1PFMA

Pf4-m2 chimeric mutant with the first 10 n-terminal residues of r-pf4 replaced by the n-terminal residues of the il8 sequence. models 1-15 of a 27-model set.
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
68
structure length
68
Chain Sequence
MSAKELRCQCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PF4-M2 CHIMERA
publication title NMR solution structure of the 32-kDa platelet factor 4 ELR-motif N-terminal chimera: a symmetric tetramer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 9
structure length 68
sequence length 68
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1995-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1pfmA00
2B2YA 2X6GA 3I90A 3P7JA 3GV3A 3IL8A 3G7LA 1IL8A 2B2WC 2K05A 4QUFA 4XT3B 1QE6A 2MJ8A 5CBEE 4UAIA 4CJ0B 1EOTA 5JJZA 1WD1A 3ONAB 1PLFA 1PDQA 2KEEA 1ICWA 1HFGA 2L1BA 5AFWA 5CMDA 4QUCA 1X3PA 1WTQA 2N88A 3D6WA 1SAPA 4CJ1B 1X3QA 4RA8A 1EQTA 2NZ1D 3F2UA 1WTPA 1G91A 1JICA 5EPKA 4U68A 2NYZD 4HEDA 1RHPA 2B2YC 2MP1A 4OIKA 4X3KA 1RTNA 3SVMA 1ILQA 1AZPA 5EQ0A 4ZKCB 1DONA 1HUMA 1MSHA 2B2TC 2K03A 1S4ZA 1PFNA 1B3AA 4IUVA 4IUQA 2K1BA 1F9RA 1U4MA 1NAPA 4NW2A 1WTXA 2RVLA 3DEOA 5EKIA 1HA6A 1RJTA 1G6ZA 1GUWA 1M8AA 1NR2A 4ZKBB 3LWEA 1O80A 1U4LA 5CBAE 2J7ZA 3H91A 1PFBA 4XT1B 3FDTA 3I91A 1DOKA 1B50A 2B2VA 1QNKA 2FINB 3HP3A 5EPLA 1WTVA 1HRJA 1RTOA 1MSGA 3N52A 1WVLA 2CVRA 1E0BA 2HDLA 2NWGA 1EIHA 2MGSA 1ESRA 3TZDA 4R9WA 1DOMA 2KOLA 4OIJA 1BF4A 2L4NA 2N55A 1CA6A 1BNZA 4ZK9B 1BBXC 1G2TA 1KNAA 1C8CA 1VMPA 1F9QA 1WTOA 2JYOA 5EPJA 2L11A 1DOLA 1IKLA 4IURA 4X3TA 1ZXTA 4RWSC 4X3SA 1AP0A 1MGSA 2EE1A 3DEPA 2B2VC 2KEDA 3KUPA 2MPMA 1XX8A 3KBXA 1ML0D 2K04A 1QG7A 2VXWA 3FPUB 1AZQA 4ZAIA 3I8ZA 4R8IA 1EL0A 2XIWA 5D14A 2KECA 5DNFA 1J9OA 2RSNA 1MI2A 5COYA 5T1GA 1F2LA 5T1IA 4O42A 1CM9A 1U4RA 2B2UA 5E4XA 1XYIA 2L9HA 2X69A 1X32A 1RODA 2R3ZA 5D65A 4DN4M 3IFDA 1JE4A 1VMCA 1NCVA 4RAUC 2EOTA 2HCIA 2FHTA 3GV6A 2X6LA 2RA4A 1WD0A 2KUMA 4HAEA 3DM1A 4IUTA 4HSVA 5E4WC 2SDFA 1F9PA 1KNEA 2BDNA 2RSOA 4IUUA 1G2SA 2D9UA 1WTRA 2B2TA 1B4OA 4MN3A 4LMQD 1HFNA 2B2UC 4XDXA 3QO2A 1F9SA 1HHVA 1SSOA 2KVMA 1O7YA 3Q6SA 1J8IA 2HCCA 2IL8A 2DY7A 4X3UA 1U4PA 2K01A 2K28A 1NR4A 2H1EA 4ZLTF 3MTSA 3UI2A 1BO0A 2B2WA 1A15A 2HUGA 4HCSA 5EJWA 5CORA 4CJ2C 3I3CA 1B53A 1LV9A 2FJ2A 2M2LA 2Q8RE 3TN2A 1ILPA 2Q8TA 4IUPA 2DY8A 1IKMA 2FMMA 1CA5A 1B2TA 2L12A 4MHEA 1TVXA 1WTWA 1Q3LA 1DZ1A 2HDMA 1EIGA 1HUNA 1PFMA 3R93A 3MWYW 2FFKB 2JP1A 1O7ZA 1SDFA 2EPBA
chains in the Genus database with same CATH superfamily
2F3IA 2BA0A 4YCWA 3G7LA 1B44D 4NXNL 4FF4A 4K0KQ 4P73A 1SE2A 1PRTC 5A2QE 2E76C 3GO5A 3HOYG 5CMDA 4JYAL 2LXKA 3C2PA 1WTPA 2F0FA 4N8X1 4XQNA 3M4YA 2QEXA 3RNUA 2OT2A 3J80i 2BE5C 3GD7A 5I6WA 1W2BA 3PO2B 1RHPA 3X3MA 1EY6A 1LUZA 1XPUA 1J6QA 3RMHA 5KYLA 4ILWA 4C3HH 4FF1A 2K1BA 1QVGA 4YCUA 1GO3E 3CQZH 2AUKA 3K59A 2ASBA 5KNCA 4GLXA 1STAA 2PMZE 2CW0C 2K4KA 4DAMA 4A3EH 2QEJC 3I4OA 1LTTD 1XNQQ 4TQUS 2UUBQ 3C3LA 1MJEA 1Q12A 4DK0A 2G9HD 2R92G 1AP0A 2EE1A 4JBJA 4K6LA 1KTKA 1CTMA 3HOVG 2WB1E 1D2BA 1ZKOA 1EQVA 4A3DH 3S1QH 4HTHA 1SR3A 1PH5A 3RN5A 2O5JC 1BKBA 3M4OB 2RF4A 3KF8A 1GUTA 3HOYB 4EVOA 3NPPA 1KRTA 4IFDI 3HOUB 3GTMB 2B2TA 4LMQD 2G9DA 2XRQD 1VQ6A 1SNQA 1HHVA 2KA7A 2SEBD 5FO7B 1HQMC 3GTOB 1U4PA 5FLXL 4UHVA 1E2ZA 2AHOB 4UPAA 4CJ2C 2EY2A 3CHBD 5CORA 5GAGC 3E5SA 1IYUA 1HTPA 2A19A 1JOKA 3NBIA 5JVG3 3T1YQ 2OWOA 5EKLA 1XPRA 2PPBC 3MVVA 5C4XB 4CDEC 3TZUA 3WWVA 2KBNA 5CBEE 2Z4IA 2KEEA 3L9AX 1KABA 1EYDA 4LNQA 2UXCQ 3ULLA 2R92B 3NQTA 2PZUA 1PH6A 3OMGA 2K32A 1B9MA 2RCNA 3V96A 2Z6KC 5DLQE 4ZUIA 1E2WA 3HS0C 1KC8C 3A8IE 1SNDA 1M8AA 1IBMQ 1NR2A 2PZWA 3VR3A 3FVQA 4B9WA 2F0JA 4AIMA 4B08A 1RTOA 2JA8H 3CAMA 1E0BA 4FF2A 2MGSA 1DOMA 2C9OA 1VQCA 3CCJA 1BNZA 3PCOB 1M1KC 1SBBB 1EWIA 1IL2A 5LL6S 2NBFA 2Z1CA 5C4JB 1I6HB 1IBKL 4DK1A 4JI4L 2EYFA 2KEDA 1Y14B 5J39A 2K04A 3L0OA 1KAWA 5KGUA 5A2QL 1AZQA 3FPUB 3D3RA 4ZAIA 4L5RC 1DJRD 2KECA 3KF8B 3PUZA 5I2XA 1UUPA 2VY3A 3ER0A 1QJOA 5E4XA 5K36H 2WFWA 5JOBA 4DK6C 4LFBQ 3IFDA 1FVIA 4KJNA 2ENBA 4DXFA 4RAUC 1YEZA 4OWTB 3MFYA 4WJWA 1N36L 3D6CA 4GS3A 2OTLA 1Z6HA 1JB7A 2XTIA 3QOLA 4GOPA 2I5HA 4DV2L 4NMZA 3S2DH 1XJVA 3KDFA 3GTJH 1CQVA 4C3HB 1YVCA 1WCMH 1ENAA 3CQZB 1XMQL 1UE1A 3G71A 3R2TA 4RGNA 3F8TA 4GNXA 3SK6A 4DR3L 1K28A 5IGDA 1TVXA 1WTWA 2IY5B 4A3EB 1YNXA 4WRDA 4DR2Q 1SFOB 1HUNA 1PFMA 2FFKB 1ONLA 2R7ZH 1GUNA 3EBEA 3I90A 1HZCA 1Q1BA 4CJ0B 2C5CA 3HKSA 3KLWA 3MEHA 2PI2A 2FMCA 3EVQA 4QUCA 4UDUC 4CJ1B 1ASYA 1EQTA 1SEBD 4J15A 4A76A 1Q81C 3HOWG 3U4VA 3MFGA 5IGEA 4O1NA 3I4LA 5CV6A 1ILQA 3DHQA 1L2FA 2B8GA 3GTPH 2B2TC 2PMZB 3PGZA 4LW1A 1F9RA 4R4OA 1FYCA 5JAVA 3BU2A 4NW2A 2HD3A 2CH4W 1VQNA 4P71A 3FHWA 3A74A 4KI0A 4ABNA 3S1RH 3W5OA 5ELOA 2UU9Q 2ZXRA 3T51B 2XVSA 5C4ZA 1KDBA 4UY8C 1XNRL 2KENA 4DUYQ 1B50A 1E2VA 4A93H 2IW3A 3NUCA 4DR1L 1YJ9A 2B39A 4XYOA 1RDPD 1STHA 1W6JA 4DV1L 4OIJA 2N55A 2BE5D 3SK5A 1VQMA 4G4KA 4ZK9B 1D7QA 3R8BA 1VMPA 3CCRA 1WTOA 4JBMA 3TRZA 1GJXA 4A3LG 3I4MG 3W1BA 2MPMA 1VQ9A 1XX8A 4B3SQ 3I8ZA 1A3UA 1QOHA 1LYLA 2UUCL 3OWFA 2E74C 2DGYA 3UE0A 3MZ5A 3PUWA 2QKIC 1PVOA 3TS0A 4GOPB 3E9IA 1SYEA 3KDFB 2K33A 2UUBL 1D5MC 4DR7L 1YBYA 4A3MH 2JEAI 4A3GG 3I55A 4KHVA 4LAAA 3OTOQ 1WTRA 3PF4A 3MXUA 2R93H 3S1NH 1EOVA 3I70A 3TBIB 5CV4A 4ZLTF 2NTSA 4N8FA 1VQIA 3TDQA 1JB3A 1LTAD 4GN4B 4C3JH 1VS0A 2UXBL 4DAYA 1QZHA 5K5PA 4L6TB 2JA8B 1JWMD 3IL8A 4OO1H 1NBWA 5AJ3L 3DUZA 3FEWX 3NEMA 4JYAQ 2AQ1B 1D6EC 1ICWA 1VQFA 1KIXA 3JC66 1WTQA 1FD7D 2WAQE 1SE4A 4RA8A 3HKZG 5BN3A 2PNRC 4K5WA 3UDIA 1ET9A 2CFMA 5FOBB 1PTOH 5FLMG 4BY7G 1YZ6A 4GOPC 2K03A 2DNCA 3IFTA 3VYUA 1JCKB 3QG1A 2RVLA 3KFUA 3P75A 2K5DA 2KHJA 1IYVA 1O80A 3L2PA 3H91A 4HJAA 2PCFB 1Z47A 1PH3A 1SJHD 4C56C 3GTGH 4KK7A 2RDFA 3N52A 4A3GB 1K3BC 5HY6A 5IP9G 4YWKA 3VA5A 3GTJB 1WCMB 2JA6H 1PZKD 1RF2D 1F2MA 3L3OC 3NENA 4IURA 1KDCA 4X3TA 4JV5L 5C44G 4HN7A 1CKOA 4NP5A 2XWJB 2UUAL 3CPWA 3TEHB 1QG7A 2SNMA 2VXWA 3R3OA 5G3LF 2PW7A 1KDAA 1CZGA 4QQBX 2XIWA 5I4DA 1NNXA 3TREA 2K50A 4XQJA 2M9VA 1U4RA 1JE4A 3VA7A 4J8QA 1BOSA 2LS01 4HJ8A 3S17H 3RLNA 2I5LX 2RA4A 1EZ6A 3VR5A 2DN8A 5E4WC 2F4IA 2CQOA 2F0OA 3OOCA 1CKNB 3GTPB 4XDXA 1Y69U 3E3XA 2OCEA 4FDBA 1NMGA 4BY7B 1A6XA 4RMFA 2NN6G 3F1ZA 3S1RB 2JA5G 1SYGA 1V1PA 2XN9C 3UI2A 1I4RA 2ALYB 3VDYA 1S5DD 2M2LA 3NTIA 3S1MB 1PH7A 2J4XA 1VQHA 4A93B 3BZCA 4DR4L 4IPHA 3BVGA 3SHLA 1RD9D 2N49A 3I4NG 2QDLA 4BY1H 2EYHA 1TU2B 1I50H 2F0LA 3HOXG 1WD1A 1GM5A 1SRUA 2OQ0A 5D3IB 3IKJA 5AFWA 1X3PA 4LF4L 4DV7L 4U68A 4RHSA 1TKWB 5C44B 4OIKA 1RTNA 4EGVA 1EEID 5HURA 1A3TA 4BBRH 5C5LA 4QY7A 2V4DA 4DKAC 5KNBA 3MXPA 5J3BA 4MIUA 2EJMA 2HQLA 1PFBA 3DWQA 4R4TA 4IPCA 4A3MB 4RKLA 3FP9A 1VQDA 1N32L 1QNKA 2G5DA 1PH8A 2LY7A 3ND8A 2K7VA 3G48A 3D4RA 2C35B 1EWHA 1CK1A 4JCVE 2GA4B 3SEBA 4KHZA 1L1OB 1CA6A 4M8AA 4JI4Q 2JYOA 3UDFA 4C3JB 2XWBB 3J81c 4Z9CB 4RWSC 2A1AA 4DU9A 1YI2A 1ML0D 1TWCB 2MO0A 1BUVT 1JMCA 1YNND 4JI7Q 2OF1A 3GTKH 5D14A 2UU9L 5DNFA 1J9OA 2RSNA 4IPGA 4KKUA 2A6EC 5FLXE 1IXRA 4LFCL 2AWOA 1RODA 4DN4M 2KHIA 1NMFA 1TS5A 1N36Q 3U9OA 3HOXB 4EQNA 1HR0W 3A56A 3RD4A 1TY0A 5CYUA 4DV2Q 2F3WA 3NBHB 2RSOA 2D9UA 1V1PB 4JI2L 3PO2G 1JJGA 3OYYA 2R6GA 3SR1A 4TVAB 3A7AB 1XMQQ 3D4WA 4LUOA 4GN3B 1TWFH 4XQQA 1LLRD 4G7ZC 4FO2A 1VQJA 1WYDA 1B2TA 2Q8TA 4MHEA 1DZ1A 1F2YA 1HXYD 1HZ9A 2WAQB 3E0JA 5G3LD 4BY1G 2EJFC 1L1OC 1R4QB 2L5TA 1Y8NB 2I5MX 4AYBE 2JA6B 3G6EA 4K8IA 2HT1A 1EFWA 1EQRA 3T16A 5DEHA 5C0XJ 3EA6A 1X3QA 1AW7A 2NZ1D 1LTRD 4YWMA 1EY0A 4YHHL 4BBRG 1TS4A 2MQHA 2FXQA 3QOJA 3H0GH 4IZ8A 1JE5A 1MSHA 5JVH3 4BBSH 4IUQA 3J80L 3JAMi 1PTOC 1EY8A 3K6OA 2Z8LA 3S17B 2E2IH 1XNRQ 5CBAE 2J7ZA 1N34L 4UP8A 1PH1A 4XT1B 3SE0A 5C3EH 4X66L 2VQEL 5M3MH 1NJIC 4AH6A 1X3EA 1K8AC 4A3BG 3HOUG 4DR1Q 2CVRA 3GTQH 4DV1Q 1FGUA 4LWCA 3O13A 4S3SA 4KMUC 1JWSD 5FJ8G 1X54A 1E22A 5EPJA 2AWNA 1LTLA 3TP5A 3K5MA 1Y1VG 3KF6A 3ULPA 2NVQH 4OHJA 5E7NA 2KCMA 1B3QA 2F0HA 2KCTA 3NXWA 1CUKA 3A5UA 3J81L 1LT4D 4HCEA 1EWCA 4JOIC 2UUCQ 1AN8A 2EXDA 3D4DA 4HIDA 4BY1B 4O42A 5C4XG 4BWGB 1I50B 3TS2A 4DPGA 3F2DA 3RLFA 1VMCA 4X64L 4DR7Q 4WJ3M 4BS9A 2Q2HA 4DNIA 4A3IH 1C4QA 2OXPA 3URYA 5IYBH 2BDNA 3H3VC 4L5TA 2B2UC 4BBRB 3MXGA 3ZJYC 1Z9FA 4LF7L 2KVMA 3Q6SA 1STEA 1H9SB 4ID6A 1RKNA 1QVCA 2UXBQ 2ZTDA 1K0RA 1LT5D 3HRZC 1OO9B 1W6KA 4IUPA 5IYCG 5JEAJ 4JBWA 4XTCS 5FKAC 5IP7G 4EQ5A 4DA2A 4PMBA 4KY5A 1DM0B 2YTYA 2EVBA 3RLOA 5AJ3Q 3CP0A 1JWUD 4A3BB 1JOOA 1JC7A 3M3YH 1S3OA 4NB3A 4XT3B 5JJZA 1P16A 1CI3M 2QDBA 1I5FA 4TRDA 1SAPA 2VB2X 2VZAA 1UE7A 1FR3A 5EPKA 1Y1VB 1MHWC 4HMJA 5M5WH 2I0QA 4KJOA 4A3FH 1YHAA 1S72A 