2IHFA

Crystal structure of deletion mutant delta 228-252 r190a of the single-stranded dna binding protein from thermus aquaticus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
235
structure length
205
Chain Sequence
b'MARGLNQVFLIGTLTARPDMRYTPGGLAILDLNLAGQDAFTDESGQEREVPWYHRVRLLGRQAEMWGDLLEKGQLIFVEGRLEYRQWEKDGEKKSEVQVRAEFIDPLEGRGRALNQVILMGNLTRDPDLRYTPQGTAVVRLGLAVNEERTHFLEVQAWRELAEWASELAKGDGLLVIGRLVNDRFQTRVEALRLERPLEDFPPEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Single-stranded DNA-binding protein
publication title 3D structure of Thermus aquaticus single-stranded DNA-binding protein gives insight into the functioning of SSB proteins.
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Dna binding protein
total genus 34
structure length 205
sequence length 235
ec nomenclature
pdb deposition date 2006-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ihfA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ihfA02
3W1GA 2JA5H 4DV5L 1VQBA 3K7UC 4P71A 4RG1A 1FVIA 4B3RQ 4JI2Q 1R9TH 1PH9A 1IBKL 3CCQA 3CF5A 5LMNL 3PF4A 3G4SA 4IFDG 3F2CA 4LF7L 1B70B 3G48A 3T1HL 1VQDA 1U5KA 1HR0Q 2UUCQ 3PO3H 4A3CG 2PI2A 2LSSA 1XNQQ 3AEVA 4YCUA 5C4XH 1Y1WG 1PH1A 2L15A 1P16A 2KHIA 2OWOA 4UP8A 1KC8C 2N3SA 3CQZH 3GTPH 1X56A 5DLQE 1PV4A 2WFWA 4O2DA 2GVBA 2JA8G 4GN5A 1LYLA 1SRUA 1V9PA 4A3DG 4OO1I 3CCEA 4IFDJ 4QL5A 2ZTEA 3I7FA 1QZGA 1PVOA 4OONA 4C3IH 3L7ZC 4DNIA 2VL6A 3G6EA 2VUMH 3HKZE 5IYDG 2CWAA 4JCVE 3OW2A 1WYDA 4DV5Q 2VQEL 3EIVA 1EUJA 3UDXA 3PIPA 2NVXH 2EXDA 5C0XI 5M3FH 3J7ZC 1J5EQ 5C44G 1IBKQ 4A3JG 1GD7A 5LMNQ 4A3KG 1Z9FA 4YWMA 4RMFA 2UUAL 4LF5L 3M4OH 3S2DH 2UXCQ 4DR3Q 5GADC 2ZJPA 3BU2A 3AFPA 2Q2HA 1YIJA 2E2HH 1Y1VH 4QIWE 1PH2A 2CWPA 2MNAA 1XPRA 1VQIA 2E2JH 1PH7A 4GOPA 3W5OA 2JQOA 4AQYQ 1YI2A 2ZTCA 3FKIH 3S1QH 1ASYA 2RHSB 1EFWA 2Q2IA 3GDEA 3L0OA 3S1RH 3HOVG 4DAYB 4GS3A 1TWCH 4UP9A 3CCRA 4DR5L 1WJJA 5M5XH 1C0AA 3BZKA 1KRTA 3RLNA 3S17H 3K80C 5HGQA 1NJIC 1HR0W 2UUBL 2ALYB 1O7IA 3HFZB 2IX1A 2NZHA 1GKHA 3HOXG 4PMWA 2WAQE 4DAMA 1SN8A 3CAMA 1AH9A 2K14A 4A3FG 3STBD 4LNQA 4OO1G 1CUKA 5E7NA 1G291 3UDFA 3HOUH 1JJGA 2UUAQ 1Y14B 3SGIA 4LF5Q 3IRBA 3J81i 3K81C 1VQ6A 1X3FA 4DV2L 4GNXC 2KCTA 1HNWL 5C0XG 3D31A 1FJGL 3HOZH 1I94Q 4GLAC 2OCEA 4A3IG 3MEFA 1PHJA 4BA2I 2F3IA 4BY1G 1WOCA 1VQAA 2XTIA 1CKOA 4NPSA 4NXNL 4B3TQ 3KOJA 5K36G 3CC2A 1L1OA 4HJ7A 4DR5Q 1XJVA 5FJ8G 1K8GA 1IBMQ 1WFQA 4LFBQ 5C3EG 2AWNA 2Q2UA 2UUBQ 3ULLA 1OXUA 2WB1G 4JBKA 3U4VA 1YZ6A 3NBHB 3PUXA 5IP9G 4GN4B 1IBLL 4DR4L 4QJFA 2LXKA 1IXRA 2ZTDA 3DLLA 3T1YQ 4JI5Q 2K5HA 4YY3L 5IYCG 4R1JA 1EWIA 3OTOQ 5JEAJ 2VNUD 4A3EG 2MO0A 2ATWA 3S15H 4A93H 2IT1A 5IYBH 1VQJA 4YHHL 3M3YH 2CQOA 1XTDA 4JC0A 2B3GA 3U50C 4DV2Q 1E1OA 1PH8A 2IY5B 1HZ9A 3TQYA 2OQKA 1CSPA 2Z6KC 2QA4A 4JI3Q 1FJGQ 3HOYH 2IHFA 3H15A 2R7ZG 4P75A 2NVTH 4JI7L 5BR8Q 1VQHA 1CKNB 3PUWA 5J3BA 4NXNQ 4LFAL 2JA7G 4A3LG 4BBRG 1UE7A 1EYGA 3S24A 3ULPA 1VQ8A 4B3MQ 3I55A 3GTJH 2JA5G 1VQNA 2R92H 3I4NH 3JC66 3RR5A 4DV7L 4OWTB 4TQUS 2ZJQA 1IBLQ 3K8AA 1QVCA 1OXVA 2CCZA 4YY3Q 5ELOA 4MTNA 3F2DA 1YITA 1J5EL 1Q86C 4DV1L 4P73A 4GLVB 3PO3G 4YHHQ 5IWAL 1EQRA 1KXLA 1KL9A 1I6HH 1NE3A 3RNUA 1N8RC 1XMQL 3GTKH 3GTQH 2UXCL 5C4XG 2IX0A 4DR3L 1QUQA 4YWKA 3STBC 1OTCA 1JE5A 2QGQA 2DUDA 3BZCA 4JOIC 4DK3C 4A4IA 4OWWB 5C4JH 3RLOA 4X65Q 4JI7Q 4EX5A 1CKMA 2JK8A 3VDYA 2I0QA 2Y0SG 4AQYL 1N33L 1YHBA 2HT1A 2NN6I 4LFAQ 4YCWA 2MQHA 1PH6A 3RN5A 1BBUA 2K5NA 1KAWA 4ALPA 2YV5A 2AHOB 3M4PA 2VUMG 3KJPA 4HIDA 2KBNA 2PQAB 2MFIA 3GTMH 2VQFL 2VW9A 1M90C 1E24A 5IP7H 4DV7Q 3MXNB 1N9WA 5M3FG 4PZ7A 2D62A 3CC4A 4JI6L 4BXXH 3A74A 4GLXA 4HIKA 3RN2A 2ASBA 4IOAA 4X64L 4X6AH 3H3VH 1PFSA 4R4TA 1JB7A 2PNHA 3A5UA 3CMAA 3F2BA 4DV1Q 1Y1VG 5IWAQ 4DR2L 4HJ5A 3M7NA 3PUZA 3ER0A 4A3CH 3E9IA 1XMQQ 2HIVA 4AIMA 4A3BH 3GTOH 1VQCA 3FKIG 2N78A 1X6OA 4DV3L 1VS0A 1BVSA 1CSQA 2R6GA 3D0FA 3J81j 4BY7H 1I94L 4L5TA 3KLWA 3H0GH 1N33Q 5JJKA 2D0PA 1SLJA 5EAYA 3CCVA 4APVA 4LF8L 2FXQA 2E8GA 2BA1A 3KF6A 4P74A 4B3TL 4MZ9A 4FDBA 2Y0SE 1OXSC 3PGZA 1JJCB 4A3GH 1HNXL 1IBML 4LFBL 4GNXA 2VQFQ 1QVGA 1NMFA 3RLFA 4OX9L 2NN6G 4A3MH 3RZOH 1VQOA 4JI6Q 4L5RC 3I56A 3S16H 4LFCQ 3HOUG 4GN3B 4X64Q 4WJ4A 2ZJRA 1YJWA 1YNXA 4R4CA 2EIFA 2N8NA 4JI5L 3J80i 3CCSA 3T1YL 4NXMQ 3HOWH 4R4QA 3J7A5 2I5HA 1S3OA 4DR2Q 3FHWA 3I4MH 2JA6H 3OTOL 4X62L 4UP7A 1UEBA 1YJ9A 1PYSB 1V43A 3HOZG 2K4KA 3E0EA 1V1QA 4KI0A 1EIYB 4DV3Q 3E9HA 2I5LX 2AMCB 2AKWB 4JI3L 2AWOA 1VQ7A 4LF8Q 5IY0A 1PYBA 1NMGA 4LWCA 4LUOA 5BR8L 3WWVA 4HJ8A 2A8VA 3S2HH 5JEAG 1WCMH 2R7DA 2ES2A 2F52A 3TRZA 2A19A 2WP8J 1K3RA 2YYZA 1HNXQ 2KENA 2JEAI 4GKJL 4K0KL 2DGYA 5M3MH 2CFMA 1A63A 4Y7NH 2Z6KA 4B3ML 4OX9Q 4A3FH 4EQ5A 5H1SE 1QZHA 1JT8A 3TEHB 1TWAH 3CCLA 5GAHC 4GOPB 1MJCA 3M9BA 1L2FA 4A93G 4A75A 5IYBG 4KHPQ 1N36Q 3UDGA 1IYJB 4OXPA 5IE8A 3S1MH 3KDFA 1OXTA 4A76A 4X62Q 2R93H 4B3SQ 4JI4L 3HOYG 1M1KC 1GO3E 2UXDL 1X9NA 1X65A 3GD7A 1XNRQ 1E3PA 2K5VA 3J80c 1EIFA 4BBSH 1N32L 2VS1A 1HJPA 3AYHB 3CW2C 1GVPA 3PCOB 3A5ZB 4HJAA 4X65L 1TWFH 4DR7L 4KHPL 1BKBA 4QY7A 3H3VI 3AQQA 1UE6A 3EN2A 5GQOA 1PA6A 1VQKA 1Q12A 2YTVA 4DKAC 3KJOA 4GKJQ 1J6QA 3UE0A 2F4VQ 1YJNA 4DUZL 1ASZA 1HNZQ 1XPOA 2R92G 3I4NG 4K0KQ 2JA9A 4LF4Q 2BH2A 4WJ3M 4C2MH 4IO9A 2I5MX 1Q82C 3KYHC 2Z0SA 1PH4A 4JI8L 2BA0A 3CCUA 4YCVA 3Q8DA 1PH5A 2UU9L 2OQ0A 3GTGH 3CCJA 1X55A 2B63H 2E5LQ 1D7QA 1C7YA 2WB1E 1RIPA 4NB3A 2A1AA 3HKSA 3OYYA 3F8TA 4TVAB 1UE5A 4JBJA 1L1OB 4JI4Q 1K83H 3NELA 5FLMH 1FL0A 3B6YA 3K0XA 1B8AA 5M5YH 4HJ9A 2UXDQ 1HZBA 2HIXA 1N32Q 4XIGS 1HZCA 1NTGA 1X54A 3ICEA 2HQLA 1W3SA 4DR7Q 2NVYH 4GKKQ 4J15A 1VQ9A 2ZM6L 4KHZA 3GO5A 1AE2A 4C3HH 3PO2H 4JV5Q 4LF9L 2GVAA 2N49A 4IOCA 5IP7G 1SMXA 1X3EA 4DUZQ 1T9HA 2XGTA 1MIUA 3G71A 4C3JH 1WI5A 4BXXG 4L5SA 3CMEA 1S40A 1JMCA 4DR1L 3DM3A 1QVFA 4JI8Q 3PIOA 1HZAA 1X3GA 4DUYL 3M85A 2UU9Q 2NVQH 1E1TA 4LFCL 1NBWA 1MKHA 4MNOA 2OTLA 1YHAA 4OWXB 3ZJYC 1U0LA 4A3BG 4NXML 2K75A 3S14H 2ID0A 3UDIA 2GN5A 4DV0L 3CC7A 1AE3A 1KIXA 4JBMA 4BY7G 1C9OA 1YBYA 3NENA 2C35B 5HY6A 4Y52H 3I2ZA 2RCNA 4X66L 3H0GG 1Y1WH 2HHHQ 1Q1BA 4PZ8A 1LTLA 4ME3A 4P72A 4JYAL 1HH2P 1VQ5A 3S1NH 2WAQG 3U4ZA 4DV6L 4UPAA 4JI1Q 2RHQB 2ZM6Q 1EOVA 4LF6L 2JA8H 4A3GG 4DK6C 5AJ3Q 4A3DH 3NEMA 3F1ZA 4HIOA 4LF9Q 2Q2TA 4BA1I 3CP0A 1Q8KA 4A3MG 1Q46A 1VQGA 3EBEA 1Q1EA 2H5XA 3K7AH 1SR3A 5IYDH 1QUQB 1I50H 4DR1Q 1IL2A 2QEXA 5GAGC 1KD1C 4DUYQ 1P8LA 5LMUL 4LF7Q 3HOWG 5JJIA 2VY3A 4LUVA 4IPCA 3T1HQ 5C44H 3I4MG 2JA6G 3UE1A 4A3JH 2JE6I 3KF8B 4A3KH 2LXJA 4PG3A 1N36L 1VQLA 3GTLH 4DV0Q 2B29A 4AYBG 3PF5A 3ERSX 3PSIA 4B3SL 4DV4L 4DR6L 3JAMi 1L0WA 1DGSA 3LGJA 4X66Q 1XMOL 4DPGA 3CPFA 1YEZA 1S72A 4JYAQ 1XNRL 4H02A 1H95A 1A62A 4R4IA 1WCMG 4DV6Q 1Q81C 2OTJA 3HOVH 2UXBL 1SFOH 4LF6Q 1VQFA 4AH6A 3PUYA 3CXCA 1YVCA 5M3MG 4JI0L 1SE8A 2VQEQ 3FP9A 4GOPC 3CD6A 1KRSA 1I5FA 1LUZA 2MO1A 2F4VL 2YU9H 1CKNA 1K0RA 5GROA 1HNZL 3HOXH 3AFQA 4LF4L 1OXXK 1A0IA 3PUVA 2CKZB 5LMUQ 4O0AA 1A8VA 1UWVA 1LM0A 5IT9c 1TXYA 2EQSA 2V1CC 4IPHA 3BJUA 2K52A 2R93G 2PI2E 2E5LL 2JJQA 4R4OA 5JJLA 1TWHH 1G6PA 2YTYA 1K9MC 3KF6B 4IPGA 4DV4Q 4BBSG 2NZOA 4DR6Q 1RL2A 3U58A 1KQSA 2K50A 1XMOQ 4IJLA 5ELNA 3CCMA 4AYBE 1Z47A 4PZ6A 4GNXB 3M4QA 1N34L 2JEBI 4JG2A 4YWLA 4A3IH 2VZAA 5LMNW 4UY8C 2D0OA 4BY1H 1G51A 1SROA 1Q7YC 5FLXc 2UXBQ 3CPWA 4GKKL 3JAMc 5FJ8H 4JI0Q 5C0XJ 4LUZA 5C3EH 2E2IH 4IFDI 5M5WH 5GAEC 4JV5L 1VQEA 1YHQA 3TS2A 1I3QH 1EQQA 3L2PA 4QQBX 4B3RL 2KHJA 4JBWA 2B63G 5IP9H 4JOIA 4KLKA 4QGUA 4JI2L 1XPUA 1E22A 3W1BA 2PQAA 1L1OC 4IJHA 4XTCS 1VQPA 1TWGH 5IYCH 2IHEA 2PMZE 1MJEA 4IPDA 1HNWQ 4A3EH 2UUCL 1HR0L 1KHIA 1B7YB 1IZ6A 3PV0A 5FLMG 4POGA 1XNQL 4POFA 1NY4A 3I4OA 1UE1A 3KFUA 1VQ4A 3A0JA 3J81c 3TS0A 1VQMA 1D8LA 2RF4A 4LW1A 2KCMA 2R7ZH 1FGUA 1N34Q 1W2BA 2BH8A 2HHHL 2YTXA 1GM5A 1PH3A 3PO2G 3HKZG 3TREA 4HIMA 2JA7H 4L5QA 4A3LH 2R7FA 3ULJA 1JJ2A 4BBRH 1BBWA 4JI1L 1VCIA 3RZDH 1E7ZA 5AJ3L 1K8AC 4DR4Q 1K73C 3KDFB
chains in the Genus database with same CATH superfamily
1SDFA 3HEJA 4RG1A 3BG3A 1FVIA 1V1PB 1G91A 4HSPA 1PH9A 1IBKL 1A6XA 3A8KE 3F2CA 3G48A 3K5MA 2UUCQ 4FYDA 1VMCA 4E6IA 3AEVA 1UAPA 4IURA 1NR2A 1Y1WG 4O1NA 1KDBA 1P16A 1HXYD 2F0MA 1U4PA 1PV4A 3WDNA 4C3IB 1LYLA 2JA8B 1F9RA 3CCEA 2RA4A 1MGSA 2ZTEA 5D3IB 1HQMC 4C3IH 4DNIA 4RH6A 2B8GA 3X3NA 5M3FB 1WYDA 4DV5Q 2M9VA 3EIVA 1EUJA 5M3FH 2XWBB 1MHWC 3C1EA 2JSOA 3DWQA 3M4OH 2E2JB 3A7LA 3BU2A 4ULLA 1RHPA 2MJ8A 3S1QB 2E2JH 1ENFA 3KLSX 1SJHD 3R2TA 1TWCB 3S1QH 5M5XB 1ASYA 3HOVB 4GS3A 1TWCH 1S5DD 1G2TA 5M5XH 1C0AA 4J6HA 3K80C 5IT9L 2IX1A 5EKIA 4PMWA 1DOLA 1SN8A 2VB2X 2K14A 2WV6D 1CUKA 4OO1G 1G291 3EFXD 4DA2A 4LF5Q 3IRBA 3J81i 3KLRA 4DV2L 1B9NA 2KCTA 4WRDA 3HOZH 5FLXL 4ZLTF 3BVZA 4K6LA 3MEFA 2Z4HA 5DAUA 4BY1B 5FO8B 4B3TQ 5K36G 1L1OA 4H13C 5FJ8G 3MVVA 2MGSA 1JICA 2PMZB 3ULLA 1DXMA 2WB1B 1XYIA 1YZ6A 3NBHB 3PUXA 3S15B 2LXKA 1IXRA 3DLLA 5CR3A 4CKCA 1BCPC 2KECA 3FDTA 4YY3L 1PRTB 5IYCG 5JEAJ 5KNCA 3S15H 3VYRA 4CHTB 1XTDA 4JC0A 2IY5B 2E74C 3DHQA 3TQYA 1SYFA 3H15A 1HUNA 4JI7L 2O2LD 1VQHA 5J3BA 1TS3A 4BBRG 1X3PA 1AW7A 2DN8A 1JWMD 3S24A 1DD2A 1ILPA 2EY1A 3R93A 1VQ8A 3GTJH 1LO5D 1LT5D 1VQNA 1WTWA 4TQUS 2EDGA 3T53B 1EY4A 4N8X1 1OXVA 1X3QA 5C4ZA 5I4DA 2DJFC 3F2DA 4QUCA 1YITA 2HDMA 5FOBB 4DV1L 3IL8A 1KL9A 1NE3A 4KJNA 3RNUA 3GTKH 1EU3A 4RFBA 2DUDA 1HFNA 4A4IA 1WTQA 2LFNA 2Y0SG 2NN6I 2L0CA 4YCWA 4ID6A 1BBUA 2K5NA 2V4DA 1M8AA 2YV5A 2B2UC 2VUMG 3KJPA 1PTOD 2VQFL 3K5NA 1E24A 5IP7H 3TDQA 4IUQA 4JI6L 4BXXH 2PW5A 3A74A 1LT6D 4K5XA 2H1EA 1LLRD 