4RKBA

Crystal structure of staphylococcal nuclease variant delta+phs v66t/v99t at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMTENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMTNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Cavities in proteins
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2014-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rkbA00
3D8GA 4E6IA 1KDCA 2PW7A 5NUCA 2EYOA 4K14A 3E5SA 2F0WA 5J1ZA 3U9OA 5KYIA 4K5VA 1SNOA 4OL7A 2F0QA 2SNSA 3D6CA 3R3OA 3DMUA 3H6MA 3P75A 4N9TA 2RKSA 3SHLA 5I9OA 1EY8A 5KRUA 2F0HA 5CV5A 2EYFA 2PZTA 4S3SA 5JAVA 3PMFA 3HEJA 4KHVA 1SYCA 4KV6A 5C5MA 3ERQA 2KHSA 4YIJA 3T16A 5I6WA 3V2TA 5IODA 1EZ6A 5IGDA 5DEHA 1A3TA 3BDCA 1KABA 4K8JA 1F2ZA 1SNCA 1SYBA 3NHHA 3ITPA 4NMZA 5I9PA 3T13A 5IGEA 1EQVA 4ZQ3A 4HMIA 5E1FA 3S9WA 4B9WA 4K5XA 1RKNA 2EY6A 4K8IA 4ID6A 4DU9A 1JOOA 1SNDA 3SK6A 1A3UA 4NP5A 5KGUA 1ENCA 5CV4A 3DHQA 2F0NA 3C1FA 4ZUJA 3EVQA 4ODGA 5C4ZA 1JORA 1EY5A 2PZWA 5I6YA 3EJIA 5CC4A 5J22A 1STAA 1U9RA 2OEOA 4ZUIA 1KAAA 4HTHA 3MXPA 3TMEA 1EYAA 5IOCA 4G57A 5CV7A 5EKKA 4EQNA 3SXHA 1EZ8A 3D4DA 2HQEA 3NUCA 1TT2A 4J1MA 4DGZA 1STNA 4KJOA 4EQOA 1F2MA 1AEXA 4NKLA 3BDLA 5KIXA 3LX0A 5HURA 2F0SA 4DFAA 2LKVA 4QF4A 2F0GA 1II3A 2QDBA 4F8MA 5IGCA 5C3WA 2M00A 3QOLA 5F2DA 5KYLA 3TP6A 3TP8A 3VA5A 2F0KA 2SNMA 3OMCA 3NP8A 1EYDA 4ME5A 4MIUA 4RKBA 4EVOA 4K2LA 2F0VA 2F3VA 3QB3A 3QOJA 4HMJA 4IZ8A 4WRDA 2EXZA 3SK4A 3OWFA 4KY7A 4NDXA 5JOBA 5IGGA 1SNMA 3SK8A 5CV8A 1STHA 3RUZA 4I65A 1SYDA 5ISRA 5CV6A 2PZUA 4KY5A 3TP5A 5CGKA 2PYKA 2KQ3A 1SYEA 2EYPA 5EKLA 5C5LA 2SOBA 1SYFA 3NQTA 5HGTA 4IALA 1KDBA 2F0OA 2F0FA 4PNYA 4PMBA 4KJNA 4TRDA 2EY2A 2OXPA 5C4HA 4IUNA 5CR3A 1JOKA 2WACA 1TR5A 3MEHA 1EY0A 2F0DA 4R8NA 1JOQA 3D4WA 4KTAA 1F2YA 1SNQA 3MHBA 5IIFA 5IGFA 5CV9A 1A2TA 5EGTA 2EYJA 2EYHA 2NUCA 4B9XA 1ENAA 2PW5A 1EY7A 2PQEA 1TQOA 2RBMA 4K5WA 3OSOA 4QMGA 2F0UA 4N9PA 5DAUA 2EY1A 2F0LA 3C1EA 1STGA 2ENBA 4QB4A 3TP7A 4LAAA 2RDFA 4J6HA 4WORA 5K5PA 1NSNS 3EROA 3OMGA 2OF1A 3MZ5A 2EYMA 4PMCA 1SNPA 1STBA 3HZXA 2F0EA 2O4XA 4KD3A 4RKLA 1A3VA 5C6AA 2EY5A 2F0JA 5KEEA 1A2UA 1EY9A 2F0MA 3NXWA 1IHZA 2F0IA 5J39A 1NUCA 3NK9A 4KY6A 4K6DA 4DF7A 2F0TA 4EQPA 4F7XA 1STYA 1EYCA 5M9OA 1EY6A 3SK5A 4K2KA 4KD4A 5IGBA 1KDAA 1EY4A 3MVVA 5C3XA 2F0PA 2EYLA 3P1HA 3SR1A 4H7BA 1SYGA 2F3WA 5E3FA
chains in the Genus database with same CATH superfamily
2I5HA 1FYCA 1KDCA 4TVAB 2P5ZX 4CDFC 1TKWB 1GHKA 1VQ4A 4F87A 3D6CA 1YHQA 1MSHA 1BF4A 2NN6I 3NELA 3SHLA 3GTMH 2JA6H 2MO1A 2F0HA 3ND8A 2HUGA 4B3ML 1B44D 3ERQA 4DR2Q 5GQOA 3TS0A 4DR1Q 5IGDA 3CCMA 1A3TA 4Q5VA 1JB7A 4OIJA 4L5QA 3PF5A 2A73B 3BZCA 2PQAB 3WWVA 2XNAC 1JCKB 2DY7A 4K5XA 2IW3A 4K8IA 4P75A 3GTPB 3FKIH 1VQ6A 3IFDA 2EOTA 3DHQA 2JA7G 3S1MH 3BJUA 4R4CA 5DM73 4JI6L 2EPBA 1PFMA 5C4ZA 3NPPA 1TWFH 2AUKA 3VR5A 3J81c 4GOPC 1GD7A 4X6AH 1CA6A 4X66Q 1G6ZA 2XVSA 1TWAB 3SXHA 1JC7A 3DM3A 2HQEA 4OO1G 2IHEA 2K5NA 2WINB 1EOVA 2Q2HA 1Y1WB 5T1GA 3KLRA 1IL8A 3BYTB 3K8AA 5F2DA 4PV1C 1I94L 3TP6A 2AHOB 1H9RA 3GTQB 4DV6L 4LF6L 4LF7L 3NENA 4NDXA 3S1NH 4OONA 2M2LA 4JCVE 5CV6A 5CGKA 4A3BG 2LXJA 2R92H 5JVH3 3J7ZC 2MFIA 1SYFA 3NQTA 1WI5A 5LL6X 3I90A 5C4HA 1YJ9A 5ELEA 3CPFA 4BA1I 4DNIA 1TWCH 1XMOL 1AE3A 3CP0A 5KNDA 1ZKOA 1RD9D 3M4OH 1HR0W 1TWHH 2F0LA 3HOZB 2ENBA 2EIFA 5K5PA 3D6WA 3S1RH 1EU4A 3S15H 2F3IA 3NBHB 3K5OA 3WOEA 1X3FA 3L9AX 4B3TL 1D5ZC 1KNAA 4ABNA 4DV0L 3K7UC 2ZTDA 1CTMA 4NB3A 1PH1A 4WJ3M 1CKNA 2JP1A 1MI2A 4R9WA 1WD1A 1RF2D 2B2VC 2VNUD 3TQYA 1RODA 3F1ZA 1F77A 3QO2A 4I7ZC 4G7HC 1LV9A 2Z0SA 5IWAQ 2SNSA 4GOPB 4N9TA 3LWEA 4OELB 4ULLA 1Q1BA 3T1HQ 5CBEE 2KHSA 1SRUA 3T16A 3MXNB 3OTOL 1LT4D 4K8JA 2E2IH 4DV5L 3HOXB 4FVMA 1PV4A 1RKNA 1X3PA 4X64L 4A3KB 2AQ2B 4NPSA 3H3VC 1MKHA 4V190 1JJGA 4CKCA 3C1FA 1TY2A 3H91A 4OX9L 2OEOA 1AZPA 4R1JA 1G91A 1PZKD 1K8OA 1EYAA 1I4QA 1RTNA 1JE5A 1UNSA 1UE7A 4LK1C 3HOVB 4L8JA 3LX0A 2LKVA 1SE3A 1U5KA 2YU9B 4GKJL 4JI8Q 3BYYB 4JI7L 4K0KQ 2SNMA 4LFCL 3NP8A 1SLJA 5M3FG 2I0QA 3GTPH 1SFOH 1CKOA 2J0TD 5JOBA 1B53A 1RL2A 1SYDA 4HCSA 5ISRA 4EQ5A 2UUCQ 5A2QE 1PDQA 1K8GA 3RZOB 4JI4Q 1KHIA 3NQIA 4DAVA 1BBWA 1TWAH 1GM5A 2KUMA 2L1BA 4BXXH 2YYZA 1LTGD 1B9NA 1U0LA 2SEBD 1O7YA 3CKIB 5M5XB 4JC0A 1YNJC 2IT1A 1OO9B 2WB1B 5IT9E 2ZT9C 3T53B 1M1KC 1G51A 3GTQH 4WORA 3HOUB 2F0EA 1SE4A 5AJ3Q 2LMCB 4L5RC 4DV2L 2UUBQ 1B4OA 2FMCA 2GVAA 3HKSA 1SBBB 1VQDA 1Y8PB 4R4QA 4JOIC 4XT3B 2XWJB 3A5UA 3FDTA 4J15A 3ER0A 1SR3A 2NN6G 3MXGA 2F0PA 2QGQA 3OHXC 3KBXA 1CHQD 3I2ZA 1BCPF 1EUJA 4CGYB 3H6MA 2BCOA 4AQYL 5D3IB 2VW9A 2O5IC 2E2JH 1JE4A 4U673 3PMFA 3M3YB 1NY4A 1C4QA 4XYOA 3CC2A 5IYCH 4A3DG 1B7YB 4ZQ3A 2YV5A 2V1CC 2E2DC 4YY3L 1PA6A 4PMWA 3FP9A 1HTLD 4JI2L 1Q81C 3I4LA 4HIMA 3Q22A 2PZWA 1Y1VB 2RVLA 3CRKC 2VS1A 1A63A 2Q8RE 2LSSA 1NNXA 1YI2A 5C4XG 3CXCA 4BY7H 1BKBA 4EQOA 1BR9A 1LTRD 2ZJRA 3QJYA 2EXDA 2F0SA 5D65A 3GTOB 1PYSB 2Z9HA 2EZVA 1FD7D 1XJVA 2G9DA 1QE6A 2WB1E 4C3HB 1I5FA 3HOXH 3TRZA 3TZUA 5DM63 1J6QA 1TS5A 4AH6A 1D2BA 3HOYH 1XX8A 3A55A 5CV8A 2O2LD 3VYTA 1VQ5A 2GN5A 4DR6Q 1BCPB 2PMZB 1G2TA 4RMFA 1LT6D 2F0OA 1N36L 3M4PA 4IJHA 2JA5G 1HZBA 4BY1B 1EY0A 3AFPA 3HOVH 3BZKA 5IGFA 2K5HA 5C0XJ 1SMYC 2RDHA 1XMQQ 4A3IH 2UXDL 3U9SA 5M5YB 3OIPA 2YU9H 3E9HA 4HIKA 2IX0A 2RDFA 3KF6B 4IPHA 1W2BA 1X32A 2MUYA 1V43A 4UDUC 3ERSX 3TREA 3ZJYC 1A2UA 2B8GA 2BOSA 2BDNA 2KA7A 2XWBB 3NK9A 1YHAA 2D0OA 3T1YQ 5JEAG 3QR8A 3KUPA 1BXTA 2XIWA 4HJ9A 3J7AV 1VDZA 2HCCA 1EY4A 4GLXA 1VF5C 2F3WA 3CQZB 4E6IA 1GVPA 3JAMi 5KYIA 4JI1Q 5M5XH 4OL7A 1JQYD 2D0PA 5LMNL 2R93G 5FLXL 3MC0B 2EDGA 2B8FA 1GXDC 1S5DD 4A93H 4X3SA 3Q0AA 3VR3A 2CKZB 1BBUA 2E76C 2F4VQ 4GNXA 3T13A 2ASBA 2IX1A 4BA2I 2K5DA 3S1QH 2AUJD 3CCEA 3F8TA 1JWMD 3F2BA 3H3VH 2FMMA 4IFDI 2PMZE 2ALYB 1HRJA 4DV3Q 1JWSD 4HTHA 3H09A 2B2TC 4JI4L 3I72A 1Q90A 5EKKA 3M7NA 2E2HB 5BN4A 1M90C 4DGZA 2E5LL 3PUXA 2K14A 1PTOC 1L0WA 1AN8A 2A6EC 1WTQA 1HFNA 2DJGC 4LFBL 1LLRD 1DONA 4DNTB 3QIAA 4C3JG 1EYDA 4XT1B 3CF5A 1PH2A 4GKKL 1MSGA 1BBXC 3X3MA 1R4PB 1F9QA 4UP9A 4UHVA 2VQEQ 2PZUA 5JJIA 2VXWA 3G48A 1CQVA 1HTPA 4DK6C 2SOBA 5HGTA 2PQAA 1KDBA 4ZKBB 4C56C 2DGYA 1GHJA 3BVZA 4L63B 4GN4B 4PMBA 1U4RA 4KHZA 1TR5A 5C3EB 2UUAQ 5FJ8H 1SNQA 4WFN3 5C44B 4QUCA 4QL5A 4DV7L 3AYHB 2RBMA 4LF9Q 2FXQA 4OO1I 4N9PA 3C1EA 4BS9A 1ENFA 4LAAA 1FJGQ 1PRTF 5E7NA 4PZ8A 2EQSA 1RTOA 4IUQA 1D7QA 1S5BD 1N32L 1WTRA 4LMQD 2L0CA 4I7AA 2F0MA 3TS2A 4IQZA 3GV6A 1QJOA 4RGNA 4JI5L 2UXBQ 3A54A 3S2DB 1HNWL 4N8FA 5EBDA 4BY1H 3PO2B 3SR1A 3T56B 1SYGA 2Y0SG 1YITA 4H0LC 3RN2A 1QNKA 3Q23A 1JJ2A 2L5TA 4DUZQ 5M5YH 1TS4A 1J5EQ 1WOCA 2RKSA 2E75C 4HSPA 5KRUA 3ICEA 3V05A 1M8AA 1VQGA 1EFWA 4KV6A 3DWPA 1N34Q 3M7GA 2R7ZB 3P20A 1RDPD 1KABA 4POGA 3ITPA 4M8AA 4DNRB 1FGBD 3G71A 3I4MG 3ULLA 1WCMG 1PH5A 4AYBB 1U4PA 4BBSB 2QEJC 3DEOA 3CMAA 1U9RA 4FXKC 1HQRD 4RCOA 2VUMG 5CV7A 1LACA 4LF5Q 1PRTB 5A2QL 2IY5B 3NUCA 1EWHA 3F2UA 2H4OA 1QWYA 1Q82C 1F2MA 5KIXA 3BDLA 1XMQL 1HZCA 5HURA 2A19A 4DFAA 5DNFA 4A75A 1QZHA 3I91A 5IP9H 1S5CD 1ESFA 1SROA 4JI3Q 3TP8A 4GOPA 1C9OA 3JAME 3SK4A 4ZYSA 1K73C 1QUQA 3UI2A 2NTSA 4P72A 5IT9L 1F9RA 2K7VA 2MHVA 4KY5A 5BR8L 1EU3A 2Q2UA 3NSWA 3HS0C 5FO7B 3UDGA 5EKLA 2KCNA 4FF4A 2F0FA 5CMDA 1GJXA 2K50A 4IUNA 4XTCS 5JJZA 2R61A 4LWCA 4A3MH 2NVXB 3S16B 4DR4L 2ZM6L 3CMEA 3PO3H 2BE5C 1MJCA 2KOLA 4FP5D 5M3MH 4B9XA 2PW5A 1VQPA 2JA6G 2PQEA 4K5WA 2HHHQ 2ATWA 4G7OC 1B50A 3MAQA 1STGA 4QB4A 4OGQC 2MJ8A 2K32A 3U58A 4PMCA 1UE6A 1O80A 3T4AC 2N55A 1EY9A 4ZRZA 1OXVA 1IHZA 3CCRA 4RGOS 4KY6A 4X62Q 4FYDA 1E24A 4A3LG 2FJ2A 3SE0A 3CCLA 2KECA 1BQQT 4AYBE 5IYDH 1VQBA 1VQJA 4H7BA 4CBVA 2L55A 3D8GA 3RD4A 4DA2A 3M9BA 1VMPA 2R3ZA 2R7DA 1ESRA 2JA7B 1N8RC 1X3QA 4XQQA 3SEBA 3HEJA 1HA5A 3RMHA 4OIKA 3QG1A 3V2TA 4DR5L 2B2VA 5DEHA 2B63G 5GAHC 4IFDG 1R4QB 1UWVA 2AKWB 5G3LD 4DPGA 2R92G 2CFMA 5K36H 5KGUA 1SDFA 1IYVA 5D3DA 1LM0A 3KOJA 3RNUA 1IBLQ 1BDOA 1D6EC 3GP7A 4MHEA 2RDGA 4HJ8A 3HOWH 4JBMA 2DNEA 2K52A 4V0BA 4XQJA 1E0BA 1TIID 3KDFB 3HG9A 3NTIA 5LL6S 2UUAL 4A3BB 4A3FG 3CPWA 3GTLH 4A3GG 1CZWA 1G291 4A3EH 1A62A 1PTOH 2Z4IA 1H9SB 1BNZA 2HIVA 2B2WC 3ONAB 4MZ9A 1VMCA 2UU9Q 1ZYRC 1FJGL 2MNAA 1HNZL 5IGGA 1IBMQ 3H0GH 5GAEC 2VB2X 2ZTCA 3KLSA 4B3SL 1IBKQ 5FLXE 1K0RA 2K03A 1QILA 3MXUA 2NYZD 5C5LA 2JA9A 4KJNA 4IJLA 1XNQQ 2JA8H 1UEBA 1UE5A 4DXFA 4DR7L 3PUWA 3D4WA 4UP7A 1A2TA 2N88A 3M85A 3A7LA 4L6TB 2IJ0A 1CUKA 3BU2A 1J5EL 1I3QB 1K83B 4JK1C 4C3IH 4OWXB 3K80C 2B2UC 1VCIA 2NVTB 1ILQA 3TSSA 1D8LA 4KD3A 5C6AA 1G6PA 2N49A 3UDIA 1CKMA 2MGSA 2EJMA 4F7XA 1XPOA 4F88A 1QCBD 2OTLA 2AQ1B 5IP7H 1Q12A 1IYJB 3VDYA 1JT8A 2FFKB 1HQMC 2NVXH 3I4NB 