3BS1A

Structure of the staphylococcus aureus agra lyttr domain bound to dna reveals a beta fold with a novel mode of binding
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
103
structure length
103
Chain Sequence
MDNSVETIELKRGSNSVYVQYDDIMFFESSTKSHRLIAHLDNRQIEFYGNLKELSQLDDRFFRCHNSFVVNRHNIESIDSKERIVYFKNKEHCYASVRNVKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*DTP*DTP*DTP*DAP*DAP*DCP*DAP*DGP*DTP*DTP*DAP*DAP*D
publication title Structure of the Staphylococcus aureus AgrA LytTR Domain Bound to DNA Reveals a Beta Fold with an Unusual Mode of Binding.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription regulator
total genus 28
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2007-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04397 LytTR LytTr DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1020 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3bs1A00
4CBVA 3BS1A 4XQJA 4XQQA 4XYOA 4XQNA 4XXEA 4XYQA 4G4KA
chains in the Genus database with same CATH superfamily
1RDPD 3K0YA 1FL0A 3NQIA 2MO1A 2NZOA 2EE1A 3GP7A 1HZCA 1LT3D 4JI8Q 3Q23A 1TKWB 4IJLA 2HDMA 1F2ZA 2F3VA 1PH7A 3I91A 1ASYA 2K1BA 3E0EA 3CQZB 1PH3A 3BVZA 3FEWX 3GTOB 5JEAJ 5HURA 2D9UA 4NXML 1UE1A 5C3WA 2DJGC 4LWCA 1KDAA 1SE3A 3BG3A 1VMCA 2SNMA 2UXBQ 3A74A 4CDCC 3S2DH 1XMOQ 1KD1C 1VCIA 2HCCA 2UXCL 4LFAL 2VS1A 3MXNA 4Q0FA 2VUMG 4DXFA 1WTPA 3FP9A 3KF8A 3TP6A 2JA6G 3S1NH 4A3MH 2DY7A 1LTGD 4RHSA 1BOSA 1MHWC 2HD3A 3K7AH 3K5NA 2SDFA 1EZ6A 2O5IC 2KENA 1WD1A 3EVQA 1MSGA 1GVPA 4BWGB 2CWAA 3H15A 5K36G 5KYLA 3MA2B 2XN9C 3GTMH 4A3IG 4BXXH 1BR9A 4UP7A 1B8AA 3TSSA 2MJ8A 4YWKA 2NVYH 1FJGQ 1A0IA 1X3EA 2K5QA 2PO4A 1QVFA 2R92H 4A3DG 1STBA 2M2LA 1I94L 4NMZA 5DAUA 2WKDA 1UE6A 3TN2A 4B9WA 3F8TA 2D0OA 1O7LA 3MAQA 3HS0C 1STEA 2R7ZG 2F0EA 1SFOH 1H95A 4FYDA 1M4VA 5IODA 1BCPC 3J81j 1TWAH 1HNXL 5KYIA 5AJ3Q 3GTQB 1AZQA 1N34Q 2FFKB 4GKKQ 4DR2Q 1TWCB 4DR6L 4OIJA 1T5EA 2KHIA 4ZCKA 2B2YC 2F0OA 3HOUG 1Y1WG 4DR7Q 1LO5D 4JBKA 3R2TA 3OYYA 2CH4W 2NVQH 2A73B 1YHQA 3G71A 1VQ8A 3OW7A 4ILWA 2F0UA 5I9OA 1ET6A 3HOVG 3HOWB 3I4LA 1LUZA 1A2TA 1UUPA 2AQ2B 2JA7G 4JV5L 2WAQB 4MN3A 1ESFA 1AEXA 2E76C 1PFMA 3FDTA 2N3SA 5M3FG 2EYLA 2KEEA 3NBHA 4QF4A 1DZ1A 3JAME 1PZJD 2EOTA 5EKKA 1JT8A 3K0XA 1D8LA 2JP1A 2ZTDA 1EY6A 4JBJA 1IL8A 1DYQA 1PRTF 3H3VH 4X66Q 1EIYB 3FVQA 4CKCA 3OPOA 4AIMA 1V1PB 3PMFA 1OXUA 2F0WA 2HDLA 3J81E 4B08A 3TREA 2PZWA 4QCLA 4KY5A 3I70A 2YU9H 3F2CA 2PZUA 3RZOB 1AH9A 2ZXPA 2PW7A 3E3XA 2KHJA 2MHVA 4IFDH 5LMUQ 2R93H 1J5EQ 4JI3L 1WCMB 4KV6A 1Y1VB 2RHQB 4K8JA 4XXEA 2WFWA 3K7UC 5IWAL 1UE5A 3T13A 3HOXG 2NN6H 4QL5A 4X3SA 2K05A 2IY5B 1PZKD 1BCPD 2GN5A 3GV6A 1HNZQ 4BS9A 1JWMD 2EJFC 4JPBW 1JWUD 1L2FA 5ELOA 5GAGC 1RCVD 3GTLH 3EFXD 3C46A 2UU9Q 2LS01 2JE6I 3H91A 1L1OA 4B3ML 2QDLA 3QOJA 1PH5A 2HIXA 1CKMA 3WDNA 4K5WA 3FKIB 3I3CA 2KECA 1XNQL 3DLLA 2RQXA 4AQYL 3TZDA 4OO1H 4L6TB 4C2MH 1JB7A 1ZEQX 1HA6A 1WD0A 2D2CC 2Z1CA 1SNQA 5D3DA 5C4XH 1L0YB 1BCPB 4OELB 1SBBB 3C2PA 1PTOF 5A2QL 1O80A 3SK8A 4XQJA 5C44B 4H44C 2PZTA 4C3HB 2MUYA 1A3UA 3C1EA 1OO9B 1R4QB 2CCZA 3NHHA 3BZDB 3K81C 1VMPA 4CBVA 3HKZE 4DR5Q 4DR3Q 1J9OA 2B8GA 1TWHB 3S17B 2F0JA 4EX5A 2H4OA 1PH9A 4FF3A 1GOZA 4J15A 1STHA 1X56A 4FXGC 4U673 3UDXA 1IL2A 2F3IA 1CZWA 5ISRA 2UUBL 4A3MG 4DV2L 4NKLA 5DLQE 2I0QA 1IHZA 4JI5Q 4DGZA 1MKHA 3S1RH 1B50A 2L9HA 1WFQA 4XT1B 5C4JH 1D5XC 2OT2A 1ZXTA 2IL8A 5M5XH 4FXDA 3AEVA 4X3UA 3QR8A 3TP8A 4BXXG 2E5LQ 4ZLTF 5CV8A 3A5ZB 3MTSA 4PMBA 4EQPA 2ALYB 1YI2A 2ZT9C 4KN4C 2RDHA 5J1ZA 2F0VA 1GKHA 1N33L 2R92G 4A3CH 3CCQA 5KIXA 2EIFA 4Z9CB 2VY3A 4YWMA 4YCVA 1UEAB 2OEOA 5IYCH 4DV1Q 3HOZH 1JOQA 2L55A 2SOBA 4GN3B 1LYLA 4R4OA 4UPAA 1TR5A 2WKCA 2Q8IB 4RCNA 3D6CA 3PUYA 4JI8L 2NVXH 3LWUA 1H9SB 1HUMA 4IQZA 3ER0A 5IGCA 1ICWA 1VQOA 4LF9Q 1EIHA 2LY7A 1B70B 4C3IB 5EBCA 2EZVA 2UXBL 1I50H 1II3A 2E2DC 3KK7A 1E3PA 3DWQA 3ZJYC 1K83H 5KEEA 2K52A 1Q86C 4OWTB 2A74C 5KRUA 2ES2A 5C3EH 2UUCQ 1JE5A 1Y69U 4KKSA 4PZ8A 1G291 1WTQA 4HAEA 1IKLA 5C0XH 3I73A 3A56A 4IJHA 3CC2A 4NXMQ 3DWAA 1KNAA 3DEPA 1X54A 4TQUS 5COYA 3PUVA 5AFWA 3CCSA 1EWHA 2Q2IA 3EBEA 2FMMA 3EIVA 4A3EG 2UXCQ 4LFAQ 1JWSD 1G6ZA 4ID6A 4APVA 1BKBA 4P75A 1QUQA 4JI1L 3RN5A 1MJCA 4A3FB 2ASBA 1L0XB 3N6RA 3SVMA 3AB9A 4Y7NH 4DK0A 2A68C 2VL6A 2JA5H 1PH4A 1TWGH 1Q82C 1C0AA 2XWBB 4X62L 5IIFA 4IFDJ 5IGFA 4IFDG 1NNXA 3AMUA 4J8QA 2R93G 2B63B 1CKNB 1EFID 1E1TA 4NB3A 5IP9H 4IPDA 1EYAA 4G7HC 1N36Q 2LXKA 4A93B 4IOAA 3BDCA 2N88A 3L2PA 5AJ3L 2Q2HA 1N34L 3RLNA 2CFMA 3P20A 2WB1B 5CV4A 5LL6S 3T53B 5FO7B 3S2HH 2JXMB 3J7A5 2K7VA 4QMGA 1QILA 2Z6KA 3FHWA 4JOIC 2F0TA 3MZ5A 4DUYQ 5JVH3 4A3KH 2L5TA 1Y8NB 2M00A 4IPHA 5C5MA 1HQMC 4RFBA 4CJ1B 3BYYB 4OO1G 5IP7H 4DNRB 3IL8A 5C4XG 1RL2A 3G6EA 1PFSA 4BY1H 3BDLA 2Z9HA 4K6DA 1YJ9A 4B3TQ 1X3FA 3SK6A 2WAQE 4X64Q 3I4NB 3D3RA 2MO0A 1VQJA 2CVRA 4F7XA 3Q22A 3VR4A 4HJ8A 1S5DD 3VR3A 5IYBG 1EU3A 3HOYH 2JJQA 4OWXB 1LTTD 2B2WA 3OTOQ 5I6WA 2EDGA 2E2JH 1SMYC 3R8BA 3GDEA 2G9DA 3M85A 1K73C 4A3BH 1P16A 4DR1Q 2VUMB 4DA2A 5ELBA 3OOCA 2F0FA 3S15H 1J5EL 1YITA 1ILQA 3KLWA 2KOLA 2QKIC 5GROA 2E2HB 3FPUB 3RZDB 1I6HB 3DHQA 3RMHA 2EY6A 3KJOA 1VQ5A 2J0TD 3ULPA 1KTKA 1N8RC 3URYA 1SR3A 4AYBG 1I3QH 4NDXA 1P8LA 4POFA 4CJ0B 2I5MX 2K5WA 1CT1D 3ONAB 3CXCA 1NR2A 2EQSA 2KCTA 3CC4A 2Z0SA 4A3CG 5DNFA 2R7DA 3S1QB 1G91A 1H9KA 5IYCG 2UU9L 3HOZG 4YCWA 1PVOA 1AP0A 1OXSC 1HUNA 3CMEA 5IWAQ 4JK1C 5E1FA 1HXYD 2ATWA 4LF8Q 4C56C 1BUVT 4ZAIA 1YJWA 2KCCA 3DXJC 5M5WB 3UDGA 3NK9A 1VQKA 4UDUC 2F3WA 4O2DA 1K9MC 5CYUA 3D4DA 4UHVA 5D3IB 3I4MH 1G2TA 2QCPX 3SK4A 1Q1EA 1K28A 2KA7A 1N32L 4TKOB 1XMQL 3MFYA 1E7ZA 3HOUB 4KHVA 5LL6X 1LTRD 1XPRA 1Y1WB 5J3BA 4OL7A 5F2DA 1TQOA 3J7YW 3CRLC 4BBSH 2SEBD 3SEBA 5D65A 4GLAC 4ABNA 3SDZA 1R9TH 2YTVA 5EPLA 4PMCA 3MXUA 5CMDA 1JICA 5C3EG 2A6EC 4LF5Q 3W1GA 1MBYA 1PMRA 5FJ8H 5C0XJ 4GNXA 1EU4A 2ZJPA 4BY7H 2XVSA 1SMYD 3AU7A 4PQXA 3CCLA 1LLRD 1EIFA 2F0DA 2GVBA 2H5XA 2PQEA 2ZJRA 4M8AA 2ENBA 2PQAA 1F9QA 4C1NK 1F2LA 1KDCA 1VQ7A 3KDFA 3L0OA 4CKEA 3KF6A 2VB2X 4IUNA 2UUBQ 5T1GA 3T1HL 1O7IA 1HJPA 2K75A 1RODA 1DM0B 2JA5G 3H0GG 3W2DA 2B2UA 2F0LA 4JBMA 2PI2E 1AW7A 3RR5A 4DUZQ 3S16B 4RKBA 2HHHL 1CFMA 5E4WC 3RLOA 1RJTA 4HJAA 5M3MH 3SGIA 1LABA 1GM5A 1LTAD 1FNWA 1SE4A 1HPCA 1MIUA 2A5HA 3ZYYX 4GOPA 3GTJB 4EQ5A 1BXTA 1CI3M 1NSNS 1U5KA 1U0LA 5FLXL 4LF9L 4H7BA 4BBRH 1I6VC 5TSSA 5M5YH 4WORA 3CKIB 3KBGA 4CJ2C 4UP8A 3CMAA 4HJ9A 1HTPA 1ZYRC 2E2IB 2E8GA 3CCUA 3E9HA 4PG3A 1PZID 4DAMA 4QGUA 4DAPA 1KAAA 2PNHA 2MP1A 5IY0A 2UUCL 4U68A 1BQQT 1UEBA 2L12A 5DEHA 3F2UA 5IP7G 5C4ZA 1A63A 1YVCA 5JEAG 4JI6L 5LMNL 4N9PA 5IGGA 3E5SA 3TRZA 3ND9A 3M3YH 3CQZH 3HEJA 2A6ED 3MEHA 4HIMA 3M7NA 3GTOH 3K57A 1PH2A 4K14A 2XGTA 1EQRA 1HZAA 4IPGA 1KLGD 1BBWA 3PGZA 1B44D 2V1CC 5I2XA 1LTSD 3HOYG 5ELCA 3S2DB 2K5NA 3HG9A 1B1ZA 1WTHA 2F0SA 4A3BG 1S40A 4Q5VA 4DXGA 4E6IA 2NZ1D 1SNCA 1O78A 3WOFA 1HH2P 5GQOA 4HCEA 4XQNA 1N36L 1OTCA 1J6QA 3WWVA 5I4DA 1I5FA 3VYUA 1K0SA 4JG2A 4L63B 4JI1Q 1Y8OB 4RG1A 1GHKA 2AWOA 3NQTA 2A69C 2FXQA 4OWWB 5ELNA 2ZJQA 1B3QA 1H9RA 2ICEC 4MTKA 4X62Q 4S3SA 4YHHL 2HUGA 4RH6A 1VQNA 4DUYL 4KD4A 1PV4A 1VQFA 1TU2B 3DUZA 1IBLQ 1YEZA 2CH4A 2XTIA 3KF8B 2A19A 3A7AB 3V2TA 1X6OA 2VQEQ 3I2ZA 1EEFD 3BVMA 2NVTB 5EBDA 3GTQH 3I4MG 1CQFA 3L7ZC 2IPKD 4B3TL 1SLJA 3BZCA 1MSHA 4X64L 2IHFA 1RD9D 1TWCH 1V1PA 4FVMA 1RKNA 2L4NA 2NYZD 3TMEA 1U4MA 2RBMA 2RA4A 4BBSG 3A8JE 1TY2A 1CM9A 4JI7Q 1DJRD 4DAYB 3HOWH 3R93A 3OTOL 2Z8LA 1KL9A 4YIJA 1SEBD 4DK3C 4DR1L 2B2VC 5ELDA 3SR1A 4JI4Q 1YNXA 4BY7G 2C5CA 2HCIA 2EYOA 3KLSX 1TIID 1EOVA 3HKZG 3D31A 3FRPB 5IOCA 3A54A 5JOBA 1KQSA 4KJOA 3J7AF 3J80i 1A3VA 1E2ZA 3GQBA 4LJZC 4XT3B 1KAWA 4BA1I 5LMNW 1HNWL 4A3EB 2M9VA 2RSOA 4K0KQ 4J6HA 4R4CA 1E1OA 1FGUA 3NPPA 4MTNA 5IYDH 1Y8PB 4ZK9B 3HGBA 1G6PA 3RZOH 4GKJQ 1O7ZA 3PUWA 1UE7A 5CV6A 1YBYA 2B29A 1EEID 1GJXA 5HY6A 4RGMA 1E22A 1EYDA 5JJLA 4LUVA 2XNAC 2JA8B 1WCMH 2VNUD 4LF8L 1FVIA 2BH8A 1Y1VH 5JJKA 4IUQA 4WJ3M 4A3LG 1IXRA 3NBHB 1EQQA 3S9WA 3U4VA 1YJNA 2WIIB 2F0PA 1I4QA 4R4IA 1TS3A 2AUJD 3GTGB 2B2YA 4KY7A 