3BS1A

Structure of the staphylococcus aureus agra lyttr domain bound to dna reveals a beta fold with a novel mode of binding
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
103
structure length
103
Chain Sequence
MDNSVETIELKRGSNSVYVQYDDIMFFESSTKSHRLIAHLDNRQIEFYGNLKELSQLDDRFFRCHNSFVVNRHNIESIDSKERIVYFKNKEHCYASVRNVKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription regulator
molecule keywords DNA (5'-D(*DTP*DTP*DTP*DAP*DAP*DCP*DAP*DGP*DTP*DTP*DAP*DAP*D
publication title Structure of the Staphylococcus aureus AgrA LytTR Domain Bound to DNA Reveals a Beta Fold with an Unusual Mode of Binding.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 28
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2007-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04397 LytTR LytTr DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1020 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3bs1A00
4CBVA 4XYOA 4XQQA 4XYQA 4XQNA 3BS1A 4XXEA 4XQJA 4G4KA
chains in the Genus database with same CATH superfamily
1GHKA 1I6HB 1NMGA 1L1OA 2K7VA 4FNFA 4DAYA 5M5YH 3I56A 1VQ5A 4QY7A 3D4WA 4B3TQ 1F2YA 1WTQA 3UDXA 1PXUA 1SE3A 2XVSA 4DV7Q 3NBIA 1CQVA 2XRSD 1SRUA 5A35A 4K2LA 4IURA 4ALPA 1KABA 4OWTB 4WJ4A 2MO1A 1LTBD 2C5CA 1MKHA 4X3UA 1F9SA 1QUQB 2F0FA 3U9SA 4FF1A 4A3CG 1ZKOA 3ULLA 1JOKA 1S40A 4A3DB 2VB3X 1K8OA 1CTMA 5KEEA 1VQ6A 3S14B 4A3MB 3GTQH 4IFDH 4P75A 3OW2A 4G7ZC 1Q46A 4L5RC 4BBRH 1VQAA 3SE0A 2YTXA 1H9JA 3OIPA 3S2HB 1GUNA 1WYDA 5D14A 1SR3A 1U5KA 2K03A 4LF9L 4UY8C 1IYJB 4JI2Q 3R2IA 2XN9C 3WOEA 3CQZB 4B08A 3QB3A 1JCKB 4JI6Q 3K5LA 1X3GA 2J0TD 3L7ZC 5FLMH 3GTOB 4A3LG 2B8GA 3EIVA 4DV4L 1PRTF 3CCUA 1Q3LA 1VF7A 4DV1Q 5EKIA 3SGIA 4NMZA 1XMQQ 2JA8B 1HNWQ 2YTYA 1Q1EA 3HOZH 3BJUA 5C5LA 2K5NA 5EKKA 2K01A 2O5IC 1V1OA 2KBNA 2Q2HA 4MIUA 3HOVB 4KD4A 5M5WB 2JA8G 4F7XA 2NVTB 3NEMA 1JB7A 5IGEA 3HOVG 3PUVA 3CC4A 2ENBA 4DK1A 4GOPA 4RGNA 4EQOA 2YU9B 4GLXA 5G3LD 1W2BA 2WB1E 3V96A 3GD7A 2J7ZA 3RLOA 3PSIA 3J80L 3VYRA 3S15H 2GVBA 3NQTA 4BY7H 3SHLA 1PTOH 2A8VA 1JWSD 4LUVA 1XNQQ 3M3YH 2PMZB 4A4IA 4DR6Q 4K5VA 4JI1L 3BS1A 1X54A 5E3FA 1QILA 1OXTA 2PQAA 2ZJRA 1ET6A 1BUVT 2F0WA 3CP0A 2Y0SB 4RA8A 5LMNL 5T1GA 4DAMA 2CW0C 2KECA 3KF6A 1SLJA 3PIPA 3J81i 3Q24A 4HMJA 2A69D 2Y0SG 2IPKD 3S1NH 3KJPA 3NSWA 1STYA 1K28A 3GTPB 4A75A 2JSOA 5CV5A 5IYCG 3S1RB 2E2DC 5C4XB 1TWFH 1X6OA 4GKKL 3CCJA 1TIID 3SR1A 4DR2L 3KF8A 1CHQD 1C8CA 3ERSX 5M3FB 5K36H 3M9BA 3D6CA 4DR4L 1I3QH 3OPOA 1I50H 3I8ZA 1S5CD 1S4ZA 1AN8A 1A0IA 2XNAC 5JVH3 2EYOA 2A1AA 3A5ZB 4K5XA 4QJFA 5E7NA 1BCPD 4X64Q 5M3FG 4DR7L 4IQZA 4A93H 1N34Q 3QG1A 3VA7A 1X3PA 3BG3A 2AWOA 5HY6A 4K8JA 5JPMC 3STBD 3S1MB 4HJAA 4FYDA 1I4PA 3MXUA 1EIFA 4NP5A 1RTOA 5ELFA 1JMCA 1C9OA 4OO1I 4HR7B 2MQHA 3E9IA 3J80c 2NVQH 2H4OA 2F4VL 1IHZA 3J7YW 4QIWE 3LNNA 2ZTDA 3P20A 2F0QA 4OEMB 4HIMA 2P5ZX 4JI7L 1M8AA 1PFSA 1I6HH 2AWNA 2IW3A 1YITA 3KLSA 3FKIB 3G48A 3PCOB 2V1CC 3C1FA 1PFNA 2JJQA 3DM3A 3KFUA 1A2UA 1VS0A 4BY1H 3RLFA 3VYSA 1V1PA 1NUCA 1V43A 3T1YL 5CORA 1GVPA 2N78A 1K0RA 2B8FA 1STGA 1T5EA 3EBEA 4M8AA 3CHBD 3Q8DA 2QF7A 1B3QA 3HKZB 1CSPA 3PIOA 3E6ZX 4OONA 2HHHL 1TWAB 1PDQA 2JP1A 3KYHC 1SMYD 2IHFA 3SXHA 1EQQA 4ZYSA 3DWAA 2YTVA 1HUMA 4RFBA 4IN3A 3HKZG 1Y1VB 2DJGC 3F2UA 4DV6Q 5EPJA 1EY9A 4Z9CB 4A3DH 1Q8IA 3S14H 5CYUA 4A3MH 2FJ2A 1PA6A 4QIWB 3NK9A 3C1EA 2QCPX 1Y1VG 3NXWA 4QUFA 4R9WA 3LX0A 4JVZA 5IT9L 2AMCB 3I70A 3V2TA 3AEVA 2FINB 4JPBW 2E2IH 1EEFD 4LK1C 5JVG3 1HR0W 3H09A 3HZXA 2QKIC 4KHPL 4LF5Q 4KK7A 1AEXA 3D6WA 1DOKA 1LTLA 4HIOA 1SYBA 3DMUA 1ENCA 3GTLB 1OXXK 1PH2A 3J7A5 1RL2A 1JOOA 4JV5Q 2Q2TA 2M2LA 4I7ZC 1ONLA 4K8IA 3PO3B 1D2BA 1XTCD 1WCMH 2K04A 4UDUC 3D3RA 1L0WA 5IY0A 3TBIB 2CHBD 1D5MC 1FR3A 3I4OA 5IOCA 1IBMQ 1ET9A 2UXBQ 3PO3G 2F0UA 3CCQA 4B3MQ 1X3FA 1VQGA 3B6YA 2X6GA 1XPUA 1FJGL 2ICEC 1NTGA 1MSGA 1B44D 2X69A 1TWCB 4X66L 1AZQA 2YU9H 1EU3A 3FHWA 3G6EA 1PZJD 2GA4B 1AH9A 1N32L 2UUCQ 3NTKA 2E2HH 4DAYB 2L0CA 4HIDA 2DGYA 4LMQD 2E5LL 1KAWA 3F2CA 2F3IA 1ESFA 3OMGA 5CR3A 4L5TA 3NE5B 2BH2A 3A0JA 1HTLD 3JAMi 3I3CA 1Q81C 3J80E 1S3OA 3K5MA 1TU2B 3DUZA 2JA5B 1PVOA 1KDCA 5GAHC 1UE1A 3NTHA 1PFBA 1PRTD 4DNTB 1EY6A 2LFNA 2FXQA 1HUNA 2JA5G 3CPFA 1VF5C 4LF8L 3GTMB 5IT9c 1OTCA 3PIP3 2B3GA 3HG9A 5CV7A 3CF5A 3S1RH 2K14A 4FXKC 4FXGC 5C4XH 4IOCA 5FO8B 3HOYB 4K0KQ 3GTJH 2K5WA 2ALYB 5M3FH 5HURA 1PH1A 1BCPC 1TY2A 4B3TL 3HOYG 3WOFA 3Q0AA 2VS1A 1RODA 2PNHA 2DJFC 4IPGA 5E1FA 4C1NK 1G91A 2F0DA 4XXEA 4RGOS 1FGUA 4R4CA 1WI5A 3E3XA 1S5BD 4DV7L 2RHSB 1LV9A 5IYBH 4K14A 4Y7NB 5KNBA 3I73A 1BBUA 2ZXRA 1ILQA 3A7LA 1NE3A 1MBYA 1W3SA 3CMEA 1IZ6A 1CI3M 1ZYRD 2D0PA 5CC4A 4X65Q 5DLQE 2QA4A 2B29A 1BNZA 4OELB 3S1MH 3P7JA 1UWVA 1DYQA 1HCZA 2MUYA 2PPBC 1MJEA 3PGZA 1O7YA 2CKZB 1HZCA 3CW2C 3L2PA 1N36Q 1LUZA 1LACA 4P74A 3SK6A 3H0GH 1ICFB 3TP8A 1YJWA 1AE3A 4OGQC 3I4LA 1Q8KA 5M5YB 4HJ5A 2ES2A 1YNJD 3FKIH 3H15A 2RKSA 4TQUS 2Q8IB 2E2JH 1Y8NB 2KHSA 4JI2L 3ULPA 1H9MA 4DNIA 4AQYQ 2AQ3B 5JJKA 4PQXA 4JI6L 1HTPA 3DHQA 4FXDA 5JEAH 3M7NA 2K05A 3BYTB 3V05A 2JN4A 4DV1L 2PQAB 1IL8A 4TSSA 1TWAH 2XWJB 1HNWL 5M3MH 1SE8A 3T56B 3HOWB 3I4MH 4IUPA 5ELBA 1EQTA 4CJ2C 3M4OH 1E1OA 1A63A 1A3TA 3DEPA 4OHJA 1G2SA 4JI5Q 3PUXA 4JI3Q 3GTQB 3U4ZA 2Q2IA 5C4JH 2F0OA 1YVCA 4BBRB 3KJOA 1V9PA 3A74A 4IFDG 4JK1C 2ID0A 4BBRG 4YWKA 5CV4A 2PZTA 1OXUA 4UHVA 1VQBA 4X6AH 1Q90A 1K0SA 2VW9A 2R7DA 5GAEC 2PNRC 1XNQL 1B8AA 1A2TA 4DR6L 1VQ9A 1FD7D 1TWGH 3M85A 5IT9E 1K8GA 1V1QA 5GROA 1KIXA 1R4PB 4EQPA 1KNAA 1Y8PB 4AYBB 4EQ5A 5FLMG 4NPSA 3MEFA 4RCNA 3HOZB 4JYAQ 4AYBG 1GOZA 1CHPD 2AQ2B 2EVBA 3CPWA 1BVSA 3H3VI 2ZTCA 3DM1A 1QVGA 3HOZG 3PUWA 1VQMA 1HFNA 4O0AA 2MHVA 2NZOA 4KD3A 4KLKA 1EY0A 4R4OA 4HMIA 2E76C 1TWCH 3CCMA 2R92B 1HR0Q 3D31A 4FF3A 1RTNA 2O4XA 4G57A 4KV6A 4IO9A 3M3YB 2G9HD 1HH2P 3RN5A 3OTOQ 3I55A 5C3XA 4DR5L 2Z4HA 5BR8Q 4X64L 4GKJQ 4EX5A 4BY7G 4F87A 1JOQA 1PTOF 3F1ZA 3KOJA 4ZKCB 1N34L 1QVCA 1V1PB 1X65A 1QNKA 4KY6A 4CDCC 3HFZB 2F0IA 2RCFA 2Z1CA 4ZCKA 1F2MA 2G5DA 3AU7A 3S1NB 5HGQA 1B2TA 2V4DA 1IW7D 3FDTA 1YHQA 4JI4Q 5JPNC 3JC66 2R7FA 1GXDC 1TWFB 1OXSC 1DXMA 1I4HA 1PH6A 3PMFA 3EFXD 3GP7A 4DR3Q 3NHHA 4EVOA 1K8AC 1G8ZD 1I3QB 2FHTA 1I50B 4RHRA 1B3AA 1EU4A 4PV1C 2HT1A 1WTVA 1SNMA 4ABNA 5K36G 1NR2A 1HZBA 1SYEA 1MD2D 4GN4B 4A93B 2AKWB 2HD3A 4IALA 1IBKQ 5EPLA 2IY5B 5DAUA 5FLXE 3BZCA 4A93G 4CJ0B 1WTRA 2PYKA 2VL6A 3L0OA 1HXYD 5DEHA 1UE6A 3QOLA 2CVRA 4GN3B 2BE5D 2Q2UA 2KVMA 1QE6A 4DV6L 4NXNQ 3G7LA 1DOLA 3IL8A 1K9MC 4LFCQ 4DXFA 1C4QA 2JA7B 2KOLA 1EZ8A 1D1KA 3UE0A 4B3RQ 2VQEQ 4V190 5IODA 4LUOA 3S17H 1LTAD 3NBHA 3HOXH 4DK6C 4YWMA 3S2DH 1Z9FA 5IWAQ 1AE2A 4BY1B 1ZXTA 5IP9H 3K81C 1VQIA 1T9HA 1Q1BA 3A8IE 2XSCA 4LF5L 3TN2A 1EOVA 2EY2A 4BY1G 5C3WA 5CV9A 1F2ZA 4LNQA 1PV4A 4HAEA 2N55A 2TSSA 1CA5A 1EQRA 3KLSX 4JBJA 4POGA 3HOWH 4PMCA 2WAQE 5EPKA 3DWPA 4C3HB 3FPUB 3GDEA 1B4OA 1IBML 4OWXB 4CDDC 2UUBQ 2UXBL 3MC0B 1I4RA 4B3ML 3LWUA 4ID6A 4QGUA 3BVZA 4A3DG 2F0KA 1HJPA 2JEBI 2SOBA 2B2VC 4A3MG 1PYSB 2K50A 1TS5A 1STEA 4OX9Q 2SNMA 1XPOA 2E2IB 1R9TB 1D7QA 2UUCL 1E1TA 3RR5A 2JYOA 3F2BA 1D8LA 3RZDH 3HRZC 2OQKA 4G7OC 1F9RA 4JI0L 5C0XH 5GADC 4RKLA 4A3FH 4KTAA 1E2VA 3J81L 1F2LA 1LT4D 1KTKA 1KDAA 1WCMB 3T1HQ 4JBMA 4RCOA 1TWHH 3H94A 4ULLA 4HJ8A 1WCMG 5ELCA 5AJ3Q 3ND8A 4DPGA 1HNXL 3D0FA 2Z6BA 3U50C 3WDNA 2MGSA 1CZGA 4BWGB 1E22A 2E8GA 1VQCA 2F3VA 2EYHA 4K0KL 2R92H 4O42A 3Q23A 1O80A 4QCLA 5EBDA 1EYGA 2E2HB 1E3PA 4A76A 2HUGA 3OYYA 2F0JA 2C35B 1NCVA 1QJOA 1VQOA 2CWAA 2RF4A 5JJZA 2AHOB 2I0QA 4DGZA 1X3QA 4YY3Q 4DR1Q 1HQMC 1ML0D 2ZJPA 2DY7A 4DV5Q 1KLUD 4UPAA 5LL6S 1E0BA 4X65L 4CKCA 4KKTA 1JICA 1DONA 1PLFA 2O2LD 2A6ED 1KRTA 4EGVA 1KHIA 2HQEA 1RIPA 1DZ1A 1IYVA 1S5FD 4DV2Q 2OEOA 4U673 1N36L 5CV8A 1BR9A 2EYPA 1CK1A 4HSPA 3GTJB 2D62A 2MO0A 1YIJA 2EY1A 2WB1B 4IJHA 5C4XG 1L2FA 5FKAC 3CC2A 2KENA 2NTSA 2DNEA 2DUDA 2VY3A 1ASZA 3J81c 3EQLC 5JOBA 4ILWA 1CKMA 2UXDQ 1FNVA 4J1MA 4QL5A 2EYLA 4AQYL 3EROA 3KLRA 3MFGA 4FF4A 4XQNA 4QQBX 2LXKA 1FNUA 1M4VA 4PZ7A 4IUTA 3K7AB 5K5PA 3J7ZC 1EY8A 3AYHB 4N9TA 3N52A 1QWYA 4XTCS 5IYBG 