2VL6A 4HSVA 1YNJD 1VQOA 1C7YA 3H3VI 1H9KA 1CZGA 4ZAIA 4JOIA 4JV5L 4FXGC 3VA7A 4Q0FA 1WVLA 3TEHB 2O5JC 2CCZA 2K4KA 2LXKA 2NVYB 5I6WA 5IODA 4JYAL 4C1NI 3BDCA 4JI3L 2XSCA 4YHHL 4ZLTF 1ET6A 4DN4M 1EQVA 1C0AA 3S9WA 4IUUA 2EY6A 3I4OA 4XXEA 3V96A 2XRQD 4IUVA 1X9NA 2UXCQ 2IL8A 4LJZC 2NZOA 3FHWA 5M3FB 1PLFA 5IOCA 1HFGA 1FNWA 4JG2A 1S4ZA 2CH4A 1SXTA 5LMNW 1Q1EA 4DR3Q 5IGCA 4R4TA 4RAUC 1HR0Q 5KYLA 3I4NG 4B3RL 1N33Q 1KRTA 3VA5A 1SN8A 4QIWB 2F0KA 3GTJH 4NXNQ 3A5ZB 2EXZA 4KY7A 3PSIA 3NTKA 4TKOB 2K1BA 3PV0A 4L5TA 2F52A 3STBC 5G3LF 1TS2A 1V1PB 4YCWA 1ML0D 1HNXL 4TRDA 2NB0A 1X65A 2G9HD 3MEHA 5TSSA 4Y52H 4KTAA 1YJWA 2V4DA 4C2MB 4DV4L 5FLXc 2IX3A 3URYA 4RWSC 1HXYD 1W6JA 2OCEA 1TU2B 1AE2A 4MTKA 4A76A 1HJPA 1EIHA 3VYSA 1JMCA 4RKLA 1YEZA 1MD2D 1L1OB 2OQKA 1Q7YC 3GO5A 2F0IA 4FDBA 1LYLA 2FHTA 3W1BA 1E3PA 1H95A 2QCPX 4ME3A 1BUVT 2RF4A 1Y1WH 4DXGA 4Y7NB 4A3DB 5JJKA 4O42A 2Z6KA 4BY7G 3T51B 2EYOA 2PNHA 1XXGA 1K9MC 1E22A 5I2XA 4FF2A 2QA4A 2OWOA 3K57A 2JN4A 1I6VC 1L0YB 4DR2L 1G2SA 3I7FA 1KNEA 2NVTH 4DR1L 1BCPC 1HZAA 1SYCA 4KHVA 1I4GA 5LMUQ 4LFAQ 3R8BA 5C4XB 2ICIA 3HOYG 4QIWE 2IPKD 4KKTA 5E1FA 4R4OA 4B9WA 1SAPA 2WFWA 4GLVB 3MA2B 1EWCA 3JAML 1OXSC 3A74A 1WTOA 3VYUA 1HZ9A 5I6YA 1LO5D 1STAA 4X66L 1KAAA 1JWUD 3E0EA 3HOZH 1IYUA 3ND9A 1V9PA 4G57A 1YNNC 4EQNA 1PZJD 1XNQL 1RHPA 4A3IG 3CC4A 1K8MA 4NKLA 1H9JA 2QDBA 4UPAA 3DWAA 2JA5B 3A8IE 5GADC 2B2TA 5CBAE 3TDQA 1WYDA 1E1TA 3D31A 3UE1A 2JSOA 1XNRQ 4I65A 4CDDC 1MGSA 3S2HB 2N3SA 2PYKA 1WTXA 4IURA 1E2VA 5M3FH 3EN2A 1GO3E 4JI0Q 1NMFA 4RGMA 5CR3A 1JOQA 2K5VA 1PXUA 3CAMA 5EGTA 2A6ED 2HQLA 1XYIA 4A93G 4YWLA 4A3KH 3TP7A 2A68D 2Z4HA 4DUYQ 1S40A 3KF8B 3BDOA 1B3QA 2NVQB 1DOLA 3R2TA 2R93B 5J39A 1XTCD 4DV1Q 1QZGA 2A69D 1TWGB 4PG3A 3I73A 1STYA 3J7AF 3CCJA 2UXCL 1F9SA 1HCZA 3WDNA 1SMXA 4RA8A 2A6HD 1BOSA 5E3FA 2TSSA 5IWAL 4FNFA 3U9OA 3RLOA 4A3JG 1SE8A 5C4JB 3DMUA 3T1HL 2Z6KC 1KLUD 2VQFQ 1AW7A 1OXTA 3PIO3 1FGUA 3PIP3 3K58A 3RZDB 5EPJA 1YZ6A 2PNRC 5KNBA 5IT9c 2Q8TA 1I50B 2AMCB 5I9PA 1QVFA 3RZOH 2D9UA 1PYWD 1DOMA 5JEAJ 1FR3A 2NTTA 4ID6A 2A5HA 1SNDA 4PQXA 3VR2A 5CV4A 4Y7NH 2F0NA 1PMRA 4GLAC 3GDEA 2A1AA 1JORA 4UP8A 4C3JB 5J22A 4HIOA 3DUZA 2N78A 3OIQA 1EL0A 4LF4Q 3TMEA 2YTVA 2JEBI 2KJXA 4BBRG 1VQFA 4OXPA 1NAPA 1T5EA 3HOUH 4KJOA 1EQQA 2JXMB 3J81i 1Q3LA 1U4MA 4JI8L 4F8MA 4K0KL 3K5MA 4JBJA 3FEWX 1I4HA 4LF8Q 1IW7D 1VQMA 1A0IA 1KLGD 3D0FA 5HY6A 2Q2TA 3DEPA 3BG3A 2UUCL 3RUZA 2LFNA 4TSSA 3W2DA 1Z7TA 3F2DA 4A3CH 2MQHA 3P7JA 1Z47A 1VQLA 2VY3A 2NBFA 3VR6A 3F2CA 1P16A 4OWWB 3M3YH 4G7ZC 4XDXA 1KIXA 2EYJA 3A0JA 1GUNA 1VQIA 1ENAA 3NWTA 4QMGA 2D2CC 3C2PA 4QCLA 3GV3A 5DAUA 4X65Q 5C0XH 2JQOA 2WKDA 2ZJPA 1LTLA 2Y0SB 3KDFA 5AJ3L 1SJHD 1EFID 1SNPA 2DNCA 2UUBL 2L9HA 5CYUA 4DAYB 3MEFA 1Y1VH 5EJWA 1YHBA 1N9WA 3IL8A 1MIUA 1PRTC 1PYBA 4DF7A 2K28A 1D1IA 2KEDA 3G4SA 4IOCA 2C35B 1OXXK 2KVMA 4KD4A 5M5WB 4IUTA 3P1HA 3GTOH 3HP3A 3NEMA 2BE5D 3NTHA 1KD1C 2PW7A 4OWTB 2CW0D 4C3HH 4KHPQ 3B6YA 3AB9A 3I4MB 4BWGB 1X3GA 3EFXD 4FF3A 2F0QA 3OW7A 1WCMB 4RH6A 3HRZC 3I3CA 5BN5A 4IUPA 3J7A5 3J7YW 2NZ1D 4P71A 2XN9C 2K05A 2RHSB 2VUMB 1PH7A 1Y8OB 3NHHA 4NMZA 5A35A 3CCUA 2KENA 1TWGH 1PH8A 2NZHA 1WTWA 2JEAI 3N6RA 2QKIC 4JI6Q 2L15A 3I70A 4A3MG 4GN3B 1FNVA 1LT3D 3ZYYX 2HD3A 3MFGA 4MNOA 1GOZA 3PO3G 2HDLA 5M3MG 4JW0A 1C48A 3EBEA 4QJFA 3JC66 5JPMC 3KLSX 1DGSA 4KMUC 2L11A 1L2FA 2M00A 3QOLA 1W6KA 3A8KE 4HR7B 2AWOA 2NWGA 3OMCA 1ICFB 5FLMH 2Y0SE 1TS3A 3GTMB 2JA6B 3NBHA 4DR6L 3CQZH 2B3GA 4DV6Q 4GZYC 4LF6Q 4LF7Q 1Y14B 2G5DA 3Q6SA 3Q8DA 4C3JH 2WIIB 3KLWA 2EYPA 2WAQG 1ONLA 3J80L 4PNYA 1Z6HA 3CC7A 2B2WA 3KYHC 4XYQA 2OXPA 4RCNA 3WOFA 3PGZA 5IIFA 3S1MB 1EEID 2EYHA 5ELNA 1TWFB 1HUNA 1XMOQ 2OT2A 1M4VA 2EY1A 1ZYRD 2CH4W 3EROA 1HPCA 4H13C 3IFTA 3MXNA 2MP1A 3FMCA 2EY5A 4YWMA 5GAGC 3T1YL 5K36G 4B3TQ 2CVRA 1SSOA 2AQ3B 3J81E 1HA6A 4DV0Q 1VQ7A 4KKUA 2E2HH 3UDFA 2ZXRA 3HOWG 2B63B 5DLQE 3IAYA 2B2UA 1LTBD 2KHJA 4HCEA 4JI1L 3D3RA 2TMPA 2IWHA 3TZDA 3S1NB 3OOCA 3U50C 5NUCA 2E74C 2X69A 5J1ZA 5IYBH 1V1PA 2R92B 1QNUA 4LF4L 1K8AC 2RHQB 1J8IA 2I46A 3G6JB 4A3EG 1XPRA 1CHPD 4A4IA 4CKBA 4JVZA 2R7FA 1RJTA 1FL0A 1TVXA 1LTID 3FKIG 1E2WA 3KBGA 2F4VL 3MFYA 1TWCB 4HIDA 2K75A 3RLFA 1SNCA 1ET9A 3H0GG 3W1GA 1PH3A 3OTOQ 1K3BC 3K6OA 4OHJA 4HMIA 4APVA 4A3FB 3M4OB 5EPKA 3KFUA 2K01A 4DV5Q 2A8VA 5C3EH 4A3GB 4NP5A 5C44H 3FVQA 2LY7A 3N52A 2H1EA 4X64Q 4G4KA 4DV3L 3S15B 1CSQA 4ODGA 4CJ2C 1S3OA 2JA8G 3K0YA 1EEFD 4KI0A 1B1ZA 4OX9Q 2I5LX 3RLNA 1V8QA 2PO4A 4C1NK 2H5XA 1K3RA 4WJ4A 1P8LA 4DK1A 3CW2C 4C3IG 4QF4A 5ELFA 1NJIC 3HKZG 1A6XA 2HCIA 1WFQA 4DAPA 1S5ED 1GUOA 4IFDJ 4GNXB 3S2DH 3PIPA 4TQUS 4GKJQ 3LNNA 4JI7Q 4IZ8A 4LFCQ 3PCOB 1HUMA 3PO2H 4QUFA 2VQEL 1X54A 4RFBA 1QG7A 3EA6A 2FINB 4B08A 2ZXPA 3R2IA 2YTXA 5IP7G 3GTKB 5D14A 1SYEA 1LT5D 2E2IB 2B2YA 3J80i 4O2DA 2ZJQA 1JOKA 2WACA 3KK7A 3L7ZC 1TY0A 2F03A 4LNQA 2R7ZH 4X3KA 2WP8J 4KN7C 4LF9L 1H9MA 1KXLA 1JICA 2X6GA 1PFSA 5FO9B 5EKIA 1KAWA 4BBSH 1UAPA 2SDFA 2EYMA 3STBD 1SJED 2RSOA 3H15A 3U4VA 4IOAA 3NXWA 1DD2A 2UXBL 3JAMc 4RG1A 4DV2Q 4X3UA 3W3AA 5M9OA 4KN4C 5EPLA 3TN2A 1SFOB 4CDCC 3KJPA 1DYQA 3E3XA 4ZUJA 4DUZL 4K14A 1YVCA 2F0WA 2Z8LA 4A3LH 4MTNA 4CDEC 5IE8A 5ELBA 3R3OA 3P75A 1NCVA 2MO0A 3L2PA 1N34L 1EWIA 1CT1D 4AQYQ 1XPUA 4UAIA 3AU7A 1CFMA 2XTIA 2OTJA 1FVIA 2RQXA 1WTVA 3SK6A 4YY3Q 3S16H 2B63H 3KF8A 4JI2Q 4IFDH 4RHSA 3EJIA 5CC4A 4ZCKA 3VYRA 4R8IA 2KEEA 4LF5L 2LS01 4HAEA 2PPBC 4JBWA 4GN5A 1GUTA 3K59A 1NBWA 1L1OC 1RIPA 5AFWA 1BCPD 1MHWC 2PI2E 3SDZA 1II3A 5C3WA 4QY7A 4JBKA 4MN3A 3KF6A 3E9IA 4MIUA 4A3FH 2WKCA 5C0XI 3L0OA 4A3GH 1PZID 2Q2IA 3OWFA 4LUOA 4QGUA 2E2JB 1STHA 1GUGA 1LUZA 2CQAA 3K0XA 1MBYA 4DKAC 4BXXG 1IXRA 4H02A 4EGVA 1Y1WG 2BH8A 4IALA 2JA7H 2A74C 1BVSA 1YNND 5COYA 1EQTA 2R6GA 2BA0A 1N36Q 2ZXOA 3M4QA 1AP0A 2L4NA 2C5CA 2HHHL 3UE0A 5FK9C 2B2YC 4WJWA 5ELOA 4OO1H 1IL2A 2Q8IB 4R4IA 5ELDA 2UXDQ 2K33A 4J6HA 1R9TB 4BY7B 3MZ5A 2F1MA 5JVG3 1QUQB 2KCTA 1BO0A 3HZXA 1GUSA 2VZAA 5EAYA 1Q46A 4X62L 3GTKH 1VF7A 2IHFA 3TBIB 1ZEQX 2F0TA 3KJOA 1QOHA 3AQQA 3SK5A 2HT1A 4A3BH 4N8X1 3MVVA 4FXDA 2CWAA 3HOZG 3HOYB 3NWSA 4K5VA 1SNOA 2BH2A 1STEA 5CORA 2XRSD 5IYCG 4AIMA 5I9OA 5I2YA 5LMNQ 5J3BA 1X3EA 2DY8A 5ELCA 3J80E 2D62A 4K6LA 3EIVA 1VQ8A 4JPBW 4HN7A 3R93A 4QQBX 4A3IB 2KBNA 4DU9A 1JOOA 2YTYA 1A3UA 1IBLL 1SMYD 1JJCB 4DAYA 3G6EA 2JE6I 1DM0B 1EY5A 1D5MC 1I4XA 1I3QH 1QVGA 3QWNA 1V1OA 1K83H 2DJFC 2EE1A 3DLLA 5JPNC 1CA5A 4CJ0B 3HOXG 4OEMB 1ASZA 4A3KG 1OTCA 2E5LQ 1AH9A 1VQAA 4M1UB 2UU9L 3MWYW 3E6ZX 2EJGC 1JR0D 4LFBQ 3J81j 1IBML 1LTSD 4K2LA 3QB3A 4Z9CB 2PCFB 3S14B 1LABA 1IBKL 5GROA 3I4NH 3BVGA 4GKKQ 1A15A 3AFQA 3IKJA 4A93B 3HOVG 2KQ3A 3C3LA 3CD6A 4YCVA 3S1QB 1UUPA 3BS1A 3J81L 4O1NA 2F0DA 2NVYH 4R8NA 1VQNA 1ZXTA 1F2YA 3U4ZA 4ZK9B 4GS3A 1TQOA 1HHVA 4DV7Q 1D1KA 1DXMA 2JYOA 2GA4B 1T9HA 2J4XA 1GKHA 2KHIA 3OMGA 2OF1A 5HGQA 1NMGA 2JJQA 4HJ5A 2DN8A 3OW2A 4A3JB 2K5WA 3CCVA 5KEEA 2QEXA 4P74A 1WJJA 4X3TA 1N32Q 3Q24A 4HJ7A 1NUCA 1OXUA 2L12A 1KC8C 3M4YA 3AEVA 1O7LA 4ILWA 4K2KA 1XWEA 1VQCA 4JI5Q 2WB1G 5IGBA 1PTOD 1EOTA 3MXPA 1HNWQ 1PFBA 3HOUG 3DXJC 1UEAB 1X55A 4DAMA 1R9TH 5CV5A 2PZTA 3VR4A 4YIJA 3W5OA 4BBRB 4O0AA 1PRTD 5IGEA 3CCSA 4HJAA 3A56A 3RR5A 3PUYA 3I56A 2ID0A 3G7LA 4A3CG 3J80c 4C2MH 3LGJA 3EVQA 1U4LA 1I6HB 2NN6H 1Y69U 4PZ6A 4PZ7A 4POFA 1PH9A 3K81C 1STNA 4DR3L 2EVBA 5C0XG 3K7AB 1HR0L 1AEXA 1CI3M 1N33L 2HIXA 2F0GA 4LW1A 1YBYA 3GQBA 3S17B 4NXNL 3C46A 1RCVD 1CKNB 1Y1VG 4CKEA 4A3DH 3NBIA 2VB3X 1SNMA 1D5XC 1F2LA 1JB3A 1J9OA 5FJ8G 2EJFC 1VQ9A 4P73A 1A8VA 1KTKA 5BR8Q 4U68A 3EQLC 3GTGB 4C3HG 3RN5A 1HH2P 4FF1A 1O78A 5KNCA 4XIGS 1E7ZA 1E2ZA 3CU7A 3MHBA 5C4XH 1AZQA 1O7ZA 1EY7A 3LWUA 2ZM6Q 4DR4Q 4RHRA 2BA1A 3IRBA 1PHJA 4H44C 1VQHA 2I5MX 1C8CA 3S14H 1XTDA 3I8ZA 2O4XA 2KCMA 1CSPA 4BY1G 1Y8NB 1VS0A 2Z6BA 5EBCA 1B9MA 5IY0A 1L0XB 1EYGA 1B8AA 2D5DA 4UY8C 1CM9A 1KDAA 2RSNA 5C3XA 3AMUA 3S24A 1K0SA 5FKAC 3E5SA 3E0JA 3H94A 3CCQA 2JA5H 4NXMQ 4IPDA 3I55A 1EY8A 5FOBB 5LMUL 4LFAL 4P2CB 5JAVA 1ICWA 5C5MA 4A3MB 3S2HH 4A3JH 2CQOA 5FLMG 1H9SA 2PI2A 2ZTEA 1KL9A 3PO3B 5M3MB 4DR5Q 1EIYB 1SYBA 3CHBD 2ES2A 1TXYA 2F4IA 3MTSA 1X56A 3K5LA 2A68C 5FO8B 5JEAH 1ILPA 3A8JE 1IZ6A 2OQ0A 2RCFA 1VQKA 1PTOF 1YJNA 2A69C 5IP9G 1DOKA 1EZ8A 4CHTB 2K5QA 3D4DA 1PH4A 1TT2A 2NVQH 1DZ1A 4B3MQ 1G8ZD 2I07B 2WAQB 2R93H 2A6HC 1PVOA 1MJEA 4BBRH 3PUVA 3FPPA 5E4WC 4RKBA 4ME5A 1KQSA 3QOJA 4WRDA 1XNRL 4DK3C 2M9VA 1F9PA 1HNZQ 3CRLC 3TP5A 1LTAD 4JI0L 1B2TA 1S72A 1I6HH 4B3SQ 3SGIA 5C4JH 2Z1CA 1EIGA 1EIFA 4DK0A 2EY2A 5IYBG 3O13A 1SE2A 2RA4A 4KKSA 1ASYA 4YWKA 3RZDH 3K7AH 1B70B 2N8NA 4DR7Q 3UDXA 4KK7A 1I50H 1NE3A 3OSOA 2F0UA 1I94Q 3S17H 3HOWB 2HDMA 4DUYL 1KRSA 4XQNA 3ULPA 2JK8A 5EQ0A 3FPUB 1NSNS 3OWEB 1LTTD 1STBA 1FNUA 4DV1L 1E1OA 5IYDG 3GTLB 2F0JA 2E8GA 5C3EG 2QW7A 3FRPB 4A3EB 1I4RA 3A7AB 1PTOB 5C44G 3BVMA 3NE5B 4EQPA 2RCNA 3GTGH 1EYCA 2B29A 3FKIB 1IW7C 2X6LA 1DCZA 1T5XD 4NW2A 1CK1A 2AWNA 3H0GB 1QB5D 2QF7A 3SVMA 4IPCA 4GNXC 1K28A 4ALPA 2VQFL 4YCUA 1GUWA 1X6OA 2EYFA 2JA8B 4S3SA 4JV5Q 4RGTA 1WTPA 1Z9FA 2WAQE 4LUZA 2KCCA 1EZ6A 1PFNA 1UE1A 3PO2G 3HFZB 1YIJA 1F2ZA 4JYAQ 2QILA 4YHHQ 4FO2A 5LHY1 1I4PA 4C3IB 4IO9A 1DJRD 1B3AA 1ENCA 3HKZB 2J7ZA 1YNXA 4HEDA 1NR4A 4ZUIA 2DUDA 2R7ZG 2CWPA 1EQRA 4ZKCB 4J1MA 1IKMA 2CHBD 4LUVA 2WV6D 4KLKA 5E4XA 5I4DA 4AYBG 2BDOA 2C9OA 3OPOA 4BBSG 4LF8L 3BZDB 2CW0C 3PF4A 1Q8IA 1TWHB 2K6AA 4B3RQ 3GD7A 4EVOA 5M5WH 2F0VA 2F3VA 4HMJA 1WD0A 3S1RB 1IKLA 2B39A 3D4RA 3SK8A 5JJLA 1L1OA 3X3NA 4EX5A 4J8QA 4IN3A 3PQIA 3OYYA 3I4MH 5BN3A 1WTHA 1NTGA 1WCMH 4L5SA 2K04A 4CJ1B 3ULJA 1AFPA 1Q8KA 1HNXQ 3K5NA 1Q86C 1VQEA 2VUMH 5CV9A 3L3OC 4NXML 2NUCA 4X65L 1V1QA 3DWQA 4DV4Q 1S5FD 3PIOA 1SEBD 1NR2A 2XGTA 2MPMA 4IPGA 5T1IA 1QVCA 2GVBA 2QDLA 1O7IA 1A3VA 1PH6A 3PUZA 1W3SA 4K6DA 5L37A 3DM1A 1EY6A 3GTJB 3HGBA 3HKZE 2EYLA 5H1SE 4KHPL 2ICEC 1CQFA