4X6AH 5FKAC 3H3VH 4R4TA 5KGUA 3F2BA 3BVGA 1RJTA 5IWAQ 4DR2L 1IYVA 4DGZA 3E9IA 1XMQQ 1KLGD 3FKIG 1PDQA 4DV3L 1L0YB 4K2LA 3J81j 5HURA 3OOCA 4C56C 3NHHA 2WAQB 1A2TA 2D0PA 4A3GB 2QF7A 2A68D 4B3TL 4FDBA 3PGZA 4A3GH 3ND9A 2G5DA 1PTOF 2A6ED 4HCEA 1VQOA 4L5RC 3I56A 3HOWB 1H9SA 5DM63 2JA6B 3RMHA 1YNXA 4RAUC 2EIFA 4NXMQ 3CHBD 4OIKA 3HOWH 4R4QA 1CA6A 1PLFA 1LABA 2XSCA 3FHWA 3MA2B 4AYBB 2JA6H 4UP7A 2TSSA 2F0SA 1YJ9A 1SEBD 2K4KA 1PZKD 1V1QA 1FD7D 1L0XB 2I5LX 2AMCB 1JCKB 1NMGA 4LUOA 2QILA 2ES2A 1I4XA 2YYZA 2JEAI 2K5QA 1EEID 4ZQ3A 3PMFA 3UI2A 1PFNA 3M9BA 4F88A 1STEA 4A75A 1IYJB 4BWGB 3NK9A 3K58A 1PTOC 3C46A 3HOYG 1OO9B 1E3PA 1C8CA 2VS1A 1HJPA 2K03A 3A5ZB 5JPMC 4KV6A 1BKBA 5CBEE 2D2CC 1JWUD 3VR2A 2YTVA 1STHA 4GKJQ 1RDPD 3VYSA 2R92G 1XPOA 2JA9A 4WJ3M 1D1IA 4HMIA 2B63B 4PMCA 2IW3A 2Z0SA 4JI8L 2BA0A 1FNWA 1RD9D 3CCUA 1KAAA 3T16A 3GTGH 1X55A 2B63H 5C5MA 1C7YA 1I6HB 2KA7A 2A6HC 3HKSA 2A6EC 3I8ZA 4JBJA 4JI4Q 3OPOA 1K83H 2PO4A 3K6OA 3K0XA 1B8AA 1EY6A 1MBYA 2UXDQ 1Q8IA 4KY7A 1NR4A 3HKZB 1KDCA 2NVYH 4CJ1B 3TP5A 1FR3A 4J15A 2ZM6L 1Q3LA 1PZID 3LNNA 1AE2A 4I7AA 4JV5Q 1TT2A 1SMXA 1T9HA 1K8OA 5ELBA 3DM3A 3PIOA 2QDBA 3M85A 3S14B 1E1TA 4L6TB 1QE6A 4OWXB 3MFGA 4NXML 4A3BB 3S14H 3VR4A 1Y1WB 3BYYB 4BY7B 2ZXPA 2F0OA 1Y1WH 3H0GG 2HHHQ 2CVRA 4ZUIA 3AMUA 5D65A 2MUYA 2QW7A 2Q8IB 4DV6L 2RHQB 3EA6A 5AJ3Q 1DYQA 3SR1A 3PIP3 3NEMA 3F1ZA 1BDOA 5T1IA 4LF9Q 2NBFA 5BN3A 5JJZA 1QUQB 4DR1Q 2K33A 1KD1C 4LF7Q 1SJED 4IPCA 5CV6A 5L37A 2B29A 5TSSA 4DAPA 1DOMA 4DU9A 4DR6L 1K0SA 3JAMi 5EPKA 3TSSA 1L0WA 1DGSA 3LGJA 4DPGA 4K5WA 1O7YA 3ONAB 3CPFA 2F0VA 5D14A 1KABA 1DCZA 1H95A 1Q81C 1GUSA 1Y8PB 5C3WA 3M4YA 2JYOA 1CI3M 2YU9B 3IAYA 4JI0L 3LWEA 2K1BA 1SE8A 1EY9A 4GOPC 3CD6A 1I5FA 2MO1A 3I90A 5NUCA 2YU9H 1CKNA 5GROA 1T5EA 4IN3A 3AFQA 2F0JA 1K8MA 3VYUA 2F03A 4O0AA 1F9QA 4OO1H 1TXYA 2R93G 5JOBA 1G6PA 1K9MC 4BS9A 4PQXA 3I73A 5E4XA 4PZ6A 1TVXA 5EQ0A 1TWFB 4JG2A 4YWLA 3F2UA 1SROA 2E2IB 2UXBQ 1QB5D 4ZUJA 5EKLA 5K36H 2C9OA 3JAMc 3SVMA 5FJ8H 2E2IH 1E2WA 5GAEC 4JV5L 1VQEA 1YHQA 3TS2A 3L2PA 4QQBX 4B3RL 4IUTA 4J1MA 4JBWA 4JOIA 4JI2L 2QCPX 1TWGH 5IYCH 1GUTA 2IHEA 1HNWQ 4IPDA 2J7ZA 1AEXA 5IGFA 1HR0L 1IW7D 1B7YB 2F0LA 4WORA 5FLMG 4POFA 5M5YB 1NY4A 3I4OA 3A0JA 1D5ZC 1D8LA 4LW1A 4YIJA 1EY0A 4CJ2C 2HHHL 2YTXA 1ICWA 4C3HB 3PO2B 2R7FA 1JJ2A 4BBRH 1BBWA 2EOTA 1E7ZA 3NTKA 5AJ3L 4DR4Q 1R9TB 4R8NA 1EIHA 3V2TA 1ESFA 3QIAA 5JAVA 2NVQB 1GHJA 4HR7B 4RGMA 4XT1B 1R9TH 4IFDG 2FINB 4LF7L 2A74C 3H6MA 1XNQQ 2LSSA 1STNA 4YCUA 3GTPB 5IT9E 4QMGA 2A5HA 2Y0SB 4UP8A 3GTPH 1X56A 2LKVA 1SRUA 2VUMB 4A3DG 3E6ZX 4IFDJ 3I7FA 2EPBA 3OMCA 2VUMH 3Q23A 3N52A 5FLXE 1CHQD 1RTNA 5A2QL 2DNCA 1IBKQ 2E2HB 4A3KB 3S2DH 2UXCQ 4DR3Q 5GADC 1JC7A 3L9AX 5ELEA 3AFPA 2Z8LA 2E2HH 4LJZC 1PH2A 2CWPA 3FKIB 1VQIA 3TP7A 4CKBA 2JQOA 4AQYQ 2ZTCA 3FKIH 1RTOA 2TMPA 1QILA 3S1RH 3L0OA 5C5LA 2KCCA 4DAYB 3S17B 2L12A 1IW7C 3A7AB 4UP9A 4DR5L 1WJJA 3RLNA 3SK5A 3S17H 4K14A 4QF4A 1NJIC 2UUBL 4KN4C 2NZHA 3HOXB 3CAMA 1AH9A 1VF7A 3STBD 2SEBD 2FMMA 1Y14B 1CQFA 1TWHB 1X3FA 1HNWL 1D1KA 3QJYA 3D31A 1I94Q 4DK0A 1EZ8A 1PHJA 4K5VA 3TMEA 1MD2D 4OELB 3KOJA 3CC2A 3BDLA 4K2KA 1K8GA 1IBMQ 4LFBQ 5C3EG 2AWNA 2FFKB 1STBA 2LY7A 5KRUA 4FP5D 1OXUA 4MIUA 3U4VA 3KLSA 4DR4L 4QJFA 4JI5Q 2K5HA 4X3UA 1EWIA 1EWHA 3OTOQ 2VNUD 4QUFA 1U9RA 4TSSA 3J81L 2K5WA 2CQOA 2XN9C 4DV2Q 1PH8A 1A3TA 1HZ9A 2IPKD 1PTOB 1CSPA 2OQKA 4KKSA 3HOYH 5J1ZA 2IHFA 3D4DA 4P75A 2KHSA 2NVTH 1PTOH 4UAIA 2B2YA 1BF4A 3CKIB 1SYDA 3PUWA 4U673 4LFAL 4A3LG 3J7YW 2Q8RE 5FK9C 3ULPA 3T4AC 2CH4A 2JA5G 2R92H 2O4XA 4DV7L 4OWTB 1G8ZD 2ZJQA 4XYQA 4YY3Q 5CV7A 2AUKA 4P73A 5EPLA 3IFTA 1O7LA 2IX0A 3X3MA 4DR3L 2UXCL 5C4XG 2A69D 1WTOA 3STBC 1OTCA 1IKMA 1JE5A 2QGQA 4JOIC 5IGCA 4OWWB 2AUJD 2E76C 4JI7Q 1CKMA 2JK8A 3VDYA 2I0QA 4AQYL 1N33L 2BDOA 3GTMB 4V190 1EEFD 1KAWA 2PZWA 3GTMH 3SXHA 1BCPD 3QOLA 4FF1A 1HHVA 4RWSC 1TS2A 1M90C 3MXNB 3QOJA 4X3KA 3RN2A 4IOAA 5CYUA 3M4OB 1JB7A 4DV1Q 5CV5A 3N6RA 1Y1VG 3PUZA 4X3SA 4AIMA 3DMUA 3H09A 1VQCA 3H0GB 1CZGA 1X6OA 1CSQA 3MFYA 3M7GA 1I94L 3H0GH 4MN3A 5EAYA 3CCVA 1F77A 3BS1A 3KF6A 2XRQD 4MZ9A 2F0QA 4ILWA 1HNXL 1IBML 1BCPF 4LFBL 4GNXA 2VQFQ 2CH4W 3RLFA 4OX9L 2NN6G 4KJOA 4JI6Q 3S16H 3MXPA 4IQZA 4GN3B 4RCOA 2IX3A 5JJKA 4JI5L 4UHVA 4DR2Q 5KEEA 3OTOL 2AQ3B 2B2TA 1UEBA 1PYSB 4KTAA 3HOZB 3E0EA 4DV3Q 3E9HA 5DM73 2EY6A 2RDGA 2AWOA 1O80A 4Q0FA 3T56B 4HEDA 5CGKA 4CJ0B 5KNDA 2A8VA 3WWVA 3DWAA 1EL0A 5JEAG 1LACA 2F52A 2A69C 2KENA 2DGYA 2G9HD 2Z6KA 4A3FH 4EQ5A 3R2IA 1WVLA 3TEHB 2HDLA 5GAHC 4GOPB 1XTCD 2R93B 1N36Q 3UDGA 4WJWA 3D4WA 4A76A 3FMCA 2R93H 4B3SQ 1S5FD 2O5IC 1V1PA 1GO3E 1SNMA 1R4QB 1I6VC 1X9NA 4EQPA 2SNSA 3GD7A 1N32L 1ZYRD 3V96A 1JOKA 4XQQA 4DR7L 4IUUA 2EE1A 1PA6A 4N9PA 1VQKA 1Q12A 1B3QA 4DKAC 2FHTA 5ISRA 1WTXA 3GTJB 2HCCA 4DUZL 3TN2A 2PPBC 3BDCA 3E5SA 1Q82C 1PH4A 1SNDA 2UU9L 2OQ0A 1HA6A 4KD3A 2E5LQ 1D7QA 2WB1E 1F2MA 3GTKB 3F8TA 2D9UA 4TVAB 4CDEC 4OHJA 2PZTA 5FLMH 3B6YA 4G4KA 5CMDA 4HJ9A 4IUVA 2HIXA 4XIGS 3U9OA 3HZXA 3NXWA 1JWSD 1VQ9A 1WTRA 4FXGC 3GO5A 5CORA 2F0IA 3FRPB 1TS5A 2GVAA 2RBMA 4IOCA 4EGVA 1JORA 4L5SA 3CMEA 1GUGA 1S40A 1QVFA 4JI8Q 4QIWB 1HZAA 2DY8A 4DUYL 1YNJC 1LTID 3RD4A 1MKHA 2OTLA 1QNUA 5EJWA 4IFDH 4RKBA 2GN5A 3CC7A 2FMCA 2L5TA 1NCVA 5HY6A 3R8BA 5IGGA 5IODA 3SEBA 4PZ8A 4KN7C 1HCZA 2OXPA 4P72A 4JI1Q 2ZM6Q 4LF6L 2K28A 4DK6C 1FNVA 2N55A 4A3DH 4RGTA 1F9PA 3DXJC 4G7OC 2Q2TA 3CP0A 1Q8KA 4A3MG 1Q46A 3EBEA 1ZYRC 4CDFC 2A6HD 1D2BA 2QEXA 4LUVA 3T1HQ 3I4MG 3UE1A 4B08A 2JE6I 3KF8B 2ZXRA 1B50A 1N36L 4H7BA 3GTLH 3NBHA 3GV3A 2F3WA 4K8JA 3GP7A 3ERSX 2JP1A 4KY6A 4B3SL 1U4LA 3SK6A 1SYBA 1QCBD 1KNEA 1IL8A 4R4IA 1WCMG 4DV6Q 4IALA 2ENBA 2K32A 3CXCA 5FO7B 1YVCA 1GOZA 1B53A 3FP9A 1LUZA 3ITPA 2WINB 3DEOA 1A0IA 5KYIA 2E2DC 1UWVA 5IT9c 1ENCA 2K52A 2E5LL 3J80L 4R4OA 2YTYA 2EYOA 4BBSG 2BOSA 4DR6Q 1LTBD 3U58A 2K50A 4DN4M 1JQYD 3VR5A 1Z47A 2CW0C 2L1BA 3CRLC 1E2VA 4AYBE 4F87A 3CCMA 1N34L 3V05A 5CV8A 2VZAA 5LMNW 1TY2A 2D0OA 2B2TC 2EJGC 4DNRB 5FLXc 4HTHA 5M5WB 4JI0Q 5C0XJ 5C3EH 5M5WH 1ENAA 1CTMA 1EU4A 2HD3A 1EQQA 3GTGB 4KLKA 4P2CB 3W1BA 3OIQA 1L1OC 4IJHA 1VQPA 1SE4A 4ZKCB 1K83B 4POGA 5DNFA 2HQEA 1A2UA 2BCOA 5A2QE 2NVYB 2BH8A 4LK1C 1EZ6A 1GM5A 4LAAA 4F7XA 3Q0AA 1SNOA 1PH3A 4HIMA 4A3LH 4L5QA 3ULJA 3QB3A 4JI1L 2JA5B 3C1FA 1VCIA 4C3JG 1X32A 1O78A 5BN4A 3KDFB 3W1GA 2JA5H 3BVMA 4P71A 4K6DA 3OWEB 4B3RQ 4JI2Q 4PV1C 3E0JA 3CCQA 4FO2A 2EY5A 5LMNL 3PF4A 3EJIA 3G4SA 5HGTA 3T1HL 1VQDA 1HR0Q 1CQVA 1UNSA 1S4ZA 5C4XH 1PRTD 1PH1A 5A35A 2B2WA 2OWOA 1KC8C 2N3SA 3CQZH 1FNUA 2RQXA 4RHRA 4I7ZC 4O2DA 2JA8G 1II3A 1TS4A 4QL5A 2Q8TA 1QZGA 1PVOA 1D6EC 1F2YA 3G6EA 2EYPA 2NVXB 3HKZE 5IYDG 5I6WA 1XXGA 4XYOA 2PCFB 3OW2A 2F0UA 2EZVA 2VB3X 3UDXA 2NVXH 2KOLA 2EXDA 5C0XI 2FJ2A 1J5EQ 3J7ZC 5C44G 4A3JG 1GD7A 1Z9FA 3NPPA 4RGNA 4RMFA 2UUAL 2LS01 2B8FA 2ZJPA 2Q2HA 1YIJA 1Y1VH 2NWGA 4RA8A 4IUPA 4ME5A 1XPRA 1I4GA 1PH7A 3W5OA 4N9TA 1YI2A 1EYDA 1EFWA 4I65A 2Q2IA 1LV9A 4ZCKA 3HOVG 3WOFA 1EY8A 3CCRA 2MP1A 3J81E 3BZKA 1KRTA 2NUCA 1TU2B 5HGQA 3EVQA 1HR0W 2ALYB 1O7IA 1GKHA 4S3SA 1EY5A 1PMRA 4A3FG 1TY0A 4JVZA 2NN6H 5E7NA 1HQRD 1D5XC 1JJGA 2BE5D 2NYZD 3K81C 3MXGA 4KD4A 4FF2A 3FVQA 3EROA 1FJGL 4ZKBB 1SXTA 2OCEA 2L9HA 4BY1G 1B2TA 2XTIA 1CKOA 4NPSA 4NXNL 4WFN3 4HJ7A 4DR5Q 1XJVA 4H44C 3DM1A 4ZK9B 2RDFA 5JEAH 2KQ3A 1PRTC 3MZ5A 2UUBQ 2WB1G 4JBKA 1Y8OB 5COYA 2F0GA 3E3XA 1SSOA 4GN4B 1IBLL 2RKSA 5G3LD 2F0DA 2ZTDA 2F3VA 4R1JA 3Q6SA 1TWGB 2P5ZX 2MO0A 2ATWA 1AZPA 1SYGA 4YHHL 2WIIB 3M3YH 1BCPB 1GUOA 4CDDC 1AZQA 4JI3Q 2R7ZG 4O42A 2RCFA 2JA7G 3KK7A 1LT4D 4BBRB 2F4IA 3I55A 3A54A 1ML0D 1WTVA 1B4OA 1QG7A 3L3OC 3K8AA 5ELCA 5G3LF 2K5DA 1J5EL 1Q86C 3PO3G 4GLVB 4EVOA 1SNQA 1N8RC 3H91A 3GTQH 4KK7A 1QUQA 3CU7A 2C5CA 3BZCA 4DK3C 3MAQA 5EKKA 3TP6A 1H9RA 2BE5C 4EX5A 1HTPA 3BYTB 3MTSA 2HT1A 3GQBA 4LFAQ 4V0BA 2MQHA 1PH6A 2AHOB 1C4QA 4HIDA 3PIO3 2PQAB 2MFIA 4C1NK 2RSOA 2WKCA 5D3DA 5BN5A 2VW9A 2Z1CA 4HAEA 4DV7Q 4PZ7A 4GLXA 2ASBA 4HIKA 1S5BD 4X64L 1QJOA 1PFSA 3S2DB 3A5UA 3CMAA 2EYHA 4A3CH 3ER0A 3NTHA 1HA5A 2HIVA 3U9SA 5DEHA 3H94A 1CHPD 4KKUA 4QB4A 4FXDA 2N78A 3A8JE 1BVSA 2R6GA 3D0FA 3S1RB 4L5TA 2A73B 3K59A 3KLWA 3NE5B 1N33Q 3Q22A 4LF8L 1SLJA 2RSNA 2FXQA 3P75A 2KEEA 4P74A 2K01A 4KY5A 2Y0SE 1OXSC 1JJCB 4A3MB 1TKWB 4KHVA 5E1FA 1NMFA 1STGA 2F0EA 4A3MH 1PFMA 3RUZA 1Z7TA 2R61A 3HOUG 1ET6A 5EGTA 2ZJRA 2PNRC 4R4CA 2N8NA 1UUPA 4KHPL 2I5HA 3I4MH 1NNXA 5IIFA 4X62L 1MSHA 1V43A 3SK4A 2XWJB 1DONA 1LT3D 1WTHA 2EJFC 4JI3L 3G7LA 3W2DA 3S2HB 3OIPA 5IY0A 3S2HH 2R7DA 1WCMH 3TRZA 1W6JA 2A19A 2WP8J 1HNXQ 4DAVA 4K0KL 1TWAB 2CFMA 4NP5A 1A63A 5K5PA 4OX9Q 1Y69U 5I2YA 1RF2D 1QZHA 1JT8A 1F2ZA 1TWAH 3LX0A 3CCLA 1NUCA 3T13A 1L2FA 4A93G 4TRDA 5IYBG 3W3AA 3S1MH 1OXTA 3VYTA 4BBSB 2JN4A 4HCSA 3CRKC 3HOYB 2D5DA 4XQJA 1X65A 4BBSH 2NVTB 4X3TA 3AYHB 4ZYSA 3URYA 3IKJA 1GVPA 3PCOB 4Q5VA 4QY7A 3H3VI 3AQQA 5GQOA 4DF7A 2KCNA 3KJOA 1J6QA 3I4NG 1YJNA 1ASZA 2R92B 3P20A 4LF4Q 1ZKOA 2I5MX 3EQLC 1PXUA 3KYHC 3HGBA 3DWPA 2SOBA 4YCVA 1PH5A 3OW7A 1BR9A 1JOQA 1RIPA 3OYYA 2J0TD 2B2UA 1W6KA 2DY7A 1L1OB 1LTSD 2OF1A 1CK1A 1FL0A 3TZDA 5I2XA 4R9WA 5EBCA 1N32Q 1HZCA 1X54A 1GUWA 1W3SA 4DR7Q 5E3FA 4GKKQ 1EQVA 1B3AA 2F0FA 4DXFA 4PMBA 4C3JB 1V8QA 1ZEQX 1VMPA 2WACA 4U68A 1X3EA 4DUZQ 4M1UB 1GUNA 2XGTA 1MIUA 3G71A 1E0BA 1WI5A 3D8GA 4C3JH 4DAYA 1JMCA 1CM9A 2XIWA 1X3GA 2UU9Q 1DZ1A 2KUMA 1RKNA 1YNNC 3TBIB 1B9MA 1U0LA 2F0WA 4A3BG 3HS0C 2K75A 4DV0L 2WKDA 4NW2A 1AN8A 5J22A 1KIXA 4JBMA 4BY7G 