3GTKB 3NSWA 3TSSA 5LMUL 1QB5D 1PFNA 1C9OA 4FXDA 4C1NK 1KLGD 3IRBA 4IUVA 4JK1C 4HJ9A 4AYBG 3J7ZC 1PRTF 3RZDH 1I4QA 1NAPA 4OELB 4P72A 1GUWA 3MA2B 4DV5Q 2B63H 5M3MG 3FKIH 5JJKA 2JXMB 5L37A 4NXML 3VYSA 3DLLA 1HNZL 3IAYA 2EYPA 1C7YA 2Q2IA 3MC0B 1LTBD 2ZTCA 3KF6B 4C3HG 2HQEA 4L5SA 4C2MH 2E8GA 1DGSA 4DFAA 2XRSD 1BBXC 1FL0A 4JV5Q 3QB3A 5C3XA 2AQ3B 5LMNW 1HR0L 1BCPD 1PZJD 2UUAQ 3PO3H 4AQYL 3LNNA 3X3NA 2D2CC 4A3EG 2BDOA 4POFA 5EBCA 2NN6I 1D5XC 2EYJA 4DV3L 1VDZA 5C6AA 1BBWA 1YJWA 3CF5A 1N8RC 4JBKA 3J7YW 1SYCA 3VYTA 4G57A 1F2ZA 3VYRA 3A7LA 5FO8B 1TWHB 4U673 2DJFC 4APVA 3H0GB 1Y1WH 4KD4A 2VS1A 1F9SA 1LTID 4R1JA 4ODGA 1O7YA 3BZKA 3KLSX 4A3DG 1BDOA 2H1EA 1TXYA 4JI7L 4AYBB 1VQ4A 2HUGA 5EJWA 3S24A 2BH2A 3I2ZA 3CC7A 5I9OA 4KY6A 2IX1A 2F0QA 1ILPA 5C3EB 2L12A 2PZTA 5M3MB 4DR4Q 3PSIA 2WV6D 3T13A 4DAPA 3LX0A 2X69A 2IX3A 1SMYD 3GTQB 2NZHA 3G6JB 1CQFA 5GAHC 2L55A 2F3VA 4A3CH 1XTCD 1KQSA 1K83H 3F2BA 4LF4Q 1NE3A 2WB1G 4KKSA 1SN8A 2NVQB 2NVYH 4DV7Q 4ZQ3A 4A3KH 1H9MA 1O7IA 2RKSA 1NUCA 2B2YC 2MP1A 4PG3A 2EY1A 2RHQB 2NVTH 2A5HA 1V43A 1E24A 4H44C 1HNXL 1HA6A 3W3AA 5M5XH 1N9WA 3ZYYX 1SE8A 4I65A 1U4LA 4A4IA 4A3IB 1N32Q 1H9KA 3MHBA 3TQYA 2ZT9C 3H3VI 1UEBA 2E2HH 1MSGA 2V1CC 1EIHA 1ESRA 3TZDA 4OXPA 1HQRD 1V1OA 1LTGD 3PO3G 3UE1A 1G2TA 5GADC 1F9QA 2A69C 5EAYA 4A3DB 3S1QB 4DV6L 5ELNA 1UNSA 4BXXH 4Q0FA 2IT1A 4ME5A 4A3JH 5JPNC 2QF7A 1Y8OB 4RKBA 2F0PA 2WP8J 5ELFA 2LMCB 2F0MA 4Y52H 3OIPA 1MI2A 2JA8G 4LFCQ 4PNYA 1F2LA 1CM9A 1H95A 1PRTD 4F88A 5CR3A 1ZEQX 4B3ML 1HNWQ 1NCVA 1ENCA 1PMRA 2M00A 2ZXPA 4YIJA 2WB1B 5IGCA 3CMAA 4HAEA 2BA1A 1AE3A 4JI2Q 2JA7H 4IFDH 5M5WB 2SDFA 4A3FB 3G4SA 2HIXA 2O5IC 4HJ7A 3DWPA 2CWAA 3I73A 4M1UB 3FMCA 4C3IH 1HFNA 3QO2A 2HIVA 1GVPA 4I7ZC 4QIWE 5C0XH 5GROA 3RZDB 5K36G 3BDLA 1RL2A 4PMWA 2B63B 1BO0A 4HCSA 1Q8IA 1LO5D 1LV9A 4DXGA 2CW0D 4X62L 4GKKL 1K3RA 3T56B 4R4QA 2D0PA 1I4PA 5D3DA 1VQ8A 3MWYW 2ZJPA 2WINB 3P7JA 2JJQA 1HA5A 4LF9L 4C2MB 5ELDA 1WCMG 4UAIA 1S5FD 3KYHC 1PDQA 1UEAB 1LABA 4N9TA 1CKMA 3F2CA 2TSSA 1AEXA 4QF4A 1VQPA 1S40A 1QZGA 2Q2UA 3KK7A 4MNOA 3PO3B 3F2UA 4YHHQ 2VUMH 4RCOA 4DUZL 1CKNA 5GAEC 1JJ2A 4HEDA 2F0IA 2F0NA 1Q90A 2MUYA 1I6VC 1M90C 2R7ZG 2D5DA 2WIIB 5IGGA 3U4ZA 3GP7A 5E1FA 1QCBD 3ICEA 3CCQA 5IYDH 3C1FA 1D1IA 3DEOA 1I94L 5EKIA 3HOZH 1JORA 1N34Q 2A68C 3CKIB 1YHQA 4X66Q 2VQEQ 5LMNL 2Y0SE 1FNWA 3GTLH 5HGTA 5HGQA 2K5HA 1A8VA 2Z4HA 5CV5A 4QL5A 1Y1WB 2CHBD 2K5QA 4TKOB 2F4VL 5EGTA 3CU7A 3CD6A 3I56A 3BJUA 1DOLA 1IKLA 4K2KA 1JR0D 1GUGA 1BXTA 3NE5B 4DV5L 4A93G 1HH2P 4HMIA 1N33L 2RBMA 1L0WA 3I7FA 3S2DB 1CSPA 4X64Q 3BYTB 5JEAH 1Q86C 4GN5A 3H6MA 2NVYB 1TQOA 5TSSA 2E75C 1TIID 4A3KB 1EYAA 2CKZB 3OW2A 1CSQA 2PNHA 1B4OA 4LF7Q 3CCSA 1G291 2NVTB 4LF5L 3SDZA 1TR5A 1HZAA 1L1OA 1MKHA 2DY7A 1VQKA 2R7ZB 1V1QA 5M5XB 3T1HL 1QUQA 2EDGA 2ZJRA 1UE5A 1L0XB 3MAQA 2FMMA 2LKVA 1K8OA 3K7UC 4A3MG 1Q3LA 1CZWA 1E7ZA 3E0EA 2PW5A 4H13C 3S9WA 1J5EQ 1F9PA 2ATWA 1BQQT 3J80E 1I3QH 2A74C 4ULLA 2R93G 1IL8A 2K05A 1OXSC 4H7BA 3K7AH 4P74A 4Q5VA 4KLKA 2RDHA 3K0YA 4JI8L 3NBHA 4C3JG 4PV1C 1JICA 1WTHA 2CQAA 3J81j 3ERQA 1G6PA 4WJ4A 5LMUQ 3LGJA 3U9SA 3PUXA 4MTNA 5ELBA 2KHSA 1SMXA 3EROA 4KV6A 4KHPL 1A63A 5KRUA 3M4PA 4LK1C 4OO1G 2F0KA 3PF5A 2K6AA 4ZRZA 1AFPA 4R4CA 3A8KE 4NXMQ 1S5ED 5LHY1 5IT9c 2I46A 3J81E 1HNZQ 2JA7B 1CHQD 4NPSA 3KLSA 1PFSA 1WFQA 3AU7A 4ALPA 1EY5A 5EPLA 1OXXK 1X3GA 2JSOA 2NVXH 1FNUA 1T5XD 4JOIA 3J80c 2KOLA 2VQFL 4C1NI 1F77A 4LF8L 2SNSA 3K80C 2VB3X 3KOJA 3CCUA 4DV4L 4A75A 1HR0Q 1V9PA 2XSCA 4AQYQ 3DEPA 4EX5A 2IHFA 3WOEA 1OXVA 3OW7A 2YU9H 2Y0SG 2YYZA 1X65A 2WAQG 1KHIA 3BVZA 5KNDA 4DV3Q 2B2UA 2JA6G 1WJJA 1EQQA 5D65A 4RGMA 1O7LA 2R93B 4QIWB 3M4QA 2F0EA 3S1NB 1I4GA 3GV6A 1DD2A 4IOCA 4HSVA 2JN4A 2LFNA 3UDXA 2E5LL 2N78A 1QUQB 3AQQA 2A8VA 1J8IA 3M4OH 3ITPA 3Q22A 2K01A 5JPMC 3HOYH 3HOZB 1A15A 3AFQA 3E9HA 4O2DA 1B53A 4JG2A 2Q8RE 1Q7YC 1CA5A 1KLUD 2ZJQA 2PQAB 3TP7A 3P1HA 1HNWL 5DM63 3R93A 4FYDA 2JP1A 1A3VA 4HR7B 4HIOA 5I9PA 4JW0A 3OIQA 1PTOB 4RH6A 4OX9L 1GUSA 4CKEA 1QE6A 4L63B 2K5VA 1O78A 1LACA 2L1BA 1IYJB 3CRLC 1M4VA 4B3RQ 2TMPA 1P8LA 5H1SE 1Y8PB 3A0JA 2NYZD 1L0YB 4IPDA 3DXJC 1H9RA 3MXNA 1H9SA 3BG3A 2Y0SB 1HNXQ 3GTGB 3S2HH 1GHJA 3ERSX 2WACA 4IFDJ 4RGTA 3K5LA 2R92H 1NTGA 1PXUA 1X55A 2RDGA 3PIOA 3CRKC 1STGA 2MFIA 3RN2A 3HOVH 1IW7C 3HP3A 3V2TA 3JAML 1TS2A 4KTAA 3PIPA 5IT9L 4QGUA 1WVLA 1YJNA 2HDLA 1R9TH 1IZ6A 1HCZA 3D0FA 4IO9A 2L4NA 1BF4A 1XWEA 4KY7A 4DV6Q 3QR8A 3B6YA 5E3FA 2L11A 2Z9HA 1U0LA 2F0TA 3KUPA 4YY3L 5J22A 3W1GA 2EY5A 4JVZA 2YTVA 5J1ZA 1SROA 1TWGH 1C48A 1PHJA 1I3QB 1MBYA 2A68D 2B3GA 2UXDL 4B3MQ 4F87A 5C4JH 2ZXOA 4RCNA 2R61A 2RCFA 3S16H 2QCPX 4IQZA 1Q1EA 1DCZA 3S14H 1S5BD 2OQKA 4LFAQ 3HFZB 3A5ZB 1VQGA 3EN2A 3PMFA 1II3A 2Q2TA 1SSOA 1YITA 3U58A 3QJYA 4PZ6A 4WORA 2L15A 2IL8A 3D31A 2K28A 3NTKA 3Q0AA 1GHKA 1SJED 3SK4A 3CCVA 2IHEA 2FJ2A 4X62Q 4GKKQ 3TN2A 3R2IA 4JI6L 2EPBA 5M5YH 2NVXB 2B2YA 2X6GA 4LF9Q 5F2DA 5KIXA 4PQXA 1VQ7A 2NZOA 3M85A 2B2WC 2F0DA 4CDDC 2MJ8A 1DXMA 1EOTA 3NELA 3ONAB 1PLFA 2ZM6L 1BBUA 3MXNB 3LWUA 1XXGA 5IGFA 4X65L 3D6WA 4DUZQ 1SFOH 1FJGL 1PYBA 1K8GA 2O2LD 1ENFA 2YU9B 2NTTA 4X6AH 4GLVB 1XMOL 5IY0A 3V05A 5EQ0A 5M9OA 3KJPA 4K6DA 4R8NA 3J81i 1YIJA 4BA2I 4DR6L 3KJOA 1I94Q 3RR5A 4E6IA 4GKJL 1J5EL 5LL6X 3E6ZX 4B9XA 3PUYA 5LMNQ 4ZKBB 1VCIA 3EIVA 3M9BA 2QW7A 1SE3A 2J0TD 3AMUA 3VR2A 3I72A 2AQ2B 1WTVA 2F4VQ 3H0GG 4BBSG 1ZYRC 4LJZC 1PTOF 4CGYB 1PH9A 5KYIA 1EU4A 2B2VC 5C0XI 1EEFD 3KBXA 5C3EG 2HHHL 4DF7A 1N33Q 4R8IA 4P2CB 1IBLL 3C1EA 1K73C 5DM73 5COYA 1K0SA 5A35A 3STBC 2IX0A 2P5ZX 1TWFB 2H5XA 2KUMA 3S15H 1X6OA 4QB4A 4UP9A 1EZ8A 4LF5Q 4OL7A 3C46A 1D8LA 2BCOA 1VQLA 4IALA 3S2HB 1AE2A 2PI2E 3Q8DA 4YWLA 3T1HQ 3L7ZC 1MJCA 3CCLA 3I3CA 3HOWH 3MEFA 2R7DA 4A3IG 5IYBG 3HOVB 3CC2A 2HDMA 2PO4A 1SDFA 2I07B 1A62A 4MZ9A 2K14A 4K5VA 1B1ZA 2NB0A 1R9TB 4OO1I 4N9PA 2QGQA 1T5EA 4JI3Q 4BBSB 3N6RA 1PA6A 4I7AA 4JI8Q 3HGBA 3J7AF 1VQBA 3P20A 1VF5C 5I6YA 4H02A 4FVMA 2EJGC 4XXEA 2ID0A 1YNJC 2E2IB 4O0AA 1ET6A 1EY7A 4L8JA 2D62A 1TWGB 4KHPQ 1HUMA 2A6ED 2KJXA 1JT8A 1EY9A 2EYOA 1LM0A 1GOZA 5IGBA 4CKCA 1KXLA 3S16B 3K0XA 1RJTA 1G6ZA 1KRSA 3S14B 2MHVA 4A3LH 3I4MH 5KEEA 2WKDA 5BR8Q 3I91A 3H94A 4DR5L 2E2JH 2FINB 1WOCA 4A3FG 2N8NA 4B3RL 1HRJA 4LF6L 1GXDC 1U5KA 1X9NA 2NWGA 5C3WA 2VQFQ 4RFBA 3K57A 1FNVA 4LF8Q 1V8QA 5M3FH 2JE6I 4DV4Q 3BDCA 2B63G 3SGIA 4V0BA 4K2LA 3FKIG 4DNRB 1HTLD 4A3GH 1PH2A 3NWTA 1PYSB 3M7GA 1ASZA 5M5YB 3NP8A 4XIGS 4QCLA 5CV7A 3J7AV 1Q82C 1EIYB 3HKZE 2L9HA 1SNOA 4DGZA 1XYIA 1IHZA 2R3ZA 1WI5A 2O4XA 1UWVA 4JI5L 1IW7D 3A55A 2FHTA 1QNUA 2BOSA 5EKKA 2E5LQ 4JI1L 1G2SA 2B8FA 4MN3A 4CDCC 1KL9A 4JI0Q 2JA9A 1VQEA 4EQOA 3OPOA 3WDNA 2HCCA 4IUNA 3K58A 4X3UA 4KKTA 1PTOD 4WFN3 3BZDB 3M3YB 1UE6A 2EYLA 1LT6D 2DJGC 2XNAC 1STBA 4K8JA 3PV0A 2Z0SA 4LUVA 4CDFC 1SNCA 5FLMH 5JJLA 4BY7H 1K8MA 1B70B 4DV0Q 1Y1WG 1YNNC 2Q8IB 4OX9Q 4OWWB 4NDXA 2EIFA 3BVMA 2KCNA 4LFAL 1SNPA 1Z7TA 3S1MH 2K5WA 1VQOA 1HFGA 4K0KL 3VR6A 1X56A 2N88A 3GQBA 3FPPA 1EY4A 3EFXD 3K5NA 5IWAQ 3RUZA 3ULJA 3FKIB 4DAVA 4X3KA 1AZPA 3H15A 1DONA 5IP9H 3CC4A 1Q8KA 1XTDA 1S4ZA 1B3AA 3HZXA 1OXTA 4A3CG 1TWAH 3NQIA 2VW9A 1EIFA 4PZ7A 5NUCA 2R7FA 3KBGA 2WKCA 1I4HA 5C44H 2Z6BA 4IJLA 4TSSA 4XYQA 3PQIA 1LT3D 3UDGA 3S15B 1QILA 5BN4A 3PIO3 4B3TQ 4A3KG 3OWEB 2AKWB 2N3SA 4L5QA 2VL6A 5M3FG 3PIP3 1EYGA 2JEBI 2IWHA 3A54A 1PV4A 1NSNS 3CMEA 1XNQL 2RHSB 1EYCA 3AFPA 4YY3Q 4IN3A 3HOWB 3CW2C 1NY4A 4F7XA 1PYWD 4GNXB 1GD7A 1SLJA 1SNMA 1C0AA 5GQOA 2A6HC 2UXDQ 4HIMA 1E1OA 5T1GA 2GVBA 4Y7NH 1LTSD 5T1IA 2ICEC 2NN6H 1EUJA 2K75A 1SYDA 1X32A 3T4AC 2JA5H 1JOQA 4H0LC 4ME3A 1TWCH 5CGKA 4F8MA 3NTHA 1TS3A 4BXXG 1PH4A 1ZYRD 4NXNQ 1E1TA 4A3JG 2D0OA 4RG1A 1CHPD 2F0WA 4PZ8A 3I4NH 3HG9A 2IPKD 4KN7C 1GKHA 1RCVD 4LUZA 3HOXH 2F0GA 1W3SA 3EQLC 2VNUD 2F1MA 1XPOA 3FRPB 4CKBA 1K83B 3I4MB 1EFID 2RQXA 1QWYA 1TY2A 4JI6Q 2JA7G 4IFDG 1FGBD 1EIGA 2E2JB 3T1YL 3BS1A 4BA1I 1O7ZA 3STBD 4C3IG 4IOAA 3DM3A 1JQYD 2GN5A 3GV3A 2KCCA 5C0XG 1PZID 2PYKA 4QUFA 2ZM6Q 5M3FB 3K8AA 4KN4C 2YV5A 2CH4A 4X65Q 4GNXC 1HJPA 3PUVA 5FO9B 1FJGQ 2AMCB 1MD2D 4FXKC 3OSOA 4G7OC 1YHBA 3QWNA 3T53B 2UXCL 3JAME 1XMOQ 4RGOS 4FXGC 4FF3A 5IT9E 3RZOH 4DR6Q 3DMUA 4ZKCB 2GVAA 2F0UA 4HJ5A 2EZVA 3AYHB 4GKJQ 2E2HB 1U4MA 3M7NA 2A73B 1WTXA 5FK9C 1X3FA 1G51A 2F0SA 3CPFA 4K14A 3LWEA 3K81C 1IBML 1VQAA 3D8GA 2PQAA 3CXCA 2VUMG 2E2DC 3FDTA 4JI3L 1B7YB 3H3VH 1KAAA 4OEMB 4A3JB 4HIKA 1BR9A 4JC0A 3SK8A 1BCPB 1T9HA 4R9WA 4YCVA 5ELEA 4G7HC 3BYYB 1MIUA 5IYDG 5CC4A 4HSPA 2IJ0A 5JJIA 1C8CA 1YNJD 3HOZG 4JPBW 1ZXTA 3HKZB 4X3SA 1MGSA 4OGQC 2HHHQ 2EYMA 5BN5A 5IOCA 