1PFMA

Pf4-m2 chimeric mutant with the first 10 n-terminal residues of r-pf4 replaced by the n-terminal residues of the il8 sequence. models 1-15 of a 27-model set.
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
68
structure length
68
Chain Sequence
MSAKELRCQCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PF4-M2 CHIMERA
publication title NMR solution structure of the 32-kDa platelet factor 4 ELR-motif N-terminal chimera: a symmetric tetramer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 9
structure length 68
sequence length 68
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1995-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1pfmA00
1WD0A 1AZQA 1G2TA 2HCCA 4IUUA 5CORA 1WD1A 1HRJA 4RWSC 1NR2A 2HDMA 1C8CA 2NWGA 4X3KA 4IURA 4R8IA 1BF4A 4U68A 2EPBA 2FINB 2K01A 1ESRA 4ZKBB 1IKMA 2EOTA 3KUPA 3FPUB 1IKLA 2L11A 1U4PA 1G91A 3UI2A 1RJTA 4OIKA 3KBXA 2Q8RE 1A15A 1IL8A 3H91A 4XT1B 3GV6A 2MGSA 1O7YA 1X32A 3F2UA 4ZAIA 1HHVA 1EOTA 1F9QA 1DOKA 1E0BA 3N52A 4IUPA 3DM1A 4NW2A 2N55A 2L9HA 1BNZA 1VMPA 5CMDA 2K28A 4X3TA 2L12A 5D14A 2VXWA 2MJ8A 3P7JA 3I91A 1RHPA 3Q6SA 1SSOA 3DEOA 4UAIA 2K05A 1HA6A 2D9UA 4O42A 1TVXA 2RA4A 3HP3A 5EJWA 5T1IA 3I90A 2KUMA 1WTPA 5EQ0A 3TZDA 1KNAA 2X6GA 3GV3A 1J8IA 3TN2A 1NAPA 1QE6A 2X6LA 2XIWA 4DN4M 2KEDA 1XYIA 1B50A 2IL8A 1HUNA 2NZ1D 2K04A 1O80A 4IUQA 5CBEE 1MSGA 1S4ZA 5AFWA 1X3PA 1F2LA 1BO0A 2K03A 3ONAB 1M8AA 2EE1A 2N88A 2B2TA 2J7ZA 1SAPA 1KNEA 2RSNA 3MWYW 1U4MA 1XX8A 1HFGA 2B2TC 3FDTA 2CVRA 2NYZD 1WTVA 5T1GA 1RODA 5EKIA 4HAEA 1F9SA 3D6WA 4RAUC 1AZPA 1DOLA 1PDQA 1U4RA 3SVMA 5JJZA 1F9PA 1DZ1A 2KEEA 1J9OA 3QO2A 5EPLA 5CBAE 5EPJA 1HFNA 1G2SA 2MP1A 4IUVA 5DNFA 5EPKA 4QUFA 1CA6A 4OIJA 3LWEA 2K1BA 5E4WC 2Q8TA 2HDLA 4MHEA 3G7LA 3I3CA 1RTOA 2KVMA 4R9WA 2DY7A 1B3AA 4LMQD 2B2YA 4HSVA 2FFKB 1O7ZA 4HEDA 4X3UA 1WTQA 2MPMA 4CJ1B 4HCSA 2HUGA 1QNKA 3I8ZA 2R3ZA 3DEPA 1ZXTA 2B2YC 5E4XA 1EIHA 1AP0A 1WTXA 1RTNA 2DY8A 2FMMA 2JYOA 2B2WA 4RA8A 1JE4A 3IFDA 1B2TA 2FJ2A 2B2UA 1WTRA 2BDNA 2B2WC 1MGSA 2L1BA 4ZK9B 2KECA 2RSOA 1ILPA 2X69A 4IUTA 4ZKCB 2B2UC 1G6ZA 1EIGA 4CJ2C 1EL0A 1ILQA 2M2LA 4QUCA 1X3QA 1PFNA 1PFBA 1PFMA 4XT3B 4CJ0B 1WTOA 1BBXC 2B2VA 1DONA 2RVLA 1ML0D 1DOMA 1VMCA 3IL8A 2HCIA 1JICA 4ZLTF 1F9RA 4X3SA 1Q3LA 1WTWA 1NCVA 2L4NA 1B4OA 1B53A 1MI2A 2FHTA 2B2VC 1ICWA 2SDFA 4MN3A 5COYA 1WVLA 1CA5A 2KOLA 3MTSA 1LV9A 1GUWA 1U4LA 4XDXA 1QG7A 1NR4A 2H1EA 2JP1A 5D65A 1SDFA 1HUMA 1MSHA 1CM9A 3R93A 1EQTA 1PLFA
chains in the Genus database with same CATH superfamily
2F3VA 2PNRC 2PZTA 4IJLA 4X3KA 1VQCA 4IOAA 3OTOL 5LHY1 4DUZQ 4AYBB 3GDEA 3S17H 1K83H 3OYYA 3BYYB 1U4PA 3CW2C 4EQPA 3PMFA 2OF1A 1JC7A 3P1HA 1A15A 3I2ZA 4GKJQ 2VQEL 2VL6A 4X66Q 1A3TA 1HQRD 4H44C 2JN4A 1WFQA 3PIP3 1EQVA 2F4VL 1GHKA 2VNUD 2LXKA 2DJGC 3U58A 4FDBA 4DK6C 4C1NI 1XNRQ 5M3FB 3ERSX 1JCKB 1KAAA 3MFGA 1EWCA 4DUZL 2A6HD 4IUQA 1KD1C 3F2CA 2F3IA 4HN7A 3GTGH 3D4WA 5IODA 1K3BC 3QIAA 2RHSB 2NYZD 3W5OA 2BE5D 4GKJL 5F2DA 1XMOQ 2IHFA 1RODA 1CSPA 4DR1Q 1EZ6A 2JA7B 1SNDA 4X66L 3PUZA 5CV4A 3VYUA 1G291 1QB5D 2KEEA 3PGZA 2JA6G 4OWXB 3RN2A 2Q2TA 5DNFA 5EPKA 3S17B 3DMUA 3LWEA 1XNRL 4K0KQ 2G9HD 3G7LA 3I3CA 1OXSC 3C1FA 1IBLQ 5CV6A 1GUSA 2Y0SG 2B2YC 2ZJPA 4KLKA 2XGTA 5IGCA 4HIKA 2L5TA 3KJPA 2AKWB 4QGUA 2FJ2A 3PIOA 4DPGA 1EU3A 5JAVA 1HXYD 2RSOA 4C3IG 2UUBQ 4KKTA 1XMOL 4DR1L 2ZJRA 2K6AA 4JVZA 4QUCA 4XT3B 1PFMA 1PH9A 1QUQA 3KOJA 2WP8J 3GTOH 1I6HB 5EPLA 1B53A 3CU7A 1EY0A 2B2VC 4RMFA 4DNRB 1M90C 4PNYA 1GUWA 1RCVD 1JWSD 5CC4A 5AJ3Q 1S5CD 1NR4A 2TMPA 3PO2G 5FLMH 4K0KL 2NBFA 1IBLL 1AN8A 2DNCA 4A93G 2CWAA 4G7OC 1Q82C 3BVZA 1PHJA 4A3DB 1V1PB 4J8QA 1IKLA 5A2QL 4XYOA 3OMCA 4H0LC 4HJ5A 2UUBL 1K8MA 3KBXA 3W2DA 3MXGA 3H91A 2YTVA 1ENCA 1I3QH 2D0OA 1DOKA 4IOCA 3KFUA 1H9JA 3SK8A 3I4MH 3J81E 4C3JH 1A8VA 3IAYA 1ICFB 1SLJA 4A3IG 2BE5C 4R1JA 1FD7D 5J22A 1GJXA 5AJ3L 3C2PA 2HD3A 4DV0Q 1FGUA 2HQEA 5EQ0A 1UEBA 3TN2A 3KLSA 2OXPA 3EJIA 4RCOA 1S40A 3T56B 1SE3A 5IY0A 1TWAH 2O2LD 4F87A 5FLXc 1O80A 1AH9A 1O78A 1X3PA 3X3MA 4LK1C 3AU7A 4A3FB 4A3EB 2OWOA 1D6EC 3GTJB 4A75A 1I94Q 2NVYB 5ELEA 3ER0A 2JA8G 5KEEA 3J80i 5C44H 2PMZB 4UY8C 4DR2L 4LUVA 2R7ZH 1K8OA 1STGA 3QOLA 4DV0L 3NP8A 2HIXA 4WJ4A 1B3QA 2K50A 4B3TQ 2YYZA 4HSVA 4K2KA 1LTTD 1KAWA 2N8NA 4UHVA 1SMXA 2A68C 1EIHA 1I3QB 5IP9G 4CDFC 3S1MH 2DNEA 3I4MB 4AYBE 3CCJA 1WTRA 1LT4D 1I94L 3S2DH 1IZ6A 4IZ8A 1TWHH 2JXMB 1H9SA 1NNXA 4IFDH 5ELNA 3QWNA 1PTOH 1BBUA 1X9NA 1GM5A 2NN6G 3ICEA 5FO7B 3NENA 1HQMC 4C3HH 1VQ7A 1TWAB 4O2DA 1XJVA 3NQIA 5C4XG 2JP1A 1BVSA 3VR6A 3Q0AA 4B3TL 4IFDI 3A55A 3D6WA 4ODGA 4DK1A 2UU9Q 2ZXPA 1L1OA 3DWPA 2NWGA 1F77A 4JK1C 4LUZA 1QVFA 1GO3E 4DF7A 1E2WA 3QB3A 4Y7NH 5C44B 3F8TA 1R9TH 1CSQA 4RFBA 2E2IB 3EA6A 2AQ1B 4P74A 2QKIC 4RHSA 2R7ZB 2PQEA 1EFWA 1ASYA 1TS3A 3I7FA 1VQ4A 5J1ZA 1EOTA 2A1AA 1PYWD 4BBSH 3HFZB 1SNQA 3OOCA 4L5QA 2Q2HA 2RCFA 3NBHA 2L12A 5CV8A 1LTSD 5GAEC 3G71A 1Y1WB 5GAHC 5DM63 4LAAA 3DEOA 2F52A 4DA2A 1PH1A 5EJWA 4CDCC 3J81j 3I90A 3U9SA 4DXFA 2UU9L 2XVSA 4DV1Q 2XRSD 1IBKL 3GTPB 1XYIA 1TWHB 1EYCA 2EDGA 3FEWX 4I7ZC 4AIMA 1EYAA 1UAPA 2F0WA 1PTOB 5IYCH 4LWCA 4RHRA 5I2YA 1J6QA 3TS2A 4C3HB 1MJCA 3D4RA 3HOWG 3SE0A 2ZXRA 5CGKA 1P8LA 2JEBI 4OO1H 1U4RA 3J80c 1QUQB 5C3EG 3L7ZC 2CHBD 2CFMA 1K8AC 2NVTH 1KL9A 3MC0B 2LXJA 4AQYQ 2EXDA 4Y7NB 5IYBH 1II3A 2Z1CA 4DV1L 1R9TB 1BCPB 2FFKB 1I6VC 4KTAA 4X3UA 4JBKA 1J5EQ 2K4KA 2Z6KA 1RTNA 2JYOA 3L3OC 4BBSB 1STAA 4WFN3 2ATWA 1LTAD 2F0MA 2E2DC 3Q23A 5BN5A 2KENA 4CJ0B 1LTBD 2RVLA 1HZAA 1JICA 4ZLTF 1WTWA 1N36Q 5ELFA 3SR1A 4G57A 1VQOA 4XDXA 3H0GH 1B9MA 1TS5A 2H1EA 4GNXC 4AQYL 2B8GA 2QA4A 2EYOA 1EQTA 2JSOA 3VYSA 1VQMA 4L5RC 2BOSA 1J5EL 3DXJC 1CKMA 2M9VA 2K01A 4MTKA 2NZOA 1RDPD 3A5ZB 3SEBA 2R93G 1SNPA 3T53B 1MJEA 1A2UA 1HPCA 1E1TA 2NVTB 1UEAB 1V8QA 5FLXL 3HG9A 3N52A 2E2JB 1BNZA 3B6YA 2KHSA 2EY5A 1N36L 3BS1A 2YU9H 2PQAA 1L0YB 1S3OA 3JAMi 3MXNA 2H5XA 1S5FD 4QL5A 4LUOA 3BDCA 4Z9CB 1SYCA 4G4KA 3LGJA 4LF9Q 5KNDA 1JJGA 2KEDA 2WKDA 5CV5A 1FYCA 3X3NA 5FJ8G 1E24A 2EQSA 2F0LA 3VR2A 3T1HL 1STBA 3IFTA 4A3BH 1XTDA 2JJQA 5IWAL 1JOQA 1H9KA 1DD2A 1T5EA 3MEHA 1MHWC 1E3PA 1HCZA 3K0YA 4NDXA 3PUVA 1Y8PB 4CKBA 1IYUA 1H9SB 3GTLH 1PH6A 1AW7A 1PH2A 4WJWA 5CR3A 1DZ1A 4P2CB 1EEFD 1S5BD 3NE5B 3HOXG 2ZTDA 1Y8OB 1OXUA 1HFNA 4BBRH 4KD4A 1E22A 1PH4A 3I4NH 5E4WC 5IOCA 3MAQA 1HZ9A 4V0BA 3C1EA 3CCUA 1Q1BA 4LF9L 3RLOA 3HS0C 2VZAA 3A0JA 1W2BA 3HOYG 3DEPA 4JOIC 1PTOD 2WB1G 2FMMA 3RZDH 1QNUA 2ZXOA 1SE2A 2QCPX 1PH3A 3HOVG 1MBYA 2YU9B 4IPHA 2JEAI 2KECA 4FXKC 3ULPA 5M5WB 2KCTA 4R4CA 1WCMB 3BZCA 1RIPA 4GS3A 4ZAIA 1PTOF 1PYSB 4QCLA 2SDFA 5KNBA 1KDBA 2KOLA 1LV9A 1U4LA 2IX0A 4EVOA 4U673 4GOPB 3TZUA 1Q86C 4XQJA 2Z4HA 3AMUA 2FXQA 1BCPD 5KNCA 5GADC 1T5XD 4K8IA 5E3FA 3GTLB 4E6IA 1ESRA 3T1YQ 4ZKBB 1X55A 1CUKA 2KHJA 1K8GA 2KBNA 2AWNA 4BBRB 5GAGC 3H94A 5IYDG 3I4NB 1N34Q 1HHVA 1KDAA 1PZJD 2WB1E 3S1RH 1SFOH 4C1NK 4X65Q 4PMWA 5D14A 1CKOA 2EY2A 4Q0FA 2VXWA 1X65A 4JBMA 2JA6H 1A3UA 3EVQA 4DV7Q 4NB3A 1JJCB 4LFBQ 3JAMc 1FVIA 4JBWA 3RZDB 1IL2A 1YJWA 1WTPA 2GVBA 4EX5A 4FF4A 5E7NA 4QIWB 3VR3A 3CHBD 4LF8Q 3T1YL 3U50C 5FO8B 2EE1A 2J7ZA 4JI5Q 1EOVA 4UP7A 4C3IH 3K59A 1BDOA 1PTOC 3AQQA 1N34L 1VDZA 1X6OA 2K75A 1PH7A 5C5LA 4QF4A 4X65L 5IGGA 4DV7L 5CBAE 1EQRA 3AYHB 4PZ8A 3A5UA 5ELOA 2I5MX 4OIJA 3R2TA 4GNXA 4R9WA 4GN4B 5J3BA 3J80E 3PSIA 3HRZC 2J0TD 4M8AA 5D3DA 4LF8L 2R6GA 1AP0A 3NTKA 3S1RB 4JI5L 2XNAC 3IFDA 5C4JH 1BCPC 1MGSA 1PA6A 2WACA 3V96A 2ENBA 1ILQA 4DAYB 1VQJA 2V1CC 1EY9A 1ML0D 3A56A 4DNIA 1SYBA 3S1QB 4A3IH 1CA5A 2EYHA 1ICWA 2PQAB 4IUNA 1BXTA 4OEMB 1G51A 3KLSX 4YCWA 3MXNB 2N78A 4DV5Q 5KIXA 4A3KG 1NTGA 3CMAA 5LMNQ 2AQ3B 2HCCA 1K28A 5KYLA 2NZHA 1TS4A 3PIO3 5BN3A 4CDEC 3CCEA 4FP5D 1JB7A 2Z8LA 1IKMA 2QDLA 4TKOB 1WOCA 2F0IA 1MIUA 4WRDA 1I50B 1FJGL 4XT1B 2EJGC 1SRUA 3WDNA 2JA8H 4K5XA 4IUPA 1VQNA 3PO3B 4YCUA 2EJMA 2BA1A 2ZT9C 1D8LA 4OX9Q 4L5TA 1CZGA 4DKAC 2A74C 1D5ZC 5M3MG 3TQYA 2L0CA 1TVXA 2RA4A 3HP3A 1SEBD 5C4JB 1S5ED 4DV5L 1D5XC 4L6TB 3K0XA 3J7ZC 3MZ5A 3RLFA 3OSOA 5C0XG 3U4VA 1EYDA 3V2TA 3SGIA 2F0PA 1E7ZA 1BR9A 3NELA 3M3YH 1F2LA 1TKWB 4JOIA 4GLAC 2XRQD 2RSNA 2B2TC 1WTHA 1NMFA 4A3LG 4X62Q 4GZYC 3S1NH 4RAUC 1W3SA 4OX9L 1F9PA 2GVAA 1DYQA 3NSWA 1ASZA 4A3MG 3VA7A 3F1ZA 2MO0A 4YWLA 4IO9A 1A63A 3FMCA 3KDFB 5G3LD 1QJOA 1H9RA 4UPAA 1B3AA 2BCOA 1D5MC 2IPKD 5BN4A 3M9BA 4FF1A 4CJ1B 3I8ZA 1NE3A 3KF8A 5FK9C 2JA8B 3KF6A 1NBWA 1QWYA 1A6XA 4IPDA 2JA5H 4WJ3M 4CKCA 2OCEA 2B2UA 1I4QA 5G3LF 1F2YA 4DV3Q 1EIGA 3A8IE 4X62L 3M7GA 5HY6A 1DOMA 1CFMA 1Q3LA 1UUPA 1B4OA 1K83B 2FHTA 2E76C 2VS1A 