4IFDI

Crystal structure of an 11-subunit eukaryotic exosome complex bound to rna
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
291
structure length
230
Chain Sequence
MACNFQFPEIAYPGKLICPQYGTENKDGEDIIFNYVPGPGTKLIQYEHNGRTLEAITATLVGTVRCEEEKKTRRTVKNILVSVLPGNDFANNLPKEGDIVLTRVTRLSLQRANVEILAVEDKPAATFSVSQASSDLGETFRGIIRSQDVRSTDRDRVKVIECFKPGDIVRAQVLSLGDGTNYYLTTARNDLGVVFARAANGAGGLMYATDWQMMTSPVTGATEKRKCAKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
publication title Crystal structure of an RNA-bound 11-subunit eukaryotic exosome complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 45
structure length 230
sequence length 291
ec nomenclature
pdb deposition date 2012-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF10447 EXOSC1 Exosome component EXOSC1/CSL4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ifdI02
2.40.50.880 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ifdI01
2HQLA 1XNRL 5JJIA 3CCLA 1XNQQ 2JE6I 3HKZG 3A0JA 2AMCB 4JI8L 3CPWA 2VQEL 4LF7L 2MFIA 4DAMA 1U5KA 3L0OA 1JJCB 1I5FA 3BU2A 3UE1A 1HNXL 4LF5Q 1SR3A 1Q1EA 4DUZL 1M1KC 2EIFA 4J15A 4R1JA 3UE0A 4OO1I 1PH2A 1VQJA 2FXQA 4YCUA 2NZOA 2JA8H 5IY0A 2R7ZH 4BA2I 2UXBL 1X54A 1YEZA 1E1OA 1PVOA 5C0XI 1WYDA 4HIOA 4JOIA 2AWNA 3MXNB 4Y7NH 3KF6B 5C44H 1EIFA 2B63H 4OXPA 1J5EQ 1I3QH 2E8GA 3KF6A 4GN3B 5FLMG 1FJGQ 3S2HH 4X6AH 2V1CC 1VQNA 1Y1WH 1V9PA 5H1SE 2OCEA 4DR6L 4LWCA 1VQ9A 3T1HL 4IJLA 3OTOL 4JI1Q 1EFWA 3U50C 2UUAQ 1N33L 5IP7H 4JI3L 4JV5Q 2ZTEA 4NPSA 2VZAA 4P74A 2VL6A 4HJ9A 4YY3Q 2E5LL 4YHHQ 2R6GA 2GN5A 3PF5A 1VQ5A 2OTLA 3E0EA 3PIPA 1K8GA 1TWHH 4LUZA 3SGIA 4EX5A 1Z47A 4AIMA 4BA1I 4HJAA 1RIPA 1PV4A 4IPGA 2NN6G 3CQZH 2HIVA 4GS3A 2ZM6Q 4A93H 3CCMA 4H02A 2KCTA 2KBNA 3PGZA 4JI2Q 1YI2A 1JJ2A 2MO0A 3UDFA 3GTGH 4C2MH 1AH9A 4MZ9A 5M5WH 4GKJQ 1UEBA 5IP9H 1HR0W 4A3EH 1HH2P 5EAYA 4R4OA 2JK8A 1YHAA 5IYBH 3H3VH 1PA6A 1VQHA 2IT1A 3CAMA 3E9IA 1SE8A 4HIKA 1VQLA 2AWOA 4PG3A 1Q82C 4AYBE 5FJ8G 4DR3L 2PQAB 4DNIA 3CP0A 3CC7A 1HR0L 5LMUL 2VQFQ 3CC4A 4B3TQ 2OTJA 1TXYA 2K52A 1E3PA 3T1YQ 3H3VI 4DV4Q 3J81i 3NEMA 4PMWA 4KHPQ 5C4JH 4YWLA 3A5UA 5C3EG 4JBMA 3AQQA 3GO5A 5FLMH 2UXDL 2H5XA 2Z6KA 4A3FG 1Q46A 2JA7H 3AFPA 1IZ6A 1X3FA 2HIXA 4POGA 3HFZB 3GTLH 3PF4A 1XNQL 4OONA 2E2IH 4JI5Q 1OXSC 3M4QA 1A8VA 2MQHA 3U4ZA 3JAMc 1IBML 2ES2A 4DR7Q 5GAGC 3CCEA 2K14A 1MKHA 1VCIA 3ER0A 3GD7A 1YITA 3ZJYC 4LF5L 1XPUA 2KHIA 1KHIA 3BZCA 4JI4L 4YWMA 2AHOB 3GTOH 4IFDG 4DR2Q 3S1RH 2ZTDA 1GO3E 2Y0SE 1ASYA 3M3YH 2YYZA 3I4MG 4A76A 4PZ6A 4B3SQ 3W5OA 5JEAG 1EQQA 1P8LA 1UE6A 3J80c 4L5SA 3HOVG 2I5HA 5GQOA 5IWAQ 1Z9FA 4ALPA 4X65L 2IHEA 1SROA 3AFQA 4TQUS 4DUYL 1K73C 1MIUA 4GLXA 3J81j 1A63A 2UUCQ 2Q2IA 4JI6L 1FVIA 2IHFA 4DV2Q 4DV5L 1MJEA 4LFBQ 1SRUA 4R4IA 2K50A 4A75A 2ASBA 4OWXB 2VS1A 3RLFA 2I5LX 1X6OA 3UDXA 1CKMA 4DPGA 5GAEC 2XGTA 1S40A 4JV5L 2WB1E 2VNUD 4GLVB 5M3MG 1KIXA 1OXXK 1IXRA 4A3DG 4YHHL 5FJ8H 2HT1A 2N3SA 4DK3C 4JI0Q 4GOPB 3S14H 4JOIC 5J3BA 2CQOA 2VW9A 3F2BA 1VQFA 5IE8A 4DV6L 4GOPA 3D0FA 4L5TA 1Q1BA 4YCVA 4P72A 3CD6A 5IYDG 1B8AA 1R9TH 2Q2TA 4OX9L 2D62A 1HNWQ 2UU9Q 1Q7YC 4JI2L 5GAHC 5C3EH 3ULPA 2QGQA 3DLLA 2R7DA 3RLNA 5M5YH 1VQPA 2HHHQ 4B3RQ 3J7ZC 4DR1L 4GKJL 4A3FH 4X66L 4DR5L 1KC8C 2CWPA 4IPCA 1A0IA 3D31A 5AJ3Q 2UXCQ 3PUVA 3J80i 4PZ7A 1OXUA 3TREA 3U58A 3H15A 4A3LG 2JA6H 4JG2A 4BY7G 4GKKQ 3FKIG 4QGUA 4AQYL 3HOXG 3WWVA 1VQOA 2KHJA 5HGQA 5M3FG 1TWCH 1VQAA 4A3CG 3TEHB 2LSSA 3KJOA 2VQFL 1X55A 1PH6A 4JI7Q 1YJNA 3EIVA 3I4MH 4NXNQ 4DV1Q 4DV4L 3TRZA 1N36L 1L1OB 2BA1A 2YTXA 1P16A 3HOVH 1IBLL 3M4OH 1L1OA 3KYHC 1OTCA 3NELA 2NVXH 3UDIA 2RCNA 1LYLA 2ZTCA 3TS0A 3K7AH 2AKWB 3I55A 1UE1A 4A4IA 3CCRA 1KL9A 2K5NA 1JMCA 1X3GA 1BBWA 4X64L 4HJ7A 2Z0SA 3RZDH 4JBJA 3CCQA 3K81C 4NXML 2EXDA 3GTQH 4JI5L 1HZAA 2R93G 1NBWA 3PO3G 4DR7L 1XMQQ 1PH5A 4LF8L 3TS2A 3HOYG 2F3IA 1OXTA 1SMXA 1DGSA 3B6YA 5M3MH 4A3JG 2JA5G 3M9BA 1TWAH 2UUBL 1TWGH 4A3DH 3CCSA 2JEBI 1AE3A 1VQGA 1IBKQ 2F4VQ 3G6EA 1O7IA 4DR2L 4K0KL 4O0AA 5LMNQ 4WJ4A 4LF6Q 4LFCL 4DV7Q 3K8AA 4Y52H 1EWIA 5IYDH 4O2DA 2JEAI 2Z6KC 4JYAL 1YHBA 4DV3Q 3ERSX 4GN5A 1N32Q 1A62A 4P75A 1C7YA 4A3IG 4B3MQ 4A3MG 1Y14B 1LUZA 4JI8Q 2VQEQ 1K9MC 4AYBG 4LF7Q 1CSQA 4A3GG 4BY1G 4LF9L 3CPFA 2C35B 5HY6A 3ULJA 2PQAA 3CCJA 1HNXQ 2B3GA 1L0WA 2JJQA 4DUZQ 2OQKA 1HZCA 1XMOL 3RZOH 1OXVA 1K8AC 1NMGA 4A3LH 1CSPA 4BY7H 1YJ9A 3CC2A 3FKIH 3PUYA 4LF4L 4AH6A 2N8NA 2GVBA 3S1NH 2WAQE 4KLKA 1Q81C 4A3BG 1RL2A 5M3FH 4HIMA 4IFDJ 1G51A 4A3CH 2KENA 1G291 1VQIA 3I4NG 1K83H 3G4SA 2YU9H 3M7NA 4DAYB 4C3HH 3GTKH 4OO1G 1ASZA 1HNWL 5ELNA 5JEAJ 1HNZQ 1E1TA 4R4TA 4IO9A 4DR6Q 1WCMG 3T1HQ 1KD1C 3CMAA 2PI2A 5C0XG 1VQEA 2A8VA 1MJCA 3H0GG 5M5XH 2HHHL 4BXXG 3S1QH 4B3RL 1BVSA 1UE7A 3JC66 5BR8Q 4JI3Q 1V1QA 2Y0SG 3IRBA 4IOAA 5AJ3L 1GVPA 1LM0A 1I6HH 2E5LQ 4GLAC 3STBC 3AYHB 3PCOB 2R93H 2RHQB 1H95A 4UP9A 4LW1A 3PO3H 4L5RC 4MTNA 1PH8A 3HOYH 4GN4B 2JA5H 1E7ZA 1EOVA 2BH8A 4GOPC 4A3JH 1J5EL 1FJGL 2R92G 4QQBX 4JBKA 4X62Q 5C44G 3RN2A 4OWWB 1VQKA 1T9HA 3HOZG 4WJ3M 1PYBA 3CCUA 4NXNL 1CKOA 2YTYA 2NN6I 4LFAQ 4JI1L 4APVA 1Y1WG 3CXCA 1Q12A 4LUOA 1D7QA 2R7FA 2IX0A 2PI2E 1YNXA 3VDYA 3NBHB 4JCVE 2XTIA 1PYSB 2WB1G 1YIJA 2PMZE 3RR5A 3F2DA 2F52A 4YY3L 4A3IH 1CKNB 3CMEA 4QIWE 4GNXB 4A3MH 1YJWA 1FL0A 1CKNA 4GNXA 2CWAA 3GTMH 1L2FA 3PV0A 1K3RA 3FP9A 1KRSA 1QZGA 3S1MH 1NMFA 4UP7A 4EQ5A 3MEFA 1YZ6A 3JAMi 4P73A 2ZM6L 2LXJA 4QJFA 4XIGS 4DR3Q 1EIYB 4ME3A 1HR0Q 1HZ9A 2RHSB 3BJUA 2NVYH 3S24A 5IT9c 1I94Q 3K0XA 4IJHA 4C3IH 1GKHA 5K36G 4KHZA 4A93G 1XPOA 1PH1A 3PIOA 1N34L 4A3BH 3M85A 4R4QA 1NJIC 1GD7A 3UDGA 1VQDA 1L1OC 1EQRA 3W1BA 4DV7L 2K5HA 2UXDQ 1GM5A 4NB3A 1N32L 2DUDA 1WCMH 2D0PA 1QVFA 3HKZE 4B3ML 3KFUA 4RG1A 3H0GH 4BXXH 3CW2C 1IBMQ 4FDBA 4DR4Q 1NE3A 1EYGA 3KF8B 1X56A 4B3TL 1D8LA 1NY4A 2DGYA 1KRTA 3T1YL 1JE5A 1I50H 4JI4Q 2B29A 2L15A 2N49A 2OWOA 4KHPL 2CFMA 1VQBA 1SLJA 4C3JH 2CKZB 1M90C 3PO2G 1SFOH 4KI0A 1N9WA 2ZJPA 4L5QA 2R92H 2A1AA 1PHJA 4IFDI 3PUWA 4A3KG 3A74A 4DV0Q 4X65Q 1X65A 2BA0A 3OYYA 3HOZH 4DUYQ 4XTCS 3EBEA 3GDEA 3ULLA 3OW2A 3RN5A 1C0AA 1Q8KA 1E24A 3STBD 1B7YB 2JA7G 2WP8J 1HNZL 4JI6Q 3HOUG 4MNOA 4DV5Q 1XPRA 1LTLA 1YVCA 3G48A 4AQYQ 4UY8C 1XJVA 1X3EA 5BR8L 3J81c 1J6QA 2GVAA 4DK6C 1VQ8A 1C9OA 5C4XG 5GROA 1N34Q 1TWFH 4RMFA 4B3SL 4PZ8A 3EN2A 4R4CA 3F8TA 3HOWG 1XTDA 1XNRQ 5IWAL 4DV6Q 3U4VA 2OQ0A 5IYCG 2BH2A 4BBSG 3I7FA 4OX9Q 1B70B 4HJ8A 2YV5A 2N78A 3M4PA 3G71A 1PFSA 4QY7A 4X62L 2E2JH 2UUCL 3S16H 4DV2L 4LFBL 1W3SA 3HKSA 3K7UC 1X9NA 1JB7A 1KAWA 2JQOA 4DR1Q 4UPAA 4LFAL 1QUQB 1UE5A 1Y1VG 4X66Q 4DR5Q 4TVAB 2K75A 4IPDA 3F2CA 2UXBQ 1QUQA 2LXKA 2WFWA 1BBUA 5E7NA 3HOXH 5ELOA 2IY5B 1VS0A 1YHQA 1VQCA 2Q2HA 2WAQG 2KCMA 5C0XJ 4HJ5A 3CF5A 4JI0L 1U0LA 1PH7A 2UUAL 2ZJQA 4LNQA 2VUMG 1JJGA 2NVQH 1W2BA 1VQ4A 2UU9L 1NTGA 4BBRG 2IX1A 2JA6G 3Q8DA 3KOJA 1I94L 1PH9A 1KXLA 3PO2H 3I4OA 3OTOQ 1N36Q 1N33Q 1SN8A 1QZHA 3BZKA 3GTJH 1IBLQ 1S72A 3KDFB 3I2ZA 1IYJB 2PNHA 3F1ZA 2RF4A 4JC0A 2ZJRA 4A3KH 2UXCL 3KDFA 4QL5A 3GTPH 2QEXA 1S3OA 2JA8G 3HOUH 4X64Q 4IPHA 2R7ZG 4GNXC 3ICEA 4HIDA 1N8RC 4NXMQ 4GKKL 3NENA 4YWKA 1VQ7A 1Q86C 1FGUA 2MO1A 3KJPA 1VQMA 5FLXc 4LF8Q 4DR4L 2VY3A 2B63G 1PH4A 2UUBQ 3I56A 4JI7L 3CCVA 2K5VA 2K4KA 5C4XH 4DV1L 5JJLA 1WOCA 2JA9A 2YTVA 4K0KQ 2I0QA 3HOWH 4LFCQ 4YCWA 2E2HH 5IYCH 4BBSH 2I5MX 4POFA 5JJKA 1QVGA 3PSIA 1QVCA 2D0OA 2Q2UA 1VQ6A 4A3GH 4JBWA 5IP7G 4JYAQ 4OWTB 2ID0A 1JT8A 4BY1H 3K80C 3W1GA 5LMNW 3RNUA 2CCZA 2ATWA 1YBYA 4DV0L 3RLOA 3KLWA 4DKAC 4UP8A 3L2PA 3S15H 2QA4A 3FHWA 3L7ZC 4LF9Q 1Y1VH 3PUXA 1BKBA 5LMUQ 1XMQL 3S2DH 2A19A 1HZBA 3LGJA 1IL2A 2EQSA 1K0RA 2NZHA 2NVTH 1XMOQ 2ALYB 3TQYA 3DM3A 3S17H 2F4VL 1E22A 3A5ZB 1IBKL 1G6PA 5DLQE 1WJJA 3E9HA 3PUZA 4P71A 5LMNL 4LF6L 1UWVA 2VUMH 1KQSA 2MNAA 4LF4Q 3I4NH 1HJPA 1CUKA 1EUJA 1WFQA 1WI5A 4IOCA 5IP9G 4LUVA 1PH3A 1V43A 4A3EG 3AEVA 1AE2A 5GADC 4DV3L 4BBRH 5IYBG 3J7A5
chains in the Genus database with same CATH superfamily
1LACA 2LS01 1XNQQ 1Y8PB 1H9KA 4C3HB 3A0JA 3CPWA 2MFIA 4DAMA 1JJCB 3TP7A 1EFID 1HNXL 1Q1EA 1PFNA 5LL6X 1II3A 4J15A 4EQNA 3T4AC 2JA8H 3I90A 4YCUA 4BA2I 2R7ZH 4M1UB 3HP3A 1A15A 5JAVA 4HIOA 4JOIA 3SK4A 2V4DA 4G57A 4A3JB 1J5EQ 1I3QH 3KF6A 4X6AH 4FXKC 3S2HH 1I4HA 1SYCA 1DD2A 1SNDA 2K33A 2O5IC 1V9PA 2NBFA 3C1FA 4DR6L 1EWHA 3T1HL 1K0SA 4XXEA 3OTOL 5C4XB 1EFWA 2AUKA 5CV8A 5IP7H 1C48A 4ABNA 1SBBB 2VZAA 4P74A 2VL6A 4YY3Q 4YHHQ 2R6GA 3PF5A 1VQ5A 3I91A 1YNND 1JE4A 1ET6A 3QO2A 5D14A 3PIPA 1Z47A 1SYEA 4BA1I 4RCNA 1EYCA 2SNSA 3NP8A 3D6WA 4GS3A 1EY6A 4A93H 3S2DB 3UDFA 4C2MH 1PTOD 3VR2A 3K5OA 4HAEA 5IODA 5CBEE 1B3QA 4A3EH 5KGUA 1HH2P 1BCPC 1TS3A 4R4OA 3D8GA 4QF4A 4F88A 1PA6A 2KEDA 3A8KE 1VQLA 4PG3A 1JWMD 4MIUA 5JVH3 3HZXA 5C5MA 3J80E 4CKBA 1RKNA 4DR3L 1SSOA 3CP0A 1HR0L 5LMUL 3WOFA 4B3TQ 4NW2A 3A56A 1I50B 3J81i 4KHPQ 5C4JH 2PYKA 5C3EG 2AQ3B 2O4XA 2UXDL 1T5XD 2FJ2A 5DM63 4A3FG 4KY5A 5C44B 2ZXPA 3HFZB 4K5VA 4OONA 3TP5A 1Y1WB 2MQHA 3JAMc 2ES2A 1MKHA 2PMZB 3GD7A 4QMGA 4IFDG 3IFTA 4JI4L 4YWMA 2AHOB 2X6LA 3IAYA 4DR2Q 3S1RH 2ZTDA 5CYUA 1CFMA 1ASYA 3RUZA 4LAAA 1EQQA 1P8LA 3HOVG 1B50A 4L5SA 2I5HA 4X65L 2F0FA 4DUYL 3N6RA 1MD2D 2PQEA 3J81j 1A63A 3SVMA 2IHFA 4DV5L 3CHBD 1SMYC 2K50A 4DPGA 3RLFA 2UUAL 2BOSA 2XGTA 1JOKA 1CI3M 2AQ2B 4CDEC 1B9NA 3A8IE 3OOCA 4TSSA 2EJGC 3D0FA 4L5TA 5EKKA 3CD6A 2IL8A 5IYDG 4OX9L 2SOBA 2UU9Q 2DNCA 4RGNA 5C3EH 5I2YA 3ULPA 2QGQA 1VQPA 2F0VA 4B3RQ 4A3FH 1KC8C 3JAML 2UXCQ 2JP1A 1WTOA 4DFAA 4A3LG 1SE3A 4K14A 4QGUA 1O80A 2F0PA 1C4QA 4PQXA 4IFDH 1D2BA 1TWCH 3TEHB 2VQFL 4CBVA 4C3HG 3BG3A 1PMRA 4DV4L 3TRZA 1N36L 1JORA 4XQJA 3HOVH 4IUTA 1IBLL 5COYA 1STNA 3NQIA 2RCNA 2ZTCA 1CK1A 3I55A 3A7AB 1X3GA 2XN9C 2QDBA 1BBWA 1XYIA 4HJ7A 4JBJA 2AQ1B 2EXDA 4K5WA 2F3IA 1OXTA 2L9HA 5A2QE 4A3JG 1V8QA 2K5QA 3CCSA 1PYWD 2JEBI 1AE3A 3VYRA 1L0XB 3G6EA 1O7IA 4NP5A 4K0KL 3MEHA 4ULLA 3QIAA 5LMNQ 4LF6Q 3KLRA 2VUMB 4DV7Q 5IYDH 2JEAI 4JYAL 3S14B 1YHBA 1VDZA 3ERSX 2HDLA 4FXGC 4KMUC 4P75A 1C7YA 4XYQA 1EY4A 3MZ5A 2C35B 3ULJA 3W3AA 3CCJA 3EQLC 1HNXQ 4HSPA 1LT5D 3RZOH 2JXMB 1OXVA 1K8AC 1NMGA 3C3LA 4A3LH 3LX0A 4C3IG 1EOTA 3PUYA 4AH6A 1ENFA 3S1NH 1VF5C 4KLKA 4ZUIA 3ND9A 1G51A 1IKLA 5CC4A 1G291 1VQIA 2GA4B 1QE6A 1LTSD 1K83H 3G4SA 3M7NA 4C3HH 4OO1G 1ASZA 5ELNA 4DGZA 1E1TA 4DR6Q 2EY5A 1H9SB 3T1HQ 3CMAA 2HHHL 4BXXG 4QIWB 3S1QH 3OHXC 5AJ3L 1GVPA 3K7AB 3AYHB 1PZID 4J1MA 1H95A 1IL8A 4L5RC 1XX8A 4FO2A 4GN4B 3VYTA 1EOVA 4A3JH 4GOPC 3L3OC 1Z6HA 2I07B 5C44G 1T9HA 1SYFA 4KKUA 4WJ3M 1TWGB 1CKOA 1Y1WG 1Q12A 4LUOA 1YNXA 3NBHB 2XTIA 1S5ED 1ICWA 4X3UA 2A6ED 3EVQA 4KV6A 3CMEA 4QIWE 2B2TC 1YJWA 2ENBA 3WDNA 3GTMH 1K3RA 5FO7B 1NMFA 2A68D 4EQ5A 1YZ6A 4DR3Q 5DM73 2ZM6L 2L5TA 3KK7A 4ME3A 1HR0Q 3BJUA 1EY5A 2NVYH 1TKWB 3MTSA 5IT9c 3K0XA 3X3NA 4C3IH 5K36G 4J6HA 1PH1A 1B3AA 1STYA 4BY7B 3K5LA 1L1OC 1AEXA 1EQRA 2K5HA 3VYUA 2UXDQ 1I4XA 4OO1H 4H0LC 2Z9HA 5M3FB 3J81E 2PZWA 2DUDA 1DCZA 3H6MA 3KFUA 3KLSX 4EQPA 4BXXH 2F0KA 1W6JA 1D5ZC 4DR4Q 1E2VA 1NE3A 1EYGA 4I7AA 2F0UA 1WVLA 1KRTA 3T1YL 1D1KA 1I50H 