1PFMA

Pf4-m2 chimeric mutant with the first 10 n-terminal residues of r-pf4 replaced by the n-terminal residues of the il8 sequence. models 1-15 of a 27-model set.
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
68
structure length
68
Chain Sequence
MSAKELRCQCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords PF4-M2 CHIMERA
publication title NMR solution structure of the 32-kDa platelet factor 4 ELR-motif N-terminal chimera: a symmetric tetramer.
pubmed doi rcsb
source organism Homo sapiens
total genus 9
structure length 68
sequence length 68
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1995-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1pfmA00
1NR2A 1DONA 2NYZD 2FMMA 1WTQA 1EL0A 4IUUA 2D9UA 5EPKA 2H1EA 2NZ1D 1MSHA 1RTOA 5T1GA 1O7YA 1DZ1A 1NCVA 2X6LA 1WTPA 2B2YA 1HUMA 1AZQA 3F2UA 1PFNA 1G6ZA 1BNZA 4ZKBB 5D65A 1TVXA 3P7JA 1E0BA 4OIJA 4ZK9B 1O80A 4MN3A 2KOLA 1Q3LA 2SDFA 2EPBA 1WTOA 1WTXA 2B2TC 1WVLA 4HEDA 3TZDA 5T1IA 1QG7A 1DOKA 1DOLA 2FFKB 1PFMA 4NW2A 5CORA 2B2WA 2CVRA 5AFWA 1VMCA 5EPLA 3Q6SA 1EIGA 1LV9A 2MPMA 4R9WA 2KECA 4XT3B 5EPJA 3D6WA 1CA6A 3I91A 1NR4A 1DOMA 1KNEA 1KNAA 1MI2A 2L1BA 1ILQA 2M2LA 5D14A 3TN2A 1GUWA 1WTVA 4U68A 1WD1A 5EJWA 2IL8A 2L11A 1CA5A 1IKLA 1MSGA 1BF4A 5CMDA 2HCIA 4X3TA 3UI2A 2X69A 2MGSA 2JP1A 3G7LA 1WTRA 3HP3A 2Q8TA 3SVMA 4RWSC 1SDFA 2JYOA 3FPUB 4X3KA 1XX8A 1B4OA 4MHEA 1AZPA 1X32A 1U4RA 1HA6A 1B3AA 2B2UC 2NWGA 4X3SA 1EIHA 1EQTA 4IUQA 1HHVA 1PFBA 2FHTA 2K04A 4DN4M 5CBEE 2B2VA 3MWYW 4R8IA 1XYIA 1QNKA 1F2LA 2VXWA 1ICWA 1X3QA 4O42A 4IUTA 2EOTA 2K05A 5EKIA 1NAPA 4IUVA 2KVMA 1G2SA 2B2YC 4CJ0B 2EE1A 2L9HA 2KEDA 2DY7A 1HUNA 2K1BA 4RA8A 1HFNA 3N52A 2KUMA 2L4NA 1BBXC 1HFGA 4ZAIA 2XIWA 2FJ2A 2L12A 1VMPA 2K01A 2HDMA 1SAPA 1F9PA 1ML0D 1C8CA 2MJ8A 1IKMA 3IFDA 1RTNA 4HAEA 1B53A 1BO0A 2B2WC 4XDXA 1U4PA 1F9QA 1AP0A 3QO2A 2HCCA 2B2TA 4LMQD 3I90A 2K03A 5E4XA 3R93A 2FINB 3GV3A 5EQ0A 1G91A 1M8AA 4IURA 1HRJA 3FDTA 1A15A 3I3CA 2HDLA 2RVLA 2J7ZA 3DEOA 1IL8A 1ZXTA 1RODA 5CBAE 1JICA 4QUFA 1JE4A 2K28A 1O7ZA 1WD0A 1F9RA 1PLFA 4UAIA 4OIKA 3LWEA 5JJZA 5COYA 1S4ZA 3DEPA 2X6GA 3DM1A 4ZLTF 2R3ZA 3KUPA 5DNFA 2N88A 5E4WC 1F9SA 4CJ2C 3GV6A 2BDNA 2B2VC 1CM9A 2KEEA 1RHPA 4RAUC 1G2TA 1WTWA 2RA4A 4HSVA 1X3PA 1J8IA 2DY8A 4X3UA 1U4LA 2B2UA 4QUCA 1U4MA 2HUGA 1EOTA 1J9OA 4XT1B 1B2TA 1B50A 1MGSA 1PDQA 1QE6A 3IL8A 1ILPA 1SSOA 2RSNA 2MP1A 3KBXA 2RSOA 3ONAB 4HCSA 4IUPA 1ESRA 2Q8RE 3H91A 4ZKCB 1RJTA 4CJ1B 3I8ZA 3MTSA 2N55A
chains in the Genus database with same CATH superfamily
4A3KG 4ZYSA 2NZ1D 5EBDA 3CKIB 1B8AA 3PO3B 3PUZA 4LFBQ 2CWAA 2KCTA 3OSOA 4GS3A 3R2TA 3P1HA 4AYBB 1MJCA 1Q86C 4MN3A 3M7NA 2SDFA 2EPBA 3QJYA 4RG1A 2R7ZB 2UUBL 2EYPA 2HQLA 4JI0Q 2CVRA 3J81c 1ICFB 3L0OA 1DXMA 1K8MA 1PXUA 1WTVA 1Y8OB 1CZWA 1EIFA 1JOKA 1SYEA 2L11A 4PMCA 4LWCA 2JXMB 4FDBA 2JJQA 4LFAL 4YY3L 3GP7A 3NE5B 3ZJYC 1HA6A 4JBKA 4JYAL 1I6HB 4OO1G 3GTPB 1HHVA 3CW2C 4IQZA 2K04A 1CHQD 4TVAB 4CBVA 1XYIA 4DV6L 3VR6A 3TSSA 1KLGD 5HGTA 1WCMG 4YWKA 4C3JB 1XMOL 2Q2HA 2J4XA 4OXPA 3PIPA 1R9TB 1HFNA 2NN6H 3B6YA 2L4NA 1I50H 5HURA 1OXVA 1TS2A 5IYCH 1I94Q 3ND9A 3A8KE 4BA2I 2HDMA 3TZUA 3CU7A 4RKLA 4EGVA 5IP7H 2MJ8A 2EQSA 4ABNA 4DXFA 4A3DH 3OTOQ 4F7XA 1OO9B 3HOVB 5ELEA 3SE0A 1BCPC 2K03A 1CTMA 5ELDA 2M00A 4EQ5A 3SK5A 2Z6KC 1XPOA 2K4KA 3PIO3 2F0SA 4MZ9A 3K0YA 4BY7B 1C7YA 4CDDC 1KTKA 3KUPA 4OHJA 5IGGA 2ALYB 1TWCH 4POFA 1PRTD 3M3YH 3V96A 2RA4A 2RCNA 2IW3A 3CQZB 4HSVA 3CCJA 2B2UA 1EY5A 1E7ZA 1EOTA 1F2YA 4X65Q 3NK9A 4LUVA 3IL8A 3MAQA 3HOYH 1H9SA 3S16H 4HCSA 4DK3C 3JAMi 4EQNA 2IHEA 2XN9C 4KY7A 1TWFB 2FMCA 3NELA 1B44D 1C9OA 4PQXA 4A3FB 1G6ZA 1RF2D 1E1OA 3IKJA 4BBSB 1EEFD 4RKBA 5JJKA 1EQQA 1KAWA 4YHHQ 4A3IB 3GTKB 4L63B 2FFKB 2EY2A 4B9WA 3GQBA 3AMUA 1N8RC 4JI8L 3U9SA 3W2DA 4YCWA 1SJHD 1ZYRC 2B63H 4U68A 2IT1A 1NBWA 2KHSA 3TP6A 4DV4Q 1S5BD 1FGUA 3C3LA 5M5WB 2SOBA 4A3CG 4R4QA 1HTPA 2B3GA 2JYOA 3DWAA 1JWSD 1XTDA 3H0GH 1GUSA 2BE5D 2N78A 2AQ2B 2A1AA 1A3UA 5BN5A 3U4ZA 1L2FA 3BYTB 4JI3L 4R8IA 5FLMG 3T1YL 3FP9A 1YI2A 4C3IG 5GAHC 1JT8A 2AWNA 2EYJA 4A3JG 2UUCL 3RN5A 5M5XB 3M4OB 2CW0C 1CKOA 2VUMG 2JA8B 4FF1A 3S2DB 4B3MQ 5G3LD 4JBJA 1PH8A 3BVMA 3CCSA 1SNDA 4YWMA 3GTMH 1KL9A 4JI7Q 1UUPA 3CCRA 4ME5A 3C1EA 3J7AV 2R93H 1BCPB 4HIMA 1CUKA 1TU2B 3HEJA 5IYDG 2E2HH 4B3SQ 1VQAA 1G6PA 3PF5A 1NMFA 3FDTA 3I3CA 4WJ3M 4IOCA 3X3MA 4LF9L 3FPPA 2VQFL 4XYQA 4OWTB 4QJFA 1VF7A 1Y1WH 4NXNL 4JI1L 2ES2A 4RAUC 1PMRA 1JR0D 4L5SA 2UXBQ 4IPHA 2DY8A 4UY8C 3PO2G 5KYIA 1KQSA 4TRDA 1ILPA 1LT4D 3I4MG 3GTJH 4ZKCB 1AN8A 2V4DA 2Q8RE 3H91A 3TQYA 1LTTD 2NVXH 2N55A 3WOEA 4WORA 1CHPD 2NYZD 1YIJA 4GN4B 1PTOC 3BDOA 4OWXB 2Y0SE 1V8QA 2QCPX 2G9HD 5IWAL 2JA5B 4C56C 4A4IA 5CGKA 2WB1G 3BZKA 4FXDA 1EWHA 4PMBA 1W3SA 1AFPA 1VMCA 4UP7A 1LV9A 4R9WA 3RLOA 4LUOA 2M2LA 5M3MG 4CKBA 4EX5A 2GN5A 2F3IA 5EJWA 2HHHQ 3K57A 1TKWB 1X3GA 4KJNA 4FVMA 5DM63 3UI2A 1K28A 3HOXG 1CT1D 1KIXA 3HKZB 3PO3G 2NVTB 4HSPA 3J81L 3I55A 2NN6I 4AYBG 2OF1A 4TSSA 3Q0AA 1Z9FA 5M3FB 2MO0A 3HOWB 3TREA 2R7ZG 1YVCA 3CMAA 2KHIA 3AB9A 3SGIA 5C44H 5BR8L 4U673 1SEBD 1VMPA 2MHVA 1UEAB 2E75C 2HIXA 2UUAL 4A3GH 3RZOB 2MFIA 5JEAG 3TBIB 5EQ0A 1K8GA 1Y14B 3BDCA 3PUXA 2J7ZA 4C2MB 4HJ8A 1IL2A 3M4YA 1A62A 1B1ZA 1PYBA 2F0QA 1YHAA 3IRBA 1P8LA 4OONA 2NTSA 2AWOA 3I4NB 4OIKA 5JJZA 2CWPA 1NUCA 2TSSA 4DAPA 1L1OC 4QY7A 4DK6C 1N36L 1F2MA 1WTWA 2E2IB 4KKUA 2HUGA 1LT5D 1MGSA 2QILA 4BY1B 3QR8A 1LTLA 3VR2A 1PTOB 4S3SA 1VQGA 2WAQE 4FNFA 1TWHB 3S17H 1K0SA 1I6VC 4DGZA 2C35B 1XJVA 1D2BA 1FGBD 1E0BA 4UDUC 4HMIA 1WTOA 3F8TA 2B2TC 4BY7G 4K2KA 2PW5A 4O0AA 1PH5A 3CD6A 3G6JB 1UE7A 1JCKB 2UXCQ 3I91A 4OO1H 1R4QB 5C4XB 3KJPA 3AYHB 4LF8L 3CRLC 1XWEA 1JJCB 1TWGB 1N34L 4C1NK 1F77A 3TP8A 1O7IA 2X69A 1AE3A 2JA6B 4JPBW 4L8JA 4OX9L 1A63A 5I6YA 3OW2A 2CQAA 3NTHA 4A3FG 3OW7A 4IFDG 4DAMA 3H3VH 2B2VA 4BBSG 3K5LA 2AHOB 2LSSA 5I4DA 5KYLA 4A3IG 2BH8A 2I5MX 2EJMA 1NAPA 2RDHA 3BZDB 3LGJA 4IUVA 4DAYA 2E5LL 4DV0L 3ND8A 1I5FA 4E6IA 1RCVD 1M1KC 1EY7A 2MO1A 1HFGA 3PUVA 1BDOA 5FO8B 1A8VA 4LF5L 4GOPC 1XNRL 4JVZA 1PH3A 4DV3L 2NVQH 3NSWA 2Q2TA 3ULLA 4AQYL 3S1NH 5BN3A 1TXYA 2KCNA 1G91A 4B3TL 3E5SA 3RNUA 3E9IA 5LMUQ 4IPGA 3CC4A 1RODA 5BN4A 1LYLA 5CBAE 1XNQQ 4BXXH 1YEZA 4V0BA 1L1OB 4FO2A 1SNPA 1X54A 4ZLTF 5I9PA 1U9RA 1VQIA 4JOIC 4DPGA 2IX3A 4A93B 1D8LA 3OYYA 2MQHA 2ASBA 2JA8G 1RD9D 3HOUB 1HTLD 1VQBA 1QNUA 1U4LA 3PF4A 4UPAA 5CV4A 4DUZL 2VNUD 3I2ZA 3ULJA 3CCUA 1HNWL 3PQIA 4C3HH 3RD4A 2M9VA 1Y8PB 2X6LA 4Y52H 4RFBA 4AH6A 1Z47A 2WAQB 1O80A 2KOLA 3OPOA 2KA7A 4POGA 3T16A 4I7ZC 5AFWA 1SMYD 3K80C 5EPJA 4XT3B 5M5YH 4LF6L 3D6WA 3UDXA 3AQQA 5FLMH 3CP0A 4C3IH 3TEHB 1IW7C 1PYWD 5ELFA 3CPWA 4A3JH 2LKVA 4DV1Q 3S15H 2NZOA 1B7YB 4BS9A 2WKDA 2F0PA 4JC0A 1RDPD 1CKNA 4X3KA 2SNSA 4QMGA 3IAYA 4CGYB 4LFCQ 4XTCS 1A0IA 5GADC 3NBHB 4LF4Q 4TKOB 1LLRD 1K3BC 2NVYB 2F0KA 2ZTEA 2JA5G 2VXWA 5IT9E 2K5DA 3R8BA 4DR2L 2F3WA 1SLJA 2K05A 5IYDH 3QWNA 1HCZA 3JAME 5J1ZA 3VR4A 3PIP3 2QGQA 1S3OA 1S5ED 4L5RC 1UE6A 4O1NA 4CDEC 4G7ZC 4NB3A 2A6EC 2HQEA 4DR3Q 5C4HA 1SMXA 4LK1C 4NXML 1STBA 4DR1L 2AUKA 1UE1A 3IFDA 5CV6A 1F9QA 2NUCA 3HOZH 2CKZB 3CC2A 1II3A 3R93A 5C5MA 4F8MA 3NUCA 1A6XA 3HKZG 4LFBL 1X65A 5C3EH 3DUZA 1S72A 4RHRA 3I4MH 3FKIB 1I4HA 3CAMA 1VQ5A 5M3FG 1WD0A 3HOWG 4JI0L 1PH7A 1H9RA 4KY6A 1F9SA 1RKNA 1FVIA 2KEEA 1O78A 1QUQB 1VQLA 2YU9H 1EY6A 2ZM6Q 2QF7A 2QDLA 3D4RA 1KXLA 3KDFA 1SFOB 1TWAB 1KC8C 1VQHA 2K5HA 5EPKA 2R92B 1H95A 5LL6X 1OTCA 1MKHA 1HZBA 1WTPA 3F2UA 2YV5A 4ZKBB 1K83B 4OO1I 1EOVA 3J7AF 4ZK9B 2EZVA 5K36G 4DU9A 3F2CA 3S1QB 3I4NG 3HOXH 3RMHA 2Z6BA 3DXJC 1J5EQ 5FJ8G 3KF8A 5KNBA 1Q12A 3K0XA 4NP5A 1V43A 2UU9Q 1PFSA 4B3RQ 5ELOA 2PI2A 3GDEA 3QB3A 1I94L 4A3EB 1DYQA 3J80L 1FJGQ 1WD1A 1KD1C 4DNTB 1BCPD 3NHHA 3K5MA 3H3VI 2MUYA 2O5IC 1GXDC 3HG9A 3OTOL 1NE3A 2XWBB 4RWSC 1HNZQ 4A3MH 2PQAB 2QDBA 1VS0A 5GROA 4IALA 3URYA 3UE0A 4DV5Q 5CBEE 2N49A 1WTHA 1QVGA 3WOFA 1SROA 1ICWA 4X66Q 2WINB 5JVH3 1TY0A 2Y0SG 2RQXA 1EQVA 4IZ8A 4K0KQ 2O5JC 4KTAA 1PZKD 4DAVA 5CC4A 4FP5D 4MIUA 4ODGA 1I6HH 4HIKA 1LTSD 1Q82C 5C4XG 2SEBD 1D6EC 1JE5A 4X65L 1N32L 5E7NA 4DF7A 3MVVA 2YYZA 2YTVA 2PNRC 1GJXA 2JA6G 1AP0A 2VS1A 1SE3A 1ASZA 3CF5A 5A2QL 1L0YB 3KBGA 4NMZA 4IURA 1Y69U 5JVG3 1IBLL 4KLKA 4P75A 2IX1A 4YHHL 2K5WA 2F0UA 1S4ZA 1ZYRD 5C3XA 3CXCA 2BOSA 2RDFA 4XQQA 1STGA 2LMCB 2A69D 3F2DA 3M7GA 3HZXA 3PCOB 4DV4L 1J9OA 5FLXL 4BBRB 1QE6A 1DD2A 3I8ZA 1YNXA 3UDGA 1NR2A 2F0TA 3MFYA 4KY5A 1RTOA 2EY6A 5LMNW 1LACA 2VZAA 1GOZA 3HGBA 5IOCA 2CW0D 1U5KA 1K3RA 3BVGA 3G6EA 1HR0Q 4V190 3TZDA 3C1FA 1I50B 2D0OA 4A93G 