4IFDI

Crystal structure of an 11-subunit eukaryotic exosome complex bound to rna
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
291
structure length
230
Chain Sequence
MACNFQFPEIAYPGKLICPQYGTENKDGEDIIFNYVPGPGTKLIQYEHNGRTLEAITATLVGTVRCEEEKKTRRTVKNILVSVLPGNDFANNLPKEGDIVLTRVTRLSLQRANVEILAVEDKPAATFSVSQASSDLGETFRGIIRSQDVRSTDRDRVKVIECFKPGDIVRAQVLSLGDGTNYYLTTARNDLGVVFARAANGAGGLMYATDWQMMTSPVTGATEKRKCAKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an RNA-bound 11-subunit eukaryotic exosome complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
total genus 45
structure length 230
sequence length 291
ec nomenclature
pdb deposition date 2012-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF10447 EXOSC1 Exosome component EXOSC1/CSL4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ifdI02
2.40.50.880 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ifdI01
1MIUA 1V1QA 1BBWA 1T9HA 2VQFL 4DV7L 3CQZH 3K7AH 4A3DH 1EWIA 1LYLA 3KLWA 3M7NA 2ES2A 1SN8A 2JA5G 1OXTA 2ATWA 3UDFA 2UXBL 1S40A 1HZBA 2WP8J 3J81i 3I4MG 2B29A 1PV4A 3M4QA 4JYAQ 2E2HH 1D8LA 3CCRA 1EFWA 3A5ZB 1GM5A 1I3QH 2F3IA 4A3MH 4DV4L 1VQGA 4X66Q 3E9HA 3A5UA 3S1MH 3AEVA 3S24A 4JI8Q 2YV5A 4DAMA 1E7ZA 3CPFA 4IPDA 2ZM6Q 5LMNL 2Z0SA 2E2IH 2IHFA 5C4XH 1KRSA 4JOIC 2CFMA 1PH5A 4JI4Q 2CQOA 1J6QA 3PV0A 1B70B 3CC7A 4A3BG 4QIWE 2E2JH 4JI1Q 5IYBH 4A3IG 1MKHA 2UXCQ 3TQYA 4A3JG 5ELOA 4KHZA 3H3VH 1Z9FA 3T1YL 1VQFA 4A3KG 3I55A 1N36Q 4DR6L 3L2PA 2R92H 3HOWH 3S1RH 4LFAL 5IYDH 4X62Q 1HNWQ 4HJ9A 1PYSB 2MO0A 4DV6Q 3PUWA 2XTIA 4DPGA 1UE6A 1PYBA 3CC2A 3PO2G 4B3RQ 1CKMA 3HOXG 4AQYL 3BZKA 4DK6C 4YHHQ 4O2DA 1UE7A 2UXDL 1NMFA 1YHAA 1VCIA 3PO2H 4JI2Q 2JK8A 4UP8A 1VQBA 1Q82C 4JI6L 1X65A 2AWNA 3AYHB 3NELA 1CKOA 1WJJA 1YZ6A 3W5OA 1EQQA 2ZTDA 4LF9L 2JA6G 3GTKH 3PF5A 3PUXA 4LF5L 4B3ML 5FJ8H 4LNQA 1XPRA 1KC8C 3PF4A 4ME3A 4UP7A 3I56A 5IYBG 2N78A 4X65Q 1XMQL 1SR3A 5M5WH 2R7FA 4DV2Q 1KIXA 1HR0W 5LMUQ 3J81c 2CCZA 1TWFH 2WAQE 4AYBE 1YI2A 4C3HH 5JJLA 1PH8A 1WYDA 2KBNA 4LF6Q 3OTOL 1Q1BA 1Y1VH 3PUYA 4GN5A 1VQ7A 4HIOA 2D62A 3NEMA 1O7IA 3HKSA 1BKBA 1HH2P 1BVSA 3S15H 4BBRG 3GTJH 2R7ZH 3FKIH 5C0XG 1VS0A 2JEAI 5C0XI 2VS1A 4P74A 3EBEA 4DV0L 4BY7G 2YTVA 1C9OA 3JAMc 4R1JA 1HR0Q 4P73A 4ALPA 5IP9G 1YJNA 2JA8H 3T1HQ 1C7YA 5JJIA 3S2DH 2UUCL 4A3CH 4X65L 3JC66 1KRTA 1E1TA 1MJCA 1PFSA 1TWAH 3CCJA 5AJ3Q 1WCMG 1KAWA 4B3MQ 4R4CA 1ASZA 4JBKA 2Q2HA 4IOAA 3M9BA 1QUQB 1M90C 2PQAA 1E1OA 2N8NA 4Y7NH 1HNZQ 1B7YB 4LF7L 3Q8DA 3UE1A 1KL9A 4JI5Q 1JT8A 4MTNA 2R7DA 4AYBG 3U50C 3EN2A 4RG1A 4DR3Q 4GOPA 2WB1G 4YY3Q 2I0QA 4B3RL 4TQUS 2ALYB 4L5TA 3E0EA 2I5MX 1X56A 3PIOA 2Z6KC 1L0WA 2VUMH 4DR6Q 1BBUA 1K83H 1VQPA 4P75A 3GTQH 3HOXH 4OX9L 4JI0L 4NB3A 2VQEQ 5M3FH 3HOYH 1K0RA 3VDYA 4LWCA 4JI7Q 1TWCH 4DV1L 1N33Q 1P16A 1QZGA 4BXXG 4LF8L 2LSSA 4HIMA 4DV1Q 2BH2A 4JC0A 1G291 5M5YH 4HJ8A 3RZDH 1FJGL 3NBHB 3A74A 4JOIA 1Q81C 1WOCA 4H02A 3CCQA 3M4OH 2UUAQ 4JI8L 3J7A5 3H0GH 4KI0A 4LUOA 4PG3A 1K8AC 5FLXc 4DR5Q 3TS0A 4A3IH 1UE1A 2KCMA 1YIJA 2R7ZG 1I6HH 4BA2I 1VQ5A 1EYGA 1Q86C 2BA1A 1GKHA 4EQ5A 4DR1L 2B63H 2NN6G 2BH8A 3GDEA 1U5KA 5DLQE 4B3TL 1Y1VG 2RCNA 1NTGA 4R4TA 3CAMA 2JA9A 1Q46A 1RIPA 1R9TH 2UUAL 1AE3A 1VQMA 3W1BA 2R93G 3F1ZA 4YCVA 1FJGQ 2VW9A 1NY4A 2DUDA 4A3CG 2XGTA 3GO5A 1N33L 4JI7L 1OXVA 3KOJA 2VQFQ 4DV7Q 1Q12A 4P72A 1Q8KA 1K8GA 2WB1E 4OO1G 3GTGH 4OX9Q 3F8TA 2VL6A 1SLJA 1DGSA 3AQQA 4IFDG 4NPSA 4LUVA 4JV5L 2FXQA 1SRUA 1OXXK 1OXUA 2AMCB 1JJGA 3HOUH 4Y52H 1HJPA 4HJ5A 1WI5A 1VQDA 4OWXB 2K14A 4BXXH 2DGYA 5M3FG 4JCVE 2NZHA 4DNIA 4QQBX 2K5NA 1LM0A 3KF6A 1G51A 2PMZE 2K5VA 4LUZA 4DR3L 3OYYA 4C2MH 3S1NH 1YEZA 1X3EA 2RHSB 3K8AA 2K50A 4JI5L 2LXKA 4IPHA 3CP0A 1CSQA 1YBYA 1EQRA 4POFA 5IYCH 1CKNA 4A3KH 3I2ZA 4GLXA 4DAYB 3HKZE 5AJ3L 3ER0A 1LTLA 3KJPA 1HNXL 3KDFB 4AH6A 3J80i 5C4JH 3H0GG 2K4KA 1L1OA 1E24A 3ULJA 1KXLA 2HT1A 2H5XA 4A3BH 2JE6I 2PNHA 2RHQB 3JAMi 2IX1A 4EX5A 1TXYA 1IBMQ 3LGJA 5FLMH 3ERSX 5IY0A 3CC4A 1NE3A 1W3SA 1VQKA 3HOYG 2VZAA 4IFDI 4OXPA 4IFDJ 5EAYA 3HOZG 1JJCB 3TEHB 1QVCA 1IZ6A 1IYJB 1HNXQ 1EIFA 3STBD 1JMCA 4NXML 4LF5Q 4QJFA 1SFOH 2B3GA 2ID0A 4IJLA 2E8GA 1IBKQ 1L1OB 4IJHA 5H1SE 4IO9A 3CD6A 4JI6Q 3B6YA 1N8RC 1P8LA 3KDFA 2Q2UA 3HOUG 4JI2L 2OTJA 2JJQA 4X64Q 1HZ9A 4DR4Q 1SE8A 3OTOQ 2LXJA 3RN2A 4AQYQ 5GAGC 2K75A 1KQSA 3FKIG 2ASBA 1CUKA 2WAQG 3E9IA 3TS2A 5LMUL 4DV6L 4A3FH 5M5XH 1PH2A 1VQAA 2BA0A 1XMQQ 4MNOA 3F2BA 3I7FA 4APVA 3K0XA 4GLAC 4YWMA 4LFAQ 1FVIA 4UY8C 1VQOA 1UEBA 4A3EG 5M3MH 1X6OA 4JV5Q 2R6GA 1WCMH 1A8VA 2JEBI 4UPAA 1NMGA 4WJ4A 2KCTA 4LF9Q 1FGUA 2UXCL 3F2CA 3FHWA 1XNQL 2QGQA 1RL2A 1YJ9A 1KD1C 2MO1A 4A3MG 2AWOA 4OO1I 1A0IA 4MZ9A 5E7NA 5J3BA 3RLNA 2UXDQ 2EIFA 3A0JA 2AKWB 1YVCA 3RNUA 3I4MH 3CMEA 5FJ8G 1PVOA 1Z47A 2ZM6L 5JJKA 3IRBA 3G6EA 1V9PA 3S17H 3RR5A 1D7QA 3OW2A 4B3TQ 4DR1Q 2Q2IA 4X62L 2JA5H 5GROA 1E22A 4K0KL 1NJIC 4DV4Q 3MEFA 1IBLQ 4PZ6A 4OWTB 3T1YQ 3RLFA 4DR5L 3D0FA 2IX0A 4A3LH 1E3PA 4JYAL 3FP9A 1VQCA 1QVFA 4BBSH 3HOZH 2K52A 4L5RC 2CWAA 4A4IA 3CW2C 3K80C 3PUVA 3G4SA 2Q2TA 4LF8Q 3KJOA 2R92G 3HOWG 1B8AA 4XTCS 4BA1I 2VQEL 1UWVA 3PIPA 4JI0Q 3ZJYC 5LMNQ 2PI2A 1PH4A 4NXMQ 4JBMA 4DR2L 4R4OA 2Z6KA 1AH9A 3BJUA 2IT1A 3CPWA 3CXCA 4GKJQ 2JA6H 1FL0A 5IYCG 2JQOA 3SGIA 2ZTCA 3ULPA 1A63A 3CCSA 2K5HA 4GOPC 1XMOL 1X54A 2VNUD 4YY3L 5C4XG 4GN4B 4IOCA 2L15A 2MQHA 1Y1WG 3K7UC 4DR7Q 2UXBQ 3CF5A 2EXDA 3L7ZC 1PH6A 3AFPA 1K73C 4QY7A 1G6PA 1LUZA 4DUYL 4A3EH 1HNZL 5IP9H 4DUZL 4GNXC 4HIKA 3RN5A 1OTCA 4LF7Q 2JA8G 1YITA 1Q1EA 2HIVA 2WFWA 2YYZA 3M4PA 2N3SA 2NVQH 4DUZQ 5GAHC 2YU9H 4DUYQ 4A3FG 4LF4L 4GKKQ 4GNXA 1GD7A 1GVPA 4R4IA 5IP7H 1N9WA 2PQAB 4QL5A 1EUJA 4R4QA 4A3JH 1AE2A 1QUQA 4B3SQ 1XTDA 1UE5A 2UUCQ 4DR7L 3T1HL 1YNXA 1KHIA 1OXSC 2ZTEA 4O0AA 1XPOA 1HR0L 1S72A 2UU9L 2E5LL 4PZ7A 1H95A 1EIYB 4DV0Q 1XJVA 3AFQA 4IPCA 5C44H 2VY3A 2UUBL 1ASYA 5BR8L 4GKJL 3BU2A 4JBJA 1VQ9A 1VQLA 3DLLA 4DV5L 2A1AA 2R93H 3PUZA 2C35B 3TREA 4P71A 2OQKA 1JE5A 1XPUA 2OCEA 2B63G 4A76A 1YHBA 2KHIA 2D0OA 4HJAA 4LFCL 5FLMG 1J5EL 4C3JH 2NVTH 1JB7A 2OTLA 1C0AA 2NVYH 1CKNB 4LF6L 2QA4A 4FDBA 3H3VI 4X6AH 1VQ4A 4YWLA 1N32Q 1VQ8A 4A3GG 4KHPL 3EIVA 1I94Q 1SMXA 4YCWA 1X3GA 1YJWA 1X3FA 1IXRA 4DV2L 3W1GA 1A62A 3CCEA 4DV3Q 2ZJRA 1IBLL 2CKZB 4A3DG 2HQLA 1VQIA 3L0OA 5LMNW 4K0KQ 4XIGS 1QZHA 2NN6I 2YTYA 2MNAA 4QGUA 3KYHC 3CCMA 1K3RA 3U4VA 3CCVA 1MJEA 2JA7H 5C3EG 2AHOB 5IE8A 3CMAA 1HZCA 2NZOA 3PSIA 5JEAG 5C44G 4BBSG 5IWAL 3J80c 4OWWB 1XNRL 1I5FA 4AIMA 3K81C 2I5LX 2YTXA 5IYDG 3CCUA 2RF4A 1YHQA 3GD7A 4LFBQ 5K36G 1Q7YC 2Y0SG 4GNXB 3PCOB 3CCLA 3M3YH 1N34L 5HGQA 5HY6A 5GAEC 3HOVG 4LFBL 1XNQQ 3ULLA 4YHHL 1IL2A 3KFUA 4UP9A 5IWAQ 1XNRQ 1NBWA 4NXNQ 4A3GH 1PA6A 3U4ZA 3I4NG 4HIDA 5GADC 3PO3G 2QEXA 1TWHH 2F52A 1PH9A 1VQ6A 1HNWL 4JI3L 2F4VL 3S1QH 5GQOA 5C0XJ 2A19A 3G71A 3DM3A 3KF6B 4JI3Q 2A8VA 1N36L 2F4VQ 4WJ3M 3U58A 2OQ0A 1I94L 3ICEA 1TWGH 1PH7A 4NXNL 1S3OA 3STBC 3S14H 2GVBA 4JI1L 1I50H 4DKAC 1W2BA 4DR4L 1EOVA 4X64L 1N34Q 4GLVB 4J15A 1J5EQ 2ZJQA 4A93G 4LFCQ 2Y0SE 3F2DA 4JI4L 1IBKL 1M1KC 4BY7H 1JJ2A 2ZJPA 1PHJA 1VQJA 4TVAB 2IY5B 1VQEA 2EQSA 3I4NH 1VQNA 4BY1H 4HJ7A 3UDXA 2KHJA 1PH1A 2V1CC 5JEAJ 5IP7G 4X66L 1CSPA 4PZ8A 4BY1G 4DV5Q 3HKZG 4DK3C 5ELNA 5BR8Q 1WFQA 4BBRH 4DV3L 2UUBQ 4L5SA 4OONA 1GO3E 3UDIA 4A93H 1IBML 3WWVA 4GS3A 3PGZA 4KHPQ 1V43A 3NENA 1N32L 5C3EH 2N49A 2JA7G 4YCUA 4A3LG 1L1OC 3BZCA 3J81j 1QVGA 4JBWA 4POGA 1Y1WH 3GTOH 4GKKL 4JG2A 2VUMG 4KLKA 3G48A 1PH3A 2NVXH 1VQHA 1SROA 3RLOA 4YWKA 3GTPH 1U0LA 3D31A 4GN3B 5IT9c 3M85A 2I5HA 2HHHQ 1X55A 3J7ZC 3PO3H 2CWPA 2HIXA 2IHEA 3HFZB 2OWOA 2GVAA 1Y14B 4L5QA 4PMWA 2GN5A 3UE0A 3I4OA 2E5LQ 3HOVH 4RMFA 4C3IH 3GTMH 4IPGA 1L2FA 2UU9Q 1XMOQ 3S2HH 4LW1A 3GTLH 4B3SL 2MFIA 1K9MC 2D0PA 2PI2E 3MXNB 4A75A 1HZAA 3KF8B 3S16H 2KENA 2HHHL 3RZOH 5M3MG 4GOPB 4LF4Q 4DR2Q 3TRZA 3H15A 1X9NA 3UDGA
chains in the Genus database with same CATH superfamily
1V1QA 1BBWA 2VQFL 3CQZH 4X3UA 3I72A 2WB1B 2RCFA 2ES2A 2JA5G 3BYTB 3I4LA 1HTPA 4L8JA 3OHXC 1FYCA 1SE3A 5HURA 1XYIA 3CRKC 4A3MH 4X66Q 3A5UA 4QUCA 1U9RA 3T13A 4DAMA 5C4XH 4RKBA 1KRSA 1PH5A 1CTMA 1JICA 2NN6H 4OEMB 1ESRA 1PLFA 1G2SA 2KUMA 2UXCQ 1KNAA 5FLXL 3TQYA 1LTBD 3NTKA 4PNYA 1AFPA 1Z9FA 1N36Q 2XWBB 3I55A 3LWEA 3HOWH 4BBRB 1KABA 2K5DA 3QB3A 2KJXA 2XTIA 3SK6A 1PYBA 1CQFA 2NZ1D 3HOXG 4MTKA 3BZKA 2XSCA 1NMFA 1YHAA 4IUTA 1SFOB 3PO2H 2FMCA 3DXJC 2ZT9C 1E2ZA 4JI6L 3CQZB 3V2TA 4EGVA 3NELA 3NXWA 2JA6G 1W6KA 1SNOA 1CI3M 1I4RA 1XPRA 1QWYA 4UP7A 3MWYW 1RD9D 4C3JG 4RAUC 2KEEA 4XQQA 1X3QA 1HRJA 1SNPA 5M5WH 1HR0W 3OW7A 2CCZA 1EEFD 3FPUB 2PZWA 4ILWA 4I65A 4ZCKA 1TWAB 1Q1BA 1JWSD 2FMMA 1FR3A 1STGA 4HIOA 5KYIA 1O7IA 1OO9B 3GTJH 3VA5A 5DEHA 1RKNA 1S5BD 1VS0A 5CR3A 4PMCA 5D3IB 4A3JB 1L0YB 3W3AA 3SK4A 3JAMc 1B2TA 2Y0SB 3T1HQ 2UUCL 2L55A 3H94A 3TP7A 4X65L 4HAEA 1PFSA 1Q90A 3CCJA 1H9MA 1ASZA 1QUQB 2PQAA 2N8NA 1S5FD 1B7YB 2F1MA 4JVZA 2E2DC 2PYKA 3OIQA 1JT8A 1LACA 3U50C 3EN2A 4O1NA 4DR3Q 4DN4M 2MGSA 1PXUA 2B2TA 2A69D 5EKLA 3PIOA 1CHQD 2Z6KC 2VUMH 4DR6Q 1VQPA 3GTQH 4OX9L 4JI0L 4NB3A 5C5MA 2B2UA 2VQEQ 3BYYB 4K14A 4LWCA 1P16A 1STNA 4H13C 2BH2A 4JC0A 1G291 4HTHA 1SNCA 1EOTA 5DAUA 1EY7A 4WORA 1BO0A 1LTAD 3TS0A 4A3IH 4XDXA 4A3FB 1Q86C 3K59A 2BA1A 5EPLA 1LO5D 2B63H 1ICWA 4S3SA 2RCNA 1NAPA 2EJGC 5KNCA 2J7ZA 4R4TA 2R93G 1LTID 3W1BA 3ND9A 5F2DA 4A3CG 4JI7L 3S15B 1Q12A 4P72A 1K8GA 2WB1E 3J7YW 2F0SA 4DAPA 1H9KA 1SRUA 3SVMA 2AMCB 1VF5C 3TMEA 1V1PB 2DN8A 1JJGA 4Y52H 1H9JA 1G91A 4BXXH 2NZHA 5K36H 2K5NA 3S2DB 1E0BA 1LM0A 3KF6A 2JYOA 4KTAA 3S1MB 1SYBA 3S14B 4JI5L 1S5CD 1EY0A 1CSQA 5CORA 2EPBA 4POFA 4FF3A 2K5WA 1XWEA 3MXGA 1BUVT 1JCKB 3HKZE 3ER0A 4FNFA 5AJ3L 1DZ1A 3KDFB 3J80i 3H0GG 1L1OA 1FNVA 1F9QA 4K6LA 2JE6I 4RFBA 2FFKB 1IBMQ 3LGJA 1WTPA 1W3SA 3HOYG 4R8NA 4RHSA 4IFDI 4OXPA 3HOZG 4N8FA 4ID6A 2N55A 3TEHB 1EIFA 4QJFA 5CBEE 4IJLA 4N9TA 2E8GA 5H1SE 3CD6A 4JI6Q 5CGKA 4JI2L 1ZXTA 2LXJA 3I70A 3RN2A 4AQYQ 2NTSA 5GAGC 3M4OB 3FKIG 2ZXPA 3MVVA 3T51B 4APVA 1W6JA 2X6GA 1VQOA 5M3MH 3K0YA 1X6OA 3OMCA 3Q22A 1STBA 2UXCL 1F2YA 1B3AA 4OO1I 3SDZA 2CVRA 1YNNC 2F0UA 1O7ZA 2EIFA 3A0JA 5E1FA 5JJKA 4F8MA 3G6EA 1V9PA 3EROA 2HDLA 3OW2A 1JB3A 4DR1Q 4X62L 2HQEA 1E22A 3VR6A 4K0KL 2MJ8A 4BBSH 1HFGA 5I6YA 1F9SA 2CWAA 4X3KA 1I4QA 3K80C 4LF8Q 5M3FB 2R92G 4BA1I 1EY8A 2VB2X 1PH4A 4R4OA 2B2TC 1QCBD 1A63A 4V0BA 3CCSA 1DJRD 2K5HA 4DK1A 1XMOL 1X54A 2F0MA 1Y1WG 2A5HA 4HN7A 2XIWA 3AFPA 1K3BC 5CV5A 2F0WA 1FNWA 1LUZA 1AN8A 4DUYL 3M3YB 3E0JA 1RF2D 2PCFB 2WFWA 1YITA 1EL0A 1GD7A 3CU7A 1SNDA 4A3JH 3C46A 1AE2A 1QUQA 1XTDA 4LMQD 1YNJD 2UU9L 4CDDC 4PZ7A 1H95A 4B9WA 1XJVA 3AFQA 4IPCA 1D5ZC 3R93A 5BR8L 3BU2A 2GA4B 2A1AA 3ONAB 1GHJA 5ELCA 2OQKA 1XPUA 4IUQA 2OCEA 1WTXA 4C3IG 1GUNA 2NVTH 3R2TA 3BG3A 1WTWA 1JB7A 1H9SB 1A2TA 1EWCA 2EJFC 1MSGA 3PIO3 2WKCA 1K8MA 1VQ4A 3EIVA 1I94Q 4YCWA 1HQMC 1A62A 2HQLA 2XVSA 3A8IE 4BWGB 3S9WA 2YTYA 2MNAA 3U4VA 4JK1C 3TP6A 3HOZB 3DWPA 5C44G 3J80c 3K81C 2I5LX 4LFBQ 5D14A 3M3YH 5K36G 3PCOB 1PZJD 1KNEA 1QE6A 2LS01 