2IHFA

Crystal structure of deletion mutant delta 228-252 r190a of the single-stranded dna binding protein from thermus aquaticus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
235
structure length
205
Chain Sequence
b'MARGLNQVFLIGTLTARPDMRYTPGGLAILDLNLAGQDAFTDESGQEREVPWYHRVRLLGRQAEMWGDLLEKGQLIFVEGRLEYRQWEKDGEKKSEVQVRAEFIDPLEGRGRALNQVILMGNLTRDPDLRYTPQGTAVVRLGLAVNEERTHFLEVQAWRELAEWASELAKGDGLLVIGRLVNDRFQTRVEALRLERPLEDFPPEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Single-stranded DNA-binding protein
molecule tags Dna binding protein
source organism Thermus aquaticus
publication title 3D structure of Thermus aquaticus single-stranded DNA-binding protein gives insight into the functioning of SSB proteins.
pubmed doi rcsb
total genus 34
structure length 205
sequence length 235
ec nomenclature
pdb deposition date 2006-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ihfA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ihfA02
2AWNA 2CKZB 5IYCH 1AE2A 1EWIA 3KDFA 1J5EL 4A3KH 2K4KA 1PH9A 4GKJL 2JEAI 2ZTEA 5LMNQ 1J5EQ 2MFIA 2HHHQ 2XGTA 2IX0A 4AQYL 2VQEQ 1XNRQ 5ELOA 4P72A 3HOVG 1SFOH 3CQZH 1XMOL 1K73C 2VW9A 4J15A 3DLLA 1IXRA 1X3GA 4NXMQ 2R7FA 3S1NH 1XTDA 3ULPA 1G51A 3F2BA 2LXKA 1AH9A 4DK6C 4IFDI 4JI4L 1YITA 1HZBA 1VQEA 4X64Q 1VQJA 2E8GA 4WJ4A 2WFWA 4DPGA 3CCJA 4JI4Q 4JBWA 1I3QH 4DV7L 3FKIH 1KL9A 2D0OA 2VZAA 1MJCA 4JV5L 5M3FG 1TWHH 1OXXK 1S3OA 2K14A 1PYBA 3IRBA 2NN6I 4KLKA 4GNXA 1SN8A 2EXDA 4MTNA 2PMZE 2KCMA 5HGQA 1XJVA 4JV5Q 3S2DH 1SLJA 3L7ZC 3GTOH 5IWAQ 4P73A 2KBNA 5ELNA 4L5QA 4LUVA 2N49A 5C0XG 2WAQE 1KHIA 4GLVB 3PSIA 3PO3H 5JJLA 3M4QA 4EQ5A 1IBMQ 2GN5A 5K36G 3CPWA 1XNRL 1VQOA 4JOIC 3FHWA 4NB3A 3E9IA 1E22A 2GVBA 4A3JH 4LF5L 2BH2A 1PH1A 4A3DH 3GTKH 1WFQA 4LWCA 1VQPA 1YI2A 4JI6L 4LF4Q 1WYDA 2JE6I 2YTVA 4DR2L 4JBMA 4YWMA 3W1BA 5IP9G 5C4JH 2UUAL 1A8VA 3PF5A 2CWPA 2WB1E 3L2PA 1HR0L 1BKBA 3CXCA 3NELA 2JA9A 4DR5L 3UDGA 1VQ9A 2UUAQ 3GTGH 5FJ8H 5JJIA 2IY5B 2UXCL 2RCNA 2MO0A 1UE5A 1G6PA 1HNZL 4ME3A 5C0XI 1K8GA 3RLNA 4DR7L 4IPHA 4BY1G 2PI2A 3OYYA 3Q8DA 5IP7H 4DR7Q 2ATWA 3CCEA 2NVYH 3KJPA 4A3DG 5H1SE 1BBUA 2C35B 4OWTB 2QEXA 1PA6A 3B6YA 3TS0A 3U58A 1CKMA 1KD1C 1S72A 2Y0SE 4DKAC 1LM0A 3HOYG 4LFBQ 5M3FH 1KRTA 3RN2A 1QZHA 4EX5A 3HOXG 1PHJA 4P74A 1N34Q 4POGA 1J6QA 4H02A 2Q2UA 3TEHB 4HJ7A 5HY6A 4HJAA 1Q86C 1PV4A 2Q2TA 3E9HA 1M1KC 4QL5A 3HOWH 4B3RQ 4UP8A 3J80i 4NXNL 4JI5L 2ZM6Q 3S14H 4GOPA 3H0GG 3H3VI 4TVAB 3CC4A 1Q46A 1YHAA 4QIWE 3A5UA 2B63H 2A19A 4PMWA 4YWLA 1UEBA 1B70B 4A4IA 2F3IA 3KFUA 4YCWA 2VL6A 1VQLA 1D8LA 3HOVH 1JMCA 2E5LQ 1Q7YC 2VQFQ 1HNZQ 1SE8A 4DUZQ 2F4VL 3T1YL 1UWVA 1HZCA 2N78A 3AQQA 2LXJA 3NENA 5LMUQ 4LW1A 1Y1VH 2JA8H 2OQ0A 1QUQB 4DV6Q 3BZKA 3FKIG 2BH8A 1AE3A 4B3TL 4P71A 2JA7H 2FXQA 1FL0A 2UUBQ 4JI1L 4DV0L 1N33Q 5FJ8G 4A3FH 1JB7A 1HNWL 1PFSA 1B8AA 1GVPA 3S1QH 4YY3L 4AH6A 4JI1Q 4DV0Q 1E3PA 5M5YH 4JI0L 2K5NA 3LGJA 2OTJA 1N36Q 4GNXB 1A0IA 2IHFA 4DV3L 3NBHB 1YJ9A 2E2IH 3M7NA 4A3BH 1N36L 4BBSG 4K0KQ 3K7AH 1YVCA 4OXPA 1VCIA 1JT8A 1Y1VG 2EIFA 2JA8G 3TRZA 3HOUH 1IZ6A 3GTMH 4BA1I 4DR4Q 1N8RC 4LFCQ 5BR8L 1W3SA 3JAMi 4JBKA 3PO3G 1TWFH 2R92G 4C3HH 3RNUA 4IOAA 4DUYL 4A3EG 4P75A 1JJCB 3CPFA 1PH2A 1Q81C 1PH8A 1HNXQ 2HQLA 4QQBX 1K3RA 4YHHQ 1N9WA 1YNXA 3H15A 2QA4A 4GKJQ 3H0GH 1D7QA 3UDXA 4JI7L 3J7A5 1Z47A 1O7IA 4DV5Q 4LF6Q 2AHOB 2K50A 2JA6G 5JEAG 4X66L 4JI3Q 3I7FA 2I0QA 1EOVA 1HZAA 3W5OA 4GLAC 3J7ZC 4BY1H 4OWWB 1JE5A 1X65A 4YWKA 1K0RA 4IPGA 2R6GA 4YY3Q 5M5WH 3CCRA 5LMNW 4LF9Q 3EN2A 3M9BA 3KF8B 1CKOA 1KAWA 4X64L 4ALPA 5E7NA 2CCZA 1I6HH 2UUCL 3M4PA 2UU9Q 4JI2L 2VS1A 1CKNB 3HOZH 1E7ZA 2UXDL 1HZ9A 2L15A 4LUOA 3U50C 5C3EG 3KDFB 2UXDQ 2DGYA 2NN6G 4AYBE 3E0EA 2GVAA 4A75A 4PZ8A 2K52A 3UE1A 1Q82C 1FJGL 2VUMH 2RHSB 3PO2H 3PIOA 3M3YH 1RIPA 3GTPH 3GTLH 3OTOL 1ASZA 4XTCS 3HOWG 3S1MH 2NZOA 2AKWB 4PG3A 2HHHL 1EIFA 3OTOQ 2QGQA 4JYAL 2R7ZH 2V1CC 4FDBA 4IPDA 1TWCH 3A74A 3GDEA 1TWAH 4QJFA 2OCEA 4IPCA 1IBML 1A63A 1L1OA 4C3JH 5IYBH 2RF4A 3KOJA 2HIVA 3TQYA 5GAGC 2ZJRA 2VUMG 3L0OA 4DR3L 1OXSC 5C0XJ 1Q1EA 4B3ML 2PNHA 4LF7L 2NVXH 3T1HL 3ER0A 1G291 1WJJA 2RHQB 4A3GG 1CUKA 4HJ5A 4GKKQ 4X65L 1WI5A 1JJ2A 4DV7Q 1QVCA 5IYDG 3PUXA 4HIMA 3RZDH 2UXCQ 3H3VH 2HIXA 4A3LH 1X3FA 4LF8Q 4HIOA 4A3BG 3RN5A 3UE0A 1FJGQ 1GO3E 1VQMA 1KIXA 3JC66 4IFDJ 5AJ3L 4A3CH 2JA5H 1YBYA 4A3IH 1OXUA 2OTLA 1E24A 2PQAB 1VQ5A 4JI0Q 4OX9L 1JJGA 2KCTA 4R4QA 2DUDA 1PH4A 3RR5A 5C44G 3PGZA 3I56A 4A3MG 1WCMG 1P8LA 3K81C 4DV2L 4POFA 4BBRH 1VQIA 4A3EH 1N34L 4JI5Q 3TREA 4O2DA 3MXNB 4DK3C 3PCOB 4Y7NH 4DV2Q 2R92H 3J80c 1LTLA 4LF5Q 4NPSA 4A3IG 3CMEA 2JA5G 1UE7A 5IE8A 1VS0A 5BR8Q 3RZOH 2VNUD 3J81c 2F52A 2YTYA 4DAMA 2I5HA 1A62A 1VQDA 2ASBA 4QGUA 4A3CG 5C4XG 3RLOA 3CCSA 2YU9H 4KHPQ 4BBRG 3CCQA 1MKHA 4GNXC 5GQOA 4OO1I 3T1YQ 5C44H 4A3MH 3CCVA 3JAMc 3D0FA 3F8TA 2CFMA 3CCLA 1L1OB 1HH2P 3GTQH 4AQYQ 1TXYA 4LF6L 1EQQA 1XMQQ 4GN3B 5IP9H 4C3IH 1KC8C 1HR0W 4BA2I 3KLWA 4JI8Q 4B3SL 4KHZA 1NJIC 5C4XH 3AYHB 3PUVA 1VQ8A 1DGSA 4LFBL 2A1AA 4UP7A 1VQBA 2Y0SG 4JI2Q 1QVFA 2A8VA 3D31A 4X62Q 1EUJA 2VY3A 1X3EA 4DV4Q 4A3KG 1VQNA 1Y14B 3SGIA 3M4OH 3MEFA 3CF5A 4UP9A 5IYCG 2R7ZG 1XNQQ 1NMFA 3PUYA 4A76A 3CCMA 1WOCA 4OONA 5EAYA 1B7YB 2ZTDA 4R4TA 4DV1L 4UY8C 1GKHA 3G71A 2I5LX 2ALYB 2IHEA 2F4VQ 4KHPL 4RMFA 1OTCA 1BBWA 1VQHA 4YHHL 3I4MG 4JYAQ 4JOIA 4L5TA 1LYLA 1SMXA 2VQEL 2K75A 4DUZL 2ZJQA 2B63G 1OXTA 2KENA 4LFAL 3BJUA 3PV0A 5LMUL 1N33L 2YV5A 1XMQL 1YZ6A 4XIGS 1U5KA 5IYDH 3I4NH 1K8AC 4BY7G 1NE3A 3KF6B 3A0JA 4JI8L 1IYJB 3TS2A 4DR6Q 1N32Q 3BZCA 1HNWQ 4GLXA 4DR1L 4BXXH 3KF6A 4GKKL 4K0KL 3ULJA 4DR1Q 2AWOA 3U4VA 1X6OA 2UU9L 3G6EA 3PUWA 5GROA 3ULLA 3UDIA 3AFPA 1VQ7A 2Z6KA 4JCVE 4R4CA 2E2JH 4DAYB 4NXNQ 4RG1A 1Q8KA 1PVOA 5J3BA 1IBLQ 1VQAA 2ZJPA 2R7DA 4A93G 4HIDA 5JJKA 2UXBL 1P16A 1RL2A 2MQHA 2WAQG 1QZGA 1CKNA 3F1ZA 2JJQA 4L5RC 2R93H 2NZHA 1UE1A 3S15H 4DUYQ 2OQKA 1EQRA 5M3MH 3F2DA 1XPRA 3K80C 3HOUG 4WJ3M 1C9OA 2WP8J 4AIMA 3A5ZB 1IL2A 1E1OA 4IJHA 4LFAQ 1OXVA 1H95A 1VQGA 4DV5L 1L1OC 4A3LG 5IT9c 5C3EH 1IBKQ 3F2CA 1XMOQ 4LF4L 3I4OA 3U4ZA 2UUBL 2WB1G 1I50H 5FLMG 4IOCA 3VDYA 1NY4A 2PQAA 1VQFA 2UUCQ 5IP7G 1HR0Q 4DV3Q 4DR2Q 4L5SA 3HOXH 1XPOA 1YHBA 2E5LL 4IJLA 3HOYH 5GAHC 3CW2C 3W1GA 3J81i 4DR5Q 1PH3A 3CD6A 5IY0A 3S2HH 2ID0A 5FLMH 3HFZB 1EYGA 5GADC 2I5MX 2H5XA 1X55A 1L2FA 3CC2A 1UE6A 3KJOA 3PIPA 3STBD 3PUZA 3G48A 2E2HH 4OX9Q 2LSSA 3HOZG 1MJEA 3PF4A 4HJ8A 4MNOA 1CSQA 1X56A 1BVSA 1TWGH 2BA1A 2KHJA 2XTIA 4MZ9A 3ZJYC 3CC7A 4YCVA 4Y52H 4KI0A 4JI7Q 1XPUA 4X6AH 1W2BA 1C0AA 4UPAA 1ASYA 2YTXA 4LUZA 1PH5A 1QVGA 2CQOA 3KYHC 1IBKL 1VQKA 1KQSA 1E1TA 3GO5A 1VQ4A 1S40A 4DR4L 2OWOA 4B3RL 2YYZA 4LNQA 4O0AA 2EQSA 4GN5A 1PH7A 1FVIA 2PI2E 3AFQA 3HKZG 3STBC 4APVA 5IYBG 2IX1A 1R9TH 2JA7G 3RLFA 2JK8A 2BA0A 1NMGA 1WCMH 2NVTH 2N8NA 4BXXG 4JG2A 2B3GA 2KHIA 2JEBI 4TQUS 1Y1WG 1PH6A 2VQFL 1V43A 1V9PA 5DLQE 5AJ3Q 4JI3L 3S1RH 4B3TQ 3ERSX 5IWAL 4GN4B 5GAEC 4B3SQ 2JQOA 1GM5A 1NBWA 5M5XH 4A3GH 1T9HA 4BBSH 4A93H 1C7YA 1GD7A 1YHQA 3UDFA 4R4IA 4LF9L 2K5VA 3I4MH 4PZ6A 1QUQA 2Q2HA 5M3MG 1Y1WH 1K83H 2D0PA 1EIYB 4GOPC 1I94L 3CAMA 4PZ7A 2R93G 1FGUA 4DV4L 4JI6Q 2N3SA 3I55A 4B3MQ 5JEAJ 3AEVA 4QY7A 4IFDG 4C2MH 3GD7A 4OO1G 3K0XA 1VQCA 5FLXc 4GOPB 4DV1Q 1YJWA 3T1HQ 3EBEA 1YJNA 3I4NG 4BY7H 4A3JG 3WWVA 3FP9A 3S24A 4X65Q 2B29A 3CCUA 4HIKA 3EIVA 1HNXL 3ICEA 2D62A 3BU2A 3HKZE 5LMNL 1V1QA 2MO1A 1YIJA 2Z0SA 3GTJH 3CMAA 1Q12A 1M90C 4R1JA 3OW2A 1U0LA 4X66Q 2NVQH 3J81j 4R4OA 4NXML 1Z9FA 4JBJA 4DV6L 1I5FA 1YEZA 3CP0A 1VQ6A 1N32L 3K7UC 2MNAA 4DR3Q 1PYSB 1Q1BA 4DNIA 2AMCB 1MIUA 1CSPA 3I2ZA 1X9NA 3K8AA 4IO9A 4YCUA 4JC0A 4LF7Q 3PO2G 4DR6L 4GS3A 4X62L 1SR3A 2Z6KC 4HJ9A 1X54A 1K9MC 1KRSA 4AYBG 1XNQL 2IT1A 3HKSA 2HT1A 2JA6H 3G4SA 2CWAA 1LUZA 1IBLL 1SRUA 1I94Q 1KXLA 2ZM6L 2K5HA 1HJPA 4OWXB 2ZTCA 3NEMA 2UXBQ 1L0WA 4A3FG 3DM3A 2Q2IA 3M85A 1EFWA 4LF8L 4LFCL 1NTGA 3S16H 1SROA 3S17H 2ES2A
chains in the Genus database with same CATH superfamily
2AWNA 1EYAA 3TSSA 2K4KA 3J7YW 4GKJL 1ENFA 3NQTA 2IX0A 4AQYL 2QDBA 3HOVG 1SFOH 1K73C 2WKDA 4NW2A 1CA5A 1AH9A 4WJ4A 1HZBA 1VQEA 2E8GA 3H09A 3QOJA 5IIFA 2J4XA 1PRTB 4MN3A 1I3QH 5KYIA 1KL9A 3IRBA 1PYBA 1WTVA 4KLKA 1T5XD 3E3XA 2KCMA 2EYMA 4P73A 4L5QA 3Q6SA 3HOVB 2F3VA 1F9QA 2WAQE 1DONA 4GLVB 2F0HA 3MFGA 1IBMQ 1SNPA 1XNRL 4UDUC 2PCFB 4NB3A 1E22A 2GVBA 4A3JH 4LF5L 1PH1A 1YI2A 1QG7A 4ZAIA 3W1BA 4DNRB 2UUAL 3PF5A 2CWPA 2WB1E 1HR0L 3GTGH 5C4HA 3CXCA 3SR1A 5JJIA 2IY5B 2UXCL 1D5XC 5T1IA 1PFMA 2RDHA 4ME3A 1K8GA 5L37A 1E2VA 3OIQA 2ATWA 4A3DG 1IW7C 4OWTB 2QEXA 1Q8IA 1D2BA 1ILPA 3TS0A 3U58A 1KD1C 2EOTA 2Y0SE 1LM0A 4LFBQ 5KIXA 5M3FH 1QZHA 4EX5A 1PRTF 3L9AX 5D3DA 1IYVA 5HY6A 1PV4A 2AQ1B 3D8GA 4TSSA 2ZM6Q 3H0GG 3MAQA 1Q46A 2XSCA 4QCLA 4A4IA 5I2XA 2MGSA 1VQLA 3RZOB 3HOVH 1NR4A 2AQ2B 1Q7YC 2VQFQ 1HNZQ 1SE8A 4O1NA 4IQZA 2FMCA 1HZCA 3NENA 5KNCA 2OQ0A 1PDQA 1QUQB 5D14A 4B3TL 2EY2A 2JA7H 2JN4A 2UUBQ 1JB7A 2QF7A 5FOBB 1I3QB 1PFSA 4A3FH 1HNWL 4YY3L 5M5YH 2B2TA 4KKSA 1WTXA 3H0GB 2OTJA 4R9WA 2E2IH 2IHFA 1B9NA 1LT6D 3HS0C 4A3BH 1ZXTA 4BBSG 4K0KQ 1YVCA 4K5WA 1EY0A 1VCIA 4OXPA 2JA8G 4LFCQ 1JR0D 4BS9A 4DA2A 2R92G 4IOAA 4XXEA 1JJCB 1HRJA 3CPFA 1PH2A 2FHTA 5ISRA 1N9WA 2ENBA 1D7QA 2Z4IA 3UDXA 1ICWA 4LF6Q 4FXGC 1S5CD 1TY2A 4BY1H 5KRUA 2A6HD 1K0RA 4YWKA 2R6GA 5LMNW 3CCRA 1QJOA 5FK9C 3KF8B 1CKOA 4OL7A 2O4XA 5E7NA 2E76C 2ICEC 2UU9Q 3S15B 2UXDL 5EPLA 3U50C 4LUOA 1S5ED 3A8JE 3HGBA 3E0EA 1V1OA 5G3LF 2EY1A 4DAYA 3U9SA 5M5XB 3D6WA 