3BS1A

Structure of the staphylococcus aureus agra lyttr domain bound to dna reveals a beta fold with a novel mode of binding
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
103
structure length
103
Chain Sequence
MDNSVETIELKRGSNSVYVQYDDIMFFESSTKSHRLIAHLDNRQIEFYGNLKELSQLDDRFFRCHNSFVVNRHNIESIDSKERIVYFKNKEHCYASVRNVKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Staphylococcus aureus AgrA LytTR Domain Bound to DNA Reveals a Beta Fold with an Unusual Mode of Binding.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription regulator
molecule keywords DNA (5'-D(*DTP*DTP*DTP*DAP*DAP*DCP*DAP*DGP*DTP*DTP*DAP*DAP*D
total genus 28
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2007-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04397 LytTR LytTr DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1020 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3bs1A00
4XQNA 4XXEA 4XQJA 4G4KA 4CBVA 3BS1A 4XYQA 4XYOA 4XQQA
chains in the Genus database with same CATH superfamily
5KEEA 1PH1A 1QJOA 4BY1B 2KVMA 1QVCA 2RBMA 4M1UB 3H6MA 1K28A 2XRQD 5J22A 2R93G 3J7A5 3WOEA 2ENBA 2MJ8A 2EOTA 1VQHA 3BG3A 1QG7A 1B2TA 4BS9A 2QCPX 2HT1A 3CXCA 1UAPA 3PO2H 3MHBA 4IOAA 1M8AA 1Y1WG 3LX0A 2IJ0A 5EJWA 5E1FA 2R61A 4RGTA 1I4GA 1O7YA 1WI5A 5I4DA 3PF5A 3T4AC 5HGTA 3IKJA 1B1ZA 1BDOA 3S2DB 1JWUD 2AUJD 2EYMA 1SYGA 3BDCA 4IALA 2B63H 4A3DB 1T5XD 4MIUA 3K6OA 4NKLA 5IP7G 1X65A 1DOMA 1PZID 2KUMA 1Z9FA 4GOPC 1B7YB 2E8GA 2EY5A 2F4IA 4HEDA 1N33L 5KIXA 1KLUD 3X3MA 4C56C 2L15A 4DR2L 2AQ3B 3VR5A 4DU9A 3MA2B 1F2LA 4QB4A 3AQQA 2A5HA 3I72A 1HCZA 3D6CA 3D0FA 1VQCA 2EZVA 1VMPA 4POGA 2KQ3A 1IKMA 5IYCH 1CA6A 2A73B 2HDMA 3GTJB 1VQNA 5FLXc 4A3JG 2QGQA 4HIKA 1EOTA 4ME3A 4LF6Q 1S40A 4KKTA 3S1MB 3QIAA 2RDFA 4CKBA 1S5FD 4X62L 4A3LG 3EIVA 3AFPA 4LFCQ 5JJKA 5FLXL 1FYCA 2Z6KC 5C3EH 4JOIC 5C4XH 2EXZA 3PF4A 3K5LA 5EKKA 3ZJYC 1KD1C 1GKHA 3KLWA 1XMQQ 1I6HB 2EYPA 2B63B 5IOCA 1FL0A 2B2VC 3OIQA 5HURA 3HKZE 3JAMi 2R3ZA 2Q2HA 2VB3X 3KDFA 2N88A 2K05A 1O7ZA 1XNRL 1SJHD 2WFWA 2L9HA 1SN8A 3NBHB 4C3HH 3STBC 1ASYA 1JOOA 4A3IH 3I7FA 3G6JB 3PIP3 3E0JA 3R2IA 1JICA 4ZLTF 3TP5A 1KIXA 3F8TA 1QWYA 3SHLA 4OELB 3J81c 2SEBD 1L0YB 2B2WC 3ERSX 3MEHA 4OO1H 2WAQG 2NWGA 3I2ZA 5FK9C 1PH9A 3P20A 1QNUA 2XGTA 2KCTA 4AH6A 4LF5Q 2R7DA 1D1IA 1T5EA 4CDEC 1WCMB 2OF1A 4DR7L 4A3EB 4ZUJA 1PTOF 1QE6A 3A56A 2B2VA 1H9RA 5FJ8G 3BZCA 3HOZH 1QCBD 3B6YA 1EYAA 3W1GA 1CA5A 1HXYD 2PPBC 1QUQA 2PQAA 2GVAA 4FF3A 2KBNA 4LJZC 2K5VA 1TXYA 1I4RA 2WV6D 4IFDH 1SYCA 1XYIA 2M9VA 1IYUA 1HA6A 1G6ZA 1EWIA 3M4YA 1MGSA 3VR6A 3BVGA 2KECA 1PTOB 4LUVA 4CDDC 2M2LA 1K8GA 2CW0D 2G9DA 3CCLA 4ZQ3A 1UNSA 5CV7A 1VQ4A 4DR2Q 2K5QA 3DM3A 2BA0A 2I0QA 1GUSA 5ELCA 1I4HA 1CZWA 3TBIB 2YTXA 3I4NH 3Q22A 2LXJA 1F9RA 1WTPA 3E3XA 1F2ZA 1KXLA 3MWYW 4LUOA 5G3LF 4BBRG 2QA4A 5C44G 1JR0D 2F52A 5CBEE 2ZXRA 3Q0AA 4PMBA 1SROA 1X9NA 3D4DA 1LTAD 1LTLA 1TS3A 3K7AB 3HOXH 1HNZQ 2B63G 3L0OA 1A3TA 1GHJA 5D3DA 4DR1Q 2KHJA 2KEDA 3MC0B 5IT9c 5I9PA 3ULPA 2UXCQ 2FFKB 4O2DA 1JOKA 4ME5A 5ELFA 3S1NB 1SMYD 3HOZB 2AWOA 4IPCA 1XX8A 3FPPA 1GD7A 1PDQA 2OQ0A 3Q8DA 3DM1A 4Y7NB 2O5IC 2PO4A 3ICEA 1F2YA 4JBJA 2NTSA 3OPOA 4G7ZC 1LTBD 1T9HA 2R92G 2I5HA 5BR8Q 1ASZA 4LF8Q 1UWVA 3A8KE 3VYSA 1I4QA 3KYHC 2HCCA 4BY1H 3FDTA 4J1MA 2K75A 4DNRB 5EKIA 2Q2UA 2K04A 3KF6B 3V96A 2CWAA 2EY2A 2Z1CA 4JG2A 2N8NA 4OIKA 5IODA 4LF7Q 5C44B 1AH9A 4PV1C 2Z9HA 1H9SA 5EQ0A 2E2HH 1EIYB 3T56B 1KLGD 2RA4A 3RN5A 4HCSA 1SDFA 2EE1A 1CUKA 2HUGA 4B3SL 3U9OA 2C9OA 1UE5A 1U4LA 3ND9A 1EOVA 2EJGC 2JJQA 4C3HG 3PO3G 1I94Q 2F3IA 3GP7A 1PH4A 2N3SA 3RZDB 4JI6Q 4EQPA 1EYDA 1HTPA 3KBXA 1GUGA 1P8LA 1FJGQ 1R4PB 3VR2A 1ZYRC 4L63B 4A93G 1XTCD 2F0EA 1KRSA 2EYJA 1UE7A 1XMQL 3PGZA 5ELDA 3J81L 1ILQA 1BBXC 1AW7A 2ICEC 3E9IA 4LFCL 4UPAA 3U50C 1SFOH 1H9SB 4AYBB 5C0XI 3I90A 5M3FB 3EA6A 4EGVA 1BR9A 3ER0A 2NN6H 3DEOA 1X56A 3S15H 3OWEB 3GTKB 4POFA 3KOJA 1PRTB 4WFN3 2VUMH 3I4MB 1G291 1ICFB 3J7AF 1STNA 1VQJA 1P16A 2TMPA 1JB3A 2RSOA 4HMJA 4GNXA 1HNWQ 3UDXA 2D5DA 3U4VA 1OXSC 4ID6A 4NB3A 1JCKB 3QWNA 1MI2A 2DJGC 4I65A 4KY6A 4ZUIA 4B3RQ 2ASBA 1G8ZD 1DM0B 1SSOA 3SGIA 1Y8OB 3GTOH 5FO9B 1IHZA 4XTCS 4C3HB 4IO9A 3EQLC 2L0CA 2UUAL 1VQLA 1ENFA 2XN9C 1C8CA 4X3SA 3ULLA 1Q90A 4CKCA 1YNND 1I5FA 4RG1A 4A3MH 2SDFA 1E24A 2LFNA 1JE5A 1DZ1A 2B2WA 1TWCH 1C9OA 1KRTA 2MPMA 4IFDI 1I4XA 2JA5H 3HOYH 1EEFD 4JI3Q 1RDPD 1SLJA 1HHVA 1VQAA 1KTKA 2QF7A 3KF8B 3S1RH 2A1AA 2Q2IA 1Y1VH 1WTWA 4EVOA 4JVZA 3GTKH 4QQBX 4RAUC 3D8GA 4C3IG 1YITA 1KAAA 1Y1VB 5G3LD 2MUYA 3A7LA 1V43A 1A62A 3TS2A 4P72A 3NELA 5IP9G 3BJUA 4B3TL 2N55A 2DGYA 2JE6I 5KNBA 1N32Q 1S5CD 3I4NB 1PFSA 2L4NA 2EYOA 1JJGA 2MO1A 4BY1G 1Q7YC 4B3RL 1STGA 1N36Q 2PZTA 2YV5A 4A3EH 1X54A 1E2VA 4YCWA 2A6EC 5E4XA 3SVMA 4DUZQ 2NVTB 4A3GG 3VR4A 3PO3B 1TKWB 4JOIA 3QB3A 1WTOA 1GHKA 4A76A 3RD4A 4ODGA 3FKIB 4GN3B 3RMHA 3D31A 2RHSB 4CDFC 2FJ2A 4DF7A 4KHPQ 4KHPL 1H95A 1VCIA 4XDXA 2WIIB 1CK1A 1DOKA 2E74C 4DR7Q 2VB2X 4DA2A 2MP1A 2Q8IB 1CSQA 1BBWA 4FO2A 3VR3A 3T1HQ 4V0BA 3A7AB 5JVG3 2E2JH 4DR1L 3S14H 3CRLC 1IL2A 4ILWA 1HFNA 1NR2A 1TY2A 1EIHA 4IUTA 1U4PA 2F0OA 5IY0A 5M3FH 2CVRA 1CT1D 1VQPA 2B2UA 1O78A 5J39A 4IURA 5K36G 1K73C 2VZAA 1LV9A 1ZKOA 4J8QA 1CQVA 1L0WA 3TS0A 5JPMC 4AQYQ 2FMMA 3HOUH 1K3BC 3FKIG 3S2DH 4GN5A 3E9HA 2KA7A 1KHIA 1U0LA 1H9JA 4HTHA 5M5XB 1XTDA 3CP0A 2P5ZX 4APVA 2BH8A 5IGCA 2DY8A 1PH2A 4LF9Q 1LT3D 4DR6L 4DR6Q 1BUVT 1K83H 1AZQA 1UEAB 1LTTD 2ZXOA 4AYBG 1VF5C 5KNCA 3TP6A 1X3QA 5JJIA 4CJ2C 4DUYQ 3NQTA 4C2MB 1B3QA 1EEID 3SK8A 1WD0A 1LLRD 5EPKA 3C1FA 2E2JB 3GTJH 1HQMC 4KN4C 1G2TA 1ONLA 2SNSA 4OO1G 3AYHB 3MTSA 3SXHA 1IZ6A 4DK3C 2DJFC 1TIID 2ZM6Q 3TZDA 1STBA 2I46A 1SE2A 2D2CC 3H0GG 4C3JG 2VUMG 2B2UC 5C4XG 5HGQA 4GKKQ 1HUNA 2NB0A 1EWCA 3PO2B 2IT1A 4OL7A 3GV3A 1IBLQ 1CKMA 1EY9A 2PMZE 3S15B 5CV4A 2QDBA 4X3UA 3H0GH 4C3JH 3S2HB 4LUZA 4LK1C 4AYBE 1R9TB 2A68D 4DN4M 3CCMA 2F3VA 1NMFA 1J9OA 3H91A 1LUZA 3HOVB 2EDGA 3A74A 4I7AA 2ZXPA 2A74C 4HR7B 4C1NI 4IPHA 3S14B 4DV7L 2UXCL 2XWJB 3TRZA 1GVPA 2JA6G 5C6AA 4QGUA 5C3EB 1A15A 4PZ6A 1QB5D 4JI5L 3D3RA 4JI5Q 2FINB 3MVVA 1VQ7A 2N78A 1UE6A 4PZ8A 4L5TA 2UXDQ 2E75C 3VYTA 2F0IA 1TS5A 5BN3A 2O5JC 1K83B 4B08A 1MSHA 3BZKA 2RQXA 3PQIA 1L1OB 4HN7A 2VNUD 4R4IA 4DV5L 4GNXC 3K81C 5I6WA 5JJLA 3ZYYX 4NMZA 4GKJQ 2IX0A 4L6TB 4Y52H 5M5XH 3J7ZC 3RLNA 1PYSB 3GV6A 1PH3A 1S5ED 5BN5A 2WKDA 2F4VL 2LS01 1RIPA 2F0JA 3IL8A 3BZDB 3L9AX 5ISRA 1YHBA 2ES2A 1KQSA 4XT1B 4JYAL 3Q6SA 1RTOA 2HD3A 1ET9A 4XIGS 1N9WA 2DNCA 1SMXA 1ILPA 5C4HA 1Y1VG 1KNAA 1PTOC 5LMNL 3GTGB 3A5ZB 4JC0A 3VA7A 1NSNS 3NBHA 1NE3A 3Q23A 3C3LA 2B2TA 3NTHA 3SK6A 2MHVA 2EYFA 3DWQA 4GN4B 3HOYG 1U4RA 2VY3A 4WRDA 1TT2A 2YTYA 4K14A 1LT4D 4JI8Q 3HOVH 3I8ZA 4ZYSA 3BVMA 3STBD 4X65L 1IYJB 5I9OA 4DV6L 2CHBD 2L5TA 1OXUA 2B29A 2WAQB 2QKIC 1S5BD 4A3CG 1WD1A 3NWSA 3GO5A 2VW9A 4N8FA 2NZOA 1TWHH 4YY3L 2NTTA 1BQQT 3GTPH 1PTOD 2EYLA 2Z4HA 4X3TA 1AP0A 1PFNA 2QDLA 2VS1A 1H9KA 4DK0A 2R92B 1IYVA 4DV0Q 1K3RA 1JC7A 1EU3A 1HFGA 1BCPF 1VF7A 2R7ZG 2HIVA 2K03A 1SNQA 4DAYA 2IL8A 2LXKA 4CJ1B 4RGOS 4FXGC 3KJOA 2F0WA 2EY1A 2BDOA 4HJ5A 1PRTD 5GROA 4DAVA 4GKKL 1HZCA 4KK7A 3OOCA 1TWFB 4S3SA 4BY7H 2JEBI 4FXDA 2B2TC 4KJOA 4KY5A 3CQZB 3CPFA 3SK5A 4K0KQ 3S1NH 3H09A 2K4KA 4DXGA 3PUWA 3I70A 1STEA 5IYBG 4JI1L 1TWCB 3G6EA 1CI3M 1RL2A 4CGYB 1SNDA 3URYA 1Y8PB 4YHHL 1YBYA 4IUQA 3K7AH 3HOXB 2BA1A 1D5ZC 4PZ7A 1WCMH 3T51B 3PO2G 2J7ZA 1LTGD 1ENAA 2WKCA 1STYA 5M3MG 1B70B 3CCRA 1XNRQ 1NR4A 4FF4A 1K9MC 2Y0SG 4KD3A 5JEAG 4A3JH 3HZXA 4RHSA 3HS0C 2JN4A 1Q12A 2PI2A 1NNXA 4OX9Q 5EAYA 1N8RC 4CDCC 3FMCA 3NWTA 3M4OH 1SYDA 4LF7L 1QNKA 1IBML 2NYZD 4LW1A 4TRDA 4DV3Q 1LO5D 3F2UA 4BBSG 4N8X1 2ZM6L 1VQIA 3M3YB 4GOPB 3DEPA 1LT5D 4PNYA 4KLKA 1IBKQ 3WOFA 1FVIA 2Q8RE 4DV1L 1XMOL 3EVQA 1XJVA 2WP8J 1VMCA 1C48A 1SE3A 3TP7A 4O0AA 3S17H 3JAME 2DY7A 2A69C 1S4ZA 2NVYH 3MXNA 1Z47A 5IT9L 1ET6A 3M7GA 1AFPA 3CKIB 2MQHA 5FJ8H 3HOZG 4A3IG 1XNQL 2J4XA 2QW7A 4XQNA 4DR5Q 1TWFH 4DV4Q 4IOCA 1C7YA 2F0UA 2NVXH 2R6GA 4HIOA 3OMGA 2ZJQA 1VQBA 3CC4A 3A5UA 5FLXE 4DV6Q 