4RAUC 1PRTC 2X6GA 4DNIA 3CC7A 1VQIA 1VQCA 3AYHB 3A55A 1VQAA 3K6OA 3M4YA 4CKBA 2TSSA 4DFAA 4CDEC 4IOCA 3EA6A 1XX8A 4OXPA 3K5LA 4RCOA 4LF7Q 3RLFA 1JQYD 2QILA 1CA5A 2N55A 1WTOA 5G3LF 3VDYA 5FLXc 2KHSA 1EYGA 2YTYA 1IW7C 2EXZA 1WI5A 1SMXA 3FKIH 2BOSA 4LF5L 1W6JA 2Y0SB 3FMCA 1GUGA 1N32Q 4KN7C 1XMQQ 5CV9A 4MNOA 5EGTA 3VR2A 4XTCS 1WJJA 2PI2A 2QA4A 2A8VA 5FOBB 4X65Q 3Q8DA 1SSOA 2Z4HA 1Q46A 2P5ZX 3VA5A 1SNDA 5C44H 2DJFC 4C3HH 1GUWA 3G6JB 4CDFC 1MI2A 1ESRA 2O5JC 1Z6HA 5EPJA 3TQYA 2K6AA 1TWHH 4QJFA 3VYTA 4DV6Q 4YCUA 4C3JB 1V8QA 3IFDA 4QY7A 4DUZL 1ICFB 3NWSA 2WINB 4L8JA 5K5PA 5M9OA 1C9OA 3PCOB 5LHY1 1IKMA 1V1OA 5IT9L 1HQRD 1SNOA 2R6GA 2JA9A 3K58A 1QCBD 3A8IE 1NE3A 3PUZA 2OWOA 4PNYA 3NUCA 1JB3A 1LTBD 2RVLA 1RF2D 5M5XB 1PH1A 3PO2H 3NWTA 3VR5A 2EXDA 1PTOC 4HSPA 3T1HQ 3TEHB 4KHZA 2CQAA 3GD7A 3ICEA 1GD7A 4KHPQ 1JCKB 1I4PA 2HHHQ 1L0WA 2KVMA 4A3GH 1ASZA 5GAHC 1HFNA 2K50A 4POGA 3GTPB 1PRTD 1KRTA 3JAML 1IYUA 1V9PA 3UE0A 4WFN3 3D0FA 1B9MA 2F0HA 4QIWB 4LFCQ 2EY2A 1DXMA 2MGSA 1RHPA 3SXHA 1VQPA 1GXDC 4OX9L 4DN4M 3D4WA 2K5HA 5C3XA 1SYCA 3J81L 1X55A 4G7ZC 2DNEA 2EJGC 2ZTEA 1A6XA 3VA7A 1NJIC 2RCFA 1BBUA 1PRTB 3I4OA 4C3IH 1BBXC 4XQQA 1JJGA 4ZKCB 2X6LA 4DV4Q 1CHPD 1NMGA 2CQOA 1CQVA 1FD7D 1FGBD 1EY4A 3HOWG 2Z6KC 3B6YA 1AN8A 3NENA 3CPWA 4LMQD 2FINB 2WAQG 5LMNQ 4JI6Q 1B4OA 2G9HD 1CKNA 3MXGA 3ND8A 1S72A 3T1YQ 2NTTA 3PO3H 4YWLA 3NE5B 3L3OC 5FO8B 1QNUA 3L9AX 1QZHA 3PF5A 1ILPA 5CC4A 3K80C 4K6LA 5KGUA 2N8NA 3S24A 1SYGA 1EL0A 2LXJA 4TRDA 4EQOA 5JPMC 4F88A 1ONLA 4LF6Q 1TXYA 3OIQA 2VQFL 3C1FA 2F0IA 4P72A 3W3AA 1I4RA 1Q7YC 4NP5A 5IYDG 4A3JB 3GTKH 1GO3E 4A3FH 1W2BA 1EY8A 1E2WA 2EYMA 3PIO3 1F77A 3J80L 2CW0C 1AFPA 3BJUA 4V0BA 1VQMA 2JA5B 3H0GB 2F52A 3I7FA 4GZYC 1ET9A 1LT4D 3E0JA 3MFGA 4LF4L 2B63H 3S14B 1IBLL 1WCMG 4HCSA 2NN6G 1Q90A 2VQEL 1Y1VG 2PW5A 5A35A 1OXTA 4A93H 1CHQD 2OF1A 1TVXA 5BR8L 1M1KC 2AKWB 2EPBA 4YHHQ 1PTOB 2IHEA 4XIGS 2G5DA 1F9PA 1K8AC 1A15A 1QZGA 3GV3A 5EQ0A 1NTGA 1OXVA 4G57A 2BE5C 4JI7L 5JVG3 4HEDA 1Z47A 1QUQB 2PNRC 1LV9A 2I5HA 2ICIA 2OCEA 4DR4Q 1HHVA 2L15A 1A62A 5HGTA 4FP5D 4O42A 3JC66 1EY0A 5EJWA 2EYPA 3N52A 1WYDA 2X69A 2I07B 4JI4L 2J4XA 1PFNA 1NCVA 2C35B 3X3NA 3Q24A 4RKLA 1SE8A 4KTAA 3PIP3 4RA8A 3W1BA 5C6AA 1NY4A 1N9WA 3ITPA 3EQLC 1PA6A 2EY1A 2BCOA 3G48A 2V4DA 3KOJA 3I4NH 4OGQC 4C3HG 5CGKA 2UXDQ 4K0KL 2RF4A 3SHLA 3AFPA 4ZKBB 4DK6C 1XJVA 3HOYB 1TS2A 2ID0A 2JA6B 1SDFA 2ZXOA 1XPUA 4GKJL 5IGEA 1SN8A 4M1UB 2A68D 3E9IA 5FK9C 3PV0A 3H3VI 3P75A 1LACA 1SNMA 2JEBI 4K5XA 2YTXA 4KI0A 2CW0D 4GNXC 1HNWQ 1KNEA 4A3IB 2KCMA 3RZDH 1I6HH 4JW0A 4QB4A 1XTDA 3WOEA 1EYCA 3PO2G 3ERQA 5KNDA 1Q8IA 2LSSA 4H13C 2QGQA 4IFDI 4XYQA 2K33A 1NBWA 1IBKL 4A3DB 2IX3A 3BZKA 1PHJA 5IT9c 4A3GG 5CBAE 4JOIA 1DD2A 4N8X1 1A3TA 4LF7L 4R1JA 3VYRA 5FLMH 2IX0A 2E75C 5L37A 2R7ZB 3E6ZX 2JEAI 4GS3A 2R3ZA 4LNQA 1TS4A 2NN6I 2B2UC 1B2TA 3K59A 1S5FD 3LGJA 1VF5C 2E74C 2UUAQ 4MZ9A 3QG1A 4RWSC 4GOPC 4JYAL 5M5WH 2I5LX 4HSVA 5HGQA 4LW1A 4N8FA 2B2TC 3NTKA 3JAMc 4OONA 4X65L 3HOVB 4C3IG 4OO1I 2Y0SE 2JA7B 4RGOS 1HR0L 3G7LA 4FO2A 1KDBA 1NUCA 3J81c 5M3FB 1FNUA 4DV6L 5C0XG 2QW7A 2DNCA 2DY8A 1HTLD 4P71A 1PH8A 3DM1A 3PO3G 1X3QA 1PYBA 4HR7B 4HMIA 4LFBQ 1LM0A 3KLSA 3J7ZC 1WTVA 2AMCB 1K3BC 5C5LA 4B3RL 3UDFA 4ZYSA 4DKAC 1CA6A 1C48A 1VQDA 4MIUA 2Q8RE 5I9PA 5E4XA 4V190 4KLKA 1DOLA 4L5RC 2K01A 3STBC 4LK1C 4KHPL 2H1EA 4K2KA 1S5CD 3FPPA 2MQHA 4DF7A 1QOHA 3C3LA 2OXPA 1GUSA 3T16A 4XDXA 5IP9G 4PZ7A 5IE8A 3S16H 4FF2A 3M4OB 3DEOA 1CK1A 4LFCL 1WTWA 2ZM6Q 1TWFB 1HRJA 3S1MB 4GN5A 1BVSA 1EY5A 3O13A 3HRZC 3GTJH 3HOXB 5EKLA 1A8VA 2TMPA 4JI0L 4C1NI 4GNXB 1VQEA 3J80c 4A93G 3DM3A 3NBIA 1T9HA 2JK8A 1B3AA 5FKAC 4IUUA 1MD2D 2AUKA 2IJ0A 4ZQ3A 4QIWE 2EYHA 4LUZA 3X3MA 4A3KG 1Z9FA 2F4VL 2E2IH 4DV4L 3BU2A 3KDFB 3OIPA 3OHXC 1IYJB 1NR4A 3KF6B 1F9RA 4ZUIA 1K0RA 3M4QA 2N78A 4OX9Q 2DN8A 3CPFA 4BY1G 3T1YL 1XNRQ 4L5TA 3T4AC 1LTID 3P7JA 2WV6D 4EGVA 3OWEB 4RGTA 1TY0A 4WJWA 2K5VA 4A4IA 3H3VC 4DV5L 3MVVA 5J39A 3F2DA 4B3SQ 4GOPB 4O0AA 3HKSA 3M3YB 1SYFA 2Z4IA 3QO2A 3R3OA 4LF6L 3I4NG 3TP5A 2F0NA 2LMCB 4FF1A 3H09A 4UP9A 2QF7A 1QNKA 1G51A 4P2CB 4HIKA 1Q12A 5C0XI 3TS0A 2L0CA 3PF4A 4BA2I 2PCFB 1I4GA 3PIOA 3S1NB 4R8NA 4A3MB 1I4HA 3T56B 3U58A 1M90C 1BCPF 3KYHC 3K7AB 2RDFA 3STBD 3CCEA 1HR0W 2IWHA 1VQGA 3UI2A 4OIKA 3ERSX 2HQLA 1HFGA 3GTMB 1G2SA 4J1MA 4JVZA 3JAMi 4HIDA 2VQFQ 1SYDA 1IYVA 4PZ6A 2PYKA 2NVYB 1E2VA 1D5ZC 1VQ9A 4TSSA 5A2QE 4O1NA 4DV0L 2XRQD 3MHBA 3OMGA 2R92B 1NAPA 2J7ZA 3J81i 3CCMA 2WB1E 5E7NA 4DAYA 1HZ9A 1ZYRD 5FLMG 3SE0A 3MXNB 1F9SA 2C9OA 4X3TA 4LF4Q 1ENFA 4A75A 4DR4L 1U4PA 4H0LC 1SFOB 3VYSA 2R7FA 1TWAB 1E0BA 2XWJB 4OEMB 4IALA 1SRUA 1YHAA 1SNPA 3U50C 5BR8Q 4FDBA 3P1HA 1W6KA 5EKIA 3MEFA 2NVTH 1F2YA 1XXGA 3PIPA 4IPCA 2O2LD 2NVQB 2MPMA 4RHRA 5IT9E 2PPBC 1J8IA 3LX0A 4LAAA 1TS5A 2UXDL 4RMFA 2PMZB 1MGSA 1BF4A 2F1MA 4IUPA 1L1OC 2RDGA 4IZ8A 3CU7A 5ELFA 5FJ8G 3BYTB 4NXNL 4JI2Q 3I72A 1QVGA 5IGDA 4I7AA 3TP7A 3AQQA 4I7ZC 1STGA 4CDDC 3MWYW 2WP8J 3HP3A 2NZHA 3ULJA 1Q1BA 1Q8KA 2YU9B 1LT6D 2O4XA 1SJHD 3RN2A 1AZPA 4ODGA 4A3EH 2A69D 4EVOA 3Q0AA 1KABA 4IURA 5M3MG 4PMWA 4L5QA 3U9SA 1QWYA 3BDOA 2R93B 3UDIA 4DV7Q 1G8ZD 1S4ZA 3U9OA 1XPOA 3V05A 2JA8H 1YIJA 2QEJC 1U9RA 4DAVA 4IUTA 4KK7A 4DK1A 2A1AA 2F03A 3T51B 2UUAL 2CKZB 4BBRG 4XYOA 4A76A 3TZUA 1H9MA 1IBKQ 5J22A 4DNTB 1E24A 4IUVA 2I46A 3GTGH 1VF7A 4K5VA 5I2YA 3GTLB 1AE2A 3AFQA 5EPKA 1U4RA 3F1ZA 1JJCB 2EYJA 1Q81C 3PUXA 3LNNA 3EN2A 1GHJA 2OQKA 4C2MB 2OTJA 1FR3A 1K3RA 4MHEA 3OW2A 5KNCA 2RKSA 1IZ6A 1BO0A 2B2VA 4NPSA 4JYAQ 5C4XB 1KLUD 2F0KA 2K03A 3I56A 3KLRA 1DOKA 1JOKA 3J80E 1QB5D 1D1IA 1S5BD 3DMUA 4LFBL 4GN4B 1CTMA 1QG7A 4TVAB 4FXKC 2AQ1B 1KC8C 3RD4A 1EZ8A 2K28A 1VQLA 1HR0Q 1EWCA 3KUPA 3SK5A 3VR6A 4H02A 1BNZA 3S17H 3H6MA 4YY3Q 3Q6SA 3BS1A 5IYBH 2EYFA 1L1OB 4DV3L 1ZKOA 2XSCA 1YNJC 1H9SA 3IFTA 1PDQA 3IKJA 1X9NA 3D8GA 4C3JH 1UNSA 3A5UA 3S1RB 1D1KA 3H94A 1O7YA 1UWVA 2K4KA 5C4JB 1TT2A 1T5XD 4R4QA 2ZM6L 4K2LA 3CAMA 4B3RQ 4IN3A 3QOLA 3TDQA 4AYBB 2D62A 1EQTA 1KIXA 3D4RA 2RSNA 2YV5A 3DWPA 1EUJA 2GA4B 1D7QA 4HN7A 1XTCD 4ME3A 3PO2B 4NW2A 2XRSD 1BDOA 1WVLA 1GUNA 3HOZB 1IBML 1DCZA 1PYWD 4A3GB 1STAA 5T1IA 3I90A 1U4LA 4JCVE 5I6YA 5JJIA 3GTPH 2NVXB 4JBWA 1KXLA 4JI0Q 1XYIA 5GAEC 4HJ5A 1XNRL 1IW7D 2HQEA 5KNBA 4ZRZA 1STYA 1VQ6A 2DUDA 2KEDA 5JAVA 4B3SL 4X3KA 5DM73 3W5OA 4HMJA 3NEMA 2RHSB 1CKOA 5CBEE 5BN3A 2F4VQ 5IGBA 1EOTA 1V1QA 4WRDA 1K8MA 3K5MA 3RNUA 2BH2A 3M7GA 2B8FA 1I50B 3V96A 2L1BA 3MXPA 2F0GA 4IO9A 1WTXA 1K83B 3PSIA 4R9WA 5C3EB 3NP8A 1CSQA 1YZ6A 3D6WA 1WTRA 1XMOL 4L5SA 1STNA 2AQ3B 2RCNA 5E3FA 1JC7A 1RTNA 1VDZA 5JJZA 4DV5Q 3CW2C 1X65A 4RGNA 1FYCA 1LTLA 3PO3B 1ENAA 2D5DA 1YNNC 1YNJD 1RTOA 5NUCA 4DU9A 1K8OA 2F4IA 1QJOA 3NSWA 2L11A 1NMFA 4R8IA 1VS0A 5G3LD 1AE3A 1HZBA 1PYSB 1C4QA 1D2BA 2WACA 5CV5A 3KFUA 3A0JA 4Y7NB 1PTOD 2DGYA 2Q2TA 2B2WC 3KBXA 1M8AA 3CCJA 1H9JA 2YYZA 2NWGA 2EY5A 1FJGL 1TWGB 2KBNA 4A3JH 3GTKB 2Q2UA 1EIGA 2R61A 2MNAA 1CSPA 3MC0B 3H0GH 4WJ4A 4HTHA 2LKVA 2KJXA 4FNFA 2JA8G 1LT5D 2NTSA 3S14H 5BN5A 1SE2A 4FF4A 2K04A 4F87A 4DV0Q 1PFBA 3IRBA 3QJYA 5BN4A 3S2HB 2VW9A 2JN4A 3OSOA 2NB0A 4GKKL 2XIWA 4DR2L 2VXWA 3HZXA 1VQ4A 1R4PB 1PTOH 2B39A 2K5DA 4DPGA 1I94Q 4JC0A 4DR7L 4CHTB 1SROA 4A3KB 1C8CA 2N49A 3CRKC 4UY8C 3FKIG 2VZAA 2NBFA 4QQBX 2VB3X 4CGYB 4JI2L 3NELA 1HNXQ 1EWIA 3OWFA 4BY1B 2Y0SG 1Y14B 2B3GA 2PMZE 2IT1A 5C44G 1CZGA 5JEAH 4DR6Q 2A6HC 1ENCA 1MJEA 4OHJA 5CR3A 2QEXA 1DGSA 1V43A 4R4TA 1UAPA 3ULLA 4F8MA 5FLXE 1YNND 1SJED 2BA1A 4X66L 3M9BA 3QIAA 3CHBD 4NXNQ 2FMCA 2E2JB 5GADC 4N9TA 1JR0D 4JV5Q 4A3BB 1D6EC 1W3SA 2FJ2A 1D5MC 3GO5A 2VUMH 4QUFA 4KKUA 3NXWA 2JA6H 3S15B 3K5OA 4DV7L 1HA5A 1C7YA 4C3JG 3CCRA 5FO9B 5DM63 5JPNC 3OMCA 3NTHA 1XWEA 1X3GA 2E2HH 3TS2A 3G4SA 1RIPA 2HT1A 5LMUL 1GUOA 2F0QA 5K36H 1CUKA 4GLVB 4EQNA 2JQOA 1EFWA 4KMUC 1I3QB 4A3IH 1HCZA 1X3PA 2LFNA 1VQHA 3S1QH 3PQIA 4A3DH 1EY7A 3CP0A 3EJIA 1HNZL 1VQBA 2K14A 1EQVA 2BE5D 2QDBA 1KHIA 2R7ZH 2FHTA 3CF5A 4JI3Q 1JE4A 1Z7TA 2Q8TA 4G4KA 1PXUA 4B9XA 5EAYA 1Q3LA 3I4MB 4KKTA 2D0PA 3I8ZA 4ULLA 3U4ZA 1SAPA 4AH6A 3UE1A 1X32A 1DOMA 3HOUH 1Y1WH 2EJMA 1JOOA 4P74A 4BBSB 2KCNA 2MFIA 4G7OC 1R9TB 3HOVH 3IAYA 2A6HD 1QE6A 4YY3L 4ME5A 2JYOA 3K8AA 2JA7H 3HFZB 4B3MQ 3A7LA 3J7AV 3TBIB 2EVBA 4DR5L 1ML0D 1XNQQ 4DR3L 4KY6A 1FNVA 4AQYQ 4UAIA 2ZXRA 5M3FH 2GVAA 4BY7B 4X6AH 2K32A 1WOCA 3HKZB 4KD3A 4QUCA 2HIVA 5C4HA 1B7YB 1S3OA 4JI5L 1JORA 5CORA 2NUCA 4HIOA 2BDNA 4ALPA 3QWNA 4K8IA 1YHBA 3KJPA 5D14A 3EROA 4I65A 1GUTA 4LUOA 4A3FG 2CWPA 1B53A 3A8KE 4DV3Q 3CCVA 2E5LL 1A2UA 2SNSA 2F0MA 2JSOA 1EY9A 4GLXA 4A3JG 4KJNA 4P73A 1K8GA 3F2BA 2BDOA 4PV1C 4AYBE 5M3MB 2B63G 2AWNA 2KQ3A 2AHOB 4DV2Q 1F2MA 3RUZA 2BA0A 4DV1L 4Y52H 1KRSA 1B9NA 2OQ0A 3M4OH 1DONA 1JMCA 3CD6A 3I55A 2Z6BA 1SYBA 1JJ2A 1OXXK 1TWFH 2KUMA 5H1SE 2WB1G 3LWEA 3S1MH 1PLFA 3R2IA 3NTIA 4BBRB 3HOXH 1SXTA 3M4PA 5M5YB 2PQAB 2OTLA 5ELEA 4A3LH 2B2TA 3BVGA 4HJ7A 2CHBD 2IX1A 1SYEA 2IW3A 1IBMQ 1QVCA 1I4XA 5CV7A 1S5ED 2ZTCA 1PH6A 1N33Q 4ZUJA 3QB3A