5I9OA 4Y52H 4X66L 1I4QA 1Q1BA 3DUZA 1SE2A 4JYAL 1HH2P 1EFID 3VR3A 3U4ZA 4UPAA 1E2ZA 2JA8H 3I72A 3J80E 4HIOA 3QR8A 1K3BC 1I50B 4QCLA 4BA1I 1VQGA 3S16B 3JAME 1Q1EA 2E75C 2H5XA 1SR3A 5IYDH 1I50H 5C44B 2CHBD 4A3JB 1IL2A 2AQ2B 4J8QA 4DUYQ 1P8LA 2JXMB 5LMUL 5JJIA 2X6GA 2VY3A 5C44H 4A3JH 5IGDA 1HFGA 2LXJA 4PG3A 4G7ZC 3PSIA 4DV4L 1XMOL 1V1OA 1SFOB 1PZJD 1S72A 1JE4A 4H02A 1A62A 1STAA 1G6ZA 2OTJA 3HOVH 1SFOH 4LF6Q 1VQFA 3I91A 3PUYA 2CQAA 5M3MG 1YNJD 2J4XA 2VQEQ 1ONLA 1KRSA 4A3FB 3MXUA 1WTPA 1K0RA 2H4OA 4ZAIA 4LF4L 1OXXK 2K7VA 1PFBA 2Z4IA 2CKZB 1A8VA 2ZT9C 5JPNC 4MTKA 2EQSA 4XDXA 1J9OA 2V1CC 3A8IE 4IPHA 2X6LA 1CZWA 2PI2E 2JJQA 5JJLA 4XQNA 2NZOA 2B39A 2QKIC 3P7JA 4Z9CB 1A3UA 2IJ0A 4BY1H 1H9SB 2N88A 5C4HA 4GKKL 4LUZA 1EWCA 1S5ED 3K0YA 1AFPA 2KHJA 1XX8A 4B9XA 1XPUA 4QGUA 1E22A 1SBBB 2PMZE 5EPJA 1M4VA 2PZUA 2UUCL 1KHIA 3G6JB 1ILQA 1IZ6A 3MXNA 2PW7A 2F1MA 3KFUA 2R7ZB 1XWEA 3J81c 4JPBW 4CKEA 2XRSD 1EOTA 1QNKA 1VDZA 1N34Q 2R7ZH 2JA7B 1KTKA 4ZRZA 3GV6A 4C3HG 3PO2G 4GZYC 1J8IA 2JA7H 1HRJA 5CV9A 1K73C 2F0PA 4ABNA 3MWYW 2I46A 4DV5L 1VQBA 3K7UC 1D5MC 1T5XD 1QOHA 5IGBA 2B2YC 1DOKA 1TQOA 3CF5A 3PO3B 5LL6S 5IOCA 2DJGC 1UEAB 3OSOA 1B70B 2CW0D 1U5KA 3PQIA 3PO3H 4A3CG 2PI2A 3ERQA 4C1NI 2PQEA 3J7AV 1GHKA 2L15A 4TKOB 4HMJA 2KHIA 4HSVA 5CC4A 2QEJC 4NMZA 5DLQE 1R4PB 2WFWA 2GVBA 3O13A 4GN5A 4CGYB 1V9PA 4OO1I 4L8JA 4A3DB 5AFWA 3SK8A 4OONA 1EIGA 1FYCA 2EYMA 1BO0A 3L7ZC 2VL6A 1Q90A 2PYKA 5KYLA 2CWAA 4JCVE 1BBXC 2VQEL 3PIPA 1JR0D 4FVMA 1SNCA 2NZ1D 1DM0B 3I70A 5LMNQ 2SNMA 4A3KG 4YWMA 4LF5L 3QWNA 2L11A 3GTLB 4RHSA 4QIWE 3BDOA 1C48A 3FPPA 2MNAA 1TIID 4GOPA 2F0KA 5EBDA 1EQTA 3SDZA 3SHLA 2RHSB 2EVBA 3GDEA 1IKLA 1BUVT 1EY7A 4G57A 5JVH3 1IYUA 2M2LA 3HFZB 3KBXA 3MHBA 3HOXG 3HOUB 4DAMA 2WAQE 4LNQA 3UDFA 4R8IA 1O7ZA 1SAPA 3HOUH 3QO2A 4NDXA 2UUAQ 3SGIA 1VQ6A 3D6WA 4GNXC 5C0XG 1BOSA 2EXZA 4DXGA 4GLAC 2O5JC 4FF4A 3K5LA 4A3IG 4BA2I 3JAML 2F3IA 1WOCA 1VQAA 4DFAA 2G9DA 5KIXA 1WD0A 1WFQA 1F2LA 2MHVA 5C3EB 2Q2UA 1G2SA 4ODGA 1A15A 3NBIA 1H9MA 5IP9G 4A93B 3T1YQ 1LTAD 1B44D 3D4RA 1HTLD 4A3EG 1GXDC 4A93H 2IT1A 5IYBH 1VQJA 3NQIA 3U50C 2B3GA 4XXEA 2KJXA 1E1OA 2ICEC 5FO9B 3C2PA 1FJGQ 2Z6KC 1QWYA 2QA4A 5ELFA 5BR8Q 3AU7A 1CKNB 4NXNQ 1UE7A 4OGQC 1EYGA 2EYFA 3I4NB 2NB0A 2L4NA 1KNAA 4B3MQ 3I4NH 3JC66 1H9KA 3RR5A 2XVSA 2A68C 3NTIA 2IWHA 1IBLQ 1QVCA 1K28A 2XNAC 3P1HA 2CCZA 4RGOS 5ELOA 2F0NA 5M9OA 1I4RA 1SMYD 4MTNA 1TR5A 2B2VA 4N8FA 3OHXC 5IWAL 4YHHQ 1EQRA 1KXLA 1ESRA 1I6HH 1XMQL 5C4JB 5T1GA 4YWKA 5C4XB 1Y8NB 2ICIA 2KEDA 5C4JH 3CQZB 3RLOA 4X65Q 5CBAE 3Q24A 3KF8A 3TZUA 3HRZC 1YHBA 2K05A 3VA5A 3RN5A 4M8AA 4ALPA 1F9SA 1EYCA 4C3IG 3M4PA 1NSNS 2KBNA 1B1ZA 4PNYA 1N9WA 1STYA 5M3FG 2D62A 3CC4A 2HUGA 2PNHA 3M7NA 4HJ5A 1Y1VB 3GTOB 4A3BH 1JB3A 2ZXOA 4DNTB 3OMGA 3GTOH 4G7HC 1RODA 1VS0A 4BY7H 5I9PA 3KUPA 4FF3A 2OT2A 1PRTF 1NAPA 4APVA 2E8GA 2BA1A 1I4HA 3S9WA 3RZOB 1QVGA 1I4PA 5I6YA 4IZ8A 3WOEA 3RZOH 3BZDB 4LFCQ 4X64Q 4WJ4A 1YJWA 2VXWA 3CCSA 4IUNA 3J80i 2KVMA 3T1YL 3J7A5 1MSGA 1S3OA 3HOZG 4HN7A 3SE0A 3HG9A 4KI0A 1EIYB 1JOOA 2AKWB 1SMYC 1WD1A 3J7AF 4JW0A 2MPMA 1VQ7A 4LF8Q 1PYBA 2L55A 5BR8L 4LWCA 4HJ8A 5J39A 1LTTD 4XT3B 5M3MB 3I3CA 4Y7NB 2EY2A 1VF5C 1K3RA 4GKJL 3AB9A 1U4RA 2LMCB 1CT1D 5M3MH 4Y7NH 1CFMA 4B3ML 2X69A 5H1SE 1HPCA 3ND8A 3K5OA 1GJXA 3KBGA 1MI2A 1MJCA 2M00A 3D3RA 4KHPQ 5ELDA 4KMUC 2GA4B 4OXPA 3M3YB 4MHEA 5IE8A 5KNBA 2NTTA 3KDFA 5CV4A 3DEPA 4X62Q 1FGBD 1CA5A 4JI4L 3R3OA 1M1KC 1ZXTA 2EYLA 3NWTA 4EQOA 2UXDL 4KKTA 1XNRQ 3J80c 2K5VA 1EIFA 3CW2C 1SYCA 4JK1C 4HJAA 3NUCA 1TWFH 4X65L 4NKLA 3A56A 1UE6A 3EN2A 2F0HA 4FXKC 3QG1A 4C2MB 3UE0A 2F4VQ 4K0KQ 2NTSA 2AQ1B 1HNZQ 4F8MA 3HP3A 2OEOA 4RCNA 2BH2A 5E4WC 4C2MH 4IO9A 2QDLA 2K6AA 3Q8DA 3IFDA 3CCJA 1HUMA 4NB3A 2A1AA 3GTQB 1KLUD 1UE5A 3NELA 1Z6HA 5M5YH 3TP8A 2K04A 1HZBA 1NTGA 3ICEA 2HQLA 2R3ZA 1H9JA 4KHZA 4C3HH 3PO2H 1KDAA 1LTRD 3H3VC 4CBVA 2RVLA 4LF9L 2N49A 5IP7G 3A55A 5C3XA 4BXXG 1LTGD 4DR1L 2NVQH 4LFCL 1NBWA 1EYAA 4MNOA 4DK1A 2DNEA 1YHAA 3MC0B 3NP8A 4UDUC 3ZJYC 1DJRD 5JVG3 2Z9HA 3T51B 2ID0A 3UDIA 5LHY1 1AE3A 4LMQD 1C9OA 1YBYA 3NENA 5F2DA 2C35B 3S1NB 3I2ZA 2RCNA 3NQTA 5C6AA 1LTLA 2B2VC 4ME3A 1VQ5A 3S1NH 2WAQG 3K57A 4H0LC 2IL8A 4K8IA 1EOVA 4A3GG 1U4MA 3VR6A 3NWSA 3K7AB 1ET9A 1AP0A 2B2WC 3K7AH 1BQQT 3OWFA 5GAGC 3HOWG 2I07B 2JA6G 3I4MB 4A3KH 1VQLA 2EYJA 4DV0Q 3PF5A 4AYBG 5IGEA 3LWUA 4X66Q 4OEMB 1YEZA 3ZYYX 4JYAQ 1XNRL 1RCVD 1WCMB 2UXBL 2RDHA 4AH6A 3FPUB 4OL7A 2HCIA 3D6CA 1YNND 2F4VL 2Z6BA 1HNZL 3HOXH 3PUVA 5LMUQ 1SYEA 1LM0A 4CDCC 3S1MB 4EQNA 3BJUA 1TWHH 3KF6B 4IPGA 4DV4Q 3FEWX 3MEHA 4A3IB 1RL2A 5C0XH 1KQSA 1XMOQ 4IJLA 5ELNA 3C3LA 4GNXB 3M4QA 4RKLA 2JEBI 4A3IH 4UY8C 2SDFA 1G51A 1ICFB 1Q7YC 3CPWA 1I3QB 4IFDI 1I3QH 3I4LA 1SNPA 2B63G 5IP9H 4A3EB 1PYWD 1A3VA 2PQAA 4XTCS 1S5CD 1MJEA 4A3EH 5LL6X 1SE3A 3PV0A 1XNQL 1BNZA 1UE1A 1BXTA 1VQ4A 2BDNA 3TS0A 4L63B 4B9WA 1VQMA 3NSWA 2RF4A 2KCMA 1FGUA 1W2BA 1IHZA 3VA7A 3HKZG 3RZDB 4FNFA 3TREA 2F0TA 4OIJA 3RZDH 2EJMA 1K8AC
chains in the Genus database with same CATH topology
3W1GA 2JA5H 4DV5L 1VQBA 3K7UC 4P71A 4RG1A 1FVIA 4B3RQ 4JI2Q 1R9TH 1PH9A 1IBKL 3CCQA 3CF5A 5LMNL 3PF4A 3G4SA 4IFDG 3F2CA 4LF7L 1B70B 3G48A 3T1HL 1VQDA 1U5KA 1HR0Q 2UUCQ 3PO3H 4A3CG 2PI2A 2LSSA 1XNQQ 3AEVA 4YCUA 5C4XH 1Y1WG 1PH1A 2L15A 1P16A 2KHIA 2OWOA 4UP8A 1KC8C 2N3SA 3CQZH 3GTPH 1X56A 5DLQE 1PV4A 2WFWA 4O2DA 2GVBA 2JA8G 4GN5A 1LYLA 1SRUA 1V9PA 4A3DG 4OO1I 3CCEA 4IFDJ 4QL5A 2ZTEA 3I7FA 1QZGA 1PVOA 4OONA 4C3IH 3L7ZC 4DNIA 2VL6A 3G6EA 2VUMH 3HKZE 5IYDG 2CWAA 4JCVE 3OW2A 1WYDA 4DV5Q 2VQEL 3EIVA 1EUJA 3UDXA 3PIPA 2NVXH 2EXDA 5C0XI 5M3FH 3J7ZC 1J5EQ 5C44G 1IBKQ 4A3JG 1GD7A 5LMNQ 4A3KG 1Z9FA 4YWMA 4RMFA 2UUAL 4LF5L 3M4OH 3S2DH 2UXCQ 4DR3Q 5GADC 2ZJPA 3BU2A 3AFPA 2Q2HA 1YIJA 2E2HH 1Y1VH 4QIWE 1PH2A 2CWPA 2MNAA 1XPRA 1VQIA 2E2JH 1PH7A 4GOPA 3W5OA 2JQOA 4AQYQ 1YI2A 2ZTCA 3FKIH 3S1QH 1ASYA 2RHSB 1EFWA 2Q2IA 3GDEA 3L0OA 3S1RH 3HOVG 4DAYB 4GS3A 1TWCH 4UP9A 3CCRA 4DR5L 1WJJA 5M5XH 1C0AA 3BZKA 1KRTA 3RLNA 3S17H 3K80C 5HGQA 1NJIC 1HR0W 2UUBL 2ALYB 1O7IA 3HFZB 2IX1A 2NZHA 1GKHA 3HOXG 4PMWA 2WAQE 4DAMA 1SN8A 3CAMA 1AH9A 2K14A 4A3FG 3STBD 4LNQA 4OO1G 1CUKA 5E7NA 1G291 3UDFA 3HOUH 1JJGA 2UUAQ 1Y14B 3SGIA 4LF5Q 3IRBA 3J81i 3K81C 1VQ6A 1X3FA 4DV2L 4GNXC 2KCTA 1HNWL 5C0XG 3D31A 1FJGL 3HOZH 1I94Q 4GLAC 2OCEA 4A3IG 3MEFA 1PHJA 4BA2I 2F3IA 4BY1G 1WOCA 1VQAA 2XTIA 1CKOA 4NPSA 4NXNL 4B3TQ 3KOJA 5K36G 3CC2A 1L1OA 4HJ7A 4DR5Q 1XJVA 5FJ8G 1K8GA 1IBMQ 1WFQA 4LFBQ 5C3EG 2AWNA 2Q2UA 2UUBQ 3ULLA 1OXUA 2WB1G 4JBKA 3U4VA 1YZ6A 3NBHB 3PUXA 5IP9G 4GN4B 1IBLL 4DR4L 4QJFA 2LXKA 1IXRA 2ZTDA 3DLLA 3T1YQ 4JI5Q 2K5HA 4YY3L 5IYCG 4R1JA 1EWIA 3OTOQ 5JEAJ 2VNUD 4A3EG 2MO0A 2ATWA 3S15H 4A93H 2IT1A 5IYBH 1VQJA 4YHHL 3M3YH 2CQOA 1XTDA 4JC0A 2B3GA 3U50C 4DV2Q 1E1OA 1PH8A 2IY5B 1HZ9A 3TQYA 2OQKA 1CSPA 2Z6KC 2QA4A 4JI3Q 1FJGQ 3HOYH 2IHFA 3H15A 2R7ZG 4P75A 2NVTH 4JI7L 5BR8Q 1VQHA 1CKNB 3PUWA 5J3BA 4NXNQ 4LFAL 2JA7G 4A3LG 4BBRG 1UE7A 1EYGA 3S24A 3ULPA 1VQ8A 4B3MQ 3I55A 3GTJH 2JA5G 1VQNA 2R92H 3I4NH 3JC66 3RR5A 4DV7L 4OWTB 4TQUS 2ZJQA 1IBLQ 3K8AA 1QVCA 1OXVA 2CCZA 4YY3Q 5ELOA 4MTNA 3F2DA 1YITA 1J5EL 1Q86C 4DV1L 4P73A 4GLVB 3PO3G 4YHHQ 5IWAL 1EQRA 1KXLA 1KL9A 1I6HH 1NE3A 3RNUA 1N8RC 1XMQL 3GTKH 3GTQH 2UXCL 5C4XG 2IX0A 4DR3L 1QUQA 4YWKA 3STBC 1OTCA 1JE5A 2QGQA 2DUDA 3BZCA 4JOIC 4DK3C 4A4IA 4OWWB 5C4JH 3RLOA 4X65Q 4JI7Q 4EX5A 1CKMA 2JK8A 3VDYA 2I0QA 2Y0SG 4AQYL 1N33L 1YHBA 2HT1A 2NN6I 4LFAQ 4YCWA 2MQHA 1PH6A 3RN5A 1BBUA 2K5NA 1KAWA 4ALPA 2YV5A 2AHOB 3M4PA 2VUMG 3KJPA 4HIDA 2KBNA 2PQAB 2MFIA 3GTMH 2VQFL 2VW9A 1M90C 1E24A 5IP7H 4DV7Q 3MXNB 1N9WA 5M3FG 4PZ7A 2D62A 3CC4A 4JI6L 4BXXH 3A74A 4GLXA 4HIKA 3RN2A 2ASBA 4IOAA 4X64L 4X6AH 3H3VH 1PFSA 4R4TA 1JB7A 2PNHA 3A5UA 3CMAA 3F2BA 4DV1Q 1Y1VG 5IWAQ 4DR2L 4HJ5A 3M7NA 3PUZA 3ER0A 4A3CH 3E9IA 1XMQQ 2HIVA 4AIMA 4A3BH 3GTOH 1VQCA 3FKIG 2N78A 1X6OA 4DV3L 1VS0A 1BVSA 1CSQA 2R6GA 3D0FA 3J81j 4BY7H 1I94L 4L5TA 3KLWA 3H0GH 1N33Q 5JJKA 2D0PA 1SLJA 5EAYA 3CCVA 4APVA 4LF8L 2FXQA 2E8GA 2BA1A 3KF6A 4P74A 4B3TL 4MZ9A 4FDBA 2Y0SE 1OXSC 3PGZA 1JJCB 4A3GH 1HNXL 1IBML 4LFBL 4GNXA 2VQFQ 1QVGA 1NMFA 3RLFA 4OX9L 2NN6G 4A3MH 3RZOH 1VQOA 4JI6Q 4L5RC 3I56A 3S16H 4LFCQ 3HOUG 4GN3B 4X64Q 4WJ4A 2ZJRA 1YJWA 1YNXA 4R4CA 2EIFA 2N8NA 4JI5L 3J80i 3CCSA 3T1YL 4NXMQ 3HOWH 4R4QA 3J7A5 2I5HA 1S3OA 4DR2Q 3FHWA 3I4MH 2JA6H 3OTOL 4X62L 4UP7A 1UEBA 1YJ9A 1PYSB 1V43A 3HOZG 2K4KA 3E0EA 1V1QA 4KI0A 1EIYB 4DV3Q 3E9HA 2I5LX 2AMCB 2AKWB 4JI3L 2AWOA 1VQ7A 4LF8Q 5IY0A 1PYBA 1NMGA 4LWCA 4LUOA 5BR8L 3WWVA 4HJ8A 2A8VA 3S2HH 5JEAG 1WCMH 2R7DA 2ES2A 2F52A 3TRZA 2A19A 2WP8J 1K3RA 2YYZA 1HNXQ 2KENA 2JEAI 4GKJL 4K0KL 2DGYA 5M3MH 2CFMA 1A63A 4Y7NH 2Z6KA 4B3ML 4OX9Q 4A3FH 4EQ5A 5H1SE 1QZHA 1JT8A 3TEHB 1TWAH 3CCLA 5GAHC 4GOPB 1MJCA 3M9BA 1L2FA 4A93G 4A75A 5IYBG 4KHPQ 1N36Q 3UDGA 1IYJB 4OXPA 5IE8A 3S1MH 3KDFA 1OXTA 4A76A 4X62Q 2R93H 4B3SQ 4JI4L 3HOYG 1M1KC 1GO3E 2UXDL 1X9NA 1X65A 3GD7A 1XNRQ 1E3PA 2K5VA 3J80c 1EIFA 4BBSH 1N32L 2VS1A 1HJPA 3AYHB 3CW2C 1GVPA 3PCOB 3A5ZB 4HJAA 4X65L 1TWFH 4DR7L 4KHPL 1BKBA 4QY7A 3H3VI 3AQQA 1UE6A 3EN2A 5GQOA 1PA6A 1VQKA 1Q12A 2YTVA 4DKAC 3KJOA 4GKJQ 1J6QA 3UE0A 2F4VQ 1YJNA 4DUZL 1ASZA 1HNZQ 1XPOA 2R92G 3I4NG 4K0KQ 2JA9A 4LF4Q 2BH2A 4WJ3M 4C2MH 4IO9A 2I5MX 1Q82C 3KYHC 2Z0SA 1PH4A 4JI8L 2BA0A 3CCUA 4YCVA 3Q8DA 1PH5A 2UU9L 2OQ0A 3GTGH 3CCJA 1X55A 2B63H 2E5LQ 1D7QA 1C7YA 2WB1E 1RIPA 4NB3A 2A1AA 3HKSA 3OYYA 3F8TA 