3A5UA

Promiscuity and specificity in dna binding to ssb: insights from the structure of the mycobacterium smegmatis ssb-ssdna complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
119
structure length
118
Chain Sequence
MAGDTTITVVGNLTADPELRFTPSGAAVANFTVASTPRMFDRQSGEWKDGEALFLRCNIWREAAENVAESLTRGSRVIVTGRLKQRSFTREGEKRTVVEVEVDEIGPSLRYATAKVNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Promiscuity and specificity in DNA binding to SSB: Insights from the structure of the Mycobacterium smegmatis SSB-ssDNA complex.
rcsb
source organism Mycobacterium smegmatis
molecule tags Dna binding protein
molecule keywords Single-stranded DNA-binding protein
total genus 18
structure length 118
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3a5uA00
1I5FA 1MIUA 3CCRA 2WP8J 4WJ4A 5M3MG 2N3SA 1VQGA 3G48A 3AFPA 3MXNB 4AYBE 3FKIG 2ZM6L 1OXXK 3GDEA 4JI7L 4LF6Q 5IYBG 4R4CA 4A3KH 4OWWB 3S24A 1SFOH 3E9HA 4QJFA 4LFCQ 2DUDA 2K14A 4IOCA 1B70B 1VQFA 3A74A 4UP7A 5C4XG 4KI0A 4JI1Q 4YHHL 1YHAA 2GVAA 4QGUA 3GTGH 2D62A 3M3YH 2RF4A 4GOPB 1YHBA 1PFSA 1Q46A 3W5OA 4A3CG 2B29A 1Y1WG 4JG2A 2UXCL 2IX0A 4UPAA 1O7IA 3G6EA 3S1RH 2NVTH 3HOYG 1JJGA 1S40A 3OW2A 2YV5A 1BBUA 1YVCA 4JBJA 1A0IA 1LYLA 4DR1L 1I3QH 3L7ZC 4GLVB 3W1GA 4C2MH 1XJVA 4HIMA 4LUOA 3I4MG 1S3OA 4GKJQ 4LWCA 1WOCA 4DR5Q 4LF4Q 5LMUQ 1EWIA 3J80c 4QQBX 3F2BA 5IYBH 1PYBA 4DK3C 1JJ2A 4BXXG 2K4KA 2A8VA 1HNWL 1YI2A 4K0KL 2UUBQ 4WJ3M 1H95A 4KHPQ 1Q12A 3H0GH 3K7UC 4OO1I 4DR4Q 1PYSB 4DR6Q 2AMCB 2Z6KA 4X62L 3RZDH 1S72A 3CC4A 1ASYA 1WJJA 2R7FA 2FXQA 5IE8A 1AH9A 1PH5A 4KHPL 4JBWA 2OCEA 2RHQB 1BBWA 2I5MX 5IP7H 4B3TL 2C35B 4DV1L 4JI0L 1YZ6A 2RCNA 5LMNL 1IBMQ 4P72A 1LM0A 1U5KA 3STBD 3PIOA 1VQ7A 4DR5L 4L5RC 1RIPA 4DR7Q 3EN2A 1SMXA 2Z6KC 4DR3Q 3LGJA 4X66Q 2KCMA 3GD7A 3U4VA 4R4TA 2OTJA 3CCSA 1EYGA 3F1ZA 4APVA 4B3RL 4RG1A 2R93H 2AHOB 1UE5A 4O2DA 4DV6Q 1CKMA 2Y0SG 4GN5A 2UUCL 3M7NA 4JV5Q 4BY7G 3J81j 1N32Q 5IWAL 1VQCA 2VUMG 4BXXH 4A3IG 3HOUH 2ZTEA 3U4ZA 3TS0A 1TWHH 3JAMi 4IPGA 3H0GG 4DV4L 3PO3H 1PHJA 3U58A 4JI8Q 1OXSC 2HQLA 1J5EL 4OWTB 3S1MH 2VNUD 1I50H 1M90C 4EQ5A 1HH2P 3HKSA 4PZ8A 1Q81C 1MKHA 1CKNA 4RMFA 3SGIA 4JBKA 5C0XI 4DV3Q 4JI3Q 1YJWA 1HR0W 3HOYH 2Y0SE 5AJ3L 4X65Q 3IRBA 4GNXC 4JI6L 3KLWA 1CKNB 2UUCQ 4OWXB 4JV5L 4ALPA 1N8RC 2K50A 2CFMA 1CSPA 3T1HQ 1EIYB 3NENA 4X64L 3D0FA 2OQ0A 3PV0A 3EIVA 1VQ9A 1YNXA 4QY7A 2VQFQ 4JBMA 4NXNL 1IBLL 3K8AA 3KJOA 4AH6A 3VDYA 1VQOA 3PSIA 3RZOH 4BA2I 4HIOA 1VS0A 4MNOA 3S17H 2AKWB 1E22A 3BZCA 4J15A 2BH8A 1VQLA 1SE8A 1KHIA 2Q2TA 2WFWA 3CMAA 2NZHA 2VQEL 3CC2A 1LUZA 4JI0Q 4DK6C 3E9IA 4DV2Q 2R7ZG 4QL5A 2QA4A 1E7ZA 1Z9FA 1QZGA 4LFBL 3K81C 2IT1A 4GN3B 1PH8A 2NZOA 5M3MH 1B7YB 1XNRL 2NN6G 1I94Q 1MJEA 1GVPA 4K0KQ 2K5NA 4PZ7A 1UE6A 4JI1L 3PUVA 2XGTA 1Q1BA 4DV5L 1N34Q 4JI2L 2JA6G 3PF5A 5HY6A 1NBWA 4QIWE 3KJPA 4KHZA 2B63H 2XTIA 2JA5G 1I94L 4BBSH 2E2HH 4UP9A 3PCOB 1YJ9A 3CW2C 5M5YH 3GTOH 1VQMA 2E5LL 1Q1EA 3MEFA 3BJUA 1VQKA 1SLJA 2HHHL 4KLKA 3GTPH 2DGYA 1HR0L 1Q8KA 2ATWA 1T9HA 1K9MC 3CPWA 2B3GA 4L5TA 2L15A 3HOZG 3HFZB 1IBLQ 4A3EH 4GNXA 1XPOA 5EAYA 4P71A 2JA7H 1N34L 3J81c 4L5QA 1HZ9A 4IO9A 2YTXA 3RLFA 5C3EH 1PVOA 1XMQL 3ER0A 1NMFA 4LF7Q 1U0LA 4NXMQ 3S16H 4A3CH 2WAQG 4DR4L 4NXNQ 2MFIA 4YHHQ 4BBSG 1PH7A 3AYHB 3CAMA 4A3GG 1L0WA 3DLLA 3TS2A 2WB1E 1XNQQ 1KC8C 4JI2Q 1GO3E 2K52A 1V43A 3M4QA 4B3TQ 5BR8L 1X65A 2NN6I 2JK8A 1C0AA 4MTNA 2MQHA 2UXBL 1HJPA 3H3VI 1XPUA 2JE6I 4MZ9A 4JI7Q 1PH2A 4DR6L 4OXPA 1N33L 5IYCG 2YYZA 1FJGL 1EUJA 2I0QA 1KXLA 4LF5L 3NBHB 3UE1A 4JI4L 3PO3G 4DV5Q 3J81i 4H02A 3AQQA 1FVIA 1P8LA 1QUQA 1WCMH 1XPRA 2UU9Q 1N33Q 3J80i 4X65L 4POFA 2CWAA 1PH9A 5GROA 1KIXA 3KF6B 2IHFA 2K5HA 4LFAQ 4HJ9A 2YTYA 4DR7L 3M85A 1MJCA 2KCTA 3FHWA 3TEHB 4X64Q 2QGQA 2ALYB 3PUWA 2LXJA 1E1TA 1NY4A 1Q86C 2HHHQ 2RHSB 3RN5A 1L2FA 4A4IA 4OX9Q 2E8GA 3CP0A 5AJ3Q 2Z0SA 4DUYQ 1GKHA 4JI6Q 2HIVA 2N78A 3S15H 2JA6H 3I4OA 3KOJA 4R1JA 5C0XG 1YITA 2PQAB 3KDFA 5GQOA 5GAEC 4DV7Q 4DV2L 1EQQA 4B3ML 3ICEA 1JT8A 4POGA 1VQ6A 3NEMA 1HNXQ 2F52A 1CSQA 1PH6A 1XNQL 4JI8L 1V9PA 4GNXB 4IOAA 4TVAB 4JOIA 1XNRQ 3L2PA 3KF6A 3A5ZB 3AEVA 5IYDH 2JEBI 4YWMA 4AYBG 3ULJA 1XMQQ 2E2IH 4OO1G 1A62A 2MO1A 4UP8A 5IT9c 1Q7YC 3TREA 3DM3A 5FJ8H 3CCMA 5LMNQ 1DGSA 3PGZA 1HZBA 4LF5Q 1QZHA 3RLNA 1NE3A 2NVQH 3I4MH 1SR3A 1SROA 1TWFH 4A3JG 1K73C 4HJ8A 1E24A 4LF9L 1QVFA 4DR3L 1WYDA 1VQ5A 2BH2A 3U50C 2UXBQ 2VQFL 4A3LG 3GTKH 2D0OA 1J6QA 1ASZA 4GN4B 4DV6L 2H5XA 1HNXL 2EIFA 1X55A 5M3FG 1SRUA 1X56A 3D31A 3I2ZA 1W2BA 1WI5A 5FLMH 2HIXA 4X66L 3Q8DA 1WFQA 3W1BA 1UE1A 4DR2L 4LFBQ 1WCMG 1OXUA 1QVGA 1KRSA 5BR8Q 3S2HH 3F2DA 3TQYA 5IYDG 4A76A 1K8GA 4A3IH 4PMWA 1K83H 3HOVH 4A3MH 3M4PA 5DLQE 5LMUL 2WB1G 1N36L 3ULLA 4GLXA 1Z47A 3GTQH 4B3SL 2KENA 4DPGA 3PIPA 2R93G 2R6GA 4YY3Q 1L1OB 5C0XJ 2HT1A 3H3VH 4DNIA 2UU9L 3S2DH 5JJLA 3CCVA 1A63A 2PI2A 5GAHC 4LFCL 4A75A 1FGUA 2ZJPA 2JEAI 3A0JA 4DV0L 4LF4L 3GTMH 2GN5A 2R7DA 4A93H 2JJQA 2JA8H 2CCZA 2KHJA 4YCUA 3RNUA 3PUYA 3UDIA 1JJCB 4IJHA 2ID0A 4C3HH 2UUBL 4DV0Q 4Y52H 1HZAA 2Q2HA 3WWVA 3KFUA 3CCEA 2UXCQ 4GOPC 1D7QA 4JCVE 3JAMc 5IYCH 2WAQE 3HOWH 4X6AH 1XTDA 1K0RA 2K5VA 1X3FA 4A3KG 3PO2H 1L1OA 2JA9A 4JI3L 4B3SQ 1VQJA 3NELA 4BA1I 2OWOA 3K7AH 1TWAH 5IY0A 3E0EA 5C44H 5K36G 2VS1A 3RN2A 2R92G 2JQOA 5GADC 4HJ7A 4L5SA 4LUZA 5FLMG 4HJAA 4BY1H 2N8NA 4A3GH 3HKZE 1I6HH 4DV4Q 3S1QH 4IFDI 4JOIC 1Y14B 2BA1A 2PQAA 1IXRA 2I5HA 2PI2E 3KDFB 4Y7NH 2I5LX 3I55A 1TXYA 1W3SA 4FDBA 5JEAJ 1Y1WH 2F3IA 3S14H 2JA5H 1G291 4NB3A 3FP9A 2CWPA 1C7YA 2F4VQ 2ZM6Q 2VZAA 4TQUS 1YIJA 1XMOL 4DV1Q 2VQEQ 1KD1C 3A5UA 3G4SA 3G71A 2K75A 3EBEA 2OTLA 4A3DG 5JJIA 3CQZH 1BKBA 3OYYA 3L0OA 2VL6A 4GLAC 4P73A 4XIGS 3RLOA 4X62Q 1A8VA 1C9OA 4DUZQ 1CUKA 3I7FA 1OXVA 4A3MG 4GKKL 1HZCA 1B8AA 2R7ZH 3PO2G 3KF8B 1N9WA 3PUZA 1SN8A 1EOVA 5E7NA 4HIKA 1HR0Q 4PZ6A 5ELOA 1YHQA 2UUAQ 1Y1VH 4B3MQ 2CQOA 2NVYH 1VQBA 2UXDL 2Q2IA 1X3GA 2YU9H 1IL2A 2PNHA 5M3FH 1YBYA 3I56A 3F2CA 4OONA 4DUYL 1PH4A 4XTCS 4A93G 4P75A 2UXDQ 2YTVA 1VQHA 1VQIA 4YCVA 4BBRH 1PA6A 2ZJRA 1HNZL 4A3LH 1YEZA 1J5EQ 5FLXc 3S1NH 3GTJH 3T1YQ 2CKZB 1YJNA 4GKKQ 4GKJL 3CCLA 3HOXG 1PV4A 2ES2A 4DUZL 5C44G 1KAWA 2UUAL 1FJGQ 1G6PA 4LF9Q 5IP9H 3I4NG 4LF6L 1QUQB 3B6YA 1VCIA 4R4OA 3K80C 3K0XA 4PG3A 4A3JH 4O0AA 2EQSA 4A3EG 1IYJB 4A3FH 1KL9A 3T1HL 4B3RQ 1XMOQ 4GS3A 4LUVA 3HOUG 2Q2UA 3KYHC 2NVXH 2MO0A 3M9BA 2LXKA 1KRTA 1Q82C 3H15A 2QEXA 5JJKA 1JE5A 1IBML 2ASBA 2JA8G 1HNWQ 3CF5A 4JI4Q 1HNZQ 5GAGC 2ZJQA 1JB7A 5ELNA 1OXTA 1L1OC 4IPCA 1OTCA 4YY3L 1X6OA 1RL2A 1UE7A 2IHEA 4JYAL 1P16A 4UY8C 3HKZG 4YCWA 4DV3L 1K8AC 1LTLA 5C4JH 3UDXA 1VQEA 4JC0A 3BZKA 3JC66 3ULPA 1IBKL 4YWKA 2IX1A 1TWCH 3RR5A 3PUXA 4GOPA 1V1QA 3CC7A 2VY3A 3OTOQ 4IPDA 1VQDA 1CKOA 5HGQA 2MNAA 1QVCA 4ME3A 3J7ZC 3CCQA 1Y1VG 3HOVG 2D0PA 1GM5A 1JMCA 5C4XH 3CD6A 1GD7A 4IPHA 2JA7G 3CMEA 4BY7H 4DR1Q 4IFDJ 4C3JH 3OTOL 3CCJA 2VUMH 4JI5Q 2N49A 4DAMA 3ERSX 1NJIC 4LW1A 4R4QA 3GO5A 4DKAC 2VW9A 1EIFA 2E2JH 4LF8Q 4P74A 1NMGA 4DAYB 1D8LA 5LMNW 4A3DH 4AQYQ 1N36Q 1UWVA 1EQRA 3F8TA 1BVSA 3CPFA 3ZJYC 2LSSA 4DV7L 3UE0A 1EFWA 2EXDA 3PF4A 2V1CC 1PH1A 4LFAL 2AWOA 4IJLA 4DR2Q 2A1AA 5FJ8G 1X54A 3STBC 3UDFA 4LF7L 1K3RA 4LNQA 4NXML 3CCUA 2R92H 4HJ5A 5M5XH 1N32L 1X3EA 4BY1G 5C3EG 2IY5B 4OX9L 5JEAG 3BU2A 3T1YL 4R4IA 4YWLA 5H1SE 1E3PA 3TRZA 1R9TH 1M1KC 3HOZH 3J7A5 2ZTCA 4AQYL 1KQSA 2GVBA 4AIMA 4NPSA 5J3BA 3GTLH 1AE3A 1UEBA 3UDGA 3FKIH 4A3FG 1PH3A 1IZ6A 2AWNA 5IWAQ 4LF8L 3HOWG 2KHIA 4JYAQ 3HOXH 2A19A 3CXCA 1X9NA 4EX5A 5IP9G 5M5WH 3I4NH 1VQPA 1TWGH 2ZTDA 4JI5L 2OQKA 1VQ4A 1IBKQ 1VQNA 2F4VL 4A3BG 1FL0A 1VQAA 4BBRG 2E5LQ 1E1OA 2KBNA 3AFQA 2PMZE 1VQ8A 1NTGA 2B63G 3M4OH 2BA0A 5IP7G 4C3IH 4IFDG 4A3BH 4HIDA 1G51A 1AE2A
chains in the Genus database with same CATH superfamily
1I5FA 1MIUA 3OWFA 2EPBA 1PFBA 3Q22A 3MXNB 1ENFA 4KJNA 1H9MA 3GDEA 3C3LA 1TIID 1SMYC 4OWWB 3S24A 1PFMA 1HTPA 3MEHA 2B8FA 3BYTB 3E9HA 2DUDA 4RHSA 3A74A 4KI0A 3LNNA 4YHHL 2GVAA 1Y1VB 4K8JA 5CBAE 4XT3B 4QB4A 5KIXA 4GOPB 1PFSA 2E74C 3G6EA 3HOYG 4OELB 1ICWA 3VA7A 4JI7L 1WTRA 1YVCA 4CJ1B 3I4MG 3NQTA 3HEJA 4CDDC 4DR5Q 4U68A 1EWIA 3J80c 2DNEA 5AFWA 1JJ2A 1HNWL 1D6EC 3EVQA 4K0KL 2UUBQ 4OO1H 1H95A 1SNOA 1FYCA 1AH9A 4CDFC 4JBWA 1TR5A 5IP7H 1YZ6A 2RCNA 1TT2A 4A3JB 1LM0A 3STBD 3PIOA 3IKJA 4L5RC 1RIPA 1SMXA 1SNPA 4LAAA 5C44B 2RKSA 3GD7A 3HKZB 4RGNA 2HUGA 3F1ZA 4APVA 4ZUJA 4B3RL 2M9VA 4CKEA 3J80E 1CKMA 4GN5A 3J81j 3HOUB 1VQCA 1LT4D 1IW7D 3HOUH 3TS0A 2SNMA 1ZYRD 1PHJA 2QEJC 3U58A 1A6XA 4JI8Q 1OXSC 3A7LA 1M90C 1JWSD 3MXPA 1PXUA 5CV9A 2H1EA 5J39A 1EIHA 5C0XI 2F0DA 4JI3Q 3CQZB 4X65Q 2F3WA 2F0JA 4JI6L 3KLWA 4DXGA 1EY9A 1N8RC 1FNVA 5IGDA 1CSPA 3NENA 3PV0A 1VQ9A 4QY7A 4JBMA 3VDYA 3PSIA 4HIOA 3S17H 2AKWB 3GTOB 4RCOA 2VQEL 1LUZA 2DJGC 4DK6C 3E9IA 1QZGA 4A3DB 2IT1A 2L1BA 1A3UA 1B7YB 1TS4A 4J6HA 1I94Q 1MJEA 1PTOD 1GVPA 4K0KQ 4PZ7A 5G3LD 4JI2L 3PUVA 3M3YH 1Q1BA 2JSOA 4C3IG 3PF5A 2B63H 2F0WA 4JVZA 1I94L 2L4NA 5M5XB 3CW2C 5M5YH 2NVXB 2E5LL 1EEID 1EY5A 3BJUA 2TSSA 2HHHL 3SK8A 2G9HD 3S15B 3GTPH 2DGYA 3T51B 1AFPA 1EYAA 4FP5D 3CPWA 2B3GA 4L5TA 4DF7A 2AQ2B 1QCBD 4ZKBB 1L0YB 5JAVA 4LJZC 4GNXA 3A8JE 5C4ZA 5EAYA 2MJ8A 2L55A 2QDBA 4CGYB 2DN8A 3E3XA 2HQEA 3FVQA 5DM63 5C3EH 4S3SA 1XMQL 4BY7B 2B2VA 4AYBB 1ET9A 1U0LA 4FXKC 4LF7Q 4A3CH 4DR4L 4L63B 4A3GG 5C3XA 3CAMA 3E6ZX 1L0WA 3DLLA 1XNQQ 1DYQA 1GO3E 1VDZA 1X65A 1JICA 1MSHA 2JK8A 5KEEA 1C0AA 4RAUC 4MTNA 4A3KB 1AW7A 2R93B 1HJPA 3H3VI 2JE6I 4MZ9A 4JI7Q 