1K8MA 4AH6A 3OMCA 1PTOD 3W3AA 1JB3A 4KHZA 3MEHA 1KAAA 5IGFA 3TS0A 1BXTA 3D4DA 2HQLA 3RZOB 1LTGD 1D6EC 4JI5L 4JI3L 3H0GB 3TDQA 2EIFA 3CU7A 4PZ6A 1LTTD 4CBVA 1N8RC 4CGYB 2JA7H 1GUWA 3K6OA 4L6TB 2KCCA 1I4QA 1JE5A 2F0NA 1SYDA 3H0GG 4BXXH 1I94Q 1XTDA 2EPBA 2E2JB 3URYA 4K6DA 5I2XA 1EWCA 2DNCA 4K6LA 3FKIG 1XJVA 5C3EB 3HOUH 3TMEA 5KNCA 4YWLA 1L0YB 2K5VA 2E74C 1PH5A 1P8LA 4JBWA 4PZ8A 1FYCA 1NAPA 5JEAG 4DF7A 3A55A 3ERQA 3S16B 5M3MB 1EWIA 1M1KC 3S1QB 3G6JB 2WKDA 3I4MB 3I90A 4LUZA 4C3HH 3M4OB 3K8AA 2HIVA 5M3MG 3E5SA 3GTGH 1LT5D 5C4JB 3I4MG 1RHPA 2R7ZB 4R1JA 1WTXA 2GN5A 2KEDA 2IHEA 1B53A 4LF7Q 1VQDA 1I4GA 3E0EA 5IGBA 1TS3A 1J6QA 2I46A 5AFWA 4R8IA 3U4VA 4DK3C 3GQBA 2K33A 2XRQD 1HR0L 2L4NA 1HA6A 1YI2A 1Z7TA 1SAPA 1M90C 1R9TH 2H1EA 1VQNA 1SYGA 3SK8A 3OTOL 1G291 3JAML 2UXCL 4JOIC 3SDZA 5I6WA 5BR8L 1UE7A 1TWGB 3T51B 2BCOA 1QZHA 1XYIA 1SJED 4IPHA 4DNRB 2QDLA 3E9HA 1RCVD 1JORA 3BYYB 2FFKB 2MJ8A 2LSSA 4IUVA 2VXWA 2VZAA 3O13A 3M4PA 1K3RA 2K4KA 1S5DD 4B3SQ 4JI4L 1A3UA 2O5JC 2HDLA 2PI2E 3NENA 1WTOA 2VUMH 2Z8LA 5JAVA 4AIMA 1EWHA 1F9PA 5C4HA 2BH8A 4X3TA 1HFGA 3OIQA 1LTSD 3K0YA 3ZJYC 2RSNA 1N33Q 2Q8TA 4J15A 3NBHB 1YEZA 3Q6SA 3OOCA 4DK0A 1QNUA 2L11A 1O7IA 2D2CC 5COYA 1EY4A 1IBKL 2A69C 3UDFA 1X9NA 1WJJA 4PMWA 2R61A 1H9SB 4C1NI 2GVAA 3WWVA 3DLLA 1X56A 4R8NA 4ME5A 1SNPA 2CH4W 2IJ0A 5A2QL 2PZWA 4NXNL 4HJ9A 4PNYA 3L3OC 5L37A 2E75C 4LFCL 3HGBA 1NJIC 1KRSA 1ENAA 2D9UA 3JAMc 2EDGA 5EJWA 2VQEL 4IFDJ 2Z6KA 3VYTA 4OXPA 3SVMA 4IUUA 1OXVA 2AUJD 1JE4A 4TRDA 5IWAL 4JG2A 1DGSA 1HZAA 1SEBD 3STBC 1ILPA 4KMUC 2RA4A 4KY5A 4N8X1 2WACA 4UP7A 2X6LA 3K7AH 3T16A 1PH7A 5EKLA 5J1ZA 2OXPA 3T53B 1SROA 2A74C 3TRZA 4CKBA 4XYOA 2KHJA 1FGBD 2WKCA 1SE2A 2WINB 3RLNA 1G51A 4GLAC 3RZOH 2UUBL 1HNZQ 2PW7A 2A6HD 1SYCA 2CFMA 4IZ8A 2EY6A 4H7BA 1NR4A 3S17B 3OWFA 1CSQA 4DAVA 3HOXB 3S2DB 4OX9L 4IOAA 3AB9A 1BDOA 5LL6X 1VMCA 2K1BA 4A3GB 2A5HA 3HOXG 3QWNA 4L5SA 2D0OA 5C3EH 1VDZA 2NN6H 1X32A 5IP9G 1O7ZA 2F0GA 3SK4A 3KLWA 1SMYC 4HTHA 1WTPA 2KCNA 4DR4Q 4KJOA 1XMQL 3S16H 4RG1A 3S1QH 3T1HL 1O78A 3A8KE 4NW2A 2F3WA 1E2WA 5C6AA 3PIO3 4X3SA 3TQYA 4A3BH 2A68D 2B2YA 3U58A 3X3NA 5J22A 3BZDB 5AJ3L 3HOWG 2R7ZH 3NWSA 4JCVE 1E7ZA 1DCZA 1SYFA 3DEOA 4NKLA 1JC7A 2NBFA 3MWYW 4NB3A 4ODGA 1SNDA 4C56C 1EYDA 1IBLQ 4GZYC 3ICEA 1LTID 2KEEA 4GNXC 1VQFA 2F0LA 4YCWA 3CCVA 4G7HC 1K73C 1J8IA 3NP8A 4KN4C 2RBMA 5J39A 2ICIA 3RZDB 3ULJA 1KXLA 5IGCA 2UU9Q 1HPCA 4ZUIA 5C44B 4MTKA 4A3FB 3H91A 4DV3Q 1WTWA 1ENFA 4KKSA 4DR1L 4P73A 5C0XG 2TMPA 2C9OA 1VQKA 4A3FG 4HIKA 1PH9A 1A62A 1Y1WH 1A6XA 1TWHB 3JAME 1FNWA 2IT1A 3T1YQ 2EYJA 4TVAB 5KNDA 3IRBA 5FK9C 3CCSA 3PO2H 3NELA 4POFA 1SXTA 3MZ5A 4QUCA 4DV2L 5TSSA 4X62Q 3GTKB 2F0EA 3NUCA 1XX8A 1YZ6A 4WRDA 1AZPA 2OTLA 2B2VA 3J7AF 2Z6KC 2KCMA 2VB2X 5I9OA 1B50A 5ELOA 5DM73 2R92G 2WIIB 1A15A 2A73B 3DWQA 3RMHA 1BCPB 1CQFA 2HCIA 2RDGA 2IWHA 2UXDL 2JXMB 3QR8A 1BF4A 2Z0SA 1KC8C 4FF2A 3W2DA 1PRTC 1BCPF 4NDXA 1I4XA 1I6VC 4N8FA 4PG3A 3BVMA 1KL9A 2YYZA 1PHJA 1IYUA 2EXDA 4C2MH 3F8TA 4DV0Q 2JQOA 1ESRA 2KA7A 3MXGA 3X3MA 4PMBA 3I72A 4LWCA 3ND9A 5CGKA 1Q12A 2BDOA 5FO9B 3ER0A 4ZLTF 3K7UC 2OWOA 1VQ7A 3UDIA 3MA2B 1LM0A 4HCSA 2CW0D 5CBEE 4JW0A 5A2QE 3PQIA 1VQHA 4A3JH 1VCIA 2WV6D 4YHHQ 3H3VC 3GO5A 1VQ8A 4L5QA 1ZYRC 1YNND 2EXZA 4C3JH 1DJRD 1X3EA 5KYLA 3MVVA 5H1SE 2PQEA 1N32Q 1H9KA 4OWWB 4FVMA 1TS4A 3MXPA 1YNXA 2I5HA 1LABA 4P2CB 4E6IA 2B2YC 1KQSA 3RNUA 4KHVA 4A3IH 2I07B 1VQLA 1KD1C 2L15A 1YNJC 1LT6D 4LF7L 1CUKA 2B63H 3NWTA 4OIKA 4GLVB 1EIHA 3TP6A 4RH6A 2JA7G 1G6PA 3RUZA 3CMAA 3R8BA 2BA1A 5DM63 1JWMD 4GN5A 2QGQA 4NXMQ 2R93H 1STAA 4BXXG 3AQQA 2K32A 3A7AB 4A3GH 2QW7A 4ZUJA 4LFAQ 2G9DA 5KGUA 3HOUB 2SNSA 4GNXB 2F0SA 5IP7H 1E2ZA 2JE6I 2OF1A 1C7YA 3CD6A 1JQYD 1EY7A 1H9SA 3L9AX 5I6YA 2F0MA 3HOUG 3IFDA 4OO1H 4MN3A 3VR6A 4JV5L 3A8JE 5ELNA 4QB4A 2OTJA 2A68C 1YHBA 4ME3A 4A3EH 3A5UA 1HQRD 4HJ7A 2PI2A 2OQ0A 2N3SA 1JJCB 3W1GA 3GTGB 3EVQA 3K80C 2H5XA 3ONAB 4H44C 4C3HG 4B3SL 4H02A 3T4AC 2F0TA 4LW1A 4TKOB 1STBA 2NWGA 2D5DA 4JI8Q 3VDYA 2F52A 1LTRD 3QJYA 2ZXOA 1C48A 1GUGA 1PZID 1N33L 1HA5A 3UDGA 2L5TA 3CKIB 4ZKBB 5T1IA 1UAPA 1Z6HA 5C44H 4FP5D 4KY7A 3CRLC 2XWBB 5LHY1 4MTNA 3CCLA 1UEBA 1A8VA 2B2WC 2QDBA 4L8JA 1U4RA 1S72A 4KKUA 1H95A 4RGTA 4HEDA 4FDBA 1D1IA 2WAQB 1EEID 1PRTB 5ELDA 5ISRA 2PMZE 1JWUD 3KDFA 5I2YA 2NVXB 1EUJA 1EIGA 3IFTA 2L1BA 2NYZD 2WAQG 1NMFA 3BDCA 1J5EQ 2ZT9C 2VUMB 4B9XA 2Y0SE 1U0LA 2EJMA 3GTKH 4LFBQ 5EGTA 2UUAQ 4HCEA 2VNUD 2VUMG 2LS01 4ZRZA 1Y14B 2A19A 3D4RA 1MIUA 1Q7YC 4C3IB 1EQVA 1YJ9A 3D8GA 1B9MA 1D5ZC 2QEJC 4RWSC 4H13C 2JA6H 5M5XB 2I5LX 4HN7A 3SEBA 1HRJA 4JOIA 1SFOH 1MJCA 2PW5A 4C3IG 3M7GA 3RD4A 1VQEA 3KUPA 3CAMA 2OT2A 1R4QB 5FOBB 4BS9A 5JEAJ 1IW7C 3EN2A 5KIXA 1SDFA 2VQFQ 2ATWA 3CCEA 1K83H 5HGTA 3I4NH 4J8QA 5KYIA 2AQ1B 4BBSH 5E4WC 1Q82C 2SDFA 4KI0A 3QOJA 5LMUQ 2ZM6Q 1T5XD 3K57A 4Y52H 1JJ2A 1HNZL 1OO9B 3TREA 3IKJA 4RHSA 2EYMA 3W1BA 4F88A 5LMNW 1VQJA 4DUYQ 3TS2A 2F0VA 2JEAI 3HP3A 4IPDA 1CA6A 2NVYB 1TKWB 3T13A 1YNNC 1PYWD 1TS2A 2WB1G 4Q0FA 3VR2A 1EYAA 2NB0A 1WTHA 3A54A 4DXGA 2Z9HA 2KCTA 5M9OA 5C5MA 4DFAA 5FJ8H 1L1OC 1K3BC 4R4QA 3C46A 1U4LA 2L9HA 5D65A 4A3KH 4MZ9A 1CKOA 2N88A 2BE5C 1XMOQ 1EIYB 2Z4IA 3BZKA 2CQOA 4XQJA 4DR5Q 3J80i 4O1NA 3BVGA 1LO5D 3OW7A 5GAGC 5IE8A 2ZJQA 1EOTA 1EFWA 3RN2A 1ICWA 3FP9A 2IX1A 4WJ3M 4N9PA 2J4XA 3G71A 5EAYA 3HKZE 5IYDH 2FMMA 4UP8A 1IBLL 1JT8A 4LF4Q 1JJGA 2NZHA 2NUCA 2KJXA 1YJNA 2OCEA 4DUZQ 4H0LC 4HSVA 2UU9L 1SSOA 4CDEC 1CM9A 2LKVA 3GV3A 3H6MA 4WJWA 2CCZA 2QILA 4DV3L 4LF6Q 5C3EG 2NN6G 3P1HA 4CKEA 4IFDI 1WOCA 3P75A 2K28A 4JYAL 4MNOA 3TP5A 1XNRQ 3OHXC 4A3BB 1TVXA 3K59A 3BDLA 4CDFC 3TZDA 1W6KA 2SEBD 1V8QA 3E0JA 4A3BG 5F2DA 1PH4A 1CZWA 3CXCA 4X62L 1PH3A 1RDPD 4A3CH 2KQ3A 2R7ZG 2F1MA 2L55A 5C0XI 4XIGS 2RSOA 5D3IB 1AFPA 3EJIA 2RDFA 3G4SA 4ZAIA 2EJGC 2N49A 1KDBA 1CKNA 1GHJA 3OSOA 3N6RA 3HS0C 4UP9A 4GKJL 2CH4A 2WP8J 4GOPC 1IXRA 4BA2I 1U9RA 3LWEA 3VR3A 3S2HH 5GQOA 3BDOA 1PFMA 2R6GA 4MHEA 1QB5D 1RKNA 4K2KA 4WORA 1Y1WB 4A3LH 2WFWA 2QEXA 2BA0A 2K52A 4IUNA 4RAUC 2RCNA 1A3VA 3CQZH 3MXNA 2NVXH 1Y8OB 3PO2B 4DV0L 1Y1WG 3GTOH 3U9OA 2RHQB 3J81E 1BOSA 3I91A 2LY7A 4EQNA 3ZYYX 1SN8A 3CCRA 1QVFA 3FMCA 1UE5A 3PO2G 1HZ9A 1GUSA 4DR3L 2JA8H 2EE1A 2PCFB 2RVLA 4XT1B 4DAPA 5CMDA 2EY5A 1BBXC 4GNXA 3HOVH 5M5WH 4C3IH 2B2TA 2K75A 2NZ1D 3TSSA 1MHWC 4APVA 4YHHL 4QF4A 4QMGA 4XDXA 5M5XH 2NVTH 5IIFA 3IAYA 4RKBA 4OIJA 1NSNS 2F0PA 3LGJA 1EFID 3H3VH 3QIAA 1TXYA 1N9WA 1PYBA 2A6EC 1SMXA 4LF9Q 3J81j 2CWPA 1TT2A 1L1OB 4V0BA 4XQQA 1YBYA 4C2MB 1RJTA 4JI0Q 1SNQA 4LAAA 4DV4Q 4CJ1B 4DN4M 2Q8RE 1QUQA 1PH8A 2XGTA 1STHA 1O7LA 2EZVA 3PUYA 5C4ZA 4B3RL 5CBAE 3BU2A 5IYCH 4R4TA 2R3ZA 4A3JB 1U4PA 2JK8A 2NVYH 1HNXQ 3GTPH 3KBGA 1NY4A 2K5QA 4NXML 3VR5A 4K5WA 4IPCA 5JJLA 1X55A 3CC7A 4A3JG 4P71A 4LFAL 4C3JB 1QG7A 5EBCA 5J3BA 3R2TA 2M00A 1PTOC 3I2ZA 5ELEA 3F2DA 1W6JA 3FEWX 4C3JG 1LLRD 5FLXL 3Q22A 3J7AV 4DKAC 3CRKC 5C0XJ 4YCUA 2RDHA 1ASYA 2BDNA 1F77A 4JC0A 4JI1Q 5IGDA 1GD7A 1WFQA 3S24A 1Y69U 2HCCA 2DN8A 1C0AA 1XPRA 1DD2A 4A3IB 3HEJA 4KN7C 2LXJA 5BN3A 2M9VA 1Q86C 3K5OA 3KDFB 5LMNQ 1G2TA 2B63B 1S5ED 2YV5A 3PV0A 4IUQA 5E4XA 2IX3A 4A3IG 1Z47A 1MSHA 5NUCA 4JI8L 1KLGD 1NBWA 1CT1D 2B63G 1EYCA 3S9WA 4DU9A 5FO7B 2R93B 1BQQT 1IL2A 3K0XA 3I7FA 4ZQ3A 1GJXA 4L63B 2K5HA 3HKSA 1QOHA 1SNOA 4XYQA 4GKKQ 3R93A 4DR2Q 2R93G 2CQAA 3A56A 1BKBA 5IGGA 3QO2A 4P72A 4S3SA 4A3GG 2FMCA 1MGSA 3FPPA 5IP7G 2B2UA 4GOPB 4A3EB 2JA9A 1F9QA 4I65A 1G6ZA 4DR7Q 4ZK9B 4OO1G 2PO4A 1WD0A 1TY0A 3FRPB 2F4IA 2ZXPA 1TR5A 2LMCB 2F0HA 4A3EG 3ITPA 1J5EL 3SK5A 4AYBE 3VA5A 1E24A 1QCBD 3M4QA 4J6HA 2PZUA 1GKHA 3KBXA 3MFYA 1SJHD 1ZEQX 2KHIA 2NTTA 3TEHB 4LFBL 2EJFC 2UUAL 2KUMA 1LYLA 3DXJC 3KF6B 2F03A 2B2TC 1B70B 4RMFA 3FVQA 1Y1VH 1QZGA 2F4VQ 5FLXc 3M4YA 5G3LF 1B7YB 5BN4A 1SE4A 1L0XB 4JI7Q 3NTIA 3MAQA 3W5OA 1YHAA 2XIWA 3K58A 4YY3L 1I5FA 5C44G 4DV5L 3KF8B 4I7AA 1BO0A 2XTIA 1UEAB 2VQFL 1EL0A 1TQOA 3K5NA 5LMUL 4UAIA 2ZM6L 3PF4A 1J9OA 3GTLH 2IX0A 2K5DA 3VR4A 5I4DA 2HHHQ 1WD1A 5DNFA 3PO3H 3NQIA 4OL7A 2EYFA 2I5MX 1P16A 2EOTA 4DUYL 2MFIA 4CHTB 2ASBA 4Q5VA 2JA6B 3MTSA 2L12A 3VYUA 2B39A 1SFOB 3C3LA 2AUKA 1NNXA 1DOMA 3PUZA 4YIJA 2JA6G 4YCVA 4G4KA 3UI2A 1PMRA 2B2WA 1LT3D 3S15B 4BY7B 1MI2A 1VMPA 1PTOB 1XMOL 3PF5A 1K83B 2HIXA 4BA1I 3I4NB 4KHPQ 2UXCQ 4BBSB 3AFPA 3TZUA 1B1ZA 4O2DA 4XT3B 2RQXA 3MHBA 3GV6A 3I4NG 4BBSG 1GM5A 5KRUA 1IKLA 2MP1A 2JA5H 3EA6A 1UNSA 2EQSA 4F8MA 4RGMA 1IKMA 5JJIA 4IJLA 1EZ6A 1GUTA 1U4MA 4X3KA 2DY8A 3AFQA 1I94L 4LF4L 4B9WA 5CV6A 1KNEA 4R4IA 3GTMH 1PZKD 2N8NA 4FO2A 4KJNA 2HDMA 1FJGQ 4DUZL 3NPPA 5D3DA 5EQ0A 4X66Q 3HOYH 3C2PA 1CKNB 1WVLA 3TP7A 4A3KB 1VQ4A 1DM0B 4LF6L 2B2UC 5FJ8G 3UE1A 2ZTEA 1AW7A 2E5LQ 2MNAA 4A3KG 1STNA 2A6HC 1XNRL 1JR0D 4JBKA 1AP0A 5BN5A 4Y7NH 3R3OA 3AMUA 1UUPA 1GUOA 3KK7A 2K6AA 1RF2D 1FL0A 3MXNB 4M1UB 2BOSA 4WFN3 1VQPA 1XXGA 3OWEB 1CFMA 1SNCA 1GO3E 1XWEA 1BBWA 1RD9D 2NN6I 1H9RA 1EY5A 4LF8Q 1B9NA 1FVIA 5IYDG 2IL8A 4DA2A 4LJZC 1HHVA 5I9PA 2NVQB 4U68A 2MPMA 4GS3A 1D5XC 1II3A 1SBBB