2XRQD 5IWAQ 2IX3A 5ISRA 4K5XA 3H3VC 1I4PA 1PA6A 2QEXA 4UHVA 1VQ6A 4JI3L 2F4VL 2A19A 5DM63 4WJ3M 1VMCA 2H1EA 1I94L 1B9NA 3URYA 4NXNL 1I50H 1EOVA 4GLVB 2F3VA 5ELDA 4OHJA 4LFCQ 1LT6D 4NP5A 1TIID 4ZKCB 4FVMA 2ZJPA 3C3LA 2NVTB 2EQSA 2LMCB 3QR8A 4LJZC 1VQNA 3UDXA 2V1CC 2SDFA 4X66L 1CZGA 3S17B 1WTRA 5CV7A 5ELNA 1WFQA 3IFDA 3ND8A 2O4XA 5I9PA 4GS3A 5T1IA 3PGZA 1V43A 3NENA 1N32L 3HGBA 2M00A 2N49A 4YCUA 1KAAA 4A3LG 3I8ZA 3GTOH 1Y1WH 2Z6BA 1PH3A 2NVXH 3D6CA 1MI2A 1SROA 3RLOA 4YWKA 3J80L 3GTPH 3D31A 4KY7A 3M85A 2I5HA 3J7ZC 1PRTF 2GVAA 4A3IB 1QOHA 2GN5A 4YIJA 3I4OA 2KECA 2E5LQ 4RMFA 4C3IH 1A3TA 1NR2A 1MHWC 3MXNB 1SDFA 1R4PB 2PZUA 3OWEB 2KENA 5A35A 5M3MG 4TSSA 1X9NA 3UDGA 2X69A 1HQRD 1QB5D 3DEPA 3SE0A 3K7AH 1JOKA 1JQYD 4DV7L 4HCSA 3K5MA 4F87A 2K32A 1UNSA 1HA5A 1ICFB 3UDFA 3D4WA 1HZBA 1MGSA 3T4AC 4HSVA 4JYAQ 1I6HB 2E2HH 1EFWA 2A6HC 3IKJA 3L3OC 2F3IA 1TWFB 2L5TA 5NUCA 5M3MB 1ML0D 3S1MH 2IWHA 4CKEA 4IPDA 3JAME 2E2IH 2B2VC 3NK9A 4CJ2C 4ZK9B 1SXTA 1SYFA 3CC7A 3NWTA 2E2JH 3GTPB 2B2UC 4KHZA 3GV3A 5LL6X 3T1YL 1VQFA 4A3KG 1QG7A 3TP8A 4DR6L 2R92H 3C2PA 5IYDH 4X62Q 2MO0A 3MTSA 4DV6Q 4DA2A 1CKMA 4FYDA 3SEBA 4FO2A 1LTRD 3N6RA 3NUCA 4ZYSA 5I2XA 1VMPA 3K7AB 3MXNA 1K8OA 1EQQA 1CKOA 2ZTDA 3GTKH 3PUXA 1SYDA 5D3DA 2SNMA 5FJ8H 1CK1A 2F0NA 1EY9A 1KC8C 4OO1H 2F0DA 2N78A 1HUNA 2V4DA 1SR3A 3BZDB 2DJGC 1TWFH 1CM9A 2WAQE 4AYBE 2EY2A 5JVH3 3EA6A 1WYDA 2A74C 1IL8A 3PUYA 4KKTA 1VQ7A 3LWUA 2A68D 3NEMA 2B8GA 1BKBA 1HTLD 1BVSA 3ZYYX 1I6VC 3FKIH 1K28A 2M9VA 3D4DA 5C0XG 4G7OC 4ZAIA 3K5LA 1B1ZA 5C0XI 2VS1A 1HPCA 4P74A 5CMDA 4DV0L 4A3BB 2OEOA 1C9OA 2MHVA 4P73A 5IP9G 3MAQA 1C7YA 4XQNA 4A3CH 1KRTA 1V8QA 4BBSB 3EJIA 1PRTD 2MPMA 5AJ3Q 1KAWA 4B3MQ 2Q2HA 3VYUA 1M90C 1HNZQ 4LF7L 3Q8DA 4JI5Q 2NVYB 3I4MB 1PRTB 1Z6HA 4DAVA 4HEDA 1GUTA 1GUGA 4YY3Q 4Q0FA 5LHY1 1L0WA 1SBBB 4ZQ3A 1BBUA 4P75A 3KLSX 3BS1A 3HOXH 2ENBA 1ZYRD 1ET9A 3U9SA 3HOYH 4KD4A 1TWCH 5CC4A 2E2JB 4ZUJA 2NTTA 2MUYA 4HIMA 1BOSA 1SEBD 3CRLC 1FJGL 4JOIA 4H02A 2B2VA 3J7A5 4JI8L 3H0GH 4KI0A 4MN3A 1K8AC 4DR5Q 1UE1A 2R7ZG 2M2LA 4BA2I 1EYGA 1G6PA 2NN6G 3VR2A 3GDEA 1U5KA 2B2YC 5DLQE 1Y1VG 3T56B 4CJ1B 3U9OA 2UUAL 1Q46A 1RIPA 1IHZA 2VW9A 1RHPA 2XGTA 3VYTA 3KOJA 2VQFQ 4DV7Q 1TS3A 2F4IA 3GTGH 2FJ2A 3IL8A 2VL6A 3AQQA 4IFDG 4JV5L 1AZQA 1OXUA 1F77A 2F0IA 3R8BA 4HJ5A 1B9MA 1E2WA 1LTSD 1VQDA 5M3FG 4JCVE 4QQBX 4NMZA 3A54A 1G51A 2PMZE 2K5VA 4DR3L 4C2MH 1YNND 3MXPA 5G3LD 4CJ0B 4NKLA 2RHSB 4IPHA 3SHLA 3CP0A 3GTOB 2F0PA 4UDUC 1YBYA 1C4QA 5FO8B 3I2ZA 3FPPA 4EQOA 3PO3B 5C4JH 1F2ZA 1KXLA 1UEAB 1BF4A 2HT1A 4A3BH 1SYGA 2RKSA 4G57A 5A2QL 1BXTA 1Y8OB 1VQKA 2VZAA 1F2MA 4JW0A 5K5PA 1TS4A 1C8CA 1STEA 5BN3A 2B3GA 2DY8A 4A3DB 1PZID 2R61A 1P8LA 3KDFA 2JJQA 4PMBA 3Q24A 2Q8TA 2RSNA 1MSHA 1SE8A 3OTOQ 2D2CC 1STYA 3TBIB 1B53A 2I46A 1A3VA 2WAQG 3E9IA 1WD0A 4DV6L 4A3FH 1S5ED 2BA0A 4MNOA 3F2BA 3I7FA 3K0XA 1UEBA 1SMYD 1B44D 4JV5Q 3C1FA 3IFTA 3LNNA 2JEBI 5J1ZA 5KGUA 1O7LA 1FGUA 1X32A 3HOYB 1KDAA 2F0VA 1XNQL 3KBXA 2NVXB 5A2QE 2MO1A 4K8IA 5C4ZA 3RLNA 4IUNA 1A3UA 3RNUA 2ZM6L 3H0GB 2B2YA 3MA2B 1D7QA 4FXGC 3RR5A 4RGTA 1FNUA 2Q2IA 3PQIA 3S1RB 4MHEA 4DV4Q 4K6DA 4QCLA 3D0FA 1QVFA 2EYMA 4RA8A 1TY0A 3RD4A 3G6JB 2RQXA 3G4SA 2TSSA 5C4XB 1B8AA 3PIPA 3BDLA 3ZJYC 5HGTA 1D1KA 4NXMQ 2K6AA 2Z6KA 1O7YA 1PTOF 1TWHB 3QG1A 1B3QA 4GKJQ 4RCOA 1PTOB 2JQOA 3ULPA 2ZTCA 1SAPA 3HOWB 2AUKA 2VNUD 2F0HA 3IAYA 4B08A 4KY5A 3K7UC 3CF5A 1PH6A 2R93B 1K73C 4QY7A 1G2TA 4GNXC 4ME5A 2JA8G 1UUPA 4DUZQ 5GAHC 4DUYQ 4LF4L 3Q0AA 5IP7H 3OIPA 4R4QA 1EUJA 5FLXE 4HSPA 4B3SQ 1UE5A 3K58A 1Y69U 2UUCQ 4DR7L 2ZTEA 4A3MB 1S72A 2E5LL 3FEWX 2VY3A 5JEAH 1ASYA 2QEJC 1VQ9A 1VQLA 4DV5L 2Z1CA 1PZKD 1H9RA 3OPOA 2K33A 4HJAA 4LFCL 3TDQA 1J5EL 3NSWA 4L6TB 2CW0D 4ZRZA 1C0AA 2NVYH 4CKBA 3SR1A 4FDBA 2G9DA 1ILQA 4A3GG 1N32Q 4KHPL 3OMGA 4ZUIA 5JVG3 1X3GA 1X3FA 4DV2L 1PTOH 3S2HB 3N52A 3CCEA 4RGMA 2ZJRA 1NNXA 1TKWB 4TKOB 2Q8IB 4LK1C 4K0KQ 5LMNW 3NQIA 1QZHA 3NQTA 3KYHC 1K3RA 3CCVA 5IE8A 1BCPC 2KCNA 1HZCA 2NZOA 3PSIA 5JEAG 1XNRL 2EXZA 2YTXA 3I90A 2MP1A 1Q7YC 2Y0SG 4CDFC 1N34L 5GAEC 5HY6A 1EYCA 1XNQQ 3KFUA 1IL2A 4XQJA 1NBWA 3KUPA 4NXNQ 4KMUC 4A3GH 3I4NG 1BDOA 1WTQA 2F52A 4DF7A 2QKIC 1WTHA 1PH9A 2ICIA 1HNWL 4RCNA 3S1QH 3G71A 3KF6B 3L9AX 1N36L 1PTOD 3U58A 2OQ0A 1M8AA 1S3OA 2GVBA 4DKAC 1II3A 3GTJB 1SNMA 2Y0SE 1CA6A 4JI4L 4BY7H 2KEDA 3I73A 1PHJA 1VQJA 4TVAB 4DU9A 5IP7G 1CSPA 4DV5Q 4JPBW 1I4HA 1Q8IA 3UDIA 4A93H 1IBML 5C3EH 1IW7D 5TSSA 3HOXB 1L1OC 3BZCA 4POGA 4DFAA 1TWCB 3G48A 3Q6SA 1VQHA 1AP0A 1U0LA 2HHHQ 5KEEA 3PO3H 3HFZB 5BN4A 5J22A 1Y14B 5C3WA 2KVMA 3GTMH 1XMOQ 4LW1A 1EU3A 5DM73 5C3XA 3GTLH 1SE2A 1BCPB 2PI2E 4A75A 3A7LA 3TZUA 1EIGA 1ENAA 3TRZA 3H15A 5FK9C 1MIUA 2VB3X 1T9HA 2CW0C 2WINB 4A3DH 1F9RA 3KLWA 3GP7A 1EWHA 2YU9B 5AFWA 4XYOA 1NCVA 3I4MG 2B29A 2JA5B 3A5ZB 1GM5A 4IUVA 1S5DD 1ET6A 1RODA 4F7XA 3MFGA 4JI8Q 2B2WA 2YV5A 2ZM6Q 3FDTA 2AQ1B 2E74C 4JI4Q 4JOIC 2CFMA 2CQOA 2IPKD 4FF4A 1EQTA 3PV0A 1B70B 4A3BG 4QIWE 5IYBH 4V190 2R3ZA 1BQQT 5ELOA 3GV6A 2SOBA 5IGGA 2QCPX 4ABNA 3L2PA 2K28A 3S1RH 4LFAL 4QMGA 2DNEA 1R4QB 1HNWQ 4HJ9A 1PYSB 2EE1A 3PUWA 3CC2A 5IGBA 1EYAA 2JA7B 1LTGD 4RH6A 4YHHQ 4O2DA 4EQNA 5ELEA 3A7AB 3QO2A 2JK8A 1TS2A 2BE5D 1VQBA 1Q82C 2WACA 1X65A 2AWNA 4H0LC 5M5YB 1WJJA 1YZ6A 2TMPA 4X3SA 3W5OA 4LNQA 1GOZA 3X3MA 1Y8NB 3D8GA 4ME3A 3I56A 4K2LA 1O80A 2BDNA 4X65Q 1XMQL 2L1BA 4A93B 2R7FA 1KIXA 5LMUQ 4B9XA 3E3XA 3J81c 1K83B 5KYLA 1Y1VH 3PO2B 2D62A 2Q8RE 4M8AA 2R7ZH 1B4OA 1KTKA 3FRPB 3RZDB 4A3KB 3KLSA 3J81E 2JEAI 3I4NB 2D9UA 3SK5A 5KNDA 4BY7G 2YTVA 3GTMB 2E2HB 1HR0Q 1YJNA 2JA8H 3CKIB 1PTOC 3DMUA 4CBVA 3AB9A 1E1TA 1TWAH 4Z9CB 2Z4IA 2EYFA 2E2IB 1JR0D 4QUFA 3D3RA 4RHRA 3SXHA 3UE1A 4MTNA 4K8JA 3I3CA 4RWSC 4U68A 4GOPA 4J1MA 4B3RL 4TQUS 2ALYB 3VYSA 4L5TA 3K6OA 1QNKA 3OOCA 4C1NK 3CHBD 2B63B 1ZEQX 1K83H 5EKIA 4N9PA 4DNTB 5COYA 1RCVD 4IURA 5M3FH 1DM0B 1K0RA 2O2LD 1N33Q 1QZGA 2EZVA 2LSSA 5G3LF 4DV1Q 5IT9E 3RZDH 3NBHB 1U4LA 3A74A 3P7JA 1Q81C 3CCQA 1Z7TA 4PG3A 1BCPD 4NDXA 5FLXc 2KCMA 1YIJA 1VQ5A 3BVZA 3S1QB 2JA8B 4EQ5A 4DR1L 3T53B 2VUMB 2BH8A 1TR5A 3R3OA 1PFNA 1NTGA 3CAMA 1XTCD 2F0TA 1AE3A 3AMUA 1GUWA 4YCVA 1FJGQ 4H7BA 2JP1A 2DUDA 3GO5A 2NUCA 4OO1G 3A56A 2VXWA 4OX9Q 1PRTC 3F8TA 2DNCA 4NPSA 2F0LA 3KK7A 4LAAA 1A2UA 1HJPA 1CZWA 1WI5A 1HFNA 2K14A 4BS9A 1D1IA 2KOLA 2K03A 4DNIA 2F0JA 2HD3A 3HS0C 4QB4A 4LUZA 1TQOA 2QILA 5IGEA 1YEZA 1X3EA 1DOMA 4ZLTF 2K50A 3DEOA 1WTOA 1DCZA 1EQRA 1CKNA 4A3KH 4DAYB 1LTTD 3KJPA 1LTLA 1HNXL 2K4KA 3ULJA 1A6XA 3H91A 5IGDA 2PNHA 2RHQB 3HOVB 3JAMi 2IX1A 5FLMH 3ERSX 5IY0A 3CC4A 1NE3A 3GTLB 1WVLA 5T1GA 5C44B 1CFMA 3MZ5A 2RVLA 2WV6D 1IYJB 3STBD 4LF5Q 4A3EB 2ID0A 1L1OB 3PMFA 4IJHA 4IO9A 1VDZA 5CV6A 3HOUG 1B50A 2Q2UA 2OTJA 4WFN3 4X64Q 1HZ9A 3MFYA 5IIFA 4EVOA 2L0CA 2K75A 4F88A 3SK8A 2ASBA 1CUKA 4IZ8A 1D6EC 5M5XH 1PH2A 4DNRB 5C5LA 2AQ2B 1I4XA 4K2KA 5IGCA 4KK7A 5CV9A 2R6GA 3DWAA 1WCMH 1A8VA 5CYUA 1SJHD 4UPAA 4WJ4A 4LF9Q 3F2CA 2QGQA 1V1OA 1YJ9A 3QOLA 2AWOA 4MZ9A 1YVCA 5FJ8G 1PVOA 3MEHA 1Z47A 3BVMA 4KHVA 3IRBA 3S17H 3H09A 1PFBA 4PZ6A 4OWTB 4A3LH 3HP3A 4JYAL 3FP9A 4L5RC 4A4IA 4C3HG 3PUVA 3EQLC 1JOOA 3KJOA 1AZPA 1SNQA 5ELBA 1HA6A 2VQEL 4OIKA 1UWVA 3C1EA 3BDCA 2A6ED 2PI2A 5I6WA 2K04A 3JAML 2EY5A 3OWFA 1AH9A 2IT1A 2A68C 5IYCG 1V1PA 4CDCC 5M5XB 5JJZA 2QW7A 4GOPC 2R92B 4YY3L 1IYUA 4IOCA 2UXBQ 3L7ZC 5JAVA 2LFNA 1Y1VB 1HNZL 5IP9H 1OTCA 3QOJA 1SMYC 3G7LA 4LF7Q 1HUMA 2HIVA 2F0QA 2YYZA 3M4PA 3RMHA 2N3SA 2R7ZB 1DOKA 1GVPA 2OT2A 4R4IA 4G7HC 1N9WA 2NB0A 4QL5A 5C0XH 1D5XC 1EU4A 3UI2A 1LV9A 1KHIA 2FHTA 4O0AA 3M7GA 1HR0L 5IODA 2E76C 3X3NA 1U4MA 5C44H 3DM1A 4JBJA 3VR5A 3PUZA 1IYVA 1JE5A 2L9HA 4NW2A 2RBMA 1ONLA 4A76A 1YHBA 1NR4A 4Y7NB 1U4RA 1H9SA 4MIUA 5FLMG 2K7VA 2I07B 3FKIB 3NP8A 4LF6L 2QA4A 4G4KA 4AYBB 3J80E 1VQ8A 2DJFC 5I4DA 3QIAA 3NTIA 1YJWA 3HOUB 5C6AA 3D4RA 3W1GA 4DV3Q 2HCIA 5CV8A 2CKZB 1I3QB 1LABA 1VQIA 1F9PA 3L0OA 3DWQA 2A6HD 4DXFA 3KLRA 2NN6I 1WCMB 4QGUA 5L37A 3CCMA 1MJEA 4U673 1JWUD 3P1HA 3S1NB 3CMAA 4BBSG 5IWAL 4OWWB 4FF2A 1I5FA 4AIMA 5IYDG 2RF4A 3CCLA 5I9OA 2EY6A 5D65A 1LT4D 5HGQA 3HOVG 4LFBL 4UP9A 1A15A 3U4ZA 5GADC 1EIHA 1TWHH 4IUUA 5C0XJ 1LT3D 1ZKOA 2A8VA 5CV4A 4N8X1 1SYCA 4ULLA 1KLGD 2IW3A 2K1BA 3STBC 3S14H 1ENCA 4JI1L 4DR4L 1L0XB 1JC7A 2EJMA 2O5IC 3BDOA 1DYQA 4J15A 1J5EQ 3NHHA 3F2DA 1STHA 2IY5B 1VQEA 4QF4A 4BY1H 2KHJA 5EJWA 3KBGA 2XNAC 4BY1G 4DK3C 4BBRH 4L5SA 3WWVA 1HXYD 1EZ6A 4KHPQ 4RKLA 4DAYA 4FF1A 1KLUD 1J8IA 1Y8PB 1I50B 2P5ZX 1QVGA 4OGQC 4JBWA 1M4VA 2VUMG 1AEXA 5IT9c 4GN3B 1EQVA 1X3PA 1BR9A 1X55A 4XYQA 3K5OA 3H6MA 1MBYA 4PMWA 2H4OA 4IN3A 3HOVH 4KJNA 4IPGA 1L2FA 1JWMD 3S2HH 2RSOA 2MFIA 3QWNA 2D0PA 3KF8B 2HHHL 3RZOH 2CHBD 2QDBA 1KDBA 1EWIA 3MHBA 3GQBA 1LYLA 3M7NA 4G7ZC 1SN8A 1OXTA 5E4WC 4KD3A 2ATWA 3D6WA 2UXBL 1S40A 2WP8J 3J81i 1PV4A 3M4QA 1D8LA 1T5EA 3CCRA 1I3QH 2XRSD 1VF7A 1BCPF 3RUZA 4DV4L 2QDLA 1VQGA 3E9HA 3AEVA 3A8KE 3S24A 4NXML 1E7ZA 2F0EA 3CPFA 4H44C 4I7AA 2Z0SA 5LMNL 2IHFA 1TT2A 4RGNA 5EPJA 1J6QA 3GTGB 2ZXOA 4E6IA 4BY7B 4JI1Q 1I4GA 4A3IG 1MKHA 2EOTA 4A3JG 1KDCA 3H3VH 2A73B 4P2CB 4WJWA 3Q23A 4DPGA 4B3RQ 3PO2G 1UE6A 3GTQB 4XT1B 3NPPA 4AQYL 2RDFA 4DK6C 1R9TB 1UE7A 2UXDL 1VCIA 1CT1D 4JI2Q 4UP8A 3I91A 2HUGA 3AYHB 4DGZA 1FD7D 4LF9L 4BY1B 3PF5A 4LF5L 5C4JB 4B3ML 1EY5A 3PF4A 5JPNC 2HCCA 2X6LA 2JA6B 5IYBG 3ITPA 3ERQA 1K0SA 3R2IA 4DV2Q 1CA5A 2EYHA 4Q5VA 3WOEA 2KHSA 2NBFA 1CHPD 1BNZA 1YI2A 5JJLA 4C3HH 1PH8A 2KBNA 2L12A 4LF6Q 2C5CA 3OTOL 4GN5A 3HKSA 1HH2P 3S15H 4BBRG 4X3TA 1DOLA 3O13A 5M9OA 3BVGA 3EBEA 4KN7C 5EBCA 2IL8A 4R1JA 4RGOS 4ALPA 5I2YA 2RDGA 1BBXC 5JJIA 3S2DH 2EVBA 3JC66 3PIP3 1MJCA 1D5MC 1RDPD 4ODGA 2OF1A 4PQXA 1WCMG 3EFXD 4R4CA 4JBKA 4UAIA 3M9BA 4IOAA 1YNJC 1NUCA 4Y7NH 1E1OA 2PPBC 1EYDA 2PQEA 5FKAC 1KL9A 3OSOA 2K01A 5C4HA 2R7DA 4AYBG 4RG1A 1XX8A 2WB1G 2I0QA 4CGYB 3V05A 2ICEC 3E0EA 2I5MX 3W2DA 4C3IB 4K5WA 1X56A 2KQ3A 3EVQA 1GXDC 1EZ8A 1XXGA 1E2VA 1RTOA 2Z9HA 1WTVA 3VDYA 4JI7Q 4BXXG 4DV1L 4KKUA 4FXDA 4LF8L 4R9WA 5M5YH 4HJ8A 2BDOA 3M4OH 1WOCA 3V96A 2UUAQ 4LUOA 2EYOA 1Q3LA 3DHQA 1LLRD 1I6HH 1GKHA 4KV6A 1ESFA 2PMZB 4HMIA 4B3TL 4OIJA 2JN4A 1QNUA 2JA9A 1R9TH 4L63B 1VQMA 3S16B 3F1ZA 1Y1WB 1NY4A 1TS5A 1PFMA 3HG9A 1N33L 1OXVA 1MD2D 1Q8KA 1U4PA 3HKZB 4C1NI 1SLJA 3K57A 1DGSA 4O42A 1PMRA 1J9OA 2PW5A 4LUVA 2FXQA 1RJTA 1OXXK 1C48A 3HOUH 3P20A 1JE4A 1GUSA 3TP5A 3E6ZX 4OWXB 3FVQA 2K05A 2DGYA 2BOSA 5CBAE 4C3HB 1EEID 1QILA 2G5DA 3OYYA 3S1NH 4M1UB 3K8AA 4CHTB 2L4NA 2LXKA 2HDMA 2AUJD 5LL6S 3TSSA 2CH4W 4CKCA 1G6ZA 5IYCH 1TY2A 1EY6A 4GLXA 1SYEA 4AH6A 4IQZA 4FXKC 2XN9C 1E24A 2H5XA 5ELFA 1T5XD 2FINB 4EX5A 1O78A 1TXYA 1PYWD 3NE5B 3NWSA 4IFDJ 5EAYA 4C2MB 1DONA 1JJCB 4C56C 1QVCA 1IZ6A 5C3EB 2O5JC 1HNXQ 2A6EC 3NTHA 1FGBD 1JMCA 3RZOB 3A55A 1SFOH 1IBKQ 4TRDA 3T16A 3B6YA 1N8RC 1JORA 4A3GB 4DR4Q 1DXMA 5IOCA 4DXGA 1KQSA 2IJ0A 3TS2A 3TZDA 5LMUL 3VR3A 1VQAA 1XMQQ 4UY8C 4GLAC 4YWMA 4LFAQ 1FVIA 1UAPA 4A3EG 1ENFA 4GZYC 1ZYRC 3WOFA 1GJXA 1NMGA 3AU7A 3HZXA 1HCZA 2KCTA 4R8IA 3A8JE 