1N33L 5FK9C 5IYCG 2YYZA 3GTJB 1EUJA 5EKLA 2I0QA 3NBHB 3UE1A 2Y0SB 2IW3A 4H02A 2UU9Q 1KIXA 2K5HA 4N9PA 1QNKA 2B2TA 5IGCA 3S1QB 3TEHB 2QGQA 2EY2A 2F0EA 1C48A 4FF2A 1M8AA 1Q86C 2HHHQ 2RHSB 1LT6D 3NXWA 3GTKB 1JWUD 2Z0SA 3T56B 5DAUA 2HIVA 4KKSA 4DK1A 1YITA 2PQAB 1EZ6A 2F0OA 4DV2L 2HDMA 4WORA 4B3ML 5TSSA 2IX3A 4DU9A 1JCKB 3DXJC 3L2PA 3I4LA 3AEVA 1XMQQ 1BBXC 5A35A 2CW0D 4G7HC 2ZXPA 2F3VA 2JN4A 3CRKC 4XQQA 1CQFA 1K73C 2PW7A 4HJ8A 1AP0A 4LF9L 1QVFA 2O5JC 2UXBQ 1BCPB 2VQFL 1ASZA 4KKTA 1PTOB 2AUKA 1X55A 1O7YA 1XX8A 5J1ZA 1STHA 2QILA 5EPLA 5FLMH 1JE4A 3Q8DA 4DAVA 2DNCA 2WKDA 1QVGA 1F2LA 5BN4A 3TQYA 4A76A 1K8GA 1IKMA 3KLSA 1K83H 3PQIA 3K58A 4ZQ3A 4GZYC 5LMUL 1N36L 4IQZA 4DPGA 3PIPA 4YY3Q 5C0XJ 1DOLA 2UU9L 1F9QA 4DNTB 5GAHC 1F2YA 2DJFC 2NUCA 3A0JA 1SYGA 3T53B 2B2WA 3NTIA 1I4PA 2KHJA 3RNUA 3PUYA 3KK7A 3BZDB 3KFUA 3JAMc 5IYCH 3HOWH 1K0RA 1RJTA 4JI3L 3GTPB 4B3SQ 3K7AH 2JQOA 1KLUD 4L5SA 4LUZA 2JYOA 5NUCA 4A3GH 1DCZA 1EL0A 2PI2E 2BCOA 2I5LX 1W3SA 2F3IA 1GXDC 3S14H 4QCLA 1G291 1WCMB 4NB3A 3S14B 3A54A 1BOSA 2VZAA 4TQUS 1YIJA 1XMOL 1KD1C 1QE6A 2K75A 5JJIA 4A3DG 3QR8A 5BN5A 3VR3A 1TWCB 1A8VA 3I7FA 1RKNA 1SSOA 1B8AA 2R7ZH 1RODA 3PO2G 3KF8B 4C3IB 1SJHD 1HR0Q 1YHQA 2XVSA 3GTGB 1VQBA 2UXDL 2RSOA 4PMCA 3D4DA 4DUYL 1U4RA 1WTOA 4A93G 4P75A 3P75A 1VQHA 1QOHA 4BBRH 4A3LH 1J5EQ 3M7GA 4GKKQ 4GKJL 4CKBA 5E1FA 3HOXG 4DUZL 1FJGQ 5K36H 2A68C 1RTOA 4MIUA 1UUPA 4LF6L 1QUQB 4PG3A 3K5NA 5A2QL 4A3FH 4B3RQ 4GS3A 2B2UC 1ILPA 1S5DD 4V190 2NVXH 2MO0A 4WJWA 5M5YB 5JJKA 2RCFA 2QF7A 2EYJA 2ASBA 4XQJA 1RD9D 1HNZQ 5GAGC 4PV1C 3FRPB 4IPCA 2IHEA 4UY8C 4ULLA 1SYBA 1NUCA 1VQEA 4JC0A 2GA4B 1XWEA 3OMGA 3RR5A 4K6DA 1V1QA 4GOPA 3ITPA 3R2TA 4IPDA 2MNAA 4JW0A 1KDCA 1Y1VG 2JA7G 3CMEA 4BBSB 3OTOL 4JI5Q 1JR0D 2F0UA 1NJIC 5HGTA 2MP1A 3GO5A 2X6GA 4B9WA 3T4AC 1J8IA 5LMNW 4IUNA 3OIQA 1EQRA 2MHVA 2JA6B 2L9HA 3CPFA 4XXEA 1PZKD 2NB0A 3U9SA 1PH1A 4DR2Q 4K2KA 4KY6A 2A1AA 1X54A 1K3RA 5T1IA 4HJ5A 1NR2A 1X3EA 2K05A 2L5TA 2Z6BA 4HAEA 2IY5B 3BU2A 3TDQA 4YWLA 3T1YL 2ICIA 1B53A 1I4QA 1KQSA 1MI2A 4H0LC 5I6WA 3GTLH 1AE3A 2EVBA 2TMPA 4JYAQ 5C4HA 2A19A 3X3MA 2OT2A 4EX5A 3T16A 5IP9G 4HCEA 1VQAA 4K14A 3MAQA 3AFQA 1HQRD 1VQ8A 2B63G 3M4OH 1ZYRC 5M5WB 2BOSA 1F2MA 1C8CA 4A3BH 2OWOA 1I4XA 4EGVA 1VQGA 4AYBE 2B8GA 4R4CA 1F77A 1SFOH 3SDZA 2I46A 4IOCA 4KD3A 3IFDA 2BE5C 2CW0C 4QGUA 2B2YA 3ND8A 5CR3A 3GTGH 3H0GB 3MWYW 1W6KA 1TQOA 3W5OA 4A3CG 5KGUA 3N6RA 1Y1WG 2IX0A 3A7AB 1O7IA 2OXPA 3S1RH 1JJGA 1AEXA 2YV5A 4JBJA 1A0IA 1CHQD 4GLVB 4ZKCB 1X32A 4K6LA 3SXHA 1RHPA 4GKJQ 5C5LA 4LF4Q 3K5LA 3CU7A 3S1RB 5COYA 2WV6D 1D5MC 1G2SA 4BXXG 5IODA 2A8VA 2XSCA 1GUNA 4UDUC 4KHPQ 3H0GH 4OO1I 4DR4Q 4DR6Q 2AMCB 2C9OA 4X62L 2J4XA 3RZDH 3FDTA 3S17B 1T5XD 1PH5A 2OCEA 1Y1WB 3O13A 4JI0L 4DAPA 2C35B 1UEAB 1D5ZC 1E2ZA 4HR7B 1CI3M 3FEWX 1IBMQ 4X3TA 1FNUA 4DR5L 1BO0A 4DR7Q 1LABA 4KK7A 3EN2A 4WRDA 4DR3Q 4X66Q 2KCMA 1BDOA 1WTVA 1GUOA 4RG1A 3D8GA 4O2DA 1NR4A 1SBBB 4A3BB 5DNFA 4BY7G 1N32Q 2PYKA 3U4ZA 1TWHH 4IPGA 4FF4A 2BDOA 2J7ZA 2VNUD 3HKSA 3JAML 4RMFA 3I3CA 4DV3Q 1JORA 1FR3A 1STEA 3HOYH 2Y0SE 4GNXC 1V1OA 1CKNB 2QW7A 2F0IA 4UAIA 4ALPA 1R9TB 4OL7A 3TZUA 3GTQB 1O7LA 2OQ0A 1TS3A 3EIVA 4K5VA 1GUGA 3MTSA 1YNXA 2B2WC 1X3PA 1LO5D 2A73B 1IBLL 3RZOH 1QG7A 1LT5D 4O42A 1VS0A 4MNOA 5FLXL 4J15A 3BZCA 3CC2A 1QNUA 1SE8A 5M3MB 2WFWA 1E2WA 2NZHA 3CMAA 4JI0Q 2R7ZG 1HUNA 1Z9FA 1PH8A 2F0NA 2NZOA 2V4DA 4ZYSA 2O5IC 5M3MH 3OSOA 5K5PA 4JI1L 4DA2A 1ONLA 1HCZA 2XGTA 1LTTD 3NUCA 1KLGD 5HY6A 1NBWA 4QIWE 2F0GA 3KJPA 3EQLC 3OMCA 3NSWA 2EY6A 4BBSH 1DXMA 4UP9A 3NPPA 3I73A 5C5MA 3K57A 1VQKA 3HG9A 4KLKA 1SNQA 1HR0L 1Q8KA 3K7AB 1H9SB 4XQNA 1EY7A 1HQMC 3HFZB 3H6MA 3OWEB 1D5XC 1T5EA 2A5HA 2JA7H 1B9MA 2LS01 3V96A 3NBHA 2M2LA 4IO9A 1EY6A 1S4ZA 3S16H 1ESRA 2KUMA 4IUPA 4LK1C 2X69A 2EJFC 1UAPA 3R8BA 1RDPD 3M4QA 5BR8L 3SK6A 2RDHA 1SFOB 4CDCC 2NN6H 4F7XA 2ZT9C 5FO9B 1K8MA 4DR6L 4FVMA 1XYIA 4G7OC 4JI4L 4DV5Q 3J81i 1FVIA 3J80i 3VR4A 4X65L 2CWAA 1STAA 2B63B 4HJ9A 2YTYA 4DR7L 3WOEA 3M85A 2OEOA 1FGBD 4X64Q 1KNEA 4ODGA 1L2FA 4RA8A 5AJ3Q 1HRJA 4JI6Q 5CV6A 2N78A 3S15H 1LLRD 4ABNA 5ELCA 3KOJA 4R1JA 5GAEC 3BG3A 2F0PA 4POGA 2E2IB 2F52A 1CSQA 1PH6A 1EEFD 5CGKA 4HTHA 4TVAB 1A2UA 3LWEA 4JOIA 5IYDH 5EBDA 1BXTA 4OO1G 4UP8A 1IW7C 5IT9c 3TREA 4U673 3CCMA 1TU2B 2CH4W 1HZBA 4MHEA 1QZHA 1PTOC 2F03A 3P7JA 2NVQH 4A3JG 1E24A 1VQ5A 2Q8IB 3S1MB 4QMGA 1V8QA 4ZLTF 3GTKH 4XYQA 1JQYD 1MHWC 1PYWD 2H5XA 4DV6L 2EYFA 2FINB 3M4OB 4ZAIA 5M3FG 2K03A 3D31A 3I2ZA 1W2BA 4R9WA 1EU3A 4DFAA 3TSSA 1DONA 3W1BA 3FMCA 1XXGA 1OXUA 4XT1B 3VYRA 4A93B 3F2DA 4KMUC 2R61A 3RZOB 1TS5A 3HOVH 5DM73 5CBEE 3HOYB 1GHJA 3DM1A 2SEBD 5C0XH 4CHTB 3HOZB 1Z47A 2LKVA 3GTQH 2OF1A 2EE1A 4HSVA 4CKCA 2R6GA 3KLRA 1AN8A 3N52A 4DNIA 3RD4A 2PI2A 4A75A 1L0XB 4DV0L 4XDXA 2R7DA 4L6TB 4A93H 1DD2A 2XNAC 3D4RA 3VYSA 1JOQA 1JJCB 4IJHA 4Y52H 4K8IA 5EGTA 4C56C 5CV8A 1I4GA 2UXCQ 1SE3A 4JCVE 1S5BD 1EY8A 2K5VA 1WD1A 1X3FA 3HRZC 2XRQD 1L1OA 1KDBA 3E5SA 1YNND 3I4NB 4H44C 3W2DA 4BA1I 3TMEA 1TWAH 5IY0A 3E0EA 5C44H 1RTNA 5ELDA 5FLMG 4HJAA 3RZDB 2N8NA 2ICEC 4ZK9B 4JOIC 5IIFA 3NTHA 2BA1A 1IXRA 2PQAA 4LFAL 1TXYA 4FDBA 3RUZA 3URYA 1Y1WH 1PRTC 5EKIA 3FP9A 2F4VQ 2ZM6Q 4DV1Q 3A5UA 2K6AA 2K1BA 5C3WA 1BKBA 3OYYA 2Q8TA 1LTGD 3H3VH 1W6JA 3RLOA 4X62Q 1C9OA 4A3MG 2UUAQ 1CUKA 4I65A 1HZCA 3VR6A 4LMQD 3DMUA 3K0YA 3NWTA 2K5WA 4PZ6A 5ELOA 3BDLA 2CQOA 4OIKA 1I4RA 2YU9H 1YBYA 3F2CA 2VUMB 1Q90A 3V2TA 1PA6A 4ZRZA 1WTHA 2WINB 2CKZB 2G5DA 1EIGA 1KAWA 4LF9Q 1GUTA 5IP9H 5D65A 3K0XA 4A3JH 4O0AA 5KRUA 1IYJB 1KL9A 3MFYA 2WKCA 4QUFA 4LUVA 2RQXA 2Q2UA 4C3JG 1SXTA 4YIJA 4A3IB 3H15A 2E2HB 5C3EB 1JE5A 4R8IA 2JA8G 1HNWQ 1PZJD 1A15A 1H9KA 4HSPA 1DZ1A 2ZJQA 2NWGA 5EPKA 1PTOF 2ZXRA 1JB7A 5ELNA 1OXTA 1HTLD 2EY5A 4YY3L 1X6OA 1RL2A 2Z9HA 1OTCA 2EYLA 4IUUA 1GHKA 3J80L 4DV3L 1TWFB 3RMHA 3UDXA 3FPUB 5KNBA 3BZKA 3JC66 3ULPA 1ESFA 5JPMC 1TWCH 2R92B 3MC0B 4OGQC 3W3AA 3D6WA 1CKOA 3J7ZC 1QVCA 4ME3A 3J81E 3WDNA 2D0PA 2HCIA 1JMCA 1A3VA 1GD7A 4C3JH 5ELFA 1G8ZD 4X3UA 4NP5A 4DAMA 3DEPA 2NTTA 2B2VC 4K5WA 2B2TC 4P74A 3UI2A 4DAYB 4A3DH 1KAAA 3S9WA 4AQYQ 1SYCA 1BVSA 2HDLA 3ZJYC 2DY7A 1CK1A 2LSSA 2E2JB 1NSNS 4DV7L 1EFWA 3PF4A 2EXDA 2PQEA 2AWOA 3UDFA 4LF7L 4RCNA 3CCUA 1HPCA 5D14A 4BY1G 5CMDA 4OX9L 3G6JB 4FXDA 5JEAG 4R4IA 1E3PA 3ERQA 3NWSA 3HOZH 3LX0A 4CBVA 3FKIB 3J7AV 1S5FD 4AIMA 4NPSA 3TP7A 3Q24A 3UDGA 4A3FG 4LF8L 2AWNA 3HOWG 5IWAQ 2KHIA 3HOXH 1I6VC 3CKIB 1TWGH 2VB3X 2B2UA 2F4VL 4A3BG 1VF7A 3PO3B 4BBRG 2E5LQ 3MVVA 1E1OA 2KBNA 2LY7A 3HOVB 1NTGA 2WAQB 1JWMD 2F0KA 4DAYA 5IP7G 3MFGA 1LTAD 1G51A 3CCRA 2WP8J 5JJZA 3PIP3 3GTMB 2ZM6L 3FKIG 1MGSA 1OXXK 1STGA 2CH4A 4LF6Q 4OIJA 4A3FB 4A3KH 1QWYA 3TP5A 1EU4A 1NAPA 2R3ZA 4QJFA 4LFCQ 3J7AF 2K14A 2A6EC 4UP7A 5C4XG 4JI1Q 1HHVA 3A8IE 1YHAA 2QCPX 2J0TD 2D62A 2SNSA 1YHBA 4G4KA 4J1MA 3OIPA 3R3OA 4JG2A 2UXCL 5BN3A 3MZ5A 1S40A 4O1NA 3OW2A 1BBUA 1LYLA 1U4MA 1I3QH 2F0TA 4C2MH 1XJVA 4LUOA 4LWCA 1WOCA 2K01A 4E6IA 5LMUQ 4QQBX 1LTRD 1LTSD 3F2BA 2A6HD 1PYBA 4DK3C 5C4XB 3NE5B 3HP3A 2K4KA 4WJ3M 2AUJD 1F9SA 1Q12A 1EQVA 1PYSB 3KUPA 4EQNA 1S72A 3CC4A 1ASYA 5IE8A 3VYUA 2I5MX 4DV1L 1IYUA 5LMNL 1SYEA 2Z4IA 4A3MB 3ONAB 1BQQT 1ML0D 3LGJA 3F2UA 3A8KE 1EYGA 2IPKD 3NHHA 4DV6Q 5KYLA 2Y0SG 2UUCL 1M4VA 2RA4A 4UHVA 2VUMG 4I7AA 4DV4L 1OO9B 3S16B 1BF4A 4OWTB 3AMUA 1I50H 4EQ5A 1HH2P 1Q81C 5IGBA 1CKNA 3SGIA 4N8X1 1K83B 1YJWA 3DWQA 5AJ3L 1HR0W 1ZKOA 4JV5L 4OWXB 2K50A 2CFMA 3T1HQ 4FO2A 1EIYB 3MA2B 4X64L 4C3JB 3OHXC 2JA5B 2VQFQ 1PMRA 4NXNL 5LHY1 3K8AA 3KJOA 1ILQA 2EJGC 2BH8A 1VQLA 1KHIA 2O4XA 4QL5A 3MXGA 1E7ZA 1R4PB 3HOXB 4RH6A 1ZEQX 1TVXA 1U9RA 2NN6G 1A2TA 3HOWB 2A69C 1N34Q 2JA6G 3H3VC 5CV5A 4KHZA 2JA5G 1HA6A 3DHQA 2KEEA 2E2HH 3NTKA 3PCOB 1CZGA 3GTOH 1YNNC 4Y7NB 1Q1EA 2K7VA 5CYUA 1I6HB 1SLJA 5FOBB 2ATWA 1T9HA 2I07B 4R8NA 1IBLQ 4A3EH 3QIAA 3U9OA 4P71A 4TRDA 1HZ9A 2YTXA 2PO4A 2ZXOA 4IN3A 1PLFA 3ER0A 1NMFA 4NXMQ 4NXNQ 1KNAA 1EWHA 2MFIA 4YHHQ 5IGEA 3AYHB 1KC8C 1LT3D 2E2DC 4TKOB 2K52A 1V43A 4B3TQ 3BVMA 2NN6I 2MQHA 2UXBL 1TWGB 3CHBD 1G2TA 2PZWA 1XPUA 4OHJA 1E0BA 1PH2A 3QO2A 2E75C 3SK4A 2HD3A 1G6ZA 3PO3G 1XPRA 4N8FA 1QUQA 2F0LA 1N33Q 3ND9A 4POFA 2KQ3A 5GROA 3KF6B 4LFAQ 1ZXTA 1R4QB 3QG1A 2BDNA 3D4WA 4DXFA 3ZYYX 2LXJA 1Z7TA 1NY4A 3RN5A 1RCVD 4A4IA 2E8GA 3CP0A 4DUYQ 3I4OA 4RGTA 3OOCA 4PQXA 3KDFA 5E4XA 5GQOA 4HN7A 3DWPA 5LL6X 3IFTA 3NEMA 1HNXQ 4KV6A 4NW2A 5EKKA 4JI8L 1V9PA 4GNXB 4IOAA 1XNRQ 3A5ZB 5JEAH 4AYBG 3H09A 2MO1A 1Q7YC 3L3OC 5FJ8H 2NVYB 3PGZA 4LF5Q 2IL8A 3I4MH 1TWFH 4DR3L 1JB3A 1KDAA 1B44D 2F0QA 3K6OA 4DNRB 5L37A 2EIFA 2HCCA 3S2HB 4ZUIA 1WI5A 3BVGA 1VF5C 3OPOA 4X66L 3QJYA 1WCMG 3KLSX 2A74C 2SOBA 3S2HH 4ZCKA 4A3IH 4PMWA 3PIO3 4A3MH 4X3SA 3M4PA 2WB1G 2MGSA 1CM9A 4NDXA 4GLXA 3VYTA 2KENA 3SR1A 5IOCA 3NP8A 5EQ0A 3PO2B 2HT1A 2KCNA 1WTWA 1XTCD 2P5ZX 3K5MA 1FGUA 3Q0AA 2ZJPA 2JEAI 1YNJD 4LF4L 1ENCA 3HS0C 5E3FA 2GN5A 3GTMH 2JJQA 1Y8NB 2JA8H 3P1HA 4YCUA 1DJRD 2JA7B 2ID0A 1NNXA 1H9SA 3A55A 3AU7A 3E0JA 2AQ3B 2Q2HA 3L9AX 3WWVA 3CCEA 1D7QA 1BR9A 2R7ZB 2WB1B 1XTDA 4A3KG 3HZXA 3PO2H 5I9OA 1SEBD 5JVG3 2JA9A 4M1UB 1VQJA 2VS1A 5D3DA 2R92G 1ICFB 1I6HH 4DV4Q 4IFDI 3OW7A 1BCPD 1SYFA 2I5HA 4Y7NH 3T13A 1A3TA 1STYA 3I70A 4MN3A 2CWPA 5JPNC 1HA5A 2EJMA 2VQEQ 3G71A 1LTBD 2OTLA 3CQZH 3C2PA 2RSNA 3L0OA 2VL6A 4HIDA 1OXVA 4CJ0B 3TP8A 1SN8A 1EOVA 5E7NA 4HIKA 1HFGA 1Y1VH 2NVYH 1EQTA 4C1NK 2FMMA 4C3HG 1X3GA 2PNHA 5M3FH 4OONA 5ISRA 1PH4A 2EYPA 1PRTF 4XTCS 2UXDQ 