1EU3A 3Q24A 2QA4A 1IBLQ 3PO2H 1B8AA 4DAYB 3JAMc 2CCZA 1HPCA 4CHTB 1VQ5A 1AH9A 2YTXA 4EQPA 3U50C 4C3IB 5BR8L 1HZBA 1ICFB 4LFBL 3NK9A 2CWPA 3DM1A 4MTKA 2AUJD 4QMGA 5EBDA 1K9MC 1KNEA 1S5CD 4IUUA 3TP6A 3W2DA 2NUCA 4P75A 2F52A 2SOBA 3SXHA 5CV9A 5I2YA 1RIPA 1E3PA 1QVFA 1ESFA 1D5ZC 4OONA 1TWAB 4GZYC 1NR4A 1TT2A 4FNFA 4OWXB 5JEAG 2B2WA 1A2TA 1DYQA 4IJHA 5IODA 2F03A 1OXUA 2OTJA 2JK8A 1IKMA 1BCPC 4K5XA 2LXJA 2VUMB 3OHXC 4DR2L 3CCEA 5ISRA 3K5OA 3AB9A 3Q23A 1A2UA 2BH8A 2A69D 3AEVA 4JI0L 3VR4A 1GUOA 4QJFA 5C4HA 1G91A 5C5MA 4J1MA 2DNEA 1SYFA 3TMEA 4A3BH 5DAUA 2KQ3A 2ICIA 4PMCA 3SVMA 3GTMH 3HOUH 3GTLB 2ZTEA 2EY6A 4Y7NB 1IBKQ 5ELCA 5FJ8H 1Q46A 2K52A 2JA5B 3GTOH 1G8ZD 2L0CA 4DV0L 1SYBA 1Y1VH 4ZCKA 3ND9A 1I4XA 3H09A 4DR5Q 3NWSA 1DOKA 2MNAA 4DNTB 4LF6Q 2B2VA 3WOFA 5CV8A 4RHRA 1CFMA 4DUYL 2LSSA 2DUDA 3I4NB 3HEJA 3NHHA 5C4XH 1SMYC 5IWAL 5IIFA 1B9NA 2B29A 1OTCA 2QILA 1KNAA 2H4OA 1H9JA 3TP8A 1CT1D 1BVSA 1STNA 3J7A5 1VF7A 4KD3A 1R4PB 1PRTB 4B3SL 3BDOA 4FP5D 1EL0A 1A0IA 5IE8A 2OEOA 1STYA 2EQSA 4J6HA 4DR3Q 4B3TL 1JJCB 4JI5Q 2K5NA 2EOTA 2HCIA 3OMCA 1D1KA 4R4IA 4DK3C 2X6LA 5IYCH 1WD0A 4JI1Q 4IUTA 5IP7H 3EJIA 3RZOB 1UAPA 4CBVA 2XGTA 2PQEA 3DWAA 2Z6KA 5FLXc 1KD1C 3OTOL 2EXZA 2JQOA 3A8JE 2F0VA 1U9RA 1BCPF 4ZUJA 3MTSA 2ES2A 3KLRA 1SXTA 3GDEA 4NKLA 1TWHH 4ZYSA 1I6HH 2A6HD 3K7AB 4GLAC 2DY8A 3QIAA 4V190 2MO1A 4POGA 3CCMA 4UP7A
chains in the Genus database with same CATH topology
2BA0A 3G7LA 1B44D 4FF4A 1SE2A 1PRTC 5A2QE 2E76C 3GO5A 5CMDA 3C2PA 1WTPA 2F0FA 4XQNA 3M4YA 2OT2A 2BE5C 3GD7A 5I6WA 3PO2B 1RHPA 3X3MA 1EY6A 3RMHA 5KYLA 4ILWA 4FF1A 2K1BA 2AUKA 3K59A 5KNCA 1STAA 2CW0C 2QEJC 1LTTD 4TQUS 3C3LA 1Q12A 4DK0A 2G9HD 1AP0A 2EE1A 4K6LA 1KTKA 1CTMA 1D2BA 1ZKOA 1EQVA 4HTHA 2O5JC 3M4OB 3KF8A 1GUTA 3HOYB 4EVOA 3NPPA 4IFDI 3HOUB 3GTMB 2B2TA 4LMQD 2G9DA 2XRQD 1SNQA 1HHVA 2KA7A 2SEBD 5FO7B 1HQMC 3GTOB 1U4PA 5FLXL 1E2ZA 4CJ2C 2EY2A 3CHBD 5CORA 3E5SA 1IYUA 1HTPA 1JOKA 3NBIA 5JVG3 5EKLA 2PPBC 3MVVA 5C4XB 3TZUA 5CBEE 2Z4IA 2KEEA 3L9AX 1KABA 1EYDA 2R92B 3NQTA 2PZUA 3OMGA 2K32A 1B9MA 3V96A 4ZUIA 1E2WA 3HS0C 3A8IE 1SNDA 1M8AA 1NR2A 2PZWA 3VR3A 3FVQA 4B9WA 2F0JA 4B08A 1RTOA 1E0BA 4FF2A 2MGSA 1DOMA 2C9OA 1BNZA 1SBBB 5LL6S 2NBFA 2Z1CA 5C4JB 1I6HB 4DK1A 2EYFA 2KEDA 5J39A 2K04A 5KGUA 5A2QL 1AZQA 3FPUB 3D3RA 4ZAIA 1DJRD 2KECA 3PUZA 5I2XA 1UUPA 1QJOA 5E4XA 5K36H 5JOBA 3IFDA 4KJNA 2ENBA 4DXFA 4RAUC 3MFYA 4WJWA 3D6CA 1Z6HA 3QOLA 4NMZA 1CQVA 4C3HB 1ENAA 3CQZB 3R2TA 4RGNA 3SK6A 5IGDA 1TVXA 1WTWA 4A3EB 4WRDA 1SFOB 1HUNA 1PFMA 2FFKB 1ONLA 1GUNA 3I90A 1Q1BA 4CJ0B 2C5CA 3MEHA 2FMCA 3EVQA 4QUCA 4UDUC 4CJ1B 1EQTA 1SEBD 3MFGA 5IGEA 4O1NA 5CV6A 3I4LA 1ILQA 3DHQA 2B8GA 2B2TC 2PMZB 1F9RA 5JAVA 1FYCA 4NW2A 4KI0A 4ABNA 2ZXRA 3T51B 2XVSA 5C4ZA 1KDBA 1B50A 1E2VA 2IW3A 3NUCA 2B39A 4XYOA 1RDPD 1STHA 1W6JA 4OIJA 2N55A 2BE5D 3SK5A 4G4KA 4ZK9B 3R8BA 1VMPA 1WTOA 1GJXA 2MPMA 1XX8A 3I8ZA 1A3UA 1QOHA 3OWFA 2E74C 3MZ5A 3PUWA 2QKIC 1SYEA 2K33A 1D5MC 2JEAI 4KHVA 4LAAA 1WTRA 3MXUA 3I70A 3TBIB 5CV4A 4ZLTF 2NTSA 3TDQA 1JB3A 1LTAD 4DAYA 5K5PA 4L6TB 2JA8B 1JWMD 3IL8A 4OO1H 3DUZA 3FEWX 2AQ1B 1D6EC 1ICWA 1WTQA 1FD7D 1SE4A 4RA8A 5BN3A 2PNRC 4K5WA 1ET9A 5FOBB 1PTOH 2K03A 2DNCA 3IFTA 3VYUA 1JCKB 3QG1A 2RVLA 3P75A 2K5DA 1IYVA 1O80A 3H91A 2PCFB 1Z47A 1SJHD 4C56C 4KK7A 2RDFA 3N52A 4A3GB 3GTJB 3VA5A 1WCMB 1PZKD 1RF2D 1F2MA 3L3OC 4IURA 4X3TA 1KDCA 4HN7A 4NP5A 2XWJB 1QG7A 2SNMA 2VXWA 3R3OA 5G3LF 2PW7A 1KDAA 1CZGA 2XIWA 5I4DA 4XQJA 2M9VA 1U4RA 1JE4A 3VA7A 4J8QA 1BOSA 2LS01 2RA4A 1EZ6A 3VR5A 2DN8A 5E4WC 2F4IA 2F0OA 3OOCA 3GTPB 4XDXA 1Y69U 4BY7B 1A6XA 2NN6G 3S1RB 1SYGA 1V1PA 2XN9C 3UI2A 1I4RA 1S5DD 2M2LA 3NTIA 3S1MB 2J4XA 4A93B 3BVGA 3SHLA 1RD9D 2EYHA 1TU2B 1WD1A 2F0LA 5D3IB 3IKJA 5AFWA 1X3PA 4U68A 4RHSA 1TKWB 5C44B 4OIKA 1RTNA 4EGVA 1EEID 5HURA 1A3TA 5C5LA 2V4DA 5KNBA 3MXPA 4MIUA 2EJMA 1PFBA 3DWQA 4A3MB 4RKLA 1QNKA 2LY7A 3ND8A 2K7VA 3D4RA 1EWHA 1CK1A 2GA4B 3SEBA 4KHZA 1CA6A 4M8AA 2JYOA 4C3JB 2XWBB 4Z9CB 4RWSC 4DU9A 1ML0D 1TWCB 1BUVT 1YNND 2OF1A 5D14A 5DNFA 1J9OA 2RSNA 4KKUA 2A6EC 5FLXE 2AWOA 1RODA 4DN4M 1TS5A 3U9OA 3HOXB 4EQNA 3A56A 3RD4A 1TY0A 5CYUA 2F3WA 2RSOA 2D9UA 1V1PB 2R6GA 3SR1A 3A7AB 3D4WA 4XQQA 1LLRD 4G7ZC 4FO2A 1B2TA 2Q8TA 4MHEA 1DZ1A 1F2YA 1HXYD 2WAQB 3E0JA 5G3LD 2EJFC 1R4QB 2L5TA 1Y8NB 2JA6B 4K8IA 3T16A 5DEHA 5C0XJ 3EA6A 1X3QA 1AW7A 2NZ1D 1LTRD 1EY0A 1TS4A 3QOJA 4IZ8A 1MSHA 5JVH3 4IUQA 3J80L 1PTOC 1EY8A 3K6OA 2Z8LA 3S17B 5CBAE 2J7ZA 4XT1B 3SE0A 2CVRA 3O13A 4S3SA 4KMUC 1JWSD 5EPJA 2AWNA 3TP5A 3K5MA 4OHJA 2F0HA 3NXWA 3J81L 1LT4D 4HCEA 1EWCA 1AN8A 3D4DA 4BY1B 4O42A 4BWGB 1I50B 3RLFA 1VMCA 4BS9A 1C4QA 2OXPA 3URYA 2BDNA 3H3VC 2B2UC 4BBRB 3MXGA 2KVMA 3Q6SA 1STEA 1H9SB 4ID6A 1RKNA 1LT5D 3HRZC 1OO9B 1W6KA 4IUPA 5JEAJ 4JBWA 4XTCS 5FKAC 4DA2A 4PMBA 4KY5A 1DM0B 2EVBA 1JWUD 4A3BB 1JOOA 1JC7A 4XT3B 5JJZA 1CI3M 2QDBA 4TRDA 1SAPA 2VB2X 1FR3A 5EPKA 1Y1VB 4HMJA 4KJOA 3GTKB 3NSWA 3TSSA 1QB5D 1PFNA 4FXDA 4C1NK 1KLGD 4IUVA 4JK1C 1PRTF 1I4QA 1NAPA 1GUWA 3MA2B 2JXMB 3VYSA 3IAYA 2EYPA 3MC0B 1LTBD 4C3HG 2HQEA 4DFAA 2XRSD 1BBXC 3QB3A 5C3XA 2AQ3B 1BCPD 1PZJD 3LNNA 3X3NA 2D2CC 2BDOA 5EBCA 2NN6I 1D5XC 2EYJA 1VDZA 5C6AA 3J7YW 1SYCA 3VYTA 4G57A 1F2ZA 3VYRA 3A7LA 5FO8B 1TWHB 4U673 3H0GB 4KD4A 1F9SA 1LTID 4ODGA 1O7YA 3KLSX 1BDOA 2H1EA 4AYBB 2HUGA 5EJWA 5I9OA 4KY6A 2IX1A 2F0QA 1ILPA 5C3EB 2L12A 2PZTA 5M3MB 3T13A 2WV6D 4DAPA 3LX0A 2X69A 2IX3A 1SMYD 3GTQB 3G6JB 1CQFA 2L55A 2F3VA 1XTCD 4KKSA 2NVQB 4ZQ3A 1H9MA 2RKSA 1NUCA 2B2YC 2MP1A 2EY1A 2A5HA 1V43A 4H44C 1HA6A 3W3AA 3ZYYX 4I65A 1U4LA 4A3IB 1H9KA 3MHBA 2ZT9C 1MSGA 1EIHA 1ESRA 3TZDA 1HQRD 1V1OA 1LTGD 1G2TA 1F9QA 2A69C 4A3DB 3S1QB 1UNSA 4Q0FA 2IT1A 4ME5A 5JPNC 2QF7A 1Y8OB 4RKBA 2F0PA 2WP8J 5ELFA 2LMCB 2F0MA 3OIPA 1MI2A 4PNYA 1F2LA 1CM9A 1PRTD 4F88A 5CR3A 1ZEQX 1NCVA 1ENCA 1PMRA 2M00A 2ZXPA 4YIJA 2WB1B 5IGCA 4HAEA 2BA1A 4IFDH 5M5WB 2SDFA 4A3FB 2O5IC 3DWPA 3I73A 4M1UB 3FMCA 1HFNA 3QO2A 4I7ZC 5C0XH 3RZDB 5K36G 3BDLA 4PMWA 2B63B 1BO0A 4HCSA 1Q8IA 1LO5D 1LV9A 4DXGA 2CW0D 3T56B 1I4PA 5D3DA 3MWYW 2WINB 3P7JA 1HA5A 4C2MB 5ELDA 4UAIA 1S5FD 1PDQA 1UEAB 1LABA 4N9TA 2TSSA 1AEXA 4QF4A 3KK7A 3PO3B 3F2UA 4RCOA 4HEDA 2F0IA 2F0NA 1Q90A 2MUYA 1I6VC 2D5DA 2WIIB 5IGGA 3GP7A 5E1FA 1QCBD 3C1FA 1D1IA 3DEOA 5EKIA 1JORA 2A68C 3CKIB 1FNWA 5HGTA 2Z4HA 5CV5A 1Y1WB 2CHBD 2K5QA 4TKOB 5EGTA 3CU7A 1DOLA 1IKLA 4K2KA 1JR0D 1GUGA 1BXTA 3NE5B 4HMIA 2RBMA 3S2DB 3BYTB 5JEAH 3H6MA 2NVYB 1TQOA 5TSSA 2E75C 1TIID 4A3KB 1EYAA 1B4OA 1G291 2NVTB 3SDZA 1TR5A 2DY7A 2R7ZB 5M5XB 2EDGA 1L0XB 3MAQA 2FMMA 2LKVA 1K8OA 1Q3LA 1CZWA 4H13C 2PW5A 3S9WA 1F9PA 1BQQT 3J80E 2A74C 4ULLA 1IL8A 2K05A 1OXSC 4H7BA 4Q5VA 2RDHA 3K0YA 4C3JG 3NBHA 4PV1C 1JICA 2CQAA 3ERQA 3U9SA 3PUXA 5ELBA 2KHSA 3EROA 4KV6A 5KRUA 4LK1C 4OO1G 2F0KA 2K6AA 4ZRZA 1AFPA 3A8KE 1S5ED 5LHY1 2I46A 3J81E 2JA7B 1CHQD 3KLSA 3AU7A 1EY5A 5EPLA 1OXXK 2JSOA 1FNUA 1T5XD 2KOLA 4C1NI 1F77A 2SNSA 2VB3X 2XSCA 3DEPA 3WOEA 1OXVA 3OW7A 2YYZA 3BVZA 5KNDA 2B2UA 5D65A 4RGMA 1O7LA 2R93B 4QIWB 2F0EA 3S1NB 1I4GA 3GV6A 1DD2A 4HSVA 2LFNA 1J8IA 3ITPA 3Q22A 2K01A 5JPMC 3HOZB 1A15A 1B53A 2Q8RE 1CA5A 1KLUD 3TP7A 3P1HA 5DM63 3R93A 4FYDA 2JP1A 1A3VA 4HR7B 5I9PA 3OIQA 1PTOB 4RH6A 1GUSA 4CKEA 1QE6A 4L63B 1O78A 1LACA 2L1BA 3CRLC 1M4VA 2TMPA 1Y8PB 2NYZD 1L0YB 3DXJC 1H9RA 3MXNA 1H9SA 3BG3A 2Y0SB 3GTGB 1GHJA 2WACA 4IFDJ 4RGTA 3K5LA 1PXUA 2RDGA 3CRKC 1STGA 1IW7C 3HP3A 3V2TA 3JAML 1TS2A 4KTAA 5IT9L 1WVLA 2HDLA 1HCZA 1BF4A 2L4NA 1XWEA 4KY7A 5E3FA 2L11A 2F0TA 3KUPA 5J22A 2EY5A 5J1ZA 1C48A 1I3QB 1MBYA 2A68D 4F87A 2ZXOA 4RCNA 2R61A 2QCPX 4IQZA 1Q1EA 1DCZA 1S5BD 3PMFA 1II3A 1SSOA 3QJYA 4WORA 2IL8A 3D31A 2K28A 3NTKA 3Q0AA 1GHKA 1SJED 3SK4A 2FJ2A 3TN2A 3R2IA 2EPBA 2NVXB 2B2YA 2X6GA 5F2DA 5KIXA 4PQXA 3M85A 2B2WC 2F0DA 2MJ8A 1DXMA 1EOTA 3ONAB 1PLFA 3LWUA 1XXGA 5IGFA 3D6WA 2O2LD 1ENFA 2YU9B 2NTTA 3V05A 5EQ0A 5M9OA 4K6DA 4R8NA 4BA2I 4E6IA 5LL6X 3E6ZX 4B9XA 3PUYA 4ZKBB 1VCIA 1SE3A 2J0TD 3AMUA 3VR2A 3I72A 2AQ2B 1WTVA 1ZYRC 4LJZC 1PTOF 4CGYB 5KYIA 1EU4A 2B2VC 5C0XI 1EEFD 3KBXA 4DF7A 4R8IA 4P2CB 3C1EA 5DM73 5COYA 5A35A 2IX0A 1TWFB 2KUMA 4QB4A 1EZ8A 4OL7A 3C46A 2BCOA 4IALA 3S2HB 3L7ZC 3I3CA 3HOVB 2HDMA 2PO4A 1SDFA 2I07B 4K5VA 1B1ZA 2NB0A 1R9TB 4OO1I 4N9PA 1T5EA 4BBSB 3N6RA 3HGBA 3J7AF 3P20A 1VF5C 5I6YA 4FVMA 2EJGC 4XXEA 2ID0A 1YNJC 2E2IB 1ET6A 1EY7A 4L8JA 2D62A 1TWGB 1HUMA 2A6ED 2KJXA 1EY9A 2EYOA 1GOZA 5IGBA 4CKCA 3S16B 1RJTA 1G6ZA 3S14B 2MHVA 5KEEA 2WKDA 3I91A 3H94A 2FINB 1HRJA 1GXDC 2NWGA 5C3WA 4RFBA 3K57A 1FNVA 1V8QA 2JE6I 