4TVAB 1UE5A 4JBJA 1L1OB 4JI4Q 1K83H 3NELA 5FLMH 1FL0A 3B6YA 3K0XA 1B8AA 5M5YH 4HJ9A 2UXDQ 1HZBA 2HIXA 1N32Q 4XIGS 1HZCA 1NTGA 1X54A 3ICEA 2HQLA 1W3SA 4DR7Q 2NVYH 4GKKQ 4J15A 1VQ9A 2ZM6L 4KHZA 3GO5A 1AE2A 4C3HH 3PO2H 4JV5Q 4LF9L 2GVAA 2N49A 4IOCA 5IP7G 1SMXA 1X3EA 4DUZQ 1T9HA 2XGTA 1MIUA 3G71A 4C3JH 1WI5A 4BXXG 4L5SA 3CMEA 1S40A 1JMCA 4DR1L 3DM3A 1QVFA 4JI8Q 3PIOA 1HZAA 1X3GA 4DUYL 3M85A 2UU9Q 2NVQH 1E1TA 4LFCL 1NBWA 1MKHA 4MNOA 2OTLA 1YHAA 4OWXB 3ZJYC 1U0LA 4A3BG 4NXML 2K75A 3S14H 2ID0A 3UDIA 2GN5A 4DV0L 3CC7A 1AE3A 1KIXA 4JBMA 4BY7G 1C9OA 1YBYA 3NENA 2C35B 5HY6A 4Y52H 3I2ZA 2RCNA 4X66L 3H0GG 1Y1WH 2HHHQ 1Q1BA 4PZ8A 1LTLA 4ME3A 4P72A 4JYAL 1HH2P 1VQ5A 3S1NH 2WAQG 3U4ZA 4DV6L 4UPAA 4JI1Q 2RHQB 2ZM6Q 1EOVA 4LF6L 2JA8H 4A3GG 4DK6C 5AJ3Q 4A3DH 3NEMA 3F1ZA 4HIOA 4LF9Q 2Q2TA 4BA1I 3CP0A 1Q8KA 4A3MG 1Q46A 1VQGA 3EBEA 1Q1EA 2H5XA 3K7AH 1SR3A 5IYDH 1QUQB 1I50H 4DR1Q 1IL2A 2QEXA 5GAGC 1KD1C 4DUYQ 1P8LA 5LMUL 4LF7Q 3HOWG 5JJIA 2VY3A 4LUVA 4IPCA 3T1HQ 5C44H 3I4MG 2JA6G 3UE1A 4A3JH 2JE6I 3KF8B 4A3KH 2LXJA 4PG3A 1N36L 1VQLA 3GTLH 4DV0Q 2B29A 4AYBG 3PF5A 3ERSX 3PSIA 4B3SL 4DV4L 4DR6L 3JAMi 1L0WA 1DGSA 3LGJA 4X66Q 1XMOL 4DPGA 3CPFA 1YEZA 1S72A 4JYAQ 1XNRL 4H02A 1H95A 1A62A 4R4IA 1WCMG 4DV6Q 1Q81C 2OTJA 3HOVH 2UXBL 1SFOH 4LF6Q 1VQFA 4AH6A 3PUYA 3CXCA 1YVCA 5M3MG 4JI0L 1SE8A 2VQEQ 3FP9A 4GOPC 3CD6A 1KRSA 1I5FA 1LUZA 2MO1A 2F4VL 2YU9H 1CKNA 1K0RA 5GROA 1HNZL 3HOXH 3AFQA 4LF4L 1OXXK 1A0IA 3PUVA 2CKZB 5LMUQ 4O0AA 1A8VA 1UWVA 1LM0A 5IT9c 1TXYA 2EQSA 2V1CC 4IPHA 3BJUA 2K52A 2R93G 2PI2E 2E5LL 2JJQA 4R4OA 5JJLA 1TWHH 1G6PA 2YTYA 1K9MC 3KF6B 4IPGA 4DV4Q 4BBSG 2NZOA 4DR6Q 1RL2A 3U58A 1KQSA 2K50A 1XMOQ 4IJLA 5ELNA 3CCMA 4AYBE 1Z47A 4PZ6A 4GNXB 3M4QA 1N34L 2JEBI 4JG2A 4YWLA 4A3IH 2VZAA 5LMNW 4UY8C 2D0OA 4BY1H 1G51A 1SROA 1Q7YC 5FLXc 2UXBQ 3CPWA 4GKKL 3JAMc 5FJ8H 4JI0Q 5C0XJ 4LUZA 5C3EH 2E2IH 4IFDI 5M5WH 5GAEC 4JV5L 1VQEA 1YHQA 3TS2A 1I3QH 1EQQA 3L2PA 4QQBX 4B3RL 2KHJA 4JBWA 2B63G 5IP9H 4JOIA 4KLKA 4QGUA 4JI2L 1XPUA 1E22A 3W1BA 2PQAA 1L1OC 4IJHA 4XTCS 1VQPA 1TWGH 5IYCH 2IHEA 2PMZE 1MJEA 4IPDA 1HNWQ 4A3EH 2UUCL 1HR0L 1KHIA 1B7YB 1IZ6A 3PV0A 5FLMG 4POGA 1XNQL 4POFA 1NY4A 3I4OA 1UE1A 3KFUA 1VQ4A 3A0JA 3J81c 3TS0A 1VQMA 1D8LA 2RF4A 4LW1A 2KCMA 2R7ZH 1FGUA 1N34Q 1W2BA 2BH8A 2HHHL 2YTXA 1GM5A 1PH3A 3PO2G 3HKZG 3TREA 4HIMA 2JA7H 4L5QA 4A3LH 2R7FA 3ULJA 1JJ2A 4BBRH 1BBWA 4JI1L 1VCIA 3RZDH 1E7ZA 5AJ3L 1K8AC 4DR4Q 1K73C 3KDFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W1G A;  2JA5 H;  4DV5 L;  1VQB A;  3K7U C;  4P71 A;  4RG1 A;  1FVI A;  4B3R Q;  4JI2 Q;  1R9T H;  1PH9 A;  1IBK L;  3CCQ A;  3CF5 A;  5LMN L;  3PF4 A;  3G4S A;  4IFD G;  3F2C A;  4LF7 L;  1B70 B;  3G48 A;  3T1H L;  1VQD A;  1U5K A;  1HR0 Q;  2UUC Q;  3PO3 H;  4A3C G;  2PI2 A;  2LSS A;  1XNQ Q;  3AEV A;  4YCU A;  5C4X H;  1Y1W G;  1PH1 A;  2L15 A;  1P16 A;  2KHI A;  2OWO A;  4UP8 A;  1KC8 C;  2N3S A;  3CQZ H;  3GTP H;  1X56 A;  5DLQ E;  1PV4 A;  2WFW A;  4O2D A;  2GVB A;  2JA8 G;  4GN5 A;  1LYL A;  1SRU A;  1V9P A;  4A3D G;  4OO1 I;  3CCE A;  4IFD J;  4QL5 A;  2ZTE A;  3I7F A;  1QZG A;  1PVO A;  4OON A;  4C3I H;  3L7Z C;  4DNI A;  2VL6 A;  3G6E A;  2VUM H;  3HKZ E;  5IYD G;  2CWA A;  4JCV E;  3OW2 A;  1WYD A;  4DV5 Q;  2VQE L;  3EIV A;  1EUJ A;  3UDX A;  3PIP A;  2NVX H;  2EXD A;  5C0X I;  5M3F H;  3J7Z C;  1J5E Q;  5C44 G;  1IBK Q;  4A3J G;  1GD7 A;  5LMN Q;  4A3K G;  1Z9F A;  4YWM A;  4RMF A;  2UUA L;  4LF5 L;  3M4O H;  3S2D H;  2UXC Q;  4DR3 Q;  5GAD C;  2ZJP A;  3BU2 A;  3AFP A;  2Q2H A;  1YIJ A;  2E2H H;  1Y1V H;  4QIW E;  1PH2 A;  2CWP A;  2MNA A;  1XPR A;  1VQI A;  2E2J H;  1PH7 A;  4GOP A;  3W5O A;  2JQO A;  4AQY Q;  1YI2 A;  2ZTC A;  3FKI H;  3S1Q H;  1ASY A;  2RHS B;  1EFW A;  2Q2I A;  3GDE A;  3L0O A;  3S1R H;  3HOV G;  4DAY B;  4GS3 A;  1TWC H;  4UP9 A;  3CCR A;  4DR5 L;  1WJJ A;  5M5X H;  1C0A A;  3BZK A;  1KRT A;  3RLN A;  3S17 H;  3K80 C;  5HGQ A;  1NJI C;  1HR0 W;  2UUB L;  2ALY B;  1O7I A;  3HFZ B;  2IX1 A;  2NZH A;  1GKH A;  3HOX G;  4PMW A;  2WAQ E;  4DAM A;  1SN8 A;  3CAM A;  1AH9 A;  2K14 A;  4A3F G;  3STB D;  4LNQ A;  4OO1 G;  1CUK A;  5E7N A;  1G29 1;  3UDF A;  3HOU H;  1JJG A;  2UUA Q;  1Y14 B;  3SGI A;  4LF5 Q;  3IRB A;  3J81 i;  3K81 C;  1VQ6 A;  1X3F A;  4DV2 L;  4GNX C;  2KCT A;  1HNW L;  5C0X G;  3D31 A;  1FJG L;  3HOZ H;  1I94 Q;  4GLA C;  2OCE A;  4A3I G;  3MEF A;  1PHJ A;  4BA2 I;  2F3I A;  4BY1 G;  1WOC A;  1VQA A;  2XTI A;  1CKO A;  4NPS A;  4NXN L;  4B3T Q;  3KOJ A;  5K36 G;  3CC2 A;  1L1O A;  4HJ7 A;  4DR5 Q;  1XJV A;  5FJ8 G;  1K8G A;  1IBM Q;  1WFQ A;  4LFB Q;  5C3E G;  2AWN A;  2Q2U A;  2UUB Q;  3ULL A;  1OXU A;  2WB1 G;  4JBK A;  3U4V A;  1YZ6 A;  3NBH B;  3PUX A;  5IP9 G;  4GN4 B;  1IBL L;  4DR4 L;  4QJF A;  2LXK A;  1IXR A;  2ZTD A;  3DLL A;  3T1Y Q;  4JI5 Q;  2K5H A;  4YY3 L;  5IYC G;  4R1J A;  1EWI A;  3OTO Q;  5JEA J;  2VNU D;  4A3E G;  2MO0 A;  2ATW A;  3S15 H;  4A93 H;  2IT1 A;  5IYB H;  1VQJ A;  4YHH L;  3M3Y H;  2CQO A;  1XTD A;  4JC0 A;  2B3G A;  3U50 C;  4DV2 Q;  1E1O A;  1PH8 A;  2IY5 B;  1HZ9 A;  3TQY A;  2OQK A;  1CSP A;  2Z6K C;  2QA4 A;  4JI3 Q;  1FJG Q;  3HOY H;  2IHF A;  3H15 A;  2R7Z G;  4P75 A;  2NVT H;  4JI7 L;  5BR8 Q;  1VQH A;  1CKN B;  3PUW A;  5J3B A;  4NXN Q;  4LFA L;  2JA7 G;  4A3L G;  4BBR G;  1UE7 A;  1EYG A;  3S24 A;  3ULP A;  1VQ8 A;  4B3M Q;  3I55 A;  3GTJ H;  2JA5 G;  1VQN A;  2R92 H;  3I4N H;  3JC6 6;  3RR5 A;  4DV7 L;  4OWT B;  4TQU S;  2ZJQ A;  1IBL Q;  3K8A A;  1QVC A;  1OXV A;  2CCZ A;  4YY3 Q;  5ELO A;  4MTN A;  3F2D A;  1YIT A;  1J5E L;  1Q86 C;  4DV1 L;  4P73 A;  4GLV B;  3PO3 G;  4YHH Q;  5IWA L;  1EQR A;  1KXL A;  1KL9 A;  1I6H H;  1NE3 A;  3RNU A;  1N8R C;  1XMQ L;  3GTK H;  3GTQ H;  2UXC L;  5C4X G;  2IX0 A;  4DR3 L;  1QUQ A;  4YWK A;  3STB C;  1OTC A;  1JE5 A;  2QGQ A;  2DUD A;  3BZC A;  4JOI C;  4DK3 C;  4A4I A;  4OWW B;  5C4J H;  3RLO A;  4X65 Q;  4JI7 Q;  4EX5 A;  1CKM A;  2JK8 A;  3VDY A;  2I0Q A;  2Y0S G;  4AQY L;  1N33 L;  1YHB A;  2HT1 A;  2NN6 I;  4LFA Q;  4YCW A;  2MQH A;  1PH6 A;  3RN5 A;  1BBU A;  2K5N A;  1KAW A;  4ALP A;  2YV5 A;  2AHO B;  3M4P A;  2VUM G;  3KJP A;  4HID A;  2KBN A;  2PQA B;  2MFI A;  3GTM H;  2VQF L;  2VW9 A;  1M90 C;  1E24 A;  5IP7 H;  4DV7 Q;  3MXN B;  1N9W A;  5M3F G;  4PZ7 A;  2D62 A;  3CC4 A;  4JI6 L;  4BXX H;  3A74 A;  4GLX A;  4HIK A;  3RN2 A;  2ASB A;  4IOA A;  4X64 L;  4X6A H;  3H3V H;  1PFS A;  4R4T A;  1JB7 A;  2PNH A;  3A5U A;  3CMA A;  3F2B A;  4DV1 Q;  1Y1V G;  5IWA Q;  4DR2 L;  4HJ5 A;  3M7N A;  3PUZ A;  3ER0 A;  4A3C H;  3E9I A;  1XMQ Q;  2HIV A;  4AIM A;  4A3B H;  3GTO H;  1VQC A;  3FKI G;  2N78 A;  1X6O A;  4DV3 L;  1VS0 A;  1BVS A;  1CSQ A;  2R6G A;  3D0F A;  3J81 j;  4BY7 H;  1I94 L;  4L5T A;  3KLW A;  3H0G H;  1N33 Q;  5JJK A;  2D0P A;  1SLJ A;  5EAY A;  3CCV A;  4APV A;  4LF8 L;  2FXQ A;  2E8G A;  2BA1 A;  3KF6 A;  4P74 A;  4B3T L;  4MZ9 A;  4FDB A;  2Y0S E;  1OXS C;  3PGZ A;  1JJC B;  4A3G H;  1HNX L;  1IBM L;  4LFB L;  4GNX A;  2VQF Q;  1QVG A;  1NMF A;  3RLF A;  4OX9 L;  2NN6 G;  4A3M H;  3RZO H;  1VQO A;  4JI6 Q;  4L5R C;  3I56 A;  3S16 H;  4LFC Q;  3HOU G;  4GN3 B;  4X64 Q;  4WJ4 A;  2ZJR A;  1YJW A;  1YNX A;  4R4C A;  2EIF A;  2N8N A;  4JI5 L;  3J80 i;  3CCS A;  3T1Y L;  4NXM Q;  3HOW H;  4R4Q A;  3J7A 5;  2I5H A;  1S3O A;  4DR2 Q;  3FHW A;  3I4M H;  2JA6 H;  3OTO L;  4X62 L;  4UP7 A;  1UEB A;  1YJ9 A;  1PYS B;  1V43 A;  3HOZ G;  2K4K A;  3E0E A;  1V1Q A;  4KI0 A;  1EIY B;  4DV3 Q;  3E9H A;  2I5L X;  2AMC B;  2AKW B;  4JI3 L;  2AWO A;  1VQ7 A;  4LF8 Q;  5IY0 A;  1PYB A;  1NMG A;  4LWC A;  4LUO A;  5BR8 L;  3WWV A;  4HJ8 A;  2A8V A;  3S2H H;  5JEA G;  1WCM H;  2R7D A;  2ES2 A;  2F52 A;  3TRZ A;  2A19 A;  2WP8 J;  1K3R A;  2YYZ A;  1HNX Q;  2KEN A;  2JEA I;  4GKJ L;  4K0K L;  2DGY A;  5M3M H;  2CFM A;  1A63 A;  4Y7N H;  2Z6K A;  4B3M L;  4OX9 Q;  4A3F H;  4EQ5 A;  5H1S E;  1QZH A;  1JT8 A;  3TEH B;  1TWA H;  3CCL A;  5GAH C;  4GOP B;  1MJC A;  3M9B A;  1L2F A;  4A93 G;  4A75 A;  5IYB G;  4KHP Q;  1N36 Q;  3UDG A;  1IYJ B;  4OXP A;  5IE8 A;  3S1M H;  3KDF A;  1OXT A;  4A76 A;  4X62 Q;  2R93 H;  4B3S Q;  4JI4 L;  3HOY G;  1M1K C;  1GO3 E;  2UXD L;  1X9N A;  1X65 A;  3GD7 A;  1XNR Q;  1E3P A;  2K5V A;  3J80 c;  1EIF A;  4BBS H;  1N32 L;  2VS1 A;  1HJP A;  3AYH B;  3CW2 C;  1GVP A;  3PCO B;  3A5Z B;  4HJA A;  4X65 L;  1TWF H;  4DR7 L;  4KHP L;  1BKB A;  4QY7 A;  3H3V I;  3AQQ A;  1UE6 A;  3EN2 A;  5GQO A;  1PA6 A;  1VQK A;  1Q12 A;  2YTV A;  4DKA C;  3KJO A;  4GKJ Q;  1J6Q A;  3UE0 A;  2F4V Q;  1YJN A;  4DUZ L;  1ASZ A;  1HNZ Q;  1XPO A;  2R92 G;  3I4N G;  4K0K Q;  2JA9 A;  4LF4 Q;  2BH2 A;  4WJ3 M;  4C2M H;  4IO9 A;  2I5M X;  1Q82 C;  3KYH C;  2Z0S A;  1PH4 A;  4JI8 L;  2BA0 A;  3CCU A;  4YCV A;  3Q8D A;  1PH5 A;  2UU9 L;  2OQ0 A;  3GTG H;  3CCJ A;  1X55 A;  2B63 H;  2E5L Q;  1D7Q A;  1C7Y A;  2WB1 E;  1RIP A;  4NB3 A;  2A1A A;  3HKS A;  3OYY A;  3F8T A;  4TVA B;  1UE5 A;  4JBJ A;  1L1O B;  4JI4 Q;  1K83 H;  3NEL A;  5FLM H;  1FL0 A;  3B6Y A;  3K0X A;  1B8A A;  5M5Y H;  4HJ9 A;  2UXD Q;  1HZB A;  2HIX A;  1N32 Q;  4XIG S;  1HZC A;  1NTG A;  1X54 A;  3ICE A;  2HQL A;  1W3S A;  4DR7 Q;  2NVY H;  4GKK Q;  4J15 A;  1VQ9 A;  2ZM6 L;  4KHZ A;  3GO5 A;  1AE2 