2CH4A 2F3WA 2KA7A 3FHWA 2F0GA 2NVQB 1RL2A 1KD1C 4A3MG 1A0IA 5E7NA 5J3BA 3GTKB 2UXDQ 2AKWB 3I4MH 3CMEA 2PNRC 1WD1A 2NYZD 4K5VA 4B3TQ 1JOQA 5IGFA 2JA5H 5GROA 1NJIC 3MEFA 1IBLQ 4XXEA 3T1YQ 3RLFA 4DR5L 2SEBD 2IX0A 1AW7A 1E3PA 4PV1C 2PZTA 4DK0A 1VQCA 4HMJA 5EGTA 3HOZH 1D2BA 2G9HD 2K52A 3CW2C 2Q2TA 3HOWG 4XTCS 3WDNA 4KN4C 2B39A 2EYJA 5LMNQ 4JI0Q 4JBMA 4OELB 4DR2L 4IALA 1GHKA 3VR4A 3BJUA 3CPWA 5KNBA 3CXCA 2JA6H 1FL0A 1SSOA 3SGIA 2BCOA 5FO9B 5EBDA 5C4XG 4OL7A 4GN4B 2L15A 2MQHA 4DR7Q 3E5SA 4KY6A 2EXDA 1IW7C 5FOBB 2OXPA 4A3EH 1GUOA 4DUZL 4HIKA 3RN5A 2NVQH 1Q1EA 3M4YA 2YU9H 4A3FG 4GKKQ 4GNXA 2PQAB 2PO4A 3TN2A 3T1HL 1YNXA 1IKLA 1OXSC 1ILPA 1XPOA 5EPKA 1NSNS 1EIYB 4DV0Q 2UUBL 2LY7A 1TWGB 2RA4A 3NBHA 4GKJL 3DLLA 3P75A 2R93H 2C35B 1IKMA 2WIIB 3TREA 4P71A 2F0KA 2B63G 4EQPA 3F2UA 2KHIA 2BE5C 2D0OA 3VYRA 5BN5A 2KCCA 4C3JH 3NBIA 2WAQB 4ZKBB 5KIXA 2B8FA 4FP5D 4I7ZC 4CDEC 2OTLA 1CKNB 2C9OA 3K5NA 3H3VI 4X6AH 4YWLA 1TVXA 2J4XA 3LX0A 1SMXA 5JPMC 1IXRA 1IBLL 4A3DG 1PDQA 4XIGS 4KJOA 3HRZC 4QIWB 5E4XA 2JA7H 5KRUA 5C3EG 2AHOB 2N88A 2J0TD 1SE4A 1YHQA 3CCUA 3GD7A 4GNXB 3QJYA 3DUZA 4WRDA 3KF8A 3ULLA 4YHHL 1XNRQ 3VA7A 1EY4A 4HIDA 3PO3G 4IFDH 2Z4HA 2EYLA 3J81L 2AQ3B 5GQOA 1SJED 3DM3A 4JI3Q 2PW7A 2F4VQ 2XWJB 3MC0B 3ICEA 1TWGH 1PH7A 1F2LA 2F0OA 1W2BA 1CQVA 3FMCA 4X64L 2K5QA 1N34Q 1RTNA 2ZJQA 4A93G 2F03A 1IBKL 1M1KC 2B2WC 5FO7B 4C3JB 1JJ2A 3J7AF 4HCEA 3I4NH 4HJ7A 5E3FA 2EY1A 1PH1A 5JEAJ 2NWGA 2CQAA 4PZ8A 3HKZG 1DD2A 5BR8Q 1S4ZA 2ZXRA 4DV3L 2UUBQ 4IUPA 4OONA 1GO3E 5M5WB 1LT5D 2A69C 4KKSA 3MXUA 2LKVA 3HEJA 4J8QA 2JSOA 5JOBA 2F0FA 2JXMB 2QF7A 2JA7G 2RDHA 3J7AV 2E75C 3J81j 2WKDA 4GKKL 4JG2A 4XT3B 4KLKA 2EYPA 2EDGA 2DY7A 4HR7B 5EKKA 2SNSA 1TU2B 5J39A 4J6HA 5DNFA 2CWPA 2HIXA 2IHEA 5IT9L 2OWOA 4L5QA 1QJOA 3UE0A 1STAA 2Z8LA 2L11A 2UU9Q 1HHVA 4B3SL 1K9MC 1EFID 1G8ZD 5EQ0A 1HZAA 3S16H 4GOPB 4LF4Q 4DR2Q 2D5DA
chains in the Genus database with same CATH topology
1V1QA 1BBWA 2VQFL 3CQZH 4X3UA 3I72A 2WB1B 2ES2A 2JA5G 3BYTB 3I4LA 1HTPA 4L8JA 3OHXC 1FYCA 1SE3A 5HURA 1XYIA 3CRKC 4A3MH 4X66Q 3A5UA 4DAMA 1U9RA 4QUCA 3T13A 5C4XH 4RKBA 1KRSA 1PH5A 1CTMA 1JICA 2NN6H 1ESRA 1PLFA 1G2SA 2UXCQ 2KUMA 1KNAA 5FLXL 3TQYA 1LTBD 3NTKA 4PNYA 1AFPA 1Z9FA 1N36Q 2XWBB 3I55A 3LWEA 3HOWH 4BBRB 1KABA 2K5DA 3QB3A 2KJXA 2XTIA 3SK6A 1PYBA 1CQFA 2NZ1D 3HOXG 3BZKA 2XSCA 1NMFA 1YHAA 4IUTA 1SFOB 3PO2H 2FMCA 3DXJC 2ZT9C 1E2ZA 4JI6L 3CQZB 3V2TA 4EGVA 3NELA 3NXWA 2JA6G 1W6KA 1SNOA 1CI3M 1I4RA 1XPRA 1QWYA 4UP7A 3MWYW 1RD9D 4C3JG 4RAUC 2KEEA 4XQQA 1X3QA 1HRJA 5M5WH 1HR0W 1SNPA 3OW7A 2CCZA 1EEFD 3FPUB 2PZWA 4ILWA 4I65A 1TWAB 1Q1BA 1JWSD 2FMMA 1FR3A 4HIOA 1STGA 5KYIA 1O7IA 1OO9B 3GTJH 3VA5A 5DEHA 1RKNA 1S5BD 1VS0A 5CR3A 4PMCA 5D3IB 4A3JB 1L0YB 3W3AA 3JAMc 3SK4A 1B2TA 2Y0SB 3T1HQ 2UUCL 2L55A 3H94A 3TP7A 4X65L 4HAEA 1PFSA 1Q90A 3CCJA 1H9MA 1ASZA 1QUQB 2PQAA 2N8NA 1S5FD 1B7YB 2F1MA 1JT8A 2E2DC 2PYKA 3OIQA 1LACA 3U50C 3EN2A 4DR3Q 4O1NA 4DN4M 2MGSA 1PXUA 2B2TA 2A69D 5EKLA 3PIOA 1CHQD 2Z6KC 2VUMH 4DR6Q 1VQPA 3GTQH 4OX9L 4JI0L 4NB3A 5C5MA 2VQEQ 2B2UA 3BYYB 4LWCA 4K14A 1P16A 1STNA 4H13C 2BH2A 4JC0A 1G291 4HTHA 1SNCA 1EOTA 5DAUA 1EY7A 4WORA 1BO0A 3TS0A 1LTAD 4A3IH 4XDXA 4A3FB 1Q86C 3K59A 2BA1A 5EPLA 1LO5D 2B63H 1ICWA 4S3SA 2RCNA 1NAPA 2EJGC 5KNCA 2J7ZA 4R4TA 2R93G 1LTID 3W1BA 3ND9A 5F2DA 4A3CG 4JI7L 3S15B 1Q12A 4P72A 1K8GA 2WB1E 3J7YW 2F0SA 4DAPA 1H9KA 1SRUA 3SVMA 2AMCB 1VF5C 3TMEA 1V1PB 1JJGA 2DN8A 4Y52H 1H9JA 1G91A 4BXXH 2NZHA 5K36H 2K5NA 3S2DB 1E0BA 1LM0A 3KF6A 2JYOA 4KTAA 3S1MB 1SYBA 3S14B 4JI5L 1S5CD 1EY0A 1CSQA 5CORA 2EPBA 4POFA 4FF3A 2K5WA 1XWEA 3MXGA 1BUVT 3HKZE 5AJ3L 3ER0A 1JCKB 4FNFA 1DZ1A 3KDFB 3J80i 3H0GG 1L1OA 1FNVA 1F9QA 4K6LA 2JE6I 4RFBA 2FFKB 1IBMQ 3LGJA 1WTPA 1W3SA 3HOYG 4IFDI 4R8NA 4RHSA 4OXPA 3HOZG 3TEHB 2N55A 4ID6A 1EIFA 4QJFA 5CBEE 4IJLA 4N9TA 2E8GA 5H1SE 3CD6A 4JI6Q 5CGKA 4JI2L 1ZXTA 2LXJA 3I70A 3RN2A 4AQYQ 5GAGC 2NTSA 3M4OB 3FKIG 2ZXPA 3MVVA 3T51B 4APVA 1W6JA 2X6GA 1VQOA 5M3MH 3K0YA 1X6OA 3OMCA 3Q22A 1STBA 2UXCL 1F2YA 1B3AA 4OO1I 3SDZA 2CVRA 1YNNC 2F0UA 2EIFA 1O7ZA 3A0JA 5E1FA 5JJKA 4F8MA 3G6EA 1V9PA 3EROA 2HDLA 3OW2A 1JB3A 4DR1Q 4X62L 2HQEA 1E22A 4K0KL 3VR6A 2MJ8A 4BBSH 1HFGA 5I6YA 2CWAA 1F9SA 4X3KA 1I4QA 3K80C 4LF8Q 5M3FB 2R92G 4BA1I 1EY8A 2VB2X 1PH4A 4R4OA 2B2TC 1QCBD 1A63A 4V0BA 3CCSA 1DJRD 2K5HA 1XMOL 4DK1A 1X54A 2F0MA 1Y1WG 2A5HA 4HN7A 2XIWA 3AFPA 5CV5A 2F0WA 1FNWA 1LUZA 1AN8A 4DUYL 3M3YB 3E0JA 1YITA 2WFWA 1RF2D 2PCFB 1EL0A 1GD7A 3CU7A 1SNDA 4A3JH 3C46A 1AE2A 1QUQA 1XTDA 4LMQD 1YNJD 2UU9L 4PZ7A 1H95A 4B9WA 1XJVA 3AFQA 4IPCA 1D5ZC 3R93A 5BR8L 3BU2A 2GA4B 2A1AA 3ONAB 1GHJA 5ELCA 2OQKA 1XPUA 4IUQA 2OCEA 1WTXA 4C3IG 1GUNA 2NVTH 3R2TA 3BG3A 1WTWA 1JB7A 1H9SB 1A2TA 1EWCA 2EJFC 1MSGA 3PIO3 2WKCA 1K8MA 1VQ4A 3EIVA 1I94Q 4YCWA 1HQMC 1A62A 2HQLA 2XVSA 3A8IE 4BWGB 3S9WA 2YTYA 2MNAA 3U4VA 4JK1C 3TP6A 3HOZB 3DWPA 5C44G 3J80c 3K81C 2I5LX 4LFBQ 5K36G 3M3YH 5D14A 3PCOB 1PZJD 1KNEA 1QE6A 2LS01 2XRQD 5IWAQ 2IX3A 5ISRA 4K5XA 3H3VC 1I4PA 1PA6A 2QEXA 1VQ6A 4JI3L 2F4VL 2A19A 5DM63 4WJ3M 1VMCA 2H1EA 1I94L 1B9NA 3URYA 4NXNL 1I50H 1EOVA 4GLVB 2F3VA 5ELDA 4LFCQ 4OHJA 1LT6D 4NP5A 1TIID 4ZKCB 2ZJPA 4FVMA 3C3LA 2NVTB 2EQSA 2LMCB 4LJZC 1VQNA 3UDXA 2V1CC 2SDFA 4X66L 1CZGA 3S17B 1WTRA 5ELNA 5CV7A 1WFQA 3IFDA 3ND8A 2O4XA 5I9PA 4GS3A 5T1IA 3PGZA 1V43A 3NENA 1N32L 3HGBA 2M00A 2N49A 4YCUA 4A3LG 1KAAA 3I8ZA 3GTOH 1Y1WH 1PH3A 2NVXH 3D6CA 1MI2A 1SROA 3RLOA 4YWKA 3GTPH 3J80L 3D31A 4KY7A 3M85A 2I5HA 3J7ZC 2GVAA 1PRTF 4A3IB 2GN5A 1QOHA 4YIJA 3I4OA 2KECA 2E5LQ 4RMFA 4C3IH 1A3TA 1NR2A 3MXNB 1SDFA 1R4PB 2PZUA 3OWEB 2KENA 5M3MG 5A35A 4TSSA 1X9NA 3UDGA 2X69A 1HQRD 4DV7L 1QB5D 3DEPA 3K7AH 1JOKA 1JQYD 3SE0A 4HCSA 3K5MA 4F87A 2K32A 1UNSA 1HA5A 3UDFA 3D4WA 1HZBA 1MGSA 3T4AC 4HSVA 4JYAQ 1I6HB 2E2HH 1EFWA 2A6HC 3IKJA 3L3OC 2F3IA 1TWFB 2L5TA 5NUCA 5M3MB 1ML0D 3S1MH 2IWHA 4CKEA 4IPDA 3JAME 2E2IH 2B2VC 3NK9A 4CJ2C 4ZK9B 1SXTA 1SYFA 3CC7A 3NWTA 2E2JH 3GTPB 2B2UC 4KHZA 3GV3A 5LL6X 3T1YL 1VQFA 4A3KG 1QG7A 3TP8A 4DR6L 2R92H 3C2PA 5IYDH 4X62Q 2MO0A 3MTSA 4DV6Q 4DA2A 1CKMA 4FYDA 3SEBA 4FO2A 1LTRD 3N6RA 3NUCA 4ZYSA 5I2XA 1VMPA 3K7AB 3MXNA 1K8OA 1EQQA 1CKOA 2ZTDA 3GTKH 3PUXA 1SYDA 5FJ8H 2SNMA 5D3DA 1CK1A 2F0NA 1KC8C 1EY9A 4OO1H 2F0DA 2N78A 1HUNA 2V4DA 1SR3A 3BZDB 1TWFH 1CM9A 2WAQE 4AYBE 2EY2A 5JVH3 3EA6A 1WYDA 2A74C 1IL8A 3PUYA 4KKTA 1VQ7A 3LWUA 2A68D 3NEMA 2B8GA 1BKBA 1HTLD 1BVSA 3ZYYX 1I6VC 3FKIH 2M9VA 5C0XG 3D4DA 4G7OC 4ZAIA 3K5LA 1B1ZA 5C0XI 2VS1A 1HPCA 4P74A 5CMDA 4DV0L 4A3BB 2OEOA 1C9OA 2MHVA 4P73A 5IP9G 3MAQA 1C7YA 4XQNA 4A3CH 1KRTA 1V8QA 4BBSB 3EJIA 1PRTD 2MPMA 5AJ3Q 1KAWA 4B3MQ 2Q2HA 3VYUA 1M90C 1HNZQ 4LF7L 3Q8DA 4JI5Q 2NVYB 3I4MB 1PRTB 1Z6HA 4DAVA 4HEDA 1GUTA 1GUGA 4YY3Q 4Q0FA 5LHY1 1L0WA 1SBBB 4ZQ3A 1BBUA 4P75A 3KLSX 3BS1A 3HOXH 2ENBA 1ZYRD 1ET9A 3U9SA 3HOYH 4KD4A 1TWCH 5CC4A 2E2JB 4ZUJA 4HIMA 2MUYA 2NTTA 1BOSA 1SEBD 1FJGL 3CRLC 4JOIA 4H02A 2B2VA 3J7A5 4JI8L 3H0GH 4KI0A 4MN3A 1K8AC 4DR5Q 1UE1A 2R7ZG 2M2LA 4BA2I 1EYGA 1G6PA 2NN6G 3VR2A 3GDEA 1U5KA 5DLQE 2B2YC 1Y1VG 3T56B 4CJ1B 3U9OA 2UUAL 1Q46A 1RIPA 2VW9A 1IHZA 1RHPA 2XGTA 3VYTA 3KOJA 2VQFQ 4DV7Q 1TS3A 2F4IA 3GTGH 2FJ2A 3IL8A 2VL6A 3AQQA 4IFDG 4JV5L 1AZQA 1OXUA 1F77A 2F0IA 3R8BA 4HJ5A 1B9MA 1E2WA 1LTSD 1VQDA 5M3FG 4JCVE 4QQBX 4NMZA 3A54A 1G51A 2PMZE 2K5VA 4DR3L 4C2MH 1YNND 3MXPA 5G3LD 4CJ0B 4NKLA 2RHSB 4IPHA 3SHLA 3CP0A 3GTOB 2F0PA 4UDUC 1YBYA 1C4QA 5FO8B 3I2ZA 3FPPA 4EQOA 3PO3B 5C4JH 1F2ZA 1KXLA 1UEAB 2HT1A 1BF4A 4A3BH 1SYGA 2RKSA 4G57A 5A2QL 1BXTA 1Y8OB 1VQKA 2VZAA 1F2MA 5K5PA 1TS4A 1C8CA 1STEA 5BN3A 2B3GA 2DY8A 4A3DB 1PZID 2R61A 1P8LA 3KDFA 2JJQA 4PMBA 3Q24A 2Q8TA 2RSNA 1SE8A 3OTOQ 1MSHA 2D2CC 1STYA 3TBIB 1B53A 2I46A 1A3VA 2WAQG 3E9IA 1WD0A 4DV6L 4A3FH 1S5ED 2BA0A 4MNOA 3F2BA 3I7FA 3K0XA 1UEBA 1SMYD 1B44D 4JV5Q 3C1FA 3IFTA 3LNNA 2JEBI 5J1ZA 5KGUA 1O7LA 1FGUA 1X32A 3HOYB 1KDAA 2F0VA 1XNQL 3KBXA 2NVXB 5A2QE 2MO1A 4K8IA 5C4ZA 3RLNA 4IUNA 1A3UA 3RNUA 2ZM6L 3H0GB 2B2YA 3MA2B 1D7QA 3RR5A 4FXGC 4RGTA 1FNUA 2Q2IA 3S1RB 4MHEA 4DV4Q 4K6DA 4QCLA 3D0FA 1QVFA 2EYMA 4RA8A 1TY0A 3RD4A 3G6JB 2RQXA 3G4SA 2TSSA 5C4XB 1B8AA 3PIPA 3BDLA 3ZJYC 5HGTA 1D1KA 4NXMQ 2K6AA 2Z6KA 1O7YA 1PTOF 1TWHB 3QG1A 4GKJQ 4RCOA 1PTOB 2JQOA 3ULPA 2ZTCA 1SAPA 3HOWB 2VNUD 2AUKA 2F0HA 3IAYA 4B08A 4KY5A 3K7UC 3CF5A 1PH6A 2R93B 1K73C 4QY7A 1G2TA 4GNXC 4ME5A 2JA8G 1UUPA 4DUZQ 5GAHC 4DUYQ 4LF4L 3Q0AA 5IP7H 3OIPA 4R4QA 1EUJA 4B3SQ 4HSPA 5FLXE 1UE5A 2UUCQ 4DR7L 3K58A 1Y69U 2ZTEA 4A3MB 1S72A 2E5LL 3FEWX 2VY3A 1ASYA 5JEAH 2QEJC 1VQ9A 1VQLA 4DV5L 2Z1CA 1PZKD 1H9RA 3OPOA 2K33A 4HJAA 4LFCL 3TDQA 1J5EL 3NSWA 4L6TB 2CW0D 4ZRZA 1C0AA 2NVYH 4CKBA 3SR1A 4FDBA 1N32Q 1ILQA 4A3GG 2G9DA 4KHPL 3OMGA 4ZUIA 5JVG3 1X3GA 1X3FA 4DV2L 1PTOH 3S2HB 3N52A 3CCEA 4RGMA 2ZJRA 1TKWB 4TKOB 2Q8IB 4LK1C 4K0KQ 5LMNW 3NQIA 1QZHA 3NQTA 3KYHC 1K3RA 3CCVA 5IE8A 1BCPC 2KCNA 1HZCA 2NZOA 3PSIA 5JEAG 1XNRL 2EXZA 2YTXA 3I90A 2MP1A 1Q7YC 2Y0SG 1N34L 5GAEC 5HY6A 1EYCA 1XNQQ 3KFUA 1IL2A 4XQJA 1NBWA 4NXNQ 3KUPA 4A3GH 4KMUC 3I4NG 1BDOA 1WTQA 2F52A 1PH9A 1HNWL 2QKIC 4DF7A 2ICIA 3S1QH 4RCNA 3G71A 3KF6B 3L9AX 1N36L 3U58A 1PTOD 2OQ0A 1M8AA 1S3OA 2GVBA 4DKAC 1II3A 3GTJB 1SNMA 2Y0SE 4JI4L 1CA6A 4BY7H 2KEDA 3I73A 1PHJA 1VQJA 4TVAB 5IP7G 4DV5Q 1CSPA 4DU9A 1I4HA 1Q8IA 3UDIA 4A93H 1IBML 5C3EH 1IW7D 5TSSA 3HOXB 1L1OC 3BZCA 4POGA 4DFAA 1TWCB 3G48A 3Q6SA 1VQHA 1AP0A 1U0LA 2HHHQ 5KEEA 3PO3H 3HFZB 5BN4A 5J22A 1Y14B 5C3WA 2KVMA 3GTMH 1XMOQ 4LW1A 3GTLH 1EU3A 5DM73 5C3XA 1SE2A 2PI2E 1BCPB 4A75A 3A7LA 3TZUA 1EIGA 1ENAA 3TRZA 3H15A 5FK9C 1MIUA 2VB3X 1T9HA 4A3DH 2CW0C 2WINB 1F9RA 3KLWA 3GP7A 1EWHA 2YU9B 5AFWA 4XYOA 1NCVA 3I4MG 2B29A 2JA5B 3A5ZB 1GM5A 4IUVA 1S5DD 1ET6A 1RODA 4F7XA 3MFGA 4JI8Q 2YV5A 2B2WA 2ZM6Q 3FDTA 2AQ1B 2E74C 4JI4Q 4JOIC 2CFMA 2CQOA 2IPKD 4FF4A 3PV0A 1EQTA 1B70B 4A3BG 4QIWE 5IYBH 4V190 2R3ZA 1BQQT 5ELOA 3GV6A 2SOBA 5IGGA 2QCPX 3L2PA 4ABNA 3S1RH 4LFAL 2K28A 4QMGA 2DNEA 1R4QB 1HNWQ 4HJ9A 1PYSB 2EE1A 3PUWA 3CC2A 5IGBA 1EYAA 2JA7B 1LTGD 4RH6A 4YHHQ 4O2DA 4EQNA 5ELEA 3A7AB 3QO2A 2JK8A 1TS2A 2BE5D 1VQBA 1Q82C 2WACA 1X65A 2AWNA 4H0LC 5M5YB 1WJJA 1YZ6A 3W5OA 2TMPA 4X3SA 4LNQA 1GOZA 3X3MA 1Y8NB 3D8GA 4ME3A 3I56A 4K2LA 4X65Q 1O80A 1XMQL 2BDNA 2L1BA 4A93B 2R7FA 1KIXA 5LMUQ 4B9XA 3J81c 1K83B 5KYLA 1Y1VH 3PO2B 2D62A 2Q8RE 4M8AA 2R7ZH 1B4OA 1KTKA 3FRPB 3RZDB 4A3KB 3KLSA 3J81E 2JEAI 3I4NB 2D9UA 3SK5A 5KNDA 4BY7G 2YTVA 3GTMB 2E2HB 1HR0Q 1YJNA 2JA8H 3CKIB 1PTOC 3DMUA 4CBVA 3AB9A 1E1TA 1TWAH 4Z9CB 2Z4IA 2EYFA 2E2IB 1JR0D 4QUFA 3D3RA 3UE1A 4RHRA 3SXHA 4MTNA 4K8JA 3I3CA 4RWSC 4GOPA 4U68A 4J1MA 4B3RL 4TQUS 2ALYB 3VYSA 4L5TA 3K6OA 1QNKA 3OOCA 4C1NK 3CHBD 2B63B 1ZEQX 1K83H 5EKIA 4N9PA 4DNTB 5COYA 1RCVD 5M3FH 4IURA 1K0RA 1DM0B 1N33Q 2O2LD 1QZGA 2EZVA 2LSSA 4DV1Q 5G3LF 5IT9E 3RZDH 3NBHB 1U4LA 3A74A 1Q81C 3P7JA 3CCQA 1Z7TA 4PG3A 1BCPD 5FLXc 4NDXA 2KCMA 1YIJA 1VQ5A 3BVZA 3S1QB 2JA8B 4EQ5A 4DR1L 3T53B 