1J5EQ

Structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Structure of the 30S ribosomal subunit.
pubmed doi rcsb
total genus 20
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2002-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1j5eQ00
1VQLA 3GD7A 1WOCA 4B3SL 4DV6L 3IRBA 4GNXA 3KF6B 3AQQA 4DV0Q 1P16A 2JQOA 4LF8Q 4YWMA 4POFA 5BR8L 4B3TL 4OWXB 3G48A 1JT8A 4EX5A 4NXML 3BZKA 3H3VH 1ASZA 1EIFA 2Y0SG 2JA6H 4A3LG 2V1CC 4KLKA 4OX9L 4UPAA 4AYBE 3PV0A 3HKZE 1FGUA 4IFDI 4PZ6A 1JB7A 1Y1WH 2ZTDA 3CCSA 3KF6A 3HOYH 2OTLA 3M4QA 4IJHA 4UP9A 5FLXc 3CCVA 3PF5A 1TWFH 1IBML 2YU9H 3CCLA 3H0GH 2VUMG 1K8GA 4LFAQ 4XIGS 1N33Q 2YTVA 3A5UA 3KJOA 4PZ7A 4LUOA 1GD7A 3LGJA 4NPSA 1YITA 3EBEA 1WYDA 4X62L 4A3BG 3KF8B 2DUDA 4LUZA 2I0QA 3GTPH 4BY7G 4KHPL 3HKSA 5E7NA 3OTOQ 1PFSA 2UXDL 3I4NH 4B3ML 3S2HH 3S17H 1YI2A 3CQZH 2B63H 1NMFA 1J6QA 2MQHA 3M4PA 1L0WA 4Y52H 2ATWA 4OO1I 5IYDH 4X65L 3NBHB 5C0XG 5M5WH 1QZGA 3TRZA 4HJ9A 4POGA 1UE5A 4DR4Q 4GKJQ 1I5FA 1G51A 3PCOB 4TVAB 1X55A 2QA4A 1FJGQ 3HOZG 1WCMH 4HJ8A 4L5QA 1XMOQ 4C3JH 2DGYA 3KOJA 4A3EH 2UUAQ 3T1HL 1VQCA 3PUVA 1QUQB 4DR5Q 2UXBL 4DV4L 3GTLH 3CMEA 1YJ9A 3F1ZA 3H0GG 4LNQA 4DV3L 2JA8G 3FKIH 2ZM6L 2UUCL 1GKHA 1HZAA 4BXXG 4LFBQ 3MXNB 2ZJPA 3S1RH 2K50A 2VY3A 1NJIC 4LWCA 2K5NA 4DK6C 2KENA 2QEXA 1YJNA 2LXKA 1S72A 1Z9FA 1WFQA 1A0IA 4JI4Q 3WWVA 4DAMA 2ALYB 2JE6I 3PUXA 4A4IA 4LF7Q 1HNWL 1BBUA 1Q12A 3M9BA 4IOCA 2WAQE 3HKZG 4GNXC 4X6AH 1X3GA 4GLXA 4EQ5A 1QVGA 2JA7G 1OXVA 4YHHL 2WFWA 2KCTA 1VQIA 1JE5A 2R92G 4DUYL 2GN5A 1K9MC 4B3TQ 1K83H 4JI0L 4IOAA 1YJWA 3B6YA 2GVAA 4NXMQ 1JJCB 2CWAA 3HOXH 4A75A 1PH3A 3CD6A 2ES2A 3CCJA 1VQKA 1P8LA 4OX9Q 4AQYL 4DPGA 4DR3Q 4P73A 3STBC 4JI5L 4A3JH 1B70B 4NXNQ 1HJPA 4PMWA 4JCVE 2YTYA 2YTXA 3RZOH 3Q8DA 3E0EA 2D0OA 3EN2A 4QQBX 2OTJA 3RR5A 1S3OA 2WB1E 1IXRA 1J5EQ 3GTJH 2E2JH 4JI1L 1L1OA 1PH5A 4A3GH 3U58A 1IBKQ 2UUBQ 4MTNA 5LMUQ 1AH9A 1SR3A 2QGQA 3TEHB 4X62Q 3AFQA 2VW9A 2NVTH 1NTGA 3NELA 3K81C 3J80i 4KHPQ 4KI0A 3I4MG 1IBLL 1JJGA 1VQ9A 2NN6G 5M3FG 1VQEA 2AKWB 4DV5L 1PV4A 3W1GA 4GOPA 1N8RC 4GKKL 4QJFA 1QVCA 1VQPA 3RLOA 3K80C 1X54A 1NMGA 1UE1A 4JBJA 4X65Q 5M5XH 4UP8A 2ASBA 3DLLA 5JJLA 1KRSA 2C35B 3PUWA 4PG3A 5C4JH 3S15H 5HY6A 3U50C 5LMNQ 4DR2L 3ERSX 2BH2A 1HNZL 2WAQG 4LF4L 2BH8A 5IYCG 2UXBQ 4DV4Q 4A3BH 4TQUS 2K5VA 3ER0A 2R93H 3J81c 5JJIA 4DV3Q 1EWIA 1RIPA 4O2DA 3GTQH 4BY7H 3KLWA 2IX1A 1BVSA 1SRUA 3CF5A 1X56A 2UUCQ 4A3GG 4GKJL 3BU2A 3F2BA 3UDFA 1NY4A 1C9OA 3CP0A 2A19A 2JA9A 5ELNA 4JI8Q 4C2MH 4A93H 2K4KA 2IY5B 1PYSB 3S24A 1K73C 1CSPA 1HNXL 1M1KC 1YHAA 1SROA 4DR6L 4JI6L 1VQNA 1I94L 4JBKA 1KRTA 2Q2IA 5IYBG 2I5LX 4DV1Q 2ZTCA 2IT1A 2VZAA 2K52A 2Q2TA 3GTKH 3W5OA 1K0RA 1VQOA 1XJVA 3HOZH 2CQOA 1I6HH 4L5TA 3PF4A 4PZ8A 1HR0W 1VQDA 3T1YL 4DUYQ 1SN8A 5IY0A 1VQ4A 3L0OA 2D62A 2JK8A 4OWTB 3S16H 1XPUA 1EYGA 2JA8H 1JJ2A 1CUKA 1Y1VG 4BXXH 4OONA 2UU9L 1E7ZA 1KC8C 5HGQA 1PYBA 2AWOA 2R93G 3MEFA 1E1TA 3ULLA 2VS1A 5H1SE 1TWGH 3RLFA 3CCRA 4HJAA 1VQMA 1YHQA 4MNOA 4JI5Q 2Z6KC 2YV5A 3I56A 4C3HH 2ZJQA 2VQFL 3I2ZA 1L1OC 3PUZA 4X64L 2LSSA 5M3MH 4XTCS 1D7QA 1MKHA 1TWHH 1KQSA 4A93G 2HIXA 2N49A 2GVBA 4QY7A 2N3SA 1VQGA 4GLAC 2JA7H 3PO3G 4P74A 4R4IA 2F4VQ 3CCEA 3KYHC 1GM5A 2R92H 4DKAC 1XNQL 4JI2L 4B3RL 1XMQQ 1HR0L 4GOPC 1Z47A 1X9NA 1KL9A 1N34L 4DV5Q 4IPHA 4IFDJ 3K0XA 1N32L 4L5SA 4GKKQ 4X66Q 4OXPA 3GTMH 2JA5G 4JV5Q 3AFPA 4YWLA 1HZ9A 2H5XA 4A3MG 1A62A 2OCEA 1VQ6A 4JI7L 2CKZB 2KHIA 4MZ9A 4BBRG 3RN5A 3H15A 1HNZQ 4AYBG 5M3MG 3KFUA 1QUQA 3I4OA 3JAMc 1X3FA 5M5YH 1JMCA 4O0AA 1ASYA 4A3DG 3CCQA 1D8LA 4DV6Q 4B3SQ 1XTDA 4GS3A 3H3VI 3I4MH 4DR7L 4IJLA 3KDFB 1YHBA 1BKBA 1A8VA 5M3FH 2CCZA 2KCMA 5BR8Q 2VQEL 1OXUA 2ZTEA 2VNUD 4JOIA 1HNXQ 2E5LL 2IHFA 4JI6Q 3M3YH 1I94Q 1OXXK 1Q1EA 3CC4A 3HOVG 2A8VA 4A3FG 3UDGA 1TWCH 2EXDA 1X3EA 3L2PA 2JJQA 4DR1L 1E3PA 4BA1I 3G71A 1M90C 2OWOA 1LYLA 1YVCA 3RN2A 1A63A 1U0LA 3KDFA 1UWVA 1Q86C 1MIUA 5IYCH 4BY1H 4DNIA 1IBMQ 3HOWG 4YWKA 5IWAL 1N36L 3UDIA 4R4CA 3J7ZC 3CC2A 1PVOA 2F3IA 2MFIA 1XNRL 4AIMA 2UU9Q 1V1QA 1PH1A 4LFAL 4APVA 3M7NA 1DGSA 2UXDQ 5C4XH 1VQBA 3CC7A 1EIYB 1FL0A 4RMFA 1CKOA 1SFOH 1LTLA 1OXSC 3KJPA 5EAYA 4A3KH 5K36G 4YCWA 4L5RC 1OXTA 2VQFQ 2PQAB 3G6EA 2RHSB 3VDYA 4A3IG 5IYBH 4GN3B 3GDEA 1X6OA 2CFMA 2N78A 5GAGC 1XPRA 1O7IA 3OTOL 3PO2G 3NEMA 4R4OA 4R4QA 3U4ZA 4LF6L 3A74A 4IPDA 1K8AC 4YCUA 2XTIA 2K75A 5DLQE 3GTGH 4NB3A 4DK3C 5GAHC 5IE8A 1MJEA 1X65A 4ME3A 4JI2Q 5FJ8G 4RG1A 1XNQQ 2R7ZG 4B3RQ 2UXCL 4KHZA 1Y1VH 4HIDA 3D31A 2R7DA 1L2FA 2PQAA 3W1BA 3T1HQ 1W3SA 1YNXA 1IZ6A 4BY1G 4LF5L 1FJGL 1N9WA 4P71A 1N32Q 5AJ3L 3HOUH 1PH7A 5C44H 3AYHB 3TS0A 2ZM6Q 2EIFA 1MJCA 1PH8A 1Q8KA 2XGTA 2OQ0A 2JEBI 4IFDG 5C4XG 3D0FA 1E22A 4GNXB 1SMXA 3I55A 2PNHA 5C3EG 4LFBL 4DV2L 4YY3L 3PO3H 4IPCA 4A3KG 1KXLA 1KAWA 4LW1A 1UEBA 1HNWQ 5IP7H 2RF4A 2NN6I 2F52A 2PMZE 3F2CA 2E2IH 4BBSG 3RLNA 4JI4L 2Q2UA 4LUVA 4P72A 1KIXA 1VQFA 3CW2C 4LF7L 4YHHQ 2RHQB 2AMCB 2CWPA 3F8TA 2WB1G 3UE0A 4J15A 4QGUA 1YIJA 1AE2A 3S1QH 1EOVA 3UDXA 1LM0A 2VQEQ 2NZOA 3CMAA 3I7FA 4JI0Q 2E5LQ 3TS2A 1E24A 1Q46A 4B3MQ 2LXJA 4JG2A 5IP9G 1QZHA 5JEAJ 4YCVA 2JA5H 3M85A 4AQYQ 4DR1Q 2I5MX 4LF9L 3HOUG 4OO1G 1BBWA 5C44G 4A3MH 5J3BA 3PUYA 1Y14B 3ULJA 1HH2P 1R9TH 4JYAL 4BBRH 1HZBA 4DR3L 1CSQA 2MNAA 4BA2I 4NXNL 1QVFA 4A3CH 5IWAQ 1N36Q 3NENA 4JI1Q 4C3IH 3CCUA 1XPOA 1KHIA 5LMNW 1TXYA 2JEAI 4Y7NH 1PH4A 2NVQH 4A3DH 1XNRQ 3E9IA 2ZJRA 1VQJA 1J5EL 5IP7G 2EQSA 3CPWA 4IPGA 2KBNA 3J7A5 3AEVA 1I3QH 3RZDH 4IO9A 1IBKL 2UUBL 1NE3A 2MO0A 5LMUL 1IBLQ 4DV7L 4HIMA 3RNUA 3HOVH 3J80c 2AWNA 2OQKA 4A3FH 1TWAH 5GADC 1VQHA 4K0KL 4LF6Q 1IYJB 2E8GA 3DM3A 1PH9A 4UY8C 4WJ3M 4DUZL 2K14A 3ICEA 1VQ5A 3HOWH 1CKNB 2E2HH 2K5HA 4JI3L 2UXCQ 1VS0A 3EIVA 4DR2Q 2JA6G 1WJJA 3S14H 1K3RA 4LFCL 4JBMA 3CPFA 4LF5Q 1B7YB 4LF4Q 1V9PA 1YBYA 4R4TA 3PIPA 4A3CG 3G4SA 5AJ3Q 5LMNL 3J81i 1WI5A 1Y1WG 2HHHL 5GROA 3HOYG 3JC66 5C0XI 4A3IH 1VQ7A 2WP8J 4JC0A 1CKNA 1H95A 3PO2H 4DV0L 4DR6Q 4P75A 4YY3Q 4DV2Q 3U4VA 3GO5A 4JI8L 2YYZA 1C7YA 3A0JA 4LF8L 5FLMH 1YEZA 3F2DA 2HQLA 4QL5A 2R7ZH 3J81j 2B29A 2IHEA 5FJ8H 3I4NG 3CAMA 2I5HA 3HFZB 1SE8A 4DV1L 4ALPA 2NVYH 1U5KA 2R6GA 1PH6A 1Q82C 2B63G 3T1YQ 3STBD 2KHJA 1CKMA 2BA0A 5IYDG 1EQRA 1HZCA 3BJUA 2L15A 5ELOA 3PIOA 3PGZA 4HIOA 1KD1C 4HIKA 1G6PA 5JJKA 4DAYB 2MO1A 1VQAA 1AE3A 4HJ7A 5IT9c 1EQQA 1GVPA 2N8NA 1WCMG 1L1OB 2RCNA 3K7AH 4R1JA 1N33L 4LF9Q 3A5ZB 3M4OH 5GAEC 2AHOB 5C3EH 4A3EG 3FHWA 1FVIA 2Y0SE 4JYAQ 1T9HA 4X64Q 3OW2A 3CXCA 4HJ5A 3S1MH 2BA1A 1W2BA 1UE7A 1RL2A 1V43A 4BBSH 5JEAG 3TREA 3FKIG 4GN4B 5C0XJ 3K8AA 2Q2HA 1G291 1PHJA 1EFWA 1I50H 3S2DH 1Q1BA 1YZ6A 3GTOH 2Z6KA 1SLJA 1E1OA 5FLMG 2B3GA 4GOPB 1VCIA 3TQYA 2A1AA 2Z0SA 3BZCA 4GLVB 2F4VL 1Q7YC 4QIWE 2PI2A 3SGIA 4DV7Q 1HR0Q 4DR4L 1S40A 5IP9H 5GQOA 1N34Q 1C0AA 2IX0A 1XMQL 1Q81C 1XMOL 4K0KQ 2UUAL 3ZJYC 4A3LH 4DR5L 3K7UC 4DUZQ 3L7ZC 3FP9A 4OWWB 4GN5A 2FXQA 4X66L 3OYYA 3ULPA 2R7FA 1LUZA 3UE1A 2NVXH 3HOXG 4WJ4A 4UP7A 4JI3Q 2HT1A 4FDBA 2ID0A 1VQ8A 1UE6A 4JI7Q 4LFCQ 1PA6A 1NBWA 3S1NH 4JV5L 3E9HA 2VUMH 2PI2E 1OTCA 3JAMi 4A3JG 3PSIA 4AH6A 4JBWA 1EUJA 2HHHQ 1PH2A 1IL2A 4DR7Q 4H02A 1GO3E 2D0PA 3CCMA 4A76A 2VL6A 2HIVA 4JOIC 1B8AA 2NZHA
chains in the Genus database with same CATH superfamily
3GD7A 3GTMB 2DN8A 4NP5A 4GNXA 3KF6B 3R8BA 4X3SA 4DV0Q 4LF8Q 4B3TL 2EE1A 1QE6A 1H9MA 2OF1A 2RVLA 3MXUA 2Z9HA 2B8GA 3QOLA 4PQXA 4FF2A 3HKZE 4PZ6A 3CCSA 3HOYH 2OTLA 1ENFA 1B9NA 5JAVA 3H0GH 5E4WC 4LFAQ 3KJOA 3M3YB 3QIAA 4NPSA 1H9SA 1XXGA 3MFGA 4A3BG 4BY7G 2PZTA 3Q23A 2WAQB 4B3ML 3A7LA 4HR7B 4R8IA 1PFMA 4LMQD 1L0WA 3ERQA 1B9MA 2EYPA 2AQ1B 1PTOD 1SSOA 2QDBA 5M5WH 1QZGA 4HJ9A 1G51A 5C4XB 3PCOB 1X55A 1WCMH 1PZJD 4HJ8A 4L5QA 2F0MA 3QG1A 1Z6HA 3T1HL 4DR5Q 3GTLH 1DOKA 1F2ZA 2NTTA 2UUCL 4LFBQ 1QNUA 1A0IA 3MTSA 1IW7C 3KK7A 3NXWA 3PUXA 1F9PA 1Q12A 2WAQE 4X6AH 4KD3A 3C46A 2JA7G 2K28A 4KJOA 1J8IA 3P1HA 1JE5A 5JVG3 1HUMA 5KRUA 4JI0L 1DOLA 1I4RA 4IOAA 1YJWA 3CD6A 2F1MA 3DEOA 4J1MA 3SXHA 4P73A 2RCFA 4JI5L 3MEHA 1B70B 3I73A 1HJPA 1WTOA 4JCVE 1C8CA 5I9PA 2MGSA 3S1QB 3IFTA 2D0OA 2F0OA 2HCIA 1BCPF 1J5EQ 1GXDC 4JI1L 2B2TC 3U58A 5D14A 3K59A 3TZDA 2EYOA 4MIUA 5IGEA 3AFQA 1CQVA 5E3FA 2NVTH 3J80i 2A73B 4E6IA 4KHPQ 2SOBA 2PO4A 4KI0A 3J81L 3R93A 4BBRB 4DV5L 5M3FG 4XQJA 2X69A 4C3IB 4A3DB 4QJFA 2Z4HA 2WINB 3RLOA 1NMGA 4X65Q 3E0JA 3A55A 1SYDA 4UP8A 2ASBA 5JJLA 1BO0A 2XIWA 3S15H 2BH8A 5IYCG 4K5WA 4A3BH 3D4RA 4BY7H 2EJFC 4DK1A 1ICFB 4RHRA 1SRUA 3TDQA 3CF5A 4A3GG 3S9WA 1NY4A 4JI8Q 1QG7A 2JA9A 2L0CA 2PZWA 4C2MH 4K5XA 4L8JA 4XDXA 1B53A 1CSPA 1M1KC 2E74C 2EJMA 1VQNA 1KNEA 2CW0D 1HXYD 5IYBG 2I5LX 4DV1Q 2K52A 2AUJD 3GTKH 2XWBB 5JOBA 3DEPA 1AP0A 4A3IB 5FO7B 1PZID 1VQDA 4DUYQ 2D62A 2JK8A 4EQPA 3S16H 3PO2B 3IAYA 3A8KE 2O2LD 1Y1VG 1HTLD 2NBFA 3EROA 5HGQA 2AWOA 4RA8A 2R93G 3MEFA 1E1TA 4HCEA 3RLFA 1YHQA 3I2ZA 1L1OC 2B2YA 4XTCS 5BN5A 3K5OA 1MKHA 2N49A 4GLAC 2OT2A 2JA7H 1UUPA 3HS0C 4R4IA 2F4VQ 1GM5A 5L37A 3HOXB 1XNQL 4ULLA 1EY8A 1WD0A 1MBYA 4XXEA 1HR0L 2G9HD 3T16A 1KL9A 4IFDJ 3K0XA 4U673 1EYDA 1N32L 4GKKQ 3NBIA 2C9OA 3M4YA 4RKLA 4FNFA 2BCOA 1LTRD 3V2TA 4YWLA 1HZ9A 2H5XA 1G91A 1A62A 2CKZB 4RCNA 5FO9B 3RN5A 3I4OA 4CKBA 1Q3LA 5M9OA 3KBXA 2Y0SB 2O5IC 4DR7L 1VMCA 4IJLA 5C5LA 3VR5A 1WTWA 5ELFA 2K05A 5M3FH 1LO5D 1I4GA 5KYLA 2VQEL 4K14A 2VNUD 2E5LL 2IHFA 1AEXA 1I94Q 1OXXK 1Q1EA 2ICEC 1F2YA 3CC4A 3HOVG 4A3FG 1E2WA 2EXDA 5KNBA 4CJ0B 3L2PA 1E3PA 