4RKBA

Crystal structure of staphylococcal nuclease variant delta+phs v66t/v99t at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMTENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMTNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Cavities in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2014-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rkbA00
3MEHA 4IUNA 2F0PA 2HQEA 3MZ5A 5CV6A 2F0UA 2EYOA 1ENAA 1EY5A 2WACA 3D8GA 4TRDA 3SK5A 4QF4A 3T13A 3DHQA 5I6WA 5KYIA 1SNMA 1SYEA 2EYFA 1SYCA 2SOBA 3EROA 1EY0A 4K2LA 4N9PA 5CV5A 1F2YA 5C4ZA 2SNSA 4KV6A 5C3XA 2F0SA 2EY5A 2PYKA 3P75A 5C4HA 2F0OA 2F3WA 4EQNA 5KGUA 1JORA 1RKNA 2F0JA 4PNYA 2EYLA 3TP8A 1JOOA 1II3A 5K5PA 3OWFA 2OXPA 4OL7A 1KDBA 3R3OA 4MIUA 4K14A 3BDCA 3QOJA 2EXZA 5IGFA 4S3SA 1EY8A 4K8IA 1U9RA 3ITPA 1EZ6A 3MHBA 5J1ZA 4N9TA 5CV7A 5IGDA 1EQVA 3HZXA 4KTAA 4NKLA 3MXPA 5CR3A 5IOCA 3NUCA 1SNDA 4F7XA 2F0QA 4ZUJA 5KIXA 3C1FA 4WORA 2F0LA 3D4DA 4J1MA 4DF7A 4KHVA 2F0KA 5EKLA 4LAAA 5KYLA 4B9XA 4IALA 1SYBA 5JOBA 2EY6A 5NUCA 4B9WA 2PW7A 4HMJA 4RKBA 1EYCA 4ID6A 5E3FA 3TP6A 4EVOA 5HGTA 3RUZA 1JOQA 4I65A 4EQPA 1JOKA 4HTHA 3NXWA 5I9OA 3EJIA 3SHLA 2F0TA 5J39A 1NUCA 2F0HA 4ODGA 5IGCA 3TMEA 4PMCA 2F3VA 1EYDA 3SK8A 3H6MA 5E1FA 5M9OA 1ENCA 1SNOA 1STYA 2EY1A 3DMUA 4KD4A 4H7BA 2PQEA 5IGGA 2EYHA 1EZ8A 2ENBA 2PZTA 3ERQA 3HEJA 3T16A 5IIFA 4K2KA 5ISRA 1A3UA 1A2UA 1EY9A 1KDAA 2SNMA 4QB4A 4QMGA 3TP5A 2QDBA 4K5WA 1EY7A 2PW5A 1AEXA 1SYFA 4DU9A 5CGKA 5I6YA 5IGBA 5IODA 3NHHA 4J6HA 3U9OA 1EY6A 2PZWA 4NP5A 2F0IA 4ZUIA 3SK6A 1STHA 5C6AA 5DAUA 4DGZA 1TR5A 1KABA 5EGTA 4KY5A 4K8JA 5EKKA 4EQOA 4NDXA 2RDFA 3C1EA 3D6CA 4K5VA 4NMZA 4WRDA 1IHZA 1STGA 4F8MA 5KEEA 4DFAA 3S9WA 3V2TA 2O4XA 2RKSA 2EYMA 3MVVA 3NP8A 2LKVA 3EVQA 1F2MA 4KJNA 2F0GA 4E6IA 1SNQA 5C3WA 5CV4A 4KJOA 4IZ8A 3D4WA 2M00A 3OMCA 4R8NA 2EYPA 5CV8A 2F0FA 4KD3A 3TP7A 3SK4A 1TT2A 2KQ3A 2OEOA 2RBMA 3SR1A 1A3TA 3E5SA 3SXHA 1STNA 3LX0A 4KY6A 4PMBA 5CC4A 5C5MA 2F0WA 2F0DA 4HMIA 2PZUA 2EYJA 2EY2A 4RKLA 1STAA 1A2TA 4G57A 5I9PA 1F2ZA 3OMGA 5IGEA 3BDLA 5KRUA 4YIJA 3OSOA 5CV9A 1SYGA 3VA5A 5F2DA 1EYAA 5HURA 4ZQ3A 1A3VA 5JAVA 2F0VA 3NQTA 1EY4A 1SNCA 3QOLA 5C5LA 1STBA 2NUCA 4ME5A 2KHSA 3NK9A 1TQOA 2F0MA 2F0EA 1SNPA 1KDCA 1SYDA 5J22A 2F0NA 3P1HA 4K6DA 3PMFA 4K5XA 3QB3A 5DEHA 2OF1A 1KAAA 1NSNS 4KY7A
chains in the Genus database with same CATH superfamily
4FXGC 4HIMA 1KQSA 1HUNA 2K28A 5EJWA 1F9SA 4UAIA 1F9QA 4QF4A 1SYCA 2B2UA 3EROA 1Z47A 2AQ3B 3HOWG 4KV6A 4A3MB 2EY5A 1LM0A 2B63B 4BBSG 2TMPA 4NXML 1I50H 1WVLA 1II3A 3Q6SA 4B3TL 1V1QA 1B8AA 2Y0SE 3MXNB 4C1NI 2BH2A 1JR0D 3QOJA 2EXZA 3HOYB 4A3CG 2QF7A 4LF4L 4LK1C 2KUMA 1Y8PB 4JW0A 3W5OA 1CKOA 2K5VA 3CRKC 2NZOA 4XT1B 5I2YA 1SMYC 3NPPA 3PUVA 2I5MX 2OTLA 3K81C 1QVCA 1HNWL 1O7ZA 1I4GA 3CCLA 2KEDA 4L6TB 2VQFQ 4PZ6A 3K0XA 3NXWA 4ZK9B 2F0HA 4JVZA 3TMEA 4NB3A 2HHHL 3E9IA 3HFZB 1U4RA 4C3JH 1EUJA 3MXGA 5IGGA 1JMCA 4HEDA 4RHSA 4K2KA 2FMMA 3X3MA 4DV3Q 4LF6Q 4GNXC 1YBYA 4JI6Q 3CC2A 1YJ9A 1HNXL 2Q8IB 3FP9A 3A0JA 5M3FG 4AQYQ 1Q12A 3N52A 3CW2C 3I3CA 1Q8KA 3A8JE 3G7LA 4DFAA 3NP8A 4BXXG 2K03A 3S1MB 1F2MA 4RCNA 1YJNA 2N3SA 5CV4A 3BZDB 5M5WH 3ICEA 3SK4A 1DXMA 1VQ4A 4H13C 4UP9A 2C5CA 3RZDB 5T1IA 5FLXL 2YU9H 2F4VL 1YVCA 3PF5A 3URYA 1GO3E 1PA6A 1YITA 5FLXc 4H44C 3VYUA 3GTGH 1PH3A 1VQLA 3E0JA 4DR2L 4JI5L 4FF3A 2H1EA 1XNQQ 2E76C 4DR6Q 1PTOH 2VUMB 2A6HC 2YTXA 2E5LL 4LFBQ 2A68D 5EBCA 2WB1E 2KHSA 3NK9A 1BCPF 1PH7A 4OIJA 4GOPC 4IFDG 2RA4A 5C4XG 1C8CA 5CV6A 2F0UA 1XMQQ 1GJXA 3GO5A 3U9SA 1TS2A 4UDUC 3EQLC 4JI2Q 1HR0W 3CCMA 3S2DB 1MBYA 3GQBA 2JP1A 5LL6S 4OWXB 3L3OC 2WAQG 2LSSA 3GTPB 1O7LA 1S5DD 4A4IA 2LS01 3M3YH 2R7FA 2ZJRA 5IGDA 5IOCA 1PFMA 4GLVB 1HZ9A 1DOLA 4XIGS 1SNDA 3K57A 1CA5A 4HSPA 3ER0A 1W3SA 4DK1A 1I3QH 2K33A 2PCFB 3K59A 1G8ZD 1DCZA 1YI2A 3KOJA 4DV0Q 1VQPA 3RR5A 2JJQA 1HNZL 1A6XA 1BUVT 4LF5L 1N34L 3FPUB 1N33Q 2RCFA 4AYBE 3D0FA 1EYDA 4DR7Q 4G7OC 4AH6A 2R93B 3NBIA 3J81E 4QQBX 5FKAC 4P72A 1SXTA 5L37A 4ZKBB 1OXVA 3FMCA 1SEBD 3D3RA 3GTOB 2B2UC 5I6YA 1X55A 5FK9C 4Y7NB 2F03A 1VF5C 3K0YA 3PF4A 1I6HH 3P7JA 4F8MA 5K36H 5M3MB 5FOBB 3W1GA 1VQGA 1TIID 2OQ0A 1D1IA 2F0GA 4FF2A 5M5XB 4IZ8A 3D4WA 1WI5A 3SGIA 2N88A 4ZRZA 1X3PA 4IO9A 2HCIA 3A7AB 2EY2A 4CKBA 3PIP3 1NBWA 1TVXA 3PUYA 3W2DA 2JA8H 3I4NB 4ZAIA 4QY7A 1PXUA 4CBVA 4OX9Q 3GTKH 4A3BH 4R4OA 4X66L 2PI2E 3HOUH 1EY4A 4IURA 1G91A 3FKIG 5C5LA 2ASBA 4A93G 5IYDH 4YHHL 3G48A 4PV1C 4LFAL 3NELA 3HKZB 3KF6A 4FF4A 1HA5A 1KAAA 1RTNA 4OWTB 3AU7A 1QILA 4C2MH 1IYUA 3MAQA 2N55A 2Q2UA 4LUZA 1CI3M 1XNRQ 4IJHA 2QEXA 5FO8B 2I5HA 1VQJA 1TWCB 1JOOA 1JE5A 4DV7L 3M85A 4L5QA 2MP1A 4GLXA 3HGBA 2BA0A 1O7IA 3I70A 3OTOQ 4GLAC 1J5EQ 3UDXA 1U4MA 4JI0Q 1LTSD 2EJGC 1X3EA 4V0BA 3HP3A 4ZUJA 1A62A 3GTLH 3HOXH 3EFXD 2BE5D 1QZGA 1WCMH 2ID0A 1Y1WB 4B3RL 1TWFH 3BZCA 3AQQA 1Q1EA 5JOBA 1PMRA 4EQ5A 3F2CA 2JK8A 2R92H 3KF6B 4O2DA 3RUZA 1BO0A 4LFCL 3TBIB 2R7DA 3KBXA 4KN4C 3DWPA 2E75C 3AMUA 4JYAQ 1GXDC 2QCPX 3S1NH 2B63G 1EZ8A 3S17B 2CQAA 1A2UA 3GTQB 3TP5A 2RSNA 3PQIA 3OYYA 4DGZA 3MFYA 4B3SQ 3JAMc 1GM5A 1IHZA 1FNWA 3BDOA 4NXNL 2LXKA 4KJNA 1HNWQ 4P73A 4KJOA 3S2HB 1A63A 1X9NA 2A19A 2RBMA 1A3TA 3CPWA 3LX0A 2MNAA 3PGZA 1PFBA 4X62L 1IBLL 1ILQA 4DUZL 1E2VA 3MTSA 1HUMA 1BCPB 3OMGA 2EIFA 3UDIA 1FGUA 3BDLA 1E22A 3HOWH 3ZYYX 4LF9L 2JA5B 4IPHA 2K05A 3NSWA 1KAWA 4XQJA 2XNAC 3OIQA 1TKWB 2CH4W 3NTHA 4DAYA 4P2CB 1GUWA 5FLXE 2K75A 2BDOA 4YCWA 5J22A 2F0NA 4DPGA 1JWUD 1EIYB 1NSNS 4BBSB 1GD7A 4QIWE 4RH6A 4HJ9A 1SE4A 2PNHA 2EYFA 3M4OH 1EY0A 4LF7Q 1HHVA 2ALYB 4RGMA 1UUPA 3R93A 1Y14B 3VR4A 1MSGA 3OWFA 2IW3A 2AWNA 3FRPB 2JQOA 4MIUA 4JI5Q 1Q7YC 4QCLA 4C1NK 3BYTB 1SMYD 3DWQA 3CCVA 4OXPA 2IWHA 2BOSA 4O1NA 4BBRB 1K8GA 3K7AB 4DN4M 4DAYB 1RCVD 1LTRD 2GA4B 4KHVA 5AJ3Q 3GDEA 2HQLA 5M5YB 2PW7A 3RNUA 4EVOA 1LLRD 1MHWC 1OXSC 2CH4A 4FXKC 4PMCA 2PO4A 4DV3L 1GOZA 1I94Q 5JJIA 1NR2A 3LWUA 5M3FB 2FJ2A 3WOFA 4BA1I 4PMWA 2L5TA 1PRTF 5BN4A 1TWGB 4Y52H 1Q81C 2ES2A 3HOZB 3SK6A 1Q46A 2G5DA 1E7ZA 3ULJA 3V05A 4UY8C 2VQEQ 4OEMB 4A3KB 5CBAE 2L55A 2DGYA 1U5KA 2YYZA 4OO1H 2K50A 1X56A 2KEEA 3Q0AA 4FVMA 3RLOA 1YHQA 5E4XA 5ELFA 3ND9A 1AZPA 3GTJB 1HZAA 4TQUS 1MSHA 2KCMA 3Q8DA 3J7AF 1HJPA 3B6YA 1XNQL 1QG7A 2R93G 2A6HD 4YY3Q 2AWOA 4DR5Q 2PNRC 2KOLA 4DNRB 5CORA 1M90C 4A3FB 1PFSA 3CKIB 2X69A 2AUJD 1BCPC 3CQZB 3I73A 3QOLA 4XDXA 4JV5Q 4X64Q 3S14B 4RGOS 1JJCB 2ZT9C 3MWYW 4DK3C 1AZQA 1XMQL 2NN6I 4K5XA 5C3EG 1AP0A 4JI2L 2VB2X 5M3MG 4A3DH 4F7XA 2WACA 3SE0A 1GVPA 4BWGB 1LT3D 3QG1A 3SDZA 2GVAA 1L0YB 3Q22A 4FDBA 5KNCA 1N32L 1BR9A 1WTRA 1E0BA 2E2JH 1MIUA 1Y1VH 3BVZA 3H3VI 4NW2A 1XXGA 2KBNA 1D1KA 2UUAQ 1HPCA 3S1QB 1ML0D 2LY7A 1XTCD 3E0EA 4HIDA 5EKLA 1BKBA 1X6OA 2EY6A 4R1JA 3UE1A 1N33L 3TP6A 5D65A 4DR7L 3GTMB 3PO3H 3KDFA 4I65A 4HSVA 3VR3A 2A73B 3I90A 1M8AA 1LO5D 3ZJYC 3U4VA 2KVMA 1IKLA 3BVGA 1K9MC 3AYHB 1A3UA 1K28A 4L5SA 3GD7A 5ELCA 4DU9A 1SFOH 4MNOA 1QE6A 5C6AA 3PCOB 4CJ0B 1KD1C 4U68A 3HRZC 2EXDA 3I72A 1VQKA 3PO2H 1XMOQ 2RF4A 3MVVA 1PTOF 4A3IH 4X6AH 3A5UA 4KD3A 4KN7C 5LL6X 3MC0B 4KY6A 1JQYD 3KDFB 3RD4A 4GOPA 3FHWA 3FKIB 1G6ZA 2R7ZH 4A93B 1CTMA 4RG1A 1CZGA 1R4QB 4A3EH 2E2DC 5IE8A 3EBEA 1IL2A 2FINB 1EQTA 1N9WA 1DOMA 3I55A 4LUOA 1GUGA 5C4ZA 4DUYL 1E2WA 1K83B 2CW0C 4IUNA 1BF4A 2VZAA 1LACA 5IWAQ 1X65A 4TRDA 1XNRL 5JPMC 1BBUA 1HQMC 1AE2A 3FPPA 4X62Q 5C4HA 5EQ0A 3OTOL 1J5EL 5T1GA 2EYLA 2K04A 1S5CD 4JI0L 4GOPB 1HZCA 1YHBA 3G4SA 3GP7A 4CDEC 2DJFC 1SN8A 4S3SA 1EY8A 4A3MH 3KFUA 1F9RA 2L1BA 3HZXA 4C3IB 1WJJA 3AFQA 1KXLA 1EOTA 1JICA 2F0QA 4UHVA 4YCVA 2EJMA 1U4LA 1W6JA 2IL8A 3M4YA 2M2LA 3HOYH 1ESRA 4KKUA 1VQ9A 2E2HB 3HS0C 5G3LD 3WOEA 4ABNA 1VS0A 5LHY1 3PIOA 5EAYA 1PRTB 4EQPA 4JYAL 4DR1Q 4BY1G 5JJLA 1FNVA 4ME3A 3SK8A 4IUTA 2HT1A 2D0PA 5CBEE 2Z8LA 2ZXPA 4O0AA 3RN5A 1K3BC 4KD4A 3IL8A 3OIPA 1DZ1A 5EBDA 3CCUA 2K14A 3HOVG 2L9HA 1KDAA 2SNMA 4B3SL 1PZJD 3U9OA 1KRSA 2KCTA 3LWEA 1STHA 4K6LA 2ICEC 4IPDA 1ZYRC 2TSSA 4BBRG 3V2TA 1RIPA 1X3QA 4DV1Q 2XWBB 4R8NA 3OMCA 5IYCG 2F0FA 5LMNW 3IAYA 3DXJC 1G291 2H4OA 5C5MA 2L4NA 2A8VA 3KK7A 4RKLA 1ZKOA 4QGUA 1EIGA 2VS1A 3S1MH 5I9PA 4MN3A 1FYCA 2IX3A 1VCIA 1DGSA 2HUGA 4LNQA 2FFKB 3RZDH 2GN5A 4FF1A 4BS9A 3H3VC 2N78A 1IBMQ 1STBA 3IRBA 2YV5A 1L0WA 3G71A 1B53A 3HOZG 4Q0FA 3P1HA 1I6VC 1KLUD 2RQXA 4A3KG 1VQBA 4LF7L 2VUMH 1S3OA 1QWYA 1NY4A 2EYOA 1ENAA 3T13A 4DAVA 2HD3A 4YWMA 1H95A 5IP9G 1WOCA 1LTID 1T9HA 1D6EC 1F2YA 4LUVA 3I56A 4WJ3M 4HAEA 1YIJA 1QOHA 2O2LD 4R4IA 5DNFA 2JYOA 1UE7A 2SEBD 1VQEA 1R4PB 2IJ0A 2PMZE 3S2DH 4A3FG 1Q86C 1CQVA 5AJ3L 1VQCA 2NVQH 3LGJA 1EFWA 4WORA 1CQFA 1XPRA 3GTPH 