2YTVA 3DEOA 1YEZA 2EZVA 1HFNA 5FLXc 2N88A 3GTJH 3T1YQ 2VXWA 5E4WC 3QOJA 1MBYA 2ES2A 5C44G 2UUAL 3B6YA 1VCIA 3K80C 4L8JA 4RGOS 2PMZB 1SJED 4KKUA 3IAYA 4WFN3 1S5CD 1GUWA 3HOUG 4C3HB 1S5ED 2IJ0A 2LXKA 3M9BA 4IUTA 5FO7B 1Q82C 2QEXA 3PMFA 3QB3A 3BVZA 5CV7A 1IBML 3CF5A 4JI4Q 1GJXA 1L1OC 4JYAL 1UE7A 1EYDA 1TS2A 2CHBD 1K8AC 1LTLA 1WTQA 1CTMA 2IX1A 4YWKA 2ENBA 1GOZA 3VR5A 3PUXA 1RF2D 3OTOQ 3CCQA 3KF8A 1O80A 1GM5A 1QB5D 2RVLA 4B9XA 5C4XH 3CD6A 1WD0A 5CV4A 2K5DA 4IFDJ 1CZWA 4HMIA 2VUMH 4QUCA 2N49A 2YU9B 1E2VA 4KN7C 3M3YB 3BDOA 3NQIA 2VW9A 4H7BA 2Z1CA 4LF8Q 1NMGA 1BUVT 3WOFA 1D8LA 2Z8LA 2NTSA 1N36Q 1V1PA 2CQAA 3CRLC 1K0SA 4XYOA 3UE0A 1Q8IA 4IJLA 5FJ8G 2MPMA 3STBC 5IT9L 1D1IA 3HGBA 3EA6A 1M1KC 3J7A5 1F2ZA 4AQYL 1FD7D 1B3AA 1V1PB 4NMZA 1PDQA 1UEBA 3MXUA 3CXCA 1WTXA 4HMJA 3I4NH 5M5WH 1VQNA 1AZPA 4BWGB 2D9UA 4H13C 2PMZE 5LL6S 4MTKA 4Q5VA 4NKLA 3C46A 4EQOA 4WJ4A 3EROA 5D3IB 5M3MG 2K5QA 2N3SA 4RKLA 3GTLB 3G48A 3AFPA 1O7ZA 2A68D 4QIWB 5IYBG 3R2IA 2A6ED 4RGMA 4J8QA 2VB2X 2FHTA 2JXMB 1B70B 1VQFA 5M3FB 3MHBA 4G7ZC 1K28A 5G3LF 5JOBA 1EWCA 2RF4A 1O78A 1Q46A 2B29A 1SE4A 4DGZA 3R93A 1YNJC 2LMCB 4UPAA 2NVTH 2A6HC 4DR1L 3L7ZC 3W1GA 1PTOH 4M8AA 3DUZA 4HIMA 1S3OA 2B39A 2NVTB 1IKLA 5IYBH 2A69D 1YI2A 4KY5A 3K7UC 2Z6KA 3P20A 2NBFA 1WJJA 1ET6A 1STNA 2FXQA 2K33A 2R7FA 3H91A 2O2LD 4KHPL 4P2CB 2RHQB 1BBWA 4B3TL 3NBIA 3QWNA 4P72A 1U5KA 1VQ7A 1F9PA 3I8ZA 4N9TA 2Z6KC 3D3RA 3U4VA 4R4TA 1SMYD 2OTJA 3CCSA 2PPBC 2FMCA 1QJOA 2R93H 1B50A 1NCVA 2AHOB 1UE5A 3C1FA 3LWUA 5T1GA 4JV5Q 3M7NA 2XWBB 5IWAL 4HCSA 1CA6A 4A3IG 4BXXH 2ZTEA 3JAMi 3H0GG 3PO3H 1SNCA 1GUSA 2HQLA 1J5EL 3S1MH 1JOOA 2EXZA 4PZ8A 1MKHA 4JBKA 3GP7A 1B2TA 1C4QA 3IRBA 3BDCA 3TZDA 2PCFB 2L11A 2UUCQ 1IL8A 4K2LA 3J7YW 2RDFA 3D0FA 3K5OA 5DEHA 4FF3A 1VQOA 4AH6A 4BA2I 4RKBA 2KOLA 3QOLA 2Q2TA 1E22A 1B4OA 1LACA 3TN2A 4DV2Q 2RBMA 5IT9E 2QA4A 3SEBA 4LFBL 3K81C 4GN3B 5KYIA 1XNRL 1SAPA 2K5NA 2K04A 1UE6A 4DV5L 2WIIB 1I3QB 1Z6HA 4C2MB 3GV3A 2XTIA 3I72A 2E76C 4IFDH 1YJ9A 1VQMA 5KNDA 3MEFA 5A2QE 3BYYB 1LV9A 4OEMB 5FO8B 1K3BC 2XIWA 1TWAB 1K9MC 2L15A 3HOZG 2N55A 2EY1A 1XPOA 1B1ZA 1BNZA 5I2XA 1N34L 3J81c 4L5QA 4FNFA 1DM0B 3RLFA 1PVOA 4KTAA 2M00A 2WAQG 1IHZA 2QDLA 2KA7A 4BBSG 1PH7A 4IURA 3TS2A 1U4LA 2WB1E 4JI2Q 2SDFA 1EZ8A 4FXGC 1IYVA 4EVOA 2C5CA 4OXPA 1II3A 3IL8A 1KXLA 2FFKB 4LF5L 3AQQA 1P8LA 1WCMH 1EY0A 1PH9A 2IHFA 5EBCA 1MJCA 2KCTA 3FHWA 5I4DA 2ALYB 3PUWA 1J9OA 5C6AA 1E1TA 1KABA 1SNDA 4I7ZC 3KBGA 1X3QA 4OX9Q 2EYHA 1GKHA 1JOKA 4IZ8A 2JA6H 4DN4M 4IUQA 4JK1C 5C0XG 1SE2A 4DV7Q 1EQQA 3ICEA 4A3EB 1EFID 1JT8A 1VQ6A 2G9DA 2EYOA 1I4HA 2H4OA 1XNQL 4BBRB 5F2DA 4C1NI 4F8MA 3KF6A 3JAME 1JC7A 4IUVA 4X3KA 2JEBI 4YWMA 3NK9A 3ULJA 2E2IH 3C1EA 1A62A 1AE2A 4ME5A 2FJ2A 3DM3A 1DOKA 2F0FA 5LMNQ 1DGSA 3DWAA 2PW5A 2F4IA 3RLNA 1NE3A 3H94A 1SR3A 1SROA 5C4JB 5I9PA 2BE5D 2X6LA 1WYDA 2MUYA 1LTID 3U50C 2BH2A 2XN9C 4A3LG 1BCPF 5ELEA 4KY7A 3I91A 2D0OA 1J6QA 3EJIA 4GN4B 4K5XA 3J81L 1F9RA 1HNXL 1STBA 1SRUA 1X56A 1Q3LA 2HIXA 3FPPA 1H9RA 1WFQA 2Q8RE 1UE1A 1SDFA 2F0MA 2QKIC 2IWHA 5JVH3 4DR2L 4LFBQ 1KRSA 3EFXD 5BR8Q 5IYDG 3MXNA 4A3GB 2XRSD 5KNCA 5DLQE 3ULLA 2EDGA 2K32A 2KECA 4B3SL 3D6CA 5EJWA 2R93G 1VMPA 1K8OA 1L1OB 2F0HA 4PMBA 2NVQB 1A63A 3S2DH 5JJLA 3CCVA 4RWSC 4LFCL 1CT1D 2PZUA 2L12A 1EOTA 5FKAC 1PRTB 1B3QA 2CCZA 1BCPC 1HXYD 3GV6A 3UDIA 4C3HH 2UUBL 1WTPA 2PZTA 1TY2A 2DY8A 3A56A 4DV0Q 4CJ2C 1U4PA 4FYDA 4KHVA 1HZAA 4TSSA 4GOPC 1SNMA 2WAQE 4X6AH 4PNYA 1TY0A 2KJXA 1WVLA 3Q6SA 3NELA 3TBIB 1MD2D 3I4MB 5K36G 3RN2A 5GADC 3SVMA 4HJ7A 4BY1H 3HKZE 3S1QH 1Y14B 2XWJB 1MSGA 3KDFB 5M9OA 5ELBA 5JEAJ 3I55A 2JA5H 2EOTA 4BY1B 1C7YA 3GQBA 3SE0A 3G4SA 4Q0FA 2JP1A 2CVRA 3Q23A 3EBEA 1PRTD 4P73A 4GLAC 4RFBA 4XIGS 4DUZQ 1FJGL 2D5DA 4GKKL 3K59A 1UNSA 1N9WA 3PUZA 4B3MQ 3AB9A 4F88A 2Q2IA 3VA5A 1IL2A 3I56A 2NYZD 3V05A 1G91A 5J22A 1B9NA 1CA5A 4YCVA 1VQIA 5I6YA 2Z4HA 2ZJRA 1HNZL 1Y8OB 4KD4A 3S1NH 1YJNA 3CCLA 3S1NB 1PV4A 1G6PA 3I4NG 4QF4A 3BS1A 4R4OA 4BS9A 1AZQA 3I90A 2EQSA 2KEDA 4A3EG 2L0CA 3T1HL 4KN4C 4Z9CB 1XMOQ 2F0SA 4F87A 5CORA 3TP6A 3VR2A 3KYHC 1SYDA 1DOMA 1KRTA 1ENAA 1TKWB 1D2BA 1VMCA 1KTKA 2KCCA 2KVMA 1Y69U 1P16A 3HKZG 4YCWA 5C4JH 4CDEC 1IBKL 4EQPA 3CC7A 2VY3A 1PFNA 1VQDA 5HGQA 3HOVG 2K28A 1H9JA 2B2YC 4IPHA 4V0BA 4BY7H 4DR1Q 4ID6A 3CCJA 1CHPD 4RHRA 1EY4A 3ERSX 2AQ1B 4B08A 4LW1A 4R4QA 5IGGA 4DKAC 1EIFA 3X3NA 2E2JH 1CFMA 4ILWA 1UWVA 4G57A 2WACA 3F8TA 3SK5A 1CQVA 4IALA 4HEDA 2V1CC 5IGFA 4KJOA 4NXML 4LNQA 2R92H 1N32L 3G7LA 2NZ1D 5M5XH 1D1KA 5C3EG 2EYMA 1FNWA 5H1SE 2JA8B 3TRZA 2LFNA 1R9TH 1PZID 2ZTCA 5FLXE 2GVBA 5EPJA 5J3BA 1QILA 2D2CC 3FKIH 2PNRC 1Y8PB 1IZ6A 2KHSA 2RDGA 1PH3A 4DK0A 1EYCA 3S2DB 1X9NA 1I50B 2F0VA 5CC4A 1VQPA 2ZTDA 4JI5L 5I2YA 2OQKA 1VQ4A 1IBKQ 4FF1A 3KBXA 1FL0A 4JPBW 1TWHB 1HUMA 3SHLA 5HURA 2BA0A 4C3IH 4IFDG 2F1MA 3M4YA
chains in the Genus database with same CATH topology
1I5FA 1MIUA 3CCRA 2WP8J 4WJ4A 5M3MG 2N3SA 1VQGA 3G48A 3AFPA 3MXNB 4AYBE 3FKIG 2ZM6L 1OXXK 3GDEA 4JI7L 4LF6Q 5IYBG 4R4CA 4A3KH 4OWWB 3S24A 1SFOH 3E9HA 4QJFA 4LFCQ 2DUDA 2K14A 4IOCA 1B70B 1VQFA 3A74A 4UP7A 5C4XG 4KI0A 4JI1Q 4YHHL 1YHAA 2GVAA 4QGUA 3GTGH 2D62A 3M3YH 2RF4A 4GOPB 1YHBA 1PFSA 1Q46A 3W5OA 4A3CG 2B29A 1Y1WG 4JG2A 2UXCL 2IX0A 4UPAA 1O7IA 3G6EA 3S1RH 2NVTH 3HOYG 1JJGA 1S40A 3OW2A 2YV5A 1BBUA 1YVCA 4JBJA 1A0IA 1LYLA 4DR1L 1I3QH 3L7ZC 4GLVB 3W1GA 4C2MH 1XJVA 4HIMA 4LUOA 3I4MG 1S3OA 4GKJQ 4LWCA 1WOCA 4DR5Q 4LF4Q 5LMUQ 1EWIA 3J80c 4QQBX 3F2BA 5IYBH 1PYBA 4DK3C 1JJ2A 4BXXG 2K4KA 2A8VA 1HNWL 1YI2A 4K0KL 2UUBQ 4WJ3M 1H95A 4KHPQ 1Q12A 3H0GH 3K7UC 4OO1I 4DR4Q 1PYSB 4DR6Q 2AMCB 2Z6KA 4X62L 3RZDH 1S72A 3CC4A 1ASYA 1WJJA 2R7FA 2FXQA 5IE8A 1AH9A 1PH5A 4KHPL 4JBWA 2OCEA 2RHQB 1BBWA 2I5MX 5IP7H 4B3TL 2C35B 4DV1L 4JI0L 1YZ6A 2RCNA 5LMNL 1IBMQ 4P72A 1LM0A 1U5KA 3STBD 3PIOA 1VQ7A 4DR5L 4L5RC 1RIPA 4DR7Q 3EN2A 1SMXA 2Z6KC 4DR3Q 3LGJA 4X66Q 2KCMA 3GD7A 3U4VA 4R4TA 2OTJA 3CCSA 1EYGA 3F1ZA 4APVA 4B3RL 4RG1A 2R93H 2AHOB 1UE5A 4O2DA 4DV6Q 1CKMA 2Y0SG 4GN5A 2UUCL 3M7NA 4JV5Q 4BY7G 3J81j 1N32Q 5IWAL 1VQCA 2VUMG 4BXXH 4A3IG 3HOUH 2ZTEA 3U4ZA 3TS0A 1TWHH 3JAMi 4IPGA 3H0GG 4DV4L 3PO3H 1PHJA 3U58A 4JI8Q 1OXSC 2HQLA 1J5EL 4OWTB 3S1MH 2VNUD 1I50H 1M90C 4EQ5A 1HH2P 3HKSA 4PZ8A 1Q81C 1MKHA 1CKNA 4RMFA 3SGIA 4JBKA 5C0XI 4DV3Q 4JI3Q 1YJWA 1HR0W 3HOYH 2Y0SE 5AJ3L 4X65Q 3IRBA 4GNXC 4JI6L 3KLWA 1CKNB 2UUCQ 4OWXB 4JV5L 4ALPA 1N8RC 2K50A 2CFMA 1CSPA 3T1HQ 1EIYB 3NENA 4X64L 3D0FA 2OQ0A 3PV0A 3EIVA 1VQ9A 1YNXA 4QY7A 2VQFQ 4JBMA 4NXNL 1IBLL 3K8AA 3KJOA 4AH6A 3VDYA 1VQOA 3PSIA 3RZOH 4BA2I 4HIOA 1VS0A 4MNOA 3S17H 2AKWB 1E22A 3BZCA 4J15A 2BH8A 1VQLA 1SE8A 1KHIA 2Q2TA 2WFWA 3CMAA 2NZHA 2VQEL 3CC2A 1LUZA 4JI0Q 4DK6C 3E9IA 4DV2Q 2R7ZG 4QL5A 2QA4A 1E7ZA 1Z9FA 1QZGA 4LFBL 3K81C 2IT1A 4GN3B 1PH8A 2NZOA 5M3MH 1B7YB 1XNRL 2NN6G 1I94Q 1MJEA 1GVPA 4K0KQ 2K5NA 4PZ7A 1UE6A 4JI1L 3PUVA 2XGTA 1Q1BA 4DV5L 1N34Q 4JI2L 2JA6G 3PF5A 5HY6A 1NBWA 4QIWE 3KJPA 4KHZA 2B63H 2XTIA 2JA5G 1I94L 4BBSH 2E2HH 4UP9A 3PCOB 1YJ9A 3CW2C 5M5YH 3GTOH 1VQMA 2E5LL 1Q1EA 3MEFA 3BJUA 1VQKA 1SLJA 2HHHL 4KLKA 3GTPH 2DGYA 1HR0L 1Q8KA 2ATWA 1T9HA 1K9MC 3CPWA 2B3GA 4L5TA 2L15A 3HOZG 3HFZB 1IBLQ 4A3EH 4GNXA 1XPOA 5EAYA 4P71A 2JA7H 1N34L 3J81c 4L5QA 1HZ9A 4IO9A 2YTXA 3RLFA 5C3EH 1PVOA 1XMQL 3ER0A 1NMFA 4LF7Q 1U0LA 4NXMQ 3S16H 4A3CH 2WAQG 4DR4L 4NXNQ 2MFIA 4YHHQ 4BBSG 1PH7A 3AYHB 3CAMA 4A3GG 1L0WA 3DLLA 3TS2A 2WB1E 1XNQQ 1KC8C 4JI2Q 1GO3E 2K52A 1V43A 3M4QA 4B3TQ 5BR8L 1X65A 2NN6I 2JK8A 1C0AA 4MTNA 2MQHA 2UXBL 1HJPA 3H3VI 1XPUA 2JE6I 4MZ9A 4JI7Q 1PH2A 4DR6L 4OXPA 1N33L 5IYCG 2YYZA 1FJGL 1EUJA 2I0QA 1KXLA 4LF5L 3NBHB 3UE1A 4JI4L 3PO3G 4DV5Q 3J81i 4H02A 3AQQA 1FVIA 1P8LA 1QUQA 1WCMH 1XPRA 2UU9Q 1N33Q 3J80i 4X65L 4POFA 2CWAA 1PH9A 5GROA 1KIXA 3KF6B 2IHFA 2K5HA 4LFAQ 4HJ9A 2YTYA 4DR7L 3M85A 1MJCA 2KCTA 3FHWA 3TEHB 4X64Q 2QGQA 2ALYB 3PUWA 2LXJA 1E1TA 1NY4A 1Q86C 2HHHQ 2RHSB 3RN5A 1L2FA 4A4IA 4OX9Q 2E8GA 3CP0A 5AJ3Q 2Z0SA 4DUYQ 1GKHA 4JI6Q 2HIVA 2N78A 3S15H 2JA6H 3I4OA 3KOJA 4R1JA 5C0XG 1YITA 2PQAB 3KDFA 5GQOA 5GAEC 4DV7Q 4DV2L 1EQQA 4B3ML 3ICEA 1JT8A 4POGA 1VQ6A 3NEMA 1HNXQ 2F52A 1CSQA 1PH6A 1XNQL 4JI8L 1V9PA 4GNXB 4IOAA 4TVAB 4JOIA 1XNRQ 3L2PA 3KF6A 3A5ZB 3AEVA 5IYDH 2JEBI 4YWMA 4AYBG 3ULJA 1XMQQ 2E2IH 4OO1G 1A62A 2MO1A 4UP8A 5IT9c 1Q7YC 3TREA 3DM3A 5FJ8H 3CCMA 5LMNQ 1DGSA 3PGZA 1HZBA 4LF5Q 1QZHA 3RLNA 1NE3A 2NVQH 3I4MH 1SR3A 1SROA 1TWFH 4A3JG 1K73C 4HJ8A 1E24A 4LF9L 1QVFA 4DR3L 1WYDA 1VQ5A 2BH2A 3U50C 2UXBQ 2VQFL 4A3LG 3GTKH 2D0OA 1J6QA 1ASZA 4GN4B 4DV6L 2H5XA 1HNXL 2EIFA 1X55A 5M3FG 1SRUA 1X56A 3D31A 3I2ZA 1W2BA 1WI5A 5FLMH 2HIXA 4X66L 3Q8DA 1WFQA 3W1BA 1UE1A 4DR2L 4LFBQ 1WCMG 1OXUA 1QVGA 1KRSA 5BR8Q 3S2HH 3F2DA 3TQYA 5IYDG 4A76A 1K8GA 4A3IH 4PMWA 1K83H 3HOVH 4A3MH 3M4PA 5DLQE 5LMUL 2WB1G 1N36L 3ULLA 4GLXA 1Z47A 3GTQH 4B3SL 2KENA 4DPGA 3PIPA 2R93G 2R6GA 4YY3Q 1L1OB 5C0XJ 2HT1A 3H3VH 4DNIA 2UU9L 3S2DH 5JJLA 3CCVA 1A63A 2PI2A 5GAHC 4LFCL 4A75A 1FGUA 2ZJPA 2JEAI 3A0JA 4DV0L 4LF4L 3GTMH 2GN5A 2R7DA 4A93H 2JJQA 2JA8H 2CCZA 2KHJA 4YCUA 3RNUA 3PUYA 3UDIA 1JJCB 4IJHA 2ID0A 4C3HH 2UUBL 4DV0Q 4Y52H 1HZAA 2Q2HA 3WWVA 3KFUA 3CCEA 2UXCQ 4GOPC 1D7QA 4JCVE 3JAMc 5IYCH 2WAQE 3HOWH 4X6AH 1XTDA 1K0RA 2K5VA 1X3FA 4A3KG 3PO2H 1L1OA 2JA9A 4JI3L 4B3SQ 1VQJA 3NELA 4BA1I 2OWOA 3K7AH 1TWAH 5IY0A 3E0EA 5C44H 5K36G 2VS1A 3RN2A 2R92G 2JQOA 5GADC 4HJ7A 4L5SA 4LUZA 5FLMG 4HJAA 4BY1H 2N8NA 4A3GH 3HKZE 