4BA1I 1WTRA 2OWOA 3VYSA 3KDFA 3BDCA 4TRDA 1UWVA 5IYCH 3GTQB 4YWKA 3UDIA 1IL8A 4QUCA 3J7ZC 2F3IA 2MFIA 4AIMA 2UU9Q 3VYRA 3I72A 2AQ2B 1DGSA 1VQBA 1EIYB 4RMFA 1CKOA 4G7HC 2ENBA 4LJZC 4N9TA 4A3KH 1VF5C 2VQFQ 2PQAB 3G6EA 1V1PB 4B3MQ 5IYBH 4GN3B 2N78A 2I46A 4ME5A 1XPRA 3CKIB 3HOYB 4LF6L 3H0GB 2K75A 2PQEA 4NB3A 4NKLA 2JA8B 5GAHC 4RGMA 5IE8A 4ME3A 4CJ1B 1Y1VH 4HIDA 2R7DA 3T1HQ 1M4VA 5D65A 1SYEA 3HOUH 1EYAA 3ND8A 3TS0A 4FYDA 2F0IA 1U4PA 4PMBA 5C4XG 1E22A 1STBA 5M5WB 3I55A 4DV2L 2KJXA 1HFGA 5IP7H 1KABA 2F52A 2PMZE 3J7YW 3F2CA 3ZYYX 3RLNA 1KIXA 4HAEA 3GTLB 3F8TA 2IJ0A 3UDXA 2HDLA 2HCCA 4JI0Q 3I7FA 1E24A 1Y69U 1RJTA 2KEEA 3VYTA 2LXJA 4JG2A 2F0LA 2FMMA 1L0XB 4QF4A 5CV8A 4JVZA 2LS01 4DR1Q 4R8NA 3PUYA 1Y14B 3ULJA 1ONLA 5FOBB 4NXNL 5IGDA 2J7ZA 1QVFA 2CHBD 3R2IA 1H9JA 4JI1Q 4G7OC 1XPOA 1KHIA 5LMNW 1SMYD 5AFWA 1PH4A 4FF4A 4KHVA 3E9IA 1K0SA 2KOLA 4IPGA 2KBNA 3J7A5 3AEVA 1I3QH 1MHWC 4IO9A 1IBKL 2UUBL 4WORA 3GP7A 5LMUL 1Y8PB 3DXJC 4HIMA 3GV6A 3RNUA 2B2TA 5EPLA 5KNCA 1MSHA 1D1IA 4A3FH 3HOVH 4X3UA 5IGGA 2RBMA 1MD2D 1TIID 1IYJB 1ZYRD 1M8AA 2K14A 3SR1A 1SYCA 1A6XA 1CKNB 4DA2A 2K5HA 3EJIA 2AUKA 2NVTB 4LFCL 1RD9D 5EBDA 2EYJA 2F0NA 4C3IG 5GROA 5CYUA 4DK0A 1PZKD 1CT1D 1AN8A 4DV0L 3U4VA 3GO5A 4LF8L 5CV5A 2JYOA 1EEID 1EWCA 4ZAIA 3CAMA 4ALPA 2NVYH 1U5KA 2B63G 2MPMA 2XVSA 4BY7B 1TT2A 2MP1A 3STBD 5ELCA 1KD1C 2QILA 4C2MB 1GVPA 2N8NA 2JXMB 3VR6A 3M4OH 1L0YB 4EQOA 4OHJA 1GUGA 3FHWA 1FVIA 3OW2A 3S1MH 1UE7A 1V43A 4GN4B 2DY7A 5EPKA 5LL6X 2IW3A 1PHJA 1EFWA 1QWYA 2Z8LA 4DAYA 3GTOH 3S16B 1JICA 4GOPB 4RKBA 1WTQA 2Z0SA 2LKVA 3OMCA 4QIWE 2PI2A 5G3LF 3JAME 1HR0Q 1S40A 1V1PA 3CRKC 2IX0A 1C0AA 4K8IA 4TKOB 2F0DA 4K0KQ 3MZ5A 4DR5L 1GUSA 5CGKA 4DUZQ 2B2WA 2FXQA 1LABA 1LUZA 3HOXG 1ESRA 1R4PB 2K6AA 2K5DA 1Y8NB 4A3JG 3IL8A 4KKTA 1EUJA 1F2LA 2HHHQ 4DR7Q 1BXTA 4A76A 1GO3E 3CCMA 2Q8RE 1B8AA 4WRDA 4DV6L 3K5NA 3AQQA 3X3MA 1NAPA 2E75C 3QWNA 1JT8A 4EX5A 3S14B 2G9DA 4CDFC 2Y0SG 4DGZA 2V1CC 4KLKA 2NUCA 5EKLA 4ZK9B 5DM73 2F0QA 5M3FB 3E5SA 3CCLA 3KLSX 3CCVA 3PF5A 3LWEA 1SNMA 1N33Q 4XIGS 4WFN3 4PZ7A 4LUOA 5IGBA 1YITA 3EBEA 3NP8A 1KNAA 2R7ZB 2DUDA 2I0QA 5D3IB 3GTPH 4KHPL 1R4QB 3HKSA 4OL7A 5E7NA 4DAPA 1PFSA 3NQTA 1EWHA 2PPBC 1GJXA 3OWEB 1LTGD 2B63H 5FKAC 2MQHA 3AB9A 1PRTF 3K5LA 2ATWA 1S5CD 5C3XA 1I4PA 4X65L 5C0XG 1II3A 2XRQD 4DR4Q 3KF8A 1I5FA 1TY2A 4F87A 1MI2A 4A3KB 1PFNA 4C3JH 1W6KA 1VQCA 1OO9B 2IWHA 4BBSB 3CMEA 3F1ZA 3H0GG 4LNQA 4KV6A 2JA8G 3S2DB 2ZM6L 2RSOA 2KQ3A 2K50A 3HP3A 1NCVA 4LWCA 1J9OA 5EPJA 2KENA 2LXKA 3MAQA 3TP5A 3DM1A 5COYA 2ALYB 4A4IA 1RTNA 3VYUA 3NUCA 1BBUA 1EEFD 3HOUB 4GLXA 2A6HD 1QVGA 4YHHL 1BBXC 1VQIA 1O7YA 2NN6H 4DUYL 2GN5A 3I4LA 3T56B 1K83H 2XNAC 4FVMA 4NXMQ 2GVAA 2CWAA 3HOXH 3S1NB 2H4OA 4CJ2C 1B50A 1VQKA 2M00A 4OX9Q 4AQYL 4DPGA 1LTID 1RTOA 4A3JH 4NXNQ 4PMWA 2YTYA 2DY8A 5CC4A 3C2PA 3AU7A 1CZWA 1IXRA 2E2JH 1IBKQ 2UUBQ 4MTNA 5LMUQ 1AH9A 1SR3A 1BCPC 2QGQA 2L1BA 1LTAD 1Y8OB 2EZVA 3K81C 2OEOA 2JA6B 2MHVA 1VQ9A 1VQEA 2AKWB 2K33A 4K2LA 2WACA 4GOPA 4GKKL 3HEJA 2E2DC 1UE1A 4K6DA 1LT6D 3URYA 3DLLA 1I3QB 3DUZA 3O13A 2C35B 3K57A 4DR2L 3ERSX 2BH2A 3HOVB 4DV4Q 5HURA 3J81c 2F0SA 3I4NB 1JOKA 5JJIA 1EWIA 2N55A 4O2DA 3GTQH 2IX1A 1BVSA 1VF7A 3CQZB 1DJRD 4UDUC 5IT9E 3UDFA 2KUMA 3CP0A 5ELNA 2A19A 2K4KA 3Q6SA 1PYSB 3FPPA 3P7JA 3TSSA 1YHAA 1SROA 3DMUA 4DR6L 3D8GA 1I94L 5C0XH 2Q2IA 1SNDA 1ZXTA 2VZAA 5EBCA 3OHXC 1V8QA 4FXDA 4L5TA 4CKCA 3PF4A 1ENCA 3SEBA 1FNUA 1SN8A 1VQ4A 1XPUA 1EYGA 2JA8H 1CUKA 2UU9L 4JK1C 1E7ZA 1I4XA 2VS1A 4MNOA 3ITPA 2NVYB 3I56A 4C3HH 2F0VA 2VQFL 3G7LA 1A2TA 2D5DA 1CTMA 1BQQT 4YIJA 2SEBD 2HIXA 2N3SA 1VQGA 1QILA 3KYHC 2EY1A 3M4OB 1JOQA 3M7GA 1F2MA 3JAML 2H1EA 1JQYD 1PTOF 1WD1A 1Z47A 3S1MB 1N34L 4IPHA 1VMPA 1QOHA 1JOOA 1SNCA 3LNNA 4IUPA 4PMCA 4JPBW 5CV6A 3GTOB 3GQBA 3AFPA 5I2YA 1ILQA 2LFNA 4JI7L 4OIJA 1HNZQ 3DWQA 3H15A 5CV4A 3KFUA 1X3FA 5M5YH 1JMCA 1CI3M 1MGSA 4DV6Q 1XTDA 5FLXE 1EOTA 2GA4B 5DM63 3KDFB 1KDBA 1D1KA 3MXGA 5EKKA 2CCZA 2EYHA 1LLRD 1OXUA 2ZTEA 3KUPA 5LL6S 1HNXQ 4JI6Q 1Q8IA 1HTPA 4DR1L 1CA6A 3P20A 1LYLA 1U0LA 5I2XA 1Q86C 1MIUA 4DU9A 4BY1H 2EY5A 3E3XA 1JE4A 1ILPA 1STNA 4R4CA 3KLSA 3CC2A 1PVOA 3BVMA 1XYIA 1FNWA 1V1QA 4DNTB 1F9RA 3MC0B 1PH1A 4LK1C 3CC7A 1SFOH 1OXSC 4YCWA 3WOEA 4WJ4A 2RHSB 1X6OA 5GAGC 4QB4A 3OTOL 4R4OA 3U4ZA 3A74A 5DLQE 2R7ZG 1X65A 4JI2Q 4B3RQ 4KKSA 1X32A 3D31A 1B3AA 1L2FA 4FF3A 3GTPB 1IZ6A 1FJGL 1N9WA 1TVXA 4P71A 1K8OA 5C44H 1STAA 3AYHB 2PYKA 2ZM6Q 2L11A 2B63B 4ZRZA 3SK6A 3T13A 2OQ0A 2Q8IB 4KK7A 2Z4IA 1SMXA 2A6EC 3SHLA 2E76C 4A3KG 3NSWA 1KAWA 4LW1A 2NN6I 2MUYA 4OGQC 1JJGA 4BBSG 4LUVA 3BYYB 4C3JB 4LF7L 1YNJC 4YHHQ 5DAUA 1HUNA 2XSCA 4QGUA 2G5DA 3PQIA 1EU3A 5A2QL 3Q22A 4HSVA 3M85A 4AQYQ 3NTIA 2I5MX 3HOUG 1O7ZA 5J3BA 4OEMB 1HH2P 3H94A 1EZ6A 1HZBA 4BA2I 3I4MB 5IWAQ 1N36Q 2JEAI 2NVQH 1TXYA 3NK9A 1K83B 1VQJA 5IP7G 2EQSA 2F0GA 4Z9CB 4MN3A 4B9WA 3WOFA 4A3JB 5EJWA 4K0KL 1DCZA 2O4XA 4F88A 1U4LA 4UY8C 4DUZL 2E2JB 1VQ5A 4KY5A 2UXCQ 1CHPD 1VS0A 3EIVA 4DR2Q 2JA6G 2RDGA 2J4XA 1F77A 3Q0AA 3S14H 1D6EC 1U4RA 4LF5Q 1V9PA 3G4SA 5AJ3Q 5LMNL 3J81i 3ONAB 2HHHL 1IW7D 1U9RA 5C0XI 4QUFA 4JC0A 2B2VA 4ZUJA 1H95A 4CGYB 4P75A 4DR6Q 3NWTA 2YYZA 1C7YA 3E6ZX 2WIIB 5FLMH 3F2DA 4M8AA 2R7ZH 3I4NG 2KVMA 1TS3A 5FO8B 2I5HA 1SE8A 2L55A 5KIXA 1KDCA 1B4OA 2KHJA 2BA0A 4ABNA 1EQRA 1HZCA 3T51B 2L15A 3PIOA 3OOCA 5J22A 4DAYB 1AE3A 4HJ7A 1G2TA 4HCSA 1ET9A 1EQQA 1N33L 1L1OB 4R1JA 3K7AH 3A56A 3A5ZB 1NR4A 4X3KA 4XYOA 4A3EG 2NWGA 3GV3A 3RD4A 2Y0SE 2IX3A 3CXCA 4RHSA 5JEAG 3TREA 1HQRD 1EQVA 5C0XJ 4BBSH 1SNQA 4XQQA 3S2DH 3TMEA 1Q1BA 1DD2A 3AMUA 2EJGC 2A1AA 4TSSA 4DR4L 2JSOA 1TS4A 1N34Q 4O42A 2Z6BA 4C3HB 2R61A 4A3LH 1D5XC 3TP6A 3FP9A 4OWWB 3UE1A 1SYGA 4JI3Q 1B44D 2EYLA 4JI7Q 3S1NH 1NBWA 4RGNA 2VUMH 2PI2E 3RZDB 1OTCA 3MA2B 4AH6A 4DN4M 3OIPA 3R2TA 3KBGA 3VA7A 1F9QA 4H02A 1BF4A 2HIVA 4JOIC 3BS1A 4IOCA 2L4NA 5FLXL 1WOCA 1WTVA 4B08A 1XTCD 2JQOA 3H6MA 4YWMA 3IFDA 5BR8L 3G48A 5FK9C 4NXML 2B39A 3BZKA 1NSNS 2JA6H 2RSNA 4OX9L 5M5YB 1NUCA 4KN7C 1GUWA 1FGUA 2IPKD 4MHEA 5CV7A 2ZTDA 3WDNA 1FD7D 1IBML 2PW5A 1SAPA 4F8MA 1K8GA 2BE5C 2YTVA 5I9OA 1PDQA 1WYDA 3U9OA 3ND9A 3KF8B 1WTXA 3OTOQ 1E0BA 4OIKA 3I4NH 5F2DA 4BY1B 3H3VC 3S2HH 3HGBA 1YI2A 1STGA 3CQZH 3SK4A 5ISRA 3J7AV 2EY2A 2SDFA 2F3VA 4POGA 1PRTC 1AZQA 1FJGQ 1SFOB 3K6OA 1SYBA 4EGVA 4A3EH 3PUVA 1QUQB 4DV4L 1Q90A 1YJ9A 1AFPA 5K5PA 3I3CA 5JEAH 1I50B 1T5XD 5DEHA 1HZAA 3NBHA 2WB1B 4BXXG 3MXNB 1JR0D 3S1RH 2VY3A 4RCOA 4JW0A 1S72A 1Z9FA 1WFQA 2R3ZA 4LF7Q 1LT5D 4V190 3M9BA 4GNXC 1X3GA 5C44B 1IYVA 1OXVA 4HN7A 4IQZA 3B6YA 1PH3A 4DF7A 2NZ1D 4C3JG 1QCBD 3J80E 3CCJA 1IKLA 1S4ZA 2K32A 3HZXA 1C48A 3RZOH 2YTXA 3Q8DA 4QCLA 3E0EA 5C3WA 1EQTA 3RR5A 1S3OA 1STYA 2WB1E 4RGOS 3GTJH 1QJOA 2A69C 2FINB 1L1OA 1PH5A 4KD4A 4KY7A 2L5TA 4X62Q 3BG3A 1NTGA 2SNMA 3I4MG 2FMCA 1SYFA 1HQMC 1G6ZA 2NN6G 4NW2A 2KEDA 1PV4A 3W1GA 4N9PA 2NVQB 2HDMA 1Y1WB 1RDPD 1VQPA 4JBJA 5A35A 4RH6A 2FJ2A 3PUWA 4PG3A 5C4JH 5HY6A 3U50C 5LMNQ 4G57A 1HNZL 2UXBQ 4TQUS 4DV3Q 1RIPA 1X56A 5BN3A 3BU2A 3F2BA 1C9OA 1I4HA 4A93H 3H91A 1HNXL 5IIFA 4JI6L 2ZTCA 2IT1A 5DNFA 1K0RA 1I6HH 2CQOA 5JPNC 4UHVA 4PZ8A 1SJED 4IALA 5IY0A 3L0OA 4K5VA 4OWTB 3TP8A 1DM0B 1DXMA 1K3BC 2EXZA 1WTPA 3EFXD 4BXXH 4OONA 4Q0FA 3ULLA 5H1SE 1TWGH 1FGBD 2YV5A 1B2TA 5C6AA 1CA5A 2ZJQA 4X64L 5ELBA 2LSSA 3BYTB 3QJYA 5M3MH 1TWHH 3N6RA 1KQSA 4CDEC 4QY7A 4IUNA 3PO3G 2J0TD 4XT3B 1RODA 2F0FA 1X3QA 3K7AB 4DKAC 1EIHA 4JI2L 4B3RL 2EOTA 3DWPA 1KLUD 1XX8A 3D4WA 3LX0A 1X9NA 2FHTA 2VB2X 3FPUB 3VR2A 1PTOC 5KEEA 1JB3A 4O1NA 2CQAA 4U68A 1ICWA 4A3MG 1EY9A 3C1EA 2KHIA 4MZ9A 4C3HG 1QUQA 2QF7A 3JAMc 1ASYA 1S5FD 3CCQA 3I4MH 5KNDA 4GS3A 5I6YA 5CV9A 5K36H 1BDOA 3MXNA 1YHBA 1BKBA 2BDOA 1A8VA 2KCMA 5BR8Q 4JOIA 1E2VA 4L63B 1PMRA 4BS9A 4ZLTF 2VUMB 2A8VA 3UDGA 1TWCH 3MXPA 3G71A 3SK8A 1A63A 1YVCA 3W3AA 3H09A 5E1FA 4DNIA 1IBMQ 1S5BD 4MTKA 5IWAL 1N36L 2F0KA 4C1NK 3TBIB 3M7NA 4IFDH 2UXDQ 2B2YC 5ELDA 1LTLA 4HMIA 3KJPA 2PNRC 1SE4A 1TY0A 1OXTA 3HOZB 2CFMA 3SDZA 1PFBA 1O7IA 3NEMA 2ZXRA 4IPDA 4YCUA 2XTIA 3KLRA 3QR8A 3GTGH 1ZKOA 4DK3C 4BWGB 4C56C 1SE2A 2UXCL 4KHZA 3VA5A 1RKNA 4GKJL 4LF5L 4HEDA 3W1BA 1YNXA 4BY1G 3EQLC 5AJ3L 4OO1H 1EZ8A 1PH7A 1A2UA 3OW7A 3S2HB 2EIFA 4LAAA 1Q8KA 1JCKB 2JEBI 3D0FA 2PNHA 5C3EG 3PO3H 1UEBA 2B8FA 3TN2A 2E2IH 1O7LA 1I6VC 4JI4L 4P72A 3CW2C 4A3EB 2F0WA 2RHQB 2AMCB 1H9RA 2EVBA 1TU2B 2WB1G 4J15A 3UE0A 1PYWD 5EKIA 1LM0A 2NZOA 2CW0C 3NQIA 3S1RB 1Q46A 2VXWA 1QZHA 5IP9G 5JEAJ 4YCVA 2HQEA 1AW7A 3J80L 1BBWA 5C44G 5ELEA 4A3MH 1BR9A 1R9TH 3C1FA 4DR3L 2MNAA 4A3CH 1BCPB 5EQ0A 4ZKCB 3CCUA 1CQFA 1SDFA 4Y7NH 1XNRQ 4IUUA 5IOCA 1A3TA 4IZ8A 4ID6A 2ZJRA 1IHZA 1TR5A 2NYZD 3CPWA 1PXUA 2FFKB 4I7ZC 3RZDH 2K5QA 1NE3A 2MO0A 4FF1A 1XWEA 3NWSA 2NB0A 2DJGC 1A3UA 2ZXPA 4PNYA 1TWAH 3RZOB 4H13C 3SVMA 2A74C 4WJ3M 3DM3A 2F0TA 3GTJB 3ICEA 1HPCA 1GUNA 2B2UC 2E2HH 3PIO3 4JI3L 2ZT9C 1WJJA 3CPFA 2WKDA 3SK5A 3PIPA 2KECA 3BDLA 1EU4A 4CHTB 1RCVD 1WI5A 1Y1WG 3FMCA 2HD3A 2Q8TA 1K28A 2WP8J 4H44C 1HRJA 1V1OA 1EY7A 1SNPA 2M9VA 4YY3Q 1GUOA 2F3WA 1KDAA 1MSGA 5C4JB 3QOJA 1F9SA 3J81j 2IHEA 1HFNA 1AZPA 2K03A 2PZUA 1D2BA 2F03A 3HFZB 1SJHD 3CRLC 1PH6A 3DWAA 1CKMA 5IYDG 5ELOA 3BJUA 4HIOA 3PGZA 4HIKA 5JJKA 4A93B 1VQAA 5IT9c 4ZKBB 4I7AA 2RCNA 3OIQA 4LF9Q 5GAEC 1K8MA 5C3EH 4JYAQ 2F0HA 1BCPD 2VB3X 4X64Q 1I6HB 1W2BA 3FKIG 1KAAA 1I50H 3HG9A 1YZ6A 2RKSA 1A15A 5J1ZA 1SLJA 