3BDCA 4JI4Q 4FVMA 2CFMA 1VQBA 1SLJA 1GXDC 2CKZB 2F0QA 1M90C 1SFOH 1N9WA 4IFDI 3PO3B 2WIIB 3MC0B 1TS2A 3PQIA 3PUWA 4Z9CB 3A74A 5A35A 3HOYB 4X65Q 3VR6A 4DUYQ 4RGTA 3EBEA 2PZUA 1C0AA 3STBD 3HOUG 2WP8J 5IGGA 4MNOA 2HQEA 1U4LA 4DV5Q 2Q8TA 1G2SA 3MFYA 4OEMB 5BR8L 4O42A 3LWEA 4DK6C 5IT9L 4HCEA 4A3IB 5GROA 1N34Q 4B3SL 2KEEA 1QNKA 1SYBA 2OQ0A 3SHLA 2BH2A 4OX9Q 5K36H 5IGCA 3G71A 2K32A 1O7ZA 4X62L 3S16H 1KABA 1LO5D 4LFBL 1GOZA 1LABA 1JB7A 5TSSA 1GHJA 2EYJA 4UPAA 1JB3A 2EPBA 5D3DA 1UE5A 4A3BB 1IKMA 4TVAB 4RWSC 3L9AX 2IY5B 2LKVA 1VS0A 1YHQA 1PRTB 4CDDC 4J8QA 4HJ5A 3QOJA 2ZJQA 1WCMB 4EVOA 4LNQA 2VUMG 4TRDA 4K5XA 1W2BA 1NTGA 2OXPA 1LV9A 2Y0SB 3CU7A 4S3SA 1KXLA 2B2WA 3I4OA 3VA5A 1BCPB 1N36Q 3MXPA 3J7AF 1QZHA 1IBLQ 1B2TA 3I2ZA 1F2ZA 4JC0A 5C3XA 4QL5A 1SJHD 5IGEA 3HOUH 5CGKA 1N8RC 4GKKL 2MJ8A 1MI2A 3DMUA 1SJED 5FLXc 2K5WA 1PH4A 5FKAC 3CCVA 2K4KA 4FNFA 5KRUA 1WOCA 1F9QA 2F0WA 2YTVA 2A69D 3TZUA 4K0KQ 1QG7A 5JJKA 4XT3B 1QVCA 2D0OA 4U673 1JT8A 4JYAQ 4P2CB 3S9WA 1KNAA 5LMNW 2K5DA 1YBYA 4IUPA 4IQZA 4DKAC 3EJIA 3C1EA 4Q5VA 3L7ZC 2E2JB 1BKBA 2ALYB 1OO9B 1E22A 1IBKL 2EOTA 2VUMH 1KQSA 1WFQA 1EUJA 1PH3A 4V0BA 3SR1A 5IYBG 2HQLA 5JJIA 3CCLA 3HEJA 2KVMA 1GUWA 2VQEL 1U5KA 3L0OA 1I5FA 3BU2A 4QUFA 3GV3A 1M1KC 2EIFA 4R1JA 3GTJB 4OO1I 1LT6D 2FXQA 1QCBD 2UXBL 3HS0C 1YEZA 3I4LA 1E1OA 1KDBA 3BS1A 3DWAA 1PVOA 2HD3A 4RAUC 2AWNA 1ESRA 2XNAC 4Y7NH 3DEOA 3MXNA 2E8GA 5HURA 5FLMG 1AZQA 4UAIA 5H1SE 2OCEA 2EYPA 1KNEA 2BDOA 3U50C 2SDFA 1N33L 1K8OA 2HCCA 4JV5Q 4BBSB 4HJ9A 2K28A 3PIO3 3Q23A 3E0EA 2CVRA 5I6WA 4LUZA 3SGIA 4HJAA 2NN6G 3CQZH 3G6JB 2ZM6Q 3CCMA 1Y1VB 4C1NK 4JI2Q 5C4HA 3GTGH 4RKLA 1AH9A 2NZ1D 4MZ9A 2QKIC 3S17B 4RGOS 5KYIA 1HR0W 4GKJQ 2XWBB 4XQNA 4QCLA 2JK8A 1YHAA 5IYBH 1ENAA 5BN5A 1BDOA 4IZ8A 3E9IA 1PFMA 4HIKA 2ZT9C 1HUMA 2WINB 4PMCA 5I4DA 1RHPA 2Z4HA 1Q82C 3H0GB 3CC7A 2F0JA 3VA7A 3T1YQ 1KLGD 3H3VI 3OPOA 1R4PB 4YWLA 3W2DA 3OMCA 4JBMA 3SDZA 5KNCA 5FLMH 4L8JA 1YNJC 1X3FA 1T5EA 3T51B 4POGA 3GTLH 1TS4A 2E2IH 1GUTA 2I46A 4DR7Q 4HSVA 3U4ZA 4LJZC 2B39A 2K14A 3ER0A 2CW0C 1YITA 1XPUA 1V1OA 4LF5L 2KHIA 1KHIA 3BZCA 4DNTB 3NTKA 1GO3E 3MAQA 3I4MG 2G9DA 4A76A 4B3SQ 2NN6H 4DXFA 3J80c 1TWHB 1CHQD 3PMFA 3R8BA 4ALPA 1O7LA 2JSOA 3OMGA 4TQUS 1K73C 3DUZA 4FYDA 2P5ZX 2F0HA 1MIUA 4XDXA 4UHVA 1VMCA 1VF7A 2DN8A 4LFBQ 4OWXB 4AQYL 1EL0A 2I5LX 1CKMA 1TR5A 3GV6A 5M3MG 4OIKA 3MXGA 4DAPA 1IXRA 4FF1A 2HT1A 2N3SA 4GOPB 4JOIC 2VW9A 5IE8A 1TT2A 4V190 4P72A 1R9TH 3R2IA 2D62A 2XIWA 5M5YH 1A3TA 3BYTB 5EQ0A 4L63B 1FYCA 3FPUB 2EVBA 4PZ7A 5ISRA 1WTQA 1PTOB 2JA7B 4JG2A 4GKKQ 1FGBD 4DNRB 4I65A 3FDTA 2KHJA 2J7ZA 3J80L 4A3CG 4DF7A 3KJOA 1X55A 1E2WA 1YJNA 3I4MH 1L1OB 2YTXA 2F3WA 3E6ZX 3FEWX 3A7LA 4HR7B 4XQQA 3HOWB 2IPKD 3M3YB 3NELA 1NR2A 1ZYRC 2E2HB 1EIHA 3TS0A 3X3MA 2AKWB 1O78A 2Q8IB 1UE1A 2K5NA 1SYDA 1Y8NB 4X64L 1EY8A 3CCQA 3RZDH 1PRTC 3K81C 3Q24A 4JI5L 3NQTA 4LF8L 1DOKA 1SMXA 5M3MH 3B6YA 2UUBL 1EYDA 2EY2A 1Y69U 1IBKQ 2WAQB 2F0SA 2F0OA 4WRDA 1EWIA 2KQ3A 1QB5D 3OW7A 3NSWA 1A62A 2EY1A 4RH6A 3TN2A 2K05A 1LUZA 2VQEQ 3CPFA 1IW7D 2RDFA 2PQAA 4DK0A 2B3GA 4HEDA 2JJQA 3HG9A 2OQKA 4X3KA 1L0WA 2PNRC 2VB2X 1YJ9A 5CV4A 2OEOA 3T13A 4JPBW 2WAQE 1Q81C 4IFDJ 4A3CH 2B63B 1STEA 2YU9H 4DAYB 4LMQD 4HN7A 5C6AA 1HNWL 1HNZQ 3DEPA 3NHHA 3K5NA 4KKSA 5C0XG 1VQEA 1MJCA 3H0GG 5M5XH 1BVSA 5I9PA 3M4OB 1V1QA 2EYHA 5ELEA 1D6EC 4IOAA 1ET9A 4GLAC 1CA5A 4CHTB 2EE1A 4DN4M 3PCOB 4UP9A 4LW1A 3SK8A 1HPCA 4ODGA 2A74C 2BH8A 3GTQB 3DWQA 1FJGL 3CRLC 4JBKA 2LFNA 3QG1A 2K6AA 4OWWB 3RN2A 5BN3A 5K5PA 1VQKA 1TWAB 1PYBA 3OIQA 5M5WB 4NXNL 3K6OA 2YTYA 2NN6I 4JI1L 4APVA 1LLRD 1HTPA 2IX0A 2PI2E 3VDYA 2PMZE 3RR5A 3F2DA 1CKNB 3HKZB 1FL0A 4GNXA 2CWAA 1B9MA 3FP9A 3S1MH 1ZKOA 4UP7A 2HUGA 1JCKB 2XWJB 1LTAD 2RHSB 2EZVA 2F03A 4KHZA 4K6LA 5A2QL 1DOLA 1MGSA 4R4QA 2B8FA 1ONLA 3W1BA 1QNUA 1RCVD 2NTTA 4NB3A 2EYFA 2OF1A 3ITPA 1IYVA 1N32L 2A6HD 2RSNA 2D0PA 1HQMC 3HKZE 4B3ML 5C0XH 4ZLTF 3GTKB 3H0GH 1BXTA 4G4KA 2E74C 3GTOB 4KTAA 2B29A 2L15A 3M4YA 2FINB 1I6VC 3RMHA 4KI0A 2BDNA 3U9SA 2R93B 2A1AA 2R3ZA 1E0BA 1UUPA 1X65A 2F0EA 2L55A 4U68A 3OW2A 1KDAA 1E24A 1B7YB 2JA7G 5CV5A 2CH4A 4IURA 3BVGA 1LTLA 3TZDA 1A2UA 1BCPF 1YVCA 3CKIB 4ZKCB 4AQYQ 4UY8C 3LNNA 3T53B 3J81c 3OIPA 4KD3A 1QJOA 2GVAA 5C5LA 5C4XG 1PZKD 1STHA 3EN2A 4RHSA 4AYBB 4R4CA 3F8TA 1G6ZA 4IUUA 3HOWG 5JOBA 3D3RA 1D5XC 3FPPA 1B70B 3I7FA 4HJ8A 2YV5A 3M4PA 4H7BA 2L0CA 4QY7A 2UUCL 1QILA 2L4NA 1W3SA 3QWNA 4LFAL 1CQFA 1QUQB 2XRQD 2K75A 4IPDA 3F2CA 5ELOA 1CTMA 1TY2A 1VQCA 2WAQG 4JI0L 1GUSA 1PH7A 1CT1D 5KNBA 3G7LA 1VQ4A 4CDCC 2IX1A 1EEFD 3KOJA 4M8AA 1MHWC 1TY0A 1I94L 3OTOQ 3VR4A 3KBGA 3NTHA 5EJWA 1S72A 3KDFB 1MSHA 3F1ZA 2RF4A 4FF4A 4C1NI 1EY0A 2R92B 2FFKB 4X64Q 3J81L 4KN7C 1HFNA 3HOZB 1DONA 2VXWA 1VQ7A 3VYSA 5CORA 1I4PA 1VQMA 1FNVA 4LF8Q 3NUCA 3D4DA 2B63G 5J22A 2UUBQ 1NCVA 4JI7L 5C4XH 1YNNC 4DV1L 5JJLA 2K01A 2B2VA 2JA9A 3HOWH 2E2HH 4PMBA 1TWFB 2G5DA 1QVGA 3FMCA 1AP0A 1BQQT 1VQ6A 2ID0A 3W1GA 3F2UA 4DV0L 1X3PA 1PTOC 1Y8OB 2SEBD 4NKLA 3KLWA 3RLOA 3L2PA 2QA4A 2F0GA 3TBIB 3S2DH 5LMUQ 1IL2A 2EQSA 1SE4A 4KHVA 3TQYA 5KNDA 3DM3A 2F4VL 3A5ZB 1UAPA 3SK5A 2KCCA 1NAPA 1UWVA 3FKIB 4KD4A 2MNAA 3HOXB 3I73A 2PPBC 1CUKA 4B9WA 1V43A 1XWEA 1AE2A 3K58A 5EPJA 1XNRL 2NWGA 4MTKA 3HKZG 3E0JA 4NMZA 4JI8L 1SEBD 4LF7L 5CR3A 1PDQA 3UE0A 4RHRA 1VQJA 4A3KB 2NZOA 1X54A 3GTPB 4N9TA 5C0XI 4HCSA 3MVVA 1BUVT 3KF6B 5C44H 1B1ZA 2B63H 4OXPA 1FJGQ 2V1CC 1SAPA 3FVQA 4BS9A 1VQNA 1CZGA 1Y1WH 3WOEA 1VQ9A 4IJLA 4JI1Q 2UUAQ 2N88A 1F77A 2ZTEA 4F7XA 4ZK9B 4A3GB 4FXDA 1J8IA 2K03A 1K8GA 4BY1B 4CDFC 4EX5A 4AIMA 1RIPA 1PV4A 2DJFC 4IPGA 5J1ZA 3NE5B 2KCTA 5D65A 3PGZA 2NVTB 5IIFA 2B2WC 1S5CD 5M5WH 1F9SA 4ZCKA 1W6KA 1M4VA 3C2PA 3H3VH 3I4NB 2IT1A 1WD1A 2PO4A 3CAMA 2WACA 3QOLA 4KJNA 4BBRB 3BDLA 3V96A 5FJ8G 2PQAB 1TU2B 2B2UA 2VQFQ 2OTJA 1TXYA 1U4PA 2Q8RE 3IFDA 4K8JA 5ELDA 2MPMA 4DV4Q 4IUQA 3T16A 2JA8B 5E4XA 1WTPA 2R7ZB 1EY9A 2WKCA 3AQQA 3GO5A 1ICFB 1GUNA 2Z6KA 4WJWA 1Q46A 1IZ6A 2HIXA 3PF4A 1DYQA 1I3QB 1SXTA 1XNQL 3M4QA 1A8VA 5GAGC 1VCIA 1H9JA 1G91A 2F0TA 5I6YA 3GTOH 1BOSA 2Y0SE 1PLFA 2A5HA 1Q90A 4ME5A 3W5OA 5JEAG 1UE6A 2XRSD 4YIJA 1U4MA 1Z9FA 2EYOA 2IHEA 3BYYB 1SROA 3AFQA 2K1BA 1JICA 1X3QA 2QDLA 4A93B 1NSNS 4E6IA 2UUCQ 1SNPA 2Q2IA 4JI6L 1FVIA 4PNYA 4C2MB 3AB9A 5CV7A 2Z8LA 2ASBA 4MHEA 3UDXA 4A3EB 1X6OA 2VNUD 4GLVB 2ZXRA 1DXMA 2XVSA 4YHHL 4R8NA 4XT1B 4OL7A 5FJ8H 4DK3C 4JI0Q 3S14H 1BCPD 4DV6L 3MHBA 1FR3A 1Q8IA 4PV1C 3TDQA 1GUOA 2RDHA 4FF2A 5NUCA 1EQVA 3DLLA 2TSSA 5C4ZA 2HHHQ 3ERQA 4DR1L 5C4JB 4X66L 4DR5L 2CWPA 4IPCA 3D31A 3J7YW 5AJ3Q 4K2KA 3J80i 1SNCA 1BF4A 1OXUA 3U58A 4BY7G 1RJTA 3FKIG 5JJZA 3HOXG 5JVG3 5HGQA 5M3FG 4GZYC 4DK1A 1PH6A 4JI7Q 3EIVA 4IUNA 4G7ZC 4DV1Q 3P20A 5JEAH 2EDGA 5G3LD 1P16A 3S1RB 4RCOA 2BE5C 1OTCA 3IKJA 1U4RA 3K7AH 1JMCA 3CCRA 2L11A 4CKEA 4KK7A 2EXZA 4X3SA 3S15B 2CHBD 4CJ2C 3PO3G 4L6TB 2JYOA 3HOYG 1STGA 1DGSA 2A6EC 2DY7A 2X6GA 3BDOA 1TWGH 2F4VQ 1VQGA 1HRJA 4DR2L 4O0AA 1LT4D 4WJ4A 1KTKA 5T1GA 2A68C 2F0DA 4Y52H 1SMYD 4O2DA 4EGVA 2K7VA 4GN5A 2ZXOA 5FO8B 4A3IG 1Y14B 1K9MC 4JI8Q 4A3GG 4LF7Q 2B2YA 4BY1G 1UNSA 3A8JE 5EBDA 1HZCA 5FLXE 4A3FB 1HUNA 1SNQA 4BY7H 3FKIH 4LF4L 2N8NA 5IOCA 2KOLA 3I70A 4A3BG 1RL2A 5M3FH 2KENA 3I4NG 1F2LA 5LHY1 3PIP3 4NDXA 1TWCB 2FHTA 2OT2A 4IO9A 1WCMG 1XXGA 4B3RL 3HOVB 3KLSA 5BR8Q 1FD7D 4UDUC 2Y0SG 2N55A 3IRBA 1LM0A 3TSSA 4C56C 5FK9C 3OWEB 1WTHA 3STBC 1DOMA 3PO3H 4MTNA 1PH8A 3HOYH 1E7ZA 2QW7A 1EZ8A 1L0YB 1EIGA 4X62Q 1F9PA 1BR9A 1I4RA 1CQVA 3QR8A 4JCVE 1GUGA 1H9MA 2F52A 4A3IH 4DU9A 2NUCA 1SE2A 1A3UA 3EA6A 5EPLA 3SEBA 2E2DC 1L2FA 3PV0A 1SNOA 5CV6A 3JAMi 4KY7A 4P73A 2LXJA 4QJFA 1K8MA 4XIGS 3A54A 1HZ9A 5E1FA 1LTTD 1R4QB 3RZOB 4A93G 3PIOA 3NWTA 4A3BH 1S4ZA 3M85A 3UDGA 4DV7L 1BBXC 4N9PA 2PZTA 3NBIA 1WCMH 1K83B 1V1PA 5T1IA 3CW2C 1NY4A 1TS5A 3DWPA 4R9WA 1J9OA 3S1QB 4RFBA 2N49A 2OWOA 3MFGA 4HMJA 5D3IB 4RKBA 1PHJA 1SDFA 1F2MA 3OYYA 4HTHA 4G7HC 4WORA 3ULLA 3RN5A 1Q8KA 2A69C 3Q0AA 4JI6Q 1XPRA 3MWYW 1JQYD 3OWFA 2AUJD 2D9UA 3P1HA 4JVZA 4CGYB 1TQOA 1VQ8A 4RMFA 5JPNC 3GTMB 2PW5A 5IWAL 4DV6Q 3U4VA 4BBSG 4N8X1 1CM9A 1PFSA 2NVYB 1HTLD 2E2JH 1HCZA 3O13A 4C3IB 4DV2L 3HKSA 2XSCA 3K7UC 2Z6BA 1KAWA 2JQOA 4JW0A 4DR1Q 1Y1VG 4X66Q 1BO0A 1A2TA 1XTCD 2L12A 4DR5Q 1G2TA 2UXBQ 2PW7A 5E7NA 5C0XJ 2Q2HA 2KCMA 2C9OA 3ONAB 3Q22A 3CF5A 1U0LA 2RBMA 1LTGD 5KEEA 2NTSA 3HGBA 1JR0D 3LWUA 3Q8DA 2HDMA 1PH9A 2ICIA 4OGQC 1DM0B 5JPMC 1N33Q 1SN8A 3BZKA 3GTJH 1B44D 5KYLA 2ZJRA 2PNHA 1SFOB 2NVXB 1F9RA 4ZRZA 4QB4A 5HGTA 4GNXC 1NNXA 1STAA 4HIDA 1UEAB 3NENA 3BVZA 4YWKA 2EJMA 1ML0D 2MP1A 1Q86C 4KKTA 5F2DA 1FGUA 2MO1A 3KBXA 4DR4L 3HRZC 3I56A 1E2ZA 4A3DB 2K5VA 1EWCA 4IALA 3TMEA 1ENCA 1AFPA 4K2LA 1EU3A 2I0QA 3MA2B 4BBSH 1WTVA 1X32A 3PSIA 4KJOA 4JBWA 2KJXA 4OWTB 5E3FA 5FO9B 2ATWA 3RNUA 2QEJC 5ELCA 3S15H 4UP8A 2J0TD 3J7AV 3FHWA 3V05A 1Y1VH 1XMQL 1DZ1A 2A19A 3S16B 5EPKA 2F1MA 1WTXA 3S17H 2SNMA 1O7YA 1G6PA 1WJJA 3PUZA 4P71A 1B53A 4LF4Q 3GQBA 1KDCA 1HJPA 1N34L 2KECA 1WI5A 2H1EA 3EFXD 5IP9G 4IOCA 3AEVA 1ESFA 2DY8A 4DV3L 3QB3A 2R61A 2JE6I 1STBA 2AMCB 3H91A 5EKIA 1RDPD 3UE1A 4LF5Q 1SR3A 3KF8A 4DUZL 5BN4A 5C3WA 1PH2A 1ZEQX 5IY0A 1I6HB 3I3CA 2RQXA 1WYDA 1PRTF 3HOUB 3K57A 3MXNB 3DHQA 1EIFA 1GHKA 2JA5B 1Z7TA 3M7GA 4GN3B 3Q6SA 4KY6A 1H9RA 4LWCA 1RD9D 2M9VA 2PCFB 4JI3L 4NPSA 1MSGA 2E5LL 3NPPA 2GN5A 4A3MB 2OTLA 2NYZD 1TWHH 5EBCA 5EGTA 4ZQ3A 1DJRD 2HIVA 3GP7A 4H02A 2MGSA 2KBNA 1JJ2A 1YI2A 1B4OA 2MO0A 2EYMA 3R3OA 3JAME 1UEBA 5IP9H 5EAYA 2HCIA 5DEHA 3UI2A 3I72A 1VQHA 1IHZA 3KUPA 5CBAE 1SE8A 4EQOA 5IGBA 2AWOA 3A55A 5G3LF 2NB0A 2TMPA 4AYBE 1JOQA 1S5FD 4DNIA 3CC4A 2D2CC 2K52A 1E3PA 2KUMA 1PFBA 3NEMA 4PMWA 4C3JB 2B2VC 3A5UA 3K59A 1M8AA 3BZDB 1TIID 2H5XA 1PTOH 3D6CA 4Y7NB 3AFPA 4DAVA 2JA7H 3VR3A 1JC7A 2KCNA 4JI5Q 1OXSC 3RD4A 1I4QA 4O1NA 1IBML 1SYGA 4RA8A 3CCEA 2WB1B 1IYUA 3OSOA 3ZJYC 3TP6A 3V2TA 4B08A 3M3YH 2YYZA 4PZ6A 1AW7A 5IGFA 5DAUA 2WV6D 5GQOA 2F0IA 5IWAQ 2BE5D 3CQZB 3NXWA 2JN4A 4GLXA 3DXJC 5IGDA 3GTGB 1GJXA 3SE0A 2B8GA 4DV2Q 1AZPA 1MJEA 1SRUA 4R4IA 4A75A 1VMPA 2KHSA 2VS1A 5GAEC 1S40A 4JV5L 1RTNA 2WB1E 1WTWA 1KIXA 2M00A 3N52A 1OXXK 4OIJA 4A3DG 2EYLA 1IW7C 2CH4W 2VB3X 5J3BA 2CQOA 3F2BA 1VQFA 2QCPX 4GOPA 1Q1BA 4YCVA 2NVQB 5M9OA 1B8AA 2Q2TA 1HNWQ 1Q7YC 4JI2L 5GAHC 3AU7A 3PO2B 4F8MA 2R7DA 3RLNA 4DXGA 2C5CA 3J7ZC 4GKJL 1KAAA 4H13C 1A0IA 1LTRD 4CJ0B 3PUVA 2B2TA 1A3VA 4KN4C 2MUYA 3TREA 2G9HD 3H15A 1CZWA 4OELB 3GTLB 1V1PB 1U9RA 2QF7A 4ZYSA 2E2IB 3WWVA 2E76C 1VQOA 2O2LD 2FMMA 2M2LA 1VQAA 5KIXA 1YNJD 2LSSA 1RODA 4K8IA 3NK9A 4NXNQ 2BA1A 3M4OH 1L1OA 5AFWA 3KYHC 4F87A 2RVLA 2RDGA 2NVXH 1QWYA 3UDIA 1LYLA 2CW0D 3R93A 1QOHA 4A4IA 1KL9A 2Z0SA 2IJ0A 4NXML 3GTQH 1HA5A 1HZAA 2R93G 1NBWA 3MXUA 3P7JA 4DR7L 1XMQQ 1PH5A 3TS2A 2B2UC 2JA5G 3AMUA 1NR4A 3M9BA 1TWAH 3NWSA 4A3DH 4CJ1B 2F4IA 1I4GA 4LFCL 3QJYA 4ID6A 1EZ6A 1ILQA 3K8AA 2RKSA 2Z6KC 4DV3Q 5CV9A 2JA6B 4WFN3 1N32Q 1D1IA 4B3MQ 1R9TB 4A3MG 4AYBG 1CSQA 4LF9L 4QUCA 5HY6A 1S5DD 2DJGC 5M5YB 3K0YA 