1I50H 3UDGA 1N34Q 3NHHA 3GTLH 3D4WA 4QL5A 4DV2Q 1BO0A 3NEMA 2HHHL 1MKHA 3D6WA 2PQAB 2YTVA 3A8JE 1DOLA 4Q0FA 4K5VA 2Y0SE 4C3IH 1R4QB 2ZJPA 1KDCA 4KKSA 4QUFA 5M5WB 3F2DA 1M4VA 1XXGA 1SRUA 1B8AA 1L1OC 4KD4A 3UDIA 4G7OC 4K0KL 1X3EA 4BA2I 3W1BA 2R7ZB 3J7YW 1HNWL 4O1NA 3AMUA 3A55A 1EY5A 4PMCA 4WJWA 5DAUA 1YI2A 1D6EC 2X6GA 4XXEA 3QOJA 1BKBA 1TWHB 4TVAB 4X3KA 1N36L 3MFYA 5KNDA 1PVOA 4GLVB 5LHY1 2F03A 2D0OA 5KGUA 1LABA 3CCEA 2Z6BA 3TQYA 3MXNB 2ZTCA 2KENA 1VQKA 4UDUC 4A75A 1JOQA 4QY7A 5IGFA 3CF5A 1Q81C 2ZTEA 4K6DA 3S17B 4JI7Q 3J80i 2V4DA 2MGSA 1W6JA 2RF4A 2K14A 3OHXC 1WTQA 3AB9A 3HKZB 1EWHA 3KDFB 1EQTA 4LMQD 1XNQQ 4ZAIA 5E3FA 1KL9A 4A3FB 1VQDA 1FR3A 2VL6A 5EGTA 1BXTA 4N9PA 2FXQA 1BCPB 4P74A 1F9SA 2A68C 4B3SQ 3C2PA 1QZHA 1LTRD 2XVSA 4BBSH 3ERQA 5CC4A 1TWGB 1J8IA 1YJWA 2VQEL 4PQXA 1GO3E 3SE0A 2E5LQ 2BE5C 2EXDA 2JA7H 1D5MC 1WFQA 1A6XA 3M4OB 3CC2A 3PV0A 2K32A 3S16B 1I6HH 5LMUL 2L55A 2X6LA 2NVQB 1HJPA 5JEAH 1SJED 4QCLA 4HJ8A 4WJ3M 1O7LA 2F0HA 4Y7NH 2HIXA 3E5SA 1KDBA 5I2XA 3KJPA 4BBRH 1MD2D 1Q8IA 4B9WA 5JVH3 1HRJA 2JA7G 5IP7H 3OYYA 1JWSD 2RHQB 2JA6H 3HKZG 1K0SA 3QG1A 4B9XA 4XYOA 1DONA 4OWWB 1X3FA 2M00A 3I4OA 3PUXA 3CQZH 5GAEC 1DJRD 1NCVA 3GTQB 1IXRA 2CQAA 3PIPA 5K36H 2A6HD 4PMWA 1JORA 3JAML 4U673 4JK1C 3K7UC 1FNWA 4H02A 4EQOA 1GUOA 3P75A 5GAGC 2A19A 1W3SA 2Y0SB 1FD7D 4R9WA 2H1EA 3A0JA 1V1PB 4PG3A 2RDHA 2CW0C 1SYBA 3DHQA 2EJMA 1Y69U 4C1NK 5M9OA 4FVMA 1PH8A 4YHHQ 4FDBA 2PW5A 4M8AA 3PUVA 1CHQD 2K7VA 4A3DG 2MO0A 2DNEA 1E2WA 1YVCA 2HQEA 2A6HC 5M3MH 3CU7A 3FPUB 3GD7A 3IRBA 1V9PA 1OXTA 4LF4Q 1NUCA 2OT2A 4K5XA 5C4JH 1PZJD 3I55A 1W6KA 2CFMA 4HMIA 2JA8G 1BOSA 1B9NA 2MFIA 3IFDA 4IUPA 2BDNA 1WVLA 5CV5A 5C4JB 1ML0D 3KLRA 1NJIC 1Q1EA 3NQIA 1VQ5A 2XNAC 3HFZB 4A3KB 2IX3A 2EY6A 3NTKA 3J80L 2JA8H 1CKNA 5C4XB 4LFBQ 5GQOA 4BXXH 4A3MG 4CBVA 4R8NA 2WB1G 2NN6I 1B3AA 2LKVA 2F1MA 3E0EA 3I56A 3RLOA 1I4PA 4A3EG 4YWKA 2C5CA 1NY4A 2YU9H 3KF8A 4A4IA 3CCUA 1VQ6A 5BR8L 4LF8L 3CD6A 1YHAA 3T16A 4IFDG 1CSPA 4A3DH 4JI7L 2R7ZH 2B8FA 3HRZC 3K5MA 2F0MA 2JA6B 2LMCB 3VYRA 2PNHA 4FXKC 2RVLA 3J81i 1TU2B 4N9TA 2K5WA 3HEJA 4A3IB 1U5KA 5FLMH 3FEWX 1X6OA 3BYTB 3GTGH 3PIOA 3S1QB 2FHTA 2UXDL 1CKNB 2HCIA 1F77A 1WTHA 1D1KA 1CKOA 3M7NA 3M3YH 4FYDA 4JI2L 4LFAL 3S1QH 3MEFA 1YNNC 2AKWB 4RMFA 1PLFA 3EBEA 1V1QA 2IPKD 2NUCA 5CV8A 3G71A 1HTLD 1XPRA 3AEVA 3CMEA 4G7HC 2CKZB 1IW7C 3H3VC 2A69D 2OEOA 2JA7B 1FNUA 4WJ4A 1MJCA 1BNZA 4KN7C 2F3WA 2K28A 1ZXTA 1BCPD 3HOXG 1QOHA 4MNOA 3K57A 1EQRA 1L0XB 2BE5D 3FP9A 3KLSA 3DLLA 3H3VI 1PYBA 4YCUA 1K8MA 2R93B 4LF5L 4NXML 2CCZA 2OXPA 1S5DD 3MAQA 5JOBA 1W2BA 1TQOA 4A3GH 4K5WA 1M90C 3GTMH 3RZOB 4DNIA 3RLFA 2NBFA 1U9RA 5FLMG 1DXMA 2G5DA 3H15A 4EQNA 2F0QA 3HKSA 4A3BB 2A6ED 4JI8L 1DCZA 2PYKA 4DAPA 3HOYB 1QVFA 4GOPA 5EPJA 4IPDA 4KI0A 1ESRA 1Y14B 4V190 4GKJL 4ZKCB 1B4OA 2RDGA 1Y1WH 4JI1Q 3TDQA 3H0GB 4C3JB 1N34L 3S2HH 1JJCB 1YNJC 4OHJA 4NXNL 1C4QA 1WCMG 1JQYD 3G48A 1HZBA 3RNUA 1B50A 4L8JA 3HOVG 4K8IA 3KK7A 5IWAL 3TP8A 4NW2A 5C44H 1SFOB 1ICWA 1KABA 5DNFA 3TMEA 1VQ9A 5GAHC 1TS2A 5NUCA 1EIGA 3KUPA 3FHWA 1GOZA 4JBMA 1PH6A 1PV4A 3N52A 4JI3L 4R8IA 1SNPA 3RZOH 2UXBQ 4H7BA 1A0IA 4IN3A 3G7LA 2IWHA 4CKEA 3OWFA 3PUYA 4DV3L 2E2IB 4UAIA 4HAEA 3G4SA 3K59A 3CRKC 4O42A 1B44D 3C1EA 4OONA 4QF4A 1EFWA 4CHTB 5M5YB 3VA5A 3W5OA 5I6YA 1IBKL 4F88A 2E2DC 5BN4A 2ZJRA 3ITPA 4DR4L 1WTVA 4RWSC 4A93B 2HQLA 4DNTB 4K8JA 2PQEA 4KV6A 2OQKA 4BWGB 1MBYA 5C4ZA 2PZWA 4ZRZA 2UUCL 3FRPB 2L1BA 3SEBA 2R93H 2ID0A 4P73A 4X64Q 5EKLA 5LL6S 4HJAA 5JAVA 1PYWD 4IUNA 4JV5L 4DAMA 3NXWA 4X66L 4ZK9B 3MZ5A 1GM5A 5IYDG 1K8AC 5C3XA 1HA5A 2PI2E 3R2TA 3CMAA 5ELOA 1NAPA 3I73A 2E76C 2KJXA 1V8QA 2IHEA 1F9QA 4FNFA 4A3KG 5IYDH 1EIFA 1SYEA 4EX5A 4G4KA 3M4QA 1SAPA 2K5HA 4DUYL 4H44C 1MSGA 4UP9A 4BXXG 1VDZA 5D65A 2OTJA 4DXFA 3A8IE 4OXPA 1HUMA 3NSWA 4TSSA 4HIMA 4F87A 3CPWA 1YIJA 3K80C 4JBKA 2K50A 1BBUA 4K2LA 4DR3Q 1RCVD 4RFBA 4U68A 3DUZA 1GJXA 1OO9B 2JK8A 5DM63 1YJNA 1PH5A 1XPUA 2QEJC 1SNCA 2B2YA 4XQJA 3RZDH 4MTNA 1SE8A 1ZYRD 1TWAB 1O80A 5CGKA 3HOWH 2KCMA 3OSOA 4QUCA 1FGUA 4GLAC 2ICIA 4AQYL 4JI4Q 4RCOA 1A8VA 3J81j 3C46A 1GUWA 1K0RA 1PRTC 4A3KH 4MHEA 5EBCA 4DV0L 2CH4W 5AJ3Q 4KMUC 1JE4A 1UE1A 1OXVA 3GTLB 3BVZA 5ELBA 4DV7Q 1S3OA 4F7XA 2SOBA 2SNMA 4LFBL 3FVQA 3A54A 1Q8KA 4JI4L 4A3FG 2VUMB 4A3MB 1LT6D 4P71A 2KCNA 2XRSD 4NP5A 4JI0Q 1A2TA 3ULJA 3S1MH 4A3GB 1STHA 4BY7G 3RUZA 4TQUS 1EYGA 2JSOA 3NPPA 2UU9L 5LMNQ 2ATWA 1CZGA 1JMCA 2IX1A 1Q86C 1V1OA 3LNNA 2DUDA 3KBGA 3IAYA 1I6VC 2EJFC 4XQQA 1LM0A 2NZ1D 4QIWE 5IP9H 2Q2TA 3F1ZA 2I07B 4K2KA 1HR0Q 4QIWB 1HR0W 3HOUG 4JYAQ 3OTOL 1E3PA 4BBRB 1OTCA 2AWNA 4QMGA 3K58A 2K52A 4LF6L 1JJ2A 3PIO3 3GTMB 4C3IB 1JT8A 2KHSA 2XWBB 5KYIA 4DV4L 1EY8A 2FMCA 1YHQA 3HOWB 4YIJA 4B3ML 1L1OA 2D0PA 2VQFL 2UUAQ 4RGNA 4Q5VA 3NE5B 4HJ7A 1I50B 5FKAC 2CQOA 5D14A 1WYDA 5CYUA 2ZT9C 4A3BG 1RJTA 1PXUA 3I91A 4DKAC 3BU2A 2F0PA 2XTIA 5F2DA 3MFGA 2JP1A 2BOSA 4NPSA 1HZAA 1A2UA 1SBBB 2DN8A 2KEEA 3KLSX 5IE8A 1KC8C 4RGMA 1Q46A 4YY3Q 3DXJC 3K5OA 1G6PA 1HNXL 1YEZA 4NDXA 2E2IH 4XT3B 3TZUA 4X66Q 4UHVA 1CFMA 1EFID 1KNEA 1EY0A 5LL6X 1EZ8A 3WWVA 3NUCA 3TREA 4P75A 1TS4A 2NZHA 1DYQA 3T1HL 4A93H 5JJZA 2IY5B 2Z6KA 4UP8A 1SR3A 3N6RA 1OXXK 1EQQA 3NTIA 2K5DA 5C3EG 5C5MA 3OTOQ 1N32L 1EL0A 2F0FA 4G57A 3X3NA 4JW0A 1C0AA 2CH4A 3CHBD 3L2PA 2BH2A 3SDZA 1SYFA 1U4MA 4RH6A 4DUZL 4A3LH 3MXUA 1G51A 2D9UA 4DV1Q 5IYCG 3TN2A 1XMOQ 3K5NA 1X32A 2JA8B 1HZ9A 1EYCA 1Q3LA 2XSCA 2Z0SA 3D4RA 4LWCA 5DLQE 2PCFB 3OIPA 4ZKBB 1EZ6A 3S24A 2GN5A 4RHRA 5J1ZA 4L5RC 4A3BH 1BF4A 4GLXA 2CWPA 5M5YH 3FKIH 3KFUA 1IKLA 2EPBA 1RKNA 4BY7B 3PCOB 4DR5L 1YNJD 3UI2A 3MXPA 4DPGA 2PW7A 5CBAE 3T13A 2WB1B 1QVGA 5K5PA 5IWAQ 1EY4A 2WB1E 4OWTB 4XYQA 2JA5B 1F9PA 1PMRA 2C35B 2BCOA 3AFQA 4DGZA 4DK1A 1JB7A 3S16H 1HPCA 5KYLA 1PA6A 3R8BA 2LSSA 3F2CA 1E2ZA 2I5LX 2PZUA 3VDYA 2Z4IA 4RA8A 2R92H 1RTNA 2GA4B 1EQVA 3U9SA 3HGBA 5FO8B 5IIFA 5JPNC 1B53A 3NENA 5COYA 5T1IA 5T1GA 2VXWA 1I3QH 3LGJA 2OWOA 1YJ9A 1ENCA 1D2BA 5CV9A 3EFXD 3O13A 2K6AA 2L11A 4Z9CB 3I4MG 2QEXA 4JV5Q 4JI6L 3U4ZA 5LMNW 2EYHA 4CJ0B 5I2YA 3IFTA 4MZ9A 3CW2C 4AIMA 3J81E 1CM9A 1A63A 3K0XA 5C0XG 3HOUB 4TKOB 1GUNA 2YU9B 1ESFA 2A8VA 5LMUQ 3TSSA 5FOBB 2Z8LA 2UUBQ 1Q82C 3QJYA 1I94L 3BYYB 5C0XH 1RHPA 4H0LC 3U58A 3M85A 2JQOA 1D5XC 2F0TA 4GNXB 2VQEQ 3J7AV 1K8OA 3BS1A 1LACA 5KRUA 4OWXB 1X3GA 5EBDA 3QR8A 5IGDA 1STAA 4J15A 1WOCA 1QZGA 4RKLA 2UUCQ 3H94A 3P7JA 1FGBD 2EVBA 1HQRD 5IT9E 1R9TH 4IUUA 4RKBA 1AN8A 3M4PA 5M3FG 1I3QB 2TSSA 4KHZA 2K01A 4R1JA 4LFAQ 4JI2Q 1PZKD 2F0GA 2O4XA 2E2HB 5CV6A 4IQZA 2PMZB 1RF2D 1ZEQX 3I3CA 5A2QE 1AEXA 5ELNA 3QO2A 4IJHA 1HNZL 5AJ3L 1PH7A 2F0NA 1VQMA 3LWEA 3SK4A 2K5NA 2B39A 1PFBA 3TEHB 5IYBH 4X65Q 4GZYC 1SXTA 4R4TA 2G9HD 5GADC 3DWAA 1E7ZA 4KJNA 3PSIA 4A3JB 4LNQA 1FNVA 2K1BA 4F8MA 4JBWA 1VQ8A 1TY0A 3BDLA 1LTID 2VQFQ 1IBLL 2WACA 3GDEA 3PO3H 4IUVA 3GQBA 1PTOH 1MHWC 2AMCB 4KY7A 5DEHA 1Z7TA 3T53B 1S72A 1G91A 1SNMA 3KF6A 4P2CB 2LY7A 1CQFA 1GUTA 2RKSA 3CAMA 5D3IB 1J5EQ 3DWPA 3V2TA 2R7FA 3P1HA 4OIJA 1E0BA 2B8GA 3I4NG 3L3OC 2F0KA 2JA9A 1SNOA 3R93A 3WDNA 2B2YC 2E5LL 1TVXA 4FF2A 2J0TD 1AZPA 3UE1A 1X3PA 1VQEA 4E6IA 1IBMQ 4HJ9A 4IZ8A 1AE2A 4WORA 4DFAA 3W3AA 1PRTF 1Z6HA 3L7ZC 2RCFA 4NXNQ 4RCNA 4OGQC 3RN2A 1D7QA 2L12A 5E4WC 3GTQH 2WAQE 3JC66 1MIUA 4L5SA 1PFMA 3I4LA 5IGBA 1FJGL 1NMGA 3DMUA 4X64L 1RODA 5C3WA 1CHPD 4I7ZC 2OTLA 1F2MA 4UY8C 1CTMA 4MTKA 4HIDA 3CCJA 5M5WH 2GVBA 1AE3A 4J6HA 4UP7A 1EU4A 2F0LA 1VS0A 2OCEA 3OMCA 3NK9A 1A3UA 4IJLA 4C2MH 5H1SE 4ULLA 2RCNA 5EPLA 3OW2A 1DD2A 2EIFA 1DGSA 3GTOB 3UE0A 2NVTH 1HNXQ 2H5XA 3AU7A 5TSSA 2WINB 4QJFA 4EQ5A 3PUZA 3HOWG 1LYLA 4FP5D 4HSVA 5AFWA 4YWLA 3H3VH 5A35A 3CC7A 2AQ2B 3UDFA 1D8LA 2NN6G 4K6LA 3K8AA 3CCSA 3F2BA 4B3MQ 1SE4A 4KHVA 3SR1A 1NTGA 3ONAB 1E1TA 4ABNA 4HSPA 2V1CC 2O2LD 1NBWA 4JI0L 2D62A 5ELEA 5CMDA 3K0YA 4A3FH 1XPOA 4HCEA 2AHOB 3JAMc 3HP3A 4LF4L 1XWEA 1J6QA 4H13C 4OO1I 2JXMB 1UEBA 2F0VA 2KCCA 2XIWA 1Q1BA 5CORA 5J3BA 1WTXA 3Q24A 1E1OA 5IGEA 3J80c 4FF1A 2JEAI 1EUJA 4JPBW 1TWGH 2ALYB 4LF9L 2F4VQ 1UUPA 3VYUA 4BBSB 4MN3A 3LWUA 2MNAA 1YZ6A 4YWMA 1L2FA 2F0SA 3NBIA 5C5LA 4KTAA 4DAYB 3E6ZX 1O7IA 5L37A 4NXMQ 4JCVE 5JEAJ 3EROA 3GTPB 3BDOA 1BCPC 4ALPA 2ZTDA 1A3VA 2AUKA 2Q8TA 4L5QA 2PNRC 3RR5A 5C0XJ 4X62Q 3S1RB 2UUBL 1IW7D 3V05A 1V1PA 3M9BA 5A2QL 2EQSA 1TWAH 4DV5Q 3CCVA 2RSNA 1TR5A 4R4CA 3NP8A 1J5EL 3S9WA 4DR4Q 1LTSD 2IW3A 2JYOA 1WJJA 3ND8A 1EY7A 1SMYC 1MJEA 5E7NA 3I4MH 1JWMD 3J80E 2N49A 1VQFA 2H4OA 4DV2L 2KOLA 2K33A 1B9MA 5M3MB 4LAAA 1HR0L 5DM73 4IPGA 5HY6A 1N33Q 2X69A 4A3CH 3HG9A 2I5MX 4BA1I 2NVYB 4B3TQ 3W2DA 2IHFA 4KKUA 5IGGA 1G2SA 1RD9D 2AQ1B 4OX9L 1M1KC 1QILA 2JA5G 1YNXA 2B3GA 5FO7B 3QOLA 2UXBL 2NVXB 4IFDJ 1WTRA 1HH2P 1X55A 1Y8NB 2KHIA 4OEMB 3OW7A 4YCVA 3CCQA 4X6AH 3T1YL 1E22A 2QILA 1EY6A 3PMFA 3MXGA 2YYZA 1SEBD 1BVSA 1Y1WB 1II3A 4DK6C 2UU9Q 1KAWA 2HHHQ 1IL8A 4R4OA 1PHJA 5CR3A 3EN2A 2NVQH 1VQOA 1QUQB 3EJIA 2HDLA 4ZCKA 1VQGA 1H9MA 4DR3L 4R4QA 3R3OA 1KDAA 4GS3A 1GXDC 2F0DA 3T1YQ
