1PFMA

Pf4-m2 chimeric mutant with the first 10 n-terminal residues of r-pf4 replaced by the n-terminal residues of the il8 sequence. models 1-15 of a 27-model set.
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
68
structure length
68
Chain Sequence
MSAKELRCQCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR solution structure of the 32-kDa platelet factor 4 ELR-motif N-terminal chimera: a symmetric tetramer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
molecule keywords PF4-M2 CHIMERA
total genus 9
structure length 68
sequence length 68
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1995-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1pfmA00
5EPJA 5T1GA 4QUCA 2KOLA 4XDXA 2HDLA 1WD0A 1MSGA 1DZ1A 2K04A 2L1BA 1B53A 1F9RA 3DM1A 4DN4M 2L9HA 1IKLA 1MI2A 5DNFA 1ILPA 1GUWA 1O80A 3HP3A 1J9OA 3IFDA 5EQ0A 4HCSA 2H1EA 1F9SA 5CMDA 1B50A 3IL8A 2FJ2A 1X32A 1EIGA 2HCIA 3DEOA 1KNEA 1SDFA 2EOTA 1NCVA 2NWGA 3I90A 4CJ2C 1QG7A 1S4ZA 1ESRA 4X3SA 1C8CA 1RJTA 1EOTA 1HA6A 3I91A 2JYOA 1HHVA 1NAPA 2DY8A 3QO2A 2KUMA 2NYZD 2MPMA 5JJZA 3KUPA 1EIHA 4X3KA 1IKMA 1AZQA 2B2WC 2X6GA 1WTPA 3UI2A 2CVRA 1AP0A 4U68A 2B2TC 2D9UA 2HUGA 1WVLA 2N55A 1QNKA 2SDFA 1U4RA 2BDNA 3MTSA 4RA8A 1RODA 1J8IA 4IUPA 2MP1A 2MJ8A 3KBXA 3ONAB 1PFBA 4QUFA 3MWYW 2L4NA 1RTNA 2KECA 5CORA 5EPKA 3R93A 5AFWA 1DONA 3FDTA 1BBXC 1TVXA 1WTQA 4LMQD 1BNZA 1ML0D 2K03A 4ZAIA 2K1BA 2L11A 2Q8RE 1PDQA 1DOKA 1EQTA 2K28A 4OIKA 4ZKCB 4NW2A 3TN2A 1ILQA 4OIJA 2B2VA 3G7LA 5T1IA 1VMPA 1WTVA 4XT1B 1M8AA 2KEEA 3SVMA 2VXWA 2B2TA 4RWSC 1F9QA 1JE4A 4X3UA 1U4LA 4IUQA 5EPLA 1KNAA 5E4XA 2EPBA 1B3AA 2HCCA 1SAPA 4HEDA 5EJWA 1G6ZA 1SSOA 2FFKB 1NR2A 1Q3LA 4XT3B 1DOMA 3I8ZA 1CA6A 4O42A 2J7ZA 5EKIA 1XYIA 1ZXTA 3N52A 2NZ1D 2M2LA 1G2TA 1IL8A 4UAIA 1XX8A 2Q8TA 2L12A 4R9WA 4IUUA 2B2YA 1HFNA 1MSHA 1HUNA 4CJ0B 2B2YC 2B2WA 1HFGA 1WTOA 4ZKBB 1X3PA 2RSOA 2RA4A 1A15A 1WD1A 2IL8A 1MGSA 3FPUB 2FINB 2K05A 2JP1A 1BO0A 3TZDA 1LV9A 5COYA 2R3ZA 2B2UC 1PFNA 4HAEA 4X3TA 3LWEA 4ZLTF 3GV6A 1VMCA 1U4PA 2EE1A 2MGSA 2N88A 2RVLA 4HSVA 1G2SA 1HRJA 1WTXA 1AZPA 4R8IA 2B2VC 1ICWA 3GV3A 1PFMA 5D65A 1CA5A 1O7ZA 1EL0A 1RHPA 2HDMA 5E4WC 1WTRA 1HUMA 1G91A 1U4MA 4IUVA 1B2TA 3I3CA 1NR4A 2K01A 1CM9A 2FMMA 4IUTA 2DY7A 1RTOA 4RAUC 1B4OA 1F9PA 2B2UA 2KVMA 2XIWA 3P7JA 3DEPA 4MHEA 3Q6SA 5CBAE 4CJ1B 2FHTA 1DOLA 2KEDA 1QE6A 1F2LA 2RSNA 4MN3A 5CBEE 3H91A 1BF4A 1E0BA 2X6LA 1WTWA 3D6WA 2X69A 1PLFA 1O7YA 1X3QA 3F2UA 5D14A 1JICA 4ZK9B 4IURA
chains in the Genus database with same CATH superfamily
4OL7A 4JI0L 2NVXH 3TSSA 3H3VH 1GXDC 2IX1A 2NVYB 1F9RA 3HOUH 2CW0C 1WOCA 3O13A 4BBSG 2EYOA 3FP9A 2G9HD 1YHAA 1KL9A 1HQMC 5EQ0A 1C0AA 3CAMA 3I7FA 2EVBA 3ZJYC 1SDFA 1RDPD 1OXSC 1W2BA 2OCEA 4PMWA 3PIOA 2B8FA 2I5HA 3KJPA 1EIHA 4C3JB 4ZRZA 5CV8A 3J80E 3LWUA 1FNVA 5LMNW 1EZ8A 1WVLA 3P20A 3BDLA 4A93G 3KDFA 3UDGA 1KHIA 2AQ2B 1DONA 1NY4A 3A7LA 3S17H 1Y1VH 1A2UA 1NTGA 5AJ3Q 3J81c 3C46A 2N3SA 3P75A 4C3IG 5CV5A 3A5ZB 5IGEA 4UDUC 5FO8B 4Y7NB 3SHLA 3HOVG 2B2TA 4PV1C 5FJ8G 1TWAB 1JE4A 4BBRH 1A3TA 1B3AA 3ULLA 4BS9A 3HRZC 4WRDA 4B3MQ 4OONA 3I8ZA 1SYBA 3FMCA 1S5DD 5IYCH 4UY8C 4HMJA 3CCMA 4UHVA 2B2YA 3S17B 1IYJB 4DV0L 1KAAA 1PYWD 1LO5D 1PH5A 4HJ9A 1KQSA 1EU4A 1STBA 5C5LA 3DUZA 1D2BA 1PYBA 5IWAL 4JYAQ 2XWJB 4ZLTF 1HZ9A 3TEHB 3HGBA 3MFYA 4A3GG 1N36L 3MXGA 1RD9D 3T4AC 3OW2A 1EEFD 2E76C 2ZTEA 4QIWB 5C4ZA 4CDFC 1X9NA 1A8VA 2HDMA 2PNHA 2VZAA 3PUYA 4HSPA 2FMMA 2K50A 2DY7A 2MO0A 2PZTA 3CQZB 5NUCA 2QF7A 4N8X1 1RF2D 5LMUQ 1PRTB 1PV4A 2NVYH 3S2HB 2C9OA 5C4XH 5M3MG 2O2LD 2EQSA 1PA6A 1AN8A 5EBDA 3EVQA 1IYVA 4B3TQ 3D6CA 3GTMB 1YNXA 3D4DA 1UE7A 2F4IA 3A55A 2ICEC 1GM5A 3EIVA 4NXMQ 1XJVA 1K3BC 2H1EA 2BDOA 2R92H 3K81C 3BZCA 2IW3A 1EIGA 3SEBA 3PGZA 2LSSA 4BXXH 2AUKA 3K5NA 3KOJA 2R7ZH 1NAPA 1UUPA 3HKZG 3K7UC 3OTOQ 3CC7A 4A3KB 3GTGH 5EKKA 5KNBA 3NP8A 2PQEA 4XTCS 4HCEA 4ZQ3A 1V1QA 1Y8NB 2D9UA 4R4QA 2F0LA 3ONAB 1U5KA 4J1MA 1CQFA 2BA1A 4PMBA 2F0MA 1RCVD 1D1IA 1EYCA 2K03A 1QUQB 1SJHD 2EYJA 1PDQA 3EFXD 3NQIA 4PQXA 5FOBB 3UDXA 4NP5A 3MXPA 3CCEA 2B39A 3OIQA 1VQPA 2K5NA 1JB3A 4POFA 1QWYA 3S9WA 4KD3A 1X65A 2VXWA 3AEVA 3SXHA 4LWCA 3VA5A 4AYBG 2R61A 1G6ZA 4FVMA 4HEDA 1YNJC 1LT6D 4A3IG 4XIGS 2CWPA 3S16B 4K2KA 3Q24A 4JI3Q 2QGQA 3IRBA 4IPHA 1EU3A 1HUNA 4PNYA 1L0YB 1IBKQ 1BOSA 1I4RA 2RSOA 1JE5A 2OEOA 1WD1A 3TP8A 2E2HB 2JEBI 3RZDB 2JP1A 1LTAD 1BKBA 1STAA 3F2DA 4IQZA 4A3MB 1VQAA 5CC4A 2WAQG 4DAPA 1QUQA 4RGNA 1TIID 2N88A 3K59A 5BN3A 1HRJA 4JK1C 2F0DA 3HOYH 1AH9A 1STGA 2B63G 4P74A 3Q8DA 3TP6A 4GLVB 1TXYA 1EEID 3KDFB 2EJFC 3P7JA 4CJ1B 2YTVA 1SJED 3K0XA 3H3VI 3NBIA 5D14A 5C44B 4YWMA 1Q82C 3Q23A 1ZEQX 2RHQB 4O2DA 1MSGA 3I4MB 4A3IH 4FDBA 3K5MA 2E2IB 1L2FA 1N36Q 1QOHA 1GUWA 4LFBL 2KCTA 3I73A 1FGUA 3FEWX 5FLMH 1KNEA 2NWGA 5HY6A 5KNCA 4JI2Q 1VF5C 2MHVA 4TSSA 1EOTA 3ZYYX 4B3TL 2JYOA 4BY1G 3I4NG 1VQIA 3WDNA 2JQOA 5E1FA 3CCUA 3MA2B 1SBBB 3TP7A 1CKNB 1UEBA 2D2CC 2A6HD 4RHSA 4BA1I 1RODA 5C3EB 3KFUA 2WIIB 3R93A 2D0PA 4L5TA 2DUDA 5C44H 2K1BA 3BDCA 3GTPB 2VQFQ 3RLFA 1XPUA 2UXDL 4WFN3 2QCPX 3KF6B 4OELB 2WFWA 1Z6HA 3AQQA 2F0IA 3DHQA 4BBRG 3G6EA 1FJGQ 3SVMA 1EOVA 4IPCA 5CYUA 4CGYB 1TS2A 1UE1A 3GTQH 2JSOA 1VQEA 4U673 2EPBA 4EGVA 1CHQD 3M7NA 3N52A 3HOYB 1LTRD 1XX8A 2EZVA 2SOBA 4ME3A 5A2QL 4A3MG 3FHWA 4FXDA 4DU9A 5G3LF 4A3LG 2IL8A 2K5VA 3FPUB 1Y1WG 2Z1CA 3GO5A 3NWTA 5GAHC 1MHWC 3K7AH 1JWUD 1FR3A 3KLRA 1FJGL 4GN3B 1HZBA 1CT1D 3VR4A 4YWLA 1CA5A 4DPGA 1W3SA 1HNZQ 1JT8A 5IY0A 5IP7H 1XTCD 2QKIC 2J0TD 2ZM6Q 4BBSB 2AKWB 4CKBA 1R4QB 3HOWH 5IWAQ 4JYAL 1JB7A 4MN3A 4NPSA 3S2DH 1XPRA 4QUCA 5M5WH 1EZ6A 1FYCA 4G7HC 5KIXA 1YIJA 2DN8A 5ELEA 5J1ZA 1ILPA 2BE5D 2UUAL 5AJ3L 3SDZA 4A3KG 3NTHA 1IXRA 2N8NA 3HEJA 1CFMA 1NMGA 5M3FG 1EUJA 4ILWA 2MUYA 4DR1Q 2M00A 1RJTA 3C2PA 1IZ6A 3D8GA 2E8GA 2WP8J 5IT9L 3IAYA 3DLLA 1EWCA 1AEXA 3PUVA 2M9VA 2WINB 2R92B 3JAMc 2I0QA 1C9OA 1SYCA 2L55A 3R8BA 4GNXA 4C1NK 4JBKA 3M4OH 5EPKA 3I4MG 4CDEC 4JI6L 3K0YA 4WJ3M 1KXLA 3C3LA 4DGZA 3S2HH 1WTVA 1R9TH 2K5WA 4RGOS 1JMCA 3BDOA 3E9HA 1WI5A 4LF5Q 5IGFA 1OXVA 1SAPA 1HR0W 4X64L 1NR2A 1Q3LA 3OWFA 4KLKA 4DF7A 2M2LA 4ODGA 1H9SA 5BR8Q 4R1JA 4DV2L 1PXUA 4YIJA 4CJ0B 4J15A 4KHZA 3VDYA 4LAAA 4LK1C 2WB1E 4S3SA 4QQBX 4YHHQ 4LF6Q 3EJIA 3K8AA 1WCMB 2F1MA 4KKUA 1QNUA 1LTLA 1KDBA 1I4HA 4JOIA 2GA4B 4OO1H 3X3NA 3CD6A 2LY7A 2Y0SB 3Q22A 4A75A 5D65A 5FK9C 1NSNS 4L5QA 5E4WC 3HOVB 1EY6A 4JI8Q 4LF9Q 2IX0A 1KIXA 2PZUA 1CKMA 4AYBB 3K5LA 3GTKB 2JXMB 2KEDA 3S1QH 1QE6A 1LM0A 3H91A 4GOPC 2WKDA 2X6LA 2AQ1B 1YBYA 4F88A 1JICA 1ZYRD 1Y1VB 1G6PA 1DYQA 2EJGC 1GUOA 4KN7C 4DK1A 2B29A 4HIKA 5M9OA 2MNAA 4A3DG 1X56A 2SNMA 2BA0A 1TS4A 4X65L 1SEBD 4K6DA 1WCMG 4LNQA 4NXNQ 5LMNL 2KJXA 1IL2A 3JAME 5CV7A 1PH8A 2UUCQ 1SE8A 1T5EA 1JJ2A 1YNNC 2PQAA 4ZCKA 3Q0AA 1VF7A 4IN3A 2ZJPA 2Z0SA 2OWOA 2UXBL 2B2WC 3A5UA 1SR3A 3SK6A 1PH3A 1EY4A 1X54A 1XXGA 2JA5B 1X3GA 4DAMA 3L3OC 2KECA 1II3A 4CKEA 3KF8B 1L0WA 1WTQA 1CHPD 2A6EC 3MEHA 2XSCA 4ZAIA 1LT5D 4FF1A 1EQTA 1CKNA 1SMXA 1QVGA 2PCFB 1E1OA 1GUTA 4RWSC 2ALYB 4IALA 2CW0D 2N49A 1SE3A 2KQ3A 4XT3B 5CV6A 2J7ZA 1SNDA 3AU7A 3H3VC 4B3RL 1QVCA 4CKCA 1VQDA 1SNPA 2HD3A 4KK7A 1P16A 4JCVE 2JA5H 2G9DA 1JWMD 2FINB 3VYTA 4A3CH 1SMYC 3D4RA 4QB4A 3BG3A 4CDDC 1PYSB 1PH9A 4X3TA 2KHJA 2GVAA 3NBHA 2A74C 2QDBA 3K57A 2AQ3B 3EN2A 4X62L 1ICWA 1V8QA 5JVH3 1F2ZA 1PTOC 3CHBD 4C3HB 5C3WA 4IUVA 1G8ZD 1SE2A 1K8AC 4GKJL 5JEAJ 1AE2A 2JA8H 2UXCL 4RAUC 1ENFA 3T16A 3T1HL 4PZ6A 1B9NA 1ASYA 4L63B 4DR5L 3B6YA 1Q12A 2WKCA 3SK8A 1G2TA 4UAIA 1SE4A 1Q81C 5T1GA 4POGA 3E6ZX 1I3QH 1LTSD 4B3SL 3I4OA 1ET9A 1TR5A 1SYDA 3GTKH 3S1QB 1PRTF 1H9JA 2B3GA 4LJZC 2WAQB 2F52A 5CMDA 4RGTA 1PHJA 1S5FD 4DUYL 3I90A 4JI7Q 3NHHA 3TZUA 1F2MA 1VQJA 1PH7A 1TQOA 4A3GH 4A93B 5DLQE 4OO1I 3RZOH 2NYZD 2MPMA 5JJZA 2F03A 1K83H 3MZ5A 1QB5D 2KBNA 1WTPA 1S5CD 3UDIA 1SN8A 3BVGA 1XTDA 1J8IA 4QY7A 4X64Q 2EY5A 3KJOA 1FNUA 1TWCB 1ENAA 5JJKA 1KLUD 2EDGA 4LUVA 1DJRD 4DV4L 5ISRA 1YNJD 2WV6D 4NW2A 1MJCA 4GLXA 2K7VA 2ZXPA 3H0GH 2HT1A 2BH2A 4ZUIA 1B9MA 1C48A 2VL6A 4RG1A 2A8VA 4B9WA 3VA7A 3RNUA 2E2JB 1F2YA 4H13C 1MBYA 1DOMA 1BCPB 1H9SB 1XWEA 4FF2A 1LTID 3M9BA 2Z6KC 3V96A 1MSHA 1HNZL 3JC66 1A15A 1OXXK 1IBLL 3CC2A 1S40A 5COYA 4A3FH 2HHHQ 1JR0D 1PFNA 3UE0A 2NTSA 4IFDG 3PQIA 2MGSA 1PTOH 4JI1L 4L5SA 3VR3A 4LFBQ 2Z6BA 4MTNA 4DR3Q 2IX3A 2K32A 4GKKL 2CFMA 5M3MB 3KLWA 1GVPA 4H02A 1DCZA 4JI5Q 5ELNA 3VR2A 4GS3A 1XMQQ 1GD7A 3BZDB 3D4WA 1V9PA 4AH6A 4DNIA 2AMCB 2QDLA 4MIUA 1K9MC 3SR1A 4RCOA 2MQHA 3S14B 3STBD 4H0LC 4RKLA 4C3IH 4DV7Q 1VQ8A 1CI3M 1PTOF 2KENA 5M5WB 3E9IA 