4DUZQ 1XMOL 1PXUA 2J4XA 1CSPA 3P75A 2A6HC 3CC2A 5LL6S 1TVXA 2GVBA 1D5MC 3IL8A 4HIMA 4ILWA 4K6DA 4JK1C 3S2HB 3GTKH 4DAYA 1RTOA 5JEAJ 4R4TA 5ELBA 1KD1C 1MBYA 1JWSD 3I4MB 2PI2A 2A8VA 1UE7A 3JC66 4JI3Q 5IT9E 1I6HH 2E5LQ 3H3VC 1PTOF 2R93H 1PZJD 2RHQB 4C3JG 3RZDB 2ICEC 5J39A 1ZYRD 2JA5H 4FP5D 1J5EL 2R92G 4QQBX 4CKCA 5M3MB 1HXYD 3ZYYX 1PRTD 3HOZG 3CCUA 4LFAQ 4DA2A 3CXCA 1D7QA 2R7FA 3H09A 1F2YA 1PYSB 2WB1G 1YIJA 2BCOA 4YY3L 4A3MH 4GNXB 4R8IA 1CA6A 1CKNA 4B9XA 2LY7A 4IN3A 1KRSA 1QZGA 3MEFA 3ND8A 2MHVA 1EIYB 4IUVA 3S24A 3VR5A 1I94Q 4IJHA 4N8FA 3SK6A 1GKHA 2DNEA 4LK1C 1XPOA 2IX3A 1EYAA 3E5SA 1NJIC 3FRPB 1GD7A 2F0LA 1VQDA 1ZXTA 1NUCA 1GM5A 2E75C 1EY7A 1HQRD 2F0MA 2YU9B 1QVFA 4RG1A 1BNZA 1K3BC 2L1BA 2IW3A 5I9OA 1IBMQ 4FDBA 2F0NA 2D5DA 4B3TL 3KF8B 1X56A 1D8LA 1A6XA 2DGYA 1JE5A 5M5XB 3EROA 3K5MA 1Q3LA 3NTIA 4KHPL 2KA7A 3U9OA 4C3JH 5FLXL 3PO2G 5ELFA 2ZJPA 2FMCA 4L5QA 2R92H 2K04A 4HMIA 4A3KG 2EY6A 4DV0Q 2BA0A 3D4WA 3HOZH 4ZKBB 2QILA 4XTCS 3GDEA 5FOBB 2Z4IA 2B2YC 1HNZL 1WD0A 4FF3A 3C46A 3G48A 1XJVA 1X3EA 3T56B 1J6QA 1C9OA 4G7OC 1TWFH 4PZ8A 2X69A 1EEID 2CQAA 4XYOA 1XTDA 3CRKC 1XNRQ 3S1MB 5IYCG 5E4WC 1CHPD 2IWHA 2N78A 4H44C 3BVMA 4BWGB 3E3XA 5C3EB 1K28A 1HHVA 1G8ZD 2H4OA 1X9NA 1JWUD 4RGMA 1QUQA 2LXKA 4ZUJA 1LT3D 2WFWA 1BBUA 3HOXH 1SNMA 2O5JC 1JJGA 2NVQH 3D4RA 1HFGA 2WKDA 2UU9L 4BBRG 2JA6G 1EU4A 3SXHA 3PO2H 5L37A 1H9SA 4OHJA 4X3TA 1KLUD 1LTID 4Q0FA 4A3KH 1IYJB 2LMCB 2UXCL 3KDFA 3GTPH 4TKOB 2QEXA 1S3OA 2JA8G 4IPHA 2R7ZG 1JOOA 3ICEA 4NXMQ 1AN8A 3KJPA 4ZAIA 2F3VA 2Z1CA 2VY3A 1FNWA 3R2TA 1LTBD 5DNFA 2A73B 1FNUA 1C8CA 4MN3A 4LFCQ 4YCWA 2RSOA 5IYCH 3NBHA 2I5MX 4POFA 2Q2UA 4A3GH 5IP7G 4BY1H 3K80C 2CCZA 1RF2D 3I8ZA 5I2XA 3DM1A 4I7ZC 4LF9Q 3PUXA 2RCFA 1HZBA 3LGJA 1K0RA 2NZHA 3URYA 2NVTH 1XMOQ 1S5BD 5CMDA 2EJFC 5DLQE 1WTRA 3E9HA 2RA4A 5LMNL 3TP8A 4LF6L 3I4NH 3H94A 1HA6A 3S1NB 4LUVA 1EQTA 4A3EG 5EKLA 5GADC 1ILPA 4BBRH 2JA6H 3J7A5
chains in the Genus database with same CATH topology
1LACA 2LS01 1XNQQ 1Y8PB 1H9KA 4C3HB 3A0JA 3CPWA 2MFIA 4DAMA 1JJCB 3TP7A 1EFID 1HNXL 1Q1EA 1PFNA 5LL6X 1II3A 4J15A 4EQNA 3T4AC 2JA8H 3I90A 4YCUA 4BA2I 2R7ZH 4M1UB 3HP3A 1A15A 5JAVA 4HIOA 4JOIA 3SK4A 2V4DA 4G57A 1J5EQ 4A3JB 1I3QH 3KF6A 4X6AH 3S2HH 4FXKC 1I4HA 1SYCA 1DD2A 1SNDA 2K33A 2O5IC 1V9PA 2NBFA 4DR6L 3C1FA 1EWHA 3T1HL 3OTOL 4XXEA 5C4XB 1EFWA 2AUKA 5CV8A 5IP7H 1C48A 4ABNA 1SBBB 2VZAA 4P74A 2VL6A 4YY3Q 4YHHQ 2R6GA 3PF5A 1VQ5A 3I91A 1YNND 1JE4A 1ET6A 3QO2A 3PIPA 5D14A 1Z47A 4BA1I 1SYEA 4RCNA 1EYCA 2SNSA 3NP8A 3D6WA 4GS3A 1EY6A 4A93H 3S2DB 3UDFA 4C2MH 1PTOD 3VR2A 3K5OA 4HAEA 5IODA 5CBEE 4A3EH 5KGUA 1HH2P 1BCPC 1TS3A 4R4OA 3D8GA 4QF4A 4F88A 1PA6A 2KEDA 3A8KE 1VQLA 4PG3A 1JWMD 4MIUA 5JVH3 3HZXA 5C5MA 4DR3L 4CKBA 1RKNA 3J80E 1SSOA 3CP0A 1HR0L 5LMUL 4B3TQ 3WOFA 4NW2A 3A56A 1I50B 3J81i 4KHPQ 5C4JH 2PYKA 5C3EG 2AQ3B 2O4XA 2UXDL 1T5XD 2FJ2A 5DM63 4A3FG 4KY5A 5C44B 2ZXPA 3HFZB 4K5VA 4OONA 3TP5A 1Y1WB 2MQHA 3JAMc 2ES2A 1MKHA 3GD7A 2PMZB 4QMGA 4IFDG 4JI4L 3IFTA 4YWMA 2AHOB 2X6LA 3IAYA 4DR2Q 3S1RH 2ZTDA 5CYUA 1CFMA 1ASYA 3RUZA 4LAAA 1EQQA 1P8LA 3HOVG 1B50A 4L5SA 2I5HA 4X65L 2F0FA 4DUYL 3N6RA 1MD2D 2PQEA 3J81j 1A63A 3SVMA 2IHFA 4DV5L 3CHBD 2K50A 1SMYC 4DPGA 3RLFA 2UUAL 2BOSA 2XGTA 1JOKA 1CI3M 2AQ2B 1B9NA 3A8IE 3OOCA 4TSSA 2EJGC 3D0FA 4L5TA 5EKKA 3CD6A 5IYDG 4OX9L 2IL8A 2SOBA 2UU9Q 2DNCA 5C3EH 3ULPA 4RGNA 5I2YA 2QGQA 1VQPA 2F0VA 4B3RQ 4A3FH 1KC8C 3JAML 2UXCQ 2JP1A 1WTOA 4DFAA 4A3LG 1SE3A 4K14A 4QGUA 1O80A 2F0PA 1C4QA 4PQXA 4IFDH 1D2BA 1TWCH 3TEHB 2VQFL 4CBVA 4C3HG 3BG3A 1PMRA 4DV4L 3TRZA 1N36L 1JORA 4XQJA 3HOVH 4IUTA 1IBLL 5COYA 1STNA 3NQIA 2RCNA 2ZTCA 1CK1A 3I55A 3A7AB 1X3GA 2XN9C 2QDBA 1BBWA 1XYIA 4HJ7A 4JBJA 2AQ1B 2EXDA 4K5WA 2F3IA 1OXTA 2L9HA 5A2QE 4A3JG 1V8QA 3CCSA 2K5QA 1PYWD 2JEBI 1AE3A 3VYRA 1L0XB 3G6EA 1O7IA 4NP5A 4K0KL 3MEHA 4ULLA 3QIAA 5LMNQ 4LF6Q 3KLRA 2VUMB 4DV7Q 5IYDH 2JEAI 4JYAL 3S14B 1YHBA 1VDZA 3ERSX 2HDLA 4FXGC 4P75A 1C7YA 4KMUC 4XYQA 1EY4A 3MZ5A 2C35B 3ULJA 3W3AA 3CCJA 3EQLC 1HNXQ 4HSPA 1LT5D 3RZOH 2JXMB 1OXVA 1K8AC 1NMGA 3C3LA 4A3LH 3LX0A 4C3IG 1EOTA 3PUYA 4AH6A 1ENFA 3S1NH 4KLKA 1VF5C 4ZUIA 3ND9A 1G51A 1IKLA 5CC4A 1G291 1VQIA 2GA4B 1QE6A 1LTSD 1K83H 3G4SA 3M7NA 4C3HH 4OO1G 1ASZA 5ELNA 4DGZA 1E1TA 4DR6Q 2EY5A 1H9SB 3T1HQ 3CMAA 2HHHL 4BXXG 3S1QH 4QIWB 3OHXC 5AJ3L 1GVPA 3K7AB 3AYHB 1PZID 1H95A 4J1MA 1IL8A 4L5RC 1XX8A 4FO2A 4GN4B 3VYTA 1EOVA 4A3JH 4GOPC 3L3OC 1Z6HA 2I07B 5C44G 1T9HA 1SYFA 4KKUA 4WJ3M 1TWGB 1CKOA 1Y1WG 1Q12A 4LUOA 1YNXA 3NBHB 2XTIA 1S5ED 1ICWA 4X3UA 2A6ED 3EVQA 4KV6A 3CMEA 4QIWE 1YJWA 2B2TC 2ENBA 3WDNA 3GTMH 1K3RA 5FO7B 1NMFA 2A68D 4EQ5A 1YZ6A 4DR3Q 2ZM6L 5DM73 2L5TA 4ME3A 3KK7A 1HR0Q 3BJUA 1EY5A 2NVYH 5IT9c 1TKWB 3MTSA 3K0XA 3X3NA 4C3IH 5K36G 4J6HA 1PH1A 1B3AA 1STYA 4BY7B 3K5LA 1L1OC 1AEXA 1EQRA 2K5HA 3VYUA 2UXDQ 1I4XA 4OO1H 4H0LC 5M3FB 3J81E 2PZWA 2DUDA 1DCZA 3H6MA 3KFUA 3KLSX 4BXXH 4EQPA 2F0KA 1W6JA 4DR4Q 1D5ZC 1E2VA 1NE3A 1EYGA 1WVLA 2F0UA 1KRTA 3T1YL 1I50H 4JI4Q 1D1KA 3BDCA 4FVMA 2CFMA 1VQBA 1SLJA 1GXDC 2CKZB 1M90C 2F0QA 1SFOH 1N9WA 4IFDI 3PO3B 2WIIB 3PUWA 1TS2A 3MC0B 4Z9CB 5A35A 3A74A 3HOYB 4X65Q 3VR6A 4DUYQ 4RGTA 3EBEA 2PZUA 1C0AA 3STBD 3HOUG 2WP8J 5IGGA 4MNOA 2HQEA 4DV5Q 1U4LA 2Q8TA 1G2SA 3MFYA 5BR8L 4O42A 3LWEA 4DK6C 5IT9L 4HCEA 4A3IB 5GROA 1N34Q 4B3SL 2KEEA 1QNKA 1SYBA 2OQ0A 3SHLA 2BH2A 4OX9Q 5K36H 5IGCA 3G71A 2K32A 1O7ZA 4X62L 3S16H 1KABA 1LO5D 4LFBL 1GOZA 1LABA 1JB7A 5TSSA 1GHJA 2EYJA 4UPAA 1JB3A 2EPBA 5D3DA 1UE5A 4A3BB 1IKMA 4TVAB 4RWSC 3L9AX 2IY5B 2LKVA 1VS0A 1YHQA 1PRTB 4J8QA 4HJ5A 2ZJQA 3QOJA 4LNQA 2VUMG 1WCMB 4EVOA 4TRDA 4K5XA 1W2BA 1NTGA 2OXPA 1LV9A 2Y0SB 3CU7A 4S3SA 1KXLA 2B2WA 3I4OA 3VA5A 1BCPB 1N36Q 3MXPA 3J7AF 1QZHA 1IBLQ 1B2TA 3I2ZA 1F2ZA 4JC0A 5C3XA 4QL5A 1SJHD 5IGEA 3HOUH 5CGKA 1N8RC 4GKKL 2MJ8A 1MI2A 3DMUA 5FLXc 1SJED 2K5WA 1PH4A 5FKAC 3CCVA 2K4KA 4FNFA 5KRUA 1WOCA 1F9QA 2YTVA 2F0WA 4K0KQ 2A69D 3TZUA 1QG7A 5JJKA 4XT3B 1QVCA 2D0OA 4U673 1JT8A 4JYAQ 4P2CB 3S9WA 1KNAA 5LMNW 2K5DA 1YBYA 4IUPA 4IQZA 4DKAC 3EJIA 3C1EA 4Q5VA 3L7ZC 2E2JB 1BKBA 2ALYB 1OO9B 1E22A 1IBKL 2EOTA 2VUMH 1KQSA 1WFQA 1EUJA 1PH3A 4V0BA 3SR1A 5IYBG 2HQLA 5JJIA 3CCLA 3HEJA 2KVMA 1GUWA 2VQEL 1U5KA 3L0OA 1I5FA 3BU2A 4QUFA 3GV3A 1M1KC 2EIFA 4R1JA 3GTJB 4OO1I 1LT6D 2FXQA 2UXBL 1QCBD 3HS0C 1YEZA 3I4LA 1E1OA 1PVOA 1KDBA 3DWAA 3BS1A 4RAUC 2AWNA 1ESRA 4Y7NH 2XNAC 3DEOA 3MXNA 2E8GA 5FLMG 5HURA 1AZQA 4UAIA 5H1SE 2OCEA 2EYPA 1KNEA 2BDOA 3U50C 2SDFA 1N33L 1K8OA 2HCCA 4JV5Q 4BBSB 4HJ9A 2K28A 3PIO3 3Q23A 3E0EA 2CVRA 5I6WA 4LUZA 3SGIA 4HJAA 2NN6G 3CQZH 2ZM6Q 3G6JB 3CCMA 1Y1VB 4C1NK 4JI2Q 5C4HA 3GTGH 4RKLA 1AH9A 4MZ9A 2NZ1D 2QKIC 3S17B 4GKJQ 4RGOS 1HR0W 5KYIA 2XWBB 4XQNA 4QCLA 2JK8A 1YHAA 5IYBH 1ENAA 5BN5A 1BDOA 4IZ8A 3E9IA 4HIKA 1PFMA 2ZT9C 1HUMA 2WINB 4PMCA 5I4DA 1Q82C 1RHPA 2Z4HA 3H0GB 3CC7A 2F0JA 3VA7A 3T1YQ 3H3VI 1KLGD 3OPOA 1R4PB 4YWLA 3W2DA 4JBMA 3OMCA 3SDZA 5FLMH 5KNCA 4L8JA 1YNJC 1X3FA 3GTLH 4POGA 1T5EA 3T51B 1TS4A 2E2IH 1GUTA 2I46A 4DR7Q 3U4ZA 4HSVA 4LJZC 2B39A 2K14A 3ER0A 1YITA 1XPUA 2CW0C 4LF5L 1V1OA 2KHIA 1KHIA 3BZCA 4DNTB 3NTKA 1GO3E 3MAQA 3I4MG 4A76A 2G9DA 4B3SQ 2NN6H 4DXFA 3J80c 1TWHB 1CHQD 3PMFA 3R8BA 4ALPA 4TQUS 1K73C 1O7LA 2JSOA 3OMGA 3DUZA 4FYDA 2F0HA 1MIUA 4XDXA 1VMCA 1VF7A 2DN8A 4LFBQ 4OWXB 4AQYL 1EL0A 2I5LX 1CKMA 1TR5A 3GV6A 5M3MG 4OIKA 3MXGA 4DAPA 1IXRA 2HT1A 4FF1A 2N3SA 4GOPB 4JOIC 2VW9A 5IE8A 1TT2A 4V190 4P72A 1R9TH 3R2IA 2D62A 5M5YH 2XIWA 1A3TA 3BYTB 5EQ0A 4L63B 1FYCA 3FPUB 2EVBA 4PZ7A 5ISRA 1WTQA 1PTOB 2JA7B 4JG2A 4GKKQ 1FGBD 4DNRB 4I65A 3FDTA 2KHJA 4A3CG 2J7ZA 3J80L 4DF7A 3KJOA 1X55A 1E2WA 1YJNA 3I4MH 1L1OB 2YTXA 2F3WA 3E6ZX 3FEWX 3A7LA 4HR7B 4XQQA 3HOWB 2IPKD 3M3YB 3NELA 1NR2A 1ZYRC 2E2HB 1EIHA 3TS0A 3X3MA 2AKWB 1O78A 2Q8IB 1UE1A 2K5NA 1SYDA 1Y8NB 4X64L 3RZDH 3CCQA 1EY8A 1PRTC 3K81C 3Q24A 4JI5L 3NQTA 4LF8L 1DOKA 1SMXA 5M3MH 3B6YA 2UUBL 1EYDA 2EY2A 1Y69U 1IBKQ 2WAQB 2F0SA 2F0OA 4WRDA 1EWIA 2KQ3A 1QB5D 3OW7A 3NSWA 1A62A 2EY1A 4RH6A 3TN2A 2K05A 1LUZA 2VQEQ 3CPFA 1IW7D 2RDFA 2PQAA 4DK0A 2B3GA 1L0WA 2JJQA 3HG9A 2OQKA 4HEDA 4X3KA 2PNRC 2VB2X 1YJ9A 5CV4A 2OEOA 3T13A 2WAQE 1Q81C 4IFDJ 4A3CH 2B63B 1STEA 2YU9H 4DAYB 1HNWL 4HN7A 4LMQD 5C6AA 1HNZQ 3DEPA 3NHHA 3K5NA 4KKSA 5C0XG 1VQEA 1MJCA 3H0GG 5M5XH 1BVSA 5I9PA 3M4OB 1V1QA 2EYHA 5ELEA 1D6EC 4IOAA 1ET9A 4GLAC 1CA5A 4CHTB 2EE1A 4DN4M 3PCOB 4UP9A 4LW1A 3SK8A 1HPCA 4ODGA 2A74C 2BH8A 3GTQB 3DWQA 1FJGL 3CRLC 4JBKA 2LFNA 3QG1A 2K6AA 4OWWB 3RN2A 5BN3A 5K5PA 1VQKA 1TWAB 1PYBA 3OIQA 5M5WB 4NXNL 3K6OA 2YTYA 2NN6I 4JI1L 4APVA 1LLRD 1HTPA 2IX0A 2PI2E 3VDYA 2PMZE 3RR5A 3F2DA 1CKNB 3HKZB 1FL0A 4GNXA 2CWAA 1B9MA 3FP9A 3S1MH 4UP7A 1ZKOA 2HUGA 1JCKB 2XWJB 1LTAD 2RHSB 2EZVA 2F03A 4KHZA 4K6LA 5A2QL 1DOLA 4R4QA 1MGSA 2B8FA 1ONLA 3W1BA 1QNUA 1RCVD 2NTTA 4NB3A 2EYFA 2OF1A 3ITPA 1IYVA 1N32L 2A6HD 2RSNA 2D0PA 3HKZE 4B3ML 1HQMC 5C0XH 4ZLTF 3GTKB 3H0GH 1BXTA 4G4KA 2E74C 3GTOB 4KTAA 2B29A 2L15A 3M4YA 2FINB 1I6VC 3RMHA 4KI0A 2BDNA 3U9SA 2R93B 2A1AA 2R3ZA 1X65A 1E0BA 1UUPA 2F0EA 2L55A 3OW2A 4U68A 1KDAA 1E24A 1B7YB 2JA7G 5CV5A 4IURA 3BVGA 1LTLA 3TZDA 1A2UA 1BCPF 1YVCA 3CKIB 4ZKCB 4AQYQ 4UY8C 3LNNA 3T53B 3J81c 3OIPA 4KD3A 1QJOA 2GVAA 5C5LA 5C4XG 1PZKD 1STHA 3EN2A 4RHSA 4AYBB 4R4CA 3F8TA 1G6ZA 4IUUA 3HOWG 5JOBA 3D3RA 3I7FA 1D5XC 1B70B 4HJ8A 3FPPA 2YV5A 3M4PA 4H7BA 2L0CA 4QY7A 2UUCL 1QILA 2L4NA 1W3SA 3QWNA 4LFAL 1CQFA 1QUQB 2XRQD 2K75A 4IPDA 3F2CA 5ELOA 1CTMA 1TY2A 1VQCA 2WAQG 4JI0L 1GUSA 1PH7A 1CT1D 5KNBA 3G7LA 1VQ4A 2IX1A 3KOJA 1I94L 1EEFD 4M8AA 1TY0A 3OTOQ 3VR4A 3KBGA 3NTHA 5EJWA 1S72A 3KDFB 1MSHA 3F1ZA 2RF4A 4FF4A 4C1NI 1EY0A 2R92B 2FFKB 4X64Q 3J81L 4KN7C 1HFNA 3HOZB 1DONA 2VXWA 1VQ7A 3VYSA 5CORA 1VQMA 1I4PA 4LF8Q 1FNVA 3NUCA 3D4DA 2B63G 5J22A 2UUBQ 1NCVA 4JI7L 5C4XH 1YNNC 4DV1L 5JJLA 2B2VA 2K01A 2JA9A 3HOWH 2E2HH 4PMBA 1TWFB 1QVGA 3FMCA 1AP0A 1BQQT 1VQ6A 2ID0A 3W1GA 3F2UA 4DV0L 1X3PA 1PTOC 1Y8OB 2SEBD 3RLOA 3KLWA 4NKLA 3L2PA 2QA4A 2F0GA 3TBIB 3S2DH 5LMUQ 1IL2A 2EQSA 1SE4A 4KHVA 3TQYA 5KNDA 3DM3A 2F4VL 3A5ZB 1UAPA 3SK5A 2KCCA 1NAPA 1UWVA 3FKIB 4KD4A 2MNAA 3HOXB 3I73A 2PPBC 1CUKA 4B9WA 1V43A 1XWEA 1AE2A 3K58A 5EPJA 1XNRL 2NWGA 3HKZG 3E0JA 4NMZA 4JI8L 1SEBD 4LF7L 5CR3A 1PDQA 3UE0A 4RHRA 1VQJA 4A3KB 2NZOA 1X54A 3GTPB 4N9TA 5C0XI 4HCSA 3MVVA 1BUVT 3KF6B 5C44H 1B1ZA 2B63H 4OXPA 1FJGQ 2V1CC 1VQNA 1SAPA 3FVQA 4BS9A 1Y1WH 1CZGA 3WOEA 1VQ9A 4IJLA 4JI1Q 2UUAQ 2N88A 2ZTEA 1F77A 4F7XA 4ZK9B 4A3GB 4FXDA 1J8IA 2K03A 1K8GA 4BY1B 4EX5A 4AIMA 1RIPA 1PV4A 4IPGA 5J1ZA 3NE5B 2KCTA 5D65A 3PGZA 2NVTB 5IIFA 2B2WC 1S5CD 5M5WH 1F9SA 1W6KA 1M4VA 3C2PA 3H3VH 3I4NB 2IT1A 1WD1A 2PO4A 3CAMA 2WACA 3QOLA 4KJNA 4BBRB 3BDLA 3V96A 5FJ8G 2PQAB 1TU2B 2B2UA 2VQFQ 2OTJA 1TXYA 1U4PA 2Q8RE 3IFDA 4K8JA 5ELDA 4DV4Q 2MPMA 4IUQA 3T16A 2JA8B 5E4XA 1WTPA 2R7ZB 1EY9A 2WKCA 3AQQA 3GO5A 2Z6KA 1GUNA 4WJWA 1Q46A 1IZ6A 2HIXA 3PF4A 1DYQA 1I3QB 1XNQL 1SXTA 3M4QA 1A8VA 5GAGC 1VCIA 1H9JA 1G91A 