4IFDI

Crystal structure of an 11-subunit eukaryotic exosome complex bound to rna
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
291
structure length
230
Chain Sequence
MACNFQFPEIAYPGKLICPQYGTENKDGEDIIFNYVPGPGTKLIQYEHNGRTLEAITATLVGTVRCEEEKKTRRTVKNILVSVLPGNDFANNLPKEGDIVLTRVTRLSLQRANVEILAVEDKPAATFSVSQASSDLGETFRGIIRSQDVRSTDRDRVKVIECFKPGDIVRAQVLSLGDGTNYYLTTARNDLGVVFARAANGAGGLMYATDWQMMTSPVTGATEKRKCAKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title Crystal structure of an RNA-bound 11-subunit eukaryotic exosome complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
total genus 45
structure length 230
sequence length 291
ec nomenclature
pdb deposition date 2012-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF10447 EXOSC1 Exosome component EXOSC1/CSL4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ifdI02
2.40.50.880 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ifdI01
4JI8L 3CXCA 4IFDG 2E8GA 2PI2E 3HOVG 4PZ6A 4IFDI 1EFWA 2IT1A 1X54A 4C3HH 3G6EA 4A3MH 3F2DA 4R4TA 4DAMA 1WJJA 3RZOH 3HOXH 1WYDA 4LNQA 3A5UA 3K7AH 4RG1A 1A0IA 1ASYA 2I5LX 4DUYL 1N34L 1CSPA 2ZJRA 4DR4L 1XPUA 3LGJA 4YWMA 4B3SL 1VQGA 1KIXA 4PG3A 5JEAG 3F1ZA 4LUVA 2JA6G 2UU9L 4R4OA 3EN2A 2ATWA 2CFMA 4JI5L 1TWFH 1QZHA 3CCLA 1KRTA 4IJLA 4P71A 1UE5A 4LFAQ 4DV1Q 1TWAH 1VQOA 1Q86C 3T1HL 1U0LA 1JE5A 3PF4A 4OWTB 4UP8A 3S1RH 2R93G 2K4KA 1KC8C 4LUOA 3CCRA 2HT1A 1V43A 2QEXA 3CCMA 1WOCA 2VQEQ 2UUCQ 4JI2Q 1OXUA 5IYBG 1KXLA 4A3CH 4YCVA 2VS1A 1Q81C 2WFWA 3CC4A 2MNAA 4UY8C 4BXXH 1HNXQ 5HY6A 2PQAA 5IYCH 3CCSA 5JEAJ 4A3EG 1LM0A 2YYZA 4WJ3M 3U4ZA 4A3IG 1XMQQ 4JBKA 4YCUA 3CQZH 1L1OA 2I5HA 3GTOH 1YNXA 4JI6Q 3GTLH 5K36G 2HQLA 1B7YB 4GN4B 5C4JH 1NMGA 1S72A 3D0FA 1Q8KA 1YBYA 2HIXA 4MTNA 1HNWQ 4DUZQ 3KF6B 3TEHB 4IOCA 3TQYA 2UXCL 4LFCQ 1A8VA 1BKBA 1VQFA 2AKWB 5AJ3Q 3G4SA 3AQQA 4GLVB 3J81c 2WB1G 1W2BA 2NZHA 3KDFA 3HKSA 4DK6C 2R7DA 1B8AA 2K5NA 4X62Q 1BBUA 4DV0L 1N34Q 1N9WA 3HOYG 3S24A 1SROA 4A3GG 1PH5A 2BH8A 4KLKA 3I56A 2V1CC 4HIMA 1PH1A 1VCIA 4HJ5A 1IBMQ 3PO2H 1Y14B 3UE1A 4EX5A 4A76A 1EIYB 1PH3A 3GTMH 4DR4Q 1QVCA 4IOAA 2Q2UA 4B3SQ 2Z6KA 2VNUD 4QGUA 1HNZQ 4A3MG 1O7IA 5M3FH 2WAQG 3CW2C 3HOXG 3H0GH 4GNXB 2UU9Q 4HIKA 5JJIA 3H15A 5DLQE 4JI5Q 1GO3E 4J15A 4DR3L 4QIWE 3W1BA 3F2BA 3T1HQ 2OQ0A 3OYYA 4GOPB 4R4IA 3SGIA 4PMWA 1Y1WH 1Q82C 1TXYA 3I4OA 2R7ZG 2K5HA 2BH2A 2IX0A 1K83H 4LF9L 4A3BG 1HH2P 4DV2L 3Q8DA 3K81C 4R4CA 4JI3L 3GD7A 2VL6A 4OO1I 2A19A 5C4XG 2DGYA 4LWCA 2E2IH 5ELNA 3KJOA 2I5MX 1TWCH 4JI0L 2GVAA 2MFIA 2YTXA 3S1NH 3S2HH 1I6HH 4A3CG 3L7ZC 2RF4A 2JQOA 5LMNL 2CCZA 3CPWA 4KHZA 4BXXG 2MO0A 3CD6A 3MEFA 5JJLA 4JBJA 3E0EA 5IYCG 3S1MH 2JEBI 2D62A 1L0WA 1E24A 2ZM6L 4POGA 1NMFA 3NEMA 3PV0A 3J80c 4A3JH 1CKMA 3CP0A 2DUDA 1EYGA 1PH2A 2A8VA 3B6YA 4AQYL 3J81i 4LF5L 1CKNA 2JJQA 1QZGA 3GTQH 4LUZA 1EQRA 1CKOA 4ME3A 4O0AA 3RLOA 4Y52H 4DV0Q 1VS0A 4HJ7A 2PI2A 2MO1A 3M4QA 4HIOA 5FLMH 1C0AA 4C3JH 4HIDA 1KHIA 2Q2IA 1G6PA 1YHQA 3CC7A 1X56A 4GKKL 3CCQA 2RCNA 3ER0A 4NPSA 2E2HH 4YWKA 3ICEA 4XTCS 1N33L 1QVGA 1N32L 1PYSB 1WCMH 2E2JH 2KHJA 3ULJA 5GAHC 5M5XH 3FKIH 2N8NA 4DR3Q 3CPFA 3K7UC 1Q7YC 4JYAL 3J7ZC 1J5EL 3KOJA 5M3FG 1CSQA 2UUBL 4X65L 4RMFA 3H0GG 4IPHA 4AYBE 1EIFA 4GLXA 1SFOH 1DGSA 4LF9Q 5IE8A 4NXNQ 2LSSA 4DV2Q 1Y1WG 4JOIA 3NBHB 1YHAA 4AH6A 1MJEA 4LF4L 1UE1A 3F8TA 3NELA 4DR5Q 3H3VH 1KRSA 3T1YQ 1WFQA 1EUJA 1UEBA 1VQCA 2FXQA 5LMNW 1GKHA 2CWPA 4JI0Q 2RHQB 4Y7NH 1EOVA 1V1QA 4DR6L 2XGTA 2YTYA 4JC0A 2JA7H 5LMNQ 2D0OA 1TWHH 2LXKA 5ELOA 5C0XJ 2ASBA 4QQBX 2VQFL 1PH6A 2IX1A 4BBSH 4B3ML 3CCUA 2VZAA 2ZM6Q 1HZAA 2GN5A 1KD1C 1Q1EA 3J80i 3OTOQ 1JB7A 3GTGH 1BVSA 2F52A 4X64L 2NVYH 1X6OA 5GQOA 4AQYQ 4LF5Q 3KDFB 1X65A 1OXXK 1LTLA 4MZ9A 3I4NH 1HZ9A 3M7NA 1Z47A 4YHHL 4A3JG 1L1OC 2KENA 1LUZA 2LXJA 5IP9H 3NENA 1B70B 4DAYB 4A3FH 1FGUA 3I55A 4TQUS 1RIPA 2BA0A 1X9NA 2AWOA 1L2FA 1YHBA 1SN8A 2NVQH 3TS0A 1OXTA 5FJ8H 1PH9A 1PH7A 1K0RA 4XIGS 4OXPA 1S40A 2VUMH 4GKKQ 2KHIA 3DLLA 4JV5L 1IXRA 3CCJA 4L5RC 5FLMG 4JI1L 1PFSA 4GKJL 4JI8Q 1N32Q 5BR8L 4BA2I 2OWOA 3HOUH 3D31A 4DNIA 1SLJA 2PMZE 1K8GA 3W5OA 2N49A 4JYAQ 4LFBL 1J5EQ 5IY0A 4X6AH 2UUBQ 4X65Q 4O2DA 2K75A 1WCMG 3CMAA 4DUYQ 1HZCA 3ERSX 3FKIG 4YWLA 2Z6KC 4EQ5A 5M5YH 4DV3L 4B3TL 1C7YA 4GS3A 3JC66 5GADC 3I7FA 3UE0A 2K52A 1EQQA 3RN2A 1X3GA 3UDXA 4LF4Q 1JMCA 1VQJA 2IY5B 2UXDL 2EQSA 2Y0SE 1Q12A 4B3RL 4LF7L 4DR6Q 3KF6A 2QGQA 3EIVA 4X66L 3ULLA 1YJ9A 1XPOA 1XNQL 4OX9L 1GVPA 2VQFQ 3H3VI 1VQEA 1KQSA 4NB3A 2CKZB 2JE6I 4B3MQ 1J6QA 3I2ZA 2JA7G 3RLFA 4LF6L 4BBRH 3J81j 4QJFA 1E22A 1TWGH 3S2DH 4P74A 2CWAA 3STBC 2ID0A 1CKNB 1VQHA 4R4QA 4BBSG 4P72A 1YITA 1I5FA 4LF8L 3GTJH 3BZCA 4JBWA 4YHHQ 3G71A 3S14H 1SE8A 3FP9A 1IYJB 4H02A 2ZTEA 3STBD 3TREA 4DR1L 1XJVA 4JCVE 4OWXB 4YY3L 1HR0L 1GM5A 3GTPH 3I4NG 4R1JA 5M5WH 3M9BA 2UXCQ 5IP9G 2KCMA 4GNXA 1XMOL 2C35B 2GVBA 4DV6L 4A3FG 4NXML 4A3DH 1JT8A 4DR7L 2NZOA 3PIOA 4JV5Q 3KFUA 1OXVA 1V9PA 4GOPA 2KCTA 3G48A 4GN3B 1AH9A 3J7A5 4GKJQ 1SRUA 5M3MH 4JBMA 5FJ8G 2D0PA 5BR8Q 1HZBA 1NY4A 2VUMG 2WB1E 4OWWB 4DPGA 3PUYA 3EBEA 3IRBA 1AE3A 1QUQA 1PV4A 4LFBQ 4K0KL 1JJGA 4HJ9A 3GO5A 3KYHC 3RZDH 1X55A 1VQIA 2BA1A 3M85A 1N8RC 3HOUG 1FL0A 2PNHA 4DV4L 4B3TQ 1NBWA 1YEZA 3CMEA 2F3IA 2NN6G 3A74A 1GD7A 4DV3Q 1FJGL 1KAWA 2OQKA 4IJHA 5IYDH 5E7NA 3PO2G 3MXNB 4POFA 1XMQL 1PHJA 1YVCA 1SR3A 4A3LH 4WJ4A 3K0XA 3U4VA 5C0XG 4DV5L 1E1OA 3F2CA 3HOWH 5C0XI 2R7FA 2QA4A 4DKAC 2JA9A 3M3YH 2ZTCA 3CC2A 4QY7A 1K3RA 4DUZL 2WAQE 2UUAL 1K9MC 2UXDQ 4B3RQ 4LF7Q 2EIFA 3HOYH 2R92H 1Y1VH 3KLWA 2ZTDA 4X66Q 1XNQQ 1RL2A 4HJ8A 2B29A 2H5XA 3PSIA 1K8AC 4JOIC 4JI3Q 4OX9Q 2JA8H 3UDIA 4X62L 3GDEA 3DM3A 1D8LA 1E7ZA 2PQAB 4LF6Q 2F4VL 1IL2A 1X3EA 2EXDA 4DR2L 4TVAB 1XNRL 1U5KA 1L1OB 1IBML 3BZKA 4BBRG 4LF8Q 1HR0W 2N3SA 2ALYB 3OW2A 3HKZE 5IWAL 1MJCA 2YU9H 4DR1Q 1HNZL 1JJCB 4JI4L 4YY3Q 1M90C 1HR0Q 4C3IH 3E9HA 2UXBL 1NTGA 2Y0SG 3HOZH 4GN5A 1VQ6A 4UPAA 2R7ZH 2AMCB 1XMOQ 3UDGA 4DV6Q 4NXMQ 4FDBA 4DR7Q 3PCOB 3UDFA 1VQ4A 3ZJYC 4PZ7A 1K73C 1N36L 3E9IA 4A3BH 2VW9A 1VQKA 1A63A 3KF8B 5IP7H 5C44H 2MQHA 3S15H 4DV7L 1C9OA 3S16H 4IFDJ 4IPDA 5C4XH 5C3EH 4A3DG 5H1SE 1OXSC 4ALPA 1G291 3PUWA 3L2PA 5JJKA 2JA5H 1VQMA 2OTLA 3K80C 2AHOB 4BY1H 1I94L 1EWIA 1G51A 4AIMA 3AFPA 4K0KQ 5M3MG 4JI7L 3VDYA 4C2MH 4QL5A 2A1AA 4APVA 1YIJA 3AYHB 4DV4Q 3PIPA 1N33Q 1FJGQ 2K14A 2Q2HA 4A3KH 1VQDA 1XTDA 1VQ9A 1X3FA 3JAMc 4IPCA 1KL9A 4DV5Q 2ES2A 3PGZA 4A75A 4A93H 5IYDG 1PH4A 3S17H 3AFQA 3KJPA 4YCWA 3WWVA 1P8LA 4A3LG 3M4PA 2UUAQ 1SMXA 5GAEC 1YJWA 1BBWA 3I4MH 2CQOA 3PUZA 1I50H 3HOWG 4IPGA 1AE2A 2R6GA 2HHHL 2OCEA 2KBNA 4P73A 1IBKL 1VQNA 4KHPL 1NJIC 3CF5A 3L0OA 5LMUL 4BY7H 3RN5A 2R92G 1Y1VG 2F4VQ 2E5LL 2YV5A 2B63H 4DR2Q 1PA6A 3PO3H 1E3PA 1Q1BA 1VQBA 4LW1A 3U50C 4A4IA 4PZ8A 1YI2A 2VY3A 4L5TA 4L5SA 1XNRQ 1D7QA 3HOVH 2JK8A 3RR5A 5IWAQ 1IBLL 1VQ7A 4AYBG 4JI4Q 3M4OH 5GAGC 2UXBQ 1HJPA 4OONA 4X64Q 3HFZB 2JEAI 1E1TA 2K5VA 1OTCA 2Q2TA 1MIUA 4KI0A 3K8AA 3ULPA 2JA6H 3GTKH 1N36Q 3BU2A 1R9TH 2IHFA 4L5QA 3HOZG 1ASZA 1YJNA 5HGQA 4UP7A 4DV7Q 2HIVA 1YZ6A 1NE3A 1M1KC 1VQ8A 1QVFA 3AEVA 2R93H 4NXNL 4OO1G 1QUQB 5IP7G 2AWNA 5C44G 4GNXC 4DV1L 2I0QA 1I94Q 4LFAL 3A0JA 4DR5L 5C3EG 1Z9FA 1PH8A 3T1YL 3HKZG 5J3BA 5IYBH 3CCEA 1FVIA 4JI7Q 2JA5G 4JI1Q 5FLXc 4GOPC 1XPRA 3BJUA 4BY1G 2ZJPA 1Q46A 5IT9c 1VQAA 3CCVA 1CUKA 2VQEL 1MKHA 1T9HA 3JAMi 2UUCL 4A3EH 4JI2L 1UWVA 3PUXA 4MNOA 1PYBA 4GLAC 5EAYA 2WP8J 4A3IH 3RNUA 3OTOL 1VQ5A 1UE7A 3CAMA 2YTVA 4A3KG 1HNXL 2OTJA 3S1QH 1H95A 2NVTH 3W1GA 3TRZA 1S3OA 1IZ6A 2NVXH 1WI5A 4DK3C 4A93G 2NN6I 4BA1I 2HHHQ 2IHEA 1I3QH 4P75A 1IBKQ 4KHPQ 4JI6L 1JJ2A 5LMUQ 1P16A 1VQLA 3I4MG 3U58A 2N78A 2K50A 3PUVA 2B3GA 3RLNA 2E5LQ 2XTIA 3PF5A 2RHSB 1HNWL 1A62A 2Z0SA 1VQPA 4LFCL 2L15A 5AJ3L 1UE6A 3A5ZB 4UP9A 1LYLA 1W3SA 4BY7G 4A3GH 4JG2A 3FHWA 3TS2A 2JA8G 4HJAA 2B63G 1IBLQ 2ZJQA 3PO3G 1PVOA 5GROA 4IO9A
chains in the Genus database with same CATH superfamily
2WIIB 3DWPA 3PO2B 2E8GA 2PI2E 1AZQA 5T1GA 3NWSA 1X54A 3G6EA 3RUZA 4A3MH 2DJGC 2K6AA 3A5UA 3K7AH 1A0IA 2ZJRA 5KYLA 4DR4L 5IGCA 1VQGA 4PG3A 3F1ZA 2UU9L 2NB0A 2ATWA 4JI5L 1TWFH 1QZHA 2BDNA 1KRTA 4DV1Q 1U0LA 3PF4A 4CKBA 4UP8A 4XT1B 2R93G 2NTSA 2EJGC 4OHJA 1KC8C 1G8ZD 2QEXA 1GUNA 3CCMA 4QIWB 3MFGA 1QILA 2UUCQ 3QJYA 2NBFA 4UHVA 4DGZA 1Z6HA 1E2VA 3CC4A 2Y0SB 2MNAA 2PQAA 2RQXA 3FMCA 3S2DB 4DN4M 1ENAA 4JBKA 2ENBA 4YCUA 1L1OA 5M5WB 1YNXA 1HTPA 4A3DB 1NMGA 1Q8KA 2HIXA 4DA2A 4QUFA 3R2IA 2AKWB 2O2LD 3AQQA 4HTHA 4KN7C 3HKSA 1IKLA 2RSNA 1SEBD 4DV0L 3HOYG 3IFDA 3RZDB 1EYAA 5IGBA 4HIMA 3SEBA 1STAA 1DZ1A 2F0SA 3UE1A 1SYEA 4DR4Q 2Q2UA 1JOOA 4A3MG 4JW0A 3HOWB 1YNND 2WAQG 3CW2C 3LX0A 2UU9Q 4HIKA 3N6RA 5DLQE 4JI5Q 1GO3E 3W1BA 3F2BA 1Z7TA 2OQ0A 4GOPB 4FF2A 4R4IA 1BNZA 2B8FA 1CHQD 4OELB 3WDNA 2PYKA 4J1MA 2B8GA 4DV2L 2E2IH 1PZKD 2YTXA 3S1NH 3S2HH 2RF4A 1SJHD 1DOLA 4JBJA 1PZJD 2JEBI 1L0WA 3QO2A 4MTKA 3OHXC 3PV0A 4HMJA 4BWGB 3J80c 3BDOA 4RKLA 2A8VA 4WRDA 1YNJC 2FINB 1QZGA 3IAYA 1EQRA 2JN4A 3HRZC 4DV0Q 1JICA 5CMDA 2Q8IB 2PI2A 1CZWA 1RHPA 1CZGA 5A2QE 1G6PA 1K0SA 3VR6A 2EOTA 1KDCA 3J7AF 3GV6A 2HCCA 4EVOA 4UAIA 2RCNA 4DXGA 4RH6A 1PYSB 1KDBA 1WCMH 2KHJA 1ET9A 2J7ZA 2N8NA 3QB3A 4JYAL 2B2YA 1NR4A 3J7ZC 2F03A 1CSQA 2NZ1D 3OWFA 3ND8A 1SFOH 1XYIA 1GXDC 1JWSD 1CFMA 2I07B 5IGGA 4DV2Q 2B63B 3T56B 3PO3B 2AQ2B 3NELA 1KRSA 3T1YQ 1CI3M 1EUJA 1UEBA 3T13A 3MHBA 1EOVA 2JA7H 1R4QB 1LT5D 1G6ZA 1PH6A 3IFTA 2CQAA 2VZAA 2KEEA 2O5JC 4OEMB 5C5MA 3GTGH 1LTGD 3BVGA 1X6OA 5FKAC 1STYA 3TMEA 2MP1A 2NWGA 3QOLA 1EU4A 1LTLA 2ICIA 1WTHA 3HEJA 3M7NA 4YHHL 1LUZA 1B70B 2F0UA 2CW0D 4I65A 5HGTA 4TQUS 3I55A 1NAPA 2A69C 1LABA 2M2LA 1PH7A 1K0RA 4JV5L 1EY0A 3CCJA 4A3EB 5J39A 4JI8Q 1B2TA 4BA2I 3S1QB 3D31A 1SLJA 2PMZE 1K8GA 3W5OA 2NVTB 4JYAQ 3J7YW 5DEHA 1QOHA 1WCMG 4DUYQ 4IALA 4B3TL 4EQ5A 1H9JA 2WB1B 5ISRA 1C7YA 5DM73 3JC66 3X3MA 3UE0A 2F0WA 3PIO3 1CT1D 2K52A 2F0EA 1PTOH 1JMCA 2PQEA 4Q5VA 2Z8LA 2IY5B 4B3RL 1Q12A 2QGQA 3TP6A 1XNQL 3MXPA 1QJOA 4ZCKA 2BOSA 4I7ZC 2CKZB 4QMGA 3K5NA 4C3HB 3HGBA 3I2ZA 1SMYC 2JA7G 3RZOB 3HOXB 4QJFA 1QG7A 1TWGH 1EY5A 2DN8A 3S2DH 2CWAA 4IUQA 4K5XA 1EY9A 3BZCA 4JBWA 2EXZA 4YHHQ 3G71A 2R7ZB 2Z4IA 2K05A 2M9VA 3J7A5 2RSOA 5M9OA 3GTPH 4L6TB 3T4AC 4A3BB 2A73B 3S1RB 3M9BA 2KCMA 4NXML 2EYFA 1IYUA 1F77A 2NZOA 1RD9D 1SXTA 3K59A 4JV5Q 3KFUA 1S5BD 1OXVA 1AH9A 3U9OA 5M3MH 2D0PA 2F0KA 1NY4A 5IGFA 1D5MC 3IRBA 5CGKA 1AE3A 3I73A 1E2ZA 1JJGA 3GO5A 1SNMA 1X55A 1VQIA 4ME5A 3CQZB 4B3TQ 4DV4L 1NBWA 2Q8TA 2F3IA 2MGSA 2OQKA 3S17B 3BDLA 1OO9B 4MIUA 2QA4A 2JA9A 4WORA 3CC2A 1SSOA 4B3RQ 3KLWA 2ZTDA 1XNQQ 2B29A 1TIID 1HTLD 4JOIC 4JI3Q 3C3LA 1XTCD 5CV7A 4X62L 4C1NK 2F0PA 1T5XD 2F4VL 1ZYRD 3KLSX 5EKKA 4DR2L 4N9TA 1RTNA 5KEEA 5E3FA 2K04A 3GP7A 1HHVA 2YU9H 1JJCB 1Y8OB 1CK1A 1NTGA 3T53B 1VQ6A 4UPAA 1Y1WB 2QW7A 4H0LC 2AMCB 5DAUA 4NXMQ 1PFNA 3MEHA 1A63A 1N36L 1LTID 3E9IA 2VW9A 5C44H 1C9OA 4CJ0B 4IFDJ 3PUWA 2JA5H 1VQMA 2OTLA 4M8AA 4DXFA 1TWCB 4BY1H 5KNDA 3VYRA 1UUPA 1A2TA 1ICWA 1PTOF 4PMBA 5M3MG 2SNSA 2X69A 