1NNXA 1WD0A 5I2XA 5FO7B 2LXKA 1WTHA 3DM1A 2B8GA 2AHOB 3RR5A 3HP3A 1J9OA 4B08A 2Z9HA 1Z9FA 1LABA 2EOTA 1YHBA 1S4ZA 4EQNA 3J81j 3HOZH 3PO3G 1HA6A 1SFOB 5IYDH 4K8IA 4DV3L 3P1HA 2G5DA 5IGDA 3KUPA 4JV5L 4X3KA 1STNA 3K7AB 1B70B 2D5DA 4XQJA 3HKSA 5IOCA 3QIAA 3URYA 2L15A 3HOXG 4L6TB 3K58A 4A3BG 2A69C 4J6HA 4DKAC 5ELOA 2O4XA 1TVXA 1W6KA 4KKSA 3CC4A 2B2VA 3BVMA 3JAMi 4XT1B 2PYKA 1TY0A 1KRSA 4KJOA 2KHIA 3CU7A 1QILA 2I46A 2F4VL 2ES2A 1EWIA 1VQGA 5M3MH 5C4XG 2EYHA 4JW0A 1PTOD 3TMEA 4IOCA 1IL8A 2Q8TA 4IUUA 4C3JG 4JBMA 1WTOA 2Y0SE 4UP8A 4A3FB 2UU9L 2HIVA 4C56C 3HFZB 3WWVA 5IGCA 3T1HQ 3OYYA 5D3IB 1D8LA 1XPOA 3S1RB 3QR8A 2AWNA 2JJQA 2R6GA 3HZXA 3KK7A 2KCCA 3CMEA 3F8TA 2F3WA 4RH6A 1IYUA 1AZPA 1X3FA 2B2VC 1NE3A 5BN4A 2OT2A 4A3BH 1STYA 3DWQA 2NZOA 4DV0Q 3W1BA 4KJNA 1K28A 1G91A 4DV6Q 5C3XA 4JI3L 2K01A 4UPAA 4HJAA 1XMOL 3NTKA 2OTJA 1DOLA 3MHBA 5J22A 5C0XG 4A3IB 1E0BA 4A3JH 1EY5A 3OPOA 3M85A 1LYLA 3M3YH 4ZUJA 3KYHC 4KTAA 5IYBG 2K4KA 1TWCH 2A6ED 1B53A 3PUXA 2R93G 1CSQA 4LF4L 2NVQB 2PW5A 3NXWA 2K5HA 4EX5A 3BYYB 1I4PA 2DNCA 2QEJC 2F0TA 3S15H 4XQQA 1TWFB 1Y69U 4IJLA 3DEOA 4DUZL 1LT4D 1NCVA 4A93H 4X3SA 4A3GB 3HOXB 3J7AF 1TWGH 2WB1G 5GAGC 4KHPQ 4DV7L 3QOJA 5H1SE 5JAVA 2ATWA 4OEMB 2E2HH 2QW7A 4DR4L 5K36H 4QUFA 1YVCA 1I3QB 1PFBA 2IJ0A 3ULJA 1RTNA 5CORA 4OXPA 4LF4Q 4K5WA 2Q8RE 2DNEA 1MD2D 2QILA 2B63H 2RBMA 3RD4A 4IUQA 3A74A 3C1FA 1CA6A 4RGMA 2ZTCA 1I4XA 2UXCQ 1QJOA 4DR4Q 3GTJH 1BBWA 2VQFL 4JI5L 4GLAC 3CPWA 2A6HC 3KF6A 3I70A 3CXCA 1SXTA 3SE0A 3PF5A 3OMGA 2R3ZA 4DR2L 1EIYB 5I6YA 3AMUA 1JORA 2F0UA 3LWEA 3GV6A 1CSPA 3CMAA 3U4ZA 5L37A 1GKHA 1Y14B 3ITPA 4LF5L 1NBWA 3NQTA 1SROA 2A68C 1IBKL 1NMFA 2PMZE 4B3SQ 2EIFA 1KTKA 2KA7A 4NXML 2CWAA 1F9PA 2B2UA 5C44G 2VW9A 1EY7A 1YEZA 3L2PA 4KV6A 5CBAE 1RKNA 3EA6A 1BF4A 3GTMH 4OWWB 1HR0Q 1F77A 3GD7A 1VQLA 1L1OB 3FKIH 3LX0A 4KI0A 4IUNA 4NMZA 3OTOL 1S5BD 4DR6L 5DM63 2EY6A 1BR9A 3KLSX 3U4VA 4N9PA 3CQZH 3E0EA 4DV4Q 4TQUS 4HMIA 1SYGA 1F9SA 1B8AA 1X32A 4KY5A 3T1YQ 5IGBA 1SNQA 3PF4A 1L1OC 2LMCB 1E24A 1H9MA 3NE5B 4CDCC 1ESFA 1TWHH 2CVRA 4K2LA 3RUZA 4YCUA 2DJGC 2MJ8A 5DAUA 1K0SA 4LUOA 1W6JA 5AFWA 5JPNC 2NZHA 1FNWA 4QIWE 1TS3A 2DJFC 4OIKA 1Y1VG 1HQRD 3ER0A 4KHPL 5EKLA 3E0JA 2EY2A 1VMPA 3A8IE 5FJ8H 4PZ8A 4JVZA 1VQ7A 2NVTB 4P73A 1M8AA 2KEEA 3KLSA 1TWAH 4Q5VA 1LT3D 4X62Q 4Y7NH 3NSWA 5E7NA 2HQEA 4DV5L 2NVTH 3DXJC 3HOVH 2EXDA 1SSOA 4DV1L 4BY7G 1CZGA 5D3DA 2Q2TA 2EY1A 2JA6H 1N34L 2NZ1D 3PO3B 4L8JA 3W1GA 3JAML 4LF8L 3K5OA 4CHTB 2H5XA 4AYBE 2I07B 1BO0A 2A69D 1LUZA 2EJMA 4JPBW 4HAEA 3U50C 1PMRA 2F0FA 3CCQA 1HCZA 3WOFA 4N9TA 3FRPB 1D1KA 4YCWA 3VR6A 1UE6A 4AQYQ 2ZJRA 2A73B 1U4MA 3J80L 4B3RQ 4DR7L 3HKZB 5BR8L 4NKLA 1R9TB 3CKIB 5CV9A 5CGKA 5F2DA 4BA2I 2NB0A 1WTWA 3MC0B 2A68D 4Q0FA 1E3PA 5DM73 3F2UA 3FKIB 4C2MH 2XRQD 3A54A 1I50B 4DV3Q 2R93H 1RL2A 5IP9G 1VDZA 2SNSA 1OXUA 2RKSA 3G6JB 3CCJA 1KD1C 1GUSA 4A3CG 1J6QA 1KLGD 4XYQA 1A3VA 5J39A 3F1ZA 4IPGA 4JI8L 1WJJA 4I7AA 2R92G 4G7OC 1ESRA 3J80i 3I91A 1N32Q 2YU9H 2TMPA 4HJ5A 4YWKA 4DK0A 2R7ZG 5ELFA 3TBIB 1ONLA 3TDQA 1AP0A 4RFBA 2HUGA 2ZTDA 1S72A 1AW7A 4RA8A 2TSSA 2E5LQ 3U58A 4NXNL 1PVOA 3FDTA 1IW7C 1EYDA 2L11A 3QB3A 1DOKA 4FXKC 4GOPB 2E75C 3S2DB 2CQOA 3HOWB 1C4QA 2UU9Q 1E7ZA 2UUCL 2JE6I 4X3UA 2F0VA 1U4LA 4A3EB 1STHA 3QJYA 4ID6A 3NEMA 4DFAA 2K5DA 1YNND 3U9SA 5FLXE 2K75A 4JG2A 4MTKA 5GAEC 1YJ9A 2VUMH 1HPCA 3GTLB 2XVSA 4F7XA 5EGTA 3OW7A 3I4LA 5C5MA 1UE5A 3MEFA 2F0HA 1D5XC 3TZDA 1XMOQ 1T9HA 1KRTA 4DV1Q 1GJXA 1K3RA 2Q2IA 1Y1WB 1VMCA 1U9RA 2R7DA 1I4GA 1PFMA 2Q8IB 1ZKOA 2CCZA 1HNWQ 3J7AV 1O7ZA 1RHPA 4LF8Q 1HUMA 2PI2E 3S15B 3I3CA 4BY7B 4LF6L 1CM9A 2IY5B 1B4OA 2V4DA 2KVMA 2NVQH 5LL6X 1AFPA 3T1YL 4DUZQ 3GTPH 3D6WA 2X69A 5I9OA 1EY8A 4TVAB 1VCIA 1O7YA 1X3QA 2OQKA 4ZK9B 1VQ4A 5EPJA 2HHHL 3M3YB 4P71A 5J3BA 5C4JH 3NTIA 4DK6C 5ELDA 4A3JB 1XNRQ 3HKZE 3T13A 3GTOH 1CQVA 2RQXA 2XRSD 5FLMG 3J81L 4R4IA 4GKKQ 2FJ2A 4K0KQ 4DA2A 2OTLA 1Z7TA 3LGJA 4A3BB 2JA7G 4GKJQ 4JI6Q 4C3HG 1C8CA 3CCVA 4DR7Q 3CRLC 3D0FA 1HHVA 2IT1A 4CBVA 1G291 5FLXc 5C3EG 2JA5G 4HN7A 4R4OA 3RLOA 4FP5D 4FNFA 3R2TA 3S1RH 1PH4A 3GTOB 4U68A 2E2IH 1X55A 1VQNA 3NK9A 4QF4A 1VQCA 5C4JB 4TRDA 1EFWA 3TREA 1R4PB 5C4HA 1I4QA 1B44D 4LMQD 1D7QA 1ML0D 4F8MA 3R3OA 1PZKD 4ZKCB 1JOOA 2GVBA 4A3DB 3A7AB 4OWXB 1CTMA 1LTGD 1DGSA 3HOUG 1PZID 1H9KA 4JI4L 2LKVA 2XWBB 4BY7H 1TS5A 1P8LA 4FO2A 1KNAA 5ELCA 2HCCA 2F0JA 5EJWA 5I4DA 1BUVT 1KABA 1LACA 1EQQA 3NUCA 5JPMC 1ZYRC 4XXEA 4DAYB 2ZM6L 1Q1BA 2EXZA 2L12A 4J8QA 3U9OA 4A3LH 5IYDG 5KYIA 1TU2B 2B2WA 1Y1WH 3DWAA 4A3MH 2UUBQ 2E74C 2RDHA 4HJ7A 1KDCA 1LTTD 1M90C 1QVFA 1M1KC 4FF3A 4HSVA 4G7ZC 2VUMB 4C1NI 1E2WA 4A4IA 1YZ6A 5G3LD 2UUAQ 3HOZB 1GO3E 4GN4B 4OX9L 2RDFA 1EL0A 4GOPA 1YHQA 4I7ZC 4RMFA 3LNNA 4A3EH 1FVIA 3ICEA 3L7ZC 3SK5A 3TRZA 3HOYG 4HIDA 2K52A 1F2LA 1JQYD 1VQKA 2D0OA 3M4QA 1PLFA 1YI2A 2BH8A 2KOLA 3D3RA 5JEAG 1DXMA 1HNWL 2ENBA 3UE1A 4C3IB 3S14H 1VS0A 4DN4M 1XMQL 4QJFA 5E3FA 3ULPA 3M4PA 1IBML 1IHZA 3BJUA 5IT9c 1I6HB 1EFID 4LUZA 4HCSA 2F0PA 3FKIG 4A3KH 4O0AA 3GTGB 3L0OA 3IKJA 1JWSD 1EYAA 1L1OA 1H9RA 2HCIA 3J80c 2YU9B 1GUNA 4BWGB 2R7ZB 5C0XI 1VQFA 1V1PB 3VYSA 3PO2B 3S1NB 1JJGA 3QO2A 2ID0A 2KUMA 1Y8PB 2RCFA 2NUCA 2ZT9C 3MVVA 2LXJA 1PFSA 4IFDH 1SMYD 2X6GA 3ERQA 1N34Q 2OQ0A 1GHKA 4LFAQ 4X66L 1K8OA 2NN6I 3VR5A 3G4SA 2L5TA 3M7GA 3MTSA 2ZJQA 2O5IC 1RIPA 3L9AX 2MP1A 1K8GA 4OHJA 4NB3A 2YV5A 3OWEB 5C0XH 1I50H 4DUYQ 4A3EG 4JI7L 4A3JG 2PPBC 4YHHL 4C2MB 4JI2L 3EROA 1DD2A 3KF8A 4HJ8A 5KEEA 1O7LA 2Z6KA 5TSSA 1BDOA 1ICFB 5C4XB 3A56A 3AB9A 1X6OA 1VQMA 5T1IA 4YCVA 1NUCA 4A76A 3S24A 2E2JH 1N33Q 4UP9A 4X6AH 1PRTD 4DR1L 3PIPA 3AFQA 1U0LA 1GUGA 3DMUA 4B9XA 5E4XA 5C0XJ 2F0QA 3H0GB 4K5XA 3ND9A 3A0JA 3I56A 2GN5A 5JVG3 1STEA 1EIFA 3CP0A 3CPFA 1Q1EA 2UXDQ 5K5PA 1HTLD 1OXTA 5A35A 1PH1A 1SRUA 2K05A 2Z4IA 3PIO3 2NN6G 2H4OA 1K83B 4E6IA 5LMUL 5K36G 3RLNA 2JK8A 1U4PA 1B1ZA 4V190 3PO3H 3UDFA 3J7YW 2JA6B 1QZHA 1XNQL 1PH6A 4X65Q 4KMUC 3PO2G 1TY2A 1HA5A 4BBRB 3QWNA 2F0SA 5HGQA 1RTOA 3CRKC 3PCOB 4QMGA 4MHEA 3ERSX 2JEAI 4ALPA 3T51B 1A63A 1E22A 2UXBQ 4ABNA 4DR3L 4XDXA 3AFPA 2K04A 3GP7A 3SGIA 1I6VC 4JBWA 1Q46A 2A19A 4IO9A 3MAQA 1HXYD 1GOZA 2WAQE 1JOQA 1ENCA 2ASBA 2HIXA 1TWHB 2F3VA 4OX9Q 2JA8B 5DEHA 5M5YB 4C3JH 4R8NA 4C3HH 5IYCG 2WACA 2K6AA 3FPPA 3OMCA 2IHEA 2RHSB 4G57A 2CQAA 2KCMA 3M4YA 2IWHA 3OIPA 1EQVA 1OO9B 2Z8LA 3A8KE 3J81E 1K8MA 1CUKA 5GQOA 1AZQA 1N8RC 3UI2A 4EVOA 2EYLA 1SNOA 2N55A 4JI0Q 4AIMA 3HOUB 4WJ4A 4K0KL 3MWYW 1YJNA 3H09A 1HNXL 2NVXB 1BNZA 2FXQA 3PUZA 1IBMQ 2YYZA 2RDGA 1PH2A 3BYTB 1C7YA 1ILQA 1BBUA 1IBLQ 4ULLA 4IZ8A 2BCOA 2LFNA 5CR3A 1F9QA 3OOCA 5ELBA 4JBJA 3I72A 4O42A 1BQQT 1I94Q 2YTYA 4F87A 4MNOA 4A3FG 3SK4A 4X66Q 4DAVA 4LFAL 2MO1A 3W2DA 2IPKD 1SNMA 3BU2A 1X3EA 1HFNA 2PMZB 2B2YC 1VQ5A 1Q90A 3NPPA 4JOIC 1SYFA 2EYFA 4DNTB 4HIMA 3BZKA 1L0XB 1MKHA 1O7IA 1EWHA 3S1MB 5FKAC 1BXTA 1JJCB 3CCSA 1EY9A 2E2DC 3GTJB 4EQ5A 2EE1A 5EAYA 3TS2A 1O78A 1Q8KA 3IFTA 4DXGA 1J5EL 4LW1A 2NBFA 5M5YH 1LTBD 4OO1G 1KDAA 4Y52H 2B63B 2RSNA 4JV5Q 1MJEA 1CK1A 2CHBD 4ZYSA 3VYUA 2ZXRA 4QCLA 5HURA 4PG3A 3PMFA 4KY6A 2PI2A 4LF9L 4KHVA 1Q86C 2VQEL 5I2YA 4RKBA 1A0IA 2BOSA 2F0EA 3IL8A 4RHRA 1A3UA 1TWGB 1QG7A 3HOXH 1NJIC 4TKOB 3FVQA 3J81i 2DY8A 3OSOA 4FF4A 2F4VQ 3A8JE 2FMCA 1TWFH 2A5HA 3T56B 1WCMH 1HR0L 2RF4A 3NELA 4BY1B 3I4NB 4K6LA 1QNKA 2JA7H 3HG9A 3V05A 5I6WA 1ET6A 4IUPA 3HOWG 5IP7G 5LMNQ 1K73C 1I5FA 2VQEQ 4ME5A 2SEBD 1FGBD 3WOEA 3H0GG 1DM0B 1S5ED 4DV2Q 4OIJA 3BS1A 1A2TA 5IE8A 4KY7A 3VYRA 1PRTC 2KCNA 4JI1Q 2K14A 1JCKB 4IFDI 1YITA 2VB2X 3MXNB 4YY3L 1N32L 1ASZA 2FFKB 3G71A 4WJWA 1Q7YC 3C1EA 4UP7A 3DM3A 1IW7D 1ZXTA 3I55A 2AWOA 2VB3X 4EQPA 4LFCL 1G51A 1VQBA 1HFGA 3M4OB 1CKOA 5M3FH 2NN6H 1EY0A 1GHJA 2PNRC 1VQOA 2B2UC 2L0CA 3S1NH 2LS01 1D6EC 3X3MA 3PO2H 1UEAB 3GV3A 3H6MA 4MZ9A 4G4KA 2P5ZX 5KRUA 5JOBA 1A6XA 1D5MC 2Z4HA 3V2TA 2JA9A 4P75A 5IYBH 1I6HH 4GN5A 2XIWA 2NTTA 4LFCQ 3PIP3 2O5JC 2EYMA 4DR2Q 4K8JA 4IPDA 4APVA 2C35B 1V1PA 4QL5A 2F0WA 4PZ7A 2VS1A 1BBXC 4IURA 1LLRD 3G48A 4DK3C 3STBC 2JA8G 3PUWA 1DZ1A 4BXXG 2CKZB 2L1BA 3CW2C 5FLXL 3PSIA 2L9HA 1SLJA 1IKLA 5DNFA 5M5XB 5LL6S 5KYLA 1UAPA 1O80A 2VY3A 4BBSH 1V43A 3MXNA 3IFDA 3H15A 2MFIA 1B50A 3N6RA 5IIFA 4DR5Q 5EBCA 3J7ZC 3HOZG 2JA6G 1TT2A 1SFOH 4FXGC 5LHY1 1OTCA 2N78A 5IGGA 3W3AA 4KN4C 2XNAC 4DR6Q 1IKMA 1Q8IA 2B2TC 5M5XH 3TQYA 4DV5Q 2SDFA 4FYDA 4XYOA 1XNRL 2J4XA 3KBXA 4B3ML 4GNXB 2L4NA 1WFQA 2ZXOA 4PMCA 1I94L 4GZYC 5BN5A 2F0GA 1Z47A 3K6OA 2K28A 4RCNA 3G7LA 3PV0A 5IT9E 3ND8A 2KHSA 3GTQB 2Q2UA 2Q2HA 5EPLA 2EYPA 3T53B 4P2CB 1HZCA 4HR7B 4A3DH 4DV6L 