chains in the Genus database with same CATH topology
1GHKA 1I6HB 2K7VA 4FNFA 4DAYA 3D4WA 1F2YA 1WTQA 1PXUA 1SE3A 2XVSA 3NBIA 1CQVA 2XRSD 5A35A 4K2LA 4IURA 1KABA 1LTBD 2C5CA 4X3UA 1F9SA 2F0FA 3U9SA 4FF1A 1ZKOA 1JOKA 4A3DB 2VB3X 1K8OA 1CTMA 5KEEA 3S14B 4A3MB 4IFDH 4G7ZC 3SE0A 1H9JA 3OIPA 3S2HB 1GUNA 5D14A 2K03A 3R2IA 2XN9C 3WOEA 3CQZB 4B08A 3QB3A 1JCKB 3K5LA 2J0TD 3L7ZC 3GTOB 2B8GA 1PRTF 1Q3LA 1VF7A 5EKIA 4NMZA 2JA8B 1Q1EA 5C5LA 5EKKA 2K01A 2O5IC 1V1OA 4MIUA 3HOVB 4KD4A 5M5WB 4F7XA 2NVTB 5IGEA 3PUVA 2ENBA 4DK1A 4RGNA 4EQOA 2YU9B 5G3LD 3V96A 3GD7A 2J7ZA 3J80L 3VYRA 3NQTA 3SHLA 1PTOH 1JWSD 2PMZB 4K5VA 3BS1A 5E3FA 1QILA 1OXTA 1ET6A 1BUVT 2F0WA 2Y0SB 4RA8A 5T1GA 2CW0C 2KECA 3Q24A 4HMJA 2A69D 2IPKD 3NSWA 1STYA 3GTPB 2JSOA 5CV5A 3S1RB 2E2DC 5C4XB 1TIID 3SR1A 3KF8A 1CHQD 1C8CA 5M3FB 5K36H 3D6CA 3OPOA 3I8ZA 1S5CD 1S4ZA 1AN8A 2XNAC 5JVH3 2EYOA 4K5XA 1BCPD 4IQZA 3QG1A 3VA7A 1X3PA 3BG3A 2AWOA 4K8JA 5JPMC 3S1MB 4FYDA 1I4PA 3MXUA 4NP5A 1RTOA 5ELFA 4OO1I 4HR7B 2H4OA 1IHZA 3J7YW 3LNNA 3P20A 2F0QA 1M8AA 2AWNA 2IW3A 3KLSA 3FKIB 3C1FA 1PFNA 1A2UA 3RLFA 3VYSA 1V1PA 1NUCA 1V43A 5CORA 2B8FA 1STGA 1T5EA 4M8AA 3CHBD 2QF7A 3HKZB 3E6ZX 1TWAB 1PDQA 2JP1A 1SMYD 3SXHA 4ZYSA 3DWAA 1HUMA 4RFBA 4IN3A 1Y1VB 3F2UA 5EPJA 1EY9A 4Z9CB 1Q8IA 5CYUA 2FJ2A 4QIWB 3NK9A 3C1EA 2QCPX 3NXWA 4QUFA 4R9WA 3LX0A 5IT9L 3I70A 3V2TA 2FINB 1EEFD 4LK1C 5JVG3 3H09A 3HZXA 2QKIC 4KK7A 1AEXA 3D6WA 1DOKA 1SYBA 3DMUA 1ENCA 3GTLB 1OXXK 1JOOA 2M2LA 4I7ZC 1ONLA 4K8IA 3PO3B 1D2BA 1XTCD 2K04A 4UDUC 3D3RA 3TBIB 2CHBD 1D5MC 1FR3A 5IOCA 1ET9A 2F0UA 2X6GA 2ICEC 1MSGA 1B44D 2X69A 1TWCB 1AZQA 1EU3A 1PZJD 2GA4B 3NTKA 2L0CA 4LMQD 1ESFA 3OMGA 5CR3A 3NE5B 1HTLD 3I3CA 3J80E 3K5MA 1TU2B 3DUZA 2JA5B 1KDCA 3NTHA 1PFBA 1PRTD 4DNTB 1EY6A 2LFNA 1HUNA 1VF5C 3GTMB 3PIP3 3HG9A 5CV7A 4FXKC 4FXGC 5FO8B 3HOYB 2K5WA 5HURA 1BCPC 1TY2A 3WOFA 3Q0AA 1RODA 5E1FA 4C1NK 1G91A 2F0DA 4XXEA 4RGOS 1S5BD 1LV9A 4K14A 4Y7NB 5KNBA 3I73A 1ILQA 1MBYA 2ZXRA 3A7LA 1CI3M 1ZYRD 5CC4A 1BNZA 3P7JA 1DYQA 1HCZA 2MUYA 2PPBC 1O7YA 1LACA 3SK6A 3TP8A 4OGQC 3I4LA 5M5YB 1YNJD 2RKSA 4TQUS 2Q8IB 1Y8NB 2KHSA 1H9MA 2AQ3B 4PQXA 1HTPA 3DHQA 4FXDA 5JEAH 3M7NA 2K05A 3BYTB 3V05A 1IL8A 4TSSA 2XWJB 3T56B 3HOWB 4IUPA 5ELBA 1EQTA 4CJ2C 1A3TA 3DEPA 4OHJA 1G2SA 3PUXA 3GTQB 2F0OA 4BBRB 4IFDG 4JK1C 2ID0A 5CV4A 2PZTA 1OXUA 1Q90A 2PNRC 1A2TA 1FD7D 3M85A 5IT9E 1R4PB 4EQPA 1KNAA 1Y8PB 4AYBB 4RCNA 3HOZB 1GOZA 1CHPD 2AQ2B 2EVBA 3DM1A 3PUWA 1HFNA 2MHVA 4KD3A 1EY0A 4HMIA 2E76C 2R92B 3D31A 4FF3A 1RTNA 2O4XA 4G57A 4KV6A 3M3YB 2G9HD 5C3XA 2Z4HA 4F87A 1JOQA 1PTOF 4ZKCB 1V1PB 1QNKA 4KY6A 2F0IA 2Z1CA 1F2MA 3AU7A 3S1NB 1B2TA 2V4DA 1IW7D 3FDTA 5JPNC 1GXDC 1TWFB 1OXSC 1DXMA 1I4HA 3PMFA 3EFXD 3GP7A 3NHHA 4EVOA 1G8ZD 1I3QB 2FHTA 1I50B 4RHRA 1B3AA 1EU4A 4PV1C 1WTVA 1SNMA 4ABNA 5K36G 1NR2A 1SYEA 1MD2D 4A93B 4IALA 5EPLA 5DAUA 5FLXE 4CJ0B 1WTRA 2PYKA 1HXYD 5DEHA 3QOLA 2CVRA 2BE5D 2KVMA 1QE6A 3G7LA 1DOLA 3IL8A 4DXFA 1C4QA 2JA7B 2KOLA 1EZ8A 1D1KA 4V190 5IODA 1LTAD 3NBHA 4BY1B 1ZXTA 1Q1BA 3A8IE 2XSCA 3TN2A 2EY2A 5C3WA 5CV9A 1F2ZA 4HAEA 2N55A 2TSSA 1CA5A 3KLSX 4PMCA 5EPKA 3DWPA 4C3HB 3FPUB 1B4OA 3MC0B 1I4RA 3LWUA 4ID6A 3BVZA 2F0KA 2JEBI 2SOBA 2B2VC 1TS5A 1STEA 2SNMA 2E2IB 1R9TB 2JYOA 3HRZC 4G7OC 1F9RA 5C0XH 4RKLA 4KTAA 1E2VA 3J81L 1F2LA 1LT4D 1KTKA 1KDAA 1WCMB 4RCOA 3H94A 4ULLA 5ELCA 3ND8A 3WDNA 2MGSA 1CZGA 4BWGB 2F3VA 2EYHA 4O42A 3Q23A 1O80A 4QCLA 5EBDA 2E2HB 2HUGA 2F0JA 1NCVA 1QJOA 5JJZA 4DGZA 1X3QA 1HQMC 1ML0D 2DY7A 1KLUD 5LL6S 1E0BA 4CKCA 4KKTA 1JICA 1DONA 1PLFA 2O2LD 2A6ED 4EGVA 2HQEA 1DZ1A 1IYVA 1S5FD 2OEOA 4U673 5CV8A 1BR9A 2EYPA 1CK1A 4HSPA 3GTJB 2D62A 2EY1A 2WB1B 5FKAC 2NTSA 2DNEA 3EQLC 5JOBA 4ILWA 1FNVA 4J1MA 2EYLA 3EROA 3KLRA 3MFGA 4FF4A 4XQNA 1FNUA 1M4VA 4IUTA 3K7AB 5K5PA 1EY8A 4N9TA 3N52A 1QWYA 4XTCS 1K8MA 3OMCA 1PTOD 3W3AA 1JB3A 4KHZA 3MEHA 1KAAA 5IGFA 1BXTA 3D4DA 3RZOB 1LTGD 1D6EC 3H0GB 3TDQA 3CU7A 1LTTD 4CBVA 4CGYB 1GUWA 3K6OA 4L6TB 2KCCA 1I4QA 2F0NA 1SYDA 2EPBA 2E2JB 3URYA 4K6DA 5I2XA 1EWCA 2DNCA 4K6LA 5C3EB 3TMEA 5KNCA 1L0YB 2E74C 4JBWA 1FYCA 1NAPA 5JEAG 4DF7A 3A55A 3ERQA 3S16B 5M3MB 3S1QB 3G6JB 2WKDA 3I4MB 3I90A 3M4OB 3E5SA 1LT5D 5C4JB 1RHPA 2R7ZB 1WTXA 2KEDA 1B53A 1I4GA 5IGBA 1TS3A 2I46A 5AFWA 4R8IA 3GQBA 2K33A 2XRQD 2L4NA 1HA6A 1Z7TA 1SAPA 2H1EA 1SYGA 3SK8A 1G291 3JAML 3SDZA 5I6WA 1TWGB 3T51B 2BCOA 1XYIA 1SJED 4DNRB 1RCVD 1JORA 3BYYB 2FFKB 2MJ8A 4IUVA 2VXWA 3O13A 1S5DD 1A3UA 2O5JC 2HDLA 1WTOA 2Z8LA 5JAVA 1EWHA 1F9PA 5C4HA 4X3TA 1HFGA 3OIQA 1LTSD 3K0YA 2RSNA 2Q8TA 3Q6SA 3OOCA 4DK0A 1QNUA 2L11A 2D2CC 5COYA 1EY4A 2A69C 4PMWA 2R61A 1H9SB 4C1NI 4R8NA 4ME5A 1SNPA 2IJ0A 5A2QL 2PZWA 4PNYA 3L3OC 2E75C 3HGBA 1ENAA 2D9UA 2EDGA 5EJWA 4IFDJ 3VYTA 3SVMA 4IUUA 1OXVA 2AUJD 1JE4A 4TRDA 1SEBD 1ILPA 4KMUC 2RA4A 4KY5A 2WACA 2X6LA 3T16A 5EKLA 5J1ZA 2OXPA 3T53B 2A74C 4CKBA 4XYOA 1FGBD 2WKCA 1SE2A 2WINB 2PW7A 2A6HD 1SYCA 4IZ8A 2EY6A 4H7BA 1NR4A 3S17B 3OWFA 4DAVA 3HOXB 3S2DB 3AB9A 1BDOA 5LL6X 1VMCA 2K1BA 4A3GB 2A5HA 3QWNA 1VDZA 2NN6H 1X32A 1O7ZA 2F0GA 3SK4A 1SMYC 4HTHA 1WTPA 2KCNA 4KJOA 1O78A 3A8KE 4NW2A 2F3WA 1E2WA 5C6AA 3PIO3 4X3SA 2A68D 2B2YA 3X3NA 5J22A 3BZDB 3NWSA 1DCZA 1SYFA 3DEOA 4NKLA 1JC7A 2NBFA 3MWYW 4ODGA 1SNDA 4C56C 1EYDA 4GZYC 1LTID 2KEEA 2F0LA 4G7HC 1J8IA 3NP8A 4KN4C 2RBMA 5J39A 2ICIA 3RZDB 5IGCA 1HPCA 4ZUIA 5C44B 4A3FB 3H91A 1WTWA 1ENFA 4KKSA 5C0XG 2TMPA 2C9OA 1A6XA 1TWHB 3JAME 1FNWA 2IT1A 2EYJA 5KNDA 5FK9C 1SXTA 3MZ5A 4QUCA 5TSSA 3GTKB 2F0EA 3NUCA 1XX8A 4WRDA 1AZPA 2B2VA 3J7AF 5I9OA 2VB2X 1B50A 5DM73 2WIIB 1A15A 2A73B 3DWQA 3RMHA 1BCPB 1CQFA 2HCIA 2RDGA 2IWHA 2JXMB 1BF4A 4FF2A 3W2DA 1PRTC 1BCPF 4NDXA 1I4XA 1I6VC 3BVMA 2YYZA 1IYUA 2KA7A 1ESRA 3MXGA 3X3MA 4PMBA 3I72A 3ND9A 5CGKA 1Q12A 2BDOA 5FO9B 4ZLTF 3MA2B 4HCSA 2CW0D 5CBEE 5A2QE 1VCIA 2WV6D 3H3VC 3GO5A 1ZYRC 1YNND 2EXZA 1DJRD 5KYLA 3MVVA 2PQEA 1H9KA 4FVMA 1TS4A 3MXPA 1LABA 4P2CB 4E6IA 2B2YC 4KHVA 2I07B 1YNJC 1LT6D 3NWTA 4OIKA 1EIHA 3TP6A 4RH6A 3RUZA 3R8BA 2BA1A 5DM63 1JWMD 1STAA 2K32A 3A7AB 4ZUJA 2G9DA 5KGUA 3HOUB 2SNSA 2F0SA 1E2ZA 2JE6I 2OF1A 1JQYD 1EY7A 1H9SA 3L9AX 5I6YA 2F0MA 3IFDA 4OO1H 4MN3A 3VR6A 3A8JE 4QB4A 2A68C 1HQRD 3GTGB 3EVQA 3ONAB 4H44C 4C3HG 3T4AC 2F0TA 4TKOB 1STBA 2NWGA 2D5DA 1LTRD 3QJYA 2ZXOA 1C48A 1GUGA 1PZID 1HA5A 2L5TA 3CKIB 4ZKBB 5T1IA 1UAPA 1Z6HA 4FP5D 4KY7A 3CRLC 2XWBB 5LHY1 2B2WC 2QDBA 4L8JA 1U4RA 4KKUA 4RGTA 4HEDA 1D1IA 2WAQB 1EEID 1PRTB 5ELDA 5ISRA 1JWUD 5I2YA 2NVXB 1EIGA 3IFTA 2L1BA 2NYZD 3BDCA 2ZT9C 2VUMB 4B9XA 2EJMA 5EGTA 4HCEA 2VNUD 2LS01 4ZRZA 3D4RA 4C3IB 1EQVA 3D8GA 1B9MA 1D5ZC 2QEJC 4RWSC 4H13C 5M5XB 1HRJA 4HN7A 3SEBA 2PW5A 4C3IG 3M7GA 3RD4A 3KUPA 2OT2A 1R4QB 5FOBB 4BS9A 5JEAJ 1IW7C 5KIXA 1SDFA 5HGTA 4J8QA 5KYIA 2AQ1B 5E4WC 2SDFA 4KI0A 3QOJA 1T5XD 3K57A 1OO9B 3IKJA 4RHSA 2EYMA 4F88A 2F0VA 2JEAI 3HP3A 1CA6A 2NVYB 1TKWB 3T13A 1YNNC 1PYWD 1TS2A 4Q0FA 3VR2A 1EYAA 2NB0A 3A54A 4DXGA 5M9OA 5C5MA 4DFAA 3C46A 1U4LA 2L9HA 5D65A 2N88A 2BE5C 2Z4IA 4XQJA 4O1NA 3BVGA 1LO5D 3OW7A 1EOTA 1ICWA 2IX1A 4N9PA 2J4XA 2FMMA 2NUCA 2KJXA 4H0LC 4HSVA 