chains in the Genus database with same CATH topology
1FYCA 1KDCA 1TKWB 1GHKA 4F87A 3D6CA 1MSHA 1BF4A 2NN6I 3SHLA 2F0HA 3ND8A 2HUGA 1B44D 3ERQA 5IGDA 1A3TA 4Q5VA 4OIJA 2A73B 2XNAC 1JCKB 2DY7A 4K5XA 2IW3A 4K8IA 3GTPB 3IFDA 2EOTA 3DHQA 5DM73 2EPBA 1PFMA 5C4ZA 3NPPA 2AUKA 3VR5A 1CA6A 1G6ZA 2XVSA 1TWAB 3SXHA 1JC7A 2HQEA 4OO1G 2WINB 1Y1WB 5T1GA 3KLRA 1IL8A 3BYTB 5F2DA 4PV1C 3TP6A 1H9RA 3GTQB 4NDXA 2M2LA 5CV6A 5CGKA 5JVH3 1SYFA 3NQTA 5LL6X 3I90A 5C4HA 5ELEA 4BA1I 5KNDA 1ZKOA 1RD9D 2F0LA 3HOZB 2ENBA 5K5PA 3D6WA 1EU4A 3WOEA 3K5OA 3L9AX 1D5ZC 1KNAA 4ABNA 1CTMA 2JP1A 1MI2A 4R9WA 1WD1A 1RF2D 2B2VC 2VNUD 1RODA 4I7ZC 1F77A 3QO2A 4G7HC 1LV9A 2SNSA 4N9TA 3LWEA 4ULLA 1Q1BA 5CBEE 2KHSA 3T16A 1LT4D 4K8JA 3HOXB 4FVMA 1RKNA 1X3PA 4A3KB 2AQ2B 3H3VC 4V190 4CKCA 3C1FA 1TY2A 3H91A 2OEOA 1AZPA 1G91A 1PZKD 1K8OA 1EYAA 1I4QA 1RTNA 1UNSA 4LK1C 3HOVB 4L8JA 3LX0A 2LKVA 1SE3A 2YU9B 3BYYB 2SNMA 3NP8A 2J0TD 5JOBA 1B53A 1SYDA 4HCSA 5ISRA 5A2QE 1PDQA 3RZOB 3NQIA 4DAVA 2KUMA 2L1BA 2YYZA 1LTGD 1B9NA 2SEBD 1O7YA 3CKIB 5M5XB 1YNJC 2IT1A 1OO9B 2WB1B 5IT9E 2ZT9C 3T53B 4WORA 3HOUB 2F0EA 1SE4A 2LMCB 1B4OA 2FMCA 1SBBB 1Y8PB 4XT3B 2XWJB 3FDTA 2NN6G 3MXGA 2F0PA 3OHXC 3KBXA 1CHQD 1BCPF 4CGYB 3H6MA 2BCOA 5D3IB 2O5IC 1JE4A 4U673 3PMFA 3M3YB 1C4QA 4XYOA 4ZQ3A 2E2DC 4PMWA 1HTLD 3I4LA 3Q22A 2PZWA 1Y1VB 2RVLA 3CRKC 2Q8RE 4EQOA 1BR9A 1LTRD 3QJYA 2F0SA 5D65A 3GTOB 2EZVA 1FD7D 2G9DA 1QE6A 4C3HB 3TZUA 5DM63 1TS5A 1D2BA 1XX8A 3A55A 5CV8A 2O2LD 3VYTA 1BCPB 2PMZB 1G2TA 1LT6D 2F0OA 4BY1B 1EY0A 5IGFA 5C0XJ 1SMYC 2RDHA 3U9SA 5M5YB 3OIPA 2IX0A 2RDFA 1X32A 2MUYA 1V43A 4UDUC 1A2UA 2B8GA 2BOSA 2BDNA 2KA7A 2XWBB 3NK9A 5JEAG 3KUPA 1BXTA 2XIWA 3J7AV 1VDZA 2HCCA 1EY4A 1VF5C 2F3WA 3CQZB 4E6IA 5KYIA 4OL7A 1JQYD 5FLXL 3MC0B 2EDGA 2B8FA 1GXDC 1S5DD 4X3SA 3Q0AA 3VR3A 2E76C 3T13A 2IX1A 4BA2I 2K5DA 2AUJD 1JWMD 2FMMA 4IFDI 1HRJA 1JWSD 4HTHA 3H09A 2B2TC 3I72A 1Q90A 5EKKA 3M7NA 2E2HB 5BN4A 4DGZA 3PUXA 1PTOC 1AN8A 2A6EC 1WTQA 1HFNA 1LLRD 1DONA 4DNTB 3QIAA 4C3JG 1EYDA 4XT1B 1MSGA 1BBXC 3X3MA 1R4PB 1F9QA 2PZUA 2VXWA 1CQVA 1HTPA 2SOBA 5HGTA 1KDBA 4ZKBB 4C56C 1GHJA 3BVZA 4L63B 4PMBA 1U4RA 4KHZA 1TR5A 5C3EB 1SNQA 4WFN3 5C44B 4QUCA 2RBMA 4OO1I 4N9PA 3C1EA 4BS9A 1ENFA 4LAAA 1PRTF 1RTOA 4IUQA 1S5BD 1WTRA 4LMQD 2L0CA 2F0MA 4IQZA 3GV6A 1QJOA 4RGNA 3A54A 3S2DB 5EBDA 3PO2B 3SR1A 3T56B 1SYGA 4H0LC 1QNKA 3Q23A 2L5TA 1TS4A 2RKSA 2E75C 4HSPA 5KRUA 3V05A 1M8AA 4KV6A 3DWPA 3M7GA 2R7ZB 3P20A 1RDPD 1KABA 3ITPA 4M8AA 4DNRB 1FGBD 4AYBB 1U4PA 4BBSB 2QEJC 3DEOA 1U9RA 4FXKC 1HQRD 4RCOA 5CV7A 1LACA 1PRTB 5A2QL 3NUCA 1EWHA 3F2UA 2H4OA 1QWYA 1F2MA 5KIXA 3BDLA 5HURA 4DFAA 5DNFA 3I91A 1S5CD 1ESFA 3TP8A 3JAME 3SK4A 4ZYSA 3UI2A 2NTSA 5IT9L 1F9RA 2K7VA 2MHVA 4KY5A 1EU3A 3NSWA 3HS0C 5FO7B 5EKLA 2KCNA 4FF4A 2F0FA 5CMDA 1GJXA 4IUNA 4XTCS 5JJZA 2R61A 2NVXB 3S16B 2BE5C 2KOLA 4FP5D 4B9XA 2PW5A 2PQEA 4K5WA 4G7OC 1B50A 3MAQA 1STGA 4QB4A 4OGQC 2MJ8A 2K32A 4PMCA 1O80A 3T4AC 2N55A 1EY9A 4ZRZA 1OXVA 1IHZA 4RGOS 4KY6A 4FYDA 2FJ2A 3SE0A 2KECA 1BQQT 4H7BA 4CBVA 2L55A 3D8GA 3RD4A 4DA2A 1VMPA 2R3ZA 1ESRA 2JA7B 1X3QA 4XQQA 3SEBA 3HEJA 1HA5A 3RMHA 4OIKA 3QG1A 3V2TA 2B2VA 5DEHA 4IFDG 1R4QB 5G3LD 5K36H 5KGUA 1SDFA 1IYVA 5D3DA 1BDOA 1D6EC 3GP7A 4MHEA 2RDGA 2DNEA 4V0BA 4XQJA 1E0BA 1TIID 3NTIA 3HG9A 5LL6S 4A3BB 1CZWA 1G291 1PTOH 2Z4IA 1H9SB 1BNZA 2B2WC 3ONAB 1VMCA 1ZYRC 5IGGA 2VB2X 3KLSA 5FLXE 2K03A 1QILA 3MXUA 2NYZD 5C5LA 4KJNA 4DXFA 3PUWA 3D4WA 1A2TA 2N88A 3M85A 3A7LA 4L6TB 2IJ0A 1I3QB 1K83B 4JK1C 2B2UC 1VCIA 2NVTB 1ILQA 3TSSA 4KD3A 5C6AA 2MGSA 2EJMA 4F7XA 4F88A 1QCBD 2AQ1B 1Q12A 2FFKB 1HQMC 3I4NB 4HSVA 1YNJD 1H9KA 1CZGA 4ZAIA 4FXGC 3VA7A 4Q0FA 1WVLA 2O5JC 2NVYB 5I6WA 5IODA 4C1NI 3BDCA 2XSCA 4ZLTF 1ET6A 4DN4M 1EQVA 3S9WA 4IUUA 2EY6A 4XXEA 3V96A 2XRQD 4IUVA 2IL8A 4LJZC 5M3FB 1PLFA 5IOCA 1HFGA 1FNWA 1S4ZA 1SXTA 1Q1EA 5IGCA 4RAUC 5KYLA 3VA5A 4QIWB 2F0KA 2EXZA 4KY7A 3NTKA 4TKOB 2K1BA 3PV0A 5G3LF 1TS2A 1V1PB 1ML0D 4TRDA 2NB0A 2G9HD 3MEHA 5TSSA 4KTAA 2V4DA 4C2MB 2IX3A 3URYA 4RWSC 1HXYD 1W6JA 1TU2B 1EIHA 3VYSA 4RKLA 1MD2D 3GO5A 2F0IA 2FHTA 2QCPX 1BUVT 4DXGA 4Y7NB 4A3DB 4O42A 3T51B 2EYOA 1XXGA 5I2XA 4FF2A 3K57A 1I6VC 1L0YB 1G2SA 1KNEA 1BCPC 4KHVA 1SYCA 1I4GA 3R8BA 5C4XB 2ICIA 2IPKD 4KKTA 5E1FA 4B9WA 1SAPA 3MA2B 1EWCA 3JAML 1OXSC 1WTOA 3VYUA 5I6YA 1LO5D 1STAA 1KAAA 1JWUD 1IYUA 3ND9A 4G57A 1YNNC 4EQNA 1PZJD 1RHPA 1K8MA 4NKLA 1H9JA 2QDBA 3DWAA 2JA5B 3A8IE 2B2TA 5CBAE 3TDQA 3D31A 2JSOA 4I65A 1MGSA 3S2HB 2PYKA 1WTXA 4IURA 1E2VA 4RGMA 5CR3A 1JOQA 1PXUA 5EGTA 2A6ED 1XYIA 3TP7A 2A68D 2Z4HA 3BDOA 2NVQB 1DOLA 3R2TA 2R93B 5J39A 1XTCD 2A69D 1TWGB 3I73A 1STYA 3J7AF 1F9SA 1HCZA 3WDNA 4RA8A 1BOSA 2A6HD 5E3FA 2TSSA 4FNFA 3U9OA 5C4JB 3DMUA 1KLUD 1AW7A 1OXTA 3PIO3 3PIP3 3K58A 3RZDB 5EPJA 5KNBA 2PNRC 2Q8TA 1I50B 5I9PA 2D9UA 1PYWD 1DOMA 5JEAJ 1FR3A 2NTTA 4ID6A 2A5HA 1SNDA 4PQXA 3VR2A 5CV4A 2F0NA 1PMRA 1JORA 4C3JB 5J22A 3DUZA 3OIQA 1EL0A 3TMEA 2JEBI 2KJXA 1NAPA 1T5EA 4KJOA 2JXMB 1Q3LA 1U4MA 4F8MA 3K5MA 3FEWX 1I4HA 1IW7D 1KLGD 3DEPA 3BG3A 3RUZA 2LFNA 4TSSA 3W2DA 1Z7TA 3P7JA 1Z47A 2NBFA 3VR6A 4G7ZC 4XDXA 2EYJA 1GUNA 1ENAA 3NWTA 4QMGA 2D2CC 3C2PA 4QCLA 3GV3A 5DAUA 5C0XH 2WKDA 2Y0SB 1SJHD 1EFID 1SNPA 2DNCA 2L9HA 5CYUA 5EJWA 3IL8A 1PRTC 4DF7A 2K28A 1D1IA 2KEDA 1OXXK 2KVMA 4KD4A 5M5WB 4IUTA 3P1HA 3HP3A 2BE5D 3NTHA 2PW7A 2CW0D 3AB9A 3I4MB 4BWGB 3EFXD 4FF3A 2F0QA 3OW7A 1WCMB 4RH6A 3HRZC 3I3CA 5BN5A 4IUPA 3J7YW 2NZ1D 2XN9C 2K05A 2VUMB 1Y8OB 3NHHA 4NMZA 5A35A 1WTWA 2JEAI 3N6RA 2QKIC 3I70A 1FNVA 1LT3D 3ZYYX 3MFGA 1GOZA 2HDLA 1C48A 5JPMC 3KLSX 4KMUC 2L11A 2M00A 3QOLA 1W6KA 3A8KE 4HR7B 2AWOA 2NWGA 3OMCA 1TS3A 3GTMB 2JA6B 3NBHA 4GZYC 3Q6SA 2WIIB 2EYPA 1ONLA 3J80L 4PNYA 1Z6HA 2B2WA 4XYQA 2OXPA 4RCNA 3WOFA 5IIFA 3S1MB 1EEID 2EYHA 1TWFB 1HUNA 2OT2A 1M4VA 2EY1A 1ZYRD 3EROA 1HPCA 4H13C 3IFTA 3MXNA 2MP1A 3FMCA 2EY5A 5K36G 2CVRA 1SSOA 2AQ3B 3J81E 1HA6A 4KKUA 2ZXRA 2B63B 3IAYA 2B2UA 1LTBD 4HCEA 3TZDA 3D3RA 2TMPA 2IWHA 3S1NB 3OOCA 5NUCA 5J1ZA 2E74C 2X69A 1V1PA 2R92B 1QNUA 1J8IA 2I46A 3G6JB 1CHPD 4CKBA 1RJTA 1TVXA 1LTID 1E2WA 3KBGA 3MFYA 1TWCB 3RLFA 1SNCA 1ET9A 3K6OA 4OHJA 4HMIA 3M4OB 4A3FB 5EPKA 2K01A 4A3GB 4NP5A 3FVQA 2LY7A 3N52A 2H1EA 4G4KA 3S15B 4ODGA 4CJ2C 3K0YA 1EEFD 4KI0A 1B1ZA 1V8QA 2PO4A 4C1NK 4DK1A 4C3IG 4QF4A 5ELFA 1A6XA 2HCIA 4DAPA 1S5ED 1GUOA 4IFDJ 4TQUS 3LNNA 4IZ8A 1HUMA 4QUFA 4RFBA 1QG7A 3EA6A 2FINB 4B08A 2ZXPA 3R2IA 3GTKB 5D14A 1SYEA 1LT5D 2E2IB 2B2YA 1JOKA 2WACA 3KK7A 3L7ZC 1TY0A 2F03A 4X3KA 2WP8J 4KN7C 1H9MA 1JICA 2X6GA 5FO9B 5EKIA 1UAPA 2SDFA 2EYMA 1SJED 2RSOA 3NXWA 1DD2A 4X3UA 3W3AA 5M9OA 4KN4C 5EPLA 3TN2A 1SFOB 1DYQA 4ZUJA 4K14A 2F0WA 2Z8LA 5ELBA 3R3OA 3P75A 1NCVA 1CT1D 4UAIA 3AU7A 1CFMA 2RQXA 1WTVA 3SK6A 3KF8A 4IFDH 4RHSA 3EJIA 5CC4A 3VYRA 4R8IA 2KEEA 2LS01 4HAEA 2PPBC 4JBWA 1GUTA 3K59A 5AFWA 1BCPD 3SDZA 1II3A 5C3WA 4MN3A 4MIUA 2WKCA 5C0XI 1PZID 3OWFA 2E2JB 1STHA 1GUGA 2CQAA 1MBYA 4EGVA 4IALA 2A74C 1YNND 5COYA 1EQTA 2R6GA 2BA0A 2ZXOA 1AP0A 2L4NA 2C5CA 5FK9C 2B2YC 4WJWA 4OO1H 2Q8IB 5ELDA 2K33A 4J6HA 1R9TB 4BY7B 3MZ5A 2F1MA 5JVG3 3HZXA 1BO0A 1GUSA 1VF7A 3TBIB 1ZEQX 2F0TA 1QOHA 3SK5A 3MVVA 4FXDA 3HOYB 3NWSA 4K5VA 1SNOA 1STEA 5CORA 2XRSD 5I9OA 5I2YA 2DY8A 5ELCA 3J80E 2D62A 4K6LA 4HN7A 3R93A 4A3IB 4DU9A 1JOOA 1A3UA 1SMYD 4DAYA 2JE6I 1DM0B 1EY5A 