3PO2H 2NVXB 3PIOA 1ESFA 3KBXA 4G7ZC 3EROA 4XTCS 5BN4A 1EIGA 2NZOA 2QGQA 2B8FA 1TR5A 3GDEA 1PYWD 2J0TD 2KEEA 4QJFA 3QB3A 2OCEA 1IBML 5IYBH 2RF4A 2HIVA 3L3OC 1UEAB 2VUMG 4DR3L 4CJ1B 1OXSC 1Q1EA 1I4GA 5C0XH 3T1HL 1WJJA 2RHQB 2XRSD 4DV7Q 4G4KA 4RHSA 4A3DB 2B39A 4HIMA 3K7AB 4QUFA 4A3LH 4A3BG 1FJGQ 4KD3A 1KIXA 1SNOA 3JC66 4IFDJ 4A3CH 2JA5H 1G2TA 1OXUA 5CC4A 1TS5A 1JJGA 4R4QA 1QWYA 2DUDA 3RR5A 4BBRH 5EGTA 3TREA 3J80c 2K5QA 5C44B 1R9TB 4A3IG 1BO0A 5IE8A 1PTOD 3GTQB 2L4NA 1VQDA 3ZYYX 1ZYRD 3SE0A 1NAPA 4OO1I 5FKAC 3T1YQ 2L0CA 5I9PA 3CCVA 3D0FA 3NUCA 2CFMA 2RBMA 4ILWA 3GTQH 3NTIA 4C3IH 1K8MA 2R92B 2IW3A 5CGKA 5FO7B 3NPPA 3KLSA 2L5TA 2Y0SB 3AYHB 3GTPB 2XN9C 1S5BD 2NUCA 2FINB 1DGSA 3HP3A 1DZ1A 1Y1VB 4JI2Q 2Y0SG 1OO9B 4RAUC 3D31A 4JV5Q 3SGIA 1JE4A 5IGEA 1PTOF 2FJ2A 3UI2A 2B2WC 4DV1L 4UY8C 1GKHA 1EY7A 2ALYB 2IHEA 3T13A 2SOBA 1XX8A 1OTCA 1BBWA 3M7GA 4JOIA 4L5TA 2VQEL 1D1KA 2B2UC 1AZQA 4XIGS 3MXNA 1U5KA 5DM63 3I4NH 1K8AC 4JI8L 1IYJB 4KKTA 1N32Q 3BZCA 4GLXA 2Z8LA 4X3UA 4BXXH 3A8KE 3KF6A 4GKKL 3V05A 1T5EA 2AWOA 4DF7A 3G6EA 2B2VA 3EQLC 3ULLA 3OPOA 4Z9CB 4R4CA 4KTAA 1WTRA 3J7AV 4A3BB 5J3BA 4KHVA 3NTHA 2DNCA 3KUPA 3MC0B 1RL2A 2WAQG 1CKNA 1UE1A 3S15H 4DUYQ 4LAAA 4OIJA 1ONLA 3HOUG 4IUUA 1C9OA 2WP8J 1G8ZD 1IL2A 4IJHA 3FVQA 1L1OC 4A3LG 1K8OA 5C3EH 2F0KA 1IBKQ 1JQYD 2UUBL 2WB1G 4J1MA 1QILA 5IP7G 1HR0Q 3BVGA 1PMRA 5C6AA 1CI3M 3HOXH 2K6AA 2L11A 2E5LL 5GAHC 3W1GA 3J81i 1PH3A 4AYBB 3N6RA 3BS1A 4V0BA 2JA7B 1O7LA 4RCNA 1EYGA 4FXDA 5GADC 4JPBW 3TP7A 2B2VC 2F0WA 2F0QA 1GUOA 1NNXA 3S1QB 1MJEA 1MD2D 4JK1C 1TWGH 4MZ9A 3NTKA 1DM0B 4KI0A 1HQRD 1C0AA 2TMPA 4DGZA 4MHEA 2CQOA 1RJTA 3A7LA 3KYHC 3S2HB 4RGMA 1DOLA 2CW0C 2ICIA 1JCKB 3GO5A 3RZDB 4O0AA 3D4DA 1IYUA 4A3KB 2PI2E 3STBC 2NVYB 4C3JG 2PPBC 2JA7G 3CRLC 4I65A 2BA0A 2RKSA 1WCMH 2NVTH 4BXXG 1S5FD 2KHIA 4TQUS 1V43A 4CKBA 2NYZD 4GN4B 4DN4M 3I4MB 2JQOA 1C7YA 3EA6A 1RDPD 1JOQA 2K5VA 5ELCA 4PZ6A 2Q2HA 2XNAC 5M3MG 1EYCA 1BBXC 1EIYB 1I94L 1LT4D 1FGUA 4K8IA 4DV4L 4JI6Q 3PIO3 2N3SA 3I55A 3AEVA 4Q5VA 4DV1Q 1KLGD 3WWVA 5ELFA 3S24A 5CMDA 2O2LD 3ICEA 3BU2A 1V1QA 2MO1A 1D6EC 3BDLA 3GTJH 4KJOA 3CMAA 2F3WA 2WKCA 1K0SA 4ZYSA 1U0LA 3T4AC 2NVQH 1LTRD 1C8CA 3MEHA 1Z9FA 4DV6L 3NXWA 3CP0A 4C3HG 1LLRD 5CV8A 5G3LD 4DNIA 1CSPA 5TSSA 3GTMB 1LTGD 3PO2G 1CT1D 4GS3A 4KN4C 1RF2D 2V4DA 1J8IA 1SR3A 1K9MC 4EGVA 3DWQA 3G4SA 1WCMB 1KXLA 2ZM6L 2KEDA 2Q2IA 3S16H 4FF3A 2EY6A 2ES2A 5IYCH 5FO8B 4HR7B 3KDFA 1STNA 4C1NK 2JEAI 2ZTEA 5LMNQ 4A3EB 2A6ED 5IGGA 2A5HA 1XNRQ 1F77A 3CHBD 2F0OA 2VW9A 4J15A 4NXMQ 3S1NH 1XTDA 3ULPA 1G51A 4DK6C 4IFDI 4JI4L 3LNNA 4G57A 2OXPA 1YITA 1VQJA 2D9UA 3HOZB 1B2TA 1BCPD 3H6MA 1BCPB 3CCJA 4JBWA 4DV7L 2NTSA 2D0OA 1EQVA 2CHBD 2VZAA 5M5WB 4JV5L 3BYTB 1Y1WB 3IFTA 1I50B 1OXXK 3K58A 2NN6I 4RGNA 1QB5D 2EXDA 2EYLA 4MTNA 1EZ6A 3X3MA 2PMZE 5HGQA 1XJVA 3S2DH 2FFKB 2OEOA 3L7ZC 4BY7B 5ELNA 2P5ZX 4RCOA 2N49A 4OO1H 3PO3H 2TSSA 5I4DA 2GN5A 5K36G 1SSOA 3NE5B 3E5SA 3I3CA 3J81L 4M1UB 2E2JB 4BWGB 4DR2L 3SK5A 4JBMA 4YWMA 5C4JH 1A8VA 3UDGA 3DMUA 2JA9A 1LV9A 3M4OB 2R93B 2RCNA 2MO0A 1G6PA 1EU4A 3E0JA 3FPPA 2A68D 4DR7L 4BY1G 2PI2A 3OYYA 3Q8DA 1KAAA 4DR7Q 3CCEA 3KJPA 5H1SE 3B6YA 4HSVA 5CBEE 2R3ZA 5CV6A 2OF1A 1SYEA 4P74A 1N34Q 5CV7A 1J6QA 4H02A 1Q86C 1M1KC 4QL5A 3HOWH 4B3RQ 3J80i 3KBGA 4K5XA 4JI5L 3S14H 3TN2A 4QIWE 1YHAA 2X6LA 3A5UA 2B63H 4YWLA 4KD4A 1RODA 1B70B 3KFUA 4YCWA 1LACA 3NK9A 2A69D 3AB9A 2E5LQ 2K5DA 1XWEA 3AQQA 1BNZA 2LXJA 1GHKA 4LW1A 1DCZA 1HCZA 4CKEA 3FKIG 1Z7TA 4JI1L 4DV0L 1IKMA 2DY8A 4JI0L 1PZJD 1K28A 3LGJA 2A69C 2IWHA 4IUPA 5A2QE 3D4WA 3X3NA 2HCCA 3ONAB 5C5MA 3TRZA 3GTMH 2JP1A 1N8RC 3I73A 5K36H 3JAMi 3PO3G 2A6HC 4C3HH 1A15A 4DUYL 4P75A 1F2ZA 2QCPX 1Q81C 1PH8A 1HNXQ 1K3RA 1SFOB 3DHQA 4M8AA 4BBRB 3H15A 3BG3A 2QA4A 5D3IB 3H0GH 4JI7L 1Z47A 2DJFC 2K50A 2JA6G 5JEAG 4X66L 4JI3Q 3I7FA 2F0IA 1F9RA 2M9VA 3W5OA 1X65A 2R61A 4IPGA 4YY3Q 4DXFA 3EN2A 3M9BA 2DNEA 5IGFA 1I4RA 1I6HH 1BDOA 2RVLA 2BOSA 3M4PA 2UUCL 5E3FA 4JI2L 4KN7C 2VS1A 1E7ZA 1HZ9A 2L15A 4O42A 3Q23A 3I8ZA 2M2LA 1SE4A 2GVAA 2K52A 1Q82C 1FJGL 3A56A 3TZDA 3NP8A 5M9OA 3HOWG 1ESRA 3LWEA 3S1MH 2AKWB 1EIFA 2R7ZH 4FDBA 4IPDA 1EOTA 3HOWB 4C56C 1SYGA 1SBBB 4IPCA 2CH4A 1HFNA 1K83B 4DK1A 4QF4A 3DUZA 2K01A 2LMCB 2NVXH 5LHY1 4DAVA 1G291 1G91A 1CUKA 2X69A 2Z1CA 1WI5A 2BCOA 4LK1C 4XT1B 5IYDG 3PUXA 4XDXA 1AP0A 3H3VH 4LF8Q 3RN5A 2EJGC 3D6CA 4HMJA 4A3JB 4A3IH 2PO4A 1RCVD 1VQ5A 3VR3A 4HCEA 2KCTA 1HA6A 4DNTB 5C44G 2HDMA 3PGZA 3I56A 2E74C 2L55A 2CVRA 1N34L 1M8AA 4JI5Q 4Y7NH 4LF5Q 4NPSA 4XQNA 2JA5G 1VS0A 5BR8Q 2F0MA 2F52A 4DAMA 2I5HA 2ASBA 5IOCA 5GQOA 4QMGA 3JAMc 3F8TA 5I6YA 3CCLA 1L1OB 4AQYQ 4LF6L 3VYUA 4GN3B 1XMQQ 5IP9H 1B3QA 4BA2I 1GOZA 3KLWA 3TP6A 4B3SL 1NJIC 2PZWA 5C4XH 3V96A 1DOKA 3PQIA 1VQ8A 5C5LA 1BQQT 1YNND 2A1AA 4UP7A 5JVG3 1VQBA 2D2CC 2A8VA 3BVMA 3OW7A 4X62Q 2VY3A 3M4OH 1VQNA 1F2LA 3MEFA 4JW0A 3CF5A 2WIIB 1NMFA 1Q3LA 2MUYA 5EAYA 1B7YB 5EPKA 1B9MA 2ZTDA 1EYDA 2B63B 1JB3A 1TWGB 2I5LX 4RGOS 3G71A 4KHPL 3OIPA 1VQHA 1HUNA 4DUZL 2Q8TA 1OXTA 4LFAL 3BJUA 4CDEC 2YV5A 3GTJB 2KOLA 3A0JA 3TS2A 1HNWQ 4DR1L 4DK0A 2PNRC 1QOHA 4K0KL 4DR1Q 1X6OA 5T1GA 3PUWA 3UDIA 1HQMC 3AFPA 1GUTA 2Z6KA 1SYDA 1WTOA 4HMIA 4NXNQ 1Q8KA 2ZJPA 4HIDA 4RA8A 3SXHA 3M4YA 2MQHA 2JJQA 2C5CA 1BXTA 3EVQA 3PO2B 5M3MH 3DEOA 1SYBA 3J80E 5FLXE 4NDXA 3A5ZB 5JOBA 1E1OA 4FYDA 1VMPA 2N88A 5LL6S 3GTOB 1KDCA 1OXVA 5CYUA 5IT9c 4ODGA 3F2CA 1XMOQ 5FLMG 1TWHB 2PQAA 1PZID 3PO3B 2C9OA 5KEEA 4L63B 4ULLA 4L5SA 3SK6A 3S2HH 3W2DA 2I46A 2EYFA 4EQNA 5FLMH 1KDBA 2JA5B 5K5PA 4RKBA 4U673 1KDAA 3KJOA 1U4RA 4KY6A 1PTOH 3HOZG 3PF4A 1SDFA 5I2YA 3P7JA 1BVSA 3H3VC 4YCVA 1STBA 1LTTD 3VR2A 1PRTD 1XPUA 4X6AH 1D1IA 3P20A 1ASYA 3QIAA 2YTXA 1GJXA 1PH5A 4RFBA 1IBKL 1KQSA 1ZEQX 4B08A 3AU7A 1B50A 4DR4L 2OWOA 5M5YB 4B3RL 4LNQA 3H94A 2EQSA 4CKCA 5IYBG 1MBYA 4OGQC 1R9TH 4XQJA 1AZPA 2JK8A 2E75C 1NMGA 1YNJD 4CDFC 4S3SA 2HD3A 2N8NA 4ZLTF 3F2UA 1WVLA 1Y1WG 4H44C 3DWAA 2RDGA 1CK1A 1GUGA 2PZTA 3R93A 4B3SQ 4LMQD 2A73B 5M5XH 4A93H 3UDFA 1TKWB 1EQTA 4ZCKA 4MTKA 3SEBA 1K83H 2K04A 3CAMA 2R93G 1MHWC 1CQFA 4ABNA 5JEAJ 2JSOA 4WFN3 1BOSA 4OO1G 3K0XA 2CQAA 1SEBD 4HN7A 2PMZB 1JOKA 3CCUA 2A74C 1MSHA 2D62A 3HKZE 3QG1A 5LMNL 3CQZB 3T56B 1E2ZA 2Z0SA 3GV3A 1NCVA 4NP5A 4FF1A 1CZGA 2F0PA 3OW2A 4K6LA 3J81j 2I07B 4R4OA 4NXML 1DD2A 1YEZA 4DAPA 3H91A 3K7UC 4DR3Q 1TS4A 3DEPA 3I2ZA 4ZKBB 4FF4A 4DR6L 2KHSA 1CA6A 2Z6KC 3NWTA 5FO9B 4HJ9A 2HT1A 2LFNA 3WOFA 3VA7A 3J80L 2PYKA 3C46A 1L0WA 4A3FG 3DM3A 4LFCL 1NTGA 4A3IB 1SROA 1BCPC 3S17H 4N8FA 2SNMA 1EWCA 4A3KH 3I70A 4C3HB 2YU9B 2MFIA 2HHHQ 3S1NB 2VQEQ 5ELOA 1I4XA 4P72A 3CU7A 3CQZH 4OIKA 5JPNC 1XMOL 3DLLA 2R7FA 4KK7A 3NHHA 4RHRA 3F2BA 1WTWA 2LXKA 4IZ8A 1JWSD 4F87A 1BF4A 2LY7A 2WFWA 4DPGA 5ELEA 4QIWB 2KUMA 4IURA 4F7XA 3A7AB 1TS2A 3FKIH 4HAEA 3IAYA 2F0UA 1TWHH 2K14A 2BDNA 1BR9A 1STEA 1W6KA 1ILQA 1TWCB 2PQEA 2KA7A 1SLJA 5KGUA 1R4PB 1A6XA 4LUVA 2VXWA 2EXZA 3PSIA 5KNDA 1RTOA 3CPWA 4I7ZC 4JOIC 3NSWA 1IW7D 5C4JB 1X3QA 4A3DH 4JI6L 4LF4Q 1ICFB 3T51B 2JE6I 3D3RA 3RUZA 3K5OA 5IP9G 4WORA 2BH2A 1BKBA 4DR5L 2UUAQ 1L0XB 1IL8A 1UE5A 5C0XI 1Z6HA 2QW7A 5IP7H 3JAML 2M00A 5KYLA 4I7AA 1JC7A 1CKMA 4BY1B 3RN2A 3HOXG 1PHJA 3TEHB 1SE2A 3E9HA 4K5VA 2H1EA 3LWUA 4GOPA 3CC4A 2A19A 3GP7A 2K7VA 1UEBA 1Y8OB 3C3LA 1LT5D 2VL6A 5IGBA 1O7ZA 1O78A 3VA5A 3SHLA 4PV1C 2K03A 1KLUD 4DUZQ 1Y8PB 3T1YL 4UHVA 2N78A 1SYCA 1EY8A 5LMUQ 1Y1VH 4K2LA 1EY4A 3M3YB 3U9OA 3BZKA 1FL0A 5BN3A 4AH6A 1E3PA 2K5NA 1HTPA 1N36Q 1A0IA 1CTMA 3NBHB 1Y8NB 1N36L 3DWPA 5ELBA 5JVH3 2EYPA 3HOUH 2F0LA 4DR4Q 1PFNA 4G7OC 3HEJA 5BR8L 1W3SA 4JBKA 1TWFH 3HKZB 5HGTA 4QQBX 5M3FB 3K59A 1F9PA 1GUSA 4GKJQ 4DV5Q 1O7IA 3MXUA 3HRZC 2I0QA 4FO2A 1ENAA 3J7ZC 3R2IA 2WINB 1NSNS 4LF9Q 5M5WH 2CCZA 4DK3C 1KAWA 4ALPA 1FNWA 3HOZH 4ZKCB 2UXDQ 2DGYA 1B4OA 1RD9D 1C48A 2QEJC 5CV4A 4AYBE 1IKLA 4PZ8A 3UE1A 1SXTA 5I9OA 2HDLA 3M3YH 1RIPA 1A3TA 2D5DA 3GTLH 3OTOL 1ASZA 3VR6A 2RSNA 4PG3A 3OTOQ 3HG9A 3S2DB 4JYAL 4F8MA 1SNCA 1TWCH 1HUMA 3A74A 4CJ2C 1TWAH 1GHJA 2F0EA 3NBIA 1D5MC 3RMHA 1A63A 1L1OA 4A3GB 3TQYA 2K33A 2PNHA 1WTQA 4LF7L 5FLXL 4A3GG 5DEHA 1DXMA 1TWFB 4HJ5A 4X65L 2J7ZA 2ZXPA 2UXCQ 2HIXA 2DY7A 1JWMD 1X3FA 4HIOA 1GO3E 3R3OA 5AJ3L 2OTLA 1E24A 2PQAB 4OX9L 4JI0Q 1PH4A 3S9WA 4A3MG 4N9PA 1HA5A 4A3EH 2EJFC 4N8X1 2RCFA 3MXNB 2XIWA 4NMZA 4NKLA 4O2DA 4XYQA 1E0BA 1TU2B 2NZ1D 1G6ZA 3VYSA 3BDOA 3CMEA 1UE7A 1EL0A 4K6DA 3J81c 2YTYA 4A3CG 1A62A 4QGUA 4X3KA 3RLOA 3CCSA 2YU9H 3RD4A 1FNVA 4KHPQ 3CCQA 5C44H 4WRDA 1HH2P 3C1FA 1TWAB 1XXGA 2QKIC 3MTSA 5JJZA 4L6TB 1HR0W 3ND8A 1O7YA 1WD1A 4KHZA 1L0YB 5LL6X 1XTCD 1QVFA 2DN8A 4A3KG 4DV4Q 1Y14B 4KJNA 2R7ZG 4DFAA 1XNQQ 2K5WA 1QNKA 3PUYA 4A76A 4OONA 4H7BA 2VB2X 2F4VQ 2F0VA 2WV6D 5EPJA 1YNNC 2ZXRA 1F2YA 1LYLA 1EZ8A 1SMXA 1UUPA 2K75A 2ZJQA 2B63G 2KENA 2KCNA 3PV0A 1JOOA 2G5DA 1N33L 3IFDA 1XMQL 1YZ6A 1EWHA 5IYDH 1AFPA 1NE3A 3GTKB 3KF6B 3N52A 4IUQA 2HCIA 2F03A 2L1BA 2UU9L 3U4VA 5EJWA 5GROA 4QUCA 4IN3A 3I4NB 4JCVE 4EQPA 2NVTB 2E2JH 4DAYB 1PVOA 1BCPF 5IODA 2R7DA 4A93G 5JJKA 2UXBL 2F0TA 3MVVA 4OHJA 1EEFD 3OMCA 2ZT9C 4C3IB 2KQ3A 2NZHA 1LTID 2R93H 1EQRA 1XPRA 3K80C 4WJ3M 1JWUD 4LFAQ 2E2IB 1Y69U 1VQGA 5IT9L 1EY6A 1XYIA 4LF4L 1I50H 4IOCA 1U4PA 4A3FB 1MSGA 1NY4A 3JAME 3OWFA 1A2TA 1VQFA 2UUCQ 2EE1A 3HOYB 1SJHD 2F0JA 3O13A 1PRTC 4IJLA 4DR5Q 4LJZC 5IY0A 5JEAH 1EEID 2ID0A 3HFZB 1SMYD 2F0SA 1X55A 3CC2A 1UE6A 2OT2A 3STBD 3PUZA 4IALA 3TP8A 2E2HH 5NUCA 2LSSA 4OX9Q 2F0FA 4ID6A 3K57A 