4GN3B 4MN3A 4PMCA 1WVLA 4HIDA 3VDYA 3Q8DA 4JYAQ 3M3YB 2HT1A 1HUMA 2SNSA 4DK0A 4LFCQ 4OWTB 4RWSC 1SJED 1C9OA 3J7YW 3S2HH 2QEXA 3S16H 3CCRA 4MTNA 4BXXH 3OHXC 4K6LA 2R7DA 4MNOA 4BA1I 1VQHA 1HZCA 1YJNA 2O5IC 4PZ6A 4DGZA 1JWMD 2I5LX 1GKHA 2Q8RE 3J81L 5K36G 1FNVA 1F9QA 1HH2P 2LS01 4B3RQ 1M4VA 2LY7A 2WIIB 3GTGB 4X3TA 4BS9A 3C46A 3L9AX 4JYAL 2PNHA 5JEAG 3GQBA 2ASBA 1YNND 4HJ7A 5I9PA 4DXGA 5DLQE 2JA5B 1AE3A 4LFCL 1KNAA 2IJ0A 3D3RA 2RBMA 4IN3A 3CCVA 1FGBD 1DCZA 4DAPA 3JAME 2K03A 2A6HC 1B7YB 1M8AA 1ZYRD 3BDOA 4KI0A 1EWHA 4KK7A 4GN5A 4JC0A 4QB4A 1QOHA 4ZUJA 1YI2A 4B3RL 4LNQA 2DUDA 1I4XA 1V43A 2E8GA 4X6AH 1CKNA 3CAMA 1NSNS 1GUGA 1V9PA 4AYBG 3TEHB 3I72A 2NVXH 1AE2A 2EYMA 4R4TA 3G4SA 3QG1A 1SROA 2VB3X 1VQAA 1O7ZA 3H09A 4APVA 1KC8C 2CCZA 2SNMA 3GTOB 2MO1A 5J39A 3CD6A 1OXVA 1F2ZA 2BH8A 3TP6A 1GUOA 1ONLA 5DM73 5DAUA 1YHAA 2R93H 3MFYA 4ZK9B 1Y69U 1S5DD 3BU2A 3URYA 4Y52H 1YEZA 2F0EA 2SOBA 5JJIA 1JE5A 4PG3A 3GTKH 1UWVA 5CV9A 3I4OA 3OW2A 1F2MA 1ET6A 1RF2D 1B8AA 4F88A 2IY5B 3UDFA 3CC2A 2RKSA 1EUJA 1W6KA 5CORA 1A62A 1C8CA 4C3JB 5FJ8H 3HOUH 3M85A 2EPBA 4JI6Q 2JA7G 5JOBA 4RGTA 3PV0A 4P72A 2E74C 2I5HA 1IL8A 3GV6A 1VQEA 2MGSA 2NVXB 1ZYRC 2AHOB 3OIPA 2N49A 1X56A 3M7NA 1VMPA 4YIJA 3HOXH 2B8FA 2PI2A 3CCQA 1HA6A 3PUXA 3DWAA 5IIFA 4ULLA 4DV2Q 3E3XA 2IX1A 2R93B 4ABNA 2X6GA 1VQ5A 3LWUA 2PZUA 1Y8NB 3A74A 2MQHA 3HOYH 4FF2A 1YZ6A 4KN4C 4JI6L 1IHZA 1IYJB 5CBEE 5JEAJ 1BO0A 5CYUA 3GTKB 3HOVH 1SAPA 1KNEA 4DR7Q 2D5DA 2CQOA 1VF5C 2CVRA 5FKAC 4NPSA 3BZDB 5EKIA 2UXCQ 5IGFA 4V190 4ZQ3A 3S1MB 5C3XA 1ENFA 3S14H 1VF7A 3HOUB 3S2DB 4GKKQ 1EY6A 3AB9A 4A3DG 5GQOA 4AH6A 3OMGA 4GLXA 4DV2L 3K81C 3V05A 4EQOA 5I2XA 2DY7A 2B2YA 4XYQA 1KHIA 4LFAQ 2NB0A 4A3JG 4A3CG 1CTMA 2HUGA 1QNKA 2K7VA 2ZTCA 5EAYA 1GVPA 3FVQA 4M1UB 3ZJYC 4OWWB 1JWUD 4LF7Q 3MA2B 4DUYQ 2GA4B 4DR7L 3R2IA 3NUCA 4JI4Q 3HOXB 1HJPA 1YHBA 3FP9A 3BYTB 1WI5A 4BWGB 5K5PA 5IYDH 2Z4IA 5NUCA 4BY1G 4CJ2C 4K8JA 2UXCL 1PFBA 1XXGA 2RDFA 2B2VA 4B3MQ 1A0IA 4PQXA 3K57A 2KCCA 5IP7H 1MI2A 5COYA 1R4PB 3HOYB 1GHJA 4GKKL 2Z6BA 2E2HH 1KIXA 4OO1I 3E6ZX 4JI1Q 3G6EA 4A3FG 4A3EG 3HOVB 1PLFA 2BA0A 1AFPA 2F0KA 4LFAL 1PRTB 2HDMA 4BY7H 4MIUA 4A3GG 1Q7YC 1SMYD 3BDLA 4LF7L 2LKVA 4DUYL 1VQ8A 2LSSA 5IT9c 2EVBA 4JI4L 3I56A 2AUKA 3NBIA 3NTIA 2C5CA 1NMGA 1VQGA 4I65A 2Q2UA 4B3ML 4A4IA 1P16A 2K28A 4JG2A 2OTLA 1CKNB 1X54A 3KBGA 4JI1L 1XPRA 3GV3A 3I4LA 2ZM6Q 4KJNA 1TT2A 3WWVA 1YJ9A 5M9OA 1SNMA 3FKIG 1MSGA 4POFA 4YY3Q 3ONAB 1IYVA 4PMBA 3G6JB 2QILA 5JVH3 1Y1VG 1OXXK 3FDTA 3L0OA 2E75C 1N8RC 2E2HB 1YNJD 1CHQD 4HIOA 3PCOB 1VQFA 2PMZE 3OWEB 5JJLA 5EKKA 2CKZB 4KKSA 3QO2A 3W1GA 2B3GA 4BY7B 2G9DA 1G2SA 2R92H 3NWSA 4QUFA 1LT5D 1JQYD 2K5VA 3K5LA 4A3KH 5HURA 5C4ZA 2R7ZG 2ZM6L 5LMNW 2ZTEA 2F0DA 2MPMA 2O5JC 1ZXTA 4F7XA 1S72A 2QGQA 4ZRZA 1VQKA 3H0GB 1Y1WG 1U9RA 2B2WC 4UDUC 1MKHA 4F8MA 2OEOA 1WTOA 1LM0A 5M5XH 4ZCKA 4QJFA 2O4XA 4LF4Q 3HKZB 3MTSA 1C0AA 5M3MH 4DR6Q 2NTTA 4TSSA 4BA2I 1L1OB 4C3HG 1N32Q 4K14A 1JE4A 5GROA 4A76A 3PF4A 5C0XH 2DJFC 3KLRA 2VUMG 3RMHA 4OELB 2WV6D 3TS0A 2F0QA 3SHLA 4IALA 1YHQA 2ALYB 1CQFA 1STEA 4ID6A 4RGNA 1LACA 5LMUQ 1I4PA 2A6ED 2R92B 3UDXA 5BR8Q 3T13A 3NBHB 1NJIC 1HR0Q 4A3LH 1PMRA 1FNWA 3L2PA 2KHIA 3GTMH 3DM1A 4HJ9A 4G7HC 1R4QB 4LF4L 4A3BB 1JMCA 4A3MH 1EQQA 3I91A 2WAQB 4DR6L 3CRKC 3M4OH 2Q2IA 3HGBA 4DR4Q 1N32L 4G7ZC 1J8IA 3VA5A 4JI8Q 4JBJA 1PRTD 1I4GA 4N8X1 2WINB 2NUCA 2A73B 4DK3C 4H13C 5M5XB 1JOKA 2N88A 3F2DA 5LMUL 3FPPA 2VY3A 2SEBD 4HR7B 1HFGA 2EXZA 5M3MB 5M5YH 5BR8L 1HR0L 4IPGA 1HTLD 1IXRA 1M1KC 2F0VA 1PRTF 3LX0A 1PDQA 2F0OA 4DR3Q 1E1OA 4JI0Q 2P5ZX 5EPJA 3OW7A 3J80L 4DR4L 4IUVA 2K1BA 2HDLA 2QW7A 4KJOA 2F4IA 2OT2A 4JI8L 4N8FA 1TXYA 4QMGA 3OPOA 4HEDA 2A69D 1PH5A 4ZYSA 1TY2A 5IYBG 3GTMB 2DY8A 3M4QA 2B63G 2EZVA 4RH6A 4CKEA 1TWCH 4K5VA 4RKBA 4XQNA 3M4OB 2X69A 5K36H 1SNCA 1X3QA 4LFBL 1DONA 1EIFA 2JQOA 4DR3L 4JI0L 3PO2H 2A6EC 4H7BA 5ELDA 4A93H 5JEAH 1JORA 1STYA 1HNZQ 2ID0A 3DLLA 3QR8A 1LTID 3R3OA 3ERQA 4I7AA 1AZQA 3A7LA 1SFOB 5D3IB 5M5YB 1SYGA 1D1KA 1BF4A 3K7AH 2RDHA 2JA6B 5KRUA 3CP0A 3SK4A 3CPFA 1BKBA 3AEVA 1UE1A 1VS0A 4FVMA 1STNA 1PRTC 5I9OA 4JV5Q 2OTJA 4JI3Q 2EJFC 1V1PA 3CC4A 3H15A 2Y0SB 1X32A 1LTRD 4JCVE 1QVGA 5ELCA 1PFSA 3KYHC 4JI7Q 5IT9E 4FYDA 1LUZA 3DHQA 1X3GA 4RGOS 2EY6A 2EYLA 3Q6SA 1BOSA 4C3IB 4KY7A 1SYFA 1DGSA 2D62A 4Q5VA 3CF5A 1TWCB 4HTHA 2EIFA 1H95A 2EYFA 1B50A 2PYKA 3AFPA 4B08A 2NZ1D 2K04A 5AFWA 1WCMG 3BZKA 3R8BA 2QF7A 3UE1A 3E9IA 1GXDC 3DUZA 1B70B 2NTSA 4HMJA 1YBYA 3K5NA 3PO2B 4JV5L 1KRTA 4JI3L 1K0RA 1XX8A 2K14A 3MXPA 1JJ2A 2HIVA 3OTOQ 4A93B 4EQ5A 1PZKD 1F9SA 4TQUS 4JI7L 2G5DA 4FXDA 1U0LA 5LMNL 1J9OA 3A7AB 3K7AB 2N3SA 1SE8A 3CCMA 3CCLA 2MUYA 3DM3A 1PYBA 2DGYA 2BH2A 1YNXA 5IP9H 3I55A 1G6PA 1I5FA 4YWMA 1YIJA 3AFQA 1AEXA 2MHVA 1B44D 3S9WA 5I6YA 4A3IB 5E4XA 2JA7H 4RA8A 4WORA 1EWIA 1EY7A 4YHHQ 2QDBA 1KXLA 2L1BA 2NN6H 4C56C 1KQSA 4HCEA 1QILA 3HOZG 1I4RA 2M2LA 3M4YA 4O0AA 3RLNA 5C4XH 1A3VA 3W1BA 1XWEA 3SK5A 3FHWA 2NN6I 4EQNA 5D65A 2ZJQA 2WAQE 1CM9A 3UE0A 3BVGA 1Q1EA 1Q81C 2OQ0A 2VB2X 3D0FA 4IURA 1SNOA 5LL6S 1EYGA 1L1OC 4YHHL 1E2ZA 4CDDC 4DFAA 1I6HH 1ZEQX 1CT1D 2L11A 1I4HA 3GD7A 4L63B 3J7A5 4OIKA 5HGQA 3NWTA 1GD7A 2XWJB 4XIGS 4DR5Q 2N55A 1PV4A 4ALPA 5ISRA 5CMDA 2K5DA 1BQQT 1VQPA 4IQZA 2KQ3A 2PCFB 2ES2A 1SSOA 2LMCB 4KKUA 4A3DH 2BDOA 1JB3A 5LL6X 4GOPC 2WFWA 1VQDA 2YV5A 3P20A 4QIWE 1ENAA 1SYEA 3S1NB 3JAML 1LTLA 3ND9A 2XIWA 4RCNA 4DN4M 4A3JH 5E1FA 1K9MC 4A3CH 1QCBD 1Q8IA 3HOWH 4DV3L 5C4XB 1HA5A 1KRSA 4JPBW 1NUCA 3DWQA 5CV7A 5C3EH 2WKCA 1HNWQ 1OO9B 3J7AV 4BY1H 4DR5L 1TU2B 4TVAB 3W3AA 1LTGD 1Q12A 4KHZA 2Q8IB 5JPMC 5IGBA 1JT8A 4S3SA 5DEHA 4GNXB 5KYIA 4A3FH 1Z9FA 2JE6I 4A3EH 4R4OA 2Q8TA 3GTJH 1CI3M 4NXNQ 1RTOA 2ICEC 2NVYH 3TREA 2QEJC 2RCNA 2RQXA 2A68D 1ET9A 4A3GH 2RF4A 1ZKOA 3PO3G 3NTHA 5C0XJ 1D2BA 1FNUA 2D0PA 3PQIA 4KV6A 5C6AA 2Z6KC 2UUAQ 4XTCS 2BDNA 2ICIA 2LFNA 1U5KA 1HNWL 3MHBA 3S2HB 3S16B 1PFNA 1B9NA 1V1QA 4NMZA 1IBMQ 4NP5A 2HHHQ 3T51B 2Y0SE 2K5WA 4X3SA 1NCVA 2L4NA 4A3JB 3HZXA 3TDQA 2YTYA 4KY6A 2K52A 4YWKA 3HOWB 3R93A 1UNSA 1BUVT 3RD4A 4NXNL 2C35B 3NXWA 4DR2Q 3PIPA 3I70A 1C7YA 5C3EB 3T16A 4XXEA 4R8IA 1T9HA 1RKNA 4BY1B 3FKIH 2PO4A 4CHTB 2OQKA 3H3VH 3EBEA 3D6CA 2AQ2B 5IE8A 3KUPA 2UUAL 5L37A 1Y1VH 1VQLA 2XSCA 5M3FG 4DAVA 2J4XA 5A2QE 3RR5A 3TP8A 2XN9C 1IBML 1EU4A 1TR5A 2HHHL 2L9HA 3H3VI 2F0NA 3P7JA 5KGUA 3D8GA 1LABA 2CQAA 2EYJA 4A3GB 4UAIA 1GUTA 4O42A 4LF5Q 1YNNC 5EGTA 4C2MH 3UDIA 3TZDA 2E2IH 3CKIB 4L8JA 2X6LA 1TY0A 4B3SQ 1YVCA 1LO5D 3WOFA 1S4ZA 3S15H 1Q46A 1SJHD 4HSPA 5TSSA 3RN5A 1Y1WH 2B2TA 4P71A 3ITPA 4DU9A 4PZ7A 4FO2A 3PF5A 1HTPA 3BG3A 1XNQQ 5EKLA 4HAEA 2MFIA 1AZPA 3GTPH 3SVMA 4UP8A 5JJZA 1K73C 4TRDA 2F0JA 4XQQA 3CRLC 1WYDA 1EZ8A 3FKIB 4LF5L 2AUJD 1TWFH 3D4DA 1CA6A 2VQFQ 3D31A 3IKJA 2K5NA 1CHPD 1EFID 2I07B 2KVMA 3U9OA 3KJOA 3QJYA 3KF8B 1Y1VB 3MEFA 2H4OA 4LMQD 3C3LA 3A8KE 3KF6B 4B3SL 2VUMH 1WJJA 2R3ZA 1SE4A 2CH4A 1IBKQ 4YCVA 4KN7C 1CZWA 4IUTA 4ZKCB 3EN2A 1G6ZA 2DN8A 1XNQL 2Z9HA 2JA5G 4KHVA 3E0JA 1KLUD 1EL0A 3A54A 3HEJA 4C2MB 2F0UA 1HR0W 4R4QA 1V1OA 1VMCA 4KY5A 2HCIA 1F9RA 3LNNA 2R7FA 1STHA 2RHQB 1FL0A 1L0WA 2L15A 1C48A 3S15B 2K5QA 1QG7A 2VQFL 2PZWA 3UDGA 1SN8A 1SBBB 4GOPA 4FF3A 1YITA 1HRJA 4IUUA 1RL2A 1GUNA 3TP7A 4NXMQ 1NR2A 4H02A 1KTKA 4JW0A 2UXDQ 1TQOA 2F0SA 4N9PA 4BXXG 2JK8A 1TWFB 1O7YA 3Q22A 1IW7D 2WB1B 4POGA 2PPBC 5A35A 2VUMB 2UXBQ 1RHPA 4IJHA 3Q24A 2K05A 1DM0B 3ND8A 4CBVA 1OTCA 5FLMG 3N6RA 5T1IA 1Y14B 1NY4A 3QOJA 3CCSA 1EY8A 1EY5A 1D1IA 1L0XB 4NXML 4R8NA 2IL8A 2K5HA 3CMEA 3S14B 3H6MA 2E2JH 1XTCD 1DJRD 1K3RA 2B63H 1PVOA 4MZ9A 5C4HA 2UXDL 3A8JE 3K6OA 4HJ8A 3RZOH 1EEID 4J1MA 1DOLA 5FOBB 3I4MG 1EIYB 4C3JG 2UXBL 2VW9A 3F2BA 2E5LQ 2EY1A 2K33A 3KLWA 1ESFA 3PUWA 4R4IA 3SXHA 2D2CC 1WTQA 4HIMA 5IGEA 4B9XA 3CXCA 3GP7A 3K5MA 5ELBA 1LT6D 2CH4W 4NKLA 3OWFA 4CGYB 4K6DA 3K58A 2B39A 1E2VA 3T1HQ 3BVMA 4ILWA 5IWAQ 1C4QA 1FR3A 2CWPA 2RDGA 1XMQQ 4RKLA 2TSSA 3OIQA 4UP9A 3FRPB 3NK9A 3G48A 4DAYA 5C44G 1WD1A 2E5LL 3NHHA 5HGTA 2A5HA 4LF6Q 1IW7C 2B63B 3E9HA 1SDFA 2FMCA 1HNXQ 1D7QA 1Q8KA 2IHEA 3RZOB 4OONA 4YY3L 5M5WH 3GTQH 4DV4Q 4ZUIA 4U68A 3BJUA 4N9TA 2FINB 2F0HA 1L2FA 1WCMH 2IX3A 3J81i 1SMYC 2EOTA 4O1NA 1PZID 3HOUG 3JC66 4RG1A 1RJTA 3GO5A 2JA9A 1OXTA 4IFDG 3WOEA 4K5WA 4HJAA 3F2UA 1XMQL 4QY7A 1CK1A 1E0BA 1VCIA 2XTIA 3MVVA 4NW2A 1LT3D 1LLRD 1VQ9A 5FLXE 1XPUA 2I46A 4LF6L 3J7AF 1DXMA 1HNXL 2KUMA 1UE5A 2F1MA 1NAPA 4DV4L 3E5SA 4FNFA 2UUCQ 1HUNA 5H1SE 4QQBX 1K0SA 2M00A 1TS2A 4IPCA 1TIID 4KD3A 5C0XI 2F03A 4DV6Q 4A3KB 3MWYW 1X3FA 3NPPA 1WTVA 5T1GA 3HOZH 