3GTOH 2F0TA 5I6YA 1BOSA 2Y0SE 1PLFA 2A5HA 1Q90A 4ME5A 3W5OA 5JEAG 1UE6A 2XRSD 4YIJA 1U4MA 1Z9FA 2IHEA 2EYOA 3BYYB 1SROA 3AFQA 2K1BA 1JICA 1X3QA 4A93B 1NSNS 4E6IA 2UUCQ 1SNPA 2Q2IA 4JI6L 1FVIA 4PNYA 4C2MB 3AB9A 5CV7A 2ASBA 2Z8LA 4MHEA 3UDXA 4A3EB 1X6OA 2VNUD 4GLVB 2ZXRA 1DXMA 2XVSA 4YHHL 4R8NA 4XT1B 4OL7A 5FJ8H 4DK3C 4JI0Q 3S14H 1BCPD 4DV6L 3MHBA 1FR3A 1Q8IA 4PV1C 3TDQA 1GUOA 2RDHA 4FF2A 5NUCA 1EQVA 3DLLA 2TSSA 5C4ZA 2HHHQ 3ERQA 4DR1L 5C4JB 4X66L 4DR5L 2CWPA 4IPCA 3D31A 3J7YW 5AJ3Q 3J80i 4K2KA 1SNCA 1BF4A 1OXUA 3U58A 4BY7G 1RJTA 3FKIG 5JJZA 3HOXG 5JVG3 5HGQA 5M3FG 4GZYC 4DK1A 1PH6A 4JI7Q 3EIVA 4IUNA 4G7ZC 4DV1Q 3P20A 5JEAH 2EDGA 5G3LD 1P16A 3S1RB 4RCOA 1OTCA 2BE5C 3IKJA 1U4RA 3K7AH 1JMCA 3CCRA 2L11A 4CKEA 4KK7A 2EXZA 4X3SA 3S15B 2CHBD 4CJ2C 3PO3G 4L6TB 2JYOA 3HOYG 1STGA 1DGSA 2A6EC 2DY7A 2X6GA 3BDOA 1TWGH 2F4VQ 1VQGA 1HRJA 4DR2L 4O0AA 1LT4D 4WJ4A 1KTKA 5T1GA 2A68C 2F0DA 4Y52H 1SMYD 4O2DA 4EGVA 2K7VA 4GN5A 2ZXOA 5FO8B 4A3IG 1Y14B 1K9MC 4JI8Q 4A3GG 4LF7Q 2B2YA 4BY1G 1UNSA 3A8JE 5EBDA 1HZCA 5FLXE 4A3FB 1HUNA 1SNQA 4BY7H 3FKIH 4LF4L 2N8NA 5IOCA 2KOLA 3I70A 4A3BG 1RL2A 5M3FH 2KENA 3I4NG 1F2LA 5LHY1 3PIP3 4NDXA 1TWCB 2FHTA 2OT2A 4IO9A 1WCMG 1XXGA 4B3RL 3HOVB 3KLSA 5BR8Q 1FD7D 4UDUC 2Y0SG 2N55A 3IRBA 1LM0A 3TSSA 4C56C 5FK9C 3OWEB 3STBC 3PO3H 1DOMA 4MTNA 1PH8A 3HOYH 1E7ZA 1EZ8A 1L0YB 1EIGA 4X62Q 1F9PA 1BR9A 1I4RA 1CQVA 4JCVE 1GUGA 1H9MA 2F52A 4A3IH 4DU9A 2NUCA 1SE2A 1A3UA 3EA6A 5EPLA 3SEBA 2E2DC 1L2FA 3PV0A 1SNOA 3JAMi 5CV6A 4KY7A 4P73A 2LXJA 4QJFA 4XIGS 1K8MA 3A54A 1HZ9A 5E1FA 1LTTD 1R4QB 3RZOB 4A93G 3PIOA 4A3BH 3NWTA 3M85A 1S4ZA 3UDGA 4DV7L 1BBXC 4N9PA 2PZTA 3NBIA 1WCMH 1K83B 1V1PA 5T1IA 3CW2C 1NY4A 1TS5A 3DWPA 4R9WA 1J9OA 3S1QB 4RFBA 2N49A 2OWOA 3MFGA 4HMJA 5D3IB 4RKBA 1PHJA 1SDFA 1F2MA 3OYYA 4HTHA 4G7HC 3ULLA 3RN5A 4WORA 1Q8KA 2A69C 3Q0AA 4JI6Q 1XPRA 3MWYW 1JQYD 3OWFA 2AUJD 2D9UA 3P1HA 1VQ8A 1TQOA 4CGYB 4RMFA 5JPNC 3GTMB 5IWAL 4DV6Q 2PW5A 3U4VA 4BBSG 1CM9A 1PFSA 2NVYB 2E2JH 1HTLD 1HCZA 3O13A 4DV2L 4C3IB 3HKSA 2XSCA 3K7UC 1KAWA 2JQOA 4DR1Q 1Y1VG 4X66Q 4DR5Q 1A2TA 1BO0A 1XTCD 2L12A 1G2TA 2UXBQ 2PW7A 5E7NA 5C0XJ 2Q2HA 2KCMA 2C9OA 3CF5A 3ONAB 3Q22A 1U0LA 2RBMA 1LTGD 5KEEA 2NTSA 3HGBA 1JR0D 3LWUA 3Q8DA 2HDMA 1PH9A 2ICIA 4OGQC 1DM0B 5JPMC 1N33Q 1SN8A 3BZKA 3GTJH 1B44D 5KYLA 2ZJRA 2PNHA 1SFOB 2NVXB 1F9RA 4ZRZA 4QB4A 5HGTA 4GNXC 4HIDA 1STAA 1UEAB 3NENA 4YWKA 3BVZA 2EJMA 1ML0D 1Q86C 2MP1A 4KKTA 5F2DA 1FGUA 2MO1A 4DR4L 3KBXA 3HRZC 3I56A 1E2ZA 4A3DB 2K5VA 1EWCA 4IALA 3TMEA 1ENCA 1AFPA 4K2LA 1EU3A 2I0QA 3MA2B 4BBSH 1WTVA 1X32A 3PSIA 4KJOA 4JBWA 4OWTB 2KJXA 5E3FA 2ATWA 5FO9B 3RNUA 2QEJC 5ELCA 3S15H 4UP8A 2J0TD 3J7AV 3FHWA 3V05A 1Y1VH 1XMQL 1DZ1A 2A19A 3S16B 5EPKA 2F1MA 1WTXA 3S17H 2SNMA 1O7YA 1G6PA 1WJJA 3PUZA 4P71A 1B53A 4LF4Q 3GQBA 1KDCA 1HJPA 1N34L 4IOCA 1WI5A 2H1EA 2KECA 5IP9G 3AEVA 3EFXD 1ESFA 4DV3L 2DY8A 3QB3A 2R61A 2JE6I 1STBA 2AMCB 3H91A 5EKIA 1RDPD 3UE1A 4LF5Q 1SR3A 3KF8A 4DUZL 5BN4A 5C3WA 1PH2A 5IY0A 1ZEQX 1I6HB 3I3CA 2RQXA 1WYDA 1PRTF 3HOUB 3K57A 3MXNB 3DHQA 1EIFA 1GHKA 2JA5B 1Z7TA 3M7GA 4GN3B 3Q6SA 4KY6A 1H9RA 4LWCA 1RD9D 2M9VA 2PCFB 4JI3L 4NPSA 1MSGA 2E5LL 3NPPA 2GN5A 4A3MB 2OTLA 2NYZD 1TWHH 5EBCA 5EGTA 4ZQ3A 1DJRD 2HIVA 3GP7A 4H02A 2MGSA 2KBNA 1JJ2A 1YI2A 2MO0A 1B4OA 2EYMA 3R3OA 3JAME 1UEBA 5IP9H 5EAYA 2HCIA 5DEHA 3UI2A 3I72A 1VQHA 1IHZA 3KUPA 5CBAE 1SE8A 4EQOA 5IGBA 2AWOA 3A55A 5G3LF 2NB0A 4AYBE 2TMPA 1JOQA 4DNIA 1S5FD 3CC4A 2D2CC 2K52A 1E3PA 2KUMA 1PFBA 3NEMA 4PMWA 4C3JB 2B2VC 3A5UA 3K59A 1M8AA 3BZDB 1TIID 2H5XA 1PTOH 3D6CA 2JA7H 3AFPA 4Y7NB 4DAVA 3VR3A 1JC7A 2KCNA 4JI5Q 1OXSC 3RD4A 1I4QA 4O1NA 1IBML 1SYGA 3CCEA 4RA8A 2WB1B 1IYUA 3OSOA 3ZJYC 3TP6A 3V2TA 4B08A 3M3YH 2YYZA 4PZ6A 1AW7A 5IGFA 5DAUA 2WV6D 5GQOA 2F0IA 5IWAQ 2BE5D 3CQZB 3NXWA 4GLXA 3DXJC 5IGDA 3GTGB 1GJXA 3SE0A 4DV2Q 2B8GA 1AZPA 1MJEA 1SRUA 4R4IA 4A75A 1VMPA 5GAEC 2VS1A 2KHSA 1S40A 4JV5L 1RTNA 2WB1E 1WTWA 1KIXA 2M00A 3N52A 1OXXK 4A3DG 4OIJA 2EYLA 1IW7C 2VB3X 5J3BA 2CQOA 3F2BA 1VQFA 2QCPX 4GOPA 1Q1BA 4YCVA 2NVQB 5M9OA 1B8AA 2Q2TA 1HNWQ 1Q7YC 4JI2L 5GAHC 3AU7A 3PO2B 4F8MA 2R7DA 3RLNA 4DXGA 2C5CA 3J7ZC 4GKJL 1KAAA 4H13C 1A0IA 1LTRD 4CJ0B 3PUVA 2B2TA 1A3VA 4KN4C 2MUYA 3TREA 2G9HD 3H15A 1CZWA 3GTLB 1V1PB 1U9RA 2QF7A 4ZYSA 2E2IB 3WWVA 1VQOA 2E76C 2O2LD 2FMMA 2M2LA 1VQAA 5KIXA 1YNJD 2LSSA 1RODA 4NXNQ 3NK9A 4K8IA 2BA1A 3M4OH 1L1OA 5AFWA 3KYHC 4F87A 2RVLA 2NVXH 2RDGA 3UDIA 1QWYA 1LYLA 2CW0D 3R93A 1QOHA 4A4IA 1KL9A 2Z0SA 2IJ0A 4NXML 3GTQH 1HA5A 1HZAA 2R93G 1NBWA 3MXUA 3P7JA 4DR7L 1XMQQ 1PH5A 3TS2A 2B2UC 2JA5G 3AMUA 1NR4A 3M9BA 1TWAH 3NWSA 4A3DH 4CJ1B 2F4IA 1I4GA 4LFCL 3QJYA 4ID6A 1EZ6A 1ILQA 3K8AA 2RKSA 2Z6KC 4DV3Q 5CV9A 2JA6B 4WFN3 1N32Q 1D1IA 4B3MQ 1R9TB 4A3MG 4AYBG 1CSQA 4LF9L 4QUCA 5HY6A 1S5DD 5M5YB 3K0YA 4DUZQ 1XMOL 1PXUA 2J4XA 1CSPA 3P75A 2A6HC 3CC2A 5LL6S 1TVXA 2GVBA 1D5MC 3IL8A 4HIMA 4ILWA 4K6DA 4JK1C 3S2HB 3GTKH 4DAYA 5JEAJ 1RTOA 4R4TA 5ELBA 1KD1C 1MBYA 1JWSD 3I4MB 2PI2A 2A8VA 1UE7A 3JC66 4JI3Q 5IT9E 1I6HH 2E5LQ 3H3VC 2R93H 1PTOF 2RHQB 1PZJD 4C3JG 3RZDB 2ICEC 5J39A 2JA5H 1ZYRD 1J5EL 4FP5D 2R92G 4QQBX 4CKCA 5M3MB 3HOZG 1HXYD 1PRTD 3ZYYX 3CCUA 4LFAQ 4DA2A 3CXCA 1D7QA 2R7FA 3H09A 1F2YA 1PYSB 2WB1G 1YIJA 2BCOA 4YY3L 4A3MH 4GNXB 4R8IA 1CA6A 1CKNA 4B9XA 2LY7A 4IN3A 1KRSA 1QZGA 3MEFA 3ND8A 1EIYB 2MHVA 4IUVA 3S24A 3VR5A 1I94Q 4IJHA 3SK6A 1GKHA 2DNEA 4LK1C 1XPOA 2IX3A 1EYAA 1NJIC 3E5SA 3FRPB 1GD7A 2F0LA 1VQDA 1ZXTA 1NUCA 1GM5A 2E75C 1EY7A 1QVFA 1HQRD 2F0MA 2YU9B 4RG1A 1BNZA 2L1BA 1IBMQ 2IW3A 5I9OA 4FDBA 2F0NA 2D5DA 4B3TL 3KF8B 1X56A 1D8LA 1A6XA 2DGYA 1JE5A 5M5XB 3EROA 4KHPL 1Q3LA 3NTIA 3K5MA 2KA7A 3U9OA 4C3JH 5FLXL 3PO2G 5ELFA 2ZJPA 4L5QA 2FMCA 2R92H 2K04A 4HMIA 4A3KG 2EY6A 4DV0Q 2BA0A 3D4WA 3HOZH 4ZKBB 2QILA 4XTCS 3GDEA 5FOBB 2Z4IA 2B2YC 1HNZL 1WD0A 4FF3A 3C46A 3G48A 1XJVA 1X3EA 3T56B 1J6QA 1C9OA 4G7OC 1TWFH 4PZ8A 2X69A 1EEID 2CQAA 4XYOA 1XTDA 1XNRQ 3CRKC 3S1MB 5IYCG 5E4WC 1CHPD 2IWHA 2N78A 4H44C 3BVMA 4BWGB 5C3EB 1HHVA 1G8ZD 2H4OA 1X9NA 1JWUD 4RGMA 1QUQA 2LXKA 4ZUJA 1LT3D 2WFWA 1BBUA 3HOXH 1SNMA 2O5JC 1JJGA 2NVQH 3D4RA 1HFGA 2WKDA 2UU9L 4BBRG 2JA6G 1EU4A 3PO2H 3SXHA 1H9SA 4OHJA 4X3TA 1KLUD 1LTID 4Q0FA 4A3KH 1IYJB 2LMCB 2UXCL 3KDFA 3GTPH 4TKOB 2QEXA 1S3OA 2JA8G 4IPHA 2R7ZG 3ICEA 1JOOA 4NXMQ 1AN8A 3KJPA 4ZAIA 2F3VA 2Z1CA 2VY3A 1FNWA 3R2TA 1LTBD 5DNFA 2A73B 1FNUA 1C8CA 4MN3A 4LFCQ 4YCWA 2RSOA 5IYCH 3NBHA 2I5MX 4POFA 2Q2UA 4A3GH 5IP7G 4BY1H 3K80C 2CCZA 1RF2D 3I8ZA 5I2XA 3DM1A 4LF9Q 4I7ZC 3PUXA 1HZBA 3LGJA 1K0RA 2NZHA 3URYA 2NVTH 1XMOQ 1S5BD 5CMDA 2EJFC 5DLQE 1WTRA 3E9HA 2RA4A 5LMNL 4LF6L 3TP8A 3I4NH 3H94A 1HA6A 3S1NB 4LUVA 4A3EG 1EQTA 5EKLA 5GADC 1ILPA 4BBRH 2JA6H 3J7A5
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HQL A;  1XNR L;  5JJI A;  3CCL A;  1XNQ Q;  2JE6 I;  3HKZ G;  3A0J A;  2AMC B;  4JI8 L;  3CPW A;  2VQE L;  4LF7 L;  2MFI A;  4DAM A;  1U5K A;  3L0O A;  1JJC B;  1I5F A;  3BU2 A;  3UE1 A;  1HNX L;  4LF5 Q;  1SR3 A;  1Q1E A;  4DUZ L;  1M1K C;  2EIF A;  4J15 A;  4R1J A;  3UE0 A;  4OO1 I;  1PH2 A;  1VQJ A;  2FXQ A;  4YCU A;  2NZO A;  2JA8 H;  5IY0 A;  2R7Z H;  4BA2 I;  2UXB L;  1X54 A;  1YEZ A;  1E1O A;  1PVO A;  5C0X I;  1WYD A;  4HIO A;  4JOI A;  2AWN A;  3MXN B;  4Y7N H;  3KF6 B;  5C44 H;  1EIF A;  2B63 H;  4OXP A;  1J5E Q;  1I3Q H;  2E8G A;  3KF6 A;  4GN3 B;  5FLM G;  1FJG Q;  3S2H H;  4X6A H;  2V1C C;  1VQN A;  1Y1W H;  1V9P A;  5H1S E;  2OCE A;  4DR6 L;  4LWC A;  1VQ9 A;  3T1H L;  4IJL A;  3OTO L;  4JI1 Q;  1EFW A;  3U50 C;  2UUA Q;  1N33 L;  5IP7 H;  4JI3 L;  4JV5 Q;  2ZTE A;  4NPS A;  2VZA A;  4P74 A;  2VL6 A;  4HJ9 A;  4YY3 Q;  2E5L L;  4YHH Q;  2R6G A;  2GN5 A;  3PF5 A;  1VQ5 A;  2OTL A;  3E0E A;  3PIP A;  1K8G A;  1TWH H;  4LUZ A;  3SGI A;  4EX5 A;  1Z47 A;  4AIM A;  4BA1 I;  4HJA A;  1RIP A;  1PV4 A;  4IPG A;  2NN6 G;  3CQZ H;  2HIV A;  4GS3 A;  2ZM6 Q;  4A93 H;  3CCM A;  4H02 A;  2KCT A;  2KBN A;  3PGZ A;  4JI2 Q;  1YI2 A;  1JJ2 A;  2MO0 A;  3UDF A;  3GTG H;  4C2M H;  1AH9 A;  4MZ9 A;  5M5W H;  4GKJ Q;  1UEB A;  5IP9 H;  1HR0 W;  4A3E H;  1HH2 P;  5EAY A;  4R4O A;  2JK8 A;  1YHA A;  5IYB H;  3H3V H;  1PA6 A;  1VQH A;  2IT1 A;  3CAM A;  3E9I A;  1SE8 A;  4HIK A;  1VQL A;  2AWO A;  4PG3 A;  1Q82 C;  4AYB E;  5FJ8 G;  4DR3 L;  2PQA B;  4DNI A;  3CP0 A;  3CC7 A;  1HR0 L;  5LMU L;  2VQF Q;  3CC4 A;  4B3T Q;  2OTJ A;  1TXY A;  2K52 A;  1E3P A;  3T1Y Q;  3H3V I;  4DV4 Q;  3J81 i;  3NEM A;  4PMW A;  4KHP Q;  5C4J H;  4YWL A;  3A5U A;  5C3E G;  4JBM A;  3AQQ A;  3GO5 A;  5FLM H;  2UXD L;  2H5X A;  2Z6K A;  4A3F G;  1Q46 A;  2JA7 H;  3AFP A;  1IZ6 A;  1X3F A;  2HIX A;  4POG A;  3HFZ B;  3GTL H;  3PF4 A;  1XNQ L;  4OON A;  2E2I H;  4JI5 Q;  1OXS C;  3M4Q A;  1A8V A;  2MQH A;  3U4Z A;  3JAM c;  1IBM L;  2ES2 A;  4DR7 Q;  5GAG C;  3CCE A;  2K14 A;  1MKH A;  1VCI A;  3ER0 A;  3GD7 A;  1YIT A;  3ZJY C;  4LF5 L;  1XPU A;  2KHI A;  1KHI A;  3BZC A;  4JI4 L;  4YWM A;  2AHO B;  3GTO H;  4IFD G;  4DR2 Q;  3S1R H;  2ZTD A;  1GO3 E;  2Y0S E;  1ASY A;  3M3Y H;  2YYZ A;  3I4M G;  4A76 A;  4PZ6 A;  4B3S Q;  3W5O A;  5JEA G;  1EQQ A;  1P8L A;  1UE6 A;  3J80 c;  4L5S A;  3HOV G;  2I5H A;  5GQO A;  5IWA Q;  1Z9F A;  4ALP A;  4X65 L;  2IHE A;  1SRO A;  3AFQ A;  4TQU S;  4DUY L;  1K73 C;  1MIU A;  4GLX A;  3J81 j;  1A63 A;  2UUC Q;  2Q2I A;  4JI6 L;  1FVI A;  2IHF A;  4DV2 Q;  4DV5 L;  1MJE A;  4LFB Q;  1SRU A;  4R4I A;  2K50 A;  4A75 A;  2ASB A;  4OWX B;  2VS1 A;  3RLF A;  2I5L X;  1X6O A;  3UDX A;  1CKM A;  4DPG A;  5GAE C;  2XGT A;  1S40 A;  4JV5 L;  2WB1 E;  2VNU D;  4GLV B;  5M3M G;  1KIX A;  1OXX K;  1IXR A;  4A3D G;  4YHH L;  5FJ8 H;  2HT1 A;  2N3S A;  4DK3 C;  4JI0 Q;  4GOP B;  3S14 H;  4JOI C;  5J3B A;  2CQO A;  2VW9 A;  3F2B A;  1VQF A;  5IE8 A;  4DV6 L;  4GOP A;  3D0F A;  4L5T A;  1Q1B A;  4YCV A;  4P72 A;  3CD6 A;  5IYD G;  1B8A A;  1R9T H;  2Q2T A;  4OX9 L;  2D62 A;  1HNW Q;  2UU9 Q;  1Q7Y C;  4JI2 L;  5GAH C;  5C3E H;  3ULP A;  2QGQ A;  3DLL A;  2R7D A;  3RLN A;  5M5Y H;  1VQP A;  2HHH Q;  4B3R Q;  3J7Z C;  4DR1 L;  4GKJ L;  4A3F H;  4X66 L;  4DR5 L;  1KC8 C;  2CWP A;  4IPC A;  1A0I A;  3D31 A;  5AJ3 Q;  2UXC Q;  3PUV A;  3J80 i;  4PZ7 A;  1OXU A;  3TRE A;  3U58 A;  3H15 A;  4A3L G;  2JA6 H;  4JG2 A;  4BY7 G;  4GKK Q;  3FKI G;  4QGU A;  4AQY L;  3HOX G;  3WWV A;  1VQO A;  2KHJ A;  5HGQ A;  5M3F G;  1TWC H;  1VQA A;  4A3C G;  3TEH B;  2LSS A;  3KJO A;  2VQF L;  1X55 A;  1PH6 A;  4JI7 Q;  1YJN A;  3EIV A;  3I4M H;  4NXN Q;  4DV1 Q;  4DV4 L;  3TRZ A;  1N36 L;  1L1O B;  2BA1 A;  2YTX A;  1P16 A;  3HOV H;  1IBL L;  3M4O H;  1L1O A;  3KYH C;  1OTC A;  3NEL A;  2NVX H;  3UDI A;  2RCN A;  1LYL A;  2ZTC A;  3TS0 A;  3K7A H;  2AKW B;  3I55 A;  1UE1 A;  4A4I A;  3CCR A;  1KL9 A;  2K5N A;  1JMC A;  1X3G A;  1BBW A;  4X64 L;  4HJ7 A;  2Z0S A;  3RZD H;  4JBJ A;  