1D5MC 1I4XA 3QWNA 1V1OA 2EE1A 5JPNC 1CA5A 4CJ0B 4M1UB 3MWYW 3E6ZX 2EJGC 1JR0D 1LTSD 4K2LA 3QB3A 4Z9CB 2PCFB 3S14B 1LABA 3BVGA 1A15A 3IKJA 4A93B 2KQ3A 3C3LA 3S1QB 1UUPA 3BS1A 3J81L 4O1NA 2F0DA 4R8NA 1ZXTA 1F2YA 4ZK9B 1TQOA 1HHVA 1D1KA 1DXMA 2JYOA 2GA4B 2J4XA 3OMGA 2OF1A 2DN8A 4A3JB 2K5WA 5KEEA 4X3TA 3Q24A 1NUCA 1OXUA 2L12A 3M4YA 1O7LA 4ILWA 4K2KA 1XWEA 5IGBA 1PTOD 1EOTA 3MXPA 1PFBA 3DXJC 1UEAB 5CV5A 2PZTA 3VR4A 4YIJA 4BBRB 1PRTD 5IGEA 3A56A 3PUYA 2ID0A 3G7LA 3EVQA 1U4LA 1I6HB 2NN6H 1Y69U 1STNA 2EVBA 5C0XG 3K7AB 1AEXA 1CI3M 2F0GA 3GQBA 3S17B 3C46A 1RCVD 4CKEA 3NBIA 2VB3X 1SNMA 1D5XC 1F2LA 1JB3A 1J9OA 2EJFC 1KTKA 4U68A 3EQLC 3GTGB 4C3HG 4FF1A 1O78A 5KNCA 4XIGS 3CU7A 1E2ZA 3MHBA 1AZQA 1O7ZA 1EY7A 3LWUA 4RHRA 2BA1A 4H44C 1C8CA 3I8ZA 2O4XA 1Y8NB 5EBCA 1B9MA 1L0XB 2D5DA 1CM9A 1KDAA 2RSNA 5C3XA 3AMUA 5FKAC 3E5SA 3E0JA 3H94A 1EY8A 5FOBB 4P2CB 5JAVA 1ICWA 5C5MA 4A3MB 1H9SA 3PO3B 5M3MB 1SYBA 3CHBD 2F4IA 3MTSA 3K5LA 2A68C 5FO8B 5JEAH 1ILPA 3A8JE 1PTOF 2A69C 1DOKA 1EZ8A 4CHTB 2K5QA 3D4DA 1TT2A 1DZ1A 1G8ZD 2I07B 2WAQB 2A6HC 3PUVA 3FPPA 5E4WC 4RKBA 4ME5A 3QOJA 4WRDA 2M9VA 1F9PA 3CRLC 3TP5A 1LTAD 1B2TA 2Z1CA 1EIGA 4DK0A 2EY2A 3O13A 1SE2A 2RA4A 4KKSA 4KK7A 3OSOA 2F0UA 3HOWB 2HDMA 4XQNA 5EQ0A 3FPUB 1NSNS 3OWEB 1LTTD 1STBA 1FNUA 3GTLB 2F0JA 3FRPB 4A3EB 1I4RA 3A7AB 1PTOB 3BVMA 3NE5B 4EQPA 1EYCA 3FKIB 1IW7C 2X6LA 1DCZA 1T5XD 4NW2A 1CK1A 2AWNA 3H0GB 1QB5D 2QF7A 3SVMA 1GUWA 2EYFA 2JA8B 4S3SA 4RGTA 1WTPA 2KCCA 1EZ6A 1PFNA 1F2ZA 2QILA 4FO2A 5LHY1 1I4PA 4C3IB 1DJRD 1B3AA 1ENCA 3HKZB 2J7ZA 4HEDA 1NR4A 4ZUIA 4ZKCB 4J1MA 1IKMA 2CHBD 2WV6D 5I4DA 5E4XA 2BDOA 2C9OA 3OPOA 3BZDB 2CW0C 1Q8IA 1TWHB 2K6AA 3GD7A 4EVOA 2F0VA 2F3VA 4HMJA 1WD0A 3S1RB 1IKLA 2B39A 3D4RA 3SK8A 3X3NA 4J8QA 4IN3A 5BN3A 2K04A 4CJ1B 1AFPA 3K5NA 5CV9A 3L3OC 2NUCA 3DWQA 1S5FD 1SEBD 1NR2A 2MPMA 5T1IA 1A3VA 3PUZA 4K6DA 3DM1A 1EY6A 3GTJB 3HGBA 2EYLA 2ICEC 1CQFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D8G A;  4E6I A;  1KDC A;  2PW7 A;  5NUC A;  2EYO A;  4K14 A;  3E5S A;  2F0W A;  5J1Z A;  3U9O A;  5KYI A;  4K5V A;  1SNO A;  4OL7 A;  2F0Q A;  2SNS A;  3D6C A;  3R3O A;  3DMU A;  3H6M A;  3P75 A;  4N9T A;  2RKS A;  3SHL A;  5I9O A;  1EY8 A;  5KRU A;  2F0H A;  5CV5 A;  2EYF A;  2PZT A;  4S3S A;  5JAV A;  3PMF A;  3HEJ A;  4KHV A;  1SYC A;  4KV6 A;  5C5M A;  3ERQ A;  2KHS A;  4YIJ A;  3T16 A;  5I6W A;  3V2T A;  5IOD A;  1EZ6 A;  5IGD A;  5DEH A;  1A3T A;  3BDC A;  1KAB A;  4K8J A;  1F2Z A;  1SNC A;  1SYB A;  3NHH A;  3ITP A;  4NMZ A;  5I9P A;  3T13 A;  5IGE A;  1EQV A;  4ZQ3 A;  4HMI A;  5E1F A;  3S9W A;  4B9W A;  4K5X A;  1RKN A;  2EY6 A;  4K8I A;  4ID6 A;  4DU9 A;  1JOO A;  1SND A;  3SK6 A;  1A3U A;  4NP5 A;  5KGU A;  1ENC A;  5CV4 A;  3DHQ A;  2F0N A;  3C1F A;  4ZUJ A;  3EVQ A;  4ODG A;  5C4Z A;  1JOR A;  1EY5 A;  2PZW A;  5I6Y A;  3EJI A;  5CC4 A;  5J22 A;  1STA A;  1U9R A;  2OEO A;  4ZUI A;  1KAA A;  4HTH A;  3MXP A;  3TME A;  1EYA A;  5IOC A;  4G57 A;  5CV7 A;  5EKK A;  4EQN A;  3SXH A;  1EZ8 A;  3D4D A;  2HQE A;  3NUC A;  1TT2 A;  4J1M A;  4DGZ A;  1STN A;  4KJO A;  4EQO A;  1F2M A;  1AEX A;  4NKL A;  3BDL A;  5KIX A;  3LX0 A;  5HUR A;  2F0S A;  4DFA A;  2LKV A;  4QF4 A;  2F0G A;  1II3 A;  2QDB A;  4F8M A;  5IGC A;  5C3W A;  2M00 A;  3QOL A;  5F2D A;  5KYL A;  3TP6 A;  3TP8 A;  3VA5 A;  2F0K A;  2SNM A;  3OMC A;  3NP8 A;  1EYD A;  4ME5 A;  4MIU A;  4RKB A;  4EVO A;  4K2L A;  2F0V A;  2F3V A;  3QB3 A;  3QOJ A;  4HMJ A;  4IZ8 A;  4WRD A;  2EXZ A;  3SK4 A;  3OWF A;  4KY7 A;  4NDX A;  5JOB A;  5IGG A;  1SNM A;  3SK8 A;  5CV8 A;  1STH A;  3RUZ A;  4I65 A;  1SYD A;  5ISR A;  5CV6 A;  2PZU A;  4KY5 A;  3TP5 A;  5CGK A;  2PYK A;  2KQ3 A;  1SYE A;  2EYP A;  5EKL A;  5C5L A;  2SOB A;  1SYF A;  3NQT A;  5HGT A;  4IAL A;  1KDB A;  2F0O A;  2F0F A;  4PNY A;  4PMB A;  4KJN A;  4TRD A;  2EY2 A;  2OXP A;  5C4H A;  4IUN A;  5CR3 A;  1JOK A;  2WAC A;  1TR5 A;  3MEH A;  1EY0 A;  2F0D A;  4R8N A;  1JOQ A;  3D4W A;  4KTA A;  1F2Y A;  1SNQ A;  3MHB A;  5IIF A;  5IGF A;  5CV9 A;  1A2T A;  5EGT A;  2EYJ A;  2EYH A;  2NUC A;  4B9X A;  1ENA A;  2PW5 A;  1EY7 A;  2PQE A;  1TQO A;  2RBM A;  4K5W A;  3OSO A;  4QMG A;  2F0U A;  4N9P A;  5DAU A;  2EY1 A;  2F0L A;  3C1E A;  1STG A;  2ENB A;  4QB4 A;  3TP7 A;  4LAA A;  2RDF A;  4J6H A;  4WOR A;  5K5P A;  1NSN S;  3ERO A;  3OMG A;  2OF1 A;  3MZ5 A;  2EYM A;  4PMC A;  1SNP A;  1STB A;  3HZX A;  2F0E A;  2O4X A;  4KD3 A;  4RKL A;  1A3V A;  5C6A A;  2EY5 A;  2F0J A;  5KEE A;  1A2U A;  1EY9 A;  2F0M A;  3NXW A;  1IHZ A;  2F0I A;  5J39 A;  1NUC A;  3NK9 A;  4KY6 A;  4K6D A;  4DF7 A;  2F0T A;  4EQP A;  4F7X A;  1STY A;  1EYC A;  5M9O A;  1EY6 A;  3SK5 A;  4K2K A;  4KD4 A;  5IGB A;  1KDA A;  1EY4 A;  3MVV A;  5C3X A;  2F0P A;  2EYL A;  3P1H A;  3SR1 A;  4H7B A;  1SYG A;  2F3W A;  5E3F A; 
#chains in the Genus database with same CATH topology
 2I5H A;  1FYC A;  1KDC A;  4TVA B;  2P5Z X;  4CDF C;  1TKW B;  1GHK A;  1VQ4 A;  4F87 A;  3D6C A;  1YHQ A;  1MSH A;  1BF4 A;  2NN6 I;  3NEL A;  3SHL A;  3GTM H;  2JA6 H;  2MO1 A;  2F0H A;  3ND8 A;  2HUG A;  4B3M L;  1B44 D;  3ERQ A;  4DR2 Q;  5GQO A;  3TS0 A;  4DR1 Q;  5IGD A;  3CCM A;  1A3T A;  4Q5V A;  1JB7 A;  4OIJ A;  4L5Q A;  3PF5 A;  2A73 B;  3BZC A;  2PQA B;  3WWV A;  2XNA C;  1JCK B;  2DY7 A;  4K5X A;  2IW3 A;  4K8I A;  4P75 A;  3GTP B;  3FKI H;  1VQ6 A;  3IFD A;  2EOT A;  3DHQ A;  2JA7 G;  3S1M H;  3BJU A;  4R4C A;  5DM7 3;  4JI6 L;  2EPB A;  1PFM A;  5C4Z A;  3NPP A;  1TWF H;  2AUK A;  3VR5 A;  3J81 c;  4GOP C;  1GD7 A;  4X6A H;  1CA6 A;  4X66 Q;  1G6Z A;  2XVS A;  1TWA B;  3SXH A;  1JC7 A;  3DM3 A;  2HQE A;  4OO1 G;  2IHE A;  2K5N A;  2WIN B;  1EOV A;  2Q2H A;  1Y1W B;  5T1G A;  3KLR A;  1IL8 A;  3BYT B;  3K8A A;  5F2D A;  4PV1 C;  1I94 L;  3TP6 A;  2AHO B;  1H9R A;  3GTQ B;  4DV6 L;  4LF6 L;  4LF7 L;  3NEN A;  4NDX A;  3S1N H;  4OON A;  2M2L A;  4JCV E;  5CV6 A;  5CGK A;  4A3B G;  2LXJ A;  2R92 H;  5JVH 3;  3J7Z C;  2MFI A;  1SYF A;  3NQT A;  1WI5 A;  5LL6 X;  3I90 A;  5C4H A;  1YJ9 A;  5ELE A;  3CPF A;  4BA1 I;  4DNI A;  1TWC H;  1XMO L;  1AE3 A;  3CP0 A;  5KND A;  1ZKO A;  1RD9 D;  3M4O H;  1HR0 W;  1TWH H;  2F0L A;  3HOZ B;  2ENB A;  2EIF A;  5K5P A;  3D6W A;  3S1R H;  1EU4 A;  3S15 H;  2F3I A;  3NBH B;  3K5O A;  3WOE A;  1X3F A;  3L9A X;  4B3T L;  1D5Z C;  1KNA A;  4ABN A;  4DV0 L;  3K7U C;  2ZTD A;  1CTM A;  4NB3 A;  1PH1 A;  4WJ3 M;  1CKN A;  2JP1 A;  1MI2 A;  4R9W A;  1WD1 A;  1RF2 D;  2B2V C;  2VNU D;  3TQY A;  1ROD A;  3F1Z A;  1F77 A;  3QO2 A;  4I7Z C;  4G7H C;  1LV9 A;  2Z0S A;  5IWA Q;  2SNS A;  4GOP B;  4N9T A;  3LWE A;  4OEL B;  4ULL A;  1Q1B A;  3T1H Q;  5CBE E;  2KHS A;  1SRU A;  3T16 A;  3MXN B;  3OTO L;  1LT4 D;  4K8J A;  2E2I H;  4DV5 L;  3HOX B;  4FVM A;  1PV4 A;  1RKN A;  1X3P A;  4X64 L;  4A3K B;  2AQ2 B;  4NPS A;  3H3V C;  1MKH A;  4V19 0;  1JJG A;  4CKC A;  3C1F A;  1TY2 A;  3H91 A;  4OX9 L;  2OEO A;  1AZP A;  4R1J A;  1G91 A;  1PZK D;  1K8O A;  1EYA A;  1I4Q A;  1RTN A;  1JE5 A;  1UNS A;  1UE7 A;  4LK1 C;  3HOV B;  4L8J A;  3LX0 A;  2LKV A;  1SE3 A;  1U5K A;  2YU9 B;  4GKJ L;  4JI8 Q;  3BYY B;  4JI7 L;  4K0K Q;  2SNM A;  4LFC L;  3NP8 A;  1SLJ A;  5M3F G;  2I0Q A;  3GTP H;  1SFO H;  1CKO A;  2J0T D;  5JOB A;  1B53 A;  1RL2 A;  1SYD A;  4HCS A;  5ISR A;  4EQ5 A;  2UUC Q;  5A2Q E;  1PDQ A;  1K8G A;  3RZO B;  4JI4 Q;  1KHI A;  3NQI A;  4DAV A;  1BBW A;  1TWA H;  1GM5 A;  2KUM A;  2L1B A;  4BXX H;  2YYZ A;  1LTG D;  1B9N A;  1U0L A;  2SEB D;  1O7Y A;  3CKI B;  5M5X B;  4JC0 A;  1YNJ C;  2IT1 A;  1OO9 B;  2WB1 B;  5IT9 E;  2ZT9 C;  3T53 B;  1M1K C;  1G51 A;  3GTQ H;  4WOR A;  3HOU B;  2F0E A;  1SE4 A;  5AJ3 Q;  2LMC B;  4L5R C;  4DV2 L;  2UUB Q;  1B4O A;  2FMC A;  2GVA A;  3HKS A;  1SBB B;  1VQD A;  1Y8P B;  4R4Q A;  4JOI C;  4XT3 B;  2XWJ B;  3A5U A;  3FDT A;  4J15 A;  3ER0 A;  1SR3 A;  2NN6 G;  3MXG A;  2F0P A;  2QGQ A;  3OHX C;  3KBX A;  1CHQ D;  3I2Z A;  1BCP F;  1EUJ A;  4CGY B;  3H6M A;  2BCO A;  4AQY L;  5D3I B;  2VW9 A;  2O5I C;  2E2J H;  1JE4 A;  4U67 3;  3PMF A;  3M3Y B;  1NY4 A;  1C4Q A;  4XYO A;  3CC2 A;  5IYC H;  4A3D G;  1B7Y B;  4ZQ3 A;  2YV5 A;  2V1C C;  2E2D C;  4YY3 L;  1PA6 A;  4PMW A;  3FP9 A;  1HTL D;  4JI2 L;  1Q81 C;  3I4L A;  4HIM A;  3Q22 A;  2PZW A;  1Y1V B;  2RVL A;  3CRK C;  2VS1 A;  1A63 A;  2Q8R E;  2LSS A;  1NNX A;  1YI2 A;  5C4X G;  3CXC A;  4BY7 H;  1BKB