3A5UA

Promiscuity and specificity in dna binding to ssb: insights from the structure of the mycobacterium smegmatis ssb-ssdna complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
119
structure length
118
Chain Sequence
MAGDTTITVVGNLTADPELRFTPSGAAVANFTVASTPRMFDRQSGEWKDGEALFLRCNIWREAAENVAESLTRGSRVIVTGRLKQRSFTREGEKRTVVEVEVDEIGPSLRYATAKVNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Single-stranded DNA-binding protein
publication title Promiscuity and specificity in DNA binding to SSB: Insights from the structure of the Mycobacterium smegmatis SSB-ssDNA complex.
rcsb
source organism Mycobacterium smegmatis
molecule tags Dna binding protein
total genus 18
structure length 118
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3a5uA00
1Q1BA 1SRUA 3RLOA 4UP8A 1AE2A 4X65Q 2ZTEA 4X64L 5FLXc 1YITA 4IFDG 2R93G 3H0GH 1BBWA 1YJWA 1YZ6A 3K8AA 3H15A 2JA8G 1L1OC 2DGYA 3FKIG 1OXTA 1XNRL 3I4NG 1JT8A 3RZOH 1HNWQ 1TWFH 1X6OA 2K14A 4UP7A 1E1OA 5HY6A 3RLFA 4GOPC 4AQYQ 4X6AH 4A3GH 4AIMA 1JJ2A 1SMXA 3OW2A 3CCLA 4BY7H 1CKOA 2NZOA 3CP0A 2QA4A 2UU9Q 3CXCA 3KFUA 3JAMi 1VQHA 1VQ8A 4DK3C 4YY3L 5DLQE 3S14H 4APVA 4X64Q 4HJ5A 1QVGA 1HZCA 1IYJB 1K83H 4XTCS 1NMFA 1WFQA 2K4KA 1K3RA 1VCIA 4FDBA 1PH7A 4L5RC 4DR7Q 5JJKA 1XNRQ 2IHFA 4QL5A 2VL6A 1UWVA 1SROA 4JBJA 2A8VA 2UUCL 3HOUH 4BXXG 1EIFA 1X55A 5M3FG 4HIMA 4JI5L 2NZHA 3GTLH 3S1MH 5IYDH 4OONA 1N32Q 4BBRH 3S1QH 2OCEA 2LXKA 4JBMA 5M5XH 1YVCA 4BA1I 1WI5A 4X62L 4QIWE 1SR3A 1D7QA 2ZJPA 4KHZA 2MFIA 1DGSA 1UEBA 4DNIA 4YY3Q 1VQLA 2UUAQ 1G6PA 4HJAA 4DV2L 4GS3A 3G71A 3F2BA 3CW2C 4GKKL 3GTKH 3PUVA 1YI2A 2AMCB 4QQBX 4JI6Q 3STBD 2VUMH 5IYBG 4JV5L 2CCZA 3I4NH 2GN5A 1X56A 1YJNA 3S2HH 1KAWA 4JI5Q 3HOZH 1U5KA 4EQ5A 2ZJRA 1HZBA 2OQKA 2HIXA 3OTOQ 3K7AH 3A74A 2V1CC 3AQQA 5LMNL 1M1KC 3G48A 5LMNW 5IE8A 3BZCA 4P73A 1VQNA 1PH4A 3S1RH 1W3SA 1XJVA 1K8GA 4QJFA 4QGUA 3S1NH 4JI3L 2VY3A 4HIOA 1E7ZA 3HOVG 2N8NA 4DV3L 2N49A 4JV5Q 3W1GA 2NN6I 1VQ9A 4YCVA 4DV4L 1OXXK 1U0LA 1LM0A 2R7FA 4P74A 3F2DA 4NB3A 4BXXH 5M3MG 4POFA 5LMUL 2LXJA 3L2PA 5M3FH 3ULJA 4A3BH 1L2FA 2D62A 1V9PA 3FP9A 1HNXL 3IRBA 5LMNQ 1SFOH 3UE1A 1KQSA 1TWHH 4JI0L 3CCMA 1LTLA 4X66L 3U4VA 1EYGA 1HR0L 1HR0W 4JI3Q 3I55A 4DR5L 3S2DH 4DR4L 3JC66 2B63H 2XGTA 4YHHQ 4DV3Q 4JG2A 3HOYG 2KHJA 5GADC 4B3RQ 4A93G 1CKMA 1C0AA 4DV4Q 3RLNA 4IO9A 5JJIA 5IYBH 2JJQA 2Z6KA 1B70B 2E2IH 2JA6G 3J7A5 4JYAQ 1K8AC 4JBWA 3M4QA 1AE3A 2B3GA 3CCJA 2ATWA 2EIFA 3NENA 2WP8J 5C0XG 1PFSA 1HNZL 1VQ6A 2ID0A 3PUYA 1RIPA 1HNXQ 2ASBA 3AFQA 5EAYA 3HOYH 2K50A 4JI0Q 5JJLA 1Q86C 4X65L 2K5HA 3Q8DA 4L5QA 4OWXB 1HR0Q 3PO3G 2HIVA 4R4OA 3TEHB 4OWTB 4BY1G 3CCRA 1VQAA 3CCVA 1QZHA 4DR4Q 3CC7A 3BU2A 1KC8C 2NVYH 1PYSB 2JA7G 2VS1A 2VQFL 3CD6A 5IT9c 1X3FA 1NTGA 2KENA 1IXRA 2I5HA 2Z6KC 4AQYL 4IOCA 3GTMH 4BBSG 3TREA 3J81c 5JEAG 4BA2I 2Z0SA 1Y14B 2A1AA 3CAMA 1PHJA 1N33L 3RNUA 1MIUA 1EFWA 1YNXA 2BA1A 5HGQA 5M5WH 1SE8A 2IY5B 1Q1EA 2D0OA 2RHQB 1OXUA 2E2HH 2Q2UA 5C4JH 1CUKA 1FL0A 2KHIA 1YIJA 1Y1VG 5C4XH 1VQ5A 4MNOA 2YTVA 4DUZQ 3F8TA 1X54A 3S15H 4HJ8A 2VQFQ 4DR7L 4LWCA 3BJUA 2R7ZG 2JA5H 3OYYA 2ES2A 2NVQH 3MEFA 1G51A 1VQGA 4PMWA 3CC4A 2JQOA 2PMZE 2F4VL 1Z47A 3ZJYC 1MJCA 2KBNA 3M3YH 1VQKA 4A3CG 2VQEL 1HZAA 1KRTA 1N33Q 5IP9G 2L15A 1N32L 5GAHC 4P71A 2PNHA 4A75A 1WCMH 4OWWB 3ICEA 2VW9A 1HZ9A 2N78A 4JI1L 4Y7NH 3CCSA 1ASZA 1OTCA 2UUAL 3S16H 3I4MH 1YHBA 5GROA 1IL2A 4YWLA 3PO3H 2BA0A 1E3PA 4O2DA 3STBC 3PIPA 4A93H 4JI6L 4BY1H 4NXMQ 3UE0A 3J81i 2ZJQA 4OO1G 3AEVA 1I50H 3PUZA 5IYCG 3BZKA 2CWAA 3UDXA 2WAQE 4GLXA 4A3EG 3J80c 1PH9A 5IP7H 4IPHA 2JA7H 4OXPA 2F4VQ 1VQCA 3GTJH 4GNXB 3H3VH 4BBSH 2VQEQ 4DV5Q 4LUVA 3OTOL 3TRZA 4YWMA 4DV0Q 1PH1A 1JE5A 1SN8A 2RHSB 3FHWA 1VQFA 2WB1E 1UE6A 4AYBG 4JI1Q 4GLVB 4A3JG 5AJ3L 4MTNA 1FGUA 3KYHC 3PF4A 1EUJA 1HJPA 1KIXA 4DR3L 4IPGA 2R93H 2AWOA 3U50C 4PZ6A 1N36Q 4LNQA 2JA8H 1VQ7A 3FKIH 3G4SA 1XMOL 3L0OA 4DR1Q 4WJ3M 1PYBA 4JI7L 1N8RC 4LF9L 3HFZB 4A3CH 1T9HA 4LUZA 5IP9H 4A3FG 1Q82C 3LGJA 4GKJQ 1KXLA 1VQBA 3J81j 4DR2Q 4DR6L 4XIGS 4L5SA 3ERSX 4LF5L 3CCUA 5AJ3Q 3G6EA 2EXDA 1EIYB 4GNXA 4DAYB 3KJPA 1C7YA 1I5FA 3PO2G 3J80i 4POGA 4DR3Q 1XMQQ 2ZTCA 4YHHL 1YJ9A 4B3RL 2B29A 3GTPH 3A0JA 1XMOQ 1EQQA 2R92G 5IYCH 4YWKA 4A3EH 4JYAL 2OWOA 1WJJA 4JI7Q 1J5EL 4LF9Q 2D0PA 4A4IA 2K5VA 1Q81C 2JA9A 4P72A 1Z9FA 3NELA 2EQSA 2Y0SG 4DR6Q 3HOWG 3EBEA 4LF5Q 1LYLA 1P8LA 3PUWA 2YU9H 4GNXC 4A3LG 1CKNB 1GD7A 4DK6C 4NXNL 3TS2A 1V1QA 4A3DG 3E0EA 3E9HA 1XPRA 4HJ9A 3HKZG 4A3IG 3I56A 4JCVE 1R9TH 1NY4A 2MNAA 2JEAI 4AH6A 2UXBL 1V43A 3CPWA 2VZAA 3PSIA 1IBKL 1QZGA 1J5EQ 1NJIC 1PVOA 1GKHA 3S24A 2RF4A 2ALYB 2E5LQ 2JE6I 1L1OB 1VS0A 1VQMA 1QUQB 4K0KL 1KRSA 5FLMG 1RL2A 3KOJA 4LFCL 2IX0A 1A62A 1W2BA 4C3JH 2OQ0A 4YCUA 4C3IH 2KCMA 1N9WA 1A0IA 4NXNQ 3KJOA 2BH2A 4DUZL 3PO2H 3U58A 2ZTDA 3T1HL 1IBLL 4LW1A 4LFBL 2WFWA 3PIOA 2UXBQ 3HOVH 4JI8L 2VNUD 4B3TL 1WYDA 1EOVA 1PV4A 1B8AA 3CPFA 5J3BA 4JI4L 1IBKQ 4BY7G 1CKNA 2R92H 4H02A 4A3MG 5M3MH 2MO0A 4R4IA 1Y1WG 4K0KQ 2I5MX 3SGIA 4GN5A 3W5OA 2E2JH 2K52A 4LFCQ 4QY7A 1A8VA 1Q8KA 1XTDA 3UDFA 3PF5A 1S72A 2NVTH 3HOWH 3GTGH 5BR8L 3JAMc 3CCQA 1L0WA 1YBYA 3F2CA 3CF5A 1UE7A 1X9NA 4LF4L 3ULLA 4A3LH 3KDFB 4DV7L 1PH2A 3T1HQ 1GVPA 1IBLQ 1QUQA 4NXML 3GD7A 5GAGC 2I0QA 4B3ML 2NN6G 3HOUG 4LFBQ 1G291 3CMAA 1VQOA 4JI8Q 4B3TQ 3HKSA 4DUYQ 4IPDA 1YHQA 1BKBA 5IYDG 1TWAH 4RG1A 1S40A 1PH8A 5ELNA 2Q2TA 4JI4Q 4PG3A 4IFDJ 1K0RA 2JA6H 2F52A 4DV5L 4L5TA 4JI2L 4KI0A 4DV0L 2ZM6Q 4UP9A 2CFMA 3L7ZC 3M7NA 1IBMQ 3PUXA 4LF6L 5FJ8G 5FLMH 5IWAQ 1Q46A 1WOCA 2IX1A 2FXQA 5BR8Q 4DV6L 4RMFA 3T1YL 1FJGL 1H95A 3WWVA 4JOIA 4LF4Q 3EN2A 2VUMG 4DV7Q 2R7DA 1O7IA 1N34Q 4ME3A 1PH6A 4B3MQ 1N36L 1E22A 3UDGA 3HOZG 2IHEA 2YV5A 1XPOA 2F3IA 2YTYA 4DR1L 3RN2A 1X65A 2OTJA 3M9BA 4JI2Q 3PGZA 1XNQQ 4OX9L 3KDFA 1UE5A 4A3MH 2AKWB 4A3KG 1ASYA 4GKJL 1Y1WH 2H5XA 2N3SA 2GVAA 4DR2L 4AYBE 4IPCA 3VDYA 1NBWA 1GM5A 4LF6Q 2I5LX 1S3OA 4P75A 5M5YH 2HHHL 4EX5A 3K7UC 1JJCB 3EIVA 4C3HH 4DV6Q 4JC0A 4LUOA 3T1YQ 1I94L 1TWGH 1BBUA 2PI2E 4J15A 4JOIC 1FJGQ 1Y1VH 3J7ZC 1XMQL 2MO1A 4LF8L 1GO3E 2WAQG 3ER0A 3K81C 1MJEA 2UUBL 4KHPL 4WJ4A 1XPUA 1JB7A 1BVSA 3CC2A 4HJ7A 4A3BG 1Q7YC 3ULPA 3M4PA 4NPSA 2AHOB 3GO5A 1VQJA 4OX9Q 1X3GA 1LUZA 5C0XI 3GTQH 1CSPA 2WB1G 3CQZH 1E1TA 2RCNA 3CMEA 5H1SE 1M90C 1OXVA 1JMCA 1MKHA 2GVBA 2HHHQ 2R7ZH 2C35B 1PA6A 2CQOA 2JK8A 4DV1L 3D31A 5FJ8H 3M85A 2Q2HA 1VQPA 3K80C 4GN4B 1I94Q 1PH5A 1AH9A 1IZ6A 2B63G 2K5NA 4C2MH 1D8LA 3AYHB 2NVXH 2UXCL 4LF8Q 4KHPQ 2UUBQ 5IY0A 2UUCQ 2CWPA 3H3VI 1Q12A 2LSSA 3TS0A 1JJGA 1TXYA 4B3SL 3DLLA 4JBKA 1NMGA 3M4OH 4DAMA 1I3QH 2E5LL 5E7NA 4X62Q 1VQDA 4A3KH 2K75A 2PQAB 2Y0SE 1YEZA 5C3EG 5C44G 2A19A 2CKZB 2MQHA 2QEXA 3A5ZB 4LFAL 5GAEC 4DV1Q 4DV2Q 3TQYA 1QVFA 5K36G 4IJHA 3KF6B 4A3JH 4GKKQ 4IFDI 1TWCH 3HOXG 1NE3A 3DM3A 4MZ9A 4A76A 1SLJA 3U4ZA 3W1BA 3UDIA 2HT1A 2UXCQ 3HKZE 4TVAB 2IT1A 1A63A 2OTLA 1VQIA 1B7YB 2YTXA 1EQRA 4UY8C 3I7FA 4B3SQ 1FVIA 2XTIA 3D0FA 4IOAA 3KF8B 1C9OA 4GN3B 4TQUS 2UXDL 4HIDA 4A3FH 3AFPA 1EWIA 4R4CA 4HIKA 4GOPB 1VQ4A 1OXSC 1E24A 4LF7L 3H0GG 3I2ZA 4LFAQ 5C4XG 3PV0A 3GTOH 3A5UA 1VQEA 5C0XJ 2JA5G 4DPGA 2BH8A 4OO1I 2PQAA 4DUYL 1K73C 4A3GG 4R4TA 2E8GA 3E9IA 3KF6A 4DKAC 5LMUQ 1PH3A 3RZDH 4PZ7A 4Y52H 4UPAA 1WCMG 2ZM6L 1CSQA 1UE1A 1KL9A 2UXDQ 4GLAC 2JEBI 3I4MG 3MXNB 1IBML 2YYZA 1QVCA 1KD1C 4LF7Q 5IWAL 1KHIA 3F1ZA 2QGQA 1J6QA 4YCWA 4X66Q 1X3EA 5C3EH 5C44H 5JEAJ 3RN5A 4PZ8A 3NBHB 4IJLA 5ELOA 4DR5Q 3K0XA 2PI2A 2Q2IA 5GQOA 4O0AA 1L1OA 3RR5A 3HOXH 3I4OA 4ALPA 1N34L 1I6HH 4A3DH 1YHAA 2R6GA 5IP7G 1P16A 3PCOB 2AWNA 3CCEA 1HNWL 4A3IH 2HQLA 3GDEA 4GOPA 2DUDA 3B6YA 4BBRG 4KLKA 3KLWA 1K9MC 4R4QA 1XNQL 1HNZQ 2UU9L 3S17H 4R1JA 2KCTA 1HH2P 3NEMA
chains in the Genus database with same CATH superfamily
1SRUA 1EYAA 4FF1A 4UP8A 1FYCA 5EBDA 1A2TA 2BOSA 5ELEA 5FLXc 4IFDG 3P7JA 3H0GH 1YJWA 3K8AA 5G3LF 2JA8G 3J80L 3FKIG 3MXNA 1HNWQ 2OF1A 1EY4A 4AQYQ 1CTMA 4A3GH 1JJ2A 4QUFA 4BY7H 2QA4A 2NZOA 1JC7A 4RH6A 1CT1D 4UDUC 1PRTB 5EGTA 1M4VA 4X64Q 1IYJB 3SEBA 2FFKB 1NMFA 1XTCD 4FDBA 5JJKA 2VL6A 1ET6A 1SROA 4JBJA 2A8VA 2UUCL 3HOUH 1FNWA 5M3FG 1D5ZC 4C3HB 2NZHA 5LL6X 3GTLH 1O80A 4OEMB 1E2ZA 1R4QB 2OCEA 2LXKA 1O7YA 4X62L 2ZJPA 1DGSA 1UEBA 3T4AC 3F2BA 4GKKL 3NHHA 4QQBX 4JI6Q 3STBD 1V1OA 2VUMH 3NPPA 2C9OA 2CCZA 1F2LA 2GN5A 1X56A 3S2HH 2R7ZB 2ZJRA 3R8BA 4F8MA 1C8CA 1HUNA 4C2MB 2NVXB 1MI2A 1WTOA 5LMNL 4C3IG 1VMCA 2PZTA 4HIOA 1SE4A 3HOVG 1JB3A 5K5PA 2NN6I 4CJ2C 4YCVA 4DV4L 4P74A 3KUPA 3F2DA 4NB3A 2NBFA 4POFA 1TWCB 2D62A 3A7AB 3FP9A 3E5SA 3HS0C 4C1NI 4JI0L 2PQEA 1HR0L 4JI3Q 5IT9L 4DR4L 2CH4A 5L37A 3JC66 2B63H 4YHHQ 1H9KA 1S5BD 2AQ1B 4QIWB 5IYBH 5CYUA 3TMEA 1TKWB 4JBWA 2XNAC 4QF4A 2EIFA 2OEOA 1HNZL 4IN3A 2D5DA 1JCKB 1A3TA 1SEBD 3K0YA 5D65A 3TEHB 3CCVA 3GQBA 2VS1A 5IT9c 1X3FA 1NTGA 5DNFA 5NUCA 4HCEA 5JEAG 2EYJA 2A1AA 3NP8A 4WFN3 2QDBA 1N33L 2Z9HA 3TSSA 1YNXA 5C6AA 5HGQA 4DAVA 3HOXB 1OXUA 3H94A 1JWMD 3R93A 4DGZA 2PPBC 1JORA 1SDFA 4UHVA 3F8TA 3BJUA 4H13C 3NTHA 2ES2A 1S5DD 4KKTA 2JA5H 3CC4A 2PMZE 2F4VL 3M3YH 4A3CG 1N32L 5IP9G 1EYCA 1D5XC 1WCMH 5C0XH 2R7ZG 3S16H 1HZ9A 1TWFB 4JI1L 2UUAL 2EE1A 2IL8A 5EKKA 3Q24A 4YWLA 3PO3H 1BCPD 2SNSA 4O2DA 3TZDA 3PIPA 2K05A 4N8X1 3UE0A 3VR3A 5A35A 3AEVA 1WTPA 1I50H 5IYCG 4A3EG 2CWAA 4GLXA 1PH9A 1MBYA 1V1PA 3ND8A 5CV6A 3H3VH 4BBSH 4DV5Q 1H9MA 3TRZA 1X3QA 4YWMA 4HR7B 1PH1A 1JE5A 4AYBG 1UE6A 2NWGA 3F2UA 1J8IA 3A8JE 4X3SA 4E6IA 5AJ3L 1XX8A 3PF4A 4I65A 1TU2B 