3CCQ A;  3K81 C;  4NXM L;  2EXD A;  3GTQ H;  4JI5 L;  1HZA A;  2R93 G;  1NBW A;  3PO3 G;  4DR7 L;  1XMQ Q;  1PH5 A;  4LF8 L;  3TS2 A;  3HOY G;  2F3I A;  1OXT A;  1SMX A;  1DGS A;  3B6Y A;  5M3M H;  4A3J G;  2JA5 G;  3M9B A;  1TWA H;  2UUB L;  1TWG H;  4A3D H;  3CCS A;  2JEB I;  1AE3 A;  1VQG A;  1IBK Q;  2F4V Q;  3G6E A;  1O7I A;  4DR2 L;  4K0K L;  4O0A A;  5LMN Q;  4WJ4 A;  4LF6 Q;  4LFC L;  4DV7 Q;  3K8A A;  4Y52 H;  1EWI A;  5IYD H;  4O2D A;  2JEA I;  2Z6K C;  4JYA L;  1YHB A;  4DV3 Q;  3ERS X;  4GN5 A;  1N32 Q;  1A62 A;  4P75 A;  1C7Y A;  4A3I G;  4B3M Q;  4A3M G;  1Y14 B;  1LUZ A;  4JI8 Q;  2VQE Q;  1K9M C;  4AYB G;  4LF7 Q;  1CSQ A;  4A3G G;  4BY1 G;  4LF9 L;  3CPF A;  2C35 B;  5HY6 A;  3ULJ A;  2PQA A;  3CCJ A;  1HNX Q;  2B3G A;  1L0W A;  2JJQ A;  4DUZ Q;  2OQK A;  1HZC A;  1XMO L;  3RZO H;  1OXV A;  1K8A C;  1NMG A;  4A3L H;  1CSP A;  4BY7 H;  1YJ9 A;  3CC2 A;  3FKI H;  3PUY A;  4LF4 L;  4AH6 A;  2N8N A;  2GVB A;  3S1N H;  2WAQ E;  4KLK A;  1Q81 C;  4A3B G;  1RL2 A;  5M3F H;  4HIM A;  4IFD J;  1G51 A;  4A3C H;  2KEN A;  1G29 1;  1VQI A;  3I4N G;  1K83 H;  3G4S A;  2YU9 H;  3M7N A;  4DAY B;  4C3H H;  3GTK H;  4OO1 G;  1ASZ A;  1HNW L;  5ELN A;  5JEA J;  1HNZ Q;  1E1T A;  4R4T A;  4IO9 A;  4DR6 Q;  1WCM G;  3T1H Q;  1KD1 C;  3CMA A;  2PI2 A;  5C0X G;  1VQE A;  2A8V A;  1MJC A;  3H0G G;  5M5X H;  2HHH L;  4BXX G;  3S1Q H;  4B3R L;  1BVS A;  1UE7 A;  3JC6 6;  5BR8 Q;  4JI3 Q;  1V1Q A;  2Y0S G;  3IRB A;  4IOA A;  5AJ3 L;  1GVP A;  1LM0 A;  1I6H H;  2E5L Q;  4GLA C;  3STB C;  3AYH B;  3PCO B;  2R93 H;  2RHQ B;  1H95 A;  4UP9 A;  4LW1 A;  3PO3 H;  4L5R C;  4MTN A;  1PH8 A;  3HOY H;  4GN4 B;  2JA5 H;  1E7Z A;  1EOV A;  2BH8 A;  4GOP C;  4A3J H;  1J5E L;  1FJG L;  2R92 G;  4QQB X;  4JBK A;  4X62 Q;  5C44 G;  3RN2 A;  4OWW B;  1VQK A;  1T9H A;  3HOZ G;  4WJ3 M;  1PYB A;  3CCU A;  4NXN L;  1CKO A;  2YTY A;  2NN6 I;  4LFA Q;  4JI1 L;  4APV A;  1Y1W G;  3CXC A;  1Q12 A;  4LUO A;  1D7Q A;  2R7F A;  2IX0 A;  2PI2 E;  1YNX A;  3VDY A;  3NBH B;  4JCV E;  2XTI A;  1PYS B;  2WB1 G;  1YIJ A;  2PMZ E;  3RR5 A;  3F2D A;  2F52 A;  4YY3 L;  4A3I H;  1CKN B;  3CME A;  4QIW E;  4GNX B;  4A3M H;  1YJW A;  1FL0 A;  1CKN A;  4GNX A;  2CWA A;  3GTM H;  1L2F A;  3PV0 A;  1K3R A;  3FP9 A;  1KRS A;  1QZG A;  3S1M H;  1NMF A;  4UP7 A;  4EQ5 A;  3MEF A;  1YZ6 A;  3JAM i;  4P73 A;  2ZM6 L;  2LXJ A;  4QJF A;  4XIG S;  4DR3 Q;  1EIY B;  4ME3 A;  1HR0 Q;  1HZ9 A;  2RHS B;  3BJU A;  2NVY H;  3S24 A;  5IT9 c;  1I94 Q;  3K0X A;  4IJH A;  4C3I H;  1GKH A;  5K36 G;  4KHZ A;  4A93 G;  1XPO A;  1PH1 A;  3PIO A;  1N34 L;  4A3B H;  3M85 A;  4R4Q A;  1NJI C;  1GD7 A;  3UDG A;  1VQD A;  1L1O C;  1EQR A;  3W1B A;  4DV7 L;  2K5H A;  2UXD Q;  1GM5 A;  4NB3 A;  1N32 L;  2DUD A;  1WCM H;  2D0P A;  1QVF A;  3HKZ E;  4B3M L;  3KFU A;  4RG1 A;  3H0G H;  4BXX H;  3CW2 C;  1IBM Q;  4FDB A;  4DR4 Q;  1NE3 A;  1EYG A;  3KF8 B;  1X56 A;  4B3T L;  1D8L A;  1NY4 A;  2DGY A;  1KRT A;  3T1Y L;  1JE5 A;  1I50 H;  4JI4 Q;  2B29 A;  2L15 A;  2N49 A;  2OWO A;  4KHP L;  2CFM A;  1VQB A;  1SLJ A;  4C3J H;  2CKZ B;  1M90 C;  3PO2 G;  1SFO H;  4KI0 A;  1N9W A;  2ZJP A;  4L5Q A;  2R92 H;  2A1A A;  1PHJ A;  4IFD I;  3PUW A;  4A3K G;  3A74 A;  4DV0 Q;  4X65 Q;  1X65 A;  2BA0 A;  3OYY A;  3HOZ H;  4DUY Q;  4XTC S;  3EBE A;  3GDE A;  3ULL A;  3OW2 A;  3RN5 A;  1C0A A;  1Q8K A;  1E24 A;  3STB D;  1B7Y B;  2JA7 G;  2WP8 J;  1HNZ L;  4JI6 Q;  3HOU G;  4MNO A;  4DV5 Q;  1XPR A;  1LTL A;  1YVC A;  3G48 A;  4AQY Q;  4UY8 C;  1XJV A;  1X3E A;  5BR8 L;  3J81 c;  1J6Q A;  2GVA A;  4DK6 C;  1VQ8 A;  1C9O A;  5C4X G;  5GRO A;  1N34 Q;  1TWF H;  4RMF A;  4B3S L;  4PZ8 A;  3EN2 A;  4R4C A;  3F8T A;  3HOW G;  1XTD A;  1XNR Q;  5IWA L;  4DV6 Q;  3U4V A;  2OQ0 A;  5IYC G;  2BH2 A;  4BBS G;  3I7F A;  4OX9 Q;  1B70 B;  4HJ8 A;  2YV5 A;  2N78 A;  3M4P A;  3G71 A;  1PFS A;  4QY7 A;  4X62 L;  2E2J H;  2UUC L;  3S16 H;  4DV2 L;  4LFB L;  1W3S A;  3HKS A;  3K7U C;  1X9N A;  1JB7 A;  1KAW A;  2JQO A;  4DR1 Q;  4UPA A;  4LFA L;  1QUQ B;  1UE5 A;  1Y1V G;  4X66 Q;  4DR5 Q;  4TVA B;  2K75 A;  4IPD A;  3F2C A;  2UXB Q;  1QUQ A;  2LXK A;  2WFW A;  1BBU A;  5E7N A;  3HOX H;  5ELO A;  2IY5 B;  1VS0 A;  1YHQ A;  1VQC A;  2Q2H A;  2WAQ G;  2KCM A;  5C0X J;  4HJ5 A;  3CF5 A;  4JI0 L;  1U0L A;  1PH7 A;  2UUA L;  2ZJQ A;  4LNQ A;  2VUM G;  1JJG A;  2NVQ H;  1W2B A;  1VQ4 A;  2UU9 L;  1NTG A;  4BBR G;  2IX1 A;  2JA6 G;  3Q8D A;  3KOJ A;  1I94 L;  1PH9 A;  1KXL A;  3PO2 H;  3I4O A;  3OTO Q;  1N36 Q;  1N33 Q;  1SN8 A;  1QZH A;  3BZK A;  3GTJ H;  1IBL Q;  1S72 A;  3KDF B;  3I2Z A;  1IYJ B;  2PNH A;  3F1Z A;  2RF4 A;  4JC0 A;  2ZJR A;  4A3K H;  2UXC L;  3KDF A;  4QL5 A;  3GTP H;  2QEX A;  1S3O A;  2JA8 G;  3HOU H;  4X64 Q;  4IPH A;  2R7Z G;  4GNX C;  3ICE A;  4HID A;  1N8R C;  4NXM Q;  4GKK L;  3NEN A;  4YWK A;  1VQ7 A;  1Q86 C;  1FGU A;  2MO1 A;  3KJP A;  1VQM A;  5FLX c;  4LF8 Q;  4DR4 L;  2VY3 A;  2B63 G;  1PH4 A;  2UUB Q;  3I56 A;  4JI7 L;  3CCV A;  2K5V A;  2K4K A;  5C4X H;  4DV1 L;  5JJL A;  1WOC A;  2JA9 A;  2YTV A;  4K0K Q;  2I0Q A;  3HOW H;  4LFC Q;  4YCW A;  2E2H H;  5IYC H;  4BBS H;  2I5M X;  4POF A;  5JJK A;  1QVG A;  3PSI A;  1QVC A;  2D0O A;  2Q2U A;  1VQ6 A;  4A3G H;  4JBW A;  5IP7 G;  4JYA Q;  4OWT B;  2ID0 A;  1JT8 A;  4BY1 H;  3K80 C;  3W1G A;  5LMN W;  3RNU A;  2CCZ A;  2ATW A;  1YBY A;  4DV0 L;  3RLO A;  3KLW A;  4DKA C;  4UP8 A;  3L2P A;  3S15 H;  2QA4 A;  3FHW A;  3L7Z C;  4LF9 Q;  1Y1V H;  3PUX A;  1BKB A;  5LMU Q;  1XMQ L;  3S2D H;  2A19 A;  1HZB A;  3LGJ A;  1IL2 A;  2EQS A;  1K0R A;  2NZH A;  2NVT H;  1XMO Q;  2ALY B;  3TQY A;  3DM3 A;  3S17 H;  2F4V L;  1E22 A;  3A5Z B;  1IBK L;  1G6P A;  5DLQ E;  1WJJ A;  3E9H A;  3PUZ A;  4P71 A;  5LMN L;  4LF6 L;  1UWV A;  2VUM H;  1KQS A;  2MNA A;  4LF4 Q;  3I4N H;  1HJP A;  1CUK A;  1EUJ A;  1WFQ A;  1WI5 A;  4IOC A;  5IP9 G;  4LUV A;  1PH3 A;  1V43 A;  4A3E G;  3AEV A;  1AE2 A;  5GAD C;  4DV3 L;  4BBR H;  5IYB G;  3J7A 5; 
#chains in the Genus database with same CATH topology
 1LAC A;  2LS0 1;  1XNQ Q;  1Y8P B;  1H9K A;  4C3H B;  3A0J A;  3CPW A;  2MFI A;  4DAM A;  1JJC B;  3TP7 A;  1EFI D;  1HNX L;  1Q1E A;  1PFN A;  5LL6 X;  1II3 A;  4J15 A;  4EQN A;  3T4A C;  2JA8 H;  3I90 A;  4YCU A;  4BA2 I;  2R7Z H;  4M1U B;  3HP3 A;  1A15 A;  5JAV A;  4HIO A;  4JOI A;  3SK4 A;  2V4D A;  4G57 A;  4A3J B;  1J5E Q;  1I3Q H;  3KF6 A;  4X6A H;  4FXK C;  3S2H H;  1I4H A;  1SYC A;  1DD2 A;  1SND A;  2K33 A;  2O5I C;  1V9P A;  2NBF A;  3C1F A;  4DR6 L;  1EWH A;  3T1H L;  1K0S A;  4XXE A;  3OTO L;  5C4X B;  1EFW A;  2AUK A;  5CV8 A;  5IP7 H;  1C48 A;  4ABN A;  1SBB B;  2VZA A;  4P74 A;  2VL6 A;  4YY3 Q;  4YHH Q;  2R6G A;  3PF5 A;  1VQ5 A;  3I91 A;  1YNN D;  1JE4 A;  1ET6 A;  3QO2 A;  5D14 A;  3PIP A;  1Z47 A;  1SYE A;  4BA1 I;  4RCN A;  1EYC A;  2SNS A;  3NP8 A;  3D6W A;  4GS3 A;  1EY6 A;  4A93 H;  3S2D B;  3UDF A;  4C2M H;  1PTO D;  3VR2 A;  3K5O A;  4HAE A;  5IOD A;  5CBE E;  1B3Q A;  4A3E H;  5KGU A;  1HH2 P;  1BCP C;  1TS3 A;  4R4O A;  3D8G A;  4QF4 A;  4F88 A;  1PA6 A;  2KED A;  3A8K E;  1VQL A;  4PG3 A;  1JWM D;  4MIU A;  5JVH 3;  3HZX A;  5C5M A;  3J80 E;  4CKB A;  1RKN A;  4DR3 L;  1SSO A;  3CP0 A;  1HR0 L;  5LMU L;  3WOF A;  4B3T Q;  4NW2 A;  3A56 A;  1I50 B;  3J81 i;  4KHP Q;  5C4J H;  2PYK A;  5C3E G;  2AQ3 B;  2O4X A;  2UXD L;  1T5X D;  2FJ2 A;  5DM6 3;  4A3F G;  4KY5 A;  5C44 B;  2ZXP A;  3HFZ B;  4K5V A;  4OON A;  3TP5 A;  1Y1W B;  2MQH A;  3JAM c;  2ES2 A;  1MKH A;  2PMZ B;  3GD7 A;  4QMG A;  4IFD G;  3IFT A;  4JI4 L;  4YWM A;  2AHO B;  2X6L A;  3IAY A;  4DR2 Q;  3S1R H;  2ZTD A;  5CYU A;  1CFM A;  1ASY A;  3RUZ A;  4LAA A;  1EQQ A;  1P8L A;  3HOV G;  1B50 A;  4L5S A;  2I5H A;  4X65 L;  2F0F A;  4DUY L;  3N6R A;  1MD2 D;  2PQE A;  3J81 j;  1A63 A;  3SVM A;  2IHF A;  4DV5 L;  3CHB D;  1SMY C;  2K50 A;  4DPG A;  3RLF A;  2UUA L;  2BOS A;  2XGT A;  1JOK A;  1CI3 M;  2AQ2 B;  4CDE C;  1B9N A;  3A8I E;  3OOC A;  4TSS A;  2EJG C;  3D0F A;  4L5T A;  5EKK A;  3CD6 A;  2IL8 A;  5IYD G;  4OX9 L;  2SOB A;  2UU9 Q;  2DNC A;  4RGN A;  5C3E H;  5I2Y A;  3ULP A;  2QGQ A;  1VQP A;  2F0V A;  4B3R Q;  4A3F H;  1KC8 C;  3JAM L;  2UXC Q;  2JP1 A;  1WTO A;  4DFA A;  4A3L G;  1SE3 A;  4K14 A;  4QGU A;  1O80 A;  2F0P A;  1C4Q A;  4PQX A;  4IFD H;  1D2B A;  1TWC H;  3TEH B;  2VQF L;  4CBV A;  4C3H G;  3BG3 A;  1PMR A;  4DV4 L;  3TRZ A;  1N36 L;  1JOR A;  4XQJ A;  3HOV H;  4IUT A;  1IBL L;  5COY A;  1STN A;  3NQI A;  2RCN A;  2ZTC A;  1CK1 A;  3I55 A;  3A7A B;  1X3G A;  2XN9 C;  2QDB A;  1BBW A;  1XYI A;  4HJ7 A;  4JBJ A;  2AQ1 B;  2EXD A;  4K5W A;  2F3I A;  1OXT A;  2L9H A;  5A2Q E;  4A3J G;  1V8Q A;  2K5Q A;  3CCS A;  1PYW D;  2JEB I;  1AE3 A;  3VYR A;  1L0X B;  3G6E A;  1O7I A;  4NP5 A;  4K0K L;  3MEH A;  4ULL A;  3QIA A;  5LMN Q;  4LF6 Q;  3KLR A;  2VUM B;  4DV7 Q;  5IYD H;  2JEA I;  4JYA L;  3S14 B;  1YHB A;  1VDZ A;  3ERS X;  2HDL A;  4FXG C;  4KMU C;  4P75 A;  1C7Y A;  4XYQ A;  1EY4 A;  3MZ5 A;  2C35 B;  3ULJ A;  3W3A A;  3CCJ A;  3EQL C;  1HNX Q;  4HSP A;  1LT5 D;  3RZO H;  2JXM B;  1OXV A;  1K8A C;  1NMG A;  3C3L A;  4A3L H;  3LX0 A;  4C3I G;  1EOT A;  3PUY A;  4AH6 A;  1ENF A;  3S1N H;  1VF5 C;  4KLK A;  4ZUI A;  3ND9 A;  1G51 A;  1IKL A;  5CC4 A;  1G29 1;  1VQI A;  2GA4 B;  1QE6 A;  1LTS D;  1K83 H;  3G4S A;  3M7N A;  4C3H H;  4OO1 G;  1ASZ A;  5ELN A;  4DGZ A;  1E1T A;  4DR6 Q;  2EY5 A;  1H9S B;  3T1H Q;  3CMA A;  2HHH L;  4BXX G;  4QIW B;  3S1Q H;  3OHX C;  5AJ3 L;  1GVP A;  3K7A B;  3AYH B;  1PZI D;  4J1M A;  1H95 A;  1IL8 A;  4L5R C;  1XX8 A;  4FO2 A;  4GN4 B;  3VYT A;  1EOV A;  4A3J H;  4GOP C;  3L3O C;  1Z6H A;  2I07 B;  5C44 G;  1T9H A;  1SYF A;  4KKU A;  4WJ3 M;  1TWG B;  1CKO A;  1Y1W G;  1Q12 A;  4LUO A;  1YNX A;  3NBH B;  2XTI A;  1S5E D;  1ICW A;  4X3U A;  2A6E D;  3EVQ A;  4KV6 A;  3CME A;  4QIW E;  2B2T C;  1YJW A;  2ENB A;  3WDN A;  3GTM H;  1K3R A;  5FO7 B;  1NMF A;  2A68 D;  4EQ5 A;  1YZ6 A;  4DR3 Q;  5DM7 3;  2ZM6 L;  2L5T A;  3KK7 A;  4ME3 A;  1HR0 Q;  3BJU A;  1EY5 A;  2NVY H;  1TKW B;  3MTS A;  5IT9 c;  3K0X A;  3X3N A;  4C3I H;  5K36 G;  4J6H A;  1PH1 A;  1B3A A;  1STY A;  4BY7 B;  3K5L A;  1L1O C;  1AEX A;  1EQR A;  2K5H A;  3VYU A;  2UXD Q;  1I4X A;  4OO1 H;  4H0L C;  2Z9H A;  5M3F B;  3J81 E;  2PZW A;  2DUD A;  1DCZ A;  3H6M A;  3KFU A;  3KLS X;  4EQP A;  4BXX H;  2F0K A;  1W6J A;  1D5Z C;  4DR4 Q;  1E2V A;  1NE3 A;  1EYG A;  4I7A A;  2F0U A;  1WVL A;  1KRT A;  3T1Y L;  1D1K A;  1I50 H;  3BDC A;  4JI4 Q;  4FVM A;  2CFM A;  1VQB A;  1SLJ A;  1GXD C;  2CKZ B;  2F0Q A;  1M90 C;  1SFO H;  1N9W A;  4IFD I;  3PO3 B;  2WII B;  3MC0 B;  1TS2 A;  3PQI A;  3PUW