2IHFA

Crystal structure of deletion mutant delta 228-252 r190a of the single-stranded dna binding protein from thermus aquaticus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
235
structure length
205
Chain Sequence
MARGLNQVFLIGTLTARPDMRYTPGGLAILDLNLAGQDAFTDESGQEREVPWYHRVRLLGRQAEMWGDLLEKGQLIFVEGRLEYRQWEKDGEKKSEVQVRAEFIDPLEGRGRALNQVILMGNLTRDPDLRYTPQGTAVVRLGLAVNEERTHFLEVQAWRELAEWASELAKGDGLLVIGRLVNDRFQTRVEALRLERPLEDFPPEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Single-stranded DNA-binding protein
publication title 3D structure of Thermus aquaticus single-stranded DNA-binding protein gives insight into the functioning of SSB proteins.
pubmed doi rcsb
source organism Thermus aquaticus
total genus 34
structure length 205
sequence length 235
ec nomenclature
pdb deposition date 2006-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ihfA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ihfA02
4A3FH 3K0XA 1N32Q 1CKMA 3S17H 1MKHA 1I94Q 1WCMG 2PNHA 1IBKQ 4OWWB 2F3IA 4A3JG 1GD7A 4GLAC 4P72A 3CMEA 1XMQL 5AJ3Q 4C3JH 4DR2L 4APVA 1KAWA 2D0OA 4LF6Q 4JI2Q 1PH6A 2IX0A 4R4QA 1S72A 3GTOH 1UE7A 4LUOA 1JT8A 5C0XI 3HOWG 4OX9Q 1Y1VH 2NZHA 3KF6B 2ASBA 1UE1A 3I4NG 1E1OA 2C35B 2ZM6Q 3RLOA 4C3HH 4HJ7A 2R7FA 1OTCA 3GO5A 1C9OA 1U5KA 5C3EG 1I5FA 1HNXL 2E5LL 2FXQA 3E9IA 4MTNA 2KENA 4OWTB 3ULJA 5GAEC 1YIJA 1M90C 4A3DH 1B70B 4DUYQ 4GNXB 5BR8Q 2ALYB 3WWVA 1N8RC 3PSIA 4WJ4A 3J80i 4JI0Q 4B3RL 4DV2L 4TQUS 2N3SA 3A0JA 3GTKH 4KI0A 4JV5L 2GN5A 2AHOB 4AIMA 2ES2A 2GVBA 4A4IA 3K7AH 4UY8C 4A3DG 4OO1I 4HJ9A 2JA5G 3HOYG 3RN5A 2YYZA 3W1GA 4LUZA 4DR7Q 3HOXG 4LFCQ 1CKNA 4QGUA 3AFPA 1S40A 5C0XG 3CCUA 4YCVA 2YTVA 1VQCA 2WB1G 4GNXC 1QVGA 2EIFA 3STBC 1IBLQ 2LXKA 3CF5A 1GVPA 4MZ9A 1BKBA 1Q12A 1TWGH 1VS0A 4DV4L 1AE2A 3RLFA 1Y14B 1BBUA 1LYLA 2JA8H 2F52A 2HT1A 1HJPA 5HY6A 1K0RA 3NEMA 3PO3H 1IYJB 1N9WA 1Q46A 2Q2HA 3A74A 3CPFA 1R9TH 1A8VA 1XMQQ 4X6AH 2AWNA 3EIVA 5LMNL 3NENA 2Q2TA 5K36G 4PZ8A 4DV1Q 2ZJRA 1PFSA 3TREA 1MJCA 2PI2E 4A3KG 2VUMH 3KF8B 1VQ8A 1AE3A 4JI7Q 3KDFB 3PCOB 1P8LA 4X64L 3M4OH 4OO1G 1I6HH 3T1HL 1G291 2NVYH 3CC7A 3CCQA 3PUYA 1E22A 2ID0A 1G6PA 4DR5L 3K80C 5JJIA 3FP9A 4BBRH 1NBWA 3FKIH 1KHIA 1X56A 1N33Q 1A0IA 3PF4A 4KHPL 1CKOA 1HZAA 2E8GA 1G51A 3H15A 3M85A 3CPWA 3CQZH 2JA7G 1L1OA 1XPOA 4QL5A 3A5ZB 1VQNA 4A3LH 2BA0A 1X6OA 3SGIA 1CSQA 2MO0A 4JC0A 2Y0SG 4NPSA 4R4IA 4TVAB 1L0WA 4XTCS 5ELOA 2A8VA 4UPAA 3TEHB 3G71A 1N32L 3M4PA 1XPUA 2XTIA 2ZJPA 3GD7A 3W1BA 2JK8A 4L5RC 5AJ3L 1PYSB 5M3FG 1V1QA 1YEZA 3KOJA 1IXRA 4JI2L 4LF6L 4A93H 2XGTA 3CC4A 5IP7G 4LWCA 2A1AA 3VDYA 2CQOA 1YJWA 1MJEA 3RR5A 1YNXA 3ULPA 1PA6A 1KQSA 4OX9L 3ICEA 4O0AA 4LUVA 2I5LX 1I3QH 2ZM6L 1YJNA 4DV6Q 1SMXA 2NVQH 3K8AA 1UEBA 3ULLA 4BA1I 3L0OA 1A62A 2K75A 3PUWA 1VQ6A 3S24A 3PF5A 2D0PA 2YV5A 4DUYL 5BR8L 3HOUH 5IP9G 1BVSA 4X64Q 3T1HQ 1QVCA 2VNUD 5C4XG 2KBNA 2ZTDA 2IX1A 2PQAB 5M5WH 4BXXG 4BY7G 1TWHH 1VQGA 2OWOA 4L5SA 3I4MG 2K50A 3I55A 1TWCH 1J5EQ 4X66Q 3J81c 3DM3A 4IFDG 2R7DA 4DUZQ 3G4SA 3CD6A 3AYHB 3KLWA 4B3TL 3KF6A 2Q2IA 3HKZE 1Y1WH 4HJAA 3RZDH 1IBLL 1OXXK 4GN4B 1VQHA 3U4ZA 1PH5A 2IY5B 4C2MH 4LF5L 3CCEA 4GN5A 2CCZA 3K7UC 4LF9L 2YTXA 2WAQE 5H1SE 1NY4A 3H0GH 4LW1A 4R4TA 4HJ8A 4YWMA 1WYDA 2JA9A 1S3OA 4YY3Q 4B3SQ 4GKJQ 2UUAQ 5IYCG 2A19A 4GNXA 3D0FA 4DV1L 2E2IH 4A3BH 3T1YL 2UU9Q 3G48A 1FJGQ 1WJJA 2VL6A 4C3IH 2Z0SA 1VQOA 3GTJH 1VQJA 5IYDG 4Y7NH 4HIMA 1YI2A 2VW9A 3J7ZC 4JI7L 3H3VH 1NTGA 4NXNQ 3U50C 4NXMQ 5FJ8H 4A3MG 2F4VQ 3GTGH 3HKZG 4JBWA 4P74A 2BH8A 4IPGA 1RL2A 1N33L 1FL0A 2R93H 4JBKA 1TWAH 4PZ7A 3KJPA 3PUZA 2B29A 3EBEA 2R7ZH 1VQBA 4JOIC 5DLQE 2OQKA 2K4KA 3F2DA 4A3EH 2I5MX 2MNAA 3BJUA 4DK3C 1ASYA 1V9PA 2HIVA 2JQOA 4JI4Q 1I50H 1EFWA 4DV7L 3HOVH 1NJIC 1GKHA 4IFDJ 1A63A 5IYBG 4OWXB 2MFIA 4DPGA 4R1JA 4O2DA 5M3MH 4B3TQ 5FLMH 4LF7L 4PMWA 4LF8Q 1VQDA 2I5HA 2JEBI 4JG2A 2R92H 3M3YH 4YHHL 2RF4A 3ER0A 3J7A5 3STBD 4LF5Q 1JE5A 3F8TA 3L7ZC 1SLJA 1UE6A 2OCEA 1IBMQ 4LF9Q 4DV3Q 2ATWA 2VS1A 4FDBA 5LMUQ 4BBSG 4A3CG 1D7QA 1PH9A 4ME3A 3G6EA 4DV6L 2AMCB 5FLXc 1X3EA 5C44G 1VQMA 5IE8A 4JYAL 4QJFA 1EOVA 1K3RA 1VQAA 1X65A 2H5XA 2OTJA 3T1YQ 1E1TA 4JI1Q 1C7YA 2UXCQ 2RHSB 5E7NA 1KIXA 1VQ7A 1KRSA 2NN6G 3D31A 2D62A 4ALPA 1HR0W 2YU9H 4X62Q 1WCMH 1ASZA 3HOZG 4A3JH 3PO2G 4IOAA 1XPRA 1LTLA 3UDFA 4DR1Q 1YVCA 4LFAL 1YHAA 2MQHA 1RIPA 2OQ0A 4A3GG 2B63G 1J5EL 4X66L 2NVTH 3HOWH 4QIWE 3I4NH 3UE1A 4DUZL 5GROA 5LMNW 4HJ5A 5IWAQ 4JCVE 4A3IG 1Z47A 1QZHA 4QY7A 2CKZB 4GOPB 5C3EH 3PUVA 2YTYA 3M9BA 1SRUA 4DV7Q 3RN2A 4JBMA 2KHJA 3S2HH 1P16A 1IZ6A 1VQLA 1HZ9A 4AQYL 4BY1G 2Z6KC 1KD1C 4X65L 4AYBE 2I0QA 4A75A 2JA6G 3GTLH 4IJHA 2IHFA 1K83H 4YY3L 2ZJQA 4B3SL 2UUAL 4DR6Q 1YHQA 4LF7Q 4GKJL 3AFQA 4A3FG 3J80c 4LFBL 5JJLA 4YHHQ 2UU9L 1LUZA 4DR3Q 1FJGL 4IFDI 3MXNB 4DK6C 1VQ9A 5GADC 4DNIA 3F2BA 4DV0Q 4P71A 5IT9c 2JA5H 1YITA 4UP9A 3HOYH 4GOPC 1KXLA 2WP8J 1QUQB 4NXNL 1UWVA 3HOXH 2UUBQ 4NXML 3I2ZA 2F4VL 3E9HA 3TS0A 4JYAQ 1Q8KA 2VQEQ 1Y1VG 1PYBA 1TXYA 1K9MC 1Q1EA 5IY0A 2AKWB 4J15A 2VY3A 3JAMc 3S15H 3UDXA 4AYBG 1PH8A 1YZ6A 1WFQA 2K14A 3HFZB 2LSSA 1YJ9A 5HGQA 1WOCA 4MNOA 1XNQL 5JEAJ 4JI8L 2CFMA 2B3GA 4LFAQ 3CC2A 4JI4L 4GLXA 2IHEA 3MEFA 1AH9A 4IOCA 4RMFA 4A3EG 1VCIA 1Q7YC 4NB3A 1X3FA 2R6GA 4A3KH 1E3PA 3GDEA 4JOIA 4JI5Q 1VQ5A 4BA2I 4OONA 3CCRA 4LF4Q 4H02A 3W5OA 1X55A 4LF8L 1SROA 3PV0A 4DR4Q 4DAYB 3GTMH 3F1ZA 4AQYQ 1IBML 1EIFA 4X65Q 4DV3L 2R92G 3CXCA 5M5XH 2QEXA 5LMUL 1D8LA 1XTDA 1Q82C 1HNZQ 2JA7H 2K5NA 3L2PA 1UE5A 1PHJA 4WJ3M 3U4VA 2JA8G 1N36Q 4LFBQ 4POFA 2BH2A 3DLLA 4JI1L 4HIDA 3PO3G 2UXCL 4AH6A 1GO3E 1K73C 1FVIA 3ERSX 2N78A 3H3VI 4X62L 3PIPA 2KCTA 2VUMG 3CCSA 4DR1L 2CWPA 5M3FH 1HZCA 1SE8A 3BU2A 1IL2A 1T9HA 2WAQG 4JI3Q 5IP7H 1HH2P 1NE3A 1EWIA 1X54A 4BBRG 3FKIG 1JJ2A 3CCLA 5IWAL 1XNQQ 4DAMA 4JBJA 5GAGC 4UP7A 2V1CC 4JI8Q 3M4QA 4LNQA 2NN6I 1EYGA 1YBYA 4YWKA 3I7FA 4IO9A 3PUXA 4GLVB 3TS2A 4A3LG 4YWLA 2K5VA 2GVAA 3UDGA 2UXBQ 5EAYA 4K0KQ 5IP9H 1O7IA 2K5HA 2WB1E 3BZKA 4DR6L 1HZBA 5C4XH 3KDFA 1TWFH 2QGQA 1VQEA 2EQSA 2NZOA 4DR3L 1VQPA 4BXXH 1VQKA 1DGSA 4BY7H 1W3SA 4JI6Q 2UXDQ 4DV0L 1XMOL 2KCMA 3I4MH 4GKKQ 1PH2A 2Z6KA 1HNWQ 4R4OA 4A93G 4DV5Q 1QVFA 5ELNA 2UUBL 2VQEL 3CCVA 2RCNA 1VQFA 1H95A 1PV4A 1Z9FA 5M5YH 1OXVA 3RLNA 2VQFL 1J6QA 3AQQA 1B8AA 1KC8C 3KJOA 3UDIA 3E0EA 4GOPA 3FHWA 1HR0L 3S1RH 3OTOQ 3JAMi 2HHHL 2UUCQ 3NELA 3AEVA 3J81j 1VQIA 1SFOH 1CSPA 3RNUA 1PH7A 1EUJA 4PG3A 5JEAG 5IYCH 3HOUG 1L2FA 4P75A 2E2JH 4L5QA 2JE6I 2KHIA 3CP0A 1PH3A 2CWAA 3B6YA 1EQQA 1N34L 4JI5L 1OXSC 3PIOA 4DR2Q 5IYDH 4UP8A 4YCUA 1M1KC 2HQLA 1CKNB 3J81i 1NMFA 2L15A 3I56A 4IPDA 2Y0SE 4A3MH 4LF4L 4XIGS 1QUQA 3LGJA 2VZAA 1PH4A 4DR4L 3CMAA 1FGUA 1CUKA 3A5UA 2IT1A 3CCMA 1Y1WG 2ZTCA 4L5TA 3UE0A 1HNZL 1SR3A 3S1QH 3U58A 1SN8A 1HNXQ 1JB7A 3CW2C 4GS3A 3OYYA 1N36L 1JJCB 2E5LQ 4IPCA 3H0GG 3NBHB 3PGZA 4GN3B 1VQ4A 4B3ML 1JJGA 1XMOQ 1B7YB 2PQAA 4B3RQ 4DV2Q 3S14H 2JEAI 2NVXH 4JV5Q 2JJQA 2DUDA 1XNRL 3KFUA 4A3BG 4YCWA 1WI5A 1OXTA 2QA4A 1MIUA 2LXJA 2RHQB 5IYBH 3OW2A 5JJKA 1EQRA 1C0AA 1KRTA 1K8AC 3JC66 4QQBX 2DGYA 2VQFQ 1Q81C 3HKSA 5C0XJ 4DKAC 5FJ8G 4KHZA 4JI3L 1I94L 1IBKL 1V43A 3TQYA 3GTPH 2AWOA 2BA1A 1KL9A 1YHBA 3ZJYC 1HR0Q 2HHHQ 3S1MH 2R93G 4BBSH 1EIYB 4R4CA 1OXUA 4EQ5A 4A3CH 1L1OB 2N8NA 1W2BA 1E7ZA 4DV4Q 5C44H 3EN2A 4HIKA 2OTLA 1BBWA 3KYHC 3GTQH 2R7ZG 2WFWA 1JMCA 3CCJA 3S2DH 1Q1BA 1GM5A 2K52A 2PI2A 4P73A 4PZ6A 4POGA 2UXBL 4EX5A 1N34Q 4A76A 5LMNQ 4K0KL 3HOVG 1PVOA 2PMZE 2HIXA 5J3BA 3RZOH 3HOZH 1XJVA 1X3GA 3PO2H 1E24A 1NMGA 2UXDL 4KLKA 4JI6L 2MO1A 2EXDA 4IPHA 1L1OC 4IJLA 5M3MG 1K8GA 4JI0L 5FLMG 4GKKL 4A3GH 3S1NH 1HNWL 3Q8DA 2B63H 4DV5L 3IRBA 4DR5Q 2ZTEA 5C4JH 4A3IH 4KHPQ 1U0LA 3S16H 3BZCA 3TRZA 1QZGA 4DR7L 4B3MQ 3I4OA 2E2HH 3M7NA 4LFCL 5GAHC 4HIOA 4OXPA 4Y52H 1LM0A 1XNRQ 2Q2UA 3OTOL 3K81C 4BY1H 2UUCL 1PH1A 3CAMA 4RG1A 5GQOA 2JA6H 2N49A 3F2CA 1Q86C 1X9NA
chains in the Genus database with same CATH superfamily
5KYLA 4ZQ3A 1CKMA 1WCMG 3NWSA 4C3JB 1AFPA 4OWWB 2F3IA 1GD7A 4GLAC 1AZQA 5AJ3Q 4C3JH 4R8NA 4I7ZC 3GTJB 1S72A 1J8IA 3H6MA 1LLRD 2ASBA 4C3HB 1HUNA 2C35B 1ZYRC 4AYBB 4Z9CB 5IODA 3E6ZX 4C3HH 4HJ7A 1OTCA 3GO5A 5C3EG 3QOJA 4MTNA 3ULJA 2CH4A 4WJWA 5GAEC 1YIJA 4A3EB 1B70B 3WWVA 1FR3A 1N8RC 3IAYA 4JI0Q 4B3RL 4DV2L 3QJYA 4RWSC 2GN5A 2XNAC 4AIMA 3X3NA 2Z6BA 3L3OC 3DUZA 5T1IA 4A4IA 3K7AH 4A3DG 4HJ9A 2YYZA 3W1GA 4DR7Q 2K33A 2XRSD 4PMCA 5C0XG 4YCVA 3CCUA 2R92B 2MHVA 2WB1G 3OIQA 1BKBA 1Q12A 1TWGH 1BBUA 2J4XA 1F77A 5KNCA 3PO3B 1PTOC 2F52A 5CORA 4K8IA 4CKCA 5JVH3 3PO3H 1IYJB 2Q2HA 1OO9B 3BVZA 1PTOF 4FNFA 1S5DD 4RAUC 2YU9B 1AE3A 4WRDA 2NVYH 3ITPA 3PUYA 2ID0A 4CHTB 2IW3A 4DR5L 5C3XA 3FKIH 1KHIA 1X56A 1N33Q 3OWFA 1HZAA 2E8GA 2ZT9C 3CQZB 3H91A 4XYOA 5DAUA 4XXEA 2A69C 1BNZA 3CQZH 4RGMA 1L1OA 4IUNA 1VQNA 4NPSA 4WORA 5BN3A 2PYKA 2D2CC 5ELOA 4XYQA 1TIID 3TEHB 1N32L 2XTIA 4OGQC 2JK8A 2BE5C 5C4ZA 1LV9A 1YEZA 2K6AA 4JI2L 1IXRA 4LF6L 3V2TA 3CC4A 1G91A 4ZAIA 3MWYW 1KQSA 1YNXA 1PA6A 2F03A 1SYDA 4O0AA 4ZYSA 1WTQA 4KJNA 4BA1I 3L0OA 2K75A 1H9KA 3PF5A 2RQXA 2VB2X 2HCCA 3HOUB 2D0PA 2YV5A 1EIGA 1U4RA 3HOUH 4S3SA 3T1HQ 5FO8B 1SNCA 2KBNA 1MSGA 1PDQA 2PQAB 1PLFA 4BY7G 1TWCB 1TWHH 5IGGA 4L5SA 4LAAA 4F7XA 2K50A 1TWCH 4KV6A 1J5EQ 4H13C 4DK1A 3URYA 1E0BA 1KLUD 2Q2IA 3VR5A 3HKZE 3DHQA 1IBLL 4GN4B 2EJGC 1PH5A 1ILQA 3C3LA 1U4LA 3BG3A 1LT6D 4YY3Q 3DWPA 5IYCG 1PMRA 2F0JA 4QUCA 1VQJA 4CDCC 3U50C 2F4VQ 3HKZG 2Z8LA 1MD2D 3A54A 4P74A 1RL2A 3NHHA 3K5MA 3IL8A 3KLSX 5KEEA 