA 1RF2D 1B7YB 1PFMA 4A3MB 3H3VI 1L2FA 1UAPA 3J81c 1BCPC 2WB1G 5KRUA 4DUZL 2F0QA 3VR6A 1UNSA 2LSSA 4LF9L 2IHFA 4CJ2C 1IBML 2ZM6L 2BE5C 3GTLB 3X3NA 1Q81C 4R4CA 3CPFA 4WFN3 1ZYRC 3I4LA 4NPSA 4KY7A 5HGTA 2KENA 1CKMA 3AYHB 3F2DA 3DMUA 1PH1A 3I90A 3S2DB 3AFPA 4YY3L 2LXKA 2CKZB 3PIPA 1YJ9A 3QJYA 2O4XA 1SJHD 1SNDA 2PI2E 1O7LA 3FKIB 4KN7C 3AFQA 3PSIA 2QKIC 5G3LD 3PUXA 1ILQA 4X62Q 2EY2A 3UDIA 3S1RH 4A3LG 1KNAA 3P75A 4LK1C 3HEJA 3GD7A 2IX3A 3AU7A 2MPMA 1LM0A 1BR9A 1SMYD 2DNEA 1K0SA 3BYYB 4K2KA 4EX5A 3VDYA 4LMQD 4BXXG 5A2QL 4DV4Q 1FL0A 4ZQ3A 2RSNA 3D4RA 1H9JA 1VF7A 2ES2A 3CCLA 3CU7A 4NKLA 4YHHL 3DWPA 5E4WC 5GROA 2NN6I 4IJHA 4X3UA 4DV5Q 1SE4A 5FO8B 1MI2A 1CKOA 3CQZB 1EQRA 5DLQE 2B2YA 1GO3E 4NW2A 4A3MG 1GHKA 1VQPA 4A3DG 1I94L 1WD0A 1N36L 3U4ZA 3H3VC 3HZXA 1STHA 2JP1A 1UWVA 1GVPA 2KECA 1TS2A 1N33Q 4DPGA 1SYFA 5IYDH 5C0XI 1PTOF 2JJQA 2NZHA 1L1OC 2DJGC 5IGDA 3HG9A 4X66Q 1LLRD 2J4XA 4B3RQ 2WAQB 2E74C 4EVOA 4EQOA 2UUCQ 4KKTA 1MKHA 3M3YH 2NVQB 1H9KA 3FKIG 4RHRA 3TP6A 2ZJPA 3LWEA 1YIJA 2GN5A 4FXKC 2K32A 1NUCA 1XMOL 5K36H 4DR3L 3DUZA 3N6RA 5FLXc 2K5DA 5IGEA 4QY7A 1U4PA 1BBXC 2F0PA 4DV2L 2BOSA 1EWCA 1OXSC 2BA1A 1CSPA 4JI8Q 2IL8A 3K59A 3RMHA 5LMUQ 4DV1L 1RD9D 3KBXA 1O80A 4MN3A 5AJ3L 4IFDI 4JI0L 3AMUA 4CDFC 1FJGL 2EJGC 1PRTB 4BY7H 3HOVB 1JMCA 5CYUA 1M1KC 2I46A 3CCMA 3S16H 3L7ZC 4JI2L 2JA8B 1JQYD 2KEDA 2NTSA 1OXTA 1F2ZA 1J5EL 1UE6A 2JEAI 4BBSH 2XTIA 3QO2A 4IPCA 2A5HA 5E1FA 1B9NA 3HOYH 3FVQA 1XX8A 4K0KL 3VR2A 3HKSA 1TWAB 1YNND 4A3BG 4DNRB 4HR7B 2JA7H 1F9SA 4B9WA 4L5RC 2OF1A 3KBGA 4N9TA 2MHVA 2L0CA 2SOBA 5IGCA 2RHSB 4KD3A 2F0SA 4MTKA 4RH6A 4R8NA 3OHXC 3RLNA 1TY0A 1AN8A 2KHJA 2ZT9C 5CMDA 4FYDA 1DOKA 1AZQA 3OTOL 3CCJA 2WAQG 1RTOA 4L6TB 3RLOA 1B3QA 3SDZA 1PHJA 5JJLA 1X3QA 4LWCA 1I6HB 4ID6A 3S14H 4OEMB 3KLRA 1X54A 2Z6KC 2F0NA 1PXUA 4K5VA 5K5PA 2WP8J 1JJCB 2HHHL 3ERSX 2L12A 2XRSD 1Q46A 3J7ZC 1R9TB 2QEJC 3H3VH 2F0FA 2EXZA 3CCQA 2XGTA 1K83H 3C46A 4C3IH 4ODGA 4J1MA 4AH6A 1WTQA 1CHPD 4DV3Q 4PG3A 2JA6B 5KYIA 4ZAIA 4DXGA 3STBD 2CH4W 4GLXA 4KHPQ 1HH2P 1STBA 2EYFA 3SVMA 4CJ1B 1EQQA 4BY1H 2AWOA 3NENA 1H9SA 2YU9H 1IYVA 3GP7A 4FNFA 4GKKL 1YHQA 1A6XA 2K75A 1JWUD 2EE1A 3H0GH 5GAGC 3EVQA 3QWNA 1XNQQ 1QUQB 2A73B 1BKBA 3VYUA 2N49A 3Q6SA 1XPOA 4BBRG 4JI3L 2VZAA 1GHJA 2ICIA 4KK7A 4JOIA 1AE3A 1KIXA 4U673 1SE2A 1K9MC 2ID0A 4QIWB 5A2QE 1QZGA 4OWTB 5DM73 4FO2A 4JYAQ 4X6AH 2RQXA 1LTAD 2IX0A 4NMZA 1C0AA 1RHPA 1WYDA 1ESFA 3BU2A 4ZRZA 4LF6L 3VYTA 4DUYL 3TSSA 4C3JH 2N3SA 4KY6A 2BCOA 3PO2B 3MXPA 5IGFA 4LF8Q 3S1NB 2VS1A 3M3YB 1FNVA 2R7ZH 5CBEE 1K8OA 3DXJC 1MHWC 5CORA 1HA6A 1L0WA 4DXFA 1ZEQX 2I0QA 3Q0AA 1SNQA 1VMPA 2SNMA 4CDCC 1A2UA 1LACA 1UE1A 3D31A 1PLFA 5M5YH 4C2MH 1EWIA 1I50B 2E8GA 1SE8A 4GLVB 4A3IH 1NJIC 2UU9Q 3L3OC 3W5OA 4TVAB 4JI0Q 1IBKQ 4GOPC 4H13C 3JAMc 4XXEA 4PMCA 1EYGA 2JA6G 1KNEA 1SNMA 3SK5A 4J15A 3SXHA 1PV4A 5ELCA 5F2DA 4FDBA 2R93B 5C0XH 1NY4A 4HTHA 3EIVA 3K80C 1F9RA 4XDXA 4FF2A 3SEBA 3D4DA 4DV6L 4JI6Q 1LT4D 1VQAA 1AP0A 4P75A 2D9UA 2K6AA 4LFBQ 3V96A 4A3FB 2EYMA 1WOCA 1KLUD 4A3CH 3D4WA 2B39A 4X65Q 1IZ6A 1LTGD 2M9VA 5C4XH 2FFKB 3NK9A 5FKAC 4B3ML 4NXNL 1DOLA 4KHZA 4UAIA 2SNSA 1EOVA 1YBYA 2A74C 1PH3A 1PFSA 2RVLA 5IWAQ 5IYDG 4GNXB 2O5IC 3OTOQ 3ZYYX 4IFDH 2NVYB 4AYBB 1JORA 2VQEQ 2EDGA 5CV6A 1RJTA 3K7UC 2F0MA 3EJIA 2A1AA 2LXJA 4JG2A 4P74A 3PO2G 1VQLA 2L9HA 4LFAL 5JEAH 3Q22A 2RKSA 4DGZA 1PTOB 4A3GH 1GKHA 5K36G 4DNTB 1AZPA 1B9MA 1QILA 2LKVA 1A0IA 1PRTD 2WAQE 3AQQA 1YHAA 3KOJA 4YCWA 3CP0A 1S72A 3A0JA 5A35A 5IT9L 3TEHB 3K5MA 1ILPA 2A68D 4GN4B 5M3MH 4DV0L 3A5ZB 2ZXRA 2R93G 1IW7D 1QZHA 2KEEA 1Y1VH 1QNKA 1C48A 5ELNA 1CSQA 1B2TA 1D1KA 1SMXA 1Z7TA 2OTLA 1DZ1A 2N78A 4A75A 1L0XB 1JC7A 5IGGA 2PNRC 4PV1C 5EKIA 1JE4A 2F4VQ 2K52A 5ISRA 2N55A 3HOYG 3CCSA 1FYCA 2Y0SE 3L2PA 3P7JA 5D14A 5M5XH 2B2VA 2JA7G 3H09A 1U4RA 2D5DA 2ZJQA 4LF6Q 1WCMB 1I4PA 4DK1A 5C4JH 4B9XA 3ULLA 3QIAA 4AYBG 4X3SA 3HOZH 1UEAB 1X3FA 3NPPA 3S17H 4A3KB 4ZUIA 4X62L 4XYOA 2E2IH 3GTPH 1W6JA 3KFUA 4RWSC 3ONAB 3A8JE 3J80i 5C3EH 4N8FA 2A68C 2I5HA 4HJAA 3DWQA 5HGQA 1G2SA 5GQOA 4DK3C 3A7AB 2PPBC 5CV5A 1E2VA 1V1PA 3OOCA 4DV4L 1CTMA 1O78A 4IURA 1N32Q 2PW7A 4Z9CB 3DHQA 5JPNC 2K1BA 1Z47A 1WTVA 2B63H 2NZOA 3A8KE 1EYDA 2H5XA 1LT3D 1DGSA 4DV5L 4IO9A 1G6PA 1XYIA 4V0BA 2CW0C 3CAMA 3MEFA 1NE3A 4X64Q 1CHQD 3HOWB 3DM3A 5C4HA 2WB1B 1XNRL 2NVTH 5LMNQ 4CGYB 5I2XA 3F8TA 4DKAC 2G9HD 1RDPD 3RLFA 4A3EB 3I55A 1KQSA 3RN5A 1A3TA 3H0GG 1TWGH 4DA2A 2UUAQ 3NP8A 3OSOA 3S1QH 5FOBB 1N33L 4OO1G 1C4QA 3RZDB 1X6OA 3IL8A 3OW2A 2L1BA 1G51A 1SNCA 3HOUH 3CHBD 1EIHA 1CM9A 2R6GA 4X66L 5KNDA 2OT2A 2V4DA 1F9PA 3TZUA 4XIGS 4LF4Q 4B3RL 1HZ9A 2L5TA 2UUCL 3UDFA 1YJNA 1PH2A 2KCTA 4ME3A 1B44D 2JEBI 1B1ZA 4RAUC 4QIWE 1J6QA 2QCPX 5T1IA 5IYBH 2MQHA 2WFWA 1VQEA 2ICEC 3TBIB 5M3FH 4F8MA 2D0PA 1BUVT 4UP8A 3NWSA 3HKZG 3NE5B 4JI8L 5LMUL 4FF3A 2A6ED 2JA5B 2B2WC 2E2JB 3KLSA 2R61A 2RDFA 2GVAA 5ELDA 1NBWA 1H9RA 3W3AA 1LT5D 2K33A 2IX1A 1QVGA 1EU3A 3G48A 2B3GA 3K5LA 1QWYA 4GN3B 4QQBX 3CMEA 2B29A 2E75C 1SEBD 2PI2A 3GTGH 1PDQA 2VL6A 4RFBA 1SN8A 1EY7A 2LMCB 4CBVA 3TS0A 3LX0A 1A63A 4DR6Q 4DU9A 5L37A 3CMAA 3IKJA 3HOWG 4A3DB 2F3VA 4ZKCB 2K05A 1HNZQ 3T16A 3W1BA 4RMFA 2HIXA 4A3EG 1Z6HA 2JE6I 1PVOA 3EBEA 1CUKA 1EEID 3VA7A 1STGA 1FNWA 3K6OA 3ERQA 1PFBA 1QVCA 4MZ9A 5IT9E 1NAPA 4UPAA 2NB0A 2RSOA 2A69C 4KI0A 2RF4A 1LO5D 3MA2B 1WI5A 4A3CG 4DR1L 3ICEA 1HRJA 3KJOA 1BCPF 5M5WH 4ZYSA 1Q12A 4EQNA 2LS01 2XWBB 1X56A 4QUCA 1A8VA 1LTSD 1L1OA 1QJOA 1H9SB 1KHIA 4R9WA 3T56B 4P73A 4BS9A 2Z4HA 2F0LA 1NCVA 4LUZA 1CQVA 3O13A 4DR4Q 3OW7A 3U9OA 4HMJA 2XSCA 1STYA 4KJOA 1U0LA 4UP9A 1D1IA 3D8GA 4H44C 4IALA 2JA5G 2A6HD 5BR8Q 1OXXK 5LHY1 5JEAG 2Q2UA 4A3GG 4DV3L 1VQDA 2V1CC 3V05A 3GTJB 4EQPA 1IXRA 2X6GA 4KHPL 2F1MA 3J7YW 5C6AA 1PH9A 1SDFA 5EPJA 1IL8A 2Z9HA 4K6DA 2HT1A 2K01A 5D3DA 2UXDQ 2JSOA 1PYWD 3RZOB 2HDMA 1VQJA 1VCIA 1GOZA 1XNQL 4IUTA 1XNRQ 2NVXB 4BA1I 1VMCA 5IODA 3PUYA 2MNAA 3T1YQ 3HP3A 3M4OB 2K4KA 1KDAA 4A3BB 2QDLA 1Q90A 3CRKC 2NVTB 3K57A 1CZWA 1LABA 4JYAL 4IUNA 2PZWA 2A19A 4PZ6A 4EGVA 4K8JA 3H91A 1G291 1D5MC 3NBHA 1ENFA 3QR8A 3GTKB 1E2WA 5IT9c 3IFDA 4RKLA 5IGBA 1PMRA 1SMYC 3TN2A 2Q8TA 4FF4A 3U50C 2OXPA 1V8QA 1EEFD 3S15H 3HS0C 4LF8L 3M4YA 4Y52H 3CD6A 1ZXTA 1IKLA 3A54A 1KL9A 4IUPA 2E2HB 3HFZB 2EOTA 2NWGA 3SR1A 4M1UB 3DEOA 4C3HH 1S5DD 1MGSA 4RA8A 4GKJQ 2E5LQ 4R1JA 2Z6KA 2UU9L 3J7AV 2KJXA 2KHIA 2FMMA 4Y7NH 1K0RA 1IBKL 2BH2A 2QGQA 1BF4A 4ME5A 4LFCQ 5T1GA 2WKDA 4HCEA 1BVSA 4HMIA 1EUJA 1ET6A 4IPGA 3TP5A 5IY0A 4C1NI 1HFGA 3NQTA 1F9QA 4DFAA 2B63G 4JI6L 3GTGB 2NUCA 5CV9A 2H1EA 4BBRB 4DV7Q 1HA5A 4LFBL 1RODA 3VYRA 3L0OA 3LNNA 2VUMH 4FP5D 1ONLA 3TZDA 3KJPA 4X65L 2EVBA 4HIMA 2CVRA 1AEXA 5IOCA 3E0JA 4KLKA 4DR2Q 1WTRA 2O5JC 2LFNA 4R4OA 4QB4A 5C5MA 4G7HC 1CKNA 4YWKA 2WB1E 5GAHC 4DR1Q 2UUBQ 1TQOA 5IWAL 2AQ2B 2ZXOA 5JVG3 2DNCA 2VQEL 2PZUA 3QOLA 1LT6D 3URYA 3G4SA 1DJRD 2K5WA 2E2DC 4JI4Q 1K8AC 4A3JH 4H02A 4A93H 3DLLA 1LTRD 2N88A 1YNXA 1I4QA 1YNJD 3CC4A 3RR5A 1WVLA 3ND8A 4TQUS 3WWVA 4V190 1V1QA 3PIO3 3JAMi 4OGQC 4OXPA 4I7ZC 2Z4IA 3B6YA 4JVZA 3S1RB 1N9WA 1X55A 1WJJA 1XWEA 4CHTB 1SR3A 3HOXH 1V1OA 1HZBA 2D2CC 1H9MA 2L55A 3GTMH 5EKLA 1D8LA 3CRLC 3CXCA 4NXMQ 3GV3A 4N9PA 5FJ8G 5EPLA 1NMGA 1PZID 1GUGA 1O7IA 2MP1A 3S2HH 2F0IA 2O2LD 4O2DA 1YNNC 3RD4A 3RN2A 4GOPA 2NTTA 1EZ8A 1KAWA 2VW9A 4G7OC 3KF8A 4OELB 2ATWA 2R92H 1GUNA 1MD2D 1D7QA 2PZTA 3K7AH 1JWSD 3OPOA 2HQEA 5LMNW 2K14A 3A5UA 2J0TD 2F4VL 1UE7A 3BYTB 3OMGA 1IYUA 3OIQA 1B8AA 2MJ8A 1PH6A 3MXUA 2IT1A 3PO3H 2F0GA 1RTNA 1G8ZD 4KKSA 2MO0A 3FHWA 3JC66 4RG1A 1V1PB 3C1FA 2VNUD 1SYCA 4OX9Q 2G9DA 3EA6A 3KLSX 1U5KA 2R7FA 4P2CB 4DF7A 4IOAA 1WTXA 3G6JB 2Z6BA 3F2UA 4LF5Q 3R93A 4DR5Q 4IJLA 2ASBA 1E7ZA 1EY0A 4RCOA 1JR0D 2ENBA 3GTQH 1F2LA 