chains in the Genus database with same CATH topology
1RDPD 3K0YA 3NQIA 2EE1A 3GP7A 1LT3D 3Q23A 1TKWB 2HDMA 1F2ZA 2F3VA 3I91A 2K1BA 3CQZB 3BVZA 3FEWX 3GTOB 5JEAJ 5HURA 2D9UA 5C3WA 1KDAA 1SE3A 3BG3A 1VMCA 2SNMA 1VCIA 2HCCA 3MXNA 4Q0FA 4DXFA 1WTPA 3KF8A 3TP6A 2DY7A 1LTGD 4RHSA 1BOSA 3K5NA 2SDFA 1EZ6A 2O5IC 1WD1A 3EVQA 1MSGA 4BWGB 5K36G 5KYLA 3MA2B 2XN9C 1BR9A 3TSSA 2MJ8A 2K5QA 2PO4A 1STBA 2M2LA 4NMZA 5DAUA 2WKDA 3TN2A 4B9WA 1O7LA 3MAQA 3HS0C 1STEA 2F0EA 4FYDA 1M4VA 5IODA 1BCPC 5KYIA 3GTQB 1AZQA 2FFKB 1TWCB 4OIJA 1T5EA 2B2YC 2F0OA 1LO5D 3R2TA 2A73B 3OW7A 4ILWA 2F0UA 5I9OA 1ET6A 3HOWB 3I4LA 1A2TA 1UUPA 2AQ2B 2WAQB 4MN3A 1ESFA 1AEXA 2E76C 1PFMA 3FDTA 2EYLA 2KEEA 3NBHA 4QF4A 1DZ1A 3JAME 1PZJD 2EOTA 5EKKA 2JP1A 1EY6A 1IL8A 1DYQA 1PRTF 3FVQA 4CKCA 3OPOA 1V1PB 3PMFA 1OXUA 2F0WA 2HDLA 3J81E 4B08A 2PZWA 4QCLA 4KY5A 3I70A 2PZUA 3RZOB 2ZXPA 2PW7A 2MHVA 4IFDH 1WCMB 4KV6A 1Y1VB 4K8JA 4XXEA 3T13A 2NN6H 4X3SA 2K05A 1PZKD 1BCPD 3GV6A 4BS9A 1JWMD 2EJFC 1JWUD 1RCVD 3EFXD 3C46A 2LS01 2JE6I 3H91A 3QOJA 3WDNA 4K5WA 3FKIB 3I3CA 2KECA 2RQXA 3TZDA 4OO1H 4L6TB 1ZEQX 1HA6A 1WD0A 2D2CC 2Z1CA 1SNQA 5D3DA 1L0YB 1BCPB 1SBBB 3C2PA 1PTOF 5A2QL 1O80A 3SK8A 4XQJA 5C44B 4H44C 2PZTA 4C3HB 2MUYA 1A3UA 3C1EA 1OO9B 1R4QB 3NHHA 3BZDB 1VMPA 4CBVA 1J9OA 2B8GA 1TWHB 3S17B 2F0JA 4FF3A 2H4OA 1GOZA 1STHA 4FXGC 4U673 1CZWA 5ISRA 4NKLA 1IHZA 4DGZA 1B50A 2L9HA 4XT1B 1D5XC 2OT2A 1ZXTA 2IL8A 4FXDA 4X3UA 3TP8A 4ZLTF 5CV8A 3MTSA 4PMBA 4EQPA 2ZT9C 4KN4C 2RDHA 5J1ZA 2F0VA 5KIXA 4Z9CB 1UEAB 2OEOA 1JOQA 2L55A 2SOBA 2Q8IB 1TR5A 2WKCA 4RCNA 3D6CA 3PUYA 3LWUA 1H9SB 1HUMA 4IQZA 5IGCA 1ICWA 1EIHA 2LY7A 4C3IB 5EBCA 2EZVA 1II3A 2E2DC 3KK7A 3DWQA 5KEEA 2A74C 5KRUA 1Y69U 4KKSA 1WTQA 1G291 4HAEA 1IKLA 5C0XH 3I73A 3A56A 3DWAA 1KNAA 4TQUS 3DEPA 5COYA 3PUVA 5AFWA 1EWHA 2FMMA 1JWSD 1G6ZA 4ID6A 4A3FB 1L0XB 3N6RA 3SVMA 3AB9A 4DK0A 2A68C 2XWBB 5IIFA 4IFDJ 5IGFA 4IFDG 3AMUA 4J8QA 2B63B 1EFID 1EYAA 4G7HC 4A93B 3BDCA 2N88A 3P20A 2WB1B 5CV4A 5LL6S 3T53B 5FO7B 2JXMB 2K7VA 4QMGA 1QILA 2F0TA 3MZ5A 5JVH3 2L5TA 1Y8NB 2M00A 5C5MA 1HQMC 4RFBA 4CJ1B 3BYYB 4OO1G 4DNRB 3IL8A 3BDLA 4K6DA 3SK6A 3I4NB 3D3RA 2CVRA 4F7XA 3Q22A 3VR4A 1S5DD 3VR3A 1EU3A 1LTTD 2B2WA 5I6WA 2EDGA 1SMYC 3R8BA 3M85A 2G9DA 2VUMB 4DA2A 5ELBA 3OOCA 2F0FA 1ILQA 2KOLA 2QKIC 2E2HB 3FPUB 3RZDB 1I6HB 3DHQA 3RMHA 2EY6A 2J0TD 1KTKA 3URYA 4NDXA 4CJ0B 2K5WA 1CT1D 3ONAB 1NR2A 5DNFA 3S1QB 1G91A 1H9KA 1AP0A 1OXSC 1HUNA 4JK1C 5E1FA 1HXYD 4C56C 1BUVT 4ZAIA 2KCCA 3DXJC 5M5WB 3NK9A 4UDUC 2F3WA 5CYUA 3D4DA 5D3IB 1G2TA 2QCPX 3SK4A 1Q1EA 2KA7A 4TKOB 3MFYA 3HOUB 4KHVA 5LL6X 1LTRD 1Y1WB 4OL7A 5F2DA 1TQOA 3J7YW 3CRLC 2SEBD 3SEBA 5D65A 4ABNA 3SDZA 5EPLA 4PMCA 3MXUA 5CMDA 1JICA 2A6EC 1MBYA 1PMRA 5C0XJ 1EU4A 2XVSA 1SMYD 3AU7A 4PQXA 1LLRD 2F0DA 2PQEA 4M8AA 2ENBA 1F9QA 4C1NK 1F2LA 1KDCA 4CKEA 2VB2X 4IUNA 5T1GA 1RODA 1DM0B 3W2DA 2B2UA 2F0LA 1AW7A 3S16B 4RKBA 1CFMA 5E4WC 1RJTA 1LABA 1LTAD 1FNWA 1SE4A 1HPCA 2A5HA 3ZYYX 3GTJB 1BXTA 1CI3M 1NSNS 5FLXL 4H7BA 1I6VC 5TSSA 4WORA 3CKIB 3KBGA 4CJ2C 1HTPA 1ZYRC 2E2IB 1PZID 4DAPA 1KAAA 2MP1A 4U68A 1BQQT 2L12A 5DEHA 3F2UA 5C4ZA 5JEAG 4N9PA 5IGGA 3E5SA 3ND9A 3HEJA 2A6ED 3MEHA 3M7NA 3K57A 4K14A 1KLGD 5I2XA 1B44D 1LTSD 5ELCA 3S2DB 3HG9A 1B1ZA 2F0SA 4Q5VA 4DXGA 4E6IA 2NZ1D 1SNCA 1O78A 3WOFA 4HCEA 4XQNA 5I4DA 3VYUA 4L63B 1Y8OB 1GHKA 2AWOA 3NQTA 2A69C 1H9RA 2ICEC 4S3SA 2HUGA 4RH6A 4KD4A 1TU2B 3DUZA 3A7AB 3V2TA 1EEFD 3BVMA 2NVTB 5EBDA 1CQFA 3L7ZC 2IPKD 1MSHA 1RD9D 1V1PA 4FVMA 1RKNA 2L4NA 2NYZD 3TMEA 1U4MA 2RBMA 2RA4A 3A8JE 1TY2A 1CM9A 1DJRD 3R93A 2Z8LA 4YIJA 1SEBD 2B2VC 5ELDA 3SR1A 2C5CA 2HCIA 2EYOA 3KLSX 1TIID 3D31A 3FRPB 5IOCA 3A54A 5JOBA 4KJOA 3J7AF 1A3VA 1E2ZA 3GQBA 4LJZC 4XT3B 4BA1I 4A3EB 2M9VA 2RSOA 4J6HA 3NPPA 1Y8PB 4ZK9B 3HGBA 1O7ZA 3PUWA 5CV6A 1EEID 1GJXA 4RGMA 1EYDA 2XNAC 2JA8B 2VNUD 4IUQA 3S9WA 2WIIB 2F0PA 1I4QA 1TS3A 2AUJD 3GTGB 2B2YA 4KY7A 4RAUC 1PRTC 2X6GA 3A55A 3K6OA 4CKBA 3M4YA 4DFAA 2TSSA 3EA6A 1XX8A 3K5LA 4RCOA 3RLFA 1JQYD 2QILA 1CA5A 2N55A 1WTOA 5G3LF 2KHSA 1IW7C 2EXZA 2BOSA 1W6JA 2Y0SB 3FMCA 1GUGA 4KN7C 5CV9A 5EGTA 3VR2A 4XTCS 5FOBB 1SSOA 2Z4HA 3VA5A 1SNDA 1GUWA 3G6JB 1MI2A 1ESRA 2O5JC 1Z6HA 5EPJA 2K6AA 3VYTA 4C3JB 1V8QA 3IFDA 3NWSA 2WINB 4L8JA 5K5PA 5M9OA 5LHY1 1IKMA 1V1OA 5IT9L 1HQRD 1SNOA 2R6GA 3K58A 1QCBD 3A8IE 3PUZA 4PNYA 3NUCA 1JB3A 1LTBD 2RVLA 1RF2D 5M5XB 3NWTA 3VR5A 1PTOC 4HSPA 4KHZA 2CQAA 3GD7A 1JCKB 1I4PA 2KVMA 1HFNA 3GTPB 1PRTD 3JAML 1IYUA 4WFN3 1B9MA 2F0HA 4QIWB 2EY2A 1DXMA 2MGSA 1RHPA 3SXHA 1GXDC 4DN4M 3D4WA 5C3XA 1SYCA 3J81L 4G7ZC 2DNEA 2EJGC 1A6XA 3VA7A 1PRTB 1BBXC 4XQQA 4ZKCB 2X6LA 1CHPD 1CQVA 1FD7D 1FGBD 1EY4A 1AN8A 4LMQD 2FINB 1B4OA 2G9HD 3MXGA 3ND8A 2NTTA 3NE5B 3L3OC 5FO8B 1QNUA 3L9AX 1ILPA 5CC4A 4K6LA 5KGUA 1SYGA 1EL0A 4EQOA 4TRDA 5JPMC 4F88A 1ONLA 3OIQA 3C1FA 2F0IA 3W3AA 1I4RA 4NP5A 4A3JB 1EY8A 1E2WA 2EYMA 3PIO3 1F77A 3J80L 2CW0C 1AFPA 4V0BA 2JA5B 3H0GB 4GZYC 1ET9A 1LT4D 3E0JA 3MFGA 3S14B 4HCSA 2NN6G 1Q90A 2PW5A 5A35A 1OXTA 1CHQD 2OF1A 1TVXA 2EPBA 1PTOB 4XIGS 1F9PA 1A15A 3GV3A 5EQ0A 1OXVA 4G57A 2BE5C 5JVG3 4HEDA 1Z47A 2ICIA 1LV9A 2PNRC 1HHVA 5HGTA 4FP5D 4O42A 1EY0A 5EJWA 2EYPA 3N52A 2X69A 2I07B 2J4XA 1PFNA 1NCVA 3X3NA 3Q24A 4RKLA 4KTAA 3PIP3 4RA8A 5C6AA 3ITPA 3EQLC 2EY1A 2BCOA 2V4DA 4OGQC 4C3HG 5CGKA 3SHLA 4ZKBB 3HOYB 1TS2A 2ID0A 2JA6B 1SDFA 2ZXOA 5IGEA 4M1UB 2A68D 5FK9C 3PV0A 3P75A 1LACA 1SNMA 2JEBI 4K5XA 4KI0A 2CW0D 1KNEA 4A3IB 4QB4A 3WOEA 1EYCA 3ERQA 5KNDA 1Q8IA 4H13C 4IFDI 4XYQA 2K33A 4A3DB 2IX3A 5CBAE 1DD2A 1A3TA 3VYRA 2IX0A 2E75C 2R7ZB 3E6ZX 2JEAI 2R3ZA 1TS4A 2NN6I 2B2UC 1B2TA 3K59A 1S5FD 1VF5C 2E74C 3QG1A 4RWSC 4HSVA 2B2TC 3NTKA 3HOVB 4C3IG 4OO1I 2JA7B 4RGOS 3G7LA 4FO2A 1KDBA 1NUCA 5M3FB 1FNUA 5C0XG 2DNCA 2DY8A 1HTLD 3DM1A 1X3QA 4HR7B 4HMIA 3KLSA 1WTVA 5C5LA 4ZYSA 1CA6A 1C48A 4MIUA 2Q8RE 5I9PA 5E4XA 4V190 1DOLA 2K01A 4LK1C 2H1EA 4K2KA 1S5CD 3FPPA 4DF7A 3C3LA 1QOHA 2OXPA 1GUSA 3T16A 4XDXA 4FF2A 3M4OB 3DEOA 1CK1A 1WTWA 1TWFB 1HRJA 3S1MB 1EY5A 3O13A 3HRZC 3HOXB 5EKLA 2TMPA 4C1NI 3NBIA 1B3AA 5FKAC 4IUUA 1MD2D 2AUKA 2IJ0A 4ZQ3A 2EYHA 3X3MA 3OIPA 3OHXC 1NR4A 1F9RA 4ZUIA 2DN8A 3T4AC 1LTID 3P7JA 2WV6D 4EGVA 3OWEB 4RGTA 1TY0A 4WJWA 3H3VC 3MVVA 5J39A 3M3YB 1SYFA 2Z4IA 3QO2A 3R3OA 3TP5A 2F0NA 2LMCB 4FF1A 3H09A 1QNKA 2QF7A 4P2CB 1Q12A 5C0XI 2L0CA 4BA2I 2PCFB 1I4GA 3S1NB 4R8NA 4A3MB 1I4HA 3T56B 1BCPF 3K7AB 2RDFA 2IWHA 3UI2A 4OIKA 1HFGA 3GTMB 1G2SA 4J1MA 1SYDA 1IYVA 2PYKA 2NVYB 1E2VA 1D5ZC 4TSSA 5A2QE 4O1NA 2XRQD 3MHBA 3OMGA 2R92B 1NAPA 2J7ZA 4DAYA 1ZYRD 3SE0A 1F9SA 2C9OA 4X3TA 1ENFA 1U4PA 4H0LC 1SFOB 3VYSA 1TWAB 1E0BA 2XWJB 4IALA 1SNPA 3P1HA 1W6KA 5EKIA 1F2YA 1XXGA 2O2LD 2NVQB 2MPMA 4RHRA 5IT9E 2PPBC 1J8IA 3LX0A 4LAAA 1TS5A 2PMZB 1MGSA 1BF4A 2F1MA 4IUPA 2RDGA 4IZ8A 3CU7A 5ELFA 3BYTB 3I72A 5IGDA 3TP7A 4I7ZC 1STGA 3MWYW 2WP8J 3HP3A 1Q1BA 2YU9B 1LT6D 2O4XA 1SJHD 1AZPA 4ODGA 2A69D 4EVOA 3Q0AA 1KABA 4IURA 4PMWA 3U9SA 1QWYA 3BDOA 2R93B 1G8ZD 1S4ZA 3U9OA 3V05A 2QEJC 1U9RA 4DAVA 4IUTA 4KK7A 4DK1A 2F03A 3T51B 4XYOA 3TZUA 1H9MA 5J22A 4DNTB 4IUVA 2I46A 1VF7A 4K5VA 