2WKCA 5FLMG 2JA5B 4J8QA 4DV7Q 4IUQA 3Q24A 5IP9H 1TWGB 4L6TB 1XMQL 1Q81C 1SNOA 2PW7A 4AYBB 5M3MB 1TWHB 3K7UC 3LWUA 1JWMD 4X66L 3ULPA 3OYYA 2R7FA 2NVXH 2HT1A 2ID0A 2I07B 4JV5L 3E9HA 2HUGA 3MVVA 2DJFC 1TKWB 3PSIA 3JAMi 1IL2A 1TQOA 2X6GA 3A54A 1EFID 2VL6A 1FYCA 4LUZA 1VQLA 4B3SL 1NR2A 3IRBA 2BOSA 1P16A 3HOWB 4POFA 4OWXB 1E2ZA 4XYQA 3P75A 3H3VH 1U4MA 1ASZA 4FXKC 3CHBD 1EIFA 2KCNA 4A3LG 4UPAA 4AYBE 3PV0A 2WV6D 4NDXA 3FVQA 4IFDI 1JB7A 1Y1WH 4K2KA 3KF6A 3M4QA 3G6JB 4IJHA 4UP9A 5FLXc 2YU9H 1TWFH 2VUMG 4DXFA 3X3NA 2SNSA 3N52A 3A5UA 2A68C 2KA7A 2EPBA 1GD7A 5IGCA 3LGJA 1STHA 1TWCB 3L3OC 4X62L 1JORA 1SE3A 3T53B 5C5MA 2F0PA 1BOSA 1SMYC 2EYFA 3S17H 3FDTA 1ET6A 1J6QA 1NMFA 3IKJA 4H0LC 2RQXA 3M4PA 5CORA 3J7AF 4Y52H 4OO1I 5IYDH 3NBHB 3NTKA 3TRZA 1T5EA 2KCCA 1UE5A 3UI2A 4GKJQ 1B3QA 1QNKA 2F0UA 4TVAB 2QA4A 3HOZG 3L9AX 1XMOQ 2B2WC 1ZYRC 2UUAQ 2DGYA 3KOJA 5D3DA 3NE5B 4IUVA 2UXBL 4XQNA 5CR3A 4DV3L 3D4DA 3K5MA 3FKIH 5IT9L 3V96A 3FRPB 1GKHA 3GTGB 4GZYC 2ZJPA 1NJIC 2K5NA 2RDFA 4DK6C 2QEXA 1YJNA 1EY4A 4JI4Q 3WWVA 4DAMA 3C3LA 2JE6I 3D3RA 4B9XA 1HNWL 2QKIC 3HKZG 3I8ZA 4EQ5A 2WFWA 2KCTA 4N8FA 4DAVA 2R92G 1GHJA 1K9MC 4B3TQ 1C4QA 1YNNC 3PO3B 1JJCB 4A75A 2ES2A 4DXGA 1DZ1A 3OPOA 2E2IB 1P8LA 2ZXOA 4DR3Q 4KY6A 3STBC 1LTBD 2QCPX 4QMGA 3EN2A 4QQBX 2OTJA 1JWUD 2X6LA 2JN4A 5JVH3 2PCFB 4A3GH 1GUTA 3NPPA 3TEHB 2VW9A 3NELA 4A3MB 4CBVA 1IBLL 1R9TB 2PMZB 1CFMA 3BVGA 1EY0A 4RGTA 1UNSA 1ESFA 1N8RC 2NTSA 4HSPA 4Y7NB 1QVCA 3U9SA 3K80C 1X54A 3W2DA 1WVLA 1HHVA 4KMUC 5M5XH 1QB5D 5BN4A 2D2CC 1KRSA 3A8JE 2A6ED 2B2UA 2WAQG 4LF4L 3MFYA 1TWAB 5IODA 2K5VA 3ER0A 2R93H 1TS5A 3CU7A 3KLWA 2UUCQ 1YNJD 4FP5D 2IY5B 2E2HB 3S24A 1K73C 4CKEA 4ODGA 4JBKA 1KRTA 3OSOA 1S5DD 1WCMB 2QW7A 2Q2TA 1X3PA 3W5OA 1JWSD 1VQOA 1XJVA 3HOZH 1KTKA 4RAUC 4ZQ3A 1HR0W 3T1YL 1O80A 1HCZA 3K0YA 1G2SA 1JJ2A 1KC8C 1PYBA 1PTOH 2JP1A 3CCRA 2UXDL 4JI5Q 1VQMA 4HJAA 3I70A 2A68D 2Z6KC 4XT1B 1EY5A 1RHPA 2F0EA 3PUZA 1A3VA 4FXGC 1D7QA 4A93G 3BVZA 2GVBA 1ZEQX 4G4KA 3A7AB 4P74A 3BDOA 3MWYW 2V4DA 3CCEA 1H9KA 2R92H 2F4IA 3BZDB 4ZUIA 1XMQQ 5C3EB 3RMHA 4GOPC 4EVOA 4I65A 4DV5Q 1ML0D 4L5SA 5EGTA 3V05A 1DOMA 4X66Q 2CH4A 4OXPA 3GTMH 3A8IE 2JA5G 4KTAA 4JV5Q 1DONA 1CHQD 1VQ6A 2OCEA 4BBRG 1BNZA 4AYBG 5I4DA 5M3MG 4O0AA 4A3DG 4B3SQ 1D8LA 3H3VI 2K1BA 3R3OA 5CMDA 3D6WA 1LT3D 2N88A 2NVXB 3OWFA 4KN4C 1HA5A 4CDCC 4C1NI 3M3YH 4UAIA 2QEJC 3S15B 1YNND 1X3EA 4QIWB 2A6HC 2JJQA 1M90C 2EDGA 3RN2A 4A3BB 1Z7TA 3QB3A 3HOWG 1KLGD 4ILWA 2K5WA 1XNRL 2Z1CA 2EYMA 1GHKA 4LFAL 3SE0A 4APVA 1O78A 1FR3A 5C4XH 1CZGA 2XWJB 1FL0A 2RA4A 4IUTA 5K36G 5EAYA 1LT4D 4V0BA 3T4AC 4IN3A 4L5RC 4A3IG 3VDYA 3GTKB 4R9WA 2XN9C 3GDEA 3I91A 2L12A 4CDDC 3PO2G 1PLFA 1PRTB 4R4QA 5G3LD 2YU9B 1K8AC 1TWFB 4K8JA 2M2LA 4PV1C 5IGFA 4G7ZC 1XNQQ 5FJ8G 4RG1A 2EY6A 4NMZA 4WJWA 1UAPA 2PQAA 1W3SA 1BUVT 1FNVA 5TSSA 1N32Q 2XRSD 1D5ZC 3I90A 2D9UA 4HMJA 1LTTD 1MJCA 3S17B 4S3SA 1PH8A 1CK1A 2XGTA 4EQNA 2K04A 2LY7A 2JA7B 3QO2A 3HRZC 4IFDG 5KYIA 4GNXB 4LFBL 4YY3L 4IPCA 1KXLA 2TMPA 1HNWQ 2RF4A 5NUCA 2LMCB 2Q2UA 1VQFA 4P2CB 2CWPA 5J39A 3OMGA 2QDLA 3S1QH 4KJNA 1YIJA 1AE2A 4FO2A 1EOVA 4KKUA 3TP7A 3FKIB 4Q5VA 2VQEQ 3CMAA 5T1IA 2ICIA 3TS2A 2E5LQ 2JA5H 2L9HA 4RFBA 5JJZA 4LF9L 2BE5D 4OO1G 1H9SB 1SBBB 2OXPA 3PIP3 1LACA 4OELB 4JYAL 4BBRH 1CSQA 1W6JA 1D5MC 3NENA 1LTSD 4C3IH 2DNEA 4A3DH 1WTHA 2IL8A 1LV9A 1J5EL 2C5CA 2DNCA 1IBLQ 2BDNA 4DV7L 1ENAA 4DNRB 3J81E 3EA6A 2AWNA 1PRTD 2OQKA 3J80c 1G8ZD 2KHSA 1TS2A 4IURA 5GADC 1VQHA 2TSSA 3NTHA 4LF6Q 1GOZA 2E8GA 1PH9A 1IYUA 4ZYSA 4ZCKA 3HOWH 4A3GB 3PMFA 1EIGA 1K3RA 4JBMA 1B7YB 3TZUA 4LF4Q 1YBYA 4R4TA 4A3CG 4F7XA 2F0JA 3F2UA 2K7VA 3HOYG 4K6LA 3JC66 4A3IH 3RUZA 1VQ7A 1CKNA 5E4XA 3PO2H 5M5XB 1VDZA 4DV2Q 4JI8L 3A0JA 4RWSC 1EYCA 5C4HA 1YEZA 2HQLA 4QL5A 1Y1VB 2B29A 5FJ8H 5C4ZA 4DV1L 5T1GA 1DYQA 3MHBA 2R93B 2R6GA 1Q82C 3T1YQ 4HTHA 3FEWX 1MJEA 1G6PA 5A2QE 2CVRA 2A5HA 1NNXA 2MO1A 1JC7A 1SXTA 2P5ZX 1CM9A 1WCMG 5I6WA 2A69D 4J6HA 2AHOB 4N8X1 3D6CA 1EY6A 4M1UB 1T9HA 4HJ5A 2O5JC 1B1ZA 2BA1A 1RL2A 2K01A 3EVQA 3K8AA 3K58A 1G291 2Q2HA 1I4QA 2Z6KA 1E1OA 4H7BA 2B3GA 1VCIA 3TQYA 3VR3A 3BZCA 4GLVB 4DFAA 2F4VL 1Q7YC 1RF2D 2CH4W 3SGIA 1PTOB 5GQOA 5KGUA 4X3TA 1XMOL 1STEA 1HA6A 2UUAL 3ZJYC 5LHY1 2MJ8A 5HGTA 1EL0A 3HKZB 3L7ZC 4GN5A 5CBEE 3NHHA 4UP7A 4FDBA 5CBAE 2R92B 1VQ8A 1UE6A 2AQ3B 1PA6A 4LFCQ 2RDHA 3DHQA 1S5ED 1SEBD 4JBWA 1PH2A 2B2VC 4A3FB 2D0PA 1UEAB 3VR4A 1IKMA 5JPMC 2NZHA
chains in the Genus database with same CATH topology
1VQLA 3GD7A 1WOCA 4B3SL 4DV6L 3IRBA 4GNXA 3KF6B 3AQQA 4DV0Q 1P16A 2JQOA 4LF8Q 4YWMA 4POFA 5BR8L 4B3TL 4OWXB 3G48A 1JT8A 4EX5A 4NXML 3BZKA 3H3VH 1ASZA 1EIFA 2Y0SG 2JA6H 4A3LG 2V1CC 4KLKA 4OX9L 4UPAA 4AYBE 3PV0A 3HKZE 1FGUA 4IFDI 4PZ6A 1JB7A 1Y1WH 2ZTDA 3CCSA 3KF6A 3HOYH 2OTLA 3M4QA 4IJHA 4UP9A 5FLXc 3CCVA 3PF5A 1TWFH 1IBML 2YU9H 3CCLA 3H0GH 2VUMG 1K8GA 4LFAQ 4XIGS 1N33Q 2YTVA 3A5UA 3KJOA 4PZ7A 4LUOA 1GD7A 3LGJA 4NPSA 1YITA 3EBEA 1WYDA 4X62L 4A3BG 3KF8B 2DUDA 4LUZA 2I0QA 3GTPH 4BY7G 4KHPL 3HKSA 5E7NA 3OTOQ 1PFSA 2UXDL 3I4NH 4B3ML 3S2HH 3S17H 1YI2A 3CQZH 2B63H 1NMFA 1J6QA 2MQHA 3M4PA 1L0WA 4Y52H 2ATWA 4OO1I 5IYDH 4X65L 3NBHB 5C0XG 5M5WH 1QZGA 3TRZA 4HJ9A 4POGA 1UE5A 4DR4Q 4GKJQ 1I5FA 1G51A 3PCOB 4TVAB 1X55A 2QA4A 1FJGQ 3HOZG 1WCMH 4HJ8A 4L5QA 1XMOQ 4C3JH 2DGYA 3KOJA 4A3EH 2UUAQ 3T1HL 1VQCA 3PUVA 1QUQB 4DR5Q 2UXBL 4DV4L 3GTLH 3CMEA 1YJ9A 3F1ZA 3H0GG 4LNQA 4DV3L 2JA8G 3FKIH 2ZM6L 2UUCL 1GKHA 1HZAA 4BXXG 4LFBQ 3MXNB 2ZJPA 3S1RH 2K50A 2VY3A 1NJIC 4LWCA 2K5NA 4DK6C 2KENA 2QEXA 1YJNA 2LXKA 1S72A 1Z9FA 1WFQA 1A0IA 4JI4Q 3WWVA 4DAMA 2ALYB 2JE6I 3PUXA 4A4IA 4LF7Q 1HNWL 1BBUA 1Q12A 3M9BA 4IOCA 2WAQE 3HKZG 4GNXC 4X6AH 1X3GA 4GLXA 4EQ5A 1QVGA 2JA7G 1OXVA 4YHHL 2WFWA 2KCTA 1VQIA 1JE5A 2R92G 4DUYL 2GN5A 1K9MC 4B3TQ 1K83H 4JI0L 4IOAA 1YJWA 3B6YA 2GVAA 4NXMQ 1JJCB 2CWAA 3HOXH 4A75A 1PH3A 3CD6A 2ES2A 3CCJA 1VQKA 1P8LA 4OX9Q 4AQYL 4DPGA 4DR3Q 4P73A 3STBC 4JI5L 4A3JH 1B70B 4NXNQ 1HJPA 4PMWA 4JCVE 2YTYA 2YTXA 3RZOH 3Q8DA 3E0EA 2D0OA 3EN2A 4QQBX 2OTJA 3RR5A 1S3OA 2WB1E 1IXRA 1J5EQ 3GTJH 2E2JH 4JI1L 1L1OA 1PH5A 4A3GH 3U58A 1IBKQ 2UUBQ 4MTNA 5LMUQ 1AH9A 1SR3A 2QGQA 3TEHB 4X62Q 3AFQA 2VW9A 2NVTH 1NTGA 3NELA 3K81C 3J80i 4KHPQ 4KI0A 3I4MG 1IBLL 1JJGA 1VQ9A 2NN6G 5M3FG 1VQEA 2AKWB 4DV5L 1PV4A 3W1GA 4GOPA 1N8RC 4GKKL 4QJFA 1QVCA 1VQPA 3RLOA 3K80C 1X54A 1NMGA 1UE1A 4JBJA 4X65Q 5M5XH 4UP8A 2ASBA 3DLLA 5JJLA 1KRSA 2C35B 3PUWA 4PG3A 5C4JH 3S15H 5HY6A 3U50C 5LMNQ 4DR2L 3ERSX 2BH2A 1HNZL 2WAQG 4LF4L 2BH8A 5IYCG 2UXBQ 4DV4Q 4A3BH 4TQUS 2K5VA 3ER0A 2R93H 3J81c 5JJIA 4DV3Q 1EWIA 1RIPA 4O2DA 3GTQH 4BY7H 3KLWA 2IX1A 1BVSA 1SRUA 3CF5A 1X56A 2UUCQ 4A3GG 4GKJL 3BU2A 3F2BA 3UDFA 1NY4A 1C9OA 3CP0A 2A19A 2JA9A 5ELNA 4JI8Q 4C2MH 4A93H 2K4KA 2IY5B 1PYSB 3S24A 1K73C 1CSPA 1HNXL 1M1KC 1YHAA 1SROA 4DR6L 4JI6L 1VQNA 1I94L 4JBKA 1KRTA 2Q2IA 5IYBG 2I5LX 4DV1Q 2ZTCA 2IT1A 2VZAA 2K52A 2Q2TA 3GTKH 3W5OA 1K0RA 1VQOA 1XJVA 3HOZH 2CQOA 1I6HH 4L5TA 3PF4A 4PZ8A 1HR0W 1VQDA 3T1YL 4DUYQ 1SN8A 5IY0A 1VQ4A 3L0OA 2D62A 2JK8A 4OWTB 3S16H 1XPUA 1EYGA 2JA8H 1JJ2A 1CUKA 1Y1VG 4BXXH 4OONA 2UU9L 1E7ZA 1KC8C 5HGQA 1PYBA 2AWOA 2R93G 3MEFA 1E1TA 3ULLA 2VS1A 5H1SE 1TWGH 3RLFA 3CCRA 4HJAA 1VQMA 1YHQA 4MNOA 4JI5Q 2Z6KC 2YV5A 3I56A 4C3HH 2ZJQA 2VQFL 3I2ZA 1L1OC 3PUZA 4X64L 2LSSA 5M3MH 4XTCS 1D7QA 1MKHA 1TWHH 1KQSA 4A93G 2HIXA 2N49A 2GVBA 4QY7A 2N3SA 1VQGA 4GLAC 2JA7H 3PO3G 4P74A 4R4IA 2F4VQ 3CCEA 3KYHC 1GM5A 2R92H 4DKAC 1XNQL 4JI2L 4B3RL 1XMQQ 1HR0L 4GOPC 1Z47A 1X9NA 1KL9A 1N34L 4DV5Q 4IPHA 4IFDJ 3K0XA 1N32L 4L5SA 4GKKQ 4X66Q 4OXPA 3GTMH 2JA5G 4JV5Q 3AFPA 4YWLA 1HZ9A 2H5XA 4A3MG 1A62A 2OCEA 1VQ6A 4JI7L 2CKZB 2KHIA 4MZ9A 4BBRG 3RN5A 3H15A 1HNZQ 4AYBG 5M3MG 3KFUA 1QUQA 3I4OA 3JAMc 1X3FA 5M5YH 1JMCA 4O0AA 1ASYA 4A3DG 3CCQA 1D8LA 4DV6Q 4B3SQ 1XTDA 4GS3A 3H3VI 3I4MH 4DR7L 4IJLA 3KDFB 1YHBA 1BKBA 1A8VA 5M3FH 2CCZA 2KCMA 5BR8Q 2VQEL 1OXUA 2ZTEA 2VNUD 4JOIA 1HNXQ 2E5LL 2IHFA 4JI6Q 3M3YH 1I94Q 1OXXK 1Q1EA 3CC4A 3HOVG 2A8VA 4A3FG 3UDGA 1TWCH 2EXDA 1X3EA 3L2PA 2JJQA 4DR1L 1E3PA 4BA1I 3G71A 1M90C 2OWOA 1LYLA 1YVCA 3RN2A 1A63A 1U0LA 3KDFA 1UWVA 1Q86C 1MIUA 5IYCH 4BY1H 4DNIA 1IBMQ 3HOWG 4YWKA 5IWAL 1N36L 3UDIA 4R4CA 3J7ZC 3CC2A 1PVOA 2F3IA 2MFIA 1XNRL 4AIMA 2UU9Q 1V1QA 1PH1A 4LFAL 4APVA 3M7NA 1DGSA 2UXDQ 5C4XH 1VQBA 3CC7A 1EIYB 1FL0A 4RMFA 1CKOA 1SFOH 1LTLA 1OXSC 3KJPA 5EAYA 4A3KH 5K36G 4YCWA 4L5RC 1OXTA 2VQFQ 2PQAB 3G6EA 2RHSB 3VDYA 4A3IG 5IYBH 4GN3B 3GDEA 1X6OA 2CFMA 2N78A 5GAGC 1XPRA 1O7IA 3OTOL 3PO2G 3NEMA 4R4OA 4R4QA 3U4ZA 4LF6L 3A74A 4IPDA 1K8AC 4YCUA 2XTIA 2K75A 5DLQE 3GTGH 4NB3A 4DK3C 5GAHC 5IE8A 1MJEA 1X65A 4ME3A 4JI2Q 5FJ8G 4RG1A 1XNQQ 2R7ZG 4B3RQ 2UXCL 4KHZA 1Y1VH 4HIDA 3D31A 2R7DA 1L2FA 2PQAA 3W1BA 3T1HQ 1W3SA 1YNXA 1IZ6A 4BY1G 4LF5L 1FJGL 1N9WA 4P71A 1N32Q 5AJ3L 3HOUH 1PH7A 5C44H 3AYHB 3TS0A 2ZM6Q 2EIFA 1MJCA 1PH8A 1Q8KA 2XGTA 2OQ0A 2JEBI 4IFDG 5C4XG 3D0FA 1E22A 4GNXB 1SMXA 3I55A 2PNHA 5C3EG 4LFBL 4DV2L 4YY3L 3PO3H 4IPCA 4A3KG 1KXLA 1KAWA 4LW1A 1UEBA 1HNWQ 5IP7H 2RF4A 2NN6I 2F52A 2PMZE 3F2CA 2E2IH 4BBSG 3RLNA 4JI4L 2Q2UA 4LUVA 4P72A 1KIXA 1VQFA 3CW2C 4LF7L 4YHHQ 2RHQB 2AMCB 2CWPA 3F8TA 2WB1G 3UE0A 4J15A 4QGUA 1YIJA 1AE2A 3S1QH 1EOVA 3UDXA 1LM0A 2VQEQ 2NZOA 3CMAA 3I7FA 4JI0Q 2E5LQ 3TS2A 1E24A 1Q46A 4B3MQ 2LXJA 4JG2A 5IP9G 1QZHA 5JEAJ 4YCVA 2JA5H 3M85A 4AQYQ 4DR1Q 2I5MX 