1SSOA 1CM9A 2LKVA 3GV3A 3H6MA 4WJWA 2QILA 2NN6G 3P1HA 4CKEA 4IFDI 3P75A 2K28A 3TP5A 3OHXC 4A3BB 1TVXA 3K59A 3BDLA 3TZDA 1W6KA 2SEBD 1V8QA 3E0JA 5F2DA 1CZWA 1RDPD 2KQ3A 2F1MA 2L55A 5C0XI 4XIGS 2RSOA 5D3IB 1AFPA 3EJIA 2RDFA 4ZAIA 2EJGC 1KDBA 1GHJA 3OSOA 3N6RA 3HS0C 2WP8J 4BA2I 1U9RA 3LWEA 3VR3A 3BDOA 1PFMA 2R6GA 4MHEA 1QB5D 1RKNA 4K2KA 4WORA 1Y1WB 2BA0A 4IUNA 4RAUC 1A3VA 3MXNA 1Y8OB 3PO2B 3U9OA 3J81E 1BOSA 3I91A 2LY7A 4EQNA 3ZYYX 3FMCA 1GUSA 2EE1A 2PCFB 2RVLA 4XT1B 4DAPA 5CMDA 2EY5A 1BBXC 2B2TA 2NZ1D 3TSSA 4QF4A 4QMGA 4XDXA 5IIFA 3IAYA 4RKBA 4OIJA 1NSNS 2F0PA 1EFID 3QIAA 2A6EC 1TT2A 4V0BA 4XQQA 4C2MB 1RJTA 1SNQA 4LAAA 4CJ1B 4DN4M 2Q8RE 1STHA 1O7LA 2EZVA 3PUYA 5C4ZA 5CBAE 2R3ZA 4A3JB 1U4PA 3KBGA 2K5QA 3VR5A 4K5WA 4C3JB 1QG7A 5EBCA 3R2TA 2M00A 1PTOC 5ELEA 1W6JA 3FEWX 4C3JG 1LLRD 5FLXL 3Q22A 3J7AV 3CRKC 5C0XJ 2RDHA 2BDNA 1F77A 5IGDA 1Y69U 2HCCA 2DN8A 1DD2A 4A3IB 3HEJA 4KN7C 5BN3A 2M9VA 3K5OA 1G2TA 2B63B 1S5ED 3PV0A 4IUQA 5E4XA 2IX3A 1Z47A 1MSHA 5NUCA 1KLGD 1CT1D 1EYCA 3S9WA 4DU9A 5FO7B 2R93B 1BQQT 4ZQ3A 1GJXA 4L63B 4XYQA 1QOHA 1SNOA 3R93A 2CQAA 3A56A 5IGGA 3QO2A 4S3SA 2FMCA 1MGSA 3FPPA 2B2UA 4A3EB 1F9QA 4I65A 1G6ZA 4ZK9B 4OO1G 2PO4A 1WD0A 1TY0A 3FRPB 2F4IA 2ZXPA 1TR5A 2LMCB 2F0HA 3ITPA 3SK5A 3VA5A 1QCBD 4J6HA 2PZUA 3KBXA 3MFYA 1SJHD 1ZEQX 2NTTA 2EJFC 2KUMA 3DXJC 2F03A 2B2TC 3FVQA 3M4YA 5G3LF 5BN4A 1SE4A 1L0XB 3NTIA 3MAQA 2XIWA 3K58A 1BO0A 1UEAB 1EL0A 1TQOA 3K5NA 4UAIA 1J9OA 2IX0A 2K5DA 3VR4A 5I4DA 1WD1A 5DNFA 3NQIA 4OL7A 2EYFA 2EOTA 4CHTB 4Q5VA 2JA6B 3MTSA 2L12A 3VYUA 2B39A 1SFOB 3C3LA 2AUKA 1DOMA 3PUZA 4YIJA 4G4KA 3UI2A 1PMRA 2B2WA 1LT3D 3S15B 4BY7B 1MI2A 1VMPA 1PTOB 1K83B 4BA1I 3I4NB 4BBSB 3TZUA 1B1ZA 4XT3B 2RQXA 3MHBA 3GV6A 5KRUA 1IKLA 2MP1A 3EA6A 1UNSA 4F8MA 4RGMA 1IKMA 1EZ6A 1GUTA 1U4MA 4X3KA 2DY8A 4B9WA 5CV6A 1KNEA 1PZKD 4FO2A 4KJNA 2HDMA 3NPPA 5D3DA 5EQ0A 3C2PA 1WVLA 3TP7A 4A3KB 1DM0B 2B2UC 1AW7A 1STNA 2A6HC 1JR0D 1AP0A 5BN5A 3R3OA 3AMUA 1UUPA 1GUOA 3KK7A 2K6AA 1RF2D 4M1UB 2BOSA 4WFN3 1XXGA 3OWEB 1CFMA 1SNCA 1XWEA 1RD9D 2NN6I 1H9RA 1EY5A 1B9NA 2IL8A 4DA2A 4LJZC 1HHVA 5I9PA 2NVQB 4U68A 2MPMA 1D5XC 1II3A 1SBBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CBV A;  4XYO A;  4XQQ A;  4XYQ A;  4XQN A;  3BS1 A;  4XXE A;  4XQJ A;  4G4K A; 
#chains in the Genus database with same CATH topology
 1GHK A;  1I6H B;  1NMG A;  1L1O A;  2K7V A;  4FNF A;  4DAY A;  5M5Y H;  3I56 A;  1VQ5 A;  4QY7 A;  3D4W A;  4B3T Q;  1F2Y A;  1WTQ A;  3UDX A;  1PXU A;  1SE3 A;  2XVS A;  4DV7 Q;  3NBI A;  1CQV A;  2XRS D;  1SRU A;  5A35 A;  4K2L A;  4IUR A;  4ALP A;  1KAB A;  4OWT B;  4WJ4 A;  2MO1 A;  1LTB D;  2C5C A;  1MKH A;  4X3U A;  1F9S A;  1QUQ B;  2F0F A;  3U9S A;  4FF1 A;  4A3C G;  1ZKO A;  3ULL A;  1JOK A;  1S40 A;  4A3D B;  2VB3 X;  1K8O A;  1CTM A;  5KEE A;  1VQ6 A;  3S14 B;  4A3M B;  3GTQ H;  4IFD H;  4P75 A;  3OW2 A;  4G7Z C;  1Q46 A;  4L5R C;  4BBR H;  1VQA A;  3SE0 A;  2YTX A;  1H9J A;  3OIP A;  3S2H B;  1GUN A;  1WYD A;  5D14 A;  1SR3 A;  1U5K A;  2K03 A;  4LF9 L;  4UY8 C;  1IYJ B;  4JI2 Q;  3R2I A;  2XN9 C;  3WOE A;  3CQZ B;  4B08 A;  3QB3 A;  1JCK B;  4JI6 Q;  3K5L A;  1X3G A;  2J0T D;  3L7Z C;  5FLM H;  3GTO B;  4A3L G;  2B8G A;  3EIV A;  4DV4 L;  1PRT F;  3CCU A;  1Q3L A;  1VF7 A;  4DV1 Q;  5EKI A;  3SGI A;  4NMZ A;  1XMQ Q;  2JA8 B;  1HNW Q;  2YTY A;  1Q1E A;  3HOZ H;  3BJU A;  5C5L A;  2K5N A;  5EKK A;  2K01 A;  2O5I C;  1V1O A;  2KBN A;  2Q2H A;  4MIU A;  3HOV B;  4KD4 A;  5M5W B;  2JA8 G;  4F7X A;  2NVT B;  3NEM A;  1JB7 A;  5IGE A;  3HOV G;  3PUV A;  3CC4 A;  2ENB A;  4DK1 A;  4GOP A;  4RGN A;  4EQO A;  2YU9 B;  4GLX A;  5G3L D;  1W2B A;  2WB1 E;  3V96 A;  3GD7 A;  2J7Z A;  3RLO A;  3PSI A;  3J80 L;  3VYR A;  3S15 H;  2GVB A;  3NQT A;  4BY7 H;  3SHL A;  1PTO H;  2A8V A;  1JWS D;  4LUV A;  1XNQ Q;  3M3Y H;  2PMZ B;  4A4I A;  4DR6 Q;  4K5V A;  4JI1 L;  3BS1 A;  1X54 A;  5E3F A;  1QIL A;  1OXT A;  2PQA A;  2ZJR A;  1ET6 A;  1BUV T;  2F0W A;  3CP0 A;  2Y0S B;  4RA8 A;  5LMN L;  5T1G A;  4DAM A;  2CW0 C;  2KEC A;  3KF6 A;  1SLJ A;  3PIP A;  3J81 i;  3Q24 A;  4HMJ A;  2A69 D;  2Y0S G;  2IPK D;  3S1N H;  3KJP A;  3NSW A;  1STY A;  1K28 A;  3GTP B;  4A75 A;  2JSO A;  5CV5 A;  5IYC G;  3S1R B;  2E2D C;  5C4X B;  1TWF H;  1X6O A;  4GKK L;  3CCJ A;  1TII D;  3SR1 A;  4DR2 L;  3KF8 A;  1CHQ D;  1C8C A;  3ERS X;  5M3F B;  5K36 H;  3M9B A;  3D6C A;  4DR4 L;  1I3Q H;  3OPO A;  1I50 H;  3I8Z A;  1S5C D;  1S4Z A;  1AN8 A;  1A0I A;  2XNA C;  5JVH 3;  2EYO A;  2A1A A;  3A5Z B;  4K5X A;  4QJF A;  5E7N A;  1BCP D;  4X64 Q;  5M3F G;  4DR7 L;  4IQZ A;  4A93 H;  1N34 Q;  3QG1 A;  3VA7 A;  1X3P A;  3BG3 A;  2AWO A;  5HY6 A;  4K8J A;  5JPM C;  3STB D;  3S1M B;  4HJA A;  4FYD A;  1I4P A;  3MXU A;  1EIF A;  4NP5 A;  1RTO A;  5ELF A;  1JMC A;  1C9O A;  4OO1 I;  4HR7 B;  2MQH A;  3E9I A;  3J80 c;  2NVQ H;  2H4O A;  2F4V L;  1IHZ A;  3J7Y W;  4QIW E;  3LNN A;  2ZTD A;  3P20 A;  2F0Q A;  4OEM B;  4HIM A;  2P5Z X;  4JI7 L;  1M8A A;  1PFS A;  1I6H H;  2AWN A;  2IW3 A;  1YIT A;  3KLS A;  3FKI B;  3G48 A;  3PCO B;  2V1C C;  3C1F A;  1PFN A;  2JJQ A;  3DM3 A;  3KFU A;  1A2U A;  1VS0 A;  4BY1 H;  3RLF A;  3VYS A;  1V1P A;  1NUC A;  1V43 A;  3T1Y L;  5COR A;  1GVP A;  2N78 A;  1K0R A;  2B8F A;  1STG A;  1T5E A;  3EBE A;  4M8A A;  3CHB D;  3Q8D A;  2QF7 A;  1B3Q A;  3HKZ B;  1CSP A;  3PIO A;  3E6Z X;  4OON A;  2HHH L;  1TWA B;  1PDQ A;  2JP1 A;  3KYH C;  1SMY D;  2IHF A;  3SXH A;  1EQQ A;  4ZYS A;  3DWA A;  2YTV A;  1HUM A;  4RFB A;  4IN3 A;  3HKZ G;  1Y1V B;  2DJG C;  3F2U A;  4DV6 Q;  5EPJ A;  1EY9 A;  4Z9C B;  4A3D H;  1Q8I A;  3S14 H;  5CYU A;  4A3M H;  2FJ2 A;  1PA6 A;  4QIW B;  3NK9 A;  3C1E A;  2QCP X;  1Y1V G;  3NXW A;  4QUF A;  4R9W A;  3LX0 A;  4JVZ A;  5IT9 L;  2AMC B;  3I70 A;  3V2T A;  3AEV A;  2FIN B;  4JPB W;  2E2I H;  1EEF D;  4LK1 C;  5JVG 3;  1HR0 W;  3H09 A;  3HZX A;  2QKI C;  4KHP L;  4LF5 Q;  4KK7 A;  1AEX A;  3D6W A;  1DOK A;  1LTL A;  4HIO A;  1SYB A;  3DMU A;  1ENC A;  3GTL B;  1OXX K;  1PH2 A;  3J7A 5;  1RL2 A;  1JOO A;  4JV5 Q;  2Q2T A;  2M2L A;  4I7Z C;  1ONL A;  4K8I A;  3PO3 B;  1D2B A;  1XTC D;  1WCM H;  2K04 A;  4UDU C;  3D3R A;  1L0W A;  5IY0 A;  3TBI B;  2CHB D;  1D5M C;  1FR3 A;  3I4O A;  5IOC A;  1IBM Q;  1ET9 A;  2UXB Q;  3PO3 G;  2F0U A;  3CCQ A;  4B3M Q;  1X3F A;  1VQG A;  3B6Y A;  2X6G A;  1XPU A;  1FJG L;  2ICE C;  1NTG A;  1MSG A;  1B44 D;  2X69 A;  1TWC B;  4X66 L;  1AZQ A;  2YU9 H;  1EU3 A;  3FHW A;  3G6E A;  1PZJ D;  2GA4 B;  1AH9 A;  1N32 L;  2UUC Q;  3NTK A;  2E2H H;  4DAY B;  2L0C A;  4HID A;  2DGY A;  4LMQ D;  2E5L L;  1KAW A;  3F2C A;  2F3I A;  1ESF A;  3OMG A;  5CR3 A;  4L5T A;  3NE5 B;  2BH2 A;  3A0J A;  1HTL D;  3JAM i;  3I3C A;  1Q81 C;  3J80 E;  1S3O A;  3K5M A;  1TU2 B;  3DUZ A;  2JA5 B;  1PVO A;  1KDC A;  5GAH C;  1UE1 A;  3NTH A;  1PFB A;  1PRT D;  4DNT B;  1EY6 A;  2LFN A;  2FXQ A;  1HUN A;  2JA5 G;  3CPF A;  1VF5 C;  4LF8 L;  3GTM B;  5IT9 c;  1OTC A;  3PIP 3;  2B3G A;  3HG9 A;  5CV7 A;  3CF5 A;  3S1R H;  2K14 A;  4FXK C;  4FXG C;  5C4X H;  4IOC A;  5FO8 B;  3HOY B;  4K0K Q;  3GTJ H;  2K5W A;  2ALY B;  5M3F H;  5HUR A;  1PH1 A;  1BCP C;  1TY2 A;  4B3T L;  3HOY G;  3WOF A;  3Q0A A;  2VS1 A;  1ROD A;  2PNH A;  2DJF C;  4IPG A;  5E1F A;  4C1N K;  1G91 A;  2F0D A;  4XXE A;  4RGO S;  1FGU A;  4R4C A;  1WI5 A;  3E3X A;  1S5B D;  4DV7 L;  2RHS B;  1LV9 A;  5IYB H;  4K14 A;  4Y7N B;  5KNB A;  3I73 A;  1BBU A;  2ZXR A;  1ILQ A;  3A7L A;  1NE3 A;  1MBY A;  1W3S A;  3CME A;  1IZ6 A;  1CI3 M;  1ZYR D;  2D0P A;  5CC4 A;  4X65 Q;  5DLQ E;  2QA4 A;  2B29 A;  1BNZ A;  4OEL B;  3S1M H;  3P7J A;  1UWV A;  1DYQ A;  1HCZ A;  2MUY A;  2PPB C;  1MJE A;  3PGZ A;  1O7Y A;  2CKZ B;  1HZC A;  3CW2 C;  3L2P A;  1N36 Q;  1LUZ A;  1LAC A;  4P74 A;  3SK6 A;  3H0G H;  1ICF B;  3TP8 A;  1YJW A;  1AE3 A;  4OGQ C;  3I4L A;  1Q8K A;  5M5Y B;  4HJ5 