2R7ZH 2C5CA 4PQXA 2K4KA 1X32A 4KHVA 2EDGA 1EZ8A 2ENBA 4DAPA 2MNAA 4DK3C 5FLXL 1XTCD 1Y69U 1I6VC 4DK0A 1PTOH 1A63A 5M3MB 4QCLA 5C4XB 5M3MH 3E5SA 4LF7L 1EQTA 4PMWA 2DJFC 3ER0A 1WD1A 1JE5A 3L7ZC 4LF9Q 3N6RA 2VS1A 5LMUQ 4BBSG 1PH9A 4ME3A 5FLXc 1X3EA 1VQMA 2OTJA 1EOVA 1K3RA 1VQAA 1LT3D 4JI1Q 1A2UA 5KYIA 2RHSB 5E7NA 1VQ7A 2TSSA 2JSOA 3MTSA 1ASZA 3HOZG 3PO2G 1D5ZC 4G7HC 2B63G 2V4DA 2KHSA 1AN8A 2WINB 3D3RA 4QIWE 2PPBC 1MHWC 4DUZL 4A3MB 5IWAQ 4JCVE 4QY7A 1B9NA 2SNMA 2CKZB 1HQMC 2K1BA 1SRUA 1VMPA 1P16A 1IZ6A 3JAML 4IJHA 2UUAL 4HCSA 5C5LA 1YHQA 4LFBL 4B08A 1FJGL 4DR3Q 1UNSA 1XXGA 3MXNB 1NCVA 2JA5H 3HOXB 4GOPC 4K5WA 2WP8J 1UWVA 3HOXH 4NXML 1Q8KA 1LT4D 4ZLTF 3JAMc 3UDXA 1LTSD 1YZ6A 1JORA 5JEAJ 3NTKA 1B2TA 3M4YA 4JI4L 3S2DB 1AH9A 1EEFD 4FF2A 4CDEC 4NB3A 2R6GA 1E3PA 3T51B 4OO1H 4OONA 3W5OA 4LF8L 1SROA 2BCOA 2KCNA 1HTPA 3S1NB 4DAYB 1B3QA 4AQYQ 1IBML 4K8JA 3NP8A 2QEXA 2EJMA 4A3IB 1STEA 3Q6SA 2Q8TA 1SAPA 2BH2A 1QNUA 2F0FA 1FVIA 5G3LD 3NQIA 2JA6B 1FGBD 3H3VI 3PIPA 4UHVA 2BDOA 3CCSA 2R61A 4ILWA 2JP1A 1SE8A 2WAQG 5IP7H 2RCFA 1EWIA 4BBRG 1TY0A 1JR0D 1XNQQ 3RUZA 5GAGC 4UP7A 4JI8Q 3M4QA 2F0TA 4YWKA 1NAPA 1JWUD 3D4DA 3TS2A 4A3LG 1QOHA 2B2YC 2B2UC 3I8ZA 4QMGA 5CV8A 4KY5A 3A8IE 5EAYA 1TWFB 5IP9H 3BZKA 4DR6L 1TWFH 3R93A 2EQSA 1ENCA 4JI6Q 2KCMA 3IFTA 1PH2A 1HNWQ 4A93G 4DV5Q 2A6ED 1QVFA 5M5YB 2F0VA 3SDZA 3V96A 5M5YH 3DWAA 1OXVA 4EQNA 3ND9A 2VQFL 1B8AA 1BDOA 2PCFB 1I4QA 3K5OA 3KJOA 3UDIA 1HR0L 1SFOB 2UUCQ 3NELA 3QWNA 2JA8B 1VQIA 3VYSA 1SFOH 1CSPA 1K8OA 3J80L 1L2FA 1I4XA 4ZRZA 5FLXE 5T1GA 1LTGD 1EQQA 4TKOB 4DR2Q 4N9PA 3PIOA 3MXNA 5D65A 1CKNB 3J81i 1NMFA 1VMCA 1WTRA 1EYCA 2MGSA 3LGJA 1HQRD 2VZAA 1UUPA 3LNNA 1NNXA 3A5UA 2IPKD 3U58A 1SN8A 1HNXQ 3OYYA 1N36L 4XQQA 3HZXA 4RGTA 1L0YB 3H0GG 3NBHB 4GN3B 4CDFC 1JJGA 1B7YB 1CT1D 4RKBA 2D9UA 4XQNA 3I90A 2JJQA 2EJFC 3RMHA 1RJTA 1XNRL 4A3BG 1WI5A 1EQRA 1C0AA 3BVGA 3OIPA 3GTPB 1Q81C 4HCEA 5FK9C 5C0XJ 5FJ8G 3H3VH 3GTPH 2AWOA 2BA1A 2BOSA 1YHBA 4RGNA 2HHHQ 3S1MH 2R93G 4DAYA 5C44B 4EQ5A 1AEXA 3NTIA 1E7ZA 2EXZA 5C44H 4DV4Q 1JMCA 3PIP3 1Q1BA 4P73A 3MHBA 1EY4A 4O1NA 4A76A 1L0XB 3JAME 2PMZE 3NXWA 1NMGA 3EA6A 3G6JB 1L1OC 4IJLA 4GKKL 3OPOA 4M8AA 4JI0L 5EGTA 5CV7A 3IRBA 4I65A 1V8QA 2ZTEA 1QNKA 4KHPQ 1HRJA 5I6YA 1ICWA 2OF1A 4DR7L 1EY9A 1SNPA 5K5PA 4B3MQ 1IKLA 3I4OA 1YNJC 4HIOA 4BY1B 5JVG3 2Q2UA 4BY1H 2K28A 5NUCA 4KD3A 4ID6A 1MKHA 4A3JG 4P72A 4CKEA 3GTOB 1SMYD 4F88A 3GTOH 1JT8A 5E3FA 3L9AX 2NZ1D 5C0XI 4OX9Q 3HOWG 3KF6B 1GUNA 3I4NG 1YNND 3GTGB 1CA6A 3RLOA 1Q8IA 3E0JA 3DXJC 2R7FA 1PXUA 1U5KA 5G3LF 2A68C 2E5LL 2FXQA 1M90C 2KENA 1EY0A 3P20A 4GNXB 1S5CD 2K5QA 4RFBA 3TN2A 5BR8Q 5TSSA 1JWSD 3PSIA 1B50A 2ZXRA 3KBGA 4TQUS 3A0JA 3GTKH 4JV5L 4ZKBB 1I50B 1R4QB 3HOYG 1O80A 1BCPB 2NYZD 3HRZC 4IZ8A 1CKNA 1FNVA 1IKMA 3U9OA 5CBEE 2EIFA 2L9HA 2NUCA 1VS0A 2HT1A 1PRTD 2HCIA 4N8X1 2EYOA 4X6AH 3NBHA 4N9TA 4FVMA 4A3KG 1VQ8A 2RA4A 1SYEA 4O42A 1WCMB 3PCOB 1P8LA 3D6WA 3T1HL 4IQZA 1B9MA 4LJZC 1E22A 1G6PA 5JJIA 3DEOA 3T56B 3K0YA 1A0IA 3PF4A 1CKOA 3H15A 3M85A 3CPWA 1RD9D 1XPOA 1TT2A 3A5ZB 3SGIA 1X6OA 1CSQA 1SYFA 4JC0A 2Y0SG 3QG1A 3O13A 2Q8IB 3G71A 5DM63 1EIHA 3EQLC 2ZJPA 1G8ZD 1PZID 1PYSB 2KJXA 3KOJA 4ZCKA 1EQVA 2XGTA 4LWCA 2CH4W 2K5DA 1UAPA 3ULPA 3ICEA 1QILA 4LUVA 3CRKC 1E2ZA 5CGKA 2Q8RE 2ZM6L 1F2MA 4DV6Q 5KRUA 1F9SA 2N55A 2WB1B 1SMXA 3TZDA 1PFNA 3K8AA 1MI2A 5HURA 1IYUA 1VQ6A 3S15B 1H9SA 2RBMA 5KNBA 4DUYL 4X64Q 1BVSA 2VNUD 3IKJA 3UI2A 1EOTA 4K14A 2F0IA 4IUQA 1BR9A 1G2TA 2OWOA 3I4MG 1U9RA 4X66Q 3J81c 4IFDG 2R7DA 3K59A 3RZDB 3AYHB 1Y1WB 3I4LA 3KF6A 5IOCA 2F0MA 2AUJD 4ODGA 4DN4M 1Y1WH 3RZDH 4C2MB 1VQHA 4C2MH 4GN5A 4DU9A 4LF9L 1NY4A 3CKIB 4YWMA 2RKSA 1WYDA 4OIJA 4B3SQ 4GKJQ 4GNXA 3K5NA 4DV1L 3BS1A 4FP5D 3G48A 1WJJA 1JWMD 3GTJH 4JI7L 1YI2A 2VW9A 3AB9A 1NSNS 3NPPA 1DYQA 1A6XA 3OHXC 4JBKA 2EY6A 4PZ7A 3KJPA 1LTRD 4DXGA 3EBEA 3ND8A 5DLQE 2OQKA 3F2DA 4A3EH 1WTVA 1LTAD 4M1UB 3BJUA 3DWQA 1ASYA 1EYDA 2F3VA 5DM73 3M7GA 5FO7B 2MFIA 4B3TQ 5EBDA 5FLMH 1IW7C 2MUYA 1BF4A 2R92H 4BY7B 1BO0A 1S4ZA 1C8CA 2RF4A 4FF1A 3IFDA 3DMUA 3STBD 4LF5Q 1ICFB 5I2YA 1SLJA 2DJGC 4FDBA 3ONAB 3G6EA 5IE8A 2H5XA 4KKTA 1JOOA 2EVBA 2QILA 1KIXA 5EKKA 1WTPA 3FPPA 4ALPA 2YU9H 4X62Q 3BYYB 3MVVA 4IOAA 3GV3A 5EPJA 2KQ3A 4DR1Q 1YVCA 2MQHA 1RIPA 4A3GG 4KKUA 1TVXA 1C48A 3PUVA 3G7LA 3RN2A 3S1QB 4K2KA 4AQYL 3GTLB 4AYBE 2I0QA 3GTLH 1D5MC 4R9WA 1A3UA 4FXGC 4K5VA 2XN9C 2UU9L 1LUZA 2VB3X 3VR6A 3SK5A 2NVXB 4HN7A 4DV0Q 3F2BA 4C3JG 1Q90A 1KXLA 4NXNL 1RODA 2QW7A 3TS0A 4JYAQ 3HEJA 1G2SA 4NKLA 4C3HG 4J15A 4AYBG 4L6TB 5KGUA 1WFQA 5IIFA 4MNOA 1XNQL 4JI8L 2OEOA 4LFAQ 1CI3M 2IHEA 5K36H 2VXWA 3K57A 4A3EG 1VCIA 1Q7YC 1KDAA 1X3FA 4LMQD 1WTXA 4JOIA 4JI5Q 3HOZB 1PFMA 4LF4Q 4H02A 3GTMB 4DR4Q 3GTMH 2EY5A 1EIFA 2JA7B 4DV3L 2R92G 1D8LA 4KKSA 2JA7H 4KY6A 1DD2A 3L2PA 1UE5A 4WJ3M 2EPBA 3U4VA 3J81E 2E2HB 1RHPA 3PO3G 2UXCL 1LABA 4AH6A 2DN8A 1I4HA 2F0NA 2N78A 3EVQA 1F9QA 1V1PB 5FOBB 1XX8A 2KCTA 3HS0C 5M3FB 2C9OA 5D3IB 3S17B 1II3A 1SYGA 5M3FH 1MGSA 3GP7A 1T9HA 4JI3Q 1X54A 1JJ2A 3FKIG 4CDDC 2QDLA 4DAMA 2XVSA 5CV5A 2NN6I 4G7ZC 1YBYA 4IO9A 4PNYA 2AUKA 1STYA 3W2DA 3EFXD 3BDOA 1Z6HA 5C4XH 3AMUA 2QGQA 2NZOA 4BXXH 2EYLA 2CW0D 5E4XA 4DAVA 2Z6KA 3DM1A 1PRTB 4R4OA 2UUBL 2VQEL 3CCVA 2RCNA 1PV4A 1BCPD 3RLNA 5CMDA 1KC8C 1WD0A 1MSHA 2HHHL 3AEVA 5HGTA 1ET6A 3RNUA 1CK1A 1EUJA 3HOUG 1KNEA 1W6KA 5ELDA 1PH3A 3CP0A 3NE5B 2CWAA 3B6YA 3I3CA 3J7AV 4EVOA 5IYDH 1BXTA 2PW7A 4A3MH 1IYVA 2WIIB 1FGUA 3NK9A 2WAQB 4IURA 2IT1A 3VR3A 1KLGD 5JPMC 4L5TA 1HNZL 1SR3A 1CM9A 3CW2C 4GS3A 3F2CA 4N8FA 1SE3A 3PGZA 4B3ML 3S14B 1XMOQ 1X3QA 2PQAA 3C1EA 4B3RQ 4DV2Q 3A56A 3S14H 1K0SA 2DUDA 1DM0B 1OXTA 2LXJA 5IYBH 2RHQB 5JJKA 3A8KE 5IGCA 1GUTA 1STHA 2DGYA 2GA4B 3TQYA 2ICIA 1TS3A 2LKVA 3ZJYC 3MXUA 3C46A 1MBYA 3GTQB 1EIYB 4R4CA 4A3CH 4C56C 4HIKA 3EN2A 3GTQH 3KYHC 1I3QB 4IUPA 2R7ZG 3S2DH 3H3VC 2PI2A 4PZ6A 4POGA 2UXBL 4EX5A 4DXFA 2NN6H 4K0KL 1HA5A 3VYRA 1PVOA 1V1PA 4KLKA 2UXDL 2MO1A 4P2CB 5M3MG 1K8GA 3TP6A 3S1NH 5M5WB 2RVLA 1GHKA 4DR5Q 3T4AC 2EOTA 4A3IH 2I46A 1QZGA 4G57A 1SJED 2B2WA 2EYHA 1LM0A 5FO9B 3OTOL 4RG1A 2JA6H 1STBA 4A3FB 1E2VA 2N49A 4A3FH 1N32Q 1IBKQ 3TP5A 4RCOA 1SXTA 3BVMA 4APVA 1IL8A 1KAWA 4LF6Q 4JI2Q 1PH6A 1Y1VB 5KIXA 2IX0A 4R4QA 1SSOA 1Y1VH 3SXHA 3U9SA 1UE1A 5CC4A 2M9VA 2DY7A 2L55A 1UEAB 3BYTB 2Z4HA 2R93B 1I5FA 4J1MA 1S5ED 4WJ4A 1RF2D 3MXPA 2AHOB 2GVBA 1B4OA 4U673 4UY8C 2Z9HA 2JA5G 4UDUC 3RN5A 4LUZA 3HOXG 4L8JA 2FFKB 3AFPA 1S40A 2YTVA 4GNXC 4B9XA 1TS4A 1IBLQ 1GVPA 4MZ9A 4KN4C 2NTTA 1AE2A 2JA8H 4EGVA 4OL7A 4F87A 1CTMA 1SE4A 1M4VA 4X3KA 5HY6A 2LY7A 1N9WA 1C4QA 3CPFA 1XMQQ 1GUSA 2Z1CA 3EIVA 5LMNL 2PMZB 2Q2TA 4PZ8A 3EROA 2VUMB 2ZJRA 1PFSA 3TREA 4ZUIA 1MJCA 2VUMH 1B44D 3KDFB 1BCPF 2CQAA 2F0GA 4BS9A 4X64L 4OO1G 4KJOA 1GJXA 2HD3A 1G291 4KMUC 1JOQA 3WDNA 3K80C 2K05A 2ICEC 1QB5D 3MXGA 1ESFA 1BUVT 2SNSA 2NVTB 1ZEQX 1G51A 3I4NB 5DEHA 1KAAA 1LO5D 1L0WA 4XTCS 1I4RA 4UPAA 1GUWA 4MN3A 5DNFA 3M4PA 3W1BA 5AJ3L 2NBFA 2MP1A 1V1QA 1S5FD 3HOYB 5IP7G 1CHQD 3VDYA 1YJWA 2CQOA 1MJEA 3RR5A 2ZXPA 4EQOA 3KLSA 2IX3A 1QE6A 3V05A 1UEBA 3ULLA 1X3PA 4CGYB 1A62A 3PUWA 1JE4A 3S24A 1GHJA 5IP9G 5JEAH 1HPCA 1V1OA 2A73B 5ELCA 1VQGA 4CJ2C 3I55A 1GXDC 5A2QL 3K6OA 1VF5C 2PW5A 5FKAC 1SDFA 1CHPD 3LWEA 3CD6A 4DUZQ 2KOLA 2AQ1B 4HSVA 4B3TL 2EYFA 3OOCA 4LF5L 2CCZA 3K7UC 2NTSA 4HJ8A 5CV4A 2F0DA 1VDZA 2UUAQ 2Y0SB 4C3IB 1FJGQ 2F0PA 1LT5D 4Y7NB 4C3IH 2Z0SA 1ESRA 5EJWA 4Y7NH 4MTKA 4X3TA 1NTGA 4MIUA 4NXMQ 3GTGH 1U4PA 1ZYRD 1TWAB 3ERQA 2BH8A 4IPGA 1N33L 5J39A 1TWAH 3PUZA 5I9PA 3TSSA 2B2VA 5L37A 3SEBA 3P7JA 4JOIC 2G9DA 4H7BA 2E74C 4RGOS 1HTLD 3HOVB 2IL8A 1GUGA 1V9PA 2HIVA 4JI4Q 2SOBA 3FMCA 1I50H 1EFWA 3HOVH 5I6WA 2AQ2B 2XWBB 3N52A 4J8QA 4OWXB 4R1JA 2O5IC 4LF8Q 2L4NA 3J7A5 2RSOA 2QF7A 2A6EC 4KTAA 3F8TA 3T13A 3TMEA 1IBMQ 2JYOA 1SYCA 3D6CA 1PTOD 1F2LA 2AMCB 5C44G 4JYAL 4QJFA 1X65A 3T1YQ 3MFYA 1F9RA 3R2TA 4H44C 1KRSA 3S1RB 2FHTA 3KLRA 2PO4A 1HR0W 2WV6D 4JPBW 1WCMH 3GQBA 4C1NI 2K01A 4IN3A 1LTLA 3UDFA 1XPRA 4LFAL 3A7LA 1YHAA 2G9HD 3T53B 2OQ0A 1J5EL 2A6HD 3Q24A 1U4MA 5IT9L 5BN4A 5LMNW 3CRLC 2A69D 2BDNA 5C3EB 5D14A 1JC7A 5C3EH 1RTNA 2YTYA 4DV7Q 4JBMA 1G6ZA 3GV6A 1HZ9A 4E6IA 4BY1G 2Z6KC 1KD1C 1JQYD 3OMGA 1SNMA 2F0SA 2ZJQA 4YY3L 4CKBA 4DR6Q 1RDPD 3WOEA 3FRPB 4A3DB 2BE5D 4YHHQ 2FMMA 2O2LD 4A3DH 4XT3B 1EY5A 4P71A 5IT9c 1ZKOA 4UP9A 2K5WA 1CZWA 5LHY1 5IGFA 3J81L 2F0HA 3I2ZA 2F4VL 1Y8PB 4HTHA 5C0XH 3PMFA 4JW0A 3I70A 4ME5A 3TZUA 3S15H 1PH8A 2F0EA 2K14A 4L63B 4QF4A 1LACA 2K7VA 3CC2A 1HFGA 2K32A 3MEFA 4LK1C 4GLXA 3PQIA 4GZYC 4IUTA 3GDEA 1D1IA 2EYJA 3W3AA 3CCRA 1KDCA 3H09A 2RDFA 3QR8A 3P1HA 2O5JC 4X3UA 4A3GB 3X3MA 5M5XB 3R3OA 4X65Q 5M5XH 1I4GA 5LMUL 5C4JB 2K5NA 3SVMA 1PHJA 1N36Q 4POFA 5I9OA 3DLLA 4JI1L 4HSPA 2F0LA 1M8AA 2IWHA 3NQTA 1TY2A 1STGA 2A74C 1A15A 1EY7A 2CWPA 3BDCA 4RHRA 3VR4A 1HZCA 2H1EA 1SE2A 1VF7A 1SMYC 1NE3A 1QWYA 3CCLA 5A2QE 5IWAL 4V190 4JBJA 5M9OA 1YNNC 4LNQA 4IALA 4GLVB 2K5VA 2KEEA 2NWGA 1O7IA 1FD7D 2WB1E 1FNUA 1HZBA 5C3WA 1VQEA 5I2XA 4DR3L 1VQPA 1VQKA 4BY7H 2B2WC 4PMBA 1XMOL 2FMCA 4GKKQ 3NBIA 4HMIA 4RHSA 4V0BA 4KK7A 3MAQA 3K7AB 2KVMA 1AW7A 1VQFA 1Z9FA 2F3WA 5C4HA 3AQQA 2B8GA 4FF4A 1F2YA 3I91A 5J22A 3QB3A 5IGEA 1TWGB 3JAMi 2L0CA 2X6GA 3VA5A 1PRTC 4R8IA 1O7LA 3CU7A 4PG3A 3SHLA 5IYCH 4P75A 1W6JA 2JE6I 2KHIA 4L5QA 5ISRA 1OXSC 1PRTF 3HKZB 4DA2A 2HQLA 3C2PA 1STNA 4Q5VA 3KUPA 4FF3A 2KA7A 1PH4A 2NVYB 2QCPX 3QO2A 5LL6S 3CCMA 5CYUA 5LL6X 3TDQA 