1I6HH 4DV4Q 3S1QH 4IFDI 4JOIC 1Y14B 2BA1A 2PQAA 1IXRA 2I5HA 2PI2E 3KDFB 4Y7NH 2I5LX 3I55A 1TXYA 1W3SA 4FDBA 5JEAJ 1Y1WH 2F3IA 3S14H 2JA5H 1G291 4NB3A 3FP9A 2CWPA 1C7YA 2F4VQ 2ZM6Q 2VZAA 4TQUS 1YIJA 1XMOL 4DV1Q 2VQEQ 1KD1C 3A5UA 3G4SA 3G71A 2K75A 3EBEA 2OTLA 4A3DG 5JJIA 3CQZH 1BKBA 3OYYA 3L0OA 2VL6A 4GLAC 4P73A 4XIGS 3RLOA 4X62Q 1A8VA 1C9OA 4DUZQ 1CUKA 3I7FA 1OXVA 4A3MG 4GKKL 1HZCA 1B8AA 2R7ZH 3PO2G 3KF8B 1N9WA 3PUZA 1SN8A 1EOVA 5E7NA 4HIKA 1HR0Q 4PZ6A 5ELOA 1YHQA 2UUAQ 1Y1VH 4B3MQ 2CQOA 2NVYH 1VQBA 2UXDL 2Q2IA 1X3GA 2YU9H 1IL2A 2PNHA 5M3FH 1YBYA 3I56A 3F2CA 4OONA 4DUYL 1PH4A 4XTCS 4A93G 4P75A 2UXDQ 2YTVA 1VQHA 1VQIA 4YCVA 4BBRH 1PA6A 2ZJRA 1HNZL 4A3LH 1YEZA 1J5EQ 5FLXc 3S1NH 3GTJH 3T1YQ 2CKZB 1YJNA 4GKKQ 4GKJL 3CCLA 3HOXG 1PV4A 2ES2A 4DUZL 5C44G 1KAWA 2UUAL 1FJGQ 1G6PA 4LF9Q 5IP9H 3I4NG 4LF6L 1QUQB 3B6YA 1VCIA 4R4OA 3K80C 3K0XA 4PG3A 4A3JH 4O0AA 2EQSA 4A3EG 1IYJB 4A3FH 1KL9A 3T1HL 4B3RQ 1XMOQ 4GS3A 4LUVA 3HOUG 2Q2UA 3KYHC 2NVXH 2MO0A 3M9BA 2LXKA 1KRTA 1Q82C 3H15A 2QEXA 5JJKA 1JE5A 1IBML 2ASBA 2JA8G 1HNWQ 3CF5A 4JI4Q 1HNZQ 5GAGC 2ZJQA 1JB7A 5ELNA 1OXTA 1L1OC 4IPCA 1OTCA 4YY3L 1X6OA 1RL2A 1UE7A 2IHEA 4JYAL 1P16A 4UY8C 3HKZG 4YCWA 4DV3L 1K8AC 1LTLA 5C4JH 3UDXA 1VQEA 4JC0A 3BZKA 3JC66 3ULPA 1IBKL 4YWKA 2IX1A 1TWCH 3RR5A 3PUXA 4GOPA 1V1QA 3CC7A 2VY3A 3OTOQ 4IPDA 1VQDA 1CKOA 5HGQA 2MNAA 1QVCA 4ME3A 3J7ZC 3CCQA 1Y1VG 3HOVG 2D0PA 1GM5A 1JMCA 5C4XH 3CD6A 1GD7A 4IPHA 2JA7G 3CMEA 4BY7H 4DR1Q 4IFDJ 4C3JH 3OTOL 3CCJA 2VUMH 4JI5Q 2N49A 4DAMA 3ERSX 1NJIC 4LW1A 4R4QA 3GO5A 4DKAC 2VW9A 1EIFA 2E2JH 4LF8Q 4P74A 1NMGA 4DAYB 1D8LA 5LMNW 4A3DH 4AQYQ 1N36Q 1UWVA 1EQRA 3F8TA 1BVSA 3CPFA 3ZJYC 2LSSA 4DV7L 3UE0A 1EFWA 2EXDA 3PF4A 2V1CC 1PH1A 4LFAL 2AWOA 4IJLA 4DR2Q 2A1AA 5FJ8G 1X54A 3STBC 3UDFA 4LF7L 1K3RA 4LNQA 4NXML 3CCUA 2R92H 4HJ5A 5M5XH 1N32L 1X3EA 4BY1G 5C3EG 2IY5B 4OX9L 5JEAG 3BU2A 3T1YL 4R4IA 4YWLA 5H1SE 1E3PA 3TRZA 1R9TH 1M1KC 3HOZH 3J7A5 2ZTCA 4AQYL 1KQSA 2GVBA 4AIMA 4NPSA 5J3BA 3GTLH 1AE3A 1UEBA 3UDGA 3FKIH 4A3FG 1PH3A 1IZ6A 2AWNA 5IWAQ 4LF8L 3HOWG 2KHIA 4JYAQ 3HOXH 2A19A 3CXCA 1X9NA 4EX5A 5IP9G 5M5WH 3I4NH 1VQPA 1TWGH 2ZTDA 4JI5L 2OQKA 1VQ4A 1IBKQ 1VQNA 2F4VL 4A3BG 1FL0A 1VQAA 4BBRG 2E5LQ 1E1OA 2KBNA 3AFQA 2PMZE 1VQ8A 1NTGA 2B63G 3M4OH 2BA0A 5IP7G 4C3IH 4IFDG 4A3BH 4HIDA 1G51A 1AE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I5F A;  1MIU A;  3CCR A;  2WP8 J;  4WJ4 A;  5M3M G;  2N3S A;  1VQG A;  3G48 A;  3AFP A;  3MXN B;  4AYB E;  3FKI G;  2ZM6 L;  1OXX K;  3GDE A;  4JI7 L;  4LF6 Q;  5IYB G;  4R4C A;  4A3K H;  4OWW B;  3S24 A;  1SFO H;  3E9H A;  4QJF A;  4LFC Q;  2DUD A;  2K14 A;  4IOC A;  1B70 B;  1VQF A;  3A74 A;  4UP7 A;  5C4X G;  4KI0 A;  4JI1 Q;  4YHH L;  1YHA A;  2GVA A;  4QGU A;  3GTG H;  2D62 A;  3M3Y H;  2RF4 A;  4GOP B;  1YHB A;  1PFS A;  1Q46 A;  3W5O A;  4A3C G;  2B29 A;  1Y1W G;  4JG2 A;  2UXC L;  2IX0 A;  4UPA A;  1O7I A;  3G6E A;  3S1R H;  2NVT H;  3HOY G;  1JJG A;  1S40 A;  3OW2 A;  2YV5 A;  1BBU A;  1YVC A;  4JBJ A;  1A0I A;  1LYL A;  4DR1 L;  1I3Q H;  3L7Z C;  4GLV B;  3W1G A;  4C2M H;  1XJV A;  4HIM A;  4LUO A;  3I4M G;  1S3O A;  4GKJ Q;  4LWC A;  1WOC A;  4DR5 Q;  4LF4 Q;  5LMU Q;  1EWI A;  3J80 c;  4QQB X;  3F2B A;  5IYB H;  1PYB A;  4DK3 C;  1JJ2 A;  4BXX G;  2K4K A;  2A8V A;  1HNW L;  1YI2 A;  4K0K L;  2UUB Q;  4WJ3 M;  1H95 A;  4KHP Q;  1Q12 A;  3H0G H;  3K7U C;  4OO1 I;  4DR4 Q;  1PYS B;  4DR6 Q;  2AMC B;  2Z6K A;  4X62 L;  3RZD H;  1S72 A;  3CC4 A;  1ASY A;  1WJJ A;  2R7F A;  2FXQ A;  5IE8 A;  1AH9 A;  1PH5 A;  4KHP L;  4JBW A;  2OCE A;  2RHQ B;  1BBW A;  2I5M X;  5IP7 H;  4B3T L;  2C35 B;  4DV1 L;  4JI0 L;  1YZ6 A;  2RCN A;  5LMN L;  1IBM Q;  4P72 A;  1LM0 A;  1U5K A;  3STB D;  3PIO A;  1VQ7 A;  4DR5 L;  4L5R C;  1RIP A;  4DR7 Q;  3EN2 A;  1SMX A;  2Z6K C;  4DR3 Q;  3LGJ A;  4X66 Q;  2KCM A;  3GD7 A;  3U4V A;  4R4T A;  2OTJ A;  3CCS A;  1EYG A;  3F1Z A;  4APV A;  4B3R L;  4RG1 A;  2R93 H;  2AHO B;  1UE5 A;  4O2D A;  4DV6 Q;  1CKM A;  2Y0S G;  4GN5 A;  2UUC L;  3M7N A;  4JV5 Q;  4BY7 G;  3J81 j;  1N32 Q;  5IWA L;  1VQC A;  2VUM G;  4BXX H;  4A3I G;  3HOU H;  2ZTE A;  3U4Z A;  3TS0 A;  1TWH H;  3JAM i;  4IPG A;  3H0G G;  4DV4 L;  3PO3 H;  1PHJ A;  3U58 A;  4JI8 Q;  1OXS C;  2HQL A;  1J5E L;  4OWT B;  3S1M H;  2VNU D;  1I50 H;  1M90 C;  4EQ5 A;  1HH2 P;  3HKS A;  4PZ8 A;  1Q81 C;  1MKH A;  1CKN A;  4RMF A;  3SGI A;  4JBK A;  5C0X I;  4DV3 Q;  4JI3 Q;  1YJW A;  1HR0 W;  3HOY H;  2Y0S E;  5AJ3 L;  4X65 Q;  3IRB A;  4GNX C;  4JI6 L;  3KLW A;  1CKN B;  2UUC Q;  4OWX B;  4JV5 L;  4ALP A;  1N8R C;  2K50 A;  2CFM A;  1CSP A;  3T1H Q;  1EIY B;  3NEN A;  4X64 L;  3D0F A;  2OQ0 A;  3PV0 A;  3EIV A;  1VQ9 A;  1YNX A;  4QY7 A;  2VQF Q;  4JBM A;  4NXN L;  1IBL L;  3K8A A;  3KJO A;  4AH6 A;  3VDY A;  1VQO A;  3PSI A;  3RZO H;  4BA2 I;  4HIO A;  1VS0 A;  4MNO A;  3S17 H;  2AKW B;  1E22 A;  3BZC A;  4J15 A;  2BH8 A;  1VQL A;  1SE8 A;  1KHI A;  2Q2T A;  2WFW A;  3CMA A;  2NZH A;  2VQE L;  3CC2 A;  1LUZ A;  4JI0 Q;  4DK6 C;  3E9I A;  4DV2 Q;  2R7Z G;  4QL5 A;  2QA4 A;  1E7Z A;  1Z9F A;  1QZG A;  4LFB L;  3K81 C;  2IT1 A;  4GN3 B;  1PH8 A;  2NZO A;  5M3M H;  1B7Y B;  1XNR L;  2NN6 G;  1I94 Q;  1MJE A;  1GVP A;  4K0K Q;  2K5N A;  4PZ7 A;  1UE6 A;  4JI1 L;  3PUV A;  2XGT A;  1Q1B A;  4DV5 L;  1N34 Q;  4JI2 L;  2JA6 G;  3PF5 A;  5HY6 A;  1NBW A;  4QIW E;  3KJP A;  4KHZ A;  2B63 H;  2XTI A;  2JA5 G;  1I94 L;  4BBS H;  2E2H H;  4UP9 A;  3PCO B;  1YJ9 A;  3CW2 C;  5M5Y H;  3GTO H;  1VQM A;  2E5L L;  1Q1E A;  3MEF A;  3BJU A;  1VQK A;  1SLJ A;  2HHH L;  4KLK A;  3GTP H;  2DGY A;  1HR0 L;  1Q8K A;  2ATW A;  1T9H A;  1K9M C;  3CPW A;  2B3G A;  4L5T A;  2L15 A;  3HOZ G;  3HFZ B;  1IBL Q;  4A3E H;  4GNX A;  1XPO A;  5EAY A;  4P71 A;  2JA7 H;  1N34 L;  3J81 c;  4L5Q A;  1HZ9 A;  4IO9 A;  2YTX A;  3RLF A;  5C3E H;  1PVO A;  1XMQ L;  3ER0 A;  1NMF A;  4LF7 Q;  1U0L A;  4NXM Q;  3S16 H;  4A3C H;  2WAQ G;  4DR4 L;  4NXN Q;  2MFI A;  4YHH Q;  4BBS G;  1PH7 A;  3AYH B;  3CAM A;  4A3G G;  1L0W A;  3DLL A;  3TS2 A;  2WB1 E;  1XNQ Q;  1KC8 C;  4JI2 Q;  1GO3 E;  2K52 A;  1V43 A;  3M4Q A;  4B3T Q;  5BR8 L;  1X65 A;  2NN6 I;  2JK8 A;  1C0A A;  4MTN A;  2MQH A;  2UXB L;  1HJP A;  3H3V I;  1XPU A;  2JE6 I;  4MZ9 A;  4JI7 Q;  1PH2 A;  4DR6 L;  4OXP A;  1N33 L;  5IYC G;  2YYZ A;  1FJG L;  1EUJ A;  2I0Q A;  1KXL A;  4LF5 L;  3NBH B;  3UE1 A;  4JI4 L;  3PO3 G;  4DV5 Q;  3J81 i;  4H02 A;  3AQQ A;  1FVI A;  1P8L A;  1QUQ A;  1WCM H;  1XPR A;  2UU9 Q;  1N33 Q;  3J80 i;  4X65 L;  4POF A;  2CWA A;  1PH9 A;  5GRO A;  1KIX A;  3KF6 B;  2IHF A;  2K5H A;  4LFA Q;  4HJ9 A;  2YTY A;  4DR7 L;  3M85 A;  1MJC A;  2KCT A;  3FHW A;  3TEH B;  4X64 Q;  2QGQ A;  2ALY B;  3PUW A;  2LXJ A;  1E1T A;  1NY4 A;  1Q86 C;  2HHH Q;  2RHS B;  3RN5 A;  1L2F A;  4A4I A;  4OX9 Q;  2E8G A;  3CP0 A;  5AJ3 Q;  2Z0S A;  4DUY Q;  1GKH A;  4JI6 Q;  2HIV A;  2N78 A;  3S15 H;  2JA6 H;  3I4O A;  3KOJ A;  4R1J A;  5C0X G;  1YIT A;  2PQA B;  3KDF A;  5GQO A;  5GAE C;  4DV7 Q;  4DV2 L;  1EQQ A;  4B3M L;  3ICE A;  1JT8 A;  4POG A;  1VQ6 A;  3NEM A;  1HNX Q;  2F52 A;  1CSQ A;  1PH6 A;  1XNQ L;  4JI8 L;  1V9P A;  4GNX B;  4IOA A;  4TVA B;  4JOI A;  1XNR Q;  3L2P A;  3KF6 A;  3A5Z B;  3AEV A;  5IYD H;  2JEB I;  4YWM A;  4AYB G;  3ULJ A;  1XMQ Q;  2E2I H;  4OO1 G;  1A62 A;  2MO1 A;  4UP8 A;  5IT9 c;  1Q7Y C;  3TRE A;  3DM3 A;  5FJ8 H;  3CCM A;  5LMN Q;  1DGS A;  3PGZ A;  1HZB A;  4LF5 Q;  1QZH A;  3RLN A;  1NE3 A;  2NVQ H;  3I4M H;  1SR3 A;  1SRO A;  1TWF H;  4A3J G;  1K73 C;  4HJ8 A;  1E24 A;  4LF9 L;  1QVF A;  4DR3 L;  1WYD A;  1VQ5 A;  2BH2 A;  3U50 C;  2UXB Q;  2VQF L;  4A3L G;  3GTK H;  2D0O A;  1J6Q A;  1ASZ A;  4GN4 B;  4DV6 L;  2H5X A;  1HNX L;  2EIF A;  1X55 A;  5M3F G;  1SRU A;  1X56 A;  3D31 A;  3I2Z A;  1W2B A;  1WI5 A;  5FLM H;  2HIX A;  4X66 L;  3Q8D A;  1WFQ A;  3W1B A;  1UE1 A;  4DR2 L;  4LFB Q;  1WCM G;  1OXU A;  1QVG A;  1KRS A;  5BR8 Q;  3S2H H;  3F2D A;  3TQY A;  5IYD G;  4A76 A;  1K8G A;  4A3I H;  4PMW A;  1K83 H;  3HOV H;  4A3M H;  3M4P A;  5DLQ E;  5LMU L;  2WB1 G;  1N36 L;  3ULL A;  4GLX A;  1Z47 A;  3GTQ H;  4B3S L;  2KEN A;  4DPG A;  3PIP A;  2R93 G;  2R6G A;  4YY3 Q;  1L1O B;  5C0X J;  2HT1 A;  3H3V H;  4DNI A;  2UU9 L;  3S2D H;  5JJL A;  3CCV A;  1A63 A;  2PI2 A;  5GAH C;  4LFC L;  4A75 A;  1FGU A;  2ZJP A;  2JEA I;  3A0J A;  4DV0 L;  4LF4 L;  3GTM H;  2GN5 A;  2R7D A;  4A93 H;  2JJQ A;  2JA8 H;  2CCZ A;  2KHJ A;  4YCU A;  3RNU A;  3PUY A;  3UDI A;  1JJC B;  4IJH A;  2ID0 A;  4C3H H;  2UUB L;  4DV0 Q;  4Y52 H;  1HZA A;  2Q2H A;  3WWV A;  3KFU A;  3CCE A;  2UXC Q;  4GOP C;  1D7Q A;  4JCV E;  3JAM c;  5IYC H;  2WAQ E;  3HOW H;  4X6A H;  1XTD A;  1K0R A;  2K5V A;  1X3F A;  4A3K G;  3PO2 H;  1L1O A;  2JA9 A;  4JI3 L;  4B3S Q;  1VQJ A;  3NEL A;  4BA1 I;  2OWO A;  3K7A H;  1TWA H;  5IY0 A;  3E0E A;  5C44 H;  5K36 G;  2VS1 A;  3RN2 A;  2R92 G;  2JQO A;  5GAD C;  4HJ7 A;  4L5S A;  4LUZ A;  5FLM G;  4HJA A;  4BY1 H;  2N8N A;  4A3G H;  3HKZ E;  1I6H H;  4DV4 Q;  3S1Q H;  4IFD I;  4JOI C;  1Y14 B;  2BA1 A;  2PQA A;  1IXR A;  2I5H A;  2PI2 E;  3KDF B;  4Y7N H;  2I5L X;  3I55 A;  1TXY A;  1W3S A;  4FDB A;  5JEA J;  1Y1W H;  2F3I A;  3S14 H;  2JA5 H;  1G29 1;  4NB3 