A;  4C3H H;  3PO2 H;  4JV5 Q;  4LF9 L;  2GVA A;  2N49 A;  4IOC A;  5IP7 G;  1SMX A;  1X3E A;  4DUZ Q;  1T9H A;  2XGT A;  1MIU A;  3G71 A;  4C3J H;  1WI5 A;  4BXX G;  4L5S A;  3CME A;  1S40 A;  1JMC A;  4DR1 L;  3DM3 A;  1QVF A;  4JI8 Q;  3PIO A;  1HZA A;  1X3G A;  4DUY L;  3M85 A;  2UU9 Q;  2NVQ H;  1E1T A;  4LFC L;  1NBW A;  1MKH A;  4MNO A;  2OTL A;  1YHA A;  4OWX B;  3ZJY C;  1U0L A;  4A3B G;  4NXM L;  2K75 A;  3S14 H;  2ID0 A;  3UDI A;  2GN5 A;  4DV0 L;  3CC7 A;  1AE3 A;  1KIX A;  4JBM A;  4BY7 G;  1C9O A;  1YBY A;  3NEN A;  2C35 B;  5HY6 A;  4Y52 H;  3I2Z A;  2RCN A;  4X66 L;  3H0G G;  1Y1W H;  2HHH Q;  1Q1B A;  4PZ8 A;  1LTL A;  4ME3 A;  4P72 A;  4JYA L;  1HH2 P;  1VQ5 A;  3S1N H;  2WAQ G;  3U4Z A;  4DV6 L;  4UPA A;  4JI1 Q;  2RHQ B;  2ZM6 Q;  1EOV A;  4LF6 L;  2JA8 H;  4A3G G;  4DK6 C;  5AJ3 Q;  4A3D H;  3NEM A;  3F1Z A;  4HIO A;  4LF9 Q;  2Q2T A;  4BA1 I;  3CP0 A;  1Q8K A;  4A3M G;  1Q46 A;  1VQG A;  3EBE A;  1Q1E A;  2H5X A;  3K7A H;  1SR3 A;  5IYD H;  1QUQ B;  1I50 H;  4DR1 Q;  1IL2 A;  2QEX A;  5GAG C;  1KD1 C;  4DUY Q;  1P8L A;  5LMU L;  4LF7 Q;  3HOW G;  5JJI A;  2VY3 A;  4LUV A;  4IPC A;  3T1H Q;  5C44 H;  3I4M G;  2JA6 G;  3UE1 A;  4A3J H;  2JE6 I;  3KF8 B;  4A3K H;  2LXJ A;  4PG3 A;  1N36 L;  1VQL A;  3GTL H;  4DV0 Q;  2B29 A;  4AYB G;  3PF5 A;  3ERS X;  3PSI A;  4B3S L;  4DV4 L;  4DR6 L;  3JAM i;  1L0W A;  1DGS A;  3LGJ A;  4X66 Q;  1XMO L;  4DPG A;  3CPF A;  1YEZ A;  1S72 A;  4JYA Q;  1XNR L;  4H02 A;  1H95 A;  1A62 A;  4R4I A;  1WCM G;  4DV6 Q;  1Q81 C;  2OTJ A;  3HOV H;  2UXB L;  1SFO H;  4LF6 Q;  1VQF A;  4AH6 A;  3PUY A;  3CXC A;  1YVC A;  5M3M G;  4JI0 L;  1SE8 A;  2VQE Q;  3FP9 A;  4GOP C;  3CD6 A;  1KRS A;  1I5F A;  1LUZ A;  2MO1 A;  2F4V L;  2YU9 H;  1CKN A;  1K0R A;  5GRO A;  1HNZ L;  3HOX H;  3AFQ A;  4LF4 L;  1OXX K;  1A0I A;  3PUV A;  2CKZ B;  5LMU Q;  4O0A A;  1A8V A;  1UWV A;  1LM0 A;  5IT9 c;  1TXY A;  2EQS A;  2V1C C;  4IPH A;  3BJU A;  2K52 A;  2R93 G;  2PI2 E;  2E5L L;  2JJQ A;  4R4O A;  5JJL A;  1TWH H;  1G6P A;  2YTY A;  1K9M C;  3KF6 B;  4IPG A;  4DV4 Q;  4BBS G;  2NZO A;  4DR6 Q;  1RL2 A;  3U58 A;  1KQS A;  2K50 A;  1XMO Q;  4IJL A;  5ELN A;  3CCM A;  4AYB E;  1Z47 A;  4PZ6 A;  4GNX B;  3M4Q A;  1N34 L;  2JEB I;  4JG2 A;  4YWL A;  4A3I H;  2VZA A;  5LMN W;  4UY8 C;  2D0O A;  4BY1 H;  1G51 A;  1SRO A;  1Q7Y C;  5FLX c;  2UXB Q;  3CPW A;  4GKK L;  3JAM c;  5FJ8 H;  4JI0 Q;  5C0X J;  4LUZ A;  5C3E H;  2E2I H;  4IFD I;  5M5W H;  5GAE C;  4JV5 L;  1VQE A;  1YHQ A;  3TS2 A;  1I3Q H;  1EQQ A;  3L2P A;  4QQB X;  4B3R L;  2KHJ A;  4JBW A;  2B63 G;  5IP9 H;  4JOI A;  4KLK A;  4QGU A;  4JI2 L;  1XPU A;  1E22 A;  3W1B A;  2PQA A;  1L1O C;  4IJH A;  4XTC S;  1VQP A;  1TWG H;  5IYC H;  2IHE A;  2PMZ E;  1MJE A;  4IPD A;  1HNW Q;  4A3E H;  2UUC L;  1HR0 L;  1KHI A;  1B7Y B;  1IZ6 A;  3PV0 A;  5FLM G;  4POG A;  1XNQ L;  4POF A;  1NY4 A;  3I4O A;  1UE1 A;  3KFU A;  1VQ4 A;  3A0J A;  3J81 c;  3TS0 A;  1VQM A;  1D8L A;  2RF4 A;  4LW1 A;  2KCM A;  2R7Z H;  1FGU A;  1N34 Q;  1W2B A;  2BH8 A;  2HHH L;  2YTX A;  1GM5 A;  1PH3 A;  3PO2 G;  3HKZ G;  3TRE A;  4HIM A;  2JA7 H;  4L5Q A;  4A3L H;  2R7F A;  3ULJ A;  1JJ2 A;  4BBR H;  1BBW A;  4JI1 L;  1VCI A;  3RZD H;  1E7Z A;  5AJ3 L;  1K8A C;  4DR4 Q;  1K73 C;  3KDF B; 
#chains in the Genus database with same CATH topology
 1SDF A;  3HEJ A;  4RG1 A;  3BG3 A;  1FVI A;  1V1P B;  1G91 A;  4HSP A;  1PH9 A;  1IBK L;  1A6X A;  3A8K E;  3F2C A;  3G48 A;  3K5M A;  2UUC Q;  4FYD A;  1VMC A;  4E6I A;  3AEV A;  1UAP A;  4IUR A;  1NR2 A;  1Y1W G;  4O1N A;  1KDB A;  1P16 A;  1HXY D;  2F0M A;  1U4P A;  1PV4 A;  3WDN A;  4C3I B;  1LYL A;  2JA8 B;  1F9R A;  3CCE A;  2RA4 A;  1MGS A;  2ZTE A;  5D3I B;  1HQM C;  4C3I H;  4DNI A;  4RH6 A;  2B8G A;  3X3N A;  5M3F B;  1WYD A;  4DV5 Q;  2M9V A;  3EIV A;  1EUJ A;  5M3F H;  2XWB B;  1MHW C;  3C1E A;  2JSO A;  3DWQ A;  3M4O H;  2E2J B;  3A7L A;  3BU2 A;  4ULL A;  1RHP A;  2MJ8 A;  3S1Q B;  2E2J H;  1ENF A;  3KLS X;  1SJH D;  3R2T A;  1TWC B;  3S1Q H;  5M5X B;  1ASY A;  3HOV B;  4GS3 A;  1TWC H;  1S5D D;  1G2T A;  5M5X H;  1C0A A;  4J6H A;  3K80 C;  5IT9 L;  2IX1 A;  5EKI A;  4PMW A;  1DOL A;  1SN8 A;  2VB2 X;  2K14 A;  2WV6 D;  1CUK A;  4OO1 G;  1G29 1;  3EFX D;  4DA2 A;  4LF5 Q;  3IRB A;  3J81 i;  3KLR A;  4DV2 L;  1B9N A;  2KCT A;  4WRD A;  3HOZ H;  5FLX L;  4ZLT F;  3BVZ A;  4K6L A;  3MEF A;  2Z4H A;  5DAU A;  4BY1 B;  5FO8 B;  4B3T Q;  5K36 G;  1L1O A;  4H13 C;  5FJ8 G;  3MVV A;  2MGS A;  1JIC A;  2PMZ B;  3ULL A;  1DXM A;  2WB1 B;  1XYI A;  1YZ6 A;  3NBH B;  3PUX A;  3S15 B;  2LXK A;  1IXR A;  3DLL A;  5CR3 A;  4CKC A;  1BCP C;  2KEC A;  3FDT A;  4YY3 L;  1PRT B;  5IYC G;  5JEA J;  5KNC A;  3S15 H;  3VYR A;  4CHT B;  1XTD A;  4JC0 A;  2IY5 B;  2E74 C;  3DHQ A;  3TQY A;  1SYF A;  3H15 A;  1HUN A;  4JI7 L;  2O2L D;  1VQH A;  5J3B A;  1TS3 A;  4BBR G;  1X3P A;  1AW7 A;  2DN8 A;  1JWM D;  3S24 A;  1DD2 A;  1ILP A;  2EY1 A;  3R93 A;  1VQ8 A;  3GTJ H;  1LO5 D;  1LT5 D;  1VQN A;  1WTW A;  4TQU S;  2EDG A;  3T53 B;  1EY4 A;  4N8X 1;  1OXV A;  1X3Q A;  5C4Z A;  5I4D A;  2DJF C;  3F2D A;  4QUC A;  1YIT A;  2HDM A;  5FOB B;  4DV1 L;  3IL8 A;  1KL9 A;  1NE3 A;  4KJN A;  3RNU A;  3GTK H;  1EU3 A;  4RFB A;  2DUD A;  1HFN A;  4A4I A;  1WTQ A;  2LFN A;  2Y0S G;  2NN6 I;  2L0C A;  4YCW A;  4ID6 A;  1BBU A;  2K5N A;  2V4D A;  1M8A A;  2YV5 A;  2B2U C;  2VUM G;  3KJP A;  1PTO D;  2VQF L;  3K5N A;  1E24 A;  5IP7 H;  3TDQ A;  4IUQ A;  4JI6 L;  4BXX H;  2PW5 A;  3A74 A;  1LT6 D;  4K5X A;  2H1E A;  1LLR D;  4X6A H;  5FKA C;  3H3V H;  4R4T A;  5KGU A;  3F2B A;  3BVG A;  1RJT A;  5IWA Q;  4DR2 L;  1IYV A;  4DGZ A;  3E9I A;  1XMQ Q;  1KLG D;  3FKI G;  1PDQ A;  4DV3 L;  1L0Y B;  4K2L A;  3J81 j;  5HUR A;  3OOC A;  4C56 C;  3NHH A;  2WAQ B;  1A2T A;  2D0P A;  4A3G B;  2QF7 A;  2A68 D;  4B3T L;  4FDB A;  3PGZ A;  4A3G H;  3ND9 A;  2G5D A;  1PTO F;  2A6E D;  4HCE A;  1VQO A;  4L5R C;  3I56 A;  3HOW B;  1H9S A;  5DM6 3;  2JA6 B;  3RMH A;  1YNX A;  4RAU C;  2EIF A;  4NXM Q;  3CHB D;  4OIK A;  3HOW H;  4R4Q A;  1CA6 A;  1PLF A;  1LAB A;  2XSC A;  3FHW A;  3MA2 B;  4AYB B;  2JA6 H;  4UP7 A;  2TSS A;  2F0S A;  1YJ9 A;  1SEB D;  2K4K A;  1PZK D;  1V1Q A;  1FD7 D;  1L0X B;  2I5L X;  2AMC B;  1JCK B;  1NMG A;  4LUO A;  2QIL A;  2ES2 A;  1I4X A;  2YYZ A;  2JEA I;  2K5Q A;  1EEI D;  4ZQ3 A;  3PMF A;  3UI2 A;  1PFN A;  3M9B A;  4F88 A;  1STE A;  4A75 A;  1IYJ B;  4BWG B;  3NK9 A;  3K58 A;  1PTO C;  3C46 A;  3HOY G;  1OO9 B;  1E3P A;  1C8C A;  2VS1 A;  1HJP A;  2K03 A;  3A5Z B;  5JPM C;  4KV6 A;  1BKB A;  5CBE E;  2D2C C;  1JWU D;  3VR2 A;  2YTV A;  1STH A;  4GKJ Q;  1RDP D;  3VYS A;  2R92 G;  1XPO A;  2JA9 A;  4WJ3 M;  1D1I A;  4HMI A;  2B63 B;  4PMC A;  2IW3 A;  2Z0S A;  4JI8 L;  2BA0 A;  1FNW A;  1RD9 D;  3CCU A;  1KAA A;  3T16 A;  3GTG H;  1X55 A;  2B63 H;  5C5M A;  1C7Y A;  1I6H B;  2KA7 A;  2A6H C;  3HKS A;  2A6E C;  3I8Z A;  4JBJ A;  4JI4 Q;  3OPO A;  1K83 H;  2PO4 A;  3K6O A;  3K0X A;  1B8A A;  1EY6 A;  1MBY A;  2UXD Q;  1Q8I A;  4KY7 A;  1NR4 A;  3HKZ B;  1KDC A;  2NVY H;  4CJ1 B;  3TP5 A;  1FR3 A;  4J15 A;  2ZM6 L;  1Q3L A;  1PZI D;  3LNN A;  1AE2 A;  4I7A A;  4JV5 Q;  1TT2 A;  1SMX A;  1T9H A;  1K8O A;  5ELB A;  3DM3 A;  3PIO A;  2QDB A;  3M85 A;  3S14 B;  1E1T A;  4L6T B;  1QE6 A;  4OWX B;  3MFG A;  4NXM L;  4A3B B;  3S14 H;  3VR4 A;  1Y1W B;  3BYY B;  4BY7 B;  2ZXP A;  2F0O A;  1Y1W H;  3H0G G;  2HHH Q;  2CVR A;  4ZUI A;  3AMU A;  5D65 A;  2MUY A;  2QW7 A;  2Q8I B;  4DV6 L;  2RHQ B;  3EA6 A;  5AJ3 Q;  1DYQ A;  3SR1 A;  3PIP 3;  3NEM A;  3F1Z A;  1BDO A;  5T1I A;  4LF9 Q;  2NBF A;  5BN3 A;  5JJZ A;  1QUQ B;  4DR1 Q;  2K33 A;  1KD1 C;  4LF7 Q;  1SJE D;  4IPC A;  5CV6 A;  5L37 A;  2B29 A;  5TSS A;  4DAP A;  1DOM A;  4DU9 A;  4DR6 L;  1K0S A;  3JAM i;  5EPK A;  3TSS A;  1L0W A;  1DGS A;  3LGJ A;  4DPG A;  4K5W A;  1O7Y A;  3ONA B;  3CPF A;  2F0V A;  5D14 A;  1KAB A;  1DCZ A;  1H95 A;  1Q81 C;  1GUS A;  1Y8P B;  5C3W A;  3M4Y A;  2JYO A;  1CI3 M;  2YU9 B;  3IAY A;  4JI0 L;  3LWE A;  2K1B A;  1SE8 A;  1EY9 A;  4GOP C;  3CD6 A;  1I5F A;  2MO1 A;  3I90 A;  5NUC A;  2YU9 H;  1CKN A;  5GRO A;  1T5E A;  4IN3 A;  3AFQ A;  2F0J A;  1K8M A;  3VYU A;  2F03 A;  4O0A A;  1F9Q A;  4OO1 H;  1TXY A;  2R93 G;  5JOB A;  1G6P A;  1K9M C;  4BS9 A;  4PQX A;  3I73 A;  5E4X A;  4PZ6 A;  1TVX A;  5EQ0 A;  1TWF B;  4JG2 A;  4YWL A;  3F2U A;  1SRO A;  2E2I B;  2UXB Q;  1QB5 D;  4ZUJ A;  5EKL A;  5K36 H;  2C9O A;  3JAM c;  3SVM A;  5FJ8 H;  2E2I H;  1E2W A;  5GAE C;  4JV5 L;  1VQE A;  1YHQ A;  3TS2 A;  3L2P A;  4QQB X;  4B3R L;  4IUT A;  4J1M A;  4JBW A;  4JOI A;  4JI2 L;  2QCP X;  1TWG H;  5IYC H;  1GUT A;  2IHE A;  1HNW Q;  4IPD A;  2J7Z A;  1AEX A;  5IGF A;  1HR0 L;  1IW7 D;  1B7Y B;  2F0L A;  4WOR A;  5FLM G;  4POF A;  5M5Y B;  1NY4 A;  3I4O A;  3A0J A;  1D5Z C;  1D8L A;  4LW1 A;  4YIJ A;  1EY0 A;  4CJ2 C;  2HHH L;  2YTX A;  1ICW A;  4C3H B;  3PO2 B;  2R7F A;  1JJ2 A;  4BBR H;  1BBW A;  2EOT A;  1E7Z A;  3NTK A;  5AJ3 L;  4DR4 Q;  1R9T B;  4R8N A;  1EIH A;  3V2T A;  1ESF A;  3QIA A;  5JAV A;  2NVQ B;  1GHJ A;  4HR7 B;  4RGM A;  4XT1 B;  1R9T H;  4IFD G;  2FIN B;  4LF7 L;  2A74 C;  3H6M