3GTLB 4MNOA 2BA1A 2KHJA 2XTIA 3CC7A 2H4OA 3Q22A 2N55A 5E4XA 1W2BA 1C4QA 2AUJD 4LUZA 4B9XA 1VQKA 1EY9A 1S40A 1SMYC 1H9SA 2K32A 2BDOA 4GN5A 3PMFA 1TIID 1FVIA 2IX1A 1FNUA 2RDFA 4TKOB 4TRDA 1K3BC 3BYYB 1IHZA 2B2WA 4WJWA 2Z9HA 2LKVA 4JG2A 2JEBI 5A2QL 1PH6A 2VQFL 5IGCA 2EYHA 2IX3A 4RKLA 4IUNA 1V9PA 1ZKOA 4JI3L 4B3TQ 2CW0D 4XT3B 3KF8A 1GM5A 4A3GH 3C2PA 3FMCA 2LS01 3D4RA 1YHQA 4R4IA 3QJYA 3FDTA 1LTAD 4ZK9B 2EYOA 1GXDC 1TS3A 1Y1WH 2D0PA 4IUTA 4GOPC 4PZ7A 1ET6A 4HSPA 2B2YC 3IL8A 4U68A 2VUMB 3T1HQ 1YJNA 4BY7H 1UNSA 3FP9A 3P1HA 4CDCC 4X65Q 2B29A 3EJIA 3S1MB 1GUWA 3EIVA 2O5JC 3SDZA 3OMGA 1YIJA 2BE5D 2G9HD 4ZQ3A 1EY5A 1AEXA 1VQ6A 1I5FA 3QWNA 1N32L 2RA4A 1I6HB 1MIUA 1HTLD 4YCUA 1PTOB 4JC0A 1KNEA 4X62L 3BVZA 1F2MA 1RHPA 1KRSA 4AYBG 2IT1A 1TY0A 2WB1B 1LABA 2EJMA 2IPKD 2F0GA 1LUZA 2RSOA 2B2YA 5EKLA 1QE6A 4Q0FA 2UXBQ 5KNBA 4OWXB 3NEMA 1RTNA 1EFWA 4LF8L 4P2CB 1HHVA 3HOUB 2CKZB 1AE2A 2KJXA 2QDLA 1EWIA 2G9DA 5ELDA 1J5EL 1QCBD 1PH9A 3A54A 5IGDA 4K8JA 1J5EQ 2XGTA 4RH6A 2F0NA 3K5NA 1WTHA 4H13C 1IXRA 1X3GA 3E6ZX 2L12A 4X64Q 3KLSX 3K5MA 4JI4Q 5C3XA 2EYJA 1SNDA 5DAUA 3KK7A 1MJCA 5E4WC 4JVZA 5M3FG 1F9SA 1S3OA 4B9WA 4N9TA 1SN8A 4GNXA 3T16A 2HQEA 1X32A 3GTOH 4QB4A 5IWAQ 2KBNA 1A3UA 4V190 4C2MB 3FRPB 3LX0A 5C0XG 2B8GA 1KHIA 3V2TA 3OOCA 1II3A 3I90A 5JJLA 3M4QA 4EQ5A 3VYTA 2NVQB 1VQOA 2KCCA 3K6OA 1AN8A 3FHWA 4E6IA 3E9IA 4K2KA 1WFQA 4LWCA 1VQPA 3GTKH 1S5DD 1WYDA 2YTVA 4HCSA 3L2PA 3NELA 1VQ9A 1H9SB 5FJ8H 3PIP3 1HNZL 3TZUA 1PLFA 2KECA 3RLNA 4IPHA 3TMEA 2XWBB 3P75A 2NVYH 3S16B 1BBUA 2C35B 5AFWA 3ITPA 4MIUA 1PA6A 1S72A 1KABA 2Q8RE 4DKAC 3S14B 4FF2A 3HOYG 3FEWX 4IUVA 1KRTA 2NN6H 4ME5A 1J9OA 4POGA 4RWSC 5D65A 2Q2UA 4HJ7A 4HJAA 2Q2TA 2A68C 3HOXB 1M4VA 4UP8A 4NXNL 3H3VI 4TVAB 4CJ0B 1LTSD 3BDCA 4PMWA 3KLRA 4CBVA 2F3IA 5IT9E 1D8LA 2O5IC 3QOLA 1JMCA 5C4XB 3FKIB 2F4VL 2NB0A 1UWVA 2F0DA 4X3TA 2JA8H 4DV6Q 4EVOA 2MPMA 3G7LA 2BH8A 1AE3A 4GZYC 2WAQB 4P71A 2FXQA 2B2UA 5DNFA 1N33Q 5FJ8G 1I4HA 3S1QH 1B8AA 1GVPA 5EBDA 4JI1Q 4DV0Q 2EDGA 4GNXB 4DV3L 3M7NA 1YJ9A 1VDZA 4PMCA 1NUCA 3MFYA 4DXGA 3K7AH 3OSOA 1HPCA 3AMUA 1JT8A 1Y1VG 2EIFA 3OWEB 3NQIA 3NWSA 1IZ6A 4X3SA 4BA1I 3S17B 3I91A 3I4LA 2R7ZB 3RNUA 4A3EG 4KMUC 2HQLA 4R8IA 4YHHQ 3J81E 1YNXA 3C1EA 4EQOA 3J7A5 2AHOB 5DM73 1ENCA 5CV9A 3DXJC 3A55A 1EOVA 1HZAA 1STHA 4GLAC 4OWWB 1JE5A 1H9KA 3OHXC 4R8NA 1GUNA 1PXUA 4OELB 3Q24A 4X64L 4H0LC 1A2UA 1CKNB 1U9RA 5C3EG 2QILA 3KDFB 2NN6G 4FVMA 1CZWA 5J39A 1VMCA 4A75A 3W3AA 2VUMH 2RHSB 2GA4B 5CBAE 1H9RA 3GTPH 4J8QA 2PW5A 2HHHL 2V1CC 4K14A 3MWYW 2MJ8A 1ET9A 4C3JH 2ZJRA 2XRQD 1V1PB 2SEBD 3KOJA 5GAGC 3L0OA 2VB3X 1R4QB 5C0XJ 2AQ3B 4B3ML 5C3EB 4C3IG 3ER0A 3GQBA 4KY7A 4GKKQ 1BUVT 2NTTA 1JJ2A 1QVCA 2Z4HA 3S1RB 3RZDH 3BZDB 3K5LA 1S4ZA 4YIJA 3UE0A 1PTOC 1SJED 2L9HA 1VQMA 4HTHA 4HEDA 1STAA 1FD7D 1ZYRC 1YBYA 1SAPA 1STGA 5EQ0A 1B53A 1QNUA 5EBCA 2PZUA 1WCMG 1LO5D 1P8LA 3K81C 4DV2L 3GTGB 4POFA 1VQIA 1H9MA 2R92H 4DV2Q 3PCOB 2ZXOA 1LTLA 4A3MB 1I4QA 4G7HC 1CFMA 3RZOH 2VNUD 1PZKD 5C4XG 5EKIA 3J7AF 4J6HA 4BBRG 1MKHA 2NWGA 4GNXC 1X3PA 1ML0D 4A3MH 4BBSB 2JXMB 4CGYB 3I72A 1TXYA 1EQQA 4PMBA 4DU9A 5EKKA 1STYA 1KC8C 5I6WA 4JI8Q 3URYA 1SYFA 1O80A 3PUVA 5CR3A 4UAIA 1V8QA 4LFBL 2JA8B 1D5ZC 5E1FA 1EUJA 1X3EA 3CKIB 1I4PA 1WD0A 1TQOA 4UP9A 5IYCG 2WACA 3CCMA 1WOCA 1G2SA 1FYCA 2SNSA 3QR8A 4L8JA 4R4TA 4CDDC 4RMFA 4YHHL 4JYAQ 3I4MG 5C3WA 1JORA 4XYOA 5LMUL 1EFID 3IKJA 4BY7G 1U4LA 2PW7A 4DR6Q 1CHPD 1FGBD 2K1BA 2K28A 2F1MA 4RGTA 3MZ5A 4F88A 1PFBA 3ULJA 3MXPA 4FXKC 2RQXA 1RKNA 2IJ0A 4ZUJA 1V1PA 1VQ7A 5J22A 2KVMA 1TVXA 1CM9A 4RG1A 5M3MB 1IBLQ 1SE3A 4PNYA 1VQAA 1EU3A 4KV6A 1VF7A 1VF5C 1P16A 4CHTB 5C4ZA 1QZGA 2JYOA 3F1ZA 4L5RC 2OQKA 5J1ZA 3R8BA 3HZXA 2CH4W 1AW7A 3F2DA 3G6JB 1Q90A 1FR3A 2K05A 2E2DC 4AIMA 2XWJB 2X6GA 1H95A 4DV5L 2MP1A 1TT2A 2XVSA 2HUGA 3I4OA 3U4ZA 2E2HB 2EPBA 3VDYA 2NBFA 4DV3Q 4DR2Q 4FNFA 1XPOA 1YHBA 3HOYH 3CW2C 3ERQA 3CD6A 1B44D 3GV6A 2EY5A 2JA6B 5F2DA 1DYQA 1MI2A 1MGSA 2I5MX 3MA2B 3QO2A 2H5XA 1B1ZA 1L2FA 5HURA 3PIPA 4XQQA 3G48A 4FP5D 4HJ8A 1CSQA 1X56A 1YNJC 3ZJYC 2EZVA 4Y52H 4KKUA 1A3VA 5CORA 4JI7Q 1LTBD 4UPAA 1HFGA 2SDFA 1DJRD 1QVGA 3FPUB 4ZRZA 1B3AA 1E1TA 1VQ4A 5COYA 1DOMA 2YYZA 1PH7A 3AFQA 3HKZG 4APVA 1W6JA 3RLFA 1HXYD 4Y7NB 2MHVA 1EIHA 2B3GA 4ZUIA 1U4MA 3VYRA 5DLQE 5AJ3Q 3S1RH 2FMMA 2EVBA 3ERSX 4C1NI 5JAVA 5IWAL 3ND9A 5GAEC 3DM1A 1KNAA 1CHQD 1SNMA 1NBWA 3T53B 3CRKC 1T9HA 4BBSH 1GD7A 4LF9L 1E2WA 3I4MH 1QUQA 3VR5A 1KTKA 2AUKA 2BE5C 3MXGA 4C3JB 3WDNA 4A93B 5CV5A 4B3MQ 3SK4A 3EFXD 4QY7A 4IFDG 1SNQA 4C2MH 3GD7A 5BN5A 1VQCA 5JPMC 5FLXc 4GOPB 3NBHA 5A35A 3EBEA 1YJWA 3I4NG 4A3JG 1H9JA 3VR4A 4HIKA 3K0YA 1HNXL 3MHBA 3SVMA 1LT3D 1Q12A 1M90C 4R1JA 4X66Q 4IFDH 2IL8A 4PQXA 3TBIB 4JBJA 4KY5A 3A8IE 3Q0AA 2MNAA 2Z6BA 1PYSB 1Q1BA 3TDQA 2AMCB 1X9NA 4OEMB 3K8AA 4IO9A 1CQVA 4LF7Q 1WTPA 3TP5A 2B2TC 2A6EC 1X54A 1XNQL 3HKSA 2JA6H 2CWAA 3R2TA 1NR2A 1SRUA 2DJGC 1I94Q 1UAPA 1IBLL 2Q8IB 3SK8A 1I6VC 2K5HA 1HJPA 2ZTCA 3M85A 2F4IA 1JICA 3WOEA
chains in the Genus database with same CATH topology
2AWNA 2CKZB 5IYCH 1AE2A 1EWIA 3KDFA 1J5EL 4A3KH 2K4KA 1PH9A 4GKJL 2JEAI 2ZTEA 5LMNQ 1J5EQ 2MFIA 2HHHQ 2XGTA 2IX0A 4AQYL 2VQEQ 1XNRQ 5ELOA 4P72A 3HOVG 1SFOH 3CQZH 1XMOL 1K73C 2VW9A 4J15A 3DLLA 1IXRA 1X3GA 4NXMQ 2R7FA 3S1NH 1XTDA 3ULPA 1G51A 3F2BA 2LXKA 1AH9A 4DK6C 4IFDI 4JI4L 1YITA 1HZBA 1VQEA 4X64Q 1VQJA 2E8GA 4WJ4A 2WFWA 4DPGA 3CCJA 4JI4Q 4JBWA 1I3QH 4DV7L 3FKIH 1KL9A 2D0OA 2VZAA 1MJCA 4JV5L 5M3FG 1TWHH 1OXXK 1S3OA 2K14A 1PYBA 3IRBA 2NN6I 4KLKA 4GNXA 1SN8A 2EXDA 4MTNA 2PMZE 2KCMA 5HGQA 1XJVA 4JV5Q 3S2DH 1SLJA 3L7ZC 3GTOH 5IWAQ 4P73A 2KBNA 5ELNA 4L5QA 4LUVA 2N49A 5C0XG 2WAQE 1KHIA 4GLVB 3PSIA 3PO3H 5JJLA 3M4QA 4EQ5A 1IBMQ 2GN5A 5K36G 3CPWA 1XNRL 1VQOA 4JOIC 3FHWA 4NB3A 3E9IA 1E22A 2GVBA 4A3JH 4LF5L 2BH2A 1PH1A 4A3DH 3GTKH 1WFQA 4LWCA 1VQPA 1YI2A 4JI6L 4LF4Q 1WYDA 2JE6I 2YTVA 4DR2L 4JBMA 4YWMA 3W1BA 5IP9G 5C4JH 2UUAL 1A8VA 3PF5A 2CWPA 2WB1E 3L2PA 1HR0L 1BKBA 3CXCA 3NELA 2JA9A 4DR5L 3UDGA 1VQ9A 2UUAQ 3GTGH 5FJ8H 5JJIA 2IY5B 2UXCL 2RCNA 2MO0A 1UE5A 1G6PA 1HNZL 4ME3A 5C0XI 1K8GA 3RLNA 4DR7L 4IPHA 4BY1G 2PI2A 3OYYA 3Q8DA 5IP7H 4DR7Q 2ATWA 3CCEA 2NVYH 3KJPA 4A3DG 5H1SE 1BBUA 2C35B 4OWTB 2QEXA 1PA6A 3B6YA 3TS0A 3U58A 1CKMA 1KD1C 1S72A 2Y0SE 4DKAC 1LM0A 3HOYG 4LFBQ 5M3FH 1KRTA 3RN2A 1QZHA 4EX5A 3HOXG 1PHJA 4P74A 1N34Q 4POGA 1J6QA 4H02A 2Q2UA 3TEHB 4HJ7A 5HY6A 4HJAA 1Q86C 1PV4A 2Q2TA 3E9HA 1M1KC 4QL5A 3HOWH 4B3RQ 4UP8A 3J80i 4NXNL 4JI5L 2ZM6Q 3S14H 4GOPA 3H0GG 3H3VI 4TVAB 3CC4A 1Q46A 1YHAA 4QIWE 3A5UA 2B63H 2A19A 4PMWA 4YWLA 1UEBA 1B70B 4A4IA 2F3IA 3KFUA 4YCWA 2VL6A 1VQLA 1D8LA 3HOVH 1JMCA 2E5LQ 1Q7YC 2VQFQ 1HNZQ 1SE8A 4DUZQ 2F4VL 3T1YL 1UWVA 1HZCA 2N78A 3AQQA 2LXJA 3NENA 5LMUQ 4LW1A 1Y1VH 2JA8H 2OQ0A 1QUQB 4DV6Q 3BZKA 3FKIG 2BH8A 1AE3A 4B3TL 4P71A 2JA7H 2FXQA 1FL0A 2UUBQ 4JI1L 4DV0L 1N33Q 5FJ8G 4A3FH 1JB7A 1HNWL 1PFSA 1B8AA 1GVPA 3S1QH 4YY3L 4AH6A 4JI1Q 4DV0Q 1E3PA 5M5YH 4JI0L 2K5NA 3LGJA 2OTJA 1N36Q 4GNXB 1A0IA 2IHFA 4DV3L 3NBHB 1YJ9A 2E2IH 3M7NA 4A3BH 1N36L 4BBSG 4K0KQ 3K7AH 1YVCA 4OXPA 1VCIA 1JT8A 1Y1VG 2EIFA 2JA8G 3TRZA 3HOUH 1IZ6A 3GTMH 4BA1I 4DR4Q 1N8RC 4LFCQ 5BR8L 1W3SA 3JAMi 4JBKA 3PO3G 1TWFH 2R92G 4C3HH 3RNUA 4IOAA 4DUYL 4A3EG 4P75A 1JJCB 3CPFA 1PH2A 1Q81C 1PH8A 1HNXQ 2HQLA 4QQBX 1K3RA 4YHHQ 1N9WA 1YNXA 3H15A 2QA4A 4GKJQ 3H0GH 1D7QA 3UDXA 4JI7L 3J7A5 1Z47A 1O7IA 4DV5Q 4LF6Q 2AHOB 2K50A 2JA6G 5JEAG 4X66L 4JI3Q 3I7FA 2I0QA 1EOVA 1HZAA 3W5OA 4GLAC 3J7ZC 4BY1H 4OWWB 1JE5A 1X65A 4YWKA 1K0RA 4IPGA 2R6GA 4YY3Q 5M5WH 3CCRA 5LMNW 4LF9Q 3EN2A 3M9BA 3KF8B 1CKOA 1KAWA 4X64L 4ALPA 5E7NA 2CCZA 1I6HH 2UUCL 3M4PA 2UU9Q 4JI2L 2VS1A 1CKNB 3HOZH 1E7ZA 2UXDL 1HZ9A 2L15A 4LUOA 3U50C 5C3EG 3KDFB 2UXDQ 2DGYA 2NN6G 4AYBE 3E0EA 2GVAA 4A75A 4PZ8A 2K52A 3UE1A 1Q82C 1FJGL 2VUMH 2RHSB 3PO2H 3PIOA 3M3YH 1RIPA 3GTPH 3GTLH 3OTOL 1ASZA 4XTCS 3HOWG 3S1MH 2NZOA 2AKWB 4PG3A 2HHHL 1EIFA 3OTOQ 2QGQA 4JYAL 2R7ZH 2V1CC 4FDBA 4IPDA 1TWCH 3A74A 3GDEA 1TWAH 4QJFA 2OCEA 4IPCA 1IBML 1A63A 1L1OA 4C3JH 5IYBH 2RF4A 3KOJA 2HIVA 3TQYA 5GAGC 2ZJRA 2VUMG 3L0OA 4DR3L 1OXSC 5C0XJ 1Q1EA 4B3ML 2PNHA 4LF7L 2NVXH 3T1HL 3ER0A 1G291 1WJJA 2RHQB 4A3GG 1CUKA 4HJ5A 4GKKQ 4X65L 1WI5A 1JJ2A 4DV7Q 1QVCA 5IYDG 3PUXA 4HIMA 3RZDH 2UXCQ 3H3VH 2HIXA 4A3LH 1X3FA 4LF8Q 4HIOA 4A3BG 3RN5A 3UE0A 1FJGQ 1GO3E 1VQMA 1KIXA 3JC66 4IFDJ 5AJ3L 4A3CH 2JA5H 1YBYA 4A3IH 1OXUA 2OTLA 1E24A 2PQAB 1VQ5A 4JI0Q 4OX9L 1JJGA 2KCTA 4R4QA 2DUDA 1PH4A 3RR5A 5C44G 3PGZA 3I56A 4A3MG 1WCMG 1P8LA 3K81C 4DV2L 4POFA 4BBRH 1VQIA 4A3EH 1N34L 4JI5Q 3TREA 4O2DA 3MXNB 4DK3C 3PCOB 4Y7NH 4DV2Q 2R92H 3J80c 1LTLA 4LF5Q 4NPSA 4A3IG 3CMEA 2JA5G 1UE7A 5IE8A 1VS0A 5BR8Q 3RZOH 2VNUD 3J81c 2F52A 2YTYA 4DAMA 2I5HA 1A62A 1VQDA 2ASBA 4QGUA 4A3CG 5C4XG 3RLOA 3CCSA 2YU9H 4KHPQ 4BBRG 3CCQA 1MKHA 4GNXC 5GQOA 4OO1I 3T1YQ 5C44H 4A3MH 3CCVA 3JAMc 3D0FA 3F8TA 2CFMA 3CCLA 1L1OB 1HH2P 3GTQH 4AQYQ 1TXYA 4LF6L 1EQQA 1XMQQ 4GN3B 5IP9H 4C3IH 1KC8C 1HR0W 4BA2I 3KLWA 4JI8Q 4B3SL 4KHZA 1NJIC 5C4XH 3AYHB 3PUVA 1VQ8A 1DGSA 4LFBL 2A1AA 4UP7A 1VQBA 2Y0SG 4JI2Q 1QVFA 2A8VA 3D31A 4X62Q 1EUJA 2VY3A 1X3EA 4DV4Q 4A3KG 1VQNA 1Y14B 3SGIA 3M4OH 3MEFA 3CF5A 4UP9A 5IYCG 2R7ZG 1XNQQ 1NMFA 3PUYA 4A76A 3CCMA 1WOCA 4OONA 5EAYA 1B7YB 2ZTDA 4R4TA 4DV1L 4UY8C 1GKHA 3G71A 2I5LX 2ALYB 2IHEA 2F4VQ 4KHPL 4RMFA 1OTCA 1BBWA 1VQHA 4YHHL 3I4MG 4JYAQ 4JOIA 4L5TA 1LYLA 1SMXA 2VQEL 2K75A 4DUZL 2ZJQA 2B63G 1OXTA 2KENA 4LFAL 