chains in the Genus database with same CATH topology
5KEEA 1QJOA 4BY1B 2KVMA 2RBMA 4M1UB 3H6MA 2XRQD 5J22A 3WOEA 2ENBA 2MJ8A 2EOTA 3BG3A 1QG7A 1B2TA 4BS9A 2QCPX 1UAPA 3MHBA 1M8AA 3LX0A 2IJ0A 5EJWA 5E1FA 2R61A 4RGTA 1I4GA 1O7YA 5I4DA 3T4AC 5HGTA 3IKJA 1B1ZA 1BDOA 3S2DB 1JWUD 2AUJD 2EYMA 1SYGA 3BDCA 4IALA 4A3DB 1T5XD 4MIUA 3K6OA 4NKLA 1DOMA 1PZID 2KUMA 2EY5A 2F4IA 4HEDA 5KIXA 1KLUD 3X3MA 4C56C 2AQ3B 3VR5A 4DU9A 3MA2B 1F2LA 4QB4A 2A5HA 3I72A 1HCZA 3D6CA 2EZVA 1VMPA 1IKMA 2KQ3A 1CA6A 2A73B 2HDMA 3GTJB 1EOTA 4KKTA 3S1MB 3QIAA 2RDFA 4CKBA 1S5FD 5FLXL 1FYCA 2EXZA 3K5LA 5EKKA 1I6HB 2EYPA 2B63B 5IOCA 2B2VC 3OIQA 5HURA 2R3ZA 2VB3X 2N88A 2K05A 1O7ZA 1SJHD 2L9HA 1JOOA 3G6JB 3PIP3 3E0JA 3R2IA 1JICA 4ZLTF 3TP5A 3SHLA 1QWYA 2SEBD 1L0YB 2B2WC 3MEHA 4OO1H 2NWGA 5FK9C 3P20A 1QNUA 1D1IA 1T5EA 1WCMB 2OF1A 4A3EB 4ZUJA 1PTOF 1QE6A 3A56A 2B2VA 1H9RA 1QCBD 1EYAA 1CA5A 1HXYD 2PPBC 4FF3A 4LJZC 1I4RA 2WV6D 4IFDH 1SYCA 1XYIA 2M9VA 1IYUA 1HA6A 1G6ZA 3M4YA 1MGSA 3VR6A 3BVGA 2KECA 1PTOB 2M2LA 2CW0D 2G9DA 4ZQ3A 1UNSA 5CV7A 2K5QA 2BA0A 1GUSA 5ELCA 1I4HA 1CZWA 3TBIB 3Q22A 1F9RA 1WTPA 1F2ZA 3MWYW 5G3LF 1JR0D 5CBEE 2ZXRA 3Q0AA 4PMBA 3D4DA 1LTAD 1TS3A 3K7AB 1A3TA 1GHJA 5D3DA 2KEDA 3MC0B 5I9PA 2FFKB 1JOKA 4ME5A 5ELFA 3S1NB 1SMYD 3HOZB 2AWOA 1XX8A 3FPPA 1PDQA 2O5IC 3DM1A 4Y7NB 2PO4A 1F2YA 2NTSA 3OPOA 4G7ZC 1LTBD 3A8KE 3VYSA 1I4QA 2HCCA 3FDTA 4J1MA 4DNRB 5EKIA 2K04A 3V96A 2EY2A 2Z1CA 4OIKA 5IODA 5C44B 4PV1C 1H9SA 5EQ0A 3T56B 1KLGD 2RA4A 4HCSA 1SDFA 2EE1A 2HUGA 3U9OA 2C9OA 1U4LA 3ND9A 2EJGC 4C3HG 3GP7A 3RZDB 4EQPA 1EYDA 1HTPA 3KBXA 1GUGA 1R4PB 3VR2A 1ZYRC 4L63B 1XTCD 2F0EA 2EYJA 5ELDA 3J81L 1ILQA 1BBXC 1AW7A 2ICEC 1H9SB 4AYBB 5C0XI 3I90A 5M3FB 4EGVA 3EA6A 1BR9A 2NN6H 3DEOA 3OWEB 3GTKB 1PRTB 4WFN3 3I4MB 1G291 3J7AF 1STNA 2TMPA 1JB3A 2RSOA 4HMJA 2D5DA 1OXSC 4ID6A 1JCKB 3QWNA 1MI2A 4KY6A 4I65A 4ZUIA 1G8ZD 1DM0B 1SSOA 1Y8OB 5FO9B 1IHZA 4XTCS 4C3HB 3EQLC 2L0CA 1ENFA 2XN9C 1C8CA 4X3SA 1Q90A 4CKCA 1YNND 2SDFA 2LFNA 1DZ1A 2B2WA 2MPMA 4IFDI 1I4XA 1EEFD 1RDPD 1HHVA 1KTKA 2QF7A 1WTWA 4EVOA 4RAUC 3D8GA 4C3IG 1KAAA 1Y1VB 5G3LD 2MUYA 3A7LA 1V43A 2N55A 2JE6I 5KNBA 1S5CD 3I4NB 2L4NA 2EYOA 1STGA 2PZTA 1E2VA 2A6EC 5E4XA 3SVMA 2NVTB 3VR4A 3PO3B 1TKWB 3QB3A 1WTOA 1GHKA 3RD4A 4ODGA 3FKIB 3RMHA 3D31A 2FJ2A 4DF7A 1VCIA 4XDXA 2WIIB 1CK1A 1DOKA 2E74C 2VB2X 4DA2A 2MP1A 2Q8IB 4FO2A 3VR3A 4V0BA 3A7AB 5JVG3 3CRLC 4ILWA 1HFNA 1NR2A 1TY2A 1EIHA 4IUTA 1U4PA 2F0OA 2CVRA 1CT1D 2B2UA 1O78A 5J39A 4IURA 5K36G 1LV9A 1ZKOA 4J8QA 1CQVA 5JPMC 2FMMA 2KA7A 5M5XB 1H9JA 4HTHA 5IGCA 2DY8A 1LT3D 1BUVT 1AZQA 1UEAB 1LTTD 2ZXOA 1VF5C 5KNCA 3TP6A 1X3QA 4CJ2C 3NQTA 4C2MB 1EEID 3SK8A 1WD0A 1LLRD 5EPKA 3C1FA 2E2JB 1HQMC 4KN4C 1G2TA 1ONLA 2SNSA 4OO1G 3MTSA 3SXHA 1TIID 3TZDA 1STBA 2I46A 1SE2A 2D2CC 4C3JG 2B2UC 1HUNA 2NB0A 1EWCA 3PO2B 2IT1A 4OL7A 3GV3A 1EY9A 3S15B 5CV4A 2QDBA 4X3UA 3S2HB 4LK1C 1R9TB 2A68D 4DN4M 2F3VA 1J9OA 3H91A 3HOVB 2EDGA 2ZXPA 2A74C 4HR7B 4C1NI 3S14B 2XWJB 5C6AA 5C3EB 1A15A 1QB5D 3D3RA 2FINB 3MVVA 2E75C 3VYTA 2F0IA 1TS5A 5BN3A 2O5JC 1K83B 4B08A 1MSHA 2RQXA 4HN7A 2VNUD 5I6WA 3ZYYX 4NMZA 2IX0A 4L6TB 3GV6A 1S5ED 5BN5A 2WKDA 2LS01 2F0JA 3IL8A 3BZDB 3L9AX 5ISRA 4XT1B 3Q6SA 1RTOA 1ET9A 4XIGS 2DNCA 1ILPA 5C4HA 1KNAA 1PTOC 3GTGB 3VA7A 1NSNS 3NBHA 3Q23A 3C3LA 2B2TA 3NTHA 3SK6A 2MHVA 2EYFA 3DWQA 1U4RA 4WRDA 1TT2A 4K14A 1LT4D 3I8ZA 4ZYSA 3BVMA 5I9OA 2CHBD 2L5TA 1OXUA 2WAQB 2QKIC 1S5BD 1WD1A 3NWSA 3GO5A 2NTTA 1BQQT 1PTOD 2EYLA 2Z4HA 4X3TA 1AP0A 1PFNA 4DK0A 1H9KA 2R92B 1IYVA 1JC7A 1EU3A 1HFGA 1BCPF 1VF7A 2K03A 1SNQA 4DAYA 2IL8A 4CJ1B 4RGOS 4FXGC 2F0WA 2EY1A 2BDOA 1PRTD 4DAVA 4KK7A 3OOCA 1TWFB 4S3SA 2JEBI 4FXDA 2B2TC 4KJOA 4KY5A 3CQZB 3SK5A 3H09A 4DXGA 3PUWA 3I70A 1STEA 1TWCB 1CI3M 4CGYB 1SNDA 3URYA 1Y8PB 4IUQA 3HOXB 2BA1A 1D5ZC 3T51B 2J7ZA 1LTGD 1ENAA 2WKCA 1STYA 1NR4A 4FF4A 4KD3A 5JEAG 3HZXA 4RHSA 3HS0C 1Q12A 3FMCA 3NWTA 1SYDA 1QNKA 2NYZD 4TRDA 1LO5D 3F2UA 3M3YB 3DEPA 1LT5D 4PNYA 3WOFA 2Q8RE 3EVQA 2WP8J 1VMCA 1C48A 1SE3A 3TP7A 3JAME 2DY7A 2A69C 1S4ZA 3MXNA 1Z47A 5IT9L 1ET6A 3M7GA 1AFPA 3CKIB 2J4XA 4XQNA 2F0UA 2R6GA 3OMGA 5FLXE 3NHHA 3D4WA 1BO0A 3D6WA 3A8JE 1DOLA 4Q0FA 4K5VA 1R4QB 1KDCA 4KKSA 4QUFA 5M5WB 1M4VA 1XXGA 4KD4A 4G7OC 4BA2I 2R7ZB 3J7YW 4O1NA 3AMUA 3A55A 1EY5A 4PMCA 4WJWA 5DAUA 1D6EC 2X6GA 4XXEA 3QOJA 1TWHB 4X3KA 3MFYA 5KNDA 5LHY1 2F03A 5KGUA 1LABA 4UDUC 1JOQA 5IGFA 4K6DA 3S17B 2V4DA 2MGSA 1W6JA 3OHXC 1WTQA 3AB9A 3HKZB 1EWHA 1EQTA 4LMQD 4ZAIA 5E3FA 4A3FB 1FR3A 5EGTA 1BXTA 4N9PA 1BCPB 1F9SA 2A68C 3C2PA 1LTRD 2XVSA 3ERQA 5CC4A 1TWGB 1J8IA 4PQXA 3SE0A 2BE5C 1D5MC 1A6XA 3M4OB 3PV0A 2K32A 3S16B 2L55A 2X6LA 2NVQB 5JEAH 1SJED 4QCLA 1O7LA 2F0HA 3E5SA 1KDBA 5I2XA 1MD2D 1Q8IA 4B9WA 5JVH3 1HRJA 1JWSD 3QG1A 4B9XA 4XYOA 1DONA 2M00A 3PUXA 1DJRD 1NCVA 3GTQB 2CQAA 5K36H 2A6HD 4PMWA 1JORA 3JAML 4U673 4JK1C 1FNWA 4EQOA 1GUOA 3P75A 4R9WA 2Y0SB 1FD7D 2H1EA 1V1PB 2RDHA 2CW0C 1SYBA 3DHQA 2EJMA 1Y69U 4C1NK 5M9OA 4FVMA 2PW5A 4M8AA 3PUVA 1CHQD 2K7VA 2DNEA 1E2WA 2HQEA 2A6HC 3CU7A 3FPUB 3GD7A 1OXTA 1NUCA 2OT2A 4K5XA 1PZJD 1W6KA 4HMIA 1BOSA 1B9NA 3IFDA 4IUPA 2BDNA 1WVLA 5CV5A 5C4JB 1ML0D 3KLRA 1Q1EA 3NQIA 2XNAC 4A3KB 2IX3A 2EY6A 3NTKA 3J80L 5C4XB 4CBVA 4R8NA 2NN6I 1B3AA 2LKVA 2F1MA 1I4PA 2C5CA 3KF8A 3T16A 4IFDG 2B8FA 3HRZC 3K5MA 2F0MA 2JA6B 2LMCB 3VYRA 4FXKC 2RVLA 1TU2B 4N9TA 2K5WA 3HEJA 4A3IB 3FEWX 3BYTB 3S1QB 2FHTA 2HCIA 1F77A 1D1KA 3M7NA 4FYDA 1YNNC 1PLFA 2IPKD 5CV8A 2NUCA 1HTLD 4G7HC 1IW7C 3H3VC 2A69D 2OEOA 2JA7B 1FNUA 1BNZA 4KN7C 2F3WA 2K28A 1ZXTA 1BCPD 1QOHA 3K57A 1L0XB 2BE5D 3KLSA 1K8MA 2R93B 2OXPA 1S5DD 3MAQA 5JOBA 1TQOA 4K5WA 3RZOB 3RLFA 2NBFA 1U9RA 1DXMA 4EQNA 2F0QA 4A3BB 2A6ED 1DCZA 2PYKA 4DAPA 3HOYB 5EPJA 4KI0A 1ESRA 4V190 4ZKCB 1B4OA 2RDGA 3TDQA 3H0GB 4C3JB 1YNJC 4OHJA 1C4QA 1JQYD 1B50A 4L8JA 4K8IA 3KK7A 3TP8A 4NW2A 1SFOB 1ICWA 1KABA 5DNFA 3TMEA 1TS2A 5NUCA 1EIGA 3KUPA 1GOZA 3N52A 4R8IA 1SNPA 4H7BA 4IN3A 3G7LA 2IWHA 4CKEA 3OWFA 3PUYA 2E2IB 4UAIA 4HAEA 3K59A 3CRKC 4O42A 1B44D 3C1EA 4QF4A 4CHTB 5M5YB 3VA5A 5I6YA 4F88A 2E2DC 5BN4A 3ITPA 1WTVA 4RWSC 4A93B 4DNTB 4K8JA 2PQEA 4KV6A 4BWGB 1MBYA 5C4ZA 2PZWA 4ZRZA 3FRPB 2L1BA 3SEBA 2ID0A 5EKLA 5LL6S 5JAVA 1PYWD 4IUNA 3NXWA 4ZK9B 3MZ5A 5C3XA 1HA5A 3R2TA 1NAPA 3I73A 2E76C 2KJXA 1V8QA 1F9QA 4FNFA 1SYEA 4G4KA 1SAPA 4H44C 1MSGA 1VDZA 5D65A 4DXFA 3A8IE 1HUMA 3NSWA 4TSSA 4F87A 4K2LA 1RCVD 4RFBA 4U68A 3DUZA 1GJXA 1OO9B 5DM63 2QEJC 1SNCA 2B2YA 4XQJA 1ZYRD 1TWAB 1O80A 5CGKA 3OSOA 4QUCA 2ICIA 4RCOA 3C46A 1GUWA 1PRTC 4MHEA 5EBCA 4KMUC 1JE4A 1OXVA 3GTLB 3BVZA 5ELBA 4F7XA 2SOBA 2SNMA 3FVQA 3A54A 2VUMB 4A3MB 1LT6D 2KCNA 2XRSD 4NP5A 1A2TA 4A3GB 1STHA 3RUZA 4TQUS 2JSOA 3NPPA 1CZGA 2IX1A 1V1OA 3LNNA 3KBGA 3IAYA 1I6VC 2EJFC 4XQQA 2NZ1D 2I07B 4K2KA 4QIWB 4BBRB 2AWNA 3K58A 4QMGA 3PIO3 3GTMB 4C3IB 2KHSA 2XWBB 5KYIA 1EY8A 2FMCA 3HOWB 4YIJA 4RGNA 4Q5VA 3NE5B 1I50B 5FKAC 5D14A 5CYUA 2ZT9C 1RJTA 1PXUA 3I91A 2F0PA 5F2DA 3MFGA 2JP1A 2BOSA 2DN8A 1A2UA 1SBBB 2KEEA 3KLSX 4RGMA 3DXJC 3K5OA 4NDXA 4XT3B 3TZUA 1CFMA 1EFID 1KNEA 1EY0A 5LL6X 1EZ8A 3NUCA 1TS4A 1DYQA 