2Q2IA 1ET6A 2K5NA 4LAAA 1QNUA 1GUSA 4BY7G 1EYCA 2B29A 4IOCA 3RN2A 2A74C 5AFWA 2A69C 1DJRD 4YWKA 1I94L 3EJIA 4IUQA 3H0GG 3T1HQ 2NVTH 1PHJA 3H6MA 2EQSA 1IXRA 5C0XG 1N32Q 2G9HD 1SNOA 1PRTC 1VMPA 2CWPA 2ZJPA 4FO2A 3C46A 1PTOB 1EY9A 2VL6A 2D0OA 1AEXA 5KNDA 5IODA 2VQEL 1WTHA 5FJ8H 1VQMA 5EGTA 4K8JA 4NDXA 1EL0A 1ET9A 1E24A 3GTOH 3EVQA 4Y7NH 1TWAB 1XTDA 2QGQA 3PIO3 2Z9HA 3A56A 2NTSA 3SXHA 3CC7A 2DUDA 1M1KC 1STNA 4J15A 4PMBA 4YY3L 4DR5L 3VA7A 3U4ZA 3HKSA 5C44B 2JN4A 1BCPD 5M5XH 1D7QA 5IGEA 2Y0SB 5A35A 1ESFA 1LT5D 3FVQA 4JV5L 4X64L 3J81j 5C3EB 4M1UB 1UAPA 1OXTA 5IP7G 2NN6G 3I4NH 4DAPA 4KY7A 1EY5A 3D6WA 4A3GB 1KIXA 3DHQA 1HTPA 4K2LA 2SNSA 4ILWA 1YNXA 1OTCA 2F0OA 1STEA 1MJCA 4F87A 5C4JB 1PH6A 5DLQE 2UUAL 2MHVA 5E7NA 3TZDA 1PZID 4DR3Q 4K14A 3QO2A 2RDGA 2JA6H 1H9SA 1I6HB 2IY5B 1U9RA 4DXFA 1RL2A 5CMDA 5KNBA 1KNAA 3A74A 3PSIA 4DV2Q 5DM63 5C0XJ 1ILPA 1GUNA 1TWCH 3NUCA 4OIKA 1H9JA 3MXUA 2NB0A 4MTKA 2NVYB 1VQ7A 3A5ZB 4DUYQ 4XXEA 4RKBA 4K0KL 2X6GA 1JOQA 2NBFA 1JOKA 5EPKA 4A3JH 1B1ZA 1XWEA 4QUFA 2O5IC 1Y1WH 3CCQA 1FVIA 3KLSX 1Z9FA 1STYA 3R8BA 2NZ1D 3EIVA 5IY0A 1C7YA 3K5LA 2PW5A 1SYFA 2FMCA 3J80c 1VQAA 2MUYA 3BU2A 1XMOL 3S1RB 1J8IA 1IW7C 1H9SB 1PTOC 2WB1B 4N8X1 2WKCA 5EKKA 3KF8A 4XYQA 3C1EA 5IYBH 3S17H 3TN2A 4C3IG 1STGA 3GTQH 1B3AA 2EYMA 5D3DA 2ZXRA 2XRQD 1A8VA 2UXCQ 4B08A 3L2PA 3ULPA 4IQZA 2F0WA 2PZUA 2ZTDA 1Q82C 4C3HH 1X54A 1Q1BA 5DM73 2AHOB 1O80A 3JAML 1B9NA 1IL8A 3S2HH 4G7HC 5F2DA 3RZOB 5JEAG 5FLMG 3UDFA 4G4KA 3HOXB 3RLNA 2JE6I 3IKJA 4UP7A 2F0MA 2RVLA 3DM1A 2F0EA 1SNPA 5IWAL 5BN3A 3VYSA 2JA5H 3KF8B 3MEHA 3M4QA 2E74C 4AYBB 3S15B 2Z4IA 3MFGA 2F0SA 4FNFA 4BBSH 2KA7A 1YHAA 2NVXH 2WAQE 2PI2A 4Q5VA 2MO0A 3UDGA 4HR7B 2CCZA 4LF8Q 3CD6A 4HIKA 4FP5D 5IGFA 5D14A 1R9TB 4K8IA 1BBXC 1QNKA 4A3CH 3E3XA 2ATWA 1EQVA 2CVRA 2F52A 4NKLA 1SSOA 4PG3A 2EE1A 3V96A 4OWWB 1S4ZA 1KC8C 4BY1B 1CM9A 1J9OA 1NMGA 3CMEA 4YCUA 4IOAA 4B9XA 4DR1L 3I91A 4CJ2C 5HGTA 2VNUD 3H91A 2ZJQA 1IYVA 1DOKA 4WFN3 5FO9B 1QVFA 4HTHA 4XT3B 3HOVB 3K7AH 1BVSA 3D31A 4L5TA 3AFPA 2A1AA 4C3JG 2CQOA 3C2PA 4KMUC 2K6AA 1T5XD 3M7GA 4L63B 2DNEA 4XQQA 3ULLA 1YNJC 4DK6C 2IX1A 4DNIA 4HN7A 3OW2A 5IGBA 1BQQT 1ZYRD 3CXCA 4NP5A 2F0IA 2JSOA 2QW7A 3CMAA 5DAUA 2NZHA 2VB3X 3CCSA 4GKKQ 2Z6BA 2NWGA 5M3FH 2RDFA 4K5VA 1RDPD 1F77A 4DV1L 4JPBW 1CK1A 4A75A 1VQOA 4JI3Q 4BXXH 1TWGH 5JEAJ 1RHPA 3M4OB 4DR4Q 3AEVA 4N8FA 5C0XI 4QJFA 5EPJA 1LT6D 1N36L 2WP8J 3I8ZA 2DJGC 3UE0A 1Y8NB 1KTKA 3TZUA 2E2IB 1QZHA 3I7FA 1IBML 1LYLA 5HGQA 1WTWA 1EEFD 4H0LC 4PZ8A 1A3VA 1C48A 2MPMA 3GTJH 2XSCA 2LXJA 3U50C 1PH2A 3DM3A 1B4OA 2K5HA 1CKMA 5LMUQ 1CSPA 2UXBL 1BNZA 2K1BA 3L9AX 3CP0A 2QILA 4A3FH 3QB3A 4IFDH 5C4XH 3BZKA 1SAPA 3CQZH 3QR8A 1SNMA 3S14H 1QB5D 1GUTA 3MA2B 4OELB 1G6PA 1JWSD 1T5EA 1SE2A 2WINB 1JORA 3KYHC 5C44G 2D9UA 2BDNA 3J7A5 2E8GA 2MGSA 3N6RA 4QUCA 4DK0A 1FL0A 2Y0SG 5J1ZA 1N8RC 4BY7B 1B7YB 3O13A 1IBKQ 1WFQA 2F1MA 1OXXK 1E1OA 1TWHH 3H0GB 5KYLA 4IALA 2JEAI 5J3BA 3DWAA 3I4OA 4B9WA 3T1HL 4L8JA 5E3FA 3NEMA 1X3FA 1PRTD 2AMCB 3KUPA 3S1QH 5GAHC 3WDNA 3KJOA 4A3GG 4ODGA 4LW1A 4XQNA 5A2QL 1YJWA 1TS4A 4X65Q 3E9HA 4V190 4GZYC 4XYOA 4JI8Q 2CFMA 4RFBA 4RA8A 4KHPQ 3IFTA 4RMFA 2PQEA 1EU4A 3K8AA 5E4WC 3GTMH 5COYA 1LTLA 5J39A 4K5WA 1EWCA 1EY7A 2DY8A 1WD1A 1AH9A 5CYUA 3PUXA 1FJGQ 1BDOA 3M4PA 5FO7B 4P74A 1EY6A 2ZTCA 5GQOA 2Z1CA 4R4QA 3FEWX 3D6CA 1NJIC 1VF7A 3KJPA 4DV4Q 1WTXA 4CHTB 5K36G 4M8AA 4QIWB 1LTTD 4DXGA 4K0KQ 1LTBD 1EWIA 4ZLTF 1PDQA 2NN6H 2UXDQ 2M00A 3T1YQ 2EYPA 1EQQA 2OEOA 3K6OA 1DD2A 1VQNA 3VYRA 3W1BA 4HMIA 3T53B 3SVMA 3SEBA 1TS3A 2Z4HA 1EFID 3OWEB 2JA8G 1PFNA 4GN3B 4HCSA 4A3BG 3S16B 3HOUG 1C9OA 2XTIA 2K7VA 1D2BA 2JA7B 1MI2A 4FYDA 4GS3A 1FD7D 1V9PA 1DYQA 2NYZD 3OW7A 3FKIH 1JJ2A 3H3VH 5IT9L 4A93H 1LUZA 1MGSA 3TSSA 3DUZA 2WB1G 1QVGA 5IT9c 1O7YA 1VQIA 3RMHA 3JAME 2ZM6Q 3CCRA 1ENFA 2F0PA 1HFGA 2UUBQ 3J81L 1XYIA 3M7NA 1K8OA 4R4CA 3STBC 5I6WA 5KYIA 5BN5A 1CHPD 2XVSA 3J81c 2BH8A 2B2WA 2WIIB 4JCVE 1HCZA 1OO9B 2OQKA 2AUKA 1WTQA 5JJZA 4DR3L 4OONA 4EQNA 1K83H 1RKNA 1JE4A 1PH1A 1SFOB 4DAMA 3TQYA 4DV2L 2VXWA 1UEBA 1Q3LA 1V43A 3JAMi 4OGQC 2JXMB 5BR8Q 5G3LF 4KTAA 1H9RA 4FXDA 1VDZA 5KIXA 3HOXG 3C1FA 1E3PA 2G9DA 2C9OA 4DF7A 2MJ8A 2R92G 1SYBA 4HMJA 3F2DA 2UU9Q 2B2VA 4I7ZC 1S5BD 1KL9A 4ZKCB 1DONA 2A5HA 2R3ZA 2KCNA 3I4MB 2F4IA 4GKJQ 4EGVA 3VR2A 4AYBG 2EY1A 1PH4A 2HIXA 1ASZA 2E2HH 4H7BA 2B63H 1IW7D 1PTOD 5I9OA 2N8NA 5EPLA 1X3GA 2PZWA 4P75A 1KNEA 1LTGD 1TR5A 1XX8A 4DV5Q 5EKIA 3H94A 1B2TA 4POGA 1K3RA 1TXYA 2KENA 5JVG3 2UXCL 1PVOA 2A6EC 2KCCA 2R6GA 2XIWA 2FXQA 3FDTA 2C35B 3NTIA 3C3LA 4JI1Q 2KQ3A 1SMXA 3QJYA 4CKCA 2VY3A 1S40A 2EVBA 2F0DA 1WTVA 3K5NA 1STAA 3G6JB 1KHIA 1K73C 2Q8RE 1D5XC 2JEBI 3K5OA 1YNNC 1A0IA 1SBBB 5LMNQ 3L0OA 5D3IB 2ZXOA 4ME5A 1HRJA 1I5FA 1VQDA 1UE6A 2I0QA 2CWAA 1W6KA 2RHSB 4P71A 2L12A 1I50B 2QEJC 1GUOA 4MHEA 4RAUC 4GN5A 1U0LA 3TDQA 2SOBA 4JBJA 1HA6A 3NQIA 1N36Q 3P75A 3BYYB 1UE1A 5KGUA 4LF8L 4RGTA 4DNTB 1HFNA 1VMCA 1FGBD 5JVH3 2IHEA 5K5PA 3QWNA 2WKDA 4OL7A 3R3OA 4KLKA 3BDCA 3RLFA 3ERSX 5ELDA 1L1OA 3AB9A 3PIPA 4HJ7A 3T4AC 5CV7A 2Q2HA 5CR3A 2UXBQ 1VQHA 1QJOA 2F0LA 3J7AV 3CCJA 2X6LA 3HKZE 4F88A 1MJEA 3PV0A 1Y8OB 4C3JB 1FR3A 1B9MA 1RF2D 3KBGA 1CZWA 1LTAD 2F3VA 2QDLA 1YNJD 3U58A 2OT2A 1ENCA 3VR6A 1EWHA 2EYHA 1HR0Q 4JI7Q 3T16A 1I4HA 5ISRA 3TEHB 4QB4A 1UWVA 4RHRA 2B2WC 4A3LG 1I4PA 1SROA 4GKKL 1XJVA 1PV4A 4ZUIA 1L1OB 4JI3L 5A2QE 5M5WB 1I4XA 1KABA 4IN3A 4WJ4A 4I7AA 1NTGA 4DR4L 1BOSA 2B2YA 1P16A 2K52A 5KEEA 4OO1G 4LJZC 2YU9B 3Q24A 2O5JC 2UUCL 1SNQA 3GV6A 1Q90A 3GTGB 5ELEA 4HJ5A 2I46A 1ZEQX 4RGNA 3R2TA 2NTTA 1ICWA 1VQ6A 2YTYA 1A2TA 1NCVA 1TWAH 2HDMA 2R93H 2B2VC 1G51A 3CPFA 1EIHA 5LMUL 2NVQB 2K5DA 1EYAA 2QKIC 1CT1D 5JAVA 4MTNA 5C44H 4J8QA 2J0TD 4CGYB 1SR3A 4DV6Q 4G7ZC 5C3EH 1CA6A 4A3DG 3NENA 3MZ5A 5M3MH 2NVTB 2K4KA 4JBWA 1EIFA 1LV9A 1RTOA 3H09A 3K5MA 3PUZA 3M3YB 3WWVA 1UE5A 1SE3A 5IT9E 2PYKA 3A8IE 1SJHD 3TP8A 3BG3A 3P20A 5TSSA 4A3GH 1I4QA 1IBKL 1Y1VG 1I3QB 2OCEA 1RD9D 3CRLC 2KECA 3ITPA 1EZ6A 1TU2B 3MHBA 4DA2A 1S5FD 2GVBA 3A7LA 3M9BA 2EPBA 5C4JH 2JA7G 3NTKA 3F2BA 4JBMA 3CU7A 4J1MA 2RDHA 2LFNA 1X32A 1SDFA 1JC7A 4PQXA 3PO3G 4X65L 2AQ1B 4JI8L 2MO1A 4KHPL 2XN9C 3J81i 2B2TA 4IPGA 2NVYH 5M9OA 4APVA 2K01A 3I2ZA 1HTLD 1FJGL 1B3QA 3ERQA 2Z6KA 4B3MQ 4IFDJ 2D2CC 1V8QA 2K5QA 4IJLA 4DV4L 3CF5A 4JK1C 3K80C 1VQ5A 4JOIA 3PO2G 1JWMD 4NMZA 2D5DA 2B8GA 3F1ZA 2UXDL 3T1YL 4A3IG 3W3AA 1L1OC 4UP8A 2Z0SA 2L11A 3S1RH 4E6IA 4X3SA 1B70B 5GADC 2JA8B 3GTKB 3SR1A 4A3BB 1A15A 3HG9A 1HXYD 1K8MA 3K7UC 3J80L 3HOUB 2MFIA 3DEOA 2EYJA 1CSQA 3EN2A 4X3TA 2L15A 3I4MG 2R7ZG 1K0RA 2EDGA 2JA6B 1D8LA 4CDCC 4YIJA 3TRZA 1SJED 4NPSA 2V1CC 2M9VA 2PMZB 4A3EG 4JI4Q 5ELNA 4RWSC 2F3IA 2JA9A 4C2MB 4CKEA 4AIMA 2NUCA 2ZM6L 4LWCA 3DLLA 2B39A 2UUBL 1SYDA 3STBD 4K6DA 3TREA 1J6QA 2N49A 3RZOH 1YZ6A 2RCNA 1CHQD 4A3JB 2J7ZA 2HQEA 4JC0A 1EYGA 4HJ8A 1OXUA 3E6ZX 5ELOA 1B50A 2FHTA 2OWOA 2B2YC 2BA1A 3BVMA 1MKHA 4IUVA 4UPAA 5BR8L 3GTLB 1JT8A 1S5ED 4NXMQ 1WCMB 4YWLA 2CW0D 1TWFB 4A3MG 2R92B 4B3TQ 2P5ZX 3T56B 3S15H 4KI0A 1GHKA 2XWJB 1RJTA 1G2TA 2EZVA 3R2IA 4JG2A 4LF4Q 3TS2A 3IFDA 2VW9A 1PH5A 2UU9L 3HOYG 1C0AA 2F0KA 4PZ7A 1R9TH 5GROA 3S1NB 1LT4D 3F8TA 4H02A 4GKJL 3VR5A 4JBKA 4C3HB 3JC66 3SHLA 4BY1H 1GKHA 5E1FA 2DY7A 3ND8A 1TS5A 4LMQD 1Y69U 3DMUA 3Q23A 4GN4B 2RSOA 2PZTA 2ENBA 1D5ZC 3HEJA 3F2UA 2HHHQ 3HOVH 5CGKA 2QDBA 1O78A 4DV5L 1PH8A 2A6ED 1SLJA 4CDDC 1GHJA 1IYJB 1ICFB 5GAEC 1HNXQ 3S9WA 3A8KE 2RKSA 2CHBD 4BBRH 1JB7A 4JI1L 2LKVA 3T51B 3HOWB 5IYCH 5M5YH 1BXTA 3E5SA 4KHZA 2NVXB 2I5LX 1KLGD 5JJKA 1YNND 2EOTA 1P8LA 4A76A 1TY0A 5LMNL 3KLRA 1IZ6A 4G57A 1F2ZA 4POFA 3NBHA 1WTPA 2F4VQ 3VA5A 2L0CA 2B2TC 2D62A 2IX0A 2HCCA 1QCBD 4ZQ3A 3G6EA 1Z7TA 1H9MA 1B44D 3NQTA 2KHIA 4X3KA 4DR2Q 2B3GA 2IPKD 4ALPA 4OO1I 1WYDA 4WJWA 2E2IH 3HOZH 3PMFA 2E5LQ 5DEHA 2OF1A 2Z6KC 4IFDI 2A68C 2VUMG 4A3KH 2UUCQ 4R4TA 5C3XA 3SK5A 1PH9A 1K0SA 1EU3A 2VQFL 2KHJA 4JOIC 1K8AC 5IP9H 3NWTA 5CV5A 1NMFA 2F3WA 1BBWA 2KJXA 2B8FA 2H5XA 2ZTEA 2OXPA 1KDBA 4LF6L 2PPBC 1F2LA 3NBHB 1E2ZA 1DM0B 4JI6L 1V1PA 2DN8A 3DEPA 4N9TA 3OPOA 4KKSA 2RHQB 3MXPA 3KLWA 1XPUA 4IUPA 3BS1A 3GV3A 4RCOA 4AQYL 4TSSA 3KLSA 4A3LH 1AFPA 2EJFC 2Q2TA 2XGTA 3QIAA 3VYTA 1CKNA 4Z9CB 3ONAB 2IT1A 5NUCA 4U673 4BY7H 3CC4A 1S72A 3LNNA 1TY2A 2V4DA 1NE3A 1H9KA 2F0TA 5IGCA 3H0GH 1HR0L 4JI7L 2Q8TA 4IUUA 1PYSB 1E1TA 1NAPA 1V1OA 1HNZQ 5C0XH 4DKAC 4LF5Q 1I4RA 3CAMA 2OTJA 3A55A 1N34Q 5I4DA 1CFMA 4BA2I 5IIFA 2AKWB 2MQHA 2XRSD 1F9PA 4EX5A 1IKMA 2K5WA 1C4QA 4HJAA 4J6HA 4DR6L 1JB3A 2A69D 1AW7A 5HY6A 4ZYSA 5FJ8G 4LFBL 4C56C 1V1PB 5C4XB 1VQFA 4HIOA 4WRDA 3OHXC 3UI2A 3H15A 3TS0A 2O4XA 3K58A 1MD2D 5C3WA 4KKTA 3S24A 1ASYA 5CV8A 1CKNB 2HIVA 1TT2A 1PLFA 1XPOA 5CC4A 1KRTA 2WAQB 2IHFA 2K32A 3CHBD 1D5MC 3MEFA 5KRUA 1SYGA 3VDYA 4KK7A 5HURA 1TWHB 4A3DB 1SNCA 1W2BA 5H1SE 1UEAB 4XTCS 1L2FA 3J80E 1AN8A 1QUQA 4QL5A 4X66Q 4DV6L 3I4NG 1TQOA 4IPCA 2YTVA 1KDCA 5IP7H 2CKZB 4CDFC 4ZCKA 3S16H 4YHHQ 1NNXA 4LFAQ 2JA7H 3D8GA 4DV0L 2BCOA 1YEZA 1SYEA 2E2JB 1G2SA 4GNXA 1Y1VB 3HKZG 4N9PA 2WFWA 1LABA 1AE3A 2ICIA 1ONLA 4ULLA 2F0JA 1FNUA 4PNYA 3J80i 3A54A 1L0XB 4MZ9A 5IYDG 2JA6G 1EEID 5I2XA 4DV7Q 1U4PA 1NR4A 1HQRD 3I4LA 3PO3B 1JJGA 1RODA 3L7ZC 3CCEA 2PQAA 1SRUA 1VQ8A 3D4DA 2QA4A 4OHJA 1JCKB 1CUKA 1QUQB 3NWSA 4R8IA 2SDFA 2WV6D 4HCEA 3EA6A 1PYBA 4ID6A 2I07B 4X3UA 2BE5C 4B3RQ 4A3JG 2HDLA 1Q8IA 1NUCA 1Y1WG 2J4XA 3D4RA 4GNXB 4LFCQ 4B3ML 3PO2B 4QMGA 4TVAB 4OX9L 1WTOA 4A3IB 4O42A 1EOVA 3NHHA 3I4MH 3NE5B 1WCMG 4R9WA 3J7YW 4EQOA 4KY5A 5IYBG 3BJUA 2DNCA 4C3IH 1M4VA 2PQAB 2AQ2B 5ELBA 2R61A 2R7ZB 1EQRA 5GAGC 3TP7A 4CJ1B 4NXNQ 5JPNC 4C3HG 1ZXTA 4A3EB 3OOCA 3MXNA 1SE8A 4JI4L 3PUWA 1HZBA 4L5RC 3OSOA 5CV9A 3J7ZC 1IBLQ 4DUZQ 1WD0A 1Z6HA 2LMCB 1HH2P 1UNSA 5JEAH 5FLMH 2F0VA 1PYWD 4LF9Q 1PZKD 2JA5G 3X3NA 4TKOB