2I5MX 4DAYA 4JC0A 4GNXC 4K5VA 1PTOB 4R9WA 5IODA 5IP9H 2BE5C 3GQBA 1JOKA 2WB1B 3NENA 1X3PA 4ZKBB 1VQ6A 5C3EH 3TS0A 1MGSA 1EQRA 3D31A 5GADC 1HH2P 3H94A 2K5QA 2XN9C 4XQNA 4IFDJ 3OHXC 5M3FB 4I65A 4IJHA 2RVLA 4OGQC 1M4VA 2DGYA 3NWSA 1WTXA 2IHFA 4YY3Q 1E2ZA 2V1CC 1NR4A 4R4CA 5HGTA 1SYEA 1E2VA 1AE3A 3MFGA 3DEPA 3RMHA 5CBEE 3I4MH 2F0OA 1HJPA 1T5XD 2HDLA 4L5RC 4AQYL 2OF1A 4P72A 2QEXA 2JA7B 2JN4A 1MI2A 3KBGA 4BY1H 3I4NH 1B7YB 4KKTA 1TKWB 2CH4W 4DNRB 2E5LL 2AUJD 3RZOB 5GROA 1HNXQ 4QGUA 4CJ2C 1N33L 1MIUA 3E5SA 2VUMG 4M1UB 4KD4A 2OXPA 3E3XA 3RN5A 1K0RA 5C6AA 2CH4A 1A62A 5I9PA 1QCBD 2F0NA 2PW7A 1KAWA 3F2BA 4EQOA 4IOAA 3RZDH 2I5LX 4N8FA 1U4RA 2BDNA 3MXUA 3CCLA 4O1NA 1UNSA 2HQLA 3NBHB 2XGTA 3F2CA 3GTLH 1BCPF 3QOLA 5A2QE 4HTHA 2D62A 1JC7A 3S16H 3TN2A 1N9WA 1FD7D 5JEAH 5KNDA 2PO4A 2Y0SG 2PZWA 4OWTB 2PQAB 2QA4A 2F3IA 1XNQQ 1V1OA 3CCRA 1VQHA 1EYGA 2A1AA 3BVZA 3DWPA 1PZJD 2VNUD 4HIOA 1D5ZC 1J5EQ 2RCNA 5EKIA 1XYIA 4LF7L 4WORA 1YJWA 1BVSA 4R4TA 3R2IA 1BCPD 3I2ZA 3GDEA 3CF5A 1QZGA 2R7FA 4V0BA 2RA4A 2YTXA 2F0KA 3TP5A 3S1MH 1UWVA 2XTIA 4M8AA 3EQLC 1VQ9A 1KC8C 5KGUA 3HS0C 1LV9A 1H95A 3RN2A 4H7BA 3QG1A 2ICIA 3K80C 1WYDA 5JJIA 4JI4Q 1G2SA 1HZAA 1FL0A 1SNCA 4R8IA 1BCPC 2C5CA 4NDXA 1Y8OB 2K33A 5CV4A 1S3OA 1WTRA 5JJLA 5FO9B 2UUBL 1B2TA 4K14A 4DXFA 4LF7Q 4IUTA 1E1TA 4H44C 3AYHB 3Q6SA 2FHTA 1CZWA 1HTPA 3EBEA 4Z9CB 3W5OA 1B3QA 2R93B 3J7A5
chains in the Genus database with same CATH topology
4OL7A 3TSSA 1GXDC 2IX1A 2NVYB 1F9RA 2CW0C 3O13A 2EYOA 2G9HD 1HQMC 5EQ0A 2EVBA 1SDFA 1RDPD 1OXSC 4PMWA 2B8FA 1EIHA 4C3JB 4ZRZA 5CV8A 3J80E 3LWUA 1FNVA 1EZ8A 1WVLA 3P20A 3BDLA 2AQ2B 1DONA 3A7LA 1A2UA 3C46A 3P75A 4C3IG 5CV5A 5IGEA 4UDUC 5FO8B 4Y7NB 3SHLA 2B2TA 4PV1C 1TWAB 1JE4A 1A3TA 1B3AA 4BS9A 3HRZC 4WRDA 3I8ZA 1SYBA 3FMCA 1S5DD 4HMJA 2B2YA 3S17B 1KAAA 1PYWD 1LO5D 1EU4A 1STBA 5C5LA 3DUZA 1D2BA 2XWJB 4ZLTF 3HGBA 3MFYA 3MXGA 1RD9D 3T4AC 1EEFD 2E76C 4QIWB 5C4ZA 2HDMA 3PUYA 4HSPA 2FMMA 2PZTA 2DY7A 3CQZB 5NUCA 2QF7A 1RF2D 3S2HB 1PRTB 2C9OA 2O2LD 1AN8A 5EBDA 3EVQA 1IYVA 3D6CA 3GTMB 3D4DA 2F4IA 3A55A 2ICEC 2H1EA 2BDOA 2IW3A 1EIGA 3SEBA 2AUKA 3K5NA 1NAPA 1UUPA 4A3KB 5EKKA 5KNBA 3NP8A 2PQEA 4XTCS 4HCEA 4ZQ3A 1Y8NB 2D9UA 2F0LA 3ONAB 4J1MA 1CQFA 2BA1A 4PMBA 2F0MA 1RCVD 1D1IA 1EYCA 2K03A 1SJHD 2EYJA 1PDQA 3EFXD 3NQIA 5FOBB 4PQXA 4NP5A 3MXPA 2B39A 3OIQA 1JB3A 1QWYA 3S9WA 4KD3A 2VXWA 3SXHA 3VA5A 2R61A 1G6ZA 4FVMA 4HEDA 1YNJC 1LT6D 4XIGS 3S16B 4K2KA 3Q24A 1HUNA 1EU3A 4PNYA 1L0YB 1BOSA 1I4RA 2RSOA 2OEOA 1WD1A 3TP8A 2E2HB 2JEBI 3RZDB 2JP1A 1LTAD 1STAA 4A3MB 4IQZA 5CC4A 4DAPA 4RGNA 1TIID 2N88A 3K59A 5BN3A 1HRJA 4JK1C 2F0DA 1STGA 3TP6A 1EEID 2EJFC 3P7JA 4CJ1B 1SJED 3NBIA 5D14A 5C44B 3Q23A 1ZEQX 1MSGA 3I4MB 3K5MA 2E2IB 1QOHA 1GUWA 3I73A 3FEWX 1KNEA 2NWGA 5KNCA 1VF5C 2MHVA 4TSSA 1EOTA 3ZYYX 2JYOA 3WDNA 5E1FA 3MA2B 1SBBB 3TP7A 2D2CC 2A6HD 4RHSA 4BA1I 1RODA 5C3EB 2WIIB 3R93A 2K1BA 3BDCA 3GTPB 3RLFA 4WFN3 2QCPX 3DHQA 1Z6HA 2F0IA 3SVMA 5CYUA 4CGYB 1TS2A 2JSOA 4U673 2EPBA 4EGVA 1CHQD 3M7NA 3N52A 3HOYB 1LTRD 1XX8A 2EZVA 2SOBA 5A2QL 4FXDA 4DU9A 5G3LF 2IL8A 3FPUB 2Z1CA 3GO5A 3NWTA 1JWUD 1FR3A 3KLRA 1CT1D 3VR4A 1CA5A 1XTCD 2QKIC 2J0TD 4BBSB 4CKBA 1R4QB 4MN3A 4QUCA 1EZ6A 1FYCA 4G7HC 5KIXA 2DN8A 5ELEA 5J1ZA 1ILPA 2BE5D 3SDZA 3NTHA 3HEJA 1CFMA 4ILWA 2MUYA 2M00A 1RJTA 3C2PA 3D8GA 2WP8J 5IT9L 3IAYA 1EWCA 1AEXA 3PUVA 2M9VA 2WINB 2R92B 1SYCA 2L55A 3R8BA 4C1NK 5EPKA 3K0YA 3C3LA 4DGZA 1WTVA 2K5WA 4RGOS 3BDOA 5IGFA 1OXVA 1SAPA 1NR2A 1Q3LA 3OWFA 4DF7A 2M2LA 4ODGA 1H9SA 1PXUA 4YIJA 4CJ0B 4KHZA 4LAAA 4LK1C 4S3SA 3EJIA 1WCMB 2F1MA 4KKUA 1QNUA 1KDBA 1I4HA 2GA4B 4OO1H 3X3NA 2LY7A 2Y0SB 3Q22A 5D65A 5FK9C 1NSNS 5E4WC 3HOVB 1EY6A 2IX0A 2PZUA 4AYBB 3K5LA 3GTKB 2JXMB 2KEDA 1QE6A 3H91A 2WKDA 2X6LA 2AQ1B 4F88A 1JICA 1ZYRD 1Y1VB 1DYQA 2EJGC 1GUOA 4KN7C 4DK1A 5M9OA 2SNMA 2BA0A 1TS4A 1SEBD 4K6DA 2KJXA 3JAME 5CV7A 1T5EA 1YNNC 3Q0AA 1VF7A 4IN3A 2B2WC 3SK6A 1EY4A 1XXGA 2JA5B 3L3OC 2KECA 1II3A 4CKEA 1WTQA 1CHPD 2A6EC 3MEHA 2XSCA 4ZAIA 1LT5D 4FF1A 1EQTA 2PCFB 1GUTA 4RWSC 4IALA 2CW0D 1SE3A 2KQ3A 4XT3B 5CV6A 2J7ZA 1SNDA 3AU7A 3H3VC 4CKCA 1SNPA 4KK7A 2G9DA 1JWMD 2FINB 3VYTA 1SMYC 3D4RA 4QB4A 3BG3A 4X3TA 3NBHA 2A74C 2QDBA 3K57A 2AQ3B 1ICWA 1V8QA 5JVH3 1F2ZA 1PTOC 3CHBD 4C3HB 5C3WA 4IUVA 1G8ZD 1SE2A 5JEAJ 4RAUC 1ENFA 3T16A 1B9NA 4L63B 1Q12A 2WKCA 3SK8A 1G2TA 4UAIA 1SE4A 5T1GA 3E6ZX 1LTSD 1ET9A 1TR5A 1SYDA 3S1QB 1PRTF 1H9JA 4LJZC 2WAQB 5CMDA 4RGTA 1S5FD 3I90A 3NHHA 3TZUA 1F2MA 1TQOA 4A93B 4OO1I 2NYZD 2MPMA 5JJZA 2F03A 3MZ5A 1QB5D 1WTPA 1S5CD 3BVGA 1J8IA 2EY5A 1FNUA 1TWCB 1ENAA 1KLUD 2EDGA 1DJRD 5ISRA 1YNJD 2WV6D 4NW2A 2K7VA 2ZXPA 4ZUIA 1B9MA 1C48A 4B9WA 3VA7A 2E2JB 1F2YA 4H13C 1MBYA 1DOMA 1BCPB 1H9SB 1XWEA 4FF2A 1LTID 3V96A 1MSHA 1A15A 1OXXK 5COYA 1JR0D 1PFNA 2NTSA 4IFDG 2MGSA 1PTOH 3VR3A 2IX3A 2K32A 5M3MB 1DCZA 3VR2A 3BZDB 3D4WA 4MIUA 3SR1A 4RCOA 3S14B 4H0LC 4RKLA 1CI3M 1PTOF 5M5WB 1WD0A 5I2XA 5FO7B 3DM1A 2B8GA 3HP3A 1J9OA 4B08A 1LABA 2EOTA 1S4ZA 4EQNA 1HA6A 1SFOB 4K8IA 3P1HA 5IGDA 3KUPA 4X3KA 1STNA 3K7AB 2D5DA 4XQJA 5IOCA 3QIAA 3K58A 3URYA 4L6TB 2A69C 4J6HA 2O4XA 1TVXA 1W6KA 4KKSA 2B2VA 3BVMA 4XT1B 2PYKA 1TY0A 4KJOA 3CU7A 1QILA 2I46A 2EYHA 1PTOD 3TMEA 1IL8A 2Q8TA 4IUUA 4C3JG 1WTOA 4A3FB 4C56C 5IGCA 5D3IB 3S1RB 2AWNA 2R6GA 3HZXA 3KK7A 2KCCA 2F3WA 4RH6A 1IYUA 1AZPA 2B2VC 5BN4A 2OT2A 1STYA 3DWQA 4KJNA 1G91A 5C3XA 2K01A 3NTKA 1DOLA 3MHBA 5J22A 5C0XG 4A3IB 1E0BA 1EY5A 3OPOA 3M85A 4ZUJA 4KTAA 2A6ED 1B53A 3PUXA 2NVQB 2PW5A 3NXWA 3BYYB 1I4PA 2DNCA 2QEJC 2F0TA 4XQQA 1TWFB 1Y69U 3DEOA 1LT4D 1NCVA 4X3SA 4A3GB 3HOXB 3J7AF 3QOJA 5JAVA 5K36H 4QUFA 1I3QB 1PFBA 2IJ0A 1RTNA 5CORA 4K5WA 2Q8RE 2DNEA 1MD2D 2QILA 2RBMA 3RD4A 4IUQA 3C1FA 1CA6A 4RGMA 1I4XA 1QJOA 2A6HC 3I70A 1SXTA 3SE0A 3OMGA 2R3ZA 5I6YA 3AMUA 1JORA 2F0UA 3LWEA 3GV6A 3ITPA 3NQTA 2A68C 1KTKA 2KA7A 1F9PA 2B2UA 1EY7A 4KV6A 5CBAE 1RKNA 3EA6A 1BF4A 1F77A 3GD7A 3LX0A 4KI0A 4IUNA 4NMZA 1S5BD 5DM63 2EY6A 1BR9A 3KLSX 4N9PA 4TQUS 4HMIA 1SYGA 1F9SA 1X32A 4KY5A 5IGBA 1SNQA 2LMCB 1H9MA 3NE5B 1ESFA 2CVRA 4K2LA 3RUZA 2MJ8A 5DAUA 5AFWA 1W6JA 5JPNC 1FNWA 1TS3A 4OIKA 1HQRD 5EKLA 3E0JA 2EY2A 1VMPA 3A8IE 2NVTB 1M8AA 2KEEA 3KLSA 4Q5VA 1LT3D 3NSWA 2HQEA 3DXJC 1SSOA 1CZGA 5D3DA 2EY1A 2NZ1D 3PO3B 4L8JA 3JAML 3K5OA 4CHTB 2I07B 1BO0A 2A69D 2EJMA 4HAEA 1PMRA 2F0FA 1HCZA 3WOFA 4N9TA 3FRPB 1D1KA 3VR6A 2A73B 1U4MA 3J80L 3HKZB 4NKLA 1R9TB 3CKIB 5CV9A 5CGKA 5F2DA 4BA2I 2NB0A 1WTWA 3MC0B 2A68D 5DM73 4Q0FA 3F2UA 3FKIB 2XRQD 3A54A 1I50B 1VDZA 2SNSA 1OXUA 2RKSA 3G6JB 1GUSA 1KLGD 4XYQA 1A3VA 5J39A 4G7OC 1ESRA 3I91A 2TMPA 4DK0A 5ELFA 3TBIB 1ONLA 3TDQA 1AP0A 4RFBA 2HUGA 1AW7A 4RA8A 2TSSA 3FDTA 1IW7C 1EYDA 2L11A 3QB3A 1DOKA 4FXKC 2E75C 3S2DB 3HOWB 1C4QA 2JE6I 4X3UA 2F0VA 1U4LA 4A3EB 1STHA 3QJYA 4ID6A 4DFAA 2K5DA 1YNND 3U9SA 5FLXE 1HPCA 3GTLB 2XVSA 4F7XA 5EGTA 3OW7A 3I4LA 5C5MA 2F0HA 1D5XC 3TZDA 1GJXA 1Y1WB 1VMCA 1U9RA 1I4GA 1PFMA 2Q8IB 1ZKOA 3J7AV 1O7ZA 1RHPA 1HUMA 3S15B 3I3CA 4BY7B 1CM9A 1B4OA 2V4DA 2KVMA 5LL6X 1AFPA 3D6WA 2X69A 5I9OA 1EY8A 1VCIA 1O7YA 1X3QA 4ZK9B 5EPJA 3M3YB 3NTIA 5ELDA 4A3JB 3T13A 1CQVA 2RQXA 2XRSD 3J81L 2FJ2A 4DA2A 4A3BB 1Z7TA 4C3HG 1C8CA 3CRLC 1HHVA 2IT1A 4CBVA 1G291 4HN7A 4FP5D 4FNFA 3R2TA 3GTOB 4U68A 3NK9A 4QF4A 5C4JB 4TRDA 1R4PB 5C4HA 1I4QA 1B44D 4LMQD 1ML0D 4F8MA 3R3OA 1PZKD 4ZKCB 1JOOA 4A3DB 3A7AB 1CTMA 1LTGD 1PZID 1H9KA 2LKVA 2XWBB 1TS5A 4FO2A 1KNAA 5ELCA 2HCCA 2F0JA 5EJWA 5I4DA 1BUVT 1KABA 1LACA 3NUCA 5JPMC 1ZYRC 4XXEA 1Q1BA 2EXZA 2L12A 4J8QA 3U9OA 5KYIA 1TU2B 2B2WA 3DWAA 2E74C 2RDHA 1KDCA 1LTTD 4FF3A 4HSVA 4G7ZC 2VUMB 4C1NI 1E2WA 5G3LD 3HOZB 2RDFA 1EL0A 4I7ZC 3LNNA 3L7ZC 3SK5A 1F2LA 1JQYD 1PLFA 2KOLA 3D3RA 5JEAG 1DXMA 2ENBA 4C3IB 4DN4M 5E3FA 1IHZA 1I6HB 1EFID 4HCSA 2F0PA 3GTGB 2YU9B 3IKJA 1JWSD 1EYAA 2HCIA 1H9RA 2R7ZB 1GUNA 4BWGB 5C0XI 1V1PB 3VYSA 3PO2B 3S1NB 3QO2A 2ID0A 2KUMA 1Y8PB 2NUCA 2ZT9C 3MVVA 4IFDH 1SMYD 2X6GA 3ERQA 1GHKA 1K8OA 2NN6I 3VR5A 2L5TA 3M7GA 3MTSA 2O5IC 3L9AX 2MP1A 4OHJA 3OWEB 5C0XH 2PPBC 4C2MB 3EROA 1DD2A 3KF8A 5KEEA 1O7LA 5TSSA 1BDOA 5C4XB 3A56A 3AB9A 5T1IA 1NUCA 1PRTD 1GUGA 3DMUA 4B9XA 5E4XA 5C0XJ 2F0QA 3H0GB 4K5XA 3ND9A 5JVG3 1STEA 1Q1EA 5K5PA 1HTLD 1OXTA 5A35A 2K05A 2Z4IA 3PIO3 2NN6G 2H4OA 1K83B 4E6IA 5K36G 1U4PA 1B1ZA 4V190 3J7YW 2JA6B 4KMUC 1TY2A 1HA5A 4BBRB 3QWNA 2F0SA 1RTOA 3CRKC 4QMGA 4MHEA 2JEAI 3T51B 4ABNA 4XDXA 2K04A 3GP7A 1I6VC 4JBWA 3MAQA 1HXYD 1GOZA 1JOQA 1ENCA 1TWHB 2F3VA 2JA8B 5DEHA 5M5YB 4R8NA 2WACA 2K6AA 3FPPA 3OMCA 4G57A 2CQAA 3M4YA 2IWHA 3OIPA 