1PFMA

Pf4-m2 chimeric mutant with the first 10 n-terminal residues of r-pf4 replaced by the n-terminal residues of the il8 sequence. models 1-15 of a 27-model set.
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
68
structure length
68
Chain Sequence
b'MSAKELRCQCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PF4-M2 CHIMERA
molecule tags Cytokine
source organism Homo sapiens
publication title NMR solution structure of the 32-kDa platelet factor 4 ELR-motif N-terminal chimera: a symmetric tetramer.
pubmed doi rcsb
total genus 9
structure length 68
sequence length 68
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1995-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1pfmA00
4RAUC 5COYA 1F2LA 1HFGA 3SVMA 1U4MA 2FFKB 2MJ8A 1U4LA 2KOLA 3I3CA 1NAPA 2HCCA 1O80A 3KUPA 4HSVA 1PFBA 2KECA 2R3ZA 4LMQD 4U68A 1MGSA 2RSOA 1B3AA 1U4PA 1DOLA 2XIWA 2RVLA 1RJTA 1J8IA 3G7LA 2Q8TA 5AFWA 1WD0A 1X3QA 1BO0A 2L1BA 1PDQA 2MGSA 3QO2A 1AZQA 2X6GA 4NW2A 3Q6SA 2B2VC 1WTWA 4CJ1B 1A15A 4UAIA 2N55A 1F9RA 2NYZD 1O7YA 1HUNA 2K28A 1HRJA 4HCSA 2HDLA 4IUVA 1EIHA 4IUTA 2B2TC 1BNZA 2L4NA 4X3TA 4O42A 3TN2A 3F2UA 2B2YC 1M8AA 1DONA 1G6ZA 1F9QA 1QNKA 1RODA 1RHPA 5CORA 1AZPA 2B2VA 1CM9A 3GV3A 4ZAIA 4XDXA 1C8CA 1SDFA 2VXWA 2FHTA 1HUMA 1ESRA 1WVLA 1B50A 2X6LA 4HEDA 2B2WC 1IKMA 1G2TA 4CJ2C 1NR2A 1RTNA 3N52A 5E4WC 2JP1A 1IKLA 5EKIA 5T1GA 3ONAB 3UI2A 3D6WA 4ZK9B 1HA6A 2KUMA 5CMDA 4ZLTF 4QUFA 4IUQA 1XYIA 2FMMA 1B4OA 5DNFA 1GUWA 2FJ2A 1WTXA 2KEEA 2CVRA 1NCVA 3H91A 1ILQA 5EPJA 2M2LA 2RA4A 1DZ1A 1O7ZA 2L11A 4MN3A 1WTOA 2J7ZA 3DEPA 2NWGA 1SAPA 2BDNA 2H1EA 1CA5A 1E0BA 3FDTA 1B53A 4X3SA 3R93A 4RA8A 4DN4M 5CBAE 1RTOA 1EQTA 4XT1B 1VMPA 1U4RA 1DOMA 2B2TA 1XX8A 2SDFA 3HP3A 3IFDA 4R9WA 2L12A 4ZKCB 1WD1A 1HHVA 2EE1A 1EIGA 2K01A 1ZXTA 1B2TA 1DOKA 2HDMA 2N88A 1PLFA 3I8ZA 3MTSA 3MWYW 1X3PA 1VMCA 1G2SA 1G91A 5E4XA 4IUPA 2B2WA 1QG7A 1KNAA 2K1BA 3I90A 4MHEA 1WTQA 1SSOA 1WTRA 4HAEA 3I91A 4IUUA 1PFNA 1WTPA 4QUCA 2NZ1D 2EPBA 4X3KA 5EQ0A 5EPKA 4OIKA 2X69A 1J9OA 3DM1A 2IL8A 1ILPA 4RWSC 1WTVA 5EPLA 2D9UA 2FINB 1PFMA 2L9HA 1HFNA 2EOTA 2JYOA 2MP1A 3KBXA 2B2UC 4R8IA 3GV6A 1QE6A 1MSGA 5EJWA 1IL8A 1MI2A 1Q3LA 3IL8A 2K03A 2KEDA 1AP0A 2DY7A 1ICWA 3FPUB 3LWEA 1F9PA 2B2UA 1X32A 5D14A 3DEOA 5JJZA 1KNEA 1BBXC 4OIJA 4IURA 3P7JA 4CJ0B 5D65A 1EOTA 1ML0D 2K04A 1CA6A 1EL0A 3TZDA 2K05A 4ZKBB 5CBEE 1F9SA 2KVMA 1BF4A 2MPMA 4X3UA 2B2YA 2DY8A 1S4ZA 2HCIA 2Q8RE 5T1IA 1LV9A 2RSNA 1NR4A 1JE4A 1JICA 2HUGA 1TVXA 4XT3B 1MSHA
chains in the Genus database with same CATH superfamily
5HGTA 4GLVB 5LL6X 2Q2IA 1PFBA 3DUZA 2E2IH 3BDOA 2F0FA 1JC7A 1O7LA 4IALA 3V05A 1CKNB 2O2LD 5C4JB 2D0OA 3HOYB 1DD2A 3U9SA 2JE6I 1DCZA 1TXYA 4KKUA 2NN6G 2QW7A 2X6GA 4NW2A 5K36H 2LSSA 3MFYA 1HRJA 4UDUC 3TREA 1FVIA 2A68D 4YY3Q 1K0RA 4X3TA 1ENFA 1N33L 1RODA 2K5HA 1F77A 1SDFA 4JI8L 4DV7Q 4TVAB 4RKLA 1K9MC 1PVOA 4K2LA 2I0QA 3Q8DA 4OWXB 2FXQA 2JA5B 2NVQH 4ZK9B 5D3IB 3J80E 1EU3A 4A3EB 3HOWH 3S15B 3QOLA 1NCVA 2ALYB 2VY3A 3H91A 2QCPX 3T1YQ 1D1IA 2FMCA 3NBHB 4NXML 4GNXA 5IGCA 5IT9E 1Z9FA 4ME5A 2QDLA 1PZJD 5J3BA 3R93A 1TQOA 2CH4W 3S1NH 1SFOB 3H3VI 1BUVT 1E2ZA 4B08A 1JE5A 4IFDI 1EIGA 2F52A 1QUQB 3J7ZC 1UUPA 4FF3A 1X3PA 2XWBB 4R4TA 3CCRA 4DV4Q 3V96A 4BBRH 5FO8B 2E2HH 2BH8A 4N9PA 2NZ1D 4R1JA 1SNMA 2UUAQ 4X3KA 1MHWC 1D2BA 2RHSB 2LS01 3I4MB 2JA7G 1PH8A 4LFCQ 2JYOA 4UP7A 2DJFC 3PO2B 1D7QA 1EUJA 3K58A 1IHZA 2JA5H 3CCUA 1E7ZA 1BBUA 3T13A 2ZT9C 5IP7H 2CKZB 1JB7A 2BOSA 1A0IA 1EY6A 2K5DA 5EKKA 2F3WA 1GJXA 4DR5Q 5JPNC 4XYOA 5GAGC 4AH6A 2NVXH 4PMWA 1F9SA 3L9AX 2NN6I 4DUZL 1T5XD 3NP8A 1OXVA 4CDCC 4DR2L 3GTOB 3T1HL 2ICEC 1GM5A 5TSSA 2F0PA 1XTDA 1TVXA 4XT3B 1KHIA 3IFTA 1K83H 1EYCA 4B3MQ 2MO1A 3GDEA 2AQ2B 1G8ZD 3CRKC 4KKTA 2VUMH 4C1NK 2ZTEA 1RJTA 4ID6A 1YNND 1B9MA 3H0GG 3GD7A 3MZ5A 3A55A 1BO0A 2F3VA 2JEBI 3A74A 1NNXA 4CJ1B 2A6HC 2ZXPA 4LF5L 1VS0A 4MTKA 1CQVA 1UE7A 1EY8A 3EFXD 3ICEA 1BNZA 2L4NA 4O42A 1Q86C 3S2HH 5JAVA 1IBMQ 3S24A 4LF7L 1F9QA 3H0GH 4GLXA 1G6ZA 1AZPA 1B1ZA 2RCFA 1C8CA 1R9TH 4JK1C 2VXWA 4F87A 3CP0A 4AQYL 3G6JB 1B50A 1G2TA 5T1GA 2JP1A 4IN3A 3AB9A 3A54A 1JORA 2FMMA 4WJWA 1D1KA 3NHHA 4DA2A 1RKNA 3DWPA 2AQ1B 1HCZA 3RZDB 4MN3A 3DEPA 2NVYB 4DV2Q 1HNWL 4IPCA 4EGVA 4QF4A 1GUNA 1MBYA 1TY0A 2B2TA 1W6JA 1Y14B 2HHHL 4A3EH 4JOIC 3CKIB 2PNRC 2E8GA 3ULJA 1EZ6A 4AIMA 1VMCA 4RG1A 1WCMB 4KLKA 3HOXH 3I4LA 2WFWA 5KNDA 1HNWQ 3I91A 5IYCG 4IFDJ 4CBVA 1AH9A 2F03A 3AQQA 2L5TA 2X69A 2SNSA 2F0TA 3OTOQ 3N6RA 4BBRG 4OWWB 4GS3A 2BDOA 5IODA 4RHRA 1PFSA 1Q3LA 1I94L 3IRBA 1SJED 4JV5Q 4A3CG 1XWEA 1SNDA 2EZVA 2BA0A 2VB2X 1EYGA 3DEOA 2XTIA 4OIJA 4RGMA 1VQ8A 5A2QE 3I4OA 4HCEA 1XNQL 3HOZG 3FEWX 2DY8A 4BBSH 1DM0B 2EY2A 4YWMA 1JE4A 4A3LG 2Q8IB 1JOQA 1B8AA 4ABNA 4C56C 3TQYA 4A4IA 2UXBL 3D6CA 2EYLA 3KUPA 3PO3B 3PUVA 3CCMA 2G9DA 3NELA 1Z7TA 4KJNA 2MFIA 3T4AC 4A3DH 2M00A 3HOVH 2DUDA 3HKZG 5IYDG 1EFWA 5KNBA 2B2VC 4A3GH 3RLOA 2N55A 1O7YA 1YNJC 4A76A 4FF4A 2CW0D 1YVCA 2KQ3A 3MXUA 3CHBD 2RF4A 2LY7A 4L63B 3RMHA 3FPPA 4XQNA 3KBGA 2EYFA 3PF5A 2Q2TA 1V9PA 4N8X1 4PMCA 2CW0C 2OT2A 1I94Q 5DEHA 3HOUG 3K0XA 1XYIA 2AUJD 3RLFA 3R2TA 4G57A 3STBD 1LACA 5C4HA 5GAHC 1SFOH 4R4QA 2BE5C 1R9TB 3E0JA 2AUKA 3VYTA 1L1OA 3G4SA 2LKVA 4J15A 2JA6B 2NVTH 1VQGA 5GADC 3M4QA 1NJIC 2A1AA 4J1MA 2B3GA 2A6ED 4A75A 3NE5B 3EJIA 4ODGA 4YCVA 4GNXB 1QB5D 2B2WA 2VZAA 3O13A 4YHHQ 1B70B 1CUKA 4BXXG 2EPBA 2F0JA 5A35A 5BN3A 2ICIA 1LT6D 3EROA 4QJFA 4NXNL 2FINB 1HFNA 1E2VA 1LO5D 3T53B 2B2UC 2EY5A 3GQBA 1CQFA 4JI2Q 4P74A 4IOAA 2GN5A 2UXDQ 4GKJL 1XMQL 1HTPA 2NN6H 2ZXRA 4K5VA 4Q0FA 1NUCA 2Z4HA 3BYYB 4L5SA 4X65L 4B3SL 2HIVA 3CU7A 3J7YW 4LF9Q 4A3FG 2QILA 2B2YA 1GD7A 2P5ZX 3HZXA 3K5LA 1PYWD 1JB3A 5KNCA 4GKJQ 3HFZB 1S5BD 1G6PA 3KLRA 4DR4L 3GTJB 4NMZA 1HZBA 1PTOD 1LLRD 2I5HA 1QZHA 2F0SA 1TWGH 4DV3Q 4HIKA 4LUOA 3NSWA 3BYTB 4CDFC 2DNEA 2OQKA 1ASYA 1Q46A 1VCIA 2H5XA 3NPPA 1KQSA 4UAIA 5I6WA 4KK7A 4ZCKA 1KRTA 4JCVE 2HD3A 4OWTB 1Y1WH 2K5NA 3U4ZA 3M9BA 1HUMA 1EZ8A 1I6VC 1Z47A 2OEOA 3S17H 4QUFA 3U50C 1PH2A 3A8IE 1N8RC 1VDZA 3C2PA 2E5LL 4JI3L 2M2LA 5DAUA 1MIUA 4JI4Q 3HKSA 1KDBA 1PYSB 3A7LA 5LMNW 3G48A 4XQQA 4GKKQ 5CBAE 1A2UA 3H15A 1F2MA 1L0WA 5BR8Q 1PZKD 1TS4A 3OWFA 3V2TA 4K14A 3MWYW 4FXDA 3T51B 1C7YA 3PIPA 4XXEA 4DXFA 3D0FA 3UE1A 1M90C 2NVTB 4OIKA 1BKBA 1FJGL 5C0XJ 1VQEA 3CC7A 4OXPA 3P75A 1KD1C 2ZM6Q 1J5EQ 2D9UA 2L9HA 2I5LX 3I72A 4JBMA 4UP8A 1GUGA 4RMFA 3TEHB 4B3RQ 1LTGD 1TU2B 3KF6A 3SXHA 3NTIA 4DAMA 1GUTA 4C3JG 4HSPA 4C3IH 3LWUA 1MJEA 5KYIA 2F0EA 4AYBB 4DR6Q 2PZWA 1YNJD 3OWEB 4K5XA 2XRSD 4C3IG 4JI0Q 5ELEA 2BH2A 1SYFA 1WOCA 5ELNA 3UE0A 4IFDG 4DR1L 1W2BA 1TWCH 1VQPA 3EVQA 3HOUH 4A3KH 3TRZA 1H9JA 1SLJA 1OXXK 4YWLA 5M5YH 2GVAA 4JBKA 3AEVA 2BA1A 3M4OB 1LTRD 4WFN3 4A93B 4IUNA 2XRQD 2RBMA 1N34L 4C1NI 4QY7A 4IPHA 1XPUA 1X3QA 4B9WA 2CFMA 1VQDA 4YIJA 2KJXA 1A15A 1CSPA 1EU4A 2B29A 4HCSA 2HDLA 3D31A 3F2UA 1OTCA 5DM73 1CM9A 3CPFA 2R93H 1JJCB 2FHTA 5M3FB 3RUZA 2K50A 1AW7A 2DJGC 3DWAA 1ET9A 2B39A 1X56A 3VYRA 1VQHA 2OWOA 3M4OH 3GTOH 2F0UA 5JEAH 3GTQB 2NB0A 4OO1G 3S14H 2N8NA 4DAPA 3CXCA 2NWGA 3HG9A 1PRTD 1SROA 3K7AB 4N8FA 1KXLA 5FLXL 2ASBA 1H9RA 4XTCS 1ONLA 4ME3A 1PH1A 1WI5A 1IBKQ 3HP3A 3HKZB 1VQ7A 3M4YA 3VR2A 2QGQA 3EBEA 3S2HB 4H44C 4P72A 4GOPA 1HA5A 1RCVD 1DYQA 4JBJA 1LT5D 2R93B 4K8IA 4B3TL 1QWYA 3PIOA 1EIYB 4IUUA 1N34Q 5EPKA 5L37A 3DM1A 1I3QB 2LXKA 3TP5A 1BCPF 1BCPB 1JQYD 2K5VA 3HOZB 1I4RA 2I07B 3B6YA 2KEDA 2EYJA 2Z6BA 3J81j 4JOIA 4K5WA 4JC0A 3RZDH 3T16A 2UXDL 4A3MG 2K05A 4WJ3M 4IPDA 1UEAB 1EFID 1ZKOA 4BXXH 4PZ6A 3ULLA 5IWAL 1JCKB 4JI1L 1YNNC 2E2IB 4NKLA 2ZM6L 4IFDH 4Y7NB 2HCCA 1Q1BA 4K0KQ 4DAVA 1DOLA 2XIWA 1JJGA 3K59A 2DGYA 3SE0A 1VQIA 3UDGA 4JPBW 4X66Q 4LUZA 5JEAG 4OO1H 3S1QB 2K28A 1IYVA 1E1TA 4ZQ3A 1LABA 4DV5Q 3KJPA 4C3HG 1QNKA 4DV6Q 1RHPA 3GP7A 4HJ8A 3GV3A 1EWHA 3K5MA 3DHQA 2RHQB 1SE3A 2OTLA 1SNQA 1HPCA 2R93G 3TMEA 4KHPL 3AFQA 1BOSA 1GUWA 3NEMA 1ESFA 1JOKA 4MNOA 1N32Q 1PXUA 1QOHA 3HOWB 3RR5A 2VQEL 1I4HA 3KDFB 3S1MB 2JXMB 1DJRD 5C44H 3H3VH 3RZOB 3UDXA 2WB1G 4DN4M 4WJ4A 4XT1B 1JWSD 1GO3E 2IX1A 1EEFD 3K5OA 1B7YB 2ZJPA 1N33Q 2ATWA 1BVSA 5AJ3Q 4O0AA 5FLXE 1M1KC 4NPSA 3NQIA 5FLMG 2Q2UA 1WTPA 2AWOA 4OONA 5EQ0A 2SOBA 1ILPA 3DWQA 1C48A 4LWCA 3CCQA 4CKCA 1JJ2A 3JAMc 1T5EA 1WTVA 2YV5A 1CHQD 2EYPA 3C1FA 4BWGB 1P8LA 2ZTDA 3NBHA 1QE6A 2PZUA 1IL8A 3K6OA 4JI5L 3W5OA 2K4KA 2IHFA 4Z9CB 1EY5A 1UE1A 1N36Q 4GZYC 3ERQA 5EGTA 2A6HD 3OSOA 4R8NA 3W3AA 3GTMB 2VUMB 5IE8A 4YY3L 4QL5A 5J1ZA 2QF7A 1EY7A 1S4ZA 1SNOA 3OW7A 2AHOB 3KOJA 2PMZE 2XWJB 5HGQA 1PH3A 1CFMA 5I9PA 