chains in the Genus database with same CATH topology
4FXGC 1HUNA 2K28A 5EJWA 1F9SA 4UAIA 1F9QA 4QF4A 1SYCA 2B2UA 3EROA 1Z47A 2AQ3B 4KV6A 4A3MB 2EY5A 2B63B 2TMPA 1WVLA 1II3A 3Q6SA 4C1NI 1JR0D 3QOJA 2EXZA 3HOYB 2QF7A 4LK1C 2KUMA 1Y8PB 3CRKC 4XT1B 5I2YA 1SMYC 3NPPA 3PUVA 1O7ZA 1I4GA 2KEDA 4L6TB 3NXWA 4ZK9B 2F0HA 3TMEA 1U4RA 3MXGA 5IGGA 4HEDA 4RHSA 4K2KA 2FMMA 3X3MA 2Q8IB 1Q12A 3N52A 3I3CA 3A8JE 3G7LA 4DFAA 3NP8A 2K03A 3S1MB 1F2MA 4RCNA 5CV4A 3BZDB 3SK4A 1DXMA 4H13C 2C5CA 3RZDB 5T1IA 5FLXL 3URYA 4H44C 3VYUA 3E0JA 4FF3A 2H1EA 2E76C 1PTOH 2VUMB 2A6HC 2A68D 5EBCA 2KHSA 3NK9A 1BCPF 4OIJA 4IFDG 2RA4A 1C8CA 5CV6A 2F0UA 1GJXA 3GO5A 3U9SA 1TS2A 4UDUC 3EQLC 3S2DB 1MBYA 3GQBA 2JP1A 5LL6S 3L3OC 3GTPB 1O7LA 1S5DD 2LS01 5IGDA 5IOCA 1PFMA 1DOLA 4XIGS 1SNDA 3K57A 1CA5A 4HSPA 4DK1A 2PCFB 2K33A 3K59A 1G8ZD 1DCZA 1A6XA 1BUVT 3FPUB 1EYDA 4G7OC 2R93B 3NBIA 3J81E 5FKAC 1SXTA 4ZKBB 1OXVA 3FMCA 1SEBD 3D3RA 3GTOB 2B2UC 5I6YA 5FK9C 4Y7NB 2F03A 1VF5C 3K0YA 3P7JA 4F8MA 5K36H 5M3MB 5FOBB 1TIID 1D1IA 2F0GA 4FF2A 5M5XB 4IZ8A 3D4WA 2N88A 4ZRZA 1X3PA 2HCIA 3A7AB 2EY2A 4CKBA 3PIP3 1TVXA 3PUYA 3W2DA 3I4NB 4ZAIA 1PXUA 4CBVA 1EY4A 4IURA 1G91A 5C5LA 4PV1C 3HKZB 4FF4A 1HA5A 1KAAA 1RTNA 3AU7A 1QILA 1IYUA 3MAQA 2N55A 1CI3M 5FO8B 1TWCB 1JOOA 3M85A 2MP1A 3HGBA 2BA0A 3I70A 1U4MA 1LTSD 2EJGC 4V0BA 3HP3A 4ZUJA 3EFXD 2BE5D 2ID0A 1Y1WB 5JOBA 1Q1EA 1PMRA 3RUZA 1BO0A 3TBIB 3KBXA 4KN4C 3DWPA 2E75C 3AMUA 1GXDC 2QCPX 1EZ8A 3S17B 2CQAA 1A2UA 3GTQB 3TP5A 2RSNA 4DGZA 3MFYA 1IHZA 1FNWA 3BDOA 4KJNA 4KJOA 3S2HB 2RBMA 1A3TA 3LX0A 1PFBA 1ILQA 1E2VA 3MTSA 1HUMA 1BCPB 3OMGA 3BDLA 3ZYYX 2JA5B 2K05A 3NSWA 4XQJA 2XNAC 3OIQA 1TKWB 3NTHA 4DAYA 4P2CB 1GUWA 5FLXE 2BDOA 5J22A 2F0NA 1JWUD 1NSNS 4BBSB 4RH6A 1SE4A 2EYFA 1EY0A 1HHVA 4RGMA 1UUPA 3R93A 3VR4A 1MSGA 3OWFA 2IW3A 2AWNA 3FRPB 4MIUA 4QCLA 4C1NK 3BYTB 1SMYD 3DWQA 2IWHA 2BOSA 4O1NA 4BBRB 3K7AB 4DN4M 1RCVD 1LTRD 2GA4B 4KHVA 5M5YB 2PW7A 4EVOA 1LLRD 1OXSC 4FXKC 4PMCA 2PO4A 1GOZA 1NR2A 3LWUA 5M3FB 2FJ2A 3WOFA 4BA1I 4PMWA 2L5TA 1PRTF 5BN4A 1TWGB 3HOZB 3SK6A 3V05A 4A3KB 5CBAE 2L55A 4OO1H 2YYZA 2KEEA 3Q0AA 4FVMA 5E4XA 5ELFA 3ND9A 1AZPA 3GTJB 4TQUS 1MSHA 3J7AF 1QG7A 2A6HD 2AWOA 2PNRC 2KOLA 4DNRB 5CORA 4A3FB 3CKIB 2X69A 2AUJD 1BCPC 3CQZB 3I73A 3QOLA 4XDXA 3S14B 4RGOS 2ZT9C 3MWYW 1AZQA 2NN6I 4K5XA 1AP0A 2VB2X 4F7XA 2WACA 3SE0A 4BWGB 1LT3D 3QG1A 3SDZA 1L0YB 3Q22A 5KNCA 1BR9A 1WTRA 1E0BA 3BVZA 4NW2A 1XXGA 1D1KA 1HPCA 3S1QB 1ML0D 2LY7A 1XTCD 5EKLA 2EY6A 3TP6A 5D65A 3GTMB 4I65A 4HSVA 3VR3A 2A73B 3I90A 1M8AA 1LO5D 2KVMA 1IKLA 3BVGA 1A3UA 3GD7A 5ELCA 4DU9A 1QE6A 5C6AA 4CJ0B 4U68A 3HRZC 3I72A 3MVVA 1PTOF 4KD3A 4KN7C 5LL6X 3MC0B 4KY6A 1JQYD 3RD4A 3FKIB 1G6ZA 4A93B 1CTMA 1CZGA 1R4QB 2E2DC 2FINB 1EQTA 1DOMA 1GUGA 5C4ZA 1E2WA 1K83B 2CW0C 4IUNA 1BF4A 1LACA 4TRDA 5JPMC 1HQMC 3FPPA 5C4HA 5EQ0A 5T1GA 2EYLA 2K04A 1S5CD 3GP7A 4S3SA 1EY8A 1F9RA 2L1BA 3HZXA 4C3IB 1EOTA 1JICA 2F0QA 2EJMA 1U4LA 1W6JA 2IL8A 3M4YA 2M2LA 1ESRA 4KKUA 2E2HB 3HS0C 5G3LD 3WOEA 4ABNA 5LHY1 1PRTB 4EQPA 1FNVA 3SK8A 4IUTA 5CBEE 2Z8LA 2ZXPA 4KD4A 3IL8A 3OIPA 1DZ1A 5EBDA 2L9HA 1KDAA 2SNMA 1PZJD 3U9OA 3LWEA 1STHA 4K6LA 2ICEC 1ZYRC 2TSSA 3V2TA 1X3QA 2XWBB 4R8NA 3OMCA 2F0FA 3IAYA 3DXJC 1G291 2H4OA 5C5MA 2L4NA 3KK7A 4RKLA 1ZKOA 1EIGA 5I9PA 4MN3A 1FYCA 2IX3A 1VCIA 2HUGA 2FFKB 4FF1A 4BS9A 3H3VC 1STBA 1B53A 4Q0FA 3P1HA 1I6VC 1KLUD 2RQXA 1QWYA 2EYOA 1ENAA 3T13A 4DAVA 1LTID 1D6EC 1F2YA 4HAEA 1QOHA 2O2LD 5DNFA 2JYOA 2SEBD 1R4PB 2IJ0A 1CQVA 4WORA 1CQFA 1ET6A 4LAAA 1QNUA 1GUSA 1EYCA 2A74C 5AFWA 2A69C 1DJRD 3EJIA 4IUQA 3H6MA 5C0XG 2G9HD 1SNOA 1PRTC 1VMPA 4FO2A 3C46A 1PTOB 1EY9A 1AEXA 5KNDA 5IODA 5EGTA 4K8JA 4NDXA 1EL0A 1ET9A 3EVQA 1TWAB 3PIO3 3A56A 2NTSA 3SXHA 1STNA 4PMBA 3VA7A 5C44B 1BCPD 5IGEA 2Y0SB 5A35A 1ESFA 1LT5D 3FVQA 5C3EB 4M1UB 1UAPA 1OXTA 2NN6G 4DAPA 4KY7A 1EY5A 3D6WA 4A3GB 3DHQA 1HTPA 4K2LA 2SNSA 4ILWA 2F0OA 1STEA 4F87A 5C4JB 2MHVA 3TZDA 1PZID 4K14A 3QO2A 2RDGA 1I6HB 1H9SA 1U9RA 4DXFA 5CMDA 5KNBA 1KNAA 5DM63 5C0XJ 1ILPA 1GUNA 3NUCA 4OIKA 1H9JA 3MXUA 2NB0A 2NVYB 4XXEA 4RKBA 2X6GA 1JOQA 2NBFA 1JOKA 5EPKA 1B1ZA 1XWEA 4QUFA 2O5IC 3KLSX 1STYA 3R8BA 2NZ1D 3K5LA 2PW5A 1SYFA 2FMCA 2MUYA 1J8IA 3S1RB 1IW7C 1H9SB 1PTOC 2WB1B 2WKCA 5EKKA 3KF8A 4XYQA 3C1EA 3TN2A 4C3IG 1STGA 1B3AA 2EYMA 5D3DA 2ZXRA 2XRQD 4B08A 4IQZA 2F0WA 2PZUA 1Q1BA 5DM73 1O80A 3JAML 1B9NA 1IL8A 4G7HC 5F2DA 3RZOB 5JEAG 4G4KA 3HOXB 2JE6I 3IKJA 2F0MA 2RVLA 3DM1A 2F0EA 1SNPA 5BN3A 3VYSA 3MEHA 2E74C 4AYBB 3S15B 2Z4IA 3MFGA 2F0SA 4FNFA 2KA7A 4Q5VA 4HR7B 4FP5D 5IGFA 5D14A 1R9TB 4K8IA 1BBXC 1QNKA 1EQVA 2CVRA 4NKLA 1SSOA 2EE1A 3V96A 1S4ZA 4BY1B 1CM9A 1J9OA 4B9XA 3I91A 4CJ2C 5HGTA 2VNUD 3H91A 1IYVA 1DOKA 4WFN3 5FO9B 4HTHA 4XT3B 3HOVB 3D31A 4C3JG 3C2PA 4KMUC 2K6AA 1T5XD 3M7GA 4L63B 2DNEA 4XQQA 1YNJC 2IX1A 4HN7A 5IGBA 1BQQT 1ZYRD 4NP5A 2F0IA 2JSOA 5DAUA 2VB3X 2NWGA 2RDFA 4K5VA 1RDPD 1F77A 1CK1A 5JEAJ 1RHPA 3M4OB 5C0XI 5EPJA 1LT6D 2WP8J 3I8ZA 1Y8NB 1KTKA 3TZUA 2E2IB 1WTWA 1EEFD 4H0LC 1A3VA 1C48A 2MPMA 2XSCA 1B4OA 1BNZA 2K1BA 3L9AX 2QILA 3QB3A 4IFDH 1SAPA 1SNMA 1QB5D 1GUTA 3MA2B 1JWSD 1T5EA 1SE2A 2WINB 1JORA 2D9UA 2BDNA 2MGSA 3N6RA 4QUCA 4DK0A 5J1ZA 4BY7B 3O13A 2F1MA 1OXXK 3H0GB 5KYLA 4IALA 2JEAI 3DWAA 4B9WA 4L8JA 5E3FA 1PRTD 3KUPA 3WDNA 4ODGA 4XQNA 5A2QL 1TS4A 4V190 4GZYC 4XYOA 4RFBA 4RA8A 3IFTA 2PQEA 1EU4A 5E4WC 5COYA 5J39A 4K5WA 1EWCA 1EY7A 2DY8A 1WD1A 5CYUA 3PUXA 1BDOA 5FO7B 1EY6A 2Z1CA 3FEWX 3D6CA 1VF7A 5K36G 1WTXA 4CHTB 4M8AA 4QIWB 1LTTD 4DXGA 1LTBD 4ZLTF 1PDQA 2NN6H 2M00A 2EYPA 2OEOA 3K6OA 1DD2A 3VYRA 4HMIA 3T53B 3SVMA 3SEBA 1TS3A 2Z4HA 1EFID 3OWEB 1PFNA 4HCSA 3S16B 2K7VA 1D2BA 2JA7B 1MI2A 4FYDA 1FD7D 2NYZD 1DYQA 3OW7A 5IT9L 1MGSA 3TSSA 3DUZA 1O7YA 3RMHA 3JAME 1ENFA 2F0PA 1HFGA 3J81L 1XYIA 3M7NA 1K8OA 5I6WA 5KYIA 5BN5A 1CHPD 2XVSA 2WIIB 2B2WA 1HCZA 1OO9B 2AUKA 1WTQA 5JJZA 4EQNA 1RKNA 1JE4A 1SFOB 2VXWA 1Q3LA 1V43A 4OGQC 2JXMB 5G3LF 4KTAA 1H9RA 4FXDA 1VDZA 5KIXA 3C1FA 2G9DA 2C9OA 4DF7A 2MJ8A 1SYBA 4HMJA 2B2VA 4I7ZC 1S5BD 4ZKCB 1DONA 2A5HA 2R3ZA 2KCNA 3I4MB 2F4IA 4EGVA 3VR2A 2EY1A 4H7BA 1IW7D 1PTOD 5I9OA 5EPLA 2PZWA 1KNEA 1LTGD 1TR5A 1XX8A 5EKIA 3H94A 1B2TA 5JVG3 2A6EC 2KCCA 2R6GA 2XIWA 3FDTA 3NTIA 3C3LA 2KQ3A 3QJYA 4CKCA 2EVBA 2F0DA 1WTVA 3K5NA 1STAA 3G6JB 2Q8RE 1D5XC 2JEBI 3K5OA 1YNNC 1SBBB 5D3IB 2ZXOA 4ME5A 1HRJA 1W6KA 2L12A 1I50B 2QEJC 1GUOA 4MHEA 4RAUC 3TDQA 2SOBA 1HA6A 3NQIA 3P75A 3BYYB 5KGUA 4RGTA 4DNTB 1HFNA 1VMCA 1FGBD 5JVH3 5K5PA 3QWNA 2WKDA 4OL7A 3R3OA 3BDCA 3RLFA 5ELDA 3AB9A 3T4AC 5CV7A 5CR3A 1QJOA 2F0LA 3J7AV 2X6LA 4F88A 3PV0A 1Y8OB 4C3JB 1FR3A 1B9MA 1RF2D 3KBGA 1CZWA 1LTAD 2F3VA 1YNJD 2OT2A 1ENCA 3VR6A 1EWHA 2EYHA 3T16A 1I4HA 5ISRA 4QB4A 4RHRA 2B2WC 1I4PA 4ZUIA 5A2QE 5M5WB 1I4XA 1KABA 4IN3A 1BOSA 2B2YA 5KEEA 4OO1G 4LJZC 2YU9B 3Q24A 2O5JC 1SNQA 3GV6A 1Q90A 3GTGB 5ELEA 2I46A 1ZEQX 4RGNA 3R2TA 2NTTA 1ICWA 1A2TA 1NCVA 2HDMA 2B2VC 1EIHA 2NVQB 2K5DA 1EYAA 2QKIC 1CT1D 5JAVA 4J8QA 2J0TD 4CGYB 4G7ZC 1CA6A 3MZ5A 2NVTB 4JBWA 1LV9A 1RTOA 3H09A 3K5MA 3PUZA 3M3YB 1SE3A 5IT9E 2PYKA 3A8IE 1SJHD 3TP8A 3BG3A 3P20A 5TSSA 1I4QA 1I3QB 1RD9D 3CRLC 2KECA 3ITPA 1EZ6A 1TU2B 3MHBA 4DA2A 1S5FD 3A7LA 2EPBA 3NTKA 3CU7A 4J1MA 2RDHA 2LFNA 1X32A 1SDFA 1JC7A 4PQXA 2AQ1B 2XN9C 2B2TA 5M9OA 2K01A 1HTLD 3ERQA 4IFDJ 2D2CC 1V8QA 2K5QA 4JK1C 