4YCUA 1VQ7A 3J80L 3VR5A 4CDEC 4OONA 5CBAE 4RHSA 3W2DA 1HQRD 1X3GA 2NN6H 3STBC 2Q8IB 1LYLA 1I3QH 5DM63 2HCIA 3HGBA 3E5SA 1VQ9A 1BCPB 5D3IB 3SE0A 1GUOA 3Q24A 4LF7Q 1Y14B 4TKOB 3A8IE 2UXCQ 2IHEA 4KHVA 3CCVA 2AQ3B 1A62A 1A3VA 1YVCA 3J81L 3ULJA 2I5LX 1K73C 1JJ2A 1N32L 1B50A 4APVA 3NWTA 1O7YA 2VY3A 4IPDA 3I4MH 2IW3A 1Q8KA 1SFOH 4K5WA 4ILWA 1WTWA 5HY6A 4BY7B 2EY1A 4X64L 1W2BA 5IP9H 1KDBA 4CKEA 3S16B 3GDEA 3M9BA 1T9HA 4CDDC 1QB5D 2DUDA 5ELBA 3M85A 5LMNL 5C44H 4BBSB 2Z8LA 3E9IA 3UDXA 1GM5A 1SBBB 4HCSA 4KD4A 2UUAL 3HOYB 1Q1EA 3K0YA 4M8AA 3T13A 2R3ZA 3PUVA 3GTOH 4B3SQ 4R4TA 2JA7B 1KRTA 1X65A 1ASYA 1W3SA 4O0AA 4LF4L 3M7GA 1D6EC 4L5TA 4YWMA 4JI5Q 4O42A 1TWFH 3PF4A 2JQOA 4A76A 3DWAA 1F2MA 1YZ6A 1SYGA 2EIFA 1P8LA 4XYQA 1TWCH 3M4PA 2VQFL 3BZKA 5J3BA 2OQ0A 3MXGA 3S14B 4DR7Q 1VQKA 2WKCA 4IUUA 3RUZA 3R2IA 4A3LH 1EQVA 3TQYA 2L4NA 1O7ZA 4NP5A 4ZK9B 4HIKA 2FJ2A 4NDXA 1KC8C 3HOXB 5ELFA 1K83B 1VQ5A 1EY9A 3GTMB 1TWHH 5JAVA 4C3IB 2M2LA 2JYOA 1ASZA 1L1OB 2DGYA 1LTTD 4BY7G 1FD7D 3NHHA 4DR6L 2WINB 2IPKD 4BY1B 1I6VC 5I4DA 1WD1A 5I9OA 3F2CA 2YU9B 1PA6A 4BBSG 4IUQA 1HNZL 2CHBD 4HJ9A 3H0GB 2PQAA 4JCVE 5I9PA 1LTBD 1PFNA 2L15A 1NR4A 1RL2A 2X69A 5C3XA 2AQ1B 1DD2A 5CV7A 3TMEA 3ZJYC 5FO7B 4JK1C 5CGKA 5FLXL 3AB9A 3GTLH 1D5XC 1KDCA 3CCRA 1K3RA 3BJUA 1DCZA 1DYQA 2PO4A 2C5CA 1I4HA 3P20A 5EAYA 1EY6A 1CA6A 1K28A 2G5DA 1ICFB 1VQNA 1PRTC 1E22A 1SNOA 2ZJRA 1CQFA 1VDZA 2GA4B 3NEMA 4CKBA 1HFNA 5CV4A 5KYLA 3ULPA 4DR4L 4C3JB 2P5ZX 1XPUA 1HUMA 3FKIH 3KF6A 3HKZB 3FRPB 3S1MH 3BZCA 1PH4A 4CKCA 4BWGB 5BR8L 2PW5A 5E3FA 3C3LA 4AQYQ 2CH4A 2R7ZB 1IW7C 4OWXB 5EGTA 3D6WA 1VQGA 1ENCA 4C2MB 2B2WA 5M5YB 4WJ3M 1JOKA 1KD1C 3NXWA 1HPCA 3NBHB 2N8NA 4A3IB 3NTIA 4JI1Q 3HOXG 3J81i 3U58A 3J80E 3K0XA 3PUZA 1VQ8A 4C3IG 2OTJA 1CK1A 1HNXQ 1I4XA 1K3BC 4JBMA 2UXDL 2FHTA 3I4MB 4HJ5A 1EYAA 1VQFA 1XTDA 4JBJA 4BY1G 1HXYD 4HN7A 3T1YL 2AUJD 3CCUA 1EY8A 1N8RC 3FP9A 3LWUA 1C9OA 3CQZH 2XNAC 3FEWX 3BZDB 3J81E 1SAPA 4FXGC 2OWOA 5KIXA 5EJWA 1AW7A 1JJGA 1VS0A 3KUPA 2KQ3A 1ICWA 3MC0B 2Q2HA 1JCKB 2GVBA 4ABNA 4HJ7A 1NNXA 4KY5A 4B3TQ 5C4XB 1JB7A 3ER0A 1QCBD 1DM0B 3WDNA 4JI7Q 5GAEC 1RIPA 5BN4A 4DNIA 1Q7YC 1ML0D 2QILA 3G6EA 3OWEB 2AUKA 4FVMA 4IZ8A 3X3MA 4BA2I 3D3RA 1BCPD 1VQIA 2K04A 1NMFA 1C7YA 4XT1B 4C3JG 2NVQH 2VQFQ 2Q2TA 4GKJL 2E5LL 1XXGA 2BE5D 1X3PA 1D5ZC 4I65A 2CWAA 1EIFA 4FXDA 4ALPA 4XQNA 1IBLQ 4A3GB 3PQIA 2K03A 2R7ZG 4YWLA 1ZYRD 4R4IA 5JPMC 2R7DA 5J39A 2B2UC 4LFCL 1CKNB 4KV6A 3IRBA 4A3IG 3PCOB 2F0WA 1B70B 2AHOB 2EXDA 1J8IA 3T4AC 2VB2X 3HOVH 5M3MB 3CPWA 3I4MG 3GO5A 1SYDA 2WIIB 1OO9B 5HURA 3SK4A 2JA8H 2XVSA 4DV7L 4HIDA 4RGMA 4PQXA 4LUVA 5C0XG 1BOSA 4IPHA 1VQOA 1Y1VB 3VR4A 1GD7A 1KRSA 1RCVD 1PZJD 3TREA 2UXBQ 4DR2L 1OXUA 1SRUA 2BDOA 4MTNA 5TSSA 5IP7H 1HNWQ 4PZ8A 2DN8A 3R3OA 2SDFA 1JT8A 4L63B 1TR5A 1G2TA 2Q8RE 3FPUB 1TWAH 2UUBL 2EY6A 3WOEA 1C8CA 2B2TC 5C4XG 3K8AA 2A6EC 5M5XB 2YTVA 2CCZA 2F0EA 4GOPB 3J7AF 3R8BA 2K5VA 2K50A 1OTCA 4JI4L 3KF8B 1F2YA 1PTOD 4JBWA 1HTPA 1HR0Q 5C4JB 3JAML 4IFDG 3FDTA 5IE8A 4LW1A 2H4OA 3HOZB 1WTOA 2NBFA 1FNUA 1TKWB 5KGUA 3S17B 2F0HA 1JOOA 4POGA 3HRZC 3UE0A 4HJ8A 3BDLA 1I4RA 3T1HQ 3GTPB 2E2IB 1QNUA 1I6HH 1E2ZA 5C3EB 4OO1I 5FLXE 3IFTA 3S1MB 2QF7A 4AYBE 4NXML 5JJIA 1EQTA 5FK9C 1B53A 2MFIA 1EYCA 1EFID 3MWYW 1R9TH 3SGIA 3J81j 4POFA 2CQAA 1AFPA 3CC7A 3EN2A 3I7FA 2IY5B 3PMFA 2EJFC 2IWHA 1MIUA 3MFYA 2PQEA 2B63B 1LV9A 2F0UA 2JA6H 5LL6S 2F4IA 2WACA 3K58A 5M3MG 1T5XD 1K8GA 3OWFA 2RDHA 3ND9A 4GNXC 4AIMA 2RBMA 4HEDA 5NUCA 4WJ4A 2HIVA 4OL7A 3T53B 1Y1VG 1QG7A 4ZCKA 3K5NA 1TS5A 1KXLA 3KDFA 3FMCA 3IAYA 1WFQA 1GUWA 1B3AA 4OX9L 5AFWA 1TWGB 2EPBA 1PTOC 4RGOS 3S1QB 3H15A 2SEBD 1BBUA 3NUCA 4WJWA 1N34Q 1Q8IA 4LF5L 3TRZA 4DR5L 1DXMA 2XIWA 4I7AA 4S3SA 3HOUB 5KNBA 4WRDA 1HTLD 1K8MA 2A6HC 3NTKA 1BXTA 3Q8DA 3EFXD 1EZ6A 3OIPA 5EPKA 2AWNA 5J22A 2BDNA 3PIOA 3A74A 5G3LF 3MXNA 1Y8PB 3I72A 2CQOA 1Y1WH 1QVFA 2K5NA 3HOZG 2HUGA 1XMQQ 3PO2H 1BBWA 5M3FB 3S1NH 4LF7L 1TXYA 2K7VA 2C9OA 3PIP3 3I4NH 5C3EG 2EY5A 2UXCL 1HZCA 3K81C 4PMWA 1Q3LA 2DJFC 4OIKA 5EKKA 1LUZA 4N8X1 1I50H 2LY7A 1D2BA 3T51B 3W1GA 3HKZE 3E6ZX 4KMUC 4UP7A 3CCEA 4L8JA 5BN5A 1E0BA 2HQLA 4Q5VA 4G57A 1P16A 1UEBA 2NYZD 2PCFB 2Q2IA 3BVMA 2R93H 1X9NA 2I07B 1II3A 1X32A 3TP7A 2B2YC 2KCNA 4R4QA 3UE1A 2F52A 4C1NK 1JICA 4X3TA 2FMCA 1E1TA 1TT2A 4JV5Q 2Y0SB 4DAYA 4B3SL 5IYCH 3NQIA 1PH8A 4A3FH 3L9AX 4GZYC 1HHVA 5DEHA 3SK8A 1EY5A 4Q0FA 1PYBA 4JC0A 4DUZQ 3J7A5 4LF9Q 1IBMQ 1S5FD 2ZTEA 2NZ1D 4IUVA 5LL6X 2YV5A 2ZM6Q 4JI5L 1TVXA 4XQJA 3HOUG 1EU4A 3QG1A 2EYJA 3DEPA 2JXMB 5FO9B 5M5WB 3UDGA 4NB3A 3Q23A 3VR3A 3C2PA 1TIID 1VQ4A 1Q82C 2VXWA 1GUSA 1GXDC 2NVYH 3BS1A 2PQAB 4DR7L 4YY3Q 1UUPA 5I6YA 2C35B 5EQ0A 5IYBG 4UY8C 2F03A 1T5EA 3GV6A 5M3FG 3EQLC 1SE3A 3GQBA 5ELEA 1AH9A 1HUNA 5DAUA 1PTOH 2ZTDA 4IQZA 1HCZA 5EBDA 1IHZA 3M4QA 3NELA 2PMZB 4IN3A 4DN4M 3CW2C 4GLAC 1M8AA 2CFMA 2HD3A 1PYSB 3K5OA 3KYHC 1S5ED 4DAPA 3FPPA 1M90C 3MVVA 1X3EA 3NSWA 4LAAA 3JAME 4WORA 1FR3A 4X3KA 4K14A 1F77A 2ALYB 1IKMA 4PNYA 3PV0A 2RCFA 4UHVA 3VA5A 4C56C 3I4OA 1ENAA 3KF6B 3NTHA 3HOVG 4GN5A 5ELOA 4YHHQ 2JA8G 5FLMH 2IJ0A 1G91A 4GS3A 2D0OA 2Y0SG 2F0VA 1HQMC 1Q86C 2JA9A 2FINB 1YNJC 3MHBA 5IP7G 4OO1H 2EQSA 2EYLA 3QOJA 2QW7A 1I94Q 1LTID 2XWJB 3I3CA 1N36Q 1QOHA 3S24A 3I8ZA 4RGNA 4JBKA 5COYA 2YTXA 2B8GA 4QCLA 1A3UA 2K28A 1CI3M 2HDLA 1WCMH 2RA4A 3MFGA 3S15B 2F0KA 3AEVA 1IYJB 1U4LA 2KCCA 3BDCA 2Z0SA 4XQQA 5C0XJ 4AQYL 1WTHA 4A3KH 1VQHA 2BH8A 1EIYB 1Y8OB 4C3HB 1R4QB 3PF5A 1Y1WB 4QF4A 5C3WA 3R2TA 1MBYA 5E4XA 1KLGD 2F0OA 1XMOQ 4DR3Q 1V9PA 3I4NB 4JI1L 4Y7NB 1EFWA 4DV2Q 2QEXA 1Z9FA 3VYSA 1HNXL 2YYZA 1VF5C 1XJVA 2B8FA 1CA5A 4DV1Q 1GJXA 2KA7A 3E9HA 4CJ0B 3KK7A 2EYPA 3C1EA 5AJ3Q 1EL0A 4IOCA 4LNQA 4R8IA 1CT1D 4G4KA 1FJGQ 1E3PA 3I91A 4RGTA 4RKBA 3UI2A 1Y8NB 3CC2A 3H94A 1CZGA 4IFDJ 2PNHA 4JI2Q 3HOWH 4KKUA 3I70A 3MZ5A 2EYOA 4K8IA 1OXVA 1J5EQ 2VUMB 1JB3A 1STAA 2RHQB 1GUTA 4F87A 2F0JA 2KHSA 4A3EH 4H0LC 1EY4A 5JEAJ 3P1HA 4B3TL 3TS2A 1UE5A 4JOIC 3V2TA 1YITA 1RKNA 3PUWA 4JI7L 4K0KQ 3RZDH 3A7LA 2L11A 2OEOA 1MSHA 4RCNA 2AKWB 1Q1BA 2F3WA 4OWWB 1EWHA 4HSPA 2PYKA 5C5LA 1BNZA 4P72A 3SK6A 3N52A 4J6HA 1YJWA 1HR0W 4L5SA 1STEA 2AMCB 4A4IA 2J7ZA 1EOTA 2RCNA 1VQMA 4A3JB 4A93B 1U9RA 4QJFA 2Z1CA 1IBLL 1PZKD 4DK6C 2K5QA 1TY2A 1R4PB 4C3HG 1Y1WG 2ZTCA 3I73A 5I2YA 2JA5H 2VB3X 4HIOA 1WTPA 2E2JH 3I4NG 4BXXH 3SHLA 1JOQA 1Y69U 2QDBA 1VQCA 3WOFA 2HHHQ 3S2HB 4ULLA 4JPBW 5CR3A 4YIJA 5JOBA 5JVH3 2XRQD 4TRDA 2R92B 1ESRA 1I4GA 2MO1A 2RDGA 5I6WA 4A3MH 1H95A 3K7AB 2UXBL 4A3DH 3QB3A 4QL5A 2JN4A 1HNWL 2F3IA 2JK8A 3U4VA 1XPRA 1VQBA 4GKKQ 3MTSA 2VUMG 3NBIA 3F2BA 1SYEA 1HJPA 1SJED 3PO3B 4H7BA 5H1SE 1J9OA 1KABA 4DAMA 1BDOA 3BVZA 4JI3Q 4LUOA 1LTLA 4O1NA 3DM1A 3KLWA 5IYCG 2MGSA 4A3FG 1L0YB 1KAAA 2CW0D 4J8QA 4K6LA 2E76C 3S2DH 2TSSA 4L5QA 1S3OA 2DY8A 4XTCS 3I56A 2ZXPA
chains in the Genus database with same CATH topology
