1J5EQ

Structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
104
structure length
104
Chain Sequence
b'PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Structure of the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 20
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2002-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1j5eQ00
5FLXc 3RLNA 3CCUA 3PIPA 1YJNA 1VQNA 4A3CH 4DR7L 1C0AA 1PYSB 3TQYA 3CMAA 3UDIA 3F8TA 2RF4A 2H5XA 3U50C 5IY0A 1EQRA 1GVPA 3D0FA 4JBJA 4GOPC 5GQOA 1JB7A 1N32Q 3TRZA 1XMQQ 5J3BA 3H15A 3F2CA 2OQKA 5BR8Q 3PV0A 3M4PA 3I4OA 4GLAC 2PMZE 3M85A 4LF4L 4AH6A 4JCVE 2VS1A 1S3OA 4YWKA 1FGUA 4LF9L 3KOJA 2CQOA 1XPOA 4DR7Q 2UUAL 4QGUA 4LF8Q 4BA2I 4BXXH 3RNUA 4X62Q 1O7IA 2JA8H 3PO2G 5EAYA 3PF4A 5IWAL 2YTVA 3M9BA 3RZDH 1MJCA 4JI2Q 4HIOA 4GLVB 3E9IA 1IL2A 3S14H 1H95A 2LXKA 4NXNQ 1VQEA 2YYZA 3HOYG 1X3GA 2RHSB 1WCMH 3RLOA 3HOXH 4UP8A 4X64Q 2F3IA 1JJ2A 1QUQA 2VL6A 1MKHA 3M7NA 1KRSA 5IWAQ 4MTNA 3L0OA 2ASBA 3HOUH 2PQAB 1NMFA 3STBC 2JA5H 1LTLA 2UUCL 1EOVA 1S40A 3S1RH 1HNXL 4LF6L 4JI4Q 3W1GA 3OYYA 3NEMA 2L15A 4YCWA 2Q2IA 1HZ9A 4KHPL 3GTOH 1VQLA 4IFDJ 3CCVA 4PMWA 1L2FA 1E1OA 4IFDI 3KJOA 4P75A 2UXDL 4GOPB 1YI2A 4HIKA 3GTPH 2UUCQ 4LF6Q 1HNXQ 1AE3A 1LYLA 1Q46A 1VQ8A 1MJEA 1PH6A 3EN2A 4DR6Q 3UDFA 1IBLL 1VQKA 3K7UC 2JQOA 2Z6KA 4KHPQ 5DLQE 4X65Q 3CC7A 2NZHA 4NB3A 4BY1H 4LFAL 4NXML 1X55A 4DV5L 3I4MH 2VNUD 4A3DG 2UXDQ 5LMUQ 1HZCA 1X3FA 5GAGC 5JJKA 2F52A 4R4OA 1OXXK 3MXNB 3BZCA 1VQMA 1P16A 1PH5A 1KD1C 1JJCB 1N9WA 1HR0L 3Q8DA 1IBLQ 4A3FG 4JBKA 1BKBA 1EYGA 4A3GH 4UY8C 1A62A 3T1YL 4OONA 4JOIC 4LFAQ 4OWTB 3I4NH 1PH3A 2LSSA 1NTGA 1J5EL 2N3SA 4K0KQ 3HOVG 1HR0W 1X56A 2RHQB 5C4XH 2R7ZH 1E24A 4EX5A 3CCLA 1HR0Q 2E2IH 3J81j 4YCVA 3H0GH 5C44H 5M5WH 2B63G 2AWNA 2F4VL 2K75A 1JJGA 3AYHB 3J81i 2D0PA 3J81c 1YJ9A 2JA9A 4B3RL 2AKWB 2DGYA 1XPRA 4A4IA 1QVFA 1D7QA 2XTIA 4POFA 1PH2A 4BBSG 1E1TA 2NVTH 2E2JH 4LFCL 5JJIA 4RG1A 1IZ6A 4AIMA 4DK6C 3UDGA 4DKAC 3BU2A 3UE0A 1OXVA 1YBYA 5IYBH 1CKNA 1YHAA 3KDFB 1HNZL 1VS0A 3CCRA 2IHEA 4B3RQ 4LF5L 3NBHB 2ZJPA 3RN2A 1VQDA 4LFCQ 1X54A 3T1HL 4XIGS 4KI0A 3SGIA 4DV2L 3KLWA 2WP8J 4YCUA 3LGJA 2ZJQA 1XNQL 2BA0A 3PIOA 1I94Q 4EQ5A 1Z9FA 3JAMi 4P72A 3JAMc 4LF5Q 2IHFA 3AFPA 4PZ7A 2QEXA 3DLLA 4GKKQ 3CC2A 3S1MH 3CAMA 4B3TL 3GTQH 3FKIG 1I6HH 1SR3A 2B3GA 3T1HQ 4DV2Q 5M3FH 1NBWA 4C3HH 1K0RA 5IP7H 4A3LH 1X3EA 4OO1G 5FJ8G 3KF6A 4IPHA 4A3MG 3KF8B 4JI5Q 3F2BA 1S72A 4A93G 3HOWH 1A0IA 4IO9A 2R93H 2OTLA 4B3TQ 4GKJL 4H02A 2N8NA 1E3PA 4KLKA 4OWXB 4POGA 1RL2A 4A3IH 4JC0A 1OTCA 1KXLA 2K52A 1N8RC 3CCMA 4J15A 3KFUA 2HHHL 2MNAA 2AHOB 1HZAA 3KYHC 3ULLA 3I55A 3BJUA 3F2DA 1IBKL 3GTMH 1PH4A 3RZOH 2R6GA 2A1AA 2KCMA 1KL9A 2N49A 4GN5A 1TWCH 1WFQA 1K9MC 1EIFA 4A3BH 1QUQB 4UPAA 4GKJQ 2ZTCA 4OX9L 1B7YB 3S2DH 4BY7G 2R92G 2I5HA 3CCSA 2HHHQ 1VQCA 3PUXA 3TS0A 3CD6A 1QVCA 1VQBA 1WYDA 4HJ7A 1Y1WG 1QVGA 1GD7A 3H3VI 2K5VA 2K5HA 1D8LA 2EIFA 4DR3L 1G291 3CCQA 3ZJYC 2WAQE 2A8VA 4HJAA 2BH8A 3RN5A 3CP0A 4OO1I 4LF4Q 1YVCA 3FHWA 4YWLA 4DV1L 2CCZA 4LF9Q 3PO2H 4DAMA 4Y7NH 2YTYA 4IOCA 2IX0A 2N78A 5C3EG 1K73C 2UUAQ 1G6PA 1VQHA 3CMEA 1BVSA 1SRUA 3W1BA 3HKZE 1EIYB 3VDYA 5IP9G 1L1OA 2JA6G 1HNWL 3HOYH 2V1CC 2B29A 4DV6L 3I7FA 4DR3Q 5IT9c 3M4QA 4YHHL 2HIXA 1E7ZA 4DUYL 1VQ6A 4C3JH 3HOXG 4GLXA 4A3EG 3S17H 2E5LL 4XTCS 1VQIA 2UXCL 1G51A 4A3KG 3U4ZA 1SFOH 4QIWE 1FJGL 1V9PA 2MFIA 4DV6Q 1GKHA 2Q2TA 1AE2A 2JE6I 4YHHQ 2I5LX 3EBEA 2R7DA 3KJPA 1QZHA 3S2HH 2MO1A 4KHZA 3PCOB 2E8GA 2ZM6L 4AQYL 4ALPA 5AJ3L 1QZGA 3I56A 1YZ6A 2IY5B 3HFZB 3PSIA 4BBRG 1VQFA 1KRTA 2D62A 4AYBE 3J7ZC 2R7FA 4HJ5A 2ALYB 5IYDG 2UXBL 1UE1A 1J6QA 4UP7A 2PNHA 5M3MH 2ZM6Q 4AQYQ 2OWOA 1I5FA 5AJ3Q 4DAYB 4HJ9A 1PH7A 1HH2P 1NMGA 4JI7L 3HOZG 4A3DH 1LUZA 2VY3A 4LUZA 2UUBL 2ATWA 4NXMQ 4DV5Q 3GDEA 1CKNB 1KQSA 3CF5A 4JI3L 1MIUA 4O0AA 3ULJA 1OXUA 4A3FH 1YEZA 4L5QA 4LUVA 1C9OA 3CCEA 3ERSX 1UE6A 3TREA 4JI7Q 3T1YQ 4JBMA 2KHIA 1M1KC 2UUBQ 4DV7L 1K83H 4JI3Q 3HOVH 1Q7YC 1PVOA 4HJ8A 1J5EQ 3G48A 4DR4L 2WAQG 2B63H 1FVIA 3PO3H 4GOPA 1W3SA 1JMCA 4DR1L 3GO5A 2I5MX 2Q2HA 4DV4L 4GN3B 3U58A 3OTOL 2F4VQ 2MO0A 1SE8A 3S15H 5K36G 4X6AH 1P8LA 4LF7L 3HKZG 4P74A 4DV7Q 1XTDA 5FLMG 1N33L 4BBSH 2MQHA 3GTGH 3TS2A 1N34L 4B3SL 2JA7G 1ASZA 2I0QA 1NE3A 3S1QH 1XMOL 5IYCG 2QGQA 1LM0A 3S24A 4DR1Q 1YNXA 1W2BA 3GTKH 4DV4Q 1K8AC 3CQZH 1HNZQ 1SLJA 2K14A 1TWFH 1WI5A 4QL5A 3OTOQ 1YHQA 1N36L 3CXCA 1I3QH 4LFBL 2VUMG 1B8AA 1N33Q 2DUDA 3I2ZA 3L7ZC 3PUZA 4PZ8A 3STBD 1VQAA 2WFWA 1EFWA 4P71A 1U5KA 5H1SE 4X66L 2JJQA 1K8GA 3S1NH 2GN5A 1VQ9A 5M5YH 1XNQQ 4DV3L 3GTLH 4APVA 1BBUA 2D0OA 1N36Q 1EQQA 3ICEA 4A3JH 5GADC 3K81C 2ID0A 1VQPA 1U0LA 1V43A 1Q81C 3FKIH 1Q82C 1Y1VG 1CSQA 1RIPA 2JEBI 2KENA 2Z6KC 5LMNL 1XPUA 3H3VH 1IYJB 2K50A 1UWVA 5C0XG 3HKSA 2QA4A 1UEBA 5FJ8H 2C35B 4IJHA 4R4CA 4A3MH 4DV3Q 1A8VA 2Z0SA 4A93H 1TXYA 5LMNW 3KDFA 4DV0L 3AFQA 5LMNQ 1OXTA 1SN8A 4GN4B 4IPDA 4JI0L 1X9NA 1X65A 1PH1A 3K7AH 3NENA 1HJPA 4IPCA 3GTJH 1M90C 4A3CG 4C2MH 2UU9L 1VQOA 1Q12A 1N32L 4DV0Q 1IBKQ 1B70B 4HIDA 1KC8C 1KHIA 4A3BG 4BY7H 2R92H 4OX9Q 4JOIA 1AH9A 1EWIA 3NELA 2A19A 4DR5L 3FP9A 4GS3A 2BH2A 2OCEA 4LF8L 4JBWA 2IX1A 1IBML 4X62L 2UU9Q 2NZOA 2OQ0A 3OW2A 4RMFA 1Y1WH 4B3ML 4BXXG 4IFDG 1IXRA 4Y52H 2JA8G 4JI2L 1PYBA 3DM3A 5C0XJ 5HGQA 1V1QA 4QJFA 4GNXA 2VQEL 3BZKA 4NXNL 5C0XI 2HIVA 3CPWA 4DR5Q 4X64L 5HY6A 1ASYA 4LWCA 5C3EH 1WCMG 1IBMQ 4DV1Q 2CWAA 4TVAB 4B3MQ 1HZBA 3RR5A 2KCTA 4O2DA 5IP9H 3A74A 1CUKA 3PGZA 1EUJA 1NJIC 2JA6H 1R9TH 2VZAA 3HOUG 2Q2UA 2VQEQ 4ME3A 1E22A 4IJLA 2JA5G 4JI4L 1HNWQ 4A3EH 3ER0A 3W5OA 4DUYQ 1VCIA 1C7YA 1GO3E 4A3KH 2EXDA 3F1ZA 2E5LQ 2UXCQ 1DGSA 3D31A 2LXJA 4A76A 1YJWA 2ES2A 1FJGQ 1YITA 1VQGA 1Q1BA 4DR6L 1TWAH 4OXPA 4C3IH 3K80C 1WJJA 4L5TA 1UE5A 2YTXA 2AWOA 4BBRH 4X65L 4NPSA 1SROA 3A5ZB 5GROA 2AMCB 2YU9H 1PFSA 1BBWA 2BA1A 1YIJA 2Y0SE 3CCJA 3I4MG 5LMUL 3PF5A 5IYDH 4BY1G 2JK8A 2WB1E 1JT8A 4IOAA 3WWVA 1A63A 2UXBQ 4UP9A 2PQAA 4JI1L 2YV5A 1PH8A 1SMXA 4A75A 4BA1I 1Z47A 3HOZH 4HIMA 5M3MG 2VQFL 4IPGA 1VQ7A 4JV5L 4A3GG 4JI8L 4QY7A 4MZ9A 1CKMA 3JC66 4JG2A 2CKZB 1XJVA 4L5SA 4LNQA 3I4NG 4K0KL 2IT1A 1UE7A 4JI1Q 3E0EA 3E9HA 5C4XG 2R7ZG 2VQFQ 3A0JA 4JV5Q 1PH9A 3H0GG 5C44G 3G71A 3M4OH 2KBNA 2PI2E 4JI8Q 2KHJA 3PUYA 3EIVA 5ELOA 2K4KA 4R4IA 4JI6L 3KF6B 1T9HA 1X6OA 4R4TA 3UDXA 3RLFA 2GVBA 3PUWA 4L5RC 4DR4Q 3PO3G 4GNXC 3A5UA 1L1OC 5ELNA 4P73A 5JEAG 5IYBG 2RCNA 4LUOA 2NN6G 2ZTDA 4MNOA 5FLMH 1PA6A 5GAHC 3K8AA 3TEHB 2FXQA 2K5NA 2JA7H 4DNIA 4LF7Q 3MEFA 1TWGH 4FDBA 5C4JH 1Q86C 4YWMA 4JI6Q 4R4QA 5IYCH 1N34Q 3L2PA 4B3SQ 2XGTA 4R1JA 1XMOQ 3M3YH 4PG3A 4DPGA 4OWWB 3K0XA 1OXSC 1I94L 1YHBA 2VUMH 1CKOA 2PI2A 1I50H 2NVXH 1VQJA 4GKKL 1K3RA 2GVAA 3ULPA 4AYBG 4LFBQ 3AQQA 4LW1A 1KIXA 4DR2L 3CC4A 4TQUS 3IRBA 1GM5A 4QQBX 2OTJA 4DUZL 3GD7A 4X66Q 1XNRL 4YY3L 4JYAL 2E2HH 2CWPA 4WJ4A 5M3FG 1Q1EA 1Y14B 3PUVA 5IP7G 2ZTEA 1CSPA 4JI5L 4A3LG 1TWHH 1Q8KA 2EQSA 1FL0A 1VQ4A 1Y1VH 2CFMA 3CPFA 4A3JG 2Y0SG 2HT1A 3G6EA 4DK3C 4DR2Q 2WB1G 2NVYH 4DUZQ 3HOWG 3S16H 2NVQH 2R93G 2HQLA 1XNRQ 1NY4A 3CW2C 5JEAJ 3U4VA 4YY3Q 5M5XH 1JE5A 3G4SA 5E7NA 3UE1A 1PV4A 1VQ5A 2JEAI 4JYAQ 2NN6I 4A3IG 5GAEC 4GNXB 5JJLA 1L1OB 3J80i 1WOCA 3J80c 2ZJRA 1KAWA 5IE8A 3AEVA 3B6YA 4PZ6A 1XMQL 1L0WA 4WJ3M 3J7A5 1PHJA 2VW9A 5BR8L 4JI0Q
chains in the Genus database with same CATH superfamily
5FLXc 1VQNA 2B2UA 4ZCKA 1CT1D 1PYSB 4DU9A 5EKKA 1O7YA 2TSSA 4M1UB 2BOSA 5IT9L 1CZWA 1EQRA 1GVPA 2IY5B 2SOBA 5C4XB 5J3BA 3H15A 2OQKA 5CV8A 3M4PA 4GLAC 2PMZE 2VS1A 2CQOA 1XPOA 4QGUA 1O80A 3D4RA 3CRKC 5IWAL 4PQXA 3VA5A 4HIOA 1H9SB 1IL2A 4Z9CB 4NXNQ 3I73A 1WCMH 4LMQD 4DK0A 1B53A 1ENAA 1QUQA 5EBCA 5IWAQ 4XT3B 2ASBA 5IGBA 1LTLA 2K33A 3S1RH 1HNXL 3D3RA 3KBXA 2XIWA 5KNDA 2L15A 4IFDJ 4PMWA 1L2FA 3S9WA 1E1OA 4IFDI 1IW7C 3KJOA 4HIKA 3GTPH 1HNXQ 1AE3A 1K28A 1VQ8A 1G2TA 1PH6A 3UDFA 1IBLL 5JPNC 5G3LD 3EFXD 3I4MH 1KDAA 2NZHA 4BY1H 4KKTA 4A3DG 1R4PB 5CYUA 1HZCA 4C56C 3MXNB 3Q23A 2B39A 1HR0L 1IBLQ 4U68A 4A3FG 1TS3A 1TWCB 3T1YL 1PFBA 4A3BB 4JOIC 2O2LD 5LL6X 5C5LA 2LSSA 1SYCA 1HR0W 1CM9A 4EX5A 1HR0Q 3RUZA 2E2IH 5M5WH 1LTGD 3D4WA 3J81i 1TIID 2D0PA 3J81c 4B3RL 1QVFA 4IALA 4POFA 3NWSA 1B9NA 3K5MA 4DKAC 3UE0A 1CKNA 2NN6H 2JA5B 4B3RQ 1ESFA 4I7ZC 4IUVA 1VQDA 3SK4A 1EL0A 3QOLA 4C3JB 3SGIA 4OL7A 3KLWA 2WP8J 1F9RA 3AFPA 4PZ7A 4ZK9B 3S2HB 3GTQH 2K32A 1I6HH 1PTOD 1SR3A 2FINB 1NBWA 4L6TB 1X3EA 4UHVA 4OO1G 3KF6A 1TU2B 3R8BA 3KF8B 4O1NA 1T5EA 4A93G 2B2VA 1A0IA 4IO9A 2R93H 4H02A 4KLKA 3X3NA 4IUQA 1DOKA 4POGA 4A3GB 1PXUA 4A3IH 5I9OA 2K52A 3CCMA 5ELDA 2ZT9C 3A56A 3RD4A 1HUMA 2KCMA 5KEEA 2R7ZB 3VYUA 2E2DC 3Q6SA 1B7YB 5EGTA 4BY7G 2R92G 5K5PA 2I5HA 1TR5A 1SE3A 5F2DA 2D9UA 5IODA 3HOVB 2EYFA 4IFDH 1WYDA 1QVGA 3PO3B 1DJRD 2G5DA 3BDLA 3VR5A 2KEDA 1D8LA 3CCQA 1MI2A 5C4ZA 4DV1L 2CCZA 4BBSB 4LF9Q 4IOCA 2IX0A 1K73C 5I6YA 5C3EG 1JORA 1BVSA 3L3OC 1EIYB 2A68D 4DV6L 3I7FA 4YHHL 1VQ6A 4DUYL 1SYFA 4CDCC 1M4VA 1QOHA 2E5LL 1STYA 3TP8A 1SFOH 4F7XA 4QIWE 3S1MB 1GJXA 3TN2A 3MAQA 1V9PA 3C3LA 4DV6Q 2A73B 1GKHA 1AE2A 4G57A 4YHHQ 1D1IA 1BQQT 4HCSA 1QZHA 1BCPB 2LFNA 4C3IG 5A35A 1HRJA 2PZWA 1VQFA 5ISRA 4FXKC 3VYSA 4DF7A 1FYCA 1HA6A 4WJWA 1LTTD 4Q5VA 2DNEA 2KHSA 3ONAB 1JWUD 1I5FA 3EVQA 4DAYB 4RHRA 4LUZA 1JC7A 1NNXA 2B2UC 2UUBL 2ATWA 4NXMQ 3GDEA 1GHJA 4JI3L 3S2DB 4BS9A 5CMDA 2HQEA 1DZ1A 3ERSX 4EVOA 2UUBQ 4DV7L 1K83H 4JI3Q 1Q7YC 1T5XD 1GUWA 4RGNA 2B63H 1O78A 4K14A 2EYJA 