1CA6A 4JV5Q 2OTLA 1EYAA 1E24A 4IFDH 1KNEA 4B3ML 2RBMA 4P2CB 3HOUG 1C4QA 1KDBA 2DJGC 2UUBQ 4A3DB 1U0LA 4ZRZA 4H0LC 4A3IH 3NEMA 2EXZA 2EYMA 2Q8IB 2OQ0A 1WTRA 1VQ6A 3S14B 4RH6A 3E3XA 3LWUA 4B3SL 1KRTA 3VYTA 3W5OA 2PCFB 3KK7A 4QF4A 2B8GA 2K5VA 2RCFA 1QNKA 2WAQG 5M5WH 3T51B 4L5QA 1TWCB 4JYAQ 3ZYYX 2PZWA 3A74A 3M3YB 1SJED 1X3FA 1C0AA 4DV6Q 1QCBD 4WJ4A 3D4WA 3HKZE 3Q24A 5LL6S 1D5XC 2KUMA 3HOYB 2A69C 3N6RA 2UXBL 1RL2A 2K01A 2L15A 4DUYQ 1PTOD 4R4TA 4ULLA 1SYCA 1RTNA 1GUNA 4R4IA 5IODA 4XQNA 3I56A 5LMNL 1U4PA 4IUNA 5M5XH 1EY4A 2EYOA 2K5NA 5FKAC 1KABA 1W6JA 2FXQA 1EWCA 3I4OA 2HDLA 2AQ1B 4G57A 2R61A 4WRDA 3MZ5A 1JORA 5GAGC 1G51A 2OWOA 2X6GA 2B63B 5DNFA 4R4OA 4HR7B 2F0FA 3OIPA 2F3VA 4DXGA 2PQEA 2HHHL 3OMGA 4X3UA 2XRSD 3EQLC 1MIUA 2PW7A 3J81j 3H0GB 1CSQA 4N8X1 3L3OC 1IBML 4X64Q 1E2WA 2A73B 5C4JH 2D9UA 1ESFA 2Z4IA 2B2YA 1YHQA 4XIGS 4DNIA 2IX0A 3FKIG 3RUZA 5EKLA 1H9MA 3STBD 3S1MH 4OGQC 5JOBA 4A75A 4G7HC 4NW2A 4DK1A 3Q6SA 3GTMB 2EJGC 3P20A 1MI2A 3MC0B 2E74C 3TN2A 2JA5H 2R93B 5IP9H 1XMQL 1EFID 3D8GA 2E2JH 3DM3A 2E2HB 1YNND 2HCIA 2RKSA 4R4CA 2LS01 1X3EA 3H09A 1HQMC 2XTIA 2R92G 2R7FA 1B3AA 2F03A 2L55A 1GKHA 5C6AA 2K5QA 1JWMD 3SR1A 3MWYW 1ET6A 3KF6B 1JJGA 3VYSA 3Q22A 1Y1WB 4YWLA 3K5NA 3OHXC 4N9TA 5C0XH 1VQ8A 3GTGH 3PGZA 3S2HB 4JI3Q 3T4AC 4IO9A 2O2LD 2KEDA 4ID6A 2DY7A 2QW7A 4RA8A 4FXGC 3A5UA 3GTJB 5IY0A 4A3EG 2XVSA 1SNOA 3K58A 4R1JA 4JCVE 2B2WC 4DNRB 4LMQD 2ZXRA 1VQDA 4H13C 4DR4Q 5C3WA 1CQVA 3TMEA 3DWQA 5D3IB 1GM5A 1HNXQ 1HH2P 1ET9A 1F9RA 4DR6Q 3ERSX 3OWFA 2B8FA 3STBC 4QQBX 4LF9Q 3L7ZC 2UXCL 2N88A 1UEBA 2DNEA 3G48A 2LY7A 3GV6A 1Y1VB 1CM9A 4WFN3 1X3PA 4CKEA 4KKTA 4JI1Q 2K50A 3UE1A 4GNXC 4FYDA 1SRUA 5FJ8H 4KJOA 1YNNC 1RJTA 3ITPA 2A74C 1NMGA 1V1PB 3MTSA 1DJRD 2K52A 1VQJA 4RHSA 4YIJA 1UE5A 1LUZA 3M4PA 3H3VC 2ZXPA 1A3TA 5TSSA 2UXDQ 4C3JG 1BNZA 4A3KH 4KKSA 4IFDI 4JI2Q 5JPMC 3L9AX 2IHFA 1WTXA 3EBEA 3CCEA 5IT9c 2PPBC 5C44B 4P72A 1QG7A 1TY2A 3W1BA 3C2PA 5CORA 3HFZB 3NPPA 3KYHC 2WV6D 4A3GB 3JAMc 1KNAA 4WJWA 5KNCA 4K5WA 3HOVG 2GA4B 1Y8NB 3QOLA 4F88A 1IKLA 4BBRG 2Z6KA 2PZUA 1ASYA 3MXNB 1PH9A 3S1RB 4GZYC 4NDXA 2A68D 1PH1A 4RGMA 5ELBA 5IGFA 1H9JA 4NKLA 1X32A 1L0WA 3HKSA 4JI4L 4G4KA 1N33Q 5LMUL 1TS3A 1XNQL 1F2LA 4GN5A 3SK6A 5ISRA 1SYDA 3UDIA 2NN6G 2HIVA 4LAAA 5IYCG 1IBKQ 1HUNA 2K1BA 5IP7G 1WCMH 1EU3A 4ZAIA 4DR7L 4A3DG 3GTLH 1VQFA 1DGSA 2ZT9C 3HS0C 4R8NA 3M4QA 4ILWA 4IJHA 1SE4A 1S40A 4XDXA 2K7VA 2JE6I 2V1CC 3SK4A 5EGTA 3EROA 3BVZA 3BU2A 4X62Q 3MXGA 4I7AA 1BBWA 1YNJD 3SHLA 1SYBA 2ICEC 4AIMA 4HJ5A 1OXSC 3BS1A 1STEA 4UAIA 1IYVA 3LWEA 3NTIA 1I3QB 2BH2A 1IW7D 3T1HQ 2A5HA 2DUDA 2KBNA 3HOYG 2E76C 4RMFA 1AEXA 1SNQA 2F0LA 2VQEL 4GNXB 3J81i 1PZID 2Z4HA 4DV1L 1N36Q 1PRTF 4IUPA 1LABA 2LXJA 2JEAI 3U9OA 1GUOA 1ONLA 3ER0A 4IPCA 1EY9A 4A93H 5IIFA 1DONA 4A76A 1SXTA 2A68C 1MSHA 5JJIA 3HOUH 3LNNA 5T1GA 1PV4A 1NCVA 1RIPA 3BDLA 1QVCA 1PFNA 4LF4L 4K2LA 5D65A 1TVXA 5E3FA 4FXKC 5ELCA 4GN3B 1TQOA 2E8GA 1VQEA 1J6QA 4ZCKA 3T13A 5E1FA 1Q1BA 2A6ED 3NWSA 2VB2X 2B63G 1PFMA 4RCNA 2MPMA 3E6ZX 3RN2A 4DR3L 3RLFA 1PH2A 2NVQB 2IL8A 5J22A 1CA5A 5IYBG 1FNVA 3H0GG 1BF4A 4P73A 2I5LX 3S1NB 1GHJA 1VQNA 4KN4C 4GKKQ 4LF8Q 3CCQA 5NUCA 5C0XI 2F4VQ 4Q5VA 1HXYD 2B2UC 4Y7NH 4JBMA 4A3CH 4KHVA 3GTOB 1PHJA 1YNJC 4JG2A 1I4XA 2KENA 2PMZE 2ID0A 4UHVA 2LXKA 3DHQA 2IPKD 1CFMA 2A8VA 1V1QA 1WFQA 2XSCA 3R2IA 1EU4A 2R93G 4TQUS 4C3HB 1E2VA 2E5LQ 4QB4A 3T53B 3SDZA 4EQPA 1F9PA 1G291 1ML0D 4KK7A 2VUMH 3RZDB 1MJEA 3OOCA 2WKCA 5G3LF 3O13A 2D5DA 1E2ZA 5I9OA 3I90A 2Z1CA 4JW0A 2R7DA 1VQPA 4CDFC 3K7AH 4DV3Q 1HJPA 2VL6A 1Y1WG 1XPUA 4AQYQ 1OXUA 4QUFA 5M5YB 1VF5C 4B3TQ 4PZ6A 5K5PA 1AH9A 4DR5L 1LT6D 3NQIA 2R3ZA 3QOJA 2UU9L 4C3IB 3GTQH 2BDNA 3WDNA 3AFPA 3VYRA 1V9PA 3S15B 1A2UA 2SNMA 2JN4A 2DNCA 1Z6HA 2N3SA 3UDFA 4GKJQ 4NPSA 3PO2H 1HNZL 3AU7A 4B08A 4OL7A 4ME3A 3VR5A 5M9OA 4N9PA 2E2DC 4KI0A 3QG1A 3J80E 3NENA 1HUMA 4J1MA 4DFAA 3G71A 1IZ6A 5IGCA 1D1KA 4X66L 4J8QA 5A35A 5IGEA 2OEOA 1BVSA 1STYA 2R92H 1DOLA 2P5ZX 4KMUC 2AKWB 2Z0SA 3I70A 4QCLA 4BA1I 1Y1VG 3W1GA 3I72A 1HQRD 3HOZB 4Z9CB 4GLXA 3K8AA 4LF6Q 1MSGA 4HJAA 5M3MH 2F0OA 1JWUD 5C3EB 2OCEA 3FPUB 1XTCD 2NB0A 2A6HD 5IT9L 5AJ3Q 1L1OA 2F0HA 3OWEB 3KFUA 1H9SB 4IFDJ 3PV0A 4G7OC 1EQTA 3K5OA 2FHTA 4DN4M 1EFWA 5ELNA 1CZGA 3JAML 3X3NA 3PO3H 3Q8DA 5JAVA 1FNUA 1HA5A 2EDGA 5C44G 3I7FA 2RHSB 2KHJA 5EKKA 2XWJB 3GD7A 4CJ0B 5F2DA 2EE1A 2DN8A 2L9HA 3FVQA 2YU9B 2R7ZH 2D2CC 4BY1G 5IE8A 3A7LA 2PMZB 2VW9A 5EBCA 5DM73 1TS4A 1B53A 1E1TA 5CV8A 2B2TA 4DR1Q 2O4XA 3S9WA 2JA7B 1X56A 1M8AA 2WP8J 5JEAH 2RVLA 5FLXE 4QL5A 1X6OA 1KRSA 5CV9A 3AEVA 1ZXTA 3F1ZA 2YTYA 5JPNC 1PA6A 1STHA 4JI6Q 1HR0L 4A3BB 1L0XB 3GTPH 3PMFA 2JSOA 3AFQA 3DM1A 3HRZC 4KD3A 3TP5A 2F0EA 4JV5L 1N9WA 2Z8LA 5E4WC 2VY3A 5D3DA 4C1NI 3KLSA 4C3JH 4PZ8A 1DM0B 3CRKC 4XQJA 4L5TA 1V1OA 3LX0A 2PNHA 1J8IA 4DV2Q 3EVQA 1R9TH 4A3MB 1E3PA 1B50A 1SSOA 3R3OA 2MP1A 3NBHA 2KJXA 3TP7A 4DK0A 1T9HA 1PZJD 3KJOA 1TS5A 1DZ1A 1S5FD 2NZHA 2A6HC 4MTNA 3HOVH 1T5EA 4H02A 4KHPQ 4BBRH 4DV7Q 4K8JA 2CCZA 3V2TA 2KQ3A 1WVLA 1QWYA 2XRQD 3A8JE 4M1UB 4GOPA 3NBIA 2KCCA 3KLSX 1EIGA 3EIVA 1FNWA 2LFNA 4FF3A 4BY7H 1PVOA 1D7QA 2TMPA 1LT3D 1VQ4A 4ZUIA 4DUYL 1CKMA 4HJ9A 3CQZH 4LF7Q 3JC66 2ENBA 1SDFA 4JI5Q 1SNCA 1XX8A 1X55A 2JA9A 5DAUA 1I4RA 4PMWA 4JOIA 1TWFH 1JB3A 1JOQA 4IUTA 3S14H 4A3FH 1D5MC 1WJJA 2KVMA 4BBSH 3F2BA 1CI3M 1QUQA 2GVBA 4RCOA 4APVA 1W6KA 3RLNA 5FO9B 4JI7L 3GTKH 5J3BA 3DLLA 1EY0A 2K75A 4J6HA 1Z7TA 2BCOA 2AMCB 1EYDA 1SAPA 4QIWB 2F1MA 3MA2B 1IKMA 2MNAA 2ZTDA 3K6OA 4LJZC 5C0XJ 1A2TA 4X64L 3QO2A 1N32Q 4LFAQ 5E4XA 4YY3Q 4LW1A 4BXXG 1YITA 4RGOS 1VQ9A 1B9MA 3TRZA 1M4VA 4K14A 1FYCA 3G4SA 1ZEQX 3J80i 1JE4A 3CC7A 1KAAA 1IBLQ 3S16B 1XMOQ 1Q90A 2B2VC 5GAEC 3MXPA 4C3HG 4A3LG 3M4OH 2PQAA 4PNYA 3I73A 2JA8H 2RSNA 3MHBA 3S2DH 1SE2A 3BG3A 2RSOA 1ESRA 4CJ1B 2I46A 1K0RA 4KN7C 1K73C 2XNAC 5IGDA 3A5ZB 4FF4A 1BUVT 1ENCA 4L6TB 1GUGA 1AZQA 3NP8A 2JEBI 2D0PA 3CMEA 5IYBH 2L0CA 1K9MC 5I2YA 1Q8KA 4LNQA 3H15A 3EN2A 2OTJA 4ALPA 3FRPB 2I07B 1MHWC 2G5DA 5C4ZA 4HIDA 5HY6A 3NXWA 1HZAA 1NR4A 3FHWA 3V05A 1D1IA 2ZJQA 3M9BA 1LO5D 1MD2D 1WOCA 1NTGA 1C48A 1LTID 2IWHA 1PRTC 1NNXA 2MGSA 1SN8A 3HP3A 2Q8TA 3SVMA 5DLQE 1D5ZC 4DR4L 1M90C 1KHIA 5LHY1 1VQOA 4UP9A 5CR3A 4MHEA 1EYGA 2ATWA 2NWGA 5CV5A 3C46A 3OIQA 4IUQA 3D6CA 2GVAA 3BZCA 1HNXL 1AW7A 1GO3E 3D3RA 5FO7B 4DR6L 2D62A 2DGYA 3J7ZC 3EJIA 3J81E 1CK1A 2EOTA 3TS2A 1HPCA 4LUZA 2PZTA 1BBXC 4JI8Q 2JQOA 4K6DA 1LTRD 2L12A 2R6GA 1O7LA 3HOZG 4I65A 5C4JB 5L37A 3S2HH 4HAEA 4CKCA 1I4PA 2CFMA 2CQOA 5C3EG 1TR5A 5GQOA 4IJLA 1QZGA 4PZ7A 3GV3A 1GVPA 1K8OA 4RGNA 2UXDL 5LMNQ 1HRJA 3S24A 3S1MB 1EYCA 1IXRA 1S5DD 4HCEA 3NQTA 2K14A 4JI2L 3PUYA 3PIOA 3T1YQ 3EA6A 2BE5C 1OXXK 1SR3A 2B39A 2NVTH 1JOOA 1PLFA 2F0NA 3EFXD 2UUCQ 2AQ3B 3H6MA 2HD3A 2NVXB 2CHBD 1EZ8A 2E2JB 5M3FH 2YTXA 3HOWH 4P74A 4EQOA 3A54A 1RHPA 1G2TA 1WYDA 1KDAA 4HMJA 3SXHA 2QA4A 4DAYB 1DCZA 4XT1B 1ENFA 1PDQA 3U50C 1CQFA 1QB5D 3KOJA 3KLRA 2OQKA 1EQRA 3U58A 2F0WA 4IPDA 4HN7A 1Y1VH 2CH4A 3RZOH 1EL0A 2RHQB 3J7A5 2JA7G 1O7YA 1VQKA 1F2ZA 1N33L 1IBMQ 1BR9A 3GTGB 4K5XA 4BWGB 3CCLA 4OIJA 2F52A 2EYLA 3QIAA 5HGQA 4YCUA 1EIYB 5JJLA 2VQFQ 1Q46A 4A3BG 2B29A 4C2MH 2C9OA 1OXTA 4ZQ3A 1DOKA 1R4PB 4PG3A 1IBKL 2ZJRA 2NTTA 1EUJA 5K36H 2F0IA 2EYHA 3TDQA 1VQMA 3I4NH 4NXNQ 1DOMA 3VA5A 5D14A 1GUWA 3H94A 3I4LA 2JK8A 2PYKA 4A3MG 1PRTB 4P71A 5FOBB 3TS0A 2PO4A 5CMDA 4X3TA 2E2IH 3A55A 5FK9C 2H5XA 1XMQQ 1BCPF 3BYYB 4BY1H 3RR5A 5J39A 1XXGA 2EIFA 1PTOH 2WFWA 4X62L 1PFBA 5C5LA 1TWHH 5IWAQ 1FL0A 1NJIC 1TIID 4Q0FA 3S1RH 2I5HA 1SYGA 2F0JA 1JJ2A 2WIIB 3T1HL 4B9XA 1STAA 2BA1A 2PI2E 4HJ7A 1UWVA 1Q7YC 1AE2A 4JK1C 1HZCA 2EVBA 2QKIC 2FJ2A 1JC7A 4J15A 3SEBA 5I2XA 2Q2UA 1C8CA 4ZUJA 5C4XH 2A19A 2WACA 4H44C 4A3KB 2ZXOA 4XYOA 1TWGH 1W2BA 4KD4A 2JA6H 3A7AB 4KV6A 1A15A 3A0JA 3J80c 1IL8A 4IOAA 1CKNB 2J0TD 3PUWA 3FMCA 1FR3A 1LTGD 3DEPA 4N8FA 2QEJC 2EJFC 2Y0SB 1JMCA 3S17B 3WWVA 5BR8Q 4MNOA 2C5CA 1U4MA 1IYUA 1Q1EA 1BXTA 3U4VA 2UUAQ 1I3QH 3KBXA 1KDCA 2F4IA 4GKKL 3KF6A 1CSPA 4IN3A 4KHZA 2F4VL 3MEFA 1FD7D 2ICIA 1XPRA 2XGTA 2OT2A 3P7JA 4UP8A 5IGBA 5KNDA 2VB3X 1PH6A 1BOSA 4FF2A 3P75A 1PYSB 2EY1A 1WCMB 4HEDA 1YJNA 1VQCA 3CPFA 5EAYA 3GTLB 1B9NA 2ZTCA 2G9DA 4QGUA 2L1BA 1ILQA 4EVOA 2EY5A 3KLWA 3L2PA 2IJ0A 4OWWB 4LFCL 3G7LA 1IHZA 3BJUA 1YJ9A 2RF4A 3D4DA 1AZPA 3ULPA 1SBBB 1BBUA 3KDFB 3E0JA 3ERQA 1YBYA 3K7UC 1SE8A 5FLXc 4O42A 1MBYA 4JI4Q 5EKIA 1GD7A 3ICEA 1IYJB 4DKAC 3K59A 3NTKA 4JBWA 3GTOH 1BQQT 3MXUA 1V1PA 2XIWA 2HT1A 2I0QA 1SNMA 3KF8B 1YZ6A 4HTHA 1VCIA 5KIXA 1LTBD 1N34Q 4GKJL 3VDYA 