2VUMB 2BH8A 1TR5A 3R3OA 1PFNA 1NTGA 3CAMA 1XTCD 2F0TA 1AE3A 3AMUA 1GUWA 4YCVA 1FJGQ 4H7BA 2JP1A 2DUDA 3GO5A 2NUCA 4OO1G 3A56A 2VXWA 4OX9Q 1PRTC 3F8TA 2DNCA 4NPSA 2F0LA 3KK7A 4LAAA 1A2UA 1HJPA 1WI5A 1CZWA 1HFNA 2K14A 4BS9A 1D1IA 2KOLA 4DNIA 2K03A 2F0JA 3HS0C 4QB4A 4LUZA 1TQOA 2QILA 5IGEA 1YEZA 1X3EA 1DOMA 4ZLTF 2K50A 3DEOA 1WTOA 1DCZA 1EQRA 1CKNA 4A3KH 4DAYB 1LTTD 3KJPA 1LTLA 1HNXL 2K4KA 3ULJA 1A6XA 3H91A 5IGDA 2PNHA 2RHQB 3HOVB 3JAMi 2IX1A 5FLMH 3ERSX 5IY0A 3CC4A 1NE3A 3GTLB 1WVLA 5T1GA 5C44B 1CFMA 3MZ5A 2RVLA 2WV6D 1IYJB 3STBD 4LF5Q 4A3EB 2ID0A 1L1OB 4IJHA 3PMFA 4IO9A 1VDZA 5CV6A 3HOUG 1B50A 2Q2UA 2OTJA 4WFN3 4X64Q 1HZ9A 3MFYA 5IIFA 4EVOA 2L0CA 2K75A 4F88A 3SK8A 2ASBA 1CUKA 4IZ8A 1D6EC 5M5XH 1PH2A 4DNRB 5C5LA 2AQ2B 1I4XA 4K2KA 5IGCA 4KK7A 5CV9A 2R6GA 3DWAA 1WCMH 1A8VA 5CYUA 4UPAA 1SJHD 4WJ4A 4LF9Q 3F2CA 2QGQA 1V1OA 1YJ9A 3QOLA 2AWOA 4MZ9A 1YVCA 5FJ8G 1PVOA 1Z47A 3MEHA 3BVMA 4KHVA 3IRBA 3S17H 3H09A 1PFBA 4PZ6A 4OWTB 4A3LH 3HP3A 4JYAL 3FP9A 4L5RC 4A4IA 4C3HG 3PUVA 3EQLC 1JOOA 3KJOA 1AZPA 1SNQA 5ELBA 1HA6A 2VQEL 4OIKA 1UWVA 3C1EA 3BDCA 2A6ED 2PI2A 5I6WA 2K04A 3JAML 2EY5A 3OWFA 1AH9A 2IT1A 2A68C 5IYCG 1V1PA 5M5XB 5JJZA 4GOPC 2R92B 4YY3L 1IYUA 4IOCA 2UXBQ 3L7ZC 5JAVA 2LFNA 1Y1VB 1HNZL 5IP9H 1OTCA 4LF7Q 1SMYC 3G7LA 3QOJA 1HUMA 2HIVA 2YYZA 3M4PA 2F0QA 3RMHA 2N3SA 2R7ZB 1DOKA 1GVPA 2OT2A 4R4IA 4G7HC 1N9WA 4QL5A 2NB0A 5C0XH 1D5XC 1EU4A 3UI2A 1LV9A 1KHIA 4O0AA 2FHTA 1HR0L 3M7GA 5IODA 2E76C 3X3NA 1U4MA 5C44H 3DM1A 4JBJA 3VR5A 3PUZA 1IYVA 1JE5A 2L9HA 4NW2A 2RBMA 4A76A 1ONLA 1YHBA 1NR4A 4Y7NB 1U4RA 1H9SA 4MIUA 5FLMG 2K7VA 2I07B 3FKIB 4LF6L 3NP8A 2QA4A 4G4KA 4AYBB 1VQ8A 3J80E 5I4DA 1YJWA 3NTIA 3QIAA 3HOUB 5C6AA 3D4RA 3W1GA 4DV3Q 2HCIA 5CV8A 2CKZB 1I3QB 1LABA 1VQIA 3L0OA 1F9PA 3DWQA 2A6HD 4DXFA 3KLRA 2NN6I 1WCMB 4QGUA 1MJEA 3CCMA 4U673 1JWUD 3P1HA 3S1NB 3CMAA 4BBSG 5IWAL 4OWWB 4FF2A 1I5FA 4AIMA 5IYDG 2RF4A 3CCLA 5I9OA 2EY6A 5D65A 1LT4D 5HGQA 3HOVG 4LFBL 4UP9A 1A15A 3U4ZA 5GADC 1EIHA 1TWHH 4IUUA 5C0XJ 1LT3D 1ZKOA 2A8VA 5CV4A 1SYCA 4ULLA 1KLGD 2IW3A 2K1BA 3STBC 3S14H 1ENCA 4JI1L 4DR4L 1L0XB 1JC7A 2EJMA 2O5IC 3BDOA 1DYQA 4J15A 1J5EQ 3NHHA 3F2DA 1STHA 2IY5B 1VQEA 4QF4A 4BY1H 2KHJA 5EJWA 3KBGA 2XNAC 4BY1G 4DK3C 4BBRH 4L5SA 3WWVA 1HXYD 4KHPQ 1EZ6A 4RKLA 4DAYA 4FF1A 1KLUD 1J8IA 1Y8PB 1I50B 1QVGA 4OGQC 4JBWA 1M4VA 2VUMG 5IT9c 1AEXA 4GN3B 1EQVA 1X3PA 1BR9A 1X55A 4XYQA 3K5OA 3H6MA 1MBYA 4PMWA 2H4OA 4IN3A 3HOVH 4KJNA 4IPGA 1L2FA 3S2HH 1JWMD 2RSOA 2MFIA 2D0PA 3QWNA 3KF8B 2HHHL 3RZOH 2CHBD 2QDBA 1KDBA 1EWIA 3MHBA 3GQBA 1LYLA 3M7NA 4G7ZC 1SN8A 1OXTA 5E4WC 4KD3A 2ATWA 3D6WA 2UXBL 1S40A 2WP8J 3J81i 1PV4A 3M4QA 1D8LA 3CCRA 1T5EA 1I3QH 2XRSD 1VF7A 1BCPF 4DV4L 3RUZA 1VQGA 3E9HA 3AEVA 3A8KE 3S24A 4NXML 1E7ZA 3CPFA 2F0EA 5LMNL 4H44C 2Z0SA 2IHFA 1TT2A 4RGNA 5EPJA 1J6QA 3GTGB 2ZXOA 4E6IA 4BY7B 4JI1Q 1I4GA 4A3IG 1MKHA 2EOTA 4A3JG 1KDCA 3H3VH 2A73B 4P2CB 4WJWA 3Q23A 4DPGA 4B3RQ 3PO2G 1UE6A 3GTQB 4XT1B 3NPPA 4AQYL 2RDFA 4DK6C 1R9TB 1UE7A 2UXDL 1VCIA 1CT1D 4JI2Q 4UP8A 3I91A 2HUGA 3AYHB 4DGZA 1FD7D 4LF9L 4BY1B 3PF5A 4LF5L 5C4JB 4B3ML 3PF4A 1EY5A 5JPNC 2HCCA 2X6LA 2JA6B 5IYBG 3ITPA 3ERQA 4DV2Q 3R2IA 1CA5A 2EYHA 4Q5VA 3WOEA 2KHSA 2NBFA 1CHPD 1BNZA 1YI2A 5JJLA 4C3HH 1PH8A 2KBNA 4LF6Q 2L12A 2C5CA 3OTOL 4GN5A 3HKSA 1HH2P 3S15H 4BBRG 4X3TA 1DOLA 3O13A 5M9OA 3BVGA 3EBEA 4KN7C 5EBCA 2IL8A 4R1JA 4RGOS 4ALPA 5I2YA 2RDGA 1BBXC 5JJIA 3S2DH 2EVBA 3JC66 3PIP3 1MJCA 1D5MC 1RDPD 4ODGA 2OF1A 4PQXA 1WCMG 4JBKA 4R4CA 3EFXD 4IOAA 3M9BA 4UAIA 1YNJC 1NUCA 4Y7NH 1E1OA 2PPBC 1EYDA 2PQEA 5FKAC 1KL9A 3OSOA 2K01A 5C4HA 2R7DA 4AYBG 4RG1A 1XX8A 2WB1G 2I0QA 4CGYB 3V05A 2ICEC 3E0EA 2I5MX 3W2DA 4C3IB 4K5WA 1X56A 2KQ3A 3EVQA 1GXDC 1EZ8A 1XXGA 1E2VA 1RTOA 1WTVA 3VDYA 4JI7Q 4BXXG 4DV1L 4KKUA 4FXDA 4LF8L 4R9WA 5M5YH 4HJ8A 2BDOA 3M4OH 1WOCA 3V96A 2UUAQ 4LUOA 2EYOA 1Q3LA 3DHQA 1LLRD 1I6HH 1GKHA 4KV6A 1ESFA 2PMZB 4HMIA 4B3TL 4OIJA 1QNUA 2JA9A 1R9TH 4L63B 1VQMA 3S16B 3F1ZA 1Y1WB 1NY4A 1TS5A 1PFMA 3HG9A 1N33L 1OXVA 1MD2D 1Q8KA 1U4PA 3HKZB 4C1NI 1SLJA 3K57A 1DGSA 4O42A 4LUVA 1J9OA 1PMRA 2PW5A 2FXQA 1RJTA 1OXXK 1C48A 3HOUH 3P20A 1JE4A 1GUSA 3TP5A 4OWXB 3E6ZX 3FVQA 2K05A 2DGYA 2BOSA 5CBAE 4C3HB 1EEID 1QILA 3OYYA 3S1NH 4M1UB 3K8AA 4CHTB 2L4NA 2LXKA 2HDMA 2AUJD 5LL6S 3TSSA 4CKCA 1G6ZA 5IYCH 1TY2A 1EY6A 4GLXA 1SYEA 4AH6A 4IQZA 4FXKC 2XN9C 1E24A 2H5XA 5ELFA 1T5XD 2FINB 4EX5A 1O78A 1TXYA 1PYWD 3NE5B 3NWSA 4IFDJ 5EAYA 4C2MB 1DONA 1JJCB 4C56C 1QVCA 1IZ6A 5C3EB 2O5JC 1HNXQ 2A6EC 3NTHA 1FGBD 1JMCA 3RZOB 3A55A 1SFOH 1IBKQ 4TRDA 3T16A 3B6YA 1N8RC 1JORA 4A3GB 4DR4Q 1DXMA 5IOCA 1KQSA 4DXGA 2IJ0A 3TS2A 5LMUL 3TZDA 3VR3A 1VQAA 1XMQQ 4UY8C 4GLAC 4YWMA 4LFAQ 1FVIA 4A3EG 1UAPA 1ENFA 4GZYC 1ZYRC 3WOFA 1GJXA 1NMGA 3AU7A 3HZXA 1HCZA 2KCTA 4R8IA 3A8JE 2F3WA 2KA7A 3FHWA 2F0GA 2NVQB 1RL2A 1KD1C 4A3MG 1A0IA 5E7NA 5J3BA 2UXDQ 3GTKB 2AKWB 3I4MH 3CMEA 2PNRC 1WD1A 2NYZD 4K5VA 4B3TQ 1JOQA 5IGFA 2JA5H 5GROA 1NJIC 3MEFA 1IBLQ 4XXEA 3T1YQ 3RLFA 4DR5L 2SEBD 2IX0A 1AW7A 1E3PA 4PV1C 2PZTA 4DK0A 1VQCA 4HMJA 3HOZH 5EGTA 1D2BA 2K52A 2G9HD 3CW2C 2Q2TA 3HOWG 4XTCS 4JI0Q 4KN4C 2B39A 2EYJA 5LMNQ 3WDNA 4JBMA 4DR2L 4IALA 1GHKA 3VR4A 3BJUA 3CPWA 3CXCA 5KNBA 2JA6H 1SSOA 1FL0A 3SGIA 2BCOA 5FO9B 5C4XG 5EBDA 4OL7A 4GN4B 2L15A 2MQHA 4DR7Q 3E5SA 4KY6A 2EXDA 1IW7C 5FOBB 2OXPA 4A3EH 4DUZL 4HIKA 1GUOA 3RN5A 2NVQH 1Q1EA 3M4YA 2YU9H 4A3FG 4GKKQ 4GNXA 2PQAB 2PO4A 3TN2A 3T1HL 1YNXA 1IKLA 1OXSC 1ILPA 1XPOA 5EPKA 1EIYB 1NSNS 4DV0Q 2UUBL 2LY7A 1TWGB 2RA4A 3NBHA 4GKJL 3DLLA 3P75A 2R93H 2C35B 1IKMA 2WIIB 3TREA 4P71A 2F0KA 2B63G 4EQPA 3F2UA 2KHIA 2D0OA 2BE5C 3VYRA 5BN5A 2KCCA 4C3JH 3NBIA 2WAQB 4ZKBB 5KIXA 2B8FA 4FP5D 4I7ZC 2OTLA 1CKNB 2C9OA 3K5NA 3H3VI 4X6AH 4YWLA 1TVXA 2J4XA 3LX0A 1SMXA 5JPMC 1IXRA 1IBLL 4A3DG 1PDQA 4XIGS 3HRZC 4KJOA 4QIWB 5E4XA 2JA7H 5KRUA 5C3EG 2AHOB 2N88A 2J0TD 1SE4A 1YHQA 3CCUA 3GD7A 4GNXB 3QJYA 3DUZA 4WRDA 3KF8A 3ULLA 4YHHL 1XNRQ 3VA7A 1EY4A 4HIDA 3PO3G 4IFDH 2Z4HA 2EYLA 3J81L 2AQ3B 5GQOA 3DM3A 4JI3Q 2F4VQ 1SJED 2PW7A 2XWJB 3MC0B 3ICEA 1TWGH 1PH7A 1F2LA 2F0OA 1W2BA 1CQVA 3FMCA 4X64L 1N34Q 2K5QA 1RTNA 2ZJQA 4A93G 2F03A 1IBKL 1M1KC 2B2WC 1JJ2A 5FO7B 4C3JB 3J7AF 4HCEA 3I4NH 4HJ7A 1PH1A 2EY1A 5E3FA 5JEAJ 2NWGA 4PZ8A 2CQAA 3HKZG 1DD2A 5BR8Q 1S4ZA 2ZXRA 4DV3L 2UUBQ 4IUPA 4OONA 1GO3E 5M5WB 1LT5D 2A69C 4KKSA 3MXUA 2LKVA 3HEJA 4J8QA 2JSOA 5JOBA 2F0FA 2JXMB 2QF7A 2JA7G 2RDHA 3J7AV 2E75C 3J81j 2WKDA 4GKKL 4JG2A 4XT3B 4KLKA 2EYPA 2EDGA 2DY7A 4HR7B 5EKKA 2SNSA 1TU2B 5J39A 4J6HA 5DNFA 2CWPA 2HIXA 2IHEA 2OWOA 5IT9L 4L5QA 1QJOA 3UE0A 1STAA 2Z8LA 2L11A 2UU9Q 1HHVA 4B3SL 1K9MC 1EFID 1G8ZD 5EQ0A 1HZAA 3S16H 4GOPB 4LF4Q 4DR2Q 2D5DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MIU A;  1V1Q A;  1BBW A;  1T9H A;  2VQF L;  4DV7 L;  3CQZ H;  3K7A H;  4A3D H;  1EWI A;  1LYL A;  3KLW A;  3M7N A;  2ES2 A;  1SN8 A;  2JA5 G;  1OXT A;  2ATW A;  3UDF A;  2UXB L;  1S40 A;  1HZB A;  2WP8 J;  3J81 i;  3I4M G;  2B29 A;  1PV4 A;  3M4Q A;  4JYA Q;  2E2H H;  1D8L A;  3CCR A;  1EFW A;  3A5Z B;  1GM5 A;  1I3Q H;  2F3I A;  4A3M H;  4DV4 L;  1VQG A;  4X66 Q;  3E9H A;  3A5U A;  3S1M H;  3AEV A;  3S24 A;  4JI8 Q;  2YV5 A;  4DAM A;  1E7Z A;  3CPF A;  4IPD A;  2ZM6 Q;  5LMN L;  2Z0S A;  2E2I H;  2IHF A;  5C4X H;  1KRS A;  4JOI C;  2CFM A;  1PH5 A;  4JI4 Q;  2CQO A;  1J6Q A;  3PV0 A;  1B70 B;  3CC7 A;  4A3B G;  4QIW E;  2E2J H;  4JI1 Q;  5IYB H;  4A3I G;  1MKH A;  2UXC Q;  3TQY A;  4A3J G;  5ELO A;  4KHZ A;  3H3V H;  1Z9F A;  3T1Y L;  1VQF A;  4A3K G;  3I55 A;  1N36 Q;  4DR6 L;  3L2P A;  2R92 H;  3HOW H;  3S1R H;  4LFA L;  5IYD H;  4X62 Q;  1HNW Q;  4HJ9 A;  1PYS B;  2MO0 A;  4DV6 Q;  3PUW A;  2XTI A;  4DPG A;  1UE6 A;  1PYB A;  3CC2 A;  3PO2 G;  4B3R Q;  1CKM A;  3HOX G;  4AQY L;  3BZK A;  4DK6 C;  4YHH Q;  4O2D A;  1UE7 A;  2UXD L;  1NMF A;  1YHA A;  1VCI A;  3PO2 H;  4JI2 Q;  2JK8 A;  4UP8 A;  1VQB A;  1Q82 C;  4JI6 L;  1X65 A;  2AWN A;  3AYH B;  3NEL A;  1CKO A;  1WJJ A;  1YZ6 A;  3W5O A;  1EQQ A;  2ZTD A;  4LF9 L;  2JA6 G;  3GTK H;  3PF5 A;  3PUX A;  4LF5 L;  4B3M L;  5FJ8 H;  4LNQ A;  1XPR A;  1KC8 C;  3PF4 A;  4ME3 A;  4UP7 A;  3I56 A;  5IYB G;  2N78 A;  4X65 Q;  1XMQ L;  1SR3 A;  5M5W H;  2R7F A;  4DV2 Q;  1KIX A;  1HR0 W;  5LMU Q;  3J81 c;  2CCZ A;  1TWF H;  2WAQ E;  4AYB E;  1YI2 A;  4C3H H;  5JJL A;  1PH8 A;  1WYD A;  2KBN A;  4LF6 Q;  3OTO L;  1Q1B A;  1Y1V H;  3PUY A;  4GN5 A;  1VQ7 A;  4HIO A;  2D62 A;  3NEM A;  1O7I A;  3HKS A;  1BKB A;  1HH2 P;  1BVS A;  3S15 H;  4BBR G;  3GTJ H;  2R7Z H;  3FKI H;  5C0X G;  1VS0 A;  2JEA I;  5C0X I;  2VS1 A;  4P74 A;  3EBE A;  4DV0 L;  4BY7 G;  2YTV A;  1C9O A;  3JAM c;  4R1J A;  1HR0 Q;  4P73 A;  4ALP A;  5IP9 G;  1YJN A;  2JA8 H;  3T1H Q;  1C7Y A;  5JJI A;  3S2D H;  2UUC L;  4A3C H;  4X65 L;  3JC6 6;  1KRT A;  1E1T A;  1MJC A;  1PFS A;  1TWA H;  3CCJ A;  5AJ3 Q;  1WCM G;  1KAW A;  4B3M Q;  4R4C A;  1ASZ A;  4JBK A;  2Q2H A;  4IOA A;  3M9B A;  1QUQ B;  1M90 C;  2PQA A;  1E1O A;  2N8N A;  4Y7N H;  1HNZ Q;  1B7Y B;  4LF7 L;  3Q8D A;  3UE1 A;  1KL9 A;  4JI5 Q;  1JT8 A;  4MTN A;  2R7D A;  4AYB G;  3U50 C;  3EN2 A;  4RG1 A;  4DR3 Q;  4GOP A;  2WB1 G;  4YY3 Q;  2I0Q A;  4B3R L;  4TQU S;  2ALY B;  4L5T A;  3E0E A;  2I5M X;  1X56 A;  3PIO A;  2Z6K C;  1L0W A;  2VUM H;  4DR6 Q;  1BBU A;  1K83 H;  1VQP A;  4P75 A;  3GTQ H;  3HOX H;  4OX9 L;  4JI0 L;  4NB3 A;  2VQE Q;  5M3F H;  3HOY H;  1K0R A;  3VDY A;  4LWC A;  4JI7 Q;  1TWC H;  4DV1 L;  1N33 Q;  1P16 A;  1QZG A;  4BXX G;  4LF8 L;  2LSS A;  4HIM A;  4DV1 Q;  2BH2 A;  4JC0 A;  1G29 1;  5M5Y H;  4HJ8 A;  3RZD H;  1FJG L;  3NBH B;  3A74 A;  4JOI A;  1Q81 C;  1WOC A;  4H02 A;  3CCQ A;  3M4O H;  2UUA Q;  4JI8 L;  3J7A 5;  3H0G H;  4KI0 A;  4LUO A;  4PG3 A;  1K8A C;  5FLX c;  4DR5 Q;  3TS0 A;  4A3I H;  1UE1 A;  2KCM A;  1YIJ A;  2R7Z G;  1I6H H;  4BA2 I;  1VQ5 A;  1EYG A;  1Q86 C;  2BA1 A;  1GKH A;  4EQ5 A;  4DR1 L;  2B63 H;  2NN6 G;  2BH8 A;  3GDE A;  1U5K A;  5DLQ E;  4B3T L;  1Y1V G;  2RCN A;  1NTG A;  4R4T A;  3CAM A;  2JA9 A;  1Q46 A;  1RIP A;  1R9T H;  2UUA L;  1AE3 A;  1VQM A;  3W1B A;  2R93 G;  3F1Z A;  4YCV A;  1FJG Q;  2VW9 A;  1NY4 A;  2DUD A;  4A3C G;  2XGT A;  3GO5 A;  1N33 L;  4JI7 L;  1OXV A;  3KOJ A;  2VQF Q;  4DV7 Q;  1Q12 A;  4P72 A;  1Q8K A;  1K8G A;  2WB1 E;  4OO1 G;  3GTG H;  4OX9 Q;  3F8T A;  2VL6 A;  1SLJ A;  1DGS A;  3AQQ A;  4IFD G;  4NPS A;  4LUV A;  4JV5 L;  2FXQ A;  1SRU A;  1OXX K;  1OXU A;  2AMC B;  1JJG A;  3HOU H;  4Y52 H;  1HJP A;  4HJ5 A;  1WI5 A;  1VQD A;  4OWX B;  2K14 A;  4BXX H;  2DGY A;  5M3F G;  4JCV E;  2NZH A;  4DNI A;  4QQB X;  2K5N A;  1LM0 A;  3KF6 A;  1G51 A;  2PMZ E;  2K5V A;  4LUZ A;  4DR3 L;  3OYY A;  4C2M H;  3S1N H;  1YEZ A;  1X3E A;  2RHS B;  3K8A A;  2K50 A;  4JI5 L;  2LXK A;  4IPH A;  3CP0 A;  1CSQ A;  1YBY A;  1EQR A;  4POF A;  5IYC H;  1CKN