A;  4EQO A;  1BR9 A;  1LTR D;  2ZJR A;  3QJY A;  2EXD A;  2F0S A;  5D65 A;  3GTO B;  1PYS B;  2Z9H A;  2EZV A;  1FD7 D;  1XJV A;  2G9D A;  1QE6 A;  2WB1 E;  4C3H B;  1I5F A;  3HOX H;  3TRZ A;  3TZU A;  5DM6 3;  1J6Q A;  1TS5 A;  4AH6 A;  1D2B A;  3HOY H;  1XX8 A;  3A55 A;  5CV8 A;  2O2L D;  3VYT A;  1VQ5 A;  2GN5 A;  4DR6 Q;  1BCP B;  2PMZ B;  1G2T A;  4RMF A;  1LT6 D;  2F0O A;  1N36 L;  3M4P A;  4IJH A;  2JA5 G;  1HZB A;  4BY1 B;  1EY0 A;  3AFP A;  3HOV H;  3BZK A;  5IGF A;  2K5H A;  5C0X J;  1SMY C;  2RDH A;  1XMQ Q;  4A3I H;  2UXD L;  3U9S A;  5M5Y B;  3OIP A;  2YU9 H;  3E9H A;  4HIK A;  2IX0 A;  2RDF A;  3KF6 B;  4IPH A;  1W2B A;  1X32 A;  2MUY A;  1V43 A;  4UDU C;  3ERS X;  3TRE A;  3ZJY C;  1A2U A;  2B8G A;  2BOS A;  2BDN A;  2KA7 A;  2XWB B;  3NK9 A;  1YHA A;  2D0O A;  3T1Y Q;  5JEA G;  3QR8 A;  3KUP A;  1BXT A;  2XIW A;  4HJ9 A;  3J7A V;  1VDZ A;  2HCC A;  1EY4 A;  4GLX A;  1VF5 C;  2F3W A;  3CQZ B;  4E6I A;  1GVP A;  3JAM i;  5KYI A;  4JI1 Q;  5M5X H;  4OL7 A;  1JQY D;  2D0P A;  5LMN L;  2R93 G;  5FLX L;  3MC0 B;  2EDG A;  2B8F A;  1GXD C;  1S5D D;  4A93 H;  4X3S A;  3Q0A A;  3VR3 A;  2CKZ B;  1BBU A;  2E76 C;  2F4V Q;  4GNX A;  3T13 A;  2ASB A;  2IX1 A;  4BA2 I;  2K5D A;  3S1Q H;  2AUJ D;  3CCE A;  3F8T A;  1JWM D;  3F2B A;  3H3V H;  2FMM A;  4IFD I;  2PMZ E;  2ALY B;  1HRJ A;  4DV3 Q;  1JWS D;  4HTH A;  3H09 A;  2B2T C;  4JI4 L;  3I72 A;  1Q90 A;  5EKK A;  3M7N A;  2E2H B;  5BN4 A;  1M90 C;  4DGZ A;  2E5L L;  3PUX A;  2K14 A;  1PTO C;  1L0W A;  1AN8 A;  2A6E C;  1WTQ A;  1HFN A;  2DJG C;  4LFB L;  1LLR D;  1DON A;  4DNT B;  3QIA A;  4C3J G;  1EYD A;  4XT1 B;  3CF5 A;  1PH2 A;  4GKK L;  1MSG A;  1BBX C;  3X3M A;  1R4P B;  1F9Q A;  4UP9 A;  4UHV A;  2VQE Q;  2PZU A;  5JJI A;  2VXW A;  3G48 A;  1CQV A;  1HTP A;  4DK6 C;  2SOB A;  5HGT A;  2PQA A;  1KDB A;  4ZKB B;  4C56 C;  2DGY A;  1GHJ A;  3BVZ A;  4L63 B;  4GN4 B;  4PMB A;  1U4R A;  4KHZ A;  1TR5 A;  5C3E B;  2UUA Q;  5FJ8 H;  1SNQ A;  4WFN 3;  5C44 B;  4QUC A;  4QL5 A;  4DV7 L;  3AYH B;  2RBM A;  4LF9 Q;  2FXQ A;  4OO1 I;  4N9P A;  3C1E A;  4BS9 A;  1ENF A;  4LAA A;  1FJG Q;  1PRT F;  5E7N A;  4PZ8 A;  2EQS A;  1RTO A;  4IUQ A;  1D7Q A;  1S5B D;  1N32 L;  1WTR A;  4LMQ D;  2L0C A;  4I7A A;  2F0M A;  3TS2 A;  4IQZ A;  3GV6 A;  1QJO A;  4RGN A;  4JI5 L;  2UXB Q;  3A54 A;  3S2D B;  1HNW L;  4N8F A;  5EBD A;  4BY1 H;  3PO2 B;  3SR1 A;  3T56 B;  1SYG A;  2Y0S G;  1YIT A;  4H0L C;  3RN2 A;  1QNK A;  3Q23 A;  1JJ2 A;  2L5T A;  4DUZ Q;  5M5Y H;  1TS4 A;  1J5E Q;  1WOC A;  2RKS A;  2E75 C;  4HSP A;  5KRU A;  3ICE A;  3V05 A;  1M8A A;  1VQG A;  1EFW A;  4KV6 A;  3DWP A;  1N34 Q;  3M7G A;  2R7Z B;  3P20 A;  1RDP D;  1KAB A;  4POG A;  3ITP A;  4M8A A;  4DNR B;  1FGB D;  3G71 A;  3I4M G;  3ULL A;  1WCM G;  1PH5 A;  4AYB B;  1U4P A;  4BBS B;  2QEJ C;  3DEO A;  3CMA A;  1U9R A;  4FXK C;  1HQR D;  4RCO A;  2VUM G;  5CV7 A;  1LAC A;  4LF5 Q;  1PRT B;  5A2Q L;  2IY5 B;  3NUC A;  1EWH A;  3F2U A;  2H4O A;  1QWY A;  1Q82 C;  1F2M A;  5KIX A;  3BDL A;  1XMQ L;  1HZC A;  5HUR A;  2A19 A;  4DFA A;  5DNF A;  4A75 A;  1QZH A;  3I91 A;  5IP9 H;  1S5C D;  1ESF A;  1SRO A;  4JI3 Q;  3TP8 A;  4GOP A;  1C9O A;  3JAM E;  3SK4 A;  4ZYS A;  1K73 C;  1QUQ A;  3UI2 A;  2NTS A;  4P72 A;  5IT9 L;  1F9R A;  2K7V A;  2MHV A;  4KY5 A;  5BR8 L;  1EU3 A;  2Q2U A;  3NSW A;  3HS0 C;  5FO7 B;  3UDG A;  5EKL A;  2KCN A;  4FF4 A;  2F0F A;  5CMD A;  1GJX A;  2K50 A;  4IUN A;  4XTC S;  5JJZ A;  2R61 A;  4LWC A;  4A3M H;  2NVX B;  3S16 B;  4DR4 L;  2ZM6 L;  3CME A;  3PO3 H;  2BE5 C;  1MJC A;  2KOL A;  4FP5 D;  5M3M H;  4B9X A;  2PW5 A;  1VQP A;  2JA6 G;  2PQE A;  4K5W A;  2HHH Q;  2ATW A;  4G7O C;  1B50 A;  3MAQ A;  1STG A;  4QB4 A;  4OGQ C;  2MJ8 A;  2K32 A;  3U58 A;  4PMC A;  1UE6 A;  1O80 A;  3T4A C;  2N55 A;  1EY9 A;  4ZRZ A;  1OXV A;  1IHZ A;  3CCR A;  4RGO S;  4KY6 A;  4X62 Q;  4FYD A;  1E24 A;  4A3L G;  2FJ2 A;  3SE0 A;  3CCL A;  2KEC A;  1BQQ T;  4AYB E;  5IYD H;  1VQB A;  1VQJ A;  4H7B A;  4CBV A;  2L55 A;  3D8G A;  3RD4 A;  4DA2 A;  3M9B A;  1VMP A;  2R3Z A;  2R7D A;  1ESR A;  2JA7 B;  1N8R C;  1X3Q A;  4XQQ A;  3SEB A;  3HEJ A;  1HA5 A;  3RMH A;  4OIK A;  3QG1 A;  3V2T A;  4DR5 L;  2B2V A;  5DEH A;  2B63 G;  5GAH C;  4IFD G;  1R4Q B;  1UWV A;  2AKW B;  5G3L D;  4DPG A;  2R92 G;  2CFM A;  5K36 H;  5KGU A;  1SDF A;  1IYV A;  5D3D A;  1LM0 A;  3KOJ A;  3RNU A;  1IBL Q;  1BDO A;  1D6E C;  3GP7 A;  4MHE A;  2RDG A;  4HJ8 A;  3HOW H;  4JBM A;  2DNE A;  2K52 A;  4V0B A;  4XQJ A;  1E0B A;  1TII D;  3KDF B;  3HG9 A;  3NTI A;  5LL6 S;  2UUA L;  4A3B B;  4A3F G;  3CPW A;  3GTL H;  4A3G G;  1CZW A;  1G29 1;  4A3E H;  1A62 A;  1PTO H;  2Z4I A;  1H9S B;  1BNZ A;  2HIV A;  2B2W C;  3ONA B;  4MZ9 A;  1VMC A;  2UU9 Q;  1ZYR C;  1FJG L;  2MNA A;  1HNZ L;  5IGG A;  1IBM Q;  3H0G H;  5GAE C;  2VB2 X;  2ZTC A;  3KLS A;  4B3S L;  1IBK Q;  5FLX E;  1K0R A;  2K03 A;  1QIL A;  3MXU A;  2NYZ D;  5C5L A;  2JA9 A;  4KJN A;  4IJL A;  1XNQ Q;  2JA8 H;  1UEB A;  1UE5 A;  4DXF A;  4DR7 L;  3PUW A;  3D4W A;  4UP7 A;  1A2T A;  2N88 A;  3M85 A;  3A7L A;  4L6T B;  2IJ0 A;  1CUK A;  3BU2 A;  1J5E L;  1I3Q B;  1K83 B;  4JK1 C;  4C3I H;  4OWX B;  3K80 C;  2B2U C;  1VCI A;  2NVT B;  1ILQ A;  3TSS A;  1D8L A;  4KD3 A;  5C6A A;  1G6P A;  2N49 A;  3UDI A;  1CKM A;  2MGS A;  2EJM A;  4F7X A;  1XPO A;  4F88 A;  1QCB D;  2OTL A;  2AQ1 B;  5IP7 H;  1Q12 A;  1IYJ B;  3VDY A;  1JT8 A;  2FFK B;  1HQM C;  2NVX H;  3I4N B;  2VL6 A;  4HSV A;  1YNJ D;  1VQO A;  1C7Y A;  3H3V I;  1H9K A;  1CZG A;  4ZAI A;  4JOI A;  4JV5 L;  4FXG C;  3VA7 A;  4Q0F A;  1WVL A;  3TEH B;  2O5J C;  2CCZ A;  2K4K A;  2LXK A;  2NVY B;  5I6W A;  5IOD A;  4JYA L;  4C1N I;  3BDC A;  4JI3 L;  2XSC A;  4YHH L;  4ZLT F;  1ET6 A;  4DN4 M;  1EQV A;  1C0A A;  3S9W A;  4IUU A;  2EY6 A;  3I4O A;  4XXE A;  3V96 A;  2XRQ D;  4IUV A;  1X9N A;  2UXC Q;  2IL8 A;  4LJZ C;  2NZO A;  3FHW A;  5M3F B;  1PLF A;  5IOC A;  1HFG A;  1FNW A;  4JG2 A;  1S4Z A;  2CH4 A;  1SXT A;  5LMN W;  1Q1E A;  4DR3 Q;  5IGC A;  4R4T A;  4RAU C;  1HR0 Q;  5KYL A;  3I4N G;  4B3R L;  1N33 Q;  1KRT A;  3VA5 A;  1SN8 A;  4QIW B;  2F0K A;  3GTJ H;  4NXN Q;  3A5Z B;  2EXZ A;  4KY7 A;  3PSI A;  3NTK A;  4TKO B;  2K1B A;  3PV0 A;  4L5T A;  2F52 A;  3STB C;  5G3L F;  1TS2 A;  1V1P B;  4YCW A;  1ML0 D;  1HNX L;  4TRD A;  2NB0 A;  1X65 A;  2G9H D;  3MEH A;  5TSS A;  4Y52 H;  4KTA A;  1YJW A;  2V4D A;  4C2M B;  4DV4 L;  5FLX c;  2IX3 A;  3URY A;  4RWS C;  1HXY D;  1W6J A;  2OCE A;  1TU2 B;  1AE2 A;  4MTK A;  4A76 A;  1HJP A;  1EIH A;  3VYS A;  1JMC A;  4RKL A;  1YEZ A;  1MD2 D;  1L1O B;  2OQK A;  1Q7Y C;  3GO5 A;  2F0I A;  4FDB A;  1LYL A;  2FHT A;  3W1B A;  1E3P A;  1H95 A;  2QCP X;  4ME3 A;  1BUV T;  2RF4 A;  1Y1W H;  4DXG A;  4Y7N B;  4A3D B;  5JJK A;  4O42 A;  2Z6K A;  4BY7 G;  3T51 B;  2EYO A;  2PNH A;  1XXG A;  1K9M C;  1E22 A;  5I2X A;  4FF2 A;  2QA4 A;  2OWO A;  3K57 A;  2JN4 A;  1I6V C;  1L0Y B;  4DR2 L;  1G2S A;  3I7F A;  1KNE A;  2NVT H;  4DR1 L;  1BCP C;  1HZA A;  1SYC A;  4KHV A;  1I4G A;  5LMU Q;  4LFA Q;  3R8B A;  5C4X B;  2ICI A;  3HOY G;  4QIW E;  2IPK D;  4KKT A;  5E1F A;  4R4O A;  4B9W A;  1SAP A;  2WFW A;  4GLV B;  3MA2 B;  1EWC A;  3JAM L;  1OXS C;  3A74 A;  1WTO A;  3VYU A;  1HZ9 A;  5I6Y A;  1LO5 D;  1STA A;  4X66 L;  1KAA A;  1JWU D;  3E0E A;  3HOZ H;  1IYU A;  3ND9 A;  1V9P A;  4G57 A;  1YNN C;  4EQN A;  1PZJ D;  1XNQ L;  1RHP A;  4A3I G;  3CC4 A;  1K8M A;  4NKL A;  1H9J A;  2QDB A;  4UPA A;  3DWA A;  2JA5 B;  3A8I E;  5GAD C;  2B2T A;  5CBA E;  3TDQ A;  1WYD A;  1E1T A;  3D31 A;  3UE1 A;  2JSO A;  1XNR Q;  4I65 A;  4CDD C;  1MGS A;  3S2H B;  2N3S A;  2PYK A;  1WTX A;  4IUR A;  1E2V A;  5M3F H;  3EN2 A;  1GO3 E;  4JI0 Q;  1NMF A;  4RGM A;  5CR3 A;  1JOQ A;  2K5V A;  1PXU A;  3CAM A;  5EGT A;  2A6E D;  2HQL A;  1XYI A;  4A93 G;  4YWL A;  4A3K H;  3TP7 A;  2A68 D;  2Z4H A;  4DUY Q;  1S40 A;  3KF8 B;  3BDO A;  1B3Q A;  2NVQ B;  1DOL A;  3R2T A;  2R93 B;  5J39 A;  1XTC D;  4DV1 Q;  1QZG A;  2A69 D;  1TWG B;  4PG3 A;  3I73 A;  1STY A;  3J7A F;  3CCJ A;  2UXC L;  1F9S A;  1HCZ A;  3WDN A;  1SMX A;  4RA8 A;  2A6H D;  1BOS A;  5E3F A;  2TSS A;  5IWA L;  4FNF A;  3U9O A;  3RLO A;  4A3J G;  1SE8 A;  5C4J B;  3DMU A;  3T1H L;  2Z6K C;  1KLU D;  2VQF Q;  1AW7 A;  1OXT A;  3PIO 3;  1FGU A;  3PIP 3;  