1EQVA 1OO9B 2Z8LA 3A8KE 3J81E 1K8MA 1AZQA 3UI2A 4EVOA 2EYLA 1SNOA 2N55A 3HOUB 3MWYW 3H09A 2NVXB 1BNZA 3PUZA 2YYZA 2RDGA 3BYTB 1ILQA 4ULLA 4IZ8A 2BCOA 2LFNA 5CR3A 1F9QA 3OOCA 5ELBA 3I72A 4O42A 1BQQT 4F87A 3SK4A 4DAVA 3W2DA 2IPKD 1SNMA 1HFNA 2PMZB 2B2YC 1Q90A 3NPPA 1SYFA 2EYFA 4DNTB 1L0XB 1EWHA 3S1MB 5FKAC 1BXTA 1EY9A 2E2DC 3GTJB 2EE1A 1O78A 3IFTA 4DXGA 2NBFA 1LTBD 4OO1G 1KDAA 2B63B 2RSNA 1CK1A 2CHBD 4ZYSA 3VYUA 2ZXRA 4QCLA 5HURA 3PMFA 4KY6A 4KHVA 5I2YA 4RKBA 2BOSA 2F0EA 3IL8A 4RHRA 1A3UA 1TWGB 1QG7A 4TKOB 3FVQA 2DY8A 3OSOA 4FF4A 3A8JE 2FMCA 2A5HA 3T56B 4BY1B 3I4NB 4K6LA 1QNKA 3HG9A 3V05A 5I6WA 1ET6A 4IUPA 4ME5A 2SEBD 1FGBD 3WOEA 1DM0B 1S5ED 4OIJA 3BS1A 1A2TA 4KY7A 3VYRA 1PRTC 2KCNA 1JCKB 4IFDI 2VB2X 2FFKB 4WJWA 3C1EA 1IW7D 1ZXTA 2AWOA 2VB3X 4EQPA 1HFGA 3M4OB 2NN6H 1EY0A 1GHJA 2PNRC 2B2UC 2L0CA 2LS01 1D6EC 3X3MA 1UEAB 3GV3A 3H6MA 5KRUA 4G4KA 5JOBA 1A6XA 1D5MC 2Z4HA 3V2TA 2XIWA 2NTTA 3PIP3 2O5JC 2EYMA 4K8JA 1V1PA 2F0WA 1BBXC 4IURA 1LLRD 3PUWA 1DZ1A 2L1BA 5FLXL 2L9HA 1IKLA 5DNFA 5M5XB 5LL6S 5KYLA 1UAPA 1O80A 1V43A 3MXNA 3IFDA 1B50A 3N6RA 5IIFA 5EBCA 1TT2A 4FXGC 5LHY1 5IGGA 3W3AA 4KN4C 2XNAC 1IKMA 1Q8IA 2B2TC 2SDFA 4FYDA 4XYOA 2J4XA 3KBXA 2L4NA 2ZXOA 4PMCA 4GZYC 5BN5A 2F0GA 1Z47A 3K6OA 2K28A 4RCNA 3G7LA 3PV0A 5IT9E 3ND8A 2KHSA 3GTQB 5EPLA 2EYPA 3T53B 4P2CB 4HR7B 4DAYA 4K5VA 1PTOB 4R9WA 5IODA 2BE5C 3GQBA 1JOKA 2WB1B 4ZKBB 1X3PA 1MGSA 3D31A 3H94A 2K5QA 2XN9C 4XQNA 4IFDJ 3OHXC 5M3FB 4I65A 2RVLA 4OGQC 1M4VA 3NWSA 1WTXA 1E2ZA 1NR4A 5HGTA 1SYEA 1E2VA 3MFGA 3DEPA 3RMHA 5CBEE 2F0OA 1T5XD 2HDLA 2OF1A 2JA7B 3KBGA 1MI2A 1TKWB 4KKTA 4DNRB 2AUJD 3RZOB 4CJ2C 3E5SA 4M1UB 4KD4A 2OXPA 5C6AA 5I9PA 1QCBD 2F0NA 2PW7A 4EQOA 1U4RA 2BDNA 3MXUA 4O1NA 1UNSA 1BCPF 3QOLA 5A2QE 4HTHA 2D62A 1JC7A 3TN2A 1FD7D 5JEAH 5KNDA 2PO4A 2PZWA 1V1OA 3BVZA 3DWPA 1PZJD 2VNUD 1D5ZC 5EKIA 1XYIA 4WORA 3R2IA 1BCPD 4V0BA 2RA4A 2F0KA 3TP5A 4M8AA 3EQLC 5KGUA 3HS0C 1LV9A 4H7BA 3QG1A 2ICIA 1G2SA 1SNCA 4R8IA 1BCPC 2C5CA 4NDXA 1Y8OB 2K33A 5CV4A 1WTRA 5FO9B 1B2TA 4K14A 4DXFA 4IUTA 4H44C 3Q6SA 2FHTA 1CZWA 1HTPA 4Z9CB 2R93B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EPJ A;  5T1G A;  4QUC A;  2KOL A;  4XDX A;  2HDL A;  1WD0 A;  1MSG A;  1DZ1 A;  2K04 A;  2L1B A;  1B53 A;  1F9R A;  3DM1 A;  4DN4 M;  2L9H A;  1IKL A;  1MI2 A;  5DNF A;  1ILP A;  1GUW A;  1O80 A;  3HP3 A;  1J9O A;  3IFD A;  5EQ0 A;  4HCS A;  2H1E A;  1F9S A;  5CMD A;  1B50 A;  3IL8 A;  2FJ2 A;  1X32 A;  1EIG A;  2HCI A;  3DEO A;  1KNE A;  1SDF A;  2EOT A;  1NCV A;  2NWG A;  3I90 A;  4CJ2 C;  1QG7 A;  1S4Z A;  1ESR A;  4X3S A;  1C8C A;  1RJT A;  1EOT A;  1HA6 A;  3I91 A;  2JYO A;  1HHV A;  1NAP A;  2DY8 A;  3QO2 A;  2KUM A;  2NYZ D;  2MPM A;  5JJZ A;  3KUP A;  1EIH A;  4X3K A;  1IKM A;  1AZQ A;  2B2W C;  2X6G A;  1WTP A;  3UI2 A;  2CVR A;  1AP0 A;  4U68 A;  2B2T C;  2D9U A;  2HUG A;  1WVL A;  2N55 A;  1QNK A;  2SDF A;  1U4R A;  2BDN A;  3MTS A;  4RA8 A;  1ROD A;  1J8I A;  4IUP A;  2MP1 A;  2MJ8 A;  3KBX A;  3ONA B;  1PFB A;  4QUF A;  3MWY W;  2L4N A;  1RTN A;  2KEC A;  5COR A;  5EPK A;  3R93 A;  5AFW A;  1DON A;  3FDT A;  1BBX C;  1TVX A;  1WTQ A;  4LMQ D;  1BNZ A;  1ML0 D;  2K03 A;  4ZAI A;  2K1B A;  2L11 A;  2Q8R E;  1PDQ A;  1DOK A;  1EQT A;  2K28 A;  4OIK A;  4ZKC B;  4NW2 A;  3TN2 A;  1ILQ A;  4OIJ A;  2B2V A;  3G7L A;  5T1I A;  1VMP A;  1WTV A;  4XT1 B;  1M8A A;  2KEE A;  3SVM A;  2VXW A;  2B2T A;  4RWS C;  1F9Q A;  1JE4 A;  4X3U A;  1U4L A;  4IUQ A;  5EPL A;  1KNA A;  5E4X A;  2EPB A;  1B3A A;  2HCC A;  1SAP A;  4HED A;  5EJW A;  1G6Z A;  1SSO A;  2FFK B;  1NR2 A;  1Q3L A;  4XT3 B;  1DOM A;  3I8Z A;  1CA6 A;  4O42 A;  2J7Z A;  5EKI A;  1XYI A;  1ZXT A;  3N52 A;  2NZ1 D;  2M2L A;  1G2T A;  1IL8 A;  4UAI A;  1XX8 A;  2Q8T A;  2L12 A;  4R9W A;  4IUU A;  2B2Y A;  1HFN A;  1MSH A;  1HUN A;  4CJ0 B;  2B2Y C;  2B2W A;  1HFG A;  1WTO A;  4ZKB B;  1X3P A;  2RSO A;  2RA4 A;  1A15 A;  1WD1 A;  2IL8 A;  1MGS A;  3FPU B;  2FIN B;  2K05 A;  2JP1 A;  1BO0 A;  3TZD A;  1LV9 A;  5COY A;  2R3Z A;  2B2U C;  1PFN A;  4HAE A;  4X3T A;  3LWE A;  4ZLT F;  3GV6 A;  1VMC A;  1U4P A;  2EE1 A;  2MGS A;  2N88 A;  2RVL A;  4HSV A;  1G2S A;  1HRJ A;  1WTX A;  1AZP A;  4R8I A;  2B2V C;  1ICW A;  3GV3 A;  1PFM A;  5D65 A;  1CA5 A;  1O7Z A;  1EL0 A;  1RHP A;  2HDM A;  5E4W C;  1WTR A;  1HUM A;  1G91 A;  1U4M A;  4IUV A;  1B2T A;  3I3C A;  1NR4 A;  2K01 A;  1CM9 A;  2FMM A;  4IUT A;  2DY7 A;  1RTO A;  4RAU C;  1B4O A;  1F9P A;  2B2U A;  2KVM A;  2XIW A;  3P7J A;  3DEP A;  4MHE A;  3Q6S A;  5CBA E;  4CJ1 B;  2FHT A;  1DOL A;  2KED A;  1QE6 A;  1F2L A;  2RSN A;  4MN3 A;  5CBE E;  3H91 A;  1BF4 A;  1E0B A;  2X6L A;  1WTW A;  3D6W A;  2X69 A;  1PLF A;  1O7Y A;  1X3Q A;  3F2U A;  5D14 A;  1JIC A;  4ZK9 B;  4IUR A; 
#chains in the Genus database with same CATH topology
 4OL7 A;  4JI0 L;  2NVX H;  3TSS A;  3H3V H;  1GXD C;  2IX1 A;  2NVY B;  1F9R A;  3HOU H;  2CW0 C;  1WOC A;  3O13 A;  4BBS G;  2EYO A;  3FP9 A;  2G9H D;  1YHA A;  1KL9 A;  1HQM C;  5EQ0 A;  1C0A A;  3CAM A;  3I7F A;  2EVB A;  3ZJY C;  1SDF A;  1RDP D;  1OXS C;  1W2B A;  2OCE A;  4PMW A;  3PIO A;  2B8F A;  2I5H A;  3KJP A;  1EIH A;  4C3J B;  4ZRZ A;  5CV8 A;  3J80 E;  3LWU A;  1FNV A;  5LMN W;  1EZ8 A;  1WVL A;  3P20 A;  3BDL A;  4A93 G;  3KDF A;  3UDG A;  1KHI A;  2AQ2 B;  1DON A;  1NY4 A;  3A7L A;  3S17 H;  1Y1V H;  1A2U A;  1NTG A;  5AJ3 Q;  3J81 c;  3C46 A;  2N3S A;  3P75 A;  4C3I G;  5CV5 A;  3A5Z B;  5IGE A;  4UDU C;  5FO8 B;  4Y7N B;  3SHL A;  3HOV G;  2B2T A;  4PV1 C;  5FJ8 G;  1TWA B;  1JE4 A;  4BBR H;  1A3T A;  1B3A A;  3ULL A;  4BS9 A;  3HRZ C;  4WRD A;  4B3M Q;  4OON A;  3I8Z A;  1SYB A;  3FMC A;  1S5D D;  5IYC H;  4UY8 C;  4HMJ A;  3CCM A;  4UHV A;  2B2Y A;  3S17 B;  1IYJ B;  4DV0 L;  1KAA A;  1PYW D;  1LO5 D;  1PH5 A;  4HJ9 A;  1KQS A;  1EU4 A;  1STB A;  5C5L A;  3DUZ A;  1D2B A;  1PYB A;  5IWA L;  4JYA Q;  2XWJ B;  4ZLT F;  1HZ9 A;  3TEH B;  3HGB A;  3MFY A;  4A3G G;  1N36 L;  3MXG A;  1RD9 D;  3T4A C;  3OW2 A;  1EEF D;  2E76 C;  2ZTE A;  4QIW B;  5C4Z A;  4CDF C;  1X9N A;  1A8V A;  2HDM A;  2PNH A;  2VZA A;  3PUY A;  4HSP A;  2FMM A;  2K50 A;  2DY7 A;  2MO0 A;  2PZT A;  3CQZ B;  5NUC A;  2QF7 A;  4N8X 1;  1RF2 D;  5LMU Q;  1PRT B;  1PV4 A;  2NVY H;  3S2H B;  2C9O A;  5C4X H;  5M3M G;  2O2L D;  2EQS A;  1PA6 A;  1AN8 A;  5EBD A;  3EVQ A;  1IYV A;  4B3T Q;  3D6C A;  3GTM B;  1YNX A;  3D4D A;  1UE7 A;  2F4I A;  3A55 A;  2ICE C;  1GM5 A;  3EIV A;  4NXM Q;  1XJV A;  1K3B C;  2H1E A;  2BDO A;  2R92 H;  3K81 C;  3BZC A;  2IW3 A;  1EIG A;  3SEB A;  3PGZ A;  2LSS A;  4BXX H;  2AUK A;  3K5N A;  3KOJ A;  2R7Z H;  1NAP A;  1UUP A;  3HKZ G;  3K7U C;  3OTO Q;  3CC7 A;  4A3K B;  3GTG H;  5EKK A;  5KNB A;  3NP8 A;  2PQE A;  4XTC S;  4HCE A;  4ZQ3 A;  1V1Q A;  1Y8N B;  2D9U A;  4R4Q A;  2F0L A;  3ONA B;  1U5K A;  4J1M A;  1CQF A;  2BA1 A;  4PMB A;  2F0M A;  1RCV D;  1D1I A;  1EYC A;  2K03 A;  1QUQ B;  1SJH D;  2EYJ A;  1PDQ A;  3EFX D;  3NQI A;  4PQX A;  5FOB B;  3UDX A;  4NP5 A;  3MXP A;  3CCE A;  2B39 A;  3OIQ A;  1VQP A;  2K5N A;  1JB3 A;  4POF A;  1QWY A;  3S9W A;  4KD3 A;  1X65 A;  2VXW A;  3AEV A;  3SXH A;  4LWC A;  3VA5 A;  4AYB G;  2R61 A;  1G6Z A;  4FVM A;  4HED A;  1YNJ C;  1LT6 D;  4A3I G;  4XIG S;  2CWP A;  3S16 B;  4K2K A;  3Q24 A;  4JI3 Q;  2QGQ A;  3IRB A;  4IPH A;  1EU3 A;  1HUN A;  4PNY A;  1L0Y B;  1IBK Q;  1BOS A;  1I4R A;  2RSO A;  1JE5 A;  2OEO A;  1WD1 A;  3TP8 A;  2E2H B;  2JEB I;  3RZD B;  2JP1 A;  1LTA D;  1BKB A;  1STA A;  3F2D A;  4IQZ A;  4A3M B;  1VQA A;  5CC4 A;  2WAQ G;  4DAP A;  1QUQ A;  4RGN A;  1TII D;  2N88 A;  3K59 A;  5BN3 A;  1HRJ A;  4JK1 C;  2F0D A;  3HOY H;  1AH9 A;  1STG A;  2B63 G;  4P74 A;  3Q8D A;  3TP6 A;  4GLV B;  1TXY A;  1EEI D;  3KDF B;  2EJF C;  3P7J A;  4CJ1 B;  2YTV A;  1SJE D;  3K0X A;  3H3V I;  3NBI A;  5D14 A;  5C44 B;  4YWM A;  1Q82 C;  3Q23 A;  1ZEQ X;  2RHQ B;  4O2D A;  1MSG A;  3I4M B;  4A3I H;  4FDB A;  3K5M A;  2E2I B;  1L2F A;  1N36 Q;  1QOH A;  1GUW A;  4LFB L;  2KCT A;  3I73 A;  1FGU A;  3FEW X;  5FLM H;  1KNE A;  2NWG A;  5HY6 A;  5KNC A;  4JI2 Q;  1VF5 C;  2MHV A;  4TSS A;  1EOT A;  3ZYY X;  4B3T L;  2JYO A;  4BY1 G;  3I4N G;  1VQI A;  3WDN A;  2JQO A;  5E1F A;  3CCU A;  3MA2 B;  1SBB B;  3TP7 A;  1CKN B;  1UEB A;  2D2C C;  2A6H D;  4RHS A;  4BA1 I;  1ROD A;  5C3E B;  3KFU A;  2WII B;  3R93 