3VDYA 1TY0A 4QL5A 4JI7L 2A1AA 5T1IA 4DV4Q 3PIPA 1N33Q 3S1MB 4IUTA 2K14A 3SXHA 2Q2HA 1NUCA 4A3KH 4A3JB 4ZRZA 4IPCA 2HD3A 4A75A 4A93H 1PH4A 3AFQA 3WWVA 3K58A 1IL8A 2XSCA 4RCNA 2N55A 1SMXA 2CQOA 4DFAA 4EQOA 2R6GA 4KHPL 1LO5D 3I90A 2F4VQ 4DAYA 1D2BA 1HFNA 2QILA 4DR2Q 1GUTA 5LHY1 1E3PA 1VQBA 1EQTA 4PZ8A 1YI2A 4L5TA 4XQJA 3O13A 2E2JB 2JK8A 3RR5A 5M5XB 3FKIB 1VQ7A 1GOZA 3M4OH 5GAGC 1JCKB 1HJPA 1UNSA 4OONA 3HFZB 1TT2A 4X64Q 1E1TA 4U68A 5JEAH 3K8AA 5LL6S 1N36Q 1YJNA 4RGOS 4UP7A 4FF1A 2HIVA 2Z6BA 1QVFA 4XDXA 1TQOA 5C44G 4RKBA 4LFAL 1Z9FA 5CBAE 4JI7Q 2NVQH 2JA5G 5JAVA 1MI2A 4BY1G 2A6ED 1BBXC 3JAMi 3TN2A 3K57A 4JI2L 2LKVA 2WP8J 3F2UA 1X3PA 5CORA 4A3KG 3TRZA 1IZ6A 2NVXH 3TP7A 4K5WA 4DK3C 2NN6I 4A93G 4P75A 3GV3A 4KHPQ 1A3TA 2B2YC 3U58A 4G7OC 2KQ3A 4FXKC 2RHSB 2PCFB 2KECA 1LYLA 2BCOA 3TS2A 1H9MA 4KN4C 3CU7A 1UAPA 1N34L 4IFDG 2PPBC 1MGSA 4PMCA 4LMQD 1EFWA 1NSNS 3F2DA 5M5YB 1KABA 4RG1A 1MD2D 2I5LX 1CSPA 2NTTA 3NP8A 4YWMA 1DYQA 1KIXA 5JEAG 2B2WC 1SNDA 2PMZB 4R4OA 2CFMA 1PFMA 1BO0A 1UE5A 4LFAQ 1TWAH 2F0GA 3MXUA 2VXWA 4LUOA 2LFNA 2HT1A 2OXPA 4BBRB 1A3UA 4JI2Q 2L5TA 1KXLA 5CYUA 2R3ZA 1LT4D 4YCVA 3BDCA 4K6DA 3EFXD 1JWMD 5EKIA 4UY8C 2TSSA 1NNXA 5IYCH 3CCSA 2YYZA 3SK5A 4WJ3M 2O4XA 1XMQQ 5ELFA 2QF7A 3TZUA 4KY5A 1D5ZC 3A7AB 4DK0A 4MTNA 3ZYYX 3H6MA 3TEHB 3TQYA 2L4NA 1W2BA 3L3OC 3J81c 2NZHA 3KDFA 1BDOA 4DK6C 1B8AA 4LK1C 2K5NA 4XYQA 2E75C 3KF8A 1N34Q 1N9WA 3OIPA 3I91A 5EPKA 1KNEA 1RCVD 2V1CC 1IBMQ 3PO2H 2JP1A 4A76A 1EIYB 1PH3A 3GTMH 2PW7A 1PMRA 3KBXA 2F0IA 4GNXB 3H0GH 3M3YB 2SNMA 1GUWA 1JWUD 1AW7A 4CDCC 4HMIA 2XN9C 1BUVT 4RCOA 2F0OA 1Q82C 3I4OA 2K5HA 3VYSA 2BH2A 1K83H 4RWSC 4IN3A 2EY6A 2XRQD 2VL6A 4AYBB 2JXMB 5C4XG 3Q6SA 1EIGA 5ELNA 5D3IB 1SNPA 1I6HH 5EBDA 3L7ZC 5K5PA 4LJZC 5LMNL 2CCZA 3CPWA 4KHZA 3MEFA 3LWEA 2RDGA 3E0EA 5IYCG 4G7HC 2ZM6L 2DUDA 4U673 4EQNA 4AQYL 2XNAC 2F0MA 5C5LA 1SE2A 4ME3A 4HJ7A 4C2MB 4HIOA 3K6OA 4C3JH 5C3WA 4F88A 1LV9A 4CDFC 3ER0A 2E2HH 3CRLC 1B9NA 1KLGD 4XTCS 1I4XA 4RAUC 4L63B 1RJTA 1HQMC 1B3QA 4OIJA 2F0LA 3GQBA 1J5EL 1K28A 3ITPA 3H0GG 1EIFA 4XQQA 2SDFA 4GLXA 3CRKC 4BY7B 1CM9A 2EY1A 4NXNQ 4JOIA 3NUCA 1II3A 3Q24A 3X3NA 3F8TA 3PIP3 1SE4A 1HA6A 1DXMA 5LMNW 4Y7NH 3D4DA 2XGTA 4JC0A 1PLFA 5LMNQ 3A8KE 2D0OA 1TWHH 5ELOA 2SOBA 4KTAA 2IX1A 1H9SA 2KEDA 4DK1A 3DEPA 4B3ML 3A54A 4BBSH 2ZM6Q 1KD1C 1JB7A 1BVSA 1O7LA 1TS5A 2NVYH 3S14B 2EYHA 4AQYQ 2FHTA 3KDFB 1J8IA 1OXXK 4MZ9A 2R93B 5JJZA 2LXJA 1EEFD 4A3FH 2AQ3B 1FGUA 3BG3A 4H44C 1L2FA 1YHBA 2E2DC 5L37A 3TS0A 2JYOA 1PH9A 1W6KA 4ZUJA 3DLLA 1IXRA 4C3JG 3A8IE 5IODA 4R8NA 1FR3A 3HOUH 4DNIA 2NN6H 4LFBL 3D6CA 1J5EQ 1JB3A 4X6AH 3MTSA 1I3QB 1HZCA 2Z6KC 4X3UA 1EYCA 4KHVA 1V1PA 1X3GA 2AUKA 3UDXA 3HOYB 5CV6A 4NP5A 2XRSD 3CKIB 2RCFA 1WTRA 2CVRA 3KF6A 1DOKA 5EQ0A 4S3SA 4HAEA 5IGDA 2XVSA 3H3VI 1B44D 5EKLA 4NB3A 2JE6I 4B3MQ 1A6XA 3KK7A 4A3MB 2ICEC 3J81E 2WAQB 3K7AB 1TS3A 4BBSG 1Y69U 4LF8L 3GTJH 3FDTA 4CBVA 1AZPA 1AEXA 1TWFB 1XJVA 3NE5B 4ZUIA 4RHRA 3S15B 1XMOL 3DHQA 1PRTB 4A3FG 1WTPA 1JT8A 1DJRD 5CV9A 3VA5A 2IPKD 3PMFA 4GN3B 2K1BA 4JBMA 3I72A 3SHLA 2EDGA 1U4LA 3TBIB 4DPGA 3EBEA 2FMMA 4ULLA 1PV4A 4LFBQ 3HOUG 4R9WA 1FL0A 2PNHA 1YEZA 1AP0A 2NN6G 3IKJA 5IYDH 1E0BA 1KAWA 2EY5A 4POFA 1FGBD 1YVCA 1SR3A 1PHJA 4KY6A 2IWHA 4DV5L 5CV5A 5C0XI 1EWHA 2FFKB 2ZTCA 4DUZL 1K3RA 2UUAL 2EIFA 1XX8A 2R92H 1Y1VH 1TKWB 1H9SB 4R8IA 2H4OA 1K8AC 2JA8H 2M00A 3UDIA 2BE5D 1DM0B 2PQAB 3V05A 2EJMA 2EVBA 5CC4A 1L1OB 3BZKA 4C1NI 4LF8Q 3S9WA 1WVLA 1HNZL 4JI4L 2B2WA 1M90C 4C3IH 3HOZH 5JVG3 2IX3A 2R7ZH 1XMOQ 3OMCA 3MAQA 4FDBA 4PZ7A 2Z1CA 4ZKCB 2KHSA 4A3BH 1EOTA 1VQKA 1PVOA 3S16H 3U9SA 2OT2A 4ZK9B 3BYTB 4IPDA 1Y8NB 5C3EH 4JPBW 5H1SE 4K8IA 2E2IB 3MVVA 3FPUB 1S4ZA 3K80C 4IUUA 4RFBA 5D3DA 2AHOB 1JQYD 3QOJA 3S1NB 1I94L 3S2HB 4AIMA 1TU2B 3NBHA 1W6JA 4APVA 5IIFA 4N8X1 1M8AA 1EFID 1QE6A 1X3FA 4DV5Q 2ES2A 4XT3B 3PGZA 5IYDG 3S17H 1A3VA 3D4RA 3VR3A 2UUAQ 3I4MH 2F3VA 4XQNA 3C46A 1I50H 4K14A 1ILPA 4ABNA 2OCEA 2KBNA 3QWNA 3L9AX 4P73A 1VF5C 3CF5A 2F0DA 4O1NA 2R92G 1Y1VG 1MBYA 2E5LL 2YV5A 5KIXA 2B2VC 4F7XA 1Q1BA 4A4IA 4LW1A 2JA8G 2OF1A 2VY3A 2IW3A 3HOVH 2BDOA 1WCMB 4NKLA 2PZWA 1IBLL 4JI4Q 4FXDA 2JSOA 4NDXA 5COYA 2JEAI 1OTCA 2K5VA 2Q2TA 1VMPA 4KI0A 3Q0AA 4RGTA 1SFOB 2JA6H 3GTKH 4QCLA 1JOQA 4C3IG 1STGA 5FO7B 1R9TH 3HOZG 1SYFA 1ASZA 5HGQA 1CA5A 4QB4A 3P20A 1YZ6A 2P5ZX 3VR5A 3OWEB 1PYWD 2I0QA 2B2TC 3D6WA 1X32A 2ZXRA 1I94Q 2JA7B 2RKSA 3A0JA 4DR5L 5C3EG 3A7LA 3HKZG 5J3BA 5IYBH 3CCEA 5I9PA 4GOPC 4HN7A 1B3AA 5IT9c 3CCVA 2LS01 3GTGB 2KUMA 2VQEL 1MKHA 1UWVA 2X6GA 4MNOA 1PYBA 4GLAC 4A3IH 4CDDC 3OTOL 3VA7A 2YTVA 1HNXL 1EY4A 4CKEA 5K36H 3W1GA 1WI5A 1F9SA 4HR7B 4JI6L 4ZQ3A 1JJ2A 1BXTA 2QDBA 1VQLA 1HPCA 3I4MG 2N78A 3DUZA 2K50A 3RLNA 2E5LQ 1U4RA 1HNWL 1A62A 1YNJD 3NBIA 4UP9A 4ZYSA 4A3GH 3FHWA 5I2YA 2QCPX 1IBLQ 2ZJQA 4IO9A 3HOVG 1LTSD 2A6HD 1RODA 4DAMA 1WJJA 1WTOA 1CA6A 1WYDA 3NQIA 2NYZD 1AFPA 1VDZA 1ASYA 3LNNA 1ZEQX 2QDLA 1XPUA 4IZ8A 3LGJA 5IT9L 4B3SL 2WV6D 4RGMA 1PTOB 2C5CA 4LUVA 4X3KA 2JA6G 3EN2A 3MXNA 1S5DD 1Q86C 1AN8A 3T1HL 1JE5A 4OWTB 3CCRA 1ONLA 1FNUA 2VQEQ 1GUGA 1TWGB 5IYBG 1B4OA 1PZID 3K5OA 1Q81C 2WFWA 1HNXQ 1KLUD 5ELBA 5JEAJ 4G4KA 1RTOA 2J0TD 3GTPB 4A3IG 2KCCA 3GTOH 4JI6Q 3GTLH 5K36G 1WD0A 1B7YB 1VF7A 1DD2A 5C4JH 1S72A 2RBMA 2A68C 1YBYA 3D0FA 1HNWQ 4MN3A 2EJFC 3ERQA 2UXCL 1BKBA 1VQFA 2ZXPA 5C6AA 5M3MB 1PDQA 1BOSA 4X62Q 3I4LA 1CTMA 3I70A 4A3GG 1SROA 3MA2B 1BCPB 2EPBA 2F0NA 4KLKA 4ODGA 3I56A 1KAAA 4CJ2C 1PH1A 4HJ5A 1Y14B 1QVCA 3MXGA 4IOAA 4Q0FA 2Z6KA 4B3SQ 1DCZA 3BS1A 5M3FH 3BZDB 5JJIA 3MC0B 3R2TA 3H15A 3PQIA 4J15A 3SK8A 4QIWE 3T1HQ 1U4PA 3P7JA 3IL8A 3SGIA 2D5DA 2XWJB 1SNCA 4R4CA 4FF3A 4KD3A 1I4RA 1EQVA 1K8MA 4ZLTF 2F0TA 2DGYA 3OOCA 1QWYA 1U4MA 2K7VA 2L55A 2I5MX 2GVAA 2MFIA 3TP8A 4J8QA 1EY6A 2YU9B 2JQOA 2L9HA 4IUPA 1SMYD 4M1UB 4DU9A 1O7YA 5JJLA 1B1ZA 2AUJD 2D62A 1SYGA 4KD4A 3CP0A 3OMGA 1B9MA 2F0HA 4OGQC 5C44B 2EYMA 1V1OA 3ONAB 1CKNA 1CQFA 3C1FA 2JJQA 2JA5B 3GTQH 1G2SA 4BY1B 4Y52H 4O42A 5A35A 1LACA 2WINB 3FEWX 1EEID 2J4XA 2IJ0A 4HIDA 1LTBD 2CHBD 3CC7A 1X56A 4GKKL 4A3KB 4YWKA 3ICEA 2K5DA 3P1HA 5ELDA 4A93B 1N32L 3ULJA 4Z9CB 1PRTD 3CPFA 3K7UC 5IT9E 5M3FG 4RMFA 4FXGC 4IPHA 1XWEA 5DNFA 2MHVA 5IE8A 4KV6A 2LSSA 1YHAA 4AH6A 1MJEA 1GHKA 1QB5D 4LF4L 4HCEA 1PFBA 1VQCA 2FXQA 1GKHA 2CWPA 2RHQB 1V1QA 4DR6L 2YTYA 3M4OB 5FOBB 1EIHA 1IYVA 3CCUA 1HZAA 1JR0D 2GN5A 1Q1EA 3E0JA 3J80i 3KUPA 2F52A 4G7ZC 1EL0A 1BR9A 1SYDA 1X65A 3I4NH 1HZ9A 4V0BA 2RDFA 3NENA 4DAYB 4EGVA 1RIPA 1HFGA 2BA0A 2NVQB 1X9NA 2VB3X 1GJXA 1HRJA 2OEOA 1O80A 1OXTA 4GKKQ 4XIGS 2VUMH 4OXPA 1WTWA 4L5RC 4H7BA 4JI1L 4X3TA 5I6YA 1WD1A 1S5ED 1PFSA 4GKJL 3VYUA 2L0CA 1N32Q 1TY2A 4HSVA 3DWAA 1F9QA 1EZ6A 1YNNC 5BN5A 2NVXB 5IY0A 3CMAA 3ERSX 3M7GA 2F0VA 4DV3L 1G91A 2SEBD 1ESFA 1B50A 3V2TA 4GS3A 3I7FA 1MHWC 3T51B 3H91A 5JPMC 1HA5A 1EQQA 3RN2A 3DEOA 4LF4Q 2DY7A 2X6LA 1VQJA 1DONA 2Z4HA 2B2VA 2EQSA 4LF7L 4DR6Q 4J6HA 4TRDA 4X66L 1GHJA 1YJ9A 2EZVA 3A55A 1VQEA 3J81j 1E22A 4HSPA 1CKNB 1LT3D 1VQHA 2G5DA 2A74C 1CHPD 1I5FA 3S14H 4ZKBB 1ENCA 1SE8A 3FP9A 1IYJB 4H02A 2ZTEA 3ND9A 3STBD 4DR1L 1TWAB 4OWXB 4YY3L 3EJIA 1HR0L 1GM5A 1F9RA 3I4NG 4N9PA 5M5WH 2B2TA 2GVBA 2PW5A 4A3DH 5C4XB 3PIOA 4WFN3 1V9PA 4GOPA 4KK7A 2KCTA 1D6EC 4GKJQ 1SRUA 4WJWA 3BVMA 4FYDA 2VUMG 3A56A 3P75A 1F9PA 2WB1E 3H3VC 3PUYA 1EWCA 3SDZA 3KYHC 3RZDH 3E5SA 4DV3Q 3OW7A 1GD7A 2AQ1B 3PO2G 4A3LH 2IL8A 3U4VA 3HOWH 2R7FA 5NUCA 4QY7A 2BE5C 1K9MC 1NR2A 1D1IA 4LF7Q 3HOYH 1QNKA 4X66Q 4HJ8A 3PSIA 3Q23A 3QR8A 1GUSA 2HUGA 1C8CA 4X3SA 3FPPA 2EXDA 3GTMB 1XNRL 1U5KA 1TS2A 3H0GB 1HR0W 2N3SA 5FLXL 2ALYB 3OW2A 3HKZE 2LMCB 4DAVA 1MJCA 3A8JE 4DR1Q 1I4PA 4YY3Q 1HR0Q 3E9HA 2TMPA 2Y0SG 4GN5A 2CW0C 5C3XA 3SE0A 1K83B 3SR1A 3ZJYC 3KF8B 5IP7H 1HUMA 3S15H 4DV7L 5EPJA 1JC7A 1F2LA 4A3DG 2B2UA 4ALPA 1G291 3L2PA 1QNUA 5AFWA 2HQEA 1I6HB 1D5XC 3AFPA 5CV8A 4KJOA 1YIJA 1PTOD 1PXUA 3D3RA 1XTDA 3JAMc 4L8JA 2V4DA 4YCWA 1P8LA 4A3LG 3M4PA 4K2KA 1YJWA 3PUZA 3HOWG 1AE2A 1L0YB 2HHHL 1DOMA 1IBKL 1NJIC 4C3JB 3L0OA 5LMUL 4K2LA 3NHHA 3R3OA 2KVMA 4JK1C 2B63H 3PO3H 2E2HB 3U50C 5JPNC 1XNRQ 2KA7A 4F87A 5EPLA 2Z9HA 3NTIA 3K0YA 3FVQA 4GZYC 5FO8B 1L0XB 1EYDA 3BU2A 2IHFA 3W3AA 4L5QA 4DV7Q 2K28A 5DM63 1BCPD 1IHZA 3AMUA 1VQ8A 3JAML 4ZAIA 5IP7G 1KNAA 2AWNA 4GNXC 4Y7NB 3HP3A 3R93A 3T1YL 1TWHB 5E1FA 1XPRA 4BBSB 1KTKA 2MJ8A 1SNOA 3BJUA 3MZ5A 2ZJPA 3V96A 1T9HA 2NVYB 4A3EH 1O7ZA 2VB2X 1HUNA 4CGYB 3HG9A 1VQ5A 3S1QH 1H95A 2NVTH 4N8FA 1S3OA 1B53A 4A3FB 1QCBD 3G6JB 1ILQA 2HHHQ 2IHEA 1IBKQ 2PZTA 5LMUQ 5JOBA 3PUVA 2XTIA 4DNTB 1VQPA 5JVH3 4LFCL 5AJ3L 1UE6A 1ZYRC 1W3SA 3I8ZA 4JG2A 2F0FA 1IW7D 2A6HC 3HOUB 2B63G 2FMCA 1ZKOA 3PO3G 3DWQA 4MHEA 1PRTF 1V8QA 4JI8L 3CXCA 2PO4A 4H13C 4PZ6A 1ET6A 4IFDI 5FLXE 2IT1A 2K5QA 4C3HH 4R4TA 3RZOH 3HOXH 4LNQA 1RKNA 4FP5D 4DUYL 1WTVA 3T16A 1S5FD 1WTXA 3CCLA 4IJLA 4P71A 1VQOA 4B9WA 1RF2D 3TSSA 4K6LA 3J80L 2R61A 3S1RH 4EQPA 1ESRA 2K4KA 2MUYA 3K5MA 1V43A 2K03A 1BF4A 2HCIA 1WOCA 2LY7A 4OL7A 4RGNA 1OXUA 4A3CH 2RDHA 2VS1A 1U9RA 4OIKA 1FYCA 4BXXH 1ZXTA 5HY6A 3GTJB 4A3EG 1LM0A 1F2MA 3K5LA 3U4ZA 1V1PB 3CQZH 2I5HA 1EY8A 4JVZA 2HQLA 4GN4B 5G3LD 4BS9A 4DUZQ 3KF6B 1EU3A 4IOCA 1NCVA 4LFCQ 1A8VA 3G4SA 5AJ3Q 4GLVB 1S5CD 2WB1G 2F0JA 2R7DA 1BBUA 3S24A 5ELEA 1PH5A 4NW2A 2BH8A 1EZ8A 2N88A 1D1KA 1FD7D 1MSGA 5FO9B 1VCIA 4EX5A 3RD4A 4XXEA 1Q8IA 2VNUD 4QGUA 4C3HG 1HNZQ 1O7IA 3M4YA 2H1EA 1JORA 3HOXG 4DR3L 5EBCA 1H9KA 5IOCA 2R92B 1R4PB 1Y1VB 3OYYA 4LAAA 3OPOA 1Y1WH 1SNQA 4PMWA 3JAME 1TXYA 2R7ZG 2JA8B 2E76C 3NTHA 4K8JA 2IX0A 2NUCA 2ZT9C 4LF9L 2QKIC 4A3BG 1HH2P 3Q8DA 2A6EC 3K81C 4JI3L 3URYA 3GD7A 5I2XA 4OO1I 4CJ1B 2A19A 4LWCA 3D8GA 4FNFA 4KKTA 3KJOA 2PZUA 1I4GA 1TWCH 4JI0L 1ML0D 4A3CG 2F4IA 4C3IB 3CHBD 3HOZB 4BXXG 2MO0A 4K5VA 3Q22A 2KCNA 3CD6A 3S1MH 2CH4W 5KNCA 4HCSA 1E24A 4POGA 4KMUC 1NMFA 5C4HA 3NEMA 3UI2A 4A3JH 1CKMA 1EYGA 1PH2A 3S16B 3B6YA 3J81i 4LF5L 5C3EB 3HKZB 1STHA 5I4DA 4LUZA 3RLOA 1CKOA 1SJED 4O0AA 4V190 1VS0A 5IGEA 2A5HA 3QIAA 4IQZA 2MO1A 3M4QA 4FF4A 5FLMH 1F2YA 1C0AA 1KHIA 2Q2IA 1YHQA 1PRTC 2XIWA 3CCQA 4NPSA 1LTRD 3NXWA 4G57A 1N33L 1QVGA 2E2JH 5GAHC 2QEJC 4IURA 5M5XH 1A15A 3FKIH 4DR3Q 3I4MB 1Q7YC 4FO2A 3KOJA 1I50B 2MPMA 2UUBL 4X65L 1LTTD 4AYBE 4I7AA 1JE4A 3MWYW 1DGSA 4LF9Q 3OIQA 3J80E 4IUVA 1Y1WG 3NBHB 2EY2A 1UE1A 4DR5Q 3H3VH 2DY8A 3HOVB 1WFQA 5I6WA 4JI0Q 4CDEC 5F2DA 1SE3A 1SYBA 2B2UC 3BYYB 3MFYA 2L1BA 2LXKA 5C0XJ 2ASBA 1WTQA 4QQBX 2VQFL 4DF7A 3OTOQ 2JA6B 3GTKB 4X64L 5I9OA 2K5WA 5GQOA 1R9TB 3KLRA 4LF5Q 2EE1A 5E4WC 4RA8A 1FNWA 1Z47A 4A3JG 2RA4A 1L1OC 2KENA 5IP9H 2AWOA 2K01A 2DJFC 3NTKA 1SN8A 1BQQT 1IKMA 5FJ8H 3OSOA 1S40A 2KHIA 1GUOA 5FLMG 3G7LA 4A3IB 2A69D 2WKCA 5BR8L 4QUCA 2OWOA 3SK4A 4DNRB 1STBA 2KOLA 2N49A 2G9DA 2K33A 4IUNA 4X65Q 4O2DA 2K75A 2UUBQ 5C0XH 5EJWA 4YWLA 3FKIG 4PV1C 1M4VA 5M5YH 2EYPA 3WOFA 3KLSA 5GADC 1MSHA 1EY7A 4A3GB 3NK9A 3HS0C 2UXDL 1X3QA 2Y0SE 3EIVA 3ULLA 4IFDH 1XPOA 1SDFA 4OX9L 1GVPA 2VQFQ 2FJ2A 1KQSA 1I4QA 1J6QA 1HQRD 