4IFDI

Crystal structure of an 11-subunit eukaryotic exosome complex bound to rna
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
291
structure length
230
Chain Sequence
MACNFQFPEIAYPGKLICPQYGTENKDGEDIIFNYVPGPGTKLIQYEHNGRTLEAITATLVGTVRCEEEKKTRRTVKNILVSVLPGNDFANNLPKEGDIVLTRVTRLSLQRANVEILAVEDKPAATFSVSQASSDLGETFRGIIRSQDVRSTDRDRVKVIECFKPGDIVRAQVLSLGDGTNYYLTTARNDLGVVFARAANGAGGLMYATDWQMMTSPVTGATEKRKCAKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an RNA-bound 11-subunit eukaryotic exosome complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
total genus 45
structure length 230
sequence length 291
ec nomenclature
pdb deposition date 2012-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF10447 EXOSC1 Exosome component EXOSC1/CSL4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ifdI02
2.40.50.880 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ifdI01
2KCTA 4DKAC 1JJCB 4BBRH 5K36G 1BBUA 5E7NA 3K80C 1VQIA 4O0AA 4DK6C 5C4XH 1NY4A 5IP7G 1M90C 4A3CG 4DUYQ 1CKNB 1J6QA 1PH4A 3PO2G 1E1OA 2E2IH 4UPAA 2VZAA 2WFWA 4YHHQ 3KOJA 4GOPA 3TQYA 4LFCL 2UXCQ 1B70B 2K52A 2YTXA 4P71A 1IBKL 4A3CH 1I94Q 3TS0A 2K75A 1Q7YC 2UXCL 4JI8Q 1I50H 2OTLA 1QVCA 1EQRA 3HOUG 2R92G 4L5QA 4JI2Q 4HJ8A 3HKZE 1VQ9A 1OXTA 2K14A 1PH5A 4NXMQ 1AH9A 1XTDA 3ULJA 3CC7A 2N49A 5GROA 4A3DG 1R9TH 4LF8Q 3S14H 1VQGA 1NTGA 5IP9H 1CKNA 2B3GA 2GN5A 4QL5A 2AHOB 4JI5L 2HHHL 2HIXA 4JI2L 4NXML 4LFAL 2NVYH 3JAMc 4EX5A 1P16A 1QUQB 4FDBA 4ME3A 4AYBG 1Q46A 1SFOH 4DV0L 2UU9L 4GN5A 4J15A 4DR2L 2XTIA 3ICEA 4DR7Q 2EIFA 4A3KH 3S17H 1XMOQ 1QVFA 1KD1C 4DV7L 4EQ5A 3GTPH 1SLJA 1C7YA 2MO0A 3CPWA 5LMUQ 1YJWA 1LYLA 4JC0A 2VQEQ 4A3IG 4NB3A 1J5EQ 4LF5L 2VUMG 1Q1BA 4LFBL 3RZOH 1YNXA 3W1BA 5M5WH 4A3LG 3HOVG 3UE1A 4LFBQ 3CP0A 5IYCH 5IWAQ 2B63G 3CCLA 4DUZL 1D7QA 1Q1EA 4AYBE 2PNHA 1YI2A 4PZ6A 5IP9G 4B3RL 4AQYQ 5C44H 4GKKQ 4IFDG 1JJGA 4X65Q 2PMZE 3KLWA 1DGSA 3H15A 1YJNA 5IYBG 1B7YB 4YY3Q 4DR1Q 2JA7G 2Q2IA 1VQ8A 4GNXC 1S72A 4A3MG 1KL9A 2HHHQ 4P73A 4JI5Q 4IFDJ 2R7FA 1YJ9A 3ERSX 2Y0SE 4IPDA 3TRZA 1C9OA 1HJPA 1CUKA 1H95A 4GOPB 2L15A 4QJFA 4BA2I 1XPRA 3K0XA 1JB7A 1E3PA 2JJQA 3EN2A 4X64L 4DAYB 2ZM6L 2QA4A 2NZHA 2PI2E 2CCZA 3LGJA 1LUZA 4JI4Q 4DUZQ 1X9NA 3MEFA 3I56A 5M5YH 1IBLL 2ZTDA 1X65A 4A3FH 2A1AA 2K5NA 4L5TA 4R4TA 2UXDQ 5JJKA 2ZTCA 3ULLA 1Y1WG 1HNXQ 1HZCA 2YV5A 1EFWA 3AEVA 1MJCA 1RL2A 2MNAA 3CCJA 4IPCA 1YIJA 1N36Q 3I4OA 4GKJQ 2CQOA 4MNOA 5GAEC 1PYSB 3S1NH 3T1HQ 3S1MH 4X62Q 1OXVA 2NZOA 2KBNA 2F3IA 3J7ZC 2F4VL 4APVA 3I4MG 3E0EA 4A3BG 1VQDA 1N32Q 4WJ4A 1N34Q 1VQEA 4LFCQ 1UE1A 2E8GA 1VQ5A 5J3BA 1G51A 1I5FA 3HFZB 4A3EH 1V43A 3GDEA 2Q2TA 1VQCA 2Z0SA 4OWTB 3G6EA 1QZHA 1VQ7A 1YHQA 4QQBX 1K3RA 3I4NH 2KHJA 2JA5H 4R4OA 2JEBI 3KF6A 2RHSB 3TREA 4A3EG 3S1RH 2I0QA 4YWKA 4JI3L 4GN3B 5IYBH 3CCVA 2JA8H 1V9PA 3GTLH 4YCWA 1OTCA 3PO2H 4B3TL 3VDYA 2EXDA 3I4NG 3J80i 1G291 5BR8L 3BU2A 4DV0Q 2K5VA 2F4VQ 2DUDA 1Z9FA 3NEMA 2R6GA 1MKHA 1Z47A 1Q82C 1PHJA 4JI6Q 4LF9L 2JA8G 3CD6A 1TWCH 3I7FA 1TWGH 2YU9H 3CQZH 2IY5B 3OTOL 3DLLA 3TS2A 3M4PA 3KJOA 1X54A 1N9WA 4LF7L 2PI2A 3E9HA 5ELOA 2R7ZH 1CKOA 3CCQA 2UUBQ 1FJGQ 2UXBL 3A5ZB 3W5OA 4JI8L 3CCUA 2ATWA 4IOAA 4HIMA 3F2BA 3NELA 4LUZA 3BZCA 5LMNQ 4A3GH 1I94L 3RNUA 3J81i 2AWOA 3S24A 4DV2L 5FJ8H 3EBEA 4DV6Q 2E2HH 1EUJA 2MQHA 1HZBA 4TVAB 4OONA 2WP8J 3M85A 4DV3Q 1JJ2A 2OTJA 4JI3Q 4LNQA 3KYHC 1WFQA 4DV5Q 4IJHA 4GOPC 3F2CA 4L5SA 1Y14B 3HOWH 2NN6G 3UDGA 2N3SA 4LUOA 3Q8DA 3T1YQ 1M1KC 2VNUD 1PH3A 1K83H 1AE2A 5IYDG 3T1YL 2R93H 4YY3L 2R92H 2B29A 3CC2A 4KHPQ 4IOCA 4OO1I 3I2ZA 1E22A 5IE8A 2KENA 1EIFA 3PCOB 1HR0L 5JJIA 4KHZA 1JE5A 2R7ZG 1EQQA 1GKHA 1YVCA 4A3MH 3JC66 5DLQE 1NE3A 1V1QA 2ZJPA 4JI0Q 4DR4L 4K0KQ 2BA1A 2YTYA 3A5UA 2UU9Q 4DR7L 4KHPL 4DR5Q 1VQLA 2IHFA 4UP8A 1VQFA 4JYAL 3M4OH 4B3MQ 1TWFH 2HIVA 2ID0A 3AFPA 4Y52H 1G6PA 3HOZG 4OO1G 1D8LA 2VUMH 3PIOA 3H3VH 1L1OB 4IPGA 1GO3E 3F2DA 4X65L 4LF6L 1NMFA 3HOVH 2A19A 1ASYA 4JBKA 1PVOA 2RCNA 3HKSA 4DR3Q 4R4CA 2C35B 5C0XG 2Q2UA 3UE0A 1XMQL 2JK8A 5LMNW 1HNZQ 4DV4L 3GTMH 1UE7A 2ALYB 1W3SA 4JBJA 3CCMA 1TWAH 2BA0A 4BY7G 4JV5L 1P8LA 3STBC 4GN4B 2HQLA 4B3SQ 2I5HA 3KDFB 1NBWA 2H5XA 1IBMQ 1U5KA 2LXJA 2FXQA 1XPOA 4DR5L 2D0PA 1A8VA 2LSSA 3KF8B 4GS3A 2WB1E 4GLXA 4A3GG 1K8GA 1WCMH 5M5XH 3HOUH 4HJ5A 5GAGC 1PH6A 3A0JA 1IL2A 3RN2A 1PH7A 4UY8C 1HZAA 4ALPA 1N33L 3S2HH 4A3JG 2UUCL 4DR2Q 3PF5A 4B3TQ 5LMNL 3PGZA 4R4IA 2I5LX 3RN5A 1K0RA 4YHHL 1KQSA 1Q81C 4A93H 4MZ9A 2AWNA 3D31A 4JCVE 3U58A 4BBSG 1W2BA 3G4SA 4LWCA 4P74A 1ASZA 3BJUA 4LF5Q 4GKJL 4C3HH 4X66Q 4B3SL 1Y1VG 1PH1A 4BY1H 1HR0W 1XNRL 3ZJYC 1JT8A 3PUYA 1GVPA 3GTOH 3FKIH 3KFUA 4OXPA 1VQ6A 3BZKA 4C3JH 4L5RC 3I55A 4HIKA 2NVQH 2GVBA 1XPUA 2CWPA 3E9IA 5IP7H 5C4JH 2Z6KA 1PH8A 5C0XJ 1S3OA 2IHEA 3CPFA 2WAQG 4JI1L 1SR3A 3D0FA 4DPGA 1QUQA 2K5HA 3EIVA 5IYCG 1YITA 2JA5G 3G71A 4PG3A 2A8VA 2F52A 1IZ6A 3CW2C 1K9MC 4A3JH 3OTOQ 3I4MH 4YCUA 4A3BH 4PMWA 2HT1A 4KLKA 2UXDL 2K50A 2AMCB 1WYDA 1HH2P 2PQAB 1GD7A 3DM3A 3G48A 4KI0A 1IBLQ 2UUAQ 1HNZL 4JBMA 5AJ3L 1RIPA 3IRBA 5M3MG 3GTKH 1IBKQ 4DR6Q 2VL6A 4QY7A 4GKKL 1E24A 1E7ZA 3SGIA 3NENA 4QGUA 3CCEA 3CAMA 4X62L 3B6YA 3T1HL 3A74A 2PQAA 2OWOA 3GTQH 2YYZA 5M3FH 4DK3C 4OX9L 2GVAA 4IPHA 1TWHH 1HNXL 3UDFA 2E2JH 2N78A 1LM0A 4POFA 1KC8C 2EQSA 4BY7H 4LF4L 2VQEL 3L7ZC 3K7AH 4IJLA 1L0WA 1PH2A 3PUVA 1I6HH 5LMUL 1MJEA 2NVXH 2IX1A 1EOVA 1FGUA 5H1SE 3HOXH 2RHQB 5JEAG 3TEHB 5C0XI 4DV5L 3HOZH 4R4QA 3STBD 2WB1G 3KJPA 1XMOL 1HR0Q 4OWWB 4DR6L 1K73C 3H0GH 4OWXB 1VQMA 3HOYG 2ZJQA 1KRTA 2KHIA 4YCVA 2RF4A 2I5MX 2DGYA 5FLMG 3RLNA 2VQFL 5GADC 1KRSA 3PF4A 1VS0A 4B3ML 1X3GA 4YWMA 1J5EL 4BXXG 4BBSH 5M3FG 2B63H 1Q8KA 3CF5A 4JI0L 1L1OC 4K0KL 2JA6G 4A3LH 4AIMA 5IYDH 2VW9A 1S40A 4JG2A 4BA1I 3CXCA 5BR8Q 4XIGS 3S15H 4BBRG 2JE6I 2BH8A 4LUVA 1VQOA 1WCMG 3L2PA 1VQKA 1PFSA 1N8RC 4LFAQ 1A62A 1EWIA 3M4QA 5IY0A 5HY6A 5GAHC 4GNXA 4WJ3M 1AE3A 3U4VA 1JMCA 2ZJRA 5FJ8G 4DR1L 1BBWA 4MTNA 3RLFA 1XJVA 1CSPA 3K8AA 1VQNA 1X3FA 3GTJH 4DV7Q 2QEXA 1BVSA 1YHBA 3AFQA 3RZDH 1VQJA 1QZGA 3UDXA 4DAMA 1B8AA 1Y1WH 3U50C 2UUCQ 3PUXA 1N33Q 1VQBA 2MFIA 2OCEA 3FKIG 5IWAL 1L2FA 3PO3G 4YWLA 4HJ7A 1Q86C 1NMGA 4X6AH 1SROA 3HKZG 4GNXB 5FLXc 3ULPA 4LF7Q 1KIXA 4GLAC 3AQQA 1SE8A 4JI1Q 1SMXA 3L0OA 3CMEA 3ER0A 2JA7H 3NBHB 1X3EA 5JJLA 4RMFA 1Q12A 2K4KA 2VY3A 5ELNA 4DV3L 4DV2Q 1YEZA 3AYHB 4IFDI 4HJ9A 5C4XG 1A63A 2UUAL 1X55A 3OYYA 1KAWA 3PO3H 4LF6Q 1OXXK 2UUBL 3J81j 4LW1A 2AKWB 2OQKA 5GQOA 1BKBA 1N36L 1YHAA 4JBWA 2IT1A 4JOIC 5C44G 4LF8L 4UP9A 1FL0A 4A3IH 5IT9c 2VQFQ 4A3FG 2R7DA 4JV5Q 5HGQA 1HNWQ 1IYJB 4QIWE 4DV1Q 1VCIA 1VQ4A 4C3IH 1UEBA 3RR5A 3J80c 2CKZB 4DR4Q 3CCRA 4A76A 1PA6A 1UWVA 1TXYA 4R1JA 3S1QH 1HZ9A 4HIOA 4A3DH 4B3RQ 2Z6KC 4H02A 1L1OA 1EYGA 1VQPA 1EIYB 4X66L 1XNRQ 3K81C 4PZ7A 4DUYL 3PUWA 4JI7L 3PUZA 3PSIA 4A3KG 4XTCS 1SRUA 2JQOA 2JA9A 4A75A 4JI7Q 4POGA 1WJJA 3H3VI 2ZTEA 1HNWL 2E5LQ 4JI4L 2BH2A 3HOYH 4A93G 4JOIA 3FP9A 4NXNQ 1KXLA 4DR3L 2R93G 1YZ6A 1X56A 3OW2A 1VQHA 4AQYL 4TQUS 4HJAA 2LXKA 3PIPA 3GTGH 3M3YH 4NXNL 4PZ8A 2NN6I 1C0AA 4GLVB 3J7A5 5AJ3Q 1PV4A 2CFMA 1Y1VH 4BY1G 4BXXH 3WWVA 3MXNB 3W1GA 1IBML 2OQ0A 4AH6A 1IXRA 1FJGL 3F1ZA 2QGQA 3KDFA 1LTLA 1U0LA 5FLMH 1A0IA 5JEAJ 1PYBA 3HOXG 4DV4Q 4HIDA 1KHIA 5EAYA 3CCSA 2ES2A 3CC4A 3S2DH 2VS1A 3FHWA 1UE5A 1XMQQ 1OXUA 1QVGA 3H0GG 4LF9Q 4X64Q 2ZM6Q 1GM5A 4JI6L 1SN8A 2NVTH 2Q2HA 4DV6L 4P72A 3K7UC 1WI5A 3HOWG 1OXSC 2E5LL 4UP7A 2ASBA 1T9HA 2JEAI 2D62A 3CMAA 2D0OA 4DNIA 2UXBQ 3RLOA 3UDIA 1CSQA 3PV0A 4O2DA 2Y0SG 2XGTA 1YBYA 5M3MH 4JYAQ 4A4IA 4Y7NH 5C3EG 3JAMi 3F8TA 3GO5A 4OX9Q 3M7NA 1CKMA 1O7IA 2YTVA 4C2MH 3J81c 4RG1A 1XNQL 2N8NA 3GD7A 3M9BA 4P75A 1I3QH 1X6OA 5C3EH 1VQAA 1FVIA 1N34L 2MO1A 1NJIC 1K8AC 3S16H 1N32L 2IX0A 4NPSA 3U4ZA 2WAQE 4DV1L 2V1CC 4IO9A 2JA6H 1PH9A 2KCMA 4LF4Q 1WOCA 3KF6B 2CWAA 1MIUA 1XNQQ 1UE6A 1E1TA
chains in the Genus database with same CATH superfamily
3K6OA 1JJCB 5E7NA 3CKIB 1UUPA 3K80C 3NTKA 3D6WA 1CKNB 4U68A 1PH4A 1STAA 2VZAA 4YHHQ 3KOJA 1H9JA 2YTXA 4IUTA 3NK9A 4OELB 2K75A 3SXHA 1Q7YC 4FXDA 1EQRA 3JAML 2R92G 4L5QA 3HKZE 1AH9A 2PW5A 2K14A 1PH5A 1XTDA 1JB3A 1TS5A 4A3BB 3ULJA 1R9TH 1CKNA 4QL5A 3GV6A 2AHOB 3A56A 2F0WA 1DYQA 4ME3A 1BDOA 4QB4A 4DV0L 2UU9L 3TZUA 1SMYD 4A3KH 1TVXA 1E2ZA 1XMOQ 1I3QB 2PQEA 1KD1C 4DV7L 4EQ5A 3CPWA 1CTMA 1RTOA 4ZKCB 2CHBD 5M5WH 2R93B 2QEJC 3HOVG 2A73B 3CP0A 4CDFC 4FYDA 2JA5B 1Z7TA 4DUZL 2JA7B 4AYBE 3S2HB 4A3MB 3R93A 2PO4A 5IP9G 4ULLA 4AQYQ 2NVXB 2NVQB 3TP8A 4GKKQ 4Q5VA 1L0XB 4X65Q 2PMZE 3NPPA 1YJNA 4YY3Q 1NR4A 2EY2A 4GNXC 4A3MG 4P73A 2B2UC 2EYLA 3ERSX 3FPUB 2NYZD 5EQ0A 4A3IB 3SVMA 4OIJA 4GOPB 2NVTB 4BA2I 5JVH3 1JB7A 1E3PA 1I4GA 1GUSA 2ZM6L 2AQ3B 4K5XA 2E2HB 2IWHA 3BVZA 3LGJA 1LUZA 4JI4Q 3R3OA 1H9MA 4KD3A 3DEOA 2A1AA 4EGVA 4NP5A 2PZTA 2A68C 4KV6A 1WTHA 1Y1WG 3LWEA 1BCPC 1HZCA 3AEVA 1M4VA 1RL2A 4GKJQ 3I4OA 5FO7B 5IGDA 4X62Q 4PMCA 1STNA 3J7ZC 3NTHA 4APVA 4A3BG 2D2CC 2Z8LA 1N34Q 1CZWA 2A69D 2E8GA 1VQ5A 1I5FA 5D65A 1TWHB 3ERQA 1TKWB 3LWUA 3CRKC 3F2UA 1VQ7A 3I4NH 1W6JA 1DXMA 1JCKB 1ZYRC 4R4OA 3S1RH 1II3A 4YCWA 4QIWB 2BCOA 4RH6A 5G3LD 2K5VA 3OPOA 2DUDA 4RHSA 4X3UA 2R6GA 1Q82C 2JA8G 1FYCA 4OHJA 3I7FA 2DJGC 3O13A 3TS2A 3OWFA 1LABA 2HCCA 2IJ0A 3A5ZB 2R93G 4HIMA 5LMNQ 3BZCA 1MGSA 2E2HH 2I46A 2NUCA 3S9WA 3HEJA 3KYHC 1U4LA 3UDGA 3T1YQ 1GHJA 1SDFA 1M1KC 1K83H 4DF7A 2FFKB 5CV8A 2F0KA 4IOCA 3I2ZA 1E22A 3J7AV 5IE8A 2K33A 2JA8B 2EJGC 2X6GA 3QOLA 1EZ8A 5FOBB 4A3MH 5DLQE 1NE3A 1V1QA 3D4RA 4DR4L 2UU9Q 2OXPA 5EJWA 4B3MQ 3I91A 3E3XA 1MI2A 4H13C 5D3IB 4OO1G 4A3JB 2VUMH 2RBMA 1GUWA 1L1OB 4RCOA 1RCVD 5CR3A 1QNUA 2A19A 1PVOA 2RCNA 2WV6D 1HTPA 4F7XA 4DR3Q 3UE0A 1XMQL 2JK8A 5LMNW 3RD4A 3GTPB 2YU9B 3S15B 4G57A 3CCMA 1TWAH 4ABNA 4JV5L 3D8GA 4GN4B 3I4LA 2XRSD 3PIP3 1D2BA 3A7LA 2O5JC 2H5XA 1IBMQ 1A8VA 2LSSA 4N9PA 4G7HC 4KKSA 1WCMH 5M5XH 3HOUH 4HJ5A 5KEEA 1F9PA 3RN2A 4UY8C 1HZAA 4ALPA 1N33L 3S2HH 4A3JG 2UUCL 3VYSA 2B2YA 2Z4HA 3ITPA 3A54A 3KLSA 1K0RA 1BCPB 4RCNA 4MZ9A 2KCCA 4LWCA 2G9DA 5FKAC 4LF5Q 3W2DA 2XIWA 1CM9A 2M00A 4HN7A 4BY1H 1HR0W 3ZJYC 3PUYA 3KLSX 3BZKA 3I55A 2NVQH 1EU4A 4X3KA 4R9WA 4CKBA 5C0XJ 1JORA 3CPFA 1WTWA 5JPNC 2FMMA 2NZ1D 4JI1L 2K5HA 5IYCG 5JOBA 4RGTA 3G71A 4PG3A 3FVQA 3CW2C 3OTOQ 2HT1A 3BYYB 1AZQA 2LS01 1DOLA 2UXDL 1WYDA 3G48A 4A93G 5JJZA 4KI0A 4ZUJA 2B2WA 3IRBA 2K04A 1NNXA 4X3SA 1U4RA 2VL6A 3D4DA 1E24A 1E7ZA 3SGIA 4UHVA 1CT1D 2C5CA 3T1HL 2OWOA 1MHWC 2F3WA 1I4HA 2JA6B 4ZAIA 2C9OA 5I9OA 2AUJD 1KC8C 3I4NB 4LF4L 2VQEL 3K7AH 1LTSD 2MPMA 1MJEA 4B9WA 2NVXH 2IX1A 1GHKA 1S5FD 1HR0Q 1TS4A 1HUMA 5EPLA 2ZJQA 1WTXA 4YCVA 3DWPA 2F0LA 2DGYA 2VQFL 3RLNA 1KRSA 3S2DB 3S1RB 1J5EL 4BXXG 4BBSH 5M3FG 2B63H 4K0KL 4AIMA 2VW9A 3HKZB 3TN2A 5BR8Q 4XIGS 4LUVA 3L2PA 3Q22A 3KF8A 2ICIA 4LFAQ 5I6WA 4NMZA 4Z9CB 2ZJRA 4ZRZA 1MBYA 3J80E 3GTJH 1BVSA 3AFQA 3UDXA 3CHBD 1Y1WH 2UUCQ 3T16A 2H1EA 5J39A 4ZYSA 3H0GB 3PO3G 4I7ZC 1BCPD 2DY8A 4LF7Q 2F0SA 2KCNA 4RGMA 3I70A 2EYFA 3VYTA 4DXFA 1SMXA 3CMEA 3ER0A 3RMHA 1D6EC 3FRPB 2K4KA 