5JJZA 3N6RA 1OXXK 3NTIA 2K5DA 5C5MA 1EL0A 2F0FA 4G57A 3X3NA 3CHBD 3SDZA 1SYFA 1U4MA 4RH6A 3MXUA 2D9UA 3TN2A 3K5NA 1X32A 2JA8B 1EYCA 1Q3LA 2XSCA 3D4RA 2PCFB 3OIPA 4ZKBB 1EZ6A 4RHRA 5J1ZA 1BF4A 1IKLA 2EPBA 1RKNA 4BY7B 1YNJD 3UI2A 3MXPA 2PW7A 5CBAE 3T13A 2WB1B 5K5PA 1EY4A 4XYQA 2JA5B 1F9PA 1PMRA 2BCOA 4DGZA 4DK1A 1HPCA 5KYLA 3R8BA 1E2ZA 2PZUA 2Z4IA 4RA8A 1RTNA 2GA4B 1EQVA 3U9SA 3HGBA 5FO8B 5IIFA 5JPNC 1B53A 5COYA 5T1IA 5T1GA 2VXWA 1ENCA 1D2BA 5CV9A 3EFXD 3O13A 2K6AA 2L11A 4Z9CB 2EYHA 4CJ0B 5I2YA 3IFTA 3J81E 1CM9A 5C0XG 3HOUB 4TKOB 1GUNA 2YU9B 1ESFA 3TSSA 5FOBB 2Z8LA 3QJYA 3BYYB 5C0XH 1RHPA 4H0LC 3M85A 1D5XC 2F0TA 3J7AV 1K8OA 3BS1A 1LACA 5KRUA 5EBDA 5IGDA 1STAA 4RKLA 3H94A 3P7JA 1FGBD 2EVBA 1HQRD 5IT9E 4IUUA 4RKBA 1AN8A 1I3QB 2TSSA 4KHZA 2K01A 1PZKD 2F0GA 2O4XA 2E2HB 5CV6A 4IQZA 2PMZB 1RF2D 1ZEQX 3I3CA 5A2QE 1AEXA 3QO2A 2F0NA 3LWEA 3SK4A 2B39A 1PFBA 4GZYC 1SXTA 2G9HD 3DWAA 4KJNA 4A3JB 1FNVA 2K1BA 4F8MA 4JBWA 1TY0A 3BDLA 1LTID 2WACA 4IUVA 3GQBA 1PTOH 3T53B 4KY7A 5DEHA 1Z7TA 1G91A 1SNMA 2LY7A 4P2CB 1CQFA 1GUTA 2RKSA 5D3IB 3DWPA 3V2TA 4OIJA 3P1HA 1E0BA 2B8GA 3L3OC 2F0KA 3R93A 1SNOA 3WDNA 2B2YC 1TVXA 4FF2A 2J0TD 1AZPA 1X3PA 4E6IA 4IZ8A 4WORA 4DFAA 3W3AA 1PRTF 1Z6HA 3L7ZC 4RCNA 4OGQC 2L12A 5E4WC 1PFMA 3I4LA 5IGBA 3DMUA 1RODA 5C3WA 1CHPD 4I7ZC 1F2MA 1CTMA 4J6HA 1EU4A 2F0LA 3OMCA 3NK9A 1A3UA 4ULLA 5EPLA 1DD2A 3GTOB 3AU7A 5TSSA 2WINB 3PUZA 4FP5D 4HSVA 5AFWA 5A35A 2AQ2B 2NN6G 4K6LA 1SE4A 4KHVA 3SR1A 3ONAB 4ABNA 4HSPA 2O2LD 2D62A 5ELEA 5CMDA 3K0YA 4HCEA 3HP3A 1XWEA 4H13C 4OO1I 2JXMB 2F0VA 2KCCA 2XIWA 5CORA 1Q1BA 1WTXA 3Q24A 5IGEA 4FF1A 2JEAI 1UUPA 3VYUA 4BBSB 4MN3A 3LWUA 2F0SA 3NBIA 5C5LA 4KTAA 3E6ZX 5JEAJ 3EROA 3GTPB 3BDOA 1BCPC 1A3VA 2AUKA 2Q8TA 2PNRC 5C0XJ 3S1RB 1IW7D 3V05A 1V1PA 5A2QL 2RSNA 1TR5A 3NP8A 3S9WA 1LTSD 2IW3A 2JYOA 3ND8A 1EY7A 1SMYC 1JWMD 3J80E 2H4OA 2KOLA 2K33A 1B9MA 5M3MB 4LAAA 5DM73 2X69A 3HG9A 4BA1I 2NVYB 3W2DA 4KKUA 5IGGA 1G2SA 1RD9D 2AQ1B 1QILA 5FO7B 3QOLA 2NVXB 4IFDJ 1WTRA 1Y8NB 3OW7A 2QILA 1EY6A 3PMFA 3MXGA 2YYZA 1SEBD 1Y1WB 1II3A 1IL8A 5CR3A 3EJIA 2HDLA 1H9MA 3R3OA 1KDAA 1GXDC 2F0DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XQN A;  4XXE A;  4XQJ A;  4G4K A;  4CBV A;  3BS1 A;  4XYQ A;  4XYO A;  4XQQ A; 
#chains in the Genus database with same CATH topology
 5KEE A;  1PH1 A;  1QJO A;  4BY1 B;  2KVM A;  1QVC A;  2RBM A;  4M1U B;  3H6M A;  1K28 A;  2XRQ D;  5J22 A;  2R93 G;  3J7A 5;  3WOE A;  2ENB A;  2MJ8 A;  2EOT A;  1VQH A;  3BG3 A;  1QG7 A;  1B2T A;  4BS9 A;  2QCP X;  2HT1 A;  3CXC A;  1UAP A;  3PO2 H;  3MHB A;  4IOA A;  1M8A A;  1Y1W G;  3LX0 A;  2IJ0 A;  5EJW A;  5E1F A;  2R61 A;  4RGT A;  1I4G A;  1O7Y A;  1WI5 A;  5I4D A;  3PF5 A;  3T4A C;  5HGT A;  3IKJ A;  1B1Z A;  1BDO A;  3S2D B;  1JWU D;  2AUJ D;  2EYM A;  1SYG A;  3BDC A;  4IAL A;  2B63 H;  4A3D B;  1T5X D;  4MIU A;  3K6O A;  4NKL A;  5IP7 G;  1X65 A;  1DOM A;  1PZI D;  2KUM A;  1Z9F A;  4GOP C;  1B7Y B;  2E8G A;  2EY5 A;  2F4I A;  4HED A;  1N33 L;  5KIX A;  1KLU D;  3X3M A;  4C56 C;  2L15 A;  4DR2 L;  2AQ3 B;  3VR5 A;  4DU9 A;  3MA2 B;  1F2L A;  4QB4 A;  3AQQ A;  2A5H A;  3I72 A;  1HCZ A;  3D6C A;  3D0F A;  1VQC A;  2EZV A;  1VMP A;  4POG A;  2KQ3 A;  1IKM A;  5IYC H;  1CA6 A;  2A73 B;  2HDM A;  3GTJ B;  1VQN A;  5FLX c;  4A3J G;  2QGQ A;  4HIK A;  1EOT A;  4ME3 A;  4LF6 Q;  1S40 A;  4KKT A;  3S1M B;  3QIA A;  2RDF A;  4CKB A;  1S5F D;  4X62 L;  4A3L G;  3EIV A;  3AFP A;  4LFC Q;  5JJK A;  5FLX L;  1FYC A;  2Z6K C;  5C3E H;  4JOI C;  5C4X H;  2EXZ A;  3PF4 A;  3K5L A;  5EKK A;  3ZJY C;  1KD1 C;  1GKH A;  3KLW A;  1XMQ Q;  1I6H B;  2EYP A;  2B63 B;  5IOC A;  1FL0 A;  2B2V C;  3OIQ A;  5HUR A;  3HKZ E;  3JAM i;  2R3Z A;  2Q2H A;  2VB3 X;  3KDF A;  2N88 A;  2K05 A;  1O7Z A;  1XNR L;  1SJH D;  2WFW A;  2L9H A;  1SN8 A;  3NBH B;  4C3H H;  3STB C;  1ASY A;  1JOO A;  4A3I H;  3I7F A;  3G6J B;  3PIP 3;  3E0J A;  3R2I A;  1JIC A;  4ZLT F;  3TP5 A;  1KIX A;  3F8T A;  1QWY A;  3SHL A;  4OEL B;  3J81 c;  2SEB D;  1L0Y B;  2B2W C;  3ERS X;  3MEH A;  4OO1 H;  2WAQ G;  2NWG A;  3I2Z A;  5FK9 C;  1PH9 A;  3P20 A;  1QNU A;  2XGT A;  2KCT A;  4AH6 A;  4LF5 Q;  2R7D A;  1D1I A;  1T5E A;  4CDE C;  1WCM B;  2OF1 A;  4DR7 L;  4A3E B;  4ZUJ A;  1PTO F;  1QE6 A;  3A56 A;  2B2V A;  1H9R A;  5FJ8 G;  3BZC A;  3HOZ H;  1QCB D;  3B6Y A;  1EYA A;  3W1G A;  1CA5 A;  1HXY D;  2PPB C;  1QUQ A;  2PQA A;  2GVA A;  4FF3 A;  2KBN A;  4LJZ C;  2K5V A;  1TXY A;  1I4R A;  2WV6 D;  4IFD H;  1SYC A;  1XYI A;  2M9V A;  1IYU A;  1HA6 A;  1G6Z A;  1EWI A;  3M4Y A;  1MGS A;  3VR6 A;  3BVG A;  2KEC A;  1PTO B;  4LUV A;  4CDD C;  2M2L A;  1K8G A;  2CW0 D;  2G9D A;  3CCL A;  4ZQ3 A;  1UNS A;  5CV7 A;  1VQ4 A;  4DR2 Q;  2K5Q A;  3DM3 A;  2BA0 A;  2I0Q A;  1GUS A;  5ELC A;  1I4H A;  1CZW A;  3TBI B;  2YTX A;  3I4N H;  3Q22 A;  2LXJ A;  1F9R A;  1WTP A;  3E3X A;  1F2Z A;  1KXL A;  3MWY W;  4LUO A;  5G3L F;  4BBR G;  2QA4 A;  5C44 G;  1JR0 D;  2F52 A;  5CBE E;  2ZXR A;  3Q0A A;  4PMB A;  1SRO A;  1X9N A;  3D4D A;  1LTA D;  1LTL A;  1TS3 A;  3K7A B;  3HOX H;  1HNZ Q;  2B63 G;  3L0O A;  1A3T A;  1GHJ A;  5D3D A;  4DR1 Q;  2KHJ A;  2KED A;  3MC0 B;  5IT9 c;  5I9P A;  3ULP A;  2UXC Q;  2FFK B;  4O2D A;  1JOK A;  4ME5 A;  5ELF A;  3S1N B;  1SMY D;  3HOZ B;  2AWO A;  4IPC A;  1XX8 A;  3FPP A;  1GD7 A;  1PDQ A;  2OQ0 A;  3Q8D A;  3DM1 A;  4Y7N B;  2O5I C;  2PO4 A;  3ICE A;  1F2Y A;  4JBJ A;  2NTS A;  3OPO A;  4G7Z C;  1LTB D;  1T9H A;  2R92 G;  2I5H A;  5BR8 Q;  1ASZ A;  4LF8 Q;  1UWV A;  3A8K E;  3VYS A;  1I4Q A;  3KYH C;  2HCC A;  4BY1 H;  3FDT A;  4J1M A;  2K75 A;  4DNR B;  5EKI A;  2Q2U A;  2K04 A;  3KF6 B;  3V96 A;  2CWA A;  2EY2 A;  2Z1C A;  4JG2 A;  2N8N A;  4OIK A;  5IOD A;  4LF7 Q;  5C44 B;  1AH9 A;  4PV1 C;  2Z9H A;  1H9S A;  5EQ0 A;  2E2H H;  1EIY B;  3T56 B;  1KLG D;  2RA4 A;  3RN5 A;  4HCS A;  1SDF A;  2EE1 A;  1CUK A;  2HUG A;  4B3S L;  3U9O A;  2C9O A;  1UE5 A;  1U4L A;  3ND9 A;  1EOV A;  2EJG C;  2JJQ A;  4C3H G;  3PO3 G;  1I94 Q;  2F3I A;  3GP7 A;  1PH4 A;  2N3S A;  3RZD B;  4JI6 Q;  4EQP A;  1EYD A;  1HTP A;  3KBX A;  1GUG A;  1P8L A;  1FJG Q;  1R4P B;  3VR2 A;  1ZYR C;  4L63 B;  4A93 G;  1XTC D;  2F0E A;  1KRS A;  2EYJ A;  1UE7 A;  1XMQ L;  3PGZ A;  5ELD A;  3J81 L;  1ILQ A;  1BBX C;  1AW7 A;  2ICE C;  3E9I A;  4LFC L;  4UPA A;  3U50 C;  1SFO H;  1H9S B;  4AYB B;  5C0X I;  3I90 A;  5M3F B;  3EA6 A;  4EGV A;  1BR9 A;  3ER0 A;  2NN6 H;  3DEO A;  1X56 A;  3S15 H;  3OWE B;  3GTK B;  4POF A;  3KOJ A;  1PRT B;  4WFN 3;  2VUM H;  3I4M B;  1G29 1;  1ICF B;  3J7A F;  1STN A;  1VQJ A;  1P16 A;  2TMP A;  1JB3 A;  2RSO A;  4HMJ A;  4GNX A;  1HNW Q;  3UDX A;  2D5D A;  3U4V A;  1OXS C;  4ID6 A;  4NB3 A;  1JCK B;  3QWN A;  1MI2 A;  2DJG C;  4I65 A;  4KY6 A;  4ZUI A;  4B3R Q;  2ASB A;  1G8Z D;  1DM0 B;  1SSO A;  3SGI A;  1Y8O B;  3GTO H;  5FO9 B;  1IHZ A;  4XTC S;  4C3H B;  4IO9 A;  3EQL C;  2L0C A;  2UUA L;  1VQL A;  1ENF A;  2XN9 C;  1C8C A;  4X3S A;  3ULL A;  1Q90 A;  4CKC A;  1YNN D;  1I5F A;  4RG1 A;  4A3M H;  2SDF A;  1E24 A;  2LFN A;  1JE5 A;  1DZ1 A;  2B2W A;  1TWC H;  1C9O A;  1KRT A;  2MPM A;  4IFD I;  1I4X A;  2JA5 H;  3HOY H;  1EEF D;  4JI3 Q;  1RDP D;  1SLJ A;  1HHV A;  1VQA A;  1KTK A;  2QF7 A;  3KF8 B;  3S1R H;  2A1A A;  2Q2I A;  1Y1V H;  1WTW A;  4EVO A;  4JVZ A;  3GTK H;  4QQB X;  4RAU C;  3D8G A;  4C3I G;  1YIT A;  1KAA A;  1Y1V B;  5G3L D;  2MUY A;  3A7L A;  1V43 A;  1A62 A;  3TS2 A;  4P72 A;  3NEL A;  5IP9 G;  3BJU A;  4B3T L;  2N55 A;  2DGY A;  2JE6 I;  5KNB A;  1N32 Q;  1S5C D;  3I4N B;  1PFS A;  2L4N A;  2EYO A;  1JJG A;  2MO1 A;  4BY1 G;  1Q7Y C;  4B3R L;  1STG A;  1N36 Q;  2PZT A;  2YV5 A;  4A3E H;  1X54 A;  1E2V A;  4YCW A;  2A6E C;  5E4X A;  3SVM A;  4DUZ Q;  2NVT B;  4A3G G;  3VR4 A;  3PO3 B;  1TKW B;  4JOI A;  3QB3 A;  1WTO A;  1GHK A;  4A76 A;  3RD4 A;  4ODG A;  3FKI