A;  3FP9 A;  2CWP A;  1C7Y A;  2F4V Q;  2ZM6 Q;  2VZA A;  4TQU S;  1YIJ A;  1XMO L;  4DV1 Q;  2VQE Q;  1KD1 C;  3A5U A;  3G4S A;  3G71 A;  2K75 A;  3EBE A;  2OTL A;  4A3D G;  5JJI A;  3CQZ H;  1BKB A;  3OYY A;  3L0O A;  2VL6 A;  4GLA C;  4P73 A;  4XIG S;  3RLO A;  4X62 Q;  1A8V A;  1C9O A;  4DUZ Q;  1CUK A;  3I7F A;  1OXV A;  4A3M G;  4GKK L;  1HZC A;  1B8A A;  2R7Z H;  3PO2 G;  3KF8 B;  1N9W A;  3PUZ A;  1SN8 A;  1EOV A;  5E7N A;  4HIK A;  1HR0 Q;  4PZ6 A;  5ELO A;  1YHQ A;  2UUA Q;  1Y1V H;  4B3M Q;  2CQO A;  2NVY H;  1VQB A;  2UXD L;  2Q2I A;  1X3G A;  2YU9 H;  1IL2 A;  2PNH A;  5M3F H;  1YBY A;  3I56 A;  3F2C A;  4OON A;  4DUY L;  1PH4 A;  4XTC S;  4A93 G;  4P75 A;  2UXD Q;  2YTV A;  1VQH A;  1VQI A;  4YCV A;  4BBR H;  1PA6 A;  2ZJR A;  1HNZ L;  4A3L H;  1YEZ A;  1J5E Q;  5FLX c;  3S1N H;  3GTJ H;  3T1Y Q;  2CKZ B;  1YJN A;  4GKK Q;  4GKJ L;  3CCL A;  3HOX G;  1PV4 A;  2ES2 A;  4DUZ L;  5C44 G;  1KAW A;  2UUA L;  1FJG Q;  1G6P A;  4LF9 Q;  5IP9 H;  3I4N G;  4LF6 L;  1QUQ B;  3B6Y A;  1VCI A;  4R4O A;  3K80 C;  3K0X A;  4PG3 A;  4A3J H;  4O0A A;  2EQS A;  4A3E G;  1IYJ B;  4A3F H;  1KL9 A;  3T1H L;  4B3R Q;  1XMO Q;  4GS3 A;  4LUV A;  3HOU G;  2Q2U A;  3KYH C;  2NVX H;  2MO0 A;  3M9B A;  2LXK A;  1KRT A;  1Q82 C;  3H15 A;  2QEX A;  5JJK A;  1JE5 A;  1IBM L;  2ASB A;  2JA8 G;  1HNW Q;  3CF5 A;  4JI4 Q;  1HNZ Q;  5GAG C;  2ZJQ A;  1JB7 A;  5ELN A;  1OXT A;  1L1O C;  4IPC A;  1OTC A;  4YY3 L;  1X6O A;  1RL2 A;  1UE7 A;  2IHE A;  4JYA L;  1P16 A;  4UY8 C;  3HKZ G;  4YCW A;  4DV3 L;  1K8A C;  1LTL A;  5C4J H;  3UDX A;  1VQE A;  4JC0 A;  3BZK A;  3JC6 6;  3ULP A;  1IBK L;  4YWK A;  2IX1 A;  1TWC H;  3RR5 A;  3PUX A;  4GOP A;  1V1Q A;  3CC7 A;  2VY3 A;  3OTO Q;  4IPD A;  1VQD A;  1CKO A;  5HGQ A;  2MNA A;  1QVC A;  4ME3 A;  3J7Z C;  3CCQ A;  1Y1V G;  3HOV G;  2D0P A;  1GM5 A;  1JMC A;  5C4X H;  3CD6 A;  1GD7 A;  4IPH A;  2JA7 G;  3CME A;  4BY7 H;  4DR1 Q;  4IFD J;  4C3J H;  3OTO L;  3CCJ A;  2VUM H;  4JI5 Q;  2N49 A;  4DAM A;  3ERS X;  1NJI C;  4LW1 A;  4R4Q A;  3GO5 A;  4DKA C;  2VW9 A;  1EIF A;  2E2J H;  4LF8 Q;  4P74 A;  1NMG A;  4DAY B;  1D8L A;  5LMN W;  4A3D H;  4AQY Q;  1N36 Q;  1UWV A;  1EQR A;  3F8T A;  1BVS A;  3CPF A;  3ZJY C;  2LSS A;  4DV7 L;  3UE0 A;  1EFW A;  2EXD A;  3PF4 A;  2V1C C;  1PH1 A;  4LFA L;  2AWO A;  4IJL A;  4DR2 Q;  2A1A A;  5FJ8 G;  1X54 A;  3STB C;  3UDF A;  4LF7 L;  1K3R A;  4LNQ A;  4NXM L;  3CCU A;  2R92 H;  4HJ5 A;  5M5X H;  1N32 L;  1X3E A;  4BY1 G;  5C3E G;  2IY5 B;  4OX9 L;  5JEA G;  3BU2 A;  3T1Y L;  4R4I A;  4YWL A;  5H1S E;  1E3P A;  3TRZ A;  1R9T H;  1M1K C;  3HOZ H;  3J7A 5;  2ZTC A;  4AQY L;  1KQS A;  2GVB A;  4AIM A;  4NPS A;  5J3B A;  3GTL H;  1AE3 A;  1UEB A;  3UDG A;  3FKI H;  4A3F G;  1PH3 A;  1IZ6 A;  2AWN A;  5IWA Q;  4LF8 L;  3HOW G;  2KHI A;  4JYA Q;  3HOX H;  2A19 A;  3CXC A;  1X9N A;  4EX5 A;  5IP9 G;  5M5W H;  3I4N H;  1VQP A;  1TWG H;  2ZTD A;  4JI5 L;  2OQK A;  1VQ4 A;  1IBK Q;  1VQN A;  2F4V L;  4A3B G;  1FL0 A;  1VQA A;  4BBR G;  2E5L Q;  1E1O A;  2KBN A;  3AFQ A;  2PMZ E;  1VQ8 A;  1NTG A;  2B63 G;  3M4O H;  2BA0 A;  5IP7 G;  4C3I H;  4IFD G;  4A3B H;  4HID A;  1G51 A;  1AE2 A; 
#chains in the Genus database with same CATH topology
 1I5F A;  1MIU A;  3OWF A;  2EPB A;  1PFB A;  3Q22 A;  3MXN B;  1ENF A;  4KJN A;  1H9M A;  3GDE A;  3C3L A;  1TII D;  1SMY C;  4OWW B;  3S24 A;  1PFM A;  1HTP A;  3MEH A;  2B8F A;  3BYT B;  3E9H A;  2DUD A;  4RHS A;  3A74 A;  4KI0 A;  3LNN A;  4YHH L;  2GVA A;  1Y1V B;  4K8J A;  5CBA E;  4XT3 B;  4QB4 A;  5KIX A;  4GOP B;  1PFS A;  2E74 C;  3G6E A;  3HOY G;  4OEL B;  1ICW A;  3VA7 A;  4JI7 L;  1WTR A;  1YVC A;  4CJ1 B;  3I4M G;  3NQT A;  3HEJ A;  4CDD C;  4DR5 Q;  4U68 A;  1EWI A;  3J80 c;  2DNE A;  5AFW A;  1JJ2 A;  1HNW L;  1D6E C;  3EVQ A;  4K0K L;  2UUB Q;  4OO1 H;  1H95 A;  1SNO A;  1FYC A;  1AH9 A;  4CDF C;  4JBW A;  1TR5 A;  5IP7 H;  1YZ6 A;  2RCN A;  1TT2 A;  4A3J B;  1LM0 A;  3STB D;  3PIO A;  3IKJ A;  4L5R C;  1RIP A;  1SMX A;  1SNP A;  4LAA A;  5C44 B;  2RKS A;  3GD7 A;  3HKZ B;  4RGN A;  2HUG A;  3F1Z A;  4APV A;  4ZUJ A;  4B3R L;  2M9V A;  4CKE A;  3J80 E;  1CKM A;  4GN5 A;  3J81 j;  3HOU B;  1VQC A;  1LT4 D;  1IW7 D;  3HOU H;  3TS0 A;  2SNM A;  1ZYR D;  1PHJ A;  2QEJ C;  3U58 A;  1A6X A;  4JI8 Q;  1OXS C;  3A7L A;  1M90 C;  1JWS D;  3MXP A;  1PXU A;  5CV9 A;  2H1E A;  5J39 A;  1EIH A;  5C0X I;  2F0D A;  4JI3 Q;  3CQZ B;  4X65 Q;  2F3W A;  2F0J A;  4JI6 L;  3KLW A;  4DXG A;  1EY9 A;  1N8R C;  1FNV A;  5IGD A;  1CSP A;  3NEN A;  3PV0 A;  1VQ9 A;  4QY7 A;  4JBM A;  3VDY A;  3PSI A;  4HIO A;  3S17 H;  2AKW B;  3GTO B;  4RCO A;  2VQE L;  1LUZ A;  2DJG C;  4DK6 C;  3E9I A;  1QZG A;  4A3D B;  2IT1 A;  2L1B A;  1A3U A;  1B7Y B;  1TS4 A;  4J6H A;  1I94 Q;  1MJE A;  1PTO D;  1GVP A;  4K0K Q;  4PZ7 A;  5G3L D;  4JI2 L;  3PUV A;  3M3Y H;  1Q1B A;  2JSO A;  4C3I G;  3PF5 A;  2B63 H;  2F0W A;  4JVZ A;  1I94 L;  2L4N A;  5M5X B;  3CW2 C;  5M5Y H;  2NVX B;  2E5L L;  1EEI D;  1EY5 A;  3BJU A;  2TSS A;  2HHH L;  3SK8 A;  2G9H D;  3S15 B;  3GTP H;  2DGY A;  3T51 B;  1AFP A;  1EYA A;  4FP5 D;  3CPW A;  2B3G A;  4L5T A;  4DF7 A;  2AQ2 B;  1QCB D;  4ZKB B;  1L0Y B;  5JAV A;  4LJZ C;  4GNX A;  3A8J E;  5C4Z A;  5EAY A;  2MJ8 A;  2L55 A;  2QDB A;  4CGY B;  2DN8 A;  3E3X A;  2HQE A;  3FVQ A;  5DM6 3;  5C3E H;  4S3S A;  1XMQ L;  4BY7 B;  2B2V A;  4AYB B;  1ET9 A;  1U0L A;  4FXK C;  4LF7 Q;  4A3C H;  4DR4 L;  4L63 B;  4A3G G;  5C3X A;  3CAM A;  3E6Z X;  1L0W A;  3DLL A;  1XNQ Q;  1DYQ A;  1GO3 E;  1VDZ A;  1X65 A;  1JIC A;  1MSH A;  2JK8 A;  5KEE A;  1C0A A;  4RAU C;  4MTN A;  4A3K B;  1AW7 A;  2R93 B;  1HJP A;  3H3V I;  2JE6 I;  4MZ9 A;  4JI7 Q;  1N33 L;  5FK9 C;  5IYC G;  2YYZ A;  3GTJ B;  1EUJ A;  5EKL A;  2I0Q A;  3NBH B;  3UE1 A;  2Y0S B;  2IW3 A;  4H02 A;  2UU9 Q;  1KIX A;  2K5H A;  4N9P A;  1QNK A;  2B2T A;  5IGC A;  3S1Q B;  3TEH B;  2QGQ A;  2EY2 A;  2F0E A;  1C48 A;  4FF2 A;  1M8A A;  1Q86 C;  2HHH Q;  2RHS B;  1LT6 D;  3NXW A;  3GTK B;  1JWU D;  2Z0S A;  3T56 B;  5DAU A;  2HIV A;  4KKS A;  4DK1 A;  1YIT A;  2PQA B;  1EZ6 A;  2F0O A;  4DV2 L;  2HDM A;  4WOR A;  4B3M L;  5TSS A;  2IX3 A;  4DU9 A;  1JCK B;  3DXJ C;  3L2P A;  3I4L A;  3AEV A;  1XMQ Q;  1BBX C;  5A35 A;  2CW0 D;  4G7H C;  2ZXP A;  2F3V A;  2JN4 A;  3CRK C;  4XQQ A;  1CQF A;  1K73 C;  2PW7 A;  4HJ8 A;  1AP0 A;  4LF9 L;  1QVF A;  2O5J C;  2UXB Q;  1BCP B;  2VQF L;  1ASZ A;  4KKT A;  1PTO B;  2AUK A;  1X55 A;  1O7Y A;  1XX8 A;  5J1Z A;  1STH A;  2QIL A;  5EPL A;  5FLM H;  1JE4 A;  3Q8D A;  4DAV A;  2DNC A;  2WKD A;  1QVG A;  1F2L A;  5BN4 A;  3TQY A;  4A76 A;  1K8G A;  1IKM A;  3KLS A;  1K83 H;  3PQI A;  3K58 A;  4ZQ3 A;  4GZY C;  5LMU L;  1N36 L;  4IQZ A;  4DPG A;  3PIP A;  4YY3 Q;  5C0X J;  1DOL A;  2UU9 L;  1F9Q A;  4DNT B;  5GAH C;  1F2Y A;  2DJF C;  2NUC A;  3A0J A;  1SYG A;  3T53 B;  2B2W A;  3NTI A;  1I4P A;  2KHJ A;  3RNU A;  3PUY A;  3KK7 A;  3BZD B;  3KFU A;  3JAM c;  5IYC H;  3HOW H;  1K0R A;  1RJT A;  4JI3 L;  3GTP B;  4B3S Q;  3K7A H;  2JQO A;  1KLU D;  4L5S A;  4LUZ A;  2JYO A;  5NUC A;  4A3G H;  1DCZ A;  1EL0 A;  2PI2 E;  2BCO A;  2I5L X;  1W3S A;  2F3I A;  1GXD C;  3S14 H;  4QCL A;  1G29 1;  1WCM B;  4NB3 A;  3S14 B;  3A54 A;  1BOS A;  2VZA A;  4TQU S;  1YIJ A;  1XMO L;  1KD1 C;  1QE6 A;  2K75 A;  5JJI A;  4A3D G;  3QR8 A;  5BN5 A;  3VR3 A;  1TWC B;  1A8V A;  3I7F A;  1RKN A;  1SSO A;  1B8A A;  2R7Z H;  1ROD A;  3PO2 G;  3KF8 B;  4C3I B;  1SJH D;  1HR0 Q;  1YHQ A;  2XVS A;  3GTG B;  1VQB A;  2UXD L;  2RSO A;  4PMC A;  3D4D A;  4DUY L;  1U4R A;  1WTO A;  4A93 G;  4P75 A;  3P75 A;  1VQH A;  1QOH A;  4BBR H;  4A3L H;  1J5E Q;  3M7G A;  4GKK Q;  4GKJ L;  4CKB A;  5E1F A;  3HOX G;  4DUZ L;  1FJG Q;  5K36 H;  2A68 C;  1RTO A;  4MIU A;  1UUP A;  4LF6 L;  1QUQ B;  4PG3 A;  3K5N A;  5A2Q L;  4A3F H;  4B3R Q;  4GS3 A;  2B2U C;  1ILP A;  1S5D D;  4V19 0;  2NVX H;  2MO0 A;  4WJW A;  5M5Y B;  5JJK A;  2RCF A;  2QF7 A;  2EYJ A;  2ASB A;  4XQJ A;  1RD9 D;  1HNZ Q;  5GAG C;  4PV1 C;  3FRP B;  4IPC A;  2IHE A;  4UY8 C;  4ULL A;  1SYB A;  1NUC A;  1VQE A;  4JC0 A;  2GA4 B;  1XWE A;  3OMG A;  3RR5 A;  4K6D A;  1V1Q A;  4GOP A;  3ITP A;  3R2T A;  4IPD A;  2MNA A;  4JW0 A;  1KDC A;  1Y1V G;  2JA7 G;  3CME A;  4BBS B;  3OTO L;  4JI5 Q;  1JR0 D;  2F0U A;  1NJI C;  5HGT A;  2MP1 A;  3GO5 A;  2X6G A;  4B9W A;  3T4A C;  1J8I A;  5LMN W;  4IUN A;  3OIQ A;  1EQR A;  2MHV A;  2JA6 B;  2L9H A;  3CPF A;  4XXE A;  1PZK D;  2NB0 A;  3U9S A;  1PH1 A;  4DR2 Q;  4K2K A;  4KY6 A;  2A1A A;  1X54 A;  1K3R A;  5T1I A;  4HJ5 A;  1NR2 A;  1X3E A;  2K05 A;  2L5T A;  2Z6B A;  4HAE A;  2IY5 B;  3BU2 A;  3TDQ A;  4YWL A;  3T1Y L;  2ICI A;  1B53 A;  1I4Q A;  1KQS A;  1MI2 A;  4H0L C;  5I6W A;  3GTL H;  1AE3 A;  2EVB A;  2TMP A;  4JYA Q;  5C4H A;  2A19 A;  3X3M A;  2OT2 A;  4EX5 A;  3T16 A;  5IP9 G;  4HCE A;  1VQA A;  4K14 A;  3MAQ A;  3AFQ A;  1HQR D;  1VQ8 A;  2B63 G;  3M4O H;  1ZYR C;  5M5W B;  2BOS A;  1F2M A;  1C8C A;  4A3B H;  2OWO A;  1I4X A;  4EGV A;  1VQG A;  4AYB E;  2B8G A;  4R4C A;  1F77 A;  1SFO H;  3SDZ A;  2I46 A;  4IOC A;  4KD3 A;  3IFD A;  2BE5 C;  2CW0 C;  4QGU A;  2B2Y