2IHFA

Crystal structure of deletion mutant delta 228-252 r190a of the single-stranded dna binding protein from thermus aquaticus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
235
structure length
205
Chain Sequence
MARGLNQVFLIGTLTARPDMRYTPGGLAILDLNLAGQDAFTDESGQEREVPWYHRVRLLGRQAEMWGDLLEKGQLIFVEGRLEYRQWEKDGEKKSEVQVRAEFIDPLEGRGRALNQVILMGNLTRDPDLRYTPQGTAVVRLGLAVNEERTHFLEVQAWRELAEWASELAKGDGLLVIGRLVNDRFQTRVEALRLERPLEDFPPEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 3D structure of Thermus aquaticus single-stranded DNA-binding protein gives insight into the functioning of SSB proteins.
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Dna binding protein
molecule keywords Single-stranded DNA-binding protein
total genus 34
structure length 205
sequence length 235
ec nomenclature
pdb deposition date 2006-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ihfA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ihfA02
4IPHA 1S72A 3PUWA 1JT8A 3CAMA 1EOVA 1SMXA 4PZ7A 4DV1L 1SROA 4DV6L 2JA7G 1PH4A 2LXJA 4JV5L 4AYBE 1A62A 4A3LG 1KL9A 3KF8B 1S3OA 4R1JA 5IWAQ 5C0XG 2UXCQ 3PCOB 1JJCB 1UE1A 2K75A 2UU9L 3S1NH 2UXDQ 2PNHA 2BH8A 2OTJA 3GTOH 1HNWL 3TRZA 3GTPH 3H3VI 2UU9Q 2OQ0A 3KJOA 3UDXA 1KQSA 4AYBG 2JA6G 3S15H 3L2PA 2NZOA 4LFBQ 1C7YA 1UWVA 4JI5Q 5FJ8G 1TWFH 1VQMA 2LXKA 1N36L 1RIPA 1UEBA 2CQOA 3AYHB 1Q8KA 1K83H 4DR3Q 5GAGC 4EX5A 1JMCA 1QUQB 1WYDA 2ZJQA 1VQ4A 2HIVA 4DUYL 3JAMc 1D8LA 3CW2C 4JI5L 2OCEA 4H02A 1P16A 2VZAA 4JOIA 1T9HA 1YHQA 4X65L 3VDYA 2F4VQ 5M5XH 3PO2H 1SRUA 1HZBA 4YCWA 4A3IG 2E5LL 3CCUA 2GN5A 4IFDI 3K8AA 3G6EA 1PH1A 1EYGA 2AWNA 3MXNB 5M3FG 3KF6B 2E2HH 3GTLH 4X6AH 4BY1H 4J15A 3EIVA 4KHZA 1NBWA 4YWLA 2R6GA 3K7AH 1FVIA 1B8AA 2KHIA 1Q46A 1VQBA 4X66L 1EIYB 3CPWA 1KC8C 1LTLA 4P72A 4LF6L 3FP9A 3HOYG 4R4OA 1JJGA 1BBWA 5GQOA 4A3KH 1IBKQ 5C0XI 4C3HH 5IYBH 4OWXB 1V9PA 1TWHH 4KHPL 3M3YH 4GLXA 3KF6A 2OQKA 3W1BA 4KI0A 2QGQA 1UE6A 4HJ9A 1B7YB 4X65Q 3UDIA 3S16H 3I4OA 4JI3L 2VQEQ 3RNUA 1VQ8A 1X3GA 3UDGA 4DUYQ 2JEAI 1Q7YC 3KJPA 2R92H 4QGUA 1CKNA 3RZDH 3MEFA 1HZ9A 3UE0A 4HJ5A 4JI6L 1L2FA 4LFAL 4DR1L 1XTDA 2H5XA 1EQQA 2D62A 3U50C 2Y0SE 3PUZA 4YWMA 4IO9A 1VQ7A 4PG3A 1IBKL 4IOAA 4JI7L 2NN6G 2F3IA 4X62L 1G6PA 4B3ML 2YTXA 4NB3A 2JE6I 3CCVA 4OX9Q 1FJGQ 3E9IA 4Y7NH 5IP7H 2E8GA 4A4IA 1E1TA 3K81C 5BR8Q 1EUJA 1PH6A 1WCMG 3K7UC 3CCQA 1VQ6A 4Y52H 1LUZA 2Q2UA 2R7ZH 4C3JH 4BBSH 2JJQA 1VQCA 1N32L 5C44G 1I94Q 4BA2I 3HKSA 5LMNW 2WP8J 1XNQQ 3RLOA 2Q2IA 1OXUA 2D0PA 5K36G 5FLMH 2I0QA 1CKOA 1I5FA 2NVYH 1M90C 1M1KC 4O0AA 4DR6L 1AE3A 4UY8C 1TXYA 4LFBL 3FKIG 3TEHB 4KLKA 3F8TA 3EN2A 1EIFA 2DGYA 1FGUA 1P8LA 2BA1A 2D0OA 2JK8A 2QEXA 3WWVA 3HOVH 5M3MH 1VS0A 4JI1L 1X3FA 4R4TA 2GVAA 2HIXA 2YYZA 3M85A 1PH7A 2WAQE 1NJIC 1DGSA 4BBRG 5IP7G 2YU9H 4LFCQ 5FLMG 2A19A 1I94L 2NVQH 4A3MG 1VCIA 4OWTB 4KHPQ 4JBWA 2UUCL 2PI2A 2ASBA 5HGQA 2FXQA 4DV5L 2L15A 1YBYA 3L0OA 4L5QA 5BR8L 1A63A 4BY7H 2K5NA 3E0EA 4GOPB 3HOWG 4MTNA 1CKNB 3M9BA 4GN5A 2K50A 1PH8A 1FJGL 3HOZG 3A0JA 2JQOA 5HY6A 3PUVA 4GKKQ 4GLAC 3HKZG 2IX0A 1L1OC 4HIDA 1KAWA 5AJ3L 4DNIA 3OTOQ 3U58A 1BBUA 3CP0A 1QVFA 4A3FH 5GROA 3GTGH 3HOUH 4A3CG 2MO1A 1OXVA 3OYYA 1GKHA 5GAHC 2C35B 1KHIA 1J5EL 3CCMA 5GADC 1E7ZA 4HJAA 3CF5A 2YTYA 4RG1A 1VQ5A 4YHHL 3HKZE 2B63H 1NMFA 4P74A 3I4NH 3B6YA 2JA5H 2IY5B 4FDBA 1D7QA 3M4QA 5E7NA 1IYJB 2I5LX 4OO1I 1N36Q 4GKJQ 3S17H 1YHAA 2LSSA 5C0XJ 4BY7G 4JI2L 1Y14B 3CPFA 3F2CA 1QZGA 1HZCA 3KOJA 2UXCL 4DV4L 4A3FG 4A3KG 1CKMA 3I7FA 1O7IA 2CFMA 1Q1EA 2Z6KC 3STBC 4X66Q 2I5HA 4JI2Q 4NXNL 2MNAA 4HIMA 4DR5Q 1XMOQ 1JB7A 2IHFA 4B3RL 1A0IA 4RMFA 3ZJYC 3K0XA 4BBRH 1SN8A 2AMCB 1SLJA 4LF7Q 2MFIA 5IE8A 1I50H 3AFQA 3GTQH 1X65A 1MKHA 2CCZA 5H1SE 1NTGA 4BY1G 3HOVG 1X54A 1G291 2E5LQ 1XJVA 1QZHA 2AKWB 2N49A 3BZCA 4DR3L 3NEMA 2UUAL 1Y1VH 1WJJA 5DLQE 4YCUA 3CMAA 4JI1Q 4C3IH 1KRSA 1C9OA 1VQGA 2JEBI 4DAYB 3CCJA 1PV4A 1IL2A 3BZKA 1E1OA 1QUQA 5LMNL 1R9TH 5IT9c 1VQNA 1OXXK 3DM3A 2F52A 1XPUA 4GKKL 1E22A 1N33Q 1VQAA 4A76A 2CKZB 3I55A 3H3VH 1KRTA 2ZTCA 1PYSB 5FJ8H 3LGJA 2UXDL 3RR5A 4JBJA 4UP8A 1H95A 1Y1VG 1YITA 2UUCQ 1YJWA 4P71A 4IPDA 3F2BA 1N34Q 3GTJH 4TVAB 4PZ8A 1XPOA 4IJHA 3S14H 1KIXA 3PIPA 4B3MQ 2R7ZG 4BBSG 3HOXH 4DV0Q 1K8AC 4JI8Q 3A74A 1EQRA 1A8VA 2ZTEA 4ME3A 1SR3A 1K73C 2RHQB 1N33L 1PFSA 3STBD 1YJ9A 4DPGA 4K0KQ 4DUZQ 4A3JG 2KENA 1U5KA 4LWCA 4A75A 4DV7Q 2ZJRA 2OWOA 3T1HQ 3RN5A 1HR0W 4P75A 1X9NA 1HR0Q 4GNXA 2B63G 1Y1WG 2K5HA 2HT1A 2VS1A 1V1QA 3ER0A 2CWAA 2RF4A 5JEAG 4DR7L 4HIOA 4JI6Q 3DLLA 1XMQL 1XNQL 2B3GA 5IYBG 2R93H 2YTVA 4DR2L 3S1RH 1VQFA 1W3SA 1IBLQ 4HJ7A 3M4OH 4JG2A 4EQ5A 2Y0SG 4A3JH 1XMQQ 3OTOL 2JA9A 1HZAA 2XGTA 2JA8G 2EIFA 2VNUD 1HR0L 4OX9L 2K52A 4A3CH 4BXXH 2MO0A 1Q1BA 4A93G 1LM0A 4X64Q 4JYAQ 5JJIA 3CC2A 1HNZL 1IZ6A 4MZ9A 4YY3L 1N8RC 1PH3A 5JEAJ 1N34L 4P73A 1HNWQ 4GS3A 1GVPA 3J80i 1K8GA 4DV5Q 1V43A 1CUKA 4IPCA 3HOWH 3AFPA 4LF4Q 4LF5L 3J7ZC 2Z0SA 1LYLA 1UE5A 3RLNA 4DR2Q 4XIGS 4IFDJ 4YHHQ 1MIUA 1WFQA 1VQLA 4A3MH 3UE1A 3TQYA 4DK3C 5IP9H 4JBMA 3GD7A 3PV0A 3U4ZA 1YNXA 1EFWA 1HH2P 4R4IA 1MJEA 3F1ZA 5AJ3Q 4JCVE 4L5SA 4QQBX 3GTMH 4DUZL 1NY4A 3PF4A 2WAQG 3PUYA 1K9MC 5EAYA 4DR4Q 3NBHB 3AQQA 1XNRQ 3FHWA 4A3EG 1VQ9A 1W2BA 3I4MG 1AE2A 3TREA 1WCMH 2ID0A 4LUZA 1SE8A 1UE7A 4NXML 1RL2A 4A3LH 4GNXB 1PH9A 1Z9FA 3J81j 1ASZA 4WJ4A 4OONA 2AWOA 2Z6KA 3CCLA 4HJ8A 1U0LA 4LF7L 3L7ZC 3CC7A 2VUMG 1I6HH 4DKAC 4IPGA 2HQLA 4LUOA 4DV6Q 1HNXQ 2NZHA 3NELA 4ALPA 4B3RQ 1J6QA 3JAMi 1IXRA 4GNXC 3G48A 3CXCA 1BVSA 4X62Q 2VW9A 2B29A 4IJLA 4DK6C 1VQOA 1AH9A 4IOCA 5IY0A 1IBMQ 1XNRL 4MNOA 1I3QH 1XMOL 1YI2A 1JE5A 2N78A 4DV2Q 1VQKA 3H15A 2R92G 5IYCG 4APVA 1HJPA 1X3EA 2JA5G 4DR6Q 2N3SA 1YIJA 1QVCA 4GN4B 3T1YQ 4C2MH 2E2IH 4OO1G 3IRBA 3RZOH 2EXDA 3EBEA 2VQFL 3J80c 2I5MX 1L1OA 3I56A 3M7NA 2HHHL 3PF5A 3HOUG 1FL0A 3H0GG 3PO3G 4DR7Q 4A3GG 4LF5Q 2NVXH 4LF4L 1GD7A 4B3TQ 4YY3Q 2IT1A 4JI3Q 1Q86C 3HOYH 3T1YL 1YHBA 2ZTDA 1Q82C 3JC66 3S1MH 4DV3L 2ES2A 3HOZH 4WJ3M 1CSQA 4QJFA 4JV5Q 4PMWA 5C4JH 5JJKA 4DR5L 4NXNQ 2YV5A 1G51A 2KCMA 4YWKA 3CD6A 4TQUS 2ALYB 3S1QH 4JYAL 1VQHA 3OW2A 2RHSB 3HFZB 4IFDG 4GOPA 1WI5A 2CWPA 2GVBA 4A3GH 3PO3H 3RN2A 3KLWA 4BXXG 2UUBL 1ASYA 3KDFB 5M5WH 4AH6A 4AQYQ 1K3RA 5ELNA 1PH2A 2PI2E 3TS2A 1VQPA 4HIKA 5M3MG 2IHEA 2E2JH 4NPSA 2R7FA 5J3BA 4LF8Q 2VQEL 4A3BH 1L0WA 5IYCH 2AHOB 5M3FH 1YZ6A 3FKIH 4LFCL 4QY7A 1K0RA 4JI4Q 1JJ2A 2R93G 2PMZE 4DR4L 4A3DH 4LNQA 3S2HH 4JOIC 2ZJPA 1KD1C 2EQSA 3PO2G 4K0KL 3E9HA 5GAEC 1E24A 4R4QA 3U4VA 1IBML 1OTCA 2JA6H 4JC0A 4GLVB 2WFWA 4JI0Q 1Q81C 3J81i 1Y1WH 3GTKH 2UUAQ 4POGA 5C44H 2WB1G 2K14A 2ZM6L 3CCEA 4JI4L 3CCSA 4JBKA 2VY3A 3G71A 2BH2A 3AEVA 1N32Q 1TWAH 1WOCA 1YEZA 3A5ZB 5ELOA 5C3EH 3I2ZA 1PHJA 2JA7H 5IWAL 1S40A 4A3EH 3I4MH 1X55A 2A1AA 3PUXA 2UUBQ 3GO5A 2Q2HA 3GDEA 2VUMH 4GKJL 3Q8DA 4UP7A 2R7DA 2ATWA 1TWCH 1X6OA 4DV4Q 3BU2A 5C3EG 4JI0L 2DUDA 1QVGA 2N8NA 1MJCA 3M4PA 1YJNA 2A8VA 4A3DG 2QA4A 2ZM6Q 4DAMA 4UPAA 3J81c 4B3SL 5FLXc 3K80C 2UXBQ 4LFAQ 4BA1I 4DV3Q 1GM5A 5LMNQ 2RCNA 4QL5A 4JI7Q 4L5RC 1OXSC 3BJUA 1BKBA 3KFUA 2MQHA 1NE3A 1E3PA 2XTIA 1PA6A 2K5VA 1IBLL 4GN3B 4B3TL 3ERSX 4DR1Q 1SFOH 5C4XG 3SGIA 3CCRA 2HHHQ 1Z47A 4YCVA 5IP9G 3KDFA 3KYHC 4QIWE 1GO3E 2VQFQ 4AQYL 3CC4A 4LF8L 1PH5A 5IYDG 4A93H 2Q2TA 4A3BG 3CMEA 1B70B 3S24A 3G4SA 4DV7L 2K4KA 3PSIA 4X64L 3ULPA 1X56A 2V1CC 3F2DA 5JJLA 4DV2L 4DV1Q 1HNZQ 3J7A5 2BA0A 4LW1A 4JI8L 2OTLA 2PQAB 4PZ6A 1PVOA 1CSPA 1YVCA 5IYDH 5LMUL 1KXLA 1TWGH 4XTCS 3PGZA 3D31A 2IX1A 3NENA 2PQAA 4A3IH 1L1OB 3ULJA 1HNXL 1PYBA 1VQJA 1XPRA 4LF9L 1VQDA 2JA8H 1VQIA 2VL6A 1VQEA 3W5OA 4NXMQ 3TS0A 3A5UA 3PIOA 4GOPC 4R4CA 3ICEA 3W1GA 1EWIA 3UDFA 2KBNA 3CQZH 2KCTA 4LUVA 3I4NG 2NN6I 4O2DA 3RLFA 3ULLA 1OXTA 3T1HL 3H0GH 1J5EQ 2F4VL 1Q12A 4LF9Q 4L5TA 2NVTH 4UP9A 4POFA 5M5YH 3HOXG 4OWWB 2WB1E 5C4XH 3D0FA 1NMGA 5LMUQ 4OXPA 1C0AA 1N9WA 4AIMA 4DV0L 4LF6Q 4B3SQ 2UXBL 2KHJA 3S2DH
chains in the Genus database with same CATH superfamily
2ICEC 1EOVA 4DV1L 1MHWC 1SROA 2JA7G 2JA8B 1PH4A 2SNSA 1KL9A 4K8IA 1TWAB 3PMFA 1JJCB 5DNFA 1D2BA 2MPMA 5COYA 3GTOH 1WTXA 5M5XB 1RODA 3VA7A 4XQQA 3MWYW 2VB2X 5IODA 1BNZA 1W6KA 1IW7C 4CJ2C 5FJ8G 2K5DA 2LXKA 1A2UA 1UEBA 4FXKC 1K83H 5LL6X 5KNDA 4EX5A 3NXWA 1QUQB 1TVXA 4DUYL 1D8LA 2HUGA 4JI5L 2OCEA 4B9XA 2VZAA 2L1BA 4JOIA 2F4VQ 3PO2H 2IX3A 4P2CB 4A3IG 3CCUA 2HDLA 2GN5A 4HMJA 3K8AA 4F87A 2MHVA 1TT2A 1EYGA 3MFGA 1L0XB 1LV9A 1STGA 1LABA 1WTWA 1IYUA 4ILWA 1MGSA 5IIFA 4WFN3 3GTJB 1Q46A 1VQBA 1EIYB 1VMCA 4LF6L 5GQOA 3S1RB 2A5HA 4C3HH 3LWEA 5G3LF 1SNQA 1E0BA 3KF6A 1K3BC 4GLXA 3A55A 3UDIA 4GZYC 2MP1A 4JI3L 1I4RA 1Q7YC 4OEMB 4QGUA 1SNOA 1CKNA 4HJ5A 1IKLA 4WJWA 1WTHA 1QCBD 3SK6A 4IOAA 3HP3A 5JEAH 2G9DA 2WKCA 1BF4A 2ZXPA 1G6PA 2QCPX 5LHY1 4OX9Q 2JE6I 3S2DB 4OIJA 3ERQA 4Y7NH 3K81C 1PH6A 4JW0A 5EKIA 3CCQA 1S5BD 4BBSH 1EIGA 5HURA 1VQCA 1N32L 3GTGB 2NVQB 2D0PA 3BZDB 3NPPA 1CKOA 1I5FA 2FINB 4O0AA 4CBVA 1U4LA 2IPKD 2PNRC 2D0OA 2BA1A 1TWCB 1V1PA 1VS0A 1B53A 1BR9A 2DNCA 2WAQE 1DGSA 4KKUA 5A2QE 1EU3A 1VCIA 1EU4A 2KEDA 2FXQA 2SOBA 1YBYA 1STHA 4BY7H 3E0EA 3E5SA 4WRDA 2Y0SB 1JC7A 2B2TC 1ZKOA 4HIDA 3PQIA 3OSOA 3OTOQ 4XYQA 4A3FH 2MO1A 1Z7TA 5CV6A 1GKHA 1DONA 3CU7A 1J5EL 1TQOA 5GADC 2KHSA 1E2WA 4RG1A 1VQ5A 2NVYB 3HKZE 1BUVT 1EZ6A 5C4JB 4P74A 2O2LD 3B6YA 2XRQD 4RWSC 3U9SA 2NTSA 1U4MA 2HD3A 5CGKA 3KLSX 1IYJB 3K5OA 4EVOA 4JI2L 4RGOS 1S4ZA 5E3FA 3X3MA 4DV4L 2CH4A 5CBAE 1O7IA 3FVQA 3RMHA 4X66Q 2UXCQ 1J8IA 4F7XA 1A0IA 3K0XA 1YNJD 2MFIA 