4PMBA 2F0DA 3GTQB 1EIGA 4F7XA 2EYHA 4HSVA 1NSNS 4DK0A 1SXTA 5KNCA 2BA0A 4UDUC 2D62A 4ZKBB 1MSGA 1I3QB 1ZKOA 5KEEA 3BVGA 1TS3A 2F0TA 1PRTF 4MIUA 1CFMA 4ZUJA 1G6ZA 3EROA 4E6IA 1B4OA 2EJMA 5D65A 4HAEA 5IIFA 2DY7A 2B2UA 2MUYA 3M7NA 1STNA 1V43A 3G7LA 4QUFA 4OHJA 1KTKA 1SFOB 4TSSA 1W6KA 1S4ZA 2KUMA 4KN4C 2HCCA 3BDOA 3A55A 1A15A 5C44B 5M9OA 5EBCA 3MEHA 2X6LA 4G7ZC 4B08A 1TU2B 1XTCD 3GTOB 4LJZC 1M4VA 1SYBA 1BO0A 2WV6D 1QE6A 2TMPA 2B2TA 5CV8A 2B2VC 5CC4A 5DNFA 1A2TA 1NR2A 1U4MA 4K5XA 1TWFB 3TP8A 3A56A 2KVMA 1DONA 4QMGA 2M00A 3H6MA 4MHEA 5J1ZA 3ITPA 1S5CD 4KTAA 4DAVA 4K2LA 3D6CA 1TWCB 2NN6G 4OIJA 4FF1A 2A69D 3U9SA 5JJZA 1SNPA 4KJNA 3TDQA 4XT3B 4U68A 5BN3A 3S9WA 1ET9A 1TWHB 2KOLA 1FGBD 3OMCA 1BQQT 1DOMA 2XN9C 1SSOA 2EZVA 4ZLTF 3MAQA 3CKIB 3BG3A 4F88A 1S5BD 1JWMD 5C4ZA 1TS4A 1RF2D 1PFMA 4A3MB 1UAPA 1BCPC 5KRUA 2F0QA 3VR6A 1UNSA 4CJ2C 2BE5C 3GTLB 3X3NA 4WFN3 1ZYRC 3I4LA 4KY7A 5HGTA 3DMUA 3I90A 3S2DB 3QJYA 2O4XA 1SJHD 1SNDA 1O7LA 3FKIB 4KN7C 2QKIC 5G3LD 3PUXA 1ILQA 2EY2A 1KNAA 3P75A 4LK1C 3HEJA 3GD7A 2IX3A 3AU7A 2MPMA 1BR9A 1SMYD 2DNEA 3BYYB 4K2KA 4LMQD 5A2QL 4ZQ3A 2RSNA 3D4RA 1H9JA 1VF7A 3CU7A 4NKLA 3DWPA 5E4WC 2NN6I 4X3UA 1SE4A 5FO8B 1MI2A 3CQZB 2B2YA 4NW2A 1GHKA 1WD0A 3H3VC 3HZXA 1STHA 2JP1A 2KECA 1TS2A 1SYFA 5C0XI 1PTOF 5IGDA 3HG9A 1LLRD 2J4XA 2WAQB 2E74C 4EVOA 4EQOA 4KKTA 2NVQB 1H9KA 4RHRA 3TP6A 3LWEA 4FXKC 2K32A 1NUCA 5K36H 3DUZA 3N6RA 2K5DA 5IGEA 1U4PA 1BBXC 2F0PA 2BOSA 1EWCA 1OXSC 2BA1A 2IL8A 3K59A 3RMHA 1RD9D 3KBXA 1O80A 4MN3A 4IFDI 3AMUA 2EJGC 1PRTB 3HOVB 5CYUA 2I46A 3L7ZC 2JA8B 1JQYD 2KEDA 2NTSA 1OXTA 1F2ZA 2JEAI 3QO2A 2A5HA 5E1FA 1B9NA 3FVQA 1XX8A 3VR2A 1TWAB 1YNND 4DNRB 4HR7B 1F9SA 4B9WA 2OF1A 3KBGA 4N9TA 2MHVA 2L0CA 2SOBA 5IGCA 4KD3A 2F0SA 4RH6A 4R8NA 3OHXC 1TY0A 1AN8A 2ZT9C 4FYDA 5CMDA 1DOKA 1AZQA 1RTOA 4L6TB 3SDZA 1X3QA 1I6HB 4ID6A 3KLRA 2F0NA 1PXUA 4K5VA 5K5PA 2WP8J 2L12A 2XRSD 1R9TB 2QEJC 2F0FA 2EXZA 3C46A 4ODGA 4J1MA 1WTQA 1CHPD 2JA6B 5KYIA 4ZAIA 4DXGA 1STBA 2EYFA 3SVMA 4CJ1B 2AWOA 1H9SA 1IYVA 3GP7A 4FNFA 1A6XA 1JWUD 2EE1A 3EVQA 3QWNA 2A73B 3VYUA 3Q6SA 1GHJA 2ICIA 4KK7A 4U673 1SE2A 2ID0A 4QIWB 5A2QE 5DM73 4FO2A 2RQXA 1LTAD 2IX0A 4NMZA 1RHPA 1ESFA 4ZRZA 3VYTA 3TSSA 4KY6A 2BCOA 3PO2B 3MXPA 5IGFA 3S1NB 3M3YB 1FNVA 5CBEE 1K8OA 3DXJC 5CORA 1HA6A 4DXFA 1ZEQX 3Q0AA 1SNQA 1VMPA 2SNMA 1A2UA 1LACA 3D31A 1PLFA 1I50B 3L3OC 4H13C 4XXEA 4PMCA 1KNEA 1SNMA 3SK5A 3SXHA 5ELCA 5F2DA 2R93B 5C0XH 4HTHA 1F9RA 4XDXA 4FF2A 3SEBA 3D4DA 1LT4D 1AP0A 2D9UA 2K6AA 3V96A 4A3FB 2EYMA 1KLUD 3D4WA 2B39A 1LTGD 2M9VA 2FFKB 3NK9A 5FKAC 1DOLA 4KHZA 4UAIA 2SNSA 2A74C 2RVLA 2O5IC 4IFDH 3ZYYX 2NVYB 4AYBB 1JORA 2EDGA 5CV6A 1RJTA 2F0MA 3EJIA 2L9HA 5JEAH 3Q22A 2RKSA 4DGZA 1PTOB 5K36G 4DNTB 1AZPA 1B9MA 1QILA 2LKVA 1PRTD 5A35A 5IT9L 3K5MA 1ILPA 2A68D 2ZXRA 1IW7D 2KEEA 1QNKA 1C48A 1B2TA 1D1KA 1Z7TA 1DZ1A 1L0XB 1JC7A 5IGGA 2PNRC 4PV1C 5EKIA 1JE4A 5ISRA 2N55A 1FYCA 3P7JA 5D14A 2B2VA 3H09A 1U4RA 2D5DA 1WCMB 1I4PA 4DK1A 4B9XA 3QIAA 4X3SA 1UEAB 3NPPA 4A3KB 4ZUIA 4XYOA 1W6JA 4RWSC 3ONAB 3A8JE 2A68C 3DWQA 1G2SA 3A7AB 2PPBC 5CV5A 1E2VA 1V1PA 3OOCA 1CTMA 1O78A 4IURA 2PW7A 4Z9CB 3DHQA 5JPNC 2K1BA 1Z47A 1WTVA 3A8KE 1EYDA 1LT3D 1XYIA 4V0BA 2CW0C 1CHQD 3HOWB 5C4HA 2WB1B 4CGYB 5I2XA 2G9HD 1RDPD 3RLFA 4A3EB 1A3TA 4DA2A 3NP8A 3OSOA 5FOBB 4OO1G 1C4QA 3RZDB 3IL8A 2L1BA 1SNCA 3CHBD 1EIHA 1CM9A 2R6GA 5KNDA 2OT2A 2V4DA 1F9PA 3TZUA 4XIGS 2L5TA 1B44D 2JEBI 1B1ZA 4RAUC 2QCPX 5T1IA 2ICEC 3TBIB 4F8MA 1BUVT 3NWSA 3NE5B 4FF3A 2JA5B 2A6ED 2B2WC 2E2JB 3KLSA 2R61A 2RDFA 5ELDA 1H9RA 3W3AA 1LT5D 2K33A 2IX1A 1EU3A 3K5LA 1QWYA 2E75C 1SEBD 1PDQA 4RFBA 4CBVA 1EY7A 2LMCB 3LX0A 4DU9A 3IKJA 4A3DB 2F3VA 4ZKCB 2K05A 3T16A 1Z6HA 2JE6I 1EEID 3VA7A 1STGA 1FNWA 3K6OA 3ERQA 1PFBA 5IT9E 1NAPA 2NB0A 2RSOA 2A69C 4KI0A 1LO5D 3MA2B 1HRJA 1BCPF 4ZYSA 1Q12A 4EQNA 2LS01 2XWBB 4QUCA 1LTSD 1QJOA 1H9SB 4R9WA 3T56B 4BS9A 2Z4HA 2F0LA 1NCVA 1CQVA 3O13A 3OW7A 3U9OA 4HMJA 2XSCA 1STYA 4KJOA 1D1IA 3D8GA 4H44C 4IALA 2A6HD 1OXXK 5LHY1 5JEAG 3V05A 3GTJB 4EQPA 2X6GA 2F1MA 3J7YW 5C6AA 1SDFA 5EPJA 1IL8A 4K6DA 2K01A 5D3DA 2JSOA 1PYWD 3RZOB 2HDMA 1VCIA 1GOZA 4IUTA 2NVXB 4BA1I 1VMCA 5IODA 3PUYA 3HP3A 3M4OB 1KDAA 4A3BB 1Q90A 3CRKC 2NVTB 3K57A 1CZWA 1LABA 4IUNA 2PZWA 4EGVA 4K8JA 3H91A 1G291 1D5MC 3NBHA 1ENFA 3GTKB 1E2WA 3IFDA 4RKLA 5IGBA 1PMRA 1SMYC 3TN2A 2Q8TA 4FF4A 2OXPA 1V8QA 1EEFD 3HS0C 3M4YA 1ZXTA 1IKLA 3A54A 4IUPA 2E2HB 2EOTA 2NWGA 3SR1A 4M1UB 3DEOA 1S5DD 1MGSA 4RA8A 3J7AV 2KJXA 2FMMA 1BF4A 4ME5A 5T1GA 2WKDA 4HCEA 4HMIA 1ET6A 3TP5A 4C1NI 1HFGA 3NQTA 1F9QA 4DFAA 3GTGB 2NUCA 5CV9A 2H1EA 4BBRB 1HA5A 1RODA 3VYRA 3LNNA 4FP5D 1ONLA 3TZDA 2EVBA 2CVRA 1AEXA 5IOCA 3E0JA 1WTRA 2O5JC 2LFNA 4QB4A 5C5MA 4G7HC 1TQOA 2AQ2B 2ZXOA 5JVG3 2DNCA 2PZUA 3QOLA 1LT6D 3URYA 1DJRD 2K5WA 2E2DC 1LTRD 2N88A 1I4QA 1YNJD 1WVLA 3ND8A 4TQUS 4V190 3PIO3 4OGQC 4I7ZC 2Z4IA 3S1RB 4CHTB 1XWEA 1V1OA 2D2CC 1H9MA 2L55A 5EKLA 3CRLC 3GV3A 4N9PA 5EPLA 1PZID 1GUGA 2MP1A 2F0IA 2O2LD 1YNNC 3RD4A 2NTTA 1EZ8A 4G7OC 3KF8A 1GUNA 1MD2D 2PZTA 1JWSD 3OPOA 2HQEA 2J0TD 3BYTB 3OMGA 1IYUA 3OIQA 2MJ8A 3MXUA 2IT1A 2F0GA 1RTNA 1G8ZD 4KKSA 1V1PB 3C1FA 2VNUD 1SYCA 2G9DA 3EA6A 3KLSX 4P2CB 4DF7A 1WTXA 3G6JB 3F2UA 3R93A 1EY0A 4RCOA 1JR0D 2ENBA 1F2LA 3J80L 3VR5A 5CBAE 4RHSA 3W2DA 1HQRD 2NN6H 2Q8IB 5DM63 2HCIA 3HGBA 3E5SA 1BCPB 5D3IB 3SE0A 1GUOA 3Q24A 4TKOB 3A8IE 4KHVA 2AQ3B 1A3VA 3J81L 1B50A 3NWTA 1O7YA 2IW3A 4K5WA 4ILWA 1WTWA 4BY7B 2EY1A 1KDBA 4CKEA 3S16B 1QB5D 5ELBA 3M85A 4BBSB 2Z8LA 1SBBB 4HCSA 4KD4A 3HOYB 1Q1EA 3K0YA 4M8AA 3T13A 2R3ZA 3PUVA 2JA7B 3M7GA 1D6EC 4O42A 3DWAA 1F2MA 1SYGA 4XYQA 3MXGA 3S14B 2WKCA 4IUUA 3RUZA 3R2IA 1EQVA 2L4NA 1O7ZA 4NP5A 4ZK9B 2FJ2A 4NDXA 3HOXB 5ELFA 1K83B 3GTMB 1EY9A 5JAVA 4C3IB 2M2LA 2JYOA 1LTTD 1FD7D 3NHHA 2WINB 2IPKD 4BY1B 1I6VC 5I4DA 1WD1A 5I9OA 2YU9B 4IUQA 2CHBD 3H0GB 5I9PA 1LTBD 1PFNA 1NR4A 2X69A 5C3XA 2AQ1B 1DD2A 5CV7A 3TMEA 5FO7B 4JK1C 5CGKA 5FLXL 3AB9A 1D5XC 1KDCA 1DCZA 1DYQA 2PO4A 2C5CA 1I4HA 3P20A 1EY6A 1CA6A 1PRTC 1SNOA 1CQFA 1VDZA 2GA4B 4CKBA 1HFNA 5CV4A 5KYLA 4C3JB 1HUMA 3HKZB 3FRPB 4CKCA 4BWGB 2PW5A 5E3FA 3C3LA 2R7ZB 1IW7C 5EGTA 3D6WA 5M5YB 4C2MB 1ENCA 2B2WA 1JOKA 3NXWA 1HPCA 4A3IB 3NTIA 3J80E 3PUZA 4C3IG 1CK1A 1I4XA 2FHTA 3I4MB 1EYAA 1HXYD 4HN7A 2AUJD 1EY8A 3LWUA 2XNAC 3FEWX 3BZDB 3J81E 1SAPA 4FXGC 5KIXA 5EJWA 1AW7A 3KUPA 2KQ3A 1ICWA 3MC0B 1JCKB 4ABNA 4KY5A 5C4XB 1QCBD 1DM0B 3WDNA 5BN4A 1ML0D 2QILA 3OWEB 2AUKA 4FVMA 4IZ8A 3X3MA 4BA2I 3D3RA 1BCPD 2K04A 4XT1B 4C3JG 1XXGA 2BE5D 1X3PA 1D5ZC 4I65A 4FXDA 4XQNA 4A3GB 2K03A 1ZYRD 5JPMC 5J39A 2B2UC 4KV6A 2F0WA 1J8IA 3T4AC 2VB2X 5M3MB 3GO5A 1SYDA 2WIIB 1OO9B 5HURA 3SK4A 2XVSA 4RGMA 4PQXA 5C0XG 1BOSA 1Y1VB 3VR4A 1RCVD 1PZJD 1OXUA 2BDOA 5TSSA 2DN8A 3R3OA 2SDFA 4L63B 1TR5A 1G2TA 2Q8RE 3FPUB 2EY6A 3WOEA 1C8CA 2B2TC 2A6EC 5M5XB 2F0EA 3J7AF 3R8BA 1F2YA 1PTOD 4JBWA 1HTPA 5C4JB 3JAML 4IFDG 3FDTA 2H4OA 3HOZB 1WTOA 2NBFA 1FNUA 1TKWB 5KGUA 3S17B 2F0HA 1JOOA 3HRZC 3BDLA 1I4RA 3GTPB 2E2IB 1QNUA 1E2ZA 5C3EB 4OO1I 5FLXE 3IFTA 3S1MB 2QF7A 1EQTA 5FK9C 1B53A 1EYCA 1EFID 3MWYW 2CQAA 1AFPA 3PMFA 2EJFC 2IWHA 3MFYA 2PQEA 2B63B 1LV9A 2F0UA 5LL6S 2F4IA 2WACA 3K58A 1T5XD 3OWFA 2RDHA 3ND9A 2RBMA 4HEDA 5NUCA 4OL7A 3T53B 1QG7A 3K5NA 1TS5A 3FMCA 3IAYA 1GUWA 1B3AA 5AFWA 1TWGB 2EPBA 1PTOC 4RGOS 3S1QB 2SEBD 3NUCA 4WJWA 1Q8IA 1DXMA 2XIWA 4S3SA 3HOUB 5KNBA 4WRDA 1HTLD 1K8MA 2A6HC 3NTKA 1BXTA 3EFXD 1EZ6A 3OIPA 5EPKA 2AWNA 5J22A 2BDNA 5G3LF 3MXNA 1Y8PB 3I72A 2HUGA 5M3FB 2K7VA 2C9OA 3PIP3 2EY5A 4PMWA 1Q3LA 4OIKA 5EKKA 2LY7A 1D2BA 3T51B 3E6ZX 4KMUC 4L8JA 5BN5A 1E0BA 4Q5VA 4G57A 2NYZD 2PCFB 3BVMA 2I07B 1II3A 1X32A 3TP7A 2B2YC 2KCNA 4C1NK 1JICA 4X3TA 2FMCA 1TT2A 2Y0SB 4DAYA 3NQIA 3L9AX 4GZYC 1HHVA 5DEHA 3SK8A 1EY5A 4Q0FA 1S5FD 4IUVA 2NZ1D 5LL6X 1TVXA 4XQJA 1EU4A 3QG1A 2EYJA 5FO9B 2JXMB 3DEPA 5M5WB 3Q23A 3VR3A 3C2PA 1TIID 2VXWA 1GUSA 1GXDC 3BS1A 1UUPA 5I6YA 5EQ0A 2F03A 1T5EA 3GV6A 3EQLC 1SE3A 3GQBA 5ELEA 1HUNA 5DAUA 1PTOH 4IQZA 1HCZA 5EBDA 1IHZA 2PMZB 4IN3A 4DN4M 1M8AA 3K5OA 1S5ED 4DAPA 3FPPA 3MVVA 3NSWA 4LAAA 3JAME 4WORA 1FR3A 4X3KA 4K14A 1F77A 1IKMA 4PNYA 3PV0A 3VA5A 4C56C 1ENAA 3NTHA 2IJ0A 1G91A 2F0VA 1HQMC 2FINB 1YNJC 3MHBA 4OO1H 2EYLA 3QOJA 1LTID 2XWJB 3I3CA 1QOHA 3I8ZA 4RGNA 5COYA 2B8GA 4QCLA 1A3UA 2K28A 1CI3M 2HDLA 2RA4A 3MFGA 3S15B 2F0KA 1U4LA 2KCCA 3BDCA 4XQQA 5C0XJ 1Y8OB 4C3HB 1R4QB 1Y1WB 4QF4A 5C3WA 3R2TA 1MBYA 5E4XA 1KLGD 2F0OA 3I4NB 4Y7NB 3VYSA 2YYZA 1VF5C 2B8FA 1CA5A 1GJXA 2KA7A 4CJ0B 3KK7A 2EYPA 3C1EA 1EL0A 4R8IA 1CT1D 4G4KA 3I91A 4RGTA 4RKBA 3UI2A 1Y8NB 3H94A 1CZGA 4IFDJ 4KKUA 3I70A 3MZ5A 2EYOA 4K8IA 1OXVA 2VUMB 1JB3A 1STAA 1GUTA 4F87A 2F0JA 2KHSA 4H0LC 1EY4A 5JEAJ 3P1HA 3V2TA 1RKNA 3PUWA 3A7LA 2L11A 2OEOA 1MSHA 4RCNA 1Q1BA 2F3WA 1EWHA 4HSPA 2PYKA 5C5LA 1BNZA 3SK6A 3N52A 4J6HA 1STEA 2J7ZA 1EOTA 4A3JB 4A93B 1U9RA 2Z1CA 1PZKD 2K5QA 1TY2A 1R4PB 4C3HG 3I73A 5I2YA 2VB3X 1WTPA 3SHLA 1JOQA 1Y69U 2QDBA 3WOFA 3S2HB 4ULLA 5CR3A 4YIJA 5JOBA 5JVH3 2XRQD 4TRDA 2R92B 1ESRA 1I4GA 2RDGA 5I6WA 3K7AB 3QB3A 3MTSA 3NBIA 1SYEA 1SJED 3PO3B 4H7BA 1J9OA 1KABA 1BDOA 3BVZA 4O1NA 3DM1A 2MGSA 1L0YB 1KAAA 2CW0D 4J8QA 4K6LA 2E76C 2TSSA 2DY8A 4XTCS 2ZXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G3L D;  1QCB D;  5G3L F;  1QB5 D;  1TII D;  4FNF A;  4FP5 D;  4FO2 A; 