4LF9L 3HOUG 4OO1G 1BBWA 5C44G 4A3MH 5J3BA 3PUYA 1Y14B 3ULJA 1HH2P 1R9TH 4JYAL 4BBRH 1HZBA 4DR3L 1CSQA 2MNAA 4BA2I 4NXNL 1QVFA 4A3CH 5IWAQ 1N36Q 3NENA 4JI1Q 4C3IH 3CCUA 1XPOA 1KHIA 5LMNW 1TXYA 2JEAI 4Y7NH 1PH4A 2NVQH 4A3DH 1XNRQ 3E9IA 2ZJRA 1VQJA 1J5EL 5IP7G 2EQSA 3CPWA 4IPGA 2KBNA 3J7A5 3AEVA 1I3QH 3RZDH 4IO9A 1IBKL 2UUBL 1NE3A 2MO0A 5LMUL 1IBLQ 4DV7L 4HIMA 3RNUA 3HOVH 3J80c 2AWNA 2OQKA 4A3FH 1TWAH 5GADC 1VQHA 4K0KL 4LF6Q 1IYJB 2E8GA 3DM3A 1PH9A 4UY8C 4WJ3M 4DUZL 2K14A 3ICEA 1VQ5A 3HOWH 1CKNB 2E2HH 2K5HA 4JI3L 2UXCQ 1VS0A 3EIVA 4DR2Q 2JA6G 1WJJA 3S14H 1K3RA 4LFCL 4JBMA 3CPFA 4LF5Q 1B7YB 4LF4Q 1V9PA 1YBYA 4R4TA 3PIPA 4A3CG 3G4SA 5AJ3Q 5LMNL 3J81i 1WI5A 1Y1WG 2HHHL 5GROA 3HOYG 3JC66 5C0XI 4A3IH 1VQ7A 2WP8J 4JC0A 1CKNA 1H95A 3PO2H 4DV0L 4DR6Q 4P75A 4YY3Q 4DV2Q 3U4VA 3GO5A 4JI8L 2YYZA 1C7YA 3A0JA 4LF8L 5FLMH 1YEZA 3F2DA 2HQLA 4QL5A 2R7ZH 3J81j 2B29A 2IHEA 5FJ8H 3I4NG 3CAMA 2I5HA 3HFZB 1SE8A 4DV1L 4ALPA 2NVYH 1U5KA 2R6GA 1PH6A 1Q82C 2B63G 3T1YQ 3STBD 2KHJA 1CKMA 2BA0A 5IYDG 1EQRA 1HZCA 3BJUA 2L15A 5ELOA 3PIOA 3PGZA 4HIOA 1KD1C 4HIKA 1G6PA 5JJKA 4DAYB 2MO1A 1VQAA 1AE3A 4HJ7A 5IT9c 1EQQA 1GVPA 2N8NA 1WCMG 1L1OB 2RCNA 3K7AH 4R1JA 1N33L 4LF9Q 3A5ZB 3M4OH 5GAEC 2AHOB 5C3EH 4A3EG 3FHWA 1FVIA 2Y0SE 4JYAQ 1T9HA 4X64Q 3OW2A 3CXCA 4HJ5A 3S1MH 2BA1A 1W2BA 1UE7A 1RL2A 1V43A 4BBSH 5JEAG 3TREA 3FKIG 4GN4B 5C0XJ 3K8AA 2Q2HA 1G291 1PHJA 1EFWA 1I50H 3S2DH 1Q1BA 1YZ6A 3GTOH 2Z6KA 1SLJA 1E1OA 5FLMG 2B3GA 4GOPB 1VCIA 3TQYA 2A1AA 2Z0SA 3BZCA 4GLVB 2F4VL 1Q7YC 4QIWE 2PI2A 3SGIA 4DV7Q 1HR0Q 4DR4L 1S40A 5IP9H 5GQOA 1N34Q 1C0AA 2IX0A 1XMQL 1Q81C 1XMOL 4K0KQ 2UUAL 3ZJYC 4A3LH 4DR5L 3K7UC 4DUZQ 3L7ZC 3FP9A 4OWWB 4GN5A 2FXQA 4X66L 3OYYA 3ULPA 2R7FA 1LUZA 3UE1A 2NVXH 3HOXG 4WJ4A 4UP7A 4JI3Q 2HT1A 4FDBA 2ID0A 1VQ8A 1UE6A 4JI7Q 4LFCQ 1PA6A 1NBWA 3S1NH 4JV5L 3E9HA 2VUMH 2PI2E 1OTCA 3JAMi 4A3JG 3PSIA 4AH6A 4JBWA 1EUJA 2HHHQ 1PH2A 1IL2A 4DR7Q 4H02A 1GO3E 2D0PA 3CCMA 4A76A 2VL6A 2HIVA 4JOIC 1B8AA 2NZHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQL A;  3GD7 A;  1WOC A;  4B3S L;  4DV6 L;  3IRB A;  4GNX A;  3KF6 B;  3AQQ A;  4DV0 Q;  1P16 A;  2JQO A;  4LF8 Q;  4YWM A;  4POF A;  5BR8 L;  4B3T L;  4OWX B;  3G48 A;  1JT8 A;  4EX5 A;  4NXM L;  3BZK A;  3H3V H;  1ASZ A;  1EIF A;  2Y0S G;  2JA6 H;  4A3L G;  2V1C C;  4KLK A;  4OX9 L;  4UPA A;  4AYB E;  3PV0 A;  3HKZ E;  1FGU A;  4IFD I;  4PZ6 A;  1JB7 A;  1Y1W H;  2ZTD A;  3CCS A;  3KF6 A;  3HOY H;  2OTL A;  3M4Q A;  4IJH A;  4UP9 A;  5FLX c;  3CCV A;  3PF5 A;  1TWF H;  1IBM L;  2YU9 H;  3CCL A;  3H0G H;  2VUM G;  1K8G A;  4LFA Q;  4XIG S;  1N33 Q;  2YTV A;  3A5U A;  3KJO A;  4PZ7 A;  4LUO A;  1GD7 A;  3LGJ A;  4NPS A;  1YIT A;  3EBE A;  1WYD A;  4X62 L;  4A3B G;  3KF8 B;  2DUD A;  4LUZ A;  2I0Q A;  3GTP H;  4BY7 G;  4KHP L;  3HKS A;  5E7N A;  3OTO Q;  1PFS A;  2UXD L;  3I4N H;  4B3M L;  3S2H H;  3S17 H;  1YI2 A;  3CQZ H;  2B63 H;  1NMF A;  1J6Q A;  2MQH A;  3M4P A;  1L0W A;  4Y52 H;  2ATW A;  4OO1 I;  5IYD H;  4X65 L;  3NBH B;  5C0X G;  5M5W H;  1QZG A;  3TRZ A;  4HJ9 A;  4POG A;  1UE5 A;  4DR4 Q;  4GKJ Q;  1I5F A;  1G51 A;  3PCO B;  4TVA B;  1X55 A;  2QA4 A;  1FJG Q;  3HOZ G;  1WCM H;  4HJ8 A;  4L5Q A;  1XMO Q;  4C3J H;  2DGY A;  3KOJ A;  4A3E H;  2UUA Q;  3T1H L;  1VQC A;  3PUV A;  1QUQ B;  4DR5 Q;  2UXB L;  4DV4 L;  3GTL H;  3CME A;  1YJ9 A;  3F1Z A;  3H0G G;  4LNQ A;  4DV3 L;  2JA8 G;  3FKI H;  2ZM6 L;  2UUC L;  1GKH A;  1HZA A;  4BXX G;  4LFB Q;  3MXN B;  2ZJP A;  3S1R H;  2K50 A;  2VY3 A;  1NJI C;  4LWC A;  2K5N A;  4DK6 C;  2KEN A;  2QEX A;  1YJN A;  2LXK A;  1S72 A;  1Z9F A;  1WFQ A;  1A0I A;  4JI4 Q;  3WWV A;  4DAM A;  2ALY B;  2JE6 I;  3PUX A;  4A4I A;  4LF7 Q;  1HNW L;  1BBU A;  1Q12 A;  3M9B A;  4IOC A;  2WAQ E;  3HKZ G;  4GNX C;  4X6A H;  1X3G A;  4GLX A;  4EQ5 A;  1QVG A;  2JA7 G;  1OXV A;  4YHH L;  2WFW A;  2KCT A;  1VQI A;  1JE5 A;  2R92 G;  4DUY L;  2GN5 A;  1K9M C;  4B3T Q;  1K83 H;  4JI0 L;  4IOA A;  1YJW A;  3B6Y A;  2GVA A;  4NXM Q;  1JJC B;  2CWA A;  3HOX H;  4A75 A;  1PH3 A;  3CD6 A;  2ES2 A;  3CCJ A;  1VQK A;  1P8L A;  4OX9 Q;  4AQY L;  4DPG A;  4DR3 Q;  4P73 A;  3STB C;  4JI5 L;  4A3J H;  1B70 B;  4NXN Q;  1HJP A;  4PMW A;  4JCV E;  2YTY A;  2YTX A;  3RZO H;  3Q8D A;  3E0E A;  2D0O A;  3EN2 A;  4QQB X;  2OTJ A;  3RR5 A;  1S3O A;  2WB1 E;  1IXR A;  1J5E Q;  3GTJ H;  2E2J H;  4JI1 L;  1L1O A;  1PH5 A;  4A3G H;  3U58 A;  1IBK Q;  2UUB Q;  4MTN A;  5LMU Q;  1AH9 A;  1SR3 A;  2QGQ A;  3TEH B;  4X62 Q;  3AFQ A;  2VW9 A;  2NVT H;  1NTG A;  3NEL A;  3K81 C;  3J80 i;  4KHP Q;  4KI0 A;  3I4M G;  1IBL L;  1JJG A;  1VQ9 A;  2NN6 G;  5M3F G;  1VQE A;  2AKW B;  4DV5 L;  1PV4 A;  3W1G A;  4GOP A;  1N8R C;  4GKK L;  4QJF A;  1QVC A;  1VQP A;  3RLO A;  3K80 C;  1X54 A;  1NMG A;  1UE1 A;  4JBJ A;  4X65 Q;  5M5X H;  4UP8 A;  2ASB A;  3DLL A;  5JJL A;  1KRS A;  2C35 B;  3PUW A;  4PG3 A;  5C4J H;  3S15 H;  5HY6 A;  3U50 C;  5LMN Q;  4DR2 L;  3ERS X;  2BH2 A;  1HNZ L;  2WAQ G;  4LF4 L;  2BH8 A;  5IYC G;  2UXB Q;  4DV4 Q;  4A3B H;  4TQU S;  2K5V A;  3ER0 A;  2R93 H;  3J81 c;  5JJI A;  4DV3 Q;  1EWI A;  1RIP A;  4O2D A;  3GTQ H;  4BY7 H;  3KLW A;  2IX1 A;  1BVS A;  1SRU A;  3CF5 A;  1X56 A;  2UUC Q;  4A3G G;  4GKJ L;  3BU2 A;  3F2B A;  3UDF A;  1NY4 A;  1C9O A;  3CP0 A;  2A19 A;  2JA9 A;  5ELN A;  4JI8 Q;  4C2M H;  4A93 H;  2K4K A;  2IY5 B;  1PYS B;  3S24 A;  1K73 C;  1CSP A;  1HNX L;  1M1K C;  1YHA A;  1SRO A;  4DR6 L;  4JI6 L;  1VQN A;  1I94 L;  4JBK A;  1KRT A;  2Q2I A;  5IYB G;  2I5L X;  4DV1 Q;  2ZTC A;  2IT1 A;  2VZA A;  2K52 A;  2Q2T A;  3GTK H;  3W5O A;  1K0R A;  1VQO A;  1XJV A;  3HOZ H;  2CQO A;  1I6H H;  4L5T A;  3PF4 A;  4PZ8 A;  1HR0 W;  1VQD A;  3T1Y L;  4DUY Q;  1SN8 A;  5IY0 A;  1VQ4 A;  3L0O A;  2D62 A;  2JK8 A;  4OWT B;  3S16 H;  1XPU A;  1EYG A;  2JA8 H;  1JJ2 A;  1CUK A;  1Y1V G;  4BXX H;  4OON A;  2UU9 L;  1E7Z A;  1KC8 C;  5HGQ A;  1PYB A;  2AWO A;  2R93 G;  3MEF A;  1E1T A;  3ULL A;  2VS1 A;  5H1S E;  1TWG H;  3RLF A;  3CCR A;  4HJA A;  1VQM A;  1YHQ A;  4MNO A;  4JI5 Q;  2Z6K C;  2YV5 A;  3I56 A;  4C3H H;  2ZJQ A;  2VQF L;  3I2Z A;  1L1O C;  3PUZ A;  4X64 L;  2LSS A;  5M3M H;  4XTC S;  1D7Q A;  1MKH A;  1TWH H;  1KQS A;  4A93 G;  2HIX A;  2N49 A;  2GVB A;  4QY7 A;  2N3S A;  1VQG A;  4GLA C;  2JA7 H;  3PO3 G;  4P74 A;  4R4I A;  2F4V Q;  3CCE A;  3KYH C;  1GM5 A;  2R92 H;  4DKA C;  1XNQ L;  4JI2 L;  4B3R L;  1XMQ Q;  1HR0 L;  4GOP C;  1Z47 A;  1X9N A;  1KL9 A;  1N34 L;  4DV5 Q;  4IPH A;  4IFD J;  3K0X A;  1N32 L;  4L5S A;  4GKK Q;  4X66 Q;  4OXP A;  3GTM H;  2JA5 G;  4JV5 Q;  3AFP A;  4YWL A;  1HZ9 A;  2H5X A;  4A3M G;  1A62 A;  2OCE A;  1VQ6 A;  4JI7 L;  2CKZ B;  2KHI A;  4MZ9 A;  4BBR G;  3RN5 A;  3H15 A;  1HNZ Q;  4AYB G;  5M3M G;  3KFU A;  1QUQ A;  3I4O A;  3JAM c;  1X3F A;  5M5Y H;  1JMC A;  4O0A A;  1ASY A;  4A3D G;  3CCQ A;  1D8L A;  4DV6 Q;  4B3S Q;  1XTD A;  4GS3 A;  3H3V I;  3I4M H;  4DR7 L;  4IJL A;  3KDF B;  1YHB A;  1BKB A;  1A8V A;  5M3F H;  2CCZ A;  2KCM A;  5BR8 Q;  2VQE L;  1OXU A;  2ZTE A;  2VNU D;  4JOI A;  1HNX Q;  2E5L L;  2IHF A;  4JI6 Q;  3M3Y H;  1I94 Q;  1OXX K;  1Q1E A;  3CC4 A;  3HOV G;  2A8V A;  4A3F G;  3UDG A;  1TWC H;  2EXD A;  1X3E A;  3L2P A;  2JJQ A;  4DR1 L;  1E3P A;  4BA1 I;  3G71 A;  1M90 C;  2OWO A;  1LYL A;  1YVC A;  3RN2 A;  1A63 A;  1U0L A;  3KDF A;  1UWV A;  1Q86 C;  1MIU A;  5IYC H;  4BY1 H;  4DNI A;  1IBM Q;  3HOW G;  4YWK A;  5IWA L;  1N36 L;  3UDI A;  4R4C A;  3J7Z C;  3CC2 A;  1PVO A;  2F3I A;  2MFI A;  1XNR L;  4AIM A;  2UU9 Q;  1V1Q A;  1PH1 A;  4LFA L;  4APV A;  3M7N A;  1DGS A;  2UXD Q;  5C4X H;  1VQB A;  3CC7 A;  1EIY B;  1FL0 A;  4RMF A;  1CKO A;  1SFO H;  1LTL A;  1OXS C;  3KJP A;  5EAY A;  4A3K H;  5K36 G;  4YCW A;  4L5R C;  1OXT A;  2VQF Q;  2PQA B;  3G6E A;  2RHS B;  3VDY A;  4A3I G;  5IYB H;  4GN3 B;  3GDE A;  1X6O A;  2CFM A;  2N78 A;  5GAG C;  1XPR A;  1O7I A;  3OTO L;  3PO2 G;  3NEM A;  4R4O A;  4R4Q A;  3U4Z A;  4LF6 L;  3A74 A;  4IPD A;  1K8A C;  4YCU A;  2XTI A;  2K75 A;  5DLQ E;  3GTG H;  4NB3 A;  4DK3 C;  5GAH C;  5IE8 A;  1MJE A;  1X65 A;  4ME3 A;  4JI2 Q;  5FJ8 G;  4RG1 A;  1XNQ Q;  2R7Z G;  4B3R Q;  2UXC L;  4KHZ A;  1Y1V H;  4HID A;  3D31 A;  2R7D A;  1L2F A;  2PQA A;  3W1B A;  3T1H Q;  1W3S A;  1YNX A;  1IZ6 A;  4BY1 G;  4LF5 L;  1FJG L;  1N9W A;  4P71 A;  1N32 Q;  5AJ3 L;  3HOU H;  1PH7 A;  5C44 H;  3AYH B;  3TS0 A;  2ZM6 Q;  2EIF A;  1MJC A;  1PH8 A;  1Q8K A;  2XGT A;  2OQ0 A;  2JEB I;  4IFD G;  5C4X G;  3D0F A;  1E22 A;  4GNX B;  1SMX A;  3I55 A;  2PNH A;  5C3E G;  4LFB L;  4DV2 L;  4YY3 L;  3PO3 H;  4IPC A;  4A3K G;  1KXL A;  1KAW A;  4LW1 A;  1UEB A;  1HNW Q;  5IP7 H;  2RF4 A;  2NN6 I;  2F52 A;  2PMZ E;  3F2C A;  2E2I H;  4BBS G;  3RLN A;  4JI4 L;  2Q2U A;  4LUV A;  4P72 A;  1KIX A;  1VQF A;  3CW2 C;  4LF7 L;  4YHH Q;  2RHQ B;  2AMC B;  2CWP A;  3F8T A;  2WB1 G;  3UE0 A;  4J15 A;  4QGU A;  1YIJ A;  1AE2 A;  3S1Q H;  1EOV A;  3UDX A;  1LM0 A;  2VQE Q;  2NZO A;  3CMA A;  3I7F A;  4JI0 Q;  2E5L Q;  3TS2 A;  1E24 A;  1Q46 A;  4B3M Q;  2LXJ A;  4JG2 A;  5IP9 G;  1QZH A;  5JEA J;  4YCV A;  2JA5 H;  3M85 A;  4AQY Q;  4DR1 Q;  2I5M X;  