1I50H 3HEJA 2FFKB 1X65A 3CHBD 4LJZC 3UI2A 4G7ZC 2EYPA 5NUCA 3HOVG 4X3TA 1XJVA 3VYRA 4DR3L 2IL8A 4YCUA 1VQGA 4QMGA 5FK9C 3BZKA 1STBA 1QUQA 4PNYA 1XPUA 1PRTD 3K58A 2LMCB 4CKBA 2K6AA 1XYIA 1FR3A 2CKZB 3H3VH 1PRTB 1KRTA 3DXJC 4Z9CB 5FJ8H 1NCVA 3LGJA 1LTTD 5DAUA 4JBJA 3RR5A 2UXDL 1H95A 1YJWA 1N34Q 4FVMA 2XNAC 2RCFA 4B3MQ 1DOKA 1I4XA 1KDBA 4DV0Q 2Q8TA 3STBD 4DPGA 4DUZQ 4A3JG 2NTTA 1G8ZD 2ZJRA 3RN5A 1HR0W 2B63G 2JXMB 2QEJC 5C6AA 2IW3A 3QJYA 2WV6D 3DLLA 4K6LA 2E75C 2KVMA 1VQFA 3NUCA 4EQ5A 1H9SA 1WTOA 1HZAA 4HCSA 2JA8G 1JE4A 4DK1A 2VNUD 5G3LD 1RKNA 3OMCA 5BN3A 2CVRA 2EYOA 1PDQA 2JYOA 3CC2A 4MZ9A 1N34L 1HNWQ 1RDPD 3NTHA 4DV5Q 1V43A 1X3QA 1LYLA 1HUMA 4DR2Q 3E6ZX 4BY7B 5CV7A 5IP9H 4N9PA 4JBMA 3U4ZA 1Y1VB 4FXGC 1ESFA 2EVBA 1TS4A 4DR4Q 3PUYA 3ND8A 1VQ9A 3R2TA 3TREA 4XYOA 2PPBC 2RSOA 2ID0A 1U9RA 4LUZA 3BDLA 1RL2A 1Z9FA 2DY7A 3TZUA 4XQJA 3CCLA 4RFBA 4LF7L 4O1NA 4DKAC 4IPGA 2NZHA 3GTKB 3JAMi 4UAIA 3GP7A 1PTOC 4IOCA 2KCNA 4MNOA 1YI2A 2N78A 1SEBD 4HN7A 1SYGA 1YNNC 1PFMA 4HAEA 4C2MH 2E2IH 1JB3A 3HRZC 4R9WA 1G2TA 2EXDA 5M3MB 2VQFL 3J80c 1TY2A 3M7NA 2HHHL 3PF5A 2EYJA 4A3GG 3S1NB 4YY3Q 3KK7A 2F03A 3HOYH 3T1YL 2EOTA 1I4QA 2ZTDA 1HTPA 3HOZH 4WJ3M 4JV5Q 4ZKBB 1LT3D 2O4XA 2F0PA 4KMUC 2RDFA 4DR5L 4NXNQ 1PTOH 2WB1B 2KCMA 2YV5A 4TQUS 4HR7B 1VQHA 1QB5D 1CQFA 2RHSB 3HFZB 2GVBA 3PO3H 4BXXG 3KLRA 1PH2A 2PI2E 1GUWA 1QOHA 1HFNA 4OO1H 5M3MG 2I46A 2L5TA 1EY7A 1L0WA 4LFCL 2F1MA 2RSNA 1JJ2A 2R93G 4KY7A 4DR4L 3PO2G 3E9HA 3K59A 2JA6H 1NSNS 4GLVB 2UUAQ 2WB1G 4PMCA 4JI4L 4JBKA 2F0UA 3A8IE 1KAAA 4BS9A 3AEVA 1N32Q 1SE3A 3H91A 1WOCA 1YEZA 1G2SA 3A5ZB 5EPLA 3VR4A 5C3EH 3A56A 3HOXB 2JA7H 2Z9HA 1X3PA 1S40A 3I4MH 5C3XA 4H44C 1G91A 2R7DA 4JI0L 2DUDA 2N8NA 1ICWA 2QA4A 1EY5A 3J81c 2UXBQ 4V0BA 4DV3Q 2P5ZX 3BJUA 1NE3A 1S5CD 2PW5A 3SGIA 3CCRA 4BWGB 3BDOA 2B2VA 3KYHC 1JR0D 2NZ1D 3CC4A 3IFDA 2JSOA 4A3BG 3S24A 2ZXRA 1X56A 2RBMA 4DV2L 4DV1Q 1HNZQ 3J7A5 1LTGD 1HFGA 3EJIA 4PZ6A 2EE1A 1Z6HA 5IGDA 2OTLA 5M5YB 1TWGH 1H9KA 1E2ZA 3NENA 3NHHA 1F2LA 1DXMA 1HNXL 1PXUA 2JA8H 2NUCA 2KUMA 2XSCA 3EFXD 1NR4A 4NXMQ 5EKKA 3TS0A 5C3WA 4GOPC 4RHRA 3GTOB 3SHLA 4LUVA 5C4HA 1EEID 3ULLA 4ABNA 1J5EQ 2B2YA 1V1OA 4OWWB 3D0FA 5CORA 5LMUQ 4OXPA 1C0AA 4AIMA 4FNFA 1F2ZA 1HA5A 4IPHA 1SMXA 2BDNA 2LXJA 4AYBE 1WD1A 1JQYD 5C0XG 1A3UA 1UE1A 3QR8A 3TRZA 2TMPA 3H3VI 4BBRB 3KJOA 1F9SA 1BCPD 4O42A 3S15H 1R4PB 3L2PA 2NZOA 4LFBQ 1O7ZA 1UWVA 3VR3A 4LMQD 1TWFH 1LACA 2Z4HA 4IUVA 3Q0AA 1VQMA 4B08A 3AYHB 4DR3Q 5GAGC 2O5IC 4G7HC 1JMCA 4Q5VA 2EY1A 2ZT9C 3CW2C 4H02A 2RKSA 3P7JA 5I6WA 4DXFA 2J4XA 2E2DC 4DFAA 2AWNA 3MXNB 1STAA 4JPBW 1WTRA 3EIVA 4KHZA 4MTKA 4ME5A 3IKJA 4YWLA 3TN2A 2R6GA 1H9SB 2BE5C 1ONLA 2AUJD 1LTLA 3AU7A 3PIO3 1PFNA 1QNKA 4R4OA 1BBWA 3R2IA 5IYBH 1TWGB 4KHPL 1PYWD 1UE6A 3S16H 3I4OA 2VQEQ 1X3GA 2JEAI 4XT3B 2R92H 4CKEA 3RZDH 3MEFA 3UE0A 1CTMA 3QOJA 4OELB 1L2FA 4LFAL 4DR1L 1EQQA 3U50C 3HOUB 2EJGC 5BN5A 3PUZA 4IO9A 2E2JB 4R8NA 4RCOA 2F3IA 1EY9A 2HQEA 3QO2A 3NSWA 2B2WA 2F0QA 2QF7A 1EFID 3E9IA 4KN7C 2E8GA 1O80A 3I72A 1EUJA 1WCMG 3K7UC 1LUZA 4E6IA 4A3FB 4G4KA 5LMNW 2WP8J 2Q2IA 5K36G 1M1KC 1H9RA 3DUZA 4DF7A 1Y8NB 4UY8C 2EPBA 4KLKA 4BY1B 1EIFA 3F2UA 3A8JE 3HOVH 3KF8A 2N55A 1H9MA 1TIID 1G6ZA 1AN8A 5EJWA 3W2DA 2GVAA 3O13A 2HIXA 5JOBA 4ZLTF 2K33A 3WOEA 5IP7G 4LFCQ 2NVQH 2LKVA 1XTCD 3SK8A 1HHVA 2PI2A 5HGQA 4ZCKA 3L0OA 5BR8L 1WTVA 5IGBA 1CKNB 4GN5A 2K50A 2VB3X 3HOZG 2K01A 4GKKQ 2SEBD 1QVFA 5AJ3L 3U58A 3J81E 3GTGH 5GROA 3HOUH 4A3CG 1WD0A 1OXVA 1BOSA 1CQVA 5GAHC 1KHIA 2R93B 3A54A 1E7ZA 5IGGA 3H3VC 4YHHL 1QE6A 3S15B 4HTHA 1H9JA 5T1IA 5EKLA 5C5MA 2AUKA 1SAPA 4X3UA 1Y8PB 1N36Q 3S17H 3NP8A 2UXCL 1Y14B 3CPFA 1QZGA 2NVXB 1HZCA 1V1PB 1T5EA 1FYCA 3W3AA 2K5WA 3G7LA 2CFMA 3HOZB 4KJNA 3MZ5A 3DEPA 4JI2Q 1JB7A 3MA2B 1Q90A 3M4OB 4RMFA 4S3SA 4RA8A 2R61A 2EY5A 3K5LA 2PO4A 4ZK9B 1NTGA 2E5LQ 1ESRA 1EEFD 1XXGA 3QOLA 2UUAL 5JAVA 3SVMA 3CMAA 3BVGA 2JEBI 1C9OA 1E1OA 1VQNA 4NKLA 5IT9c 5FO7B 1BCPC 2Z6BA 4GKKL 1ICFB 3QWNA 1EY6A 3EROA 1BO0A 2ZTCA 1PYSB 3J80E 1A15A 5C4ZA 3GTJH 2AQ3B 4IJHA 2F0WA 1KIXA 3FKIB 3HOXH 1K8AC 1K73C 2RHQB 4DN4M 1YJ9A 4K0KQ 2QW7A 1D5MC 4LWCA 2VUMB 2OWOA 3T1HQ 4P75A 1X9NA 4GNXA 3D6CA 3ER0A 2RF4A 2F0DA 4HIOA 4I7AA 4KV6A 2B3GA 5IYBG 2R93H 2YTVA 3S1RH 1W3SA 1IBLQ 4MN3A 5D3DA 3OTOL 2XGTA 1HA6A 1XWEA 2K52A 3NQIA 3HOVB 2F0KA 1DYQA 5CV4A 4JYAQ 5JJIA 5JJZA 4PMBA 1HNZL 1IZ6A 5KNCA 4GS3A 1GVPA 1CUKA 4LF4Q 1STNA 4IFDJ 2Z0SA 1UE5A 1WFQA 1VQLA 3UE1A 2KOLA 4DK3C 1DOLA 2F0IA 4J6HA 2WIIB 3PV0A 1PTOF 2BDOA 4R4IA 1MJEA 4JCVE 3TDQA 3Q6SA 1KNAA 3GTMH 1NY4A 1RTOA 3PF4A 2WAQG 1K9MC 5EAYA 5EQ0A 1FGBD 1CI3M 3FHWA 4A3EG 1A2TA 1KLUD 3L9AX 2PW7A 5EPJA 3OWFA 1ENAA 1UE7A 4NXML 1PH9A 3C2PA 5CMDA 1ASZA 2AWOA 1U0LA 3L7ZC 4LUOA 1HNXQ 4DV6Q 2F0VA 5CV8A 4B3RQ 4HSPA 4GNXC 1FNVA 1BDOA 3G48A 4IJLA 5J1ZA 1B4OA 1IBMQ 1XNRL 1I3QH 1BCPB 3H15A 5IYCG 2X6LA 2B8GA 4LK1C 2N3SA 2NN6H 2WAQB 3RZOH 3J80L 4K5XA 5M5WB 3NBHA 2I5MX 1S5ED 4YIJA 3HOUG 4C1NI 5D65A 1GD7A 5ELCA 4B3TQ 3Q22A 1SE4A 2SDFA 1YHBA 4DV3L 4CDFC 5C4JH 5JJKA 3S1QH 4YWKA 3I3CA 3I4NB 2L11A 2DJFC 1DM0B 4IFDG 4GOPA 4EQNA 4Y7NB 2BE5D 2EJMA 2F0LA 2EY6A 3KLWA 4N8FA 3D4WA 3KDFB 5CV5A 4AH6A 4AQYQ 4ZUIA 3KBXA 4OIKA 3TS2A 1AEXA 4HIKA 2F0SA 2EYLA 4A3BH 3K5MA 5IYCH 3CRLC 3OMGA 5M3FH 1YZ6A 4QY7A 3R8BA 4JI4Q 3GTQB 4LNQA 4K5VA 4JOIC 4K0KL 2PYKA 3C46A 1X32A 4KK7A 5GAEC 1E24A 4R4QA 3DWAA 3U4VA 5K36H 1JOOA 4POGA 2LY7A 2ZM6L 3CCSA 2B8FA 4J8QA 4ZYSA 3G71A 4K8JA 2A74C 3I2ZA 1B44D 1E2VA 3ZYYX 4L6TB 4A3EH 2A1AA 3D4RA 5J22A 2OXPA 3T4AC 2ZXOA 1ZYRC 1Q8IA 5C3EG 2TSSA 1MBYA 1YJNA 2A8VA 1S5DD 4IUNA 4DNTB 3IFTA 1ET6A 5EBDA 4CDEC 1GM5A 4QL5A 3KLSA 1OXSC 1BKBA 1HPCA 3MAQA 2MQHA 1PA6A 2K5VA 4B3TL 4GN3B 5TSSA 5C4XG 3RUZA 2FMCA 4AQYL 5IYDG 4A93H 2EY2A 2A6HC 4DNRB 3CMEA 1KTKA 2V1CC 5JJLA 1Y8OB 2F0TA 3DMUA 1CZGA 4JI8L 5C3EB 1PVOA 1CSPA 1YVCA 1QJOA 1KXLA 4XTCS 3OW7A 3D31A 2IX1A 1L1OB 3TZDA 1VQJA 4RAUC 1XPRA 4TRDA 1VQEA 3W5OA 3A5UA 3D8GA 4R4CA 3ICEA 1EWIA 3UDFA 3CQZH 2KCTA 5T1GA 2NN6I 2F4VL 2B2WC 4RKLA 4LF9Q 4UP9A 3LNNA 4C3HB 1ILQA 2RDGA 4ULLA 4POFA 3HOXG 4MHEA 1NMGA 2NBFA 1I4GA 1N9WA 4DV0L 4LF6Q 1KDCA 3URYA 3S2DH 2FJ2A 5I6YA 3PUWA 5JVG3 1JT8A 3CAMA 4K2LA 2HDMA 4PZ7A 3SK4A 2KQ3A 4JV5L 1SYFA 1AZPA 1A62A 4A3LG 1JORA 3KF8B 5IWAQ 1S3OA 4R1JA 4WJ4A 3PCOB 2UXDQ 2PNHA 2BH8A 2OTJA 1EYAA 1HNWL 3BYTB 2UU9Q 2X69A 1S5FD 4UHVA 1MSGA 1O78A 1C7YA 5D3IB 1RIPA 2CQOA 1UAPA 1WYDA 4OL7A 2L12A 3JAMc 3TP7A 2XN9C 2L9HA 3BYYB 4IURA 4C3IG 3VDYA 4TSSA 1D5ZC 1HZBA 3OOCA 2E5LL 4IFDI 2CHBD 3S16B 1SYEA 3D6WA 3KF6B 1OO9B 2E2HH 3GTLH 4X6AH 4J15A 5EBCA 4B9WA 1DOMA 1TS2A 2A6HD 1FVIA 5IT9L 3IL8A 1WVLA 3CPWA 4FF1A 1LTSD 4A3KH 2E74C 3FMCA 3GTPB 2G9HD 4OWXB 1ZXTA 3M3YH 2E76C 3HOWB 3W1BA 1EWCA 4KI0A 3NWTA 1B7YB 1AZQA 1GUOA 2KECA 1MI2A 3JAML 1HZ9A 4JI6L 1LTAD 1XTDA 2H5XA 2H1EA 3T16A 4CKCA 1GHKA 2D62A 2EYMA 1YNND 4PG3A 1IBKL 1JICA 4JI7L 2OT2A 4IUTA 2F0HA 2F0JA 1PZID 2F0NA 4IUUA 3FPPA 1I6VC 1PTOD 4A4IA 4PV1C 1E1TA 5BR8Q 4EGVA 2RDHA 4KY6A 1VQ6A 4KD4A 4Y52H 3SR1A 2M2LA 4X3KA 2JJQA 5CV9A 5C44G 3BG3A 4BA2I 3HKSA 5D14A 5A2QL 3RLOA 3M7GA 5FLMH 1O7LA 4G57A 4I65A 4RCNA 1M90C 4F8MA 4EQPA 4U673 1LTBD 3RD4A 4DR6L 5FO8B 3F8TA 2V4DA 2DGYA 1FGUA 1P8LA 3HS0C 2JK8A 5M3MH 4JI1L 3S17B 1X3FA 4R4TA 1PH7A 1NJIC 2F3VA 4KHVA 2YU9H 3AMUA 1AW7A 1CHQD 3ND9A 4JBWA 5EGTA 4R8IA 4FXDA 2K5NA 4XDXA 4IUPA 4X3SA 3Q24A 4GOPB 5C0XH 4MTNA 3MC0B 3TP8A 2A6ED 3A0JA 2JQOA 3MEHA 1K8MA 3CRKC 4GLAC 3HKZG 1L1OC 3GV3A 1KAWA 5FLXE 1BBUA 2Q8RE 3CP0A 2WKDA 3WDNA 5E4XA 1D5XC 3OYYA 4KKTA 1CHPD 2C35B 3CCMA 1BQQT 2YTYA 2BCOA 4CDCC 1NMFA 5J39A 3I4NH 2IJ0A 1B3AA 1TY0A 3M4QA 5JPMC 1RHPA 2I5LX 1YHAA 2LSSA 5C0XJ 4BY7G 5FLXL 1TR5A 3KOJA 2F3WA 4A3FG 4A3KG 3I7FA 4K14A 3STBC 1XMOQ 1SE2A 4NXNL 2MNAA 4HIMA 4DR5Q 4B3RL 1WTPA 2IHFA 5IGCA 3SXHA 4BBRH 2AMCB 1SLJA 3GTQH 1F2MA 1MKHA 5H1SE 3SEBA 4BY1G 1G291 2D9UA 4BBSB 1SMYC 2N49A 2PZUA 3VR5A 3BZCA 1TS3A 3NEMA 3T56B 1Y1VH 5ELBA 4N8X1 3PIP3 4JI1Q 3MFYA 1KRSA 4RGNA 3NBIA 1PLFA 4C3IH 3CCJA 5LMNL 1R9TH 1OXXK 3DM3A 5CBEE 5A35A 1N33Q 1VQAA 4IALA 4A76A 1A3TA 3I55A 1GUTA 4HEDA 4UP8A 3J81L 1ENCA 1YITA 1FD7D 4IPDA 4QIWB 1KNEA 3F2BA 4TVAB 1HCZA 3WOFA 1XPOA 1VDZA 5DM73 4BBSG 1YNJC 1Q3LA 1HRJA 1A8VA 2ZTEA 1SR3A 1N33L 1PFSA 2KA7A 5BN4A 2KENA 3MHBA 2JA6B 4A75A 4DV7Q 1CM9A 1KDAA 4QF4A 1HR0Q 2B2UA 1Y1WG 2A68C 3K7AB 2CWAA 3OPOA 3NWSA 1PZKD 4C3HG 5C5LA 4DR2L 4WORA 4JG2A 2Y0SG 4A3JH 1XMQQ 2JA9A 1GXDC 5ELEA 3G6JB 3NQTA 1SYDA 4MIUA 4OX9L 1DJRD 1SNCA 1SDFA 3D3RA 4BXXH 2MO0A 3PO3B 4A93G 4X64Q 2QKIC 3SE0A 3K5NA 4CHTB 1N8RC 2YU9B 2B2VC 2SNMA 3ITPA 3HOWH 3AFPA 5KYIA 4LF5L 1GHJA 1F9RA 4XIGS 4YHHQ 1MIUA 2JN4A 2IWHA 2J0TD 4A3MH 3TQYA 1GUNA 3A8KE 1F2YA 3GD7A 1EFWA 3F1ZA 3I70A 2AQ2B 1VF7A 4OGQC 4QB4A 4C3IB 4QQBX 2N88A 4DUZL 2LFNA 2F0FA 3NBHB 3AQQA 2NVTB 1XNRQ 3I4MG 1W2BA 2EXZA 3BDCA 4GNXB 3J81j 4OONA 3E0JA 1EWHA 2VUMG 2HQLA 3NELA 1MSHA 4ALPA 1J6QA 3I73A 1IXRA 2B2UC 3OIQA 3CXCA 1BVSA 2B29A 1VQOA 1PMRA 4KTAA 4A3BB 5KEEA 1XMOL 3OHXC 4DV2Q 1HJPA 1X3EA 2Z1CA 3NE5B 3A7AB 4DR6Q 4FF2A 3DWPA 1NUCA 4GN4B 4FF3A 4OO1G 3IRBA 3GTLB 3EBEA 1FNUA 4DU9A 3GQBA 1L1OA 1FL0A 4LF5Q 2NVXH 3U9OA 2IT1A 4KD3A 3JC66 2ES2A 4QUFA 5KRUA 4KKSA 4A3JB 2PMZB 4PMWA 4M8AA 2B63B 2X6GA 3M3YB 2ALYB 2E2HB 1I4PA 1EYCA 1WI5A 2CWPA 4A3GH 3MVVA 1RTNA 4IFDH 2J7ZA 4N9TA 5C44B 5M5WH 4V190 3MXNA 5ELNA 5ELFA 1TU2B 4PQXA 2IHEA 1F9PA 2R7FA 4NPSA 5J3BA 5I2YA 1I3QB 1UEAB 2VQEL 2EYHA 4LF8Q 4XXEA 2AHOB 4A3EB 