3J7A5 3A5UA 3F8TA 3ULPA 1O80A 4HSVA 1K83B 1NE3A 1VQKA 1B3AA 1U4PA 4QB4A 5I4DA 1E22A 1HZCA 2AMCB 4BY1H 2Q8TA 4C3JB 1NTGA 4JG2A 4LW1A 1CK1A 1JMCA 3QO2A 1PH9A 1KRSA 2PI2A 1OXSC 4C3HB 1C4QA 2KHJA 2NYZD 4JI1Q 3I4MG 1SN8A 2B2TC 2D2CC 2UUAL 1GVPA 1HJPA 2D0PA 4H02A 2L15A 1A3UA 3I2ZA 3G6EA 5C44G 1X54A 1V1OA 5CGKA 3MAQA 1CTMA 3CCEA 1AE3A 3UI2A 4ZLTF 1QVGA 1OXTA 5BN4A 5M9OA 4X64L 1SYEA 2CWPA 1J5EL 1ZYRD 3E9IA 3X3MA 1FYCA 3KF8A 1SE8A 2R7ZG 5JJKA 4APVA 5D3DA 1XPRA 3Q0AA 4EQOA 4X3SA 1PV4A 2RKSA 5DM63 2K75A 1RTOA 1RL2A 1GKHA 1H9SB 4GN5A 1XX8A 4R9WA 2KA7A 4EQNA 4DUYQ 1A2TA 2ID0A 1YHAA 5E1FA 2K52A 1ICFB 1W3SA 1EYAA 3A0JA 3TSSA 2R92B 1HHVA 3JAML 1EY0A 3KK7A 1X55A 4CGYB 5IGBA 3MTSA 4PG3A 4UY8C 4EQPA 1I5FA 5J22A 2K1BA 3A8KE 3S2DB 2VW9A 3M4PA 1CKNA 3BZDB 3PUWA 3ITPA 2OCEA 1S40A 1PH6A 3NUCA 5F2DA 5EPLA 3S16B 4FP5D 3TP8A 3FKIH 4DR1Q 1DXMA 2PZTA 5CV5A 5IP7G 5NUCA 5A2QL 1VQ6A 4BBSB 3I4NB 3SDZA 3K0YA 1VQNA 5IYDH 1ICWA 1Q12A 4IQZA 5C4XB 1EQRA 5C3EG 1MD2D 3PQIA 5HURA 1YJWA 1KNEA 4JYAQ 3DXJC 1CZGA 3P7JA 2B63G 1L0YB 3X3NA 1BF4A 2JA8B 4F8MA 2HCIA 2J4XA 1YI2A 2PQEA 3NWSA 3HOVB 1CHPD 4AQYQ 1IW7D 4A3JH 4IJLA 4RAUC 2Y0SG 2JA7H 3SVMA 4GN3B 4TRDA 4B9XA 1RDPD 3MFGA 4DR2Q 1A62A 5C4ZA 4AYBG 4P2CB 2RSOA 2UXCQ 1M4VA 3NTKA 2RVLA 1H9KA 3CD6A 1H95A 5AFWA 3CMAA 3CCSA 2L1BA 2Z1CA 4HR7B 2L55A 2EY6A 4MZ9A 4CDEC 1B44D 2CWAA 3S16H 2C9OA 1HXYD 4BBRB 1X6OA 1SYDA 2N78A 4JI3Q 4OX9L 4UP9A 3NTHA 3AMUA 4ZAIA 1J6QA 4ZRZA 1IW7C 1D5XC 1ESRA 1H9MA 3SK4A 2MO0A 3RN2A 4KY6A 3M7GA 1STNA 1LTID 4OL7A 3N52A 2UXBQ 1IYJB 4KHVA 2K32A 1YJ9A 3I70A 1X3EA 5CMDA 4F88A 3CC2A 1A3TA 5C0XG 1JWMD 1F2YA 2CVRA 1D6EC 3VR3A 1SMYD 2RQXA 4LFCL 4GLAC 3T56B 2PQAB 1STEA 4A3JB 1SAPA 4A3KB 1BXTA 4A3MH 1VQ5A 4EX5A 1PRTC 4P71A 1R4PB 3U9OA 4BY7H 5KGUA 3ERSX 5C4XG 3F2DA 3M3YB 3KDFA 2A73B 4DR4Q 1GOZA 2A19A 3OMGA 4DNRB 2E76C 2K7VA 1PHJA 2K33A 4QUCA 1PH7A 2IWHA 1SNCA 3J80L 4IPGA 2Z9HA 1EY4A 3VR5A 1E24A 4RWSC 2EY1A 3QWNA 1PFMA 2JA9A 4X62L 1YIJA 1FNUA 1VQBA 5IWAQ 5K5PA 5IGGA 5M5XH 4J6HA 3NWTA 3K80C 2ES2A 4LF5Q 1PRTB 3PO3G 1GXDC 5E7NA 5BN5A 1PRTF 4RCOA 4NXNQ 4RGOS 4F7XA 5LHY1 4PZ7A 3CQZB 2LFNA 1PYBA 3EQLC 4G7OC 1KAAA 2F0GA 2RCNA 1MSHA 3A8JE 2KOLA 1WCMH 2JEAI 5FK9C 1I6HB 2E2JB 2NZHA 2RDHA 3I56A 2N49A 2GVBA 3OIQA 3SHLA 3KLSA 2R7FA 4FYDA 1FGUA 3Q6SA 4V0BA 2HQEA 2JA7B 5JJLA 5E3FA 4LF8Q 1QCBD 3CAMA 2ZTCA 4RGNA 4IUTA 3MXNB 4IO9A 2PO4A 4KKSA 3U4VA 3DM3A 2UUCQ 5M5WB 2UXCL 5M5XB 4A3IH 1SYGA 4ZYSA 5JJIA 2NVQB 1KAWA 3UDIA 2F0OA 3NK9A 1Y1WB 1LTTD 3D4RA 4LF6Q 3ONAB 1L1OB 3CF5A 4CKEA 1XXGA 2IW3A 3A5ZB 1WTXA 2HIXA 2ZXOA 1RD9D 2QDBA 1WJJA 1IZ6A 4V190 1GHJA 1V8QA 3CRLC 1CA5A 3JAMi 3MEFA 3VA7A 1E0BA 3S2DH 2NBFA 4JI8Q 1P16A 3VR4A 4RA8A 1SYBA 2YTYA 1PH5A 2R7ZH 1Q8IA 1EWCA 1ZXTA 4A3DB 1PLFA 3W1BA 1G2SA 3BG3A 3Q23A 4BA2I 1FJGQ 4A3GB 2YYZA 3KYHC 2WV6D 4RGTA 1XNRQ 1L1OC 3KF8B 3GTGB 2EVBA 2GA4B 1VQLA 2NTTA 1LM0A 3J7AV 2MP1A 1Q1EA 1PTOC 1O78A 3J7AF 3A7AB 4U673 1IL2A 3I4MH 1NMFA 1EEID 1STGA 3RZOH 2F4VQ 1CSQA 4A93G 1VQFA 1G51A 4DFAA 3L3OC 3OHXC 3NQTA 4X6AH 1CA6A 3NENA 1BCPD 4A93H 2F0VA 4JYAL 1V1PB 5ELCA 5C3XA 3JAME 4IUVA 3WWVA 1UE6A 4BS9A 1SBBB 2F0MA 2DNCA 2MJ8A 3BVZA 4HMJA 1EWIA 2V4DA 3C46A 1S5DD 2F0NA 3SK6A 5KIXA 3HEJA 1D5MC 5IGFA 2WB1B 4A3BG 4DR6L 2Z6KC 1BCPC 3BDCA 2BCOA 1KIXA 2JA8G 3TN2A 5M3FH 1KL9A 3HOWG 1A63A 1STAA 4JI7Q 3MEHA 3MA2B 2C5CA 5EKLA 1YEZA 4N9TA 1I4PA 3BJUA 3SR1A 1CZWA 1B4OA 4E6IA 1LTAD 3QOJA 3KLSX 4OHJA 1Y1VB 4YCUA 4A3FH 1IBKL 1S3OA 1EYDA 5ELBA 1EQQA 4B3TQ 1K8OA 3HOXB 3GO5A 3I8ZA 3PUXA 4KN4C 2R6GA 1SMXA 1QG7A 2Z0SA 1WTQA 2VQEQ 1IBLQ 4DR7Q 4HAEA 2Z4IA 1PA6A 1C9OA 3FHWA 4OX9Q 5I6YA 3PIO3 2IL8A 1B3QA 3CCJA 5IP9H 3PMFA 2XVSA 1Y1VG 3JC66 1UEBA 4KY5A 4A3KG 1I3QH 4IOCA 4JI4L 1ET6A 1C0AA 2O4XA 2VB3X 1ENCA 1AP0A 2WAQG 4DR3L 3MHBA 4DV4L 1STYA 4JI7L 4JI2L 4MIUA 3VYUA 3OIPA 3K7UC 2IPKD 1Z6HA 4Y7NH 1Y1VH 1VQMA 1WTHA 1Q81C 2F4IA 2JN4A 1HH2P 1X3GA 4X3UA 4DAYA 2Q8RE 2O5IC 1OXUA 4LFAL 1NR4A 3Q24A 4A3BB 1HR0L 3CW2C 2R7DA 4DV1Q 4NXMQ 1N36L 1I50B 1CI3M 4DR5L 3S15H 4LMQD 2EYHA 3S9WA 4I7AA 4LFBL 3P20A 3CCLA 5IYCH 1WD0A 3HOXG 2UU9Q 3E6ZX 4XIGS 1JWUD 3S1QH 1I4XA 4C2MH 3VDYA 4PNYA 5CR3A 4K6LA 5HY6A 2K5WA 1F9RA 4DKAC 4BY7G 1SRUA 3RNUA 2SEBD 1LUZA 2MQHA 2KCTA 3HOVG 3SK5A 5IT9L 1BBWA 1M8AA 1AN8A 5JEAJ 4FVMA 4BY1G 1XMQQ 4XDXA 3DLLA 1HNXQ 4HTHA 2X6LA 1IKMA 1WCMG 2BE5D 3D6WA 1CKMA 3MXGA 1XMOQ 2XSCA 1Q8KA 2WP8J 5M5YB 2EJFC 4K6DA 4A3LH 5CV6A 2KHIA 3FRPB 1D8LA 3BZCA 4M1UB 3L2PA 4KN7C 5KRUA 4YHHL 1VF7A 4C2MB 1TIID 1VQCA 1KLUD 1LTSD 1EQTA 1VMPA 3DMUA 4Q5VA 4ZKCB 3IFDA 3WOEA 4JBWA 3M85A 1VQ9A 3ND9A 2LMCB 5FKAC 1B2TA 1RF2D 3K8AA 4OO1I 3FP9A 2UUBQ 4IUPA 2PYKA 4MHEA 1VQOA 1I4GA 1SSOA 3S1RB 2EXDA 4K8JA 5C6AA 3PO2G 2Y0SB 1AEXA 3PSIA 4CDDC 3AFPA 4PV1C 4WORA 1HZAA 4FXKC 4DK1A 5GROA 1N32L 1XTCD 2E2JH 4K0KL 4LF6L 3S14B 4HJ5A 2PW7A 1QZGA 1X65A 2H4OA 4A3MB 4DR7L 3RD4A 4FO2A 1TWAB 3C1EA 2B2UA 5CYUA 4TQUS 4UPAA 2CHBD 3E5SA 1HR0W 3K7AH 5IGDA 1Q7YC 1ML0D 1TWHH 1PTOH 5CBEE 1X9NA 4ZUIA 3TZUA 4OELB 2E74C 3SGIA 5C0XH 2I46A 5C0XI 3GTJH 3J81E 4BY7B 2EIFA 2OXPA 1F2LA 1Y8NB 1T9HA 3VYSA 2KCMA 4KMUC 1U4LA 3I3CA 1TS3A 5C4JH 1A3VA 1KABA 2XGTA 4X65Q 4B3SQ 3PCOB 1XPOA 1H9SA 3T1YL 3BS1A 3GTKB 1E1OA 4KV6A 3A56A 2QEXA 2MGSA 2LXJA 2IX3A 1AZQA 2ZJQA 4S3SA 2OQ0A 1HUNA 1EIHA 3QG1A 4XYQA 3OMCA 5CV8A 4G4KA 4EQ5A 4A3FB 5IP9G 3S17B 3C3LA 1ASZA 4PZ8A 4QIWE 2B2WC 4UHVA 2QEJC 4KTAA 3R8BA 1W6KA 3NXWA 3TS0A 2WB1E 3MVVA 2KUMA 4IUQA 2R92H 4DUZQ 4JV5L 3LGJA 5JVG3 4TKOB 2XNAC 2VQFQ 3GTKH 1L2FA 4DV0Q 1QUQA 2KHSA 3NBIA 5CC4A 4DK6C 5ISRA 1SE2A 3H94A 5J39A 1K8GA 4CHTB 4HIDA 2L12A 2IY5B 2UUBL 4KI0A 1V43A 2YTXA 1HR0Q 1NY4A 1ENAA 4G7ZC 2K01A 4POFA 1I4QA 2JA5G 3D4DA 2D5DA 3FKIG 1A8VA 5E4XA 1V1QA 2A5HA 2JK8A 3BDLA 3FVQA 1WTRA 2F4VL 4DK3C 3I4NH 1SNPA 4G7HC 2V1CC 3H09A 4GN4B 1JT8A 1IYUA 1K8MA 4OGQC 2F0KA 3PO2H 2E2HB 4FF1A 5BR8L 4A3IB 4DV7L 5I9OA 3PO3H 2EOTA 2ZJRA 2JA8H 4LAAA 1GUOA 1UWVA 4PQXA 4A3CH 3HOYG 5FJ8H 3IL8A 4GOPC 2KCCA 2D62A 4A3BH 4R4CA 3BU2A 3EA6A 4M8AA 3M7NA 2KCNA 2Y0SE 1S72A 5JJZA 3OYYA 4HIOA 4RKBA 5H1SE 2K04A 5C44B 2EDGA 4KD3A 4P75A 2ENBA 4ZKBB 2AWNA 2JA6H 5T1IA 1LV9A 3HOYH 4QIWB 1YITA 2WIIB 1JICA 5KEEA 1KLGD 3R3OA 5COYA 1EQVA 1ZEQX 3VR6A 4YWKA 1NAPA 1TT2A 2R3ZA 4A3EG 1MGSA 4DAYB 3KLWA 1S5FD 1J8IA 2NZOA 3W2DA 3BVGA 1QVFA 5GQOA 5FLMH 3PV0A 4KHPQ 2K14A 3ZYYX 5LMNQ 4AYBE 4JVZA 4L5TA 4L8JA 1DONA 1XNQQ 3KFUA 1STHA 3H6MA 4DV3L 1UNSA 2IJ0A 3GTMH 2YU9H 4LNQA 4CJ2C 1Y69U 4R4OA 5DNFA 2FJ2A 5LMNL 2KEEA 1DGSA 5KYLA 3T1HQ 3M3YH 4JI6Q 1O7ZA 1VQ4A 2J7ZA 4BY1B 2H1EA 3S1RH 4ILWA 5I2YA 3WOFA 4JI5Q 2EYMA 1PMRA 4C3HH 4DR3Q 3EN2A 1YZ6A 1WD1A 3I55A 1TY2A 1II3A 2DN8A 3PUYA 3J80i 1KTKA 4DU9A 1VQAA 4IZ8A 3D8GA 2OF1A 5IT9c 2F0QA 4P73A 3PIP3 1EIFA 1IBLL 1TS2A 1IXRA 5LL6S 2E5LQ 2R7ZB 1QILA 1LTBD 4A3IG 3CC4A 1TWGB 3KBXA 2SNMA 2M9VA 5C3EH 1OO9B 3OTOL 4R8IA 3GTPB 4O1NA 3GV6A 1MI2A 2VL6A 2Z8LA 3WDNA 1EY9A 4KY7A 4A3GG 4NP5A 1AE2A 2DY7A 1TS5A 1GUSA 1KDAA 1D5ZC 2PW5A 4H13C 5FLXc 2PMZB 4RCNA 4DF7A 4A3DG 2Q2HA 1SJHD 4XQJA 1EOTA 3AYHB 3TZDA 2KVMA 3LNNA 1FGBD 1QJOA 2MPMA 3R2IA 3J81c 1K8AC 4H7BA 5E4WC 2F0LA 1LT4D 1HFGA 4DV0L 2TSSA 3PUZA 2A69D 3S1NB 3D3RA 1FD7D 1TWFB 5CV4A 1G291 1HNXL 1V1PA 2F3IA 2F0DA 4ALPA 1R4QB 2E2DC 1HQMC 4DPGA 2QA4A 1BR9A 2J0TD 1WTWA 3URYA 5FJ8G 1CT1D 2WAQE 1U0LA 4LF4Q 2HQLA 2B2YC 3QB3A 3GTLB 3EIVA 4HJ9A 2AKWB 2NVYH 2RDGA 4C3IB 3RLNA 1HNZL 3FKIB 5IGEA 4DUYL 5FO9B 2VQFL 1HA6A 1FNWA 3I4NG 5FO7B 3HRZC 4YCWA 4LUVA 1VQJA 2EJGC 2G9HD 1SE4A 4NDXA 4FDBA 2YTVA 4L5RC 4ULLA 4X64Q 5JVH3 4BA1I 4QCLA 4JI0L 5EAYA 2YU9B 1U4RA 1DOMA 3QR8A 1A6XA 2EE1A 2UU9L 1Q82C 1DOKA 3GTLH 2N88A 5K36G 3I73A 1CKOA 2NUCA 3OW2A 2A8VA 2WAQB 3CCVA 2R92G 4DNIA 1NBWA 1EOVA 5FOBB 1TWCB 5ELDA 2JA6G 4LF9L 4POGA 1RIPA 5EJWA 1LYLA 5AJ3L 1WYDA 2EQSA 1PZID 5LMUQ 1XMOL 4LF7Q 2K6AA 3E9HA 5M3MG 3CPWA 4RH6A 3SEBA 1JOOA 3OPOA 3GTQH 4ZUJA 4TSSA 3AU7A 2VNUD 4IURA 4JW0A 1YNXA 4HJAA 4GKKL 1EL0A 2I5MX 3KF6B 4FF2A 3GTPH 1K73C 2QKIC 3W1GA 2WKCA 4MTNA 3IKJA 3ZJYC 4A3JG 4KJOA 1U4MA 2FFKB 2WINB 1BDOA 4IJHA 2KECA 3PGZA 1UAPA 2KENA 2B63H 5M3MB 1YHQA 1SMYC 4L6TB 2A68C 4LK1C 4LF8L 1E3PA 3TP6A 1TWAH 3E3XA 2TMPA 2PPBC 4DV1L 5C3WA 5CV7A 2IX0A 3VA5A 4HIMA 2R61A 4RHSA 4B3ML 2A6EC 3I7FA 5ELOA 3RN5A 1BQQT 1TWFH 4R4IA 1Y8PB 4HN7A 5JOBA 3K57A 2AQ3B 4EVOA 1WVLA 4HEDA 1SEBD 2RDFA 5EKIA 1RTNA 1YBYA 3L7ZC 1TWHB 5CV9A 5M3FG 1K3RA 4DV2L 2K5QA 1I6HH 5EPJA 1KC8C 4BBSG 1WTOA 3HOZH 1MJCA 1O7IA 2BDNA 2CQOA 1B53A 2PQAA 4FNFA 1LT3D 4X66L 1FL0A 4O2DA 1U5KA 1U9RA 1K3BC 2SDFA 4RFBA 4I65A 4HMIA 4DXGA 3OOCA 