4DR3L 5M5XB 3T56B 1QILA 4PZ6A 4LNQA 2JA8H 2WINB 3FKIH 3G4SA 1XMOL 2ENBA 3RD4A 3GTKB 1PYBA 4JI7L 4ID6A 3HFZB 1Q82C 1I4GA 1KXLA 4DR6L 1HTLD 2F0DA 4O1NA 1SYDA 2EXDA 1M8AA 3CRKC 1C7YA 2L0CA 3D4RA 4FXGC 1YJ9A 4KKSA 4OIKA 4OO1H 1E2WA 2F0NA 1Y8PB 4CKBA 3S1NB 3ND9A 2BCOA 4LF9Q 1BCPB 4ABNA 2D0PA 1BOSA 3G6JB 3NELA 2EQSA 2B2VC 4RA8A 1LYLA 2QF7A 1P8LA 4A3LG 2YU9H 1CKNB 4DK0A 3TN2A 3DMUA 2B39A 3E0EA 1PTOD 2UXBL 1TWHB 2WB1B 3J7AV 3OIPA 3PSIA 1QZGA 1WD0A 2B2WA 3TBIB 4K0KL 2JE6I 1QJOA 1QUQB 1HA5A 5FLMG 1CZGA 4LFCL 1W2BA 2DY8A 4C3IH 2WKDA 4M1UB 4NXNQ 1GUNA 2LKVA 3U58A 3PO2H 1EQVA 3OWEB 1WTVA 1SE3A 2B2YA 3HOVH 4JI8L 4B3TL 5J1ZA 1PV4A 2EDGA 5JOBA 3S9WA 4RHSA 5IGCA 4H02A 4A3MG 2I5MX 2NVYB 1AZPA 2A6EC 5CORA 1I6HB 4GN5A 3W5OA 2E2JH 1A8VA 1DOKA 4KK7A 3UDFA 3W2DA 1EWCA 2HCCA 3CCQA 1L0WA 1UE7A 4HN7A 1YNNC 1IBLQ 3GD7A 5GAGC 3CMAA 3HKSA 4DUYQ 1BKBA 5C4XB 3H0GB 4KY6A 4JI2L 4KI0A 2ZM6Q 3S15B 1PTOB 2CFMA 2V4DA 1IBMQ 2CW0D 1SXTA 3FDTA 5BR8Q 3CKIB 3T1YL 1H95A 1FJGL 4ME5A 3WWVA 1CZWA 4DV7Q 4Y7NB 3I4MB 1STHA 2PNRC 2F3IA 1CHQD 2NTTA 2YTYA 3SVMA 1XNQQ 4CKCA 4GKJL 2N3SA 2JA7B 4IPCA 2I5LX 3GTJB 2SNMA 4C3HH 1G2TA 4LUOA 4OIJA 4JOIC 1ICWA 1XMQL 3NQIA 3J81E 1RDPD 5JJZA 3C2PA 1BVSA 5KGUA 1TVXA 4KD4A 3T16A 4NPSA 4OX9Q 1X3GA 1CSPA 2WB1G 3SK5A 3S2HB 5H1SE 1OXVA 5FLXE 4DXFA 1MKHA 4DN4M 2HHHQ 2R7ZH 4P2CB 2CQOA 2JK8A 3M85A 3K80C 3IAYA 4L6TB 4C2MH 1PDQA 3AYHB 2UXCL 2NVXH 1PYWD 4FP5D 1SNOA 2CWPA 2LSSA 2CHBD 1TXYA 3BYTB 2F0MA 1RTNA 4DAMA 1TR5A 1I3QH 1I4PA 1RD9D 2RKSA 2KECA 3MVVA 2C5CA 1KABA 3GTPB 2HDMA 1YEZA 2A19A 5GAEC 2EY1A 5K36G 3KF6B 1TWCH 3X3MA 3U4ZA 4TRDA 3UDIA 1SJHD 3J80E 4TVAB 1JE4A 4JVZA 1GHKA 1PZID 3QO2A 2OTLA 1ILQA 1G8ZD 4B3SQ 4JPBW 4IOAA 4HIDA 1FD7D 1STYA 3OWFA 4HIKA 4GOPB 5C4XG 3H0GG 3I2ZA 3MTSA 4LFAQ 2L9HA 1EY7A 3PV0A 5EQ0A 3A5UA 3SDZA 2IWHA 1I4HA 5C0XJ 5CV5A 4DPGA 3MFYA 2PW7A 4A3GG 3E9IA 4PZ7A 4Y52H 2J4XA 1KL9A 2B2TC 4WRDA 2UXDQ 1ENCA 3I4MG 2NUCA 4R8IA 1KHIA 5KEEA 3TS2A 2R92B 5C3EH 3DEOA 1SAPA 3RN5A 3KLSX 4DR5Q 5ELOA 3K0XA 2EY6A 5GQOA 4O0AA 1L1OA 3HOXH 4DFAA 5IP7G 1HNWL 1QCBD 2Y0SB 3TP5A 4FXDA 5CBEE 4EQOA 4R4QA 4EGVA 1HH2P 3NEMA 3HKZB 3RLOA 4K5XA 2DNCA 5IIFA 2ZTEA 4X64L 1U4RA 1BBWA 4NKLA 1YZ6A 4HEDA 1SYFA 3OPOA 1ZXTA 1A3VA 1JT8A 1K8MA 4FF4A 1TWFH 3PO3B 3K6OA 2PO4A 3CP0A 3GP7A 1Z6HA 1VF7A 1Q8IA 3JAMi 5BN3A 3K5MA 1FNVA 3KLRA 2XIWA 1QVGA 1CA6A 4MIUA 4BBSB 1HZCA 1WTWA 1K83H 1DONA 1WFQA 2JYOA 2K4KA 1VCIA 2Q8IB 5IT9E 4L5RC 1A2UA 1XNRQ 4KJOA 1EY5A 1UWVA 1EIFA 3SR1A 4HIMA 2F0KA 2X6GA 4RWSC 3R3OA 4CDFC 3V96A 4OONA 4JBMA 5M5XH 3AMUA 4K5WA 1RCVD 4YY3Q 2MJ8A 1VQLA 1G6PA 4CDCC 4DV2L 5IGGA 3GTKH 1NNXA 2ZT9C 1YI2A 5D14A 1U4PA 1GJXA 5IYBG 4OELB 5EKLA 2K01A 5IGEA 1YJNA 1KAWA 4EQ5A 2OQKA 1RTOA 2F0UA 2HIXA 1SYEA 4U68A 1ZYRD 1D1KA 2XRQD 5I6WA 1S5FD 2KQ3A 3G48A 2JP1A 5LMNW 5IE8A 1W3SA 3D6WA 4QJFA 3S1NH 3BS1A 4JI3L 1Y69U 4RHRA 2XVSA 2EOTA 3MZ5A 4A3KB 3W1GA 3NTIA 1VF5C 1U0LA 3IFTA 3VR5A 1B9NA 2F3WA 4BXXH 3M7GA 5F2DA 2LXJA 3L2PA 3ULJA 1KTKA 4QCLA 5JAVA 1KDBA 1EY6A 1TWHH 3M4YA 4ZRZA 4LK1C 1HR0W 2X6LA 1BR9A 3SK8A 4GZYC 1BBXC 1HCZA 1D5MC 2KHJA 5GADC 1CKMA 2JJQA 5KNBA 1B70B 1SYBA 3OSOA 4KKUA 2ICEC 3L9AX 3NENA 2WP8J 1AEXA 1PFSA 5C0XG 1HNXQ 3AFQA 1MSHA 5JJLA 1IW7D 4RAUC 1Q86C 2DJGC 2K5HA 4OWXB 4X65L 3PO3G 4ZUJA 3RZDB 1EY9A 3IKJA 2NVYH 5JVG3 2E75C 2E2JB 3CD6A 3FRPB 2KENA 1IXRA 3OW7A 2I5HA 4IOCA 4BBSG 1G2SA 3TREA 3J81c 5JPNC 2H1EA 4B9XA 1PHJA 3FVQA 3RNUA 5ELFA 4IUQA 3BYYB 1SE8A 4A3DB 2D0OA 1PRTF 4F88A 1TS3A 1WTHA 2Q2UA 1FL0A 3T53B 1YIJA 5C4XH 1VQ5A 2L1BA 4DUZQ 3S17B 3LX0A 1X54A 3S15H 4DR7L 1PTOH 3VYRA 3MEFA 1G51A 1VQGA 3HOYH 3ZJYC 1ILPA 2QKIC 5KRUA 1KRTA 3C1FA 5GAHC 2PNHA 4A75A 2Q8TA 1EY0A 3RZOB 1GHJA 4OWWB 2VW9A 3CCSA 2N78A 4ZUIA 4Y7NH 3ICEA 1FGBD 1GUWA 3I4MH 1ONLA 1IL2A 3Q0AA 1E3PA 2VB2X 1IYUA 2ZXPA 4NXMQ 2ZJQA 4OO1G 3BZKA 2JA7H 3J80c 5IP7H 2EVBA 3GTJH 2RVLA 4GNXB 2F0VA 2OXPA 1QG7A 3A55A 4R9WA 3OTOL 4DV0Q 2RHSB 3FHWA 1VQFA 1ENFA 4YIJA 4MTNA 5EJWA 1FGUA 3D8GA 1CK1A 1KDCA 1HJPA 2EYLA 4NP5A 2RSOA 2D9UA 2EYMA 4G7ZC 2EXZA 1HRJA 1AN8A 3L0OA 4DXGA 4DR1Q 4CKEA 1N8RC 4LF9L 1II3A 5DM63 1T9HA 4LUZA 2BE5C 1VQBA 2QW7A 3J81j 4XIGS 1F2MA 2EY2A 3G6EA 2PMZB 4FXKC 3KJPA 3PO2G 1RKNA 1I3QB 3K7AB 4POGA 1O7ZA 4B3RL 1NR4A 3GTPH 1EQQA 5T1IA 4JYAL 4YWKA 2A69C 2KEDA 3KLSA 2DY7A 2O2LD 4A4IA 3NK9A 4DU9A 3BG3A 1Z9FA 3OMCA 1C48A 2F0FA 4HSVA 3UI2A 1B3QA 2XWJB 4NXNL 4A3DG 3E9HA 1XPRA 3HGBA 2JEAI 3VYUA 4AH6A 3CPWA 3CRLC 2QILA 3S2DB 4XDXA 3DHQA 3IL8A 3JAML 1K8OA 2K5DA 2OQ0A 3KBXA 2KCMA 1MHWC 3I3CA 3EVQA 4KN7C 1IBLL 4RGTA 2WFWA 5D3DA 2VNUD 1EU3A 4KV6A 1T5XD 2F0JA 1DCZA 4DA2A 5C3EB 1CKNA 2R92H 5IODA 2B2WC 1DXMA 2XN9C 3SGIA 1Q8KA 1XTDA 2F0EA 4C3HG 2CVRA 3GTGH 5BR8L 3JAMc 3CF5A 3ULLA 3KDFB 4DV7L 1PH2A 1GVPA 3RMHA 1QUQA 4LFBQ 3J7AF 2E2HB 2B2YC 1VQOA 1CA5A 4TSSA 1YHQA 5IYDG 4OHJA 1LV9A 1GXDC 4RG1A 1PH8A 4PG3A 3GV3A 4UP9A 3OIQA 3L7ZC 5FK9C 2NVQB 4XT1B 3PUXA 1RJTA 2LMCB 5IWAQ 1LTTD 3MAQA 1UEAB 1WOCA 3N52A 2FXQA 3TP6A 3PQIA 1PFMA 2O5IC 3QB3A 4U673 1N34Q 1O7IA 1PH6A 3SHLA 1N36L 1E22A 1OO9B 2AQ2B 1PZJD 2PZUA 1K83B 1X65A 3PGZA 4OX9L 5C3WA 1UE5A 1Y1WH 2GVAA 4DR2L 4AYBE 2G9DA 2BDOA 3W3AA 3VDYA 4LF6Q 1GM5A 2HHHL 5M5YH 2Z4IA 1JJCB 4F87A 3C1EA 4J15A 1RF2D 4G4KA 1GO3E 2DN8A 4WJ4A 1IHZA 2NN6H 1JB7A 1XPUA 4H44C 3SXHA 4HJ7A 1HFNA 3ITPA 2K5WA 3VR4A 3M4PA 1BCPF 3E3XA 4ZKBB 2AHOB 1EWHA 2B2UA 3AU7A 1JWSD 3CMEA 4FYDA 1H9RA 3Q22A 1D2BA 2KCCA 3D31A 5FJ8H 1LT6D 1PH5A 1IZ6A 1JQYD 4XYOA 2TMPA 4LF8Q 1S4ZA 4ZCKA 4OL7A 5IY0A 2UUCQ 4K8IA 2R3ZA 2WV6D 4B3SL 3DLLA 2Z4HA 1NMGA 4JBKA 2F3VA 2E5LL 3C46A 4X62Q 2EYOA 1J9OA 4A3KH 5C3EG 1A3UA 1HPCA 2L12A 1ZEQX 4LFAL 2SEBD 4IJHA 4GKKQ 3HOXG 1NE3A 2N88A 4A76A 1SLJA 4FO2A 5C5LA 1A63A 1B7YB 4UY8C 5HGTA 1Z7TA 4DAYA 5COYA 5E4WC 4IUNA 2XTIA 3D6CA 3D0FA 4J8QA 5I2XA 5CV7A 2UXDL 1WVLA 5I9PA 2AUKA 1B1ZA 1VQEA 1SNPA 5E3FA 4C3JB 4IUVA 1SYGA 2A69D 3KF6A 4KY7A 4DKAC 3RZDH 5FO9B 1IKLA 1CSQA 1G91A 4BWGB 2J0TD 4GLAC 4XQNA 1QVCA 3BVGA 1JOQA 2QGQA 1X3EA 3HZXA 3NBHB 2WKCA 2PI2A 4J6HA 3I4OA 1LTSD 1LTID 4A3DH 1KNEA 3A56A 2AWNA 4GOPA 3HOWB 1U4MA 5CV9A 3KLWA 4CHTB 1HNZQ 2A6HC 2FJ2A 5FKAC 3S17H 3HOYB 1I4XA 4A93B 5C3XA 4EQNA 1CHPD 2JA6B 2K6AA 3VA5A 2A68C 1L1OC 2DGYA 4V190 1OXTA 1XNRL 2DNEA 3RZOH 1FNUA 1X6OA 2K14A 1S5CD 4AIMA 1SMXA 1VMPA 2UU9Q 4F7XA 3P75A 3CXCA 2L5TA 3KFUA 4S3SA 4DK3C 1A6XA 4YY3L 5DLQE 1I4QA 3T13A 3SK6A 5I2YA 1HQRD 3PIO3 2EJMA 1PH7A 1KDAA 3R2TA 4BXXG 1F9RA 2IPKD 1EEFD 4RCOA 1TWGB 5IYDH 2JSOA 1N32Q 1F9SA 3PMFA 1DYQA 4BA1I 1D7QA 1SR3A 4KHZA 2MFIA 4NW2A 2UUAQ 5J22A 1I4RA 1YNJC 4HJAA 4GS3A 3PUVA 3QOLA 2VXWA 2AMCB 2QCPX 1BXTA 3CQZB 3I4NH 4JI5Q 2M9VA 3EA6A 1BF4A 1U5KA 3K7AH 5KYLA 4N9PA 1LLRD 2EYHA 1M1KC 3BZCA 4P73A 1VQNA 1IKMA 5M9OA 2CH4W 2VY3A 2KOLA 3BVMA 2RQXA 1SYCA 1PRTC 2N49A 4JV5Q 1VQ9A 1NAPA 5C5MA 3MHBA 1LT4D 2R7FA 1LM0A 4JW0A 4A3JB 1GUOA 5LMUL 1L2FA 1W6KA 1V9PA 1X3PA 1HNXL 3QIAA 1KQSA 3UE1A 3VYTA 1LTLA 4X66L 5JVH3 1PFNA 2PZWA 3CU7A 5IGBA 3S2DH 2F1MA 2RDFA 2XGTA 3LNNA 5CV4A 1TY2A 4JG2A 5CMDA 4DV3Q 4A3FB 3HOYG 4A93G 1F9QA 5JJIA 2E2IH 2Z6KA 2JA6G 1K8AC 2A5HA 3MC0B 2B3GA 1GUTA 1VQ6A 2XSCA 3PUYA 4UAIA 2K50A 4LMQD 2AQ3B 3Q23A 1STBA 1SNDA 3RUZA 1I6VC 2HIVA 4R4OA 3CCRA 1QZHA 1LACA 1VQAA 3CC7A 1KC8C 2JA7G 2FHTA 3FPPA 2D2CC 4AQYL 5C44B 3GTGB 2JN4A 3CAMA 2F0TA 2PYKA 1TT2A 1CQVA 1EFWA 2BA1A 2IY5B 1SBBB 4B9WA 4BS9A 4A3IB 2RHQB 2E2HH 4LAAA 1LT3D 2KCNA 1DOMA 1JR0D 4RGOS 4MNOA 1B53A 3TZUA 2VQFQ 3H09A 1BUVT 3DEPA 2NVQH 4PMWA 2JQOA 1Z47A 2KBNA 1FR3A 2BDNA 1VQKA 3NUCA 3Q6SA 3A54A 3K58A 4P71A 1HHVA 2EPBA 1SJED 2A6ED 3QR8A 4IQZA 3STBC 3HEJA 4JI6L 4BY1H 4HAEA 3DWQA 1Y1WB 1YNND 4XT3B 2WAQE 5M5YB 4IPHA 4H7BA 4OXPA 1V8QA 1VQCA 3HP3A 2HD3A 2VQEQ 4LUVA 2OT2A 2GA4B 4HMIA 5T1GA 2H4OA 1BQQT 3JAME 4A3JG 3S1MB 1EUJA 3S1QB 4RGNA 2X69A 2O5JC 1KIXA 4IPGA 4EQPA 3NWTA 1ET9A 4LJZC 1VQ7A 2VB3X 1QOHA 4FF2A 4OGQC 1STGA 3SE0A 4WJ3M 3C3LA 4A3FG 4JK1C 4KTAA 4GKJQ 1HFGA 2K04A 3I72A 4PMBA 1K28A 4L5SA 3ERSX 3K57A 2K33A 3CCUA 1MSGA 3HOZB 4NMZA 3WDNA 4CBVA 1EIYB 4GNXA 1B4OA 5KNDA 1STNA 1XMQQ 2ZTCA 4YHHL 1EY8A 2B29A 3A0JA 2R92G 2EYPA 2NB0A 2OWOA 1WJJA 5EBCA 1EZ8A 1LTAD 4Z9CB 2QDLA 2K5VA 3BVZA 1O78A 2Y0SG 5CR3A 2F0WA 5FO7B 1UAPA 4LF5Q 2LFNA 1F2YA 4DK1A 3NBIA 1HUMA 5M3FB 5ELDA 4A3BB 1ML0D 1V1QA 1EFID 2HQEA 1QNKA 3HKZG 5LHY1 4A3IG 1K3BC 4JCVE 2MNAA 4X3UA 1JOOA 2HDLA 3K5NA 2VZAA 1T5EA 1KAAA 1J5EQ 4Q0FA 1NJIC 3S24A 4X3TA 2RF4A 2ALYB 1L1OB 1VS0A 1VQMA 3TP8A 1KRSA 5I6YA 1RL2A 3KOJA 2IX0A 1S5ED 4C3JH 1AP0A 2E74C 4KMUC 2K03A 1N9WA 1A0IA 2F0HA 4KN4C 2BH2A 3DWPA 1TS2A 4LW1A 4LFBL 3PIOA 2ZXRA 1WYDA 2PW5A 1B8AA 3CPFA 1IBKQ 2MO0A 4R4IA 3QJYA 1Y1WG 3EROA 5G3LD 2ICIA 2NVTH 3NWSA 3PF5A 1S72A 3GTMB 3HOWH 4DAPA 1DZ1A 1B44D 1BCPC 1YBYA 1Y8OB 1X9NA 3T1HQ 2I0QA 2NN6G 5KYIA 1G291 3VR2A 4PMCA 4IPDA 4A93H 2L11A 4JI4Q 1VDZA 4N8FA 2JA6H 4DV5L 4L5TA 1LO5D 2FMMA 1TIID 3M7NA 4K5VA 5DM73 4LF6L 5FJ8G 1H9SB 2B8GA 2IX1A 4R8NA 2L55A 4LF4Q 3DM1A 3EN2A 4G7HC 2R7DA 4B3MQ 3HRZC 3HOZG 2IHEA 2YV5A 1EIHA 2E2DC 3I8ZA 3M9BA 1WD1A 3KDFA 4XYQA 2PCFB 4A3KG 1ASYA 1QE6A 3TDQA 2IX3A 1F77A 1S3OA 4EX5A 3K7UC 3EIVA 4DV6Q 4JC0A 5CBAE 1TWGH 2RCFA 1PMRA 2B8FA 4H0LC 5ELBA 2Z1CA 5ELCA 2MO1A 4LF8L 1CI3M 3K81C 3MWYW 4K8JA 3CC2A 1HQMC 1HTPA 3FPUB 3I4LA 4A3BG 2R61A 1Q7YC 3GO5A 1VQJA 1BNZA 2R93B 2F4IA 5C0XI 1SNQA 3CQZH 1JMCA 3I4NB 5CGKA 1DOLA 2GVBA 2C35B 1PA6A 4IUTA 2TSSA 5I4DA 1I94Q 4GN4B 1A15A 1DJRD 3GV6A 1PTOC 