B;  4GN3 B;  3RMH A;  3D31 A;  2RHS B;  4CDF C;  2FJ2 A;  4DF7 A;  4KHP Q;  4KHP L;  1H95 A;  1VCI A;  4XDX A;  2WII B;  1CK1 A;  1DOK A;  2E74 C;  4DR7 Q;  2VB2 X;  4DA2 A;  2MP1 A;  2Q8I B;  1CSQ A;  1BBW A;  4FO2 A;  3VR3 A;  3T1H Q;  4V0B A;  3A7A B;  5JVG 3;  2E2J H;  4DR1 L;  3S14 H;  3CRL C;  1IL2 A;  4ILW A;  1HFN A;  1NR2 A;  1TY2 A;  1EIH A;  4IUT A;  1U4P A;  2F0O A;  5IY0 A;  5M3F H;  2CVR A;  1CT1 D;  1VQP A;  2B2U A;  1O78 A;  5J39 A;  4IUR A;  5K36 G;  1K73 C;  2VZA A;  1LV9 A;  1ZKO A;  4J8Q A;  1CQV A;  1L0W A;  3TS0 A;  5JPM C;  4AQY Q;  2FMM A;  3HOU H;  1K3B C;  3FKI G;  3S2D H;  4GN5 A;  3E9H A;  2KA7 A;  1KHI A;  1U0L A;  1H9J A;  4HTH A;  5M5X B;  1XTD A;  3CP0 A;  2P5Z X;  4APV A;  2BH8 A;  5IGC A;  2DY8 A;  1PH2 A;  4LF9 Q;  1LT3 D;  4DR6 L;  4DR6 Q;  1BUV T;  1K83 H;  1AZQ A;  1UEA B;  1LTT D;  2ZXO A;  4AYB G;  1VF5 C;  5KNC A;  3TP6 A;  1X3Q A;  5JJI A;  4CJ2 C;  4DUY Q;  3NQT A;  4C2M B;  1B3Q A;  1EEI D;  3SK8 A;  1WD0 A;  1LLR D;  5EPK A;  3C1F A;  2E2J B;  3GTJ H;  1HQM C;  4KN4 C;  1G2T A;  1ONL A;  2SNS A;  4OO1 G;  3AYH B;  3MTS A;  3SXH A;  1IZ6 A;  4DK3 C;  2DJF C;  1TII D;  2ZM6 Q;  3TZD A;  1STB A;  2I46 A;  1SE2 A;  2D2C C;  3H0G G;  4C3J G;  2VUM G;  2B2U C;  5C4X G;  5HGQ A;  4GKK Q;  1HUN A;  2NB0 A;  1EWC A;  3PO2 B;  2IT1 A;  4OL7 A;  3GV3 A;  1IBL Q;  1CKM A;  1EY9 A;  2PMZ E;  3S15 B;  5CV4 A;  2QDB A;  4X3U A;  3H0G H;  4C3J H;  3S2H B;  4LUZ A;  4LK1 C;  4AYB E;  1R9T B;  2A68 D;  4DN4 M;  3CCM A;  2F3V A;  1NMF A;  1J9O A;  3H91 A;  1LUZ A;  3HOV B;  2EDG A;  3A74 A;  4I7A A;  2ZXP A;  2A74 C;  4HR7 B;  4C1N I;  4IPH A;  3S14 B;  4DV7 L;  2UXC L;  2XWJ B;  3TRZ A;  1GVP A;  2JA6 G;  5C6A A;  4QGU A;  5C3E B;  1A15 A;  4PZ6 A;  1QB5 D;  4JI5 L;  3D3R A;  4JI5 Q;  2FIN B;  3MVV A;  1VQ7 A;  2N78 A;  1UE6 A;  4PZ8 A;  4L5T A;  2UXD Q;  2E75 C;  3VYT A;  2F0I A;  1TS5 A;  5BN3 A;  2O5J C;  1K83 B;  4B08 A;  1MSH A;  3BZK A;  2RQX A;  3PQI A;  1L1O B;  4HN7 A;  2VNU D;  4R4I A;  4DV5 L;  4GNX C;  3K81 C;  5I6W A;  5JJL A;  3ZYY X;  4NMZ A;  4GKJ Q;  2IX0 A;  4L6T B;  4Y52 H;  5M5X H;  3J7Z C;  3RLN A;  1PYS B;  3GV6 A;  1PH3 A;  1S5E D;  5BN5 A;  2WKD A;  2F4V L;  2LS0 1;  1RIP A;  2F0J A;  3IL8 A;  3BZD B;  3L9A X;  5ISR A;  1YHB A;  2ES2 A;  1KQS A;  4XT1 B;  4JYA L;  3Q6S A;  1RTO A;  2HD3 A;  1ET9 A;  4XIG S;  1N9W A;  2DNC A;  1SMX A;  1ILP A;  5C4H A;  1Y1V G;  1KNA A;  1PTO C;  5LMN L;  3GTG B;  3A5Z B;  4JC0 A;  3VA7 A;  1NSN S;  3NBH A;  1NE3 A;  3Q23 A;  3C3L A;  2B2T A;  3NTH A;  3SK6 A;  2MHV A;  2EYF A;  3DWQ A;  4GN4 B;  3HOY G;  1U4R A;  2VY3 A;  4WRD A;  1TT2 A;  2YTY A;  4K14 A;  1LT4 D;  4JI8 Q;  3HOV H;  3I8Z A;  4ZYS A;  3BVM A;  3STB D;  4X65 L;  1IYJ B;  5I9O A;  4DV6 L;  2CHB D;  2L5T A;  1OXU A;  2B29 A;  2WAQ B;  2QKI C;  1S5B D;  4A3C G;  1WD1 A;  3NWS A;  3GO5 A;  2VW9 A;  4N8F A;  2NZO A;  1TWH H;  4YY3 L;  2NTT A;  1BQQ T;  3GTP H;  1PTO D;  2EYL A;  2Z4H A;  4X3T A;  1AP0 A;  1PFN A;  2QDL A;  2VS1 A;  1H9K A;  4DK0 A;  2R92 B;  1IYV A;  4DV0 Q;  1K3R A;  1JC7 A;  1EU3 A;  1HFG A;  1BCP F;  1VF7 A;  2R7Z G;  2HIV A;  2K03 A;  1SNQ A;  4DAY A;  2IL8 A;  2LXK A;  4CJ1 B;  4RGO S;  4FXG C;  3KJO A;  2F0W A;  2EY1 A;  2BDO A;  4HJ5 A;  1PRT D;  5GRO A;  4DAV A;  4GKK L;  1HZC A;  4KK7 A;  3OOC A;  1TWF B;  4S3S A;  4BY7 H;  2JEB I;  4FXD A;  2B2T C;  4KJO A;  4KY5 A;  3CQZ B;  3CPF A;  3SK5 A;  4K0K Q;  3S1N H;  3H09 A;  2K4K A;  4DXG A;  3PUW A;  3I70 A;  1STE A;  5IYB G;  4JI1 L;  1TWC B;  3G6E A;  1CI3 M;  1RL2 A;  4CGY B;  1SND A;  3URY A;  1Y8P B;  4YHH L;  1YBY A;  4IUQ A;  3K7A H;  3HOX B;  2BA1 A;  1D5Z C;  4PZ7 A;  1WCM H;  3T51 B;  3PO2 G;  2J7Z A;  1LTG D;  1ENA A;  2WKC A;  1STY A;  5M3M G;  1B70 B;  3CCR A;  1XNR Q;  1NR4 A;  4FF4 A;  1K9M C;  2Y0S G;  4KD3 A;  5JEA G;  4A3J H;  3HZX A;  4RHS A;  3HS0 C;  2JN4 A;  1Q12 A;  2PI2 A;  1NNX A;  4OX9 Q;  5EAY A;  1N8R C;  4CDC C;  3FMC A;  3NWT A;  3M4O H;  1SYD A;  4LF7 L;  1QNK A;  1IBM L;  2NYZ D;  4LW1 A;  4TRD A;  4DV3 Q;  1LO5 D;  3F2U A;  4BBS G;  4N8X 1;  2ZM6 L;  1VQI A;  3M3Y B;  4GOP B;  3DEP A;  1LT5 D;  4PNY A;  4KLK A;  1IBK Q;  3WOF A;  1FVI A;  2Q8R E;  4DV1 L;  1XMO L;  3EVQ A;  1XJV A;  2WP8 J;  1VMC A;  1C48 A;  1SE3 A;  3TP7 A;  4O0A A;  3S17 H;  3JAM E;  2DY7 A;  2A69 C;  1S4Z A;  2NVY H;  3MXN A;  1Z47 A;  5IT9 L;  1ET6 A;  3M7G A;  1AFP A;  3CKI B;  2MQH A;  5FJ8 H;  3HOZ G;  4A3I G;  1XNQ L;  2J4X A;  2QW7 A;  4XQN A;  4DR5 Q;  1TWF H;  4DV4 Q;  4IOC A;  1C7Y A;  2F0U A;  2NVX H;  2R6G A;  4HIO A;  3OMG A;  2ZJQ A;  1VQB A;  3CC4 A;  3A5U A;  5FLX E;  4DV6 Q;  1I50 H;  3UDG A;  1N34 Q;  3NHH A;  3GTL H;  3D4W A;  4QL5 A;  4DV2 Q;  1BO0 A;  3NEM A;  2HHH L;  1MKH A;  3D6W A;  2PQA B;  2YTV A;  3A8J E;  1DOL A;  4Q0F A;  4K5V A;  2Y0S E;  4C3I H;  1R4Q B;  2ZJP A;  1KDC A;  4KKS A;  4QUF A;  5M5W B;  3F2D A;  1M4V A;  1XXG A;  1SRU A;  1B8A A;  1L1O C;  4KD4 A;  3UDI A;  4G7O C;  4K0K L;  1X3E A;  4BA2 I;  3W1B A;  2R7Z B;  3J7Y W;  1HNW L;  4O1N A;  3AMU A;  3A55 A;  1EY5 A;  4PMC A;  4WJW A;  5DAU A;  1YI2 A;  1D6E C;  2X6G A;  4XXE A;  3QOJ A;  1BKB A;  1TWH B;  4TVA B;  4X3K A;  1N36 L;  3MFY A;  5KND A;  1PVO A;  4GLV B;  5LHY 1;  2F03 A;  2D0O A;  5KGU A;  1LAB A;  3CCE A;  2Z6B A;  3TQY A;  3MXN B;  2ZTC A;  2KEN A;  1VQK A;  4UDU C;  4A75 A;  1JOQ A;  4QY7 A;  5IGF A;  3CF5 A;  1Q81 C;  2ZTE A;  4K6D A;  3S17 B;  4JI7 Q;  3J80 i;  2V4D A;  2MGS A;  1W6J A;  2RF4 A;  2K14 A;  3OHX C;  1WTQ A;  3AB9 A;  3HKZ B;  1EWH A;  3KDF B;  1EQT A;  4LMQ D;  1XNQ Q;  4ZAI A;  5E3F A;  1KL9 A;  4A3F B;  1VQD A;  1FR3 A;  2VL6 A;  5EGT A;  1BXT A;  4N9P A;  2FXQ A;  1BCP B;  4P74 A;  1F9S A;  2A68 C;  4B3S Q;  3C2P A;  1QZH A;  1LTR D;  2XVS A;  4BBS H;  3ERQ A;  5CC4 A;  1TWG B;  1J8I A;  1YJW A;  2VQE L;  4PQX A;  1GO3 E;  3SE0 A;  2E5L Q;  2BE5 C;  2EXD A;  2JA7 H;  1D5M C;  1WFQ A;  1A6X A;  3M4O B;  3CC2 A;  3PV0 A;  2K32 A;  3S16 B;  1I6H H;  5LMU L;  2L55 A;  2X6L A;  2NVQ B;  1HJP A;  5JEA H;  1SJE D;  4QCL A;  4HJ8 A;  4WJ3 M;  1O7L A;  2F0H A;  4Y7N H;  2HIX A;  3E5S A;  1KDB A;  5I2X A;  3KJP A;  4BBR H;  1MD2 D;  1Q8I A;  4B9W A;  5JVH 3;  1HRJ A;  2JA7 G;  5IP7 H;  3OYY A;  1JWS D;  2RHQ B;  2JA6 H;  3HKZ G;  1K0S A;  3QG1 A;  4B9X A;  4XYO A;  1DON A;  4OWW B;  1X3F A;  2M00 A;  3I4O A;  3PUX A;  3CQZ H;  5GAE C;  1DJR D;  1NCV A;  3GTQ B;  1IXR A;  2CQA A;  3PIP A;  5K36 H;  2A6H D;  4PMW A;  1JOR A;  3JAM L;  4U67 3;  4JK1 C;  3K7U C;  1FNW A;  4H02 A;  4EQO A;  1GUO A;  3P75 A;  5GAG C;  2A19 A;  1W3S A;  2Y0S B;  1FD7 D;  4R9W A;  2H1E A;  3A0J A;  1V1P B;  4PG3 A;  2RDH A;  2CW0 C;  1SYB A;  3DHQ A;  2EJM A;  1Y69 U;  4C1N K;  5M9O A;  4FVM A;  1PH8 A;  4YHH Q;  4FDB A;  2PW5 A;  4M8A A;  3PUV A;  1CHQ D;  2K7V A;  4A3D G;  2MO0 A;  2DNE A;  1E2W A;  1YVC A;  2HQE A;  2A6H C;  5M3M H;  3CU7 A;  3FPU B;  3GD7 A;  3IRB A;  1V9P A;  1OXT A;  4LF4 Q;  1NUC A;  2OT2 A;  4K5X A;  5C4J H;  1PZJ D;  3I55 A;  1W6K A;  2CFM A;  4HMI A;  2JA8 G;  1BOS A;  1B9N A;  2MFI A;  3IFD A;  4IUP A;  2BDN A;  1WVL A;  5CV5 A;  5C4J B;  1ML0 D;  3KLR A;  1NJI C;  1Q1E A;  3NQI A;  1VQ5 A;  2XNA C;  3HFZ B;  4A3K B;  2IX3 A;  2EY6 A;  3NTK A;  3J80 L;  2JA8 H;  1CKN A;  5C4X B;  4LFB Q;  5GQO A;  4BXX H;  4A3M G;  4CBV A;  4R8N A;  2WB1 G;  2NN6 I;  1B3A A;  2LKV A;  2F1M A;  3E0E A;  3I56 A;  3RLO A;  1I4P A;  4A3E G;  4YWK A;  2C5C A;  1NY4 A;  2YU9 H;  3KF8 A;  4A4I A;  3CCU A;  1VQ6 A;  5BR8 L;  4LF8 L;  3CD6 A;  1YHA A;  3T16 A;  4IFD G;  1CSP A;  4A3D H;  4JI7 L;  2R7Z H;  2B8F A;  3HRZ C;  3K5M A;  2F0M A;  2JA6 B;  2LMC B;  3VYR A;  2PNH A;  4FXK C;  2RVL A;  3J81 i;  1TU2 B;  4N9T A;  2K5W A;  3HEJ A;  4A3I B;  1U5K A;  5FLM H;  3FEW X;  1X6O A;  3BYT B;  3GTG H;  3PIO A;  3S1Q