#chains in the Genus database with same CATH topology
 4PMB A;  2F0D A;  3GTQ B;  1EIG A;  1HR0 L;  1FVI A;  4F7X A;  2EYH A;  4HSV A;  1NSN S;  4DK0 A;  1IL2 A;  1SXT A;  5KNC A;  1PH7 A;  2BA0 A;  4UDU C;  3T1H L;  2D62 A;  4A3J G;  3KDF B;  4A93 G;  4ZKB B;  1MSG A;  1I3Q B;  1YEZ A;  1ZKO A;  5KEE A;  4DUY Q;  2KCM A;  2A8V A;  3BVG A;  4EQ5 A;  1TS3 A;  2F0T A;  1PRT F;  2I5M X;  4MIU A;  3RNU A;  1CFM A;  4ZUJ A;  1G6Z A;  1QUQ A;  1AE2 A;  3ERO A;  2CWP A;  1HZA A;  4E6I A;  2KBN A;  3PGZ A;  1B4O A;  2EJM A;  5D65 A;  1E24 A;  4HAE A;  5IIF A;  2DY7 A;  4QGU A;  2B2U A;  2MUY A;  4JW0 A;  3M7N A;  1STN A;  4P71 A;  1V43 A;  3G7L A;  4QUF A;  4OHJ A;  1FGU A;  1KTK A;  3D0F A;  1SFO B;  4TSS A;  3GTJ H;  1W6K A;  1S4Z A;  2KUM A;  4KN4 C;  2K5H A;  2HCC A;  3BDO A;  3A55 A;  3MXN B;  1A15 A;  5C44 B;  2PMZ E;  5M9O A;  3RZO H;  4PZ7 A;  2R92 G;  5EBC A;  2NVX H;  3MEH A;  2X6L A;  3F1Z A;  4G7Z C;  3M4O H;  3I2Z A;  4A3B H;  1N34 L;  4B08 A;  1TU2 B;  4DV6 Q;  1XTC D;  3PO3 G;  5FLM G;  4MNO A;  3GTO B;  4LJZ C;  1M4V A;  1SYB A;  1BO0 A;  1MJC A;  2WV6 D;  1S40 A;  1QE6 A;  2TMP A;  2FXQ A;  2B2T A;  5CV8 A;  2B2V C;  5CC4 A;  5DNF A;  3GTK H;  1A2T A;  1NR2 A;  5E7N A;  1U4M A;  4K5X A;  1TWF B;  3TP8 A;  4B3M Q;  4NXN Q;  3A56 A;  2KVM A;  1DON A;  4QMG A;  5GAD C;  2YTY A;  2M00 A;  3H6M A;  4MHE A;  5J1Z A;  1XMQ L;  3ITP A;  1S5C D;  2OQK A;  4KTA A;  4DAV A;  4K2L A;  3CF5 A;  3D6C A;  1TWC B;  2E2H H;  2NN6 G;  1WCM G;  4OIJ A;  3E0E A;  4DAY B;  1SRO A;  5JJK A;  1I5F A;  4FF1 A;  3OYY A;  2A69 D;  4LFA Q;  3U9S A;  5JJZ A;  4A3K G;  1JE5 A;  1NTG A;  1SNP A;  2OCE A;  4KJN A;  3TDQ A;  4XT3 B;  5FJ8 H;  4U68 A;  5BN3 A;  3S9W A;  1ET9 A;  1TWH B;  2KOL A;  3G71 A;  1FGB D;  3OMC A;  1BQQ T;  1DOM A;  3J80 c;  1VQ6 A;  2XN9 C;  1SSO A;  3LGJ A;  2EZV A;  5IP9 G;  4YCV A;  2QA4 A;  3E3X A;  4ZLT F;  3MAQ A;  1PH5 A;  3CKI B;  1E1O A;  3BG3 A;  4F88 A;  5C44 G;  1YHB A;  1S5B D;  4DV0 Q;  4GNX A;  1YI2 A;  1JWM D;  5C4Z A;  4JV5 L;  1TS4 A;  4BBR H;  1MJE A;  1SLJ A;  1RF2 D;  1B7Y B;  1PFM A;  4A3M B;  3H3V I;  1L2F A;  1UAP A;  3J81 c;  1BCP C;  2WB1 G;  5KRU A;  4DUZ L;  2F0Q A;  3VR6 A;  1UNS A;  2LSS A;  4LF9 L;  2IHF A;  4CJ2 C;  1IBM L;  2ZM6 L;  2BE5 C;  3GTL B;  3X3N A;  1Q81 C;  4R4C A;  3CPF A;  4WFN 3;  1ZYR C;  3I4L A;  4NPS A;  4KY7 A;  5HGT A;  2KEN A;  1CKM A;  3AYH B;  3F2D A;  3DMU A;  1PH1 A;  3I90 A;  3S2D B;  3AFP A;  4YY3 L;  2LXK A;  2CKZ B;  3PIP A;  1YJ9 A;  3QJY A;  2O4X A;  1SJH D;  1SND A;  2PI2 E;  1O7L A;  3FKI B;  4KN7 C;  3AFQ A;  3PSI A;  2QKI C;  5G3L D;  3PUX A;  1ILQ A;  4X62 Q;  2EY2 A;  3UDI A;  3S1R H;  4A3L G;  1KNA A;  3P75 A;  4LK1 C;  3HEJ A;  3GD7 A;  2IX3 A;  3AU7 A;  2MPM A;  1LM0 A;  1BR9 A;  1SMY D;  2DNE A;  1K0S A;  3BYY B;  4K2K A;  4EX5 A;  3VDY A;  4LMQ D;  4BXX G;  5A2Q L;  4DV4 Q;  1FL0 A;  4ZQ3 A;  2RSN A;  3D4R A;  1H9J A;  1VF7 A;  2ES2 A;  3CCL A;  3CU7 A;  4NKL A;  4YHH L;  3DWP A;  5E4W C;  5GRO A;  2NN6 I;  4IJH A;  4X3U A;  4DV5 Q;  1SE4 A;  5FO8 B;  1MI2 A;  1CKO A;  3CQZ B;  1EQR A;  5DLQ E;  2B2Y A;  1GO3 E;  4NW2 A;  4A3M G;  1GHK A;  1VQP A;  4A3D G;  1I94 L;  1WD0 A;  1N36 L;  3U4Z A;  3H3V C;  3HZX A;  1STH A;  2JP1 A;  1UWV A;  1GVP A;  2KEC A;  1TS2 A;  1N33 Q;  4DPG A;  1SYF A;  5IYD H;  5C0X I;  1PTO F;  2JJQ A;  2NZH A;  1L1O C;  2DJG C;  5IGD A;  3HG9 A;  4X66 Q;  1LLR D;  2J4X A;  4B3R Q;  2WAQ B;  2E74 C;  4EVO A;  4EQO A;  2UUC Q;  4KKT A;  1MKH A;  3M3Y H;  2NVQ B;  1H9K A;  3FKI G;  4RHR A;  3TP6 A;  2ZJP A;  3LWE A;  1YIJ A;  2GN5 A;  4FXK C;  2K32 A;  1NUC A;  1XMO L;  5K36 H;  4DR3 L;  3DUZ A;  3N6R A;  5FLX c;  2K5D A;  5IGE A;  4QY7 A;  1U4P A;  1BBX C;  2F0P A;  4DV2 L;  2BOS A;  1EWC A;  1OXS C;  2BA1 A;  1CSP A;  4JI8 Q;  2IL8 A;  3K59 A;  3RMH A;  5LMU Q;  4DV1 L;  1RD9 D;  3KBX A;  1O80 A;  4MN3 A;  5AJ3 L;  4IFD I;  4JI0 L;  3AMU A;  4CDF C;  1FJG L;  2EJG C;  1PRT B;  4BY7 H;  3HOV B;  1JMC A;  5CYU A;  1M1K C;  2I46 A;  3CCM A;  3S16 H;  3L7Z C;  4JI2 L;  2JA8 B;  1JQY D;  2KED A;  2NTS A;  1OXT A;  1F2Z A;  1J5E L;  1UE6 A;  2JEA I;  4BBS H;  2XTI A;  3QO2 A;  4IPC A;  2A5H A;  5E1F A;  1B9N A;  3HOY H;  3FVQ A;  1XX8 A;  4K0K L;  3VR2 A;  3HKS A;  1TWA B;  1YNN D;  4A3B G;  4DNR B;  4HR7 B;  2JA7 H;  1F9S A;  4B9W A;  4L5R C;  2OF1 A;  3KBG A;  4N9T A;  2MHV A;  2L0C A;  2SOB A;  5IGC A;  2RHS B;  4KD3 A;  2F0S A;  4MTK A;  4RH6 A;  4R8N A;  3OHX C;  3RLN A;  1TY0 A;  1AN8 A;  2KHJ A;  2ZT9 C;  5CMD A;  4FYD A;  1DOK A;  1AZQ A;  3OTO L;  3CCJ A;  2WAQ G;  1RTO A;  4L6T B;  3RLO A;  1B3Q A;  3SDZ A;  1PHJ A;  5JJL A;  1X3Q A;  4LWC A;  1I6H B;  4ID6 A;  3S14 H;  4OEM B;  3KLR A;  1X54 A;  2Z6K C;  2F0N A;  1PXU A;  4K5V A;  5K5P A;  2WP8 J;  1JJC B;  2HHH L;  3ERS X;  2L12 A;  2XRS D;  1Q46 A;  3J7Z C;  1R9T B;  2QEJ C;  3H3V H;  2F0F A;  2EXZ A;  3CCQ A;  2XGT A;  1K83 H;  3C46 A;  4C3I H;  4ODG A;  4J1M A;  4AH6 A;  1WTQ A;  1CHP D;  4DV3 Q;  4PG3 A;  2JA6 B;  5KYI A;  4ZAI A;  4DXG A;  3STB D;  2CH4 W;  4GLX A;  4KHP Q;  1HH2 P;  1STB A;  2EYF A;  3SVM A;  4CJ1 B;  1EQQ A;  4BY1 H;  2AWO A;  3NEN A;  1H9S A;  2YU9 H;  1IYV A;  3GP7 A;  4FNF A;  4GKK L;  1YHQ A;  1A6X A;  2K75 A;  1JWU D;  2EE1 A;  3H0G H;  5GAG C;  3EVQ A;  3QWN A;  1XNQ Q;  1QUQ B;  2A73 B;  1BKB A;  3VYU A;  2N49 A;  3Q6S A;  1XPO A;  4BBR G;  4JI3 L;  2VZA A;  1GHJ A;  2ICI A;  4KK7 A;  4JOI A;  1AE3 A;  1KIX A;  4U67 3;  1SE2 A;  1K9M C;  2ID0 A;  4QIW B;  5A2Q E;  1QZG A;  4OWT B;  5DM7 3;  4FO2 A;  4JYA Q;  4X6A H;  2RQX A;  1LTA D;  2IX0 A;  4NMZ A;  1C0A A;  1RHP A;  1WYD A;  1ESF A;  3BU2 A;  4ZRZ A;  4LF6 L;  3VYT A;  4DUY L;  3TSS A;  4C3J H;  2N3S A;  4KY6 A;  2BCO A;  3PO2 B;  3MXP A;  5IGF A;  4LF8 Q;  3S1N B;  2VS1 A;  3M3Y B;  1FNV A;  2R7Z H;  5CBE E;  1K8O A;  3DXJ C;  1MHW C;  5COR A;  1HA6 A;  1L0W A;  4DXF A;  1ZEQ X;  2I0Q A;  3Q0A A;  1SNQ A;  1VMP A;  2SNM A;  4CDC C;  1A2U A;  1LAC A;  1UE1 A;  3D31 A;  1PLF A;  5M5Y H;  4C2M H;  1EWI A;  1I50 B;  2E8G A;  1SE8 A;  4GLV B;  4A3I H;  1NJI C;  2UU9 Q;  3L3O C;  3W5O A;  4TVA B;  4JI0 Q;  1IBK Q;  4GOP C;  4H13 C;  3JAM c;  4XXE A;  4PMC A;  1EYG A;  2JA6 G;  1KNE A;  1SNM A;  3SK5 A;  4J15 A;  3SXH A;  1PV4 A;  5ELC A;  5F2D A;  4FDB A;  2R93 B;  5C0X H;  1NY4 A;  4HTH A;  3EIV A;  3K80 C;  1F9R A;  4XDX A;  4FF2 A;  3SEB A;  3D4D A;  4DV6 L;  4JI6 Q;  1LT4 D;  1VQA A;  1AP0 A;  4P75 A;  2D9U A;  2K6A A;  4LFB Q;  3V96 A;  4A3F B;  2EYM A;  1WOC A;  1KLU D;  4A3C H;  3D4W A;  2B39 A;  4X65 Q;  1IZ6 A;  1LTG D;  2M9V A;  5C4X H;  2FFK B;  3NK9 A;  5FKA C;  4B3M L;  4NXN L;  1DOL A;  4KHZ A;  4UAI A;  2SNS A;  1EOV A;  1YBY A;  2A74 C;  1PH3 A;  1PFS A;  2RVL A;  5IWA Q;  5IYD G;  4GNX B;  2O5I