A;  3ND8 A;  5CR3 A;  3GTG H;  3H0G B;  3MWY W;  1W6K A;  1TQO A;  3W5O A;  4A3C G;  5KGU A;  3N6R A;  1Y1W G;  2IX0 A;  3A7A B;  1O7I A;  2OXP A;  3S1R H;  1JJG A;  1AEX A;  2YV5 A;  4JBJ A;  1A0I A;  1CHQ D;  4GLV B;  4ZKC B;  1X32 A;  4K6L A;  3SXH A;  1RHP A;  4GKJ Q;  5C5L A;  4LF4 Q;  3K5L A;  3CU7 A;  3S1R B;  5COY A;  2WV6 D;  1D5M C;  1G2S A;  4BXX G;  5IOD A;  2A8V A;  2XSC A;  1GUN A;  4UDU C;  4KHP Q;  3H0G H;  4OO1 I;  4DR4 Q;  4DR6 Q;  2AMC B;  2C9O A;  4X62 L;  2J4X A;  3RZD H;  3FDT A;  3S17 B;  1T5X D;  1PH5 A;  2OCE A;  1Y1W B;  3O13 A;  4JI0 L;  4DAP A;  2C35 B;  1UEA B;  1D5Z C;  1E2Z A;  4HR7 B;  1CI3 M;  3FEW X;  1IBM Q;  4X3T A;  1FNU A;  4DR5 L;  1BO0 A;  4DR7 Q;  1LAB A;  4KK7 A;  3EN2 A;  4WRD A;  4DR3 Q;  4X66 Q;  2KCM A;  1BDO A;  1WTV A;  1GUO A;  4RG1 A;  3D8G A;  4O2D A;  1NR4 A;  1SBB B;  4A3B B;  5DNF A;  4BY7 G;  1N32 Q;  2PYK A;  3U4Z A;  1TWH H;  4IPG A;  4FF4 A;  2BDO A;  2J7Z A;  2VNU D;  3HKS A;  3JAM L;  4RMF A;  3I3C A;  4DV3 Q;  1JOR A;  1FR3 A;  1STE A;  3HOY H;  2Y0S E;  4GNX C;  1V1O A;  1CKN B;  2QW7 A;  2F0I A;  4UAI A;  4ALP A;  1R9T B;  4OL7 A;  3TZU A;  3GTQ B;  1O7L A;  2OQ0 A;  1TS3 A;  3EIV A;  4K5V A;  1GUG A;  3MTS A;  1YNX A;  2B2W C;  1X3P A;  1LO5 D;  2A73 B;  1IBL L;  3RZO H;  1QG7 A;  1LT5 D;  4O42 A;  1VS0 A;  4MNO A;  5FLX L;  4J15 A;  3BZC A;  3CC2 A;  1QNU A;  1SE8 A;  5M3M B;  2WFW A;  1E2W A;  2NZH A;  3CMA A;  4JI0 Q;  2R7Z G;  1HUN A;  1Z9F A;  1PH8 A;  2F0N A;  2NZO A;  2V4D A;  4ZYS A;  2O5I C;  5M3M H;  3OSO A;  5K5P A;  4JI1 L;  4DA2 A;  1ONL A;  1HCZ A;  2XGT A;  1LTT D;  3NUC A;  1KLG D;  5HY6 A;  1NBW A;  4QIW E;  2F0G A;  3KJP A;  3EQL C;  3OMC A;  3NSW A;  2EY6 A;  4BBS H;  1DXM A;  4UP9 A;  3NPP A;  3I73 A;  5C5M A;  3K57 A;  1VQK A;  3HG9 A;  4KLK A;  1SNQ A;  1HR0 L;  1Q8K A;  3K7A B;  1H9S B;  4XQN A;  1EY7 A;  1HQM C;  3HFZ B;  3H6M A;  3OWE B;  1D5X C;  1T5E A;  2A5H A;  2JA7 H;  1B9M A;  2LS0 1;  3V96 A;  3NBH A;  2M2L A;  4IO9 A;  1EY6 A;  1S4Z A;  3S16 H;  1ESR A;  2KUM A;  4IUP A;  4LK1 C;  2X69 A;  2EJF C;  1UAP A;  3R8B A;  1RDP D;  3M4Q A;  5BR8 L;  3SK6 A;  2RDH A;  1SFO B;  4CDC C;  2NN6 H;  4F7X A;  2ZT9 C;  5FO9 B;  1K8M A;  4DR6 L;  4FVM A;  1XYI A;  4G7O C;  4JI4 L;  4DV5 Q;  3J81 i;  1FVI A;  3J80 i;  3VR4 A;  4X65 L;  2CWA A;  1STA A;  2B63 B;  4HJ9 A;  2YTY A;  4DR7 L;  3WOE A;  3M85 A;  2OEO A;  1FGB D;  4X64 Q;  1KNE A;  4ODG A;  1L2F A;  4RA8 A;  5AJ3 Q;  1HRJ A;  4JI6 Q;  5CV6 A;  2N78 A;  3S15 H;  1LLR D;  4ABN A;  5ELC A;  3KOJ A;  4R1J A;  5GAE C;  3BG3 A;  2F0P A;  4POG A;  2E2I B;  2F52 A;  1CSQ A;  1PH6 A;  1EEF D;  5CGK A;  4HTH A;  4TVA B;  1A2U A;  3LWE A;  4JOI A;  5IYD H;  5EBD A;  1BXT A;  4OO1 G;  4UP8 A;  1IW7 C;  5IT9 c;  3TRE A;  4U67 3;  3CCM A;  1TU2 B;  2CH4 W;  1HZB A;  4MHE A;  1QZH A;  1PTO C;  2F03 A;  3P7J A;  2NVQ H;  4A3J G;  1E24 A;  1VQ5 A;  2Q8I B;  3S1M B;  4QMG A;  1V8Q A;  4ZLT F;  3GTK H;  4XYQ A;  1JQY D;  1MHW C;  1PYW D;  2H5X A;  4DV6 L;  2EYF A;  2FIN B;  3M4O B;  4ZAI A;  5M3F G;  2K03 A;  3D31 A;  3I2Z A;  1W2B A;  4R9W A;  1EU3 A;  4DFA A;  3TSS A;  1DON A;  3W1B A;  3FMC A;  1XXG A;  1OXU A;  4XT1 B;  3VYR A;  4A93 B;  3F2D A;  4KMU C;  2R61 A;  3RZO B;  1TS5 A;  3HOV H;  5DM7 3;  5CBE E;  3HOY B;  1GHJ A;  3DM1 A;  2SEB D;  5C0X H;  4CHT B;  3HOZ B;  1Z47 A;  2LKV A;  3GTQ H;  2OF1 A;  2EE1 A;  4HSV A;  4CKC A;  2R6G A;  3KLR A;  1AN8 A;  3N52 A;  4DNI A;  3RD4 A;  2PI2 A;  4A75 A;  1L0X B;  4DV0 L;  4XDX A;  2R7D A;  4L6T B;  4A93 H;  1DD2 A;  2XNA C;  3D4R A;  3VYS A;  1JOQ A;  1JJC B;  4IJH A;  4Y52 H;  4K8I A;  5EGT A;  4C56 C;  5CV8 A;  1I4G A;  2UXC Q;  1SE3 A;  4JCV E;  1S5B D;  1EY8 A;  2K5V A;  1WD1 A;  1X3F A;  3HRZ C;  2XRQ D;  1L1O A;  1KDB A;  3E5S A;  1YNN D;  3I4N B;  4H44 C;  3W2D A;  4BA1 I;  3TME A;  1TWA H;  5IY0 A;  3E0E A;  5C44 H;  1RTN A;  5ELD A;  5FLM G;  4HJA A;  3RZD B;  2N8N A;  2ICE C;  4ZK9 B;  4JOI C;  5IIF A;  3NTH A;  2BA1 A;  1IXR A;  2PQA A;  4LFA L;  1TXY A;  4FDB A;  3RUZ A;  3URY A;  1Y1W H;  1PRT C;  5EKI A;  3FP9 A;  2F4V Q;  2ZM6 Q;  4DV1 Q;  3A5U A;  2K6A A;  2K1B A;  5C3W A;  1BKB A;  3OYY A;  2Q8T A;  1LTG D;  3H3V H;  1W6J A;  3RLO A;  4X62 Q;  1C9O A;  4A3M G;  2UUA Q;  1CUK A;  4I65 A;  1HZC A;  3VR6 A;  4LMQ D;  3DMU A;  3K0Y A;  3NWT A;  2K5W A;  4PZ6 A;  5ELO A;  3BDL A;  2CQO A;  4OIK A;  1I4R A;  2YU9 H;  1YBY A;  3F2C A;  2VUM B;  1Q90 A;  3V2T A;  1PA6 A;  4ZRZ A;  1WTH A;  2WIN B;  2CKZ B;  2G5D A;  1EIG A;  1KAW A;  4LF9 Q;  1GUT A;  5IP9 H;  5D65 A;  3K0X A;  4A3J H;  4O0A A;  5KRU A;  1IYJ B;  1KL9 A;  3MFY A;  2WKC A;  4QUF A;  4LUV A;  2RQX A;  2Q2U A;  4C3J G;  1SXT A;  4YIJ A;  4A3I B;  3H15 A;  2E2H B;  5C3E B;  1JE5 A;  4R8I A;  2JA8 G;  1HNW Q;  1PZJ D;  1A15 A;  1H9K A;  4HSP A;  1DZ1 A;  2ZJQ A;  2NWG A;  5EPK A;  1PTO F;  2ZXR A;  1JB7 A;  5ELN A;  1OXT A;  1HTL D;  2EY5 A;  4YY3 L;  1X6O A;  1RL2 A;  2Z9H A;  1OTC A;  2EYL A;  4IUU A;  1GHK A;  3J80 L;  4DV3 L;  1TWF B;  3RMH A;  3UDX A;  3FPU B;  5KNB A;  3BZK A;  3JC6 6;  3ULP A;  1ESF A;  5JPM C;  1TWC H;  2R92 B;  3MC0 B;  4OGQ C;  3W3A A;  3D6W A;  1CKO A;  3J7Z C;  1QVC A;  4ME3 A;  3J81 E;  3WDN A;  2D0P A;  2HCI A;  1JMC A;  1A3V A;  1GD7 A;  4C3J H;  5ELF A;  1G8Z D;  4X3U A;  4NP5 A;  4DAM A;  3DEP A;  2NTT A;  2B2V C;  4K5W A;  2B2T C;  4P74 A;  3UI2 A;  4DAY B;  4A3D H;  1KAA A;  3S9W A;  4AQY Q;  1SYC A;  1BVS A;  2HDL A;  3ZJY C;  2DY7 A;  1CK1 A;  2LSS A;  2E2J B;  1NSN S;  4DV7 L;  1EFW A;  3PF4 A;  2EXD A;  2PQE A;  2AWO A;  3UDF A;  4LF7 L;  4RCN A;  3CCU A;  1HPC A;  5D14 A;  4BY1 G;  5CMD A;  4OX9 L;  3G6J B;  4FXD A;  5JEA G;  4R4I A;  1E3P A;  3ERQ A;  3NWS A;  3HOZ H;  3LX0 A;  4CBV A;  3FKI B;  3J7A V;  1S5F D;  4AIM A;  4NPS A;  3TP7 A;  3Q24 A;  3UDG A;  4A3F G;  4LF8 L;  2AWN A;  3HOW G;  5IWA Q;  2KHI A;  3HOX H;  1I6V C;  3CKI B;  1TWG H;  2VB3 X;  2B2U A;  2F4V L;  4A3B G;  1VF7 A;  3PO3 B;  4BBR G;  2E5L Q;  3MVV A;  1E1O A;  2KBN A;  2LY7 A;  3HOV B;  1NTG A;  2WAQ B;  1JWM D;  2F0K A;  4DAY A;  5IP7 G;  3MFG A;  1LTA D;  1G51 A;  3CCR A;  2WP8 J;  5JJZ A;  3PIP 3;  3GTM B;  2ZM6 L;  3FKI G;  1MGS A;  1OXX K;  1STG A;  2CH4 A;  4LF6 Q;  4OIJ A;  4A3F B;  4A3K H;  1QWY A;  3TP5 A;  1EU4 A;  1NAP A;  2R3Z A;  4QJF A;  4LFC Q;  3J7A F;  2K14 A;  2A6E C;  4UP7 A;  5C4X G;  4JI1 Q;  1HHV A;  3A8I E;  1YHA A;  2QCP X;  2J0T D;  2D62 A;  2SNS A;  1YHB A;  4G4K A;  4J1M A;  3OIP A;  3R3O A;  4JG2 A;  2UXC L;  5BN3 A;  3MZ5 A;  1S40 A;  4O1N A;  3OW2 A;  1BBU A;  1LYL A;  1U4M A;  1I3Q H;  2F0T A;  4C2M H;  1XJV A;  4LUO A;  4LWC A;  1WOC A;  2K01 A;  4E6I A;  5LMU Q;  4QQB X;  1LTR D;  1LTS D;  3F2B A;  2A6H D;  1PYB A;  4DK3 C;  5C4X B;  3NE5 B;  3HP3 A;  2K4K A;  4WJ3 M;  2AUJ D;  1F9S A;  1Q12 A;  1EQV A;  1PYS B;  3KUP A;  4EQN A;  1S72 A;  3CC4 A;  1ASY A;  5IE8 A;  3VYU A;  2I5M X;  4DV1 L;  1IYU A;  5LMN L;  1SYE A;  2Z4I A;  4A3M B;  3ONA B;  1BQQ T;  1ML0 D;  3LGJ A;  3F2U A;  3A8K E;  1EYG A;  2IPK D;  3NHH A;  4DV6 Q;  5KYL A;  2Y0S G;  2UUC L;  1M4V A;  2RA4 A;  4UHV A;  2VUM G;  4I7A A;  4DV4 L;  1OO9 B;  3S16 B;  1BF4 A;  4OWT B;  3AMU A;  1I50 H;  4EQ5 A;  1HH2 P;  1Q81 C;  5IGB A;  1CKN A;  3SGI A;  4N8X 1;  1K83 B;  1YJW A;  3DWQ A;  5AJ3 L;  1HR0 W;  1ZKO A;  4JV5 L;  4OWX B;  2K50 A;  2CFM A;  3T1H Q;  4FO2 A;  1EIY B;  3MA2 B;  4X64 L;  4C3J B;  3OHX C;  2JA5 B;  2VQF Q;  1PMR A;  4NXN L;  5LHY 1;  3K8A A;  3KJO A;  1ILQ A;  2EJG C;  2BH8 A;  1VQL A;  1KHI A;  2O4X A;  4QL5 A;  3MXG A;  1E7Z A;  1R4P B;  3HOX B;  4RH6 A;  1ZEQ X;  1TVX A;  1U9R A;  2NN6 G;  1A2T A;  3HOW B;  2A69 C;  1N34 Q;  2JA6 G;  3H3V C;  5CV5 A;  4KHZ A;  2JA5 G;  1HA6 A;  3DHQ A;  2KEE A;  2E2H H;  3NTK A;  3PCO B;  1CZG A;  3GTO H;  1YNN C;  4Y7N B;  1Q1E A;  2K7V A;  5CYU A;  1I6H B;  1SLJ A;  5FOB B;  2ATW A;  1T9H A;  2I07 B;  4R8N A;  1IBL Q;  4A3E H;  3QIA A;  3U9O A;  4P71 A;  4TRD A;  1HZ9 A;  2YTX A;  2PO4 A;  2ZXO A;  4IN3 A;  1PLF A;  3ER0 A;  1NMF A;  4NXM Q;  4NXN Q;  1KNA A;  1EWH A;  2MFI A;  4YHH Q;  5IGE A;  3AYH B;  1KC8 C;  1LT3 D;  2E2D C;  4TKO B;  2K52 A;  1V43 A;  4B3T Q;  3BVM A;  2NN6 I;  2MQH A;  2UXB L;  1TWG B;  3CHB D;  1G2T A;  2PZW A;  1XPU A;  4OHJ A;  1E0B A;  1PH2 A;  3QO2 A;  2E75 C;  3SK4 A;  2HD3 A;  1G6Z A;  3PO3 G;  1XPR A;  4N8F A;  1QUQ A;  2F0L A;  1N33 Q;  3ND9 A;  4POF A;  2KQ3 A;  5GRO A;  3KF6 B;  4LFA Q;  1ZXT A;  1R4Q B;  3QG1 A;  2BDN A;  3D4W A;  4DXF A;  3ZYY X;  2LXJ A;  1Z7T A;  1NY4 A;  3RN5 A;  1RCV D;  4A4I A;  2E8G A;  3CP0 A;  4DUY Q;  3I4O A;  4RGT A;  3OOC A;  4PQX A;  3KDF A;  5E4X A;  5GQO A;  4HN7 A;  3DWP A;  5LL6 X;  3IFT A;  3NEM A;  1HNX Q;  4KV6 A;  4NW2 A;  5EKK A;  4JI8 L;  1V9P A;  4GNX B;  4IOA A;  1XNR Q;  3A5Z B;  5JEA H;  4AYB G;  3H09 A;  2MO1 A;  1Q7Y C;  3L3O C;  5FJ8 H;  2NVY B;  3PGZ A;  4LF5 Q;  2IL8 A;  3I4M H;  1TWF H;  4DR3 L;  1JB3 A;  1KDA A;  1B44 D;  2F0Q A;  3K6O A;  4DNR B;  5L37 A;  2EIF A;  2HCC A;  3S2H B;  4ZUI A;  1WI5 A;  3BVG A;  1VF5 C;  3OPO A;  4X66 L;  3QJY A;  1WCM G;  3KLS X;  2A74 C;  2SOB A;  3S2H H;  4ZCK A;  4A3I