2NVQH 3EIVA 3T4AC 3KK7A 3M4PA 4OGQC 4OXPA 3K8AA 1YNJC 3EROA 1HZBA 4BBSG 3GTQB 2PW7A 3SDZA 3E0EA 1XPOA 4EGVA 4B9WA 4KHPQ 3TSSA 5FO9B 5I6WA 2F0FA 4GLVB 2MP1A 1KDCA 1A2TA 4MHEA 4OL7A 1GOZA 3ULJA 1CQVA 1N33Q 3KDFA 2KJXA 2UUCL 1H9MA 4HMIA 4HCSA 4ME3A 1RD9D 1QZHA 4J15A 3H3VC 1O7LA 5IYCG 3VYRA 1WTXA 1KLGD 4K2LA 2EYPA 1TWGH 1JR0D 4DV6L 2PW5A 1B2TA 2AMCB 2CW0D 1VQBA 3S24A 2B2UC 3P75A 5C5MA 2KCNA 1Q90A 2A8VA 3PUYA 4RGMA 2HQLA 4DAMA 1BBXC 4OO1G 3MXUA 2XWBB 3CQZH 4KHPL 1SXTA 1BCPF 3EFXD 2IWHA 2GN5A 1SYDA 2F0GA 5IP7G 3TRZA 5I4DA 1MD2D 1G2TA 1N33L 3K80C 4DNTB 3HOZB 2NVQB 2A19A 1Z7TA 4A3MB 3ZYYX 3S1QH 2YTXA 3STBD 5JPNC 3FPUB 3J81c 3VR4A 5EBCA 1W6JA 4BY7G 1G91A 3UI2A 3K5OA 2L55A 3HKSA 5IT9L 3TMEA 4L5SA 2V4DA 3CC7A 2MJ8A 4J6HA 4OHJA 2R61A 4JI2Q 2D9UA 4LJZC 3H0GG 1KABA 4IFDJ 1TWGB 1QZGA 3NEMA 3IRBA 1UE6A 2MNAA 1I50H 2B29A 2Z0SA 1QE6A 1G8ZD 2IT1A 2AWOA 3O13A 5IGDA 3PO3H 2IW3A 3TP5A 4X64Q 3CQZB 4KMUC 5C3WA 3HKZG 1U4MA 4PV1C 1EY4A 1N9WA 3VYTA 5EBDA 1VQ6A 3NQTA 2F3WA 1HNZL 1X3EA 2I0QA 2CW0C 1Z6HA 3EQLC 3U4ZA 1FJGQ 1O7IA 1BBWA 4LW1A 4JI2L 3SK6A 1VQIA 3K7UC 4P75A 2F0TA 1Z47A 5JVG3 1SR3A 2R92G 2A69C 4X64L 4P73A 1PXUA 2B2WA 4A3BG 1B1ZA 1QVCA 2WAQG 3ULLA 3CPWA 3I73A 3RUZA 5M3FH 1ILPA 1LYLA 1JOOA 2KA7A 1PH8A 2C9OA 3STBC 3TBIB 5JJKA 2VQEQ 3IL8A 1WD0A 3HKZE 2K32A 4ME5A 2PI2E 4BBRG 2F4VQ 1UE7A 3RNUA 3I4NG 1MSHA 4FXGC 2KCMA 3VR5A
chains in the Genus database with same CATH topology
2F3VA 2PNRC 2PZTA 4X3KA 5LHY1 4AYBB 3BYYB 1U4PA 4EQPA 3PMFA 2OF1A 1JC7A 3P1HA 1A15A 1A3TA 1HQRD 4H44C 3PIP3 1EQVA 1GHKA 2VNUD 4C1NI 5M3FB 1JCKB 1KAAA 3MFGA 1EWCA 2A6HD 4IUQA 4HN7A 3D4WA 5IODA 3QIAA 2NYZD 2BE5D 5F2DA 1RODA 1EZ6A 2JA7B 1SNDA 3PUZA 5CV4A 3VYUA 1G291 1QB5D 2KEEA 5DNFA 5EPKA 3S17B 3DMUA 3LWEA 2G9HD 3G7LA 3I3CA 1OXSC 3C1FA 5CV6A 1GUSA 2B2YC 5IGCA 2L5TA 2FJ2A 1EU3A 5JAVA 1HXYD 2RSOA 4C3IG 4KKTA 2K6AA 4XT3B 4QUCA 1PFMA 2WP8J 1I6HB 5EPLA 1B53A 3CU7A 1EY0A 2B2VC 4DNRB 4PNYA 1GUWA 1RCVD 1JWSD 5CC4A 1S5CD 1NR4A 2TMPA 2NBFA 1AN8A 2DNCA 4G7OC 3BVZA 4A3DB 1V1PB 4J8QA 1IKLA 5A2QL 4XYOA 3OMCA 4H0LC 1K8MA 3KBXA 3W2DA 3MXGA 3H91A 1ENCA 1DOKA 1H9JA 3SK8A 3J81E 3IAYA 2BE5C 1FD7D 5J22A 1GJXA 3C2PA 2HQEA 5EQ0A 3TN2A 3KLSA 2OXPA 3EJIA 4RCOA 3T56B 1SE3A 2O2LD 4F87A 1O80A 1O78A 1X3PA 3X3MA 4LK1C 3AU7A 4A3FB 4A3EB 1D6EC 3GTJB 2NVYB 5ELEA 5KEEA 2PMZB 1K8OA 1STGA 3QOLA 3NP8A 2YYZA 4HSVA 4K2KA 1LTTD 2A68C 1EIHA 1I3QB 2DNEA 3I4MB 1WTRA 1LT4D 4IZ8A 2JXMB 1H9SA 4IFDH 3QWNA 1PTOH 2NN6G 5FO7B 1HQMC 1TWAB 3NQIA 2JP1A 3VR6A 3Q0AA 4IFDI 3A55A 3D6WA 4ODGA 4DK1A 2ZXPA 3DWPA 2NWGA 1F77A 4JK1C 4DF7A 1E2WA 3QB3A 5C44B 4RFBA 2E2IB 3EA6A 2AQ1B 2R7ZB 2QKIC 4RHSA 2PQEA 1TS3A 5J1ZA 1EOTA 1PYWD 1SNQA 3OOCA 3NBHA 2L12A 5CV8A 1LTSD 1Y1WB 5DM63 4LAAA 3DEOA 4DA2A 5EJWA 3I90A 3U9SA 4DXFA 2XVSA 2XRSD 3GTPB 1XYIA 1TWHB 1EYCA 2EDGA 3FEWX 4I7ZC 1EYAA 1UAPA 2F0WA 1PTOB 4RHRA 5I2YA 4C3HB 3D4RA 3SE0A 2ZXRA 5CGKA 2JEBI 4OO1H 1U4RA 3L7ZC 2CHBD 3MC0B 4Y7NB 1II3A 2Z1CA 1R9TB 1BCPB 2FFKB 1I6VC 4KTAA 4X3UA 1RTNA 2JYOA 3L3OC 4BBSB 1STAA 4WFN3 1LTAD 2F0MA 2E2DC 3Q23A 5BN5A 4CJ0B 1LTBD 2RVLA 1JICA 4ZLTF 1WTWA 5ELFA 3SR1A 4G57A 4XDXA 1B9MA 1TS5A 2H1EA 2B8GA 2EYOA 1EQTA 2JSOA 3VYSA 2BOSA 3DXJC 2M9VA 2K01A 1RDPD 3SEBA 1SNPA 3T53B 1A2UA 1HPCA 2NVTB 1UEAB 1V8QA 5FLXL 3HG9A 3N52A 2E2JB 1BNZA 2KHSA 2EY5A 3BS1A 1L0YB 3MXNA 1S5FD 3BDCA 4Z9CB 1SYCA 4G4KA 5KNDA 2KEDA 2WKDA 5CV5A 1FYCA 3X3NA 2F0LA 3VR2A 1STBA 3IFTA 1JOQA 1H9KA 1DD2A 1T5EA 3MEHA 1HCZA 3K0YA 4NDXA 3PUVA 1Y8PB 4CKBA 1IYUA 1H9SB 1AW7A 4WJWA 5CR3A 1DZ1A 4P2CB 1EEFD 1S5BD 3NE5B 1Y8OB 1OXUA 1HFNA 4KD4A 5E4WC 5IOCA 3MAQA 4V0BA 3C1EA 1Q1BA 3HS0C 3DEPA 1PTOD 2FMMA 1QNUA 2ZXOA 1SE2A 2QCPX 1MBYA 2YU9B 2JEAI 2KECA 4FXKC 5M5WB 1WCMB 4ZAIA 1PTOF 4QCLA 2SDFA 5KNBA 1KDBA 2KOLA 1LV9A 1U4LA 2IX0A 4EVOA 4U673 3TZUA 4XQJA 2Z4HA 3AMUA 1BCPD 5KNCA 1T5XD 4K8IA 5E3FA 3GTLB 4E6IA 1ESRA 4ZKBB 2AWNA 4BBRB 3H94A 3I4NB 1HHVA 1PZJD 1KDAA 4C1NK 4PMWA 5D14A 4Q0FA 2EY2A 2VXWA 1A3UA 3EVQA 4JBWA 3RZDB 1WTPA 4FF4A 4QIWB 3VR3A 3CHBD 5FO8B 2EE1A 2J7ZA 3K59A 1BDOA 1PTOC 1VDZA 5C5LA 4QF4A 5IGGA 5CBAE 4OIJA 3R2TA 4R9WA 3J80E 3HRZC 2J0TD 4M8AA 5D3DA 2R6GA 1AP0A 3NTKA 3S1RB 2XNAC 3IFDA 1BCPC 1MGSA 2WACA 3V96A 2ENBA 1ILQA 1EY9A 1ML0D 3A56A 1SYBA 3S1QB 1CA5A 2EYHA 1ICWA 4IUNA 1BXTA 3KLSX 5KIXA 2AQ3B 2HCCA 5KYLA 1TS4A 3PIO3 5BN3A 4FP5D 2Z8LA 1IKMA 4TKOB 2F0IA 4WRDA 1I50B 4XT1B 2EJGC 3WDNA 4K5XA 4IUPA 3PO3B 2EJMA 2BA1A 2ZT9C 1CZGA 2A74C 1D5ZC 2L0CA 1TVXA 2RA4A 3HP3A 1SEBD 5C4JB 1S5ED 1D5XC 4L6TB 3MZ5A 3RLFA 3OSOA 5C0XG 1EYDA 3V2TA 2F0PA 1BR9A 1F2LA 1TKWB 2XRQD 2RSNA 2B2TC 4GZYC 4RAUC 1F9PA 1DYQA 3NSWA 3VA7A 3FMCA 5G3LD 1QJOA 1H9RA 1B3AA 2BCOA 1D5MC 2IPKD 5BN4A 4FF1A 4CJ1B 3I8ZA 3KF8A 5FK9C 2JA8B 1QWYA 1A6XA 4CKCA 2B2UA 1I4QA 5G3LF 1F2YA 1EIGA 3A8IE 3M7GA 1DOMA 1CFMA 1Q3LA 1UUPA 1B4OA 1K83B 2FHTA 2E76C 4MN3A 4PMCA 1WVLA 3M3YB 1HUMA 2SNSA 4DK0A 4RWSC 1SJED 3J7YW 3OHXC 4K6LA 4BA1I 2O5IC 4DGZA 1JWMD 2Q8RE 3J81L 5K36G 1FNVA 1F9QA 2LS01 1M4VA 2LY7A 2WIIB 3GTGB 4X3TA 4BS9A 3C46A 3L9AX 5JEAG 3GQBA 1YNND 5I9PA 4DXGA 2JA5B 1KNAA 2IJ0A 3D3RA 2RBMA 4IN3A 1FGBD 1DCZA 4DAPA 3JAME 2K03A 2A6HC 1M8AA 1ZYRD 3BDOA 4KI0A 1EWHA 4KK7A 4QB4A 1QOHA 4ZUJA 1I4XA 1V43A 1NSNS 1GUGA 3I72A 2EYMA 3QG1A 2VB3X 1O7ZA 3H09A 3GTOB 2SNMA 5J39A 1OXVA 1F2ZA 3TP6A 1GUOA 1ONLA 5DM73 5DAUA 3MFYA 4ZK9B 1Y69U 1S5DD 3URYA 2F0EA 2SOBA 5CV9A 1F2MA 1ET6A 1RF2D 4F88A 2RKSA 1W6KA 5CORA 1C8CA 4C3JB 3M85A 2EPBA 5JOBA 4RGTA 3PV0A 2E74C 1IL8A 3GV6A 2MGSA 2NVXB 1ZYRC 3OIPA 3M7NA 1VMPA 4YIJA 2B8FA 1HA6A 3PUXA 3DWAA 5IIFA 4ULLA 2IX1A 2R93B 4ABNA 2X6GA 3LWUA 2PZUA 1Y8NB 4FF2A 4KN4C 1IHZA 5CBEE 5JEAJ 1BO0A 5CYUA 3GTKB 1SAPA 1KNEA 2D5DA 1VF5C 2CVRA 5FKAC 3BZDB 5EKIA 5IGFA 4V190 4ZQ3A 3S1MB 5C3XA 1ENFA 1VF7A 3HOUB 3S2DB 1EY6A 3AB9A 3OMGA 4EQOA 3V05A 5I2XA 2DY7A 2B2YA 4XYQA 2NB0A 1CTMA 2HUGA 1QNKA 2K7VA 3FVQA 4M1UB 1JWUD 3MA2B 2GA4B 3R2IA 3NUCA 3HOXB 3BYTB 4BWGB 5K5PA 2Z4IA 4CJ2C 5NUCA 4K8JA 1PFBA 1XXGA 2RDFA 2B2VA 4PQXA 3K57A 2KCCA 1MI2A 5COYA 1R4PB 3HOYB 1GHJA 4OO1I 3E6ZX 3HOVB 1PLFA 2BA0A 1AFPA 2F0KA 1PRTB 2HDMA 4MIUA 1SMYD 3BDLA 2LKVA 2EVBA 2AUKA 3NBIA 3NTIA 2C5CA 4I65A 2K28A 3KBGA 3GV3A 3I4LA 4KJNA 1TT2A 5M9OA 1SNMA 1MSGA 3ONAB 1IYVA 4PMBA 3G6JB 2QILA 5JVH3 1OXXK 3FDTA 2E75C 2E2HB 1YNJD 1CHQD 3OWEB 5EKKA 4KKSA 3QO2A 4BY7B 2G9DA 1G2SA 3NWSA 4QUFA 1LT5D 1JQYD 3K5LA 5HURA 5C4ZA 2F0DA 2MPMA 2O5JC 1ZXTA 4F7XA 4ZRZA 3H0GB 1U9RA 2B2WC 4UDUC 4F8MA 2OEOA 1WTOA 2O4XA 3HKZB 3MTSA 2NTTA 4TSSA 4BA2I 4C3HG 4K14A 1JE4A 5C0XH 3KLRA 3RMHA 2WV6D 2F0QA 3SHLA 4IALA 1CQFA 1STEA 4ID6A 4RGNA 1LACA 1I4PA 2A6ED 2R92B 3T13A 1PMRA 1FNWA 3DM1A 4G7HC 1R4QB 4A3BB 3I91A 2WAQB 3CRKC 3HGBA 4G7ZC 1J8IA 3VA5A 1PRTD 1I4GA 2WINB 2NUCA 2A73B 4H13C 5M5XB 1JOKA 2N88A 3FPPA 2SEBD 4HR7B 1HFGA 2EXZA 5M3MB 1HTLD 2F0VA 1PRTF 3LX0A 1PDQA 2F0OA 5EPJA 3OW7A 3J80L 4IUVA 2K1BA 2HDLA 4KJOA 2F4IA 2OT2A 4QMGA 3OPOA 4HEDA 2A69D 4ZYSA 1TY2A 3GTMB 2DY8A 2EZVA 4RH6A 4CKEA 4K5VA 4RKBA 4XQNA 3M4OB 2X69A 5K36H 1SNCA 1X3QA 1DONA 2A6EC 4H7BA 5ELDA 5JEAH 1JORA 1STYA 2ID0A 1LTID 3R3OA 3ERQA 1AZQA 3A7LA 1SFOB 5D3IB 5M5YB 1SYGA 1D1KA 1BF4A 2RDHA 2JA6B 5KRUA 3SK4A 4FVMA 1STNA 1PRTC 5I9OA 2EJFC 1V1PA 2Y0SB 1X32A 1LTRD 5ELCA 5IT9E 4FYDA 3DHQA 4RGOS 2EY6A 2EYLA 3Q6SA 1BOSA 4C3IB 4KY7A 1SYFA 4Q5VA 2D62A 1TWCB 4HTHA 2EYFA 1B50A 2PYKA 4B08A 2NZ1D 2K04A 5AFWA 3R8BA 2QF7A 1GXDC 3DUZA 4HMJA 2NTSA 3K5NA 3PO2B 1XX8A 3MXPA 4A93B 1PZKD 1F9SA 4TQUS 4FXDA 1J9OA 3A7AB 3K7AB 2MUYA 1AEXA 2MHVA 1B44D 3S9WA 5I6YA 4A3IB 5E4XA 4RA8A 4WORA 1EY7A 2QDBA 2L1BA 2NN6H 4C56C 4HCEA 1QILA 1I4RA 2M2LA 3M4YA 1A3VA 1XWEA 3SK5A 2NN6I 4EQNA 5D65A 1CM9A 3BVGA 1Q1EA 2VB2X 4IURA 1SNOA 5LL6S 1E2ZA 4DFAA 1ZEQX 1CT1D 2L11A 1I4HA 3GD7A 4L63B 4OIKA 3NWTA 2XWJB 4XIGS 2N55A 5ISRA 5CMDA 2K5DA 1BQQT 4IQZA 2KQ3A 2PCFB 1SSOA 2LMCB 4KKUA 2BDOA 1JB3A 5LL6X 3P20A 1ENAA 1SYEA 3S1NB 3JAML 3ND9A 2XIWA 4RCNA 4DN4M 5E1FA 1QCBD 1Q8IA 5C4XB 1HA5A 1NUCA 3DWQA 5CV7A 2WKCA 1OO9B 3J7AV 1TU2B 3W3AA 1LTGD 1Q12A 4KHZA 2Q8IB 5JPMC 5IGBA 4S3SA 5DEHA 5KYIA 2JE6I 2Q8TA 1CI3M 1RTOA 2ICEC 2QEJC 2RQXA 2A68D 1ET9A 1ZKOA 3NTHA 5C0XJ 1D2BA 1FNUA 4KV6A 5C6AA 4XTCS 2BDNA 2ICIA 2LFNA 3MHBA 3S2HB 3S16B 1PFNA 1B9NA 4NMZA 4NP5A 3T51B 2K5WA 4X3SA 1NCVA 2L4NA 4A3JB 3HZXA 3TDQA 4KY6A 3HOWB 3R93A 1UNSA 1BUVT 3RD4A 3NXWA 3I70A 5C3EB 3T16A 4XXEA 4R8IA 4BY1B 1RKNA 2PO4A 4CHTB 3D6CA 2AQ2B 3KUPA 2XSCA 4DAVA 2J4XA 5A2QE 3TP8A 2XN9C 1EU4A 1TR5A 2L9HA 2F0NA 3P7JA 5KGUA 3D8GA 1LABA 2CQAA 2EYJA 4A3GB 4UAIA 1GUTA 