A;  2D0P A;  4L5T A;  2DUD A;  5C44 H;  2K1B A;  3BDC A;  3GTP B;  2VQF Q;  3RLF A;  1XPU A;  2UXD L;  4WFN 3;  2QCP X;  3KF6 B;  4OEL B;  2WFW A;  1Z6H A;  3AQQ A;  2F0I A;  3DHQ A;  4BBR G;  3G6E A;  1FJG Q;  3SVM A;  1EOV A;  4IPC A;  5CYU A;  4CGY B;  1TS2 A;  1UE1 A;  3GTQ H;  2JSO A;  1VQE A;  4U67 3;  2EPB A;  4EGV A;  1CHQ D;  3M7N A;  3N52 A;  3HOY B;  1LTR D;  1XX8 A;  2EZV A;  2SOB A;  4ME3 A;  5A2Q L;  4A3M G;  3FHW A;  4FXD A;  4DU9 A;  5G3L F;  4A3L G;  2IL8 A;  2K5V A;  3FPU B;  1Y1W G;  2Z1C A;  3GO5 A;  3NWT A;  5GAH C;  1MHW C;  3K7A H;  1JWU D;  1FR3 A;  3KLR A;  1FJG L;  4GN3 B;  1HZB A;  1CT1 D;  3VR4 A;  4YWL A;  1CA5 A;  4DPG A;  1W3S A;  1HNZ Q;  1JT8 A;  5IY0 A;  5IP7 H;  1XTC D;  2QKI C;  2J0T D;  2ZM6 Q;  4BBS B;  2AKW B;  4CKB A;  1R4Q B;  3HOW H;  5IWA Q;  4JYA L;  1JB7 A;  4MN3 A;  4NPS A;  3S2D H;  1XPR A;  4QUC A;  5M5W H;  1EZ6 A;  1FYC A;  4G7H C;  5KIX A;  1YIJ A;  2DN8 A;  5ELE A;  5J1Z A;  1ILP A;  2BE5 D;  2UUA L;  5AJ3 L;  3SDZ A;  4A3K G;  3NTH A;  1IXR A;  2N8N A;  3HEJ A;  1CFM A;  1NMG A;  5M3F G;  1EUJ A;  4ILW A;  2MUY A;  4DR1 Q;  2M00 A;  1RJT A;  3C2P A;  1IZ6 A;  3D8G A;  2E8G A;  2WP8 J;  5IT9 L;  3IAY A;  3DLL A;  1EWC A;  1AEX A;  3PUV A;  2M9V A;  2WIN B;  2R92 B;  3JAM c;  2I0Q A;  1C9O A;  1SYC A;  2L55 A;  3R8B A;  4GNX A;  4C1N K;  4JBK A;  3M4O H;  5EPK A;  3I4M G;  4CDE C;  4JI6 L;  3K0Y A;  4WJ3 M;  1KXL A;  3C3L A;  4DGZ A;  3S2H H;  1WTV A;  1R9T H;  2K5W A;  4RGO S;  1JMC A;  3BDO A;  3E9H A;  1WI5 A;  4LF5 Q;  5IGF A;  1OXV A;  1SAP A;  1HR0 W;  4X64 L;  1NR2 A;  1Q3L A;  3OWF A;  4KLK A;  4DF7 A;  2M2L A;  4ODG A;  1H9S A;  5BR8 Q;  4R1J A;  4DV2 L;  1PXU A;  4YIJ A;  4CJ0 B;  4J15 A;  4KHZ A;  3VDY A;  4LAA A;  4LK1 C;  2WB1 E;  4S3S A;  4QQB X;  4YHH Q;  4LF6 Q;  3EJI A;  3K8A A;  1WCM B;  2F1M A;  4KKU A;  1QNU A;  1LTL A;  1KDB A;  1I4H A;  4JOI A;  2GA4 B;  4OO1 H;  3X3N A;  3CD6 A;  2LY7 A;  2Y0S B;  3Q22 A;  4A75 A;  5D65 A;  5FK9 C;  1NSN S;  4L5Q A;  5E4W C;  3HOV B;  1EY6 A;  4JI8 Q;  4LF9 Q;  2IX0 A;  1KIX A;  2PZU A;  1CKM A;  4AYB B;  3K5L A;  3GTK B;  2JXM B;  2KED A;  3S1Q H;  1QE6 A;  1LM0 A;  3H91 A;  4GOP C;  2WKD A;  2X6L A;  2AQ1 B;  1YBY A;  4F88 A;  1JIC A;  1ZYR D;  1Y1V B;  1G6P A;  1DYQ A;  2EJG C;  1GUO A;  4KN7 C;  4DK1 A;  2B29 A;  4HIK A;  5M9O A;  2MNA A;  4A3D G;  1X56 A;  2SNM A;  2BA0 A;  1TS4 A;  4X65 L;  1SEB D;  4K6D A;  1WCM G;  4LNQ A;  4NXN Q;  5LMN L;  2KJX A;  1IL2 A;  3JAM E;  5CV7 A;  1PH8 A;  2UUC Q;  1SE8 A;  1T5E A;  1JJ2 A;  1YNN C;  2PQA A;  4ZCK A;  3Q0A A;  1VF7 A;  4IN3 A;  2ZJP A;  2Z0S A;  2OWO A;  2UXB L;  2B2W C;  3A5U A;  1SR3 A;  3SK6 A;  1PH3 A;  1EY4 A;  1X54 A;  1XXG A;  2JA5 B;  1X3G A;  4DAM A;  3L3O C;  2KEC A;  1II3 A;  4CKE A;  3KF8 B;  1L0W A;  1WTQ A;  1CHP D;  2A6E C;  3MEH A;  2XSC A;  4ZAI A;  1LT5 D;  4FF1 A;  1EQT A;  1CKN A;  1SMX A;  1QVG A;  2PCF B;  1E1O A;  1GUT A;  4RWS C;  2ALY B;  4IAL A;  2CW0 D;  2N49 A;  1SE3 A;  2KQ3 A;  4XT3 B;  5CV6 A;  2J7Z A;  1SND A;  3AU7 A;  3H3V C;  4B3R L;  1QVC A;  4CKC A;  1VQD A;  1SNP A;  2HD3 A;  4KK7 A;  1P16 A;  4JCV E;  2JA5 H;  2G9D A;  1JWM D;  2FIN B;  3VYT A;  4A3C H;  1SMY C;  3D4R A;  4QB4 A;  3BG3 A;  4CDD C;  1PYS B;  1PH9 A;  4X3T A;  2KHJ A;  2GVA A;  3NBH A;  2A74 C;  2QDB A;  3K57 A;  2AQ3 B;  3EN2 A;  4X62 L;  1ICW A;  1V8Q A;  5JVH 3;  1F2Z A;  1PTO C;  3CHB D;  4C3H B;  5C3W A;  4IUV A;  1G8Z D;  1SE2 A;  1K8A C;  4GKJ L;  5JEA J;  1AE2 A;  2JA8 H;  2UXC L;  4RAU C;  1ENF A;  3T16 A;  3T1H L;  4PZ6 A;  1B9N A;  1ASY A;  4L63 B;  4DR5 L;  3B6Y A;  1Q12 A;  2WKC A;  3SK8 A;  1G2T A;  4UAI A;  1SE4 A;  1Q81 C;  5T1G A;  4POG A;  3E6Z X;  1I3Q H;  1LTS D;  4B3S L;  3I4O A;  1ET9 A;  1TR5 A;  1SYD A;  3GTK H;  3S1Q B;  1PRT F;  1H9J A;  2B3G A;  4LJZ C;  2WAQ B;  2F52 A;  5CMD A;  4RGT A;  1PHJ A;  1S5F D;  4DUY L;  3I90 A;  4JI7 Q;  3NHH A;  3TZU A;  1F2M A;  1VQJ A;  1PH7 A;  1TQO A;  4A3G H;  4A93 B;  5DLQ E;  4OO1 I;  3RZO H;  2NYZ D;  2MPM A;  5JJZ A;  2F03 A;  1K83 H;  3MZ5 A;  1QB5 D;  2KBN A;  1WTP A;  1S5C D;  3UDI A;  1SN8 A;  3BVG A;  1XTD A;  1J8I A;  4QY7 A;  4X64 Q;  2EY5 A;  3KJO A;  1FNU A;  1TWC B;  1ENA A;  5JJK A;  1KLU D;  2EDG A;  4LUV A;  1DJR D;  4DV4 L;  5ISR A;  1YNJ D;  2WV6 D;  4NW2 A;  1MJC A;  4GLX A;  2K7V A;  2ZXP A;  3H0G H;  2HT1 A;  2BH2 A;  4ZUI A;  1B9M A;  1C48 A;  2VL6 A;  4RG1 A;  2A8V A;  4B9W A;  3VA7 A;  3RNU A;  2E2J B;  1F2Y A;  4H13 C;  1MBY A;  1DOM A;  1BCP B;  1H9S B;  1XWE A;  4FF2 A;  1LTI D;  3M9B A;  2Z6K C;  3V96 A;  1MSH A;  1HNZ L;  3JC6 6;  1A15 A;  1OXX K;  1IBL L;  3CC2 A;  1S40 A;  5COY A;  4A3F H;  2HHH Q;  1JR0 D;  1PFN A;  3UE0 A;  2NTS A;  4IFD G;  3PQI A;  2MGS A;  1PTO H;  4JI1 L;  4L5S A;  3VR3 A;  4LFB Q;  2Z6B A;  4MTN A;  4DR3 Q;  2IX3 A;  2K32 A;  4GKK L;  2CFM A;  5M3M B;  3KLW A;  1GVP A;  4H02 A;  1DCZ A;  4JI5 Q;  5ELN A;  3VR2 A;  4GS3 A;  1XMQ Q;  1GD7 A;  3BZD B;  3D4W A;  1V9P A;  4AH6 A;  4DNI A;  2AMC B;  2QDL A;  4MIU A;  1K9M C;  3SR1 A;  4RCO A;  2MQH A;  3S14 B;  3STB D;  4H0L C;  4RKL A;  4C3I H;  4DV7 Q;  1VQ8 A;  1CI3 M;  1PTO F;  2KEN A;  5M5W B;  3E9I A;  1NNX A;  1WD0 A;  5I2X A;  5FO7 B;  2LXK A;  1WTH A;  3DM1 A;  2B8G A;  2AHO B;  3RR5 A;  3HP3 A;  1J9O A;  4B08 A;  2Z9H A;  1Z9F A;  1LAB A;  2EOT A;  1YHB A;  1S4Z A;  4EQN A;  3J81 j;  3HOZ H;  3PO3 G;  1HA6 A;  1SFO B;  5IYD H;  4K8I A;  4DV3 L;  3P1H A;  2G5D A;  5IGD A;  3KUP A;  4JV5 L;  4X3K A;  1STN A;  3K7A B;  1B70 B;  2D5D A;  4XQJ A;  3HKS A;  5IOC A;  3QIA A;  3URY A;  2L15 A;  3HOX G;  4L6T B;  3K58 A;  4A3B G;  2A69 C;  4J6H A;  4DKA C;  5ELO A;  2O4X A;  1TVX A;  1W6K A;  4KKS A;  3CC4 A;  2B2V A;  3BVM A;  3JAM i;  4XT1 B;  2PYK A;  1TY0 A;  1KRS A;  4KJO A;  2KHI A;  3CU7 A;  1QIL A;  2I46 A;  2F4V L;  2ES2 A;  1EWI A;  1VQG A;  5M3M H;  5C4X G;  2EYH A;  4JW0 A;  1PTO D;  3TME A;  4IOC A;  1IL8 A;  2Q8T A;  4IUU A;  4C3J G;  4JBM A;  1WTO A;  2Y0S E;  4UP8 A;  4A3F B;  2UU9 L;  2HIV A;  4C56 C;  3HFZ B;  3WWV A;  5IGC A;  3T1H Q;  3OYY A;  5D3I B;  1D8L A;  1XPO A;  3S1R B;  3QR8 A;  2AWN A;  2JJQ A;  2R6G A;  3HZX A;  3KK7 A;  2KCC A;  3CME A;  3F8T A;  2F3W A;  4RH6 A;  1IYU A;  1AZP A;  1X3F A;  2B2V C;  1NE3 A;  5BN4 A;  2OT2 A;  4A3B H;  1STY A;  3DWQ A;  2NZO A;  4DV0 Q;  3W1B A;  4KJN A;  1K28 A;  1G91 A;  4DV6 Q;  5C3X A;  4JI3 L;  2K01 A;  4UPA A;  4HJA A;  1XMO L;  3NTK A;  2OTJ A;  1DOL A;  3MHB A;  5J22 A;  5C0X G;  4A3I B;  1E0B A;  4A3J H;  1EY5 A;  3OPO A;  3M85 A;  1LYL A;  3M3Y H;  4ZUJ A;  3KYH C;  4KTA A;  5IYB G;  2K4K A;  1TWC H;  2A6E D;  1B53 A;  3PUX A;  2R93 G;  1CSQ A;  4LF4 L;  2NVQ B;  2PW5 A;  3NXW A;  2K5H A;  4EX5 A;  3BYY B;  1I4P A;  2DNC A;  2QEJ C;  2F0T A;  3S15 H;  4XQQ A;  1TWF B;  1Y69 U;  4IJL A;  3DEO A;  4DUZ L;  1LT4 D;  1NCV A;  4A93 H;  4X3S A;  4A3G B;  3HOX B;  3J7A F;  1TWG H;  2WB1 G;  5GAG C;  4KHP Q;  4DV7 L;  3QOJ A;  5H1S E;  5JAV A;  2ATW A;  4OEM B;  2E2H H;  2QW7 A;  4DR4 L;  5K36 H;  4QUF A;  1YVC A;  1I3Q B;  1PFB A;  2IJ0 A;  3ULJ A;  1RTN A;  5COR A;  4OXP A;  4LF4 Q;  4K5W A;  2Q8R E;  2DNE A;  1MD2 D;  2QIL A;  2B63 H;  2RBM A;  3RD4 A;  4IUQ A;  3A74 A;  3C1F A;  1CA6 A;  4RGM A;  2ZTC A;  1I4X A;  2UXC Q;  1QJO A;  4DR4 Q;  3GTJ H;  1BBW A;  2VQF L;  4JI5 L;  4GLA C;  3CPW A;  2A6H C;  3KF6 A;  3I70 A;  3CXC A;  1SXT A;  3SE0 A;  3PF5 A;  3OMG A;  2R3Z A;  4DR2 L;  1EIY B;  5I6Y A;  3AMU A;  1JOR A;  2F0U A;  3LWE A;  3GV6 A;  1CSP A;  3CMA A;  3U4Z A;  5L37 A;  1GKH A;  1Y14 B;  3ITP A;  4LF5 L;  1NBW A;  3NQT A;  1SRO A;  2A68 C;  1IBK L;  1NMF A;  2PMZ E;  4B3S Q;  2EIF A;  1KTK A;  2KA7 A;  4NXM L;  2CWA A;  1F9P A;  2B2U A;  5C44 G;  2VW9 A;  1EY7 A;  1YEZ A;  3L2P A;  4KV6 A;  5CBA E;  1RKN A;  3EA6 A;  1BF4 A;  3GTM H;  4OWW B;  1HR0 Q;  1F77 A;  3GD7 A;  1VQL A;  1L1O B;  3FKI H;  3LX0 A;  4KI0 A;  4IUN A;  4NMZ A;  3OTO L;  1S5B D;  4DR6 L;  5DM6 3;  2EY6 A;  1BR9 A;  3KLS X;  3U4V A;  4N9P A;  3CQZ H;  3E0E A;  4DV4 Q;  4TQU S;  4HMI A;  1SYG A;  1F9S A;  1B8A A;  1X32 A;  4KY5 A;  3T1Y Q;  5IGB A;  1SNQ A;  3PF4 A;  1L1O C;  2LMC B;  1E24 A;  1H9M A;  3NE5 B;  4CDC C;  1ESF A;  1TWH H;  2CVR A;  4K2L A;  3RUZ A;  4YCU A;  2DJG C;  2MJ8 A;  5DAU A;  1K0S A;  4LUO A;  1W6J A;  5AFW