5ELNA 3Q0AA 4DV3L 4K6LA 3AYHB 2QKIC 4HJ9A 2UUAL 1X55A 1KAWA 2RCFA 4IN3A 4KHVA 3J81j 3A55A 3OMGA 1T5EA 2OQKA 2PZUA 4H7BA 1YHAA 1SBBB 4A3FG 1WVLA 4JV5Q 1HNWQ 5HGQA 1LT6D 2JSOA 4M8AA 4C3IH 5BN3A 3IAYA 3J80c 2LFNA 1RD9D 1AZPA 3GTQB 5JJKA 3S1QH 3P75A 2RSOA 4R1JA 1LTGD 2Z6KC 1EYGA 4A3FB 2J4XA 5C4ZA 4JW0A 3K81C 4PZ7A 1HCZA 1BO0A 5IODA 5M3MB 3PUWA 3K58A 3PUZA 4RA8A 5ELEA 2K7VA 2JQOA 2JA9A 4JI7Q 4POGA 3H3VI 1ZYRD 2M2LA 2SOBA 4NXNQ 1YZ6A 1PTOD 4TQUS 1GUNA 1JOQA 5EPJA 4NXNL 4GLVB 1PXUA 4BY1G 1EYDA 2E76C 4HEDA 2QF7A 3VR4A 4BXXH 2LY7A 1FJGL 4TSSA 2IX3A 3F1ZA 3KDFA 3HOXG 1PYBA 3S2DH 1KHIA 5EAYA 3CCSA 2PPBC 2VS1A 3U9SA 4LF9Q 4GZYC 2ZM6Q 3HG9A 2NVTH 3HOVB 4P72A 2E5LL 3MXPA 3NBHA 2PW7A 2D62A 2A6HC 2UXBQ 1CSQA 4ODGA 2EJFC 4O2DA 3K5LA 4JYAQ 3JAMi 1O7IA 2YTVA 2B8FA 4C2MH 4C3IB 1KABA 1BR9A 5ELBA 3M9BA 1QCBD 3A8IE 5C3EH 1N34L 1K8AC 3TMEA 1NJIC 1N32L 1ZKOA 3U4ZA 2SEBD 5M3FB 2VB2X 4OWXB 1UE6A 2KCTA 2P5ZX 5G3LF 1G6ZA 4BBRH 1BBUA 1G2TA 1M90C 1NY4A 4A3CG 1NSNS 2O5IC 1E1OA 2K01A 5IT9E 1DOMA 2UXCQ 1B70B 1PFMA 1IBKL 1LLRD 3TS0A 1STEA 4JI8Q 1HXYD 1HNWL 1Q3LA 3J80L 1VQ9A 1ENFA 2L11A 1H9SA 3N6RA 3HRZC 3QJYA 5GROA 3L3OC 2QILA 3S14H 1VQGA 3DM1A 2GN5A 5JEAH 1MSHA 4Y7NB 5CORA 4LFAL 4PNYA 4EX5A 4J8QA 2N55A 4AYBG 3H94A 3ICEA 2J0TD 4DR2L 4DR7Q 3S17H 2WINB 5FO9B 1U4MA 5LMUQ 1K8OA 3NQTA 4A3IG 1J5EQ 4LF5L 4LFBL 3C2PA 1BNZA 3W1BA 2NTSA 3Q6SA 5C4XB 2XWBB 4K5VA 3UE1A 2WAQB 5IWAQ 1H9KA 4DGZA 5KIXA 1FD7D 4FNFA 1DJRD 1YI2A 4IFDG 4L8JA 1B7YB 4HR7B 2Q2IA 4TKOB 1YJ9A 2Y0SE 5CV9A 3TRZA 4KY6A 1H95A 1CUKA 4IUNA 3ND9A 5TSSA 3EFXD 1V1PA 5KNBA 4B08A 3NWSA 4QMGA 2K1BA 3SHLA 1GUOA 4DFAA 1JC7A 1X9NA 4IQZA 5M5YH 4A3FH 2K5NA 4L5TA 4R4TA 2ZTCA 1SNOA 2KECA 1YIJA 1MD2D 4I65A 2JYOA 4OL7A 4C1NK 4ZLTF 5LL6S 1PYSB 3S1NH 5E3FA 3IKJA 2F3IA 2F4VL 4CBVA 3E0EA 5J3BA 1I4PA 2BE5C 2IL8A 1VQCA 3G6EA 5EBDA 1YHQA 1EFID 4QQBX 4MTKA 3MZ5A 1KDBA 2RHSB 1FNUA 4MIUA 2HD3A 1V9PA 3OIQA 1SEBD 3UI2A 3VYRA 4G7ZC 3VDYA 3I4NG 1G291 5BR8L 3BU2A 5A35A 2KHSA 2F4VQ 1CHPD 1MKHA 1UNSA 1PHJA 3CD6A 1TWCH 1PFBA 1S4ZA 3OTOL 3EA6A 1X54A 2UUBQ 1KLGD 3KLRA 3W5OA 2ATWA 3CCUA 4IOAA 1I94L 2AWOA 3EBEA 2NWGA 4IUPA 1EUJA 2MQHA 4TVAB 1JJ2A 3I8ZA 4L6TB 3E0JA 4LNQA 1B1ZA 1WFQA 4IJHA 1QILA 3F2CA 3QO2A 4L5SA 1JOKA 1V1PB 3EQLC 3Q8DA 1IW7C 4BBRB 1B4OA 3KUPA 1IYUA 1WCMB 3MEHA 1PYWD 1S5ED 2B29A 3SK6A 5C3XA 1IL8A 2CQAA 3PCOB 1EIFA 1V1OA 1WTOA 3DMUA 1HR0L 1JE5A 2R7ZG 3OOCA 2BDOA 2BA1A 2HUGA 4B9XA 1VQLA 1ENCA 1A3UA 1VQFA 3IFTA 4FF3A 2F0OA 2HDLA 2HIVA 4Y52H 3HOZG 5FO8B 2WB1B 3SDZA 1D8LA 1RODA 5CV7A 4UAIA 1K28A 3PIOA 1U9RA 3H3VH 2B2VA 3HOVH 1A3VA 3A8JE 4RWSC 4A3GB 4JBKA 1HA5A 3MAQA 1BCPF 1LT3D 1GUGA 1ICFB 2ALYB 1W3SA 4BY7G 2KJXA 1C4QA 2E74C 2LXJA 2R3ZA 5T1GA 2FXQA 1I6VC 1DOKA 2D0PA 4GS3A 3KF8B 2F3VA 4HCSA 4GLXA 1EL0A 1K8GA 3BZDB 1J9OA 4DN4M 1PH6A 3A0JA 2B2UA 2ICEC 3MFGA 1PH7A 1B3AA 3EVQA 4DR2Q 3PF5A 5LMNL 1EY6A 3PGZA 2A6HD 4R4IA 3RN5A 4KTAA 4RGNA 3I90A 3G7LA 2WACA 4P74A 2E75C 1L0YB 2XSCA 3EJIA 4MN3A 4C3HH 4X66Q 4B3SL 1Y1VG 1XNRL 1HRJA 1EY0A 1JT8A 3FPPA 1B3QA 3FKIH 3KFUA 4XQQA 1CK1A 3QB3A 5C4JH 1SNCA 4FO2A 1S3OA 2IHEA 1QB5D 1Y1VB 3MWYW 3IFDA 3EIVA 1M8AA 4K6DA 2F52A 1IZ6A 1TWCB 4ZQ3A 3I4MH 2RDHA 2K50A 4KY5A 4K8JA 3BG3A 1HNZL 5J22A 5AJ3L 1RIPA 1SYDA 1IBKQ 4DR6Q 1PTOB 2DJFC 2NB0A 3CAMA 3LX0A 3B6YA 3GTQH 1CA5A 1IKMA 3HS0C 4OX9L 2GVAA 3C1EA 4PQXA 4XQNA 3L7ZC 4PV1C 3PUVA 5DM63 5LMUL 3QOJA 1EOVA 1FGUA 3S16B 2RHQB 3M3YB 1EWHA 1SMYC 3OW7A 2CH4W 2L55A 3NWTA 4R4QA 3KJPA 1BUVT 1KDAA 5D14A 3H0GH 1KRTA 4O1NA 1CFMA 2RF4A 2I5MX 2F4IA 1PRTB 5GADC 3PF4A 2PNRC 4C3HB 1ENAA 1Q8IA 4YWMA 1X32A 1LTBD 1Q90A 4KN7C 5KRUA 4JI0L 2K28A 2JA6G 4A3LH 4H44C 2DNEA 4K5WA 1S40A 4BA1I 3CXCA 2CH4A 1VQOA 4XT1B 1WTPA 3M4QA 1XX8A 4HTHA 5KYLA 5GAHC 1AE3A 2RDGA 1G2SA 4C56C 1D5MC 3RLFA 3GTJB 3BDOA 2AQ2B 1CSPA 2OT2A 3DEPA 5I4DA 1AW7A 4DV7Q 2NTTA 2CW0D 1JWSD 4CJ2C 1EZ6A 3PUXA 3TSSA 3D3RA 3QG1A 4XXEA 1L2FA 4ZCKA 4YWLA 1AFPA 2AQ1B 1Q86C 1SROA 3BYTB 3ULPA 1KIXA 1A6XA 2EZVA 3MA2B 1SE8A 3HP3A 2JA7H 4BBSB 1X3EA 3X3NA 4C3HG 5JJLA 4RMFA 1Q12A 3K0YA 2VY3A 3H3VC 2F0HA 4DV2Q 4IFDI 4E6IA 3I3CA 5DEHA 1T5XD 2ZXOA 3OYYA 2G5DA 5JPMC 1OXXK 1EEFD 4LW1A 3HZXA 4L63B 1BKBA 4JOIC 1J8IA 2PMZB 5CV5A 1E2WA 5IT9c 4LAAA 1EY9A 1CHQD 4QIWE 1YNND 1UEBA 1TS3A 2CKZB 1TIID 4A76A 1PA6A 1TXYA 1EY8A 4HIOA 1PMRA 1L1OA 5HGTA 2KQ3A 4OIKA 4A3KG 2K05A 4XTCS 2EYJA 1LTID 2ZTEA 2E5LQ 4IALA 5C3WA 1E0BA 2F03A 3T53B 2BH2A 3GTOB 3H91A 1X56A 4AQYL 5EBCA 2NN6I 1B53A 5AJ3Q 2CFMA 1Y1VH 2B8GA 3BVMA 3GP7A 1SYFA 4R8IA 1B9MA 1WD0A 1IXRA 4OGQC 2QGQA 1RHPA 4DV4Q 4HIDA 3FKIB 1ET6A 2ES2A 4FF1A 1OXUA 1QVGA 5CV6A 2WKDA 4JI6L 2Q2HA 1MSGA 4WORA 4MHEA 1WI5A 2NN6H 4UP7A 5JAVA 3TZDA 3UDIA 3PV0A 3W3AA 1PZKD 4Y7NH 3F8TA 3GO5A 4OX9Q 3NBIA 1CKMA 2LKVA 4NKLA 1F9SA 1SYCA 5KNCA 1XNQL 2SNMA 3BS1A 5T1IA 2EYMA 4KKUA 2MO1A 3S16H 2WAQE 2V1CC 2KOLA 4LF4Q 1WOCA 2KVMA 4IPGA 1MIUA 1E1TA 3KJOA 1O80A 1EY4A 2XRQD 5K36G 5IP7G 5C4XH 1VQIA 4O0AA 2EVBA 4DUYQ 3PO2G 2E2IH 3P7JA 4JVZA 2EY5A 1U4PA 4LFCL 2K52A 3VR6A 4P71A 4A3CH 1PZJD 2MUYA 5ELDA 1I50H 3C1FA 4IUUA 4HJ8A 3I4MB 3CC7A 1AP0A 2N49A 1SXTA 4LF8Q 4A3DG 1EYAA 2B39A 1NTGA 5IP9H 2B3GA 3SK4A 1F77A 2HHHL 1HA6A 2HIXA 4JI2L 4NXML 4NW2A 3H6MA 3JAMc 4FDBA 1QUQB 1SFOH 4DNRB 2L4NA 4DK1A 4J15A 2XTIA 2L1BA 3VR3A 2EIFA 1PLFA 4BS9A 1D5XC 1O7ZA 4QF4A 3GTKB 3I73A 1KLUD 3GTPH 1VF7A 1SLJA 3MXUA 4KMUC 1C7YA 1LV9A 4KY7A 1PRTF 3MTSA 1JICA 2EE1A 2L9HA 4JC0A 2H4OA 4ZUIA 5I9PA 3HOWB 3R2IA 5DAUA 5CBAE 3K5NA 1S5CD 3S1MB 1H9RA 3CCLA 2PNHA 1O7YA 1UAPA 4PZ6A 4B3RL 4ZKBB 1SAPA 1JJGA 4DAYA 3FEWX 5ELCA 5KYIA 1DGSA 3H15A 2Q8IB 2JA7G 3OIPA 1CA6A 1KL9A 1JOOA 4JI5Q 1PTOF 1RKNA 1IKLA 1C9OA 4CGYB 1HJPA 1SNQA 1EU3A 4CKCA 5CC4A 2L15A 1XPRA 1CZGA 3EN2A 2DN8A 4XDXA 4X64L 4DAYB 2QA4A 2NZHA 3C46A 1RJTA 3I56A 1IBLL 1TU2B 2ZXPA 2UXDQ 3G6JB 3ULLA 1MJCA 2WKCA 3DWQA 1EIGA 4IPCA 3WDNA 3J7YW 4MNOA 1Y8PB 1GXDC 2X69A 3RZDB 3NUCA 4DAPA 3T1HQ 4BY7B 3NXWA 2NZOA 2KBNA 4A3DB 3I4MG 1X3PA 1VQDA 5KNDA 2FMCA 4CDCC 1UE1A 5D3DA 4K2KA 3HFZB 4A3EH 2QW7A 2Z0SA 1QZHA 1TWFB 4C3JG 2JA5H 2JEBI 3KF6A 2I0QA 4YWKA 4JI3L 4GN3B 5IYBH 1STYA 1OTCA 2B63B 4IFDH 3PO2H 2EXDA 2HCIA 3BDLA 1QOHA 3PQIA 1B9NA 3MFYA 5AFWA 1C8CA 4JI6Q 1VF5C 2YU9H 3NQIA 3CQZH 3WOEA 2F0NA 3M4PA 2Q8TA 1N9WA 2PI2A 5ELOA 1CKOA 3CCQA 1LT5D 4JI8L 3F2BA 3BDCA 4LUZA 4A3GH 2GA4B 3S24A 4DV2L 4DV6Q 3QR8A 1HZBA 3M85A 4OONA 2WP8J 2OTJA 1RTNA 2Q8RE 4DV5Q 2F0TA 1PTOH 4GOPC 1Y14B 4R8NA 2NN6G 2B2TA 3DWAA 3AU7A 3MXNA 1PH3A 1B2TA 2A68D 2F0FA 3NE5B 1AE2A 5IYDG 5FK9C 3T1YL 3WOFA 2EJMA 2R93H 4YY3L 2XVSA 3CC2A 4KHPQ 2KENA 2OEOA 4JI0Q 3Q23A 3A5UA 1SE2A 4DR5Q 2OF1A 2IHFA 3AB9A 1NCVA 4JYAL 1TWFH 2SDFA 4JPBW 3AFPA 1G6PA 5K36H 5LHY1 4LF6L 1ILPA 1NAPA 1ASYA 2BE5D 4R4CA 2C35B 3DHQA 4DV4L 1UE7A 4KJNA 2EOTA 1P8LA 3STBC 1EIHA 1NBWA 3SK5A 5IIFA 2WB1E 1I4QA 2EYPA 5GAGC 1IL2A 1FNVA 2ENBA 1SE4A 4B3TQ 2F0QA 1Q81C 4A93H 3U58A 3AMUA 1STBA 1W2BA 3G4SA 5CMDA 4GKJL 1JE4A 1PRTC 1VQ6A 4C3JH 1FGBD 4HIKA 1Z6HA 1QJOA 1XPUA 1I50B 2CWPA 5IP7H 4F87A 2Z6KA 2RQXA 1TWGB 1VDZA 2M9VA 3D0FA 4XYOA 4DPGA 1YITA 2A8VA 4KJOA 1A15A 1K9MC 4A3JH 4YCUA 3QWNA 1HH2P 4JBMA 1KTKA 3J81E 3GTKH 4ZK9B 3CCEA 4CHTB 3NENA 4X62L 4HSVA 3A74A 2PQAA 5M3FH 3V2TA 4YIJA 5F2DA 1TWHH 5CYUA 1HNXL 4G4KA 2E2JH 2N78A 3NSWA 4QCLA 5I6YA 2EQSA 4BY7H 4IJLA 1VMCA 1L0WA 1I4RA 1AEXA 1E2VA 3TEHB 1H9SB 3PMFA 2WB1G 4IURA 4ME5A 4WRDA 1XMOL 3HOZB 3HOYG 3GTGB 4X3TA 1VS0A 1FR3A 1WD1A 5EPKA 5EGTA 3CF5A 2XN9C 1LTTD 4JG2A 2D9UA 4IUVA 1WCMG 1N8RC 3ZYYX 1A62A 3S14B 2EY6A 3D4WA 1JMCA 4DR1L 3CU7A 1HFGA 1BBWA 4MTNA 4EQOA 1XJVA 1JQYD 3MVVA 3QIAA 3R8BA 1X3FA 4V0BA 2K5DA 2A6ED 3VR5A 1YHBA 1QZGA 2KUMA 5E1FA 4DAMA 4WJWA 4LK1C 2PYKA 2OCEA 4X6AH 3HKZG 2NBFA 5J1ZA 1F2LA 1K83B 4GLAC 4K14A 3AQQA 3OHXC 3KBGA 1BOSA 1ML0D 4JI1Q 3L0OA 4KN4C 1K8MA 2L0CA 4BY1B 1YEZA 4C3JB 2Z6BA 4RGOS 4F8MA 1WTVA 1TY0A 1A63A 5COYA 3PO3H 2B2YC 4LF6Q 2PZWA 2MJ8A 1N36L 2IT1A 3SR1A 1F2MA 2DNCA 4UP9A 1PRTD 1IYJB 5IGCA 1VQ4A 1NR2A 4DU9A 3CCRA 1UWVA 2R61A 1TWAB 4X66L 5I2XA 5IGBA 1XNRQ 4DUYL 4Q0FA 1EOTA 2F0VA 4JI7L 1C48A 2K6AA 1IYVA 1EYCA 1EQTA 2IW3A 2F0EA 3JAME 1WJJA 2E2JB 4CJ0B 1O7LA 3K57A 3HOYH 3K5OA 3ND8A 3T56B 3SE0A 4HJAA 4N9TA 4PZ8A 5HURA 1PV4A 3WWVA 3MXNB 3W1GA 1X3QA 3J81L 3E5SA 5IGEA 2BOSA 1U0LA 3URYA 3CC4A 1TT2A 2XWJB 1SYBA 3FHWA 1XMQQ 3MHBA 4RFBA 3H0GG 4X64Q 1GM5A 4DV6L 5M5YB 2F0MA 5JVG3 2FINB 3HOWG 4HMJA 2Y0SB 2ASBA 1T9HA 4U673 2JEAI 4DNIA 2TMPA 3OWEB 2Y0SG 2XGTA 5A2QL 1YBYA 1SFOB 2EYOA 4RG1A 4WFN3 4TRDA 2Z4IA 4P75A 1I3QH 1X6OA 1VQAA 1DCZA 1W6KA 1CI3M 4IZ8A 4DXGA 4DV1L 4IO9A 2JA6H 1UEAB 1PH9A 3VA5A 1WTQA 4XYQA 2CWAA 2F0DA 2HQLA 1IHZA 1XNQQ 4DKAC 2F0PA 1TQOA 2LMCB 4A3EB 4DK6C 2A5HA 1YNNC 1HHVA 2G9HD 2ZT9C 2R92B 1J6QA 3HOYB 5K5PA 4UPAA 2WFWA 4ID6A 4GOPA 3TQYA 2EY1A 3T4AC 1I94Q 2F0UA 2EPBA 1SYGA 2UXCL 5C4JB 2OTLA 1QVCA 3HOUG 4JI2Q 4NXMQ 3HGBA 1OXTA 1ET9A 2K5QA 3OSOA 5C5MA 5ISRA 2R7ZB 3A7AB 4QUCA 4N8X1 2B2TC 3CQZB 1SJHD 3N52A 4JI5L 4FF2A 2NVYH 4CDEC 1P16A 4ILWA 1Q46A 1ICWA 4GN5A 5E4XA 1D1KA 1QVFA 1B50A 1CQVA 1RDPD 2MO0A 5IT9L 1YJWA 1LYLA 5CV4A 2VQEQ 5M5WB 4NB3A 2VUMG 1Q1BA 3RZOH 1YNXA 4A3LG 4LFBQ 2RKSA 1FNWA 5IYCH 1XYIA 4FXKC 4NDXA 1D7QA 2F0JA 1DM0B 4QUFA 1Q1EA 4K2LA 4OO1H 2MGSA 1Y69U 5C44H 4FP5D 2KA7A 3KLWA 5IYBG 1SSOA 4G7OC 1HQMC 4DR1Q 1VQ8A 1S72A 3M7GA 2HHHQ 1CQFA 4IFDJ 1O78A 2R7FA 4IPDA 5FLXL 2VUMB 4O42A 3T51B 1KNAA 4QJFA 1WTRA 3K0XA 1KNEA 2JJQA 4A3KB 3TP7A 2PI2E 1YNJC 2CCZA 4DUZQ 3U9OA 3MEFA 1OO9B 1X65A 2ZTDA 3VA7A 5C0XH 1HNXQ 2YV5A 1EFWA 2MNAA 3CCJA 1N36Q 4CKEA 2CQOA 2D5DA 3GQBA 5GAEC 3FMCA 2HQEA 3S1MH 1OXVA 1KDCA 1I6HB 1A2TA 3HOUB 1N32Q 1LTAD 4WJ4A 1SNMA 1VQEA 2RVLA 1NUCA 4LFCQ 1G51A 1HTLD 5EKKA 1V43A 3GDEA 2Q2TA 4OWTB 5M9OA 1K3RA 2KHJA 1EQVA 3TREA 4A3EG 2BDNA 3GTLH 3CCVA 2JA8H 4B3TL 3TP5A 3J80i 1VMPA 4DV0Q 1PFNA 1Z9FA 3NEMA 1Z47A 4J6HA 5C5LA 4LF9L 1TWGH 1HFNA 3GTMB 2IY5B 3TBIB 3DLLA 4KKTA 2Z9HA 1V8QA 2DY7A 3D6CA 3T13A 4LF7L 3E9HA 2R7ZH 5L37A 1QWYA 3M4YA 1FJGQ 3FDTA 2XNAC 2UXBL 1KAAA 5IGFA 4C2MB 3NELA 3RNUA 3J81i 5FJ8H 4DV3Q 2A6EC 4JI3Q 5E4WC 1JWUD 2MHVA 2O2LD 3HOWH 2F1MA 2N3SA 4J1MA 4LUOA 2VNUD 2V4DA 3P20A 1HUNA 1TS2A 4KK7A 4HMIA 4CJ1B 2R92H 5C6AA 5KGUA 4OO1I 1ZXTA 2O4XA 5JJIA 4KHZA 3NTIA 1PZID 2I07B 1EQQA 1GKHA 1YVCA 3BVGA 1R4PB 3JC66 1EY5A 2ZJPA 4K0KQ 2N88A 2YTYA 4DNTB 4DR7L 4KHPL 4PMBA 2Z1CA 1Y8NB 4UP8A 1ESFA 3M4OH 4DK0A 2ID0A 4HAEA 2HDMA 1LO5D 1SYEA 1GO3E 2J7ZA 4X65L 3F2DA 1NMFA 1TR5A 5CBEE 4DA2A 3HKSA 5C0XG 3S17B 2Q2UA 2VB3X 1HNZQ 3GTMH 2QCPX 4JBJA 2L12A 1F2ZA 2BA0A 4RAUC 1Y8OB 4B3SQ 2I5HA 3KDFB 1U5KA 2NVYB 3X3MA 4F88A 4DR5L 1XPOA 2AUKA 4A3GG 4LJZC 4FVMA 5C3EB 4BWGB 1K0SA 4I7AA 5I2YA 4K8IA 1K3BC 5ELFA 5CGKA 4A93B 3A8KE 2EXZA 1QG7A 1LACA 2I5LX 4YHHL 1KQSA 2JXMB 2RA4A 4RHRA 2AWNA 3D31A 4JCVE 4BBSG 4DAVA 1R4QB 2SNSA 3MXGA 3BJUA 1ASZA 1IW7D 2FHTA 4S3SA 3V05A 4FXGC 2X6LA 1PH1A 1BF4A 1GVPA 3GTOH 5NUCA 4OXPA 4L5RC 3VYUA 3GTLB 1F9QA 2GVBA 3TP6A 3E9IA 1PDQA 1PH8A 2QDLA 