4LF9 L;  3HOU G;  4OO1 G;  1BBW A;  5C44 G;  4A3M H;  5J3B A;  3PUY A;  1Y14 B;  3ULJ A;  1HH2 P;  1R9T H;  4JYA L;  4BBR H;  1HZB A;  4DR3 L;  1CSQ A;  2MNA A;  4BA2 I;  4NXN L;  1QVF A;  4A3C H;  5IWA Q;  1N36 Q;  3NEN A;  4JI1 Q;  4C3I H;  3CCU A;  1XPO A;  1KHI A;  5LMN W;  1TXY A;  2JEA I;  4Y7N H;  1PH4 A;  2NVQ H;  4A3D H;  1XNR Q;  3E9I A;  2ZJR A;  1VQJ A;  1J5E L;  5IP7 G;  2EQS A;  3CPW A;  4IPG A;  2KBN A;  3J7A 5;  3AEV A;  1I3Q H;  3RZD H;  4IO9 A;  1IBK L;  2UUB L;  1NE3 A;  2MO0 A;  5LMU L;  1IBL Q;  4DV7 L;  4HIM A;  3RNU A;  3HOV H;  3J80 c;  2AWN A;  2OQK A;  4A3F H;  1TWA H;  5GAD C;  1VQH A;  4K0K L;  4LF6 Q;  1IYJ B;  2E8G A;  3DM3 A;  1PH9 A;  4UY8 C;  4WJ3 M;  4DUZ L;  2K14 A;  3ICE A;  1VQ5 A;  3HOW H;  1CKN B;  2E2H H;  2K5H A;  4JI3 L;  2UXC Q;  1VS0 A;  3EIV A;  4DR2 Q;  2JA6 G;  1WJJ A;  3S14 H;  1K3R A;  4LFC L;  4JBM A;  3CPF A;  4LF5 Q;  1B7Y B;  4LF4 Q;  1V9P A;  1YBY A;  4R4T A;  3PIP A;  4A3C G;  3G4S A;  5AJ3 Q;  5LMN L;  3J81 i;  1WI5 A;  1Y1W G;  2HHH L;  5GRO A;  3HOY G;  3JC6 6;  5C0X I;  4A3I H;  1VQ7 A;  2WP8 J;  4JC0 A;  1CKN A;  1H95 A;  3PO2 H;  4DV0 L;  4DR6 Q;  4P75 A;  4YY3 Q;  4DV2 Q;  3U4V A;  3GO5 A;  4JI8 L;  2YYZ A;  1C7Y A;  3A0J A;  4LF8 L;  5FLM H;  1YEZ A;  3F2D A;  2HQL A;  4QL5 A;  2R7Z H;  3J81 j;  2B29 A;  2IHE A;  5FJ8 H;  3I4N G;  3CAM A;  2I5H A;  3HFZ B;  1SE8 A;  4DV1 L;  4ALP A;  2NVY H;  1U5K A;  2R6G A;  1PH6 A;  1Q82 C;  2B63 G;  3T1Y Q;  3STB D;  2KHJ A;  1CKM A;  2BA0 A;  5IYD G;  1EQR A;  1HZC A;  3BJU A;  2L15 A;  5ELO A;  3PIO A;  3PGZ A;  4HIO A;  1KD1 C;  4HIK A;  1G6P A;  5JJK A;  4DAY B;  2MO1 A;  1VQA A;  1AE3 A;  4HJ7 A;  5IT9 c;  1EQQ A;  1GVP A;  2N8N A;  1WCM G;  1L1O B;  2RCN A;  3K7A H;  4R1J A;  1N33 L;  4LF9 Q;  3A5Z B;  3M4O H;  5GAE C;  2AHO B;  5C3E H;  4A3E G;  3FHW A;  1FVI A;  2Y0S E;  4JYA Q;  1T9H A;  4X64 Q;  3OW2 A;  3CXC A;  4HJ5 A;  3S1M H;  2BA1 A;  1W2B A;  1UE7 A;  1RL2 A;  1V43 A;  4BBS H;  5JEA G;  3TRE A;  3FKI G;  4GN4 B;  5C0X J;  3K8A A;  2Q2H A;  1G29 1;  1PHJ A;  1EFW A;  1I50 H;  3S2D H;  1Q1B A;  1YZ6 A;  3GTO H;  2Z6K A;  1SLJ A;  1E1O A;  5FLM G;  2B3G A;  4GOP B;  1VCI A;  3TQY A;  2A1A A;  2Z0S A;  3BZC A;  4GLV B;  2F4V L;  1Q7Y C;  4QIW E;  2PI2 A;  3SGI A;  4DV7 Q;  1HR0 Q;  4DR4 L;  1S40 A;  5IP9 H;  5GQO A;  1N34 Q;  1C0A A;  2IX0 A;  1XMQ L;  1Q81 C;  1XMO L;  4K0K Q;  2UUA L;  3ZJY C;  4A3L H;  4DR5 L;  3K7U C;  4DUZ Q;  3L7Z C;  3FP9 A;  4OWW B;  4GN5 A;  2FXQ A;  4X66 L;  3OYY A;  3ULP A;  2R7F A;  1LUZ A;  3UE1 A;  2NVX H;  3HOX G;  4WJ4 A;  4UP7 A;  4JI3 Q;  2HT1 A;  4FDB A;  2ID0 A;  1VQ8 A;  1UE6 A;  4JI7 Q;  4LFC Q;  1PA6 A;  1NBW A;  3S1N H;  4JV5 L;  3E9H A;  2VUM H;  2PI2 E;  1OTC A;  3JAM i;  4A3J G;  3PSI A;  4AH6 A;  4JBW A;  1EUJ A;  2HHH Q;  1PH2 A;  1IL2 A;  4DR7 Q;  4H02 A;  1GO3 E;  2D0P A;  3CCM A;  4A76 A;  2VL6 A;  2HIV A;  4JOI C;  1B8A A;  2NZH A; 
#chains in the Genus database with same CATH topology
 3GD7 A;  3GTM B;  2DN8 A;  4NP5 A;  4GNX A;  3KF6 B;  3R8B A;  4X3S A;  4DV0 Q;  4LF8 Q;  4B3T L;  2EE1 A;  1QE6 A;  1H9M A;  2OF1 A;  2RVL A;  3MXU A;  2Z9H A;  2B8G A;  3QOL A;  4PQX A;  4FF2 A;  3HKZ E;  4PZ6 A;  3CCS A;  3HOY H;  2OTL A;  1ENF A;  1B9N A;  5JAV A;  3H0G H;  5E4W C;  4LFA Q;  3KJO A;  3M3Y B;  3QIA A;  4NPS A;  1H9S A;  1XXG A;  3MFG A;  4A3B G;  4BY7 G;  2PZT A;  3Q23 A;  2WAQ B;  4B3M L;  3A7L A;  4HR7 B;  4R8I A;  1PFM A;  4LMQ D;  1L0W A;  3ERQ A;  1B9M A;  2EYP A;  2AQ1 B;  1PTO D;  1SSO A;  2QDB A;  5M5W H;  1QZG A;  4HJ9 A;  1G51 A;  5C4X B;  3PCO B;  1X55 A;  1WCM H;  1PZJ D;  4HJ8 A;  4L5Q A;  2F0M A;  3QG1 A;  1Z6H A;  3T1H L;  4DR5 Q;  3GTL H;  1DOK A;  1F2Z A;  2NTT A;  2UUC L;  4LFB Q;  1QNU A;  1A0I A;  3MTS A;  1IW7 C;  3KK7 A;  3NXW A;  3PUX A;  1F9P A;  1Q12 A;  2WAQ E;  4X6A H;  4KD3 A;  3C46 A;  2JA7 G;  2K28 A;  4KJO A;  1J8I A;  3P1H A;  1JE5 A;  5JVG 3;  1HUM A;  5KRU A;  4JI0 L;  1DOL A;  1I4R A;  4IOA A;  1YJW A;  3CD6 A;  2F1M A;  3DEO A;  4J1M A;  3SXH A;  4P73 A;  2RCF A;  4JI5 L;  3MEH A;  1B70 B;  3I73 A;  1HJP A;  1WTO A;  4JCV E;  1C8C A;  5I9P A;  2MGS A;  3S1Q B;  3IFT A;  2D0O A;  2F0O A;  2HCI A;  1BCP F;  1J5E Q;  1GXD C;  4JI1 L;  2B2T C;  3U58 A;  5D14 A;  3K59 A;  3TZD A;  2EYO A;  4MIU A;  5IGE A;  3AFQ A;  1CQV A;  5E3F A;  2NVT H;  3J80 i;  2A73 B;  4E6I A;  4KHP Q;  2SOB A;  2PO4 A;  4KI0 A;  3J81 L;  3R93 A;  4BBR B;  4DV5 L;  5M3F G;  4XQJ A;  2X69 A;  4C3I B;  4A3D B;  4QJF A;  2Z4H A;  2WIN B;  3RLO A;  1NMG A;  4X65 Q;  3E0J A;  3A55 A;  1SYD A;  4UP8 A;  2ASB A;  5JJL A;  1BO0 A;  2XIW A;  3S15 H;  2BH8 A;  5IYC G;  4K5W A;  4A3B H;  3D4R A;  4BY7 H;  2EJF C;  4DK1 A;  1ICF B;  4RHR A;  1SRU A;  3TDQ A;  3CF5 A;  4A3G G;  3S9W A;  1NY4 A;  4JI8 Q;  1QG7 A;  2JA9 A;  2L0C A;  2PZW A;  4C2M H;  4K5X A;  4L8J A;  4XDX A;  1B53 A;  1CSP A;  1M1K C;  2E74 C;  2EJM A;  1VQN A;  1KNE A;  2CW0 D;  1HXY D;  5IYB G;  2I5L X;  4DV1 Q;  2K52 A;  2AUJ D;  3GTK H;  2XWB B;  5JOB A;  3DEP A;  1AP0 A;  4A3I B;  5FO7 B;  1PZI D;  1VQD A;  4DUY Q;  2D62 A;  2JK8 A;  4EQP A;  3S16 H;  3PO2 B;  3IAY A;  3A8K E;  2O2L D;  1Y1V G;  1HTL D;  2NBF A;  3ERO A;  5HGQ A;  2AWO A;  4RA8 A;  2R93 G;  3MEF A;  1E1T A;  4HCE A;  3RLF A;  1YHQ A;  3I2Z A;  1L1O C;  2B2Y A;  4XTC S;  5BN5 A;  3K5O A;  1MKH A;  2N49 A;  4GLA C;  2OT2 A;  2JA7 H;  1UUP A;  3HS0 C;  4R4I A;  2F4V Q;  1GM5 A;  5L37 A;  3HOX B;  1XNQ L;  4ULL A;  1EY8 A;  1WD0 A;  1MBY A;  4XXE A;  1HR0 L;  2G9H D;  3T16 A;  1KL9 A;  4IFD J;  3K0X A;  4U67 3;  1EYD A;  1N32 L;  4GKK Q;  3NBI A;  2C9O A;  3M4Y A;  4RKL A;  4FNF A;  2BCO A;  1LTR D;  3V2T A;  4YWL A;  1HZ9 A;  2H5X A;  1G91 A;  1A62 A;  2CKZ B;  4RCN A;  5FO9 B;  3RN5 A;  3I4O A;  4CKB A;  1Q3L A;  5M9O A;  3KBX A;  2Y0S B;  2O5I C;  4DR7 L;  1VMC A;  4IJL A;  5C5L A;  3VR5 A;  1WTW A;  5ELF A;  2K05 A;  5M3F H;  1LO5 D;  1I4G A;  5KYL A;  2VQE L;  4K14 A;  2VNU D;  2E5L L;  2IHF A;  1AEX A;  1I94 Q;  1OXX K;  1Q1E A;  2ICE C;  1F2Y A;  3CC4 A;  3HOV G;  4A3F G;  1E2W A;  2EXD A;  5KNB A;  4CJ0 B;  3L2P A;  1E3P A;  4BA1 I;  1WTR A;  2OWO A;  3VYS A;  3KDF A;  3BDC A;  4TRD A;  1UWV A;  5IYC H;  3GTQ B;  4YWK A;  3UDI A;  1IL8 A;  4QUC A;  3J7Z C;  2F3I A;  2MFI A;  4AIM A;  2UU9 Q;  3VYR A;  3I72 A;  2AQ2 B;  1DGS A;  1VQB A;  1EIY B;  4RMF A;  1CKO A;  4G7H C;  2ENB A;  4LJZ C;  4N9T A;  4A3K H;  1VF5 C;  2VQF Q;  2PQA B;  3G6E A;  1V1P B;  4B3M Q;  5IYB H;  4GN3 B;  2N78 A;  2I46 A;  4ME5 A;  1XPR A;  3CKI B;  3HOY B;  4LF6 L;  3H0G B;  2K75 A;  2PQE A;  4NB3 A;  4NKL A;  2JA8 B;  5GAH C;  4RGM A;  5IE8 A;  4ME3 A;  4CJ1 B;  1Y1V H;  4HID A;  2R7D A;  3T1H Q;  1M4V A;  5D65 A;  1SYE A;  3HOU H;  1EYA A;  3ND8 A;  3TS0 A;  4FYD A;  2F0I A;  1U4P A;  4PMB A;  5C4X G;  1E22 A;  1STB A;  5M5W B;  3I55 A;  4DV2 L;  2KJX A;  1HFG A;  5IP7 H;  1KAB A;  2F52 A;  2PMZ E;  3J7Y W;  3F2C A;  3ZYY X;  3RLN A;  1KIX A;  4HAE A;  3GTL B;  3F8T A;  2IJ0 A;  3UDX A;  2HDL A;  2HCC A;  4JI0 Q;  3I7F A;  1E24 A;  1Y69 U;  1RJT A;  2KEE A;  3VYT A;  2LXJ A;  4JG2 A;  2F0L A;  2FMM A;  1L0X B;  4QF4 A;  5CV8 A;  4JVZ A;  2LS0 1;  4DR1 Q;  4R8N A;  3PUY A;  1Y14 B;  3ULJ A;  1ONL A;  5FOB B;  4NXN L;  5IGD A;  2J7Z A;  1QVF A;  2CHB D;  3R2I A;  1H9J A;  4JI1 Q;  4G7O C;  1XPO A;  1KHI A;  5LMN W;  1SMY D;  5AFW A;  1PH4 A;  4FF4 A;  4KHV A;  3E9I A;  1K0S A;  2KOL A;  4IPG A;  2KBN A;  3J7A 5;  3AEV A;  1I3Q H;  1MHW C;  4IO9 A;  1IBK L;  2UUB L;  4WOR A;  3GP7 A;  5LMU L;  1Y8P B;  3DXJ C;  4HIM A;  3GV6 A;  3RNU A;  2B2T A;  5EPL A;  5KNC A;  1MSH A;  1D1I A;  4A3F H;  3HOV H;  4X3U A;  5IGG A;  2RBM A;  1MD2 D;  1TII D;  1IYJ B;  1ZYR D;  1M8A A;  2K14 A;  3SR1 A;  1SYC A;  1A6X A;  1CKN B;  4DA2 A;  2K5H A;  3EJI A;  2AUK A;  2NVT B;  4LFC L;  1RD9 D;  5EBD A;  2EYJ A;  2F0N A;  4C3I G;  5GRO A;  5CYU A;  4DK0 A;  1PZK D;  1CT1 D;  1AN8 A;  4DV0 L;  3U4V A;  3GO5 A;  4LF8 L;  5CV5 A;  2JYO A;  1EEI D;  1EWC A;  4ZAI A;  3CAM A;  4ALP A;  2NVY H;  1U5K A;  2B63 G;  2MPM A;  2XVS A;  4BY7 B;  1TT2 A;  2MP1 A;  3STB D;  5ELC A;  1KD1 C;  2QIL A;  4C2M B;  1GVP A;  2N8N A;  2JXM B;  3VR6 A;  3M4O H;  1L0Y B;  4EQO A;  4OHJ A;  1GUG A;  3FHW A;  1FVI A;  3OW2 A;  3S1M H;  1UE7 A;  1V43 A;  4GN4 B;  2DY7 A;  5EPK A;  5LL6 X;  2IW3 A;  1PHJ A;  1EFW A;  1QWY A;  2Z8L A;  4DAY A;  3GTO H;  3S16 B;  1JIC A;  4GOP B;  4RKB A;  1WTQ A;  2Z0S A;  2LKV A;  3OMC A;  4QIW E;  2PI2 A;  5G3L F;  3JAM E;  1HR0 Q;  1S40 A;  1V1P A;  3CRK C;  2IX0 A;  1C0A A;  4K8I A;  4TKO B;  2F0D A;  4K0K Q;  3MZ5 A;  4DR5 L;  1GUS A;  5CGK A;  4DUZ Q;  2B2W A;  2FXQ A;  1LAB A;  1LUZ A;  3HOX G;  1ESR A;  1R4P B;  2K6A A;  2K5D A;  1Y8N B;  4A3J G;  3IL8 A;  4KKT A;  1EUJ A;  1F2L A;  2HHH Q;  4DR7 Q;  1BXT A;  4A76 A;  1GO3 E;  3CCM A;  2Q8R E;  1B8A A;  4WRD A;  4DV6 L;  3K5N A;  3AQQ A;  3X3M A;  1NAP A;  2E75 C;  3QWN A;  1JT8 A;  4EX5 A;  3S14 B;  2G9D A;  4CDF C;  2Y0S G;  4DGZ A;  2V1C C;  4KLK A;  2NUC A;  5EKL A;  4ZK9 B;  5DM7 3;  2F0Q A;  5M3F B;  3E5S A;  3CCL A;  