5CV7A 4DR7Q 4X6AH 1ZKOA 2WB1E 3CCMA 2K32A 1PTOF 1EWIA 3T56B 2FINB 4OX9Q 2H4OA 4A3LH 4CHTB 2DJFC 1EY8A 2RDGA 3RZDH 1Q81C 3A8IE 2QEXA 1JICA 3W3AA 2K28A 2NVYH 4GLVB 1JQYD 4DV0Q 4YCVA 1B70B 5CYUA 2ZM6L 3MXNA 1E22A 1LM0A 5JEAJ 2K6AA 1LTAD 2Z9HA 3GO5A 4K5VA 2F0DA 1B3QA 1EEID 5I6WA 1G8ZD 4QUCA 1B2TA 4LF5Q 1UNSA 3CHBD 4OEMB 3CCVA 3ONAB 5KRUA 4AYBE 4Y7NB 1XNRQ 1EIHA 1I4QA 1HZ9A 3DMUA 1PH4A 1WTQA 2FMMA 2VQEQ 4IUUA 2H1EA 5AJ3L 4K8IA 2L5TA 1BKBA 3E9HA 1J5EL 1I4GA 2F0MA 4B3RL 1Q3LA 5KEEA 4RGTA 2F0GA 5T1IA 4A3JB 1FJGL 2BA0A 2B2WA 3FKIH 4MTKA 5EPLA 5IP9G 1QZHA 1VQ7A 2KCMA 2IY5B 2KECA 4M8AA 3DWPA 2VUMB 3OMCA 1Q8IA 1H9KA 1GHKA 1P16A 1WI5A 3SK8A 3NWTA 1TT2A 1GUTA 4DUZQ 4OELB 3FEWX 1K8AC 3PSIA 2JP1A 1HNWQ 3M85A 4DV5L 4GOPB 3D31A 3K7AB 3K81C 1EZ6A 3E0EA 2Q2IA 1B4OA 2N8NA 1U4RA 4XXEA 4X3SA 2AUJD 1S5CD 5H1SE 1SFOH 5C0XG 1KLUD 1TWAH 4O2DA 4K0KL 1A3VA 1X3QA 4K6LA 4JI6L 1HR0W 3GTQB 3IFTA 1K83H 1QOHA 4DA2A 1G2SA 4GNXA 2B2YC 1STNA 3MEHA 3VR3A 3S1QH 1SYFA 3N52A 3Q23A 1JB7A 4PV1C 4DV2L 1VDZA 1UAPA 3PO2B 3MFGA 1YHBA 1SMYC 2NBFA 1YJWA 1X9NA 3I4MB 1QVFA 1BO0A 3A56A 2F0VA 4HIOA 4A3EH 5KGUA 1T5XD 2HCCA 2EYFA 5DEHA 1NY4A 1NSNS 4KHPL 3VA7A 4DV7L 3DEOA 4GLAC 4QIWE 1ENAA 1QILA 2EXDA 2WB1B 5A2QE 1O7ZA 4DR2Q 4A3GG 5COYA 2BDOA 4H7BA 2JA7H 4CJ2C 2ZJPA 5M3MB 2K33A 2OXPA 3J7YW 4DR5Q 2CH4W 4CDCC 3VYUA 4NXMQ 4A3BH 3D0FA 4F87A 1QJOA 4LF7L 3HOXB 4JI5L
chains in the Genus database with same CATH topology
4ZYSA 2NZ1D 5EBDA 3CKIB 3PO3B 3PUZA 3OSOA 3R2TA 3P1HA 4AYBB 4MN3A 3M7NA 2SDFA 2EPBA 3QJYA 2R7ZB 2EYPA 2CVRA 1DXMA 1K8MA 1PXUA 1WTVA 1Y8OB 1CZWA 1JOKA 1SYEA 2L11A 4PMCA 2JXMB 3GP7A 3NE5B 1HA6A 1I6HB 4OO1G 3GTPB 1HHVA 4IQZA 2K04A 1CHQD 4CBVA 1XYIA 3VR6A 3TSSA 1KLGD 5HGTA 4C3JB 2J4XA 1R9TB 1HFNA 2NN6H 2L4NA 5HURA 1OXVA 1TS2A 4BA2I 3ND9A 3A8KE 2HDMA 3TZUA 3CU7A 4RKLA 4EGVA 2MJ8A 4ABNA 4DXFA 4F7XA 1OO9B 3HOVB 5ELEA 3SE0A 1BCPC 2K03A 1CTMA 5ELDA 2M00A 3SK5A 3PIO3 2F0SA 3K0YA 4BY7B 1KTKA 3KUPA 4OHJA 5IGGA 1PRTD 3V96A 2RA4A 3CQZB 2IW3A 4HSVA 2B2UA 1EY5A 1EOTA 1F2YA 3NK9A 3IL8A 3MAQA 1H9SA 4HCSA 4EQNA 2XN9C 4KY7A 1TWFB 2FMCA 1B44D 4PQXA 4A3FB 1G6ZA 1RF2D 3IKJA 4BBSB 1EEFD 4RKBA 4A3IB 3GTKB 4L63B 2FFKB 2EY2A 4B9WA 3GQBA 3AMUA 3U9SA 3W2DA 1SJHD 1ZYRC 4U68A 2IT1A 2KHSA 3TP6A 1S5BD 3C3LA 5M5WB 2SOBA 1HTPA 2JYOA 3DWAA 1JWSD 1GUSA 2BE5D 2AQ2B 1A3UA 5BN5A 3BYTB 4R8IA 4C3IG 2AWNA 2EYJA 5M5XB 3M4OB 2CW0C 2JA8B 4FF1A 3S2DB 5G3LD 3BVMA 1SNDA 1UUPA 4ME5A 3C1EA 3J7AV 1BCPB 1TU2B 3HEJA 3FDTA 3I3CA 3X3MA 3FPPA 4XYQA 1VF7A 4RAUC 1PMRA 1JR0D 2DY8A 5KYIA 4TRDA 1ILPA 1LT4D 4ZKCB 1AN8A 2V4DA 2Q8RE 3H91A 1LTTD 2N55A 3WOEA 4WORA 1CHPD 2NYZD 1PTOC 3BDOA 1V8QA 2QCPX 2G9HD 2JA5B 4C56C 5CGKA 4FXDA 1EWHA 4PMBA 1AFPA 1VMCA 1LV9A 4R9WA 2M2LA 4CKBA 5EJWA 3K57A 1TKWB 4KJNA 4FVMA 5DM63 3UI2A 1CT1D 3HKZB 2NVTB 4HSPA 3J81L 2NN6I 2OF1A 4TSSA 3Q0AA 5M3FB 3HOWB 3AB9A 4U673 1SEBD 1VMPA 2MHVA 1UEAB 2E75C 3RZOB 5JEAG 3TBIB 5EQ0A 3BDCA 3PUXA 2J7ZA 4C2MB 3M4YA 1B1ZA 2F0QA 2NTSA 2AWOA 3I4NB 4OIKA 5JJZA 1NUCA 2TSSA 4DAPA 1F2MA 1WTWA 2E2IB 4KKUA 2HUGA 1LT5D 1MGSA 2QILA 4BY1B 3VR2A 1PTOB 4S3SA 4FNFA 1TWHB 1I6VC 4DGZA 1D2BA 1FGBD 1E0BA 4UDUC 4HMIA 1WTOA 2B2TC 4K2KA 2PW5A 3G6JB 1JCKB 3I91A 4OO1H 1R4QB 5C4XB 3CRLC 1XWEA 1TWGB 4C1NK 1F77A 3TP8A 2X69A 2JA6B 4L8JA 5I6YA 2CQAA 3NTHA 3OW7A 4IFDG 2B2VA 3K5LA 5I4DA 5KYLA 2EJMA 1NAPA 2RDHA 3BZDB 4IUVA 4DAYA 3ND8A 4E6IA 1RCVD 1EY7A 1HFGA 3PUVA 1BDOA 5FO8B 3NSWA 5BN3A 1G91A 2KCNA 3E5SA 1RODA 5BN4A 5CBAE 4V0BA 4FO2A 1SNPA 4ZLTF 5I9PA 1U9RA 2IX3A 4A93B 1RD9D 3HOUB 1HTLD 1QNUA 1U4LA 5CV4A 2VNUD 3RD4A 2M9VA 1Y8PB 2X6LA 4RFBA 1Z47A 2WAQB 1O80A 2KOLA 3OPOA 2KA7A 3T16A 4I7ZC 5AFWA 1SMYD 5EPJA 4XT3B 3D6WA 1IW7C 1PYWD 5ELFA 2LKVA 4BS9A 2WKDA 2F0PA 1RDPD 4X3KA 2SNSA 4QMGA 3IAYA 4CGYB 4XTCS 4TKOB 1LLRD 2NVYB 2F0KA 2VXWA 5IT9E 2K5DA 3R8BA 2F3WA 2K05A 3QWNA 1HCZA 3JAME 5J1ZA 3VR4A 3PIP3 1S5ED 4O1NA 4G7ZC 2A6EC 2HQEA 5C4HA 4LK1C 1STBA 2AUKA 3IFDA 5CV6A 1F9QA 2NUCA 1II3A 3R93A 5C5MA 4F8MA 3NUCA 1A6XA 3DUZA 4RHRA 3FKIB 1I4HA 1WD0A 1H9RA 4KY6A 1F9SA 1RKNA 2KEEA 1O78A 1EY6A 2QF7A 3D4RA 1SFOB 1TWAB 5EPKA 2R92B 5LL6X 1WTPA 3F2UA 4ZKBB 1K83B 4OO1I 3J7AF 4ZK9B 2EZVA 5K36G 4DU9A 3S1QB 3RMHA 3DXJC 3KF8A 5KNBA 1Q12A 4NP5A 1V43A 3QB3A 4A3EB 1DYQA 3J80L 1WD1A 4DNTB 1BCPD 3NHHA 3K5MA 2MUYA 2O5IC 1GXDC 3HG9A 2XWBB 4RWSC 2QDBA 4IALA 3URYA 5CBEE 3WOFA 1ICWA 2WINB 5JVH3 1TY0A 2RQXA 1EQVA 4IZ8A 2O5JC 4KTAA 1PZKD 4DAVA 5CC4A 4FP5D 4MIUA 4ODGA 1LTSD 2SEBD 1D6EC 4DF7A 3MVVA 2YYZA 2PNRC 1GJXA 1AP0A 1SE3A 5A2QL 1L0YB 3KBGA 4NMZA 4IURA 1Y69U 5JVG3 2IX1A 2K5WA 2F0UA 1S4ZA 1ZYRD 5C3XA 2BOSA 2RDFA 4XQQA 1STGA 2LMCB 2A69D 3M7GA 3HZXA 1J9OA 5FLXL 4BBRB 1QE6A 1DD2A 3I8ZA 1NR2A 2F0TA 3MFYA 4KY5A 1RTOA 2EY6A 1LACA 1GOZA 3HGBA 5IOCA 2CW0D 3BVGA 4V190 3TZDA 3C1FA 1I50B 1CA6A 1EYAA 4IFDH 1KNEA 2RBMA 4P2CB 1C4QA 1KDBA 4A3DB 4ZRZA 4H0LC 2EXZA 2EYMA 2Q8IB 1WTRA 3S14B 4RH6A 3LWUA 3VYTA 2PCFB 3KK7A 4QF4A 2B8GA 1QNKA 3T51B 1TWCB 3ZYYX 2PZWA 3M3YB 1SJED 1QCBD 3D4WA 3Q24A 5LL6S 1D5XC 2KUMA 3HOYB 2A69C 3N6RA 2K01A 1PTOD 4ULLA 1SYCA 1RTNA 1GUNA 5IODA 4XQNA 1U4PA 4IUNA 1EY4A 2EYOA 5FKAC 1KABA 1W6JA 1EWCA 2HDLA 2AQ1B 4G57A 2R61A 4WRDA 3MZ5A 1JORA 2X6GA 2B63B 5DNFA 4HR7B 2F0FA 3OIPA 2F3VA 4DXGA 2PQEA 3OMGA 4X3UA 2XRSD 3EQLC 2PW7A 3H0GB 3L3OC 1E2WA 2A73B 2D9UA 1ESFA 2Z4IA 2B2YA 4XIGS 2IX0A 3RUZA 5EKLA 1H9MA 4OGQC 5JOBA 4G7HC 4NW2A 4DK1A 3Q6SA 3GTMB 2EJGC 3P20A 1MI2A 3MC0B 2E74C 3TN2A 2R93B 1EFID 3D8GA 2E2HB 1YNND 2HCIA 2RKSA 2LS01 3H09A 1HQMC 1B3AA 2F03A 2L55A 5C6AA 2K5QA 1JWMD 3SR1A 3MWYW 1ET6A 3VYSA 3Q22A 1Y1WB 3K5NA 3OHXC 4N9TA 5C0XH 3S2HB 3T4AC 2O2LD 2KEDA 4ID6A 2DY7A 4RA8A 4FXGC 3GTJB 2XVSA 1SNOA 3K58A 2B2WC 4DNRB 4LMQD 2ZXRA 4H13C 5C3WA 1CQVA 3TMEA 3DWQA 5D3IB 1ET9A 1F9RA 3OWFA 2B8FA 3L7ZC 2N88A 2DNEA 2LY7A 3GV6A 1Y1VB 1CM9A 4WFN3 1X3PA 4CKEA 4KKTA 4FYDA 4KJOA 1YNNC 1RJTA 3ITPA 2A74C 1V1PB 3MTSA 1DJRD 4RHSA 4YIJA 3H3VC 2ZXPA 1A3TA 5TSSA 4C3JG 1BNZA 4KKSA 4IFDI 5JPMC 3L9AX 1WTXA 2PPBC 5C44B 1QG7A 1TY2A 3C2PA 5CORA 3NPPA 2WV6D 4A3GB 1KNAA 4WJWA 5KNCA 4K5WA 2GA4B 1Y8NB 3QOLA 4F88A 1IKLA 2PZUA 3S1RB 4GZYC 4NDXA 2A68D 4RGMA 5ELBA 5IGFA 1H9JA 4NKLA 1X32A 4G4KA 1TS3A 1F2LA 3SK6A 5ISRA 1SYDA 2NN6G 4LAAA 1HUNA 2K1BA 1EU3A 4ZAIA 2ZT9C 3HS0C 4R8NA 4ILWA 1SE4A 4XDXA 2K7VA 2JE6I 3SK4A 5EGTA 3EROA 3BVZA 3MXGA 1YNJD 3SHLA 1SYBA 2ICEC 1OXSC 3BS1A 1STEA 4UAIA 1IYVA 3LWEA 3NTIA 1I3QB 1IW7D 2A5HA 2E76C 1AEXA 1SNQA 2F0LA 1PZID 2Z4HA 1PRTF 4IUPA 1LABA 2JEAI 3U9OA 1GUOA 1ONLA 1EY9A 5IIFA 1DONA 1SXTA 2A68C 1MSHA 3LNNA 5T1GA 1NCVA 3BDLA 1PFNA 4K2LA 5D65A 1TVXA 5E3FA 4FXKC 5ELCA 1TQOA 3T13A 5E1FA 1Q1BA 2A6ED 3NWSA 2VB2X 1PFMA 4RCNA 2MPMA 3E6ZX 3RLFA 2NVQB 2IL8A 5J22A 1CA5A 1FNVA 1BF4A 3S1NB 1GHJA 4KN4C 5NUCA 5C0XI 4Q5VA 1HXYD 2B2UC 4KHVA 3GTOB 1YNJC 1I4XA 2ID0A 3DHQA 2IPKD 1CFMA 2XSCA 3R2IA 1EU4A 4TQUS 4C3HB 1E2VA 4QB4A 3T53B 3SDZA 4EQPA 1F9PA 1G291 1ML0D 4KK7A 3RZDB 3OOCA 2WKCA 5G3LF 3O13A 2D5DA 1E2ZA 5I9OA 3I90A 2Z1CA 1OXUA 4QUFA 5M5YB 1VF5C 5K5PA 1LT6D 3NQIA 2R3ZA 3QOJA 4C3IB 2BDNA 3WDNA 3VYRA 3S15B 1A2UA 2SNMA 2DNCA 1Z6HA 3AU7A 4B08A 4OL7A 3VR5A 5M9OA 4N9PA 2E2DC 4KI0A 3QG1A 3J80E 1HUMA 4J1MA 4DFAA 5IGCA 1D1KA 4J8QA 5A35A 5IGEA 2OEOA 1STYA 1DOLA 4KMUC 3I70A 4QCLA 4BA1I 3I72A 1HQRD 3HOZB 4Z9CB 1MSGA 2F0OA 1JWUD 5C3EB 3FPUB 1XTCD 2NB0A 2A6HD 5IT9L 4IFDJ 2F0HA 3OWEB 4G7OC 1H9SB 3PV0A 1EQTA 3K5OA 2FHTA 4DN4M 1CZGA 3JAML 3X3NA 5JAVA 1FNUA 1HA5A 2EDGA 5EKKA 2XWJB 3GD7A 4CJ0B 5F2DA 2EE1A 2DN8A 2L9HA 3FVQA 2YU9B 2D2CC 3A7LA 2PMZB 5EBCA 5DM73 1TS4A 1B53A 5CV8A 2B2TA 2O4XA 3S9WA 2JA7B 1M8AA 2WP8J 5JEAH 2RVLA 5FLXE 5CV9A 1ZXTA 5JPNC 1STHA 4A3BB 1L0XB 3PMFA 2JSOA 3DM1A 3HRZC 4KD3A 3TP5A 2F0EA 2Z8LA 5E4WC 5D3DA 4C1NI 3KLSA 1DM0B 3CRKC 4XQJA 1V1OA 3LX0A 1J8IA 3EVQA 4A3MB 1B50A 1SSOA 3R3OA 2MP1A 3NBHA 2KJXA 3TP7A 4DK0A 1PZJD 1TS5A 1DZ1A 1S5FD 2A6HC 1T5EA 4K8JA 3V2TA 2KQ3A 1WVLA 1QWYA 2XRQD 3A8JE 4M1UB 3NBIA 2KCCA 3KLSX 1EIGA 1FNWA 2LFNA 4FF3A 2TMPA 1LT3D 4ZUIA 2ENBA 1SDFA 1SNCA 1XX8A 5DAUA 1I4RA 4PMWA 1JB3A 1JOQA 4IUTA 1D5MC 2KVMA 1CI3M 4RCOA 5FO9B 1W6KA 1EY0A 4J6HA 1Z7TA 2BCOA 1EYDA 1SAPA 4QIWB 2F1MA 3MA2B 1IKMA 3K6OA 4LJZC 5C0XJ 1A2TA 3QO2A 5E4XA 4RGOS 1B9MA 1M4VA 4K14A 1FYCA 1ZEQX 1JE4A 1KAAA 3S16B 1Q90A 2B2VC 3MXPA 4C3HG 4PNYA 3I73A 2RSNA 3MHBA 1SE2A 3BG3A 2RSOA 1ESRA 4CJ1B 2I46A 4KN7C 2XNAC 5IGDA 4FF4A 1BUVT 1ENCA 4L6TB 1GUGA 1AZQA 3NP8A 2JEBI 2L0CA 5I2YA 3FRPB 2I07B 5C4ZA 3NXWA 1NR4A 3V05A 1D1IA 1LO5D 1MD2D 1C48A 1LTID 2IWHA 1PRTC 2MGSA 3HP3A 2Q8TA 3SVMA 