1D1IA 2WAQG 3R2TA 1SNPA 3RUZA 1SR3A 1QUQA 2JA5G 2JP1A 2K32A 5LL6X 2EYHA 2FJ2A 4A3BH 4PMWA 2F0IA 3K5MA 4KLKA 2AMCB 4H0LC 2PQAB 3DM3A 1GD7A 3I72A 1IBLQ 3PIO3 2UUAQ 1QNKA 5M3MG 1XTCD 1ILQA 4QY7A 4GKKL 1EEID 4QGUA 2YYZA 2ZXRA 4HSPA 4AYBB 4DK3C 1DD2A 4IPHA 3UDFA 1SJED 1LM0A 4POFA 3GV3A 1PH2A 1I6HH 1S5DD 5C44B 1G8ZD 5H1SE 4DV5L 3HOXH 3HOZH 5JEAG 5C0XI 2RDFA 3STBD 4OWWB 1JR0D 4DR6L 1K73C 1VQMA 2KHIA 2KEDA 5FLMG 3C3LA 2B2WC 4B3ML 4IUQA 3M4OB 2E2IB 1X3GA 3P1HA 4EVOA 1LT4D 1Q8KA 2E2DC 1GOZA 1L1OC 1XXGA 4CDDC 5BN4A 5IYDH 5DNFA 1PTOC 3Q24A 3PO3B 4C3IG 3S15H 4BBRG 2JE6I 2BH8A 4M1UB 1VQKA 5IOCA 1PFSA 4UDUC 1EWIA 5IY0A 1YNJD 4KD4A 5HY6A 3ONAB 4GNXA 4WJ3M 3U4VA 1RF2D 3CRLC 5FJ8G 1SNDA 3S1NB 1SE3A 4FF4A 1A2UA 3K8AA 1VQNA 3KBXA 1ZEQX 3K7AB 2QEXA 3RZDH 4RKLA 1VQJA 1DONA 1B8AA 3SEBA 1D5ZC 3U50C 5BN5A 4N8FA 1N33Q 1VQBA 2MFIA 3VR2A 4XQJA 1STHA 3FKIG 2WIIB 5IWAL 4HJ7A 1A3TA 3MC0B 1HPCA 1NMGA 4GNXB 5FLXc 1XWEA 4EQPA 4EQNA 5A2QE 5DM73 2K5WA 3J7AF 3DXJC 1QE6A 3H09A 3NBHB 3L9AX 3NHHA 2A74C 5C4XG 2KEEA 1F9RA 4OEMB 1R9TB 2UUBL 1JWMD 2AKWB 5GQOA 1ESRA 4JK1C 1EY7A 3NP8A 4JBWA 5C44G 4LF8L 3V96A 1DZ1A 2CVRA 3K59A 1FL0A 4A3IH 4XT3B 2VQFQ 2R7DA 1BQQT 5EKIA 4DV1Q 1TY2A 1VCIA 4V190 3S1QB 3RR5A 1I4XA 4DR4Q 1STGA 5EKLA 4A3DH 2IPKD 4B3RQ 1HZ9A 1Y1WB 4H02A 1VQPA 1EIYB 3IL8A 4LMQD 3SK8A 1GUTA 3PSIA 1GJXA 1SRUA 5FLXE 3RZOB 4A75A 4C1NI 1LTRD 2PCFB 2B2VC 1S5BD 4JI4L 3LNNA 4JOIA 1BBXC 3FP9A 1KXLA 2A69C 4DR3L 2L5TA 3PO2B 3OW2A 1VQHA 2LXKA 3PIPA 3GTGH 2CW0C 3M3YH 1C0AA 3J7A5 3DUZA 2QDBA 1IBML 2RSNA 2OQ0A 4AH6A 1LTLA 5FLMH 1A0IA 5JEAJ 3TDQA 3EROA 1UE5A 3OMCA 1F2YA 1SN8A 2JN4A 5C4HA 2VXWA 3E6ZX 4RKBA 3K7UC 1OXSC 3KK7A 1AN8A 1B44D 5IGGA 2D0OA 3CMAA 3RLOA 1ONLA 1HQRD 1EWCA 5M3MH 4HCEA 4A4IA 5C3EG 3M7NA 3J81c 2EDGA 1BXTA 2K03A 2N8NA 3GD7A 2TSSA 2F0GA 5M5XB 1FVIA 3HOXB 2IX0A 4NPSA 1G91A 2MP1A 2KCMA 3KF6B 4P2CB 2B63G
chains in the Genus database with same CATH topology
3K6OA 1JJCB 5E7NA 3CKIB 3K80C 1UUPA 3NTKA 3D6WA 1CKNB 4U68A 1PH4A 1STAA 2VZAA 4YHHQ 3KOJA 1H9JA 2YTXA 4IUTA 3NK9A 2K75A 3SXHA 1Q7YC 4FXDA 1EQRA 3JAML 2R92G 4L5QA 3HKZE 1AH9A 2PW5A 2K14A 1PH5A 1XTDA 1JB3A 1TS5A 4A3BB 3ULJA 1R9TH 1CKNA 4QL5A 3GV6A 2AHOB 3A56A 2F0WA 1DYQA 4ME3A 1BDOA 4QB4A 4DV0L 2UU9L 3TZUA 4A3KH 1SMYD 1TVXA 1E2ZA 1XMOQ 1I3QB 2PQEA 1KD1C 4DV7L 4EQ5A 3CPWA 1CTMA 1RTOA 4ZKCB 2CHBD 5M5WH 2R93B 2QEJC 3HOVG 2A73B 3CP0A 4FYDA 2JA5B 1Z7TA 4DUZL 2JA7B 4AYBE 3S2HB 4A3MB 3R93A 2PO4A 5IP9G 4ULLA 4AQYQ 2NVXB 2NVQB 3TP8A 4GKKQ 4Q5VA 1L0XB 4X65Q 2PMZE 3NPPA 1YJNA 4YY3Q 1NR4A 2EY2A 4GNXC 4A3MG 4P73A 2B2UC 2EYLA 3ERSX 3FPUB 2NYZD 5EQ0A 4A3IB 4GOPB 4OIJA 3SVMA 2NVTB 4BA2I 5JVH3 1JB7A 1E3PA 2ZM6L 1GUSA 1I4GA 2AQ3B 4K5XA 2E2HB 2IWHA 3BVZA 3LGJA 1LUZA 4JI4Q 3R3OA 1H9MA 4KD3A 3DEOA 2A1AA 4EGVA 4NP5A 2PZTA 2A68C 4KV6A 1Y1WG 3LWEA 1HZCA 3AEVA 1BCPC 1M4VA 1RL2A 4GKJQ 3I4OA 5FO7B 5IGDA 4X62Q 4PMCA 1STNA 3J7ZC 3NTHA 4APVA 4A3BG 2D2CC 2Z8LA 1N34Q 1CZWA 2A69D 2E8GA 1VQ5A 1I5FA 5D65A 1TWHB 3ERQA 1VQ7A 1TKWB 3CRKC 3F2UA 3LWUA 3I4NH 1W6JA 1DXMA 1JCKB 4R4OA 1ZYRC 3S1RH 1II3A 4YCWA 4QIWB 2BCOA 4RH6A 5G3LD 2K5VA 3OPOA 2DUDA 4RHSA 1Q82C 2R6GA 4X3UA 2JA8G 1FYCA 4OHJA 3I7FA 3O13A 3TS2A 3OWFA 1LABA 2HCCA 2IJ0A 3A5ZB 2R93G 4HIMA 5LMNQ 3BZCA 1MGSA 2E2HH 2I46A 2NUCA 3S9WA 3HEJA 3KYHC 1U4LA 3UDGA 3T1YQ 1M1KC 1GHJA 1SDFA 1K83H 4DF7A 2FFKB 5CV8A 2F0KA 4IOCA 3I2ZA 1E22A 3J7AV 5IE8A 2K33A 2JA8B 2EJGC 2X6GA 3QOLA 1EZ8A 4A3MH 4DR4L 5DLQE 1NE3A 1V1QA 3D4RA 5FOBB 2UU9Q 2OXPA 5EJWA 4B3MQ 3I91A 1MI2A 4H13C 5D3IB 4OO1G 4A3JB 2VUMH 2RBMA 1GUWA 1L1OB 4RCOA 1RCVD 5CR3A 1QNUA 2A19A 1PVOA 2RCNA 4DR3Q 1HTPA 2WV6D 4F7XA 3UE0A 1XMQL 2JK8A 5LMNW 3RD4A 3GTPB 2YU9B 3S15B 4G57A 3CCMA 1TWAH 4ABNA 4JV5L 3D8GA 4GN4B 3I4LA 2XRSD 3PIP3 1D2BA 3A7LA 2O5JC 2H5XA 1IBMQ 1A8VA 2LSSA 4N9PA 4G7HC 4KKSA 1WCMH 5M5XH 3HOUH 4HJ5A 5KEEA 1F9PA 3RN2A 4UY8C 1HZAA 4ALPA 1N33L 3S2HH 4A3JG 2UUCL 3VYSA 2B2YA 2Z4HA 3ITPA 3A54A 3KLSA 1K0RA 1BCPB 4RCNA 4MZ9A 2KCCA 4LWCA 2G9DA 4LF5Q 5FKAC 3W2DA 2XIWA 1CM9A 2M00A 4HN7A 4BY1H 1HR0W 3ZJYC 3PUYA 3KLSX 3BZKA 3I55A 2NVQH 1EU4A 4X3KA 4R9WA 5C0XJ 4CKBA 1JORA 3CPFA 1WTWA 5JPNC 2FMMA 4JI1L 2NZ1D 2K5HA 5IYCG 5JOBA 4RGTA 3G71A 4PG3A 3FVQA 3CW2C 3OTOQ 2HT1A 3BYYB 1AZQA 2LS01 2UXDL 1DOLA 1WYDA 3G48A 4A93G 5JJZA 4KI0A 4ZUJA 2B2WA 3IRBA 2K04A 4X3SA 2VL6A 1U4RA 3D4DA 1E24A 1E7ZA 3SGIA 1CT1D 2C5CA 3T1HL 2OWOA 2F3WA 1I4HA 2JA6B 4ZAIA 2C9OA 5I9OA 2AUJD 1KC8C 3I4NB 4LF4L 2VQEL 3K7AH 1LTSD 2MPMA 1MJEA 2NVXH 4B9WA 2IX1A 1GHKA 1S5FD 1HR0Q 1TS4A 1HUMA 5EPLA 2ZJQA 1WTXA 4YCVA 3DWPA 2F0LA 2DGYA 2VQFL 3RLNA 1KRSA 3S2DB 3S1RB 1J5EL 4BXXG 4BBSH 5M3FG 2B63H 4K0KL 4AIMA 2VW9A 3HKZB 3TN2A 5BR8Q 4XIGS 4LUVA 3L2PA 3Q22A 3KF8A 2ICIA 4LFAQ 5I6WA 4NMZA 4Z9CB 2ZJRA 4ZRZA 1MBYA 3J80E 3GTJH 1BVSA 3AFQA 3UDXA 1Y1WH 3CHBD 2UUCQ 3T16A 2H1EA 5J39A 4ZYSA 3H0GB 3PO3G 4I7ZC 1BCPD 4LF7Q 2DY8A 2F0SA 2KCNA 4RGMA 3I70A 2EYFA 3VYTA 4DXFA 1SMXA 3CMEA 3ER0A 3RMHA 1D6EC 3FRPB 2K4KA 5ELNA 4DV3L 3Q0AA 4K6LA 3AYHB 2QKIC 4HJ9A 2UUAL 1X55A 1KAWA 4IN3A 4KHVA 3J81j 3A55A 3OMGA 2OQKA 1T5EA 2PZUA 4H7BA 1YHAA 1SBBB 4A3FG 4JV5Q 1WVLA 1HNWQ 5HGQA 1LT6D 2JSOA 4M8AA 4C3IH 5BN3A 3IAYA 3J80c 2LFNA 1RD9D 1AZPA 3GTQB 5JJKA 3S1QH 4R1JA 2RSOA 3P75A 1LTGD 2Z6KC 1EYGA 4A3FB 2J4XA 5C4ZA 3K81C 4PZ7A 1HCZA 1BO0A 5IODA 5M3MB 3PUWA 3K58A 3PUZA 4RA8A 5ELEA 2K7VA 2JQOA 2JA9A 4JI7Q 4POGA 3H3VI 1ZYRD 2M2LA 2SOBA 4NXNQ 1YZ6A 1PTOD 4TQUS 1GUNA 1JOQA 5EPJA 4NXNL 4GLVB 1PXUA 4BY1G 1EYDA 2E76C 4HEDA 2QF7A 4BXXH 3VR4A 2LY7A 1FJGL 4TSSA 2IX3A 3F1ZA 3KDFA 3HOXG 1PYBA 3S2DH 1KHIA 5EAYA 3CCSA 2PPBC 2VS1A 3U9SA 4LF9Q 4GZYC 2ZM6Q 3HG9A 2NVTH 3HOVB 4P72A 2E5LL 3MXPA 3NBHA 2PW7A 2D62A 2A6HC 2UXBQ 1CSQA 4ODGA 2EJFC 4O2DA 4JYAQ 3K5LA 3JAMi 1O7IA 2YTVA 4C2MH 2B8FA 4C3IB 1KABA 1BR9A 5ELBA 3M9BA 1QCBD 5C3EH 1K8AC 1N34L 3A8IE 1NJIC 3TMEA 1N32L 1ZKOA 3U4ZA 2SEBD 5M3FB 2VB2X 4OWXB 1UE6A 2KCTA 5G3LF 1G6ZA 4BBRH 1BBUA 1G2TA 1M90C 1NY4A 4A3CG 1NSNS 2O5IC 1E1OA 2K01A 5IT9E 1DOMA 2UXCQ 1B70B 1PFMA 1IBKL 1LLRD 3TS0A 4JI8Q 1STEA 1HXYD 1HNWL 1Q3LA 3J80L 1VQ9A 1ENFA 2L11A 1H9SA 3N6RA 5GROA 3HRZC 3QJYA 3L3OC 3S14H 2QILA 1VQGA 3DM1A 2GN5A 5JEAH 1MSHA 4Y7NB 5CORA 4LFAL 4PNYA 4EX5A 4AYBG 2N55A 4J8QA 3H94A 3ICEA 4DR7Q 4DR2L 2J0TD 3S17H 2WINB 5FO9B 1U4MA 5LMUQ 1K8OA 4A3IG 1J5EQ 3NQTA 4LF5L 4LFBL 3C2PA 1BNZA 3W1BA 2NTSA 3Q6SA 5C4XB 2XWBB 4K5VA 3UE1A 2WAQB 5IWAQ 1H9KA 4DGZA 5KIXA 1FD7D 4FNFA 1DJRD 1YI2A 4IFDG 4L8JA 1B7YB 4HR7B 2Q2IA 4TKOB 1YJ9A 2Y0SE 3TRZA 5CV9A 4KY6A 1H95A 1CUKA 4IUNA 3ND9A 5TSSA 3EFXD 1V1PA 5KNBA 4B08A 3NWSA 4QMGA 2K1BA 3SHLA 1GUOA 4DFAA 1JC7A 1X9NA 4IQZA 5M5YH 4A3FH 2K5NA 4L5TA 4R4TA 2ZTCA 1SNOA 2KECA 1YIJA 1MD2D 4I65A 2JYOA 4OL7A 4C1NK 4ZLTF 5LL6S 1PYSB 3S1NH 5E3FA 3IKJA 2F3IA 2F4VL 4CBVA 3E0EA 5J3BA 1I4PA 2BE5C 2IL8A 1VQCA 3G6EA 1YHQA 4QQBX 1EFID 5EBDA 3MZ5A 1KDBA 2RHSB 1FNUA 4MIUA 1V9PA 3OIQA 1SEBD 3UI2A 3VYRA 3VDYA 4G7ZC 3I4NG 1G291 5BR8L 3BU2A 5A35A 2F4VQ 2KHSA 1CHPD 1MKHA 1PHJA 1UNSA 3CD6A 1TWCH 1PFBA 1S4ZA 3OTOL 3EA6A 1X54A 2UUBQ 1KLGD 3KLRA 3W5OA 2ATWA 3CCUA 4IOAA 1I94L 2AWOA 3EBEA 2NWGA 4IUPA 1EUJA 2MQHA 4TVAB 1JJ2A 3I8ZA 4L6TB 3E0JA 4LNQA 1WFQA 1B1ZA 4IJHA 1QILA 3F2CA 3QO2A 4L5SA 1JOKA 1V1PB 3EQLC 3Q8DA 1IW7C 4BBRB 1B4OA 3KUPA 1IYUA 1WCMB 3MEHA 2B29A 1PYWD 1S5ED 3SK6A 5C3XA 1IL8A 2CQAA 3PCOB 1EIFA 1V1OA 1WTOA 1HR0L 3DMUA 1JE5A 2R7ZG 3OOCA 2BDOA 2BA1A 2HUGA 4B9XA 1VQLA 1ENCA 1A3UA 1VQFA 3IFTA 4FF3A 2F0OA 2HDLA 2HIVA 4Y52H 3HOZG 5FO8B 2WB1B 3SDZA 1D8LA 1RODA 5CV7A 4UAIA 3PIOA 1U9RA 3H3VH 2B2VA 3HOVH 1A3VA 3A8JE 4RWSC 4A3GB 4JBKA 1HA5A 3MAQA 1BCPF 1LT3D 1GUGA 2ALYB 1W3SA 4BY7G 2KJXA 1C4QA 2E74C 2LXJA 2R3ZA 5T1GA 2FXQA 1I6VC 1DOKA 2D0PA 4GS3A 3KF8B 4GLXA 2F3VA 4HCSA 1EL0A 1K8GA 3BZDB 1J9OA 4DN4M 1PH6A 3A0JA 2B2UA 2ICEC 1PH7A 3MFGA 1B3AA 4DR2Q 3EVQA 3PF5A 5LMNL 1EY6A 3PGZA 4R4IA 2A6HD 3RN5A 4KTAA 4RGNA 3I90A 3G7LA 2WACA 4P74A 2E75C 1L0YB 2XSCA 3EJIA 4MN3A 4C3HH 4X66Q 4B3SL 1Y1VG 1XNRL 1HRJA 1JT8A 1EY0A 3FPPA 3FKIH 3KFUA 4XQQA 1CK1A 3QB3A 5C4JH 1SNCA 4FO2A 1S3OA 2IHEA 1QB5D 1Y1VB 3MWYW 3IFDA 3EIVA 1M8AA 4K6DA 2F52A 1IZ6A 1TWCB 4ZQ3A 3I4MH 2RDHA 2K50A 4KY5A 4K8JA 3BG3A 1HNZL 5J22A 5AJ3L 1RIPA 1SYDA 1IBKQ 4DR6Q 1PTOB 3CAMA 2NB0A 3LX0A 3B6YA 3GTQH 1CA5A 1IKMA 3HS0C 4OX9L 2GVAA 3C1EA 4PQXA 4XQNA 3L7ZC 4PV1C 3PUVA 5DM63 5LMUL 3QOJA 1EOVA 1FGUA 3S16B 2RHQB 3M3YB 1EWHA 1SMYC 3OW7A 2L55A 3NWTA 4R4QA 3KJPA 1BUVT 1KDAA 5D14A 3H0GH 1KRTA 4O1NA 1CFMA 2RF4A 2I5MX 2F4IA 1PRTB 5GADC 3PF4A 2PNRC 4C3HB 1ENAA 1Q8IA 4YWMA 1X32A 1LTBD 1Q90A 4KN7C 5KRUA 4JI0L 2K28A 2JA6G 4A3LH 4H44C 2DNEA 4K5WA 1S40A 4BA1I 3CXCA 1VQOA 4XT1B 1WTPA 3M4QA 1XX8A 4HTHA 5KYLA 5GAHC 1AE3A 2RDGA 1G2SA 4C56C 1D5MC 3RLFA 3GTJB 3BDOA 2AQ2B 1CSPA 2OT2A 3DEPA 5I4DA 4DV7Q 1AW7A 2NTTA 2CW0D 1JWSD 4CJ2C 3PUXA 1EZ6A 3TSSA 3D3RA 3QG1A 4XXEA 1L2FA 4YWLA 1AFPA 2AQ1B 1Q86C 1SROA 3BYTB 3ULPA 1KIXA 1A6XA 2EZVA 3MA2B 1SE8A 3HP3A 2JA7H 4BBSB 1X3EA 5JJLA 3X3NA 4C3HG 4RMFA 1Q12A 3K0YA 2VY3A 3H3VC 2F0HA 4DV2Q 4IFDI 4E6IA 3I3CA 5DEHA 1T5XD 2ZXOA 3OYYA 5JPMC 1OXXK 1EEFD 4LW1A 3HZXA 4L63B 1BKBA 4JOIC 1J8IA 2PMZB 5CV5A 1E2WA 5IT9c 4LAAA 1EY9A 1CHQD 4QIWE 1YNND 1UEBA 1TS3A 2CKZB 1TIID 4A76A 1PA6A 1TXYA 1EY8A 4HIOA 1PMRA 1L1OA 5HGTA 2KQ3A 4OIKA 4A3KG 2K05A 4XTCS 2EYJA 2ZTEA 1LTID 2E5LQ 2BH2A 4IALA 1E0BA 5C3WA 3T53B 2F03A 3GTOB 3H91A 1X56A 4AQYL 5EBCA 2NN6I 1B53A 5AJ3Q 2CFMA 1Y1VH 2B8GA 3BVMA 3GP7A 1SYFA 4R8IA 1B9MA 1WD0A 1IXRA 4OGQC 2QGQA 1RHPA 4DV4Q 4HIDA 3FKIB 1ET6A 2ES2A 4FF1A 1OXUA 1QVGA 5CV6A 4JI6L 2WKDA 2Q2HA 1MSGA 4WORA 4MHEA 1WI5A 4UP7A 2NN6H 5JAVA 3TZDA 3UDIA 3PV0A 3W3AA 1PZKD 4Y7NH 3F8TA 3GO5A 4OX9Q 3NBIA 1CKMA 2LKVA 4NKLA 1F9SA 1SYCA 5KNCA 1XNQL 2SNMA 3BS1A 5T1IA 2EYMA 4KKUA 2MO1A 3S16H 2WAQE 2V1CC 2KOLA 4LF4Q 1WOCA 2KVMA 4IPGA 1MIUA 3KJOA 1E1TA 5K36G 1EY4A 1O80A 2XRQD 5IP7G 5C4XH 1VQIA 4O0AA 2EVBA 4DUYQ 3PO2G 2E2IH 3P7JA 2EY5A 1U4PA 4LFCL 2K52A 3VR6A 4P71A 4A3CH 1PZJD 2MUYA 5ELDA 1I50H 3C1FA 4IUUA 4HJ8A 3I4MB 3CC7A 1AP0A 2N49A 4A3DG 4LF8Q 1SXTA 1EYAA 2B39A 1NTGA 5IP9H 2B3GA 3SK4A 1F77A 2HHHL 1HA6A 2HIXA 4JI2L 4NXML 4NW2A 3H6MA 3JAMc 4FDBA 1QUQB 1SFOH 4DNRB 2L4NA 4DK1A 4J15A 2XTIA 2L1BA 3VR3A 2EIFA 1PLFA 4BS9A 1D5XC 1O7ZA 4QF4A 3GTKB 3I73A 3GTPH 1KLUD 1VF7A 1SLJA 1C7YA 3MXUA 4KMUC 1LV9A 4KY7A 1PRTF 3MTSA 1JICA 2EE1A 2L9HA 4JC0A 2H4OA 4ZUIA 5I9PA 3HOWB 3R2IA 5DAUA 5CBAE 3K5NA 1S5CD 3S1MB 1H9RA 3CCLA 2PNHA 1O7YA 1UAPA 4PZ6A 4B3RL 4ZKBB 1SAPA 1JJGA 4DAYA 3FEWX 5ELCA 5KYIA 1DGSA 3H15A 2Q8IB 2JA7G 3OIPA 1CA6A 1KL9A 4JI5Q 1JOOA 1PTOF 1RKNA 1IKLA 1C9OA 4CGYB 1HJPA 1SNQA 1EU3A 4CKCA 5CC4A 2L15A 1XPRA 1CZGA 3EN2A 2DN8A 4XDXA 4X64L 4DAYB 2QA4A 2NZHA 3C46A 1RJTA 3I56A 1IBLL 1TU2B 2ZXPA 2UXDQ 3G6JB 3ULLA 1MJCA 2WKCA 3DWQA 1EIGA 4IPCA 3WDNA 3J7YW 4MNOA 1Y8PB 1GXDC 2X69A 3RZDB 3NUCA 4DAPA 3T1HQ 4BY7B 3NXWA 2NZOA 2KBNA 4A3DB 3I4MG 1X3PA 1VQDA 5KNDA 2FMCA 1UE1A 5D3DA 4K2KA 3HFZB 4A3EH 2Z0SA 1QZHA 1TWFB 