H;  4PMW A;  3PIO 3;  4A3M H;  4X3S A;  3M4P A;  2WB1 G;  2MGS A;  1CM9 A;  4NDX A;  4GLX A;  3VYT A;  2KEN A;  3SR1 A;  5IOC A;  3NP8 A;  5EQ0 A;  3PO2 B;  2HT1 A;  2KCN A;  1WTW A;  1XTC D;  2P5Z X;  3K5M A;  1FGU A;  3Q0A A;  2ZJP A;  2JEA I;  1YNJ D;  4LF4 L;  1ENC A;  3HS0 C;  5E3F A;  2GN5 A;  3GTM H;  2JJQ A;  1Y8N B;  2JA8 H;  3P1H A;  4YCU A;  1DJR D;  2JA7 B;  2ID0 A;  1NNX A;  1H9S A;  3A55 A;  3AU7 A;  3E0J A;  2AQ3 B;  2Q2H A;  3L9A X;  3WWV A;  3CCE A;  1D7Q A;  1BR9 A;  2R7Z B;  2WB1 B;  1XTD A;  4A3K G;  3HZX A;  3PO2 H;  5I9O A;  1SEB D;  5JVG 3;  2JA9 A;  4M1U B;  1VQJ A;  2VS1 A;  5D3D A;  2R92 G;  1ICF B;  1I6H H;  4DV4 Q;  4IFD I;  3OW7 A;  1BCP D;  1SYF A;  2I5H A;  4Y7N H;  3T13 A;  1A3T A;  1STY A;  3I70 A;  4MN3 A;  2CWP A;  5JPN C;  1HA5 A;  2EJM A;  2VQE Q;  3G71 A;  1LTB D;  2OTL A;  3CQZ H;  3C2P A;  2RSN A;  3L0O A;  2VL6 A;  4HID A;  1OXV A;  4CJ0 B;  3TP8 A;  1SN8 A;  1EOV A;  5E7N A;  4HIK A;  1HFG A;  1Y1V H;  2NVY H;  1EQT A;  4C1N K;  2FMM A;  4C3H G;  1X3G A;  2PNH A;  5M3F H;  4OON A;  5ISR A;  1PH4 A;  2EYP A;  1PRT F;  4XTC S;  2UXD Q;  2YTV A;  3DEO A;  1YEZ A;  2EZV A;  1HFN A;  5FLX c;  2N88 A;  3GTJ H;  3T1Y Q;  2VXW A;  5E4W C;  3QOJ A;  1MBY A;  2ES2 A;  5C44 G;  2UUA L;  3B6Y A;  1VCI A;  3K80 C;  4L8J A;  4RGO S;  2PMZ B;  1SJE D;  4KKU A;  3IAY A;  4WFN 3;  1S5C D;  1GUW A;  3HOU G;  4C3H B;  1S5E D;  2IJ0 A;  2LXK A;  3M9B A;  4IUT A;  5FO7 B;  1Q82 C;  2QEX A;  3PMF A;  3QB3 A;  3BVZ A;  5CV7 A;  1IBM L;  3CF5 A;  4JI4 Q;  1GJX A;  1L1O C;  4JYA L;  1UE7 A;  1EYD A;  1TS2 A;  2CHB D;  1K8A C;  1LTL A;  1WTQ A;  1CTM A;  2IX1 A;  4YWK A;  2ENB A;  1GOZ A;  3VR5 A;  3PUX A;  1RF2 D;  3OTO Q;  3CCQ A;  3KF8 A;  1O80 A;  1GM5 A;  1QB5 D;  2RVL A;  4B9X A;  5C4X H;  3CD6 A;  1WD0 A;  5CV4 A;  2K5D A;  4IFD J;  1CZW A;  4HMI A;  2VUM H;  4QUC A;  2N49 A;  2YU9 B;  1E2V A;  4KN7 C;  3M3Y B;  3BDO A;  3NQI A;  2VW9 A;  4H7B A;  2Z1C A;  4LF8 Q;  1NMG A;  1BUV T;  3WOF A;  1D8L A;  2Z8L A;  2NTS A;  1N36 Q;  1V1P A;  2CQA A;  3CRL C;  1K0S A;  4XYO A;  3UE0 A;  1Q8I A;  4IJL A;  5FJ8 G;  2MPM A;  3STB C;  5IT9 L;  1D1I A;  3HGB A;  3EA6 A;  1M1K C;  3J7A 5;  1F2Z A;  4AQY L;  1FD7 D;  1B3A A;  1V1P B;  4NMZ A;  1PDQ A;  1UEB A;  3MXU A;  3CXC A;  1WTX A;  4HMJ A;  3I4N H;  5M5W H;  1VQN A;  1AZP A;  4BWG B;  2D9U A;  4H13 C;  2PMZ E;  5LL6 S;  4MTK A;  4Q5V A;  4NKL A;  3C46 A;  4EQO A;  4WJ4 A;  3ERO A;  5D3I B;  5M3M G;  2K5Q A;  2N3S A;  4RKL A;  3GTL B;  3G48 A;  3AFP A;  1O7Z A;  2A68 D;  4QIW B;  5IYB G;  3R2I A;  2A6E D;  4RGM A;  4J8Q A;  2VB2 X;  2FHT A;  2JXM B;  1B70 B;  1VQF A;  5M3F B;  3MHB A;  4G7Z C;  1K28 A;  5G3L F;  5JOB A;  1EWC A;  2RF4 A;  1O78 A;  1Q46 A;  2B29 A;  1SE4 A;  4DGZ A;  3R93 A;  1YNJ C;  2LMC B;  4UPA A;  2NVT H;  2A6H C;  4DR1 L;  3L7Z C;  3W1G A;  1PTO H;  4M8A A;  3DUZ A;  4HIM A;  1S3O A;  2B39 A;  2NVT B;  1IKL A;  5IYB H;  2A69 D;  1YI2 A;  4KY5 A;  3K7U C;  2Z6K A;  3P20 A;  2NBF A;  1WJJ A;  1ET6 A;  1STN A;  2FXQ A;  2K33 A;  2R7F A;  3H91 A;  2O2L D;  4KHP L;  4P2C B;  2RHQ B;  1BBW A;  4B3T L;  3NBI A;  3QWN A;  4P72 A;  1U5K A;  1VQ7 A;  1F9P A;  3I8Z A;  4N9T A;  2Z6K C;  3D3R A;  3U4V A;  4R4T A;  1SMY D;  2OTJ A;  3CCS A;  2PPB C;  2FMC A;  1QJO A;  2R93 H;  1B50 A;  1NCV A;  2AHO B;  1UE5 A;  3C1F A;  3LWU A;  5T1G A;  4JV5 Q;  3M7N A;  2XWB B;  5IWA L;  4HCS A;  1CA6 A;  4A3I G;  4BXX H;  2ZTE A;  3JAM i;  3H0G G;  3PO3 H;  1SNC A;  1GUS A;  2HQL A;  1J5E L;  3S1M H;  1JOO A;  2EXZ A;  4PZ8 A;  1MKH A;  4JBK A;  3GP7 A;  1B2T A;  1C4Q A;  3IRB A;  3BDC A;  3TZD A;  2PCF B;  2L11 A;  2UUC Q;  1IL8 A;  4K2L A;  3J7Y W;  2RDF A;  3D0F A;  3K5O A;  5DEH A;  4FF3 A;  1VQO A;  4AH6 A;  4BA2 I;  4RKB A;  2KOL A;  3QOL A;  2Q2T A;  1E22 A;  1B4O A;  1LAC A;  3TN2 A;  4DV2 Q;  2RBM A;  5IT9 E;  2QA4 A;  3SEB A;  4LFB L;  3K81 C;  4GN3 B;  5KYI A;  1XNR L;  1SAP A;  2K5N A;  2K04 A;  1UE6 A;  4DV5 L;  2WII B;  1I3Q B;  1Z6H A;  4C2M B;  3GV3 A;  2XTI A;  3I72 A;  2E76 C;  4IFD H;  1YJ9 A;  1VQM A;  5KND A;  3MEF A;  5A2Q E;  3BYY B;  1LV9 A;  4OEM B;  5FO8 B;  1K3B C;  2XIW A;  1TWA B;  1K9M C;  2L15 A;  3HOZ G;  2N55 A;  2EY1 A;  1XPO A;  1B1Z A;  1BNZ A;  5I2X A;  1N34 L;  3J81 c;  4L5Q A;  4FNF A;  1DM0 B;  3RLF A;  1PVO A;  4KTA A;  2M00 A;  2WAQ G;  1IHZ A;  2QDL A;  2KA7 A;  4BBS G;  1PH7 A;  4IUR A;  3TS2 A;  1U4L A;  2WB1 E;  4JI2 Q;  2SDF A;  1EZ8 A;  4FXG C;  1IYV A;  4EVO A;  2C5C A;  4OXP A;  1II3 A;  3IL8 A;  1KXL A;  2FFK B;  4LF5 L;  3AQQ A;  1P8L A;  1WCM H;  1EY0 A;  1PH9 A;  2IHF A;  5EBC A;  1MJC A;  2KCT A;  3FHW A;  5I4D A;  2ALY B;  3PUW A;  1J9O A;  5C6A A;  1E1T A;  1KAB A;  1SND A;  4I7Z C;  3KBG A;  1X3Q A;  4OX9 Q;  2EYH A;  1GKH A;  1JOK A;  4IZ8 A;  2JA6 H;  4DN4 M;  4IUQ A;  4JK1 C;  5C0X G;  1SE2 A;  4DV7 Q;  1EQQ A;  3ICE A;  4A3E B;  1EFI D;  1JT8 A;  1VQ6 A;  2G9D A;  2EYO A;  1I4H A;  2H4O A;  1XNQ L;  4BBR B;  5F2D A;  4C1N I;  4F8M A;  3KF6 A;  3JAM E;  1JC7 A;  4IUV A;  4X3K A;  2JEB I;  4YWM A;  3NK9 A;  3ULJ A;  2E2I H;  3C1E A;  1A62 A;  1AE2 A;  4ME5 A;  2FJ2 A;  3DM3 A;  1DOK A;  2F0F A;  5LMN Q;  1DGS A;  3DWA A;  2PW5 A;  2F4I A;  3RLN A;  1NE3 A;  3H94 A;  1SR3 A;  1SRO A;  5C4J B;  5I9P A;  2BE5 D;  2X6L A;  1WYD A;  2MUY A;  1LTI D;  3U50 C;  2BH2 A;  2XN9 C;  4A3L G;  1BCP F;  5ELE A;  4KY7 A;  3I91 A;  2D0O A;  1J6Q A;  3EJI A;  4GN4 B;  4K5X A;  3J81 L;  1F9R A;  1HNX L;  1STB A;  1SRU A;  1X56 A;  1Q3L A;  2HIX A;  3FPP A;  1H9R A;  1WFQ A;  2Q8R E;  1UE1 A;  1SDF A;  2F0M A;  2QKI C;  2IWH A;  5JVH 3;  4DR2 L;  4LFB Q;  1KRS A;  3EFX D;  5BR8 Q;  5IYD G;  3MXN A;  4A3G B;  2XRS D;  5KNC A;  5DLQ E;  3ULL A;  2EDG A;  2K32 A;  2KEC A;  4B3S L;  3D6C A;  5EJW A;  2R93 G;  1VMP A;  1K8O A;  1L1O B;  2F0H A;  4PMB A;  2NVQ B;  1A63 A;  3S2D H;  5JJL A;  3CCV A;  4RWS C;  4LFC L;  1CT1 D;  2PZU A;  2L12 A;  1EOT A;  5FKA C;  1PRT B;  1B3Q A;  2CCZ A;  1BCP C;  1HXY D;  3GV6 A;  3UDI A;  4C3H H;  2UUB L;  1WTP A;  2PZT A;  1TY2 A;  2DY8 A;  3A56 A;  4DV0 Q;  4CJ2 C;  1U4P A;  4FYD A;  4KHV A;  1HZA A;  4TSS A;  4GOP C;  1SNM A;  2WAQ E;  4X6A H;  4PNY A;  1TY0 A;  2KJX A;  1WVL A;  3Q6S A;  3NEL A;  3TBI B;  1MD2 D;  3I4M B;  5K36 G;  3RN2 A;  5GAD C;  3SVM A;  4HJ7 A;  4BY1 H;  3HKZ E;  3S1Q H;  1Y14 B;  2XWJ B;  1MSG A;  3KDF B;  5M9O A;  5ELB A;  5JEA J;  3I55 A;  2JA5 H;  2EOT A;  4BY1 B;  1C7Y A;  3GQB A;  3SE0 A;  3G4S A;  4Q0F A;  2JP1 A;  2CVR A;  3Q23 A;  3EBE A;  1PRT D;  4P73 A;  4GLA C;  4RFB A;  4XIG S;  4DUZ Q;  1FJG L;  2D5D A;  4GKK L;  3K59 A;  1UNS A;  1N9W A;  3PUZ A;  4B3M Q;  3AB9 A;  4F88 A;  2Q2I A;  3VA5 A;  1IL2 A;  3I56 A;  2NYZ D;  3V05 A;  1G91 A;  5J22 A;  1B9N A;  1CA5 A;  4YCV A;  1VQI A;  5I6Y A;  2Z4H A;  2ZJR A;  1HNZ L;  1Y8O B;  4KD4 A;  3S1N H;  1YJN A;  3CCL A;  3S1N B;  1PV4 A;  1G6P A;  3I4N G;  4QF4 A;  3BS1 A;  4R4O A;  4BS9 A;  1AZQ A;  3I90 A;  2EQS A;  2KED A;  4A3E G;  2L0C A;  3T1H L;  4KN4 C;  4Z9C B;  1XMO Q;  2F0S A;  4F87 A;  5COR A;  3TP6 A;  3VR2 A;  3KYH C;  1SYD A;  1DOM A;  1KRT A;  1ENA A;  1TKW B;  1D2B A;  1VMC A;  1KTK A;  2KCC A;  2KVM A;  1Y69 U;  1P16 A;  3HKZ G;  4YCW A;  5C4J H;  4CDE C;  1IBK L;  4EQP A;  3CC7 A;  2VY3 A;  1PFN A;  1VQD A;  5HGQ A;  3HOV G;  2K28 A;  1H9J A;  2B2Y C;  4IPH A;  4V0B A;  4BY7 H;  4DR1 Q;  4ID6 A;  3CCJ A;  1CHP D;  4RHR A;  1EY4 A;  3ERS X;  2AQ1 B;  4B08 A;  4LW1 A;  4R4Q A;  5IGG A;  4DKA C;  1EIF A;  3X3N A;  2E2J H;  1CFM A;  4ILW A;  1UWV A;  4G57 A;  2WAC A;  3F8T A;  3SK5 A;  1CQV A;  4IAL A;  4HED A;  2V1C C;  5IGF A;  4KJO A;  4NXM L;  4LNQ A;  2R92 H;  1N32 L;  3G7L A;  2NZ1 D;  5M5X H;  1D1K A;  5C3E G;  2EYM A;  1FNW A;  5H1S E;  2JA8 B;  3TRZ A;  2LFN A;  1R9T H;  1PZI D;  2ZTC A;  5FLX E;  2GVB A;  5EPJ A;  5J3B A;  1QIL A;  2D2C C;  3FKI H;  2PNR C;  1Y8P B;  1IZ6 A;  2KHS A;  2RDG A;  1PH3 A;  4DK0 A;  1EYC A;  3S2D B;  1X9N A;  1I50 B;  2F0V A;  5CC4 A;  1VQP A;  2ZTD A;  4JI5 L;  5I2Y A;  2OQK A;  1VQ4 A;  1IBK Q;  4FF1 A;  3KBX A;  1FL0 A;  4JPB W;  1TWH B;  1HUM A;  3SHL A;  5HUR A;  2BA0 A;  4C3I H;  4IFD G;  2F1M A;  3M4Y A; 
#chains in the Genus database with same CATH homology