3BDCA 4V0BA 4K2LA 4DNRB 1HTLD 3NWTA 3M7GA 5M5YB 3NP8A 4XIGS 4QCLA 5CV7A 3J7AV 1XYIA 2L9HA 1SNOA 4DGZA 1IHZA 2R3ZA 2O4XA 1IW7D 3A55A 2FHTA 1QNUA 2BOSA 5EKKA 1G2SA 2B8FA 4MN3A 4EQOA 3OPOA 3WDNA 2HCCA 4IUNA 3K58A 4X3UA 4KKTA 1PTOD 4WFN3 3BZDB 3M3YB 2EYLA 1LT6D 2XNAC 1STBA 4K8JA 3PV0A 1SNCA 1K8MA 1YNNC 2Q8IB 4NDXA 3BVMA 2KCNA 1SNPA 1Z7TA 2K5WA 1HFGA 3VR6A 2N88A 3GQBA 3FPPA 1EY4A 3EFXD 3K5NA 3RUZA 3FKIB 4DAVA 4X3KA 1AZPA 1DONA 1S4ZA 1B3AA 3HZXA 1OXTA 3NQIA 5NUCA 3KBGA 2WKCA 1I4HA 4TSSA 4XYQA 3S15B 1LT3D 1QILA 5BN4A 3PIO3 3OWEB 3PIP3 2JEBI 2IWHA 3A54A 1NSNS 1EYCA 4IN3A 3HOWB 4F7XA 1PYWD 1SNMA 2A6HC 5T1GA 1LTSD 5T1IA 2ICEC 2NN6H 1SYDA 1X32A 3T4AC 1JOQA 4H0LC 5CGKA 4F8MA 3NTHA 1TS3A 1ZYRD 1CHPD 2F0WA 3HG9A 2IPKD 4KN7C 1RCVD 2F0GA 3EQLC 2VNUD 2F1MA 3FRPB 4CKBA 1K83B 3I4MB 1EFID 2RQXA 1QWYA 1TY2A 4IFDG 1FGBD 1EIGA 2E2JB 3BS1A 4BA1I 1O7ZA 4C3IG 1JQYD 3GV3A 2KCCA 5C0XG 1PZID 2PYKA 4QUFA 5M3FB 4KN4C 5FO9B 3PUVA 1MD2D 4FXKC 3OSOA 4G7OC 3T53B 3QWNA 3JAME 4RGOS 4FXGC 4FF3A 5IT9E 3DMUA 4ZKCB 2F0UA 2EZVA 2E2HB 1U4MA 3M7NA 2A73B 1WTXA 5FK9C 2F0SA 4K14A 3LWEA 3D8GA 2E2DC 3FDTA 1KAAA 4A3JB 1BR9A 3SK8A 1BCPB 5ELEA 4R9WA 4G7HC 3BYYB 5CC4A 4HSPA 2IJ0A 1C8CA 1YNJD 1ZXTA 3HKZB 4X3SA 1MGSA 4OGQC 2EYMA 5BN5A 5IOCA 1EU3A 3Q24A 1HPCA 4CHTB 4EQPA 4C3IB 3NK9A 3DM1A 2AUJD 4QMGA 5EBDA 1KNEA 1S5CD 4IUUA 3TP6A 3W2DA 2NUCA 2SOBA 3SXHA 5CV9A 5I2YA 1ESFA 1D5ZC 1TWAB 4GZYC 1NR4A 1TT2A 4FNFA 5JEAG 2B2WA 1A2TA 1DYQA 5IODA 2F03A 1OXUA 1IKMA 1BCPC 4K5XA 2VUMB 3OHXC 5ISRA 3K5OA 3AB9A 3Q23A 1A2UA 2A69D 3VR4A 1GUOA 5C4HA 1G91A 5C5MA 4J1MA 2DNEA 1SYFA 3TMEA 5DAUA 2KQ3A 2ICIA 4PMCA 3SVMA 3GTLB 2EY6A 4Y7NB 5ELCA 2JA5B 1G8ZD 2L0CA 1SYBA 3ND9A 1I4XA 3H09A 3NWSA 1DOKA 4DNTB 2B2VA 3WOFA 5CV8A 4RHRA 1CFMA 3I4NB 3HEJA 3NHHA 1SMYC 5IIFA 1B9NA 2QILA 1KNAA 2H4OA 1H9JA 3TP8A 1CT1D 1STNA 1VF7A 4KD3A 1R4PB 1PRTB 3BDOA 4FP5D 1EL0A 2OEOA 1STYA 4J6HA 2EOTA 2HCIA 3OMCA 1D1KA 2X6LA 1WD0A 4IUTA 3EJIA 3RZOB 1UAPA 4CBVA 2PQEA 3DWAA 2EXZA 3A8JE 2F0VA 1U9RA 1BCPF 4ZUJA 3MTSA 3KLRA 1SXTA 4NKLA 4ZYSA 2A6HD 3K7AB 2DY8A 3QIAA 4V190
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B2Y A;  2X6G A;  3I90 A;  3P7J A;  3GV3 A;  3IL8 A;  3G7L A;  1IL8 A;  2B2W C;  2K05 A;  4QUF A;  4XT3 B;  1QE6 A;  2MJ8 A;  5CBE E;  4UAI A;  4CJ0 B;  1EOT A;  5JJZ A;  1WD1 A;  3ONA B;  1PLF A;  1PDQ A;  2KEE A;  1ICW A;  1HFG A;  2L1B A;  5AFW A;  5CMD A;  4QUC A;  1X3P A;  1WTQ A;  2N88 A;  3D6W A;  1SAP A;  4CJ1 B;  1X3Q A;  4RA8 A;  1EQT A;  2NZ1 D;  3F2U A;  1WTP A;  1G91 A;  1JIC A;  5EPK A;  4U68 A;  2NYZ D;  4HED A;  1RHP A;  2B2Y C;  2MP1 A;  4OIK A;  4X3K A;  1RTN A;  3SVM A;  1ILQ A;  1AZP A;  5EQ0 A;  4ZKC B;  1DON A;  1HUM A;  1MSH A;  2B2T C;  2K03 A;  1S4Z A;  1PFN A;  1B3A A;  4IUV A;  4IUQ A;  2K1B A;  1F9R A;  1U4M A;  1NAP A;  4NW2 A;  1WTX A;  2RVL A;  3DEO A;  5EKI A;  1HA6 A;  1RJT A;  1G6Z A;  1GUW A;  1M8A A;  1NR2 A;  4ZKB B;  3LWE A;  1O80 A;  1U4L A;  5CBA E;  2J7Z A;  3H91 A;  1PFB A;  4XT1 B;  3FDT A;  3I91 A;  1DOK A;  1B50 A;  2B2V A;  1QNK A;  2FIN B;  3HP3 A;  5EPL A;  1WTV A;  1HRJ A;  1RTO A;  1MSG A;  3N52 A;  1WVL A;  2CVR A;  1E0B A;  2HDL A;  2NWG A;  1EIH A;  2MGS A;  1ESR A;  3TZD A;  4R9W A;  1DOM A;  2KOL A;  4OIJ A;  1BF4 A;  2L4N A;  2N55 A;  1CA6 A;  1BNZ A;  4ZK9 B;  1BBX C;  1G2T A;  1KNA A;  1C8C A;  1VMP A;  1F9Q A;  1WTO A;  2JYO A;  5EPJ A;  2L11 A;  1DOL A;  1IKL A;  4IUR A;  4X3T A;  1ZXT A;  4RWS C;  4X3S A;  1AP0 A;  1MGS A;  2EE1 A;  3DEP A;  2B2V C;  2KED A;  3KUP A;  2MPM A;  1XX8 A;  3KBX A;  1ML0 D;  2K04 A;  1QG7 A;  2VXW A;  3FPU B;  1AZQ A;  4ZAI A;  3I8Z A;  4R8I A;  1EL0 A;  2XIW A;  5D14 A;  2KEC A;  5DNF A;  1J9O A;  2RSN A;  1MI2 A;  5COY A;  5T1G A;  1F2L A;  5T1I A;  4O42 A;  1CM9 A;  1U4R A;  2B2U A;  5E4X A;  1XYI A;  2L9H A;  2X69 A;  1X32 A;  1ROD A;  2R3Z A;  5D65 A;  4DN4 M;  3IFD A;  1JE4 A;  1VMC A;  1NCV A;  4RAU C;  2EOT A;  2HCI A;  2FHT A;  3GV6 A;  2X6L A;  2RA4 A;  1WD0 A;  2KUM A;  4HAE A;  3DM1 A;  4IUT A;  4HSV A;  5E4W C;  2SDF A;  1F9P A;  1KNE A;  2BDN A;  2RSO A;  4IUU A;  1G2S A;  2D9U A;  1WTR A;  2B2T A;  1B4O A;  4MN3 A;  4LMQ D;  1HFN A;  2B2U C;  4XDX A;  3QO2 A;  1F9S A;  1HHV A;  1SSO A;  2KVM A;  1O7Y A;  3Q6S A;  1J8I A;  2HCC A;  2IL8 A;  2DY7 A;  4X3U A;  1U4P A;  2K01 A;  2K28 A;  1NR4 A;  2H1E A;  4ZLT F;  3MTS A;  3UI2 A;  1BO0 A;  2B2W A;  1A15 A;  2HUG A;  4HCS A;  5EJW A;  5COR A;  4CJ2 C;  3I3C A;  1B53 A;  1LV9 A;  2FJ2 A;  2M2L A;  2Q8R E;  3TN2 A;  1ILP A;  2Q8T A;  4IUP A;  2DY8 A;  1IKM A;  2FMM A;  1CA5 A;  1B2T A;  2L12 A;  4MHE A;  1TVX A;  1WTW A;  1Q3L A;  1DZ1 A;  2HDM A;  1EIG A;  1HUN A;  1PFM A;  3R93 A;  3MWY W;  2FFK B;  2JP1 A;  1O7Z A;  1SDF A;  2EPB A; 
#chains in the Genus database with same CATH topology
 2F3I A;  2BA0 A;  4YCW A;  3G7L A;  1B44 D;  4NXN L;  4FF4 A;  4K0K Q;  4P73 A;  1SE2 A;  1PRT C;  5A2Q E;  2E76 C;  3GO5 A;  3HOY G;  5CMD A;  4JYA L;  2LXK A;  3C2P A;  1WTP A;  2F0F A;  4N8X 1;  4XQN A;  3M4Y A;  2QEX A;  3RNU A;  2OT2 A;  3J80 i;  2BE5 C;  3GD7 A;  5I6W A;  1W2B A;  3PO2 B;  1RHP A;  3X3M A;  1EY6 A;  1LUZ A;  1XPU A;  1J6Q A;  3RMH A;  5KYL A;  4ILW A;  4C3H H;  4FF1 A;  2K1B A;  1QVG A;  4YCU A;  1GO3 E;  3CQZ H;  2AUK A;  3K59 A;  2ASB A;  5KNC A;  4GLX A;  1STA A;  2PMZ E;  2CW0 C;  2K4K A;  4DAM A;  4A3E H;  2QEJ C;  3I4O A;  1LTT D;  1XNQ Q;  4TQU S;  2UUB Q;  3C3L A;  1MJE A;  1Q12 A;  4DK0 A;  2G9H D;  2R92 G;  1AP0 A;  2EE1 A;  4JBJ A;  4K6L A;  1KTK A;  1CTM A;  3HOV G;  2WB1 E;  1D2B A;  1ZKO A;  1EQV A;  4A3D H;  3S1Q H;  4HTH A;  1SR3 A;  1PH5 A;  3RN5 A;  2O5J C;  1BKB A;  3M4O B;  2RF4 A;  3KF8 A;  1GUT A;  3HOY B;  4EVO A;  3NPP A;  1KRT A;  4IFD I;  3HOU B;  3GTM B;  2B2T A;  4LMQ D;  2G9D A;  2XRQ D;  1VQ6 A;  1SNQ A;  1HHV A;  2KA7 A;  2SEB D;  5FO7 B;  1HQM C;  3GTO B;  1U4P A;  5FLX L;  4UHV A;  1E2Z A;  2AHO B;  4UPA A;  4CJ2 C;  2EY2 A;  3CHB D;  5COR A;  5GAG C;  3E5S A;  1IYU A;  1HTP A;  2A19 A;  1JOK A;  3NBI A;  5JVG 3;  3T1Y Q;  2OWO A;  5EKL A;  1XPR A;  2PPB C;  3MVV A;  5C4X B;  4CDE C;  3TZU A;  3WWV A;  2KBN A;  5CBE E;  2Z4I A;  2KEE A;  3L9A X;  1KAB A;  1EYD A;  4LNQ A;  2UXC Q;  3ULL A;  2R92 B;  3NQT A;  2PZU A;  1PH6 A;  3OMG A;  2K32 A;  1B9M A;  2RCN A;  3V96 A;  2Z6K C;  5DLQ E;  4ZUI A;  1E2W A;  3HS0 C;  1KC8 C;  3A8I E;  1SND A;  1M8A A;  1IBM Q;  1NR2 A;  2PZW A;  3VR3 A;  3FVQ A;  4B9W A;  2F0J A;  4AIM A;  4B08 A;  1RTO A;  2JA8 H;  3CAM A;  1E0B A;  4FF2 A;  2MGS A;  1DOM A;  2C9O A;  1VQC A;  3CCJ A;  1BNZ A;  3PCO B;  1M1K C;  1SBB B;  1EWI A;  1IL2 A;  5LL6 S;  2NBF A;  2Z1C A;  5C4J B;  1I6H B;  1IBK L;  4DK1 A;  4JI4 L;  2EYF A;  2KED A;  1Y14 B;  5J39 A;  2K04 A;  3L0O A;  1KAW A;  5KGU A;  5A2Q L;  1AZQ A;  3FPU B;  3D3R A;  4ZAI A;  4L5R C;  1DJR D;  2KEC A;  3KF8 B;  3PUZ A;  5I2X A;  1UUP A;  2VY3 A;  3ER0 A;  1QJO A;  5E4X A;  5K36 H;  2WFW A;  5JOB A;  4DK6 C;  4LFB Q;  3IFD A;  1FVI A;  4KJN A;  2ENB A;  4DXF A;  4RAU C;  1YEZ A;  4OWT B;  3MFY A;  4WJW A;  1N36 L;  3D6C A;  4GS3 A;  2OTL A;  1Z6H A;  1JB7 A;  2XTI A;  3QOL A;  4GOP A;  2I5H A;  4DV2 L;  4NMZ A;  3S2D H;  1XJV A;  3KDF A;  3GTJ H;  1CQV A;  4C3H B;  1YVC A;  1WCM H;  1ENA A;  3CQZ B;  1XMQ L;  1UE1 A;  3G71 A;  3R2T A;  4RGN A;  3F8T A;  4GNX A;  3SK6 A;  4DR3 L;  1K28 A;  5IGD A;  1TVX A;  1WTW A;  2IY5 B;  4A3E B;  1YNX A;  4WRD A;  4DR2 Q;  1SFO B;  1HUN A;  1PFM A;  2FFK B;  1ONL A;  2R7Z H;  1GUN A;  3EBE A;  3I90 A;  1HZC A;  1Q1B A;  4CJ0 B;  2C5C A;  3HKS A;  3KLW A;  3MEH A;  2PI2 A;  2FMC A;  3EVQ A;  4QUC A;  4UDU C;  4CJ1 B;  1ASY A;  1EQT A;  1SEB D;  4J15 A;  4A76 A;  1Q81 C;  3HOW G;  3U4V A;  3MFG A;  5IGE A;  4O1N A;  3I4L A;  5CV6 A;  1ILQ A;  3DHQ A;  1L2F A;  2B8G A;  3GTP H;  2B2T C;  2PMZ B;  3PGZ A;  4LW1 A;  1F9R A;  4R4O A;  1FYC A;  5JAV A;  3BU2 A;  4NW2 A;  2HD3 A;  2CH4 W;  1VQN A;  4P71 A;  3FHW A;  3A74 A;  4KI0 A;  4ABN A;  3S1R H;  3W5O A;  5ELO A;  2UU9 Q;  2ZXR A;  3T51 B;  2XVS A;  5C4Z A;  1KDB A;  4UY8 C;  1XNR L;  2KEN A;  4DUY Q;  1B50 A;  1E2V A;  4A93 H;  2IW3 A;  3NUC A;  4DR1 L;  1YJ9 A;  2B39 A;  4XYO A;  1RDP D;  1STH A;  1W6J A;  4DV1 L;  4OIJ A;  2N55 A;  2BE5 D;  3SK5 A;  1VQM A;  4G4K A;  4ZK9 B;  1D7Q A;  3R8B A;  1VMP A;  3CCR A;  1WTO A;  4JBM A;  3TRZ A;  1GJX