2PZWA 4EQOA 1PFBA 1GUGA 4A3DH 3S2HH 2L55A 5IGFA 2ZJPA 1KD1C 1SNPA 1F9QA 1OTCA 4JC0A 2WFWA 4JI0Q 2PCFB 3J81i 3GTKH 1LTID 2A68D 2K14A 3CCEA 2BH2A 1B9NA 2KJXA 3OWEB 1IW7D 2Z4IA 1PHJA 1RJTA 1X55A 1HQRD 2UUBQ 2E2IB 2EDGA 1EY0A 2VUMH 1W6JA 4UP7A 1TWCH 1X6OA 4DV4Q 3BU2A 4QCLA 1QVGA 1MJCA 1SNMA 2DN8A 3M4PA 4A3DG 1EIHA 4UPAA 3CQZB 4BA1I 5LMNQ 2RCNA 5M9OA 1IBLL 1GUSA 1LT6D 2PQEA 3VYSA 1SFOH 4DK0A 2HHHQ 1T5XD 1WTQA 1QNUA 1DZ1A 3KDFA 1K8OA 1SNDA 2VQFQ 4LF8L 1PH5A 5IOCA 3C1FA 2Q2TA 1B70B 1TS5A 1SMYD 4DV7L 3ULPA 3PSIA 2OF1A 3F2DA 1V8QA 3L3OC 1EYDA 1EY8A 4JK1C 2BA0A 4LW1A 2OEOA 5ISRA 2PQAB 1IL8A 5IYDH 3T51B 3BVMA 5LMUL 4A3DB 3S2HB 3PGZA 1VF5C 4A3IH 4FP5D 4A3GB 1PYBA 2K5QA 4LF9L 1VQDA 5FKAC 1VQIA 2EYFA 4ZAIA 3MXPA 1I4HA 3QB3A 2Q8IB 1AFPA 1J9OA 4O2DA 1OXTA 3H0GH 1Q12A 2FMMA 2O5JC 2A69D 5JVH3 2C9OA 5KYLA 4C1NK 3J7YW 2EZVA 2G5DA 4IUQA 2UXBL 1L0YB 5EPKA 3X3NA 3P75A 1S72A 2WINB 2K7VA 1STYA 3V96A 4QUCA 4DV6L 1D1KA 2DY8A 2A6EC 3S1NH 2K75A 1KLGD 2UU9L 1JCKB 2PZTA 3PO2B 5FOBB 3GTPH 2C5CA 4RGMA 2OQ0A 1SFOB 3VR2A 4I7ZC 3UDXA 1KQSA 2M00A 4AYBG 2JA6G 2HCCA 5C4XB 4JI5Q 1I6HB 1ENFA 2MUYA 1N36L 1Q8KA 3D4DA 1K0SA 2CW0C 3FPUB 2ZJQA 1VQ4A 2HIVA 4G7OC 2M9VA 1P16A 1M4VA 3AB9A 1T9HA 1SXTA 1YHQA 1Y69U 4X65L 5M5XH 3SDZA 1SRUA 2KCCA 4YCWA 1KABA 5KGUA 3G6EA 1PH1A 3EQLC 5M3FG 3P20A 4L8JA 3RZOB 4BY1H 1NBWA 4ZKCB 3TBIB 3TP5A 3K7AH 3P1HA 1B8AA 2KHIA 4X66L 2H4OA 1KC8C 4P72A 2R3ZA 3FP9A 3HOYG 1JJGA 1SSOA 4OHJA 1IBKQ 5C0XI 4DXGA 1V9PA 1TWHH 3S1QB 2OQKA 4RKBA 2QGQA 4HJ9A 4X65Q 2JA5B 3FEWX 3RNUA 1VQ8A 4NMZA 2B39A 1O7YA 5L37A 4DUYQ 3UDGA 3KJPA 3J7AF 3A7LA 2I07B 3H0GB 2Y0SE 1IHZA 4YWMA 1BBXC 1VQ7A 3DEOA 3T13A 2K1BA 4U68A 2NN6G 4XT1B 4X62L 4B3ML 4KY5A 3LWUA 2KEEA 1GOZA 2YTXA 4NB3A 5I9PA 3CCVA 1FJGQ 2GA4B 5IP7H 3MXUA 4A3MB 1TKWB 3I4LA 2F4IA 1D1IA 2R7ZH 2Q2UA 3ONAB 4C3JH 5I9OA 5CR3A 1NNXA 3TSSA 1QG7A 1I94Q 1B3QA 1XNQQ 4NP5A 4UDUC 1OXUA 3DM1A 1RCVD 2I0QA 2NVYH 1AE3A 1TXYA 4LFBL 3FKIG 3TEHB 1D6EC 3EN2A 2QEXA 4HCEA 3WWVA 5E1FA 1EOTA 3MXGA 2YYZA 3M85A 1DCZA 2RQXA 2HCIA 4BBRG 4NW2A 1CK1A 3EA6A 2NYZD 2A19A 4K6DA 5FLMG 1I94L 4A3MG 4OWTB 4KHPQ 2UUCL 5KIXA 1TWHB 1XX8A 3VYUA 2ASBA 4DV5L 2L15A 4L5QA 1U4PA 1A63A 2JP1A 4H13C 3HOWG 2K05A 2LS01 3M9BA 1FJGL 1PH8A 5FO9B 5HY6A 3PUVA 4TKOB 2IX0A 4DNIA 4H7BA 3CKIB 3J7AV 5CYUA 5LL6S 3HZXA 4HJAA 3CF5A 2D5DA 2B63H 2BOSA 2VXWA 1B9MA 1PTOB 4CGYB 2JA5H 1ET9A 2IY5B 4FDBA 2DNEA 1B2TA 1DD2A 1EY4A 1D7QA 2CH4W 5E7NA 4OO1I 1GJXA 3C3LA 3KBGA 3F2CA 4HSVA 4FO2A 3FDTA 3NK9A 1CKMA 1R9TB 2Z6KC 1MD2D 1Q1EA 4GKJQ 2I5HA 2L0CA 5E4WC 3ZJYC 1SN8A 4LF7Q 5IE8A 3AFQA 1BXTA 2CCZA 3K57A 1K28A 1X54A 2R7ZB 4Q0FA 3V05A 1QZHA 2AKWB 1C8CA 2F0OA 1WJJA 5DLQE 3I90A 4DAYB 1PV4A 1SBBB 1IL2A 1HTLD 2F52A 1E22A 1WCMB 4KN4C 1F77A 4C3JG 3BVZA 1Y1VG 2UUCQ 3JAME 3HKZB 4P71A 5K5PA 1ZYRD 4PZ8A 4FYDA 4RGTA 3OIPA 3S14H 1EL0A 3K6OA 4NDXA 3PIPA 2R7ZG 4JI8Q 1HXYD 3A74A 2A69C 1CA5A 1EQRA 3TMEA 4ME3A 1QWYA 2RVLA 1TWFB 3NTKA 1U5KA 2HT1A 2K5HA 2VS1A 1V1QA 5JEAG 1LT4D 4DR7L 3M4YA 2RA4A 2WACA 4C3JB 4JI6Q 4KJOA 1XMQL 1XNQL 1UNSA 1JOKA 2A73B 3VA5A 4RH6A 4A3KB 1A6XA 5I2XA 4HJ7A 3M4OH 1IKMA 3QIAA 3H6MA 1SYCA 4A3IB 4IQZA 2EIFA 3C1EA 1HR0L 4L63B 4A3CH 1Q1BA 1LM0A 2CQAA 2Z8LA 3VR6A 1JWMD 4DAPA 4YY3L 1PH3A 5JEAJ 4P73A 4F88A 2QILA 3J80i 1K8GA 4AYBB 4DGZA 4IPCA 1PZJD 2L4NA 2XWJB 1PRTC 3J7ZC 3RLNA 3KUPA 2K03A 3H94A 5AFWA 1RD9D 4ODGA 4DAVA 1SJHD 3RZDB 3VYTA 1YNXA 4L5SA 1HH2P 1BCPF 3DWQA 5AJ3Q 1II3A 1SJED 2D2CC 3S9WA 1AE2A 2XVSA 4RHSA 5M3FB 1WCMH 1SE8A 2QDBA 4C2MB 4A3LH 2Z6KA 2B2YC 3QG1A 4HJ8A 3CC7A 1I6HH 1LLRD 1NAPA 1Y1WB 3HOYB 3K0YA 1EZ8A 2VW9A 4X62Q 4DK6C 1AH9A 2AQ1B 5IY0A 1JE5A 4J1MA 1VQKA 3R93A 2R92G 4DAYA 4APVA 2JA5G 1LO5D 1R4QB 4JVZA 1NR2A 1YIJA 1QVCA 4ZQ3A 3T1YQ 2F0EA 5HGTA 3V2TA 1JWUD 3I56A 3N6RA 3H0GG 3PO3G 4M1UB 4DR7Q 4A93B 4LF4L 4JI3Q 1Q86C 4H0LC 1CZWA 1LT5D 1Q82C 3S1MH 1CSQA 4DA2A 4QJFA 2FHTA 4ZUJA 4FF4A 5IGEA 3CD6A 1ML0D 1G51A 2EJFC 4JYAL 3OW2A 2MJ8A 1LTRD 3RN2A 5IT9E 3SK5A 1ASYA 2UUBL 2R92B 1K3RA 1IYVA 1EQVA 1VQPA 4LAAA 2E2JH 3TP6A 2K04A 5DEHA 3I4MB 3FKIH 1HUNA 3DHQA 1K0RA 5F2DA 2PMZE 1I50B 1A3VA 3GV6A 2EQSA 3T53B 5ELDA 4K5WA 1IBML 3LX0A 2CW0D 2XWBB 1Q81C 1Y1WH 1CFMA 5C44H 2ENBA 1M8AA 3I8ZA 2VY3A 1VMPA 1TWAH 3E3XA 4IN3A 5ELOA 5IWAL 2ICIA 3MTSA 3PUXA 3GO5A 1PRTF 2Q2HA 3GDEA 4GKJL 3Q8DA 4ZRZA 2ATWA 3FRPB 4IZ8A 1QILA 2XRSD 1ZEQX 1K83B 2ZM6Q 4DAMA 4K2KA 2K28A 2NB0A 2B2TA 4B3SL 5FLXc 3K80C 1JOQA 4LFAQ 4L5RC 4JI7Q 1ILPA 4CJ0B 3H09A 5I4DA 3KFUA 1SYBA 1E3PA 2XTIA 3ERSX 4DR1Q 2F0GA 1Z47A 4YCVA 3IAYA 5IP9G 1UUPA 1CA6A 3Q23A 1FNWA 1GO3E 3HG9A 4QIWE 2MGSA 1B50A 1JWSD 2F0MA 4CJ1B 2K32A 5JPNC 2K4KA 4X64L 3G4SA 3S1MB 3S14B 1C4QA 5CC4A 2QDLA 4C56C 3GTMB 3EVQA 1AP0A 2DJGC 2JA7B 1STEA 1U4RA 4XQNA 1B1ZA 2PQAA 3ULJA 4HMIA 3I91A 3N52A 3R3OA 2VL6A 3PIOA 3NTIA 2NWGA 3W1GA 1RF2D 4ID6A 2KBNA 3I4NG 3RLFA 3T1HL 3BS1A 1CT1D 4L5TA 2NVTH 5DM63 1HQMC 1EQTA 5M5YH 2WB1E 5C4XH 1C48A 3HGBA 4CDDC 4B3SQ 2KHJA 2XIWA 5KNBA
chains in the Genus database with same CATH topology
4IPHA 1S72A 3PUWA 1JT8A 3CAMA 1EOVA 1SMXA 4PZ7A 4DV1L 1SROA 4DV6L 2JA7G 1PH4A 2LXJA 4JV5L 4AYBE 1A62A 4A3LG 1KL9A 3KF8B 1S3OA 4R1JA 5IWAQ 5C0XG 2UXCQ 3PCOB 1JJCB 1UE1A 2K75A 2UU9L 3S1NH 2UXDQ 2PNHA 2BH8A 2OTJA 3GTOH 1HNWL 3TRZA 3GTPH 3H3VI 2UU9Q 2OQ0A 3KJOA 3UDXA 1KQSA 4AYBG 2JA6G 3S15H 3L2PA 2NZOA 4LFBQ 1C7YA 1UWVA 4JI5Q 5FJ8G 1TWFH 1VQMA 2LXKA 1N36L 1RIPA 1UEBA 2CQOA 3AYHB 1Q8KA 1K83H 4DR3Q 5GAGC 4EX5A 1JMCA 1QUQB 1WYDA 2ZJQA 1VQ4A 2HIVA 4DUYL 3JAMc 1D8LA 3CW2C 4JI5L 2OCEA 4H02A 1P16A 2VZAA 4JOIA 1T9HA 1YHQA 4X65L 3VDYA 2F4VQ 5M5XH 3PO2H 1SRUA 1HZBA 4YCWA 4A3IG 2E5LL 3CCUA 2GN5A 4IFDI 3K8AA 3G6EA 1PH1A 1EYGA 2AWNA 3MXNB 5M3FG 3KF6B 2E2HH 3GTLH 4X6AH 4BY1H 4J15A 3EIVA 4KHZA 1NBWA 4YWLA 2R6GA 3K7AH 1FVIA 1B8AA 2KHIA 1Q46A 1VQBA 4X66L 1EIYB 3CPWA 1KC8C 1LTLA 4P72A 4LF6L 3FP9A 3HOYG 4R4OA 1JJGA 1BBWA 5GQOA 4A3KH 1IBKQ 5C0XI 4C3HH 5IYBH 4OWXB 1V9PA 1TWHH 4KHPL 3M3YH 4GLXA 3KF6A 2OQKA 3W1BA 4KI0A 2QGQA 1UE6A 4HJ9A 1B7YB 4X65Q 3UDIA 3S16H 3I4OA 4JI3L 2VQEQ 3RNUA 1VQ8A 1X3GA 3UDGA 4DUYQ 2JEAI 1Q7YC 3KJPA 2R92H 4QGUA 1CKNA 3RZDH 3MEFA 1HZ9A 3UE0A 4HJ5A 4JI6L 1L2FA 4LFAL 4DR1L 1XTDA 2H5XA 1EQQA 2D62A 3U50C 2Y0SE 3PUZA 4YWMA 4IO9A 1VQ7A 4PG3A 1IBKL 4IOAA 4JI7L 2NN6G 2F3IA 4X62L 1G6PA 4B3ML 2YTXA 4NB3A 2JE6I 3CCVA 4OX9Q 1FJGQ 3E9IA 4Y7NH 5IP7H 2E8GA 4A4IA 1E1TA 3K81C 5BR8Q 1EUJA 1PH6A 1WCMG 3K7UC 3CCQA 1VQ6A 4Y52H 1LUZA 2Q2UA 2R7ZH 4C3JH 4BBSH 2JJQA 1VQCA 1N32L 5C44G 1I94Q 4BA2I 3HKSA 5LMNW 2WP8J 1XNQQ 3RLOA 2Q2IA 1OXUA 2D0PA 5K36G 5FLMH 2I0QA 1CKOA 1I5FA 2NVYH 1M90C 1M1KC 4O0AA 4DR6L 1AE3A 4UY8C 1TXYA 4LFBL 3FKIG 3TEHB 4KLKA 3F8TA 3EN2A 1EIFA 2DGYA 1FGUA 1P8LA 2BA1A 2D0OA 2JK8A 2QEXA 3WWVA 3HOVH 5M3MH 1VS0A 4JI1L 1X3FA 4R4TA 2GVAA 2HIXA 2YYZA 3M85A 1PH7A 2WAQE 1NJIC 1DGSA 4BBRG 5IP7G 2YU9H 4LFCQ 5FLMG 2A19A 1I94L 2NVQH 4A3MG 1VCIA 4OWTB 4KHPQ 4JBWA 2UUCL 2PI2A 2ASBA 5HGQA 2FXQA 4DV5L 2L15A 1YBYA 3L0OA 4L5QA 5BR8L 1A63A 4BY7H 2K5NA 3E0EA 4GOPB 3HOWG 4MTNA 1CKNB 3M9BA 4GN5A 2K50A 1PH8A 1FJGL 3HOZG 3A0JA 2JQOA 5HY6A 3PUVA 4GKKQ 4GLAC 3HKZG 2IX0A 1L1OC 4HIDA 1KAWA 5AJ3L 4DNIA 3OTOQ 3U58A 1BBUA 3CP0A 1QVFA 4A3FH 5GROA 3GTGH 3HOUH 4A3CG 2MO1A 1OXVA 3OYYA 1GKHA 5GAHC 2C35B 1KHIA 1J5EL 3CCMA 5GADC 1E7ZA 4HJAA 3CF5A 2YTYA 4RG1A 1VQ5A 4YHHL 3HKZE 2B63H 1NMFA 4P74A 3I4NH 3B6YA 2JA5H 2IY5B 4FDBA 1D7QA 3M4QA 5E7NA 1IYJB 2I5LX 4OO1I 1N36Q 4GKJQ 3S17H 1YHAA 2LSSA 5C0XJ 4BY7G 4JI2L 1Y14B 3CPFA 3F2CA 1QZGA 1HZCA 3KOJA 2UXCL 4DV4L 4A3FG 4A3KG 1CKMA 3I7FA 1O7IA 2CFMA 1Q1EA 2Z6KC 3STBC 4X66Q 2I5HA 4JI2Q 4NXNL 2MNAA 4HIMA 4DR5Q 1XMOQ 1JB7A 2IHFA 4B3RL 1A0IA 4RMFA 3ZJYC 3K0XA 4BBRH 1SN8A 2AMCB 1SLJA 4LF7Q 2MFIA 5IE8A 1I50H 3AFQA 3GTQH 1X65A 1MKHA 2CCZA 5H1SE 1NTGA 4BY1G 3HOVG 1X54A 1G291 2E5LQ 1XJVA 1QZHA 2AKWB 2N49A 3BZCA 4DR3L 3NEMA 2UUAL 1Y1VH 1WJJA 5DLQE 4YCUA 3CMAA 4JI1Q 4C3IH 1KRSA 1C9OA 1VQGA 2JEBI 4DAYB 3CCJA 1PV4A 1IL2A 3BZKA 1E1OA 1QUQA 5LMNL 1R9TH 5IT9c 1VQNA 1OXXK 3DM3A 2F52A 1XPUA 4GKKL 1E22A 1N33Q 1VQAA 4A76A 2CKZB 3I55A 3H3VH 1KRTA 2ZTCA 1PYSB 5FJ8H 3LGJA 2UXDL 3RR5A 4JBJA 4UP8A 1H95A 1Y1VG 1YITA 2UUCQ 1YJWA 4P71A 4IPDA 3F2BA 1N34Q 3GTJH 4TVAB 4PZ8A 1XPOA 4IJHA 3S14H 1KIXA 3PIPA 4B3MQ 2R7ZG 4BBSG 3HOXH 4DV0Q 1K8AC 4JI8Q 3A74A 1EQRA 1A8VA 2ZTEA 4ME3A 1SR3A 1K73C 2RHQB 1N33L 1PFSA 3STBD 1YJ9A 4DPGA 4K0KQ 4DUZQ 4A3JG 2KENA 1U5KA 4LWCA 4A75A 4DV7Q 2ZJRA 2OWOA 3T1HQ 3RN5A 1HR0W 4P75A 1X9NA 1HR0Q 4GNXA 2B63G 1Y1WG 2K5HA 2HT1A 2VS1A 1V1QA 3ER0A 2CWAA 2RF4A 5JEAG 4DR7L 4HIOA 4JI6Q 3DLLA 1XMQL 1XNQL 2B3GA 5IYBG 2R93H 2YTVA 4DR2L 3S1RH 1VQFA 1W3SA 1IBLQ 4HJ7A 3M4OH 4JG2A 4EQ5A 2Y0SG 4A3JH 1XMQQ 3OTOL 2JA9A 1HZAA 2XGTA 2JA8G 2EIFA 2VNUD 1HR0L 4OX9L 2K52A 4A3CH 4BXXH 2MO0A 1Q1BA 4A93G 1LM0A 4X64Q 4JYAQ 5JJIA 3CC2A 1HNZL 1IZ6A 4MZ9A 4YY3L 1N8RC 1PH3A 5JEAJ 1N34L 4P73A 1HNWQ 4GS3A 1GVPA 3J80i 1K8GA 4DV5Q 1V43A 1CUKA 4IPCA 3HOWH 3AFPA 4LF4Q 4LF5L 3J7ZC 2Z0SA 1LYLA 1UE5A 3RLNA 4DR2Q 4XIGS 4IFDJ 4YHHQ 1MIUA 1WFQA 1VQLA 4A3MH 3UE1A 3TQYA 4DK3C 5IP9H 4JBMA 3GD7A 3PV0A 3U4ZA 1YNXA 1EFWA 1HH2P 4R4IA 1MJEA 3F1ZA 5AJ3Q 4JCVE 4L5SA 4QQBX 3GTMH 4DUZL 1NY4A 3PF4A 2WAQG 3PUYA 1K9MC 5EAYA 4DR4Q 3NBHB 3AQQA 1XNRQ 3FHWA 4A3EG 1VQ9A 1W2BA 3I4MG 1AE2A 3TREA 1WCMH 2ID0A 4LUZA 1SE8A 1UE7A 4NXML 1RL2A 4A3LH 4GNXB 1PH9A 1Z9FA 3J81j 1ASZA 4WJ4A 4OONA 2AWOA 2Z6KA 3CCLA 4HJ8A 1U0LA 4LF7L 3L7ZC 3CC7A 2VUMG 1I6HH 4DKAC 4IPGA 