 1I5F A;  1MIU A;  3CCR A;  2WP8 J;  4WJ4 A;  5M3M G;  2N3S A;  1VQG A;  3G48 A;  3AFP A;  3MXN B;  4AYB E;  3FKI G;  2ZM6 L;  1OXX K;  3GDE A;  4JI7 L;  4LF6 Q;  5IYB G;  4R4C A;  4A3K H;  4OWW B;  3S24 A;  1SFO H;  3E9H A;  4QJF A;  4LFC Q;  2DUD A;  2K14 A;  4IOC A;  1B70 B;  1VQF A;  3A74 A;  4UP7 A;  5C4X G;  4KI0 A;  4JI1 Q;  4YHH L;  1YHA A;  2GVA A;  4QGU A;  3GTG H;  2D62 A;  3M3Y H;  2RF4 A;  4GOP B;  1YHB A;  1PFS A;  1Q46 A;  3W5O A;  4A3C G;  2B29 A;  1Y1W G;  4JG2 A;  2UXC L;  2IX0 A;  4UPA A;  1O7I A;  3G6E A;  3S1R H;  2NVT H;  3HOY G;  1JJG A;  1S40 A;  3OW2 A;  2YV5 A;  1BBU A;  1YVC A;  4JBJ A;  1A0I A;  1LYL A;  4DR1 L;  1I3Q H;  3L7Z C;  4GLV B;  3W1G A;  4C2M H;  1XJV A;  4HIM A;  4LUO A;  3I4M G;  1S3O A;  4GKJ Q;  4LWC A;  1WOC A;  4DR5 Q;  4LF4 Q;  5LMU Q;  1EWI A;  3J80 c;  4QQB X;  3F2B A;  5IYB H;  1PYB A;  4DK3 C;  1JJ2 A;  4BXX G;  2K4K A;  2A8V A;  1HNW L;  1YI2 A;  4K0K L;  2UUB Q;  4WJ3 M;  1H95 A;  4KHP Q;  1Q12 A;  3H0G H;  3K7U C;  4OO1 I;  4DR4 Q;  1PYS B;  4DR6 Q;  2AMC B;  2Z6K A;  4X62 L;  3RZD H;  1S72 A;  3CC4 A;  1ASY A;  1WJJ A;  2R7F A;  2FXQ A;  5IE8 A;  1AH9 A;  1PH5 A;  4KHP L;  4JBW A;  2OCE A;  2RHQ B;  1BBW A;  2I5M X;  5IP7 H;  4B3T L;  2C35 B;  4DV1 L;  4JI0 L;  1YZ6 A;  2RCN A;  5LMN L;  1IBM Q;  4P72 A;  1LM0 A;  1U5K A;  3STB D;  3PIO A;  1VQ7 A;  4DR5 L;  4L5R C;  1RIP A;  4DR7 Q;  3EN2 A;  1SMX A;  2Z6K C;  4DR3 Q;  3LGJ A;  4X66 Q;  2KCM A;  3GD7 A;  3U4V A;  4R4T A;  2OTJ A;  3CCS A;  1EYG A;  3F1Z A;  4APV A;  4B3R L;  4RG1 A;  2R93 H;  2AHO B;  1UE5 A;  4O2D A;  4DV6 Q;  1CKM A;  2Y0S G;  4GN5 A;  2UUC L;  3M7N A;  4JV5 Q;  4BY7 G;  3J81 j;  1N32 Q;  5IWA L;  1VQC A;  2VUM G;  4BXX H;  4A3I G;  3HOU H;  2ZTE A;  3U4Z A;  3TS0 A;  1TWH H;  3JAM i;  4IPG A;  3H0G G;  4DV4 L;  3PO3 H;  1PHJ A;  3U58 A;  4JI8 Q;  1OXS C;  2HQL A;  1J5E L;  4OWT B;  3S1M H;  2VNU D;  1I50 H;  1M90 C;  4EQ5 A;  1HH2 P;  3HKS A;  4PZ8 A;  1Q81 C;  1MKH A;  1CKN A;  4RMF A;  3SGI A;  4JBK A;  5C0X I;  4DV3 Q;  4JI3 Q;  1YJW A;  1HR0 W;  3HOY H;  2Y0S E;  5AJ3 L;  4X65 Q;  3IRB A;  4GNX C;  4JI6 L;  3KLW A;  1CKN B;  2UUC Q;  4OWX B;  4JV5 L;  4ALP A;  1N8R C;  2K50 A;  2CFM A;  1CSP A;  3T1H Q;  1EIY B;  3NEN A;  4X64 L;  3D0F A;  2OQ0 A;  3PV0 A;  3EIV A;  1VQ9 A;  1YNX A;  4QY7 A;  2VQF Q;  4JBM A;  4NXN L;  1IBL L;  3K8A A;  3KJO A;  4AH6 A;  3VDY A;  1VQO A;  3PSI A;  3RZO H;  4BA2 I;  4HIO A;  1VS0 A;  4MNO A;  3S17 H;  2AKW B;  1E22 A;  3BZC A;  4J15 A;  2BH8 A;  1VQL A;  1SE8 A;  1KHI A;  2Q2T A;  2WFW A;  3CMA A;  2NZH A;  2VQE L;  3CC2 A;  1LUZ A;  4JI0 Q;  4DK6 C;  3E9I A;  4DV2 Q;  2R7Z G;  4QL5 A;  2QA4 A;  1E7Z A;  1Z9F A;  1QZG A;  4LFB L;  3K81 C;  2IT1 A;  4GN3 B;  1PH8 A;  2NZO A;  5M3M H;  1B7Y B;  1XNR L;  2NN6 G;  1I94 Q;  1MJE A;  1GVP A;  4K0K Q;  2K5N A;  4PZ7 A;  1UE6 A;  4JI1 L;  3PUV A;  2XGT A;  1Q1B A;  4DV5 L;  1N34 Q;  4JI2 L;  2JA6 G;  3PF5 A;  5HY6 A;  1NBW A;  4QIW E;  3KJP A;  4KHZ A;  2B63 H;  2XTI A;  2JA5 G;  1I94 L;  4BBS H;  2E2H H;  4UP9 A;  3PCO B;  1YJ9 A;  3CW2 C;  5M5Y H;  3GTO H;  1VQM A;  2E5L L;  1Q1E A;  3MEF A;  3BJU A;  1VQK A;  1SLJ A;  2HHH L;  4KLK A;  3GTP H;  2DGY A;  1HR0 L;  1Q8K A;  2ATW A;  1T9H A;  1K9M C;  3CPW A;  2B3G A;  4L5T A;  2L15 A;  3HOZ G;  3HFZ B;  1IBL Q;  4A3E H;  4GNX A;  1XPO A;  5EAY A;  4P71 A;  2JA7 H;  1N34 L;  3J81 c;  4L5Q A;  1HZ9 A;  4IO9 A;  2YTX A;  3RLF A;  5C3E H;  1PVO A;  1XMQ L;  3ER0 A;  1NMF A;  4LF7 Q;  1U0L A;  4NXM Q;  3S16 H;  4A3C H;  2WAQ G;  4DR4 L;  4NXN Q;  2MFI A;  4YHH Q;  4BBS G;  1PH7 A;  3AYH B;  3CAM A;  4A3G G;  1L0W A;  3DLL A;  3TS2 A;  2WB1 E;  1XNQ Q;  1KC8 C;  4JI2 Q;  1GO3 E;  2K52 A;  1V43 A;  3M4Q A;  4B3T Q;  5BR8 L;  1X65 A;  2NN6 I;  2JK8 A;  1C0A A;  4MTN A;  2MQH A;  2UXB L;  1HJP A;  3H3V I;  1XPU A;  2JE6 I;  4MZ9 A;  4JI7 Q;  1PH2 A;  4DR6 L;  4OXP A;  1N33 L;  5IYC G;  2YYZ A;  1FJG L;  1EUJ A;  2I0Q A;  1KXL A;  4LF5 L;  3NBH B;  3UE1 A;  4JI4 L;  3PO3 G;  4DV5 Q;  3J81 i;  4H02 A;  3AQQ A;  1FVI A;  1P8L A;  1QUQ A;  1WCM H;  1XPR A;  2UU9 Q;  1N33 Q;  3J80 i;  4X65 L;  4POF A;  2CWA A;  1PH9 A;  5GRO A;  1KIX A;  3KF6 B;  2IHF A;  2K5H A;  4LFA Q;  4HJ9 A;  2YTY A;  4DR7 L;  3M85 A;  1MJC A;  2KCT A;  3FHW A;  3TEH B;  4X64 Q;  2QGQ A;  2ALY B;  3PUW A;  2LXJ A;  1E1T A;  1NY4 A;  1Q86 C;  2HHH Q;  2RHS B;  3RN5 A;  1L2F A;  4A4I A;  4OX9 Q;  2E8G A;  3CP0 A;  5AJ3 Q;  2Z0S A;  4DUY Q;  1GKH A;  4JI6 Q;  2HIV A;  2N78 A;  3S15 H;  2JA6 H;  3I4O A;  3KOJ A;  4R1J A;  5C0X G;  1YIT A;  2PQA B;  3KDF A;  5GQO A;  5GAE C;  4DV7 Q;  4DV2 L;  1EQQ A;  4B3M L;  3ICE A;  1JT8 A;  4POG A;  1VQ6 A;  3NEM A;  1HNX Q;  2F52 A;  1CSQ A;  1PH6 A;  1XNQ L;  4JI8 L;  1V9P A;  4GNX B;  4IOA A;  4TVA B;  4JOI A;  1XNR Q;  3L2P A;  3KF6 A;  3A5Z B;  3AEV A;  5IYD H;  2JEB I;  4YWM A;  4AYB G;  3ULJ A;  1XMQ Q;  2E2I H;  4OO1 G;  1A62 A;  2MO1 A;  4UP8 A;  5IT9 c;  1Q7Y C;  3TRE A;  3DM3 A;  5FJ8 H;  3CCM A;  5LMN Q;  1DGS A;  3PGZ A;  1HZB A;  4LF5 Q;  1QZH A;  3RLN A;  1NE3 A;  2NVQ H;  3I4M H;  1SR3 A;  1SRO A;  1TWF H;  4A3J G;  1K73 C;  4HJ8 A;  1E24 A;  4LF9 L;  1QVF A;  4DR3 L;  1WYD A;  1VQ5 A;  2BH2 A;  3U50 C;  2UXB Q;  2VQF L;  4A3L G;  3GTK H;  2D0O A;  1J6Q A;  1ASZ A;  4GN4 B;  4DV6 L;  2H5X A;  1HNX L;  2EIF A;  1X55 A;  5M3F G;  1SRU A;  1X56 A;  3D31 A;  3I2Z A;  1W2B A;  1WI5 A;  5FLM H;  2HIX A;  4X66 L;  3Q8D A;  1WFQ A;  3W1B A;  1UE1 A;  4DR2 L;  4LFB Q;  1WCM G;  1OXU A;  1QVG A;  1KRS A;  5BR8 Q;  3S2H H;  3F2D A;  3TQY A;  5IYD G;  4A76 A;  1K8G A;  4A3I H;  4PMW A;  1K83 H;  3HOV H;  4A3M H;  3M4P A;  5DLQ E;  5LMU L;  2WB1 G;  1N36 L;  3ULL A;  4GLX A;  1Z47 A;  3GTQ H;  4B3S L;  2KEN A;  4DPG A;  3PIP A;  2R93 G;  2R6G A;  4YY3 Q;  1L1O B;  5C0X J;  2HT1 A;  3H3V H;  4DNI A;  2UU9 L;  3S2D H;  5JJL A;  3CCV A;  1A63 A;  2PI2 A;  5GAH C;  4LFC L;  4A75 A;  1FGU A;  2ZJP A;  2JEA I;  3A0J A;  4DV0 L;  4LF4 L;  3GTM H;  2GN5 A;  2R7D A;  4A93 H;  2JJQ A;  2JA8 H;  2CCZ A;  2KHJ A;  4YCU A;  3RNU A;  3PUY A;  3UDI A;  1JJC B;  4IJH A;  2ID0 A;  4C3H H;  2UUB L;  4DV0 Q;  4Y52 H;  1HZA A;  2Q2H A;  3WWV A;  3KFU A;  3CCE A;  2UXC Q;  4GOP C;  1D7Q A;  4JCV E;  3JAM c;  5IYC H;  2WAQ E;  3HOW H;  4X6A H;  1XTD A;  1K0R A;  2K5V A;  1X3F A;  4A3K G;  3PO2 H;  1L1O A;  2JA9 A;  4JI3 L;  4B3S Q;  1VQJ A;  3NEL A;  4BA1 I;  2OWO A;  3K7A H;  1TWA H;  5IY0 A;  3E0E A;  5C44 H;  5K36 G;  2VS1 A;  3RN2 A;  2R92 G;  2JQO A;  5GAD C;  4HJ7 A;  4L5S A;  4LUZ A;  5FLM G;  4HJA A;  4BY1 H;  2N8N A;  4A3G H;  3HKZ E;  1I6H H;  4DV4 Q;  3S1Q H;  4IFD I;  4JOI C;  1Y14 B;  2BA1 A;  2PQA A;  1IXR A;  2I5H A;  2PI2 E;  3KDF B;  4Y7N H;  2I5L X;  3I55 A;  1TXY A;  1W3S A;  4FDB A;  5JEA J;  1Y1W H;  2F3I A;  3S14 H;  2JA5 H;  1G29 1;  4NB3 A;  3FP9 A;  2CWP A;  1C7Y A;  2F4V Q;  2ZM6 Q;  2VZA A;  4TQU S;  1YIJ A;  1XMO L;  4DV1 Q;  2VQE Q;  1KD1 C;  3A5U A;  3G4S A;  3G71 A;  2K75 A;  3EBE A;  2OTL A;  4A3D G;  5JJI A;  3CQZ H;  1BKB A;  3OYY A;  3L0O A;  2VL6 A;  4GLA C;  4P73 A;  4XIG S;  3RLO A;  4X62 Q;  1A8V A;  1C9O A;  4DUZ Q;  1CUK A;  3I7F A;  1OXV A;  4A3M G;  4GKK L;  1HZC A;  1B8A A;  2R7Z H;  3PO2 G;  3KF8 B;  1N9W A;  3PUZ A;  1SN8 A;  1EOV A;  5E7N A;  4HIK A;  1HR0 Q;  4PZ6 A;  5ELO A;  1YHQ A;  2UUA Q;  1Y1V H;  4B3M Q;  2CQO A;  2NVY H;  1VQB A;  2UXD L;  2Q2I A;  1X3G A;  2YU9 H;  1IL2 A;  2PNH A;  5M3F H;  1YBY A;  3I56 A;  3F2C A;  4OON A;  4DUY L;  1PH4 A;  4XTC S;  4A93 G;  4P75 A;  2UXD Q;  2YTV A;  1VQH A;  1VQI A;  4YCV A;  4BBR H;  1PA6 A;  2ZJR A;  1HNZ L;  4A3L H;  1YEZ A;  1J5E Q;  5FLX c;  3S1N H;  3GTJ H;  3T1Y Q;  2CKZ B;  1YJN A;  4GKK Q;  4GKJ L;  3CCL A;  3HOX G;  1PV4 A;  2ES2 A;  4DUZ L;  5C44 G;  1KAW A;  2UUA L;  1FJG Q;  1G6P A;  4LF9 Q;  5IP9 H;  3I4N G;  4LF6 L;  1QUQ B;  3B6Y A;  1VCI A;  4R4O A;  3K80 C;  3K0X A;  4PG3 A;  4A3J H;  4O0A A;  2EQS A;  4A3E G;  1IYJ B;  4A3F H;  1KL9 A;  3T1H L;  4B3R Q;  1XMO Q;  4GS3 A;  4LUV A;  3HOU G;  2Q2U A;  3KYH C;  2NVX H;  2MO0 A;  3M9B A;  2LXK A;  1KRT A;  1Q82 C;  3H15 A;  2QEX A;  5JJK A;  1JE5 A;  1IBM L;  2ASB A;  2JA8 G;  1HNW Q;  3CF5 A;  4JI4 Q;  1HNZ Q;  5GAG C;  2ZJQ A;  1JB7 A;  5ELN A;  1OXT A;  1L1O C;  4IPC A;  1OTC A;  4YY3 L;  1X6O A;  1RL2 A;  1UE7 A;  2IHE A;  4JYA L;  1P16 A;  4UY8 C;  3HKZ G;  4YCW A;  4DV3 L;  1K8A C;  1LTL A;  5C4J H;  3UDX A;  1VQE A;  4JC0 A;  3BZK A;  3JC6 6;  3ULP A;  1IBK L;  4YWK A;  2IX1 A;  1TWC H;  3RR5 A;  3PUX A;  4GOP A;  1V1Q A;  3CC7 A;  2VY3 A;  3OTO Q;  4IPD A;  1VQD A;  1CKO A;  5HGQ A;  2MNA A;  1QVC A;  4ME3 A;  3J7Z C;  3CCQ A;  1Y1V G;  3HOV G;  2D0P A;  1GM5 A;  1JMC A;  5C4X H;  3CD6 A;  1GD7 A;  4IPH A;  2JA7 G;  3CME A;  4BY7 H;  4DR1 Q;  4IFD J;  4C3J H;  3OTO L;  3CCJ A;  2VUM H;  4JI5 Q;  2N49 A;  4DAM A;  3ERS X;  1NJI C;  4LW1 A;  4R4Q A;  3GO5 A;  4DKA C;  2VW9 A;  1EIF A;  2E2J H;  4LF8 Q;  4P74 A;  1NMG A;  4DAY B;  1D8L A;  5LMN W;  4A3D H;  4AQY Q;  1N36 Q;  1UWV A;  1EQR A;  3F8T A;  1BVS A;  3CPF A;  3ZJY C;  2LSS A;  4DV7 L;  3UE0 A;  1EFW A;  2EXD A;  3PF4 A;  2V1C C;  1PH1 A;  4LFA L;  2AWO A;  4IJL A;  4DR2 Q;  2A1A A;  5FJ8 G;  1X54 A;  3STB C;  3UDF A;  4LF7 L;  1K3R A;  4LNQ A;  4NXM L;  3CCU A;  2R92 H;  4HJ5 A;  5M5X H;  1N32 L;  1X3E A;  4BY1 G;  5C3E G;  2IY5 B;  4OX9 L;  5JEA G;  3BU2 A;  3T1Y L;  4R4I A;  4YWL A;  5H1S E;  1E3P A;  3TRZ A;  1R9T H;  1M1K C;  3HOZ H;  3J7A 5;  2ZTC A;  4AQY L;  1KQS A;  2GVB A;  4AIM A;  4NPS A;  5J3B A;  3GTL H;  1AE3 A;  1UEB A;  3UDG A;  3FKI H;  4A3F G;  1PH3 A;  1IZ6 A;  2AWN A;  5IWA Q;  4LF8 L;  3HOW G;  2KHI A;  4JYA Q;  3HOX H;  2A19 A;  3CXC A;  1X9N A;  4EX5 A;  5IP9 G;  5M5W H;  3I4N H;  1VQP A;  1TWG H;  2ZTD A;  4JI5 L;  2OQK A;  1VQ4 A;  1IBK Q;  1VQN A;  2F4V L;  4A3B G;  1FL0 A;  1VQA A;  4BBR G;  2E5L Q;  1E1O A;  2KBN A;  3AFQ A;  2PMZ E;  1VQ8 A;  1NTG A;  2B63 G;  3M4O H;  2BA0 A;  5IP7 G;  4C3I H;  4IFD G;  4A3B H;  4HID A;  1G51 A;  1AE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...