1JWMD 4NMZA 2D5DA 2B8GA 3W3AA 2L11A 4E6IA 4X3SA 2JA8B 3GTKB 3SR1A 4A3BB 1A15A 3HG9A 1HXYD 1K8MA 3J80L 3HOUB 3DEOA 2EYJA 4X3TA 2EDGA 2JA6B 4YIJA 1SJED 2M9VA 2PMZB 4RWSC 4C2MB 4CKEA 2NUCA 2B39A 1SYDA 4K6DA 1CHQD 4A3JB 2J7ZA 2HQEA 1OXUA 3E6ZX 1B50A 2FHTA 2B2YC 2BA1A 3BVMA 4IUVA 3GTLB 1S5ED 1WCMB 2CW0D 1TWFB 2R92B 3T56B 4KI0A 1GHKA 2XWJB 1RJTA 1G2TA 2EZVA 3R2IA 3IFDA 2F0KA 3S1NB 1LT4D 3VR5A 4C3HB 3SHLA 5E1FA 2DY7A 3ND8A 1TS5A 4LMQD 1Y69U 3DMUA 3Q23A 2RSOA 2PZTA 2ENBA 1D5ZC 3HEJA 3F2UA 5CGKA 2QDBA 1O78A 2A6ED 1GHJA 3S9WA 3A8KE 2RKSA 2CHBD 2LKVA 3T51B 3HOWB 1BXTA 3E5SA 4KHZA 2NVXB 1KLGD 1YNND 2EOTA 1TY0A 3KLRA 4G57A 1F2ZA 3NBHA 1WTPA 3VA5A 2L0CA 2B2TC 2D62A 2IX0A 2HCCA 1QCBD 4ZQ3A 1Z7TA 1H9MA 1B44D 3NQTA 4X3KA 2IPKD 4OO1I 4WJWA 3PMFA 5DEHA 2OF1A 4IFDI 2A68C 5C3XA 3SK5A 1EU3A 3NWTA 5CV5A 2F3WA 2KJXA 2B8FA 2OXPA 1KDBA 2PPBC 1F2LA 1E2ZA 1DM0B 1V1PA 2DN8A 3DEPA 4N9TA 3OPOA 4KKSA 3MXPA 4IUPA 3BS1A 3GV3A 4RCOA 4TSSA 3KLSA 1AFPA 2EJFC 3QIAA 3VYTA 4Z9CB 5NUCA 3ONAB 2IT1A 4U673 3LNNA 1TY2A 2V4DA 1H9KA 2F0TA 5IGCA 2Q8TA 4IUUA 1NAPA 1V1OA 5C0XH 1I4RA 3A55A 5I4DA 1CFMA 4BA2I 5IIFA 2XRSD 1F9PA 1IKMA 2K5WA 1C4QA 4J6HA 1JB3A 2A69D 1AW7A 4ZYSA 4C56C 1V1PB 5C4XB 4WRDA 3OHXC 3UI2A 2O4XA 3K58A 1MD2D 5C3WA 4KKTA 5CV8A 1TT2A 1PLFA 5CC4A 2WAQB 2K32A 3CHBD 5KRUA 1D5MC 1SYGA 4KK7A 5HURA 1TWHB 4A3DB 1SNCA 1UEAB 4XTCS 3J80E 1AN8A 1TQOA 1KDCA 3D8GA 2BCOA 1SYEA 2E2JB 1G2SA 1Y1VB 4N9PA 1LABA 2ICIA 1ONLA 4ULLA 2F0JA 1FNUA 4PNYA 3A54A 1L0XB 1EEID 5I2XA 1U4PA 1NR4A 1HQRD 3I4LA 3PO3B 1RODA 3L7ZC 3D4DA 4OHJA 1JCKB 3NWSA 4R8IA 2SDFA 2WV6D 4HCEA 3EA6A 4ID6A 2I07B 4X3UA 2BE5C 2HDLA 1Q8IA 1NUCA 2J4XA 3D4RA 3PO2B 4QMGA 1WTOA 4A3IB 4O42A 3NHHA 3NE5B 4R9WA 3J7YW 4EQOA 4KY5A 2DNCA 1M4VA 2AQ2B 5ELBA 2R61A 2R7ZB 3TP7A 4CJ1B 5JPNC 4C3HG 1ZXTA 4A3EB 3OOCA 3MXNA 3PUWA 3OSOA 5CV9A 1WD0A 1Z6HA 2LMCB 1UNSA 5JEAH 2F0VA 1PYWD 1PZKD 3X3NA 4TKOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MEH A;  4IUN A;  2F0P A;  2HQE A;  3MZ5 A;  5CV6 A;  2F0U A;  2EYO A;  1ENA A;  1EY5 A;  2WAC A;  3D8G A;  4TRD A;  3SK5 A;  4QF4 A;  3T13 A;  3DHQ A;  5I6W A;  5KYI A;  1SNM A;  1SYE A;  2EYF A;  1SYC A;  2SOB A;  3ERO A;  1EY0 A;  4K2L A;  4N9P A;  5CV5 A;  1F2Y A;  5C4Z A;  2SNS A;  4KV6 A;  5C3X A;  2F0S A;  2EY5 A;  2PYK A;  3P75 A;  5C4H A;  2F0O A;  2F3W A;  4EQN A;  5KGU A;  1JOR A;  1RKN A;  2F0J A;  4PNY A;  2EYL A;  3TP8 A;  1JOO A;  1II3 A;  5K5P A;  3OWF A;  2OXP A;  4OL7 A;  1KDB A;  3R3O A;  4MIU A;  4K14 A;  3BDC A;  3QOJ A;  2EXZ A;  5IGF A;  4S3S A;  1EY8 A;  4K8I A;  1U9R A;  3ITP A;  1EZ6 A;  3MHB A;  5J1Z A;  4N9T A;  5CV7 A;  5IGD A;  1EQV A;  3HZX A;  4KTA A;  4NKL A;  3MXP A;  5CR3 A;  5IOC A;  3NUC A;  1SND A;  4F7X A;  2F0Q A;  4ZUJ A;  5KIX A;  3C1F A;  4WOR A;  2F0L A;  3D4D A;  4J1M A;  4DF7 A;  4KHV A;  2F0K A;  5EKL A;  4LAA A;  5KYL A;  4B9X A;  4IAL A;  1SYB A;  5JOB A;  2EY6 A;  5NUC A;  4B9W A;  2PW7 A;  4HMJ A;  4RKB A;  1EYC A;  4ID6 A;  5E3F A;  3TP6 A;  4EVO A;  5HGT A;  3RUZ A;  1JOQ A;  4I65 A;  4EQP A;  1JOK A;  4HTH A;  3NXW A;  5I9O A;  3EJI A;  3SHL A;  2F0T A;  5J39 A;  1NUC A;  2F0H A;  4ODG A;  5IGC A;  3TME A;  4PMC A;  2F3V A;  1EYD A;  3SK8 A;  3H6M A;  5E1F A;  5M9O A;  1ENC A;  1SNO A;  1STY A;  2EY1 A;  3DMU A;  4KD4 A;  4H7B A;  2PQE A;  5IGG A;  2EYH A;  1EZ8 A;  2ENB A;  2PZT A;  3ERQ A;  3HEJ A;  3T16 A;  5IIF A;  4K2K A;  5ISR A;  1A3U A;  1A2U A;  1EY9 A;  1KDA A;  2SNM A;  4QB4 A;  4QMG A;  3TP5 A;  2QDB A;  4K5W A;  1EY7 A;  2PW5 A;  1AEX A;  1SYF A;  4DU9 A;  5CGK A;  5I6Y A;  5IGB A;  5IOD A;  3NHH A;  4J6H A;  3U9O A;  1EY6 A;  2PZW A;  4NP5 A;  2F0I A;  4ZUI A;  3SK6 A;  1STH A;  5C6A A;  5DAU A;  4DGZ A;  1TR5 A;  1KAB A;  5EGT A;  4KY5 A;  4K8J A;  5EKK A;  4EQO A;  4NDX A;  2RDF A;  3C1E A;  3D6C A;  4K5V A;  4NMZ A;  4WRD A;  1IHZ A;  1STG A;  4F8M A;  5KEE A;  4DFA A;  3S9W A;  3V2T A;  2O4X A;  2RKS A;  2EYM A;  3MVV A;  3NP8 A;  2LKV A;  3EVQ A;  1F2M A;  4KJN A;  2F0G A;  4E6I A;  1SNQ A;  5C3W A;  5CV4 A;  4KJO A;  4IZ8 A;  3D4W A;  2M00 A;  3OMC A;  4R8N A;  2EYP A;  5CV8 A;  2F0F A;  4KD3 A;  3TP7 A;  3SK4 A;  1TT2 A;  2KQ3 A;  2OEO A;  2RBM A;  3SR1 A;  1A3T A;  3E5S A;  3SXH A;  1STN A;  3LX0 A;  4KY6 A;  4PMB A;  5CC4 A;  5C5M A;  2F0W A;  2F0D A;  4HMI A;  2PZU A;  2EYJ A;  2EY2 A;  4RKL A;  1STA A;  1A2T A;  4G57 A;  5I9P A;  1F2Z A;  3OMG A;  5IGE A;  3BDL A;  5KRU A;  4YIJ A;  3OSO A;  5CV9 A;  1SYG A;  3VA5 A;  5F2D A;  1EYA A;  5HUR A;  4ZQ3 A;  1A3V A;  5JAV A;  2F0V A;  3NQT A;  1EY4 A;  1SNC A;  3QOL A;  5C5L A;  1STB A;  2NUC A;  4ME5 A;  2KHS A;  3NK9 A;  1TQO A;  2F0M A;  2F0E A;  1SNP A;  1KDC A;  1SYD A;  5J22 A;  2F0N A;  3P1H A;  4K6D A;  3PMF A;  4K5X A;  3QB3 A;  5DEH A;  2OF1 A;  1KAA A;  1NSN S;  4KY7 A; 
#chains in the Genus database with same CATH topology
 4FXG C;  4HIM A;  1KQS A;  1HUN A;  2K28 A;  5EJW A;  1F9S A;  4UAI A;  1F9Q A;  4QF4 A;  1SYC A;  2B2U A;  3ERO A;  1Z47 A;  2AQ3 B;  3HOW G;  4KV6 A;  4A3M B;  2EY5 A;  1LM0 A;  2B63 B;  4BBS G;  2TMP A;  4NXM L;  1I50 H;  1WVL A;  1II3 A;  3Q6S A;  4B3T L;  1V1Q A;  1B8A A;  2Y0S E;  3MXN B;  4C1N I;  2BH2 A;  1JR0 D;  3QOJ A;  2EXZ A;  3HOY B;  4A3C G;  2QF7 A;  4LF4 L;  4LK1 C;  2KUM A;  1Y8P B;  4JW0 A;  3W5O A;  1CKO A;  2K5V A;  3CRK C;  2NZO A;  4XT1 B;  5I2Y A;  1SMY C;  3NPP A;  3PUV A;  2I5M X;  2OTL A;  3K81 C;  1QVC A;  1HNW L;  1O7Z A;  1I4G A;  3CCL A;  2KED A;  4L6T B;  2VQF Q;  4PZ6 A;  3K0X A;  3NXW A;  4ZK9 B;  2F0H A;  4JVZ A;  3TME A;  4NB3 A;  2HHH L;  3E9I A;  3HFZ B;  1U4R A;  4C3J H;  1EUJ A;  3MXG A;  5IGG A;  1JMC A;  4HED A;  4RHS A;  4K2K A;  2FMM A;  3X3M A;  4DV3 Q;  4LF6 Q;  4GNX C;  1YBY A;  4JI6 Q;  3CC2 A;  1YJ9 A;  1HNX L;  2Q8I B;  3FP9 A;  3A0J A;  5M3F G;  4AQY Q;  1Q12 A;  3N52 A;  3CW2 C;  3I3C A;  1Q8K A;  3A8J E;  3G7L A;  4DFA A;  3NP8 A;  4BXX G;  2K03 A;  3S1M B;  1F2M A;  4RCN A;  1YJN A;  2N3S A;  5CV4 A;  3BZD B;  5M5W H;  3ICE A;  3SK4 A;  1DXM A;  1VQ4 A;  4H13 C;  4UP9 A;  2C5C A;  3RZD B;  5T1I A;  5FLX L;  2YU9 H;  2F4V L;  1YVC A;  3PF5 A;  3URY A;  1GO3 E;  1PA6 A;  1YIT A;  5FLX c;  4H44 C;  3VYU A;  3GTG H;  1PH3 A;  1VQL A;  3E0J A;  4DR2 L;  4JI5 L;  4FF3 A;  2H1E A;  1XNQ Q;  2E76 C;  4DR6 Q;  1PTO H;  2VUM B;  2A6H C;  2YTX A;  2E5L L;  4LFB Q;  2A68 D;  5EBC A;  2WB1 E;  2KHS A;  3NK9 A;  1BCP F;  1PH7 A;  4OIJ A;  4GOP C;  4IFD G;  2RA4 A;  5C4X G;  1C8C A;  5CV6 A;  2F0U A;  1XMQ Q;  1GJX A;  3GO5 A;  3U9S A;  1TS2 A;  4UDU C;  3EQL C;  4JI2 Q;  1HR0 W;  3CCM A;  3S2D B;  1MBY A;  3GQB A;  2JP1 A;  5LL6 S;  4OWX B;  3L3O C;  2WAQ G;  2LSS A;  3GTP B;  1O7L A;  1S5D D;  4A4I A;  2LS0 1;  3M3Y H;  2R7F A;  2ZJR A;  5IGD A;  5IOC A;  1PFM A;  4GLV B;  1HZ9 A;  1DOL A;  4XIG S;  1SND A;  3K57 A;  1CA5 A;  4HSP A;  3ER0 A;  1W3S A;  4DK1 A;  1I3Q H;  2K33 A;  2PCF B;  3K59 A;  1G8Z D;  1DCZ A;  1YI2 A;  3KOJ A;  4DV0 Q;  1VQP A;  3RR5 A;  2JJQ A;  1HNZ L;  1A6X A;  1BUV T;  4LF5 L;  1N34 L;  3FPU B;  1N33 Q;  2RCF A;  4AYB E;  3D0F A;  1EYD A;  4DR7 Q;  4G7O C;  4AH6 A;  2R93 B;  3NBI A;  3J81 E;  4QQB X;  5FKA C;  4P72 A;  1SXT A;  5L37 A;  4ZKB B;  1OXV A;  3FMC A;  1SEB D;  3D3R A;  3GTO B;  2B2U C;  5I6Y A;  1X55 A;  5FK9 C;  4Y7N B;  2F03 A;  1VF5 C;  3K0Y A;  3PF4 A;  1I6H H;  3P7J A;  4F8M A;  5K36 H;  5M3M B;  5FOB B;  3W1G A;  1VQG A;  1TII D;  2OQ0 A;  1D1I A;  2F0G A;  4FF2 A;  5M5X B;  4IZ8 A;  3D4W A;  1WI5 A;  3SGI A;  2N88 A;  4ZRZ A;  1X3P A;  4IO9 A;  2HCI A;  3A7A B;  2EY2 A;  4CKB A;  3PIP 3;  1NBW A;  1TVX A;  3PUY A;  3W2D A;  2JA8 H;  3I4N B;  4ZAI A;  4QY7 A;  1PXU A;  4CBV A;  4OX9 Q;  3GTK H;  4A3B H;  4R4O A;  4X66 L;  2PI2 E;  3HOU H;  1EY4 A;  4IUR A;  1G91 A;  3FKI G;  5C5L A;  2ASB A;  4A93 G;  5IYD H;  4YHH L;  3G48 A;  4PV1 C;  4LFA L;  3NEL A;  3HKZ B;  3KF6 A;  4FF4 A;  1HA5 A;  1KAA A;  1RTN A;  4OWT B;  3AU7 A;  1QIL A;  4C2M H;  1IYU A;  3MAQ A;  2N55 A;  2Q2U A;  4LUZ A;  1CI3 M;  1XNR Q;  4IJH A;  2QEX A;  5FO8 B;  2I5H A;  1VQJ A;  1TWC B;  1JOO A;  1JE5 A;  4DV7 L;  3M85 A;  4L5Q A;  2MP1 A;  4GLX A;  3HGB A;  2BA0 A;  1O7I A;  3I70 A;  3OTO Q;  4GLA C;  1J5E Q;  3UDX A;  1U4M A;  4JI0 Q;  1LTS D;  2EJG C;  1X3E A;  4V0B A;  3HP3 A;  4ZUJ A;  1A62 A;  3GTL H;  3HOX H;  3EFX D;  2BE5 D;  1QZG A;  1WCM H;  2ID0 A;  1Y1W B;  