A;  4Z9C B;  3A74 A;  5A35 A;  3HOY B;  4X65 Q;  3VR6 A;  4DUY Q;  4RGT A;  3EBE A;  2PZU A;  1C0A A;  3STB D;  3HOU G;  2WP8 J;  5IGG A;  4MNO A;  2HQE A;  1U4L A;  4DV5 Q;  2Q8T A;  1G2S A;  3MFY A;  4OEM B;  5BR8 L;  4O42 A;  3LWE A;  4DK6 C;  5IT9 L;  4HCE A;  4A3I B;  5GRO A;  1N34 Q;  4B3S L;  2KEE A;  1QNK A;  1SYB A;  2OQ0 A;  3SHL A;  2BH2 A;  4OX9 Q;  5K36 H;  5IGC A;  3G71 A;  2K32 A;  1O7Z A;  4X62 L;  3S16 H;  1KAB A;  1LO5 D;  4LFB L;  1GOZ A;  1LAB A;  1JB7 A;  5TSS A;  1GHJ A;  2EYJ A;  4UPA A;  1JB3 A;  2EPB A;  5D3D A;  1UE5 A;  4A3B B;  1IKM A;  4TVA B;  4RWS C;  3L9A X;  2IY5 B;  2LKV A;  1VS0 A;  1YHQ A;  1PRT B;  4CDD C;  4J8Q A;  4HJ5 A;  3QOJ A;  2ZJQ A;  1WCM B;  4EVO A;  4LNQ A;  2VUM G;  4TRD A;  4K5X A;  1W2B A;  1NTG A;  2OXP A;  1LV9 A;  2Y0S B;  3CU7 A;  4S3S A;  1KXL A;  2B2W A;  3I4O A;  3VA5 A;  1BCP B;  1N36 Q;  3MXP A;  3J7A F;  1QZH A;  1IBL Q;  1B2T A;  3I2Z A;  1F2Z A;  4JC0 A;  5C3X A;  4QL5 A;  1SJH D;  5IGE A;  3HOU H;  5CGK A;  1N8R C;  4GKK L;  2MJ8 A;  1MI2 A;  3DMU A;  1SJE D;  5FLX c;  2K5W A;  1PH4 A;  5FKA C;  3CCV A;  2K4K A;  4FNF A;  5KRU A;  1WOC A;  1F9Q A;  2F0W A;  2YTV A;  2A69 D;  3TZU A;  4K0K Q;  1QG7 A;  5JJK A;  4XT3 B;  1QVC A;  2D0O A;  4U67 3;  1JT8 A;  4JYA Q;  4P2C B;  3S9W A;  1KNA A;  5LMN W;  2K5D A;  1YBY A;  4IUP A;  4IQZ A;  4DKA C;  3EJI A;  3C1E A;  4Q5V A;  3L7Z C;  2E2J B;  1BKB A;  2ALY B;  1OO9 B;  1E22 A;  1IBK L;  2EOT A;  2VUM H;  1KQS A;  1WFQ A;  1EUJ A;  1PH3 A;  4V0B A;  3SR1 A;  5IYB G;  2HQL A;  5JJI A;  3CCL A;  3HEJ A;  2KVM A;  1GUW A;  2VQE L;  1U5K A;  3L0O A;  1I5F A;  3BU2 A;  4QUF A;  3GV3 A;  1M1K C;  2EIF A;  4R1J A;  3GTJ B;  4OO1 I;  1LT6 D;  2FXQ A;  1QCB D;  2UXB L;  3HS0 C;  1YEZ A;  3I4L A;  1E1O A;  1KDB A;  3BS1 A;  3DWA A;  1PVO A;  2HD3 A;  4RAU C;  2AWN A;  1ESR A;  2XNA C;  4Y7N H;  3DEO A;  3MXN A;  2E8G A;  5HUR A;  5FLM G;  1AZQ A;  4UAI A;  5H1S E;  2OCE A;  2EYP A;  1KNE A;  2BDO A;  3U50 C;  2SDF A;  1N33 L;  1K8O A;  2HCC A;  4JV5 Q;  4BBS B;  4HJ9 A;  2K28 A;  3PIO 3;  3Q23 A;  3E0E A;  2CVR A;  5I6W A;  4LUZ A;  3SGI A;  4HJA A;  2NN6 G;  3CQZ H;  3G6J B;  2ZM6 Q;  3CCM A;  1Y1V B;  4C1N K;  4JI2 Q;  5C4H A;  3GTG H;  4RKL A;  1AH9 A;  2NZ1 D;  4MZ9 A;  2QKI C;  3S17 B;  4RGO S;  5KYI A;  1HR0 W;  4GKJ Q;  2XWB B;  4XQN A;  4QCL A;  2JK8 A;  1YHA A;  5IYB H;  1ENA A;  5BN5 A;  1BDO A;  4IZ8 A;  3E9I A;  1PFM A;  4HIK A;  2ZT9 C;  1HUM A;  2WIN B;  4PMC A;  5I4D A;  1RHP A;  2Z4H A;  1Q82 C;  3H0G B;  3CC7 A;  2F0J A;  3VA7 A;  3T1Y Q;  1KLG D;  3H3V I;  3OPO A;  1R4P B;  4YWL A;  3W2D A;  3OMC A;  4JBM A;  3SDZ A;  5KNC A;  5FLM H;  4L8J A;  1YNJ C;  1X3F A;  1T5E A;  3T51 B;  4POG A;  3GTL H;  1TS4 A;  2E2I H;  1GUT A;  2I46 A;  4DR7 Q;  4HSV A;  3U4Z A;  4LJZ C;  2B39 A;  2K14 A;  3ER0 A;  2CW0 C;  1YIT A;  1XPU A;  1V1O A;  4LF5 L;  2KHI A;  1KHI A;  3BZC A;  4DNT B;  3NTK A;  1GO3 E;  3MAQ A;  3I4M G;  2G9D A;  4A76 A;  4B3S Q;  2NN6 H;  4DXF A;  3J80 c;  1TWH B;  1CHQ D;  3PMF A;  3R8B A;  4ALP A;  1O7L A;  2JSO A;  3OMG A;  4TQU S;  1K73 C;  3DUZ A;  4FYD A;  2P5Z X;  2F0H A;  1MIU A;  4XDX A;  4UHV A;  1VMC A;  1VF7 A;  2DN8 A;  4LFB Q;  4OWX B;  4AQY L;  1EL0 A;  2I5L X;  1CKM A;  1TR5 A;  3GV6 A;  5M3M G;  4OIK A;  3MXG A;  4DAP A;  1IXR A;  4FF1 A;  2HT1 A;  2N3S A;  4GOP B;  4JOI C;  2VW9 A;  5IE8 A;  1TT2 A;  4V19 0;  4P72 A;  1R9T H;  3R2I A;  2D62 A;  2XIW A;  5M5Y H;  1A3T A;  3BYT B;  5EQ0 A;  4L63 B;  1FYC A;  3FPU B;  2EVB A;  4PZ7 A;  5ISR A;  1WTQ A;  1PTO B;  2JA7 B;  4JG2 A;  4GKK Q;  1FGB D;  4DNR B;  4I65 A;  3FDT A;  2KHJ A;  2J7Z A;  3J80 L;  4A3C G;  4DF7 A;  3KJO A;  1X55 A;  1E2W A;  1YJN A;  3I4M H;  1L1O B;  2YTX A;  2F3W A;  3E6Z X;  3FEW X;  3A7L A;  4HR7 B;  4XQQ A;  3HOW B;  2IPK D;  3M3Y B;  3NEL A;  1NR2 A;  1ZYR C;  2E2H B;  1EIH A;  3TS0 A;  3X3M A;  2AKW B;  1O78 A;  2Q8I B;  1UE1 A;  2K5N A;  1SYD A;  1Y8N B;  4X64 L;  1EY8 A;  3CCQ A;  3RZD H;  1PRT C;  3K81 C;  3Q24 A;  4JI5 L;  3NQT A;  4LF8 L;  1DOK A;  1SMX A;  5M3M H;  3B6Y A;  2UUB L;  1EYD A;  2EY2 A;  1Y69 U;  1IBK Q;  2WAQ B;  2F0S A;  2F0O A;  4WRD A;  1EWI A;  2KQ3 A;  1QB5 D;  3OW7 A;  3NSW A;  1A62 A;  2EY1 A;  4RH6 A;  3TN2 A;  2K05 A;  1LUZ A;  2VQE Q;  3CPF A;  1IW7 D;  2RDF A;  2PQA A;  4DK0 A;  2B3G A;  4HED A;  2JJQ A;  3HG9 A;  2OQK A;  4X3K A;  1L0W A;  2PNR C;  2VB2 X;  1YJ9 A;  5CV4 A;  2OEO A;  3T13 A;  4JPB W;  2WAQ E;  1Q81 C;  4IFD J;  4A3C H;  2B63 B;  1STE A;  2YU9 H;  4DAY B;  4LMQ D;  4HN7 A;  5C6A A;  1HNW L;  1HNZ Q;  3DEP A;  3NHH A;  3K5N A;  4KKS A;  5C0X G;  1VQE A;  1MJC A;  3H0G G;  5M5X H;  1BVS A;  5I9P A;  3M4O B;  1V1Q A;  2EYH A;  5ELE A;  1D6E C;  4IOA A;  1ET9 A;  4GLA C;  1CA5 A;  4CHT B;  2EE1 A;  4DN4 M;  3PCO B;  4UP9 A;  4LW1 A;  3SK8 A;  1HPC A;  4ODG A;  2A74 C;  2BH8 A;  3GTQ B;  3DWQ A;  1FJG L;  3CRL C;  4JBK A;  2LFN A;  3QG1 A;  2K6A A;  4OWW B;  3RN2 A;  5BN3 A;  5K5P A;  1VQK A;  1TWA B;  1PYB A;  3OIQ A;  5M5W B;  4NXN L;  3K6O A;  2YTY A;  2NN6 I;  4JI1 L;  4APV A;  1LLR D;  1HTP A;  2IX0 A;  2PI2 E;  3VDY A;  2PMZ E;  3RR5 A;  3F2D A;  1CKN B;  3HKZ B;  1FL0 A;  4GNX A;  2CWA A;  1B9M A;  3FP9 A;  3S1M H;  1ZKO A;  4UP7 A;  2HUG A;  1JCK B;  2XWJ B;  1LTA D;  2RHS B;  2EZV A;  2F03 A;  4KHZ A;  4K6L A;  5A2Q L;  1DOL A;  1MGS A;  4R4Q A;  2B8F A;  1ONL A;  3W1B A;  1QNU A;  1RCV D;  2NTT A;  4NB3 A;  2EYF A;  2OF1 A;  3ITP A;  1IYV A;  1N32 L;  2A6H D;  2RSN A;  2D0P A;  1HQM C;  3HKZ E;  4B3M L;  5C0X H;  4ZLT F;  3GTK B;  3H0G H;  1BXT A;  4G4K A;  2E74 C;  3GTO B;  4KTA A;  2B29 A;  2L15 A;  3M4Y A;  2FIN B;  1I6V C;  3RMH A;  4KI0 A;  2BDN A;  3U9S A;  2R93 B;  2A1A A;  2R3Z A;  1E0B A;  1UUP A;  1X65 A;  2F0E A;  2L55 A;  4U68 A;  3OW2 A;  1KDA A;  1E24 A;  1B7Y B;  2JA7 G;  5CV5 A;  2CH4 A;  4IUR A;  3BVG A;  1LTL A;  3TZD A;  1A2U A;  1BCP F;  1YVC A;  3CKI B;  4ZKC B;  4AQY Q;  4UY8 C;  3LNN A;  3T53 B;  3J81 c;  3OIP A;  4KD3 A;  1QJO A;  2GVA A;  5C5L A;  5C4X G;  1PZK D;  1STH A;  3EN2 A;  4RHS A;  4AYB B;  4R4C A;  3F8T A;  1G6Z A;  4IUU A;  3HOW G;  5JOB A;  3D3R A;  1D5X C;  3FPP A;  1B70 B;  3I7F A;  4HJ8 A;  2YV5 A;  3M4P A;  4H7B A;  2L0C A;  4QY7 A;  2UUC L;  1QIL A;  2L4N A;  1W3S A;  3QWN A;  4LFA L;  1CQF A;  1QUQ B;  2XRQ D;  2K75 A;  4IPD A;  3F2C A;  5ELO A;  1CTM A;  1TY2 A;  1VQC A;  2WAQ G;  4JI0 L;  1GUS A;  1PH7 A;  1CT1 D;  5KNB A;  3G7L A;  1VQ4 A;  4CDC C;  2IX1 A;  1EEF D;  3KOJ A;  4M8A A;  1MHW C;  1TY0 A;  1I94 L;  3OTO Q;  3VR4 A;  3KBG A;  3NTH A;  5EJW A;  1S72 A;  3KDF B;  1MSH A;  3F1Z A;  2RF4 A;  4FF4 A;  4C1N I;  1EY0 A;  2R92 B;  2FFK B;  4X64 Q;  3J81 L;  4KN7 C;  1HFN A;  3HOZ B;  1DON A;  2VXW A;  1VQ7 A;  3VYS A;  5COR A;  1I4P A;  1VQM A;  1FNV A;  4LF8 Q;  3NUC A;  3D4D A;  2B63 G;  5J22 A;  2UUB Q;  1NCV A;  4JI7 L;  5C4X H;  1YNN C;  4DV1 L;  5JJL A;  2K01 A;  2B2V A;  2JA9 A;  3HOW H;  2E2H H;  4PMB A;  1TWF B;  2G5D A;  1QVG A;  3FMC A;  1AP0 A;  1BQQ T;  1VQ6 A;  2ID0 A;  3W1G A;  3F2U A;  4DV0 L;  1X3P A;  1PTO C;  1Y8O B;  2SEB D;  4NKL A;  3KLW A;  3RLO A;  3L2P A;  2QA4 A;  2F0G A;  3TBI B;  3S2D H;  5LMU Q;  1IL2 A;  2EQS A;  1SE4 A;  4KHV A;  3TQY A;  5KND A;  3DM3 A;  2F4V L;  3A5Z B;  1UAP A;  3SK5 A;  2KCC A;  1NAP A;  1UWV A;  3FKI B;  4KD4 A;  2MNA A;  3HOX B;  3I73 A;  2PPB C;  1CUK A;  4B9W A;  1V43 A;  1XWE A;  1AE2 A;  3K58 A;  5EPJ A;  1XNR L;  2NWG A;  4MTK A;  3HKZ G;  3E0J A;  4NMZ A;  4JI8 L;  1SEB D;  4LF7 L;  5CR3 A;  1PDQ A;  3UE0 A;  4RHR A;  1VQJ A;  4A3K B;  2NZO A;  1X54 A;  3GTP B;  4N9T A;  5C0X I;  4HCS A;  3MVV A;  1BUV T;  3KF6 B;  5C44 H;  1B1Z A;  2B63 H;  4OXP A;  1FJG Q;  2V1C C;  1SAP A;  3FVQ A;  4BS9 A;  1VQN A;  1CZG A;  1Y1W H;  3WOE A;  1VQ9 A;  4IJL A;  4JI1 Q;  2UUA Q;  2N88 A;  1F77 A;  2ZTE A;  4F7X A;  4ZK9 B;  4A3G B;  4FXD A;  1J8I A;  2K03 A;  1K8G A;  4BY1 B;  4CDF C;  4EX5 A;  4AIM A;  1RIP A;  1PV4 A;  2DJF C;  4IPG A;  5J1Z A;  3NE5 B;  2KCT A;  5D65 A;  3PGZ A;  2NVT B;  5IIF A;  2B2W C;  1S5C D;  5M5W H;  1F9S A;  4ZCK A;  1W6K A;  1M4V A;  3C2P A;  3H3V H;  3I4N B;  2IT1 A;  1WD1 A;  2PO4 A;  3CAM A;  2WAC A;  3QOL A;  4KJN A;  4BBR B;  3BDL A;  3V96 A;  5FJ8 G;  2PQA B;  1TU2 B;  2B2U A;  2VQF Q;  2OTJ A;  1TXY A;  1U4P A;  2Q8R E;  3IFD A;  4K8J A;  5ELD A;  2MPM A;  4DV4 Q;  4IUQ A;  3T16 A;  2JA8 B;  5E4X A;  1WTP A;  2R7Z B;  1EY9 A;  2WKC A;  3AQQ A;  3GO5 A;  1ICF B;  1GUN A;  2Z6K A;  4WJW A;  1Q46 A;  1IZ6 A;  2HIX A;  3PF4 A;  1DYQ A;  1I3Q B;  1SXT A;  1XNQ L;  3M4Q A;  1A8V A;  5GAG C;  1VCI A;  1H9J A;  1G91 A;  2F0T A;  5I6Y A;  3GTO H;  1BOS A;  2Y0S E;  1PLF A;  2A5H A;  1Q90 A;  4ME5 A;  3W5O A;  5JEA G;  1UE6 A;  2XRS D;  4YIJ A;  1U4M A;  1Z9F A;  2EYO A;  2IHE A;  3BYY B;  1SRO A;  3AFQ A;  2K1B A;  1JIC A;  1X3Q A;  2QDL A;  4A93 B;  1NSN S;  4E6I A;  2UUC Q;  1SNP A;  2Q2I A;  4JI6 L;  1FVI A;  4PNY A;  4C2M B;  3AB9 A;  5CV7 A;  2Z8L A;  2ASB A;  4MHE A;  3UDX A;  4A3E B;  1X6O A;  2VNU D;  4GLV B;  2ZXR A;  1DXM A;  2XVS A;  4YHH L;  4R8N A;  4XT1 B;  4OL7 A;  5FJ8 H;  4DK3 C;  4JI0 Q;  3S14 H;  1BCP D;  4DV6 L;  3MHB A;  1FR3 A;  1Q8I A;  4PV1 C;  3TDQ A;  1GUO A;  2RDH A;  4FF2 A;  5NUC A;  1EQV A;  3DLL A;  2TSS A;  5C4Z A;  2HHH Q;  3ERQ A;  4DR1 L;  5C4J B;  4X66 L;  4DR5 L;  2CWP A;  4IPC A;  3D31 A;  3J7Y W;  5AJ3 Q;  4K2K A;  3J80 i;  1SNC A;  1BF4 A;  1OXU A;  3U58 A;  4BY7 G;  1RJT A;  3FKI G;  5JJZ A;  3HOX G;  5JVG 3;  5HGQ A;  5M3F G;  4GZY C;  4DK1 A;  1PH6 A;  4JI7 Q;  3EIV A;  4IUN A;  4G7Z C;  4DV1 Q;  3P20 A;  5JEA H;  2EDG A;  5G3L D;  1P16 A;  3S1R B;  4RCO A;  2BE5 C;  1OTC A;  3IKJ A;  1U4R A;  3K7A H;  1JMC A;  3CCR A;  2L11 A;  4CKE A;  4KK7 A;  2EXZ A;  4X3S A;  3S15 B;  2CHB D;  4CJ2 C;  3PO3 G;  4L6T B;  2JYO A;  3HOY G;  1STG A;  1DGS A;  2A6E C;  2DY7 A;  2X6G A;  3BDO A;  1TWG H;  2F4V Q;  1VQG A;  1HRJ A;  4DR2 L;  4O0A A;  1LT4 D;  4WJ4 A;  1KTK A;  5T1G A;  2A68 C;  2F0D A;  4Y52 H;  1SMY D;  4O2D A;  4EGV A;  2K7V A;  4GN5 A;  2ZXO A;  5FO8 B;  4A3I G;  1Y14 B;  1K9M C;  4JI8 Q;  4A3G G;  4LF7 Q;  2B2Y A;  4BY1 G;  1UNS A;  3A8J E;  5EBD A;  1HZC A;  5FLX E;  4A3F B;  1HUN A;  1SNQ A;  4BY7 H;  3FKI H;  4LF4 L;  2N8N A;  5IOC A;  2KOL A;  3I70 A;  4A3B G;  1RL2 A;  5M3F H;  2KEN A;  3I4N G;  1F2L A;  5LHY 1;  3PIP 3;  4NDX A;  1TWC B;  2FHT A;  2OT2 A;  4IO9 A;  1WCM G;  1XXG A;  4B3R L;  3HOV B;  3KLS A;  5BR8 Q;  1FD7 D;  4UDU C;  2Y0S G;  2N55 A;  3IRB A;  1LM0 A;  3TSS A;  4C56 C;  5FK9 C;  3OWE B;  1WTH A;  3STB C;  1DOM A;  3PO3 H;  4MTN A;  1PH8 A;  3HOY H;  1E7Z