A;  5JPN C;  2NZH A;  1FNW A;  4QIW E;  1TS3 A;  2DJF C;  4OIK A;  1Y1V G;  1HQR D;  3ER0 A;  4KHP L;  5EKL A;  3E0J A;  2EY2 A;  1VMP A;  3A8I E;  5FJ8 H;  4PZ8 A;  4JVZ A;  1VQ7 A;  2NVT B;  4P73 A;  1M8A A;  2KEE A;  3KLS A;  1TWA H;  4Q5V A;  1LT3 D;  4X62 Q;  4Y7N H;  3NSW A;  5E7N A;  2HQE A;  4DV5 L;  2NVT H;  3DXJ C;  3HOV H;  2EXD A;  1SSO A;  4DV1 L;  4BY7 G;  1CZG A;  5D3D A;  2Q2T A;  2EY1 A;  2JA6 H;  1N34 L;  2NZ1 D;  3PO3 B;  4L8J A;  3W1G A;  3JAM L;  4LF8 L;  3K5O A;  4CHT B;  2H5X A;  4AYB E;  2I07 B;  1BO0 A;  2A69 D;  1LUZ A;  2EJM A;  4JPB W;  4HAE A;  3U50 C;  1PMR A;  2F0F A;  3CCQ A;  1HCZ A;  3WOF A;  4N9T A;  3FRP B;  1D1K A;  4YCW A;  3VR6 A;  1UE6 A;  4AQY Q;  2ZJR A;  2A73 B;  1U4M A;  3J80 L;  4B3R Q;  4DR7 L;  3HKZ B;  5BR8 L;  4NKL A;  1R9T B;  3CKI B;  5CV9 A;  5CGK A;  5F2D A;  4BA2 I;  2NB0 A;  1WTW A;  3MC0 B;  2A68 D;  4Q0F A;  1E3P A;  5DM7 3;  3F2U A;  3FKI B;  4C2M H;  2XRQ D;  3A54 A;  1I50 B;  4DV3 Q;  2R93 H;  1RL2 A;  5IP9 G;  1VDZ A;  2SNS A;  1OXU A;  2RKS A;  3G6J B;  3CCJ A;  1KD1 C;  1GUS A;  4A3C G;  1J6Q A;  1KLG D;  4XYQ A;  1A3V A;  5J39 A;  3F1Z A;  4IPG A;  4JI8 L;  1WJJ A;  4I7A A;  2R92 G;  4G7O C;  1ESR A;  3J80 i;  3I91 A;  1N32 Q;  2YU9 H;  2TMP A;  4HJ5 A;  4YWK A;  4DK0 A;  2R7Z G;  5ELF A;  3TBI B;  1ONL A;  3TDQ A;  1AP0 A;  4RFB A;  2HUG A;  2ZTD A;  1S72 A;  1AW7 A;  4RA8 A;  2TSS A;  2E5L Q;  3U58 A;  4NXN L;  1PVO A;  3FDT A;  1IW7 C;  1EYD A;  2L11 A;  3QB3 A;  1DOK A;  4FXK C;  4GOP B;  2E75 C;  3S2D B;  2CQO A;  3HOW B;  1C4Q A;  2UU9 Q;  1E7Z A;  2UUC L;  2JE6 I;  4X3U A;  2F0V A;  1U4L A;  4A3E B;  1STH A;  3QJY A;  4ID6 A;  3NEM A;  4DFA A;  2K5D A;  1YNN D;  3U9S A;  5FLX E;  2K75 A;  4JG2 A;  4MTK A;  5GAE C;  1YJ9 A;  2VUM H;  1HPC A;  3GTL B;  2XVS A;  4F7X A;  5EGT A;  3OW7 A;  3I4L A;  5C5M A;  1UE5 A;  3MEF A;  2F0H A;  1D5X C;  3TZD A;  1XMO Q;  1T9H A;  1KRT A;  4DV1 Q;  1GJX A;  1K3R A;  2Q2I A;  1Y1W B;  1VMC A;  1U9R A;  2R7D A;  1I4G A;  1PFM A;  2Q8I B;  1ZKO A;  2CCZ A;  1HNW Q;  3J7A V;  1O7Z A;  1RHP A;  4LF8 Q;  1HUM A;  2PI2 E;  3S15 B;  3I3C A;  4BY7 B;  4LF6 L;  1CM9 A;  2IY5 B;  1B4O A;  2V4D A;  2KVM A;  2NVQ H;  5LL6 X;  1AFP A;  3T1Y L;  4DUZ Q;  3GTP H;  3D6W A;  2X69 A;  5I9O A;  1EY8 A;  4TVA B;  1VCI A;  1O7Y A;  1X3Q A;  2OQK A;  4ZK9 B;  1VQ4 A;  5EPJ A;  2HHH L;  3M3Y B;  4P71 A;  5J3B A;  5C4J H;  3NTI A;  4DK6 C;  5ELD A;  4A3J B;  1XNR Q;  3HKZ E;  3T13 A;  3GTO H;  1CQV A;  2RQX A;  2XRS D;  5FLM G;  3J81 L;  4R4I A;  4GKK Q;  2FJ2 A;  4K0K Q;  4DA2 A;  2OTL A;  1Z7T A;  3LGJ A;  4A3B B;  2JA7 G;  4GKJ Q;  4JI6 Q;  4C3H G;  1C8C A;  3CCV A;  4DR7 Q;  3CRL C;  3D0F A;  1HHV A;  2IT1 A;  4CBV A;  1G29 1;  5FLX c;  5C3E G;  2JA5 G;  4HN7 A;  4R4O A;  3RLO A;  4FP5 D;  4FNF A;  3R2T A;  3S1R H;  1PH4 A;  3GTO B;  4U68 A;  2E2I H;  1X55 A;  1VQN A;  3NK9 A;  4QF4 A;  1VQC A;  5C4J B;  4TRD A;  1EFW A;  3TRE A;  1R4P B;  5C4H A;  1I4Q A;  1B44 D;  4LMQ D;  1D7Q A;  1ML0 D;  4F8M A;  3R3O A;  1PZK D;  4ZKC B;  1JOO A;  2GVB A;  4A3D B;  3A7A B;  4OWX B;  1CTM A;  1LTG D;  1DGS A;  3HOU G;  1PZI D;  1H9K A;  4JI4 L;  2LKV A;  2XWB B;  4BY7 H;  1TS5 A;  1P8L A;  4FO2 A;  1KNA A;  5ELC A;  2HCC A;  2F0J A;  5EJW A;  5I4D A;  1BUV T;  1KAB A;  1LAC A;  1EQQ A;  3NUC A;  5JPM C;  1ZYR C;  4XXE A;  4DAY B;  2ZM6 L;  1Q1B A;  2EXZ A;  2L12 A;  4J8Q A;  3U9O A;  4A3L H;  5IYD G;  5KYI A;  1TU2 B;  2B2W A;  1Y1W H;  3DWA A;  4A3M H;  2UUB Q;  2E74 C;  2RDH A;  4HJ7 A;  1KDC A;  1LTT D;  1M90 C;  1QVF A;  1M1K C;  4FF3 A;  4HSV A;  4G7Z C;  2VUM B;  4C1N I;  1E2W A;  4A4I A;  1YZ6 A;  5G3L D;  2UUA Q;  3HOZ B;  1GO3 E;  4GN4 B;  4OX9 L;  2RDF A;  1EL0 A;  4GOP A;  1YHQ A;  4I7Z C;  4RMF A;  3LNN A;  4A3E H;  1FVI A;  3ICE A;  3L7Z C;  3SK5 A;  3TRZ A;  3HOY G;  4HID A;  2K52 A;  1F2L A;  1JQY D;  1VQK A;  2D0O A;  3M4Q A;  1PLF A;  1YI2 A;  2BH8 A;  2KOL A;  3D3R A;  5JEA G;  1DXM A;  1HNW L;  2ENB A;  3UE1 A;  4C3I B;  3S14 H;  1VS0 A;  4DN4 M;  1XMQ L;  4QJF A;  5E3F A;  3ULP A;  3M4P A;  1IBM L;  1IHZ A;  3BJU A;  5IT9 c;  1I6H B;  1EFI D;  4LUZ A;  4HCS A;  2F0P A;  3FKI G;  4A3K H;  4O0A A;  3GTG B;  3L0O A;  3IKJ A;  1JWS D;  1EYA A;  1L1O A;  1H9R A;  2HCI A;  3J80 c;  2YU9 B;  1GUN A;  4BWG B;  2R7Z B;  5C0X I;  1VQF A;  1V1P B;  3VYS A;  3PO2 B;  3S1N B;  1JJG A;  3QO2 A;  2ID0 A;  2KUM A;  1Y8P B;  2RCF A;  2NUC A;  2ZT9 C;  3MVV A;  2LXJ A;  1PFS A;  4IFD H;  1SMY D;  2X6G A;  3ERQ A;  1N34 Q;  2OQ0 A;  1GHK A;  4LFA Q;  4X66 L;  1K8O A;  2NN6 I;  3VR5 A;  3G4S A;  2L5T A;  3M7G A;  3MTS A;  2ZJQ A;  2O5I C;  1RIP A;  3L9A X;  2MP1 A;  1K8G A;  4OHJ A;  4NB3 A;  2YV5 A;  3OWE B;  5C0X H;  1I50 H;  4DUY Q;  4A3E G;  4JI7 L;  4A3J G;  2PPB C;  4YHH L;  4C2M B;  4JI2 L;  3ERO A;  1DD2 A;  3KF8 A;  4HJ8 A;  5KEE A;  1O7L A;  2Z6K A;  5TSS A;  1BDO A;  1ICF B;  5C4X B;  3A56 A;  3AB9 A;  1X6O A;  1VQM A;  5T1I A;  4YCV A;  1NUC A;  4A76 A;  3S24 A;  2E2J H;  1N33 Q;  4UP9 A;  4X6A H;  1PRT D;  4DR1 L;  3PIP A;  3AFQ A;  1U0L A;  1GUG A;  3DMU A;  4B9X A;  5E4X A;  5C0X J;  2F0Q A;  3H0G B;  4K5X A;  3ND9 A;  3A0J A;  3I56 A;  2GN5 A;  5JVG 3;  1STE A;  1EIF A;  3CP0 A;  3CPF A;  1Q1E A;  2UXD Q;  5K5P A;  1HTL D;  1OXT A;  5A35 A;  1PH1 A;  1SRU A;  2K05 A;  2Z4I A;  3PIO 3;  2NN6 G;  2H4O A;  1K83 B;  4E6I A;  5LMU L;  5K36 G;  3RLN A;  2JK8 A;  1U4P A;  1B1Z A;  4V19 0;  3PO3 H;  3UDF A;  3J7Y W;  2JA6 B;  1QZH A;  1XNQ L;  1PH6 A;  4X65 Q;  4KMU C;  3PO2 G;  1TY2 A;  1HA5 A;  4BBR B;  3QWN A;  2F0S A;  5HGQ A;  1RTO A;  3CRK C;  3PCO B;  4QMG A;  4MHE A;  3ERS X;  2JEA I;  4ALP A;  3T51 B;  1A63 A;  1E22 A;  2UXB Q;  4ABN A;  4DR3 L;  4XDX A;  3AFP A;  2K04 A;  3GP7 A;  3SGI A;  1I6V C;  4JBW A;  1Q46 A;  2A19 A;  4IO9 A;  3MAQ A;  1HXY D;  1GOZ A;  2WAQ E;  1JOQ A;  1ENC A;  2ASB A;  2HIX A;  1TWH B;  2F3V A;  4OX9 Q;  2JA8 B;  5DEH A;  5M5Y B;  4C3J H;  4R8N A;  4C3H H;  5IYC G;  2WAC A;  2K6A A;  3FPP A;  3OMC A;  2IHE A;  2RHS B;  4G57 A;  2CQA A;  2KCM A;  3M4Y A;  2IWH A;  3OIP A;  1EQV A;  1OO9 B;  2Z8L A;  3A8K E;  3J81 E;  1K8M A;  1CUK A;  5GQO A;  1AZQ A;  1N8R C;  3UI2 A;  4EVO A;  2EYL A;  1SNO A;  2N55 A;  4JI0 Q;  4AIM A;  3HOU B;  4WJ4 A;  4K0K L;  3MWY W;  1YJN A;  3H09 A;  1HNX L;  2NVX B;  1BNZ A;  2FXQ A;  3PUZ A;  1IBM Q;  2YYZ A;  2RDG A;  1PH2 A;  3BYT B;  1C7Y A;  1ILQ A;  1BBU A;  1IBL Q;  4ULL A;  4IZ8 A;  2BCO A;  2LFN A;  5CR3 A;  1F9Q A;  3OOC A;  5ELB A;  4JBJ A;  3I72 A;  4O42 A;  1BQQ T;  1I94 Q;  2YTY A;  4F87 A;  4MNO A;  4A3F G;  3SK4 A;  4X66 Q;  4DAV A;  4LFA L;  2MO1 A;  3W2D A;  2IPK D;  1SNM A;  3BU2 A;  1X3E A;  1HFN A;  2PMZ B;  2B2Y C;  1VQ5 A;  1Q90 A;  3NPP A;  4JOI C;  1SYF A;  2EYF A;  4DNT B;  4HIM A;  3BZK A;  1L0X B;  1MKH A;  1O7I A;  1EWH A;  3S1M B;  5FKA C;  1BXT A;  1JJC B;  3CCS A;  1EY9 A;  2E2D C;  3GTJ B;  4EQ5 A;  2EE1 A;  5EAY A;  3TS2 A;  1O78 A;  1Q8K A;  3IFT A;  4DXG A;  1J5E L;  4LW1 A;  2NBF A;  5M5Y H;  1LTB D;  4OO1 G;  1KDA A;  4Y52 H;  2B63 B;  2RSN A;  4JV5 Q;  1MJE A;  1CK1 A;  2CHB D;  4ZYS A;  3VYU A;  2ZXR A;  4QCL A;  5HUR A;  4PG3 A;  3PMF A;  4KY6 A;  2PI2 A;  4LF9 L;  4KHV A;  1Q86 C;  2VQE L;  5I2Y A;  4RKB A;  1A0I A;  2BOS A;  2F0E A;  3IL8 A;  4RHR A;  1A3U A;  1TWG B;  1QG7 A;  3HOX H;  1NJI C;  4TKO B;  3FVQ A;  3J81 i;  2DY8 A;  3OSO A;  4FF4 A;  2F4V Q;  3A8J E;  2FMC A;  1TWF H;  2A5H A;  3T56 B;  1WCM H;  1HR0 L;  2RF4 A;  3NEL A;  4BY1 B;  3I4N B;  4K6L A;  1QNK A;  2JA7 H;  3HG9 A;  3V05 A;  5I6W A;  1ET6 A;  4IUP A;  3HOW G;  5IP7 G;  5LMN Q;  1K73 C;  1I5F A;  2VQE Q;  4ME5 A;  2SEB D;  1FGB D;  3WOE A;  3H0G G;  1DM0 B;  1S5E D;  4DV2 Q;  4OIJ A;  3BS1 A;  1A2T A;  5IE8 A;  4KY7 A;  3VYR A;  1PRT C;  2KCN A;  4JI1 Q;  2K14 A;  1JCK B;  4IFD I;  1YIT A;  2VB2 X;  3MXN B;  4YY3 L;  1N32 L;  1ASZ A;  2FFK B;  3G71 A;  4WJW A;  1Q7Y C;  3C1E A;  4UP7 A;  3DM3 A;  1IW7 D;  1ZXT A;  3I55 A;  2AWO A;  2VB3 X;  4EQP A;  4LFC L;  1G51 A;  1VQB A;  1HFG A;  3M4O B;  1CKO A;  5M3F H;  2NN6 H;  1EY0 A;  1GHJ A;  2PNR C;  1VQO A;  2B2U C;  2L0C A;  3S1N H;  2LS0 1;  1D6E C;  3X3M A;  3PO2 H;  1UEA B;  3GV3 A;  3H6M A;  4MZ9 A;  4G4K A;  2P5Z X;  5KRU A;  5JOB A;  1A6X A;  1D5M C;  2Z4H A;  3V2T A;  2JA9 A;  4P75 A;  5IYB