4B3R L;  1TWF H;  3BZC A;  3AQQ A;  1Q1E A;  5JOB A;  1PMR A;  4EQ5 A;  3F2C A;  2JK8 A;  2R92 H;  3KF6 B;  4O2D A;  3RUZ A;  1BO0 A;  4LFC L;  3TBI B;  2R7D A;  3KBX A;  4KN4 C;  3DWP A;  2E75 C;  3AMU A;  4JYA Q;  1GXD C;  2QCP X;  3S1N H;  2B63 G;  1EZ8 A;  3S17 B;  2CQA A;  1A2U A;  3GTQ B;  3TP5 A;  2RSN A;  3PQI A;  3OYY A;  4DGZ A;  3MFY A;  4B3S Q;  3JAM c;  1GM5 A;  1IHZ A;  1FNW A;  3BDO A;  4NXN L;  2LXK A;  4KJN A;  1HNW Q;  4P73 A;  4KJO A;  3S2H B;  1A63 A;  1X9N A;  2A19 A;  2RBM A;  1A3T A;  3CPW A;  3LX0 A;  2MNA A;  3PGZ A;  1PFB A;  4X62 L;  1IBL L;  1ILQ A;  4DUZ L;  1E2V A;  3MTS A;  1HUM A;  1BCP B;  3OMG A;  2EIF A;  3UDI A;  1FGU A;  3BDL A;  1E22 A;  3HOW H;  3ZYY X;  4LF9 L;  2JA5 B;  4IPH A;  2K05 A;  3NSW A;  1KAW A;  4XQJ A;  2XNA C;  3OIQ A;  1TKW B;  2CH4 W;  3NTH A;  4DAY A;  4P2C B;  1GUW A;  5FLX E;  2K75 A;  2BDO A;  4YCW A;  5J22 A;  2F0N A;  4DPG A;  1JWU D;  1EIY B;  1NSN S;  4BBS B;  1GD7 A;  4QIW E;  4RH6 A;  4HJ9 A;  1SE4 A;  2PNH A;  2EYF A;  3M4O H;  1EY0 A;  4LF7 Q;  1HHV A;  2ALY B;  4RGM A;  1UUP A;  3R93 A;  1Y14 B;  3VR4 A;  1MSG A;  3OWF A;  2IW3 A;  2AWN A;  3FRP B;  2JQO A;  4MIU A;  4JI5 Q;  1Q7Y C;  4QCL A;  4C1N K;  3BYT B;  1SMY D;  3DWQ A;  3CCV A;  4OXP A;  2IWH A;  2BOS A;  4O1N A;  4BBR B;  1K8G A;  3K7A B;  4DN4 M;  4DAY B;  1RCV D;  1LTR D;  2GA4 B;  4KHV A;  5AJ3 Q;  3GDE A;  2HQL A;  5M5Y B;  2PW7 A;  3RNU A;  4EVO A;  1LLR D;  1MHW C;  1OXS C;  2CH4 A;  4FXK C;  4PMC A;  2PO4 A;  4DV3 L;  1GOZ A;  1I94 Q;  5JJI A;  1NR2 A;  3LWU A;  5M3F B;  2FJ2 A;  3WOF A;  4BA1 I;  4PMW A;  2L5T A;  1PRT F;  5BN4 A;  1TWG B;  4Y52 H;  1Q81 C;  2ES2 A;  3HOZ B;  3SK6 A;  1Q46 A;  2G5D A;  1E7Z A;  3ULJ A;  3V05 A;  4UY8 C;  2VQE Q;  4OEM B;  4A3K B;  5CBA E;  2L55 A;  2DGY A;  1U5K A;  2YYZ A;  4OO1 H;  2K50 A;  1X56 A;  2KEE A;  3Q0A A;  4FVM A;  3RLO A;  1YHQ A;  5E4X A;  5ELF A;  3ND9 A;  1AZP A;  3GTJ B;  1HZA A;  4TQU S;  1MSH A;  2KCM A;  3Q8D A;  3J7A F;  1HJP A;  3B6Y A;  1XNQ L;  1QG7 A;  2R93 G;  2A6H D;  4YY3 Q;  2AWO A;  4DR5 Q;  2PNR C;  2KOL A;  4DNR B;  5COR A;  1M90 C;  4A3F B;  1PFS A;  3CKI B;  2X69 A;  2AUJ D;  1BCP C;  3CQZ B;  3I73 A;  3QOL A;  4XDX A;  4JV5 Q;  4X64 Q;  3S14 B;  4RGO S;  1JJC B;  2ZT9 C;  3MWY W;  4DK3 C;  1AZQ A;  1XMQ L;  2NN6 I;  4K5X A;  5C3E G;  1AP0 A;  4JI2 L;  2VB2 X;  5M3M G;  4A3D H;  4F7X A;  2WAC A;  3SE0 A;  1GVP A;  4BWG B;  1LT3 D;  3QG1 A;  3SDZ A;  2GVA A;  1L0Y B;  3Q22 A;  4FDB A;  5KNC A;  1N32 L;  1BR9 A;  1WTR A;  1E0B A;  2E2J H;  1MIU A;  1Y1V H;  3BVZ A;  3H3V I;  4NW2 A;  1XXG A;  2KBN A;  1D1K A;  2UUA Q;  1HPC A;  3S1Q B;  1ML0 D;  2LY7 A;  1XTC D;  3E0E A;  4HID A;  5EKL A;  1BKB A;  1X6O A;  2EY6 A;  4R1J A;  3UE1 A;  1N33 L;  3TP6 A;  5D65 A;  4DR7 L;  3GTM B;  3PO3 H;  3KDF A;  4I65 A;  4HSV A;  3VR3 A;  2A73 B;  3I90 A;  1M8A A;  1LO5 D;  3ZJY C;  3U4V A;  2KVM A;  1IKL A;  3BVG A;  1K9M C;  3AYH B;  1A3U A;  1K28 A;  4L5S A;  3GD7 A;  5ELC A;  4DU9 A;  1SFO H;  4MNO A;  1QE6 A;  5C6A A;  3PCO B;  4CJ0 B;  1KD1 C;  4U68 A;  3HRZ C;  2EXD A;  3I72 A;  1VQK A;  3PO2 H;  1XMO Q;  2RF4 A;  3MVV A;  1PTO F;  4A3I H;  4X6A H;  3A5U A;  4KD3 A;  4KN7 C;  5LL6 X;  3MC0 B;  4KY6 A;  1JQY D;  3KDF B;  3RD4 A;  4GOP A;  3FHW A;  3FKI B;  1G6Z A;  2R7Z H;  4A93 B;  1CTM A;  4RG1 A;  1CZG A;  1R4Q B;  4A3E H;  2E2D C;  5IE8 A;  3EBE A;  1IL2 A;  2FIN B;  1EQT A;  1N9W A;  1DOM A;  3I55 A;  4LUO A;  1GUG A;  5C4Z A;  4DUY L;  1E2W A;  1K83 B;  2CW0 C;  4IUN A;  1BF4 A;  2VZA A;  1LAC A;  5IWA Q;  1X65 A;  4TRD A;  1XNR L;  5JPM C;  1BBU A;  1HQM C;  1AE2 A;  3FPP A;  4X62 Q;  5C4H A;  5EQ0 A;  3OTO L;  1J5E L;  5T1G A;  2EYL A;  2K04 A;  1S5C D;  4JI0 L;  4GOP B;  1HZC A;  1YHB A;  3G4S A;  3GP7 A;  4CDE C;  2DJF C;  1SN8 A;  4S3S A;  1EY8 A;  4A3M H;  3KFU A;  1F9R A;  2L1B A;  3HZX A;  4C3I B;  1WJJ A;  3AFQ A;  1KXL A;  1EOT A;  1JIC A;  2F0Q A;  4UHV A;  4YCV A;  2EJM A;  1U4L A;  1W6J A;  2IL8 A;  3M4Y A;  2M2L A;  3HOY H;  1ESR A;  4KKU A;  1VQ9 A;  2E2H B;  3HS0 C;  5G3L D;  3WOE A;  4ABN A;  1VS0 A;  5LHY 1;  3PIO A;  5EAY A;  1PRT B;  4EQP A;  4JYA L;  4DR1 Q;  4BY1 G;  5JJL A;  1FNV A;  4ME3 A;  3SK8 A;  4IUT A;  2HT1 A;  2D0P A;  5CBE E;  2Z8L A;  2ZXP A;  4O0A A;  3RN5 A;  1K3B C;  4KD4 A;  3IL8 A;  3OIP A;  1DZ1 A;  5EBD A;  3CCU A;  2K14 A;  3HOV G;  2L9H A;  1KDA A;  2SNM A;  4B3S L;  1PZJ D;  3U9O A;  1KRS A;  2KCT A;  3LWE A;  1STH A;  4K6L A;  2ICE C;  4IPD A;  1ZYR C;  2TSS A;  4BBR G;  3V2T A;  1RIP A;  1X3Q A;  4DV1 Q;  2XWB B;  4R8N A;  3OMC A;  5IYC G;  2F0F A;  5LMN W;  3IAY A;  3DXJ C;  1G29 1;  2H4O A;  5C5M A;  2L4N A;  2A8V A;  3KK7 A;  4RKL A;  1ZKO A;  4QGU A;  1EIG A;  2VS1 A;  3S1M H;  5I9P A;  4MN3 A;  1FYC A;  2IX3 A;  1VCI A;  1DGS A;  2HUG A;  4LNQ A;  2FFK B;  3RZD H;  2GN5 A;  4FF1 A;  4BS9 A;  3H3V C;  2N78 A;  1IBM Q;  1STB A;  3IRB A;  2YV5 A;  1L0W A;  3G71 A;  1B53 A;  3HOZ G;  4Q0F A;  3P1H A;  1I6V C;  1KLU D;  2RQX A;  4A3K G;  1VQB A;  4LF7 L;  2VUM H;  1S3O A;  1QWY A;  1NY4 A;  2EYO A;  1ENA A;  3T13 A;  4DAV A;  2HD3 A;  4YWM A;  1H95 A;  5IP9 G;  1WOC A;  1LTI D;  1T9H A;  1D6E C;  1F2Y A;  4LUV A;  3I56 A;  4WJ3 M;  4HAE A;  1YIJ A;  1QOH A;  2O2L D;  4R4I A;  5DNF A;  2JYO A;  1UE7 A;  2SEB D;  1VQE A;  1R4P B;  2IJ0 A;  2PMZ E;  3S2D H;  4A3F G;  1Q86 C;  1CQV A;  5AJ3 L;  1VQC A;  2NVQ H;  3LGJ A;  1EFW A;  4WOR A;  1CQF A;  1XPR A;  3GTP H;  2Q2I A;  1ET6 A;  2K5N A;  4LAA A;  1QNU A;  1GUS A;  4BY7 G;  1EYC A;  2B29 A;  4IOC A;  3RN2 A;  2A74 C;  5AFW A;  2A69 C;  1DJR D;  4YWK A;  1I94 L;  3EJI A;  4IUQ A;  3H0G G;  3T1H Q;  2NVT H;  1PHJ A;  3H6M A;  2EQS A;  1IXR A;  5C0X G;  1N32 Q;  2G9H D;  1SNO A;  1PRT C;  1VMP A;  2CWP A;  2ZJP A;  4FO2 A;  3C46 A;  1PTO B;  1EY9 A;  2VL6 A;  2D0O A;  1AEX A;  5KND A;  5IOD A;  2VQE L;  1WTH A;  5FJ8 H;  1VQM A;  5EGT A;  4K8J A;  4NDX A;  1EL0 A;  1ET9 A;  1E24 A;  3GTO H;  3EVQ A;  4Y7N H;  1TWA B;  1XTD A;  2QGQ A;  3PIO 3;  2Z9H A;  3A56 A;  2NTS A;  3SXH A;  3CC7 A;  2DUD A;  1M1K C;  1STN A;  4J15 A;  4PMB A;  4YY3 L;  4DR5 L;  3VA7 A;  3U4Z A;  3HKS A;  5C44 B;  2JN4 A;  1BCP D;  5M5X H;  1D7Q A;  5IGE A;  2Y0S B;  5A35 A;  1ESF A;  1LT5 D;  3FVQ A;  4JV5 L;  4X64 L;  3J81 j;  5C3E B;  4M1U B;  1UAP A;  1OXT A;  5IP7 G;  2NN6 G;  3I4N H;  4DAP A;  4KY7 A;  1EY5 A;  3D6W A;  4A3G B;  1KIX A;  3DHQ A;  1HTP A;  4K2L A;  2SNS A;  4ILW A;  1YNX A;  1OTC A;  2F0O A;  1STE A;  1MJC A;  4F87 A;  5C4J B;  1PH6 A;  5DLQ E;  2UUA L;  2MHV A;  5E7N A;  3TZD A;  1PZI D;  4DR3 Q;  4K14 A;  3QO2 A;  2RDG A;  2JA6 H;  1H9S A;  1I6H B;  2IY5 B;  1U9R A;  4DXF A;  1RL2 A;  5CMD A;  5KNB A;  1KNA A;  3A74 A;  3PSI A;  4DV2 Q;  5DM6 3;  5C0X J;  1ILP A;  1GUN A;  1TWC H;  3NUC A;  4OIK A;  1H9J A;  3MXU A;  2NB0 A;  4MTK A;  2NVY B;  1VQ7 A;  3A5Z B;  4DUY Q;  4XXE A;  4RKB A;  4K0K L;  2X6G A;  1JOQ A;  2NBF A;  1JOK A;  5EPK A;  4A3J H;  1B1Z A;  1XWE A;  4QUF A;  2O5I C;  1Y1W H;  3CCQ A;  1FVI A;  3KLS X;  1Z9F A;  1STY A;  3R8B A;  2NZ1 D;  3EIV A;  5IY0 A;  1C7Y A;  3K5L A;  2PW5 A;  1SYF A;  2FMC A;  3J80 c;  1VQA A;  2MUY A;  3BU2 A;  1XMO L;  3S1R B;  1J8I A;  1IW7 C;  1H9S B;  1PTO C;  2WB1 B;  4N8X 1;  2WKC A;  5EKK A;  3KF8 A;  4XYQ A;  3C1E A;  5IYB H;  3S17 H;  3TN2 A;  4C3I G;  1STG A;  3GTQ H;  1B3A A;  2EYM A;  5D3D A;  2ZXR A;  2XRQ D;  1A8V A;  2UXC Q;  4B08 A;  3L2P A;  3ULP A;  4IQZ A;  2F0W A;  2PZU A;  2ZTD A;  1Q82 C;  4C3H H;  1X54 A;  1Q1B A;  5DM7 3;  2AHO B;  1O80 A;  3JAM L;  1B9N A;  1IL8 A;  3S2H H;  4G7H C;  5F2D A;  3RZO B;  5JEA G;  5FLM G;  3UDF A;  4G4K A;  3HOX B;  3RLN A;  2JE6 I;  3IKJ A;  4UP7 A;  2F0M A;  2RVL A;  3DM1 A;  2F0E A;  1SNP A;  5IWA L;  5BN3 A;  3VYS A;  2JA5 H;  3KF8 B;  3MEH A;  3M4Q A;  2E74 C;  4AYB B;  3S15 B;  2Z4I A;  3MFG A;  2F0S A;  4FNF A;  4BBS H;  2KA7 A;  1YHA A;  2NVX H;  2WAQ E;  2PI2 A;  4Q5V A;  2MO0 A;  3UDG A;  4HR7 B;  2CCZ A;  4LF8 Q;  3CD6 A;  4HIK A;  4FP5 D;  5IGF A;  5D14 A;  1R9T B;  4K8I A;  1BBX C;  1QNK A;  4A3C H;  3E3X A;  2ATW A;  1EQV A;  2CVR A;  2F52 A;  4NKL A;  1SSO A;  4PG3 A;  2EE1 A;  3V96 A;  4OWW B;  1S4Z A;  1KC8 C;  4BY1 B;  1CM9 A;  1J9O A;  1NMG A;  3CME A;  4YCU A;  4IOA A;  4B9X A;  4DR1 L;  3I91 A;  4CJ2 C;  5HGT