1D5ZC 5LHY1 5CR3A 4MHEA 2NWGA 5CV5A 3C46A 3OIQA 4IUQA 3D6CA 1AW7A 3D3RA 5FO7B 2D62A 3EJIA 3J81E 1CK1A 2EOTA 1HPCA 2PZTA 1BBXC 4K6DA 1LTRD 2L12A 2R6GA 1O7LA 4I65A 5C4JB 4HAEA 4CKCA 1I4PA 1TR5A 3GV3A 1K8OA 4RGNA 1HRJA 3S1MB 1EYCA 1S5DD 4HCEA 3NQTA 3PUYA 3EA6A 2BE5C 1OXXK 2B39A 1JOOA 1PLFA 2F0NA 3EFXD 2AQ3B 3H6MA 2NVXB 2CHBD 1EZ8A 2E2JB 4EQOA 3A54A 1RHPA 1G2TA 1KDAA 4HMJA 3SXHA 1DCZA 4XT1B 1ENFA 1PDQA 1CQFA 1QB5D 3KLRA 2F0WA 4HN7A 1EL0A 1O7YA 1F2ZA 1BR9A 3GTGB 4K5XA 4BWGB 4OIJA 2EYLA 3QIAA 2C9OA 1OXTA 4ZQ3A 1DOKA 1R4PB 2NTTA 5K36H 2F0IA 2EYHA 3TDQA 1DOMA 3VA5A 5D14A 1GUWA 3H94A 3I4LA 2PYKA 1PRTB 5FOBB 2PO4A 5CMDA 4X3TA 3A55A 5FK9C 1BCPF 3BYYB 5J39A 1XXGA 1PTOH 1PFBA 5C5LA 1TIID 4Q0FA 1SYGA 2F0JA 2WIIB 4B9XA 1STAA 2BA1A 4JK1C 2EVBA 2QKIC 2FJ2A 1JC7A 3SEBA 5I2XA 1C8CA 4ZUJA 2WACA 4H44C 4A3KB 2ZXOA 4XYOA 4KD4A 3A7AB 4KV6A 1A15A 1IL8A 2J0TD 3PUWA 3FMCA 1FR3A 1LTGD 3DEPA 2QEJC 2EJFC 2Y0SB 3S17B 2C5CA 1U4MA 1Q1EA 1IYUA 1BXTA 3KBXA 1KDCA 2F4IA 4IN3A 4KHZA 1FD7D 2ICIA 2OT2A 3P7JA 5IGBA 5KNDA 2VB3X 1BOSA 4FF2A 3P75A 2EY1A 1WCMB 4HEDA 3GTLB 1B9NA 2G9DA 2L1BA 1ILQA 4EVOA 2EY5A 2IJ0A 3G7LA 1IHZA 3D4DA 1AZPA 1SBBB 3E0JA 3ERQA 4O42A 1MBYA 5EKIA 3K59A 3NTKA 4JBWA 1BQQT 3MXUA 1V1PA 2XIWA 1SNMA 4HTHA 1VCIA 5KIXA 1LTBD 5CV7A 1ZKOA 2K32A 1PTOF 3T56B 2FINB 2H4OA 4CHTB 1EY8A 2RDGA 3A8IE 1JICA 3W3AA 2K28A 1JQYD 5CYUA 3MXNA 5JEAJ 2K6AA 1LTAD 3GO5A 4K5VA 2F0DA 1EEID 5I6WA 1G8ZD 4QUCA 1B2TA 1UNSA 3CHBD 3ONAB 5KRUA 4Y7NB 1EIHA 1I4QA 3DMUA 1WTQA 2FMMA 4IUUA 2H1EA 4K8IA 2L5TA 1I4GA 2F0MA 1Q3LA 5KEEA 4RGTA 2F0GA 5T1IA 4A3JB 2BA0A 2B2WA 5EPLA 2KECA 4M8AA 3DWPA 2VUMB 3OMCA 1Q8IA 1H9KA 1GHKA 3SK8A 3NWTA 1TT2A 1GUTA 3FEWX 2JP1A 3M85A 3D31A 3K7AB 1EZ6A 1B4OA 1U4RA 4XXEA 4X3SA 2AUJD 1S5CD 5C0XG 1KLUD 1A3VA 1X3QA 4K6LA 3GTQB 3IFTA 1QOHA 4DA2A 1G2SA 2B2YC 1STNA 3MEHA 3VR3A 1SYFA 3N52A 3Q23A 4PV1C 1VDZA 1UAPA 3PO2B 3MFGA 1SMYC 2NBFA 3I4MB 1BO0A 3A56A 2F0VA 5KGUA 1T5XD 2HCCA 2EYFA 5DEHA 1NSNS 3VA7A 3DEOA 1ENAA 1QILA 2WB1B 5A2QE 1O7ZA 5COYA 2BDOA 4H7BA 4CJ2C 5M3MB 2K33A 2OXPA 3J7YW 3VYUA 4F87A 1QJOA 3HOXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NR2 A;  1DON A;  2NYZ D;  2FMM A;  1WTQ A;  1EL0 A;  4IUU A;  2D9U A;  5EPK A;  2H1E A;  2NZ1 D;  1MSH A;  1RTO A;  5T1G A;  1O7Y A;  1DZ1 A;  1NCV A;  2X6L A;  1WTP A;  2B2Y A;  1HUM A;  1AZQ A;  3F2U A;  1PFN A;  1G6Z A;  1BNZ A;  4ZKB B;  5D65 A;  1TVX A;  3P7J A;  1E0B A;  4OIJ A;  4ZK9 B;  1O80 A;  4MN3 A;  2KOL A;  1Q3L A;  2SDF A;  2EPB A;  1WTO A;  1WTX A;  2B2T C;  1WVL A;  4HED A;  3TZD A;  5T1I A;  1QG7 A;  1DOK A;  1DOL A;  2FFK B;  1PFM A;  4NW2 A;  5COR A;  2B2W A;  2CVR A;  5AFW A;  1VMC A;  5EPL A;  3Q6S A;  1EIG A;  1LV9 A;  2MPM A;  4R9W A;  2KEC A;  4XT3 B;  5EPJ A;  3D6W A;  1CA6 A;  3I91 A;  1NR4 A;  1DOM A;  1KNE A;  1KNA A;  1MI2 A;  2L1B A;  1ILQ A;  2M2L A;  5D14 A;  3TN2 A;  1GUW A;  1WTV A;  4U68 A;  1WD1 A;  5EJW A;  2IL8 A;  2L11 A;  1CA5 A;  1IKL A;  1MSG A;  1BF4 A;  5CMD A;  2HCI A;  4X3T A;  3UI2 A;  2X69 A;  2MGS A;  2JP1 A;  3G7L A;  1WTR A;  3HP3 A;  2Q8T A;  3SVM A;  4RWS C;  1SDF A;  2JYO A;  3FPU B;  4X3K A;  1XX8 A;  1B4O A;  4MHE A;  1AZP A;  1X32 A;  1U4R A;  1HA6 A;  1B3A A;  2B2U C;  2NWG A;  4X3S A;  1EIH A;  1EQT A;  4IUQ A;  1HHV A;  1PFB A;  2FHT A;  2K04 A;  4DN4 M;  5CBE E;  2B2V A;  3MWY W;  4R8I A;  1XYI A;  1QNK A;  1F2L A;  2VXW A;  1ICW A;  1X3Q A;  4O42 A;  4IUT A;  2EOT A;  2K05 A;  5EKI A;  1NAP A;  4IUV A;  2KVM A;  1G2S A;  2B2Y C;  4CJ0 B;  2EE1 A;  2L9H A;  2KED A;  2DY7 A;  1HUN A;  2K1B A;  4RA8 A;  1HFN A;  3N52 A;  2KUM A;  2L4N A;  1BBX C;  1HFG A;  4ZAI A;  2XIW A;  2FJ2 A;  2L12 A;  1VMP A;  2K01 A;  2HDM A;  1SAP A;  1F9P A;  1ML0 D;  1C8C A;  2MJ8 A;  1IKM A;  3IFD A;  1RTN A;  4HAE A;  1B53 A;  1BO0 A;  2B2W C;  4XDX A;  1U4P A;  1F9Q A;  1AP0 A;  3QO2 A;  2HCC A;  2B2T A;  4LMQ D;  3I90 A;  2K03 A;  5E4X A;  3R93 A;  2FIN B;  3GV3 A;  5EQ0 A;  1G91 A;  1M8A A;  4IUR A;  1HRJ A;  3FDT A;  1A15 A;  3I3C A;  2HDL A;  2RVL A;  2J7Z A;  3DEO A;  1IL8 A;  1ZXT A;  1ROD A;  5CBA E;  1JIC A;  4QUF A;  1JE4 A;  2K28 A;  1O7Z A;  1WD0 A;  1F9R A;  1PLF A;  4UAI A;  4OIK A;  3LWE A;  5JJZ A;  5COY A;  1S4Z A;  3DEP A;  2X6G A;  3DM1 A;  4ZLT F;  2R3Z A;  3KUP A;  5DNF A;  2N88 A;  5E4W C;  1F9S A;  4CJ2 C;  3GV6 A;  2BDN A;  2B2V C;  1CM9 A;  2KEE A;  1RHP A;  4RAU C;  1G2T A;  1WTW A;  2RA4 A;  4HSV A;  1X3P A;  1J8I A;  2DY8 A;  4X3U A;  1U4L A;  2B2U A;  4QUC A;  1U4M A;  2HUG A;  1EOT A;  1J9O A;  4XT1 B;  1B2T A;  1B50 A;  1MGS A;  1PDQ A;  1QE6 A;  3IL8 A;  1ILP A;  1SSO A;  2RSN A;  2MP1 A;  3KBX A;  2RSO A;  3ONA B;  4HCS A;  4IUP A;  1ESR A;  2Q8R E;  3H91 A;  4ZKC B;  1RJT A;  4CJ1 B;  3I8Z A;  3MTS A;  2N55 A; 
#chains in the Genus database with same CATH topology
 4A3K G;  4ZYS A;  2NZ1 D;  5EBD A;  3CKI B;  1B8A A;  3PO3 B;  3PUZ A;  4LFB Q;  2CWA A;  2KCT A;  3OSO A;  4GS3 A;  3R2T A;  3P1H A;  4AYB B;  1MJC A;  1Q86 C;  4MN3 A;  3M7N A;  2SDF A;  2EPB A;  3QJY A;  4RG1 A;  2R7Z B;  2UUB L;  2EYP A;  2HQL A;  4JI0 Q;  2CVR A;  3J81 c;  1ICF B;  3L0O A;  1DXM A;  1K8M A;  1PXU A;  1WTV A;  1Y8O B;  1CZW A;  1EIF A;  1JOK A;  1SYE A;  2L11 A;  4PMC A;  4LWC A;  2JXM B;  4FDB A;  2JJQ A;  4LFA L;  4YY3 L;  3GP7 A;  3NE5 B;  3ZJY C;  1HA6 A;  4JBK A;  4JYA L;  1I6H B;  4OO1 G;  3GTP B;  1HHV A;  3CW2 C;  4IQZ A;  2K04 A;  1CHQ D;  4TVA B;  4CBV A;  1XYI A;  4DV6 L;  3VR6 A;  3TSS A;  1KLG D;  5HGT A;  1WCM G;  4YWK A;  4C3J B;  1XMO L;  2Q2H A;  2J4X A;  4OXP A;  3PIP A;  1R9T B;  1HFN A;  2NN6 H;  3B6Y A;  2L4N A;  1I50 H;  5HUR A;  1OXV A;  1TS2 A;  5IYC H;  1I94 Q;  3ND9 A;  3A8K E;  4BA2 I;  2HDM A;  3TZU A;  3CU7 A;  4RKL A;  4EGV A;  5IP7 H;  2MJ8 A;  2EQS A;  4ABN A;  4DXF A;  4A3D H;  3OTO Q;  4F7X A;  1OO9 B;  3HOV B;  5ELE A;  3SE0 A;  1BCP C;  2K03 A;  1CTM A;  5ELD A;  2M00 A;  4EQ5 A;  3SK5 A;  2Z6K C;  1XPO A;  2K4K A;  3PIO 3;  2F0S A;  4MZ9 A;  3K0Y A;  4BY7 B;  1C7Y A;  4CDD C;  1KTK A;  3KUP A;  4OHJ A;  5IGG A;  2ALY B;  1TWC H;  4POF A;  1PRT D;  3M3Y H;  3V96 A;  2RA4 A;  2RCN A;  2IW3 A;  3CQZ B;  4HSV A;  3CCJ A;  2B2U A;  1EY5 A;  1E7Z A;  1EOT A;  1F2Y A;  4X65 Q;  3NK9 A;  4LUV A;  3IL8 A;  3MAQ A;  3HOY H;  1H9S A;  3S16 H;  4HCS A;  4DK3 C;  3JAM i;  4EQN A;  2IHE A;  2XN9 C;  4KY7 A;  1TWF B;  2FMC A;  3NEL A;  1B44 D;  1C9O A;  4PQX A;  4A3F B;  1G6Z A;  1RF2 D;  1E1O A;  3IKJ A;  4BBS B;  1EEF D;  4RKB A;  5JJK A;  1EQQ A;  1KAW A;  4YHH Q;  4A3I B;  3GTK B;  4L63 B;  2FFK B;  2EY2 A;  4B9W A;  3GQB A;  3AMU A;  1N8R C;  4JI8 L;  3U9S A;  3W2D A;  4YCW A;  1SJH D;  1ZYR C;  2B63 H;  4U68 A;  2IT1 A;  1NBW A;  2KHS A;  3TP6 A;  4DV4 Q;  1S5B D;  1FGU A;  3C3L A;  5M5W B;  2SOB A;  4A3C G;  4R4Q A;  1HTP A;  2B3G A;  2JYO A;  3DWA A;  1JWS D;  1XTD A;  3H0G H;  1GUS A;  2BE5 D;  2N78 A;  2AQ2 B;  2A1A A;  1A3U A;  5BN5 A;  3U4Z A;  1L2F A;  3BYT B;  4JI3 L;  4R8I A;  5FLM G;  3T1Y L;  3FP9 A;  1YI2 A;  4C3I G;  5GAH C;  1JT8 A;  2AWN A;  2EYJ A;  4A3J G;  2UUC L;  3RN5 A;  5M5X B;  3M4O B;  2CW0 C;  1CKO A;  2VUM G;  2JA8 B;  4FF1 A;  3S2D B;  4B3M Q;  5G3L D;  4JBJ A;  1PH8 A;  3BVM A;  3CCS A;  1SND A;  4YWM A;  3GTM H;  1KL9 A;  4JI7 Q;  1UUP A;  3CCR A;  4ME5 A;  3C1E A;  3J7A V;  2R93 H;  1BCP B;  4HIM A;  1CUK A;  1TU2 B;  3HEJ A;  5IYD G;  2E2H H;  4B3S Q;  1VQA A;  1G6P A;  3PF5 A;  1NMF A;  3FDT A;  3I3C A;  4WJ3 M;  4IOC A;  3X3M A;  4LF9 L;  3FPP A;  2VQF L;  4XYQ A;  4OWT B;  4QJF A;  1VF7 A;  1Y1W H;  4NXN L;  4JI1 L;  2ES2 A;  4RAU C;  1PMR A;  1JR0 D;  4L5S A;  2UXB Q;  4IPH A;  2DY8 A;  4UY8 C;  3PO2 G;  5KYI A;  1KQS A;  4TRD A;  1ILP A;  1LT4 D;  3I4M G;  3GTJ H;  4ZKC B;  1AN8 A;  2V4D A;  2Q8R E;  3H91 A;  3TQY A;  1LTT D;  2NVX H;  2N55 A;  3WOE A;  4WOR A;  1CHP D;  2NYZ D;  1YIJ A;  4GN4 B;  1PTO C;  3BDO A;  4OWX B;  2Y0S E;  1V8Q A;  2QCP X;  2G9H D;  5IWA L;  2JA5 B;  4C56 C;  4A4I A;  5CGK A;  2WB1 G;  3BZK A;  4FXD A;  1EWH A;  4PMB A;  1W3S A;  1AFP A;  1VMC A;  4UP7 A;  1LV9 A;  4R9W A;  3RLO A;  4LUO A;  2M2L A;  5M3M G;  4CKB A;  4EX5 A;  2GN5 A;  2F3I A;  5EJW A;  2HHH Q;  3K57 A;  1TKW B;  1X3G A;  4KJN A;  4FVM A;  5DM6 3;  3UI2 A;  1K28 A;  3HOX G;  1CT1 D;  1KIX A;  3HKZ B;  3PO3 G;  2NVT B;  4HSP A;  3J81 L;  3I55 A;  2NN6 I;  4AYB G;  2OF1 A;  4TSS