H;  1I6H H;  4GN5 A;  2XIW A;  2NTT A;  4LFC Q;  3PIP 3;  2O5J C;  2EYM A;  4DR2 Q;  4K8J A;  4IPD A;  4APV A;  2C35 B;  1V1P A;  4QL5 A;  2F0W A;  4PZ7 A;  2VS1 A;  1BBX C;  4IUR A;  1LLR D;  3G48 A;  4DK3 C;  3STB C;  2JA8 G;  3PUW A;  1DZ1 A;  4BXX G;  2CKZ B;  2L1B A;  3CW2 C;  5FLX L;  3PSI A;  2L9H A;  1SLJ A;  1IKL A;  5DNF A;  5M5X B;  5LL6 S;  5KYL A;  1UAP A;  1O80 A;  2VY3 A;  4BBS H;  1V43 A;  3MXN A;  3IFD A;  3H15 A;  2MFI A;  1B50 A;  3N6R A;  5IIF A;  4DR5 Q;  5EBC A;  3J7Z C;  3HOZ G;  2JA6 G;  1TT2 A;  1SFO H;  4FXG C;  5LHY 1;  1OTC A;  2N78 A;  5IGG A;  3W3A A;  4KN4 C;  2XNA C;  4DR6 Q;  1IKM A;  1Q8I A;  2B2T C;  5M5X H;  3TQY A;  4DV5 Q;  2SDF A;  4FYD A;  4XYO A;  1XNR L;  2J4X A;  3KBX A;  4B3M L;  4GNX B;  2L4N A;  1WFQ A;  2ZXO A;  4PMC A;  1I94 L;  4GZY C;  5BN5 A;  2F0G A;  1Z47 A;  3K6O A;  2K28 A;  4RCN A;  3G7L A;  3PV0 A;  5IT9 E;  3ND8 A;  2KHS A;  3GTQ B;  2Q2U A;  2Q2H A;  5EPL A;  2EYP A;  3T53 B;  4P2C B;  1HZC A;  4HR7 B;  4A3D H;  4DV6 L;  2I5M X;  4DAY A;  4JC0 A;  4GNX C;  4K5V A;  1PTO B;  4R9W A;  5IOD A;  5IP9 H;  2BE5 C;  3GQB A;  1JOK A;  2WB1 B;  3NEN A;  1X3P A;  4ZKB B;  1VQ6 A;  5C3E H;  3TS0 A;  1MGS A;  1EQR A;  3D31 A;  5GAD C;  1HH2 P;  3H94 A;  2K5Q A;  2XN9 C;  4XQN A;  4IFD J;  3OHX C;  5M3F B;  4I65 A;  4IJH A;  2RVL A;  4OGQ C;  1M4V A;  2DGY A;  3NWS A;  1WTX A;  2IHF A;  4YY3 Q;  1E2Z A;  2V1C C;  1NR4 A;  4R4C A;  5HGT A;  1SYE A;  1E2V A;  1AE3 A;  3MFG A;  3DEP A;  3RMH A;  5CBE E;  3I4M H;  2F0O A;  1HJP A;  1T5X D;  2HDL A;  4L5R C;  4AQY L;  2OF1 A;  4P72 A;  2QEX A;  2JA7 B;  2JN4 A;  1MI2 A;  3KBG A;  4BY1 H;  3I4N H;  1B7Y B;  4KKT A;  1TKW B;  2CH4 W;  4DNR B;  2E5L L;  2AUJ D;  3RZO B;  5GRO A;  1HNX Q;  4QGU A;  4CJ2 C;  1N33 L;  1MIU A;  3E5S A;  2VUM G;  4M1U B;  4KD4 A;  2OXP A;  3E3X A;  3RN5 A;  1K0R A;  5C6A A;  2CH4 A;  1A62 A;  5I9P A;  1QCB D;  2F0N A;  2PW7 A;  1KAW A;  3F2B A;  4EQO A;  4IOA A;  3RZD H;  2I5L X;  4N8F A;  1U4R A;  2BDN A;  3MXU A;  3CCL A;  4O1N A;  1UNS A;  2HQL A;  3NBH B;  2XGT A;  3F2C A;  3GTL H;  1BCP F;  3QOL A;  5A2Q E;  4HTH A;  2D62 A;  1JC7 A;  3S16 H;  3TN2 A;  1N9W A;  1FD7 D;  5JEA H;  5KND A;  2PO4 A;  2Y0S G;  2PZW A;  4OWT B;  2PQA B;  2QA4 A;  2F3I A;  1XNQ Q;  1V1O A;  3CCR A;  1VQH A;  1EYG A;  2A1A A;  3BVZ A;  3DWP A;  1PZJ D;  2VNU D;  4HIO A;  1D5Z C;  1J5E Q;  2RCN A;  5EKI A;  1XYI A;  4LF7 L;  4WOR A;  1YJW A;  1BVS A;  4R4T A;  3R2I A;  1BCP D;  3I2Z A;  3GDE A;  3CF5 A;  1QZG A;  2R7F A;  4V0B A;  2RA4 A;  2YTX A;  2F0K A;  3TP5 A;  3S1M H;  1UWV A;  2XTI A;  4M8A A;  3EQL C;  1VQ9 A;  1KC8 C;  5KGU A;  3HS0 C;  1LV9 A;  1H95 A;  3RN2 A;  4H7B A;  3QG1 A;  2ICI A;  3K80 C;  1WYD A;  5JJI A;  4JI4 Q;  1G2S A;  1HZA A;  1FL0 A;  1SNC A;  4R8I A;  1BCP C;  2C5C A;  4NDX A;  1Y8O B;  2K33 A;  5CV4 A;  1S3O A;  1WTR A;  5JJL A;  5FO9 B;  2UUB L;  1B2T A;  4K14 A;  4DXF A;  4LF7 Q;  4IUT A;  1E1T A;  4H44 C;  3AYH B;  3Q6S A;  2FHT A;  1CZW A;  1HTP A;  3EBE A;  4Z9C B;  3W5O A;  1B3Q A;  2R93 B;  3J7A 5; 
#chains in the Genus database with same CATH homology
 4OL7 A;  3TSS A;  1GXD C;  2IX1 A;  2NVY B;  1F9R A;  2CW0 C;  3O13 A;  2EYO A;  2G9H D;  1HQM C;  5EQ0 A;  2EVB A;  1SDF A;  1RDP D;  1OXS C;  4PMW A;  2B8F A;  1EIH A;  4C3J B;  4ZRZ A;  5CV8 A;  3J80 E;  3LWU A;  1FNV A;  1EZ8 A;  1WVL A;  3P20 A;  3BDL A;  2AQ2 B;  1DON A;  3A7L A;  1A2U A;  3C46 A;  3P75 A;  4C3I G;  5CV5 A;  5IGE A;  4UDU C;  5FO8 B;  4Y7N B;  3SHL A;  2B2T A;  4PV1 C;  1TWA B;  1JE4 A;  1A3T A;  1B3A A;  4BS9 A;  3HRZ C;  4WRD A;  3I8Z A;  1SYB A;  3FMC A;  1S5D D;  4HMJ A;  2B2Y A;  3S17 B;  1KAA A;  1PYW D;  1LO5 D;  1EU4 A;  1STB A;  5C5L A;  3DUZ A;  1D2B A;  2XWJ B;  4ZLT F;  3HGB A;  3MFY A;  3MXG A;  1RD9 D;  3T4A C;  1EEF D;  2E76 C;  4QIW B;  5C4Z A;  2HDM A;  3PUY A;  4HSP A;  2FMM A;  2PZT A;  2DY7 A;  3CQZ B;  5NUC A;  2QF7 A;  1RF2 D;  3S2H B;  1PRT B;  2C9O A;  2O2L D;  1AN8 A;  5EBD A;  3EVQ A;  1IYV A;  3D6C A;  3GTM B;  3D4D A;  2F4I A;  3A55 A;  2ICE C;  2H1E A;  2BDO A;  2IW3 A;  1EIG A;  3SEB A;  2AUK A;  3K5N A;  1NAP A;  1UUP A;  4A3K B;  5EKK A;  5KNB A;  3NP8 A;  2PQE A;  4XTC S;  4HCE A;  4ZQ3 A;  1Y8N B;  2D9U A;  2F0L A;  3ONA B;  4J1M A;  1CQF A;  2BA1 A;  4PMB A;  2F0M A;  1RCV D;  1D1I A;  1EYC A;  2K03 A;  1SJH D;  2EYJ A;  1PDQ A;  3EFX D;  3NQI A;  5FOB B;  4PQX A;  4NP5 A;  3MXP A;  2B39 A;  3OIQ A;  1JB3 A;  1QWY A;  3S9W A;  4KD3 A;  2VXW A;  3SXH A;  3VA5 A;  2R61 A;  1G6Z A;  4FVM A;  4HED A;  1YNJ C;  1LT6 D;  4XIG S;  3S16 B;  4K2K A;  3Q24 A;  1HUN A;  1EU3 A;  4PNY A;  1L0Y B;  1BOS A;  1I4R A;  2RSO A;  2OEO A;  1WD1 A;  3TP8 A;  2E2H B;  2JEB I;  3RZD B;  2JP1 A;  1LTA D;  1STA A;  4A3M B;  4IQZ A;  5CC4 A;  4DAP A;  4RGN A;  1TII D;  2N88 A;  3K59 A;  5BN3 A;  1HRJ A;  4JK1 C;  2F0D A;  1STG A;  3TP6 A;  1EEI D;  2EJF C;  3P7J A;  4CJ1 B;  1SJE D;  3NBI A;  5D14 A;  5C44 B;  3Q23 A;  1ZEQ X;  1MSG A;  3I4M B;  3K5M A;  2E2I B;  1QOH A;  1GUW A;  3I73 A;  3FEW X;  1KNE A;  2NWG A;  5KNC A;  1VF5 C;  2MHV A;  4TSS A;  1EOT A;  3ZYY X;  2JYO A;  3WDN A;  5E1F A;  3MA2 B;  1SBB B;  3TP7 A;  2D2C C;  2A6H D;  4RHS A;  4BA1 I;  1ROD A;  5C3E B;  2WII B;  3R93 A;  2K1B A;  3BDC A;  3GTP B;  3RLF A;  4WFN 3;  2QCP X;  3DHQ A;  1Z6H A;  2F0I A;  3SVM A;  5CYU A;  4CGY B;  1TS2 A;  2JSO A;  4U67 3;  2EPB A;  4EGV A;  1CHQ D;  3M7N A;  3N52 A;  3HOY B;  1LTR D;  1XX8 A;  2EZV A;  2SOB A;  5A2Q L;  4FXD A;  4DU9 A;  5G3L F;  2IL8 A;  3FPU B;  2Z1C A;  3GO5 A;  3NWT A;  1JWU D;  1FR3 A;  3KLR A;  1CT1 D;  3VR4 A;  1CA5 A;  1XTC D;  2QKI C;  2J0T D;  4BBS B;  4CKB A;  1R4Q B;  4MN3 A;  4QUC A;  1EZ6 A;  1FYC A;  4G7H C;  5KIX A;  2DN8 A;  5ELE A;  5J1Z A;  1ILP A;  2BE5 D;  3SDZ A;  3NTH A;  3HEJ A;  1CFM A;  4ILW A;  2MUY A;  2M00 A;  1RJT A;  3C2P A;  3D8G A;  2WP8 J;  5IT9 L;  3IAY A;  1EWC A;  1AEX A;  3PUV A;  2M9V A;  2WIN B;  2R92 B;  1SYC A;  2L55 A;  3R8B A;  4C1N K;  5EPK A;  3K0Y A;  3C3L A;  4DGZ A;  1WTV A;  2K5W A;  4RGO S;  3BDO A;  5IGF A;  1OXV A;  1SAP A;  1NR2 A;  1Q3L A;  3OWF A;  4DF7 A;  2M2L A;  4ODG A;  1H9S A;  1PXU A;  4YIJ A;  4CJ0 B;  4KHZ A;  4LAA A;  4LK1 C;  4S3S A;  3EJI A;  1WCM B;  2F1M A;  4KKU A;  1QNU A;  1KDB A;  1I4H A;  2GA4 B;  4OO1 H;  3X3N A;  2LY7 A;  2Y0S B;  3Q22 A;  5D65 A;  5FK9 C;  1NSN S;  5E4W C;  3HOV B;  1EY6 A;  2IX0 A;  2PZU A;  4AYB B;  3K5L A;  3GTK B;  2JXM B;  2KED A;  1QE6 A;  3H91 A;  2WKD A;  2X6L A;  2AQ1 B;  4F88 A;  1JIC A;  1ZYR D;  1Y1V B;  1DYQ A;  2EJG C;  1GUO A;  4KN7 C;  4DK1 A;  5M9O A;  2SNM A;  2BA0 A;  1TS4 A;  1SEB D;  4K6D A;  2KJX A;  3JAM E;  5CV7 A;  1T5E A;  1YNN C;  3Q0A A;  1VF7 A;  4IN3 A;  2B2W C;  3SK6 A;  1EY4 A;  1XXG A;  2JA5 B;  3L3O C;  2KEC A;  1II3 A;  4CKE A;  1WTQ A;  1CHP D;  2A6E C;  3MEH A;  2XSC A;  4ZAI A;  1LT5 D;  4FF1 A;  1EQT A;  2PCF B;  1GUT A;  4RWS C;  4IAL A;  2CW0 D;  1SE3 A;  2KQ3 A;  4XT3 B;  5CV6 A;  2J7Z A;  1SND A;  3AU7 A;  3H3V C;  4CKC A;  1SNP A;  4KK7 A;  2G9D A;  1JWM D;  2FIN B;  3VYT A;  1SMY C;  3D4R A;  4QB4 A;  3BG3 A;  4X3T A;  3NBH A;  2A74 C;  2QDB A;  3K57 A;  2AQ3 B;  1ICW A;  1V8Q A;  5JVH 3;  1F2Z A;  1PTO C;  3CHB D;  4C3H B;  5C3W A;  4IUV A;  1G8Z D;  1SE2 A;  5JEA J;  4RAU C;  1ENF A;  3T16 A;  1B9N A;  4L63 B;  1Q12 A;  2WKC A;  3SK8 A;  1G2T A;  4UAI A;  1SE4 A;  5T1G A;  3E6Z X;  1LTS D;  1ET9 A;  1TR5 A;  1SYD A;  3S1Q B;  1PRT F;  1H9J A;  4LJZ C;  2WAQ B;  5CMD A;  4RGT A;  1S5F D;  3I90 A;  3NHH A;  3TZU A;  1F2M A;  1TQO A;  4A93 B;  4OO1 I;  2NYZ D;  2MPM A;  5JJZ A;  2F03 A;  3MZ5 A;  1QB5 D;  1WTP A;  1S5C D;  3BVG A;  1J8I A;  2EY5 A;  1FNU A;  1TWC B;  1ENA A;  1KLU D;  2EDG A;  1DJR D;  5ISR A;  1YNJ D;  2WV6 D;  4NW2 A;  2K7V A;  2ZXP A;  4ZUI A;  1B9M A;  1C48 A;  4B9W A;  3VA7 A;  2E2J B;  1F2Y A;  4H13 C;  1MBY A;  1DOM A;  1BCP B;  1H9S B;  1XWE A;  4FF2 A;  1LTI D;  3V96 A;  1MSH A;  1A15 A;  1OXX K;  5COY A;  1JR0 D;  1PFN A;  2NTS A;  4IFD G;  2MGS A;  1PTO H;  3VR3 A;  2IX3 A;  2K32 A;  5M3M B;  1DCZ A;  3VR2 A;  3BZD B;  3D4W A;  4MIU A;  3SR1 A;  4RCO A;  3S14 B;  4H0L C;  4RKL A;  1CI3 M;  1PTO F;  5M5W B;  1WD0 A;  5I2X A;  5FO7 B;  3DM1 A;  2B8G A;  3HP3 A;  1J9O A;  4B08 A;  1LAB A;  2EOT A;  1S4Z A;  