A;  2VNU D;  3H91 A;  2ZJQ A;  1IYV A;  1DOK A;  4WFN 3;  5FO9 B;  1QVF A;  4HTH A;  4XT3 B;  3HOV B;  3K7A H;  1BVS A;  3D31 A;  4L5T A;  3AFP A;  2A1A A;  4C3J G;  2CQO A;  3C2P A;  4KMU C;  2K6A A;  1T5X D;  3M7G A;  4L63 B;  2DNE A;  4XQQ A;  3ULL A;  1YNJ C;  4DK6 C;  2IX1 A;  4DNI A;  4HN7 A;  3OW2 A;  5IGB A;  1BQQ T;  1ZYR D;  3CXC A;  4NP5 A;  2F0I A;  2JSO A;  2QW7 A;  3CMA A;  5DAU A;  2NZH A;  2VB3 X;  3CCS A;  4GKK Q;  2Z6B A;  2NWG A;  5M3F H;  2RDF A;  4K5V A;  1RDP D;  1F77 A;  4DV1 L;  4JPB W;  1CK1 A;  4A75 A;  1VQO A;  4JI3 Q;  4BXX H;  1TWG H;  5JEA J;  1RHP A;  3M4O B;  4DR4 Q;  3AEV A;  4N8F A;  5C0X I;  4QJF A;  5EPJ A;  1LT6 D;  1N36 L;  2WP8 J;  3I8Z A;  2DJG C;  3UE0 A;  1Y8N B;  1KTK A;  3TZU A;  2E2I B;  1QZH A;  3I7F A;  1IBM L;  1LYL A;  5HGQ A;  1WTW A;  1EEF D;  4H0L C;  4PZ8 A;  1A3V A;  1C48 A;  2MPM A;  3GTJ H;  2XSC A;  2LXJ A;  3U50 C;  1PH2 A;  3DM3 A;  1B4O A;  2K5H A;  1CKM A;  5LMU Q;  1CSP A;  2UXB L;  1BNZ A;  2K1B A;  3L9A X;  3CP0 A;  2QIL A;  4A3F H;  3QB3 A;  4IFD H;  5C4X H;  3BZK A;  1SAP A;  3CQZ H;  3QR8 A;  1SNM A;  3S14 H;  1QB5 D;  1GUT A;  3MA2 B;  4OEL B;  1G6P A;  1JWS D;  1T5E A;  1SE2 A;  2WIN B;  1JOR A;  3KYH C;  5C44 G;  2D9U A;  2BDN A;  3J7A 5;  2E8G A;  2MGS A;  3N6R A;  4QUC A;  4DK0 A;  1FL0 A;  2Y0S G;  5J1Z A;  1N8R C;  4BY7 B;  1B7Y B;  3O13 A;  1IBK Q;  1WFQ A;  2F1M A;  1OXX K;  1E1O A;  1TWH H;  3H0G B;  5KYL A;  4IAL A;  2JEA I;  5J3B A;  3DWA A;  3I4O A;  4B9W A;  3T1H L;  4L8J A;  5E3F A;  3NEM A;  1X3F A;  1PRT D;  2AMC B;  3KUP A;  3S1Q H;  5GAH C;  3WDN A;  3KJO A;  4A3G G;  4ODG A;  4LW1 A;  4XQN A;  5A2Q L;  1YJW A;  1TS4 A;  4X65 Q;  3E9H A;  4V19 0;  4GZY C;  4XYO A;  4JI8 Q;  2CFM A;  4RFB A;  4RA8 A;  4KHP Q;  3IFT A;  4RMF A;  2PQE A;  1EU4 A;  3K8A A;  5E4W C;  3GTM H;  5COY A;  1LTL A;  5J39 A;  4K5W A;  1EWC A;  1EY7 A;  2DY8 A;  1WD1 A;  1AH9 A;  5CYU A;  3PUX A;  1FJG Q;  1BDO A;  3M4P A;  5FO7 B;  4P74 A;  1EY6 A;  2ZTC A;  5GQO A;  2Z1C A;  4R4Q A;  3FEW X;  3D6C A;  1NJI C;  1VF7 A;  3KJP A;  4DV4 Q;  1WTX A;  4CHT B;  5K36 G;  4M8A A;  4QIW B;  1LTT D;  4DXG A;  4K0K Q;  1LTB D;  1EWI A;  4ZLT F;  1PDQ A;  2NN6 H;  2UXD Q;  2M00 A;  3T1Y Q;  2EYP A;  1EQQ A;  2OEO A;  3K6O A;  1DD2 A;  1VQN A;  3VYR A;  3W1B A;  4HMI A;  3T53 B;  3SVM A;  3SEB A;  1TS3 A;  2Z4H A;  1EFI D;  3OWE B;  2JA8 G;  1PFN A;  4GN3 B;  4HCS A;  4A3B G;  3S16 B;  3HOU G;  1C9O A;  2XTI A;  2K7V A;  1D2B A;  2JA7 B;  1MI2 A;  4FYD A;  4GS3 A;  1FD7 D;  1V9P A;  1DYQ A;  2NYZ D;  3OW7 A;  3FKI H;  1JJ2 A;  3H3V H;  5IT9 L;  4A93 H;  1LUZ A;  1MGS A;  3TSS A;  3DUZ A;  2WB1 G;  1QVG A;  5IT9 c;  1O7Y A;  1VQI A;  3RMH A;  3JAM E;  2ZM6 Q;  3CCR A;  1ENF A;  2F0P A;  1HFG A;  2UUB Q;  3J81 L;  1XYI A;  3M7N A;  1K8O A;  4R4C A;  3STB C;  5I6W A;  5KYI A;  5BN5 A;  1CHP D;  2XVS A;  3J81 c;  2BH8 A;  2B2W A;  2WII B;  4JCV E;  1HCZ A;  1OO9 B;  2OQK A;  2AUK A;  1WTQ A;  5JJZ A;  4DR3 L;  4OON A;  4EQN A;  1K83 H;  1RKN A;  1JE4 A;  1PH1 A;  1SFO B;  4DAM A;  3TQY A;  4DV2 L;  2VXW A;  1UEB A;  1Q3L A;  1V43 A;  3JAM i;  4OGQ C;  2JXM B;  5BR8 Q;  5G3L F;  4KTA A;  1H9R A;  4FXD A;  1VDZ A;  5KIX A;  3HOX G;  3C1F A;  1E3P A;  2G9D A;  2C9O A;  4DF7 A;  2MJ8 A;  2R92 G;  1SYB A;  4HMJ A;  3F2D A;  2UU9 Q;  2B2V A;  4I7Z C;  1S5B D;  1KL9 A;  4ZKC B;  1DON A;  2A5H A;  2R3Z A;  2KCN A;  3I4M B;  2F4I A;  4GKJ Q;  4EGV A;  3VR2 A;  4AYB G;  2EY1 A;  1PH4 A;  2HIX A;  1ASZ A;  2E2H H;  4H7B A;  2B63 H;  1IW7 D;  1PTO D;  5I9O A;  2N8N A;  5EPL A;  1X3G A;  2PZW A;  4P75 A;  1KNE A;  1LTG D;  1TR5 A;  1XX8 A;  4DV5 Q;  5EKI A;  3H94 A;  1B2T A;  4POG A;  1K3R A;  1TXY A;  2KEN A;  5JVG 3;  2UXC L;  1PVO A;  2A6E C;  2KCC A;  2R6G A;  2XIW A;  2FXQ A;  3FDT A;  2C35 B;  3NTI A;  3C3L A;  4JI1 Q;  2KQ3 A;  1SMX A;  3QJY A;  4CKC A;  2VY3 A;  1S40 A;  2EVB A;  2F0D A;  1WTV A;  3K5N A;  1STA A;  3G6J B;  1KHI A;  1K73 C;  2Q8R E;  1D5X C;  2JEB I;  3K5O A;  1YNN C;  1A0I A;  1SBB B;  5LMN Q;  3L0O A;  5D3I B;  2ZXO A;  4ME5 A;  1HRJ A;  1I5F A;  1VQD A;  1UE6 A;  2I0Q A;  2CWA A;  1W6K A;  2RHS B;  4P71 A;  2L12 A;  1I50 B;  2QEJ C;  1GUO A;  4MHE A;  4RAU C;  4GN5 A;  1U0L A;  3TDQ A;  2SOB A;  4JBJ A;  1HA6 A;  3NQI A;  1N36 Q;  3P75 A;  3BYY B;  1UE1 A;  5KGU A;  4LF8 L;  4RGT A;  4DNT B;  1HFN A;  1VMC A;  1FGB D;  5JVH 3;  2IHE A;  5K5P A;  3QWN A;  2WKD A;  4OL7 A;  3R3O A;  4KLK A;  3BDC A;  3RLF A;  3ERS X;  5ELD A;  1L1O A;  3AB9 A;  3PIP A;  4HJ7 A;  3T4A C;  5CV7 A;  2Q2H A;  5CR3 A;  2UXB Q;  1VQH A;  1QJO A;  2F0L A;  3J7A V;  3CCJ A;  2X6L A;  3HKZ E;  4F88 A;  1MJE A;  3PV0 A;  1Y8O B;  4C3J B;  1FR3 A;  1B9M A;  1RF2 D;  3KBG A;  1CZW A;  1LTA D;  2F3V A;  2QDL A;  1YNJ D;  3U58 A;  2OT2 A;  1ENC A;  3VR6 A;  1EWH A;  2EYH A;  1HR0 Q;  4JI7 Q;  3T16 A;  1I4H A;  5ISR A;  3TEH B;  4QB4 A;  1UWV A;  4RHR A;  2B2W C;  4A3L G;  1I4P A;  1SRO A;  4GKK L;  1XJV A;  1PV4 A;  4ZUI A;  1L1O B;  4JI3 L;  5A2Q E;  5M5W B;  1I4X A;  1KAB A;  4IN3 A;  4WJ4 A;  4I7A A;  1NTG A;  4DR4 L;  1BOS A;  2B2Y A;  1P16 A;  2K52 A;  5KEE A;  4OO1 G;  4LJZ C;  2YU9 B;  3Q24 A;  2O5J C;  2UUC L;  1SNQ A;  3GV6 A;  1Q90 A;  3GTG B;  5ELE A;  4HJ5 A;  2I46 A;  1ZEQ X;  4RGN A;  3R2T A;  2NTT A;  1ICW A;  1VQ6 A;  2YTY A;  1A2T A;  1NCV A;  1TWA H;  2HDM A;  2R93 H;  2B2V C;  1G51 A;  3CPF A;  1EIH A;  5LMU L;  2NVQ B;  2K5D A;  1EYA A;  2QKI C;  1CT1 D;  5JAV A;  4MTN A;  5C44 H;  4J8Q A;  2J0T D;  4CGY B;  1SR3 A;  4DV6 Q;  4G7Z C;  5C3E H;  1CA6 A;  4A3D G;  3NEN A;  3MZ5 A;  5M3M H;  2NVT B;  2K4K A;  4JBW A;  1EIF A;  1LV9 A;  1RTO A;  3H09 A;  3K5M A;  3PUZ A;  3M3Y B;  3WWV A;  1UE5 A;  1SE3 A;  5IT9 E;  2PYK A;  3A8I E;  1SJH D;  3TP8 A;  3BG3 A;  3P20 A;  5TSS A;  4A3G H;  1I4Q A;  1IBK L;  1Y1V G;  1I3Q B;  2OCE A;  1RD9 D;  3CRL C;  2KEC A;  3ITP A;  1EZ6 A;  1TU2 B;  3MHB A;  4DA2 A;  1S5F D;  2GVB A;  3A7L A;  3M9B A;  2EPB A;  5C4J H;  2JA7 G;  3NTK A;  3F2B A;  4JBM A;  3CU7 A;  4J1M A;  2RDH A;  2LFN A;  1X32 A;  1SDF A;  1JC7 A;  4PQX A;  3PO3 G;  4X65 L;  2AQ1 B;  4JI8 L;  2MO1 A;  4KHP L;  2XN9 C;  3J81 i;  2B2T A;  4IPG A;  2NVY H;  5M9O A;  4APV A;  2K01 A;  3I2Z A;  1HTL D;  1FJG L;  1B3Q A;  3ERQ A;  2Z6K A;  4B3M Q;  4IFD J;  2D2C C;  1V8Q A;  2K5Q A;  4IJL A;  4DV4 L;  3CF5 A;  4JK1 C;  3K80 C;  1VQ5 A;  4JOI A;  3PO2 G;  1JWM D;  4NMZ A;  2D5D A;  2B8G A;  3F1Z A;  2UXD L;  3T1Y L;  4A3I G;  3W3A A;  1L1O C;  4UP8 A;  2Z0S A;  2L11 A;  3S1R H;  4E6I A;  4X3S A;  1B70 B;  5GAD C;  2JA8 B;  3GTK B;  3SR1 A;  4A3B B;  1A15 A;  3HG9 A;  1HXY D;  1K8M A;  3K7U C;  3J80 L;  3HOU B;  2MFI A;  3DEO A;  2EYJ A;  1CSQ A;  3EN2 A;  4X3T A;  2L15 A;  3I4M G;  2R7Z G;  1K0R A;  2EDG A;  2JA6 B;  1D8L A;  4CDC C;  4YIJ A;  3TRZ A;  1SJE D;  4NPS A;  2V1C C;  2M9V A;  2PMZ B;  4A3E G;  4JI4 Q;  5ELN A;  4RWS C;  2F3I A;  2JA9 A;  4C2M B;  4CKE A;  4AIM A;  2NUC A;  2ZM6 L;  4LWC A;  3DLL A;  2B39 A;  2UUB L;  1SYD A;  3STB D;  4K6D A;  3TRE A;  1J6Q A;  2N49 A;  3RZO H;  1YZ6 A;  2RCN A;  1CHQ D;  4A3J B;  2J7Z A;  2HQE A;  4JC0 A;  1EYG A;  4HJ8 A;  1OXU A;  3E6Z X;  5ELO A;  1B50 A;  2FHT A;  2OWO A;  2B2Y C;  2BA1 A;  3BVM A;  1MKH A;  4IUV A;  4UPA A;  5BR8 L;  3GTL B;  1JT8 A;  1S5E D;  4NXM Q;  1WCM B;  4YWL A;  2CW0 D;  1TWF B;  4A3M G;  2R92 B;  4B3T Q;  2P5Z X;  3T56 B;  3S15 H;  4KI0 A;  1GHK A;  2XWJ B;  1RJT A;  1G2T A;  2EZV A;  3R2I A;  4JG2 A;  4LF4 Q;  3TS2 A;  3IFD A;  2VW9 A;  1PH5 A;  2UU9 L;  3HOY G;  1C0A A;  2F0K A;  4PZ7 A;  1R9T H;  5GRO A;  3S1N B;  1LT4 D;  3F8T A;  4H02 A;  4GKJ L;  3VR5 A;  4JBK A;  4C3H B;  3JC6 6;  3SHL A;  4BY1 H;  1GKH A;  5E1F A;  2DY7 A;  3ND8 A;  1TS5 A;  4LMQ D;  1Y69 U;  3DMU A;  3Q23 A;  4GN4 B;  2RSO A;  2PZT A;  2ENB A;  1D5Z C;  3HEJ A;  3F2U A;  2HHH Q;  3HOV H;  5CGK A;  2QDB A;  1O78 A;  4DV5 L;  1PH8 A;  2A6E D;  1SLJ A;  4CDD C;  1GHJ A;  1IYJ B;  1ICF B;  5GAE C;  1HNX Q;  3S9W A;  3A8K E;  2RKS A;  2CHB D;  4BBR H;  1JB7 A;  4JI1 L;  2LKV A;  3T51 B;  3HOW B;  5IYC H;  5M5Y H;  1BXT A;  3E5S A;  4KHZ A;  2NVX B;  2I5L X;  1KLG D;  5JJK A;  1YNN D;  2EOT A;  1P8L A;  4A76 A;  1TY0 A;  5LMN L;  3KLR A;  1IZ6 A;  4G57 A;  1F2Z A;  4POF A;  3NBH A;  1WTP A;  2F4V Q;  3VA5 A;  2L0C A;  2B2T C;  2D62 