1Y1WG 2ZTCA 3UE0A 2J0TD 3FKIB 3S1QH 1D6EC 1EY6A 2A6HC 2EY1A 1BBXC 2E5LQ 1A3TA 1VQ4A 1WTOA 1LTID 3LX0A 2RDHA 3FEWX 2JEAI 2NVXH 4JV5Q 3KFUA 4YCWA 2QA4A 1MIUA 3OW2A 1K8MA 1K8AC 1H9RA 5CR3A 3MFGA 1EYAA 4DKAC 1IBKL 1KL9A 2PNRC 4BBSB 4QB4A 1TS5A 4BBSH 1OXUA 3NWTA 5IT9E 1W2BA 5JPNC 2OTLA 1STAA 3P75A 1BBWA 2WFWA 3CCJA 2NB0A 2D5DA 2KUMA 1GM5A 1N34Q 4K6LA 5IGBA 3PO2B 3HOZH 1B1ZA 3PO2H 4JI6L 2B63B 2EXDA 4IPHA 2CHBD 5FLMG 1HNWL 2B63H 1TWHB 4DV5L 3S16B 1LTTD 3OW7A 3S16H 3I56A 2WKCA 3TRZA 2KEDA 2E2HH 3I73A 3M7NA 1AZPA 3A8JE 4OXPA 4Y52H 3MEHA 2E76C 3K81C 2UUCL 2DNCA 3CAMA 1PH1A 4OIKA 3AU7A 2K04A 3DEPA 3K0XA 4RH6A 3S17H 4QIWB 3KK7A 1I94Q 2PNHA 1PZKD 1XMQL 3CMEA 2M2LA 5E1FA 4DR2L 1CQFA 2D0OA 4DF7A 1UE7A 4LUOA 2NZHA 1E1OA 4ZKCB 1PYWD 4RA8A 2ZM6Q 1ONLA 1C9OA 2QKIC 1HNXL 3D4WA 2KCCA 4OWTB 3E9IA 1D2BA 2R7ZB 1ILPA 4DUYQ 2ALYB 3J80i 2X69A 2N3SA 4JVZA 4KI0A 3LWUA 3T16A 2ES2A 2JXMB 1PTOB 1PFBA 4OO1I 1NR4A 1HHVA 2OT2A 4LFCQ 4QGUA 4KN7C 1BOSA 1AP0A 1B53A 1E2WA 1VQCA 1ET9A 4J6HA 1QVGA 1H9JA 1TKWB 3STBC 2LXKA 3CF5A 4CBVA 2K03A 4DV4L 3RLFA 1Y14B 1LYLA 2XSCA 1JOKA 1HJPA 1F9PA 2SEBD 1K0RA 1R9TB 3NEMA 1Q46A 5EPLA 3A74A 1R9TH 1A8VA 2AWNA 4HAEA 3NENA 5K36G 4DV1Q 3R8BA 1RCVD 3VR2A 2CVRA 2PI2E 2Z4IA 3M4OB 3KF8B 1I6HB 4JI7Q 2B2VC 1GOZA 3M4OH 1I6HH 4XT1B 3CC7A 4BBRB 3CCQA 5C6AA 1XYIA 3EJIA 4K6DA 3FP9A 4BBRH 1NBWA 2X6LA 3FDTA 2F0UA 4KHPL 3SK8A 1FNWA 4ULLA 1NR2A 2B2TA 2JA7G 1GUOA 4QL5A 1CFMA 4A3LH 2BA0A 2MO0A 2B39A 4R4IA 5ELFA 4TVAB 1Y8OB 1J9OA 2A8VA 1LTBD 2HDMA 4FXKC 3GD7A 1EU4A 4OEMB 4I7AA 4A93B 4L5RC 1TQOA 5M3FG 4A93H 2JA5B 2A1AA 1EL0A 4OX9L 1A3VA 2I5LX 5JJZA 1I3QH 2NVQB 1YJNA 2F0QA 1K28A 2NVQH 2N88A 3J7YW 4QUFA 1DOMA 5BR8L 3NTHA 2HUGA 1DXMA 1QVCA 5C4XG 3WOFA 4FYDA 2ZTDA 2IX1A 1O7ZA 5M5WH 4BXXG 2EYMA 5CV9A 1KTKA 3FVQA 2LS01 4CJ0B 3DM3A 1I4PA 3G4SA 2FJ2A 3KLWA 1YNJD 3SK6A 5ELEA 4HJAA 1OXXK 3U4ZA 3SE0A 4OHJA 2IY5B 3H0GB 3CCEA 4XDXA 5JOBA 3HGBA 2YTXA 2WAQE 5EBCA 5H1SE 3H0GH 4LW1A 3BZDB 2IJ0A 1SNQA 4R4TA 3OMCA 2JA9A 2E2IB 1S3OA 4OELB 4A3BB 2A19A 3D0FA 2E2IH 2FINB 4A3BH 1HXYD 3T1YL 2UU9Q 2VL6A 1VQOA 1EFID 3KBXA 4RCNA 1O78A 2E75C 5IYDG 4HIMA 3J7ZC 4NXNQ 1T5EA 4HEDA 3SK4A 5FJ8H 4A3MG 4NP5A 1R4PB 4JBWA 1EWHA 2R93H 1FL0A 1SYBA 2O4XA 2A68D 1PZJD 2B29A 1VQBA 1Y8NB 2I5MX 1WTHA 1QG7A 3MZ5A 2JQOA 5E4WC 1KDBA 4C1NK 4DV7L 2I07B 3SR1A 1NJIC 1GKHA 4IFDJ 3NUCA 3D4RA 4NW2A 2SDFA 5IYBG 4UAIA 2H4OA 4DPGA 5J1ZA 4O2DA 3M3YB 2B8FA 3KF8A 2CW0C 3QOLA 1VQDA 2I5HA 2JEBI 4JG2A 3TP8A 3K5LA 3ZYYX 4YHHL 3M3YH 2ATWA 1UE6A 2OCEA 4DV3Q 5KNDA 2XIWA 1D7QA 4A3CG 3VYUA 4DV6L 1BCPC 5BN5A 5I4DA 2F0KA 2XRQD 1E1TA 1C7YA 2UXCQ 2NN6G 3D31A 5JAVA 5AFWA 4FXDA 2D62A 1DCZA 1KNAA 4A3JB 4BWGB 1SBBB 2F0WA 1EEID 4A3JH 1BQQT 4DGZA 5COYA 1ENFA 4IUUA 4CJ1B 3C1FA 1DOLA 3HOWB 4X66L 1DONA 1JB3A 4X3SA 2NVTH 3HOWH 3I4NH 3UE1A 2L5TA 3Q0AA 5GROA 4HJ5A 4A3IG 1Z47A 1QZHA 4PV1C 2AQ3B 3S2HB 4GOPB 2QEJC 3M9BA 5EKLA 3S2HH 2KHJA 4YIJA 1VQLA 1JCKB 1Q3LA 1HUMA 4X65L 1K83B 3A7AB 4A75A 2JA6G 1CQVA 2IHFA 1K83H 4B3SL 4GKJL 1H95A 5JJLA 4LF7Q 3AFQA 4A3FG 3J80c 1NUCA 3OWEB 4IFDI 4DK6C 1XPUA 1VQ9A 5GADC 4DNIA 2PZWA 3HOYH 1YITA 1SNDA 1QUQB 1T5XD 4B9WA 2UUBQ 3E9HA 3TBIB 2VQEQ 1Y1VG 1PYBA 1TXYA 1K9MC 1Q1EA 5IY0A 2AKWB 2VY3A 1EZ6A 3HG9A 3S1MB 1DJRD 2EY2A 3HFZB 1EU3A 2LSSA 1YJ9A 4HMJA 1WOCA 5HGQA 4DNTB 4ZK9B 2CFMA 2B3GA 1WVLA 4IOCA 1WTWA 4RMFA 4A3KB 2MJ8A 2M00A 4A3KH 1VQ5A 4BA2I 3TP7A 1X55A 3PV0A 4JK1C 1JICA 3F1ZA 3FPUB 5A35A 2WKDA 4DNRB 3CXCA 1Q82C 1HNZQ 1XTDA 2F4IA 2JA8G 1A2TA 4LFBQ 4TRDA 1CZGA 4HIDA 1GO3E 1IHZA 1H9SB 1K73C 3ERSX 3RD4A 4X62L 2HQEA 3E3XA 3VA7A 3Q22A 2VUMG 1HCZA 5D3DA 2PZUA 4DR1L 3F2UA 3BU2A 1IL2A 1SJHD 3MC0B 1H9MA 2F1MA 1HH2P 2L1BA 5C5MA 2V1CC 1D5XC 1EYGA 3I7FA 3PUXA 2XWJB 1QCBD 4YWLA 2GVAA 2HDLA 3UDGA 3CHBD 2UXBQ 4NDXA 2DY8A 4K0KQ 3VYTA 2OXPA 2K5HA 1ENAA 3KDFA 1Z7TA 2RSNA 2RDGA 4ZUJA 3PIO3 3I4MB 1IW7D 1DGSA 2UXDQ 1W3SA 3GTKB 4DV0L 4NMZA 3I4MH 4WFN3 4G7OC 4FO2A 5ELNA 1FYCA 2ZXOA 1ZXTA 2KECA 4IFDH 1ML0D 2QDBA 3BDLA 1SEBD 1J6QA 4TSSA 1DOKA 3E0EA 4GOPA 3FHWA 3S1RH 3OTOQ 3NSWA 4U68A 3J81j 1TS2A 1PH7A 2E2JB 1DZ1A 5JEAG 1SNOA 4F8MA 5F2DA 2L11A 2E2JH 5EQ0A 1TU2B 1N34L 4JI5L 3K58A 4UP8A 4YCUA 1M1KC 2L15A 1RTOA 1K3BC 3R2IA 1B3AA 2Y0SE 4IPDA 4K2LA 3H94A 4XIGS 4LF4L 1QUQA 4DR4L 3CMAA 1HA6A 1CUKA 2LFNA 2R3ZA 2EZVA 1F2ZA 4Q0FA 1JB7A 2JN4A 1KABA 3Q23A 1JJCB 2A5HA 4ABNA 1O7YA 3I72A 3S9WA 4IPCA 2MPMA 4G4KA 2PZTA 1QJOA 4C3IG 2WACA 1KRTA 3JC66 4QQBX 2VQFQ 3OSOA 5EPKA 3HKSA 2F0OA 5EKIA 2G5DA 3HP3A 4KHZA 4JI3L 1I94L 1V43A 4EQPA 1EWCA 3J80E 1HR0Q 1HFNA 4MHEA 1L1OB 2N8NA 3MA2B 2L12A 2TMPA 1TR5A 5CBAE 4HR7B 2K52A 5LMNQ 3RZOB 1D1KA 3A55A 3QIAA 4K5XA 3HOVG 2HIXA 5J3BA 5CV6A 4XQJA 4KY7A 5IGDA 1XJVA 3RZOH 1X3GA 1E24A 2E2DC 2B2TC 2EE1A 4A3GH 3Q8DA 2EYPA 2B2YA 2B2UA 4RKLA 5ELBA 4IUVA 5C4JH 1U0LA 3BZCA 2DNEA 1RKNA 2J7ZA 4LFCL 5GAHC 4DFAA 1XWEA 2P5ZX 1CA5A 1XNRQ 2LMCB 1S5BD 4H0LC 5GQOA 1EY8A 3J7AF 3D8GA 1Q86C 1X9NA 4KD4A 2PQEA
chains in the Genus database with same CATH topology
4A3FH 3K0XA 1N32Q 1CKMA 3S17H 1MKHA 1I94Q 1WCMG 2PNHA 1IBKQ 4OWWB 2F3IA 4A3JG 1GD7A 4GLAC 4P72A 3CMEA 1XMQL 5AJ3Q 4C3JH 4DR2L 4APVA 1KAWA 2D0OA 4LF6Q 4JI2Q 1PH6A 2IX0A 4R4QA 1S72A 3GTOH 1UE7A 4LUOA 1JT8A 5C0XI 3HOWG 4OX9Q 1Y1VH 2NZHA 3KF6B 2ASBA 1UE1A 3I4NG 1E1OA 2C35B 2ZM6Q 3RLOA 4C3HH 4HJ7A 2R7FA 1OTCA 3GO5A 1C9OA 1U5KA 5C3EG 1I5FA 1HNXL 2E5LL 2FXQA 3E9IA 4MTNA 2KENA 4OWTB 3ULJA 5GAEC 1YIJA 1M90C 4A3DH 1B70B 4DUYQ 4GNXB 5BR8Q 2ALYB 3WWVA 1N8RC 3PSIA 4WJ4A 3J80i 4JI0Q 4B3RL 4DV2L 4TQUS 2N3SA 3A0JA 3GTKH 4KI0A 4JV5L 2GN5A 2AHOB 4AIMA 2ES2A 2GVBA 4A4IA 3K7AH 4UY8C 4A3DG 4OO1I 4HJ9A 2JA5G 3HOYG 3RN5A 2YYZA 3W1GA 4LUZA 4DR7Q 3HOXG 4LFCQ 1CKNA 4QGUA 3AFPA 1S40A 5C0XG 3CCUA 4YCVA 2YTVA 1VQCA 2WB1G 4GNXC 1QVGA 2EIFA 3STBC 1IBLQ 2LXKA 3CF5A 1GVPA 4MZ9A 1BKBA 1Q12A 1TWGH 1VS0A 4DV4L 1AE2A 3RLFA 1Y14B 1BBUA 1LYLA 2JA8H 2F52A 2HT1A 1HJPA 5HY6A 1K0RA 3NEMA 3PO3H 1IYJB 1N9WA 1Q46A 2Q2HA 3A74A 3CPFA 1R9TH 1A8VA 1XMQQ 4X6AH 2AWNA 3EIVA 5LMNL 3NENA 2Q2TA 5K36G 4PZ8A 4DV1Q 2ZJRA 1PFSA 3TREA 1MJCA 2PI2E 4A3KG 2VUMH 3KF8B 1VQ8A 1AE3A 4JI7Q 3KDFB 3PCOB 1P8LA 4X64L 3M4OH 4OO1G 1I6HH 3T1HL 1G291 2NVYH 3CC7A 3CCQA 3PUYA 1E22A 2ID0A 1G6PA 4DR5L 3K80C 5JJIA 3FP9A 4BBRH 1NBWA 3FKIH 1KHIA 1X56A 1N33Q 1A0IA 3PF4A 4KHPL 1CKOA 1HZAA 2E8GA 1G51A 3H15A 3M85A 3CPWA 3CQZH 2JA7G 1L1OA 1XPOA 4QL5A 3A5ZB 1VQNA 4A3LH 2BA0A 1X6OA 3SGIA 1CSQA 2MO0A 4JC0A 2Y0SG 4NPSA 4R4IA 4TVAB 1L0WA 4XTCS 5ELOA 2A8VA 4UPAA 3TEHB 3G71A 1N32L 3M4PA 1XPUA 2XTIA 2ZJPA 3GD7A 3W1BA 2JK8A 4L5RC 5AJ3L 1PYSB 5M3FG 1V1QA 1YEZA 3KOJA 1IXRA 4JI2L 4LF6L 4A93H 2XGTA 3CC4A 5IP7G 4LWCA 2A1AA 3VDYA 2CQOA 1YJWA 1MJEA 3RR5A 1YNXA 3ULPA 1PA6A 1KQSA 4OX9L 3ICEA 4O0AA 4LUVA 2I5LX 1I3QH 2ZM6L 1YJNA 4DV6Q 1SMXA 2NVQH 3K8AA 1UEBA 3ULLA 4BA1I 3L0OA 1A62A 2K75A 3PUWA 1VQ6A 3S24A 3PF5A 2D0PA 2YV5A 4DUYL 5BR8L 3HOUH 5IP9G 1BVSA 4X64Q 3T1HQ 1QVCA 2VNUD 5C4XG 2KBNA 2ZTDA 2IX1A 2PQAB 5M5WH 4BXXG 4BY7G 1TWHH 1VQGA 2OWOA 4L5SA 3I4MG 2K50A 3I55A 1TWCH 1J5EQ 4X66Q 3J81c 3DM3A 4IFDG 2R7DA 4DUZQ 3G4SA 3CD6A 3AYHB 3KLWA 4B3TL 3KF6A 2Q2IA 3HKZE 1Y1WH 4HJAA 3RZDH 1IBLL 1OXXK 4GN4B 1VQHA 3U4ZA 1PH5A 2IY5B 4C2MH 4LF5L 3CCEA 4GN5A 2CCZA 3K7UC 4LF9L 2YTXA 2WAQE 5H1SE 1NY4A 3H0GH 4LW1A 4R4TA 4HJ8A 4YWMA 1WYDA 2JA9A 1S3OA 4YY3Q 4B3SQ 4GKJQ 2UUAQ 5IYCG 2A19A 4GNXA 3D0FA 4DV1L 2E2IH 4A3BH 3T1YL 2UU9Q 3G48A 1FJGQ 1WJJA 2VL6A 4C3IH 2Z0SA 1VQOA 3GTJH 1VQJA 5IYDG 4Y7NH 4HIMA 1YI2A 2VW9A 3J7ZC 4JI7L 3H3VH 1NTGA 4NXNQ 3U50C 4NXMQ 5FJ8H 4A3MG 2F4VQ 3GTGH 3HKZG 4JBWA 4P74A 2BH8A 4IPGA 1RL2A 1N33L 1FL0A 2R93H 4JBKA 1TWAH 4PZ7A 3KJPA 3PUZA 2B29A 3EBEA 2R7ZH 1VQBA 4JOIC 5DLQE 2OQKA 2K4KA 3F2DA 4A3EH 2I5MX 2MNAA 3BJUA 4DK3C 1ASYA 1V9PA 2HIVA 2JQOA 4JI4Q 1I50H 1EFWA 4DV7L 3HOVH 1NJIC 1GKHA 4IFDJ 1A63A 5IYBG 4OWXB 2MFIA 4DPGA 4R1JA 4O2DA 5M3MH 4B3TQ 5FLMH 4LF7L 4PMWA 4LF8Q 1VQDA 2I5HA 2JEBI 4JG2A 2R92H 3M3YH 4YHHL 2RF4A 3ER0A 3J7A5 3STBD 4LF5Q 1JE5A 3F8TA 3L7ZC 1SLJA 1UE6A 2OCEA 1IBMQ 4LF9Q 4DV3Q 2ATWA 2VS1A 4FDBA 5LMUQ 4BBSG 4A3CG 1D7QA 1PH9A 4ME3A 3G6EA 4DV6L 2AMCB 5FLXc 1X3EA 5C44G 1VQMA 5IE8A 4JYAL 4QJFA 1EOVA 1K3RA 1VQAA 1X65A 2H5XA 2OTJA 3T1YQ 1E1TA 4JI1Q 1C7YA 2UXCQ 2RHSB 5E7NA 1KIXA 1VQ7A 1KRSA 2NN6G 3D31A 2D62A 4ALPA 1HR0W 2YU9H 4X62Q 1WCMH 1ASZA 3HOZG 4A3JH 3PO2G 4IOAA 1XPRA 1LTLA 3UDFA 4DR1Q 1YVCA 4LFAL 1YHAA 2MQHA 1RIPA 2OQ0A 4A3GG 2B63G 1J5EL 4X66L 2NVTH 3HOWH 4QIWE 3I4NH 3UE1A 4DUZL 5GROA 5LMNW 4HJ5A 5IWAQ 4JCVE 4A3IG 1Z47A 1QZHA 4QY7A 2CKZB 4GOPB 5C3EH 3PUVA 2YTYA 3M9BA 1SRUA 4DV7Q 3RN2A 4JBMA 2KHJA 3S2HH 1P16A 1IZ6A 1VQLA 1HZ9A 4AQYL 4BY1G 2Z6KC 1KD1C 4X65L 4AYBE 2I0QA 4A75A 2JA6G 3GTLH 4IJHA 2IHFA 1K83H 4YY3L 2ZJQA 4B3SL 2UUAL 4DR6Q 1YHQA 4LF7Q 4GKJL 3AFQA 4A3FG 3J80c 4LFBL 5JJLA 4YHHQ 2UU9L 1LUZA 4DR3Q 1FJGL 4IFDI 3MXNB 4DK6C 1VQ9A 5GADC 4DNIA 3F2BA 4DV0Q 4P71A 5IT9c 2JA5H 1YITA 4UP9A 3HOYH 4GOPC 1KXLA 2WP8J 1QUQB 4NXNL 1UWVA 3HOXH 2UUBQ 4NXML 3I2ZA 2F4VL 3E9HA 3TS0A 4JYAQ 1Q8KA 2VQEQ 1Y1VG 1PYBA 1TXYA 1K9MC 1Q1EA 5IY0A 2AKWB 4J15A 2VY3A 3JAMc 3S15H 3UDXA 4AYBG 1PH8A 1YZ6A 1WFQA 2K14A 3HFZB 2LSSA 1YJ9A 5HGQA 1WOCA 4MNOA 1XNQL 5JEAJ 4JI8L 2CFMA 2B3GA 4LFAQ 3CC2A 4JI4L 4GLXA 2IHEA 3MEFA 1AH9A 4IOCA 4RMFA 4A3EG 1VCIA 1Q7YC 4NB3A 1X3FA 2R6GA 4A3KH 1E3PA 3GDEA 4JOIA 4JI5Q 1VQ5A 4BA2I 4OONA 3CCRA 4LF4Q 4H02A 3W5OA 1X55A 4LF8L 1SROA 3PV0A 4DR4Q 4DAYB 3GTMH 3F1ZA 4AQYQ 1IBML 1EIFA 4X65Q 