4O42A 1YNNC 5EGTA 3TZDA 3CKIB 4L8JA 2X6LA 1TY0A 1LO5D 3WOFA 1S4ZA 1SJHD 4HSPA 5TSSA 2B2TA 3ITPA 4DU9A 4FO2A 1HTPA 3BG3A 5EKLA 4HAEA 1AZPA 3SVMA 5JJZA 4TRDA 2F0JA 4XQQA 3CRLC 3FKIB 1EZ8A 2AUJD 3D4DA 1CA6A 3D31A 3IKJA 1CHPD 1EFID 2I07B 2KVMA 3U9OA 3QJYA 4LMQD 1Y1VB 2H4OA 3C3LA 3A8KE 2R3ZA 1SE4A 4KN7C 1CZWA 4IUTA 4ZKCB 1G6ZA 2DN8A 4KHVA 3E0JA 1KLUD 1EL0A 3A54A 3HEJA 4C2MB 2F0UA 1V1OA 1VMCA 4KY5A 2HCIA 1F9RA 3LNNA 1STHA 1C48A 3S15B 2K5QA 1QG7A 2PZWA 1SBBB 4FF3A 1HRJA 4IUUA 1GUNA 3TP7A 1NR2A 1KTKA 1TQOA 2F0SA 4N9PA 1TWFB 1O7YA 3Q22A 1IW7D 2WB1B 2PPBC 5A35A 2VUMB 1RHPA 3Q24A 2K05A 1DM0B 3ND8A 4CBVA 3N6RA 5T1IA 3QOJA 1EY8A 1EY5A 1D1IA 1L0XB 4R8NA 2IL8A 3S14B 3H6MA 1XTCD 1DJRD 5C4HA 3A8JE 3K6OA 1EEID 4J1MA 1DOLA 5FOBB 4C3JG 2EY1A 2K33A 1ESFA 3PUWA 3SXHA 2D2CC 1WTQA 5IGEA 4B9XA 3GP7A 3K5MA 5ELBA 1LT6D 4NKLA 3OWFA 4CGYB 4K6DA 3K58A 2B39A 1E2VA 3BVMA 4ILWA 1C4QA 1FR3A 2RDGA 4RKLA 2TSSA 3OIQA 3FRPB 3NK9A 4DAYA 1WD1A 3NHHA 5HGTA 2A5HA 1IW7C 2B63B 1SDFA 2FMCA 3RZOB 4ZUIA 4U68A 4N9TA 2FINB 2F0HA 2IX3A 1SMYC 2EOTA 4O1NA 1PZID 1RJTA 3GO5A 1OXTA 4IFDG 3WOEA 4K5WA 3F2UA 1CK1A 1E0BA 1VCIA 3MVVA 4NW2A 1LT3D 1LLRD 5FLXE 2I46A 3J7AF 1DXMA 2KUMA 2F1MA 1NAPA 3E5SA 4FNFA 1HUNA 2M00A 1TS2A 1TIID 4KD3A 5C0XI 2F03A 4A3KB 3MWYW 3NPPA 1WTVA 5T1GA 3T4AC 3KK7A 4OGQC 1YNJC 3EROA 3GTQB 2PW7A 3SDZA 4EGVA 4B9WA 3TSSA 5FO9B 5I6WA 2F0FA 2MP1A 1KDCA 1A2TA 4MHEA 4OL7A 1GOZA 1CQVA 2KJXA 1H9MA 4HMIA 4HCSA 1RD9D 3H3VC 1O7LA 3VYRA 1WTXA 1KLGD 4K2LA 2EYPA 1JR0D 2PW5A 1B2TA 2CW0D 2B2UC 3P75A 5C5MA 2KCNA 1Q90A 3PUYA 4RGMA 1BBXC 4OO1G 3MXUA 2XWBB 1SXTA 1BCPF 3EFXD 2IWHA 1SYDA 2F0GA 5I4DA 1MD2D 1G2TA 4DNTB 3HOZB 2NVQB 1Z7TA 4A3MB 3ZYYX 5JPNC 3FPUB 3VR4A 5EBCA 1W6JA 1G91A 3UI2A 3K5OA 2L55A 5IT9L 3TMEA 2V4DA 2MJ8A 4J6HA 4OHJA 2R61A 2D9UA 4LJZC 1KABA 4IFDJ 1TWGB 1QE6A 1G8ZD 2IT1A 2AWOA 3O13A 5IGDA 2IW3A 3TP5A 3CQZB 4KMUC 5C3WA 1U4MA 4PV1C 1EY4A 3VYTA 5EBDA 3NQTA 2F3WA 2CW0C 1Z6HA 3EQLC 3SK6A 2F0TA 1Z47A 5JVG3 2A69C 1PXUA 2B2WA 1B1ZA 3I73A 3RUZA 1ILPA 1JOOA 2KA7A 2C9OA 3TBIB 3IL8A 1WD0A 2K32A 4ME5A 1MSHA 4FXGC 3VR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WD0 A;  1AZQ A;  1G2T A;  2HCC A;  4IUU A;  5COR A;  1WD1 A;  1HRJ A;  4RWS C;  1NR2 A;  2HDM A;  1C8C A;  2NWG A;  4X3K A;  4IUR A;  4R8I A;  1BF4 A;  4U68 A;  2EPB A;  2FIN B;  2K01 A;  1ESR A;  4ZKB B;  1IKM A;  2EOT A;  3KUP A;  3FPU B;  1IKL A;  2L11 A;  1U4P A;  1G91 A;  3UI2 A;  1RJT A;  4OIK A;  3KBX A;  2Q8R E;  1A15 A;  1IL8 A;  3H91 A;  4XT1 B;  3GV6 A;  2MGS A;  1O7Y A;  1X32 A;  3F2U A;  4ZAI A;  1HHV A;  1EOT A;  1F9Q A;  1DOK A;  1E0B A;  3N52 A;  4IUP A;  3DM1 A;  4NW2 A;  2N55 A;  2L9H A;  1BNZ A;  1VMP A;  5CMD A;  2K28 A;  4X3T A;  2L12 A;  5D14 A;  2VXW A;  2MJ8 A;  3P7J A;  3I91 A;  1RHP A;  3Q6S A;  1SSO A;  3DEO A;  4UAI A;  2K05 A;  1HA6 A;  2D9U A;  4O42 A;  1TVX A;  2RA4 A;  3HP3 A;  5EJW A;  5T1I A;  3I90 A;  2KUM A;  1WTP A;  5EQ0 A;  3TZD A;  1KNA A;  2X6G A;  3GV3 A;  1J8I A;  3TN2 A;  1NAP A;  1QE6 A;  2X6L A;  2XIW A;  4DN4 M;  2KED A;  1XYI A;  1B50 A;  2IL8 A;  1HUN A;  2NZ1 D;  2K04 A;  1O80 A;  4IUQ A;  5CBE E;  1MSG A;  1S4Z A;  5AFW A;  1X3P A;  1F2L A;  1BO0 A;  2K03 A;  3ONA B;  1M8A A;  2EE1 A;  2N88 A;  2B2T A;  2J7Z A;  1SAP A;  1KNE A;  2RSN A;  3MWY W;  1U4M A;  1XX8 A;  1HFG A;  2B2T C;  3FDT A;  2CVR A;  2NYZ D;  1WTV A;  5T1G A;  1ROD A;  5EKI A;  4HAE A;  1F9S A;  3D6W A;  4RAU C;  1AZP A;  1DOL A;  1PDQ A;  1U4R A;  3SVM A;  5JJZ A;  1F9P A;  1DZ1 A;  2KEE A;  1J9O A;  3QO2 A;  5EPL A;  5CBA E;  5EPJ A;  1HFN A;  1G2S A;  2MP1 A;  4IUV A;  5DNF A;  5EPK A;  4QUF A;  1CA6 A;  4OIJ A;  3LWE A;  2K1B A;  5E4W C;  2Q8T A;  2HDL A;  4MHE A;  3G7L A;  3I3C A;  1RTO A;  2KVM A;  4R9W A;  2DY7 A;  1B3A A;  4LMQ D;  2B2Y A;  4HSV A;  2FFK B;  1O7Z A;  4HED A;  4X3U A;  1WTQ A;  2MPM A;  4CJ1 B;  4HCS A;  2HUG A;  1QNK A;  3I8Z A;  2R3Z A;  3DEP A;  1ZXT A;  2B2Y C;  5E4X A;  1EIH A;  1AP0 A;  1WTX A;  1RTN A;  2DY8 A;  2FMM A;  2JYO A;  2B2W A;  4RA8 A;  1JE4 A;  3IFD A;  1B2T A;  2FJ2 A;  2B2U A;  1WTR A;  2BDN A;  2B2W C;  1MGS A;  2L1B A;  4ZK9 B;  2KEC A;  2RSO A;  1ILP A;  2X69 A;  4IUT A;  4ZKC B;  2B2U C;  1G6Z A;  1EIG A;  4CJ2 C;  1EL0 A;  1ILQ A;  2M2L A;  4QUC A;  1X3Q A;  1PFN A;  1PFB A;  1PFM A;  4XT3 B;  4CJ0 B;  1WTO A;  1BBX C;  2B2V A;  1DON A;  2RVL A;  1ML0 D;  1DOM A;  1VMC A;  3IL8 A;  2HCI A;  1JIC A;  4ZLT F;  1F9R A;  4X3S A;  1Q3L A;  1WTW A;  1NCV A;  2L4N A;  1B4O A;  1B53 A;  1MI2 A;  2FHT A;  2B2V C;  1ICW A;  2SDF A;  4MN3 A;  5COY A;  1WVL A;  1CA5 A;  2KOL A;  3MTS A;  1LV9 A;  1GUW A;  1U4L A;  4XDX A;  1QG7 A;  1NR4 A;  2H1E A;  2JP1 A;  5D65 A;  1SDF A;  1HUM A;  1MSH A;  1CM9 A;  3R93 A;  1EQT A;  1PLF A; 
#chains in the Genus database with same CATH topology
 2F3V A;  2PNR C;  2PZT A;  4IJL A;  4X3K A;  1VQC A;  4IOA A;  3OTO L;  5LHY 1;  4DUZ Q;  4AYB B;  3GDE A;  3S17 H;  1K83 H;  3OYY A;  3BYY B;  1U4P A;  3CW2 C;  4EQP A;  3PMF A;  2OF1 A;  1JC7 A;  3P1H A;  1A15 A;  3I2Z A;  4GKJ Q;  2VQE L;  2VL6 A;  4X66 Q;  1A3T A;  1HQR D;  4H44 C;  2JN4 A;  1WFQ A;  3PIP 3;  1EQV A;  2F4V L;  1GHK A;  2VNU D;  2LXK A;  2DJG C;  3U58 A;  4FDB A;  4DK6 C;  4C1N I;  1XNR Q;  5M3F B;  3ERS X;  1JCK B;  1KAA A;  3MFG A;  1EWC A;  4DUZ L;  2A6H D;  4IUQ A;  1KD1 C;  3F2C A;  2F3I A;  4HN7 A;  3GTG H;  3D4W A;  5IOD A;  1K3B C;  3QIA A;  2RHS B;  2NYZ D;  3W5O A;  2BE5 D;  4GKJ L;  5F2D A;  1XMO Q;  2IHF A;  1ROD A;  1CSP A;  4DR1 Q;  1EZ6 A;  2JA7 B;  1SND A;  4X66 L;  3PUZ A;  5CV4 A;  3VYU A;  1G29 1;  1QB5 D;  2KEE A;  3PGZ A;  2JA6 G;  4OWX B;  3RN2 A;  2Q2T A;  5DNF A;  5EPK A;  3S17 B;  3DMU A;  3LWE A;  1XNR L;  4K0K Q;  2G9H D;  3G7L A;  3I3C A;  1OXS C;  3C1F A;  1IBL Q;  5CV6 A;  1GUS A;  2Y0S G;  2B2Y C;  2ZJP A;  4KLK A;  2XGT A;  5IGC A;  4HIK A;  2L5T A;  3KJP A;  2AKW B;  4QGU A;  2FJ2 A;  3PIO A;  4DPG A;  1EU3 A;  5JAV A;  1HXY D;  2RSO A;  4C3I G;  2UUB Q;  4KKT A;  1XMO L;  4DR1 L;  2ZJR A;  2K6A A;  4JVZ A;  4QUC A;  4XT3 B;  1PFM A;  1PH9 A;  1QUQ A;  3KOJ A;  2WP8 J;  3GTO H;  1I6H B;  5EPL A;  1B53 A;  3CU7 A;  1EY0 A;  2B2V C;  4RMF A;  4DNR B;  1M90 C;  4PNY A;  1GUW A;  1RCV D;  1JWS D;  5CC4 A;  5AJ3 Q;  1S5C D;  1NR4 A;  2TMP A;  3PO2 G;  5FLM H;  4K0K L;  2NBF A;  1IBL L;  1AN8 A;  2DNC A;  4A93 G;  2CWA A;  4G7O C;  1Q82 C;  3BVZ A;  1PHJ A;  4A3D B;  1V1P B;  4J8Q A;  1IKL A;  5A2Q L;  4XYO A;  3OMC A;  4H0L C;  4HJ5 A;  2UUB L;  1K8M A;  3KBX A;  3W2D A;  3MXG A;  3H91 A;  2YTV A;  1ENC A;  1I3Q H;  2D0O A;  1DOK A;  4IOC A;  3KFU A;  1H9J A;  3SK8 A;  3I4M H;  3J81 E;  4C3J H;  1A8V A;  3IAY A;  1ICF B;  1SLJ A;  4A3I G;  2BE5 C;  4R1J A;  1FD7 D;  5J22 A;  1GJX A;  5AJ3 L;  3C2P A;  2HD3 A;  4DV0 Q;  1FGU A;  2HQE A;  5EQ0 A;  1UEB A;  3TN2 A;  3KLS A;  2OXP A;  3EJI A;  4RCO A;  1S40 A;  3T56 B;  1SE3 A;  5IY0 A;  1TWA H;  2O2L D;  4F87 A;  5FLX c;  1O80 A;  1AH9 A;  1O78 A;  1X3P A;  3X3M A;  4LK1 C;  3AU7 A;  4A3F B;  4A3E B;  2OWO A;  1D6E C;  3GTJ B;  4A75 A;  1I94 Q;  2NVY B;  5ELE A;  3ER0 A;  2JA8 G;  5KEE A;  3J80 i;  5C44 H;  2PMZ B;  4UY8 C;  4DR2 L;  4LUV A;  2R7Z H;  1K8O A;  1STG A;  3QOL A;  4DV0 L;  3NP8 A;  2HIX A;  4WJ4 A;  1B3Q A;  2K50 A;  4B3T Q;  2YYZ A;  4HSV A;  4K2K A;  1LTT D;  1KAW A;  2N8N A;  4UHV A;  1SMX A;  2A68 C;  1EIH A;  1I3Q B;  5IP9 G;  4CDF C;  3S1M H;  2DNE A;  3I4M B;  4AYB E;  3CCJ A;  1WTR A;  1LT4 D;  1I94 L;  3S2D H;  1IZ6 A;  4IZ8 A;  1TWH H;  2JXM B;  1H9S A;  1NNX A;  4IFD H;  5ELN A;  3QWN A;  1PTO H;  1BBU A;  1X9N A;  1GM5 A;  2NN6 G;  3ICE A;  5FO7 B;  3NEN A;  1HQM C;  4C3H H;  1VQ7 A;  1TWA B;  4O2D A;  1XJV A;  3NQI A;  5C4X G;  2JP1 A;  1BVS A;  3VR6 A;  3Q0A A;  4B3T L;  4IFD I;  3A55 A;  3D6W A;  4ODG A;  4DK1 A;  2UU9 Q;  2ZXP A;  1L1O A;  3DWP A;  2NWG A;  1F77 A;  4JK1 C;  4LUZ A;  1QVF A;  1GO3 E;  4DF7 A;  1E2W A;  3QB3 A;  4Y7N H;  5C44 B;  3F8T A;  1R9T H;  1CSQ A;  4RFB A;  2E2I B;  3EA6 A;  2AQ1 B;  4P74 A;  2QKI C;  4RHS A;  2R7Z B;  2PQE A;  1EFW A;  1ASY A;  1TS3 A;  3I7F A;  1VQ4 A;  5J1Z A;  1EOT A;  2A1A A;  1PYW D;  4BBS H;  3HFZ B;  1SNQ A;  3OOC A;  4L5Q A;  2Q2H A;  2RCF A;  3NBH A;  2L12 A;  5CV8 A;  1LTS D;  5GAE C;  3G71 A;  1Y1W B;  5GAH C;  5DM6 3;  4LAA A;  3DEO A;  2F52 A;  4DA2 A;  1PH1 A;  5EJW A;  4CDC C;  3J81 