4Y7NB 1JMCA 3TDQA 3U58A 3OTOL 1EEFD 1DD2A 3S15H 4X6AH 2HCIA 4DV7Q 2EYOA 2KECA 1F2ZA 1N34L 4B3SL 2JA7G 2I0QA 1NE3A 1X3QA 1H9MA 2RVLA 1HNZQ 4KJOA 2K14A 3OTOQ 4QL5A 1R9TB 1PRTF 1N36L 3P75A 1I3QH 3OWEB 1C48A 1B8AA 1QCBD 2B2TC 2DUDA 4HMIA 1JOQA 1VQAA 3URYA 5H1SE 4X66L 1CI3M 3S1NH 1PRTC 1N36Q 1SYGA 1F2MA 4XQJA 3C46A 3FKIH 3GV6A 1U4MA 5LMNL 2JEBI 3I90A 1IYJB 4O42A 4ZLTF 1UUPA 5C0XG 3HKSA 1UEBA 1QILA 4IJHA 4A3MH 4A3DB 2Z0SA 5LMNW 1WD1A 5LMNQ 1SN8A 4GN4B 3J80E 1X65A 1PH1A 4FVMA 4IPCA 1YNJD 4HR7B 3I3CA 3T53B 1K3BC 2PMZB 4R9WA 4RGMA 5HGTA 5D65A 4OX9Q 1SMYD 1LTBD 3NELA 4DR5L 2A19A 1ZXTA 4OIJA 3MVVA 4JVZA 5FK9C 1IBML 4LF8L 2NZOA 1STBA 5CV6A 4IFDG 1PYBA 1STHA 5EQ0A 5HGQA 4QF4A 4QJFA 3HEJA 3CQZB 5EBDA 4DR5Q 4ZYSA 1HTLD 1TWFB 4QUCA 1ASYA 1IBMQ 1SNCA 1WTHA 4IN3A 3RR5A 1KXLA 5IP9H 3PGZA 1NJIC 5A2QE 1WVLA 1Q3LA 1E22A 1HNWQ 3N6RA 4G7OC 3GTLB 3W5OA 3T13A 2HUGA 1I50B 2AUJD 2K6AA 1VCIA 1GO3E 2NVXB 4A3KH 1STNA 4XQQA 5IGEA 4A76A 2ES2A 1Q1BA 4N8X1 1WTVA 1F9PA 2DY7A 5COYA 1RD9D 3TMEA 4ID6A 2B2VC 2B2WA 4A93B 2AWOA 4BBRH 4RH6A 2RDFA 3S16B 2BA1A 5IYDH 2L9HA 2WB1E 3TSSA 2KQ3A 1E2WA 1DOLA 2M2LA 4OEMB 4IPGA 1VQ7A 2ENBA 4DAVA 2EJMA 4JI8L 3JC66 4JG2A 2R92B 2KUMA 3MEHA 1SYEA 1QG7A 1HTPA 1OO9B 5C4XG 1BCPD 1RTNA 5C44G 3M4OH 4JI8Q 2KHJA 2K01A 3E6ZX 2DY8A 2MHVA 2I07B 1EQTA 4R4TA 2GVBA 1SYDA 1KTKA 3MTSA 1AFPA 5IYBG 2F0NA 2M00A 4MNOA 5FLMH 1DOMA 5GAHC 4KN4C 3TEHB 3C2PA 1WCMB 2Z4HA 4B08A 5C4JH 1TKWB 2IPKD 4YWMA 2L5TA 5DEHA 1W6KA 4R1JA 5J1ZA 4OWWB 1Z7TA 1OXSC 1YHBA 2VUMH 1CKOA 4DNRB 3EROA 5KIXA 1NCVA 1VQJA 1K3RA 2GVAA 4CJ1B 3LWUA 2KA7A 3CC4A 2OEOA 2HDLA 4QQBX 2OTJA 4C3IB 3D8GA 3JAME 2L0CA 2E2HH 3E0JA 1CSPA 5IP7G 1TWHH 2EQSA 3DEPA 5AFWA 3GTPB 3E5SA 2A6HC 3I4LA 2WB1G 2NVQH 4KMUC 2Z9HA 3MXUA 5JEAJ 5M5XH 3I4MB 3UE1A 1EWHA 4I7AA 4GNXB 1K8OA 1L1OB 4LAAA 3FDTA 3J80i 1WOCA 2L12A 3J80c 1KAWA 4DFAA 3AEVA 1XMQL 3I72A 4WJ3M 1PHJA 2F0SA 5CR3A 4JI0Q 3K59A 3DEOA 4BWGB 1S5ED 4EQNA 3CMAA 3F8TA 2F0PA 3D0FA 4KN7C 1N32Q 5IGCA 2A74C 3A7AB 4CKBA 1JQYD 3VA7A 1XMQQ 4CHTB 2E2IB 4XT1B 5M5WB 3I4OA 1DM0B 4LF4L 4AH6A 1S3OA 1GUGA 4YWKA 1BNZA 2UUAL 2EYHA 2JA7B 3KUPA 2JA8H 2OXPA 1TWGB 3PF4A 4ZKBB 1TS5A 2YTVA 1MJCA 4JI2Q 1HQMC 3E9IA 4GLVB 1IKLA 1VQEA 2KEEA 4UP8A 4QIWB 1W6JA 1XWEA 2K04A 2XRQD 1HXYD 1MKHA 2M9VA 4C3JG 3K5LA 1E0BA 3L0OA 3HOUH 2PQAB 2X69A 4DXFA 2UUCL 1S40A 4JI4Q 2J7ZA 3FEWX 4F87A 2L1BA 2Q2IA 1HZ9A 1LABA 1GUTA 3OPOA 4M8AA 1JCKB 3GQBA 2NVYB 4GOPB 1YI2A 4H0LC 2UUCQ 3P1HA 1LYLA 1Q46A 4LK1C 3EN2A 1KLGD 1VQKA 3K7UC 3OW7A 2QEJC 1MHWC 4X65Q 1X55A 2N88A 4DV5L 1IYUA 4ZKCB 4A3IB 1X3FA 1PH5A 1P16A 2CVRA 2WIIB 1JJCB 4IUUA 1KD1C 2F0IA 3ITPA 4OONA 2O5JC 5IOCA 3I4NH 1SNOA 1U9RA 1ZYRC 1E2VA 1PH3A 3BVZA 3C1EA 4S3SA 2C9OA 4K0KQ 3HOVG 2WINB 1PTOB 1E24A 4IZ8A 3VR4A 2F4VL 4U673 2K75A 1JJGA 2PYKA 2A5HA 3AYHB 3RZDB 5C6AA 2JA9A 1D7QA 4A4IA 2F0HA 2XTIA 1HUNA 1EIHA 4BBSG 1E1TA 4RA8A 4LFCL 3VYRA 2KJXA 5JEAH 1EOTA 3KDFB 4I65A 3J7AV 1AEXA 2PZTA 3NBHB 5BN5A 4LFCQ 1SJHD 3H94A 3A7LA 4XIGS 2ZXOA 3LGJA 1V1PA 3NUCA 1BO0A 1F9SA 3EA6A 4EQ5A 3JAMi 3JAMc 4RWSC 2C5CA 3R2TA 4PMCA 3DLLA 2B2WC 5JAVA 4GKKQ 1QE6A 5M3FH 1TY0A 1ICFB 1K0RA 4N9TA 4C3HH 1EZ8A 3SEBA 4DA2A 4IPHA 2BE5C 1KLUD 4JI5Q 3F2BA 4GKJL 1E3PA 1WTXA 1HFGA 2DJFC 1U4RA 3SXHA 4HCEA 4J15A 1N8RC 2AHOB 1HZAA 1S4ZA 3KYHC 3BJUA 3RZOH 2R6GA 1KL9A 1K9MC 1II3A 4YIJA 2E75C 1QUQB 4UPAA 4GKJQ 3R93A 4C1NK 5C44B 1EEID 3SVMA 2MP1A 3PUXA 3TS0A 1K83B 1K8MA 1VQBA 2B63B 4NKLA 3H3VI 3PQIA 2EIFA 2A8VA 1AZPA 2WAQE 2BH8A 3CP0A 1YVCA 2PW7A 1I4XA 2E74C 3PO2H 1DCZA 2X6GA 2YTYA 3CMEA 2RDHA 1PFNA 2V1CC 2B29A 3HOYH 1NUCA 3CRLC 2HIXA 2KCCA 2B2TA 4L63B 4RKLA 1AW7A 5BN4A 2F0JA 3S17H 4XTCS 3MZ5A 4HMJA 1B9MA 2D2CC 1FJGL 3S1NB 4NMZA 2JE6I 4OHJA 4X3KA 3KJPA 1FNVA 2MO1A 4AQYL 2LS01 2WB1B 2D62A 4AYBE 2JYOA 2R7FA 2ALYB 2NBFA 4HAEA 4A3MB 3HG9A 1UE1A 2PNHA 1H9SA 3SR1A 5M3MH 3BYTB 4AQYQ 1HH2P 1NMGA 2VY3A 1CKNB 1KQSA 1MIUA 4O0AA 1ICWA 3OMCA 3ULJA 1OXUA 4L5QA 1C9OA 1D6EC 2H4OA 3T1YQ 2KHIA 5FKAC 3W3AA 4DR4L 2WAQG 1O7LA 5EPKA 5T1GA 4DR1L 2QW7A 2I5MX 4CGYB 2Z1CA 4R8NA 1SE8A 2NTTA 5K36G 2BDOA 4P74A 1XTDA 2A6ED 2MQHA 4MTKA 5CV4A 1CHQD 3Q22A 3S1QH 1RTOA 2F03A 3FPPA 2EPBA 1LM0A 1PDQA 4DR1Q 1YNXA 1FNWA 2F3WA 2K28A 1K8AC 1PLFA 1WI5A 2JXMB 5ELCA 3MXNA 3DUZA 3MWYW 2K1BA 2FMCA 1Q90A 3L7ZC 3STBD 4P71A 1QNKA 4A3KB 1K8GA 3M4YA 1BBXC 2GN5A 2RSOA 1VQ9A 1BBUA 1EQVA 2D0OA 1EQQA 5G3LF 1PYWD 2ID0A 1U0LA 3HS0C 1Q81C 3TP6A 1Y1VG 3H3VH 1RIPA 2F1MA 1NSNS 1KNAA 4BBRB 2QA4A 3K0YA 4HTHA 2LY7A 5FJ8H 3OMGA 1EYCA 1L0XB 1A8VA 1SBBB 2ICEC 4L8JA 2K5QA 4DV0L 1RF2D 1OXTA 4N9PA 2O4XA 2RSNA 4B9WA 1X9NA 3QR8A 3K7AH 3NENA 2H1EA 1HJPA 3OIQA 3GTJH 1M90C 4C2MH 2UU9L 3F2UA 4RCNA 3H3VC 4UAIA 2XVSA 4DV0Q 4KJNA 4HIDA 1KC8C 4TKOB 5CV5A 2F0OA 4FYDA 1EWIA 2SEBD 3FP9A 1MSGA 2EDGA 4X62L 2UU9Q 4ABNA 2OQ0A 5J22A 1Y1WH 3GTGB 1IXRA 5ELFA 2NYZD 3KF8A 1VDZA 1JE4A 1ILPA 3BZKA 3GTKB 1S5FD 1IL8A 3HKZB 4X64L 4HEDA 1WCMG 2R3ZA 4DV1Q 3A55A 4TVAB 1KDCA 3LX0A 2WKDA 2JA6H 1EUJA 2VZAA 4A3EH 3HRZC 1A6XA 4DUYQ 1AZQA 2EXDA 2E5LQ 3D31A 1SDFA 2EYMA 1C8CA 1VQGA 2Q8RE 3T4AC 4G4KA 4DR6L 1Y8NB 1TWAH 1SNMA 3NTIA 4L5TA 1UE5A 5I9PA 2YTXA 5DAUA 2AMCB 5CORA 1YIJA 3SE0A 2Y0SE 3I4MG 5LMUL 5M5XB 4BY1G 2JK8A 4UP9A 4A75A 3HOZH 5M3MG 2E76C 3NBIA 1VMPA 5ELBA 4QY7A 1CKMA 2L55A 4LNQA 4ZUJA 3CHBD 4JPBW 1SNDA 4KD3A 1A2UA 3GP7A 2EY5A 3E0EA 3SK5A 3G71A 2PI2E 3PUYA 5ELOA 2K4KA 1EZ6A 1T9HA 1TS4A 3RLFA 3PMFA 4RFBA 4DGZA 4P73A 4TRDA 2KOLA 2Z4IA 2JN4A 2NN6G 1PA6A 5EPLA 3K8AA 3D6CA 2K5NA 4DAYA 1XXGA 4KY7A 1VF7A 5IYCH 1N34Q 2IX3A 4B3SQ 1GOZA 1H9RA 1GUNA 5L37A 3BDOA 1I94L 3BDCA 1DXMA 3QB3A 1CHPD 3KLSX 5LL6S 3ULPA 4DN4M 3AQQA 2J0TD 3OHXC 4ZAIA 4DR2L 3IRBA 1LT6D 4DUZL 5IGDA 4X66Q 4YY3L 3J7AF 1A3TA 1Q8KA 5CC4A 2K03A 2D5DA 2IJ0A 2Y0SG 1NR2A 1EY8A 2DNCA 4DR2Q 4DUZQ 2R61A 2R93G 2HQLA 3G6JB 3CW2C 3U4VA 4YY3Q 2RKSA 3G4SA 1D1KA 1PV4A 2SDFA 3D4DA 4A3IG 2ZJRA 5IE8A 4J6HA 4PZ6A 1L0WA 3J7A5 4CBVA 5BR8L 3RLNA 3PIPA 4A3CH 1SE4A 4LJZC 1BOSA 2NUCA 1NAPA 3TQYA 3UDIA 1CTMA 3NP8A 2WAQB 1SNPA 3F2CA 5FO9B 2EY6A 3O13A 5BR8Q 3PV0A 3M85A 4JK1C 3TP7A 1B2TA 1RJTA 2F0GA 4LF8Q 4BXXH 3RNUA 2DN8A 5EAYA 3Q24A 3HZXA 2EE1A 3M9BA 5M9OA 3VR3A 2CQAA 4CJ0B 2YYZA 3RLOA 3NPPA 3HOXH 2ZXPA 2B2YA 2F3IA 1JJ2A 2EOTA 5IT9E 1CZGA 3M7NA 1KRSA 3KK7A 4MTNA 3NHHA 2JA5H 3RMHA 1EU3A 5J39A 1EOVA 1KDBA 3W1GA 4IUPA 4AYBB 1Y1VB 3OOCA 2F0TA 3GTOH 1VQLA 3DWPA 3CCVA 1AN8A 4X3SA 2QCPX 1SJED 1ET9A 2UXDL 5M3FB 1EY9A 4UDUC 4XYQA 1XX8A 1MJEA 1WTOA 2K5DA 1Z6HA 2Z6KA 5DLQE 3CC7A 1RKNA 4OGQC 2A6HD 2UXDQ 4R4OA 3IFDA 1TY2A 2V4DA 3DM1A 1N9WA 3RZOB 4JBKA 4A3GH 1A62A 3BVMA 4F8MA 2EZVA 5JJZA 3NQTA 1NTGA 1J5EL 1YNNC 2RHQB 2R7ZH 1EYAA 3CCLA 3J81j 2B63G 3H0GH 4XDXA 3IL8A 4EQOA 2TMPA 2XN9C 2AKWB 1XPRA 5FO8B 1SAPA 1LT3D 2NVTH 2E2JH 1D5MC 1JOKA 4K6DA 1IZ6A 4DK6C 3UDGA 2KVMA 3DWQA 3BU2A 4RGOS 1YBYA 4X3TA 5KNCA 3PIP3 1SXTA 5E3FA 1IYVA 1VS0A 3CCRA 2IHEA 5IGFA 2ZJPA 3RN2A 3S1RB 4DV2L 4KI0A 4CDEC 1HQRD 1XNQL 4WORA 1R4QB 3A8JE 1Z9FA 4P72A 2IHFA 3KLSA 3IFTA 3CC2A 1BXTA 3S1MH 3CAMA 4B3TL 3FKIG 3L9AX 4FXGC 1PMRA 1X3PA 4DV2Q 4A3LH 4BY1B 4A3MG 4P2CB 4ZQ3A 1ZEQX 4FP5D 3MC0B 1EU4A 3HOWH 4B3TQ 5M3MB 3TZUA 3LWEA 2N8NA 4OWXB 2G9HD 4FF3A 1LLRD 4JC0A 1OTCA 4DXGA 3KFUA 5T1IA 2MNAA 1A3UA 1BCPF 2LMCB 3I55A 3F2DA 1IBKL 3GTMH 3ND9A 4GN5A 2N49A 4ME5A 5CV7A 2IWHA 1I4GA 1QJOA 4WRDA 4OIKA 3S2DH 1BCPC 3CCSA 3K57A 1VQCA 3CD6A 1ZKOA 1ONLA 3AB9A 4K2KA 2K5WA 1QVCA 1LTSD 4HJ7A 1G2SA 3FMCA 1PZKD 3NK9A 2Z6BA 1U4LA 2QKIC 3RN5A 4OO1I 4LF4Q 4YWLA 1J8IA 2F0QA 3HP3A 4Y7NH 3V05A 2PQEA 1BDOA 2UUAQ 1VQHA 3T51B 1SRUA 3S1QB 4KK7A 3W1BA 3HKZE 4CKCA 5IP9G 4ULLA 1L1OA 4KV6A 5EPJA 5IT9c 3M4QA 2PO4A 3HOXG 4DNTB 1MSHA 1LTRD 2UXCL 1VQIA 4Q0FA 4A3KG 2CW0C 3GTQB 1I6HB 2MFIA 2Q2TA 2I5LX 3EBEA 1QNUA 2RA4A 4KHZA 2Y0SB 2E8GA 4ALPA 1QZGA 3HFZB 4BBRG 2R93B 1KRTA 1MBYA 1SYBA 2FHTA 5IYDG 2UXBL 2AQ2B 1J6QA 2PPBC 2OWOA 2CHBD 4HJ9A 1H9KA 4JI7L 4A3DH 5CGKA 4FXDA 4DV5Q 3CKIB 1STEA 2XRSD 1YEZA 4A3FH 4LUVA 1WD0A 3KLRA 4JI7Q 4JBMA 5KYLA 1M1KC 5CV9A 2PCFB 2PNRC 3MFGA 5EJWA 1PVOA 4K8IA 3OIPA 4GOPA 4WFN3 1B1ZA 2Q2HA 3GO5A 1KAAA 4XXEA 2F4VQ 2MO0A 3A54A 2CH4W 3HKZG 4LF7L 5FLMG 3K5OA 1N33L 2B2YC 4IQZA 3TS2A 1CK1A 1XMOL 2L11A 3SHLA 2NB0A 1W2BA 1LT5D 1VMCA 3CQZH 1H95A 1B44D 1YHQA 1TWFH 1SFOB 2XSCA 2WKCA 3DWAA 3T56B 3CXCA 4LFBL 2VUMG 1N33Q 2HDMA 3I2ZA 4A3EB 4ZUIA 5E4XA 5HURA 5M5YH 1QB5D 4DV3L 3GTLH 1JWSD 4APVA 3QOJA 1TS2A 1A15A 4A3JH 5GADC 3K81C 1VQPA 1GHKA 4KY6A 5I2YA 1WTQA 2KENA 1IW7D 2Q8IB 1XPUA 2Z6KC 1I4RA 2QDLA 1EY4A 2K50A 2A69C 1F9QA 2F0EA 4OO1H 2C35B 1DONA 4DV3Q 4QUFA 2FMMA 4K6LA 4A93H 3K5NA 2F3VA 2CH4A 3KDFA 1HFNA 2WACA 3H09A 4RAUC 3ZYYX 1GUSA 1M8AA 1VQOA 1WTRA 5FO7B 4H13C 4QMGA 1B70B 1HCZA 3SK8A 2B8FA 5E4WC 5A2QL 2R92H 4BY7H 1JICA 2BH2A 1ML0D 2OCEA 2IX1A 3S15B 1PRTB 3OW2A 2N55A 2X6LA 2JA8G 5C0XJ 1V1QA 4NXNL 5C0XI 3MXGA 4QCLA 1FNUA 2PW5A 4H7BA 5C3EH 1I3QB 4GZYC 2CWAA 2KCTA 4O2DA 3A74A 5CBAE 2B8GA 4XYOA 2Q8TA 3DXJC 5KNBA 3HOUG 2AUKA 4ME3A 4IJLA 5EKIA 1ILQA 3ER0A 1SSOA 3F1ZA 1F77A 3FKIB 1EY5A 1JOOA 1WTPA 1FJGQ 1CA6A 4KD4A 3BZDB 4C3IH 3K80C 1WJJA 1B4OA 2YU9H 1SROA 3A5ZB 3VYTA 5I4DA 1PFSA 4KKSA 1B50A 4RKBA 3CCJA 4ODGA 5C5MA 1LTID 4IOAA 5JVH3 3MA2B 2P5ZX 1SMXA 4HIMA 2VQFL 3U9OA 1XYIA 3TZDA 1GUOA 4MZ9A 2WV6D 2CKZB 1XJVA 3I4NG 3LNNA 2RQXA 4RGTA 2HCCA 2IT1A 1C4QA 3SK6A 3IKJA 2VQFQ 5LHY1 3A0JA 