A;  2ES2 A;  1YNJ D;  3FKI H;  3H15 A;  2RKS A;  4TQU S;  2Q8I B;  2E2J H;  1Y8N B;  2KHS A;  4JI2 L;  3ULP A;  1H9M A;  4DNI A;  4AQY Q;  2AQ3 B;  5JJK A;  4PQX A;  4JI6 L;  1HTP A;  3DHQ A;  4FXD A;  5JEA H;  3M7N A;  2K05 A;  3BYT B;  3V05 A;  2JN4 A;  4DV1 L;  2PQA B;  1IL8 A;  4TSS A;  1TWA H;  2XWJ B;  1HNW L;  5M3M H;  1SE8 A;  3T56 B;  3HOW B;  3I4M H;  4IUP A;  5ELB A;  1EQT A;  4CJ2 C;  3M4O H;  1E1O A;  1A63 A;  1A3T A;  3DEP A;  4OHJ A;  1G2S A;  4JI5 Q;  3PUX A;  4JI3 Q;  3GTQ B;  3U4Z A;  2Q2I A;  5C4J H;  2F0O A;  1YVC A;  4BBR B;  3KJO A;  1V9P A;  3A74 A;  4IFD G;  4JK1 C;  2ID0 A;  4BBR G;  4YWK A;  5CV4 A;  2PZT A;  1OXU A;  4UHV A;  1VQB A;  4X6A H;  1Q90 A;  1K0S A;  2VW9 A;  2R7D A;  5GAE C;  2PNR C;  1XNQ L;  1B8A A;  1A2T A;  4DR6 L;  1VQ9 A;  1FD7 D;  1TWG H;  3M85 A;  5IT9 E;  1K8G A;  1V1Q A;  5GRO A;  1KIX A;  1R4P B;  4EQP A;  1KNA A;  1Y8P B;  4AYB B;  4EQ5 A;  5FLM G;  4NPS A;  3MEF A;  4RCN A;  3HOZ B;  4JYA Q;  4AYB G;  1GOZ A;  1CHP D;  2AQ2 B;  2EVB A;  3CPW A;  1BVS A;  3H3V I;  2ZTC A;  3DM1 A;  1QVG A;  3HOZ G;  3PUW A;  1VQM A;  1HFN A;  4O0A A;  2MHV A;  2NZO A;  4KD3 A;  4KLK A;  1EY0 A;  4R4O A;  4HMI A;  2E76 C;  1TWC H;  3CCM A;  2R92 B;  1HR0 Q;  3D31 A;  4FF3 A;  1RTN A;  2O4X A;  4G57 A;  4KV6 A;  4IO9 A;  3M3Y B;  2G9H D;  1HH2 P;  3RN5 A;  3OTO Q;  3I55 A;  5C3X A;  4DR5 L;  2Z4H A;  5BR8 Q;  4X64 L;  4GKJ Q;  4EX5 A;  4BY7 G;  4F87 A;  1JOQ A;  1PTO F;  3F1Z A;  3KOJ A;  4ZKC B;  1N34 L;  1QVC A;  1V1P B;  1X65 A;  1QNK A;  4KY6 A;  4CDC C;  3HFZ B;  2F0I A;  2RCF A;  2Z1C A;  4ZCK A;  1F2M A;  2G5D A;  3AU7 A;  3S1N B;  5HGQ A;  1B2T A;  2V4D A;  1IW7 D;  3FDT A;  1YHQ A;  4JI4 Q;  5JPN C;  3JC6 6;  2R7F A;  1GXD C;  1TWF B;  1OXS C;  1DXM A;  1I4H A;  1PH6 A;  3PMF A;  3EFX D;  3GP7 A;  4DR3 Q;  3NHH A;  4EVO A;  1K8A C;  1G8Z D;  1I3Q B;  2FHT A;  1I50 B;  4RHR A;  1B3A A;  1EU4 A;  4PV1 C;  2HT1 A;  1WTV A;  1SNM A;  4ABN A;  5K36 G;  1NR2 A;  1HZB A;  1SYE A;  1MD2 D;  4GN4 B;  4A93 B;  2AKW B;  2HD3 A;  4IAL A;  1IBK Q;  5EPL A;  2IY5 B;  5DAU A;  5FLX E;  3BZC A;  4A93 G;  4CJ0 B;  1WTR A;  2PYK A;  2VL6 A;  3L0O A;  1HXY D;  5DEH A;  1UE6 A;  3QOL A;  2CVR A;  4GN3 B;  2BE5 D;  2Q2U A;  2KVM A;  1QE6 A;  4DV6 L;  4NXN Q;  3G7L A;  1DOL A;  3IL8 A;  1K9M C;  4LFC Q;  4DXF A;  1C4Q A;  2JA7 B;  2KOL A;  1EZ8 A;  1D1K A;  3UE0 A;  4B3R Q;  2VQE Q;  4V19 0;  5IOD A;  4LUO A;  3S17 H;  1LTA D;  3NBH A;  3HOX H;  4DK6 C;  4YWM A;  3S2D H;  1Z9F A;  5IWA Q;  1AE2 A;  4BY1 B;  1ZXT A;  5IP9 H;  3K81 C;  1VQI A;  1T9H A;  1Q1B A;  3A8I E;  2XSC A;  4LF5 L;  3TN2 A;  1EOV A;  2EY2 A;  4BY1 G;  5C3W A;  5CV9 A;  1F2Z A;  4LNQ A;  1PV4 A;  4HAE A;  2N55 A;  2TSS A;  1CA5 A;  1EQR A;  3KLS X;  4JBJ A;  4POG A;  3HOW H;  4PMC A;  2WAQ E;  5EPK A;  3DWP A;  4C3H B;  3FPU B;  3GDE A;  1B4O A;  1IBM L;  4OWX B;  4CDD C;  2UUB Q;  2UXB L;  3MC0 B;  1I4R A;  4B3M L;  3LWU A;  4ID6 A;  4QGU A;  3BVZ A;  4A3D G;  2F0K A;  1HJP A;  2JEB I;  2SOB A;  2B2V C;  4A3M G;  1PYS B;  2K50 A;  1TS5 A;  1STE A;  4OX9 Q;  2SNM A;  1XPO A;  2E2I B;  1R9T B;  1D7Q A;  2UUC L;  1E1T A;  3RR5 A;  2JYO A;  3F2B A;  1D8L A;  3RZD H;  3HRZ C;  2OQK A;  4G7O C;  1F9R A;  4JI0 L;  5C0X H;  5GAD C;  4RKL A;  4A3F H;  4KTA A;  1E2V A;  3J81 L;  1F2L A;  1LT4 D;  1KTK A;  1KDA A;  1WCM B;  3T1H Q;  4JBM A;  4RCO A;  1TWH H;  3H94 A;  4ULL A;  4HJ8 A;  1WCM G;  5ELC A;  5AJ3 Q;  3ND8 A;  4DPG A;  1HNX L;  3D0F A;  2Z6B A;  3U50 C;  3WDN A;  2MGS A;  1CZG A;  4BWG B;  1E22 A;  2E8G A;  1VQC A;  2F3V A;  2EYH A;  4K0K L;  2R92 H;  4O42 A;  3Q23 A;  1O80 A;  4QCL A;  5EBD A;  1EYG A;  2E2H B;  1E3P A;  4A76 A;  2HUG A;  3OYY A;  2F0J A;  2C35 B;  1NCV A;  1QJO A;  1VQO A;  2CWA A;  2RF4 A;  5JJZ A;  2AHO B;  2I0Q A;  4DGZ A;  1X3Q A;  4YY3 Q;  4DR1 Q;  1HQM C;  1ML0 D;  2ZJP A;  2DY7 A;  4DV5 Q;  1KLU D;  4UPA A;  5LL6 S;  1E0B A;  4X65 L;  4CKC A;  4KKT A;  1JIC A;  1DON A;  1PLF A;  2O2L D;  2A6E D;  1KRT A;  4EGV A;  1KHI A;  2HQE A;  1RIP A;  1DZ1 A;  1IYV A;  1S5F D;  4DV2 Q;  2OEO A;  4U67 3;  1N36 L;  5CV8 A;  1BR9 A;  2EYP A;  1CK1 A;  4HSP A;  3GTJ B;  2D62 A;  2MO0 A;  1YIJ A;  2EY1 A;  2WB1 B;  4IJH A;  5C4X G;  1L2F A;  5FKA C;  3CC2 A;  2KEN A;  2NTS A;  2DNE A;  2DUD A;  2VY3 A;  1ASZ A;  3J81 c;  3EQL C;  5JOB A;  4ILW A;  1CKM A;  2UXD Q;  1FNV A;  4J1M A;  4QL5 A;  2EYL A;  4AQY L;  3ERO A;  3KLR A;  3MFG A;  4FF4 A;  4XQN A;  4QQB X;  2LXK A;  1FNU A;  1M4V A;  4PZ7 A;  4IUT A;  3K7A B;  5K5P A;  3J7Z C;  1EY8 A;  3AYH B;  4N9T A;  3N52 A;  1QWY A;  4XTC S;  5IYB G;  1K8M A;  4AH6 A;  3OMC A;  1PTO D;  3W3A A;  1JB3 A;  4KHZ A;  3MEH A;  1KAA A;  5IGF A;  3TS0 A;  1BXT A;  3D4D A;  2HQL A;  3RZO B;  1LTG D;  1D6E C;  4JI5 L;  4JI3 L;  3H0G B;  3TDQ A;  2EIF A;  3CU7 A;  4PZ6 A;  1LTT D;  4CBV A;  1N8R C;  4CGY B;  2JA7 H;  1GUW A;  3K6O A;  4L6T B;  2KCC A;  1I4Q A;  1JE5 A;  2F0N A;  1SYD A;  3H0G G;  4BXX H;  1I94 Q;  1XTD A;  2EPB A;  2E2J B;  3URY A;  4K6D A;  5I2X A;  1EWC A;  2DNC A;  4K6L A;  3FKI G;  1XJV A;  5C3E B;  3HOU H;  3TME A;  5KNC A;  4YWL A;  1L0Y B;  2K5V A;  2E74 C;  1PH5 A;  1P8L A;  4JBW A;  4PZ8 A;  1FYC A;  1NAP A;  5JEA G;  4DF7 A;  3A55 A;  3ERQ A;  3S16 B;  5M3M B;  1EWI A;  1M1K C;  3S1Q B;  3G6J B;  2WKD A;  3I4M B;  3I90 A;  4LUZ A;  4C3H H;  3M4O B;  3K8A A;  2HIV A;  5M3M G;  3E5S A;  3GTG H;  1LT5 D;  5C4J B;  3I4M G;  1RHP A;  2R7Z B;  4R1J A;  1WTX A;  2GN5 A;  2KED A;  2IHE A;  1B53 A;  4LF7 Q;  1VQD A;  1I4G A;  3E0E A;  5IGB A;  1TS3 A;  1J6Q A;  2I46 A;  5AFW A;  4R8I A;  3U4V A;  4DK3 C;  3GQB A;  2K33 A;  2XRQ D;  1HR0 L;  2L4N A;  1HA6 A;  1YI2 A;  1Z7T A;  1SAP A;  1M90 C;  1R9T H;  2H1E A;  1VQN A;  1SYG A;  3SK8 A;  3OTO L;  1G29 1;  3JAM L;  2UXC L;  4JOI C;  3SDZ A;  5I6W A;  5BR8 L;  1UE7 A;  1TWG B;  3T51 B;  2BCO A;  1QZH A;  1XYI A;  1SJE D;  4IPH A;  4DNR B;  2QDL A;  3E9H A;  1RCV D;  1JOR A;  3BYY B;  2FFK B;  2MJ8 A;  2LSS A;  4IUV A;  2VXW A;  2VZA A;  3O13 A;  3M4P A;  1K3R A;  2K4K A;  1S5D D;  4B3S Q;  4JI4 L;  1A3U A;  2O5J C;  2HDL A;  2PI2 E;  3NEN A;  1WTO A;  2VUM H;  2Z8L A;  5JAV A;  4AIM A;  1EWH A;  1F9P A;  5C4H A;  2BH8 A;  4X3T A;  1HFG A;  3OIQ A;  1LTS D;  3K0Y A;  3ZJY C;  2RSN A;  1N33 Q;  2Q8T A;  4J15 A;  3NBH B;  1YEZ A;  3Q6S A;  3OOC A;  4DK0 A;  1QNU A;  2L11 A;  1O7I A;  2D2C C;  5COY A;  1EY4 A;  1IBK L;  2A69 C;  3UDF A;  1X9N A;  1WJJ A;  4PMW A;  2R61 A;  1H9S B;  4C1N I;  2GVA A;  3WWV A;  3DLL A;  1X56 A;  4R8N A;  4ME5 A;  1SNP A;  2CH4 W;  2IJ0 A;  5A2Q L;  2PZW A;  4NXN L;  4HJ9 A;  4PNY A;  3L3O C;  5L37 A;  2E75 C;  4LFC L;  3HGB A;  1NJI C;  1KRS A;  1ENA A;  2D9U A;  3JAM c;  2EDG A;  5EJW A;  2VQE L;  4IFD J;  2Z6K A;  3VYT A;  4OXP A;  3SVM A;  4IUU A;  1OXV A;  2AUJ D;  1JE4 A;  4TRD A;  5IWA L;  4JG2 A;  1DGS A;  1HZA A;  1SEB D;  3STB C;  1ILP A;  4KMU C;  2RA4 A;  4KY5 A;  4N8X 1;  2WAC A;  4UP7 A;  2X6L A;  3K7A H;  3T16 A;  1PH7 A;  5EKL A;  5J1Z A;  2OXP A;  3T53 B;  1SRO A;  2A74 C;  3TRZ A;  4CKB A;  4XYO A;  2KHJ A;  1FGB D;  2WKC A;  1SE2 A;  2WIN B;  3RLN A;  1G51 A;  4GLA C;  3RZO H;  2UUB L;  1HNZ Q;  2PW7 A;  2A6H D;  1SYC A;  2CFM A;  4IZ8 A;  2EY6 A;  4H7B A;  1NR4 A;  3S17 B;  3OWF A;  1CSQ A;  4DAV A;  3HOX B;  3S2D B;  4OX9 L;  4IOA A;  3AB9 A;  1BDO A;  5LL6 X;  1VMC A;  2K1B A;  4A3G B;  2A5H A;  3HOX G;  3QWN A;  4L5S A;  2D0O A;  5C3E H;  1VDZ A;  2NN6 H;  1X32 A;  5IP9 G;  1O7Z A;  2F0G A;  3SK4 A;  3KLW A;  1SMY C;  4HTH A;  1WTP A;  2KCN A;  4DR4 Q;  4KJO A;  1XMQ L;  3S16 H;  4RG1 A;  3S1Q H;  3T1H L;  1O78 A;  3A8K E;  4NW2 A;  2F3W A;  1E2W A;  5C6A A;  3PIO 3;  4X3S A;  3TQY A;  4A3B H;  2A68 D;  2B2Y A;  3U58 A;  3X3N A;  5J22 A;  3BZD B;  5AJ3 L;  3HOW G;  2R7Z H;  3NWS