1D8LA 4DF7A 1GUGA 5CC4A 4J1MA 4KHPQ 2UUBQ 1TS5A 4RCNA 3J7YW 3H3VI 1E0BA 4MTKA 1JJGA 3NE5B 3U9SA 1L0XB 4MN3A 2B2UC 1SSOA 4NDXA 1VQDA 2PQAB 2ZXOA 4A3EB 2MQHA 4DV1Q 4DV2Q 3TQYA 1QVFA 4A3JH 4IFDI 1PXUA 4RFBA 3DM3A 2LS01 3W1BA 1NCVA 2IT1A 4I7AA 4AYBB 2YTXA 1EQRA 3VYSA 3I7FA 3WOEA 1AW7A 2F0PA 3KF8B 4GN3B 1R9TB 4TQUS 4CDEC 2F03A 5C4HA 4A3FH 1EWIA 2E2IB 4R4CA 1VQ4A 1OXSC 1E24A 5A2QL 3GTOH 5I9OA 2F0SA 1D1IA 3MA2B 4OO1I 2EJGC 4DUYL 4R4TA 5DEHA 4ILWA 1ZKOA 2KJXA 2K7VA 4UPAA 3IFDA 1GUSA 4KY5A 1PLFA 2RBMA 3T51B 2ZM6L 4IZ8A 3FMCA 2JEBI 2CW0C 3MXNB 1IBML 2YYZA 1KD1C 4LF7Q 2EYFA 4YCWA 5C44H 2JXMB 4PZ8A 5M3MB 3BDCA 1BDOA 3K5LA 3I73A 2M2LA 4KJNA 4EVOA 3RR5A 4MHEA 2R6GA 1QWYA 3PCOB 1Q90A 3U9OA 4A3IH 2HQLA 4C56C 3GDEA 2AUJD 4KLKA 1EQTA 5IOCA 1K9MC 1XNQL 2UU9L 4R1JA 5KNCA 1RHPA 4RKLA 1Q1BA 1D6EC 1TWAB 1TQOA 1AE2A 4X65Q 1YITA 2R93G 3H15A 3I4NG 4QB4A 1DM0B 2N55A 3MXGA 4UP7A 4GOPC 1E1OA 5HY6A 3RLFA 4X6AH 2WACA 3OW2A 2FMCA 3NBHA 3CCLA 1CKOA 4BY1B 1EL0A 2P5ZX 1VQHA 2IW3A 1VQ8A 1X32A 4N9TA 3S14H 3I90A 3I70A 4APVA 4HJ5A 3NSWA 5LL6S 1K0SA 2F0LA 4XTCS 4ZLTF 1K3RA 4A3MB 4KD3A 4DR7Q 4HTHA 2IHFA 4QL5A 1AZQA 3VA7A 1X55A 1IYVA 4JI5L 4IURA 4ZK9B 3S1MH 3ONAB 1NR2A 3KK7A 1Y1VB 4BBRH 3S1QH 2MHVA 1YVCA 1SE2A 1WI5A 4WORA 4QIWE 4ZQ3A 4DNIA 2NZ1D 1ESRA 3G71A 3CW2C 4IFDH 3GTQB 2CQAA 1WTRA 4JV5L 4I7ZC 3QOJA 2I07B 2RDGA 3HOZH 3DWAA 1HZBA 1Q3LA 1SNCA 5KIXA 3OTOQ 2RDHA 5TSSA 3A74A 5EPJA 2V1CC 3AQQA 2A74C 1ENAA 1PH4A 3S1RH 1U4LA 1XJVA 3M4OB 1K8GA 4QGUA 1MD2D 4CDDC 1E7ZA 2N8NA 4DV3L 2F0OA 1G6ZA 1OXXK 2K5QA 3H3VC 5M3MG 5M3FH 1GOZA 4A3BH 4ZKCB 2BE5D 3IRBA 5LMNQ 1SFOH 3ZYYX 3CCMA 4M8AA 1EYGA 3U4VA 2SDFA 3V05A 3I55A 4DR5L 2KEEA 3EJIA 4B08A 2MP1A 4B3RQ 1STEA 1C0AA 4DV4Q 3RLNA 4IO9A 4JYAQ 4FVMA 3J7A5 1EOTA 1HXYD 1E2VA 4ZAIA 3M4QA 1AE3A 2ATWA 3CCJA 2A73B 2SOBA 1SMYC 2ID0A 1PTOF 1RIPA 1F2ZA 2ASBA 5EAYA 1RODA 4JI0Q 3Q8DA 4L5QA 2KVMA 1HR0Q 4OWTB 4BY1G 5FOBB 4DR4Q 3BU2A 1PYSB 2VQFL 2DJFC 2NVTB 2G5DA 2Z6KC 3GTMH 4XXEA 1EEID 4BA2I 2Z0SA 1Y14B 1MIUA 1R4PB 2I46A 2Z8LA 3D4WA 5M5WH 1Q1EA 4FF3A 5C4JH 1CUKA 2KHIA 1V1PB 4K6LA 1Y1VG 5J39A 2YTVA 4KHVA 4RGMA 4PV1C 4HJ8A 4LWCA 3OYYA 4C1NK 1MJCA 1KLUD 2VQEL 1HZAA 1N33Q 2L15A 1XYIA 2HCIA 2J7ZA 2QEJC 1OTCA 1ASZA 4G7OC 1IL8A 2KUMA 4A3GB 1YHBA 1JOKA 5GROA 1C4QA 4BY7B 2BA0A 2NTSA 3QG1A 5HURA 3J81i 3PUZA 3URYA 3UDXA 1ESFA 4HMJA 3NTKA 2K28A 2F4VQ 1LTGD 1ZYRC 5JEAH 1CFMA 2RA4A 1QB5D 1SN8A 2F0GA 2WB1E 3HOUB 4JI1Q 4DNRB 4GLVB 4CJ1B 3KYHC 3GTLB 1TS4A 2R93H 2K1BA 4XQJA 2AWOA 4K2KA 3U50C 3FEWX 3R2IA 1WTQA 1N36Q 1PZKD 2RSNA 1B2TA 3D3RA 2EZVA 5EKIA 3H91A 5EPKA 2FINB 1BO0A 4A3CH 3TP7A 2VUMB 5IP9H 2G9HD 3LGJA 2KA7A 4G57A 4C3JG 5IGFA 4DR2Q 2O4XA 1LTRD 2B2VA 4LF5L 5AJ3Q 1MGSA 2NYZD 3MFGA 4DAYB 3A8KE 1I5FA 1LT5D 3J80i 4DR3Q 3P1HA 3L3OC 1XWEA 4L63B 3OOCA 1XMOQ 3E0JA 2XRSD 5IYCH 4A3EH 2F0QA 4K14A 5D3IB 4JI7Q 1J5EL 2MPMA 5DAUA 3VR6A 1Q81C 2JA9A 4P72A 3ERQA 4DR6Q 1IW7C 3HOWG 1O7LA 2WAQB 3EBEA 3PUWA 4IALA 5EPLA 4GNXC 1GD7A 4DK6C 1ICFB 3K59A 3MXUA 1H9JA 3NQTA 4HJ9A 3D4DA 3I56A 1R9TH 1NY4A 1V43A 4HCSA 3BDOA 4WJWA 5BN5A 1IBKL 3GTOB 3EQLC 1PVOA 1GKHA 4IUPA 2E5LQ 2Z6BA 2B63B 1A62A 4YCUA 3P20A 3KJOA 4DUZL 2ZTDA 4IUUA 3T1HL 3E6ZX 4ODGA 2UXBQ 2WIIB 3OHXC 1KLGD 1EOVA 5J3BA 4JI4L 2K32A 3A7LA 4BY7G 3HG9A 5M3MH 4K0KQ 4QMGA 2K52A 4LFCQ 4QY7A 4DNTB 2XWBB 5IGDA 3NXWA 4CJ0B 1B50A 3F2CA 4A3LH 1DD2A 4LF4L 2HUGA 4NXML 1WTXA 3DXJC 3HOUG 4B3ML 4PNYA 3SK4A 3N6RA 4JI8Q 4B3TQ 1S40A 1EIGA 1TWAH 2Q2TA 3O13A 1JICA 5ELNA 4Q5VA 4IFDJ 1K0RA 4ZYSA 2F52A 1NUCA 4DV0L 1SMYD 2JA5B 1CQFA 2MUYA 3EFXD 1TY0A 5FLMH 3X3NA 1EYDA 1Q46A 3M3YB 1UNSA 4DV6L 4RMFA 1SNMA 4JOIA 2VUMG 3BZDB 1WCMB 4ME3A 3S16B 3UDGA 3S14B 1XPOA 3CHBD 4DR1L 3RN2A 2OTJA 1LABA 3LWUA 4JI2Q 2M00A 4A3MH 2AKWB 2A6HD 1I50B 2Q8RE 2H5XA 4RKBA 1NBWA 4P75A 5AFWA 1STAA 3A8IE 5A2QE 3T1YQ 1FJGQ 1I94L 4BBRB 1BBUA 2PI2E 1Y1VH 3J7ZC 2A68D 4HSPA 4KHPL 2WAQG 3ER0A 1MJEA 2UUBL 3WOFA 1H9SA 4V0BA 3G7LA 3ULPA 4PQXA 1EU4A 1LUZA 3GTQH 2JA8B 3FKIB 1E1TA 2RCNA 1M90C 4DV1L 1VQPA 3H6MA 1L0YB 2Q2HA 1NSNS 1AH9A 2B63G 2K5NA 2E76C 2KHSA 4TKOB 1PFBA 3S1RB 1Q12A 3TS0A 5E4XA 5ISRA 3M4OH 4CGYB 1UUPA 2MGSA 5FO8B 3MXPA 5E7NA 2F0IA 3LWEA 2K75A 2Y0SE 5C44G 2CKZB 2QEXA 3MEHA 3A5ZB 1QNUA 3PIP3 3I91A 1YNJD 1AFPA 1KNAA 5C4ZA 4MZ9A 1LTBD 3DUZA 4ULLA 2HT1A 2UXCQ 3HKZE 1SFOB 4K6DA 5BN4A 1VQIA 1Y8NB 2YU9B 5E1FA 4FNFA 1B3AA 1FVIA 2EJFC 1JWUD 1C9OA 1W6JA 2B2TA 5JPMC 3AFPA 4LF7L 4O42A 2JA5G 2BH8A 3J81L 3QWNA 1PRTD 2PQAA 2LY7A 1K73C 3K5OA 4K2LA 4C3IB 2E8GA 3KBGA 5LMUQ 1PH3A 3PO2B 1HA6A 1WCMG 1F9PA 2IJ0A 1UE1A 3AB9A 4QUCA 5FLXL 3HOVB 5IWAL 3F1ZA 1J6QA 4X66Q 5JEAJ 2EY5A 4IJLA 3V2TA 5K36H 5M5WB 2Q2IA 4ALPA 1N34L 3KF8A 3OMGA 4L8JA 1YHAA 1I6HH 1P16A 3CCEA 5C4JB 1B9MA 2DUDA 1U9RA 1CM9A 1XXGA 3B6YA 4BBRG 4X3KA 1EZ6A 3BDLA 5CV8A 2KCTA 2L4NA 4XQQA
chains in the Genus database with same CATH topology
1Q1BA 1SRUA 3RLOA 4UP8A 1AE2A 4X65Q 2ZTEA 4X64L 5FLXc 1YITA 4IFDG 2R93G 3H0GH 1BBWA 1YJWA 1YZ6A 3K8AA 3H15A 2JA8G 1L1OC 2DGYA 3FKIG 1OXTA 1XNRL 3I4NG 1JT8A 3RZOH 1HNWQ 1TWFH 1X6OA 2K14A 4UP7A 1E1OA 5HY6A 3RLFA 4GOPC 4AQYQ 4X6AH 4A3GH 4AIMA 1JJ2A 1SMXA 3OW2A 3CCLA 4BY7H 1CKOA 2NZOA 3CP0A 2QA4A 2UU9Q 3CXCA 3KFUA 3JAMi 1VQHA 1VQ8A 4DK3C 4YY3L 5DLQE 3S14H 4APVA 4X64Q 4HJ5A 1QVGA 1HZCA 1IYJB 1K83H 4XTCS 1NMFA 1WFQA 2K4KA 1K3RA 1VCIA 4FDBA 1PH7A 4L5RC 4DR7Q 5JJKA 1XNRQ 2IHFA 4QL5A 2VL6A 1UWVA 1SROA 4JBJA 2A8VA 2UUCL 3HOUH 4BXXG 1EIFA 1X55A 5M3FG 4HIMA 4JI5L 2NZHA 3GTLH 3S1MH 5IYDH 4OONA 1N32Q 4BBRH 3S1QH 2OCEA 2LXKA 4JBMA 5M5XH 1YVCA 4BA1I 1WI5A 4X62L 4QIWE 1SR3A 1D7QA 2ZJPA 4KHZA 2MFIA 1DGSA 1UEBA 4DNIA 4YY3Q 1VQLA 2UUAQ 1G6PA 4HJAA 4DV2L 4GS3A 3G71A 3F2BA 3CW2C 4GKKL 3GTKH 3PUVA 1YI2A 2AMCB 4QQBX 4JI6Q 3STBD 2VUMH 5IYBG 4JV5L 2CCZA 3I4NH 2GN5A 1X56A 1YJNA 3S2HH 1KAWA 4JI5Q 3HOZH 1U5KA 4EQ5A 2ZJRA 1HZBA 2OQKA 2HIXA 3OTOQ 3K7AH 3A74A 2V1CC 3AQQA 5LMNL 1M1KC 3G48A 5LMNW 5IE8A 3BZCA 4P73A 1VQNA 1PH4A 3S1RH 1W3SA 1XJVA 1K8GA 4QJFA 4QGUA 3S1NH 4JI3L 2VY3A 4HIOA 1E7ZA 3HOVG 2N8NA 4DV3L 2N49A 4JV5Q 3W1GA 2NN6I 1VQ9A 4YCVA 4DV4L 1OXXK 1U0LA 1LM0A 2R7FA 4P74A 3F2DA 4NB3A 4BXXH 5M3MG 4POFA 5LMUL 2LXJA 3L2PA 5M3FH 3ULJA 4A3BH 1L2FA 2D62A 1V9PA 3FP9A 1HNXL 3IRBA 5LMNQ 1SFOH 3UE1A 1KQSA 1TWHH 4JI0L 3CCMA 1LTLA 4X66L 3U4VA 1EYGA 1HR0L 1HR0W 4JI3Q 3I55A 4DR5L 3S2DH 4DR4L 3JC66 2B63H 2XGTA 4YHHQ 4DV3Q 4JG2A 3HOYG 2KHJA 5GADC 4B3RQ 4A93G 1CKMA 1C0AA 4DV4Q 3RLNA 4IO9A 5JJIA 5IYBH 2JJQA 2Z6KA 1B70B 2E2IH 2JA6G 3J7A5 4JYAQ 1K8AC 4JBWA 3M4QA 1AE3A 2B3GA 3CCJA 2ATWA 2EIFA 3NENA 2WP8J 5C0XG 1PFSA 1HNZL 1VQ6A 2ID0A 3PUYA 1RIPA 1HNXQ 2ASBA 3AFQA 5EAYA 3HOYH 2K50A 4JI0Q 5JJLA 1Q86C 4X65L 2K5HA 3Q8DA 4L5QA 4OWXB 1HR0Q 3PO3G 2HIVA 4R4OA 3TEHB 4OWTB 4BY1G 3CCRA 1VQAA 3CCVA 1QZHA 4DR4Q 3CC7A 3BU2A 1KC8C 2NVYH 1PYSB 2JA7G 2VS1A 2VQFL 3CD6A 5IT9c 1X3FA 1NTGA 2KENA 1IXRA 2I5HA 2Z6KC 4AQYL 4IOCA 3GTMH 4BBSG 3TREA 3J81c 5JEAG 4BA2I 2Z0SA 1Y14B 2A1AA 3CAMA 1PHJA 1N33L 3RNUA 1MIUA 1EFWA 1YNXA 2BA1A 5HGQA 5M5WH 1SE8A 2IY5B 1Q1EA 2D0OA 2RHQB 1OXUA 2E2HH 2Q2UA 5C4JH 1CUKA 1FL0A 2KHIA 1YIJA 1Y1VG 5C4XH 1VQ5A 4MNOA 2YTVA 4DUZQ 3F8TA 1X54A 3S15H 4HJ8A 2VQFQ 4DR7L 4LWCA 3BJUA 2R7ZG 2JA5H 3OYYA 2ES2A 2NVQH 3MEFA 1G51A 1VQGA 4PMWA 3CC4A 2JQOA 2PMZE 2F4VL 1Z47A 3ZJYC 1MJCA 2KBNA 3M3YH 1VQKA 4A3CG 2VQEL 1HZAA 1KRTA 1N33Q 5IP9G 2L15A 1N32L 5GAHC 4P71A 2PNHA 4A75A 1WCMH 4OWWB 3ICEA 2VW9A 1HZ9A 2N78A 4JI1L 4Y7NH 3CCSA 1ASZA 1OTCA 2UUAL 3S16H 3I4MH 1YHBA 5GROA 1IL2A 4YWLA 3PO3H 2BA0A 1E3PA 4O2DA 3STBC 3PIPA 4A93H 4JI6L 4BY1H 4NXMQ 3UE0A 3J81i 2ZJQA 4OO1G 3AEVA 1I50H 3PUZA 5IYCG 3BZKA 2CWAA 3UDXA 2WAQE 4GLXA 4A3EG 3J80c 1PH9A 5IP7H 4IPHA 2JA7H 4OXPA 2F4VQ 1VQCA 3GTJH 4GNXB 3H3VH 4BBSH 2VQEQ 4DV5Q 4LUVA 3OTOL 3TRZA 4YWMA 4DV0Q 1PH1A 1JE5A 1SN8A 2RHSB 3FHWA 1VQFA 2WB1E 1UE6A 4AYBG 4JI1Q 4GLVB 4A3JG 5AJ3L 4MTNA 1FGUA 3KYHC 3PF4A 1EUJA 1HJPA 1KIXA 4DR3L 4IPGA 2R93H 2AWOA 3U50C 4PZ6A 1N36Q 4LNQA 2JA8H 1VQ7A 3FKIH 3G4SA 1XMOL 3L0OA 4DR1Q 4WJ3M 1PYBA 4JI7L 1N8RC 4LF9L 3HFZB 4A3CH 1T9HA 4LUZA 5IP9H 4A3FG 1Q82C 3LGJA 4GKJQ 1KXLA 1VQBA 3J81j 4DR2Q 4DR6L 4XIGS 4L5SA 3ERSX 4LF5L 3CCUA 5AJ3Q 3G6EA 2EXDA 1EIYB 4GNXA 4DAYB 3KJPA 1C7YA 1I5FA 3PO2G 3J80i 4POGA 4DR3Q 1XMQQ 2ZTCA 4YHHL 1YJ9A 4B3RL 2B29A 3GTPH 3A0JA 1XMOQ 1EQQA 2R92G 5IYCH 4YWKA 4A3EH 4JYAL 2OWOA 1WJJA 4JI7Q 1J5EL 4LF9Q 2D0PA 4A4IA 2K5VA 1Q81C 2JA9A 4P72A 1Z9FA 3NELA 2EQSA 2Y0SG 4DR6Q 3HOWG 3EBEA 4LF5Q 1LYLA 1P8LA 3PUWA 2YU9H 4GNXC 4A3LG 1CKNB 1GD7A 4DK6C 4NXNL 3TS2A 1V1QA 4A3DG 3E0EA 3E9HA 1XPRA 4HJ9A 3HKZG 4A3IG 3I56A 4JCVE 1R9TH 1NY4A 2MNAA 2JEAI 4AH6A 2UXBL 1V43A 3CPWA 2VZAA 3PSIA 1IBKL 1QZGA 1J5EQ 1NJIC 1PVOA 1GKHA 3S24A 2RF4A 2ALYB 2E5LQ 2JE6I 1L1OB 1VS0A 1VQMA 1QUQB 4K0KL 1KRSA 5FLMG 1RL2A 3KOJA 4LFCL 2IX0A 1A62A 1W2BA 4C3JH 2OQ0A 4YCUA 4C3IH 2KCMA 1N9WA 1A0IA 4NXNQ 3KJOA 2BH2A 4DUZL 3PO2H 3U58A 2ZTDA 3T1HL 1IBLL 4LW1A 4LFBL 2WFWA 3PIOA 2UXBQ 3HOVH 4JI8L 2VNUD 4B3TL 1WYDA 1EOVA 1PV4A 1B8AA 3CPFA 5J3BA 4JI4L 1IBKQ 4BY7G 1CKNA 2R92H 4H02A 4A3MG 5M3MH 2MO0A 4R4IA 1Y1WG 4K0KQ 2I5MX 3SGIA 4GN5A 3W5OA 2E2JH 2K52A 4LFCQ 4QY7A 1A8VA 1Q8KA 1XTDA 3UDFA 3PF5A 1S72A 2NVTH 3HOWH 3GTGH 5BR8L 3JAMc 3CCQA 1L0WA 1YBYA 3F2CA 3CF5A 1UE7A 1X9NA 4LF4L 3ULLA 4A3LH 3KDFB 4DV7L 1PH2A 3T1HQ 1GVPA 1IBLQ 1QUQA 4NXML 3GD7A 5GAGC 2I0QA 4B3ML 2NN6G 3HOUG 4LFBQ 1G291 3CMAA 1VQOA 4JI8Q 4B3TQ 3HKSA 4DUYQ 4IPDA 1YHQA 