1SYCA 2Z6KA 2B63B 3G71A 4X62Q 4HJ7A 2HDMA 3J81L 3H0GB 5C3EB 4K2KA 1G91A 4QGUA 1FR3A 1STBA 2HT1A 4QQBX 5IYBH 3P1HA 5IOCA 2PNHA 1X3FA 1E2WA 3BZKA 1L0XB 3MXNA 5EBCA 3K81C 1XNRL 3D4WA 3HKZE 2N3SA 3F1ZA 4LF4L 5C4XH 2K03A 2B8GA 5M5WH 1TKWB 2NTSA 5G3LF 4DNTB 2F0HA 3FPUB 3MC0B 1PH4A 1LTLA 1X32A 3H3VC 5C5LA 3LX0A 4NB3A 3S1MH 4LJZC 2CCZA 4J8QA 2F0WA 2MHVA 5GAEC 4DGZA 3F2CA 3KJOA 2UUCL 2RSNA 1I50H 5JPMC 2HUGA 4QMGA 5IY0A 1F2ZA 2JJQA 3FMCA 3GTGH 1S5ED 2O5JC 5DLQE 4U68A 5IYBG 3L0OA 2HHHQ 4JI6L 5G3LD 3G7LA 1Y1WG 2A74C 2F0IA 1PDQA 3E0EA 2B8FA 3CMEA 4DV5L 4DV6L 1Q90A 4I7ZC 2CH4A 3K5NA 1K28A 1QNUA 4GOPB 2PI2E 5CORA 4Y52H 2B2VA 2C35B 1UE5A 2EJMA 3J80c 2XN9C 2VUMG 2PCFB 1AFPA 1NR2A 1Y8OB 1IKLA 3QJYA 3BVMA 3QIAA 1ILQA 4CKBA 2RA4A 2JQOA 2WACA 3PF4A 2OTJA 1S5CD 1DZ1A 1GHKA 1FNVA 5C5MA 3UDFA 1XJVA 4FXGC 1MKHA 3FDTA 3TS2A 2KBNA 1YHBA 2CQAA 3HGBA 3TP7A 1HQRD 3ND8A 2MUYA 2E75C 3IAYA 4B3RL 3ER0A 1KNAA 3I90A 3HS0C 4OEMB 2IT1A 1KDCA 2F1MA 1PFNA 5I2XA 3F2BA 5ELFA 2IHEA 1IBML 1J9OA 4PMBA 3J81i 1ZYRC 4WRDA 1WFQA 1VF5C 2NVXB 4GNXC 2A69C 1PTOB 1HNZQ 1PTOF 2EYOA 4LFBQ 1NMGA 1MSGA 4C3JH 1K0SA 1JR0D 1YJNA 2JSOA 3HOUB 1HTLD 3LWEA 1TR5A 1F9PA 1B9NA 2EXZA 4DK0A 5LMUL 1QVCA 3U58A 5D14A 2L0CA 1BBXC 3STBC 3CQZH 4LFAQ 5EBDA 5D65A 4CJ0B 1NSNS 4KHZA 5M3MH 2WKDA 2VS1A 3Q22A 1HZ9A 3TBIB 5IIFA 1SR3A 4KD4A 3SK8A 2MNAA 3TDQA 4H0LC 4L5QA 1SXTA 1N9WA 2L11A 3MXPA 2G5DA
chains in the Genus database with same CATH topology
5HGTA 5LL6X 1PFBA 3DUZA 3BDOA 2F0FA 1JC7A 1O7LA 4IALA 3V05A 2O2LD 5C4JB 1DD2A 3HOYB 3U9SA 2JE6I 1DCZA 4KKUA 2NN6G 2X6GA 4NW2A 5K36H 3MFYA 1HRJA 4UDUC 2A68D 4X3TA 1ENFA 1RODA 1F77A 1SDFA 4RKLA 4K2LA 2JA5B 4ZK9B 5D3IB 3J80E 1EU3A 4A3EB 3S15B 3QOLA 1NCVA 3H91A 2QCPX 1D1IA 2FMCA 5IGCA 5IT9E 4ME5A 1PZJD 3R93A 1TQOA 1SFOB 1BUVT 1E2ZA 4B08A 4IFDI 1EIGA 1UUPA 4FF3A 1X3PA 2XWBB 3V96A 5FO8B 4N9PA 2NZ1D 1SNMA 4X3KA 1D2BA 2LS01 3I4MB 2JYOA 3PO2B 3K58A 1IHZA 3T13A 2ZT9C 2BOSA 1EY6A 2K5DA 5EKKA 2F3WA 1GJXA 5JPNC 4XYOA 4PMWA 1F9SA 3L9AX 2NN6I 1T5XD 3NP8A 1OXVA 3GTOB 2ICEC 5TSSA 2F0PA 1TVXA 4XT3B 3IFTA 1EYCA 2AQ2B 1G8ZD 3CRKC 4KKTA 4C1NK 1RJTA 4ID6A 1YNND 1B9MA 3MZ5A 3GD7A 3A55A 1BO0A 2F3VA 2JEBI 4CJ1B 2A6HC 2ZXPA 1CQVA 1EY8A 3EFXD 1BNZA 2L4NA 4O42A 5JAVA 1G6ZA 1F9QA 1AZPA 1B1ZA 1C8CA 4JK1C 2VXWA 4F87A 3G6JB 1B50A 1G2TA 5T1GA 2JP1A 4IN3A 3AB9A 3A54A 1JORA 2FMMA 4WJWA 1D1KA 3NHHA 4DA2A 1RKNA 3DWPA 2AQ1B 1HCZA 3RZDB 4MN3A 3DEPA 2NVYB 4EGVA 4QF4A 1GUNA 1MBYA 1TY0A 2B2TA 1W6JA 3CKIB 2PNRC 1EZ6A 1VMCA 1WCMB 3I4LA 5KNDA 3I91A 4IFDJ 4CBVA 2F03A 2L5TA 2X69A 2SNSA 2F0TA 3N6RA 2BDOA 5IODA 4RHRA 1Q3LA 1SJED 1XWEA 1SNDA 2EZVA 2BA0A 2VB2X 3DEOA 4RGMA 4OIJA 5A2QE 4HCEA 3FEWX 2DY8A 1DM0B 2EY2A 1JE4A 2Q8IB 1JOQA 4ABNA 4C56C 3D6CA 2EYLA 3KUPA 3PO3B 3PUVA 2G9DA 1Z7TA 4KJNA 3T4AC 2M00A 5KNBA 2B2VC 2N55A 1O7YA 1YNJC 4FF4A 2CW0D 2KQ3A 3MXUA 3CHBD 4L63B 2LY7A 3RMHA 3FPPA 4XQNA 3KBGA 2EYFA 4PMCA 2CW0C 2OT2A 5DEHA 1XYIA 2AUJD 3RLFA 3R2TA 4G57A 1LACA 5C4HA 2BE5C 1R9TB 3E0JA 2AUKA 3VYTA 2LKVA 2JA6B 4J1MA 2A6ED 3NE5B 3EJIA 4ODGA 1QB5D 2B2WA 3O13A 2EPBA 2F0JA 5BN3A 5A35A 2ICIA 1LT6D 3EROA 2FINB 1HFNA 1E2VA 1LO5D 3T53B 2B2UC 2EY5A 3GQBA 1CQFA 1HTPA 2NN6H 2ZXRA 4K5VA 4Q0FA 1NUCA 2Z4HA 3BYYB 3CU7A 3J7YW 2QILA 2B2YA 3HZXA 3K5LA 1PYWD 1JB3A 5KNCA 1S5BD 3KLRA 3GTJB 4NMZA 1PTOD 1LLRD 2F0SA 3NSWA 3BYTB 2DNEA 1VCIA 3NPPA 4UAIA 5I6WA 4KK7A 1HUMA 1EZ8A 1I6VC 1Z47A 2OEOA 4QUFA 3A8IE 1VDZA 3C2PA 2M2LA 5DAUA 1KDBA 3A7LA 4XQQA 5CBAE 1A2UA 1F2MA 1PZKD 1TS4A 3OWFA 3V2TA 4K14A 3MWYW 4FXDA 3T51B 4XXEA 4DXFA 2NVTB 4OIKA 5C0XJ 3P75A 2D9UA 2L9HA 3I72A 1GUGA 1LTGD 1TU2B 3SXHA 3NTIA 1GUTA 4C3JG 4HSPA 3LWUA 5KYIA 2F0EA 4AYBB 2PZWA 1YNJD 3OWEB 4K5XA 2XRSD 4C3IG 5ELEA 1SYFA 4IFDG 3EVQA 1H9JA 1OXXK 2BA1A 3M4OB 1LTRD 4WFN3 4A93B 4IUNA 2XRQD 2RBMA 4C1NI 1X3QA 4B9WA 4YIJA 2KJXA 1A15A 1EU4A 4HCSA 2HDLA 3D31A 3F2UA 5DM73 1CM9A 2FHTA 5M3FB 3RUZA 1AW7A 3DWAA 1ET9A 2B39A 3VYRA 2F0UA 5JEAH 3GTQB 2NB0A 4OO1G 4DAPA 2NWGA 3HG9A 1PRTD 3K7AB 5FLXL 1H9RA 4XTCS 1ONLA 3HP3A 3HKZB 3M4YA 3VR2A 3S2HB 4H44C 1HA5A 1RCVD 1DYQA 1LT5D 2R93B 4K8IA 1QWYA 4IUUA 5EPKA 3DM1A 1I3QB 3TP5A 1BCPF 1BCPB 1JQYD 3HOZB 1I4RA 2I07B 2KEDA 2EYJA 4K5WA 3T16A 2K05A 1UEAB 1EFID 1ZKOA 1JCKB 1YNNC 2E2IB 4NKLA 4IFDH 4Y7NB 2HCCA 1Q1BA 4DAVA 1DOLA 2XIWA 3K59A 3SE0A 5JEAG 4OO1H 3S1QB 2K28A 1IYVA 4ZQ3A 1LABA 4C3HG 1QNKA 1RHPA 3GP7A 3GV3A 1EWHA 3K5MA 3DHQA 1SE3A 1SNQA 1HPCA 3TMEA 1BOSA 1GUWA 1ESFA 1JOKA 1PXUA 1QOHA 3HOWB 1I4HA 3S1MB 2JXMB 1DJRD 3RZOB 4DN4M 4XT1B 1JWSD 2IX1A 1EEFD 3K5OA 5FLXE 3NQIA 1WTPA 2AWOA 5EQ0A 2SOBA 1ILPA 3DWQA 1C48A 4CKCA 1T5EA 1WTVA 1CHQD 2EYPA 3C1FA 4BWGB 3NBHA 1QE6A 2PZUA 1IL8A 3K6OA 4Z9CB 1EY5A 4GZYC 3ERQA 5EGTA 2A6HD 3OSOA 4R8NA 3W3AA 3GTMB 2VUMB 5J1ZA 2QF7A 1EY7A 1S4ZA 1SNOA 3OW7A 2XWJB 1CFMA 5I9PA 1O80A 4HSVA 1K83B 1B3AA 1U4PA 4QB4A 5I4DA 2Q8TA 4C3JB 1CK1A 3QO2A 4C3HB 1OXSC 1C4QA 2NYZD 2B2TC 2D2CC 1A3UA 1V1OA 5CGKA 3MAQA 1CTMA 3UI2A 4ZLTF 1OXTA 5BN4A 5M9OA 1SYEA 1ZYRD 3X3MA 1FYCA 3KF8A 5D3DA 3Q0AA 4EQOA 4X3SA 5DM63 2RKSA 1RTOA 1H9SB 4R9WA 1XX8A 2KA7A 4EQNA 1A2TA 2ID0A 5E1FA 3TSSA 2R92B 1EYAA 1HHVA 3JAML 1EY0A 3KK7A 4CGYB 5IGBA 3MTSA 4EQPA 5J22A 2K1BA 3A8KE 3S2DB 3BZDB 3PUWA 3ITPA 3NUCA 5F2DA 5EPLA 3S16B 4FP5D 3TP8A 1DXMA 2PZTA 5CV5A 5A2QL 5NUCA 4BBSB 3I4NB 3SDZA 3K0YA 1ICWA 1Q12A 4IQZA 5C4XB 1MD2D 5HURA 1KNEA 3DXJC 1CZGA 3P7JA 1L0YB 3X3NA 1BF4A 2JA8B 4F8MA 2HCIA 2J4XA 2PQEA 3NWSA 3HOVB 1CHPD 1IW7D 4RAUC 3SVMA 4B9XA 4TRDA 1RDPD 3MFGA 5C4ZA 4P2CB 2RSOA 1M4VA 3NTKA 2RVLA 1H9KA 5AFWA 2L1BA 2Z1CA 4HR7B 2L55A 2EY6A 1B44D 2C9OA 1HXYD 4BBRB 1SYDA 3NTHA 3AMUA 4ZAIA 4ZRZA 1IW7C 1D5XC 1ESRA 1H9MA 3SK4A 4KY6A 3M7GA 1STNA 1LTID 4OL7A 3N52A 4KHVA 2K32A 3I70A 5CMDA 4F88A 1A3TA 5C0XG 1JWMD 1F2YA 2CVRA 1D6EC 3VR3A 1SMYD 2RQXA 3T56B 1STEA 4A3JB 1SAPA 4A3KB 1BXTA 1PRTC 1R4PB 3U9OA 5KGUA 3M3YB 2A73B 1GOZA 3OMGA 4DNRB 2E76C 2K7VA 2K33A 4QUCA 2IWHA 1SNCA 3J80L 1EY4A 3VR5A 4RWSC 2EY1A 3QWNA 1PFMA 1FNUA 5K5PA 5IGGA 4J6HA 3NWTA 1PRTB 1GXDC 5BN5A 1PRTF 4RCOA 5LHY1 4RGOS 4F7XA 3CQZB 2LFNA 3EQLC 4G7OC 1KAAA 2F0GA 1MSHA 3A8JE 2KOLA 2JEAI 5FK9C 1I6HB 2E2JB 2RDHA 3OIQA 3SHLA 3KLSA 4FYDA 3Q6SA 4V0BA 2HQEA 2JA7B 5E3FA 1QCBD 4RGNA 4IUTA 2PO4A 4KKSA 5M5WB 5M5XB 1SYGA 4ZYSA 2NVQB 2F0OA 3NK9A 1Y1WB 1LTTD 3D4RA 3ONAB 4CKEA 1XXGA 2IW3A 1WTXA 2ZXOA 1RD9D 2QDBA 4V190 1GHJA 1V8QA 3CRLC 1CA5A 3VA7A 1E0BA 2NBFA 3VR4A 4RA8A 1SYBA 1Q8IA 1EWCA 1ZXTA 4A3DB 1PLFA 1G2SA 3BG3A 3Q23A 4BA2I 4A3GB 2YYZA 2WV6D 4RGTA 3GTGB 2EVBA 2GA4B 2NTTA 3J7AV 2MP1A 1Q1EA 1PTOC 1O78A 3J7AF 3A7AB 4U673 1EEID 1STGA 4DFAA 3L3OC 3OHXC 3NQTA 1CA6A 1BCPD 2F0VA 5ELCA 5C3XA 3JAME 4IUVA 4BS9A 1SBBB 2F0MA 2DNCA 2MJ8A 3BVZA 4HMJA 2V4DA 3C46A 1S5DD 2F0NA 3SK6A 5KIXA 3HEJA 1D5MC 5IGFA 2WB1B 1BCPC 3BDCA 2BCOA 3TN2A 1STAA 3MEHA 3MA2B 2C5CA 5EKLA 4N9TA 1I4PA 3SR1A 1CZWA 1B4OA 4E6IA 1LTAD 3QOJA 3KLSX 4OHJA 1Y1VB 1EYDA 5ELBA 1K8OA 3HOXB 3GO5A 3I8ZA 3PUXA 4KN4C 2R6GA 1QG7A 1WTQA 4HAEA 2Z4IA 5I6YA 3PIO3 2IL8A 3PMFA 2XVSA 4KY5A 1ET6A 2O4XA 2VB3X 1ENCA 1AP0A 3MHBA 1STYA 4MIUA 3VYUA 3OIPA 2IPKD 1Z6HA 2F4IA 4X3UA 4DAYA 2Q8RE 2O5IC 1OXUA 1NR4A 3Q24A 4A3BB 1I50B 1CI3M 4LMQD 2EYHA 3S9WA 3P20A 1WD0A 3E6ZX 4XIGS 1JWUD 1I4XA 4PNYA 5CR3A 4K6LA 2K5WA 1F9RA 2SEBD 3SK5A 5IT9L 1M8AA 1AN8A 5JEAJ 4FVMA 4XDXA 4HTHA 2X6LA 1IKMA 2BE5D 3D6WA 3MXGA 2XSCA 2WP8J 5M5YB 2EJFC 4K6DA 5CV6A 3FRPB 4M1UB 4KN7C 5KRUA 1VF7A 4C2MB 1TIID 1KLUD 1LTSD 1EQTA 4Q5VA 1VMPA 3DMUA 4ZKCB 3IFDA 3WOEA 4JBWA 3M85A 3ND9A 2LMCB 5FKAC 1B2TA 1RF2D 4OO1I 4IUPA 2PYKA 4MHEA 1I4GA 1SSOA 3S1RB 4K8JA 5C6AA 2Y0SB 1AEXA 4PV1C 4WORA 4FXKC 4DK1A 1XTCD 3S14B 2PW7A 2H4OA 4A3MB 3RD4A 4FO2A 1TWAB 3C1EA 2B2UA 5CYUA 4TQUS 2CHBD 3E5SA 5IGDA 1ML0D 1PTOH 5CBEE 4ZUIA 3TZUA 2E74C 5C0XH 2I46A 5C0XI 3J81E 4BY7B 2OXPA 1F2LA 1Y8NB 3VYSA 4KMUC 1U4LA 3I3CA 1TS3A 1A3VA 1KABA 1H9SA 3BS1A 3GTKB 4KV6A 3A56A 2MGSA 2IX3A 1AZQA 4S3SA 1HUNA 1EIHA 3QG1A 4XYQA 3OMCA 5CV8A 4G4KA 4A3FB 3S17B 3C3LA 2B2WC 2QEJC 4KTAA 3R8BA 1W6KA 3NXWA 3MVVA 2KUMA 4IUQA 5JVG3 4TKOB 2XNAC 2KHSA 3NBIA 5CC4A 5ISRA 1SE2A 3H94A 5J39A 4CHTB 2L12A 4KI0A 1V43A 1ENAA 4G7ZC 2K01A 1I4QA 3D4DA 2D5DA 5E4XA 2A5HA 3BDLA 1WTRA 3FVQA 1SNPA 4G7HC 3H09A 1IYUA 1K8MA 4OGQC 2F0KA 2E2HB 4FF1A 4A3IB 5I9OA 2EOTA 4LAAA 1GUOA 4PQXA 3IL8A 2KCCA 2D62A 3EA6A 4M8AA 3M7NA 2KCNA 5JJZA 4RKBA 5C44B 2K04A 2EDGA 4KD3A 4ZKBB 2ENBA 2AWNA 5T1IA 1LV9A 4QIWB 2WIIB 5KEEA 1JICA 1KLGD 3R3OA 5COYA 1EQVA 1ZEQX 3VR6A 1NAPA 1TT2A 2R3ZA 1MGSA 1S5FD 1J8IA 3W2DA 3BVGA 3PV0A 3ZYYX 