2D9UA 3NSWA 3RLFA 4LF6L 3W2DA 4BBRH 5KYIA 2L12A 4P74A 3R8BA 3STBC 3TZDA 2ID0A 4XYOA 4R4QA 2ZXOA 4P72A 2XWBB 1YITA 4HEDA 3SK6A 5D14A 2F0QA 1BCPF 1XXGA 1TR5A 4E6IA 3TREA 2G9HD 4JCVE 3E6ZX 4R1JA 4KJNA 4QF4A 2UXCQ 1HXYD 5IP9G 3VYTA 2KJXA 4GNXA 2C35B 1K3BC 4DV6L 1T5EA 1Q3LA 1VMCA 4DR7L 4TSSA 3EVQA 2D2CC 2Q8RE 3G48A 5TSSA 1RDPD 1HCZA 5ELCA 5FJ8G 5BR8Q 1HZBA 3FRPB 2WACA 1E2WA 2EYOA 4OWWB 1QUQA 4K0KL 4HJ9A 2BA1A 3M85A 1N8RC 3GTOB 5BN3A 3CMEA 3GTLB 3A74A 1FJGL 3C2PA 1STEA 4IJHA 5C4JB 5E7NA 4WJ4A 3MXNB 1XMQL 4ILWA 3K0XA 2F1MA 5C0XG 3J7AV 1I4HA 1E1OA 4F8MA 4TKOB 3F2CA 5KNBA 3AU7A 4DKAC 3M3YH 4B08A 2WAQE 2UXDQ 3E3XA 1SAPA 3EA6A 3C1EA 5J22A 4FVMA 1RL2A 1LLRD 2H5XA 1ENFA 4OX9Q 1KDAA 3GDEA 3DM3A 1D8LA 1E7ZA 4LF6Q 2B39A 2DNEA 5LL6X 1X3EA 1IL2A 1K8OA 2O5IC 4TVAB 1A2UA 5J1ZA 5M3FB 1IBML 4BBRG 2CH4A 4KKSA 3EQLC 2L11A 2GA4B 3WOEA 5IWAL 2PNRC 3NPPA 2RVLA 1O78A 2UXBL 4KKUA 5EGTA 1I6VC 4KY7A 3UDGA 4DV6Q 4DR7Q 3PCOB 3UDFA 1VQ4A 1K73C 4OO1H 2EYLA 2MQHA 4B9XA 3HZXA 4C56C 3AB9A 5C4XH 1OXSC 1ICFB 5JJKA 2HDMA 1SYCA 1PTOC 1EWIA 1G51A 4K0KQ 1LTAD 4C2MH 3I3CA 3AYHB 1STNA 3EROA 4PQXA 3DM1A 3VR2A 1FJGQ 1VQDA 3D4WA 1VQ9A 1C48A 5G3LF 1KL9A 1JOKA 3KJPA 1CQVA 5KRUA 5GAEC 3GTQB 1BBWA 3DMUA 4IPGA 1LT6D 2E74C 1VQNA 2A68D 4BY7H 3RN5A 3VR4A 1Q90A 1PA6A 2DNCA 4YIJA 3TP5A 4L5SA 1D7QA 2WKDA 4NMZA 3BVZA 5D65A 5IWAQ 1TS4A 4AYBG 4UDUC 2UXBQ 1UEAB 5KGUA 5CR3A 2I46A 3H09A 1F2ZA 5CV4A 1BCPC 1MIUA 4PNYA 1H9RA 1FNVA 3ULPA 2C9OA 5E4XA 1TVXA 5FK9C 4RHSA 1M1KC 1NE3A 3AEVA 3QG1A 4NXNL 2R93H 4OO1G 1QUQB 3N52A 5C4ZA 4DV1L 1PH8A 2HDLA 1FVIA 3NWTA 2K32A 4JI1Q 5FLXc 3LWUA 1Q46A 3J81L 1VQAA 1CUKA 4DAPA 2UUCL 3PUXA 3H94A 5HURA 5EAYA 5BN4A 1Y8PB 3RNUA 1UE7A 3CAMA 3I4NB 2OTJA 2EYJA 1G2TA 5CBEE 4BA1I 1I3QH 4P2CB 2F3WA 1P16A 1IW7C 1C4QA 4CHTB 2B3GA 4CKCA 2VUMB 4ID6A 3PF5A 2Z0SA 3DXJC 2L15A 3SVMA 3A5ZB 3RMHA 1SBBB 4BY7G 4HJAA 3TDQA 3KBGA 5A2QL 1J9OA 5GROA 3NQTA
chains in the Genus database with same CATH topology
2WIIB 3DWPA 3PO2B 2E8GA 2PI2E 1AZQA 5T1GA 3NWSA 1X54A 3G6EA 4A3MH 3RUZA 2K6AA 3A5UA 3K7AH 1A0IA 2ZJRA 4DR4L 5KYLA 5IGCA 1VQGA 4PG3A 3F1ZA 2UU9L 2NB0A 2ATWA 4JI5L 1TWFH 1QZHA 2BDNA 1KRTA 4DV1Q 1U0LA 3PF4A 4CKBA 4UP8A 4XT1B 2R93G 2NTSA 2EJGC 4OHJA 1KC8C 1G8ZD 2QEXA 1GUNA 3CCMA 4QIWB 3MFGA 1QILA 2UUCQ 3QJYA 2NBFA 4DGZA 1Z6HA 1E2VA 3CC4A 2MNAA 2Y0SB 2PQAA 2RQXA 3FMCA 3S2DB 4DN4M 1ENAA 4JBKA 2ENBA 4YCUA 1L1OA 5M5WB 1YNXA 1HTPA 4A3DB 1NMGA 1Q8KA 2HIXA 4DA2A 4QUFA 3R2IA 2AKWB 2O2LD 3AQQA 4HTHA 4KN7C 3HKSA 1IKLA 2RSNA 1SEBD 4DV0L 3HOYG 3IFDA 3RZDB 1EYAA 5IGBA 4HIMA 3SEBA 1STAA 1DZ1A 2F0SA 3UE1A 1SYEA 4DR4Q 2Q2UA 1JOOA 4A3MG 3HOWB 1YNND 2WAQG 3CW2C 3LX0A 2UU9Q 4HIKA 5DLQE 4JI5Q 3N6RA 1GO3E 3W1BA 3F2BA 2OQ0A 1Z7TA 4GOPB 4FF2A 4R4IA 1BNZA 2B8FA 1CHQD 3WDNA 2PYKA 4J1MA 4DV2L 2B8GA 2E2IH 1PZKD 2YTXA 3S1NH 3S2HH 2RF4A 1SJHD 1DOLA 4JBJA 1PZJD 2JEBI 1L0WA 3QO2A 3OHXC 3PV0A 4HMJA 3J80c 4BWGB 3BDOA 4RKLA 2A8VA 4WRDA 1YNJC 2FINB 1QZGA 3IAYA 1EQRA 3HRZC 4DV0Q 1JICA 5CMDA 2Q8IB 2PI2A 1CZWA 1RHPA 1CZGA 5A2QE 1G6PA 3VR6A 2EOTA 1KDCA 3J7AF 3GV6A 2HCCA 4EVOA 4UAIA 2RCNA 4DXGA 4RH6A 1PYSB 1KDBA 1WCMH 2KHJA 1ET9A 2J7ZA 2N8NA 3QB3A 4JYAL 2B2YA 1NR4A 3J7ZC 2F03A 1CSQA 2NZ1D 3OWFA 3ND8A 1SFOH 1XYIA 1GXDC 1JWSD 1CFMA 2I07B 5IGGA 4DV2Q 2B63B 3T56B 3PO3B 2AQ2B 3NELA 1KRSA 3T1YQ 1CI3M 1EUJA 1UEBA 3T13A 3MHBA 1EOVA 2JA7H 1R4QB 1LT5D 1G6ZA 1PH6A 3IFTA 2CQAA 2VZAA 2KEEA 2O5JC 3GTGH 5C5MA 1LTGD 3BVGA 1X6OA 5FKAC 1STYA 3TMEA 2MP1A 2NWGA 3QOLA 1EU4A 1LTLA 2ICIA 3M7NA 3HEJA 4YHHL 1LUZA 1B70B 2F0UA 2CW0D 4I65A 3I55A 4TQUS 5HGTA 1NAPA 2A69C 1LABA 2M2LA 1PH7A 1K0RA 4JV5L 1EY0A 3CCJA 4A3EB 5J39A 4JI8Q 1B2TA 4BA2I 3S1QB 3D31A 1SLJA 2PMZE 1K8GA 3W5OA 2NVTB 4JYAQ 3J7YW 5DEHA 1QOHA 1WCMG 4DUYQ 4IALA 4B3TL 4EQ5A 1H9JA 1C7YA 2WB1B 5ISRA 5DM73 3JC66 3X3MA 3UE0A 2F0WA 3PIO3 2K52A 1CT1D 2F0EA 1PTOH 1JMCA 2PQEA 4Q5VA 2Z8LA 2IY5B 4B3RL 1Q12A 2QGQA 1XNQL 3TP6A 3MXPA 1QJOA 2BOSA 4I7ZC 2CKZB 4QMGA 3K5NA 4C3HB 3HGBA 3I2ZA 1SMYC 2JA7G 3RZOB 3HOXB 4QJFA 1TWGH 1QG7A 1EY5A 2DN8A 2CWAA 4IUQA 4K5XA 1EY9A 3BZCA 4JBWA 4YHHQ 3G71A 2EXZA 2R7ZB 2Z4IA 2K05A 3J7A5 2M9VA 2RSOA 3GTPH 5M9OA 4L6TB 3T4AC 4A3BB 2A73B 3S1RB 3M9BA 2KCMA 4NXML 2EYFA 1IYUA 1F77A 2NZOA 4JV5Q 1RD9D 1SXTA 3K59A 3KFUA 1S5BD 1OXVA 1AH9A 3U9OA 5M3MH 2D0PA 2F0KA 1NY4A 5IGFA 1D5MC 3IRBA 5CGKA 1AE3A 3I73A 1E2ZA 1JJGA 3GO5A 1SNMA 1X55A 1VQIA 4ME5A 3CQZB 4B3TQ 4DV4L 1NBWA 2Q8TA 2F3IA 2MGSA 2OQKA 3S17B 3BDLA 1OO9B 4MIUA 2QA4A 2JA9A 3CC2A 4WORA 1SSOA 4B3RQ 3KLWA 2ZTDA 1XNQQ 2B29A 4JI3Q 1HTLD 4JOIC 1TIID 3C3LA 1XTCD 5CV7A 4X62L 4C1NK 2F0PA 2F4VL 1T5XD 1ZYRD 3KLSX 5EKKA 4DR2L 4N9TA 1RTNA 5KEEA 5E3FA 2K04A 3GP7A 1HHVA 2YU9H 1JJCB 1Y8OB 1CK1A 1NTGA 1VQ6A 3T53B 4UPAA 1Y1WB 4H0LC 2AMCB 5DAUA 4NXMQ 1PFNA 3MEHA 1A63A 1N36L 1LTID 3E9IA 2VW9A 5C44H 1C9OA 4CJ0B 4IFDJ 3PUWA 2JA5H 1VQMA 2OTLA 4M8AA 4DXFA 1TWCB 4BY1H 5KNDA 3VYRA 1UUPA 1A2TA 5M3MG 4JI7L 3VDYA 1ICWA 1PTOF 2SNSA 2X69A 4QL5A 1TY0A 4PMBA 2A1AA 5T1IA 4DV4Q 3PIPA 1N33Q 3S1MB 4IUTA 2K14A 3SXHA 2Q2HA 4A3KH 1NUCA 4A3JB 4ZRZA 4IPCA 4A75A 4A93H 1PH4A 3AFQA 3WWVA 3K58A 1IL8A 2XSCA 4RCNA 2N55A 1SMXA 2CQOA 4DFAA 4EQOA 2R6GA 4KHPL 1LO5D 3I90A 2F4VQ 4DAYA 1D2BA 1HFNA 2QILA 4DR2Q 1GUTA 5LHY1 1E3PA 1VQBA 4PZ8A 1YI2A 1EQTA 4L5TA 4XQJA 3O13A 2E2JB 2JK8A 3RR5A 5M5XB 3FKIB 1VQ7A 1GOZA 3M4OH 5GAGC 1JCKB 1HJPA 4OONA 4X64Q 3HFZB 1TT2A 1UNSA 1E1TA 4U68A 5JEAH 3K8AA 5LL6S 1N36Q 1YJNA 4RGOS 4UP7A 4FF1A 2HIVA 1QVFA 4XDXA 1TQOA 5C44G 4RKBA 4LFAL 2NVQH 1Z9FA 4JI7Q 5CBAE 2JA5G 5JAVA 1MI2A 4BY1G 2A6ED 1BBXC 3JAMi 4JI2L 3TN2A 3K57A 2LKVA 2WP8J 4A3KG 1X3PA 3F2UA 5CORA 3TRZA 1IZ6A 2NVXH 3TP7A 4DK3C 4A93G 2NN6I 4K5WA 4P75A 3GV3A 4KHPQ 1A3TA 2B2YC 3U58A 4G7OC 2KQ3A 4FXKC 2RHSB 2PCFB 2KECA 1LYLA 2BCOA 3TS2A 1H9MA 4KN4C 3CU7A 1UAPA 1N34L 4IFDG 2PPBC 1MGSA 4PMCA 4LMQD 1EFWA 1NSNS 3F2DA 5M5YB 1KABA 4RG1A 1MD2D 2I5LX 1CSPA 2NTTA 3NP8A 4YWMA 1DYQA 1KIXA 5JEAG 2B2WC 1SNDA 2PMZB 4R4OA 2CFMA 1PFMA 1BO0A 1UE5A 4LFAQ 1TWAH 2F0GA 3MXUA 2VXWA 4LUOA 2LFNA 2HT1A 2OXPA 4BBRB 1A3UA 4JI2Q 1KXLA 2L5TA 5CYUA 2R3ZA 1LT4D 4YCVA 3BDCA 4K6DA 3EFXD 1JWMD 5EKIA 4UY8C 2TSSA 5IYCH 3CCSA 2YYZA 3SK5A 4WJ3M 1XMQQ 2O4XA 5ELFA 2QF7A 3TZUA 4KY5A 1D5ZC 3A7AB 4DK0A 4MTNA 3ZYYX 3H6MA 3TEHB 3TQYA 2L4NA 1W2BA 3L3OC 3J81c 2NZHA 3KDFA 1BDOA 4DK6C 1B8AA 4LK1C 2K5NA 4XYQA 2E75C 3KF8A 1N34Q 1N9WA 3OIPA 3I91A 5EPKA 1KNEA 1RCVD 2V1CC 1IBMQ 3PO2H 2JP1A 4A76A 1EIYB 1PH3A 3GTMH 2PW7A 1PMRA 3KBXA 2F0IA 4GNXB 3H0GH 3M3YB 2SNMA 1GUWA 1JWUD 1AW7A 4HMIA 2XN9C 1BUVT 4RCOA 2F0OA 1Q82C 3I4OA 2K5HA 3VYSA 2BH2A 1K83H 4RWSC 4IN3A 2EY6A 2XRQD 2VL6A 4AYBB 2JXMB 5C4XG 3Q6SA 1EIGA 5ELNA 5D3IB 1SNPA 1I6HH 5EBDA 3L7ZC 5LMNL 4LJZC 5K5PA 2CCZA 3CPWA 4KHZA 3MEFA 3LWEA 2RDGA 3E0EA 5IYCG 4G7HC 2ZM6L 2DUDA 4U673 4EQNA 4AQYL 2XNAC 2F0MA 5C5LA 1SE2A 4ME3A 4HJ7A 4C2MB 4HIOA 3K6OA 4C3JH 5C3WA 4F88A 1LV9A 3ER0A 2E2HH 3CRLC 4XTCS 1B9NA 1KLGD 1I4XA 4RAUC 4L63B 1RJTA 1HQMC 4OIJA 2F0LA 3GQBA 1J5EL 3ITPA 3H0GG 1EIFA 4XQQA 2SDFA 4GLXA 3CRKC 4BY7B 1CM9A 2EY1A 4NXNQ 4JOIA 3NUCA 1II3A 3Q24A 3X3NA 3F8TA 3PIP3 1SE4A 1HA6A 1DXMA 5LMNW 4Y7NH 3D4DA 2XGTA 4JC0A 1PLFA 5LMNQ 3A8KE 2D0OA 1TWHH 5ELOA 2SOBA 4KTAA 2IX1A 1H9SA 4BBSH 4B3ML 2KEDA 3DEPA 3A54A 4DK1A 2ZM6Q 1KD1C 1JB7A 1BVSA 1O7LA 2NVYH 1TS5A 3S14B 2EYHA 4AQYQ 2FHTA 3KDFB 1J8IA 1OXXK 4MZ9A 2R93B 5JJZA 2LXJA 1EEFD 4A3FH 2AQ3B 1FGUA 3BG3A 4H44C 1L2FA 1YHBA 2E2DC 3TS0A 2JYOA 1PH9A 1W6KA 4ZUJA 3DLLA 1IXRA 4C3JG 3A8IE 5IODA 4R8NA 1FR3A 3HOUH 4DNIA 2NN6H 4LFBL 3D6CA 1J5EQ 1JB3A 4X6AH 3MTSA 1I3QB 1HZCA 2Z6KC 4X3UA 1EYCA 4KHVA 1V1PA 1X3GA 3UDXA 2AUKA 3HOYB 5CV6A 4NP5A 2XRSD 3CKIB 1WTRA 2CVRA 3KF6A 1DOKA 5EQ0A 4S3SA 4HAEA 5IGDA 2XVSA 3H3VI 4B3MQ 1B44D 4NB3A 2JE6I 5EKLA 1A6XA 3KK7A 4A3MB 2ICEC 3J81E 2WAQB 3K7AB 1TS3A 4BBSG 1Y69U 4LF8L 3GTJH 3FDTA 4CBVA 1AZPA 1AEXA 1TWFB 1XJVA 3NE5B 4ZUIA 4RHRA 3S15B 1XMOL 3DHQA 1PRTB 4A3FG 1WTPA 1JT8A 1DJRD 5CV9A 3VA5A 2IPKD 3PMFA 4GN3B 2K1BA 4JBMA 3I72A 3SHLA 2EDGA 1U4LA 4DPGA 3TBIB 3EBEA 2FMMA 4ULLA 1PV4A 4LFBQ 3HOUG 4R9WA 1FL0A 2PNHA 1YEZA 1AP0A 2NN6G 3IKJA 5IYDH 1E0BA 1KAWA 4POFA 2EY5A 1PHJA 1YVCA 1SR3A 1FGBD 4KY6A 2IWHA 4DV5L 5CV5A 5C0XI 1EWHA 2ZTCA 2FFKB 4DUZL 1K3RA 2UUAL 2EIFA 2R92H 1XX8A 1Y1VH 1TKWB 1H9SB 4R8IA 2H4OA 1K8AC 2JA8H 2M00A 3UDIA 2BE5D 1DM0B 2PQAB 3V05A 2EJMA 2EVBA 5CC4A 1L1OB 3BZKA 4C1NI 4LF8Q 3S9WA 1WVLA 1HNZL 4JI4L 2B2WA 1M90C 4C3IH 3HOZH 5JVG3 2IX3A 2R7ZH 1XMOQ 3OMCA 3MAQA 4FDBA 4PZ7A 4A3BH 2Z1CA 2KHSA 4ZKCB 1VQKA 1EOTA 1PVOA 3S16H 3U9SA 2OT2A 4ZK9B 3BYTB 4IPDA 1Y8NB 5C3EH 5H1SE 4K8IA 2E2IB 3MVVA 3FPUB 1S4ZA 3K80C 4IUUA 4RFBA 5D3DA 2AHOB 1JQYD 3QOJA 3S1NB 1I94L 3S2HB 4AIMA 1TU2B 3NBHA 1W6JA 4APVA 5IIFA 1M8AA 1EFID 1QE6A 1X3FA 4DV5Q 2ES2A 4XT3B 3PGZA 5IYDG 3S17H 1A3VA 3D4RA 3VR3A 2UUAQ 3I4MH 2F3VA 4XQNA 3C46A 1I50H 4K14A 1ILPA 4ABNA 2OCEA 2KBNA 4P73A 3L9AX 3QWNA 1VF5C 3CF5A 2F0DA 4O1NA 2R92G 1Y1VG 1MBYA 2E5LL 2YV5A 5KIXA 2B2VC 4F7XA 1Q1BA 4A4IA 4LW1A 2JA8G 2OF1A 2VY3A 2IW3A 3HOVH 2BDOA 1WCMB 4NKLA 2PZWA 1IBLL 4JI4Q 4FXDA 2JSOA 4NDXA 5COYA 2JEAI 1OTCA 2K5VA 2Q2TA 1VMPA 4KI0A 3Q0AA 2JA6H 3GTKH 4RGTA 1SFOB 4QCLA 1JOQA 4C3IG 1STGA 1R9TH 5FO7B 3HOZG 1ASZA 1SYFA 5HGQA 1CA5A 4QB4A 3P20A 1YZ6A 3VR5A 3OWEB 1PYWD 2I0QA 2B2TC 3D6WA 1X32A 1I94Q 2ZXRA 2JA7B 2RKSA 3A0JA 4DR5L 5C3EG 3A7LA 3HKZG 5J3BA 5IYBH 3CCEA 5I9PA 4GOPC 4HN7A 1B3AA 5IT9c 3CCVA 2LS01 3GTGB 2VQEL 2KUMA 1MKHA 1UWVA 2X6GA 4MNOA 1PYBA 4GLAC 4A3IH 3OTOL 3VA7A 2YTVA 1HNXL 1EY4A 4CKEA 5K36H 3W1GA 1WI5A 1F9SA 4HR7B 4JI6L 4ZQ3A 1JJ2A 3I4MG 1BXTA 1VQLA 1HPCA 2QDBA 2N78A 3DUZA 2K50A 3RLNA 2E5LQ 1U4RA 1HNWL 1A62A 1YNJD 3NBIA 4UP9A 4ZYSA 4A3GH 3FHWA 5I2YA 2QCPX 1IBLQ 2ZJQA 4IO9A 3HOVG 1LTSD 2A6HD 1RODA 4DAMA 1WJJA 1WTOA 1CA6A 1WYDA 3NQIA 2NYZD 1AFPA 1VDZA 1ASYA 3LNNA 1ZEQX 1XPUA 4IZ8A 3LGJA 4B3SL 5IT9L 2WV6D 4RGMA 1PTOB 2C5CA 4LUVA 4X3KA 2JA6G 3EN2A 3MXNA 1S5DD 1Q86C 1AN8A 3T1HL 1JE5A 4OWTB 3CCRA 1ONLA 1FNUA 2VQEQ 1GUGA 1TWGB 5IYBG 1B4OA 1PZID 1Q81C 3K5OA 2WFWA 1HNXQ 1KLUD 5ELBA 5JEAJ 4G4KA 1RTOA 2J0TD 3GTPB 4A3IG 2KCCA 3GTOH 4JI6Q 3GTLH 5K36G 1WD0A 1B7YB 1VF7A 1DD2A 5C4JH 1S72A 2RBMA 3D0FA 1YBYA 2A68C 1HNWQ 4MN3A 2EJFC 2UXCL 3ERQA 1BKBA 1VQFA 2ZXPA 5C6AA 5M3MB 1PDQA 1BOSA 4X62Q 3I4LA 1CTMA 4A3GG 3I70A 1SROA 3MA2B 1BCPB 2EPBA 2F0NA 4KLKA 4ODGA 3I56A 1KAAA 4CJ2C 1PH1A 4HJ5A 1Y14B 1QVCA 4IOAA 3MXGA 4B3SQ 2Z6KA 4Q0FA 1DCZA 3BS1A 5M3FH 3BZDB 5JJIA 3MC0B 3R2TA 3H15A 4J15A 3SK8A 4QIWE 3T1HQ 1U4PA 3P7JA 3IL8A 3SGIA 2D5DA 2XWJB 1SNCA 4R4CA 4FF3A 4KD3A 1I4RA 1EQVA 1K8MA 4ZLTF 2F0TA 2DGYA 3OOCA 1QWYA 1U4MA 2K7VA 2L55A 2I5MX 2GVAA 2MFIA 3TP8A 4J8QA 1EY6A 2YU9B 2JQOA 2L9HA 4IUPA 1SMYD 4M1UB 4DU9A 1O7YA 5JJLA 1B1ZA 2D62A 2AUJD 1SYGA 4KD4A 3CP0A 3OMGA 1B9MA 2F0HA 4OGQC 5C44B 2EYMA 1V1OA 3ONAB 1CKNA 1CQFA 3C1FA 2JJQA 2JA5B 3GTQH 1G2SA 4Y52H 4BY1B 4O42A 5A35A 1LACA 2WINB 3FEWX 1EEID 2J4XA 2IJ0A 4HIDA 1LTBD 2CHBD 3CC7A 1X56A 4GKKL 4A3KB 