A;  2IX0 A;  2HCC A;  1QCB D;  4ZQ3 A;  3G6E A;  1Z7T A;  1H9M A;  1B44 D;  3NQT A;  2KHI A;  4X3K A;  4DR2 Q;  2B3G A;  2IPK D;  4ALP A;  4OO1 I;  1WYD A;  4WJW A;  2E2I H;  3HOZ H;  3PMF A;  2E5L Q;  5DEH A;  2OF1 A;  2Z6K C;  4IFD I;  2A68 C;  2VUM G;  4A3K H;  2UUC Q;  4R4T A;  5C3X A;  3SK5 A;  1PH9 A;  1K0S A;  1EU3 A;  2VQF L;  2KHJ A;  4JOI C;  1K8A C;  5IP9 H;  3NWT A;  5CV5 A;  1NMF A;  2F3W A;  1BBW A;  2KJX A;  2B8F A;  2H5X A;  2ZTE A;  2OXP A;  1KDB A;  4LF6 L;  2PPB C;  1F2L A;  3NBH B;  1E2Z A;  1DM0 B;  4JI6 L;  1V1P A;  2DN8 A;  3DEP A;  4N9T A;  3OPO A;  4KKS A;  2RHQ B;  3MXP A;  3KLW A;  1XPU A;  4IUP A;  3BS1 A;  3GV3 A;  4RCO A;  4AQY L;  4TSS A;  3KLS A;  4A3L H;  1AFP A;  2EJF C;  2Q2T A;  2XGT A;  3QIA A;  3VYT A;  1CKN A;  4Z9C B;  3ONA B;  2IT1 A;  5NUC A;  4U67 3;  4BY7 H;  3CC4 A;  1S72 A;  3LNN A;  1TY2 A;  2V4D A;  1NE3 A;  1H9K A;  2F0T A;  5IGC A;  3H0G H;  1HR0 L;  4JI7 L;  2Q8T A;  4IUU A;  1PYS B;  1E1T A;  1NAP A;  1V1O A;  1HNZ Q;  5C0X H;  4DKA C;  4LF5 Q;  1I4R A;  3CAM A;  2OTJ A;  3A55 A;  1N34 Q;  5I4D A;  1CFM A;  4BA2 I;  5IIF A;  2AKW B;  2MQH A;  2XRS D;  1F9P A;  4EX5 A;  1IKM A;  2K5W A;  1C4Q A;  4HJA A;  4J6H A;  4DR6 L;  1JB3 A;  2A69 D;  1AW7 A;  5HY6 A;  4ZYS A;  5FJ8 G;  4LFB L;  4C56 C;  1V1P B;  5C4X B;  1VQF A;  4HIO A;  4WRD A;  3OHX C;  3UI2 A;  3H15 A;  3TS0 A;  2O4X A;  3K58 A;  1MD2 D;  5C3W A;  4KKT A;  3S24 A;  1ASY A;  5CV8 A;  1CKN B;  2HIV A;  1TT2 A;  1PLF A;  1XPO A;  5CC4 A;  1KRT A;  2WAQ B;  2IHF A;  2K32 A;  3CHB D;  1D5M C;  3MEF A;  5KRU A;  1SYG A;  3VDY A;  4KK7 A;  5HUR A;  1TWH B;  4A3D B;  1SNC A;  1W2B A;  5H1S E;  1UEA B;  4XTC S;  1L2F A;  3J80 E;  1AN8 A;  1QUQ A;  4QL5 A;  4X66 Q;  4DV6 L;  3I4N G;  1TQO A;  4IPC A;  2YTV A;  1KDC A;  5IP7 H;  2CKZ B;  4CDF C;  4ZCK A;  3S16 H;  4YHH Q;  1NNX A;  4LFA Q;  2JA7 H;  3D8G A;  4DV0 L;  2BCO A;  1YEZ A;  1SYE A;  2E2J B;  1G2S A;  4GNX A;  1Y1V B;  3HKZ G;  4N9P A;  2WFW A;  1LAB A;  1AE3 A;  2ICI A;  1ONL A;  4ULL A;  2F0J A;  1FNU A;  4PNY A;  3J80 i;  3A54 A;  1L0X B;  4MZ9 A;  5IYD G;  2JA6 G;  1EEI D;  5I2X A;  4DV7 Q;  1U4P A;  1NR4 A;  1HQR D;  3I4L A;  3PO3 B;  1JJG A;  1ROD A;  3L7Z C;  3CCE A;  2PQA A;  1SRU A;  1VQ8 A;  3D4D A;  2QA4 A;  4OHJ A;  1JCK B;  1CUK A;  1QUQ B;  3NWS A;  4R8I A;  2SDF A;  2WV6 D;  4HCE A;  3EA6 A;  1PYB A;  4ID6 A;  2I07 B;  4X3U A;  2BE5 C;  4B3R Q;  4A3J G;  2HDL A;  1Q8I A;  1NUC A;  1Y1W G;  2J4X A;  3D4R A;  4GNX B;  4LFC Q;  4B3M L;  3PO2 B;  4QMG A;  4TVA B;  4OX9 L;  1WTO A;  4A3I B;  4O42 A;  1EOV A;  3NHH A;  3I4M H;  3NE5 B;  1WCM G;  4R9W A;  3J7Y W;  4EQO A;  4KY5 A;  5IYB G;  3BJU A;  2DNC A;  4C3I H;  1M4V A;  2PQA B;  2AQ2 B;  5ELB A;  2R61 A;  2R7Z B;  1EQR A;  5GAG C;  3TP7 A;  4CJ1 B;  4NXN Q;  5JPN C;  4C3H G;  1ZXT A;  4A3E B;  3OOC A;  3MXN A;  1SE8 A;  4JI4 L;  3PUW A;  1HZB A;  4L5R C;  3OSO A;  5CV9 A;  3J7Z C;  1IBL Q;  4DUZ Q;  1WD0 A;  1Z6H A;  2LMC B;  1HH2 P;  1UNS A;  5JEA H;  5FLM H;  2F0V A;  1PYW D;  4LF9 Q;  1PZK D;  2JA5 G;  3X3N A;  4TKO B; 
#chains in the Genus database with same CATH homology
 4FXG C;  1HUN A;  2K28 A;  5EJW A;  1F9S A;  4UAI A;  1F9Q A;  4QF4 A;  1SYC A;  2B2U A;  3ERO A;  1Z47 A;  2AQ3 B;  4KV6 A;  4A3M B;  2EY5 A;  2B63 B;  2TMP A;  1WVL A;  1II3 A;  3Q6S A;  4C1N I;  1JR0 D;  3QOJ A;  2EXZ A;  3HOY B;  2QF7 A;  4LK1 C;  2KUM A;  1Y8P B;  3CRK C;  4XT1 B;  5I2Y A;  1SMY C;  3NPP A;  3PUV A;  1O7Z A;  1I4G A;  2KED A;  4L6T B;  3NXW A;  4ZK9 B;  2F0H A;  3TME A;  1U4R A;  3MXG A;  5IGG A;  4HED A;  4RHS A;  4K2K A;  2FMM A;  3X3M A;  2Q8I B;  1Q12 A;  3N52 A;  3I3C A;  3A8J E;  3G7L A;  4DFA A;  3NP8 A;  2K03 A;  3S1M B;  1F2M A;  4RCN A;  5CV4 A;  3BZD B;  3SK4 A;  1DXM A;  4H13 C;  2C5C A;  3RZD B;  5T1I A;  5FLX L;  3URY A;  4H44 C;  3VYU A;  3E0J A;  4FF3 A;  2H1E A;  2E76 C;  1PTO H;  2VUM B;  2A6H C;  2A68 D;  5EBC A;  2KHS A;  3NK9 A;  1BCP F;  4OIJ A;  4IFD G;  2RA4 A;  1C8C A;  5CV6 A;  2F0U A;  1GJX A;  3GO5 A;  3U9S A;  1TS2 A;  4UDU C;  3EQL C;  3S2D B;  1MBY A;  3GQB A;  2JP1 A;  5LL6 S;  3L3O C;  3GTP B;  1O7L A;  1S5D D;  2LS0 1;  5IGD A;  5IOC A;  1PFM A;  1DOL A;  4XIG S;  1SND A;  3K57 A;  1CA5 A;  4HSP A;  4DK1 A;  2PCF B;  2K33 A;  3K59 A;  1G8Z D;  1DCZ A;  1A6X A;  1BUV T;  3FPU B;  1EYD A;  4G7O C;  2R93 B;  3NBI A;  3J81 E;  5FKA C;  1SXT A;  4ZKB B;  1OXV A;  3FMC A;  1SEB D;  3D3R A;  3GTO B;  2B2U C;  5I6Y A;  5FK9 C;  4Y7N B;  2F03 A;  1VF5 C;  3K0Y A;  3P7J A;  4F8M A;  5K36 H;  5M3M B;  5FOB B;  1TII D;  1D1I A;  2F0G A;  4FF2 A;  5M5X B;  4IZ8 A;  3D4W A;  2N88 A;  4ZRZ A;  1X3P A;  2HCI A;  3A7A B;  2EY2 A;  4CKB A;  3PIP 3;  1TVX A;  3PUY A;  3W2D A;  3I4N B;  4ZAI A;  1PXU A;  4CBV A;  1EY4 A;  4IUR A;  1G91 A;  5C5L A;  4PV1 C;  3HKZ B;  4FF4 A;  1HA5 A;  1KAA A;  1RTN A;  3AU7 A;  1QIL A;  1IYU A;  3MAQ A;  2N55 A;  1CI3 M;  5FO8 B;  1TWC B;  1JOO A;  3M85 A;  2MP1 A;  3HGB A;  2BA0 A;  3I70 A;  1U4M A;  1LTS D;  2EJG C;  4V0B A;  3HP3 A;  4ZUJ A;  3EFX D;  2BE5 D;  2ID0 A;  1Y1W B;  5JOB A;  1Q1E A;  1PMR A;  3RUZ A;  1BO0 A;  3TBI B;  3KBX A;  4KN4 C;  3DWP A;  2E75 C;  3AMU A;  1GXD C;  2QCP X;  1EZ8 A;  3S17 B;  2CQA A;  1A2U A;  3GTQ B;  3TP5 A;  2RSN A;  4DGZ A;  3MFY A;  1IHZ A;  1FNW A;  3BDO A;  4KJN A;  4KJO A;  3S2H B;  2RBM A;  1A3T A;  3LX0 A;  1PFB A;  1ILQ A;  1E2V A;  3MTS A;  1HUM A;  1BCP B;  3OMG A;  3BDL A;  3ZYY X;  2JA5 B;  2K05 A;  3NSW A;  4XQJ A;  2XNA C;  3OIQ A;  1TKW B;  3NTH A;  4DAY A;  4P2C B;  1GUW A;  5FLX E;  2BDO A;  5J22 A;  2F0N A;  1JWU D;  1NSN S;  4BBS B;  4RH6 A;  1SE4 A;  2EYF A;  1EY0 A;  1HHV A;  4RGM A;  1UUP A;  3R93 A;  3VR4 A;  1MSG A;  3OWF A;  2IW3 A;  2AWN A;  3FRP B;  4MIU A;  4QCL A;  4C1N K;  3BYT B;  1SMY D;  3DWQ A;  2IWH A;  2BOS A;  4O1N A;  4BBR B;  3K7A B;  4DN4 M;  1RCV D;  1LTR D;  2GA4 B;  4KHV A;  5M5Y B;  2PW7 A;  4EVO A;  1LLR D;  1OXS C;  4FXK C;  4PMC A;  2PO4 A;  1GOZ A;  1NR2 A;  3LWU A;  5M3F B;  2FJ2 A;  3WOF A;  4BA1 I;  4PMW A;  2L5T A;  1PRT F;  5BN4 A;  1TWG B;  3HOZ B;  3SK6 A;  3V05 A;  4A3K B;  5CBA E;  2L55 A;  4OO1 H;  2YYZ A;  2KEE A;  3Q0A A;  4FVM A;  5E4X A;  5ELF A;  3ND9 A;  1AZP A;  3GTJ B;  4TQU S;  1MSH A;  3J7A F;  1QG7 A;  2A6H D;  2AWO A;  2PNR C;  2KOL A;  4DNR B;  5COR A;  4A3F B;  3CKI B;  2X69 A;  2AUJ D;  1BCP C;  3CQZ B;  3I73 A;  3QOL A;  4XDX A;  3S14 B;  4RGO S;  2ZT9 C;  3MWY W;  1AZQ A;  2NN6 I;  4K5X A;  1AP0 A;  2VB2 X;  4F7X A;  2WAC A;  3SE0 A;  4BWG B;  1LT3 D;  3QG1 A;  3SDZ A;  1L0Y B;  3Q22 A;  5KNC A;  1BR9 A;  1WTR A;  1E0B A;  3BVZ A;  4NW2 A;  1XXG A;  1D1K A;  1HPC A;  3S1Q B;  1ML0 D;  2LY7 A;  1XTC D;  5EKL A;  2EY6 A;  3TP6 A;  5D65 A;  3GTM B;  4I65 A;  4HSV A;  3VR3 A;  2A73 B;  3I90 A;  1M8A A;  1LO5 D;  2KVM A;  1IKL A;  3BVG A;  1A3U A;  3GD7 A;  5ELC A;  4DU9 A;  1QE6 A;  5C6A A;  4CJ0 B;  4U68 A;  3HRZ C;  3I72 A;  3MVV A;  1PTO F;  4KD3 A;  4KN7 C;  5LL6 X;  3MC0 B;  4KY6 A;  1JQY D;  3RD4 A;  3FKI B;  1G6Z A;  4A93 B;  1CTM A;  1CZG A;  1R4Q B;  2E2D C;  2FIN B;  1EQT A;  1DOM A;  1GUG A;  5C4Z A;  1E2W A;  1K83 B;  2CW0 C;  4IUN A;  1BF4 A;  1LAC A;  4TRD A;  5JPM C;  1HQM C;  3FPP A;  5C4H A;  5EQ0 A;  5T1G A;  2EYL A;  2K04 A;  1S5C D;  3GP7 A;  4S3S A;  1EY8 A;  1F9R A;  2L1B A;  3HZX A;  4C3I B;  1EOT A;  1JIC A;  2F0Q A;  2EJM A;  1U4L A;  1W6J A;  2IL8 A;  3M4Y A;  2M2L A;  1ESR A;  4KKU A;  2E2H B;  3HS0 C;  5G3L D;  3WOE A;  4ABN A;  5LHY 1;  1PRT B;  4EQP A;  1FNV A;  3SK8 A;  4IUT A;  5CBE E;  2Z8L A;  2ZXP A;  4KD4 A;  3IL8 A;  3OIP A;  1DZ1 A;  5EBD A;  2L9H A;  1KDA A;  2SNM A;  1PZJ D;  3U9O A;  3LWE A;  1STH A;  4K6L A;  2ICE C;  1ZYR C;  2TSS A;  3V2T A;  1X3Q A;  2XWB B;  4R8N A;  3OMC A;  2F0F A;  3IAY A;  3DXJ C;  1G29 1;  2H4O A;  5C5M A;  2L4N A;  3KK7 A;  4RKL A;  1ZKO A;  1EIG A;  5I9P A;  4MN3 A;  1FYC A;  2IX3 A;  1VCI A;  2HUG A;  2FFK B;  4FF1 A;  4BS9 A;  3H3V C;  1STB A;  1B53 A;  4Q0F A;  3P1H A;  1I6V C;  1KLU D;  2RQX A;  1QWY A;  2EYO A;  1ENA A;  3T13 A;  4DAV A;  1LTI D;  1D6E C;  1F2Y A;  4HAE A;  1QOH A;  2O2L D;  5DNF A;  2JYO A;  2SEB D;  1R4P B;  2IJ0 A;  1CQV A;  4WOR A;  1CQF A;  1ET6 A;  4LAA A;  1QNU A;  1GUS A;  1EYC A;  2A74 C;  5AFW A;  2A69 C;  1DJR D;  3EJI A;  4IUQ A;  