A;  1XNQ Q;  2LSS A;  1STN A;  4YCU A;  3GTP B;  5IT9 E;  4QMG A;  2A5H A;  2Y0S B;  4UP8 A;  3GTP H;  1X56 A;  2LKV A;  1SRU A;  2VUM B;  4A3D G;  3E6Z X;  4IFD J;  3I7F A;  2EPB A;  3OMC A;  2VUM H;  3Q23 A;  3N52 A;  5FLX E;  1CHQ D;  1RTN A;  5A2Q L;  2DNC A;  1IBK Q;  2E2H B;  4A3K B;  3S2D H;  2UXC Q;  4DR3 Q;  5GAD C;  1JC7 A;  3L9A X;  5ELE A;  3AFP A;  2Z8L A;  2E2H H;  4LJZ C;  1PH2 A;  2CWP A;  3FKI B;  1VQI A;  3TP7 A;  4CKB A;  2JQO A;  4AQY Q;  2ZTC A;  3FKI H;  1RTO A;  2TMP A;  1QIL A;  3S1R H;  3L0O A;  5C5L A;  2KCC A;  4DAY B;  3S17 B;  2L12 A;  1IW7 C;  3A7A B;  4UP9 A;  4DR5 L;  1WJJ A;  3RLN A;  3SK5 A;  3S17 H;  4K14 A;  4QF4 A;  1NJI C;  2UUB L;  4KN4 C;  2NZH A;  3HOX B;  3CAM A;  1AH9 A;  1VF7 A;  3STB D;  2SEB D;  2FMM A;  1Y14 B;  1CQF A;  1TWH B;  1X3F A;  1HNW L;  1D1K A;  3QJY A;  3D31 A;  1I94 Q;  4DK0 A;  1EZ8 A;  1PHJ A;  4K5V A;  3TME A;  1MD2 D;  4OEL B;  3KOJ A;  3CC2 A;  3BDL A;  4K2K A;  1K8G A;  1IBM Q;  4LFB Q;  5C3E G;  2AWN A;  2FFK B;  1STB A;  2LY7 A;  5KRU A;  4FP5 D;  1OXU A;  4MIU A;  3U4V A;  3KLS A;  4DR4 L;  4QJF A;  4JI5 Q;  2K5H A;  4X3U A;  1EWI A;  1EWH A;  3OTO Q;  2VNU D;  4QUF A;  1U9R A;  4TSS A;  3J81 L;  2K5W A;  2CQO A;  2XN9 C;  4DV2 Q;  1PH8 A;  1A3T A;  1HZ9 A;  2IPK D;  1PTO B;  1CSP A;  2OQK A;  4KKS A;  3HOY H;  5J1Z A;  2IHF A;  3D4D A;  4P75 A;  2KHS A;  2NVT H;  1PTO H;  4UAI A;  2B2Y A;  1BF4 A;  3CKI B;  1SYD A;  3PUW A;  4U67 3;  4LFA L;  4A3L G;  3J7Y W;  2Q8R E;  5FK9 C;  3ULP A;  3T4A C;  2CH4 A;  2JA5 G;  2R92 H;  2O4X A;  4DV7 L;  4OWT B;  1G8Z D;  2ZJQ A;  4XYQ A;  4YY3 Q;  5CV7 A;  2AUK A;  4P73 A;  5EPL A;  3IFT A;  1O7L A;  2IX0 A;  3X3M A;  4DR3 L;  2UXC L;  5C4X G;  2A69 D;  1WTO A;  3STB C;  1OTC A;  1IKM A;  1JE5 A;  2QGQ A;  4JOI C;  5IGC A;  4OWW B;  2AUJ D;  2E76 C;  4JI7 Q;  1CKM A;  2JK8 A;  3VDY A;  2I0Q A;  4AQY L;  1N33 L;  2BDO A;  3GTM B;  4V19 0;  1EEF D;  1KAW A;  2PZW A;  3GTM H;  3SXH A;  1BCP D;  3QOL A;  4FF1 A;  1HHV A;  4RWS C;  1TS2 A;  1M90 C;  3MXN B;  3QOJ A;  4X3K A;  3RN2 A;  4IOA A;  5CYU A;  3M4O B;  1JB7 A;  4DV1 Q;  5CV5 A;  3N6R A;  1Y1V G;  3PUZ A;  4X3S A;  4AIM A;  3DMU A;  3H09 A;  1VQC A;  3H0G B;  1CZG A;  1X6O A;  1CSQ A;  3MFY A;  3M7G A;  1I94 L;  3H0G H;  4MN3 A;  5EAY A;  3CCV A;  1F77 A;  3BS1 A;  3KF6 A;  2XRQ D;  4MZ9 A;  2F0Q A;  4ILW A;  1HNX L;  1IBM L;  1BCP F;  4LFB L;  4GNX A;  2VQF Q;  2CH4 W;  3RLF A;  4OX9 L;  2NN6 G;  4KJO A;  4JI6 Q;  3S16 H;  3MXP A;  4IQZ A;  4GN3 B;  4RCO A;  2IX3 A;  5JJK A;  4JI5 L;  4UHV A;  4DR2 Q;  5KEE A;  3OTO L;  2AQ3 B;  2B2T A;  1UEB A;  1PYS B;  4KTA A;  3HOZ B;  3E0E A;  4DV3 Q;  3E9H A;  5DM7 3;  2EY6 A;  2RDG A;  2AWO A;  1O80 A;  4Q0F A;  3T56 B;  4HED A;  5CGK A;  4CJ0 B;  5KND A;  2A8V A;  3WWV A;  3DWA A;  1EL0 A;  5JEA G;  1LAC A;  2F52 A;  2A69 C;  2KEN A;  2DGY A;  2G9H D;  2Z6K A;  4A3F H;  4EQ5 A;  3R2I A;  1WVL A;  3TEH B;  2HDL A;  5GAH C;  4GOP B;  1XTC D;  2R93 B;  1N36 Q;  3UDG A;  4WJW A;  3D4W A;  4A76 A;  3FMC A;  2R93 H;  4B3S Q;  1S5F D;  2O5I C;  1V1P A;  1GO3 E;  1SNM A;  1R4Q B;  1I6V C;  1X9N A;  4EQP A;  2SNS A;  3GD7 A;  1N32 L;  1ZYR D;  3V96 A;  1JOK A;  4XQQ A;  4DR7 L;  4IUU A;  2EE1 A;  1PA6 A;  4N9P A;  1VQK A;  1Q12 A;  1B3Q A;  4DKA C;  2FHT A;  5ISR A;  1WTX A;  3GTJ B;  2HCC A;  4DUZ L;  3TN2 A;  2PPB C;  3BDC A;  3E5S A;  1Q82 C;  1PH4 A;  1SND A;  2UU9 L;  2OQ0 A;  1HA6 A;  4KD3 A;  2E5L Q;  1D7Q A;  2WB1 E;  1F2M A;  3GTK B;  3F8T A;  2D9U A;  4TVA B;  4CDE C;  4OHJ A;  2PZT A;  5FLM H;  3B6Y A;  4G4K A;  5CMD A;  4HJ9 A;  4IUV A;  2HIX A;  4XIG S;  3U9O A;  3HZX A;  3NXW A;  1JWS D;  1VQ9 A;  1WTR A;  4FXG C;  3GO5 A;  5COR A;  2F0I A;  3FRP B;  1TS5 A;  2GVA A;  2RBM A;  4IOC A;  4EGV A;  1JOR A;  4L5S A;  3CME A;  1GUG A;  1S40 A;  1QVF A;  4JI8 Q;  4QIW B;  1HZA A;  2DY8 A;  4DUY L;  1YNJ C;  1LTI D;  3RD4 A;  1MKH A;  2OTL A;  1QNU A;  5EJW A;  4IFD H;  4RKB A;  2GN5 A;  3CC7 A;  2FMC A;  2L5T A;  1NCV A;  5HY6 A;  3R8B A;  5IGG A;  5IOD A;  3SEB A;  4PZ8 A;  4KN7 C;  1HCZ A;  2OXP A;  4P72 A;  4JI1 Q;  2ZM6 Q;  4LF6 L;  2K28 A;  4DK6 C;  1FNV A;  2N55 A;  4A3D H;  4RGT A;  1F9P A;  3DXJ C;  4G7O C;  2Q2T A;  3CP0 A;  1Q8K A;  4A3M G;  1Q46 A;  3EBE A;  1ZYR C;  4CDF C;  2A6H D;  1D2B A;  2QEX A;  4LUV A;  3T1H Q;  3I4M G;  3UE1 A;  4B08 A;  2JE6 I;  3KF8 B;  2ZXR A;  1B50 A;  1N36 L;  4H7B A;  3GTL H;  3NBH A;  3GV3 A;  2F3W A;  4K8J A;  3GP7 A;  3ERS X;  2JP1 A;  4KY6 A;  4B3S L;  1U4L A;  3SK6 A;  1SYB A;  1QCB D;  1KNE A;  1IL8 A;  4R4I A;  1WCM G;  4DV6 Q;  4IAL A;  2ENB A;  2K32 A;  3CXC A;  5FO7 B;  1YVC A;  1GOZ A;  1B53 A;  3FP9 A;  1LUZ A;  3ITP A;  2WIN B;  3DEO A;  1A0I A;  5KYI A;  2E2D C;  1UWV A;  5IT9 c;  1ENC A;  2K52 A;  2E5L L;  3J80 L;  4R4O A;  2YTY A;  2EYO A;  4BBS G;  2BOS A;  4DR6 Q;  1LTB D;  3U58 A;  2K50 A;  4DN4 M;  1JQY D;  3VR5 A;  1Z47 A;  2CW0 C;  2L1B A;  3CRL C;  1E2V A;  4AYB E;  4F87 A;  3CCM A;  1N34 L;  3V05 A;  5CV8 A;  2VZA A;  5LMN W;  1TY2 A;  2D0O A;  2B2T C;  2EJG C;  4DNR B;  5FLX c;  4HTH A;  5M5W B;  4JI0 Q;  5C0X J;  5C3E H;  5M5W H;  1ENA A;  1CTM A;  1EU4 A;  2HD3 A;  1EQQ A;  3GTG B;  4KLK A;  4P2C B;  3W1B A;  3OIQ A;  1L1O C;  4IJH A;  1VQP A;  1SE4 A;  4ZKC B;  1K83 B;  4POG A;  5DNF A;  2HQE A;  1A2U A;  2BCO A;  5A2Q E;  2NVY B;  2BH8 A;  4LK1 C;  1EZ6 A;  1GM5 A;  4LAA A;  4F7X A;  3Q0A A;  1SNO A;  1PH3 A;  4HIM A;  4A3L H;  4L5Q A;  3ULJ A;  3QB3 A;  4JI1 L;  2JA5 B;  3C1F A;  1VCI A;  4C3J G;  1X32 A;  1O78 A;  5BN4 A;  3KDF B;  3W1G A;  2JA5 H;  3BVM A;  4P71 A;  4K6D A;  3OWE B;  4B3R Q;  4JI2 Q;  4PV1 C;  3E0J A;  3CCQ A;  4FO2 A;  2EY5 A;  5LMN L;  3PF4 A;  3EJI A;  3G4S A;  5HGT A;  3T1H L;  1VQD A;  1HR0 Q;  1CQV A;  1UNS A;  1S4Z A;  5C4X H;  1PRT D;  1PH1 A;  5A35 A;  2B2W A;  2OWO A;  1KC8 C;  2N3S A;  3CQZ H;  1FNU A;  2RQX A;  4RHR A;  4I7Z C;  4O2D A;  2JA8 G;  1II3 A;  1TS4 A;  4QL5 A;  2Q8T A;  1QZG A;  1PVO A;  1D6E C;  1F2Y A;  3G6E A;  2EYP A;  2NVX B;  3HKZ E;  5IYD G;  5I6W A;  1XXG A;  4XYO A;  2PCF B;  3OW2 A;  2F0U A;  2EZV A;  2VB3 X;  3UDX A;  2NVX H;  2KOL A;  2EXD A;  5C0X I;  2FJ2 A;  1J5E Q;  3J7Z C;  5C44 G;  4A3J G;  1GD7 A;  1Z9F A;  3NPP A;  4RGN A;  4RMF A;  2UUA L;  2LS0 1;  2B8F A;  2ZJP A;  2Q2H A;  1YIJ A;  1Y1V H;  2NWG A;  4RA8 A;  4IUP A;  4ME5 A;  1XPR A;  1I4G A;  1PH7 A;  3W5O A;  4N9T A;  1YI2 A;  1EYD A;  1EFW A;  4I65 A;  2Q2I A;  1LV9 A;  4ZCK A;  3HOV G;  3WOF A;  1EY8 A;  3CCR A;  2MP1 A;  3J81 E;  3BZK A;  1KRT A;  2NUC A;  1TU2 B;  5HGQ A;  3EVQ A;  1HR0 W;  2ALY B;  1O7I A;  1GKH A;  4S3S A;  1EY5 A;  1PMR A;  4A3F G;  1TY0 A;  4JVZ A;  2NN6 H;  5E7N A;  1HQR D;  1D5X C;  1JJG A;  2BE5 D;  2NYZ D;  3K81 C;  3MXG A;  4KD4 A;  4FF2 A;  3FVQ A;  3ERO A;  1FJG L;  4ZKB B;  1SXT A;  2OCE A;  2L9H A;  4BY1 G;  1B2T A;  2XTI A;  1CKO A;  4NPS A;  4NXN L;  4WFN 3;  4HJ7 A;  4DR5 Q;  1XJV A;  4H44 C;  3DM1 A;  4ZK9 B;  2RDF A;  5JEA H;  2KQ3 A;  1PRT C;  3MZ5 A;  2UUB Q;  2WB1 G;  4JBK A;  1Y8O B;  5COY A;  2F0G A;  3E3X A;  1SSO A;  4GN4 B;  1IBL L;  2RKS A;  5G3L D;  2F0D A;  2ZTD A;  2F3V A;  4R1J A;  3Q6S A;  1TWG B;  2P5Z X;  2MO0 A;  2ATW A;  1AZP A;  1SYG A;  4YHH L;  2WII B;  3M3Y H;  1BCP B;  1GUO A;  4CDD C;  1AZQ A;  4JI3 Q;  2R7Z G;  4O42 A;  2RCF A;  2JA7 G;  3KK7 A;  1LT4 D;  4BBR B;  2F4I A;  3I55 A;  3A54 A;  1ML0 D;  1WTV A;  1B4O A;  1QG7 A;  3L3O C;  3K8A A;  5ELC A;  5G3L F;  2K5D A;  1J5E L;  1Q86 C;  3PO3 G;  4GLV B;  4EVO A;  1SNQ A;  1N8R C;  3H91 A;  3GTQ H;  4KK7 A;  1QUQ A;  3CU7 A;  2C5C A;  3BZC A;  4DK3 C;  3MAQ A;  5EKK A;  3TP6 A;  1H9R A;  2BE5 C;  4EX5 A;  1HTP A;  3BYT B;  3MTS A;  2HT1 A;  3GQB A;  4LFA Q;  4V0B A;  2MQH A;  1PH6 A;  2AHO B;  1C4Q A;  4HID A;  3PIO 3;  2PQA B;  2MFI A;  4C1N K;  2RSO A;  2WKC A;  5D3D A;  5BN5 A;  2VW9 A;  2Z1C A;  4HAE A;  4DV7 Q;  4PZ7 A;  4GLX A;  2ASB A;  4HIK A;  1S5B D;  4X64 L;  1QJO A;  1PFS A;  3S2D B;  3A5U A;  3CMA A;  2EYH A;  4A3C H;  3ER0 A;  3NTH A;  1HA5 A;  2HIV A;  3U9S A;  5DEH A;  3H94 A;  1CHP D;  4KKU A;  4QB4 A;  4FXD A;  2N78 A;  3A8J E;  1BVS A;  2R6G A;  3D0F A;  3S1R B;  4L5T A;  2A73 B;  3K59 A;  3KLW A;  3NE5 B;  1N33 Q;  3Q22 A;  4LF8 L;  1SLJ A;  2RSN A;  2FXQ A;  3P75 A;  2KEE A;  4P74 A;  2K01 A;  4KY5 A;  2Y0S E;  1OXS C;  1JJC B;  4A3M B;  1TKW B;  4KHV A;  5E1F A;  1NMF A;  1STG A;  2F0E A;  4A3M H;  1PFM A;  3RUZ A;  1Z7T A;  2R61 A;  3HOU G;  1ET6 A;  5EGT A;  2ZJR A;  2PNR C;  4R4C A;  2N8N A;  1UUP A;  4KHP L;  2I5H A;  3I4M H;  1NNX A;  5IIF A;  4X62 L;  1MSH A;  1V43 A;  3SK4 A;  2XWJ B;  1DON A;  1LT3 D;  1WTH A;  2EJF C;  4JI3 L;  3G7L A;  3W2D A;  3S2H B;  3OIP A;  5IY0 A;  3S2H H;  2R7D A;  1WCM H;  3TRZ A;  1W6J A;  2A19 A;  2WP8 J;  1HNX Q;  4DAV A;  4K0K L;  1TWA B;  2CFM A;  4NP5 A;  1A63 A;  5K5P A;  4OX9 Q;  1Y69 U;  5I2Y A;  1RF2 D;  1QZH A;  1JT8 A;  1F2Z A;  1TWA H;  3LX0 A;  3CCL A;  1NUC A;  3T13 A;  1L2F A;  4A93 G;  4TRD A;  5IYB G;  3W3A A;  3S1M H;  1OXT A;  3VYT A;  4BBS B;  2JN4 A;  4HCS A;  3CRK C;  3HOY B;  2D5D A;  4XQJ A;  1X65 A;  4BBS H;  2NVT B;  4X3T A;  3AYH B;  