1D5XC 1PH9A 1STAA 3EIVA 4K5XA 3U9SA 3R3OA 1G6ZA 1S5DD 4JI6L 3KF6B 3UDXA 4L5RC 3JAML 4DR4Q 1PZJD 4HSPA 3MFYA 4KTAA 4GNXC 3A5UA 1L1OC 5JEAG 4LUOA 2ZTDA 3D6WA 4X3UA 2VB2X 2JA7H 3C1FA 4DNIA 1J9OA 1TWGH 4HSVA 1Q86C 3HOXB 3IAYA 4JI6Q 2XGTA 2RDGA 1G8ZD 2OT2A 3M3YH 3A8IE 3K0XA 4KY5A 1EY0A 1DYQA 1U4PA 2EVBA 4AYBG 5FLXL 1KIXA 2EYPA 1GM5A 1RDPD 3GD7A 1XNRL 3BS1A 1EFID 3GTOB 1S5CD 4K5WA 4WJ4A 5M3FG 1Y14B 4MIUA 2F0MA 4C3HG 1FL0A 1I6VC 2CFMA 2HT1A 1EY6A 3CPFA 4A3JG 3BG3A 3G6EA 4DK3C 1CQFA 3KBGA 1X32A 5C0XH 2NVYH 1XNRQ 2XWJB 1JE5A 5E7NA 5GAEC 3V96A 1CQVA 4FNFA 5JJLA 4IUTA 1G91A 2BDNA 1KABA 1Y8PB 2VW9A 1RCVD 5DM63 3CCUA 1SE2A 3G7LA 1YJNA 4DR7L 1C0AA 3M4OB 3NQIA 2RF4A 2H5XA 4PV1C 3U50C 5C3XA 3X3MA 4JBJA 5IY0A 4GOPC 1JB7A 5GQOA 3TRZA 4KKUA 5IGGA 3H0GB 4JCVE 1I4HA 1FGUA 4LF9L 3KOJA 1PTOH 4DR7Q 4BA2I 4X62Q 1O7IA 3PO2G 1CFMA 2NVTB 2E2JB 2A6EC 5C4JB 3RZDH 2G9DA 1CA5A 3S14H 2LXKA 1H9JA 3HOYG 1X3GA 2RHSB 1PTOF 4E6IA 2VUMB 4X64Q 5IIFA 4R8IA 2VL6A 3FPUB 1NMFA 3STBC 3AMUA 1PZID 4LF6L 1PTOC 2I46A 3NSWA 2E2HB 3OYYA 5KRUA 3NEMA 1TWHB 4YCWA 1MD2D 1PRTD 5JOBA 4KHPL 1JR0D 1TVXA 4G7HC 4P75A 2NVQB 2F0FA 4LF6Q 4H44C 2GA4B 3J81L 4DR6Q 2RCFA 2EJFC 2JQOA 4KHPQ 3HOWB 2BCOA 2NZ1D 4NB3A 4LFAL 3NTKA 4NXML 1VF5C 4TSSA 2VNUD 3WDNA 5LMUQ 5GAGC 5JJKA 1PFMA 2F52A 1TQOA 1OXXK 1VQMA 3BZCA 3Q8DA 3GTMB 1BKBA 3OWFA 1EYGA 4UY8C 2VB3X 1V8QA 3TP5A 4LFAQ 4OWTB 1RODA 2IL8A 2N3SA 1FR3A 2HD3A 1X56A 5C4XH 4YCVA 5C44H 2JA8B 4DK1A 2O5IC 2AWNA 2F0VA 2F0WA 3CU7A 1YJ9A 2F0KA 2DGYA 1PH2A 2A68C 5JJIA 4RG1A 4AIMA 3DMUA 5IYBH 1OXVA 1BR9A 1YHAA 1HNZL 3HOUB 4NP5A 3I8ZA 4LF5L 4HN7A 4IURA 1EWCA 1X54A 3T1HL 4YCUA 2ZJQA 3P20A 3WOFA 2BA0A 5DNFA 3PIOA 1I94Q 4LF5Q 2QEXA 1K0SA 5C3WA 1A2TA 3K58A 2B3GA 3T1HQ 3DHQA 5IP7H 3ND8A 1ESRA 5FJ8G 1S72A 1L0YB 3UI2A 2OTLA 1IKMA 1STGA 2MJ8A 2DJGC 1RL2A 1D2BA 1O7ZA 3I4NB 4C1NI 2HHHL 1AP0A 3ULLA 3QIAA 2ICIA 1Q8IA 3P7JA 4KHVA 1PH4A 2A1AA 1TWCH 1WFQA 4A3FB 1EIFA 4A3BH 1V1OA 2ZTCA 4OX9L 1F2YA 2EYLA 2JP1A 2SNMA 1HPCA 1GXDC 2HHHQ 3I70A 3H91A 4NDXA 5ELEA 1RHPA 4MN3A 1Y1WG 4V190 1GD7A 2K5VA 2K5HA 4DR3L 1G291 1YNND 3ZJYC 4HJAA 1JWMD 1E2ZA 2K7VA 3FHWA 4ILWA 2Z8LA 1HHVA 4OELB 4DAMA 1G6PA 2N78A 2ZXRA 3H6MA 3VDYA 4FF4A 3J7YW 1MGSA 2JA6G 1HNWL 3EJIA 4DR3Q 1E7ZA 3TBIB 4C3JH 4A3EG 4GLXA 3VR2A 1LO5D 1G51A 4V0BA 3NE5B 3U4ZA 3MHBA 3N52A 4C3HB 5M5YB 2R7DA 1UAPA 3S2HH 1XTCD 2FFKB 4A3JB 3PCOB 2ZM6L 3M7GA 5AJ3L 4MHEA 3I56A 1YZ6A 3AU7A 3PSIA 4ZRZA 2NTSA 3J7ZC 4HJ5A 2KCNA 4UP7A 2ZM6Q 1YNJC 4J1MA 5AJ3Q 1PH7A 3HOZG 1LUZA 3PIO3 3GV3A 3CF5A 4DAPA 1SMYC 4N8FA 1UNSA 3CCEA 4QB4A 1UE6A 3TREA 1B3AA 4BY7B 1A3VA 2EY2A 2MUYA 3HOVH 3VR6A 5TSSA 4F88A 4HJ8A 1J5EQ 3G48A 1FVIA 3PO3H 3PO2B 5DM73 1W3SA 3W2DA 3V2TA 4K8JA 4DV4L 4GN3B 3K6OA 1UEAB 1P8LA 4BBSH 3HOYB 3GTGH 2F0UA 1ASZA 1ENFA 5C3EB 5C4HA 5IYCG 2QGQA 1HA5A 3S24A 3GTKH 3S17B 3EQLC 4DV4Q 1SLJA 1SNQA 4EQPA 2QILA 1EFWA 3PUZA 1JB3A 4PZ8A 2WFWA 2EXZA 1U5KA 5BN3A 1S5BD 2JJQA 5D14A 2AQ3B 3SDZA 1XNQQ 4B9XA 5NUCA 4K2LA 3ICEA 1BUVT 3NWTA 2CW0D 1EYDA 1V43A 1LTAD 2F4IA 1Q82C 1CSQA 2OF1A 2QF7A 1UWVA 1LACA 2JSOA 2YU9B 1I4PA 3ERQA 4R4CA 3HGBA 2J4XA 4PMBA 1TXYA 3AFQA 1WTWA 4IPDA 2FJ2A 4JI0L 4FF1A 2NWGA 4A3CG 3BVGA 4JW0A 1SEBD 5FLXE 1Q12A 1N32L 1IBKQ 5EKLA 1ZYRD 5I6WA 4FF2A 1KHIA 4A3BG 4JOIA 1AH9A 4GS3A 1EIGA 4JBWA 1LT4D 3OSOA 2MPMA 4RMFA 4B3ML 5E1FA 4BXXG 4Y52H 4JI2L 3DM3A 4GNXA 1Y8OB 2VQEL 4IUNA 2HIVA 3CPWA 1TT2A 5HY6A 3I91A 3QO2A 4LWCA 3R2IA 5D3IB 4B3MQ 1HZBA 4K5VA 1CUKA 4CDFC 1R9TH 2Q2UA 2F0LA 3M3YB 2VQEQ 2JA5G 4JI4L 2K05A 5D3DA 1NR4A 1C7YA 1KNEA 4EGVA 3QJYA 2UXCQ 1DGSA 2LXJA 2XWBB 1YJWA 1YITA 5JPMC 3FVQA 2MGSA 4OXPA 4X65L 4NPSA 5GROA 2BE5D 1BBWA 3PF5A 3K7AB 3QWNA 1JT8A 2AQ1B 2A69D 3WWVA 1A63A 2UXBQ 2F0DA 3GTJB 2PQAA 4JI1L 2YV5A 1F2LA 4C2MB 5KYIA 1PH8A 1B3QA 4BA1I 1Z47A 5JVG3 4PNYA 1FGBD 4JV5L 5KGUA 4A3GG 1ET6A 1Y69U 3MXPA 4L5SA 4K0KL 1V1PB 1ENCA 4CDDC 3BYYB 1UE7A 4JI1Q 5I2XA 3E9HA 4G7ZC 2R7ZG 1IHZA 1Y1WB 4JV5Q 3Q0AA 3H0GG 2KBNA 4J8QA 2RBMA 4XQNA 2EY1A 4R4IA 3J81E 4RHSA 1X6OA 2IW3A 3E3XA 1D5ZC 3PUWA 2EJGC 3PO3G 5K36H 5ELNA 2RCNA 4RCOA 3NXWA 2JA6B 3S14B 2L4NA 3WOEA 2FXQA 4LF7Q 3MEFA 4FDBA 4R4QA 3NTHA 3L2PA 1LV9A 1I4QA 1XMOQ 3J80L 3T16A 4PG3A 3QG1A 4DPGA 1FD7D 2PI2A 1I50H 4CJ2C 2NVXH 4GKKL 4LFBQ 4LW1A 4TQUS 1TWAB 3FRPB 4FO2A 4CKEA 2PZUA 5CBEE 4JYAL 2CWPA 1Q1EA 3PUVA 2ZTEA 4JI5L 5FOBB 4A3LG 1VQ4A 1Y1VH 2XNAC 3HOWG 3S16H 2QDBA 2SNSA 3HOZB 1NY4A 4NW2A 1QWYA 3NBHA 1BF4A 4JYAQ 1VQ5A 2JEAI 2NN6I 1EY7A 2LKVA 3A8KE 3B6YA 2VXWA
chains in the Genus database with same CATH topology
5FLXc 3RLNA 3CCUA 3PIPA 1YJNA 1VQNA 4A3CH 4DR7L 1C0AA 1PYSB 3TQYA 3CMAA 3UDIA 3F8TA 2RF4A 2H5XA 3U50C 5IY0A 1EQRA 1GVPA 3D0FA 4JBJA 4GOPC 5GQOA 1JB7A 1N32Q 3TRZA 1XMQQ 5J3BA 3H15A 3F2CA 2OQKA 5BR8Q 3PV0A 3M4PA 3I4OA 4GLAC 2PMZE 3M85A 4LF4L 4AH6A 4JCVE 2VS1A 1S3OA 4YWKA 1FGUA 4LF9L 3KOJA 2CQOA 1XPOA 4DR7Q 2UUAL 4QGUA 4LF8Q 4BA2I 4BXXH 3RNUA 4X62Q 1O7IA 2JA8H 3PO2G 5EAYA 3PF4A 5IWAL 2YTVA 3M9BA 3RZDH 1MJCA 4JI2Q 4HIOA 4GLVB 3E9IA 1IL2A 3S14H 1H95A 2LXKA 4NXNQ 1VQEA 2YYZA 3HOYG 1X3GA 2RHSB 1WCMH 3RLOA 3HOXH 4UP8A 4X64Q 2F3IA 1JJ2A 1QUQA 2VL6A 1MKHA 3M7NA 1KRSA 5IWAQ 4MTNA 3L0OA 2ASBA 3HOUH 2PQAB 1NMFA 3STBC 2JA5H 1LTLA 2UUCL 1EOVA 1S40A 3S1RH 1HNXL 4LF6L 4JI4Q 3W1GA 3OYYA 3NEMA 2L15A 4YCWA 2Q2IA 1HZ9A 4KHPL 3GTOH 1VQLA 4IFDJ 3CCVA 4PMWA 1L2FA 1E1OA 4IFDI 3KJOA 4P75A 2UXDL 4GOPB 1YI2A 4HIKA 3GTPH 2UUCQ 4LF6Q 1HNXQ 1AE3A 1LYLA 1Q46A 1VQ8A 1MJEA 1PH6A 3EN2A 4DR6Q 3UDFA 1IBLL 1VQKA 3K7UC 2JQOA 2Z6KA 4KHPQ 5DLQE 4X65Q 3CC7A 2NZHA 4NB3A 4BY1H 4LFAL 4NXML 1X55A 4DV5L 3I4MH 2VNUD 4A3DG 2UXDQ 5LMUQ 1HZCA 1X3FA 5GAGC 5JJKA 2F52A 4R4OA 1OXXK 3MXNB 3BZCA 1VQMA 1P16A 1PH5A 1KD1C 1JJCB 1N9WA 1HR0L 3Q8DA 1IBLQ 4A3FG 4JBKA 1BKBA 1EYGA 4A3GH 4UY8C 1A62A 3T1YL 4OONA 4JOIC 4LFAQ 4OWTB 3I4NH 1PH3A 2LSSA 1NTGA 1J5EL 2N3SA 4K0KQ 3HOVG 1HR0W 1X56A 2RHQB 5C4XH 2R7ZH 1E24A 4EX5A 3CCLA 1HR0Q 2E2IH 3J81j 4YCVA 3H0GH 5C44H 5M5WH 2B63G 2AWNA 2F4VL 2K75A 1JJGA 3AYHB 3J81i 2D0PA 3J81c 1YJ9A 2JA9A 4B3RL 2AKWB 2DGYA 1XPRA 4A4IA 1QVFA 1D7QA 2XTIA 4POFA 1PH2A 4BBSG 1E1TA 2NVTH 2E2JH 4LFCL 5JJIA 4RG1A 1IZ6A 4AIMA 4DK6C 3UDGA 4DKAC 3BU2A 3UE0A 1OXVA 1YBYA 5IYBH 1CKNA 1YHAA 3KDFB 1HNZL 1VS0A 3CCRA 2IHEA 4B3RQ 4LF5L 3NBHB 2ZJPA 3RN2A 1VQDA 4LFCQ 1X54A 3T1HL 4XIGS 4KI0A 3SGIA 4DV2L 3KLWA 2WP8J 4YCUA 3LGJA 2ZJQA 1XNQL 2BA0A 3PIOA 1I94Q 4EQ5A 1Z9FA 3JAMi 4P72A 3JAMc 4LF5Q 2IHFA 3AFPA 4PZ7A 2QEXA 3DLLA 4GKKQ 3CC2A 3S1MH 3CAMA 4B3TL 3GTQH 3FKIG 1I6HH 1SR3A 2B3GA 3T1HQ 4DV2Q 5M3FH 1NBWA 4C3HH 1K0RA 5IP7H 4A3LH 1X3EA 4OO1G 5FJ8G 3KF6A 4IPHA 4A3MG 3KF8B 4JI5Q 3F2BA 1S72A 4A93G 3HOWH 1A0IA 4IO9A 2R93H 2OTLA 4B3TQ 4GKJL 4H02A 2N8NA 1E3PA 4KLKA 4OWXB 4POGA 1RL2A 4A3IH 4JC0A 1OTCA 1KXLA 2K52A 1N8RC 3CCMA 4J15A 3KFUA 2HHHL 2MNAA 2AHOB 1HZAA 3KYHC 3ULLA 3I55A 3BJUA 3F2DA 1IBKL 3GTMH 1PH4A 3RZOH 2R6GA 2A1AA 2KCMA 1KL9A 2N49A 4GN5A 1TWCH 1WFQA 1K9MC 1EIFA 4A3BH 1QUQB 4UPAA 4GKJQ 2ZTCA 4OX9L 1B7YB 3S2DH 4BY7G 2R92G 2I5HA 3CCSA 2HHHQ 1VQCA 3PUXA 3TS0A 3CD6A 1QVCA 1VQBA 1WYDA 4HJ7A 1Y1WG 1QVGA 1GD7A 3H3VI 2K5VA 2K5HA 1D8LA 2EIFA 4DR3L 1G291 3CCQA 3ZJYC 2WAQE 2A8VA 4HJAA 2BH8A 3RN5A 3CP0A 4OO1I 4LF4Q 1YVCA 3FHWA 4YWLA 4DV1L 2CCZA 4LF9Q 3PO2H 4DAMA 4Y7NH 2YTYA 4IOCA 2IX0A 2N78A 5C3EG 1K73C 2UUAQ 1G6PA 1VQHA 3CMEA 1BVSA 1SRUA 3W1BA 3HKZE 1EIYB 3VDYA 5IP9G 1L1OA 2JA6G 1HNWL 3HOYH 2V1CC 2B29A 4DV6L 3I7FA 4DR3Q 5IT9c 3M4QA 4YHHL 2HIXA 1E7ZA 4DUYL 1VQ6A 4C3JH 3HOXG 4GLXA 4A3EG 3S17H 2E5LL 4XTCS 1VQIA 2UXCL 1G51A 4A3KG 3U4ZA 1SFOH 4QIWE 1FJGL 1V9PA 2MFIA 4DV6Q 1GKHA 2Q2TA 1AE2A 2JE6I 4YHHQ 2I5LX 3EBEA 2R7DA 3KJPA 1QZHA 3S2HH 2MO1A 4KHZA 3PCOB 2E8GA 2ZM6L 4AQYL 4ALPA 5AJ3L 1QZGA 3I56A 1YZ6A 2IY5B 3HFZB 3PSIA 4BBRG 1VQFA 1KRTA 2D62A 4AYBE 3J7ZC 2R7FA 4HJ5A 2ALYB 5IYDG 2UXBL 1UE1A 1J6QA 4UP7A 2PNHA 5M3MH 2ZM6Q 4AQYQ 2OWOA 1I5FA 5AJ3Q 4DAYB 4HJ9A 1PH7A 1HH2P 1NMGA 4JI7L 3HOZG 4A3DH 1LUZA 2VY3A 4LUZA 2UUBL 2ATWA 4NXMQ 4DV5Q 3GDEA 1CKNB 1KQSA 3CF5A 4JI3L 1MIUA 4O0AA 3ULJA 1OXUA 4A3FH 1YEZA 4L5QA 4LUVA 1C9OA 3CCEA 3ERSX 1UE6A 3TREA 4JI7Q 3T1YQ 4JBMA 2KHIA 1M1KC 2UUBQ 4DV7L 1K83H 4JI3Q 3HOVH 1Q7YC 1PVOA 4HJ8A 1J5EQ 3G48A 4DR4L 2WAQG 2B63H 1FVIA 3PO3H 4GOPA 1W3SA 1JMCA 4DR1L 3GO5A 2I5MX 2Q2HA 4DV4L 4GN3B 3U58A 3OTOL 2F4VQ 2MO0A 1SE8A 3S15H 5K36G 4X6AH 1P8LA 4LF7L 3HKZG 4P74A 4DV7Q 1XTDA 5FLMG 1N33L 4BBSH 2MQHA 3GTGH 3TS2A 1N34L 4B3SL 2JA7G 1ASZA 2I0QA 1NE3A 3S1QH 1XMOL 5IYCG 2QGQA 1LM0A 3S24A 4DR1Q 1YNXA 1W2BA 3GTKH 4DV4Q 1K8AC 3CQZH 1HNZQ 1SLJA 2K14A 1TWFH 1WI5A 4QL5A 3OTOQ 1YHQA 1N36L 3CXCA 1I3QH 4LFBL 2VUMG 1B8AA 1N33Q 2DUDA 3I2ZA 3L7ZC 3PUZA 4PZ8A 3STBD 1VQAA 2WFWA 1EFWA 4P71A 1U5KA 5H1SE 4X66L 2JJQA 1K8GA 3S1NH 2GN5A 1VQ9A 5M5YH 1XNQQ 4DV3L 3GTLH 4APVA 1BBUA 2D0OA 1N36Q 1EQQA 3ICEA 4A3JH 5GADC 3K81C 2ID0A 1VQPA 1U0LA 1V43A 1Q81C 3FKIH 1Q82C 1Y1VG 1CSQA 1RIPA 2JEBI 2KENA 2Z6KC 5LMNL 1XPUA 3H3VH 1IYJB 2K50A 1UWVA 5C0XG 3HKSA 2QA4A 1UEBA 5FJ8H 2C35B 4IJHA 4R4CA 4A3MH 4DV3Q 1A8VA 2Z0SA 4A93H 1TXYA 5LMNW 3KDFA 4DV0L 3AFQA 5LMNQ 1OXTA 1SN8A 4GN4B 4IPDA 4JI0L 1X9NA 1X65A 1PH1A 3K7AH 3NENA 1HJPA 4IPCA 3GTJH 1M90C 4A3CG 4C2MH 2UU9L 1VQOA 1Q12A 1N32L 4DV0Q 1IBKQ 1B70B 4HIDA 1KC8C 1KHIA 4A3BG 4BY7H 2R92H 4OX9Q 4JOIA 1AH9A 1EWIA 3NELA 2A19A 4DR5L 3FP9A 4GS3A 2BH2A 2OCEA 4LF8L 4JBWA 2IX1A 1IBML 4X62L 2UU9Q 2NZOA 