A;  4JCV E;  1E7Z A;  1DCZ A;  1SYF A;  3DEO A;  4NKL A;  1JC7 A;  2NBF A;  3MWY W;  4NB3 A;  4ODG A;  1SND A;  4C56 C;  1EYD A;  1IBL Q;  4GZY C;  3ICE A;  1LTI D;  2KEE A;  4GNX C;  1VQF A;  2F0L A;  4YCW A;  3CCV A;  4G7H C;  1K73 C;  1J8I A;  3NP8 A;  4KN4 C;  2RBM A;  5J39 A;  2ICI A;  3RZD B;  3ULJ A;  1KXL A;  5IGC A;  2UU9 Q;  1HPC A;  4ZUI A;  5C44 B;  4MTK A;  4A3F B;  3H91 A;  4DV3 Q;  1WTW A;  1ENF A;  4KKS A;  4DR1 L;  4P73 A;  5C0X G;  2TMP A;  2C9O A;  1VQK A;  4A3F G;  4HIK A;  1PH9 A;  1A62 A;  1Y1W H;  1A6X A;  1TWH B;  3JAM E;  1FNW A;  2IT1 A;  3T1Y Q;  2EYJ A;  4TVA B;  5KND A;  3IRB A;  5FK9 C;  3CCS A;  3PO2 H;  3NEL A;  4POF A;  1SXT A;  3MZ5 A;  4QUC A;  4DV2 L;  5TSS A;  4X62 Q;  3GTK B;  2F0E A;  3NUC A;  1XX8 A;  1YZ6 A;  4WRD A;  1AZP A;  2OTL A;  2B2V A;  3J7A F;  2Z6K C;  2KCM A;  2VB2 X;  5I9O A;  1B50 A;  5ELO A;  5DM7 3;  2R92 G;  2WII B;  1A15 A;  2A73 B;  3DWQ A;  3RMH A;  1BCP B;  1CQF A;  2HCI A;  2RDG A;  2IWH A;  2UXD L;  2JXM B;  3QR8 A;  1BF4 A;  2Z0S A;  1KC8 C;  4FF2 A;  3W2D A;  1PRT C;  1BCP F;  4NDX A;  1I4X A;  1I6V C;  4N8F A;  4PG3 A;  3BVM A;  1KL9 A;  2YYZ A;  1PHJ A;  1IYU A;  2EXD A;  4C2M H;  3F8T A;  4DV0 Q;  2JQO A;  1ESR A;  2KA7 A;  3MXG A;  3X3M A;  4PMB A;  3I72 A;  4LWC A;  3ND9 A;  5CGK A;  1Q12 A;  2BDO A;  5FO9 B;  3ER0 A;  4ZLT F;  3K7U C;  2OWO A;  1VQ7 A;  3UDI A;  3MA2 B;  1LM0 A;  4HCS A;  2CW0 D;  5CBE E;  4JW0 A;  5A2Q E;  3PQI A;  1VQH A;  4A3J H;  1VCI A;  2WV6 D;  4YHH Q;  3H3V C;  3GO5 A;  1VQ8 A;  4L5Q A;  1ZYR C;  1YNN D;  2EXZ A;  4C3J H;  1DJR D;  1X3E A;  5KYL A;  3MVV A;  5H1S E;  2PQE A;  1N32 Q;  1H9K A;  4OWW B;  4FVM A;  1TS4 A;  3MXP A;  1YNX A;  2I5H A;  1LAB A;  4P2C B;  4E6I A;  2B2Y C;  1KQS A;  3RNU A;  4KHV A;  4A3I H;  2I07 B;  1VQL A;  1KD1 C;  2L15 A;  1YNJ C;  1LT6 D;  4LF7 L;  1CUK A;  2B63 H;  3NWT A;  4OIK A;  4GLV B;  1EIH A;  3TP6 A;  4RH6 A;  2JA7 G;  1G6P A;  3RUZ A;  3CMA A;  3R8B A;  2BA1 A;  5DM6 3;  1JWM D;  4GN5 A;  2QGQ A;  4NXM Q;  2R93 H;  1STA A;  4BXX G;  3AQQ A;  2K32 A;  3A7A B;  4A3G H;  2QW7 A;  4ZUJ A;  4LFA Q;  2G9D A;  5KGU A;  3HOU B;  2SNS A;  4GNX B;  2F0S A;  5IP7 H;  1E2Z A;  2JE6 I;  2OF1 A;  1C7Y A;  3CD6 A;  1JQY D;  1EY7 A;  1H9S A;  3L9A X;  5I6Y A;  2F0M A;  3HOU G;  3IFD A;  4OO1 H;  4MN3 A;  3VR6 A;  4JV5 L;  3A8J E;  5ELN A;  4QB4 A;  2OTJ A;  2A68 C;  1YHB A;  4ME3 A;  4A3E H;  3A5U A;  1HQR D;  4HJ7 A;  2PI2 A;  2OQ0 A;  2N3S A;  1JJC B;  3W1G A;  3GTG B;  3EVQ A;  3K80 C;  2H5X A;  3ONA B;  4H44 C;  4C3H G;  4B3S L;  4H02 A;  3T4A C;  2F0T A;  4LW1 A;  4TKO B;  1STB A;  2NWG A;  2D5D A;  4JI8 Q;  3VDY A;  2F52 A;  1LTR D;  3QJY A;  2ZXO A;  1C48 A;  1GUG A;  1PZI D;  1N33 L;  1HA5 A;  3UDG A;  2L5T A;  3CKI B;  4ZKB B;  5T1I A;  1UAP A;  1Z6H A;  5C44 H;  4FP5 D;  4KY7 A;  3CRL C;  2XWB B;  5LHY 1;  4MTN A;  3CCL A;  1UEB A;  1A8V A;  2B2W C;  2QDB A;  4L8J A;  1U4R A;  1S72 A;  4KKU A;  1H95 A;  4RGT A;  4HED A;  4FDB A;  1D1I A;  2WAQ B;  1EEI D;  1PRT B;  5ELD A;  5ISR A;  2PMZ E;  1JWU D;  3KDF A;  5I2Y A;  2NVX B;  1EUJ A;  1EIG A;  3IFT A;  2L1B A;  2NYZ D;  2WAQ G;  1NMF A;  3BDC A;  1J5E Q;  2ZT9 C;  2VUM B;  4B9X A;  2Y0S E;  1U0L A;  2EJM A;  3GTK H;  4LFB Q;  5EGT A;  2UUA Q;  4HCE A;  2VNU D;  2VUM G;  2LS0 1;  4ZRZ A;  1Y14 B;  2A19 A;  3D4R A;  1MIU A;  1Q7Y C;  4C3I B;  1EQV A;  1YJ9 A;  3D8G A;  1B9M A;  1D5Z C;  2QEJ C;  4RWS C;  4H13 C;  2JA6 H;  5M5X B;  2I5L X;  4HN7 A;  3SEB A;  1HRJ A;  4JOI A;  1SFO H;  1MJC A;  2PW5 A;  4C3I G;  3M7G A;  3RD4 A;  1VQE A;  3KUP A;  3CAM A;  2OT2 A;  1R4Q B;  5FOB B;  4BS9 A;  5JEA J;  1IW7 C;  3EN2 A;  5KIX A;  1SDF A;  2VQF Q;  2ATW A;  3CCE A;  1K83 H;  5HGT A;  3I4N H;  4J8Q A;  5KYI A;  2AQ1 B;  4BBS H;  5E4W C;  1Q82 C;  2SDF A;  4KI0 A;  3QOJ A;  5LMU Q;  2ZM6 Q;  1T5X D;  3K57 A;  4Y52 H;  1JJ2 A;  1HNZ L;  1OO9 B;  3TRE A;  3IKJ A;  4RHS A;  2EYM A;  3W1B A;  4F88 A;  5LMN W;  1VQJ A;  4DUY Q;  3TS2 A;  2F0V A;  2JEA I;  3HP3 A;  4IPD A;  1CA6 A;  2NVY B;  1TKW B;  3T13 A;  1YNN C;  1PYW D;  1TS2 A;  2WB1 G;  4Q0F A;  3VR2 A;  1EYA A;  2NB0 A;  1WTH A;  3A54 A;  4DXG A;  2Z9H A;  2KCT A;  5M9O A;  5C5M A;  4DFA A;  5FJ8 H;  1L1O C;  1K3B C;  4R4Q A;  3C46 A;  1U4L A;  2L9H A;  5D65 A;  4A3K H;  4MZ9 A;  1CKO A;  2N88 A;  2BE5 C;  1XMO Q;  1EIY B;  2Z4I A;  3BZK A;  2CQO A;  4XQJ A;  4DR5 Q;  3J80 i;  4O1N A;  3BVG A;  1LO5 D;  3OW7 A;  5GAG C;  5IE8 A;  2ZJQ A;  1EOT A;  1EFW A;  3RN2 A;  1ICW A;  3FP9 A;  2IX1 A;  4WJ3 M;  4N9P A;  2J4X A;  3G71 A;  5EAY A;  3HKZ E;  5IYD H;  2FMM A;  4UP8 A;  1IBL L;  1JT8 A;  4LF4 Q;  1JJG A;  2NZH A;  2NUC A;  2KJX A;  1YJN A;  2OCE A;  4DUZ Q;  4H0L C;  4HSV A;  2UU9 L;  1SSO A;  4CDE C;  1CM9 A;  2LKV A;  3GV3 A;  3H6M A;  4WJW A;  2CCZ A;  2QIL A;  4DV3 L;  4LF6 Q;  5C3E G;  2NN6 G;  3P1H A;  4CKE A;  4IFD I;  1WOC A;  3P75 A;  2K28 A;  4JYA L;  4MNO A;  3TP5 A;  1XNR Q;  3OHX C;  4A3B B;  1TVX A;  3K59 A;  3BDL A;  4CDF C;  3TZD A;  1W6K A;  2SEB D;  1V8Q A;  3E0J A;  4A3B G;  5F2D A;  1PH4 A;  1CZW A;  3CXC A;  4X62 L;  1PH3 A;  1RDP D;  4A3C H;  2KQ3 A;  2R7Z G;  2F1M A;  2L55 A;  5C0X I;  4XIG S;  2RSO A;  5D3I B;  1AFP A;  3EJI A;  2RDF A;  3G4S A;  4ZAI A;  2EJG C;  2N49 A;  1KDB A;  1CKN A;  1GHJ A;  3OSO A;  3N6R A;  3HS0 C;  4UP9 A;  4GKJ L;  2CH4 A;  2WP8 J;  4GOP C;  1IXR A;  4BA2 I;  1U9R A;  3LWE A;  3VR3 A;  3S2H H;  5GQO A;  3BDO A;  1PFM A;  2R6G A;  4MHE A;  1QB5 D;  1RKN A;  4K2K A;  4WOR A;  1Y1W B;  4A3L H;  2WFW A;  2QEX A;  2BA0 A;  2K52 A;  4IUN A;  4RAU C;  2RCN A;  1A3V A;  3CQZ H;  3MXN A;  2NVX H;  1Y8O B;  3PO2 B;  4DV0 L;  1Y1W G;  3GTO H;  3U9O A;  2RHQ B;  3J81 E;  1BOS A;  3I91 A;  2LY7 A;  4EQN A;  3ZYY X;  1SN8 A;  3CCR A;  1QVF A;  3FMC A;  1UE5 A;  3PO2 G;  1HZ9 A;  1GUS A;  4DR3 L;  2JA8 H;  2EE1 A;  2PCF B;  2RVL A;  4XT1 B;  4DAP A;  5CMD A;  2EY5 A;  1BBX C;  4GNX A;  3HOV H;  5M5W H;  4C3I H;  2B2T A;  2K75 A;  2NZ1 D;  3TSS A;  1MHW C;  4APV A;  4YHH L;  4QF4 A;  4QMG A;  4XDX A;  5M5X H;  2NVT H;  5IIF A;  3IAY A;  4RKB A;  4OIJ A;  1NSN S;  2F0P A;  3LGJ A;  1EFI D;  3H3V H;  3QIA A;  1TXY A;  1N9W A;  1PYB A;  2A6E C;  1SMX A;  4LF9 Q;  3J81 j;  2CWP A;  1TT2 A;  1L1O B;  4V0B A;  4XQQ A;  1YBY A;  4C2M B;  1RJT A;  4JI0 Q;  1SNQ A;  4LAA A;  4DV4 Q;  4CJ1 B;  4DN4 M;  2Q8R E;  1QUQ A;  1PH8 A;  2XGT A;  1STH A;  1O7L A;  2EZV A;  3PUY A;  5C4Z A;  4B3R L;  5CBA E;  3BU2 A;  5IYC H;  4R4T A;  2R3Z A;  4A3J B;  1U4P A;  2JK8 A;  2NVY H;  1HNX Q;  3GTP H;  3KBG A;  1NY4 A;  2K5Q A;  4NXM L;  3VR5 A;  4K5W A;  4IPC A;  5JJL A;  1X55 A;  3CC7 A;  4A3J G;  4P71 A;  4LFA L;  4C3J B;  1QG7 A;  5EBC A;  5J3B A;  3R2T A;  2M00 A;  1PTO C;  3I2Z A;  5ELE A;  3F2D A;  1W6J A;  3FEW X;  4C3J G;  1LLR D;  5FLX L;  3Q22 A;  3J7A V;  4DKA C;  3CRK C;  5C0X J;  4YCU A;  2RDH A;  1ASY A;  2BDN A;  1F77 A;  4JC0 A;  4JI1 Q;  5IGD A;  1GD7 A;  1WFQ A;  3S24 A;  1Y69 U;  2HCC A;  2DN8 A;  1C0A A;  1XPR A;  1DD2 A;  4A3I B;  3HEJ A;  4KN7 C;  2LXJ A;  5BN3 A;  2M9V A;  1Q86 C;  3K5O A;  3KDF B;  5LMN Q;  1G2T A;  2B63 B;  1S5E D;  2YV5 A;  3PV0 A;  4IUQ A;  5E4X A;  2IX3 A;  4A3I G;  1Z47 A;  1MSH A;  5NUC A;  4JI8 L;  1KLG D;  1NBW A;  1CT1 D;  2B63 G;  1EYC A;  3S9W A;  4DU9 A;  5FO7 B;  2R93 B;  1BQQ T;  1IL2 A;  3K0X A;  3I7F A;  4ZQ3 A;  1GJX A;  4L63 B;  2K5H A;  3HKS A;  1QOH A;  1SNO A;  4XYQ A;  4GKK Q;  3R93 A;  4DR2 Q;  2R93 G;  2CQA A;  3A56 A;  1BKB A;  5IGG A;  3QO2 A;  4P72 A;  4S3S A;  4A3G G;  2FMC A;  1MGS A;  3FPP A;  5IP7 G;  2B2U A;  4GOP B;  4A3E B;  2JA9 A;  1F9Q A;  4I65 A;  1G6Z A;  4DR7 Q;  4ZK9 B;  4OO1 G;  2PO4 A;  1WD0 A;  1TY0 A;  3FRP B;  2F4I A;  2ZXP A;  1TR5 A;  2LMC B;  2F0H A;  4A3E G;  3ITP A;  1J5E L;  3SK5 A;  4AYB E;  3VA5 A;  