B;  2FHT A;  2UXD L;  1CKN B;  2HCI A;  1F77 A;  1WTH A;  1D1K A;  1CKO A;  3M7N A;  3M3Y H;  4FYD A;  4JI2 L;  4LFA L;  3S1Q H;  3MEF A;  1YNN C;  2AKW B;  4RMF A;  1PLF A;  3EBE A;  1V1Q A;  2IPK D;  2NUC A;  5CV8 A;  3G71 A;  1HTL D;  1XPR A;  3AEV A;  3CME A;  4G7H C;  2CKZ B;  1IW7 C;  3H3V C;  2A69 D;  2OEO A;  2JA7 B;  1FNU A;  4WJ4 A;  1MJC A;  1BNZ A;  4KN7 C;  2F3W A;  2K28 A;  1ZXT A;  1BCP D;  3HOX G;  1QOH A;  4MNO A;  3K57 A;  1EQR A;  1L0X B;  2BE5 D;  3FP9 A;  3KLS A;  3DLL A;  3H3V I;  1PYB A;  4YCU A;  1K8M A;  2R93 B;  4LF5 L;  4NXM L;  2CCZ A;  2OXP A;  1S5D D;  3MAQ A;  5JOB A;  1W2B A;  1TQO A;  4A3G H;  4K5W A;  1M90 C;  3GTM H;  3RZO B;  4DNI A;  3RLF A;  2NBF A;  1U9R A;  5FLM G;  1DXM A;  2G5D A;  3H15 A;  4EQN A;  2F0Q A;  3HKS A;  4A3B B;  2A6E D;  4JI8 L;  1DCZ A;  2PYK A;  4DAP A;  3HOY B;  1QVF A;  4GOP A;  5EPJ A;  4IPD A;  4KI0 A;  1ESR A;  1Y14 B;  4V19 0;  4GKJ L;  4ZKC B;  1B4O A;  2RDG A;  1Y1W H;  4JI1 Q;  3TDQ A;  3H0G B;  4C3J B;  1N34 L;  3S2H H;  1JJC B;  1YNJ C;  4OHJ A;  4NXN L;  1C4Q A;  1WCM G;  1JQY D;  3G48 A;  1HZB A;  3RNU A;  1B50 A;  4L8J A;  3HOV G;  4K8I A;  3KK7 A;  5IWA L;  3TP8 A;  4NW2 A;  5C44 H;  1SFO B;  1ICW A;  1KAB A;  5DNF A;  3TME A;  1VQ9 A;  5GAH C;  1TS2 A;  5NUC A;  1EIG A;  3KUP A;  3FHW A;  1GOZ A;  4JBM A;  1PH6 A;  1PV4 A;  3N52 A;  4JI3 L;  4R8I A;  1SNP A;  3RZO H;  2UXB Q;  4H7B A;  1A0I A;  4IN3 A;  3G7L A;  2IWH A;  4CKE A;  3OWF A;  3PUY A;  4DV3 L;  2E2I B;  4UAI A;  4HAE A;  3G4S A;  3K59 A;  3CRK C;  4O42 A;  1B44 D;  3C1E A;  4OON A;  4QF4 A;  1EFW A;  4CHT B;  5M5Y B;  3VA5 A;  3W5O A;  5I6Y A;  1IBK L;  4F88 A;  2E2D C;  5BN4 A;  2ZJR A;  3ITP A;  4DR4 L;  1WTV A;  4RWS C;  4A93 B;  2HQL A;  4DNT B;  4K8J A;  2PQE A;  4KV6 A;  2OQK A;  4BWG B;  1MBY A;  5C4Z A;  2PZW A;  4ZRZ A;  2UUC L;  3FRP B;  2L1B A;  3SEB A;  2R93 H;  2ID0 A;  4P73 A;  4X64 Q;  5EKL A;  5LL6 S;  4HJA A;  5JAV A;  1PYW D;  4IUN A;  4JV5 L;  4DAM A;  3NXW A;  4X66 L;  4ZK9 B;  3MZ5 A;  1GM5 A;  5IYD G;  1K8A C;  5C3X A;  1HA5 A;  2PI2 E;  3R2T A;  3CMA A;  5ELO A;  1NAP A;  3I73 A;  2E76 C;  2KJX A;  1V8Q A;  2IHE A;  1F9Q A;  4FNF A;  4A3K G;  5IYD H;  1EIF A;  1SYE A;  4EX5 A;  4G4K A;  3M4Q A;  1SAP A;  2K5H A;  4DUY L;  4H44 C;  1MSG A;  4UP9 A;  4BXX G;  1VDZ A;  5D65 A;  2OTJ A;  4DXF A;  3A8I E;  4OXP A;  1HUM A;  3NSW A;  4TSS A;  4HIM A;  4F87 A;  3CPW A;  1YIJ A;  3K80 C;  4JBK A;  2K50 A;  1BBU A;  4K2L A;  4DR3 Q;  1RCV D;  4RFB A;  4U68 A;  3DUZ A;  1GJX A;  1OO9 B;  2JK8 A;  5DM6 3;  1YJN A;  1PH5 A;  1XPU A;  2QEJ C;  1SNC A;  2B2Y A;  4XQJ A;  3RZD H;  4MTN A;  1SE8 A;  1ZYR D;  1TWA B;  1O80 A;  5CGK A;  3HOW H;  2KCM A;  3OSO A;  4QUC A;  1FGU A;  4GLA C;  2ICI A;  4AQY L;  4JI4 Q;  4RCO A;  1A8V A;  3J81 j;  3C46 A;  1GUW A;  1K0R A;  1PRT C;  4A3K H;  4MHE A;  5EBC A;  4DV0 L;  2CH4 W;  5AJ3 Q;  4KMU C;  1JE4 A;  1UE1 A;  1OXV A;  3GTL B;  3BVZ A;  5ELB A;  4DV7 Q;  1S3O A;  4F7X A;  2SOB A;  2SNM A;  4LFB L;  3FVQ A;  3A54 A;  1Q8K A;  4JI4 L;  4A3F G;  2VUM B;  4A3M B;  1LT6 D;  4P71 A;  2KCN A;  2XRS D;  4NP5 A;  4JI0 Q;  1A2T A;  3ULJ A;  3S1M H;  4A3G B;  1STH A;  4BY7 G;  3RUZ A;  4TQU S;  1EYG A;  2JSO A;  3NPP A;  2UU9 L;  5LMN Q;  2ATW A;  1CZG A;  1JMC A;  2IX1 A;  1Q86 C;  1V1O A;  3LNN A;  2DUD A;  3KBG A;  3IAY A;  1I6V C;  2EJF C;  4XQQ A;  1LM0 A;  2NZ1 D;  4QIW E;  5IP9 H;  2Q2T A;  3F1Z A;  2I07 B;  4K2K A;  1HR0 Q;  4QIW B;  1HR0 W;  3HOU G;  4JYA Q;  3OTO L;  1E3P A;  4BBR B;  1OTC A;  2AWN A;  4QMG A;  3K58 A;  2K52 A;  4LF6 L;  1JJ2 A;  3PIO 3;  3GTM B;  4C3I B;  1JT8 A;  2KHS A;  2XWB B;  5KYI A;  4DV4 L;  1EY8 A;  2FMC A;  1YHQ A;  3HOW B;  4YIJ A;  4B3M L;  1L1O A;  2D0P A;  2VQF L;  2UUA Q;  4RGN A;  4Q5V A;  3NE5 B;  4HJ7 A;  1I50 B;  5FKA C;  2CQO A;  5D14 A;  1WYD A;  5CYU A;  2ZT9 C;  4A3B G;  1RJT A;  1PXU A;  3I91 A;  4DKA C;  3BU2 A;  2F0P A;  2XTI A;  5F2D A;  3MFG A;  2JP1 A;  2BOS A;  4NPS A;  1HZA A;  1A2U A;  1SBB B;  2DN8 A;  2KEE A;  3KLS X;  5IE8 A;  1KC8 C;  4RGM A;  1Q46 A;  4YY3 Q;  3DXJ C;  3K5O A;  1G6P A;  1HNX L;  1YEZ A;  4NDX A;  2E2I H;  4XT3 B;  3TZU A;  4X66 Q;  4UHV A;  1CFM A;  1EFI D;  1KNE A;  1EY0 A;  5LL6 X;  1EZ8 A;  3WWV A;  3NUC A;  3TRE A;  4P75 A;  1TS4 A;  2NZH A;  1DYQ A;  3T1H L;  4A93 H;  5JJZ A;  2IY5 B;  2Z6K A;  4UP8 A;  1SR3 A;  3N6R A;  1OXX K;  1EQQ A;  3NTI A;  2K5D A;  5C3E G;  5C5M A;  3OTO Q;  1N32 L;  1EL0 A;  2F0F A;  4G57 A;  3X3N A;  4JW0 A;  1C0A A;  2CH4 A;  3CHB D;  3L2P A;  2BH2 A;  3SDZ A;  1SYF A;  1U4M A;  4RH6 A;  4DUZ L;  4A3L H;  3MXU A;  1G51 A;  2D9U A;  4DV1 Q;  5IYC G;  3TN2 A;  1XMO Q;  3K5N A;  1X32 A;  2JA8 B;  1HZ9 A;  1EYC A;  1Q3L A;  2XSC A;  2Z0S A;  3D4R A;  4LWC A;  5DLQ E;  2PCF B;  3OIP A;  4ZKB B;  1EZ6 A;  3S24 A;  2GN5 A;  4RHR A;  5J1Z A;  4L5R C;  4A3B H;  1BF4 A;  4GLX A;  2CWP A;  5M5Y H;  3FKI H;  3KFU A;  1IKL A;  2EPB A;  1RKN A;  4BY7 B;  3PCO B;  4DR5 L;  1YNJ D;  3UI2 A;  3MXP A;  4DPG A;  2PW7 A;  5CBA E;  3T13 A;  2WB1 B;  1QVG A;  5K5P A;  5IWA Q;  1EY4 A;  2WB1 E;  4OWT B;  4XYQ A;  2JA5 B;  1F9P A;  1PMR A;  2C35 B;  2BCO A;  3AFQ A;  4DGZ A;  4DK1 A;  1JB7 A;  3S16 H;  1HPC A;  5KYL A;  1PA6 A;  3R8B A;  2LSS A;  3F2C A;  1E2Z A;  2I5L X;  2PZU A;  3VDY A;  2Z4I A;  4RA8 A;  2R92 H;  1RTN A;  2GA4 B;  1EQV A;  3U9S A;  3HGB A;  5FO8 B;  5IIF A;  5JPN C;  1B53 A;  3NEN A;  5COY A;  5T1I A;  5T1G A;  2VXW A;  1I3Q H;  3LGJ A;  2OWO A;  1YJ9 A;  1ENC A;  1D2B A;  5CV9 A;  3EFX D;  3O13 A;  2K6A A;  2L11 A;  4Z9C B;  3I4M G;  2QEX A;  4JV5 Q;  4JI6 L;  3U4Z A;  5LMN W;  2EYH A;  4CJ0 B;  5I2Y A;  3IFT A;  4MZ9 A;  3CW2 C;  4AIM A;  3J81 E;  1CM9 A;  1A63 A;  3K0X A;  5C0X G;  3HOU B;  4TKO B;  1GUN A;  2YU9 B;  1ESF A;  2A8V A;  5LMU Q;  3TSS A;  5FOB B;  2Z8L A;  2UUB Q;  1Q82 C;  3QJY A;  1I94 L;  3BYY B;  5C0X H;  1RHP A;  4H0L C;  3U58 A;  3M85 A;  2JQO A;  1D5X C;  2F0T A;  4GNX B;  2VQE Q;  3J7A V;  1K8O A;  3BS1 A;  1LAC A;  5KRU A;  4OWX B;  1X3G A;  5EBD A;  3QR8 A;  5IGD A;  1STA A;  4J15 A;  1WOC A;  1QZG A;  4RKL A;  2UUC Q;  3H94 A;  3P7J A;  1FGB D;  2EVB A;  1HQR D;  5IT9 E;  1R9T H;  4IUU A;  4RKB A;  1AN8 A;  3M4P A;  5M3F G;  1I3Q B;  2TSS A;  4KHZ A;  2K01 A;  4R1J A;  4LFA Q;  4JI2 Q;  1PZK D;  2F0G A;  2O4X A;  2E2H B;  5CV6 A;  4IQZ A;  2PMZ B;  1RF2 D;  1ZEQ X;  3I3C A;  5A2Q E;  1AEX A;  5ELN A;  3QO2 A;  4IJH A;  1HNZ L;  5AJ3 L;  1PH7 A;  2F0N A;  1VQM A;  3LWE A;  3SK4 A;  2K5N A;  2B39 A;  1PFB A;  3TEH B;  5IYB H;  4X65 Q;  4GZY C;  1SXT A;  4R4T A;  2G9H D;  5GAD C;  3DWA A;  1E7Z A;  4KJN A;  3PSI A;  4A3J B;  4LNQ A;  1FNV A;  2K1B A;  4F8M A;  4JBW A;  1VQ8 A;  1TY0 A;  3BDL A;  1LTI D;  2VQF Q;  1IBL L;  2WAC A;  3GDE A;  3PO3 H;  4IUV A;  3GQB A;  1PTO H;  1MHW C;  2AMC B;  4KY7 A;  5DEH A;  1Z7T A;  3T53 B;  1S72 A;  1G91 A;  1SNM A;  3KF6 A;  4P2C B;  2LY7 A;  1CQF A;  1GUT A;  2RKS A;  3CAM A;  5D3I B;  1J5E Q;  3DWP A;  3V2T A;  2R7F A;  3P1H A;  4OIJ A;  1E0B A;  2B8G A;  3I4N G;  3L3O C;  2F0K A;  2JA9 A;  1SNO A;  3R93 A;  3WDN A;  2B2Y C;  2E5L L;  1TVX A;  4FF2 A;  2J0T D;  1AZP A;  3UE1 A;  1X3P A;  1VQE A;  4E6I A;  1IBM Q;  4HJ9 A;  4IZ8 A;  1AE2 A;  4WOR A;  4DFA A;  3W3A A;  1PRT F;  1Z6H A;  3L7Z C;  2RCF A;  4NXN Q;  4RCN A;  4OGQ C;  3RN2 A;  1D7Q A;  2L12 A;  5E4W C;  3GTQ H;  2WAQ E;  3JC6 6;  1MIU A;  4L5S A;  1PFM A;  3I4L A;  5IGB A;  1FJG L;  1NMG A;  3DMU A;  4X64 L;  1ROD A;  5C3W A;  1CHP D;  4I7Z C;  2OTL A;  1F2M A;  4UY8 C;  1CTM A;  4MTK A;  4HID A;  3CCJ A;  5M5W H;  2GVB A;  1AE3 A;  4J6H A;  4UP7 A;  1EU4 A;  2F0L A;  1VS0 A;  2OCE A;  3OMC A;  3NK9 A;  1A3U A;  4IJL A;  4C2M H;  5H1S E;  4ULL A;  2RCN A;  5EPL A;  3OW2 A;  1DD2 A;  2EIF A;  1DGS A;  3GTO B;  3UE0 