A;  3Q0A A;  1Z9F A;  5M3F B;  2MO0 A;  3HOW B;  3TRE A;  2R7Z G;  1YVC A;  3CMA A;  2KHI A;  3AB9 A;  3SGI A;  5C44 H;  5BR8 L;  4U67 3;  1SEB D;  1VMP A;  2MHV A;  1UEA B;  2E75 C;  2HIX A;  2UUA L;  4A3G H;  3RZO B;  2MFI A;  5JEA G;  3TBI B;  5EQ0 A;  1K8G A;  1Y14 B;  3BDC A;  3PUX A;  2J7Z A;  4C2M B;  4HJ8 A;  1IL2 A;  3M4Y A;  1A62 A;  1B1Z A;  1PYB A;  2F0Q A;  1YHA A;  3IRB A;  1P8L A;  4OON A;  2NTS A;  2AWO A;  3I4N B;  4OIK A;  5JJZ A;  2CWP A;  1NUC A;  2TSS A;  4DAP A;  1L1O C;  4QY7 A;  4DK6 C;  1N36 L;  1F2M A;  1WTW A;  2E2I B;  4KKU A;  2HUG A;  1LT5 D;  1MGS A;  2QIL A;  4BY1 B;  3QR8 A;  1LTL A;  3VR2 A;  1PTO B;  4S3S A;  1VQG A;  2WAQ E;  4FNF A;  1TWH B;  3S17 H;  1K0S A;  1I6V C;  4DGZ A;  2C35 B;  1XJV A;  1D2B A;  1FGB D;  1E0B A;  4UDU C;  4HMI A;  1WTO A;  3F8T A;  2B2T C;  4BY7 G;  4K2K A;  2PW5 A;  4O0A A;  1PH5 A;  3CD6 A;  3G6J B;  1UE7 A;  1JCK B;  2UXC Q;  3I91 A;  4OO1 H;  1R4Q B;  5C4X B;  3KJP A;  3AYH B;  4LF8 L;  3CRL C;  1XWE A;  1JJC B;  1TWG B;  1N34 L;  4C1N K;  1F77 A;  3TP8 A;  1O7I A;  2X69 A;  1AE3 A;  2JA6 B;  4JPB W;  4L8J A;  4OX9 L;  1A63 A;  5I6Y A;  3OW2 A;  2CQA A;  3NTH A;  4A3F G;  3OW7 A;  4IFD G;  4DAM A;  3H3V H;  2B2V A;  4BBS G;  3K5L A;  2AHO B;  2LSS A;  5I4D A;  5KYL A;  4A3I G;  2BH8 A;  2I5M X;  2EJM A;  1NAP A;  2RDH A;  3BZD B;  3LGJ A;  4IUV A;  4DAY A;  2E5L L;  4DV0 L;  3ND8 A;  1I5F A;  4E6I A;  1RCV D;  1M1K C;  1EY7 A;  2MO1 A;  1HFG A;  3PUV A;  1BDO A;  5FO8 B;  1A8V A;  4LF5 L;  4GOP C;  1XNR L;  4JVZ A;  1PH3 A;  4DV3 L;  2NVQ H;  3NSW A;  2Q2T A;  3ULL A;  4AQY L;  3S1N H;  5BN3 A;  1TXY A;  2KCN A;  1G91 A;  4B3T L;  3E5S A;  3RNU A;  3E9I A;  5LMU Q;  4IPG A;  3CC4 A;  1ROD A;  5BN4 A;  1LYL A;  5CBA E;  1XNQ Q;  4BXX H;  1YEZ A;  4V0B A;  1L1O B;  4FO2 A;  1SNP A;  1X54 A;  4ZLT F;  5I9P A;  1U9R A;  1VQI A;  4JOI C;  4DPG A;  2IX3 A;  4A93 B;  1D8L A;  3OYY A;  2MQH A;  2ASB A;  2JA8 G;  1RD9 D;  3HOU B;  1HTL D;  1VQB A;  1QNU A;  1U4L A;  3PF4 A;  4UPA A;  5CV4 A;  4DUZ L;  2VNU D;  3I2Z A;  3ULJ A;  3CCU A;  1HNW L;  3PQI A;  4C3H H;  3RD4 A;  2M9V A;  1Y8P B;  2X6L A;  4Y52 H;  4RFB A;  4AH6 A;  1Z47 A;  2WAQ B;  1O80 A;  2KOL A;  3OPO A;  2KA7 A;  4POG A;  3T16 A;  4I7Z C;  5AFW A;  1SMY D;  3K80 C;  5EPJ A;  4XT3 B;  5M5Y H;  4LF6 L;  3D6W A;  3UDX A;  3AQQ A;  5FLM H;  3CP0 A;  4C3I H;  3TEH B;  1IW7 C;  1PYW D;  5ELF A;  3CPW A;  4A3J H;  2LKV A;  4DV1 Q;  3S15 H;  2NZO A;  1B7Y B;  4BS9 A;  2WKD A;  2F0P A;  4JC0 A;  1RDP D;  1CKN A;  4X3K A;  2SNS A;  4QMG A;  3IAY A;  4CGY B;  4LFC Q;  4XTC S;  1A0I A;  5GAD C;  3NBH B;  4LF4 Q;  4TKO B;  1LLR D;  1K3B C;  2NVY B;  2F0K A;  2ZTE A;  2JA5 G;  2VXW A;  5IT9 E;  2K5D A;  3R8B A;  4DR2 L;  2F3W A;  1SLJ A;  2K05 A;  5IYD H;  3QWN A;  1HCZ A;  3JAM E;  5J1Z A;  3VR4 A;  3PIP 3;  2QGQ A;  1S3O A;  1S5E D;  4L5R C;  1UE6 A;  4O1N A;  4CDE C;  4G7Z C;  4NB3 A;  2A6E C;  2HQE A;  4DR3 Q;  5C4H A;  1SMX A;  4LK1 C;  4NXM L;  1STB A;  4DR1 L;  2AUK A;  1UE1 A;  3IFD A;  5CV6 A;  1F9Q A;  2NUC A;  3HOZ H;  2CKZ B;  3CC2 A;  1II3 A;  3R93 A;  5C5M A;  4F8M A;  3NUC A;  1A6X A;  3HKZ G;  4LFB L;  1X65 A;  5C3E H;  3DUZ A;  1S72 A;  4RHR A;  3I4M H;  3FKI B;  1I4H A;  3CAM A;  1VQ5 A;  5M3F G;  1WD0 A;  3HOW G;  4JI0 L;  1PH7 A;  1H9R A;  4KY6 A;  1F9S A;  1RKN A;  1FVI A;  2KEE A;  1O78 A;  1QUQ B;  1VQL A;  2YU9 H;  1EY6 A;  2ZM6 Q;  2QF7 A;  2QDL A;  3D4R A;  1KXL A;  3KDF A;  1SFO B;  1TWA B;  1KC8 C;  1VQH A;  2K5H A;  5EPK A;  2R92 B;  1H95 A;  5LL6 X;  1OTC A;  1MKH A;  1HZB A;  1WTP A;  3F2U A;  2YV5 A;  4ZKB B;  1K83 B;  4OO1 I;  1EOV A;  3J7A F;  4ZK9 B;  2EZV A;  5K36 G;  4DU9 A;  3F2C A;  3S1Q B;  3I4N G;  3HOX H;  3RMH A;  2Z6B A;  3DXJ C;  1J5E Q;  5FJ8 G;  3KF8 A;  5KNB A;  1Q12 A;  3K0X A;  4NP5 A;  1V43 A;  2UU9 Q;  1PFS A;  4B3R Q;  5ELO A;  2PI2 A;  3GDE A;  3QB3 A;  1I94 L;  4A3E B;  1DYQ A;  3J80 L;  1FJG Q;  1WD1 A;  1KD1 C;  4DNT B;  1BCP D;  3NHH A;  3K5M A;  3H3V I;  2MUY A;  2O5I C;  1GXD C;  3HG9 A;  3OTO L;  1NE3 A;  2XWB B;  4RWS C;  1HNZ Q;  4A3M H;  2PQA B;  2QDB A;  1VS0 A;  5GRO A;  4IAL A;  3URY A;  3UE0 A;  4DV5 Q;  5CBE E;  2N49 A;  1WTH A;  1QVG A;  3WOF A;  1SRO A;  1ICW A;  4X66 Q;  2WIN B;  5JVH 3;  1TY0 A;  2Y0S G;  2RQX A;  1EQV A;  4IZ8 A;  4K0K Q;  2O5J C;  4KTA A;  1PZK D;  4DAV A;  5CC4 A;  4FP5 D;  4MIU A;  4ODG A;  1I6H H;  4HIK A;  1LTS D;  1Q82 C;  5C4X G;  2SEB D;  1D6E C;  1JE5 A;  4X65 L;  1N32 L;  5E7N A;  4DF7 A;  3MVV A;  2YYZ A;  2YTV A;  2PNR C;  1GJX A;  2JA6 G;  1AP0 A;  2VS1 A;  1SE3 A;  1ASZ A;  3CF5 A;  5A2Q L;  1L0Y B;  3KBG A;  4NMZ A;  4IUR A;  1Y69 U;  5JVG 3;  1IBL L;  4KLK A;  4P75 A;  2IX1 A;  4YHH L;  2K5W A;  2F0U A;  1S4Z A;  1ZYR D;  5C3X A;  3CXC A;  2BOS A;  2RDF A;  4XQQ A;  1STG A;  2LMC B;  2A69 D;  3F2D A;  3M7G A;  3HZX A;  3PCO B;  4DV4 L;  1J9O A;  5FLX L;  4BBR B;  1QE6 A;  1DD2 A;  3I8Z A;  1YNX A;  3UDG A;  1NR2 A;  2F0T A;  3MFY A;  4KY5 A;  1RTO A;  2EY6 A;  5LMN W;  1LAC A;  2VZA A;  1GOZ A;  3HGB A;  5IOC A;  2CW0 D;  1U5K A;  1K3R A;  3BVG A;  3G6E A;  1HR0 Q;  4V19 0;  3TZD A;  3C1F A;  1I50 B;  2D0O A;  4A93 G;  1CA6 A;  4JV5 Q;  2OTL A;  1EYA A;  1E24 A;  4IFD H;  1KNE A;  4B3M L;  2RBM A;  4P2C B;  3HOU G;  1C4Q A;  1KDB A;  2DJG C;  2UUB Q;  4A3D B;  1U0L A;  4ZRZ A;  4H0L C;  4A3I H;  3NEM A;  2EXZ A;  2EYM A;  2Q8I B;  2OQ0 A;  1WTR A;  1VQ6 A;  3S14 B;  4RH6 A;  3E3X A;  3LWU A;  4B3S L;  1KRT A;  3VYT A;  3W5O A;  2PCF B;  3KK7 A;  4QF4 A;  2B8G A;  2K5V A;  2RCF A;  1QNK A;  2WAQ G;  5M5W H;  3T51 B;  4L5Q A;  1TWC B;  4JYA Q;  3ZYY X;  2PZW A;  3A74 A;  3M3Y B;  1SJE D;  1X3F A;  1C0A A;  4DV6 Q;  1QCB D;  4WJ4 A;  3D4W A;  3HKZ E;  3Q24 A;  5LL6 S;  1D5X C;  2KUM A;  3HOY B;  2A69 C;  3N6R A;  2UXB L;  1RL2 A;  2K01 A;  2L15 A;  4DUY Q;  1PTO D;  4R4T A;  4ULL A;  1SYC A;  1RTN A;  1GUN A;  4R4I A;  5IOD A;  4XQN A;  3I56 A;  5LMN L;  1U4P A;  4IUN A;  5M5X H;  1EY4 A;  2EYO A;  2K5N A;  5FKA C;  1KAB A;  1W6J A;  2FXQ A;  1EWC A;  3I4O A;  2HDL A;  2AQ1 B;  4G57 A;  2R61 A;  4WRD A;  3MZ5 A;  1JOR A;  5GAG C;  1G51 A;  2OWO A;  2X6G A;  2B63 B;  5DNF A;  4R4O A;  4HR7 B;  2F0F A;  3OIP A;  2F3V A;  4DXG A;  2PQE A;  2HHH L;  3OMG A;  4X3U A;  2XRS D;  3EQL C;  1MIU A;  2PW7 A;  3J81 j;  3H0G B;  1CSQ A;  4N8X 1;  3L3O C;  1IBM L;  4X64 Q;  1E2W A;  2A73 B;  5C4J H;  2D9U A;  1ESF A;  2Z4I A;  2B2Y A;  1YHQ A;  4XIG S;  4DNI A;  2IX0 A;  3FKI G;  3RUZ A;  5EKL A;  1H9M A;  3STB D;  3S1M H;  4OGQ C;  5JOB A;  4A75 A;  4G7H C;  4NW2 A;  4DK1 A;  3Q6S A;  3GTM B;  2EJG C;  3P20 A;  1MI2 A;  3MC0 B;  2E74 C;  3TN2 A;  2JA5 H;  2R93 B;  5IP9 H;  1XMQ L;  1EFI D;  3D8G A;  2E2J H;  3DM3 A;  2E2H B;  1YNN D;  2HCI A;  2RKS A;  4R4C A;  2LS0 1;  1X3E A;  3H09 A;  1HQM C;  2XTI A;  2R92 G;  2R7F A;  1B3A A;  2F03 A;  2L55 A;  1GKH A;  5C6A A;  2K5Q A;  1JWM D;  3SR1 A;  3MWY W;  1ET6 A;  3KF6 B;  1JJG A;  3VYS A;  3Q22 A;  1Y1W B;  4YWL A;  3K5N A;  3OHX C;  4N9T A;  5C0X H;  1VQ8 A;  3GTG H;  3PGZ A;  3S2H B;  4JI3 Q;  3T4A C;  4IO9 A;  2O2L D;  2KED A;  4ID6 A;  2DY7 A;  2QW7 A;  4RA8 A;  4FXG C;  3A5U A;  3GTJ B;  5IY0 A;  4A3E G;  2XVS A;  1SNO A;  3K58 A;  4R1J A;  4JCV E;  2B2W C;  4DNR B;  4LMQ D;  2ZXR A;  1VQD A;  4H13 C;  4DR4 Q;  5C3W A;  1CQV A;  3TME A;  3DWQ A;  5D3I B;  1GM5 A;  1HNX Q;  1HH2 P;  1ET9 A;  1F9R A;  4DR6 Q;  3ERS X;  3OWF A;  2B8F A;  3STB C;  4QQB X;  4LF9 Q;  3L7Z C;  2UXC L;  2N88 A;  1UEB A;  2DNE A;  3G48 A;  2LY7 A;  3GV6 A;  1Y1V B;  1CM9 A;  4WFN 3;  1X3P A;  4CKE A;  4KKT A;  4JI1 Q;  2K50 A;  3UE1 A;  4GNX C;  4FYD A;  1SRU A;  5FJ8 H;  4KJO A;  1YNN C;  1RJT A;  3ITP A;  2A74 C;  1NMG A;  1V1P B;  3MTS A;  1DJR D;  2K52 A;  1VQJ A;  4RHS A;  4YIJ A;  1UE5 A;  1LUZ A;  3M4P A;  3H3V C;  2ZXP A;  1A3T A;  5TSS A;  2UXD Q;  4C3J G;  1BNZ A;  4A3K H;  4KKS A;  4IFD I;  4JI2 Q;  5JPM C;  3L9A X;  2IHF A;  1WTX A;  3EBE A;  3CCE A;  5IT9 c;  2PPB C;  5C44 B;  4P72 A;  1QG7 A;  1TY2 A;  3W1B A;  3C2P A;  5COR A;  3HFZ B;  3NPP A;  3KYH C;  2WV6 D;  4A3G B;  3JAM c;  1KNA A;  4WJW A;  5KNC A;  4K5W A;  3HOV G;  2GA4 B;  1Y8N B;  3QOL A;  4F88 A;  1IKL A;  4BBR G;  2Z6K A;  2PZU A;  1ASY A;  3MXN B;  1PH9 A;  3S1R B;  4GZY C;  4NDX A;  2A68 D;  1PH1 