5I2YA 3GTLB 5EPKA 1U4RA 2EYJA 3PUXA 3LNNA 1GHJA 4C2MB 1FR3A 4MHEA 5KNCA 2RKSA 1BO0A 2B2VA 5C4XB 1KLUD 2F0KA 2K03A 3KLRA 1DOKA 1JOKA 3J80E 1QB5D 1D1IA 1S5BD 3DMUA 1CTMA 1QG7A 4FXKC 2AQ1B 3RD4A 1EZ8A 2K28A 1EWCA 3KUPA 3SK5A 3VR6A 1BNZA 3H6MA 3Q6SA 3BS1A 2EYFA 1ZKOA 2XSCA 1YNJC 1H9SA 3IFTA 1PDQA 3IKJA 3D8GA 1UNSA 3S1RB 1D1KA 3H94A 1O7YA 5C4JB 1TT2A 1T5XD 4K2LA 4IN3A 3QOLA 3TDQA 4AYBB 2D62A 1EQTA 3D4RA 2RSNA 3DWPA 2GA4B 4HN7A 1XTCD 3PO2B 4NW2A 2XRSD 1BDOA 1WVLA 1GUNA 3HOZB 1DCZA 1PYWD 4A3GB 1STAA 5T1IA 3I90A 1U4LA 5I6YA 2NVXB 4JBWA 1XYIA 1IW7D 2HQEA 5KNBA 4ZRZA 1STYA 2KEDA 5JAVA 4X3KA 5DM73 4HMJA 5CBEE 5BN3A 5IGBA 1EOTA 4WRDA 1K8MA 3K5MA 3M7GA 2B8FA 1I50B 3V96A 2L1BA 3MXPA 2F0GA 1WTXA 1K83B 4R9WA 5C3EB 3NP8A 3D6WA 1WTRA 1STNA 2AQ3B 5E3FA 1RTNA 1JC7A 1VDZA 5JJZA 4RGNA 1FYCA 3PO3B 1ENAA 2D5DA 1YNNC 1YNJD 1RTOA 5NUCA 4DU9A 1K8OA 2F4IA 1QJOA 3NSWA 2L11A 4R8IA 5G3LD 1C4QA 1D2BA 2WACA 5CV5A 4Y7NB 1PTOD 2B2WC 3KBXA 1M8AA 1H9JA 2YYZA 2NWGA 2EY5A 1TWGB 3GTKB 1EIGA 2R61A 3MC0B 4HTHA 2LKVA 2KJXA 4FNFA 1LT5D 2NTSA 5BN5A 1SE2A 4FF4A 2K04A 4F87A 1PFBA 3QJYA 5BN4A 3S2HB 3OSOA 2NB0A 2XIWA 2VXWA 3HZXA 1R4PB 1PTOH 2B39A 2K5DA 4CHTB 4A3KB 1C8CA 3CRKC 2NBFA 2VB3X 4CGYB 3OWFA 4BY1B 2IT1A 1CZGA 5JEAH 2A6HC 1ENCA 4OHJA 5CR3A 1V43A 1UAPA 4F8MA 5FLXE 1YNND 1SJED 2BA1A 3CHBD 3QIAA 2FMCA 2E2JB 4N9TA 1JR0D 4A3BB 1D6EC 2FJ2A 1D5MC 3GO5A 4QUFA 4KKUA 3NXWA 3S15B 3K5OA 1HA5A 4C3JG 5FO9B 5DM63 5JPNC 3OMCA 3NTHA 1XWEA 1GUOA 2F0QA 5K36H 4EQNA 4KMUC 1I3QB 1HCZA 1X3PA 2LFNA 1EY7A 3EJIA 1EQVA 2BE5D 2QDBA 2FHTA 1JE4A 1Z7TA 2Q8TA 4G4KA 1PXUA 4B9XA 1Q3LA 3I4MB 4KKTA 3I8ZA 4ULLA 1SAPA 1X32A 1DOMA 2EJMA 1JOOA 4BBSB 2KCNA 4G7OC 1R9TB 3IAYA 2A6HD 1QE6A 4ME5A 2JYOA 3J7AV 3A7LA 3TBIB 2EVBA 1ML0D 4KY6A 1FNVA 4UAIA 2ZXRA 4BY7B 2K32A 3HKZB 4KD3A 4QUCA 5C4HA 1JORA 5CORA 2NUCA 2BDNA 3QWNA 4K8IA 5D14A 3EROA 4I65A 1GUTA 1B53A 3A8KE 1A2UA 2SNSA 2F0MA 2JSOA 1EY9A 4KJNA 2BDOA 4PV1C 5M3MB 2AWNA 2KQ3A 1F2MA 3RUZA 2BA0A 1B9NA 1DONA 1SYBA 1OXXK 2KUMA 3LWEA 1PLFA 3R2IA 3NTIA 4BBRB 1SXTA 5M5YB 5ELEA 2B2TA 3BVGA 2CHBD 2IX1A 1SYEA 2IW3A 1I4XA 5CV7A 1S5ED 4ZUJA 3QB3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CBV A;  3BS1 A;  4XQJ A;  4XQQ A;  4XYO A;  4XQN A;  4XXE A;  4XYQ A;  4G4K A; 
#chains in the Genus database with same CATH topology
 1RDP D;  3K0Y A;  1FL0 A;  3NQI A;  2MO1 A;  2NZO A;  2EE1 A;  3GP7 A;  1HZC A;  1LT3 D;  4JI8 Q;  3Q23 A;  1TKW B;  4IJL A;  2HDM A;  1F2Z A;  2F3V A;  1PH7 A;  3I91 A;  1ASY A;  2K1B A;  3E0E A;  3CQZ B;  1PH3 A;  3BVZ A;  3FEW X;  3GTO B;  5JEA J;  5HUR A;  2D9U A;  4NXM L;  1UE1 A;  5C3W A;  2DJG C;  4LWC A;  1KDA A;  1SE3 A;  3BG3 A;  1VMC A;  2SNM A;  2UXB Q;  3A74 A;  4CDC C;  3S2D H;  1XMO Q;  1KD1 C;  1VCI A;  2HCC A;  2UXC L;  4LFA L;  2VS1 A;  3MXN A;  4Q0F A;  2VUM G;  4DXF A;  1WTP A;  3FP9 A;  3KF8 A;  3TP6 A;  2JA6 G;  3S1N H;  4A3M H;  2DY7 A;  1LTG D;  4RHS A;  1BOS A;  1MHW C;  2HD3 A;  3K7A H;  3K5N A;  2SDF A;  1EZ6 A;  2O5I C;  2KEN A;  1WD1 A;  3EVQ A;  1MSG A;  1GVP A;  4BWG B;  2CWA A;  3H15 A;  5K36 G;  5KYL A;  3MA2 B;  2XN9 C;  3GTM H;  4A3I G;  4BXX H;  1BR9 A;  4UP7 A;  1B8A A;  3TSS A;  2MJ8 A;  4YWK A;  2NVY H;  1FJG Q;  1A0I A;  1X3E A;  2K5Q A;  2PO4 A;  1QVF A;  2R92 H;  4A3D G;  1STB A;  2M2L A;  1I94 L;  4NMZ A;  5DAU A;  2WKD A;  1UE6 A;  3TN2 A;  4B9W A;  3F8T A;  2D0O A;  1O7L A;  3MAQ A;  3HS0 C;  1STE A;  2R7Z G;  2F0E A;  1SFO H;  1H95 A;  4FYD A;  1M4V A;  5IOD A;  1BCP C;  3J81 j;  1TWA H;  1HNX L;  5KYI A;  5AJ3 Q;  3GTQ B;  1AZQ A;  1N34 Q;  2FFK B;  4GKK Q;  4DR2 Q;  1TWC B;  4DR6 L;  4OIJ A;  1T5E A;  2KHI A;  4ZCK A;  2B2Y C;  2F0O A;  3HOU G;  1Y1W G;  4DR7 Q;  1LO5 D;  4JBK A;  3R2T A;  3OYY A;  2CH4 W;  2NVQ H;  2A73 B;  1YHQ A;  3G71 A;  1VQ8 A;  3OW7 A;  4ILW A;  2F0U A;  5I9O A;  1ET6 A;  3HOV G;  3HOW B;  3I4L A;  1LUZ A;  1A2T A;  1UUP A;  2AQ2 B;  2JA7 G;  4JV5 L;  2WAQ B;  4MN3 A;  1ESF A;  1AEX A;  2E76 C;  1PFM A;  3FDT A;  2N3S A;  5M3F G;  2EYL A;  2KEE A;  3NBH A;  4QF4 A;  1DZ1 A;  3JAM E;  1PZJ D;  2EOT A;  5EKK A;  1JT8 A;  3K0X A;  1D8L A;  2JP1 A;  2ZTD A;  1EY6 A;  4JBJ A;  1IL8 A;  1DYQ A;  1PRT F;  3H3V H;  4X66 Q;  1EIY B;  3FVQ A;  4CKC A;  3OPO A;  4AIM A;  1V1P B;  3PMF A;  1OXU A;  2F0W A;  2HDL A;  3J81 E;  4B08 A;  3TRE A;  2PZW A;  4QCL A;  4KY5 A;  3I70 A;  2YU9 H;  3F2C A;  2PZU A;  3RZO B;  1AH9 A;  2ZXP A;  2PW7 A;  3E3X A;  2KHJ A;  2MHV A;  4IFD H;  5LMU Q;  2R93 H;  1J5E Q;  4JI3 L;  1WCM B;  4KV6 A;  1Y1V B;  2RHQ B;  4K8J A;  4XXE A;  2WFW A;  3K7U C;  5IWA L;  1UE5 A;  3T13 A;  3HOX G;  2NN6 H;  4QL5 A;  4X3S A;  2K05 A;  2IY5 B;  1PZK D;  1BCP D;  2GN5 A;  3GV6 A;  1HNZ Q;  4BS9 A;  1JWM D;  2EJF C;  4JPB W;  1JWU D;  1L2F A;  5ELO A;  5GAG C;  1RCV D;  3GTL H;  3EFX D;  3C46 A;  2UU9 Q;  2LS0 1;  2JE6 I;  3H91 A;  1L1O A;  4B3M L;  2QDL A;  3QOJ A;  1PH5 A;  2HIX A;  1CKM A;  3WDN A;  4K5W A;  3FKI B;  3I3C A;  2KEC A;  1XNQ L;  3DLL A;  2RQX A;  4AQY L;  3TZD A;  4OO1 H;  4L6T B;  4C2M H;  1JB7 A;  1ZEQ X;  1HA6 A;  1WD0 A;  2D2C C;  2Z1C A;  1SNQ A;  5D3D A;  5C4X H;  1L0Y B;  1BCP B;  4OEL B;  1SBB B;  3C2P A;  1PTO F;  5A2Q L;  1O80 A;  3SK8 A;  4XQJ A;  5C44 B;  4H44 C;  2PZT A;  4C3H B;  2MUY A;  1A3U A;  3C1E A;  1OO9 B;  1R4Q B;  2CCZ A;  3NHH A;  3BZD B;  3K81 C;  1VMP A;  4CBV A;  3HKZ E;  4DR5 Q;  4DR3 Q;  1J9O A;  2B8G A;  1TWH B;  3S17 B;  2F0J A;  4EX5 A;  2H4O A;  1PH9 A;  4FF3 A;  1GOZ A;  4J15 A;  1STH A;  1X56 A;  4FXG C;  4U67 3;  3UDX A;  1IL2 A;  2F3I A;  1CZW A;  5ISR A;  2UUB L;  4A3M G;  4DV2 L;  4NKL A;  5DLQ E;  2I0Q A;  1IHZ A;  4JI5 Q;  4DGZ A;  1MKH A;  3S1R H;  1B50 A;  2L9H A;  1WFQ A;  4XT1 B;  5C4J H;  1D5X C;  2OT2 A;  1ZXT A;  2IL8 A;  5M5X H;  4FXD A;  3AEV A;  4X3U A;  3QR8 A;  3TP8 A;  4BXX G;  2E5L Q;  4ZLT F;  5CV8 A;  3A5Z B;  3MTS A;  4PMB A;  4EQP A;  2ALY B;  1YI2 A;  2ZT9 C;  4KN4 C;  2RDH A;  5J1Z A;  2F0V A;  1GKH A;  1N33 L;  2R92 G;  4A3C H;  3CCQ A;  5KIX A;  2EIF A;  4Z9C B;  2VY3 A;  4YWM A;  4YCV A;  1UEA B;  2OEO A;  5IYC H;  4DV1 Q;  3HOZ H;  1JOQ A;  2L55 A;  2SOB A;  4GN3 B;  1LYL A;  4R4O A;  4UPA A;  1TR5 A;  2WKC A;  2Q8I B;  4RCN A;  3D6C A;  3PUY A;  4JI8 L;  2NVX H;  3LWU A;  1H9S B;  1HUM A;  4IQZ A;  3ER0 A;  5IGC A;  1ICW A;  1VQO A;  4LF9 Q;  1EIH A;  2LY7 A;  1B70 B;  4C3I B;  5EBC A;  2EZV A;  2UXB L;  1I50 H;  1II3 A;  2E2D C;  3KK7 A;  1E3P A;  3DWQ A;  3ZJY C;  1K83 H;  5KEE A;  2K52 A;  1Q86 C;  4OWT B;  2A74 C;  5KRU A;  2ES2 A;  5C3E H;  2UUC Q;  1JE5 A;  1Y69 U;  4KKS A;  4PZ8 A;  1G29 1;  1WTQ A;  4HAE A;  1IKL A;  5C0X H;  3I73 A;  3A56 A;  4IJH A;  3CC2 A;  4NXM Q;  3DWA A;  1KNA A;  3DEP A;  1X54 A;  4TQU S;  5COY A;  3PUV A;  5AFW A;  3CCS A;  1EWH A;  2Q2I A;  3EBE A;  2FMM A;  3EIV A;  4A3E G;  2UXC Q;  4LFA Q;  1JWS D;  1G6Z A;  4ID6 A;  4APV A;  1BKB A;  4P75 A;  1QUQ A;  4JI1 L;  3RN5 A;  1MJC A;  4A3F B;  2ASB A;  1L0X B;  3N6R A;  3SVM A;  3AB9 A;  4Y7N H;  4DK0 A;  2A68 C;  2VL6 A;  2JA5 H;  1PH4 A;  1TWG H;  1Q82 C;  1C0A A;  2XWB B;  4X62 L;  5IIF A;  4IFD J;  5IGF A;  4IFD G;  1NNX A;  3AMU A;  4J8Q A;  2R93 G;  2B63 B;  1CKN B;  1EFI D;  1E1T A;  4NB3 A;  5IP9 H;  4IPD A;  1EYA A;  4G7H C;  1N36 Q;  2LXK A;  4A93 B;  4IOA A;  3BDC A;  2N88 A;  3L2P A;  5AJ3 L;  2Q2H A;  1N34 L;  3RLN A;  2CFM A;  3P20 A;  2WB1 B;  5CV4 A;  5LL6 S;  3T53 B;  5FO7 B;  3S2H H;  2JXM B;  3J7A 5;  2K7V A;  4QMG A;  1QIL A;  2Z6K A;  3FHW A;  4JOI C;  2F0T A;  3MZ5 A;  4DUY Q;  5JVH 3;  4A3K H;  2L5T A;  1Y8N B;  2M00 A;  4IPH A;  5C5M A;  1HQM C;  4RFB A;  4CJ1 B;  3BYY B;  4OO1 G;  5IP7 H;  4DNR B;  3IL8 A;  5C4X G;  1RL2 A;  3G6E A;  1PFS A;  4BY1 H;  3BDL A;  2Z9H A;  4K6D A;  1YJ9 A;  4B3T Q;  1X3F A;  3SK6 A;  2WAQ E;  4X64 Q;  3I4N B;  3D3R A;  2MO0 A;  1VQJ A;  2CVR A;  4F7X A;  3Q22 