3BJUA 3PV0A 5LMUL 1N33L 2YV5A 1XMQL 1YZ6A 4XIGS 1U5KA 5IYDH 3I4NH 1K8AC 4BY7G 1NE3A 3KF6B 3A0JA 4JI8L 1IYJB 3TS2A 4DR6Q 1N32Q 3BZCA 1HNWQ 4GLXA 4DR1L 4BXXH 3KF6A 4GKKL 4K0KL 3ULJA 4DR1Q 2AWOA 3U4VA 1X6OA 2UU9L 3G6EA 3PUWA 5GROA 3ULLA 3UDIA 3AFPA 1VQ7A 2Z6KA 4JCVE 4R4CA 2E2JH 4DAYB 4NXNQ 4RG1A 1Q8KA 1PVOA 5J3BA 1IBLQ 1VQAA 2ZJPA 2R7DA 4A93G 4HIDA 5JJKA 2UXBL 1P16A 1RL2A 2MQHA 2WAQG 1QZGA 1CKNA 3F1ZA 2JJQA 4L5RC 2R93H 2NZHA 1UE1A 3S15H 4DUYQ 2OQKA 1EQRA 5M3MH 3F2DA 1XPRA 3K80C 3HOUG 4WJ3M 1C9OA 2WP8J 4AIMA 3A5ZB 1IL2A 1E1OA 4IJHA 4LFAQ 1OXVA 1H95A 1VQGA 4DV5L 1L1OC 4A3LG 5IT9c 5C3EH 1IBKQ 3F2CA 1XMOQ 4LF4L 3I4OA 3U4ZA 2UUBL 2WB1G 1I50H 5FLMG 4IOCA 3VDYA 1NY4A 2PQAA 1VQFA 2UUCQ 5IP7G 1HR0Q 4DV3Q 4DR2Q 4L5SA 3HOXH 1XPOA 1YHBA 2E5LL 4IJLA 3HOYH 5GAHC 3CW2C 3W1GA 3J81i 4DR5Q 1PH3A 3CD6A 5IY0A 3S2HH 2ID0A 5FLMH 3HFZB 1EYGA 5GADC 2I5MX 2H5XA 1X55A 1L2FA 3CC2A 1UE6A 3KJOA 3PIPA 3STBD 3PUZA 3G48A 2E2HH 4OX9Q 2LSSA 3HOZG 1MJEA 3PF4A 4HJ8A 4MNOA 1CSQA 1X56A 1BVSA 1TWGH 2BA1A 2KHJA 2XTIA 4MZ9A 3ZJYC 3CC7A 4YCVA 4Y52H 4KI0A 4JI7Q 1XPUA 4X6AH 1W2BA 1C0AA 4UPAA 1ASYA 2YTXA 4LUZA 1PH5A 1QVGA 2CQOA 3KYHC 1IBKL 1VQKA 1KQSA 1E1TA 3GO5A 1VQ4A 1S40A 4DR4L 2OWOA 4B3RL 2YYZA 4LNQA 4O0AA 2EQSA 4GN5A 1PH7A 1FVIA 2PI2E 3AFQA 3HKZG 3STBC 4APVA 5IYBG 2IX1A 1R9TH 2JA7G 3RLFA 2JK8A 2BA0A 1NMGA 1WCMH 2NVTH 2N8NA 4BXXG 4JG2A 2B3GA 2KHIA 2JEBI 4TQUS 1Y1WG 1PH6A 2VQFL 1V43A 1V9PA 5DLQE 5AJ3Q 4JI3L 3S1RH 4B3TQ 3ERSX 5IWAL 4GN4B 5GAEC 4B3SQ 2JQOA 1GM5A 1NBWA 5M5XH 4A3GH 1T9HA 4BBSH 4A93H 1C7YA 1GD7A 1YHQA 3UDFA 4R4IA 4LF9L 2K5VA 3I4MH 4PZ6A 1QUQA 2Q2HA 5M3MG 1Y1WH 1K83H 2D0PA 1EIYB 4GOPC 1I94L 3CAMA 4PZ7A 2R93G 1FGUA 4DV4L 4JI6Q 2N3SA 3I55A 4B3MQ 5JEAJ 3AEVA 4QY7A 4IFDG 4C2MH 3GD7A 4OO1G 3K0XA 1VQCA 5FLXc 4GOPB 4DV1Q 1YJWA 3T1HQ 3EBEA 1YJNA 3I4NG 4BY7H 4A3JG 3WWVA 3FP9A 3S24A 4X65Q 2B29A 3CCUA 4HIKA 3EIVA 1HNXL 3ICEA 2D62A 3BU2A 3HKZE 5LMNL 1V1QA 2MO1A 1YIJA 2Z0SA 3GTJH 3CMAA 1Q12A 1M90C 4R1JA 3OW2A 1U0LA 4X66Q 2NVQH 3J81j 4R4OA 4NXML 1Z9FA 4JBJA 4DV6L 1I5FA 1YEZA 3CP0A 1VQ6A 1N32L 3K7UC 2MNAA 4DR3Q 1PYSB 1Q1BA 4DNIA 2AMCB 1MIUA 1CSPA 3I2ZA 1X9NA 3K8AA 4IO9A 4YCUA 4JC0A 4LF7Q 3PO2G 4DR6L 4GS3A 4X62L 1SR3A 2Z6KC 4HJ9A 1X54A 1K9MC 1KRSA 4AYBG 1XNQL 2IT1A 3HKSA 2HT1A 2JA6H 3G4SA 2CWAA 1LUZA 1IBLL 1SRUA 1I94Q 1KXLA 2ZM6L 2K5HA 1HJPA 4OWXB 2ZTCA 3NEMA 2UXBQ 1L0WA 4A3FG 3DM3A 2Q2IA 3M85A 1EFWA 4LF8L 4LFCL 1NTGA 3S16H 1SROA 3S17H 2ES2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AWN A;  2CKZ B;  5IYC H;  1AE2 A;  1EWI A;  3KDF A;  1J5E L;  4A3K H;  2K4K A;  1PH9 A;  4GKJ L;  2JEA I;  2ZTE A;  5LMN Q;  1J5E Q;  2MFI A;  2HHH Q;  2XGT A;  2IX0 A;  4AQY L;  2VQE Q;  1XNR Q;  5ELO A;  4P72 A;  3HOV G;  1SFO H;  3CQZ H;  1XMO L;  1K73 C;  2VW9 A;  4J15 A;  3DLL A;  1IXR A;  1X3G A;  4NXM Q;  2R7F A;  3S1N H;  1XTD A;  3ULP A;  1G51 A;  3F2B A;  2LXK A;  1AH9 A;  4DK6 C;  4IFD I;  4JI4 L;  1YIT A;  1HZB A;  1VQE A;  4X64 Q;  1VQJ A;  2E8G A;  4WJ4 A;  2WFW A;  4DPG A;  3CCJ A;  4JI4 Q;  4JBW A;  1I3Q H;  4DV7 L;  3FKI H;  1KL9 A;  2D0O A;  2VZA A;  1MJC A;  4JV5 L;  5M3F G;  1TWH H;  1OXX K;  1S3O A;  2K14 A;  1PYB A;  3IRB A;  2NN6 I;  4KLK A;  4GNX A;  1SN8 A;  2EXD A;  4MTN A;  2PMZ E;  2KCM A;  5HGQ A;  1XJV A;  4JV5 Q;  3S2D H;  1SLJ A;  3L7Z C;  3GTO H;  5IWA Q;  4P73 A;  2KBN A;  5ELN A;  4L5Q A;  4LUV A;  2N49 A;  5C0X G;  2WAQ E;  1KHI A;  4GLV B;  3PSI A;  3PO3 H;  5JJL A;  3M4Q A;  4EQ5 A;  1IBM Q;  2GN5 A;  5K36 G;  3CPW A;  1XNR L;  1VQO A;  4JOI C;  3FHW A;  4NB3 A;  3E9I A;  1E22 A;  2GVB A;  4A3J H;  4LF5 L;  2BH2 A;  1PH1 A;  4A3D H;  3GTK H;  1WFQ A;  4LWC A;  1VQP A;  1YI2 A;  4JI6 L;  4LF4 Q;  1WYD A;  2JE6 I;  2YTV A;  4DR2 L;  4JBM A;  4YWM A;  3W1B A;  5IP9 G;  5C4J H;  2UUA L;  1A8V A;  3PF5 A;  2CWP A;  2WB1 E;  3L2P A;  1HR0 L;  1BKB A;  3CXC A;  3NEL A;  2JA9 A;  4DR5 L;  3UDG A;  1VQ9 A;  2UUA Q;  3GTG H;  5FJ8 H;  5JJI A;  2IY5 B;  2UXC L;  2RCN A;  2MO0 A;  1UE5 A;  1G6P A;  1HNZ L;  4ME3 A;  5C0X I;  1K8G A;  3RLN A;  4DR7 L;  4IPH A;  4BY1 G;  2PI2 A;  3OYY A;  3Q8D A;  5IP7 H;  4DR7 Q;  2ATW A;  3CCE A;  2NVY H;  3KJP A;  4A3D G;  5H1S E;  1BBU A;  2C35 B;  4OWT B;  2QEX A;  1PA6 A;  3B6Y A;  3TS0 A;  3U58 A;  1CKM A;  1KD1 C;  1S72 A;  2Y0S E;  4DKA C;  1LM0 A;  3HOY G;  4LFB Q;  5M3F H;  1KRT A;  3RN2 A;  1QZH A;  4EX5 A;  3HOX G;  1PHJ A;  4P74 A;  1N34 Q;  4POG A;  1J6Q A;  4H02 A;  2Q2U A;  3TEH B;  4HJ7 A;  5HY6 A;  4HJA A;  1Q86 C;  1PV4 A;  2Q2T A;  3E9H A;  1M1K C;  4QL5 A;  3HOW H;  4B3R Q;  4UP8 A;  3J80 i;  4NXN L;  4JI5 L;  2ZM6 Q;  3S14 H;  4GOP A;  3H0G G;  3H3V I;  4TVA B;  3CC4 A;  1Q46 A;  1YHA A;  4QIW E;  3A5U A;  2B63 H;  2A19 A;  4PMW A;  4YWL A;  1UEB A;  1B70 B;  4A4I A;  2F3I A;  3KFU A;  4YCW A;  2VL6 A;  1VQL A;  1D8L A;  3HOV H;  1JMC A;  2E5L Q;  1Q7Y C;  2VQF Q;  1HNZ Q;  1SE8 A;  4DUZ Q;  2F4V L;  3T1Y L;  1UWV A;  1HZC A;  2N78 A;  3AQQ A;  2LXJ A;  3NEN A;  5LMU Q;  4LW1 A;  1Y1V H;  2JA8 H;  2OQ0 A;  1QUQ B;  4DV6 Q;  3BZK A;  3FKI G;  2BH8 A;  1AE3 A;  4B3T L;  4P71 A;  2JA7 H;  2FXQ A;  1FL0 A;  2UUB Q;  4JI1 L;  4DV0 L;  1N33 Q;  5FJ8 G;  4A3F H;  1JB7 A;  1HNW L;  1PFS A;  1B8A A;  1GVP A;  3S1Q H;  4YY3 L;  4AH6 A;  4JI1 Q;  4DV0 Q;  1E3P A;  5M5Y H;  4JI0 L;  2K5N A;  3LGJ A;  2OTJ A;  1N36 Q;  4GNX B;  1A0I A;  2IHF A;  4DV3 L;  3NBH B;  1YJ9 A;  2E2I H;  3M7N A;  4A3B H;  1N36 L;  4BBS G;  4K0K Q;  3K7A H;  1YVC A;  4OXP A;  1VCI A;  1JT8 A;  1Y1V G;  2EIF A;  2JA8 G;  3TRZ A;  3HOU H;  1IZ6 A;  3GTM H;  4BA1 I;  4DR4 Q;  1N8R C;  4LFC Q;  5BR8 L;  1W3S A;  3JAM i;  4JBK A;  3PO3 G;  1TWF H;  2R92 G;  4C3H H;  3RNU A;  4IOA A;  4DUY L;  4A3E G;  4P75 A;  1JJC B;  3CPF A;  1PH2 A;  1Q81 C;  1PH8 A;  1HNX Q;  2HQL A;  4QQB X;  1K3R A;  4YHH Q;  1N9W A;  1YNX A;  3H15 A;  2QA4 A;  4GKJ Q;  3H0G H;  1D7Q A;  3UDX A;  4JI7 L;  3J7A 5;  1Z47 A;  1O7I A;  4DV5 Q;  4LF6 Q;  2AHO B;  2K50 A;  2JA6 G;  5JEA G;  4X66 L;  4JI3 Q;  3I7F A;  2I0Q A;  1EOV A;  1HZA A;  3W5O A;  4GLA C;  3J7Z C;  4BY1 H;  4OWW B;  1JE5 A;  1X65 A;  4YWK A;  1K0R A;  4IPG A;  2R6G A;  4YY3 Q;  5M5W H;  3CCR A;  5LMN W;  4LF9 Q;  3EN2 A;  3M9B A;  3KF8 B;  1CKO A;  1KAW A;  4X64 L;  4ALP A;  5E7N A;  2CCZ A;  1I6H H;  2UUC L;  3M4P A;  2UU9 Q;  4JI2 L;  2VS1 A;  1CKN B;  3HOZ H;  1E7Z A;  2UXD L;  1HZ9 A;  2L15 A;  4LUO A;  3U50 C;  5C3E G;  3KDF B;  2UXD Q;  2DGY A;  2NN6 G;  4AYB E;  3E0E A;  2GVA A;  4A75 A;  4PZ8 A;  2K52 A;  3UE1 A;  1Q82 C;  1FJG L;  2VUM H;  2RHS B;  3PO2 H;  3PIO A;  3M3Y H;  1RIP A;  3GTP H;  3GTL H;  3OTO L;  1ASZ A;  4XTC S;  3HOW G;  3S1M H;  2NZO A;  2AKW B;  4PG3 A;  2HHH L;  1EIF A;  3OTO Q;  2QGQ A;  4JYA L;  2R7Z H;  2V1C C;  4FDB A;  4IPD A;  1TWC H;  3A74 A;  3GDE A;  1TWA H;  4QJF A;  2OCE A;  4IPC A;  1IBM L;  1A63 A;  1L1O A;  4C3J H;  5IYB H;  2RF4 A;  3KOJ A;  2HIV A;  3TQY A;  5GAG C;  2ZJR A;  2VUM G;  3L0O A;  4DR3 L;  1OXS C;  5C0X J;  1Q1E A;  4B3M L;  2PNH A;  4LF7 L;  2NVX H;  3T1H L;  3ER0 A;  1G29 1;  1WJJ A;  2RHQ B;  4A3G G;  1CUK A;  4HJ5 A;  4GKK Q;  4X65 L;  1WI5 A;  1JJ2 A;  4DV7 Q;  1QVC A;  5IYD G;  3PUX A;  4HIM A;  3RZD H;  2UXC Q;  3H3V H;  2HIX A;  4A3L H;  1X3F A;  4LF8 Q;  4HIO A;  4A3B G;  3RN5 A;  3UE0 A;  1FJG Q;  1GO3 E;  1VQM A;  1KIX A;  3JC6 6;  4IFD J;  5AJ3 L;  4A3C H;  2JA5 H;  1YBY A;  4A3I H;  1OXU A;  2OTL A;  1E24 A;  2PQA B;  1VQ5 A;  4JI0 Q;  4OX9 L;  1JJG A;  2KCT A;  4R4Q A;  2DUD A;  1PH4 A;  3RR5 A;  5C44 G;  3PGZ A;  3I56 A;  4A3M G;  1WCM G;  1P8L A;  3K81 C;  4DV2 L;  4POF A;  4BBR H;  1VQI A;  4A3E H;  1N34 L;  4JI5 Q;  3TRE A;  4O2D A;  3MXN B;  4DK3 C;  3PCO B;  4Y7N H;  4DV2 Q;  2R92 H;  3J80 c;  1LTL A;  4LF5 Q;  4NPS A;  4A3I G;  3CME A;  2JA5 G;  1UE7 A;  5IE8 A;  1VS0 A;  5BR8 Q;  3RZO H;  2VNU D;  3J81 c;  2F52 A;  2YTY A;  4DAM A;  2I5H A;  1A62 A;  1VQD A;  2ASB A;  4QGU A;  4A3C G;  5C4X G;  3RLO A;  3CCS A;  2YU9 H;  4KHP Q;  4BBR G;  3CCQ A;  1MKH A;  4GNX C;  5GQO A;  4OO1 I;  3T1Y Q;  5C44 H;  4A3M H;  3CCV A;  3JAM c;  3D0F A;  3F8T A;  2CFM A;  3CCL A;  1L1O B;  1HH2 P;  3GTQ H;  4AQY Q;  1TXY A;  4LF6 L;  1EQQ A;  1XMQ Q;  4GN3 B;  5IP9 H;  4C3I H;  1KC8 C;  1HR0 W;  4BA2 I;  3KLW A;  4JI8 Q;  4B3S L;  4KHZ A;  1NJI C;  5C4X H;  3AYH B;  3PUV A;  1VQ8 A;  1DGS A;  4LFB L;  2A1A A;  4UP7 A;  1VQB A;  2Y0S G;  4JI2 Q;  1QVF A;  2A8V A;  3D31 A;  4X62 Q;  1EUJ A;  2VY3 A;  1X3E A;  4DV4 Q;  4A3K G;  1VQN A;  1Y14 B;  3SGI A;  3M4O H;  3MEF A;  3CF5 A;  4UP9 A;  5IYC G;  2R7Z G;  1XNQ Q;  1NMF A;  3PUY A;  4A76 A;  3CCM A;  1WOC A;  4OON A;  5EAY A;  1B7Y B;  2ZTD A;  4R4T A;  4DV1 L;  4UY8 C;  1GKH A;  3G71 A;  2I5L X;  2ALY B;  2IHE A;  2F4V Q;  4KHP L;  4RMF A;  1OTC A;  1BBW A;  1VQH A;  4YHH L;  3I4M G;  4JYA Q;  4JOI A;  4L5T A;  1LYL A;  1SMX A;  2VQE L;  2K75 A;  4DUZ L;  2ZJQ A;  2B63 G;  1OXT A;  2KEN A;  4LFA L;  3BJU A;  3PV0 A;  5LMU L;  1N33 L;  2YV5 A;  1XMQ L;  1YZ6 A;  4XIG S;  1U5K A;  5IYD H;  3I4N H;  1K8A C;  4BY7 G;  1NE3 A;  3KF6 B;  3A0J A;  4JI8 L;  1IYJ B;  3TS2 A;  4DR6 Q;  1N32 Q;  3BZC A;  1HNW Q;  4GLX A;  4DR1 L;  4BXX H;  3KF6 A;  4GKK L;  4K0K L;  3ULJ A;  4DR1 Q;  2AWO A;  3U4V A;  1X6O A;  