4DV3L 2R92G 3CXCA 5M5XH 2QEXA 5LMUL 1D8LA 1XTDA 1Q82C 1HNZQ 2JA7H 2K5NA 3L2PA 1UE5A 1PHJA 4WJ3M 3U4VA 2JA8G 1N36Q 4LFBQ 4POFA 2BH2A 3DLLA 4JI1L 4HIDA 3PO3G 2UXCL 4AH6A 1GO3E 1K73C 1FVIA 3ERSX 2N78A 3H3VI 4X62L 3PIPA 2KCTA 2VUMG 3CCSA 4DR1L 2CWPA 5M3FH 1HZCA 1SE8A 3BU2A 1IL2A 1T9HA 2WAQG 4JI3Q 5IP7H 1HH2P 1NE3A 1EWIA 1X54A 4BBRG 3FKIG 1JJ2A 3CCLA 5IWAL 1XNQQ 4DAMA 4JBJA 5GAGC 4UP7A 2V1CC 4JI8Q 3M4QA 4LNQA 2NN6I 1EYGA 1YBYA 4YWKA 3I7FA 4IO9A 3PUXA 4GLVB 3TS2A 4A3LG 4YWLA 2K5VA 2GVAA 3UDGA 2UXBQ 5EAYA 4K0KQ 5IP9H 1O7IA 2K5HA 2WB1E 3BZKA 4DR6L 1HZBA 5C4XH 3KDFA 1TWFH 2QGQA 1VQEA 2EQSA 2NZOA 4DR3L 1VQPA 4BXXH 1VQKA 1DGSA 4BY7H 1W3SA 4JI6Q 2UXDQ 4DV0L 1XMOL 2KCMA 3I4MH 4GKKQ 1PH2A 2Z6KA 1HNWQ 4R4OA 4A93G 4DV5Q 1QVFA 5ELNA 2UUBL 2VQEL 3CCVA 2RCNA 1VQFA 1H95A 1PV4A 1Z9FA 5M5YH 1OXVA 3RLNA 2VQFL 1J6QA 3AQQA 1B8AA 1KC8C 3KJOA 3UDIA 3E0EA 4GOPA 3FHWA 1HR0L 3S1RH 3OTOQ 3JAMi 2HHHL 2UUCQ 3NELA 3AEVA 3J81j 1VQIA 1SFOH 1CSPA 3RNUA 1PH7A 1EUJA 4PG3A 5JEAG 5IYCH 3HOUG 1L2FA 4P75A 2E2JH 4L5QA 2JE6I 2KHIA 3CP0A 1PH3A 2CWAA 3B6YA 1EQQA 1N34L 4JI5L 1OXSC 3PIOA 4DR2Q 5IYDH 4UP8A 4YCUA 1M1KC 2HQLA 1CKNB 3J81i 1NMFA 2L15A 3I56A 4IPDA 2Y0SE 4A3MH 4LF4L 4XIGS 1QUQA 3LGJA 2VZAA 1PH4A 4DR4L 3CMAA 1FGUA 1CUKA 3A5UA 2IT1A 3CCMA 1Y1WG 2ZTCA 4L5TA 3UE0A 1HNZL 1SR3A 3S1QH 3U58A 1SN8A 1HNXQ 1JB7A 3CW2C 4GS3A 3OYYA 1N36L 1JJCB 2E5LQ 4IPCA 3H0GG 3NBHB 3PGZA 4GN3B 1VQ4A 4B3ML 1JJGA 1XMOQ 1B7YB 2PQAA 4B3RQ 4DV2Q 3S14H 2JEAI 2NVXH 4JV5Q 2JJQA 2DUDA 1XNRL 3KFUA 4A3BG 4YCWA 1WI5A 1OXTA 2QA4A 1MIUA 2LXJA 2RHQB 5IYBH 3OW2A 5JJKA 1EQRA 1C0AA 1KRTA 1K8AC 3JC66 4QQBX 2DGYA 2VQFQ 1Q81C 3HKSA 5C0XJ 4DKAC 5FJ8G 4KHZA 4JI3L 1I94L 1IBKL 1V43A 3TQYA 3GTPH 2AWOA 2BA1A 1KL9A 1YHBA 3ZJYC 1HR0Q 2HHHQ 3S1MH 2R93G 4BBSH 1EIYB 4R4CA 1OXUA 4EQ5A 4A3CH 1L1OB 2N8NA 1W2BA 1E7ZA 4DV4Q 5C44H 3EN2A 4HIKA 2OTLA 1BBWA 3KYHC 3GTQH 2R7ZG 2WFWA 1JMCA 3CCJA 3S2DH 1Q1BA 1GM5A 2K52A 2PI2A 4P73A 4PZ6A 4POGA 2UXBL 4EX5A 1N34Q 4A76A 5LMNQ 4K0KL 3HOVG 1PVOA 2PMZE 2HIXA 5J3BA 3RZOH 3HOZH 1XJVA 1X3GA 3PO2H 1E24A 1NMGA 2UXDL 4KLKA 4JI6L 2MO1A 2EXDA 4IPHA 1L1OC 4IJLA 5M3MG 1K8GA 4JI0L 5FLMG 4GKKL 4A3GH 3S1NH 1HNWL 3Q8DA 2B63H 4DV5L 3IRBA 4DR5Q 2ZTEA 5C4JH 4A3IH 4KHPQ 1U0LA 3S16H 3BZCA 3TRZA 1QZGA 4DR7L 4B3MQ 3I4OA 2E2HH 3M7NA 4LFCL 5GAHC 4HIOA 4OXPA 4Y52H 1LM0A 1XNRQ 2Q2UA 3OTOL 3K81C 4BY1H 2UUCL 1PH1A 3CAMA 4RG1A 5GQOA 2JA6H 2N49A 3F2CA 1Q86C 1X9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3F H;  3K0X A;  1N32 Q;  1CKM A;  3S17 H;  1MKH A;  1I94 Q;  1WCM G;  2PNH A;  1IBK Q;  4OWW B;  2F3I A;  4A3J G;  1GD7 A;  4GLA C;  4P72 A;  3CME A;  1XMQ L;  5AJ3 Q;  4C3J H;  4DR2 L;  4APV A;  1KAW A;  2D0O A;  4LF6 Q;  4JI2 Q;  1PH6 A;  2IX0 A;  4R4Q A;  1S72 A;  3GTO H;  1UE7 A;  4LUO A;  1JT8 A;  5C0X I;  3HOW G;  4OX9 Q;  1Y1V H;  2NZH A;  3KF6 B;  2ASB A;  1UE1 A;  3I4N G;  1E1O A;  2C35 B;  2ZM6 Q;  3RLO A;  4C3H H;  4HJ7 A;  2R7F A;  1OTC A;  3GO5 A;  1C9O A;  1U5K A;  5C3E G;  1I5F A;  1HNX L;  2E5L L;  2FXQ A;  3E9I A;  4MTN A;  2KEN A;  4OWT B;  3ULJ A;  5GAE C;  1YIJ A;  1M90 C;  4A3D H;  1B70 B;  4DUY Q;  4GNX B;  5BR8 Q;  2ALY B;  3WWV A;  1N8R C;  3PSI A;  4WJ4 A;  3J80 i;  4JI0 Q;  4B3R L;  4DV2 L;  4TQU S;  2N3S A;  3A0J A;  3GTK H;  4KI0 A;  4JV5 L;  2GN5 A;  2AHO B;  4AIM A;  2ES2 A;  2GVB A;  4A4I A;  3K7A H;  4UY8 C;  4A3D G;  4OO1 I;  4HJ9 A;  2JA5 G;  3HOY G;  3RN5 A;  2YYZ A;  3W1G A;  4LUZ A;  4DR7 Q;  3HOX G;  4LFC Q;  1CKN A;  4QGU A;  3AFP A;  1S40 A;  5C0X G;  3CCU A;  4YCV A;  2YTV A;  1VQC A;  2WB1 G;  4GNX C;  1QVG A;  2EIF A;  3STB C;  1IBL Q;  2LXK A;  3CF5 A;  1GVP A;  4MZ9 A;  1BKB A;  1Q12 A;  1TWG H;  1VS0 A;  4DV4 L;  1AE2 A;  3RLF A;  1Y14 B;  1BBU A;  1LYL A;  2JA8 H;  2F52 A;  2HT1 A;  1HJP A;  5HY6 A;  1K0R A;  3NEM A;  3PO3 H;  1IYJ B;  1N9W A;  1Q46 A;  2Q2H A;  3A74 A;  3CPF A;  1R9T H;  1A8V A;  1XMQ Q;  4X6A H;  2AWN A;  3EIV A;  5LMN L;  3NEN A;  2Q2T A;  5K36 G;  4PZ8 A;  4DV1 Q;  2ZJR A;  1PFS A;  3TRE A;  1MJC A;  2PI2 E;  4A3K G;  2VUM H;  3KF8 B;  1VQ8 A;  1AE3 A;  4JI7 Q;  3KDF B;  3PCO B;  1P8L A;  4X64 L;  3M4O H;  4OO1 G;  1I6H H;  3T1H L;  1G29 1;  2NVY H;  3CC7 A;  3CCQ A;  3PUY A;  1E22 A;  2ID0 A;  1G6P A;  4DR5 L;  3K80 C;  5JJI A;  3FP9 A;  4BBR H;  1NBW A;  3FKI H;  1KHI A;  1X56 A;  1N33 Q;  1A0I A;  3PF4 A;  4KHP L;  1CKO A;  1HZA A;  2E8G A;  1G51 A;  3H15 A;  3M85 A;  3CPW A;  3CQZ H;  2JA7 G;  1L1O A;  1XPO A;  4QL5 A;  3A5Z B;  1VQN A;  4A3L H;  2BA0 A;  1X6O A;  3SGI A;  1CSQ A;  2MO0 A;  4JC0 A;  2Y0S G;  4NPS A;  4R4I A;  4TVA B;  1L0W A;  4XTC S;  5ELO A;  2A8V A;  4UPA A;  3TEH B;  3G71 A;  1N32 L;  3M4P A;  1XPU A;  2XTI A;  2ZJP A;  3GD7 A;  3W1B A;  2JK8 A;  4L5R C;  5AJ3 L;  1PYS B;  5M3F G;  1V1Q A;  1YEZ A;  3KOJ A;  1IXR A;  4JI2 L;  4LF6 L;  4A93 H;  2XGT A;  3CC4 A;  5IP7 G;  4LWC A;  2A1A A;  3VDY A;  2CQO A;  1YJW A;  1MJE A;  3RR5 A;  1YNX A;  3ULP A;  1PA6 A;  1KQS A;  4OX9 L;  3ICE A;  4O0A A;  4LUV A;  2I5L X;  1I3Q H;  2ZM6 L;  1YJN A;  4DV6 Q;  1SMX A;  2NVQ H;  3K8A A;  1UEB A;  3ULL A;  4BA1 I;  3L0O A;  1A62 A;  2K75 A;  3PUW A;  1VQ6 A;  3S24 A;  3PF5 A;  2D0P A;  2YV5 A;  4DUY L;  5BR8 L;  3HOU H;  5IP9 G;  1BVS A;  4X64 Q;  3T1H Q;  1QVC A;  2VNU D;  5C4X G;  2KBN A;  2ZTD A;  2IX1 A;  2PQA B;  5M5W H;  4BXX G;  4BY7 G;  1TWH H;  1VQG A;  2OWO A;  4L5S A;  3I4M G;  2K50 A;  3I55 A;  1TWC H;  1J5E Q;  4X66 Q;  3J81 c;  3DM3 A;  4IFD G;  2R7D A;  4DUZ Q;  3G4S A;  3CD6 A;  3AYH B;  3KLW A;  4B3T L;  3KF6 A;  2Q2I A;  3HKZ E;  1Y1W H;  4HJA A;  3RZD H;  1IBL L;  1OXX K;  4GN4 B;  1VQH A;  3U4Z A;  1PH5 A;  2IY5 B;  4C2M H;  4LF5 L;  3CCE A;  4GN5 A;  2CCZ A;  3K7U C;  4LF9 L;  2YTX A;  2WAQ E;  5H1S E;  1NY4 A;  3H0G H;  4LW1 A;  4R4T A;  4HJ8 A;  4YWM A;  1WYD A;  2JA9 A;  1S3O A;  4YY3 Q;  4B3S Q;  4GKJ Q;  2UUA Q;  5IYC G;  2A19 A;  4GNX A;  3D0F A;  4DV1 L;  2E2I H;  4A3B H;  3T1Y L;  2UU9 Q;  3G48 A;  1FJG Q;  1WJJ A;  2VL6 A;  4C3I H;  2Z0S A;  1VQO A;  3GTJ H;  1VQJ A;  5IYD G;  4Y7N H;  4HIM A;  1YI2 A;  2VW9 A;  3J7Z C;  4JI7 L;  3H3V H;  1NTG A;  4NXN Q;  3U50 C;  4NXM Q;  5FJ8 H;  4A3M G;  2F4V Q;  3GTG H;  3HKZ G;  4JBW A;  4P74 A;  2BH8 A;  4IPG A;  1RL2 A;  1N33 L;  1FL0 A;  2R93 H;  4JBK A;  1TWA H;  4PZ7 A;  3KJP A;  3PUZ A;  2B29 A;  3EBE A;  2R7Z H;  1VQB A;  4JOI C;  5DLQ E;  2OQK A;  2K4K A;  3F2D A;  4A3E H;  2I5M X;  2MNA A;  3BJU A;  4DK3 C;  1ASY A;  1V9P A;  2HIV A;  2JQO A;  4JI4 Q;  1I50 H;  1EFW A;  4DV7 L;  3HOV H;  1NJI C;  1GKH A;  4IFD J;  1A63 A;  5IYB G;  4OWX B;  2MFI A;  4DPG A;  4R1J A;  4O2D A;  5M3M H;  4B3T Q;  5FLM H;  4LF7 L;  4PMW A;  4LF8 Q;  1VQD A;  2I5H A;  2JEB I;  4JG2 A;  2R92 H;  3M3Y H;  4YHH L;  2RF4 A;  3ER0 A;  3J7A 5;  3STB D;  4LF5 Q;  1JE5 A;  3F8T A;  3L7Z C;  1SLJ A;  1UE6 A;  2OCE A;  1IBM Q;  4LF9 Q;  4DV3 Q;  2ATW A;  2VS1 A;  4FDB A;  5LMU Q;  4BBS G;  4A3C G;  1D7Q A;  1PH9 A;  4ME3 A;  3G6E A;  4DV6 L;  2AMC B;  5FLX c;  1X3E A;  5C44 G;  1VQM A;  5IE8 A;  4JYA L;  4QJF A;  1EOV A;  1K3R A;  1VQA A;  1X65 A;  2H5X A;  2OTJ A;  3T1Y Q;  1E1T A;  4JI1 Q;  1C7Y A;  2UXC Q;  2RHS B;  5E7N A;  1KIX A;  1VQ7 A;  1KRS A;  2NN6 G;  3D31 A;  2D62 A;  4ALP A;  1HR0 W;  2YU9 H;  4X62 Q;  1WCM H;  1ASZ A;  3HOZ G;  4A3J H;  3PO2 G;  4IOA A;  1XPR A;  1LTL A;  3UDF A;  4DR1 Q;  1YVC A;  4LFA L;  1YHA A;  2MQH A;  1RIP A;  2OQ0 A;  4A3G G;  2B63 G;  1J5E L;  4X66 L;  2NVT H;  3HOW H;  4QIW E;  3I4N H;  3UE1 A;  4DUZ L;  5GRO A;  5LMN W;  4HJ5 A;  5IWA Q;  4JCV E;  4A3I G;  1Z47 A;  1QZH A;  4QY7 A;  2CKZ B;  4GOP B;  5C3E H;  3PUV A;  2YTY A;  3M9B A;  1SRU A;  4DV7 Q;  3RN2 A;  4JBM A;  2KHJ A;  3S2H H;  1P16 A;  1IZ6 A;  1VQL A;  1HZ9 A;  4AQY L;  4BY1 G;  2Z6K C;  1KD1 C;  4X65 L;  4AYB E;  2I0Q A;  4A75 A;  2JA6 G;  3GTL H;  4IJH A;  2IHF A;  1K83 H;  4YY3 L;  2ZJQ A;  4B3S L;  2UUA L;  4DR6 Q;  1YHQ A;  4LF7 Q;  4GKJ L;  3AFQ A;  4A3F G;  3J80 c;  4LFB L;  5JJL A;  4YHH Q;  2UU9 L;  1LUZ A;  4DR3 Q;  1FJG L;  4IFD I;  3MXN B;  4DK6 C;  1VQ9 A;  5GAD C;  4DNI A;  3F2B A;  4DV0 Q;  4P71 A;  5IT9 c;  2JA5 H;  1YIT A;  4UP9 A;  3HOY H;  4GOP C;  1KXL A;  2WP8 J;  1QUQ B;  4NXN L;  1UWV A;  3HOX H;  2UUB Q;  4NXM L;  3I2Z A;  2F4V L;  3E9H A;  3TS0 A;  4JYA Q;  1Q8K A;  2VQE Q;  1Y1V G;  1PYB A;  1TXY A;  1K9M C;  1Q1E A;  5IY0 A;  2AKW B;  4J15 A;  2VY3 A;  3JAM c;  3S15 H;  3UDX A;  4AYB G;  1PH8 A;  1YZ6 A;  1WFQ A;  2K14 A;  3HFZ B;  2LSS A;  1YJ9 A;  5HGQ A;  1WOC A;  4MNO A;  1XNQ L;  5JEA J;  4JI8 L;  2CFM A;  2B3G A;  4LFA Q;  3CC2 A;  4JI4 L;  4GLX A;  2IHE A;  3MEF A;  1AH9 A;  4IOC A;  4RMF A;  4A3E G;  1VCI A;  1Q7Y C;  4NB3 A;  1X3F A;  2R6G A;  4A3K H;  1E3P A;  3GDE A;  4JOI A;  4JI5 Q;  1VQ5 A;  4BA2 I;  4OON A;  3CCR A;  4LF4 Q;  4H02 A;  3W5O A;  1X55 A;  4LF8 L;  1SRO A;  3PV0 A;  4DR4 Q;  4DAY B;  3GTM H;  3F1Z A;  4AQY Q;  1IBM L;  1EIF A;  4X65 Q;  4DV3 L;  2R92 G;  3CXC A;  5M5X H;  2QEX A;  5LMU L;  1D8L A;  1XTD A;  1Q82 C;  1HNZ Q;  2JA7 H;  2K5N A;  3L2P A;  1UE5 A;  1PHJ A;  4WJ3 M;  3U4V A;  2JA8 G;  1N36 Q;  4LFB Q;  4POF A;  2BH2 A;  3DLL A;  4JI1 L;  4HID A;  3PO3 G;  2UXC L;  4AH6 A;  1GO3 E;  1K73 C;  1FVI A;  3ERS X;  