A;  3VR4 A;  4HJ8 A;  1S5D D;  3VR3 A;  5IYB G;  1EU3 A;  3HOY H;  2JJQ A;  4OWX B;  1LTT D;  2B2W A;  3OTO Q;  5I6W A;  2EDG A;  2E2J H;  1SMY C;  3R8B A;  3GDE A;  2G9D A;  3M85 A;  1K73 C;  4A3B H;  1P16 A;  4DR1 Q;  2VUM B;  4DA2 A;  5ELB A;  3OOC A;  2F0F A;  3S15 H;  1J5E L;  1YIT A;  1ILQ A;  3KLW A;  2KOL A;  2QKI C;  5GRO A;  2E2H B;  3FPU B;  3RZD B;  1I6H B;  3DHQ A;  3RMH A;  2EY6 A;  3KJO A;  1VQ5 A;  2J0T D;  3ULP A;  1KTK A;  1N8R C;  3URY A;  1SR3 A;  4AYB G;  1I3Q H;  4NDX A;  1P8L A;  4POF A;  4CJ0 B;  2I5M X;  2K5W A;  1CT1 D;  3ONA B;  3CXC A;  1NR2 A;  2EQS A;  2KCT A;  3CC4 A;  2Z0S A;  4A3C G;  5DNF A;  2R7D A;  3S1Q B;  1G91 A;  1H9K A;  5IYC G;  2UU9 L;  3HOZ G;  4YCW A;  1PVO A;  1AP0 A;  1OXS C;  1HUN A;  3CME A;  5IWA Q;  4JK1 C;  5E1F A;  1HXY D;  2ATW A;  4LF8 Q;  4C56 C;  1BUV T;  4ZAI A;  1YJW A;  2KCC A;  3DXJ C;  5M5W B;  3UDG A;  3NK9 A;  1VQK A;  4UDU C;  2F3W A;  4O2D A;  1K9M C;  5CYU A;  3D4D A;  4UHV A;  5D3I B;  3I4M H;  1G2T A;  2QCP X;  3SK4 A;  1Q1E A;  1K28 A;  2KA7 A;  1N32 L;  4TKO B;  1XMQ L;  3MFY A;  1E7Z A;  3HOU B;  4KHV A;  5LL6 X;  1LTR D;  1XPR A;  1Y1W B;  5J3B A;  4OL7 A;  5F2D A;  1TQO A;  3J7Y W;  3CRL C;  4BBS H;  2SEB D;  3SEB A;  5D65 A;  4GLA C;  4ABN A;  3SDZ A;  1R9T H;  2YTV A;  5EPL A;  4PMC A;  3MXU A;  5CMD A;  1JIC A;  5C3E G;  2A6E C;  4LF5 Q;  3W1G A;  1MBY A;  1PMR A;  5FJ8 H;  5C0X J;  4GNX A;  1EU4 A;  2ZJP A;  4BY7 H;  2XVS A;  1SMY D;  3AU7 A;  4PQX A;  3CCL A;  1LLR D;  1EIF A;  2F0D A;  2GVB A;  2H5X A;  2PQE A;  2ZJR A;  4M8A A;  2ENB A;  2PQA A;  1F9Q A;  4C1N K;  1F2L A;  1KDC A;  1VQ7 A;  3KDF A;  3L0O A;  4CKE A;  3KF6 A;  2VB2 X;  4IUN A;  2UUB Q;  5T1G A;  3T1H L;  1O7I A;  1HJP A;  2K75 A;  1ROD A;  1DM0 B;  2JA5 G;  3H0G G;  3W2D A;  2B2U A;  2F0L A;  4JBM A;  2PI2 E;  1AW7 A;  3RR5 A;  4DUZ Q;  3S16 B;  4RKB A;  2HHH L;  1CFM A;  5E4W C;  3RLO A;  1RJT A;  4HJA A;  5M3M H;  3SGI A;  1LAB A;  1GM5 A;  1LTA D;  1FNW A;  1SE4 A;  1HPC A;  1MIU A;  2A5H A;  3ZYY X;  4GOP A;  3GTJ B;  4EQ5 A;  1BXT A;  1CI3 M;  1NSN S;  1U5K A;  1U0L A;  5FLX L;  4LF9 L;  4H7B A;  4BBR H;  1I6V C;  5TSS A;  5M5Y H;  4WOR A;  3CKI B;  3KBG A;  4CJ2 C;  4UP8 A;  3CMA A;  4HJ9 A;  1HTP A;  1ZYR C;  2E2I B;  2E8G A;  3CCU A;  3E9H A;  4PG3 A;  1PZI D;  4DAM A;  4QGU A;  4DAP A;  1KAA A;  2PNH A;  2MP1 A;  5IY0 A;  2UUC L;  4U68 A;  1BQQ T;  1UEB A;  2L12 A;  5DEH A;  3F2U A;  5IP7 G;  5C4Z A;  1A63 A;  1YVC A;  5JEA G;  4JI6 L;  5LMN L;  4N9P A;  5IGG A;  3E5S A;  3TRZ A;  3ND9 A;  3M3Y H;  3CQZ H;  3HEJ A;  2A6E D;  3MEH A;  4HIM A;  3M7N A;  3GTO H;  3K57 A;  1PH2 A;  4K14 A;  2XGT A;  1EQR A;  1HZA A;  4IPG A;  1KLG D;  1BBW A;  3PGZ A;  1B44 D;  2V1C C;  5I2X A;  1LTS D;  3HOY G;  5ELC A;  3S2D B;  2K5N A;  3HG9 A;  1B1Z A;  1WTH A;  2F0S A;  4A3B G;  1S40 A;  4Q5V A;  4DXG A;  4E6I A;  2NZ1 D;  1SNC A;  1O78 A;  3WOF A;  1HH2 P;  5GQO A;  4HCE A;  4XQN A;  1N36 L;  1OTC A;  1J6Q A;  3WWV A;  5I4D A;  1I5F A;  3VYU A;  1K0S A;  4JG2 A;  4L63 B;  4JI1 Q;  1Y8O B;  4RG1 A;  1GHK A;  2AWO A;  3NQT A;  2A69 C;  2FXQ A;  4OWW B;  5ELN A;  2ZJQ A;  1B3Q A;  1H9R A;  2ICE C;  4MTK A;  4X62 Q;  4S3S A;  4YHH L;  2HUG A;  4RH6 A;  1VQN A;  4DUY L;  4KD4 A;  1PV4 A;  1VQF A;  1TU2 B;  3DUZ A;  1IBL Q;  1YEZ A;  2CH4 A;  2XTI A;  3KF8 B;  2A19 A;  3A7A B;  3V2T A;  1X6O A;  2VQE Q;  3I2Z A;  1EEF D;  3BVM A;  2NVT B;  5EBD A;  3GTQ H;  3I4M G;  1CQF A;  3L7Z C;  2IPK D;  4B3T L;  1SLJ A;  3BZC A;  1MSH A;  4X64 L;  2IHF A;  1RD9 D;  1TWC H;  1V1P A;  4FVM A;  1RKN A;  2L4N A;  2NYZ D;  3TME A;  1U4M A;  2RBM A;  2RA4 A;  4BBS G;  3A8J E;  1TY2 A;  1CM9 A;  4JI7 Q;  1DJR D;  4DAY B;  3HOW H;  3R93 A;  3OTO L;  2Z8L A;  1KL9 A;  4YIJ A;  1SEB D;  4DK3 C;  4DR1 L;  2B2V C;  5ELD A;  3SR1 A;  4JI4 Q;  1YNX A;  4BY7 G;  2C5C A;  2HCI A;  2EYO A;  3KLS X;  1TII D;  1EOV A;  3HKZ G;  3D31 A;  3FRP B;  5IOC A;  3A54 A;  5JOB A;  1KQS A;  4KJO A;  3J7A F;  3J80 i;  1A3V A;  1E2Z A;  3GQB A;  4LJZ C;  4XT3 B;  1KAW A;  4BA1 I;  5LMN W;  1HNW L;  4A3E B;  2M9V A;  2RSO A;  4K0K Q;  4J6H A;  4R4C A;  1E1O A;  1FGU A;  3NPP A;  4MTN A;  5IYD H;  1Y8P B;  4ZK9 B;  3HGB A;  1G6P A;  3RZO H;  4GKJ Q;  1O7Z A;  3PUW A;  1UE7 A;  5CV6 A;  1YBY A;  2B29 A;  1EEI D;  1GJX A;  5HY6 A;  4RGM A;  1E22 A;  1EYD A;  5JJL A;  4LUV A;  2XNA C;  2JA8 B;  1WCM H;  2VNU D;  4LF8 L;  1FVI A;  2BH8 A;  1Y1V H;  5JJK A;  4IUQ A;  4WJ3 M;  4A3L G;  1IXR A;  3NBH B;  1EQQ A;  3S9W A;  3U4V A;  1YJN A;  2WII B;  2F0P A;  1I4Q A;  4R4I A;  1TS3 A;  2AUJ D;  3GTG B;  2B2Y A;  4KY7 A;  4RAU C;  1PRT C;  2X6G A;  4DNI A;  3CC7 A;  1VQI A;  1VQC A;  3AYH B;  3A55 A;  1VQA A;  3K6O A;  3M4Y A;  4CKB A;  2TSS A;  4DFA A;  4CDE C;  4IOC A;  3EA6 A;  1XX8 A;  4OXP A;  3K5L A;  4RCO A;  4LF7 Q;  3RLF A;  1JQY D;  2QIL A;  1CA5 A;  2N55 A;  1WTO A;  5G3L F;  3VDY A;  5FLX c;  2KHS A;  1EYG A;  2YTY A;  1IW7 C;  2EXZ A;  1WI5 A;  1SMX A;  3FKI H;  2BOS A;  4LF5 L;  1W6J A;  2Y0S B;  3FMC A;  1GUG A;  1N32 Q;  4KN7 C;  1XMQ Q;  5CV9 A;  4MNO A;  5EGT A;  3VR2 A;  4XTC S;  1WJJ A;  2PI2 A;  2QA4 A;  2A8V A;  5FOB B;  4X65 Q;  3Q8D A;  1SSO A;  2Z4H A;  1Q46 A;  2P5Z X;  3VA5 A;  1SND A;  5C44 H;  2DJF C;  4C3H H;  1GUW A;  3G6J B;  4CDF C;  1MI2 A;  1ESR A;  2O5J C;  1Z6H A;  5EPJ A;  3TQY A;  2K6A A;  1TWH H;  4QJF A;  3VYT A;  4DV6 Q;  4YCU A;  4C3J B;  1V8Q A;  3IFD A;  4QY7 A;  4DUZ L;  1ICF B;  3NWS A;  2WIN B;  4L8J A;  5K5P A;  5M9O A;  1C9O A;  3PCO B;  5LHY 1;  1IKM A;  1V1O A;  5IT9 L;  1HQR D;  1SNO A;  2R6G A;  2JA9 A;  3K58 A;  1QCB D;  3A8I E;  1NE3 A;  3PUZ A;  2OWO A;  4PNY A;  3NUC A;  1JB3 A;  1LTB D;  2RVL A;  1RF2 D;  5M5X B;  1PH1 A;  3PO2 H;  3NWT A;  3VR5 A;  2EXD A;  1PTO C;  4HSP A;  3T1H Q;  3TEH B;  4KHZ A;  2CQA A;  3GD7 A;  3ICE A;  1GD7 A;  4KHP Q;  1JCK B;  1I4P A;  2HHH Q;  1L0W A;  2KVM A;  4A3G H;  1ASZ A;  5GAH C;  1HFN A;  2K50 A;  4POG A;  3GTP B;  1PRT D;  1KRT A;  3JAM L;  1IYU A;  1V9P A;  3UE0 A;  4WFN 3;  3D0F A;  1B9M A;  2F0H A;  4QIW B;  4LFC Q;  2EY2 A;  1DXM A;  2MGS A;  1RHP A;  3SXH A;  1VQP A;  1GXD C;  4OX9 L;  4DN4 M;  3D4W A;  2K5H A;  5C3X A;  1SYC A;  3J81 L;  1X55 A;  4G7Z C;  2DNE A;  2EJG C;  2ZTE A;  1A6X A;  3VA7 A;  1NJI C;  2RCF A;  1BBU A;  1PRT B;  3I4O A;  4C3I H;  1BBX C;  4XQQ A;  1JJG A;  4ZKC B;  2X6L A;  4DV4 Q;  1CHP D;  1NMG A;  2CQO A;  1CQV A;  1FD7 D;  1FGB D;  1EY4 A;  3HOW G;  2Z6K C;  3B6Y A;  1AN8 A;  3NEN A;  3CPW A;  4LMQ D;  2FIN B;  2WAQ G;  5LMN Q;  4JI6 Q;  1B4O A;  2G9H D;  1CKN A;  3MXG A;  3ND8 A;  1S72 A;  3T1Y Q;  2NTT A;  3PO3 H;  4YWL A;  3NE5 B;  3L3O C;  5FO8 B;  1QNU A;  3L9A X;  1QZH A;  3PF5 A;  1ILP A;  5CC4 A;  3K80 C;  4K6L A;  5KGU A;  2N8N A;  3S24 A;  1SYG A;  1EL0 A;  2LXJ A;  4TRD A;  4EQO A;  5JPM C;  4F88 A;  1ONL A;  4LF6 Q;  1TXY A;  3OIQ A;  2VQF L;  3C1F A;  2F0I A;  4P72 A;  3W3A A;  1I4R A;  1Q7Y C;  4NP5 A;  5IYD G;  4A3J B;  3GTK H;  1GO3 E;  4A3F H;  1W2B A;  1EY8 A;  1E2W A;  2EYM A;  3PIO 3;  1F77 A;  3J80 L;  2CW0 C;  1AFP A;  3BJU A;  4V0B A;  1VQM A;  2JA5 B;  3H0G B;  2F52 A;  3I7F A;  4GZY C;  1ET9 A;  1LT4 D;  3E0J A;  3MFG A;  4LF4 L;  2B63 H;  3S14 B;  1IBL L;  1WCM G;  4HCS A;  2NN6 G;  1Q90 A;  2VQE L;  1Y1V G;  2PW5 A;  5A35 A;  1OXT A;  4A93 H;  1CHQ D;  2OF1 A;  1TVX A;  5BR8 L;  1M1K C;  2AKW B;  2EPB A;  4YHH Q;  1PTO B;  2IHE A;  4XIG S;  2G5D A;  1F9P A;  1K8A C;  1A15 A;  1QZG A;  3GV3 A;  5EQ0 A;  1NTG A;  1OXV A;  4G57 A;  2BE5 C;  4JI7 L;  5JVG 3;  4HED A;  1Z47 A;  1QUQ B;  2PNR C;  1LV9 A;  2I5H A;  2ICI A;  2OCE A;  4DR4 Q;  1HHV A;  2L15 A;  1A62 A;  5HGT A;  4FP5 D;  4O42 A;  3JC6 6;  1EY0 A;  5EJW A;  2EYP A;  3N52 A;  1WYD A;  2X69 A;  2I07 B;  4JI4 L;  2J4X A;  1PFN A;  1NCV