2IHFA

Crystal structure of deletion mutant delta 228-252 r190a of the single-stranded dna binding protein from thermus aquaticus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
235
structure length
205
Chain Sequence
MARGLNQVFLIGTLTARPDMRYTPGGLAILDLNLAGQDAFTDESGQEREVPWYHRVRLLGRQAEMWGDLLEKGQLIFVEGRLEYRQWEKDGEKKSEVQVRAEFIDPLEGRGRALNQVILMGNLTRDPDLRYTPQGTAVVRLGLAVNEERTHFLEVQAWRELAEWASELAKGDGLLVIGRLVNDRFQTRVEALRLERPLEDFPPEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Single-stranded DNA-binding protein
publication title 3D structure of Thermus aquaticus single-stranded DNA-binding protein gives insight into the functioning of SSB proteins.
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Dna binding protein
total genus 34
structure length 205
sequence length 235
ec nomenclature
pdb deposition date 2006-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ihfA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ihfA02
3AFQA 3H0GH 1G51A 1K3RA 2PQAA 4JOIA 4KI0A 3M3YH 4DV3Q 1VQ6A 2ZJQA 3CC4A 3ULLA 4PZ7A 1K73C 4YWMA 4DV7Q 3PO3G 2R7FA 3CMEA 1G6PA 5C4XH 4JI0Q 2F3IA 4A3CG 4X6AH 4X64Q 4GNXB 4BA2I 4C3HH 4NXMQ 1A63A 3KF8B 4DUYL 1SFOH 1Q81C 2UXBQ 3RLNA 5IP7G 5M5YH 4LUVA 1L2FA 3MEFA 4DKAC 3AQQA 3RLOA 1KIXA 3CCSA 3T1YL 2MO1A 2B63H 1HZBA 2AWNA 4P72A 3EN2A 4X66Q 4JI4L 2R7ZH 1PVOA 2NVTH 2NZOA 3S1MH 3JAMc 3E9IA 4JI2L 1KL9A 1PA6A 1NY4A 4LWCA 1YHAA 1J6QA 2IX0A 3HKZE 3CCLA 3S15H 4DR4L 3SGIA 5HY6A 4GLXA 2CFMA 1YJ9A 2H5XA 1PYSB 4A3FH 3W1GA 4OWTB 1RL2A 3TS2A 2PNHA 3WWVA 1IL2A 4YHHL 4LF9Q 1K9MC 5M5XH 3G6EA 4JV5Q 2YTYA 1GKHA 5M3FG 5GQOA 4YWKA 1HH2P 2KHJA 2KHIA 2V1CC 4GKKQ 5EAYA 4R4QA 3PGZA 2Y0SG 4DV0Q 4HJ7A 4O0AA 4A3KH 1FJGQ 1SRUA 5FJ8G 1KHIA 3CPWA 4A93G 3HKSA 3K8AA 1R9TH 2Z6KC 1L1OB 4L5SA 2NN6G 4HIOA 3HOWG 3PSIA 1E3PA 3EBEA 3CW2C 2NVQH 4A3IG 3T1HL 2QEXA 3KF6A 4LF7L 1XNRL 3GDEA 3PF5A 3KFUA 1Q12A 1MKHA 2YU9H 2VS1A 2K5HA 1N32L 1VQAA 4DK3C 3AFPA 3F2DA 1VQFA 1EIYB 2HQLA 1D8LA 2JEBI 1S72A 2JA7G 2CWAA 2UUAQ 4BBSG 2NVYH 3TREA 1HNZL 2GN5A 2OQKA 4NXNL 3KOJA 2I5HA 4R4TA 4L5TA 4HIKA 2OWOA 2VUMG 1YHBA 4YY3L 4YCUA 3HOVG 5IYDH 2JA5G 2BH2A 3HKZG 3JC66 3I4NG 4DAYB 2Q2IA 3BU2A 1XPUA 3GTLH 1IBMQ 4K0KL 2Z6KA 3D31A 2AWOA 1X3GA 3TQYA 2L15A 4DV0L 1PV4A 1HNWQ 3PO3H 5IYCG 2UXDQ 5GROA 4A3CH 3K7UC 4DK6C 2EIFA 2K5NA 2LSSA 1YZ6A 2E2JH 1C9OA 2FXQA 3TS0A 3I4OA 4DR2L 1SMXA 3ULPA 2PMZE 3NBHB 5IP7H 2R92H 3PUZA 1BBWA 5JJIA 4OO1G 1YEZA 1N36Q 1P8LA 3A5UA 1D7QA 2JQOA 3S2HH 1AE2A 4BXXH 5LMNQ 2PI2A 1UE5A 5IYBG 4GKJL 2HIVA 1PH5A 4NB3A 3RZOH 3KJPA 4POFA 5M3MG 4AIMA 1Y1WG 2VW9A 4LF6Q 2MQHA 4JYAQ 3STBD 2CCZA 1PHJA 3KDFA 1VQIA 4GLVB 1PH7A 4DUZQ 4C3JH 3GTMH 4OX9Q 5FLMG 3S2DH 2N78A 5M3FH 2F4VL 1PH6A 1A62A 1X3FA 2K75A 2A1AA 3K80C 3CPFA 4A3LG 1B8AA 4Y7NH 5FJ8H 4LFAQ 1HR0L 4XTCS 1VQGA 3M4QA 4DV2L 1Y14B 1V43A 3NELA 2K4KA 1OXTA 2KCMA 2N49A 4X62Q 4A76A 4ME3A 3PUVA 4BY7G 4B3RL 5C0XI 3HOWH 3ZJYC 4P73A 5GAGC 2OCEA 1JE5A 3HFZB 2VQFQ 4A3IH 3CP0A 3CCJA 3H15A 2IHFA 4JI7Q 4JCVE 4A3GG 1Q86C 2UXCL 2LXKA 1EUJA 1N33Q 3HOUG 4QQBX 4JG2A 3UDIA 4B3TL 1E22A 2HIXA 1UWVA 4LFCQ 1JJCB 3J81c 4DR7L 4L5QA 1EWIA 4IPCA 4B3SQ 4LF8Q 4BBSH 3A0JA 4QJFA 4YCWA 4WJ3M 1IBLQ 4IJHA 4TVAB 3BJUA 3UDFA 2VUMH 2AKWB 1EFWA 4AYBE 2MFIA 4MTNA 3HOVH 1XMQQ 2JA5H 1X6OA 1YIJA 1YVCA 4JI1Q 1M1KC 1YJWA 4JI5Q 2WP8J 3J81j 3I4NH 1YNXA 3A5ZB 2E5LQ 5AJ3L 4A3DG 4GOPB 2UUCL 4RMFA 4DV1L 1TXYA 3S1NH 1KXLA 4DR3L 4GNXC 1XMOQ 1VQDA 5IP9G 4X62L 3HOXG 5LMUL 2AHOB 3H3VI 1I3QH 2ATWA 2WFWA 4DR5Q 3U58A 4DV6L 1CKNA 4B3ML 2B3GA 3G71A 1C0AA 4PG3A 3S1RH 4P74A 3F1ZA 4YWLA 1LM0A 3KLWA 3J7ZC 5IYBH 1N34L 4LFBQ 4DV4L 1Y1WH 3I4MG 4A93H 2JA6G 5C4JH 4UY8C 3GTOH 3CMAA 1EQRA 1HNXQ 2VY3A 3G48A 3E0EA 1NMGA 4DNIA 1VQ7A 4DV3L 2QGQA 3GTKH 2RCNA 1K8GA 2JA9A 5FLMH 4DV7L 2OTJA 3CCEA 4JI0L 1HZCA 2YTXA 4X64L 1NTGA 4GNXA 4NXML 5GAEC 4X65Q 1VQ4A 2UU9Q 2YYZA 1VQNA 1MJEA 2UXBL 5IE8A 4GN4B 3FHWA 1XNQQ 3L7ZC 4QGUA 4HJ5A 1QVFA 1CSPA 4A3LH 2Z0SA 4UPAA 4AYBG 4AQYQ 3S14H 4GN5A 1PH3A 3FKIG 1O7IA 1Q8KA 1WYDA 1L1OC 1Q1EA 4IPDA 4X66L 5BR8Q 4BY7H 1VQLA 2R93G 1EOVA 1K0RA 5C0XJ 4DR5L 2WB1E 2RHQB 3DLLA 3HOYG 3PIPA 1PYBA 1W3SA 4DV5Q 4A3GH 1KRSA 1HJPA 1B70B 1RIPA 1TWCH 4PMWA 2MO0A 4BY1G 4JI8Q 3HOUH 3CF5A 1WFQA 5C44G 1TWGH 3RR5A 3OYYA 4LF9L 4JV5L 2JA8G 4R4OA 3KJOA 3A74A 1E24A 4R4IA 5C3EG 1KAWA 1XJVA 2UUBQ 1WCMG 2HHHQ 1X9NA 4GKKL 3U50C 1CUKA 1ASZA 4JC0A 2D62A 1H95A 1IZ6A 1FJGL 5GADC 4J15A 1KC8C 1LYLA 2JE6I 2ZM6Q 4HJ8A 4LF5Q 3TEHB 3CXCA 1L1OA 2WAQE 1NJIC 3AEVA 4A3DH 1V1QA 2PI2E 4A3BG 3UDGA 3KDFB 1G291 3MXNB 1N8RC 4DR1Q 3UE0A 5IWAQ 4WJ4A 5IP9H 3S16H 2Q2HA 1SE8A 1YJNA 4APVA 3CQZH 3S24A 4A3EG 4TQUS 1OTCA 3HOZG 1E1TA 4A75A 4L5RC 3EIVA 2RHSB 3CAMA 2YTVA 5IY0A 1WOCA 2UUAL 1UE6A 1EYGA 2XGTA 1I94Q 1Y1VG 5C0XG 3CCMA 4HIDA 1B7YB 2OQ0A 4P71A 5FLXc 1KRTA 2B63G 2R7ZG 1SN8A 3J80i 3I4MH 4EQ5A 4KHPQ 1J5EQ 3K7AH 3Q8DA 3AYHB 4IFDI 1K83H 3I2ZA 1QZGA 1E7ZA 4A3MG 1MIUA 1PH4A 1HR0W 1IBML 4DR6Q 1N9WA 1QVGA 1NBWA 4P75A 3TRZA 2UXDL 1HNWL 1FGUA 1Q7YC 4JI3Q 1X3EA 4A3FG 1LUZA 4LNQA 4QL5A 3I55A 3F8TA 5ELNA 3PF4A 3F2CA 5E7NA 4BBRG 4XIGS 3PO2G 2PQAB 2R7DA 1AE3A 3NENA 1OXXK 5H1SE 1TWFH 4OXPA 1SLJA 4MNOA 3FKIH 4AH6A 4A3JG 1N36L 2ES2A 4NPSA 5LMNL 2R93H 2K14A 1QUQA 1W2BA 4LF6L 4DUYQ 1VQ5A 2NVXH 2JA7H 3RNUA 4DPGA 3FP9A 4JYAL 4LF4Q 1I94L 1PH9A 2N8NA 3OTOQ 5DLQE 3K0XA 2GVBA 1FL0A 1X55A 4BY1H 1SR3A 3LGJA 5C44H 4DUZL 1XPOA 1NE3A 3T1YQ 4OX9L 1I6HH 4JI4Q 2JA8H 4KHPL 5JJKA 4LUOA 3K81C 4FDBA 4JI2Q 3UDXA 4DR4Q 4RG1A 5C3EH 1XTDA 1C7YA 1WCMH 1PH2A 2Q2UA 3JAMi 4IJLA 2DUDA 1P16A 5HGQA 5IYCH 4LFAL 2IY5B 1HZAA 1VQCA 1A8VA 4R4CA 4YHHQ 1IBKQ 2GVAA 4Y52H 1TWAH 2ZTCA 4LUZA 3ER0A 4GOPC 1EQQA 2F52A 2A8VA 1UEBA 3CCQA 4A3BH 2JK8A 3GTPH 2VQFL 1JT8A 1NMFA 1AH9A 4JI7L 3CCUA 1QZHA 1DGSA 4A4IA 3RZDH 4C3IH 1N33L 1X54A 4MZ9A 3W1BA 3F2BA 1Q46A 1X65A 4A3EH 2E2HH 3BZCA 2I5LX 1S40A 3HOZH 4HJAA 1GM5A 4YCVA 5M3MH 2VZAA 1TWHH 4LFCL 3M7NA 1Q82C 3GTQH 4OWXB 2R92G 4B3SL 4LF8L 5GAHC 4LF4L 2BH8A 1CSQA 1Y1VH 1FVIA 3OTOL 3KF6B 3T1HQ 1IBLL 1OXSC 4LF7Q 1XNRQ 3PUYA 4BXXG 4OONA 1I50H 3S1QH 1XMQL 1Z47A 1N32Q 5K36G 4JI5L 4JI1L 3M85A 4IOAA 3KYHC 4IFDJ 1K8AC 1QVCA 4A3MH 2E5LL 3OW2A 4DAMA 1LTLA 4UP7A 5IT9c 5M5WH 4LW1A 4GOPA 1HNZQ 1HZ9A 2Q2TA 4NXNQ 1KQSA 1CKOA 1XPRA 1BKBA 1XMOL 4DV4Q 3I56A 4YY3Q 1IBKL 1JMCA 3CCVA 2EXDA 4IO9A 3ERSX 3CC7A 2K50A 1IXRA 4BBRH 4C2MH 3PO2H 4K0KQ 5JJLA 2MNAA 4QY7A 4A3JH 3PV0A 2XTIA 2QA4A 1M90C 2KCTA 4UP9A 4LFBL 3ULJA 2VQEQ 2K52A 4DR2Q 4OWWB 2N3SA 1E1OA 1HNXL 1VQ8A 1PH8A 3H3VH 3D0FA 3RN5A 1IYJB 2JEAI 1JJ2A 1VQEA 2BA1A 2R6GA 1Z9FA 1BBUA 2KENA 4GKJQ 3M4PA 3PUWA 2BA0A 4X65L 2UU9L 3L2PA 3NEMA 3H0GG 4ALPA 3GD7A 2KBNA 1XNQL 1VQKA 4JBWA 4AQYL 2E8GA 3GTJH 2EQSA 4IFDG 4PZ8A 3CC2A 2NN6I 2A19A 1T9HA 2YV5A 3HOXH 1OXUA 1L0WA 5BR8L 4EX5A 1CKMA 1YHQA 3I7FA 5C4XG 2IX1A 3STBC 2F4VQ 2HT1A 3B6YA 2VNUD 2LXJA 1S3OA 1VCIA 4JBKA 1I5FA 4DV5L 4POGA 4IPHA 4JI8L 4HIMA 2K5VA 4BA1I 1HR0Q 4JI6Q 1MJCA 4DV2Q 4JBJA 2ZTDA 1UE1A 2VQEL 2WB1G 4B3RQ 5JEAJ 2JA6H 2E2IH 1GO3E 2ID0A 2I0QA 2IT1A 4GLAC 2I5MX 2UUBL 1U5KA 2HHHL 1SROA 2CKZB 2CQOA 2RF4A 3RN2A 2ALYB 1OXVA 4GN3B 2UXCQ 3G4SA 3M4OH 4B3TQ 3GTGH 2VL6A 1QUQB 1PFSA 1WI5A 4O2DA 1YITA 3U4ZA 2ZM6L 1X56A 1PH1A 2OTLA 4LF5L 3PUXA 4DR7Q 4JBMA 3W5OA 5LMNW 4IPGA 2D0PA 3CCRA 1V9PA 1Q1BA 3IRBA 3U4VA 1U0LA 3L0OA 4DR1L 5IWAL 2NZHA 3PCOB 3GO5A 3J81i 2D0OA 4IOCA 2AMCB 4A3KG 1VQPA 4H02A 2WAQG 2ZJRA 4OO1I 1VQHA 3E9HA 3M9BA 4JOIC 5ELOA 3VDYA 4PZ6A 3S17H 1BVSA 1WJJA 4UP8A 5AJ3Q 1VQMA 2DGYA 3HOYH 2UUCQ 2JJQA 3UE1A 3RLFA 3J80c 3CD6A 3ICEA 4DV1Q 3J7A5 1VQBA 4DR3Q 1UE7A 3PIOA 4JI6L 1A0IA 2ZTEA 1VQ9A 5LMUQ 4HJ9A 2B29A 1KD1C 2IHEA 3BZKA 2C35B 1GVPA 1VQJA 1CKNB 4QIWE 4DV6Q 1J5EL 4DR6L 4B3MQ 1JB7A 2ASBA 4GS3A 1YBYA 3DM3A 5JEAG 2ZJPA 1ASYA 1GD7A 4KHZA 1VS0A 4JI3L 1N34Q 1VQOA 1JJGA 1EIFA 2Y0SE 1YI2A 4KLKA 4R1JA 5J3BA 5IYDG 2CWPA
chains in the Genus database with same CATH superfamily
1J8IA 3OW7A 4KI0A 4IFDH 3M3YH 1DJRD 4IUUA 3CC4A 1K73C 4YWMA 4DV7Q 1SBBB 1U9RA 3CMEA 1SE3A 4JI0Q 4GNXB 4EGVA 3HRZC 4I65A 1EZ6A 2TSSA 1L2FA 3MEFA 4LUVA 2JA5B 3I4NB 1GUOA 4DXFA 3G6JB 2MO1A 3T1YL 1YNJC 4Q0FA 1QNKA 1JORA 3S1MH 4ODGA 4JI2L 5JPMC 1KL9A 3HG9A 4DR4L 4LWCA 2IX0A 1J6QA 1GUTA 2A6EC 4GLXA 1EQVA 2H5XA 5EGTA 2AUJD 1RL2A 3SK4A 3G6EA 2PZWA 2L55A 4YWKA 1W6JA 4GKKQ 2PW5A 2EYJA 2X69A 5CV5A 4A3KH 2NTTA 1FJGQ 1SRUA 3KLRA 4FXGC 4DXGA 2RSNA 3CW2C 1S5BD 2K5HA 3E5SA 3PQIA 1D5ZC 4LK1C 1EIYB 2FFKB 4EQOA 5FLXE 2JEBI 2UUAQ 4BBSG 1SJHD 2NVYH 3J7AV 1KNAA 4MIUA 4C2MB 1GHJA 4YCUA 2FMMA 4K5XA 2Q8TA 3NTKA 4DAYB 5DAUA 1K28A 2Z6KA 2FHTA 4K14A 3TQYA 1HNWQ 2UXDQ 5GROA 4DK6C 1WTOA 1C9OA 1SMXA 3NBHB 5IP7H 2R92H 3MVVA 2F0UA 5CV6A 3A5UA 1AE2A 2IW3A 5LMNQ 2PI2A 1D6EC 3D4RA 3RZOH 1Y1WG 2E74C 5IGDA 3STBD 1PHJA 2MP1A 3KDFA 3MXNA 4GLVB 1PH7A 2B2YA 3GTMH 1FNWA 4OX9Q 5FLMG 1BR9A 3VA5A 3D8GA 1CQFA 2F4VL 1LT4D 1ENCA 4IUPA 5I6YA 4A3LG 3K7AB 2QDLA 1LTAD 2H4OA 5IT9L 1V43A 4A93H 1K8OA 1OXTA 1RCVD 4A76A 4ME3A 2NN6H 5EJWA 1HCZA 3ZJYC 2OCEA 1JE5A 1A3UA 2EY5A 2RDHA 3FDTA 2LXKA 1EUJA 1AZQA 4QQBX 3OWFA 2HCCA 4JG2A 4B3TL 1FD7D 1E22A 3K6OA 3G7LA 1EU3A 1TWFB 5A2QL 2K01A 1EWIA 4WJ3M 1Q8IA 3VR3A 3EROA 3OPOA 3UDFA 2MFIA 2NVXB 2JA5H 4JI1Q 1M1KC 2F0FA 3I4NH 3I8ZA 1FR3A 4PMCA 1Q90A 5C44B 4GOPB 5LL6X 2UUCL 5CMDA 4RMFA 1I6HB 4B9XA 4GNXC 1VQDA 3OMGA 5LMUL 2MGSA 2IWHA 3U58A 2NTSA 4DV6L 3NWTA 1JWSD 4B3ML 2B3GA 4PG3A 5DM63 2L12A 1Y69U 1DD2A 1N34L 3MTSA 4DV4L 