2OQ0A 3OW2A 4RMFA 1Y1WH 4B3ML 4BXXG 4IFDG 1IXRA 4Y52H 2JA8G 4JI2L 1PYBA 3DM3A 5C0XJ 5HGQA 1V1QA 4QJFA 4GNXA 2VQEL 3BZKA 4NXNL 5C0XI 2HIVA 3CPWA 4DR5Q 4X64L 5HY6A 1ASYA 4LWCA 5C3EH 1WCMG 1IBMQ 4DV1Q 2CWAA 4TVAB 4B3MQ 1HZBA 3RR5A 2KCTA 4O2DA 5IP9H 3A74A 1CUKA 3PGZA 1EUJA 1NJIC 2JA6H 1R9TH 2VZAA 3HOUG 2Q2UA 2VQEQ 4ME3A 1E22A 4IJLA 2JA5G 4JI4L 1HNWQ 4A3EH 3ER0A 3W5OA 4DUYQ 1VCIA 1C7YA 1GO3E 4A3KH 2EXDA 3F1ZA 2E5LQ 2UXCQ 1DGSA 3D31A 2LXJA 4A76A 1YJWA 2ES2A 1FJGQ 1YITA 1VQGA 1Q1BA 4DR6L 1TWAH 4OXPA 4C3IH 3K80C 1WJJA 4L5TA 1UE5A 2YTXA 2AWOA 4BBRH 4X65L 4NPSA 1SROA 3A5ZB 5GROA 2AMCB 2YU9H 1PFSA 1BBWA 2BA1A 1YIJA 2Y0SE 3CCJA 3I4MG 5LMUL 3PF5A 5IYDH 4BY1G 2JK8A 2WB1E 1JT8A 4IOAA 3WWVA 1A63A 2UXBQ 4UP9A 2PQAA 4JI1L 2YV5A 1PH8A 1SMXA 4A75A 4BA1I 1Z47A 3HOZH 4HIMA 5M3MG 2VQFL 4IPGA 1VQ7A 4JV5L 4A3GG 4JI8L 4QY7A 4MZ9A 1CKMA 3JC66 4JG2A 2CKZB 1XJVA 4L5SA 4LNQA 3I4NG 4K0KL 2IT1A 1UE7A 4JI1Q 3E0EA 3E9HA 5C4XG 2R7ZG 2VQFQ 3A0JA 4JV5Q 1PH9A 3H0GG 5C44G 3G71A 3M4OH 2KBNA 2PI2E 4JI8Q 2KHJA 3PUYA 3EIVA 5ELOA 2K4KA 4R4IA 4JI6L 3KF6B 1T9HA 1X6OA 4R4TA 3UDXA 3RLFA 2GVBA 3PUWA 4L5RC 4DR4Q 3PO3G 4GNXC 3A5UA 1L1OC 5ELNA 4P73A 5JEAG 5IYBG 2RCNA 4LUOA 2NN6G 2ZTDA 4MNOA 5FLMH 1PA6A 5GAHC 3K8AA 3TEHB 2FXQA 2K5NA 2JA7H 4DNIA 4LF7Q 3MEFA 1TWGH 4FDBA 5C4JH 1Q86C 4YWMA 4JI6Q 4R4QA 5IYCH 1N34Q 3L2PA 4B3SQ 2XGTA 4R1JA 1XMOQ 3M3YH 4PG3A 4DPGA 4OWWB 3K0XA 1OXSC 1I94L 1YHBA 2VUMH 1CKOA 2PI2A 1I50H 2NVXH 1VQJA 4GKKL 1K3RA 2GVAA 3ULPA 4AYBG 4LFBQ 3AQQA 4LW1A 1KIXA 4DR2L 3CC4A 4TQUS 3IRBA 1GM5A 4QQBX 2OTJA 4DUZL 3GD7A 4X66Q 1XNRL 4YY3L 4JYAL 2E2HH 2CWPA 4WJ4A 5M3FG 1Q1EA 1Y14B 3PUVA 5IP7G 2ZTEA 1CSPA 4JI5L 4A3LG 1TWHH 1Q8KA 2EQSA 1FL0A 1VQ4A 1Y1VH 2CFMA 3CPFA 4A3JG 2Y0SG 2HT1A 3G6EA 4DK3C 4DR2Q 2WB1G 2NVYH 4DUZQ 3HOWG 3S16H 2NVQH 2R93G 2HQLA 1XNRQ 1NY4A 3CW2C 5JEAJ 3U4VA 4YY3Q 5M5XH 1JE5A 3G4SA 5E7NA 3UE1A 1PV4A 1VQ5A 2JEAI 4JYAQ 2NN6I 4A3IG 5GAEC 4GNXB 5JJLA 1L1OB 3J80i 1WOCA 3J80c 2ZJRA 1KAWA 5IE8A 3AEVA 3B6YA 4PZ6A 1XMQL 1L0WA 4WJ3M 3J7A5 1PHJA 2VW9A 5BR8L 4JI0Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLX c;  3RLN A;  3CCU A;  3PIP A;  1YJN A;  1VQN A;  4A3C H;  4DR7 L;  1C0A A;  1PYS B;  3TQY A;  3CMA A;  3UDI A;  3F8T A;  2RF4 A;  2H5X A;  3U50 C;  5IY0 A;  1EQR A;  1GVP A;  3D0F A;  4JBJ A;  4GOP C;  5GQO A;  1JB7 A;  1N32 Q;  3TRZ A;  1XMQ Q;  5J3B A;  3H15 A;  3F2C A;  2OQK A;  5BR8 Q;  3PV0 A;  3M4P A;  3I4O A;  4GLA C;  2PMZ E;  3M85 A;  4LF4 L;  4AH6 A;  4JCV E;  2VS1 A;  1S3O A;  4YWK A;  1FGU A;  4LF9 L;  3KOJ A;  2CQO A;  1XPO A;  4DR7 Q;  2UUA L;  4QGU A;  4LF8 Q;  4BA2 I;  4BXX H;  3RNU A;  4X62 Q;  1O7I A;  2JA8 H;  3PO2 G;  5EAY A;  3PF4 A;  5IWA L;  2YTV A;  3M9B A;  3RZD H;  1MJC A;  4JI2 Q;  4HIO A;  4GLV B;  3E9I A;  1IL2 A;  3S14 H;  1H95 A;  2LXK A;  4NXN Q;  1VQE A;  2YYZ A;  3HOY G;  1X3G A;  2RHS B;  1WCM H;  3RLO A;  3HOX H;  4UP8 A;  4X64 Q;  2F3I A;  1JJ2 A;  1QUQ A;  2VL6 A;  1MKH A;  3M7N A;  1KRS A;  5IWA Q;  4MTN A;  3L0O A;  2ASB A;  3HOU H;  2PQA B;  1NMF A;  3STB C;  2JA5 H;  1LTL A;  2UUC L;  1EOV A;  1S40 A;  3S1R H;  1HNX L;  4LF6 L;  4JI4 Q;  3W1G A;  3OYY A;  3NEM A;  2L15 A;  4YCW A;  2Q2I A;  1HZ9 A;  4KHP L;  3GTO H;  1VQL A;  4IFD J;  3CCV A;  4PMW A;  1L2F A;  1E1O A;  4IFD I;  3KJO A;  4P75 A;  2UXD L;  4GOP B;  1YI2 A;  4HIK A;  3GTP H;  2UUC Q;  4LF6 Q;  1HNX Q;  1AE3 A;  1LYL A;  1Q46 A;  1VQ8 A;  1MJE A;  1PH6 A;  3EN2 A;  4DR6 Q;  3UDF A;  1IBL L;  1VQK A;  3K7U C;  2JQO A;  2Z6K A;  4KHP Q;  5DLQ E;  4X65 Q;  3CC7 A;  2NZH A;  4NB3 A;  4BY1 H;  4LFA L;  4NXM L;  1X55 A;  4DV5 L;  3I4M H;  2VNU D;  4A3D G;  2UXD Q;  5LMU Q;  1HZC A;  1X3F A;  5GAG C;  5JJK A;  2F52 A;  4R4O A;  1OXX K;  3MXN B;  3BZC A;  1VQM A;  1P16 A;  1PH5 A;  1KD1 C;  1JJC B;  1N9W A;  1HR0 L;  3Q8D A;  1IBL Q;  4A3F G;  4JBK A;  1BKB A;  1EYG A;  4A3G H;  4UY8 C;  1A62 A;  3T1Y L;  4OON A;  4JOI C;  4LFA Q;  4OWT B;  3I4N H;  1PH3 A;  2LSS A;  1NTG A;  1J5E L;  2N3S A;  4K0K Q;  3HOV G;  1HR0 W;  1X56 A;  2RHQ B;  5C4X H;  2R7Z H;  1E24 A;  4EX5 A;  3CCL A;  1HR0 Q;  2E2I H;  3J81 j;  4YCV A;  3H0G H;  5C44 H;  5M5W H;  2B63 G;  2AWN A;  2F4V L;  2K75 A;  1JJG A;  3AYH B;  3J81 i;  2D0P A;  3J81 c;  1YJ9 A;  2JA9 A;  4B3R L;  2AKW B;  2DGY A;  1XPR A;  4A4I A;  1QVF A;  1D7Q A;  2XTI A;  4POF A;  1PH2 A;  4BBS G;  1E1T A;  2NVT H;  2E2J H;  4LFC L;  5JJI A;  4RG1 A;  1IZ6 A;  4AIM A;  4DK6 C;  3UDG A;  4DKA C;  3BU2 A;  3UE0 A;  1OXV A;  1YBY A;  5IYB H;  1CKN A;  1YHA A;  3KDF B;  1HNZ L;  1VS0 A;  3CCR A;  2IHE A;  4B3R Q;  4LF5 L;  3NBH B;  2ZJP A;  3RN2 A;  1VQD A;  4LFC Q;  1X54 A;  3T1H L;  4XIG S;  4KI0 A;  3SGI A;  4DV2 L;  3KLW A;  2WP8 J;  4YCU A;  3LGJ A;  2ZJQ A;  1XNQ L;  2BA0 A;  3PIO A;  1I94 Q;  4EQ5 A;  1Z9F A;  3JAM i;  4P72 A;  3JAM c;  4LF5 Q;  2IHF A;  3AFP A;  4PZ7 A;  2QEX A;  3DLL A;  4GKK Q;  3CC2 A;  3S1M H;  3CAM A;  4B3T L;  3GTQ H;  3FKI G;  1I6H H;  1SR3 A;  2B3G A;  3T1H Q;  4DV2 Q;  5M3F H;  1NBW A;  4C3H H;  1K0R A;  5IP7 H;  4A3L H;  1X3E A;  4OO1 G;  5FJ8 G;  3KF6 A;  4IPH A;  4A3M G;  3KF8 B;  4JI5 Q;  3F2B A;  1S72 A;  4A93 G;  3HOW H;  1A0I A;  4IO9 A;  2R93 H;  2OTL A;  4B3T Q;  4GKJ L;  4H02 A;  2N8N A;  1E3P A;  4KLK A;  4OWX B;  4POG A;  1RL2 A;  4A3I H;  4JC0 A;  1OTC A;  1KXL A;  2K52 A;  1N8R C;  3CCM A;  4J15 A;  3KFU A;  2HHH L;  2MNA A;  2AHO B;  1HZA A;  3KYH C;  3ULL A;  3I55 A;  3BJU A;  3F2D A;  1IBK L;  3GTM H;  1PH4 A;  3RZO H;  2R6G A;  2A1A A;  2KCM A;  1KL9 A;  2N49 A;  4GN5 A;  1TWC H;  1WFQ A;  1K9M C;  1EIF A;  4A3B H;  1QUQ B;  4UPA A;  4GKJ Q;  2ZTC A;  4OX9 L;  1B7Y B;  3S2D H;  4BY7 G;  2R92 G;  2I5H A;  3CCS A;  2HHH Q;  1VQC A;  3PUX A;  3TS0 A;  3CD6 A;  1QVC A;  1VQB A;  1WYD A;  4HJ7 A;  1Y1W G;  1QVG A;  1GD7 A;  3H3V I;  2K5V A;  2K5H A;  1D8L A;  2EIF A;  4DR3 L;  1G29 1;  3CCQ A;  3ZJY C;  2WAQ E;  2A8V A;  4HJA A;  2BH8 A;  3RN5 A;  3CP0 A;  4OO1 I;  4LF4 Q;  1YVC A;  3FHW A;  4YWL A;  4DV1 L;  2CCZ A;  4LF9 Q;  3PO2 H;  4DAM A;  4Y7N H;  2YTY A;  4IOC A;  2IX0 A;  2N78 A;  5C3E G;  1K73 C;  2UUA Q;  1G6P A;  1VQH A;  3CME A;  1BVS A;  1SRU A;  3W1B A;  3HKZ E;  1EIY B;  3VDY A;  5IP9 G;  1L1O A;  2JA6 G;  1HNW L;  3HOY H;  2V1C C;  2B29 A;  4DV6 L;  3I7F A;  4DR3 Q;  5IT9 c;  3M4Q A;  4YHH L;  2HIX A;  1E7Z A;  4DUY L;  1VQ6 A;  4C3J H;  3HOX G;  4GLX A;  4A3E G;  3S17 H;  2E5L L;  4XTC S;  1VQI A;  2UXC L;  1G51 A;  4A3K G;  3U4Z A;  1SFO H;  4QIW E;  1FJG L;  1V9P A;  2MFI A;  4DV6 Q;  1GKH A;  2Q2T A;  1AE2 A;  2JE6 I;  4YHH Q;  2I5L X;  3EBE A;  2R7D A;  3KJP A;  1QZH A;  3S2H H;  2MO1 A;  4KHZ A;  3PCO B;  2E8G A;  2ZM6 L;  4AQY L;  4ALP A;  5AJ3 L;  1QZG A;  3I56 A;  1YZ6 A;  2IY5 B;  3HFZ B;  3PSI A;  4BBR G;  1VQF A;  1KRT A;  2D62 A;  4AYB E;  3J7Z C;  2R7F A;  4HJ5 A;  2ALY B;  5IYD G;  2UXB L;  1UE1 A;  1J6Q A;  4UP7 A;  2PNH A;  5M3M H;  2ZM6 Q;  4AQY Q;  2OWO A;  1I5F A;  5AJ3 Q;  4DAY B;  4HJ9 A;  1PH7 A;  1HH2 P;  1NMG A;  4JI7 L;  3HOZ G;  4A3D H;  1LUZ A;  2VY3 A;  4LUZ A;  2UUB L;  2ATW A;  4NXM Q;  4DV5 Q;  3GDE A;  1CKN B;  1KQS A;  3CF5 A;  4JI3 L;  1MIU A;  4O0A A;  3ULJ A;  1OXU A;  4A3F H;  1YEZ A;  4L5Q A;  4LUV A;  1C9O A;  3CCE A;  3ERS X;  1UE6 A;  3TRE A;  4JI7 Q;  3T1Y Q;  4JBM A;  2KHI A;  1M1K C;  2UUB Q;  4DV7 L;  1K83 H;  4JI3 Q;  3HOV H;  1Q7Y C;  1PVO A;  4HJ8 A;  1J5E Q;  3G48 A;  4DR4 L;  2WAQ G;  2B63 H;  1FVI A;  3PO3 H;  4GOP A;  1W3S A;  1JMC A;  4DR1 L;  3GO5 A;  2I5M X;  2Q2H A;  4DV4 L;  4GN3 B;  3U58 A;  3OTO L;  2F4V Q;  2MO0 A;  1SE8 A;  3S15 H;  5K36 G;  4X6A H;  1P8L A;  4LF7 L;  3HKZ G;  4P74 A;  4DV7 Q;  1XTD A;  5FLM G;  1N33 L;  4BBS H;  2MQH A;  3GTG H;  3TS2 A;  1N34 L;  4B3S L;  2JA7 G;  1ASZ A;  2I0Q A;  1NE3 A;  3S1Q H;  1XMO L;  5IYC G;  2QGQ A;  1LM0 A;  3S24 A;  4DR1 Q;  1YNX A;  1W2B A;  3GTK H;  4DV4 Q;  1K8A C;  3CQZ H;  1HNZ Q;  1SLJ A;  2K14 A;  1TWF H;  1WI5 A;  4QL5 A;  3OTO Q;  1YHQ A;  1N36 L;  3CXC A;  1I3Q H;  4LFB L;  2VUM G;  1B8A A;  1N33 Q;  2DUD A;  3I2Z A;  3L7Z C;  3PUZ A;  4PZ8 A;  3STB D;  1VQA A;  2WFW A;  1EFW A;  4P71 A;  1U5K A;  5H1S E;  4X66 L;  2JJQ A;  1K8G A;  3S1N H;  2GN5 A;  1VQ9 A;  5M5Y H;  1XNQ Q;  4DV3 L;  3GTL H;  4APV A;  1BBU A;  2D0O A;  1N36 Q;  1EQQ A;  3ICE A;  4A3J H;  5GAD C;  3K81 C;  2ID0 A;  1VQP A;  1U0L A;  1V43 A;  1Q81 C;  3FKI H;  1Q82 C;  1Y1V G;  1CSQ A;  1RIP A;  2JEB I;  2KEN A;  2Z6K C;  5LMN L;  1XPU A;  3H3V H;  1IYJ B;  2K50 A;  1UWV A;  5C0X G;  3HKS A;  2QA4 A;  1UEB A;  5FJ8 H;  2C35 B;  4IJH A;  4R4C A;  4A3M H;  4DV3 Q;  1A8V A;  2Z0S A;  4A93 H;  1TXY A;  5LMN W;  3KDF A;  4DV0 L;  3AFQ A;  5LMN Q;  1OXT A;  1SN8 A;  4GN4 B;  4IPD A;  4JI0 L;  1X9N A;  1X65 A;  1PH1 A;  3K7A H;  3NEN A;  1HJP A;  4IPC A;  3GTJ H;  1M90 C;  4A3C G;  4C2M H;  2UU9 L;  1VQO A;  1Q12 A;  1N32 L;  4DV0 Q;  1IBK Q;  1B70 B;  4HID A;  1KC8 C;  1KHI A;  4A3B G;  4BY7 H;  2R92 H;  4OX9 Q;  4JOI A;  1AH9 A;  1EWI A;  3NEL A;  2A19 A;  4DR5 L;  3FP9 A;  4GS3 A;  2BH2 A;  2OCE A;  4LF8 L;  4JBW A;  2IX1 A;  1IBM L;  4X62 L;  2UU9 Q;  2NZO A;  2OQ0 A;  3OW2 A;  4RMF A;  1Y1W H;  4B3M