2UU9 L;  3G6E A;  3PUW A;  5GRO A;  3ULL A;  3UDI A;  3AFP A;  1VQ7 A;  2Z6K A;  4JCV E;  4R4C A;  2E2J H;  4DAY B;  4NXN Q;  4RG1 A;  1Q8K A;  1PVO A;  5J3B A;  1IBL Q;  1VQA A;  2ZJP A;  2R7D A;  4A93 G;  4HID A;  5JJK A;  2UXB L;  1P16 A;  1RL2 A;  2MQH A;  2WAQ G;  1QZG A;  1CKN A;  3F1Z A;  2JJQ A;  4L5R C;  2R93 H;  2NZH A;  1UE1 A;  3S15 H;  4DUY Q;  2OQK A;  1EQR A;  5M3M H;  3F2D A;  1XPR A;  3K80 C;  3HOU G;  4WJ3 M;  1C9O A;  2WP8 J;  4AIM A;  3A5Z B;  1IL2 A;  1E1O A;  4IJH A;  4LFA Q;  1OXV A;  1H95 A;  1VQG A;  4DV5 L;  1L1O C;  4A3L G;  5IT9 c;  5C3E H;  1IBK Q;  3F2C A;  1XMO Q;  4LF4 L;  3I4O A;  3U4Z A;  2UUB L;  2WB1 G;  1I50 H;  5FLM G;  4IOC A;  3VDY A;  1NY4 A;  2PQA A;  1VQF A;  2UUC Q;  5IP7 G;  1HR0 Q;  4DV3 Q;  4DR2 Q;  4L5S A;  3HOX H;  1XPO A;  1YHB A;  2E5L L;  4IJL A;  3HOY H;  5GAH C;  3CW2 C;  3W1G A;  3J81 i;  4DR5 Q;  1PH3 A;  3CD6 A;  5IY0 A;  3S2H H;  2ID0 A;  5FLM H;  3HFZ B;  1EYG A;  5GAD C;  2I5M X;  2H5X A;  1X55 A;  1L2F A;  3CC2 A;  1UE6 A;  3KJO A;  3PIP A;  3STB D;  3PUZ A;  3G48 A;  2E2H H;  4OX9 Q;  2LSS A;  3HOZ G;  1MJE A;  3PF4 A;  4HJ8 A;  4MNO A;  1CSQ A;  1X56 A;  1BVS A;  1TWG H;  2BA1 A;  2KHJ A;  2XTI A;  4MZ9 A;  3ZJY C;  3CC7 A;  4YCV A;  4Y52 H;  4KI0 A;  4JI7 Q;  1XPU A;  4X6A H;  1W2B A;  1C0A A;  4UPA A;  1ASY A;  2YTX A;  4LUZ A;  1PH5 A;  1QVG A;  2CQO A;  3KYH C;  1IBK L;  1VQK A;  1KQS A;  1E1T A;  3GO5 A;  1VQ4 A;  1S40 A;  4DR4 L;  2OWO A;  4B3R L;  2YYZ A;  4LNQ A;  4O0A A;  2EQS A;  4GN5 A;  1PH7 A;  1FVI A;  2PI2 E;  3AFQ A;  3HKZ G;  3STB C;  4APV A;  5IYB G;  2IX1 A;  1R9T H;  2JA7 G;  3RLF A;  2JK8 A;  2BA0 A;  1NMG A;  1WCM H;  2NVT H;  2N8N A;  4BXX G;  4JG2 A;  2B3G A;  2KHI A;  2JEB I;  4TQU S;  1Y1W G;  1PH6 A;  2VQF L;  1V43 A;  1V9P A;  5DLQ E;  5AJ3 Q;  4JI3 L;  3S1R H;  4B3T Q;  3ERS X;  5IWA L;  4GN4 B;  5GAE C;  4B3S Q;  2JQO A;  1GM5 A;  1NBW A;  5M5X H;  4A3G H;  1T9H A;  4BBS H;  4A93 H;  1C7Y A;  1GD7 A;  1YHQ A;  3UDF A;  4R4I A;  4LF9 L;  2K5V A;  3I4M H;  4PZ6 A;  1QUQ A;  2Q2H A;  5M3M G;  1Y1W H;  1K83 H;  2D0P A;  1EIY B;  4GOP C;  1I94 L;  3CAM A;  4PZ7 A;  2R93 G;  1FGU A;  4DV4 L;  4JI6 Q;  2N3S A;  3I55 A;  4B3M Q;  5JEA J;  3AEV A;  4QY7 A;  4IFD G;  4C2M H;  3GD7 A;  4OO1 G;  3K0X A;  1VQC A;  5FLX c;  4GOP B;  4DV1 Q;  1YJW A;  3T1H Q;  3EBE A;  1YJN A;  3I4N G;  4BY7 H;  4A3J G;  3WWV A;  3FP9 A;  3S24 A;  4X65 Q;  2B29 A;  3CCU A;  4HIK A;  3EIV A;  1HNX L;  3ICE A;  2D62 A;  3BU2 A;  3HKZ E;  5LMN L;  1V1Q A;  2MO1 A;  1YIJ A;  2Z0S A;  3GTJ H;  3CMA A;  1Q12 A;  1M90 C;  4R1J A;  3OW2 A;  1U0L A;  4X66 Q;  2NVQ H;  3J81 j;  4R4O A;  4NXM L;  1Z9F A;  4JBJ A;  4DV6 L;  1I5F A;  1YEZ A;  3CP0 A;  1VQ6 A;  1N32 L;  3K7U C;  2MNA A;  4DR3 Q;  1PYS B;  1Q1B A;  4DNI A;  2AMC B;  1MIU A;  1CSP A;  3I2Z A;  1X9N A;  3K8A A;  4IO9 A;  4YCU A;  4JC0 A;  4LF7 Q;  3PO2 G;  4DR6 L;  4GS3 A;  4X62 L;  1SR3 A;  2Z6K C;  4HJ9 A;  1X54 A;  1K9M C;  1KRS A;  4AYB G;  1XNQ L;  2IT1 A;  3HKS A;  2HT1 A;  2JA6 H;  3G4S A;  2CWA A;  1LUZ A;  1IBL L;  1SRU A;  1I94 Q;  1KXL A;  2ZM6 L;  2K5H A;  1HJP A;  4OWX B;  2ZTC A;  3NEM A;  2UXB Q;  1L0W A;  4A3F G;  3DM3 A;  2Q2I A;  3M85 A;  1EFW A;  4LF8 L;  4LFC L;  1NTG A;  3S16 H;  1SRO A;  3S17 H;  2ES2 A; 
#chains in the Genus database with same CATH topology
 2AWN A;  1EYA A;  3TSS A;  2K4K A;  3J7Y W;  4GKJ L;  1ENF A;  3NQT A;  2IX0 A;  4AQY L;  2QDB A;  3HOV G;  1SFO H;  1K73 C;  2WKD A;  4NW2 A;  1CA5 A;  1AH9 A;  4WJ4 A;  1HZB A;  1VQE A;  2E8G A;  3H09 A;  3QOJ A;  5IIF A;  2J4X A;  1PRT B;  4MN3 A;  1I3Q H;  5KYI A;  1KL9 A;  3IRB A;  1PYB A;  1WTV A;  4KLK A;  1T5X D;  3E3X A;  2KCM A;  2EYM A;  4P73 A;  4L5Q A;  3Q6S A;  3HOV B;  2F3V A;  1F9Q A;  2WAQ E;  1DON A;  4GLV B;  2F0H A;  3MFG A;  1IBM Q;  1SNP A;  1XNR L;  4UDU C;  2PCF B;  4NB3 A;  1E22 A;  2GVB A;  4A3J H;  4LF5 L;  1PH1 A;  1YI2 A;  1QG7 A;  4ZAI A;  3W1B A;  4DNR B;  2UUA L;  3PF5 A;  2CWP A;  2WB1 E;  1HR0 L;  3GTG H;  5C4H A;  3CXC A;  3SR1 A;  5JJI A;  2IY5 B;  2UXC L;  1D5X C;  5T1I A;  1PFM A;  2RDH A;  4ME3 A;  1K8G A;  5L37 A;  1E2V A;  3OIQ A;  2ATW A;  4A3D G;  1IW7 C;  4OWT B;  2QEX A;  1Q8I A;  1D2B A;  1ILP A;  3TS0 A;  3U58 A;  1KD1 C;  2EOT A;  2Y0S E;  1LM0 A;  4LFB Q;  5KIX A;  5M3F H;  1QZH A;  4EX5 A;  1PRT F;  3L9A X;  5D3D A;  1IYV A;  5HY6 A;  1PV4 A;  2AQ1 B;  3D8G A;  4TSS A;  2ZM6 Q;  3H0G G;  3MAQ A;  1Q46 A;  2XSC A;  4QCL A;  4A4I A;  5I2X A;  2MGS A;  1VQL A;  3RZO B;  3HOV H;  1NR4 A;  2AQ2 B;  1Q7Y C;  2VQF Q;  1HNZ Q;  1SE8 A;  4O1N A;  4IQZ A;  2FMC A;  1HZC A;  3NEN A;  5KNC A;  2OQ0 A;  1PDQ A;  1QUQ B;  5D14 A;  4B3T L;  2EY2 A;  2JA7 H;  2JN4 A;  2UUB Q;  1JB7 A;  2QF7 A;  5FOB B;  1I3Q B;  1PFS A;  4A3F H;  1HNW L;  4YY3 L;  5M5Y H;  2B2T A;  4KKS A;  1WTX A;  3H0G B;  2OTJ A;  4R9W A;  2E2I H;  2IHF A;  1B9N A;  1LT6 D;  3HS0 C;  4A3B H;  1ZXT A;  4BBS G;  4K0K Q;  1YVC A;  4K5W A;  1EY0 A;  1VCI A;  4OXP A;  2JA8 G;  4LFC Q;  1JR0 D;  4BS9 A;  4DA2 A;  2R92 G;  4IOA A;  4XXE A;  1JJC B;  1HRJ A;  3CPF A;  1PH2 A;  2FHT A;  5ISR A;  1N9W A;  2ENB A;  1D7Q A;  2Z4I A;  3UDX A;  1ICW A;  4LF6 Q;  4FXG C;  1S5C D;  1TY2 A;  4BY1 H;  5KRU A;  2A6H D;  1K0R A;  4YWK A;  2R6G A;  5LMN W;  3CCR A;  1QJO A;  5FK9 C;  3KF8 B;  1CKO A;  4OL7 A;  2O4X A;  5E7N A;  2E76 C;  2ICE C;  2UU9 Q;  3S15 B;  2UXD L;  5EPL A;  3U50 C;  4LUO A;  1S5E D;  3A8J E;  3HGB A;  3E0E A;  1V1O A;  5G3L F;  2EY1 A;  4DAY A;  3U9S A;  5M5X B;  3D6W A;  3PO2 H;  2NVX B;  3PIO A;  1ESF A;  3KBX A;  4G7Z C;  3ERO A;  4XTC S;  5BN4 A;  1EIG A;  2NZO A;  2QGQ A;  2B8F A;  1TR5 A;  3GDE A;  1PYW D;  2J0T D;  2KEE A;  4QJF A;  3QB3 A;  2OCE A;  1IBM L;  5IYB H;  2RF4 A;  2HIV A;  3L3O C;  1UEA B;  2VUM G;  4DR3 L;  4CJ1 B;  1OXS C;  1Q1E A;  1I4G A;  5C0X H;  3T1H L;  1WJJ A;  2RHQ B;  2XRS D;  4DV7 Q;  4G4K A;  4RHS A;  4A3D B;  2B39 A;  4HIM A;  3K7A B;  4QUF A;  4A3L H;  4A3B G;  1FJG Q;  4KD3 A;  1KIX A;  1SNO A;  3JC6 6;  4IFD J;  4A3C H;  2JA5 H;  1G2T A;  1OXU A;  5CC4 A;  1TS5 A;  1JJG A;  4R4Q A;  1QWY A;  2DUD A;  3RR5 A;  4BBR H;  5EGT A;  3TRE A;  3J80 c;  2K5Q A;  5C44 B;  1R9T B;  4A3I G;  1BO0 A;  5IE8 A;  1PTO D;  3GTQ B;  2L4N A;  1VQD A;  3ZYY X;  1ZYR D;  3SE0 A;  1NAP A;  4OO1 I;  5FKA C;  3T1Y Q;  2L0C A;  5I9P A;  3CCV A;  3D0F A;  3NUC A;  2CFM A;  2RBM A;  4ILW A;  3GTQ H;  3NTI A;  4C3I H;  1K8M A;  2R92 B;  2IW3 A;  5CGK A;  5FO7 B;  3NPP A;  3KLS A;  2L5T A;  2Y0S B;  3AYH B;  3GTP B;  2XN9 C;  1S5B D;  2NUC A;  2FIN B;  1DGS A;  3HP3 A;  1DZ1 A;  1Y1V B;  4JI2 Q;  2Y0S G;  1OO9 B;  4RAU C;  3D31 A;  4JV5 Q;  3SGI A;  1JE4 A;  5IGE A;  1PTO F;  2FJ2 A;  3UI2 A;  2B2W C;  4DV1 L;  4UY8 C;  1GKH A;  1EY7 A;  2ALY B;  2IHE A;  3T13 A;  2SOB A;  1XX8 A;  1OTC A;  1BBW A;  3M7G A;  4JOI A;  4L5T A;  2VQE L;  1D1K A;  2B2U C;  1AZQ A;  4XIG S;  3MXN A;  1U5K A;  5DM6 3;  3I4N H;  1K8A C;  4JI8 L;  1IYJ B;  4KKT A;  1N32 Q;  3BZC A;  4GLX A;  2Z8L A;  4X3U A;  4BXX H;  3A8K E;  3KF6 A;  4GKK L;  3V05 A;  1T5E A;  2AWO A;  4DF7 A;  3G6E A;  2B2V A;  3EQL C;  3ULL A;  3OPO A;  4Z9C B;  4R4C A;  4KTA A;  1WTR A;  3J7A V;  4A3B B;  5J3B A;  4KHV A;  3NTH A;  2DNC A;  3KUP A;  3MC0 B;  1RL2 A;  2WAQ G;  1CKN A;  1UE1 A;  3S15 H;  4DUY Q;  4LAA A;  4OIJ A;  1ONL A;  3HOU G;  4IUU A;  1C9O A;  2WP8 J;  1G8Z D;  1IL2 A;  4IJH A;  3FVQ A;  1L1O C;  4A3L G;  1K8O A;  5C3E H;  2F0K A;  1IBK Q;  1JQY D;  2UUB L;  2WB1 G;  4J1M A;  1QIL A;  5IP7 G;  1HR0 Q;  3BVG A;  1PMR A;  5C6A A;  1CI3 M;  3HOX H;  2K6A A;  2L11 A;  2E5L L;  5GAH C;  3W1G A;  3J81 i;  1PH3 A;  4AYB B;  3N6R A;  3BS1 A;  4V0B A;  2JA7 B;  1O7L A;  4RCN A;  1EYG A;  4FXD A;  5GAD C;  4JPB W;  3TP7 A;  2B2V C;  2F0W A;  2F0Q A;  1GUO A;  1NNX A;  3S1Q B;  1MJE A;  1MD2 D;  4JK1 C;  1TWG H;  4MZ9 A;  3NTK A;  1DM0 B;  4KI0 A;  1HQR D;  1C0A A;  2TMP A;  4DGZ A;  4MHE A;  2CQO A;  1RJT A;  3A7L A;  3KYH C;  3S2H B;  4RGM A;  1DOL A;  2CW0 C;  2ICI A;  1JCK B;  3GO5 A;  3RZD B;  4O0A A;  3D4D A;  1IYU A;  4A3K B;  2PI2 E;  3STB C;  2NVY B;  4C3J G;  2PPB C;  2JA7 G;  3CRL C;  4I65 A;  2BA0 A;  2RKS A;  1WCM H;  2NVT H;  4BXX G;  1S5F D;  2KHI A;  4TQU S;  1V43 A;  4CKB A;  2NYZ D;  4GN4 B;  4DN4 M;  3I4M B;  2JQO A;  1C7Y A;  3EA6 A;  1RDP D;  1JOQ A;  2K5V A;  5ELC A;  4PZ6 A;  2Q2H A;  2XNA C;  5M3M G;  1EYC A;  1BBX C;  1EIY B;  1I94 L;  1LT4 D;  1FGU A;  4K8I A;  4DV4 L;  4JI6 Q;  3PIO 3;  2N3S A;  3I55 A;  3AEV A;  4Q5V A;  4DV1 Q;  1KLG D;  3WWV A;  5ELF A;  3S24 A;  5CMD A;  2O2L D;  3ICE A;  3BU2 A;  1V1Q A;  2MO1 A;  1D6E C;  3BDL A;  3GTJ H;  4KJO A;  3CMA A;  2F3W A;  2WKC A;  1K0S A;  4ZYS A;  1U0L A;  3T4A C;  2NVQ H;  1LTR D;  1C8C A;  3MEH A;  1Z9F A;  4DV6 L;  3NXW A;  3CP0 A;  4C3H G;  1LLR D;  5CV8 A;  5G3L D;  4DNI A;  1CSP A;  5TSS A;  3GTM B;  1LTG D;  3PO2 G;  1CT1 D;  4GS3 A;  4KN4 C;  1RF2 D;  2V4D A;  1J8I A;  1SR3 A;  1K9M C;  4EGV A;  3DWQ A;  3G4S A;  1WCM B;  1KXL A;  2ZM6 L;  2KED A;  2Q2I A;  3S16 H;  4FF3 A;  2EY6 A;  2ES2 A;  5IYC H;  5FO8 B;  4HR7 B;  3KDF A;  1STN A;  4C1N K;  2JEA I;  2ZTE A;  5LMN Q;  4A3E B;  