3K58 A;  3RZD B;  5EPJ A;  1YZ6 A;  2PNR C;  5KNB A;  5IT9 c;  2Q8T A;  1I50 B;  2AMC B;  5I9P A;  1QVF A;  3RZO H;  2D9U A;  1PYW D;  1DOM A;  5JEA J;  1FR3 A;  2NTT A;  4ID6 A;  2A5H A;  1SND A;  4PQX A;  3VR2 A;  5CV4 A;  4Y7N H;  2F0N A;  1PMR A;  4GLA C;  3GDE A;  2A1A A;  1JOR A;  4UP8 A;  4C3J B;  5J22 A;  4HIO A;  3DUZ A;  2N78 A;  3OIQ A;  1EL0 A;  4LF4 Q;  3TME A;  2YTV A;  2JEB I;  2KJX A;  4BBR G;  1VQF A;  4OXP A;  1NAP A;  1T5E A;  3HOU H;  4KJO A;  1EQQ A;  2JXM B;  3J81 i;  1Q3L A;  1U4M A;  4JI8 L;  4F8M A;  4K0K L;  3K5M A;  4JBJ A;  3FEW X;  1I4H A;  4LF8 Q;  1IW7 D;  1VQM A;  1A0I A;  1KLG D;  3D0F A;  5HY6 A;  2Q2T A;  3DEP A;  3BG3 A;  2UUC L;  3RUZ A;  2LFN A;  4TSS A;  3W2D A;  1Z7T A;  3F2D A;  4A3C H;  2MQH A;  3P7J A;  1Z47 A;  1VQL A;  2VY3 A;  2NBF A;  3VR6 A;  3F2C A;  1P16 A;  4OWW B;  3M3Y H;  4G7Z C;  4XDX A;  1KIX A;  2EYJ A;  3A0J A;  1GUN A;  1VQI A;  1ENA A;  3NWT A;  4QMG A;  2D2C C;  3C2P A;  4QCL A;  3GV3 A;  5DAU A;  4X65 Q;  5C0X H;  2JQO A;  2WKD A;  2ZJP A;  1LTL A;  2Y0S B;  3KDF A;  5AJ3 L;  1SJH D;  1EFI D;  1SNP A;  2DNC A;  2UUB L;  2L9H A;  5CYU A;  4DAY B;  3MEF A;  1Y1V H;  5EJW A;  1YHB A;  1N9W A;  3IL8 A;  1MIU A;  1PRT C;  1PYB A;  4DF7 A;  2K28 A;  1D1I A;  2KED A;  3G4S A;  4IOC A;  2C35 B;  1OXX K;  2KVM A;  4KD4 A;  5M5W B;  4IUT A;  3P1H A;  3GTO H;  3HP3 A;  3NEM A;  2BE5 D;  3NTH A;  1KD1 C;  2PW7 A;  4OWT B;  2CW0 D;  4C3H H;  4KHP Q;  3B6Y A;  3AB9 A;  3I4M B;  4BWG B;  1X3G A;  3EFX D;  4FF3 A;  2F0Q A;  3OW7 A;  1WCM B;  4RH6 A;  3HRZ C;  3I3C A;  5BN5 A;  4IUP A;  3J7A 5;  3J7Y W;  2NZ1 D;  4P71 A;  2XN9 C;  2K05 A;  2RHS B;  2VUM B;  1PH7 A;  1Y8O B;  3NHH A;  4NMZ A;  5A35 A;  3CCU A;  2KEN A;  1TWG H;  1PH8 A;  2NZH A;  1WTW A;  2JEA I;  3N6R A;  2QKI C;  4JI6 Q;  2L15 A;  3I70 A;  4A3M G;  4GN3 B;  1FNV A;  1LT3 D;  3ZYY X;  2HD3 A;  3MFG A;  4MNO A;  1GOZ A;  3PO3 G;  2HDL A;  5M3M G;  4JW0 A;  1C48 A;  3EBE A;  4QJF A;  3JC6 6;  5JPM C;  3KLS X;  1DGS A;  4KMU C;  2L11 A;  1L2F A;  2M00 A;  3QOL A;  1W6K A;  3A8K E;  4HR7 B;  2AWO A;  2NWG A;  3OMC A;  1ICF B;  5FLM H;  2Y0S E;  1TS3 A;  3GTM B;  2JA6 B;  3NBH A;  4DR6 L;  3CQZ H;  2B3G A;  4DV6 Q;  4GZY C;  4LF6 Q;  4LF7 Q;  1Y14 B;  2G5D A;  3Q6S A;  3Q8D A;  4C3J H;  2WII B;  3KLW A;  2EYP A;  2WAQ G;  1ONL A;  3J80 L;  4PNY A;  1Z6H A;  3CC7 A;  2B2W A;  3KYH C;  4XYQ A;  2OXP A;  4RCN A;  3WOF A;  3PGZ A;  5IIF A;  3S1M B;  1EEI D;  2EYH A;  5ELN A;  1TWF B;  1HUN A;  1XMO Q;  2OT2 A;  1M4V A;  2EY1 A;  1ZYR D;  2CH4 W;  3ERO A;  1HPC A;  4H13 C;  3IFT A;  3MXN A;  2MP1 A;  3FMC A;  2EY5 A;  4YWM A;  5GAG C;  3T1Y L;  5K36 G;  4B3T Q;  2CVR A;  1SSO A;  2AQ3 B;  3J81 E;  1HA6 A;  4DV0 Q;  1VQ7 A;  4KKU A;  2E2H H;  3UDF A;  2ZXR A;  3HOW G;  2B63 B;  5DLQ E;  3IAY A;  2B2U A;  1LTB D;  2KHJ A;  4HCE A;  4JI1 L;  3D3R A;  2TMP A;  2IWH A;  3TZD A;  3S1N B;  3OOC A;  3U50 C;  5NUC A;  2E74 C;  2X69 A;  5J1Z A;  5IYB H;  1V1P A;  2R92 B;  1QNU A;  4LF4 L;  1K8A C;  2RHQ B;  1J8I A;  2I46 A;  3G6J B;  4A3E G;  1XPR A;  1CHP D;  4A4I A;  4CKB A;  4JVZ A;  2R7F A;  1RJT A;  1FL0 A;  1TVX A;  1LTI D;  3FKI G;  1E2W A;  3KBG A;  2F4V L;  3MFY A;  1TWC B;  4HID A;  2K75 A;  3RLF A;  1SNC A;  1ET9 A;  3H0G G;  3W1G A;  1PH3 A;  3OTO Q;  1K3B C;  3K6O A;  4OHJ A;  4HMI A;  4APV A;  4A3F B;  3M4O B;  5EPK A;  3KFU A;  2K01 A;  4DV5 Q;  2A8V A;  5C3E H;  4A3G B;  4NP5 A;  5C44 H;  3FVQ A;  2LY7 A;  3N52 A;  2H1E A;  4X64 Q;  4G4K A;  4DV3 L;  3S15 B;  1CSQ A;  4ODG A;  4CJ2 C;  1S3O A;  2JA8 G;  3K0Y A;  1EEF D;  4KI0 A;  1B1Z A;  4OX9 Q;  2I5L X;  3RLN A;  1V8Q A;  2PO4 A;  4C1N K;  2H5X A;  1K3R A;  4WJ4 A;  1P8L A;  4DK1 A;  3CW2 C;  4C3I G;  4QF4 A;  5ELF A;  1NJI C;  3HKZ G;  1A6X A;  2HCI A;  1WFQ A;  4DAP A;  1S5E D;  1GUO A;  4IFD J;  4GNX B;  3S2D H;  3PIP A;  4TQU S;  4GKJ Q;  3LNN A;  4JI7 Q;  4IZ8 A;  4LFC Q;  3PCO B;  1HUM A;  3PO2 H;  4QUF A;  2VQE L;  1X54 A;  4RFB A;  1QG7 A;  3EA6 A;  2FIN B;  4B08 A;  2ZXP A;  3R2I A;  2YTX A;  5IP7 G;  3GTK B;  5D14 A;  1SYE A;  1LT5 D;  2E2I B;  2B2Y A;  3J80 i;  4O2D A;  2ZJQ A;  1JOK A;  2WAC A;  3KK7 A;  3L7Z C;  1TY0 A;  2F03 A;  4LNQ A;  2R7Z H;  4X3K A;  2WP8 J;  4KN7 C;  4LF9 L;  1H9M A;  1KXL A;  1JIC A;  2X6G A;  1PFS A;  5FO9 B;  5EKI A;  1KAW A;  4BBS H;  1UAP A;  2SDF A;  2EYM A;  3STB D;  1SJE D;  2RSO A;  3H15 A;  3U4V A;  4IOA A;  3NXW A;  1DD2 A;  2UXB L;  3JAM c;  4RG1 A;  4DV2 Q;  4X3U A;  3W3A A;  5M9O A;  4KN4 C;  5EPL A;  3TN2 A;  1SFO B;  4CDC C;  3KJP A;  1DYQ A;  3E3X A;  4ZUJ A;  4DUZ L;  4K14 A;  1YVC A;  2F0W A;  2Z8L A;  4A3L H;  4MTN A;  4CDE C;  5IE8 A;  5ELB A;  3R3O A;  3P75 A;  1NCV A;  2MO0 A;  3L2P A;  1N34 L;  1EWI A;  1CT1 D;  4AQY Q;  1XPU A;  4UAI A;  3AU7 A;  1CFM A;  2XTI A;  2OTJ A;  1FVI A;  2RQX A;  1WTV A;  3SK6 A;  4YY3 Q;  3S16 H;  2B63 H;  3KF8 A;  4JI2 Q;  4IFD H;  4RHS A;  3EJI A;  5CC4 A;  4ZCK A;  3VYR A;  4R8I A;  2KEE A;  4LF5 L;  2LS0 1;  4HAE A;  2PPB C;  4JBW A;  4GN5 A;  1GUT A;  3K59 A;  1NBW A;  1L1O C;  1RIP A;  5AFW A;  1BCP D;  1MHW C;  2PI2 E;  3SDZ A;  1II3 A;  5C3W A;  4QY7 A;  4JBK A;  4MN3 A;  3KF6 A;  3E9I A;  4MIU A;  4A3F H;  2WKC A;  5C0X I;  3L0O A;  4A3G H;  1PZI D;  2Q2I A;  3OWF A;  4LUO A;  4QGU A;  2E2J B;  1STH A;  1GUG A;  1LUZ A;  2CQA A;  3K0X A;  1MBY A;  4DKA C;  4BXX G;  1IXR A;  4H02 A;  4EGV A;  1Y1W G;  2BH8 A;  4IAL A;  2JA7 H;  2A74 C;  1BVS A;  1YNN D;  5COY A;  1EQT A;  2R6G A;  2BA0 A;  1N36 Q;  2ZXO A;  3M4Q A;  1AP0 A;  2L4N A;  2C5C A;  2HHH L;  3UE0 A;  5FK9 C;  2B2Y C;  4WJW A;  5ELO A;  4OO1 H;  1IL2 A;  2Q8I B;  4R4I A;  5ELD A;  2UXD Q;  2K33 A;  4J6H A;  1R9T B;  4BY7 B;  3MZ5 A;  2F1M A;  5JVG 3;  1QUQ B;  2KCT A;  1BO0 A;  3HZX A;  1GUS A;  2VZA A;  5EAY A;  1Q46 A;  4X62 L;  3GTK H;  1VF7 A;  2IHF A;  3TBI B;  1ZEQ X;  2F0T A;  3KJO A;  1QOH A;  3AQQ A;  3SK5 A;  2HT1 A;  4A3B H;  4N8X 1;  3MVV A;  4FXD A;  2CWA A;  3HOZ G;  3HOY B;  3NWS A;  4K5V A;  1SNO A;  2BH2 A;  1STE A;  5COR A;  2XRS D;  5IYC G;  4AIM A;  5I9O A;  5I2Y A;  5LMN Q;  5J3B A;  1X3E A;  2DY8 A;  5ELC A;  3J80 E;  2D62 A;  4K6L A;  3EIV A;  1VQ8 A;  4JPB W;  4HN7 A;  3R93 A;  4QQB X;  4A3I B;  2KBN A;  4DU9 A;  1JOO A;  2YTY A;  1A3U A;  1IBL L;  1SMY D;  1JJC B;  4DAY A;  3G6E A;  2JE6 I;  1DM0 B;  1EY5 A;  1D5M C;  1I4X A;  1I3Q H;  1QVG A;  3QWN A;  1V1O A;  1K83 H;  2DJF C;  2EE1 A;  3DLL A;  5JPN C;  1CA5 A;  4CJ0 B;  3HOX G;  4OEM B;  1ASZ A;  4A3K G;  1OTC A;  2E5L Q;  1AH9 A;  1VQA A;  4M1U B;  2UU9 L;  3MWY W;  3E6Z X;  2EJG C;  1JR0 D;  4LFB Q;  3J81 j;  1IBM L;  1LTS D;  4K2L A;  3QB3 A;  4Z9C B;  2PCF B;  3S14 B;  1LAB A;  1IBK L;  5GRO A;  3I4N H;  3BVG A;  4GKK Q;  1A15 A;  3AFQ A;  3IKJ A;  4A93 B;  3HOV G;  2KQ3 A;  3C3L A;  3CD6 A;  4YCV A;  3S1Q B;  1UUP A;  3BS1 A;  3J81 L;  4O1N A;  2F0D A;  2NVY H;  4R8N A;  1VQN A;  1ZXT A;  1F2Y A;  3U4Z A;  4ZK9 B;  4GS3 A;  1TQO A;  1HHV A;  4DV7 Q;  1D1K A;  1DXM A;  2JYO A;  2GA4 B;  1T9H A;  2J4X A;  1GKH A;  2KHI A;  3OMG A;  2OF1 A;  5HGQ A;  1NMG A;  2JJQ A;  4HJ5 A;  2DN8 A;  3OW2 A;  4A3J B;  2K5W A;  3CCV A;  5KEE A;  2QEX A;  4P74 A;  1WJJ A;  4X3T A;  1N32 Q;  3Q24 A;  4HJ7 A;  1NUC A;  1OXU A;  2L12 A;  1KC8 C;  3M4Y A;  3AEV A;  1O7L A;  4ILW A;  4K2K A;  1XWE A;  1VQC A;  4JI5 Q;  2WB1 G;  5IGB A;  1PTO D;  1EOT A;  3MXP A;  1HNW Q;  1PFB A;  3HOU G;  3DXJ C;  1UEA B;  1X55 A;  4DAM A;  1R9T H;  5CV5 A;  2PZT A;  3VR4 A;  4YIJ A;  3W5O A;  4BBR B;  4O0A A;  1PRT D;  5IGE A;  3CCS A;  4HJA A;  3A56 A;  3RR5 A;  3PUY A;  3I56 A;  2ID0 A;  3G7L A;  4A3C G;  3J80 c;  4C2M H;  3LGJ A;  3EVQ A;  1U4L A;  1I6H B;  2NN6 H;  1Y69 U;  4PZ6 A;  4PZ7 A;  4POF A;  1PH9 A;  3K81 C;  1STN A;  4DR3 L;  2EVB A;  5C0X G;  3K7A B;  1HR0 L;  1AEX A;  1CI3 M;  1N33 L;  2HIX A;  2F0G A;  4LW1 A;  1YBY A;  3GQB A;  3S17 B;  4NXN L;  3C46 A;  1RCV D;  1CKN B;  1Y1V G;  4CKE A;  4A3D H;  3NBI A;  2VB3 X;  1SNM A;  1D5X C;  1F2L A;  1JB3 A;  1J9O A;  5FJ8 G;  2EJF C;  1VQ9 A;  4P73 A;  1A8V A;  1KTK A;  5BR8 Q;  4U68 A;  3EQL C;  3GTG B;  4C3H G;  3RN5 A;  1HH2 P;  4FF1 A;  1O78 A;  5KNC A;  4XIG S;  1E7Z A;  1E2Z A;  3CU7 A;  3MHB A;  5C4X H;  1AZQ A;  1O7Z A;  1EY7 A;  3LWU A;  2ZM6 Q;  4DR4 Q;  4RHR A;  2BA1 A;  3IRB A;  