C;  3OTO Q;  3ZYY X;  4IFD H;  2NVY B;  4AYB B;  1JOR A;  2VQE Q;  2EDG A;  5CV6 A;  1RJT A;  3K7U C;  2F0M A;  3EJI A;  2A1A A;  2LXJ A;  4JG2 A;  4P74 A;  3PO2 G;  1VQL A;  2L9H A;  4LFA L;  5JEA H;  3Q22 A;  2RKS A;  4DGZ A;  1PTO B;  4A3G H;  1GKH A;  5K36 G;  4DNT B;  1AZP A;  1B9M A;  1QIL A;  2LKV A;  1A0I A;  1PRT D;  2WAQ E;  3AQQ A;  1YHA A;  3KOJ A;  4YCW A;  3CP0 A;  1S72 A;  3A0J A;  5A35 A;  5IT9 L;  3TEH B;  3K5M A;  1ILP A;  2A68 D;  4GN4 B;  5M3M H;  4DV0 L;  3A5Z B;  2ZXR A;  2R93 G;  1IW7 D;  1QZH A;  2KEE A;  1Y1V H;  1QNK A;  1C48 A;  5ELN A;  1CSQ A;  1B2T A;  1D1K A;  1SMX A;  1Z7T A;  2OTL A;  1DZ1 A;  2N78 A;  4A75 A;  1L0X B;  1JC7 A;  5IGG A;  2PNR C;  4PV1 C;  5EKI A;  1JE4 A;  2F4V Q;  2K52 A;  5ISR A;  2N55 A;  3HOY G;  3CCS A;  1FYC A;  2Y0S E;  3L2P A;  3P7J A;  5D14 A;  5M5X H;  2B2V A;  2JA7 G;  3H09 A;  1U4R A;  2D5D A;  2ZJQ A;  4LF6 Q;  1WCM B;  1I4P A;  4DK1 A;  5C4J H;  4B9X A;  3ULL A;  3QIA A;  4AYB G;  4X3S A;  3HOZ H;  1UEA B;  1X3F A;  3NPP A;  3S17 H;  4A3K B;  4ZUI A;  4X62 L;  4XYO A;  2E2I H;  3GTP H;  1W6J A;  3KFU A;  4RWS C;  3ONA B;  3A8J E;  3J80 i;  5C3E H;  4N8F A;  2A68 C;  2I5H A;  4HJA A;  3DWQ A;  5HGQ A;  1G2S A;  5GQO A;  4DK3 C;  3A7A B;  2PPB C;  5CV5 A;  1E2V A;  1V1P A;  3OOC A;  4DV4 L;  1CTM A;  1O78 A;  4IUR A;  1N32 Q;  2PW7 A;  4Z9C B;  3DHQ A;  5JPN C;  2K1B A;  1Z47 A;  1WTV A;  2B63 H;  2NZO A;  3A8K E;  1EYD A;  2H5X A;  1LT3 D;  1DGS A;  4DV5 L;  4IO9 A;  1G6P A;  1XYI A;  4V0B A;  2CW0 C;  3CAM A;  3MEF A;  1NE3 A;  4X64 Q;  1CHQ D;  3HOW B;  3DM3 A;  5C4H A;  2WB1 B;  1XNR L;  2NVT H;  5LMN Q;  4CGY B;  5I2X A;  3F8T A;  4DKA C;  2G9H D;  1RDP D;  3RLF A;  4A3E B;  3I55 A;  1KQS A;  3RN5 A;  1A3T A;  3H0G G;  1TWG H;  4DA2 A;  2UUA Q;  3NP8 A;  3OSO A;  3S1Q H;  5FOB B;  1N33 L;  4OO1 G;  1C4Q A;  3RZD B;  1X6O A;  3IL8 A;  3OW2 A;  2L1B A;  1G51 A;  1SNC A;  3HOU H;  3CHB D;  1EIH A;  1CM9 A;  2R6G A;  4X66 L;  5KND A;  2OT2 A;  2V4D A;  1F9P A;  3TZU A;  4XIG S;  4LF4 Q;  4B3R L;  1HZ9 A;  2L5T A;  2UUC L;  3UDF A;  1YJN A;  1PH2 A;  2KCT A;  4ME3 A;  1B44 D;  2JEB I;  1B1Z A;  4RAU C;  4QIW E;  1J6Q A;  2QCP X;  5T1I A;  5IYB H;  2MQH A;  2WFW A;  1VQE A;  2ICE C;  3TBI B;  5M3F H;  4F8M A;  2D0P A;  1BUV T;  4UP8 A;  3NWS A;  3HKZ G;  3NE5 B;  4JI8 L;  5LMU L;  4FF3 A;  2A6E D;  2JA5 B;  2B2W C;  2E2J B;  3KLS A;  2R61 A;  2RDF A;  2GVA A;  5ELD A;  1NBW A;  1H9R A;  3W3A A;  1LT5 D;  2K33 A;  2IX1 A;  1QVG A;  1EU3 A;  3G48 A;  2B3G A;  3K5L A;  1QWY A;  4GN3 B;  4QQB X;  3CME A;  2B29 A;  2E75 C;  1SEB D;  2PI2 A;  3GTG H;  1PDQ A;  2VL6 A;  4RFB A;  1SN8 A;  1EY7 A;  2LMC B;  4CBV A;  3TS0 A;  3LX0 A;  1A63 A;  4DR6 Q;  4DU9 A;  5L37 A;  3CMA A;  3IKJ A;  3HOW G;  4A3D B;  2F3V A;  4ZKC B;  2K05 A;  1HNZ Q;  3T16 A;  3W1B A;  4RMF A;  2HIX A;  4A3E G;  1Z6H A;  2JE6 I;  1PVO A;  3EBE A;  1CUK A;  1EEI D;  3VA7 A;  1STG A;  1FNW A;  3K6O A;  3ERQ A;  1PFB A;  1QVC A;  4MZ9 A;  5IT9 E;  1NAP A;  4UPA A;  2NB0 A;  2RSO A;  2A69 C;  4KI0 A;  2RF4 A;  1LO5 D;  3MA2 B;  1WI5 A;  4A3C G;  4DR1 L;  3ICE A;  1HRJ A;  3KJO A;  1BCP F;  5M5W H;  4ZYS A;  1Q12 A;  4EQN A;  2LS0 1;  2XWB B;  1X56 A;  4QUC A;  1A8V A;  1LTS D;  1L1O A;  1QJO A;  1H9S B;  1KHI A;  4R9W A;  3T56 B;  4P73 A;  4BS9 A;  2Z4H A;  2F0L A;  1NCV A;  4LUZ A;  1CQV A;  3O13 A;  4DR4 Q;  3OW7 A;  3U9O A;  4HMJ A;  2XSC A;  1STY A;  4KJO A;  1U0L A;  4UP9 A;  1D1I A;  3D8G A;  4H44 C;  4IAL A;  2JA5 G;  2A6H D;  5BR8 Q;  1OXX K;  5LHY 1;  5JEA G;  2Q2U A;  4A3G G;  4DV3 L;  1VQD A;  2V1C C;  3V05 A;  3GTJ B;  4EQP A;  1IXR A;  2X6G A;  4KHP L;  2F1M A;  3J7Y W;  5C6A A;  1PH9 A;  1SDF A;  5EPJ A;  1IL8 A;  2Z9H A;  4K6D A;  2HT1 A;  2K01 A;  5D3D A;  2UXD Q;  2JSO A;  1PYW D;  3RZO B;  2HDM A;  1VQJ A;  1VCI A;  1GOZ A;  1XNQ L;  4IUT A;  1XNR Q;  2NVX B;  4BA1 I;  1VMC A;  5IOD A;  3PUY A;  2MNA A;  3T1Y Q;  3HP3 A;  3M4O B;  2K4K A;  1KDA A;  4A3B B;  2QDL A;  1Q90 A;  3CRK C;  2NVT B;  3K57 A;  1CZW A;  1LAB A;  4JYA L;  4IUN A;  2PZW A;  2A19 A;  4PZ6 A;  4EGV A;  4K8J A;  3H91 A;  1G29 1;  1D5M C;  3NBH A;  1ENF A;  3QR8 A;  3GTK B;  1E2W A;  5IT9 c;  3IFD A;  4RKL A;  5IGB A;  1PMR A;  1SMY C;  3TN2 A;  2Q8T A;  4FF4 A;  3U50 C;  2OXP A;  1V8Q A;  1EEF D;  3S15 H;  3HS0 C;  4LF8 L;  3M4Y A;  4Y52 H;  3CD6 A;  1ZXT A;  1IKL A;  3A54 A;  1KL9 A;  4IUP A;  2E2H B;  3HFZ B;  2EOT A;  2NWG A;  3SR1 A;  4M1U B;  3DEO A;  4C3H H;  1S5D D;  1MGS A;  4RA8 A;  4GKJ Q;  2E5L Q;  4R1J A;  2Z6K A;  2UU9 L;  3J7A V;  2KJX A;  2KHI A;  2FMM A;  4Y7N H;  1K0R A;  1IBK L;  2BH2 A;  2QGQ A;  1BF4 A;  4ME5 A;  4LFC Q;  5T1G A;  2WKD A;  4HCE A;  1BVS A;  4HMI A;  1EUJ A;  1ET6 A;  4IPG A;  3TP5 A;  5IY0 A;  4C1N I;  1HFG A;  3NQT A;  1F9Q A;  4DFA A;  2B63 G;  4JI6 L;  3GTG B;  2NUC A;  5CV9 A;  2H1E A;  4BBR B;  4DV7 Q;  1HA5 A;  4LFB L;  1ROD A;  3VYR A;  3L0O A;  3LNN A;  2VUM H;  4FP5 D;  1ONL A;  3TZD A;  3KJP A;  4X65 L;  2EVB A;  4HIM A;  2CVR A;  1AEX A;  5IOC A;  3E0J A;  4KLK A;  4DR2 Q;  1WTR A;  2O5J C;  2LFN A;  4R4O A;  4QB4 A;  5C5M A;  4G7H C;  1CKN A;  4YWK A;  2WB1 E;  5GAH C;  4DR1 Q;  2UUB Q;  1TQO A;  5IWA L;  2AQ2 B;  2ZXO A;  5JVG 3;  2DNC A;  2VQE L;  2PZU A;  3QOL A;  1LT6 D;  3URY A;  3G4S A;  1DJR D;  2K5W A;  2E2D C;  4JI4 Q;  1K8A C;  4A3J H;  4H02 A;  4A93 H;  3DLL A;  1LTR D;  2N88 A;  1YNX A;  1I4Q A;  1YNJ D;  3CC4 A;  3RR5 A;  1WVL A;  3ND8 A;  4TQU S;  3WWV A;  4V19 0;  1V1Q A;  3PIO 3;  3JAM i;  4OGQ C;  4OXP A;  4I7Z C;  2Z4I A;  3B6Y A;  4JVZ A;  3S1R B;  1N9W A;  1X55 A;  1WJJ A;  1XWE A;  4CHT B;  1SR3 A;  3HOX H;  1V1O A;  1HZB A;  2D2C C;  1H9M A;  2L55 A;  3GTM H;  5EKL A;  1D8L A;  3CRL C;  3CXC A;  4NXM Q;  3GV3 A;  4N9P A;  5FJ8 G;  5EPL A;  1NMG A;  1PZI D;  1GUG A;  1O7I A;  2MP1 A;  3S2H H;  2F0I A;  2O2L D;  4O2D A;  1YNN C;  3RD4 A;  3RN2 A;  4GOP A;  2NTT A;  1EZ8 A;  1KAW A;  2VW9 A;  4G7O C;  3KF8 A;  4OEL B;  2ATW A;  2R92 H;  1GUN A;  1MD2 D;  1D7Q A;  2PZT A;  3K7A H;  1JWS D;  3OPO A;  2HQE A;  5LMN W;  2K14 A;  3A5U A;  2J0T D;  2F4V L;  1UE7 A;  3BYT B;  3OMG A;  1IYU A;  3OIQ A;  1B8A A;  2MJ8 A;  1PH6 A;  3MXU A;  2IT1 A;  3PO3 H;  2F0G A;  1RTN A;  1G8Z D;  4KKS A;  2MO0 A;  3FHW A;  3JC6 6;  4RG1 A;  1V1P B;  3C1F A;  2VNU D;  1SYC A;  4OX9 Q;  2G9D A;  3EA6 A;  3KLS X;  1U5K A;  2R7F A;  4P2C B;  4DF7 A;  4IOA A;  1WTX A;  3G6J B;  2Z6B A;  3F2U A;  4LF5 Q;  3R93 A;  4DR5 Q;  4IJL A;  2ASB A;  1E7Z A;  1EY0 A;  4RCO A;  1JR0 D;  2ENB A;  3GTQ H;  1F2L A;  4YCU A;  1VQ7 A;  3J80 L;  3VR5 A;  4CDE C;  4OON A;  5CBA E;  4RHS A;  3W2D A;  1HQR D;  1X3G A;  2NN6 H;  3STB C;  2Q8I B;  1LYL A;  1I3Q H;  5DM6 3;  2HCI A;  3HGB A;  3E5S A;  1VQ9 A;  1BCP B;  5D3I B;  3SE0 A;  1GUO A;  3Q24 A;  4LF7 Q;  1Y14 B;  4TKO B;  3A8I E;  2UXC Q;  2IHE A;  4KHV A;  3CCV A;  2AQ3 B;  1A62 A;  1A3V A;  1YVC A;  3J81 L;  3ULJ A;  2I5L X;  1K73 C;  1JJ2 A;  1N32 L;  1B50 A;  4APV A;  3NWT A;  1O7Y A;  2VY3 A;  4IPD A;  3I4M H;  2IW3 A;  1Q8K A;  1SFO H;  4K5W A;  4ILW A;  1WTW A;  5HY6 A;  4BY7 B;  2EY1 A;  4X64 L;  1W2B A;  5IP9 H;  1KDB A;  4CKE A;  3S16 B;  3GDE A;  3M9B A;  1T9H A;  4CDD C;  1QB5 D;  2DUD A;  5ELB A;  3M85 A;  5LMN L;  5C44 H;  4BBS B;  2Z8L A;  3E9I A;  3UDX A;  1GM5 A;  1SBB B;  4HCS A;  4KD4 A;  2UUA L;  3HOY B;  1Q1E A;  3K0Y A;  4M8A A;  3T13 A;  2R3Z A;  3PUV A;  3GTO H;  4B3S Q;  4R4T A;  2JA7 B;  1KRT A;  1X65 A;  1ASY A;  1W3S A;  4O0A A;  4LF4 