4YWKA 3ICEA 2K5DA 3P1HA 5ELDA 1N32L 4A93B 3ULJA 4Z9CB 1PRTD 3CPFA 3K7UC 5IT9E 5M3FG 4RMFA 4FXGC 4IPHA 1XWEA 5DNFA 2MHVA 5IE8A 4KV6A 2LSSA 1YHAA 4AH6A 1MJEA 1GHKA 4LF4L 1QB5D 4HCEA 1PFBA 1VQCA 2FXQA 1GKHA 2CWPA 2RHQB 1V1QA 4DR6L 2YTYA 3M4OB 5FOBB 1EIHA 1IYVA 3CCUA 1HZAA 2GN5A 1JR0D 1Q1EA 3J80i 3E0JA 3KUPA 2F52A 4G7ZC 1EL0A 1BR9A 1SYDA 1X65A 3I4NH 1HZ9A 4V0BA 3NENA 2RDFA 4DAYB 4EGVA 1RIPA 2BA0A 1HFGA 2NVQB 1X9NA 2VB3X 1GJXA 1HRJA 2OEOA 1O80A 1OXTA 4GKKQ 4XIGS 2VUMH 4OXPA 1WTWA 4L5RC 4H7BA 4JI1L 4X3TA 5I6YA 1WD1A 1S5ED 1PFSA 4GKJL 3VYUA 2L0CA 1N32Q 1TY2A 4HSVA 3DWAA 1F9QA 1EZ6A 1YNNC 5BN5A 2NVXB 5IY0A 3CMAA 3ERSX 3M7GA 2F0VA 4DV3L 1G91A 2SEBD 1ESFA 1B50A 3V2TA 4GS3A 3I7FA 5JPMC 3T51B 3H91A 1HA5A 1EQQA 3RN2A 4LF4Q 3DEOA 2DY7A 2X6LA 1VQJA 1DONA 2Z4HA 2B2VA 2EQSA 4LF7L 4DR6Q 4J6HA 4TRDA 4X66L 1YJ9A 1GHJA 2EZVA 3A55A 1VQEA 3J81j 1E22A 4HSPA 1CKNB 1VQHA 1LT3D 2A74C 1CHPD 1I5FA 3S14H 4ZKBB 1ENCA 1SE8A 3FP9A 1IYJB 4H02A 3S2DH 2ZTEA 3STBD 4DR1L 1TWAB 4OWXB 4YY3L 1HR0L 3EJIA 1GM5A 3ND9A 1F9RA 3I4NG 4N9PA 5M5WH 2B2TA 2GVBA 2PW5A 4A3DH 5C4XB 3PIOA 4WFN3 1V9PA 4GOPA 4KK7A 2KCTA 1D6EC 4GKJQ 1SRUA 4WJWA 3BVMA 4FYDA 2VUMG 3A56A 3P75A 2WB1E 1F9PA 3H3VC 3PUYA 1EWCA 3SDZA 3KYHC 3RZDH 3E5SA 4DV3Q 3OW7A 1GD7A 2AQ1B 3PO2G 4A3LH 2IL8A 3U4VA 3HOWH 2R7FA 5NUCA 4QY7A 2BE5C 1K9MC 1NR2A 1D1IA 4LF7Q 3HOYH 1QNKA 4X66Q 4HJ8A 3PSIA 3Q23A 1GUSA 2HUGA 1C8CA 4X3SA 3FPPA 2EXDA 3GTMB 1XNRL 1U5KA 1TS2A 3H0GB 1HR0W 2N3SA 5FLXL 2ALYB 3OW2A 3HKZE 2LMCB 4DAVA 1MJCA 3A8JE 4DR1Q 1I4PA 4YY3Q 1HR0Q 3E9HA 2TMPA 2Y0SG 4GN5A 2CW0C 5C3XA 3SE0A 1K83B 3SR1A 3ZJYC 3KF8B 5IP7H 1HUMA 3S15H 4DV7L 5EPJA 1JC7A 1F2LA 4A3DG 2B2UA 4ALPA 1G291 3L2PA 1QNUA 5AFWA 2HQEA 1I6HB 1D5XC 3AFPA 5CV8A 4KJOA 1YIJA 1PTOD 1PXUA 3D3RA 1XTDA 3JAMc 4L8JA 2V4DA 4YCWA 1P8LA 4A3LG 3M4PA 1YJWA 4K2KA 3PUZA 3HOWG 1AE2A 1L0YB 2HHHL 1DOMA 1IBKL 1NJIC 4C3JB 3L0OA 5LMUL 4K2LA 3NHHA 3R3OA 2KVMA 2B63H 4JK1C 3PO3H 2E2HB 3U50C 5JPNC 1XNRQ 2KA7A 4F87A 5EPLA 3NTIA 3K0YA 3FVQA 4GZYC 5FO8B 1L0XB 1EYDA 3BU2A 2IHFA 4L5QA 3W3AA 4DV7Q 2K28A 5DM63 1BCPD 1IHZA 3AMUA 1VQ8A 3JAML 4ZAIA 5IP7G 2AWNA 4GNXC 1KNAA 4Y7NB 3HP3A 3R93A 3T1YL 1TWHB 5E1FA 1XPRA 4BBSB 1KTKA 2MJ8A 1SNOA 3BJUA 3MZ5A 2ZJPA 3V96A 1T9HA 2NVYB 4A3EH 1O7ZA 2VB2X 1HUNA 4CGYB 1VQ5A 3HG9A 3S1QH 1H95A 2NVTH 1S3OA 1B53A 4A3FB 1QCBD 3G6JB 1ILQA 2HHHQ 2IHEA 1IBKQ 5LMUQ 2PZTA 5JOBA 3PUVA 2XTIA 4DNTB 1VQPA 5JVH3 4LFCL 5AJ3L 1UE6A 1ZYRC 1W3SA 4JG2A 3I8ZA 2F0FA 1IW7D 2A6HC 3HOUB 2B63G 2FMCA 1ZKOA 3PO3G 3DWQA 4MHEA 1PRTF 1V8QA 4JI8L 3CXCA 2PO4A 4PZ6A 4H13C 1ET6A 4IFDI 5FLXE 2IT1A 2K5QA 4C3HH 4R4TA 3RZOH 3HOXH 4LNQA 1RKNA 4FP5D 4DUYL 1WTVA 3T16A 1S5FD 3CCLA 1WTXA 4IJLA 4P71A 1VQOA 4B9WA 1RF2D 3TSSA 4K6LA 3J80L 3S1RH 2R61A 4EQPA 2K4KA 1ESRA 2MUYA 3K5MA 1V43A 2K03A 1BF4A 2HCIA 1WOCA 2LY7A 4OL7A 4RGNA 1OXUA 4A3CH 2RDHA 2VS1A 1U9RA 4OIKA 1FYCA 4BXXH 1ZXTA 5HY6A 3GTJB 4A3EG 1LM0A 1F2MA 3K5LA 3U4ZA 1V1PB 3CQZH 2I5HA 1EY8A 2HQLA 4GN4B 5G3LD 4BS9A 4DUZQ 3KF6B 1EU3A 4IOCA 1NCVA 4LFCQ 1A8VA 3G4SA 5AJ3Q 4GLVB 1S5CD 2WB1G 2F0JA 2R7DA 1BBUA 3S24A 1PH5A 5ELEA 4NW2A 2BH8A 1EZ8A 2N88A 1D1KA 1FD7D 1MSGA 5FO9B 1VCIA 4EX5A 3RD4A 4XXEA 1Q8IA 2VNUD 4QGUA 1HNZQ 4C3HG 1O7IA 3M4YA 2H1EA 1JORA 3HOXG 4DR3L 5EBCA 1H9KA 5IOCA 2R92B 1R4PB 1Y1VB 3OYYA 4LAAA 3OPOA 1Y1WH 1SNQA 4PMWA 3JAME 1TXYA 2R7ZG 2JA8B 2E76C 3NTHA 4K8JA 2IX0A 2NUCA 2ZT9C 4LF9L 2QKIC 4A3BG 1HH2P 3Q8DA 3K81C 4JI3L 2A6EC 3URYA 3GD7A 4OO1I 5I2XA 4CJ1B 2A19A 4LWCA 3D8GA 4FNFA 4KKTA 3KJOA 2PZUA 1I4GA 1TWCH 4JI0L 1ML0D 4A3CG 2F4IA 4C3IB 3CHBD 4BXXG 3HOZB 2MO0A 3CD6A 4K5VA 2KCNA 3Q22A 3S1MH 5KNCA 4HCSA 1E24A 4POGA 4KMUC 1NMFA 5C4HA 3NEMA 3UI2A 4A3JH 1CKMA 1EYGA 1PH2A 3S16B 3B6YA 3J81i 4LF5L 5C3EB 3HKZB 1STHA 5I4DA 4LUZA 3RLOA 1CKOA 1SJED 4O0AA 4V190 1VS0A 5IGEA 2A5HA 3QIAA 4IQZA 2MO1A 3M4QA 4FF4A 5FLMH 1C0AA 1F2YA 1KHIA 2Q2IA 1YHQA 1PRTC 3CCQA 2XIWA 4NPSA 1LTRD 3NXWA 4G57A 1N33L 1QVGA 2E2JH 5GAHC 2QEJC 5M5XH 4IURA 1A15A 3FKIH 4DR3Q 3I4MB 1Q7YC 4FO2A 3KOJA 1I50B 2MPMA 2UUBL 4X65L 1LTTD 4AYBE 1JE4A 3MWYW 1DGSA 4LF9Q 3OIQA 3J80E 1Y1WG 4IUVA 3NBHB 2EY2A 1UE1A 4DR5Q 3H3VH 2DY8A 3HOVB 1WFQA 5I6WA 4JI0Q 5F2DA 1SE3A 1SYBA 2B2UC 3BYYB 3MFYA 2L1BA 2LXKA 5C0XJ 2ASBA 1WTQA 4QQBX 2VQFL 4DF7A 3OTOQ 2JA6B 3GTKB 4X64L 5I9OA 2K5WA 5GQOA 1R9TB 3KLRA 4LF5Q 2EE1A 5E4WC 4RA8A 1FNWA 1Z47A 4A3JG 2RA4A 1L1OC 2KENA 5IP9H 2AWOA 2K01A 3NTKA 1SN8A 1BQQT 1IKMA 5FJ8H 3OSOA 1S40A 2KHIA 1GUOA 5FLMG 3G7LA 4A3IB 2A69D 2WKCA 5BR8L 4QUCA 2OWOA 3SK4A 4DNRB 1STBA 2N49A 2KOLA 2G9DA 2K33A 2UUBQ 4X65Q 4O2DA 2K75A 4IUNA 5C0XH 5EJWA 4YWLA 3FKIG 4PV1C 5M5YH 1M4VA 2EYPA 3WOFA 3KLSA 5GADC 1MSHA 1EY7A 4A3GB 3NK9A 3HS0C 2UXDL 2Y0SE 1X3QA 3EIVA 3ULLA 4IFDH 1XPOA 1SDFA 4OX9L 1GVPA 2VQFQ 2FJ2A 1KQSA 1I4QA 1J6QA 1HQRD 2D9UA 3NSWA 3RLFA 4LF6L 4BBRH 3W2DA 5KYIA 4P74A 2L12A 3R8BA 3STBC 3TZDA 2ID0A 4XYOA 4R4QA 2ZXOA 4P72A 2XWBB 1YITA 4HEDA 3SK6A 5D14A 2F0QA 1BCPF 1XXGA 1TR5A 4E6IA 3TREA 2G9HD 4JCVE 3E6ZX 4R1JA 4KJNA 4QF4A 2UXCQ 1HXYD 5IP9G 4GNXA 2KJXA 3VYTA 2C35B 4DV6L 1T5EA 4DR7L 1Q3LA 1VMCA 4TSSA 3EVQA 2D2CC 2Q8RE 3G48A 5TSSA 1RDPD 1HCZA 5ELCA 5FJ8G 5BR8Q 1HZBA 2WACA 3FRPB 1E2WA 2EYOA 4OWWB 1QUQA 4K0KL 4HJ9A 2BA1A 3M85A 1N8RC 3GTOB 5BN3A 3CMEA 3GTLB 3A74A 1FJGL 3C2PA 1STEA 4IJHA 5C4JB 5E7NA 4WJ4A 3MXNB 1XMQL 4ILWA 3K0XA 5C0XG 2F1MA 3J7AV 1I4HA 1E1OA 4F8MA 3F2CA 4TKOB 5KNBA 3AU7A 4DKAC 3M3YH 4B08A 2WAQE 2UXDQ 1SAPA 3EA6A 3C1EA 5J22A 4FVMA 1RL2A 1LLRD 2H5XA 4OX9Q 1ENFA 1KDAA 3GDEA 3DM3A 1D8LA 1E7ZA 4LF6Q 2B39A 2DNEA 1IL2A 1X3EA 5LL6X 1K8OA 2O5IC 4TVAB 1A2UA 5J1ZA 5M3FB 1IBML 4BBRG 4KKSA 3EQLC 5IWAL 2GA4B 2L11A 3WOEA 2PNRC 3NPPA 2RVLA 1O78A 2UXBL 4KKUA 5EGTA 1I6VC 4KY7A 3UDGA 4DV6Q 4DR7Q 3PCOB 3UDFA 1VQ4A 1K73C 4OO1H 2EYLA 2MQHA 4B9XA 3HZXA 4C56C 5C4XH 3AB9A 1OXSC 5JJKA 2HDMA 1SYCA 1PTOC 1EWIA 1G51A 4K0KQ 1LTAD 4C2MH 3I3CA 3AYHB 1STNA 3EROA 4PQXA 3DM1A 3VR2A 1FJGQ 1VQDA 3D4WA 1VQ9A 1C48A 5G3LF 1KL9A 1JOKA 3KJPA 1CQVA 5GAEC 5KRUA 3GTQB 1BBWA 3DMUA 4IPGA 1LT6D 2E74C 1VQNA 2A68D 4BY7H 3RN5A 3VR4A 1Q90A 1PA6A 2DNCA 4YIJA 3TP5A 4L5SA 1D7QA 2WKDA 4NMZA 3BVZA 5D65A 5IWAQ 1TS4A 4AYBG 4UDUC 2UXBQ 1UEAB 5KGUA 5CR3A 2I46A 3H09A 1F2ZA 5CV4A 1BCPC 1MIUA 4PNYA 1H9RA 1FNVA 3ULPA 2C9OA 5E4XA 1TVXA 5FK9C 4RHSA 1M1KC 1NE3A 3AEVA 2R93H 4NXNL 3QG1A 4OO1G 1QUQB 3N52A 5C4ZA 4DV1L 1PH8A 2HDLA 1FVIA 4JI1Q 5FLXc 2K32A 3NWTA 3LWUA 1Q46A 3J81L 1VQAA 1CUKA 4DAPA 2UUCL 3PUXA 3H94A 5HURA 5EAYA 5BN4A 1Y8PB 3RNUA 1UE7A 3CAMA 3I4NB 2OTJA 2EYJA 1G2TA 5CBEE 4BA1I 1I3QH 4P2CB 2F3WA 1P16A 1IW7C 1C4QA 4CHTB 2B3GA 4CKCA 2VUMB 4ID6A 3PF5A 2Z0SA 3DXJC 2L15A 3SVMA 3A5ZB 3RMHA 4BY7G 1SBBB 4HJAA 3TDQA 3KBGA 5A2QL 1J9OA 5GROA 3NQTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI8 L;  3CXC A;  4IFD G;  2E8G A;  2PI2 E;  3HOV G;  4PZ6 A;  4IFD I;  1EFW A;  2IT1 A;  1X54 A;  4C3H H;  3G6E A;  4A3M H;  3F2D A;  4R4T A;  4DAM A;  1WJJ A;  3RZO H;  3HOX H;  1WYD A;  4LNQ A;  3A5U A;  3K7A H;  4RG1 A;  1A0I A;  1ASY A;  2I5L X;  4DUY L;  1N34 L;  1CSP A;  2ZJR A;  4DR4 L;  1XPU A;  3LGJ A;  4YWM A;  4B3S L;  1VQG A;  1KIX A;  4PG3 A;  5JEA G;  3F1Z A;  4LUV A;  2JA6 G;  2UU9 L;  4R4O A;  3EN2 A;  2ATW A;  2CFM A;  4JI5 L;  1TWF H;  1QZH A;  3CCL A;  1KRT A;  4IJL A;  4P71 A;  1UE5 A;  4LFA Q;  4DV1 Q;  1TWA H;  1VQO A;  1Q86 C;  3T1H L;  1U0L A;  1JE5 A;  3PF4 A;  4OWT B;  4UP8 A;  3S1R H;  2R93 G;  2K4K A;  1KC8 C;  4LUO A;  3CCR A;  2HT1 A;  1V43 A;  2QEX A;  3CCM A;  1WOC A;  2VQE Q;  2UUC Q;  4JI2 Q;  1OXU A;  5IYB G;  1KXL A;  4A3C H;  4YCV A;  2VS1 A;  1Q81 C;  2WFW A;  3CC4 A;  2MNA A;  4UY8 C;  4BXX H;  1HNX Q;  5HY6 A;  2PQA A;  5IYC H;  3CCS A;  5JEA J;  4A3E G;  1LM0 A;  2YYZ A;  4WJ3 M;  3U4Z A;  4A3I G;  1XMQ Q;  4JBK A;  4YCU A;  3CQZ H;  1L1O A;  2I5H A;  3GTO H;  1YNX A;  4JI6 Q;  3GTL H;  5K36 G;  2HQL A;  1B7Y B;  4GN4 B;  5C4J H;  1NMG A;  1S72 A;  3D0F A;  1Q8K A;  1YBY A;  2HIX A;  4MTN A;  1HNW Q;  4DUZ Q;  3KF6 B;  3TEH B;  4IOC A;  3TQY A;  2UXC L;  4LFC Q;  1A8V A;  1BKB A;  1VQF A;  2AKW B;  5AJ3 Q;  3G4S A;  3AQQ A;  4GLV B;  3J81 c;  2WB1 G;  1W2B A;  2NZH A;  3KDF A;  3HKS A;  4DK6 C;  2R7D A;  1B8A A;  2K5N A;  4X62 Q;  1BBU A;  4DV0 L;  1N34 Q;  1N9W A;  3HOY G;  3S24 A;  1SRO A;  4A3G G;  1PH5 A;  2BH8 A;  4KLK A;  3I56 A;  2V1C C;  4HIM A;  1PH1 A;  1VCI A;  4HJ5 A;  1IBM Q;  3PO2 H;  1Y14 B;  3UE1 A;  4EX5 A;  4A76 A;  1EIY B;  1PH3 A;  3GTM H;  4DR4 Q;  1QVC A;  4IOA A;  2Q2U A;  4B3S Q;  2Z6K A;  2VNU D;  4QGU A;  1HNZ Q;  4A3M G;  1O7I A;  5M3F H;  2WAQ G;  3CW2 C;  3HOX G;  3H0G H;  4GNX B;  2UU9 Q;  4HIK A;  5JJI A;  3H15 A;  5DLQ E;  4JI5 Q;  1GO3 E;  4J15 A;  4DR3 L;  4QIW E;  3W1B A;  3F2B A;  3T1H Q;  2OQ0 A;  3OYY A;  4GOP B;  4R4I A;  3SGI A;  4PMW A;  1Y1W H;  1Q82 C;  1TXY A;  3I4O A;  2R7Z G;  2K5H A;  2BH2 A;  2IX0 A;  1K83 H;  4LF9 L;  4A3B G;  1HH2 P;  4DV2 L;  3Q8D A;  3K81 C;  4R4C A;  4JI3 L;  3GD7 A;  2VL6 A;  4OO1 I;  2A19 A;  5C4X G;  2DGY A;  4LWC A;  2E2I H;  5ELN A;  3KJO A;  2I5M X;  1TWC H;  4JI0 L;  2GVA A;  2MFI A;  2YTX A;  3S1N H;  3S2H H;  1I6H H;  4A3C G;  3L7Z C;  2RF4 A;  2JQO A;  5LMN L;  2CCZ A;  3CPW A;  4KHZ A;  4BXX G;  2MO0 A;  3CD6 A;  3MEF A;  5JJL A;  4JBJ A;  3E0E A;  5IYC G;  3S1M H;  2JEB I;  2D62 A;  1L0W A;  1E24 A;  2ZM6 L;  4POG A;  1NMF A;  3NEM A;  3PV0 A;  3J80 c;  4A3J H;  1CKM A;  3CP0 A;  2DUD A;  1EYG A;  1PH2 A;  2A8V A;  3B6Y A;  4AQY L;  3J81 i;  4LF5 L;  1CKN A;  2JJQ A;  1QZG A;  3GTQ H;  4LUZ A;  1EQR A;  1CKO A;  4ME3 A;  4O0A A;  3RLO A;  4Y52 H;  4DV0 Q;  1VS0 A;  4HJ7 A;  2PI2 A;  2MO1 A;  3M4Q A;  4HIO A;  5FLM H;  1C0A A;  4C3J H;  4HID A;  1KHI A;  2Q2I A;  1G6P A;  1YHQ A;  3CC7 A;  1X56 A;  4GKK L;  3CCQ A;  2RCN A;  3ER0 A;  4NPS A;  2E2H H;  4YWK A;  3ICE A;  4XTC S;  1N33 L;  1QVG A;  1N32 L;  1PYS B;  1WCM H;  2E2J H;  2KHJ A;  3ULJ A;  5GAH C;  5M5X H;  3FKI H;  2N8N A;  4DR3 Q;  3CPF A;  3K7U C;  1Q7Y C;  4JYA L;  3J7Z C;  1J5E L;  3KOJ A;  5M3F G;  1CSQ A;  2UUB L;  4X65 L;  4RMF A;  3H0G G;  4IPH A;  4AYB E;  1EIF A;  4GLX A;  1SFO H;  1DGS A;  4LF9 Q;  5IE8 A;  4NXN Q;  2LSS A;  4DV2 Q;  1Y1W G;  4JOI A;  3NBH B;  1YHA A;  4AH6 A;  1MJE A;  4LF4 L;  1UE1 A;  3F8T A;  3NEL A;  4DR5 Q;  3H3V H;  1KRS A;  3T1Y Q;  1WFQ A;  1EUJ A;  1UEB A;  1VQC A;  2FXQ A;  5LMN W;  1GKH A;  2CWP A;  4JI0 Q;  2RHQ B;  4Y7N H;  1EOV A;  1V1Q A;  4DR6 L;  2XGT A;  2YTY A;  4JC0 A;  2JA7 H;  5LMN Q;  2D0O A;  1TWH H;  2LXK A;  5ELO A;  5C0X J;  2ASB A;  4QQB X;  2VQF L;  1PH6 A;  2IX1 A;  4BBS H;  4B3M L;  3CCU A;  2VZA A;  2ZM6 Q;  1HZA A;  2GN5 A;  1KD1 C;  1Q1E A;  3J80 i;  3OTO Q;  1JB7 A;  3GTG H;  1BVS A;  2F52 A;  4X64 L;  2NVY H;  1X6O A;  5GQO A;  4AQY Q;  4LF5 Q;  3KDF B;  1X65 A;  1OXX K;  1LTL A;  4MZ9 A;  3I4N H;  1HZ9 A;  3M7N