1E24 A;  1QCB D;  3M4Q A;  4J6H A;  2PZU A;  1GKH A;  3KBX A;  3MFY A;  1SJH D;  1ZEQ X;  2KHI A;  2NTT A;  3TEH B;  4LFB L;  2EJF C;  2UUA L;  2KUM A;  1LYL A;  3DXJ C;  3KF6 B;  2F03 A;  2B2T C;  1B70 B;  4RMF A;  3FVQ A;  1Y1V H;  1QZG A;  2F4V Q;  5FLX c;  3M4Y A;  5G3L F;  1B7Y B;  5BN4 A;  1SE4 A;  1L0X B;  4JI7 Q;  3NTI A;  3MAQ A;  3W5O A;  1YHA A;  2XIW A;  3K58 A;  4YY3 L;  1I5F A;  5C44 G;  4DV5 L;  3KF8 B;  4I7A A;  1BO0 A;  2XTI A;  1UEA B;  2VQF L;  1EL0 A;  1TQO A;  3K5N A;  5LMU L;  4UAI A;  2ZM6 L;  3PF4 A;  1J9O A;  3GTL H;  2IX0 A;  2K5D A;  3VR4 A;  5I4D A;  2HHH Q;  1WD1 A;  5DNF A;  3PO3 H;  3NQI A;  4OL7 A;  2EYF A;  2I5M X;  1P16 A;  2EOT A;  4DUY L;  2MFI A;  4CHT B;  2ASB A;  4Q5V A;  2JA6 B;  3MTS A;  2L12 A;  3VYU A;  2B39 A;  1SFO B;  3C3L A;  2AUK A;  1NNX A;  1DOM A;  3PUZ A;  4YIJ A;  2JA6 G;  4YCV A;  4G4K A;  3UI2 A;  1PMR A;  2B2W A;  1LT3 D;  3S15 B;  4BY7 B;  1MI2 A;  1VMP A;  1PTO B;  1XMO L;  3PF5 A;  1K83 B;  2HIX A;  4BA1 I;  3I4N B;  4KHP Q;  2UXC Q;  4BBS B;  3AFP A;  3TZU A;  1B1Z A;  4O2D A;  4XT3 B;  2RQX A;  3MHB A;  3GV6 A;  3I4N G;  4BBS G;  1GM5 A;  5KRU A;  1IKL A;  2MP1 A;  2JA5 H;  3EA6 A;  1UNS A;  2EQS A;  4F8M A;  4RGM A;  1IKM A;  5JJI A;  4IJL A;  1EZ6 A;  1GUT A;  1U4M A;  4X3K A;  2DY8 A;  3AFQ A;  1I94 L;  4LF4 L;  4B9W A;  5CV6 A;  1KNE A;  4R4I A;  3GTM H;  1PZK D;  2N8N A;  4FO2 A;  4KJN A;  2HDM A;  1FJG Q;  4DUZ L;  3NPP A;  5D3D A;  5EQ0 A;  4X66 Q;  3HOY H;  3C2P A;  1CKN B;  1WVL A;  3TP7 A;  4A3K B;  1VQ4 A;  1DM0 B;  4LF6 L;  2B2U C;  5FJ8 G;  3UE1 A;  2ZTE A;  1AW7 A;  2E5L Q;  2MNA A;  4A3K G;  1STN A;  2A6H C;  1XNR L;  1JR0 D;  4JBK A;  1AP0 A;  5BN5 A;  4Y7N H;  3R3O A;  3AMU A;  1UUP A;  1GUO A;  3KK7 A;  2K6A A;  1RF2 D;  1FL0 A;  3MXN B;  4M1U B;  2BOS A;  4WFN 3;  1VQP A;  1XXG A;  3OWE B;  1CFM A;  1SNC A;  1GO3 E;  1XWE A;  1BBW A;  1RD9 D;  2NN6 I;  1H9R A;  1EY5 A;  4LF8 Q;  1B9N A;  1FVI A;  5IYD G;  2IL8 A;  4DA2 A;  4LJZ C;  1HHV A;  5I9P A;  2NVQ B;  4U68 A;  2MPM A;  4GS3 A;  1D5X C;  1II3 A;  1SBB B; 
#chains in the Genus database with same CATH homology
 1GHK A;  1I6H B;  2K7V A;  4FNF A;  4DAY A;  3D4W A;  1F2Y A;  1WTQ A;  1PXU A;  1SE3 A;  2XVS A;  3NBI A;  1CQV A;  2XRS D;  5A35 A;  4K2L A;  4IUR A;  1KAB A;  1LTB D;  2C5C A;  4X3U A;  1F9S A;  2F0F A;  3U9S A;  4FF1 A;  1ZKO A;  1JOK A;  4A3D B;  2VB3 X;  1K8O A;  1CTM A;  5KEE A;  3S14 B;  4A3M B;  4IFD H;  4G7Z C;  3SE0 A;  1H9J A;  3OIP A;  3S2H B;  1GUN A;  5D14 A;  2K03 A;  3R2I A;  2XN9 C;  3WOE A;  3CQZ B;  4B08 A;  3QB3 A;  1JCK B;  3K5L A;  2J0T D;  3L7Z C;  3GTO B;  2B8G A;  1PRT F;  1Q3L A;  1VF7 A;  5EKI A;  4NMZ A;  2JA8 B;  1Q1E A;  5C5L A;  5EKK A;  2K01 A;  2O5I C;  1V1O A;  4MIU A;  3HOV B;  4KD4 A;  5M5W B;  4F7X A;  2NVT B;  5IGE A;  3PUV A;  2ENB A;  4DK1 A;  4RGN A;  4EQO A;  2YU9 B;  5G3L D;  3V96 A;  3GD7 A;  2J7Z A;  3J80 L;  3VYR A;  3NQT A;  3SHL A;  1PTO H;  1JWS D;  2PMZ B;  4K5V A;  3BS1 A;  5E3F A;  1QIL A;  1OXT A;  1ET6 A;  1BUV T;  2F0W A;  2Y0S B;  4RA8 A;  5T1G A;  2CW0 C;  2KEC A;  3Q24 A;  4HMJ A;  2A69 D;  2IPK D;  3NSW A;  1STY A;  3GTP B;  2JSO A;  5CV5 A;  3S1R B;  2E2D C;  5C4X B;  1TII D;  3SR1 A;  3KF8 A;  1CHQ D;  1C8C A;  5M3F B;  5K36 H;  3D6C A;  3OPO A;  3I8Z A;  1S5C D;  1S4Z A;  1AN8 A;  2XNA C;  5JVH 3;  2EYO A;  4K5X A;  1BCP D;  4IQZ A;  3QG1 A;  3VA7 A;  1X3P A;  3BG3 A;  2AWO A;  4K8J A;  5JPM C;  3S1M B;  4FYD A;  1I4P A;  3MXU A;  4NP5 A;  1RTO A;  5ELF A;  4OO1 I;  4HR7 B;  2H4O A;  1IHZ A;  3J7Y W;  3LNN A;  3P20 A;  2F0Q A;  1M8A A;  2AWN A;  2IW3 A;  3KLS A;  3FKI B;  3C1F A;  1PFN A;  1A2U A;  3RLF A;  3VYS A;  1V1P A;  1NUC A;  1V43 A;  5COR A;  2B8F A;  1STG A;  1T5E A;  4M8A A;  3CHB D;  2QF7 A;  3HKZ B;  3E6Z X;  1TWA B;  1PDQ A;  2JP1 A;  1SMY D;  3SXH A;  4ZYS A;  3DWA A;  1HUM A;  4RFB A;  4IN3 A;  1Y1V B;  3F2U A;  5EPJ A;  1EY9 A;  4Z9C B;  1Q8I A;  5CYU A;  2FJ2 A;  4QIW B;  3NK9 A;  3C1E A;  2QCP X;  3NXW A;  4QUF A;  4R9W A;  3LX0 A;  5IT9 L;  3I70 A;  3V2T A;  2FIN B;  1EEF D;  4LK1 C;  5JVG 3;  3H09 A;  3HZX A;  2QKI C;  4KK7 A;  1AEX A;  3D6W A;  1DOK A;  1SYB A;  3DMU A;  1ENC A;  3GTL B;  1OXX K;  1JOO A;  2M2L A;  4I7Z C;  1ONL A;  4K8I A;  3PO3 B;  1D2B A;  1XTC D;  2K04 A;  4UDU C;  3D3R A;  3TBI B;  2CHB D;  1D5M C;  1FR3 A;  5IOC A;  1ET9 A;  2F0U A;  2X6G A;  2ICE C;  1MSG A;  1B44 D;  2X69 A;  1TWC B;  1AZQ A;  1EU3 A;  1PZJ D;  2GA4 B;  3NTK A;  2L0C A;  4LMQ D;  1ESF A;  3OMG A;  5CR3 A;  3NE5 B;  1HTL D;  3I3C A;  3J80 E;  3K5M A;  1TU2 B;  3DUZ A;  2JA5 B;  1KDC A;  3NTH A;  1PFB A;  1PRT D;  4DNT B;  1EY6 A;  2LFN A;  1HUN A;  1VF5 C;  3GTM B;  3PIP 3;  3HG9 A;  5CV7 A;  4FXK C;  4FXG C;  5FO8 B;  3HOY B;  2K5W A;  5HUR A;  1BCP C;  1TY2 A;  3WOF A;  3Q0A A;  1ROD A;  5E1F A;  4C1N K;  1G91 A;  2F0D A;  4XXE A;  4RGO S;  1S5B D;  1LV9 A;  4K14 A;  4Y7N B;  5KNB A;  3I73 A;  1ILQ A;  1MBY A;  2ZXR A;  3A7L A;  1CI3 M;  1ZYR D;  5CC4 A;  1BNZ A;  3P7J A;  1DYQ A;  1HCZ A;  2MUY A;  2PPB C;  1O7Y A;  1LAC A;  3SK6 A;  3TP8 A;  4OGQ C;  3I4L A;  5M5Y B;  1YNJ D;  2RKS A;  4TQU S;  2Q8I B;  1Y8N B;  2KHS A;  1H9M A;  2AQ3 B;  4PQX A;  1HTP A;  3DHQ A;  4FXD A;  5JEA H;  3M7N A;  2K05 A;  3BYT B;  3V05 A;  1IL8 A;  4TSS A;  2XWJ B;  3T56 B;  3HOW B;  4IUP A;  5ELB A;  1EQT A;  4CJ2 C;  1A3T A;  3DEP A;  4OHJ A;  1G2S A;  3PUX A;  3GTQ B;  2F0O A;  4BBR B;  4IFD G;  4JK1 C;  2ID0 A;  5CV4 A;  2PZT A;  1OXU A;  1Q90 A;  2PNR C;  1A2T A;  1FD7 D;  3M85 A;  5IT9 E;  1R4P B;  4EQP A;  1KNA A;  1Y8P B;  4AYB B;  4RCN A;  3HOZ B;  1GOZ A;  1CHP D;  2AQ2 B;  2EVB A;  3DM1 A;  3PUW A;  1HFN A;  2MHV A;  4KD3 A;  1EY0 A;  4HMI A;  2E76 C;  2R92 B;  3D31 A;  4FF3 A;  1RTN A;  2O4X A;  4G57 A;  4KV6 A;  3M3Y B;  2G9H D;  5C3X A;  2Z4H A;  4F87 A;  1JOQ A;  1PTO F;  4ZKC B;  1V1P B;  1QNK A;  4KY6 A;  2F0I A;  2Z1C A;  1F2M A;  3AU7 A;  3S1N B;  1B2T A;  2V4D A;  1IW7 D;  3FDT A;  5JPN C;  1GXD C;  1TWF B;  1OXS C;  1DXM A;  1I4H A;  3PMF A;  3EFX D;  3GP7 A;  3NHH A;  4EVO A;  1G8Z D;  1I3Q B;  2FHT A;  1I50 B;  4RHR A;  1B3A A;  1EU4 A;  4PV1 C;  1WTV A;  1SNM A;  4ABN A;  5K36 G;  1NR2 A;  1SYE A;  1MD2 D;  4A93 B;  4IAL A;  5EPL A;  5DAU A;  5FLX E;  4CJ0 B;  1WTR A;  2PYK A;  1HXY D;  5DEH A;  3QOL A;  2CVR A;  2BE5 D;  2KVM A;  1QE6 A;  3G7L A;  1DOL A;  3IL8 A;  4DXF A;  1C4Q A;  2JA7 B;  2KOL A;  1EZ8 A;  1D1K A;  4V19 0;  5IOD A;  1LTA D;  3NBH A;  4BY1 B;  1ZXT A;  1Q1B A;  3A8I E;  2XSC A;  3TN2 A;  2EY2 A;  5C3W A;  5CV9 A;  1F2Z A;  4HAE A;  2N55 A;  2TSS A;  1CA5 A;  3KLS X;  4PMC A;  5EPK A;  3DWP A;  4C3H B;  3FPU B;  1B4O A;  3MC0 B;  1I4R A;  3LWU A;  4ID6 A;  3BVZ A;  2F0K A;  2JEB I;  2SOB A;  2B2V C;  1TS5 A;  1STE A;  2SNM A;  2E2I B;  1R9T B;  2JYO A;  3HRZ C;  4G7O C;  1F9R A;  5C0X H;  4RKL A;  4KTA A;  1E2V A;  3J81 L;  1F2L A;  1LT4 D;  1KTK A;  1KDA A;  1WCM B;  4RCO A;  3H94 A;  4ULL A;  5ELC A;  3ND8 A;  3WDN A;  2MGS A;  1CZG A;  4BWG B;  2F3V A;  2EYH A;  4O42 A;  3Q23 A;  1O80 A;  4QCL A;  5EBD A;  2E2H B;  2HUG A;  2F0J A;  1NCV A;  1QJO A;  5JJZ A;  4DGZ A;  1X3Q A;  1HQM C;  1ML0 D;  2DY7 A;  1KLU D;  5LL6 S;  1E0B A;  4CKC A;  4KKT A;  1JIC A;  1DON A;  1PLF A;  2O2L D;  2A6E D;  4EGV A;  2HQE A;  1DZ1 A;  1IYV A;  1S5F D;  2OEO A;  4U67 3;  5CV8 A;  1BR9 A;  2EYP A;  1CK1 A;  4HSP A;  3GTJ B;  2D62 A;  2EY1 A;  2WB1 B;  5FKA C;  2NTS A;  2DNE A;  3EQL C;  5JOB A;  4ILW A;  1FNV A;  4J1M A;  2EYL A;  3ERO A;  3KLR A;  3MFG A;  4FF4 A;  4XQN A;  1FNU A;  1M4V A;  4IUT A;  3K7A B;  5K5P A;  1EY8 A;  4N9T A;  3N52 A;  1QWY A;  4XTC S;  1K8M A;  3OMC A;  1PTO D;  3W3A A;  1JB3 A;  4KHZ A;  3MEH A;  1KAA A;  5IGF A;  1BXT A;  3D4D A;  3RZO B;  1LTG D;  1D6E C;  3H0G B;  3TDQ A;  3CU7 