1BKBA 5IYDG 1TWAH 4RG1A 1S40A 1PH8A 5ELNA 2Q2TA 4JI4Q 4PG3A 4IFDJ 1K0RA 2JA6H 2F52A 4DV5L 4L5TA 4JI2L 4KI0A 4DV0L 2ZM6Q 4UP9A 2CFMA 3L7ZC 3M7NA 1IBMQ 3PUXA 4LF6L 5FJ8G 5FLMH 5IWAQ 1Q46A 1WOCA 2IX1A 2FXQA 5BR8Q 4DV6L 4RMFA 3T1YL 1FJGL 1H95A 3WWVA 4JOIA 4LF4Q 3EN2A 2VUMG 4DV7Q 2R7DA 1O7IA 1N34Q 4ME3A 1PH6A 4B3MQ 1N36L 1E22A 3UDGA 3HOZG 2IHEA 2YV5A 1XPOA 2F3IA 2YTYA 4DR1L 3RN2A 1X65A 2OTJA 3M9BA 4JI2Q 3PGZA 1XNQQ 4OX9L 3KDFA 1UE5A 4A3MH 2AKWB 4A3KG 1ASYA 4GKJL 1Y1WH 2H5XA 2N3SA 2GVAA 4DR2L 4AYBE 4IPCA 3VDYA 1NBWA 1GM5A 4LF6Q 2I5LX 1S3OA 4P75A 5M5YH 2HHHL 4EX5A 3K7UC 1JJCB 3EIVA 4C3HH 4DV6Q 4JC0A 4LUOA 3T1YQ 1I94L 1TWGH 1BBUA 2PI2E 4J15A 4JOIC 1FJGQ 1Y1VH 3J7ZC 1XMQL 2MO1A 4LF8L 1GO3E 2WAQG 3ER0A 3K81C 1MJEA 2UUBL 4KHPL 4WJ4A 1XPUA 1JB7A 1BVSA 3CC2A 4HJ7A 4A3BG 1Q7YC 3ULPA 3M4PA 4NPSA 2AHOB 3GO5A 1VQJA 4OX9Q 1X3GA 1LUZA 5C0XI 3GTQH 1CSPA 2WB1G 3CQZH 1E1TA 2RCNA 3CMEA 5H1SE 1M90C 1OXVA 1JMCA 1MKHA 2GVBA 2HHHQ 2R7ZH 2C35B 1PA6A 2CQOA 2JK8A 4DV1L 3D31A 5FJ8H 3M85A 2Q2HA 1VQPA 3K80C 4GN4B 1I94Q 1PH5A 1AH9A 1IZ6A 2B63G 2K5NA 4C2MH 1D8LA 3AYHB 2NVXH 2UXCL 4LF8Q 4KHPQ 2UUBQ 5IY0A 2UUCQ 2CWPA 3H3VI 1Q12A 2LSSA 3TS0A 1JJGA 1TXYA 4B3SL 3DLLA 4JBKA 1NMGA 3M4OH 4DAMA 1I3QH 2E5LL 5E7NA 4X62Q 1VQDA 4A3KH 2K75A 2PQAB 2Y0SE 1YEZA 5C3EG 5C44G 2A19A 2CKZB 2MQHA 2QEXA 3A5ZB 4LFAL 5GAEC 4DV1Q 4DV2Q 3TQYA 1QVFA 5K36G 4IJHA 3KF6B 4A3JH 4GKKQ 4IFDI 1TWCH 3HOXG 1NE3A 3DM3A 4MZ9A 4A76A 1SLJA 3U4ZA 3W1BA 3UDIA 2HT1A 2UXCQ 3HKZE 4TVAB 2IT1A 1A63A 2OTLA 1VQIA 1B7YB 2YTXA 1EQRA 4UY8C 3I7FA 4B3SQ 1FVIA 2XTIA 3D0FA 4IOAA 3KF8B 1C9OA 4GN3B 4TQUS 2UXDL 4HIDA 4A3FH 3AFPA 1EWIA 4R4CA 4HIKA 4GOPB 1VQ4A 1OXSC 1E24A 4LF7L 3H0GG 3I2ZA 4LFAQ 5C4XG 3PV0A 3GTOH 3A5UA 1VQEA 5C0XJ 2JA5G 4DPGA 2BH8A 4OO1I 2PQAA 4DUYL 1K73C 4A3GG 4R4TA 2E8GA 3E9IA 3KF6A 4DKAC 5LMUQ 1PH3A 3RZDH 4PZ7A 4Y52H 4UPAA 1WCMG 2ZM6L 1CSQA 1UE1A 1KL9A 2UXDQ 4GLAC 2JEBI 3I4MG 3MXNB 1IBML 2YYZA 1QVCA 1KD1C 4LF7Q 5IWAL 1KHIA 3F1ZA 2QGQA 1J6QA 4YCWA 4X66Q 1X3EA 5C3EH 5C44H 5JEAJ 3RN5A 4PZ8A 3NBHB 4IJLA 5ELOA 4DR5Q 3K0XA 2PI2A 2Q2IA 5GQOA 4O0AA 1L1OA 3RR5A 3HOXH 3I4OA 4ALPA 1N34L 1I6HH 4A3DH 1YHAA 2R6GA 5IP7G 1P16A 3PCOB 2AWNA 3CCEA 1HNWL 4A3IH 2HQLA 3GDEA 4GOPA 2DUDA 3B6YA 4BBRG 4KLKA 3KLWA 1K9MC 4R4QA 1XNQL 1HNZQ 2UU9L 3S17H 4R1JA 2KCTA 1HH2P 3NEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q1B A;  1SRU A;  3RLO A;  4UP8 A;  1AE2 A;  4X65 Q;  2ZTE A;  4X64 L;  5FLX c;  1YIT A;  4IFD G;  2R93 G;  3H0G H;  1BBW A;  1YJW A;  1YZ6 A;  3K8A A;  3H15 A;  2JA8 G;  1L1O C;  2DGY A;  3FKI G;  1OXT A;  1XNR L;  3I4N G;  1JT8 A;  3RZO H;  1HNW Q;  1TWF H;  1X6O A;  2K14 A;  4UP7 A;  1E1O A;  5HY6 A;  3RLF A;  4GOP C;  4AQY Q;  4X6A H;  4A3G H;  4AIM A;  1JJ2 A;  1SMX A;  3OW2 A;  3CCL A;  4BY7 H;  1CKO A;  2NZO A;  3CP0 A;  2QA4 A;  2UU9 Q;  3CXC A;  3KFU A;  3JAM i;  1VQH A;  1VQ8 A;  4DK3 C;  4YY3 L;  5DLQ E;  3S14 H;  4APV A;  4X64 Q;  4HJ5 A;  1QVG A;  1HZC A;  1IYJ B;  1K83 H;  4XTC S;  1NMF A;  1WFQ A;  2K4K A;  1K3R A;  1VCI A;  4FDB A;  1PH7 A;  4L5R C;  4DR7 Q;  5JJK A;  1XNR Q;  2IHF A;  4QL5 A;  2VL6 A;  1UWV A;  1SRO A;  4JBJ A;  2A8V A;  2UUC L;  3HOU H;  4BXX G;  1EIF A;  1X55 A;  5M3F G;  4HIM A;  4JI5 L;  2NZH A;  3GTL H;  3S1M H;  5IYD H;  4OON A;  1N32 Q;  4BBR H;  3S1Q H;  2OCE A;  2LXK A;  4JBM A;  5M5X H;  1YVC A;  4BA1 I;  1WI5 A;  4X62 L;  4QIW E;  1SR3 A;  1D7Q A;  2ZJP A;  4KHZ A;  2MFI A;  1DGS A;  1UEB A;  4DNI A;  4YY3 Q;  1VQL A;  2UUA Q;  1G6P A;  4HJA A;  4DV2 L;  4GS3 A;  3G71 A;  3F2B A;  3CW2 C;  4GKK L;  3GTK H;  3PUV A;  1YI2 A;  2AMC B;  4QQB X;  4JI6 Q;  3STB D;  2VUM H;  5IYB G;  4JV5 L;  2CCZ A;  3I4N H;  2GN5 A;  1X56 A;  1YJN A;  3S2H H;  1KAW A;  4JI5 Q;  3HOZ H;  1U5K A;  4EQ5 A;  2ZJR A;  1HZB A;  2OQK A;  2HIX A;  3OTO Q;  3K7A H;  3A74 A;  2V1C C;  3AQQ A;  5LMN L;  1M1K C;  3G48 A;  5LMN W;  5IE8 A;  3BZC A;  4P73 A;  1VQN A;  1PH4 A;  3S1R H;  1W3S A;  1XJV A;  1K8G A;  4QJF A;  4QGU A;  3S1N H;  4JI3 L;  2VY3 A;  4HIO A;  1E7Z A;  3HOV G;  2N8N A;  4DV3 L;  2N49 A;  4JV5 Q;  3W1G A;  2NN6 I;  1VQ9 A;  4YCV A;  4DV4 L;  1OXX K;  1U0L A;  1LM0 A;  2R7F A;  4P74 A;  3F2D A;  4NB3 A;  4BXX H;  5M3M G;  4POF A;  5LMU L;  2LXJ A;  3L2P A;  5M3F H;  3ULJ A;  4A3B H;  1L2F A;  2D62 A;  1V9P A;  3FP9 A;  1HNX L;  3IRB A;  5LMN Q;  1SFO H;  3UE1 A;  1KQS A;  1TWH H;  4JI0 L;  3CCM A;  1LTL A;  4X66 L;  3U4V A;  1EYG A;  1HR0 L;  1HR0 W;  4JI3 Q;  3I55 A;  4DR5 L;  3S2D H;  4DR4 L;  3JC6 6;  2B63 H;  2XGT A;  4YHH Q;  4DV3 Q;  4JG2 A;  3HOY G;  2KHJ A;  5GAD C;  4B3R Q;  4A93 G;  1CKM A;  1C0A A;  4DV4 Q;  3RLN A;  4IO9 A;  5JJI A;  5IYB H;  2JJQ A;  2Z6K A;  1B70 B;  2E2I H;  2JA6 G;  3J7A 5;  4JYA Q;  1K8A C;  4JBW A;  3M4Q A;  1AE3 A;  2B3G A;  3CCJ A;  2ATW A;  2EIF A;  3NEN A;  2WP8 J;  5C0X G;  1PFS A;  1HNZ L;  1VQ6 A;  2ID0 A;  3PUY A;  1RIP A;  1HNX Q;  2ASB A;  3AFQ A;  5EAY A;  3HOY H;  2K50 A;  4JI0 Q;  5JJL A;  1Q86 C;  4X65 L;  2K5H A;  3Q8D A;  4L5Q A;  4OWX B;  1HR0 Q;  3PO3 G;  2HIV A;  4R4O A;  3TEH B;  4OWT B;  4BY1 G;  3CCR A;  1VQA A;  3CCV A;  1QZH A;  4DR4 Q;  3CC7 A;  3BU2 A;  1KC8 C;  2NVY H;  1PYS B;  2JA7 G;  2VS1 A;  2VQF L;  3CD6 A;  5IT9 c;  1X3F A;  1NTG A;  2KEN A;  1IXR A;  2I5H A;  2Z6K C;  4AQY L;  4IOC A;  3GTM H;  4BBS G;  3TRE A;  3J81 c;  5JEA G;  4BA2 I;  2Z0S A;  1Y14 B;  2A1A A;  3CAM A;  1PHJ A;  1N33 L;  3RNU A;  1MIU A;  1EFW A;  1YNX A;  2BA1 A;  5HGQ A;  5M5W H;  1SE8 A;  2IY5 B;  1Q1E A;  2D0O A;  2RHQ B;  1OXU A;  2E2H H;  2Q2U A;  5C4J H;  1CUK A;  1FL0 A;  2KHI A;  1YIJ A;  1Y1V G;  5C4X H;  1VQ5 A;  4MNO A;  2YTV A;  4DUZ Q;  3F8T A;  1X54 A;  3S15 H;  4HJ8 A;  2VQF Q;  4DR7 L;  4LWC A;  3BJU A;  2R7Z G;  2JA5 H;  3OYY A;  2ES2 A;  2NVQ H;  3MEF A;  1G51 A;  1VQG A;  4PMW A;  3CC4 A;  2JQO A;  2PMZ E;  2F4V L;  1Z47 A;  3ZJY C;  1MJC A;  2KBN A;  3M3Y H;  1VQK A;  4A3C G;  2VQE L;  1HZA A;  1KRT A;  1N33 Q;  5IP9 G;  2L15 A;  1N32 L;  5GAH C;  4P71 A;  2PNH A;  4A75 A;  1WCM H;  4OWW B;  3ICE A;  2VW9 A;  1HZ9 A;  2N78 A;  4JI1 L;  4Y7N H;  3CCS A;  1ASZ A;  1OTC A;  2UUA L;  3S16 H;  3I4M H;  1YHB A;  5GRO A;  1IL2 A;  4YWL A;  3PO3 H;  2BA0 A;  1E3P A;  4O2D A;  3STB C;  3PIP A;  4A93 H;  4JI6 L;  4BY1 H;  4NXM Q;  3UE0 A;  3J81 i;  2ZJQ A;  4OO1 G;  3AEV A;  1I50 H;  3PUZ A;  5IYC G;  3BZK A;  2CWA A;  3UDX A;  2WAQ E;  4GLX A;  4A3E G;  3J80 c;  1PH9 A;  5IP7 H;  4IPH A;  2JA7 H;  4OXP A;  2F4V Q;  1VQC A;  3GTJ H;  4GNX B;  3H3V H;  4BBS H;  2VQE Q;  4DV5 Q;  4LUV A;  3OTO L;  3TRZ A;  4YWM A;  4DV0 Q;  1PH1 A;  1JE5 A;  1SN8 A;  2RHS B;  3FHW A;  1VQF A;  2WB1 E;  1UE6 A;  4AYB G;  4JI1 Q;  4GLV B;  4A3J G;  5AJ3 L;  4MTN A;  1FGU A;  3KYH C;  3PF4 A;  1EUJ A;  1HJP A;  1KIX A;  4DR3 L;  4IPG A;  2R93 H;  2AWO A;  3U50 C;  4PZ6 A;  1N36 Q;  4LNQ A;  2JA8 H;  1VQ7 A;  3FKI H;  3G4S A;  1XMO L;  3L0O A;  4DR1 Q;  4WJ3 M;  1PYB A;  4JI7 L;  1N8R C;  4LF9 L;  3HFZ B;  4A3C H;  1T9H A;  4LUZ A;  5IP9 H;  4A3F G;  1Q82 C;  3LGJ A;  4GKJ Q;  1KXL A;  1VQB A;  3J81 j;  4DR2 Q;  4DR6 L;  4XIG S;  4L5S A;  3ERS X;  4LF5 L;  3CCU A;  5AJ3 Q;  3G6E A;  2EXD A;  1EIY B;  4GNX A;  4DAY B;  3KJP A;  1C7Y A;  1I5F A;  3PO2 G;  3J80 i;  4POG A;  4DR3 Q;  1XMQ Q;  2ZTC A;  4YHH L;  1YJ9 A;  4B3R L;  2B29 A;  3GTP H;  3A0J A;  1XMO Q;  1EQQ A;  2R92 G;  5IYC H;  4YWK A;  4A3E H;  4JYA L;  2OWO A;  1WJJ A;  4JI7 Q;  1J5E L;  4LF9 Q;  2D0P A;  4A4I A;  2K5V A;  1Q81 C;  2JA9 A;  4P72 A;  1Z9F A;  3NEL A;  2EQS A;  2Y0S G;  4DR6 Q;  3HOW G;  3EBE A;  4LF5 Q;  1LYL A;  1P8L A;  3PUW A;  2YU9 H;  4GNX C;  4A3L G;  1CKN B;  1GD7 A;  4DK6 C;  4NXN L;  3TS2 A;  1V1Q A;  4A3D G;  3E0E A;  3E9H A;  1XPR A;  4HJ9 A;  3HKZ G;  4A3I G;  3I56 A;  4JCV E;  1R9T H;  1NY4 A;  2MNA A;  2JEA I;  4AH6 A;  2UXB L;  1V43 A;  3CPW A;  2VZA A;  3PSI A;  1IBK L;  1QZG A;  1J5E Q;  1NJI C;  1PVO A;  1GKH A;  3S24 A;  2RF4 A;  2ALY B;  2E5L Q;  2JE6 I;  1L1O B;  1VS0 A;  1VQM A;  1QUQ B;  4K0K L;  1KRS A;  5FLM G;  1RL2 A;  3KOJ A;  4LFC L;  2IX0 A;  1A62 A;  1W2B A;  4C3J H;  2OQ0 A;  4YCU A;  4C3I H;  2KCM A;  1N9W A;  1A0I A;  4NXN Q;  3KJO A;  2BH2 A;  4DUZ L;  3PO2 H;  3U58 A;  2ZTD A;  3T1H L;  1IBL L;  4LW1 A;  4LFB L;  2WFW A;  3PIO A;  2UXB Q;  3HOV H;  4JI8 L;  2VNU D;  4B3T L;  1WYD A;  1EOV A;  1PV4 A;  1B8A A;  3CPF A;  5J3B A;  4JI4 L;  1IBK Q;  4BY7 G;  1CKN A;  2R92 H;  4H02 A;  4A3M G;  5M3M H;  2MO0 A;  4R4I A;  1Y1W G;  4K0K Q;  2I5M X;  3SGI A;  4GN5 A;  3W5O A;  2E2J H;  2K52 A;  4LFC Q;  4QY7 A;  1A8V A;  1Q8K A;  1XTD A;  3UDF A;  3PF5 A;  1S72 A;  2NVT H;  3HOW H;  3GTG H;  5BR8 L;  3JAM c;  3CCQ A;  1L0W A;  1YBY A;  3F2C A;  3CF5 A;  1UE7 A;  1X9N A;  4LF4 L;  3ULL A;  4A3L H;  3KDF B;  4DV7 L;  1PH2 A;  3T1H Q;  1GVP A;  1IBL Q;  1QUQ A;  4NXM L;  3GD7 A;  5GAG C;  2I0Q A;  4B3M L;  2NN6 G;  3HOU G;  4LFB Q;  1G29 1;  3CMA A;  1VQO A;  4JI8 Q;  4B3T Q;  3HKS A;  4DUY Q;  4IPD A;  1YHQ A;  1BKB A;  5IYD G;  1TWA H;  4RG1 A;  1S40 A;  1PH8 A;  5ELN A;  2Q2T A;  4JI4 Q;  4PG3 A;  4IFD J;  1K0R A;  2JA6 H;  2F52 A;  4DV5 L;  4L5T A;  4JI2 L;  4KI0 A;  4DV0 L;  2ZM6 Q;  4UP9 A;  2CFM A;  3L7Z C;  3M7N A;  1IBM