2HQLA 4LUOA 4DV6Q 1HNXQ 2NZHA 3NELA 4ALPA 4B3RQ 1J6QA 3JAMi 1IXRA 4GNXC 3G48A 3CXCA 1BVSA 4X62Q 2VW9A 2B29A 4IJLA 4DK6C 1VQOA 1AH9A 4IOCA 5IY0A 1IBMQ 1XNRL 4MNOA 1I3QH 1XMOL 1YI2A 1JE5A 2N78A 4DV2Q 1VQKA 3H15A 2R92G 5IYCG 4APVA 1HJPA 1X3EA 2JA5G 4DR6Q 2N3SA 1YIJA 1QVCA 4GN4B 3T1YQ 4C2MH 2E2IH 4OO1G 3IRBA 3RZOH 2EXDA 3EBEA 2VQFL 3J80c 2I5MX 1L1OA 3I56A 3M7NA 2HHHL 3PF5A 3HOUG 1FL0A 3H0GG 3PO3G 4DR7Q 4A3GG 4LF5Q 2NVXH 4LF4L 1GD7A 4B3TQ 4YY3Q 2IT1A 4JI3Q 1Q86C 3HOYH 3T1YL 1YHBA 2ZTDA 1Q82C 3JC66 3S1MH 4DV3L 2ES2A 3HOZH 4WJ3M 1CSQA 4QJFA 4JV5Q 4PMWA 5C4JH 5JJKA 4DR5L 4NXNQ 2YV5A 1G51A 2KCMA 4YWKA 3CD6A 4TQUS 2ALYB 3S1QH 4JYAL 1VQHA 3OW2A 2RHSB 3HFZB 4IFDG 4GOPA 1WI5A 2CWPA 2GVBA 4A3GH 3PO3H 3RN2A 3KLWA 4BXXG 2UUBL 1ASYA 3KDFB 5M5WH 4AH6A 4AQYQ 1K3RA 5ELNA 1PH2A 2PI2E 3TS2A 1VQPA 4HIKA 5M3MG 2IHEA 2E2JH 4NPSA 2R7FA 5J3BA 4LF8Q 2VQEL 4A3BH 1L0WA 5IYCH 2AHOB 5M3FH 1YZ6A 3FKIH 4LFCL 4QY7A 1K0RA 4JI4Q 1JJ2A 2R93G 2PMZE 4DR4L 4A3DH 4LNQA 3S2HH 4JOIC 2ZJPA 1KD1C 2EQSA 3PO2G 4K0KL 3E9HA 5GAEC 1E24A 4R4QA 3U4VA 1IBML 1OTCA 2JA6H 4JC0A 4GLVB 2WFWA 4JI0Q 1Q81C 3J81i 1Y1WH 3GTKH 2UUAQ 4POGA 5C44H 2WB1G 2K14A 2ZM6L 3CCEA 4JI4L 3CCSA 4JBKA 2VY3A 3G71A 2BH2A 3AEVA 1N32Q 1TWAH 1WOCA 1YEZA 3A5ZB 5ELOA 5C3EH 3I2ZA 1PHJA 2JA7H 5IWAL 1S40A 4A3EH 3I4MH 1X55A 2A1AA 3PUXA 2UUBQ 3GO5A 2Q2HA 3GDEA 2VUMH 4GKJL 3Q8DA 4UP7A 2R7DA 2ATWA 1TWCH 1X6OA 4DV4Q 3BU2A 5C3EG 4JI0L 2DUDA 1QVGA 2N8NA 1MJCA 3M4PA 1YJNA 2A8VA 4A3DG 2QA4A 2ZM6Q 4DAMA 4UPAA 3J81c 4B3SL 5FLXc 3K80C 2UXBQ 4LFAQ 4BA1I 4DV3Q 1GM5A 5LMNQ 2RCNA 4QL5A 4JI7Q 4L5RC 1OXSC 3BJUA 1BKBA 3KFUA 2MQHA 1NE3A 1E3PA 2XTIA 1PA6A 2K5VA 1IBLL 4GN3B 4B3TL 3ERSX 4DR1Q 1SFOH 5C4XG 3SGIA 3CCRA 2HHHQ 1Z47A 4YCVA 5IP9G 3KDFA 3KYHC 4QIWE 1GO3E 2VQFQ 4AQYL 3CC4A 4LF8L 1PH5A 5IYDG 4A93H 2Q2TA 4A3BG 3CMEA 1B70B 3S24A 3G4SA 4DV7L 2K4KA 3PSIA 4X64L 3ULPA 1X56A 2V1CC 3F2DA 5JJLA 4DV2L 4DV1Q 1HNZQ 3J7A5 2BA0A 4LW1A 4JI8L 2OTLA 2PQAB 4PZ6A 1PVOA 1CSPA 1YVCA 5IYDH 5LMUL 1KXLA 1TWGH 4XTCS 3PGZA 3D31A 2IX1A 3NENA 2PQAA 4A3IH 1L1OB 3ULJA 1HNXL 1PYBA 1VQJA 1XPRA 4LF9L 1VQDA 2JA8H 1VQIA 2VL6A 1VQEA 3W5OA 4NXMQ 3TS0A 3A5UA 3PIOA 4GOPC 4R4CA 3ICEA 3W1GA 1EWIA 3UDFA 2KBNA 3CQZH 2KCTA 4LUVA 3I4NG 2NN6I 4O2DA 3RLFA 3ULLA 1OXTA 3T1HL 3H0GH 1J5EQ 2F4VL 1Q12A 4LF9Q 4L5TA 2NVTH 4UP9A 4POFA 5M5YH 3HOXG 4OWWB 2WB1E 5C4XH 3D0FA 1NMGA 5LMUQ 4OXPA 1C0AA 1N9WA 4AIMA 4DV0L 4LF6Q 4B3SQ 2UXBL 2KHJA 3S2DH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IPH A;  1S72 A;  3PUW A;  1JT8 A;  3CAM A;  1EOV A;  1SMX A;  4PZ7 A;  4DV1 L;  1SRO A;  4DV6 L;  2JA7 G;  1PH4 A;  2LXJ A;  4JV5 L;  4AYB E;  1A62 A;  4A3L G;  1KL9 A;  3KF8 B;  1S3O A;  4R1J A;  5IWA Q;  5C0X G;  2UXC Q;  3PCO B;  1JJC B;  1UE1 A;  2K75 A;  2UU9 L;  3S1N H;  2UXD Q;  2PNH A;  2BH8 A;  2OTJ A;  3GTO H;  1HNW L;  3TRZ A;  3GTP H;  3H3V I;  2UU9 Q;  2OQ0 A;  3KJO A;  3UDX A;  1KQS A;  4AYB G;  2JA6 G;  3S15 H;  3L2P A;  2NZO A;  4LFB Q;  1C7Y A;  1UWV A;  4JI5 Q;  5FJ8 G;  1TWF H;  1VQM A;  2LXK A;  1N36 L;  1RIP A;  1UEB A;  2CQO A;  3AYH B;  1Q8K A;  1K83 H;  4DR3 Q;  5GAG C;  4EX5 A;  1JMC A;  1QUQ B;  1WYD A;  2ZJQ A;  1VQ4 A;  2HIV A;  4DUY L;  3JAM c;  1D8L A;  3CW2 C;  4JI5 L;  2OCE A;  4H02 A;  1P16 A;  2VZA A;  4JOI A;  1T9H A;  1YHQ A;  4X65 L;  3VDY A;  2F4V Q;  5M5X H;  3PO2 H;  1SRU A;  1HZB A;  4YCW A;  4A3I G;  2E5L L;  3CCU A;  2GN5 A;  4IFD I;  3K8A A;  3G6E A;  1PH1 A;  1EYG A;  2AWN A;  3MXN B;  5M3F G;  3KF6 B;  2E2H H;  3GTL H;  4X6A H;  4BY1 H;  4J15 A;  3EIV A;  4KHZ A;  1NBW A;  4YWL A;  2R6G A;  3K7A H;  1FVI A;  1B8A A;  2KHI A;  1Q46 A;  1VQB A;  4X66 L;  1EIY B;  3CPW A;  1KC8 C;  1LTL A;  4P72 A;  4LF6 L;  3FP9 A;  3HOY G;  4R4O A;  1JJG A;  1BBW A;  5GQO A;  4A3K H;  1IBK Q;  5C0X I;  4C3H H;  5IYB H;  4OWX B;  1V9P A;  1TWH H;  4KHP L;  3M3Y H;  4GLX A;  3KF6 A;  2OQK A;  3W1B A;  4KI0 A;  2QGQ A;  1UE6 A;  4HJ9 A;  1B7Y B;  4X65 Q;  3UDI A;  3S16 H;  3I4O A;  4JI3 L;  2VQE Q;  3RNU A;  1VQ8 A;  1X3G A;  3UDG A;  4DUY Q;  2JEA I;  1Q7Y C;  3KJP A;  2R92 H;  4QGU A;  1CKN A;  3RZD H;  3MEF A;  1HZ9 A;  3UE0 A;  4HJ5 A;  4JI6 L;  1L2F A;  4LFA L;  4DR1 L;  1XTD A;  2H5X A;  1EQQ A;  2D62 A;  3U50 C;  2Y0S E;  3PUZ A;  4YWM A;  4IO9 A;  1VQ7 A;  4PG3 A;  1IBK L;  4IOA A;  4JI7 L;  2NN6 G;  2F3I A;  4X62 L;  1G6P A;  4B3M L;  2YTX A;  4NB3 A;  2JE6 I;  3CCV A;  4OX9 Q;  1FJG Q;  3E9I A;  4Y7N H;  5IP7 H;  2E8G A;  4A4I A;  1E1T A;  3K81 C;  5BR8 Q;  1EUJ A;  1PH6 A;  1WCM G;  3K7U C;  3CCQ A;  1VQ6 A;  4Y52 H;  1LUZ A;  2Q2U A;  2R7Z H;  4C3J H;  4BBS H;  2JJQ A;  1VQC A;  1N32 L;  5C44 G;  1I94 Q;  4BA2 I;  3HKS A;  5LMN W;  2WP8 J;  1XNQ Q;  3RLO A;  2Q2I A;  1OXU A;  2D0P A;  5K36 G;  5FLM H;  2I0Q A;  1CKO A;  1I5F A;  2NVY H;  1M90 C;  1M1K C;  4O0A A;  4DR6 L;  1AE3 A;  4UY8 C;  1TXY A;  4LFB L;  3FKI G;  3TEH B;  4KLK A;  3F8T A;  3EN2 A;  1EIF A;  2DGY A;  1FGU A;  1P8L A;  2BA1 A;  2D0O A;  2JK8 A;  2QEX A;  3WWV A;  3HOV H;  5M3M H;  1VS0 A;  4JI1 L;  1X3F A;  4R4T A;  2GVA A;  2HIX A;  2YYZ A;  3M85 A;  1PH7 A;  2WAQ E;  1NJI C;  1DGS A;  4BBR G;  5IP7 G;  2YU9 H;  4LFC Q;  5FLM G;  2A19 A;  1I94 L;  2NVQ H;  4A3M G;  1VCI A;  4OWT B;  4KHP Q;  4JBW A;  2UUC L;  2PI2 A;  2ASB A;  5HGQ A;  2FXQ A;  4DV5 L;  2L15 A;  1YBY A;  3L0O A;  4L5Q A;  5BR8 L;  1A63 A;  4BY7 H;  2K5N A;  3E0E A;  4GOP B;  3HOW G;  4MTN A;  1CKN B;  3M9B A;  4GN5 A;  2K50 A;  1PH8 A;  1FJG L;  3HOZ G;  3A0J A;  2JQO A;  5HY6 A;  3PUV A;  4GKK Q;  4GLA C;  3HKZ G;  2IX0 A;  1L1O C;  4HID A;  1KAW A;  5AJ3 L;  4DNI A;  3OTO Q;  3U58 A;  1BBU A;  3CP0 A;  1QVF A;  4A3F H;  5GRO A;  3GTG H;  3HOU H;  4A3C G;  2MO1 A;  1OXV A;  3OYY A;  1GKH A;  5GAH C;  2C35 B;  1KHI A;  1J5E L;  3CCM A;  5GAD C;  1E7Z A;  4HJA A;  3CF5 A;  2YTY A;  4RG1 A;  1VQ5 A;  4YHH L;  3HKZ E;  2B63 H;  1NMF A;  4P74 A;  3I4N H;  3B6Y A;  2JA5 H;  2IY5 B;  4FDB A;  1D7Q A;  3M4Q A;  5E7N A;  1IYJ B;  2I5L X;  4OO1 I;  1N36 Q;  4GKJ Q;  3S17 H;  1YHA A;  2LSS A;  5C0X J;  4BY7 G;  4JI2 L;  1Y14 B;  3CPF A;  3F2C A;  1QZG A;  1HZC A;  3KOJ A;  2UXC L;  4DV4 L;  4A3F G;  4A3K G;  1CKM A;  3I7F A;  1O7I A;  2CFM A;  1Q1E A;  2Z6K C;  3STB C;  4X66 Q;  2I5H A;  4JI2 Q;  4NXN L;  2MNA A;  4HIM A;  4DR5 Q;  1XMO Q;  1JB7 A;  2IHF A;  4B3R L;  1A0I A;  4RMF A;  3ZJY C;  3K0X A;  4BBR H;  1SN8 A;  2AMC B;  1SLJ A;  4LF7 Q;  2MFI A;  5IE8 A;  1I50 H;  3AFQ A;  3GTQ H;  1X65 A;  1MKH A;  2CCZ A;  5H1S E;  1NTG A;  4BY1 G;  3HOV G;  1X54 A;  1G29 1;  2E5L Q;  1XJV A;  1QZH A;  2AKW B;  2N49 A;  3BZC A;  4DR3 L;  3NEM A;  2UUA L;  1Y1V H;  1WJJ A;  5DLQ E;  4YCU A;  3CMA A;  4JI1 Q;  4C3I H;  1KRS A;  1C9O A;  1VQG A;  2JEB I;  4DAY B;  3CCJ A;  1PV4 A;  1IL2 A;  3BZK A;  1E1O A;  1QUQ A;  5LMN L;  1R9T H;  5IT9 c;  1VQN A;  1OXX K;  3DM3 A;  2F52 A;  1XPU A;  4GKK L;  1E22 A;  1N33 Q;  1VQA A;  4A76 A;  2CKZ B;  3I55 A;  3H3V H;  1KRT A;  2ZTC A;  1PYS B;  5FJ8 H;  3LGJ A;  2UXD L;  3RR5 A;  4JBJ A;  4UP8 A;  1H95 A;  1Y1V G;  1YIT A;  2UUC Q;  1YJW A;  4P71 A;  4IPD A;  3F2B A;  1N34 Q;  3GTJ H;  4TVA B;  4PZ8 A;  1XPO A;  4IJH A;  3S14 H;  1KIX A;  3PIP A;  4B3M Q;  2R7Z G;  4BBS G;  3HOX H;  4DV0 Q;  1K8A C;  4JI8 Q;  3A74 A;  1EQR A;  1A8V A;  2ZTE A;  4ME3 A;  1SR3 A;  1K73 C;  2RHQ B;  1N33 L;  1PFS A;  3STB D;  1YJ9 A;  4DPG A;  4K0K Q;  4DUZ Q;  4A3J G;  2KEN A;  1U5K A;  4LWC A;  4A75 A;  4DV7 Q;  2ZJR A;  2OWO A;  3T1H Q;  3RN5 A;  1HR0 W;  4P75 A;  1X9N A;  1HR0 Q;  4GNX A;  2B63 G;  1Y1W G;  2K5H A;  2HT1 A;  2VS1 A;  1V1Q A;  3ER0 A;  2CWA A;  2RF4 A;  5JEA G;  4DR7 L;  4HIO A;  4JI6 Q;  3DLL A;  1XMQ L;  1XNQ L;  2B3G A;  5IYB G;  2R93 H;  2YTV A;  4DR2 L;  3S1R H;  1VQF A;  1W3S A;  1IBL Q;  4HJ7 A;  3M4O H;  4JG2 A;  4EQ5 A;  2Y0S G;  4A3J H;  1XMQ Q;  3OTO L;  2JA9 A;  1HZA A;  2XGT A;  2JA8 G;  2EIF A;  2VNU D;  1HR0 L;  4OX9 L;  2K52 A;  4A3C H;  4BXX H;  2MO0 A;  1Q1B A;  4A93 G;  1LM0 A;  4X64 Q;  4JYA Q;  5JJI A;  3CC2 A;  1HNZ L;  1IZ6 A;  4MZ9 A;  4YY3 L;  1N8R C;  1PH3 A;  5JEA J;  1N34 L;  4P73 A;  1HNW Q;  4GS3 A;  1GVP A;  3J80 i;  1K8G A;  4DV5 Q;  1V43 A;  1CUK A;  4IPC A;  3HOW H;  3AFP A;  4LF4 Q;  4LF5 L;  3J7Z C;  2Z0S A;  1LYL A;  1UE5 A;  3RLN A;  4DR2 Q;  4XIG S;  4IFD J;  4YHH Q;  1MIU A;  1WFQ A;  1VQL A;  4A3M H;  3UE1 A;  3TQY A;  4DK3 C;  5IP9 H;  4JBM A;  3GD7 A;  3PV0 A;  3U4Z A;  1YNX A;  1EFW A;  1HH2 P;  4R4I A;  1MJE A;  3F1Z A;  5AJ3 Q;  4JCV E;  4L5S A;  4QQB X;  3GTM H;  4DUZ L;  1NY4 A;  3PF4 A;  2WAQ G;  3PUY A;  1K9M C;  5EAY A;  4DR4 Q;  3NBH B;  3AQQ A;  1XNR Q;  3FHW A;  4A3E G;  1VQ9 A;  1W2B A;  3I4M G;  1AE2 A;  3TRE A;  1WCM H;  2ID0 A;  4LUZ A;  1SE8 A;  1UE7 A;  4NXM L;  1RL2 A;  4A3L H;  4GNX B;  1PH9 A;  1Z9F A;  3J81 j;  1ASZ A;  4WJ4 A;  4OON A;  2AWO A;  2Z6K A;  3CCL A;  4HJ8 A;  1U0L A;  4LF7 L;  3L7Z C;  3CC7 A;  2VUM G;  1I6H H;  4DKA C;  4IPG A;  2HQL A;  4LUO A;  4DV6 Q;  1HNX Q;  2NZH A;  3NEL A;  4ALP A;  4B3R Q;  1J6Q A;  3JAM i;  1IXR A;  4GNX C;  3G48 A;  3CXC A;  1BVS A;  4X62 Q;  2VW9 A;  2B29 A;  4IJL A;  4DK6 C;  1VQO A;  1AH9 A;  4IOC A;  5IY0 A;  1IBM Q;  1XNR L;  4MNO A;  1I3Q H;  1XMO L;  1YI2 A;  1JE5 A;  2N78 A;  4DV2 Q;  