2PO4A 3MXUA 2JA6G 2K32A 2VY3A 3G48A 3I73A 1NMGA 3QJYA 2Q8IB 4C3HB 4LJZC 2JSOA 4WFN3 5M5YB 5GAEC 1VQNA 3QWNA 2UXBL 5IE8A 4KKUA 4PQXA 4QGUA 4HJ5A 2PPBC 4FF4A 5FO7B 3S1QB 4GN5A 4IUVA 1S4ZA 1Q1EA 4X66L 5BR8Q 2R93G 2WB1E 1AP0A 1EEID 3BYYB 1LTSD 1TS4A 4BY1G 1JOKA 4JW0A 5ELDA 3NE5B 1F2LA 3PO2B 1AFPA 3A7AB 3J80L 3OYYA 3DEOA 4RGMA 3LX0A 4R4OA 2HHHQ 1DM0B 3I91A 1KDCA 3CKIB 2Q8RE 2D62A 4NW2A 5GADC 1KC8C 1RTNA 4IZ8A 1NJIC 1SNMA 1V1QA 2NWGA 4KKSA 4IN3A 1UAPA 3MXPA 2A69D 2MHVA 5IP9H 1J9OA 1SE8A 3A8IE 4A3EG 3R8BA 3HOZG 3TDQA 1E1TA 3GTJB 1GXDC 5CBEE 1ML0D 1Y1VG 5C0XG 3NTHA 1B44D 5FLXc 1KRTA 5IGCA 3D4DA 1WD1A 3K7AH 3I3CA 1WTPA 4DR6Q 2M00A 1PH4A 1N9WA 5COYA 1K8MA 1BDOA 2EJGC 1Q7YC 1X3EA 4LNQA 1SDFA 1RD9D 5T1GA 4JPBW 3DM1A 4B9WA 2HUGA 4BBRG 1FNUA 5H1SE 3GTGB 1TWFH 4OXPA 2ES2A 1F9PA 5EBDA 4ZUJA 1JOOA 4FNFA 4LF6L 1VQ5A 2NVXH 3LWUA 3WOFA 3FP9A 1ILPA 4G7HC 3PF4A 1X55A 1TKWB 5C44H 1XX8A 4DUZL 1XPOA 4XT3B 3T1YQ 1I6HH 4OHJA 1HTPA 5FO8B 3K81C 4JI2Q 2K28A 4DR4Q 1EY7A 1PH2A 4K2LA 2X6LA 1LTBD 1A2TA 4H13C 1HZAA 2BDOA 4R4CA 1IBKQ 2EY2A 4GOPC 5A2QE 1O7LA 1NMFA 1PDQA 1R4QB 2K5QA 4HMIA 4TKOB 4HJAA 5K5PA 2EPBA 4YCVA 1GM5A 4K2KA 2VZAA 3M7NA 1Q82C 4B3SL 3K0YA 1FVIA 4B08A 1HFNA 2MUYA 4BXXG 4OONA 3S1QH 1XMQL 3M85A 3IKJA 2KQ3A 2RKSA 1YNJD 3FVQA 4F88A 2EYMA 3OMCA 2Q2TA 3ONAB 1XPRA 5D3DA 3FEWX 2WIIB 3I56A 2BDNA 3PO2H 2JYOA 3ITPA 5IGGA 1GUGA 1IKLA 5JJLA 5IGEA 4IQZA 4OIJA 1PFMA 1AN8A 4NP5A 1TIID 2QA4A 2VQEQ 1HNXL 1BF4A 3D0FA 1IYJB 1RKNA 4H0LC 1R9TB 3M4PA 2B39A 3SK8A 2BA0A 2NVQB 2UU9L 5F2DA 4RHSA 5DNFA 4NKLA 1XNQL 1VQKA 4BY7B 1HQRD 2LKVA 3GTJH 4IFDG 3H09A 5I6WA 1OXUA 1SEBD 1CKMA 2EVBA 3I7FA 2AQ3B 3STBC 2F4VQ 2VNUD 2JXMB 3HOUB 1OO9B 4JBKA 2FINB 3BVZA 4IPHA 3E3XA 1DZ1A 1STAA 3FPUB 4JBJA 1MI2A 2JA6H 2I0QA 4DAYA 3PO3B 4K5VA 1SYFA 2CKZB 2CQOA 3RN2A 1Z7TA 3G4SA 1DYQA 5K36H 4B3TQ 3GTGH 4LAAA 1QUQB 3U9OA 1WI5A 1YITA 2ZM6L 3M7GA 2XWJB 3BS1A 5JVG3 5BN5A 4JBMA 2KOLA 3NBHA 1Q1BA 5C4HA 3L0OA 4DR1L 3PCOB 3CHBD 4RAUC 4IOCA 4A3KG 3NHHA 4ZLTF 2WAQG 1VQHA 3KUPA 5ELOA 3VDYA 1YNNC 3MZ5A 2UUCQ 3UE1A 3RLFA 3CD6A 3T56B 3PIOA 3BG3A 4QMGA 5FO9B 1JQYD 3MWYW 5LMUQ 3BZKA 1JOQA 4DV6Q 2Y0SB 4B3MQ 2F0HA 3R2TA 2CQAA 1QILA 4KHZA 3FPPA 1N34Q 3HOWB 4DV4Q 4A3IB 4CBVA 3NELA 2CWPA 2ENBA 1K3RA 2BCOA 4JOIA 1G8ZD 3QOLA 4RKBA 1WD0A 2R7FA 1G6PA 2EYFA 4BA2I 1A63A 2PYKA 1PXUA 4IUTA 4DUYL 1Q81C 2UXBQ 1GJXA 1LO5D 2VUMB 5IP7G 2KA7A 3HOVB 4G4KA 3PMFA 1CHPD 3AB9A 4X66Q 3EN2A 1F2YA 1PA6A 3Q6SA 3HKZE 3CCLA 5CV8A 4DA2A 5CGKA 2CFMA 3H6MA 1I3QB 4ZCKA 2B2TA 4K6DA 1IL2A 3S1RB 1C48A 5FLXL 2V1CC 2KHIA 4QF4A 4R4QA 3PGZA 3FMCA 4JK1C 4DV0Q 4HJ7A 1HTLD 4DAVA 3R3OA 3CPWA 3K8AA 2F0SA 1R9TH 2Z6KC 4A93G 2EDGA 2NN6G 2IX3A 4F87A 3EBEA 2NVQH 3NP8A 3PF5A 1ET9A 1AW7A 1LT5D 3SE0A 1N32L 4BWGB 3S14B 2HD3A 2CWAA 1EY0A 2A69C 2WKCA 3OIQA 4NXNL 1LABA 4R4TA 3H3VC 1VMCA 1GUSA 5I2YA 4HIKA 4ZRZA 3VYUA 2JA5G 4OGQC 1QNUA 3JC66 3I4NG 2Q2IA 3BU2A 2B8FA 2F0DA 1TWCB 4K5WA 4K0KL 4DNRB 2B2YC 1T5XD 2RCFA 1X3GA 3MAQA 2VB2X 1PV4A 3PO3H 3MEHA 5IYCG 1LT6D 4A3CH 5IOCA 3TS0A 2PMZE 3PUZA 2RVLA 2PZUA 4LMQD 3WOEA 2JQOA 3OSOA 4BXXH 1UE5A 4GKJL 1AZPA 4KJNA 2K6AA 4LF6Q 2MQHA 1STGA 2V4DA 3TZDA 3HOXB 2QCPX 4DUZQ 2I46A 4O1NA 3S2DH 1KLUD 2R61A 2N78A 3H91A 1O7ZA 1A62A 1MSGA 2Z9HA 2K75A 3EFXD 3K80C 1S5CD 3I4MB 2QDBA 3SDZA 2L0CA 2E2IB 4RH6A 1K83B 4DV2L 1Y14B 4X62Q 1JR0D 4WJWA 1GUNA 3PUVA 5C0XI 3HOWH 5GAGC 3Q22A 2Z8LA 1EQTA 4A3IH 3CP0A 3CCJA 3DWAA 5JAVA 5ELFA 1F9QA 2L4NA 2UXCL 1EIHA 1W6KA 5CV9A 3UDIA 3GV3A 2JP1A 1JJCB 3FKIB 4OIKA 4L5QA 4B3SQ 4RGNA 4QJFA 2DN8A 4N8FA 4TVAB 2VUMH 2F0IA 4AYBE 4RHRA 4V0BA 3HOVH 1XMQQ 1X6OA 1YIJA 1ZXTA 4WORA 1YNXA 3K5OA 4QUCA 3V2TA 3DXJC 4DV1L 2JA8B 1KXLA 5DEHA 5IP9G 1SYBA 4CDFC 5C3EB 3H3VI 1I3QH 1WCMB 2WFWA 4DR5Q 4EQPA 1CKNA 3W2DA 1PFBA 2F0KA 3S1RH 1ONLA 3F1ZA 4YWLA 1TWAB 1RDPD 4OL7A 1VF7A 1SNDA 2NB0A 2F1MA 4UY8C 4XYQA 1EQRA 2KEDA 1HNXQ 3NSWA 1FGBD 4C3IB 3E0EA 1O78A 2ICIA 2JA9A 4KD3A 3GTQB 2A6HC 4X3UA 4X64L 4NXML 2UU9Q 1RHPA 1ESFA 4HN7A 4GN4B 3FHWA 1XNQQ 2B63B 2R7ZB 3BYTB 4ID6A 3S14H 1U4LA 1ZEQX 1O7IA 5DM73 1JC7A 1SNCA 3DUZA 5G3LF 1EOVA 1ET6A 1JICA 1A3TA 2ZXOA 2RHQB 4A3FB 1PYBA 1W3SA 2Z1CA 4DF7A 1HJPA 1B70B 1TWCH 4PMWA 1JWMD 3CF5A 2HQEA 1SNPA 5C44G 5TSSA 4LF9L 4JV5L 1A3VA 4A3JB 1TS2A 4QB4A 3A74A 1E24A 1XJVA 3U50C 4BS9A 1LYLA 4P2CB 4HJ8A 2ZM6Q 3TEHB 2WAQE 4UHVA 2EYLA 3I72A 2ZXRA 4DR1Q 2I07B 3LNNA 2Q2HA 1NNXA 1YJNA 3S24A 1OTCA 1PMRA 2HDLA 1AEXA 4C3HG 4L5RC 5HURA 2RHSB 3T53B 1EYGA 2XGTA 2O5JC 3CCMA 4HIDA 2OQ0A 4FXDA 3I4MH 4KHPQ 4IFDI 1K83H 3I2ZA 1IBML 1HR0W 1WTXA 1QVGA 3QOJA 1NBWA 2F03A 4P75A 1FGUA 1LUZA 3AMUA 3NUCA 5ELNA 1WTRA 3DWQA 3PO2G 1WTHA 2R7DA 4HR7B 1OXXK 4ZKBB 3FKIH 4AH6A 1QWYA 1QUQA 4U673 4TSSA 5EKKA 1G6ZA 4DUYQ 4LF4Q 1I94L 3OTOQ 1YNND 3K0XA 5DLQE 3LGJA 5EKIA 3S17B 4PV1C 1KTKA 4ZYSA 2JA8H 5JJKA 1H9MA 4LUOA 4FDBA 2F0NA 4FYDA 3UDXA 2RA4A 4RG1A 3P7JA 5C3EH 4Y7NB 1STBA 1WCMH 5CBAE 5ISRA 3KBGA 1STEA 5IYCH 4LFAL 4Y52H 1A8VA 1TWAH 2Z4HA 2ZTCA 4KTAA 4LUZA 2A8VA 1UEBA 3CCQA 1M8AA 3GV6A 1ICFB 5EPLA 1NUCA 3CCUA 1STHA 4C3IH 1X54A 3W1BA 1X65A 1S40A 2I5LX 2DY7A 1VDZA 3GTQH 4OWXB 1I4XA 5C4XB 1IBLL 1ENAA 3OIPA 3TP5A 2L1BA 1SFOB 1N32Q 5K36G 1I4PA 3KYHC 4DNTB 2XVSA 1QVCA 4PMBA 4UP7A 3BDCA 1Z6HA 3TSSA 1HZ9A 4NXNQ 4L8JA 2NVTB 1SJED 2A68D 1D2BA 1I6VC 2XRQD 4IO9A 1EIGA 3CC7A 2C9OA 2K50A 4C2MH 5ELEA 4K0KQ 3OWEB 1SE2A 5E3FA 1H9JA 4QY7A 4A3JH 2XTIA 1D5MC 3K59A 4N8X1 2LS01 5IGBA 4LFBL 3ULJA 3S9WA 4ZK9B 2N3SA 1E1OA 1VQ8A 1EY6A 1JJ2A 2R6GA 4ZAIA 1EYDA 4GKJQ 1LLRD 2K05A 3T4AC 1E2ZA 1U4MA 3NEMA 1JWUD 3GD7A 5CC4A 4K8JA 2EQSA 1B2TA 3CC2A 2NN6I 2A19A 1Y8NB 1T9HA 1L0WA 3RUZA 1SYGA 3DHQA 3L3OC 4CJ0B 3PIP3 3B6YA 1LTGD 1VCIA 2F0GA 3A8KE 4DV5L 2AQ2B 2NYZD 4DV2Q 1ILQA 1F2MA 5JEAJ 3QIAA 1GO3E 2A73B 1WTWA 5C4ZA 1EY4A 1SROA 2CHBD 3J81E 2DJGC 4FVMA 2UXCQ 1HUNA 5KYLA 4EQNA 2EJMA 1PFSA 4O2DA 2OTLA 3U4ZA 1A6XA 1X56A 3PUXA 3W5OA 5CYUA 4KK7A 2D0PA 3NK9A 3CCRA 1S5DD 2QKIC 4L6TB 3CQZB 1GHKA 5IWAL 3J81i 3EVQA 2AMCB 2K33A 4FO2A 2ZJRA 4JOIC 3S17H 4PZ6A 1D5XC 1EL0A 4UP8A 1DXMA 1IL8A 4C3JB 5JPNC 4DV1Q 4H44C 1VQBA 1V1PA 4JI6L 4CGYB 5M3FB 4CKEA 3QO2A 2B29A 1H9KA 1GVPA 1CKNB 2XN9C 3T51B 3WDNA 1JB7A 1NR4A 4CKCA 5G3LD 2ASBA 1TY2A 3DM3A 1ASYA 1PTOB 5E4WC 1F9SA 1JJGA 1EIFA 1PRTF 1G51A 2B2TC 2K04A 1VQ6A 3IFDA 5C3WA 3PO3G 2JA7B 5C4XH 4A3CG 2F3IA 4X64Q 4C3HH 4NXMQ 5I9PA 1SFOH 1F9RA 5M5YH 4DKAC 1IKMA 3AQQA 3RLOA 1KIXA 3HKZB 4XXEA 4P72A 2AWNA 4JI4L 1FYCA 1PVOA 2NVTH 2NZOA 4YIJA 3E9IA 1YHAA 1SAPA 1TT2A 3SGIA 5HY6A 4QUFA 3P20A 1CZWA 3HZXA 4C1NI 4LF9Q 4JV5Q 3Q0AA 4CHTB 1GKHA 3VR4A 3K57A 2D9UA 2EZVA 1EEFD 1QJOA 2Y0SG 5M3MB 3I90A 5C4JB 3HP3A 2WINB 4HEDA 5KYIA 3IAYA 1B4OA 3P75A 4L5SA 3SR1A 4HIOA 3HOWG 1E3PA 2A6HD 2F0QA 3GTKB 4A3IG 2K5DA 3MA2B 2QEXA 3KF6A 1Q12A 1MKHA 2GA4B 3AFPA 3F2DA 2F0WA 5CORA 5IODA 1D8LA 3K5MA 2CH4W 1S72A 3TREA 2FJ2A 5JEAH 2GN5A 2OQKA 4RGOS 2I5HA 4IURA 4L5TA 2VUMG 2OWOA 4YY3L 3HOVG 5IYDH 5D65A 3SK5A 2BH2A 1EYAA 1S5ED 4A3GB 2QILA 1IBMQ 1TWGB 2EYOA 2PMZB 3LWEA 2K03A 1LV9A 1LT3D 1YZ6A 2EIFA 2K5NA 2LSSA 2FXQA 2DNEA 3I4OA 2K5WA 2SNSA 4X3SA 5J22A 4DR2L 3ULPA 4CJ1B 1BBWA 1T5EA 1EY8A 1TS5A 1YEZA 3SEBA 4F8MA 2E76C 4A3DB 1PH5A 4AIMA 5KGUA 2VW9A 1XTCD 1NR2A 4L63B 1SNQA 1X3QA 5J39A 1QE6A 1VQIA 4C3JH 2F0EA 3TZUA 5M3FH 1PH6A 1X3FA 4DAPA 2KCCA 3CPFA 5FJ8H 4LFAQ 1HR0L 1VQGA 5J1ZA 2K4KA 1II3A 2KCMA 2N49A 4DFAA 1PTOH 1BUVT 4P73A 3NWSA 3KBXA 3H15A 2IHFA 4EVOA 4JCVE 2J0TD 4KD4A 5EQ0A 2HIXA 4AYBB 4JVZA 4ZUIA 3J81c 4DR7L 2EXZA 4I7ZC 4IPCA 2P5ZX 4FF2A 2PCFB 4YCWA 1PTOC 1IBLQ 4IJHA 2AKWB 1EFWA 4MTNA 3HOYB 1YJWA 2WP8J 1MSHA 2K7VA 2RSOA 2D2CC 2F3VA 2B8GA 2XWBB 3HOXG 1RJTA 4ZKCB 1HHVA 2ATWA 1CFMA 4OO1H 3G71A 1IYUA 4CKBA 4P74A 2A68C 1LM0A 5IYBH 3GP7A 4H7BA 4LFBQ 3GTPB 4A3BB 3I4MG 5C4JH 2H1EA 3CMAA 1WTVA 1SYDA 3RZDB 2E2HB 4DNIA 1CZGA 4DV3L 3R93A 1VQ7A 3A55A 2R3ZA 2RCNA 1K8GA 3GTKH 2BE5D 2OTJA 1TWHB 3CCEA 1HZCA 2YYZA 4O42A 4MN3A 3KF8A 5ELCA 1QVFA 1I50B 2Z0SA 1K0SA 1PH3A 3FKIG 1BQQT 1Q8KA 1EWCA 1SE4A 4A3MB 4IPDA 4BY7H 3TMEA 1H9SA 1VQLA 1K0RA 1HRJA 1D1KA 3NPPA 3K58A 4DV5Q 4A3GH 5D3IB 1RIPA 3HOUH 2EE1A 3J7YW 4HTHA 1BCPB 1TWGH 1QB5D 2JA8G 3VR2A 2B2WA 3SVMA 1PTOF 5C3EG 2WAQB 1WCMG 3EJIA 1X9NA 3BVGA 5C3XA 1CUKA 1C8CA 3Q23A 1ASZA 3IFTA 1LTID 1MD2D 3CXCA 1L1OA 4A3DH 2ZXPA 2RQXA 4ULLA 2PI2E 1K3BC 1MGSA 1VMPA 3UE0A 5IWAQ 4RCNA 4C3IG 1B3AA 4RWSC 2NVYB 4TQUS 2HDMA 4A75A 3EIVA 3CAMA 3IL8A 2YTVA 5IY0A 1WOCA 1RTOA 1V1PB 2A5HA 2G9DA 1LACA 2WV6D 1DOMA 2NBFA 2B63G 2CW0C 1BBXC 2R7ZG 3NBIA 2F0PA 3Q8DA 3AYHB 1QZGA 1E7ZA 1PYWD 1DONA 3V05A 1I4HA 4KY7A 1KABA 1Y8PB 4A3FG 2R92B 1TQOA 4QL5A 3I55A 1KDBA 5FOBB 3F8TA 3ND8A 3F2CA 1HFGA 5E7NA 3NTIA 4KV6A 4RA8A 4K8IA 1AE3A 3SXHA 3BVMA 3NENA 4Q5VA 3M4OB 1HQMC 1N36L 1SLJA 2KJXA 4A3JG 1D1IA 1CHQD 4NPSA 3RMHA 4HMJA 3D4WA 3OHXC 4DPGA 4JYAL 1UEAB 3JAME 1PH9A 2GVBA 1FL0A 2G9HD 3T16A 2B2VC 2F0VA 5JVH3 4JI4Q 2KUMA 1I4QA 3A56A 3D6CA 2RDFA 1PZJD 1SYEA 3MFGA 1XTDA 1SSOA 1C7YA 4DGZA 2Q2UA 3JAMi 2DUDA 1P16A 5HGQA 1G2SA 3EA6A 2XIWA 1EQQA 3ER0A 3MC0B 1NCVA 4A3BH 3GTPH 5KNDA 2VQFL 1JT8A 1HUMA 1JCKB 4JI7L 1DGSA 4A4IA 3RZDH 5E1FA 1N33L 1GOZA 2E2HH 3H0GB 5ELBA 4DK1A 1E2VA 2KECA 4LFCL 1TWHH 4LF8L 1TU2B 2BH8A 1CSQA 3KF6B 4TRDA 1OXSC 5E4XA 1G2TA 1I50H 1Y8OB 1Z47A 4JI5L 4IOAA 1E2WA 1K8AC 3DWPA 5EPKA 4A3MH 2E5LL 5I4DA 2OT2A 4G57A 4LW1A 1BOSA 2WB1B 1KQSA 1CKOA 3KK7A 1BKBA 1XMOL 2EOTA 4YY3Q 1IBKL 1JMCA 3S15B 3CCVA 2EXDA 2F4IA 1IXRA 