Q;  3PUX A;  4LF6 L;  5FJ8 G;  5FLM H;  5IWA Q;  1Q46 A;  1WOC A;  2IX1 A;  2FXQ A;  5BR8 Q;  4DV6 L;  4RMF A;  3T1Y L;  1FJG L;  1H95 A;  3WWV A;  4JOI A;  4LF4 Q;  3EN2 A;  2VUM G;  4DV7 Q;  2R7D A;  1O7I A;  1N34 Q;  4ME3 A;  1PH6 A;  4B3M Q;  1N36 L;  1E22 A;  3UDG A;  3HOZ G;  2IHE A;  2YV5 A;  1XPO A;  2F3I A;  2YTY A;  4DR1 L;  3RN2 A;  1X65 A;  2OTJ A;  3M9B A;  4JI2 Q;  3PGZ A;  1XNQ Q;  4OX9 L;  3KDF A;  1UE5 A;  4A3M H;  2AKW B;  4A3K G;  1ASY A;  4GKJ L;  1Y1W H;  2H5X A;  2N3S A;  2GVA A;  4DR2 L;  4AYB E;  4IPC A;  3VDY A;  1NBW A;  1GM5 A;  4LF6 Q;  2I5L X;  1S3O A;  4P75 A;  5M5Y H;  2HHH L;  4EX5 A;  3K7U C;  1JJC B;  3EIV A;  4C3H H;  4DV6 Q;  4JC0 A;  4LUO A;  3T1Y Q;  1I94 L;  1TWG H;  1BBU A;  2PI2 E;  4J15 A;  4JOI C;  1FJG Q;  1Y1V H;  3J7Z C;  1XMQ L;  2MO1 A;  4LF8 L;  1GO3 E;  2WAQ G;  3ER0 A;  3K81 C;  1MJE A;  2UUB L;  4KHP L;  4WJ4 A;  1XPU A;  1JB7 A;  1BVS A;  3CC2 A;  4HJ7 A;  4A3B G;  1Q7Y C;  3ULP A;  3M4P A;  4NPS A;  2AHO B;  3GO5 A;  1VQJ A;  4OX9 Q;  1X3G A;  1LUZ A;  5C0X I;  3GTQ H;  1CSP A;  2WB1 G;  3CQZ H;  1E1T A;  2RCN A;  3CME A;  5H1S E;  1M90 C;  1OXV A;  1JMC A;  1MKH A;  2GVB A;  2HHH Q;  2R7Z H;  2C35 B;  1PA6 A;  2CQO A;  2JK8 A;  4DV1 L;  3D31 A;  5FJ8 H;  3M85 A;  2Q2H A;  1VQP A;  3K80 C;  4GN4 B;  1I94 Q;  1PH5 A;  1AH9 A;  1IZ6 A;  2B63 G;  2K5N A;  4C2M H;  1D8L A;  3AYH B;  2NVX H;  2UXC L;  4LF8 Q;  4KHP Q;  2UUB Q;  5IY0 A;  2UUC Q;  2CWP A;  3H3V I;  1Q12 A;  2LSS A;  3TS0 A;  1JJG A;  1TXY A;  4B3S L;  3DLL A;  4JBK A;  1NMG A;  3M4O H;  4DAM A;  1I3Q H;  2E5L L;  5E7N A;  4X62 Q;  1VQD A;  4A3K H;  2K75 A;  2PQA B;  2Y0S E;  1YEZ A;  5C3E G;  5C44 G;  2A19 A;  2CKZ B;  2MQH A;  2QEX A;  3A5Z B;  4LFA L;  5GAE C;  4DV1 Q;  4DV2 Q;  3TQY A;  1QVF A;  5K36 G;  4IJH A;  3KF6 B;  4A3J H;  4GKK Q;  4IFD I;  1TWC H;  3HOX G;  1NE3 A;  3DM3 A;  4MZ9 A;  4A76 A;  1SLJ A;  3U4Z A;  3W1B A;  3UDI A;  2HT1 A;  2UXC Q;  3HKZ E;  4TVA B;  2IT1 A;  1A63 A;  2OTL A;  1VQI A;  1B7Y B;  2YTX A;  1EQR A;  4UY8 C;  3I7F A;  4B3S Q;  1FVI A;  2XTI A;  3D0F A;  4IOA A;  3KF8 B;  1C9O A;  4GN3 B;  4TQU S;  2UXD L;  4HID A;  4A3F H;  3AFP A;  1EWI A;  4R4C A;  4HIK A;  4GOP B;  1VQ4 A;  1OXS C;  1E24 A;  4LF7 L;  3H0G G;  3I2Z A;  4LFA Q;  5C4X G;  3PV0 A;  3GTO H;  3A5U A;  1VQE A;  5C0X J;  2JA5 G;  4DPG A;  2BH8 A;  4OO1 I;  2PQA A;  4DUY L;  1K73 C;  4A3G G;  4R4T A;  2E8G A;  3E9I A;  3KF6 A;  4DKA C;  5LMU Q;  1PH3 A;  3RZD H;  4PZ7 A;  4Y52 H;  4UPA A;  1WCM G;  2ZM6 L;  1CSQ A;  1UE1 A;  1KL9 A;  2UXD Q;  4GLA C;  2JEB I;  3I4M G;  3MXN B;  1IBM L;  2YYZ A;  1QVC A;  1KD1 C;  4LF7 Q;  5IWA L;  1KHI A;  3F1Z A;  2QGQ A;  1J6Q A;  4YCW A;  4X66 Q;  1X3E A;  5C3E H;  5C44 H;  5JEA J;  3RN5 A;  4PZ8 A;  3NBH B;  4IJL A;  5ELO A;  4DR5 Q;  3K0X A;  2PI2 A;  2Q2I A;  5GQO A;  4O0A A;  1L1O A;  3RR5 A;  3HOX H;  3I4O A;  4ALP A;  1N34 L;  1I6H H;  4A3D H;  1YHA A;  2R6G A;  5IP7 G;  1P16 A;  3PCO B;  2AWN A;  3CCE A;  1HNW L;  4A3I H;  2HQL A;  3GDE A;  4GOP A;  2DUD A;  3B6Y A;  4BBR G;  4KLK A;  3KLW A;  1K9M C;  4R4Q A;  1XNQ L;  1HNZ Q;  2UU9 L;  3S17 H;  4R1J A;  2KCT A;  1HH2 P;  3NEM A; 
#chains in the Genus database with same CATH topology
 1SRU A;  1EYA A;  4FF1 A;  4UP8 A;  1FYC A;  5EBD A;  1A2T A;  2BOS A;  5ELE A;  5FLX c;  4IFD G;  3P7J A;  3H0G H;  1YJW A;  3K8A A;  5G3L F;  2JA8 G;  3J80 L;  3FKI G;  3MXN A;  1HNW Q;  2OF1 A;  1EY4 A;  4AQY Q;  1CTM A;  4A3G H;  1JJ2 A;  4QUF A;  4BY7 H;  2QA4 A;  2NZO A;  1JC7 A;  4RH6 A;  1CT1 D;  4UDU C;  1PRT B;  5EGT A;  1M4V A;  4X64 Q;  1IYJ B;  3SEB A;  2FFK B;  1NMF A;  1XTC D;  4FDB A;  5JJK A;  2VL6 A;  1ET6 A;  1SRO A;  4JBJ A;  2A8V A;  2UUC L;  3HOU H;  1FNW A;  5M3F G;  1D5Z C;  4C3H B;  2NZH A;  5LL6 X;  3GTL H;  1O80 A;  4OEM B;  1E2Z A;  1R4Q B;  2OCE A;  2LXK A;  1O7Y A;  4X62 L;  2ZJP A;  1DGS A;  1UEB A;  3T4A C;  3F2B A;  4GKK L;  3NHH A;  4QQB X;  4JI6 Q;  3STB D;  1V1O A;  2VUM H;  3NPP A;  2C9O A;  2CCZ A;  1F2L A;  2GN5 A;  1X56 A;  3S2H H;  2R7Z B;  2ZJR A;  3R8B A;  4F8M A;  1C8C A;  1HUN A;  4C2M B;  2NVX B;  1MI2 A;  1WTO A;  5LMN L;  4C3I G;  1VMC A;  2PZT A;  4HIO A;  1SE4 A;  3HOV G;  1JB3 A;  5K5P A;  2NN6 I;  4CJ2 C;  4YCV A;  4DV4 L;  4P74 A;  3KUP A;  3F2D A;  4NB3 A;  2NBF A;  4POF A;  1TWC B;  2D62 A;  3A7A B;  3FP9 A;  3E5S A;  3HS0 C;  4C1N I;  4JI0 L;  2PQE A;  1HR0 L;  4JI3 Q;  5IT9 L;  4DR4 L;  2CH4 A;  5L37 A;  3JC6 6;  2B63 H;  4YHH Q;  1H9K A;  1S5B D;  2AQ1 B;  4QIW B;  5IYB H;  5CYU A;  3TME A;  1TKW B;  4JBW A;  2XNA C;  4QF4 A;  2EIF A;  2OEO A;  1HNZ L;  4IN3 A;  2D5D A;  1JCK B;  1A3T A;  1SEB D;  3K0Y A;  5D65 A;  3TEH B;  3CCV A;  3GQB A;  2VS1 A;  5IT9 c;  1X3F A;  1NTG A;  5DNF A;  5NUC A;  4HCE A;  5JEA G;  2EYJ A;  2A1A A;  3NP8 A;  4WFN 3;  2QDB A;  1N33 L;  2Z9H A;  3TSS A;  1YNX A;  5C6A A;  5HGQ A;  4DAV A;  3HOX B;  1OXU A;  3H94 A;  1JWM D;  3R93 A;  4DGZ A;  2PPB C;  1JOR A;  1SDF A;  4UHV A;  3F8T A;  3BJU A;  4H13 C;  3NTH A;  2ES2 A;  1S5D D;  4KKT A;  2JA5 H;  3CC4 A;  2PMZ E;  2F4V L;  3M3Y H;  4A3C G;  1N32 L;  5IP9 G;  1EYC A;  1D5X C;  1WCM H;  5C0X H;  2R7Z G;  3S16 H;  1HZ9 A;  1TWF B;  4JI1 L;  2UUA L;  2EE1 A;  2IL8 A;  5EKK A;  3Q24 A;  4YWL A;  3PO3 H;  1BCP D;  2SNS A;  4O2D A;  3TZD A;  3PIP A;  2K05 A;  4N8X 1;  3UE0 A;  3VR3 A;  5A35 A;  3AEV A;  1WTP A;  1I50 H;  5IYC G;  4A3E G;  2CWA A;  4GLX A;  1PH9 A;  1MBY A;  1V1P A;  3ND8 A;  5CV6 A;  3H3V H;  4BBS H;  4DV5 Q;  1H9M A;  3TRZ A;  1X3Q A;  4YWM A;  4HR7 B;  1PH1 A;  1JE5 A;  4AYB G;  1UE6 A;  2NWG A;  3F2U A;  1J8I A;  3A8J E;  4X3S A;  4E6I A;  5AJ3 L;  1XX8 A;  3PF4 A;  4I65 A;  1TU2 B;  4DR3 L;  5M5X B;  3T56 B;  1QIL A;  4PZ6 A;  4LNQ A;  2JA8 H;  2WIN B;  3FKI H;  3G4S A;  1XMO L;  2ENB A;  3RD4 A;  3GTK B;  1PYB A;  4JI7 L;  4ID6 A;  3HFZ B;  1Q82 C;  1I4G A;  1KXL A;  4DR6 L;  1HTL D;  2F0D A;  4O1N A;  1SYD A;  2EXD A;  1M8A A;  3CRK C;  1C7Y A;  2L0C A;  3D4R A;  4FXG C;  1YJ9 A;  4KKS A;  4OIK A;  4OO1 H;  1E2W A;  2F0N A;  1Y8P B;  4CKB A;  3S1N B;  3ND9 A;  2BCO A;  4LF9 Q;  1BCP B;  4ABN A;  2D0P A;  1BOS A;  3G6J B;  3NEL A;  2EQS A;  2B2V C;  4RA8 A;  1LYL A;  2QF7 A;  1P8L A;  4A3L G;  2YU9 H;  1CKN B;  4DK0 A;  3TN2 A;  3DMU A;  2B39 A;  3E0E A;  1PTO D;  2UXB L;  1TWH B;  2WB1 B;  3J7A V;  3OIP A;  3PSI A;  1QZG A;  1WD0 A;  2B2W A;  3TBI B;  4K0K L;  2JE6 I;  1QJO A;  1QUQ B;  1HA5 A;  5FLM G;  1CZG A;  4LFC L;  1W2B A;  2DY8 A;  4C3I H;  2WKD A;  4M1U B;  4NXN Q;  1GUN A;  2LKV A;  3U58 A;  3PO2 H;  1EQV A;  3OWE B;  1WTV A;  1SE3 A;  2B2Y A;  3HOV H;  4JI8 L;  4B3T L;  5J1Z A;  1PV4 A;  2EDG A;  5JOB A;  3S9W A;  4RHS A;  5IGC A;  4H02 A;  4A3M G;  2I5M X;  2NVY B;  1AZP A;  2A6E C;  5COR A;  1I6H B;  4GN5 A;  3W5O A;  2E2J H;  1A8V A;  1DOK A;  4KK7 A;  3UDF A;  3W2D A;  1EWC A;  2HCC A;  3CCQ A;  1L0W A;  1UE7 A;  4HN7 A;  1YNN C;  1IBL Q;  3GD7 A;  5GAG C;  3CMA A;  3HKS A;  4DUY Q;  1BKB A;  5C4X B;  3H0G B;  4KY6 A;  4JI2 L;  4KI0 A;  2ZM6 Q;  3S15 B;  1PTO B;  2CFM A;  2V4D A;  1IBM Q;  2CW0 D;  1SXT A;  3FDT A;  5BR8 Q;  3CKI B;  3T1Y L;  1H95 A;  1FJG L;  4ME5 A;  3WWV A;  1CZW A;  4DV7 Q;  4Y7N B;  3I4M B;  1STH A;  2PNR C;  2F3I A;  1CHQ D;  2NTT A;  2YTY A;  3SVM A;  1XNQ Q;  4CKC A;  4GKJ L;  2N3S A;  2JA7 B;  4IPC A;  2I5L X;  3GTJ B;  2SNM A;  4C3H H;  1G2T A;  4LUO A;  4OIJ A;  4JOI C;  1ICW A;  1XMQ L;  3NQI A;  3J81 E;  1RDP D;  5JJZ A;  3C2P A;  1BVS A;  5KGU A;  1TVX A;  4KD4 A;  3T16 A;  4NPS A;  4OX9 Q;  1X3G A;  1CSP A;  2WB1 G;  3SK5 A;  3S2H B;  5H1S E;  1OXV A;  5FLX E;  4DXF A;  1MKH A;  4DN4 M;  2HHH Q;  2R7Z H;  4P2C B;  2CQO A;  2JK8 A;  3M85 A;  3K80 C;  3IAY A;  4L6T B;  4C2M H;  1PDQ A;  3AYH B;  2UXC L;  2NVX H;  1PYW D;  4FP5 D;  1SNO A;  2CWP A;  2LSS A;  2CHB D;  1TXY A;  3BYT B;  2F0M A;  1RTN A;  4DAM A;  1TR5 A;  1I3Q H;  1I4P A;  1RD9 D;  2RKS A;  2KEC A;  3MVV A;  2C5C A;  1KAB A;  3GTP B;  2HDM A;  1YEZ A;  2A19 A;  5GAE C;  2EY1 A;  5K36 G;  3KF6 B;  1TWC H;  3X3M A;  3U4Z A;  4TRD A;  3UDI A;  1SJH D;  3J80 E;  4TVA B;  1JE4 A;  4JVZ A;  1GHK A;  1PZI D;  3QO2 A;  2OTL A;  1ILQ A;  1G8Z D;  4B3S Q;  4JPB W;  4IOA A;  4HID A;  1FD7 D;  1STY A;  3OWF A;  4HIK A;  4GOP B;  5C4X G;  3H0G G;  3I2Z A;  3MTS A;  4LFA Q;  2L9H A;  1EY7 A;  3PV0 A;  5EQ0 A;  3A5U A;  3SDZ A;  2IWH A;  1I4H A;  5C0X J;  5CV5 A;  4DPG A;  3MFY A;  2PW7 A;  4A3G G;  3E9I A;  4PZ7 A;  4Y52 H;  2J4X A;  1KL9 A;  2B2T C;  4WRD A;  2UXD Q;  1ENC A;  3I4M G;  2NUC A;  4R8I A;  1KHI A;  5KEE A;  3TS2 A;  2R92 B;  5C3E H;  3DEO A;  1SAP A;  3RN5 A;  3KLS X;  4DR5 Q;  5ELO A;  3K0X A;  2EY6 A;  5GQO A;  4O0A A;  1L1O A;  3HOX H;  4DFA A;  5IP7 G;  1HNW L;  1QCB D;  2Y0S B;  3TP5 A;  4FXD A;  5CBE E;  4EQO A;  4R4Q A;  4EGV A;  1HH2 P;  3NEM A;  3HKZ B;  3RLO A;  4K5X A;  2DNC A;  5IIF A;  2ZTE A;  4X64 L;  1U4R A;  1BBW A;  4NKL A;  1YZ6 A;  4HED A;  1SYF A;  3OPO A;  1ZXT A;  1A3V A;  1JT8 A;  1K8M A;  4FF4 A;  1TWF H;  3PO3 B;  3K6O A;  2PO4 A;  3CP0 A;  3GP7 A;  1Z6H A;  1VF7 A;  1Q8I A;  3JAM i;  5BN3 A;  3K5M A;  1FNV A;  3KLR A;  2XIW