A;  4A3K H;  3I2Z A;  4GLX A;  4DAY B;  3HKZ E;  5AJ3 L;  3ER0 A;  1LTL A;  3KJP A;  1HNX L;  3KDF B;  4AH6 A;  3J80 i;  5C4J H;  3H0G G;  2K4K A;  1L1O A;  1E24 A;  3ULJ A;  1KXL A;  2HT1 A;  2H5X A;  4A3B H;  2JE6 I;  2PNH A;  2RHQ B;  3JAM i;  2IX1 A;  4EX5 A;  1TXY A;  1IBM Q;  3LGJ A;  5FLM H;  3ERS X;  5IY0 A;  3CC4 A;  1NE3 A;  1W3S A;  1VQK A;  3HOY G;  2VZA A;  4IFD I;  4OXP A;  4IFD J;  5EAY A;  3HOZ G;  1JJC B;  3TEH B;  1QVC A;  1IZ6 A;  1IYJ B;  1HNX Q;  1EIF A;  3STB D;  1JMC A;  4NXM L;  4LF5 Q;  4QJF A;  1SFO H;  2B3G A;  2ID0 A;  4IJL A;  2E8G A;  1IBK Q;  1L1O B;  4IJH A;  5H1S E;  4IO9 A;  3CD6 A;  4JI6 Q;  3B6Y A;  1N8R C;  1P8L A;  3KDF A;  2Q2U A;  3HOU G;  4JI2 L;  2OTJ A;  2JJQ A;  4X64 Q;  1HZ9 A;  4DR4 Q;  1SE8 A;  3OTO Q;  2LXJ A;  3RN2 A;  4AQY Q;  5GAG C;  2K75 A;  1KQS A;  3FKI G;  2ASB A;  1CUK A;  2WAQ G;  3E9I A;  3TS2 A;  5LMU L;  4DV6 L;  4A3F H;  5M5X H;  1PH2 A;  1VQA A;  2BA0 A;  1XMQ Q;  4MNO A;  3F2B A;  3I7F A;  4APV A;  3K0X A;  4GLA C;  4YWM A;  4LFA Q;  1FVI A;  4UY8 C;  1VQO A;  1UEB A;  4A3E G;  5M3M H;  1X6O A;  4JV5 Q;  2R6G A;  1WCM H;  1A8V A;  2JEB I;  4UPA A;  1NMG A;  4WJ4 A;  2KCT A;  4LF9 Q;  1FGU A;  2UXC L;  3F2C A;  3FHW A;  1XNQ L;  2QGQ A;  1RL2 A;  1YJ9 A;  1KD1 C;  2MO1 A;  4A3M G;  2AWO A;  4OO1 I;  1A0I A;  4MZ9 A;  5E7N A;  5J3B A;  3RLN A;  2UXD Q;  2EIF A;  3A0J A;  2AKW B;  1YVC A;  3RNU A;  3I4M H;  3CME A;  5FJ8 G;  1PVO A;  1Z47 A;  2ZM6 L;  5JJK A;  3IRB A;  3G6E A;  1V9P A;  3S17 H;  3RR5 A;  1D7Q A;  3OW2 A;  4B3T Q;  4DR1 Q;  2Q2I A;  4X62 L;  2JA5 H;  5GRO A;  1E22 A;  4K0K L;  1NJI C;  4DV4 Q;  3MEF A;  1IBL Q;  4PZ6 A;  4OWT B;  3T1Y Q;  3RLF A;  4DR5 L;  3D0F A;  2IX0 A;  4A3L H;  1E3P A;  4JYA L;  3FP9 A;  1VQC A;  1QVF A;  4BBS H;  3HOZ H;  2K52 A;  4L5R C;  2CWA A;  4A4I A;  3CW2 C;  3K80 C;  3PUV A;  3G4S A;  2Q2T A;  4LF8 Q;  3KJO A;  2R92 G;  3HOW G;  1B8A A;  4XTC S;  4BA1 I;  2VQE L;  1UWV A;  3PIP A;  4JI0 Q;  3ZJY C;  5LMN Q;  2PI2 A;  1PH4 A;  4NXM Q;  4JBM A;  4DR2 L;  4R4O A;  2Z6K A;  1AH9 A;  3BJU A;  2IT1 A;  3CPW A;  3CXC A;  4GKJ Q;  2JA6 H;  1FL0 A;  5IYC G;  2JQO A;  3SGI A;  2ZTC A;  3ULP A;  1A63 A;  3CCS A;  2K5H A;  4GOP C;  1XMO L;  1X54 A;  2VNU D;  4YY3 L;  5C4X G;  4GN4 B;  4IOC A;  2L15 A;  2MQH A;  1Y1W G;  3K7U C;  4DR7 Q;  2UXB Q;  3CF5 A;  2EXD A;  3L7Z C;  1PH6 A;  3AFP A;  1K73 C;  4QY7 A;  1G6P A;  1LUZ A;  4DUY L;  4A3E H;  1HNZ L;  5IP9 H;  4DUZ L;  4GNX C;  4HIK A;  3RN5 A;  1OTC A;  4LF7 Q;  2JA8 G;  1YIT A;  1Q1E A;  2HIV A;  2WFW A;  2YYZ A;  3M4P A;  2N3S A;  2NVQ H;  4DUZ Q;  5GAH C;  2YU9 H;  4DUY Q;  4A3F G;  4LF4 L;  4GKK Q;  4GNX A;  1GD7 A;  1GVP A;  4R4I A;  5IP7 H;  1N9W A;  2PQA B;  4QL5 A;  1EUJ A;  4R4Q A;  4A3J H;  1AE2 A;  1QUQ A;  4B3S Q;  1XTD A;  1UE5 A;  2UUC Q;  4DR7 L;  3T1H L;  1YNX A;  1KHI A;  1OXS C;  2ZTE A;  4O0A A;  1XPO A;  1HR0 L;  1S72 A;  2UU9 L;  2E5L L;  4PZ7 A;  1H95 A;  1EIY B;  4DV0 Q;  1XJV A;  3AFQ A;  4IPC A;  5C44 H;  2VY3 A;  2UUB L;  1ASY A;  5BR8 L;  4GKJ L;  3BU2 A;  4JBJ A;  1VQ9 A;  1VQL A;  3DLL A;  4DV5 L;  2A1A A;  2R93 H;  3PUZ A;  2C35 B;  3TRE A;  4P71 A;  2OQK A;  1JE5 A;  1XPU A;  2OCE A;  2B63 G;  4A76 A;  1YHB A;  2KHI A;  2D0O A;  4HJA A;  4LFC L;  5FLM G;  1J5E L;  4C3J H;  2NVT H;  1JB7 A;  2OTL A;  1C0A A;  2NVY H;  1CKN B;  4LF6 L;  2QA4 A;  4FDB A;  3H3V I;  4X6A H;  1VQ4 A;  4YWL A;  1N32 Q;  1VQ8 A;  4A3G G;  4KHP L;  3EIV A;  1I94 Q;  1SMX A;  4YCW A;  1X3G A;  1YJW A;  1X3F A;  1IXR A;  4DV2 L;  3W1G A;  1A62 A;  3CCE A;  4DV3 Q;  2ZJR A;  1IBL L;  2CKZ B;  4A3D G;  2HQL A;  1VQI A;  3L0O A;  5LMN W;  4K0K Q;  4XIG S;  1QZH A;  2NN6 I;  2YTY A;  2MNA A;  4QGU A;  3KYH C;  3CCM A;  1K3R A;  3U4V A;  3CCV A;  1MJE A;  2JA7 H;  5C3E G;  2AHO B;  5IE8 A;  3CMA A;  1HZC A;  2NZO A;  3PSI A;  5JEA G;  5C44 G;  4BBS G;  5IWA L;  3J80 c;  4OWW B;  1XNR L;  1I5F A;  4AIM A;  3K81 C;  2I5L X;  2YTX A;  5IYD G;  3CCU A;  2RF4 A;  1YHQ A;  3GD7 A;  4LFB Q;  5K36 G;  1Q7Y C;  2Y0S G;  4GNX B;  3PCO B;  3CCL A;  3M3Y H;  1N34 L;  5HGQ A;  5HY6 A;  5GAE C;  3HOV G;  4LFB L;  1XNQ Q;  3ULL A;  4YHH L;  1IL2 A;  3KFU A;  4UP9 A;  5IWA Q;  1XNR Q;  1NBW A;  4NXN Q;  4A3G H;  1PA6 A;  3U4Z A;  3I4N G;  4HID A;  5GAD C;  3PO3 G;  2QEX A;  1TWH H;  2F52 A;  1PH9 A;  1VQ6 A;  1HNW L;  4JI3 L;  2F4V L;  3S1Q H;  5GQO A;  5C0X J;  2A19 A;  3G71 A;  3DM3 A;  3KF6 B;  4JI3 Q;  2A8V A;  1N36 L;  2F4V Q;  4WJ3 M;  3U58 A;  2OQ0 A;  1I94 L;  3ICE A;  1TWG H;  1PH7 A;  4NXN L;  1S3O A;  3STB C;  3S14 H;  2GVB A;  4JI1 L;  1I50 H;  4DKA C;  1W2B A;  4DR4 L;  1EOV A;  4X64 L;  1N34 Q;  4GLV B;  4J15 A;  1J5E Q;  2ZJQ A;  4A93 G;  4LFC Q;  2Y0S E;  3F2D A;  4JI4 L;  1IBK L;  1M1K C;  4BY7 H;  1JJ2 A;  2ZJP A;  1PHJ A;  1VQJ A;  4TVA B;  2IY5 B;  1VQE A;  2EQS A;  3I4N H;  1VQN A;  4BY1 H;  4HJ7 A;  3UDX A;  2KHJ A;  1PH1 A;  2V1C C;  5JEA J;  5IP7 G;  4X66 L;  1CSP A;  4PZ8 A;  4BY1 G;  4DV5 Q;  3HKZ G;  4DK3 C;  5ELN A;  5BR8 Q;  1WFQ A;  4BBR H;  4DV3 L;  2UUB Q;  4L5S A;  4OON A;  1GO3 E;  3UDI A;  4A93 H;  1IBM L;  3WWV A;  4GS3 A;  3PGZ A;  4KHP Q;  1V43 A;  3NEN A;  1N32 L;  5C3E H;  2N49 A;  2JA7 G;  4YCU A;  4A3L G;  1L1O C;  3BZC A;  3J81 j;  1QVG A;  4JBW A;  4POG A;  1Y1W H;  3GTO H;  4GKK L;  4JG2 A;  2VUM G;  4KLK A;  3G48 A;  1PH3 A;  2NVX H;  1VQH A;  1SRO A;  3RLO A;  4YWK A;  3GTP H;  1U0L A;  3D31 A;  4GN3 B;  5IT9 c;  3M85 A;  2I5H A;  2HHH Q;  1X55 A;  3J7Z C;  3PO3 H;  2CWP A;  2HIX A;  2IHE A;  3HFZ B;  2OWO A;  2GVA A;  1Y14 B;  4L5Q A;  4PMW A;  2GN5 A;  3UE0 A;  3I4O A;  2E5L Q;  3HOV H;  4RMF A;  4C3I H;  3GTM H;  4IPG A;  1L2F A;  2UU9 Q;  1XMO Q;  3S2H H;  4LW1 A;  3GTL H;  4B3S L;  2MFI A;  1K9M C;  2D0P A;  2PI2 E;  3MXN B;  4A75 A;  1HZA A;  3KF8 B;  3S16 H;  2KEN A;  2HHH L;  3RZO H;  5M3M G;  4GOP B;  4LF4 Q;  4DR2 Q;  3TRZ A;  3H15 A;  1X9N A;  3UDG A; 
#chains in the Genus database with same CATH topology
 1V1Q A;  1BBW A;  2VQF L;  3CQZ H;  4X3U A;  3I72 A;  2WB1 B;  2RCF A;  2ES2 A;  2JA5 G;  3BYT B;  3I4L A;  1HTP A;  4L8J A;  3OHX C;  1FYC A;  1SE3 A;  5HUR A;  1XYI A;  3CRK C;  4A3M H;  4X66 Q;  3A5U A;  4QUC A;  1U9R A;  3T13 A;  4DAM A;  5C4X H;  4RKB A;  1KRS A;  1PH5 A;  1CTM A;  1JIC A;  2NN6 H;  4OEM B;  1ESR A;  1PLF A;  1G2S A;  2KUM A;  2UXC Q;  1KNA A;  5FLX L;  3TQY A;  1LTB D;  3NTK A;  4PNY A;  1AFP A;  1Z9F A;  1N36 Q;  2XWB B;  3I55 A;  3LWE A;  3HOW H;  4BBR B;  1KAB A;  2K5D A;  3QB3 A;  2KJX A;  2XTI A;  3SK6 A;  1PYB A;  1CQF A;  2NZ1 D;  3HOX G;  4MTK A;  3BZK A;  2XSC A;  1NMF A;  1YHA A;  4IUT A;  1SFO B;  3PO2 H;  2FMC A;  3DXJ C;  2ZT9 C;  1E2Z A;  4JI6 L;  3CQZ B;  3V2T A;  4EGV A;  3NEL A;  3NXW A;  2JA6 G;  1W6K A;  1SNO A;  1CI3 M;  1I4R A;  1XPR A;  1QWY A;  4UP7 A;  3MWY W;  1RD9 D;  4C3J G;  4RAU C;  2KEE A;  4XQQ A;  1X3Q A;  1HRJ A;  1SNP A;  5M5W H;  1HR0 W;  3OW7 A;  2CCZ A;  1EEF D;  3FPU B;  2PZW A;  4ILW A;  4I65 A;  4ZCK A;  1TWA B;  1Q1B A;  1JWS D;  2FMM A;  1FR3 A;  1STG A;  4HIO A;  5KYI A;  1O7I A;  1OO9 B;  3GTJ H;  3VA5 A;  5DEH A;  1RKN A;  1S5B D;  1VS0 A;  5CR3 A;  4PMC A;  5D3I B;  4A3J B;  1L0Y B;  3W3A A;  3SK4 A;  3JAM c;  1B2T A;  2Y0S B;  3T1H Q;  2UUC L;  2L55 A;  3H94 A;  3TP7 A;  4X65 L;  4HAE A;  1PFS A;  1Q90 A;  3CCJ A;  1H9M A;  1ASZ A;  1QUQ B;  2PQA A;  2N8N A;  1S5F D;  1B7Y B;  2F1M A;  4JVZ A;  2E2D C;  2PYK A;  3OIQ A;  1JT8 A;  1LAC A;  3U50 C;  3EN2 A;  4O1N A;  4DR3 Q;  4DN4 M;  2MGS A;  1PXU A;  2B2T A;  2A69 D;  5EKL A;  3PIO A;  1CHQ D;  2Z6K C;  2VUM H;  4DR6 Q;  1VQP A;  3GTQ H;  4OX9 L;  4JI0 L;  4NB3 A;  5C5M A;  2B2U A;  2VQE Q;  3BYY B;  4K14 A;  4LWC A;  1P16 A;  1STN A;  4H13 C;  2BH2 A;  4JC0 A;  1G29 1;  4HTH A;  1SNC A;  1EOT A;  5DAU A;  1EY7 A;  4WOR A;  1BO0 A;  1LTA D;  3TS0 A;  4A3I H;  4XDX A;  4A3F B;  1Q86 C;  3K59 A;  2BA1 A;  5EPL A;  1LO5 D;  2B63 H;  1ICW A;  4S3S A;  2RCN A;  1NAP A;  2EJG C;  5KNC A;  2J7Z A;  4R4T A;  2R93 G;  1LTI D;  3W1B A;  3ND9 A;  5F2D A;  4A3C G;  4JI7 L;  3S15 B;  1Q12 A;  4P72 A;  1K8G A;  2WB1 E;  3J7Y W;  2F0S A;  4DAP A;  1H9K A;  1SRU A;  3SVM A;  2AMC B;  1VF5 C;  3TME A;  1V1P B;  2DN8 A;  1JJG A;  4Y52 H;  1H9J A;  1G91 A;  4BXX H;  2NZH A;  5K36 H;  2K5N A;  3S2D B;  1E0B A;  1LM0 A;  3KF6 A;  2JYO A;  4KTA A;  3S1M B;  1SYB A;  3S14 B;  4JI5 L;  1S5C D;  1EY0 A;  1CSQ A;  5COR A;  2EPB A;  4POF A;  4FF3 A;  2K5W A;  1XWE A;  3MXG A;  1BUV T;  1JCK B;  3HKZ E;  3ER0 A;  4FNF A;  5AJ3 L;  1DZ1 A;  3KDF B;  3J80 i;  3H0G G;  1L1O A;  1FNV A;  1F9Q A;  4K6L A;  2JE6 I;  4RFB A;  2FFK B;  1IBM Q;  3LGJ A;  1WTP A;  1W3S A;  3HOY G;  4R8N A;  4RHS A;  4IFD I;  4OXP A;  3HOZ G;  4N8F A;  4ID6 A;  2N55 A;  3TEH B;  1EIF A;  4QJF A;  5CBE E;  4IJL A;  4N9T A;  2E8G A;  5H1S E;  3CD6 A;  4JI6 Q;  5CGK A;  4JI2 L;  1ZXT A;  2LXJ A;  3I70 A;  3RN2 A;  4AQY Q;  2NTS A;  5GAG C;  3M4O B;  3FKI G;  2ZXP A;  3MVV A;  3T51 B;  4APV A;  1W6J A;  2X6G A;  1VQO A;  5M3M H;  3K0Y A;  1X6O A;  3OMC A;  3Q22 A;  1STB A;  2UXC L;  1F2Y A;  1B3A A;  4OO1 I;  3SDZ A;  2CVR A;  1YNN C;  2F0U A;  1O7Z A;  2EIF A;  3A0J A;  5E1F A;  5JJK A;  4F8M A;  3G6E A;  1V9P A;  3ERO A;  2HDL A;  3OW2 A;  1JB3 A;  4DR1 Q;  4X62 L;  2HQE A;  1E22 A;  3VR6 A;  4K0K L;  2MJ8 A;  4BBS H;  1HFG A;  5I6Y A;  1F9S A;  2CWA A;  4X3K A;  1I4Q A;  3K80 C;  4LF8 Q;  5M3F B;  2R92 G;  4BA1 I;  1EY8 A;  2VB2 X;  1PH4 A;  4R4O A;  2B2T C;  1QCB D;  1A63 A;  4V0B A;  3CCS A;  1DJR D;  2K5H A;  4DK1 A;  1XMO L;  1X54 A;  2F0M A;  1Y1W G;  2A5H A;  4HN7 A;  2XIW A;  3AFP A;  1K3B C;  5CV5 A;  2F0W A;  1FNW A;  1LUZ A;  1AN8 A;  4DUY L;  3M3Y B;  3E0J A;  1RF2 D;  2PCF B;  2WFW A;  1YIT A;  1EL0 A;  1GD7 A;  3CU7 A;  1SND A;  4A3J H;  3C46 A;  1AE2 A;  1QUQ A;  1XTD A;  4LMQ D;  1YNJ D;  2UU9 L;  4CDD C;  4PZ7 A;  1H95 A;  4B9W A;  1XJV A;  3AFQ A;  4IPC A;  1D5Z C;  3R93 A;  5BR8 L;  3BU2 A;  2GA4 B;  2A1A A;  3ONA B;  1GHJ A;  5ELC A;  2OQK A;  1XPU A;  4IUQ A;  2OCE A;  1WTX A;  4C3I G;  1GUN A;  2NVT H;  3R2T A;  3BG3 A;  1WTW A;  1JB7 A;  1H9S B;  1A2T A;  1EWC A;  2EJF C;  1MSG A;  3PIO 3;  2WKC A;  1K8M A;  1VQ4 A;  3EIV A;  1I94 Q;  4YCW A;  1HQM C;  1A62 A;  2HQL A;  2XVS A;  3A8I E;  4BWG B;  3S9W A;  2YTY A;  2MNA A;  3U4V A;  4JK1 C;  3TP6 A;  3HOZ B;  3DWP A;  5C44 G;  3J80 c;  3K81 C;  2I5L X;  4LFB Q;  5D14 A;  3M3Y H;  5K36 G;  3PCO B;  1PZJ D;  1KNE A;  1QE6 A;  2LS0 1;  2XRQ D;  5IWA Q;  2IX3 A;  5ISR A;  4K5X A;  3H3V C;  1I4P A;  1PA6 A;  2QEX A;  4UHV A;  1VQ6 A;  4JI3 L;  2F4V L;  2A19 A;  5DM6 3;  4WJ3 M;  1VMC A;  2H1E A;  