L;  3M7G A;  1D6E C;  4L5T A;  4YWM A;  4JI5 Q;  4O42 A;  1TWF H;  3PF4 A;  2JQO A;  4A76 A;  3DWA A;  1F2M A;  1YZ6 A;  1SYG A;  2EIF A;  1P8L A;  4XYQ A;  1TWC H;  3M4P A;  2VQF L;  3BZK A;  5J3B A;  2OQ0 A;  3MXG A;  3S14 B;  4DR7 Q;  1VQK A;  2WKC A;  4IUU A;  3RUZ A;  3R2I A;  4A3L H;  1EQV A;  3TQY A;  2L4N A;  1O7Z A;  4NP5 A;  4ZK9 B;  4HIK A;  2FJ2 A;  4NDX A;  1KC8 C;  3HOX B;  5ELF A;  1K83 B;  1VQ5 A;  1EY9 A;  3GTM B;  1TWH H;  5JAV A;  4C3I B;  2M2L A;  2JYO A;  1ASZ A;  1L1O B;  2DGY A;  1LTT D;  4BY7 G;  1FD7 D;  3NHH A;  4DR6 L;  2WIN B;  2IPK D;  4BY1 B;  1I6V C;  5I4D A;  1WD1 A;  5I9O A;  3F2C A;  2YU9 B;  1PA6 A;  4BBS G;  4IUQ A;  1HNZ L;  2CHB D;  4HJ9 A;  3H0G B;  2PQA A;  4JCV E;  5I9P A;  1LTB D;  1PFN A;  2L15 A;  1NR4 A;  1RL2 A;  2X69 A;  5C3X A;  2AQ1 B;  1DD2 A;  5CV7 A;  3TME A;  3ZJY C;  5FO7 B;  4JK1 C;  5CGK A;  5FLX L;  3AB9 A;  3GTL H;  1D5X C;  1KDC A;  3CCR A;  1K3R A;  3BJU A;  1DCZ A;  1DYQ A;  2PO4 A;  2C5C A;  1I4H A;  3P20 A;  5EAY A;  1EY6 A;  1CA6 A;  1K28 A;  2G5D A;  1ICF B;  1VQN A;  1PRT C;  1E22 A;  1SNO A;  2ZJR A;  1CQF A;  1VDZ A;  2GA4 B;  3NEM A;  4CKB A;  1HFN A;  5CV4 A;  5KYL A;  3ULP A;  4DR4 L;  4C3J B;  2P5Z X;  1XPU A;  1HUM A;  3FKI H;  3KF6 A;  3HKZ B;  3FRP B;  3S1M H;  3BZC A;  1PH4 A;  4CKC A;  4BWG B;  5BR8 L;  2PW5 A;  5E3F A;  3C3L A;  4AQY Q;  2CH4 A;  2R7Z B;  1IW7 C;  4OWX B;  5EGT A;  3D6W A;  1VQG A;  1ENC A;  4C2M B;  2B2W A;  5M5Y B;  4WJ3 M;  1JOK A;  1KD1 C;  3NXW A;  1HPC A;  3NBH B;  2N8N A;  4A3I B;  3NTI A;  4JI1 Q;  3HOX G;  3J81 i;  3U58 A;  3J80 E;  3K0X A;  3PUZ A;  1VQ8 A;  4C3I G;  2OTJ A;  1CK1 A;  1HNX Q;  1I4X A;  1K3B C;  4JBM A;  2UXD L;  2FHT A;  3I4M B;  4HJ5 A;  1EYA A;  1VQF A;  1XTD A;  4JBJ A;  4BY1 G;  1HXY D;  4HN7 A;  3T1Y L;  2AUJ D;  3CCU A;  1EY8 A;  1N8R C;  3FP9 A;  3LWU A;  1C9O A;  3CQZ H;  2XNA C;  3FEW X;  3BZD B;  3J81 E;  1SAP A;  4FXG C;  2OWO A;  5KIX A;  5EJW A;  1AW7 A;  1JJG A;  1VS0 A;  3KUP A;  2KQ3 A;  1ICW A;  3MC0 B;  2Q2H A;  1JCK B;  2GVB A;  4ABN A;  4HJ7 A;  1NNX A;  4KY5 A;  4B3T Q;  5C4X B;  1JB7 A;  3ER0 A;  1QCB D;  1DM0 B;  3WDN A;  4JI7 Q;  5GAE C;  1RIP A;  5BN4 A;  4DNI A;  1Q7Y C;  1ML0 D;  2QIL A;  3G6E A;  3OWE B;  2AUK A;  4FVM A;  4IZ8 A;  3X3M A;  4BA2 I;  3D3R A;  1BCP D;  1VQI A;  2K04 A;  1NMF A;  1C7Y A;  4XT1 B;  4C3J G;  2NVQ H;  2VQF Q;  2Q2T A;  4GKJ L;  2E5L L;  1XXG A;  2BE5 D;  1X3P A;  1D5Z C;  4I65 A;  2CWA A;  1EIF A;  4FXD A;  4ALP A;  4XQN A;  1IBL Q;  4A3G B;  3PQI A;  2K03 A;  2R7Z G;  4YWL A;  1ZYR D;  4R4I A;  5JPM C;  2R7D A;  5J39 A;  2B2U C;  4LFC L;  1CKN B;  4KV6 A;  3IRB A;  4A3I G;  3PCO B;  2F0W A;  1B70 B;  2AHO B;  2EXD A;  1J8I A;  3T4A C;  2VB2 X;  3HOV H;  5M3M B;  3CPW A;  3I4M G;  3GO5 A;  1SYD A;  2WII B;  1OO9 B;  5HUR A;  3SK4 A;  2JA8 H;  2XVS A;  4DV7 L;  4HID A;  4RGM A;  4PQX A;  4LUV A;  5C0X G;  1BOS A;  4IPH A;  1VQO A;  1Y1V B;  3VR4 A;  1GD7 A;  1KRS A;  1RCV D;  1PZJ D;  3TRE A;  2UXB Q;  4DR2 L;  1OXU A;  1SRU A;  2BDO A;  4MTN A;  5TSS A;  5IP7 H;  1HNW Q;  4PZ8 A;  2DN8 A;  3R3O A;  2SDF A;  1JT8 A;  4L63 B;  1TR5 A;  1G2T A;  2Q8R E;  3FPU B;  1TWA H;  2UUB L;  2EY6 A;  3WOE A;  1C8C A;  2B2T C;  5C4X G;  3K8A A;  2A6E C;  5M5X B;  2YTV A;  2CCZ A;  2F0E A;  4GOP B;  3J7A F;  3R8B A;  2K5V A;  2K50 A;  1OTC A;  4JI4 L;  3KF8 B;  1F2Y A;  1PTO D;  4JBW A;  1HTP A;  1HR0 Q;  5C4J B;  3JAM L;  4IFD G;  3FDT A;  5IE8 A;  4LW1 A;  2H4O A;  3HOZ B;  1WTO A;  2NBF A;  1FNU A;  1TKW B;  5KGU A;  3S17 B;  2F0H A;  1JOO A;  4POG A;  3HRZ C;  3UE0 A;  4HJ8 A;  3BDL A;  1I4R A;  3T1H Q;  3GTP B;  2E2I B;  1QNU A;  1I6H H;  1E2Z A;  5C3E B;  4OO1 I;  5FLX E;  3IFT A;  3S1M B;  2QF7 A;  4AYB E;  4NXM L;  5JJI A;  1EQT A;  5FK9 C;  1B53 A;  2MFI A;  1EYC A;  1EFI D;  3MWY W;  1R9T H;  3SGI A;  3J81 j;  4POF A;  2CQA A;  1AFP A;  3CC7 A;  3EN2 A;  3I7F A;  2IY5 B;  3PMF A;  2EJF C;  2IWH A;  1MIU A;  3MFY A;  2PQE A;  2B63 B;  1LV9 A;  2F0U A;  2JA6 H;  5LL6 S;  2F4I A;  2WAC A;  3K58 A;  5M3M G;  1T5X D;  1K8G A;  3OWF A;  2RDH A;  3ND9 A;  4GNX C;  4AIM A;  2RBM A;  4HED A;  5NUC A;  4WJ4 A;  2HIV A;  4OL7 A;  3T53 B;  1Y1V G;  1QG7 A;  4ZCK A;  3K5N A;  1TS5 A;  1KXL A;  3KDF A;  3FMC A;  3IAY A;  1WFQ A;  1GUW A;  1B3A A;  4OX9 L;  5AFW A;  1TWG B;  2EPB A;  1PTO C;  4RGO S;  3S1Q B;  3H15 A;  2SEB D;  1BBU A;  3NUC A;  4WJW A;  1N34 Q;  1Q8I A;  4LF5 L;  3TRZ A;  4DR5 L;  1DXM A;  2XIW A;  4I7A A;  4S3S A;  3HOU B;  5KNB A;  4WRD A;  1HTL D;  1K8M A;  2A6H C;  3NTK A;  1BXT A;  3Q8D A;  3EFX D;  1EZ6 A;  3OIP A;  5EPK A;  2AWN A;  5J22 A;  2BDN A;  3PIO A;  3A74 A;  5G3L F;  3MXN A;  1Y8P B;  3I72 A;  2CQO A;  1Y1W H;  1QVF A;  2K5N A;  3HOZ G;  2HUG A;  1XMQ Q;  3PO2 H;  1BBW A;  5M3F B;  3S1N H;  4LF7 L;  1TXY A;  2K7V A;  2C9O A;  3PIP 3;  3I4N H;  5C3E G;  2EY5 A;  2UXC L;  1HZC A;  3K81 C;  4PMW A;  1Q3L A;  2DJF C;  4OIK A;  5EKK A;  1LUZ A;  4N8X 1;  1I50 H;  2LY7 A;  1D2B A;  3T51 B;  3W1G A;  3HKZ E;  3E6Z X;  4KMU C;  4UP7 A;  3CCE A;  4L8J A;  5BN5 A;  1E0B A;  2HQL A;  4Q5V A;  4G57 A;  1P16 A;  1UEB A;  2NYZ D;  2PCF B;  2Q2I A;  3BVM A;  2R93 H;  1X9N A;  2I07 B;  1II3 A;  1X32 A;  3TP7 A;  2B2Y C;  2KCN A;  4R4Q A;  3UE1 A;  2F52 A;  4C1N K;  1JIC A;  4X3T A;  2FMC A;  1E1T A;  1TT2 A;  4JV5 Q;  2Y0S B;  4DAY A;  4B3S L;  5IYC H;  3NQI A;  1PH8 A;  4A3F H;  3L9A X;  4GZY C;  1HHV A;  5DEH A;  3SK8 A;  1EY5 A;  4Q0F A;  1PYB A;  4JC0 A;  4DUZ Q;  3J7A 5;  4LF9 Q;  1IBM Q;  1S5F D;  2ZTE A;  2NZ1 D;  4IUV A;  5LL6 X;  2YV5 A;  2ZM6 Q;  4JI5 L;  1TVX A;  4XQJ A;  3HOU G;  1EU4 A;  3QG1 A;  2EYJ A;  3DEP A;  2JXM B;  5FO9 B;  5M5W B;  3UDG A;  4NB3 A;  3Q23 A;  3VR3 A;  3C2P A;  1TII D;  1VQ4 A;  1Q82 C;  2VXW A;  1GUS A;  1GXD C;  2NVY H;  3BS1 A;  2PQA B;  4DR7 L;  4YY3 Q;  1UUP A;  5I6Y A;  2C35 B;  5EQ0 A;  5IYB G;  4UY8 C;  2F03 A;  1T5E A;  3GV6 A;  5M3F G;  3EQL C;  1SE3 A;  3GQB A;  5ELE A;  1AH9 A;  1HUN A;  5DAU A;  1PTO H;  2ZTD A;  4IQZ A;  1HCZ A;  5EBD A;  1IHZ A;  3M4Q A;  3NEL A;  2PMZ B;  4IN3 A;  4DN4 M;  3CW2 C;  4GLA C;  1M8A A;  2CFM A;  2HD3 A;  1PYS B;  3K5O A;  3KYH C;  1S5E D;  4DAP A;  3FPP A;  1M90 C;  3MVV A;  1X3E A;  3NSW A;  4LAA A;  3JAM E;  4WOR A;  1FR3 A;  4X3K A;  4K14 A;  1F77 A;  2ALY B;  1IKM A;  4PNY A;  3PV0 A;  2RCF A;  4UHV A;  3VA5 A;  4C56 C;  3I4O A;  1ENA A;  3KF6 B;  3NTH A;  3HOV G;  4GN5 A;  5ELO A;  4YHH Q;  2JA8 G;  5FLM H;  2IJ0 A;  1G91 A;  4GS3 A;  2D0O A;  2Y0S G;  2F0V A;  1HQM C;  1Q86 C;  2JA9 A;  2FIN B;  1YNJ C;  3MHB A;  5IP7 G;  4OO1 H;  2EQS A;  2EYL A;  3QOJ A;  2QW7 A;  1I94 Q;  1LTI D;  2XWJ B;  3I3C A;  1N36 Q;  1QOH A;  3S24 A;  3I8Z A;  4RGN A;  4JBK A;  5COY A;  2YTX A;  2B8G A;  4QCL A;  1A3U A;  2K28 A;  1CI3 M;  2HDL A;  1WCM H;  2RA4 A;  3MFG A;  3S15 B;  2F0K A;  3AEV A;  1IYJ B;  1U4L A;  2KCC A;  3BDC A;  2Z0S A;  4XQQ A;  5C0X J;  4AQY L;  1WTH A;  4A3K H;  1VQH A;  2BH8 A;  1EIY B;  1Y8O B;  4C3H B;  1R4Q B;  3PF5 A;  1Y1W B;  4QF4 A;  5C3W A;  3R2T A;  1MBY A;  5E4X A;  1KLG D;  2F0O A;  1XMO Q;  4DR3 Q;  1V9P A;  3I4N B;  4JI1 L;  4Y7N B;  1EFW A;  4DV2 Q;  2QEX A;  1Z9F A;  3VYS A;  1HNX L;  2YYZ A;  1VF5 C;  1XJV A;  2B8F A;  1CA5 A;  4DV1 Q;  1GJX A;  2KA7 A;  3E9H A;  4CJ0 B;  3KK7 A;  2EYP A;  3C1E A;  5AJ3 Q;  1EL0 A;  4IOC A;  4LNQ A;  4R8I A;  1CT1 D;  4G4K A;  1FJG Q;  1E3P A;  3I91 A;  4RGT A;  4RKB A;  3UI2 A;  1Y8N B;  3CC2 A;  3H94 A;  1CZG A;  4IFD J;  