4ZYS A;  3URY A;  3IKJ A;  1GVP A;  3PCO B;  4Q5V A;  4QY7 A;  3H3V I;  3AQQ A;  5GQO A;  4DF7 A;  2KCN A;  3KJO A;  1J6Q A;  3I4N G;  1YJN A;  1ASZ A;  2R92 B;  3P20 A;  4LF4 Q;  1ZKO A;  2I5M X;  3EQL C;  1PXU A;  3KYH C;  3HGB A;  3DWP A;  2SOB A;  4YCV A;  1PH5 A;  3OW7 A;  1BR9 A;  1JOQ A;  1RIP A;  3OYY A;  2J0T D;  2B2U A;  1W6K A;  2DY7 A;  1L1O B;  1LTS D;  2OF1 A;  1CK1 A;  1FL0 A;  3TZD A;  5I2X A;  4R9W A;  5EBC A;  1N32 Q;  1HZC A;  1X54 A;  1GUW A;  1W3S A;  4DR7 Q;  5E3F A;  4GKK Q;  1EQV A;  1B3A A;  2F0F A;  4DXF A;  4PMB A;  4C3J B;  1V8Q A;  1ZEQ X;  1VMP A;  2WAC A;  4U68 A;  1X3E A;  4DUZ Q;  4M1U B;  1GUN A;  2XGT A;  1MIU A;  3G71 A;  1E0B A;  1WI5 A;  3D8G A;  4C3J H;  4DAY A;  1JMC A;  1CM9 A;  2XIW A;  1X3G A;  2UU9 Q;  1DZ1 A;  2KUM A;  1RKN A;  1YNN C;  3TBI B;  1B9M A;  1U0L A;  2F0W A;  4A3B G;  3HS0 C;  2K75 A;  4DV0 L;  2WKD A;  4NW2 A;  1AN8 A;  5J22 A;  1KIX A;  4JBM A;  4BY7 G;  5I9O A;  4Y52 H;  4X66 L;  1I4Q A;  1Q1B A;  3DUZ A;  1SE2 A;  4JYA L;  1HH2 P;  1EFI D;  3VR3 A;  3U4Z A;  4UPA A;  1E2Z A;  2JA8 H;  3I72 A;  3J80 E;  4HIO A;  3QR8 A;  1K3B C;  1I50 B;  4QCL A;  4BA1 I;  1VQG A;  3S16 B;  3JAM E;  1Q1E A;  2E75 C;  2H5X A;  1SR3 A;  5IYD H;  1I50 H;  5C44 B;  2CHB D;  4A3J B;  1IL2 A;  2AQ2 B;  4J8Q A;  4DUY Q;  1P8L A;  2JXM B;  5LMU L;  5JJI A;  2X6G A;  2VY3 A;  5C44 H;  4A3J H;  5IGD A;  1HFG A;  2LXJ A;  4PG3 A;  4G7Z C;  3PSI A;  4DV4 L;  1XMO L;  1V1O A;  1SFO B;  1PZJ D;  1S72 A;  1JE4 A;  4H02 A;  1A62 A;  1STA A;  1G6Z A;  2OTJ A;  3HOV H;  1SFO H;  4LF6 Q;  1VQF A;  3I91 A;  3PUY A;  2CQA A;  5M3M G;  1YNJ D;  2J4X A;  2VQE Q;  1ONL A;  1KRS A;  4A3F B;  3MXU A;  1WTP A;  1K0R A;  2H4O A;  4ZAI A;  4LF4 L;  1OXX K;  2K7V A;  1PFB A;  2Z4I A;  2CKZ B;  1A8V A;  2ZT9 C;  5JPN C;  4MTK A;  2EQS A;  4XDX A;  1J9O A;  2V1C C;  3A8I E;  4IPH A;  2X6L A;  1CZW A;  2PI2 E;  2JJQ A;  5JJL A;  4XQN A;  2NZO A;  2B39 A;  2QKI C;  3P7J A;  4Z9C B;  1A3U A;  2IJ0 A;  4BY1 H;  1H9S B;  2N88 A;  5C4H A;  4GKK L;  4LUZ A;  1EWC A;  1S5E D;  3K0Y A;  1AFP A;  2KHJ A;  1XX8 A;  4B9X A;  1XPU A;  4QGU A;  1E22 A;  1SBB B;  2PMZ E;  5EPJ A;  1M4V A;  2PZU A;  2UUC L;  1KHI A;  3G6J B;  1ILQ A;  1IZ6 A;  3MXN A;  2PW7 A;  2F1M A;  3KFU A;  2R7Z B;  1XWE A;  3J81 c;  4JPB W;  4CKE A;  2XRS D;  1EOT A;  1QNK A;  1VDZ A;  1N34 Q;  2R7Z H;  2JA7 B;  1KTK A;  4ZRZ A;  3GV6 A;  4C3H G;  3PO2 G;  4GZY C;  1J8I A;  2JA7 H;  1HRJ A;  5CV9 A;  1K73 C;  2F0P A;  4ABN A;  3MWY W;  2I46 A;  4DV5 L;  1VQB A;  3K7U C;  1D5M C;  1T5X D;  1QOH A;  5IGB A;  2B2Y C;  1DOK A;  1TQO A;  3CF5 A;  3PO3 B;  5LL6 S;  5IOC A;  2DJG C;  1UEA B;  3OSO A;  1B70 B;  2CW0 D;  1U5K A;  3PQI A;  3PO3 H;  4A3C G;  2PI2 A;  3ERQ A;  4C1N I;  2PQE A;  3J7A V;  1GHK A;  2L15 A;  4TKO B;  4HMJ A;  2KHI A;  4HSV A;  5CC4 A;  2QEJ C;  4NMZ A;  5DLQ E;  1R4P B;  2WFW A;  2GVB A;  3O13 A;  4GN5 A;  4CGY B;  1V9P A;  4OO1 I;  4L8J A;  4A3D B;  5AFW A;  3SK8 A;  4OON A;  1EIG A;  1FYC A;  2EYM A;  1BO0 A;  3L7Z C;  2VL6 A;  1Q90 A;  2PYK A;  5KYL A;  2CWA A;  4JCV E;  1BBX C;  2VQE L;  3PIP A;  1JR0 D;  4FVM A;  1SNC A;  2NZ1 D;  1DM0 B;  3I70 A;  5LMN Q;  2SNM A;  4A3K G;  4YWM A;  4LF5 L;  3QWN A;  2L11 A;  3GTL B;  4RHS A;  4QIW E;  3BDO A;  1C48 A;  3FPP A;  2MNA A;  1TII D;  4GOP A;  2F0K A;  5EBD A;  1EQT A;  3SDZ A;  3SHL A;  2RHS B;  2EVB A;  3GDE A;  1IKL A;  1BUV T;  1EY7 A;  4G57 A;  5JVH 3;  1IYU A;  2M2L A;  3HFZ B;  3KBX A;  3MHB A;  3HOX G;  3HOU B;  4DAM A;  2WAQ E;  4LNQ A;  3UDF A;  4R8I A;  1O7Z A;  1SAP A;  3HOU H;  3QO2 A;  4NDX A;  2UUA Q;  3SGI A;  1VQ6 A;  3D6W A;  4GNX C;  5C0X G;  1BOS A;  2EXZ A;  4DXG A;  4GLA C;  2O5J C;  4FF4 A;  3K5L A;  4A3I G;  4BA2 I;  3JAM L;  2F3I A;  1WOC A;  1VQA A;  4DFA A;  2G9D A;  5KIX A;  1WD0 A;  1WFQ A;  1F2L A;  2MHV A;  5C3E B;  2Q2U A;  1G2S A;  4ODG A;  1A15 A;  3NBI A;  1H9M A;  5IP9 G;  4A93 B;  3T1Y Q;  1LTA D;  1B44 D;  3D4R A;  1HTL D;  4A3E G;  1GXD C;  4A93 H;  2IT1 A;  5IYB H;  1VQJ A;  3NQI A;  3U50 C;  2B3G A;  4XXE A;  2KJX A;  1E1O A;  2ICE C;  5FO9 B;  3C2P A;  1FJG Q;  2Z6K C;  1QWY A;  2QA4 A;  5ELF A;  5BR8 Q;  3AU7 A;  1CKN B;  4NXN Q;  1UE7 A;  4OGQ C;  1EYG A;  2EYF A;  3I4N B;  2NB0 A;  2L4N A;  1KNA A;  4B3M Q;  3I4N H;  3JC6 6;  1H9K A;  3RR5 A;  2XVS A;  2A68 C;  3NTI A;  2IWH A;  1IBL Q;  1QVC A;  1K28 A;  2XNA C;  3P1H A;  2CCZ A;  4RGO S;  5ELO A;  2F0N A;  5M9O A;  1I4R A;  1SMY D;  4MTN A;  1TR5 A;  2B2V A;  4N8F A;  3OHX C;  5IWA L;  4YHH Q;  1EQR A;  1KXL A;  1ESR A;  1I6H H;  1XMQ L;  5C4J B;  5T1G A;  4YWK A;  5C4X B;  1Y8N B;  2ICI A;  2KED A;  5C4J H;  3CQZ B;  3RLO A;  4X65 Q;  5CBA E;  3Q24 A;  3KF8 A;  3TZU A;  3HRZ C;  1YHB A;  2K05 A;  3VA5 A;  3RN5 A;  4M8A A;  4ALP A;  1F9S A;  1EYC A;  4C3I G;  3M4P A;  1NSN S;  2KBN A;  1B1Z A;  4PNY A;  1N9W A;  1STY A;  5M3F G;  2D62 A;  3CC4 A;  2HUG A;  2PNH A;  3M7N A;  4HJ5 A;  1Y1V B;  3GTO B;  4A3B H;  1JB3 A;  2ZXO A;  4DNT B;  3OMG A;  3GTO H;  4G7H C;  1ROD A;  1VS0 A;  4BY7 H;  5I9P A;  3KUP A;  4FF3 A;  2OT2 A;  1PRT F;  1NAP A;  4APV A;  2E8G A;  2BA1 A;  1I4H A;  3S9W A;  3RZO B;  1QVG A;  1I4P A;  5I6Y A;  4IZ8 A;  3WOE A;  3RZO H;  3BZD B;  4LFC Q;  4X64 Q;  4WJ4 A;  1YJW A;  2VXW A;  3CCS A;  4IUN A;  3J80 i;  2KVM A;  3T1Y L;  3J7A 5;  1MSG A;  1S3O A;  3HOZ G;  4HN7 A;  3SE0 A;  3HG9 A;  4KI0 A;  1EIY B;  1JOO A;  2AKW B;  1SMY C;  1WD1 A;  3J7A F;  4JW0 A;  2MPM A;  1VQ7 A;  4LF8 Q;  1PYB A;  2L55 A;  5BR8 L;  4LWC A;  4HJ8 A;  5J39 A;  1LTT D;  4XT3 B;  5M3M B;  3I3C A;  4Y7N B;  2EY2 A;  1VF5 C;  1K3R A;  4GKJ L;  3AB9 A;  1U4R A;  2LMC B;  1CT1 D;  5M3M H;  4Y7N H;  1CFM A;  4B3M L;  2X69 A;  5H1S E;  1HPC A;  3ND8 A;  3K5O A;  1GJX A;  3KBG A;  1MI2 A;  1MJC A;  2M00 A;  3D3R A;  4KHP Q;  5ELD A;  4KMU C;  2GA4 B;  4OXP A;  3M3Y B;  4MHE A;  5IE8 A;  5KNB A;  2NTT A;  3KDF A;  5CV4 A;  3DEP A;  4X62 Q;  1FGB D;  1CA5 A;  4JI4 L;  3R3O A;  1M1K C;  1ZXT A;  2EYL A;  3NWT A;  4EQO A;  2UXD L;  4KKT A;  1XNR Q;  3J80 c;  2K5V A;  1EIF A;  3CW2 C;  1SYC A;  4JK1 C;  4HJA A;  3NUC A;  1TWF H;  4X65 L;  4NKL A;  3A56 A;  1UE6 A;  3EN2 A;  2F0H A;  4FXK C;  3QG1 A;  4C2M B;  3UE0 A;  2F4V Q;  4K0K Q;  2NTS A;  2AQ1 B;  1HNZ Q;  4F8M A;  3HP3 A;  2OEO A;  4RCN A;  2BH2 A;  5E4W C;  4C2M H;  4IO9 A;  2QDL A;  2K6A A;  3Q8D A;  3IFD A;  3CCJ A;  1HUM A;  4NB3 A;  2A1A A;  3GTQ B;  1KLU D;  1UE5 A;  3NEL A;  1Z6H A;  5M5Y H;  3TP8 A;  2K04 A;  1HZB A;  1NTG A;  3ICE A;  2HQL A;  2R3Z A;  1H9J A;  4KHZ A;  4C3H H;  3PO2 H;  1KDA A;  1LTR D;  3H3V C;  4CBV A;  2RVL A;  4LF9 L;  2N49 A;  5IP7 G;  3A55 A;  5C3X A;  4BXX G;  1LTG D;  4DR1 L;  2NVQ H;  4LFC L;  1NBW A;  1EYA A;  4MNO A;  4DK1 A;  2DNE A;  1YHA A;  3MC0 B;  3NP8 A;  4UDU C;  3ZJY C;  1DJR D;  5JVG 3;  2Z9H A;  3T51 B;  2ID0 A;  3UDI A;  5LHY 1;  1AE3 A;  4LMQ D;  1C9O A;  1YBY A;  3NEN A;  5F2D A;  2C35 B;  3S1N B;  3I2Z A;  2RCN A;  3NQT A;  5C6A A;  1LTL A;  2B2V C;  4ME3 A;  1VQ5 A;  3S1N H;  2WAQ G;  3K57 A;  4H0L C;  2IL8 A;  4K8I A;  1EOV A;  4A3G G;  1U4M A;  3VR6 A;  3NWS A;  3K7A B;  1ET9 A;  1AP0 A;  2B2W C;  3K7A H;  1BQQ T;  3OWF A;  5GAG C;  3HOW G;  2I07 B;  2JA6 G;  3I4M B;  4A3K H;  1VQL A;  2EYJ A;  4DV0 Q;  3PF5 A;  4AYB G;  5IGE A;  3LWU A;  4X66 Q;  4OEM B;  1YEZ A;  3ZYY X;  4JYA Q;  1XNR L;  1RCV D;  1WCM B;  2UXB L;  2RDH A;  4AH6 A;  3FPU B;  4OL7 A;  2HCI A;  3D6C A;  1YNN D;  2F4V L;  2Z6B A;  1HNZ L;  3HOX H;  3PUV A;  5LMU Q;  1SYE A;  1LM0 A;  4CDC C;  3S1M B;  4EQN A;  3BJU A;  1TWH H;  3KF6 B;  4IPG A;  4DV4 Q;  3FEW X;  3MEH A;  4A3I B;  1RL2 A;  5C0X H;  1KQS A;  1XMO Q;  4IJL A;  5ELN A;  3C3L A;  4GNX B;  3M4Q A;  4RKL A;  2JEB I;  4A3I H;  4UY8 C;  2SDF A;  1G51 A;  1ICF B;  1Q7Y C;  3CPW A;  1I3Q B;  4IFD I;  1I3Q H;  3I4L A;  1SNP A;  2B63 G;  5IP9 H;  4A3E B;  1PYW D;  1A3V A;  2PQA A;  4XTC S;  1S5C D;  1MJE A;  4A3E H;  5LL6 X;  1SE3 A;  3PV0 A;  1XNQ L;  1BNZ A;  1UE1 A;  1BXT A;  1VQ4 A;  2BDN A;  3TS0 A;  4L63 B;  4B9W A;  1VQM A;  3NSW A;  2RF4 A;  2KCM A;  1FGU A;  1W2B A;  1IHZ A;  3VA7 A;  3HKZ G;  3RZD B;  4FNF A;  3TRE A;  2F0T A;  4OIJ A;  3RZD H;  2EJM A;  1K8A C; 
#chains in the Genus database with same CATH homology