A;  1Z47 A;  4YHH L;  4A3J G;  1L1O C;  2KEN A;  1LUZ A;  2LXJ A;  5IP9 H;  3NEN A;  1B70 B;  4DAY B;  4A3F H;  1FGU A;  3I55 A;  4TQU S;  1RIP A;  2BA0 A;  1X9N A;  2AWO A;  1L2F A;  1YHB A;  1SN8 A;  2NVQ H;  3TS0 A;  1OXT A;  5FJ8 H;  1PH9 A;  1PH7 A;  1K0R A;  4XIG S;  4OXP A;  1S40 A;  2VUM H;  4GKK Q;  2KHI A;  3DLL A;  4JV5 L;  1IXR A;  3CCJ A;  4L5R C;  5FLM G;  4JI1 L;  1PFS A;  4GKJ L;  4JI8 Q;  1N32 Q;  5BR8 L;  4BA2 I;  2OWO A;  3HOU H;  3D31 A;  4DNI A;  1SLJ A;  2PMZ E;  1K8G A;  3W5O A;  2N49 A;  4JYA Q;  4LFB L;  1J5E Q;  5IY0 A;  4X6A H;  2UUB Q;  4X65 Q;  4O2D A;  2K75 A;  1WCM G;  3CMA A;  4DUY Q;  1HZC A;  3ERS X;  3FKI G;  4YWL A;  2Z6K C;  4EQ5 A;  5M5Y H;  4DV3 L;  4B3T L;  1C7Y A;  4GS3 A;  3JC6 6;  5GAD C;  3I7F A;  3UE0 A;  2K52 A;  1EQQ A;  3RN2 A;  1X3G A;  3UDX A;  4LF4 Q;  1JMC A;  1VQJ A;  2IY5 B;  2UXD L;  2EQS A;  2Y0S E;  1Q12 A;  4B3R L;  4LF7 L;  4DR6 Q;  3KF6 A;  2QGQ A;  3EIV A;  4X66 L;  3ULL A;  1YJ9 A;  1XPO A;  1XNQ L;  4OX9 L;  1GVP A;  2VQF Q;  3H3V I;  1VQE A;  1KQS A;  4NB3 A;  2CKZ B;  2JE6 I;  4B3M Q;  1J6Q A;  3I2Z A;  2JA7 G;  3RLF A;  4LF6 L;  4BBR H;  3J81 j;  4QJF A;  1E22 A;  1TWG H;  3S2D H;  4P74 A;  2CWA A;  3STB C;  2ID0 A;  1CKN B;  1VQH A;  4R4Q A;  4BBS G;  4P72 A;  1YIT A;  1I5F A;  4LF8 L;  3GTJ H;  3BZC A;  4JBW A;  4YHH Q;  3G71 A;  3S14 H;  1SE8 A;  3FP9 A;  1IYJ B;  4H02 A;  2ZTE A;  3STB D;  3TRE A;  4DR1 L;  1XJV A;  4JCV E;  4OWX B;  4YY3 L;  1HR0 L;  1GM5 A;  3GTP H;  3I4N G;  4R1J A;  5M5W H;  3M9B A;  2UXC Q;  5IP9 G;  2KCM A;  4GNX A;  1XMO L;  2C35 B;  2GVB A;  4DV6 L;  4A3F G;  4NXM L;  4A3D H;  1JT8 A;  4DR7 L;  2NZO A;  3PIO A;  4JV5 Q;  3KFU A;  1OXV A;  1V9P A;  4GOP A;  2KCT A;  3G48 A;  4GN3 B;  1AH9 A;  3J7A 5;  4GKJ Q;  1SRU A;  5M3M H;  4JBM A;  5FJ8 G;  2D0P A;  5BR8 Q;  1HZB A;  1NY4 A;  2VUM G;  2WB1 E;  4OWW B;  4DPG A;  3PUY A;  3EBE A;  3IRB A;  1AE3 A;  1QUQ A;  1PV4 A;  4LFB Q;  4K0K L;  1JJG A;  4HJ9 A;  3GO5 A;  3KYH C;  3RZD H;  1X55 A;  1VQI A;  2BA1 A;  3M85 A;  1N8R C;  3HOU G;  1FL0 A;  2PNH A;  4DV4 L;  4B3T Q;  1NBW A;  1YEZ A;  3CME A;  2F3I A;  2NN6 G;  3A74 A;  1GD7 A;  4DV3 Q;  1FJG L;  1KAW A;  2OQK A;  4IJH A;  5IYD H;  5E7N A;  3PO2 G;  3MXN B;  4POF A;  1XMQ L;  1PHJ A;  1YVC A;  1SR3 A;  4A3L H;  4WJ4 A;  3K0X A;  3U4V A;  5C0X G;  4DV5 L;  1E1O A;  3F2C A;  3HOW H;  5C0X I;  2R7F A;  2QA4 A;  4DKA C;  2JA9 A;  3M3Y H;  2ZTC A;  3CC2 A;  4QY7 A;  1K3R A;  4DUZ L;  2WAQ E;  2UUA L;  1K9M C;  2UXD Q;  4B3R Q;  4LF7 Q;  2EIF A;  3HOY H;  2R92 H;  1Y1V H;  3KLW A;  2ZTD A;  4X66 Q;  1XNQ Q;  1RL2 A;  4HJ8 A;  2B29 A;  2H5X A;  3PSI A;  1K8A C;  4JOI C;  4JI3 Q;  4OX9 Q;  2JA8 H;  3UDI A;  4X62 L;  3GDE A;  3DM3 A;  1D8L A;  1E7Z A;  2PQA B;  4LF6 Q;  2F4V L;  1IL2 A;  1X3E A;  2EXD A;  4DR2 L;  4TVA B;  1XNR L;  1U5K A;  1L1O B;  1IBM L;  3BZK A;  4BBR G;  4LF8 Q;  1HR0 W;  2N3S A;  2ALY B;  3OW2 A;  3HKZ E;  5IWA L;  1MJC A;  2YU9 H;  4DR1 Q;  1HNZ L;  1JJC B;  4JI4 L;  4YY3 Q;  1M90 C;  1HR0 Q;  4C3I H;  3E9H A;  2UXB L;  1NTG A;  2Y0S G;  3HOZ H;  4GN5 A;  1VQ6 A;  4UPA A;  2R7Z H;  2AMC B;  1XMO Q;  3UDG A;  4DV6 Q;  4NXM Q;  4FDB A;  4DR7 Q;  3PCO B;  3UDF A;  1VQ4 A;  3ZJY C;  4PZ7 A;  1K73 C;  1N36 L;  3E9I A;  4A3B H;  2VW9 A;  1VQK A;  1A63 A;  3KF8 B;  5IP7 H;  5C44 H;  2MQH A;  3S15 H;  4DV7 L;  1C9O A;  3S16 H;  4IFD J;  4IPD A;  5C4X H;  5C3E H;  4A3D G;  5H1S E;  1OXS C;  4ALP A;  1G29 1;  3PUW A;  3L2P A;  5JJK A;  2JA5 H;  1VQM A;  2OTL A;  3K80 C;  2AHO B;  4BY1 H;  1I94 L;  1EWI A;  1G51 A;  4AIM A;  3AFP A;  4K0K Q;  5M3M G;  4JI7 L;  3VDY A;  4C2M H;  4QL5 A;  2A1A A;  4APV A;  1YIJ A;  3AYH B;  4DV4 Q;  3PIP A;  1N33 Q;  1FJG Q;  2K14 A;  2Q2H A;  4A3K H;  1VQD A;  1XTD A;  1VQ9 A;  1X3F A;  3JAM c;  4IPC A;  1KL9 A;  4DV5 Q;  2ES2 A;  3PGZ A;  4A75 A;  4A93 H;  5IYD G;  1PH4 A;  3S17 H;  3AFQ A;  3KJP A;  4YCW A;  3WWV A;  1P8L A;  4A3L G;  3M4P A;  2UUA Q;  1SMX A;  5GAE C;  1YJW A;  1BBW A;  3I4M H;  2CQO A;  3PUZ A;  1I50 H;  3HOW G;  4IPG A;  1AE2 A;  2R6G A;  2HHH L;  2OCE A;  2KBN A;  4P73 A;  1IBK L;  1VQN A;  4KHP L;  1NJI C;  3CF5 A;  3L0O A;  5LMU L;  4BY7 H;  3RN5 A;  2R92 G;  1Y1V G;  2F4V Q;  2E5L L;  2YV5 A;  2B63 H;  4DR2 Q;  1PA6 A;  3PO3 H;  1E3P A;  1Q1B A;  1VQB A;  4LW1 A;  3U50 C;  4A4I A;  4PZ8 A;  1YI2 A;  2VY3 A;  4L5T A;  4L5S A;  1XNR Q;  1D7Q A;  3HOV H;  2JK8 A;  3RR5 A;  5IWA Q;  1IBL L;  1VQ7 A;  4AYB G;  4JI4 Q;  3M4O H;  5GAG C;  2UXB Q;  1HJP A;  4OON A;  4X64 Q;  3HFZ B;  2JEA I;  1E1T A;  2K5V A;  1OTC A;  2Q2T A;  1MIU A;  4KI0 A;  3K8A A;  3ULP A;  2JA6 H;  3GTK H;  1N36 Q;  3BU2 A;  1R9T H;  2IHF A;  4L5Q A;  3HOZ G;  1ASZ A;  1YJN A;  5HGQ A;  4UP7 A;  4DV7 Q;  2HIV A;  1YZ6 A;  1NE3 A;  1M1K C;  1VQ8 A;  1QVF A;  3AEV A;  2R93 H;  4NXN L;  4OO1 G;  1QUQ B;  5IP7 G;  2AWN A;  5C44 G;  4GNX C;  4DV1 L;  2I0Q A;  1I94 Q;  4LFA L;  3A0J A;  4DR5 L;  5C3E G;  1Z9F A;  1PH8 A;  3T1Y L;  3HKZ G;  5J3B A;  5IYB H;  3CCE A;  1FVI A;  4JI7 Q;  2JA5 G;  4JI1 Q;  5FLX c;  4GOP C;  1XPR A;  3BJU A;  4BY1 G;  2ZJP A;  1Q46 A;  5IT9 c;  1VQA A;  3CCV A;  1CUK A;  2VQE L;  1MKH A;  1T9H A;  3JAM i;  2UUC L;  4A3E H;  4JI2 L;  1UWV A;  3PUX A;  4MNO A;  1PYB A;  4GLA C;  5EAY A;  2WP8 J;  4A3I H;  3RNU A;  3OTO L;  1VQ5 A;  1UE7 A;  3CAM A;  2YTV A;  4A3K G;  1HNX L;  2OTJ A;  3S1Q H;  1H95 A;  2NVT H;  3W1G A;  3TRZ A;  1S3O A;  1IZ6 A;  2NVX H;  1WI5 A;  4DK3 C;  4A93 G;  2NN6 I;  4BA1 I;  2HHH Q;  2IHE A;  1I3Q H;  4P75 A;  1IBK Q;  4KHP Q;  4JI6 L;  1JJ2 A;  5LMU Q;  1P16 A;  1VQL A;  3I4M G;  3U58 A;  2N78 A;  2K50 A;  3PUV A;  2B3G A;  3RLN A;  2E5L Q;  2XTI A;  3PF5 A;  2RHS B;  1HNW L;  1A62 A;  2Z0S A;  1VQP A;  4LFC L;  2L15 A;  5AJ3 L;  1UE6 A;  3A5Z B;  4UP9 A;  1LYL A;  1W3S A;  4BY7 G;  4A3G H;  4JG2 A;  3FHW A;  3TS2 A;  2JA8 G;  4HJA A;  2B63 G;  1IBL Q;  2ZJQ A;  3PO3 G;  1PVO A;  5GRO A;  4IO9 A; 
#chains in the Genus database with same CATH topology
 2WII B;  3DWP A;  3PO2 B;  2E8G A;  2PI2 E;  1AZQ A;  5T1G A;  3NWS A;  1X54 A;  3G6E A;  3RUZ A;  4A3M H;  2DJG C;  2K6A A;  3A5U A;  3K7A H;  1A0I A;  2ZJR A;  5KYL A;  4DR4 L;  5IGC A;  1VQG A;  4PG3 A;  3F1Z A;  2UU9 L;  2NB0 A;  2ATW A;  4JI5 L;  1TWF H;  1QZH A;  2BDN A;  1KRT A;  4DV1 Q;  1U0L A;  3PF4 A;  4CKB A;  4UP8 A;  4XT1 B;  2R93 G;  2NTS A;  2EJG C;  4OHJ A;  1KC8 C;  1G8Z D;  2QEX A;  1GUN A;  3CCM A;  4QIW B;  3MFG A;  1QIL A;  2UUC Q;  3QJY A;  2NBF A;  4UHV A;  4DGZ A;  1Z6H A;  1E2V A;  3CC4 A;  2Y0S B;  2MNA A;  2PQA A;  2RQX A;  3FMC A;  3S2D B;  4DN4 M;  1ENA A;  4JBK A;  2ENB A;  4YCU A;  1L1O A;  5M5W B;  1YNX A;  1HTP A;  4A3D B;  1NMG A;  1Q8K A;  2HIX A;  4DA2 A;  4QUF A;  3R2I A;  2AKW B;  2O2L D;  3AQQ A;  4HTH A;  4KN7 C;  3HKS A;  1IKL A;  2RSN A;  1SEB D;  4DV0 L;  3HOY G;  3IFD A;  3RZD B;  1EYA A;  5IGB A;  4HIM A;  3SEB A;  1STA A;  1DZ1 A;  2F0S A;  3UE1 A;  1SYE A;  4DR4 Q;  2Q2U A;  1JOO A;  4A3M G;  4JW0 A;  3HOW B;  1YNN D;  2WAQ G;  3CW2 C;  3LX0 A;  2UU9 Q;  4HIK A;  3N6R A;  5DLQ E;  4JI5 Q;  1GO3 E;  3W1B A;  3F2B A;  1Z7T A;  2OQ0 A;  4GOP B;  4FF2 A;  4R4I A;  1BNZ A;  2B8F A;  1CHQ D;  4OEL B;  3WDN A;  2PYK A;  4J1M A;  2B8G A;  4DV2 L;  2E2I H;  1PZK D;  2YTX A;  3S1N H;  3S2H H;  2RF4 A;  1SJH D;  1DOL A;  4JBJ A;  1PZJ D;  2JEB I;  1L0W A;  3QO2 A;  4MTK A;  3OHX C;  3PV0 A;  4HMJ A;  4BWG B;  3J80 c;  3BDO A;  4RKL A;  2A8V A;  4WRD A;  1YNJ C;  2FIN B;  1QZG A;  3IAY A;  1EQR A;  2JN4 A;  3HRZ C;  4DV0 Q;  1JIC A;  5CMD A;  2Q8I B;  2PI2 A;  1CZW A;  1RHP A;  1CZG A;  5A2Q E;  1G6P A;  1K0S A;  3VR6 A;  2EOT A;  1KDC A;  3J7A F;  3GV6 A;  2HCC A;  4EVO A;  4UAI A;  2RCN A;  4DXG A;  4RH6 A;  1PYS B;  1KDB A;  1WCM H;  2KHJ A;  1ET9 A;  2J7Z A;  2N8N A;  3QB3 A;  4JYA L;  2B2Y A;  1NR4 A;  3J7Z C;  2F03 A;  1CSQ A;  2NZ1 D;  3OWF A;  3ND8 A;  1SFO H;  1XYI A;  1GXD C;  1JWS D;  1CFM A;  2I07 B;  5IGG A;  4DV2 Q;  2B63 B;  3T56 B;  3PO3 B;  2AQ2 B;  3NEL A;  1KRS A;  3T1Y Q;  1CI3 M;  1EUJ A;  1UEB A;  3T13 A;  3MHB A;  1EOV A;  2JA7 H;  1R4Q B;  1LT5 D;  1G6Z A;  1PH6 A;  3IFT A;  2CQA A;  2VZA A;  2KEE A;  2O5J C;  4OEM B;  5C5M A;  3GTG H;  1LTG D;  3BVG A;  1X6O A;  5FKA C;  1STY A;  3TME A;  2MP1 A;  2NWG A;  3QOL A;  1EU4 A;  1LTL A;  2ICI A;  1WTH A;  3HEJ A;  3M7N A;  4YHH L;  1LUZ A;  1B70 B;  2F0U A;  2CW0 D;  4I65 A;  5HGT A;  4TQU S;  3I55 A;  1NAP A;  2A69 C;  1LAB A;  2M2L A;  1PH7 A;  1K0R A;  4JV5 L;  1EY0 A;  3CCJ A;  4A3E B;  5J39 A;  4JI8 Q;  1B2T A;  4BA2 I;  3S1Q B;  3D31 A;  1SLJ A;  2PMZ E;  1K8G A;  3W5O A;  2NVT B;  4JYA Q;  3J7Y W;  5DEH A;  1QOH A;  1WCM G;  4DUY Q;  4IAL A;  4B3T L;  4EQ5 A;  1H9J A;  2WB1 B;  5ISR A;  1C7Y A;  5DM7 3;  3JC6 6;  3X3M A;  3UE0 A;  2F0W A;  3PIO 3;  1CT1 D;  2K52 A;  2F0E A;  1PTO H;  1JMC A;  2PQE A;  4Q5V A;  2Z8L A;  2IY5 B;  4B3R L;  1Q12 A;  2QGQ A;  3TP6 A;  1XNQ L;  3MXP A;  1QJO A;  4ZCK A;  2BOS A;  4I7Z C;  2CKZ B;  4QMG A;  3K5N A;  4C3H B;  3HGB A;  3I2Z A;  1SMY C;  2JA7 G;  3RZO B;  3HOX B;  4QJF A;  1QG7 A;  1TWG H;  1EY5 A;  2DN8 A;  3S2D H;  2CWA A;  4IUQ A;  4K5X A;  1EY9 A;  3BZC A;  4JBW A;  2EXZ A;  4YHH Q;  3G71 A;  2R7Z B;  2Z4I A;  2K05 A;  2M9V A;  3J7A 5;  2RSO A;  5M9O A;  3GTP H;  4L6T B;  3T4A C;  4A3B B;  2A73 B;  3S1R B;  3M9B A;  2KCM A;  4NXM L;  2EYF A;  1IYU A;  1F77 A;  2NZO A;  1RD9 D;  1SXT A;  3K59 A;  4JV5 Q;  3KFU A;  1S5B D;  1OXV A;  1AH9 A;  3U9O A;  5M3M H;  2D0P A;  2F0K A;  1NY4 A;  5IGF A;  1D5M C;  3IRB A;  5CGK A;  1AE3 A;  3I73 A;  1E2Z A;  1JJG A;  3GO5 A;  1SNM A;  1X55 A;  1VQI A;  4ME5 A;  3CQZ B;  4B3T Q;  4DV4 L;  1NBW A;  2Q8T A;  2F3I A;  2MGS A;  2OQK A;  3S17 B;  3BDL A;  1OO9 B;  4MIU A;  2QA4 A;  2JA9 A;  4WOR A;  3CC2 A;  1SSO A;  4B3R Q;  3KLW A;  2ZTD A;  1XNQ Q;  2B29 A;  1TII D;  1HTL D;  4JOI C;  4JI3 Q;  3C3L A;  1XTC D;  5CV7 A;  4X62 L;  4C1N K;  2F0P A;  1T5X D;  2F4V L;  1ZYR D;  3KLS X;  5EKK A;  4DR2 L;  4N9T A;  1RTN A;  5KEE A;  5E3F A;  2K04 A;  3GP7 A;  1HHV A;  2YU9 H;  1JJC B;  1Y8O B;  1CK1 A;  1NTG A;  3T53 B;  1VQ6 A;  4UPA A;  1Y1W B;  2QW7 A;  4H0L C;  2AMC B;  5DAU A;  4NXM Q;  1PFN A;  3MEH A;  1A63 A;  1N36 L;  1LTI D;  3E9I A;  2VW9 A;  5C44 H;  1C9O A;  4CJ0 B;  4IFD J;  3PUW A;  2JA5 H;  1VQM A;  2OTL A;  4M8A A;  4DXF A;  1TWC B;  4BY1 H;  5KND A;  3VYR A;  1UUP A;  1A2T A;  1ICW A;  1PTO F;  4PMB A;  5M3M G;  2SNS A;  2X69 A;  3VDY A;  1TY0 A;  4QL5 A;  4JI7 L;  2A1A A;  5T1I A;  4DV4 Q;  3PIP A;  1N33 Q;  3S1M B;  4IUT A;  2K14 A;  3SXH A;  2Q2H A;  1NUC A;  4A3K H;  4A3J B;  4ZRZ A;  4IPC A;  