A;  2QW7 A;  1EZ8 A;  1L0Y B;  1EIG A;  4X62 Q;  1F9P A;  1BR9 A;  1I4R A;  1CQV A;  3QR8 A;  4JCV E;  1GUG A;  1H9M A;  2F52 A;  4A3I H;  4DU9 A;  2NUC A;  1SE2 A;  1A3U A;  3EA6 A;  5EPL A;  3SEB A;  2E2D C;  1L2F A;  3PV0 A;  1SNO A;  5CV6 A;  3JAM i;  4KY7 A;  4P73 A;  2LXJ A;  4QJF A;  1K8M A;  4XIG S;  3A54 A;  1HZ9 A;  5E1F A;  1LTT D;  1R4Q B;  3RZO B;  4A93 G;  3PIO A;  3NWT A;  4A3B H;  1S4Z A;  3M85 A;  3UDG A;  4DV7 L;  1BBX C;  4N9P A;  2PZT A;  3NBI A;  1WCM H;  1K83 B;  1V1P A;  5T1I A;  3CW2 C;  1NY4 A;  1TS5 A;  3DWP A;  4R9W A;  1J9O A;  3S1Q B;  4RFB A;  2N49 A;  2OWO A;  3MFG A;  4HMJ A;  5D3I B;  4RKB A;  1PHJ A;  1SDF A;  1F2M A;  3OYY A;  4HTH A;  4G7H C;  4WOR A;  3ULL A;  3RN5 A;  1Q8K A;  2A69 C;  3Q0A A;  4JI6 Q;  1XPR A;  3MWY W;  1JQY D;  3OWF A;  2AUJ D;  2D9U A;  3P1H A;  4JVZ A;  4CGY B;  1TQO A;  1VQ8 A;  4RMF A;  5JPN C;  3GTM B;  2PW5 A;  5IWA L;  4DV6 Q;  3U4V A;  4BBS G;  4N8X 1;  1CM9 A;  1PFS A;  2NVY B;  1HTL D;  2E2J H;  1HCZ A;  3O13 A;  4C3I B;  4DV2 L;  3HKS A;  2XSC A;  3K7U C;  2Z6B A;  1KAW A;  2JQO A;  4JW0 A;  4DR1 Q;  1Y1V G;  4X66 Q;  1BO0 A;  1A2T A;  1XTC D;  2L12 A;  4DR5 Q;  1G2T A;  2UXB Q;  2PW7 A;  5E7N A;  5C0X J;  2Q2H A;  2KCM A;  2C9O A;  3ONA B;  3Q22 A;  3CF5 A;  1U0L A;  2RBM A;  1LTG D;  5KEE A;  2NTS A;  3HGB A;  1JR0 D;  3LWU A;  3Q8D A;  2HDM A;  1PH9 A;  2ICI A;  4OGQ C;  1DM0 B;  5JPM C;  1N33 Q;  1SN8 A;  3BZK A;  3GTJ H;  1B44 D;  5KYL A;  2ZJR A;  2PNH A;  1SFO B;  2NVX B;  1F9R A;  4ZRZ A;  4QB4 A;  5HGT A;  4GNX C;  1NNX A;  1STA A;  4HID A;  1UEA B;  3NEN A;  3BVZ A;  4YWK A;  2EJM A;  1ML0 D;  2MP1 A;  1Q86 C;  4KKT A;  5F2D A;  1FGU A;  2MO1 A;  3KBX A;  4DR4 L;  3HRZ C;  3I56 A;  1E2Z A;  4A3D B;  2K5V A;  1EWC A;  4IAL A;  3TME A;  1ENC A;  1AFP A;  4K2L A;  1EU3 A;  2I0Q A;  3MA2 B;  4BBS H;  1WTV A;  1X32 A;  3PSI A;  4KJO A;  4JBW A;  2KJX A;  4OWT B;  5E3F A;  5FO9 B;  2ATW A;  3RNU A;  2QEJ C;  5ELC A;  3S15 H;  4UP8 A;  2J0T D;  3J7A V;  3FHW A;  3V05 A;  1Y1V H;  1XMQ L;  1DZ1 A;  2A19 A;  3S16 B;  5EPK A;  2F1M A;  1WTX A;  3S17 H;  2SNM A;  1O7Y A;  1G6P A;  1WJJ A;  3PUZ A;  4P71 A;  1B53 A;  4LF4 Q;  3GQB A;  1KDC A;  1HJP A;  1N34 L;  2KEC A;  1WI5 A;  2H1E A;  3EFX D;  5IP9 G;  4IOC A;  3AEV A;  1ESF A;  2DY8 A;  4DV3 L;  3QB3 A;  2R61 A;  2JE6 I;  1STB A;  2AMC B;  3H91 A;  5EKI A;  1RDP D;  3UE1 A;  4LF5 Q;  1SR3 A;  3KF8 A;  4DUZ L;  5BN4 A;  5C3W A;  1PH2 A;  1ZEQ X;  5IY0 A;  1I6H B;  3I3C A;  2RQX A;  1WYD A;  1PRT F;  3HOU B;  3K57 A;  3MXN B;  3DHQ A;  1EIF A;  1GHK A;  2JA5 B;  1Z7T A;  3M7G A;  4GN3 B;  3Q6S A;  4KY6 A;  1H9R A;  4LWC A;  1RD9 D;  2M9V A;  2PCF B;  4JI3 L;  4NPS A;  1MSG A;  2E5L L;  3NPP A;  2GN5 A;  4A3M B;  2OTL A;  2NYZ D;  1TWH H;  5EBC A;  5EGT A;  4ZQ3 A;  1DJR D;  2HIV A;  3GP7 A;  4H02 A;  2MGS A;  2KBN A;  1JJ2 A;  1YI2 A;  1B4O A;  2MO0 A;  2EYM A;  3R3O A;  3JAM E;  1UEB A;  5IP9 H;  5EAY A;  2HCI A;  5DEH A;  3UI2 A;  3I72 A;  1VQH A;  1IHZ A;  3KUP A;  5CBA E;  1SE8 A;  4EQO A;  5IGB A;  2AWO A;  3A55 A;  5G3L F;  2NB0 A;  2TMP A;  4AYB E;  1JOQ A;  1S5F D;  4DNI A;  3CC4 A;  2D2C C;  2K52 A;  1E3P A;  2KUM A;  1PFB A;  3NEM A;  4PMW A;  4C3J B;  2B2V C;  3A5U A;  3K59 A;  1M8A A;  3BZD B;  1TII D;  2H5X A;  1PTO H;  3D6C A;  4Y7N B;  3AFP A;  4DAV A;  2JA7 H;  3VR3 A;  1JC7 A;  2KCN A;  4JI5 Q;  1OXS C;  3RD4 A;  1I4Q A;  4O1N A;  1IBM L;  1SYG A;  4RA8 A;  3CCE A;  2WB1 B;  1IYU A;  3OSO A;  3ZJY C;  3TP6 A;  3V2T A;  4B08 A;  3M3Y H;  2YYZ A;  4PZ6 A;  1AW7 A;  5IGF A;  5DAU A;  2WV6 D;  5GQO A;  2F0I A;  5IWA Q;  2BE5 D;  3CQZ B;  3NXW A;  2JN4 A;  4GLX A;  3DXJ C;  5IGD A;  3GTG B;  1GJX A;  3SE0 A;  2B8G A;  4DV2 Q;  1AZP A;  1MJE A;  1SRU A;  4R4I A;  4A75 A;  1VMP A;  2KHS A;  2VS1 A;  5GAE C;  1S40 A;  4JV5 L;  1RTN A;  2WB1 E;  1WTW A;  1KIX A;  2M00 A;  3N52 A;  1OXX K;  4OIJ A;  4A3D G;  2EYL A;  1IW7 C;  2CH4 W;  2VB3 X;  5J3B A;  2CQO A;  3F2B A;  1VQF A;  2QCP X;  4GOP A;  1Q1B A;  4YCV A;  2NVQ B;  5M9O A;  1B8A A;  2Q2T A;  1HNW Q;  1Q7Y C;  4JI2 L;  5GAH C;  3AU7 A;  3PO2 B;  4F8M A;  2R7D A;  3RLN A;  4DXG A;  2C5C A;  3J7Z C;  4GKJ L;  1KAA A;  4H13 C;  1A0I A;  1LTR D;  4CJ0 B;  3PUV A;  2B2T A;  1A3V A;  4KN4 C;  2MUY A;  3TRE A;  2G9H D;  3H15 A;  1CZW A;  4OEL B;  3GTL B;  1V1P B;  1U9R A;  2QF7 A;  4ZYS A;  2E2I B;  3WWV A;  2E76 C;  1VQO A;  2O2L D;  2FMM A;  2M2L A;  1VQA A;  5KIX A;  1YNJ D;  2LSS A;  1ROD A;  4K8I A;  3NK9 A;  4NXN Q;  2BA1 A;  3M4O H;  1L1O A;  5AFW A;  3KYH C;  4F87 A;  2RVL A;  2RDG A;  2NVX H;  1QWY A;  3UDI A;  1LYL A;  2CW0 D;  3R93 A;  1QOH A;  4A4I A;  1KL9 A;  2Z0S A;  2IJ0 A;  4NXM L;  3GTQ H;  1HA5 A;  1HZA A;  2R93 G;  1NBW A;  3MXU A;  3P7J A;  4DR7 L;  1XMQ Q;  1PH5 A;  3TS2 A;  2B2U C;  2JA5 G;  3AMU A;  1NR4 A;  3M9B A;  1TWA H;  3NWS A;  4A3D H;  4CJ1 B;  2F4I A;  1I4G A;  4LFC L;  3QJY A;  4ID6 A;  1EZ6 A;  1ILQ A;  3K8A A;  2RKS A;  2Z6K C;  4DV3 Q;  5CV9 A;  2JA6 B;  4WFN 3;  1N32 Q;  1D1I A;  4B3M Q;  1R9T B;  4A3M G;  4AYB G;  1CSQ A;  4LF9 L;  4QUC A;  5HY6 A;  1S5D D;  2DJG C;  5M5Y B;  3K0Y A;  4DUZ Q;  1XMO L;  1PXU A;  2J4X A;  1CSP A;  3P75 A;  2A6H C;  3CC2 A;  5LL6 S;  1TVX A;  2GVB A;  1D5M C;  3IL8 A;  4HIM A;  4ILW A;  4K6D A;  4JK1 C;  3S2H B;  3GTK H;  4DAY A;  1RTO A;  5JEA J;  4R4T A;  5ELB A;  1KD1 C;  1MBY A;  1JWS D;  3I4M B;  2PI2 A;  2A8V A;  1UE7 A;  3JC6 6;  4JI3 Q;  5IT9 E;  1I6H H;  2E5L Q;  3H3V C;  1PTO F;  2R93 H;  1PZJ D;  2RHQ B;  4C3J G;  3RZD B;  2ICE C;  5J39 A;  1ZYR D;  2JA5 H;  4FP5 D;  1J5E L;  2R92 G;  4QQB X;  4CKC A;  5M3M B;  1HXY D;  3ZYY X;  1PRT D;  3HOZ G;  3CCU A;  4LFA Q;  4DA2 A;  3CXC A;  1D7Q A;  2R7F A;  3H09 A;  1F2Y A;  1PYS B;  2WB1 G;  1YIJ A;  2BCO A;  4YY3 L;  4A3M H;  4GNX B;  4R8I A;  1CA6 A;  1CKN A;  4B9X A;  2LY7 A;  4IN3 A;  1KRS A;  1QZG A;  3MEF A;  3ND8 A;  2MHV A;  1EIY B;  4IUV A;  3S24 A;  3VR5 A;  1I94 Q;  4IJH A;  4N8F A;  3SK6 A;  1GKH A;  2DNE A;  4LK1 C;  1XPO A;  2IX3 A;  1EYA A;  3E5S A;  1NJI C;  3FRP B;  1GD7 A;  2F0L A;  1VQD A;  1ZXT A;  1NUC A;  1GM5 A;  2E75 C;  1EY7 A;  1HQR D;  2F0M A;  2YU9 B;  1QVF A;  4RG1 A;  1BNZ A;  1K3B C;  2L1B A;  2IW3 A;  5I9O A;  1IBM Q;  4FDB A;  2F0N A;  2D5D A;  4B3T L;  3KF8 B;  1X56 A;  1D8L A;  1A6X A;  2DGY A;  1JE5 A;  5M5X B;  3ERO A;  3K5M A;  1Q3L A;  3NTI A;  4KHP L;  2KA7 A;  3U9O A;  4C3J H;  5FLX L;  3PO2 G;  5ELF A;  2ZJP A;  2FMC A;  4L5Q A;  2R92 H;  2K04 A;  4HMI A;  4A3K G;  2EY6 A;  4DV0 Q;  2BA0 A;  3D4W A;  3HOZ H;  4ZKB B;  2QIL A;  4XTC S;  3GDE A;  5FOB B;  2Z4I A;  2B2Y C;  1HNZ L;  1WD0 A;  4FF3 A;  3C46 A;  3G48 A;  1XJV A;  1X3E A;  3T56 B;  1J6Q A;  1C9O A;  4G7O C;  1TWF H;  4PZ8 A;  2X69 A;  1EEI D;  2CQA A;  4XYO A;  1XTD A;  3CRK C;  1XNR Q;  3S1M B;  5IYC G;  5E4W C;  1CHP D;  2IWH A;  2N78 A;  4H44 C;  3BVM A;  4BWG B;  3E3X A;  5C3E B;  1K28 A;  1HHV A;  1G8Z D;  2H4O A;  1X9N A;  1JWU D;  4RGM A;  1QUQ A;  2LXK A;  4ZUJ A;  1LT3 D;  2WFW A;  1BBU A;  3HOX H;  1SNM A;  2O5J C;  1JJG A;  2NVQ H;  3D4R A;  1HFG A;  2WKD A;  2UU9 L;  4BBR G;  2JA6 G;  1EU4 A;  3SXH A;  3PO2 H;  5L37 A;  1H9S A;  4OHJ A;  4X3T A;  1KLU D;  1LTI D;  4Q0F A;  4A3K H;  1IYJ B;  2LMC B;  2UXC L;  3KDF A;  3GTP H;  4TKO B;  2QEX A;  1S3O A;  2JA8 G;  4IPH A;  2R7Z G;  1JOO A;  3ICE A;  4NXM Q;  1AN8 A;  3KJP A;  4ZAI A;  2F3V A;  2Z1C A;  2VY3 A;  1FNW A;  3R2T A;  1LTB D;  5DNF A;  2A73 B;  1FNU A;  1C8C A;  4MN3 A;  4LFC Q;  4YCW A;  2RSO A;  5IYC H;  3NBH A;  2I5M X;  4POF A;  2Q2U A;  4A3G H;  5IP7 G;  4BY1 H;  3K80 C;  2CCZ A;  1RF2 D;  3I8Z A;  5I2X A;  3DM1 A;  4I7Z C;  4LF9 Q;  3PUX A;  2RCF A;  1HZB A;  3LGJ A;  1K0R A;  2NZH A;  3URY A;  2NVT H;  1XMO Q;  1S5B D;  5CMD A;  2EJF C;  5DLQ E;  1WTR A;  3E9H A;  2RA4 A;  5LMN L;  3TP8 A;  4LF6 L;  3I4N H;  3H94 A;  1HA6 A;  3S1N B;  4LUV A;  1EQT A;  4A3E G;  5EKL A;  5GAD C;  1ILP A;  4BBR H;  2JA6 H;  3J7A 5; 
#chains in the Genus database with same CATH homology
 1LAC A;  2LS0 1;  1XNQ Q;  1Y8P B;  1H9K A;  4C3H B;  3A0J A;  3CPW A;  2MFI A;  4DAM A;  1JJC B;  3TP7 A;  1EFI D;  1HNX L;  1Q1E A;  1PFN A;  5LL6 X;  1II3 A;  4J15 A;  4EQN A;  3T4A C;  2JA8 H;  3I90 A;  4YCU A;  4BA2 I;  2R7Z H;  4M1U B;  3HP3 A;  1A15 A;  5JAV A;  4HIO A;  4JOI A;  3SK4 A;  2V4D A;  4G57 A;  1J5E Q;  4A3J B;  1I3Q H;  3KF6 A;  4X6A H;  3S2H H;  4FXK C;  1I4H A;  1SYC A;  1DD2 A;  1SND A;  2K33 A;  2O5I C;  1V9P A;  2NBF A;  4DR6 L;  3C1F A;  1EWH A;  3T1H L;  3OTO L;  4XXE A;  5C4X B;  1EFW A;  2AUK A;  5CV8 A;  5IP7 H;  1C48 A;  4ABN A;  1SBB B;  2VZA A;  4P74 A;  2VL6 A;  4YY3 Q;  4YHH Q;  2R6G A;  3PF5 A;  1VQ5 A;  3I91 A;  1YNN D;  1JE4 A;  1ET6 A;  3QO2 A;  3PIP A;  5D14 A;  1Z47 A;  4BA1 I;  1SYE A;  4RCN A;  1EYC A;  2SNS A;  3NP8 A;  3D6W A;  4GS3 A;  1EY6 A;  4A93 H;  3S2D B;  3UDF A;  4C2M H;  1PTO D;  3VR2 A;  3K5O A;  4HAE A;  5IOD A;  5CBE E;  4A3E H;  5KGU A;  1HH2 P;  1BCP C;  1TS3 A;  4R4O A;  3D8G A;  4QF4 A;  4F88 A;  1PA6 A;  2KED A;  3A8K E;  1VQL A;  4PG3 A;  1JWM D;  4MIU A;  5JVH 3;  3HZX A;  5C5M A;  4DR3 L;  4CKB A;  1RKN A;  3J80 E;  1SSO A;  3CP0 A;  1HR0 L;  5LMU L;  4B3T Q;  3WOF A;  4NW2 A;  3A56 A;  1I50 B;  3J81 i;  4KHP Q;  5C4J H;  2PYK A;  5C3E G;  2AQ3 B;  2O4X A;  2UXD L;  1T5X D;  2FJ2 A;  5DM6 3;  4A3F G;  4KY5 A;  5C44 B;  2ZXP A;  3HFZ B;  4K5V A;  4OON A;  3TP5 A;  1Y1W B;  2MQH A;  3JAM c;  2ES2 A;  1MKH A;  3GD7 A;  2PMZ B;  4QMG A;  4IFD G;  4JI4 L;  3IFT A;  4YWM A;  2AHO B;  2X6L A;  3IAY A;  4DR2 Q;  3S1R H;  2ZTD A;  5CYU A;  1CFM A;  1ASY A;  3RUZ A;  4LAA A;  1EQQ A;  1P8L A;  3HOV G;  1B50 A;  4L5S A;  2I5H A;  4X65 L;  2F0F A;  4DUY L;  3N6R A;  1MD2 D;  2PQE A;  3J81 j;  1A63 A;  3SVM A;  2IHF A;  4DV5 L;  3CHB D;  2K50 A;  1SMY C;  4DPG A;  3RLF A;  2UUA L;  2BOS A;  2XGT A;  1JOK A;  1CI3 M;  2AQ2 B;  1B9N A;  3A8I E;  3OOC A;  4TSS A;  2EJG C;  3D0F A;  4L5T A;  5EKK A;  3CD6 A;  5IYD G;  4OX9 L;  2IL8 A;  2SOB A;  2UU9 Q;  2DNC A;  5C3E H;  3ULP A;  4RGN A;  5I2Y A;  2QGQ A;  1VQP A;  2F0V A;  4B3R Q;  4A3F H;  1KC8 C;  3JAM L;  2UXC Q;  2JP1 A;  1WTO A;  4DFA A;  4A3L G;  1SE3 A;  4K14 A;  4QGU A;  1O80 A;  2F0P A;  1C4Q A;  4PQX A;  4IFD H;  1D2B A;  1TWC H;  3TEH B;  2VQF L;  4CBV A;  4C3H G;  3BG3 A;  1PMR A;  4DV4 L;  3TRZ A;  1N36 L;  1JOR A;  4XQJ A;  3HOV H;  4IUT A;  1IBL L;  5COY A;  1STN A;  3NQI A;  2RCN A;  2ZTC A;  1CK1 A;  3I55 A;  3A7A B;  1X3G A;  2XN9 C;  2QDB A;  1BBW A;  1XYI A;  4HJ7 A;  4JBJ A;  2AQ1 B;  2EXD A;  4K5W A;  2F3I A;  1OXT A;  2L9H A;  5A2Q E;  4A3J G;  1V8Q A;  