A;  4RGM A;  5ELB A;  5IGF A;  1H9J A;  4NKL A;  1X32 A;  1L0W A;  3HKS A;  4JI4 L;  4G4K A;  1N33 Q;  5LMU L;  1TS3 A;  1XNQ L;  1F2L A;  4GN5 A;  3SK6 A;  5ISR A;  1SYD A;  3UDI A;  2NN6 G;  2HIV A;  4LAA A;  5IYC G;  1IBK Q;  1HUN A;  2K1B A;  5IP7 G;  1WCM H;  1EU3 A;  4ZAI A;  4DR7 L;  4A3D G;  3GTL H;  1VQF A;  1DGS A;  2ZT9 C;  3HS0 C;  4R8N A;  3M4Q A;  4ILW A;  4IJH A;  1SE4 A;  1S40 A;  4XDX A;  2K7V A;  2JE6 I;  2V1C C;  3SK4 A;  5EGT A;  3ERO A;  3BVZ A;  3BU2 A;  4X62 Q;  3MXG A;  4I7A A;  1BBW A;  1YNJ D;  3SHL A;  1SYB A;  2ICE C;  4AIM A;  4HJ5 A;  1OXS C;  3BS1 A;  1STE A;  4UAI A;  1IYV A;  3LWE A;  3NTI A;  1I3Q B;  2BH2 A;  1IW7 D;  3T1H Q;  2A5H A;  2DUD A;  2KBN A;  3HOY G;  2E76 C;  4RMF A;  1AEX A;  1SNQ A;  2F0L A;  2VQE L;  4GNX B;  3J81 i;  1PZI D;  2Z4H A;  4DV1 L;  1N36 Q;  1PRT F;  4IUP A;  1LAB A;  2LXJ A;  2JEA I;  3U9O A;  1GUO A;  1ONL A;  3ER0 A;  4IPC A;  1EY9 A;  4A93 H;  5IIF A;  1DON A;  4A76 A;  1SXT A;  2A68 C;  1MSH A;  5JJI A;  3HOU H;  3LNN A;  5T1G A;  1PV4 A;  1NCV A;  1RIP A;  3BDL A;  1QVC A;  1PFN A;  4LF4 L;  4K2L A;  5D65 A;  1TVX A;  5E3F A;  4FXK C;  5ELC A;  4GN3 B;  1TQO A;  2E8G A;  1VQE A;  1J6Q A;  4ZCK A;  3T13 A;  5E1F A;  1Q1B A;  2A6E D;  3NWS A;  2VB2 X;  2B63 G;  1PFM A;  4RCN A;  2MPM A;  3E6Z X;  3RN2 A;  4DR3 L;  3RLF A;  1PH2 A;  2NVQ B;  2IL8 A;  5J22 A;  1CA5 A;  5IYB G;  1FNV A;  3H0G G;  1BF4 A;  4P73 A;  2I5L X;  3S1N B;  1GHJ A;  1VQN A;  4KN4 C;  4GKK Q;  4LF8 Q;  3CCQ A;  5NUC A;  5C0X I;  2F4V Q;  4Q5V A;  1HXY D;  2B2U C;  4Y7N H;  4JBM A;  4A3C H;  4KHV A;  3GTO B;  1PHJ A;  1YNJ C;  4JG2 A;  1I4X A;  2KEN A;  2PMZ E;  2ID0 A;  4UHV A;  2LXK A;  3DHQ A;  2IPK D;  1CFM A;  2A8V A;  1V1Q A;  1WFQ A;  2XSC A;  3R2I A;  1EU4 A;  2R93 G;  4TQU S;  4C3H B;  1E2V A;  2E5L Q;  4QB4 A;  3T53 B;  3SDZ A;  4EQP A;  1F9P A;  1G29 1;  1ML0 D;  4KK7 A;  2VUM H;  3RZD B;  1MJE A;  3OOC A;  2WKC A;  5G3L F;  3O13 A;  2D5D A;  1E2Z A;  5I9O A;  3I90 A;  2Z1C A;  4JW0 A;  2R7D A;  1VQP A;  4CDF C;  3K7A H;  4DV3 Q;  1HJP A;  2VL6 A;  1Y1W G;  1XPU A;  4AQY Q;  1OXU A;  4QUF A;  5M5Y B;  1VF5 C;  4B3T Q;  4PZ6 A;  5K5P A;  1AH9 A;  4DR5 L;  1LT6 D;  3NQI A;  2R3Z A;  3QOJ A;  2UU9 L;  4C3I B;  3GTQ H;  2BDN A;  3WDN A;  3AFP A;  3VYR A;  1V9P A;  3S15 B;  1A2U A;  2SNM A;  2JN4 A;  2DNC A;  1Z6H A;  2N3S A;  3UDF A;  4GKJ Q;  4NPS A;  3PO2 H;  1HNZ L;  3AU7 A;  4B08 A;  4OL7 A;  4ME3 A;  3VR5 A;  5M9O A;  4N9P A;  2E2D C;  4KI0 A;  3QG1 A;  3J80 E;  3NEN A;  1HUM A;  4J1M A;  4DFA A;  3G71 A;  1IZ6 A;  5IGC A;  1D1K A;  4X66 L;  4J8Q A;  5A35 A;  5IGE A;  2OEO A;  1BVS A;  1STY A;  2R92 H;  1DOL A;  2P5Z X;  4KMU C;  2AKW B;  2Z0S A;  3I70 A;  4QCL A;  4BA1 I;  1Y1V G;  3W1G A;  3I72 A;  1HQR D;  3HOZ B;  4Z9C B;  4GLX A;  3K8A A;  4LF6 Q;  1MSG A;  4HJA A;  5M3M H;  2F0O A;  1JWU D;  5C3E B;  2OCE A;  3FPU B;  1XTC D;  2NB0 A;  2A6H D;  5IT9 L;  5AJ3 Q;  1L1O A;  2F0H A;  3OWE B;  3KFU A;  1H9S B;  4IFD J;  3PV0 A;  4G7O C;  1EQT A;  3K5O A;  2FHT A;  4DN4 M;  1EFW A;  5ELN A;  1CZG A;  3JAM L;  3X3N A;  3PO3 H;  3Q8D A;  5JAV A;  1FNU A;  1HA5 A;  2EDG A;  5C44 G;  3I7F A;  2RHS B;  2KHJ A;  5EKK A;  2XWJ B;  3GD7 A;  4CJ0 B;  5F2D A;  2EE1 A;  2DN8 A;  2L9H A;  3FVQ A;  2YU9 B;  2R7Z H;  2D2C C;  4BY1 G;  5IE8 A;  3A7L A;  2PMZ B;  2VW9 A;  5EBC A;  5DM7 3;  1TS4 A;  1B53 A;  1E1T A;  5CV8 A;  2B2T A;  4DR1 Q;  2O4X A;  3S9W A;  2JA7 B;  1X56 A;  1M8A A;  2WP8 J;  5JEA H;  2RVL A;  5FLX E;  4QL5 A;  1X6O A;  1KRS A;  5CV9 A;  3AEV A;  1ZXT A;  3F1Z A;  2YTY A;  5JPN C;  1PA6 A;  1STH A;  4JI6 Q;  1HR0 L;  4A3B B;  1L0X B;  3GTP H;  3PMF A;  2JSO A;  3AFQ A;  3DM1 A;  3HRZ C;  4KD3 A;  3TP5 A;  2F0E A;  4JV5 L;  1N9W A;  2Z8L A;  5E4W C;  2VY3 A;  5D3D A;  4C1N I;  3KLS A;  4C3J H;  4PZ8 A;  1DM0 B;  3CRK C;  4XQJ A;  4L5T A;  1V1O A;  3LX0 A;  2PNH A;  1J8I A;  4DV2 Q;  3EVQ A;  1R9T H;  4A3M B;  1E3P A;  1B50 A;  1SSO A;  3R3O A;  2MP1 A;  3NBH A;  2KJX A;  3TP7 A;  4DK0 A;  1T9H A;  1PZJ D;  3KJO A;  1TS5 A;  1DZ1 A;  1S5F D;  2NZH A;  2A6H C;  4MTN A;  3HOV H;  1T5E A;  4H02 A;  4KHP Q;  4BBR H;  4DV7 Q;  4K8J A;  2CCZ A;  3V2T A;  2KQ3 A;  1WVL A;  1QWY A;  2XRQ D;  3A8J E;  4M1U B;  4GOP A;  3NBI A;  2KCC A;  3KLS X;  1EIG A;  3EIV A;  1FNW A;  2LFN A;  4FF3 A;  4BY7 H;  1PVO A;  1D7Q A;  2TMP A;  1LT3 D;  1VQ4 A;  4ZUI A;  4DUY L;  1CKM A;  4HJ9 A;  3CQZ H;  4LF7 Q;  3JC6 6;  2ENB A;  1SDF A;  4JI5 Q;  1SNC A;  1XX8 A;  1X55 A;  2JA9 A;  5DAU A;  1I4R A;  4PMW A;  4JOI A;  1TWF H;  1JB3 A;  1JOQ A;  4IUT A;  3S14 H;  4A3F H;  1D5M C;  1WJJ A;  2KVM A;  4BBS H;  3F2B A;  1CI3 M;  1QUQ A;  2GVB A;  4RCO A;  4APV A;  1W6K A;  3RLN A;  5FO9 B;  4JI7 L;  3GTK H;  5J3B A;  3DLL A;  1EY0 A;  2K75 A;  4J6H A;  1Z7T A;  2BCO A;  2AMC B;  1EYD A;  1SAP A;  4QIW B;  2F1M A;  3MA2 B;  1IKM A;  2MNA A;  2ZTD A;  3K6O A;  4LJZ C;  5C0X J;  1A2T A;  4X64 L;  3QO2 A;  1N32 Q;  4LFA Q;  5E4X A;  4YY3 Q;  4LW1 A;  4BXX G;  1YIT A;  4RGO S;  1VQ9 A;  1B9M A;  3TRZ A;  1M4V A;  4K14 A;  1FYC A;  3G4S A;  1ZEQ X;  3J80 i;  1JE4 A;  3CC7 A;  1KAA A;  1IBL Q;  3S16 B;  1XMO Q;  1Q90 A;  2B2V C;  5GAE C;  3MXP A;  4C3H G;  4A3L G;  3M4O H;  2PQA A;  4PNY A;  3I73 A;  2JA8 H;  2RSN A;  3MHB A;  3S2D H;  1SE2 A;  3BG3 A;  2RSO A;  1ESR A;  4CJ1 B;  2I46 A;  1K0R A;  4KN7 C;  1K73 C;  2XNA C;  5IGD A;  3A5Z B;  4FF4 A;  1BUV T;  1ENC A;  4L6T B;  1GUG A;  1AZQ A;  3NP8 A;  2JEB I;  2D0P A;  3CME A;  5IYB H;  2L0C A;  1K9M C;  5I2Y A;  1Q8K A;  4LNQ A;  3H15 A;  3EN2 A;  2OTJ A;  4ALP A;  3FRP B;  2I07 B;  1MHW C;  2G5D A;  5C4Z A;  4HID A;  5HY6 A;  3NXW A;  1HZA A;  1NR4 A;  3FHW A;  3V05 A;  1D1I A;  2ZJQ A;  3M9B A;  1LO5 D;  1MD2 D;  1WOC A;  1NTG A;  1C48 A;  1LTI D;  2IWH A;  1PRT C;  1NNX A;  2MGS A;  1SN8 A;  3HP3 A;  2Q8T A;  3SVM A;  5DLQ E;  1D5Z C;  4DR4 L;  1M90 C;  1KHI A;  5LHY 1;  1VQO A;  4UP9 A;  5CR3 A;  4MHE A;  1EYG A;  2ATW A;  2NWG A;  5CV5 A;  3C46 A;  3OIQ A;  4IUQ A;  3D6C A;  2GVA A;  3BZC A;  1HNX L;  1AW7 A;  1GO3 E;  3D3R A;  5FO7 B;  4DR6 L;  2D62 A;  2DGY A;  3J7Z C;  3EJI A;  3J81 E;  1CK1 A;  2EOT A;  3TS2 A;  1HPC A;  4LUZ A;  2PZT A;  1BBX C;  4JI8 Q;  2JQO A;  4K6D A;  1LTR D;  2L12 A;  2R6G A;  1O7L A;  3HOZ G;  4I65 A;  5C4J B;  5L37 A;  3S2H H;  4HAE A;  4CKC A;  1I4P A;  2CFM A;  2CQO A;  5C3E G;  1TR5 A;  5GQO A;  4IJL A;  1QZG A;  4PZ7 A;  3GV3 A;  1GVP A;  1K8O A;  4RGN A;  2UXD L;  5LMN Q;  1HRJ A;  3S24 A;  3S1M B;  1EYC A;  1IXR A;  1S5D D;  4HCE A;  3NQT A;  2K14 A;  4JI2 L;  3PUY A;  3PIO A;  3T1Y Q;  3EA6 A;  2BE5 C;  1OXX K;  1SR3 A;  2B39 A;  2NVT H;  1JOO A;  1PLF A;  2F0N A;  3EFX D;  2UUC Q;  2AQ3 B;  3H6M A;  2HD3 A;  2NVX B;  2CHB D;  1EZ8 A;  2E2J B;  5M3F H;  2YTX A;  3HOW H;  4P74 A;  4EQO A;  3A54 A;  1RHP A;  1G2T A;  1WYD A;  1KDA A;  4HMJ A;  3SXH A;  2QA4 A;  4DAY B;  1DCZ A;  4XT1 B;  1ENF A;  1PDQ A;  3U50 C;  1CQF A;  1QB5 D;  3KOJ A;  3KLR A;  2OQK A;  1EQR A;  3U58 A;  2F0W A;  4IPD A;  4HN7 A;  1Y1V H;  2CH4 A;  3RZO H;  1EL0 A;  2RHQ B;  3J7A 5;  2JA7 G;  1O7Y A;  1VQK A;  1F2Z A;  1N33 L;  1IBM Q;  1BR9 A;  3GTG B;  4K5X A;  4BWG B;  3CCL A;  4OIJ A;  2F52 A;  2EYL A;  3QIA A;  5HGQ A;  4YCU A;  1EIY B;  5JJL A;  2VQF Q;  1Q46 A;  4A3B G;  2B29 A;  4C2M H;  2C9O A;  1OXT A;  4ZQ3 A;  1DOK A;  1R4P B;  4PG3 A;  1IBK L;  2ZJR A;  2NTT A;  1EUJ A;  5K36 H;  2F0I A;  2EYH A;  3TDQ A;  1VQM A;  3I4N H;  4NXN Q;  1DOM A;  3VA5 A;  5D14 A;  1GUW A;  3H94 A;  3I4L A;  2JK8 A;  2PYK A;  4A3M G;  1PRT B;  4P71 A;  5FOB B;  3TS0 A;  2PO4 A;  5CMD A;  4X3T A;  2E2I H;  3A55 A;  5FK9 C;  2H5X A;  1XMQ Q;  1BCP F;  3BYY B;  4BY1 H;  3RR5 A;  5J39 A;  1XXG A;  2EIF A;  1PTO H;  2WFW A;  4X62 L;  1PFB A;  5C5L A;  1TWH H;  5IWA Q;  1FL0 A;  1NJI C;  1TII D;  4Q0F A;  3S1R H;  2I5H A;  1SYG A;  2F0J A;  1JJ2 A;  2WII B;  3T1H L;  4B9X A;  1STA A;  2BA1 A;  2PI2 E;  4HJ7 A;  1UWV A;  1Q7Y C;  1AE2 A;  4JK1 C;  1HZC A;  2EVB A;  2QKI C;  2FJ2 A;  1JC7 A;  4J15 A;  3SEB A;  5I2X A;  2Q2U A;  1C8C A;  4ZUJ A;  5C4X H;  2A19 A;  2WAC A;  4H44 C;  4A3K B;  2ZXO A;  4XYO A;  1TWG H;  1W2B A;  4KD4 A;  2JA6 H;  3A7A B;  4KV6 A;  1A15 A;  3A0J A;  3J80 c;  1IL8 A;  4IOA A;  1CKN B;  2J0T D;  3PUW A;  3FMC A;  