1I94 L;  1B9N A;  3URY A;  4NXN L;  1I50 H;  1EOV A;  4GLV B;  2F3V A;  5ELD A;  4OHJ A;  4LFC Q;  1LT6 D;  4NP5 A;  1TII D;  4ZKC B;  4FVM A;  2ZJP A;  3C3L A;  2NVT B;  2EQS A;  2LMC B;  3QR8 A;  4LJZ C;  1VQN A;  3UDX A;  2V1C C;  2SDF A;  4X66 L;  1CZG A;  3S17 B;  1WTR A;  5CV7 A;  5ELN A;  1WFQ A;  3IFD A;  3ND8 A;  2O4X A;  5I9P A;  4GS3 A;  5T1I A;  3PGZ A;  1V43 A;  3NEN A;  1N32 L;  3HGB A;  2M00 A;  2N49 A;  4YCU A;  1KAA A;  4A3L G;  3I8Z A;  3GTO H;  1Y1W H;  2Z6B A;  1PH3 A;  2NVX H;  3D6C A;  1MI2 A;  1SRO A;  3RLO A;  4YWK A;  3J80 L;  3GTP H;  3D31 A;  4KY7 A;  3M85 A;  2I5H A;  3J7Z C;  1PRT F;  2GVA A;  4A3I B;  1QOH A;  2GN5 A;  4YIJ A;  3I4O A;  2KEC A;  2E5L Q;  4RMF A;  4C3I H;  1A3T A;  1NR2 A;  1MHW C;  3MXN B;  1SDF A;  1R4P B;  2PZU A;  3OWE B;  2KEN A;  5A35 A;  5M3M G;  4TSS A;  1X9N A;  3UDG A;  2X69 A;  1HQR D;  1QB5 D;  3DEP A;  3SE0 A;  3K7A H;  1JOK A;  1JQY D;  4DV7 L;  4HCS A;  3K5M A;  4F87 A;  2K32 A;  1UNS A;  1HA5 A;  1ICF B;  3UDF A;  3D4W A;  1HZB A;  1MGS A;  3T4A C;  4HSV A;  4JYA Q;  1I6H B;  2E2H H;  1EFW A;  2A6H C;  3IKJ A;  3L3O C;  2F3I A;  1TWF B;  2L5T A;  5NUC A;  5M3M B;  1ML0 D;  3S1M H;  2IWH A;  4CKE A;  4IPD A;  3JAM E;  2E2I H;  2B2V C;  3NK9 A;  4CJ2 C;  4ZK9 B;  1SXT A;  1SYF A;  3CC7 A;  3NWT A;  2E2J H;  3GTP B;  2B2U C;  4KHZ A;  3GV3 A;  5LL6 X;  3T1Y L;  1VQF A;  4A3K G;  1QG7 A;  3TP8 A;  4DR6 L;  2R92 H;  3C2P A;  5IYD H;  4X62 Q;  2MO0 A;  3MTS A;  4DV6 Q;  4DA2 A;  1CKM A;  4FYD A;  3SEB A;  4FO2 A;  1LTR D;  3N6R A;  3NUC A;  4ZYS A;  5I2X A;  1VMP A;  3K7A B;  3MXN A;  1K8O A;  1EQQ A;  1CKO A;  2ZTD A;  3GTK H;  3PUX A;  1SYD A;  5D3D A;  2SNM A;  5FJ8 H;  1CK1 A;  2F0N A;  1EY9 A;  1KC8 C;  4OO1 H;  2F0D A;  2N78 A;  1HUN A;  2V4D A;  1SR3 A;  3BZD B;  2DJG C;  1TWF H;  1CM9 A;  2WAQ E;  4AYB E;  2EY2 A;  5JVH 3;  3EA6 A;  1WYD A;  2A74 C;  1IL8 A;  3PUY A;  4KKT A;  1VQ7 A;  3LWU A;  2A68 D;  3NEM A;  2B8G A;  1BKB A;  1HTL D;  1BVS A;  3ZYY X;  1I6V C;  3FKI H;  1K28 A;  2M9V A;  3D4D A;  5C0X G;  4G7O C;  4ZAI A;  3K5L A;  1B1Z A;  5C0X I;  2VS1 A;  1HPC A;  4P74 A;  5CMD A;  4DV0 L;  4A3B B;  2OEO A;  1C9O A;  2MHV A;  4P73 A;  5IP9 G;  3MAQ A;  1C7Y A;  4XQN A;  4A3C H;  1KRT A;  1V8Q A;  4BBS B;  3EJI A;  1PRT D;  2MPM A;  5AJ3 Q;  1KAW A;  4B3M Q;  2Q2H A;  3VYU A;  1M90 C;  1HNZ Q;  4LF7 L;  3Q8D A;  4JI5 Q;  2NVY B;  3I4M B;  1PRT B;  1Z6H A;  4DAV A;  4HED A;  1GUT A;  1GUG A;  4YY3 Q;  4Q0F A;  5LHY 1;  1L0W A;  1SBB B;  4ZQ3 A;  1BBU A;  4P75 A;  3KLS X;  3BS1 A;  3HOX H;  2ENB A;  1ZYR D;  1ET9 A;  3U9S A;  3HOY H;  4KD4 A;  1TWC H;  5CC4 A;  2E2J B;  4ZUJ A;  2NTT A;  2MUY A;  4HIM A;  1BOS A;  1SEB D;  3CRL C;  1FJG L;  4JOI A;  4H02 A;  2B2V A;  3J7A 5;  4JI8 L;  3H0G H;  4KI0 A;  4MN3 A;  1K8A C;  4DR5 Q;  1UE1 A;  2R7Z G;  2M2L A;  4BA2 I;  1EYG A;  1G6P A;  2NN6 G;  3VR2 A;  3GDE A;  1U5K A;  2B2Y C;  5DLQ E;  1Y1V G;  3T56 B;  4CJ1 B;  3U9O A;  2UUA L;  1Q46 A;  1RIP A;  1IHZ A;  2VW9 A;  1RHP A;  2XGT A;  3VYT A;  3KOJ A;  2VQF Q;  4DV7 Q;  1TS3 A;  2F4I A;  3GTG H;  2FJ2 A;  3IL8 A;  2VL6 A;  3AQQ A;  4IFD G;  4JV5 L;  1AZQ A;  1OXU A;  1F77 A;  2F0I A;  3R8B A;  4HJ5 A;  1B9M A;  1E2W A;  1LTS D;  1VQD A;  5M3F G;  4JCV E;  4QQB X;  4NMZ A;  3A54 A;  1G51 A;  2PMZ E;  2K5V A;  4DR3 L;  4C2M H;  1YNN D;  3MXP A;  5G3L D;  4CJ0 B;  4NKL A;  2RHS B;  4IPH A;  3SHL A;  3CP0 A;  3GTO B;  2F0P A;  4UDU C;  1YBY A;  1C4Q A;  5FO8 B;  3I2Z A;  3FPP A;  4EQO A;  3PO3 B;  5C4J H;  1F2Z A;  1KXL A;  1UEA B;  1BF4 A;  2HT1 A;  4A3B H;  1SYG A;  2RKS A;  4G57 A;  5A2Q L;  1BXT A;  1Y8O B;  1VQK A;  2VZA A;  1F2M A;  4JW0 A;  5K5P A;  1TS4 A;  1C8C A;  1STE A;  5BN3 A;  2B3G A;  2DY8 A;  4A3D B;  1PZI D;  2R61 A;  1P8L A;  3KDF A;  2JJQ A;  4PMB A;  3Q24 A;  2Q8T A;  2RSN A;  1MSH A;  1SE8 A;  3OTO Q;  2D2C C;  1STY A;  3TBI B;  1B53 A;  2I46 A;  1A3V A;  2WAQ G;  3E9I A;  1WD0 A;  4DV6 L;  4A3F H;  1S5E D;  2BA0 A;  4MNO A;  3F2B A;  3I7F A;  3K0X A;  1UEB A;  1SMY D;  1B44 D;  4JV5 Q;  3C1F A;  3IFT A;  3LNN A;  2JEB I;  5J1Z A;  5KGU A;  1O7L A;  1FGU A;  1X32 A;  3HOY B;  1KDA A;  2F0V A;  1XNQ L;  3KBX A;  2NVX B;  5A2Q E;  2MO1 A;  4K8I A;  5C4Z A;  3RLN A;  4IUN A;  1A3U A;  3RNU A;  2ZM6 L;  3H0G B;  2B2Y A;  3MA2 B;  1D7Q A;  4FXG C;  3RR5 A;  4RGT A;  1FNU A;  2Q2I A;  3PQI A;  3S1R B;  4MHE A;  4DV4 Q;  4K6D A;  4QCL A;  3D0F A;  1QVF A;  2EYM A;  4RA8 A;  1TY0 A;  3RD4 A;  3G6J B;  2RQX A;  3G4S A;  2TSS A;  5C4X B;  1B8A A;  3PIP A;  3BDL A;  3ZJY C;  5HGT A;  1D1K A;  4NXM Q;  2K6A A;  2Z6K A;  1O7Y A;  1PTO F;  1TWH B;  3QG1 A;  1B3Q A;  4GKJ Q;  4RCO A;  1PTO B;  2JQO A;  3ULP A;  2ZTC A;  1SAP A;  3HOW B;  2AUK A;  2VNU D;  2F0H A;  3IAY A;  4B08 A;  4KY5 A;  3K7U C;  3CF5 A;  1PH6 A;  2R93 B;  1K73 C;  4QY7 A;  1G2T A;  4GNX C;  4ME5 A;  2JA8 G;  1UUP A;  4DUZ Q;  5GAH C;  4DUY Q;  4LF4 L;  3Q0A A;  5IP7 H;  3OIP A;  4R4Q A;  1EUJ A;  5FLX E;  4HSP A;  4B3S Q;  1UE5 A;  3K58 A;  1Y69 U;  2UUC Q;  4DR7 L;  2ZTE A;  4A3M B;  1S72 A;  2E5L L;  3FEW X;  2VY3 A;  5JEA H;  1ASY A;  2QEJ C;  1VQ9 A;  1VQL A;  4DV5 L;  2Z1C A;  1PZK D;  1H9R A;  3OPO A;  2K33 A;  4HJA A;  4LFC L;  3TDQ A;  1J5E L;  3NSW A;  4L6T B;  2CW0 D;  4ZRZ A;  1C0A A;  2NVY H;  4CKB A;  3SR1 A;  4FDB A;  2G9D A;  1ILQ A;  4A3G G;  1N32 Q;  4KHP L;  3OMG A;  4ZUI A;  5JVG 3;  1X3G A;  1X3F A;  4DV2 L;  1PTO H;  3S2H B;  3N52 A;  3CCE A;  4RGM A;  2ZJR A;  1NNX A;  1TKW B;  4TKO B;  2Q8I B;  4LK1 C;  4K0K Q;  5LMN W;  3NQI A;  1QZH A;  3NQT A;  3KYH C;  1K3R A;  3CCV A;  5IE8 A;  1BCP C;  2KCN A;  1HZC A;  2NZO A;  3PSI A;  5JEA G;  1XNR L;  2EXZ A;  2YTX A;  3I90 A;  2MP1 A;  1Q7Y C;  2Y0S G;  4CDF C;  1N34 L;  5GAE C;  5HY6 A;  1EYC A;  1XNQ Q;  3KFU A;  1IL2 A;  4XQJ A;  1NBW A;  3KUP A;  4NXN Q;  4KMU C;  4A3G H;  3I4N G;  1BDO A;  1WTQ A;  2F52 A;  4DF7 A;  2QKI C;  1WTH A;  1PH9 A;  2ICI A;  1HNW L;  4RCN A;  3S1Q H;  3G71 A;  3KF6 B;  3L9A X;  1N36 L;  1PTO D;  3U58 A;  2OQ0 A;  1M8A A;  1S3O A;  2GVB A;  4DKA C;  1II3 A;  3GTJ B;  1SNM A;  2Y0S E;  1CA6 A;  4JI4 L;  4BY7 H;  2KED A;  3I73 A;  1PHJ A;  1VQJ A;  4TVA B;  4DU9 A;  5IP7 G;  1CSP A;  4DV5 Q;  4JPB W;  1I4H A;  1Q8I A;  3UDI A;  4A93 H;  1IBM L;  5C3E H;  1IW7 D;  5TSS A;  3HOX B;  1L1O C;  3BZC A;  4POG A;  4DFA A;  1TWC B;  3G48 A;  3Q6S A;  1VQH A;  1AP0 A;  1U0L A;  2HHH Q;  5KEE A;  3PO3 H;  3HFZ B;  5BN4 A;  5J22 A;  1Y14 B;  5C3W A;  2KVM A;  3GTM H;  1XMO Q;  4LW1 A;  1EU3 A;  5DM7 3;  5C3X A;  3GTL H;  1SE2 A;  1BCP B;  2PI2 E;  4A75 A;  3A7L A;  3TZU A;  1EIG A;  1ENA A;  3TRZ A;  3H15 A;  5FK9 C;  1MIU A;  2VB3 X;  1T9H A;  2CW0 C;  2WIN B;  4A3D H;  1F9R A;  3KLW A;  3GP7 A;  1EWH A;  2YU9 B;  5AFW A;  4XYO A;  1NCV A;  3I4M G;  2B29 A;  2JA5 B;  3A5Z B;  1GM5 A;  4IUV A;  1S5D D;  1ET6 A;  1ROD A;  4F7X A;  3MFG A;  4JI8 Q;  2B2W A;  2YV5 A;  2ZM6 Q;  3FDT A;  2AQ1 B;  2E74 C;  4JI4 Q;  4JOI C;  2CFM A;  2CQO A;  2IPK D;  4FF4 A;  1EQT A;  3PV0 A;  1B70 B;  4A3B G;  4QIW E;  5IYB H;  4V19 0;  2R3Z A;  1BQQ T;  5ELO A;  3GV6 A;  2SOB A;  5IGG A;  2QCP X;  4ABN A;  3L2P A;  2K28 A;  3S1R H;  4LFA L;  4QMG A;  2DNE A;  1R4Q B;  1HNW Q;  4HJ9 A;  1PYS B;  2EE1 A;  3PUW A;  3CC2 A;  5IGB A;  1EYA A;  2JA7 B;  1LTG D;  4RH6 A;  4YHH Q;  4O2D A;  4EQN A;  5ELE A;  3A7A B;  3QO2 A;  2JK8 A;  1TS2 A;  2BE5 D;  1VQB A;  1Q82 C;  2WAC A;  1X65 A;  2AWN A;  4H0L C;  5M5Y B;  1WJJ A;  1YZ6 A;  2TMP A;  4X3S A;  3W5O A;  4LNQ A;  1GOZ A;  3X3M A;  1Y8N B;  3D8G A;  4ME3 A;  3I56 A;  4K2L A;  1O80 A;  2BDN A;  4X65 Q;  1XMQ L;  2L1B A;  4A93 B;  2R7F A;  1KIX A;  5LMU Q;  4B9X A;  3E3X A;  3J81 c;  1K83 B;  5KYL A;  1Y1V H;  3PO2 B;  2D62 A;  2Q8R E;  4M8A A;  2R7Z H;  1B4O A;  1KTK A;  3FRP B;  3RZD B;  4A3K B;  3KLS A;  3J81 E;  2JEA I;  3I4N B;  2D9U A;  3SK5 A;  5KND A;  4BY7 G;  2YTV A;  3GTM B;  2E2H B;  1HR0 Q;  1YJN A;  2JA8 H;  3CKI B;  1PTO C;  3DMU A;  4CBV A;  3AB9 A;  1E1T A;  1TWA H;  4Z9C B;  2Z4I A;  2EYF A;  2E2I B;  1JR0 D;  4QUF A;  3D3R A;  4RHR A;  3SXH A;  3UE1 A;  4MTN A;  4K8J A;  3I3C A;  4RWS C;  4U68 A;  4GOP A;  4J1M A;  4B3R L;  4TQU S;  2ALY B;  3VYS A;  4L5T A;  3K6O A;  1QNK A;  3OOC A;  4C1N K;  3CHB D;  2B63 B;  1ZEQ X;  1K83 H;  5EKI A;  4N9P A;  4DNT B;  5COY A;  1RCV D;  4IUR A;  5M3F H;  1DM0 B;  1K0R A;  2O2L D;  1N33 Q;  1QZG A;  2EZV A;  2LSS A;  5G3L F;  4DV1 Q;  5IT9 E;  3RZD H;  3NBH B;  1U4L A;  3A74 A;  3P7J A;  1Q81 C;  3CCQ A;  1Z7T A;  4PG3 A;  1BCP D;  4NDX A;  5FLX c;  2KCM A;  1YIJ A;  1VQ5 A;  3BVZ A;  3S1Q B;  2JA8 B;  4EQ5 A;  4DR1 L;  3T53 B;  2VUM B;  2BH8 A;  1TR5 A;  3R3O A;  1PFN A;  1NTG A;  3CAM A;  1XTC D;  2F0T A;  1AE3 A;  3AMU A;  1GUW A;  4YCV A;  1FJG Q;  4H7B A;  2JP1 A;  2DUD A;  3GO5 A;  2NUC A;  4OO1 G;  3A56 A;  2VXW A;  4OX9 Q;  1PRT C;  3F8T A;  2DNC A;  4NPS A;  2F0L A;  3KK7 A;  4LAA A;  1A2U A;  1HJP A;  1CZW A;  1WI5 A;  1HFN A;  2K14 A;  4BS9 A;  1D1I A;  2KOL A;  2K03 A;  4DNI A;  2F0J A;  2HD3 A;  3HS0 C;  4QB4 A;  4LUZ A;  1TQO A;  2QIL A;  5IGE A;  1YEZ A;  1X3E A;  1DOM A;  4ZLT F;  2K50 A;  3DEO A;  1WTO A;  1DCZ A;  1EQR A;  1CKN A;  4A3K H;  4DAY B;  1LTT D;  3KJP A;  1LTL A;  1HNX L;  2K4K A;  3ULJ A;  1A6X A;  3H91 A;  5IGD A;  2PNH A;  2RHQ B;  3HOV B;  3JAM i;  2IX1 A;  5FLM H;  3ERS X;  5IY0 A;  3CC4 A;  1NE3 A;  3GTL B;  1WVL A;  5T1G A;  5C44 B;  1CFM A;  3MZ5 A;  2RVL A;  2WV6 D;  1IYJ B;  3STB D;  4LF5 Q;  4A3E B;  2ID0 A;  1L1O B;  3PMF A;  4IJH A;  4IO9 A;  1VDZ A;  5CV6 A;  3HOU G;  1B50 A;  2Q2U A;  2OTJ A;  4WFN 3;  4X64 Q;  1HZ9 A;  3MFY A;  5IIF A;  4EVO A;  2L0C A;  2K75 A;  4F88 A;  3SK8 A;  2ASB A;  1CUK A;  4IZ8 A;  1D6E C;  5M5X H;  1PH2 A;  4DNR B;  5C5L A;  2AQ2 B;  1I4X A;  4K2K A;  5IGC A;  4KK7 A;  5CV9 A;  2R6G A;  3DWA A;  1WCM H;  1A8V A;  5CYU A;  1SJH D;  4UPA A;  4WJ4 A;  4LF9 Q;  3F2C A;  2QGQ A;  1V1O A;  1YJ9 A;  3QOL A;  2AWO A;  4MZ9 A;  1YVC A;  5FJ8 G;  1PVO A;  3MEH A;  1Z47 A;  3BVM A;  4KHV A;  3IRB A;  3S17 H;  3H09 A;  1PFB A;  4PZ6 A;  4OWT B;  4A3L H;  3HP3 A;  4JYA L;  3FP9 A;  4L5R C;  4A4I A;  4C3H G;  3PUV A;  3EQL C;  1JOO A;  3KJO A;  1AZP A;  1SNQ A;  5ELB A;  1HA6 A;  2VQE L;  4OIK A;  1UWV A;  3C1E A;  3BDC A;  2A6E D;  2PI2 A;  5I6W A;  2K04 A;  3JAM L;  2EY5 A;  3OWF A;  1AH9 A;  2IT1 A;  2A68 C;  5IYC G;  1V1P A;  4CDC C;  5M5X B;  5JJZ A;  2QW7 A;  4GOP C;  2R92 B;  4YY3 L;  1IYU A;  4IOC A;  2UXB Q;  3L7Z C;  5JAV A;  2LFN A;  1Y1V B;  1HNZ L;  5IP9 H;  1OTC A;  3QOJ A;  1SMY C;  3G7L A;  4LF7 Q;  1HUM A;  2HIV A;  2F0Q A;  2YYZ A;  3M4P