3KLS X;  3CCV A;  3PF5 A;  3LWE A;  1SNM A;  1N33 Q;  4XIG S;  4WFN 3;  4PZ7 A;  4LUO A;  5IGB A;  1YIT A;  3EBE A;  3NP8 A;  1KNA A;  2R7Z B;  2DUD A;  2I0Q A;  5D3I B;  3GTP H;  4KHP L;  1R4Q B;  3HKS A;  4OL7 A;  5E7N A;  4DAP A;  1PFS A;  3NQT A;  1EWH A;  2PPB C;  1GJX A;  3OWE B;  1LTG D;  2B63 H;  5FKA C;  2MQH A;  3AB9 A;  1PRT F;  3K5L A;  2ATW A;  1S5C D;  5C3X A;  1I4P A;  4X65 L;  5C0X G;  1II3 A;  2XRQ D;  4DR4 Q;  3KF8 A;  1I5F A;  1TY2 A;  4F87 A;  1MI2 A;  4A3K B;  1PFN A;  4C3J H;  1W6K A;  1VQC A;  1OO9 B;  2IWH A;  4BBS B;  3CME A;  3F1Z A;  3H0G G;  4LNQ A;  4KV6 A;  2JA8 G;  3S2D B;  2ZM6 L;  2RSO A;  2KQ3 A;  2K50 A;  3HP3 A;  1NCV A;  4LWC A;  1J9O A;  5EPJ A;  2KEN A;  2LXK A;  3MAQ A;  3TP5 A;  3DM1 A;  5COY A;  2ALY B;  4A4I A;  1RTN A;  3VYU A;  3NUC A;  1BBU A;  1EEF D;  3HOU B;  4GLX A;  2A6H D;  1QVG A;  4YHH L;  1BBX C;  1VQI A;  1O7Y A;  2NN6 H;  4DUY L;  2GN5 A;  3I4L A;  3T56 B;  1K83 H;  2XNA C;  4FVM A;  4NXM Q;  2GVA A;  2CWA A;  3HOX H;  3S1N B;  2H4O A;  4CJ2 C;  1B50 A;  1VQK A;  2M00 A;  4OX9 Q;  4AQY L;  4DPG A;  1LTI D;  1RTO A;  4A3J H;  4NXN Q;  4PMW A;  2YTY A;  2DY8 A;  5CC4 A;  3C2P A;  3AU7 A;  1CZW A;  1IXR A;  2E2J H;  1IBK Q;  2UUB Q;  4MTN A;  5LMU Q;  1AH9 A;  1SR3 A;  1BCP C;  2QGQ A;  2L1B A;  1LTA D;  1Y8O B;  2EZV A;  3K81 C;  2OEO A;  2JA6 B;  2MHV A;  1VQ9 A;  1VQE A;  2AKW B;  2K33 A;  4K2L A;  2WAC A;  4GOP A;  4GKK L;  3HEJ A;  2E2D C;  1UE1 A;  4K6D A;  1LT6 D;  3URY A;  3DLL A;  1I3Q B;  3DUZ A;  3O13 A;  2C35 B;  3K57 A;  4DR2 L;  3ERS X;  2BH2 A;  3HOV B;  4DV4 Q;  5HUR A;  3J81 c;  2F0S A;  3I4N B;  1JOK A;  5JJI A;  1EWI A;  2N55 A;  4O2D A;  3GTQ H;  2IX1 A;  1BVS A;  1VF7 A;  3CQZ B;  1DJR D;  4UDU C;  5IT9 E;  3UDF A;  2KUM A;  3CP0 A;  5ELN A;  2A19 A;  2K4K A;  3Q6S A;  1PYS B;  3FPP A;  3P7J A;  3TSS A;  1YHA A;  1SRO A;  3DMU A;  4DR6 L;  3D8G A;  1I94 L;  5C0X H;  2Q2I A;  1SND A;  1ZXT A;  2VZA A;  5EBC A;  3OHX C;  1V8Q A;  4FXD A;  4L5T A;  4CKC A;  3PF4 A;  1ENC A;  3SEB A;  1FNU A;  1SN8 A;  1VQ4 A;  1XPU A;  1EYG A;  2JA8 H;  1CUK A;  2UU9 L;  4JK1 C;  1E7Z A;  1I4X A;  2VS1 A;  4MNO A;  3ITP A;  2NVY B;  3I56 A;  4C3H H;  2F0V A;  2VQF L;  3G7L A;  1A2T A;  2D5D A;  1CTM A;  1BQQ T;  4YIJ A;  2SEB D;  2HIX A;  2N3S A;  1VQG A;  1QIL A;  3KYH C;  2EY1 A;  3M4O B;  1JOQ A;  3M7G A;  1F2M A;  3JAM L;  2H1E A;  1JQY D;  1PTO F;  1WD1 A;  1Z47 A;  3S1M B;  1N34 L;  4IPH A;  1VMP A;  1QOH A;  1JOO A;  1SNC A;  3LNN A;  4IUP A;  4PMC A;  4JPB W;  5CV6 A;  3GTO B;  3GQB A;  3AFP A;  5I2Y A;  1ILQ A;  2LFN A;  4JI7 L;  4OIJ A;  1HNZ Q;  3DWQ A;  3H15 A;  5CV4 A;  3KFU A;  1X3F A;  5M5Y H;  1JMC A;  1CI3 M;  1MGS A;  4DV6 Q;  1XTD A;  5FLX E;  1EOT A;  2GA4 B;  5DM6 3;  3KDF B;  1KDB A;  1D1K A;  3MXG A;  5EKK A;  2CCZ A;  2EYH A;  1LLR D;  1OXU A;  2ZTE A;  3KUP A;  5LL6 S;  1HNX Q;  4JI6 Q;  1Q8I A;  1HTP A;  4DR1 L;  1CA6 A;  3P20 A;  1LYL A;  1U0L A;  5I2X A;  1Q86 C;  1MIU A;  4DU9 A;  4BY1 H;  2EY5 A;  3E3X A;  1JE4 A;  1ILP A;  1STN A;  4R4C A;  3KLS A;  3CC2 A;  1PVO A;  3BVM A;  1XYI A;  1FNW A;  1V1Q A;  4DNT B;  1F9R A;  3MC0 B;  1PH1 A;  4LK1 C;  3CC7 A;  1SFO H;  1OXS C;  4YCW A;  3WOE A;  4WJ4 A;  2RHS B;  1X6O A;  5GAG C;  4QB4 A;  3OTO L;  4R4O A;  3U4Z A;  3A74 A;  5DLQ E;  2R7Z G;  1X65 A;  4JI2 Q;  4B3R Q;  4KKS A;  1X32 A;  3D31 A;  1B3A A;  1L2F A;  4FF3 A;  3GTP B;  1IZ6 A;  1FJG L;  1N9W A;  1TVX A;  4P71 A;  1K8O A;  5C44 H;  1STA A;  3AYH B;  2PYK A;  2ZM6 Q;  2L11 A;  2B63 B;  4ZRZ A;  3SK6 A;  3T13 A;  2OQ0 A;  2Q8I B;  4KK7 A;  2Z4I A;  1SMX A;  2A6E C;  3SHL A;  2E76 C;  4A3K G;  3NSW A;  1KAW A;  4LW1 A;  2NN6 I;  2MUY A;  4OGQ C;  1JJG A;  4BBS G;  4LUV A;  3BYY B;  4C3J B;  4LF7 L;  1YNJ C;  4YHH Q;  5DAU A;  1HUN A;  2XSC A;  4QGU A;  2G5D A;  3PQI A;  1EU3 A;  5A2Q L;  3Q22 A;  4HSV A;  3M85 A;  4AQY Q;  3NTI A;  2I5M X;  3HOU G;  1O7Z A;  5J3B A;  4OEM B;  1HH2 P;  3H94 A;  1EZ6 A;  1HZB A;  4BA2 I;  3I4M B;  5IWA Q;  1N36 Q;  2JEA I;  2NVQ H;  1TXY A;  3NK9 A;  1K83 B;  1VQJ A;  5IP7 G;  2EQS A;  2F0G A;  4Z9C B;  4MN3 A;  4B9W A;  3WOF A;  4A3J B;  5EJW A;  4K0K L;  1DCZ A;  2O4X A;  4F88 A;  1U4L A;  4UY8 C;  4DUZ L;  2E2J B;  1VQ5 A;  4KY5 A;  2UXC Q;  1CHP D;  1VS0 A;  3EIV A;  4DR2 Q;  2JA6 G;  2RDG A;  2J4X A;  1F77 A;  3Q0A A;  3S14 H;  1D6E C;  1U4R A;  4LF5 Q;  1V9P A;  3G4S A;  5AJ3 Q;  5LMN L;  3J81 i;  3ONA B;  2HHH L;  1IW7 D;  1U9R A;  5C0X I;  4QUF A;  4JC0 A;  2B2V A;  4ZUJ A;  1H95 A;  4CGY B;  4P75 A;  4DR6 Q;  3NWT A;  2YYZ A;  1C7Y A;  3E6Z X;  2WII B;  5FLM H;  3F2D A;  4M8A A;  2R7Z H;  3I4N G;  2KVM A;  1TS3 A;  5FO8 B;  2I5H A;  1SE8 A;  2L55 A;  5KIX A;  1KDC A;  1B4O A;  2KHJ A;  2BA0 A;  4ABN A;  1EQR A;  1HZC A;  3T51 B;  2L15 A;  3PIO A;  3OOC A;  5J22 A;  4DAY B;  1AE3 A;  4HJ7 A;  1G2T A;  4HCS A;  1ET9 A;  1EQQ A;  1N33 L;  1L1O B;  4R1J A;  3K7A H;  3A56 A;  3A5Z B;  1NR4 A;  4X3K A;  4XYO A;  4A3E G;  2NWG A;  3GV3 A;  3RD4 A;  2Y0S E;  2IX3 A;  3CXC A;  4RHS A;  5JEA G;  3TRE A;  1HQR D;  1EQV A;  5C0X J;  4BBS H;  1SNQ A;  4XQQ A;  3S2D H;  3TME A;  1Q1B A;  1DD2 A;  3AMU A;  2EJG C;  2A1A A;  4TSS A;  4DR4 L;  2JSO A;  1TS4 A;  1N34 Q;  4O42 A;  2Z6B A;  4C3H B;  2R61 A;  4A3L H;  1D5X C;  3TP6 A;  3FP9 A;  4OWW B;  3UE1 A;  1SYG A;  4JI3 Q;  1B44 D;  2EYL A;  4JI7 Q;  3S1N H;  1NBW A;  4RGN A;  2VUM H;  2PI2 E;  3RZD B;  1OTC A;  3MA2 B;  4AH6 A;  4DN4 M;  3OIP A;  3R2T A;  3KBG A;  3VA7 A;  1F9Q A;  4H02 A;  1BF4 A;  2HIV A;  4JOI C;  3BS1 A;  4IOC A;  2L4N A;  5FLX L;  1WOC A;  1WTV A;  4B08 A;  1XTC D;  2JQO A;  3H6M A;  4YWM A;  3IFD A;  5BR8 L;  3G48 A;  5FK9 C;  4NXM L;  2B39 A;  3BZK A;  1NSN S;  2JA6 H;  2RSN A;  4OX9 L;  5M5Y B;  1NUC A;  4KN7 C;  1GUW A;  1FGU A;  2IPK D;  4MHE A;  5CV7 A;  2ZTD A;  3WDN A;  1FD7 D;  1IBM L;  2PW5 A;  1SAP A;  4F8M A;  1K8G A;  2BE5 C;  2YTV A;  5I9O A;  1PDQ A;  1WYD A;  3U9O A;  3ND9 A;  3KF8 B;  1WTX A;  3OTO Q;  1E0B A;  4OIK A;  3I4N H;  5F2D A;  4BY1 B;  3H3V C;  3S2H H;  3HGB A;  1YI2 A;  1STG A;  3CQZ H;  3SK4 A;  5ISR A;  3J7A V;  2EY2 A;  2SDF A;  2F3V A;  4POG A;  1PRT C;  1AZQ A;  1FJG Q;  1SFO B;  3K6O A;  1SYB A;  4EGV A;  4A3E H;  3PUV A;  1QUQ B;  4DV4 L;  1Q90 A;  1YJ9 A;  1AFP A;  5K5P A;  3I3C A;  5JEA H;  1I50 B;  1T5X D;  5DEH A;  1HZA A;  3NBH A;  2WB1 B;  4BXX G;  3MXN B;  1JR0 D;  3S1R H;  2VY3 A;  4RCO A;  4JW0 A;  1S72 A;  1Z9F A;  1WFQ A;  2R3Z A;  4LF7 Q;  1LT5 D;  4V19 0;  3M9B A;  4GNX C;  1X3G A;  5C44 B;  1IYV A;  1OXV A;  4HN7 A;  4IQZ A;  3B6Y A;  1PH3 A;  4DF7 A;  2NZ1 D;  4C3J G;  1QCB D;  3J80 E;  3CCJ A;  1IKL A;  1S4Z A;  2K32 A;  3HZX A;  1C48 A;  3RZO H;  2YTX A;  3Q8D A;  4QCL A;  3E0E A;  5C3W A;  1EQT A;  3RR5 A;  1S3O A;  1STY A;  2WB1 E;  4RGO S;  3GTJ H;  1QJO A;  2A69 C;  2FIN B;  1L1O A;  1PH5 A;  4KD4 A;  4KY7 A;  2L5T A;  4X62 Q;  3BG3 A;  1NTG A;  2SNM A;  3I4M G;  2FMC A;  1SYF A;  1HQM C;  1G6Z A;  2NN6 G;  4NW2 A;  2KED A;  1PV4 A;  3W1G A;  4N9P A;  2NVQ B;  2HDM A;  1Y1W B;  1RDP D;  1VQP A;  4JBJ A;  5A35 A;  4RH6 A;  2FJ2 A;  3PUW A;  4PG3 A;  5C4J H;  5HY6 A;  3U50 C;  5LMN Q;  4G57 A;  1HNZ L;  2UXB Q;  4TQU S;  4DV3 Q;  1RIP A;  1X56 A;  5BN3 A;  3BU2 A;  3F2B A;  1C9O A;  1I4H A;  4A93 H;  3H91 A;  1HNX L;  5IIF A;  4JI6 L;  2ZTC A;  2IT1 A;  5DNF A;  1K0R A;  1I6H H;  2CQO A;  5JPN C;  4UHV A;  4PZ8 A;  1SJE D;  4IAL A;  5IY0 A;  3L0O A;  4K5V A;  4OWT B;  3TP8 A;  1DM0 B;  1DXM A;  1K3B C;  2EXZ A;  1WTP A;  3EFX D;  4BXX H;  4OON A;  4Q0F A;  3ULL A;  5H1S E;  1TWG H;  1FGB D;  2YV5 A;  1B2T A;  5C6A A;  1CA5 A;  2ZJQ A;  4X64 L;  5ELB A;  2LSS A;  3BYT B;  3QJY A;  5M3M H;  1TWH H;  3N6R A;  1KQS A;  4CDE C;  4QY7 A;  4IUN A;  3PO3 G;  2J0T D;  4XT3 B;  1ROD A;  2F0F A;  1X3Q A;  3K7A B;  4DKA C;  1EIH A;  4JI2 L;  4B3R L;  2EOT A;  3DWP A;  1KLU D;  1XX8 A;  3D4W A;  3LX0 A;  1X9N A;  2FHT A;  2VB2 X;  3FPU B;  3VR2 A;  1PTO C;  5KEE A;  1JB3 A;  4O1N A;  2CQA A;  4U68 A;  1ICW A;  4A3M G;  1EY9 A;  3C1E A;  2KHI A;  4MZ9 A;  4C3H G;  1QUQ A;  2QF7 A;  3JAM c;  1ASY A;  1S5F D;  3CCQ A;  3I4M H;  5KND A;  4GS3 A;  5I6Y A;  5CV9 A;  5K36 H;  1BDO A;  3MXN A;  1YHB A;  1BKB A;  2BDO A;  1A8V A;  2KCM A;  5BR8 Q;  4JOI A;  1E2V A;  4L63 B;  1PMR A;  4BS9 A;  4ZLT F;  2VUM B;  2A8V A;  3UDG A;  1TWC H;  3MXP A;  3G71 A;  3SK8 A;  1A63 A;  1YVC A;  3W3A A;  3H09 A;  5E1F A;  4DNI A;  1IBM Q;  1S5B D;  4MTK A;  5IWA L;  1N36 L;  2F0K A;  4C1N K;  3TBI B;  3M7N A;  4IFD H;  2UXD Q;  2B2Y C;  5ELD A;  1LTL A;  4HMI A;  3KJP A;  2PNR C;  1SE4 A;  1TY0 A;  1OXT A;  3HOZ B;  2CFM A;  3SDZ A;  1PFB A;  1O7I A;  3NEM A;  2ZXR A;  4IPD A;  4YCU A;  2XTI A;  3KLR A;  3QR8 A;  3GTG H;  1ZKO A;  4DK3 C;  4BWG B;  4C56 C;  1SE2 A;  2UXC L;  4KHZ A;  3VA5 A;  1RKN A;  4GKJ L;  4LF5 L;  4HED A;  3W1B A;  1YNX A;  4BY1 G;  3EQL C;  5AJ3 L;  4OO1 H;  1EZ8 A;  1PH7 A;  1A2U A;  3OW7 A;  3S2H B;  2EIF A;  4LAA A;  1Q8K A;  1JCK B;  2JEB I;  3D0F A;  2PNH A;  5C3E G;  3PO3 H;  1UEB A;  2B8F A;  3TN2 A;  2E2I