4C3JG 2JA5H 2JEBI 3KF6A 2I0QA 4YWKA 4JI3L 4GN3B 5IYBH 1STYA 1OTCA 2B63B 4IFDH 3PO2H 2EXDA 2HCIA 3BDLA 1QOHA 1B9NA 4JI6Q 3MFYA 5AFWA 1C8CA 1VF5C 2YU9H 3NQIA 3CQZH 3WOEA 2F0NA 3M4PA 2Q8TA 1N9WA 2PI2A 5ELOA 1CKOA 3CCQA 1LT5D 4JI8L 3F2BA 4LUZA 3BDCA 4A3GH 2GA4B 3S24A 4DV2L 4DV6Q 1HZBA 3M85A 4OONA 2WP8J 2OTJA 1RTNA 2Q8RE 4DV5Q 2F0TA 4GOPC 1PTOH 1Y14B 4R8NA 2NN6G 2B2TA 3DWAA 3AU7A 3MXNA 1PH3A 1B2TA 2A68D 2F0FA 3NE5B 1AE2A 5IYDG 5FK9C 3T1YL 3WOFA 2R93H 2EJMA 4YY3L 2XVSA 3CC2A 4KHPQ 2KENA 2OEOA 4JI0Q 3Q23A 3A5UA 1SE2A 4DR5Q 2OF1A 2IHFA 3AB9A 1NCVA 4JYAL 1TWFH 2SDFA 3AFPA 1G6PA 5K36H 5LHY1 4LF6L 1ILPA 1NAPA 1ASYA 2BE5D 4R4CA 2C35B 3DHQA 4DV4L 1UE7A 4KJNA 2EOTA 1P8LA 3STBC 1EIHA 1NBWA 3SK5A 5IIFA 2WB1E 1I4QA 2EYPA 5GAGC 1IL2A 1FNVA 2ENBA 4B3TQ 1SE4A 1Q81C 2F0QA 4A93H 3U58A 3AMUA 1STBA 1W2BA 3G4SA 5CMDA 4GKJL 1JE4A 1PRTC 1VQ6A 4C3JH 1FGBD 4HIKA 1Z6HA 1QJOA 1XPUA 2CWPA 5IP7H 1I50B 4F87A 2Z6KA 2RQXA 1TWGB 1VDZA 2M9VA 3D0FA 4DPGA 1YITA 2A8VA 4XYOA 4KJOA 1A15A 1K9MC 4A3JH 4YCUA 3QWNA 1HH2P 4JBMA 1KTKA 3J81E 3GTKH 4ZK9B 3CCEA 4CHTB 3NENA 4X62L 4HSVA 3A74A 2PQAA 5M3FH 3V2TA 4YIJA 5F2DA 1TWHH 5CYUA 1HNXL 4G4KA 2E2JH 2N78A 3NSWA 4QCLA 5I6YA 2EQSA 4BY7H 4IJLA 1L0WA 1VMCA 1I4RA 1AEXA 1E2VA 3TEHB 1H9SB 3PMFA 2WB1G 1XMOL 4IURA 4ME5A 4WRDA 3HOZB 3HOYG 3GTGB 4X3TA 1VS0A 1FR3A 1WD1A 5EPKA 5EGTA 3CF5A 2XN9C 1LTTD 4JG2A 2D9UA 4IUVA 1WCMG 1N8RC 3ZYYX 1A62A 3S14B 2EY6A 3D4WA 1JMCA 4DR1L 3CU7A 1HFGA 1BBWA 4MTNA 1XJVA 4EQOA 1JQYD 3MVVA 3QIAA 3R8BA 1X3FA 4V0BA 2K5DA 2A6ED 3VR5A 1YHBA 1QZGA 2KUMA 5E1FA 4DAMA 4WJWA 4LK1C 2PYKA 2OCEA 4X6AH 3HKZG 2NBFA 5J1ZA 1F2LA 1K83B 4GLAC 4K14A 3AQQA 3OHXC 3KBGA 1BOSA 1ML0D 4JI1Q 3L0OA 4KN4C 1K8MA 2L0CA 4BY1B 1YEZA 4C3JB 4RGOS 4F8MA 1WTVA 1TY0A 1A63A 5COYA 3PO3H 2B2YC 4LF6Q 2PZWA 2MJ8A 1N36L 2IT1A 3SR1A 1F2MA 4UP9A 2DNCA 1PRTD 1IYJB 5IGCA 1VQ4A 1NR2A 4DU9A 3CCRA 1UWVA 2R61A 1TWAB 4X66L 1XNRQ 5I2XA 5IGBA 4DUYL 4Q0FA 1EOTA 4JI7L 2F0VA 1C48A 2K6AA 1IYVA 1EYCA 1EQTA 2IW3A 2F0EA 3JAME 1WJJA 2E2JB 4CJ0B 1O7LA 3K57A 3HOYH 3K5OA 3ND8A 3T56B 3SE0A 4HJAA 4N9TA 4PZ8A 5HURA 1PV4A 3WWVA 3MXNB 3W1GA 1X3QA 3J81L 3E5SA 5IGEA 2BOSA 1U0LA 3URYA 3CC4A 1TT2A 2XWJB 1SYBA 3FHWA 1XMQQ 3MHBA 4RFBA 3H0GG 4X64Q 1GM5A 4DV6L 5M5YB 2F0MA 5JVG3 3HOWG 2FINB 4HMJA 2ASBA 2Y0SB 1T9HA 4U673 2JEAI 4DNIA 2TMPA 3OWEB 2Y0SG 2XGTA 5A2QL 1YBYA 1SFOB 2EYOA 4RG1A 4WFN3 4TRDA 2Z4IA 4P75A 1I3QH 1X6OA 1VQAA 1DCZA 1W6KA 1CI3M 4IZ8A 4DXGA 4DV1L 4IO9A 2JA6H 1UEAB 1PH9A 3VA5A 1WTQA 4XYQA 2HQLA 1IHZA 2CWAA 1XNQQ 2F0DA 4DKAC 2F0PA 1TQOA 2LMCB 4A3EB 4DK6C 2A5HA 1YNNC 1HHVA 2G9HD 2ZT9C 2R92B 1J6QA 3HOYB 5K5PA 4UPAA 2WFWA 4ID6A 4GOPA 3TQYA 2EY1A 3T4AC 1I94Q 2F0UA 2EPBA 1SYGA 2UXCL 5C4JB 2OTLA 1QVCA 3HOUG 4JI2Q 4NXMQ 3HGBA 1OXTA 1ET9A 2K5QA 3OSOA 5C5MA 5ISRA 2R7ZB 3A7AB 4QUCA 2B2TC 3CQZB 1SJHD 3N52A 4JI5L 4FF2A 2NVYH 1P16A 4ILWA 1Q46A 1ICWA 4GN5A 5E4XA 1QVFA 1D1KA 1B50A 1CQVA 1RDPD 2MO0A 5IT9L 1YJWA 1LYLA 2VQEQ 2VUMG 5CV4A 4NB3A 5M5WB 1Q1BA 3RZOH 1YNXA 4A3LG 4LFBQ 2RKSA 5IYCH 1FNWA 1XYIA 4FXKC 4NDXA 1D7QA 2F0JA 1DM0B 4QUFA 1Q1EA 4K2LA 4OO1H 2MGSA 1Y69U 5C44H 4FP5D 2KA7A 3KLWA 5IYBG 1SSOA 4G7OC 4DR1Q 1HQMC 1VQ8A 1S72A 3M7GA 2HHHQ 1CQFA 4IFDJ 1O78A 2R7FA 4IPDA 5FLXL 2VUMB 4O42A 3T51B 1KNAA 4QJFA 1WTRA 3K0XA 1KNEA 2JJQA 4A3KB 3TP7A 2PI2E 2CCZA 1YNJC 4DUZQ 3U9OA 3MEFA 1OO9B 2ZTDA 1X65A 3VA7A 5C0XH 1HNXQ 2YV5A 1EFWA 2MNAA 3CCJA 1N36Q 4CKEA 2CQOA 2D5DA 3GQBA 5GAEC 3FMCA 2HQEA 3S1MH 1OXVA 1KDCA 1I6HB 1A2TA 3HOUB 1N32Q 4WJ4A 1LTAD 1SNMA 1VQEA 2RVLA 4LFCQ 1NUCA 1G51A 1HTLD 5EKKA 1V43A 3GDEA 2Q2TA 4OWTB 5M9OA 1K3RA 2KHJA 1EQVA 3TREA 4A3EG 2BDNA 3GTLH 3CCVA 2JA8H 4B3TL 3TP5A 3J80i 1VMPA 4DV0Q 1PFNA 1Z9FA 3NEMA 1Z47A 4LF9L 4J6HA 5C5LA 1TWGH 1HFNA 3GTMB 2IY5B 3DLLA 3TBIB 4KKTA 3D6CA 1V8QA 2DY7A 2R7ZH 3T13A 4LF7L 3E9HA 1QWYA 1FJGQ 3M4YA 3FDTA 2XNAC 2UXBL 1KAAA 5IGFA 4C2MB 3NELA 3RNUA 3J81i 5FJ8H 4DV3Q 2A6EC 4JI3Q 5E4WC 1JWUD 2MHVA 2O2LD 3HOWH 2F1MA 2N3SA 4LUOA 4J1MA 2VNUD 2V4DA 3P20A 1HUNA 1TS2A 4KK7A 4HMIA 4CJ1B 2R92H 5C6AA 4OO1I 5KGUA 1ZXTA 2O4XA 5JJIA 4KHZA 3NTIA 1PZID 1EQQA 2I07B 1GKHA 1YVCA 3BVGA 3JC66 2ZJPA 1R4PB 4K0KQ 1EY5A 2N88A 2YTYA 4DNTB 4DR7L 4KHPL 4PMBA 2Z1CA 1Y8NB 4UP8A 1ESFA 3M4OH 4DK0A 2ID0A 4HAEA 2HDMA 1LO5D 1SYEA 1GO3E 3F2DA 4X65L 2J7ZA 1NMFA 1TR5A 5CBEE 4DA2A 3HKSA 5C0XG 3S17B 2Q2UA 2VB3X 1HNZQ 3GTMH 2QCPX 4JBJA 2L12A 2BA0A 1F2ZA 4RAUC 1Y8OB 4B3SQ 2I5HA 3KDFB 1U5KA 2NVYB 3X3MA 1XPOA 4DR5L 4F88A 2AUKA 4A3GG 4LJZC 4FVMA 5C3EB 4BWGB 5I2YA 4K8IA 5ELFA 5CGKA 4A93B 3A8KE 2EXZA 1QG7A 1LACA 2I5LX 4YHHL 1KQSA 2JXMB 2RA4A 4RHRA 2AWNA 3D31A 4JCVE 4BBSG 4DAVA 1R4QB 2SNSA 1ASZA 3BJUA 3MXGA 1IW7D 2FHTA 4S3SA 3V05A 1PH1A 2X6LA 4FXGC 1BF4A 1GVPA 3GTOH 5NUCA 4OXPA 4L5RC 3VYUA 3GTLB 1F9QA 2GVBA 3TP6A 3E9IA 1PDQA 1PH8A 1D1IA 2WAQG 3R2TA 1SNPA 3RUZA 1SR3A 1QUQA 2JA5G 2JP1A 2K32A 5LL6X 2EYHA 2FJ2A 4A3BH 4PMWA 2F0IA 3K5MA 4KLKA 2AMCB 4H0LC 2PQAB 3DM3A 1GD7A 1IBLQ 3I72A 3PIO3 2UUAQ 1QNKA 5M3MG 1XTCD 1ILQA 4QY7A 4GKKL 1EEID 4QGUA 2YYZA 2ZXRA 4DK3C 4HSPA 4AYBB 1DD2A 4IPHA 3UDFA 1SJED 1LM0A 4POFA 3GV3A 1PH2A 1I6HH 1S5DD 5C44B 1G8ZD 5H1SE 4DV5L 3HOXH 3HOZH 5JEAG 5C0XI 2RDFA 3STBD 4OWWB 1JR0D 4DR6L 1K73C 1VQMA 2KHIA 2KEDA 5FLMG 3C3LA 2B2WC 4B3ML 4IUQA 3M4OB 2E2IB 1X3GA 3P1HA 4EVOA 1LT4D 1Q8KA 2E2DC 1GOZA 1L1OC 1XXGA 5BN4A 5IYDH 5DNFA 1PTOC 3Q24A 3PO3B 3S15H 4C3IG 4BBRG 2JE6I 2BH8A 4M1UB 1VQKA 5IOCA 1PFSA 4UDUC 1EWIA 5IY0A 1YNJD 4KD4A 5HY6A 4WJ3M 4GNXA 3ONAB 3U4VA 1RF2D 3CRLC 5FJ8G 1SNDA 3S1NB 1SE3A 4FF4A 1A2UA 3K8AA 1VQNA 3KBXA 1ZEQX 3K7AB 2QEXA 3RZDH 4RKLA 1VQJA 1DONA 1B8AA 3SEBA 1D5ZC 3U50C 5BN5A 1N33Q 1VQBA 2MFIA 3VR2A 4XQJA 1STHA 3FKIG 5IWAL 2WIIB 4HJ7A 1A3TA 3MC0B 1NMGA 1HPCA 4GNXB 5FLXc 1XWEA 4EQPA 4EQNA 5A2QE 5DM73 2K5WA 3J7AF 3DXJC 1QE6A 3H09A 3NBHB 3L9AX 3NHHA 2A74C 5C4XG 2KEEA 1F9RA 2UUBL 1R9TB 1JWMD 2AKWB 5GQOA 1ESRA 4JK1C 4JBWA 4LF8L 1EY7A 5C44G 3NP8A 3V96A 1DZ1A 2CVRA 3K59A 1FL0A 4A3IH 2VQFQ 4XT3B 2R7DA 1BQQT 5EKIA 4DV1Q 1VCIA 1TY2A 4V190 3S1QB 3RR5A 1I4XA 4DR4Q 1STGA 4A3DH 5EKLA 2IPKD 4B3RQ 1HZ9A 1Y1WB 4H02A 1VQPA 1EIYB 3IL8A 4LMQD 3SK8A 1GUTA 3PSIA 1GJXA 1SRUA 5FLXE 3RZOB 4A75A 4C1NI 1LTRD 2PCFB 2B2VC 1S5BD 4JI4L 3LNNA 4JOIA 1BBXC 3FP9A 1KXLA 2A69C 4DR3L 2L5TA 3PO2B 3OW2A 1VQHA 2LXKA 3PIPA 3GTGH 3M3YH 2CW0C 1C0AA 3J7A5 3DUZA 2QDBA 1IBML 2RSNA 2OQ0A 4AH6A 1LTLA 5FLMH 1A0IA 5JEAJ 3TDQA 3EROA 1UE5A 3OMCA 1F2YA 1SN8A 5C4HA 2VXWA 3E6ZX 4RKBA 3K7UC 1OXSC 3KK7A 1AN8A 3CMAA 1B44D 2D0OA 5IGGA 3RLOA 1ONLA 1HQRD 1EWCA 5M3MH 4HCEA 4A4IA 5C3EG 3M7NA 3J81c 2EDGA 1BXTA 2K03A 2N8NA 3GD7A 2TSSA 2F0GA 5M5XB 1FVIA 3HOXB 2IX0A 4NPSA 1G91A 2MP1A 2KCMA 3KF6B 4P2CB 2B63G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KCT A;  4DKA C;  1JJC B;  4BBR H;  5K36 G;  1BBU A;  5E7N A;  3K80 C;  1VQI A;  4O0A A;  4DK6 C;  5C4X H;  1NY4 A;  5IP7 G;  1M90 C;  4A3C G;  4DUY Q;  1CKN B;  1J6Q A;  1PH4 A;  3PO2 G;  1E1O A;  2E2I H;  4UPA A;  2VZA A;  2WFW A;  4YHH Q;  3KOJ A;  4GOP A;  3TQY A;  4LFC L;  2UXC Q;  1B70 B;  2K52 A;  2YTX A;  4P71 A;  1IBK L;  4A3C H;  1I94 Q;  3TS0 A;  2K75 A;  1Q7Y C;  2UXC L;  4JI8 Q;  1I50 H;  2OTL A;  1QVC A;  1EQR A;  3HOU G;  2R92 G;  4L5Q A;  4JI2 Q;  4HJ8 A;  3HKZ E;  1VQ9 A;  1OXT A;  2K14 A;  1PH5 A;  4NXM Q;  1AH9 A;  1XTD A;  3ULJ A;  3CC7 A;  2N49 A;  5GRO A;  4A3D G;  1R9T H;  4LF8 Q;  3S14 H;  1VQG A;  1NTG A;  5IP9 H;  1CKN A;  2B3G A;  2GN5 A;  4QL5 A;  2AHO B;  4JI5 L;  2HHH L;  2HIX A;  4JI2 L;  4NXM L;  4LFA L;  2NVY H;  3JAM c;  4EX5 A;  1P16 A;  1QUQ B;  4FDB A;  4ME3 A;  4AYB G;  1Q46 A;  1SFO H;  4DV0 L;  2UU9 L;  4GN5 A;  4J15 A;  4DR2 L;  2XTI A;  3ICE A;  4DR7 Q;  2EIF A;  4A3K H;  3S17 H;  1XMO Q;  1QVF A;  1KD1 C;  4DV7 L;  4EQ5 A;  3GTP H;  1SLJ A;  1C7Y A;  2MO0 A;  3CPW A;  5LMU Q;  1YJW A;  1LYL A;  4JC0 A;  2VQE Q;  4A3I G;  4NB3 A;  1J5E Q;  4LF5 L;  2VUM G;  1Q1B A;  4LFB L;  3RZO H;  1YNX A;  3W1B A;  5M5W H;  4A3L G;  3HOV G;  3UE1 A;  4LFB Q;  3CP0 A;  5IYC H;  5IWA Q;  2B63 G;  3CCL A;  4DUZ L;  1D7Q A;  1Q1E A;  4AYB E;  2PNH A;  1YI2 A;  4PZ6 A;  5IP9 G;  4B3R L;  4AQY Q;  5C44 H;  4GKK Q;  4IFD G;  1JJG A;  4X65 Q;  2PMZ E;  3KLW A;  1DGS A;  3H15 A;  1YJN A;  5IYB G;  1B7Y B;  4YY3 Q;  4DR1 Q;  2JA7 G;  2Q2I A;  1VQ8 A;  4GNX C;  1S72 A;  4A3M G;  1KL9 A;  2HHH Q;  4P73 A;  4JI5 Q;  4IFD J;  2R7F A;  1YJ9 A;  3ERS X;  2Y0S E;  4IPD A;  3TRZ A;  1C9O A;  1HJP A;  1CUK A;  1H95 A;  4GOP B;  2L15 A;  4QJF A;  4BA2 I;  1XPR A;  3K0X A;  1JB7 A;  1E3P A;  2JJQ A;  3EN2 A;  4X64 L;  4DAY B;  2ZM6 L;  2QA4 A;  2NZH A;  2PI2 E;  2CCZ A;  3LGJ A;  1LUZ A;  4JI4 Q;  4DUZ Q;  1X9N A;  3MEF A;  3I56 A;  5M5Y H;  1IBL L;  2ZTD A;  1X65 A;  4A3F H;  2A1A A;  2K5N A;  4L5T A;  4R4T A;  2UXD Q;  5JJK A;  2ZTC A;  3ULL A;  1Y1W G;  1HNX Q;  1HZC A;  2YV5 A;  1EFW A;  3AEV A;  1MJC A;  1RL2 A;  2MNA A;  3CCJ A;  4IPC A;  1YIJ A;  1N36 Q;  3I4O A;  4GKJ Q;  2CQO A;  4MNO A;  5GAE C;  1PYS B;  3S1N H;  3T1H Q;  3S1M H;  4X62 Q;  1OXV A;  2NZO A;  2KBN A;  2F3I A;  3J7Z C;  2F4V L;  4APV A;  3I4M G;  3E0E A;  4A3B G;  1VQD A;  1N32 Q;  4WJ4 A;  1N34 Q;  1VQE A;  4LFC Q;  1UE1 A;  2E8G A;  1VQ5 A;  5J3B A;  1G51 A;  1I5F A;  3HFZ B;  4A3E H;  1V43 A;  3GDE A;  2Q2T A;  1VQC A;  2Z0S A;  4OWT B;  3G6E A;  1QZH A;  1VQ7 A;  1YHQ A;  4QQB X;  1K3R A;  3I4N H;  2KHJ A;  2JA5 H;  4R4O A;  2JEB I;  3KF6 A;  2RHS B;  3TRE A;  4A3E G;  3S1R H;  2I0Q A;  4YWK A;  4JI3 L;  4GN3 B;  5IYB H;  3CCV A;  2JA8 H;  1V9P A;  3GTL H;  4YCW A;  1OTC A;  3PO2 H;  4B3T L;  3VDY A;  2EXD A;  3I4N G;  3J80 i;  1G29 1;  5BR8 L;  3BU2 A;  4DV0 Q;  2K5V A;  2F4V Q;  2DUD A;  1Z9F A;  3NEM A;  2R6G A;  1MKH A;  1Z47 A;  1Q82 C;  1PHJ A;  4JI6 Q;  4LF9 L;  2JA8 G;  3CD6 A;  1TWC H;  3I7F A;  1TWG H;  2YU9 H;  3CQZ H;  2IY5 B;  3OTO L;  3DLL A;  3TS2 A;  3M4P A;  3KJO A;  1X54 A;  1N9W A;  4LF7 L;  2PI2 A;  3E9H A;  5ELO A;  2R7Z H;  1CKO A;  3CCQ A;  2UUB Q;  1FJG Q;  2UXB L;  3A5Z B;  3W5O A;  4JI8 L;  3CCU A;  2ATW A;  4IOA A;  4HIM A;  3F2B A;  3NEL A;  4LUZ A;  3BZC A;  5LMN Q;  4A3G H;  1I94 L;  3RNU A;  3J81 i;  2AWO A;  3S24 A;  4DV2 L;  5FJ8 H;  3EBE A;  4DV6 Q;  2E2H H;  1EUJ A;  2MQH A;  1HZB A;  4TVA B;  4OON A;  2WP8 J;  3M85 A;  4DV3 Q;  1JJ2 A;  2OTJ A;  4JI3 Q;  4LNQ A;  3KYH C;  1WFQ A;  4DV5 Q;  4IJH A;  4GOP C;  3F2C A;  4L5S A;  1Y14 B;  3HOW H;  2NN6 G;  3UDG A;  2N3S A;  4LUO A;  3Q8D A;  3T1Y Q;  1M1K C;  2VNU D;  1PH3 A;  1K83 H;  1AE2 A;  5IYD G;  3T1Y L;  2R93 H;  4YY3 L;  2R92 H;  2B29 A;  3CC2 A;  4KHP Q;  4IOC A;  4OO1 I;  3I2Z A;  1E22 A;  5IE8 A;  2KEN A;  1EIF A;  3PCO B;  1HR0 L;  5JJI A;  4KHZ A;  1JE5 A;  2R7Z G;  1EQQ A;  1GKH A;  1YVC A;  4A3M H;  3JC6 6;  5DLQ E;  1NE3 A;  1V1Q A;  2ZJP A;  4JI0 Q;  4DR4 L;  4K0K Q;  2BA1 A;  2YTY A;  3A5U A;  2UU9 