4EQN A;  1HA6 A;  1SFO B;  4K8I A;  3P1H A;  5IGD A;  3KUP A;  4X3K A;  1STN A;  3K7A B;  2D5D A;  4XQJ A;  5IOC A;  3QIA A;  3K58 A;  3URY A;  4L6T B;  2A69 C;  4J6H A;  2O4X A;  1TVX A;  1W6K A;  4KKS A;  2B2V A;  3BVM A;  4XT1 B;  2PYK A;  1TY0 A;  4KJO A;  3CU7 A;  1QIL A;  2I46 A;  2EYH A;  1PTO D;  3TME A;  1IL8 A;  2Q8T A;  4IUU A;  4C3J G;  1WTO A;  4A3F B;  4C56 C;  5IGC A;  5D3I B;  3S1R B;  2AWN A;  2R6G A;  3HZX A;  3KK7 A;  2KCC A;  2F3W A;  4RH6 A;  1IYU A;  1AZP A;  2B2V C;  5BN4 A;  2OT2 A;  1STY A;  3DWQ A;  4KJN A;  1G91 A;  5C3X A;  2K01 A;  3NTK A;  1DOL A;  3MHB A;  5J22 A;  5C0X G;  4A3I B;  1E0B A;  1EY5 A;  3OPO A;  3M85 A;  4ZUJ A;  4KTA A;  2A6E D;  1B53 A;  3PUX A;  2NVQ B;  2PW5 A;  3NXW A;  3BYY B;  1I4P A;  2DNC A;  2QEJ C;  2F0T A;  4XQQ A;  1TWF B;  1Y69 U;  3DEO A;  1LT4 D;  1NCV A;  4X3S A;  4A3G B;  3HOX B;  3J7A F;  3QOJ A;  5JAV A;  5K36 H;  4QUF A;  1I3Q B;  1PFB A;  2IJ0 A;  1RTN A;  5COR A;  4K5W A;  2Q8R E;  2DNE A;  1MD2 D;  2QIL A;  2RBM A;  3RD4 A;  4IUQ A;  3C1F A;  1CA6 A;  4RGM A;  1I4X A;  1QJO A;  2A6H C;  3I70 A;  1SXT A;  3SE0 A;  3OMG A;  2R3Z A;  5I6Y A;  3AMU A;  1JOR A;  2F0U A;  3LWE A;  3GV6 A;  3ITP A;  3NQT A;  2A68 C;  1KTK A;  2KA7 A;  1F9P A;  2B2U A;  1EY7 A;  4KV6 A;  5CBA E;  1RKN A;  3EA6 A;  1BF4 A;  1F77 A;  3GD7 A;  3LX0 A;  4KI0 A;  4IUN A;  4NMZ A;  1S5B D;  5DM6 3;  2EY6 A;  1BR9 A;  3KLS X;  4N9P A;  4TQU S;  4HMI A;  1SYG A;  1F9S A;  1X32 A;  4KY5 A;  5IGB A;  1SNQ A;  2LMC B;  1H9M A;  3NE5 B;  1ESF A;  2CVR A;  4K2L A;  3RUZ A;  2MJ8 A;  5DAU A;  5AFW A;  1W6J A;  5JPN C;  1FNW A;  1TS3 A;  4OIK A;  1HQR D;  5EKL A;  3E0J A;  2EY2 A;  1VMP A;  3A8I E;  2NVT B;  1M8A A;  2KEE A;  3KLS A;  4Q5V A;  1LT3 D;  3NSW A;  2HQE A;  3DXJ C;  1SSO A;  1CZG A;  5D3D A;  2EY1 A;  2NZ1 D;  3PO3 B;  4L8J A;  3JAM L;  3K5O A;  4CHT B;  2I07 B;  1BO0 A;  2A69 D;  2EJM A;  4HAE A;  1PMR A;  2F0F A;  1HCZ A;  3WOF A;  4N9T A;  3FRP B;  1D1K A;  3VR6 A;  2A73 B;  1U4M A;  3J80 L;  3HKZ B;  4NKL A;  1R9T B;  3CKI B;  5CV9 A;  5CGK A;  5F2D A;  4BA2 I;  2NB0 A;  1WTW A;  3MC0 B;  2A68 D;  5DM7 3;  4Q0F A;  3F2U A;  3FKI B;  2XRQ D;  3A54 A;  1I50 B;  1VDZ A;  2SNS A;  1OXU A;  2RKS A;  3G6J B;  1GUS A;  1KLG D;  4XYQ A;  1A3V A;  5J39 A;  4G7O C;  1ESR A;  3I91 A;  2TMP A;  4DK0 A;  5ELF A;  3TBI B;  1ONL A;  3TDQ A;  1AP0 A;  4RFB A;  2HUG A;  1AW7 A;  4RA8 A;  2TSS A;  3FDT A;  1IW7 C;  1EYD A;  2L11 A;  3QB3 A;  1DOK A;  4FXK C;  2E75 C;  3S2D B;  3HOW B;  1C4Q A;  2JE6 I;  4X3U A;  2F0V A;  1U4L A;  4A3E B;  1STH A;  3QJY A;  4ID6 A;  4DFA A;  2K5D A;  1YNN D;  3U9S A;  5FLX E;  1HPC A;  3GTL B;  2XVS A;  4F7X A;  5EGT A;  3OW7 A;  3I4L A;  5C5M A;  2F0H A;  1D5X C;  3TZD A;  1GJX A;  1Y1W B;  1VMC A;  1U9R A;  1I4G A;  1PFM A;  2Q8I B;  1ZKO A;  3J7A V;  1O7Z A;  1RHP A;  1HUM A;  3S15 B;  3I3C A;  4BY7 B;  1CM9 A;  1B4O A;  2V4D A;  2KVM A;  5LL6 X;  1AFP A;  3D6W A;  2X69 A;  5I9O A;  1EY8 A;  1VCI A;  1O7Y A;  1X3Q A;  4ZK9 B;  5EPJ A;  3M3Y B;  3NTI A;  5ELD A;  4A3J B;  3T13 A;  1CQV A;  2RQX A;  2XRS D;  3J81 L;  2FJ2 A;  4DA2 A;  4A3B B;  1Z7T A;  4C3H G;  1C8C A;  3CRL C;  1HHV A;  2IT1 A;  4CBV A;  1G29 1;  4HN7 A;  4FP5 D;  4FNF A;  3R2T A;  3GTO B;  4U68 A;  3NK9 A;  4QF4 A;  5C4J B;  4TRD A;  1R4P B;  5C4H A;  1I4Q A;  1B44 D;  4LMQ D;  1ML0 D;  4F8M A;  3R3O A;  1PZK D;  4ZKC B;  1JOO A;  4A3D B;  3A7A B;  1CTM A;  1LTG D;  1PZI D;  1H9K A;  2LKV A;  2XWB B;  1TS5 A;  4FO2 A;  1KNA A;  5ELC A;  2HCC A;  2F0J A;  5EJW A;  5I4D A;  1BUV T;  1KAB A;  1LAC A;  3NUC A;  5JPM C;  1ZYR C;  4XXE A;  1Q1B A;  2EXZ A;  2L12 A;  4J8Q A;  3U9O A;  5KYI A;  1TU2 B;  2B2W A;  3DWA A;  2E74 C;  2RDH A;  1KDC A;  1LTT D;  4FF3 A;  4HSV A;  4G7Z C;  2VUM B;  4C1N I;  1E2W A;  5G3L D;  3HOZ B;  2RDF A;  1EL0 A;  4I7Z C;  3LNN A;  3L7Z C;  3SK5 A;  1F2L A;  1JQY D;  1PLF A;  2KOL A;  3D3R A;  5JEA G;  1DXM A;  2ENB A;  4C3I B;  4DN4 M;  5E3F A;  1IHZ A;  1I6H B;  1EFI D;  4HCS A;  2F0P A;  3GTG B;  2YU9 B;  3IKJ A;  1JWS D;  1EYA A;  2HCI A;  1H9R A;  2R7Z B;  1GUN A;  4BWG B;  5C0X I;  1V1P B;  3VYS A;  3PO2 B;  3S1N B;  3QO2 A;  2ID0 A;  2KUM A;  1Y8P B;  2NUC A;  2ZT9 C;  3MVV A;  4IFD H;  1SMY D;  2X6G A;  3ERQ A;  1GHK A;  1K8O A;  2NN6 I;  3VR5 A;  2L5T A;  3M7G A;  3MTS A;  2O5I C;  3L9A X;  2MP1 A;  4OHJ A;  3OWE B;  5C0X H;  2PPB C;  4C2M B;  3ERO A;  1DD2 A;  3KF8 A;  5KEE A;  1O7L A;  5TSS A;  1BDO A;  5C4X B;  3A56 A;  3AB9 A;  5T1I A;  1NUC A;  1PRT D;  1GUG A;  3DMU A;  4B9X A;  5E4X A;  5C0X J;  2F0Q A;  3H0G B;  4K5X A;  3ND9 A;  5JVG 3;  1STE A;  1Q1E A;  5K5P A;  1HTL D;  1OXT A;  5A35 A;  2K05 A;  2Z4I A;  3PIO 3;  2NN6 G;  2H4O A;  1K83 B;  4E6I A;  5K36 G;  1U4P A;  1B1Z A;  4V19 0;  3J7Y W;  2JA6 B;  4KMU C;  1TY2 A;  1HA5 A;  4BBR B;  3QWN A;  2F0S A;  1RTO A;  3CRK C;  4QMG A;  4MHE A;  2JEA I;  3T51 B;  4ABN A;  4XDX A;  2K04 A;  3GP7 A;  1I6V C;  4JBW A;  3MAQ A;  1HXY D;  1GOZ A;  1JOQ A;  1ENC A;  1TWH B;  2F3V A;  2JA8 B;  5DEH A;  5M5Y B;  4R8N A;  2WAC A;  2K6A A;  3FPP A;  3OMC A;  4G57 A;  2CQA A;  3M4Y A;  2IWH A;  3OIP A;  1EQV A;  1OO9 B;  2Z8L A;  3A8K E;  3J81 E;  1K8M A;  1AZQ A;  3UI2 A;  4EVO A;  2EYL A;  1SNO A;  2N55 A;  3HOU B;  3MWY W;  3H09 A;  2NVX B;  1BNZ A;  3PUZ A;  2YYZ A;  2RDG A;  3BYT B;  1ILQ A;  4ULL A;  4IZ8 A;  2BCO A;  2LFN A;  5CR3 A;  1F9Q A;  3OOC A;  5ELB A;  3I72 A;  4O42 A;  1BQQ T;  4F87 A;  3SK4 A;  4DAV A;  3W2D A;  2IPK D;  1SNM A;  1HFN A;  2PMZ B;  2B2Y C;  1Q90 A;  3NPP A;  1SYF A;  2EYF A;  4DNT B;  1L0X B;  1EWH A;  3S1M B;  5FKA C;  1BXT A;  1EY9 A;  2E2D C;  3GTJ B;  2EE1 A;  1O78 A;  3IFT A;  4DXG A;  2NBF A;  1LTB D;  4OO1 G;  1KDA A;  2B63 B;  2RSN A;  1CK1 A;  2CHB D;  4ZYS A;  3VYU A;  2ZXR A;  4QCL A;  5HUR A;  3PMF A;  4KY6 A;  4KHV A;  5I2Y A;  4RKB A;  2BOS A;  2F0E A;  3IL8 A;  4RHR A;  1A3U A;  1TWG B;  1QG7 A;  4TKO B;  3FVQ A;  2DY8 A;  3OSO A;  4FF4 A;  3A8J E;  2FMC A;  2A5H A;  3T56 B;  4BY1 B;  3I4N B;  4K6L A;  1QNK A;  3HG9 A;  3V05 A;  5I6W A;  1ET6 A;  4IUP A;  4ME5 A;  2SEB D;  1FGB D;  3WOE A;  1DM0 B;  1S5E D;  4OIJ A;  3BS1 A;  1A2T A;  4KY7 A;  3VYR A;  1PRT C;  2KCN A;  1JCK B;  4IFD I;  2VB2 X;  2FFK B;  4WJW A;  3C1E A;  1IW7 D;  1ZXT A;  2AWO A;  2VB3 X;  4EQP A;  1HFG A;  3M4O B;  2NN6 H;  1EY0 A;  1GHJ A;  2PNR C;  2B2U C;  2L0C A;  2LS0 1;  1D6E C;  3X3M A;  1UEA B;  3GV3 A;  3H6M A;  5KRU A;  4G4K A;  5JOB A;  1A6X A;  1D5M C;  2Z4H A;  3V2T A;  2XIW A;  2NTT A;  3PIP 3;  2O5J C;  2EYM A;  4K8J A;  1V1P A;  2F0W A;  1BBX C;  4IUR A;  1LLR D;  3PUW A;  1DZ1 A;  2L1B A;  5FLX L;  2L9H A;  1IKL A;  5DNF A;  5M5X B;  5LL6 S;  5KYL A;  1UAP A;  1O80 A;  1V43 A;  3MXN A;  3IFD A;  1B50 A;  3N6R A;  5IIF A;  5EBC A;  1TT2 A;  4FXG C;  5LHY 1;  5IGG A;  3W3A A;  4KN4 C;  2XNA C;  1IKM A;  1Q8I A;  2B2T C;  2SDF A;  4FYD A;  4XYO A;  2J4X A;  3KBX A;  2L4N A;  2ZXO A;  4PMC A;  4GZY C;  5BN5 A;  2F0G A;  1Z47 A;  3K6O A;  2K28 A;  4RCN A;  3G7L A;  3PV0 A;  5IT9 E;  3ND8 A;  2KHS A;  3GTQ B;  5EPL A;  2EYP A;  3T53 B;  4P2C B;  4HR7 B;  4DAY A;  4K5V A;  1PTO B;  4R9W A;  5IOD A;  2BE5 C;  3GQB A;  1JOK A;  2WB1 B;  4ZKB B;  1X3P A;  1MGS A;  3D31 A;  3H94 A;  2K5Q A;  2XN9 C;  4XQN A;  4IFD J;  3OHX C;  5M3F B;  4I65 A;  2RVL A;  4OGQ C;  1M4V A;  3NWS A;  1WTX A;  1E2Z A;  1NR4 A;  5HGT A;  1SYE A;  1E2V A;  3MFG A;  3DEP A;  3RMH A;  5CBE E;  2F0O A;  1T5X D;  2HDL A;  2OF1 A;  2JA7 B;  3KBG A;  1MI2 A;  1TKW B;  4KKT A;  4DNR B;  2AUJ D;  3RZO B;  4CJ2 C;  3E5S A;  4M1U B;  4KD4 A;  2OXP A;  5C6A A;  5I9P A;  1QCB D;  2F0N A;  2PW7 A;  4EQO A;  1U4R A;  2BDN A;  3MXU A;  4O1N A;  1UNS A;  1BCP F;  3QOL A;  5A2Q E;  4HTH A;  2D62 A;  1JC7 A;  3TN2 A;  1FD7 D;  5JEA H;  5KND A;  2PO4 A;  2PZW A;  1V1O A;  3BVZ A;  3DWP A;  1PZJ D;  2VNU D;  1D5Z C;  5EKI A;  1XYI A;  4WOR A;  3R2I A;  1BCP D;  4V0B A;  2RA4 A;  2F0K A;  3TP5 A;  4M8A A;  3EQL C;  5KGU A;  3HS0 C;  1LV9 A;  4H7B A;  3QG1 A;  2ICI A;  1G2S A;  1SNC A;  4R8I A;  1BCP C;  2C5C A;  4NDX A;  1Y8O B;  2K33 A;  5CV4 A;  1WTR A;  5FO9 B;  1B2T A;  4K14 A;  4DXF A;  4IUT A;  4H44 C;  3Q6S A;  2FHT A;  1CZW A;  1HTP A;  4Z9C B;  2R93 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...