2HD3 A;  4A75 A;  4A93 H;  1PH4 A;  3AFQ A;  3WWV A;  3K58 A;  1IL8 A;  2XSC A;  4RCN A;  2N55 A;  1SMX A;  2CQO A;  4DFA A;  4EQO A;  2R6G A;  4KHP L;  1LO5 D;  3I90 A;  2F4V Q;  4DAY A;  1D2B A;  1HFN A;  2QIL A;  4DR2 Q;  1GUT A;  5LHY 1;  1E3P A;  1VQB A;  1EQT A;  4PZ8 A;  1YI2 A;  4L5T A;  4XQJ A;  3O13 A;  2E2J B;  2JK8 A;  3RR5 A;  5M5X B;  3FKI B;  1VQ7 A;  1GOZ A;  3M4O H;  5GAG C;  1JCK B;  1HJP A;  1UNS A;  4OON A;  3HFZ B;  1TT2 A;  4X64 Q;  1E1T A;  4U68 A;  5JEA H;  3K8A A;  5LL6 S;  1N36 Q;  1YJN A;  4RGO S;  4UP7 A;  4FF1 A;  2HIV A;  2Z6B A;  1QVF A;  4XDX A;  1TQO A;  5C44 G;  4RKB A;  4LFA L;  1Z9F A;  5CBA E;  4JI7 Q;  2NVQ H;  2JA5 G;  5JAV A;  1MI2 A;  4BY1 G;  2A6E D;  1BBX C;  3JAM i;  3TN2 A;  3K57 A;  4JI2 L;  2LKV A;  2WP8 J;  3F2U A;  1X3P A;  5COR A;  4A3K G;  3TRZ A;  1IZ6 A;  2NVX H;  3TP7 A;  4K5W A;  4DK3 C;  2NN6 I;  4A93 G;  4P75 A;  3GV3 A;  4KHP Q;  1A3T A;  2B2Y C;  3U58 A;  4G7O C;  2KQ3 A;  4FXK C;  2RHS B;  2PCF B;  2KEC A;  1LYL A;  2BCO A;  3TS2 A;  1H9M A;  4KN4 C;  3CU7 A;  1UAP A;  1N34 L;  4IFD G;  2PPB C;  1MGS A;  4PMC A;  4LMQ D;  1EFW A;  1NSN S;  3F2D A;  5M5Y B;  1KAB A;  4RG1 A;  1MD2 D;  2I5L X;  1CSP A;  2NTT A;  3NP8 A;  4YWM A;  1DYQ A;  1KIX A;  5JEA G;  2B2W C;  1SND A;  2PMZ B;  4R4O A;  2CFM A;  1PFM A;  1BO0 A;  1UE5 A;  4LFA Q;  1TWA H;  2F0G A;  3MXU A;  2VXW A;  4LUO A;  2LFN A;  2HT1 A;  2OXP A;  4BBR B;  1A3U A;  4JI2 Q;  2L5T A;  1KXL A;  5CYU A;  2R3Z A;  1LT4 D;  4YCV A;  3BDC A;  4K6D A;  3EFX D;  1JWM D;  5EKI A;  4UY8 C;  2TSS A;  1NNX A;  5IYC H;  3CCS A;  2YYZ A;  3SK5 A;  4WJ3 M;  2O4X A;  1XMQ Q;  5ELF A;  2QF7 A;  3TZU A;  4KY5 A;  1D5Z C;  3A7A B;  4DK0 A;  4MTN A;  3ZYY X;  3H6M A;  3TEH B;  3TQY A;  2L4N A;  1W2B A;  3L3O C;  3J81 c;  2NZH A;  3KDF A;  1BDO A;  4DK6 C;  1B8A A;  4LK1 C;  2K5N A;  4XYQ A;  2E75 C;  3KF8 A;  1N34 Q;  1N9W A;  3OIP A;  3I91 A;  5EPK A;  1KNE A;  1RCV D;  2V1C C;  1IBM Q;  3PO2 H;  2JP1 A;  4A76 A;  1EIY B;  1PH3 A;  3GTM H;  2PW7 A;  1PMR A;  3KBX A;  2F0I A;  4GNX B;  3H0G H;  3M3Y B;  2SNM A;  1GUW A;  1JWU D;  1AW7 A;  4CDC C;  4HMI A;  2XN9 C;  1BUV T;  4RCO A;  2F0O A;  1Q82 C;  3I4O A;  2K5H A;  3VYS A;  2BH2 A;  1K83 H;  4RWS C;  4IN3 A;  2EY6 A;  2XRQ D;  2VL6 A;  4AYB B;  2JXM B;  5C4X G;  3Q6S A;  1EIG A;  5ELN A;  5D3I B;  1SNP A;  1I6H H;  5EBD A;  3L7Z C;  5K5P A;  4LJZ C;  5LMN L;  2CCZ A;  3CPW A;  4KHZ A;  3MEF A;  3LWE A;  2RDG A;  3E0E A;  5IYC G;  4G7H C;  2ZM6 L;  2DUD A;  4U67 3;  4EQN A;  4AQY L;  2XNA C;  2F0M A;  5C5L A;  1SE2 A;  4ME3 A;  4HJ7 A;  4C2M B;  4HIO A;  3K6O A;  4C3J H;  5C3W A;  4F88 A;  1LV9 A;  4CDF C;  3ER0 A;  2E2H H;  3CRL C;  1B9N A;  1KLG D;  4XTC S;  1I4X A;  4RAU C;  4L63 B;  1RJT A;  1HQM C;  1B3Q A;  4OIJ A;  2F0L A;  3GQB A;  1J5E L;  1K28 A;  3ITP A;  3H0G G;  1EIF A;  4XQQ A;  2SDF A;  4GLX A;  3CRK C;  4BY7 B;  1CM9 A;  2EY1 A;  4NXN Q;  4JOI A;  3NUC A;  1II3 A;  3Q24 A;  3X3N A;  3F8T A;  3PIP 3;  1SE4 A;  1HA6 A;  1DXM A;  5LMN W;  4Y7N H;  3D4D A;  2XGT A;  4JC0 A;  1PLF A;  5LMN Q;  3A8K E;  2D0O A;  1TWH H;  5ELO A;  2SOB A;  4KTA A;  2IX1 A;  1H9S A;  2KED A;  4DK1 A;  3DEP A;  4B3M L;  3A54 A;  4BBS H;  2ZM6 Q;  1KD1 C;  1JB7 A;  1BVS A;  1O7L A;  1TS5 A;  2NVY H;  3S14 B;  2EYH A;  4AQY Q;  2FHT A;  3KDF B;  1J8I A;  1OXX K;  4MZ9 A;  2R93 B;  5JJZ A;  2LXJ A;  1EEF D;  4A3F H;  2AQ3 B;  1FGU A;  3BG3 A;  4H44 C;  1L2F A;  1YHB A;  2E2D C;  5L37 A;  3TS0 A;  2JYO A;  1PH9 A;  1W6K A;  4ZUJ A;  3DLL A;  1IXR A;  4C3J G;  3A8I E;  5IOD A;  4R8N A;  1FR3 A;  3HOU H;  4DNI A;  2NN6 H;  4LFB L;  3D6C A;  1J5E Q;  1JB3 A;  4X6A H;  3MTS A;  1I3Q B;  1HZC A;  2Z6K C;  4X3U A;  1EYC A;  4KHV A;  1V1P A;  1X3G A;  2AUK A;  3UDX A;  3HOY B;  5CV6 A;  4NP5 A;  2XRS D;  3CKI B;  2RCF A;  1WTR A;  2CVR A;  3KF6 A;  1DOK A;  5EQ0 A;  4S3S A;  4HAE A;  5IGD A;  2XVS A;  3H3V I;  1B44 D;  5EKL A;  4NB3 A;  2JE6 I;  4B3M Q;  1A6X A;  3KK7 A;  4A3M B;  2ICE C;  3J81 E;  2WAQ B;  3K7A B;  1TS3 A;  4BBS G;  1Y69 U;  4LF8 L;  3GTJ H;  3FDT A;  4CBV A;  1AZP A;  1AEX A;  1TWF B;  1XJV A;  3NE5 B;  4ZUI A;  4RHR A;  3S15 B;  1XMO L;  3DHQ A;  1PRT B;  4A3F G;  1WTP A;  1JT8 A;  1DJR D;  5CV9 A;  3VA5 A;  2IPK D;  3PMF A;  4GN3 B;  2K1B A;  4JBM A;  3I72 A;  3SHL A;  2EDG A;  1U4L A;  3TBI B;  4DPG A;  3EBE A;  2FMM A;  4ULL A;  1PV4 A;  4LFB Q;  3HOU G;  4R9W A;  1FL0 A;  2PNH A;  1YEZ A;  1AP0 A;  2NN6 G;  3IKJ A;  5IYD H;  1E0B A;  1KAW A;  2EY5 A;  4POF A;  1FGB D;  1YVC A;  1SR3 A;  1PHJ A;  4KY6 A;  2IWH A;  4DV5 L;  5CV5 A;  5C0X I;  1EWH A;  2FFK B;  2ZTC A;  4DUZ L;  1K3R A;  2UUA L;  2EIF A;  1XX8 A;  2R92 H;  1Y1V H;  1TKW B;  1H9S B;  4R8I A;  2H4O A;  1K8A C;  2JA8 H;  2M00 A;  3UDI A;  2BE5 D;  1DM0 B;  2PQA B;  3V05 A;  2EJM A;  2EVB A;  5CC4 A;  1L1O B;  3BZK A;  4C1N I;  4LF8 Q;  3S9W A;  1WVL A;  1HNZ L;  4JI4 L;  2B2W A;  1M90 C;  4C3I H;  3HOZ H;  5JVG 3;  2IX3 A;  2R7Z H;  1XMO Q;  3OMC A;  3MAQ A;  4FDB A;  4PZ7 A;  2Z1C A;  4ZKC B;  2KHS A;  4A3B H;  1EOT A;  1VQK A;  1PVO A;  3S16 H;  3U9S A;  2OT2 A;  4ZK9 B;  3BYT B;  4IPD A;  1Y8N B;  5C3E H;  4JPB W;  5H1S E;  4K8I A;  2E2I B;  3MVV A;  3FPU B;  1S4Z A;  3K80 C;  4IUU A;  4RFB A;  5D3D A;  2AHO B;  1JQY D;  3QOJ A;  3S1N B;  1I94 L;  3S2H B;  4AIM A;  1TU2 B;  3NBH A;  1W6J A;  4APV A;  5IIF A;  4N8X 1;  1M8A A;  1EFI D;  1QE6 A;  1X3F A;  4DV5 Q;  2ES2 A;  4XT3 B;  3PGZ A;  5IYD G;  3S17 H;  1A3V A;  3D4R A;  3VR3 A;  2UUA Q;  3I4M H;  2F3V A;  4XQN A;  3C46 A;  1I50 H;  4K14 A;  1ILP A;  4ABN A;  2OCE A;  2KBN A;  3QWN A;  3L9A X;  4P73 A;  1VF5 C;  3CF5 A;  2F0D A;  4O1N A;  2R92 G;  1Y1V G;  1MBY A;  2E5L L;  2YV5 A;  5KIX A;  2B2V C;  4F7X A;  1Q1B A;  4A4I A;  4LW1 A;  2JA8 G;  2OF1 A;  2VY3 A;  2IW3 A;  3HOV H;  2BDO A;  1WCM B;  4NKL A;  2PZW A;  1IBL L;  4JI4 Q;  4FXD A;  2JSO A;  4NDX A;  5COY A;  2JEA I;  1OTC A;  2K5V A;  2Q2T A;  1VMP A;  4KI0 A;  3Q0A A;  4RGT A;  1SFO B;  2JA6 H;  3GTK H;  4QCL A;  1JOQ A;  4C3I G;  1STG A;  5FO7 B;  1R9T H;  3HOZ G;  1SYF A;  1ASZ A;  5HGQ A;  1CA5 A;  4QB4 A;  3P20 A;  1YZ6 A;  2P5Z X;  3VR5 A;  3OWE B;  1PYW D;  2I0Q A;  2B2T C;  3D6W A;  1X32 A;  2ZXR A;  1I94 Q;  2JA7 B;  2RKS A;  3A0J A;  4DR5 L;  5C3E G;  3A7L A;  3HKZ G;  5J3B A;  5IYB H;  3CCE A;  5I9P A;  4GOP C;  4HN7 A;  1B3A A;  5IT9 c;  3CCV A;  2LS0 1;  3GTG B;  2KUM A;  2VQE L;  1MKH A;  1UWV A;  2X6G A;  4MNO A;  1PYB A;  4GLA C;  4A3I H;  4CDD C;  3OTO L;  3VA7 A;  2YTV A;  1HNX L;  1EY4 A;  4CKE A;  5K36 H;  3W1G A;  1WI5 A;  1F9S A;  4HR7 B;  4JI6 L;  4ZQ3 A;  1JJ2 A;  1BXT A;  2QDB A;  1VQL A;  1HPC A;  3I4M G;  2N78 A;  3DUZ A;  2K50 A;  3RLN A;  2E5L Q;  1U4R A;  1HNW L;  1A62 A;  1YNJ D;  3NBI A;  4UP9 A;  4ZYS A;  4A3G H;  3FHW A;  5I2Y A;  2QCP X;  1IBL Q;  2ZJQ A;  4IO9 A;  3HOV G;  1LTS D;  2A6H D;  1ROD A;  4DAM A;  1WJJ A;  1WTO A;  1CA6 A;  1WYD A;  3NQI A;  2NYZ D;  1AFP A;  1VDZ A;  1ASY A;  3LNN A;  1ZEQ X;  2QDL A;  1XPU A;  4IZ8 A;  3LGJ A;  5IT9 L;  4B3S L;  2WV6 D;  4RGM A;  1PTO B;  2C5C A;  4LUV A;  4X3K A;  2JA6 G;  3EN2 A;  3MXN A;  1S5D D;  1Q86 C;  1AN8 A;  3T1H L;  1JE5 A;  4OWT B;  3CCR A;  1ONL A;  1FNU A;  2VQE Q;  1GUG A;  1TWG B;  5IYB G;  1B4O A;  1PZI D;  3K5O A;  1Q81 C;  2WFW A;  1HNX Q;  1KLU D;  5ELB A;  5JEA J;  4G4K A;  1RTO A;  2J0T D;  3GTP B;  4A3I G;  2KCC A;  3GTO H;  4JI6 Q;  3GTL H;  5K36 G;  1WD0 A;  1B7Y B;  1VF7 A;  1DD2 A;  5C4J H;  1S72 A;  2RBM A;  2A68 C;  1YBY A;  3D0F A;  1HNW Q;  4MN3 A;  2EJF C;  3ERQ A;  2UXC L;  1BKB A;  1VQF A;  2ZXP A;  5C6A A;  5M3M B;  1PDQ A;  1BOS A;  4X62 Q;  3I4L A;  1CTM A;  3I70 A;  4A3G G;  1SRO A;  3MA2 B;  1BCP B;  2EPB A;  2F0N A;  4KLK A;  4ODG A;  3I56 A;  1KAA A;  4CJ2 C;  1PH1 A;  4HJ5 A;  1Y14 B;  1QVC A;  3MXG A;  4IOA A;  4Q0F A;  2Z6K A;  4B3S Q;  1DCZ A;  3BS1 A;  5M3F H;  3BZD B;  5JJI A;  3MC0 B;  3R2T A;  3H15 A;  3PQI A;  4J15 A;  3SK8 A;  4QIW E;  3T1H Q;  1U4P A;  3P7J A;  3IL8 A;  3SGI A;  2D5D A;  2XWJ B;  1SNC A;  4R4C A;  4FF3 A;  4KD3 A;  1I4R A;  1EQV A;  1K8M A;  4ZLT F;  2F0T A;  2DGY A;  3OOC A;  1QWY A;  1U4M A;  2K7V A;  2L55 A;  2I5M X;  2GVA A;  2MFI A;  3TP8 A;  4J8Q A;  1EY6 A;  2YU9 B;  2JQO A;  2L9H A;  4IUP A;  1SMY D;  4M1U B;  4DU9 A;  1O7Y A;  5JJL A;  1B1Z A;  2AUJ D;  2D62 A;  1SYG A;  4KD4 A;  3CP0 A;  3OMG A;  1B9M A;  2F0H A;  4OGQ C;  5C44 B;  2EYM A;  1V1O A;  3ONA B;  1CKN A;  1CQF A;  3C1F A;  2JJQ A;  2JA5 B;  3GTQ H;  1G2S A;  4BY1 B;  4Y52 H;  4O42 A;  5A35 A;  1LAC A;  2WIN B;  3FEW X;  1EEI D;  2J4X A;  2IJ0 A;  4HID A;  1LTB D;  2CHB D;  3CC7 A;  1X56 A;  4GKK L;  4A3K B;  4YWK A;  3ICE A;  2K5D A;  3P1H A;  5ELD A;  4A93 B;  1N32 L;  3ULJ A;  4Z9C B;  1PRT D;  3CPF A;  3K7U C;  5IT9 E;  5M3F G;  4RMF A;  4FXG C;  4IPH A;  1XWE A;  5DNF A;  2MHV A;  5IE8 A;  4KV6 A;  2LSS A;  1YHA A;  4AH6 A;  1MJE A;  1GHK A;  1QB5 D;  4LF4 L;  4HCE A;  1PFB A;  1VQC A;  2FXQ A;  1GKH A;  2CWP A;  2RHQ B;  1V1Q A;  4DR6 L;  2YTY A;  3M4O B;  5FOB B;  1EIH A;  1IYV A;  3CCU A;  1HZA A;  1JR0 D;  2GN5 A;  1Q1E A;  3E0J A;  3J80 i;  3KUP A;  2F52 A;  4G7Z C;  1EL0 A;  1BR9 A;  1SYD A;  1X65 A;  3I4N H;  1HZ9 A;  4V0B A;  2RDF A;  3NEN A;  4DAY B;  4EGV A;  1RIP A;  1HFG A;  2BA0 A;  2NVQ B;  1X9N A;  2VB3 X;  1GJX A;  1HRJ A;  2OEO A;  1O80 A;  1OXT A;  4GKK Q;  4XIG S;  2VUM H;  4OXP A;  1WTW A;  4L5R C;  4H7B A;  4JI1 L;  4X3T A;  5I6Y A;  1WD1 A;  1S5E D;  1PFS A;  4GKJ L;  3VYU A;  2L0C A;  1N32 Q;  1TY2 A;  4HSV A;  3DWA A;  1F9Q A;  1EZ6 A;  1YNN C;  5BN5 A;  2NVX B;  5IY0 A;  3CMA A;  3ERS X;  3M7G A;  2F0V A;  4DV3 L;  1G91 A;  2SEB D;  1ESF A;  1B50 A;  3V2T A;  4GS3 A;  3I7F A;  1MHW C;  3T51 B;  3H91 A;  5JPM C;  1HA5 A;  1EQQ A;  3RN2 A;  3DEO A;  4LF4 Q;  2DY7 A;  2X6L A;  1VQJ A;  1DON A;  2Z4H A;  2B2V A;  2EQS A;  4LF7 L;  4DR6 Q;  4J6H A;  4TRD A;  4X66 L;  1GHJ A;  1YJ9 A;  2EZV A;  3A55 A;  1VQE A;  3J81 j;  1E22 A;  4HSP A;  1CKN B;  1LT3 D;  1VQH A;  2G5D A;  2A74 C;  1CHP D;  1I5F A;  3S14 H;  4ZKB B;  1ENC A;  1SE8 A;  3FP9 A;  1IYJ B;  4H02 A;  2ZTE A;  3ND9 A;  3STB D;  4DR1 L;  1TWA B;  4OWX B;  4YY3 L;  3EJI A;  1HR0 L;  1GM5 A;  1F9R A;  3I4N G;  4N9P A;  5M5W H;  2B2T A;  2GVB A;  2PW5 A;  4A3D H;  5C4X B;  3PIO A;  4WFN 3;  1V9P A;  4GOP A;  4KK7 A;  2KCT A;  1D6E C;  4GKJ Q;  1SRU A;  4WJW A;  3BVM A;  4FYD A;  2VUM G;  3A56 A;  3P75 A;  1F9P A;  2WB1 E;  3H3V C;  3PUY A;  1EWC A;  3SDZ A;  3KYH C;  3RZD H;  3E5S A;  4DV3 Q;  3OW7 A;  1GD7 A;  2AQ1 B;  3PO2 G;  4A3L H;  2IL8 A;  3U4V A;  3HOW H;  2R7F A;  5NUC A;  4QY7 