2N78 A;  3H3V I;  4X62 L;  3PIP A;  2KCT A;  2VUM G;  3CCS A;  4DR1 L;  2CWP A;  5M3F H;  1HZC A;  1SE8 A;  3BU2 A;  1IL2 A;  1T9H A;  2WAQ G;  4JI3 Q;  5IP7 H;  1HH2 P;  1NE3 A;  1EWI A;  1X54 A;  4BBR G;  3FKI G;  1JJ2 A;  3CCL A;  5IWA L;  1XNQ Q;  4DAM A;  4JBJ A;  5GAG C;  4UP7 A;  2V1C C;  4JI8 Q;  3M4Q A;  4LNQ A;  2NN6 I;  1EYG A;  1YBY A;  4YWK A;  3I7F A;  4IO9 A;  3PUX A;  4GLV B;  3TS2 A;  4A3L G;  4YWL A;  2K5V A;  2GVA A;  3UDG A;  2UXB Q;  5EAY A;  4K0K Q;  5IP9 H;  1O7I A;  2K5H A;  2WB1 E;  3BZK A;  4DR6 L;  1HZB A;  5C4X H;  3KDF A;  1TWF H;  2QGQ A;  1VQE A;  2EQS A;  2NZO A;  4DR3 L;  1VQP A;  4BXX H;  1VQK A;  1DGS A;  4BY7 H;  1W3S A;  4JI6 Q;  2UXD Q;  4DV0 L;  1XMO L;  2KCM A;  3I4M H;  4GKK Q;  1PH2 A;  2Z6K A;  1HNW Q;  4R4O A;  4A93 G;  4DV5 Q;  1QVF A;  5ELN A;  2UUB L;  2VQE L;  3CCV A;  2RCN A;  1VQF A;  1H95 A;  1PV4 A;  1Z9F A;  5M5Y H;  1OXV A;  3RLN A;  2VQF L;  1J6Q A;  3AQQ A;  1B8A A;  1KC8 C;  3KJO A;  3UDI A;  3E0E A;  4GOP A;  3FHW A;  1HR0 L;  3S1R H;  3OTO Q;  3JAM i;  2HHH L;  2UUC Q;  3NEL A;  3AEV A;  3J81 j;  1VQI A;  1SFO H;  1CSP A;  3RNU A;  1PH7 A;  1EUJ A;  4PG3 A;  5JEA G;  5IYC H;  3HOU G;  1L2F A;  4P75 A;  2E2J H;  4L5Q A;  2JE6 I;  2KHI A;  3CP0 A;  1PH3 A;  2CWA A;  3B6Y A;  1EQQ A;  1N34 L;  4JI5 L;  1OXS C;  3PIO A;  4DR2 Q;  5IYD H;  4UP8 A;  4YCU A;  1M1K C;  2HQL A;  1CKN B;  3J81 i;  1NMF A;  2L15 A;  3I56 A;  4IPD A;  2Y0S E;  4A3M H;  4LF4 L;  4XIG S;  1QUQ A;  3LGJ A;  2VZA A;  1PH4 A;  4DR4 L;  3CMA A;  1FGU A;  1CUK A;  3A5U A;  2IT1 A;  3CCM A;  1Y1W G;  2ZTC A;  4L5T A;  3UE0 A;  1HNZ L;  1SR3 A;  3S1Q H;  3U58 A;  1SN8 A;  1HNX Q;  1JB7 A;  3CW2 C;  4GS3 A;  3OYY A;  1N36 L;  1JJC B;  2E5L Q;  4IPC A;  3H0G G;  3NBH B;  3PGZ A;  4GN3 B;  1VQ4 A;  4B3M L;  1JJG A;  1XMO Q;  1B7Y B;  2PQA A;  4B3R Q;  4DV2 Q;  3S14 H;  2JEA I;  2NVX H;  4JV5 Q;  2JJQ A;  2DUD A;  1XNR L;  3KFU A;  4A3B G;  4YCW A;  1WI5 A;  1OXT A;  2QA4 A;  1MIU A;  2LXJ A;  2RHQ B;  5IYB H;  3OW2 A;  5JJK A;  1EQR A;  1C0A A;  1KRT A;  1K8A C;  3JC6 6;  4QQB X;  2DGY A;  2VQF Q;  1Q81 C;  3HKS A;  5C0X J;  4DKA C;  5FJ8 G;  4KHZ A;  4JI3 L;  1I94 L;  1IBK L;  1V43 A;  3TQY A;  3GTP H;  2AWO A;  2BA1 A;  1KL9 A;  1YHB A;  3ZJY C;  1HR0 Q;  2HHH Q;  3S1M H;  2R93 G;  4BBS H;  1EIY B;  4R4C A;  1OXU A;  4EQ5 A;  4A3C H;  1L1O B;  2N8N A;  1W2B A;  1E7Z A;  4DV4 Q;  5C44 H;  3EN2 A;  4HIK A;  2OTL A;  1BBW A;  3KYH C;  3GTQ H;  2R7Z G;  2WFW A;  1JMC A;  3CCJ A;  3S2D H;  1Q1B A;  1GM5 A;  2K52 A;  2PI2 A;  4P73 A;  4PZ6 A;  4POG A;  2UXB L;  4EX5 A;  1N34 Q;  4A76 A;  5LMN Q;  4K0K L;  3HOV G;  1PVO A;  2PMZ E;  2HIX A;  5J3B A;  3RZO H;  3HOZ H;  1XJV A;  1X3G A;  3PO2 H;  1E24 A;  1NMG A;  2UXD L;  4KLK A;  4JI6 L;  2MO1 A;  2EXD A;  4IPH A;  1L1O C;  4IJL A;  5M3M G;  1K8G A;  4JI0 L;  5FLM G;  4GKK L;  4A3G H;  3S1N H;  1HNW L;  3Q8D A;  2B63 H;  4DV5 L;  3IRB A;  4DR5 Q;  2ZTE A;  5C4J H;  4A3I H;  4KHP Q;  1U0L A;  3S16 H;  3BZC A;  3TRZ A;  1QZG A;  4DR7 L;  4B3M Q;  3I4O A;  2E2H H;  3M7N A;  4LFC L;  5GAH C;  4HIO A;  4OXP A;  4Y52 H;  1LM0 A;  1XNR Q;  2Q2U A;  3OTO L;  3K81 C;  4BY1 H;  2UUC L;  1PH1 A;  3CAM A;  4RG1 A;  5GQO A;  2JA6 H;  2N49 A;  3F2C A;  1Q86 C;  1X9N A; 
#chains in the Genus database with same CATH topology
 5KYL A;  4ZQ3 A;  1CKM A;  1WCM G;  3NWS A;  4C3J B;  1AFP A;  4OWW B;  2F3I A;  1GD7 A;  4GLA C;  1AZQ A;  5AJ3 Q;  4C3J H;  4R8N A;  4I7Z C;  3GTJ B;  1S72 A;  1J8I A;  3H6M A;  1LLR D;  2ASB A;  4C3H B;  1HUN A;  2C35 B;  1ZYR C;  4AYB B;  4Z9C B;  5IOD A;  3E6Z X;  4C3H H;  4HJ7 A;  1OTC A;  3GO5 A;  5C3E G;  3QOJ A;  4MTN A;  3ULJ A;  2CH4 A;  4WJW A;  5GAE C;  1YIJ A;  4A3E B;  1B70 B;  3WWV A;  1FR3 A;  1N8R C;  3IAY A;  4JI0 Q;  4B3R L;  4DV2 L;  3QJY A;  4RWS C;  2GN5 A;  2XNA C;  4AIM A;  3X3N A;  2Z6B A;  3L3O C;  3DUZ A;  5T1I A;  4A4I A;  3K7A H;  4A3D G;  4HJ9 A;  2YYZ A;  3W1G A;  4DR7 Q;  2K33 A;  2XRS D;  4PMC A;  5C0X G;  4YCV A;  3CCU A;  2R92 B;  2MHV A;  2WB1 G;  3OIQ A;  1BKB A;  1Q12 A;  1TWG H;  1BBU A;  2J4X A;  1F77 A;  5KNC A;  3PO3 B;  1PTO C;  2F52 A;  5COR A;  4K8I A;  4CKC A;  5JVH 3;  3PO3 H;  1IYJ B;  2Q2H A;  1OO9 B;  3BVZ A;  1PTO F;  4FNF A;  1S5D D;  4RAU C;  2YU9 B;  1AE3 A;  4WRD A;  2NVY H;  3ITP A;  3PUY A;  2ID0 A;  4CHT B;  2IW3 A;  4DR5 L;  5C3X A;  3FKI H;  1KHI A;  1X56 A;  1N33 Q;  3OWF A;  1HZA A;  2E8G A;  2ZT9 C;  3CQZ B;  3H91 A;  4XYO A;  5DAU A;  4XXE A;  2A69 C;  1BNZ A;  3CQZ H;  4RGM A;  1L1O A;  4IUN A;  1VQN A;  4NPS A;  4WOR A;  5BN3 A;  2PYK A;  2D2C C;  5ELO A;  4XYQ A;  1TII D;  3TEH B;  1N32 L;  2XTI A;  4OGQ C;  2JK8 A;  2BE5 C;  5C4Z A;  1LV9 A;  1YEZ A;  2K6A A;  4JI2 L;  1IXR A;  4LF6 L;  3V2T A;  3CC4 A;  1G91 A;  4ZAI A;  3MWY W;  1KQS A;  1YNX A;  1PA6 A;  2F03 A;  1SYD A;  4O0A A;  4ZYS A;  1WTQ A;  4KJN A;  4BA1 I;  3L0O A;  2K75 A;  1H9K A;  3PF5 A;  2RQX A;  2VB2 X;  2HCC A;  3HOU B;  2D0P A;  2YV5 A;  1EIG A;  1U4R A;  3HOU H;  4S3S A;  3T1H Q;  5FO8 B;  1SNC A;  2KBN A;  1MSG A;  1PDQ A;  2PQA B;  1PLF A;  4BY7 G;  1TWC B;  1TWH H;  5IGG A;  4L5S A;  4LAA A;  4F7X A;  2K50 A;  1TWC H;  4KV6 A;  1J5E Q;  4H13 C;  4DK1 A;  3URY A;  1E0B A;  1KLU D;  2Q2I A;  3VR5 A;  3HKZ E;  3DHQ A;  1IBL L;  4GN4 B;  2EJG C;  1PH5 A;  1ILQ A;  3C3L A;  1U4L A;  3BG3 A;  1LT6 D;  4YY3 Q;  3DWP A;  5IYC G;  1PMR A;  2F0J A;  4QUC A;  1VQJ A;  4CDC C;  3U50 C;  2F4V Q;  3HKZ G;  2Z8L A;  1MD2 D;  3A54 A;  4P74 A;  1RL2 A;  3NHH A;  3K5M A;  3IL8 A;  3KLS X;  5KEE A;  2R7Z H;  2C5C A;  4PQX A;  2K4K A;  1X32 A;  4KHV A;  2EDG A;  1EZ8 A;  2ENB A;  4DAP A;  2MNA A;  4DK3 C;  5FLX L;  1XTC D;  1Y69 U;  1I6V C;  4DK0 A;  1PTO H;  1A63 A;  5M3M B;  4QCL A;  5C4X B;  5M3M H;  3E5S A;  4LF7 L;  1EQT A;  4PMW A;  2DJF C;  3ER0 A;  1WD1 A;  1JE5 A;  3L7Z C;  4LF9 Q;  3N6R A;  2VS1 A;  5LMU Q;  4BBS G;  1PH9 A;  4ME3 A;  5FLX c;  1X3E A;  1VQM A;  2OTJ A;  1EOV A;  1K3R A;  1VQA A;  1LT3 D;  4JI1 Q;  1A2U A;  5KYI A;  2RHS B;  5E7N A;  1VQ7 A;  2TSS A;  2JSO A;  3MTS A;  1ASZ A;  3HOZ G;  3PO2 G;  1D5Z C;  4G7H C;  2B63 G;  2V4D A;  2KHS A;  1AN8 A;  2WIN B;  3D3R A;  4QIW E;  2PPB C;  1MHW C;  4DUZ L;  4A3M B;  5IWA Q;  4JCV E;  4QY7 A;  1B9N A;  2SNM A;  2CKZ B;  1HQM C;  2K1B A;  1SRU A;  1VMP A;  1P16 A;  1IZ6 A;  3JAM L;  4IJH A;  2UUA L;  4HCS A;  5C5L A;  1YHQ A;  4LFB L;  4B08 A;  1FJG L;  4DR3 Q;  1UNS A;  1XXG A;  3MXN B;  1NCV A;  2JA5 H;  3HOX B;  4GOP C;  4K5W A;  2WP8 J;  1UWV A;  3HOX H;  4NXM L;  1Q8K A;  1LT4 D;  4ZLT F;  3JAM c;  3UDX A;  1LTS D;  1YZ6 A;  1JOR A;  5JEA J;  3NTK A;  1B2T A;  3M4Y A;  4JI4 L;  3S2D B;  1AH9 A;  1EEF D;  4FF2 A;  4CDE C;  4NB3 A;  2R6G A;  1E3P A;  3T51 B;  4OO1 H;  4OON A;  3W5O A;  4LF8 L;  1SRO A;  2BCO A;  2KCN A;  1HTP A;  3S1N B;  4DAY B;  1B3Q A;  4AQY Q;  1IBM L;  4K8J A;  3NP8 A;  2QEX A;  2EJM A;  4A3I B;  1STE A;  3Q6S A;  2Q8T A;  1SAP A;  2BH2 A;  1QNU A;  2F0F A;  1FVI A;  5G3L D;  3NQI A;  2JA6 B;  1FGB D;  3H3V I;  3PIP A;  4UHV A;  2BDO A;  3CCS A;  2R61 A;  4ILW A;  2JP1 A;  1SE8 A;  2WAQ G;  5IP7 H;  2RCF A;  1EWI A;  4BBR G;  1TY0 A;  1JR0 D;  1XNQ Q;  3RUZ A;  5GAG C;  4UP7 A;  4JI8 Q;  3M4Q A;  2F0T A;  4YWK A;  1NAP A;  1JWU D;  3D4D A;  3TS2 A;  4A3L G;  1QOH A;  2B2Y C;  2B2U C;  3I8Z A;  4QMG A;  5CV8 A;  4KY5 A;  3A8I E;  5EAY A;  1TWF B;  5IP9 H;  3BZK A;  4DR6 L;  1TWF H;  3R93 A;  2EQS A;  1ENC A;  4JI6 Q;  2KCM A;  3IFT A;  1PH2 A;  1HNW Q;  4A93 G;  4DV5 Q;  2A6E D;  1QVF A;  5M5Y B;  2F0V A;  3SDZ A;  3V96 A;  5M5Y H;  3DWA A;  1OXV A;  4EQN A;  3ND9 A;  2VQF L;  1B8A A;  1BDO A;  2PCF B;  1I4Q A;  3K5O A;  3KJO A;  3UDI A;  1HR0 L;  1SFO B;  2UUC Q;  3NEL A;  3QWN A;  2JA8 B;  1VQI A;  3VYS A;  1SFO H;  1CSP A;  1K8O A;  3J80 L;  1L2F A;  1I4X A;  4ZRZ A;  5FLX E;  5T1G A;  1LTG D;  1EQQ A;  4TKO B;  4DR2 Q;  4N9P A;  3PIO A;  3MXN A;  5D65 A;  1CKN B;  3J81 i;  1NMF A;  1VMC A;  1WTR A;  1EYC A;  2MGS A;  3LGJ A;  1HQR D;  2VZA A;  1UUP A;  3LNN A;  1NNX A;  3A5U A;  2IPK D;  3U58 A;  1SN8 A;  1HNX Q;  3OYY A;  1N36 L;  4XQQ A;  3HZX A;  4RGT A;  1L0Y B;  3H0G G;  3NBH B;  4GN3 B;  4CDF C;  1JJG A;  1B7Y B;  1CT1 D;  4RKB A;  2D9U A;  4XQN A;  3I90 A;  2JJQ A;  2EJF C;  3RMH A;  1RJT A;  1XNR L;  4A3B G;  1WI5 A;  1EQR A;  1C0A A;  3BVG A;  3OIP A;  3GTP B;  1Q81 C;  4HCE A;  5FK9 C;  5C0X J;  5FJ8 G;  3H3V H;  3GTP H;  2AWO A;  2BA1 A;  2BOS A;  1YHB A;  4RGN A;  2HHH Q;  3S1M H;  2R93 G;  4DAY A;  5C44 B;  4EQ5 A;  1AEX A;  3NTI A;  1E7Z A;  2EXZ A;  5C44 H;  4DV4 Q;  1JMC A;  3PIP 3;  1Q1B A;  4P73 A;  3MHB A;  1EY4 A;  4O1N A;  4A76 A;  1L0X B;  3JAM E;  2PMZ E;  3NXW A;  1NMG A;  3EA6 A;  3G6J B;  1L1O C;  4IJL A;  4GKK L;  3OPO A;  4M8A A;  4JI0 L;  5EGT A;  5CV7 A;  3IRB A;  4I65 A;  1V8Q A;  2ZTE A;  1QNK A;  4KHP Q;  1HRJ A;  5I6Y A;  1ICW A;  2OF1 A;  4DR7 L;  1EY9 A;  1SNP A;  5K5P A;  4B3M Q;  1IKL A;  3I4O A;  1YNJ C;  4HIO A;  4BY1 B;  5JVG 3;  2Q2U A;  4BY1 H;  2K28 A;  5NUC A;  4KD3 A;  4ID6 A;  1MKH A;  4A3J G;  4P72 A;  4CKE A;  3GTO B;  1SMY D;  4F88 A;  3GTO H;  1JT8 A;  5E3F A;  3L9A X;  2NZ1 D;  5C0X