A;  1LTT D;  4CBV A;  4CGY B;  1GUW A;  3K6O A;  4L6T B;  2KCC A;  1I4Q A;  2F0N A;  1SYD A;  2EPB A;  2E2J B;  3URY A;  4K6D A;  5I2X A;  1EWC A;  2DNC A;  4K6L A;  5C3E B;  3TME A;  5KNC A;  1L0Y B;  2E74 C;  4JBW A;  1FYC A;  1NAP A;  5JEA G;  4DF7 A;  3A55 A;  3ERQ A;  3S16 B;  5M3M B;  3S1Q B;  3G6J B;  2WKD A;  3I4M B;  3I90 A;  3M4O B;  3E5S A;  1LT5 D;  5C4J B;  1RHP A;  2R7Z B;  1WTX A;  2KED A;  1B53 A;  1I4G A;  5IGB A;  1TS3 A;  2I46 A;  5AFW A;  4R8I A;  3GQB A;  2K33 A;  2XRQ D;  2L4N A;  1HA6 A;  1Z7T A;  1SAP A;  2H1E A;  1SYG A;  3SK8 A;  1G29 1;  3JAM L;  3SDZ A;  5I6W A;  1TWG B;  3T51 B;  2BCO A;  1XYI A;  1SJE D;  4DNR B;  1RCV D;  1JOR A;  3BYY B;  2FFK B;  2MJ8 A;  4IUV A;  2VXW A;  3O13 A;  1S5D D;  1A3U A;  2O5J C;  2HDL A;  1WTO A;  2Z8L A;  5JAV A;  1EWH A;  1F9P A;  5C4H A;  4X3T A;  1HFG A;  3OIQ A;  1LTS D;  3K0Y A;  2RSN A;  2Q8T A;  3Q6S A;  3OOC A;  4DK0 A;  1QNU A;  2L11 A;  2D2C C;  5COY A;  1EY4 A;  2A69 C;  4PMW A;  2R61 A;  1H9S B;  4C1N I;  4R8N A;  4ME5 A;  1SNP A;  2IJ0 A;  5A2Q L;  2PZW A;  4PNY A;  3L3O C;  2E75 C;  3HGB A;  1ENA A;  2D9U A;  2EDG A;  5EJW A;  4IFD J;  3VYT A;  3SVM A;  4IUU A;  1OXV A;  2AUJ D;  1JE4 A;  4TRD A;  1SEB D;  1ILP A;  4KMU C;  2RA4 A;  4KY5 A;  2WAC A;  2X6L A;  3T16 A;  5EKL A;  5J1Z A;  2OXP A;  3T53 B;  2A74 C;  4CKB A;  4XYO A;  1FGB D;  2WKC A;  1SE2 A;  2WIN B;  2PW7 A;  2A6H D;  1SYC A;  4IZ8 A;  2EY6 A;  4H7B A;  1NR4 A;  3S17 B;  3OWF A;  4DAV A;  3HOX B;  3S2D B;  3AB9 A;  1BDO A;  5LL6 X;  1VMC A;  2K1B A;  4A3G B;  2A5H A;  3QWN A;  1VDZ A;  2NN6 H;  1X32 A;  1O7Z A;  2F0G A;  3SK4 A;  1SMY C;  4HTH A;  1WTP A;  2KCN A;  4KJO A;  1O78 A;  3A8K E;  4NW2 A;  2F3W A;  1E2W A;  5C6A A;  3PIO 3;  4X3S A;  2A68 D;  2B2Y A;  3X3N A;  5J22 A;  3BZD B;  3NWS A;  1DCZ A;  1SYF A;  3DEO A;  4NKL A;  1JC7 A;  2NBF A;  3MWY W;  4ODG A;  1SND A;  4C56 C;  1EYD A;  4GZY C;  1LTI D;  2KEE A;  2F0L A;  4G7H C;  1J8I A;  3NP8 A;  4KN4 C;  2RBM A;  5J39 A;  2ICI A;  3RZD B;  5IGC A;  1HPC A;  4ZUI A;  5C44 B;  4A3F B;  3H91 A;  1WTW A;  1ENF A;  4KKS A;  5C0X G;  2TMP A;  2C9O A;  1A6X A;  1TWH B;  3JAM E;  1FNW A;  2IT1 A;  2EYJ A;  5KND A;  5FK9 C;  1SXT A;  3MZ5 A;  4QUC A;  5TSS A;  3GTK B;  2F0E A;  3NUC A;  1XX8 A;  4WRD A;  1AZP A;  2B2V A;  3J7A F;  5I9O A;  2VB2 X;  1B50 A;  5DM7 3;  2WII B;  1A15 A;  2A73 B;  3DWQ A;  3RMH A;  1BCP B;  1CQF A;  2HCI A;  2RDG A;  2IWH A;  2JXM B;  1BF4 A;  4FF2 A;  3W2D A;  1PRT C;  1BCP F;  4NDX A;  1I4X A;  1I6V C;  3BVM A;  2YYZ A;  1IYU A;  2KA7 A;  1ESR A;  3MXG A;  3X3M A;  4PMB A;  3I72 A;  3ND9 A;  5CGK A;  1Q12 A;  2BDO A;  5FO9 B;  4ZLT F;  3MA2 B;  4HCS A;  2CW0 D;  5CBE E;  5A2Q E;  1VCI A;  2WV6 D;  3H3V C;  3GO5 A;  1ZYR C;  1YNN D;  2EXZ A;  1DJR D;  5KYL A;  3MVV A;  2PQE A;  1H9K A;  4FVM A;  1TS4 A;  3MXP A;  1LAB A;  4P2C B;  4E6I A;  2B2Y C;  4KHV A;  2I07 B;  1YNJ C;  1LT6 D;  3NWT A;  4OIK A;  1EIH A;  3TP6 A;  4RH6 A;  3RUZ A;  3R8B A;  2BA1 A;  5DM6 3;  1JWM D;  1STA A;  2K32 A;  3A7A B;  4ZUJ A;  2G9D A;  5KGU A;  3HOU B;  2SNS A;  2F0S A;  1E2Z A;  2JE6 I;  2OF1 A;  1JQY D;  1EY7 A;  1H9S A;  3L9A X;  5I6Y A;  2F0M A;  3IFD A;  4OO1 H;  4MN3 A;  3VR6 A;  3A8J E;  4QB4 A;  2A68 C;  1HQR D;  3GTG B;  3EVQ A;  3ONA B;  4H44 C;  4C3H G;  3T4A C;  2F0T A;  4TKO B;  1STB A;  2NWG A;  2D5D A;  1LTR D;  3QJY A;  2ZXO A;  1C48 A;  1GUG A;  1PZI D;  1HA5 A;  2L5T A;  3CKI B;  4ZKB B;  5T1I A;  1UAP A;  1Z6H A;  4FP5 D;  4KY7 A;  3CRL C;  2XWB B;  5LHY 1;  2B2W C;  2QDB A;  4L8J A;  1U4R A;  4KKU A;  4RGT A;  4HED A;  1D1I A;  2WAQ B;  1EEI D;  1PRT B;  5ELD A;  5ISR A;  1JWU D;  5I2Y A;  2NVX B;  1EIG A;  3IFT A;  2L1B A;  2NYZ D;  3BDC A;  2ZT9 C;  2VUM B;  4B9X A;  2EJM A;  5EGT A;  4HCE A;  2VNU D;  2LS0 1;  4ZRZ A;  3D4R A;  4C3I B;  1EQV A;  3D8G A;  1B9M A;  1D5Z C;  2QEJ C;  4RWS C;  4H13 C;  5M5X B;  1HRJ A;  4HN7 A;  3SEB A;  2PW5 A;  4C3I G;  3M7G A;  3RD4 A;  3KUP A;  2OT2 A;  1R4Q B;  5FOB B;  4BS9 A;  5JEA J;  1IW7 C;  5KIX A;  1SDF A;  5HGT A;  4J8Q A;  5KYI A;  2AQ1 B;  5E4W C;  2SDF A;  4KI0 A;  3QOJ A;  1T5X D;  3K57 A;  1OO9 B;  3IKJ A;  4RHS A;  2EYM A;  4F88 A;  2F0V A;  2JEA I;  3HP3 A;  1CA6 A;  2NVY B;  1TKW B;  3T13 A;  1YNN C;  1PYW D;  1TS2 A;  4Q0F A;  3VR2 A;  1EYA A;  2NB0 A;  3A54 A;  4DXG A;  5M9O A;  5C5M A;  4DFA A;  3C46 A;  1U4L A;  2L9H A;  5D65 A;  2N88 A;  2BE5 C;  2Z4I A;  4XQJ A;  4O1N A;  3BVG A;  1LO5 D;  3OW7 A;  1EOT A;  1ICW A;  2IX1 A;  4N9P A;  2J4X A;  2FMM A;  2NUC A;  2KJX A;  4H0L C;  4HSV A;  1SSO A;  1CM9 A;  2LKV A;  3GV3 A;  3H6M A;  4WJW A;  2QIL A;  2NN6 G;  3P1H A;  4CKE A;  4IFD I;  3P75 A;  2K28 A;  3TP5 A;  3OHX C;  4A3B B;  1TVX A;  3K59 A;  3BDL A;  3TZD A;  1W6K A;  2SEB D;  1V8Q A;  3E0J A;  5F2D A;  1CZW A;  1RDP D;  2KQ3 A;  2F1M A;  2L55 A;  5C0X I;  4XIG S;  2RSO A;  5D3I B;  1AFP A;  3EJI A;  2RDF A;  4ZAI A;  2EJG C;  1KDB A;  1GHJ A;  3OSO A;  3N6R A;  3HS0 C;  2WP8 J;  4BA2 I;  1U9R A;  3LWE A;  3VR3 A;  3BDO A;  1PFM A;  2R6G A;  4MHE A;  1QB5 D;  1RKN A;  4K2K A;  4WOR A;  1Y1W B;  2BA0 A;  4IUN A;  4RAU C;  1A3V A;  3MXN A;  1Y8O B;  3PO2 B;  3U9O A;  3J81 E;  1BOS A;  3I91 A;  2LY7 A;  4EQN A;  3ZYY X;  3FMC A;  1GUS A;  2EE1 A;  2PCF B;  2RVL A;  4XT1 B;  4DAP A;  5CMD A;  2EY5 A;  1BBX C;  2B2T A;  2NZ1 D;  3TSS A;  4QF4 A;  4QMG A;  4XDX A;  5IIF A;  3IAY A;  4RKB A;  4OIJ A;  1NSN S;  2F0P A;  1EFI D;  3QIA A;  2A6E C;  1TT2 A;  4V0B A;  4XQQ A;  4C2M B;  1RJT A;  1SNQ A;  4LAA A;  4CJ1 B;  4DN4 M;  2Q8R E;  1STH A;  1O7L A;  2EZV A;  3PUY A;  5C4Z A;  5CBA E;  2R3Z A;  4A3J B;  1U4P A;  3KBG A;  2K5Q A;  3VR5 A;  4K5W A;  4C3J B;  1QG7 A;  5EBC A;  3R2T A;  2M00 A;  1PTO C;  5ELE A;  1W6J A;  3FEW X;  4C3J G;  1LLR D;  5FLX L;  3Q22 A;  3J7A V;  3CRK C;  5C0X J;  2RDH A;  2BDN A;  1F77 A;  5IGD A;  1Y69 U;  2HCC A;  2DN8 A;  1DD2 A;  4A3I B;  3HEJ A;  4KN7 C;  5BN3 A;  2M9V A;  3K5O A;  1G2T A;  2B63 B;  1S5E D;  3PV0 A;  4IUQ A;  5E4X A;  2IX3 A;  1Z47 A;  1MSH A;  5NUC A;  1KLG D;  1CT1 D;  1EYC A;  3S9W A;  4DU9 A;  5FO7 B;  2R93 B;  1BQQ T;  4ZQ3 A;  1GJX A;  4L63 B;  4XYQ A;  1QOH A;  1SNO A;  3R93 A;  2CQA A;  3A56 A;  5IGG A;  3QO2 A;  4S3S A;  2FMC A;  1MGS A;  3FPP A;  2B2U A;  4A3E B;  1F9Q A;  4I65 A;  1G6Z A;  4ZK9 B;  4OO1 G;  2PO4 A;  1WD0 A;  1TY0 A;  3FRP B;  2F4I A;  2ZXP A;  1TR5 A;  2LMC B;  2F0H A;  3ITP A;  3SK5 A;  3VA5 A;  1QCB D;  4J6H A;  2PZU A;  3KBX A;  3MFY A;  1SJH D;  1ZEQ X;  2NTT A;  2EJF C;  2KUM A;  3DXJ C;  2F03 A;  2B2T C;  3FVQ A;  3M4Y A;  5G3L F;  5BN4 A;  1SE4 A;  1L0X B;  3NTI A;  3MAQ A;  2XIW A;  3K58 A;  1BO0 A;  1UEA B;  1EL0 A;  1TQO A;  3K5N A;  4UAI A;  1J9O A;  2IX0 A;  2K5D A;  3VR4 A;  5I4D A;  1WD1 A;  5DNF A;  3NQI A;  4OL7 A;  2EYF A;  2EOT A;  4CHT B;  4Q5V A;  2JA6 B;  3MTS A;  2L12 A;  3VYU A;  2B39 A;  1SFO B;  3C3L A;  2AUK A;  1DOM A;  3PUZ A;  4YIJ A;  4G4K A;  3UI2 A;  1PMR A;  2B2W A;  1LT3 D;  3S15 B;  4BY7 B;  1MI2 A;  1VMP A;  1PTO B;  1K83 B;  4BA1 I;  3I4N B;  4BBS B;  3TZU A;  1B1Z A;  4XT3 B;  2RQX A;  3MHB A;  3GV6 A;  5KRU A;  1IKL A;  2MP1 A;  3EA6 A;  1UNS A;  4F8M A;  4RGM A;  1IKM A;  1EZ6 A;  1GUT A;  1U4M A;  4X3K A;  2DY8 A;  4B9W A;  5CV6 A;  1KNE A;  1PZK D;  4FO2 A;  4KJN A;  2HDM A;  3NPP A;  5D3D A;  5EQ0 A;  3C2P A;  1WVL A;  3TP7 A;  4A3K B;  1DM0 B;  2B2U C;  1AW7 A;  1STN A;  2A6H C;  1JR0 D;  1AP0 A;  5BN5 A;  3R3O A;  3AMU A;  1UUP A;  1GUO A;  3KK7 A;  2K6A A;  1RF2 D;  4M1U B;  2BOS A;  4WFN 3;  1XXG A;  3OWE B;  1CFM A;  1SNC A;  1XWE A;  1RD9 D;  2NN6 I;  1H9R A;  1EY5 A;  1B9N A;  2IL8 A;  4DA2 A;  4LJZ C;  1HHV A;  5I9P A;  2NVQ B;  4U68 A;  2MPM A;  1D5X C;  1II3 A;  1SBB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...