A;  2BE5 C;  1K9M C;  1NR2 A;  1D1I A;  4LF7 Q;  3HOY H;  1QNK A;  4X66 Q;  4HJ8 A;  3PSI A;  3Q23 A;  3QR8 A;  1GUS A;  2HUG A;  1C8C A;  4X3S A;  3FPP A;  2EXD A;  3GTM B;  1XNR L;  1U5K A;  1TS2 A;  3H0G B;  1HR0 W;  2N3S A;  5FLX L;  2ALY B;  3OW2 A;  3HKZ E;  2LMC B;  4DAV A;  1MJC A;  3A8J E;  4DR1 Q;  1I4P A;  4YY3 Q;  1HR0 Q;  3E9H A;  2TMP A;  2Y0S G;  4GN5 A;  2CW0 C;  5C3X A;  3SE0 A;  1K83 B;  3SR1 A;  3ZJY C;  3KF8 B;  5IP7 H;  1HUM A;  3S15 H;  4DV7 L;  5EPJ A;  1JC7 A;  1F2L A;  4A3D G;  2B2U A;  4ALP A;  1G29 1;  3L2P A;  1QNU A;  5AFW A;  2HQE A;  1I6H B;  1D5X C;  3AFP A;  5CV8 A;  4KJO A;  1YIJ A;  1PTO D;  1PXU A;  3D3R A;  1XTD A;  3JAM c;  4L8J A;  2V4D A;  4YCW A;  1P8L A;  4A3L G;  3M4P A;  4K2K A;  1YJW A;  3PUZ A;  3HOW G;  1AE2 A;  1L0Y B;  2HHH L;  1DOM A;  1IBK L;  1NJI C;  4C3J B;  3L0O A;  5LMU L;  4K2L A;  3NHH A;  3R3O A;  2KVM A;  4JK1 C;  2B63 H;  3PO3 H;  2E2H B;  3U50 C;  5JPN C;  1XNR Q;  2KA7 A;  4F87 A;  5EPL A;  2Z9H A;  3NTI A;  3K0Y A;  3FVQ A;  4GZY C;  5FO8 B;  1L0X B;  1EYD A;  3BU2 A;  2IHF A;  3W3A A;  4L5Q A;  4DV7 Q;  2K28 A;  5DM6 3;  1BCP D;  1IHZ A;  3AMU A;  1VQ8 A;  3JAM L;  4ZAI A;  5IP7 G;  1KNA A;  2AWN A;  4GNX C;  4Y7N B;  3HP3 A;  3R93 A;  3T1Y L;  1TWH B;  5E1F A;  1XPR A;  4BBS B;  1KTK A;  2MJ8 A;  1SNO A;  3BJU A;  3MZ5 A;  2ZJP A;  3V96 A;  1T9H A;  2NVY B;  4A3E H;  1O7Z A;  2VB2 X;  1HUN A;  4CGY B;  3HG9 A;  1VQ5 A;  3S1Q H;  1H95 A;  2NVT H;  4N8F A;  1S3O A;  1B53 A;  4A3F B;  1QCB D;  3G6J B;  1ILQ A;  2HHH Q;  2IHE A;  1IBK Q;  2PZT A;  5LMU Q;  5JOB A;  3PUV A;  2XTI A;  4DNT B;  1VQP A;  5JVH 3;  4LFC L;  5AJ3 L;  1UE6 A;  1ZYR C;  1W3S A;  3I8Z A;  4JG2 A;  2F0F A;  1IW7 D;  2A6H C;  3HOU B;  2B63 G;  2FMC A;  1ZKO A;  3PO3 G;  3DWQ A;  4MHE A;  1PRT F;  1V8Q A;  4JI8 L;  3CXC A;  2PO4 A;  4H13 C;  4PZ6 A;  1ET6 A;  4IFD I;  5FLX E;  2IT1 A;  2K5Q A;  4C3H H;  4R4T A;  3RZO H;  3HOX H;  4LNQ A;  1RKN A;  4FP5 D;  4DUY L;  1WTV A;  3T16 A;  1S5F D;  1WTX A;  3CCL A;  4IJL A;  4P71 A;  1VQO A;  4B9W A;  1RF2 D;  3TSS A;  4K6L A;  3J80 L;  2R61 A;  3S1R H;  4EQP A;  1ESR A;  2K4K A;  2MUY A;  3K5M A;  1V43 A;  2K03 A;  1BF4 A;  2HCI A;  1WOC A;  2LY7 A;  4OL7 A;  4RGN A;  1OXU A;  4A3C H;  2RDH A;  2VS1 A;  1U9R A;  4OIK A;  1FYC A;  4BXX H;  1ZXT A;  5HY6 A;  3GTJ B;  4A3E G;  1LM0 A;  1F2M A;  3K5L A;  3U4Z A;  1V1P B;  3CQZ H;  2I5H A;  1EY8 A;  4JVZ A;  2HQL A;  4GN4 B;  5G3L D;  4BS9 A;  4DUZ Q;  3KF6 B;  1EU3 A;  4IOC A;  1NCV A;  4LFC Q;  1A8V A;  3G4S A;  5AJ3 Q;  4GLV B;  1S5C D;  2WB1 G;  2F0J A;  2R7D A;  1BBU A;  3S24 A;  5ELE A;  1PH5 A;  4NW2 A;  2BH8 A;  1EZ8 A;  2N88 A;  1D1K A;  1FD7 D;  1MSG A;  5FO9 B;  1VCI A;  4EX5 A;  3RD4 A;  4XXE A;  1Q8I A;  2VNU D;  4QGU A;  4C3H G;  1HNZ Q;  1O7I A;  3M4Y A;  2H1E A;  1JOR A;  3HOX G;  4DR3 L;  5EBC A;  1H9K A;  5IOC A;  2R92 B;  1R4P B;  1Y1V B;  3OYY A;  4LAA A;  3OPO A;  1Y1W H;  1SNQ A;  4PMW A;  3JAM E;  1TXY A;  2R7Z G;  2JA8 B;  2E76 C;  3NTH A;  4K8J A;  2IX0 A;  2NUC A;  2ZT9 C;  4LF9 L;  2QKI C;  4A3B G;  1HH2 P;  3Q8D A;  2A6E C;  3K81 C;  4JI3 L;  3URY A;  3GD7 A;  5I2X A;  4OO1 I;  4CJ1 B;  2A19 A;  4LWC A;  3D8G A;  4FNF A;  4KKT A;  3KJO A;  2PZU A;  1I4G A;  1TWC H;  4JI0 L;  1ML0 D;  4A3C G;  2F4I A;  4C3I B;  3CHB D;  3HOZ B;  4BXX G;  2MO0 A;  4K5V A;  3Q22 A;  2KCN A;  3CD6 A;  3S1M H;  2CH4 W;  5KNC A;  4HCS A;  1E24 A;  4POG A;  4KMU C;  1NMF A;  5C4H A;  3NEM A;  3UI2 A;  4A3J H;  1CKM A;  1EYG A;  1PH2 A;  3S16 B;  3B6Y A;  3J81 i;  4LF5 L;  5C3E B;  3HKZ B;  1STH A;  5I4D A;  4LUZ A;  3RLO A;  1CKO A;  1SJE D;  4O0A A;  4V19 0;  1VS0 A;  5IGE A;  2A5H A;  3QIA A;  4IQZ A;  2MO1 A;  3M4Q A;  4FF4 A;  5FLM H;  1F2Y A;  1C0A A;  1KHI A;  2Q2I A;  1YHQ A;  1PRT C;  2XIW A;  3CCQ A;  4NPS A;  1LTR D;  3NXW A;  4G57 A;  1N33 L;  1QVG A;  2E2J H;  5GAH C;  2QEJ C;  4IUR A;  5M5X H;  1A15 A;  3FKI H;  4DR3 Q;  3I4M B;  1Q7Y C;  4FO2 A;  3KOJ A;  1I50 B;  2MPM A;  2UUB L;  4X65 L;  1LTT D;  4AYB E;  4I7A A;  1JE4 A;  3MWY W;  1DGS A;  4LF9 Q;  3OIQ A;  3J80 E;  4IUV A;  1Y1W G;  3NBH B;  2EY2 A;  1UE1 A;  4DR5 Q;  3H3V H;  2DY8 A;  3HOV B;  1WFQ A;  5I6W A;  4JI0 Q;  4CDE C;  5F2D A;  1SE3 A;  1SYB A;  2B2U C;  3BYY B;  3MFY A;  2L1B A;  2LXK A;  5C0X J;  2ASB A;  1WTQ A;  4QQB X;  2VQF L;  4DF7 A;  3OTO Q;  2JA6 B;  3GTK B;  4X64 L;  5I9O A;  2K5W A;  5GQO A;  1R9T B;  3KLR A;  4LF5 Q;  2EE1 A;  5E4W C;  4RA8 A;  1FNW A;  1Z47 A;  4A3J G;  2RA4 A;  1L1O C;  2KEN A;  5IP9 H;  2AWO A;  2K01 A;  2DJF C;  3NTK A;  1SN8 A;  1BQQ T;  1IKM A;  5FJ8 H;  3OSO A;  1S40 A;  2KHI A;  1GUO A;  5FLM G;  3G7L A;  4A3I B;  2A69 D;  2WKC A;  5BR8 L;  4QUC A;  2OWO A;  3SK4 A;  4DNR B;  1STB A;  2KOL A;  2N49 A;  2G9D A;  2K33 A;  4IUN A;  4X65 Q;  4O2D A;  2K75 A;  2UUB Q;  5C0X H;  5EJW A;  4YWL A;  3FKI G;  4PV1 C;  1M4V A;  5M5Y H;  2EYP A;  3WOF A;  3KLS A;  5GAD C;  1MSH A;  1EY7 A;  4A3G B;  3NK9 A;  3HS0 C;  2UXD L;  1X3Q A;  2Y0S E;  3EIV A;  3ULL A;  4IFD H;  1XPO A;  1SDF A;  4OX9 L;  1GVP A;  2VQF Q;  2FJ2 A;  1KQS A;  1I4Q A;  1J6Q A;  1HQR D;  2D9U A;  3NSW A;  3RLF A;  4LF6 L;  3W2D A;  4BBR H;  5KYI A;  2L12 A;  4P74 A;  3R8B A;  3STB C;  3TZD A;  2ID0 A;  4XYO A;  4R4Q A;  2ZXO A;  4P72 A;  2XWB B;  1YIT A;  4HED A;  3SK6 A;  5D14 A;  2F0Q A;  1BCP F;  1XXG A;  1TR5 A;  4E6I A;  3TRE A;  2G9H D;  4JCV E;  3E6Z X;  4R1J A;  4KJN A;  4QF4 A;  2UXC Q;  1HXY D;  5IP9 G;  3VYT A;  2KJX A;  4GNX A;  2C35 B;  1K3B C;  4DV6 L;  1T5E A;  1Q3L A;  1VMC A;  4DR7 L;  4TSS A;  3EVQ A;  2D2C C;  2Q8R E;  3G48 A;  5TSS A;  1RDP D;  1HCZ A;  5ELC A;  5FJ8 G;  5BR8 Q;  1HZB A;  3FRP B;  2WAC A;  1E2W A;  2EYO A;  4OWW B;  1QUQ A;  4K0K L;  4HJ9 A;  2BA1 A;  3M85 A;  1N8R C;  3GTO B;  5BN3 A;  3CME A;  3GTL B;  3A74 A;  1FJG L;  3C2P A;  1STE A;  4IJH A;  5C4J B;  5E7N A;  4WJ4 A;  3MXN B;  1XMQ L;  4ILW A;  3K0X A;  2F1M A;  5C0X G;  3J7A V;  1I4H A;  1E1O A;  4F8M A;  4TKO B;  3F2C A;  5KNB A;  3AU7 A;  4DKA C;  3M3Y H;  4B08 A;  2WAQ E;  2UXD Q;  3E3X A;  1SAP A;  3EA6 A;  3C1E A;  5J22 A;  4FVM A;  1RL2 A;  1LLR D;  2H5X A;  1ENF A;  4OX9 Q;  1KDA A;  3GDE A;  3DM3 A;  1D8L A;  1E7Z A;  4LF6 Q;  2B39 A;  2DNE A;  5LL6 X;  1X3E A;  1IL2 A;  1K8O A;  2O5I C;  4TVA B;  1A2U A;  5J1Z A;  5M3F B;  1IBM L;  4BBR G;  2CH4 A;  4KKS A;  3EQL C;  2L11 A;  2GA4 B;  3WOE A;  5IWA L;  2PNR C;  3NPP A;  2RVL A;  1O78 A;  2UXB L;  4KKU A;  5EGT A;  1I6V C;  4KY7 A;  3UDG A;  4DV6 Q;  4DR7 Q;  3PCO B;  3UDF A;  1VQ4 A;  1K73 C;  4OO1 H;  2EYL A;  2MQH A;  4B9X A;  3HZX A;  4C56 C;  3AB9 A;  5C4X H;  1OXS C;  1ICF B;  5JJK A;  2HDM A;  1SYC A;  1PTO C;  1EWI A;  1G51 A;  4K0K Q;  1LTA D;  4C2M H;  3I3C A;  3AYH B;  1STN A;  3ERO A;  4PQX A;  3DM1 A;  3VR2 A;  1FJG Q;  1VQD A;  3D4W A;  1VQ9 A;  1C48 A;  5G3L F;  1KL9 A;  1JOK A;  3KJP A;  1CQV A;  5KRU A;  5GAE C;  3GTQ B;  1BBW A;  3DMU A;  4IPG A;  1LT6 D;  2E74 C;  1VQN A;  2A68 D;  4BY7 H;  3RN5 A;  3VR4 A;  1Q90 A;  1PA6 A;  2DNC A;  4YIJ A;  3TP5 A;  4L5S A;  1D7Q A;  2WKD A;  4NMZ A;  3BVZ A;  5D65 A;  5IWA Q;  1TS4 A;  4AYB G;  4UDU C;  2UXB Q;  1UEA B;  5KGU A;  5CR3 A;  2I46 A;  3H09 A;  1F2Z A;  5CV4 A;  1BCP C;  1MIU A;  4PNY A;  1H9R A;  1FNV A;  3ULP A;  2C9O A;  5E4X A;  1TVX A;  5FK9 C;  4RHS A;  1M1K C;  1NE3 A;  3AEV A;  3QG1 A;  4NXN L;  2R93 H;  4OO1 G;  1QUQ B;  3N52 A;  5C4Z A;  4DV1 L;  1PH8 A;  2HDL A;  1FVI A;  3NWT A;  2K32 A;  4JI1 Q;  5FLX c;  3LWU A;  1Q46 A;  3J81 L;  1VQA A;  1CUK A;  4DAP A;  2UUC L;  3PUX A;  3H94 A;  5HUR A;  5EAY A;  5BN4 A;  1Y8P B;  3RNU A;  1UE7 A;  3CAM A;  3I4N B;  2OTJ A;  2EYJ A;  1G2T A;  5CBE E;  4BA1 I;  1I3Q H;  4P2C B;  2F3W A;  1P16 A;  1IW7 C;  1C4Q A;  4CHT B;  2B3G A;  4CKC A;  2VUM B;  4ID6 A;  3PF5 A;  2Z0S A;  3DXJ C;  2L15 A;  3SVM A;  3A5Z B;  3RMH A;  1SBB B;  4BY7 G;  4HJA A;  3TDQ A;  3KBG A;  5A2Q L;  1J9O A;  5GRO A;  3NQT A; 
#chains in the Genus database with same CATH homology
 2WII B;  3DWP A;  3PO2 B;  2E8G A;  2PI2 E;  1AZQ A;  5T1G A;  3NWS A;  1X54 A;  3G6E A;  4A3M H;  3RUZ A;  2K6A A;  3A5U A;  3K7A H;  1A0I A;  2ZJR A;  4DR4 L;  5KYL A;  5IGC A;  1VQG A;  4PG3 A;  3F1Z A;  2UU9 L;  2NB0 A;  2ATW A;  4JI5 L;  1TWF H;  1QZH A;  2BDN A;  1KRT A;  4DV1 Q;  1U0L A;  3PF4 A;  4CKB A;  4UP8 A;  4XT1 B;  2R93 G;  2NTS A;  2EJG C;  4OHJ A;  1KC8 C;  1G8Z D;  2QEX A;  1GUN A;  3CCM A;  4QIW B;  3MFG A;  1QIL A;  2UUC Q;  3QJY A;  2NBF A;  4DGZ A;  1Z6H A;  1E2V A;  3CC4 A;  2MNA A;  2Y0S B;  2PQA A;  2RQX A;  3FMC A;  3S2D B;  4DN4 M;  1ENA A;  4JBK A;  2ENB A;  4YCU A;  1L1O A;  5M5W B;  1YNX A;  1HTP A;  4A3D B;  1NMG A;  1Q8K A;  2HIX A;  4DA2 A;  4QUF A;  3R2I A;  2AKW B;  2O2L D;  3AQQ A;  4HTH A;  4KN7 C;  3HKS A;  1IKL A;  2RSN A;  1SEB D;  4DV0 L;  3HOY G;  3IFD A;  3RZD B;  1EYA A;  5IGB A;  4HIM A;  3SEB A;  1STA A;  1DZ1 A;  2F0S A;  3UE1 A;  1SYE A;  4DR4 Q;  2Q2U A;  1JOO A;  4A3M G;  3HOW B;  1YNN D;  2WAQ G;  3CW2 C;  3LX0 A;  2UU9 Q;  4HIK A;  5DLQ E;  4JI5 Q;  3N6R A;  1GO3 E;  3W1B A;  3F2B A;  2OQ0 A;  1Z7T A;  4GOP B;  4FF2 A;  4R4I A;  1BNZ A;  2B8F A;  1CHQ D;  3WDN A;  2PYK A;  4J1M A;  4DV2 L;  2B8G A;  2E2I H;  1PZK D;  2YTX A;  3S1N H;  3S2H H;  2RF4 A;  1SJH D;  1DOL A;  4JBJ A;  1PZJ D;  2JEB I;  1L0W A;  3QO2 A;  3OHX C;  3PV0 A;  4HMJ A;  3J80 c;  4BWG B;  3BDO A;  4RKL A;  2A8V A;  4WRD A;  1YNJ C;  2FIN B;  1QZG A;  3IAY A;  1EQR A;  3HRZ C;  4DV0 Q;  1JIC A;  5CMD A;  2Q8I B;  2PI2 A;  1CZW A;  1RHP A;  1CZG A;  5A2Q E;  1G6P A;  3VR6 A;  2EOT A;  1KDC A;  3J7A F;  3GV6 A;  2HCC A;  4EVO A;  4UAI A;  2RCN A;  4DXG A;  4RH6 A;  1PYS B;  1KDB A;  1WCM H;  2KHJ A;  1ET9 A;  2J7Z A;  2N8N A;  3QB3 A;  4JYA L;  2B2Y A;  1NR4 A;  3J7Z C;  2F03 A;  1CSQ A;  2NZ1 D;  3OWF A;  3ND8 A;  1SFO H;  1XYI A;  1GXD C;  1JWS D;  1CFM A;  2I07 B;  5IGG A;  4DV2 Q;  2B63 B;  3T56 B;  3PO3 B;  2AQ2 B;  3NEL A;  1KRS A;  3T1Y Q;  1CI3 M;  1EUJ A;  1UEB A;  3T13 A;  3MHB A;  1EOV A;  2JA7 H;  1R4Q B;  1LT5 D;  1G6Z A;  1PH6 A;  3IFT A;  2CQA A;  2VZA A;  2KEE A;  2O5J C;  3GTG H;  5C5M A;  1LTG D;  3BVG A;  1X6O A;  5FKA C;  1STY A;  3TME A;  2MP1 A;  2NWG A;  3QOL A;  1EU4 A;  1LTL A;  2ICI A;  3M7N A;  3HEJ A;  4YHH L;  1LUZ A;  1B70 B;  2F0U A;  2CW0 D;  4I65 A;  3I55 A;  4TQU S;  5HGT A;  1NAP A;  2A69 C;  1LAB A;  2M2L A;  1PH7 A;  1K0R A;  4JV5 L;  1EY0 A;  3CCJ A;  4A3E B;  5J39 A;  4JI8 Q;  1B2T A;  4BA2 I;  3S1Q B;  3D31 A;  1SLJ A;  2PMZ E;  1K8G A;  3W5O A;  2NVT B;  4JYA Q;  3J7Y W;  5DEH A;  1QOH A;  1WCM G;  4DUY Q;  4IAL A;  4B3T L;  4EQ5 