A;  4A3L G;  3I4M G;  3W1B A;  2MPM A;  1VQ9 A;  1XX8 A;  4B3S Q;  3I8Z A;  1A3U A;  1QOH A;  1LYL A;  2UUC L;  3OWF A;  2E74 C;  2DGY A;  3UE0 A;  3MZ5 A;  3PUW A;  2QKI C;  1PVO A;  3TS0 A;  4GOP B;  3E9I A;  1SYE A;  3KDF B;  2K33 A;  2UUB L;  1D5M C;  4DR7 L;  1YBY A;  4A3M H;  2JEA I;  4A3G G;  3I55 A;  4KHV A;  4LAA A;  3OTO Q;  1WTR A;  3PF4 A;  3MXU A;  2R93 H;  3S1N H;  1EOV A;  3I70 A;  3TBI B;  5CV4 A;  4ZLT F;  2NTS A;  4N8F A;  1VQI A;  3TDQ A;  1JB3 A;  1LTA D;  4GN4 B;  4C3J H;  1VS0 A;  2UXB L;  4DAY A;  1QZH A;  5K5P A;  4L6T B;  2JA8 B;  1JWM D;  3IL8 A;  4OO1 H;  1NBW A;  5AJ3 L;  3DUZ A;  3FEW X;  3NEM A;  4JYA Q;  2AQ1 B;  1D6E C;  1ICW A;  1VQF A;  1KIX A;  3JC6 6;  1WTQ A;  1FD7 D;  2WAQ E;  1SE4 A;  4RA8 A;  3HKZ G;  5BN3 A;  2PNR C;  4K5W A;  3UDI A;  1ET9 A;  2CFM A;  5FOB B;  1PTO H;  5FLM G;  4BY7 G;  1YZ6 A;  4GOP C;  2K03 A;  2DNC A;  3IFT A;  3VYU A;  1JCK B;  3QG1 A;  2RVL A;  3KFU A;  3P75 A;  2K5D A;  2KHJ A;  1IYV A;  1O80 A;  3L2P A;  3H91 A;  4HJA A;  2PCF B;  1Z47 A;  1PH3 A;  1SJH D;  4C56 C;  3GTG H;  4KK7 A;  2RDF A;  3N52 A;  4A3G B;  1K3B C;  5HY6 A;  5IP9 G;  4YWK A;  3VA5 A;  3GTJ B;  1WCM B;  2JA6 H;  1PZK D;  1RF2 D;  1F2M A;  3L3O C;  3NEN A;  4IUR A;  1KDC A;  4X3T A;  4JV5 L;  5C44 G;  4HN7 A;  1CKO A;  4NP5 A;  2XWJ B;  2UUA L;  3CPW A;  3TEH B;  1QG7 A;  2SNM A;  2VXW A;  3R3O A;  5G3L F;  2PW7 A;  1KDA A;  1CZG A;  4QQB X;  2XIW A;  5I4D A;  1NNX A;  3TRE A;  2K50 A;  4XQJ A;  2M9V A;  1U4R A;  1JE4 A;  3VA7 A;  4J8Q A;  1BOS A;  2LS0 1;  4HJ8 A;  3S17 H;  3RLN A;  2I5L X;  2RA4 A;  1EZ6 A;  3VR5 A;  2DN8 A;  5E4W C;  2F4I A;  2CQO A;  2F0O A;  3OOC A;  1CKN B;  3GTP B;  4XDX A;  1Y69 U;  3E3X A;  2OCE A;  4FDB A;  1NMG A;  4BY7 B;  1A6X A;  4RMF A;  2NN6 G;  3F1Z A;  3S1R B;  2JA5 G;  1SYG A;  1V1P A;  2XN9 C;  3UI2 A;  1I4R A;  2ALY B;  3VDY A;  1S5D D;  2M2L A;  3NTI A;  3S1M B;  1PH7 A;  2J4X A;  1VQH A;  4A93 B;  3BZC A;  4DR4 L;  4IPH A;  3BVG A;  3SHL A;  1RD9 D;  2N49 A;  3I4N G;  2QDL A;  4BY1 H;  2EYH A;  1TU2 B;  1I50 H;  2F0L A;  3HOX G;  1WD1 A;  1GM5 A;  1SRU A;  2OQ0 A;  5D3I B;  3IKJ A;  5AFW A;  1X3P A;  4LF4 L;  4DV7 L;  4U68 A;  4RHS A;  1TKW B;  5C44 B;  4OIK A;  1RTN A;  4EGV A;  1EEI D;  5HUR A;  1A3T A;  4BBR H;  5C5L A;  4QY7 A;  2V4D A;  4DKA C;  5KNB A;  3MXP A;  5J3B A;  4MIU A;  2EJM A;  2HQL A;  1PFB A;  3DWQ A;  4R4T A;  4IPC A;  4A3M B;  4RKL A;  3FP9 A;  1VQD A;  1N32 L;  1QNK A;  2G5D A;  1PH8 A;  2LY7 A;  3ND8 A;  2K7V A;  3G48 A;  3D4R A;  2C35 B;  1EWH A;  1CK1 A;  4JCV E;  2GA4 B;  3SEB A;  4KHZ A;  1L1O B;  1CA6 A;  4M8A A;  4JI4 Q;  2JYO A;  3UDF A;  4C3J B;  2XWB B;  3J81 c;  4Z9C B;  4RWS C;  2A1A A;  4DU9 A;  1YI2 A;  1ML0 D;  1TWC B;  2MO0 A;  1BUV T;  1JMC A;  1YNN D;  4JI7 Q;  2OF1 A;  3GTK H;  5D14 A;  2UU9 L;  5DNF A;  1J9O A;  2RSN A;  4IPG A;  4KKU A;  2A6E C;  5FLX E;  1IXR A;  4LFC L;  2AWO A;  1ROD A;  4DN4 M;  2KHI A;  1NMF A;  1TS5 A;  1N36 Q;  3U9O A;  3HOX B;  4EQN A;  1HR0 W;  3A56 A;  3RD4 A;  1TY0 A;  5CYU A;  4DV2 Q;  2F3W A;  3NBH B;  2RSO A;  2D9U A;  1V1P B;  4JI2 L;  3PO2 G;  1JJG A;  3OYY A;  2R6G A;  3SR1 A;  4TVA B;  3A7A B;  1XMQ Q;  3D4W A;  4LUO A;  4GN3 B;  1TWF H;  4XQQ A;  1LLR D;  4G7Z C;  4FO2 A;  1VQJ A;  1WYD A;  1B2T A;  2Q8T A;  4MHE A;  1DZ1 A;  1F2Y A;  1HXY D;  1HZ9 A;  2WAQ B;  3E0J A;  5G3L D;  4BY1 G;  2EJF C;  1L1O C;  1R4Q B;  2L5T A;  1Y8N B;  2I5M X;  4AYB E;  2JA6 B;  3G6E A;  4K8I A;  2HT1 A;  1EFW A;  1EQR A;  3T16 A;  5DEH A;  5C0X J;  3EA6 A;  1X3Q A;  1AW7 A;  2NZ1 D;  1LTR D;  4YWM A;  1EY0 A;  4YHH L;  4BBR G;  1TS4 A;  2MQH A;  2FXQ A;  3QOJ A;  3H0G H;  4IZ8 A;  1JE5 A;  1MSH A;  5JVH 3;  4BBS H;  4IUQ A;  3J80 L;  3JAM i;  1PTO C;  1EY8 A;  3K6O A;  2Z8L A;  3S17 B;  2E2I H;  1XNR Q;  5CBA E;  2J7Z A;  1N34 L;  4UP8 A;  1PH1 A;  4XT1 B;  3SE0 A;  5C3E H;  4X66 L;  2VQE L;  5M3M H;  1NJI C;  4AH6 A;  1X3E A;  1K8A C;  4A3B G;  3HOU G;  4DR1 Q;  2CVR A;  3GTQ H;  4DV1 Q;  1FGU A;  4LWC A;  3O13 A;  4S3S A;  4KMU C;  1JWS D;  5FJ8 G;  1X54 A;  1E22 A;  5EPJ A;  2AWN A;  1LTL A;  3TP5 A;  3K5M A;  1Y1V G;  3KF6 A;  3ULP A;  2NVQ H;  4OHJ A;  5E7N A;  2KCM A;  1B3Q A;  2F0H A;  2KCT A;  3NXW A;  1CUK A;  3A5U A;  3J81 L;  1LT4 D;  4HCE A;  1EWC A;  4JOI C;  2UUC Q;  1AN8 A;  2EXD A;  3D4D A;  4HID A;  4BY1 B;  4O42 A;  5C4X G;  4BWG B;  1I50 B;  3TS2 A;  4DPG A;  3F2D A;  3RLF A;  1VMC A;  4X64 L;  4DR7 Q;  4WJ3 M;  4BS9 A;  2Q2H A;  4DNI A;  4A3I H;  1C4Q A;  2OXP A;  3URY A;  5IYB H;  2BDN A;  3H3V C;  4L5T A;  2B2U C;  4BBR B;  3MXG A;  3ZJY C;  1Z9F A;  4LF7 L;  2KVM A;  3Q6S A;  1STE A;  1H9S B;  4ID6 A;  1RKN A;  1QVC A;  2UXB Q;  2ZTD A;  1K0R A;  1LT5 D;  3HRZ C;  1OO9 B;  1W6K A;  4IUP A;  5IYC G;  5JEA J;  4JBW A;  4XTC S;  5FKA C;  5IP7 G;  4EQ5 A;  4DA2 A;  4PMB A;  4KY5 A;  1DM0 B;  2YTY A;  2EVB A;  3RLO A;  5AJ3 Q;  3CP0 A;  1JWU D;  4A3B B;  1JOO A;  1JC7 A;  3M3Y H;  1S3O A;  4NB3 A;  4XT3 B;  5JJZ A;  1P16 A;  1CI3 M;  2QDB A;  1I5F A;  4TRD A;  1SAP A;  2VB2 X;  2VZA A;  1UE7 A;  1FR3 A;  5EPK A;  1Y1V B;  1MHW C;  4HMJ A;  5M5W H;  2I0Q A;  4KJO A;  4A3F H;  1YHA A;  1S72 A;  3GTK B;  3NSW A;  3TSS A;  5LMU L;  1QB5 D;  1PFN A;  1C9O A;  4FXD A;  4C1N K;  1KLG D;  3IRB A;  4IUV A;  4JK1 C;  4HJ9 A;  4AYB G;  3J7Z C;  1PRT F;  3RZD H;  1I4Q A;  1NAP A;  4OEL B;  4P72 A;  1GUW A;  3MA2 B;  4DV5 Q;  2B63 H;  5M3M G;  3FKI H;  5JJK A;  2JXM B;  5L37 A;  4NXM L;  3VYS A;  3DLL A;  1HNZ L;  3IAY A;  2EYP A;  1C7Y A;  2Q2I A;  3MC0 B;  1LTB D;  2ZTC A;  3KF6 B;  4C3H G;  2HQE A;  4L5S A;  4C2M H;  2E8G A;  1DGS A;  4DFA A;  2XRS D;  1BBX C;  1FL0 A;  4JV5 Q;  3QB3 A;  5C3X A;  2AQ3 B;  5LMN W;  1HR0 L;  1BCP D;  1PZJ D;  2UUA Q;  3PO3 H;  4AQY L;  3LNN A;  3X3N A;  2D2C C;  4A3E G;  2BDO A;  4POF A;  5EBC A;  2NN6 I;  1D5X C;  2EYJ A;  4DV3 L;  1VDZ A;  5C6A A;  1BBW A;  1YJW A;  3CF5 A;  1N8R C;  4JBK A;  3J7Y W;  1SYC A;  3VYT A;  4G57 A;  1F2Z A;  3VYR A;  3A7L A;  5FO8 B;  1TWH B;  4U67 3;  2DJF C;  4APV A;  3H0G B;  1Y1W H;  4KD4 A;  2VS1 A;  1F9S A;  1LTI D;  4R1J A;  4ODG A;  1O7Y A;  3BZK A;  3KLS X;  4A3D G;  1BDO A;  2H1E A;  1TXY A;  4JI7 L;  4AYB B;  1VQ4 A;  2HUG A;  5EJW A;  3S24 A;  2BH2 A;  3I2Z A;  3CC7 A;  5I9O A;  4KY6 A;  2IX1 A;  2F0Q A;  1ILP A;  5C3E B;  2L12 A;  2PZT A;  5M3M B;  4DR4 Q;  3PSI A;  2WV6 D;  3T13 A;  4DAP A;  3LX0 A;  2X69 A;  2IX3 A;  1SMY D;  3GTQ B;  2NZH A;  3G6J B;  1CQF A;  5GAH C;  2L55 A;  2F3V A;  4A3C H;  1XTC D;  1KQS A;  1K83 H;  3F2B A;  4LF4 Q;  1NE3 A;  2WB1 G;  4KKS A;  1SN8 A;  2NVQ B;  2NVY H;  4DV7 Q;  4ZQ3 A;  4A3K H;  1H9M A;  1O7I A;  2RKS A;  1NUC A;  2B2Y C;  2MP1 A;  4PG3 A;  2EY1 A;  2RHQ B;  2NVT H;  2A5H A;  1V43 A;  1E24 A;  4H44 C;  1HNX L;  1HA6 A;  3W3A A;  5M5X H;  1N9W A;  3ZYY X;  1SE8 A;  4I65 A;  1U4L A;  4A4I A;  4A3I B;  1N32 Q;  1H9K A;  3MHB A;  3TQY A;  2ZT9 C;  3H3V I;  1UEB A;  2E2H H;  1MSG A;  2V1C C;  1EIH A;  1ESR A;  3TZD A;  4OXP A;  1HQR D;  1V1O A;  1LTG D;  3PO3 G;  3UE1 A;  1G2T A;  5GAD C;  1F9Q A;  2A69 C;  5EAY A;  4A3D B;  3S1Q B;  4DV6 L;  5ELN A;  1UNS A;  4BXX H;  4Q0F A;  2IT1 A;  4ME5 A;  4A3J H;  5JPN C;  2QF7 A;  1Y8O B;  4RKB A;  2F0P A;  2WP8 J;  5ELF A;  2LMC B;  2F0M A;  4Y52 H;  3OIP A;  1MI2 A;  2JA8 G;  4LFC Q;  4PNY A;  1F2L A;  1CM9 A;  1H95 A;  1PRT D;  4F88 A;  5CR3 A;  1ZEQ X;  4B3M L;  1HNW Q;  1NCV A;  1ENC A;  1PMR A;  2M00 A;  2ZXP A;  4YIJ A;  2WB1 B;  5IGC A;  3CMA A;  4HAE A;  2BA1 A;  1AE3 A;  4JI2 Q;  2JA7 H;  4IFD H;  5M5W B;  2SDF A;  4A3F B;  3G4S A;  2HIX A;  2O5I C;  4HJ7 A;  3DWP A;  2CWA A;  3I73 A;  4M1U B;  3FMC A;  4C3I H;  1HFN A;  3QO2 A;  2HIV A;  1GVP A;  4I7Z C;  4QIW E;  5C0X H;  5GRO A;  3RZD B;  5K36 G;  3BDL A;  1RL2 A;  4PMW A;  2B63 B;  1BO0 A;  4HCS A;  1Q8I A;  1LO5 D;  1LV9 A;  4DXG A;  2CW0 D;  4X62 L;  4GKK L;  1K3R A;  3T56 B;  4R4Q A;  2D0P A;  1I4P A;  5D3D A;  1VQ8 A;  3MWY W;  2ZJP A;  2WIN B;  3P7J A;  2JJQ A;  1HA5 A;  4LF9 L;  4C2M B;  5ELD A;  1WCM G;  4UAI A;  1S5F D;  3KYH C;  1PDQ A;  1UEA B;  1LAB A;  4N9T A;  1CKM A;  3F2C A;  2TSS A;  1AEX A;  4QF4 A;  1VQP A;  1S40 A;  1QZG A;  2Q2U A;  3KK7 A;  4MNO A;  3PO3 B;  3F2U A;  4YHH Q;  2VUM H;  4RCO A;  4DUZ L;  1CKN A;  5GAE C;  