Q;  4DR7 L;  4KHP L;  4DR5 Q;  1VQL A;  2IHF A;  4UP8 A;  1VQF A;  4JYA L;  3M4O H;  4B3M Q;  1TWF H;  2HIV A;  2ID0 A;  3AFP A;  4Y52 H;  1G6P A;  3HOZ G;  4OO1 G;  1D8L A;  2VUM H;  3PIO A;  3H3V H;  1L1O B;  4IPG A;  1GO3 E;  3F2D A;  4X65 L;  4LF6 L;  1NMF A;  3HOV H;  2A19 A;  1ASY A;  4JBK A;  1PVO A;  2RCN A;  3HKS A;  4DR3 Q;  4R4C A;  2C35 B;  5C0X G;  2Q2U A;  3UE0 A;  1XMQ L;  2JK8 A;  5LMN W;  1HNZ Q;  4DV4 L;  3GTM H;  1UE7 A;  2ALY B;  1W3S A;  4JBJ A;  3CCM A;  1TWA H;  2BA0 A;  4BY7 G;  4JV5 L;  1P8L A;  3STB C;  4GN4 B;  2HQL A;  4B3S Q;  2I5H A;  3KDF B;  1NBW A;  2H5X A;  1IBM Q;  1U5K A;  2LXJ A;  2FXQ A;  1XPO A;  4DR5 L;  2D0P A;  1A8V A;  2LSS A;  3KF8 B;  4GS3 A;  2WB1 E;  4GLX A;  4A3G G;  1K8G A;  1WCM H;  5M5X H;  3HOU H;  4HJ5 A;  5GAG C;  1PH6 A;  3A0J A;  1IL2 A;  3RN2 A;  1PH7 A;  4UY8 C;  1HZA A;  4ALP A;  1N33 L;  3S2H H;  4A3J G;  2UUC L;  4DR2 Q;  3PF5 A;  4B3T Q;  5LMN L;  3PGZ A;  4R4I A;  2I5L X;  3RN5 A;  1K0R A;  4YHH L;  1KQS A;  1Q81 C;  4A93 H;  4MZ9 A;  2AWN A;  3D31 A;  4JCV E;  3U58 A;  4BBS G;  1W2B A;  3G4S A;  4LWC A;  4P74 A;  1ASZ A;  3BJU A;  4LF5 Q;  4GKJ L;  4C3H H;  4X66 Q;  4B3S L;  1Y1V G;  1PH1 A;  4BY1 H;  1HR0 W;  1XNR L;  3ZJY C;  1JT8 A;  3PUY A;  1GVP A;  3GTO H;  3FKI H;  3KFU A;  4OXP A;  1VQ6 A;  3BZK A;  4C3J H;  4L5R C;  3I55 A;  4HIK A;  2NVQ H;  2GVB A;  1XPU A;  2CWP A;  3E9I A;  5IP7 H;  5C4J H;  2Z6K A;  1PH8 A;  5C0X J;  1S3O A;  2IHE A;  3CPF A;  2WAQ G;  4JI1 L;  1SR3 A;  3D0F A;  4DPG A;  1QUQ A;  2K5H A;  3EIV A;  5IYC G;  1YIT A;  2JA5 G;  3G71 A;  4PG3 A;  2A8V A;  2F52 A;  1IZ6 A;  3CW2 C;  1K9M C;  4A3J H;  3OTO Q;  3I4M H;  4YCU A;  4A3B H;  4PMW A;  2HT1 A;  4KLK A;  2UXD L;  2K50 A;  2AMC B;  1WYD A;  1HH2 P;  2PQA B;  1GD7 A;  3DM3 A;  3G48 A;  4KI0 A;  1IBL Q;  2UUA Q;  1HNZ L;  4JBM A;  5AJ3 L;  1RIP A;  3IRB A;  5M3M G;  3GTK H;  1IBK Q;  4DR6 Q;  2VL6 A;  4QY7 A;  4GKK L;  1E24 A;  1E7Z A;  3SGI A;  3NEN A;  4QGU A;  3CCE A;  3CAM A;  4X62 L;  3B6Y A;  3T1H L;  3A74 A;  2PQA A;  2OWO A;  3GTQ H;  2YYZ A;  5M3F H;  4DK3 C;  4OX9 L;  2GVA A;  4IPH A;  1TWH H;  1HNX L;  3UDF A;  2E2J H;  2N78 A;  1LM0 A;  4POF A;  1KC8 C;  2EQS A;  4BY7 H;  4LF4 L;  2VQE L;  3L7Z C;  3K7A H;  4IJL A;  1L0W A;  1PH2 A;  3PUV A;  1I6H H;  5LMU L;  1MJE A;  2NVX H;  2IX1 A;  1EOV A;  1FGU A;  5H1S E;  3HOX H;  2RHQ B;  5JEA G;  3TEH B;  5C0X I;  4DV5 L;  3HOZ H;  4R4Q A;  3STB D;  2WB1 G;  3KJP A;  1XMO L;  1HR0 Q;  4OWW B;  4DR6 L;  1K73 C;  3H0G H;  4OWX B;  1VQM A;  3HOY G;  2ZJQ A;  1KRT A;  2KHI A;  4YCV A;  2RF4 A;  2I5M X;  2DGY A;  5FLM G;  3RLN A;  2VQF L;  5GAD C;  1KRS A;  3PF4 A;  1VS0 A;  4B3M L;  1X3G A;  4YWM A;  1J5E L;  4BXX G;  4BBS H;  5M3F G;  2B63 H;  1Q8K A;  3CF5 A;  4JI0 L;  1L1O C;  4K0K L;  2JA6 G;  4A3L H;  4AIM A;  5IYD H;  2VW9 A;  1S40 A;  4JG2 A;  4BA1 I;  3CXC A;  5BR8 Q;  4XIG S;  3S15 H;  4BBR G;  2JE6 I;  2BH8 A;  4LUV A;  1VQO A;  1WCM G;  3L2P A;  1VQK A;  1PFS A;  1N8R C;  4LFA Q;  1A62 A;  1EWI A;  3M4Q A;  5IY0 A;  5HY6 A;  5GAH C;  4GNX A;  4WJ3 M;  1AE3 A;  3U4V A;  1JMC A;  2ZJR A;  5FJ8 G;  4DR1 L;  1BBW A;  4MTN A;  3RLF A;  1XJV A;  1CSP A;  3K8A A;  1VQN A;  1X3F A;  3GTJ H;  4DV7 Q;  2QEX A;  1BVS A;  1YHB A;  3AFQ A;  3RZD H;  1VQJ A;  1QZG A;  3UDX A;  4DAM A;  1B8A A;  1Y1W H;  3U50 C;  2UUC Q;  3PUX A;  1N33 Q;  1VQB A;  2MFI A;  2OCE A;  3FKI G;  5IWA L;  1L2F A;  3PO3 G;  4YWL A;  4HJ7 A;  1Q86 C;  1NMG A;  4X6A H;  1SRO A;  3HKZ G;  4GNX B;  5FLX c;  3ULP A;  4LF7 Q;  1KIX A;  4GLA C;  3AQQ A;  1SE8 A;  4JI1 Q;  1SMX A;  3L0O A;  3CME A;  3ER0 A;  2JA7 H;  3NBH B;  1X3E A;  5JJL A;  4RMF A;  1Q12 A;  2K4K A;  2VY3 A;  5ELN A;  4DV3 L;  4DV2 Q;  1YEZ A;  3AYH B;  4IFD I;  4HJ9 A;  5C4X G;  1A63 A;  2UUA L;  1X55 A;  3OYY A;  1KAW A;  3PO3 H;  4LF6 Q;  1OXX K;  2UUB L;  3J81 j;  4LW1 A;  2AKW B;  2OQK A;  5GQO A;  1BKB A;  1N36 L;  1YHA A;  4JBW A;  2IT1 A;  4JOI C;  5C44 G;  4LF8 L;  4UP9 A;  1FL0 A;  4A3I H;  5IT9 c;  2VQF Q;  4A3F G;  2R7D A;  4JV5 Q;  5HGQ A;  1HNW Q;  1IYJ B;  4QIW E;  4DV1 Q;  1VCI A;  1VQ4 A;  4C3I H;  1UEB A;  3RR5 A;  3J80 c;  2CKZ B;  4DR4 Q;  3CCR A;  4A76 A;  1PA6 A;  1UWV A;  1TXY A;  4R1J A;  3S1Q H;  1HZ9 A;  4HIO A;  4A3D H;  4B3R Q;  2Z6K C;  4H02 A;  1L1O A;  1EYG A;  1VQP A;  1EIY B;  4X66 L;  1XNR Q;  3K81 C;  4PZ7 A;  4DUY L;  3PUW A;  4JI7 L;  3PUZ A;  3PSI A;  4A3K G;  4XTC S;  1SRU A;  2JQO A;  2JA9 A;  4A75 A;  4JI7 Q;  4POG A;  1WJJ A;  3H3V I;  2ZTE A;  1HNW L;  2E5L Q;  4JI4 L;  2BH2 A;  3HOY H;  4A93 G;  4JOI A;  3FP9 A;  4NXN Q;  1KXL A;  4DR3 L;  2R93 G;  1YZ6 A;  1X56 A;  3OW2 A;  1VQH A;  4AQY L;  4TQU S;  4HJA A;  2LXK A;  3PIP A;  3GTG H;  3M3Y H;  4NXN L;  4PZ8 A;  2NN6 I;  1C0A A;  4GLV B;  3J7A 5;  5AJ3 Q;  1PV4 A;  2CFM A;  1Y1V H;  4BY1 G;  4BXX H;  3WWV A;  3MXN B;  3W1G A;  1IBM L;  2OQ0 A;  4AH6 A;  1IXR A;  1FJG L;  3F1Z A;  2QGQ A;  3KDF A;  1LTL A;  1U0L A;  5FLM H;  1A0I A;  5JEA J;  1PYB A;  3HOX G;  4DV4 Q;  4HID A;  1KHI A;  5EAY A;  3CCS A;  2ES2 A;  3CC4 A;  3S2D H;  2VS1 A;  3FHW A;  1UE5 A;  1XMQ Q;  1OXU A;  1QVG A;  3H0G G;  4LF9 Q;  4X64 Q;  2ZM6 Q;  1GM5 A;  4JI6 L;  1SN8 A;  2NVT H;  2Q2H A;  4DV6 L;  4P72 A;  3K7U C;  1WI5 A;  3HOW G;  1OXS C;  2E5L L;  4UP7 A;  2ASB A;  1T9H A;  2JEA I;  2D62 A;  3CMA A;  2D0O A;  4DNI A;  2UXB Q;  3RLO A;  3UDI A;  1CSQ A;  3PV0 A;  4O2D A;  2Y0S G;  2XGT A;  1YBY A;  5M3M H;  4JYA Q;  4A4I A;  4Y7N H;  5C3E G;  3JAM i;  3F8T A;  3GO5 A;  4OX9 Q;  3M7N A;  1CKM A;  1O7I A;  2YTV A;  4C2M H;  3J81 c;  4RG1 A;  1XNQ L;  2N8N A;  3GD7 A;  3M9B A;  4P75 A;  1I3Q H;  1X6O A;  5C3E H;  1VQA A;  1FVI A;  1N34 L;  2MO1 A;  1NJI C;  1K8A C;  3S16 H;  1N32 L;  2IX0 A;  4NPS A;  3U4Z A;  2WAQ E;  4DV1 L;  2V1C C;  4IO9 A;  2JA6 H;  1PH9 A;  2KCM A;  4LF4 Q;  1WOC A;  3KF6 B;  2CWA A;  1MIU A;  1XNQ Q;  1UE6 A;  1E1T A; 
#chains in the Genus database with same CATH topology
 3K6O A;  1JJC B;  5E7N A;  3CKI B;  1UUP A;  3K80 C;  3NTK A;  3D6W A;  1CKN B;  4U68 A;  1PH4 A;  1STA A;  2VZA A;  4YHH Q;  3KOJ A;  1H9J A;  2YTX A;  4IUT A;  3NK9 A;  4OEL B;  2K75 A;  3SXH A;  1Q7Y C;  4FXD A;  1EQR A;  3JAM L;  2R92 G;  4L5Q A;  3HKZ E;  1AH9 A;  2PW5 A;  2K14 A;  1PH5 A;  1XTD A;  1JB3 A;  1TS5 A;  4A3B B;  3ULJ A;  1R9T H;  1CKN A;  4QL5 A;  3GV6 A;  2AHO B;  3A56 A;  2F0W A;  1DYQ A;  4ME3 A;  1BDO A;  4QB4 A;  4DV0 L;  2UU9 L;  3TZU A;  1SMY D;  4A3K H;  1TVX A;  1E2Z A;  1XMO Q;  1I3Q B;  2PQE A;  1KD1 C;  4DV7 L;  4EQ5 A;  3CPW A;  1CTM A;  1RTO A;  4ZKC B;  2CHB D;  5M5W H;  2R93 B;  2QEJ C;  3HOV G;  2A73 B;  3CP0 A;  4CDF C;  4FYD A;  2JA5 B;  1Z7T A;  4DUZ L;  2JA7 B;  4AYB E;  3S2H B;  4A3M B;  3R93 A;  2PO4 A;  5IP9 G;  4ULL A;  4AQY Q;  2NVX B;  2NVQ B;  3TP8 A;  4GKK Q;  4Q5V A;  1L0X B;  4X65 Q;  2PMZ E;  3NPP A;  1YJN A;  4YY3 Q;  1NR4 A;  2EY2 A;  4GNX C;  4A3M G;  4P73 A;  2B2U C;  2EYL A;  3ERS X;  3FPU B;  2NYZ D;  5EQ0 A;  4A3I B;  3SVM A;  4OIJ A;  4GOP B;  2NVT B;  4BA2 I;  5JVH 3;  1JB7 A;  1E3P A;  1I4G A;  1GUS A;  2ZM6 L;  2AQ3 B;  4K5X A;  2E2H B;  2IWH A;  3BVZ A;  3LGJ A;  1LUZ A;  4JI4 Q;  3R3O A;  1H9M A;  4KD3 A;  3DEO A;  2A1A A;  4EGV A;  4NP5 A;  2PZT A;  2A68 C;  4KV6 A;  1WTH A;  1Y1W G;  3LWE A;  1BCP C;  1HZC A;  3AEV A;  1M4V A;  1RL2 A;  4GKJ Q;  3I4O A;  5FO7 B;  5IGD A;  4X62 Q;  4PMC A;  1STN A;  3J7Z C;  3NTH A;  4APV A;  4A3B G;  2D2C C;  2Z8L A;  1N34 Q;  1CZW A;  2A69 D;  2E8G A;  1VQ5 A;  1I5F A;  5D65 A;  1TWH B;  3ERQ A;  1TKW B;  3LWU A;  3CRK C;  3F2U A;  1VQ7 A;  3I4N H;  1W6J A;  1DXM A;  1JCK B;  1ZYR C;  4R4O A;  3S1R H;  1II3 A;  4YCW A;  4QIW B;  2BCO A;  4RH6 A;  5G3L D;  2K5V A;  3OPO A;  2DUD A;  4RHS A;  4X3U A;  2R6G A;  1Q82 C;  2JA8 G;  1FYC A;  4OHJ A;  3I7F A;  2DJG C;  3O13 A;  3TS2 A;  3OWF A;  1LAB A;  2HCC A;  2IJ0 A;  3A5Z B;  2R93 G;  4HIM A;  5LMN Q;  3BZC A;  1MGS A;  2E2H H;  2I46 A;  2NUC A;  3S9W A;  3HEJ A;  3KYH C;  1U4L A;  3UDG A;  3T1Y Q;  1GHJ A;  1SDF A;  1M1K C;  1K83 H;  4DF7 A;  2FFK B;  5CV8 A;  2F0K A;  4IOC A;  3I2Z A;  1E22 A;  3J7A V;  5IE8 A;  2K33 A;  2JA8 B;  2EJG C;  2X6G A;  3QOL A;  1EZ8 A;  5FOB B;  4A3M H;  5DLQ E;  1NE3 A;  1V1Q A;  3D4R A;  4DR4 L;  2UU9 Q;  2OXP A;  5EJW A;  4B3M Q;  3I91 A;  3E3X A;  1MI2 A;  4H13 C;  5D3I B;  4OO1 G;  4A3J B;  2VUM H;  2RBM A;  1GUW A;  1L1O B;  4RCO A;  1RCV D;  5CR3 A;  1QNU A;  2A19 A;  1PVO A;  2RCN A;  2WV6 D;  1HTP A;  4F7X A;  4DR3 Q;  3UE0 A;  1XMQ L;  2JK8 A;  5LMN W;  3RD4 A;  3GTP B;  2YU9 B;  3S15 B;  4G57 A;  3CCM A;  1TWA H;  4ABN A;  4JV5 L;  3D8G A;  4GN4 B;  3I4L A;  2XRS D;  3PIP 3;  1D2B A;  3A7L A;  2O5J C;  2H5X A;  1IBM Q;  1A8V A;  2LSS A;  4N9P A;  4G7H C;  4KKS A;  1WCM H;  5M5X H;  3HOU H;  4HJ5 A;  5KEE A;  1F9P A;  3RN2 A;  4UY8 C;  1HZA A;  4ALP A;  1N33 L;  3S2H H;  4A3J G;  2UUC L;  3VYS A;  2B2Y A;  2Z4H A;  3ITP A;  3A54 A;  3KLS A;  1K0R A;  1BCP B;  4RCN A;  4MZ9 A;  2KCC A;  4LWC A;  2G9D A;  5FKA C;  4LF5 Q;  3W2D A;  2XIW A;  1CM9 A;  2M00 A;  4HN7 A;  4BY1 H;  1HR0 W;  3ZJY C;  3PUY A;  3KLS X;  3BZK A;  3I55 A;  2NVQ H;  1EU4 A;  4X3K A;  4R9W A;  4CKB A;  5C0X J;  1JOR A;  3CPF A;  1WTW A;  5JPN C;  2FMM A;  2NZ1 D;  4JI1 L;  2K5H A;  5IYC G;  5JOB A;  4RGT A;  3G71 A;  4PG3 A;  3FVQ A;  3CW2 C;  3OTO Q;  2HT1 A;  3BYY B;  1AZQ A;  2LS0 1;  1DOL A;  2UXD L;  1WYD A;  3G48 A;  4A93 G;  5JJZ A;  4KI0 A;  4ZUJ A;  2B2W A;  3IRB A;  2K04 A;  1NNX A;  4X3S A;  1U4R A;  2VL6 A;  3D4D A;  1E24 A;  1E7Z A;  3SGI A;  4UHV A;  1CT1 D;  2C5C A;  3T1H L;  2OWO A;  1MHW C;  2F3W A;  1I4H A;  2JA6 B;  4ZAI A;  2C9O A;  5I9O A;  2AUJ D;  1KC8 C;  3I4N B;  4LF4 L;  2VQE L;  3K7A H;  1LTS D;  2MPM A;  1MJE A;  4B9W A;  2NVX H;  2IX1 A;  1GHK A;  1S5F D;  1HR0 Q;  1TS4 A;  1HUM A;  5EPL A;  2ZJQ A;  1WTX A;  4YCV A;  3DWP A;  2F0L A;  2DGY A;  2VQF L;  3RLN A;  1KRS A;  3S2D B;  3S1R B;  1J5E L;  4BXX G;  4BBS H;  5M3F G;  2B63 H;  4K0K L;  4AIM A;  2VW9 A;  3HKZ B;  3TN2 A;  5BR8 Q;  4XIG S;  4LUV A;  3L2P A;  3Q22 A;  3KF8 A;  2ICI A;  4LFA Q;  5I6W A;  4NMZ A;  4Z9C B;  2ZJR A;  4ZRZ A;  1MBY A;  3J80 E;  3GTJ H;  1BVS A;  3AFQ A;  3UDX A;  3CHB D;  1Y1W H;  2UUC Q;  3T16 A;  2H1E A;  5J39 A;  4ZYS A;  3H0G B;  3PO3 G;  4I7Z C;  1BCP D;  2DY8 A;  4LF7 Q;  2F0S A;  2KCN A;  4RGM A;  3I70 A;  2EYF A;  3VYT A;  4DXF A;  1SMX A;  3CME A;  3ER0 A;  3RMH A;  1D6E C;  3FRP B;  2K4K A;  5ELN A;  3Q0A A;  4DV3 L;  4K6L A;  3AYH B;  2QKI C;  4HJ9 A;  2UUA L;  1X55 A;  1KAW A;  2RCF A;  4IN3 A;  4KHV A;  3J81 j;  3A55 A;  3OMG A;  1T5E A;  2OQK A;  