A;  1H9J A;  1C7Y A;  2WB1 B;  5ISR A;  5DM7 3;  3JC6 6;  3X3M A;  3UE0 A;  2F0W A;  3PIO 3;  2K52 A;  1CT1 D;  2F0E A;  1PTO H;  1JMC A;  2PQE A;  4Q5V A;  2Z8L A;  2IY5 B;  4B3R L;  1Q12 A;  2QGQ A;  1XNQ L;  3TP6 A;  3MXP A;  1QJO A;  2BOS A;  4I7Z C;  2CKZ B;  4QMG A;  3K5N A;  4C3H B;  3HGB A;  3I2Z A;  1SMY C;  2JA7 G;  3RZO B;  3HOX B;  4QJF A;  1TWG H;  1QG7 A;  1EY5 A;  2DN8 A;  2CWA A;  4IUQ A;  4K5X A;  1EY9 A;  3BZC A;  4JBW A;  4YHH Q;  3G71 A;  2EXZ A;  2R7Z B;  2Z4I A;  2K05 A;  3J7A 5;  2M9V A;  2RSO A;  3GTP H;  5M9O A;  4L6T B;  3T4A C;  4A3B B;  2A73 B;  3S1R B;  3M9B A;  2KCM A;  4NXM L;  2EYF A;  1IYU A;  1F77 A;  2NZO A;  4JV5 Q;  1RD9 D;  1SXT A;  3K59 A;  3KFU A;  1S5B D;  1OXV A;  1AH9 A;  3U9O A;  5M3M H;  2D0P A;  2F0K A;  1NY4 A;  5IGF A;  1D5M C;  3IRB A;  5CGK A;  1AE3 A;  3I73 A;  1E2Z A;  1JJG A;  3GO5 A;  1SNM A;  1X55 A;  1VQI A;  4ME5 A;  3CQZ B;  4B3T Q;  4DV4 L;  1NBW A;  2Q8T A;  2F3I A;  2MGS A;  2OQK A;  3S17 B;  3BDL A;  1OO9 B;  4MIU A;  2QA4 A;  2JA9 A;  3CC2 A;  4WOR A;  1SSO A;  4B3R Q;  3KLW A;  2ZTD A;  1XNQ Q;  2B29 A;  4JI3 Q;  1HTL D;  4JOI C;  1TII D;  3C3L A;  1XTC D;  5CV7 A;  4X62 L;  4C1N K;  2F0P A;  2F4V L;  1T5X D;  1ZYR D;  3KLS X;  5EKK A;  4DR2 L;  4N9T A;  1RTN A;  5KEE A;  5E3F A;  2K04 A;  3GP7 A;  1HHV A;  2YU9 H;  1JJC B;  1Y8O B;  1CK1 A;  1NTG A;  1VQ6 A;  3T53 B;  4UPA A;  1Y1W B;  4H0L C;  2AMC B;  5DAU A;  4NXM Q;  1PFN A;  3MEH A;  1A63 A;  1N36 L;  1LTI D;  3E9I A;  2VW9 A;  5C44 H;  1C9O A;  4CJ0 B;  4IFD J;  3PUW A;  2JA5 H;  1VQM A;  2OTL A;  4M8A A;  4DXF A;  1TWC B;  4BY1 H;  5KND A;  3VYR A;  1UUP A;  1A2T A;  5M3M G;  4JI7 L;  3VDY A;  1ICW A;  1PTO F;  2SNS A;  2X69 A;  4QL5 A;  1TY0 A;  4PMB A;  2A1A A;  5T1I A;  4DV4 Q;  3PIP A;  1N33 Q;  3S1M B;  4IUT A;  2K14 A;  3SXH A;  2Q2H A;  4A3K H;  1NUC A;  4A3J B;  4ZRZ A;  4IPC A;  4A75 A;  4A93 H;  1PH4 A;  3AFQ A;  3WWV A;  3K58 A;  1IL8 A;  2XSC A;  4RCN A;  2N55 A;  1SMX A;  2CQO A;  4DFA A;  4EQO A;  2R6G A;  4KHP L;  1LO5 D;  3I90 A;  2F4V Q;  4DAY A;  1D2B A;  1HFN A;  2QIL A;  4DR2 Q;  1GUT A;  5LHY 1;  1E3P A;  1VQB A;  4PZ8 A;  1YI2 A;  1EQT A;  4L5T A;  4XQJ A;  3O13 A;  2E2J B;  2JK8 A;  3RR5 A;  5M5X B;  3FKI B;  1VQ7 A;  1GOZ A;  3M4O H;  5GAG C;  1JCK B;  1HJP A;  4OON A;  4X64 Q;  3HFZ B;  1TT2 A;  1UNS A;  1E1T A;  4U68 A;  5JEA H;  3K8A A;  5LL6 S;  1N36 Q;  1YJN A;  4RGO S;  4UP7 A;  4FF1 A;  2HIV A;  1QVF A;  4XDX A;  1TQO A;  5C44 G;  4RKB A;  4LFA L;  2NVQ H;  1Z9F A;  4JI7 Q;  5CBA E;  2JA5 G;  5JAV A;  1MI2 A;  4BY1 G;  2A6E D;  1BBX C;  3JAM i;  4JI2 L;  3TN2 A;  3K57 A;  2LKV A;  2WP8 J;  4A3K G;  1X3P A;  3F2U A;  5COR A;  3TRZ A;  1IZ6 A;  2NVX H;  3TP7 A;  4DK3 C;  4A93 G;  2NN6 I;  4K5W A;  4P75 A;  3GV3 A;  4KHP Q;  1A3T A;  2B2Y C;  3U58 A;  4G7O C;  2KQ3 A;  4FXK C;  2RHS B;  2PCF B;  2KEC A;  1LYL A;  2BCO A;  3TS2 A;  1H9M A;  4KN4 C;  3CU7 A;  1UAP A;  1N34 L;  4IFD G;  2PPB C;  1MGS A;  4PMC A;  4LMQ D;  1EFW A;  1NSN S;  3F2D A;  5M5Y B;  1KAB A;  4RG1 A;  1MD2 D;  2I5L X;  1CSP A;  2NTT A;  3NP8 A;  4YWM A;  1DYQ A;  1KIX A;  5JEA G;  2B2W C;  1SND A;  2PMZ B;  4R4O A;  2CFM A;  1PFM A;  1BO0 A;  1UE5 A;  4LFA Q;  1TWA H;  2F0G A;  3MXU A;  2VXW A;  4LUO A;  2LFN A;  2HT1 A;  2OXP A;  4BBR B;  1A3U A;  4JI2 Q;  1KXL A;  2L5T A;  5CYU A;  2R3Z A;  1LT4 D;  4YCV A;  3BDC A;  4K6D A;  3EFX D;  1JWM D;  5EKI A;  4UY8 C;  2TSS A;  5IYC H;  3CCS A;  2YYZ A;  3SK5 A;  4WJ3 M;  1XMQ Q;  2O4X A;  5ELF A;  2QF7 A;  3TZU A;  4KY5 A;  1D5Z C;  3A7A B;  4DK0 A;  4MTN A;  3ZYY X;  3H6M A;  3TEH B;  3TQY A;  2L4N A;  1W2B A;  3L3O C;  3J81 c;  2NZH A;  3KDF A;  1BDO A;  4DK6 C;  1B8A A;  4LK1 C;  2K5N A;  4XYQ A;  2E75 C;  3KF8 A;  1N34 Q;  1N9W A;  3OIP A;  3I91 A;  5EPK A;  1KNE A;  1RCV D;  2V1C C;  1IBM Q;  3PO2 H;  2JP1 A;  4A76 A;  1EIY B;  1PH3 A;  3GTM H;  2PW7 A;  1PMR A;  3KBX A;  2F0I A;  4GNX B;  3H0G H;  3M3Y B;  2SNM A;  1GUW A;  1JWU D;  1AW7 A;  4HMI A;  2XN9 C;  1BUV T;  4RCO A;  2F0O A;  1Q82 C;  3I4O A;  2K5H A;  3VYS A;  2BH2 A;  1K83 H;  4RWS C;  4IN3 A;  2EY6 A;  2XRQ D;  2VL6 A;  4AYB B;  2JXM B;  5C4X G;  3Q6S A;  1EIG A;  5ELN A;  5D3I B;  1SNP A;  1I6H H;  5EBD A;  3L7Z C;  5LMN L;  4LJZ C;  5K5P A;  2CCZ A;  3CPW A;  4KHZ A;  3MEF A;  3LWE A;  2RDG A;  3E0E A;  5IYC G;  4G7H C;  2ZM6 L;  2DUD A;  4U67 3;  4EQN A;  4AQY L;  2XNA C;  2F0M A;  5C5L A;  1SE2 A;  4ME3 A;  4HJ7 A;  4C2M B;  4HIO A;  3K6O A;  4C3J H;  5C3W A;  4F88 A;  1LV9 A;  3ER0 A;  2E2H H;  3CRL C;  4XTC S;  1B9N A;  1KLG D;  1I4X A;  4RAU C;  4L63 B;  1RJT A;  1HQM C;  4OIJ A;  2F0L A;  3GQB A;  1J5E L;  3ITP A;  3H0G G;  1EIF A;  4XQQ A;  2SDF A;  4GLX A;  3CRK C;  4BY7 B;  1CM9 A;  2EY1 A;  4NXN Q;  4JOI A;  3NUC A;  1II3 A;  3Q24 A;  3X3N A;  3F8T A;  3PIP 3;  1SE4 A;  1HA6 A;  1DXM A;  5LMN W;  4Y7N H;  3D4D A;  2XGT A;  4JC0 A;  1PLF A;  5LMN Q;  3A8K E;  2D0O A;  1TWH H;  5ELO A;  2SOB A;  4KTA A;  2IX1 A;  1H9S A;  4BBS H;  4B3M L;  2KED A;  3DEP A;  3A54 A;  4DK1 A;  2ZM6 Q;  1KD1 C;  1JB7 A;  1BVS A;  1O7L A;  2NVY H;  1TS5 A;  3S14 B;  2EYH A;  4AQY Q;  2FHT A;  3KDF B;  1J8I A;  1OXX K;  4MZ9 A;  2R93 B;  5JJZ A;  2LXJ A;  1EEF D;  4A3F H;  2AQ3 B;  1FGU A;  3BG3 A;  4H44 C;  1L2F A;  1YHB A;  2E2D C;  3TS0 A;  2JYO A;  1PH9 A;  1W6K A;  4ZUJ A;  3DLL A;  1IXR A;  4C3J G;  3A8I E;  5IOD A;  4R8N A;  1FR3 A;  3HOU H;  4DNI A;  2NN6 H;  4LFB L;  3D6C A;  1J5E Q;  1JB3 A;  4X6A H;  3MTS A;  1I3Q B;  1HZC A;  2Z6K C;  4X3U A;  1EYC A;  4KHV A;  1V1P A;  1X3G A;  3UDX A;  2AUK A;  3HOY B;  5CV6 A;  4NP5 A;  2XRS D;  3CKI B;  1WTR A;  2CVR A;  3KF6 A;  1DOK A;  5EQ0 A;  4S3S A;  4HAE A;  5IGD A;  2XVS A;  3H3V I;  4B3M Q;  1B44 D;  4NB3 A;  2JE6 I;  5EKL A;  1A6X A;  3KK7 A;  4A3M B;  2ICE C;  3J81 E;  2WAQ B;  3K7A B;  1TS3 A;  4BBS G;  1Y69 U;  4LF8 L;  3GTJ H;  3FDT A;  4CBV A;  1AZP A;  1AEX A;  1TWF B;  1XJV A;  3NE5 B;  4ZUI A;  4RHR A;  3S15 B;  1XMO L;  3DHQ A;  1PRT B;  4A3F G;  1WTP A;  1JT8 A;  1DJR D;  5CV9 A;  3VA5 A;  2IPK D;  3PMF A;  4GN3 B;  2K1B A;  4JBM A;  3I72 A;  3SHL A;  2EDG A;  1U4L A;  4DPG A;  3TBI B;  3EBE A;  2FMM A;  4ULL A;  1PV4 A;  4LFB Q;  3HOU G;  4R9W A;  1FL0 A;  2PNH A;  1YEZ A;  1AP0 A;  2NN6 G;  3IKJ A;  5IYD H;  1E0B A;  1KAW A;  4POF A;  2EY5 A;  1PHJ A;  1YVC A;  1SR3 A;  1FGB D;  4KY6 A;  2IWH A;  4DV5 L;  5CV5 A;  5C0X I;  1EWH A;  2ZTC A;  2FFK B;  4DUZ L;  1K3R A;  2UUA L;  2EIF A;  2R92 H;  1XX8 A;  1Y1V H;  1TKW B;  1H9S B;  4R8I A;  2H4O A;  1K8A C;  2JA8 H;  2M00 A;  3UDI A;  2BE5 D;  1DM0 B;  2PQA B;  3V05 A;  2EJM A;  2EVB A;  5CC4 A;  1L1O B;  3BZK A;  4C1N I;  4LF8 Q;  3S9W A;  1WVL A;  1HNZ L;  4JI4 L;  2B2W A;  1M90 C;  4C3I H;  3HOZ H;  5JVG 3;  2IX3 A;  2R7Z H;  1XMO Q;  3OMC A;  3MAQ A;  4FDB A;  4PZ7 A;  4A3B H;  2Z1C A;  2KHS A;  4ZKC B;  1VQK A;  1EOT A;  1PVO A;  3S16 H;  3U9S A;  2OT2 A;  4ZK9 B;  3BYT B;  4IPD A;  1Y8N B;  5C3E H;  5H1S E;  4K8I A;  2E2I B;  3MVV A;  3FPU B;  1S4Z A;  3K80 C;  4IUU A;  4RFB A;  5D3D A;  2AHO B;  1JQY D;  3QOJ A;  3S1N B;  1I94 L;  3S2H B;  4AIM A;  1TU2 B;  3NBH A;  1W6J A;  4APV A;  5IIF A;  1M8A A;  1EFI D;  1QE6 A;  1X3F A;  4DV5 Q;  2ES2 A;  4XT3 B;  3PGZ A;  5IYD G;  3S17 H;  1A3V A;  3D4R A;  3VR3 A;  2UUA Q;  3I4M H;  2F3V A;  4XQN A;  3C46 A;  1I50 H;  4K14 A;  1ILP A;  4ABN A;  2OCE A;  2KBN A;  4P73 A;  3L9A X;  3QWN A;  1VF5 C;  3CF5 A;  2F0D A;  4O1N A;  2R92 G;  1Y1V G;  1MBY A;  2E5L L;  2YV5 A;  5KIX A;  2B2V C;  4F7X A;  1Q1B A;  4A4I A;  4LW1 A;  2JA8 G;  2OF1 A;  2VY3 A;  2IW3 A;  3HOV H;  2BDO A;  1WCM B;  4NKL A;  2PZW A;  1IBL L;  4JI4 Q;  4FXD A;  2JSO A;  4NDX A;  5COY A;  2JEA I;  1OTC A;  2K5V A;  2Q2T A;  1VMP A;  4KI0 A;  3Q0A A;  2JA6 H;  3GTK H;  4RGT A;  1SFO B;  4QCL A;  1JOQ A;  4C3I G;  1STG A;  1R9T H;  5FO7 B;  3HOZ G;  1ASZ A;  1SYF A;  5HGQ A;  1CA5 A;  4QB4 A;  3P20 A;  1YZ6 A;  3VR5 A;  3OWE B;  1PYW D;  2I0Q A;  2B2T C;  3D6W A;  1X32 A;  1I94 Q;  2ZXR A;  2JA7 B;  2RKS A;  3A0J A;  4DR5 L;  5C3E G;  3A7L A;  3HKZ G;  5J3B A;  5IYB H;  3CCE A;  5I9P A;  4GOP C;  4HN7 A;  1B3A A;  5IT9 c;  3CCV A;  2LS0 1;  3GTG B;  2VQE L;  2KUM A;  1MKH A;  1UWV A;  2X6G A;  4MNO A;  1PYB A;  4GLA C;  4A3I H;  3OTO L;  3VA7 A;  2YTV A;  1HNX L;  1EY4 A;  4CKE A;  5K36 H;  3W1G A;  1WI5 A;  1F9S A;  4HR7 B;  4JI6 L;  4ZQ3 A;  1JJ2 A;  3I4M G;  1BXT A;  1VQL A;  1HPC A;  2QDB A;  2N78 A;  3DUZ A;  2K50 A;  3RLN A;  2E5L Q;  1U4R A;  1HNW L;  1A62 A;  1YNJ D;  3NBI A;  4UP9 A;  4ZYS A;  4A3G H;  3FHW A;  5I2Y A;  2QCP X;  1IBL Q;  2ZJQ A;  4IO9 A;  3HOV G;  1LTS D;  2A6H D;  1ROD A;  4DAM A;  1WJJ A;  1WTO A;  1CA6 A;  1WYD A;  3NQI A;  2NYZ D;  1AFP A;  1VDZ A;  1ASY A;  3LNN A;  1ZEQ X;  1XPU A;  4IZ8 A;  3LGJ A;  4B3S L;  5IT9 L;  2WV6 D;  4RGM A;  1PTO B;  2C5C A;  4LUV A;  4X3K A;  2JA6 G;  3EN2 A;  3MXN A;  1S5D D;  1Q86 C;  1AN8 A;  3T1H L;  1JE5 A;  4OWT B;  3CCR A;  1ONL A;  1FNU A;  2VQE Q;  1GUG A;  1TWG B;  5IYB G;  1B4O A;  1PZI D;  1Q81 C;  3K5O A;  2WFW A;  1HNX Q;  1KLU D;  5ELB A;  5JEA J;  4G4K A;  1RTO A;  2J0T D;  3GTP B;  4A3I G;  2KCC A;  3GTO H;  4JI6 Q;  3GTL H;  5K36 G;  1WD0 A;  1B7Y B;  1VF7 A;  1DD2 A;  5C4J H;  1S72 A;  2RBM A;  3D0F A;  1YBY A;  2A68 C;  1HNW Q;  4MN3 A;  2EJF C;  2UXC L;  3ERQ A;  1BKB A;  1VQF A;  2ZXP A;  5C6A A;  5M3M B;  1PDQ A;  1BOS A;  4X62 Q;  3I4L A;  1CTM A;  4A3G G;  3I70 A;  1SRO A;  3MA2 B;  1BCP B;  2EPB A;  2F0N A;  4KLK A;  4ODG A;  3I56 A;  1KAA A;  4CJ2 C;  1PH1 A;  4HJ5 A;  1Y14 B;  1QVC A;  4IOA A;  3MXG A;  4B3S Q;  2Z6K A;  4Q0F A;  1DCZ A;  3BS1 A;  5M3F H;  3BZD B;  5JJI A;  3MC0 B;  3R2T A;  3H15 A;  4J15 A;  3SK8 A;  4QIW E;  3T1H Q;  1U4P A;  3P7J A;  3IL8 A;  3SGI A;  2D5D A;  2XWJ B;  1SNC A;  4R4C A;  4FF3 A;  4KD3 A;  1I4R A;  1EQV A;  1K8M A;  4ZLT F;  2F0T A;  2DGY A;  3OOC A;  1QWY A;  1U4M A;  2K7V A;  2L55 A;  2I5M X;  2GVA A;  2MFI A;  3TP8 A;  4J8Q A;  1EY6 A;  2YU9 B;  2JQO A;  2L9H A;  4IUP A;  1SMY D;  4M1U B;  4DU9 A;  1O7Y A;  5JJL A;  1B1Z A;  2D62 A;  2AUJ D;  1SYG A;  4KD4 A;  3CP0 A;  3OMG A;  1B9M A;  2F0H A;  4OGQ C;  5C44 B;  2EYM A;  1V1O A;  3ONA B;  1CKN A;  1CQF A;  3C1F A;  2JJQ A;  2JA5 B;  3GTQ H;  1G2S A;  4Y52 H;  4BY1 B;  4O42 A;  5A35 A;  1LAC A;  2WIN B;  3FEW X;  1EEI D;  2J4X A;  2IJ0 A;  4HID A;  1LTB D;  2CHB D;  3CC7 A;  1X56 A;  4GKK L;  4A3K B;  4YWK A;  3ICE A;  2K5D A;  3P1H A;  5ELD A;  1N32 L;  4A93 B;  3ULJ A;  4Z9C B;  1PRT D;  3CPF A;  3K7U C;  5IT9 E;  5M3F G;  4RMF A;  4FXG C;  4IPH A;  1XWE A;  5DNF A;  2MHV A;  5IE8 A;  4K