I;  4OX9 Q;  3HOW G;  3KF6 B;  1GUN A;  3I4N G;  1YNN D;  3GTG B;  1CA6 A;  3RLO A;  1Q8I A;  3E0J A;  3DXJ C;  2R7F A;  1PXU A;  1U5K A;  5G3L F;  2A68 C;  2E5L L;  2FXQ A;  1M90 C;  2KEN A;  1EY0 A;  3P20 A;  4GNX B;  1S5C D;  2K5Q A;  4RFB A;  3TN2 A;  5BR8 Q;  5TSS A;  1JWS D;  3PSI A;  1B50 A;  2ZXR A;  3KBG A;  4TQU S;  3A0J A;  3GTK H;  4JV5 L;  4ZKB B;  1I50 B;  1R4Q B;  3HOY G;  1O80 A;  1BCP B;  2NYZ D;  3HRZ C;  4IZ8 A;  1CKN A;  1FNV A;  1IKM A;  3U9O A;  5CBE E;  2EIF A;  2L9H A;  2NUC A;  1VS0 A;  2HT1 A;  1PRT D;  2HCI A;  4N8X 1;  2EYO A;  4X6A H;  3NBH A;  4N9T A;  4FVM A;  4A3K G;  1VQ8 A;  2RA4 A;  1SYE A;  4O42 A;  1WCM B;  3PCO B;  1P8L A;  3D6W A;  3T1H L;  4IQZ A;  1B9M A;  4LJZ C;  1E22 A;  1G6P A;  5JJI A;  3DEO A;  3T56 B;  3K0Y A;  1A0I A;  3PF4 A;  1CKO A;  3H15 A;  3M85 A;  3CPW A;  1RD9 D;  1XPO A;  1TT2 A;  3A5Z B;  3SGI A;  1X6O A;  1CSQ A;  1SYF A;  4JC0 A;  2Y0S G;  3QG1 A;  3O13 A;  2Q8I B;  3G71 A;  5DM6 3;  1EIH A;  3EQL C;  2ZJP A;  1G8Z D;  1PZI D;  1PYS B;  2KJX A;  3KOJ A;  4ZCK A;  1EQV A;  2XGT A;  4LWC A;  2CH4 W;  2K5D A;  1UAP A;  3ULP A;  3ICE A;  1QIL A;  4LUV A;  3CRK C;  1E2Z A;  5CGK A;  2Q8R E;  2ZM6 L;  1F2M A;  4DV6 Q;  5KRU A;  1F9S A;  2N55 A;  2WB1 B;  1SMX A;  3TZD A;  1PFN A;  3K8A A;  1MI2 A;  5HUR A;  1IYU A;  1VQ6 A;  3S15 B;  1H9S A;  2RBM A;  5KNB A;  4DUY L;  4X64 Q;  1BVS A;  2VNU D;  3IKJ A;  3UI2 A;  1EOT A;  4K14 A;  2F0I A;  4IUQ A;  1BR9 A;  1G2T A;  2OWO A;  3I4M G;  1U9R A;  4X66 Q;  3J81 c;  4IFD G;  2R7D A;  3K59 A;  3RZD B;  3AYH B;  1Y1W B;  3I4L A;  3KF6 A;  5IOC A;  2F0M A;  2AUJ D;  4ODG A;  4DN4 M;  1Y1W H;  3RZD H;  4C2M B;  1VQH A;  4C2M H;  4GN5 A;  4DU9 A;  4LF9 L;  1NY4 A;  3CKI B;  4YWM A;  2RKS A;  1WYD A;  4OIJ A;  4B3S Q;  4GKJ Q;  4GNX A;  3K5N A;  4DV1 L;  3BS1 A;  4FP5 D;  3G48 A;  1WJJ A;  1JWM D;  3GTJ H;  4JI7 L;  1YI2 A;  2VW9 A;  3AB9 A;  1NSN S;  3NPP A;  1DYQ A;  1A6X A;  3OHX C;  4JBK A;  2EY6 A;  4PZ7 A;  3KJP A;  1LTR D;  4DXG A;  3EBE A;  3ND8 A;  5DLQ E;  2OQK A;  3F2D A;  4A3E H;  1WTV A;  1LTA D;  4M1U B;  3BJU A;  3DWQ A;  1ASY A;  1EYD A;  2F3V A;  5DM7 3;  3M7G A;  5FO7 B;  2MFI A;  4B3T Q;  5EBD A;  5FLM H;  1IW7 C;  2MUY A;  1BF4 A;  2R92 H;  4BY7 B;  1BO0 A;  1S4Z A;  1C8C A;  2RF4 A;  4FF1 A;  3IFD A;  3DMU A;  3STB D;  4LF5 Q;  1ICF B;  5I2Y A;  1SLJ A;  2DJG C;  4FDB A;  3ONA B;  3G6E A;  5IE8 A;  2H5X A;  4KKT A;  1JOO A;  2EVB A;  2QIL A;  1KIX A;  5EKK A;  1WTP A;  3FPP A;  4ALP A;  2YU9 H;  4X62 Q;  3BYY B;  3MVV A;  4IOA A;  3GV3 A;  5EPJ A;  2KQ3 A;  4DR1 Q;  1YVC A;  2MQH A;  1RIP A;  4A3G G;  4KKU A;  1TVX A;  1C48 A;  3PUV A;  3G7L A;  3RN2 A;  3S1Q B;  4K2K A;  4AQY L;  3GTL B;  4AYB E;  2I0Q A;  3GTL H;  1D5M C;  4R9W A;  1A3U A;  4FXG C;  4K5V A;  2XN9 C;  2UU9 L;  1LUZ A;  2VB3 X;  3VR6 A;  3SK5 A;  2NVX B;  4HN7 A;  4DV0 Q;  3F2B A;  4C3J G;  1Q90 A;  1KXL A;  4NXN L;  1ROD A;  2QW7 A;  3TS0 A;  4JYA Q;  3HEJ A;  1G2S A;  4NKL A;  4C3H G;  4J15 A;  4AYB G;  4L6T B;  5KGU A;  1WFQ A;  5IIF A;  4MNO A;  1XNQ L;  4JI8 L;  2OEO A;  4LFA Q;  1CI3 M;  2IHE A;  5K36 H;  2VXW A;  3K57 A;  4A3E G;  1VCI A;  1Q7Y C;  1KDA A;  1X3F A;  4LMQ D;  1WTX A;  4JOI A;  4JI5 Q;  3HOZ B;  1PFM A;  4LF4 Q;  4H02 A;  3GTM B;  4DR4 Q;  3GTM H;  2EY5 A;  1EIF A;  2JA7 B;  4DV3 L;  2R92 G;  1D8L A;  4KKS A;  2JA7 H;  4KY6 A;  1DD2 A;  3L2P A;  1UE5 A;  4WJ3 M;  2EPB A;  3U4V A;  3J81 E;  2E2H B;  1RHP A;  3PO3 G;  2UXC L;  1LAB A;  4AH6 A;  2DN8 A;  1I4H A;  2F0N A;  2N78 A;  3EVQ A;  1F9Q A;  1V1P B;  5FOB B;  1XX8 A;  2KCT A;  3HS0 C;  5M3F B;  2C9O A;  5D3I B;  3S17 B;  1II3 A;  1SYG A;  5M3F H;  1MGS A;  3GP7 A;  1T9H A;  4JI3 Q;  1X54 A;  1JJ2 A;  3FKI G;  4CDD C;  2QDL A;  4DAM A;  2XVS A;  5CV5 A;  2NN6 I;  4G7Z C;  1YBY A;  4IO9 A;  4PNY A;  2AUK A;  1STY A;  3W2D A;  3EFX D;  3BDO A;  1Z6H A;  5C4X H;  3AMU A;  2QGQ A;  2NZO A;  4BXX H;  2EYL A;  2CW0 D;  5E4X A;  4DAV A;  2Z6K A;  3DM1 A;  1PRT B;  4R4O A;  2UUB L;  2VQE L;  3CCV A;  2RCN A;  1PV4 A;  1BCP D;  3RLN A;  5CMD A;  1KC8 C;  1WD0 A;  1MSH A;  2HHH L;  3AEV A;  5HGT A;  1ET6 A;  3RNU A;  1CK1 A;  1EUJ A;  3HOU G;  1KNE A;  1W6K A;  5ELD A;  1PH3 A;  3CP0 A;  3NE5 B;  2CWA A;  3B6Y A;  3I3C A;  3J7A V;  4EVO A;  5IYD H;  1BXT A;  2PW7 A;  4A3M H;  1IYV A;  2WII B;  1FGU A;  3NK9 A;  2WAQ B;  4IUR A;  2IT1 A;  3VR3 A;  1KLG D;  5JPM C;  4L5T A;  1HNZ L;  1SR3 A;  1CM9 A;  3CW2 C;  4GS3 A;  3F2C A;  4N8F A;  1SE3 A;  3PGZ A;  4B3M L;  3S14 B;  1XMO Q;  1X3Q A;  2PQA A;  3C1E A;  4B3R Q;  4DV2 Q;  3A56 A;  3S14 H;  1K0S A;  2DUD A;  1DM0 B;  1OXT A;  2LXJ A;  5IYB H;  2RHQ B;  5JJK A;  3A8K E;  5IGC A;  1GUT A;  1STH A;  2DGY A;  2GA4 B;  3TQY A;  2ICI A;  1TS3 A;  2LKV A;  3ZJY C;  3MXU A;  3C46 A;  1MBY A;  3GTQ B;  1EIY B;  4R4C A;  4A3C H;  4C56 C;  4HIK A;  3EN2 A;  3GTQ H;  3KYH C;  1I3Q B;  4IUP A;  2R7Z G;  3S2D H;  3H3V C;  2PI2 A;  4PZ6 A;  4POG A;  2UXB L;  4EX5 A;  4DXF A;  2NN6 H;  4K0K L;  1HA5 A;  3VYR A;  1PVO A;  1V1P A;  4KLK A;  2UXD L;  2MO1 A;  4P2C B;  5M3M G;  1K8G A;  3TP6 A;  3S1N H;  5M5W B;  2RVL A;  1GHK A;  4DR5 Q;  3T4A C;  2EOT A;  4A3I H;  2I46 A;  1QZG A;  4G57 A;  1SJE D;  2B2W A;  2EYH A;  1LM0 A;  5FO9 B;  3OTO L;  4RG1 A;  2JA6 H;  1STB A;  4A3F B;  1E2V A;  2N49 A;  4A3F H;  1N32 Q;  1IBK Q;  3TP5 A;  4RCO A;  1SXT A;  3BVM A;  4APV A;  1IL8 A;  1KAW A;  4LF6 Q;  4JI2 Q;  1PH6 A;  1Y1V B;  5KIX A;  2IX0 A;  4R4Q A;  1SSO A;  1Y1V H;  3SXH A;  3U9S A;  1UE1 A;  5CC4 A;  2M9V A;  2DY7 A;  2L55 A;  1UEA B;  3BYT B;  2Z4H A;  2R93 B;  1I5F A;  4J1M A;  1S5E D;  4WJ4 A;  1RF2 D;  3MXP A;  2AHO B;  2GVB A;  1B4O A;  4U67 3;  4UY8 C;  2Z9H A;  2JA5 G;  4UDU C;  3RN5 A;  4LUZ A;  3HOX G;  4L8J A;  2FFK B;  3AFP A;  1S40 A;  2YTV A;  4GNX C;  4B9X A;  1TS4 A;  1IBL Q;  1GVP A;  4MZ9 A;  4KN4 C;  2NTT A;  1AE2 A;  2JA8 H;  4EGV A;  4OL7 A;  4F87 A;  1CTM A;  1SE4 A;  1M4V A;  4X3K A;  5HY6 A;  2LY7 A;  1N9W A;  1C4Q A;  3CPF A;  1XMQ Q;  1GUS A;  2Z1C A;  3EIV A;  5LMN L;  2PMZ B;  2Q2T A;  4PZ8 A;  3ERO A;  2VUM B;  2ZJR A;  1PFS A;  3TRE A;  4ZUI A;  1MJC A;  2VUM H;  1B44 D;  3KDF B;  1BCP F;  2CQA A;  2F0G A;  4BS9 A;  4X64 L;  4OO1 G;  4KJO A;  1GJX A;  2HD3 A;  1G29 1;  4KMU C;  1JOQ A;  3WDN A;  3K80 C;  2K05 A;  2ICE C;  1QB5 D;  3MXG A;  1ESF A;  1BUV T;  2SNS A;  2NVT B;  1ZEQ X;  1G51 A;  3I4N B;  5DEH A;  1KAA A;  1LO5 D;  1L0W A;  4XTC S;  1I4R A;  4UPA A;  1GUW A;  4MN3 A;  5DNF A;  3M4P A;  3W1B A;  5AJ3 L;  2NBF A;  2MP1 A;  1V1Q A;  1S5F D;  3HOY B;  5IP7 G;  1CHQ D;  3VDY A;  1YJW A;  2CQO A;  1MJE A;  3RR5 A;  2ZXP A;  4EQO A;  3KLS A;  2IX3 A;  1QE6 A;  3V05 A;  1UEB A;  3ULL A;  1X3P A;  4CGY B;  1A62 A;  3PUW A;  1JE4 A;  3S24 A;  1GHJ A;  5IP9 G;  5JEA H;  1HPC A;  1V1O A;  2A73 B;  5ELC A;  1VQG A;  4CJ2 C;  3I55 A;  1GXD C;  5A2Q L;  3K6O A;  1VF5 C;  2PW5 A;  5FKA C;  1SDF A;  1CHP D;  3LWE A;  3CD6 A;  4DUZ Q;  2KOL A;  2AQ1 B;  4HSV A;  4B3T L;  2EYF A;  3OOC A;  4LF5 L;  2CCZ A;  3K7U C;  2NTS A;  4HJ8 A;  5CV4 A;  2F0D A;  1VDZ A;  2UUA Q;  2Y0S B;  4C3I B;  1FJG Q;  2F0P A;  1LT5 D;  4Y7N B;  4C3I H;  2Z0S A;  1ESR A;  5EJW A;  4Y7N H;  4MTK A;  4X3T A;  1NTG A;  4MIU A;  4NXM Q;  3GTG H;  1U4P A;  1ZYR D;  1TWA B;  3ERQ A;  2BH8 A;  4IPG A;  1N33 L;  5J39 A;  1TWA H;  3PUZ A;  5I9P A;  3TSS A;  2B2V A;  5L37 A;  3SEB A;  3P7J A;  4JOI C;  2G9D A;  4H7B A;  2E74 C;  4RGO S;  1HTL D;  3HOV B;  2IL8 A;  1GUG A;  1V9P A;  2HIV A;  4JI4 Q;  2SOB A;  3FMC A;  1I50 H;  1EFW A;  3HOV H;  5I6W A;  2AQ2 B;  2XWB B;  3N52 A;  4J8Q A;  4OWX B;  4R1J A;  2O5I C;  4LF8 Q;  2L4N A;  3J7A 5;  2RSO A;  2QF7 A;  2A6E C;  4KTA A;  3F8T A;  3T13 A;  3TME A;  1IBM Q;  2JYO A;  1SYC A;  3D6C A;  1PTO D;  1F2L A;  2AMC B;  5C44 G;  4JYA L;  4QJF A;  1X65 A;  3T1Y Q;  3MFY A;  1F9R A;  3R2T A;  4H44 C;  1KRS A;  3S1R B;  2FHT A;  3KLR A;  2PO4 A;  1HR0 W;  2WV6 D;  4JPB W;  1WCM H;  3GQB A;  4C1N I;  2K01 A;  4IN3 A;  1LTL A;  3UDF A;  1XPR A;  4LFA L;  3A7L A;  1YHA A;  2G9H D;  3T53 B;  2OQ0 A;  1J5E L;  2A6H D;  3Q24 A;  1U4M A;  5IT9 L;  5BN4 A;  5LMN W;  3CRL C;  2A69 D;  2BDN A;  5C3E B;  5D14 A;  1JC7 A;  5C3E H;  1RTN A;  2YTY A;  4DV7 Q;  4JBM A;  1G6Z A;  3GV6 A;  1HZ9 A;  4E6I A;  4BY1 G;  2Z6K C;  1KD1 C;  1JQY D;  3OMG A;  1SNM A;  2F0S A;  2ZJQ A;  4YY3 L;  4CKB A;  4DR6 Q;  1RDP D;  3WOE A;  3FRP B;  4A3D B;  2BE5 D;  4YHH Q;  2FMM A;  2O2L D;  4A3D H;  4XT3 B;  1EY5 A;  4P71 A;  5IT9 c;  1ZKO A;  4UP9 A;  2K5W A;  1CZW A;  5LHY 1;  5IGF A;  3J81 L;  2F0H A;  3I2Z A;  2F4V L;  1Y8P B;  4HTH A;  5C0X H;  3PMF A;  4JW0 A;  3I70 A;  4ME5 A;  3TZU A;  3S15 H;  1PH8 A;  2F0E A;  2K14 A;  4L63 B;  4QF4 A;  1LAC A;  2K7V A;  3CC2 A;  1HFG A;  2K32 A;  3MEF A;  4LK1 C;  4GLX A;  3PQI A;  4GZY C;  4IUT A;  3GDE A;  1D1I A;  2EYJ A;  3W3A A;  3CCR A;  1KDC A;  3H09 A;  2RDF A;  3QR8 A;  3P1H A;  2O5J C;  4X3U A;  4A3G B;  3X3M A;  5M5X B;  3R3O A;  4X65 Q;  5M5X H;  1I4G A;  5LMU L;  5C4J B;  2K5N A;  3SVM A;  1PHJ A;  1N36 Q;  4POF A;  5I9O A;  3DLL A;  4JI1 L;  4HSP A;  2F0L A;  1M8A A;  2IWH A;  3NQT A;  