L;  4BXX G;  4IFD G;  1IXR A;  4Y52 H;  2JA8 G;  4JI2 L;  1PYB A;  3DM3 A;  5C0X J;  5HGQ A;  1V1Q A;  4QJF A;  4GNX A;  2VQE L;  3BZK A;  4NXN L;  5C0X I;  2HIV A;  3CPW A;  4DR5 Q;  4X64 L;  5HY6 A;  1ASY A;  4LWC A;  5C3E H;  1WCM G;  1IBM Q;  4DV1 Q;  2CWA A;  4TVA B;  4B3M Q;  1HZB A;  3RR5 A;  2KCT A;  4O2D A;  5IP9 H;  3A74 A;  1CUK A;  3PGZ A;  1EUJ A;  1NJI C;  2JA6 H;  1R9T H;  2VZA A;  3HOU G;  2Q2U A;  2VQE Q;  4ME3 A;  1E22 A;  4IJL A;  2JA5 G;  4JI4 L;  1HNW Q;  4A3E H;  3ER0 A;  3W5O A;  4DUY Q;  1VCI A;  1C7Y A;  1GO3 E;  4A3K H;  2EXD A;  3F1Z A;  2E5L Q;  2UXC Q;  1DGS A;  3D31 A;  2LXJ A;  4A76 A;  1YJW A;  2ES2 A;  1FJG Q;  1YIT A;  1VQG A;  1Q1B A;  4DR6 L;  1TWA H;  4OXP A;  4C3I H;  3K80 C;  1WJJ A;  4L5T A;  1UE5 A;  2YTX A;  2AWO A;  4BBR H;  4X65 L;  4NPS A;  1SRO A;  3A5Z B;  5GRO A;  2AMC B;  2YU9 H;  1PFS A;  1BBW A;  2BA1 A;  1YIJ A;  2Y0S E;  3CCJ A;  3I4M G;  5LMU L;  3PF5 A;  5IYD H;  4BY1 G;  2JK8 A;  2WB1 E;  1JT8 A;  4IOA A;  3WWV A;  1A63 A;  2UXB Q;  4UP9 A;  2PQA A;  4JI1 L;  2YV5 A;  1PH8 A;  1SMX A;  4A75 A;  4BA1 I;  1Z47 A;  3HOZ H;  4HIM A;  5M3M G;  2VQF L;  4IPG A;  1VQ7 A;  4JV5 L;  4A3G G;  4JI8 L;  4QY7 A;  4MZ9 A;  1CKM A;  3JC6 6;  4JG2 A;  2CKZ B;  1XJV A;  4L5S A;  4LNQ A;  3I4N G;  4K0K L;  2IT1 A;  1UE7 A;  4JI1 Q;  3E0E A;  3E9H A;  5C4X G;  2R7Z G;  2VQF Q;  3A0J A;  4JV5 Q;  1PH9 A;  3H0G G;  5C44 G;  3G71 A;  3M4O H;  2KBN A;  2PI2 E;  4JI8 Q;  2KHJ A;  3PUY A;  3EIV A;  5ELO A;  2K4K A;  4R4I A;  4JI6 L;  3KF6 B;  1T9H A;  1X6O A;  4R4T A;  3UDX A;  3RLF A;  2GVB A;  3PUW A;  4L5R C;  4DR4 Q;  3PO3 G;  4GNX C;  3A5U A;  1L1O C;  5ELN A;  4P73 A;  5JEA G;  5IYB G;  2RCN A;  4LUO A;  2NN6 G;  2ZTD A;  4MNO A;  5FLM H;  1PA6 A;  5GAH C;  3K8A A;  3TEH B;  2FXQ A;  2K5N A;  2JA7 H;  4DNI A;  4LF7 Q;  3MEF A;  1TWG H;  4FDB A;  5C4J H;  1Q86 C;  4YWM A;  4JI6 Q;  4R4Q A;  5IYC H;  1N34 Q;  3L2P A;  4B3S Q;  2XGT A;  4R1J A;  1XMO Q;  3M3Y H;  4PG3 A;  4DPG A;  4OWW B;  3K0X A;  1OXS C;  1I94 L;  1YHB A;  2VUM H;  1CKO A;  2PI2 A;  1I50 H;  2NVX H;  1VQJ A;  4GKK L;  1K3R A;  2GVA A;  3ULP A;  4AYB G;  4LFB Q;  3AQQ A;  4LW1 A;  1KIX A;  4DR2 L;  3CC4 A;  4TQU S;  3IRB A;  1GM5 A;  4QQB X;  2OTJ A;  4DUZ L;  3GD7 A;  4X66 Q;  1XNR L;  4YY3 L;  4JYA L;  2E2H H;  2CWP A;  4WJ4 A;  5M3F G;  1Q1E A;  1Y14 B;  3PUV A;  5IP7 G;  2ZTE A;  1CSP A;  4JI5 L;  4A3L G;  1TWH H;  1Q8K A;  2EQS A;  1FL0 A;  1VQ4 A;  1Y1V H;  2CFM A;  3CPF A;  4A3J G;  2Y0S G;  2HT1 A;  3G6E A;  4DK3 C;  4DR2 Q;  2WB1 G;  2NVY H;  4DUZ Q;  3HOW G;  3S16 H;  2NVQ H;  2R93 G;  2HQL A;  1XNR Q;  1NY4 A;  3CW2 C;  5JEA J;  3U4V A;  4YY3 Q;  5M5X H;  1JE5 A;  3G4S A;  5E7N A;  3UE1 A;  1PV4 A;  1VQ5 A;  2JEA I;  4JYA Q;  2NN6 I;  4A3I G;  5GAE C;  4GNX B;  5JJL A;  1L1O B;  3J80 i;  1WOC A;  3J80 c;  2ZJR A;  1KAW A;  5IE8 A;  3AEV A;  3B6Y A;  4PZ6 A;  1XMQ L;  1L0W A;  4WJ3 M;  3J7A 5;  1PHJ A;  2VW9 A;  5BR8 L;  4JI0 Q; 
#chains in the Genus database with same CATH topology
 5FLX c;  1VQN A;  2B2U A;  4ZCK A;  1CT1 D;  1PYS B;  4DU9 A;  5EKK A;  1O7Y A;  2TSS A;  4M1U B;  2BOS A;  5IT9 L;  1CZW A;  1EQR A;  1GVP A;  2IY5 B;  2SOB A;  5C4X B;  5J3B A;  3H15 A;  2OQK A;  5CV8 A;  3M4P A;  4GLA C;  2PMZ E;  2VS1 A;  2CQO A;  1XPO A;  4QGU A;  1O80 A;  3D4R A;  3CRK C;  5IWA L;  4PQX A;  3VA5 A;  4HIO A;  1H9S B;  1IL2 A;  4Z9C B;  4NXN Q;  3I73 A;  1WCM H;  4LMQ D;  4DK0 A;  1B53 A;  1ENA A;  1QUQ A;  5EBC A;  5IWA Q;  4XT3 B;  2ASB A;  5IGB A;  1LTL A;  2K33 A;  3S1R H;  1HNX L;  3D3R A;  3KBX A;  2XIW A;  5KND A;  2L15 A;  4IFD J;  4PMW A;  1L2F A;  3S9W A;  1E1O A;  4IFD I;  1IW7 C;  3KJO A;  4HIK A;  3GTP H;  1HNX Q;  1AE3 A;  1K28 A;  1VQ8 A;  1G2T A;  1PH6 A;  3UDF A;  1IBL L;  5JPN C;  5G3L D;  3EFX D;  3I4M H;  1KDA A;  2NZH A;  4BY1 H;  4KKT A;  4A3D G;  1R4P B;  5CYU A;  1HZC A;  4C56 C;  3MXN B;  3Q23 A;  2B39 A;  1HR0 L;  1IBL Q;  4U68 A;  4A3F G;  1TS3 A;  1TWC B;  3T1Y L;  1PFB A;  4A3B B;  4JOI C;  2O2L D;  5LL6 X;  5C5L A;  2LSS A;  1SYC A;  1HR0 W;  1CM9 A;  4EX5 A;  1HR0 Q;  3RUZ A;  2E2I H;  5M5W H;  1LTG D;  3D4W A;  3J81 i;  1TII D;  2D0P A;  3J81 c;  4B3R L;  1QVF A;  4IAL A;  4POF A;  3NWS A;  1B9N A;  3K5M A;  4DKA C;  3UE0 A;  1CKN A;  2NN6 H;  2JA5 B;  4B3R Q;  1ESF A;  4I7Z C;  4IUV A;  1VQD A;  3SK4 A;  1EL0 A;  3QOL A;  4C3J B;  3SGI A;  4OL7 A;  3KLW A;  2WP8 J;  1F9R A;  3AFP A;  4PZ7 A;  4ZK9 B;  3S2H B;  3GTQ H;  2K32 A;  1I6H H;  1PTO D;  1SR3 A;  2FIN B;  1NBW A;  4L6T B;  1X3E A;  4UHV A;  4OO1 G;  3KF6 A;  1TU2 B;  3R8B A;  3KF8 B;  4O1N A;  1T5E A;  4A93 G;  2B2V A;  1A0I A;  4IO9 A;  2R93 H;  4H02 A;  4KLK A;  3X3N A;  4IUQ A;  1DOK A;  4POG A;  4A3G B;  1PXU A;  4A3I H;  5I9O A;  2K52 A;  3CCM A;  5ELD A;  2ZT9 C;  3A56 A;  3RD4 A;  1HUM A;  2KCM A;  5KEE A;  2R7Z B;  3VYU A;  2E2D C;  3Q6S A;  1B7Y B;  5EGT A;  4BY7 G;  2R92 G;  5K5P A;  2I5H A;  1TR5 A;  1SE3 A;  5F2D A;  2D9U A;  5IOD A;  3HOV B;  2EYF A;  4IFD H;  1WYD A;  1QVG A;  3PO3 B;  1DJR D;  2G5D A;  3BDL A;  3VR5 A;  2KED A;  1D8L A;  3CCQ A;  1MI2 A;  5C4Z A;  4DV1 L;  2CCZ A;  4BBS B;  4LF9 Q;  4IOC A;  2IX0 A;  1K73 C;  5I6Y A;  5C3E G;  1JOR A;  1BVS A;  3L3O C;  1EIY B;  2A68 D;  4DV6 L;  3I7F A;  4YHH L;  1VQ6 A;  4DUY L;  1SYF A;  4CDC C;  1M4V A;  1QOH A;  2E5L L;  1STY A;  3TP8 A;  1SFO H;  4F7X A;  4QIW E;  3S1M B;  1GJX A;  3TN2 A;  3MAQ A;  1V9P A;  3C3L A;  4DV6 Q;  2A73 B;  1GKH A;  1AE2 A;  4G57 A;  4YHH Q;  1D1I A;  1BQQ T;  4HCS A;  1QZH A;  1BCP B;  2LFN A;  4C3I G;  5A35 A;  1HRJ A;  2PZW A;  1VQF A;  5ISR A;  4FXK C;  3VYS A;  4DF7 A;  1FYC A;  1HA6 A;  4WJW A;  1LTT D;  4Q5V A;  2DNE A;  2KHS A;  3ONA B;  1JWU D;  1I5F A;  3EVQ A;  4DAY B;  4RHR A;  4LUZ A;  1JC7 A;  1NNX A;  2B2U C;  2UUB L;  2ATW A;  4NXM Q;  3GDE A;  1GHJ A;  4JI3 L;  3S2D B;  4BS9 A;  5CMD A;  2HQE A;  1DZ1 A;  3ERS X;  4EVO A;  2UUB Q;  4DV7 L;  1K83 H;  4JI3 Q;  1Q7Y C;  1T5X D;  1GUW A;  4RGN A;  2B63 H;  1O78 A;  4K14 A;  2EYJ A;  4Y7N B;  1JMC A;  3TDQ A;  3U58 A;  3OTO L;  1EEF D;  1DD2 A;  3S15 H;  4X6A H;  2HCI A;  4DV7 Q;  2EYO A;  2KEC A;  1F2Z A;  1N34 L;  4B3S L;  2JA7 G;  2I0Q A;  1NE3 A;  1X3Q A;  1H9M A;  2RVL A;  1HNZ Q;  4KJO A;  2K14 A;  3OTO Q;  4QL5 A;  1R9T B;  1PRT F;  1N36 L;  3P75 A;  1I3Q H;  3OWE B;  1C48 A;  1B8A A;  1QCB D;  2B2T C;  2DUD A;  4HMI A;  1JOQ A;  1VQA A;  3URY A;  5H1S E;  4X66 L;  1CI3 M;  3S1N H;  1PRT C;  1N36 Q;  1SYG A;  1F2M A;  4XQJ A;  3C46 A;  3FKI H;  3GV6 A;  1U4M A;  5LMN L;  2JEB I;  3I90 A;  1IYJ B;  4O42 A;  4ZLT F;  1UUP A;  5C0X G;  3HKS A;  1UEB A;  1QIL A;  4IJH A;  4A3M H;  4A3D B;  2Z0S A;  5LMN W;  1WD1 A;  5LMN Q;  1SN8 A;  4GN4 B;  3J80 E;  1X65 A;  1PH1 A;  4FVM A;  4IPC A;  1YNJ D;  4HR7 B;  3I3C A;  3T53 B;  1K3B C;  2PMZ B;  4R9W A;  4RGM A;  5HGT A;  5D65 A;  4OX9 Q;  1SMY D;  1LTB D;  3NEL A;  4DR5 L;  2A19 A;  1ZXT A;  4OIJ A;  3MVV A;  4JVZ A;  5FK9 C;  1IBM L;  4LF8 L;  2NZO A;  1STB A;  5CV6 A;  4IFD G;  1PYB A;  1STH A;  5EQ0 A;  5HGQ A;  4QF4 A;  4QJF A;  3HEJ A;  3CQZ B;  5EBD A;  4DR5 Q;  4ZYS A;  1HTL D;  1TWF B;  4QUC A;  1ASY A;  1IBM Q;  1SNC A;  1WTH A;  4IN3 A;  3RR5 A;  1KXL A;  5IP9 H;  3PGZ A;  1NJI C;  5A2Q E;  1WVL A;  1Q3L A;  1E22 A;  1HNW Q;  3N6R A;  4G7O C;  3GTL B;  3W5O A;  3T13 A;  2HUG A;  1I50 B;  2AUJ D;  2K6A A;  1VCI A;  1GO3 E;  2NVX B;  4A3K H;  1STN A;  4XQQ A;  5IGE A;  4A76 A;  2ES2 A;  1Q1B A;  4N8X 1;  1WTV A;  1F9P A;  2DY7 A;  5COY A;  1RD9 D;  3TME A;  4ID6 A;  2B2V C;  2B2W A;  4A93 B;  2AWO A;  4BBR H;  4RH6 A;  2RDF A;  3S16 B;  2BA1 A;  5IYD H;  2L9H A;  2WB1 E;  3TSS A;  2KQ3 A;  1E2W A;  1DOL A;  2M2L A;  4OEM B;  4IPG A;  1VQ7 A;  2ENB A;  4DAV A;  2EJM A;  4JI8 L;  3JC6 6;  4JG2 A;  2R92 B;  2KUM A;  3MEH A;  1SYE A;  1QG7 A;  1HTP A;  1OO9 B;  5C4X G;  1BCP D;  1RTN A;  5C44 G;  3M4O H;  4JI8 Q;  2KHJ A;  2K01 A;  3E6Z X;  2DY8 A;  2MHV A;  2I07 B;  1EQT A;  4R4T A;  2GVB A;  1SYD A;  1KTK A;  3MTS A;  1AFP A;  5IYB G;  2F0N A;  2M00 A;  4MNO A;  5FLM H;  1DOM A;  5GAH C;  4KN4 C;  3TEH B;  3C2P A;  1WCM B;  2Z4H A;  4B08 A;  5C4J H;  1TKW B;  2IPK D;  4YWM A;  2L5T A;  5DEH A;  1W6K A;  4R1J A;  5J1Z A;  4OWW B;  1Z7T A;  1OXS C;  1YHB A;  2VUM H;  1CKO A;  4DNR B;  3ERO A;  5KIX A;  1NCV A;  1VQJ A;  1K3R A;  2GVA A;  4CJ1 B;  3LWU A;  2KA7 A;  3CC4 A;  2OEO A;  2HDL A;  4QQB X;  2OTJ A;  4C3I B;  3D8G A;  3JAM E;  2L0C A;  2E2H H;  3E0J A;  1CSP A;  5IP7 G;  1TWH H;  2EQS A;  3DEP A;  5AFW A;  3GTP B;  3E5S A;  2A6H C;  3I4L A;  2WB1 G;  2NVQ H;  4KMU C;  2Z9H A;  3MXU A;  5JEA J;  5M5X H;  3I4M B;  3UE1 A;  1EWH A;  4I7A A;  4GNX B;  1K8O A;  1L1O B;  4LAA A;  3FDT A;  3J80 i;  1WOC A;  2L12 A;  3J80 c;  1KAW A;  4DFA A;  3AEV A;  1XMQ L;  3I72 A;  4WJ3 M;  1PHJ A;  2F0S A;  5CR3 A;  4JI0 Q;  3K59 A;  3DEO A;  4BWG B;  1S5E D;  4EQN A;  3CMA A;  3F8T A;  2F0P A;  3D0F A;  4KN7 C;  1N32 Q;  5IGC A;  2A74 C;  3A7A B;  4CKB A;  1JQY D;  3VA7 A;  1XMQ Q;  4CHT B;  2E2I B;  4XT1 B;  5M5W B;  3I4O A;  1DM0 B;  4LF4 L;  