1VQK A;  3H15 A;  2R92 G;  5IYC G;  4APV A;  1HJP A;  1X3E A;  2JA5 G;  4DR6 Q;  2N3S A;  1YIJ A;  1QVC A;  4GN4 B;  3T1Y Q;  4C2M H;  2E2I H;  4OO1 G;  3IRB A;  3RZO H;  2EXD A;  3EBE A;  2VQF L;  3J80 c;  2I5M X;  1L1O A;  3I56 A;  3M7N A;  2HHH L;  3PF5 A;  3HOU G;  1FL0 A;  3H0G G;  3PO3 G;  4DR7 Q;  4A3G G;  4LF5 Q;  2NVX H;  4LF4 L;  1GD7 A;  4B3T Q;  4YY3 Q;  2IT1 A;  4JI3 Q;  1Q86 C;  3HOY H;  3T1Y L;  1YHB A;  2ZTD A;  1Q82 C;  3JC6 6;  3S1M H;  4DV3 L;  2ES2 A;  3HOZ H;  4WJ3 M;  1CSQ A;  4QJF A;  4JV5 Q;  4PMW A;  5C4J H;  5JJK A;  4DR5 L;  4NXN Q;  2YV5 A;  1G51 A;  2KCM A;  4YWK A;  3CD6 A;  4TQU S;  2ALY B;  3S1Q H;  4JYA L;  1VQH A;  3OW2 A;  2RHS B;  3HFZ B;  4IFD G;  4GOP A;  1WI5 A;  2CWP A;  2GVB A;  4A3G H;  3PO3 H;  3RN2 A;  3KLW A;  4BXX G;  2UUB L;  1ASY A;  3KDF B;  5M5W H;  4AH6 A;  4AQY Q;  1K3R A;  5ELN A;  1PH2 A;  2PI2 E;  3TS2 A;  1VQP A;  4HIK A;  5M3M G;  2IHE A;  2E2J H;  4NPS A;  2R7F A;  5J3B A;  4LF8 Q;  2VQE L;  4A3B H;  1L0W A;  5IYC H;  2AHO B;  5M3F H;  1YZ6 A;  3FKI H;  4LFC L;  4QY7 A;  1K0R A;  4JI4 Q;  1JJ2 A;  2R93 G;  2PMZ E;  4DR4 L;  4A3D H;  4LNQ A;  3S2H H;  4JOI C;  2ZJP A;  1KD1 C;  2EQS A;  3PO2 G;  4K0K L;  3E9H A;  5GAE C;  1E24 A;  4R4Q A;  3U4V A;  1IBM L;  1OTC A;  2JA6 H;  4JC0 A;  4GLV B;  2WFW A;  4JI0 Q;  1Q81 C;  3J81 i;  1Y1W H;  3GTK H;  2UUA Q;  4POG A;  5C44 H;  2WB1 G;  2K14 A;  2ZM6 L;  3CCE A;  4JI4 L;  3CCS A;  4JBK A;  2VY3 A;  3G71 A;  2BH2 A;  3AEV A;  1N32 Q;  1TWA H;  1WOC A;  1YEZ A;  3A5Z B;  5ELO A;  5C3E H;  3I2Z A;  1PHJ A;  2JA7 H;  5IWA L;  1S40 A;  4A3E H;  3I4M H;  1X55 A;  2A1A A;  3PUX A;  2UUB Q;  3GO5 A;  2Q2H A;  3GDE A;  2VUM H;  4GKJ L;  3Q8D A;  4UP7 A;  2R7D A;  2ATW A;  1TWC H;  1X6O A;  4DV4 Q;  3BU2 A;  5C3E G;  4JI0 L;  2DUD A;  1QVG A;  2N8N A;  1MJC A;  3M4P A;  1YJN A;  2A8V A;  4A3D G;  2QA4 A;  2ZM6 Q;  4DAM A;  4UPA A;  3J81 c;  4B3S L;  5FLX c;  3K80 C;  2UXB Q;  4LFA Q;  4BA1 I;  4DV3 Q;  1GM5 A;  5LMN Q;  2RCN A;  4QL5 A;  4JI7 Q;  4L5R C;  1OXS C;  3BJU A;  1BKB A;  3KFU A;  2MQH A;  1NE3 A;  1E3P A;  2XTI A;  1PA6 A;  2K5V A;  1IBL L;  4GN3 B;  4B3T L;  3ERS X;  4DR1 Q;  1SFO H;  5C4X G;  3SGI A;  3CCR A;  2HHH Q;  1Z47 A;  4YCV A;  5IP9 G;  3KDF A;  3KYH C;  4QIW E;  1GO3 E;  2VQF Q;  4AQY L;  3CC4 A;  4LF8 L;  1PH5 A;  5IYD G;  4A93 H;  2Q2T A;  4A3B G;  3CME A;  1B70 B;  3S24 A;  3G4S A;  4DV7 L;  2K4K A;  3PSI A;  4X64 L;  3ULP A;  1X56 A;  2V1C C;  3F2D A;  5JJL A;  4DV2 L;  4DV1 Q;  1HNZ Q;  3J7A 5;  2BA0 A;  4LW1 A;  4JI8 L;  2OTL A;  2PQA B;  4PZ6 A;  1PVO A;  1CSP A;  1YVC A;  5IYD H;  5LMU L;  1KXL A;  1TWG H;  4XTC S;  3PGZ A;  3D31 A;  2IX1 A;  3NEN A;  2PQA A;  4A3I H;  1L1O B;  3ULJ A;  1HNX L;  1PYB A;  1VQJ A;  1XPR A;  4LF9 L;  1VQD A;  2JA8 H;  1VQI A;  2VL6 A;  1VQE A;  3W5O A;  4NXM Q;  3TS0 A;  3A5U A;  3PIO A;  4GOP C;  4R4C A;  3ICE A;  3W1G A;  1EWI A;  3UDF A;  2KBN A;  3CQZ H;  2KCT A;  4LUV A;  3I4N G;  2NN6 I;  4O2D A;  3RLF A;  3ULL A;  1OXT A;  3T1H L;  3H0G H;  1J5E Q;  2F4V L;  1Q12 A;  4LF9 Q;  4L5T A;  2NVT H;  4UP9 A;  4POF A;  5M5Y H;  3HOX G;  4OWW B;  2WB1 E;  5C4X H;  3D0F A;  1NMG A;  5LMU Q;  4OXP A;  1C0A A;  1N9W A;  4AIM A;  4DV0 L;  4LF6 Q;  4B3S Q;  2UXB L;  2KHJ A;  3S2D H; 
#chains in the Genus database with same CATH topology
 2ICE C;  1EOV A;  4DV1 L;  1MHW C;  1SRO A;  2JA7 G;  2JA8 B;  1PH4 A;  2SNS A;  1KL9 A;  4K8I A;  1TWA B;  3PMF A;  1JJC B;  5DNF A;  1D2B A;  2MPM A;  5COY A;  3GTO H;  1WTX A;  5M5X B;  1ROD A;  3VA7 A;  4XQQ A;  3MWY W;  2VB2 X;  5IOD A;  1BNZ A;  1W6K A;  1IW7 C;  4CJ2 C;  5FJ8 G;  2K5D A;  2LXK A;  1A2U A;  1UEB A;  4FXK C;  1K83 H;  5LL6 X;  5KND A;  4EX5 A;  3NXW A;  1QUQ B;  1TVX A;  4DUY L;  1D8L A;  2HUG A;  4JI5 L;  2OCE A;  4B9X A;  2VZA A;  2L1B A;  4JOI A;  2F4V Q;  3PO2 H;  2IX3 A;  4P2C B;  4A3I G;  3CCU A;  2HDL A;  2GN5 A;  4HMJ A;  3K8A A;  4F87 A;  2MHV A;  1TT2 A;  1EYG A;  3MFG A;  1L0X B;  1LV9 A;  1STG A;  1LAB A;  1WTW A;  1IYU A;  4ILW A;  1MGS A;  5IIF A;  4WFN 3;  3GTJ B;  1Q46 A;  1VQB A;  1EIY B;  1VMC A;  4LF6 L;  5GQO A;  3S1R B;  2A5H A;  4C3H H;  3LWE A;  5G3L F;  1SNQ A;  1E0B A;  3KF6 A;  1K3B C;  4GLX A;  3A55 A;  3UDI A;  4GZY C;  2MP1 A;  4JI3 L;  1I4R A;  1Q7Y C;  4OEM B;  4QGU A;  1SNO A;  1CKN A;  4HJ5 A;  1IKL A;  4WJW A;  1WTH A;  1QCB D;  3SK6 A;  4IOA A;  3HP3 A;  5JEA H;  2G9D A;  2WKC A;  1BF4 A;  2ZXP A;  1G6P A;  2QCP X;  5LHY 1;  4OX9 Q;  2JE6 I;  3S2D B;  4OIJ A;  3ERQ A;  4Y7N H;  3K81 C;  1PH6 A;  4JW0 A;  5EKI A;  3CCQ A;  1S5B D;  4BBS H;  1EIG A;  5HUR A;  1VQC A;  1N32 L;  3GTG B;  2NVQ B;  2D0P A;  3BZD B;  3NPP A;  1CKO A;  1I5F A;  2FIN B;  4O0A A;  4CBV A;  1U4L A;  2IPK D;  2PNR C;  2D0O A;  2BA1 A;  1TWC B;  1V1P A;  1VS0 A;  1B53 A;  1BR9 A;  2DNC A;  2WAQ E;  1DGS A;  4KKU A;  5A2Q E;  1EU3 A;  1VCI A;  1EU4 A;  2KED A;  2FXQ A;  2SOB A;  1YBY A;  1STH A;  4BY7 H;  3E0E A;  3E5S A;  4WRD A;  2Y0S B;  1JC7 A;  2B2T C;  1ZKO A;  4HID A;  3PQI A;  3OSO A;  3OTO Q;  4XYQ A;  4A3F H;  2MO1 A;  1Z7T A;  5CV6 A;  1GKH A;  1DON A;  3CU7 A;  1J5E L;  1TQO A;  5GAD C;  2KHS A;  1E2W A;  4RG1 A;  1VQ5 A;  2NVY B;  3HKZ E;  1BUV T;  1EZ6 A;  5C4J B;  4P74 A;  2O2L D;  3B6Y A;  2XRQ D;  4RWS C;  3U9S A;  2NTS A;  1U4M A;  2HD3 A;  5CGK A;  3KLS X;  1IYJ B;  3K5O A;  4EVO A;  4JI2 L;  4RGO S;  1S4Z A;  5E3F A;  3X3M A;  4DV4 L;  2CH4 A;  5CBA E;  1O7I A;  3FVQ A;  3RMH A;  4X66 Q;  2UXC Q;  1J8I A;  4F7X A;  1A0I A;  3K0X A;  1YNJ D;  2MFI A;  1I50 H;  3HEJ A;  2FFK B;  1X65 A;  3CHB D;  4LJZ C;  3UI2 A;  4G7Z C;  2EYP A;  5NUC A;  3HOV G;  4X3T A;  1XJV A;  3VYR A;  4DR3 L;  2IL8 A;  4YCU A;  1VQG A;  4QMG A;  5FK9 C;  3BZK A;  1STB A;  1QUQ A;  4PNY A;  1XPU A;  1PRT D;  3K58 A;  2LMC B;  4CKB A;  2K6A A;  1XYI A;  1FR3 A;  2CKZ B;  3H3V H;  1PRT B;  1KRT A;  3DXJ C;  4Z9C B;  5FJ8 H;  1NCV A;  3LGJ A;  1LTT D;  5DAU A;  4JBJ A;  3RR5 A;  2UXD L;  1H95 A;  1YJW A;  1N34 Q;  4FVM A;  2XNA C;  2RCF A;  4B3M Q;  1DOK A;  1I4X A;  1KDB A;  4DV0 Q;  2Q8T A;  3STB D;  4DPG A;  4DUZ Q;  4A3J G;  2NTT A;  1G8Z D;  2ZJR A;  3RN5 A;  1HR0 W;  2B63 G;  2JXM B;  2QEJ C;  5C6A A;  2IW3 A;  3QJY A;  2WV6 D;  3DLL A;  4K6L A;  2E75 C;  2KVM A;  1VQF A;  3NUC A;  4EQ5 A;  1H9S A;  1WTO A;  1HZA A;  4HCS A;  2JA8 G;  1JE4 A;  4DK1 A;  2VNU D;  5G3L D;  1RKN A;  3OMC A;  5BN3 A;  2CVR A;  2EYO A;  1PDQ A;  2JYO A;  3CC2 A;  4MZ9 A;  1N34 L;  1HNW Q;  1RDP D;  3NTH A;  4DV5 Q;  1V43 A;  1X3Q A;  1LYL A;  1HUM A;  4DR2 Q;  3E6Z X;  4BY7 B;  5CV7 A;  5IP9 H;  4N9P A;  4JBM A;  3U4Z A;  1Y1V B;  4FXG C;  1ESF A;  2EVB A;  1TS4 A;  4DR4 Q;  3PUY A;  3ND8 A;  1VQ9 A;  3R2T A;  3TRE A;  4XYO A;  2PPB C;  2RSO A;  2ID0 A;  1U9R A;  4LUZ A;  3BDL A;  1RL2 A;  1Z9F A;  2DY7 A;  3TZU A;  4XQJ A;  3CCL A;  4RFB A;  4LF7 L;  4O1N A;  4DKA C;  4IPG A;  2NZH A;  3GTK B;  3JAM i;  4UAI A;  3GP7 A;  1PTO C;  4IOC A;  2KCN A;  4MNO A;  1YI2 A;  2N78 A;  1SEB D;  4HN7 A;  1SYG A;  1YNN C;  1PFM A;  4HAE A;  4C2M H;  2E2I H;  1JB3 A;  3HRZ C;  4R9W A;  1G2T A;  2EXD A;  5M3M B;  2VQF L;  3J80 c;  1TY2 A;  3M7N A;  2HHH L;  3PF5 A;  2EYJ A;  4A3G G;  3S1N B;  4YY3 Q;  3KK7 A;  2F03 A;  3HOY H;  3T1Y L;  2EOT A;  1I4Q A;  2ZTD A;  1HTP A;  3HOZ H;  4WJ3 M;  4JV5 Q;  4ZKB B;  1LT3 D;  2O4X A;  2F0P A;  4KMU C;  2RDF A;  4DR5 L;  4NXN Q;  1PTO H;  2WB1 B;  2KCM A;  2YV5 A;  4TQU S;  4HR7 B;  1VQH A;  1QB5 D;  1CQF A;  2RHS B;  3HFZ B;  2GVB A;  3PO3 H;  4BXX G;  3KLR A;  1PH2 A;  2PI2 E;  1GUW A;  1QOH A;  1HFN A;  4OO1 H;  5M3M G;  2I46 A;  2L5T A;  1EY7 A;  1L0W A;  4LFC L;  2F1M A;  2RSN A;  1JJ2 A;  2R93 G;  4KY7 A;  4DR4 L;  3PO2 G;  3E9H A;  3K59 A;  2JA6 H;  1NSN S;  4GLV B;  2UUA Q;  2WB1 G;  4PMC A;  4JI4 L;  4JBK A;  2F0U A;  3A8I E;  1KAA A;  4BS9 A;  3AEV A;  1N32 Q;  1SE3 A;  3H91 A;  1WOC A;  1YEZ A;  1G2S A;  3A5Z B;  5EPL A;  3VR4 A;  5C3E H;  3A56 A;  3HOX B;  2JA7 H;  2Z9H A;  1X3P A;  1S40 A;  3I4M H;  5C3X A;  4H44 C;  1G91 A;  2R7D A;  4JI0 L;  2DUD A;  2N8N A;  1ICW A;  2QA4 A;  1EY5 A;  3J81 c;  2UXB Q;  4V0B A;  4DV3 Q;  2P5Z X;  3BJU A;  1NE3 A;  1S5C D;  2PW5 A;  3SGI A;  3CCR A;  4BWG B;  3BDO A;  2B2V A;  3KYH C;  1JR0 D;  2NZ1 D;  3CC4 A;  3IFD A;  2JSO A;  4A3B G;  3S24 A;  2ZXR A;  1X56 A;  2RBM A;  4DV2 L;  4DV1 Q;  1HNZ Q;  3J7A 5;  1LTG D;  1HFG A;  3EJI A;  4PZ6 A;  2EE1 A;  1Z6H A;  5IGD A;  2OTL A;  5M5Y B;  1TWG H;  1H9K A;  1E2Z A;  3NEN A;  3NHH A;  1F2L A;  1DXM A;  1HNX L;  1PXU A;  2JA8 H;  2NUC A;  2KUM A;  2XSC A;  3EFX D;  1NR4 A;  4NXM Q;  5EKK A;  3TS0 A;  5C3W A;  4GOP C;  4RHR A;  3GTO B;  3SHL A;  4LUV A;  5C4H A;  1EEI D;  3ULL A;  4ABN A;  1J5E Q;  2B2Y A;  1V1O A;  4OWW B;  3D0F A;  5COR A;  5LMU Q;  4OXP A;  1C0A A;  4AIM A;  4FNF A;  1F2Z A;  1HA5 A;  4IPH A;  1SMX A;  2BDN A;  2LXJ A;  4AYB E;  1WD1 A;  1JQY D;  5C0X G;  1A3U A;  1UE1 A;  3QR8 A;  3TRZ A;  2TMP A;  3H3V I;  4BBR B;  3KJO A;  1F9S A;  1BCP D;  4O42 A;  3S15 H;  1R4P B;  3L2P A;  2NZO A;  4LFB Q;  1O7Z A;  1UWV A;  3VR3 A;  4LMQ D;  1TWF H;  1LAC A;  2Z4H A;  4IUV A;  3Q0A A;  1VQM A;  4B08 A;  3AYH B;  4DR3 