A;  1QVG A;  1CA6 A;  4MIU A;  4BBS B;  1HZC A;  1WTW A;  1K83 H;  1DON A;  1WFQ A;  2JYO A;  2K4K A;  1VCI A;  2Q8I B;  5IT9 E;  4L5R C;  1A2U A;  1XNR Q;  4KJO A;  1EY5 A;  1UWV A;  1EIF A;  3SR1 A;  4HIM A;  2F0K A;  2X6G A;  4RWS C;  3R3O A;  4CDF C;  3V96 A;  4OON A;  4JBM A;  5M5X H;  3AMU A;  4K5W A;  1RCV D;  4YY3 Q;  2MJ8 A;  1VQL A;  1G6P A;  4CDC C;  4DV2 L;  5IGG A;  3GTK H;  1NNX A;  2ZT9 C;  1YI2 A;  5D14 A;  1U4P A;  1GJX A;  5IYB G;  4OEL B;  5EKL A;  2K01 A;  5IGE A;  1YJN A;  1KAW A;  4EQ5 A;  2OQK A;  1RTO A;  2F0U A;  2HIX A;  1SYE A;  4U68 A;  1ZYR D;  1D1K A;  2XRQ D;  5I6W A;  1S5F D;  2KQ3 A;  3G48 A;  2JP1 A;  5LMN W;  5IE8 A;  1W3S A;  3D6W A;  4QJF A;  3S1N H;  3BS1 A;  4JI3 L;  1Y69 U;  4RHR A;  2XVS A;  2EOT A;  3MZ5 A;  4A3K B;  3W1G A;  3NTI A;  1VF5 C;  1U0L A;  3IFT A;  3VR5 A;  1B9N A;  2F3W A;  4BXX H;  3M7G A;  5F2D A;  2LXJ A;  3L2P A;  3ULJ A;  1KTK A;  4QCL A;  5JAV A;  1KDB A;  1EY6 A;  1TWH H;  3M4Y A;  4ZRZ A;  4LK1 C;  1HR0 W;  2X6L A;  1BR9 A;  3SK8 A;  4GZY C;  1BBX C;  1HCZ A;  1D5M C;  2KHJ A;  5GAD C;  1CKM A;  2JJQ A;  5KNB A;  1B70 B;  1SYB A;  3OSO A;  4KKU A;  2ICE C;  3L9A X;  3NEN A;  2WP8 J;  1AEX A;  1PFS A;  5C0X G;  1HNX Q;  3AFQ A;  1MSH A;  5JJL A;  1IW7 D;  4RAU C;  1Q86 C;  2DJG C;  2K5H A;  4OWX B;  4X65 L;  3PO3 G;  4ZUJ A;  3RZD B;  1EY9 A;  3IKJ A;  2NVY H;  5JVG 3;  2E75 C;  2E2J B;  3CD6 A;  3FRP B;  2KEN A;  1IXR A;  3OW7 A;  2I5H A;  4IOC A;  4BBS G;  1G2S A;  3TRE A;  3J81 c;  5JPN C;  2H1E A;  4B9X A;  1PHJ A;  3FVQ A;  3RNU A;  5ELF A;  4IUQ A;  3BYY B;  1SE8 A;  4A3D B;  2D0O A;  1PRT F;  4F88 A;  1TS3 A;  1WTH A;  2Q2U A;  1FL0 A;  3T53 B;  1YIJ A;  5C4X H;  1VQ5 A;  2L1B A;  4DUZ Q;  3S17 B;  3LX0 A;  1X54 A;  3S15 H;  4DR7 L;  1PTO H;  3VYR A;  3MEF A;  1G51 A;  1VQG A;  3HOY H;  3ZJY C;  1ILP A;  2QKI C;  5KRU A;  1KRT A;  3C1F A;  5GAH C;  2PNH A;  4A75 A;  2Q8T A;  1EY0 A;  3RZO B;  1GHJ A;  4OWW B;  2VW9 A;  3CCS A;  2N78 A;  4ZUI A;  4Y7N H;  3ICE A;  1FGB D;  1GUW A;  3I4M H;  1ONL A;  1IL2 A;  3Q0A A;  1E3P A;  2VB2 X;  1IYU A;  2ZXP A;  4NXM Q;  2ZJQ A;  4OO1 G;  3BZK A;  2JA7 H;  3J80 c;  5IP7 H;  2EVB A;  3GTJ H;  2RVL A;  4GNX B;  2F0V A;  2OXP A;  1QG7 A;  3A55 A;  4R9W A;  3OTO L;  4DV0 Q;  2RHS B;  3FHW A;  1VQF A;  1ENF A;  4YIJ A;  4MTN A;  5EJW A;  1FGU A;  3D8G A;  1CK1 A;  1KDC A;  1HJP A;  2EYL A;  4NP5 A;  2RSO A;  2D9U A;  2EYM A;  4G7Z C;  2EXZ A;  1HRJ A;  1AN8 A;  3L0O A;  4DXG A;  4DR1 Q;  4CKE A;  1N8R C;  4LF9 L;  1II3 A;  5DM6 3;  1T9H A;  4LUZ A;  2BE5 C;  1VQB A;  2QW7 A;  3J81 j;  4XIG S;  1F2M A;  2EY2 A;  3G6E A;  2PMZ B;  4FXK C;  3KJP A;  3PO2 G;  1RKN A;  1I3Q B;  3K7A B;  4POG A;  1O7Z A;  4B3R L;  1NR4 A;  3GTP H;  1EQQ A;  5T1I A;  4JYA L;  4YWK A;  2A69 C;  2KED A;  3KLS A;  2DY7 A;  2O2L D;  4A4I A;  3NK9 A;  4DU9 A;  3BG3 A;  1Z9F A;  3OMC A;  1C48 A;  2F0F A;  4HSV A;  3UI2 A;  1B3Q A;  2XWJ B;  4NXN L;  4A3D G;  3E9H A;  1XPR A;  3HGB A;  2JEA I;  3VYU A;  4AH6 A;  3CPW A;  3CRL C;  2QIL A;  3S2D B;  4XDX A;  3DHQ A;  3IL8 A;  3JAM L;  1K8O A;  2K5D A;  2OQ0 A;  3KBX A;  2KCM A;  1MHW C;  3I3C A;  3EVQ A;  4KN7 C;  1IBL L;  4RGT A;  2WFW A;  5D3D A;  2VNU D;  1EU3 A;  4KV6 A;  1T5X D;  2F0J A;  1DCZ A;  4DA2 A;  5C3E B;  1CKN A;  2R92 H;  5IOD A;  2B2W C;  1DXM A;  2XN9 C;  3SGI A;  1Q8K A;  1XTD A;  2F0E A;  4C3H G;  2CVR A;  3GTG H;  5BR8 L;  3JAM c;  3CF5 A;  3ULL A;  3KDF B;  4DV7 L;  1PH2 A;  1GVP A;  3RMH A;  1QUQ A;  4LFB Q;  3J7A F;  2E2H B;  2B2Y C;  1VQO A;  1CA5 A;  4TSS A;  1YHQ A;  5IYD G;  4OHJ A;  1LV9 A;  1GXD C;  4RG1 A;  1PH8 A;  4PG3 A;  3GV3 A;  4UP9 A;  3OIQ A;  3L7Z C;  5FK9 C;  2NVQ B;  4XT1 B;  3PUX A;  1RJT A;  2LMC B;  5IWA Q;  1LTT D;  3MAQ A;  1UEA B;  1WOC A;  3N52 A;  2FXQ A;  3TP6 A;  3PQI A;  1PFM A;  2O5I C;  3QB3 A;  4U67 3;  1N34 Q;  1O7I A;  1PH6 A;  3SHL A;  1N36 L;  1E22 A;  1OO9 B;  2AQ2 B;  1PZJ D;  2PZU A;  1K83 B;  1X65 A;  3PGZ A;  4OX9 L;  5C3W A;  1UE5 A;  1Y1W H;  2GVA A;  4DR2 L;  4AYB E;  2G9D A;  2BDO A;  3W3A A;  3VDY A;  4LF6 Q;  1GM5 A;  2HHH L;  5M5Y H;  2Z4I A;  1JJC B;  4F87 A;  3C1E A;  4J15 A;  1RF2 D;  4G4K A;  1GO3 E;  2DN8 A;  4WJ4 A;  1IHZ A;  2NN6 H;  1JB7 A;  1XPU A;  4H44 C;  3SXH A;  4HJ7 A;  1HFN A;  3ITP A;  2K5W A;  3VR4 A;  3M4P A;  1BCP F;  3E3X A;  4ZKB B;  2AHO B;  1EWH A;  2B2U A;  3AU7 A;  1JWS D;  3CME A;  4FYD A;  1H9R A;  3Q22 A;  1D2B A;  2KCC A;  3D31 A;  5FJ8 H;  1LT6 D;  1PH5 A;  1IZ6 A;  1JQY D;  4XYO A;  2TMP A;  4LF8 Q;  1S4Z A;  4ZCK A;  4OL7 A;  5IY0 A;  2UUC Q;  4K8I A;  2R3Z A;  2WV6 D;  4B3S L;  3DLL A;  2Z4H A;  1NMG A;  4JBK A;  2F3V A;  2E5L L;  3C46 A;  4X62 Q;  2EYO A;  1J9O A;  4A3K H;  5C3E G;  1A3U A;  1HPC A;  2L12 A;  1ZEQ X;  4LFA L;  2SEB D;  4IJH A;  4GKK Q;  3HOX G;  1NE3 A;  2N88 A;  4A76 A;  1SLJ A;  4FO2 A;  5C5L A;  1A63 A;  1B7Y B;  4UY8 C;  5HGT A;  1Z7T A;  4DAY A;  5COY A;  5E4W C;  4IUN A;  2XTI A;  3D6C A;  3D0F A;  4J8Q A;  5I2X A;  5CV7 A;  2UXD L;  1WVL A;  5I9P A;  2AUK A;  1B1Z A;  1VQE A;  1SNP A;  5E3F A;  4C3J B;  4IUV A;  1SYG A;  2A69 D;  3KF6 A;  4KY7 A;  4DKA C;  3RZD H;  5FO9 B;  1IKL A;  1CSQ A;  1G91 A;  4BWG B;  2J0T D;  4GLA C;  4XQN A;  1QVC A;  3BVG A;  1JOQ A;  2QGQ A;  1X3E A;  3HZX A;  3NBH B;  2WKC A;  2PI2 A;  4J6H A;  3I4O A;  1LTS D;  1LTI D;  4A3D H;  1KNE A;  3A56 A;  2AWN A;  4GOP A;  3HOW B;  1U4M A;  5CV9 A;  3KLW A;  4CHT B;  1HNZ Q;  2A6H C;  2FJ2 A;  5FKA C;  3S17 H;  3HOY B;  1I4X A;  4A93 B;  5C3X A;  4EQN A;  1CHP D;  2JA6 B;  2K6A A;  3VA5 A;  2A68 C;  1L1O C;  2DGY A;  4V19 0;  1OXT A;  1XNR L;  2DNE A;  3RZO H;  1FNU A;  1X6O A;  2K14 A;  1S5C D;  4AIM A;  1SMX A;  1VMP A;  2UU9 Q;  4F7X A;  3P75 A;  3CXC A;  2L5T A;  3KFU A;  4S3S A;  4DK3 C;  1A6X A;  4YY3 L;  5DLQ E;  1I4Q A;  3T13 A;  3SK6 A;  5I2Y A;  1HQR D;  3PIO 3;  2EJM A;  1PH7 A;  1KDA A;  3R2T A;  4BXX G;  1F9R A;  2IPK D;  1EEF D;  4RCO A;  1TWG B;  5IYD H;  2JSO A;  1N32 Q;  1F9S A;  3PMF A;  1DYQ A;  4BA1 I;  1D7Q A;  1SR3 A;  4KHZ A;  2MFI A;  4NW2 A;  2UUA Q;  5J22 A;  1I4R A;  1YNJ C;  4HJA A;  4GS3 A;  3PUV A;  3QOL A;  2VXW A;  2AMC B;  2QCP X;  1BXT A;  3CQZ B;  3I4N H;  4JI5 Q;  2M9V A;  3EA6 A;  1BF4 A;  1U5K A;  3K7A H;  5KYL A;  4N9P A;  1LLR D;  2EYH A;  1M1K C;  3BZC A;  4P73 A;  1VQN A;  1IKM A;  5M9O A;  2CH4 W;  2VY3 A;  2KOL A;  3BVM A;  2RQX A;  1SYC A;  1PRT C;  2N49 A;  4JV5 Q;  1VQ9 A;  1NAP A;  5C5M A;  3MHB A;  1LT4 D;  2R7F A;  1LM0 A;  4JW0 A;  4A3J B;  1GUO A;  5LMU L;  1L2F A;  1W6K A;  1V9P A;  1X3P A;  1HNX L;  3QIA A;  1KQS A;  3UE1 A;  3VYT A;  1LTL A;  4X66 L;  5JVH 3;  1PFN A;  2PZW A;  3CU7 A;  5IGB A;  3S2D H;  2F1M A;  2RDF A;  2XGT A;  3LNN A;  5CV4 A;  1TY2 A;  4JG2 A;  5CMD A;  4DV3 Q;  4A3F B;  3HOY G;  4A93 G;  1F9Q A;  5JJI A;  2E2I H;  2Z6K A;  2JA6 G;  1K8A C;  2A5H A;  3MC0 B;  2B3G A;  1GUT A;  1VQ6 A;  2XSC A;  3PUY A;  4UAI A;  2K50 A;  4LMQ D;  2AQ3 B;  3Q23 A;  1STB A;  1SND A;  3RUZ A;  1I6V C;  2HIV A;  4R4O A;  3CCR A;  1QZH A;  1LAC A;  1VQA A;  3CC7 A;  1KC8 C;  2JA7 G;  2FHT A;  3FPP A;  2D2C C;  4AQY L;  5C44 B;  3GTG B;  2JN4 A;  3CAM A;  2F0T A;  2PYK A;  1TT2 A;  1CQV A;  1EFW A;  2BA1 A;  2IY5 B;  1SBB B;  4B9W A;  4BS9 A;  4A3I B;  2RHQ B;  2E2H H;  4LAA A;  1LT3 D;  2KCN A;  1DOM A;  1JR0 D;  4RGO S;  4MNO A;  1B53 A;  3TZU A;  2VQF Q;  3H09 A;  1BUV T;  3DEP A;  2NVQ H;  4PMW A;  2JQO A;  1Z47 A;  2KBN A;  1FR3 A;  2BDN A;  1VQK A;  3NUC A;  3Q6S A;  3A54 A;  3K58 A;  4P71 A;  1HHV A;  2EPB A;  1SJE D;  2A6E D;  3QR8 A;  4IQZ A;  3STB C;  3HEJ A;  4JI6 L;  4BY1 H;  4HAE A;  3DWQ A;  1Y1W B;  1YNN D;  4XT3 B;  2WAQ E;  5M5Y B;  4IPH A;  4H7B A;  4OXP A;  1V8Q A;  1VQC A;  3HP3 A;  2HD3 A;  2VQE Q;  4LUV A;  2OT2 A;  2GA4 B;  4HMI A;  5T1G A;  2H4O A;  1BQQ T;  3JAM E;  4A3J G;  3S1M B;  1EUJ A;  3S1Q B;  4RGN A;  2X69 A;  2O5J C;  1KIX A;  4IPG A;  4EQP A;  3NWT A;  1ET9 A;  4LJZ C;  1VQ7 A;  2VB3 X;  1QOH A;  4FF2 A;  4OGQ C;  1STG A;  3SE0 A;  4WJ3 M;  3C3L A;  4A3F G;  4JK1 C;  4KTA A;  4GKJ Q;  1HFG A;  2K04 A;  3I72 A;  4PMB A;  1K28 A;  4L5S A;  3ERS X;  3K57 A;  2K33 A;  3CCU A;  1MSG A;  3HOZ B;  4NMZ A;  3WDN A;  4CBV A;  1EIY B;  4GNX A;  1B4O A;  5KND A;  1STN A;  1XMQ Q;  2ZTC A;  4YHH L;  1EY8 A;  2B29 A;  3A0J A;  2R92 G;  2EYP A;  2NB0 A;  2OWO A;  1WJJ A;  5EBC A;  1EZ8 A;  1LTA D;  4Z9C B;  2QDL A;  2K5V A;  3BVZ A;  1O78 A;  2Y0S G;  5CR3 A;  2F0W A;  5FO7 B;  1UAP A;  4LF5 Q;  2LFN A;  1F2Y A;  4DK1 A;  3NBI A;  1HUM A;  5M3F B;  5ELD A;  4A3B B;  1ML0 D;  1V1Q A;  1EFI D;  2HQE A;  1QNK A;  3HKZ G;  5LHY 1;  4A3I G;  1K3B C;  4JCV E;  2MNA A;  4X3U A;  1JOO A;  2HDL A;  3K5N A;  2VZA A;  1T5E A;  1KAA A;  1J5E Q;  4Q0F A;  1NJI C;  3S24 A;  4X3T A;  2RF4 A;  2ALY B;  1L1O B;  1VS0 A;  1VQM A;  3TP8 A;  1KRS A;  5I6Y A;  1RL2 A;  3KOJ A;  2IX0 A;  1S5E D;  4C3J H;  1AP0 A;  2E74 C;  4KMU C;  2K03 A;  1N9W A;  1A0I A;  2F0H A;  4KN4 C;  2BH2 A;  3DWP A;  1TS2 A;  4LW1 A;  4LFB L;  3PIO A;  2ZXR A;  1WYD A;  2PW5 A;  1B8A A;  3CPF A;  1IBK Q;  2MO0 A;  4R4I A;  3QJY A;  1Y1W G;  3ERO A;  5G3L D;  2ICI A;  2NVT H;  3NWS A;  3PF5 A;  1S72 A;  3GTM B;  3HOW H;  4DAP A;  1DZ1 A;  1B44 D;  1BCP C;  1YBY A;  1Y8O B;  1X9N A;  3T1H Q;  2I0Q A;  2NN6 G;  5KYI A;  1G29 1;  3VR2 A;  4PMC A;  4IPD A;  4A93 H;  2L11 A;  4JI4 Q;  1VDZ A;  4N8F A;  2JA6 H;  4DV5 L;  4L5T A;  1LO5 D;  2FMM A;  1TII D;  3M7N A;  4K5V A;  5DM7 3;  4LF6 L;  5FJ8 G;  1H9S B;  2B8G A;  2IX1 A;  4R8N A;  2L55 A;  4LF4 Q;  3DM1 A;  3EN2 A;  4G7H C;  2R7D A;  4B3M Q;  3HRZ C;  3HOZ G;  2IHE A;  2YV5 A;  1EIH A;  2E2D C;  3I8Z A;  3M9B A;  1WD1 A;  3KDF A;  4XYQ A;  2PCF B;  4A3K G;  1ASY A;  1QE6 A;  3TDQ A;  2IX3 A;  1F77 A;  1S3O A;  4EX5 A;  3K7U C;  3EIV A;  4DV6 Q;  4JC0 A;  5CBA E;  1TWG H;  2RCF A;  1PMR A;  2B8F A;  4H0L C;  5ELB A;  2Z1C A;  5ELC A;  2MO1 A;  4LF8 L;  1CI3 M;  3K81 C;  3MWY W;  4K8J A;  3CC2 A;  1HQM C;  1HTP A;  3FPU B;  3I4L A;  4A3B G;  2R61 A;  1Q7Y C;  3GO5 A;  1VQJ A;  1BNZ A;  2R93 B;  2F4I A;  5C0X I;  1SNQ A;  3CQZ H;  1JMC A;  3I4N B;  5CGK A;  1DOL A;  2GVB A;  2C35 B;  1PA6 A;  4IUT A;  2TSS A;  5I4D A;  1I94 Q;  4GN4 B;  1A15 A;  1DJR D;  3GV6 A;  1PTO C;  1D8L A;  4DF7 A;  1GUG A;  5CC4 A;  4J1M A;  4KHP Q;  2UUB Q;  1TS5 A;  4RCN A;  3J7Y W;  3H3V I;  1E0B A;  4MTK A;  1JJG A;  3NE5 B;  3U9S A;  1L0X B;  4MN3 A;  2B2U C;  1SSO A;  4NDX A;  1VQD A;  2PQA B;  2ZXO A;  4A3E B;  2MQH A;  4DV1 Q;  4DV2 Q;  3TQY A;  1QVF A;  4A3J H;  4IFD I;  1PXU A;  4RFB A;  3DM3 A;  2LS0 1;  3W1B A;  1NCV A;  2IT1 A;  4I7A A;  4AYB B;  2YTX A;  1EQR A;  3VYS A;  3I7F A;  3WOE A;  1AW7 A;  2F0P A;  3KF8 B;  4GN3 B;  1R9T B;  4TQU S;  4CDE C;  2F03 A;  5C4H A;  4A3F H;  1EWI A;  2E2I B;  4R4C A;  1VQ4 A;  1OXS C;  1E24 A;  5A2Q L;  3GTO H;  5I9O A;  2F0S A;  1D1I A;  3MA2 B;  4OO1 I;  2EJG C;  4DUY L;  4R4T A;  5DEH A;  4ILW A;  1ZKO A;  2KJX A;  2K7V A;  4UPA A;  3IFD A;  1GUS A;  4KY5 A;  1PLF A;  2RBM A;  3T51 B;  2ZM6 L;  4IZ8 A;  3FMC A;  2JEB I;  2CW0 C;  3MXN B;  1IBM L;  2YYZ A;  1KD1 C;  4LF7 Q;  2EYF A;  4YCW A;  5C44 H;  2JXM B;  4PZ8 A;  5M3M B;  3BDC A;  1BDO A;  3K5L A;  3I73 A;  2M2L A;  4KJN A;  4EVO A;  3RR5 A;  4MHE A;  2R6G A;  1QWY A;  3PCO B;  1Q90 A;  3U9O A;  4A3I H;  2HQL A;  4C56 C;  3GDE A;  2AUJ D;  4KLK A;  1EQT A;  5IOC A;  1K9M C;  1XNQ L;  2UU9 L;  4R1J A;  5KNC A;  1RHP A;  4RKL A;  1Q1B A;  1D6E C;  1TWA B;  1TQO A;  1AE2 A;  4X65 Q;  1YIT A;  2R93 G;  3H15 A;  3I4N G;  4QB4 A;  1DM0 B;  2N55 A;  3MXG A;  4UP7 A;  4GOP C;  1E1O A;  5HY6 A;  3RLF A;  4X6A H;  2WAC A;  3OW2 A;  2FMC A;  3NBH A;  3CCL A;  1CKO A;  4BY1 B;  1EL0 A;  2P5Z X;  1VQH A;  2IW3 A;  1VQ8 A;  1X32 A;  4N9T A;  3S14 H;  3I90 A;  3I70 A;  4APV A;  4HJ5 A;  3NSW A;  5LL6 S;  1K0S A;  2F0L A;  4XTC S;  4ZLT F;  1K3R A;  4A3M B;  4KD3 A;  4DR7 Q;  4HTH A;  2IHF A;  4QL5 A;  1AZQ A;  3VA7 A;  1X55 A;  1IYV A;  4JI5 L;  4IUR A;  4ZK9 B;  3S1M H;  3ONA B;  1NR2 A;  3KK7 A;  1Y1V B;  4BBR H;  3S1Q H;  2MHV A;  1YVC A;  1SE2 A;  1WI5 A;  4WOR A;  4QIW E;  4ZQ3 A;  4DNI A;  2NZ1 D;  1ESR A;  3G71 A;  3CW2 C;  4IFD H;  3GTQ B;  2CQA A;  1WTR A;  4JV5 L;  4I7Z C;  3QOJ A;  2I07 B;  2RDG A;  3HOZ H;  3DWA A;  1HZB A;  1Q3L A;  1SNC A;  5KIX A;  3OTO Q;  2RDH A;  5TSS A;  3A74 A;  5EPJ A;  2V1C C;  3AQQ A;  2A74 C;  1ENA A;  1PH4 A;  3S1R H;  1U4L A;  1XJV A;  3M4O B;  1K8G A;  4QGU A;  1MD2 D;  4CDD C;  1E7Z A;  2N8N A;  4DV3 L;  2F0O A;  1G6Z A;  1OXX K;  2K5Q A;  3H3V C;  5M3M G;  5M3F H;  1GOZ A;  4A3B H;  4ZKC B;  2BE5 D;  3IRB A;  5LMN Q;  1SFO H;  3ZYY X;  3CCM A;  4M8A A;  1EYG A;  3U4V A;  2SDF A;  3V05 A;  3I55 A;  4DR5 L;  2KEE A;  3EJI A;  4B08 A;  2MP1 A;  4B3R Q;  1STE A;  1C0A A;  4DV4 Q;  3RLN A;  4IO9 A;  4JYA Q;  4FVM A;  3J7A 5;  1EOT A;  1HXY D;  1E2V A;  4ZAI A;  3M4Q A;  1AE3 A;  2ATW A;  3CCJ A;  2A73 B;  2SOB A;  1SMY C;  2ID0 A;  1PTO F;  1RIP A;  1F2Z A;  2ASB A;  5EAY A;  1ROD A;  4JI0 Q;  3Q8D A;  4L5Q A;  2KVM A;  1HR0 Q;  4OWT B;  4BY1 G;  5FOB B;  4DR4 Q;  3BU2 A;  1PYS B;  2VQF L;  2DJF C;  2NVT B;  2G5D A;  2Z6K C;  3GTM H;  4XXE A;  1EEI D;  4BA2 I;  2Z0S A;  1Y14 B;  1MIU A;  1R4P B;  2I46 A;  2Z8L A;  3D4W A;  5M5W H;  1Q1E A;  4FF3 A;  5C4J H;  1CUK A;  2KHI A;  1V1P B;  4K6L A;  1Y1V G;  5J39 A;  2YTV A;  4KHV A;  4RGM A;  4PV1 C;  4HJ8 A;  4LWC A;  3OYY A;  4C1N K;  1MJC A;  1KLU D;  2VQE L;  1HZA A;  1N33 Q;  2L15 A;  1XYI A;  2HCI A;  2J7Z A;  2QEJ C;  1OTC A;  1ASZ A;  4G7O C;  1IL8 A;  2KUM A;  4A3G B;  1YHB A;  1JOK A;  5GRO A;  1C4Q A;  4BY7 B;  2BA0 A;  2NTS A;  3QG1 A;  5HUR A;  3J81 i;  3PUZ A;  3URY A;  3UDX A;  1ESF A;  4HMJ A;  3NTK A;  2K28 A;  2F4V Q;  1LTG D;  1ZYR C;  5JEA H;  1CFM A;  2RA4 A;  1QB5 D;  1SN8 A;  2F0G A;  2WB1 E;  3HOU B;  4JI1 Q;  4DNR B;  4GLV B;  4CJ1 B;  3KYH C;  3GTL B;  1TS4 A;  2R93 H;  2K1B A;  4XQJ A;  2AWO A;  4K2K A;  3U50 C;  3FEW X;  3R2I A;  1WTQ A;  1N36 Q;  1PZK D;  2RSN A;  1B2T A;  3D3R A;  2EZV A;  5EKI A;  3H91 A;  5EPK A;  2FIN B;  1BO0 A;  4A3C H;  3TP7 A;  2VUM B;  5IP9 H;  2G9H D;  3LGJ A;  2KA7 A;  4G57 A;  4C3J G;  5IGF A;  4DR2 Q;  2O4X A;  1LTR D;  2B2V A;  4LF5 L;  5AJ3 Q;  1MGS A;  2NYZ D;  3MFG A;  4DAY B;  3A8K E;  1I5F A;  1LT5 D;  3J80 i;  4DR3 Q;  3P1H A;  3L3O C;  1XWE A;  4L63 B;  3OOC A;  1XMO Q;  3E0J A;  2XRS D;  5IYC H;  4A3E H;  2F0Q A;  4K14 A;  5D3I B;  4JI7 Q;  1J5E L;  2MPM A;  5DAU A;  3VR6 A;  1Q81 C;  2JA9 A;  4P72 A;  3ERQ A;  4DR6 Q;  1IW7 C;  3HOW G;  1O7L A;  2WAQ B;  3EBE A;  3PUW A;  4IAL A;  5EPL A;  4GNX C;  1GD7 A;  4DK6 C;  1ICF B;  3K59 A;  3MXU A;  1H9J A;  3NQT A;  4HJ9 A;  3D4D A;  3I56 A;  1R9T H;  1NY4 A;  1V43 A;  4HCS A;  3BDO A;  4WJW A;  5BN5 A;  1IBK L;  3GTO B;  3EQL C;  1PVO A;  1GKH A;  4IUP A;  2E5L Q;  2Z6B A;  2B63 B;  1A62 A;  4YCU A;  3P20 A;  3KJO A;  4DUZ L;  2ZTD A;  4IUU A;  3T1H L;  3E6Z X;  4ODG A;  2UXB Q;  2WII B;  3OHX C;  1KLG D;  1EOV A;  5J3B A;  4JI4 L;  2K32 A;  3A7L A;  4BY7 G;  3HG9 A;  5M3M H;  4K0K Q;  4QMG A;  2K52 A;  4LFC Q;  4QY7 A;  4DNT B;  2XWB B;  5IGD A;  3NXW A;  4CJ0 B;  1B50 A;  3F2C A;  4A3L H;  1DD2 A;  4LF4 L;  2HUG A;  4NXM L;  1WTX A;  3DXJ C;  3HOU G;  4B3M L;  4PNY A;  3SK4 A;  3N6R A;  4JI8 Q;  4B3T Q;  1S40 A;  1EIG A;  1TWA H;  2Q2T A;  3O13 A;  1JIC A;  5ELN A;  4Q5V A;  4IFD J;  1K0R A;  4ZYS A;  2F52 A;  1NUC A;  4DV0 L;  1SMY D;  2JA5 B;  1CQF A;  2MUY A;  3EFX D;  1TY0 A;  5FLM H;  3X3N A;  1EYD A;  1Q46 A;  3M3Y B;  1UNS A;  4DV6 L;  4RMF A;  1SNM A;  4JOI A;  2VUM G;  3BZD B;  1WCM B;  4ME3 A;  3S16 B;  3UDG A;  3S14 B;  1XPO A;  3CHB D;  4DR1 L;  3RN2 A;  2OTJ A;  1LAB A;  3LWU A;  4JI2 Q;  2M00 A;  4A3M H;  2AKW B;  2A6H D;  1I50 B;  2Q8R E;  2H5X A;  4RKB A;  1NBW A;  4P75 A;  5AFW A;  1STA A;  3A8I E;  5A2Q E;  3T1Y Q;  1FJG Q;  1I94 L;  4BBR B;  1BBU A;  2PI2 E;  1Y1V H;  3J7Z C;  2A68 D;  4HSP A;  4KHP L;  2WAQ G;  3ER0 A;  1MJE A;  2UUB L;  3WOF A;  1H9S A;  4V0B A;  3G7L A;  3ULP A;  4PQX A;  1EU4 A;  1LUZ A;  3GTQ H;  2JA8 B;  3FKI B;  1E1T A;  2RCN A;  1M90 C;  4DV1 L;  1VQP A;  3H6M A;  1L0Y B;  2Q2H A;  1NSN S;  1AH9 A;  2B63 G;  2K5N A;  2E76 C;  2KHS A;  4TKO B;  1PFB A;  3S1R B;  1Q12 A;  3TS0 A;  5E4X A;  5ISR A;  3M4O H;  4CGY B;  1UUP A;  2MGS A;  5FO8 B;  3MXP A;  5E7N A;  2F0I A;  3LWE A;  2K75 A;  2Y0S E;  5C44 G;  2CKZ B;  2QEX A;  3MEH A;  3A5Z B;  1QNU A;  3PIP 3;  3I91 A;  1YNJ D;  1AFP A;  1KNA A;  5C4Z A;  4MZ9 A;  1LTB D;  3DUZ A;  4ULL A;  2HT1 A;  2UXC Q;  3HKZ E;  1SFO B;  4K6D A;  5BN4 A;  1VQI A;  1Y8N B;  2YU9 B;  5E1F A;  4FNF A;  1B3A A;  1FVI A;  2EJF C;  1JWU D;  1C9O A;  1W6J A;  2B2T A;  5JPM C;  3AFP A;  4LF7 L;  4O42 A;  2JA5 G;  2BH8 A;  3J81 L;  3QWN A;  1PRT D;  2PQA A;  2LY7 A;  1K73 C;  3K5O A;  4K2L A;  4C3I B;  2E8G A;  3KBG A;  5LMU Q;  1PH3 A;  3PO2 B;  1HA6 A;  1WCM G;  1F9P A;  2IJ0 A;  1UE1 A;  3AB9 A;  4QUC A;  5FLX L;  3HOV B;  5IWA L;  3F1Z A;  1J6Q A;  4X66 Q;  5JEA J;  2EY5 A;  4IJL A;  3V2T A;  5K36 H;  5M5W B;  2Q2I A;  4ALP A;  1N34 L;  3KF8 A;  3OMG A;  4L8J A;  1YHA A;  1I6H H;  1P16 A;  3CCE A;  5C4J B;  1B9M A;  2DUD A;  1U9R A;  1CM9 A;  1XXG A;  3B6Y A;  4BBR G;  4X3K A;  1EZ6 A;  3BDL A;  5CV8 A;  2KCT A;  2L4N A;  4XQQ A; 
#chains in the Genus database with same CATH homology