1PHJ A;  4H44 C;  1VQH A;  2I5M X;  1C8C A;  3S14 H;  1XTD A;  3I8Z A;  2O4X A;  2KCM A;  1CSP A;  4BY1 G;  1Y8N B;  1VS0 A;  2Z6B A;  5EBC A;  1B9M A;  5IY0 A;  1L0X B;  1EYG A;  1B8A A;  2D5D A;  4UY8 C;  1CM9 A;  1KDA A;  2RSN A;  5C3X A;  3AMU A;  3S24 A;  1K0S A;  5FKA C;  3E5S A;  3E0J A;  3H94 A;  3CCQ A;  2JA5 H;  4NXM Q;  4IPD A;  3I55 A;  1EY8 A;  5FOB B;  5LMU L;  4LFA L;  4P2C B;  5JAV A;  1ICW A;  5C5M A;  4A3M B;  3S2H H;  4A3J H;  2CQO A;  5FLM G;  1H9S A;  2PI2 A;  2ZTE A;  1KL9 A;  3PO3 B;  5M3M B;  4DR5 Q;  1EIY B;  1SYB A;  3CHB D;  2ES2 A;  1TXY A;  2F4I A;  3MTS A;  1X56 A;  3K5L A;  2A68 C;  5FO8 B;  5JEA H;  1ILP A;  3A8J E;  1IZ6 A;  2OQ0 A;  2RCF A;  1VQK A;  1PTO F;  1YJN A;  2A69 C;  5IP9 G;  1DOK A;  1EZ8 A;  4CHT B;  2K5Q A;  3D4D A;  1PH4 A;  1TT2 A;  2NVQ H;  1DZ1 A;  4B3M Q;  1G8Z D;  2I07 B;  2WAQ B;  2R93 H;  2A6H C;  1PVO A;  1MJE A;  4BBR H;  3PUV A;  3FPP A;  5E4W C;  4RKB A;  4ME5 A;  1KQS A;  3QOJ A;  4WRD A;  1XNR L;  4DK3 C;  2M9V A;  1F9P A;  1HNZ Q;  3CRL C;  3TP5 A;  1LTA D;  4JI0 L;  1B2T A;  1S72 A;  1I6H H;  4B3S Q;  3SGI A;  5C4J H;  2Z1C A;  1EIG A;  1EIF A;  4DK0 A;  2EY2 A;  5IYB G;  3O13 A;  1SE2 A;  2RA4 A;  4KKS A;  1ASY A;  4YWK A;  3RZD H;  3K7A H;  1B70 B;  2N8N A;  4DR7 Q;  3UDX A;  4KK7 A;  1I50 H;  1NE3 A;  3OSO A;  2F0U A;  1I94 Q;  3S17 H;  3HOW B;  2HDM A;  4DUY L;  1KRS A;  4XQN A;  3ULP A;  2JK8 A;  5EQ0 A;  3FPU B;  1NSN S;  3OWE B;  1LTT D;  1STB A;  1FNU A;  4DV1 L;  1E1O A;  5IYD G;  3GTL B;  2F0J A;  2E8G A;  5C3E G;  2QW7 A;  3FRP B;  4A3E B;  1I4R A;  3A7A B;  1PTO B;  5C44 G;  3BVM A;  3NE5 B;  4EQP A;  2RCN A;  3GTG H;  1EYC A;  2B29 A;  3FKI B;  1IW7 C;  2X6L A;  1DCZ A;  1T5X D;  4NW2 A;  1CK1 A;  2AWN A;  3H0G B;  1QB5 D;  2QF7 A;  3SVM A;  4IPC A;  4GNX C;  1K28 A;  4ALP A;  2VQF L;  4YCU A;  1GUW A;  1X6O A;  2EYF A;  2JA8 B;  4S3S A;  4JV5 Q;  4RGT A;  1WTP A;  1Z9F A;  2WAQ E;  4LUZ A;  2KCC A;  1EZ6 A;  1PFN A;  1UE1 A;  3PO2 G;  3HFZ B;  1YIJ A;  1F2Z A;  4JYA Q;  2QIL A;  4YHH Q;  4FO2 A;  5LHY 1;  1I4P A;  4C3I B;  4IO9 A;  1DJR D;  1B3A A;  1ENC A;  3HKZ B;  2J7Z A;  1YNX A;  4HED A;  1NR4 A;  4ZUI A;  2DUD A;  2R7Z G;  2CWP A;  1EQR A;  4ZKC B;  4J1M A;  1IKM A;  2CHB D;  4LUV A;  2WV6 D;  4KLK A;  5E4X A;  5I4D A;  4AYB G;  2BDO A;  2C9O A;  3OPO A;  4BBS G;  4LF8 L;  3BZD B;  2CW0 C;  3PF4 A;  1Q8I A;  1TWH B;  2K6A A;  4B3R Q;  3GD7 A;  4EVO A;  5M5W H;  2F0V A;  2F3V A;  4HMJ A;  1WD0 A;  3S1R B;  1IKL A;  2B39 A;  3D4R A;  3SK8 A;  5JJL A;  1L1O A;  3X3N A;  4EX5 A;  4J8Q A;  4IN3 A;  3PQI A;  3OYY A;  3I4M H;  5BN3 A;  1WTH A;  1NTG A;  1WCM H;  4L5S A;  2K04 A;  4CJ1 B;  3ULJ A;  1AFP A;  1Q8K A;  1HNX Q;  3K5N A;  1Q86 C;  1VQE A;  2VUM H;  5CV9 A;  3L3O C;  4NXM L;  2NUC A;  4X65 L;  1V1Q A;  3DWQ A;  4DV4 Q;  1S5F D;  3PIO A;  1SEB D;  1NR2 A;  2XGT A;  2MPM A;  4IPG A;  5T1I A;  1QVC A;  2GVB A;  2QDL A;  1O7I A;  1A3V A;  1PH6 A;  3PUZ A;  1W3S A;  4K6D A;  5L37 A;  3DM1 A;  1EY6 A;  3GTJ B;  3HGB A;  3HKZ E;  2EYL A;  5H1S E;  4KHP L;  2ICE C;  1CQF A; 
#chains in the Genus database with same CATH homology
 1FYC A;  1KDC A;  1TKW B;  1GHK A;  4F87 A;  3D6C A;  1MSH A;  1BF4 A;  2NN6 I;  3SHL A;  2F0H A;  3ND8 A;  2HUG A;  1B44 D;  3ERQ A;  5IGD A;  1A3T A;  4Q5V A;  4OIJ A;  2A73 B;  2XNA C;  1JCK B;  2DY7 A;  4K5X A;  2IW3 A;  4K8I A;  3GTP B;  3IFD A;  2EOT A;  3DHQ A;  5DM7 3;  2EPB A;  1PFM A;  5C4Z A;  3NPP A;  2AUK A;  3VR5 A;  1CA6 A;  1G6Z A;  2XVS A;  1TWA B;  3SXH A;  1JC7 A;  2HQE A;  4OO1 G;  2WIN B;  1Y1W B;  5T1G A;  3KLR A;  1IL8 A;  3BYT B;  5F2D A;  4PV1 C;  3TP6 A;  1H9R A;  3GTQ B;  4NDX A;  2M2L A;  5CV6 A;  5CGK A;  5JVH 3;  1SYF A;  3NQT A;  5LL6 X;  3I90 A;  5C4H A;  5ELE A;  4BA1 I;  5KND A;  1ZKO A;  1RD9 D;  2F0L A;  3HOZ B;  2ENB A;  5K5P A;  3D6W A;  1EU4 A;  3WOE A;  3K5O A;  3L9A X;  1D5Z C;  1KNA A;  4ABN A;  1CTM A;  2JP1 A;  1MI2 A;  4R9W A;  1WD1 A;  1RF2 D;  2B2V C;  2VNU D;  1ROD A;  4I7Z C;  1F77 A;  3QO2 A;  4G7H C;  1LV9 A;  2SNS A;  4N9T A;  3LWE A;  4ULL A;  1Q1B A;  5CBE E;  2KHS A;  3T16 A;  1LT4 D;  4K8J A;  3HOX B;  4FVM A;  1RKN A;  1X3P A;  4A3K B;  2AQ2 B;  3H3V C;  4V19 0;  4CKC A;  3C1F A;  1TY2 A;  3H91 A;  2OEO A;  1AZP A;  1G91 A;  1PZK D;  1K8O A;  1EYA A;  1I4Q A;  1RTN A;  1UNS A;  4LK1 C;  3HOV B;  4L8J A;  3LX0 A;  2LKV A;  1SE3 A;  2YU9 B;  3BYY B;  2SNM A;  3NP8 A;  2J0T D;  5JOB A;  1B53 A;  1SYD A;  4HCS A;  5ISR A;  5A2Q E;  1PDQ A;  3RZO B;  3NQI A;  4DAV A;  2KUM A;  2L1B A;  2YYZ A;  1LTG D;  1B9N A;  2SEB D;  1O7Y A;  3CKI B;  5M5X B;  1YNJ C;  2IT1 A;  1OO9 B;  2WB1 B;  5IT9 E;  2ZT9 C;  3T53 B;  4WOR A;  3HOU B;  2F0E A;  1SE4 A;  2LMC B;  1B4O A;  2FMC A;  1SBB B;  1Y8P B;  4XT3 B;  2XWJ B;  3FDT A;  2NN6 G;  3MXG A;  2F0P A;  3OHX C;  3KBX A;  1CHQ D;  1BCP F;  4CGY B;  3H6M A;  2BCO A;  5D3I B;  2O5I C;  1JE4 A;  4U67 3;  3PMF A;  3M3Y B;  1C4Q A;  4XYO A;  4ZQ3 A;  2E2D C;  4PMW A;  1HTL D;  3I4L A;  3Q22 A;  2PZW A;  1Y1V B;  2RVL A;  3CRK C;  2Q8R E;  4EQO A;  1BR9 A;  1LTR D;  3QJY A;  2F0S A;  5D65 A;  3GTO B;  2EZV A;  1FD7 D;  2G9D A;  1QE6 A;  4C3H B;  3TZU A;  5DM6 3;  1TS5 A;  1D2B A;  1XX8 A;  3A55 A;  5CV8 A;  2O2L D;  3VYT A;  1BCP B;  2PMZ B;  1G2T A;  1LT6 D;  2F0O A;  4BY1 B;  1EY0 A;  5IGF A;  5C0X J;  1SMY C;  2RDH A;  3U9S A;  5M5Y B;  3OIP A;  2IX0 A;  2RDF A;  1X32 A;  2MUY A;  1V43 A;  4UDU C;  1A2U A;  2B8G A;  2BOS A;  2BDN A;  2KA7 A;  2XWB B;  3NK9 A;  5JEA G;  3KUP A;  1BXT A;  2XIW A;  3J7A V;  1VDZ A;  2HCC A;  1EY4 A;  1VF5 C;  2F3W A;  3CQZ B;  4E6I A;  5KYI A;  4OL7 A;  1JQY D;  5FLX L;  3MC0 B;  2EDG A;  2B8F A;  1GXD C;  1S5D D;  4X3S A;  3Q0A A;  3VR3 A;  2E76 C;  3T13 A;  2IX1 A;  4BA2 I;  2K5D A;  2AUJ D;  1JWM D;  2FMM A;  4IFD I;  1HRJ A;  1JWS D;  4HTH A;  3H09 A;  2B2T C;  3I72 A;  1Q90 A;  5EKK A;  3M7N A;  2E2H B;  5BN4 A;  4DGZ A;  3PUX A;  1PTO C;  1AN8 A;  2A6E C;  1WTQ A;  1HFN A;  1LLR D;  1DON A;  4DNT B;  3QIA A;  4C3J G;  1EYD A;  4XT1 B;  1MSG A;  1BBX C;  3X3M A;  1R4P B;  1F9Q A;  2PZU A;  2VXW A;  1CQV A;  1HTP A;  2SOB A;  5HGT A;  1KDB A;  4ZKB B;  4C56 C;  1GHJ A;  3BVZ A;  4L63 B;  4PMB A;  1U4R A;  4KHZ A;  1TR5 A;  5C3E B;  1SNQ A;  4WFN 3;  5C44 B;  4QUC A;  2RBM A;  4OO1 I;  4N9P A;  3C1E A;  4BS9 A;  1ENF A;  4LAA A;  1PRT F;  1RTO A;  4IUQ A;  1S5B D;  1WTR A;  4LMQ D;  2L0C A;  2F0M A;  4IQZ A;  3GV6 A;  1QJO A;  4RGN A;  3A54 A;  3S2D B;  5EBD A;  3PO2 B;  3SR1 A;  3T56 B;  1SYG A;  4H0L C;  1QNK A;  3Q23 A;  2L5T A;  1TS4 A;  2RKS A;  2E75 C;  4HSP A;  5KRU A;  3V05 A;  1M8A A;  4KV6 A;  3DWP A;  3M7G A;  2R7Z B;  3P20 A;  1RDP D;  1KAB A;  3ITP A;  4M8A A;  4DNR B;  1FGB D;  4AYB B;  1U4P A;  4BBS B;  2QEJ C;  3DEO A;  1U9R A;  4FXK C;  1HQR D;  4RCO A;  5CV7 A;  1LAC A;  1PRT B;  5A2Q L;  3NUC A;  1EWH A;  3F2U A;  2H4O A;  1QWY A;  1F2M A;  5KIX A;  3BDL A;  5HUR A;  4DFA A;  5DNF A;  3I91 A;  1S5C D;  1ESF A;  3TP8 A;  3JAM E;  3SK4 A;  4ZYS A;  3UI2 A;  2NTS A;  5IT9 L;  1F9R A;  2K7V A;  2MHV A;  4KY5 A;  1EU3 A;  3NSW A;  3HS0 C;  5FO7 B;  5EKL A;  2KCN A;  4FF4 A;  2F0F A;  5CMD A;  1GJX A;  4IUN A;  4XTC S;  5JJZ A;  2R61 A;  2NVX B;  3S16 B;  2BE5 C;  2KOL A;  4FP5 D;  4B9X A;  2PW5 A;  2PQE A;  4K5W A;  4G7O C;  1B50 A;  3MAQ A;  1STG A;  4QB4 A;  4OGQ C;  2MJ8 A;  2K32 A;  4PMC A;  1O80 A;  3T4A C;  2N55 A;  1EY9 A;  4ZRZ A;  1OXV A;  1IHZ A;  4RGO S;  4KY6 A;  4FYD A;  2FJ2 A;  3SE0 A;  2KEC A;  1BQQ T;  4H7B A;  4CBV A;  2L55 A;  3D8G A;  3RD4 A;  4DA2 A;  1VMP A;  2R3Z A;  1ESR A;  2JA7 B;  1X3Q A;  4XQQ A;  3SEB A;  3HEJ A;  1HA5 A;  3RMH A;  4OIK A;  3QG1 A;  3V2T A;  2B2V A;  5DEH A;  4IFD G;  1R4Q B;  5G3L D;  5K36 H;  5KGU A;  1SDF A;  1IYV A;  5D3D A;  1BDO A;  1D6E C;  3GP7 A;  4MHE A;  2RDG A;  2DNE A;  4V0B A;  4XQJ A;  1E0B A;  1TII D;  3NTI A;  3HG9 A;  5LL6 S;  4A3B B;  1CZW A;  1G29 1;  1PTO H;  2Z4I A;  1H9S B;  1BNZ A;  2B2W C;  3ONA B;  1VMC A;  1ZYR C;  5IGG A;  2VB2 X;  3KLS A;  5FLX E;  2K03 A;  1QIL A;  3MXU A;  2NYZ D;  5C5L A;  4KJN A;  4DXF A;  3PUW A;  3D4W A;  1A2T A;  2N88 A;  3M85 A;  3A7L A;  4L6T B;  2IJ0 A;  1I3Q B;  1K83 B;  4JK1 C;  2B2U C;  1VCI A;  2NVT B;  1ILQ A;  3TSS A;  4KD3 A;  5C6A A;  2MGS A;  2EJM A;  4F7X A;  4F88 A;  