1IW7C 3BDOA 2MNAA 1UUPA 2O5IC 4UDUC 1I4RA 5M5XB 2TMPA 4KHVA 4RCOA 4UP9A 2K52A 4XYOA 4DR2Q 4OWWB 1QG7A 2SOBA 1ZKOA 2JEAI 1BCPC 1PRTB 1EOTA 2BA1A 1STYA 4CDCC 5LL6S 4X65L 1TY0A 1SMYD 1STNA 2F0LA 1UNSA 2YU9B 4AQYL 3Q24A 1GUWA 4PZ8A 3CRKC 1ZYRC 3J81L 2EYHA 2YV5A 3HOXH 4KN7C 1X3PA 4EX5A 1YHQA 5C4XG 1IYVA 3BZDB 5AFWA 5C5MA 4JI8L 2L5TA 2Z6BA 2K5VA 3U9SA 1HR0Q 3GTLB 4HSVA 1QCBD 1UE1A 2VQEL 1HPCA 2PQEA 1DCZA 2E2IH 2ID0A 2IT1A 2I5MX 2UUBL 1U5KA 1BNZA 2RF4A 4K6LA 3CU7A 5T1IA 1PFNA 2E2JB 2ALYB 1OXVA 4GN3B 3M4OH 4R8NA 1PH1A 4LF5L 4DR7Q 1B3QA 2DJFC 5LMNW 3S2HB 3KLSX 1U0LA 3M4YA 1C4QA 3GO5A 2D0OA 1I4GA 3M9BA 5I2XA 1BXTA 1BVSA 4WRDA 3VYTA 2JJQA 1UE7A 3L9AX 1A0IA 1VQ9A 4IUQA 2IHEA 1FNVA 4QIWE 1J5EL 1KDAA 3K5LA 3ZYYX 4ABNA 1BCPF 1SYCA 5JEAG 1YBYA 1VS0A 4JI3L 3DMUA 1VQOA 2F0OA 1YI2A 4KLKA 3H94A 4R1JA 5IYDG 3OOCA 2PNRC 3AFQA 1LTRD 3H0GH 1CQVA 2PQAA 4DV3Q 2CVRA 3SHLA 4DU9A 2ZJQA 3ULLA 4PZ7A 4NMZA 4FF3A 1PTOD 4BBSB 4X6AH 3R2IA 4KN4C 2B2VA 3C1EA 3KF8B 3RLNA 2ICEC 3T13A 2BE5C 1CTMA 2X6GA 5M9OA 4CDEC 5EPJA 4DN4M 3CCSA 2B63H 2R7ZH 1HZBA 2IPKD 1H9SB 3TN2A 2QF7A 3JAMc 2EYPA 2VB3X 1NY4A 4FXKC 3S1NB 3S15H 1PLFA 1YJ9A 3TP7A 1PYSB 4A3FH 3W1GA 4OWTB 4C3JG 3TS2A 1F77A 2PNHA 5EKLA 3WWVA 4YHHL 1K9MC 5M5XH 2YTYA 5M3FG 5GQOA 3EQLC 1HH2P 2KHJA 5EAYA 1Y1WB 4O0AA 5FJ8G 1KHIA 3GTOB 3HKSA 1M4VA 1L1OB 4UAIA 3PSIA 4J8QA 3T1HL 4LF7L 1XNRL 3GDEA 3KFUA 1TR5A 2YU9H 2VS1A 4FF1A 1VQAA 4DK3C 1VQFA 4M1UB 2HQLA 1PRTC 2JA7G 2DNCA 2XSCA 2XRSD 4OELB 1HNZL 4XDXA 3KOJA 2QEJC 1O7YA 1YHBA 1HXYD 3HKZG 5BN3A 1EZ8A 1XPUA 3GTLH 1JE4A 2B2UC 3D3RA 3D31A 2AWOA 2L15A 4DV0L 1HA6A 1NAPA 1CI3M 3K7UC 2M2LA 2N55A 2E2JH 5JJIA 4KMUC 4OO1G 2J4XA 1N36Q 1P8LA 1D7QA 3MXGA 3S2HH 3W3AA 5IYBG 2HIVA 5BN4A 4NB3A 3KJPA 5M3MG 2A74C 4PNYA 3S16B 4JYAQ 2CCZA 5C6AA 2OF1A 2O4XA 5C5LA 1B50A 2EJFC 5D14A 1Q3LA 2CW0D 4RFBA 1RF2D 3HGBA 2A1AA 2IL8A 3N6RA 5KNCA 4HCSA 3HEJA 1B8AA 4Y7NH 2JA6B 4XTCS 3M4QA 5IIFA 4M8AA 2ZT9C 4BY7G 4B3RL 4CDDC 3UI2A 3HFZB 4ILWA 5FKAC 3QG1A 3KLSA 4N9TA 5NUCA 2VQFQ 4JI7Q 4A3GG 1Q86C 1N33Q 3HOUG 1QOHA 5LHY1 2Z4IA 3GQBA 1UWVA 3C1FA 1KLGD 4LFCQ 2MPMA 5KIXA 4BBSH 4LF8Q 3A0JA 1CT1D 2KCNA 2OXPA 4X3TA 2R93B 1IHZA 3BJUA 3VYSA 5IT9E 3K5NA 4N9PA 4JI5Q 1YVCA 2LMCB 3RD4A 5L37A 3J81j 1U4RA 3A5ZB 2E5LQ 4BY1B 5AJ3L 4V190 4A3DG 3PIO3 5KRUA 4FP5D 1L0YB 1VF5C 4QCLA 1TXYA 3S1NH 4DR3L 1XMOQ 2O2LD 3BDLA 4X62L 4ZQ3A 2AHOB 4NDXA 4KKTA 1NSNS 1V1OA 1TVXA 1C0AA 2F3WA 1S5FD 2AQ1B 3DEPA 3KLWA 3J7ZC 3N52A 1PZID 2AUKA 1Y1WH 3GTOH 3ERQA 1B9MA 4F7XA 4A3EB 3HOZB 2QGQA 5FLMH 4DV7L 1B1ZA 3QB3A 2B2WC 4JI0L 2YTXA 1NTGA 2HCIA 4GNXA 1VQ4A 4X65Q 1Y1VB 1MJEA 4DK0A 4GZYC 3L7ZC 1CSPA 4A3LH 1PZKD 4UPAA 4AYBG 1B9NA 4AQYQ 2A6ED 3TBIB 1WYDA 5IGFA 1L1OC 1EY9A 3C3LA 2E75C 1SMYC 4DR5L 4U68A 5C0XJ 5M5WB 5JJZA 1ENFA 3DLLA 3VR5A 3J7AF 3HOYG 3PIPA 1KRSA 3VYRA 1IW7D 4JI8Q 1EFID 2MO0A 1WFQA 4BBRB 3RR5A 2MJ8A 3KJOA 4R4IA 1KAWA 2UUBQ 1V8QA 2F0JA 4GKKL 1WTQA 4JC0A 5HGTA 1H95A 3P1HA 1IZ6A 1FJGL 1BCPD 2OEOA 4J15A 4XQJA 2JE6I 4LF5Q 4XT1B 3AEVA 4C1NK 1CM9A 4A3BG 3UDGA 3KDFB 1G291 3MXNB 1U4PA 2EY6A 1A15A 2F0MA 1N8RC 4WJ4A 3S16H 4CJ2C 3J80E 4G7OC 5JOBA 4APVA 3CQZH 5CV4A 1ZYRD 2NUCA 3A54A 2UUAL 1UE6A 1I94Q 4G7ZC 1E0BA 1B7YB 2B2UA 4IALA 4P71A 1SN8A 2WKDA 3J80i 1CK1A 2LFNA 4EQ5A 3VA7A 1J5EQ 2C5CA 4A3MG 1MIUA 1ICWA 4KY5A 2PW7A 3JAML 3TRZA 2UXDL 2KVMA 1HNWL 4JI3Q 2CH4A 4XIGS 2N88A 2PQAB 4IUNA 3A7LA 1G91A 4MNOA 1EU4A 3NXWA 5LMNL 1L0XB 2R93H 2K14A 1W2BA 5CR3A 2JA7H 3I4LA 3RNUA 1DOKA 3S2DB 1H9RA 2N8NA 2E2DC 4BY1H 1SR3A 1NE3A 4OX9L 3I70A 2DY8A 4KHPL 4J1MA 1O80A 2L9HA 2PZTA 4R8IA 4IJLA 3MHBA 2IY5B 1XYIA 1VQCA 4OEMB 4YHHQ 2GVAA 5I9OA 3E0JA 2F52A 2JK8A 1XXGA 4XQQA 1AH9A 1QZHA 4MZ9A 3F2BA 1Q46A 4XQNA 4A3EH 3BZCA 2QW7A 3HOZH 5M3MH 2LY7A 3M3YB 1ESRA 2R92G 5GAHC 4LF4L 4MHEA 3T1HQ 1Y1VH 5C0XH 3OTOL 4LF7Q 1XNRQ 1SNOA 3F2UA 3PUYA 3QR8A 2SDFA 4ME5A 1XWEA 1B53A 2NZ1D 4JI1L 3X3NA 2JN4A 4IFDJ 4KY6A 1TS3A 3OW2A 2SEBD 3X3MA 4MTKA 1LTLA 4DAMA 2G5DA 5IT9c 5M5WH 4GOPA 1EYCA 3C46A 1HNZQ 2XNAC 1HA5A 3S1MB 4E6IA 3FRPB 1DOLA 5CV7A 4X3KA 3ERSX 3E6ZX 4BBRH 1EY5A 4HCEA 2M9VA 3PV0A 4J6HA 4S3SA 1M90C 2KCTA 3HS0C 3ND9A 2RBMA 1KNEA 1PH8A 3H3VH 4C56C 3RN5A 4A3KB 1KAAA 4HSPA 1VQEA 4R9WA 1Z9FA 1BBUA 2KENA 3PUWA 3TP6A 3VR6A 3L2PA 1RODA 2J7ZA 3H0GG 4ALPA 2KBNA 4JBWA 2EY1A 2E8GA 1PRTD 5A35A 5FK9C 1EWHA 3CRLC 5KNBA 5BR8L 1BO0A 2IX1A 1LTTD 2HT1A 2SNMA 4HAEA 1X32A 2LXJA 1S3OA 4Z9CB 1I5FA 4POGA 3A8JE 4HIMA 4BA1I 3D6WA 4JI6Q 1MJCA 1F2ZA 2L11A 2ZTDA 2WB1G 4B3RQ 2IJ0A 1WVLA 4GLAC 3V96A 3AU7A 2HHHL 2VXWA 1MBYA 4RKLA 1CA6A 2VL6A 5EBCA 1MHWC 4RGTA 3MFYA 2D5DA 4IPGA 1V9PA 3SK6A 3IRBA 3U4VA 1R4PB 2F0TA 2NZHA 3RZOB 1A2UA 2KEEA 1VQPA 1SXTA 4H02A 4OO1I 2WACA 3E9HA 1WJJA 1VQMA 5AJ3Q 2RDGA 1CA5A 1JB3A 2DGYA 3C2PA 3HOYH 3GTMB 4QIWB 3J80c 3ICEA 3J7A5 3NQTA 4DR3Q 2BOSA 2KHSA 2ZTEA 3O13A 5KEEA 4HJ9A 1KD1C 3URYA 2C35B 1VQJA 4I7AA 3TP8A 2K1BA 4DR6L 2FMCA 4A93B 4GS3A 2ZJPA 1GD7A 2Y0SE 5J3BA 4POFA 4KJOA 3NQIA
chains in the Genus database with same CATH topology
3AFQA 3H0GH 1G51A 1K3RA 2PQAA 4JOIA 4KI0A 3M3YH 4DV3Q 1VQ6A 2ZJQA 3CC4A 3ULLA 4PZ7A 1K73C 4YWMA 4DV7Q 3PO3G 2R7FA 3CMEA 1G6PA 5C4XH 4JI0Q 2F3IA 4A3CG 4X6AH 4X64Q 4GNXB 4BA2I 4C3HH 4NXMQ 1A63A 3KF8B 4DUYL 1SFOH 1Q81C 2UXBQ 3RLNA 5IP7G 5M5YH 4LUVA 1L2FA 3MEFA 4DKAC 3AQQA 3RLOA 1KIXA 3CCSA 3T1YL 2MO1A 2B63H 1HZBA 2AWNA 4P72A 3EN2A 4X66Q 4JI4L 2R7ZH 1PVOA 2NVTH 2NZOA 3S1MH 3JAMc 3E9IA 4JI2L 1KL9A 1PA6A 1NY4A 4LWCA 1YHAA 1J6QA 2IX0A 3HKZE 3CCLA 3S15H 4DR4L 3SGIA 5HY6A 4GLXA 2CFMA 1YJ9A 2H5XA 1PYSB 4A3FH 3W1GA 4OWTB 1RL2A 3TS2A 2PNHA 3WWVA 1IL2A 4YHHL 4LF9Q 1K9MC 5M5XH 3G6EA 4JV5Q 2YTYA 1GKHA 5M3FG 5GQOA 4YWKA 1HH2P 2KHJA 2KHIA 2V1CC 4GKKQ 5EAYA 4R4QA 3PGZA 2Y0SG 4DV0Q 4HJ7A 4O0AA 4A3KH 1FJGQ 1SRUA 5FJ8G 1KHIA 3CPWA 4A93G 3HKSA 3K8AA 1R9TH 2Z6KC 1L1OB 4L5SA 2NN6G 4HIOA 3HOWG 3PSIA 1E3PA 3EBEA 3CW2C 2NVQH 4A3IG 3T1HL 2QEXA 3KF6A 4LF7L 1XNRL 3GDEA 3PF5A 3KFUA 1Q12A 1MKHA 2YU9H 2VS1A 2K5HA 1N32L 1VQAA 4DK3C 3AFPA 3F2DA 1VQFA 1EIYB 2HQLA 1D8LA 2JEBI 1S72A 2JA7G 2CWAA 2UUAQ 4BBSG 2NVYH 3TREA 1HNZL 2GN5A 2OQKA 4NXNL 3KOJA 2I5HA 4R4TA 4L5TA 4HIKA 2OWOA 2VUMG 1YHBA 4YY3L 4YCUA 3HOVG 5IYDH 2JA5G 2BH2A 3HKZG 3JC66 3I4NG 4DAYB 2Q2IA 3BU2A 1XPUA 3GTLH 1IBMQ 4K0KL 2Z6KA 3D31A 2AWOA 1X3GA 3TQYA 2L15A 4DV0L 1PV4A 1HNWQ 3PO3H 5IYCG 2UXDQ 5GROA 4A3CH 3K7UC 4DK6C 2EIFA 2K5NA 2LSSA 1YZ6A 2E2JH 1C9OA 2FXQA 3TS0A 3I4OA 4DR2L 1SMXA 3ULPA 2PMZE 3NBHB 5IP7H 2R92H 3PUZA 1BBWA 5JJIA 4OO1G 1YEZA 1N36Q 1P8LA 3A5UA 1D7QA 2JQOA 3S2HH 1AE2A 4BXXH 5LMNQ 2PI2A 1UE5A 5IYBG 4GKJL 2HIVA 1PH5A 4NB3A 3RZOH 3KJPA 4POFA 5M3MG 4AIMA 1Y1WG 2VW9A 4LF6Q 2MQHA 4JYAQ 3STBD 2CCZA 1PHJA 3KDFA 1VQIA 4GLVB 1PH7A 4DUZQ 4C3JH 3GTMH 4OX9Q 5FLMG 3S2DH 2N78A 5M3FH 2F4VL 1PH6A 1A62A 1X3FA 2K75A 2A1AA 3K80C 3CPFA 4A3LG 1B8AA 4Y7NH 5FJ8H 4LFAQ 1HR0L 4XTCS 1VQGA 3M4QA 4DV2L 1Y14B 1V43A 3NELA 2K4KA 1OXTA 2KCMA 2N49A 4X62Q 4A76A 4ME3A 3PUVA 4BY7G 4B3RL 5C0XI 3HOWH 3ZJYC 4P73A 5GAGC 2OCEA 1JE5A 3HFZB 2VQFQ 4A3IH 3CP0A 3CCJA 3H15A 2IHFA 4JI7Q 4JCVE 4A3GG 1Q86C 2UXCL 2LXKA 1EUJA 1N33Q 3HOUG 4QQBX 4JG2A 3UDIA 4B3TL 1E22A 2HIXA 1UWVA 4LFCQ 1JJCB 3J81c 4DR7L 4L5QA 1EWIA 4IPCA 4B3SQ 4LF8Q 4BBSH 3A0JA 4QJFA 4YCWA 4WJ3M 1IBLQ 4IJHA 4TVAB 3BJUA 3UDFA 2VUMH 2AKWB 1EFWA 4AYBE 2MFIA 4MTNA 3HOVH 1XMQQ 2JA5H 1X6OA 1YIJA 1YVCA 4JI1Q 1M1KC 1YJWA 4JI5Q 2WP8J 3J81j 3I4NH 1YNXA 3A5ZB 2E5LQ 5AJ3L 4A3DG 4GOPB 2UUCL 4RMFA 4DV1L 1TXYA 3S1NH 1KXLA 4DR3L 4GNXC 1XMOQ 1VQDA 5IP9G 4X62L 3HOXG 5LMUL 2AHOB 3H3VI 1I3QH 2ATWA 2WFWA 4DR5Q 3U58A 4DV6L 1CKNA 4B3ML 2B3GA 3G71A 1C0AA 4PG3A 3S1RH 4P74A 3F1ZA 4YWLA 1LM0A 3KLWA 3J7ZC 5IYBH 1N34L 4LFBQ 4DV4L 1Y1WH 3I4MG 4A93H 2JA6G 5C4JH 4UY8C 3GTOH 3CMAA 1EQRA 1HNXQ 2VY3A 3G48A 3E0EA 1NMGA 4DNIA 1VQ7A 4DV3L 2QGQA 3GTKH 2RCNA 1K8GA 2JA9A 5FLMH 4DV7L 2OTJA 3CCEA 4JI0L 1HZCA 2YTXA 4X64L 1NTGA 4GNXA 4NXML 5GAEC 4X65Q 1VQ4A 2UU9Q 2YYZA 1VQNA 1MJEA 2UXBL 5IE8A 4GN4B 3FHWA 1XNQQ 3L7ZC 4QGUA 4HJ5A 1QVFA 1CSPA 4A3LH 2Z0SA 4UPAA 4AYBG 4AQYQ 3S14H 4GN5A 1PH3A 3FKIG 1O7IA 1Q8KA 1WYDA 1L1OC 1Q1EA 4IPDA 4X66L 5BR8Q 4BY7H 1VQLA 2R93G 1EOVA 1K0RA 5C0XJ 4DR5L 2WB1E 2RHQB 3DLLA 3HOYG 3PIPA 1PYBA 1W3SA 4DV5Q 4A3GH 1KRSA 1HJPA 1B70B 1RIPA 1TWCH 4PMWA 2MO0A 4BY1G 4JI8Q 3HOUH 3CF5A 1WFQA 5C44G 1TWGH 3RR5A 3OYYA 4LF9L 4JV5L 2JA8G 4R4OA 3KJOA 3A74A 1E24A 4R4IA 5C3EG 1KAWA 1XJVA 2UUBQ 1WCMG 2HHHQ 1X9NA 4GKKL 3U50C 1CUKA 1ASZA 4JC0A 2D62A 1H95A 1IZ6A 1FJGL 5GADC 4J15A 1KC8C 1LYLA 2JE6I 2ZM6Q 4HJ8A 4LF5Q 3TEHB 3CXCA 1L1OA 2WAQE 1NJIC 3AEVA 4A3DH 1V1QA 2PI2E 4A3BG 3UDGA 3KDFB 1G291 3MXNB 1N8RC 4DR1Q 3UE0A 5IWAQ 4WJ4A 5IP9H 3S16H 2Q2HA 1SE8A 1YJNA 4APVA 3CQZH 3S24A 4A3EG 4TQUS 1OTCA 3HOZG 1E1TA 4A75A 4L5RC 3EIVA 2RHSB 3CAMA 2YTVA 5IY0A 1WOCA 2UUAL 1UE6A 1EYGA 2XGTA 1I94Q 1Y1VG 5C0XG 3CCMA 4HIDA 1B7YB 2OQ0A 4P71A 5FLXc 1KRTA 2B63G 2R7ZG 1SN8A 3J80i 3I4MH 4EQ5A 4KHPQ 1J5EQ 3K7AH 3Q8DA 3AYHB 4IFDI 1K83H 3I2ZA 1QZGA 1E7ZA 4A3MG 1MIUA 1PH4A 1HR0W 1IBML 4DR6Q 1N9WA 1QVGA 1NBWA 4P75A 3TRZA 2UXDL 1HNWL 1FGUA 1Q7YC 4JI3Q 1X3EA 4A3FG 1LUZA 4LNQA 4QL5A 3I55A 3F8TA 5ELNA 3PF4A 3F2CA 5E7NA 4BBRG 4XIGS 3PO2G 2PQAB 2R7DA 1AE3A 3NENA 1OXXK 5H1SE 1TWFH 4OXPA 1SLJA 4MNOA 3FKIH 4AH6A 4A3JG 1N36L 2ES2A 4NPSA 5LMNL 2R93H 2K14A 1QUQA 1W2BA 4LF6L 4DUYQ 1VQ5A 2NVXH 2JA7H 3RNUA 4DPGA 3FP9A 4JYAL 4LF4Q 1I94L 1PH9A 2N8NA 3OTOQ 5DLQE 3K0XA 2GVBA 1FL0A 1X55A 4BY1H 1SR3A 3LGJA 