3CCS A;  2K5Q A;  1PYW D;  2JEB I;  1AE3 A;  3VYR A;  1L0X B;  3G6E A;  1O7I A;  4NP5 A;  4K0K L;  3MEH A;  4ULL A;  3QIA A;  5LMN Q;  4LF6 Q;  3KLR A;  2VUM B;  4DV7 Q;  5IYD H;  2JEA I;  4JYA L;  3S14 B;  1YHB A;  1VDZ A;  3ERS X;  2HDL A;  4FXG C;  4P75 A;  1C7Y A;  4KMU C;  4XYQ A;  1EY4 A;  3MZ5 A;  2C35 B;  3ULJ A;  3W3A A;  3CCJ A;  3EQL C;  1HNX Q;  4HSP A;  1LT5 D;  3RZO H;  2JXM B;  1OXV A;  1K8A C;  1NMG A;  3C3L A;  4A3L H;  3LX0 A;  4C3I G;  1EOT A;  3PUY A;  4AH6 A;  1ENF A;  3S1N H;  4KLK A;  1VF5 C;  4ZUI A;  3ND9 A;  1G51 A;  1IKL A;  5CC4 A;  1G29 1;  1VQI A;  2GA4 B;  1QE6 A;  1LTS D;  1K83 H;  3G4S A;  3M7N A;  4C3H H;  4OO1 G;  1ASZ A;  5ELN A;  4DGZ A;  1E1T A;  4DR6 Q;  2EY5 A;  1H9S B;  3T1H Q;  3CMA A;  2HHH L;  4BXX G;  3S1Q H;  4QIW B;  3OHX C;  5AJ3 L;  1GVP A;  3K7A B;  3AYH B;  1PZI D;  1H95 A;  4J1M A;  1IL8 A;  4L5R C;  1XX8 A;  4FO2 A;  4GN4 B;  3VYT A;  1EOV A;  4A3J H;  4GOP C;  3L3O C;  1Z6H A;  2I07 B;  5C44 G;  1T9H A;  1SYF A;  4KKU A;  4WJ3 M;  1TWG B;  1CKO A;  1Y1W G;  1Q12 A;  4LUO A;  1YNX A;  3NBH B;  2XTI A;  1S5E D;  1ICW A;  4X3U A;  2A6E D;  3EVQ A;  4KV6 A;  3CME A;  4QIW E;  1YJW A;  2B2T C;  2ENB A;  3WDN A;  3GTM H;  1K3R A;  5FO7 B;  1NMF A;  2A68 D;  4EQ5 A;  1YZ6 A;  4DR3 Q;  2ZM6 L;  5DM7 3;  2L5T A;  4ME3 A;  3KK7 A;  1HR0 Q;  3BJU A;  1EY5 A;  2NVY H;  5IT9 c;  1TKW B;  3MTS A;  3K0X A;  3X3N A;  4C3I H;  5K36 G;  4J6H A;  1PH1 A;  1B3A A;  1STY A;  4BY7 B;  3K5L A;  1L1O C;  1AEX A;  1EQR A;  2K5H A;  3VYU A;  2UXD Q;  1I4X A;  4OO1 H;  4H0L C;  5M3F B;  3J81 E;  2PZW A;  2DUD A;  1DCZ A;  3H6M A;  3KFU A;  3KLS X;  4BXX H;  4EQP A;  2F0K A;  1W6J A;  4DR4 Q;  1D5Z C;  1E2V A;  1NE3 A;  1EYG A;  1WVL A;  2F0U A;  1KRT A;  3T1Y L;  1I50 H;  4JI4 Q;  1D1K A;  3BDC A;  4FVM A;  2CFM A;  1VQB A;  1SLJ A;  1GXD C;  2CKZ B;  1M90 C;  2F0Q A;  1SFO H;  1N9W A;  4IFD I;  3PO3 B;  2WII B;  3PUW A;  1TS2 A;  3MC0 B;  4Z9C B;  5A35 A;  3A74 A;  3HOY B;  4X65 Q;  3VR6 A;  4DUY Q;  4RGT A;  3EBE A;  2PZU A;  1C0A A;  3STB D;  3HOU G;  2WP8 J;  5IGG A;  4MNO A;  2HQE A;  4DV5 Q;  1U4L A;  2Q8T A;  1G2S A;  3MFY A;  5BR8 L;  4O42 A;  3LWE A;  4DK6 C;  5IT9 L;  4HCE A;  4A3I B;  5GRO A;  1N34 Q;  4B3S L;  2KEE A;  1QNK A;  1SYB A;  2OQ0 A;  3SHL A;  2BH2 A;  4OX9 Q;  5K36 H;  5IGC A;  3G71 A;  2K32 A;  1O7Z A;  4X62 L;  3S16 H;  1KAB A;  1LO5 D;  4LFB L;  1GOZ A;  1LAB A;  1JB7 A;  5TSS A;  1GHJ A;  2EYJ A;  4UPA A;  1JB3 A;  2EPB A;  5D3D A;  1UE5 A;  4A3B B;  1IKM A;  4TVA B;  4RWS C;  3L9A X;  2IY5 B;  2LKV A;  1VS0 A;  1YHQ A;  1PRT B;  4J8Q A;  4HJ5 A;  2ZJQ A;  3QOJ A;  4LNQ A;  2VUM G;  1WCM B;  4EVO A;  4TRD A;  4K5X A;  1W2B A;  1NTG A;  2OXP A;  1LV9 A;  2Y0S B;  3CU7 A;  4S3S A;  1KXL A;  2B2W A;  3I4O A;  3VA5 A;  1BCP B;  1N36 Q;  3MXP A;  3J7A F;  1QZH A;  1IBL Q;  1B2T A;  3I2Z A;  1F2Z A;  4JC0 A;  5C3X A;  4QL5 A;  1SJH D;  5IGE A;  3HOU H;  5CGK A;  1N8R C;  4GKK L;  2MJ8 A;  1MI2 A;  3DMU A;  5FLX c;  1SJE D;  2K5W A;  1PH4 A;  5FKA C;  3CCV A;  2K4K A;  4FNF A;  5KRU A;  1WOC A;  1F9Q A;  2YTV A;  2F0W A;  4K0K Q;  2A69 D;  3TZU A;  1QG7 A;  5JJK A;  4XT3 B;  1QVC A;  2D0O A;  4U67 3;  1JT8 A;  4JYA Q;  4P2C B;  3S9W A;  1KNA A;  5LMN W;  2K5D A;  1YBY A;  4IUP A;  4IQZ A;  4DKA C;  3EJI A;  3C1E A;  4Q5V A;  3L7Z C;  2E2J B;  1BKB A;  2ALY B;  1OO9 B;  1E22 A;  1IBK L;  2EOT A;  2VUM H;  1KQS A;  1WFQ A;  1EUJ A;  1PH3 A;  4V0B A;  3SR1 A;  5IYB G;  2HQL A;  5JJI A;  3CCL A;  3HEJ A;  2KVM A;  1GUW A;  2VQE L;  1U5K A;  3L0O A;  1I5F A;  3BU2 A;  4QUF A;  3GV3 A;  1M1K C;  2EIF A;  4R1J A;  3GTJ B;  4OO1 I;  1LT6 D;  2FXQ A;  2UXB L;  1QCB D;  3HS0 C;  1YEZ A;  3I4L A;  1E1O A;  1PVO A;  1KDB A;  3DWA A;  3BS1 A;  4RAU C;  2AWN A;  1ESR A;  4Y7N H;  2XNA C;  3DEO A;  3MXN A;  2E8G A;  5FLM G;  5HUR A;  1AZQ A;  4UAI A;  5H1S E;  2OCE A;  2EYP A;  1KNE A;  2BDO A;  3U50 C;  2SDF A;  1N33 L;  1K8O A;  2HCC A;  4JV5 Q;  4BBS B;  4HJ9 A;  2K28 A;  3PIO 3;  3Q23 A;  3E0E A;  2CVR A;  5I6W A;  4LUZ A;  3SGI A;  4HJA A;  2NN6 G;  3CQZ H;  2ZM6 Q;  3G6J B;  3CCM A;  1Y1V B;  4C1N K;  4JI2 Q;  5C4H A;  3GTG H;  4RKL A;  1AH9 A;  4MZ9 A;  2NZ1 D;  2QKI C;  3S17 B;  4GKJ Q;  4RGO S;  1HR0 W;  5KYI A;  2XWB B;  4XQN A;  4QCL A;  2JK8 A;  1YHA A;  5IYB H;  1ENA A;  5BN5 A;  1BDO A;  4IZ8 A;  3E9I A;  4HIK A;  1PFM A;  2ZT9 C;  1HUM A;  2WIN B;  4PMC A;  5I4D A;  1Q82 C;  1RHP A;  2Z4H A;  3H0G B;  3CC7 A;  2F0J A;  3VA7 A;  3T1Y Q;  3H3V I;  1KLG D;  3OPO A;  1R4P B;  4YWL A;  3W2D A;  4JBM A;  3OMC A;  3SDZ A;  5FLM H;  5KNC A;  4L8J A;  1YNJ C;  1X3F A;  3GTL H;  4POG A;  1T5E A;  3T51 B;  1TS4 A;  2E2I H;  1GUT A;  2I46 A;  4DR7 Q;  3U4Z A;  4HSV A;  4LJZ C;  2B39 A;  2K14 A;  3ER0 A;  1YIT A;  1XPU A;  2CW0 C;  4LF5 L;  1V1O A;  2KHI A;  1KHI A;  3BZC A;  4DNT B;  3NTK A;  1GO3 E;  3MAQ A;  3I4M G;  4A76 A;  2G9D A;  4B3S Q;  2NN6 H;  4DXF A;  3J80 c;  1TWH B;  1CHQ D;  3PMF A;  3R8B A;  4ALP A;  4TQU S;  1K73 C;  1O7L A;  2JSO A;  3OMG A;  3DUZ A;  4FYD A;  2F0H A;  1MIU A;  4XDX A;  1VMC A;  1VF7 A;  2DN8 A;  4LFB Q;  4OWX B;  4AQY L;  1EL0 A;  2I5L X;  1CKM A;  1TR5 A;  3GV6 A;  5M3M G;  4OIK A;  3MXG A;  4DAP A;  1IXR A;  2HT1 A;  4FF1 A;  2N3S A;  4GOP B;  4JOI C;  2VW9 A;  5IE8 A;  1TT2 A;  4V19 0;  4P72 A;  1R9T H;  3R2I A;  2D62 A;  5M5Y H;  2XIW A;  1A3T A;  3BYT B;  5EQ0 A;  4L63 B;  1FYC A;  3FPU B;  2EVB A;  4PZ7 A;  5ISR A;  1WTQ A;  1PTO B;  2JA7 B;  4JG2 A;  4GKK Q;  1FGB D;  4DNR B;  4I65 A;  3FDT A;  2KHJ A;  4A3C G;  2J7Z A;  3J80 L;  4DF7 A;  3KJO A;  1X55 A;  1E2W A;  1YJN A;  3I4M H;  1L1O B;  2YTX A;  2F3W A;  3E6Z X;  3FEW X;  3A7L A;  4HR7 B;  4XQQ A;  3HOW B;  2IPK D;  3M3Y B;  3NEL A;  1NR2 A;  1ZYR C;  2E2H B;  1EIH A;  3TS0 A;  3X3M A;  2AKW B;  1O78 A;  2Q8I B;  1UE1 A;  2K5N A;  1SYD A;  1Y8N B;  4X64 L;  3RZD H;  3CCQ A;  1EY8 A;  1PRT C;  3K81 C;  3Q24 A;  4JI5 L;  3NQT A;  4LF8 L;  1DOK A;  1SMX A;  5M3M H;  3B6Y A;  2UUB L;  1EYD A;  2EY2 A;  1Y69 U;  1IBK Q;  2WAQ B;  2F0S A;  2F0O A;  4WRD A;  1EWI A;  2KQ3 A;  1QB5 D;  3OW7 A;  3NSW A;  1A62 A;  2EY1 A;  4RH6 A;  3TN2 A;  2K05 A;  1LUZ A;  2VQE Q;  3CPF A;  1IW7 D;  2RDF A;  2PQA A;  4DK0 A;  2B3G A;  1L0W A;  2JJQ A;  3HG9 A;  2OQK A;  4HED A;  4X3K A;  2PNR C;  2VB2 X;  1YJ9 A;  5CV4 A;  2OEO A;  3T13 A;  2WAQ E;  1Q81 C;  4IFD J;  4A3C H;  2B63 B;  1STE A;  2YU9 H;  4DAY B;  1HNW L;  4HN7 A;  4LMQ D;  5C6A A;  1HNZ Q;  3DEP A;  3NHH A;  3K5N A;  4KKS A;  5C0X G;  1VQE A;  1MJC A;  3H0G G;  5M5X H;  1BVS A;  5I9P A;  3M4O B;  1V1Q A;  2EYH A;  5ELE A;  1D6E C;  4IOA A;  1ET9 A;  4GLA C;  1CA5 A;  4CHT B;  2EE1 A;  4DN4 M;  3PCO B;  4UP9 A;  4LW1 A;  3SK8 A;  1HPC A;  4ODG A;  2A74 C;  2BH8 A;  3GTQ B;  3DWQ A;  1FJG L;  3CRL C;  4JBK A;  2LFN A;  3QG1 A;  2K6A A;  4OWW B;  3RN2 A;  5BN3 A;  5K5P A;  1VQK A;  1TWA B;  1PYB A;  3OIQ A;  5M5W B;  4NXN L;  3K6O A;  2YTY A;  2NN6 I;  4JI1 L;  4APV A;  1LLR D;  1HTP A;  2IX0 A;  2PI2 E;  3VDY A;  2PMZ E;  3RR5 A;  3F2D A;  1CKN B;  3HKZ B;  1FL0 A;  4GNX A;  2CWA A;  1B9M A;  3FP9 A;  3S1M H;  4UP7 A;  1ZKO A;  2HUG A;  1JCK B;  2XWJ B;  1LTA D;  2RHS B;  2EZV A;  2F03 A;  4KHZ A;  4K6L A;  5A2Q L;  1DOL A;  4R4Q A;  1MGS A;  2B8F A;  1ONL A;  3W1B A;  1QNU A;  1RCV D;  2NTT A;  4NB3 A;  2EYF A;  2OF1 A;  3ITP A;  1IYV A;  1N32 L;  2A6H D;  2RSN A;  2D0P A;  3HKZ E;  4B3M L;  1HQM C;  5C0X H;  4ZLT F;  3GTK B;  3H0G H;  1BXT A;  4G4K A;  2E74 C;  3GTO B;  4KTA A;  2B29 A;  2L15 A;  3M4Y A;  2FIN B;  1I6V C;  3RMH A;  4KI0 A;  2BDN A;  3U9S A;  2R93 B;  2A1A A;  2R3Z A;  1X65 A;  1E0B A;  1UUP A;  2F0E A;  2L55 A;  3OW2 A;  4U68 A;  1KDA A;  1E24 A;  1B7Y B;  2JA7 G;  5CV5 A;  4IUR A;  3BVG A;  1LTL A;  3TZD A;  1A2U A;  1BCP F;  1YVC A;  3CKI B;  4ZKC B;  4AQY Q;  4UY8 C;  3LNN A;  3T53 B;  3J81 c;  3OIP A;  4KD3 A;  1QJO A;  2GVA A;  5C5L A;  5C4X G;  1PZK D;  1STH A;  3EN2 A;  4RHS A;  4AYB B;  4R4C A;  3F8T A;  1G6Z A;  4IUU A;  3HOW G;  5JOB A;  3D3R A;  3I7F A;  1D5X C;  1B70 B;  4HJ8 A;  3FPP A;  2YV5 A;  3M4P A;  4H7B A;  2L0C A;  4QY7 A;  2UUC L;  1QIL A;  2L4N A;  1W3S A;  3QWN A;  4LFA L;  1CQF A;  1QUQ B;  2XRQ D;  2K75 A;  4IPD A;  3F2C A;  5ELO A;  1CTM A;  1TY2 A;  1VQC A;  2WAQ G;  4JI0 L;  1GUS A;  1PH7 A;  1CT1 D;  5KNB A;  3G7L A;  1VQ4 A;  2IX1 A;  3KOJ A;  1I94 L;  1EEF D;  4M8A A;  1TY0 A;  3OTO Q;  3VR4 A;  3KBG A;  3NTH A;  5EJW A;  1S72 A;  3KDF B;  1MSH A;  3F1Z A;  2RF4 A;  4FF4 A;  4C1N I;  1EY0 A;  2R92 B;  2FFK B;  4X64 Q;  3J81 L;  4KN7 C;  1HFN A;  3HOZ B;  1DON A;  2VXW A;  1VQ7 A;  3VYS A;  5COR A;  1VQM A;  1I4P A;  4LF8 Q;  1FNV A;  3NUC A;  3D4D A;  2B63 G;  5J22 A;  2UUB Q;  1NCV A;  4JI7 L;  5C4X H;  1YNN C;  4DV1 L;  5JJL A;  2B2V A;  2K01 A;  2JA9 A;  3HOW H;  2E2H H;  4PMB A;  1TWF B;  1QVG A;  3FMC A;  1AP0 A;  1BQQ T;  1VQ6 A;  2ID0 A;  3W1G A;  3F2U A;  4DV0 L;  1X3P A;  1PTO C;  1Y8O B;  2SEB D;  3RLO A;  3KLW A;  4NKL A;  3L2P A;  2QA4 A;  2F0G A;  3TBI B;  3S2D H;  5LMU Q;  1IL2 A;  2EQS A;  1SE4 A;  4KHV A;  3TQY A;  5KND A;  3DM3 A;  2F4V L;  3A5Z B;  1UAP A;  3SK5 A;  2KCC A;  1NAP A;  1UWV A;  3FKI B;  4KD4 A;  2MNA A;  3HOX B;  3I73 A;  2PPB C;  1CUK A;  4B9W A;  1V43 A;  1XWE A;  1AE2 A;  3K58 A;  5EPJ A;  1XNR L;  2NWG A;  3HKZ G;  3E0J A;  4NMZ A;  4JI8 L;  1SEB D;  4LF7 L;  5CR3 A;  1PDQ A;  3UE0 A;  4RHR A;  1VQJ A;  4A3K B;  2NZO A;  1X54 A;  3GTP B;  4N9T A;  5C0X I;  4HCS A;  3MVV A;  1BUV T;  3KF6 B;  5C44 H;  1B1Z A;  2B63 H;  4OXP A;  1FJG Q;  2V1C C;  1VQN A;  1SAP A;  3FVQ A;  4BS9 A;  1Y1W H;  1CZG A;  3WOE A;  1VQ9 A;  4IJL A;  4JI1 Q;  2UUA Q;  2N88 A;  2ZTE A;  1F77 A;  4F7X A;  4ZK9 B;  4A3G B;  4FXD A;  1J8I A;  2K03 A;  1K8G A;  4BY1 B;  4EX5 A;  4AIM A;  1RIP A;  1PV4 A;  4IPG A;  5J1Z A;  3NE5 B;  2KCT A;  5D65 A;  3PGZ A;  2NVT B;  5IIF A;  2B2W C;  1S5C D;  5M5W H;  1F9S A;  1W6K A;  1M4V A;  3C2P A;  3H3V H;  3I4N B;  2IT1 A;  1WD1 A;  2PO4 A;  3CAM A;  2WAC A;  3QOL A;  4KJN A;  4BBR B;  3BDL A;  3V96 A;  5FJ8 G;  2PQA B;  1TU2 B;  2B2U A;  2VQF Q;  2OTJ A;  1TXY A;  1U4P A;  2Q8R E;  3IFD A;  4K8J A;  5ELD A;  4DV4 Q;  2MPM A;  4IUQ A;  3T16 A;  2JA8 B;  5E4X A;  1WTP A;  2R7Z B;  1EY9 A;  2WKC A;  3AQQ A;  3GO5 A;  2Z6K A;  1GUN A;  4WJW A;  1Q46 A;  1IZ6 A;  2HIX A;  3PF4 A;  1DYQ A;  1I3Q B;  1XNQ L;  1SXT A;  3M4Q A;  1A8V A;  5GAG C;  1VCI A;  1H9J A;  1G91 A;  3GTO H;  2F0T A;  5I6Y A;  1BOS A;  2Y0S E;  1PLF A;  2A5H A;  1Q90 A;  4ME5 A;  3W5O A;  5JEA G;  1UE6 A;  2XRS D;  4YIJ A;  1U4M A;  1Z9F A;  2IHE A;  2EYO A;  3BYY B;  1SRO A;  3A