1QCB D;  2AQ1 B;  1Q12 A;  2FFK B;  1HQM C;  3I4N B;  4HSV A;  1YNJ D;  1H9K A;  1CZG A;  4ZAI A;  4FXG C;  3VA7 A;  4Q0F A;  1WVL A;  2O5J C;  2NVY B;  5I6W A;  5IOD A;  4C1N I;  3BDC A;  2XSC A;  4ZLT F;  1ET6 A;  4DN4 M;  1EQV A;  3S9W A;  4IUU A;  2EY6 A;  4XXE A;  3V96 A;  2XRQ D;  4IUV A;  2IL8 A;  4LJZ C;  5M3F B;  1PLF A;  5IOC A;  1HFG A;  1FNW A;  1S4Z A;  1SXT A;  1Q1E A;  5IGC A;  4RAU C;  5KYL A;  3VA5 A;  4QIW B;  2F0K A;  2EXZ A;  4KY7 A;  3NTK A;  4TKO B;  2K1B A;  3PV0 A;  5G3L F;  1TS2 A;  1V1P B;  1ML0 D;  4TRD A;  2NB0 A;  2G9H D;  3MEH A;  5TSS A;  4KTA A;  2V4D A;  4C2M B;  2IX3 A;  3URY A;  4RWS C;  1HXY D;  1W6J A;  1TU2 B;  1EIH A;  3VYS A;  4RKL A;  1MD2 D;  3GO5 A;  2F0I A;  2FHT A;  2QCP X;  1BUV T;  4DXG A;  4Y7N B;  4A3D B;  4O42 A;  3T51 B;  2EYO A;  1XXG A;  5I2X A;  4FF2 A;  3K57 A;  1I6V C;  1L0Y B;  1G2S A;  1KNE A;  1BCP C;  4KHV A;  1SYC A;  1I4G A;  3R8B A;  5C4X B;  2ICI A;  2IPK D;  4KKT A;  5E1F A;  4B9W A;  1SAP A;  3MA2 B;  1EWC A;  3JAM L;  1OXS C;  1WTO A;  3VYU A;  5I6Y A;  1LO5 D;  1STA A;  1KAA A;  1JWU D;  1IYU A;  3ND9 A;  4G57 A;  1YNN C;  4EQN A;  1PZJ D;  1RHP A;  1K8M A;  4NKL A;  1H9J A;  2QDB A;  3DWA A;  2JA5 B;  3A8I E;  2B2T A;  5CBA E;  3TDQ A;  3D31 A;  2JSO A;  4I65 A;  1MGS A;  3S2H B;  2PYK A;  1WTX A;  4IUR A;  1E2V A;  4RGM A;  5CR3 A;  1JOQ A;  1PXU A;  5EGT A;  2A6E D;  1XYI A;  3TP7 A;  2A68 D;  2Z4H A;  3BDO A;  2NVQ B;  1DOL A;  3R2T A;  2R93 B;  5J39 A;  1XTC D;  2A69 D;  1TWG B;  3I73 A;  1STY A;  3J7A F;  1F9S A;  1HCZ A;  3WDN A;  4RA8 A;  1BOS A;  2A6H D;  5E3F A;  2TSS A;  4FNF A;  3U9O A;  5C4J B;  3DMU A;  1KLU D;  1AW7 A;  1OXT A;  3PIO 3;  3PIP 3;  3K58 A;  3RZD B;  5EPJ A;  5KNB A;  2PNR C;  2Q8T A;  1I50 B;  5I9P A;  2D9U A;  1PYW D;  1DOM A;  5JEA J;  1FR3 A;  2NTT A;  4ID6 A;  2A5H A;  1SND A;  4PQX A;  3VR2 A;  5CV4 A;  2F0N A;  1PMR A;  1JOR A;  4C3J B;  5J22 A;  3DUZ A;  3OIQ A;  1EL0 A;  3TME A;  2JEB I;  2KJX A;  1NAP A;  1T5E A;  4KJO A;  2JXM B;  1Q3L A;  1U4M A;  4F8M A;  3K5M A;  3FEW X;  1I4H A;  1IW7 D;  1KLG D;  3DEP A;  3BG3 A;  3RUZ A;  2LFN A;  4TSS A;  3W2D A;  1Z7T A;  3P7J A;  1Z47 A;  2NBF A;  3VR6 A;  4G7Z C;  4XDX A;  2EYJ A;  1GUN A;  1ENA A;  3NWT A;  4QMG A;  2D2C C;  3C2P A;  4QCL A;  3GV3 A;  5DAU A;  5C0X H;  2WKD A;  2Y0S B;  1SJH D;  1EFI D;  1SNP A;  2DNC A;  2L9H A;  5CYU A;  5EJW A;  3IL8 A;  1PRT C;  4DF7 A;  2K28 A;  1D1I A;  2KED A;  1OXX K;  2KVM A;  4KD4 A;  5M5W B;  4IUT A;  3P1H A;  3HP3 A;  2BE5 D;  3NTH A;  2PW7 A;  2CW0 D;  3AB9 A;  3I4M B;  4BWG B;  3EFX D;  4FF3 A;  2F0Q A;  3OW7 A;  1WCM B;  4RH6 A;  3HRZ C;  3I3C A;  5BN5 A;  4IUP A;  3J7Y W;  2NZ1 D;  2XN9 C;  2K05 A;  2VUM B;  1Y8O B;  3NHH A;  4NMZ A;  5A35 A;  1WTW A;  2JEA I;  3N6R A;  2QKI C;  3I70 A;  1FNV A;  1LT3 D;  3ZYY X;  3MFG A;  1GOZ A;  2HDL A;  1C48 A;  5JPM C;  3KLS X;  4KMU C;  2L11 A;  2M00 A;  3QOL A;  1W6K A;  3A8K E;  4HR7 B;  2AWO A;  2NWG A;  3OMC A;  1TS3 A;  3GTM B;  2JA6 B;  3NBH A;  4GZY C;  3Q6S A;  2WII B;  2EYP A;  1ONL A;  3J80 L;  4PNY A;  1Z6H A;  2B2W A;  4XYQ A;  2OXP A;  4RCN A;  3WOF A;  5IIF A;  3S1M B;  1EEI D;  2EYH A;  1TWF B;  1HUN A;  2OT2 A;  1M4V A;  2EY1 A;  1ZYR D;  3ERO A;  1HPC A;  4H13 C;  3IFT A;  3MXN A;  2MP1 A;  3FMC A;  2EY5 A;  5K36 G;  2CVR A;  1SSO A;  2AQ3 B;  3J81 E;  1HA6 A;  4KKU A;  2ZXR A;  2B63 B;  3IAY A;  2B2U A;  1LTB D;  4HCE A;  3TZD A;  3D3R A;  2TMP A;  2IWH A;  3S1N B;  3OOC A;  5NUC A;  5J1Z A;  2E74 C;  2X69 A;  1V1P A;  2R92 B;  1QNU A;  1J8I A;  2I46 A;  3G6J B;  1CHP D;  4CKB A;  1RJT A;  1TVX A;  1LTI D;  1E2W A;  3KBG A;  3MFY A;  1TWC B;  3RLF A;  1SNC A;  1ET9 A;  3K6O A;  4OHJ A;  4HMI A;  3M4O B;  4A3F B;  5EPK A;  2K01 A;  4A3G B;  4NP5 A;  3FVQ A;  2LY7 A;  3N52 A;  2H1E A;  4G4K A;  3S15 B;  4ODG A;  4CJ2 C;  3K0Y A;  1EEF D;  4KI0 A;  1B1Z A;  1V8Q A;  2PO4 A;  4C1N K;  4DK1 A;  4C3I G;  4QF4 A;  5ELF A;  1A6X A;  2HCI A;  4DAP A;  1S5E D;  1GUO A;  4IFD J;  4TQU S;  3LNN A;  4IZ8 A;  1HUM A;  4QUF A;  4RFB A;  1QG7 A;  3EA6 A;  2FIN B;  4B08 A;  2ZXP A;  3R2I A;  3GTK B;  5D14 A;  1SYE A;  1LT5 D;  2E2I B;  2B2Y A;  1JOK A;  2WAC A;  3KK7 A;  3L7Z C;  1TY0 A;  2F03 A;  4X3K A;  2WP8 J;  4KN7 C;  1H9M A;  1JIC A;  2X6G A;  5FO9 B;  5EKI A;  1UAP A;  2SDF A;  2EYM A;  1SJE D;  2RSO A;  3NXW A;  1DD2 A;  4X3U A;  3W3A A;  5M9O A;  4KN4 C;  5EPL A;  3TN2 A;  1SFO B;  1DYQ A;  4ZUJ A;  4K14 A;  2F0W A;  2Z8L A;  5ELB A;  3R3O A;  3P75 A;  1NCV A;  1CT1 D;  4UAI A;  3AU7 A;  1CFM A;  2RQX A;  1WTV A;  3SK6 A;  3KF8 A;  4IFD H;  4RHS A;  3EJI A;  5CC4 A;  3VYR A;  4R8I A;  2KEE A;  2LS0 1;  4HAE A;  2PPB C;  4JBW A;  1GUT A;  3K59 A;  5AFW A;  1BCP D;  3SDZ A;  1II3 A;  5C3W A;  4MN3 A;  4MIU A;  2WKC A;  5C0X I;  1PZI D;  3OWF A;  2E2J B;  1STH A;  1GUG A;  2CQA A;  1MBY A;  4EGV A;  4IAL A;  2A74 C;  1YNN D;  5COY A;  1EQT A;  2R6G A;  2BA0 A;  2ZXO A;  1AP0 A;  2L4N A;  2C5C A;  5FK9 C;  2B2Y C;  4WJW A;  4OO1 H;  2Q8I B;  5ELD A;  2K33 A;  4J6H A;  1R9T B;  4BY7 B;  3MZ5 A;  2F1M A;  5JVG 3;  3HZX A;  1BO0 A;  1GUS A;  1VF7 A;  3TBI B;  1ZEQ X;  2F0T A;  1QOH A;  3SK5 A;  3MVV A;  4FXD A;  3HOY B;  3NWS A;  4K5V A;  1SNO A;  1STE A;  5COR A;  2XRS D;  5I9O A;  5I2Y A;  2DY8 A;  5ELC A;  3J80 E;  2D62 A;  4K6L A;  4HN7 A;  3R93 A;  4A3I B;  4DU9 A;  1JOO A;  1A3U A;  1SMY D;  4DAY A;  2JE6 I;  1DM0 B;  1EY5 A;  1D5M C;  1I4X A;  3QWN A;  1V1O A;  2EE1 A;  5JPN C;  1CA5 A;  4CJ0 B;  4M1U B;  3MWY W;  3E6Z X;  2EJG C;  1JR0 D;  1LTS D;  4K2L A;  3QB3 A;  4Z9C B;  2PCF B;  3S14 B;  1LAB A;  3BVG A;  1A15 A;  3IKJ A;  4A93 B;  2KQ3 A;  3C3L A;  3S1Q B;  1UUP A;  3BS1 A;  3J81 L;  4O1N A;  2F0D A;  4R8N A;  1ZXT A;  1F2Y A;  4ZK9 B;  1TQO A;  1HHV A;  1D1K A;  1DXM A;  2JYO A;  2GA4 B;  2J4X A;  3OMG A;  2OF1 A;  2DN8 A;  4A3J B;  2K5W A;  5KEE A;  4X3T A;  3Q24 A;  1NUC A;  1OXU A;  2L12 A;  3M4Y A;  1O7L A;  4ILW A;  4K2K A;  1XWE A;  5IGB A;  1PTO D;  1EOT A;  3MXP A;  1PFB A;  3DXJ C;  1UEA B;  5CV5 A;  2PZT A;  3VR4 A;  4YIJ A;  4BBR B;  1PRT D;  5IGE A;  3A56 A;  3PUY A;  2ID0 A;  3G7L A;  3EVQ A;  1U4L A;  1I6H B;  2NN6 H;  1Y69 U;  1STN A;  2EVB A;  5C0X G;  3K7A B;  1AEX A;  1CI3 M;  2F0G A;  3GQB A;  3S17 B;  3C46 A;  1RCV D;  4CKE A;  3NBI A;  2VB3 X;  1SNM A;  1D5X C;  1F2L A;  1JB3 A;  1J9O A;  2EJF C;  1KTK A;  4U68 A;  3EQL C;  3GTG B;  4C3H G;  4FF1 A;  1O78 A;  5KNC A;  4XIG S;  3CU7 A;  1E2Z A;  3MHB A;  1AZQ A;  1O7Z A;  1EY7 A;  3LWU A;  4RHR A;  2BA1 A;  4H44 C;  1C8C A;  3I8Z A;  2O4X A;  1Y8N B;  5EBC A;  1B9M A;  1L0X B;  2D5D A;  1CM9 A;  1KDA A;  2RSN A;  5C3X A;  3AMU A;  5FKA C;  3E5S A;  3E0J A;  3H94 A;  1EY8 A;  5FOB B;  4P2C B;  5JAV A;  1ICW A;  5C5M A;  4A3M B;  1H9S A;  3PO3 B;  5M3M B;  1SYB A;  3CHB D;  2F4I A;  3MTS A;  3K5L A;  2A68 C;  5FO8 B;  5JEA H;  1ILP A;  3A8J E;  1PTO F;  2A69 C;  1DOK A;  1EZ8 A;  4CHT B;  2K5Q A;  3D4D A;  1TT2 A;  1DZ1 A;  1G8Z D;  2I07 B;  2WAQ B;  2A6H C;  3PUV A;  3FPP A;  5E4W C;  4RKB A;  4ME5 A;  3QOJ A;  4WRD A;  2M9V A;  1F9P A;  3CRL C;  3TP5 A;  1LTA D;  1B2T A;  2Z1C A;  1EIG A;  4DK0 A;  2EY2 A;  3O13 A;  1SE2 A;  2RA4 A;  4KKS A;  4KK7 A;  3OSO A;  2F0U A;  3HOW B;  2HDM A;  4XQN A;  5EQ0 A;  3FPU B;  1NSN S;  3OWE B;  1LTT D;  1STB A;  1FNU A;  3GTL B;  2F0J A;  3FRP B;  4A3E B;  1I4R A;  3A7A B;  1PTO B;  3BVM A;  3NE5 B;  4EQP A;  1EYC A;  3FKI B;  1IW7 C;  2X6L A;  1DCZ A;  1T5X D;  4NW2 A;  1CK1 A;  2AWN A;  3H0G B;  1QB5 D;  2QF7 A;  3SVM A;  1GUW A;  2EYF A;  2JA8 B;  4S3S A;  4RGT A;  1WTP A;  2KCC A;  1EZ6 A;  1PFN A;  1F2Z A;  2QIL A;  4FO2 A;  5LHY 1;  1I4P A;  4C3I B;  1DJR D;  1B3A A;  1ENC A;  3HKZ B;  2J7Z A;  4HED A;  1NR4 A;  4ZUI A;  4ZKC B;  4J1M A;  1IKM A;  2CHB D;  2WV6 D;  5I4D A;  5E4X A;  2BDO A;  2C9O A;  3OPO A;  3BZD B;  2CW0 C;  1Q8I A;  1TWH B;  2K6A A;  3GD7 A;  4EVO A;  2F0V A;  2F3V A;  4HMJ A;  1WD0 A;  3S1R B;  1IKL A;  2B39 A;  3D4R A;  3SK8 A;  3X3N A;  4J8Q A;  4IN3 A;  5BN3 A;  2K04 A;  4CJ1 B;  1AFP A;  3K5N A;  5CV9 A;  3L3O C;  2NUC A;  3DWQ A;  1S5F D;  1SEB D;  1NR2 A;  2MPM A;  5T1I A;  1A3V A;  3PUZ A;  4K6D A;  3DM1 A;  1EY6 A;  3GTJ B;  3HGB A;  2EYL A;  2ICE C;  1CQF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...