5C44H 4DUZL 1XPOA 1NE3A 3T1YQ 4OX9L 1I6HH 4JI4Q 2JA8H 4KHPL 5JJKA 4LUOA 3K81C 4FDBA 4JI2Q 3UDXA 4DR4Q 4RG1A 5C3EH 1XTDA 1C7YA 1WCMH 1PH2A 2Q2UA 3JAMi 4IJLA 2DUDA 1P16A 5HGQA 5IYCH 4LFAL 2IY5B 1HZAA 1VQCA 1A8VA 4R4CA 4YHHQ 1IBKQ 2GVAA 4Y52H 1TWAH 2ZTCA 4LUZA 3ER0A 4GOPC 1EQQA 2F52A 2A8VA 1UEBA 3CCQA 4A3BH 2JK8A 3GTPH 2VQFL 1JT8A 1NMFA 1AH9A 4JI7L 3CCUA 1QZHA 1DGSA 4A4IA 3RZDH 4C3IH 1N33L 1X54A 4MZ9A 3W1BA 3F2BA 1Q46A 1X65A 4A3EH 2E2HH 3BZCA 2I5LX 1S40A 3HOZH 4HJAA 1GM5A 4YCVA 5M3MH 2VZAA 1TWHH 4LFCL 3M7NA 1Q82C 3GTQH 4OWXB 2R92G 4B3SL 4LF8L 5GAHC 4LF4L 2BH8A 1CSQA 1Y1VH 1FVIA 3OTOL 3KF6B 3T1HQ 1IBLL 1OXSC 4LF7Q 1XNRQ 3PUYA 4BXXG 4OONA 1I50H 3S1QH 1XMQL 1Z47A 1N32Q 5K36G 4JI5L 4JI1L 3M85A 4IOAA 3KYHC 4IFDJ 1K8AC 1QVCA 4A3MH 2E5LL 3OW2A 4DAMA 1LTLA 4UP7A 5IT9c 5M5WH 4LW1A 4GOPA 1HNZQ 1HZ9A 2Q2TA 4NXNQ 1KQSA 1CKOA 1XPRA 1BKBA 1XMOL 4DV4Q 3I56A 4YY3Q 1IBKL 1JMCA 3CCVA 2EXDA 4IO9A 3ERSX 3CC7A 2K50A 1IXRA 4BBRH 4C2MH 3PO2H 4K0KQ 5JJLA 2MNAA 4QY7A 4A3JH 3PV0A 2XTIA 2QA4A 1M90C 2KCTA 4UP9A 4LFBL 3ULJA 2VQEQ 2K52A 4DR2Q 4OWWB 2N3SA 1E1OA 1HNXL 1VQ8A 1PH8A 3H3VH 3D0FA 3RN5A 1IYJB 2JEAI 1JJ2A 1VQEA 2BA1A 2R6GA 1Z9FA 1BBUA 2KENA 4GKJQ 3M4PA 3PUWA 2BA0A 4X65L 2UU9L 3L2PA 3NEMA 3H0GG 4ALPA 3GD7A 2KBNA 1XNQL 1VQKA 4JBWA 4AQYL 2E8GA 3GTJH 2EQSA 4IFDG 4PZ8A 3CC2A 2NN6I 2A19A 1T9HA 2YV5A 3HOXH 1OXUA 1L0WA 5BR8L 4EX5A 1CKMA 1YHQA 3I7FA 5C4XG 2IX1A 3STBC 2F4VQ 2HT1A 3B6YA 2VNUD 2LXJA 1S3OA 1VCIA 4JBKA 1I5FA 4DV5L 4POGA 4IPHA 4JI8L 4HIMA 2K5VA 4BA1I 1HR0Q 4JI6Q 1MJCA 4DV2Q 4JBJA 2ZTDA 1UE1A 2VQEL 2WB1G 4B3RQ 5JEAJ 2JA6H 2E2IH 1GO3E 2ID0A 2I0QA 2IT1A 4GLAC 2I5MX 2UUBL 1U5KA 2HHHL 1SROA 2CKZB 2CQOA 2RF4A 3RN2A 2ALYB 1OXVA 4GN3B 2UXCQ 3G4SA 3M4OH 4B3TQ 3GTGH 2VL6A 1QUQB 1PFSA 1WI5A 4O2DA 1YITA 3U4ZA 2ZM6L 1X56A 1PH1A 2OTLA 4LF5L 3PUXA 4DR7Q 4JBMA 3W5OA 5LMNW 4IPGA 2D0PA 3CCRA 1V9PA 1Q1BA 3IRBA 3U4VA 1U0LA 3L0OA 4DR1L 5IWAL 2NZHA 3PCOB 3GO5A 3J81i 2D0OA 4IOCA 2AMCB 4A3KG 1VQPA 4H02A 2WAQG 2ZJRA 4OO1I 1VQHA 3E9HA 3M9BA 4JOIC 5ELOA 3VDYA 4PZ6A 3S17H 1BVSA 1WJJA 4UP8A 5AJ3Q 1VQMA 2DGYA 3HOYH 2UUCQ 2JJQA 3UE1A 3RLFA 3J80c 3CD6A 3ICEA 4DV1Q 3J7A5 1VQBA 4DR3Q 1UE7A 3PIOA 4JI6L 1A0IA 2ZTEA 1VQ9A 5LMUQ 4HJ9A 2B29A 1KD1C 2IHEA 3BZKA 2C35B 1GVPA 1VQJA 1CKNB 4QIWE 4DV6Q 1J5EL 4DR6L 4B3MQ 1JB7A 2ASBA 4GS3A 1YBYA 3DM3A 5JEAG 2ZJPA 1ASYA 1GD7A 4KHZA 1VS0A 4JI3L 1N34Q 1VQOA 1JJGA 1EIFA 2Y0SE 1YI2A 4KLKA 4R1JA 5J3BA 5IYDG 2CWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AFQ A;  3H0G H;  1G51 A;  1K3R A;  2PQA A;  4JOI A;  4KI0 A;  3M3Y H;  4DV3 Q;  1VQ6 A;  2ZJQ A;  3CC4 A;  3ULL A;  4PZ7 A;  1K73 C;  4YWM A;  4DV7 Q;  3PO3 G;  2R7F A;  3CME A;  1G6P A;  5C4X H;  4JI0 Q;  2F3I A;  4A3C G;  4X6A H;  4X64 Q;  4GNX B;  4BA2 I;  4C3H H;  4NXM Q;  1A63 A;  3KF8 B;  4DUY L;  1SFO H;  1Q81 C;  2UXB Q;  3RLN A;  5IP7 G;  5M5Y H;  4LUV A;  1L2F A;  3MEF A;  4DKA C;  3AQQ A;  3RLO A;  1KIX A;  3CCS A;  3T1Y L;  2MO1 A;  2B63 H;  1HZB A;  2AWN A;  4P72 A;  3EN2 A;  4X66 Q;  4JI4 L;  2R7Z H;  1PVO A;  2NVT H;  2NZO A;  3S1M H;  3JAM c;  3E9I A;  4JI2 L;  1KL9 A;  1PA6 A;  1NY4 A;  4LWC A;  1YHA A;  1J6Q A;  2IX0 A;  3HKZ E;  3CCL A;  3S15 H;  4DR4 L;  3SGI A;  5HY6 A;  4GLX A;  2CFM A;  1YJ9 A;  2H5X A;  1PYS B;  4A3F H;  3W1G A;  4OWT B;  1RL2 A;  3TS2 A;  2PNH A;  3WWV A;  1IL2 A;  4YHH L;  4LF9 Q;  1K9M C;  5M5X H;  3G6E A;  4JV5 Q;  2YTY A;  1GKH A;  5M3F G;  5GQO A;  4YWK A;  1HH2 P;  2KHJ A;  2KHI A;  2V1C C;  4GKK Q;  5EAY A;  4R4Q A;  3PGZ A;  2Y0S G;  4DV0 Q;  4HJ7 A;  4O0A A;  4A3K H;  1FJG Q;  1SRU A;  5FJ8 G;  1KHI A;  3CPW A;  4A93 G;  3HKS A;  3K8A A;  1R9T H;  2Z6K C;  1L1O B;  4L5S A;  2NN6 G;  4HIO A;  3HOW G;  3PSI A;  1E3P A;  3EBE A;  3CW2 C;  2NVQ H;  4A3I G;  3T1H L;  2QEX A;  3KF6 A;  4LF7 L;  1XNR L;  3GDE A;  3PF5 A;  3KFU A;  1Q12 A;  1MKH A;  2YU9 H;  2VS1 A;  2K5H A;  1N32 L;  1VQA A;  4DK3 C;  3AFP A;  3F2D A;  1VQF A;  1EIY B;  2HQL A;  1D8L A;  2JEB I;  1S72 A;  2JA7 G;  2CWA A;  2UUA Q;  4BBS G;  2NVY H;  3TRE A;  1HNZ L;  2GN5 A;  2OQK A;  4NXN L;  3KOJ A;  2I5H A;  4R4T A;  4L5T A;  4HIK A;  2OWO A;  2VUM G;  1YHB A;  4YY3 L;  4YCU A;  3HOV G;  5IYD H;  2JA5 G;  2BH2 A;  3HKZ G;  3JC6 6;  3I4N G;  4DAY B;  2Q2I A;  3BU2 A;  1XPU A;  3GTL H;  1IBM Q;  4K0K L;  2Z6K A;  3D31 A;  2AWO A;  1X3G A;  3TQY A;  2L15 A;  4DV0 L;  1PV4 A;  1HNW Q;  3PO3 H;  5IYC G;  2UXD Q;  5GRO A;  4A3C H;  3K7U C;  4DK6 C;  2EIF A;  2K5N A;  2LSS A;  1YZ6 A;  2E2J H;  1C9O A;  2FXQ A;  3TS0 A;  3I4O A;  4DR2 L;  1SMX A;  3ULP A;  2PMZ E;  3NBH B;  5IP7 H;  2R92 H;  3PUZ A;  1BBW A;  5JJI A;  4OO1 G;  1YEZ A;  1N36 Q;  1P8L A;  3A5U A;  1D7Q A;  2JQO A;  3S2H H;  1AE2 A;  4BXX H;  5LMN Q;  2PI2 A;  1UE5 A;  5IYB G;  4GKJ L;  2HIV A;  1PH5 A;  4NB3 A;  3RZO H;  3KJP A;  4POF A;  5M3M G;  4AIM A;  1Y1W G;  2VW9 A;  4LF6 Q;  2MQH A;  4JYA Q;  3STB D;  2CCZ A;  1PHJ A;  3KDF A;  1VQI A;  4GLV B;  1PH7 A;  4DUZ Q;  4C3J H;  3GTM H;  4OX9 Q;  5FLM G;  3S2D H;  2N78 A;  5M3F H;  2F4V L;  1PH6 A;  1A62 A;  1X3F A;  2K75 A;  2A1A A;  3K80 C;  3CPF A;  4A3L G;  1B8A A;  4Y7N H;  5FJ8 H;  4LFA Q;  1HR0 L;  4XTC S;  1VQG A;  3M4Q A;  4DV2 L;  1Y14 B;  1V43 A;  3NEL A;  2K4K A;  1OXT A;  2KCM A;  2N49 A;  4X62 Q;  4A76 A;  4ME3 A;  3PUV A;  4BY7 G;  4B3R L;  5C0X I;  3HOW H;  3ZJY C;  4P73 A;  5GAG C;  2OCE A;  1JE5 A;  3HFZ B;  2VQF Q;  4A3I H;  3CP0 A;  3CCJ A;  3H15 A;  2IHF A;  4JI7 Q;  4JCV E;  4A3G G;  1Q86 C;  2UXC L;  2LXK A;  1EUJ A;  1N33 Q;  3HOU G;  4QQB X;  4JG2 A;  3UDI A;  4B3T L;  1E22 A;  2HIX A;  1UWV A;  4LFC Q;  1JJC B;  3J81 c;  4DR7 L;  4L5Q A;  1EWI A;  4IPC A;  4B3S Q;  4LF8 Q;  4BBS H;  3A0J A;  4QJF A;  4YCW A;  4WJ3 M;  1IBL Q;  4IJH A;  4TVA B;  3BJU A;  3UDF A;  2VUM H;  2AKW B;  1EFW A;  4AYB E;  2MFI A;  4MTN A;  3HOV H;  1XMQ Q;  2JA5 H;  1X6O A;  1YIJ A;  1YVC A;  4JI1 Q;  1M1K C;  1YJW A;  4JI5 Q;  2WP8 J;  3J81 j;  3I4N H;  1YNX A;  3A5Z B;  2E5L Q;  5AJ3 L;  4A3D G;  4GOP B;  2UUC L;  4RMF A;  4DV1 L;  1TXY A;  3S1N H;  1KXL A;  4DR3 L;  4GNX C;  1XMO Q;  1VQD A;  5IP9 G;  4X62 L;  3HOX G;  5LMU L;  2AHO B;  3H3V I;  1I3Q H;  2ATW A;  2WFW A;  4DR5 Q;  3U58 A;  4DV6 L;  1CKN A;  4B3M L;  2B3G A;  3G71 A;  1C0A A;  4PG3 A;  3S1R H;  4P74 A;  3F1Z A;  4YWL A;  1LM0 A;  3KLW A;  3J7Z C;  5IYB H;  1N34 L;  4LFB Q;  4DV4 L;  1Y1W H;  3I4M G;  4A93 H;  2JA6 G;  5C4J H;  4UY8 C;  3GTO H;  3CMA A;  1EQR A;  1HNX Q;  2VY3 A;  3G48 A;  3E0E A;  1NMG A;  4DNI A;  1VQ7 A;  4DV3 L;  2QGQ A;  3GTK H;  2RCN A;  1K8G A;  2JA9 A;  5FLM H;  4DV7 L;  2OTJ A;  3CCE A;  4JI0 L;  1HZC A;  2YTX A;  4X64 L;  1NTG A;  4GNX A;  4NXM L;  5GAE C;  4X65 Q;  1VQ4 A;  2UU9 Q;  2YYZ A;  1VQN A;  1MJE A;  2UXB L;  5IE8 A;  4GN4 B;  3FHW A;  1XNQ Q;  3L7Z C;  4QGU A;  4HJ5 A;  1QVF A;  1CSP A;  4A3L H;  2Z0S A;  4UPA A;  4AYB G;  4AQY Q;  3S14 H;  4GN5 A;  1PH3 A;  3FKI G;  1O7I A;  1Q8K A;  1WYD A;  1L1O C;  1Q1E A;  4IPD A;  4X66 L;  5BR8 Q;  4BY7 H;  1VQL A;  2R93 G;  1EOV A;  1K0R A;  5C0X J;  4DR5 L;  2WB1 E;  2RHQ B;  3DLL A;  3HOY G;  3PIP A;  1PYB A;  1W3S A;  4DV5 Q;  4A3G H;  1KRS A;  1HJP A;  1B70 B;  1RIP A;  1TWC H;  4PMW A;  2MO0 A;  4BY1 G;  4JI8 Q;  3HOU H;  3CF5 A;  1WFQ A;  5C44 G;  1TWG H;  3RR5 A;  3OYY A;  4LF9 L;  4JV5 L;  2JA8 G;  4R4O A;  3KJO A;  3A74 A;  1E24 A;  4R4I A;  5C3E G;  1KAW A;  1XJV A;  2UUB Q;  1WCM G;  2HHH Q;  1X9N A;  4GKK L;  3U50 C;  1CUK A;  1ASZ A;  4JC0 A;  2D62 A;  1H95 A;  1IZ6 A;  1FJG L;  5GAD C;  4J15 A;  1KC8 C;  1LYL A;  2JE6 I;  2ZM6 Q;  4HJ8 A;  4LF5 Q;  3TEH B;  3CXC A;  1L1O A;  2WAQ E;  1NJI C;  3AEV A;  4A3D H;  1V1Q A;  2PI2 E;  4A3B G;  3UDG A;  3KDF B;  1G29 1;  3MXN B;  1N8R C;  4DR1 Q;  3UE0 A;  5IWA Q;  4WJ4 A;  5IP9 H;  3S16 H;  2Q2H A;  1SE8 A;  1YJN A;  4APV A;  3CQZ H;  3S24 A;  4A3E G;  4TQU S;  1OTC A;  3HOZ G;  1E1T A;  4A75 A;  4L5R C;  3EIV A;  2RHS B;  3CAM A;  2YTV A;  5IY0 A;  1WOC A;  2UUA L;  1UE6 A;  1EYG A;  2XGT A;  1I94 Q;  1Y1V G;  5C0X G;  3CCM A;  4HID A;  1B7Y B;  2OQ0 A;  4P71 A;  5FLX c;  1KRT A;  2B63 G;  2R7Z G;  1SN8 A;  3J80 i;  3I4M H;  4EQ5 A;  4KHP Q;  1J5E Q;  3K7A H;  3Q8D A;  3AYH B;  4IFD I;  1K83 H;  3I2Z A;  1QZG A;  1E7Z A;  4A3M G;  1MIU A;  1PH4 A;  1HR0 W;  1IBM L;  4DR6 Q;  1N9W A;  1QVG A;  1NBW A;  4P75 A;  3TRZ A;  2UXD L;  1HNW L;  1FGU A;  1Q7Y C;  4JI3 Q;  1X3E A;  4A3F G;  1LUZ A;  4LNQ A;  4QL5 A;  3I55 A;  3F8T A;  5ELN A;  3PF4 A;  3F2C A;  5E7N A;  4BBR G;  4XIG S;  3PO2 G;  2PQA B;  2R7D A;  1AE3 A;  3NEN A;  1OXX K;  5H1S E;  1TWF H;  4OXP A;  1SLJ A;  4MNO A;  3FKI H;  4AH6 A;  4A3J G;  1N36 L;  2ES2 A;  4NPS A;  5LMN L;  2R93 H;  2K14 A;  1QUQ A;  1W2B A;  4LF6 L;  4DUY Q;  1VQ5 A;  2NVX H;  2JA7 H;  3RNU A;  4DPG A;  3FP9 A;  4JYA L;  4LF4 Q;  1I94 L;  1PH9 A;  2N8N A;  3OTO Q;  5DLQ E;  3K0X A;  2GVB A;  1FL0 A;  1X55 A;  4BY1 H;  1SR3 A;  3LGJ A;  5C44 H;  4DUZ L;  1XPO A;  1NE3 A;  3T1Y Q;  4OX9 L;  1I6H H;  4JI4 Q;  2JA8 H;  4KHP L;  5JJK A;  4LUO A;  3K81 C;  4FDB A;  4JI2 Q;  3UDX A;  4DR4 Q;  4RG1 A;  5C3E H;  1XTD A;  1C7Y A;  1WCM H;  1PH2 A;  2Q2U A;  3JAM i;  4IJL A;  2DUD A;  1P16 A;  5HGQ A;  5IYC H;  4LFA L;  2IY5 B;  1HZA A;  1VQC A;  