1FR3 A;  1LTG D;  3DEP A;  4N8F A;  2QEJ C;  2EJF C;  2Y0S B;  1JMC A;  3S17 B;  3WWV A;  5BR8 Q;  4MNO A;  2C5C A;  1U4M A;  1IYU A;  1Q1E A;  1BXT A;  3U4V A;  2UUA Q;  1I3Q H;  3KBX A;  1KDC A;  2F4I A;  4GKK L;  3KF6 A;  1CSP A;  4IN3 A;  4KHZ A;  2F4V L;  3MEF A;  1FD7 D;  2ICI A;  1XPR A;  2XGT A;  2OT2 A;  3P7J A;  4UP8 A;  5IGB A;  5KND A;  2VB3 X;  1PH6 A;  1BOS A;  4FF2 A;  3P75 A;  1PYS B;  2EY1 A;  1WCM B;  4HED A;  1YJN A;  1VQC A;  3CPF A;  5EAY A;  3GTL B;  1B9N A;  2ZTC A;  2G9D A;  4QGU A;  2L1B A;  1ILQ A;  4EVO A;  2EY5 A;  3KLW A;  3L2P A;  2IJ0 A;  4OWW B;  4LFC L;  3G7L A;  1IHZ A;  3BJU A;  1YJ9 A;  2RF4 A;  3D4D A;  1AZP A;  3ULP A;  1SBB B;  1BBU A;  3KDF B;  3E0J A;  3ERQ A;  1YBY A;  3K7U C;  1SE8 A;  5FLX c;  4O42 A;  1MBY A;  4JI4 Q;  5EKI A;  1GD7 A;  3ICE A;  1IYJ B;  4DKA C;  3K59 A;  3NTK A;  4JBW A;  3GTO H;  1BQQ T;  3MXU A;  1V1P A;  2XIW A;  2HT1 A;  2I0Q A;  1SNM A;  3KF8 B;  1YZ6 A;  4HTH A;  1VCI A;  5KIX A;  1LTB D;  1N34 Q;  4GKJ L;  3VDY A;  5CV7 A;  4DR7 Q;  4X6A H;  1ZKO A;  2WB1 E;  3CCM A;  2K32 A;  1PTO F;  1EWI A;  3T56 B;  2FIN B;  4OX9 Q;  2H4O A;  4A3L H;  4CHT B;  2DJF C;  1EY8 A;  2RDG A;  3RZD H;  1Q81 C;  3A8I E;  2QEX A;  1JIC A;  3W3A A;  2K28 A;  2NVY H;  4GLV B;  1JQY D;  4DV0 Q;  4YCV A;  1B70 B;  5CYU A;  2ZM6 L;  3MXN A;  1E22 A;  1LM0 A;  5JEA J;  2K6A A;  1LTA D;  2Z9H A;  3GO5 A;  4K5V A;  2F0D A;  1B3Q A;  1EEI D;  5I6W A;  1G8Z D;  4QUC A;  1B2T A;  4LF5 Q;  1UNS A;  3CHB D;  4OEM B;  3CCV A;  3ONA B;  5KRU A;  4AYB E;  4Y7N B;  1XNR Q;  1EIH A;  1I4Q A;  1HZ9 A;  3DMU A;  1PH4 A;  1WTQ A;  2FMM A;  2VQE Q;  4IUU A;  2H1E A;  5AJ3 L;  4K8I A;  2L5T A;  1BKB A;  3E9H A;  1J5E L;  1I4G A;  2F0M A;  4B3R L;  1Q3L A;  5KEE A;  4RGT A;  2F0G A;  5T1I A;  4A3J B;  1FJG L;  2BA0 A;  2B2W A;  3FKI H;  4MTK A;  5EPL A;  5IP9 G;  1QZH A;  1VQ7 A;  2KCM A;  2IY5 B;  2KEC A;  4M8A A;  3DWP A;  2VUM B;  3OMC A;  1Q8I A;  1H9K A;  1GHK A;  1P16 A;  1WI5 A;  3SK8 A;  3NWT A;  1TT2 A;  1GUT A;  4DUZ Q;  4OEL B;  3FEW X;  1K8A C;  3PSI A;  2JP1 A;  1HNW Q;  3M85 A;  4DV5 L;  4GOP B;  3D31 A;  3K7A B;  3K81 C;  1EZ6 A;  3E0E A;  2Q2I A;  1B4O A;  2N8N A;  1U4R A;  4XXE A;  4X3S A;  2AUJ D;  1S5C D;  5H1S E;  1SFO H;  5C0X G;  1KLU D;  1TWA H;  4O2D A;  4K0K L;  1A3V A;  1X3Q A;  4K6L A;  4JI6 L;  1HR0 W;  3GTQ B;  3IFT A;  1K83 H;  1QOH A;  4DA2 A;  1G2S A;  4GNX A;  2B2Y C;  1STN A;  3MEH A;  3VR3 A;  3S1Q H;  1SYF A;  3N52 A;  3Q23 A;  1JB7 A;  4PV1 C;  4DV2 L;  1VDZ A;  1UAP A;  3PO2 B;  3MFG A;  1YHB A;  1SMY C;  2NBF A;  1YJW A;  1X9N A;  3I4M B;  1QVF A;  1BO0 A;  3A56 A;  2F0V A;  4HIO A;  4A3E H;  5KGU A;  1T5X D;  2HCC A;  2EYF A;  5DEH A;  1NY4 A;  1NSN S;  4KHP L;  3VA7 A;  4DV7 L;  3DEO A;  4GLA C;  4QIW E;  1ENA A;  1QIL A;  2EXD A;  2WB1 B;  5A2Q E;  1O7Z A;  4DR2 Q;  4A3G G;  5COY A;  2BDO A;  4H7B A;  2JA7 H;  4CJ2 C;  2ZJP A;  5M3M B;  2K33 A;  2OXP A;  3J7Y W;  4DR5 Q;  2CH4 W;  4CDC C;  3VYU A;  4NXM Q;  4A3B H;  3D0F A;  4F87 A;  1QJO A;  4LF7 L;  3HOX B;  4JI5 L; 
#chains in the Genus database with same CATH homology
 4ZYS A;  2NZ1 D;  5EBD A;  3CKI B;  3PO3 B;  3PUZ A;  3OSO A;  3R2T A;  3P1H A;  4AYB B;  4MN3 A;  3M7N A;  2SDF A;  2EPB A;  3QJY A;  2R7Z B;  2EYP A;  2CVR A;  1DXM A;  1K8M A;  1PXU A;  1WTV A;  1Y8O B;  1CZW A;  1JOK A;  1SYE A;  2L11 A;  4PMC A;  2JXM B;  3GP7 A;  3NE5 B;  1HA6 A;  1I6H B;  4OO1 G;  3GTP B;  1HHV A;  4IQZ A;  2K04 A;  1CHQ D;  4CBV A;  1XYI A;  3VR6 A;  3TSS A;  1KLG D;  5HGT A;  4C3J B;  2J4X A;  1R9T B;  1HFN A;  2NN6 H;  2L4N A;  5HUR A;  1OXV A;  1TS2 A;  4BA2 I;  3ND9 A;  3A8K E;  2HDM A;  3TZU A;  3CU7 A;  4RKL A;  4EGV A;  2MJ8 A;  4ABN A;  4DXF A;  4F7X A;  1OO9 B;  3HOV B;  5ELE A;  3SE0 A;  1BCP C;  2K03 A;  1CTM A;  5ELD A;  2M00 A;  3SK5 A;  3PIO 3;  2F0S A;  3K0Y A;  4BY7 B;  1KTK A;  3KUP A;  4OHJ A;  5IGG A;  1PRT D;  3V96 A;  2RA4 A;  3CQZ B;  2IW3 A;  4HSV A;  2B2U A;  1EY5 A;  1EOT A;  1F2Y A;  3NK9 A;  3IL8 A;  3MAQ A;  1H9S A;  4HCS A;  4EQN A;  2XN9 C;  4KY7 A;  1TWF B;  2FMC A;  1B44 D;  4PQX A;  4A3F B;  1G6Z A;  1RF2 D;  3IKJ A;  4BBS B;  1EEF D;  4RKB A;  4A3I B;  3GTK B;  4L63 B;  2FFK B;  2EY2 A;  4B9W A;  3GQB A;  3AMU A;  3U9S A;  3W2D A;  1SJH D;  1ZYR C;  4U68 A;  2IT1 A;  2KHS A;  3TP6 A;  1S5B D;  3C3L A;  5M5W B;  2SOB A;  1HTP A;  2JYO A;  3DWA A;  1JWS D;  1GUS A;  2BE5 D;  2AQ2 B;  1A3U A;  5BN5 A;  3BYT B;  4R8I A;  4C3I G;  2AWN A;  2EYJ A;  5M5X B;  3M4O B;  2CW0 C;  2JA8 B;  4FF1 A;  3S2D B;  5G3L D;  3BVM A;  1SND A;  1UUP A;  4ME5 A;  3C1E A;  3J7A V;  1BCP B;  1TU2 B;  3HEJ A;  3FDT A;  3I3C A;  3X3M A;  3FPP A;  4XYQ A;  1VF7 A;  4RAU C;  1PMR A;  1JR0 D;  2DY8 A;  5KYI A;  4TRD A;  1ILP A;  1LT4 D;  4ZKC B;  1AN8 A;  2V4D A;  2Q8R E;  3H91 A;  1LTT D;  2N55 A;  3WOE A;  4WOR A;  1CHP D;  2NYZ D;  1PTO C;  3BDO A;  1V8Q A;  2QCP X;  2G9H D;  2JA5 B;  4C56 C;  5CGK A;  4FXD A;  1EWH A;  4PMB A;  1AFP A;  1VMC A;  1LV9 A;  4R9W A;  2M2L A;  4CKB A;  5EJW A;  3K57 A;  1TKW B;  4KJN A;  4FVM A;  5DM6 3;  3UI2 A;  1CT1 D;  3HKZ B;  2NVT B;  4HSP A;  3J81 L;  2NN6 I;  2OF1 A;  4TSS A;  3Q0A A;  5M3F B;  3HOW B;  3AB9 A;  4U67 3;  1SEB D;  1VMP A;  2MHV A;  1UEA B;  2E75 C;  3RZO B;  5JEA G;  3TBI B;  5EQ0 A;  3BDC A;  3PUX A;  2J7Z A;  4C2M B;  3M4Y A;  1B1Z A;  2F0Q A;  2NTS A;  2AWO A;  3I4N B;  4OIK A;  5JJZ A;  1NUC A;  2TSS A;  4DAP A;  1F2M A;  1WTW A;  2E2I B;  4KKU A;  2HUG A;  1LT5 D;  1MGS A;  2QIL A;  4BY1 B;  3VR2 A;  1PTO B;  4S3S A;  4FNF A;  1TWH B;  1I6V C;  4DGZ A;  1D2B A;  1FGB D;  1E0B A;  4UDU C;  4HMI A;  1WTO A;  2B2T C;  4K2K A;  2PW5 A;  3G6J B;  1JCK B;  3I91 A;  4OO1 H;  1R4Q B;  5C4X B;  3CRL C;  1XWE A;  1TWG B;  4C1N K;  1F77 A;  3TP8 A;  2X69 A;  2JA6 B;  4L8J A;  5I6Y A;  2CQA A;  3NTH A;  3OW7 A;  4IFD G;  2B2V A;  3K5L A;  5I4D A;  5KYL A;  2EJM A;  1NAP A;  2RDH A;  3BZD B;  4IUV A;  4DAY A;  3ND8 A;  4E6I A;  1RCV D;  1EY7 A;  1HFG A;  3PUV A;  1BDO A;  5FO8 B;  3NSW A;  5BN3 A;  1G91 A;  2KCN A;  3E5S A;  1ROD A;  5BN4 A;  5CBA E;  4V0B A;  4FO2 A;  1SNP A;  4ZLT F;  5I9P A;  1U9R A;  2IX3 A;  4A93 B;  1RD9 D;  3HOU B;  1HTL D;  1QNU A;  1U4L A;  5CV4 A;  2VNU D;  3RD4 A;  2M9V A;  1Y8P B;  2X6L A;  4RFB A;  1Z47 A;  2WAQ B;  1O80 A;  2KOL A;  3OPO A;  2KA7 A;  3T16 A;  4I7Z C;  5AFW A;  1SMY D;  5EPJ A;  4XT3 B;  3D6W A;  1IW7 C;  1PYW D;  5ELF A;  2LKV A;  4BS9 A;  2WKD A;  2F0P A;  1RDP D;  4X3K A;  2SNS A;  4QMG A;  3IAY A;  4CGY B;  4XTC S;  4TKO B;  1LLR D;  2NVY B;  2F0K A;  2VXW A;  5IT9 E;  2K5D A;  3R8B A;  2F3W A;  2K05 A;  3QWN A;  1HCZ A;  3JAM E;  5J1Z A;  3VR4 A;  3PIP 3;  1S5E D;  4O1N A;  4G7Z C;  2A6E C;  2HQE A;  5C4H A;  4LK1 C;  1STB A;  2AUK A;  3IFD A;  5CV6 A;  1F9Q A;  2NUC A;  1II3 A;  3R93 A;  5C5M A;  4F8M A;  3NUC A;  1A6X A;  3DUZ A;  4RHR A;  3FKI B;  1I4H A;  1WD0 A;  1H9R A;  4KY6 A;  1F9S A;  1RKN A;  2KEE A;  1O78 A;  1EY6 A;  2QF7 A;  3D4R A;  1SFO B;  1TWA B;  5EPK A;  2R92 B;  5LL6 X;  1WTP A;  3F2U A;  4ZKB B;  1K83 B;  4OO1 I;  3J7A F;  4ZK9 B;  2EZV A;  5K36 G;  4DU9 A;  3S1Q B;  3RMH A;  3DXJ C;  3KF8 A;  5KNB A;  1Q12 A;  4NP5 A;  1V43 A;  3QB3 A;  4A3E B;  1DYQ A;  3J80 L;  1WD1 A;  4DNT B;  1BCP D;  3NHH A;  3K5M A;  2MUY A;  2O5I C;  1GXD C;  3HG9 A;  2XWB B;  4RWS C;  2QDB A;  4IAL A;  3URY A;  5CBE E;  3WOF A;  1ICW A;  2WIN B;  5JVH 3;  1TY0 A;  2RQX A;  1EQV A;  4IZ8 A;  2O5J C;  4KTA A;  1PZK D;  4DAV A;  5CC4 A;  4FP5 D;  4MIU A;  4ODG A;  1LTS D;  2SEB D;  1D6E C;  4DF7 A;  3MVV A;  2YYZ A;  2PNR C;  1GJX A;  1AP0 A;  1SE3 A;  5A2Q L;  1L0Y B;  3KBG A;  4NMZ A;  4IUR A;  1Y69 U;  5JVG 3;  2IX1 A;  2K5W A;  2F0U A;  1S4Z A;  1ZYR D;  5C3X A;  2BOS A;  2RDF A;  4XQQ A;  1STG A;  2LMC B;  2A69 D;  3M7G A;  3HZX A;  1J9O A;  5FLX L;  4BBR B;  1QE6 A;  1DD2 A;  3I8Z A;  1NR2 A;  2F0T A;  3MFY A;  4KY5 A;  1RTO A;  2EY6 A;  1LAC A;  1GOZ A;  3HGB A;  5IOC A;  2CW0 D;  3BVG A;  4V19 0;  3TZD A;  3C1F A;  1I50 B;  1CA6 A;  1EYA A;  4IFD H;  1KNE A;  2RBM A;  4P2C B;  1C4Q A;  1KDB A;  4A3D B;  4ZRZ A;  4H0L C;  2EXZ A;  2EYM A;  2Q8I B;  1WTR A;  3S14 B;  4RH6 A;  3LWU A;  3VYT A;  2PCF B;  3KK7 A;  4QF4 A;  2B8G A;  1QNK A;  3T51 B;  1TWC B;  3ZYY X;  2PZW A;  3M3Y B;  1SJE D;  1QCB D;  3D4W A;  3Q24 A;  5LL6 S;  1D5X C;  2KUM A;  3HOY B;  2A69 C;  3N6R A;  2K01 A;  1PTO D;  4ULL A;  1SYC A;  1RTN A;  1GUN A;  5IOD A;  4XQN A;  1U4P A;  4IUN A;  1EY4 A;  2EYO A;  5FKA C;  1KAB A;  1W6J A;  1EWC A;  2HDL A;  2AQ1 B;  4G57 A;  2R61 A;  4WRD A;  3MZ5 A;  1JOR A;  2X6G A;  2B63 B;  5DNF A;  4HR7 B;  2F0F A;  3OIP A;  2F3V A;  4DXG A;  2PQE A;  3OMG A;  4X3U A;  2XRS D;  3EQL C;  2PW7 A;  3H0G B;  3L3O C;  1E2W A;  2A73 B;  2D9U A;  1ESF A;  2Z4I A;  2B2Y A;  4XIG S;  2IX0 A;  3RUZ A;  5EKL A;  1H9M A;  4OGQ C;  5JOB A;  4G7H C;  4NW2 A;  4DK1 A;  3Q6S A;  3GTM B;  2EJG C;  3P20 A;  1MI2 A;  3MC0 B;  2E74 C;  3TN2 A;  2R93 B;  1EFI D;  3D8G A;  2E2H B;  1YNN D;  2HCI A;  2RKS A;  2LS0 1;  3H09 A;  1HQM C;  1B3A A;  2F03 A;  2L55 A;  5C6A A;  2K5Q A;  1JWM D;  3SR1 A;  3MWY W;  1ET6 A;  3VYS A;  3Q22 A;  1Y1W B;  3K5N A;  3OHX C;  4N9T A;  5C0X H;  3S2H B;  3T4A C;  2O2L D;  2KED A;  4ID6 A;  2DY7 A;  4RA8 A;  4FXG C;  3GTJ B;  2XVS A;  1SNO A;  3K58 A;  2B2W C;  4DNR B;  4LMQ D;  2ZXR A;  4H13 C;  5C3W A;  1CQV A;  3TME A;  3DWQ A;  5D3I B;  1ET9 A;  1F9R A;  3OWF A;  2B8F A;  3L7Z C;  2N88 A;  2DNE A;  2LY7 A;  3GV6 A;  1Y1V B;  1CM9 A;  4WFN 3;  1X3P A;  4CKE A;  4KKT A;  4FYD A;  4KJO A;  1YNN C;  1RJT A;  3ITP A;  2A74 C;  1V1P B;  3MTS A;  1DJR D;  4RHS A;  4YIJ A;  3H3V C;  2ZXP A;  1A3T A;  5TSS A;  4C3J G;  1BNZ A;  4KKS A;  4IFD I;  5JPM C;  3L9A X;  1WTX A;  2PPB C;  5C44 B;  1QG7 A;  1TY2 A;  3C2P A;  5COR A;  3NPP A;  2WV6 D;  4A3G B;  1KNA A;  4WJW A;  5KNC A;  4K5W A;  2GA4 B;  1Y8N B;  3QOL A;  4F88 A;  1IKL A;  2PZU A;  3S1R B;  4GZY C;  4NDX A;  2A68 D;  4RGM A;  5ELB A;  5IGF A;  1H9J A;  4NKL A;  1X32 A;  4G4K A;  1TS3 A;  1F2L A;  3SK6 A;  5ISR A;  1SYD A;  2NN6 G;  4LAA A;  1HUN A;  2K1B A;  1EU3 A;  4ZAI A;  2ZT9 C;  3HS0 C;  4R8N A;  4ILW A;  1SE4 A;  4XDX A;  2K7V A;  2JE6 I;  3SK4 A;  5EGT A;  3ERO A;  3BVZ A;  3MXG A;  1YNJ D;  3SHL A;  1SYB A;  2ICE C;  1OXS C;  3BS1 A;  1STE A;  4UAI A;  1IYV A;  3LWE A;  3NTI A;  1I3Q B;  1IW7 D;  2A5H A;  2E76 C;  1AEX A;  1SNQ A;  2F0L A;  1PZI D;  2Z4H A;  1PRT F;  4IUP A;  1LAB A;  2JEA I;  3U9O A;  1GUO A;  1ONL A;  1EY9 A;  5IIF A;  1DON A;  1SXT A;  2A68 C;  1MSH A;  3LNN A;  5T1G A;  1NCV A;  3BDL A;  1PFN A;  4K2L A;  5D65 A;  1TVX A;  5E3F A;  4FXK C;  5ELC A;  1TQO A;  3T13 A;  5E1F A;  1Q1B A;  2A6E D;  3NWS A;  2VB2 X;  1PFM A;  4RCN A;  2MPM A;  3E6Z X;  3RLF A;  2NVQ B;  2IL8 A;  5J22 A;  1CA5 A;  1FNV A;  1BF4 A;  3S1N B;  1GHJ A;  4KN4 C;  5NUC A;  5C0X I;  4Q5V A;  1HXY D;  2B2U C;  4KHV A;  3GTO B;  1YNJ C;  1I4X A;  2ID0 A;  3DHQ A;  2IPK D;  1CFM A;  2XSC A;  3R2I A;  1EU4 A;  4TQU S;  4C3H B;  1E2V A;  4QB4 A;  3T53 B;  3SDZ A;  4EQP A;  1F9P A;  1G29 1;  1ML0 D;  4KK7 A;  3RZD B;  3OOC A;  2WKC A;  5G3L F;  3O13 A;  2D5D A;  1E2Z A;  5I9O A;  3I90 A;  2Z1C A;  1OXU A;  4QUF A;  5M5Y B;  1VF5 C;  5K5P A;  1LT6 D;  3NQI A;  2R3Z A;  3QOJ A;  4C3I B;  2BDN A;  3WDN A;  3VYR A;  3S15 B;  1A2U A;  2SNM A;  2DNC A;  1Z6H A;  3AU7 A;  4B08 A;  4OL7 A;  3VR5 A;  5M9O A;  4N9P A;  2E2D C;  4KI0 A;  3QG1 A;  3J80 E;  1HUM A;  4J1M A;  4DFA A;  5IGC A;  1D1K A;  4J8Q A;  5A35 A;  5IGE A;  2OEO A;  1STY A;  1DOL A;  4KMU C;  3I70 A;  4QCL A;  4BA1 I;  3I72 A;  1HQR D;  3HOZ B;  4Z9C B;  1MSG A;  2F0O A;  1JWU D;  5C3E B;  3FPU B;  1XTC D;  2NB0 A;  2A6H D;  5IT9 L;  4IFD J;  2F0H A;  3OWE B;  4G7O C;  1H9S B;  3PV0 A;  1EQT A;  3K5O A;  2FHT A;  4DN4 M;  1CZG A;  3JAM L;  3X3N A;  5JAV A;  1FNU A;  1HA5 A;  2EDG A;  5EKK A;  2XWJ B;  3GD7 A;  4CJ0 B;  5F2D A;  2EE1 A;  2DN8 A;  2L9H A;  3FVQ A;  2YU9 B;  2D2C C;  3A7L A;  2PMZ B;  5EBC A;  5DM7 3;  1TS4 A;  1B53 A;  5CV8 A;  2B2T A;  2O4X A;  3S9W A;  2JA7 B;  1M8A A;  2WP8 J;  5JEA H;  2RVL A;  5FLX E;  5CV9 A;  1ZXT A;  5JPN C;  1STH A;  4A3B B;  1L0X B;  3PMF A;  2JSO A;  3DM1 A;  3HRZ C;  4KD3 A;  3TP5 A;  2F0E A;  2Z8L A;  5E4W C;  5D3D A;  4C1N I;  3KLS A;  1DM0 B;  3CRK C;  4XQJ A;  1V1O A;  3LX0 A;  1J8I A;  3EVQ A;  4A3M B;  1B50 A;  1SSO A;  3R3O A;  2MP1 A;  3NBH A;  2KJX A;  3TP7 A;  4DK0 A;  1PZJ D;  1TS5 A;  1DZ1 A;  1S5F D;  2A6H C;  1T5E A;  4K8J A;  3V2T A;  2KQ3 A;  1WVL A;  1QWY A;  2XRQ D;  3A8J E;  4M1U B;  3NBI A;  2KCC A;  3KLS X;  1EIG A;  1FNW A;  2LFN A;  4FF3 A;  2TMP A;  1LT3 D;  4ZUI A;  2ENB A;  1SDF A;  1SNC A;  1XX8 A;  5DAU A;  1I4R A;  4PMW A;  1JB3 A;  1JOQ A;  4IUT A;  1D5M C;  2KVM A;  1CI3 M;  4RCO A;  5FO9 B;  1W6K A;  1EY0 A;  4J6H A;  1Z7T A;  2BCO A;  1EYD A;  1SAP A;  4QIW B;  2F1M A;  3MA2 B;  1IKM A;  3K6O A;  4LJZ C;  5C0X J;  1A2T A;  3QO2 A;  5E4X A;  4RGO S;  1B9M A;  1M4V A;  4K14 A;  1FYC A;  1ZEQ X;  1JE4 A;  1KAA A;  3S16 B;  1Q90 A;  2B2V C;  3MXP A;  4C3H G;  4PNY A;  3I73 A;  2RSN A;  3MHB A;  1SE2 A;  3BG3 A;  2RSO A;  1ESR A;  4CJ1 B;  2I46 A;  4KN7 C;  2XNA C;  5IGD A;  4FF4 A;  1BUV T;  1ENC A;  4L6T B;  1GUG A;  1AZQ A;  3NP8 A;  2JEB I;  2L0C A;  5I2Y A;  3FRP B;  2I07 B;  5C4Z A;  3NXW A;  1NR4 A;  3V05 A;  1D1I A;  1LO5 D;  1MD2 D;  1C48 A;  1LTI D;  2IWH A;  1PRT C;  2MGS A;  3HP3 A;  2Q8T A;  3SVM A;  1D5Z C;  5LHY 1;  5CR3 A;  4MHE A;  2NWG A;  5CV5 A;  3C46 A;  3OIQ A;  4IUQ A;  3D6C A;  1AW7 A;  3D3R A;  5FO7 B;  2D62 A;  3EJI A;  3J81 E;  1CK1 A;  2EOT A;  1HPC A;  2PZT A;  1BBX C;  4K6D A;  1LTR D;  2L12 A;  2R6G A;  1O7L A;  4I65 A;  5C4J B;  4HAE A;  4CKC A;  1I4P A;  1TR5 A;  3GV3 A;  1K8O A;  4RGN A;  1HRJ A;  3S1M B;  1EYC A;  1S5D D;  4HCE A;  3NQT A;  3PUY A;  3EA6 A;  2BE5 C;  1OXX K;  2B39 A;  1JOO A;  1PLF A;  2F0N A;  3EFX D;  2AQ3 B;  3H6M A;  2NVX B;  2CHB D;  1EZ8 A;  2E2J B;  4EQO A;  3A54 A;  1RHP A;  1G2T A;  1KDA A;  4HMJ A;  3SXH A;  1DCZ A;  4XT1 B;  1ENF A;  1PDQ A;  1CQF A;  1QB5 D;  3KLR A;  2F0W A;  4HN7 A;  1EL0 A;  1O7Y A;  1F2Z A;  1BR9 A;  3GTG B;  4K5X A;  4BWG B;  4OIJ A;  2EYL A;  3QIA A;  2C9O A;  1OXT A;  4ZQ3 A;  1DOK A;  1R4P B;  2NTT A;  5K36 H;  2F0I A;  2EYH A;  3TDQ A;  1DOM A;  3VA5 A;  5D14 A;  1GUW A;  3H94 A;  3I4L A;  2PYK A;  1PRT B;  5FOB B;  2PO4 A;  5CMD A;  4X3T A;  3A55 A;  5FK9 C;  1BCP F;  3BYY B;  5J39 A;  1XXG A;  1PTO H;  1PFB A;  5C5L A;  1TII D;  4Q0F A;  1SYG A;  2F0J A;  2WII B;  4B9X A;  1STA A;  2BA1 A;  4JK1 C;  2EVB A;  2QKI C;  2FJ2 A;  1JC7 A;  3SEB A;  5I2X A;  1C8C A;  4ZUJ A;  2WAC A;  4H44 C;  4A3K B;  2ZXO A;  4XYO A;  4KD4 A;  3A7A B;  4KV6 A;  1A15 A;  1IL8 A;  2J0T D;  3PUW A;  3FMC A;  1FR3 A;  1LTG D;  3DEP A;  2QEJ C;  2EJF C;  2Y0S B;  3S17 B;  2C5C A;  1U4M A;  1Q1E A;  1IYU A;  1BXT A;  3KBX A;  1KDC A;  2F4I A;  4IN3 A;  4KHZ A;  1FD7 D;  2ICI A;  2OT2 A;  3P7J A;  5IGB A;  5KND A;  2VB3 X;  1BOS A;  4FF2 A;  3P75 A;  2EY1 A;  1WCM B;  4HED A;  3GTL B;  1B9N A;  2G9D A;  2L1B A;  1ILQ A;  4EVO A;  2EY5 A;  2IJ0 A;  3G7L A;  1IHZ A;  3D4D A;  1AZP A;  1SBB B;  3E0J A;  3ERQ A;  4O42 A;  1MBY A;  5EKI A;  3K59 A;  3NTK A;  4JBW A;  1BQQ T;  3MXU A;  1V1P A;  2XIW A;  1SNM A;  4HTH A;  1VCI A;  5KIX A;  1LTB D;  5CV7 A;  1ZKO A;  2K32 A;  1PTO F;  3T56 B;  2FIN B;  2H4O A;  4CHT B;  1EY8 A;  2RDG A;  3A8I E;  1JIC A;  3W3A A;  2K28 A;  1JQY D;  5CYU A;  3MXN A;  5JEA J;  2K6A A;  1LTA D;  3GO5 A;  4K5V A;  2F0D A;  1EEI D;  5I6W A;  1G8Z D;  4QUC A;  1B2T A;  1UNS A;  3CHB D;  3ONA B;  5KRU A;  4Y7N B;  1EIH A;  1I4Q A;  3DMU A;  1WTQ A;  2FMM A;  4IUU A;  2H1E A;  4K8I A;  2L5T A;  1I4G A;  2F0M A;  1Q3L A;  5KEE A;  4RGT A;  2F0G A;  5T1I A;  4A3J B;  2BA0 A;  2B2W A;  5EPL A;  2KEC A;  4M8A A;  3DWP A;  2VUM B;  3OMC A;  1Q8I A;  1H9K A;  1GHK A;  3SK8 A;  3NWT A;  1TT2 A;  1GUT A;  3FEW X;  2JP1 A;  3M85 A;  3D31 A;  3K7A B;  1EZ6 A;  1B4O A;  1U4R A;  4XXE A;  4X3S A;  2AUJ D;  1S5C D;  5C0X G;  1KLU D;  1A3V A;  1X3Q A;  4K6L A;  3GTQ B;  3IFT A;  1QOH A;  4DA2 A;  1G2S A;  2B2Y C;  1STN A;  3MEH A;  3VR3 A;  1SYF A;  3N52 A;  3Q23 A;  4PV1 C;  1VDZ A;  1UAP A;  3PO2 B;  3MFG A;  1SMY C;  2NBF A;  3I4M B;  1BO0 A;  3A56 A;  2F0V A;  5KGU A;  1T5X D;  2HCC A;  2EYF A;  5DEH A;  1NSN S;  3VA7 A;  3DEO A;  1ENA A;  1QIL A;  2WB1 B;  5A2Q E;  1O7Z A;  5COY A;  2BDO A;  4H7B A;  4CJ2 C;  5M3M B;  2K33 A;  2OXP A;  3J7Y W;  3VYU A;  4F87 A;  1QJO A;  3HOX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...