4AH6 A;  1S3O A;  1GUG A;  4YWK A;  1BNZ A;  2UUA L;  2EYH A;  2JA7 B;  3KUP A;  2JA8 H;  2OXP A;  1TWG B;  3PF4 A;  4ZKB B;  1TS5 A;  2YTV A;  1MJC A;  4JI2 Q;  1HQM C;  3E9I A;  4GLV B;  1IKL A;  1VQE A;  2KEE A;  4UP8 A;  4QIW B;  1W6J A;  1XWE A;  2K04 A;  2XRQ D;  1HXY D;  1MKH A;  2M9V A;  4C3J G;  3K5L A;  1E0B A;  3L0O A;  3HOU H;  2PQA B;  2X69 A;  4DXF A;  2UUC L;  1S40 A;  4JI4 Q;  2J7Z A;  3FEW X;  4F87 A;  2L1B A;  2Q2I A;  1HZ9 A;  1LAB A;  1GUT A;  3OPO A;  4M8A A;  1JCK B;  3GQB A;  2NVY B;  4GOP B;  1YI2 A;  4H0L C;  2UUC Q;  3P1H A;  1LYL A;  1Q46 A;  4LK1 C;  3EN2 A;  1KLG D;  1VQK A;  3K7U C;  3OW7 A;  2QEJ C;  1MHW C;  4X65 Q;  1X55 A;  2N88 A;  4DV5 L;  1IYU A;  4ZKC B;  4A3I B;  1X3F A;  1PH5 A;  1P16 A;  2CVR A;  2WII B;  1JJC B;  4IUU A;  1KD1 C;  2F0I A;  3ITP A;  4OON A;  2O5J C;  5IOC A;  3I4N H;  1SNO A;  1U9R A;  1ZYR C;  1E2V A;  1PH3 A;  3BVZ A;  3C1E A;  4S3S A;  2C9O A;  4K0K Q;  3HOV G;  2WIN B;  1PTO B;  1E24 A;  4IZ8 A;  3VR4 A;  2F4V L;  4U67 3;  2K75 A;  1JJG A;  2PYK A;  2A5H A;  3AYH B;  3RZD B;  5C6A A;  2JA9 A;  1D7Q A;  4A4I A;  2F0H A;  2XTI A;  1HUN A;  1EIH A;  4BBS G;  1E1T A;  4RA8 A;  4LFC L;  3VYR A;  2KJX A;  5JEA H;  1EOT A;  3KDF B;  4I65 A;  3J7A V;  1AEX A;  2PZT A;  3NBH B;  5BN5 A;  4LFC Q;  1SJH D;  3H94 A;  3A7L A;  4XIG S;  2ZXO A;  3LGJ A;  1V1P A;  3NUC A;  1BO0 A;  1F9S A;  3EA6 A;  4EQ5 A;  3JAM i;  3JAM c;  4RWS C;  2C5C A;  3R2T A;  4PMC A;  3DLL A;  2B2W C;  5JAV A;  4GKK Q;  1QE6 A;  5M3F H;  1TY0 A;  1ICF B;  1K0R A;  4N9T A;  4C3H H;  1EZ8 A;  3SEB A;  4DA2 A;  4IPH A;  2BE5 C;  1KLU D;  4JI5 Q;  3F2B A;  4GKJ L;  1E3P A;  1WTX A;  1HFG A;  2DJF C;  1U4R A;  3SXH A;  4HCE A;  4J15 A;  1N8R C;  2AHO B;  1HZA A;  1S4Z A;  3KYH C;  3BJU A;  3RZO H;  2R6G A;  1KL9 A;  1K9M C;  1II3 A;  4YIJ A;  2E75 C;  1QUQ B;  4UPA A;  4GKJ Q;  3R93 A;  4C1N K;  5C44 B;  1EEI D;  3SVM A;  2MP1 A;  3PUX A;  3TS0 A;  1K83 B;  1K8M A;  1VQB A;  2B63 B;  4NKL A;  3H3V I;  3PQI A;  2EIF A;  2A8V A;  1AZP A;  2WAQ E;  2BH8 A;  3CP0 A;  1YVC A;  2PW7 A;  1I4X A;  2E74 C;  3PO2 H;  1DCZ A;  2X6G A;  2YTY A;  3CME A;  2RDH A;  1PFN A;  2V1C C;  2B29 A;  3HOY H;  1NUC A;  3CRL C;  2HIX A;  2KCC A;  2B2T A;  4L63 B;  4RKL A;  1AW7 A;  5BN4 A;  2F0J A;  3S17 H;  4XTC S;  3MZ5 A;  4HMJ A;  1B9M A;  2D2C C;  1FJG L;  3S1N B;  4NMZ A;  2JE6 I;  4OHJ A;  4X3K A;  3KJP A;  1FNV A;  2MO1 A;  4AQY L;  2LS0 1;  2WB1 B;  2D62 A;  4AYB E;  2JYO A;  2R7F A;  2ALY B;  2NBF A;  4HAE A;  4A3M B;  3HG9 A;  1UE1 A;  2PNH A;  1H9S A;  3SR1 A;  5M3M H;  3BYT B;  4AQY Q;  1HH2 P;  1NMG A;  2VY3 A;  1CKN B;  1KQS A;  1MIU A;  4O0A A;  1ICW A;  3OMC A;  3ULJ A;  1OXU A;  4L5Q A;  1C9O A;  1D6E C;  2H4O A;  3T1Y Q;  2KHI A;  5FKA C;  3W3A A;  4DR4 L;  2WAQ G;  1O7L A;  5EPK A;  5T1G A;  4DR1 L;  2QW7 A;  2I5M X;  4CGY B;  2Z1C A;  4R8N A;  1SE8 A;  2NTT A;  5K36 G;  2BDO A;  4P74 A;  1XTD A;  2A6E D;  2MQH A;  4MTK A;  5CV4 A;  1CHQ D;  3Q22 A;  3S1Q H;  1RTO A;  2F03 A;  3FPP A;  2EPB A;  1LM0 A;  1PDQ A;  4DR1 Q;  1YNX A;  1FNW A;  2F3W A;  2K28 A;  1K8A C;  1PLF A;  1WI5 A;  2JXM B;  5ELC A;  3MXN A;  3DUZ A;  3MWY W;  2K1B A;  2FMC A;  1Q90 A;  3L7Z C;  3STB D;  4P71 A;  1QNK A;  4A3K B;  1K8G A;  3M4Y A;  1BBX C;  2GN5 A;  2RSO A;  1VQ9 A;  1BBU A;  1EQV A;  2D0O A;  1EQQ A;  5G3L F;  1PYW D;  2ID0 A;  1U0L A;  3HS0 C;  1Q81 C;  3TP6 A;  1Y1V G;  3H3V H;  1RIP A;  2F1M A;  1NSN S;  1KNA A;  4BBR B;  2QA4 A;  3K0Y A;  4HTH A;  2LY7 A;  5FJ8 H;  3OMG A;  1EYC A;  1L0X B;  1A8V A;  1SBB B;  2ICE C;  4L8J A;  2K5Q A;  4DV0 L;  1RF2 D;  1OXT A;  4N9P A;  2O4X A;  2RSN A;  4B9W A;  1X9N A;  3QR8 A;  3K7A H;  3NEN A;  2H1E A;  1HJP A;  3OIQ A;  3GTJ H;  1M90 C;  4C2M H;  2UU9 L;  3F2U A;  4RCN A;  3H3V C;  4UAI A;  2XVS A;  4DV0 Q;  4KJN A;  4HID A;  1KC8 C;  4TKO B;  5CV5 A;  2F0O A;  4FYD A;  1EWI A;  2SEB D;  3FP9 A;  1MSG A;  2EDG A;  4X62 L;  2UU9 Q;  4ABN A;  2OQ0 A;  5J22 A;  1Y1W H;  3GTG B;  1IXR A;  5ELF A;  2NYZ D;  3KF8 A;  1VDZ A;  1JE4 A;  1ILP A;  3BZK A;  3GTK B;  1S5F D;  1IL8 A;  3HKZ B;  4X64 L;  4HED A;  1WCM G;  2R3Z A;  4DV1 Q;  3A55 A;  4TVA B;  1KDC A;  3LX0 A;  2WKD A;  2JA6 H;  1EUJ A;  2VZA A;  4A3E H;  3HRZ C;  1A6X A;  4DUY Q;  1AZQ A;  2EXD A;  2E5L Q;  3D31 A;  1SDF A;  2EYM A;  1C8C A;  1VQG A;  2Q8R E;  3T4A C;  4G4K A;  4DR6 L;  1Y8N B;  1TWA H;  1SNM A;  3NTI A;  4L5T A;  1UE5 A;  5I9P A;  2YTX A;  5DAU A;  2AMC B;  5COR A;  1YIJ A;  3SE0 A;  2Y0S E;  3I4M G;  5LMU L;  5M5X B;  4BY1 G;  2JK8 A;  4UP9 A;  4A75 A;  3HOZ H;  5M3M G;  2E76 C;  3NBI A;  1VMP A;  5ELB A;  4QY7 A;  1CKM A;  2L55 A;  4LNQ A;  4ZUJ A;  3CHB D;  4JPB W;  1SND A;  4KD3 A;  1A2U A;  3GP7 A;  2EY5 A;  3E0E A;  3SK5 A;  3G71 A;  2PI2 E;  3PUY A;  5ELO A;  2K4K A;  1EZ6 A;  1T9H A;  1TS4 A;  3RLF A;  3PMF A;  4RFB A;  4DGZ A;  4P73 A;  4TRD A;  2KOL A;  2Z4I A;  2JN4 A;  2NN6 G;  1PA6 A;  5EPL A;  3K8A A;  3D6C A;  2K5N A;  4DAY A;  1XXG A;  4KY7 A;  1VF7 A;  5IYC H;  1N34 Q;  2IX3 A;  4B3S Q;  1GOZ A;  1H9R A;  1GUN A;  5L37 A;  3BDO A;  1I94 L;  3BDC A;  1DXM A;  3QB3 A;  1CHP D;  3KLS X;  5LL6 S;  3ULP A;  4DN4 M;  3AQQ A;  2J0T D;  3OHX C;  4ZAI A;  4DR2 L;  3IRB A;  1LT6 D;  4DUZ L;  5IGD A;  4X66 Q;  4YY3 L;  3J7A F;  1A3T A;  1Q8K A;  5CC4 A;  2K03 A;  2D5D A;  2IJ0 A;  2Y0S G;  1NR2 A;  1EY8 A;  2DNC A;  4DR2 Q;  4DUZ Q;  2R61 A;  2R93 G;  2HQL A;  3G6J B;  3CW2 C;  3U4V A;  4YY3 Q;  2RKS A;  3G4S A;  1D1K A;  1PV4 A;  2SDF A;  3D4D A;  4A3I G;  2ZJR A;  5IE8 A;  4J6H A;  4PZ6 A;  1L0W A;  3J7A 5;  4CBV A;  5BR8 L;  3RLN A;  3PIP A;  4A3C H;  1SE4 A;  4LJZ C;  1BOS A;  2NUC A;  1NAP A;  3TQY A;  3UDI A;  1CTM A;  3NP8 A;  2WAQ B;  1SNP A;  3F2C A;  5FO9 B;  2EY6 A;  3O13 A;  5BR8 Q;  3PV0 A;  3M85 A;  4JK1 C;  3TP7 A;  1B2T A;  1RJT A;  2F0G A;  4LF8 Q;  4BXX H;  3RNU A;  2DN8 A;  5EAY A;  3Q24 A;  3HZX A;  2EE1 A;  3M9B A;  5M9O A;  3VR3 A;  2CQA A;  4CJ0 B;  2YYZ A;  3RLO A;  3NPP A;  3HOX H;  2ZXP A;  2B2Y A;  2F3I A;  1JJ2 A;  2EOT A;  5IT9 E;  1CZG A;  3M7N A;  1KRS A;  3KK7 A;  4MTN A;  3NHH A;  2JA5 H;  3RMH A;  1EU3 A;  5J39 A;  1EOV A;  1KDB A;  3W1G A;  4IUP A;  4AYB B;  1Y1V B;  3OOC A;  2F0T A;  3GTO H;  1VQL A;  3DWP A;  3CCV A;  1AN8 A;  4X3S A;  2QCP X;  1SJE D;  1ET9 A;  2UXD L;  5M3F B;  1EY9 A;  4UDU C;  4XYQ A;  1XX8 A;  1MJE A;  1WTO A;  2K5D A;  1Z6H A;  2Z6K A;  5DLQ E;  3CC7 A;  1RKN A;  4OGQ C;  2A6H D;  2UXD Q;  4R4O A;  3IFD A;  1TY2 A;  2V4D A;  3DM1 A;  1N9W A;  3RZO B;  4JBK A;  4A3G H;  1A62 A;  3BVM A;  4F8M A;  2EZV A;  5JJZ A;  3NQT A;  1NTG A;  1J5E L;  1YNN C;  2RHQ B;  2R7Z H;  1EYA A;  3CCL A;  3J81 j;  2B63 G;  3H0G H;  4XDX A;  3IL8 A;  4EQO A;  2TMP A;  2XN9 C;  2AKW B;  1XPR A;  5FO8 B;  1SAP A;  1LT3 D;  2NVT H;  2E2J H;  1D5M C;  1JOK A;  4K6D A;  1IZ6 A;  4DK6 C;  3UDG A;  2KVM A;  3DWQ A;  3BU2 A;  4RGO S;  1YBY A;  4X3T A;  5KNC A;  3PIP 3;  1SXT A;  5E3F A;  1IYV A;  1VS0 A;  3CCR A;  2IHE A;  5IGF A;  2ZJP A;  3RN2 A;  3S1R B;  4DV2 L;  4KI0 A;  4CDE C;  1HQR D;  1XNQ L;  4WOR A;  1R4Q B;  3A8J E;  1Z9F A;  4P72 A;  2IHF A;  3KLS A;  3IFT A;  3CC2 A;  1BXT A;  3S1M H;  3CAM A;  4B3T L;  3FKI G;  3L9A X;  4FXG C;  1PMR A;  1X3P A;  4DV2 Q;  4A3L H;  4BY1 B;  4A3M G;  4P2C B;  4ZQ3 A;  1ZEQ X;  4FP5 D;  3MC0 B;  1EU4 A;  3HOW H;  4B3T Q;  5M3M B;  3TZU A;  3LWE A;  2N8N A;  4OWX B;  2G9H D;  4FF3 A;  1LLR D;  4JC0 A;  1OTC A;  4DXG A;  3KFU A;  5T1I A;  2MNA A;  1A3U A;  1BCP F;  2LMC B;  3I55 A;  3F2D A;  1IBK L;  3GTM H;  3ND9 A;  4GN5 A;  2N49 A;  4ME5 A;  5CV7 A;  2IWH A;  1I4G A;  1QJO A;  4WRD A;  4OIK A;  3S2D H;  1BCP C;  3CCS A;  3K57 A;  1VQC A;  3CD6 A;  1ZKO A;  1ONL A;  3AB9 A;  4K2K A;  2K5W A;  1QVC A;  1LTS D;  4HJ7 A;  1G2S A;  3FMC A;  1PZK D;  3NK9 A;  2Z6B A;  1U4L A;  2QKI C;  3RN5 A;  4OO1 I;  4LF4 Q;  4YWL A;  1J8I A;  2F0Q A;  3HP3 A;  4Y7N H;  3V05 A;  2PQE A;  1BDO A;  2UUA Q;  1VQH A;  3T51 B;  1SRU A;  3S1Q B;  4KK7 A;  3W1B A;  3HKZ E;  4CKC A;  5IP9 G;  4ULL A;  1L1O A;  4KV6 A;  5EPJ A;  5IT9 c;  3M4Q A;  2PO4 A;  3HOX G;  4DNT B;  1MSH A;  1LTR D;  2UXC L;  1VQI A;  4Q0F A;  4A3K G;  2CW0 C;  3GTQ B;  1I6H B;  2MFI A;  2Q2T A;  2I5L X;  3EBE A;  1QNU A;  2RA4 A;  4KHZ A;  2Y0S B;  2E8G A;  4ALP A;  1QZG A;  3HFZ B;  4BBR G;  2R93 B;  1KRT A;  1MBY A;  1SYB A;  2FHT A;  5IYD G;  2UXB L;  2AQ2 B;  1J6Q A;  2PPB C;  2OWO A;  2CHB D;  4HJ9 A;  1H9K A;  4JI7 L;  4A3D H;  5CGK A;  4FXD A;  4DV5 Q;  3CKI B;  1STE A;  2XRS D;  1YEZ A;  4A3F H;  4LUV A;  1WD0 A;  3KLR A;  4JI7 Q;  4JBM A;  5KYL A;  1M1K C;  5CV9 A;  2PCF B;  2PNR C;  3MFG A;  5EJW A;  1PVO A;  4K8I A;  3OIP A;  4GOP A;  4WFN 3;  1B1Z A;  2Q2H A;  3GO5 A;  1KAA A;  4XXE A;  2F4V Q;  2MO0 A;  3A54 A;  2CH4 W;  3HKZ G;  4LF7 L;  5FLM G;  3K5O A;  1N33 L;  2B2Y C;  4IQZ A;  3TS2 A;  1CK1 A;  1XMO L;  2L11 A;  3SHL A;  2NB0 A;  1W2B A;  1LT5 D;  1VMC A;  3CQZ H;  1H95 A;  1B44 D;  1YHQ A;  1TWF H;  1SFO B;  2XSC A;  2WKC A;  3DWA A;  3T56 B;  3CXC A;  4LFB L;  2VUM G;  1N33 Q;  2HDM A;  3I2Z