1A8V A;  4R4C A;  4YHH Q;  1IBK Q;  2GVA A;  4Y52 H;  1TWA H;  2ZTC A;  4LUZ A;  3ER0 A;  4GOP C;  1EQQ A;  2F52 A;  2A8V A;  1UEB A;  3CCQ A;  4A3B H;  2JK8 A;  3GTP H;  2VQF L;  1JT8 A;  1NMF A;  1AH9 A;  4JI7 L;  3CCU A;  1QZH A;  1DGS A;  4A4I A;  3RZD H;  4C3I H;  1N33 L;  1X54 A;  4MZ9 A;  3W1B A;  3F2B A;  1Q46 A;  1X65 A;  4A3E H;  2E2H H;  3BZC A;  2I5L X;  1S40 A;  3HOZ H;  4HJA A;  1GM5 A;  4YCV A;  5M3M H;  2VZA A;  1TWH H;  4LFC L;  3M7N A;  1Q82 C;  3GTQ H;  4OWX B;  2R92 G;  4B3S L;  4LF8 L;  5GAH C;  4LF4 L;  2BH8 A;  1CSQ A;  1Y1V H;  1FVI A;  3OTO L;  3KF6 B;  3T1H Q;  1IBL L;  1OXS C;  4LF7 Q;  1XNR Q;  3PUY A;  4BXX G;  4OON A;  1I50 H;  3S1Q H;  1XMQ L;  1Z47 A;  1N32 Q;  5K36 G;  4JI5 L;  4JI1 L;  3M85 A;  4IOA A;  3KYH C;  4IFD J;  1K8A C;  1QVC A;  4A3M H;  2E5L L;  3OW2 A;  4DAM A;  1LTL A;  4UP7 A;  5IT9 c;  5M5W H;  4LW1 A;  4GOP A;  1HNZ Q;  1HZ9 A;  2Q2T A;  4NXN Q;  1KQS A;  1CKO A;  1XPR A;  1BKB A;  1XMO L;  4DV4 Q;  3I56 A;  4YY3 Q;  1IBK L;  1JMC A;  3CCV A;  2EXD A;  4IO9 A;  3ERS X;  3CC7 A;  2K50 A;  1IXR A;  4BBR H;  4C2M H;  3PO2 H;  4K0K Q;  5JJL A;  2MNA A;  4QY7 A;  4A3J H;  3PV0 A;  2XTI A;  2QA4 A;  1M90 C;  2KCT A;  4UP9 A;  4LFB L;  3ULJ A;  2VQE Q;  2K52 A;  4DR2 Q;  4OWW B;  2N3S A;  1E1O A;  1HNX L;  1VQ8 A;  1PH8 A;  3H3V H;  3D0F A;  3RN5 A;  1IYJ B;  2JEA I;  1JJ2 A;  1VQE A;  2BA1 A;  2R6G A;  1Z9F A;  1BBU A;  2KEN A;  4GKJ Q;  3M4P A;  3PUW A;  2BA0 A;  4X65 L;  2UU9 L;  3L2P A;  3NEM A;  3H0G G;  4ALP A;  3GD7 A;  2KBN A;  1XNQ L;  1VQK A;  4JBW A;  4AQY L;  2E8G A;  3GTJ H;  2EQS A;  4IFD G;  4PZ8 A;  3CC2 A;  2NN6 I;  2A19 A;  1T9H A;  2YV5 A;  3HOX H;  1OXU A;  1L0W A;  5BR8 L;  4EX5 A;  1CKM A;  1YHQ A;  3I7F A;  5C4X G;  2IX1 A;  3STB C;  2F4V Q;  2HT1 A;  3B6Y A;  2VNU D;  2LXJ A;  1S3O A;  1VCI A;  4JBK A;  1I5F A;  4DV5 L;  4POG A;  4IPH A;  4JI8 L;  4HIM A;  2K5V A;  4BA1 I;  1HR0 Q;  4JI6 Q;  1MJC A;  4DV2 Q;  4JBJ A;  2ZTD A;  1UE1 A;  2VQE L;  2WB1 G;  4B3R Q;  5JEA J;  2JA6 H;  2E2I H;  1GO3 E;  2ID0 A;  2I0Q A;  2IT1 A;  4GLA C;  2I5M X;  2UUB L;  1U5K A;  2HHH L;  1SRO A;  2CKZ B;  2CQO A;  2RF4 A;  3RN2 A;  2ALY B;  1OXV A;  4GN3 B;  2UXC Q;  3G4S A;  3M4O H;  4B3T Q;  3GTG H;  2VL6 A;  1QUQ B;  1PFS A;  1WI5 A;  4O2D A;  1YIT A;  3U4Z A;  2ZM6 L;  1X56 A;  1PH1 A;  2OTL A;  4LF5 L;  3PUX A;  4DR7 Q;  4JBM A;  3W5O A;  5LMN W;  4IPG A;  2D0P A;  3CCR A;  1V9P A;  1Q1B A;  3IRB A;  3U4V A;  1U0L A;  3L0O A;  4DR1 L;  5IWA L;  2NZH A;  3PCO B;  3GO5 A;  3J81 i;  2D0O A;  4IOC A;  2AMC B;  4A3K G;  1VQP A;  4H02 A;  2WAQ G;  2ZJR A;  4OO1 I;  1VQH A;  3E9H A;  3M9B A;  4JOI C;  5ELO A;  3VDY A;  4PZ6 A;  3S17 H;  1BVS A;  1WJJ A;  4UP8 A;  5AJ3 Q;  1VQM A;  2DGY A;  3HOY H;  2UUC Q;  2JJQ A;  3UE1 A;  3RLF A;  3J80 c;  3CD6 A;  3ICE A;  4DV1 Q;  3J7A 5;  1VQB A;  4DR3 Q;  1UE7 A;  3PIO A;  4JI6 L;  1A0I A;  2ZTE A;  1VQ9 A;  5LMU Q;  4HJ9 A;  2B29 A;  1KD1 C;  2IHE A;  3BZK A;  2C35 B;  1GVP A;  1VQJ A;  1CKN B;  4QIW E;  4DV6 Q;  1J5E L;  4DR6 L;  4B3M Q;  1JB7 A;  2ASB A;  4GS3 A;  1YBY A;  3DM3 A;  5JEA G;  2ZJP A;  1ASY A;  1GD7 A;  4KHZ A;  1VS0 A;  4JI3 L;  1N34 Q;  1VQO A;  1JJG A;  1EIF A;  2Y0S E;  1YI2 A;  4KLK A;  4R1J A;  5J3B A;  5IYD G;  2CWP A; 
#chains in the Genus database with same CATH topology
 1J8I A;  3OW7 A;  4KI0 A;  4IFD H;  3M3Y H;  1DJR D;  4IUU A;  3CC4 A;  1K73 C;  4YWM A;  4DV7 Q;  1SBB B;  1U9R A;  3CME A;  1SE3 A;  4JI0 Q;  4GNX B;  4EGV A;  3HRZ C;  4I65 A;  1EZ6 A;  2TSS A;  1L2F A;  3MEF A;  4LUV A;  2JA5 B;  3I4N B;  1GUO A;  4DXF A;  3G6J B;  2MO1 A;  3T1Y L;  1YNJ C;  4Q0F A;  1QNK A;  1JOR A;  3S1M H;  4ODG A;  4JI2 L;  5JPM C;  1KL9 A;  3HG9 A;  4DR4 L;  4LWC A;  2IX0 A;  1J6Q A;  1GUT A;  2A6E C;  4GLX A;  1EQV A;  2H5X A;  5EGT A;  2AUJ D;  1RL2 A;  3SK4 A;  3G6E A;  2PZW A;  2L55 A;  4YWK A;  1W6J A;  4GKK Q;  2PW5 A;  2EYJ A;  2X69 A;  5CV5 A;  4A3K H;  2NTT A;  1FJG Q;  1SRU A;  3KLR A;  4FXG C;  4DXG A;  2RSN A;  3CW2 C;  1S5B D;  2K5H A;  3E5S A;  3PQI A;  1D5Z C;  4LK1 C;  1EIY B;  2FFK B;  4EQO A;  5FLX E;  2JEB I;  2UUA Q;  4BBS G;  1SJH D;  2NVY H;  3J7A V;  1KNA A;  4MIU A;  4C2M B;  1GHJ A;  4YCU A;  2FMM A;  4K5X A;  2Q8T A;  3NTK A;  4DAY B;  5DAU A;  1K28 A;  2Z6K A;  2FHT A;  4K14 A;  3TQY A;  1HNW Q;  2UXD Q;  5GRO A;  4DK6 C;  1WTO A;  1C9O A;  1SMX A;  3NBH B;  5IP7 H;  2R92 H;  3MVV A;  2F0U A;  5CV6 A;  3A5U A;  1AE2 A;  2IW3 A;  5LMN Q;  2PI2 A;  1D6E C;  3D4R A;  3RZO H;  1Y1W G;  2E74 C;  5IGD A;  3STB D;  1PHJ A;  2MP1 A;  3KDF A;  3MXN A;  4GLV B;  1PH7 A;  2B2Y A;  3GTM H;  1FNW A;  4OX9 Q;  5FLM G;  1BR9 A;  3VA5 A;  3D8G A;  1CQF A;  2F4V L;  1LT4 D;  1ENC A;  4IUP A;  5I6Y A;  4A3L G;  3K7A B;  2QDL A;  1LTA D;  2H4O A;  5IT9 L;  1V43 A;  4A93 H;  1K8O A;  1OXT A;  1RCV D;  4A76 A;  4ME3 A;  2NN6 H;  5EJW A;  1HCZ A;  3ZJY C;  2OCE A;  1JE5 A;  1A3U A;  2EY5 A;  2RDH A;  3FDT A;  2LXK A;  1EUJ A;  1AZQ A;  4QQB X;  3OWF A;  2HCC A;  4JG2 A;  4B3T L;  1FD7 D;  1E22 A;  3K6O A;  3G7L A;  1EU3 A;  1TWF B;  5A2Q L;  2K01 A;  1EWI A;  4WJ3 M;  1Q8I A;  3VR3 A;  3ERO A;  3OPO A;  3UDF A;  2MFI A;  2NVX B;  2JA5 H;  4JI1 Q;  1M1K C;  2F0F A;  3I4N H;  3I8Z A;  1FR3 A;  4PMC A;  1Q90 A;  5C44 B;  4GOP B;  5LL6 X;  2UUC L;  5CMD A;  4RMF A;  1I6H B;  4B9X A;  4GNX C;  1VQD A;  3OMG A;  5LMU L;  2MGS A;  2IWH A;  3U58 A;  2NTS A;  4DV6 L;  3NWT A;  1JWS D;  4B3M L;  2B3G A;  4PG3 A;  5DM6 3;  2L12 A;  1Y69 U;  1DD2 A;  1N34 L;  3MTS A;  4DV4 L;  2PO4 A;  3MXU A;  2JA6 G;  2K32 A;  2VY3 A;  3G48 A;  3I73 A;  1NMG A;  3QJY A;  2Q8I B;  4C3H B;  4LJZ C;  2JSO A;  4WFN 3;  5M5Y B;  5GAE C;  1VQN A;  3QWN A;  2UXB L;  5IE8 A;  4KKU A;  4PQX A;  4QGU A;  4HJ5 A;  2PPB C;  4FF4 A;  5FO7 B;  3S1Q B;  4GN5 A;  4IUV A;  1S4Z A;  1Q1E A;  4X66 L;  5BR8 Q;  2R93 G;  2WB1 E;  1AP0 A;  1EEI D;  3BYY B;  1LTS D;  1TS4 A;  4BY1 G;  1JOK A;  4JW0 A;  5ELD A;  3NE5 B;  1F2L A;  3PO2 B;  1AFP A;  3A7A B;  3J80 L;  3OYY A;  3DEO A;  4RGM A;  3LX0 A;  4R4O A;  2HHH Q;  1DM0 B;  3I91 A;  1KDC A;  3CKI B;  2Q8R E;  2D62 A;  4NW2 A;  5GAD C;  1KC8 C;  1RTN A;  4IZ8 A;  1NJI C;  1SNM A;  1V1Q A;  2NWG A;  4KKS A;  4IN3 A;  1UAP A;  3MXP A;  2A69 D;  2MHV A;  5IP9 H;  1J9O A;  1SE8 A;  3A8I E;  4A3E G;  3R8B A;  3HOZ G;  3TDQ A;  1E1T A;  3GTJ B;  1GXD C;  5CBE E;  1ML0 D;  1Y1V G;  5C0X G;  3NTH A;  1B44 D;  5FLX c;  1KRT A;  5IGC A;  3D4D A;  1WD1 A;  3K7A H;  3I3C A;  1WTP A;  4DR6 Q;  2M00 A;  1PH4 A;  1N9W A;  5COY A;  1K8M A;  1BDO A;  2EJG C;  1Q7Y C;  1X3E A;  4LNQ A;  1SDF A;  1RD9 D;  5T1G A;  4JPB W;  3DM1 A;  4B9W A;  2HUG A;  4BBR G;  1FNU A;  5H1S E;  3GTG B;  1TWF H;  4OXP A;  2ES2 A;  1F9P A;  5EBD A;  4ZUJ A;  1JOO A;  4FNF A;  4LF6 L;  1VQ5 A;  2NVX H;  3LWU A;  3WOF A;  3FP9 A;  1ILP A;  4G7H C;  3PF4 A;  1X55 A;  1TKW B;  5C44 H;  1XX8 A;  4DUZ L;  1XPO A;  4XT3 B;  3T1Y Q;  1I6H H;  4OHJ A;  1HTP A;  5FO8 B;  3K81 C;  4JI2 Q;  2K28 A;  4DR4 Q;  1EY7 A;  1PH2 A;  4K2L A;  2X6L A;  1LTB D;  1A2T A;  4H13 C;  1HZA A;  2BDO A;  4R4C A;  1IBK Q;  2EY2 A;  4GOP C;  5A2Q E;  1O7L A;  1NMF A;  1PDQ A;  1R4Q B;  2K5Q A;  4HMI A;  4TKO B;  4HJA A;  5K5P A;  2EPB A;  4YCV A;  1GM5 A;  4K2K A;  2VZA A;  3M7N A;  1Q82 C;  4B3S L;  3K0Y A;  1FVI A;  4B08 A;  1HFN A;  2MUY A;  4BXX G;  4OON A;  3S1Q H;  1XMQ L;  3M85 A;  3IKJ A;  2KQ3 A;  2RKS A;  1YNJ D;  3FVQ A;  4F88 A;  2EYM A;  3OMC A;  2Q2T A;  3ONA B;  1XPR A;  5D3D A;  3FEW X;  2WII B;  3I56 A;  2BDN A;  3PO2 H;  2JYO A;  3ITP A;  5IGG A;  1GUG A;  1IKL A;  5JJL A;  5IGE A;  4IQZ A;  4OIJ A;  1PFM A;  1AN8 A;  4NP5 A;  1TII D;  2QA4 A;  2VQE Q;  1HNX L;  1BF4 A;  3D0F A;  1IYJ B;  1RKN A;  4H0L C;  1R9T B;  3M4P A;  2B39 A;  3SK8 A;  2BA0 A;  2NVQ B;  2UU9 L;  5F2D A;  4RHS A;  5DNF A;  4NKL A;  1XNQ L;  1VQK A;  4BY7 B;  1HQR D;  2LKV A;  3GTJ H;  4IFD G;  3H09 A;  5I6W A;  1OXU A;  1SEB D;  1CKM A;  2EVB A;  3I7F A;  2AQ3 B;  3STB C;  2F4V Q;  2VNU D;  2JXM B;  3HOU B;  1OO9 B;  4JBK A;  2FIN B;  3BVZ A;  4IPH A;  3E3X A;  1DZ1 A;  1STA A;  3FPU B;  4JBJ A;  1MI2 A;  2JA6 H;  2I0Q A;  4DAY A;  3PO3 B;  4K5V A;  1SYF A;  2CKZ B;  2CQO A;  3RN2 A;  1Z7T A;  3G4S A;  1DYQ A;  5K36 H;  4B3T Q;  3GTG H;  4LAA A;  1QUQ B;  3U9O A;  1WI5 A;  1YIT A;  2ZM6 L;  3M7G A;  2XWJ B;  3BS1 A;  5JVG 3;  5BN5 A;  4JBM A;  2KOL A;  3NBH A;  1Q1B A;  5C4H A;  3L0O A;  4DR1 L;  3PCO B;  3CHB D;  4RAU C;  4IOC A;  4A3K G;  3NHH A;  4ZLT F;  2WAQ G;  1VQH A;  3KUP A;  5ELO A;  3VDY A;  1YNN C;  3MZ5 A;  2UUC Q;  3UE1 A;  3RLF A;  3CD6 A;  3T56 B;  3PIO A;  3BG3 A;  4QMG A;  5FO9 B;  1JQY D;  3MWY W;  5LMU Q;  3BZK A;  1JOQ A;  4DV6 Q;  2Y0S B;  4B3M Q;  2F0H A;  3R2T A;  2CQA A;  1QIL A;  4KHZ A;  3FPP A;  1N34 Q;  3HOW B;  4DV4 Q;  4A3I B;  4CBV A;  3NEL A;  2CWP A;  2ENB A;  1K3R A;  2BCO A;  4JOI A;  1G8Z D;  3QOL A;  4RKB A;  1WD0 A;  2R7F A;  1G6P A;  2EYF A;  4BA2 I;  1A63 A;  2PYK A;  1PXU A;  4IUT A;  4DUY L;  1Q81 C;  2UXB Q;  1GJX A;  1LO5 D;  2VUM B;  5IP7 G;  2KA7 A;  3HOV B;  4G4K A;  3PMF A;  1CHP D;  3AB9 A;  4X66 Q;  3EN2 A;  1F2Y A;  1PA6 A;  3Q6S A;  3HKZ E;  3CCL A;  5CV8 A;  4DA2 A;  5CGK A;  2CFM A;  3H6M A;  1I3Q B;  4ZCK A;  2B2T A;  4K6D A;  1IL2 A;  3S1R B;  1C48 A;  5FLX L;  2V1C C;  2KHI A;  4QF4 A;  4R4Q A;  3PGZ A;  3FMC A;  4JK1 C;  4DV0 Q;  4HJ7 A;  1HTL D;  4DAV A;  3R3O A;  3CPW A;  3K8A A;  2F0S A;  1R9T H;  2Z6K C;  4A93 G;  2EDG A;  2NN6 G;  2IX3 A;  4F87 A;  3EBE A;  2NVQ H;  3NP8 A;  3PF5 A;  1ET9 A;  1AW7 A;  1LT5 D;  3SE0 A;  1N32 L;  4BWG B;  3S14 B;  2HD3 A;  2CWA A;  1EY0 A;  2A69 C;  2WKC A;  3OIQ A;  4NXN L;  1LAB A;  4R4T A;  3H3V C;  1VMC A;  1GUS A;  5I2Y A;  4HIK A;  4ZRZ A;  3VYU A;  2JA5 G;  4OGQ C;  1QNU A;  3JC6 6;  3I4N G;  2Q2I A;  3BU2 A;  2B8F A;  2F0D A;  1TWC B;  4K5W A;  4K0K L;  4DNR B;  2B2Y C;  1T5X D;  2RCF A;  1X3G A;  3MAQ A;  2VB2 X;  1PV4 A;  3PO3 H;  3MEH A;  5IYC G;  1LT6 D;  4A3C H;  5IOC A;  3TS0 A;  2PMZ E;  3PUZ A;  2RVL A;  2PZU A;  4LMQ D;  3WOE A;  2JQO A;  3OSO A;  4BXX H;  1UE5 A;  4GKJ L;  1AZP A;  4KJN A;  2K6A A;  4LF6 Q;  2MQH A;  1STG A;  2V4D A;  3TZD A;  3HOX B;  2QCP X;  4DUZ Q;  2I46 A;  4O1N A;  3S2D H;  1KLU D;  2R61 A;  2N78 A;  3H91 A;  1O7Z A;  1A62 A;  1MSG A;  2Z9H A;  2K75 A;  3EFX D;  3K80 C;  1S5C D;  3I4M B;  2QDB A;  3SDZ A;  2L0C A;  2E2I B;  4RH6 A;  1K83 B;  4DV2 L;  1Y14 B;  4X62 Q;  1JR0 D;  4WJW A;  1GUN A;  3PUV A;  5C0X I;  3HOW H;  5GAG C;  3Q22 A;  2Z8L A;  1EQT A;  4A3I H;  3CP0 A;  3CCJ A;  3DWA A;  5JAV A;  5ELF A;  1F9Q A;  2L4N A;  2UXC L;  1EIH A;  1W6K A;  5CV9 A;  3UDI A;  3GV3 A;  2JP1 A;  1JJC B;  3FKI B;  4OIK A;  4L5Q A;  4B3S Q;  4RGN A;  4QJF A;  2DN8 A;  4N8F A;  4TVA B;  2VUM H;  2F0I A;  4AYB E;  4RHR A;  4V0B A;  3HOV H;  1XMQ Q;  1X6O A;  1YIJ A;  1ZXT A;  4WOR A;  1YNX A;  3K5O A;  4QUC A;  3V2T A;  3DXJ C;  4DV1 L;  2JA8 B;  1KXL A;  5DEH A;  5IP9 G;  1SYB A;  4CDF C;  5C3E B;  3H3V I;  1I3Q H;  1WCM B;  2WFW A;  4DR5 Q;  4EQP A;  1CKN A;  3W2D A;  1PFB A;  2F0K A;  3S1R H;  1ONL A;  3F1Z A;  4YWL A;  1TWA B;  1RDP D;  4OL7 A;  1VF7 A;  1SND A;  2NB0 A;  2F1M A;  4UY8 C;  4XYQ A;  1EQR A;  2KED A;  1HNX Q;  3NSW A;  1FGB D;  4C3I B;  3E0E A;  1O78 A;  2ICI A;  2JA9 A;  4KD3 A;  3GTQ B;  2A6H C;  4X3U A;  4X64 L;  4NXM L;  2UU9 Q;  1RHP A;  1ESF A;  4HN7 A;  4GN4 B;  3FHW A;  1XNQ Q;  2B63 B;  2R7Z B;  3BYT B;  4ID6 A;  3S14 H;  1U4L A;  1ZEQ X;  1O7I A;  5DM7 3;  1JC7 A;  1SNC A;  3DUZ A;  5G3L F;  1EOV A;  1ET6 A;  1JIC A;  1A3T A;  2ZXO A;  2RHQ B;  4A3F B;  1PYB A;  1W3S A;  2Z1C A;  4DF7 A;  1HJP A;  1B70 B;  1TWC H;  4PMW A;  1JWM D;  3CF5 A;  2HQE A;  1SNP A;  5C44 G;  5TSS A;  4LF9 L;  4JV5 L;  1A3V A;  4A3J B;  1TS2 A;  4QB4 A;  3A74 A;  1E24 A;  1XJV A;  3U50 C;  4BS9 A;  1LYL A;  4P2C B;  4HJ8 A;  2ZM6 Q;  3TEH B;  2WAQ E;  4UHV A;  2EYL A;  3I72 A;  2ZXR A;  4DR1 Q;  2I07 B;  3LNN A;  2Q2H A;  1NNX A;  1YJN A;  3S24 A;  1OTC A;  1PMR A;  2HDL A;  1AEX A;  4C3H G;  4L5R C;  5HUR A;  2RHS B;  3T53 B;  1EYG A;  2XGT A;  2O5J C;  3CCM A;  4HID A;  2OQ0 A;  4FXD A;  3I4M H;  4KHP Q;  4IFD I;  1K83 H;  3I2Z A;  1IBM L;  1HR0 W;  1WTX A;  1QVG A;  3QOJ A;  1NBW A;  2F03 A;  4P75 A;  1FGU A;  1LUZ A;  3AMU A;  3NUC A;  5ELN A;  1WTR A;  3DWQ A;  3PO2 G;  1WTH A;  2R7D A;  4HR7 B;  1OXX K;  4ZKB B;  3FKI H;  4AH6 A;  1QWY A;  1QUQ A;  4U67 3;  4TSS A;  5EKK A;  1G6Z A;  4DUY Q;  4LF4 Q;  1I94 L;  3OTO Q;  1YNN D;  3K0X A;  5DLQ E;  3LGJ A;  5EKI A;  3S17 B;  4PV1 C;  1KTK A;  4ZYS A;  2JA8 H;  5JJK A;  1H9M A;  4LUO A;  4FDB A;  2F0N A;  4FYD A;  3UDX A;  2RA4 A;  4RG1 A;  3P7J A;  5C3E H;  4Y7N B;  1STB A;  1WCM H;  5CBA E;  5ISR A;  3KBG A;  1STE A;  5IYC H;  4LFA L;  4Y52 H;  1A8V A;  1TWA H;  2Z4H A;  2ZTC A;  4KTA A;  4LUZ A;  2A8V A;  1UEB A;  3CCQ A;  1M8A A;  3GV6 A;  1ICF B;  5EPL A;  1NUC A;  3CCU A;  1STH A;  4C3I H;  1X54 A;  3W1B A;  1X65 A;  1S40 A;  2I5L X;  2DY7 A;  1VDZ A;  3GTQ H;  4OWX B;  1I4X A;  5C4X B;  1IBL L;  1ENA A;  3OIP A;  3TP5 A;  2L1B A;  1SFO B;  1N32 Q;  5K36 G;  1I4P A;  3KYH C;  4DNT B;  2XVS A;  1QVC A;  4PMB A;  4UP7 A;  3BDC A;  1Z6H A;  3TSS A;  1HZ9 A;  4NXN Q;  4L8J A;  2NVT B;  1SJE D;  2A68 D;  1D2B A;  1I6V C;  2XRQ D;  4IO9 A;  1EIG A;  3CC7 A;  2C9O A;  2K50 A;  4C2M H;  5ELE A;  4K0K Q;  3OWE B;  1SE2 A;  5E3F A;  1H9J A;  4QY7 A;  4A3J H;  2XTI A;  1D5M C;  3K59 A;  4N8X 1;  2LS0 1;  5IGB A;  4LFB L;  3ULJ A;  3S9W A;  4ZK9 B;  2N3S A;  1E1O A;  1VQ8 A;  1EY6 A;  1JJ2 A;  2R6G A;  4ZAI A;  1EYD A;  4GKJ Q;  1LLR D;  2K05 A;  3T4A C;  1E2Z A;  1U4M A;  3NEM A;  1JWU D;  3GD7 A;  5CC4 A;  4K8J A;  2EQS A;  1B2T A;  3CC2 A;  2NN6 I;  2A19 A;  1Y8N B;  1T9H A;  1L0W A;  3RUZ A;  1SYG A;  3DHQ A;  3L3O C;  4CJ0 B;  3PIP 3;  3B6Y A;  1LTG D;  1VCI A;  2F0G A;  3A8K E;  4DV5 L;  2AQ2 B;  2NYZ D;  4DV2 Q;  1ILQ A;  1F2M A;  5JEA J;  3QIA A;  1GO3 E;  2A73 B;  1WTW A;  5C4Z A;  1EY4 A;  1SRO A;  2CHB D;  3J81 E;  2DJG C;  4FVM A;  2UXC Q;  1HUN A;  5KYL A;  4EQN A;  2EJM A;  1PFS A;  4O2D A;  2OTL A;  3U4Z A;  1A6X A;  1X56 A;  3PUX A;  3W5O A;  5CYU A;  4KK7 A;  2D0P A;  3NK9 A;  3CCR A;  1S5D D;  2QKI C;  4L6T B;  3CQZ B;  1GHK A;  5IWA L;  3J81 i;  3EVQ A;  2AMC B;  2K33 A;  4FO2 A;  2ZJR A;  4JOI C;  3S17 H;  4PZ6 A;  1D5X C;  1EL0 A;  4UP8 A;  1DXM A;  1IL8 A;  4C3J B;  5JPN C;  4DV1 Q;  4H44 C;  1VQB A;  1V1P A;  4JI6 L;  4CGY B;  5M3F B;  4CKE A;  3QO2 A;  2B29 A;  1H9K A;  1GVP A;  1CKN B;  2XN9 C;  3T51 B;  3WDN A;  1JB7 A;  1NR4 A;  4CKC A;  5G3L D;  2ASB A;  1TY2 A;  3DM3 A;  1ASY A;  1PTO B;  5E4W C;  1F9S A;  1JJG A;  1EIF A;  1PRT F;  1G51 A;  2B2T C;  2K04 A;  1VQ6 A;  3IFD A;  5C3W A;  3PO3 G;  2JA7 B;  5C4X H;  4A3C G;  2F3I A;  4X64 Q;  4C3H H;  4NXM Q;  5I9P A;  1SFO H;  1F9R A;  5M5Y H;  4DKA C;  1IKM A;  3AQQ A;  3RLO A;  1KIX A;  3HKZ B;  4XXE A;  4P72 A;  2AWN A;  4JI4 L;  1FYC A;  1PVO A;  2NVT H;  2NZO A;  4YIJ A;  3E9I A;  1YHA A;  1SAP A;  1TT2 A;  3SGI A;  5HY6 A;  4QUF A;  3P20 A;  1CZW A;  3HZX A;  4C1N I;  4LF9 Q;  4JV5 Q;  3Q0A A;  4CHT B;  1GKH A;  3VR4 A;  3K57 A;  2D9U A;  2EZV A;  1EEF D;  1QJO A;  2Y0S G;  5M3M B;  3I90 A;  5C4J B;  3HP3 A;  2WIN B;  4HED A;  5KYI A;  3IAY A;  1B4O A;  3P75 A;  4L5S A;  3SR1 A;  4HIO A;  3HOW G;  1E3P A;  2A6H D;  2F0Q A;  3GTK B;  4A3I G;  2K5D A;  3MA2 B;  2QEX A;  3KF6 A;  1Q12 A;  1MKH A;  2GA4 B;  3AFP A;  3F2D A;  2F0W A;  5COR A;  5IOD A;  1D8L A;  3K5M A;  2CH4 W;  1S72 A;  3TRE A;  2FJ2 A;  5JEA H;  2GN5 A;  2OQK A;  4RGO S;  2I5H A;  4IUR A;  4L5T A;  2VUM G;  2OWO A;  4YY3 L;  3HOV G;  5IYD H;  5D65 A;  3SK5 A;  2BH2 A;  1EYA A;  1S5E D;  4A3G B;  2QIL A;  1IBM Q;  1TWG B;  2EYO A;  2PMZ B;  3LWE A;  2K03 A;  1LV9 A;  1LT3 D;  1YZ6 A;  2EIF A;  2K5N A;  2LSS A;  2FXQ A;  2DNE A;  3I4O A;  2K5W A;  2SNS A;  4X3S A;  5J22 A;  4DR2 L;  3ULP A;  4CJ1 B;  1BBW A;  1T5E A;  1EY8 A;  1TS5 A;  1YEZ A;  3SEB A;  4F8M A;  2E76 C;  4A3D B;  1PH5 A;  4AIM A;  5KGU A;  2VW9 A;  1XTC D;  1NR2 A;  4L63 B;  1SNQ A;  1X3Q A;  5J39 A;  1QE6 A;  1VQI A;  4C3J H;  2F0E A;  3TZU A;  5M3F H;  1PH6 A;  1X3F A;  4DAP A;  2KCC A;  3CPF A;  5FJ8 H;  4LFA Q;  1HR0 L;  1VQG A;  5J1Z A;  2K4K A;  1II3 A;  2KCM A;  2N49 A;  4DFA A;  1PTO H;  1BUV T;  4P73 A;  3NWS A;  3KBX A;  3H15 A;  2IHF A;  4EVO A;  4JCV E;  2J0T D;  4KD4 A;  5EQ0 A;  2HIX A;  4AYB B;  4JVZ A;  4ZUI A;  3J81 c;  4DR7 L;  2EXZ A;  4I7Z C;  4IPC A;  2P5Z X;  4FF2 A;  2PCF B;  4YCW A;  1PTO C;  1IBL Q;  4IJH A;  2AKW B;  1EFW A;  4MTN A;  3HOY B;  1YJW A;  2WP8 J;  1MSH A;  2K7V A;  2RSO A;  2D2C C;  2F3V A;  2B8G A;  2XWB B;  3HOX G;  1RJT A;  4ZKC B;  1HHV A;  2ATW A;  1CFM A;  4OO1 H;  3G71 A;  1IYU A;  4CKB A;  4P74 A;  2A68 C;  1LM0 A;  5IYB H;  3GP7 A;  4H7B A;  4LFB Q;  3GTP B;  4A3B B;  3I4M G;  5C4J H;  2H1E A;  3CMA A;  1WTV A;  1SYD A;  3RZD B;  2E2H B;  4DNI A;  1CZG A;  4DV3 L;  3R93 A;  1VQ7 A;  3A55 A;  2R3Z A;  2RCN A;  1K8G A;  3GTK H;  2BE5 D;  2OTJ A;  1TWH B;  3CCE A;  1HZC A;  2YYZ A;  4O42 A;  4MN3 A;  3KF8 A;  5ELC A;  1QVF A;  1I50 B;  2Z0S A;  1K0S A;  1PH3 A;  3FKI G;  1BQQ T;  1Q8K A;  1EWC A;  1SE4 A;  4A3M B;  4IPD A;  4BY7 H;  3TME A;  1H9S A;  1VQL A;  1K0R A;  1HRJ A;  1D1K A;  3NPP A;  3K58 A;  4DV5 Q;  4A3G H;  5D3I B;  1RIP A;  3HOU H;  2EE1 A;  3J7Y W;  4HTH A;  1BCP B;  1TWG H;  1QB5 D;  2JA8 G;  3VR2 A;  2B2W A;  3SVM A;  1PTO F;  5C3E G;  2WAQ B;  1WCM G;  3EJI A;  1X9N A;  3BVG A;  5C3X A;  1CUK A;  1C8C A;  3Q23 A;  1ASZ A;  3IFT A;  1LTI D;  1MD2 D;  3CXC A;  1L1O A;  4A3D H;  2ZXP A;  2RQX A;  4ULL A;  2PI2 E;  1K3B C;  1MGS A;  1VMP A;  3UE0 A;  5IWA Q;  4RCN A;  4C3I G;  1B3A A;  4RWS C;  2NVY B;  4TQU S;  2HDM A;  4A75 A;  3EIV A;  3CAM A;  3IL8 A;  2YTV A;  5IY0 A;  1WOC A;  1RTO A;  1V1P B;  2A5H A;  2G9D A;  1LAC A;  2WV6 D;  1DOM A;  2NBF A;  2B63 G;  2CW0 C;  1BBX C;  2R7Z G;  3NBI A;  2F0P A;  3Q8D A;  3AYH B;  1QZG A;  1E7Z A;  1PYW D;  1DON A;  3V05 A;  1I4H A;  4KY7 A;  1KAB A;  1Y8P B;  4A3F G;  2R92 B;  1TQO A;  4QL5 A;  3I55 A;  1KDB A;  5FOB B;  3F8T A;  3ND8 A;  3F2C A;  1HFG A;  5E7N A;  3NTI A;  4KV6 A;  4RA8 A;  4K8I A;  1AE3 A;  3SXH A;  3BVM A;  3NEN A;  4Q5V A;  3M4O B;  1HQM C;  1N36 L;  1SLJ A;  2KJX A;  4A3J G;  1D1I A;  1CHQ D;  