Q;  5GAG C;  2O5I C;  4G7H C;  1JMC A;  4Q5V A;  2EY1 A;  2ZT9 C;  3CW2 C;  4H02 A;  2RKS A;  3P7J A;  5I6W A;  4DXF A;  2J4X A;  2E2D C;  4DFA A;  2AWN A;  3MXN B;  1STA A;  4JPB W;  1WTR A;  3EIV A;  4KHZ A;  4MTK A;  4ME5 A;  3IKJ A;  4YWL A;  3TN2 A;  2R6G A;  1H9S B;  2BE5 C;  1ONL A;  2AUJ D;  1LTL A;  3AU7 A;  3PIO 3;  1PFN A;  1QNK A;  4R4O A;  1BBW A;  3R2I A;  5IYB H;  1TWG B;  4KHP L;  1PYW D;  1UE6 A;  3S16 H;  3I4O A;  2VQE Q;  1X3G A;  2JEA I;  4XT3 B;  2R92 H;  4CKE A;  3RZD H;  3MEF A;  3UE0 A;  1CTM A;  3QOJ A;  4OEL B;  1L2F A;  4LFA L;  4DR1 L;  1EQQ A;  3U50 C;  3HOU B;  2EJG C;  5BN5 A;  3PUZ A;  4IO9 A;  2E2J B;  4R8N A;  4RCO A;  2F3I A;  1EY9 A;  2HQE A;  3QO2 A;  3NSW A;  2B2W A;  2F0Q A;  2QF7 A;  1EFI D;  3E9I A;  4KN7 C;  2E8G A;  1O80 A;  3I72 A;  1EUJ A;  1WCM G;  3K7U C;  1LUZ A;  4E6I A;  4A3F B;  4G4K A;  5LMN W;  2WP8 J;  2Q2I A;  5K36 G;  1M1K C;  1H9R A;  3DUZ A;  4DF7 A;  1Y8N B;  4UY8 C;  2EPB A;  4KLK A;  4BY1 B;  1EIF A;  3F2U A;  3A8J E;  3HOV H;  3KF8 A;  2N55 A;  1H9M A;  1TII D;  1G6Z A;  1AN8 A;  5EJW A;  3W2D A;  2GVA A;  3O13 A;  2HIX A;  5JOB A;  4ZLT F;  2K33 A;  3WOE A;  5IP7 G;  4LFC Q;  2NVQ H;  2LKV A;  1XTC D;  3SK8 A;  1HHV A;  2PI2 A;  5HGQ A;  4ZCK A;  3L0O A;  5BR8 L;  1WTV A;  5IGB A;  1CKN B;  4GN5 A;  2K50 A;  2VB3 X;  3HOZ G;  2K01 A;  4GKK Q;  2SEB D;  1QVF A;  5AJ3 L;  3U58 A;  3J81 E;  3GTG H;  5GRO A;  3HOU H;  4A3C G;  1WD0 A;  1OXV A;  1BOS A;  1CQV A;  5GAH C;  1KHI A;  2R93 B;  3A54 A;  1E7Z A;  5IGG A;  3H3V C;  4YHH L;  1QE6 A;  3S15 B;  4HTH A;  1H9J A;  5T1I A;  5EKL A;  5C5M A;  2AUK A;  1SAP A;  4X3U A;  1Y8P B;  1N36 Q;  3S17 H;  3NP8 A;  2UXC L;  1Y14 B;  3CPF A;  1QZG A;  2NVX B;  1HZC A;  1V1P B;  1T5E A;  1FYC A;  3W3A A;  2K5W A;  3G7L A;  2CFM A;  3HOZ B;  4KJN A;  3MZ5 A;  3DEP A;  4JI2 Q;  1JB7 A;  3MA2 B;  1Q90 A;  3M4O B;  4RMF A;  4S3S A;  4RA8 A;  2R61 A;  2EY5 A;  3K5L A;  2PO4 A;  4ZK9 B;  1NTG A;  2E5L Q;  1ESR A;  1EEF D;  1XXG A;  3QOL A;  2UUA L;  5JAV A;  3SVM A;  3CMA A;  3BVG A;  2JEB I;  1C9O A;  1E1O A;  1VQN A;  4NKL A;  5IT9 c;  5FO7 B;  1BCP C;  2Z6B A;  4GKK L;  1ICF B;  3QWN A;  1EY6 A;  3ERO A;  1BO0 A;  2ZTC A;  1PYS B;  3J80 E;  1A15 A;  5C4Z A;  3GTJ H;  2AQ3 B;  4IJH A;  2F0W A;  1KIX A;  3FKI B;  3HOX H;  1K8A C;  1K73 C;  2RHQ B;  4DN4 M;  1YJ9 A;  4K0K Q;  2QW7 A;  1D5M C;  4LWC A;  2VUM B;  2OWO A;  3T1H Q;  4P75 A;  1X9N A;  4GNX A;  3D6C A;  3ER0 A;  2RF4 A;  2F0D A;  4HIO A;  4I7A A;  4KV6 A;  2B3G A;  5IYB G;  2R93 H;  2YTV A;  3S1R H;  1W3S A;  1IBL Q;  4MN3 A;  5D3D A;  3OTO L;  2XGT A;  1HA6 A;  1XWE A;  2K52 A;  3NQI A;  3HOV B;  2F0K A;  1DYQ A;  5CV4 A;  4JYA Q;  5JJI A;  5JJZ A;  4PMB A;  1HNZ L;  1IZ6 A;  5KNC A;  4GS3 A;  1GVP A;  1CUK A;  4LF4 Q;  1STN A;  4IFD J;  2Z0S A;  1UE5 A;  1WFQ A;  1VQL A;  3UE1 A;  2KOL A;  4DK3 C;  1DOL A;  2F0I A;  4J6H A;  2WII B;  3PV0 A;  1PTO F;  2BDO A;  4R4I A;  1MJE A;  4JCV E;  3TDQ A;  3Q6S A;  1KNA A;  3GTM H;  1NY4 A;  1RTO A;  3PF4 A;  2WAQ G;  1K9M C;  5EAY A;  5EQ0 A;  1FGB D;  1CI3 M;  3FHW A;  4A3E G;  1A2T A;  1KLU D;  3L9A X;  2PW7 A;  5EPJ A;  3OWF A;  1ENA A;  1UE7 A;  4NXM L;  1PH9 A;  3C2P A;  5CMD A;  1ASZ A;  2AWO A;  1U0L A;  3L7Z C;  4LUO A;  1HNX Q;  4DV6 Q;  2F0V A;  5CV8 A;  4B3R Q;  4HSP A;  4GNX C;  1FNV A;  1BDO A;  3G48 A;  4IJL A;  5J1Z A;  1B4O A;  1IBM Q;  1XNR L;  1I3Q H;  1BCP B;  3H15 A;  5IYC G;  2X6L A;  2B8G A;  4LK1 C;  2N3S A;  2NN6 H;  2WAQ B;  3RZO H;  3J80 L;  4K5X A;  5M5W B;  3NBH A;  2I5M X;  1S5E D;  4YIJ A;  3HOU G;  4C1N I;  5D65 A;  1GD7 A;  5ELC A;  4B3T Q;  3Q22 A;  1SE4 A;  2SDF A;  1YHB A;  4DV3 L;  4CDF C;  5C4J H;  5JJK A;  3S1Q H;  4YWK A;  3I3C A;  3I4N B;  2L11 A;  2DJF C;  1DM0 B;  4IFD G;  4GOP A;  4EQN A;  4Y7N B;  2BE5 D;  2EJM A;  2F0L A;  2EY6 A;  3KLW A;  4N8F A;  3D4W A;  3KDF B;  5CV5 A;  4AH6 A;  4AQY Q;  4ZUI A;  3KBX A;  4OIK A;  3TS2 A;  1AEX A;  4HIK A;  2F0S A;  2EYL A;  4A3B H;  3K5M A;  5IYC H;  3CRL C;  3OMG A;  5M3F H;  1YZ6 A;  4QY7 A;  3R8B A;  4JI4 Q;  3GTQ B;  4LNQ A;  4K5V A;  4JOI C;  4K0K L;  2PYK A;  3C46 A;  1X32 A;  4KK7 A;  5GAE C;  1E24 A;  4R4Q A;  3DWA A;  3U4V A;  5K36 H;  1JOO A;  4POG A;  2LY7 A;  2ZM6 L;  3CCS A;  2B8F A;  4J8Q A;  4ZYS A;  3G71 A;  4K8J A;  2A74 C;  3I2Z A;  1B44 D;  1E2V A;  3ZYY X;  4L6T B;  4A3E H;  2A1A A;  3D4R A;  5J22 A;  2OXP A;  3T4A C;  2ZXO A;  1ZYR C;  1Q8I A;  5C3E G;  2TSS A;  1MBY A;  1YJN A;  2A8V A;  1S5D D;  4IUN A;  4DNT B;  3IFT A;  1ET6 A;  5EBD A;  4CDE C;  1GM5 A;  4QL5 A;  3KLS A;  1OXS C;  1BKB A;  1HPC A;  3MAQ A;  2MQH A;  1PA6 A;  2K5V A;  4B3T L;  4GN3 B;  5TSS A;  5C4X G;  3RUZ A;  2FMC A;  4AQY L;  5IYD G;  4A93 H;  2EY2 A;  2A6H C;  4DNR B;  3CME A;  1KTK A;  2V1C C;  5JJL A;  1Y8O B;  2F0T A;  3DMU A;  1CZG A;  4JI8 L;  5C3E B;  1PVO A;  1CSP A;  1YVC A;  1QJO A;  1KXL A;  4XTC S;  3OW7 A;  3D31 A;  2IX1 A;  1L1O B;  3TZD A;  1VQJ A;  4RAU C;  1XPR A;  4TRD A;  1VQE A;  3W5O A;  3A5U A;  3D8G A;  4R4C A;  3ICE A;  1EWI A;  3UDF A;  3CQZ H;  2KCT A;  5T1G A;  2NN6 I;  2F4V L;  2B2W C;  4RKL A;  4LF9 Q;  4UP9 A;  3LNN A;  4C3H B;  1ILQ A;  2RDG A;  4ULL A;  4POF A;  3HOX G;  4MHE A;  1NMG A;  2NBF A;  1I4G A;  1N9W A;  4DV0 L;  4LF6 Q;  1KDC A;  3URY A;  3S2D H;  2FJ2 A;  5I6Y A;  3PUW A;  5JVG 3;  1JT8 A;  3CAM A;  4K2L A;  2HDM A;  4PZ7 A;  3SK4 A;  2KQ3 A;  4JV5 L;  1SYF A;  1AZP A;  1A62 A;  4A3L G;  1JOR A;  3KF8 B;  5IWA Q;  1S3O A;  4R1J A;  4WJ4 A;  3PCO B;  2UXD Q;  2PNH A;  2BH8 A;  2OTJ A;  1EYA A;  1HNW L;  3BYT B;  2UU9 Q;  2X69 A;  1S5F D;  4UHV A;  1MSG A;  1O78 A;  1C7Y A;  5D3I B;  1RIP A;  2CQO A;  1UAP A;  1WYD A;  4OL7 A;  2L12 A;  3JAM c;  3TP7 A;  2XN9 C;  2L9H A;  3BYY B;  4IUR A;  4C3I G;  3VDY A;  4TSS A;  1D5Z C;  1HZB A;  3OOC A;  2E5L L;  4IFD I;  2CHB D;  3S16 B;  1SYE A;  3D6W A;  3KF6 B;  1OO9 B;  2E2H H;  3GTL H;  4X6A H;  4J15 A;  5EBC A;  4B9W A;  1DOM A;  1TS2 A;  2A6H D;  1FVI A;  5IT9 L;  3IL8 A;  1WVL A;  3CPW A;  4FF1 A;  1LTS D;  4A3K H;  2E74 C;  3FMC A;  3GTP B;  2G9H D;  4OWX B;  1ZXT A;  3M3Y H;  2E76 C;  3HOW B;  3W1B A;  1EWC A;  4KI0 A;  3NWT A;  1B7Y B;  1AZQ A;  1GUO A;  2KEC A;  1MI2 A;  3JAM L;  1HZ9 A;  4JI6 L;  1LTA D;  1XTD A;  2H5X A;  2H1E A;  3T16 A;  4CKC A;  1GHK A;  2D62 A;  2EYM A;  1YNN D;  4PG3 A;  1IBK L;  1JIC A;  4JI7 L;  2OT2 A;  4IUT A;  2F0H A;  2F0J A;  1PZI D;  2F0N A;  4IUU A;  3FPP A;  1I6V C;  1PTO D;  4A4I A;  4PV1 C;  1E1T A;  5BR8 Q;  4EGV A;  2RDH A;  4KY6 A;  1VQ6 A;  4KD4 A;  4Y52 H;  3SR1 A;  2M2L A;  4X3K A;  2JJQ A;  5CV9 A;  5C44 G;  3BG3 A;  4BA2 I;  3HKS A;  5D14 A;  5A2Q L;  3RLO A;  3M7G A;  5FLM H;  1O7L A;  4G57 A;  4I65 A;  4RCN A;  1M90 C;  4F8M A;  4EQP A;  4U67 3;  1LTB D;  3RD4 A;  4DR6 L;  5FO8 B;  3F8T A;  2V4D A;  2DGY A;  1FGU A;  1P8L A;  3HS0 C;  2JK8 A;  5M3M H;  4JI1 L;  3S17 B;  1X3F A;  4R4T A;  1PH7 A;  1NJI C;  2F3V A;  4KHV A;  2YU9 H;  3AMU A;  1AW7 A;  1CHQ D;  3ND9 A;  4JBW A;  5EGT A;  4R8I A;  4FXD A;  2K5N A;  4XDX A;  4IUP A;  4X3S A;  3Q24 A;  4GOP B;  5C0X H;  4MTN A;  3MC0 B;  3TP8 A;  2A6E D;  3A0J A;  2JQO A;  3MEH A;  1K8M A;  3CRK C;  4GLA C;  3HKZ G;  1L1O C;  3GV3 A;  1KAW A;  5FLX E;  1BBU A;  2Q8R E;  3CP0 A;  2WKD A;  3WDN A;  5E4X A;  1D5X C;  3OYY A;  4KKT A;  1CHP D;  2C35 B;  3CCM A;  1BQQ T;  2YTY A;  2BCO A;  4CDC C;  1NMF A;  5J39 A;  3I4N H;  2IJ0 A;  1B3A A;  1TY0 A;  3M4Q A;  5JPM C;  1RHP A;  2I5L X;  1YHA A;  2LSS A;  5C0X J;  4BY7 G;  5FLX L;  1TR5 A;  3KOJ A;  2F3W A;  4A3F G;  4A3K G;  3I7F A;  4K14 A;  3STB C;  1XMO Q;  1SE2 A;  4NXN L;  2MNA A;  4HIM A;  4DR5 Q;  4B3R L;  1WTP A;  2IHF A;  5IGC A;  3SXH A;  4BBR H;  2AMC B;  1SLJ A;  3GTQ H;  1F2M A;  1MKH A;  5H1S E;  3SEB A;  4BY1 G;  1G29 1;  2D9U A;  4BBS B;  1SMY C;  2N49 A;  2PZU A;  3VR5 A;  3BZC A;  1TS3 A;  3NEM A;  3T56 B;  1Y1V H;  5ELB A;  4N8X 1;  3PIP 3;  4JI1 Q;  3MFY A;  1KRS A;  4RGN A;  3NBI A;  1PLF A;  4C3I H;  3CCJ A;  5LMN L;  1R9T H;  1OXX K;  3DM3 A;  5CBE E;  5A35 A;  1N33 Q;  1VQA A;  4IAL A;  4A76 A;  1A3T A;  3I55 A;  1GUT A;  4HED A;  4UP8 A;  3J81 L;  1ENC A;  1YIT A;  1FD7 D;  4IPD A;  4QIW B;  1KNE A;  3F2B A;  4TVA B;  1HCZ A;  3WOF A;  1XPO A;  1VDZ A;  5DM7 3;  4BBS G;  1YNJ C;  1Q3L A;  1HRJ A;  1A8V A;  2ZTE A;  1SR3 A;  1N33 L;  1PFS A;  2KA7 A;  5BN4 A;  2KEN A;  3MHB A;  2JA6 B;  4A75 A;  4DV7 Q;  1CM9 A;  1KDA A;  4QF4 A;  1HR0 Q;  2B2U A;  1Y1W G;  2A68 C;  3K7A B;  2CWA A;  3OPO A;  3NWS A;  1PZK D;  4C3H G;  5C5L A;  4DR2 L;  4WOR A;  4JG2 A;  2Y0S G;  4A3J H;  1XMQ Q;  2JA9 A;  1GXD C;  5ELE A;  3G6J B;  3NQT A;  1SYD A;  4MIU A;  4OX9 L;  1DJR D;  1SNC A;  1SDF A;  3D3R A;  4BXX H;  2MO0 A;  3PO3 B;  4A93 G;  4X64 Q;  2QKI C;  3SE0 A;  3K5N A;  4CHT B;  1N8R C;  2YU9 B;  2B2V C;  2SNM A;  3ITP A;  3HOW H;  3AFP A;  5KYI A;  4LF5 L;  1GHJ A;  1F9R A;  4XIG S;  4YHH Q;  1MIU A;  2JN4 A;  2IWH A;  2J0T D;  4A3M H;  3TQY A;  1GUN A;  3A8K E;  1F2Y A;  3GD7 A;  1EFW A;  3F1Z A;  3I70 A;  2AQ2 B;  1VF7 A;  4OGQ C;  4QB4 A;  4C3I B;  4QQB X;  2N88 A;  4DUZ L;  2LFN A;  2F0F A;  3NBH B;  3AQQ A;  2NVT B;  1XNR Q;  3I4M G;  1W2B A;  2EXZ A;  3BDC A;  4GNX B;  3J81 j;  4OON A;  3E0J A;  1EWH A;  2VUM G;  2HQL A;  3NEL A;  1MSH A;  4ALP A;  1J6Q A;  3I73 A;  1IXR A;  2B2U C;  3OIQ A;  3CXC A;  1BVS A;  2B29 A;  1VQO A;  1PMR A;  4KTA A;  4A3B B;  5KEE A;  1XMO L;  3OHX C;  4DV2 Q;  1HJP A;  1X3E A;  2Z1C A;  3NE5 B;  3A7A B;  4DR6 Q;  4FF2 A;  3DWP A;  1NUC A;  4GN4 B;  4FF3 A;  4OO1 G;  3IRB A;  3GTL B;  3EBE A;  1FNU A;  4DU9 A;  3GQB A;  1L1O A;  1FL0 A;  4LF5 Q;  2NVX H;  3U9O A;  2IT1 A;  4KD3 A;  3JC6 6;  2ES2 A;  4QUF A;  5KRU A;  4KKS A;  4A3J B;  2PMZ B;  4PMW A;  4M8A A;  2B63 B;  2X6G A;  3M3Y B;  2ALY B;  2E2H B;  1I4P A;  1EYC A;  1WI5 A;  2CWP A;  4A3G H;  3MVV A;  1RTN A;  4IFD H;  2J7Z A;  4N9T A;  5C44 B;  5M5W H;  4V19 0;  3MXN A;  5ELN A;  5ELF A;  1TU2 B;  4PQX A;  2IHE A;  1F9P A;  2R7F A;  4NPS A;  5J3B A;  5I2Y A;  1I3Q B;  1UEA B;  2VQE L;  2EYH A;  4LF8 Q;  4XXE A;  2AHO B;  4A3E B;  2PZW A;  4EQO A;  1PFB A;  1GUG A;  4A3D H;  3S2H H;  2L55 A;  5IGF A;  2ZJP A;  1KD1 C;  1SNP A;  1F9Q A;  1OTC A;  4JC0 A;  2WFW A;  4JI0 Q;  2PCF B;  3J81 i;  3GTK H;  1LTI D;  2A68 D;  2K14 A;  3CCE A;  2BH2 A;  1B9N A;  2KJX A;  3OWE B;  1IW7 D;  2Z4I A;  1PHJ A;  1RJT A;  1X55 A;  1HQR D;  2UUB Q;  2E2I B;  2EDG A;  1EY0 A;  2VUM H;  1W6J A;  4UP7 A;  1TWC H;  1X6O A;  4DV4 Q;  3BU2 A;  4QCL A;  1QVG A;  1MJC A;  1SNM A;  2DN8 A;  3M4P A;  4A3D G;  1EIH A;  4UPA A;  3CQZ B;  4BA1 I;  5LMN Q;  2RCN A;  5M9O A;  1IBL L;  1GUS A;  1LT6 D;  2PQE A;  3VYS A;  1SFO H;  4DK0 A;  2HHH Q;  1T5X D;  1WTQ A;  1QNU A;  1DZ1 A;  3KDF A;  1K8O A;  1SND A;  2VQF Q;  4LF8 L;  1PH5 A;  5IOC A;  3C1F A;  2Q2T A;  1B70 B;  1TS5 A;  1SMY D;  4DV7 L;  3ULP A;  3PSI A;  2OF1 A;  3F2D A;  1V8Q A;  3L3O C;  1EYD A;  1EY8 A;  4JK1 C;  2BA0 A;  4LW1 A;  2OEO A;  5ISR A;  2PQA B;  1IL8 A;  5IYD H;  3T51 B;  3BVM A;  5LMU L;  4A3D B;  3S2H B;  3PGZ A;  1VF5 C;  4A3I H;  4FP5 D;  4A3G B;  1PYB A;  2K5Q A;  4LF9 L;  1VQD A;  5FKA C;  1VQI A;  2EYF A;  4ZAI A;  3MXP A;  1I4H A;  3QB3 A;  2Q8I B;  1AFP A;  1J9O A;  4O2D A;  1OXT A;  3H0G H;  1Q12 A;  2FMM A;  2O5J C;  2A69 D;  5JVH 3;  2C9O A;  5KYL A;  4C1N K;  3J7Y W;  2EZV A;  2G5D A;  4IUQ A;  2UXB L;  1L0Y B;  5EPK A;  3X3N A;  3P75 A;  1S72 A;  2WIN B;  2K7V A;  1STY A;  3V96 A;  4QUC A;  4DV6 L;  1D1K A;  2DY8 A;  2A6E C;  3S1N H;  2K75 A;  1KLG D;  2UU9 L;  1JCK B;  2PZT A;  3PO2 B;  5FOB B;  3GTP H;  2C5C A;  4RGM A;  2OQ0 A;  1SFO B;  3VR2 A;  4I7Z C;  3UDX A;  1KQS A;  2M00 A;  4AYB G;  2JA6 G;  2HCC A;  5C4X B;  4JI5 Q;  1I6H B;  1ENF A;  2MUY A;  1N36 L;  1Q8K A;  3D4D A;  1K0S A;  2CW0 C;  3FPU B;  2ZJQ A;  1VQ4 A;  2HIV A;  4G7O C;  2M9V A;  1P16 A;  1M4V A;  3AB9 A;  1T9H A;  1SXT A;  1YHQ A;  1Y69 U;  4X65 L;  5M5X H;  3SDZ A;  1SRU A;  2KCC A;  4YCW A;  1KAB A;  5KGU A;  3G6E A;  1PH1 A;  3EQL C;  5M3F G;  3P20 A;  4L8J A;  3RZO B;  4BY1 H;  1NBW A;  4ZKC B;  3TBI B;  3TP5 A;  3K7A H;  3P1H A;  1B8A A;  2KHI A;  4X66 L;  2H4O A;  1KC8 C;  4P72 A;  2R3Z A;  3FP9 A;  3HOY G;  1JJG A;  1SSO A;  4OHJ A;  1IBK Q;  5C0X I;  4DXG A;  1V9P A;  1TWH H;  3S1Q B;  2OQK A;  4RKB A;  2QGQ A;  4HJ9 A;  4X65 Q;  2JA5 B;  3FEW X;  3RNU A;  1VQ8 A;  4NMZ A;  2B39 A;  1O7Y A;  5L37 A;  4DUY Q;  3UDG A;  3KJP A;  3J7A F;  3A7L A;  2I07 B;  3H0G B;  2Y0S E;  1IHZ A;  4YWM A;  1BBX C;  1VQ7 A;  3DEO A;  3T13 A;  2K1B A;  4U68 A;  2NN6 G;  4XT1 B;  4X62 L;  4B3M L;  4KY5 A;  3LWU A;  2KEE A;  1GOZ A;  2YTX A;  4NB3 A;  5I9P A;  3CCV A;  1FJG Q;  2GA4 B;  5IP7 H;  3MXU A;  4A3M B;  1TKW B;  3I4L A;  2F4I A;  1D1I A;  2R7Z H;  2Q2U A;  3ONA B;  4C3J H;  5I9O A;  5CR3 A;  1NNX A;  3TSS A;  1QG7 A;  1I94 Q;  1B3Q A;  1XNQ Q;  4NP5 A;  4UDU C;  1OXU A;  3DM1 A;  1RCV D;  2I0Q A;  2NVY H;  1AE3 A;  1TXY A;  4LFB L;  3FKI G;  3TEH B;  1D6E C;  3EN2 A;  2QEX A;  4HCE A;  3WWV A;  5E1F A;  1EOT A;  3MXG A;  2YYZ A;  3M85 A;  1DCZ A;  2RQX A;  2HCI A;  4BBR G;  4NW2 A;  1CK1 A;  3EA6 A;  2NYZ D;  2A19 A;  4K6D A;  5FLM G;  1I94 L;  4A3M G;  4OWT B;  4KHP Q;  2UUC L;  5KIX A;  1TWH B;  1XX8 A;  3VYU A;  2ASB A;  4DV5 L;  2L15 A;  4L5Q A;  1U4P A;  1A63 A;  2JP1 A;  4H13 C;  3HOW G;  2K05 A;  2LS0 1;  3M9B A;  1FJG L;  1PH8 A;  5FO9 B;  5HY6 A;  3PUV A;  4TKO B;  2IX0 A;  4DNI A;  4H7B A;  3CKI B;  3J7A V;  5CYU A;  5LL6 S;  3HZX A;  4HJA A;  3CF5 A;  2D5D A;  2B63 H;  2BOS A;  2VXW A;  1B9M A;  1PTO B;  4CGY B;  2JA5 H;  1ET9 A;  2IY5 B;  4FDB A;  2DNE A;  1B2T A;  1DD2 A;  1EY4 A;  1D7Q A;  2CH4 W;  5E7N A;  4OO1 I;  1GJX A;  3C3L A;  3KBG A;  3F2C A;  4HSV A;  4FO2 A;  3FDT A;  3NK9 A;  1CKM A;  1R9T B;  2Z6K C;  1MD2 D;  1Q1E A;  4GKJ Q;  2I5H A;  2L0C A;  5E4W C;  3ZJY C;  1SN8 A;  4LF7 Q;  5IE8 A;  3AFQ A;  1BXT A;  2CCZ A;  3K57 A;  1K28 A;  1X54 A;  2R7Z B;  4Q0F A;  3V05 A;  1QZH A;  2AKW B;  1C8C A;  2F0O A;  1WJJ A;  5DLQ E;  3I90 A;  4DAY B;  1PV4 A;  1SBB B;  1IL2 A;  1HTL D;  2F52 A;  1E22 A;  1WCM B;  4KN4 C;  1F77 A;  4C3J G;  3BVZ A;  1Y1V G;  2UUC Q;  3JAM E;  3HKZ B;  4P71 A;  5K5P A;  1ZYR D;  4PZ8 A;  4FYD A;  4RGT A;  3OIP A;  3S14 H;  1EL0 A;  3K6O A;  4NDX A;  3PIP A;  2R7Z G;  4JI8 Q;  1HXY D;  3A74 A;  2A69 C;  1CA5 A;  1EQR A;  3TME A;  4ME3 A;  1QWY A;  2RVL A;  1TWF B;  3NTK A;  1U5K A;  2HT1 A;  2K5H A;  2VS1 A;  1V1Q A;  5JEA G;  1LT4 D;  4DR7 L;  3M4Y A;  2RA4 A;  2WAC A;  4C3J B;  4JI6 Q;  4KJO A;  1XMQ L;  1XNQ L;  1UNS A;  1JOK A;  2A73 B;  3VA5 A;  4RH6 A;  4A3K B;  1A6X A;  5I2X A;  4HJ7 A;  3M4O H;  1IKM A;  3QIA A;  3H6M A;  1SYC A;  4A3I B;  4IQZ A;  2EIF A;  3C1E A;  1HR0 L;  4L63 B;  4A3C H;  1Q1B A;  1LM0 A;  2CQA A;  2Z8L A;  3VR6 A;  1JWM D;  4DAP A;  4YY3 L;  1PH3 A;  5JEA J;  4P73 A;  4F88 A;  2QIL A;  3J80 i;  1K8G A;  4AYB B;  4DGZ A;  4IPC A;  1PZJ D;  2L4N A;  2XWJ B;  1PRT C;  3J7Z C;  3RLN A;  3KUP A;  2K03 A;  3H94 A;  5AFW A;  1RD9 D;  4ODG A;  4DAV A;  1SJH D;  3RZD B;  3VYT A;  1YNX A;  4L5S A;  1HH2 P;  1BCP F;  3DWQ A;  5AJ3 Q;  1II3 A;  1SJE D;  2D2C C;  3S9W A;  1AE2 A;  2XVS A;  4RHS A;  5M3F B;  1WCM H;  1SE8 A;  2QDB A;  4C2M B;  4A3L H;  2Z6K A;  2B2Y C;  3QG1 A;  4HJ8 A;  3CC7 A;  1I6H H;  1LLR D;  1NAP A;  1Y1W B;  3HOY B;  3K0Y A;  1EZ8 A;  2VW9 A;  4X62 Q;  4DK6 C;  1AH9 A;  2AQ1 B;  5IY0 A;  1JE5 A;  4J1M A;  1VQK A;  3R93 A;  2R92 G;  4DAY A;  4APV A;  2JA5 G;  1LO5 D;  1R4Q B;  4JVZ A;  1NR2 A;  1YIJ A;  1QVC A;  4ZQ3 A;  3T1Y Q;  2F0E A;  5HGT A;  3V2T A;  1JWU D;  3I56 A;  3N6R A;  3H0G G;  3PO3 G;  4M1U B;  4DR7 Q;  4A93 B;  4LF4 L;  4JI3 Q;  1Q86 C;  4H0L C;  1CZW A;  1LT5 D;  1Q82 C;  3S1M H;  1CSQ A;  4DA2 A;  4QJF A;  2FHT A;  4ZUJ A;  4FF4 A;  5IGE A;  3CD6 A;  1ML0 D;  1G51 A;  2EJF C;  4JYA L;  3OW2 A;  2MJ8 A;  1LTR D;  3RN2 A;  5IT9 E;  3SK5 A;  1ASY A;  2UUB L;  2R92 B;  1K3R A;  1IYV A;  1EQV A;  1VQP A;  4LAA A;  2E2J H;  3TP6 A;  2K04 A;  5DEH A;  3I4M B;  3FKI H;  1HUN A;  3DHQ A;  1K0R A;  5F2D A;  2PMZ E;  1I50 B;  1A3V A;  3GV6 A;  2EQS A;  3T53 B;  5ELD A;  4K5W A;  1IBM L;  3LX0 A;  2CW0 D;  2XWB B;  1Q81 C;  1Y1W H;  1CFM A;  5C44 H;  2ENB A;  1M8A A;  3I8Z A;  2VY3 A;  1VMP A;  1TWA H;  3E3X A;  4IN3 A;  5ELO A;  5IWA L;  2ICI A;  3MTS A;  3PUX A;  3GO5 A;  1PRT F;  2Q2H A;  3GDE A;  4GKJ L;  3Q8D A;  4ZRZ A;  2ATW A;  3FRP B;  4IZ8 A;  1QIL A;  2XRS D;  1ZEQ X;  1K83 B;  2ZM6 Q;  4DAM A;  4K2K A;  2K28 A;  2NB0 A;  2B2T A;  4B3S L;  5FLX c;  3K80 C;  1JOQ A;  4LFA Q;  4L5R C;  4JI7 Q;  1ILP A;  4CJ0 B;  3H09 A;  5I4D A;  3KFU A;  1SYB A;  1E3P A;  2XTI A;  3ERS X;  4DR1 Q;  2F0G A;  1Z47 A;  4YCV A;  3IAY A;  5IP9 G;  1UUP A;  1CA6 A;  3Q23 A;  1FNW A;  1GO3 E;  3HG9 A;  4QIW E;  2MGS A;  1B50 A;  1JWS D;  2F0M A;  4CJ1 B;  2K32 A;  5JPN C;  2K4K A;  4X64 L;  3G4S A;  3S1M B;  3S14 B;  1C4Q A;  5CC4 A;  2QDL A;  4C56 C;  3GTM B;  3EVQ A;  1AP0 A;  2DJG C;  2JA7 B;  1STE A;  1U4R A;  4XQN A;  1B1Z A;  2PQA A;  3ULJ A;  4HMI A;  3I91 A;  3N52 A;  3R3O A;  2VL6 A;  3PIO A;  3NTI A;  2NWG A;  3W1G A;  1RF2 D;  4ID6 A;  2KBN A;  3I4N G;  3RLF A;  3T1H L;  3BS1 A;  1CT1 D;  4L5T A;  2NVT H;  5DM6 3;  1HQM C;  1EQT A;  5M5Y H;  2WB1 E;  5C4X H;  1C48 A;  3HGB A;  4CDD C;  4B3S Q;  2KHJ A;  2XIW A;  5KNB A; 
#chains in the Genus database with same CATH homology