1TY2 A;  1STG A;  2A74 C;  1A15 A;  1EY7 A;  2CWP A;  3BDC A;  4RHR A;  3VR4 A;  1HZC A;  2H1E A;  1SE2 A;  1VF7 A;  1SMY C;  1NE3 A;  1QWY A;  3CCL A;  5A2Q E;  5IWA L;  4V19 0;  4JBJ A;  5M9O A;  1YNN C;  4LNQ A;  4IAL A;  4GLV B;  2K5V A;  2KEE A;  2NWG A;  1O7I A;  1FD7 D;  2WB1 E;  1FNU A;  1HZB A;  5C3W A;  1VQE A;  5I2X A;  4DR3 L;  1VQP A;  1VQK A;  4BY7 H;  2B2W C;  4PMB A;  1XMO L;  2FMC A;  4GKK Q;  3NBI A;  4HMI A;  4RHS A;  4V0B A;  4KK7 A;  3MAQ A;  3K7A B;  2KVM A;  1AW7 A;  1VQF A;  1Z9F A;  2F3W A;  5C4H A;  3AQQ A;  2B8G A;  4FF4 A;  1F2Y A;  3I91 A;  5J22 A;  3QB3 A;  5IGE A;  1TWG B;  3JAM i;  2L0C A;  2X6G A;  3VA5 A;  1PRT C;  4R8I A;  1O7L A;  3CU7 A;  4PG3 A;  3SHL A;  5IYC H;  4P75 A;  1W6J A;  2JE6 I;  2KHI A;  4L5Q A;  5ISR A;  1OXS C;  1PRT F;  3HKZ B;  4DA2 A;  2HQL A;  3C2P A;  1STN A;  4Q5V A;  3KUP A;  4FF3 A;  2KA7 A;  1PH4 A;  2NVY B;  2QCP X;  3QO2 A;  5LL6 S;  3CCM A;  5CYU A;  5LL6 X;  3TDQ A;  1Y1W G;  2ZTC A;  3UE0 A;  2J0T D;  3FKI B;  3S1Q H;  1D6E C;  1EY6 A;  2A6H C;  2EY1 A;  1BBX C;  2E5L Q;  1A3T A;  1VQ4 A;  1WTO A;  1LTI D;  3LX0 A;  2RDH A;  3FEW X;  2JEA I;  2NVX H;  4JV5 Q;  3KFU A;  4YCW A;  2QA4 A;  1MIU A;  3OW2 A;  1K8M A;  1K8A C;  1H9R A;  5CR3 A;  3MFG A;  1EYA A;  4DKA C;  1IBK L;  1KL9 A;  2PNR C;  4BBS B;  4QB4 A;  1TS5 A;  4BBS H;  1OXU A;  3NWT A;  5IT9 E;  1W2B A;  5JPN C;  2OTL A;  1STA A;  3P75 A;  1BBW A;  2WFW A;  3CCJ A;  2NB0 A;  2D5D A;  2KUM A;  1GM5 A;  1N34 Q;  4K6L A;  5IGB A;  3PO2 B;  3HOZ H;  1B1Z A;  3PO2 H;  4JI6 L;  2B63 B;  2EXD A;  4IPH A;  2CHB D;  5FLM G;  1HNW L;  2B63 H;  1TWH B;  4DV5 L;  3S16 B;  1LTT D;  3OW7 A;  3S16 H;  3I56 A;  2WKC A;  3TRZ A;  2KED A;  2E2H H;  3I73 A;  3M7N A;  1AZP A;  3A8J E;  4OXP A;  4Y52 H;  3MEH A;  2E76 C;  3K81 C;  2UUC L;  2DNC A;  3CAM A;  1PH1 A;  4OIK A;  3AU7 A;  2K04 A;  3DEP A;  3K0X A;  4RH6 A;  3S17 H;  4QIW B;  3KK7 A;  1I94 Q;  2PNH A;  1PZK D;  1XMQ L;  3CME A;  2M2L A;  5E1F A;  4DR2 L;  1CQF A;  2D0O A;  4DF7 A;  1UE7 A;  4LUO A;  2NZH A;  1E1O A;  4ZKC B;  1PYW D;  4RA8 A;  2ZM6 Q;  1ONL A;  1C9O A;  2QKI C;  1HNX L;  3D4W A;  2KCC A;  4OWT B;  3E9I A;  1D2B A;  2R7Z B;  1ILP A;  4DUY Q;  2ALY B;  3J80 i;  2X69 A;  2N3S A;  4JVZ A;  4KI0 A;  3LWU A;  3T16 A;  2ES2 A;  2JXM B;  1PTO B;  1PFB A;  4OO1 I;  1NR4 A;  1HHV A;  2OT2 A;  4LFC Q;  4QGU A;  4KN7 C;  1BOS A;  1AP0 A;  1B53 A;  1E2W A;  1VQC A;  1ET9 A;  4J6H A;  1QVG A;  1H9J A;  1TKW B;  3STB C;  2LXK A;  3CF5 A;  4CBV A;  2K03 A;  4DV4 L;  3RLF A;  1Y14 B;  1LYL A;  2XSC A;  1JOK A;  1HJP A;  1F9P A;  2SEB D;  1K0R A;  1R9T B;  3NEM A;  1Q46 A;  5EPL A;  3A74 A;  1R9T H;  1A8V A;  2AWN A;  4HAE A;  3NEN A;  5K36 G;  4DV1 Q;  3R8B A;  1RCV D;  3VR2 A;  2CVR A;  2PI2 E;  2Z4I A;  3M4O B;  3KF8 B;  1I6H B;  4JI7 Q;  2B2V C;  1GOZ A;  3M4O H;  1I6H H;  4XT1 B;  3CC7 A;  4BBR B;  3CCQ A;  5C6A A;  1XYI A;  3EJI A;  4K6D A;  3FP9 A;  4BBR H;  1NBW A;  2X6L A;  3FDT A;  2F0U A;  4KHP L;  3SK8 A;  1FNW A;  4ULL A;  1NR2 A;  2B2T A;  2JA7 G;  1GUO A;  4QL5 A;  1CFM A;  4A3L H;  2BA0 A;  2MO0 A;  2B39 A;  4R4I A;  5ELF A;  4TVA B;  1Y8O B;  1J9O A;  2A8V A;  1LTB D;  2HDM A;  4FXK C;  3GD7 A;  1EU4 A;  4OEM B;  4I7A A;  4A93 B;  4L5R C;  1TQO A;  5M3F G;  4A93 H;  2JA5 B;  2A1A A;  1EL0 A;  4OX9 L;  1A3V A;  2I5L X;  5JJZ A;  1I3Q H;  2NVQ B;  1YJN A;  2F0Q A;  1K28 A;  2NVQ H;  2N88 A;  3J7Y W;  4QUF A;  1DOM A;  5BR8 L;  3NTH A;  2HUG A;  1DXM A;  1QVC A;  5C4X G;  3WOF A;  4FYD A;  2ZTD A;  2IX1 A;  1O7Z A;  5M5W H;  4BXX G;  2EYM A;  5CV9 A;  1KTK A;  3FVQ A;  2LS0 1;  4CJ0 B;  3DM3 A;  1I4P A;  3G4S A;  2FJ2 A;  3KLW A;  1YNJ D;  3SK6 A;  5ELE A;  4HJA A;  1OXX K;  3U4Z A;  3SE0 A;  4OHJ A;  2IY5 B;  3H0G B;  3CCE A;  4XDX A;  5JOB A;  3HGB A;  2YTX A;  2WAQ E;  5EBC A;  5H1S E;  3H0G H;  4LW1 A;  3BZD B;  2IJ0 A;  1SNQ A;  4R4T A;  3OMC A;  2JA9 A;  2E2I B;  1S3O A;  4OEL B;  4A3B B;  2A19 A;  3D0F A;  2E2I H;  2FIN B;  4A3B H;  1HXY D;  3T1Y L;  2UU9 Q;  2VL6 A;  1VQO A;  1EFI D;  3KBX A;  4RCN A;  1O78 A;  2E75 C;  5IYD G;  4HIM A;  3J7Z C;  4NXN Q;  1T5E A;  4HED A;  3SK4 A;  5FJ8 H;  4A3M G;  4NP5 A;  1R4P B;  4JBW A;  1EWH A;  2R93 H;  1FL0 A;  1SYB A;  2O4X A;  2A68 D;  1PZJ D;  2B29 A;  1VQB A;  1Y8N B;  2I5M X;  1WTH A;  1QG7 A;  3MZ5 A;  2JQO A;  5E4W C;  1KDB A;  4C1N K;  4DV7 L;  2I07 B;  3SR1 A;  1NJI C;  1GKH A;  4IFD J;  3NUC A;  3D4R A;  4NW2 A;  2SDF A;  5IYB G;  4UAI A;  2H4O A;  4DPG A;  5J1Z A;  4O2D A;  3M3Y B;  2B8F A;  3KF8 A;  2CW0 C;  3QOL A;  1VQD A;  2I5H A;  2JEB I;  4JG2 A;  3TP8 A;  3K5L A;  3ZYY X;  4YHH L;  3M3Y H;  2ATW A;  1UE6 A;  2OCE A;  4DV3 Q;  5KND A;  2XIW A;  1D7Q A;  4A3C G;  3VYU A;  4DV6 L;  1BCP C;  5BN5 A;  5I4D A;  2F0K A;  2XRQ D;  1E1T A;  1C7Y A;  2UXC Q;  2NN6 G;  3D31 A;  5JAV A;  5AFW A;  4FXD A;  2D62 A;  1DCZ A;  1KNA A;  4A3J B;  4BWG B;  1SBB B;  2F0W A;  1EEI D;  4A3J H;  1BQQ T;  4DGZ A;  5COY A;  1ENF A;  4IUU A;  4CJ1 B;  3C1F A;  1DOL A;  3HOW B;  4X66 L;  1DON A;  1JB3 A;  4X3S A;  2NVT H;  3HOW H;  3I4N H;  3UE1 A;  2L5T A;  3Q0A A;  5GRO A;  4HJ5 A;  4A3I G;  1Z47 A;  1QZH A;  4PV1 C;  2AQ3 B;  3S2H B;  4GOP B;  2QEJ C;  3M9B A;  5EKL A;  3S2H H;  2KHJ A;  4YIJ A;  1VQL A;  1JCK B;  1Q3L A;  1HUM A;  4X65 L;  1K83 B;  3A7A B;  4A75 A;  2JA6 G;  1CQV A;  2IHF A;  1K83 H;  4B3S L;  4GKJ L;  1H95 A;  5JJL A;  4LF7 Q;  3AFQ A;  4A3F G;  3J80 c;  1NUC A;  3OWE B;  4IFD I;  4DK6 C;  1XPU A;  1VQ9 A;  5GAD C;  4DNI A;  2PZW A;  3HOY H;  1YIT A;  1SND A;  1QUQ B;  1T5X D;  4B9W A;  2UUB Q;  3E9H A;  3TBI B;  2VQE Q;  1Y1V G;  1PYB A;  1TXY A;  1K9M C;  1Q1E A;  5IY0 A;  2AKW B;  2VY3 A;  1EZ6 A;  3HG9 A;  3S1M B;  1DJR D;  2EY2 A;  3HFZ B;  1EU3 A;  2LSS A;  1YJ9 A;  4HMJ A;  1WOC A;  5HGQ A;  4DNT B;  4ZK9 B;  2CFM A;  2B3G A;  1WVL A;  4IOC A;  1WTW A;  4RMF A;  4A3K B;  2MJ8 A;  2M00 A;  4A3K H;  1VQ5 A;  4BA2 I;  3TP7 A;  1X55 A;  3PV0 A;  4JK1 C;  1JIC A;  3F1Z A;  3FPU B;  5A35 A;  2WKD A;  4DNR B;  3CXC A;  1Q82 C;  1HNZ Q;  1XTD A;  2F4I A;  2JA8 G;  1A2T A;  4LFB Q;  4TRD A;  1CZG A;  4HID A;  1GO3 E;  1IHZ A;  1H9S B;  1K73 C;  3ERS X;  3RD4 A;  4X62 L;  2HQE A;  3E3X A;  3VA7 A;  3Q22 A;  2VUM G;  1HCZ A;  5D3D A;  2PZU A;  4DR1 L;  3F2U A;  3BU2 A;  1IL2 A;  1SJH D;  3MC0 B;  1H9M A;  2F1M A;  1HH2 P;  2L1B A;  5C5M A;  2V1C C;  1D5X C;  1EYG A;  3I7F A;  3PUX A;  2XWJ B;  1QCB D;  4YWL A;  2GVA A;  2HDL A;  3UDG A;  3CHB D;  2UXB Q;  4NDX A;  2DY8 A;  4K0K Q;  3VYT A;  2OXP A;  2K5H A;  1ENA A;  3KDF A;  1Z7T A;  2RSN A;  2RDG A;  4ZUJ A;  3PIO 3;  3I4M B;  1IW7 D;  1DGS A;  2UXD Q;  1W3S A;  3GTK B;  4DV0 L;  4NMZ A;  3I4M H;  4WFN 3;  4G7O C;  4FO2 A;  5ELN A;  1FYC A;  2ZXO A;  1ZXT A;  2KEC A;  4IFD H;  1ML0 D;  2QDB A;  3BDL A;  1SEB D;  1J6Q A;  4TSS A;  1DOK A;  3E0E A;  4GOP A;  3FHW A;  3S1R H;  3OTO Q;  3NSW A;  4U68 A;  3J81 j;  1TS2 A;  1PH7 A;  2E2J B;  1DZ1 A;  5JEA G;  1SNO A;  4F8M A;  5F2D A;  2L11 A;  2E2J H;  5EQ0 A;  1TU2 B;  1N34 L;  4JI5 L;  3K58 A;  4UP8 A;  4YCU A;  1M1K C;  2L15 A;  1RTO A;  1K3B C;  3R2I A;  1B3A A;  2Y0S E;  4IPD A;  4K2L A;  3H94 A;  4XIG S;  4LF4 L;  1QUQ A;  4DR4 L;  3CMA A;  1HA6 A;  1CUK A;  2LFN A;  2R3Z A;  2EZV A;  1F2Z A;  4Q0F A;  1JB7 A;  2JN4 A;  1KAB A;  3Q23 A;  1JJC B;  2A5H A;  4ABN A;  1O7Y A;  3I72 A;  3S9W A;  4IPC A;  2MPM A;  4G4K A;  2PZT A;  1QJO A;  4C3I G;  2WAC A;  1KRT A;  3JC6 6;  4QQB X;  2VQF Q;  3OSO A;  5EPK A;  3HKS A;  2F0O A;  5EKI A;  2G5D A;  3HP3 A;  4KHZ A;  4JI3 L;  1I94 L;  1V43 A;  4EQP A;  1EWC A;  3J80 E;  1HR0 Q;  1HFN A;  4MHE A;  1L1O B;  2N8N A;  3MA2 B;  2L12 A;  2TMP A;  1TR5 A;  5CBA E;  4HR7 B;  2K52 A;  5LMN Q;  3RZO B;  1D1K A;  3A55 A;  3QIA A;  4K5X A;  3HOV G;  2HIX A;  5J3B A;  5CV6 A;  4XQJ A;  4KY7 A;  5IGD A;  1XJV A;  3RZO H;  1X3G A;  1E24 A;  2E2D C;  2B2T C;  2EE1 A;  4A3G H;  3Q8D A;  2EYP A;  2B2Y A;  2B2U A;  4RKL A;  5ELB A;  4IUV A;  5C4J H;  1U0L A;  3BZC A;  2DNE A;  1RKN A;  2J7Z A;  4LFC L;  5GAH C;  4DFA A;  1XWE A;  2P5Z X;  1CA5 A;  1XNR Q;  2LMC B;  1S5B D;  4H0L C;  5GQO A;  1EY8 A;  3J7A F;  3D8G A;  1Q86 C;  1X9N A;  4KD4 A;  2PQE A; 
#chains in the Genus database with same CATH homology