A;  2C35 B;  3X3N A;  3Q24 A;  4RKL A;  1SE8 A;  4KTA A;  3PIP 3;  4RA8 A;  3W1B A;  5C6A A;  1NY4 A;  1N9W A;  3ITP A;  3EQL C;  1PA6 A;  2EY1 A;  2BCO A;  3G48 A;  2V4D A;  3KOJ A;  3I4N H;  4OGQ C;  4C3H G;  5CGK A;  2UXD Q;  4K0K L;  2RF4 A;  3SHL A;  3AFP A;  4ZKB B;  4DK6 C;  1XJV A;  3HOY B;  1TS2 A;  2ID0 A;  2JA6 B;  1SDF A;  2ZXO A;  1XPU A;  4GKJ L;  5IGE A;  1SN8 A;  4M1U B;  2A68 D;  3E9I A;  5FK9 C;  3PV0 A;  3H3V I;  3P75 A;  1LAC A;  1SNM A;  2JEB I;  4K5X A;  2YTX A;  4KI0 A;  2CW0 D;  4GNX C;  1HNW Q;  1KNE A;  4A3I B;  2KCM A;  3RZD H;  1I6H H;  4JW0 A;  4QB4 A;  1XTD A;  3WOE A;  1EYC A;  3PO2 G;  3ERQ A;  5KND A;  1Q8I A;  2LSS A;  4H13 C;  2QGQ A;  4IFD I;  4XYQ A;  2K33 A;  1NBW A;  1IBK L;  4A3D B;  2IX3 A;  3BZK A;  1PHJ A;  5IT9 c;  4A3G G;  5CBA E;  4JOI A;  1DD2 A;  4N8X 1;  1A3T A;  4LF7 L;  4R1J A;  3VYR A;  5FLM H;  2IX0 A;  2E75 C;  5L37 A;  2R7Z B;  3E6Z X;  2JEA I;  4GS3 A;  2R3Z A;  4LNQ A;  1TS4 A;  2NN6 I;  2B2U C;  1B2T A;  3K59 A;  1S5F D;  3LGJ A;  1VF5 C;  2E74 C;  2UUA Q;  4MZ9 A;  3QG1 A;  4RWS C;  4GOP C;  4JYA L;  5M5W H;  2I5L X;  4HSV A;  5HGQ A;  4LW1 A;  4N8F A;  2B2T C;  3NTK A;  3JAM c;  4OON A;  4X65 L;  3HOV B;  4C3I G;  4OO1 I;  2Y0S E;  2JA7 B;  4RGO S;  1HR0 L;  3G7L A;  4FO2 A;  1KDB A;  1NUC A;  3J81 c;  5M3F B;  1FNU A;  4DV6 L;  5C0X G;  2QW7 A;  2DNC A;  2DY8 A;  1HTL D;  4P71 A;  1PH8 A;  3DM1 A;  3PO3 G;  1X3Q A;  1PYB A;  4HR7 B;  4HMI A;  4LFB Q;  1LM0 A;  3KLS A;  3J7Z C;  1WTV A;  2AMC B;  1K3B C;  5C5L A;  4B3R L;  3UDF A;  4ZYS A;  4DKA C;  1CA6 A;  1C48 A;  1VQD A;  4MIU A;  2Q8R E;  5I9P A;  5E4X A;  4V19 0;  4KLK A;  1DOL A;  4L5R C;  2K01 A;  3STB C;  4LK1 C;  4KHP L;  2H1E A;  4K2K A;  1S5C D;  3FPP A;  2MQH A;  4DF7 A;  1QOH A;  3C3L A;  2OXP A;  1GUS A;  3T16 A;  4XDX A;  5IP9 G;  4PZ7 A;  5IE8 A;  3S16 H;  4FF2 A;  3M4O B;  3DEO A;  1CK1 A;  4LFC L;  1WTW A;  2ZM6 Q;  1TWF B;  1HRJ A;  3S1M B;  4GN5 A;  1BVS A;  1EY5 A;  3O13 A;  3HRZ C;  3GTJ H;  3HOX B;  5EKL A;  1A8V A;  2TMP A;  4JI0 L;  4C1N I;  4GNX B;  1VQE A;  3J80 c;  4A93 G;  3DM3 A;  3NBI A;  1T9H A;  2JK8 A;  1B3A A;  5FKA C;  4IUU A;  1MD2 D;  2AUK A;  2IJ0 A;  4ZQ3 A;  4QIW E;  2EYH A;  4LUZ A;  3X3M A;  4A3K G;  1Z9F A;  2F4V L;  2E2I H;  4DV4 L;  3BU2 A;  3KDF B;  3OIP A;  3OHX C;  1IYJ B;  1NR4 A;  3KF6 B;  1F9R A;  4ZUI A;  1K0R A;  3M4Q A;  2N78 A;  4OX9 Q;  2DN8 A;  3CPF A;  4BY1 G;  3T1Y L;  1XNR Q;  4L5T A;  3T4A C;  1LTI D;  3P7J A;  2WV6 D;  4EGV A;  3OWE B;  4RGT A;  1TY0 A;  4WJW A;  2K5V A;  4A4I A;  3H3V C;  4DV5 L;  3MVV A;  5J39 A;  3F2D A;  4B3S Q;  4GOP B;  4O0A A;  3HKS A;  3M3Y B;  1SYF A;  2Z4I A;  3QO2 A;  3R3O A;  4LF6 L;  3I4N G;  3TP5 A;  2F0N A;  2LMC B;  4FF1 A;  3H09 A;  4UP9 A;  2QF7 A;  1QNK A;  1G51 A;  4P2C B;  4HIK A;  1Q12 A;  5C0X I;  3TS0 A;  2L0C A;  3PF4 A;  4BA2 I;  2PCF B;  1I4G A;  3PIO A;  3S1N B;  4R8N A;  4A3M B;  1I4H A;  3T56 B;  3U58 A;  1M90 C;  1BCP F;  3KYH C;  3K7A B;  2RDF A;  3STB D;  3CCE A;  1HR0 W;  2IWH A;  1VQG A;  3UI2 A;  4OIK A;  3ERS X;  2HQL A;  1HFG A;  3GTM B;  1G2S A;  4J1M A;  4JVZ A;  3JAM i;  4HID A;  2VQF Q;  1SYD A;  1IYV A;  4PZ6 A;  2PYK A;  2NVY B;  1E2V A;  1D5Z C;  1VQ9 A;  4TSS A;  5A2Q E;  4O1N A;  4DV0 L;  2XRQ D;  3MHB A;  3OMG A;  2R92 B;  1NAP A;  2J7Z A;  3J81 i;  3CCM A;  2WB1 E;  5E7N A;  4DAY A;  1HZ9 A;  1ZYR D;  5FLM G;  3SE0 A;  3MXN B;  1F9S A;  2C9O A;  4X3T A;  4LF4 Q;  1ENF A;  4A75 A;  4DR4 L;  1U4P A;  4H0L C;  1SFO B;  3VYS A;  2R7F A;  1TWA B;  1E0B A;  2XWJ B;  4OEM B;  4IAL A;  1SRU A;  1YHA A;  1SNP A;  3U50 C;  5BR8 Q;  4FDB A;  3P1H A;  1W6K A;  5EKI A;  3MEF A;  2NVT H;  1F2Y A;  1XXG A;  3PIP A;  4IPC A;  2O2L D;  2NVQ B;  2MPM A;  4RHR A;  5IT9 E;  2PPB C;  1J8I A;  3LX0 A;  4LAA A;  1TS5 A;  2UXD L;  4RMF A;  2PMZ B;  1MGS A;  1BF4 A;  2F1M A;  4IUP A;  1L1O C;  2RDG A;  4IZ8 A;  3CU7 A;  5ELF A;  5FJ8 G;  3BYT B;  4NXN L;  4JI2 Q;  3I72 A;  1QVG A;  5IGD A;  4I7A A;  3TP7 A;  3AQQ A;  4I7Z C;  1STG A;  4CDD C;  3MWY W;  2WP8 J;  3HP3 A;  2NZH A;  3ULJ A;  1Q1B A;  1Q8K A;  2YU9 B;  1LT6 D;  2O4X A;  1SJH D;  3RN2 A;  1AZP A;  4ODG A;  4A3E H;  2A69 D;  4EVO A;  3Q0A A;  1KAB A;  4IUR A;  5M3M G;  4PMW A;  4L5Q A;  3U9S A;  1QWY A;  3BDO A;  2R93 B;  3UDI A;  4DV7 Q;  1G8Z D;  1S4Z A;  3U9O A;  1XPO A;  3V05 A;  2JA8 H;  1YIJ A;  2QEJ C;  1U9R A;  4DAV A;  4IUT A;  4KK7 A;  4DK1 A;  2A1A A;  2F03 A;  3T51 B;  2UUA L;  2CKZ B;  4BBR G;  4XYO A;  4A76 A;  3TZU A;  1H9M A;  1IBK Q;  5J22 A;  4DNT B;  1E24 A;  4IUV A;  2I46 A;  3GTG H;  1VF7 A;  4K5V A;  5I2Y A;  3GTL B;  1AE2 A;  3AFQ A;  5EPK A;  1U4R A;  3F1Z A;  1JJC B;  2EYJ A;  1Q81 C;  3PUX A;  3LNN A;  3EN2 A;  1GHJ A;  2OQK A;  4C2M B;  2OTJ A;  1FR3 A;  1K3R A;  4MHE A;  3OW2 A;  5KNC A;  2RKS A;  1IZ6 A;  1BO0 A;  2B2V A;  4NPS A;  4JYA Q;  5C4X B;  1KLU D;  2F0K A;  2K03 A;  3I56 A;  3KLR A;  1DOK A;  1JOK A;  3J80 E;  1QB5 D;  1D1I A;  1S5B D;  3DMU A;  4LFB L;  4GN4 B;  1CTM A;  1QG7 A;  4TVA B;  4FXK C;  2AQ1 B;  1KC8 C;  3RD4 A;  1EZ8 A;  2K28 A;  1VQL A;  1HR0 Q;  1EWC A;  3KUP A;  3SK5 A;  3VR6 A;  4H02 A;  1BNZ A;  3S17 H;  3H6M A;  4YY3 Q;  3Q6S A;  3BS1 A;  5IYB H;  2EYF A;  1L1O B;  4DV3 L;  1ZKO A;  2XSC A;  1YNJ C;  1H9S A;  3IFT A;  1PDQ A;  3IKJ A;  1X9N A;  3D8G A;  4C3J H;  1UNS A;  3A5U A;  3S1R B;  1D1K A;  3H94 A;  1O7Y A;  1UWV A;  2K4K A;  5C4J B;  1TT2 A;  1T5X D;  4R4Q A;  2ZM6 L;  4K2L A;  3CAM A;  4B3R Q;  4IN3 A;  3QOL A;  3TDQ A;  4AYB B;  2D62 A;  1EQT A;  1KIX A;  3D4R A;  2RSN A;  2YV5 A;  3DWP A;  1EUJ A;  2GA4 B;  1D7Q A;  4HN7 A;  1XTC D;  4ME3 A;  3PO2 B;  4NW2 A;  2XRS D;  1BDO A;  1WVL A;  1GUN A;  3HOZ B;  1IBM L;  1DCZ A;  1PYW D;  4A3G B;  1STA A;  5T1I A;  3I90 A;  1U4L A;  4JCV E;  5I6Y A;  5JJI A;  3GTP H;  2NVX B;  4JBW A;  1KXL A;  4JI0 Q;  1XYI A;  5GAE C;  4HJ5 A;  1XNR L;  1IW7 D;  2HQE A;  5KNB A;  4ZRZ A;  1STY A;  1VQ6 A;  2DUD A;  2KED A;  5JAV A;  4B3S L;  4X3K A;  5DM7 3;  3W5O A;  4HMJ A;  3NEM A;  2RHS B;  1CKO A;  5CBE E;  5BN3 A;  2F4V Q;  5IGB A;  1EOT A;  1V1Q A;  4WRD A;  1K8M A;  3K5M A;  3RNU A;  2BH2 A;  3M7G A;  2B8F A;  1I50 B;  3V96 A;  2L1B A;  3MXP A;  2F0G A;  4IO9 A;  1WTX A;  1K83 B;  3PSI A;  4R9W A;  5C3E B;  3NP8 A;  1CSQ A;  1YZ6 A;  3D6W A;  1WTR A;  1XMO L;  4L5S A;  1STN A;  2AQ3 B;  2RCN A;  5E3F A;  1JC7 A;  1RTN A;  1VDZ A;  5JJZ A;  4DV5 Q;  3CW2 C;  1X65 A;  4RGN A;  1FYC A;  1LTL A;  3PO3 B;  1ENA A;  2D5D A;  1YNN C;  1YNJ D;  1RTO A;  5NUC A;  4DU9 A;  1K8O A;  2F4I A;  1QJO A;  3NSW A;  2L11 A;  1NMF A;  4R8I A;  1VS0 A;  5G3L D;  1AE3 A;  1HZB A;  1PYS B;  1C4Q A;  1D2B A;  2WAC A;  5CV5 A;  3KFU A;  3A0J A;  4Y7N B;  1PTO D;  2DGY A;  2Q2T A;  2B2W C;  3KBX A;  1M8A A;  3CCJ A;  1H9J A;  2YYZ A;  2NWG A;  2EY5 A;  1FJG L;  1TWG B;  2KBN A;  4A3J H;  3GTK B;  2Q2U A;  1EIG A;  2R61 A;  2MNA A;  1CSP A;  3MC0 B;  3H0G H;  4WJ4 A;  4HTH A;  2LKV A;  2KJX A;  4FNF A;  2JA8 G;  1LT5 D;  2NTS A;  3S14 H;  5BN5 A;  1SE2 A;  4FF4 A;  2K04 A;  4F87 A;  4DV0 Q;  1PFB A;  3IRB A;  3QJY A;  5BN4 A;  3S2H B;  2VW9 A;  2JN4 A;  3OSO A;  2NB0 A;  4GKK L;  2XIW A;  4DR2 L;  2VXW A;  3HZX A;  1VQ4 A;  1R4P B;  1PTO H;  2B39 A;  2K5D A;  4DPG A;  1I94 Q;  4JC0 A;  4DR7 L;  4CHT B;  1SRO A;  4A3K B;  1C8C A;  2N49 A;  3CRK C;  4UY8 C;  3FKI G;  2VZA A;  2NBF A;  4QQB X;  2VB3 X;  4CGY B;  4JI2 L;  3NEL A;  1HNX Q;  1EWI A;  3OWF A;  4BY1 B;  2Y0S G;  1Y14 B;  2B3G A;  2PMZ E;  2IT1 A;  5C44 G;  1CZG A;  5JEA H;  4DR6 Q;  2A6H C;  1ENC A;  1MJE A;  4OHJ A;  5CR3 A;  2QEX A;  1DGS A;  1V43 A;  4R4T A;  1UAP A;  3ULL A;  4F8M A;  5FLX E;  1YNN D;  1SJE D;  2BA1 A;  4X66 L;  3M9B A;  3QIA A;  3CHB D;  4NXN Q;  2FMC A;  2E2J B;  5GAD C;  4N9T A;  1JR0 D;  4JV5 