 4IPH A;  1S72 A;  3PUW A;  1JT8 A;  3CAM A;  1EOV A;  1SMX A;  4PZ7 A;  4DV1 L;  1SRO A;  4DV6 L;  2JA7 G;  1PH4 A;  2LXJ A;  4JV5 L;  4AYB E;  1A62 A;  4A3L G;  1KL9 A;  3KF8 B;  1S3O A;  4R1J A;  5IWA Q;  5C0X G;  2UXC Q;  3PCO B;  1JJC B;  1UE1 A;  2K75 A;  2UU9 L;  3S1N H;  2UXD Q;  2PNH A;  2BH8 A;  2OTJ A;  3GTO H;  1HNW L;  3TRZ A;  3GTP H;  3H3V I;  2UU9 Q;  2OQ0 A;  3KJO A;  3UDX A;  1KQS A;  4AYB G;  2JA6 G;  3S15 H;  3L2P A;  2NZO A;  4LFB Q;  1C7Y A;  1UWV A;  4JI5 Q;  5FJ8 G;  1TWF H;  1VQM A;  2LXK A;  1N36 L;  1RIP A;  1UEB A;  2CQO A;  3AYH B;  1Q8K A;  1K83 H;  4DR3 Q;  5GAG C;  4EX5 A;  1JMC A;  1QUQ B;  1WYD A;  2ZJQ A;  1VQ4 A;  2HIV A;  4DUY L;  3JAM c;  1D8L A;  3CW2 C;  4JI5 L;  2OCE A;  4H02 A;  1P16 A;  2VZA A;  4JOI A;  1T9H A;  1YHQ A;  4X65 L;  3VDY A;  2F4V Q;  5M5X H;  3PO2 H;  1SRU A;  1HZB A;  4YCW A;  4A3I G;  2E5L L;  3CCU A;  2GN5 A;  4IFD I;  3K8A A;  3G6E A;  1PH1 A;  1EYG A;  2AWN A;  3MXN B;  5M3F G;  3KF6 B;  2E2H H;  3GTL H;  4X6A H;  4BY1 H;  4J15 A;  3EIV A;  4KHZ A;  1NBW A;  4YWL A;  2R6G A;  3K7A H;  1FVI A;  1B8A A;  2KHI A;  1Q46 A;  1VQB A;  4X66 L;  1EIY B;  3CPW A;  1KC8 C;  1LTL A;  4P72 A;  4LF6 L;  3FP9 A;  3HOY G;  4R4O A;  1JJG A;  1BBW A;  5GQO A;  4A3K H;  1IBK Q;  5C0X I;  4C3H H;  5IYB H;  4OWX B;  1V9P A;  1TWH H;  4KHP L;  3M3Y H;  4GLX A;  3KF6 A;  2OQK A;  3W1B A;  4KI0 A;  2QGQ A;  1UE6 A;  4HJ9 A;  1B7Y B;  4X65 Q;  3UDI A;  3S16 H;  3I4O A;  4JI3 L;  2VQE Q;  3RNU A;  1VQ8 A;  1X3G A;  3UDG A;  4DUY Q;  2JEA I;  1Q7Y C;  3KJP A;  2R92 H;  4QGU A;  1CKN A;  3RZD H;  3MEF A;  1HZ9 A;  3UE0 A;  4HJ5 A;  4JI6 L;  1L2F A;  4LFA L;  4DR1 L;  1XTD A;  2H5X A;  1EQQ A;  2D62 A;  3U50 C;  2Y0S E;  3PUZ A;  4YWM A;  4IO9 A;  1VQ7 A;  4PG3 A;  1IBK L;  4IOA A;  4JI7 L;  2NN6 G;  2F3I A;  4X62 L;  1G6P A;  4B3M L;  2YTX A;  4NB3 A;  2JE6 I;  3CCV A;  4OX9 Q;  1FJG Q;  3E9I A;  4Y7N H;  5IP7 H;  2E8G A;  4A4I A;  1E1T A;  3K81 C;  5BR8 Q;  1EUJ A;  1PH6 A;  1WCM G;  3K7U C;  3CCQ A;  1VQ6 A;  4Y52 H;  1LUZ A;  2Q2U A;  2R7Z H;  4C3J H;  4BBS H;  2JJQ A;  1VQC A;  1N32 L;  5C44 G;  1I94 Q;  4BA2 I;  3HKS A;  5LMN W;  2WP8 J;  1XNQ Q;  3RLO A;  2Q2I A;  1OXU A;  2D0P A;  5K36 G;  5FLM H;  2I0Q A;  1CKO A;  1I5F A;  2NVY H;  1M90 C;  1M1K C;  4O0A A;  4DR6 L;  1AE3 A;  4UY8 C;  1TXY A;  4LFB L;  3FKI G;  3TEH B;  4KLK A;  3F8T A;  3EN2 A;  1EIF A;  2DGY A;  1FGU A;  1P8L A;  2BA1 A;  2D0O A;  2JK8 A;  2QEX A;  3WWV A;  3HOV H;  5M3M H;  1VS0 A;  4JI1 L;  1X3F A;  4R4T A;  2GVA A;  2HIX A;  2YYZ A;  3M85 A;  1PH7 A;  2WAQ E;  1NJI C;  1DGS A;  4BBR G;  5IP7 G;  2YU9 H;  4LFC Q;  5FLM G;  2A19 A;  1I94 L;  2NVQ H;  4A3M G;  1VCI A;  4OWT B;  4KHP Q;  4JBW A;  2UUC L;  2PI2 A;  2ASB A;  5HGQ A;  2FXQ A;  4DV5 L;  2L15 A;  1YBY A;  3L0O A;  4L5Q A;  5BR8 L;  1A63 A;  4BY7 H;  2K5N A;  3E0E A;  4GOP B;  3HOW G;  4MTN A;  1CKN B;  3M9B A;  4GN5 A;  2K50 A;  1PH8 A;  1FJG L;  3HOZ G;  3A0J A;  2JQO A;  5HY6 A;  3PUV A;  4GKK Q;  4GLA C;  3HKZ G;  2IX0 A;  1L1O C;  4HID A;  1KAW A;  5AJ3 L;  4DNI A;  3OTO Q;  3U58 A;  1BBU A;  3CP0 A;  1QVF A;  4A3F H;  5GRO A;  3GTG H;  3HOU H;  4A3C G;  2MO1 A;  1OXV A;  3OYY A;  1GKH A;  5GAH C;  2C35 B;  1KHI A;  1J5E L;  3CCM A;  5GAD C;  1E7Z A;  4HJA A;  3CF5 A;  2YTY A;  4RG1 A;  1VQ5 A;  4YHH L;  3HKZ E;  2B63 H;  1NMF A;  4P74 A;  3I4N H;  3B6Y A;  2JA5 H;  2IY5 B;  4FDB A;  1D7Q A;  3M4Q A;  5E7N A;  1IYJ B;  2I5L X;  4OO1 I;  1N36 Q;  4GKJ Q;  3S17 H;  1YHA A;  2LSS A;  5C0X J;  4BY7 G;  4JI2 L;  1Y14 B;  3CPF A;  3F2C A;  1QZG A;  1HZC A;  3KOJ A;  2UXC L;  4DV4 L;  4A3F G;  4A3K G;  1CKM A;  3I7F A;  1O7I A;  2CFM A;  1Q1E A;  2Z6K C;  3STB C;  4X66 Q;  2I5H A;  4JI2 Q;  4NXN L;  2MNA A;  4HIM A;  4DR5 Q;  1XMO Q;  1JB7 A;  2IHF A;  4B3R L;  1A0I A;  4RMF A;  3ZJY C;  3K0X A;  4BBR H;  1SN8 A;  2AMC B;  1SLJ A;  4LF7 Q;  2MFI A;  5IE8 A;  1I50 H;  3AFQ A;  3GTQ H;  1X65 A;  1MKH A;  2CCZ A;  5H1S E;  1NTG A;  4BY1 G;  3HOV G;  1X54 A;  1G29 1;  2E5L Q;  1XJV A;  1QZH A;  2AKW B;  2N49 A;  3BZC A;  4DR3 L;  3NEM A;  2UUA L;  1Y1V H;  1WJJ A;  5DLQ E;  4YCU A;  3CMA A;  4JI1 Q;  4C3I H;  1KRS A;  1C9O A;  1VQG A;  2JEB I;  4DAY B;  3CCJ A;  1PV4 A;  1IL2 A;  3BZK A;  1E1O A;  1QUQ A;  5LMN L;  1R9T H;  5IT9 c;  1VQN A;  1OXX K;  3DM3 A;  2F52 A;  1XPU A;  4GKK L;  1E22 A;  1N33 Q;  1VQA A;  4A76 A;  2CKZ B;  3I55 A;  3H3V H;  1KRT A;  2ZTC A;  1PYS B;  5FJ8 H;  3LGJ A;  2UXD L;  3RR5 A;  4JBJ A;  4UP8 A;  1H95 A;  1Y1V G;  1YIT A;  2UUC Q;  1YJW A;  4P71 A;  4IPD A;  3F2B A;  1N34 Q;  3GTJ H;  4TVA B;  4PZ8 A;  1XPO A;  4IJH A;  3S14 H;  1KIX A;  3PIP A;  4B3M Q;  2R7Z G;  4BBS G;  3HOX H;  4DV0 Q;  1K8A C;  4JI8 Q;  3A74 A;  1EQR A;  1A8V A;  2ZTE A;  4ME3 A;  1SR3 A;  1K73 C;  2RHQ B;  1N33 L;  1PFS A;  3STB D;  1YJ9 A;  4DPG A;  4K0K Q;  4DUZ Q;  4A3J G;  2KEN A;  1U5K A;  4LWC A;  4A75 A;  4DV7 Q;  2ZJR A;  2OWO A;  3T1H Q;  3RN5 A;  1HR0 W;  4P75 A;  1X9N A;  1HR0 Q;  4GNX A;  2B63 G;  1Y1W G;  2K5H A;  2HT1 A;  2VS1 A;  1V1Q A;  3ER0 A;  2CWA A;  2RF4 A;  5JEA G;  4DR7 L;  4HIO A;  4JI6 Q;  3DLL A;  1XMQ L;  1XNQ L;  2B3G A;  5IYB G;  2R93 H;  2YTV A;  4DR2 L;  3S1R H;  1VQF A;  1W3S A;  1IBL Q;  4HJ7 A;  3M4O H;  4JG2 A;  4EQ5 A;  2Y0S G;  4A3J H;  1XMQ Q;  3OTO L;  2JA9 A;  1HZA A;  2XGT A;  2JA8 G;  2EIF A;  2VNU D;  1HR0 L;  4OX9 L;  2K52 A;  4A3C H;  4BXX H;  2MO0 A;  1Q1B A;  4A93 G;  1LM0 A;  4X64 Q;  4JYA Q;  5JJI A;  3CC2 A;  1HNZ L;  1IZ6 A;  4MZ9 A;  4YY3 L;  1N8R C;  1PH3 A;  5JEA J;  1N34 L;  4P73 A;  1HNW Q;  4GS3 A;  1GVP A;  3J80 i;  1K8G A;  4DV5 Q;  1V43 A;  1CUK A;  4IPC A;  3HOW H;  3AFP A;  4LF4 Q;  4LF5 L;  3J7Z C;  2Z0S A;  1LYL A;  1UE5 A;  3RLN A;  4DR2 Q;  4XIG S;  4IFD J;  4YHH Q;  1MIU A;  1WFQ A;  1VQL A;  4A3M H;  3UE1 A;  3TQY A;  4DK3 C;  5IP9 H;  4JBM A;  3GD7 A;  3PV0 A;  3U4Z A;  1YNX A;  1EFW A;  1HH2 P;  4R4I A;  1MJE A;  3F1Z A;  5AJ3 Q;  4JCV E;  4L5S A;  4QQB X;  3GTM H;  4DUZ L;  1NY4 A;  3PF4 A;  2WAQ G;  3PUY A;  1K9M C;  5EAY A;  4DR4 Q;  3NBH B;  3AQQ A;  1XNR Q;  3FHW A;  4A3E G;  1VQ9 A;  1W2B A;  3I4M G;  1AE2 A;  3TRE A;  1WCM H;  2ID0 A;  4LUZ A;  1SE8 A;  1UE7 A;  4NXM L;  1RL2 A;  4A3L H;  4GNX B;  1PH9 A;  1Z9F A;  3J81 j;  1ASZ A;  4WJ4 A;  4OON A;  2AWO A;  2Z6K A;  3CCL A;  4HJ8 A;  1U0L A;  4LF7 L;  3L7Z C;  3CC7 A;  2VUM G;  1I6H H;  4DKA C;  4IPG A;  2HQL A;  4LUO A;  4DV6 Q;  1HNX Q;  2NZH A;  3NEL A;  4ALP A;  4B3R Q;  1J6Q A;  3JAM i;  1IXR A;  4GNX C;  3G48 A;  3CXC A;  1BVS A;  4X62 Q;  2VW9 A;  2B29 A;  4IJL A;  4DK6 C;  1VQO A;  1AH9 A;  4IOC A;  5IY0 A;  1IBM Q;  1XNR L;  4MNO A;  1I3Q H;  1XMO L;  1YI2 A;  1JE5 A;  2N78 A;  4DV2 Q;  1VQK A;  3H15 A;  2R92 G;  5IYC G;  4APV A;  1HJP A;  1X3E A;  2JA5 G;  4DR6 Q;  2N3S A;  1YIJ A;  1QVC A;  4GN4 B;  3T1Y Q;  4C2M H;  2E2I H;  4OO1 G;  3IRB A;  3RZO H;  2EXD A;  3EBE A;  2VQF L;  3J80 c;  2I5M X;  1L1O A;  3I56 A;  3M7N A;  2HHH L;  3PF5 A;  3HOU G;  1FL0 A;  3H0G G;  3PO3 G;  4DR7 Q;  4A3G G;  4LF5 Q;  2NVX H;  4LF4 L;  1GD7 A;  4B3T Q;  4YY3 Q;  2IT1 A;  4JI3 Q;  1Q86 C;  3HOY H;  3T1Y L;  1YHB A;  2ZTD A;  1Q82 C;  3JC6 6;  3S1M H;  4DV3 L;  2ES2 A;  3HOZ H;  4WJ3 M;  1CSQ A;  4QJF A;  4JV5 Q;  4PMW A;  5C4J H;  5JJK A;  4DR5 L;  4NXN Q;  2YV5 A;  1G51 A;  2KCM A;  4YWK A;  3CD6 A;  4TQU S;  2ALY B;  3S1Q H;  4JYA L;  1VQH A;  3OW2 A;  2RHS B;  3HFZ B;  4IFD G;  4GOP A;  1WI5 A;  2CWP A;  2GVB A;  4A3G H;  3PO3 H;  3RN2 A;  3KLW A;  4BXX G;  2UUB L;  1ASY A;  3KDF B;  5M5W H;  4AH6 A;  4AQY Q;  1K3R A;  5ELN A;  1PH2 A;  2PI2 E;  3TS2 A;  1VQP A;  4HIK A;  5M3M G;  2IHE A;  2E2J H;  4NPS A;  2R7F A;  5J3B A;  4LF8 Q;  2VQE L;  4A3B H;  1L0W A;  5IYC H;  2AHO B;  5M3F H;  1YZ6 A;  3FKI H;  4LFC L;  4QY7 A;  1K0R A;  4JI4 Q;  1JJ2 A;  2R93 G;  2PMZ E;  4DR4 L;  4A3D H;  4LNQ A;  3S2H H;  4JOI C;  2ZJP A;  1KD1 C;  2EQS A;  3PO2 G;  4K0K L;  3E9H A;  5GAE C;  1E24 A;  4R4Q A;  3U4V A;  1IBM L;  1OTC A;  2JA6 H;  4JC0 A;  4GLV B;  2WFW A;  4JI0 Q;  1Q81 C;  3J81 i;  1Y1W H;  3GTK H;  2UUA Q;  4POG A;  5C44 H;  2WB1 G;  2K14 A;  2ZM6 L;  3CCE A;  4JI4 L;  3CCS A;  4JBK A;  2VY3 A;  3G71 A;  2BH2 A;  3AEV A;  1N32 Q;  1TWA H;  1WOC A;  1YEZ A;  3A5Z B;  5ELO A;  5C3E H;  3I2Z A;  1PHJ A;  2JA7 H;  5IWA L;  1S40 A;  4A3E H;  3I4M H;  1X55 A;  2A1A A;  3PUX A;  2UUB Q;  3GO5 A;  2Q2H A;  3GDE A;  2VUM H;  4GKJ L;  3Q8D A;  4UP7 A;  2R7D A;  2ATW A;  1TWC H;  1X6O A;  4DV4 Q;  3BU2 A;  5C3E G;  4JI0 L;  2DUD A;  1QVG A;  2N8N A;  1MJC A;  3M4P A;  1YJN A;  2A8V A;  4A3D G;  2QA4 A;  2ZM6 Q;  4DAM A;  4UPA A;  3J81 c;  4B3S L;  5FLX c;  3K80 C;  2UXB Q;  4LFA Q;  4BA1 I;  4DV3 Q;  1GM5 A;  5LMN Q;  2RCN A;  4QL5 A;  4JI7 Q;  4L5R C;  1OXS C;  3BJU A;  1BKB A;  3KFU A;  2MQH A;  1NE3 A;  1E3P A;  2XTI A;  1PA6 A;  2K5V A;  1IBL L;  4GN3 B;  4B3T L;  3ERS X;  4DR1 Q;  1SFO H;  5C4X G;  3SGI A;  3CCR A;  2HHH Q;  1Z47 A;  4YCV A;  5IP9 G;  3KDF A;  3KYH C;  4QIW E;  1GO3 E;  2VQF Q;  4AQY L;  3CC4 A;  4LF8 L;  1PH5 A;  5IYD G;  4A93 H;  2Q2T A;  4A3B G;  3CME A;  1B70 B;  3S24 A;  3G4S A;  4DV7 L;  2K4K A;  3PSI A;  4X64 L;  3ULP A;  1X56 A;  2V1C C;  3F2D A;  5JJL A;  4DV2 L;  4DV1 Q;  1HNZ Q;  3J7A 5;  2BA0 A;  4LW1 A;  4JI8 L;  2OTL A;  2PQA B;  4PZ6 A;  1PVO A;  1CSP A;  1YVC A;  5IYD H;  5LMU L;  1KXL A;  1TWG H;  4XTC S;  3PGZ A;  3D31 A;  2IX1 A;  3NEN A;  2PQA A;  4A3I H;  1L1O B;  3ULJ A;  1HNX L;  1PYB A;  1VQJ A;  1XPR A;  4LF9 L;  1VQD A;  2JA8 H;  1VQI A;  2VL6 A;  1VQE A;  3W5O A;  4NXM Q;  3TS0 A;  3A5U A;  3PIO A;  4GOP C;  4R4C A;  3ICE A;  3W1G A;  1EWI A;  3UDF A;  2KBN A;  3CQZ H;  2KCT A;  4LUV A;  3I4N G;  2NN6 I;  4O2D A;  3RLF A;  3ULL A;  1OXT A;  3T1H L;  3H0G H;  1J5E Q;  2F4V L;  1Q12 A;  4LF9 Q;  4L5T A;  2NVT H;  4UP9 A;  4POF A;  5M5Y H;  3HOX G;  4OWW B;  2WB1 E;  5C4X H;  3D0F A;  1NMG A;  5LMU Q;  4OXP A;  1C0A A;  1N9W A;  4AIM A;  4DV0 L;  4LF6 Q;  4B3S Q;  2UXB L;  2KHJ A;  3S2D H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...