2PZU A;  4H7B A;  1YHA A;  1SBB B;  4A3F G;  1WVL A;  4JV5 Q;  1HNW Q;  5HGQ A;  1LT6 D;  2JSO A;  4M8A A;  4C3I H;  5BN3 A;  3IAY A;  3J80 c;  2LFN A;  1RD9 D;  1AZP A;  3GTQ B;  5JJK A;  3S1Q H;  3P75 A;  2RSO A;  4R1J A;  1LTG D;  2Z6K C;  1EYG A;  4A3F B;  2J4X A;  5C4Z A;  4JW0 A;  3K81 C;  4PZ7 A;  1HCZ A;  1BO0 A;  5IOD A;  5M3M B;  3PUW A;  3K58 A;  3PUZ A;  4RA8 A;  5ELE A;  2K7V A;  2JQO A;  2JA9 A;  4JI7 Q;  4POG A;  3H3V I;  1ZYR D;  2M2L A;  2SOB A;  4NXN Q;  1YZ6 A;  1PTO D;  4TQU S;  1GUN A;  1JOQ A;  5EPJ A;  4NXN L;  4GLV B;  1PXU A;  4BY1 G;  1EYD A;  2E76 C;  4HED A;  2QF7 A;  3VR4 A;  4BXX H;  2LY7 A;  1FJG L;  4TSS A;  2IX3 A;  3F1Z A;  3KDF A;  3HOX G;  1PYB A;  3S2D H;  1KHI A;  5EAY A;  3CCS A;  2PPB C;  2VS1 A;  3U9S A;  4LF9 Q;  4GZY C;  2ZM6 Q;  3HG9 A;  2NVT H;  3HOV B;  4P72 A;  2E5L L;  3MXP A;  3NBH A;  2PW7 A;  2D62 A;  2A6H C;  2UXB Q;  1CSQ A;  4ODG A;  2EJF C;  4O2D A;  3K5L A;  4JYA Q;  3JAM i;  1O7I A;  2YTV A;  2B8F A;  4C2M H;  4C3I B;  1KAB A;  1BR9 A;  5ELB A;  3M9B A;  1QCB D;  3A8I E;  5C3E H;  1N34 L;  1K8A C;  3TME A;  1NJI C;  1N32 L;  1ZKO A;  3U4Z A;  2SEB D;  5M3F B;  2VB2 X;  4OWX B;  1UE6 A;  2KCT A;  2P5Z X;  5G3L F;  1G6Z A;  4BBR H;  1BBU A;  1G2T A;  1M90 C;  1NY4 A;  4A3C G;  1NSN S;  2O5I C;  1E1O A;  2K01 A;  5IT9 E;  1DOM A;  2UXC Q;  1B70 B;  1PFM A;  1IBK L;  1LLR D;  3TS0 A;  1STE A;  4JI8 Q;  1HXY D;  1HNW L;  1Q3L A;  3J80 L;  1VQ9 A;  1ENF A;  2L11 A;  1H9S A;  3N6R A;  3HRZ C;  3QJY A;  5GRO A;  3L3O C;  2QIL A;  3S14 H;  1VQG A;  3DM1 A;  2GN5 A;  5JEA H;  1MSH A;  4Y7N B;  5COR A;  4LFA L;  4PNY A;  4EX5 A;  4J8Q A;  2N55 A;  4AYB G;  3H94 A;  3ICE A;  2J0T D;  4DR2 L;  4DR7 Q;  3S17 H;  2WIN B;  5FO9 B;  1U4M A;  5LMU Q;  1K8O A;  3NQT A;  4A3I G;  1J5E Q;  4LF5 L;  4LFB L;  3C2P A;  1BNZ A;  3W1B A;  2NTS A;  3Q6S A;  5C4X B;  2XWB B;  4K5V A;  3UE1 A;  2WAQ B;  5IWA Q;  1H9K A;  4DGZ A;  5KIX A;  1FD7 D;  4FNF A;  1DJR D;  1YI2 A;  4IFD G;  4L8J A;  1B7Y B;  4HR7 B;  2Q2I A;  4TKO B;  1YJ9 A;  2Y0S E;  5CV9 A;  3TRZ A;  4KY6 A;  1H95 A;  1CUK A;  4IUN A;  3ND9 A;  5TSS A;  3EFX D;  1V1P A;  5KNB A;  4B08 A;  3NWS A;  4QMG A;  2K1B A;  3SHL A;  1GUO A;  4DFA A;  1JC7 A;  1X9N A;  4IQZ A;  5M5Y H;  4A3F H;  2K5N A;  4L5T A;  4R4T A;  2ZTC A;  1SNO A;  2KEC A;  1YIJ A;  1MD2 D;  4I65 A;  2JYO A;  4OL7 A;  4C1N K;  4ZLT F;  5LL6 S;  1PYS B;  3S1N H;  5E3F A;  3IKJ A;  2F3I A;  2F4V L;  4CBV A;  3E0E A;  5J3B A;  1I4P A;  2BE5 C;  2IL8 A;  1VQC A;  3G6E A;  5EBD A;  1YHQ A;  1EFI D;  4QQB X;  4MTK A;  3MZ5 A;  1KDB A;  2RHS B;  1FNU A;  4MIU A;  2HD3 A;  1V9P A;  3OIQ A;  1SEB D;  3UI2 A;  3VYR A;  4G7Z C;  3VDY A;  3I4N G;  1G29 1;  5BR8 L;  3BU2 A;  5A35 A;  2KHS A;  2F4V Q;  1CHP D;  1MKH A;  1UNS A;  1PHJ A;  3CD6 A;  1TWC H;  1PFB A;  1S4Z A;  3OTO L;  3EA6 A;  1X54 A;  2UUB Q;  1KLG D;  3KLR A;  3W5O A;  2ATW A;  3CCU A;  4IOA A;  1I94 L;  2AWO A;  3EBE A;  2NWG A;  4IUP A;  1EUJ A;  2MQH A;  4TVA B;  1JJ2 A;  3I8Z A;  4L6T B;  3E0J A;  4LNQ A;  1B1Z A;  1WFQ A;  4IJH A;  1QIL A;  3F2C A;  3QO2 A;  4L5S A;  1JOK A;  1V1P B;  3EQL C;  3Q8D A;  1IW7 C;  4BBR B;  1B4O A;  3KUP A;  1IYU A;  1WCM B;  3MEH A;  1PYW D;  1S5E D;  2B29 A;  3SK6 A;  5C3X A;  1IL8 A;  2CQA A;  3PCO B;  1EIF A;  1V1O A;  1WTO A;  3DMU A;  1HR0 L;  1JE5 A;  2R7Z G;  3OOC A;  2BDO A;  2BA1 A;  2HUG A;  4B9X A;  1VQL A;  1ENC A;  1A3U A;  1VQF A;  3IFT A;  4FF3 A;  2F0O A;  2HDL A;  2HIV A;  4Y52 H;  3HOZ G;  5FO8 B;  2WB1 B;  3SDZ A;  1D8L A;  1ROD A;  5CV7 A;  4UAI A;  1K28 A;  3PIO A;  1U9R A;  3H3V H;  2B2V A;  3HOV H;  1A3V A;  3A8J E;  4RWS C;  4A3G B;  4JBK A;  1HA5 A;  3MAQ A;  1BCP F;  1LT3 D;  1GUG A;  1ICF B;  2ALY B;  1W3S A;  4BY7 G;  2KJX A;  1C4Q A;  2E74 C;  2LXJ A;  2R3Z A;  5T1G A;  2FXQ A;  1I6V C;  1DOK A;  2D0P A;  4GS3 A;  3KF8 B;  2F3V A;  4HCS A;  4GLX A;  1EL0 A;  1K8G A;  3BZD B;  1J9O A;  4DN4 M;  1PH6 A;  3A0J A;  2B2U A;  2ICE C;  3MFG A;  1PH7 A;  1B3A A;  3EVQ A;  4DR2 Q;  3PF5 A;  5LMN L;  1EY6 A;  3PGZ A;  2A6H D;  4R4I A;  3RN5 A;  4KTA A;  4RGN A;  3I90 A;  3G7L A;  2WAC A;  4P74 A;  2E75 C;  1L0Y B;  2XSC A;  3EJI A;  4MN3 A;  4C3H H;  4X66 Q;  4B3S L;  1Y1V G;  1XNR L;  1HRJ A;  1EY0 A;  1JT8 A;  3FPP A;  1B3Q A;  3FKI H;  3KFU A;  4XQQ A;  1CK1 A;  3QB3 A;  5C4J H;  1SNC A;  4FO2 A;  1S3O A;  2IHE A;  1QB5 D;  1Y1V B;  3MWY W;  3IFD A;  3EIV A;  1M8A A;  4K6D A;  2F52 A;  1IZ6 A;  1TWC B;  4ZQ3 A;  3I4M H;  2RDH A;  2K50 A;  4KY5 A;  4K8J A;  3BG3 A;  1HNZ L;  5J22 A;  5AJ3 L;  1RIP A;  1SYD A;  1IBK Q;  4DR6 Q;  1PTO B;  2DJF C;  2NB0 A;  3CAM A;  3LX0 A;  3B6Y A;  3GTQ H;  1CA5 A;  1IKM A;  3HS0 C;  4OX9 L;  2GVA A;  3C1E A;  4PQX A;  4XQN A;  3L7Z C;  4PV1 C;  3PUV A;  5DM6 3;  5LMU L;  3QOJ A;  1EOV A;  1FGU A;  3S16 B;  2RHQ B;  3M3Y B;  1EWH A;  1SMY C;  3OW7 A;  2CH4 W;  2L55 A;  3NWT A;  4R4Q A;  3KJP A;  1BUV T;  1KDA A;  5D14 A;  3H0G H;  1KRT A;  4O1N A;  1CFM A;  2RF4 A;  2I5M X;  2F4I A;  1PRT B;  5GAD C;  3PF4 A;  2PNR C;  4C3H B;  1ENA A;  1Q8I A;  4YWM A;  1X32 A;  1LTB D;  1Q90 A;  4KN7 C;  5KRU A;  4JI0 L;  2K28 A;  2JA6 G;  4A3L H;  4H44 C;  2DNE A;  4K5W A;  1S40 A;  4BA1 I;  3CXC A;  2CH4 A;  1VQO A;  4XT1 B;  1WTP A;  3M4Q A;  1XX8 A;  4HTH A;  5KYL A;  5GAH C;  1AE3 A;  2RDG A;  1G2S A;  4C56 C;  1D5M C;  3RLF A;  3GTJ B;  3BDO A;  2AQ2 B;  1CSP A;  2OT2 A;  3DEP A;  5I4D A;  1AW7 A;  4DV7 Q;  2NTT A;  2CW0 D;  1JWS D;  4CJ2 C;  1EZ6 A;  3PUX A;  3TSS A;  3D3R A;  3QG1 A;  4XXE A;  1L2F A;  4ZCK A;  4YWL A;  1AFP A;  2AQ1 B;  1Q86 C;  1SRO A;  3BYT B;  3ULP A;  1KIX A;  1A6X A;  2EZV A;  3MA2 B;  1SE8 A;  3HP3 A;  2JA7 H;  4BBS B;  1X3E A;  3X3N A;  4C3H G;  5JJL A;  4RMF A;  1Q12 A;  3K0Y A;  2VY3 A;  3H3V C;  2F0H A;  4DV2 Q;  4IFD I;  4E6I A;  3I3C A;  5DEH A;  1T5X D;  2ZXO A;  3OYY A;  2G5D A;  5JPM C;  1OXX K;  1EEF D;  4LW1 A;  3HZX A;  4L63 B;  1BKB A;  4JOI C;  1J8I A;  2PMZ B;  5CV5 A;  1E2W A;  5IT9 c;  4LAA A;  1EY9 A;  1CHQ D;  4QIW E;  1YNN D;  1UEB A;  1TS3 A;  2CKZ B;  1TII D;  4A76 A;  1PA6 A;  1TXY A;  1EY8 A;  4HIO A;  1PMR A;  1L1O A;  5HGT A;  2KQ3 A;  4OIK A;  4A3K G;  2K05 A;  4XTC S;  2EYJ A;  1LTI D;  2ZTE A;  2E5L Q;  4IAL A;  5C3W A;  1E0B A;  2F03 A;  3T53 B;  2BH2 A;  3GTO B;  3H91 A;  1X56 A;  4AQY L;  5EBC A;  2NN6 I;  1B53 A;  5AJ3 Q;  2CFM A;  1Y1V H;  2B8G A;  3BVM A;  3GP7 A;  1SYF A;  4R8I A;  1B9M A;  1WD0 A;  1IXR A;  4OGQ C;  2QGQ A;  1RHP A;  4DV4 Q;  4HID A;  3FKI B;  1ET6 A;  2ES2 A;  4FF1 A;  1OXU A;  1QVG A;  5CV6 A;  2WKD A;  4JI6 L;  2Q2H A;  1MSG A;  4WOR A;  4MHE A;  1WI5 A;  2NN6 H;  4UP7 A;  5JAV A;  3TZD A;  3UDI A;  3PV0 A;  3W3A A;  1PZK D;  4Y7N H;  3F8T A;  3GO5 A;  4OX9 Q;  3NBI A;  1CKM A;  2LKV A;  4NKL A;  1F9S A;  1SYC A;  5KNC A;  1XNQ L;  2SNM A;  3BS1 A;  5T1I A;  2EYM A;  4KKU A;  2MO1 A;  3S16 H;  2WAQ E;  2V1C C;  2KOL A;  4LF4 Q;  1WOC A;  2KVM A;  4IPG A;  1MIU A;  1E1T A;  3KJO A;  1O80 A;  1EY4 A;  2XRQ D;  5K36 G;  5IP7 G;  5C4X H;  1VQI A;  4O0A A;  2EVB A;  4DUY Q;  3PO2 G;  2E2I H;  3P7J A;  4JVZ A;  2EY5 A;  1U4P A;  4LFC L;  2K52 A;  3VR6 A;  4P71 A;  4A3C H;  1PZJ D;  2MUY A;  5ELD A;  1I50 H;  3C1F A;  4IUU A;  4HJ8 A;  3I4M B;  3CC7 A;  1AP0 A;  2N49 A;  1SXT A;  4LF8 Q;  4A3D G;  1EYA A;  2B39 A;  1NTG A;  5IP9 H;  2B3G A;  3SK4 A;  1F77 A;  2HHH L;  1HA6 A;  2HIX A;  4JI2 L;  4NXM L;  4NW2 A;  3H6M A;  3JAM c;  4FDB A;  1QUQ B;  1SFO H;  4DNR B;  2L4N A;  4DK1 A;  4J15 A;  2XTI A;  2L1B A;  3VR3 A;  2EIF A;  1PLF A;  4BS9 A;  1D5X C;  1O7Z A;  4QF4 A;  3GTK B;  3I73 A;  1KLU D;  3GTP H;  1VF7 A;  1SLJ A;  3MXU A;  4KMU C;  1C7Y A;  1LV9 A;  4KY7 A;  1PRT F;  3MTS A;  1JIC A;  2EE1 A;  2L9H A;  4JC0 A;  2H4O A;  4ZUI A;  5I9P A;  3HOW B;  3R2I A;  5DAU A;  5CBA E;  3K5N A;  1S5C D;  3S1M B;  1H9R A;  3CCL A;  2PNH A;  1O7Y A;  1UAP A;  4PZ6 A;  4B3R L;  4ZKB B;  1SAP A;  1JJG A;  4DAY A;  3FEW X;  5ELC A;  5KYI A;  1DGS A;  3H15 A;  2Q8I B;  2JA7 G;  3OIP A;  1CA6 A;  1KL9 A;  1JOO A;  4JI5 Q;  1PTO F;  1RKN A;  1IKL A;  1C9O A;  4CGY B;  1HJP A;  1SNQ A;  1EU3 A;  4CKC A;  5CC4 A;  2L15 A;  1XPR A;  1CZG A;  3EN2 A;  2DN8 A;  4XDX A;  4X64 L;  4DAY B;  2QA4 A;  2NZH A;  3C46 A;  1RJT A;  3I56 A;  1IBL L;  1TU2 B;  2ZXP A;  2UXD Q;  3G6J B;  3ULL A;  1MJC A;  2WKC A;  3DWQ A;  1EIG A;  4IPC A;  3WDN A;  3J7Y W;  4MNO A;  1Y8P B;  1GXD C;  2X69 A;  3RZD B;  3NUC A;  4DAP A;  3T1H Q;  4BY7 B;  3NXW A;  2NZO A;  2KBN A;  4A3D B;  3I4M G;  1X3P A;  1VQD A;  5KND A;  2FMC A;  4CDC C;  1UE1 A;  5D3D A;  4K2K A;  3HFZ B;  4A3E H;  2QW7 A;  2Z0S A;  1QZH A;  1TWF B;  4C3J G;  2JA5 H;  2JEB I;  3KF6 A;  2I0Q A;  4YWK A;  4JI3 L;  4GN3 B;  5IYB H;  1STY A;  1OTC A;  2B63 B;  4IFD H;  3PO2 H;  2EXD A;  2HCI A;  3BDL A;  1QOH A;  3PQI A;  1B9N A;  3MFY A;  5AFW A;  1C8C A;  4JI6 Q;  1VF5 C;  2YU9 H;  3NQI A;  3CQZ H;  3WOE A;  2F0N A;  3M4P A;  2Q8T A;  1N9W A;  2PI2 A;  5ELO A;  1CKO A;  3CCQ A;  1LT5 D;  4JI8 L;  3F2B A;  3BDC A;  4LUZ A;  4A3G H;  2GA4 B;  3S24 A;  4DV2 L;  4DV6 Q;  3QR8 A;  1HZB A;  3M85 A;  4OON A;  2WP8 J;  2OTJ A;  1RTN A;  2Q8R E;  4DV5 Q;  2F0T A;  1PTO H;  4GOP C;  1Y14 B;  4R8N A;  2NN6 G;  2B2T A;  3DWA A;  3AU7 A;  3MXN A;  1PH3 A;  1B2T A;  2A68 D;  2F0F A;  3NE5 B;  1AE2 A;  5IYD G;  5FK9 C;  3T1Y L;  3WOF A;  2EJM A;  2R93 H;  4YY3 L;  2XVS A;  3CC2 A;  4KHP Q;  2KEN A;  2OEO A;  4JI0 Q;  3Q23 A;  3A5U A;  1SE2 A;  4DR5 Q;  2OF1 A;  2IHF A;  3AB9 A;  1NCV A;  4JYA L;  1TWF H;  2SDF A;  4JPB W;  3AFP A;  1G6P A;  5K36 H;  5LHY 1;  4LF6 L;  1ILP A;  1NAP A;  1ASY A;  2BE5 D;  4R4C A;  2C35 B;  3DHQ A;  4DV4 L;  1UE7 A;  4KJN A;  2EOT A;  1P8L A;  3STB C;  1EIH A;  1NBW A;  3SK5 A;  5IIF A;  2WB1 E;  1I4Q A;  2EYP A;  5GAG C;  1IL2 A;  1FNV A;  2ENB A;  1SE4 A;  4B3T Q;  2F0Q A;  1Q81 C;  4A93 H;  3U58 A;  3AMU A;  1STB A;  1W2B A;  3G4S A;  5CMD A;  4GKJ L;  1JE4 A;  1PRT C;  1VQ6 A;  4C3J H;  1FGB D;  4HIK A;  1Z6H A;  1QJO A;  1XPU A;  1I50 B;  2CWP A;  5IP7 H;  4F87 A;  2Z6K A;  2RQX A;  1TWG B;  1VDZ A;  2M9V A;  3D0F A;  4XYO A;  4DPG A;  1YIT A;  2A8V A;  4KJO A;  1A15 A;  1K9M C;  4A3J H;  4YCU A;  3QWN A;  1HH2 P;  4JBM A;  1KTK A;  3J81 E;  3GTK H;  4ZK9 B;  3CCE A;  4CHT B;  3NEN A;  4X62 L;  4HSV A;  3A74 A;  2PQA A;  5M3F H;  3V2T A;  4YIJ A;  5F2D A;  1TWH H;  5CYU A;  1HNX L;  4G4K A;  2E2J H;  2N78 A;  3NSW A;  4QCL A;  5I6Y A;  2EQS A;  4BY7 H;  4IJL A;  1VMC A;  1L0W A;  1I4R A;  1AEX A;  1E2V A;  3TEH B;  1H9S B;  3PMF A;  2WB1 G;  4IUR A;  4ME5 A;  4WRD A;  1XMO L;  3HOZ B;  3HOY G;  3GTG B;  4X3T