 4A3F H;  3K0X A;  1N32 Q;  1CKM A;  3S17 H;  1MKH A;  1I94 Q;  1WCM G;  2PNH A;  1IBK Q;  4OWW B;  2F3I A;  4A3J G;  1GD7 A;  4GLA C;  4P72 A;  3CME A;  1XMQ L;  5AJ3 Q;  4C3J H;  4DR2 L;  4APV A;  1KAW A;  2D0O A;  4LF6 Q;  4JI2 Q;  1PH6 A;  2IX0 A;  4R4Q A;  1S72 A;  3GTO H;  1UE7 A;  4LUO A;  1JT8 A;  5C0X I;  3HOW G;  4OX9 Q;  1Y1V H;  2NZH A;  3KF6 B;  2ASB A;  1UE1 A;  3I4N G;  1E1O A;  2C35 B;  2ZM6 Q;  3RLO A;  4C3H H;  4HJ7 A;  2R7F A;  1OTC A;  3GO5 A;  1C9O A;  1U5K A;  5C3E G;  1I5F A;  1HNX L;  2E5L L;  2FXQ A;  3E9I A;  4MTN A;  2KEN A;  4OWT B;  3ULJ A;  5GAE C;  1YIJ A;  1M90 C;  4A3D H;  1B70 B;  4DUY Q;  4GNX B;  5BR8 Q;  2ALY B;  3WWV A;  1N8R C;  3PSI A;  4WJ4 A;  3J80 i;  4JI0 Q;  4B3R L;  4DV2 L;  4TQU S;  2N3S A;  3A0J A;  3GTK H;  4KI0 A;  4JV5 L;  2GN5 A;  2AHO B;  4AIM A;  2ES2 A;  2GVB A;  4A4I A;  3K7A H;  4UY8 C;  4A3D G;  4OO1 I;  4HJ9 A;  2JA5 G;  3HOY G;  3RN5 A;  2YYZ A;  3W1G A;  4LUZ A;  4DR7 Q;  3HOX G;  4LFC Q;  1CKN A;  4QGU A;  3AFP A;  1S40 A;  5C0X G;  3CCU A;  4YCV A;  2YTV A;  1VQC A;  2WB1 G;  4GNX C;  1QVG A;  2EIF A;  3STB C;  1IBL Q;  2LXK A;  3CF5 A;  1GVP A;  4MZ9 A;  1BKB A;  1Q12 A;  1TWG H;  1VS0 A;  4DV4 L;  1AE2 A;  3RLF A;  1Y14 B;  1BBU A;  1LYL A;  2JA8 H;  2F52 A;  2HT1 A;  1HJP A;  5HY6 A;  1K0R A;  3NEM A;  3PO3 H;  1IYJ B;  1N9W A;  1Q46 A;  2Q2H A;  3A74 A;  3CPF A;  1R9T H;  1A8V A;  1XMQ Q;  4X6A H;  2AWN A;  3EIV A;  5LMN L;  3NEN A;  2Q2T A;  5K36 G;  4PZ8 A;  4DV1 Q;  2ZJR A;  1PFS A;  3TRE A;  1MJC A;  2PI2 E;  4A3K G;  2VUM H;  3KF8 B;  1VQ8 A;  1AE3 A;  4JI7 Q;  3KDF B;  3PCO B;  1P8L A;  4X64 L;  3M4O H;  4OO1 G;  1I6H H;  3T1H L;  1G29 1;  2NVY H;  3CC7 A;  3CCQ A;  3PUY A;  1E22 A;  2ID0 A;  1G6P A;  4DR5 L;  3K80 C;  5JJI A;  3FP9 A;  4BBR H;  1NBW A;  3FKI H;  1KHI A;  1X56 A;  1N33 Q;  1A0I A;  3PF4 A;  4KHP L;  1CKO A;  1HZA A;  2E8G A;  1G51 A;  3H15 A;  3M85 A;  3CPW A;  3CQZ H;  2JA7 G;  1L1O A;  1XPO A;  4QL5 A;  3A5Z B;  1VQN A;  4A3L H;  2BA0 A;  1X6O A;  3SGI A;  1CSQ A;  2MO0 A;  4JC0 A;  2Y0S G;  4NPS A;  4R4I A;  4TVA B;  1L0W A;  4XTC S;  5ELO A;  2A8V A;  4UPA A;  3TEH B;  3G71 A;  1N32 L;  3M4P A;  1XPU A;  2XTI A;  2ZJP A;  3GD7 A;  3W1B A;  2JK8 A;  4L5R C;  5AJ3 L;  1PYS B;  5M3F G;  1V1Q A;  1YEZ A;  3KOJ A;  1IXR A;  4JI2 L;  4LF6 L;  4A93 H;  2XGT A;  3CC4 A;  5IP7 G;  4LWC A;  2A1A A;  3VDY A;  2CQO A;  1YJW A;  1MJE A;  3RR5 A;  1YNX A;  3ULP A;  1PA6 A;  1KQS A;  4OX9 L;  3ICE A;  4O0A A;  4LUV A;  2I5L X;  1I3Q H;  2ZM6 L;  1YJN A;  4DV6 Q;  1SMX A;  2NVQ H;  3K8A A;  1UEB A;  3ULL A;  4BA1 I;  3L0O A;  1A62 A;  2K75 A;  3PUW A;  1VQ6 A;  3S24 A;  3PF5 A;  2D0P A;  2YV5 A;  4DUY L;  5BR8 L;  3HOU H;  5IP9 G;  1BVS A;  4X64 Q;  3T1H Q;  1QVC A;  2VNU D;  5C4X G;  2KBN A;  2ZTD A;  2IX1 A;  2PQA B;  5M5W H;  4BXX G;  4BY7 G;  1TWH H;  1VQG A;  2OWO A;  4L5S A;  3I4M G;  2K50 A;  3I55 A;  1TWC H;  1J5E Q;  4X66 Q;  3J81 c;  3DM3 A;  4IFD G;  2R7D A;  4DUZ Q;  3G4S A;  3CD6 A;  3AYH B;  3KLW A;  4B3T L;  3KF6 A;  2Q2I A;  3HKZ E;  1Y1W H;  4HJA A;  3RZD H;  1IBL L;  1OXX K;  4GN4 B;  1VQH A;  3U4Z A;  1PH5 A;  2IY5 B;  4C2M H;  4LF5 L;  3CCE A;  4GN5 A;  2CCZ A;  3K7U C;  4LF9 L;  2YTX A;  2WAQ E;  5H1S E;  1NY4 A;  3H0G H;  4LW1 A;  4R4T A;  4HJ8 A;  4YWM A;  1WYD A;  2JA9 A;  1S3O A;  4YY3 Q;  4B3S Q;  4GKJ Q;  2UUA Q;  5IYC G;  2A19 A;  4GNX A;  3D0F A;  4DV1 L;  2E2I H;  4A3B H;  3T1Y L;  2UU9 Q;  3G48 A;  1FJG Q;  1WJJ A;  2VL6 A;  4C3I H;  2Z0S A;  1VQO A;  3GTJ H;  1VQJ A;  5IYD G;  4Y7N H;  4HIM A;  1YI2 A;  2VW9 A;  3J7Z C;  4JI7 L;  3H3V H;  1NTG A;  4NXN Q;  3U50 C;  4NXM Q;  5FJ8 H;  4A3M G;  2F4V Q;  3GTG H;  3HKZ G;  4JBW A;  4P74 A;  2BH8 A;  4IPG A;  1RL2 A;  1N33 L;  1FL0 A;  2R93 H;  4JBK A;  1TWA H;  4PZ7 A;  3KJP A;  3PUZ A;  2B29 A;  3EBE A;  2R7Z H;  1VQB A;  4JOI C;  5DLQ E;  2OQK A;  2K4K A;  3F2D A;  4A3E H;  2I5M X;  2MNA A;  3BJU A;  4DK3 C;  1ASY A;  1V9P A;  2HIV A;  2JQO A;  4JI4 Q;  1I50 H;  1EFW A;  4DV7 L;  3HOV H;  1NJI C;  1GKH A;  4IFD J;  1A63 A;  5IYB G;  4OWX B;  2MFI A;  4DPG A;  4R1J A;  4O2D A;  5M3M H;  4B3T Q;  5FLM H;  4LF7 L;  4PMW A;  4LF8 Q;  1VQD A;  2I5H A;  2JEB I;  4JG2 A;  2R92 H;  3M3Y H;  4YHH L;  2RF4 A;  3ER0 A;  3J7A 5;  3STB D;  4LF5 Q;  1JE5 A;  3F8T A;  3L7Z C;  1SLJ A;  1UE6 A;  2OCE A;  1IBM Q;  4LF9 Q;  4DV3 Q;  2ATW A;  2VS1 A;  4FDB A;  5LMU Q;  4BBS G;  4A3C G;  1D7Q A;  1PH9 A;  4ME3 A;  3G6E A;  4DV6 L;  2AMC B;  5FLX c;  1X3E A;  5C44 G;  1VQM A;  5IE8 A;  4JYA L;  4QJF A;  1EOV A;  1K3R A;  1VQA A;  1X65 A;  2H5X A;  2OTJ A;  3T1Y Q;  1E1T A;  4JI1 Q;  1C7Y A;  2UXC Q;  2RHS B;  5E7N A;  1KIX A;  1VQ7 A;  1KRS A;  2NN6 G;  3D31 A;  2D62 A;  4ALP A;  1HR0 W;  2YU9 H;  4X62 Q;  1WCM H;  1ASZ A;  3HOZ G;  4A3J H;  3PO2 G;  4IOA A;  1XPR A;  1LTL A;  3UDF A;  4DR1 Q;  1YVC A;  4LFA L;  1YHA A;  2MQH A;  1RIP A;  2OQ0 A;  4A3G G;  2B63 G;  1J5E L;  4X66 L;  2NVT H;  3HOW H;  4QIW E;  3I4N H;  3UE1 A;  4DUZ L;  5GRO A;  5LMN W;  4HJ5 A;  5IWA Q;  4JCV E;  4A3I G;  1Z47 A;  1QZH A;  4QY7 A;  2CKZ B;  4GOP B;  5C3E H;  3PUV A;  2YTY A;  3M9B A;  1SRU A;  4DV7 Q;  3RN2 A;  4JBM A;  2KHJ A;  3S2H H;  1P16 A;  1IZ6 A;  1VQL A;  1HZ9 A;  4AQY L;  4BY1 G;  2Z6K C;  1KD1 C;  4X65 L;  4AYB E;  2I0Q A;  4A75 A;  2JA6 G;  3GTL H;  4IJH A;  2IHF A;  1K83 H;  4YY3 L;  2ZJQ A;  4B3S L;  2UUA L;  4DR6 Q;  1YHQ A;  4LF7 Q;  4GKJ L;  3AFQ A;  4A3F G;  3J80 c;  4LFB L;  5JJL A;  4YHH Q;  2UU9 L;  1LUZ A;  4DR3 Q;  1FJG L;  4IFD I;  3MXN B;  4DK6 C;  1VQ9 A;  5GAD C;  4DNI A;  3F2B A;  4DV0 Q;  4P71 A;  5IT9 c;  2JA5 H;  1YIT A;  4UP9 A;  3HOY H;  4GOP C;  1KXL A;  2WP8 J;  1QUQ B;  4NXN L;  1UWV A;  3HOX H;  2UUB Q;  4NXM L;  3I2Z A;  2F4V L;  3E9H A;  3TS0 A;  4JYA Q;  1Q8K A;  2VQE Q;  1Y1V G;  1PYB A;  1TXY A;  1K9M C;  1Q1E A;  5IY0 A;  2AKW B;  4J15 A;  2VY3 A;  3JAM c;  3S15 H;  3UDX A;  4AYB G;  1PH8 A;  1YZ6 A;  1WFQ A;  2K14 A;  3HFZ B;  2LSS A;  1YJ9 A;  5HGQ A;  1WOC A;  4MNO A;  1XNQ L;  5JEA J;  4JI8 L;  2CFM A;  2B3G A;  4LFA Q;  3CC2 A;  4JI4 L;  4GLX A;  2IHE A;  3MEF A;  1AH9 A;  4IOC A;  4RMF A;  4A3E G;  1VCI A;  1Q7Y C;  4NB3 A;  1X3F A;  2R6G A;  4A3K H;  1E3P A;  3GDE A;  4JOI A;  4JI5 Q;  1VQ5 A;  4BA2 I;  4OON A;  3CCR A;  4LF4 Q;  4H02 A;  3W5O A;  1X55 A;  4LF8 L;  1SRO A;  3PV0 A;  4DR4 Q;  4DAY B;  3GTM H;  3F1Z A;  4AQY Q;  1IBM L;  1EIF A;  4X65 Q;  4DV3 L;  2R92 G;  3CXC A;  5M5X H;  2QEX A;  5LMU L;  1D8L A;  1XTD A;  1Q82 C;  1HNZ Q;  2JA7 H;  2K5N A;  3L2P A;  1UE5 A;  1PHJ A;  4WJ3 M;  3U4V A;  2JA8 G;  1N36 Q;  4LFB Q;  4POF A;  2BH2 A;  3DLL A;  4JI1 L;  4HID A;  3PO3 G;  2UXC L;  4AH6 A;  1GO3 E;  1K73 C;  1FVI A;  3ERS X;  2N78 A;  3H3V I;  4X62 L;  3PIP A;  2KCT A;  2VUM G;  3CCS A;  4DR1 L;  2CWP A;  5M3F H;  1HZC A;  1SE8 A;  3BU2 A;  1IL2 A;  1T9H A;  2WAQ G;  4JI3 Q;  5IP7 H;  1HH2 P;  1NE3 A;  1EWI A;  1X54 A;  4BBR G;  3FKI G;  1JJ2 A;  3CCL A;  5IWA L;  1XNQ Q;  4DAM A;  4JBJ A;  5GAG C;  4UP7 A;  2V1C C;  4JI8 Q;  3M4Q A;  4LNQ A;  2NN6 I;  1EYG A;  1YBY A;  4YWK A;  3I7F A;  4IO9 A;  3PUX A;  4GLV B;  3TS2 A;  4A3L G;  4YWL A;  2K5V A;  2GVA A;  3UDG A;  2UXB Q;  5EAY A;  4K0K Q;  5IP9 H;  1O7I A;  2K5H A;  2WB1 E;  3BZK A;  4DR6 L;  1HZB A;  5C4X H;  3KDF A;  1TWF H;  2QGQ A;  1VQE A;  2EQS A;  2NZO A;  4DR3 L;  1VQP A;  4BXX H;  1VQK A;  1DGS A;  4BY7 H;  1W3S A;  4JI6 Q;  2UXD Q;  4DV0 L;  1XMO L;  2KCM A;  3I4M H;  4GKK Q;  1PH2 A;  2Z6K A;  1HNW Q;  4R4O A;  4A93 G;  4DV5 Q;  1QVF A;  5ELN A;  2UUB L;  2VQE L;  3CCV A;  2RCN A;  1VQF A;  1H95 A;  1PV4 A;  1Z9F A;  5M5Y H;  1OXV A;  3RLN A;  2VQF L;  1J6Q A;  3AQQ A;  1B8A A;  1KC8 C;  3KJO A;  3UDI A;  3E0E A;  4GOP A;  3FHW A;  1HR0 L;  3S1R H;  3OTO Q;  3JAM i;  2HHH L;  2UUC Q;  3NEL A;  3AEV A;  3J81 j;  1VQI A;  1SFO H;  1CSP A;  3RNU A;  1PH7 A;  1EUJ A;  4PG3 A;  5JEA G;  5IYC H;  3HOU G;  1L2F A;  4P75 A;  2E2J H;  4L5Q A;  2JE6 I;  2KHI A;  3CP0 A;  1PH3 A;  2CWA A;  3B6Y A;  1EQQ A;  1N34 L;  4JI5 L;  1OXS C;  3PIO A;  4DR2 Q;  5IYD H;  4UP8 A;  4YCU A;  1M1K C;  2HQL A;  1CKN B;  3J81 i;  1NMF A;  2L15 A;  3I56 A;  4IPD A;  2Y0S E;  4A3M H;  4LF4 L;  4XIG S;  1QUQ A;  3LGJ A;  2VZA A;  1PH4 A;  4DR4 L;  3CMA A;  1FGU A;  1CUK A;  3A5U A;  2IT1 A;  3CCM A;  1Y1W G;  2ZTC A;  4L5T A;  3UE0 A;  1HNZ L;  1SR3 A;  3S1Q H;  3U58 A;  1SN8 A;  1HNX Q;  1JB7 A;  3CW2 C;  4GS3 A;  3OYY A;  1N36 L;  1JJC B;  2E5L Q;  4IPC A;  3H0G G;  3NBH B;  3PGZ A;  4GN3 B;  1VQ4 A;  4B3M L;  1JJG A;  1XMO Q;  1B7Y B;  2PQA A;  4B3R Q;  4DV2 Q;  3S14 H;  2JEA I;  2NVX H;  4JV5 Q;  2JJQ A;  2DUD A;  1XNR L;  3KFU A;  4A3B G;  4YCW A;  1WI5 A;  1OXT A;  2QA4 A;  1MIU A;  2LXJ A;  2RHQ B;  5IYB H;  3OW2 A;  5JJK A;  1EQR A;  1C0A A;  1KRT A;  1K8A C;  3JC6 6;  4QQB X;  2DGY A;  2VQF Q;  1Q81 C;  3HKS A;  5C0X J;  4DKA C;  5FJ8 G;  4KHZ A;  4JI3 L;  1I94 L;  1IBK L;  1V43 A;  3TQY A;  3GTP H;  2AWO A;  2BA1 A;  1KL9 A;  1YHB A;  3ZJY C;  1HR0 Q;  2HHH Q;  3S1M H;  2R93 G;  4BBS H;  1EIY B;  4R4C A;  1OXU A;  4EQ5 A;  4A3C H;  1L1O B;  2N8N A;  1W2B A;  1E7Z A;  4DV4 Q;  5C44 H;  3EN2 A;  4HIK A;  2OTL A;  1BBW A;  3KYH C;  3GTQ H;  2R7Z G;  2WFW A;  1JMC A;  3CCJ A;  3S2D H;  1Q1B A;  1GM5 A;  2K52 A;  2PI2 A;  4P73 A;  4PZ6 A;  4POG A;  2UXB L;  4EX5 A;  1N34 Q;  4A76 A;  5LMN Q;  4K0K L;  3HOV G;  1PVO A;  2PMZ E;  2HIX A;  5J3B A;  3RZO H;  3HOZ H;  1XJV A;  1X3G A;  3PO2 H;  1E24 A;  1NMG A;  2UXD L;  4KLK A;  4JI6 L;  2MO1 A;  2EXD A;  4IPH A;  1L1O C;  4IJL A;  5M3M G;  1K8G A;  4JI0 L;  5FLM G;  4GKK L;  4A3G H;  3S1N H;  1HNW L;  3Q8D A;  2B63 H;  4DV5 L;  3IRB A;  4DR5 Q;  2ZTE A;  5C4J H;  4A3I H;  4KHP Q;  1U0L A;  3S16 H;  3BZC A;  3TRZ A;  1QZG A;  4DR7 L;  4B3M Q;  3I4O A;  2E2H H;  3M7N A;  4LFC L;  5GAH C;  4HIO A;  4OXP A;  4Y52 H;  1LM0 A;  1XNR Q;  2Q2U A;  3OTO L;  3K81 C;  4BY1 H;  2UUC L;  1PH1 A;  3CAM A;  4RG1 A;  5GQO A;  2JA6 H;  2N49 A;  3F2C A;  1Q86 C;  1X9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...