4NPS A;  3RMH A;  4HMJ A;  3D4W A;  3OHX C;  4DPG A;  4JYA L;  1UEA B;  3JAM E;  1PH9 A;  2GVB A;  1FL0 A;  2G9H D;  3T16 A;  2B2V C;  2F0V A;  5JVH 3;  4JI4 Q;  2KUM A;  1I4Q A;  3A56 A;  3D6C A;  2RDF A;  1PZJ D;  1SYE A;  3MFG A;  1XTD A;  1SSO A;  1C7Y A;  4DGZ A;  2Q2U A;  3JAM i;  2DUD A;  1P16 A;  5HGQ A;  1G2S A;  3EA6 A;  2XIW A;  1EQQ A;  3ER0 A;  3MC0 B;  1NCV A;  4A3B H;  3GTP H;  5KND A;  2VQF L;  1JT8 A;  1HUM A;  1JCK B;  4JI7 L;  1DGS A;  4A4I A;  3RZD H;  5E1F A;  1N33 L;  1GOZ A;  2E2H H;  3H0G B;  5ELB A;  4DK1 A;  1E2V A;  2KEC A;  4LFC L;  1TWH H;  4LF8 L;  1TU2 B;  2BH8 A;  1CSQ A;  3KF6 B;  4TRD A;  1OXS C;  5E4X A;  1G2T A;  1I50 H;  1Y8O B;  1Z47 A;  4JI5 L;  4IOA A;  1E2W A;  1K8A C;  3DWP A;  5EPK A;  4A3M H;  2E5L L;  5I4D A;  2OT2 A;  4G57 A;  4LW1 A;  1BOS A;  2WB1 B;  1KQS A;  1CKO A;  3KK7 A;  1BKB A;  1XMO L;  2EOT A;  4YY3 Q;  1IBK L;  1JMC A;  3S15 B;  3CCV A;  2EXD A;  2F4I A;  1IXR A;  1IW7 C;  3BDO A;  2MNA A;  1UUP A;  2O5I C;  4UDU C;  1I4R A;  5M5X B;  2TMP A;  4KHV A;  4RCO A;  4UP9 A;  2K52 A;  4XYO A;  4DR2 Q;  4OWW B;  1QG7 A;  2SOB A;  1ZKO A;  2JEA I;  1BCP C;  1PRT B;  1EOT A;  2BA1 A;  1STY A;  4CDC C;  5LL6 S;  4X65 L;  1TY0 A;  1SMY D;  1STN A;  2F0L A;  1UNS A;  2YU9 B;  4AQY L;  3Q24 A;  1GUW A;  4PZ8 A;  3CRK C;  1ZYR C;  3J81 L;  2EYH A;  2YV5 A;  3HOX H;  4KN7 C;  1X3P A;  4EX5 A;  1YHQ A;  5C4X G;  1IYV A;  3BZD B;  5AFW A;  5C5M A;  4JI8 L;  2L5T A;  2Z6B A;  2K5V A;  3U9S A;  1HR0 Q;  3GTL B;  4HSV A;  1QCB D;  1UE1 A;  2VQE L;  1HPC A;  2PQE A;  1DCZ A;  2E2I H;  2ID0 A;  2IT1 A;  2I5M X;  2UUB L;  1U5K A;  1BNZ A;  2RF4 A;  4K6L A;  3CU7 A;  5T1I A;  1PFN A;  2E2J B;  2ALY B;  1OXV A;  4GN3 B;  3M4O H;  4R8N A;  1PH1 A;  4LF5 L;  4DR7 Q;  1B3Q A;  2DJF C;  5LMN W;  3S2H B;  3KLS X;  1U0L A;  3M4Y A;  1C4Q A;  3GO5 A;  2D0O A;  1I4G A;  3M9B A;  5I2X A;  1BXT A;  1BVS A;  4WRD A;  3VYT A;  2JJQ A;  1UE7 A;  3L9A X;  1A0I A;  1VQ9 A;  4IUQ A;  2IHE A;  1FNV A;  4QIW E;  1J5E L;  1KDA A;  3K5L A;  3ZYY X;  4ABN A;  1BCP F;  1SYC A;  5JEA G;  1YBY A;  1VS0 A;  4JI3 L;  3DMU A;  1VQO A;  2F0O A;  1YI2 A;  4KLK A;  3H94 A;  4R1J A;  5IYD G;  3OOC A;  2PNR C;  3AFQ A;  1LTR D;  3H0G H;  1CQV A;  2PQA A;  4DV3 Q;  2CVR A;  3SHL A;  4DU9 A;  2ZJQ A;  3ULL A;  4PZ7 A;  4NMZ A;  4FF3 A;  1PTO D;  4BBS B;  4X6A H;  3R2I A;  4KN4 C;  2B2V A;  3C1E A;  3KF8 B;  3RLN A;  2ICE C;  3T13 A;  2BE5 C;  1CTM A;  2X6G A;  5M9O A;  4CDE C;  5EPJ A;  4DN4 M;  3CCS A;  2B63 H;  2R7Z H;  1HZB A;  2IPK D;  1H9S B;  3TN2 A;  2QF7 A;  3JAM c;  2EYP A;  2VB3 X;  1NY4 A;  4FXK C;  3S1N B;  3S15 H;  1PLF A;  1YJ9 A;  3TP7 A;  1PYS B;  4A3F H;  3W1G A;  4OWT B;  4C3J G;  3TS2 A;  1F77 A;  2PNH A;  5EKL A;  3WWV A;  4YHH L;  1K9M C;  5M5X H;  2YTY A;  5M3F G;  5GQO A;  3EQL C;  1HH2 P;  2KHJ A;  5EAY A;  1Y1W B;  4O0A A;  5FJ8 G;  1KHI A;  3GTO B;  3HKS A;  1M4V A;  1L1O B;  4UAI A;  3PSI A;  4J8Q A;  3T1H L;  4LF7 L;  1XNR L;  3GDE A;  3KFU A;  1TR5 A;  2YU9 H;  2VS1 A;  4FF1 A;  1VQA A;  4DK3 C;  1VQF A;  4M1U B;  2HQL A;  1PRT C;  2JA7 G;  2DNC A;  2XSC A;  2XRS D;  4OEL B;  1HNZ L;  4XDX A;  3KOJ A;  2QEJ C;  1O7Y A;  1YHB A;  1HXY D;  3HKZ G;  5BN3 A;  1EZ8 A;  1XPU A;  3GTL H;  1JE4 A;  2B2U C;  3D3R A;  3D31 A;  2AWO A;  2L15 A;  4DV0 L;  1HA6 A;  1NAP A;  1CI3 M;  3K7U C;  2M2L A;  2N55 A;  2E2J H;  5JJI A;  4KMU C;  4OO1 G;  2J4X A;  1N36 Q;  1P8L A;  1D7Q A;  3MXG A;  3S2H H;  3W3A A;  5IYB G;  2HIV A;  5BN4 A;  4NB3 A;  3KJP A;  5M3M G;  2A74 C;  4PNY A;  3S16 B;  4JYA Q;  2CCZ A;  5C6A A;  2OF1 A;  2O4X A;  5C5L A;  1B50 A;  2EJF C;  5D14 A;  1Q3L A;  2CW0 D;  4RFB A;  1RF2 D;  3HGB A;  2A1A A;  2IL8 A;  3N6R A;  5KNC A;  4HCS A;  3HEJ A;  1B8A A;  4Y7N H;  2JA6 B;  4XTC S;  3M4Q A;  5IIF A;  4M8A A;  2ZT9 C;  4BY7 G;  4B3R L;  4CDD C;  3UI2 A;  3HFZ B;  4ILW A;  5FKA C;  3QG1 A;  3KLS A;  4N9T A;  5NUC A;  2VQF Q;  4JI7 Q;  4A3G G;  1Q86 C;  1N33 Q;  3HOU G;  1QOH A;  5LHY 1;  2Z4I A;  3GQB A;  1UWV A;  3C1F A;  1KLG D;  4LFC Q;  2MPM A;  5KIX A;  4BBS H;  4LF8 Q;  3A0J A;  1CT1 D;  2KCN A;  2OXP A;  4X3T A;  2R93 B;  1IHZ A;  3BJU A;  3VYS A;  5IT9 E;  3K5N A;  4N9P A;  4JI5 Q;  1YVC A;  2LMC B;  3RD4 A;  5L37 A;  3J81 j;  1U4R A;  3A5Z B;  2E5L Q;  4BY1 B;  5AJ3 L;  4V19 0;  4A3D G;  3PIO 3;  5KRU A;  4FP5 D;  1L0Y B;  1VF5 C;  4QCL A;  1TXY A;  3S1N H;  4DR3 L;  1XMO Q;  2O2L D;  3BDL A;  4X62 L;  4ZQ3 A;  2AHO B;  4NDX A;  4KKT A;  1NSN S;  1V1O A;  1TVX A;  1C0A A;  2F3W A;  1S5F D;  2AQ1 B;  3DEP A;  3KLW A;  3J7Z C;  3N52 A;  1PZI D;  2AUK A;  1Y1W H;  3GTO H;  3ERQ A;  1B9M A;  4F7X A;  4A3E B;  3HOZ B;  2QGQ A;  5FLM H;  4DV7 L;  1B1Z A;  3QB3 A;  2B2W C;  4JI0 L;  2YTX A;  1NTG A;  2HCI A;  4GNX A;  1VQ4 A;  4X65 Q;  1Y1V B;  1MJE A;  4DK0 A;  4GZY C;  3L7Z C;  1CSP A;  4A3L H;  1PZK D;  4UPA A;  4AYB G;  1B9N A;  4AQY Q;  2A6E D;  3TBI B;  1WYD A;  5IGF A;  1L1O C;  1EY9 A;  3C3L A;  2E75 C;  1SMY C;  4DR5 L;  4U68 A;  5C0X J;  5M5W B;  5JJZ A;  1ENF A;  3DLL A;  3VR5 A;  3J7A F;  3HOY G;  3PIP A;  1KRS A;  3VYR A;  1IW7 D;  4JI8 Q;  1EFI D;  2MO0 A;  1WFQ A;  4BBR B;  3RR5 A;  2MJ8 A;  3KJO A;  4R4I A;  1KAW A;  2UUB Q;  1V8Q A;  2F0J A;  4GKK L;  1WTQ A;  4JC0 A;  5HGT A;  1H95 A;  3P1H A;  1IZ6 A;  1FJG L;  1BCP D;  2OEO A;  4J15 A;  4XQJ A;  2JE6 I;  4LF5 Q;  4XT1 B;  3AEV A;  4C1N K;  1CM9 A;  4A3B G;  3UDG A;  3KDF B;  1G29 1;  3MXN B;  1U4P A;  2EY6 A;  1A15 A;  2F0M A;  1N8R C;  4WJ4 A;  3S16 H;  4CJ2 C;  3J80 E;  4G7O C;  5JOB A;  4APV A;  3CQZ H;  5CV4 A;  1ZYR D;  2NUC A;  3A54 A;  2UUA L;  1UE6 A;  1I94 Q;  4G7Z C;  1E0B A;  1B7Y B;  2B2U A;  4IAL A;  4P71 A;  1SN8 A;  2WKD A;  3J80 i;  1CK1 A;  2LFN A;  4EQ5 A;  3VA7 A;  1J5E Q;  2C5C A;  4A3M G;  1MIU A;  1ICW A;  4KY5 A;  2PW7 A;  3JAM L;  3TRZ A;  2UXD L;  2KVM A;  1HNW L;  4JI3 Q;  2CH4 A;  4XIG S;  2N88 A;  2PQA B;  4IUN A;  3A7L A;  1G91 A;  4MNO A;  1EU4 A;  3NXW A;  5LMN L;  1L0X B;  2R93 H;  2K14 A;  1W2B A;  5CR3 A;  2JA7 H;  3I4L A;  3RNU A;  1DOK A;  3S2D B;  1H9R A;  2N8N A;  2E2D C;  4BY1 H;  1SR3 A;  1NE3 A;  4OX9 L;  3I70 A;  2DY8 A;  4KHP L;  4J1M A;  1O80 A;  2L9H A;  2PZT A;  4R8I A;  4IJL A;  3MHB A;  2IY5 B;  1XYI A;  1VQC A;  4OEM B;  4YHH Q;  2GVA A;  5I9O A;  3E0J A;  2F52 A;  2JK8 A;  1XXG A;  4XQQ A;  1AH9 A;  1QZH A;  4MZ9 A;  3F2B A;  1Q46 A;  4XQN A;  4A3E H;  3BZC A;  2QW7 A;  3HOZ H;  5M3M H;  2LY7 A;  3M3Y B;  1ESR A;  2R92 G;  5GAH C;  4LF4 L;  4MHE A;  3T1H Q;  1Y1V H;  5C0X H;  3OTO L;  4LF7 Q;  1XNR Q;  1SNO A;  3F2U A;  3PUY A;  3QR8 A;  2SDF A;  4ME5 A;  1XWE A;  1B53 A;  2NZ1 D;  4JI1 L;  3X3N A;  2JN4 A;  4IFD J;  4KY6 A;  1TS3 A;  3OW2 A;  2SEB D;  3X3M A;  4MTK A;  1LTL A;  4DAM A;  2G5D A;  5IT9 c;  5M5W H;  4GOP A;  1EYC A;  3C46 A;  1HNZ Q;  2XNA C;  1HA5 A;  3S1M B;  4E6I A;  3FRP B;  1DOL A;  5CV7 A;  4X3K A;  3ERS X;  3E6Z X;  4BBR H;  1EY5 A;  4HCE A;  2M9V A;  3PV0 A;  4J6H A;  4S3S A;  1M90 C;  2KCT A;  3HS0 C;  3ND9 A;  2RBM A;  1KNE A;  1PH8 A;  3H3V H;  4C56 C;  3RN5 A;  4A3K B;  1KAA A;  4HSP A;  1VQE A;  4R9W A;  1Z9F A;  1BBU A;  2KEN A;  3PUW A;  3TP6 A;  3VR6 A;  3L2P A;  1ROD A;  2J7Z A;  3H0G G;  4ALP A;  2KBN A;  4JBW A;  2EY1 A;  2E8G A;  1PRT D;  5A35 A;  5FK9 C;  1EWH A;  3CRL C;  5KNB A;  5BR8 L;  1BO0 A;  2IX1 A;  1LTT D;  2HT1 A;  2SNM A;  4HAE A;  1X32 A;  2LXJ A;  1S3O A;  4Z9C B;  1I5F A;  4POG A;  3A8J E;  4HIM A;  4BA1 I;  3D6W A;  4JI6 Q;  1MJC A;  1F2Z A;  2L11 A;  2ZTD A;  2WB1 G;  4B3R Q;  2IJ0 A;  1WVL A;  4GLA C;  3V96 A;  3AU7 A;  2HHH L;  2VXW A;  1MBY A;  4RKL A;  1CA6 A;  2VL6 A;  5EBC A;  1MHW C;  4RGT A;  3MFY A;  2D5D A;  4IPG A;  1V9P A;  3SK6 A;  3IRB A;  3U4V A;  1R4P B;  2F0T A;  2NZH A;  3RZO B;  1A2U A;  2KEE A;  1VQP A;  1SXT A;  4H02 A;  4OO1 I;  2WAC A;  3E9H A;  1WJJ A;  1VQM A;  5AJ3 Q;  2RDG A;  1CA5 A;  1JB3 A;  2DGY A;  3C2P A;  3HOY H;  3GTM B;  4QIW B;  3J80 c;  3ICE A;  3J7A 5;  3NQT A;  4DR3 Q;  2BOS A;  2KHS A;  2ZTE A;  3O13 A;  5KEE A;  4HJ9 A;  1KD1 C;  3URY A;  2C35 B;  1VQJ A;  4I7A A;  3TP8 A;  2K1B A;  4DR6 L;  2FMC A;  4A93 B;  4GS3 A;  2ZJP A;  1GD7 A;  2Y0S E;  5J3B A;  4POF A;  4KJO A;  3NQI A; 
#chains in the Genus database with same CATH homology