A;  2NVT H;  1HNX Q;  2H5X A;  3AU7 A;  5TSS A;  2WIN B;  4QJF A;  4EQ5 A;  3PUZ A;  3HOW G;  1LYL A;  4FP5 D;  4HSV A;  5AFW A;  4YWL A;  3H3V H;  5A35 A;  3CC7 A;  2AQ2 B;  3UDF A;  1D8L A;  2NN6 G;  4K6L A;  3K8A A;  3CCS A;  3F2B A;  4B3M Q;  1SE4 A;  4KHV A;  3SR1 A;  1NTG A;  3ONA B;  1E1T A;  4ABN A;  4HSP A;  2V1C C;  2O2L D;  1NBW A;  4JI0 L;  2D62 A;  5ELE A;  5CMD A;  3K0Y A;  4A3F H;  1XPO A;  4HCE A;  2AHO B;  3JAM c;  3HP3 A;  4LF4 L;  1XWE A;  1J6Q A;  4H13 C;  4OO1 I;  2JXM B;  1UEB A;  2F0V A;  2KCC A;  2XIW A;  1Q1B A;  5COR A;  5J3B A;  1WTX A;  3Q24 A;  1E1O A;  5IGE A;  3J80 c;  4FF1 A;  2JEA I;  1EUJ A;  4JPB W;  1TWG H;  2ALY B;  4LF9 L;  2F4V Q;  1UUP A;  3VYU A;  4BBS B;  4MN3 A;  3LWU A;  2MNA A;  1YZ6 A;  4YWM A;  1L2F A;  2F0S A;  3NBI A;  5C5L A;  4KTA A;  4DAY B;  3E6Z X;  1O7I A;  5L37 A;  4NXM Q;  4JCV E;  5JEA J;  3ERO A;  3GTP B;  3BDO A;  1BCP C;  4ALP A;  2ZTD A;  1A3V A;  2AUK A;  2Q8T A;  4L5Q A;  2PNR C;  3RR5 A;  5C0X J;  4X62 Q;  3S1R B;  2UUB L;  1IW7 D;  3V05 A;  1V1P A;  3M9B A;  5A2Q L;  2EQS A;  1TWA H;  4DV5 Q;  3CCV A;  2RSN A;  1TR5 A;  4R4C A;  3NP8 A;  1J5E L;  3S9W A;  4DR4 Q;  1LTS D;  2IW3 A;  2JYO A;  1WJJ A;  3ND8 A;  1EY7 A;  1SMY C;  1MJE A;  5E7N A;  3I4M H;  1JWM D;  3J80 E;  2N49 A;  1VQF A;  2H4O A;  4DV2 L;  2KOL A;  2K33 A;  1B9M A;  5M3M B;  4LAA A;  1HR0 L;  5DM7 3;  4IPG A;  5HY6 A;  1N33 Q;  2X69 A;  4A3C H;  3HG9 A;  2I5M X;  4BA1 I;  2NVY B;  4B3T Q;  3W2D A;  2IHF A;  4KKU A;  5IGG A;  1G2S A;  1RD9 D;  2AQ1 B;  4OX9 L;  1M1K C;  1QIL A;  2JA5 G;  1YNX A;  2B3G A;  5FO7 B;  3QOL A;  2UXB L;  2NVX B;  4IFD J;  1WTR A;  1HH2 P;  1X55 A;  1Y8N B;  2KHI A;  4OEM B;  3OW7 A;  4YCV A;  3CCQ A;  4X6A H;  3T1Y L;  1E22 A;  2QIL A;  1EY6 A;  3PMF A;  3MXG A;  2YYZ A;  1SEB D;  1BVS A;  1Y1W B;  1II3 A;  4DK6 C;  2UU9 Q;  1KAW A;  2HHH Q;  1IL8 A;  4R4O A;  1PHJ A;  5CR3 A;  3EN2 A;  2NVQ H;  1VQO A;  1QUQ B;  3EJI A;  2HDL A;  4ZCK A;  1VQG A;  1H9M A;  4DR3 L;  4R4Q A;  3R3O A;  1KDA A;  4GS3 A;  1GXD C;  2F0D A;  3T1Y Q; 
#chains in the Genus database with same CATH homology
 5KEE A;  1QJO A;  4BY1 B;  2KVM A;  2RBM A;  4M1U B;  3H6M A;  2XRQ D;  5J22 A;  3WOE A;  2ENB A;  2MJ8 A;  2EOT A;  3BG3 A;  1QG7 A;  1B2T A;  4BS9 A;  2QCP X;  1UAP A;  3MHB A;  1M8A A;  3LX0 A;  2IJ0 A;  5EJW A;  5E1F A;  2R61 A;  4RGT A;  1I4G A;  1O7Y A;  5I4D A;  3T4A C;  5HGT A;  3IKJ A;  1B1Z A;  1BDO A;  3S2D B;  1JWU D;  2AUJ D;  2EYM A;  1SYG A;  3BDC A;  4IAL A;  4A3D B;  1T5X D;  4MIU A;  3K6O A;  4NKL A;  1DOM A;  1PZI D;  2KUM A;  2EY5 A;  2F4I A;  4HED A;  5KIX A;  1KLU D;  3X3M A;  4C56 C;  2AQ3 B;  3VR5 A;  4DU9 A;  3MA2 B;  1F2L A;  4QB4 A;  2A5H A;  3I72 A;  1HCZ A;  3D6C A;  2EZV A;  1VMP A;  1IKM A;  2KQ3 A;  1CA6 A;  2A73 B;  2HDM A;  3GTJ B;  1EOT A;  4KKT A;  3S1M B;  3QIA A;  2RDF A;  4CKB A;  1S5F D;  5FLX L;  1FYC A;  2EXZ A;  3K5L A;  5EKK A;  1I6H B;  2EYP A;  2B63 B;  5IOC A;  2B2V C;  3OIQ A;  5HUR A;  2R3Z A;  2VB3 X;  2N88 A;  2K05 A;  1O7Z A;  1SJH D;  2L9H A;  1JOO A;  3G6J B;  3PIP 3;  3E0J A;  3R2I A;  1JIC A;  4ZLT F;  3TP5 A;  3SHL A;  1QWY A;  2SEB D;  1L0Y B;  2B2W C;  3MEH A;  4OO1 H;  2NWG A;  5FK9 C;  3P20 A;  1QNU A;  1D1I A;  1T5E A;  1WCM B;  2OF1 A;  4A3E B;  4ZUJ A;  1PTO F;  1QE6 A;  3A56 A;  2B2V A;  1H9R A;  1QCB D;  1EYA A;  1CA5 A;  1HXY D;  2PPB C;  4FF3 A;  4LJZ C;  1I4R A;  2WV6 D;  4IFD H;  1SYC A;  1XYI A;  2M9V A;  1IYU A;  1HA6 A;  1G6Z A;  3M4Y A;  1MGS A;  3VR6 A;  3BVG A;  2KEC A;  1PTO B;  2M2L A;  2CW0 D;  2G9D A;  4ZQ3 A;  1UNS A;  5CV7 A;  2K5Q A;  2BA0 A;  1GUS A;  5ELC A;  1I4H A;  1CZW A;  3TBI B;  3Q22 A;  1F9R A;  1WTP A;  1F2Z A;  3MWY W;  5G3L F;  1JR0 D;  5CBE E;  2ZXR A;  3Q0A A;  4PMB A;  3D4D A;  1LTA D;  1TS3 A;  3K7A B;  1A3T A;  1GHJ A;  5D3D A;  2KED A;  3MC0 B;  5I9P A;  2FFK B;  1JOK A;  4ME5 A;  5ELF A;  3S1N B;  1SMY D;  3HOZ B;  2AWO A;  1XX8 A;  3FPP A;  1PDQ A;  2O5I C;  3DM1 A;  4Y7N B;  2PO4 A;  1F2Y A;  2NTS A;  3OPO A;  4G7Z C;  1LTB D;  3A8K E;  3VYS A;  1I4Q A;  2HCC A;  3FDT A;  4J1M A;  4DNR B;  5EKI A;  2K04 A;  3V96 A;  2EY2 A;  2Z1C A;  4OIK A;  5IOD A;  5C44 B;  4PV1 C;  1H9S A;  5EQ0 A;  3T56 B;  1KLG D;  2RA4 A;  4HCS A;  1SDF A;  2EE1 A;  2HUG A;  3U9O A;  2C9O A;  1U4L A;  3ND9 A;  2EJG C;  4C3H G;  3GP7 A;  3RZD B;  4EQP A;  1EYD A;  1HTP A;  3KBX A;  1GUG A;  1R4P B;  3VR2 A;  1ZYR C;  4L63 B;  1XTC D;  2F0E A;  2EYJ A;  5ELD A;  3J81 L;  1ILQ A;  1BBX C;  1AW7 A;  2ICE C;  1H9S B;  4AYB B;  5C0X I;  3I90 A;  5M3F B;  4EGV A;  3EA6 A;  1BR9 A;  2NN6 H;  3DEO A;  3OWE B;  3GTK B;  1PRT B;  4WFN 3;  3I4M B;  1G29 1;  3J7A F;  1STN A;  2TMP A;  1JB3 A;  2RSO A;  4HMJ A;  2D5D A;  1OXS C;  4ID6 A;  1JCK B;  3QWN A;  1MI2 A;  4KY6 A;  4I65 A;  4ZUI A;  1G8Z D;  1DM0 B;  1SSO A;  1Y8O B;  5FO9 B;  1IHZ A;  4XTC S;  4C3H B;  3EQL C;  2L0C A;  1ENF A;  2XN9 C;  1C8C A;  4X3S A;  1Q90 A;  4CKC A;  1YNN D;  2SDF A;  2LFN A;  1DZ1 A;  2B2W A;  2MPM A;  4IFD I;  1I4X A;  1EEF D;  1RDP D;  1HHV A;  1KTK A;  2QF7 A;  1WTW A;  4EVO A;  4RAU C;  3D8G A;  4C3I G;  1KAA A;  1Y1V B;  5G3L D;  2MUY A;  3A7L A;  1V43 A;  2N55 A;  2JE6 I;  5KNB A;  1S5C D;  3I4N B;  2L4N A;  2EYO A;  1STG A;  2PZT A;  1E2V A;  2A6E C;  5E4X A;  3SVM A;  2NVT B;  3VR4 A;  3PO3 B;  1TKW B;  3QB3 A;  1WTO A;  1GHK A;  3RD4 A;  4ODG A;  3FKI B;  3RMH A;  3D31 A;  2FJ2 A;  4DF7 A;  1VCI A;  4XDX A;  2WII B;  1CK1 A;  1DOK A;  2E74 C;  2VB2 X;  4DA2 A;  2MP1 A;  2Q8I B;  4FO2 A;  3VR3 A;  4V0B A;  3A7A B;  5JVG 3;  3CRL C;  4ILW A;  1HFN A;  1NR2 A;  1TY2 A;  1EIH A;  4IUT A;  1U4P A;  2F0O A;  2CVR A;  1CT1 D;  2B2U A;  1O78 A;  5J39 A;  4IUR A;  5K36 G;  1LV9 A;  1ZKO A;  4J8Q A;  1CQV A;  5JPM C;  2FMM A;  2KA7 A;  5M5X B;  1H9J A;  4HTH A;  5IGC A;  2DY8 A;  1LT3 D;  1BUV T;  1AZQ A;  1UEA B;  1LTT D;  2ZXO A;  1VF5 C;  5KNC A;  3TP6 A;  1X3Q A;  4CJ2 C;  3NQT A;  4C2M B;  1EEI D;  3SK8 A;  1WD0 A;  1LLR D;  5EPK A;  3C1F A;  2E2J B;  1HQM C;  4KN4 C;  1G2T A;  1ONL A;  2SNS A;  4OO1 G;  3MTS A;  3SXH A;  1TII D;  3TZD A;  1STB A;  2I46 A;  1SE2 A;  2D2C C;  4C3J G;  2B2U C;  1HUN A;  2NB0 A;  1EWC A;  3PO2 B;  2IT1 A;  4OL7 A;  3GV3 A;  1EY9 A;  3S15 B;  5CV4 A;  2QDB A;  4X3U A;  3S2H B;  4LK1 C;  1R9T B;  2A68 D;  4DN4 M;  2F3V A;  1J9O A;  3H91 A;  3HOV B;  2EDG A;  2ZXP A;  2A74 C;  4HR7 B;  4C1N I;  3S14 B;  2XWJ B;  5C6A A;  5C3E B;  1A15 A;  1QB5 D;  3D3R A;  2FIN B;  3MVV A;  2E75 C;  3VYT A;  2F0I A;  1TS5 A;  5BN3 A;  2O5J C;  1K83 B;  4B08 A;  1MSH A;  2RQX A;  4HN7 A;  2VNU D;  5I6W A;  3ZYY X;  4NMZ A;  2IX0 A;  4L6T B;  3GV6 A;  1S5E D;  5BN5 A;  2WKD A;  2LS0 1;  2F0J A;  3IL8 A;  3BZD B;  3L9A X;  5ISR A;  4XT1 B;  3Q6S A;  1RTO A;  1ET9 A;  4XIG S;  2DNC A;  1ILP A;  5C4H A;  1KNA A;  1PTO C;  3GTG B;  3VA7 A;  1NSN S;  3NBH A;  3Q23 A;  3C3L A;  2B2T A;  3NTH A;  3SK6 A;  2MHV A;  2EYF A;  3DWQ A;  1U4R A;  4WRD A;  1TT2 A;  4K14 A;  1LT4 D;  3I8Z A;  4ZYS A;  3BVM A;  5I9O A;  2CHB D;  2L5T A;  1OXU A;  2WAQ B;  2QKI C;  1S5B D;  1WD1 A;  3NWS A;  3GO5 A;  2NTT A;  1BQQ T;  1PTO D;  2EYL A;  2Z4H A;  4X3T A;  1AP0 A;  1PFN A;  4DK0 A;  1H9K A;  2R92 B;  1IYV A;  1JC7 A;  1EU3 A;  1HFG A;  1BCP F;  1VF7 A;  2K03 A;  1SNQ A;  4DAY A;  2IL8 A;  4CJ1 B;  4RGO S;  4FXG C;  2F0W A;  2EY1 A;  2BDO A;  1PRT D;  4DAV A;  4KK7 A;  3OOC A;  1TWF B;  4S3S A;  2JEB I;  4FXD A;  2B2T C;  4KJO A;  4KY5 A;  3CQZ B;  3SK5 A;  3H09 A;  4DXG A;  3PUW A;  3I70 A;  1STE A;  1TWC B;  1CI3 M;  4CGY B;  1SND A;  3URY A;  1Y8P B;  4IUQ A;  3HOX B;  2BA1 A;  1D5Z C;  3T51 B;  2J7Z A;  1LTG D;  1ENA A;  2WKC A;  1STY A;  1NR4 A;  4FF4 A;  4KD3 A;  5JEA G;  3HZX A;  4RHS A;  3HS0 C;  1Q12 A;  3FMC A;  3NWT A;  1SYD A;  1QNK A;  2NYZ D;  4TRD A;  1LO5 D;  3F2U A;  3M3Y B;  3DEP A;  1LT5 D;  4PNY A;  3WOF A;  2Q8R E;  3EVQ A;  2WP8 J;  1VMC A;  1C48 A;  1SE3 A;  3TP7 A;  3JAM E;  2DY7 A;  2A69 C;  1S4Z A;  3MXN A;  1Z47 A;  5IT9 L;  1ET6 A;  3M7G A;  1AFP A;  3CKI B;  2J4X A;  4XQN A;  2F0U A;  2R6G A;  3OMG A;  5FLX E;  3NHH A;  3D4W A;  1BO0 A;  3D6W A;  3A8J E;  1DOL A;  4Q0F A;  4K5V A;  1R4Q B;  1KDC A;  4KKS A;  4QUF A;  5M5W B;  1M4V A;  1XXG A;  4KD4 A;  4G7O C;  4BA2 I;  2R7Z B;  3J7Y W;  4O1N A;  3AMU A;  3A55 A;  1EY5 A;  4PMC A;  4WJW A;  5DAU A;  1D6E C;  2X6G A;  4XXE A;  3QOJ A;  1TWH B;  4X3K A;  3MFY A;  5KND A;  5LHY 1;  2F03 A;  5KGU A;  1LAB A;  4UDU C;  1JOQ A;  5IGF A;  4K6D A;  3S17 B;  2V4D A;  2MGS A;  1W6J A;  3OHX C;  1WTQ A;  3AB9 A;  3HKZ B;  1EWH A;  1EQT A;  4LMQ D;  4ZAI A;  5E3F A;  4A3F B;  1FR3 A;  5EGT A;  1BXT A;  4N9P A;  1BCP B;  1F9S A;  2A68 C;  3C2P A;  1LTR D;  2XVS A;  3ERQ A;  5CC4 A;  1TWG B;  1J8I A;  4PQX A;  3SE0 A;  2BE5 C;  1D5M C;  1A6X A;  3M4O B;  3PV0 A;  2K32 A;  3S16 B;  2L55 A;  2X6L A;  2NVQ B;  5JEA H;  1SJE D;  4QCL A;  1O7L A;  2F0H A;  3E5S A;  1KDB A;  5I2X A;  1MD2 D;  1Q8I A;  4B9W A;  5JVH 3;  1HRJ A;  1JWS D;  3QG1 A;  4B9X A;  4XYO A;  1DON A;  2M00 A;  3PUX A;  1DJR D;  1NCV A;  3GTQ B;  2CQA A;  5K36 H;  2A6H D;  4PMW A;  1JOR A;  3JAM L;  4U67 3;  4JK1 C;  1FNW A;  4EQO A;  1GUO A;  3P75 A;  4R9W A;  2Y0S B;  1FD7 D;  2H1E A;  1V1P B;  2RDH A;  2CW0 C;  1SYB A;  3DHQ A;  2EJM A;  1Y69 U;  4C1N K;  5M9O A;  4FVM A;  2PW5 A;  4M8A A;  3PUV A;  1CHQ D;  2K7V A;  2DNE A;  1E2W A;  2HQE A;  2A6H C;  3CU7 A;  3FPU B;  3GD7 A;  1OXT A;  1NUC A;  2OT2 A;  4K5X A;  1PZJ D;  1W6K A;  4HMI A;  1BOS A;  1B9N A;  3IFD A;  4IUP A;  2BDN A;  1WVL A;  5CV5 A;  5C4J B;  1ML0 D;  3KLR A;  1Q1E A;  3NQI A;  2XNA C;  4A3K B;  2IX3 A;  2EY6 A;  3NTK A;  3J80 L;  5C4X B;  4CBV A;  4R8N A;  2NN6 I;  1B3A A;  2LKV A;  2F1M A;  1I4P A;  2C5C A;  3KF8 A;  3T16 A;  4IFD G;  2B8F A;  3HRZ C;  3K5M A;  2F0M A;  2JA6 B;  2LMC B;  3VYR A;  4FXK C;  2RVL A;  1TU2 B;  4N9T A;  2K5W A;  3HEJ A;  4A3I B;  3FEW X;  3BYT B;  3S1Q B;  2FHT A;  2HCI A;  1F77 A;  1D1K A;  3M7N A;  4FYD A;  1YNN C;  1PLF A;  2IPK D;  5CV8 A;  2NUC A;  1HTL D;  4G7H C;  1IW7 C;  3H3V C;  2A69 D;  2OEO A;  2JA7 B;  1FNU A;  1BNZ A;  4KN7 C;  2F3W A;  2K28 A;  1ZXT A;  1BCP D;  1QOH A;  3K57 A;  1L0X B;  2BE5 D;  3KLS A;  1K8M A;  2R93 B;  2OXP A;  1S5D D;  3MAQ A;  5JOB A;  1TQO A;  4K5W A;  3RZO B;  3RLF A;  2NBF A;  1U9R A;  1DXM A;  4EQN A;  2F0Q A;  4A3B B;  2A6E D;  1DCZ A;  2PYK A;  4DAP A;  3HOY B;  5EPJ A;  4KI0 A;  1ESR A;  4V19 0;  4ZKC B;  1B4O A;  2RDG A;  3TDQ A;  3H0G B;  4C3J B;  1YNJ C;  4OHJ A;  1C4Q A;  1JQY D;  1B50 A;  4L8J A;  4K8I A;  3KK7 A;  3TP8 A;  4NW2 A;  1SFO B;  1ICW A;  1KAB A;  5DNF A;  3TME A;  1TS2 A;  5NUC A;  1EIG A;  3KUP A;  1GOZ A;  3N52 A;  4R8I A;  1SNP A;  4H7B A;  4IN3 A;  3G7L A;  2IWH A;  4CKE A;  3OWF A;  3PUY A;  2E2I B;  4UAI A;  4HAE A;  3K59 A;  3CRK C;  4O42 A;  1B44 D;  3C1E A;  4QF4 A;  4CHT B;  5M5Y B;  3VA5 A;  5I6Y A;  4F88 A;  2E2D C;  5BN4 A;  3ITP A;  1WTV A;  4RWS C;  4A93 B;  4DNT B;  4K8J A;  2PQE A;  4KV6 A;  4BWG B;  1MBY A;  5C4Z A;  2PZW A;  4ZRZ A;  3FRP B;  2L1B A;  3SEB A;  2ID0 A;  5EKL A;  5LL6 S;  5JAV A;  1PYW D;  4IUN A;  3NXW A;  4ZK9 B;  3MZ5 A;  5C3X A;  1HA5 A;  3R2T A;  1NAP A;  3I73 A;  2E76 C;  2KJX A;  1V8Q A;  1F9Q A;  4FNF A;  1SYE A;  4G4K A;  1SAP A;  4H44 C;  1MSG A;  1VDZ A;  5D65 A;  4DXF A;  3A8I E;  1HUM A;  3NSW A;  4TSS A;  4F87 A;  4K2L A;  1RCV D;  4RFB A;  4U68 A;  3DUZ A;  1GJX A;  1OO9 B;  5DM6 3;  2QEJ C;  1SNC A;  2B2Y A;  4XQJ A;  1ZYR D;  1TWA B;  1O80 A;  5CGK A;  3OSO A;  4QUC A;  2ICI A;  4RCO A;  3C46 A;  1GUW A;  1PRT C;  4MHE A;  5EBC A;  4KMU C;  1JE4 A;  1OXV A;  3GTL B;  3BVZ A;  5ELB A;  4F7X A;  2SOB A;  2SNM A;  3FVQ A;  3A54 A;  2VUM B;  4A3M B;  1LT6 D;  2KCN A;  2XRS D;  4NP5 A;  1A2T A;  4A3G B;  1STH A;  3RUZ A;  4TQU S;  2JSO A;  3NPP A;  1CZG A;  2IX1 A;  1V1O A;  3LNN A;  3KBG A;  3IAY A;  1I6V C;  2EJF C;  4XQQ A;  2NZ1 D;  2I07 B;  4K2K A;  4QIW B;  4BBR B;  2AWN A;  3K58 A;  4QMG A;  3PIO 3;  3GTM B;  4C3I B;  2KHS A;  2XWB B;  5KYI A;  1EY8 A;  2FMC A;  3HOW B;  4YIJ A;  4RGN A;  4Q5V A;  3NE5 B;  1I50 B;  5FKA C;  5D14 A;  5CYU A;  2ZT9 C;  1RJT A;  1PXU A;  3I91 A;  2F0P A;  5F2D A;  3MFG A;  2JP1 A;  2BOS A;  2DN8 A;  1A2U A;  1SBB B;  2KEE A;  3KLS X;  4RGM A;  3DXJ C;  3K5O A;  4NDX A;  4XT3 B;  3TZU A;  1CFM A;  1EFI D;  1KNE A;  1EY0 A;  5LL6 X;  1EZ8 A;  3NUC A;  1TS4 A;  1DYQ A;  5JJZ A;  3N6R A;  1OXX K;  3NTI A;  2K5D A;  5C5M A;  1EL0 A;  2F0F A;  4G57 A;  3X3N A;  3CHB D;  3SDZ A;  1SYF A;  1U4M A;  4RH6 A;  3MXU A;  2D9U A;  3TN2 A;  3K5N A;  1X32 A;  2JA8 B;  1EYC A;  1Q3L A;  2XSC A;  3D4R A;  2PCF B;  3OIP A;  4ZKB B;  1EZ6 A;  4RHR A;  5J1Z A;  1BF4 A;  1IKL A;  2EPB A;  1RKN A;  4BY7 B;  1YNJ D;  3UI2 A;  3MXP A;  2PW7 A;  5CBA E;  3T13 A;  2WB1 B;  5K5P A;  1EY4 A;  4XYQ A;  2JA5 B;  1F9P A;  1PMR A;  2BCO A;  4DGZ A;  4DK1 A;  1HPC A;  5KYL A;  3R8B A;  1E2Z A;  2PZU A;  2Z4I A;  4RA8 A;  1RTN A;  2GA4 B;  1EQV A;  3U9S A;  3HGB A;  5FO8 B;  5IIF A;  5JPN C;  1B53 A;  5COY A;  5T1I A;  5T1G A;  2VXW A;  1ENC A;  1D2B A;  5CV9 A;  3EFX D;  3O13 A;  2K6A A;  2L11 A;  4Z9C B;  2EYH A;  4CJ0 B;  5I2Y A;  3IFT A;  3J81 E;  1CM9 A;  5C0X G;  3HOU B;  4TKO B;  1GUN A;  2YU9 B;  1ESF A;  3TSS A;  5FOB B;  2Z8L A;  3QJY A;  3BYY B;  5C0X H;  1RHP A;  4H0L C;  3M85 A;  1D5X C;  2F0T A;  3J7A V;  1K8O A;  3BS1 A;  1LAC A;  5KRU A;  5EBD A;  5IGD A;  1STA A;  4RKL A;  3H94 A;  3P7J A;  1FGB D;  2EVB A;  1HQR D;  5IT9 E;  4IUU A;  4RKB A;  1AN8 A;  1I3Q B;  2TSS A;  4KHZ A;  2K01 A;  1PZK D;  2F0G A;  2O4X A;  2E2H B;  5CV6 A;  4IQZ A;  2PMZ B;  1RF2 D;  1ZEQ X;  3I3C A;  5A2Q E;  1AEX A;  3QO2 A;  2F0N A;  3LWE A;  3SK4 A;  2B39 A;  1PFB A;  4GZY C;  1SXT A;  2G9H D;  3DWA A;  4KJN A;  4A3J B;  1FNV A;  2K1B A;  4F8M A;  4JBW A;  1TY0 A;  3BDL A;  1LTI D;  2WAC A;  4IUV A;  3GQB A;  1PTO H;  3T53 B;  4KY7 A;  5DEH A;  1Z7T A;  1G91 A;  1SNM A;  2LY7 A;  4P2C B;  1CQF A;  1GUT A;  2RKS A;  5D3I B;  3DWP A;  3V2T A;  4OIJ A;  3P1H A;  1E0B A;  2B8G A;  3L3O C;  2F0K A;  3R93 A;  1SNO A;  3WDN A;  2B2Y C;  1TVX A;  4FF2 A;  2J0T D;  1AZP A;  1X3P A;  4E6I A;  4IZ8 A;  4WOR A;  4DFA A;  3W3A A;  1PRT F;  1Z6H A;  3L7Z C;  4RCN A;  4OGQ C;  2L12 A;  5E4W C;  1PFM A;  3I4L A;  5IGB A;  3DMU A;  1ROD A;  5C3W A;  1CHP D;  4I7Z C;  1F2M A;  1CTM A;  4J6H A;  1EU4 A;  2F0L A;  3OMC A;  3NK9 A;  1A3U A;  4ULL A;  5EPL A;  1DD2 A;  3GTO B;  3AU7 A;  5TSS A;  2WIN B;  3PUZ A;  4FP5 D;  4HSV A;  5AFW A;  5A35 A;  2AQ2 B;  2NN6 G;  4K6L A;  1SE4 A;  4KHV A;  3SR1 A;  3ONA B;  4ABN A;  4HSP A;  2O2L D;  2D62 A;  5ELE A;  5CMD A;  3K0Y A;  4HCE A;  3HP3 A;  1XWE A;  4H13 C;  4OO1 I;  2JXM B;  2F0V A;  2KCC A;  2XIW A;  5COR A;  1Q1B A;  1WTX A;  3Q24 A;  5IGE A;  4FF1 A;  2JEA I;  1UUP A;  3VYU A;  4BBS B;  4MN3 A;  3LWU A;  2F0S A;  3NBI A;  5C5L A;  4KTA A;  3E6Z X;  5JEA J;  3ERO A;  3GTP B;  3BDO A;  1BCP C;  1A3V A;  2AUK A;  2Q8T A;  2PNR C;  5C0X J;  3S1R B;  1IW7 D;  3V05 A;  1V1P A;  5A2Q L;  2RSN A;  1TR5 A;  3NP8 A;  3S9W A;  1LTS D;  2IW3 A;  2JYO A;  3ND8 A;  1EY7 A;  1SMY C;  1JWM D;  3J80 E;  2H4O A;  2KOL A;  2K33 A;  1B9M A;  5M3M B;  4LAA A;  5DM7 3;  2X69 A;  3HG9 A;  4BA1 I;  2NVY B;  3W2D A;  4KKU A;  5IGG A;  1G2S A;  1RD9 D;  2AQ1 B;  1QIL A;  5FO7 B;  3QOL A;  2NVX B;  4IFD J;  1WTR A;  1Y8N B;  3OW7 A;  2QIL A;  1EY6 A;  3PMF A;  3MXG A;  2YYZ A;  1SEB D;  1Y1W B;  1II3 A;  1IL8 A;  5CR3 A;  3EJI A;  2HDL A;  1H9M A;  3R3O A;  1KDA A;  1GXD C;  2F0D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...