3H6M A;  5C0X G;  2G9H D;  1SNO A;  1PRT C;  1VMP A;  4FO2 A;  3C46 A;  1PTO B;  1EY9 A;  1AEX A;  5KND A;  5IOD A;  5EGT A;  4K8J A;  4NDX A;  1EL0 A;  1ET9 A;  3EVQ A;  1TWA B;  3PIO 3;  3A56 A;  2NTS A;  3SXH A;  1STN A;  4PMB A;  3VA7 A;  5C44 B;  1BCP D;  5IGE A;  2Y0S B;  5A35 A;  1ESF A;  1LT5 D;  3FVQ A;  5C3E B;  4M1U B;  1UAP A;  1OXT A;  2NN6 G;  4DAP A;  4KY7 A;  1EY5 A;  3D6W A;  4A3G B;  3DHQ A;  1HTP A;  4K2L A;  2SNS A;  4ILW A;  2F0O A;  1STE A;  4F87 A;  5C4J B;  2MHV A;  3TZD A;  1PZI D;  4K14 A;  3QO2 A;  2RDG A;  1I6H B;  1H9S A;  1U9R A;  4DXF A;  5CMD A;  5KNB A;  1KNA A;  5DM6 3;  5C0X J;  1ILP A;  1GUN A;  3NUC A;  4OIK A;  1H9J A;  3MXU A;  2NB0 A;  2NVY B;  4XXE A;  4RKB A;  2X6G A;  1JOQ A;  2NBF A;  1JOK A;  5EPK A;  1B1Z A;  1XWE A;  4QUF A;  2O5I C;  3KLS X;  1STY A;  3R8B A;  2NZ1 D;  3K5L A;  2PW5 A;  1SYF A;  2FMC A;  2MUY A;  1J8I A;  3S1R B;  1IW7 C;  1H9S B;  1PTO C;  2WB1 B;  2WKC A;  5EKK A;  3KF8 A;  4XYQ A;  3C1E A;  3TN2 A;  4C3I G;  1STG A;  1B3A A;  2EYM A;  5D3D A;  2ZXR A;  2XRQ D;  4B08 A;  4IQZ A;  2F0W A;  2PZU A;  1Q1B A;  5DM7 3;  1O80 A;  3JAM L;  1B9N A;  1IL8 A;  4G7H C;  5F2D A;  3RZO B;  5JEA G;  4G4K A;  3HOX B;  2JE6 I;  3IKJ A;  2F0M A;  2RVL A;  3DM1 A;  2F0E A;  1SNP A;  5BN3 A;  3VYS A;  3MEH A;  2E74 C;  4AYB B;  3S15 B;  2Z4I A;  3MFG A;  2F0S A;  4FNF A;  2KA7 A;  4Q5V A;  4HR7 B;  4FP5 D;  5IGF A;  5D14 A;  1R9T B;  4K8I A;  1BBX C;  1QNK A;  1EQV A;  2CVR A;  4NKL A;  1SSO A;  2EE1 A;  3V96 A;  1S4Z A;  4BY1 B;  1CM9 A;  1J9O A;  4B9X A;  3I91 A;  4CJ2 C;  5HGT A;  2VNU D;  3H91 A;  1IYV A;  1DOK A;  4WFN 3;  5FO9 B;  4HTH A;  4XT3 B;  3HOV B;  3D31 A;  4C3J G;  3C2P A;  4KMU C;  2K6A A;  1T5X D;  3M7G A;  4L63 B;  2DNE A;  4XQQ A;  1YNJ C;  2IX1 A;  4HN7 A;  5IGB A;  1BQQ T;  1ZYR D;  4NP5 A;  2F0I A;  2JSO A;  5DAU A;  2VB3 X;  2NWG A;  2RDF A;  4K5V A;  1RDP D;  1F77 A;  1CK1 A;  5JEA J;  1RHP A;  3M4O B;  5C0X I;  5EPJ A;  1LT6 D;  2WP8 J;  3I8Z A;  1Y8N B;  1KTK A;  3TZU A;  2E2I B;  1WTW A;  1EEF D;  4H0L C;  1A3V A;  1C48 A;  2MPM A;  2XSC A;  1B4O A;  1BNZ A;  2K1B A;  3L9A X;  2QIL A;  3QB3 A;  4IFD H;  1SAP A;  1SNM A;  1QB5 D;  1GUT A;  3MA2 B;  1JWS D;  1T5E A;  1SE2 A;  2WIN B;  1JOR A;  2D9U A;  2BDN A;  2MGS A;  3N6R A;  4QUC A;  4DK0 A;  5J1Z A;  4BY7 B;  3O13 A;  2F1M A;  1OXX K;  3H0G B;  5KYL A;  4IAL A;  2JEA I;  3DWA A;  4B9W A;  4L8J A;  5E3F A;  1PRT D;  3KUP A;  3WDN A;  4ODG A;  4XQN A;  5A2Q L;  1TS4 A;  4V19 0;  4GZY C;  4XYO A;  4RFB A;  4RA8 A;  3IFT A;  2PQE A;  1EU4 A;  5E4W C;  5COY A;  5J39 A;  4K5W A;  1EWC A;  1EY7 A;  2DY8 A;  1WD1 A;  5CYU A;  3PUX A;  1BDO A;  5FO7 B;  1EY6 A;  2Z1C A;  3FEW X;  3D6C A;  1VF7 A;  5K36 G;  1WTX A;  4CHT B;  4M8A A;  4QIW B;  1LTT D;  4DXG A;  1LTB D;  4ZLT F;  1PDQ A;  2NN6 H;  2M00 A;  2EYP A;  2OEO A;  3K6O A;  1DD2 A;  3VYR A;  4HMI A;  3T53 B;  3SVM A;  3SEB A;  1TS3 A;  2Z4H A;  1EFI D;  3OWE B;  1PFN A;  4HCS A;  3S16 B;  2K7V A;  1D2B A;  2JA7 B;  1MI2 A;  4FYD A;  1FD7 D;  2NYZ D;  1DYQ A;  3OW7 A;  5IT9 L;  1MGS A;  3TSS A;  3DUZ A;  1O7Y A;  3RMH A;  3JAM E;  1ENF A;  2F0P A;  1HFG A;  3J81 L;  1XYI A;  3M7N A;  1K8O A;  5I6W A;  5KYI A;  5BN5 A;  1CHP D;  2XVS A;  2WII B;  2B2W A;  1HCZ A;  1OO9 B;  2AUK A;  1WTQ A;  5JJZ A;  4EQN A;  1RKN A;  1JE4 A;  1SFO B;  2VXW A;  1Q3L A;  1V43 A;  4OGQ C;  2JXM B;  5G3L F;  4KTA A;  1H9R A;  4FXD A;  1VDZ A;  5KIX A;  3C1F A;  2G9D A;  2C9O A;  4DF7 A;  2MJ8 A;  1SYB A;  4HMJ A;  2B2V A;  4I7Z C;  1S5B D;  4ZKC B;  1DON A;  2A5H A;  2R3Z A;  2KCN A;  3I4M B;  2F4I A;  4EGV A;  3VR2 A;  2EY1 A;  4H7B A;  1IW7 D;  1PTO D;  5I9O A;  5EPL A;  2PZW A;  1KNE A;  1LTG D;  1TR5 A;  1XX8 A;  5EKI A;  3H94 A;  1B2T A;  5JVG 3;  2A6E C;  2KCC A;  2R6G A;  2XIW A;  3FDT A;  3NTI A;  3C3L A;  2KQ3 A;  3QJY A;  4CKC A;  2EVB A;  2F0D A;  1WTV A;  3K5N A;  1STA A;  3G6J B;  2Q8R E;  1D5X C;  2JEB I;  3K5O A;  1YNN C;  1SBB B;  5D3I B;  2ZXO A;  4ME5 A;  1HRJ A;  1W6K A;  2L12 A;  1I50 B;  2QEJ C;  1GUO A;  4MHE A;  4RAU C;  3TDQ A;  2SOB A;  1HA6 A;  3NQI A;  3P75 A;  3BYY B;  5KGU A;  4RGT A;  4DNT B;  1HFN A;  1VMC A;  1FGB D;  5JVH 3;  5K5P A;  3QWN A;  2WKD A;  4OL7 A;  3R3O A;  3BDC A;  3RLF A;  5ELD A;  3AB9 A;  3T4A C;  5CV7 A;  5CR3 A;  1QJO A;  2F0L A;  3J7A V;  2X6L A;  4F88 A;  3PV0 A;  1Y8O B;  4C3J B;  1FR3 A;  1B9M A;  1RF2 D;  3KBG A;  1CZW A;  1LTA D;  2F3V A;  1YNJ D;  2OT2 A;  1ENC A;  3VR6 A;  1EWH A;  2EYH A;  3T16 A;  1I4H A;  5ISR A;  4QB4 A;  4RHR A;  2B2W C;  1I4P A;  4ZUI A;  5A2Q E;  5M5W B;  1I4X A;  1KAB A;  4IN3 A;  1BOS A;  2B2Y A;  5KEE A;  4OO1 G;  4LJZ C;  2YU9 B;  3Q24 A;  2O5J C;  1SNQ A;  3GV6 A;  1Q90 A;  3GTG B;  5ELE A;  2I46 A;  1ZEQ X;  4RGN A;  3R2T A;  2NTT A;  1ICW A;  1A2T A;  1NCV A;  2HDM A;  2B2V C;  1EIH A;  2NVQ B;  2K5D A;  1EYA A;  2QKI C;  1CT1 D;  5JAV A;  4J8Q A;  2J0T D;  4CGY B;  4G7Z C;  1CA6 A;  3MZ5 A;  2NVT B;  4JBW A;  1LV9 A;  1RTO A;  3H09 A;  3K5M A;  3PUZ A;  3M3Y B;  1SE3 A;  5IT9 E;  2PYK A;  3A8I E;  1SJH D;  3TP8 A;  3BG3 A;  3P20 A;  5TSS A;  1I4Q A;  1I3Q B;  1RD9 D;  3CRL C;  2KEC A;  3ITP A;  1EZ6 A;  1TU2 B;  3MHB A;  4DA2 A;  1S5F D;  3A7L A;  2EPB A;  3NTK A;  3CU7 A;  4J1M A;  2RDH A;  2LFN A;  1X32 A;  1SDF A;  1JC7 A;  4PQX A;  2AQ1 B;  2XN9 C;  2B2T A;  5M9O A;  2K01 A;  1HTL D;  3ERQ A;  4IFD J;  2D2C C;  1V8Q A;  2K5Q A;  4JK1 C;  1JWM D;  4NMZ A;  2D5D A;  2B8G A;  3W3A A;  2L11 A;  4E6I A;  4X3S A;  2JA8 B;  3GTK B;  3SR1 A;  4A3B B;  1A15 A;  3HG9 A;  1HXY D;  1K8M A;  3J80 L;  3HOU B;  3DEO A;  2EYJ A;  4X3T A;  2EDG A;  2JA6 B;  4YIJ A;  1SJE D;  2M9V A;  2PMZ B;  4RWS C;  4C2M B;  4CKE A;  2NUC A;  2B39 A;  1SYD A;  4K6D A;  1CHQ D;  4A3J B;  2J7Z A;  2HQE A;  1OXU A;  3E6Z X;  1B50 A;  2FHT A;  2B2Y C;  2BA1 A;  3BVM A;  4IUV A;  3GTL B;  1S5E D;  1WCM B;  2CW0 D;  1TWF B;  2R92 B;  3T56 B;  4KI0 A;  1GHK A;  2XWJ B;  1RJT A;  1G2T A;  2EZV A;  3R2I A;  3IFD A;  2F0K A;  3S1N B;  1LT4 D;  3VR5 A;  4C3H B;  3SHL A;  5E1F A;  2DY7 A;  3ND8 A;  1TS5 A;  4LMQ D;  1Y69 U;  3DMU A;  3Q23 A;  2RSO A;  2PZT A;  2ENB A;  1D5Z C;  3HEJ A;  3F2U A;  5CGK A;  2QDB A;  1O78 A;  2A6E D;  1GHJ A;  3S9W A;  3A8K E;  2RKS A;  2CHB D;  2LKV A;  3T51 B;  3HOW B;  1BXT A;  3E5S A;  4KHZ A;  2NVX B;  1KLG D;  1YNN D;  2EOT A;  1TY0 A;  3KLR A;  4G57 A;  1F2Z A;  3NBH A;  1WTP A;  3VA5 A;  2L0C A;  2B2T C;  2D62 A;  2IX0 A;  2HCC A;  1QCB D;  4ZQ3 A;  1Z7T A;  1H9M A;  1B44 D;  3NQT A;  4X3K A;  2IPK D;  4OO1 I;  4WJW A;  3PMF A;  5DEH A;  2OF1 A;  4IFD I;  2A68 C;  5C3X A;  3SK5 A;  1EU3 A;  3NWT A;  5CV5 A;  2F3W A;  2KJX A;  2B8F A;  2OXP A;  1KDB A;  2PPB C;  1F2L A;  1E2Z A;  1DM0 B;  1V1P A;  2DN8 A;  3DEP A;  4N9T A;  3OPO A;  4KKS A;  3MXP A;  4IUP A;  3BS1 A;  3GV3 A;  4RCO A;  4TSS A;  3KLS A;  1AFP A;  2EJF C;  3QIA A;  3VYT A;  4Z9C B;  5NUC A;  3ONA B;  2IT1 A;  4U67 3;  3LNN A;  1TY2 A;  2V4D A;  1H9K A;  2F0T A;  5IGC A;  2Q8T A;  4IUU A;  1NAP A;  1V1O A;  5C0X H;  1I4R A;  3A55 A;  5I4D A;  1CFM A;  4BA2 I;  5IIF A;  2XRS D;  1F9P A;  1IKM A;  2K5W A;  1C4Q A;  4J6H A;  1JB3 A;  2A69 D;  1AW7 A;  4ZYS A;  4C56 C;  1V1P B;  5C4X B;  4WRD A;  3OHX C;  3UI2 A;  2O4X A;  3K58 A;  1MD2 D;  5C3W A;  4KKT A;  5CV8 A;  1TT2 A;  1PLF A;  5CC4 A;  2WAQ B;  2K32 A;  3CHB D;  5KRU A;  1D5M C;  1SYG A;  4KK7 A;  5HUR A;  1TWH B;  4A3D B;  1SNC A;  1UEA B;  4XTC S;  3J80 E;  1AN8 A;  1TQO A;  1KDC A;  3D8G A;  2BCO A;  1SYE A;  2E2J B;  1G2S A;  1Y1V B;  4N9P A;  1LAB A;  2ICI A;  1ONL A;  4ULL A;  2F0J A;  1FNU A;  4PNY A;  3A54 A;  1L0X B;  1EEI D;  5I2X A;  1U4P A;  1NR4 A;  1HQR D;  3I4L A;  3PO3 B;  1ROD A;  3L7Z C;  3D4D A;  4OHJ A;  1JCK B;  3NWS A;  4R8I A;  2SDF A;  2WV6 D;  4HCE A;  3EA6 A;  4ID6 A;  2I07 B;  4X3U A;  2BE5 C;  2HDL A;  1Q8I A;  1NUC A;  2J4X A;  3D4R A;  3PO2 B;  4QMG A;  1WTO A;  4A3I B;  4O42 A;  3NHH A;  3NE5 B;  4R9W A;  3J7Y W;  4EQO A;  4KY5 A;  2DNC A;  1M4V A;  2AQ2 B;  5ELB A;  2R61 A;  2R7Z B;  3TP7 A;  4CJ1 B;  5JPN C;  4C3H G;  1ZXT A;  4A3E B;  3OOC A;  3MXN A;  3PUW A;  3OSO A;  5CV9 A;  1WD0 A;  1Z6H A;  2LMC B;  1UNS A;  5JEA H;  2F0V A;  1PYW D;  1PZK D;  3X3N A;  4TKO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...