2A6E D;  5IGG A;  2A5H A;  1XNR Q;  1F77 A;  3CHB D;  2F0O A;  2VW9 A;  4J15 A;  4NXM Q;  3S1N H;  1XTD A;  3ULP A;  1G51 A;  4DK6 C;  4IFD I;  4JI4 L;  3LNN A;  4G57 A;  2OXP A;  1YIT A;  1VQJ A;  2D9U A;  3HOZ B;  1B2T A;  1BCP D;  3H6M A;  1BCP B;  3CCJ A;  4JBW A;  4DV7 L;  2NTS A;  2D0O A;  1EQV A;  2CHB D;  2VZA A;  5M5W B;  4JV5 L;  3BYT B;  1Y1W B;  3IFT A;  1I50 B;  1OXX K;  3K58 A;  2NN6 I;  4RGN A;  1QB5 D;  2EXD A;  2EYL A;  4MTN A;  1EZ6 A;  3X3M A;  2PMZ E;  5HGQ A;  1XJV A;  3S2D H;  2FFK B;  2OEO A;  3L7Z C;  4BY7 B;  5ELN A;  2P5Z X;  4RCO A;  2N49 A;  4OO1 H;  3PO3 H;  2TSS A;  5I4D A;  2GN5 A;  5K36 G;  1SSO A;  3NE5 B;  3E5S A;  3I3C A;  3J81 L;  4M1U B;  2E2J B;  4BWG B;  4DR2 L;  3SK5 A;  4JBM A;  4YWM A;  5C4J H;  1A8V A;  3UDG A;  3DMU A;  2JA9 A;  1LV9 A;  3M4O B;  2R93 B;  2RCN A;  2MO0 A;  1G6P A;  1EU4 A;  3E0J A;  3FPP A;  2A68 D;  4DR7 L;  4BY1 G;  2PI2 A;  3OYY A;  3Q8D A;  1KAA A;  4DR7 Q;  3CCE A;  3KJP A;  5H1S E;  3B6Y A;  4HSV A;  5CBE E;  2R3Z A;  5CV6 A;  2OF1 A;  1SYE A;  4P74 A;  1N34 Q;  5CV7 A;  1J6Q A;  4H02 A;  1Q86 C;  1M1K C;  4QL5 A;  3HOW H;  4B3R Q;  3J80 i;  3KBG A;  4K5X A;  4JI5 L;  3S14 H;  3TN2 A;  4QIW E;  1YHA A;  2X6L A;  3A5U A;  2B63 H;  4YWL A;  4KD4 A;  1ROD A;  1B70 B;  3KFU A;  4YCW A;  1LAC A;  3NK9 A;  2A69 D;  3AB9 A;  2E5L Q;  2K5D A;  1XWE A;  3AQQ A;  1BNZ A;  2LXJ A;  1GHK A;  4LW1 A;  1DCZ A;  1HCZ A;  4CKE A;  3FKI G;  1Z7T A;  4JI1 L;  4DV0 L;  1IKM A;  2DY8 A;  4JI0 L;  1PZJ D;  1K28 A;  3LGJ A;  2A69 C;  2IWH A;  4IUP A;  5A2Q E;  3D4W A;  3X3N A;  2HCC A;  3ONA B;  5C5M A;  3TRZ A;  3GTM H;  2JP1 A;  1N8R C;  3I73 A;  5K36 H;  3JAM i;  3PO3 G;  2A6H C;  4C3H H;  1A15 A;  4DUY L;  4P75 A;  1F2Z A;  2QCP X;  1Q81 C;  1PH8 A;  1HNX Q;  1K3R A;  1SFO B;  3DHQ A;  4M8A A;  4BBR B;  3H15 A;  3BG3 A;  2QA4 A;  5D3I B;  3H0G H;  4JI7 L;  1Z47 A;  2DJF C;  2K50 A;  2JA6 G;  5JEA G;  4X66 L;  4JI3 Q;  3I7F A;  2F0I A;  1F9R A;  2M9V A;  3W5O A;  1X65 A;  2R61 A;  4IPG A;  4YY3 Q;  4DXF A;  3EN2 A;  3M9B A;  2DNE A;  5IGF A;  1I4R A;  1I6H H;  1BDO A;  2RVL A;  2BOS A;  3M4P A;  2UUC L;  5E3F A;  4JI2 L;  4KN7 C;  2VS1 A;  1E7Z A;  1HZ9 A;  2L15 A;  4O42 A;  3Q23 A;  3I8Z A;  2M2L A;  1SE4 A;  2GVA A;  2K52 A;  1Q82 C;  1FJG L;  3A56 A;  3TZD A;  3NP8 A;  5M9O A;  3HOW G;  1ESR A;  3LWE A;  3S1M H;  2AKW B;  1EIF A;  2R7Z H;  4FDB A;  4IPD A;  1EOT A;  3HOW B;  4C56 C;  1SYG A;  1SBB B;  4IPC A;  2CH4 A;  1HFN A;  1K83 B;  4DK1 A;  4QF4 A;  3DUZ A;  2K01 A;  2LMC B;  2NVX H;  5LHY 1;  4DAV A;  1G29 1;  1G91 A;  1CUK A;  2X69 A;  2Z1C A;  1WI5 A;  2BCO A;  4LK1 C;  4XT1 B;  5IYD G;  3PUX A;  4XDX A;  1AP0 A;  3H3V H;  4LF8 Q;  3RN5 A;  2EJG C;  3D6C A;  4HMJ A;  4A3J B;  4A3I H;  2PO4 A;  1RCV D;  1VQ5 A;  3VR3 A;  4HCE A;  2KCT A;  1HA6 A;  4DNT B;  5C44 G;  2HDM A;  3PGZ A;  3I56 A;  2E74 C;  2L55 A;  2CVR A;  1N34 L;  1M8A A;  4JI5 Q;  4Y7N H;  4LF5 Q;  4NPS A;  4XQN A;  2JA5 G;  1VS0 A;  5BR8 Q;  2F0M A;  2F52 A;  4DAM A;  2I5H A;  2ASB A;  5IOC A;  5GQO A;  4QMG A;  3JAM c;  3F8T A;  5I6Y A;  3CCL A;  1L1O B;  4AQY Q;  4LF6 L;  3VYU A;  4GN3 B;  1XMQ Q;  5IP9 H;  1B3Q A;  4BA2 I;  1GOZ A;  3KLW A;  3TP6 A;  4B3S L;  1NJI C;  2PZW A;  5C4X H;  3V96 A;  1DOK A;  3PQI A;  1VQ8 A;  5C5L A;  1BQQ T;  1YNN D;  2A1A A;  4UP7 A;  5JVG 3;  1VQB A;  2D2C C;  2A8V A;  3BVM A;  3OW7 A;  4X62 Q;  2VY3 A;  3M4O H;  1VQN A;  1F2L A;  3MEF A;  4JW0 A;  3CF5 A;  2WII B;  1NMF A;  1Q3L A;  2MUY A;  5EAY A;  1B7Y B;  5EPK A;  1B9M A;  2ZTD A;  1EYD A;  2B63 B;  1JB3 A;  1TWG B;  2I5L X;  4RGO S;  3G71 A;  4KHP L;  3OIP A;  1VQH A;  1HUN A;  4DUZ L;  2Q8T A;  1OXT A;  4LFA L;  3BJU A;  4CDE C;  2YV5 A;  3GTJ B;  2KOL A;  3A0J A;  3TS2 A;  1HNW Q;  4DR1 L;  4DK0 A;  2PNR C;  1QOH A;  4K0K L;  4DR1 Q;  1X6O A;  5T1G A;  3PUW A;  3UDI A;  1HQM C;  3AFP A;  1GUT A;  2Z6K A;  1SYD A;  1WTO A;  4HMI A;  4NXN Q;  1Q8K A;  2ZJP A;  4HID A;  4RA8 A;  3SXH A;  3M4Y A;  2MQH A;  2JJQ A;  2C5C A;  1BXT A;  3EVQ A;  3PO2 B;  5M3M H;  3DEO A;  1SYB A;  3J80 E;  5FLX E;  4NDX A;  3A5Z B;  5JOB A;  1E1O A;  4FYD A;  1VMP A;  2N88 A;  5LL6 S;  3GTO B;  1KDC A;  1OXV A;  5CYU A;  5IT9 c;  4ODG A;  3F2C A;  1XMO Q;  5FLM G;  1TWH B;  2PQA A;  1PZI D;  3PO3 B;  2C9O A;  5KEE A;  4L63 B;  4ULL A;  4L5S A;  3SK6 A;  3S2H H;  3W2D A;  2I46 A;  2EYF A;  4EQN A;  5FLM H;  1KDB A;  2JA5 B;  5K5P A;  4RKB A;  4U67 3;  1KDA A;  3KJO A;  1U4R A;  4KY6 A;  1PTO H;  3HOZ G;  3PF4 A;  1SDF A;  5I2Y A;  3P7J A;  1BVS A;  3H3V C;  4YCV A;  1STB A;  1LTT D;  3VR2 A;  1PRT D;  1XPU A;  4X6A H;  1D1I A;  3P20 A;  1ASY A;  3QIA A;  2YTX A;  1GJX A;  1PH5 A;  4RFB A;  1IBK L;  1KQS A;  1ZEQ X;  4B08 A;  3AU7 A;  1B50 A;  4DR4 L;  2OWO A;  5M5Y B;  4B3R L;  4LNQ A;  3H94 A;  2EQS A;  4CKC A;  5IYB G;  1MBY A;  4OGQ C;  1R9T H;  4XQJ A;  1AZP A;  2JK8 A;  2E75 C;  1NMG A;  1YNJ D;  4CDF C;  4S3S A;  2HD3 A;  2N8N A;  4ZLT F;  3F2U A;  1WVL A;  1Y1W G;  4H44 C;  3DWA A;  2RDG A;  1CK1 A;  1GUG A;  2PZT A;  3R93 A;  4B3S Q;  4LMQ D;  2A73 B;  5M5X H;  4A93 H;  3UDF A;  1TKW B;  1EQT A;  4ZCK A;  4MTK A;  3SEB A;  1K83 H;  2K04 A;  3CAM A;  2R93 G;  1MHW C;  1CQF A;  4ABN A;  5JEA J;  2JSO A;  4WFN 3;  1BOS A;  4OO1 G;  3K0X A;  2CQA A;  1SEB D;  4HN7 A;  2PMZ B;  1JOK A;  3CCU A;  2A74 C;  1MSH A;  2D62 A;  3HKZ E;  3QG1 A;  5LMN L;  3CQZ B;  3T56 B;  1E2Z A;  2Z0S A;  3GV3 A;  1NCV A;  4NP5 A;  4FF1 A;  1CZG A;  2F0P A;  3OW2 A;  4K6L A;  3J81 j;  2I07 B;  4R4O A;  4NXM L;  1DD2 A;  1YEZ A;  4DAP A;  3H91 A;  3K7U C;  4DR3 Q;  1TS4 A;  3DEP A;  3I2Z A;  4ZKB B;  4FF4 A;  4DR6 L;  2KHS A;  1CA6 A;  2Z6K C;  3NWT A;  5FO9 B;  4HJ9 A;  2HT1 A;  2LFN A;  3WOF A;  3VA7 A;  3J80 L;  2PYK A;  3C46 A;  1L0W A;  4A3F G;  3DM3 A;  4LFC L;  1NTG A;  4A3I B;  1SRO A;  1BCP C;  3S17 H;  4N8F A;  2SNM A;  1EWC A;  4A3K H;  3I70 A;  4C3H B;  2YU9 B;  2MFI A;  2HHH Q;  3S1N B;  2VQE Q;  5ELO A;  1I4X A;  4P72 A;  3CU7 A;  3CQZ H;  4OIK A;  5JPN C;  1XMO L;  3DLL A;  2R7F A;  4KK7 A;  3NHH A;  4RHR A;  3F2B A;  1WTW A;  2LXK A;  4IZ8 A;  1JWS D;  4F87 A;  1BF4 A;  2LY7 A;  2WFW A;  4DPG A;  5ELE A;  4QIW B;  2KUM A;  4IUR A;  4F7X A;  3A7A B;  1TS2 A;  3FKI H;  4HAE A;  3IAY A;  2F0U A;  1TWH H;  2K14 A;  2BDN A;  1BR9 A;  1STE A;  1W6K A;  1ILQ A;  1TWC B;  2PQE A;  2KA7 A;  1SLJ A;  5KGU A;  1R4P B;  1A6X A;  4LUV A;  2VXW A;  2EXZ A;  3PSI A;  5KND A;  1RTO A;  3CPW A;  4I7Z C;  4JOI C;  3NSW A;  1IW7 D;  5C4J B;  1X3Q A;  4A3D H;  4JI6 L;  4LF4 Q;  1ICF B;  3T51 B;  2JE6 I;  3D3R A;  3RUZ A;  3K5O A;  5IP9 G;  4WOR A;  2BH2 A;  1BKB A;  4DR5 L;  2UUA Q;  1L0X B;  1IL8 A;  1UE5 A;  5C0X I;  1Z6H A;  2QW7 A;  5IP7 H;  3JAM L;  2M00 A;  5KYL A;  4I7A A;  1JC7 A;  1CKM A;  4BY1 B;  3RN2 A;  3HOX G;  1PHJ A;  3TEH B;  1SE2 A;  3E9H A;  4K5V A;  2H1E A;  3LWU A;  4GOP A;  3CC4 A;  2A19 A;  3GP7 A;  2K7V A;  1UEB A;  1Y8O B;  3C3L A;  1LT5 D;  2VL6 A;  5IGB A;  1O7Z A;  1O78 A;  3VA5 A;  3SHL A;  4PV1 C;  2K03 A;  1KLU D;  4DUZ Q;  1Y8P B;  3T1Y L;  4UHV A;  2N78 A;  1SYC A;  1EY8 A;  5LMU Q;  1Y1V H;  4K2L A;  1EY4 A;  3M3Y B;  3U9O A;  3BZK A;  1FL0 A;  5BN3 A;  4AH6 A;  1E3P A;  2K5N A;  1HTP A;  1N36 Q;  1A0I A;  1CTM A;  3NBH B;  1Y8N B;  1N36 L;  3DWP A;  5ELB A;  5JVH 3;  2EYP A;  3HOU H;  2F0L A;  4DR4 Q;  1PFN A;  4G7O C;  3HEJ A;  5BR8 L;  1W3S A;  4JBK A;  1TWF H;  3HKZ B;  5HGT A;  4QQB X;  5M3F B;  3K59 A;  1F9P A;  1GUS A;  4GKJ Q;  4DV5 Q;  1O7I A;  3MXU A;  3HRZ C;  2I0Q A;  4FO2 A;  1ENA A;  3J7Z C;  3R2I A;  2WIN B;  1NSN S;  4LF9 Q;  5M5W H;  2CCZ A;  4DK3 C;  1KAW A;  4ALP A;  1FNW A;  3HOZ H;  4ZKC B;  2UXD Q;  2DGY A;  1B4O A;  1RD9 D;  1C48 A;  2QEJ C;  5CV4 A;  4AYB E;  1IKL A;  4PZ8 A;  3UE1 A;  1SXT A;  5I9O A;  2HDL A;  3M3Y H;  1RIP A;  1A3T A;  2D5D A;  3GTL H;  3OTO L;  1ASZ A;  3VR6 A;  2RSN A;  4PG3 A;  3OTO Q;  3HG9 A;  3S2D B;  4JYA L;  4F8M A;  1SNC A;  1TWC H;  1HUM A;  3A74 A;  4CJ2 C;  1TWA H;  1GHJ A;  2F0E A;  3NBI A;  1D5M C;  3RMH A;  1A63 A;  1L1O A;  4A3G B;  3TQY A;  2K33 A;  2PNH A;  1WTQ A;  4LF7 L;  5FLX L;  4A3G G;  5DEH A;  1DXM A;  1TWF B;  4HJ5 A;  4X65 L;  2J7Z A;  2ZXP A;  2UXC Q;  2HIX A;  2DY7 A;  1JWM D;  1X3F A;  4HIO A;  1GO3 E;  3R3O A;  5AJ3 L;  2OTL A;  1E24 A;  2PQA B;  4OX9 L;  4JI0 Q;  1PH4 A;  3S9W A;  4A3M G;  4N9P A;  1HA5 A;  4A3E H;  2EJF C;  4N8X 1;  2RCF A;  3MXN B;  2XIW A;  4NMZ A;  4NKL A;  4O2D A;  4XYQ A;  1E0B A;  1TU2 B;  2NZ1 D;  1G6Z A;  3VYS A;  3BDO A;  3CME A;  1UE7 A;  1EL0 A;  4K6D A;  3J81 c;  2YTY A;  4A3C G;  1A62 A;  4QGU A;  4X3K A;  3RLO A;  3CCS A;  2YU9 H;  3RD4 A;  1FNV A;  4KHP Q;  3CCQ A;  5C44 H;  4WRD A;  1HH2 P;  3C1F A;  1TWA B;  1XXG A;  2QKI C;  3MTS A;  5JJZ A;  4L6T B;  1HR0 W;  3ND8 A;  1O7Y A;  1WD1 A;  4KHZ A;  1L0Y B;  5LL6 X;  1XTC D;  1QVF A;  2DN8 A;  4A3K G;  4DV4 Q;  1Y14 B;  4KJN A;  2R7Z G;  4DFA A;  1XNQ Q;  2K5W A;  1QNK A;  3PUY A;  4A76 A;  4OON A;  4H7B A;  2VB2 X;  2F4V Q;  2F0V A;  2WV6 D;  5EPJ A;  1YNN C;  2ZXR A;  1F2Y A;  1LYL A;  1EZ8 A;  1SMX A;  1UUP A;  2K75 A;  2ZJQ A;  2B63 G;  2KEN A;  2KCN A;  3PV0 A;  