j;  3I90 A;  3U9S A;  4DXF A;  2UU9 L;  2XVS A;  4DV1 Q;  2XRS D;  1IBK L;  3GTP B;  1XYI A;  1TWH B;  1EYC A;  2EDG A;  3FEW X;  4I7Z C;  4AIM A;  1EYA A;  1UAP A;  2F0W A;  1PTO B;  5IYC H;  4LWC A;  4RHR A;  5I2Y A;  1J6Q A;  3TS2 A;  4C3H B;  1MJC A;  3D4R A;  3HOW G;  3SE0 A;  2ZXR A;  5CGK A;  1P8L A;  2JEB I;  4OO1 H;  1U4R A;  3J80 c;  1QUQ B;  5C3E G;  3L7Z C;  2CHB D;  2CFM A;  1K8A C;  2NVT H;  1KL9 A;  3MC0 B;  2LXJ A;  4AQY Q;  2EXD A;  4Y7N B;  5IYB H;  1II3 A;  2Z1C A;  4DV1 L;  1R9T B;  1BCP B;  2FFK B;  1I6V C;  4KTA A;  4X3U A;  4JBK A;  1J5E Q;  2K4K A;  2Z6K A;  1RTN A;  2JYO A;  3L3O C;  4BBS B;  1STA A;  4WFN 3;  2ATW A;  1LTA D;  2F0M A;  2E2D C;  3Q23 A;  5BN5 A;  2KEN A;  4CJ0 B;  1LTB D;  2RVL A;  1HZA A;  1JIC A;  4ZLT F;  1WTW A;  1N36 Q;  5ELF A;  3SR1 A;  4G57 A;  1VQO A;  4XDX A;  3H0G H;  1B9M A;  1TS5 A;  2H1E A;  4GNX C;  4AQY L;  2B8G A;  2QA4 A;  2EYO A;  1EQT A;  2JSO A;  3VYS A;  1VQM A;  4L5R C;  2BOS A;  1J5E L;  3DXJ C;  1CKM A;  2M9V A;  2K01 A;  4MTK A;  2NZO A;  1RDP D;  3A5Z B;  3SEB A;  2R93 G;  1SNP A;  3T53 B;  1MJE A;  1A2U A;  1HPC A;  1E1T A;  2NVT B;  1UEA B;  1V8Q A;  5FLX L;  3HG9 A;  3N52 A;  2E2J B;  1BNZ A;  3B6Y A;  2KHS A;  2EY5 A;  1N36 L;  3BS1 A;  2YU9 H;  2PQA A;  1L0Y B;  1S3O A;  3JAM i;  3MXN A;  2H5X A;  1S5F D;  4QL5 A;  4LUO A;  3BDC A;  4Z9C B;  1SYC A;  4G4K A;  3LGJ A;  4LF9 Q;  5KND A;  1JJG A;  2KED A;  2WKD A;  5CV5 A;  1FYC A;  3X3N A;  5FJ8 G;  1E24 A;  2EQS A;  2F0L A;  3VR2 A;  3T1H L;  1STB A;  3IFT A;  4A3B H;  1XTD A;  2JJQ A;  5IWA L;  1JOQ A;  1H9K A;  1DD2 A;  1T5E A;  3MEH A;  1MHW C;  1E3P A;  1HCZ A;  3K0Y A;  4NDX A;  3PUV A;  1Y8P B;  4CKB A;  1IYU A;  1H9S B;  3GTL H;  1PH6 A;  1AW7 A;  1PH2 A;  4WJW A;  5CR3 A;  1DZ1 A;  4P2C B;  1EEF D;  1S5B D;  3NE5 B;  3HOX G;  2ZTD A;  1Y8O B;  1OXU A;  1HFN A;  4BBR H;  4KD4 A;  1E22 A;  1PH4 A;  3I4N H;  5E4W C;  5IOC A;  3MAQ A;  1HZ9 A;  4V0B A;  3C1E A;  3CCU A;  1Q1B A;  4LF9 L;  3RLO A;  3HS0 C;  2VZA A;  3A0J A;  1W2B A;  3HOY G;  3DEP A;  4JOI C;  1PTO D;  2WB1 G;  2FMM A;  3RZD H;  1QNU A;  2ZXO A;  1SE2 A;  2QCP X;  1PH3 A;  3HOV G;  1MBY A;  2YU9 B;  4IPH A;  2JEA I;  2KEC A;  4FXK C;  3ULP A;  5M5W B;  2KCT A;  4R4C A;  1WCM B;  3BZC A;  1RIP A;  4GS3 A;  4ZAI A;  1PTO F;  1PYS B;  4QCL A;  2SDF A;  5KNB A;  1KDB A;  2KOL A;  1LV9 A;  1U4L A;  2IX0 A;  4EVO A;  4U67 3;  4GOP B;  3TZU A;  1Q86 C;  4XQJ A;  2Z4H A;  3AMU A;  2FXQ A;  1BCP D;  5KNC A;  5GAD C;  1T5X D;  4K8I A;  5E3F A;  3GTL B;  4E6I A;  1ESR A;  3T1Y Q;  4ZKB B;  1X55 A;  1CUK A;  2KHJ A;  1K8G A;  2KBN A;  2AWN A;  4BBR B;  5GAG C;  3H94 A;  5IYD G;  3I4N B;  1N34 Q;  1HHV A;  1KDA A;  1PZJ D;  2WB1 E;  3S1R H;  1SFO H;  4C1N K;  4X65 Q;  4PMW A;  5D14 A;  1CKO A;  2EY2 A;  4Q0F A;  2VXW A;  1X65 A;  4JBM A;  2JA6 H;  1A3U A;  3EVQ A;  4DV7 Q;  4NB3 A;  1JJC B;  4LFB Q;  3JAM c;  1FVI A;  4JBW A;  3RZD B;  1IL2 A;  1YJW A;  1WTP A;  2GVB A;  4EX5 A;  4FF4 A;  5E7N A;  4QIW B;  3VR3 A;  3CHB D;  4LF8 Q;  3T1Y L;  3U50 C;  5FO8 B;  2EE1 A;  2J7Z A;  4JI5 Q;  1EOV A;  4UP7 A;  4C3I H;  3K59 A;  1BDO A;  1PTO C;  3AQQ A;  1N34 L;  1VDZ A;  1X6O A;  2K75 A;  1PH7 A;  5C5L A;  4QF4 A;  4X65 L;  5IGG A;  4DV7 L;  5CBA E;  1EQR A;  3AYH B;  4PZ8 A;  3A5U A;  5ELO A;  2I5M X;  4OIJ A;  3R2T A;  4GNX A;  4R9W A;  4GN4 B;  5J3B A;  3J80 E;  3PSI A;  3HRZ C;  2J0T D;  4M8A A;  5D3D A;  4LF8 L;  2R6G A;  1AP0 A;  3NTK A;  3S1R B;  4JI5 L;  2XNA C;  3IFD A;  5C4J H;  1BCP C;  1MGS A;  1PA6 A;  2WAC A;  3V96 A;  2ENB A;  1ILQ A;  4DAY B;  1VQJ A;  2V1C C;  1EY9 A;  1ML0 D;  3A56 A;  4DNI A;  1SYB A;  3S1Q B;  4A3I H;  1CA5 A;  2EYH A;  1ICW A;  2PQA B;  4IUN A;  1BXT A;  4OEM B;  1G51 A;  3KLS X;  4YCW A;  3MXN B;  2N78 A;  4DV5 Q;  5KIX A;  4A3K G;  1NTG A;  3CMA A;  5LMN Q;  2AQ3 B;  2HCC A;  1K28 A;  5KYL A;  2NZH A;  1TS4 A;  3PIO 3;  5BN3 A;  4CDE C;  3CCE A;  4FP5 D;  1JB7 A;  2Z8L A;  1IKM A;  2QDL A;  4TKO B;  1WOC A;  2F0I A;  1MIU A;  4WRD A;  1I50 B;  1FJG L;  4XT1 B;  2EJG C;  1SRU A;  3WDN A;  2JA8 H;  4K5X A;  4IUP A;  1VQN A;  3PO3 B;  4YCU A;  2EJM A;  2BA1 A;  2ZT9 C;  1D8L A;  4OX9 Q;  4L5T A;  1CZG A;  4DKA C;  2A74 C;  1D5Z C;  5M3M G;  3TQY A;  2L0C A;  1TVX A;  2RA4 A;  3HP3 A;  1SEB D;  5C4J B;  1S5E D;  4DV5 L;  1D5X C;  4L6T B;  3K0X A;  3J7Z C;  3MZ5 A;  3RLF A;  3OSO A;  5C0X G;  3U4V A;  1EYD A;  3V2T A;  3SGI A;  2F0P A;  1E7Z A;  1BR9 A;  3NEL A;  3M3Y H;  1F2L A;  1TKW B;  4JOI A;  4GLA C;  2XRQ D;  2RSN A;  2B2T C;  1WTH A;  1NMF A;  4A3L G;  4X62 Q;  4GZY C;  3S1N H;  4RAU C;  1W3S A;  4OX9 L;  1F9P A;  2GVA A;  1DYQ A;  3NSW A;  1ASZ A;  4A3M G;  3VA7 A;  3F1Z A;  2MO0 A;  4YWL A;  4IO9 A;  1A63 A;  3FMC A;  3KDF B;  5G3L D;  1QJO A;  1H9R A;  4UPA A;  1B3A A;  2BCO A;  1D5M C;  2IPK D;  5BN4 A;  3M9B A;  4FF1 A;  4CJ1 B;  3I8Z A;  1NE3 A;  3KF8 A;  5FK9 C;  2JA8 B;  3KF6 A;  1NBW A;  1QWY A;  1A6X A;  4IPD A;  2JA5 H;  4WJ3 M;  4CKC A;  2OCE A;  2B2U A;  1I4Q A;  5G3L F;  1F2Y A;  4DV3 Q;  1EIG A;  3A8I E;  4X62 L;  3M7G A;  5HY6 A;  1DOM A;  1CFM A;  1Q3L A;  1UUP A;  1B4O A;  1K83 B;  2FHT A;  2E76 C;  2VS1 A;  4GN3 B;  4MN3 A;  4PMC A;  1WVL A;  4HID A;  3VDY A;  3Q8D A;  4JYA Q;  3M3Y B;  2HT1 A;  1HUM A;  2SNS A;  4DK0 A;  4LFC Q;  4OWT B;  4RWS C;  1SJE D;  1C9O A;  3J7Y W;  3S2H H;  2QEX A;  3S16 H;  3CCR A;  4MTN A;  4BXX H;  3OHX C;  4K6L A;  2R7D A;  4MNO A;  4BA1 I;  1VQH A;  1HZC A;  1YJN A;  2O5I C;  4PZ6 A;  4DGZ A;  1JWM D;  2I5L X;  1GKH A;  2Q8R E;  3J81 L;  5K36 G;  1FNV A;  1F9Q A;  1HH2 P;  2LS0 1;  4B3R Q;  1M4V A;  2LY7 A;  2WII B;  3GTG B;  4X3T A;  4BS9 A;  3C46 A;  3L9A X;  4JYA L;  2PNH A;  5JEA G;  3GQB A;  2ASB A;  1YNN D;  4HJ7 A;  5I9P A;  4DXG A;  5DLQ E;  2JA5 B;  1AE3 A;  4LFC L;  1KNA A;  2IJ0 A;  3D3R A;  2RBM A;  4IN3 A;  3CCV A;  1FGB D;  1DCZ A;  4DAP A;  3JAM E;  2K03 A;  2A6H C;  1B7Y B;  1M8A A;  1ZYR D;  3BDO A;  4KI0 A;  1EWH A;  4KK7 A;  4GN5 A;  4JC0 A;  4QB4 A;  1QOH A;  4ZUJ A;  1YI2 A;  4B3R L;  4LNQ A;  2DUD A;  1I4X A;  1V43 A;  2E8G A;  4X6A H;  1CKN A;  3CAM A;  1NSN S;  1GUG A;  1V9P A;  4AYB G;  3TEH B;  3I72 A;  2NVX H;  1AE2 A;  2EYM A;  4R4T A;  3G4S A;  3QG1 A;  1SRO A;  2VB3 X;  1VQA A;  1O7Z A;  3H09 A;  4APV A;  1KC8 C;  2CCZ A;  2SNM A;  3GTO B;  2MO1 A;  5J39 A;  3CD6 A;  1OXV A;  1F2Z A;  2BH8 A;  3TP6 A;  1GUO A;  1ONL A;  5DM7 3;  5DAU A;  1YHA A;  2R93 H;  3MFY A;  4ZK9 B;  1Y69 U;  1S5D D;  3BU2 A;  3URY A;  4Y52 H;  1YEZ A;  2F0E A;  2SOB A;  5JJI A;  1JE5 A;  4PG3 A;  3GTK H;  1UWV A;  5CV9 A;  3I4O A;  3OW2 A;  1F2M A;  1ET6 A;  1RF2 D;  1B8A A;  4F88 A;  2IY5 B;  3UDF A;  3CC2 A;  2RKS A;  1EUJ A;  1W6K A;  5COR A;  1A62 A;  1C8C A;  4C3J B;  5FJ8 H;  3HOU H;  3M85 A;  2EPB A;  4JI6 Q;  2JA7 G;  5JOB A;  4RGT A;  3PV0 A;  4P72 A;  2E74 C;  2I5H A;  1IL8 A;  3GV6 A;  1VQE A;  2MGS A;  2NVX B;  1ZYR C;  2AHO B;  3OIP A;  2N49 A;  1X56 A;  3M7N A;  1VMP A;  4YIJ A;  3HOX H;  2B8F A;  2PI2 A;  3CCQ A;  1HA6 A;  3PUX A;  3DWA A;  5IIF A;  4ULL A;  4DV2 Q;  3E3X A;  2IX1 A;  2R93 B;  4ABN A;  2X6G A;  1VQ5 A;  3LWU A;  2PZU A;  1Y8N B;  3A74 A;  2MQH A;  3HOY H;  4FF2 A;  1YZ6 A;  4KN4 C;  4JI6 L;  1IHZ A;  1IYJ B;  5CBE E;  5JEA J;  1BO0 A;  5CYU A;  3GTK B;  3HOV H;  1SAP A;  1KNE A;  4DR7 Q;  2D5D A;  2CQO A;  1VF5 C;  2CVR A;  5FKA C;  4NPS A;  3BZD B;  5EKI A;  2UXC Q;  5IGF A;  4V19 0;  4ZQ3 A;  3S1M B;  5C3X A;  1ENF A;  3S14 H;  1VF7 A;  3HOU B;  3S2D B;  4GKK Q;  1EY6 A;  3AB9 A;  4A3D G;  5GQO A;  4AH6 A;  3OMG A;  4GLX A;  4DV2 L;  3K81 C;  3V05 A;  4EQO A;  5I2X A;  2DY7 A;  2B2Y A;  4XYQ A;  1KHI A;  4LFA Q;  2NB0 A;  4A3J G;  4A3C G;  1CTM A;  2HUG A;  1QNK A;  2K7V A;  2ZTC A;  5EAY A;  1GVP A;  3FVQ A;  4M1U B;  3ZJY C;  4OWW B;  1JWU D;  4LF7 Q;  3MA2 B;  4DUY Q;  2GA4 B;  4DR7 L;  3R2I A;  3NUC A;  4JI4 Q;  3HOX B;  1HJP A;  1YHB A;  3FP9 A;  3BYT B;  1WI5 A;  4BWG B;  5K5P A;  5IYD H;  2Z4I A;  5NUC A;  4BY1 G;  4CJ2 C;  4K8J A;  2UXC L;  1PFB A;  1XXG A;  2RDF A;  2B2V A;  4B3M Q;  1A0I A;  4PQX A;  3K57 A;  2KCC A;  5IP7 H;  1MI2 A;  5COY A;  1R4P B;  3HOY B;  1GHJ A;  4GKK L;  2Z6B A;  2E2H H;  1KIX A;  4OO1 I;  3E6Z X;  4JI1 Q;  3G6E A;  4A3F G;  4A3E G;  3HOV B;  1PLF A;  2BA0 A;  1AFP A;  2F0K A;  4LFA L;  1PRT B;  2HDM A;  4BY7 H;  4MIU A;  4A3G G;  1Q7Y C;  1SMY D;  3BDL A;  4LF7 L;  2LKV A;  4DUY L;  1VQ8 A;  2LSS A;  5IT9 c;  2EVB A;  4JI4 L;  3I56 A;  2AUK A;  3NBI A;  3NTI A;  2C5C A;  1NMG A;  1VQG A;  4I65 A;  2Q2U A;  4B3M L;  4A4I A;  1P16 A;  2K28 A;  4JG2 A;  2OTL A;  1CKN B;  1X54 A;  3KBG A;  4JI1 L;  1XPR A;  3GV3 A;  3I4L A;  2ZM6 Q;  4KJN A;  1TT2 A;  3WWV A;  1YJ9 A;  5M9O A;  1SNM A;  3FKI G;  1MSG A;  4POF A;  4YY3 Q;  3ONA B;  1IYV A;  4PMB A;  3G6J B;  2QIL A;  5JVH 3;  1Y1V G;  1OXX K;  3FDT A;  3L0O A;  2E75 C;  1N8R C;  2E2H B;  1YNJ D;  1CHQ D;  4HIO A;  3PCO B;  1VQF A;  2PMZ E;  3OWE B;  5JJL A;  5EKK A;  2CKZ B;  4KKS A;  3QO2 A;  3W1G A;  2B3G A;  4BY7 B;  2G9D A;  1G2S A;  2R92 H;  3NWS A;  4QUF A;  1LT5 D;  1JQY D;  2K5V A;  3K5L A;  4A3K H;  5HUR A;  5C4Z A;  2R7Z G;  2ZM6 L;  5LMN W;  2ZTE A;  2F0D A;  2MPM A;  2O5J C;  1ZXT A;  4F7X A;  1S72 A;  2QGQ A;  4ZRZ A;  1VQK A;  3H0G B;  1Y1W G;  1U9R A;  2B2W C;  4UDU C;  1MKH A;  4F8M A;  2OEO A;  1WTO A;  1LM0 A;  5M5X H;  4ZCK A;  4QJF A;  2O4X A;  4LF4 Q;  3HKZ B;  3MTS A;  1C0A A;  5M3M H;  4DR6 Q;  2NTT A;  4TSS A;  4BA2 I;  1L1O B;  4C3H G;  1N32 Q;  4K14 A;  1JE4 A;  5GRO A;  4A76 A;  3PF4 A;  5C0X H;  2DJF C;  3KLR A;  2VUM G;  3RMH A;  4OEL B;  2WV6 D;  3TS0 A;  2F0Q A;  3SHL A;  4IAL A;  1YHQ A;  2ALY B;  1CQF A;  1STE A;  4ID6 A;  4RGN A;  1LAC A;  5LMU Q;  1I4P A;  2A6E D;  2R92 B;  3UDX A;  5BR8 Q;  3T13 A;  3NBH B;  1NJI C;  1HR0 Q;  4A3L H;  1PMR A;  1FNW A;  3L2P A;  2KHI A;  3GTM H;  3DM1 A;  4HJ9 A;  4G7H C;  1R4Q B;  4LF4 L;  4A3B B;  1JMC A;  4A3M H;  1EQQ A;  3I91 A;  2WAQ B;  4DR6 L;  3CRK C;  3M4O H;  2Q2I A;  3HGB A;  4DR4 Q;  1N32 L;  4G7Z C;  1J8I A;  3VA5 A;  4JI8 Q;  4JBJ A;  1PRT D;  1I4G A;  4N8X 1;  2WIN B;  2NUC A;  2A73 B;  4DK3 C;  4H13 C;  5M5X B;  1JOK A;  2N88 A;  3F2D A;  5LMU L;  3FPP A;  2VY3 A;  2SEB D;  4HR7 B;  1HFG A;  2EXZ A;  5M3M B;  5M5Y H;  5BR8 L;  1HR0 L;  4IPG A;  1HTL D;  1IXR A;  1M1K C;  2F0V A;  1PRT F;  3LX0 A;  1PDQ A;  2F0O A;  4DR3 Q;  1E1O A;  4JI0 Q;  2P5Z X;  5EPJ A;  3OW7 A;  3J80 L;  4DR4 L;  4IUV A;  2K1B A;  2HDL A;  2QW7 A;  4KJO A;  2F4I A;  2OT2 A;  4JI8 L;  4N8F A;  1TXY A;  4QMG A;  3OPO A;  4HED A;  2A69 D;  1PH5 A;  4ZYS A;  1TY2 A;  5IYB G;  3GTM B;  2DY8 A;  3M4Q A;  2B63 G;  2EZV A;  4RH6 A;  4CKE A;  1TWC H;  4K5V A;  4RKB A;  4XQN A;  3M4O B;  2X69 A;  5K36 H;  1SNC A;  1X3Q A;  4LFB L;  1DON A;  1EIF A;  2JQO A;  4DR3 L;  4JI0 L;  3PO2 H;  2A6E C;  4H7B A;  5ELD A;  4A93 H;  5JEA H;  1JOR A;  1STY A;  1HNZ Q;  2ID0 A;  3DLL A;  3QR8 A;  1LTI D;  3R3O A;  3ERQ A;  4I7A A;  1AZQ A;  3A7L A;  1SFO B;  5D3I B;  5M5Y B;  1SYG A;  1D1K A;  1BF4 A;  3K7A H;  2RDH A;  2JA6 B;  5KRU A;  3CP0 A;  3SK4 A;  3CPF A;  1BKB A;  3AEV A;  1UE1 A;  1VS0 A;  4FVM A;  1STN A;  1PRT C;  5I9O A;  4JV5 Q;  2OTJ A;  4JI3 Q;  2EJF C;  1V1P A;  3CC4 A;  3H15 A;  2Y0S B;  1X32 A;  1LTR D;  4JCV E;  1QVG A;  5ELC A;  1PFS A;  3KYH C;  4JI7 Q;  5IT9 E;  4FYD A;  1LUZ A;  3DHQ A;  1X3G A;  4RGO S;  2EY6 A;  2EYL A;  3Q6S A;  1BOS A;  4C3I B;  4KY7 A;  1SYF A;  1DGS A;  2D62 A;  4Q5V A;  3CF5 A;  1TWC B;  4HTH A;  2EIF A;  1H95 A;  2EYF A;  1B50 A;  2PYK A;  3AFP A;  4B08 A;  2NZ1 D;  2K04 A;  5AFW A;  1WCM G;  3BZK A;  3R8B A;  2QF7 A;  3UE1 A;  3E9I A;  1GXD C;  3DUZ A;  1B70 B;  2NTS A;  4HMJ A;  1YBY A;  3K5N A;  3PO2 B;  4JV5 L;  1KRT A;  4JI3 L;  1K0R A;  1XX8 A;  2K14 A;  3MXP A;  1JJ2 A;  2HIV A;  3OTO Q;  4A93 B;  4EQ5 A;  1PZK D;  1F9S A;  4TQU S;  4JI7 L;  2G5D A;  4FXD A;  1U0L A;  5LMN L;  1J9O A;  3A7A B;  3K7A B;  2N3S A;  1SE8 A;  3CCM A;  3CCL A;  2MUY A;  3DM3 A;  1PYB A;  2DGY A;  2BH2 A;  1YNX A;  5IP9 H;  3I55 A;  1G6P A;  1I5F A;  4YWM A;  1YIJ A;  3AFQ A;  1AEX A;  2MHV A;  1B44 D;  3S9W A;  5I6Y A;  4A3I B;  5E4X A;  2JA7 H;  4RA8 A;  4WOR A;  1EWI A;  1EY7 A;  4YHH Q;  2QDB A;  1KXL A;  2L1B A;  2NN6 H;  4C56 C;  1KQS A;  4HCE A;  1QIL A;  3HOZ G;  1I4R A;  2M2L A;  3M4Y A;  4O0A A;  3RLN A;  5C4X H;  1A3V A;  3W1B A;  1XWE A;  3SK5 A;  3FHW A;  2NN6 I;  4EQN A;  5D65 A;  2ZJQ A;  2WAQ E;  1CM9 A;  3UE0 A;  3BVG A;  1Q1E A;  1Q81 C;  2OQ0 A;  2VB2 X;  3D0F A;  4IUR A;  1SNO A;  5LL6 S;  1EYG A;  1L1O C;  4YHH L;  1E2Z A;  4CDD C;  4DFA A;  1I6H H;  1ZEQ X;  1CT1 D;  2L11 A;  1I4H A;  3GD7 A;  4L63 B;  3J7A 5;  4OIK A;  5HGQ A;  3NWT A;  1GD7 A;  2XWJ B;  4XIG S;  4DR5 Q;  2N55 A;  1PV4 A;  4ALP A;  5ISR A;  5CMD A;  2K5D A;  1BQQ T;  1VQP A;  4IQZ A;  2KQ3 A;  2PCF B;  2ES2 A;  1SSO A;  2LMC B;  4KKU A;  4A3D H;  2BDO A;  1JB3 A;  5LL6 X;  4GOP C;  2WFW A;  1VQD A;  2YV5 A;  3P20 A;  4QIW E;  1ENA A;  1SYE A;  3S1N B;  3JAM L;  1LTL A;  3ND9 A;  2XIW A;  4RCN A;  4DN4 M;  4A3J H;  5E1F A;  1K9M C;  4A3C H;  1QCB D;  1Q8I A;  3HOW H;  4DV3 L;  5C4X B;  1HA5 A;  1KRS A;  4JPB W;  1NUC A;  3DWQ A;  5CV7 A;  5C3E H;  2WKC A;  1HNW Q;  1OO9 B;  3J7A V;  4BY1 H;  4DR5 L;  1TU2 B;  4TVA B;  3W3A A;  1LTG D;  1Q12 A;  4KHZ A;  2Q8I B;  5JPM C;  5IGB A;  1JT8 A;  4S3S A;  5DEH A;  4GNX B;  5KYI A;  4A3F H;  1Z9F A;  2JE6 I;  4A3E H;  4R4O A;  2Q8T A;  3GTJ H;  1CI3 M;  4NXN Q;  1RTO A;  2ICE C;  2NVY H;  3TRE A;  2QEJ C;  2RCN A;  2RQX A;  2A68 D;  1ET9 A;  4A3G H;  2RF4 A;  1ZKO A;  3PO3 G;  3NTH A;  5C0X J;  1D2B A;  1FNU A;  2D0P A;  3PQI A;  4KV6 A;  5C6A A;  2Z6K C;  2UUA Q;  4XTC S;  2BDN A;  2ICI A;  2LFN A;  1U5K A;  1HNW L;  3MHB A;  3S2H B;  3S16 B;  1PFN A;  1B9N A;  1V1Q A;  4NMZ A;  1IBM Q;  4NP5 A;  2HHH Q;  3T51 B;  2Y0S E;  2K5W A;  4X3S A;  1NCV A;  2L4N A;  4A3J B;  3HZX A;  3TDQ A;  2YTY A;  4KY6 A;  2K52 A;  4YWK A;  3HOW B;  3R93 A;  1UNS A;  1BUV T;  3RD4 A;  4NXN L;  2C35 B;  3NXW A;  4DR2 Q;  3PIP A;  3I70 A;  1C7Y A;  5C3E B;  3T16 A;  4XXE A;  4R8I A;  1T9H A;  1RKN A;  4BY1 B;  3FKI H;  2PO4 A;  4CHT B;  2OQK A;  3H3V H;  3EBE A;  3D6C A;  2AQ2 B;  5IE8 A;  3KUP A;  2UUA L;  5L37 A;  1Y1V H;  1VQL A;  2XSC A;  5M3F G;  4DAV A;  2J4X A;  5A2Q E;  3RR5 A;  3TP8 A;  2XN9 C;  1IBM L;  1EU4 A;  1TR5 A;  2HHH L;  2L9H A;  3H3V I;  2F0N A;  3P7J A;  5KGU A;  3D8G A;  1LAB A;  2CQA A;  2EYJ A;  4A3G B;  4UAI A;  1GUT A;  4O42 A;  4LF5 Q;  1YNN C;  5EGT A;  4C2M H;  3UDI A;  3TZD A;  2E2I H;  3CKI B;  4L8J A;  2X6L A;  1TY0 A;  4B3S Q;  1YVC A;  1LO5 D;  3WOF A;  1S4Z A;  3S15 H;  1Q46 A;  1SJH D;  4HSP A;  5TSS A;  3RN5 A;  1Y1W H;  2B2T A;  4P71 A;  3ITP A;  4DU9 A;  4PZ7 A;  4FO2 A;  3PF5 A;  1HTP A;  3BG3 A;  1XNQ Q;  5EKL A;  4HAE A;  2MFI A;  1AZP A;  3GTP H;  3SVM A;  4UP8 A;  5JJZ A;  1K73 C;  4TRD A;  2F0J A;  4XQQ A;  3CRL C;  1WYD A;  1EZ8 A;  3FKI B;  4LF5 L;  2AUJ D;  1TWF H;  3D4D A;  1CA6 A;  2VQF Q;  3D31 A;  3IKJ A;  2K5N A;  1CHP D;  1EFI D;  2I07 B;  2KVM A;  3U9O A;  3KJO A;  3QJY A;  3KF8 B;  1Y1V B;  3MEF A;  2H4O A;  4LMQ D;  3C3L A;  3A8K E;  3KF6 B;  4B3S L;  2VUM H;  1WJJ A;  2R3Z A;  1SE4 A;  2CH4 A;  1IBK Q;  4YCV A;  4KN7 C;  1CZW A;  4IUT A;  4ZKC B;  3EN2 A;  1G6Z A;  2DN8 A;  1XNQ L;  2Z9H A;  2JA5 G;  4KHV A;  3E0J A;  1KLU D;  1EL0 A;  3A54 A;  3HEJ A;  4C2M B;  2F0U A;  1HR0 W;  4R4Q A;  1V1O A;  1VMC A;  4KY5 A;  2HCI A;  1F9R A;  3LNN A;  2R7F A;  1STH A;  2RHQ B;  1FL0 A;  1L0W A;  2L15 A;  1C48 A;  3S15 B;  2K5Q A;  1QG7 A;  2VQF L;  2PZW A;  3UDG A;  1SN8 A;  1SBB B;  4GOP A;  4FF3 A;  1YIT A;  1HRJ A;  4IUU A;  1RL2 A;  1GUN A;  3TP7 A;  4NXM Q;  1NR2 A;  4H02 A;  1KTK A;  4JW0 A;  2UXD Q;  1TQO A;  2F0S A;  4N9P A;  4BXX G;  2JK8 A;  1TWF B;  1O7Y A;  3Q22 A;  1IW7 D;  2WB1 B;  4POG A;  2PPB C;  5A35 A;  2VUM B;  2UXB Q;  1RHP A;  4IJH A;  3Q24 A;  2K05 A;  1DM0 B;  3ND8 A;  4CBV A;  1OTC A;  5FLM G;  3N6R A;  5T1I A;  1Y14 B;  1NY4 A;  3QOJ A;  3CCS A;  1EY8 A;  1EY5 A;  1D1I A;  1L0X B;  4NXM L;  4R8N A;  2IL8 A;  2K5H A;  3CME A;  3S14 B;  3H6M A;  2E2J H;  1XTC D;  1DJR D;  1K3R A;  2B63 H;  1PVO A;  4MZ9 A;  5C4H A;  2UXD L;  3A8J E;  3K6O A;  4HJ8 A;  3RZO H;  1EEI D;  4J1M A;  1DOL A;  5FOB B;  3I4M G;  1EIY B;  4C3J G;  2UXB L;  2VW9 A;  3F2B A;  2E5L Q;  2EY1 A;  2K33 A;  3KLW A;  1ESF A;  3PUW A;  4R4I A;  3SXH A;  2D2C C;  1WTQ A;  4HIM A;  5IGE A;  4B9X A;  3CXC A;  3GP7 A;  3K5M A;  5ELB A;  1LT6 D;  2CH4 W;  4NKL A;  3OWF A;  4CGY B;  4K6D A;  3K58 A;  2B39 