A;  1VS0 A;  1FR3 A;  1WD1 A;  5EPK A;  5EGT A;  3CF5 A;  2XN9 C;  1LTT D;  4JG2 A;  2D9U A;  4IUV A;  1WCM G;  1N8R C;  3ZYY X;  1A62 A;  3S14 B;  2EY6 A;  3D4W A;  1JMC A;  4DR1 L;  3CU7 A;  1HFG A;  1BBW A;  4MTN A;  4EQO A;  1XJV A;  1JQY D;  3MVV A;  3QIA A;  3R8B A;  1X3F A;  4V0B A;  2K5D A;  2A6E D;  3VR5 A;  1YHB A;  1QZG A;  2KUM A;  5E1F A;  4DAM A;  4WJW A;  4LK1 C;  2PYK A;  2OCE A;  4X6A H;  3HKZ G;  2NBF A;  5J1Z A;  1F2L A;  1K83 B;  4GLA C;  4K14 A;  3AQQ A;  3OHX C;  3KBG A;  1BOS A;  1ML0 D;  4JI1 Q;  3L0O A;  4KN4 C;  1K8M A;  2L0C A;  4BY1 B;  1YEZ A;  4C3J B;  2Z6B A;  4RGO S;  4F8M A;  1WTV A;  1TY0 A;  1A63 A;  5COY A;  3PO3 H;  2B2Y C;  4LF6 Q;  2PZW A;  2MJ8 A;  1N36 L;  2IT1 A;  3SR1 A;  1F2M A;  2DNC A;  4UP9 A;  1PRT D;  1IYJ B;  5IGC A;  1VQ4 A;  1NR2 A;  4DU9 A;  3CCR A;  1UWV A;  2R61 A;  1TWA B;  4X66 L;  5I2X A;  5IGB A;  1XNR Q;  4DUY L;  4Q0F A;  1EOT A;  2F0V A;  4JI7 L;  1C48 A;  2K6A A;  1IYV A;  1EYC A;  1EQT A;  2IW3 A;  2F0E A;  3JAM E;  1WJJ A;  2E2J B;  4CJ0 B;  1O7L A;  3K57 A;  3HOY H;  3K5O A;  3ND8 A;  3T56 B;  3SE0 A;  4HJA A;  4N9T A;  4PZ8 A;  5HUR A;  1PV4 A;  3WWV A;  3MXN B;  3W1G A;  1X3Q A;  3J81 L;  3E5S A;  5IGE A;  2BOS A;  1U0L A;  3URY A;  3CC4 A;  1TT2 A;  2XWJ B;  1SYB A;  3FHW A;  1XMQ Q;  3MHB A;  4RFB A;  3H0G G;  4X64 Q;  1GM5 A;  4DV6 L;  5M5Y B;  2F0M A;  5JVG 3;  2FIN B;  3HOW G;  4HMJ A;  2Y0S B;  2ASB A;  1T9H A;  4U67 3;  2JEA I;  4DNI A;  2TMP A;  3OWE B;  2Y0S G;  2XGT A;  5A2Q L;  1YBY A;  1SFO B;  2EYO A;  4RG1 A;  4WFN 3;  4TRD A;  2Z4I A;  4P75 A;  1I3Q H;  1X6O A;  1VQA A;  1DCZ A;  1W6K A;  1CI3 M;  4IZ8 A;  4DXG A;  4DV1 L;  4IO9 A;  2JA6 H;  1UEA B;  1PH9 A;  3VA5 A;  1WTQ A;  4XYQ A;  2CWA A;  2F0D A;  2HQL A;  1IHZ A;  1XNQ Q;  4DKA C;  2F0P A;  1TQO A;  2LMC B;  4A3E B;  4DK6 C;  2A5H A;  1YNN C;  1HHV A;  2G9H D;  2ZT9 C;  2R92 B;  1J6Q A;  3HOY B;  5K5P A;  4UPA A;  2WFW A;  4ID6 A;  4GOP A;  3TQY A;  2EY1 A;  3T4A C;  1I94 Q;  2F0U A;  2EPB A;  1SYG A;  2UXC L;  5C4J B;  2OTL A;  1QVC A;  3HOU G;  4JI2 Q;  4NXM Q;  3HGB A;  1OXT A;  1ET9 A;  2K5Q A;  3OSO A;  5C5M A;  5ISR A;  2R7Z B;  3A7A B;  4QUC A;  4N8X 1;  2B2T C;  3CQZ B;  1SJH D;  3N52 A;  4JI5 L;  4FF2 A;  2NVY H;  4CDE C;  1P16 A;  4ILW A;  1Q46 A;  1ICW A;  4GN5 A;  5E4X A;  1D1K A;  1QVF A;  1B50 A;  1CQV A;  1RDP D;  2MO0 A;  5IT9 L;  1YJW A;  1LYL A;  5CV4 A;  2VQE Q;  5M5W B;  4NB3 A;  2VUM G;  1Q1B A;  3RZO H;  1YNX A;  4A3L G;  4LFB Q;  2RKS A;  1FNW A;  5IYC H;  1XYI A;  4FXK C;  4NDX A;  1D7Q A;  2F0J A;  1DM0 B;  4QUF A;  1Q1E A;  4K2L A;  4OO1 H;  2MGS A;  1Y69 U;  5C44 H;  4FP5 D;  2KA7 A;  3KLW A;  5IYB G;  1SSO A;  4G7O C;  1HQM C;  4DR1 Q;  1VQ8 A;  1S72 A;  3M7G A;  2HHH Q;  1CQF A;  4IFD J;  1O78 A;  2R7F A;  4IPD A;  5FLX L;  2VUM B;  4O42 A;  3T51 B;  1KNA A;  4QJF A;  1WTR A;  3K0X A;  1KNE A;  2JJQ A;  4A3K B;  3TP7 A;  2PI2 E;  1YNJ C;  2CCZ A;  4DUZ Q;  3U9O A;  3MEF A;  1OO9 B;  1X65 A;  2ZTD A;  3VA7 A;  5C0X H;  1HNX Q;  2YV5 A;  1EFW A;  2MNA A;  3CCJ A;  1N36 Q;  4CKE A;  2CQO A;  2D5D A;  3GQB A;  5GAE C;  3FMC A;  2HQE A;  3S1M H;  1OXV A;  1KDC A;  1I6H B;  1A2T A;  3HOU B;  1N32 Q;  1LTA D;  4WJ4 A;  1SNM A;  1VQE A;  2RVL A;  1NUC A;  4LFC Q;  1G51 A;  1HTL D;  5EKK A;  1V43 A;  3GDE A;  2Q2T A;  4OWT B;  5M9O A;  1K3R A;  2KHJ A;  1EQV A;  3TRE A;  4A3E G;  2BDN A;  3GTL H;  3CCV A;  2JA8 H;  4B3T L;  3TP5 A;  3J80 i;  1VMP A;  4DV0 Q;  1PFN A;  1Z9F A;  3NEM A;  1Z47 A;  4J6H A;  5C5L A;  4LF9 L;  1TWG H;  1HFN A;  3GTM B;  2IY5 B;  3TBI B;  3DLL A;  4KKT A;  2Z9H A;  1V8Q A;  2DY7 A;  3D6C A;  3T13 A;  4LF7 L;  3E9H A;  2R7Z H;  5L37 A;  1QWY A;  3M4Y A;  1FJG Q;  3FDT A;  2XNA C;  2UXB L;  1KAA A;  5IGF A;  4C2M B;  3NEL A;  3RNU A;  3J81 i;  5FJ8 H;  4DV3 Q;  2A6E C;  4JI3 Q;  5E4W C;  1JWU D;  2MHV A;  2O2L D;  3HOW H;  2F1M A;  2N3S A;  4J1M A;  4LUO A;  2VNU D;  2V4D A;  3P20 A;  1HUN A;  1TS2 A;  4KK7 A;  4HMI A;  4CJ1 B;  2R92 H;  5C6A A;  5KGU A;  4OO1 I;  1ZXT A;  2O4X A;  5JJI A;  4KHZ A;  3NTI A;  1PZI D;  2I07 B;  1EQQ A;  1GKH A;  1YVC A;  3BVG A;  1R4P B;  3JC6 6;  1EY5 A;  2ZJP A;  4K0K Q;  2N88 A;  2YTY A;  4DNT B;  4DR7 L;  4KHP L;  4PMB A;  2Z1C A;  1Y8N B;  4UP8 A;  1ESF A;  3M4O H;  4DK0 A;  2ID0 A;  4HAE A;  2HDM A;  1LO5 D;  1SYE A;  1GO3 E;  2J7Z A;  4X65 L;  3F2D A;  1NMF A;  1TR5 A;  5CBE E;  4DA2 A;  3HKS A;  5C0X G;  3S17 B;  2Q2U A;  2VB3 X;  1HNZ Q;  3GTM H;  2QCP X;  4JBJ A;  2L12 A;  1F2Z A;  2BA0 A;  4RAU C;  1Y8O B;  4B3S Q;  2I5H A;  3KDF B;  1U5K A;  2NVY B;  3X3M A;  4F88 A;  4DR5 L;  1XPO A;  2AUK A;  4A3G G;  4LJZ C;  4FVM A;  5C3E B;  4BWG B;  1K0S A;  4I7A A;  5I2Y A;  4K8I A;  1K3B C;  5ELF A;  5CGK A;  4A93 B;  3A8K E;  2EXZ A;  1QG7 A;  1LAC A;  2I5L X;  4YHH L;  1KQS A;  2JXM B;  2RA4 A;  4RHR A;  2AWN A;  3D31 A;  4JCV E;  4BBS G;  4DAV A;  1R4Q B;  2SNS A;  3MXG A;  3BJU A;  1ASZ A;  1IW7 D;  2FHT A;  4S3S A;  3V05 A;  4FXG C;  2X6L A;  1PH1 A;  1BF4 A;  1GVP A;  3GTO H;  5NUC A;  4OXP A;  4L5R C;  3VYU A;  3GTL B;  1F9Q A;  2GVB A;  3TP6 A;  3E9I A;  1PDQ A;  1PH8 A;  2QDL A;  1D1I A;  2WAQ G;  3R2T A;  1SNP A;  3RUZ A;  1SR3 A;  1QUQ A;  2JA5 G;  2JP1 A;  2K32 A;  5LL6 X;  2EYH A;  2FJ2 A;  4A3B H;  4PMW A;  2F0I A;  3K5M A;  4KLK A;  2AMC B;  4H0L C;  2PQA B;  3DM3 A;  1GD7 A;  3I72 A;  1IBL Q;  3PIO 3;  2UUA Q;  1QNK A;  5M3M G;  1XTC D;  1ILQ A;  4QY7 A;  4GKK L;  1EEI D;  4QGU A;  2YYZ A;  2ZXR A;  4HSP A;  4AYB B;  4DK3 C;  1DD2 A;  4IPH A;  3UDF A;  1SJE D;  1LM0 A;  4POF A;  3GV3 A;  1PH2 A;  1I6H H;  1S5D D;  5C44 B;  1G8Z D;  5H1S E;  4DV5 L;  3HOX H;  3HOZ H;  5JEA G;  5C0X I;  2RDF A;  3STB D;  4OWW B;  1JR0 D;  4DR6 L;  1K73 C;  1VQM A;  2KHI A;  2KED A;  5FLM G;  3C3L A;  2B2W C;  4B3M L;  4IUQ A;  3M4O B;  2E2I B;  1X3G A;  3P1H A;  4EVO A;  1LT4 D;  1Q8K A;  2E2D C;  1GOZ A;  1L1O C;  1XXG A;  4CDD C;  5BN4 A;  5IYD H;  5DNF A;  1PTO C;  3Q24 A;  3PO3 B;  4C3I G;  3S15 H;  4BBR G;  2JE6 I;  2BH8 A;  4M1U B;  1VQK A;  5IOC A;  1PFS A;  4UDU C;  1EWI A;  5IY0 A;  1YNJ D;  4KD4 A;  5HY6 A;  3ONA B;  4GNX A;  4WJ3 M;  3U4V A;  1RF2 D;  3CRL C;  5FJ8 G;  1SND A;  3S1N B;  1SE3 A;  4FF4 A;  1A2U A;  3K8A A;  1VQN A;  3KBX A;  1ZEQ X;  3K7A B;  2QEX A;  3RZD H;  4RKL A;  1VQJ A;  1DON A;  1B8A A;  3SEB A;  1D5Z C;  3U50 C;  5BN5 A;  4N8F A;  1N33 Q;  1VQB A;  2MFI A;  3VR2 A;  4XQJ A;  1STH A;  3FKI G;  2WII B;  5IWA L;  4HJ7 A;  1A3T A;  3MC0 B;  1HPC A;  1NMG A;  4GNX B;  5FLX c;  1XWE A;  4EQP A;  4EQN A;  5A2Q E;  5DM7 3;  2K5W A;  3J7A F;  3DXJ C;  1QE6 A;  3H09 A;  3NBH B;  3L9A X;  3NHH A;  2A74 C;  5C4X G;  2KEE A;  1F9R A;  4OEM B;  1R9T B;  2UUB L;  1JWM D;  2AKW B;  5GQO A;  1ESR A;  4JK1 C;  1EY7 A;  3NP8 A;  4JBW A;  5C44 G;  4LF8 L;  3V96 A;  1DZ1 A;  2CVR A;  3K59 A;  1FL0 A;  4A3I H;  4XT3 B;  2VQF Q;  2R7D A;  1BQQ T;  5EKI A;  4DV1 Q;  1TY2 A;  1VCI A;  4V19 0;  3S1Q B;  3RR5 A;  1I4X A;  4DR4 Q;  1STG A;  5EKL A;  4A3D H;  2IPK D;  4B3R Q;  1HZ9 A;  1Y1W B;  4H02 A;  1VQP A;  1EIY B;  3IL8 A;  4LMQ D;  3SK8 A;  1GUT A;  3PSI A;  1GJX A;  1SRU A;  5FLX E;  3RZO B;  4A75 A;  4C1N I;  1LTR D;  2PCF B;  2B2V C;  1S5B D;  4JI4 L;  3LNN A;  4JOI A;  1BBX C;  3FP9 A;  1KXL A;  2A69 C;  4DR3 L;  2L5T A;  3PO2 B;  3OW2 A;  1VQH A;  2LXK A;  3PIP A;  3GTG H;  2CW0 C;  3M3Y H;  1C0A A;  3J7A 5;  3DUZ A;  2QDB A;  1IBM L;  2RSN A;  2OQ0 A;  4AH6 A;  1LTL A;  5FLM H;  1A0I A;  5JEA J;  3TDQ A;  3ERO A;  1UE5 A;  3OMC A;  1F2Y A;  1SN8 A;  2JN4 A;  5C4H A;  2VXW A;  3E6Z X;  4RKB A;  3K7U C;  1OXS C;  3KK7 A;  1AN8 A;  1B44 D;  5IGG A;  2D0O A;  3CMA A;  3RLO A;  1ONL A;  1HQR D;  1EWC A;  5M3M H;  4HCE A;  4A4I A;  5C3E G;  3M7N A;  3J81 c;  2EDG A;  1BXT A;  2K03 A;  2N8N A;  3GD7 A;  2TSS A;  2F0G A;  5M5X B;  1FVI A;  3HOX B;  2IX0 A;  4NPS A;  1G91 A;  2MP1 A;  2KCM A;  3KF6 B;  4P2C B;  2B63 G; 
#chains in the Genus database with same CATH homology
 3K6O A;  1JJC B;  5E7N A;  3CKI B;  3K80 C;  1UUP A;  3NTK A;  3D6W A;  1CKN B;  4U68 A;  1PH4 A;  1STA A;  2VZA A;  4YHH Q;  3KOJ A;  1H9J A;  2YTX A;  4IUT A;  3NK9 A;  2K75 A;  3SXH A;  1Q7Y C;  4FXD A;  1EQR A;  3JAM L;  2R92 G;  4L5Q A;  3HKZ E;  1AH9 A;  2PW5 A;  2K14 A;  1PH5 A;  1XTD A;  1JB3 A;  1TS5 A;  4A3B B;  3ULJ A;  1R9T H;  1CKN A;  4QL5 A;  3GV6 A;  2AHO B;  3A56 A;  2F0W A;  1DYQ A;  4ME3 A;  1BDO A;  4QB4 A;  4DV0 L;  2UU9 L;  3TZU A;  4A3K H;  1SMY D;  1TVX A;  1E2Z A;  1XMO Q;  1I3Q B;  2PQE A;  1KD1 C;  4DV7 L;  4EQ5 A;  3CPW A;  1CTM A;  1RTO A;  4ZKC B;  2CHB D;  5M5W H;  2R93 B;  2QEJ C;  3HOV G;  2A73 B;  3CP0 A;  4FYD A;  2JA5 B;  1Z7T A;  4DUZ L;  2JA7 B;  4AYB E;  3S2H B;  4A3M B;  3R93 A;  2PO4 A;  5IP9 G;  4ULL A;  4AQY Q;  2NVX B;  2NVQ B;  3TP8 A;  4GKK Q;  4Q5V A;  1L0X B;  4X65 Q;  2PMZ E;  3NPP A;  1YJN A;  4YY3 Q;  1NR4 A;  2EY2 A;  4GNX C;  4A3M G;  4P73 A;  2B2U C;  2EYL A;  3ERS X;  3FPU B;  2NYZ D;  5EQ0 A;  4A3I B;  4GOP B;  4OIJ A;  3SVM A;  2NVT B;  4BA2 I;  5JVH 3;  1JB7 A;  1E3P A;  2ZM6 L;  1GUS A;  1I4G A;  2AQ3 B;  4K5X A;  2E2H B;  2IWH A;  3BVZ A;  3LGJ A;  1LUZ A;  4JI4 Q;  3R3O A;  1H9M A;  4KD3 A;  3DEO A;  2A1A A;  4EGV A;  4NP5 A;  2PZT A;  2A68 C;  4KV6 A;  1Y1W G;  3LWE A;  1HZC A;  3AEV A;  1BCP C;  1M4V A;  1RL2 A;  4GKJ Q;  3I4O A;  5FO7 B;  5IGD A;  4X62 Q;  4PMC A;  1STN A;  3J7Z C;  3NTH A;  4APV A;  4A3B G;  2D2C C;  2Z8L A;  1N34 Q;  1CZW A;  2A69 D;  2E8G A;  1VQ5 A;  1I5F A;  5D65 A;  1TWH B;  3ERQ A;  1VQ7 A;  1TKW B;  3CRK C;  3F2U A;  3LWU A;  3I4N H;  1W6J A;  1DXM A;  1JCK B;  4R4O A;  1ZYR C;  3S1R H;  1II3 A;  4YCW A;  4QIW B;  2BCO A;  4RH6 A;  5G3L D;  2K5V A;  3OPO A;  2DUD A;  4RHS A;  1Q82 C;  2R6G A;  4X3U A;  2JA8 G;  1FYC A;  4OHJ A;  3I7F A;  3O13 A;  3TS2 A;  3OWF A;  1LAB A;  2HCC A;  2IJ0 A;  3A5Z B;  2R93 G;  4HIM A;  5LMN Q;  3BZC A;  1MGS A;  2E2H H;  2I46 A;  2NUC A;  3S9W A;  3HEJ A;  3KYH C;  1U4L A;  3UDG A;  3T1Y Q;  1M1K C;  1GHJ A;  1SDF A;  1K83 H;  4DF7 A;  2FFK B;  5CV8 A;  2F0K A;  4IOC A;  3I2Z A;  1E22 A;  3J7A V;  5IE8 A;  2K33 A;  2JA8 B;  2EJG C;  2X6G A;  3QOL A;  1EZ8 A;  4A3M H;  4DR4 L;  5DLQ E;  1NE3 A;  1V1Q A;  3D4R A;  5FOB B;  2UU9 Q;  2OXP A;  5EJW A;  4B3M Q;  3I91 A;  1MI2 A;  4H13 C;  5D3I B;  4OO1 G;  4A3J B;  2VUM H;  2RBM A;  1GUW A;  1L1O B;  4RCO A;  1RCV D;  5CR3 A;  1QNU A;  2A19 A;  1PVO A;  2RCN A;  4DR3 Q;  1HTP A;  2WV6 D;  4F7X A;  3UE0 A;  1XMQ L;  2JK8 A;  5LMN W;  3RD4 A;  3GTP B;  2YU9 B;  3S15 B;  4G57 A;  3CCM A;  1TWA H;  4ABN A;  4JV5 L;  3D8G A;  4GN4 B;  3I4L A;  2XRS D;  3PIP 3;  