4L8JA 1DONA 1STHA 3H6MA 1UNSA 2IJ0A 4CJ2C 1Y69U 5DNFA 2FJ2A 2KEEA 5KYLA 1O7ZA 2J7ZA 4BY1B 2H1EA 4ILWA 5I2YA 3WOFA 2EYMA 1PMRA 1WD1A 1TY2A 1II3A 2DN8A 3PUYA 1KTKA 4DU9A 4IZ8A 3D8GA 2OF1A 2F0QA 3PIP3 1TS2A 5LL6S 2R7ZB 1QILA 1LTBD 1TWGB 3KBXA 2SNMA 2M9VA 1OO9B 4R8IA 3GTPB 4O1NA 3GV6A 1MI2A 2Z8LA 3WDNA 1EY9A 4KY7A 4NP5A 2DY7A 1TS5A 1GUSA 1KDAA 1D5ZC 2PW5A 4H13C 2PMZB 4RCNA 4DF7A 1SJHD 4XQJA 1EOTA 3TZDA 2KVMA 3LNNA 1FGBD 1QJOA 2MPMA 3R2IA 4H7BA 5E4WC 2F0LA 1LT4D 1HFGA 2TSSA 3PUZA 2A69D 3S1NB 3D3RA 1FD7D 1TWFB 5CV4A 1G291 1V1PA 2F0DA 1R4QB 2E2DC 1HQMC 1BR9A 2J0TD 1WTWA 3URYA 1CT1D 2B2YC 3QB3A 3GTLB 2RDGA 4C3IB 3FKIB 5IGEA 5FO9B 1HA6A 1FNWA 5FO7B 3HRZC 2EJGC 2G9HD 1SE4A 4NDXA 4ULLA 5JVH3 4BA1I 4QCLA 2YU9B 1U4RA 1DOMA 1A6XA 2EE1A 1DOKA 2N88A 5K36G 3I73A 2NUCA 2WAQB 5FOBB 1TWCB 5ELDA 5EJWA 1PZID 2K6AA 4RH6A 3SEBA 1JOOA 3OPOA 4ZUJA 4TSSA 3AU7A 2VNUD 4IURA 1EL0A 4FF2A 2QKIC 2WKCA 3IKJA 4KJOA 1U4MA 2FFKB 2WINB 1BDOA 2KECA 1UAPA 5M3MB 1SMYC 4L6TB 2A68C 4LK1C 3TP6A 2TMPA 2PPBC 5C3WA 5CV7A 2IX0A 3VA5A 2R61A 4RHSA 2A6EC 1BQQT 1Y8PB 4HN7A 5JOBA 3K57A 2AQ3B 4EVOA 1WVLA 4HEDA 1SEBD 2RDFA 5EKIA 1RTNA 3L7ZC 1TWHB 5CV9A 2K5QA 5EPJA 1WTOA 2BDNA 1B53A 4FNFA 1LT3D 1U9RA 2SDFA 4RFBA 4I65A 4HMIA 4DXGA 1SYCA 3OOCA 2B63B 2HDMA 3J81L 3H0GB 5C3EB 4K2KA 1G91A 1FR3A 1STBA 3P1HA 5IOCA 1E2WA 1L0XB 3MXNA 5EBCA 3D4WA 2K03A 2B8GA 1TKWB 2NTSA 5G3LF 4DNTB 2F0HA 3FPUB 3MC0B 1X32A 3H3VC 5C5LA 3LX0A 4LJZC 4J8QA 2F0WA 2MHVA 4DGZA 2RSNA 5JPMC 2HUGA 4QMGA 1F2ZA 3FMCA 1S5ED 2O5JC 4U68A 5G3LD 3G7LA 2A74C 2F0IA 1PDQA 2B8FA 1Q90A 4I7ZC 3K5NA 1QNUA 5CORA 2B2VA 2EJMA 2XN9C 2PCFB 1AFPA 1NR2A 1Y8OB 1IKLA 3QJYA 3BVMA 3QIAA 1ILQA 4CKBA 2RA4A 2WACA 1DZ1A 1S5CD 1GHKA 1FNVA 5C5MA 4FXGC 3FDTA 2CQAA 3HGBA 3TP7A 1HQRD 3ND8A 2MUYA 2E75C 3IAYA 1KNAA 3I90A 3HS0C 2IT1A 1KDCA 2F1MA 1PFNA 5I2XA 5ELFA 1J9OA 4PMBA 1ZYRC 4WRDA 1VF5C 2NVXB 2A69C 1PTOB 1PTOF 2EYOA 1MSGA 1JR0D 2JSOA 3HOUB 1HTLD 3LWEA 1TR5A 1F9PA 1B9NA 2EXZA 4DK0A 5D14A 2L0CA 1BBXC 4CJ0B 5D65A 5EBDA 1NSNS 4KHZA 2WKDA 3Q22A 3TBIB 5IIFA 4KD4A 3SK8A 3TDQA 4H0LC 1SXTA 3MXPA 2L11A 1V1PB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RAU C;  5COY A;  1F2L A;  1HFG A;  3SVM A;  1U4M A;  2FFK B;  2MJ8 A;  1U4L A;  2KOL A;  3I3C A;  1NAP A;  2HCC A;  1O80 A;  3KUP A;  4HSV A;  1PFB A;  2KEC A;  2R3Z A;  4LMQ D;  4U68 A;  1MGS A;  2RSO A;  1B3A A;  1U4P A;  1DOL A;  2XIW A;  2RVL A;  1RJT A;  1J8I A;  3G7L A;  2Q8T A;  5AFW A;  1WD0 A;  1X3Q A;  1BO0 A;  2L1B A;  1PDQ A;  2MGS A;  3QO2 A;  1AZQ A;  2X6G A;  4NW2 A;  3Q6S A;  2B2V C;  1WTW A;  4CJ1 B;  1A15 A;  4UAI A;  2N55 A;  1F9R A;  2NYZ D;  1O7Y A;  1HUN A;  2K28 A;  1HRJ A;  4HCS A;  2HDL A;  4IUV A;  1EIH A;  4IUT A;  2B2T C;  1BNZ A;  2L4N A;  4X3T A;  4O42 A;  3TN2 A;  3F2U A;  2B2Y C;  1M8A A;  1DON A;  1G6Z A;  1F9Q A;  1QNK A;  1ROD A;  1RHP A;  5COR A;  1AZP A;  2B2V A;  1CM9 A;  3GV3 A;  4ZAI A;  4XDX A;  1C8C A;  1SDF A;  2VXW A;  2FHT A;  1HUM A;  1ESR A;  1WVL A;  1B50 A;  2X6L A;  4HED A;  2B2W C;  1IKM A;  1G2T A;  4CJ2 C;  1NR2 A;  1RTN A;  3N52 A;  5E4W C;  2JP1 A;  1IKL A;  5EKI A;  5T1G A;  3ONA B;  3UI2 A;  3D6W A;  4ZK9 B;  1HA6 A;  2KUM A;  5CMD A;  4ZLT F;  4QUF A;  4IUQ A;  1XYI A;  2FMM A;  1B4O A;  5DNF A;  1GUW A;  2FJ2 A;  1WTX A;  2KEE A;  2CVR A;  1NCV A;  3H91 A;  1ILQ A;  5EPJ A;  2M2L A;  2RA4 A;  1DZ1 A;  1O7Z A;  2L11 A;  4MN3 A;  1WTO A;  2J7Z A;  3DEP A;  2NWG A;  1SAP A;  2BDN A;  2H1E A;  1CA5 A;  1E0B A;  3FDT A;  1B53 A;  4X3S A;  3R93 A;  4RA8 A;  4DN4 M;  5CBA E;  1RTO A;  1EQT A;  4XT1 B;  1VMP A;  1U4R A;  1DOM A;  2B2T A;  1XX8 A;  2SDF A;  3HP3 A;  3IFD A;  4R9W A;  2L12 A;  4ZKC B;  1WD1 A;  1HHV A;  2EE1 A;  1EIG A;  2K01 A;  1ZXT A;  1B2T A;  1DOK A;  2HDM A;  2N88 A;  1PLF A;  3I8Z A;  3MTS A;  3MWY W;  1X3P A;  1VMC A;  1G2S A;  1G91 A;  5E4X A;  4IUP A;  2B2W A;  1QG7 A;  1KNA A;  2K1B A;  3I90 A;  4MHE A;  1WTQ A;  1SSO A;  1WTR A;  4HAE A;  3I91 A;  4IUU A;  1PFN A;  1WTP A;  4QUC A;  2NZ1 D;  2EPB A;  4X3K A;  5EQ0 A;  5EPK A;  4OIK A;  2X69 A;  1J9O A;  3DM1 A;  2IL8 A;  1ILP A;  4RWS C;  1WTV A;  5EPL A;  2D9U A;  2FIN B;  1PFM A;  2L9H A;  1HFN A;  2EOT A;  2JYO A;  2MP1 A;  3KBX A;  2B2U C;  4R8I A;  3GV6 A;  1QE6 A;  1MSG A;  5EJW A;  1IL8 A;  1MI2 A;  1Q3L A;  3IL8 A;  2K03 A;  2KED A;  1AP0 A;  2DY7 A;  1ICW A;  3FPU B;  3LWE A;  1F9P A;  2B2U A;  1X32 A;  5D14 A;  3DEO A;  5JJZ A;  1KNE A;  1BBX C;  4OIJ A;  4IUR A;  3P7J A;  4CJ0 B;  5D65 A;  1EOT A;  1ML0 D;  2K04 A;  1CA6 A;  1EL0 A;  3TZD A;  2K05 A;  4ZKB B;  5CBE E;  1F9S A;  2KVM A;  1BF4 A;  2MPM A;  4X3U A;  2B2Y A;  2DY8 A;  1S4Z A;  2HCI A;  2Q8R E;  5T1I A;  1LV9 A;  2RSN A;  1NR4 A;  1JE4 A;  1JIC A;  2HUG A;  1TVX A;  4XT3 B;  1MSH A; 
#chains in the Genus database with same CATH topology
 5HGT A;  4GLV B;  5LL6 X;  2Q2I A;  1PFB A;  3DUZ A;  2E2I H;  3BDO A;  2F0F A;  1JC7 A;  1O7L A;  4IAL A;  3V05 A;  1CKN B;  2O2L D;  5C4J B;  2D0O A;  3HOY B;  1DD2 A;  3U9S A;  2JE6 I;  1DCZ A;  1TXY A;  4KKU A;  2NN6 G;  2QW7 A;  2X6G A;  4NW2 A;  5K36 H;  2LSS A;  3MFY A;  1HRJ A;  4UDU C;  3TRE A;  1FVI A;  2A68 D;  4YY3 Q;  1K0R A;  4X3T A;  1ENF A;  1N33 L;  1ROD A;  2K5H A;  1F77 A;  1SDF A;  4JI8 L;  4DV7 Q;  4TVA B;  4RKL A;  1K9M C;  1PVO A;  4K2L A;  2I0Q A;  3Q8D A;  4OWX B;  2FXQ A;  2JA5 B;  2NVQ H;  4ZK9 B;  5D3I B;  3J80 E;  1EU3 A;  4A3E B;  3HOW H;  3S15 B;  3QOL A;  1NCV A;  2ALY B;  2VY3 A;  3H91 A;  2QCP X;  3T1Y Q;  1D1I A;  2FMC A;  3NBH B;  4NXM L;  4GNX A;  5IGC A;  5IT9 E;  1Z9F A;  4ME5 A;  2QDL A;  1PZJ D;  5J3B A;  3R93 A;  1TQO A;  2CH4 W;  3S1N H;  1SFO B;  3H3V I;  1BUV T;  1E2Z A;  4B08 A;  1JE5 A;  4IFD I;  1EIG A;  2F52 A;  1QUQ B;  3J7Z C;  1UUP A;  4FF3 A;  1X3P A;  2XWB B;  4R4T A;  3CCR A;  4DV4 Q;  3V96 A;  4BBR H;  5FO8 B;  2E2H H;  2BH8 A;  4N9P A;  2NZ1 D;  4R1J A;  1SNM A;  2UUA Q;  4X3K A;  1MHW C;  1D2B A;  2RHS B;  2LS0 1;  3I4M B;  2JA7 G;  1PH8 A;  4LFC Q;  2JYO A;  4UP7 A;  2DJF C;  3PO2 B;  1D7Q A;  1EUJ A;  3K58 A;  1IHZ A;  2JA5 H;  3CCU A;  1E7Z A;  1BBU A;  3T13 A;  2ZT9 C;  5IP7 H;  2CKZ B;  1JB7 A;  2BOS A;  1A0I A;  1EY6 A;  2K5D A;  5EKK A;  2F3W A;  1GJX A;  4DR5 Q;  5JPN C;  4XYO A;  5GAG C;  4AH6 A;  2NVX H;  4PMW A;  1F9S A;  3L9A X;  2NN6 I;  4DUZ L;  1T5X D;  3NP8 A;  1OXV A;  4CDC C;  4DR2 L;  3GTO B;  3T1H L;  2ICE C;  1GM5 A;  5TSS A;  2F0P A;  1XTD A;  1TVX A;  4XT3 B;  1KHI A;  3IFT A;  1K83 H;  1EYC A;  4B3M Q;  2MO1 A;  3GDE A;  2AQ2 B;  1G8Z D;  3CRK C;  4KKT A;  2VUM H;  4C1N K;  2ZTE A;  1RJT A;  4ID6 A;  1YNN D;  1B9M A;  3H0G G;  3GD7 A;  3MZ5 A;  3A55 A;  1BO0 A;  2F3V A;  2JEB I;  3A74 A;  1NNX A;  4CJ1 B;  2A6H C;  2ZXP A;  4LF5 L;  1VS0 A;  4MTK A;  1CQV A;  1UE7 A;  1EY8 A;  3EFX D;  3ICE A;  1BNZ A;  2L4N A;  4O42 A;  1Q86 C;  3S2H H;  5JAV A;  1IBM Q;  3S24 A;  4LF7 L;  1F9Q A;  3H0G H;  4GLX A;  1G6Z A;  1AZP A;  1B1Z A;  2RCF A;  1C8C A;  1R9T H;  4JK1 C;  2VXW A;  4F87 A;  3CP0 A;  4AQY L;  3G6J B;  1B50 A;  1G2T A;  5T1G A;  2JP1 A;  4IN3 A;  3AB9 A;  3A54 A;  1JOR A;  2FMM A;  4WJW A;  1D1K A;  3NHH A;  4DA2 A;  1RKN A;  3DWP A;  2AQ1 B;  1HCZ A;  3RZD B;  4MN3 A;  3DEP A;  2NVY B;  4DV2 Q;  1HNW L;  4IPC A;  4EGV A;  4QF4 A;  1GUN A;  1MBY A;  1TY0 A;  2B2T A;  1W6J A;  1Y14 B;  2HHH L;  4A3E H;  4JOI C;  3CKI B;  2PNR C;  2E8G A;  3ULJ A;  1EZ6 A;  4AIM A;  1VMC A;  4RG1 A;  1WCM B;  4KLK A;  3HOX H;  3I4L A;  2WFW A;  5KND A;  1HNW Q;  3I91 A;  5IYC G;  4IFD J;  4CBV A;  1AH9 A;  2F03 A;  3AQQ A;  2L5T A;  2X69 A;  2SNS A;  2F0T A;  3OTO Q;  3N6R A;  4BBR G;  4OWW B;  4GS3 A;  2BDO A;  5IOD A;  4RHR A;  1PFS A;  1Q3L A;  1I94 L;  3IRB A;  1SJE D;  4JV5 Q;  4A3C G;  1XWE A;  1SND A;  2EZV A;  2BA0 A;  2VB2 X;  1EYG A;  3DEO A;  2XTI A;  4OIJ A;  4RGM A;  1VQ8 A;  5A2Q E;  3I4O A;  4HCE A;  1XNQ L;  3HOZ G;  3FEW X;  2DY8 A;  4BBS H;  1DM0 B;  2EY2 A;  4YWM A;  1JE4 A;  4A3L G;  2Q8I B;  1JOQ A;  1B8A A;  4ABN A;  4C56 C;  3TQY A;  4A4I A;  2UXB L;  3D6C A;  2EYL A;  3KUP A;  3PO3 B;  3PUV A;  3CCM A;  2G9D A;  3NEL A;  1Z7T A;  4KJN A;  2MFI A;  3T4A C;  4A3D H;  2M00 A;  3HOV H;  2DUD A;  3HKZ G;  5IYD G;  1EFW A;  5KNB A;  2B2V C;  4A3G H;  3RLO A;  2N55 A;  1O7Y A;  1YNJ C;  4A76 A;  4FF4 A;  2CW0 D;  1YVC A;  2KQ3 A;  3MXU A;  3CHB D;  2RF4 A;  2LY7 