 1Q1B A;  1SRU A;  3RLO A;  4UP8 A;  1AE2 A;  4X65 Q;  2ZTE A;  4X64 L;  5FLX c;  1YIT A;  4IFD G;  2R93 G;  3H0G H;  1BBW A;  1YJW A;  1YZ6 A;  3K8A A;  3H15 A;  2JA8 G;  1L1O C;  2DGY A;  3FKI G;  1OXT A;  1XNR L;  3I4N G;  1JT8 A;  3RZO H;  1HNW Q;  1TWF H;  1X6O A;  2K14 A;  4UP7 A;  1E1O A;  5HY6 A;  3RLF A;  4GOP C;  4AQY Q;  4X6A H;  4A3G H;  4AIM A;  1JJ2 A;  1SMX A;  3OW2 A;  3CCL A;  4BY7 H;  1CKO A;  2NZO A;  3CP0 A;  2QA4 A;  2UU9 Q;  3CXC A;  3KFU A;  3JAM i;  1VQH A;  1VQ8 A;  4DK3 C;  4YY3 L;  5DLQ E;  3S14 H;  4APV A;  4X64 Q;  4HJ5 A;  1QVG A;  1HZC A;  1IYJ B;  1K83 H;  4XTC S;  1NMF A;  1WFQ A;  2K4K A;  1K3R A;  1VCI A;  4FDB A;  1PH7 A;  4L5R C;  4DR7 Q;  5JJK A;  1XNR Q;  2IHF A;  4QL5 A;  2VL6 A;  1UWV A;  1SRO A;  4JBJ A;  2A8V A;  2UUC L;  3HOU H;  4BXX G;  1EIF A;  1X55 A;  5M3F G;  4HIM A;  4JI5 L;  2NZH A;  3GTL H;  3S1M H;  5IYD H;  4OON A;  1N32 Q;  4BBR H;  3S1Q H;  2OCE A;  2LXK A;  4JBM A;  5M5X H;  1YVC A;  4BA1 I;  1WI5 A;  4X62 L;  4QIW E;  1SR3 A;  1D7Q A;  2ZJP A;  4KHZ A;  2MFI A;  1DGS A;  1UEB A;  4DNI A;  4YY3 Q;  1VQL A;  2UUA Q;  1G6P A;  4HJA A;  4DV2 L;  4GS3 A;  3G71 A;  3F2B A;  3CW2 C;  4GKK L;  3GTK H;  3PUV A;  1YI2 A;  2AMC B;  4QQB X;  4JI6 Q;  3STB D;  2VUM H;  5IYB G;  4JV5 L;  2CCZ A;  3I4N H;  2GN5 A;  1X56 A;  1YJN A;  3S2H H;  1KAW A;  4JI5 Q;  3HOZ H;  1U5K A;  4EQ5 A;  2ZJR A;  1HZB A;  2OQK A;  2HIX A;  3OTO Q;  3K7A H;  3A74 A;  2V1C C;  3AQQ A;  5LMN L;  1M1K C;  3G48 A;  5LMN W;  5IE8 A;  3BZC A;  4P73 A;  1VQN A;  1PH4 A;  3S1R H;  1W3S A;  1XJV A;  1K8G A;  4QJF A;  4QGU A;  3S1N H;  4JI3 L;  2VY3 A;  4HIO A;  1E7Z A;  3HOV G;  2N8N A;  4DV3 L;  2N49 A;  4JV5 Q;  3W1G A;  2NN6 I;  1VQ9 A;  4YCV A;  4DV4 L;  1OXX K;  1U0L A;  1LM0 A;  2R7F A;  4P74 A;  3F2D A;  4NB3 A;  4BXX H;  5M3M G;  4POF A;  5LMU L;  2LXJ A;  3L2P A;  5M3F H;  3ULJ A;  4A3B H;  1L2F A;  2D62 A;  1V9P A;  3FP9 A;  1HNX L;  3IRB A;  5LMN Q;  1SFO H;  3UE1 A;  1KQS A;  1TWH H;  4JI0 L;  3CCM A;  1LTL A;  4X66 L;  3U4V A;  1EYG A;  1HR0 L;  1HR0 W;  4JI3 Q;  3I55 A;  4DR5 L;  3S2D H;  4DR4 L;  3JC6 6;  2B63 H;  2XGT A;  4YHH Q;  4DV3 Q;  4JG2 A;  3HOY G;  2KHJ A;  5GAD C;  4B3R Q;  4A93 G;  1CKM A;  1C0A A;  4DV4 Q;  3RLN A;  4IO9 A;  5JJI A;  5IYB H;  2JJQ A;  2Z6K A;  1B70 B;  2E2I H;  2JA6 G;  3J7A 5;  4JYA Q;  1K8A C;  4JBW A;  3M4Q A;  1AE3 A;  2B3G A;  3CCJ A;  2ATW A;  2EIF A;  3NEN A;  2WP8 J;  5C0X G;  1PFS A;  1HNZ L;  1VQ6 A;  2ID0 A;  3PUY A;  1RIP A;  1HNX Q;  2ASB A;  3AFQ A;  5EAY A;  3HOY H;  2K50 A;  4JI0 Q;  5JJL A;  1Q86 C;  4X65 L;  2K5H A;  3Q8D A;  4L5Q A;  4OWX B;  1HR0 Q;  3PO3 G;  2HIV A;  4R4O A;  3TEH B;  4OWT B;  4BY1 G;  3CCR A;  1VQA A;  3CCV A;  1QZH A;  4DR4 Q;  3CC7 A;  3BU2 A;  1KC8 C;  2NVY H;  1PYS B;  2JA7 G;  2VS1 A;  2VQF L;  3CD6 A;  5IT9 c;  1X3F A;  1NTG A;  2KEN A;  1IXR A;  2I5H A;  2Z6K C;  4AQY L;  4IOC A;  3GTM H;  4BBS G;  3TRE A;  3J81 c;  5JEA G;  4BA2 I;  2Z0S A;  1Y14 B;  2A1A A;  3CAM A;  1PHJ A;  1N33 L;  3RNU A;  1MIU A;  1EFW A;  1YNX A;  2BA1 A;  5HGQ A;  5M5W H;  1SE8 A;  2IY5 B;  1Q1E A;  2D0O A;  2RHQ B;  1OXU A;  2E2H H;  2Q2U A;  5C4J H;  1CUK A;  1FL0 A;  2KHI A;  1YIJ A;  1Y1V G;  5C4X H;  1VQ5 A;  4MNO A;  2YTV A;  4DUZ Q;  3F8T A;  1X54 A;  3S15 H;  4HJ8 A;  2VQF Q;  4DR7 L;  4LWC A;  3BJU A;  2R7Z G;  2JA5 H;  3OYY A;  2ES2 A;  2NVQ H;  3MEF A;  1G51 A;  1VQG A;  4PMW A;  3CC4 A;  2JQO A;  2PMZ E;  2F4V L;  1Z47 A;  3ZJY C;  1MJC A;  2KBN A;  3M3Y H;  1VQK A;  4A3C G;  2VQE L;  1HZA A;  1KRT A;  1N33 Q;  5IP9 G;  2L15 A;  1N32 L;  5GAH C;  4P71 A;  2PNH A;  4A75 A;  1WCM H;  4OWW B;  3ICE A;  2VW9 A;  1HZ9 A;  2N78 A;  4JI1 L;  4Y7N H;  3CCS A;  1ASZ A;  1OTC A;  2UUA L;  3S16 H;  3I4M H;  1YHB A;  5GRO A;  1IL2 A;  4YWL A;  3PO3 H;  2BA0 A;  1E3P A;  4O2D A;  3STB C;  3PIP A;  4A93 H;  4JI6 L;  4BY1 H;  4NXM Q;  3UE0 A;  3J81 i;  2ZJQ A;  4OO1 G;  3AEV A;  1I50 H;  3PUZ A;  5IYC G;  3BZK A;  2CWA A;  3UDX A;  2WAQ E;  4GLX A;  4A3E G;  3J80 c;  1PH9 A;  5IP7 H;  4IPH A;  2JA7 H;  4OXP A;  2F4V Q;  1VQC A;  3GTJ H;  4GNX B;  3H3V H;  4BBS H;  2VQE Q;  4DV5 Q;  4LUV A;  3OTO L;  3TRZ A;  4YWM A;  4DV0 Q;  1PH1 A;  1JE5 A;  1SN8 A;  2RHS B;  3FHW A;  1VQF A;  2WB1 E;  1UE6 A;  4AYB G;  4JI1 Q;  4GLV B;  4A3J G;  5AJ3 L;  4MTN A;  1FGU A;  3KYH C;  3PF4 A;  1EUJ A;  1HJP A;  1KIX A;  4DR3 L;  4IPG A;  2R93 H;  2AWO A;  3U50 C;  4PZ6 A;  1N36 Q;  4LNQ A;  2JA8 H;  1VQ7 A;  3FKI H;  3G4S A;  1XMO L;  3L0O A;  4DR1 Q;  4WJ3 M;  1PYB A;  4JI7 L;  1N8R C;  4LF9 L;  3HFZ B;  4A3C H;  1T9H A;  4LUZ A;  5IP9 H;  4A3F G;  1Q82 C;  3LGJ A;  4GKJ Q;  1KXL A;  1VQB A;  3J81 j;  4DR2 Q;  4DR6 L;  4XIG S;  4L5S A;  3ERS X;  4LF5 L;  3CCU A;  5AJ3 Q;  3G6E A;  2EXD A;  1EIY B;  4GNX A;  4DAY B;  3KJP A;  1C7Y A;  1I5F A;  3PO2 G;  3J80 i;  4POG A;  4DR3 Q;  1XMQ Q;  2ZTC A;  4YHH L;  1YJ9 A;  4B3R L;  2B29 A;  3GTP H;  3A0J A;  1XMO Q;  1EQQ A;  2R92 G;  5IYC H;  4YWK A;  4A3E H;  4JYA L;  2OWO A;  1WJJ A;  4JI7 Q;  1J5E L;  4LF9 Q;  2D0P A;  4A4I A;  2K5V A;  1Q81 C;  2JA9 A;  4P72 A;  1Z9F A;  3NEL A;  2EQS A;  2Y0S G;  4DR6 Q;  3HOW G;  3EBE A;  4LF5 Q;  1LYL A;  1P8L A;  3PUW A;  2YU9 H;  4GNX C;  4A3L G;  1CKN B;  1GD7 A;  4DK6 C;  4NXN L;  3TS2 A;  1V1Q A;  4A3D G;  3E0E A;  3E9H A;  1XPR A;  4HJ9 A;  3HKZ G;  4A3I G;  3I56 A;  4JCV E;  1R9T H;  1NY4 A;  2MNA A;  2JEA I;  4AH6 A;  2UXB L;  1V43 A;  3CPW A;  2VZA A;  3PSI A;  1IBK L;  1QZG A;  1J5E Q;  1NJI C;  1PVO A;  1GKH A;  3S24 A;  2RF4 A;  2ALY B;  2E5L Q;  2JE6 I;  1L1O B;  1VS0 A;  1VQM A;  1QUQ B;  4K0K L;  1KRS A;  5FLM G;  1RL2 A;  3KOJ A;  4LFC L;  2IX0 A;  1A62 A;  1W2B A;  4C3J H;  2OQ0 A;  4YCU A;  4C3I H;  2KCM A;  1N9W A;  1A0I A;  4NXN Q;  3KJO A;  2BH2 A;  4DUZ L;  3PO2 H;  3U58 A;  2ZTD A;  3T1H L;  1IBL L;  4LW1 A;  4LFB L;  2WFW A;  3PIO A;  2UXB Q;  3HOV H;  4JI8 L;  2VNU D;  4B3T L;  1WYD A;  1EOV A;  1PV4 A;  1B8A A;  3CPF A;  5J3B A;  4JI4 L;  1IBK Q;  4BY7 G;  1CKN A;  2R92 H;  4H02 A;  4A3M G;  5M3M H;  2MO0 A;  4R4I A;  1Y1W G;  4K0K Q;  2I5M X;  3SGI A;  4GN5 A;  3W5O A;  2E2J H;  2K52 A;  4LFC Q;  4QY7 A;  1A8V A;  1Q8K A;  1XTD A;  3UDF A;  3PF5 A;  1S72 A;  2NVT H;  3HOW H;  3GTG H;  5BR8 L;  3JAM c;  3CCQ A;  1L0W A;  1YBY A;  3F2C A;  3CF5 A;  1UE7 A;  1X9N A;  4LF4 L;  3ULL A;  4A3L H;  3KDF B;  4DV7 L;  1PH2 A;  3T1H Q;  1GVP A;  1IBL Q;  1QUQ A;  4NXM L;  3GD7 A;  5GAG C;  2I0Q A;  4B3M L;  2NN6 G;  3HOU G;  4LFB Q;  1G29 1;  3CMA A;  1VQO A;  4JI8 Q;  4B3T Q;  3HKS A;  4DUY Q;  4IPD A;  1YHQ A;  1BKB A;  5IYD G;  1TWA H;  4RG1 A;  1S40 A;  1PH8 A;  5ELN A;  2Q2T A;  4JI4 Q;  4PG3 A;  4IFD J;  1K0R A;  2JA6 H;  2F52 A;  4DV5 L;  4L5T A;  4JI2 L;  4KI0 A;  4DV0 L;  2ZM6 Q;  4UP9 A;  2CFM A;  3L7Z C;  3M7N A;  1IBM Q;  3PUX A;  4LF6 L;  5FJ8 G;  5FLM H;  5IWA Q;  1Q46 A;  1WOC A;  2IX1 A;  2FXQ A;  5BR8 Q;  4DV6 L;  4RMF A;  3T1Y L;  1FJG L;  1H95 A;  3WWV A;  4JOI A;  4LF4 Q;  3EN2 A;  2VUM G;  4DV7 Q;  2R7D A;  1O7I A;  1N34 Q;  4ME3 A;  1PH6 A;  4B3M Q;  1N36 L;  1E22 A;  3UDG A;  3HOZ G;  2IHE A;  2YV5 A;  1XPO A;  2F3I A;  2YTY A;  4DR1 L;  3RN2 A;  1X65 A;  2OTJ A;  3M9B A;  4JI2 Q;  3PGZ A;  1XNQ Q;  4OX9 L;  3KDF A;  1UE5 A;  4A3M H;  2AKW B;  4A3K G;  1ASY A;  4GKJ L;  1Y1W H;  2H5X A;  2N3S A;  2GVA A;  4DR2 L;  4AYB E;  4IPC A;  3VDY A;  1NBW A;  1GM5 A;  4LF6 Q;  2I5L X;  1S3O A;  4P75 A;  5M5Y H;  2HHH L;  4EX5 A;  3K7U C;  1JJC B;  3EIV A;  4C3H H;  4DV6 Q;  4JC0 A;  4LUO A;  3T1Y Q;  1I94 L;  1TWG H;  1BBU A;  2PI2 E;  4J15 A;  4JOI C;  1FJG Q;  1Y1V H;  3J7Z C;  1XMQ L;  2MO1 A;  4LF8 L;  1GO3 E;  2WAQ G;  3ER0 A;  3K81 C;  1MJE A;  2UUB L;  4KHP L;  4WJ4 A;  1XPU A;  1JB7 A;  1BVS A;  3CC2 A;  4HJ7 A;  4A3B G;  1Q7Y C;  3ULP A;  3M4P A;  4NPS A;  2AHO B;  3GO5 A;  1VQJ A;  4OX9 Q;  1X3G A;  1LUZ A;  5C0X I;  3GTQ H;  1CSP A;  2WB1 G;  3CQZ H;  1E1T A;  2RCN A;  3CME A;  5H1S E;  1M90 C;  1OXV A;  1JMC A;  1MKH A;  2GVB A;  2HHH Q;  2R7Z H;  2C35 B;  1PA6 A;  2CQO A;  2JK8 A;  4DV1 L;  3D31 A;  5FJ8 H;  3M85 A;  2Q2H A;  1VQP A;  3K80 C;  4GN4 B;  1I94 Q;  1PH5 A;  1AH9 A;  1IZ6 A;  2B63 G;  2K5N A;  4C2M H;  1D8L A;  3AYH B;  2NVX H;  2UXC L;  4LF8 Q;  4KHP Q;  2UUB Q;  5IY0 A;  2UUC Q;  2CWP A;  3H3V I;  1Q12 A;  2LSS A;  3TS0 A;  1JJG A;  1TXY A;  4B3S L;  3DLL A;  4JBK A;  1NMG A;  3M4O H;  4DAM A;  1I3Q H;  2E5L L;  5E7N A;  4X62 Q;  1VQD A;  4A3K H;  2K75 A;  2PQA B;  2Y0S E;  1YEZ A;  5C3E G;  5C44 G;  2A19 A;  2CKZ B;  2MQH A;  2QEX A;  3A5Z B;  4LFA L;  5GAE C;  4DV1 Q;  4DV2 Q;  3TQY A;  1QVF A;  5K36 G;  4IJH A;  3KF6 B;  4A3J H;  4GKK Q;  4IFD I;  1TWC H;  3HOX G;  1NE3 A;  3DM3 A;  4MZ9 A;  4A76 A;  1SLJ A;  3U4Z A;  3W1B A;  3UDI A;  2HT1 A;  2UXC Q;  3HKZ E;  4TVA B;  2IT1 A;  1A63 A;  2OTL A;  1VQI A;  1B7Y B;  2YTX A;  1EQR A;  4UY8 C;  3I7F A;  4B3S Q;  1FVI A;  2XTI A;  3D0F A;  4IOA A;  3KF8 B;  1C9O A;  4GN3 B;  4TQU S;  2UXD L;  4HID A;  4A3F H;  3AFP A;  1EWI A;  4R4C A;  4HIK A;  4GOP B;  1VQ4 A;  1OXS C;  1E24 A;  4LF7 L;  3H0G G;  3I2Z A;  4LFA Q;  5C4X G;  3PV0 A;  3GTO H;  3A5U A;  1VQE A;  5C0X J;  2JA5 G;  4DPG A;  2BH8 A;  4OO1 I;  2PQA A;  4DUY L;  1K73 C;  4A3G G;  4R4T A;  2E8G A;  3E9I A;  3KF6 A;  4DKA C;  5LMU Q;  1PH3 A;  3RZD H;  4PZ7 A;  4Y52 H;  4UPA A;  1WCM G;  2ZM6 L;  1CSQ A;  1UE1 A;  1KL9 A;  2UXD Q;  4GLA C;  2JEB I;  3I4M G;  3MXN B;  1IBM L;  2YYZ A;  1QVC A;  1KD1 C;  4LF7 Q;  5IWA L;  1KHI A;  3F1Z A;  2QGQ A;  1J6Q A;  4YCW A;  4X66 Q;  1X3E A;  5C3E H;  5C44 H;  5JEA J;  3RN5 A;  4PZ8 A;  3NBH B;  4IJL A;  5ELO A;  4DR5 Q;  3K0X A;  2PI2 A;  2Q2I A;  5GQO A;  4O0A A;  1L1O A;  3RR5 A;  3HOX H;  3I4O A;  4ALP A;  1N34 L;  1I6H H;  4A3D H;  1YHA A;  2R6G A;  5IP7 G;  1P16 A;  3PCO B;  2AWN A;  3CCE A;  1HNW L;  4A3I H;  2HQL A;  3GDE A;  4GOP A;  2DUD A;  3B6Y A;  4BBR G;  4KLK A;  3KLW A;  1K9M C;  4R4Q A;  1XNQ L;  1HNZ Q;  2UU9 L;  3S17 H;  4R1J A;  2KCT A;  1HH2 P;  3NEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...