A;  4A3E B;  4ZUI A;  5E4X A;  5HUR A;  5M5Y H;  1QB5 D;  4DV3 L;  3GTL H;  1JWS D;  4APV A;  3QOJ A;  1TS2 A;  1A15 A;  4A3J H;  5GAD C;  3K81 C;  1VQP A;  1GHK A;  4KY6 A;  5I2Y A;  1WTQ A;  2KEN A;  1IW7 D;  2Q8I B;  1XPU A;  2Z6K C;  1I4R A;  2QDL A;  1EY4 A;  2K50 A;  2A69 C;  1F9Q A;  2F0E A;  4OO1 H;  2C35 B;  1DON A;  4DV3 Q;  4QUF A;  2FMM A;  4K6L A;  4A93 H;  3K5N A;  2F3V A;  2CH4 A;  3KDF A;  1HFN A;  2WAC A;  3H09 A;  4RAU C;  3ZYY X;  1GUS A;  1M8A A;  1VQO A;  1WTR A;  5FO7 B;  4H13 C;  4QMG A;  1B70 B;  1HCZ A;  3SK8 A;  2B8F A;  5E4W C;  5A2Q L;  2R92 H;  4BY7 H;  1JIC A;  2BH2 A;  1ML0 D;  2OCE A;  2IX1 A;  3S15 B;  1PRT B;  3OW2 A;  2N55 A;  2X6L A;  2JA8 G;  5C0X J;  1V1Q A;  4NXN L;  5C0X I;  3MXG A;  4QCL A;  1FNU A;  2PW5 A;  4H7B A;  5C3E H;  1I3Q B;  4GZY C;  2CWA A;  2KCT A;  4O2D A;  3A74 A;  5CBA E;  2B8G A;  4XYO A;  2Q8T A;  3DXJ C;  5KNB A;  3HOU G;  2AUK A;  4ME3 A;  4IJL A;  5EKI A;  1ILQ A;  3ER0 A;  1SSO A;  3F1Z A;  1F77 A;  3FKI B;  1EY5 A;  1JOO A;  1WTP A;  1FJG Q;  1CA6 A;  4KD4 A;  3BZD B;  4C3I H;  3K80 C;  1WJJ A;  1B4O A;  2YU9 H;  1SRO A;  3A5Z B;  3VYT A;  5I4D A;  1PFS A;  4KKS A;  1B50 A;  4RKB A;  3CCJ A;  4ODG A;  5C5M A;  1LTI D;  4IOA A;  5JVH 3;  3MA2 B;  2P5Z X;  1SMX A;  4HIM A;  2VQF L;  3U9O A;  1XYI A;  3TZD A;  1GUO A;  4MZ9 A;  2WV6 D;  2CKZ B;  1XJV A;  3I4N G;  3LNN A;  2RQX A;  4RGT A;  2HCC A;  2IT1 A;  1C4Q A;  3SK6 A;  3IKJ A;  2VQF Q;  5LHY 1;  3A0J A;  1D5X C;  1PH9 A;  1STA A;  3EIV A;  4K5X A;  3U9S A;  3R3O A;  1G6Z A;  1S5D D;  4JI6 L;  3KF6 B;  3UDX A;  4L5R C;  3JAM L;  4DR4 Q;  1PZJ D;  4HSP A;  3MFY A;  4KTA A;  4GNX C;  3A5U A;  1L1O C;  5JEA G;  4LUO A;  2ZTD A;  3D6W A;  4X3U A;  2VB2 X;  2JA7 H;  3C1F A;  4DNI A;  1J9O A;  1TWG H;  4HSV A;  1Q86 C;  3HOX B;  3IAY A;  4JI6 Q;  2XGT A;  2RDG A;  1G8Z D;  2OT2 A;  3M3Y H;  3A8I E;  3K0X A;  4KY5 A;  1EY0 A;  1DYQ A;  1U4P A;  2EVB A;  4AYB G;  5FLX L;  1KIX A;  2EYP A;  1GM5 A;  1RDP D;  3GD7 A;  1XNR L;  3BS1 A;  1EFI D;  3GTO B;  1S5C D;  4K5W A;  4WJ4 A;  5M3F G;  1Y14 B;  4MIU A;  2F0M A;  4C3H G;  1FL0 A;  1I6V C;  2CFM A;  2HT1 A;  1EY6 A;  3CPF A;  4A3J G;  3BG3 A;  3G6E A;  4DK3 C;  1CQF A;  3KBG A;  1X32 A;  5C0X H;  2NVY H;  1XNR Q;  2XWJ B;  1JE5 A;  5E7N A;  5GAE C;  3V96 A;  1CQV A;  4FNF A;  5JJL A;  4IUT A;  1G91 A;  2BDN A;  1KAB A;  1Y8P B;  2VW9 A;  1RCV D;  5DM6 3;  3CCU A;  1SE2 A;  3G7L A;  1YJN A;  4DR7 L;  1C0A A;  3M4O B;  3NQI A;  2RF4 A;  2H5X A;  4PV1 C;  3U50 C;  5C3X A;  3X3M A;  4JBJ A;  5IY0 A;  4GOP C;  1JB7 A;  5GQO A;  3TRZ A;  4KKU A;  5IGG A;  3H0G B;  4JCV E;  1I4H A;  1FGU A;  4LF9 L;  3KOJ A;  1PTO H;  4DR7 Q;  4BA2 I;  4X62 Q;  1O7I A;  3PO2 G;  1CFM A;  2NVT B;  2E2J B;  2A6E C;  5C4J B;  3RZD H;  2G9D A;  1CA5 A;  3S14 H;  2LXK A;  1H9J A;  3HOY G;  1X3G A;  2RHS B;  1PTO F;  4E6I A;  2VUM B;  4X64 Q;  5IIF A;  4R8I A;  2VL6 A;  3FPU B;  1NMF A;  3STB C;  3AMU A;  1PZI D;  4LF6 L;  1PTO C;  2I46 A;  3NSW A;  2E2H B;  3OYY A;  5KRU A;  3NEM A;  1TWH B;  4YCW A;  1MD2 D;  1PRT D;  5JOB A;  4KHP L;  1JR0 D;  1TVX A;  4G7H C;  4P75 A;  2NVQ B;  2F0F A;  4LF6 Q;  4H44 C;  2GA4 B;  3J81 L;  4DR6 Q;  2RCF A;  2EJF C;  2JQO A;  4KHP Q;  3HOW B;  2BCO A;  2NZ1 D;  4NB3 A;  4LFA L;  3NTK A;  4NXM L;  1VF5 C;  4TSS A;  2VNU D;  3WDN A;  5LMU Q;  5GAG C;  5JJK A;  1PFM A;  2F52 A;  1TQO A;  1OXX K;  1VQM A;  3BZC A;  3Q8D A;  3GTM B;  1BKB A;  3OWF A;  1EYG A;  4UY8 C;  2VB3 X;  1V8Q A;  3TP5 A;  4LFA Q;  4OWT B;  1ROD A;  2IL8 A;  2N3S A;  1FR3 A;  2HD3 A;  1X56 A;  5C4X H;  4YCV A;  5C44 H;  2JA8 B;  4DK1 A;  2O5I C;  2AWN A;  2F0V A;  2F0W A;  3CU7 A;  1YJ9 A;  2F0K A;  2DGY A;  1PH2 A;  2A68 C;  5JJI A;  4RG1 A;  4AIM A;  3DMU A;  5IYB H;  1OXV A;  1BR9 A;  1YHA A;  1HNZ L;  3HOU B;  4NP5 A;  3I8Z A;  4LF5 L;  4HN7 A;  4IUR A;  1EWC A;  1X54 A;  3T1H L;  4YCU A;  2ZJQ A;  3P20 A;  3WOF A;  2BA0 A;  5DNF A;  3PIO A;  1I94 Q;  4LF5 Q;  2QEX A;  1K0S A;  5C3W A;  1A2T A;  3K58 A;  2B3G A;  3T1H Q;  3DHQ A;  5IP7 H;  3ND8 A;  1ESR A;  5FJ8 G;  1S72 A;  1L0Y B;  3UI2 A;  2OTL A;  1IKM A;  1STG A;  2MJ8 A;  2DJG C;  1RL2 A;  1D2B A;  1O7Z A;  3I4N B;  4C1N I;  2HHH L;  1AP0 A;  3ULL A;  3QIA A;  2ICI A;  1Q8I A;  3P7J A;  4KHV A;  1PH4 A;  2A1A A;  1TWC H;  1WFQ A;  4A3F B;  1EIF A;  4A3B H;  1V1O A;  2ZTC A;  4OX9 L;  1F2Y A;  2EYL A;  2JP1 A;  2SNM A;  1HPC A;  1GXD C;  2HHH Q;  3I70 A;  3H91 A;  4NDX A;  5ELE A;  1RHP A;  4MN3 A;  1Y1W G;  4V19 0;  1GD7 A;  2K5V A;  2K5H A;  4DR3 L;  1G29 1;  1YNN D;  3ZJY C;  4HJA A;  1JWM D;  1E2Z A;  2K7V A;  3FHW A;  4ILW A;  2Z8L A;  1HHV A;  4OEL B;  4DAM A;  1G6P A;  2N78 A;  2ZXR A;  3H6M A;  3VDY A;  4FF4 A;  3J7Y W;  1MGS A;  2JA6 G;  1HNW L;  3EJI A;  4DR3 Q;  1E7Z A;  3TBI B;  4C3J H;  4A3E G;  4GLX A;  3VR2 A;  1LO5 D;  1G51 A;  4V0B A;  3NE5 B;  3U4Z A;  3MHB A;  3N52 A;  4C3H B;  5M5Y B;  2R7D A;  1UAP A;  3S2H H;  1XTC D;  2FFK B;  4A3J B;  3PCO B;  2ZM6 L;  3M7G A;  5AJ3 L;  4MHE A;  3I56 A;  1YZ6 A;  3AU7 A;  3PSI A;  4ZRZ A;  2NTS A;  3J7Z C;  4HJ5 A;  2KCN A;  4UP7 A;  2ZM6 Q;  1YNJ C;  4J1M A;  5AJ3 Q;  1PH7 A;  3HOZ G;  1LUZ A;  3PIO 3;  3GV3 A;  3CF5 A;  4DAP A;  1SMY C;  4N8F A;  1UNS A;  3CCE A;  4QB4 A;  1UE6 A;  3TRE A;  1B3A A;  4BY7 B;  1A3V A;  2EY2 A;  2MUY A;  3HOV H;  3VR6 A;  5TSS A;  4F88 A;  4HJ8 A;  1J5E Q;  3G48 A;  1FVI A;  3PO3 H;  3PO2 B;  5DM7 3;  1W3S A;  3W2D A;  3V2T A;  4K8J A;  4DV4 L;  4GN3 B;  3K6O A;  1UEA B;  1P8L A;  4BBS H;  3HOY B;  3GTG H;  2F0U A;  1ASZ A;  1ENF A;  5C3E B;  5C4H A;  5IYC G;  2QGQ A;  1HA5 A;  3S24 A;  3GTK H;  3S17 B;  3EQL C;  4DV4 Q;  1SLJ A;  1SNQ A;  4EQP A;  2QIL A;  1EFW A;  3PUZ A;  1JB3 A;  4PZ8 A;  2WFW A;  2EXZ A;  1U5K A;  5BN3 A;  1S5B D;  2JJQ A;  5D14 A;  2AQ3 B;  3SDZ A;  1XNQ Q;  4B9X A;  5NUC A;  4K2L A;  3ICE A;  1BUV T;  3NWT A;  2CW0 D;  1EYD A;  1V43 A;  1LTA D;  2F4I A;  1Q82 C;  1CSQ A;  2OF1 A;  2QF7 A;  1UWV A;  1LAC A;  2JSO A;  2YU9 B;  1I4P A;  3ERQ A;  4R4C A;  3HGB A;  2J4X A;  4PMB A;  1TXY A;  3AFQ A;  1WTW A;  4IPD A;  2FJ2 A;  4JI0 L;  4FF1 A;  2NWG A;  4A3C G;  3BVG A;  4JW0 A;  1SEB D;  5FLX E;  1Q12 A;  1N32 L;  1IBK Q;  5EKL A;  1ZYR D;  5I6W A;  4FF2 A;  1KHI A;  4A3B G;  4JOI A;  1AH9 A;  4GS3 A;  1EIG A;  4JBW A;  1LT4 D;  3OSO A;  2MPM A;  4RMF A;  4B3M L;  5E1F A;  4BXX G;  4Y52 H;  4JI2 L;  3DM3 A;  4GNX A;  1Y8O B;  2VQE L;  4IUN A;  2HIV A;  3CPW A;  1TT2 A;  5HY6 A;  3I91 A;  3QO2 A;  4LWC A;  3R2I A;  5D3I B;  4B3M Q;  1HZB A;  4K5V A;  1CUK A;  4CDF C;  1R9T H;  2Q2U A;  2F0L A;  3M3Y B;  2VQE Q;  2JA5 G;  4JI4 L;  2K05 A;  5D3D A;  1NR4 A;  1C7Y A;  1KNE A;  4EGV A;  3QJY A;  2UXC Q;  1DGS A;  2LXJ A;  2XWB B;  1YJW A;  1YIT A;  5JPM C;  3FVQ A;  2MGS A;  4OXP A;  4X65 L;  4NPS A;  5GRO A;  2BE5 D;  1BBW A;  3PF5 A;  3K7A B;  3QWN A;  1JT8 A;  2AQ1 B;  2A69 D;  3WWV A;  1A63 A;  2UXB Q;  2F0D A;  3GTJ B;  2PQA A;  4JI1 L;  2YV5 A;  1F2L A;  4C2M B;  5KYI A;  1PH8 A;  1B3Q A;  4BA1 I;  1Z47 A;  5JVG 3;  4PNY A;  1FGB D;  4JV5 L;  5KGU A;  4A3G G;  1ET6 A;  1Y69 U;  3MXP A;  4L5S A;  4K0K L;  1V1P B;  1ENC A;  4CDD C;  3BYY B;  1UE7 A;  4JI1 Q;  5I2X A;  3E9H A;  4G7Z C;  2R7Z G;  1IHZ A;  1Y1W B;  4JV5 Q;  3Q0A A;  3H0G G;  2KBN A;  4J8Q A;  2RBM A;  4XQN A;  2EY1 A;  4R4I A;  3J81 E;  4RHS A;  1X6O A;  2IW3 A;  3E3X A;  1D5Z C;  3PUW A;  2EJG C;  3PO3 G;  5K36 H;  5ELN A;  2RCN A;  4RCO A;  3NXW A;  2JA6 B;  3S14 B;  2L4N A;  3WOE A;  2FXQ A;  4LF7 Q;  3MEF A;  4FDB A;  4R4Q A;  3NTH A;  3L2P A;  1LV9 A;  1I4Q A;  1XMO Q;  3J80 L;  3T16 A;  4PG3 A;  3QG1 A;  4DPG A;  1FD7 D;  2PI2 A;  1I50 H;  4CJ2 C;  2NVX H;  4GKK L;  4LFB Q;  4LW1 A;  4TQU S;  1TWA B;  3FRP B;  4FO2 A;  4CKE A;  2PZU A;  5CBE E;  4JYA L;  2CWP A;  1Q1E A;  3PUV A;  2ZTE A;  4JI5 L;  5FOB B;  4A3L G;  1VQ4 A;  1Y1V H;  2XNA C;  3HOW G;  3S16 H;  2QDB A;  2SNS A;  3HOZ B;  1NY4 A;  4NW2 A;  1QWY A;  3NBH A;  1BF4 A;  4JYA Q;  1VQ5 A;  2JEA I;  2NN6 I;  1EY7 A;  2LKV A;  3A8K E;  3B6Y A;  2VXW A; 
#chains in the Genus database with same CATH homology