A;  4L63 B;  3RMH A;  3FPP A;  4XQN A;  3KBG A;  2EYF A;  3PF5 A;  2Q2T A;  1V9P A;  4N8X 1;  4PMC A;  2CW0 C;  2OT2 A;  1I94 Q;  5DEH A;  3HOU G;  3K0X A;  1XYI A;  2AUJ D;  3RLF A;  3R2T A;  4G57 A;  3STB D;  1LAC A;  5C4H A;  5GAH C;  1SFO H;  4R4Q A;  2BE5 C;  1R9T B;  3E0J A;  2AUK A;  3VYT A;  1L1O A;  3G4S A;  2LKV A;  4J15 A;  2JA6 B;  2NVT H;  1VQG A;  5GAD C;  3M4Q A;  1NJI C;  2A1A A;  4J1M A;  2B3G A;  2A6E D;  4A75 A;  3NE5 B;  3EJI A;  4ODG A;  4YCV A;  4GNX B;  1QB5 D;  2B2W A;  2VZA A;  3O13 A;  4YHH Q;  1B70 B;  1CUK A;  4BXX G;  2EPB A;  2F0J A;  5A35 A;  5BN3 A;  2ICI A;  1LT6 D;  3ERO A;  4QJF A;  4NXN L;  2FIN B;  1HFN A;  1E2V A;  1LO5 D;  3T53 B;  2B2U C;  2EY5 A;  3GQB A;  1CQF A;  4JI2 Q;  4P74 A;  4IOA A;  2GN5 A;  2UXD Q;  4GKJ L;  1XMQ L;  1HTP A;  2NN6 H;  2ZXR A;  4K5V A;  4Q0F A;  1NUC A;  2Z4H A;  3BYY B;  4L5S A;  4X65 L;  4B3S L;  2HIV A;  3CU7 A;  3J7Y W;  4LF9 Q;  4A3F G;  2QIL A;  2B2Y A;  1GD7 A;  2P5Z X;  3HZX A;  3K5L A;  1PYW D;  1JB3 A;  5KNC A;  4GKJ Q;  3HFZ B;  1S5B D;  1G6P A;  3KLR A;  4DR4 L;  3GTJ B;  4NMZ A;  1HZB A;  1PTO D;  1LLR D;  2I5H A;  1QZH A;  2F0S A;  1TWG H;  4DV3 Q;  4HIK A;  4LUO A;  3NSW A;  3BYT B;  4CDF C;  2DNE A;  2OQK A;  1ASY A;  1Q46 A;  1VCI A;  2H5X A;  3NPP A;  1KQS A;  4UAI A;  5I6W A;  4KK7 A;  4ZCK A;  1KRT A;  4JCV E;  2HD3 A;  4OWT B;  1Y1W H;  2K5N A;  3U4Z A;  3M9B A;  1HUM A;  1EZ8 A;  1I6V C;  1Z47 A;  2OEO A;  3S17 H;  4QUF A;  3U50 C;  1PH2 A;  3A8I E;  1N8R C;  1VDZ A;  3C2P A;  2E5L L;  4JI3 L;  2M2L A;  5DAU A;  1MIU A;  4JI4 Q;  3HKS A;  1KDB A;  1PYS B;  3A7L A;  5LMN W;  3G48 A;  4XQQ A;  4GKK Q;  5CBA E;  1A2U A;  3H15 A;  1F2M A;  1L0W A;  5BR8 Q;  1PZK D;  1TS4 A;  3OWF A;  3V2T A;  4K14 A;  3MWY W;  4FXD A;  3T51 B;  1C7Y A;  3PIP A;  4XXE A;  4DXF A;  3D0F A;  3UE1 A;  1M90 C;  2NVT B;  4OIK A;  1BKB A;  1FJG L;  5C0X J;  1VQE A;  3CC7 A;  4OXP A;  3P75 A;  1KD1 C;  2ZM6 Q;  1J5E Q;  2D9U A;  2L9H A;  2I5L X;  3I72 A;  4JBM A;  4UP8 A;  1GUG A;  4RMF A;  3TEH B;  4B3R Q;  1LTG D;  1TU2 B;  3KF6 A;  3SXH A;  3NTI A;  4DAM A;  1GUT A;  4C3J G;  4HSP A;  4C3I H;  3LWU A;  1MJE A;  5KYI A;  2F0E A;  4AYB B;  4DR6 Q;  2PZW A;  1YNJ D;  3OWE B;  4K5X A;  2XRS D;  4C3I G;  4JI0 Q;  5ELE A;  2BH2 A;  1SYF A;  1WOC A;  5ELN A;  3UE0 A;  4IFD G;  4DR1 L;  1W2B A;  1TWC H;  1VQP A;  3EVQ A;  3HOU H;  4A3K H;  3TRZ A;  1H9J A;  1SLJ A;  1OXX K;  4YWL A;  5M5Y H;  2GVA A;  4JBK A;  3AEV A;  2BA1 A;  3M4O B;  1LTR D;  4WFN 3;  4A93 B;  4IUN A;  2XRQ D;  2RBM A;  1N34 L;  4C1N I;  4QY7 A;  4IPH A;  1XPU A;  1X3Q A;  4B9W A;  2CFM A;  1VQD A;  4YIJ A;  2KJX A;  1A15 A;  1CSP A;  1EU4 A;  2B29 A;  4HCS A;  2HDL A;  3D31 A;  3F2U A;  1OTC A;  5DM7 3;  1CM9 A;  3CPF A;  2R93 H;  1JJC B;  2FHT A;  5M3F B;  3RUZ A;  2K50 A;  1AW7 A;  2DJG C;  3DWA A;  1ET9 A;  2B39 A;  1X56 A;  3VYR A;  1VQH A;  2OWO A;  3M4O H;  3GTO H;  2F0U A;  5JEA H;  3GTQ B;  2NB0 A;  4OO1 G;  3S14 H;  2N8N A;  4DAP A;  3CXC A;  2NWG A;  3HG9 A;  1PRT D;  1SRO A;  3K7A B;  4N8F A;  1KXL A;  5FLX L;  2ASB A;  1H9R A;  4XTC S;  1ONL A;  4ME3 A;  1PH1 A;  1WI5 A;  1IBK Q;  3HP3 A;  3HKZ B;  1VQ7 A;  3M4Y A;  3VR2 A;  2QGQ A;  3EBE A;  3S2H B;  4H44 C;  4P72 A;  4GOP A;  1HA5 A;  1RCV D;  1DYQ A;  4JBJ A;  1LT5 D;  2R93 B;  4K8I A;  4B3T L;  1QWY A;  3PIO A;  1EIY B;  4IUU A;  1N34 Q;  5EPK A;  5L37 A;  3DM1 A;  1I3Q B;  2LXK A;  3TP5 A;  1BCP F;  1BCP B;  1JQY D;  2K5V A;  3HOZ B;  1I4R A;  2I07 B;  3B6Y A;  2KED A;  2EYJ A;  2Z6B A;  3J81 j;  4JOI A;  4K5W A;  4JC0 A;  3RZD H;  3T16 A;  2UXD L;  4A3M G;  2K05 A;  4WJ3 M;  4IPD A;  1UEA B;  1EFI D;  1ZKO A;  4BXX H;  4PZ6 A;  3ULL A;  5IWA L;  1JCK B;  4JI1 L;  1YNN C;  2E2I B;  4NKL A;  2ZM6 L;  4IFD H;  4Y7N B;  2HCC A;  1Q1B A;  4K0K Q;  4DAV A;  1DOL A;  2XIW A;  1JJG A;  3K59 A;  2DGY A;  3SE0 A;  1VQI A;  3UDG A;  4JPB W;  4X66 Q;  4LUZ A;  5JEA G;  4OO1 H;  3S1Q B;  2K28 A;  1IYV A;  1E1T A;  4ZQ3 A;  1LAB A;  4DV5 Q;  3KJP A;  4C3H G;  1QNK A;  4DV6 Q;  1RHP A;  3GP7 A;  4HJ8 A;  3GV3 A;  1EWH A;  3K5M A;  3DHQ A;  2RHQ B;  1SE3 A;  2OTL A;  1SNQ A;  1HPC A;  2R93 G;  3TME A;  4KHP L;  3AFQ A;  1BOS A;  1GUW A;  3NEM A;  1ESF A;  1JOK A;  4MNO A;  1N32 Q;  1PXU A;  1QOH A;  3HOW B;  3RR5 A;  2VQE L;  1I4H A;  3KDF B;  3S1M B;  2JXM B;  1DJR D;  5C44 H;  3H3V H;  3RZO B;  3UDX A;  2WB1 G;  4DN4 M;  4WJ4 A;  4XT1 B;  1JWS D;  1GO3 E;  2IX1 A;  1EEF D;  3K5O A;  1B7Y B;  2ZJP A;  1N33 Q;  2ATW A;  1BVS A;  5AJ3 Q;  4O0A A;  5FLX E;  1M1K C;  4NPS A;  3NQI A;  5FLM G;  2Q2U A;  1WTP A;  2AWO A;  4OON A;  5EQ0 A;  2SOB A;  1ILP A;  3DWQ A;  1C48 A;  4LWC A;  3CCQ A;  4CKC A;  1JJ2 A;  3JAM c;  1T5E A;  1WTV A;  2YV5 A;  1CHQ D;  2EYP A;  3C1F A;  4BWG B;  1P8L A;  2ZTD A;  3NBH A;  1QE6 A;  2PZU A;  1IL8 A;  3K6O A;  4JI5 L;  3W5O A;  2K4K A;  2IHF A;  4Z9C B;  1EY5 A;  1UE1 A;  1N36 Q;  4GZY C;  3ERQ A;  5EGT A;  2A6H D;  3OSO A;  4R8N A;  3W3A A;  3GTM B;  2VUM B;  5IE8 A;  4YY3 L;  4QL5 A;  5J1Z A;  2QF7 A;  1EY7 A;  1S4Z A;  1SNO A;  3OW7 A;  2AHO B;  3KOJ A;  2PMZ E;  2XWJ B;  5HGQ A;  1PH3 A;  1CFM A;  5I9P A;  3J7A 5;  3A5U A;  3F8T A;  3ULP A;  1O80 A;  4HSV A;  1K83 B;  1NE3 A;  1VQK A;  1B3A A;  1U4P A;  4QB4 A;  5I4D A;  1E22 A;  1HZC A;  2AMC B;  4BY1 H;  2Q8T A;  4C3J B;  1NTG A;  4JG2 A;  4LW1 A;  1CK1 A;  1JMC A;  3QO2 A;  1PH9 A;  1KRS A;  2PI2 A;  1OXS C;  4C3H B;  1C4Q A;  2KHJ A;  2NYZ D;  4JI1 Q;  3I4M G;  1SN8 A;  2B2T C;  2D2C C;  2UUA L;  1GVP A;  1HJP A;  2D0P A;  4H02 A;  2L15 A;  1A3U A;  3I2Z A;  3G6E A;  5C44 G;  1X54 A;  1V1O A;  5CGK A;  3MAQ A;  1CTM A;  3CCE A;  1AE3 A;  3UI2 A;  4ZLT F;  1QVG A;  1OXT A;  5BN4 A;  5M9O A;  4X64 L;  1SYE A;  2CWP A;  1J5E L;  1ZYR D;  3E9I A;  3X3M A;  1FYC A;  3KF8 A;  1SE8 A;  2R7Z G;  5JJK A;  4APV A;  5D3D A;  1XPR A;  3Q0A A;  4EQO A;  4X3S A;  1PV4 A;  2RKS A;  5DM6 3;  2K75 A;  1RTO A;  1RL2 A;  1GKH A;  1H9S B;  4GN5 A;  1XX8 A;  4R9W A;  2KA7 A;  4EQN A;  4DUY Q;  1A2T A;  2ID0 A;  1YHA A;  5E1F A;  2K52 A;  1ICF B;  1W3S A;  1EYA A;  3A0J A;  3TSS A;  2R92 B;  1HHV A;  3JAM L;  1EY0 A;  3KK7 A;  1X55 A;  4CGY B;  5IGB A;  3MTS A;  4PG3 A;  4UY8 C;  4EQP A;  1I5F A;  5J22 A;  2K1B A;  3A8K E;  3S2D B;  2VW9 A;  3M4P A;  1CKN A;  3BZD B;  3PUW A;  3ITP A;  2OCE A;  1S40 A;  1PH6 A;  3NUC A;  5F2D A;  5EPL A;  3S16 B;  4FP5 D;  3TP8 A;  3FKI H;  4DR1 Q;  1DXM A;  2PZT A;  5CV5 A;  5IP7 G;  5NUC A;  5A2Q L;  1VQ6 A;  4BBS B;  3I4N B;  3SDZ A;  3K0Y A;  1VQN A;  5IYD H;  1ICW A;  1Q12 A;  4IQZ A;  5C4X B;  1EQR A;  5C3E G;  1MD2 D;  3PQI A;  5HUR A;  1YJW A;  1KNE A;  4JYA Q;  3DXJ C;  1CZG A;  3P7J A;  2B63 G;  1L0Y B;  3X3N A;  1BF4 A;  2JA8 B;  4F8M A;  2HCI A;  2J4X A;  1YI2 A;  2PQE A;  3NWS A;  3HOV B;  1CHP D;  4AQY Q;  1IW7 D;  4A3J H;  4IJL A;  4RAU C;  2Y0S G;  2JA7 H;  3SVM A;  4GN3 B;  4TRD A;  4B9X A;  1RDP D;  3MFG A;  4DR2 Q;  1A62 A;  5C4Z A;  4AYB G;  4P2C B;  2RSO A;  2UXC Q;  1M4V A;  3NTK A;  2RVL A;  1H9K A;  3CD6 A;  1H95 A;  5AFW A;  3CMA A;  3CCS A;  2L1B A;  2Z1C A;  4HR7 B;  2L55 A;  2EY6 A;  4MZ9 A;  4CDE C;  1B44 D;  2CWA A;  3S16 H;  2C9O A;  1HXY D;  4BBR B;  1X6O A;  1SYD A;  2N78 A;  4JI3 Q;  4OX9 L;  4UP9 A;  3NTH A;  3AMU A;  4ZAI A;  1J6Q A;  4ZRZ A;  1IW7 C;  1D5X C;  1ESR A;  1H9M A;  3SK4 A;  2MO0 A;  3RN2 A;  4KY6 A;  3M7G A;  1STN A;  1LTI D;  4OL7 A;  3N52 A;  2UXB Q;  1IYJ B;  4KHV A;  2K32 A;  1YJ9 A;  3I70 A;  1X3E A;  5CMD A;  4F88 A;  3CC2 A;  1A3T A;  5C0X G;  1JWM D;  1F2Y A;  2CVR A;  1D6E C;  3VR3 A;  1SMY D;  2RQX A;  4LFC L;  4GLA C;  3T56 B;  2PQA B;  1STE A;  4A3J B;  1SAP A;  4A3K B;  1BXT A;  4A3M H;  1VQ5 A;  4EX5 A;  1PRT C;  4P71 A;  1R4P B;  3U9O A;  4BY7 H;  5KGU A;  3ERS X;  5C4X G;  3F2D A;  3M3Y B;  3KDF A;  2A73 B;  4DR4 Q;  1GOZ A;  2A19 A;  3OMG A;  4DNR B;  2E76 C;  2K7V A;  1PHJ A;  2K33 A;  4QUC A;  1PH7 A;  2IWH A;  1SNC A;  3J80 L;  4IPG A;  2Z9H A;  1EY4 A;  3VR5 A;  1E24 A;  4RWS C;  2EY1 A;  3QWN A;  1PFM A;  2JA9 A;  4X62 L;  1YIJ A;  1FNU A;  1VQB A;  5IWA Q;  5K5P A;  5IGG A;  5M5X H;  4J6H A;  3NWT A;  3K80 C;  2ES2 A;  4LF5 Q;  1PRT B;  3PO3 G;  1GXD C;  5E7N A;  5BN5 A;  1PRT F;  4RCO A;  4NXN Q;  4RGO S;  4F7X A;  5LHY 1;  4PZ7 A;  3CQZ B;  2LFN A;  1PYB A;  