 3AFQ A;  3H0G H;  1G51 A;  1K3R A;  2PQA A;  4JOI A;  4KI0 A;  3M3Y H;  4DV3 Q;  1VQ6 A;  2ZJQ A;  3CC4 A;  3ULL A;  4PZ7 A;  1K73 C;  4YWM A;  4DV7 Q;  3PO3 G;  2R7F A;  3CME A;  1G6P A;  5C4X H;  4JI0 Q;  2F3I A;  4A3C G;  4X6A H;  4X64 Q;  4GNX B;  4BA2 I;  4C3H H;  4NXM Q;  1A63 A;  3KF8 B;  4DUY L;  1SFO H;  1Q81 C;  2UXB Q;  3RLN A;  5IP7 G;  5M5Y H;  4LUV A;  1L2F A;  3MEF A;  4DKA C;  3AQQ A;  3RLO A;  1KIX A;  3CCS A;  3T1Y L;  2MO1 A;  2B63 H;  1HZB A;  2AWN A;  4P72 A;  3EN2 A;  4X66 Q;  4JI4 L;  2R7Z H;  1PVO A;  2NVT H;  2NZO A;  3S1M H;  3JAM c;  3E9I A;  4JI2 L;  1KL9 A;  1PA6 A;  1NY4 A;  4LWC A;  1YHA A;  1J6Q A;  2IX0 A;  3HKZ E;  3CCL A;  3S15 H;  4DR4 L;  3SGI A;  5HY6 A;  4GLX A;  2CFM A;  1YJ9 A;  2H5X A;  1PYS B;  4A3F H;  3W1G A;  4OWT B;  1RL2 A;  3TS2 A;  2PNH A;  3WWV A;  1IL2 A;  4YHH L;  4LF9 Q;  1K9M C;  5M5X H;  3G6E A;  4JV5 Q;  2YTY A;  1GKH A;  5M3F G;  5GQO A;  4YWK A;  1HH2 P;  2KHJ A;  2KHI A;  2V1C C;  4GKK Q;  5EAY A;  4R4Q A;  3PGZ A;  2Y0S G;  4DV0 Q;  4HJ7 A;  4O0A A;  4A3K H;  1FJG Q;  1SRU A;  5FJ8 G;  1KHI A;  3CPW A;  4A93 G;  3HKS A;  3K8A A;  1R9T H;  2Z6K C;  1L1O B;  4L5S A;  2NN6 G;  4HIO A;  3HOW G;  3PSI A;  1E3P A;  3EBE A;  3CW2 C;  2NVQ H;  4A3I G;  3T1H L;  2QEX A;  3KF6 A;  4LF7 L;  1XNR L;  3GDE A;  3PF5 A;  3KFU A;  1Q12 A;  1MKH A;  2YU9 H;  2VS1 A;  2K5H A;  1N32 L;  1VQA A;  4DK3 C;  3AFP A;  3F2D A;  1VQF A;  1EIY B;  2HQL A;  1D8L A;  2JEB I;  1S72 A;  2JA7 G;  2CWA A;  2UUA Q;  4BBS G;  2NVY H;  3TRE A;  1HNZ L;  2GN5 A;  2OQK A;  4NXN L;  3KOJ A;  2I5H A;  4R4T A;  4L5T A;  4HIK A;  2OWO A;  2VUM G;  1YHB A;  4YY3 L;  4YCU A;  3HOV G;  5IYD H;  2JA5 G;  2BH2 A;  3HKZ G;  3JC6 6;  3I4N G;  4DAY B;  2Q2I A;  3BU2 A;  1XPU A;  3GTL H;  1IBM Q;  4K0K L;  2Z6K A;  3D31 A;  2AWO A;  1X3G A;  3TQY A;  2L15 A;  4DV0 L;  1PV4 A;  1HNW Q;  3PO3 H;  5IYC G;  2UXD Q;  5GRO A;  4A3C H;  3K7U C;  4DK6 C;  2EIF A;  2K5N A;  2LSS A;  1YZ6 A;  2E2J H;  1C9O A;  2FXQ A;  3TS0 A;  3I4O A;  4DR2 L;  1SMX A;  3ULP A;  2PMZ E;  3NBH B;  5IP7 H;  2R92 H;  3PUZ A;  1BBW A;  5JJI A;  4OO1 G;  1YEZ A;  1N36 Q;  1P8L A;  3A5U A;  1D7Q A;  2JQO A;  3S2H H;  1AE2 A;  4BXX H;  5LMN Q;  2PI2 A;  1UE5 A;  5IYB G;  4GKJ L;  2HIV A;  1PH5 A;  4NB3 A;  3RZO H;  3KJP A;  4POF A;  5M3M G;  4AIM A;  1Y1W G;  2VW9 A;  4LF6 Q;  2MQH A;  4JYA Q;  3STB D;  2CCZ A;  1PHJ A;  3KDF A;  1VQI A;  4GLV B;  1PH7 A;  4DUZ Q;  4C3J H;  3GTM H;  4OX9 Q;  5FLM G;  3S2D H;  2N78 A;  5M3F H;  2F4V L;  1PH6 A;  1A62 A;  1X3F A;  2K75 A;  2A1A A;  3K80 C;  3CPF A;  4A3L G;  1B8A A;  4Y7N H;  5FJ8 H;  4LFA Q;  1HR0 L;  4XTC S;  1VQG A;  3M4Q A;  4DV2 L;  1Y14 B;  1V43 A;  3NEL A;  2K4K A;  1OXT A;  2KCM A;  2N49 A;  4X62 Q;  4A76 A;  4ME3 A;  3PUV A;  4BY7 G;  4B3R L;  5C0X I;  3HOW H;  3ZJY C;  4P73 A;  5GAG C;  2OCE A;  1JE5 A;  3HFZ B;  2VQF Q;  4A3I H;  3CP0 A;  3CCJ A;  3H15 A;  2IHF A;  4JI7 Q;  4JCV E;  4A3G G;  1Q86 C;  2UXC L;  2LXK A;  1EUJ A;  1N33 Q;  3HOU G;  4QQB X;  4JG2 A;  3UDI A;  4B3T L;  1E22 A;  2HIX A;  1UWV A;  4LFC Q;  1JJC B;  3J81 c;  4DR7 L;  4L5Q A;  1EWI A;  4IPC A;  4B3S Q;  4LF8 Q;  4BBS H;  3A0J A;  4QJF A;  4YCW A;  4WJ3 M;  1IBL Q;  4IJH A;  4TVA B;  3BJU A;  3UDF A;  2VUM H;  2AKW B;  1EFW A;  4AYB E;  2MFI A;  4MTN A;  3HOV H;  1XMQ Q;  2JA5 H;  1X6O A;  1YIJ A;  1YVC A;  4JI1 Q;  1M1K C;  1YJW A;  4JI5 Q;  2WP8 J;  3J81 j;  3I4N H;  1YNX A;  3A5Z B;  2E5L Q;  5AJ3 L;  4A3D G;  4GOP B;  2UUC L;  4RMF A;  4DV1 L;  1TXY A;  3S1N H;  1KXL A;  4DR3 L;  4GNX C;  1XMO Q;  1VQD A;  5IP9 G;  4X62 L;  3HOX G;  5LMU L;  2AHO B;  3H3V I;  1I3Q H;  2ATW A;  2WFW A;  4DR5 Q;  3U58 A;  4DV6 L;  1CKN A;  4B3M L;  2B3G A;  3G71 A;  1C0A A;  4PG3 A;  3S1R H;  4P74 A;  3F1Z A;  4YWL A;  1LM0 A;  3KLW A;  3J7Z C;  5IYB H;  1N34 L;  4LFB Q;  4DV4 L;  1Y1W H;  3I4M G;  4A93 H;  2JA6 G;  5C4J H;  4UY8 C;  3GTO H;  3CMA A;  1EQR A;  1HNX Q;  2VY3 A;  3G48 A;  3E0E A;  1NMG A;  4DNI A;  1VQ7 A;  4DV3 L;  2QGQ A;  3GTK H;  2RCN A;  1K8G A;  2JA9 A;  5FLM H;  4DV7 L;  2OTJ A;  3CCE A;  4JI0 L;  1HZC A;  2YTX A;  4X64 L;  1NTG A;  4GNX A;  4NXM L;  5GAE C;  4X65 Q;  1VQ4 A;  2UU9 Q;  2YYZ A;  1VQN A;  1MJE A;  2UXB L;  5IE8 A;  4GN4 B;  3FHW A;  1XNQ Q;  3L7Z C;  4QGU A;  4HJ5 A;  1QVF A;  1CSP A;  4A3L H;  2Z0S A;  4UPA A;  4AYB G;  4AQY Q;  3S14 H;  4GN5 A;  1PH3 A;  3FKI G;  1O7I A;  1Q8K A;  1WYD A;  1L1O C;  1Q1E A;  4IPD A;  4X66 L;  5BR8 Q;  4BY7 H;  1VQL A;  2R93 G;  1EOV A;  1K0R A;  5C0X J;  4DR5 L;  2WB1 E;  2RHQ B;  3DLL A;  3HOY G;  3PIP A;  1PYB A;  1W3S A;  4DV5 Q;  4A3G H;  1KRS A;  1HJP A;  1B70 B;  1RIP A;  1TWC H;  4PMW A;  2MO0 A;  4BY1 G;  4JI8 Q;  3HOU H;  3CF5 A;  1WFQ A;  5C44 G;  1TWG H;  3RR5 A;  3OYY A;  4LF9 L;  4JV5 L;  2JA8 G;  4R4O A;  3KJO A;  3A74 A;  1E24 A;  4R4I A;  5C3E G;  1KAW A;  1XJV A;  2UUB Q;  1WCM G;  2HHH Q;  1X9N A;  4GKK L;  3U50 C;  1CUK A;  1ASZ A;  4JC0 A;  2D62 A;  1H95 A;  1IZ6 A;  1FJG L;  5GAD C;  4J15 A;  1KC8 C;  1LYL A;  2JE6 I;  2ZM6 Q;  4HJ8 A;  4LF5 Q;  3TEH B;  3CXC A;  1L1O A;  2WAQ E;  1NJI C;  3AEV A;  4A3D H;  1V1Q A;  2PI2 E;  4A3B G;  3UDG A;  3KDF B;  1G29 1;  3MXN B;  1N8R C;  4DR1 Q;  3UE0 A;  5IWA Q;  4WJ4 A;  5IP9 H;  3S16 H;  2Q2H A;  1SE8 A;  1YJN A;  4APV A;  3CQZ H;  3S24 A;  4A3E G;  4TQU S;  1OTC A;  3HOZ G;  1E1T A;  4A75 A;  4L5R C;  3EIV A;  2RHS B;  3CAM A;  2YTV A;  5IY0 A;  1WOC A;  2UUA L;  1UE6 A;  1EYG A;  2XGT A;  1I94 Q;  1Y1V G;  5C0X G;  3CCM A;  4HID A;  1B7Y B;  2OQ0 A;  4P71 A;  5FLX c;  1KRT A;  2B63 G;  2R7Z G;  1SN8 A;  3J80 i;  3I4M H;  4EQ5 A;  4KHP Q;  1J5E Q;  3K7A H;  3Q8D A;  3AYH B;  4IFD I;  1K83 H;  3I2Z A;  1QZG A;  1E7Z A;  4A3M G;  1MIU A;  1PH4 A;  1HR0 W;  1IBM L;  4DR6 Q;  1N9W A;  1QVG A;  1NBW A;  4P75 A;  3TRZ A;  2UXD L;  1HNW L;  1FGU A;  1Q7Y C;  4JI3 Q;  1X3E A;  4A3F G;  1LUZ A;  4LNQ A;  4QL5 A;  3I55 A;  3F8T A;  5ELN A;  3PF4 A;  3F2C A;  5E7N A;  4BBR G;  4XIG S;  3PO2 G;  2PQA B;  2R7D A;  1AE3 A;  3NEN A;  1OXX K;  5H1S E;  1TWF H;  4OXP A;  1SLJ A;  4MNO A;  3FKI H;  4AH6 A;  4A3J G;  1N36 L;  2ES2 A;  4NPS A;  5LMN L;  2R93 H;  2K14 A;  1QUQ A;  1W2B A;  4LF6 L;  4DUY Q;  1VQ5 A;  2NVX H;  2JA7 H;  3RNU A;  4DPG A;  3FP9 A;  4JYA L;  4LF4 Q;  1I94 L;  1PH9 A;  2N8N A;  3OTO Q;  5DLQ E;  3K0X A;  2GVB A;  1FL0 A;  1X55 A;  4BY1 H;  1SR3 A;  3LGJ A;  5C44 H;  4DUZ L;  1XPO A;  1NE3 A;  3T1Y Q;  4OX9 L;  1I6H H;  4JI4 Q;  2JA8 H;  4KHP L;  5JJK A;  4LUO A;  3K81 C;  4FDB A;  4JI2 Q;  3UDX A;  4DR4 Q;  4RG1 A;  5C3E H;  1XTD A;  1C7Y A;  1WCM H;  1PH2 A;  2Q2U A;  3JAM i;  4IJL A;  2DUD A;  1P16 A;  5HGQ A;  5IYC H;  4LFA L;  2IY5 B;  1HZA A;  1VQC A;  1A8V A;  4R4C A;  4YHH Q;  1IBK Q;  2GVA A;  4Y52 H;  1TWA H;  2ZTC A;  4LUZ A;  3ER0 A;  4GOP C;  1EQQ A;  2F52 A;  2A8V A;  1UEB A;  3CCQ A;  4A3B H;  2JK8 A;  3GTP H;  2VQF L;  1JT8 A;  1NMF A;  1AH9 A;  4JI7 L;  3CCU A;  1QZH A;  1DGS A;  4A4I A;  3RZD H;  4C3I H;  1N33 L;  1X54 A;  4MZ9 A;  3W1B A;  3F2B A;  1Q46 A;  1X65 A;  4A3E H;  2E2H H;  3BZC A;  2I5L X;  1S40 A;  3HOZ H;  4HJA A;  1GM5 A;  4YCV A;  5M3M H;  2VZA A;  1TWH H;  4LFC L;  3M7N A;  1Q82 C;  3GTQ H;  4OWX B;  2R92 G;  4B3S L;  4LF8 L;  5GAH C;  4LF4 L;  2BH8 A;  1CSQ A;  1Y1V H;  1FVI A;  3OTO L;  3KF6 B;  3T1H Q;  1IBL L;  1OXS C;  4LF7 Q;  1XNR Q;  3PUY A;  4BXX G;  4OON A;  1I50 H;  3S1Q H;  1XMQ L;  1Z47 A;  1N32 Q;  5K36 G;  4JI5 L;  4JI1 L;  3M85 A;  4IOA A;  3KYH C;  4IFD J;  1K8A C;  1QVC A;  4A3M H;  2E5L L;  3OW2 A;  4DAM A;  1LTL A;  4UP7 A;  5IT9 c;  5M5W H;  4LW1 A;  4GOP A;  1HNZ Q;  1HZ9 A;  2Q2T A;  4NXN Q;  1KQS A;  1CKO A;  1XPR A;  1BKB A;  1XMO L;  4DV4 Q;  3I56 A;  4YY3 Q;  1IBK L;  1JMC A;  3CCV A;  2EXD A;  4IO9 A;  3ERS X;  3CC7 A;  2K50 A;  1IXR A;  4BBR H;  4C2M H;  3PO2 H;  4K0K Q;  5JJL A;  2MNA A;  4QY7 A;  4A3J H;  3PV0 A;  2XTI A;  2QA4 A;  1M90 C;  2KCT A;  4UP9 A;  4LFB L;  3ULJ A;  2VQE Q;  2K52 A;  4DR2 Q;  4OWW B;  2N3S A;  1E1O A;  1HNX L;  1VQ8 A;  1PH8 A;  3H3V H;  3D0F A;  3RN5 A;  1IYJ B;  2JEA I;  1JJ2 A;  1VQE A;  2BA1 A;  2R6G A;  1Z9F A;  1BBU A;  2KEN A;  4GKJ Q;  3M4P A;  3PUW A;  2BA0 A;  4X65 L;  2UU9 L;  3L2P A;  3NEM A;  3H0G G;  4ALP A;  3GD7 A;  2KBN A;  1XNQ L;  1VQK A;  4JBW A;  4AQY L;  2E8G A;  3GTJ H;  2EQS A;  4IFD G;  4PZ8 A;  3CC2 A;  2NN6 I;  2A19 A;  1T9H A;  2YV5 A;  3HOX H;  1OXU A;  1L0W A;  5BR8 L;  4EX5 A;  1CKM A;  1YHQ A;  3I7F A;  5C4X G;  2IX1 A;  3STB C;  2F4V Q;  2HT1 A;  3B6Y A;  2VNU D;  2LXJ A;  1S3O A;  1VCI A;  4JBK A;  1I5F A;  4DV5 L;  4POG A;  4IPH A;  4JI8 L;  4HIM A;  2K5V A;  4BA1 I;  1HR0 Q;  4JI6 Q;  1MJC A;  4DV2 Q;  4JBJ A;  2ZTD A;  1UE1 A;  2VQE L;  2WB1 G;  4B3R Q;  5JEA J;  2JA6 H;  2E2I H;  1GO3 E;  2ID0 A;  2I0Q A;  2IT1 A;  4GLA C;  2I5M X;  2UUB L;  1U5K A;  2HHH L;  1SRO A;  2CKZ B;  2CQO A;  2RF4 A;  3RN2 A;  2ALY B;  1OXV A;  4GN3 B;  2UXC Q;  3G4S A;  3M4O H;  4B3T Q;  3GTG H;  2VL6 A;  1QUQ B;  1PFS A;  1WI5 A;  4O2D A;  1YIT A;  3U4Z A;  2ZM6 L;  1X56 A;  1PH1 A;  2OTL A;  4LF5 L;  3PUX A;  4DR7 Q;  4JBM A;  3W5O A;  5LMN W;  4IPG A;  2D0P A;  3CCR A;  1V9P A;  1Q1B A;  3IRB A;  3U4V A;  1U0L A;  3L0O A;  4DR1 L;  5IWA L;  2NZH A;  3PCO B;  3GO5 A;  3J81 i;  2D0O A;  4IOC A;  2AMC B;  4A3K G;  1VQP A;  4H02 A;  2WAQ G;  2ZJR A;  4OO1 I;  1VQH A;  3E9H A;  3M9B A;  4JOI C;  5ELO A;  3VDY A;  4PZ6 A;  3S17 H;  1BVS A;  1WJJ A;  4UP8 A;  5AJ3 Q;  1VQM A;  2DGY A;  3HOY H;  2UUC Q;  2JJQ A;  3UE1 A;  3RLF A;  3J80 c;  3CD6 A;  3ICE A;  4DV1 Q;  3J7A 5;  1VQB A;  4DR3 Q;  1UE7 A;  3PIO A;  4JI6 L;  1A0I A;  2ZTE A;  1VQ9 A;  5LMU Q;  4HJ9 A;  2B29 A;  1KD1 C;  2IHE A;  3BZK A;  2C35 B;  1GVP A;  1VQJ A;  1CKN B;  4QIW E;  4DV6 Q;  1J5E L;  4DR6 L;  4B3M Q;  1JB7 A;  2ASB A;  4GS3 A;  1YBY A;  3DM3 A;  5JEA G;  2ZJP A;  1ASY A;  1GD7 A;  4KHZ A;  1VS0 A;  4JI3 L;  1N34 Q;  1VQO A;  1JJG A;  1EIF A;  2Y0S E;  1YI2 A;  4KLK A;  4R1J A;  5J3B A;  5IYD G;  2CWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...