 3W1G A;  2JA5 H;  4DV5 L;  1VQB A;  3K7U C;  4P71 A;  4RG1 A;  1FVI A;  4B3R Q;  4JI2 Q;  1R9T H;  1PH9 A;  1IBK L;  3CCQ A;  3CF5 A;  5LMN L;  3PF4 A;  3G4S A;  4IFD G;  3F2C A;  4LF7 L;  1B70 B;  3G48 A;  3T1H L;  1VQD A;  1U5K A;  1HR0 Q;  2UUC Q;  3PO3 H;  4A3C G;  2PI2 A;  2LSS A;  1XNQ Q;  3AEV A;  4YCU A;  5C4X H;  1Y1W G;  1PH1 A;  2L15 A;  1P16 A;  2KHI A;  2OWO A;  4UP8 A;  1KC8 C;  2N3S A;  3CQZ H;  3GTP H;  1X56 A;  5DLQ E;  1PV4 A;  2WFW A;  4O2D A;  2GVB A;  2JA8 G;  4GN5 A;  1LYL A;  1SRU A;  1V9P A;  4A3D G;  4OO1 I;  3CCE A;  4IFD J;  4QL5 A;  2ZTE A;  3I7F A;  1QZG A;  1PVO A;  4OON A;  4C3I H;  3L7Z C;  4DNI A;  2VL6 A;  3G6E A;  2VUM H;  3HKZ E;  5IYD G;  2CWA A;  4JCV E;  3OW2 A;  1WYD A;  4DV5 Q;  2VQE L;  3EIV A;  1EUJ A;  3UDX A;  3PIP A;  2NVX H;  2EXD A;  5C0X I;  5M3F H;  3J7Z C;  1J5E Q;  5C44 G;  1IBK Q;  4A3J G;  1GD7 A;  5LMN Q;  4A3K G;  1Z9F A;  4YWM A;  4RMF A;  2UUA L;  4LF5 L;  3M4O H;  3S2D H;  2UXC Q;  4DR3 Q;  5GAD C;  2ZJP A;  3BU2 A;  3AFP A;  2Q2H A;  1YIJ A;  2E2H H;  1Y1V H;  4QIW E;  1PH2 A;  2CWP A;  2MNA A;  1XPR A;  1VQI A;  2E2J H;  1PH7 A;  4GOP A;  3W5O A;  2JQO A;  4AQY Q;  1YI2 A;  2ZTC A;  3FKI H;  3S1Q H;  1ASY A;  2RHS B;  1EFW A;  2Q2I A;  3GDE A;  3L0O A;  3S1R H;  3HOV G;  4DAY B;  4GS3 A;  1TWC H;  4UP9 A;  3CCR A;  4DR5 L;  1WJJ A;  5M5X H;  1C0A A;  3BZK A;  1KRT A;  3RLN A;  3S17 H;  3K80 C;  5HGQ A;  1NJI C;  1HR0 W;  2UUB L;  2ALY B;  1O7I A;  3HFZ B;  2IX1 A;  2NZH A;  1GKH A;  3HOX G;  4PMW A;  2WAQ E;  4DAM A;  1SN8 A;  3CAM A;  1AH9 A;  2K14 A;  4A3F G;  3STB D;  4LNQ A;  4OO1 G;  1CUK A;  5E7N A;  1G29 1;  3UDF A;  3HOU H;  1JJG A;  2UUA Q;  1Y14 B;  3SGI A;  4LF5 Q;  3IRB A;  3J81 i;  3K81 C;  1VQ6 A;  1X3F A;  4DV2 L;  4GNX C;  2KCT A;  1HNW L;  5C0X G;  3D31 A;  1FJG L;  3HOZ H;  1I94 Q;  4GLA C;  2OCE A;  4A3I G;  3MEF A;  1PHJ A;  4BA2 I;  2F3I A;  4BY1 G;  1WOC A;  1VQA A;  2XTI A;  1CKO A;  4NPS A;  4NXN L;  4B3T Q;  3KOJ A;  5K36 G;  3CC2 A;  1L1O A;  4HJ7 A;  4DR5 Q;  1XJV A;  5FJ8 G;  1K8G A;  1IBM Q;  1WFQ A;  4LFB Q;  5C3E G;  2AWN A;  2Q2U A;  2UUB Q;  3ULL A;  1OXU A;  2WB1 G;  4JBK A;  3U4V A;  1YZ6 A;  3NBH B;  3PUX A;  5IP9 G;  4GN4 B;  1IBL L;  4DR4 L;  4QJF A;  2LXK A;  1IXR A;  2ZTD A;  3DLL A;  3T1Y Q;  4JI5 Q;  2K5H A;  4YY3 L;  5IYC G;  4R1J A;  1EWI A;  3OTO Q;  5JEA J;  2VNU D;  4A3E G;  2MO0 A;  2ATW A;  3S15 H;  4A93 H;  2IT1 A;  5IYB H;  1VQJ A;  4YHH L;  3M3Y H;  2CQO A;  1XTD A;  4JC0 A;  2B3G A;  3U50 C;  4DV2 Q;  1E1O A;  1PH8 A;  2IY5 B;  1HZ9 A;  3TQY A;  2OQK A;  1CSP A;  2Z6K C;  2QA4 A;  4JI3 Q;  1FJG Q;  3HOY H;  2IHF A;  3H15 A;  2R7Z G;  4P75 A;  2NVT H;  4JI7 L;  5BR8 Q;  1VQH A;  1CKN B;  3PUW A;  5J3B A;  4NXN Q;  4LFA L;  2JA7 G;  4A3L G;  4BBR G;  1UE7 A;  1EYG A;  3S24 A;  3ULP A;  1VQ8 A;  4B3M Q;  3I55 A;  3GTJ H;  2JA5 G;  1VQN A;  2R92 H;  3I4N H;  3JC6 6;  3RR5 A;  4DV7 L;  4OWT B;  4TQU S;  2ZJQ A;  1IBL Q;  3K8A A;  1QVC A;  1OXV A;  2CCZ A;  4YY3 Q;  5ELO A;  4MTN A;  3F2D A;  1YIT A;  1J5E L;  1Q86 C;  4DV1 L;  4P73 A;  4GLV B;  3PO3 G;  4YHH Q;  5IWA L;  1EQR A;  1KXL A;  1KL9 A;  1I6H H;  1NE3 A;  3RNU A;  1N8R C;  1XMQ L;  3GTK H;  3GTQ H;  2UXC L;  5C4X G;  2IX0 A;  4DR3 L;  1QUQ A;  4YWK A;  3STB C;  1OTC A;  1JE5 A;  2QGQ A;  2DUD A;  3BZC A;  4JOI C;  4DK3 C;  4A4I A;  4OWW B;  5C4J H;  3RLO A;  4X65 Q;  4JI7 Q;  4EX5 A;  1CKM A;  2JK8 A;  3VDY A;  2I0Q A;  2Y0S G;  4AQY L;  1N33 L;  1YHB A;  2HT1 A;  2NN6 I;  4LFA Q;  4YCW A;  2MQH A;  1PH6 A;  3RN5 A;  1BBU A;  2K5N A;  1KAW A;  4ALP A;  2YV5 A;  2AHO B;  3M4P A;  2VUM G;  3KJP A;  4HID A;  2KBN A;  2PQA B;  2MFI A;  3GTM H;  2VQF L;  2VW9 A;  1M90 C;  1E24 A;  5IP7 H;  4DV7 Q;  3MXN B;  1N9W A;  5M3F G;  4PZ7 A;  2D62 A;  3CC4 A;  4JI6 L;  4BXX H;  3A74 A;  4GLX A;  4HIK A;  3RN2 A;  2ASB A;  4IOA A;  4X64 L;  4X6A H;  3H3V H;  1PFS A;  4R4T A;  1JB7 A;  2PNH A;  3A5U A;  3CMA A;  3F2B A;  4DV1 Q;  1Y1V G;  5IWA Q;  4DR2 L;  4HJ5 A;  3M7N A;  3PUZ A;  3ER0 A;  4A3C H;  3E9I A;  1XMQ Q;  2HIV A;  4AIM A;  4A3B H;  3GTO H;  1VQC A;  3FKI G;  2N78 A;  1X6O A;  4DV3 L;  1VS0 A;  1BVS A;  1CSQ A;  2R6G A;  3D0F A;  3J81 j;  4BY7 H;  1I94 L;  4L5T A;  3KLW A;  3H0G H;  1N33 Q;  5JJK A;  2D0P A;  1SLJ A;  5EAY A;  3CCV A;  4APV A;  4LF8 L;  2FXQ A;  2E8G A;  2BA1 A;  3KF6 A;  4P74 A;  4B3T L;  4MZ9 A;  4FDB A;  2Y0S E;  1OXS C;  3PGZ A;  1JJC B;  4A3G H;  1HNX L;  1IBM L;  4LFB L;  4GNX A;  2VQF Q;  1QVG A;  1NMF A;  3RLF A;  4OX9 L;  2NN6 G;  4A3M H;  3RZO H;  1VQO A;  4JI6 Q;  4L5R C;  3I56 A;  3S16 H;  4LFC Q;  3HOU G;  4GN3 B;  4X64 Q;  4WJ4 A;  2ZJR A;  1YJW A;  1YNX A;  4R4C A;  2EIF A;  2N8N A;  4JI5 L;  3J80 i;  3CCS A;  3T1Y L;  4NXM Q;  3HOW H;  4R4Q A;  3J7A 5;  2I5H A;  1S3O A;  4DR2 Q;  3FHW A;  3I4M H;  2JA6 H;  3OTO L;  4X62 L;  4UP7 A;  1UEB A;  1YJ9 A;  1PYS B;  1V43 A;  3HOZ G;  2K4K A;  3E0E A;  1V1Q A;  4KI0 A;  1EIY B;  4DV3 Q;  3E9H A;  2I5L X;  2AMC B;  2AKW B;  4JI3 L;  2AWO A;  1VQ7 A;  4LF8 Q;  5IY0 A;  1PYB A;  1NMG A;  4LWC A;  4LUO A;  5BR8 L;  3WWV A;  4HJ8 A;  2A8V A;  3S2H H;  5JEA G;  1WCM H;  2R7D A;  2ES2 A;  2F52 A;  3TRZ A;  2A19 A;  2WP8 J;  1K3R A;  2YYZ A;  1HNX Q;  2KEN A;  2JEA I;  4GKJ L;  4K0K L;  2DGY A;  5M3M H;  2CFM A;  1A63 A;  4Y7N H;  2Z6K A;  4B3M L;  4OX9 Q;  4A3F H;  4EQ5 A;  5H1S E;  1QZH A;  1JT8 A;  3TEH B;  1TWA H;  3CCL A;  5GAH C;  4GOP B;  1MJC A;  3M9B A;  1L2F A;  4A93 G;  4A75 A;  5IYB G;  4KHP Q;  1N36 Q;  3UDG A;  1IYJ B;  4OXP A;  5IE8 A;  3S1M H;  3KDF A;  1OXT A;  4A76 A;  4X62 Q;  2R93 H;  4B3S Q;  4JI4 L;  3HOY G;  1M1K C;  1GO3 E;  2UXD L;  1X9N A;  1X65 A;  3GD7 A;  1XNR Q;  1E3P A;  2K5V A;  3J80 c;  1EIF A;  4BBS H;  1N32 L;  2VS1 A;  1HJP A;  3AYH B;  3CW2 C;  1GVP A;  3PCO B;  3A5Z B;  4HJA A;  4X65 L;  1TWF H;  4DR7 L;  4KHP L;  1BKB A;  4QY7 A;  3H3V I;  3AQQ A;  1UE6 A;  3EN2 A;  5GQO A;  1PA6 A;  1VQK A;  1Q12 A;  2YTV A;  4DKA C;  3KJO A;  4GKJ Q;  1J6Q A;  3UE0 A;  2F4V Q;  1YJN A;  4DUZ L;  1ASZ A;  1HNZ Q;  1XPO A;  2R92 G;  3I4N G;  4K0K Q;  2JA9 A;  4LF4 Q;  2BH2 A;  4WJ3 M;  4C2M H;  4IO9 A;  2I5M X;  1Q82 C;  3KYH C;  2Z0S A;  1PH4 A;  4JI8 L;  2BA0 A;  3CCU A;  4YCV A;  3Q8D A;  1PH5 A;  2UU9 L;  2OQ0 A;  3GTG H;  3CCJ A;  1X55 A;  2B63 H;  2E5L Q;  1D7Q A;  1C7Y A;  2WB1 E;  1RIP A;  4NB3 A;  2A1A A;  3HKS A;  3OYY A;  3F8T A;  4TVA B;  1UE5 A;  4JBJ A;  1L1O B;  4JI4 Q;  1K83 H;  3NEL A;  5FLM H;  1FL0 A;  3B6Y A;  3K0X A;  1B8A A;  5M5Y H;  4HJ9 A;  2UXD Q;  1HZB A;  2HIX A;  1N32 Q;  4XIG S;  1HZC A;  1NTG A;  1X54 A;  3ICE A;  2HQL A;  1W3S A;  4DR7 Q;  2NVY H;  4GKK Q;  4J15 A;  1VQ9 A;  2ZM6 L;  4KHZ A;  3GO5 A;  1AE2 A;  4C3H H;  3PO2 H;  4JV5 Q;  4LF9 L;  2GVA A;  2N49 A;  4IOC A;  5IP7 G;  1SMX A;  1X3E A;  4DUZ Q;  1T9H A;  2XGT A;  1MIU A;  3G71 A;  4C3J H;  1WI5 A;  4BXX G;  4L5S A;  3CME A;  1S40 A;  1JMC A;  4DR1 L;  3DM3 A;  1QVF A;  4JI8 Q;  3PIO A;  1HZA A;  1X3G A;  4DUY L;  3M85 A;  2UU9 Q;  2NVQ H;  1E1T A;  4LFC L;  1NBW A;  1MKH A;  4MNO A;  2OTL A;  1YHA A;  4OWX B;  3ZJY C;  1U0L A;  4A3B G;  4NXM L;  2K75 A;  3S14 H;  2ID0 A;  3UDI A;  2GN5 A;  4DV0 L;  3CC7 A;  1AE3 A;  1KIX A;  4JBM A;  4BY7 G;  1C9O A;  1YBY A;  3NEN A;  2C35 B;  5HY6 A;  4Y52 H;  3I2Z A;  2RCN A;  4X66 L;  3H0G G;  1Y1W H;  2HHH Q;  1Q1B A;  4PZ8 A;  1LTL A;  4ME3 A;  4P72 A;  4JYA L;  1HH2 P;  1VQ5 A;  3S1N H;  2WAQ G;  3U4Z A;  4DV6 L;  4UPA A;  4JI1 Q;  2RHQ B;  2ZM6 Q;  1EOV A;  4LF6 L;  2JA8 H;  4A3G G;  4DK6 C;  5AJ3 Q;  4A3D H;  3NEM A;  3F1Z A;  4HIO A;  4LF9 Q;  2Q2T A;  4BA1 I;  3CP0 A;  1Q8K A;  4A3M G;  1Q46 A;  1VQG A;  3EBE A;  1Q1E A;  2H5X A;  3K7A H;  1SR3 A;  5IYD H;  1QUQ B;  1I50 H;  4DR1 Q;  1IL2 A;  2QEX A;  5GAG C;  1KD1 C;  4DUY Q;  1P8L A;  5LMU L;  4LF7 Q;  3HOW G;  5JJI A;  2VY3 A;  4LUV A;  4IPC A;  3T1H Q;  5C44 H;  3I4M G;  2JA6 G;  3UE1 A;  4A3J H;  2JE6 I;  3KF8 B;  4A3K H;  2LXJ A;  4PG3 A;  1N36 L;  1VQL A;  3GTL H;  4DV0 Q;  2B29 A;  4AYB G;  3PF5 A;  3ERS X;  3PSI A;  4B3S L;  4DV4 L;  4DR6 L;  3JAM i;  1L0W A;  1DGS A;  3LGJ A;  4X66 Q;  1XMO L;  4DPG A;  3CPF A;  1YEZ A;  1S72 A;  4JYA Q;  1XNR L;  4H02 A;  1H95 A;  1A62 A;  4R4I A;  1WCM G;  4DV6 Q;  1Q81 C;  2OTJ A;  3HOV H;  2UXB L;  1SFO H;  4LF6 Q;  1VQF A;  4AH6 A;  3PUY A;  3CXC A;  1YVC A;  5M3M G;  4JI0 L;  1SE8 A;  2VQE Q;  3FP9 A;  4GOP C;  3CD6 A;  1KRS A;  1I5F A;  1LUZ A;  2MO1 A;  2F4V L;  2YU9 H;  1CKN A;  1K0R A;  5GRO A;  1HNZ L;  3HOX H;  3AFQ A;  4LF4 L;  1OXX K;  1A0I A;  3PUV A;  2CKZ B;  5LMU Q;  4O0A A;  1A8V A;  1UWV A;  1LM0 A;  5IT9 c;  1TXY A;  2EQS A;  2V1C C;  4IPH A;  3BJU A;  2K52 A;  2R93 G;  2PI2 E;  2E5L L;  2JJQ A;  4R4O A;  5JJL A;  1TWH H;  1G6P A;  2YTY A;  1K9M C;  3KF6 B;  4IPG A;  4DV4 Q;  4BBS G;  2NZO A;  4DR6 Q;  1RL2 A;  3U58 A;  1KQS A;  2K50 A;  1XMO Q;  4IJL A;  5ELN A;  3CCM A;  4AYB E;  1Z47 A;  4PZ6 A;  4GNX B;  3M4Q A;  1N34 L;  2JEB I;  4JG2 A;  4YWL A;  4A3I H;  2VZA A;  5LMN W;  4UY8 C;  2D0O A;  4BY1 H;  1G51 A;  1SRO A;  1Q7Y C;  5FLX c;  2UXB Q;  3CPW A;  4GKK L;  3JAM c;  5FJ8 H;  4JI0 Q;  5C0X J;  4LUZ A;  5C3E H;  2E2I H;  4IFD I;  5M5W H;  5GAE C;  4JV5 L;  1VQE A;  1YHQ A;  3TS2 A;  1I3Q H;  1EQQ A;  3L2P A;  4QQB X;  4B3R L;  2KHJ A;  4JBW A;  2B63 G;  5IP9 H;  4JOI A;  4KLK A;  4QGU A;  4JI2 L;  1XPU A;  1E22 A;  3W1B A;  2PQA A;  1L1O C;  4IJH A;  4XTC S;  1VQP A;  1TWG H;  5IYC H;  2IHE A;  2PMZ E;  1MJE A;  4IPD A;  1HNW Q;  4A3E H;  2UUC L;  1HR0 L;  1KHI A;  1B7Y B;  1IZ6 A;  3PV0 A;  5FLM G;  4POG A;  1XNQ L;  4POF A;  1NY4 A;  3I4O A;  1UE1 A;  3KFU A;  1VQ4 A;  3A0J A;  3J81 c;  3TS0 A;  1VQM A;  1D8L A;  2RF4 A;  4LW1 A;  2KCM A;  2R7Z H;  1FGU A;  1N34 Q;  1W2B A;  2BH8 A;  2HHH L;  2YTX A;  1GM5 A;  1PH3 A;  3PO2 G;  3HKZ G;  3TRE A;  4HIM A;  2JA7 H;  4L5Q A;  4A3L H;  2R7F A;  3ULJ A;  1JJ2 A;  4BBR H;  1BBW A;  4JI1 L;  1VCI A;  3RZD H;  1E7Z A;  5AJ3 L;  1K8A C;  4DR4 Q;  1K73 C;  3KDF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...