A;  1E2V A;  3T1H Q;  3BVM A;  4ILW A;  5IWA Q;  1C4Q A;  1FR3 A;  2CWP A;  2RDG A;  1XMQ Q;  4RKL A;  2TSS A;  3OIQ A;  4UP9 A;  3FRP B;  3NK9 A;  3G48 A;  4DAY A;  5C44 G;  1WD1 A;  2E5L L;  3NHH A;  5HGT A;  2A5H A;  4LF6 Q;  1IW7 C;  2B63 B;  3E9H A;  1SDF A;  2FMC A;  1HNX Q;  1D7Q A;  1Q8K A;  2IHE A;  3RZO B;  4OON A;  4YY3 L;  5M5W H;  3GTQ H;  4DV4 Q;  4ZUI A;  4U68 A;  3BJU A;  4N9T A;  2FIN B;  2F0H A;  1L2F A;  1WCM H;  2IX3 A;  3J81 i;  1SMY C;  2EOT A;  4O1N A;  1PZI D;  3HOU G;  3JC6 6;  4RG1 A;  1RJT A;  3GO5 A;  2JA9 A;  1OXT A;  4IFD G;  3WOE A;  4K5W A;  4HJA A;  3F2U A;  1XMQ L;  4QY7 A;  1CK1 A;  1E0B A;  1VCI A;  2XTI A;  3MVV A;  4NW2 A;  1LT3 D;  1LLR D;  1VQ9 A;  5FLX E;  1XPU A;  2I46 A;  4LF6 L;  3J7A F;  1DXM A;  1HNX L;  2KUM A;  1UE5 A;  2F1M A;  1NAP A;  4DV4 L;  3E5S A;  4FNF A;  2UUC Q;  1HUN A;  5H1S E;  4QQB X;  1K0S A;  2M00 A;  1TS2 A;  4IPC A;  1TII D;  4KD3 A;  5C0X I;  2F03 A;  4DV6 Q;  4A3K B;  3MWY W;  1X3F A;  3NPP A;  1WTV A;  5T1G A;  3HOZ H;  2NVQ H;  3EIV A;  3T4A C;  3KK7 A;  3M4P A;  4OGQ C;  4OXP A;  3K8A A;  1YNJ C;  3ERO A;  1HZB A;  4BBS G;  3GTQ B;  2PW7 A;  3SDZ A;  3E0E A;  1XPO A;  4EGV A;  4B9W A;  4KHP Q;  3TSS A;  5FO9 B;  5I6W A;  2F0F A;  4GLV B;  2MP1 A;  1KDC A;  1A2T A;  4MHE A;  4OL7 A;  1GOZ A;  3ULJ A;  1CQV A;  1N33 Q;  3KDF A;  2KJX A;  2UUC L;  1H9M A;  4HMI A;  4HCS A;  4ME3 A;  1RD9 D;  1QZH A;  4J15 A;  3H3V C;  1O7L A;  5IYC G;  3VYR A;  1WTX A;  1KLG D;  4K2L A;  2EYP A;  1TWG H;  1JR0 D;  4DV6 L;  2PW5 A;  1B2T A;  2AMC B;  2CW0 D;  1VQB A;  3S24 A;  2B2U C;  3P75 A;  5C5M A;  2KCN A;  1Q90 A;  2A8V A;  3PUY A;  4RGM A;  2HQL A;  4DAM A;  1BBX C;  4OO1 G;  3MXU A;  2XWB B;  3CQZ H;  4KHP L;  1SXT A;  1BCP F;  3EFX D;  2IWH A;  2GN5 A;  1SYD A;  2F0G A;  5IP7 G;  3TRZ A;  5I4D A;  1MD2 D;  1G2T A;  1N33 L;  3K80 C;  4DNT B;  3HOZ B;  2NVQ B;  2A19 A;  1Z7T A;  4A3M B;  3ZYY X;  3S1Q H;  2YTX A;  3STB D;  5JPN C;  3FPU B;  3J81 c;  3VR4 A;  5EBC A;  1W6J A;  4BY7 G;  1G91 A;  3UI2 A;  3K5O A;  2L55 A;  3HKS A;  5IT9 L;  3TME A;  4L5S A;  2V4D A;  3CC7 A;  2MJ8 A;  4J6H A;  4OHJ A;  2R61 A;  4JI2 Q;  2D9U A;  4LJZ C;  3H0G G;  1KAB A;  4IFD J;  1TWG B;  1QZG A;  3NEM A;  3IRB A;  1UE6 A;  2MNA A;  1I50 H;  2B29 A;  2Z0S A;  1QE6 A;  1G8Z D;  2IT1 A;  2AWO A;  3O13 A;  5IGD A;  3PO3 H;  2IW3 A;  3TP5 A;  4X64 Q;  3CQZ B;  4KMU C;  5C3W A;  3HKZ G;  1U4M A;  4PV1 C;  1EY4 A;  1N9W A;  3VYT A;  5EBD A;  1VQ6 A;  3NQT A;  2F3W A;  1HNZ L;  1X3E A;  2I0Q A;  2CW0 C;  1Z6H A;  3EQL C;  3U4Z A;  1FJG Q;  1O7I A;  1BBW A;  4LW1 A;  4JI2 L;  3SK6 A;  1VQI A;  3K7U C;  4P75 A;  2F0T A;  1Z47 A;  5JVG 3;  1SR3 A;  2R92 G;  2A69 C;  4X64 L;  4P73 A;  1PXU A;  2B2W A;  4A3B G;  1B1Z A;  1QVC A;  2WAQ G;  3ULL A;  3CPW A;  3I73 A;  3RUZ A;  5M3F H;  1ILP A;  1LYL A;  1JOO A;  2KA7 A;  1PH8 A;  2C9O A;  3STB C;  3TBI B;  5JJK A;  2VQE Q;  3IL8 A;  1WD0 A;  3HKZ E;  2K32 A;  4ME5 A;  2PI2 E;  4BBR G;  2F4V Q;  1UE7 A;  3RNU A;  3I4N G;  1MSH A;  4FXG C;  2KCM A;  3VR5 A; 
#chains in the Genus database with same CATH homology
 2F3V A;  2PNR C;  2PZT A;  4X3K A;  5LHY 1;  4AYB B;  3BYY B;  1U4P A;  4EQP A;  3PMF A;  2OF1 A;  1JC7 A;  3P1H A;  1A15 A;  1A3T A;  1HQR D;  4H44 C;  3PIP 3;  1EQV A;  1GHK A;  2VNU D;  4C1N I;  5M3F B;  1JCK B;  1KAA A;  3MFG A;  1EWC A;  2A6H D;  4IUQ A;  4HN7 A;  3D4W A;  5IOD A;  3QIA A;  2NYZ D;  2BE5 D;  5F2D A;  1ROD A;  1EZ6 A;  2JA7 B;  1SND A;  3PUZ A;  5CV4 A;  3VYU A;  1G29 1;  1QB5 D;  2KEE A;  5DNF A;  5EPK A;  3S17 B;  3DMU A;  3LWE A;  2G9H D;  3G7L A;  3I3C A;  1OXS C;  3C1F A;  5CV6 A;  1GUS A;  2B2Y C;  5IGC A;  2L5T A;  2FJ2 A;  1EU3 A;  5JAV A;  1HXY D;  2RSO A;  4C3I G;  4KKT A;  2K6A A;  4XT3 B;  4QUC A;  1PFM A;  2WP8 J;  1I6H B;  5EPL A;  1B53 A;  3CU7 A;  1EY0 A;  2B2V C;  4DNR B;  4PNY A;  1GUW A;  1RCV D;  1JWS D;  5CC4 A;  1S5C D;  1NR4 A;  2TMP A;  2NBF A;  1AN8 A;  2DNC A;  4G7O C;  3BVZ A;  4A3D B;  1V1P B;  4J8Q A;  1IKL A;  5A2Q L;  4XYO A;  3OMC A;  4H0L C;  1K8M A;  3KBX A;  3W2D A;  3MXG A;  3H91 A;  1ENC A;  1DOK A;  1H9J A;  3SK8 A;  3J81 E;  3IAY A;  2BE5 C;  1FD7 D;  5J22 A;  1GJX A;  3C2P A;  2HQE A;  5EQ0 A;  3TN2 A;  3KLS A;  2OXP A;  3EJI A;  4RCO A;  3T56 B;  1SE3 A;  2O2L D;  4F87 A;  1O80 A;  1O78 A;  1X3P A;  3X3M A;  4LK1 C;  3AU7 A;  4A3F B;  4A3E B;  1D6E C;  3GTJ B;  2NVY B;  5ELE A;  5KEE A;  2PMZ B;  1K8O A;  1STG A;  3QOL A;  3NP8 A;  2YYZ A;  4HSV A;  4K2K A;  1LTT D;  2A68 C;  1EIH A;  1I3Q B;  2DNE A;  3I4M B;  1WTR A;  1LT4 D;  4IZ8 A;  2JXM B;  1H9S A;  4IFD H;  3QWN A;  1PTO H;  2NN6 G;  5FO7 B;  1HQM C;  1TWA B;  3NQI A;  2JP1 A;  3VR6 A;  3Q0A A;  4IFD I;  3A55 A;  3D6W A;  4ODG A;  4DK1 A;  2ZXP A;  3DWP A;  2NWG A;  1F77 A;  4JK1 C;  4DF7 A;  1E2W A;  3QB3 A;  5C44 B;  4RFB A;  2E2I B;  3EA6 A;  2AQ1 B;  2R7Z B;  2QKI C;  4RHS A;  2PQE A;  1TS3 A;  5J1Z A;  1EOT A;  1PYW D;  1SNQ A;  3OOC A;  3NBH A;  2L12 A;  5CV8 A;  1LTS D;  1Y1W B;  5DM6 3;  4LAA A;  3DEO A;  4DA2 A;  5EJW A;  3I90 A;  3U9S A;  4DXF A;  2XVS A;  2XRS D;  3GTP B;  1XYI A;  1TWH B;  1EYC A;  2EDG A;  3FEW X;  4I7Z C;  1EYA A;  1UAP A;  2F0W A;  1PTO B;  4RHR A;  5I2Y A;  4C3H B;  3D4R A;  3SE0 A;  2ZXR A;  5CGK A;  2JEB I;  4OO1 H;  1U4R A;  3L7Z C;  2CHB D;  3MC0 B;  4Y7N B;  1II3 A;  2Z1C A;  1R9T B;  1BCP B;  2FFK B;  1I6V C;  4KTA A;  4X3U A;  1RTN A;  2JYO A;  3L3O C;  4BBS B;  1STA A;  4WFN 3;  1LTA D;  2F0M A;  2E2D C;  3Q23 A;  5BN5 A;  4CJ0 B;  1LTB D;  2RVL A;  1JIC A;  4ZLT F;  1WTW A;  5ELF A;  3SR1 A;  4G57 A;  4XDX A;  1B9M A;  1TS5 A;  2H1E A;  2B8G A;  2EYO A;  1EQT A;  2JSO A;  3VYS A;  2BOS A;  3DXJ C;  2M9V A;  2K01 A;  1RDP D;  3SEB A;  1SNP A;  3T53 B;  1A2U A;  1HPC A;  2NVT B;  1UEA B;  1V8Q A;  5FLX L;  3HG9 A;  3N52 A;  2E2J B;  1BNZ A;  2KHS A;  2EY5 A;  3BS1 A;  1L0Y B;  3MXN A;  1S5F D;  3BDC A;  4Z9C B;  1SYC A;  4G4K A;  5KND A;  2KED A;  2WKD A;  5CV5 A;  1FYC A;  3X3N A;  2F0L A;  3VR2 A;  1STB A;  3IFT A;  1JOQ A;  1H9K A;  1DD2 A;  1T5E A;  3MEH A;  1HCZ A;  3K0Y A;  4NDX A;  3PUV A;  1Y8P B;  4CKB A;  1IYU A;  1H9S B;  1AW7 A;  4WJW A;  5CR3 A;  1DZ1 A;  4P2C B;  1EEF D;  1S5B D;  3NE5 B;  1Y8O B;  1OXU A;  1HFN A;  4KD4 A;  5E4W C;  5IOC A;  3MAQ A;  4V0B A;  3C1E A;  1Q1B A;  3HS0 C;  3DEP A;  1PTO D;  2FMM A;  1QNU A;  2ZXO A;  1SE2 A;  2QCP X;  1MBY A;  2YU9 B;  2JEA I;  2KEC A;  4FXK C;  5M5W B;  1WCM B;  4ZAI A;  1PTO F;  4QCL A;  2SDF A;  5KNB A;  1KDB A;  2KOL A;  1LV9 A;  1U4L A;  2IX0 A;  4EVO A;  4U67 3;  3TZU A;  4XQJ A;  2Z4H A;  3AMU A;  1BCP D;  5KNC A;  1T5X D;  4K8I A;  5E3F A;  3GTL B;  4E6I A;  1ESR A;  4ZKB B;  2AWN A;  4BBR B;  3H94 A;  3I4N B;  1HHV A;  1PZJ D;  1KDA A;  4C1N K;  4PMW A;  5D14 A;  4Q0F A;  2EY2 A;  2VXW A;  1A3U A;  3EVQ A;  4JBW A;  3RZD B;  1WTP A;  4FF4 A;  4QIW B;  3VR3 A;  3CHB D;  5FO8 B;  2EE1 A;  2J7Z A;  3K59 A;  1BDO A;  1PTO C;  1VDZ A;  5C5L A;  4QF4 A;  5IGG A;  5CBA E;  4OIJ A;  3R2T A;  4R9W A;  3J80 E;  3HRZ C;  2J0T D;  4M8A A;  5D3D A;  2R6G A;  1AP0 A;  3NTK A;  3S1R B;  2XNA C;  3IFD A;  1BCP C;  1MGS A;  2WAC A;  3V96 A;  2ENB A;  1ILQ A;  1EY9 A;  1ML0 D;  3A56 A;  1SYB A;  3S1Q B;  1CA5 A;  2EYH A;  1ICW A;  4IUN A;  1BXT A;  3KLS X;  5KIX A;  2AQ3 B;  2HCC A;  5KYL A;  1TS4 A;  3PIO 3;  5BN3 A;  4FP5 D;  2Z8L A;  1IKM A;  4TKO B;  2F0I A;  4WRD A;  1I50 B;  4XT1 B;  2EJG C;  3WDN A;  4K5X A;  4IUP A;  3PO3 B;  2EJM A;  2BA1 A;  2ZT9 C;  1CZG A;  2A74 C;  1D5Z C;  2L0C A;  1TVX A;  2RA4 A;  3HP3 A;  1SEB D;  5C4J B;  1S5E D;  1D5X C;  4L6T B;  3MZ5 A;  3RLF A;  3OSO A;  5C0X G;  1EYD A;  3V2T A;  2F0P A;  1BR9 A;  1F2L A;  1TKW B;  2XRQ D;  2RSN A;  2B2T C;  4GZY C;  4RAU C;  1F9P A;  1DYQ A;  3NSW A;  3VA7 A;  3FMC A;  5G3L D;  1QJO A;  1H9R A;  1B3A A;  2BCO A;  1D5M C;  2IPK D;  5BN4 A;  4FF1 A;  4CJ1 B;  3I8Z A;  3KF8 A;  5FK9 C;  2JA8 B;  1QWY A;  1A6X A;  4CKC A;  2B2U A;  1I4Q A;  5G3L F;  1F2Y A;  1EIG A;  3A8I E;  3M7G A;  1DOM A;  1CFM A;  1Q3L A;  1UUP A;  1B4O A;  1K83 B;  2FHT A;  2E76 C;  4MN3 A;  4PMC A;  1WVL A;  3M3Y B;  1HUM A;  2SNS A;  4DK0 A;  4RWS C;  1SJE D;  3J7Y W;  3OHX C;  4K6L A;  4BA1 I;  2O5I C;  4DGZ A;  1JWM D;  2Q8R E;  3J81 L;  5K36 G;  1FNV A;  1F9Q A;  