Q;  4A3B B;  1D6E C;  1W3S A;  2FJ2 A;  1D5M C;  3GO5 A;  2VUM H;  4QUF A;  4KKU A;  3NXW A;  2JA6 H;  3S15 B;  3K5O A;  4DV7 L;  1HA5 A;  1C7Y A;  4C3J G;  3CCR A;  5FO9 B;  5DM6 3;  5JPN C;  3OMC A;  3NTH A;  1XWE A;  1X3G A;  2E2H H;  3TS2 A;  3G4S A;  1RIP A;  2HT1 A;  5LMU L;  1GUO A;  2F0Q A;  5K36 H;  1CUK A;  4GLV B;  4EQN A;  2JQO A;  1EFW A;  4KMU C;  1I3Q B;  4A3I H;  1HCZ A;  1X3P A;  2LFN A;  1VQH A;  3S1Q H;  3PQI A;  4A3D H;  1EY7 A;  3CP0 A;  3EJI A;  1HNZ L;  1VQB A;  2K14 A;  1EQV A;  2BE5 D;  2QDB A;  1KHI A;  2R7Z H;  2FHT A;  3CF5 A;  4JI3 Q;  1JE4 A;  1Z7T A;  2Q8T A;  4G4K A;  1PXU A;  4B9X A;  5EAY A;  1Q3L A;  3I4M B;  4KKT A;  2D0P A;  3I8Z A;  4ULL A;  3U4Z A;  1SAP A;  4AH6 A;  3UE1 A;  1X32 A;  1DOM A;  3HOU H;  1Y1W H;  2EJM A;  1JOO A;  4P74 A;  4BBS B;  2KCN A;  2MFI A;  4G7O C;  1R9T B;  3HOV H;  3IAY A;  2A6H D;  1QE6 A;  4YY3 L;  4ME5 A;  2JYO A;  3K8A A;  2JA7 H;  3HFZ B;  4B3M Q;  3A7L A;  3J7A V;  3TBI B;  2EVB A;  4DR5 L;  1ML0 D;  1XNQ Q;  4DR3 L;  4KY6 A;  1FNV A;  4AQY Q;  4UAI A;  2ZXR A;  5M3F H;  2GVA A;  4BY7 B;  4X6A H;  2K32 A;  1WOC A;  3HKZ B;  4KD3 A;  4QUC A;  2HIV A;  5C4H A;  1B7Y B;  1S3O A;  4JI5 L;  1JOR A;  5COR A;  2NUC A;  4HIO A;  2BDN A;  4ALP A;  3QWN A;  4K8I A;  1YHB A;  3KJP A;  5D14 A;  3ERO A;  4I65 A;  1GUT A;  4LUO A;  4A3F G;  2CWP A;  1B53 A;  3A8K E;  4DV3 Q;  3CCV A;  2E5L L;  1A2U A;  2SNS A;  2F0M A;  2JSO A;  1EY9 A;  4GLX A;  4A3J G;  4KJN A;  4P73 A;  1K8G A;  3F2B A;  2BDO A;  4PV1 C;  4AYB E;  5M3M B;  2B63 G;  2AWN A;  2KQ3 A;  2AHO B;  4DV2 Q;  1F2M A;  3RUZ A;  2BA0 A;  4DV1 L;  4Y52 H;  1KRS A;  1B9N A;  2OQ0 A;  3M4O H;  1DON A;  1JMC A;  3CD6 A;  3I55 A;  2Z6B A;  1SYB A;  1JJ2 A;  1OXX K;  1TWF H;  2KUM A;  5H1S E;  2WB1 G;  3LWE A;  3S1M H;  1PLF A;  3R2I A;  3NTI A;  4BBR B;  3HOX H;  1SXT A;  3M4P A;  5M5Y B;  2PQA B;  2OTL A;  5ELE A;  4A3L H;  2B2T A;  3BVG A;  4HJ7 A;  2CHB D;  2IX1 A;  1SYE A;  2IW3 A;  1IBM Q;  1QVC A;  1I4X A;  5CV7 A;  1S5E D;  2ZTC A;  1PH6 A;  1N33 Q;  4ZUJ A;  3QB3 A; 
#chains in the Genus database with same CATH homology
 1RDP D;  3K0Y A;  3NQI A;  2EE1 A;  3GP7 A;  1LT3 D;  3Q23 A;  1TKW B;  2HDM A;  1F2Z A;  2F3V A;  3I91 A;  2K1B A;  3CQZ B;  3BVZ A;  3FEW X;  3GTO B;  5JEA J;  5HUR A;  2D9U A;  5C3W A;  1KDA A;  1SE3 A;  3BG3 A;  1VMC A;  2SNM A;  1VCI A;  2HCC A;  3MXN A;  4Q0F A;  4DXF A;  1WTP A;  3KF8 A;  3TP6 A;  2DY7 A;  1LTG D;  4RHS A;  1BOS A;  3K5N A;  2SDF A;  1EZ6 A;  2O5I C;  1WD1 A;  3EVQ A;  1MSG A;  4BWG B;  5K36 G;  5KYL A;  3MA2 B;  2XN9 C;  1BR9 A;  3TSS A;  2MJ8 A;  2K5Q A;  2PO4 A;  1STB A;  2M2L A;  4NMZ A;  5DAU A;  2WKD A;  3TN2 A;  4B9W A;  1O7L A;  3MAQ A;  3HS0 C;  1STE A;  2F0E A;  4FYD A;  1M4V A;  5IOD A;  1BCP C;  5KYI A;  3GTQ B;  1AZQ A;  2FFK B;  1TWC B;  4OIJ A;  1T5E A;  2B2Y C;  2F0O A;  1LO5 D;  3R2T A;  2A73 B;  3OW7 A;  4ILW A;  2F0U A;  5I9O A;  1ET6 A;  3HOW B;  3I4L A;  1A2T A;  1UUP A;  2AQ2 B;  2WAQ B;  4MN3 A;  1ESF A;  1AEX A;  2E76 C;  1PFM A;  3FDT A;  2EYL A;  2KEE A;  3NBH A;  4QF4 A;  1DZ1 A;  3JAM E;  1PZJ D;  2EOT A;  5EKK A;  2JP1 A;  1EY6 A;  1IL8 A;  1DYQ A;  1PRT F;  3FVQ A;  4CKC A;  3OPO A;  1V1P B;  3PMF A;  1OXU A;  2F0W A;  2HDL A;  3J81 E;  4B08 A;  2PZW A;  4QCL A;  4KY5 A;  3I70 A;  2PZU A;  3RZO B;  2ZXP A;  2PW7 A;  2MHV A;  4IFD H;  1WCM B;  4KV6 A;  1Y1V B;  4K8J A;  4XXE A;  3T13 A;  2NN6 H;  4X3S A;  2K05 A;  1PZK D;  1BCP D;  3GV6 A;  4BS9 A;  1JWM D;  2EJF C;  1JWU D;  1RCV D;  3EFX D;  3C46 A;  2LS0 1;  2JE6 I;  3H91 A;  3QOJ A;  3WDN A;  4K5W A;  3FKI B;  3I3C A;  2KEC A;  2RQX A;  3TZD A;  4OO1 H;  4L6T B;  1ZEQ X;  1HA6 A;  1WD0 A;  2D2C C;  2Z1C A;  1SNQ A;  5D3D A;  1L0Y B;  1BCP B;  1SBB B;  3C2P A;  1PTO F;  5A2Q L;  1O80 A;  3SK8 A;  4XQJ A;  5C44 B;  4H44 C;  2PZT A;  4C3H B;  2MUY A;  1A3U A;  3C1E A;  1OO9 B;  1R4Q B;  3NHH A;  3BZD B;  1VMP A;  4CBV A;  1J9O A;  2B8G A;  1TWH B;  3S17 B;  2F0J A;  4FF3 A;  2H4O A;  1GOZ A;  1STH A;  4FXG C;  4U67 3;  1CZW A;  5ISR A;  4NKL A;  1IHZ A;  4DGZ A;  1B50 A;  2L9H A;  4XT1 B;  1D5X C;  2OT2 A;  1ZXT A;  2IL8 A;  4FXD A;  4X3U A;  3TP8 A;  4ZLT F;  5CV8 A;  3MTS A;  4PMB A;  4EQP A;  2ZT9 C;  4KN4 C;  2RDH A;  5J1Z A;  2F0V A;  5KIX A;  4Z9C B;  1UEA B;  2OEO A;  1JOQ A;  2L55 A;  2SOB A;  2Q8I B;  1TR5 A;  2WKC A;  4RCN A;  3D6C A;  3PUY A;  3LWU A;  1H9S B;  1HUM A;  4IQZ A;  5IGC A;  1ICW A;  1EIH A;  2LY7 A;  4C3I B;  5EBC A;  2EZV A;  1II3 A;  2E2D C;  3KK7 A;  3DWQ A;  5KEE A;  2A74 C;  5KRU A;  1Y69 U;  4KKS A;  1WTQ A;  1G29 1;  4HAE A;  1IKL A;  5C0X H;  3I73 A;  3A56 A;  3DWA A;  1KNA A;  4TQU S;  3DEP A;  5COY A;  3PUV A;  5AFW A;  1EWH A;  2FMM A;  1JWS D;  1G6Z A;  4ID6 A;  4A3F B;  1L0X B;  3N6R A;  3SVM A;  3AB9 A;  4DK0 A;  2A68 C;  2XWB B;  5IIF A;  4IFD J;  5IGF A;  4IFD G;  3AMU A;  4J8Q A;  2B63 B;  1EFI D;  1EYA A;  4G7H C;  4A93 B;  3BDC A;  2N88 A;  3P20 A;  2WB1 B;  5CV4 A;  5LL6 S;  3T53 B;  5FO7 B;  2JXM B;  2K7V A;  4QMG A;  1QIL A;  2F0T A;  3MZ5 A;  5JVH 3;  2L5T A;  1Y8N B;  2M00 A;  5C5M A;  1HQM C;  4RFB A;  4CJ1 B;  3BYY B;  4OO1 G;  4DNR B;  3IL8 A;  3BDL A;  4K6D A;  3SK6 A;  3I4N B;  3D3R A;  2CVR A;  4F7X A;  3Q22 A;  3VR4 A;  1S5D D;  3VR3 A;  1EU3 A;  1LTT D;  2B2W A;  5I6W A;  2EDG A;  1SMY C;  3R8B A;  3M85 A;  2G9D A;  2VUM B;  4DA2 A;  5ELB A;  3OOC A;  2F0F A;  1ILQ A;  2KOL A;  2QKI C;  2E2H B;  3FPU B;  3RZD B;  1I6H B;  3DHQ A;  3RMH A;  2EY6 A;  2J0T D;  1KTK A;  3URY A;  4NDX A;  4CJ0 B;  2K5W A;  1CT1 D;  3ONA B;  1NR2 A;  5DNF A;  3S1Q B;  1G91 A;  1H9K A;  1AP0 A;  1OXS C;  1HUN A;  4JK1 C;  5E1F A;  1HXY D;  4C56 C;  1BUV T;  4ZAI A;  2KCC A;  3DXJ C;  5M5W B;  3NK9 A;  4UDU C;  2F3W A;  5CYU A;  3D4D A;  5D3I B;  1G2T A;  2QCP X;  3SK4 A;  1Q1E A;  2KA7 A;  4TKO B;  3MFY A;  3HOU B;  4KHV A;  5LL6 X;  1LTR D;  1Y1W B;  4OL7 A;  5F2D A;  1TQO A;  3J7Y W;  3CRL C;  2SEB D;  3SEB A;  5D65 A;  4ABN A;  3SDZ A;  5EPL A;  4PMC A;  3MXU A;  5CMD A;  1JIC A;  2A6E C;  1MBY A;  1PMR A;  5C0X J;  1EU4 A;  2XVS A;  1SMY D;  3AU7 A;  4PQX A;  1LLR D;  2F0D A;  2PQE A;  4M8A A;  2ENB A;  1F9Q A;  4C1N K;  1F2L A;  1KDC A;  4CKE A;  2VB2 X;  4IUN A;  5T1G A;  1ROD A;  1DM0 B;  3W2D A;  2B2U A;  2F0L A;  1AW7 A;  3S16 B;  4RKB A;  1CFM A;  5E4W C;  1RJT A;  1LAB A;  1LTA D;  1FNW A;  1SE4 A;  1HPC A;  2A5H A;  3ZYY X;  3GTJ B;  1BXT A;  1CI3 M;  1NSN S;  5FLX L;  4H7B A;  1I6V C;  5TSS A;  4WOR A;  3CKI B;  3KBG A;  4CJ2 C;  1HTP A;  1ZYR C;  2E2I B;  1PZI D;  4DAP A;  1KAA A;  2MP1 A;  4U68 A;  1BQQ T;  2L12 A;  5DEH A;  3F2U A;  5C4Z A;  5JEA G;  4N9P A;  5IGG A;  3E5S A;  3ND9 A;  3HEJ A;  2A6E D;  3MEH A;  3M7N A;  3K57 A;  4K14 A;  1KLG D;  5I2X A;  1B44 D;  1LTS D;  5ELC A;  3S2D B;  3HG9 A;  1B1Z A;  2F0S A;  4Q5V A;  4DXG A;  4E6I A;  2NZ1 D;  1SNC A;  1O78 A;  3WOF A;  4HCE A;  4XQN A;  5I4D A;  3VYU A;  4L63 B;  1Y8O B;  1GHK A;  2AWO A;  3NQT A;  2A69 C;  1H9R A;  2ICE C;  4S3S A;  2HUG A;  4RH6 A;  4KD4 A;  1TU2 B;  3DUZ A;  3A7A B;  3V2T A;  1EEF D;  3BVM A;  2NVT B;  5EBD A;  1CQF A;  3L7Z C;  2IPK D;  1MSH A;  1RD9 D;  1V1P A;  4FVM A;  1RKN A;  2L4N A;  2NYZ D;  3TME A;  1U4M A;  2RBM A;  2RA4 A;  3A8J E;  1TY2 A;  1CM9 A;  1DJR D;  3R93 A;  2Z8L A;  4YIJ A;  1SEB D;  2B2V C;  5ELD A;  3SR1 A;  2C5C A;  2HCI A;  2EYO A;  3KLS X;  1TII D;  3D31 A;  3FRP B;  5IOC A;  3A54 A;  5JOB A;  4KJO A;  3J7A F;  1A3V A;  1E2Z A;  3GQB A;  4LJZ C;  4XT3 B;  4BA1 I;  4A3E B;  2M9V A;  2RSO A;  4J6H A;  3NPP A;  1Y8P B;  4ZK9 B;  3HGB A;  1O7Z A;  3PUW A;  5CV6 A;  1EEI D;  1GJX A;  4RGM A;  1EYD A;  2XNA C;  2JA8 B;  2VNU D;  4IUQ A;  3S9W A;  2WII B;  2F0P A;  1I4Q A;  1TS3 A;  2AUJ D;  3GTG B;  2B2Y A;  4KY7 A;  4RAU C;  1PRT C;  2X6G