3EQL C;  4G7O C;  1KAA A;  2F0G A;  2RCN A;  1MSH A;  3A8J E;  2KOL A;  1WCM H;  2JEA I;  5FK9 C;  1I6H B;  2E2J B;  2NZH A;  2RDH A;  3I56 A;  2N49 A;  2GVB A;  3OIQ A;  3SHL A;  3KLS A;  2R7F A;  4FYD A;  1FGU A;  3Q6S A;  4V0B A;  2HQE A;  2JA7 B;  5JJL A;  5E3F A;  4LF8 Q;  1QCB D;  3CAM A;  2ZTC A;  4RGN A;  4IUT A;  3MXN B;  4IO9 A;  2PO4 A;  4KKS A;  3U4V A;  3DM3 A;  2UUC Q;  5M5W B;  2UXC L;  5M5X B;  4A3I H;  1SYG A;  4ZYS A;  5JJI A;  2NVQ B;  1KAW A;  3UDI A;  2F0O A;  3NK9 A;  1Y1W B;  1LTT D;  3D4R A;  4LF6 Q;  3ONA B;  1L1O B;  3CF5 A;  4CKE A;  1XXG A;  2IW3 A;  3A5Z B;  1WTX A;  2HIX A;  2ZXO A;  1RD9 D;  2QDB A;  1WJJ A;  1IZ6 A;  4V19 0;  1GHJ A;  1V8Q A;  3CRL C;  1CA5 A;  3JAM i;  3MEF A;  3VA7 A;  1E0B A;  3S2D H;  2NBF A;  4JI8 Q;  1P16 A;  3VR4 A;  4RA8 A;  1SYB A;  2YTY A;  1PH5 A;  2R7Z H;  1Q8I A;  1EWC A;  1ZXT A;  4A3D B;  1PLF A;  3W1B A;  1G2S A;  3BG3 A;  3Q23 A;  4BA2 I;  1FJG Q;  4A3G B;  2YYZ A;  3KYH C;  2WV6 D;  4RGT A;  1XNR Q;  1L1O C;  3KF8 B;  3GTG B;  2EVB A;  2GA4 B;  1VQL A;  2NTT A;  1LM0 A;  3J7A V;  2MP1 A;  1Q1E A;  1PTO C;  1O78 A;  3J7A F;  3A7A B;  4U67 3;  1IL2 A;  3I4M H;  1NMF A;  1EEI D;  1STG A;  3RZO H;  2F4V Q;  1CSQ A;  4A93 G;  1VQF A;  1G51 A;  4DFA A;  3L3O C;  3OHX C;  3NQT A;  4X6A H;  1CA6 A;  3NEN A;  1BCP D;  4A93 H;  2F0V A;  4JYA L;  1V1P B;  5ELC A;  5C3X A;  3JAM E;  4IUV A;  3WWV A;  1UE6 A;  4BS9 A;  1SBB B;  2F0M A;  2DNC A;  2MJ8 A;  3BVZ A;  4HMJ A;  1EWI A;  2V4D A;  3C46 A;  1S5D D;  2F0N A;  3SK6 A;  5KIX A;  3HEJ A;  1D5M C;  5IGF A;  2WB1 B;  4A3B G;  4DR6 L;  2Z6K C;  1BCP C;  3BDC A;  2BCO A;  1KIX A;  2JA8 G;  3TN2 A;  5M3F H;  1KL9 A;  3HOW G;  1A63 A;  1STA A;  4JI7 Q;  3MEH A;  3MA2 B;  2C5C A;  5EKL A;  1YEZ A;  4N9T A;  1I4P A;  3BJU A;  3SR1 A;  1CZW A;  1B4O A;  4E6I A;  1LTA D;  3QOJ A;  3KLS X;  4OHJ A;  1Y1V B;  4YCU A;  4A3F H;  1IBK L;  1S3O A;  1EYD A;  5ELB A;  1EQQ A;  4B3T Q;  1K8O A;  3HOX B;  3GO5 A;  3I8Z A;  3PUX A;  4KN4 C;  2R6G A;  1SMX A;  1QG7 A;  2Z0S A;  1WTQ A;  2VQE Q;  1IBL Q;  4DR7 Q;  4HAE A;  2Z4I A;  1PA6 A;  1C9O A;  3FHW A;  4OX9 Q;  5I6Y A;  3PIO 3;  2IL8 A;  1B3Q A;  3CCJ A;  5IP9 H;  3PMF A;  2XVS A;  1Y1V G;  3JC6 6;  1UEB A;  4KY5 A;  4A3K G;  1I3Q H;  4IOC A;  4JI4 L;  1ET6 A;  1C0A A;  2O4X A;  2VB3 X;  1ENC A;  1AP0 A;  2WAQ G;  4DR3 L;  3MHB A;  4DV4 L;  1STY A;  4JI7 L;  4JI2 L;  4MIU A;  3VYU A;  3OIP A;  3K7U C;  2IPK D;  1Z6H A;  4Y7N H;  1Y1V H;  1VQM A;  1WTH A;  1Q81 C;  2F4I A;  2JN4 A;  1HH2 P;  1X3G A;  4X3U A;  4DAY A;  2Q8R E;  2O5I C;  1OXU A;  4LFA L;  1NR4 A;  3Q24 A;  4A3B B;  1HR0 L;  3CW2 C;  2R7D A;  4DV1 Q;  4NXM Q;  1N36 L;  1I50 B;  1CI3 M;  4DR5 L;  3S15 H;  4LMQ D;  2EYH A;  3S9W A;  4I7A A;  4LFB L;  3P20 A;  3CCL A;  5IYC H;  1WD0 A;  3HOX G;  2UU9 Q;  3E6Z X;  4XIG S;  1JWU D;  3S1Q H;  1I4X A;  4C2M H;  3VDY A;  4PNY A;  5CR3 A;  4K6L A;  5HY6 A;  2K5W A;  1F9R A;  4DKA C;  4BY7 G;  1SRU A;  3RNU A;  2SEB D;  1LUZ A;  2MQH A;  2KCT A;  3HOV G;  3SK5 A;  5IT9 L;  1BBW A;  1M8A A;  1AN8 A;  5JEA J;  4FVM A;  4BY1 G;  1XMQ Q;  4XDX A;  3DLL A;  1HNX Q;  4HTH A;  2X6L A;  1IKM A;  1WCM G;  2BE5 D;  3D6W A;  1CKM A;  3MXG A;  1XMO Q;  2XSC A;  1Q8K A;  2WP8 J;  5M5Y B;  2EJF C;  4K6D A;  4A3L H;  5CV6 A;  2KHI A;  3FRP B;  1D8L A;  3BZC A;  4M1U B;  3L2P A;  4KN7 C;  5KRU A;  4YHH L;  1VF7 A;  4C2M B;  1TII D;  1VQC A;  1KLU D;  1LTS D;  1EQT A;  1VMP A;  3DMU A;  4Q5V A;  4ZKC B;  3IFD A;  3WOE A;  4JBW A;  3M85 A;  1VQ9 A;  3ND9 A;  2LMC B;  5FKA C;  1B2T A;  1RF2 D;  3K8A A;  4OO1 I;  3FP9 A;  2UUB Q;  4IUP A;  2PYK A;  4MHE A;  1VQO A;  1I4G A;  1SSO A;  3S1R B;  2EXD A;  4K8J A;  5C6A A;  3PO2 G;  2Y0S B;  1AEX A;  3PSI A;  4CDD C;  3AFP A;  4PV1 C;  4WOR A;  1HZA A;  4FXK C;  4DK1 A;  5GRO A;  1N32 L;  1XTC D;  2E2J H;  4K0K L;  4LF6 L;  3S14 B;  4HJ5 A;  2PW7 A;  1QZG A;  1X65 A;  2H4O A;  4A3M B;  4DR7 L;  3RD4 A;  4FO2 A;  1TWA B;  3C1E A;  2B2U A;  5CYU A;  4TQU S;  4UPA A;  2CHB D;  3E5S A;  1HR0 W;  3K7A H;  5IGD A;  1Q7Y C;  1ML0 D;  1TWH H;  1PTO H;  5CBE E;  1X9N A;  4ZUI A;  3TZU A;  4OEL B;  2E74 C;  3SGI A;  5C0X H;  2I46 A;  5C0X I;  3GTJ H;  3J81 E;  4BY7 B;  2EIF A;  2OXP A;  1F2L A;  1Y8N B;  1T9H A;  3VYS A;  2KCM A;  4KMU C;  1U4L A;  3I3C A;  1TS3 A;  5C4J H;  1A3V A;  1KAB A;  2XGT A;  4X65 Q;  4B3S Q;  3PCO B;  1XPO A;  1H9S A;  3T1Y L;  3BS1 A;  3GTK B;  1E1O A;  4KV6 A;  3A56 A;  2QEX A;  2MGS A;  2LXJ A;  2IX3 A;  1AZQ A;  2ZJQ A;  4S3S A;  2OQ0 A;  1HUN A;  1EIH A;  3QG1 A;  4XYQ A;  3OMC A;  5CV8 A;  4G4K A;  4EQ5 A;  4A3F B;  5IP9 G;  3S17 B;  3C3L A;  1ASZ A;  4PZ8 A;  4QIW E;  2B2W C;  4UHV A;  2QEJ C;  4KTA A;  3R8B A;  1W6K A;  3NXW A;  3TS0 A;  2WB1 E;  3MVV A;  2KUM A;  4IUQ A;  2R92 H;  4DUZ Q;  4JV5 L;  3LGJ A;  5JVG 3;  4TKO B;  2XNA C;  2VQF Q;  3GTK H;  1L2F A;  4DV0 Q;  1QUQ A;  2KHS A;  3NBI A;  5CC4 A;  4DK6 C;  5ISR A;  1SE2 A;  3H94 A;  5J39 A;  1K8G A;  4CHT B;  4HID A;  2L12 A;  2IY5 B;  2UUB L;  4KI0 A;  1V43 A;  2YTX A;  1HR0 Q;  1NY4 A;  1ENA A;  4G7Z C;  2K01 A;  4POF A;  1I4Q A;  2JA5 G;  3D4D A;  2D5D A;  3FKI G;  1A8V A;  5E4X A;  1V1Q A;  2A5H A;  2JK8 A;  3BDL A;  3FVQ A;  1WTR A;  2F4V L;  4DK3 C;  3I4N H;  1SNP A;  4G7H C;  2V1C C;  3H09 A;  4GN4 B;  1JT8 A;  1IYU A;  1K8M A;  4OGQ C;  2F0K A;  3PO2 H;  2E2H B;  4FF1 A;  5BR8 L;  4A3I B;  4DV7 L;  5I9O A;  3PO3 H;  2EOT A;  2ZJR A;  2JA8 H;  4LAA A;  1GUO A;  1UWV A;  4PQX A;  4A3C H;  3HOY G;  5FJ8 H;  3IL8 A;  4GOP C;  2KCC A;  2D62 A;  4A3B H;  4R4C A;  3BU2 A;  3EA6 A;  4M8A A;  3M7N A;  2KCN A;  2Y0S E;  1S72 A;  5JJZ A;  3OYY A;  4HIO A;  4RKB A;  5H1S E;  2K04 A;  5C44 B;  2EDG A;  4KD3 A;  4P75 A;  2ENB A;  4ZKB B;  2AWN A;  2JA6 H;  5T1I A;  1LV9 A;  3HOY H;  4QIW B;  1YIT A;  2WII B;  1JIC A;  5KEE A;  1KLG D;  3R3O A;  5COY A;  1EQV A;  1ZEQ X;  3VR6 A;  4YWK A;  1NAP A;  1TT2 A;  2R3Z A;  4A3E G;  1MGS A;  4DAY B;  3KLW A;  1S5F D;  1J8I A;  2NZO A;  3W2D A;  3BVG A;  1QVF A;  5GQO A;  5FLM H;  3PV0 A;  4KHP Q;  2K14 A;  3ZYY X;  5LMN Q;  4AYB E;  4JVZ A;  4L5T A;  4L8J A;  1DON A;  1XNQ Q;  3KFU A;  1STH A;  3H6M A;  4DV3 L;  1UNS A;  2IJ0 A;  3GTM H;  2YU9 H;  4LNQ A;  4CJ2 C;  1Y69 U;  4R4O A;  5DNF A;  2FJ2 A;  5LMN L;  2KEE A;  1DGS A;  5KYL A;  3T1H Q;  3M3Y H;  4JI6 Q;  1O7Z A;  1VQ4 A;  2J7Z A;  4BY1 B;  2H1E A;  3S1R H;  4ILW A;  5I2Y A;  3WOF A;  4JI5 Q;  2EYM A;  1PMR A;  4C3H H;  4DR3 Q;  3EN2 A;  1YZ6 A;  1WD1 A;  3I55 A;  1TY2 A;  1II3 A;  2DN8 A;  3PUY A;  3J80 i;  1KTK A;  4DU9 A;  1VQA A;  4IZ8 A;  3D8G A;  2OF1 A;  5IT9 c;  2F0Q A;  4P73 A;  3PIP 3;  1EIF A;  1IBL L;  1TS2 A;  1IXR A;  5LL6 S;  2E5L Q;  2R7Z B;  1QIL A;  1LTB D;  4A3I G;  3CC4 A;  1TWG B;  3KBX A;  2SNM A;  2M9V A;  5C3E H;  1OO9 B;  3OTO L;  4R8I A;  3GTP B;  4O1N A;  3GV6 A;  1MI2 A;  2VL6 A;  2Z8L A;  3WDN A;  1EY9 A;  4KY7 A;  4A3G G;  4NP5 A;  1AE2 A;  2DY7 A;  1TS5 A;  1GUS A;  1KDA A;  1D5Z C;  2PW5 A;  4H13 C;  5FLX c;  2PMZ B;  4RCN A;  4DF7 A;  4A3D G;  2Q2H A;  1SJH D;  4XQJ A;  1EOT A;  3AYH B;  3TZD A;  2KVM A;  3LNN A;  1FGB D;  1QJO A;  2MPM A;  3R2I A;  3J81 c;  1K8A C;  4H7B A;  5E4W C;  2F0L A;  1LT4 D;  1HFG A;  4DV0 L;  2TSS A;  3PUZ A;  2A69 D;  3S1N B;  3D3R A;  1FD7 D;  1TWF B;  5CV4 A;  1G29 1;  1HNX L;  1V1P A;  2F3I A;  2F0D A;  4ALP A;  1R4Q B;  2E2D C;  1HQM C;  4DPG A;  2QA4 A;  1BR9 A;  2J0T D;  1WTW A;  3URY A;  5FJ8 G;  1CT1 D;  2WAQ E;  1U0L A;  4LF4 Q;  2HQL A;  2B2Y C;  3QB3 A;  3GTL B;  3EIV A;  4HJ9 A;  2AKW B;  2NVY H;  2RDG A;  4C3I B;  3RLN A;  1HNZ L;  3FKI B;  5IGE A;  4DUY L;  5FO9 B;  2VQF L;  1HA6 A;  1FNW A;  3I4N G;  5FO7 B;  3HRZ C;  4YCW A;  4LUV A;  1VQJ A;  2EJG C;  2G9H D;  1SE4 A;  4NDX A;  4FDB A;  2YTV A;  4L5R C;  4ULL A;  4X64 Q;  5JVH 3;  4BA1 I;  4QCL A;  4JI0 L;  5EAY A;  2YU9 B;  1U4R A;  1DOM A;  3QR8 A;  1A6X A;  2EE1 A;  2UU9 L;  1Q82 C;  1DOK A;  3GTL H;  2N88 A;  5K36 G;  3I73 A;  1CKO A;  2NUC A;  3OW2 A;  2A8V A;  2WAQ B;  3CCV A;  2R92 G;  4DNI A;  1NBW A;  1EOV A;  5FOB B;  1TWC B;  5ELD A;  2JA6 G;  4LF9 L;  4POG A;  1RIP A;  5EJW A;  1LYL A;  5AJ3 L;  1WYD A;  2EQS A;  1PZI D;  5LMU Q;  1XMO L;  4LF7 Q;  2K6A A;  3E9H A;  5M3M G;  3CPW A;  4RH6 A;  3SEB A;  1JOO A;  3OPO A;  