2LS0 1;  1M4V A;  2LY7 A;  2WII B;  3GTG B;  4X3T A;  4BS9 A;  3C46 A;  3L9A X;  5JEA G;  3GQB A;  1YNN D;  5I9P A;  4DXG A;  2JA5 B;  1KNA A;  2IJ0 A;  3D3R A;  2RBM A;  4IN3 A;  1FGB D;  1DCZ A;  4DAP A;  3JAM E;  2K03 A;  2A6H C;  1M8A A;  1ZYR D;  3BDO A;  4KI0 A;  1EWH A;  4KK7 A;  4QB4 A;  1QOH A;  4ZUJ A;  1I4X A;  1V43 A;  1NSN S;  1GUG A;  3I72 A;  2EYM A;  3QG1 A;  2VB3 X;  1O7Z A;  3H09 A;  3GTO B;  2SNM A;  5J39 A;  1OXV A;  1F2Z A;  3TP6 A;  1GUO A;  1ONL A;  5DM7 3;  5DAU A;  3MFY A;  4ZK9 B;  1Y69 U;  1S5D D;  3URY A;  2F0E A;  2SOB A;  5CV9 A;  1F2M A;  1ET6 A;  1RF2 D;  4F88 A;  2RKS A;  1W6K A;  5COR A;  1C8C A;  4C3J B;  3M85 A;  2EPB A;  5JOB A;  4RGT A;  3PV0 A;  2E74 C;  1IL8 A;  3GV6 A;  2MGS A;  2NVX B;  1ZYR C;  3OIP A;  3M7N A;  1VMP A;  4YIJ A;  2B8F A;  1HA6 A;  3PUX A;  3DWA A;  5IIF A;  4ULL A;  2IX1 A;  2R93 B;  4ABN A;  2X6G A;  3LWU A;  2PZU A;  1Y8N B;  4FF2 A;  4KN4 C;  1IHZ A;  5CBE E;  5JEA J;  1BO0 A;  5CYU A;  3GTK B;  1SAP A;  1KNE A;  2D5D A;  1VF5 C;  2CVR A;  5FKA C;  3BZD B;  5EKI A;  5IGF A;  4V19 0;  4ZQ3 A;  3S1M B;  5C3X A;  1ENF A;  1VF7 A;  3HOU B;  3S2D B;  1EY6 A;  3AB9 A;  3OMG A;  4EQO A;  3V05 A;  5I2X A;  2DY7 A;  2B2Y A;  4XYQ A;  2NB0 A;  1CTM A;  2HUG A;  1QNK A;  2K7V A;  3FVQ A;  4M1U B;  1JWU D;  3MA2 B;  2GA4 B;  3R2I A;  3NUC A;  3HOX B;  3BYT B;  4BWG B;  5K5P A;  2Z4I A;  4CJ2 C;  5NUC A;  4K8J A;  1PFB A;  1XXG A;  2RDF A;  2B2V A;  4PQX A;  3K57 A;  2KCC A;  1MI2 A;  5COY A;  1R4P B;  3HOY B;  1GHJ A;  4OO1 I;  3E6Z X;  3HOV B;  1PLF A;  2BA0 A;  1AFP A;  2F0K A;  1PRT B;  2HDM A;  4MIU A;  1SMY D;  3BDL A;  2LKV A;  2EVB A;  2AUK A;  3NBI A;  3NTI A;  2C5C A;  4I65 A;  2K28 A;  3KBG A;  3GV3 A;  3I4L A;  4KJN A;  1TT2 A;  5M9O A;  1SNM A;  1MSG A;  3ONA B;  1IYV A;  4PMB A;  3G6J B;  2QIL A;  5JVH 3;  1OXX K;  3FDT A;  2E75 C;  2E2H B;  1YNJ D;  1CHQ D;  3OWE B;  5EKK A;  4KKS A;  3QO2 A;  4BY7 B;  2G9D A;  1G2S A;  3NWS A;  4QUF A;  1LT5 D;  1JQY D;  3K5L A;  5HUR A;  5C4Z A;  2F0D A;  2MPM A;  2O5J C;  1ZXT A;  4F7X A;  4ZRZ A;  3H0G B;  1U9R A;  2B2W C;  4UDU C;  4F8M A;  2OEO A;  1WTO A;  2O4X A;  3HKZ B;  3MTS A;  2NTT A;  4TSS A;  4BA2 I;  4C3H G;  4K14 A;  1JE4 A;  5C0X H;  3KLR A;  3RMH A;  2WV6 D;  2F0Q A;  3SHL A;  4IAL A;  1CQF A;  1STE A;  4ID6 A;  4RGN A;  1LAC A;  1I4P A;  2A6E D;  2R92 B;  3T13 A;  1PMR A;  1FNW A;  3DM1 A;  4G7H C;  1R4Q B;  4A3B B;  3I91 A;  2WAQ B;  3CRK C;  3HGB A;  4G7Z C;  1J8I A;  3VA5 A;  1PRT D;  1I4G A;  2WIN B;  2NUC A;  2A73 B;  4H13 C;  5M5X B;  1JOK A;  2N88 A;  3FPP A;  2SEB D;  4HR7 B;  1HFG A;  2EXZ A;  5M3M B;  1HTL D;  2F0V A;  1PRT F;  3LX0 A;  1PDQ A;  2F0O A;  5EPJ A;  3OW7 A;  3J80 L;  4IUV A;  2K1B A;  2HDL A;  4KJO A;  2F4I A;  2OT2 A;  4QMG A;  3OPO A;  4HED A;  2A69 D;  4ZYS A;  1TY2 A;  3GTM B;  2DY8 A;  2EZV A;  4RH6 A;  4CKE A;  4K5V A;  4RKB A;  4XQN A;  3M4O B;  2X69 A;  5K36 H;  1SNC A;  1X3Q A;  1DON A;  2A6E C;  4H7B A;  5ELD A;  5JEA H;  1JOR A;  1STY A;  2ID0 A;  1LTI D;  3R3O A;  3ERQ A;  1AZQ A;  3A7L A;  1SFO B;  5D3I B;  5M5Y B;  1SYG A;  1D1K A;  1BF4 A;  2RDH A;  2JA6 B;  5KRU A;  3SK4 A;  4FVM A;  1STN A;  1PRT C;  5I9O A;  2EJF C;  1V1P A;  2Y0S B;  1X32 A;  1LTR D;  5ELC A;  5IT9 E;  4FYD A;  3DHQ A;  4RGO S;  2EY6 A;  2EYL A;  3Q6S A;  1BOS A;  4C3I B;  4KY7 A;  1SYF A;  4Q5V A;  2D62 A;  1TWC B;  4HTH A;  2EYF A;  1B50 A;  2PYK A;  4B08 A;  2NZ1 D;  2K04 A;  5AFW A;  3R8B A;  2QF7 A;  1GXD C;  3DUZ A;  4HMJ A;  2NTS A;  3K5N A;  3PO2 B;  1XX8 A;  3MXP A;  4A93 B;  1PZK D;  1F9S A;  4TQU S;  4FXD A;  1J9O A;  3A7A B;  3K7A B;  2MUY A;  1AEX A;  2MHV A;  1B44 D;  3S9W A;  5I6Y A;  4A3I B;  5E4X A;  4RA8 A;  4WOR A;  1EY7 A;  2QDB A;  2L1B A;  2NN6 H;  4C56 C;  4HCE A;  1QIL A;  1I4R A;  2M2L A;  3M4Y A;  1A3V A;  1XWE A;  3SK5 A;  2NN6 I;  4EQN A;  5D65 A;  1CM9 A;  3BVG A;  1Q1E A;  2VB2 X;  4IUR A;  1SNO A;  5LL6 S;  1E2Z A;  4DFA A;  1ZEQ X;  1CT1 D;  2L11 A;  1I4H A;  3GD7 A;  4L63 B;  4OIK A;  3NWT A;  2XWJ B;  4XIG S;  2N55 A;  5ISR A;  5CMD A;  2K5D A;  1BQQ T;  4IQZ A;  2KQ3 A;  2PCF B;  1SSO A;  2LMC B;  4KKU A;  2BDO A;  1JB3 A;  5LL6 X;  3P20 A;  1ENA A;  1SYE A;  3S1N B;  3JAM L;  3ND9 A;  2XIW A;  4RCN A;  4DN4 M;  5E1F A;  1QCB D;  1Q8I A;  5C4X B;  1HA5 A;  1NUC A;  3DWQ A;  5CV7 A;  2WKC A;  1OO9 B;  3J7A V;  1TU2 B;  3W3A A;  1LTG D;  1Q12 A;  4KHZ A;  2Q8I B;  5JPM C;  5IGB A;  4S3S A;  5DEH A;  5KYI A;  2JE6 I;  2Q8T A;  1CI3 M;  1RTO A;  2ICE C;  2QEJ C;  2RQX A;  2A68 D;  1ET9 A;  1ZKO A;  3NTH A;  5C0X J;  1D2B A;  1FNU A;  4KV6 A;  5C6A A;  4XTC S;  2BDN A;  2ICI A;  2LFN A;  3MHB A;  3S2H B;  3S16 B;  1PFN A;  1B9N A;  4NMZ A;  4NP5 A;  3T51 B;  2K5W A;  4X3S A;  1NCV A;  2L4N A;  4A3J B;  3HZX A;  3TDQ A;  4KY6 A;  3HOW B;  3R93 A;  1UNS A;  1BUV T;  3RD4 A;  3NXW A;  3I70 A;  5C3E B;  3T16 A;  4XXE A;  4R8I A;  4BY1 B;  1RKN A;  2PO4 A;  4CHT B;  3D6C A;  2AQ2 B;  3KUP A;  2XSC A;  4DAV A;  2J4X A;  5A2Q E;  3TP8 A;  2XN9 C;  1EU4 A;  1TR5 A;  2L9H A;  2F0N A;  3P7J A;  5KGU A;  3D8G A;  1LAB A;  2CQA A;  2EYJ A;  4A3G B;  4UAI A;  1GUT A;  4O42 A;  1YNN C;  5EGT A;  3TZD A;  3CKI B;  4L8J A;  2X6L A;  1TY0 A;  1LO5 D;  3WOF A;  1S4Z A;  1SJH D;  4HSP A;  5TSS A;  2B2T A;  3ITP A;  4DU9 A;  4FO2 A;  1HTP A;  3BG3 A;  5EKL A;  4HAE A;  1AZP A;  3SVM A;  5JJZ A;  4TRD A;  2F0J A;  4XQQ A;  3CRL C;  3FKI B;  1EZ8 A;  2AUJ D;  3D4D A;  1CA6 A;  3D31 A;  3IKJ A;  1CHP D;  1EFI D;  2I07 B;  2KVM A;  3U9O A;  3QJY A;  4LMQ D;  1Y1V B;  2H4O A;  3C3L A;  3A8K E;  2R3Z A;  1SE4 A;  4KN7 C;  1CZW A;  4IUT A;  4ZKC B;  1G6Z A;  2DN8 A;  4KHV A;  3E0J A;  1KLU D;  1EL0 A;  3A54 A;  3HEJ A;  4C2M B;  2F0U A;  1V1O A;  1VMC A;  4KY5 A;  2HCI A;  1F9R A;  3LNN A;  1STH A;  1C48 A;  3S15 B;  2K5Q A;  1QG7 A;  2PZW A;  1SBB B;  4FF3 A;  1HRJ A;  4IUU A;  1GUN A;  3TP7 A;  1NR2 A;  1KTK A;  1TQO A;  2F0S A;  4N9P A;  1TWF B;  1O7Y A;  3Q22 A;  1IW7 D;  2WB1 B;  2PPB C;  5A35 A;  2VUM B;  1RHP A;  3Q24 A;  2K05 A;  1DM0 B;  3ND8 A;  4CBV A;  3N6R A;  5T1I A;  3QOJ A;  1EY8 A;  1EY5 A;  1D1I A;  1L0X B;  4R8N A;  2IL8 A;  3S14 B;  3H6M A;  1XTC D;  1DJR D;  5C4H A;  3A8J E;  3K6O A;  1EEI D;  4J1M A;  1DOL A;  5FOB B;  4C3J G;  2EY1 A;  2K33 A;  1ESF A;  3PUW A;  3SXH A;  2D2C C;  1WTQ A;  5IGE A;  4B9X A;  3GP7 A;  3K5M A;  5ELB A;  1LT6 D;  4NKL A;  3OWF A;  4CGY B;  4K6D A;  3K58 A;  2B39 A;  1E2V A;  3BVM A;  4ILW A;  1C4Q A;  1FR3 A;  2RDG A;  4RKL A;  2TSS A;  3OIQ A;  3FRP B;  3NK9 A;  4DAY A;  1WD1 A;  3NHH A;  5HGT A;  2A5H A;  1IW7 C;  2B63 B;  1SDF A;  2FMC A;  3RZO B;  4ZUI A;  4U68 A;  4N9T A;  2FIN B;  2F0H A;  2IX3 A;  1SMY C;  2EOT A;  4O1N A;  1PZI D;  1RJT A;  3GO5 A;  1OXT A;  4IFD G;  3WOE A;  4K5W A;  3F2U A;  1CK1 A;  1E0B A;  1VCI A;  3MVV A;  4NW2 A;  1LT3 D;  1LLR D;  5FLX E;  2I46 A;  3J7A F;  1DXM A;  2KUM A;  2F1M A;  1NAP A;  3E5S A;  4FNF A;  1HUN A;  2M00 A;  1TS2 A;  1TII D;  4KD3 A;  5C0X I;  2F03 A;  4A3K B;  3MWY W;  3NPP A;  1WTV A;  5T1G A;  3T4A C;  3KK7 A;  4OGQ C;  1YNJ C;  3ERO A;  3GTQ B;  2PW7 A;  3SDZ A;  4EGV A;  4B9W A;  3TSS A;  5FO9 B;  5I6W A;  2F0F A;  2MP1 A;  1KDC A;  1A2T A;  4MHE A;  4OL7 A;  1GOZ A;  1CQV A;  2KJX A;  1H9M A;  4HMI A;  4HCS A;  1RD9 D;  3H3V C;  1O7L A;  3VYR A;  1WTX A;  1KLG D;  4K2L A;  2EYP A;  1JR0 D;  2PW5 A;  1B2T A;  2CW0 D;  2B2U C;  3P75 A;  5C5M A;  2KCN A;  1Q90 A;  3PUY A;  4RGM A;  1BBX C;  4OO1 G;  3MXU A;  2XWB B;  1SXT A;  1BCP F;  3EFX D;  2IWH A;  1SYD A;  2F0G A;  5I4D A;  1MD2 D;  1G2T A;  4DNT B;  3HOZ B;  2NVQ B;  1Z7T A;  4A3M B;  3ZYY X;  5JPN C;  3FPU B;  3VR4 A;  5EBC A;  1W6J A;  1G91 A;  3UI2 A;  3K5O A;  2L55 A;  5IT9 L;  3TME A;  2V4D A;  2MJ8 A;  4J6H A;  4OHJ A;  2R61 A;  2D9U A;  4LJZ C;  1KAB A;  4IFD J;  1TWG B;  1QE6 A;  1G8Z D;  2IT1 A;  2AWO A;  3O13 A;  5IGD A;  2IW3 A;  3TP5 A;  3CQZ B;  4KMU C;  5C3W A;  1U4M A;  4PV1 C;  1EY4 A;  3VYT A;  5EBD A;  3NQT A;  2F3W A;  2CW0 C;  1Z6H A;  3EQL C;  3SK6 A;  2F0T A;  1Z47 A;  5JVG 3;  2A69 C;  1PXU A;  2B2W A;  1B1Z A;  3I73 A;  3RUZ A;  1ILP A;  1JOO A;  2KA7 A;  2C9O A;  3TBI B;  3IL8 A;  1WD0 A;  2K32 A;  4ME5 A;  1MSH A;  4FXG C;  3VR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...