1JOO A;  2G5D A;  1N33 L;  3IFD A;  1XMQ L;  1YZ6 A;  1EWH A;  5IYD H;  1AFP A;  1NE3 A;  3GTK B;  3KF6 B;  3N52 A;  4IUQ A;  2HCI A;  2F03 A;  2L1B A;  2UU9 L;  3U4V A;  5EJW A;  5GRO A;  4QUC A;  4IN3 A;  3I4N B;  4JCV E;  4EQP A;  2NVT B;  2E2J H;  4DAY B;  1PVO A;  1BCP F;  5IOD A;  2R7D A;  4A93 G;  5JJK A;  2UXB L;  2F0T A;  3MVV A;  4OHJ A;  1EEF D;  3OMC A;  2ZT9 C;  4C3I B;  2KQ3 A;  2NZH A;  1LTI D;  2R93 H;  1EQR A;  1XPR A;  3K80 C;  4WJ3 M;  1JWU D;  4LFA Q;  2E2I B;  1Y69 U;  1VQG A;  5IT9 L;  1EY6 A;  1XYI A;  4LF4 L;  1I50 H;  4IOC A;  1U4P A;  4A3F B;  1MSG A;  1NY4 A;  3JAM E;  3OWF A;  1A2T A;  1VQF A;  2UUC Q;  2EE1 A;  3HOY B;  1SJH D;  2F0J A;  3O13 A;  1PRT C;  4IJL A;  4DR5 Q;  4LJZ C;  5IY0 A;  5JEA H;  1EEI D;  2ID0 A;  3HFZ B;  1SMY D;  2F0S A;  1X55 A;  3CC2 A;  1UE6 A;  2OT2 A;  3STB D;  3PUZ A;  4IAL A;  3TP8 A;  2E2H H;  5NUC A;  2LSS A;  4OX9 Q;  2F0F A;  4ID6 A;  3K57 A;  3GTL B;  4MNO A;  2BA1 A;  2KHJ A;  2XTI A;  3CC7 A;  2H4O A;  3Q22 A;  2N55 A;  5E4X A;  1W2B A;  1C4Q A;  2AUJ D;  4LUZ A;  4B9X A;  1VQK A;  1EY9 A;  1S40 A;  1SMY C;  1H9S A;  2K32 A;  2BDO A;  4GN5 A;  3PMF A;  1TII D;  1FVI A;  2IX1 A;  1FNU A;  2RDF A;  4TKO B;  4TRD A;  1K3B C;  3BYY B;  1IHZ A;  2B2W A;  4WJW A;  2Z9H A;  2LKV A;  4JG2 A;  2JEB I;  5A2Q L;  1PH6 A;  2VQF L;  5IGC A;  2EYH A;  2IX3 A;  4RKL A;  4IUN A;  1V9P A;  1ZKO A;  4JI3 L;  4B3T Q;  2CW0 D;  4XT3 B;  3KF8 A;  1GM5 A;  4A3G H;  3C2P A;  3FMC A;  2LS0 1;  3D4R A;  1YHQ A;  4R4I A;  3QJY A;  3FDT A;  1LTA D;  4ZK9 B;  2EYO A;  1GXD C;  1TS3 A;  1Y1W H;  2D0P A;  4IUT A;  4GOP C;  4PZ7 A;  1ET6 A;  4HSP A;  2B2Y C;  3IL8 A;  4U68 A;  2VUM B;  3T1H Q;  1YJN A;  4BY7 H;  1UNS A;  3FP9 A;  3P1H A;  4CDC C;  4X65 Q;  2B29 A;  3EJI A;  3S1M B;  1GUW A;  3EIV A;  2O5J C;  3SDZ A;  3OMG A;  1YIJ A;  2BE5 D;  2G9H D;  4ZQ3 A;  1EY5 A;  1AEX A;  1VQ6 A;  1I5F A;  3QWN A;  1N32 L;  2RA4 A;  1I6H B;  1MIU A;  1HTL D;  4YCU A;  1PTO B;  4JC0 A;  1KNE A;  4X62 L;  3BVZ A;  1F2M A;  1RHP A;  1KRS A;  4AYB G;  2IT1 A;  1TY0 A;  2WB1 B;  1LAB A;  2EJM A;  2IPK D;  2F0G A;  1LUZ A;  2RSO A;  2B2Y A;  5EKL A;  1QE6 A;  4Q0F A;  2UXB Q;  5KNB A;  4OWX B;  3NEM A;  1RTN A;  1EFW A;  4LF8 L;  4P2C B;  1HHV A;  3HOU B;  2CKZ B;  1AE2 A;  2KJX A;  2QDL A;  1EWI A;  2G9D A;  5ELD A;  1J5E L;  1QCB D;  1PH9 A;  3A54 A;  5IGD A;  4K8J A;  1J5E Q;  2XGT A;  4RH6 A;  2F0N A;  3K5N A;  1WTH A;  4H13 C;  1IXR A;  1X3G A;  3E6Z X;  2L12 A;  4X64 Q;  3KLS X;  3K5M A;  4JI4 Q;  5C3X A;  2EYJ A;  1SND A;  5DAU A;  3KK7 A;  1MJC A;  5E4W C;  4JVZ A;  5M3F G;  1F9S A;  1S3O A;  4B9W A;  4N9T A;  1SN8 A;  4GNX A;  3T16 A;  2HQE A;  1X32 A;  3GTO H;  4QB4 A;  5IWA Q;  2KBN A;  1A3U A;  4V19 0;  4C2M B;  3FRP B;  3LX0 A;  5C0X G;  2B8G A;  1KHI A;  3V2T A;  3OOC A;  1II3 A;  3I90 A;  5JJL A;  3M4Q A;  4EQ5 A;  3VYT A;  2NVQ B;  1VQO A;  2KCC A;  3K6O A;  1AN8 A;  3FHW A;  4E6I A;  3E9I A;  4K2K A;  1WFQ A;  4LWC A;  1VQP A;  3GTK H;  1S5D D;  1WYD A;  2YTV A;  4HCS A;  3L2P A;  3NEL A;  1VQ9 A;  1H9S B;  5FJ8 H;  3PIP 3;  1HNZ L;  3TZU A;  1PLF A;  2KEC A;  3RLN A;  4IPH A;  3TME A;  2XWB B;  3P75 A;  2NVY H;  3S16 B;  1BBU A;  2C35 B;  5AFW A;  3ITP A;  4MIU A;  1PA6 A;  1S72 A;  1KAB A;  2Q8R E;  4DKA C;  3S14 B;  4FF2 A;  3HOY G;  3FEW X;  4IUV A;  1KRT A;  2NN6 H;  4ME5 A;  1J9O A;  4POG A;  4RWS C;  5D65 A;  2Q2U A;  4HJ7 A;  4HJA A;  2Q2T A;  2A68 C;  3HOX B;  1M4V A;  4UP8 A;  4NXN L;  3H3V I;  4TVA B;  4CJ0 B;  1LTS D;  3BDC A;  4PMW A;  3KLR A;  4CBV A;  2F3I A;  5IT9 E;  1D8L A;  2O5I C;  3QOL A;  1JMC A;  5C4X B;  3FKI B;  2F4V L;  2NB0 A;  1UWV A;  2F0D A;  4X3T A;  2JA8 H;  4DV6 Q;  4EVO A;  2MPM A;  3G7L A;  2BH8 A;  1AE3 A;  4GZY C;  2WAQ B;  4P71 A;  2FXQ A;  2B2U A;  5DNF A;  1N33 Q;  5FJ8 G;  1I4H A;  3S1Q H;  1B8A A;  1GVP A;  5EBD A;  4JI1 Q;  4DV0 Q;  2EDG A;  4GNX B;  4DV3 L;  3M7N A;  1YJ9 A;  1VDZ A;  4PMC A;  1NUC A;  3MFY A;  4DXG A;  3K7A H;  3OSO A;  1HPC A;  3AMU A;  1JT8 A;  1Y1V G;  2EIF A;  3OWE B;  3NQI A;  3NWS A;  1IZ6 A;  4X3S A;  4BA1 I;  3S17 B;  3I91 A;  3I4L A;  2R7Z B;  3RNU A;  4A3E G;  4KMU C;  2HQL A;  4R8I A;  4YHH Q;  3J81 E;  1YNX A;  3C1E A;  4EQO A;  3J7A 5;  2AHO B;  5DM7 3;  1ENC A;  5CV9 A;  3DXJ C;  3A55 A;  1EOV A;  1HZA A;  1STH A;  4GLA C;  4OWW B;  1JE5 A;  1H9K A;  3OHX C;  4R8N A;  1GUN A;  1PXU A;  4OEL B;  3Q24 A;  4X64 L;  4H0L C;  1A2U A;  1CKN B;  1U9R A;  5C3E G;  2QIL A;  3KDF B;  2NN6 G;  4FVM A;  1CZW A;  5J39 A;  1VMC A;  4A75 A;  3W3A A;  2VUM H;  2RHS B;  2GA4 B;  5CBA E;  1H9R A;  3GTP H;  4J8Q A;  2PW5 A;  2HHH L;  2V1C C;  4K14 A;  3MWY W;  2MJ8 A;  1ET9 A;  4C3J H;  2ZJR A;  2XRQ D;  1V1P B;  2SEB D;  3KOJ A;  5GAG C;  3L0O A;  2VB3 X;  1R4Q B;  5C0X J;  2AQ3 B;  4B3M L;  5C3E B;  4C3I G;  3ER0 A;  3GQB A;  4KY7 A;  4GKK Q;  1BUV T;  2NTT A;  1JJ2 A;  1QVC A;  2Z4H A;  3S1R B;  3RZD H;  3BZD B;  3K5L A;  1S4Z A;  4YIJ A;  3UE0 A;  1PTO C;  1SJE D;  2L9H A;  1VQM A;  4HTH A;  4HED A;  1STA A;  1FD7 D;  1ZYR C;  1YBY A;  1SAP A;  1STG A;  5EQ0 A;  1B53 A;  1QNU A;  5EBC A;  2PZU A;  1WCM G;  1LO5 D;  1P8L A;  3K81 C;  4DV2 L;  3GTG B;  4POF A;  1VQI A;  1H9M A;  2R92 H;  4DV2 Q;  3PCO B;  2ZXO A;  1LTL A;  4A3M B;  1I4Q A;  4G7H C;  1CFM A;  3RZO H;  2VNU D;  1PZK D;  5C4X G;  5EKI A;  3J7A F;  4J6H A;  4BBR G;  1MKH A;  2NWG A;  4GNX C;  1X3P A;  1ML0 D;  4A3M H;  4BBS B;  2JXM B;  4CGY B;  3I72 A;  1TXY A;  1EQQ A;  4PMB A;  4DU9 A;  5EKK A;  1STY A;  1KC8 C;  5I6W A;  4JI8 Q;  3URY A;  1SYF A;  1O80 A;  3PUV A;  5CR3 A;  4UAI A;  1V8Q A;  4LFB L;  2JA8 B;  1D5Z C;  5E1F A;  1EUJ A;  1X3E A;  3CKI B;  1I4P A;  1WD0 A;  1TQO A;  4UP9 A;  5IYC G;  2WAC A;  3CCM A;  1WOC A;  1G2S A;  1FYC A;  2SNS A;  3QR8 A;  4L8J A;  4R4T A;  4CDD C;  4RMF A;  4YHH L;  4JYA Q;  3I4M G;  5C3W A;  1JOR A;  4XYO A;  5LMU L;  1EFI D;  3IKJ A;  4BY7 G;  1U4L A;  2PW7 A;  4DR6 Q;  1CHP D;  1FGB D;  2K1B A;  2K28 A;  2F1M A;  4RGT A;  3MZ5 A;  4F88 A;  1PFB A;  3ULJ A;  3MXP A;  4FXK C;  2RQX A;  1RKN A;  2IJ0 A;  4ZUJ A;  1V1P A;  1VQ7 A;  5J22 A;  2KVM A;  1TVX A;  1CM9 A;  4RG1 A;  5M3M B;  1IBL Q;  1SE3 A;  4PNY A;  1VQA A;  1EU3 A;  4KV6 A;  1VF7 A;  1VF5 C;  1P16 A;  4CHT B;  5C4Z A;  1QZG A;  2JYO A;  3F1Z A;  4L5R C;  2OQK A;  5J1Z A;  3R8B A;  3HZX A;  2CH4 W;  1AW7 A;  3F2D A;  3G6J B;  1Q90 A;  1FR3 A;  2K05 A;  2E2D C;  4AIM A;  2XWJ B;  2X6G A;  1H95 A;  4DV5 L;  2MP1 A;  1TT2 A;  2XVS A;  2HUG A;  3I4O A;  3U4Z A;  2E2H B;  2EPB A;  3VDY A;  2NBF A;  4DV3 Q;  4DR2 Q;  4FNF A;  1XPO A;  1YHB A;  3HOY H;  3CW2 C;  3ERQ A;  3CD6 A;  1B44 D;  3GV6 A;  2EY5 A;  2JA6 B;  5F2D A;  1DYQ A;  1MI2 A;  1MGS A;  2I5M X;  3MA2 B;  3QO2 A;  2H5X A;  1B1Z A;  1L2F A;  5HUR A;  3PIP A;  4XQQ A;  3G48 A;  4FP5 D;  4HJ8 A;  1CSQ A;  1X56 A;  1YNJ C;  3ZJY C;  2EZV A;  4Y52 H;  4KKU A;  1A3V A;  5COR A;  4JI7 Q;  1LTB D;  4UPA A;  1HFG A;  2SDF A;  1DJR D;  1QVG A;  3FPU B;  4ZRZ A;  1B3A A;  1E1T A;  1VQ4 A;  5COY A;  1DOM A;  2YYZ A;  1PH7 A;  3AFQ A;  3HKZ G;  4APV A;  1W6J A;  3RLF A;  1HXY D;  4Y7N B;  2MHV A;  1EIH A;  2B3G A;  4ZUI A;  1U4M A;  3VYR A;  5DLQ E;  5AJ3 Q;  3S1R H;  2FMM A;  2EVB A;  3ERS X;  4C1N I;  5JAV A;  5IWA L;  3ND9 A;  5GAE C;  3DM1 A;  1KNA A;  1CHQ D;  1SNM A;  1NBW A;  3T53 B;  3CRK C;  1T9H A;  4BBS H;  1GD7 A;  4LF9 L;  1E2W A;  3I4M H;  1QUQ A;  3VR5 A;  1KTK A;  2AUK A;  2BE5 C;  3MXG A;  4C3J B;  3WDN A;  4A93 B;  5CV5 A;  4B3M Q;  3SK4 A;  3EFX D;  4QY7 A;  4IFD G;  1SNQ A;  4C2M H;  3GD7 A;  5BN5 A;  1VQC A;  5JPM C;  5FLX c;  4GOP B;  3NBH A;  5A35 A;  3EBE A;  1YJW A;  3I4N G;  4A3J G;  1H9J A;  3VR4 A;  4HIK A;  3K0Y A;  1HNX L;  3MHB A;  3SVM A;  1LT3 D;  1Q12 A;  1M90 C;  4R1J A;  4X66 Q;  4IFD H;  2IL8 A;  4PQX A;  3TBI B;  4JBJ A;  4KY5 A;  3A8I E;  3Q0A A;  2MNA A;  2Z6B A;  1PYS B;  1Q1B A;  3TDQ A;  2AMC B;  1X9N A;  4OEM B;  3K8A A;  4IO9 A;  1CQV A;  4LF7 Q;  1WTP A;  3TP5 A;  2B2T C;  2A6E C;  1X54 A;  1XNQ L;  3HKS A;  2JA6 H;  2CWA A;  3R2T A;  1NR2 A;  1SRU A;  2DJG C;  1I94 Q;  1UAP A;  1IBL L;  2Q8I B;  3SK8 A;  1I6V C;  2K5H A;  1HJP A;  2ZTC A;  3M85 A;  2F4I A;  1JIC A;  3WOE A; 
#chains in the Genus database with same CATH homology