3GTQ H;  4ZUJ A;  4TSS A;  3AU7 A;  2VNU D;  4IUR A;  4JW0 A;  1YNX A;  4HJA A;  4GKK L;  1EL0 A;  2I5M X;  3KF6 B;  4FF2 A;  3GTP H;  1K73 C;  2QKI C;  3W1G A;  2WKC A;  4MTN A;  3IKJ A;  3ZJY C;  4A3J G;  4KJO A;  1U4M A;  2FFK B;  2WIN B;  1BDO A;  4IJH A;  2KEC A;  3PGZ A;  1UAP A;  2KEN A;  2B63 H;  5M3M B;  1YHQ A;  1SMY C;  4L6T B;  2A68 C;  4LK1 C;  4LF8 L;  1E3P A;  3TP6 A;  1TWA H;  3E3X A;  2TMP A;  2PPB C;  4DV1 L;  5C3W A;  5CV7 A;  2IX0 A;  3VA5 A;  4HIM A;  2R61 A;  4RHS A;  4B3M L;  2A6E C;  3I7F A;  5ELO A;  3RN5 A;  1BQQ T;  1TWF H;  4R4I A;  1Y8P B;  4HN7 A;  5JOB A;  3K57 A;  2AQ3 B;  4EVO A;  1WVL A;  4HED A;  1SEB D;  2RDF A;  5EKI A;  1RTN A;  1YBY A;  3L7Z C;  1TWH B;  5CV9 A;  5M3F G;  1K3R A;  4DV2 L;  2K5Q A;  1I6H H;  5EPJ A;  1KC8 C;  4BBS G;  1WTO A;  3HOZ H;  1MJC A;  1O7I A;  2BDN A;  2CQO A;  1B53 A;  2PQA A;  4FNF A;  1LT3 D;  4X66 L;  1FL0 A;  4O2D A;  1U5K A;  1U9R A;  1K3B C;  2SDF A;  4RFB A;  4I65 A;  4HMI A;  4DXG A;  3OOC A;  1SYC A;  2Z6K A;  2B63 B;  3G71 A;  4X62 Q;  4HJ7 A;  2HDM A;  3J81 L;  3H0G B;  5C3E B;  4K2K A;  1G91 A;  4QGU A;  1FR3 A;  1STB A;  2HT1 A;  4QQB X;  5IYB H;  3P1H A;  5IOC A;  2PNH A;  1X3F A;  1E2W A;  3BZK A;  1L0X B;  3MXN A;  5EBC A;  3K81 C;  1XNR L;  3D4W A;  3HKZ E;  2N3S A;  3F1Z A;  4LF4 L;  5C4X H;  2K03 A;  2B8G A;  5M5W H;  1TKW B;  2NTS A;  5G3L F;  4DNT B;  2F0H A;  3FPU B;  3MC0 B;  1PH4 A;  1LTL A;  1X32 A;  3H3V C;  5C5L A;  3LX0 A;  4NB3 A;  3S1M H;  4LJZ C;  2CCZ A;  4J8Q A;  2F0W A;  2MHV A;  5GAE C;  4DGZ A;  3F2C A;  3KJO A;  2UUC L;  2RSN A;  1I50 H;  5JPM C;  2HUG A;  4QMG A;  5IY0 A;  1F2Z A;  2JJQ A;  3FMC A;  3GTG H;  1S5E D;  2O5J C;  5DLQ E;  4U68 A;  5IYB G;  3L0O A;  2HHH Q;  4JI6 L;  5G3L D;  3G7L A;  1Y1W G;  2A74 C;  2F0I A;  1PDQ A;  3E0E A;  2B8F A;  3CME A;  4DV5 L;  4DV6 L;  1Q90 A;  4I7Z C;  2CH4 A;  3K5N A;  1K28 A;  1QNU A;  4GOP B;  2PI2 E;  5COR A;  4Y52 H;  2B2V A;  2C35 B;  1UE5 A;  2EJM A;  3J80 c;  2XN9 C;  2VUM G;  2PCF B;  1AFP A;  1NR2 A;  1Y8O B;  1IKL A;  3QJY A;  3BVM A;  3QIA A;  1ILQ A;  4CKB A;  2RA4 A;  2JQO A;  2WAC A;  3PF4 A;  2OTJ A;  1S5C D;  1DZ1 A;  1GHK A;  1FNV A;  5C5M A;  3UDF A;  1XJV A;  4FXG C;  1MKH A;  3FDT A;  3TS2 A;  2KBN A;  1YHB A;  2CQA A;  3HGB A;  3TP7 A;  1HQR D;  3ND8 A;  2MUY A;  2E75 C;  3IAY A;  4B3R L;  3ER0 A;  1KNA A;  3I90 A;  3HS0 C;  4OEM B;  2IT1 A;  1KDC A;  2F1M A;  1PFN A;  5I2X A;  3F2B A;  5ELF A;  2IHE A;  1IBM L;  1J9O A;  4PMB A;  3J81 i;  1ZYR C;  4WRD A;  1WFQ A;  1VF5 C;  2NVX B;  4GNX C;  2A69 C;  1PTO B;  1HNZ Q;  1PTO F;  2EYO A;  4LFB Q;  1NMG A;  1MSG A;  4C3J H;  1K0S A;  1JR0 D;  1YJN A;  2JSO A;  3HOU B;  1HTL D;  3LWE A;  1TR5 A;  1F9P A;  1B9N A;  2EXZ A;  4DK0 A;  5LMU L;  1QVC A;  3U58 A;  5D14 A;  2L0C A;  1BBX C;  3STB C;  3CQZ H;  4LFA Q;  5EBD A;  5D65 A;  4CJ0 B;  1NSN S;  4KHZ A;  5M3M H;  2WKD A;  2VS1 A;  3Q22 A;  1HZ9 A;  3TBI B;  5IIF A;  1SR3 A;  4KD4 A;  3SK8 A;  2MNA A;  3TDQ A;  4H0L C;  4L5Q A;  1SXT A;  1N9W A;  2L11 A;  3MXP A;  2G5D A; 
#chains in the Genus database with same CATH homology
 5HGT A;  5LL6 X;  1PFB A;  3DUZ A;  3BDO A;  2F0F A;  1JC7 A;  1O7L A;  4IAL A;  3V05 A;  2O2L D;  5C4J B;  1DD2 A;  3HOY B;  3U9S A;  2JE6 I;  1DCZ A;  4KKU A;  2NN6 G;  2X6G A;  4NW2 A;  5K36 H;  3MFY A;  1HRJ A;  4UDU C;  2A68 D;  4X3T A;  1ENF A;  1ROD A;  1F77 A;  1SDF A;  4RKL A;  4K2L A;  2JA5 B;  4ZK9 B;  5D3I B;  3J80 E;  1EU3 A;  4A3E B;  3S15 B;  3QOL A;  1NCV A;  3H91 A;  2QCP X;  1D1I A;  2FMC A;  5IGC A;  5IT9 E;  4ME5 A;  1PZJ D;  3R93 A;  1TQO A;  1SFO B;  1BUV T;  1E2Z A;  4B08 A;  4IFD I;  1EIG A;  1UUP A;  4FF3 A;  1X3P A;  2XWB B;  3V96 A;  5FO8 B;  4N9P A;  2NZ1 D;  1SNM A;  4X3K A;  1D2B A;  2LS0 1;  3I4M B;  2JYO A;  3PO2 B;  3K58 A;  1IHZ A;  3T13 A;  2ZT9 C;  2BOS A;  1EY6 A;  2K5D A;  5EKK A;  2F3W A;  1GJX A;  5JPN C;  4XYO A;  4PMW A;  1F9S A;  3L9A X;  2NN6 I;  1T5X D;  3NP8 A;  1OXV A;  3GTO B;  2ICE C;  5TSS A;  2F0P A;  1TVX A;  4XT3 B;  3IFT A;  1EYC A;  2AQ2 B;  1G8Z D;  3CRK C;  4KKT A;  4C1N K;  1RJT A;  4ID6 A;  1YNN D;  1B9M A;  3MZ5 A;  3GD7 A;  3A55 A;  1BO0 A;  2F3V A;  2JEB I;  4CJ1 B;  2A6H C;  2ZXP A;  1CQV A;  1EY8 A;  3EFX D;  1BNZ A;  2L4N A;  4O42 A;  5JAV A;  1G6Z A;  1F9Q A;  1AZP A;  1B1Z A;  1C8C A;  4JK1 C;  2VXW A;  4F87 A;  3G6J B;  1B50 A;  1G2T A;  5T1G A;  2JP1 A;  4IN3 A;  3AB9 A;  3A54 A;  1JOR A;  2FMM A;  4WJW A;  1D1K A;  3NHH A;  4DA2 A;  1RKN A;  3DWP A;  2AQ1 B;  1HCZ A;  3RZD B;  4MN3 A;  3DEP A;  2NVY B;  4EGV A;  4QF4 A;  1GUN A;  1MBY A;  1TY0 A;  2B2T A;  1W6J A;  3CKI B;  2PNR C;  1EZ6 A;  1VMC A;  1WCM B;  3I4L A;  5KND A;  3I91 A;  4IFD J;  4CBV A;  2F03 A;  2L5T A;  2X69 A;  2SNS A;  2F0T A;  3N6R A;  2BDO A;  5IOD A;  4RHR A;  1Q3L A;  1SJE D;  1XWE A;  1SND A;  2EZV A;  2BA0 A;  2VB2 X;  3DEO A;  4RGM A;  4OIJ A;  5A2Q E;  4HCE A;  3FEW X;  2DY8 A;  1DM0 B;  2EY2 A;  1JE4 A;  2Q8I B;  1JOQ A;  4ABN A;  4C56 C;  3D6C A;  2EYL A;  3KUP A;  3PO3 B;  3PUV A;  2G9D A;  1Z7T A;  4KJN A;  3T4A C;  2M00 A;  5KNB A;  2B2V C;  2N55 A;  1O7Y A;  1YNJ C;  4FF4 A;  2CW0 D;  2KQ3 A;  3MXU A;  3CHB D;  4L63 B;  2LY7 A;  3RMH A;  3FPP A;  4XQN A;  3KBG A;  2EYF A;  4PMC A;  2CW0 C;  2OT2 A;  5DEH A;  1XYI A;  2AUJ D;  3RLF A;  3R2T A;  4G57 A;  1LAC A;  5C4H A;  2BE5 C;  1R9T B;  3E0J A;  2AUK A;  3VYT A;  2LKV A;  2JA6 B;  4J1M A;  2A6E D;  3NE5 B;  3EJI A;  4ODG A;  1QB5 D;  2B2W A;  3O13 A;  2EPB A;  2F0J A;  5BN3 A;  5A35 A;  2ICI A;  1LT6 D;  3ERO A;  2FIN B;  1HFN A;  1E2V A;  1LO5 D;  3T53 B;  2B2U C;  2EY5 A;  3GQB A;  1CQF A;  1HTP A;  2NN6 H;  2ZXR A;  4K5V A;  4Q0F A;  1NUC A;  2Z4H A;  3BYY B;  3CU7 A;  3J7Y W;  2QIL A;  2B2Y A;  3HZX A;  3K5L A;  1PYW D;  1JB3 A;  5KNC A;  1S5B D;  3KLR A;  3GTJ B;  4NMZ A;  1PTO D;  1LLR D;  2F0S A;  3NSW A;  3BYT B;  2DNE A;  1VCI A;  3NPP A;  4UAI A;  5I6W A;  4KK7 A;  1HUM A;  1EZ8 A;  1I6V C;  1Z47 A;  2OEO A;  4QUF A;  3A8I E;  1VDZ A;  3C2P A;  2M2L A;  5DAU A;  1KDB A;  3A7L A;  4XQQ A;  5CBA E;  1A2U A;  1F2M A;  1PZK D;  1TS4 A;  3OWF A;  3V2T A;  4K14 A;  3MWY W;  4FXD A;  3T51 B;  4XXE A;  4DXF A;  2NVT B;  4OIK A;  5C0X J;  3P75 A;  2D9U A;  2L9H A;  3I72 A;  1GUG A;  1LTG D;  1TU2 B;  3SXH A;  3NTI A;  1GUT A;  4C3J G;  4HSP A;  3LWU A;  5KYI A;  2F0E A;  4AYB B;  2PZW A;  1YNJ D;  3OWE B;  4K5X A;  2XRS D;  4C3I G;  5ELE A;  1SYF A;  4IFD G;  3EVQ A;  1H9J A;  1OXX K;  2BA1 A;  3M4O B;  1LTR D;  4WFN 3;  4A93 B;  4IUN A;  2XRQ D;  2RBM A;  4C1N I;  1X3Q A;  4B9W A;  4YIJ A;  2KJX A;  1A15 A;  1EU4 A;  4HCS A;  2HDL A;  3D31 A;  3F2U A;  5DM7 3;  1CM9 A;  2FHT A;  5M3F B;  3RUZ A;  1AW7 A;  3DWA A;  1ET9 A;  2B39 A;  3VYR A;  2F0U A;  5JEA H;  3GTQ B;  2NB0 A;  4OO1 G;  4DAP A;  2NWG A;  3HG9 A;  1PRT D;  3K7A B;  5FLX L;  1H9R A;  4XTC S;  1ONL A;  3HP3 A;  3HKZ B;  3M4Y A;  3VR2 A;  3S2H B;  4H44 C;  1HA5 A;  1RCV D;  1DYQ A;  1LT5 D;  2R93 B;  4K8I A;  1QWY A;  4IUU A;  5EPK A;  3DM1 A;  1I3Q B;  3TP5 A;  1BCP F;  1BCP B;  1JQY D;  3HOZ B;  1I4R A;  2I07 B;  2KED A;  2EYJ A;  4K5W A;  3T16 A;  2K05 A;  1UEA B;  1EFI D;  1ZKO A;  1JCK B;  1YNN C;  2E2I B;  4NKL A;  4IFD H;  4Y7N B;  2HCC A;  1Q1B A;  4DAV A;  1DOL A;  2XIW A;  3K59 A;  3SE0 A;  5JEA G;  4OO1 H;  3S1Q B;  2K28 A;  1IYV A;  4ZQ3 A;  1LAB A;  4C3H G;  1QNK A;  1RHP A;  3GP7 A;  3GV3 A;  1EWH A;  3K5M A;  3DHQ A;  1SE3 A;  1SNQ A;  1HPC A;  3TME A;  1BOS A;  1GUW A;  1ESF A;  1JOK A;  1PXU A;  1QOH A;  3HOW B;  1I4H A;  3S1M B;  2JXM B;  1DJR D;  3RZO B;  4DN4 M;  4XT1 B;  1JWS D;  2IX1 A;  1EEF D;  3K5O A;  5FLX E;  3NQI A;  1WTP A;  2AWO A;  5EQ0 A;  2SOB A;  1ILP A;  3DWQ A;  1C48 A;  4CKC A;  1T5E A;  1WTV A;  1CHQ D;  2EYP A;  3C1F A;  4BWG B;  3NBH A;  1QE6 A;  2PZU A;  1IL8 A;  3K6O A;  4Z9C B;  1EY5 A;  4GZY C;  3ERQ A;  5EGT A;  2A6H D;  3OSO A;  4R8N A;  3W3A A;  3GTM B;  2VUM B;  5J1Z A;  2QF7 A;  1EY7 A;  1S4Z A;  1SNO A;  3OW7 A;  2XWJ B;  1CFM A;  5I9P A;  1O80 A;  4HSV A;  1K83 B;  1B3A A;  1U4P A;  4QB4 A;  5I4D A;  2Q8T A;  4C3J B;  1CK1 A;  3QO2 A;  4C3H B;  1OXS C;  1C4Q A;  2NYZ D;  2B2T C;  2D2C C;  1A3U A;  1V1O A;  5CGK A;  3MAQ A;  1CTM A;  3UI2 A;  4ZLT F;  1OXT A;  5BN4 A;  5M9O A;  1SYE A;  1ZYR D;  3X3M A;  