A;  3RMH A;  2N3S A;  2R7Z B;  1DOK A;  1GVP A;  2OT2 A;  4R4I A;  4G7H C;  1N9W A;  2NB0 A;  4QL5 A;  5C0X H;  1D5X C;  1EU4 A;  3UI2 A;  1LV9 A;  1KHI A;  2FHT A;  4O0A A;  3M7G A;  1HR0 L;  5IOD A;  2E76 C;  3X3N A;  1U4M A;  5C44 H;  3DM1 A;  4JBJ A;  3VR5 A;  3PUZ A;  1IYV A;  1JE5 A;  2L9H A;  4NW2 A;  2RBM A;  1ONL A;  4A76 A;  1YHB A;  1NR4 A;  4Y7N B;  1U4R A;  1H9S A;  4MIU A;  5FLM G;  2K7V A;  2I07 B;  3FKI B;  3NP8 A;  4LF6 L;  2QA4 A;  4G4K A;  4AYB B;  3J80 E;  1VQ8 A;  2DJF C;  5I4D A;  3QIA A;  3NTI A;  1YJW A;  3HOU B;  5C6A A;  3D4R A;  3W1G A;  4DV3 Q;  2HCI A;  5CV8 A;  2CKZ B;  1I3Q B;  1LAB A;  1VQI A;  1F9P A;  3L0O A;  3DWQ A;  2A6H D;  4DXF A;  3KLR A;  2NN6 I;  1WCM B;  4QGU A;  5L37 A;  3CCM A;  1MJE A;  4U67 3;  1JWU D;  3P1H A;  3S1N B;  3CMA A;  4BBS G;  5IWA L;  4OWW B;  4FF2 A;  1I5F A;  4AIM A;  5IYD G;  2RF4 A;  3CCL A;  5I9O A;  2EY6 A;  5D65 A;  1LT4 D;  5HGQ A;  3HOV G;  4LFB L;  4UP9 A;  1A15 A;  3U4Z A;  5GAD C;  1EIH A;  1TWH H;  4IUU A;  5C0X J;  1LT3 D;  1ZKO A;  2A8V A;  5CV4 A;  4N8X 1;  1SYC A;  4ULL A;  1KLG D;  2IW3 A;  2K1B A;  3STB C;  3S14 H;  1ENC A;  4JI1 L;  4DR4 L;  1L0X B;  1JC7 A;  2EJM A;  2O5I C;  3BDO A;  1DYQ A;  4J15 A;  1J5E Q;  3NHH A;  3F2D A;  1STH A;  2IY5 B;  1VQE A;  4QF4 A;  4BY1 H;  2KHJ A;  5EJW A;  3KBG A;  2XNA C;  4BY1 G;  4DK3 C;  4BBR H;  4L5S A;  3WWV A;  1HXY D;  1EZ6 A;  4KHP Q;  4RKL A;  4DAY A;  4FF1 A;  1KLU D;  1J8I A;  1Y8P B;  1I50 B;  2P5Z X;  1QVG A;  4OGQ C;  4JBW A;  1M4V A;  2VUM G;  1AEX A;  5IT9 c;  4GN3 B;  1EQV A;  1X3P A;  1BR9 A;  1X55 A;  4XYQ A;  3K5O A;  3H6M A;  1MBY A;  4PMW A;  2H4O A;  4IN3 A;  3HOV H;  4KJN A;  4IPG A;  1L2F A;  1JWM D;  3S2H H;  2RSO A;  2MFI A;  3QWN A;  2D0P A;  3KF8 B;  2HHH L;  3RZO H;  2CHB D;  2QDB A;  1KDB A;  1EWI A;  3MHB A;  3GQB A;  1LYL A;  3M7N A;  4G7Z C;  1SN8 A;  1OXT A;  5E4W C;  4KD3 A;  2ATW A;  3D6W A;  2UXB L;  1S40 A;  2WP8 J;  3J81 i;  1PV4 A;  3M4Q A;  1D8L A;  1T5E A;  3CCR A;  1I3Q H;  2XRS D;  1VF7 A;  1BCP F;  3RUZ A;  4DV4 L;  2QDL A;  1VQG A;  3E9H A;  3AEV A;  3A8K E;  3S24 A;  4NXM L;  1E7Z A;  2F0E A;  3CPF A;  4H44 C;  4I7A A;  2Z0S A;  5LMN L;  2IHF A;  1TT2 A;  4RGN A;  5EPJ A;  1J6Q A;  3GTG B;  2ZXO A;  4E6I A;  4BY7 B;  4JI1 Q;  1I4G A;  4A3I G;  1MKH A;  2EOT A;  4A3J G;  1KDC A;  3H3V H;  2A73 B;  4P2C B;  4WJW A;  3Q23 A;  4DPG A;  4B3R Q;  3PO2 G;  1UE6 A;  3GTQ B;  4XT1 B;  3NPP A;  4AQY L;  2RDF A;  4DK6 C;  1R9T B;  1UE7 A;  2UXD L;  1VCI A;  1CT1 D;  4JI2 Q;  4UP8 A;  3I91 A;  2HUG A;  3AYH B;  4DGZ A;  1FD7 D;  4LF9 L;  4BY1 B;  3PF5 A;  4LF5 L;  5C4J B;  4B3M L;  1EY5 A;  3PF4 A;  5JPN C;  2HCC A;  2X6L A;  2JA6 B;  5IYB G;  3ITP A;  3ERQ A;  1K0S A;  3R2I A;  4DV2 Q;  1CA5 A;  2EYH A;  4Q5V A;  3WOE A;  2KHS A;  2NBF A;  1CHP D;  1BNZ A;  1YI2 A;  5JJL A;  4C3H H;  1PH8 A;  2KBN A;  2L12 A;  4LF6 Q;  2C5C A;  3OTO L;  4GN5 A;  3HKS A;  1HH2 P;  3S15 H;  4BBR G;  4X3T A;  1DOL A;  3O13 A;  5M9O A;  3BVG A;  3EBE A;  4KN7 C;  5EBC A;  2IL8 A;  4R1J A;  4RGO S;  4ALP A;  5I2Y A;  2RDG A;  1BBX C;  5JJI A;  3S2D H;  2EVB A;  3JC6 6;  3PIP 3;  1MJC A;  1D5M C;  1RDP D;  4ODG A;  2OF1 A;  4PQX A;  1WCM G;  3EFX D;  4R4C A;  4JBK A;  4UAI A;  3M9B A;  4IOA A;  1YNJ C;  1NUC A;  4Y7N H;  1E1O A;  2PPB C;  1EYD A;  2PQE A;  5FKA C;  1KL9 A;  3OSO A;  2K01 A;  5C4H A;  2R7D A;  4AYB G;  4RG1 A;  1XX8 A;  2WB1 G;  2I0Q A;  4CGY B;  3V05 A;  2ICE C;  3E0E A;  2I5M X;  3W2D A;  4C3I B;  4K5W A;  1X56 A;  2KQ3 A;  3EVQ A;  1GXD C;  1EZ8 A;  1XXG A;  1E2V A;  1RTO A;  2Z9H A;  1WTV A;  3VDY A;  4JI7 Q;  4BXX G;  4DV1 L;  4KKU A;  4FXD A;  4LF8 L;  4R9W A;  5M5Y H;  4HJ8 A;  2BDO A;  3M4O H;  1WOC A;  3V96 A;  2UUA Q;  4LUO A;  2EYO A;  1Q3L A;  3DHQ A;  1LLR D;  1I6H H;  1GKH A;  4KV6 A;  1ESF A;  2PMZ B;  4HMI A;  4B3T L;  4OIJ A;  2JN4 A;  1QNU A;  2JA9 A;  1R9T H;  4L63 B;  1VQM A;  3S16 B;  3F1Z A;  1Y1W B;  1NY4 A;  1TS5 A;  1PFM A;  3HG9 A;  1N33 L;  1OXV A;  1MD2 D;  1Q8K A;  1U4P A;  3HKZ B;  4C1N I;  1SLJ A;  3K57 A;  1DGS A;  4O42 A;  1PMR A;  1J9O A;  2PW5 A;  4LUV A;  2FXQ A;  1RJT A;  1OXX K;  1C48 A;  3HOU H;  3P20 A;  1JE4 A;  1GUS A;  3TP5 A;  3E6Z X;  4OWX B;  3FVQ A;  2K05 A;  2DGY A;  2BOS A;  5CBA E;  4C3H B;  1EEI D;  1QIL A;  2G5D A;  3OYY A;  3S1N H;  4M1U B;  3K8A A;  4CHT B;  2L4N A;  2LXK A;  2HDM A;  2AUJ D;  5LL6 S;  3TSS A;  2CH4 W;  4CKC A;  1G6Z A;  5IYC H;  1TY2 A;  1EY6 A;  4GLX A;  1SYE A;  4AH6 A;  4IQZ A;  4FXK C;  2XN9 C;  1E24 A;  2H5X A;  5ELF A;  1T5X D;  2FIN B;  4EX5 A;  1O78 A;  1TXY A;  1PYW D;  3NE5 B;  3NWS A;  4IFD J;  5EAY A;  4C2M B;  1DON A;  1JJC B;  4C56 C;  1QVC A;  1IZ6 A;  5C3E B;  2O5J C;  1HNX Q;  2A6E C;  3NTH A;  1FGB D;  1JMC A;  3RZO B;  3A55 A;  1SFO H;  1IBK Q;  4TRD A;  3T16 A;  3B6Y A;  1N8R C;  1JOR A;  4A3G B;  4DR4 Q;  1DXM A;  5IOC A;  4DXG A;  1KQS A;  2IJ0 A;  3TS2 A;  3TZD A;  5LMU L;  3VR3 A;  1VQA A;  1XMQ Q;  4UY8 C;  4GLA C;  4YWM A;  4LFA Q;  1FVI A;  1UAP A;  4A3E G;  1ENF A;  4GZY C;  1ZYR C;  3WOF A;  1GJX A;  1NMG A;  3AU7 A;  3HZX A;  1HCZ A;  2KCT A;  4R8I A;  3A8J E;  2CH4 A;  2F3W A;  2KA7 A;  3FHW A;  2F0G A;  2NVQ B;  1RL2 A;  1KD1 C;  4A3M G;  1A0I A;  5E7N A;  5J3B A;  3GTK B;  2UXD Q;  2AKW B;  3I4M H;  3CME A;  2PNR C;  1WD1 A;  2NYZ D;  4K5V A;  4B3T Q;  1JOQ A;  5IGF A;  2JA5 H;  5GRO A;  1NJI C;  3MEF A;  1IBL Q;  4XXE A;  3T1Y Q;  3RLF A;  4DR5 L;  2SEB D;  2IX0 A;  1AW7 A;  1E3P A;  4PV1 C;  2PZT A;  4DK0 A;  1VQC A;  4HMJ A;  5EGT A;  3HOZ H;  1D2B A;  2G9H D;  2K52 A;  3CW2 C;  2Q2T A;  3HOW G;  4XTC S;  3WDN A;  4KN4 C;  2B39 A;  2EYJ A;  5LMN Q;  4JI0 Q;  4JBM A;  4OEL B;  4DR2 L;  4IAL A;  1GHK A;  3VR4 A;  3BJU A;  3CPW A;  5KNB A;  3CXC A;  2JA6 H;  1FL0 A;  1SSO A;  3SGI A;  2BCO A;  5FO9 B;  5EBD A;  5C4X G;  4OL7 A;  4GN4 B;  2L15 A;  2MQH A;  4DR7 Q;  3E5S A;  4KY6 A;  2EXD A;  1IW7 C;  5FOB B;  2OXP A;  4A3E H;  1GUO A;  4DUZ L;  4HIK A;  3RN5 A;  2NVQ H;  1Q1E A;  3M4Y A;  2YU9 H;  4A3F G;  4GKK Q;  4GNX A;  2PQA B;  2PO4 A;  3TN2 A;  3T1H L;  1YNX A;  1IKL A;  1OXS C;  1ILP A;  1XPO A;  5EPK A;  1NSN S;  1EIY B;  4DV0 Q;  2UUB L;  2LY7 A;  1TWG B;  2RA4 A;  3NBH A;  4GKJ L;  3DLL A;  3P75 A;  2R93 H;  2C35 B;  1IKM A;  2WII B;  3TRE A;  4P71 A;  2F0K A;  2B63 G;  4EQP A;  3F2U A;  2KHI A;  2BE5 C;  2D0O A;  3VYR A;  5BN5 A;  2KCC A;  4C3J H;  3NBI A;  2WAQ B;  4ZKB B;  5KIX A;  2B8F A;  4FP5 D;  4I7Z C;  4CDE C;  2OTL A;  1CKN B;  2C9O A;  3K5N A;  3H3V I;  4X6A H;  4YWL A;  1TVX A;  2J4X A;  3LX0 A;  1SMX A;  5JPM C;  1IXR A;  1IBL L;  4A3D G;  1PDQ A;  4XIG S;  4KJO A;  3HRZ C;  4QIW B;  5E4X A;  2JA7 H;  5KRU A;  5C3E G;  2AHO B;  2N88 A;  2J0T D;  1SE4 A;  1YHQ A;  3CCU A;  3GD7 A;  4GNX B;  3QJY A;  3DUZ A;  4WRD A;  3KF8 A;  3ULL A;  4YHH L;  1XNR Q;  3VA7 A;  1EY4 A;  4HID A;  3PO3 G;  4IFD H;  2Z4H A;  2EYL A;  3J81 L;  2AQ3 B;  5GQO A;  1SJE D;  3DM3 A;  4JI3 Q;  2PW7 A;  2F4V Q;  2XWJ B;  3MC0 B;  3ICE A;  1TWG H;  1PH7 A;  1F2L A;  2F0O A;  1W2B A;  1CQV A;  3FMC A;  4X64 L;  2K5Q A;  1N34 Q;  1RTN A;  2ZJQ A;  4A93 G;  2F03 A;  1IBK L;  1M1K C;  2B2W C;  5FO7 B;  4C3J B;  1JJ2 A;  3J7A F;  4HCE A;  3I4N H;  4HJ7 A;  5E3F A;  2EY1 A;  1PH1 A;  5JEA J;  2NWG A;  2CQA A;  4PZ8 A;  3HKZ G;  1DD2 A;  5BR8 Q;  1S4Z A;  2ZXR A;  4DV3 L;  2UUB Q;  4IUP A;  4OON A;  1GO3 E;  5M5W B;  1LT5 D;  2A69 C;  4KKS A;  3MXU A;  2LKV A;  3HEJ A;  4J8Q A;  2JSO A;  5JOB A;  2F0F A;  2JXM B;  2QF7 A;  2JA7 G;  2RDH A;  3J7A V;  2E75 C;  3J81 j;  2WKD A;  4GKK L;  4JG2 A;  4XT3 B;  4KLK A;  2EYP A;  2EDG A;  2DY7 A;  4HR7 B;  5EKK A;  2SNS A;  1TU2 B;  5J39 A;  4J6H A;  5DNF A;  2CWP A;  2HIX A;  2IHE A;  5IT9 L;  2OWO A;  4L5Q A;  1QJO A;  3UE0 A;  1STA A;  2Z8L A;  2L11 A;  2UU9 Q;  1HHV A;  4B3S L;  1K9M C;  1EFI D;  1G8Z D;  5EQ0 A;  1HZA A;  3S16 H;  4GOP B;  4LF4 Q;  4DR2 Q;  2D5D A; 
#chains in the Genus database with same CATH homology
 1V1Q A;  1BBW A;  2VQF L;  3CQZ H;  4X3U A;  3I72 A;  2WB1 B;  2ES2 A;  2JA5 G;  3BYT B;  3I4L A;  1HTP A;  4L8J A;  3OHX C;  1FYC A;  1SE3 A;  5HUR A;  1XYI A;  3CRK C;  4A3M H;  4X66 Q;  3A5U A;  4DAM A;  1U9R A;  4QUC A;  3T13 A;  5C4X H;  4RKB A;  1KRS A;  1PH5 A;  1CTM A;  1JIC A;  2NN6 H;  1ESR A;  1PLF A;  1G2S A;  2UXC Q;  2KUM A;  1KNA A;  5FLX L;  3TQY A;  1LTB D;  3NTK A;  4PNY A;  1AFP A;  1Z9F A;  1N36 Q;  2XWB B;  3I55 A;  3LWE A;  3HOW H;  4BBR B;  1KAB A;  2K5D A;  3QB3 A;  2KJX A;  2XTI A;  3SK6 A;  1PYB A;  1CQF A;  2NZ1 D;  3HOX G;  3BZK A;  2XSC A;  1NMF A;  1YHA A;  4IUT A;  1SFO B;  3PO2 H;  2FMC A;  3DXJ C;  2ZT9 C;  1E2Z A;  4JI6 L;  3CQZ B;  3V2T A;  4EGV A;  3NEL A;  3NXW A;  2JA6 G;  1W6K A;  1SNO A;  1CI3 M;  1I4R A;  1XPR A;  1QWY A;  4UP7 A;  3MWY W;  1RD9 D;  4C3J G;  4RAU C;  2KEE A;  4XQQ A;  1X3Q A;  1HRJ A;  5M5W H;  1HR0 W;  1SNP A;  3OW7 A;  2CCZ A;  1EEF D;  3FPU B;  2PZW A;  4ILW A;  4I65 A;  1TWA B;  1Q1B A;  1JWS D;  2FMM A;  1FR3 A;  4HIO A;  1STG A;  5KYI A;  1O7I A;  1OO9 B;  3GTJ H;  3VA5 A;  5DEH A;  1RKN A;  1S5B D;  1VS0 A;  5CR3 A;  4PMC A;  5D3I B;  4A3J B;  1L0Y B;  3W3A A;  3JAM c;  3SK4 A;  1B2T A;  2Y0S B;  3T1H Q;  2UUC L;  2L55 A;  3H94 A;  3TP7 A;  4X65 L;  4HAE A;  1PFS A;  1Q90 A;  3CCJ A;  1H9M A;  1ASZ A;  1QUQ B;  2PQA A;  2N8N A;  1S5F D;  1B7Y B;  2F1M A;  1JT8 A;  2E2D C;  2PYK A;  3OIQ A;  1LAC A;  3U50 C;  3EN2 A;  4DR3 Q;  4O1N A;  4DN4 M;  2MGS A;  1PXU A;  2B2T A;  2A69 D;  5EKL A;  3PIO A;  1CHQ D;  2Z6K C;  2VUM H;  4DR6 Q;  1VQP A;  3GTQ H;  4OX9 L;  4JI0 L;  4NB3 A;  5C5M A;  2VQE Q;  2B2U A;  3BYY B;  4LWC A;  4K14 A;  1P16 A;  1STN A;  4H13 C;  2BH2 A;  4JC0 A;  1G29 1;  4HTH A;  1SNC A;  1EOT A;  5DAU A;  1EY7 A;  4WOR A;  1BO0 A;  3TS0 A;  1LTA D;  4A3I H;  4XDX A;  4A3F B;  1Q86 C;  3K59 A;  2BA1 A;  5EPL A;  1LO5 D;  2B63 H;  1ICW A;  4S3S A;  2RCN A;  1NAP A;  2EJG C;  5KNC A;  2J7Z A;  4R4T A;  2R93 G;  1LTI D;  3W1B A;  3ND9 A;  5F2D A;  4A3C G;  4JI7 L;  3S15 B;  1Q12 A;  4P72 A;  1K8G A;  2WB1 E;  3J7Y W;  2F0S A;  4DAP A;  1H9K A;  1SRU A;  3SVM A;  2AMC B;  1VF5 C;  3TME A;  1V1P B;  1JJG A;  2DN8 A;  4Y52 H;  1H9J A;  1G91 A;  4BXX H;  2NZH A;  5K36 H;  2K5N A;  3S2D B;  1E0B A;  1LM0 A;  3KF6 A;  2JYO A;  4KTA A;  3S1M B;  1SYB A;  3S14 B;  4JI5 L;  1S5C D;  1EY0 A;  1CSQ A;  5COR A;  2EPB A;  4POF A;  4FF3 A;  2K5W A;  1XWE A;  3MXG A;  1BUV T;  3HKZ E;  5AJ3 L;  3ER0 A;  1JCK B;  4FNF A;  1DZ1 A;  3KDF B;  3J80 i;  3H0G G;  1L1O A;  1FNV A;  1F9Q A;  4K6L A;  2JE6 I;  4RFB A;  2FFK B;  1IBM Q;  3LGJ A;  1WTP A;  1W3S A;  3HOY G;  