 2AWN A;  2CKZ B;  5IYC H;  1AE2 A;  1EWI A;  3KDF A;  1J5E L;  4A3K H;  2K4K A;  1PH9 A;  4GKJ L;  2JEA I;  2ZTE A;  5LMN Q;  1J5E Q;  2MFI A;  2HHH Q;  2XGT A;  2IX0 A;  4AQY L;  2VQE Q;  1XNR Q;  5ELO A;  4P72 A;  3HOV G;  1SFO H;  3CQZ H;  1XMO L;  1K73 C;  2VW9 A;  4J15 A;  3DLL A;  1IXR A;  1X3G A;  4NXM Q;  2R7F A;  3S1N H;  1XTD A;  3ULP A;  1G51 A;  3F2B A;  2LXK A;  1AH9 A;  4DK6 C;  4IFD I;  4JI4 L;  1YIT A;  1HZB A;  1VQE A;  4X64 Q;  1VQJ A;  2E8G A;  4WJ4 A;  2WFW A;  4DPG A;  3CCJ A;  4JI4 Q;  4JBW A;  1I3Q H;  4DV7 L;  3FKI H;  1KL9 A;  2D0O A;  2VZA A;  1MJC A;  4JV5 L;  5M3F G;  1TWH H;  1OXX K;  1S3O A;  2K14 A;  1PYB A;  3IRB A;  2NN6 I;  4KLK A;  4GNX A;  1SN8 A;  2EXD A;  4MTN A;  2PMZ E;  2KCM A;  5HGQ A;  1XJV A;  4JV5 Q;  3S2D H;  1SLJ A;  3L7Z C;  3GTO H;  5IWA Q;  4P73 A;  2KBN A;  5ELN A;  4L5Q A;  4LUV A;  2N49 A;  5C0X G;  2WAQ E;  1KHI A;  4GLV B;  3PSI A;  3PO3 H;  5JJL A;  3M4Q A;  4EQ5 A;  1IBM Q;  2GN5 A;  5K36 G;  3CPW A;  1XNR L;  1VQO A;  4JOI C;  3FHW A;  4NB3 A;  3E9I A;  1E22 A;  2GVB A;  4A3J H;  4LF5 L;  2BH2 A;  1PH1 A;  4A3D H;  3GTK H;  1WFQ A;  4LWC A;  1VQP A;  1YI2 A;  4JI6 L;  4LF4 Q;  1WYD A;  2JE6 I;  2YTV A;  4DR2 L;  4JBM A;  4YWM A;  3W1B A;  5IP9 G;  5C4J H;  2UUA L;  1A8V A;  3PF5 A;  2CWP A;  2WB1 E;  3L2P A;  1HR0 L;  1BKB A;  3CXC A;  3NEL A;  2JA9 A;  4DR5 L;  3UDG A;  1VQ9 A;  2UUA Q;  3GTG H;  5FJ8 H;  5JJI A;  2IY5 B;  2UXC L;  2RCN A;  2MO0 A;  1UE5 A;  1G6P A;  1HNZ L;  4ME3 A;  5C0X I;  1K8G A;  3RLN A;  4DR7 L;  4IPH A;  4BY1 G;  2PI2 A;  3OYY A;  3Q8D A;  5IP7 H;  4DR7 Q;  2ATW A;  3CCE A;  2NVY H;  3KJP A;  4A3D G;  5H1S E;  1BBU A;  2C35 B;  4OWT B;  2QEX A;  1PA6 A;  3B6Y A;  3TS0 A;  3U58 A;  1CKM A;  1KD1 C;  1S72 A;  2Y0S E;  4DKA C;  1LM0 A;  3HOY G;  4LFB Q;  5M3F H;  1KRT A;  3RN2 A;  1QZH A;  4EX5 A;  3HOX G;  1PHJ A;  4P74 A;  1N34 Q;  4POG A;  1J6Q A;  4H02 A;  2Q2U A;  3TEH B;  4HJ7 A;  5HY6 A;  4HJA A;  1Q86 C;  1PV4 A;  2Q2T A;  3E9H A;  1M1K C;  4QL5 A;  3HOW H;  4B3R Q;  4UP8 A;  3J80 i;  4NXN L;  4JI5 L;  2ZM6 Q;  3S14 H;  4GOP A;  3H0G G;  3H3V I;  4TVA B;  3CC4 A;  1Q46 A;  1YHA A;  4QIW E;  3A5U A;  2B63 H;  2A19 A;  4PMW A;  4YWL A;  1UEB A;  1B70 B;  4A4I A;  2F3I A;  3KFU A;  4YCW A;  2VL6 A;  1VQL A;  1D8L A;  3HOV H;  1JMC A;  2E5L Q;  1Q7Y C;  2VQF Q;  1HNZ Q;  1SE8 A;  4DUZ Q;  2F4V L;  3T1Y L;  1UWV A;  1HZC A;  2N78 A;  3AQQ A;  2LXJ A;  3NEN A;  5LMU Q;  4LW1 A;  1Y1V H;  2JA8 H;  2OQ0 A;  1QUQ B;  4DV6 Q;  3BZK A;  3FKI G;  2BH8 A;  1AE3 A;  4B3T L;  4P71 A;  2JA7 H;  2FXQ A;  1FL0 A;  2UUB Q;  4JI1 L;  4DV0 L;  1N33 Q;  5FJ8 G;  4A3F H;  1JB7 A;  1HNW L;  1PFS A;  1B8A A;  1GVP A;  3S1Q H;  4YY3 L;  4AH6 A;  4JI1 Q;  4DV0 Q;  1E3P A;  5M5Y H;  4JI0 L;  2K5N A;  3LGJ A;  2OTJ A;  1N36 Q;  4GNX B;  1A0I A;  2IHF A;  4DV3 L;  3NBH B;  1YJ9 A;  2E2I H;  3M7N A;  4A3B H;  1N36 L;  4BBS G;  4K0K Q;  3K7A H;  1YVC A;  4OXP A;  1VCI A;  1JT8 A;  1Y1V G;  2EIF A;  2JA8 G;  3TRZ A;  3HOU H;  1IZ6 A;  3GTM H;  4BA1 I;  4DR4 Q;  1N8R C;  4LFC Q;  5BR8 L;  1W3S A;  3JAM i;  4JBK A;  3PO3 G;  1TWF H;  2R92 G;  4C3H H;  3RNU A;  4IOA A;  4DUY L;  4A3E G;  4P75 A;  1JJC B;  3CPF A;  1PH2 A;  1Q81 C;  1PH8 A;  1HNX Q;  2HQL A;  4QQB X;  1K3R A;  4YHH Q;  1N9W A;  1YNX A;  3H15 A;  2QA4 A;  4GKJ Q;  3H0G H;  1D7Q A;  3UDX A;  4JI7 L;  3J7A 5;  1Z47 A;  1O7I A;  4DV5 Q;  4LF6 Q;  2AHO B;  2K50 A;  2JA6 G;  5JEA G;  4X66 L;  4JI3 Q;  3I7F A;  2I0Q A;  1EOV A;  1HZA A;  3W5O A;  4GLA C;  3J7Z C;  4BY1 H;  4OWW B;  1JE5 A;  1X65 A;  4YWK A;  1K0R A;  4IPG A;  2R6G A;  4YY3 Q;  5M5W H;  3CCR A;  5LMN W;  4LF9 Q;  3EN2 A;  3M9B A;  3KF8 B;  1CKO A;  1KAW A;  4X64 L;  4ALP A;  5E7N A;  2CCZ A;  1I6H H;  2UUC L;  3M4P A;  2UU9 Q;  4JI2 L;  2VS1 A;  1CKN B;  3HOZ H;  1E7Z A;  2UXD L;  1HZ9 A;  2L15 A;  4LUO A;  3U50 C;  5C3E G;  3KDF B;  2UXD Q;  2DGY A;  2NN6 G;  4AYB E;  3E0E A;  2GVA A;  4A75 A;  4PZ8 A;  2K52 A;  3UE1 A;  1Q82 C;  1FJG L;  2VUM H;  2RHS B;  3PO2 H;  3PIO A;  3M3Y H;  1RIP A;  3GTP H;  3GTL H;  3OTO L;  1ASZ A;  4XTC S;  3HOW G;  3S1M H;  2NZO A;  2AKW B;  4PG3 A;  2HHH L;  1EIF A;  3OTO Q;  2QGQ A;  4JYA L;  2R7Z H;  2V1C C;  4FDB A;  4IPD A;  1TWC H;  3A74 A;  3GDE A;  1TWA H;  4QJF A;  2OCE A;  4IPC A;  1IBM L;  1A63 A;  1L1O A;  4C3J H;  5IYB H;  2RF4 A;  3KOJ A;  2HIV A;  3TQY A;  5GAG C;  2ZJR A;  2VUM G;  3L0O A;  4DR3 L;  1OXS C;  5C0X J;  1Q1E A;  4B3M L;  2PNH A;  4LF7 L;  2NVX H;  3T1H L;  3ER0 A;  1G29 1;  1WJJ A;  2RHQ B;  4A3G G;  1CUK A;  4HJ5 A;  4GKK Q;  4X65 L;  1WI5 A;  1JJ2 A;  4DV7 Q;  1QVC A;  5IYD G;  3PUX A;  4HIM A;  3RZD H;  2UXC Q;  3H3V H;  2HIX A;  4A3L H;  1X3F A;  4LF8 Q;  4HIO A;  4A3B G;  3RN5 A;  3UE0 A;  1FJG Q;  1GO3 E;  1VQM A;  1KIX A;  3JC6 6;  4IFD J;  5AJ3 L;  4A3C H;  2JA5 H;  1YBY A;  4A3I H;  1OXU A;  2OTL A;  1E24 A;  2PQA B;  1VQ5 A;  4JI0 Q;  4OX9 L;  1JJG A;  2KCT A;  4R4Q A;  2DUD A;  1PH4 A;  3RR5 A;  5C44 G;  3PGZ A;  3I56 A;  4A3M G;  1WCM G;  1P8L A;  3K81 C;  4DV2 L;  4POF A;  4BBR H;  1VQI A;  4A3E H;  1N34 L;  4JI5 Q;  3TRE A;  4O2D A;  3MXN B;  4DK3 C;  3PCO B;  4Y7N H;  4DV2 Q;  2R92 H;  3J80 c;  1LTL A;  4LF5 Q;  4NPS A;  4A3I G;  3CME A;  2JA5 G;  1UE7 A;  5IE8 A;  1VS0 A;  5BR8 Q;  3RZO H;  2VNU D;  3J81 c;  2F52 A;  2YTY A;  4DAM A;  2I5H A;  1A62 A;  1VQD A;  2ASB A;  4QGU A;  4A3C G;  5C4X G;  3RLO A;  3CCS A;  2YU9 H;  4KHP Q;  4BBR G;  3CCQ A;  1MKH A;  4GNX C;  5GQO A;  4OO1 I;  3T1Y Q;  5C44 H;  4A3M H;  3CCV A;  3JAM c;  3D0F A;  3F8T A;  2CFM A;  3CCL A;  1L1O B;  1HH2 P;  3GTQ H;  4AQY Q;  1TXY A;  4LF6 L;  1EQQ A;  1XMQ Q;  4GN3 B;  5IP9 H;  4C3I H;  1KC8 C;  1HR0 W;  4BA2 I;  3KLW A;  4JI8 Q;  4B3S L;  4KHZ A;  1NJI C;  5C4X H;  3AYH B;  3PUV A;  1VQ8 A;  1DGS A;  4LFB L;  2A1A A;  4UP7 A;  1VQB A;  2Y0S G;  4JI2 Q;  1QVF A;  2A8V A;  3D31 A;  4X62 Q;  1EUJ A;  2VY3 A;  1X3E A;  4DV4 Q;  4A3K G;  1VQN A;  1Y14 B;  3SGI A;  3M4O H;  3MEF A;  3CF5 A;  4UP9 A;  5IYC G;  2R7Z G;  1XNQ Q;  1NMF A;  3PUY A;  4A76 A;  3CCM A;  1WOC A;  4OON A;  5EAY A;  1B7Y B;  2ZTD A;  4R4T A;  4DV1 L;  4UY8 C;  1GKH A;  3G71 A;  2I5L X;  2ALY B;  2IHE A;  2F4V Q;  4KHP L;  4RMF A;  1OTC A;  1BBW A;  1VQH A;  4YHH L;  3I4M G;  4JYA Q;  4JOI A;  4L5T A;  1LYL A;  1SMX A;  2VQE L;  2K75 A;  4DUZ L;  2ZJQ A;  2B63 G;  1OXT A;  2KEN A;  4LFA L;  3BJU A;  3PV0 A;  5LMU L;  1N33 L;  2YV5 A;  1XMQ L;  1YZ6 A;  4XIG S;  1U5K A;  5IYD H;  3I4N H;  1K8A C;  4BY7 G;  1NE3 A;  3KF6 B;  3A0J A;  4JI8 L;  1IYJ B;  3TS2 A;  4DR6 Q;  1N32 Q;  3BZC A;  1HNW Q;  4GLX A;  4DR1 L;  4BXX H;  3KF6 A;  4GKK L;  4K0K L;  3ULJ A;  4DR1 Q;  2AWO A;  3U4V A;  1X6O A;  2UU9 L;  3G6E A;  3PUW A;  5GRO A;  3ULL A;  3UDI A;  3AFP A;  1VQ7 A;  2Z6K A;  4JCV E;  4R4C A;  2E2J H;  4DAY B;  4NXN Q;  4RG1 A;  1Q8K A;  1PVO A;  5J3B A;  1IBL Q;  1VQA A;  2ZJP A;  2R7D A;  4A93 G;  4HID A;  5JJK A;  2UXB L;  1P16 A;  1RL2 A;  2MQH A;  2WAQ G;  1QZG A;  1CKN A;  3F1Z A;  2JJQ A;  4L5R C;  2R93 H;  2NZH A;  1UE1 A;  3S15 H;  4DUY Q;  2OQK A;  1EQR A;  5M3M H;  3F2D A;  1XPR A;  3K80 C;  3HOU G;  4WJ3 M;  1C9O A;  2WP8 J;  4AIM A;  3A5Z B;  1IL2 A;  1E1O A;  4IJH A;  4LFA Q;  1OXV A;  1H95 A;  1VQG A;  4DV5 L;  1L1O C;  4A3L G;  5IT9 c;  5C3E H;  1IBK Q;  3F2C A;  1XMO Q;  4LF4 L;  3I4O A;  3U4Z A;  2UUB L;  2WB1 G;  1I50 H;  5FLM G;  4IOC A;  3VDY A;  1NY4 A;  2PQA A;  1VQF A;  2UUC Q;  5IP7 G;  1HR0 Q;  4DV3 Q;  4DR2 Q;  4L5S A;  3HOX H;  1XPO A;  1YHB A;  2E5L L;  4IJL A;  3HOY H;  5GAH C;  3CW2 C;  3W1G A;  3J81 i;  4DR5 Q;  1PH3 A;  3CD6 A;  5IY0 A;  3S2H H;  2ID0 A;  5FLM H;  3HFZ B;  1EYG A;  5GAD C;  2I5M X;  2H5X A;  1X55 A;  1L2F A;  3CC2 A;  1UE6 A;  3KJO A;  3PIP A;  3STB D;  3PUZ A;  3G48 A;  2E2H H;  4OX9 Q;  2LSS A;  3HOZ G;  1MJE A;  3PF4 A;  4HJ8 A;  4MNO A;  1CSQ A;  1X56 A;  1BVS A;  1TWG H;  2BA1 A;  2KHJ A;  2XTI A;  4MZ9 A;  3ZJY C;  3CC7 A;  4YCV A;  4Y52 H;  4KI0 A;  4JI7 Q;  1XPU A;  4X6A H;  1W2B A;  1C0A A;  4UPA A;  1ASY A;  2YTX A;  4LUZ A;  1PH5 A;  1QVG A;  2CQO A;  3KYH C;  1IBK L;  1VQK A;  1KQS A;  1E1T A;  3GO5 A;  1VQ4 A;  1S40 A;  4DR4 L;  2OWO A;  4B3R L;  2YYZ A;  4LNQ A;  4O0A A;  2EQS A;  4GN5 A;  1PH7 A;  1FVI A;  2PI2 E;  3AFQ A;  3HKZ G;  3STB C;  4APV A;  5IYB G;  2IX1 A;  1R9T H;  2JA7 G;  3RLF A;  2JK8 A;  2BA0 A;  1NMG A;  1WCM H;  2NVT H;  2N8N A;  4BXX G;  4JG2 A;  2B3G A;  2KHI A;  2JEB I;  4TQU S;  1Y1W G;  1PH6 A;  2VQF L;  1V43 A;  1V9P A;  5DLQ E;  5AJ3 Q;  4JI3 L;  3S1R H;  4B3T Q;  3ERS X;  5IWA L;  4GN4 B;  5GAE C;  4B3S Q;  2JQO A;  1GM5 A;  1NBW A;  5M5X H;  4A3G H;  1T9H A;  4BBS H;  4A93 H;  1C7Y A;  1GD7 A;  1YHQ A;  3UDF A;  4R4I A;  4LF9 L;  2K5V A;  3I4M H;  4PZ6 A;  1QUQ A;  2Q2H A;  5M3M G;  1Y1W H;  1K83 H;  2D0P A;  1EIY B;  4GOP C;  1I94 L;  3CAM A;  4PZ7 A;  2R93 G;  1FGU A;  4DV4 L;  4JI6 Q;  2N3S A;  3I55 A;  4B3M Q;  5JEA J;  3AEV A;  4QY7 A;  4IFD G;  4C2M H;  3GD7 A;  4OO1 G;  3K0X A;  1VQC A;  5FLX c;  4GOP B;  4DV1 Q;  1YJW A;  3T1H Q;  3EBE A;  1YJN A;  3I4N G;  4BY7 H;  4A3J G;  3WWV A;  3FP9 A;  3S24 A;  4X65 Q;  2B29 A;  3CCU A;  4HIK A;  3EIV A;  1HNX L;  3ICE A;  2D62 A;  3BU2 A;  3HKZ E;  5LMN L;  1V1Q A;  2MO1 A;  1YIJ A;  2Z0S A;  3GTJ H;  3CMA A;  1Q12 A;  1M90 C;  4R1J A;  3OW2 A;  1U0L A;  4X66 Q;  2NVQ H;  3J81 j;  4R4O A;  4NXM L;  1Z9F A;  4JBJ A;  4DV6 L;  1I5F A;  1YEZ A;  3CP0 A;  1VQ6 A;  1N32 L;  3K7U C;  2MNA A;  4DR3 Q;  1PYS B;  1Q1B A;  4DNI A;  2AMC B;  1MIU A;  1CSP A;  3I2Z A;  1X9N A;  3K8A A;  4IO9 A;  4YCU A;  4JC0 A;  4LF7 Q;  3PO2 G;  4DR6 L;  4GS3 A;  4X62 L;  1SR3 A;  2Z6K C;  4HJ9 A;  1X54 A;  1K9M C;  1KRS A;  4AYB G;  1XNQ L;  2IT1 A;  3HKS A;  2HT1 A;  2JA6 H;  3G4S A;  2CWA A;  1LUZ A;  1IBL L;  1SRU A;  1I94 Q;  1KXL A;  2ZM6 L;  2K5H A;  1HJP A;  4OWX B;  2ZTC A;  3NEM A;  2UXB Q;  1L0W A;  4A3F G;  3DM3 A;  2Q2I A;  3M85 A;  1EFW A;  4LF8 L;  4LFC L;  1NTG A;  3S16 H;  1SRO A;  3S17 H;  2ES2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...