 5FLX c;  3RLN A;  3CCU A;  3PIP A;  1YJN A;  1VQN A;  4A3C H;  4DR7 L;  1C0A A;  1PYS B;  3TQY A;  3CMA A;  3UDI A;  3F8T A;  2RF4 A;  2H5X A;  3U50 C;  5IY0 A;  1EQR A;  1GVP A;  3D0F A;  4JBJ A;  4GOP C;  5GQO A;  1JB7 A;  1N32 Q;  3TRZ A;  1XMQ Q;  5J3B A;  3H15 A;  3F2C A;  2OQK A;  5BR8 Q;  3PV0 A;  3M4P A;  3I4O A;  4GLA C;  2PMZ E;  3M85 A;  4LF4 L;  4AH6 A;  4JCV E;  2VS1 A;  1S3O A;  4YWK A;  1FGU A;  4LF9 L;  3KOJ A;  2CQO A;  1XPO A;  4DR7 Q;  2UUA L;  4QGU A;  4LF8 Q;  4BA2 I;  4BXX H;  3RNU A;  4X62 Q;  1O7I A;  2JA8 H;  3PO2 G;  5EAY A;  3PF4 A;  5IWA L;  2YTV A;  3M9B A;  3RZD H;  1MJC A;  4JI2 Q;  4HIO A;  4GLV B;  3E9I A;  1IL2 A;  3S14 H;  1H95 A;  2LXK A;  4NXN Q;  1VQE A;  2YYZ A;  3HOY G;  1X3G A;  2RHS B;  1WCM H;  3RLO A;  3HOX H;  4UP8 A;  4X64 Q;  2F3I A;  1JJ2 A;  1QUQ A;  2VL6 A;  1MKH A;  3M7N A;  1KRS A;  5IWA Q;  4MTN A;  3L0O A;  2ASB A;  3HOU H;  2PQA B;  1NMF A;  3STB C;  2JA5 H;  1LTL A;  2UUC L;  1EOV A;  1S40 A;  3S1R H;  1HNX L;  4LF6 L;  4JI4 Q;  3W1G A;  3OYY A;  3NEM A;  2L15 A;  4YCW A;  2Q2I A;  1HZ9 A;  4KHP L;  3GTO H;  1VQL A;  4IFD J;  3CCV A;  4PMW A;  1L2F A;  1E1O A;  4IFD I;  3KJO A;  4P75 A;  2UXD L;  4GOP B;  1YI2 A;  4HIK A;  3GTP H;  2UUC Q;  4LF6 Q;  1HNX Q;  1AE3 A;  1LYL A;  1Q46 A;  1VQ8 A;  1MJE A;  1PH6 A;  3EN2 A;  4DR6 Q;  3UDF A;  1IBL L;  1VQK A;  3K7U C;  2JQO A;  2Z6K A;  4KHP Q;  5DLQ E;  4X65 Q;  3CC7 A;  2NZH A;  4NB3 A;  4BY1 H;  4LFA L;  4NXM L;  1X55 A;  4DV5 L;  3I4M H;  2VNU D;  4A3D G;  2UXD Q;  5LMU Q;  1HZC A;  1X3F A;  5GAG C;  5JJK A;  2F52 A;  4R4O A;  1OXX K;  3MXN B;  3BZC A;  1VQM A;  1P16 A;  1PH5 A;  1KD1 C;  1JJC B;  1N9W A;  1HR0 L;  3Q8D A;  1IBL Q;  4A3F G;  4JBK A;  1BKB A;  1EYG A;  4A3G H;  4UY8 C;  1A62 A;  3T1Y L;  4OON A;  4JOI C;  4LFA Q;  4OWT B;  3I4N H;  1PH3 A;  2LSS A;  1NTG A;  1J5E L;  2N3S A;  4K0K Q;  3HOV G;  1HR0 W;  1X56 A;  2RHQ B;  5C4X H;  2R7Z H;  1E24 A;  4EX5 A;  3CCL A;  1HR0 Q;  2E2I H;  3J81 j;  4YCV A;  3H0G H;  5C44 H;  5M5W H;  2B63 G;  2AWN A;  2F4V L;  2K75 A;  1JJG A;  3AYH B;  3J81 i;  2D0P A;  3J81 c;  1YJ9 A;  2JA9 A;  4B3R L;  2AKW B;  2DGY A;  1XPR A;  4A4I A;  1QVF A;  1D7Q A;  2XTI A;  4POF A;  1PH2 A;  4BBS G;  1E1T A;  2NVT H;  2E2J H;  4LFC L;  5JJI A;  4RG1 A;  1IZ6 A;  4AIM A;  4DK6 C;  3UDG A;  4DKA C;  3BU2 A;  3UE0 A;  1OXV A;  1YBY A;  5IYB H;  1CKN A;  1YHA A;  3KDF B;  1HNZ L;  1VS0 A;  3CCR A;  2IHE A;  4B3R Q;  4LF5 L;  3NBH B;  2ZJP A;  3RN2 A;  1VQD A;  4LFC Q;  1X54 A;  3T1H L;  4XIG S;  4KI0 A;  3SGI A;  4DV2 L;  3KLW A;  2WP8 J;  4YCU A;  3LGJ A;  2ZJQ A;  1XNQ L;  2BA0 A;  3PIO A;  1I94 Q;  4EQ5 A;  1Z9F A;  3JAM i;  4P72 A;  3JAM c;  4LF5 Q;  2IHF A;  3AFP A;  4PZ7 A;  2QEX A;  3DLL A;  4GKK Q;  3CC2 A;  3S1M H;  3CAM A;  4B3T L;  3GTQ H;  3FKI G;  1I6H H;  1SR3 A;  2B3G A;  3T1H Q;  4DV2 Q;  5M3F H;  1NBW A;  4C3H H;  1K0R A;  5IP7 H;  4A3L H;  1X3E A;  4OO1 G;  5FJ8 G;  3KF6 A;  4IPH A;  4A3M G;  3KF8 B;  4JI5 Q;  3F2B A;  1S72 A;  4A93 G;  3HOW H;  1A0I A;  4IO9 A;  2R93 H;  2OTL A;  4B3T Q;  4GKJ L;  4H02 A;  2N8N A;  1E3P A;  4KLK A;  4OWX B;  4POG A;  1RL2 A;  4A3I H;  4JC0 A;  1OTC A;  1KXL A;  2K52 A;  1N8R C;  3CCM A;  4J15 A;  3KFU A;  2HHH L;  2MNA A;  2AHO B;  1HZA A;  3KYH C;  3ULL A;  3I55 A;  3BJU A;  3F2D A;  1IBK L;  3GTM H;  1PH4 A;  3RZO H;  2R6G A;  2A1A A;  2KCM A;  1KL9 A;  2N49 A;  4GN5 A;  1TWC H;  1WFQ A;  1K9M C;  1EIF A;  4A3B H;  1QUQ B;  4UPA A;  4GKJ Q;  2ZTC A;  4OX9 L;  1B7Y B;  3S2D H;  4BY7 G;  2R92 G;  2I5H A;  3CCS A;  2HHH Q;  1VQC A;  3PUX A;  3TS0 A;  3CD6 A;  1QVC A;  1VQB A;  1WYD A;  4HJ7 A;  1Y1W G;  1QVG A;  1GD7 A;  3H3V I;  2K5V A;  2K5H A;  1D8L A;  2EIF A;  4DR3 L;  1G29 1;  3CCQ A;  3ZJY C;  2WAQ E;  2A8V A;  4HJA A;  2BH8 A;  3RN5 A;  3CP0 A;  4OO1 I;  4LF4 Q;  1YVC A;  3FHW A;  4YWL A;  4DV1 L;  2CCZ A;  4LF9 Q;  3PO2 H;  4DAM A;  4Y7N H;  2YTY A;  4IOC A;  2IX0 A;  2N78 A;  5C3E G;  1K73 C;  2UUA Q;  1G6P A;  1VQH A;  3CME A;  1BVS A;  1SRU A;  3W1B A;  3HKZ E;  1EIY B;  3VDY A;  5IP9 G;  1L1O A;  2JA6 G;  1HNW L;  3HOY H;  2V1C C;  2B29 A;  4DV6 L;  3I7F A;  4DR3 Q;  5IT9 c;  3M4Q A;  4YHH L;  2HIX A;  1E7Z A;  4DUY L;  1VQ6 A;  4C3J H;  3HOX G;  4GLX A;  4A3E G;  3S17 H;  2E5L L;  4XTC S;  1VQI A;  2UXC L;  1G51 A;  4A3K G;  3U4Z A;  1SFO H;  4QIW E;  1FJG L;  1V9P A;  2MFI A;  4DV6 Q;  1GKH A;  2Q2T A;  1AE2 A;  2JE6 I;  4YHH Q;  2I5L X;  3EBE A;  2R7D A;  3KJP A;  1QZH A;  3S2H H;  2MO1 A;  4KHZ A;  3PCO B;  2E8G A;  2ZM6 L;  4AQY L;  4ALP A;  5AJ3 L;  1QZG A;  3I56 A;  1YZ6 A;  2IY5 B;  3HFZ B;  3PSI A;  4BBR G;  1VQF A;  1KRT A;  2D62 A;  4AYB E;  3J7Z C;  2R7F A;  4HJ5 A;  2ALY B;  5IYD G;  2UXB L;  1UE1 A;  1J6Q A;  4UP7 A;  2PNH A;  5M3M H;  2ZM6 Q;  4AQY Q;  2OWO A;  1I5F A;  5AJ3 Q;  4DAY B;  4HJ9 A;  1PH7 A;  1HH2 P;  1NMG A;  4JI7 L;  3HOZ G;  4A3D H;  1LUZ A;  2VY3 A;  4LUZ A;  2UUB L;  2ATW A;  4NXM Q;  4DV5 Q;  3GDE A;  1CKN B;  1KQS A;  3CF5 A;  4JI3 L;  1MIU A;  4O0A A;  3ULJ A;  1OXU A;  4A3F H;  1YEZ A;  4L5Q A;  4LUV A;  1C9O A;  3CCE A;  3ERS X;  1UE6 A;  3TRE A;  4JI7 Q;  3T1Y Q;  4JBM A;  2KHI A;  1M1K C;  2UUB Q;  4DV7 L;  1K83 H;  4JI3 Q;  3HOV H;  1Q7Y C;  1PVO A;  4HJ8 A;  1J5E Q;  3G48 A;  4DR4 L;  2WAQ G;  2B63 H;  1FVI A;  3PO3 H;  4GOP A;  1W3S A;  1JMC A;  4DR1 L;  3GO5 A;  2I5M X;  2Q2H A;  4DV4 L;  4GN3 B;  3U58 A;  3OTO L;  2F4V Q;  2MO0 A;  1SE8 A;  3S15 H;  5K36 G;  4X6A H;  1P8L A;  4LF7 L;  3HKZ G;  4P74 A;  4DV7 Q;  1XTD A;  5FLM G;  1N33 L;  4BBS H;  2MQH A;  3GTG H;  3TS2 A;  1N34 L;  4B3S L;  2JA7 G;  1ASZ A;  2I0Q A;  1NE3 A;  3S1Q H;  1XMO L;  5IYC G;  2QGQ A;  1LM0 A;  3S24 A;  4DR1 Q;  1YNX A;  1W2B A;  3GTK H;  4DV4 Q;  1K8A C;  3CQZ H;  1HNZ Q;  1SLJ A;  2K14 A;  1TWF H;  1WI5 A;  4QL5 A;  3OTO Q;  1YHQ A;  1N36 L;  3CXC A;  1I3Q H;  4LFB L;  2VUM G;  1B8A A;  1N33 Q;  2DUD A;  3I2Z A;  3L7Z C;  3PUZ A;  4PZ8 A;  3STB D;  1VQA A;  2WFW A;  1EFW A;  4P71 A;  1U5K A;  5H1S E;  4X66 L;  2JJQ A;  1K8G A;  3S1N H;  2GN5 A;  1VQ9 A;  5M5Y H;  1XNQ Q;  4DV3 L;  3GTL H;  4APV A;  1BBU A;  2D0O A;  1N36 Q;  1EQQ A;  3ICE A;  4A3J H;  5GAD C;  3K81 C;  2ID0 A;  1VQP A;  1U0L A;  1V43 A;  1Q81 C;  3FKI H;  1Q82 C;  1Y1V G;  1CSQ A;  1RIP A;  2JEB I;  2KEN A;  2Z6K C;  5LMN L;  1XPU A;  3H3V H;  1IYJ B;  2K50 A;  1UWV A;  5C0X G;  3HKS A;  2QA4 A;  1UEB A;  5FJ8 H;  2C35 B;  4IJH A;  4R4C A;  4A3M H;  4DV3 Q;  1A8V A;  2Z0S A;  4A93 H;  1TXY A;  5LMN W;  3KDF A;  4DV0 L;  3AFQ A;  5LMN Q;  1OXT A;  1SN8 A;  4GN4 B;  4IPD A;  4JI0 L;  1X9N A;  1X65 A;  1PH1 A;  3K7A H;  3NEN A;  1HJP A;  4IPC A;  3GTJ H;  1M90 C;  4A3C G;  4C2M H;  2UU9 L;  1VQO A;  1Q12 A;  1N32 L;  4DV0 Q;  1IBK Q;  1B70 B;  4HID A;  1KC8 C;  1KHI A;  4A3B G;  4BY7 H;  2R92 H;  4OX9 Q;  4JOI A;  1AH9 A;  1EWI A;  3NEL A;  2A19 A;  4DR5 L;  3FP9 A;  4GS3 A;  2BH2 A;  2OCE A;  4LF8 L;  4JBW A;  2IX1 A;  1IBM L;  4X62 L;  2UU9 Q;  2NZO A;  2OQ0 A;  3OW2 A;  4RMF A;  1Y1W H;  4B3M L;  4BXX G;  4IFD G;  1IXR A;  4Y52 H;  2JA8 G;  4JI2 L;  1PYB A;  3DM3 A;  5C0X J;  5HGQ A;  1V1Q A;  4QJF A;  4GNX A;  2VQE L;  3BZK A;  4NXN L;  5C0X I;  2HIV A;  3CPW A;  4DR5 Q;  4X64 L;  5HY6 A;  1ASY A;  4LWC A;  5C3E H;  1WCM G;  1IBM Q;  4DV1 Q;  2CWA A;  4TVA B;  4B3M Q;  1HZB A;  3RR5 A;  2KCT A;  4O2D A;  5IP9 H;  3A74 A;  1CUK A;  3PGZ A;  1EUJ A;  1NJI C;  2JA6 H;  1R9T H;  2VZA A;  3HOU G;  2Q2U A;  2VQE Q;  4ME3 A;  1E22 A;  4IJL A;  2JA5 G;  4JI4 L;  1HNW Q;  4A3E H;  3ER0 A;  3W5O A;  4DUY Q;  1VCI A;  1C7Y A;  1GO3 E;  4A3K H;  2EXD A;  3F1Z A;  2E5L Q;  2UXC Q;  1DGS A;  3D31 A;  2LXJ A;  4A76 A;  1YJW A;  2ES2 A;  1FJG Q;  1YIT A;  1VQG A;  1Q1B A;  4DR6 L;  1TWA H;  4OXP A;  4C3I H;  3K80 C;  1WJJ A;  4L5T A;  1UE5 A;  2YTX A;  2AWO A;  4BBR H;  4X65 L;  4NPS A;  1SRO A;  3A5Z B;  5GRO A;  2AMC B;  2YU9 H;  1PFS A;  1BBW A;  2BA1 A;  1YIJ A;  2Y0S E;  3CCJ A;  3I4M G;  5LMU L;  3PF5 A;  5IYD H;  4BY1 G;  2JK8 A;  2WB1 E;  1JT8 A;  4IOA A;  3WWV A;  1A63 A;  2UXB Q;  4UP9 A;  2PQA A;  4JI1 L;  2YV5 A;  1PH8 A;  1SMX A;  4A75 A;  4BA1 I;  1Z47 A;  3HOZ H;  4HIM A;  5M3M G;  2VQF L;  4IPG A;  1VQ7 A;  4JV5 L;  4A3G G;  4JI8 L;  4QY7 A;  4MZ9 A;  1CKM A;  3JC6 6;  4JG2 A;  2CKZ B;  1XJV A;  4L5S A;  4LNQ A;  3I4N G;  4K0K L;  2IT1 A;  1UE7 A;  4JI1 Q;  3E0E A;  3E9H A;  5C4X G;  2R7Z G;  2VQF Q;  3A0J A;  4JV5 Q;  1PH9 A;  3H0G G;  5C44 G;  3G71 A;  3M4O H;  2KBN A;  2PI2 E;  4JI8 Q;  2KHJ A;  3PUY A;  3EIV A;  5ELO A;  2K4K A;  4R4I A;  4JI6 L;  3KF6 B;  1T9H A;  1X6O A;  4R4T A;  3UDX A;  3RLF A;  2GVB A;  3PUW A;  4L5R C;  4DR4 Q;  3PO3 G;  4GNX C;  3A5U A;  1L1O C;  5ELN A;  4P73 A;  5JEA G;  5IYB G;  2RCN A;  4LUO A;  2NN6 G;  2ZTD A;  4MNO A;  5FLM H;  1PA6 A;  5GAH C;  3K8A A;  3TEH B;  2FXQ A;  2K5N A;  2JA7 H;  4DNI A;  4LF7 Q;  3MEF A;  1TWG H;  4FDB A;  5C4J H;  1Q86 C;  4YWM A;  4JI6 Q;  4R4Q A;  5IYC H;  1N34 Q;  3L2P A;  4B3S Q;  2XGT A;  4R1J A;  1XMO Q;  3M3Y H;  4PG3 A;  4DPG A;  4OWW B;  3K0X A;  1OXS C;  1I94 L;  1YHB A;  2VUM H;  1CKO A;  2PI2 A;  1I50 H;  2NVX H;  1VQJ A;  4GKK L;  1K3R A;  2GVA A;  3ULP A;  4AYB G;  4LFB Q;  3AQQ A;  4LW1 A;  1KIX A;  4DR2 L;  3CC4 A;  4TQU S;  3IRB A;  1GM5 A;  4QQB X;  2OTJ A;  4DUZ L;  3GD7 A;  4X66 Q;  1XNR L;  4YY3 L;  4JYA L;  2E2H H;  2CWP A;  4WJ4 A;  5M3F G;  1Q1E A;  1Y14 B;  3PUV A;  5IP7 G;  2ZTE A;  1CSP A;  4JI5 L;  4A3L G;  1TWH H;  1Q8K A;  2EQS A;  1FL0 A;  1VQ4 A;  1Y1V H;  2CFM A;  3CPF A;  4A3J G;  2Y0S G;  2HT1 A;  3G6E A;  4DK3 C;  4DR2 Q;  2WB1 G;  2NVY H;  4DUZ Q;  3HOW G;  3S16 H;  2NVQ H;  2R93 G;  2HQL A;  1XNR Q;  1NY4 A;  3CW2 C;  5JEA J;  3U4V A;  4YY3 Q;  5M5X H;  1JE5 A;  3G4S A;  5E7N A;  3UE1 A;  1PV4 A;  1VQ5 A;  2JEA I;  4JYA Q;  2NN6 I;  4A3I G;  5GAE C;  4GNX B;  5JJL A;  1L1O B;  3J80 i;  1WOC A;  3J80 c;  2ZJR A;  1KAW A;  5IE8 A;  3AEV A;  3B6Y A;  4PZ6 A;  1XMQ L;  1L0W A;  4WJ3 M;  3J7A 5;  1PHJ A;  2VW9 A;  5BR8 L;  4JI0 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...