4IFD I;  4R8N A;  4RHS A;  4OXP A;  3HOZ G;  3TEH B;  2N55 A;  4ID6 A;  1EIF A;  4QJF A;  5CBE E;  4IJL A;  4N9T A;  2E8G A;  5H1S E;  3CD6 A;  4JI6 Q;  5CGK A;  4JI2 L;  1ZXT A;  2LXJ A;  3I70 A;  3RN2 A;  4AQY Q;  5GAG C;  2NTS A;  3M4O B;  3FKI G;  2ZXP A;  3MVV A;  3T51 B;  4APV A;  1W6J A;  2X6G A;  1VQO A;  5M3M H;  3K0Y A;  1X6O A;  3OMC A;  3Q22 A;  1STB A;  2UXC L;  1F2Y A;  1B3A A;  4OO1 I;  3SDZ A;  2CVR A;  1YNN C;  2F0U A;  2EIF A;  1O7Z A;  3A0J A;  5E1F A;  5JJK A;  4F8M A;  3G6E A;  1V9P A;  3ERO A;  2HDL A;  3OW2 A;  1JB3 A;  4DR1 Q;  4X62 L;  2HQE A;  1E22 A;  4K0K L;  3VR6 A;  2MJ8 A;  4BBS H;  1HFG A;  5I6Y A;  2CWA A;  1F9S A;  4X3K A;  1I4Q A;  3K80 C;  4LF8 Q;  5M3F B;  2R92 G;  4BA1 I;  1EY8 A;  2VB2 X;  1PH4 A;  4R4O A;  2B2T C;  1QCB D;  1A63 A;  4V0B A;  3CCS A;  1DJR D;  2K5H A;  1XMO L;  4DK1 A;  1X54 A;  2F0M A;  1Y1W G;  2A5H A;  4HN7 A;  2XIW A;  3AFP A;  5CV5 A;  2F0W A;  1FNW A;  1LUZ A;  1AN8 A;  4DUY L;  3M3Y B;  3E0J A;  1YIT A;  2WFW A;  1RF2 D;  2PCF B;  1EL0 A;  1GD7 A;  3CU7 A;  1SND A;  4A3J H;  3C46 A;  1AE2 A;  1QUQ A;  1XTD A;  4LMQ D;  1YNJ D;  2UU9 L;  4PZ7 A;  1H95 A;  4B9W A;  1XJV A;  3AFQ A;  4IPC A;  1D5Z C;  3R93 A;  5BR8 L;  3BU2 A;  2GA4 B;  2A1A A;  3ONA B;  1GHJ A;  5ELC A;  2OQK A;  1XPU A;  4IUQ A;  2OCE A;  1WTX A;  4C3I G;  1GUN A;  2NVT H;  3R2T A;  3BG3 A;  1WTW A;  1JB7 A;  1H9S B;  1A2T A;  1EWC A;  2EJF C;  1MSG A;  3PIO 3;  2WKC A;  1K8M A;  1VQ4 A;  3EIV A;  1I94 Q;  4YCW A;  1HQM C;  1A62 A;  2HQL A;  2XVS A;  3A8I E;  4BWG B;  3S9W A;  2YTY A;  2MNA A;  3U4V A;  4JK1 C;  3TP6 A;  3HOZ B;  3DWP A;  5C44 G;  3J80 c;  3K81 C;  2I5L X;  4LFB Q;  5K36 G;  3M3Y H;  5D14 A;  3PCO B;  1PZJ D;  1KNE A;  1QE6 A;  2LS0 1;  2XRQ D;  5IWA Q;  2IX3 A;  5ISR A;  4K5X A;  3H3V C;  1I4P A;  1PA6 A;  2QEX A;  1VQ6 A;  4JI3 L;  2F4V L;  2A19 A;  5DM6 3;  4WJ3 M;  1VMC A;  2H1E A;  1I94 L;  1B9N A;  3URY A;  4NXN L;  1I50 H;  1EOV A;  4GLV B;  2F3V A;  5ELD A;  4LFC Q;  4OHJ A;  1LT6 D;  4NP5 A;  1TII D;  4ZKC B;  2ZJP A;  4FVM A;  3C3L A;  2NVT B;  2EQS A;  2LMC B;  4LJZ C;  1VQN A;  3UDX A;  2V1C C;  2SDF A;  4X66 L;  1CZG A;  3S17 B;  1WTR A;  5ELN A;  5CV7 A;  1WFQ A;  3IFD A;  3ND8 A;  2O4X A;  5I9P A;  4GS3 A;  5T1I A;  3PGZ A;  1V43 A;  3NEN A;  1N32 L;  3HGB A;  2M00 A;  2N49 A;  4YCU A;  4A3L G;  1KAA A;  3I8Z A;  3GTO H;  1Y1W H;  1PH3 A;  2NVX H;  3D6C A;  1MI2 A;  1SRO A;  3RLO A;  4YWK A;  3GTP H;  3J80 L;  3D31 A;  4KY7 A;  3M85 A;  2I5H A;  3J7Z C;  2GVA A;  1PRT F;  4A3I B;  2GN5 A;  1QOH A;  4YIJ A;  3I4O A;  2KEC A;  2E5L Q;  4RMF A;  4C3I H;  1A3T A;  1NR2 A;  3MXN B;  1SDF A;  1R4P B;  2PZU A;  3OWE B;  2KEN A;  5M3M G;  5A35 A;  4TSS A;  1X9N A;  3UDG A;  2X69 A;  1HQR D;  4DV7 L;  1QB5 D;  3DEP A;  3K7A H;  1JOK A;  1JQY D;  3SE0 A;  4HCS A;  3K5M A;  4F87 A;  2K32 A;  1UNS A;  1HA5 A;  3UDF A;  3D4W A;  1HZB A;  1MGS A;  3T4A C;  4HSV A;  4JYA Q;  1I6H B;  2E2H H;  1EFW A;  2A6H C;  3IKJ A;  3L3O C;  2F3I A;  1TWF B;  2L5T A;  5NUC A;  5M3M B;  1ML0 D;  3S1M H;  2IWH A;  4CKE A;  4IPD A;  3JAM E;  2E2I H;  2B2V C;  3NK9 A;  4CJ2 C;  4ZK9 B;  1SXT A;  1SYF A;  3CC7 A;  3NWT A;  2E2J H;  3GTP B;  2B2U C;  4KHZ A;  3GV3 A;  5LL6 X;  3T1Y L;  1VQF A;  4A3K G;  1QG7 A;  3TP8 A;  4DR6 L;  2R92 H;  3C2P A;  5IYD H;  4X62 Q;  2MO0 A;  3MTS A;  4DV6 Q;  4DA2 A;  1CKM A;  4FYD A;  3SEB A;  4FO2 A;  1LTR D;  3N6R A;  3NUC A;  4ZYS A;  5I2X A;  1VMP A;  3K7A B;  3MXN A;  1K8O A;  1EQQ A;  1CKO A;  2ZTD A;  3GTK H;  3PUX A;  1SYD A;  5FJ8 H;  2SNM A;  5D3D A;  1CK1 A;  2F0N A;  1KC8 C;  1EY9 A;  4OO1 H;  2F0D A;  2N78 A;  1HUN A;  2V4D A;  1SR3 A;  3BZD B;  1TWF H;  1CM9 A;  2WAQ E;  4AYB E;  2EY2 A;  5JVH 3;  3EA6 A;  1WYD A;  2A74 C;  1IL8 A;  3PUY A;  4KKT A;  1VQ7 A;  3LWU A;  2A68 D;  3NEM A;  2B8G A;  1BKB A;  1HTL D;  1BVS A;  3ZYY X;  1I6V C;  3FKI H;  2M9V A;  5C0X G;  3D4D A;  4G7O C;  4ZAI A;  3K5L A;  1B1Z A;  5C0X I;  2VS1 A;  1HPC A;  4P74 A;  5CMD A;  4DV0 L;  4A3B B;  2OEO A;  1C9O A;  2MHV A;  4P73 A;  5IP9 G;  3MAQ A;  1C7Y A;  4XQN A;  4A3C H;  1KRT A;  1V8Q A;  4BBS B;  3EJI A;  1PRT D;  2MPM A;  5AJ3 Q;  1KAW A;  4B3M Q;  2Q2H A;  3VYU A;  1M90 C;  1HNZ Q;  4LF7 L;  3Q8D A;  4JI5 Q;  2NVY B;  3I4M B;  1PRT B;  1Z6H A;  4DAV A;  4HED A;  1GUT A;  1GUG A;  4YY3 Q;  4Q0F A;  5LHY 1;  1L0W A;  1SBB B;  4ZQ3 A;  1BBU A;  4P75 A;  3KLS X;  3BS1 A;  3HOX H;  2ENB A;  1ZYR D;  1ET9 A;  3U9S A;  3HOY H;  4KD4 A;  1TWC H;  5CC4 A;  2E2J B;  4ZUJ A;  4HIM A;  2MUY A;  2NTT A;  1BOS A;  1SEB D;  1FJG L;  3CRL C;  4JOI A;  4H02 A;  2B2V A;  3J7A 5;  4JI8 L;  3H0G H;  4KI0 A;  4MN3 A;  1K8A C;  4DR5 Q;  1UE1 A;  2R7Z G;  2M2L A;  4BA2 I;  1EYG A;  1G6P A;  2NN6 G;  3VR2 A;  3GDE A;  1U5K A;  5DLQ E;  2B2Y C;  1Y1V G;  3T56 B;  4CJ1 B;  3U9O A;  2UUA L;  1Q46 A;  1RIP A;  2VW9 A;  1IHZ A;  1RHP A;  2XGT A;  3VYT A;  3KOJ A;  2VQF Q;  4DV7 Q;  1TS3 A;  2F4I A;  3GTG H;  2FJ2 A;  3IL8 A;  2VL6 A;  3AQQ A;  4IFD G;  4JV5 L;  1AZQ A;  1OXU A;  1F77 A;  2F0I A;  3R8B A;  4HJ5 A;  1B9M A;  1E2W A;  1LTS D;  1VQD A;  5M3F G;  4JCV E;  4QQB X;  4NMZ A;  3A54 A;  1G51 A;  2PMZ E;  2K5V A;  4DR3 L;  4C2M H;  1YNN D;  3MXP A;  5G3L D;  4CJ0 B;  4NKL A;  2RHS B;  4IPH A;  3SHL A;  3CP0 A;  3GTO B;  2F0P A;  4UDU C;  1YBY A;  1C4Q A;  5FO8 B;  3I2Z A;  3FPP A;  4EQO A;  3PO3 B;  5C4J H;  1F2Z A;  1KXL A;  1UEA B;  2HT1 A;  1BF4 A;  4A3B H;  1SYG A;  2RKS A;  4G57 A;  5A2Q L;  1BXT A;  1Y8O B;  1VQK A;  2VZA A;  1F2M A;  5K5P A;  1TS4 A;  1C8C A;  1STE A;  5BN3 A;  2B3G A;  2DY8 A;  4A3D B;  1PZI D;  2R61 A;  1P8L A;  3KDF A;  2JJQ A;  4PMB A;  3Q24 A;  2Q8T A;  2RSN A;  1SE8 A;  3OTO Q;  1MSH A;  2D2C C;  1STY A;  3TBI B;  1B53 A;  2I46 A;  1A3V A;  2WAQ G;  3E9I A;  1WD0 A;  4DV6 L;  4A3F H;  1S5E D;  2BA0 A;  4MNO A;  3F2B A;  3I7F A;  3K0X A;  1UEB A;  1SMY D;  1B44 D;  4JV5 Q;  3C1F A;  3IFT A;  3LNN A;  2JEB I;  5J1Z A;  5KGU A;  1O7L A;  1FGU A;  1X32 A;  3HOY B;  1KDA A;  2F0V A;  1XNQ L;  3KBX A;  2NVX B;  5A2Q E;  2MO1 A;  4K8I A;  5C4Z A;  3RLN A;  4IUN A;  1A3U A;  3RNU A;  2ZM6 L;  3H0G B;  2B2Y A;  3MA2 B;  1D7Q A;  3RR5 A;  4FXG C;  4RGT A;  1FNU A;  2Q2I A;  3S1R B;  4MHE A;  4DV4 Q;  4K6D A;  4QCL A;  3D0F A;  1QVF A;  2EYM A;  4RA8 A;  1TY0 A;  3RD4 A;  3G6J B;  2RQX A;  3G4S A;  2TSS A;  5C4X B;  1B8A A;  3PIP A;  3BDL A;  3ZJY C;  5HGT A;  1D1K A;  4NXM Q;  2K6A A;  2Z6K A;  1O7Y A;  1PTO F;  1TWH B;  3QG1 A;  4GKJ Q;  4RCO A;  1PTO B;  2JQO A;  3ULP A;  2ZTC A;  1SAP A;  3HOW B;  2VNU D;  2AUK A;  2F0H A;  3IAY A;  4B08 A;  4KY5 A;  3K7U C;  3CF5 A;  1PH6 A;  2R93 B;  1K73 C;  4QY7 A;  1G2T A;  4GNX C;  4ME5 A;  2JA8 G;  1UUP A;  4DUZ Q;  5GAH C;  4DUY Q;  4LF4 L;  3Q0A A;  5IP7 H;  3OIP A;  4R4Q A;  1EUJ A;  4B3S Q;  4HSP A;  5FLX E;  1UE5 A;  2UUC Q;  4DR7 L;  3K58 A;  1Y69 U;  2ZTE A;  4A3M B;  1S72 A;  2E5L L;  3FEW X;  2VY3 A;  1ASY A;  5JEA H;  2QEJ C;  1VQ9 A;  1VQL A;  4DV5 L;  2Z1C A;  1PZK D;  1H9R A;  3OPO A;  2K33 A;  4HJA A;  4LFC L;  3TDQ A;  1J5E L;  3NSW A;  4L6T B;  2CW0 D;  4ZRZ A;  1C0A A;  2NVY H;  4CKB A;  3SR1 A;  4FDB A;  1N32 Q;  1ILQ A;  4A3G G;  2G9D A;  4KHP L;  3OMG A;  4ZUI A;  5JVG 3;  1X3G A;  1X3F A;  4DV2 L;  1PTO H;  3S2H B;  3N52 A;  3CCE A;  4RGM A;  2ZJR A;  1TKW B;  4TKO B;  2Q8I B;  4LK1 C;  4K0K Q;  5LMN W;  3NQI A;  1QZH A;  3NQT A;  3KYH C;  1K3R A;  3CCV A;  5IE8 A;  1BCP C;  2KCN A;  1HZC A;  2NZO A;  3PSI A;  5JEA G;  1XNR L;  2EXZ A;  2YTX A;  3I90 A;  2MP1 A;  1Q7Y C;  2Y0S G;  1N34 L;  5GAE C;  5HY6 A;  1EYC A;  1XNQ Q;  3KFU A;  1IL2 A;  4XQJ A;  1NBW A;  4NXN Q;  3KUP A;  4A3G H;  4KMU C;  3I4N G;  1BDO A;  1WTQ A;  2F52 A;  1PH9 A;  1HNW L;  2QKI C;  4DF7 A;  2ICI A;  3S1Q H;  4RCN A;  3G71 A;  3KF6 B;  3L9A X;  1N36 L;  3U58 A;  1PTO D;  2OQ0 A;  1M8A A;  1S3O A;  2GVB A;  4DKA C;  1II3 A;  3GTJ B;  1SNM A;  2Y0S E;  4JI4 L;  1CA6 A;  4BY7 H;  2KED A;  3I73 A;  1PHJ A;  1VQJ A;  4TVA B;  5IP7 G;  4DV5 Q;  1CSP A;  4DU9 A;  1I4H A;  1Q8I A;  3UDI A;  4A93 H;  1IBM L;  5C3E H;  1IW7 D;  5TSS A;  3HOX B;  1L1O C;  3BZC A;  4POG A;  4DFA A;  1TWC B;  3G48 A;  3Q6S A;  1VQH A;  1AP0 A;  1U0L A;  2HHH Q;  5KEE A;  3PO3 H;  3HFZ B;  5BN4 A;  5J22 A;  1Y14 B;  5C3W A;  2KVM A;  3GTM H;  1XMO Q;  4LW1 A;  3GTL H;  1EU3 A;  5DM7 3;  5C3X A;  1SE2 A;  2PI2 E;  1BCP B;  4A75 A;  3A7L A;  3TZU A;  1EIG A;  1ENA A;  3TRZ A;  3H15 A;  5FK9 C;  1MIU A;  2VB3 X;  1T9H A;  4A3D H;  2CW0 C;  2WIN B;  1F9R A;  3KLW A;  3GP7 A;  1EWH A;  2YU9 B;  5AFW A;  4XYO A;  1NCV A;  3I4M G;  2B29 A;  2JA5 B;  3A5Z B;  1GM5 A;  4IUV A;  1S5D D;  1ET6 A;  1ROD A;  4F7X A;  3MFG A;  4JI8 Q;  2YV5 A;  2B2W A;  2ZM6 Q;  3FDT A;  2AQ1 B;  2E74 C;  4JI4 Q;  4JOI C;  2CFM A;  2CQO A;  2IPK D;  4FF4 A;  3PV0 A;  1EQT A;  1B70 B;  4A3B G;  4QIW E;  5IYB H;  4V19 0;  2R3Z A;  1BQQ T;  5ELO A;  3GV6 A;  2SOB A;  5IGG A;  2QCP X;  3L2P A;  4ABN A;  3S1R H;  4LFA L;  2K28 A;  4QMG A;  2DNE A;  1R4Q B;  1HNW Q;  4HJ9 A;  1PYS B;  2EE1 A;  3PUW A;  3CC2 A;  5IGB A;  1EYA A;  2JA7 B;  1LTG D;  4RH6 A;  4YHH Q;  4O2D A;  4EQN A;  5ELE A;  3A7A B;  3QO2 A;  2JK8 A;  1TS2 A;  2BE5 D;  1VQB A;  1Q82 C;  2WAC A;  1X65 A;  2AWN A;  4H0L C;  5M5Y B;  1WJJ A;  1YZ6 A;  3W5O A;  2TMP A;  4X3S A;  4LNQ A;  1GOZ A;  3X3M A;  1Y8N B;  3D8G A;  4ME3 A;  3I56 A;  4K2L A;  4X65 Q;  1O80 A;  1XMQ L;  2BDN A;  2L1B A;  4A93 B;  2R7F A;  1KIX A;  5LMU Q;  4B9X A;  3J81 c;  1K83 B;  5KYL A;  1Y1V H;  3PO2 B;  2D62 A;  2Q8R E;  4M8A A;  2R7Z H;  1B4O A;  1KTK A;  3FRP B;  3RZD B;  4A3K B;  3KLS A;  3J81 E;  2JEA I;  3I4N B;  2D9U A;  3SK5 A;  5KND A;  4BY7 G;  2YTV A;  3GTM B;  2E2H B;  1HR0 Q;  1YJN A;  2JA8 H;  3CKI B;  1PTO C;  3DMU A;  4CBV A;  3AB9 A;  1E1T A;  1TWA H;  4Z9C B;  2Z4I A;  2EYF A;  2E2I B;  1JR0 D;  4QUF A;  3D3R A;  3UE1 A;  4RHR A;  3SXH A;  4MTN A;  4K8J A;  3I3C A;  4RWS C;  4GOP A;  4U68 A;  4J1M A;  4B3R L;  4TQU S;  2ALY B;  3VYS A;  4L5T A;  3K6O A;  1QNK A;  3OOC A;  4C1N K;  3CHB D;  2B63 B;  1ZEQ X;  1K83 H;  5EKI A;  4N9P A;  4DNT B;  5COY A;  1RCV D;  5M3F H;  4IUR A;  1K0R A;  1DM0 B;  1N33 Q;  2O2L D;  1QZG A;  2EZV A;  2LSS A;  4DV1 Q;  5G3L F;  5IT9 E;  3RZD H;  3NBH B;  1U4L A;  3A74 A;  1Q81 C;  3P7J A;  3CCQ A;  1Z7T A;  4PG3 A;  1BCP D;  5FLX c;  4NDX A;  2KCM A;  1YIJ A;  1VQ5 A;  3BVZ A;  3S1Q B;  2JA8 B;  4EQ5 A;  4DR1 L;  3T53 B;  2VUM B;  2BH8 A;  1TR5 A;  3R3O A;  1PFN A;  1NTG A;  3CAM A;  1XTC D;  2F0T A;  1AE3 A;  3AMU A;  1GUW A;  4YCV A;  1FJG Q;  4H7B A;  2JP1 A;  2DUD A;  3GO5 A;  2NUC A;  4OO1 G;  3A56