1FYC A;  3KF8 A;  5D3D A;  3Q0A A;  4EQO A;  4X3S A;  5DM6 3;  2RKS A;  1RTO A;  1H9S B;  4R9W A;  1XX8 A;  2KA7 A;  4EQN A;  1A2T A;  2ID0 A;  5E1F A;  3TSS A;  2R92 B;  1EYA A;  1HHV A;  3JAM L;  1EY0 A;  3KK7 A;  4CGY B;  5IGB A;  3MTS A;  4EQP A;  5J22 A;  2K1B A;  3A8K E;  3S2D B;  3BZD B;  3PUW A;  3ITP A;  3NUC A;  5F2D A;  5EPL A;  3S16 B;  4FP5 D;  3TP8 A;  1DXM A;  2PZT A;  5CV5 A;  5A2Q L;  5NUC A;  4BBS B;  3I4N B;  3SDZ A;  3K0Y A;  1ICW A;  1Q12 A;  4IQZ A;  5C4X B;  1MD2 D;  5HUR A;  1KNE A;  3DXJ C;  1CZG A;  3P7J A;  1L0Y B;  3X3N A;  1BF4 A;  2JA8 B;  4F8M A;  2HCI A;  2J4X A;  2PQE A;  3NWS A;  3HOV B;  1CHP D;  1IW7 D;  4RAU C;  3SVM A;  4B9X A;  4TRD A;  1RDP D;  3MFG A;  5C4Z A;  4P2C B;  2RSO A;  1M4V A;  3NTK A;  2RVL A;  1H9K A;  5AFW A;  2L1B A;  2Z1C A;  4HR7 B;  2L55 A;  2EY6 A;  1B44 D;  2C9O A;  1HXY D;  4BBR B;  1SYD A;  3NTH A;  3AMU A;  4ZAI A;  4ZRZ A;  1IW7 C;  1D5X C;  1ESR A;  1H9M A;  3SK4 A;  4KY6 A;  3M7G A;  1STN A;  1LTI D;  4OL7 A;  3N52 A;  4KHV A;  2K32 A;  3I70 A;  5CMD A;  4F88 A;  1A3T A;  5C0X G;  1JWM D;  1F2Y A;  2CVR A;  1D6E C;  3VR3 A;  1SMY D;  2RQX A;  3T56 B;  1STE A;  4A3J B;  1SAP A;  4A3K B;  1BXT A;  1PRT C;  1R4P B;  3U9O A;  5KGU A;  3M3Y B;  2A73 B;  1GOZ A;  3OMG A;  4DNR B;  2E76 C;  2K7V A;  2K33 A;  4QUC A;  2IWH A;  1SNC A;  3J80 L;  1EY4 A;  3VR5 A;  4RWS C;  2EY1 A;  3QWN A;  1PFM A;  1FNU A;  5K5P A;  5IGG A;  4J6H A;  3NWT A;  1PRT B;  1GXD C;  5BN5 A;  1PRT F;  4RCO A;  5LHY 1;  4RGO S;  4F7X A;  3CQZ B;  2LFN A;  3EQL C;  4G7O C;  1KAA A;  2F0G A;  1MSH A;  3A8J E;  2KOL A;  2JEA I;  5FK9 C;  1I6H B;  2E2J B;  2RDH A;  3OIQ A;  3SHL A;  3KLS A;  4FYD A;  3Q6S A;  4V0B A;  2HQE A;  2JA7 B;  5E3F A;  1QCB D;  4RGN A;  4IUT A;  2PO4 A;  4KKS A;  5M5W B;  5M5X B;  1SYG A;  4ZYS A;  2NVQ B;  2F0O A;  3NK9 A;  1Y1W B;  1LTT D;  3D4R A;  3ONA B;  4CKE A;  1XXG A;  2IW3 A;  1WTX A;  2ZXO A;  1RD9 D;  2QDB A;  4V19 0;  1GHJ A;  1V8Q A;  3CRL C;  1CA5 A;  3VA7 A;  1E0B A;  2NBF A;  3VR4 A;  4RA8 A;  1SYB A;  1Q8I A;  1EWC A;  1ZXT A;  4A3D B;  1PLF A;  1G2S A;  3BG3 A;  3Q23 A;  4BA2 I;  4A3G B;  2YYZ A;  2WV6 D;  4RGT A;  3GTG B;  2EVB A;  2GA4 B;  2NTT A;  3J7A V;  2MP1 A;  1Q1E A;  1PTO C;  1O78 A;  3J7A F;  3A7A B;  4U67 3;  1EEI D;  1STG A;  4DFA A;  3L3O C;  3OHX C;  3NQT A;  1CA6 A;  1BCP D;  2F0V A;  5ELC A;  5C3X A;  3JAM E;  4IUV A;  4BS9 A;  1SBB B;  2F0M A;  2DNC A;  2MJ8 A;  3BVZ A;  4HMJ A;  2V4D A;  3C46 A;  1S5D D;  2F0N A;  3SK6 A;  5KIX A;  3HEJ A;  1D5M C;  5IGF A;  2WB1 B;  1BCP C;  3BDC A;  2BCO A;  3TN2 A;  1STA A;  3MEH A;  3MA2 B;  2C5C A;  5EKL A;  4N9T A;  1I4P A;  3SR1 A;  1CZW A;  1B4O A;  4E6I A;  1LTA D;  3QOJ A;  3KLS X;  4OHJ A;  1Y1V B;  1EYD A;  5ELB A;  1K8O A;  3HOX B;  3GO5 A;  3I8Z A;  3PUX A;  4KN4 C;  2R6G A;  1QG7 A;  1WTQ A;  4HAE A;  2Z4I A;  5I6Y A;  3PIO 3;  2IL8 A;  3PMF A;  2XVS A;  4KY5 A;  1ET6 A;  2O4X A;  2VB3 X;  1ENC A;  1AP0 A;  3MHB A;  1STY A;  4MIU A;  3VYU A;  3OIP A;  2IPK D;  1Z6H A;  2F4I A;  4X3U A;  4DAY A;  2Q8R E;  2O5I C;  1OXU A;  1NR4 A;  3Q24 A;  4A3B B;  1I50 B;  1CI3 M;  4LMQ D;  2EYH A;  3S9W A;  3P20 A;  1WD0 A;  3E6Z X;  4XIG S;  1JWU D;  1I4X A;  4PNY A;  5CR3 A;  4K6L A;  2K5W A;  1F9R A;  2SEB D;  3SK5 A;  5IT9 L;  1M8A A;  1AN8 A;  5JEA J;  4FVM A;  4XDX A;  4HTH A;  2X6L A;  1IKM A;  2BE5 D;  3D6W A;  3MXG A;  2XSC A;  2WP8 J;  5M5Y B;  2EJF C;  4K6D A;  5CV6 A;  3FRP B;  4M1U B;  4KN7 C;  5KRU A;  1VF7 A;  4C2M B;  1TII D;  1KLU D;  1LTS D;  1EQT A;  4Q5V A;  1VMP A;  3DMU A;  4ZKC B;  3IFD A;  3WOE A;  4JBW A;  3M85 A;  3ND9 A;  2LMC B;  5FKA C;  1B2T A;  1RF2 D;  4OO1 I;  4IUP A;  2PYK A;  4MHE A;  1I4G A;  1SSO A;  3S1R B;  4K8J A;  5C6A A;  2Y0S B;  1AEX A;  4PV1 C;  4WOR A;  4FXK C;  4DK1 A;  1XTC D;  3S14 B;  2PW7 A;  2H4O A;  4A3M B;  3RD4 A;  4FO2 A;  1TWA B;  3C1E A;  2B2U A;  5CYU A;  4TQU S;  2CHB D;  3E5S A;  5IGD A;  1ML0 D;  1PTO H;  5CBE E;  4ZUI A;  3TZU A;  2E74 C;  5C0X H;  2I46 A;  5C0X I;  3J81 E;  4BY7 B;  2OXP A;  1F2L A;  1Y8N B;  3VYS A;  4KMU C;  1U4L A;  3I3C A;  1TS3 A;  1A3V A;  1KAB A;  1H9S A;  3BS1 A;  3GTK B;  4KV6 A;  3A56 A;  2MGS A;  2IX3 A;  1AZQ A;  4S3S A;  1HUN A;  1EIH A;  3QG1 A;  4XYQ A;  3OMC A;  5CV8 A;  4G4K A;  4A3F B;  3S17 B;  3C3L A;  2B2W C;  2QEJ C;  4KTA A;  3R8B A;  1W6K A;  3NXW A;  3MVV A;  2KUM A;  4IUQ A;  5JVG 3;  4TKO B;  2XNA C;  2KHS A;  3NBI A;  5CC4 A;  5ISR A;  1SE2 A;  3H94 A;  5J39 A;  4CHT B;  2L12 A;  4KI0 A;  1V43 A;  1ENA A;  4G7Z C;  2K01 A;  1I4Q A;  3D4D A;  2D5D A;  5E4X A;  2A5H A;  3BDL A;  1WTR A;  3FVQ A;  1SNP A;  4G7H C;  3H09 A;  1IYU A;  1K8M A;  4OGQ C;  2F0K A;  2E2H B;  4FF1 A;  4A3I B;  5I9O A;  2EOT A;  4LAA A;  1GUO A;  4PQX A;  3IL8 A;  2KCC A;  2D62 A;  3EA6 A;  4M8A A;  3M7N A;  2KCN A;  5JJZ A;  4RKB A;  5C44 B;  2K04 A;  2EDG A;  4KD3 A;  4ZKB B;  2ENB A;  2AWN A;  5T1I A;  1LV9 A;  4QIW B;  2WII B;  5KEE A;  1JIC A;  1KLG D;  3R3O A;  5COY A;  1EQV A;  1ZEQ X;  3VR6 A;  1NAP A;  1TT2 A;  2R3Z A;  1MGS A;  1S5F D;  1J8I A;  3W2D A;  3BVG A;  3PV0 A;  3ZYY X;  4L8J A;  1DON A;  1STH A;  3H6M A;  1UNS A;  2IJ0 A;  4CJ2 C;  1Y69 U;  5DNF A;  2FJ2 A;  2KEE A;  5KYL A;  1O7Z A;  2J7Z A;  4BY1 B;  2H1E A;  4ILW A;  5I2Y A;  3WOF A;  2EYM A;  1PMR A;  1WD1 A;  1TY2 A;  1II3 A;  2DN8 A;  3PUY A;  1KTK A;  4DU9 A;  4IZ8 A;  3D8G A;  2OF1 A;  2F0Q A;  3PIP 3;  1TS2 A;  5LL6 S;  2R7Z B;  1QIL A;  1LTB D;  1TWG B;  3KBX A;  2SNM A;  2M9V A;  1OO9 B;  4R8I A;  3GTP B;  4O1N A;  3GV6 A;  1MI2 A;  2Z8L A;  3WDN A;  1EY9 A;  4KY7 A;  4NP5 A;  2DY7 A;  1TS5 A;  1GUS A;  1KDA A;  1D5Z C;  2PW5 A;  4H13 C;  2PMZ B;  4RCN A;  4DF7 A;  1SJH D;  4XQJ A;  1EOT A;  3TZD A;  2KVM A;  3LNN A;  1FGB D;  1QJO A;  2MPM A;  3R2I A;  4H7B A;  5E4W C;  2F0L A;  1LT4 D;  1HFG A;  2TSS A;  3PUZ A;  2A69 D;  3S1N B;  3D3R A;  1FD7 D;  1TWF B;  5CV4 A;  1G29 1;  1V1P A;  2F0D A;  1R4Q B;  2E2D C;  1HQM C;  1BR9 A;  2J0T D;  1WTW A;  3URY A;  1CT1 D;  2B2Y C;  3QB3 A;  3GTL B;  2RDG A;  4C3I B;  3FKI B;  5IGE A;  5FO9 B;  1HA6 A;  1FNW A;  5FO7 B;  3HRZ C;  2EJG C;  2G9H D;  1SE4 A;  4NDX A;  4ULL A;  5JVH 3;  4BA1 I;  4QCL A;  2YU9 B;  1U4R A;  1DOM A;  1A6X A;  2EE1 A;  1DOK A;  2N88 A;  5K36 G;  3I73 A;  2NUC A;  2WAQ B;  5FOB B;  1TWC B;  5ELD A;  5EJW A;  1PZI D;  2K6A A;  4RH6 A;  3SEB A;  1JOO A;  3OPO A;  4ZUJ A;  4TSS A;  3AU7 A;  2VNU D;  4IUR A;  1EL0 A;  4FF2 A;  2QKI C;  2WKC A;  3IKJ A;  4KJO A;  1U4M A;  2FFK B;  2WIN B;  1BDO A;  2KEC A;  1UAP A;  5M3M B;  1SMY C;  4L6T B;  2A68 C;  4LK1 C;  3TP6 A;  2TMP A;  2PPB C;  5C3W A;  5CV7 A;  2IX0 A;  3VA5 A;  2R61 A;  4RHS A;  2A6E C;  1BQQ T;  1Y8P B;  4HN7 A;  5JOB A;  3K57 A;  2AQ3 B;  4EVO A;  1WVL A;  4HED A;  1SEB D;  2RDF A;  5EKI A;  1RTN A;  3L7Z C;  1TWH B;  5CV9 A;  2K5Q A;  5EPJ A;  1WTO A;  2BDN A;  1B53 A;  4FNF A;  1LT3 D;  1U9R A;  2SDF A;  4RFB A;  4I65 A;  4HMI A;  4DXG A;  1SYC A;  3OOC A;  2B63 B;  2HDM A;  3J81 L;  3H0G B;  5C3E B;  4K2K A;  1G91 A;  1FR3 A;  1STB A;  3P1H A;  5IOC A;  1E2W A;  1L0X B;  3MXN A;  5EBC A;  3D4W A;  2K03 A;  2B8G A;  1TKW B;  2NTS A;  5G3L F;  4DNT B;  2F0H A;  3FPU B;  3MC0 B;  1X32 A;  3H3V C;  5C5L A;  3LX0 A;  4LJZ C;  4J8Q A;  2F0W A;  2MHV A;  4DGZ A;  2RSN A;  5JPM C;  2HUG A;  4QMG A;  1F2Z A;  3FMC A;  1S5E D;  2O5J C;  4U68 A;  5G3L D;  3G7L A;  2A74 C;  2F0I A;  1PDQ A;  2B8F A;  1Q90 A;  4I7Z C;  3K5N A;  1QNU A;  5COR A;  2B2V A;  2EJM A;  2XN9 C;  2PCF B;  1AFP A;  1NR2 A;  1Y8O B;  1IKL A;  3QJY A;  3BVM A;  3QIA A;  1ILQ A;  4CKB A;  2RA4 A;  2WAC A;  1DZ1 A;  1S5C D;  1GHK A;  1FNV A;  5C5M A;  4FXG C;  3FDT A;  2CQA A;  3HGB A;  3TP7 A;  1HQR D;  3ND8 A;  2MUY A;  2E75 C;  3IAY A;  1KNA A;  3I90 A;  3HS0 C;  2IT1 A;  1KDC A;  2F1M A;  1PFN A;  5I2X A;  5ELF A;  1J9O A;  4PMB A;  1ZYR C;  4WRD A;  1VF5 C;  2NVX B;  2A69 C;  1PTO B;  1PTO F;  2EYO A;  1MSG A;  1JR0 D;  2JSO A;  3HOU B;  1HTL D;  3LWE A;  1TR5 A;  1F9P A;  1B9N A;  2EXZ A;  4DK0 A;  5D14 A;  2L0C A;  1BBX C;  4CJ0 B;  5D65 A;  5EBD A;  1NSN S;  4KHZ A;  2WKD A;  3Q22 A;  3TBI B;  5IIF A;  4KD4 A;  3SK8 A;  3TDQ A;  4H0L C;  1SXT A;  3MXP A;  2L11 A;  1V1P B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...