H;  1O7L A;  1I6V C;  4JI4 L;  4P72 A;  3CW2 C;  4A3E B;  2F0W A;  2RHQ B;  2AMC B;  1H9R A;  2EVB A;  1TU2 B;  2WB1 G;  4J15 A;  3UE0 A;  1PYW D;  5EKI A;  1LM0 A;  2NZO A;  2CW0 C;  3NQI A;  3S1R B;  1Q46 A;  2VXW A;  1QZH A;  5IP9 G;  5JEA J;  4YCV A;  2HQE A;  1AW7 A;  3J80 L;  1BBW A;  5C44 G;  5ELE A;  4A3M H;  1BR9 A;  1R9T H;  3C1F A;  4DR3 L;  2MNA A;  4A3C H;  1BCP B;  5EQ0 A;  4ZKC B;  3CCU A;  1CQF A;  1SDF A;  4Y7N H;  1XNR Q;  4IUU A;  5IOC A;  1A3T A;  4IZ8 A;  4ID6 A;  2ZJR A;  1IHZ A;  1TR5 A;  2NYZ D;  3CPW A;  1PXU A;  2FFK B;  4I7Z C;  3RZD H;  2K5Q A;  1NE3 A;  2MO0 A;  4FF1 A;  1XWE A;  3NWS A;  2NB0 A;  2DJG C;  1A3U A;  2ZXP A;  4PNY A;  1TWA H;  3RZO B;  4H13 C;  3SVM A;  2A74 C;  4WJ3 M;  3DM3 A;  2F0T A;  3GTJ B;  3ICE A;  1HPC A;  1GUN A;  2B2U C;  2E2H H;  3PIO 3;  4JI3 L;  2ZT9 C;  1WJJ A;  3CPF A;  2WKD A;  3SK5 A;  3PIP A;  2KEC A;  3BDL A;  1EU4 A;  4CHT B;  1RCV D;  1WI5 A;  1Y1W G;  3FMC A;  2HD3 A;  2Q8T A;  1K28 A;  2WP8 J;  4H44 C;  1HRJ A;  1V1O A;  1EY7 A;  1SNP A;  2M9V A;  4YY3 Q;  1GUO A;  2F3W A;  1KDA A;  1MSG A;  5C4J B;  3QOJ A;  1F9S A;  3J81 j;  2IHE A;  1HFN A;  1AZP A;  2K03 A;  2PZU A;  1D2B A;  2F03 A;  3HFZ B;  1SJH D;  3CRL C;  1PH6 A;  3DWA A;  1CKM A;  5IYD G;  5ELO A;  3BJU A;  4HIO A;  3PGZ A;  4HIK A;  5JJK A;  4A93 B;  1VQA A;  5IT9 c;  4ZKB B;  4I7A A;  2RCN A;  3OIQ A;  4LF9 Q;  5GAE C;  1K8M A;  5C3E H;  4JYA Q;  2F0H A;  1BCP D;  2VB3 X;  4X64 Q;  1I6H B;  1W2B A;  3FKI G;  1KAA A;  1I50 H;  3HG9 A;  1YZ6 A;  2RKS A;  1A15 A;  5J1Z A;  1SLJ A;  2WKC A;  5FLM G;  2JA5 B;  4J8Q A;  4DV7 Q;  4IUQ A;  3Q24 A;  5IP9 H;  1TWG B;  4L6T B;  1XMQ L;  1Q81 C;  1SNO A;  2PW7 A;  4AYB B;  5M3M B;  1TWH B;  3K7U C;  3LWU A;  1JWM D;  4X66 L;  3ULP A;  3OYY A;  2R7F A;  2NVX H;  2HT1 A;  2ID0 A;  2I07 B;  4JV5 L;  3E9H A;  2HUG A;  3MVV A;  2DJF C;  1TKW B;  3PSI A;  3JAM i;  1IL2 A;  1TQO A;  2X6G A;  3A54 A;  1EFI D;  2VL6 A;  1FYC A;  4LUZ A;  1VQL A;  4B3S L;  1NR2 A;  3IRB A;  2BOS A;  1P16 A;  3HOW B;  4POF A;  4OWX B;  1E2Z A;  4XYQ A;  3P75 A;  3H3V H;  1U4M A;  1ASZ A;  4FXK C;  3CHB D;  1EIF A;  2KCN A;  4A3L G;  4UPA A;  4AYB E;  3PV0 A;  2WV6 D;  4NDX A;  3FVQ A;  4IFD I;  1JB7 A;  1Y1W H;  4K2K A;  3KF6 A;  3M4Q A;  3G6J B;  4IJH A;  4UP9 A;  5FLX c;  2YU9 H;  1TWF H;  2VUM G;  4DXF A;  3X3N A;  2SNS A;  3N52 A;  3A5U A;  2A68 C;  2KA7 A;  2EPB A;  1GD7 A;  5IGC A;  3LGJ A;  1STH A;  1TWC B;  3L3O C;  4X62 L;  1JOR A;  1SE3 A;  3T53 B;  5C5M A;  2F0P A;  1BOS A;  1SMY C;  2EYF A;  3S17 H;  3FDT A;  1ET6 A;  1J6Q A;  1NMF A;  3IKJ A;  4H0L C;  2RQX A;  3M4P A;  5COR A;  3J7A F;  4Y52 H;  4OO1 I;  5IYD H;  3NBH B;  3NTK A;  3TRZ A;  1T5E A;  2KCC A;  1UE5 A;  3UI2 A;  4GKJ Q;  1B3Q A;  1QNK A;  2F0U A;  4TVA B;  2QA4 A;  3HOZ G;  3L9A X;  1XMO Q;  2B2W C;  1ZYR C;  2UUA Q;  2DGY A;  3KOJ A;  5D3D A;  3NE5 B;  4IUV A;  2UXB L;  4XQN A;  5CR3 A;  4DV3 L;  3D4D A;  3K5M A;  3FKI H;  5IT9 L;  3V96 A;  3FRP B;  1GKH A;  3GTG B;  4GZY C;  2ZJP A;  1NJI C;  2K5N A;  2RDF A;  4DK6 C;  2QEX A;  1YJN A;  1EY4 A;  4JI4 Q;  3WWV A;  4DAM A;  3C3L A;  2JE6 I;  3D3R A;  4B9X A;  1HNW L;  2QKI C;  3HKZ G;  3I8Z A;  4EQ5 A;  2WFW A;  2KCT A;  4N8F A;  4DAV A;  2R92 G;  1GHJ A;  1K9M C;  4B3T Q;  1C4Q A;  1YNN C;  3PO3 B;  1JJC B;  4A75 A;  2ES2 A;  4DXG A;  1DZ1 A;  3OPO A;  2E2I B;  1P8L A;  2ZXO A;  4DR3 Q;  4KY6 A;  3STB C;  1LTB D;  2QCP X;  4QMG A;  3EN2 A;  4QQB X;  2OTJ A;  1JWU D;  2X6L A;  2JN4 A;  5JVH 3;  2PCF B;  4A3G H;  1GUT A;  3NPP A;  3TEH B;  2VW9 A;  3NEL A;  4A3M B;  4CBV A;  1IBL L;  1R9T B;  2PMZ B;  1CFM A;  3BVG A;  1EY0 A;  4RGT A;  1UNS A;  1ESF A;  1N8R C;  2NTS A;  4HSP A;  4Y7N B;  1QVC A;  3U9S A;  3K80 C;  1X54 A;  3W2D A;  1WVL A;  1HHV A;  4KMU C;  5M5X H;  1QB5 D;  5BN4 A;  2D2C C;  1KRS A;  3A8J E;  2A6E D;  2B2U A;  2WAQ G;  4LF4 L;  3MFY A;  1TWA B;  5IOD A;  2K5V A;  3ER0 A;  2R93 H;  1TS5 A;  3CU7 A;  3KLW A;  2UUC Q;  1YNJ D;  4FP5 D;  2IY5 B;  2E2H B;  3S24 A;  1K73 C;  4CKE A;  4ODG A;  4JBK A;  1KRT A;  3OSO A;  1S5D D;  1WCM B;  2QW7 A;  2Q2T A;  1X3P A;  3W5O A;  1JWS D;  1VQO A;  1XJV A;  3HOZ H;  1KTK A;  4RAU C;  4ZQ3 A;  1HR0 W;  3T1Y L;  1O80 A;  1HCZ A;  3K0Y A;  1G2S A;  1JJ2 A;  1KC8 C;  1PYB A;  1PTO H;  2JP1 A;  3CCR A;  2UXD L;  4JI5 Q;  1VQM A;  4HJA A;  3I70 A;  2A68 D;  2Z6K C;  4XT1 B;  1EY5 A;  1RHP A;  2F0E A;  3PUZ A;  1A3V A;  4FXG C;  1D7Q A;  4A93 G;  3BVZ A;  2GVB A;  1ZEQ X;  4G4K A;  3A7A B;  4P74 A;  3BDO A;  3MWY W;  2V4D A;  3CCE A;  1H9K A;  2R92 H;  2F4I A;  3BZD B;  4ZUI A;  1XMQ Q;  5C3E B;  3RMH A;  4GOP C;  4EVO A;  4I65 A;  4DV5 Q;  1ML0 D;  4L5S A;  5EGT A;  3V05 A;  1DOM A;  4X66 Q;  2CH4 A;  4OXP A;  3GTM H;  3A8I E;  2JA5 G;  4KTA A;  4JV5 Q;  1DON A;  1CHQ D;  1VQ6 A;  2OCE A;  4BBR G;  1BNZ A;  4AYB G;  5I4D A;  5M3M G;  4O0A A;  4A3D G;  4B3S Q;  1D8L A;  3H3V I;  2K1B A;  3R3O A;  5CMD A;  3D6W A;  1LT3 D;  2N88 A;  2NVX B;  3OWF A;  4KN4 C;  1HA5 A;  4CDC C;  4C1N I;  3M3Y H;  4UAI A;  2QEJ C;  3S15 B;  1YNN D;  1X3E A;  4QIW B;  2A6H C;  2JJQ A;  1M90 C;  2EDG A;  3RN2 A;  4A3B B;  1Z7T A;  3QB3 A;  3HOW G;  1KLG D;  4ILW A;  2K5W A;  1XNR L;  2Z1C A;  2EYM A;  1GHK A;  4LFA L;  3SE0 A;  4APV A;  1O78 A;  1FR3 A;  5C4X H;  1CZG A;  2XWJ B;  1FL0 A;  2RA4 A;  4IUT A;  5K36 G;  5EAY A;  1LT4 D;  4V0B A;  3T4A C;  4IN3 A;  4L5R C;  4A3I G;  3VDY A;  3GTK B;  4R9W A;  2XN9 C;  3GDE A;  3I91 A;  2L12 A;  4CDD C;  3PO2 G;  1PLF A;  1PRT B;  4R4Q A;  5G3L D;  2YU9 B;  1K8A C;  1TWF B;  4K8J A;  2M2L A;  4PV1 C;  5IGF A;  4G7Z C;  1XNQ Q;  5FJ8 G;  4RG1 A;  2EY6 A;  4NMZ A;  4WJW A;  1UAP A;  2PQA A;  1W3S A;  1BUV T;  1FNV A;  5TSS A;  1N32 Q;  2XRS D;  1D5Z C;  3I90 A;  2D9U A;  4HMJ A;  1LTT D;  1MJC A;  3S17 B;  4S3S A;  1PH8 A;  1CK1 A;  2XGT A;  4EQN A;  2K04 A;  2LY7 A;  2JA7 B;  3QO2 A;  3HRZ C;  4IFD G;  5KYI A;  4GNX B;  4LFB L;  4YY3 L;  4IPC A;  1KXL A;  2TMP A;  1HNW Q;  2RF4 A;  5NUC A;  2LMC B;  2Q2U A;  1VQF A;  4P2C B;  2CWP A;  5J39 A;  3OMG A;  2QDL A;  3S1Q H;  4KJN A;  1YIJ A;  1AE2 A;  4FO2 A;  1EOV A;  4KKU A;  3TP7 A;  3FKI B;  4Q5V A;  2VQE Q;  3CMA A;  5T1I A;  2ICI A;  3TS2 A;  2E5L Q;  2JA5 H;  2L9H A;  4RFB A;  5JJZ A;  4LF9 L;  2BE5 D;  4OO1 G;  1H9S B;  1SBB B;  2OXP A;  3PIP 3;  1LAC A;  4OEL B;  4JYA L;  4BBR H;  1CSQ A;  1W6J A;  1D5M C;  3NEN A;  1LTS D;  4C3I H;  2DNE A;  4A3D H;  1WTH A;  2IL8 A;  1LV9 A;  1J5E L;  2C5C A;  2DNC A;  1IBL Q;  2BDN A;  4DV7 L;  1ENA A;  4DNR B;  3J81 E;  3EA6 A;  2AWN A;  1PRT D;  2OQK A;  3J80 c;  1G8Z D;  2KHS A;  1TS2 A;  4IUR A;  5GAD C;  1VQH A;  2TSS A;  3NTH A;  4LF6 Q;  1GOZ A;  2E8G A;  1PH9 A;  1IYU A;  4ZYS A;  4ZCK A;  3HOW H;  4A3G B;  3PMF A;  1EIG A;  1K3R A;  4JBM A;  1B7Y B;  3TZU A;  4LF4 Q;  1YBY A;  4R4T A;  4A3C G;  4F7X A;  2F0J A;  3F2U A;  2K7V A;  3HOY G;  4K6L A;  3JC6 6;  4A3I H;  3RUZ A;  1VQ7 A;  1CKN A;  5E4X A;  3PO2 H;  5M5X B;  1VDZ A;  4DV2 Q;  4JI8 L;  3A0J A;  4RWS C;  1EYC A;  5C4H A;  1YEZ A;  2HQL A;  4QL5 A;  1Y1V B;  2B29 A;  5FJ8 H;  5C4Z A;  4DV1 L;  5T1G A;  1DYQ A;  3MHB A;  2R93 B;  2R6G A;  1Q82 C;  3T1Y Q;  4HTH A;  3FEW X;  1MJE A;  1G6P A;  5A2Q E;  2CVR A;  2A5H A;  1NNX A;  2MO1 A;  1JC7 A;  1SXT A;  2P5Z X;  1CM9 A;  1WCM G;  5I6W A;  2A69 D;  4J6H A;  2AHO B;  4N8X 1;  3D6C A;  1EY6 A;  4M1U B;  1T9H A;  4HJ5 A;  2O5J C;  1B1Z A;  2BA1 A;  1RL2 A;  2K01 A;  3EVQ A;  3K8A A;  3K58 A;  1G29 1;  2Q2H A;  1I4Q A;  2Z6K A;  1E1O A;  4H7B A;  2B3G A;  1VCI A;  3TQY A;  3VR3 A;  3BZC A;  4GLV B;  4DFA A;  2F4V L;  1Q7Y C;  1RF2 D;  2CH4 W;  3SGI A;  1PTO B;  5GQO A;  5KGU A;  4X3T A;  1XMO L;  1STE A;  1HA6 A;  2UUA L;  3ZJY C;  5LHY 1;  2MJ8 A;  5HGT A;  1EL0 A;  3HKZ B;  3L7Z C;  4GN5 A;  5CBE E;  3NHH A;  4UP7 A;  4FDB A;  5CBA E;  2R92 B;  1VQ8 A;  1UE6 A;  2AQ3 B;  1PA6 A;  4LFC Q;  2RDH A;  3DHQ A;  1S5E D;  1SEB D;  4JBW A;  1PH2 A;  2B2V C;  4A3F B;  2D0P A;  1UEA B;  3VR4 A;  1IKM A;  5JPM C;  2NZH A; 
#chains in the Genus database with same CATH homology