2PNH A;  4JI2 Q;  3HOW H;  4KKU A;  3I70 A;  3MZ5 A;  2EYO A;  4K8I A;  1OXV A;  1J5E Q;  2VUM B;  1JB3 A;  1STA A;  2RHQ B;  1GUT A;  4F87 A;  2F0J A;  2KHS A;  4A3E H;  4H0L C;  1EY4 A;  5JEA J;  3P1H A;  4B3T L;  3TS2 A;  1UE5 A;  4JOI C;  3V2T A;  1YIT A;  1RKN A;  3PUW A;  4JI7 L;  4K0K Q;  3RZD H;  3A7L A;  2L11 A;  2OEO A;  1MSH A;  4RCN A;  2AKW B;  1Q1B A;  2F3W A;  4OWW B;  1EWH A;  4HSP A;  2PYK A;  5C5L A;  1BNZ A;  4P72 A;  3SK6 A;  3N52 A;  4J6H A;  1YJW A;  1HR0 W;  4L5S A;  1STE A;  2AMC B;  4A4I A;  2J7Z A;  1EOT A;  2RCN A;  1VQM A;  4A3J B;  4A93 B;  1U9R A;  4QJF A;  2Z1C A;  1IBL L;  1PZK D;  4DK6 C;  2K5Q A;  1TY2 A;  1R4P B;  4C3H G;  1Y1W G;  2ZTC A;  3I73 A;  5I2Y A;  2JA5 H;  2VB3 X;  4HIO A;  1WTP A;  2E2J H;  3I4N G;  4BXX H;  3SHL A;  1JOQ A;  1Y69 U;  2QDB A;  1VQC A;  3WOF A;  2HHH Q;  3S2H B;  4ULL A;  4JPB W;  5CR3 A;  4YIJ A;  5JOB A;  5JVH 3;  2XRQ D;  4TRD A;  2R92 B;  1ESR A;  1I4G A;  2MO1 A;  2RDG A;  5I6W A;  4A3M H;  1H95 A;  3K7A B;  2UXB L;  4A3D H;  3QB3 A;  4QL5 A;  2JN4 A;  1HNW L;  2F3I A;  2JK8 A;  3U4V A;  1XPR A;  1VQB A;  4GKK Q;  3MTS A;  2VUM G;  3NBI A;  3F2B A;  1SYE A;  1HJP A;  1SJE D;  3PO3 B;  4H7B A;  5H1S E;  1J9O A;  1KAB A;  4DAM A;  1BDO A;  3BVZ A;  4JI3 Q;  4LUO A;  1LTL A;  4O1N A;  3DM1 A;  3KLW A;  5IYC G;  2MGS A;  4A3F G;  1L0Y B;  1KAA A;  2CW0 D;  4J8Q A;  4K6L A;  2E76 C;  3S2D H;  2TSS A;  4L5Q A;  1S3O A;  2DY8 A;  4XTC S;  3I56 A;  2ZXP A; 
#chains in the Genus database with same CATH homology
 4PMB A;  2F0D A;  3GTQ B;  1EIG A;  4F7X A;  2EYH A;  4HSV A;  1NSN S;  4DK0 A;  1SXT A;  5KNC A;  2BA0 A;  4UDU C;  2D62 A;  4ZKB B;  1MSG A;  1I3Q B;  1ZKO A;  5KEE A;  3BVG A;  1TS3 A;  2F0T A;  1PRT F;  4MIU A;  1CFM A;  4ZUJ A;  1G6Z A;  3ERO A;  4E6I A;  1B4O A;  2EJM A;  5D65 A;  4HAE A;  5IIF A;  2DY7 A;  2B2U A;  2MUY A;  3M7N A;  1STN A;  1V43 A;  3G7L A;  4QUF A;  4OHJ A;  1KTK A;  1SFO B;  4TSS A;  1W6K A;  1S4Z A;  2KUM A;  4KN4 C;  2HCC A;  3BDO A;  3A55 A;  1A15 A;  5C44 B;  5M9O A;  5EBC A;  3MEH A;  2X6L A;  4G7Z C;  4B08 A;  1TU2 B;  1XTC D;  3GTO B;  4LJZ C;  1M4V A;  1SYB A;  1BO0 A;  2WV6 D;  1QE6 A;  2TMP A;  2B2T A;  5CV8 A;  2B2V C;  5CC4 A;  5DNF A;  1A2T A;  1NR2 A;  1U4M A;  4K5X A;  1TWF B;  3TP8 A;  3A56 A;  2KVM A;  1DON A;  4QMG A;  2M00 A;  3H6M A;  4MHE A;  5J1Z A;  3ITP A;  1S5C D;  4KTA A;  4DAV A;  4K2L A;  3D6C A;  1TWC B;  2NN6 G;  4OIJ A;  4FF1 A;  2A69 D;  3U9S A;  5JJZ A;  1SNP A;  4KJN A;  3TDQ A;  4XT3 B;  4U68 A;  5BN3 A;  3S9W A;  1ET9 A;  1TWH B;  2KOL A;  1FGB D;  3OMC A;  1BQQ T;  1DOM A;  2XN9 C;  1SSO A;  2EZV A;  4ZLT F;  3MAQ A;  3CKI B;  3BG3 A;  4F88 A;  1S5B D;  1JWM D;  5C4Z A;  1TS4 A;  1RF2 D;  1PFM A;  4A3M B;  1UAP A;  1BCP C;  5KRU A;  2F0Q A;  3VR6 A;  1UNS A;  4CJ2 C;  2BE5 C;  3GTL B;  3X3N A;  4WFN 3;  1ZYR C;  3I4L A;  4KY7 A;  5HGT A;  3DMU A;  3I90 A;  3S2D B;  3QJY A;  2O4X A;  1SJH D;  1SND A;  1O7L A;  3FKI B;  4KN7 C;  2QKI C;  5G3L D;  3PUX A;  1ILQ A;  2EY2 A;  1KNA A;  3P75 A;  4LK1 C;  3HEJ A;  3GD7 A;  2IX3 A;  3AU7 A;  2MPM A;  1BR9 A;  1SMY D;  2DNE A;  3BYY B;  4K2K A;  4LMQ D;  5A2Q L;  4ZQ3 A;  2RSN A;  3D4R A;  1H9J A;  1VF7 A;  3CU7 A;  4NKL A;  3DWP A;  5E4W C;  2NN6 I;  4X3U A;  1SE4 A;  5FO8 B;  1MI2 A;  3CQZ B;  2B2Y A;  4NW2 A;  1GHK A;  1WD0 A;  3H3V C;  3HZX A;  1STH A;  2JP1 A;  2KEC A;  1TS2 A;  1SYF A;  5C0X I;  1PTO F;  5IGD A;  3HG9 A;  1LLR D;  2J4X A;  2WAQ B;  2E74 C;  4EVO A;  4EQO A;  4KKT A;  2NVQ B;  1H9K A;  4RHR A;  3TP6 A;  3LWE A;  4FXK C;  2K32 A;  1NUC A;  5K36 H;  3DUZ A;  3N6R A;  2K5D A;  5IGE A;  1U4P A;  1BBX C;  2F0P A;  2BOS A;  1EWC A;  1OXS C;  2BA1 A;  2IL8 A;  3K59 A;  3RMH A;  1RD9 D;  3KBX A;  1O80 A;  4MN3 A;  4IFD I;  3AMU A;  2EJG C;  1PRT B;  3HOV B;  5CYU A;  2I46 A;  3L7Z C;  2JA8 B;  1JQY D;  2KED A;  2NTS A;  1OXT A;  1F2Z A;  2JEA I;  3QO2 A;  2A5H A;  5E1F A;  1B9N A;  3FVQ A;  1XX8 A;  3VR2 A;  1TWA B;  1YNN D;  4DNR B;  4HR7 B;  1F9S A;  4B9W A;  2OF1 A;  3KBG A;  4N9T A;  2MHV A;  2L0C A;  2SOB A;  5IGC A;  4KD3 A;  2F0S A;  4RH6 A;  4R8N A;  3OHX C;  1TY0 A;  1AN8 A;  2ZT9 C;  4FYD A;  5CMD A;  1DOK A;  1AZQ A;  1RTO A;  4L6T B;  3SDZ A;  1X3Q A;  1I6H B;  4ID6 A;  3KLR A;  2F0N A;  1PXU A;  4K5V A;  5K5P A;  2WP8 J;  2L12 A;  2XRS D;  1R9T B;  2QEJ C;  2F0F A;  2EXZ A;  3C46 A;  4ODG A;  4J1M A;  1WTQ A;  1CHP D;  2JA6 B;  5KYI A;  4ZAI A;  4DXG A;  1STB A;  2EYF A;  3SVM A;  4CJ1 B;  2AWO A;  1H9S A;  1IYV A;  3GP7 A;  4FNF A;  1A6X A;  1JWU D;  2EE1 A;  3EVQ A;  3QWN A;  2A73 B;  3VYU A;  3Q6S A;  1GHJ A;  2ICI A;  4KK7 A;  4U67 3;  1SE2 A;  2ID0 A;  4QIW B;  5A2Q E;  5DM7 3;  4FO2 A;  2RQX A;  1LTA D;  2IX0 A;  4NMZ A;  1RHP A;  1ESF A;  4ZRZ A;  3VYT A;  3TSS A;  4KY6 A;  2BCO A;  3PO2 B;  3MXP A;  5IGF A;  3S1N B;  3M3Y B;  1FNV A;  5CBE E;  1K8O A;  3DXJ C;  5COR A;  1HA6 A;  4DXF A;  1ZEQ X;  3Q0A A;  1SNQ A;  1VMP A;  2SNM A;  1A2U A;  1LAC A;  3D31 A;  1PLF A;  1I50 B;  3L3O C;  4H13 C;  4XXE A;  4PMC A;  1KNE A;  1SNM A;  3SK5 A;  3SXH A;  5ELC A;  5F2D A;  2R93 B;  5C0X H;  4HTH A;  1F9R A;  4XDX A;  4FF2 A;  3SEB A;  3D4D A;  1LT4 D;  1AP0 A;  2D9U A;  2K6A A;  3V96 A;  4A3F B;  2EYM A;  1KLU D;  3D4W A;  2B39 A;  1LTG D;  2M9V A;  2FFK B;  3NK9 A;  5FKA C;  1DOL A;  4KHZ A;  4UAI A;  2SNS A;  2A74 C;  2RVL A;  2O5I C;  4IFD H;  3ZYY X;  2NVY B;  4AYB B;  1JOR A;  2EDG A;  5CV6 A;  1RJT A;  2F0M A;  3EJI A;  2L9H A;  5JEA H;  3Q22 A;  2RKS A;  4DGZ A;  1PTO B;  5K36 G;  4DNT B;  1AZP A;  1B9M A;  1QIL A;  2LKV A;  1PRT D;  5A35 A;  5IT9 L;  3K5M A;  1ILP A;  2A68 D;  2ZXR A;  1IW7 D;  2KEE A;  1QNK A;  1C48 A;  1B2T A;  1D1K A;  1Z7T A;  1DZ1 A;  1L0X B;  1JC7 A;  5IGG A;  2PNR C;  4PV1 C;  5EKI A;  1JE4 A;  5ISR A;  2N55 A;  1FYC A;  3P7J A;  5D14 A;  2B2V A;  3H09 A;  1U4R A;  2D5D A;  1WCM B;  1I4P A;  4DK1 A;  4B9X A;  3QIA A;  4X3S A;  1UEA B;  3NPP A;  4A3K B;  4ZUI A;  4XYO A;  1W6J A;  4RWS C;  3ONA B;  3A8J E;  2A68 C;  3DWQ A;  1G2S A;  3A7A B;  2PPB C;  5CV5 A;  1E2V A;  1V1P A;  3OOC A;  1CTM A;  1O78 A;  4IUR A;  2PW7 A;  4Z9C B;  3DHQ A;  5JPN C;  2K1B A;  1Z47 A;  1WTV A;  3A8K E;  1EYD A;  1LT3 D;  1XYI A;  4V0B A;  2CW0 C;  1CHQ D;  3HOW B;  5C4H A;  2WB1 B;  4CGY B;  5I2X A;  2G9H D;  1RDP D;  3RLF A;  4A3E B;  1A3T A;  4DA2 A;  3NP8 A;  3OSO A;  5FOB B;  4OO1 G;  1C4Q A;  3RZD B;  3IL8 A;  2L1B A;  1SNC A;  3CHB D;  1EIH A;  1CM9 A;  2R6G A;  5KND A;  2OT2 A;  2V4D A;  1F9P A;  3TZU A;  4XIG S;  2L5T A;  1B44 D;  2JEB I;  1B1Z A;  4RAU C;  2QCP X;  5T1I A;  2ICE C;  3TBI B;  4F8M A;  1BUV T;  3NWS A;  3NE5 B;  4FF3 A;  2JA5 B;  2A6E D;  2B2W C;  2E2J B;  3KLS A;  2R61 A;  2RDF A;  5ELD A;  1H9R A;  3W3A A;  1LT5 D;  2K33 A;  2IX1 A;  1EU3 A;  3K5L A;  1QWY A;  2E75 C;  1SEB D;  1PDQ A;  4RFB A;  4CBV A;  1EY7 A;  2LMC B;  3LX0 A;  4DU9 A;  3IKJ A;  4A3D B;  2F3V A;  4ZKC B;  2K05 A;  3T16 A;  1Z6H A;  2JE6 I;  1EEI D;  3VA7 A;  1STG A;  1FNW A;  3K6O A;  3ERQ A;  1PFB A;  5IT9 E;  1NAP A;  2NB0 A;  2RSO A;  2A69 C;  4KI0 A;  1LO5 D;  3MA2 B;  1HRJ A;  1BCP F;  4ZYS A;  1Q12 A;  4EQN A;  2LS0 1;  2XWB B;  4QUC A;  1LTS D;  1QJO A;  1H9S B;  4R9W A;  3T56 B;  4BS9 A;  2Z4H A;  2F0L A;  1NCV A;  1CQV A;  3O13 A;  3OW7 A;  3U9O A;  4HMJ A;  2XSC A;  1STY A;  4KJO A;  1D1I A;  3D8G A;  4H44 C;  4IAL A;  2A6H D;  1OXX K;  5LHY 1;  5JEA G;  3V05 A;  3GTJ B;  4EQP A;  2X6G A;  2F1M A;  3J7Y W;  5C6A A;  1SDF A;  5EPJ A;  1IL8 A;  4K6D A;  2K01 A;  5D3D A;  2JSO A;  1PYW D;  3RZO B;  2HDM A;  1VCI A;  1GOZ A;  4IUT A;  2NVX B;  4BA1 I;  1VMC A;  5IOD A;  3PUY A;  3HP3 A;  3M4O B;  1KDA A;  4A3B B;  1Q90 A;  3CRK C;  2NVT B;  3K57 A;  1CZW A;  1LAB A;  4IUN A;  2PZW A;  4EGV A;  4K8J A;  3H91 A;  1G29 1;  1D5M C;  3NBH A;  1ENF A;  3GTK B;  1E2W A;  3IFD A;  4RKL A;  5IGB A;  1PMR A;  1SMY C;  3TN2 A;  2Q8T A;  4FF4 A;  2OXP A;  1V8Q A;  1EEF D;  3HS0 C;  3M4Y A;  1ZXT A;  1IKL A;  3A54 A;  4IUP A;  2E2H B;  2EOT A;  2NWG A;  3SR1 A;  4M1U B;  3DEO A;  1S5D D;  1MGS A;  4RA8 A;  3J7A V;  2KJX A;  2FMM A;  1BF4 A;  4ME5 A;  5T1G A;  2WKD A;  4HCE A;  4HMI A;  1ET6 A;  3TP5 A;  4C1N I;  1HFG A;  3NQT A;  1F9Q A;  4DFA A;  3GTG B;  2NUC A;  5CV9 A;  2H1E A;  4BBR B;  1HA5 A;  1ROD A;  3VYR A;  3LNN A;  4FP5 D;  1ONL A;  3TZD A;  2EVB A;  2CVR A;  1AEX A;  5IOC A;  3E0J A;  1WTR A;  2O5J C;  2LFN A;  4QB4 A;  5C5M A;  4G7H C;  1TQO A;  2AQ2 B;  2ZXO A;  5JVG 3;  2DNC A;  2PZU A;  3QOL A;  1LT6 D;  3URY A;  1DJR D;  2K5W A;  2E2D C;  1LTR D;  2N88 A;  1I4Q A;  1YNJ D;  1WVL A;  3ND8 A;  4TQU S;  4V19 0;  3PIO 3;  4OGQ C;  4I7Z C;  2Z4I A;  3S1R B;  4CHT B;  1XWE A;  1V1O A;  2D2C C;  1H9M A;  2L55 A;  5EKL A;  3CRL C;  3GV3 A;  4N9P A;  5EPL A;  1PZI D;  1GUG A;  2MP1 A;  2F0I A;  2O2L D;  1YNN C;  3RD4 A;  2NTT A;  1EZ8 A;  4G7O C;  3KF8 A;  1GUN A;  1MD2 D;  2PZT A;  1JWS D;  3OPO A;  2HQE A;  2J0T D;  3BYT B;  3OMG A;  1IYU A;  3OIQ A;  2MJ8 A;  3MXU A;  2IT1 A;  2F0G A;  1RTN A;  1G8Z D;  4KKS A;  1V1P B;  3C1F A;  2VNU D;  1SYC A;  2G9D A;  3EA6 A;  3KLS X;  4P2C B;  4DF7 A;  1WTX A;  3G6J B;  3F2U A;  3R93 A;  1EY0 A;  4RCO A;  1JR0 D;  2ENB A;  1F2L A;  3J80 L;  3VR5 A;  5CBA E;  4RHS A;  3W2D A;  1HQR D;  2NN6 H;  2Q8I B;  5DM6 3;  2HCI A;  3HGB A;  3E5S A;  1BCP B;  5D3I B;  3SE0 A;  1GUO A;  3Q24 A;  4TKO B;  3A8I E;  4KHV A;  2AQ3 B;  1A3V A;  3J81 L;  1B50 A;  3NWT A;  1O7Y A;  2IW3 A;  4K5W A;  4ILW A;  1WTW A;  4BY7 B;  2EY1 A;  1KDB A;  4CKE A;  3S16 B;  1QB5 D;  5ELB A;  3M85 A;  4BBS B;  2Z8L A;  1SBB B;  4HCS A;  4KD4 A;  3HOY B;  1Q1E A;  3K0Y A;  4M8A A;  3T13 A;  2R3Z A;  3PUV A;  2JA7 B;  3M7G A;  1D6E C;  4O42 A;  3DWA A;  1F2M A;  1SYG A;  4XYQ A;  3MXG A;  3S14 B;  2WKC A;  4IUU A;  3RUZ A;  3R2I A;  1EQV A;  2L4N A;  1O7Z A;  4NP5 A;  4ZK9 B;  2FJ2 A;  4NDX A;  3HOX B;  5ELF A;  1K83 B;  3GTM B;  1EY9 A;  5JAV A;  4C3I B;  2M2L A;  2JYO A;  1LTT D;  1FD7 D;  3NHH A;  2WIN B;  2IPK D;  4BY1 B;  1I6V C;  5I4D A;  1WD1 A;  5I9O A;  2YU9 B;  4IUQ A;  2CHB D;  3H0G B;  5I9P A;  1LTB D;  1PFN A;  1NR4 A;  2X69 A;  5C3X A;  2AQ1 B;  1DD2 A;  5CV7 A;  3TME A;  5FO7 B;  4JK1 C;  5CGK A;  5FLX L;  3AB9 A;  1D5X C;  1KDC A;  1DCZ A;  1DYQ A;  2PO4 A;  2C5C A;  1I4H A;  3P20 A;  1EY6 A;  1CA6 A;  1PRT C;  1SNO A;  1CQF A;  1VDZ A;  2GA4 B;  4CKB A;  1HFN A;  5CV4 A;  5KYL A;  4C3J B;  1HUM A;  3HKZ B;  3FRP B;  4CKC A;  4BWG B;  2PW5 A;  5E3F A;  3C3L A;  2R7Z B;  1IW7 C;  5EGT A;  3D6W A;  5M5Y B;  4C2M B;  1ENC A;  2B2W A;  1JOK A;  3NXW A;  1HPC A;  4A3I B;  3NTI A;  3J80 E;  3PUZ A;  4C3I G;  1CK1 A;  1I4X A;  2FHT A;  3I4M B;  1EYA A;  1HXY D;  4HN7 A;  2AUJ D;  1EY8 A;  3LWU A;  2XNA C;  3FEW X;  3BZD B;  3J81 E;  1SAP A;  4FXG C;  5KIX A;  5EJW A;  1AW7 A;  3KUP A;  2KQ3 A;  1ICW A;  3MC0 B;  1JCK B;  4ABN A;  4KY5 A;  5C4X B;  1QCB D;  1DM0 B;  3WDN A;  5BN4 A;  1ML0 D;  2QIL A;  3OWE B;  2AUK A;  4FVM A;  4IZ8 A;  3X3M A;  4BA2 I;  3D3R A;  1BCP D;  2K04 A;  4XT1 B;  4C3J G;  1XXG A;  2BE5 D;  1X3P A;  1D5Z C;  4I65 A;  4FXD A;  4XQN A;  4A3G B;  2K03 A;  1ZYR D;  5JPM C;  5J39 A;  2B2U C;  4KV6 A;  2F0W A;  1J8I A;  3T4A C;  2VB2 X;  5M3M B;  3GO5 A;  1SYD A;  2WII B;  1OO9 B;  5HUR A;  3SK4 A;  2XVS A;  4RGM A;  4PQX A;  5C0X G;  1BOS A;  1Y1V B;  3VR4 A;  1RCV D;  1PZJ D;  1OXU A;  2BDO A;  5TSS A;  2DN8 A;  3R3O A;  2SDF A;  4L63 B;  1TR5 A;  1G2T A;  2Q8R E;  3FPU B;  2EY6 A;  3WOE A;  1C8C A;  2B2T C;  2A6E C;  5M5X B;  2F0E A;  3J7A F;  3R8B A;  1F2Y A;  1PTO D;  4JBW A;  1HTP A;  5C4J B;  3JAM L;  4IFD G;  3FDT A;  2H4O A;  3HOZ B;  1WTO A;  2NBF A;  1FNU A;  1TKW B;  5KGU A;  3S17 B;  2F0H A;  1JOO A;  3HRZ C;  3BDL A;  1I4R A;  3GTP B;  2E2I B;  1QNU A;  1E2Z A;  5C3E B;  4OO1 I;  5FLX E;  3IFT A;  3S1M B;  2QF7 A;  1EQT A;  5FK9 C;  1B53 A;  1EYC A;  1EFI D;  3MWY W;  2CQA A;  1AFP A;  3PMF A;  2EJF C;  2IWH A;  3MFY A;  2PQE A;  2B63 B;  1LV9 A;  2F0U A;  5LL6 S;  2F4I A;  2WAC A;  3K58 A;  1T5X D;  3OWF A;  2RDH A;  3ND9 A;  2RBM A;  4HED A;  5NUC A;  4OL7 A;  3T53 B;  1QG7 A;  3K5N A;  1TS5 A;  3FMC A;  3IAY A;  1GUW A;  1B3A A;  5AFW A;  1TWG B;  2EPB A;  1PTO C;  4RGO S;  3S1Q B;  2SEB D;  3NUC A;  4WJW A;  1Q8I A;  1DXM A;  2XIW A;  4S3S A;  3HOU B;  5KNB A;  4WRD A;  1HTL D;  1K8M A;  2A6H C;  3NTK A;  1BXT A;  3EFX D;  1EZ6 A;  3OIP A;  5EPK A;  2AWN A;  5J22 A;  2BDN A;  5G3L F;  3MXN A;  1Y8P B;  3I72 A;  2HUG A;  5M3F B;  2K7V A;  2C9O A;  3PIP 3;  2EY5 A;  4PMW A;  1Q3L A;  4OIK A;  5EKK A;  2LY7 A;  1D2B A;  3T51 B;  3E6Z X;  4KMU C;  4L8J A;  5BN5 A;  1E0B A;  4Q5V A;  4G57 A;  2NYZ D;  2PCF B;  3BVM A;  2I07 B;  1II3 A;  1X32 A;  3TP7 A;  2B2Y C;  2KCN A;  4C1N K;  1JIC A;  4X3T A;  2FMC A;  1TT2 A;  2Y0S B;  4DAY A;  3NQI A;  3L9A X;  4GZY C;  1HHV A;  5DEH A;  3SK8 A;  1EY5 A;  4Q0F A;  1S5F D;  4IUV A;  2NZ1 D;  5LL6 X;  1TVX A;  4XQJ A;  1EU4 A;  3QG1 A;  2EYJ A;  5FO9 B;  2JXM B;  3DEP A;  5M5W B;  3Q23 A;  3VR3 A;  3C2P A;  1TII D;  2VXW A;  1GUS A;  1GXD C;  3BS1 A;  1UUP A;  5I6Y A;  5EQ0 A;  2F03 A;  1T5E A;  3GV6 A;  3EQL C;  1SE3 A;  3GQB A;  5ELE A;  1HUN A;  5DAU A;  1PTO H;  4IQZ A;  1HCZ A;  5EBD A;  1IHZ A;  2PMZ B;  4IN3 A;  4DN4 M;  1M8A A;  3K5O A;  1S5E D;  4DAP A;  3FPP A;  3MVV A;  3NSW A;  4LAA A;  3JAM E;  4WOR A;  1FR3 A;  4X3K A;  4K14 A;  1F77 A;  1IKM A;  4PNY A;  3PV0 A;  3VA5 A;  4C56 C;  1ENA A;  3NTH A;  2IJ0 A;  1G91 A;  2F0V A;  1HQM C;  2FIN B;  1YNJ C;  3MHB A;  4OO1 H;  2EYL A;  3QOJ A;  1LTI D;  2XWJ B;  3I3C A;  1QOH A;  3I8Z A;  4RGN A;  5COY A;  2B8G A;  4QCL A;  1A3U A;  2K28 A;  1CI3 M;  2HDL A;  2RA4 A;  3MFG A;  3S15 B;  2F0K A;  1U4L A;  2KCC A;  3BDC A;  4XQQ A;  5C0X J;  1Y8O B;  4C3H B;  1R4Q B;  1Y1W B;  4QF4 A;  5C3W A;  3R2T A;  1MBY A;  5E4X A;  1KLG D;  2F0O A;  3I4N B;  4Y7N B;  3VYS A;  2YYZ A;  1VF5 C;  2B8F A;  1CA5 A;  1GJX A;  2KA7 A;  4CJ0 B;  3KK7 A;  2EYP A;  3C1E A;  1EL0 A;  4R8I A;  1CT1 D;  4G4K A;  3I91 A;  4RGT A;  4RKB A;  3UI2 A;  1Y8N B;  3H94 A;  1CZG A;  4IFD J;  4KKU A;  3I70 A;  3MZ5 A;  2EYO A;  4K8I A;  1OXV A;  2VUM B;  1JB3 A;  1STA A;  1GUT A;  4F87 A;  2F0J A;  2KHS A;  4H0L C;  1EY4 A;  5JEA J;  3P1H A;  3V2T A;  1RKN A;  3PUW A;  3A7L A;  2L11 A;  2OEO A;  1MSH A;  4RCN A;  1Q1B A;  2F3W A;  1EWH A;  4HSP A;  2PYK A;  5C5L A;  1BNZ A;  3SK6 A;  3N52 A;  4J6H A;  1STE A;  2J7Z A;  1EOT A;  4A3J B;  4A93 B;  1U9R A;  2Z1C A;  1PZK D;  2K5Q A;  1TY2 A;  1R4P B;  4C3H G;  3I73 A;  5I2Y A;  2VB3 X;  1WTP A;  3SHL A;  1JOQ A;  1Y69 U;  2QDB A;  3WOF A;  3S2H B;  4ULL A;  5CR3 A;  4YIJ A;  5JOB A;  5JVH 3;  2XRQ D;  4TRD A;  2R92 B;  1ESR A;  1I4G A;  2RDG A;  5I6W A;  3K7A B;  3QB3 A;  3MTS A;  3NBI A;  1SYE A;  1SJE D;  3PO3 B;  4H7B A;  1J9O A;  1KAB A;  1BDO A;  3BVZ A;  4O1N A;  3DM1 A;  2MGS A;  1L0Y B;  1KAA A;  2CW0 D;  4J8Q A;  4K6L A;  2E76 C;  2TSS A;  2DY8 A;  4XTC S;  2ZXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...