1D2B A;  3A7L A;  2O5J C;  2H5X A;  1IBM Q;  1A8V A;  2LSS A;  4N9P A;  4G7H C;  4KKS A;  1WCM H;  5M5X H;  3HOU H;  4HJ5 A;  5KEE A;  1F9P A;  3RN2 A;  4UY8 C;  1HZA A;  4ALP A;  1N33 L;  3S2H H;  4A3J G;  2UUC L;  3VYS A;  2B2Y A;  2Z4H A;  3ITP A;  3A54 A;  3KLS A;  1K0R A;  1BCP B;  4RCN A;  4MZ9 A;  2KCC A;  4LWC A;  2G9D A;  4LF5 Q;  5FKA C;  3W2D A;  2XIW A;  1CM9 A;  2M00 A;  4HN7 A;  4BY1 H;  1HR0 W;  3ZJY C;  3PUY A;  3KLS X;  3BZK A;  3I55 A;  2NVQ H;  1EU4 A;  4X3K A;  4R9W A;  5C0X J;  4CKB A;  1JOR A;  3CPF A;  1WTW A;  5JPN C;  2FMM A;  4JI1 L;  2NZ1 D;  2K5H A;  5IYC G;  5JOB A;  4RGT A;  3G71 A;  4PG3 A;  3FVQ A;  3CW2 C;  3OTO Q;  2HT1 A;  3BYY B;  1AZQ A;  2LS0 1;  2UXD L;  1DOL A;  1WYD A;  3G48 A;  4A93 G;  5JJZ A;  4KI0 A;  4ZUJ A;  2B2W A;  3IRB A;  2K04 A;  4X3S A;  2VL6 A;  1U4R A;  3D4D A;  1E24 A;  1E7Z A;  3SGI A;  1CT1 D;  2C5C A;  3T1H L;  2OWO A;  2F3W A;  1I4H A;  2JA6 B;  4ZAI A;  2C9O A;  5I9O A;  2AUJ D;  1KC8 C;  3I4N B;  4LF4 L;  2VQE L;  3K7A H;  1LTS D;  2MPM A;  1MJE A;  2NVX H;  4B9W A;  2IX1 A;  1GHK A;  1S5F D;  1HR0 Q;  1TS4 A;  1HUM A;  5EPL A;  2ZJQ A;  1WTX A;  4YCV A;  3DWP A;  2F0L A;  2DGY A;  2VQF L;  3RLN A;  1KRS A;  3S2D B;  3S1R B;  1J5E L;  4BXX G;  4BBS H;  5M3F G;  2B63 H;  4K0K L;  4AIM A;  2VW9 A;  3HKZ B;  3TN2 A;  5BR8 Q;  4XIG S;  4LUV A;  3L2P A;  3Q22 A;  3KF8 A;  2ICI A;  4LFA Q;  5I6W A;  4NMZ A;  4Z9C B;  2ZJR A;  4ZRZ A;  1MBY A;  3J80 E;  3GTJ H;  1BVS A;  3AFQ A;  3UDX A;  1Y1W H;  3CHB D;  2UUC Q;  3T16 A;  2H1E A;  5J39 A;  4ZYS A;  3H0G B;  3PO3 G;  4I7Z C;  1BCP D;  4LF7 Q;  2DY8 A;  2F0S A;  2KCN A;  4RGM A;  3I70 A;  2EYF A;  3VYT A;  4DXF A;  1SMX A;  3CME A;  3ER0 A;  3RMH A;  1D6E C;  3FRP B;  2K4K A;  5ELN A;  4DV3 L;  3Q0A A;  4K6L A;  3AYH B;  2QKI C;  4HJ9 A;  2UUA L;  1X55 A;  1KAW A;  4IN3 A;  4KHV A;  3J81 j;  3A55 A;  3OMG A;  2OQK A;  1T5E A;  2PZU A;  4H7B A;  1YHA A;  1SBB B;  4A3F G;  4JV5 Q;  1WVL A;  1HNW Q;  5HGQ A;  1LT6 D;  2JSO A;  4M8A A;  4C3I H;  5BN3 A;  3IAY A;  3J80 c;  2LFN A;  1RD9 D;  1AZP A;  3GTQ B;  5JJK A;  3S1Q H;  4R1J A;  2RSO A;  3P75 A;  1LTG D;  2Z6K C;  1EYG A;  4A3F B;  2J4X A;  5C4Z A;  3K81 C;  4PZ7 A;  1HCZ A;  1BO0 A;  5IOD A;  5M3M B;  3PUW A;  3K58 A;  3PUZ A;  4RA8 A;  5ELE A;  2K7V A;  2JQO A;  2JA9 A;  4JI7 Q;  4POG A;  3H3V I;  1ZYR D;  2M2L A;  2SOB A;  4NXN Q;  1YZ6 A;  1PTO D;  4TQU S;  1GUN A;  1JOQ A;  5EPJ A;  4NXN L;  4GLV B;  1PXU A;  4BY1 G;  1EYD A;  2E76 C;  4HED A;  2QF7 A;  4BXX H;  3VR4 A;  2LY7 A;  1FJG L;  4TSS A;  2IX3 A;  3F1Z A;  3KDF A;  3HOX G;  1PYB A;  3S2D H;  1KHI A;  5EAY A;  3CCS A;  2PPB C;  2VS1 A;  3U9S A;  4LF9 Q;  4GZY C;  2ZM6 Q;  3HG9 A;  2NVT H;  3HOV B;  4P72 A;  2E5L L;  3MXP A;  3NBH A;  2PW7 A;  2D62 A;  2A6H C;  2UXB Q;  1CSQ A;  4ODG A;  2EJF C;  4O2D A;  4JYA Q;  3K5L A;  3JAM i;  1O7I A;  2YTV A;  4C2M H;  2B8F A;  4C3I B;  1KAB A;  1BR9 A;  5ELB A;  3M9B A;  1QCB D;  5C3E H;  1K8A C;  1N34 L;  3A8I E;  1NJI C;  3TME A;  1N32 L;  1ZKO A;  3U4Z A;  2SEB D;  5M3F B;  2VB2 X;  4OWX B;  1UE6 A;  2KCT A;  5G3L F;  1G6Z A;  4BBR H;  1BBU A;  1G2T A;  1M90 C;  1NY4 A;  4A3C G;  1NSN S;  2O5I C;  1E1O A;  2K01 A;  5IT9 E;  1DOM A;  2UXC Q;  1B70 B;  1PFM A;  1IBK L;  1LLR D;  3TS0 A;  4JI8 Q;  1STE A;  1HXY D;  1HNW L;  1Q3L A;  3J80 L;  1VQ9 A;  1ENF A;  2L11 A;  1H9S A;  3N6R A;  5GRO A;  3HRZ C;  3QJY A;  3L3O C;  3S14 H;  2QIL A;  1VQG A;  3DM1 A;  2GN5 A;  5JEA H;  1MSH A;  4Y7N B;  5COR A;  4LFA L;  4PNY A;  4EX5 A;  4AYB G;  2N55 A;  4J8Q A;  3H94 A;  3ICE A;  4DR7 Q;  4DR2 L;  2J0T D;  3S17 H;  2WIN B;  5FO9 B;  1U4M A;  5LMU Q;  1K8O A;  4A3I G;  1J5E Q;  3NQT A;  4LF5 L;  4LFB L;  3C2P A;  1BNZ A;  3W1B A;  2NTS A;  3Q6S A;  5C4X B;  2XWB B;  4K5V A;  3UE1 A;  2WAQ B;  5IWA Q;  1H9K A;  4DGZ A;  5KIX A;  1FD7 D;  4FNF A;  1DJR D;  1YI2 A;  4IFD G;  4L8J A;  1B7Y B;  4HR7 B;  2Q2I A;  4TKO B;  1YJ9 A;  2Y0S E;  3TRZ A;  5CV9 A;  4KY6 A;  1H95 A;  1CUK A;  4IUN A;  3ND9 A;  5TSS A;  3EFX D;  1V1P A;  5KNB A;  4B08 A;  3NWS A;  4QMG A;  2K1B A;  3SHL A;  1GUO A;  4DFA A;  1JC7 A;  1X9N A;  4IQZ A;  5M5Y H;  4A3F H;  2K5N A;  4L5T A;  4R4T A;  2ZTC A;  1SNO A;  2KEC A;  1YIJ A;  1MD2 D;  4I65 A;  2JYO A;  4OL7 A;  4C1N K;  4ZLT F;  5LL6 S;  1PYS B;  3S1N H;  5E3F A;  3IKJ A;  2F3I A;  2F4V L;  4CBV A;  3E0E A;  5J3B A;  1I4P A;  2BE5 C;  2IL8 A;  1VQC A;  3G6E A;  1YHQ A;  4QQB X;  1EFI D;  5EBD A;  3MZ5 A;  1KDB A;  2RHS B;  1FNU A;  4MIU A;  1V9P A;  3OIQ A;  1SEB D;  3UI2 A;  3VYR A;  3VDY A;  4G7Z C;  3I4N G;  1G29 1;  5BR8 L;  3BU2 A;  5A35 A;  2F4V Q;  2KHS A;  1CHP D;  1MKH A;  1PHJ A;  1UNS A;  3CD6 A;  1TWC H;  1PFB A;  1S4Z A;  3OTO L;  3EA6 A;  1X54 A;  2UUB Q;  1KLG D;  3KLR A;  3W5O A;  2ATW A;  3CCU A;  4IOA A;  1I94 L;  2AWO A;  3EBE A;  2NWG A;  4IUP A;  1EUJ A;  2MQH A;  4TVA B;  1JJ2 A;  3I8Z A;  4L6T B;  3E0J A;  4LNQ A;  1WFQ A;  1B1Z A;  4IJH A;  1QIL A;  3F2C A;  3QO2 A;  4L5S A;  1JOK A;  1V1P B;  3EQL C;  3Q8D A;  1IW7 C;  4BBR B;  1B4O A;  3KUP A;  1IYU A;  1WCM B;  3MEH A;  2B29 A;  1PYW D;  1S5E D;  3SK6 A;  5C3X A;  1IL8 A;  2CQA A;  3PCO B;  1EIF A;  1V1O A;  1WTO A;  1HR0 L;  3DMU A;  1JE5 A;  2R7Z G;  3OOC A;  2BDO A;  2BA1 A;  2HUG A;  4B9X A;  1VQL A;  1ENC A;  1A3U A;  1VQF A;  3IFT A;  4FF3 A;  2F0O A;  2HDL A;  2HIV A;  4Y52 H;  3HOZ G;  5FO8 B;  2WB1 B;  3SDZ A;  1D8L A;  1ROD A;  5CV7 A;  4UAI A;  3PIO A;  1U9R A;  3H3V H;  2B2V A;  3HOV H;  1A3V A;  3A8J E;  4RWS C;  4A3G B;  4JBK A;  1HA5 A;  3MAQ A;  1BCP F;  1LT3 D;  1GUG A;  2ALY B;  1W3S A;  4BY7 G;  2KJX A;  1C4Q A;  2E74 C;  2LXJ A;  2R3Z A;  5T1G A;  2FXQ A;  1I6V C;  1DOK A;  2D0P A;  4GS3 A;  3KF8 B;  4GLX A;  2F3V A;  4HCS A;  1EL0 A;  1K8G A;  3BZD B;  1J9O A;  4DN4 M;  1PH6 A;  3A0J A;  2B2U A;  2ICE C;  1PH7 A;  3MFG A;  1B3A A;  4DR2 Q;  3EVQ A;  3PF5 A;  5LMN L;  1EY6 A;  3PGZ A;  4R4I A;  2A6H D;  3RN5 A;  4KTA A;  4RGN A;  3I90 A;  3G7L A;  2WAC A;  4P74 A;  2E75 C;  1L0Y B;  2XSC A;  3EJI A;  4MN3 A;  4C3H H;  4X66 Q;  4B3S L;  1Y1V G;  1XNR L;  1HRJ A;  1JT8 A;  1EY0 A;  3FPP A;  3FKI H;  3KFU A;  4XQQ A;  1CK1 A;  3QB3 A;  5C4J H;  1SNC A;  4FO2 A;  1S3O A;  2IHE A;  1QB5 D;  1Y1V B;  3MWY W;  3IFD A;  3EIV A;  1M8A A;  4K6D A;  2F52 A;  1IZ6 A;  1TWC B;  4ZQ3 A;  3I4M H;  2RDH A;  2K50 A;  4KY5 A;  4K8J A;  3BG3 A;  1HNZ L;  5J22 A;  5AJ3 L;  1RIP A;  1SYD A;  1IBK Q;  4DR6 Q;  1PTO B;  3CAM A;  2NB0 A;  3LX0 A;  3B6Y A;  3GTQ H;  1CA5 A;  1IKM A;  3HS0 C;  4OX9 L;  2GVA A;  3C1E A;  4PQX A;  4XQN A;  3L7Z C;  4PV1 C;  3PUV A;  5DM6 3;  5LMU L;  3QOJ A;  1EOV A;  1FGU A;  3S16 B;  2RHQ B;  3M3Y B;  1EWH A;  1SMY C;  3OW7 A;  2L55 A;  3NWT A;  4R4Q A;  3KJP A;  1BUV T;  1KDA A;  5D14 A;  3H0G H;  1KRT A;  4O1N A;  1CFM A;  2RF4 A;  2I5M X;  2F4I A;  1PRT B;  5GAD C;  3PF4 A;  2PNR C;  4C3H B;  1ENA A;  1Q8I A;  4YWM A;  1X32 A;  1LTB D;  1Q90 A;  4KN7 C;  5KRU A;  4JI0 L;  2K28 A;  2JA6 G;  4A3L H;  4H44 C;  2DNE A;  4K5W A;  1S40 A;  4BA1 I;  3CXC A;  1VQO A;  4XT1 B;  1WTP A;  3M4Q A;  1XX8 A;  4HTH A;  5KYL A;  5GAH C;  1AE3 A;  2RDG A;  1G2S A;  4C56 C;  1D5M C;  3RLF A;  3GTJ B;  3BDO A;  2AQ2 B;  1CSP A;  2OT2 A;  3DEP A;  5I4D A;  4DV7 Q;  1AW7 A;  2NTT A;  2CW0 D;  1JWS D;  4CJ2 C;  3PUX A;  1EZ6 A;  3TSS A;  3D3R A;  3QG1 A;  4XXE A;  1L2F A;  4YWL A;  1AFP A;  2AQ1 B;  1Q86 C;  1SRO A;  3BYT B;  3ULP A;  1KIX A;  1A6X A;  2EZV A;  3MA2 B;  1SE8 A;  3HP3 A;  2JA7 H;  4BBS B;  1X3E A;  5JJL A;  3X3N A;  4C3H G;  4RMF A;  1Q12 A;  3K0Y A;  2VY3 A;  3H3V C;  2F0H A;  4DV2 Q;  4IFD I;  4E6I A;  3I3C A;  5DEH A;  1T5X D;  2ZXO A;  3OYY A;  5JPM C;  1OXX K;  1EEF D;  4LW1 A;  3HZX A;  4L63 B;  1BKB A;  4JOI C;  1J8I A;  2PMZ B;  5CV5 A;  1E2W A;  5IT9 c;  4LAA A;  1EY9 A;  1CHQ D;  4QIW E;  1YNN D;  1UEB A;  1TS3 A;  2CKZ B;  1TII D;  4A76 A;  1PA6 A;  1TXY A;  1EY8 A;  4HIO A;  1PMR A;  1L1O A;  5HGT A;  2KQ3 A;  4OIK A;  4A3K G;  2K05 A;  4XTC S;  2EYJ A;  2ZTE A;  1LTI D;  2E5L Q;  2BH2 A;  4IAL A;  1E0B A;  5C3W A;  3T53 B;  2F03 A;  3GTO B;  3H91 A;  1X56 A;  4AQY L;  5EBC A;  2NN6 I;  1B53 A;  5AJ3 Q;  2CFM A;  1Y1V H;  2B8G A;  3BVM A;  3GP7 A;  1SYF A;  4R8I A;  1B9M A;  1WD0 A;  1IXR A;  4OGQ C;  2QGQ A;  1RHP A;  4DV4 Q;  4HID A;  3FKI B;  1ET6 A;  2ES2 A;  4FF1 A;  1OXU A;  1QVG A;  5CV6 A;  4JI6 L;  2WKD A;  2Q2H A;  1MSG A;  4WOR A;  4MHE A;  1WI5 A;  4UP7 A;  2NN6 H;  5JAV A;  3TZD A;  3UDI A;  3PV0 A;  3W3A A;  1PZK D;  4Y7N H;  3F8T A;  3GO5 A;  4OX9 Q;  3NBI A;  1CKM A;  2LKV A;  4NKL A;  1F9S A;  1SYC A;  5KNC A;  1XNQ L;  2SNM A;  3BS1 A;  5T1I A;  2EYM A;  4KKU A;  2MO1 A;  3S16 H;  2WAQ E;  2V1C C;  2KOL A;  4LF4 Q;  1WOC A;  2KVM A;  4IPG A;  1MIU A;  3KJO A;  1E1T A;  5K36 G;  1EY4 A;  1O80 A;  2XRQ D;  5IP7 G;  5C4X H;  1VQI A;  4O0A A;  2EVB A;  4DUY Q;  3PO2 G;  2E2I H;  3P7J A;  2EY5 A;  1U4P A;  4LFC L;  2K52 A;  3VR6 A;  4P71 A;  4A3C H;  1PZJ D;  2MUY A;  5ELD A;  1I50 H;  3C1F A;  4IUU A;  4HJ8 A;  3I4M B;  3CC7 A;  1AP0 A;  2N49 A;  4A3D G;  4LF8 Q;  1SXT A;  1EYA A;  2B39 A;  1NTG A;  5IP9 H;  2B3G A;  3SK4 A;  1F77 A;  2HHH L;  1HA6 A;  2HIX A;  4JI2 L;  4NXM L;  4NW2 A;  3H6M A;  3JAM c;  4FDB A;  1QUQ B;  1SFO H;  4DNR B;  2L4N A;  4DK1 A;  4J15 A;  2XTI A;  2L1B A;  3VR3 A;  2EIF A;  1PLF A;  4BS9 A;  1D5X C;  1O7Z A;  4QF4 A;  3GTK B;  3I73 A;  3GTP H;  1KLU D;  1VF7 A;  1SLJ A;  1C7Y A;  3MXU A;  4KMU C;  1LV9 A;  4KY7 A;  1PRT F;  3MTS A;  1JIC A;  2EE1 A;  2L9H A;  4JC0 A;  2H4O A;  4ZUI A;  5I9P A;  3HOW B;  3R2I A;  5DAU A;  5CBA E;  3K5N A;  1S5C D;  3S1M B;  1H9R A;  3CCL A;  2PNH A;  1O7Y A;  1UAP A;  4PZ6 A;  4B3R L;  4ZKB B;  1SAP A;  1JJG A;  4DAY A;  3FEW X;  5ELC A;  5KYI A;  1DGS A;  3H15 A;  2Q8I B;  2JA7 G;  3OIP A;  1CA6 A;  1KL9 A;  4JI5 Q;  1JOO A;  1PTO F;  1RKN A;  1IKL A;  1C9O A;  4CGY B;  1HJP A;  1SNQ A;  1EU3 A;  4CKC A;  5CC4 A;  2L15 A;  1XPR A;  1CZG A;  3EN2 A;  2DN8 A;  4XDX A;  4X64 L;  4DAY B;  2QA4 A;  2NZH A;  3C46 A;  1RJT A;  3I56 A;  1IBL L;  1TU2 B;  2ZXP A;  2UXD Q;  3G6J B;  3ULL A;  1MJC A;  2WKC A;  3DWQ A;  1EIG A;  4IPC A;  3WDN A;  3J7Y W;  4MNO A;  1Y8P B;  1GXD C;  2X69 A;  3RZD B;  3NUC A;  4DAP A;  3T1H Q;  4BY7 B;  3NXW A;  2NZO A;  2KBN A;  4A3D B;  3I4M G;  1X3P A;  1VQD A;  5KND A;  2FMC A;  1UE1 A;  5D3D A;  4K2K A;  3HFZ B;  4A3E H;  2Z0S A;  1QZH A;  1TWF B;  4C3J G;  2JA5 H;  2JEB I;  3KF6 A;  2I0Q A;  4YWK A;  4JI3 L;  4GN3 B;  5IYB H;  1STY A;  1OTC A;  2B63 B;  4IFD H;  3PO2 H;  2EXD A;  2HCI A;  3BDL A;  1QOH A;  1B9N A;  4JI6 Q;  3MFY