 1VQL A;  3GD7 A;  1WOC A;  4B3S L;  4DV6 L;  3IRB A;  4GNX A;  3KF6 B;  3AQQ A;  4DV0 Q;  1P16 A;  2JQO A;  4LF8 Q;  4YWM A;  4POF A;  5BR8 L;  4B3T L;  4OWX B;  3G48 A;  1JT8 A;  4EX5 A;  4NXM L;  3BZK A;  3H3V H;  1ASZ A;  1EIF A;  2Y0S G;  2JA6 H;  4A3L G;  2V1C C;  4KLK A;  4OX9 L;  4UPA A;  4AYB E;  3PV0 A;  3HKZ E;  1FGU A;  4IFD I;  4PZ6 A;  1JB7 A;  1Y1W H;  2ZTD A;  3CCS A;  3KF6 A;  3HOY H;  2OTL A;  3M4Q A;  4IJH A;  4UP9 A;  5FLX c;  3CCV A;  3PF5 A;  1TWF H;  1IBM L;  2YU9 H;  3CCL A;  3H0G H;  2VUM G;  1K8G A;  4LFA Q;  4XIG S;  1N33 Q;  2YTV A;  3A5U A;  3KJO A;  4PZ7 A;  4LUO A;  1GD7 A;  3LGJ A;  4NPS A;  1YIT A;  3EBE A;  1WYD A;  4X62 L;  4A3B G;  3KF8 B;  2DUD A;  4LUZ A;  2I0Q A;  3GTP H;  4BY7 G;  4KHP L;  3HKS A;  5E7N A;  3OTO Q;  1PFS A;  2UXD L;  3I4N H;  4B3M L;  3S2H H;  3S17 H;  1YI2 A;  3CQZ H;  2B63 H;  1NMF A;  1J6Q A;  2MQH A;  3M4P A;  1L0W A;  4Y52 H;  2ATW A;  4OO1 I;  5IYD H;  4X65 L;  3NBH B;  5C0X G;  5M5W H;  1QZG A;  3TRZ A;  4HJ9 A;  4POG A;  1UE5 A;  4DR4 Q;  4GKJ Q;  1I5F A;  1G51 A;  3PCO B;  4TVA B;  1X55 A;  2QA4 A;  1FJG Q;  3HOZ G;  1WCM H;  4HJ8 A;  4L5Q A;  1XMO Q;  4C3J H;  2DGY A;  3KOJ A;  4A3E H;  2UUA Q;  3T1H L;  1VQC A;  3PUV A;  1QUQ B;  4DR5 Q;  2UXB L;  4DV4 L;  3GTL H;  3CME A;  1YJ9 A;  3F1Z A;  3H0G G;  4LNQ A;  4DV3 L;  2JA8 G;  3FKI H;  2ZM6 L;  2UUC L;  1GKH A;  1HZA A;  4BXX G;  4LFB Q;  3MXN B;  2ZJP A;  3S1R H;  2K50 A;  2VY3 A;  1NJI C;  4LWC A;  2K5N A;  4DK6 C;  2KEN A;  2QEX A;  1YJN A;  2LXK A;  1S72 A;  1Z9F A;  1WFQ A;  1A0I A;  4JI4 Q;  3WWV A;  4DAM A;  2ALY B;  2JE6 I;  3PUX A;  4A4I A;  4LF7 Q;  1HNW L;  1BBU A;  1Q12 A;  3M9B A;  4IOC A;  2WAQ E;  3HKZ G;  4GNX C;  4X6A H;  1X3G A;  4GLX A;  4EQ5 A;  1QVG A;  2JA7 G;  1OXV A;  4YHH L;  2WFW A;  2KCT A;  1VQI A;  1JE5 A;  2R92 G;  4DUY L;  2GN5 A;  1K9M C;  4B3T Q;  1K83 H;  4JI0 L;  4IOA A;  1YJW A;  3B6Y A;  2GVA A;  4NXM Q;  1JJC B;  2CWA A;  3HOX H;  4A75 A;  1PH3 A;  3CD6 A;  2ES2 A;  3CCJ A;  1VQK A;  1P8L A;  4OX9 Q;  4AQY L;  4DPG A;  4DR3 Q;  4P73 A;  3STB C;  4JI5 L;  4A3J H;  1B70 B;  4NXN Q;  1HJP A;  4PMW A;  4JCV E;  2YTY A;  2YTX A;  3RZO H;  3Q8D A;  3E0E A;  2D0O A;  3EN2 A;  4QQB X;  2OTJ A;  3RR5 A;  1S3O A;  2WB1 E;  1IXR A;  1J5E Q;  3GTJ H;  2E2J H;  4JI1 L;  1L1O A;  1PH5 A;  4A3G H;  3U58 A;  1IBK Q;  2UUB Q;  4MTN A;  5LMU Q;  1AH9 A;  1SR3 A;  2QGQ A;  3TEH B;  4X62 Q;  3AFQ A;  2VW9 A;  2NVT H;  1NTG A;  3NEL A;  3K81 C;  3J80 i;  4KHP Q;  4KI0 A;  3I4M G;  1IBL L;  1JJG A;  1VQ9 A;  2NN6 G;  5M3F G;  1VQE A;  2AKW B;  4DV5 L;  1PV4 A;  3W1G A;  4GOP A;  1N8R C;  4GKK L;  4QJF A;  1QVC A;  1VQP A;  3RLO A;  3K80 C;  1X54 A;  1NMG A;  1UE1 A;  4JBJ A;  4X65 Q;  5M5X H;  4UP8 A;  2ASB A;  3DLL A;  5JJL A;  1KRS A;  2C35 B;  3PUW A;  4PG3 A;  5C4J H;  3S15 H;  5HY6 A;  3U50 C;  5LMN Q;  4DR2 L;  3ERS X;  2BH2 A;  1HNZ L;  2WAQ G;  4LF4 L;  2BH8 A;  5IYC G;  2UXB Q;  4DV4 Q;  4A3B H;  4TQU S;  2K5V A;  3ER0 A;  2R93 H;  3J81 c;  5JJI A;  4DV3 Q;  1EWI A;  1RIP A;  4O2D A;  3GTQ H;  4BY7 H;  3KLW A;  2IX1 A;  1BVS A;  1SRU A;  3CF5 A;  1X56 A;  2UUC Q;  4A3G G;  4GKJ L;  3BU2 A;  3F2B A;  3UDF A;  1NY4 A;  1C9O A;  3CP0 A;  2A19 A;  2JA9 A;  5ELN A;  4JI8 Q;  4C2M H;  4A93 H;  2K4K A;  2IY5 B;  1PYS B;  3S24 A;  1K73 C;  1CSP A;  1HNX L;  1M1K C;  1YHA A;  1SRO A;  4DR6 L;  4JI6 L;  1VQN A;  1I94 L;  4JBK A;  1KRT A;  2Q2I A;  5IYB G;  2I5L X;  4DV1 Q;  2ZTC A;  2IT1 A;  2VZA A;  2K52 A;  2Q2T A;  3GTK H;  3W5O A;  1K0R A;  1VQO A;  1XJV A;  3HOZ H;  2CQO A;  1I6H H;  4L5T A;  3PF4 A;  4PZ8 A;  1HR0 W;  1VQD A;  3T1Y L;  4DUY Q;  1SN8 A;  5IY0 A;  1VQ4 A;  3L0O A;  2D62 A;  2JK8 A;  4OWT B;  3S16 H;  1XPU A;  1EYG A;  2JA8 H;  1JJ2 A;  1CUK A;  1Y1V G;  4BXX H;  4OON A;  2UU9 L;  1E7Z A;  1KC8 C;  5HGQ A;  1PYB A;  2AWO A;  2R93 G;  3MEF A;  1E1T A;  3ULL A;  2VS1 A;  5H1S E;  1TWG H;  3RLF A;  3CCR A;  4HJA A;  1VQM A;  1YHQ A;  4MNO A;  4JI5 Q;  2Z6K C;  2YV5 A;  3I56 A;  4C3H H;  2ZJQ A;  2VQF L;  3I2Z A;  1L1O C;  3PUZ A;  4X64 L;  2LSS A;  5M3M H;  4XTC S;  1D7Q A;  1MKH A;  1TWH H;  1KQS A;  4A93 G;  2HIX A;  2N49 A;  2GVB A;  4QY7 A;  2N3S A;  1VQG A;  4GLA C;  2JA7 H;  3PO3 G;  4P74 A;  4R4I A;  2F4V Q;  3CCE A;  3KYH C;  1GM5 A;  2R92 H;  4DKA C;  1XNQ L;  4JI2 L;  4B3R L;  1XMQ Q;  1HR0 L;  4GOP C;  1Z47 A;  1X9N A;  1KL9 A;  1N34 L;  4DV5 Q;  4IPH A;  4IFD J;  3K0X A;  1N32 L;  4L5S A;  4GKK Q;  4X66 Q;  4OXP A;  3GTM H;  2JA5 G;  4JV5 Q;  3AFP A;  4YWL A;  1HZ9 A;  2H5X A;  4A3M G;  1A62 A;  2OCE A;  1VQ6 A;  4JI7 L;  2CKZ B;  2KHI A;  4MZ9 A;  4BBR G;  3RN5 A;  3H15 A;  1HNZ Q;  4AYB G;  5M3M G;  3KFU A;  1QUQ A;  3I4O A;  3JAM c;  1X3F A;  5M5Y H;  1JMC A;  4O0A A;  1ASY A;  4A3D G;  3CCQ A;  1D8L A;  4DV6 Q;  4B3S Q;  1XTD A;  4GS3 A;  3H3V I;  3I4M H;  4DR7 L;  4IJL A;  3KDF B;  1YHB A;  1BKB A;  1A8V A;  5M3F H;  2CCZ A;  2KCM A;  5BR8 Q;  2VQE L;  1OXU A;  2ZTE A;  2VNU D;  4JOI A;  1HNX Q;  2E5L L;  2IHF A;  4JI6 Q;  3M3Y H;  1I94 Q;  1OXX K;  1Q1E A;  3CC4 A;  3HOV G;  2A8V A;  4A3F G;  3UDG A;  1TWC H;  2EXD A;  1X3E A;  3L2P A;  2JJQ A;  4DR1 L;  1E3P A;  4BA1 I;  3G71 A;  1M90 C;  2OWO A;  1LYL A;  1YVC A;  3RN2 A;  1A63 A;  1U0L A;  3KDF A;  1UWV A;  1Q86 C;  1MIU A;  5IYC H;  4BY1 H;  4DNI A;  1IBM Q;  3HOW G;  4YWK A;  5IWA L;  1N36 L;  3UDI A;  4R4C A;  3J7Z C;  3CC2 A;  1PVO A;  2F3I A;  2MFI A;  1XNR L;  4AIM A;  2UU9 Q;  1V1Q A;  1PH1 A;  4LFA L;  4APV A;  3M7N A;  1DGS A;  2UXD Q;  5C4X H;  1VQB A;  3CC7 A;  1EIY B;  1FL0 A;  4RMF A;  1CKO A;  1SFO H;  1LTL A;  1OXS C;  3KJP A;  5EAY A;  4A3K H;  5K36 G;  4YCW A;  4L5R C;  1OXT A;  2VQF Q;  2PQA B;  3G6E A;  2RHS B;  3VDY A;  4A3I G;  5IYB H;  4GN3 B;  3GDE A;  1X6O A;  2CFM A;  2N78 A;  5GAG C;  1XPR A;  1O7I A;  3OTO L;  3PO2 G;  3NEM A;  4R4O A;  4R4Q A;  3U4Z A;  4LF6 L;  3A74 A;  4IPD A;  1K8A C;  4YCU A;  2XTI A;  2K75 A;  5DLQ E;  3GTG H;  4NB3 A;  4DK3 C;  5GAH C;  5IE8 A;  1MJE A;  1X65 A;  4ME3 A;  4JI2 Q;  5FJ8 G;  4RG1 A;  1XNQ Q;  2R7Z G;  4B3R Q;  2UXC L;  4KHZ A;  1Y1V H;  4HID A;  3D31 A;  2R7D A;  1L2F A;  2PQA A;  3W1B A;  3T1H Q;  1W3S A;  1YNX A;  1IZ6 A;  4BY1 G;  4LF5 L;  1FJG L;  1N9W A;  4P71 A;  1N32 Q;  5AJ3 L;  3HOU H;  1PH7 A;  5C44 H;  3AYH B;  3TS0 A;  2ZM6 Q;  2EIF A;  1MJC A;  1PH8 A;  1Q8K A;  2XGT A;  2OQ0 A;  2JEB I;  4IFD G;  5C4X G;  3D0F A;  1E22 A;  4GNX B;  1SMX A;  3I55 A;  2PNH A;  5C3E G;  4LFB L;  4DV2 L;  4YY3 L;  3PO3 H;  4IPC A;  4A3K G;  1KXL A;  1KAW A;  4LW1 A;  1UEB A;  1HNW Q;  5IP7 H;  2RF4 A;  2NN6 I;  2F52 A;  2PMZ E;  3F2C A;  2E2I H;  4BBS G;  3RLN A;  4JI4 L;  2Q2U A;  4LUV A;  4P72 A;  1KIX A;  1VQF A;  3CW2 C;  4LF7 L;  4YHH Q;  2RHQ B;  2AMC B;  2CWP A;  3F8T A;  2WB1 G;  3UE0 A;  4J15 A;  4QGU A;  1YIJ A;  1AE2 A;  3S1Q H;  1EOV A;  3UDX A;  1LM0 A;  2VQE Q;  2NZO A;  3CMA A;  3I7F A;  4JI0 Q;  2E5L Q;  3TS2 A;  1E24 A;  1Q46 A;  4B3M Q;  2LXJ A;  4JG2 A;  5IP9 G;  1QZH A;  5JEA J;  4YCV A;  2JA5 H;  3M85 A;  4AQY Q;  4DR1 Q;  2I5M X;  4LF9 L;  3HOU G;  4OO1 G;  1BBW A;  5C44 G;  4A3M H;  5J3B A;  3PUY A;  1Y14 B;  3ULJ A;  1HH2 P;  1R9T H;  4JYA L;  4BBR H;  1HZB A;  4DR3 L;  1CSQ A;  2MNA A;  4BA2 I;  4NXN L;  1QVF A;  4A3C H;  5IWA Q;  1N36 Q;  3NEN A;  4JI1 Q;  4C3I H;  3CCU A;  1XPO A;  1KHI A;  5LMN W;  1TXY A;  2JEA I;  4Y7N H;  1PH4 A;  2NVQ H;  4A3D H;  1XNR Q;  3E9I A;  2ZJR A;  1VQJ A;  1J5E L;  5IP7 G;  2EQS A;  3CPW A;  4IPG A;  2KBN A;  3J7A 5;  3AEV A;  1I3Q H;  3RZD H;  4IO9 A;  1IBK L;  2UUB L;  1NE3 A;  2MO0 A;  5LMU L;  1IBL Q;  4DV7 L;  4HIM A;  3RNU A;  3HOV H;  3J80 c;  2AWN A;  2OQK A;  4A3F H;  1TWA H;  5GAD C;  1VQH A;  4K0K L;  4LF6 Q;  1IYJ B;  2E8G A;  3DM3 A;  1PH9 A;  4UY8 C;  4WJ3 M;  4DUZ L;  2K14 A;  3ICE A;  1VQ5 A;  3HOW H;  1CKN B;  2E2H H;  2K5H A;  4JI3 L;  2UXC Q;  1VS0 A;  3EIV A;  4DR2 Q;  2JA6 G;  1WJJ A;  3S14 H;  1K3R A;  4LFC L;  4JBM A;  3CPF A;  4LF5 Q;  1B7Y B;  4LF4 Q;  1V9P A;  1YBY A;  4R4T A;  3PIP A;  4A3C G;  3G4S A;  5AJ3 Q;  5LMN L;  3J81 i;  1WI5 A;  1Y1W G;  2HHH L;  5GRO A;  3HOY G;  3JC6 6;  5C0X I;  4A3I H;  1VQ7 A;  2WP8 J;  4JC0 A;  1CKN A;  1H95 A;  3PO2 H;  4DV0 L;  4DR6 Q;  4P75 A;  4YY3 Q;  4DV2 Q;  3U4V A;  3GO5 A;  4JI8 L;  2YYZ A;  1C7Y A;  3A0J A;  4LF8 L;  5FLM H;  1YEZ A;  3F2D A;  2HQL A;  4QL5 A;  2R7Z H;  3J81 j;  2B29 A;  2IHE A;  5FJ8 H;  3I4N G;  3CAM A;  2I5H A;  3HFZ B;  1SE8 A;  4DV1 L;  4ALP A;  2NVY H;  1U5K A;  2R6G A;  1PH6 A;  1Q82 C;  2B63 G;  3T1Y Q;  3STB D;  2KHJ A;  1CKM A;  2BA0 A;  5IYD G;  1EQR A;  1HZC A;  3BJU A;  2L15 A;  5ELO A;  3PIO A;  3PGZ A;  4HIO A;  1KD1 C;  4HIK A;  1G6P A;  5JJK A;  4DAY B;  2MO1 A;  1VQA A;  1AE3 A;  4HJ7 A;  5IT9 c;  1EQQ A;  1GVP A;  2N8N A;  1WCM G;  1L1O B;  2RCN A;  3K7A H;  4R1J A;  1N33 L;  4LF9 Q;  3A5Z B;  3M4O H;  5GAE C;  2AHO B;  5C3E H;  4A3E G;  3FHW A;  1FVI A;  2Y0S E;  4JYA Q;  1T9H A;  4X64 Q;  3OW2 A;  3CXC A;  4HJ5 A;  3S1M H;  2BA1 A;  1W2B A;  1UE7 A;  1RL2 A;  1V43 A;  4BBS H;  5JEA G;  3TRE A;  3FKI G;  4GN4 B;  5C0X J;  3K8A A;  2Q2H A;  1G29 1;  1PHJ A;  1EFW A;  1I50 H;  3S2D H;  1Q1B A;  1YZ6 A;  3GTO H;  2Z6K A;  1SLJ A;  1E1O A;  5FLM G;  2B3G A;  4GOP B;  1VCI A;  3TQY A;  2A1A A;  2Z0S A;  3BZC A;  4GLV B;  2F4V L;  1Q7Y C;  4QIW E;  2PI2 A;  3SGI A;  4DV7 Q;  1HR0 Q;  4DR4 L;  1S40 A;  5IP9 H;  5GQO A;  1N34 Q;  1C0A A;  2IX0 A;  1XMQ L;  1Q81 C;  1XMO L;  4K0K Q;  2UUA L;  3ZJY C;  4A3L H;  4DR5 L;  3K7U C;  4DUZ Q;  3L7Z C;  3FP9 A;  4OWW B;  4GN5 A;  2FXQ A;  4X66 L;  3OYY A;  3ULP A;  2R7F A;  1LUZ A;  3UE1 A;  2NVX H;  3HOX G;  4WJ4 A;  4UP7 A;  4JI3 Q;  2HT1 A;  4FDB A;  2ID0 A;  1VQ8 A;  1UE6 A;  4JI7 Q;  4LFC Q;  1PA6 A;  1NBW A;  3S1N H;  4JV5 L;  3E9H A;  2VUM H;  2PI2 E;  1OTC A;  3JAM i;  4A3J G;  3PSI A;  4AH6 A;  4JBW A;  1EUJ A;  2HHH Q;  1PH2 A;  1IL2 A;  4DR7 Q;  4H02 A;  1GO3 E;  2D0P A;  3CCM A;  4A76 A;  2VL6 A;  2HIV A;  4JOI C;  1B8A A;  2NZH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...