1JJ2 A;  4HED A;  2F0I A;  2F0N A;  1Q90 A;  2MUY A;  1I6V C;  1M90 C;  2R7Z G;  2D5D A;  2WII B;  5IGG A;  3U4Z A;  3GP7 A;  5E1F A;  1QCB D;  3ICE A;  3CCQ A;  5IYD H;  3C1F A;  1D1I A;  3DEO A;  1I94 L;  5EKI A;  3HOZ H;  1JOR A;  1N34 Q;  2A68 C;  3CKI B;  1YHQ A;  4X66 Q;  2VQE Q;  5LMN L;  2Y0S E;  1FNW A;  3GTL H;  5HGT A;  5HGQ A;  2K5H A;  1A8V A;  2Z4H A;  5CV5 A;  4QL5 A;  1Y1W B;  2CHB D;  2K5Q A;  4TKO B;  2F4V L;  5EGT A;  3CU7 A;  3CD6 A;  3I56 A;  3BJU A;  1DOL A;  1IKL A;  4K2K A;  1JR0 D;  1GUG A;  1BXT A;  3NE5 B;  4DV5 L;  4A93 G;  1HH2 P;  4HMI A;  1N33 L;  2RBM A;  1L0W A;  3I7F A;  3S2D B;  1CSP A;  4X64 Q;  3BYT B;  5JEA H;  1Q86 C;  4GN5 A;  3H6M A;  2NVY B;  1TQO A;  5TSS A;  2E75 C;  1TII D;  4A3K B;  1EYA A;  2CKZ B;  3OW2 A;  1CSQ A;  2PNH A;  1B4O A;  4LF7 Q;  3CCS A;  1G29 1;  2NVT B;  4LF5 L;  3SDZ A;  1TR5 A;  1HZA A;  1L1O A;  1MKH A;  2DY7 A;  1VQK A;  2R7Z B;  1V1Q A;  5M5X B;  3T1H L;  1QUQ A;  2EDG A;  2ZJR A;  1UE5 A;  1L0X B;  3MAQ A;  2FMM A;  2LKV A;  1K8O A;  3K7U C;  4A3M G;  1Q3L A;  1CZW A;  1E7Z A;  3E0E A;  2PW5 A;  4H13 C;  3S9W A;  1J5E Q;  1F9P A;  2ATW A;  1BQQ T;  3J80 E;  1I3Q H;  2A74 C;  4ULL A;  2R93 G;  1IL8 A;  2K05 A;  1OXS C;  4H7B A;  3K7A H;  4P74 A;  4Q5V A;  4KLK A;  2RDH A;  3K0Y A;  4JI8 L;  3NBH A;  4C3J G;  4PV1 C;  1JIC A;  1WTH A;  2CQA A;  3J81 j;  3ERQ A;  1G6P A;  4WJ4 A;  5LMU Q;  3LGJ A;  3U9S A;  3PUX A;  4MTN A;  5ELB A;  2KHS A;  1SMX A;  3ERO A;  4KV6 A;  4KHP L;  1A63 A;  5KRU A;  3M4P A;  4LK1 C;  4OO1 G;  2F0K A;  3PF5 A;  2K6A A;  4ZRZ A;  1AFP A;  4R4C A;  3A8K E;  4NXM Q;  1S5E D;  5LHY 1;  5IT9 c;  2I46 A;  3J81 E;  1HNZ Q;  2JA7 B;  1CHQ D;  4NPS A;  3KLS A;  1PFS A;  1WFQ A;  3AU7 A;  4ALP A;  1EY5 A;  5EPL A;  1OXX K;  1X3G A;  2JSO A;  2NVX H;  1FNU A;  1T5X D;  4JOI A;  3J80 c;  2KOL A;  2VQF L;  4C1N I;  1F77 A;  4LF8 L;  2SNS A;  3K80 C;  2VB3 X;  3KOJ A;  3CCU A;  4DV4 L;  4A75 A;  1HR0 Q;  1V9P A;  2XSC A;  4AQY Q;  3DEP A;  4EX5 A;  2IHF A;  3WOE A;  1OXV A;  3OW7 A;  2YU9 H;  2Y0S G;  2YYZ A;  1X65 A;  2WAQ G;  1KHI A;  3BVZ A;  5KND A;  4DV3 Q;  2B2U A;  2JA6 G;  1WJJ A;  1EQQ A;  5D65 A;  4RGM A;  1O7L A;  2R93 B;  4QIW B;  3M4Q A;  2F0E A;  3S1N B;  1I4G A;  3GV6 A;  1DD2 A;  4IOC A;  4HSV A;  2JN4 A;  2LFN A;  3UDX A;  2E5L L;  2N78 A;  1QUQ B;  3AQQ A;  2A8V A;  1J8I A;  3M4O H;  3ITP A;  3Q22 A;  2K01 A;  5JPM C;  3HOY H;  3HOZ B;  1A15 A;  3AFQ A;  3E9H A;  4O2D A;  1B53 A;  4JG2 A;  2Q8R E;  1Q7Y C;  1CA5 A;  1KLU D;  2ZJQ A;  2PQA B;  3TP7 A;  3P1H A;  1HNW L;  5DM6 3;  3R93 A;  4FYD A;  2JP1 A;  1A3V A;  4HR7 B;  4HIO A;  5I9P A;  4JW0 A;  3OIQ A;  1PTO B;  4RH6 A;  4OX9 L;  1GUS A;  4CKE A;  1QE6 A;  4L63 B;  2K5V A;  1O78 A;  1LAC A;  2L1B A;  1IYJ B;  3CRL C;  1M4V A;  4B3R Q;  2TMP A;  1P8L A;  5H1S E;  1Y8P B;  3A0J A;  2NYZ D;  1L0Y B;  4IPD A;  3DXJ C;  1H9R A;  3MXN A;  1H9S A;  3BG3 A;  2Y0S B;  1HNX Q;  3GTG B;  3S2H H;  1GHJ A;  3ERS X;  2WAC A;  4IFD J;  4RGT A;  3K5L A;  2R92 H;  1NTG A;  1PXU A;  1X55 A;  2RDG A;  3PIO A;  3CRK C;  1STG A;  2MFI A;  3RN2 A;  3HOV H;  1IW7 C;  3HP3 A;  3V2T A;  3JAM L;  1TS2 A;  4KTA A;  3PIP A;  5IT9 L;  4QGU A;  1WVL A;  1YJN A;  2HDL A;  1R9T H;  1IZ6 A;  1HCZ A;  3D0F A;  4IO9 A;  2L4N A;  1BF4 A;  1XWE A;  4KY7 A;  4DV6 Q;  3QR8 A;  3B6Y A;  5E3F A;  2L11 A;  2Z9H A;  1U0L A;  2F0T A;  3KUP A;  4YY3 L;  5J22 A;  3W1G A;  2EY5 A;  4JVZ A;  2YTV A;  5J1Z A;  1SRO A;  1TWG H;  1C48 A;  1PHJ A;  1I3Q B;  1MBY A;  2A68 D;  2B3G A;  2UXD L;  4B3M Q;  4F87 A;  5C4J H;  2ZXO A;  4RCN A;  2R61 A;  2RCF A;  3S16 H;  2QCP X;  4IQZ A;  1Q1E A;  1DCZ A;  3S14 H;  1S5B D;  2OQK A;  4LFA Q;  3HFZ B;  3A5Z B;  1VQG A;  3EN2 A;  3PMF A;  1II3 A;  2Q2T A;  1SSO A;  1YIT A;  3U58 A;  3QJY A;  4PZ6 A;  4WOR A;  2L15 A;  2IL8 A;  3D31 A;  2K28 A;  3NTK A;  3Q0A A;  1GHK A;  1SJE D;  3SK4 A;  3CCV A;  2IHE A;  2FJ2 A;  4X62 Q;  4GKK Q;  3TN2 A;  3R2I A;  4JI6 L;  2EPB A;  5M5Y H;  2NVX B;  2B2Y A;  2X6G A;  4LF9 Q;  5F2D A;  5KIX A;  4PQX A;  1VQ7 A;  2NZO A;  3M85 A;  2B2W C;  2F0D A;  4CDD C;  2MJ8 A;  1DXM A;  1EOT A;  3NEL A;  3ONA B;  1PLF A;  2ZM6 L;  1BBU A;  3MXN B;  3LWU A;  1XXG A;  5IGF A;  4X65 L;  3D6W A;  4DUZ Q;  1SFO H;  1FJG L;  1PYB A;  1K8G A;  2O2L D;  1ENF A;  2YU9 B;  2NTT A;  4X6A H;  4GLV B;  1XMO L;  5IY0 A;  3V05 A;  5EQ0 A;  5M9O A;  3KJP A;  4K6D A;  4R8N A;  3J81 i;  1YIJ A;  4BA2 I;  4DR6 L;  3KJO A;  1I94 Q;  3RR5 A;  4E6I A;  4GKJ L;  1J5E L;  5LL6 X;  3E6Z X;  4B9X A;  3PUY A;  5LMN Q;  4ZKB B;  1VCI A;  3EIV A;  3M9B A;  2QW7 A;  1SE3 A;  2J0T D;  3AMU A;  3VR2 A;  3I72 A;  2AQ2 B;  1WTV A;  2F4V Q;  3H0G G;  4BBS G;  1ZYR C;  4LJZ C;  1PTO F;  4CGY B;  1PH9 A;  5KYI A;  1EU4 A;  2B2V C;  5C0X I;  1EEF D;  3KBX A;  5C3E G;  2HHH L;  4DF7 A;  1N33 Q;  4R8I A;  4P2C B;  1IBL L;  3C1E A;  1K73 C;  5DM7 3;  5COY A;  1K0S A;  5A35 A;  3STB C;  2IX0 A;  2P5Z X;  1TWF B;  2H5X A;  2KUM A;  3S15 H;  1X6O A;  4QB4 A;  4UP9 A;  1EZ8 A;  4LF5 Q;  4OL7 A;  3C46 A;  1D8L A;  2BCO A;  1VQL A;  4IAL A;  3S2H B;  1AE2 A;  2PI2 E;  3Q8D A;  4YWL A;  3T1H Q;  3L7Z C;  1MJC A;  3CCL A;  3I3C A;  3HOW H;  3MEF A;  2R7D A;  4A3I G;  5IYB G;  3HOV B;  3CC2 A;  2HDM A;  2PO4 A;  1SDF A;  2I07 B;  1A62 A;  4MZ9 A;  2K14 A;  4K5V A;  1B1Z A;  2NB0 A;  1R9T B;  4OO1 I;  4N9P A;  2QGQ A;  1T5E A;  4JI3 Q;  4BBS B;  3N6R A;  1PA6 A;  4I7A A;  4JI8 Q;  3HGB A;  3J7A F;  1VQB A;  3P20 A;  1VF5 C;  5I6Y A;  4H02 A;  4FVM A;  2EJG C;  4XXE A;  2ID0 A;  1YNJ C;  2E2I B;  4O0A A;  1ET6 A;  1EY7 A;  4L8J A;  2D62 A;  1TWG B;  4KHP Q;  1HUM A;  2A6E D;  2KJX A;  1JT8 A;  1EY9 A;  2EYO A;  1LM0 A;  1GOZ A;  5IGB A;  4CKC A;  1KXL A;  3S16 B;  3K0X A;  1RJT A;  1G6Z A;  1KRS A;  3S14 B;  2MHV A;  4A3L H;  3I4M H;  5KEE A;  2WKD A;  5BR8 Q;  3I91 A;  3H94 A;  4DR5 L;  2E2J H;  2FIN B;  1WOC A;  4A3F G;  2N8N A;  4B3R L;  1HRJ A;  4LF6 L;  1GXD C;  1U5K A;  1X9N A;  2NWG A;  5C3W A;  2VQF Q;  4RFB A;  3K57 A;  1FNV A;  4LF8 Q;  1V8Q A;  5M3F H;  2JE6 I;  4DV4 Q;  3BDC A;  2B63 G;  3SGI A;  4V0B A;  4K2L A;  3FKI G;  4DNR B;  1HTL D;  4A3G H;  1PH2 A;  3NWT A;  1PYS B;  3M7G A;  1ASZ A;  5M5Y B;  3NP8 A;  4XIG S;  4QCL A;  5CV7 A;  3J7A V;  1Q82 C;  1EIY B;  3HKZ E;  2L9H A;  1SNO A;  4DGZ A;  1XYI A;  1IHZ A;  2R3Z A;  1WI5 A;  2O4X A;  1UWV A;  4JI5 L;  1IW7 D;  3A55 A;  2FHT A;  1QNU A;  2BOS A;  5EKK A;  2E5L Q;  4JI1 L;  1G2S A;  2B8F A;  4MN3 A;  4CDC C;  1KL9 A;  4JI0 Q;  2JA9 A;  1VQE A;  4EQO A;  3OPO A;  3WDN A;  2HCC A;  4IUN A;  3K58 A;  4X3U A;  4KKT A;  1PTO D;  4WFN 3;  3BZD B;  3M3Y B;  1UE6 A;  2EYL A;  1LT6 D;  2DJG C;  2XNA C;  1STB A;  4K8J A;  3PV0 A;  2Z0S A;  4LUV A;  4CDF C;  1SNC A;  5FLM H;  5JJL A;  4BY7 H;  1K8M A;  1B70 B;  4DV0 Q;  1Y1W G;  1YNN C;  2Q8I B;  4OX9 Q;  4OWW B;  4NDX A;  2EIF A;  3BVM A;  2KCN A;  4LFA L;  1SNP A;  1Z7T A;  3S1M H;  2K5W A;  1VQO A;  1HFG A;  4K0K L;  3VR6 A;  1X56 A;  2N88 A;  3GQB A;  3FPP A;  1EY4 A;  3EFX D;  3K5N A;  5IWA Q;  3RUZ A;  3ULJ A;  3FKI B;  4DAV A;  4X3K A;  1AZP A;  3H15 A;  1DON A;  5IP9 H;  3CC4 A;  1Q8K A;  1XTD A;  1S4Z A;  1B3A A;  3HZX A;  1OXT A;  4A3C G;  1TWA H;  3NQI A;  2VW9 A;  1EIF A;  4PZ7 A;  5NUC A;  2R7F A;  3KBG A;  2WKC A;  1I4H A;  5C44 H;  2Z6B A;  4IJL A;  4TSS A;  4XYQ A;  3PQI A;  1LT3 D;  3UDG A;  3S15 B;  1QIL A;  5BN4 A;  3PIO 3;  4B3T Q;  4A3K G;  3OWE B;  2AKW B;  2N3S A;  4L5Q A;  2VL6 A;  5M3F G;  3PIP 3;  1EYG A;  2JEB I;  2IWH A;  3A54 A;  1PV4 A;  1NSN S;  3CME A;  1XNQ L;  2RHS B;  1EYC A;  3AFP A;  4YY3 Q;  4IN3 A;  3HOW B;  3CW2 C;  1NY4 A;  4F7X A;  1PYW D;  4GNX B;  1GD7 A;  1SLJ A;  1SNM A;  1C0A A;  5GQO A;  2A6H C;  2UXD Q;  4HIM A;  1E1O A;  5T1G A;  2GVB A;  4Y7N H;  1LTS D;  5T1I A;  2ICE C;  2NN6 H;  1EUJ A;  2K75 A;  1SYD A;  1X32 A;  3T4A C;  2JA5 H;  1JOQ A;  4H0L C;  4ME3 A;  1TWC H;  5CGK A;  4F8M A;  3NTH A;  1TS3 A;  4BXX G;  1PH4 A;  1ZYR D;  4NXN Q;  1E1T A;  4A3J G;  2D0O A;  4RG1 A;  1CHP D;  2F0W A;  4PZ8 A;  3I4N H;  3HG9 A;  2IPK D;  4KN7 C;  1GKH A;  1RCV D;  4LUZ A;  3HOX H;  2F0G A;  1W3S A;  3EQL C;  2VNU D;  2F1M A;  1XPO A;  3FRP B;  4CKB A;  1K83 B;  3I4M B;  1EFI D;  2RQX A;  1QWY A;  1TY2 A;  4JI6 Q;  2JA7 G;  4IFD G;  1FGB