A;  3A55 A;  3K6O A;  4CKB A;  3M4Y A;  4DFA A;  2TSS A;  3EA6 A;  1XX8 A;  3K5L A;  4RCO A;  3RLF A;  1JQY D;  2QIL A;  1CA5 A;  2N55 A;  1WTO A;  5G3L F;  2KHS A;  1IW7 C;  2EXZ A;  2BOS A;  1W6J A;  2Y0S B;  3FMC A;  1GUG A;  4KN7 C;  5CV9 A;  5EGT A;  3VR2 A;  4XTC S;  5FOB B;  1SSO A;  2Z4H A;  3VA5 A;  1SND A;  1GUW A;  3G6J B;  1MI2 A;  1ESR A;  2O5J C;  1Z6H A;  5EPJ A;  2K6A A;  3VYT A;  4C3J B;  1V8Q A;  3IFD A;  3NWS A;  2WIN B;  4L8J A;  5K5P A;  5M9O A;  5LHY 1;  1IKM A;  1V1O A;  5IT9 L;  1HQR D;  1SNO A;  2R6G A;  3K58 A;  1QCB D;  3A8I E;  3PUZ A;  4PNY A;  3NUC A;  1JB3 A;  1LTB D;  2RVL A;  1RF2 D;  5M5X B;  3NWT A;  3VR5 A;  1PTO C;  4HSP A;  4KHZ A;  2CQA A;  3GD7 A;  1JCK B;  1I4P A;  2KVM A;  1HFN A;  3GTP B;  1PRT D;  3JAM L;  1IYU A;  4WFN 3;  1B9M A;  2F0H A;  4QIW B;  2EY2 A;  1DXM A;  2MGS A;  1RHP A;  3SXH A;  1GXD C;  4DN4 M;  3D4W A;  5C3X A;  1SYC A;  3J81 L;  4G7Z C;  2DNE A;  2EJG C;  1A6X A;  3VA7 A;  1PRT B;  1BBX C;  4XQQ A;  4ZKC B;  2X6L A;  1CHP D;  1CQV A;  1FD7 D;  1FGB D;  1EY4 A;  1AN8 A;  4LMQ D;  2FIN B;  1B4O A;  2G9H D;  3MXG A;  3ND8 A;  2NTT A;  3NE5 B;  3L3O C;  5FO8 B;  1QNU A;  3L9A X;  1ILP A;  5CC4 A;  4K6L A;  5KGU A;  1SYG A;  1EL0 A;  4EQO A;  4TRD A;  5JPM C;  4F88 A;  1ONL A;  3OIQ A;  3C1F A;  2F0I A;  3W3A A;  1I4R A;  4NP5 A;  4A3J B;  1EY8 A;  1E2W A;  2EYM A;  3PIO 3;  1F77 A;  3J80 L;  2CW0 C;  1AFP A;  4V0B A;  2JA5 B;  3H0G B;  4GZY C;  1ET9 A;  1LT4 D;  3E0J A;  3MFG A;  3S14 B;  4HCS A;  2NN6 G;  1Q90 A;  2PW5 A;  5A35 A;  1OXT A;  1CHQ D;  2OF1 A;  1TVX A;  2EPB A;  1PTO B;  4XIG S;  1F9P A;  1A15 A;  3GV3 A;  5EQ0 A;  1OXV A;  4G57 A;  2BE5 C;  5JVG 3;  4HED A;  1Z47 A;  2ICI A;  1LV9 A;  2PNR C;  1HHV A;  5HGT A;  4FP5 D;  4O42 A;  1EY0 A;  5EJW A;  2EYP A;  3N52 A;  2X69 A;  2I07 B;  2J4X A;  1PFN A;  1NCV A;  3X3N A;  3Q24 A;  4RKL A;  4KTA A;  3PIP 3;  4RA8 A;  5C6A A;  3ITP A;  3EQL C;  2EY1 A;  2BCO A;  2V4D A;  4OGQ C;  4C3H G;  5CGK A;  3SHL A;  4ZKB B;  3HOY B;  1TS2 A;  2ID0 A;  2JA6 B;  1SDF A;  2ZXO A;  5IGE A;  4M1U B;  2A68 D;  5FK9 C;  3PV0 A;  3P75 A;  1LAC A;  1SNM A;  2JEB I;  4K5X A;  4KI0 A;  2CW0 D;  1KNE A;  4A3I B;  4QB4 A;  3WOE A;  1EYC A;  3ERQ A;  5KND A;  1Q8I A;  4H13 C;  4IFD I;  4XYQ A;  2K33 A;  4A3D B;  2IX3 A;  5CBA E;  1DD2 A;  1A3T A;  3VYR A;  2IX0 A;  2E75 C;  2R7Z B;  3E6Z X;  2JEA I;  2R3Z A;  1TS4 A;  2NN6 I;  2B2U C;  1B2T A;  3K59 A;  1S5F D;  1VF5 C;  2E74 C;  3QG1 A;  4RWS C;  4HSV A;  2B2T C;  3NTK A;  3HOV B;  4C3I G;  4OO1 I;  2JA7 B;  4RGO S;  3G7L A;  4FO2 A;  1KDB A;  1NUC A;  5M3F B;  1FNU A;  5C0X G;  2DNC A;  2DY8 A;  1HTL D;  3DM1 A;  1X3Q A;  4HR7 B;  4HMI A;  3KLS A;  1WTV A;  5C5L A;  4ZYS A;  1CA6 A;  1C48 A;  4MIU A;  2Q8R E;  5I9P A;  5E4X A;  4V19 0;  1DOL A;  2K01 A;  4LK1 C;  2H1E A;  4K2K A;  1S5C D;  3FPP A;  4DF7 A;  3C3L A;  1QOH A;  2OXP A;  1GUS A;  3T16 A;  4XDX A;  4FF2 A;  3M4O B;  3DEO A;  1CK1 A;  1WTW A;  1TWF B;  1HRJ A;  3S1M B;  1EY5 A;  3O13 A;  3HRZ C;  3HOX B;  5EKL A;  2TMP A;  4C1N I;  3NBI A;  1B3A A;  5FKA C;  4IUU A;  1MD2 D;  2AUK A;  2IJ0 A;  4ZQ3 A;  2EYH A;  3X3M A;  3OIP A;  3OHX C;  1NR4 A;  1F9R A;  4ZUI A;  2DN8 A;  3T4A C;  1LTI D;  3P7J A;  2WV6 D;  4EGV A;  3OWE B;  4RGT A;  1TY0 A;  4WJW A;  3H3V C;  3MVV A;  5J39 A;  3M3Y B;  1SYF A;  2Z4I A;  3QO2 A;  3R3O A;  3TP5 A;  2F0N A;  2LMC B;  4FF1 A;  3H09 A;  1QNK A;  2QF7 A;  4P2C B;  1Q12 A;  5C0X I;  2L0C A;  4BA2 I;  2PCF B;  1I4G A;  3S1N B;  4R8N A;  4A3M B;  1I4H A;  3T56 B;  1BCP F;  3K7A B;  2RDF A;  2IWH A;  3UI2 A;  4OIK A;  1HFG A;  3GTM B;  1G2S A;  4J1M A;  1SYD A;  1IYV A;  2PYK A;  2NVY B;  1E2V A;  1D5Z C;  4TSS A;  5A2Q E;  4O1N A;  2XRQ D;  3MHB A;  3OMG A;  2R92 B;  1NAP A;  2J7Z A;  4DAY A;  1ZYR D;  3SE0 A;  1F9S A;  2C9O A;  4X3T A;  1ENF A;  1U4P A;  4H0L C;  1SFO B;  3VYS A;  1TWA B;  1E0B A;  2XWJ B;  4IAL A;  1SNP A;  3P1H A;  1W6K A;  5EKI A;  1F2Y A;  1XXG A;  2O2L D;  2NVQ B;  2MPM A;  4RHR A;  5IT9 E;  2PPB C;  1J8I A;  3LX0 A;  4LAA A;  1TS5 A;  2PMZ B;  1MGS A;  1BF4 A;  2F1M A;  4IUP A;  2RDG A;  4IZ8 A;  3CU7 A;  5ELF A;  3BYT B;  3I72 A;  5IGD A;  3TP7 A;  4I7Z C;  1STG A;  3MWY W;  2WP8 J;  3HP3 A;  1Q1B A;  2YU9 B;  1LT6 D;  2O4X A;  1SJH D;  1AZP A;  4ODG A;  2A69 D;  4EVO A;  3Q0A A;  1KAB A;  4IUR A;  4PMW A;  3U9S A;  1QWY A;  3BDO A;  2R93 B;  1G8Z D;  1S4Z A;  3U9O A;  3V05 A;  2QEJ C;  1U9R A;  4DAV A;  4IUT A;  4KK7 A;  4DK1 A;  2F03 A;  3T51 B;  4XYO A;  3TZU A;  1H9M A;  5J22 A;  4DNT B;  4IUV A;  2I46 A;  1VF7 A;  4K5V A;  5I2Y A;  3GTL B;  5EPK A;  1U4R A;  2EYJ A;  3PUX A;  3LNN A;  1GHJ A;  4C2M B;  1FR3 A;  4MHE A;  5KNC A;  2RKS A;  1BO0 A;  2B2V A;  5C4X B;  1KLU D;  2F0K A;  2K03 A;  3KLR A;  1DOK A;  1JOK A;  3J80 E;  1QB5 D;  1D1I A;  1S5B D;  3DMU A;  1CTM A;  1QG7 A;  4FXK C;  2AQ1 B;  3RD4 A;  1EZ8 A;  2K28 A;  1EWC A;  3KUP A;  3SK5 A;  3VR6 A;  1BNZ A;  3H6M A;  3Q6S A;  3BS1 A;  2EYF A;  1ZKO A;  2XSC A;  1YNJ C;  1H9S A;  3IFT A;  1PDQ A;  3IKJ A;  3D8G A;  1UNS A;  3S1R B;  1D1K A;  3H94 A;  1O7Y A;  5C4J B;  1TT2 A;  1T5X D;  4K2L A;  4IN3 A;  3QOL A;  3TDQ A;  4AYB B;  2D62 A;  1EQT A;  3D4R A;  2RSN A;  3DWP A;  2GA4 B;  4HN7 A;  1XTC D;  3PO2 B;  4NW2 A;  2XRS D;  1BDO A;  1WVL A;  1GUN A;  3HOZ B;  1DCZ A;  1PYW D;  4A3G B;  1STA A;  5T1I A;  3I90 A;  1U4L A;  5I6Y A;  2NVX B;  4JBW A;  1XYI A;  1IW7 D;  2HQE A;  5KNB A;  4ZRZ A;  1STY A;  2KED A;  5JAV A;  4X3K A;  5DM7 3;  4HMJ A;  5CBE E;  5BN3 A;  5IGB A;  1EOT A;  4WRD A;  1K8M A;  3K5M A;  3M7G A;  2B8F A;  1I50 B;  3V96 A;  2L1B A;  3MXP A;  2F0G A;  1WTX A;  1K83 B;  4R9W A;  5C3E B;  3NP8 A;  3D6W A;  1WTR A;  1STN A;  2AQ3 B;  5E3F A;  1RTN A;  1JC7 A;  1VDZ A;  5JJZ A;  4RGN A;  1FYC A;  3PO3 B;  1ENA A;  2D5D A;  1YNN C;  1YNJ D;  1RTO A;  5NUC A;  4DU9 A;  1K8O A;  2F4I A;  1QJO A;  3NSW A;  2L11 A;  4R8I A;  5G3L D;  1C4Q A;  1D2B A;  2WAC A;  5CV5 A;  4Y7N B;  1PTO D;  2B2W C;  3KBX A;  1M8A A;  1H9J A;  2YYZ A;  2NWG A;  2EY5 A;  1TWG B;  3GTK B;  1EIG A;  2R61 A;  3MC0 B;  4HTH A;  2LKV A;  2KJX A;  4FNF A;  1LT5 D;  2NTS A;  5BN5 A;  1SE2 A;  4FF4 A;  2K04 A;  4F87 A;  1PFB A;  3QJY A;  5BN4 A;  3S2H B;  3OSO A;  2NB0 A;  2XIW A;  2VXW A;  3HZX A;  1R4P B;  1PTO H;  2B39 A;  2K5D A;  4CHT B;  4A3K B;  1C8C A;  3CRK C;  2NBF A;  2VB3 X;  4CGY B;  3OWF A;  4BY1 B;  2IT1 A;  1CZG A;  5JEA H;  2A6H C;  1ENC A;  4OHJ A;  5CR3 A;  1V43 A;  1UAP A;  4F8M A;  5FLX E;  1YNN D;  1SJE D;  2BA1 A;  3CHB D;  3QIA A;  2FMC A;  2E2J B;  4N9T A;  1JR0 D;  4A3B B;  1D6E C;  2FJ2 A;  1D5M C;  3GO5 A;  4QUF A;  4KKU A;  3NXW A;  3S15 B;  3K5O A;  1HA5 A;  4C3J G;  5FO9 B;  5DM6 3;  5JPN C;  3OMC A;  3NTH A;  1XWE A;  1GUO A;  2F0Q A;  5K36 H;  4EQN A;  4KMU C;  1I3Q B;  1HCZ A;  1X3P A;  2LFN A;  1EY7 A;  3EJI A;  1EQV A;  2BE5 D;  2QDB A;  2FHT A;  1JE4 A;  1Z7T A;  2Q8T A;  4G4K A;  1PXU A;  4B9X A;  1Q3L A;  3I4M B;  4KKT A;  3I8Z A;  4ULL A;  1SAP A;  1X32 A;  1DOM A;  2EJM A;  1JOO A;  4BBS B;  2KCN A;  4G7O C;  1R9T B;  3IAY A;  2A6H D;  1QE6 A;  4ME5 A;  2JYO A;  3J7A V;  3A7L A;  3TBI B;  2EVB A;  1ML0 D;  4KY6 A;  1FNV A;  4UAI A;  2ZXR A;  4BY7 B;  2K32 A;  3HKZ B;  4KD3 A;  4QUC A;  5C4H A;  1JOR A;  5COR A;  2NUC A;  2BDN A;  3QWN A;  4K8I A;  5D14 A;  3ERO A;  4I65 A;  1GUT A;  1B53 A;  3A8K E;  1A2U A;  2SNS A;  2F0M A;  2JSO A;  1EY9 A;  4KJN A;  2BDO A;  4PV1 C;  5M3M B;  2AWN A;  2KQ3 A;  1F2M A;  3RUZ A;  2BA0 A;  1B9N A;  1DON A;  1SYB A;  1OXX K;  2KUM A;  3LWE A;  1PLF A;  3R2I A;  3NTI A;  4BBR B;  1SXT A;  5M5Y B;  5ELE A;  2B2T A;  3BVG A;  2CHB D;  2IX1 A;  1SYE A;  2IW3 A;  1I4X A;  5CV7 A;  1S5E D;  4ZUJ A;  3QB3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...