D;  1EIG A;  2E2J B;  3T1Y L;  3BS1 A;  4BA1 I;  1O7Z A;  3STB D;  4C3I G;  4IOA A;  3DM3 A;  1JQY D;  2GN5 A;  3GV3 A;  2KCC A;  5C0X G;  1PZI D;  2PYK A;  4QUF A;  2ZM6 Q;  5M3F B;  3K8A A;  4KN4 C;  2YV5 A;  2CH4 A;  4X65 Q;  4GNX C;  1HJP A;  3PUV A;  5FO9 B;  1FJG Q;  2AMC B;  1MD2 D;  4FXK C;  3OSO A;  4G7O C;  1YHB A;  3QWN A;  3T53 B;  2UXC L;  3JAM E;  1XMO Q;  4RGO S;  4FXG C;  4FF3 A;  5IT9 E;  3RZO H;  4DR6 Q;  3DMU A;  4ZKC B;  2GVA A;  2F0U A;  4HJ5 A;  2EZV A;  3AYH B;  4GKJ Q;  2E2H B;  1U4M A;  3M7N A;  2A73 B;  1WTX A;  5FK9 C;  1X3F A;  1G51 A;  2F0S A;  3CPF A;  4K14 A;  3LWE A;  3K81 C;  1IBM L;  1VQA A;  3D8G A;  2PQA A;  3CXC A;  2VUM G;  2E2D C;  3FDT A;  4JI3 L;  1B7Y B;  3H3V H;  1KAA A;  4OEM B;  4A3J B;  4HIK A;  1BR9 A;  4JC0 A;  3SK8 A;  1BCP B;  1T9H A;  4R9W A;  4YCV A;  5ELE A;  4G7H C;  3BYY B;  1MIU A;  5IYD G;  5CC4 A;  4HSP A;  2IJ0 A;  5JJI A;  1C8C A;  1YNJ D;  3HOZ G;  4JPB W;  1ZXT A;  3HKZ B;  4X3S A;  1MGS A;  4OGQ C;  2HHH Q;  2EYM A;  5BN5 A;  5IOC A;  1EU3 A;  3Q24 A;  2QA4 A;  1IBL Q;  3PO2 H;  1B8A A;  4DAY B;  3JAM c;  2CCZ A;  1HPC A;  4CHT B;  1VQ5 A;  1AH9 A;  2YTX A;  4EQP A;  3U50 C;  4C3I B;  5BR8 L;  1HZB A;  1ICF B;  4LFB L;  3NK9 A;  2CWP A;  3DM1 A;  4MTK A;  2AUJ D;  4QMG A;  5EBD A;  1K9M C;  1KNE A;  1S5C D;  4IUU A;  3TP6 A;  3W2D A;  2NUC A;  4P75 A;  2F52 A;  2SOB A;  3SXH A;  5CV9 A;  5I2Y A;  1RIP A;  1E3P A;  1QVF A;  1ESF A;  1D5Z C;  4OON A;  1TWA B;  4GZY C;  1NR4 A;  1TT2 A;  4FNF A;  4OWX B;  5JEA G;  2B2W A;  1A2T A;  1DYQ A;  4IJH A;  5IOD A;  2F03 A;  1OXU A;  2OTJ A;  2JK8 A;  1IKM A;  1BCP C;  4K5X A;  2LXJ A;  2VUM B;  3OHX C;  4DR2 L;  3CCE A;  5ISR A;  3K5O A;  3AB9 A;  3Q23 A;  1A2U A;  2BH8 A;  2A69 D;  3AEV A;  4JI0 L;  3VR4 A;  1GUO A;  4QJF A;  5C4H A;  1G91 A;  5C5M A;  4J1M A;  2DNE A;  1SYF A;  3TME A;  4A3B H;  5DAU A;  2KQ3 A;  2ICI A;  4PMC A;  3SVM A;  3GTM H;  3HOU H;  3GTL B;  2ZTE A;  2EY6 A;  4Y7N B;  1IBK Q;  5ELC A;  5FJ8 H;  1Q46 A;  2K52 A;  2JA5 B;  3GTO H;  1G8Z D;  2L0C A;  4DV0 L;  1SYB A;  1Y1V H;  4ZCK A;  3ND9 A;  1I4X A;  3H09 A;  4DR5 Q;  3NWS A;  1DOK A;  2MNA A;  4DNT B;  4LF6 Q;  2B2V A;  3WOF A;  5CV8 A;  4RHR A;  1CFM A;  4DUY L;  2LSS A;  2DUD A;  3I4N B;  3HEJ A;  3NHH A;  5C4X H;  1SMY C;  5IWA L;  5IIF A;  1B9N A;  2B29 A;  1OTC A;  2QIL A;  1KNA A;  2H4O A;  1H9J A;  3TP8 A;  1CT1 D;  1BVS A;  1STN A;  3J7A 5;  1VF7 A;  4KD3 A;  1R4P B;  1PRT B;  4B3S L;  3BDO A;  4FP5 D;  1EL0 A;  1A0I A;  5IE8 A;  2OEO A;  1STY A;  2EQS A;  4J6H A;  4DR3 Q;  4B3T L;  1JJC B;  4JI5 Q;  2K5N A;  2EOT A;  2HCI A;  3OMC A;  1D1K A;  4R4I A;  4DK3 C;  2X6L A;  5IYC H;  1WD0 A;  4JI1 Q;  4IUT A;  5IP7 H;  3EJI A;  3RZO B;  1UAP A;  4CBV A;  2XGT A;  2PQE A;  3DWA A;  2Z6K A;  5FLX c;  1KD1 C;  3OTO L;  2EXZ A;  2JQO A;  3A8J E;  2F0V A;  1U9R A;  1BCP F;  4ZUJ A;  3MTS A;  2ES2 A;  3KLR A;  1SXT A;  3GDE A;  4NKL A;  1TWH H;  4ZYS A;  1I6H H;  2A6H D;  3K7A B;  4GLA C;  2DY8 A;  3QIA A;  4V19 0;  2MO1 A;  4POG A;  3CCM A;  4UP7 A; 
#chains in the Genus database with same CATH homology
 2BA0 A;  3G7L A;  1B44 D;  4FF4 A;  1SE2 A;  1PRT C;  5A2Q E;  2E76 C;  3GO5 A;  5CMD A;  3C2P A;  1WTP A;  2F0F A;  4XQN A;  3M4Y A;  2OT2 A;  2BE5 C;  3GD7 A;  5I6W A;  3PO2 B;  1RHP A;  3X3M A;  1EY6 A;  3RMH A;  5KYL A;  4ILW A;  4FF1 A;  2K1B A;  2AUK A;  3K59 A;  5KNC A;  1STA A;  2CW0 C;  2QEJ C;  1LTT D;  4TQU S;  3C3L A;  1Q12 A;  4DK0 A;  2G9H D;  1AP0 A;  2EE1 A;  4K6L A;  1KTK A;  1CTM A;  1D2B A;  1ZKO A;  1EQV A;  4HTH A;  2O5J C;  3M4O B;  3KF8 A;  1GUT A;  3HOY B;  4EVO A;  3NPP A;  4IFD I;  3HOU B;  3GTM B;  2B2T A;  4LMQ D;  2G9D A;  2XRQ D;  1SNQ A;  1HHV A;  2KA7 A;  2SEB D;  5FO7 B;  1HQM C;  3GTO B;  1U4P A;  5FLX L;  1E2Z A;  4CJ2 C;  2EY2 A;  3CHB D;  5COR A;  3E5S A;  1IYU A;  1HTP A;  1JOK A;  3NBI A;  5JVG 3;  5EKL A;  2PPB C;  3MVV A;  5C4X B;  3TZU A;  5CBE E;  2Z4I A;  2KEE A;  3L9A X;  1KAB A;  1EYD A;  2R92 B;  3NQT A;  2PZU A;  3OMG A;  2K32 A;  1B9M A;  3V96 A;  4ZUI A;  1E2W A;  3HS0 C;  3A8I E;  1SND A;  1M8A A;  1NR2 A;  2PZW A;  3VR3 A;  3FVQ A;  4B9W A;  2F0J A;  4B08 A;  1RTO A;  1E0B A;  4FF2 A;  2MGS A;  1DOM A;  2C9O A;  1BNZ A;  1SBB B;  5LL6 S;  2NBF A;  2Z1C A;  5C4J B;  1I6H B;  4DK1 A;  2EYF A;  2KED A;  5J39 A;  2K04 A;  5KGU A;  5A2Q L;  1AZQ A;  3FPU B;  3D3R A;  4ZAI A;  1DJR D;  2KEC A;  3PUZ A;  5I2X A;  1UUP A;  1QJO A;  5E4X A;  5K36 H;  5JOB A;  3IFD A;  4KJN A;  2ENB A;  4DXF A;  4RAU C;  3MFY A;  4WJW A;  3D6C A;  1Z6H A;  3QOL A;  4NMZ A;  1CQV A;  4C3H B;  1ENA A;  3CQZ B;  3R2T A;  4RGN A;  3SK6 A;  5IGD A;  1TVX A;  1WTW A;  4A3E B;  4WRD A;  1SFO B;  1HUN A;  1PFM A;  2FFK B;  1ONL A;  1GUN A;  3I90 A;  1Q1B A;  4CJ0 B;  2C5C A;  3MEH A;  2FMC A;  3EVQ A;  4QUC A;  4UDU C;  4CJ1 B;  1EQT A;  1SEB D;  3MFG A;  5IGE A;  4O1N A;  5CV6 A;  3I4L A;  1ILQ A;  3DHQ A;  2B8G A;  2B2T C;  2PMZ B;  1F9R A;  5JAV A;  1FYC A;  4NW2 A;  4KI0 A;  4ABN A;  2ZXR A;  3T51 B;  2XVS A;  5C4Z A;  1KDB A;  1B50 A;  1E2V A;  2IW3 A;  3NUC A;  2B39 A;  4XYO A;  1RDP D;  1STH A;  1W6J A;  4OIJ A;  2N55 A;  2BE5 D;  3SK5 A;  4G4K A;  4ZK9 B;  3R8B A;  1VMP A;  1WTO A;  1GJX A;  2MPM A;  1XX8 A;  3I8Z A;  1A3U A;  1QOH A;  3OWF A;  2E74 C;  3MZ5 A;  3PUW A;  2QKI C;  1SYE A;  2K33 A;  1D5M C;  2JEA I;  4KHV A;  4LAA A;  1WTR A;  3MXU A;  3I70 A;  3TBI B;  5CV4 A;  4ZLT F;  2NTS A;  3TDQ A;  1JB3 A;  1LTA D;  4DAY A;  5K5P A;  4L6T B;  2JA8 B;  1JWM D;  3IL8 A;  4OO1 H;  3DUZ A;  3FEW X;  2AQ1 B;  1D6E C;  1ICW A;  1WTQ A;  1FD7 D;  1SE4 A;  4RA8 A;  5BN3 A;  2PNR C;  4K5W A;  1ET9 A;  5FOB B;  1PTO H;  2K03 A;  2DNC A;  3IFT A;  3VYU A;  1JCK B;  3QG1 A;  2RVL A;  3P75 A;  2K5D A;  1IYV A;  1O80 A;  3H91 A;  2PCF B;  1Z47 A;  1SJH D;  4C56 C;  4KK7 A;  2RDF A;  3N52 A;  4A3G B;  3GTJ B;  3VA5 A;  1WCM B;  1PZK D;  1RF2 D;  1F2M A;  3L3O C;  4IUR A;  4X3T A;  1KDC A;  4HN7 A;  4NP5 A;  2XWJ B;  1QG7 A;  2SNM A;  2VXW A;  3R3O A;  5G3L F;  2PW7 A;  1KDA A;  1CZG A;  2XIW A;  5I4D A;  4XQJ A;  2M9V A;  1U4R A;  1JE4 A;  3VA7 A;  4J8Q A;  1BOS A;  2LS0 1;  2RA4 A;  1EZ6 A;  3VR5 A;  2DN8 A;  5E4W C;  2F4I A;  2F0O A;  3OOC A;  3GTP B;  4XDX A;  1Y69 U;  4BY7 B;  1A6X A;  2NN6 G;  3S1R B;  1SYG A;  1V1P A;  2XN9 C;  3UI2 A;  1I4R A;  1S5D D;  2M2L A;  3NTI A;  3S1M B;  2J4X A;  4A93 B;  3BVG A;  3SHL A;  1RD9 D;  2EYH A;  1TU2 B;  1WD1 A;  2F0L A;  5D3I B;  3IKJ A;  5AFW A;  1X3P A;  4U68 A;  4RHS A;  1TKW B;  5C44 B;  4OIK A;  1RTN A;  4EGV A;  1EEI D;  5HUR A;  1A3T A;  5C5L A;  2V4D A;  5KNB A;  3MXP A;  4MIU A;  2EJM A;  1PFB A;  3DWQ A;  4A3M B;  4RKL A;  1QNK A;  2LY7 A;  3ND8 A;  2K7V A;  3D4R A;  1EWH A;  1CK1 A;  2GA4 B;  3SEB A;  4KHZ A;  1CA6 A;  4M8A A;  2JYO A;  4C3J B;  2XWB B;  4Z9C B;  4RWS C;  4DU9 A;  1ML0 D;  1TWC B;  1BUV T;  1YNN D;  2OF1 A;  5D14 A;  5DNF A;  1J9O A;  2RSN A;  4KKU A;  2A6E C;  5FLX E;  2AWO A;  1ROD A;  4DN4 M;  1TS5 A;  3U9O A;  3HOX B;  4EQN A;  3A56 A;  3RD4 A;  1TY0 A;  5CYU A;  2F3W A;  2RSO A;  2D9U A;  1V1P B;  2R6G A;  3SR1 A;  3A7A B;  3D4W A;  4XQQ A;  1LLR D;  4G7Z C;  4FO2 A;  1B2T A;  2Q8T A;  4MHE A;  1DZ1 A;  1F2Y A;  1HXY D;  2WAQ B;  3E0J A;  5G3L D;  2EJF C;  1R4Q B;  2L5T A;  1Y8N B;  2JA6 B;  4K8I A;  3T16 A;  5DEH A;  5C0X J;  3EA6 A;  1X3Q A;  1AW7 A;  2NZ1 D;  1LTR D;  1EY0 A;  1TS4 A;  3QOJ A;  4IZ8 A;  1MSH A;  5JVH 3;  4IUQ A;  3J80 L;  1PTO C;  1EY8 A;  3K6O A;  2Z8L A;  3S17 B;  5CBA E;  2J7Z A;  4XT1 B;  3SE0 A;  2CVR A;  3O13 A;  4S3S A;  4KMU C;  1JWS D;  5EPJ A;  2AWN A;  3TP5 A;  3K5M A;  4OHJ A;  2F0H A;  3NXW A;  3J81 L;  1LT4 D;  4HCE A;  1EWC A;  1AN8 A;  3D4D A;  4BY1 B;  4O42 A;  4BWG B;  1I50 B;  3RLF A;  1VMC A;  4BS9 A;  1C4Q A;  2OXP A;  3URY A;  2BDN A;  3H3V C;  2B2U C;  4BBR B;  3MXG A;  2KVM A;  3Q6S A;  1STE A;  1H9S B;  4ID6 A;  1RKN A;  1LT5 D;  3HRZ C;  1OO9 B;  1W6K A;  4IUP A;  5JEA J;  4JBW A;  4XTC S;  5FKA C;  4DA2 A;  4PMB A;  4KY5 A;  1DM0 B;  2EVB A;  1JWU D;  4A3B B;  1JOO A;  1JC7 A;  4XT3 B;  5JJZ A;  1CI3 M;  2QDB A;  4TRD A;  1SAP A;  2VB2 X;  1FR3 A;  5EPK A;  1Y1V B;  4HMJ A;  4KJO A;  3GTK B;  3NSW A;  3TSS A;  1QB5 D;  1PFN A;  4FXD A;  4C1N K;  1KLG D;  4IUV A;  4JK1 C;  1PRT F;  1I4Q A;  1NAP A;  1GUW A;  3MA2 B;  2JXM B;  3VYS A;  3IAY A;  2EYP A;  3MC0 B;  1LTB D;  4C3H G;  2HQE A;  4DFA A;  2XRS D;  1BBX C;  3QB3 A;  5C3X A;  2AQ3 B;  1BCP D;  1PZJ D;  3LNN A;  3X3N A;  2D2C C;  2BDO A;  5EBC A;  2NN6 I;  1D5X C;  2EYJ A;  1VDZ A;  5C6A A;  3J7Y W;  1SYC A;  3VYT A;  4G57 A;  1F2Z A;  3VYR A;  3A7L A;  5FO8 B;  1TWH B;  4U67 3;  3H0G B;  4KD4 A;  1F9S A;  1LTI D;  4ODG A;  1O7Y A;  3KLS X;  1BDO A;  2H1E A;  4AYB B;  2HUG A;  5EJW A;  5I9O A;  4KY6 A;  2IX1 A;  2F0Q A;  1ILP A;  5C3E B;  2L12 A;  2PZT A;  5M3M B;  3T13 A;  2WV6 D;  4DAP A;  3LX0 A;  2X69 A;  2IX3 A;  1SMY D;  3GTQ B;  3G6J B;  1CQF A;  2L55 A;  2F3V A;  1XTC D;  4KKS A;  2NVQ B;  4ZQ3 A;  1H9M A;  2RKS A;  1NUC A;  2B2Y C;  2MP1 A;  2EY1 A;  2A5H A;  1V43 A;  4H44 C;  1HA6 A;  3W3A A;  3ZYY X;  4I65 A;  1U4L A;  4A3I B;  1H9K A;  3MHB A;  2ZT9 C;  1MSG A;  1EIH A;  1ESR A;  3TZD A;  1HQR D;  1V1O A;  1LTG D;  1G2T A;  1F9Q A;  2A69 C;  4A3D B;  3S1Q B;  1UNS A;  4Q0F A;  2IT1 A;  4ME5 A;  5JPN C;  2QF7 A;  1Y8O B;  4RKB A;  2F0P A;  2WP8 J;  5ELF A;  2LMC B;  2F0M A;  3OIP A;  1MI2 A;  4PNY A;  1F2L A;  1CM9 A;  1PRT D;  4F88 A;  5CR3 A;  1ZEQ X;  1NCV A;  1ENC A;  1PMR A;  2M00 A;  2ZXP A;  4YIJ A;  2WB1 B;  5IGC A;  4HAE A;  2BA1 A;  4IFD H;  5M5W B;  2SDF A;  4A3F B;  2O5I C;  3DWP A;  3I73 A;  4M1U B;  3FMC A;  1HFN A;  3QO2 A;  4I7Z C;  5C0X H;  3RZD B;  5K36 G;  3BDL A;  4PMW A;  2B63 B;  1BO0 A;  4HCS A;  1Q8I A;  1LO5 D;  1LV9 A;  4DXG A;  2CW0 D;  3T56 B;  1I4P A;  5D3D A;  3MWY W;  2WIN B;  3P7J A;  1HA5 A;  4C2M B;  5ELD A;  4UAI A;  1S5F D;  1PDQ A;  1UEA B;  1LAB A;  4N9T A;  2TSS A;  1AEX A;  4QF4 A;  3KK7 A;  3PO3 B;  3F2U A;  4RCO A;  4HED A;  2F0I A;  2F0N A;  1Q90 A;  2MUY A;  1I6V C;  2D5D A;  2WII B;  5IGG A;  3GP7 A;  5E1F A;  1QCB D;  3C1F A;  1D1I A;  3DEO A;  5EKI A;  1JOR A;  2A68 C;  3CKI B;  1FNW A;  5HGT A;  2Z4H A;  5CV5 A;  1Y1W B;  2CHB D;  2K5Q A;  4TKO B;  5EGT A;  3CU7 A;  1DOL A;  1IKL A;  4K2K A;  1JR0 D;  1GUG A;  1BXT A;  3NE5 B;  4HMI A;  2RBM A;  3S2D B;  3BYT B;  5JEA H;  3H6M A;  2NVY B;  1TQO A;  5TSS A;  2E75 C;  1TII D;  4A3K B;  1EYA A;  1B4O A;  1G29 1;  2NVT B;  3SDZ A;  1TR5 A;  2DY7 A;  2R7Z B;  5M5X B;  2EDG A;  1L0X B;  3MAQ A;  2FMM A;  2LKV A;  1K8O A;  1Q3L A;  1CZW A;  4H13 C;  2PW5 A;  3S9W A;  1F9P A;  1BQQ T;  3J80 E;  2A74 C;  4ULL A;  1IL8 A;  2K05 A;  1OXS C;  4H7B A;  4Q5V A;  2RDH A;  3K0Y A;  4C3J G;  3NBH A;  4PV1 C;  1JIC A;  2CQA A;  3ERQ A;  3U9S A;  3PUX A;  5ELB A;  2KHS A;  3ERO A;  4KV6 A;  5KRU A;  4LK1 C;  4OO1 G;  2F0K A;  2K6A A;  4ZRZ A;  1AFP A;  3A8K E;  1S5E D;  5LHY 1;  2I46 A;  3J81 E;  2JA7 B;  1CHQ D;  3KLS A;  3AU7 A;  1EY5 A;  5EPL A;  1OXX K;  2JSO A;  1FNU A;  1T5X D;  2KOL A;  4C1N I;  1F77 A;  2SNS A;  2VB3 X;  2XSC A;  3DEP A;  3WOE A;  1OXV A;  3OW7 A;  2YYZ A;  3BVZ A;  5KND A;  2B2U A;  5D65 A;  4RGM A;  1O7L A;  2R93 B;  4QIW B;  2F0E A;  3S1N B;  1I4G A;  3GV6 A;  1DD2 A;  4HSV A;  2LFN A;  1J8I A;  3ITP A;  3Q22 A;  2K01 A;  5JPM C;  3HOZ B;  1A15 A;  1B53 A;  2Q8R E;  1CA5 A;  1KLU D;  3TP7 A;  3P1H A;  5DM6 3;  3R93 A;  4FYD A;  2JP1 A;  1A3V A;  4HR7 B;  5I9P A;  3OIQ A;  1PTO B;  4RH6 A;  1GUS A;  4CKE A;  1QE6 A;  4L63 B;  1O78 A;  1LAC A;  2L1B A;  3CRL C;  1M4V A;  2TMP A;  1Y8P B;  2NYZ D;  1L0Y B;  3DXJ C;  1H9R A;  3MXN A;  1H9S A;  3BG3 A;  2Y0S B;  3GTG B;  1GHJ A;  2WAC A;  4IFD J;  4RGT A;  3K5L A;  1PXU A;  2RDG A;  3CRK C;  1STG A;  1IW7 C;  3HP3 A;  3V2T A;  3JAM L;  1TS2 A;  4KTA A;  5IT9 L;  1WVL A;  2HDL A;  1HCZ A;  1BF4 A;  2L4N A;  1XWE A;  4KY7 A;  5E3F A;  2L11 A;  2F0T A;  3KUP A;  5J22 A;  2EY5 A;  5J1Z A;  1C48 A;  1I3Q B;  1MBY A;  2A68 D;  4F87 A;  2ZXO A;  4RCN A;  2R61 A;  2QCP X;  4IQZ A;  1Q1E A;  1DCZ A;  1S5B D;  3PMF A;  1II3 A;  1SSO A;  3QJY A;  4WOR A;  2IL8 A;  3D31 A;  2K28 A;  3NTK A;  3Q0A A;  1GHK A;  1SJE D;  3SK4 A;  2FJ2 A;  3TN2 A;  3R2I A;  2EPB A;  2NVX B;  2B2Y A;  2X6G A;  5F2D A;  5KIX A;  4PQX A;  3M85 A;  2B2W C;  2F0D A;  2MJ8 A;  1DXM A;  1EOT A;  3ONA B;  1PLF A;  3LWU A;  1XXG A;  5IGF A;  3D6W A;  2O2L D;  1ENF A;  2YU9 B;  2NTT A;  3V05 A;  5EQ0 A;  5M9O A;  4K6D A;  4R8N A;  4BA2 I;  4E6I A;  5LL6 X;  3E6Z X;  4B9X A;  3PUY A;  4ZKB B;  1VCI A;  1SE3 A;  2J0T D;  3AMU A;  3VR2 A;  3I72 A;  2AQ2 B;  1WTV A;  1ZYR C;  4LJZ C;  1PTO F;  4CGY B;  5KYI A;  1EU4 A;  2B2V C;  5C0X I;  1EEF D;  3KBX A;  4DF7 A;  4R8I A;  4P2C B;  3C1E A;  5DM7 3;  5COY A;  5A35 A;  2IX0 A;  1TWF B;  2KUM A;  4QB4 A;  1EZ8 A;  4OL7 A;  3C46 A;  2BCO A;  4IAL A;  3S2H B;  3L7Z C;  3I3C A;  3HOV B;  2HDM A;  2PO4 A;  1SDF A;  2I07 B;  4K5V A;  1B1Z A;  2NB0 A;  1R9T B;  4OO1 I;  4N9P A;  1T5E A;  4BBS B;  3N6R A;  3HGB A;  3J7A F;  3P20 A;  1VF5 C;  5I6Y A;  4FVM A;  2EJG C;  4XXE A;  2ID0 A;  1YNJ C;  2E2I B;  1ET6 A;  1EY7 A;  4L8J A;  2D62 A;  1TWG B;  1HUM A;  2A6E D;  2KJX A;  1EY9 A;  2EYO A;  1GOZ A;  5IGB A;  4CKC A;  3S16 B;  1RJT A;  1G6Z A;  3S14 B;  2MHV A;  5KEE A;  2WKD A;  3I91 A;  3H94 A;  2FIN B;  1HRJ A;  1GXD C;  2NWG A;  5C3W A;  4RFB A;  3K57 A;  1FNV A;  1V8Q A;  2JE6 I;  3BDC A;  4V0B A;  4K2L A;  4DNR B;  1HTL D;  3NWT A;  3M7G A;  5M5Y B;  3NP8 A;  4XIG S;  4QCL A;  5CV7 A;  3J7A V;  1XYI A;  2L9H A;  1SNO A;  4DGZ A;  1IHZ A;  2R3Z A;  2O4X A;  1IW7 D;  3A55 A;  2FHT A;  1QNU A;  2BOS A;  5EKK A;  1G2S A;  2B8F A;  4MN3 A;  4EQO A;  3OPO A;  3WDN A;  2HCC A;  4IUN A;  3K58 A;  4X3U A;  4KKT A;  1PTO D;  4WFN 3;  3BZD B;  3M3Y B;  2EYL A;  1LT6 D;  2XNA C;  1STB A;  4K8J A;  3PV0 A;  1SNC A;  1K8M A;  1YNN C;  2Q8I B;  4NDX A;  3BVM A;  2KCN A;  1SNP A;  1Z7T A;  2K5W A;  1HFG A;  3VR6 A;  2N88 A;  3GQB A;  3FPP A;  1EY4 A;  3EFX D;  3K5N A;  3RUZ A;  3FKI B;  4DAV A;  4X3K A;  1AZP A;  1DON A;  1S4Z A;  1B3A A;  3HZX A;  1OXT A;  3NQI A;  5NUC A;  3KBG A;  2WKC A;  1I4H A;  4TSS A;  4XYQ A;  3S15 B;  1LT3 D;  1QIL A;  5BN4 A;  3PIO 3;  3OWE B;  3PIP 3;  2JEB I;  2IWH A;  3A54 A;  1NSN S;  1EYC A;  4IN3 A;  3HOW B;  4F7X A;  1PYW D;  1SNM A;  2A6H C;  5T1G A;  1LTS D;  5T1I A;  2ICE C;  2NN6 H;  1SYD A;  1X32 A;  3T4A C;  1JOQ A;  4H0L C;  5CGK A;  4F8M A;  3NTH A;  1TS3 A;  1ZYR D;  1CHP D;  2F0W A;  3HG9 A;  2IPK D;  4KN7 C;  1RCV D;  2F0G A;  3EQL C;  2VNU D;  2F1M A;  3FRP B;  4CKB A;  1K83 B;  3I4M B;  1EFI D;  2RQX A;  1QWY A;  1TY2 A;  4IFD G;  1FGB D;  1EIG A;  2E2J B;  3BS1 A;  4BA1 I;  1O7Z A;  4C3I G;  1JQY D;  3GV3 A;  2KCC A;  5C0X G;  1PZI D;  2PYK A;  4QUF A;  5M3F B;  4KN4 C;  5FO9 B;  3PUV A;  1MD2 D;  4FXK C;  3OSO A;  4G7O C;  3T53 B;  3QWN A;  3JAM E;  4RGO S;  4FXG C;  4FF3 A;  5IT9 E;  3DMU A;  4ZKC B;  2F0U A;  2EZV A;  2E2H B;  1U4M A;  3M7N A;  2A73 B;  1WTX A;  5FK9 C;  2F0S A;  4K14 A;  3LWE A;  3D8G A;  2E2D C;  3FDT A;  1KAA A;  4A3J B;  1BR9 A;  3SK8 A;  1BCP B;  5ELE A;  4R9W A;  4G7H C;  3BYY B;  5CC4 A;  4HSP A;  2IJ0 A;  1C8C A;  1YNJ D;  1ZXT A;  3HKZ B;  4X3S A;  1MGS A;  4OGQ C;  2EYM A;  5BN5 A;  5IOC A;  1EU3 A;  3Q24 A;  1HPC A;  4CHT B;  4EQP A;  4C3I B;  3NK9 A;  3DM1 A;  2AUJ D;  4QMG A;  5EBD A;  1KNE A;  1S5C D;  4IUU A;  3TP6 A;  3W2D A;  2NUC A;  2SOB A;  3SXH A;  5CV9 A;  5I2Y A;  1ESF A;  1D5Z C;  1TWA B;  4GZY C;  1NR4 A;  1TT2 A;  4FNF A;  5JEA G;  2B2W A;  1A2T A;  1DYQ A;  5IOD A;  2F03 A;  1OXU A;  1IKM A;  1BCP C;  4K5X A;  2VUM B;  3OHX C;  5ISR A;  3K5O A;  3AB9 A;  3Q23 A;  1A2U A;  2A69 D;  3VR4 A;  1GUO A;  5C4H A;  1G91 A;  5C5M A;  4J1M A;  2DNE A;  1SYF A;  3TME A;  5DAU A;  2KQ3 A;  2ICI A;  4PMC A;  3SVM A;  3GTL B;  2EY6 A;  4Y7N B;  5ELC A;  2JA5 B;  1G8Z D;  2L0C A;  1SYB A;  3ND9 A;  1I4X A;  3H09 A;  3NWS A;  1DOK A;  4DNT B;  2B2V A;  3WOF A;  5CV8 A;  4RHR A;  1CFM A;  3I4N B;  3HEJ A;  3NHH A;  1SMY C;  5IIF A;  1B9N A;  2QIL A;  1KNA A;  2H4O A;  1H9J A;  3TP8 A;  1CT1 D;  1STN A;  1VF7 A;  4KD3 A;  1R4P B;  1PRT B;  3BDO A;  4FP5 D;  1EL0 A;  2OEO A;  1STY A;  4J6H A;  2EOT A;  2HCI A;  3OMC A;  1D1K A;  2X6L A;  1WD0 A;  4IUT A;  3EJI A;  3RZO B;  1UAP A;  4CBV A;  2PQE A;  3DWA A;  2EXZ A;  3A8J E;  2F0V A;  1U9R A;  1BCP F;  4ZUJ A;  3MTS A;  3KLR A;  1SXT A;  4NKL A;  4ZYS A;  2A6H D;  3K7A B;  2DY8 A;  3QIA A;  4V19 0; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...