3A5UA

Promiscuity and specificity in dna binding to ssb: insights from the structure of the mycobacterium smegmatis ssb-ssdna complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
119
structure length
118
Chain Sequence
MAGDTTITVVGNLTADPELRFTPSGAAVANFTVASTPRMFDRQSGEWKDGEALFLRCNIWREAAENVAESLTRGSRVIVTGRLKQRSFTREGEKRTVVEVEVDEIGPSLRYATAKVNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Promiscuity and specificity in DNA binding to SSB: Insights from the structure of the Mycobacterium smegmatis SSB-ssDNA complex.
rcsb
source organism Mycobacterium smegmatis
molecule tags Dna binding protein
molecule keywords Single-stranded DNA-binding protein
total genus 18
structure length 118
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3a5uA00
5M5WH 4A3IG 2Q2TA 1PH6A 1GO3E 1HNZL 3G48A 2VQFL 2JA7G 3ICEA 5JJKA 1VQNA 4DV6L 4DR7L 1VQOA 4GS3A 1YHQA 3E0EA 4LF7L 3TS2A 2D0PA 1E7ZA 3CCRA 1YBYA 4IOCA 4A3GH 1UE1A 5LMNQ 4IPDA 4B3ML 2NZHA 4JG2A 3NBHB 2VQEQ 2E5LQ 2IX1A 3T1HQ 1TWHH 3CW2C 3NELA 5EAYA 2PQAA 2Y0SG 2QGQA 4DR3L 2F3IA 5IYCH 1I3QH 3AEVA 2N8NA 3B6YA 3KDFB 2R93H 1ASYA 1VQIA 5FLMG 1Q7YC 1XNRQ 3K80C 3I2ZA 2KHIA 5M3MH 1IL2A 1FJGL 4LFCL 4A93G 2K5HA 1WCMH 4IPGA 1P16A 5GQOA 2WAQE 5AJ3Q 3RN2A 2UUCQ 2Q2UA 2WFWA 4OX9Q 4B3RQ 3GTJH 4JV5L 5C4XH 1MJEA 4DR1L 1VQCA 4L5TA 3S16H 2QA4A 1QVCA 1L1OA 2NN6G 3UDGA 1HZ9A 1KQSA 1QZHA 1Y1VG 3M4QA 5M3MG 2ZTCA 4DV5Q 4LF5L 2I5HA 2GVBA 2AKWB 5GADC 5IYCG 4GOPC 1XMQL 2ZM6L 4X64Q 1U5KA 4DV2Q 4AYBE 5HGQA 3A5UA 2BA1A 1HZBA 1RIPA 3PSIA 4LW1A 4PZ6A 2RHQB 1HNWQ 2K4KA 1SLJA 3BZCA 2JA5G 4QJFA 4HJ8A 4QL5A 1IBKQ 3CCEA 1K3RA 3BJUA 1PFSA 1VQJA 4GLAC 4MTNA 4EX5A 1L0WA 4OWTB 4GN5A 4OONA 3U4VA 3Q8DA 1S40A 3KF8B 1D7QA 1YHAA 1PH2A 3A74A 4JBWA 2YTVA 2OCEA 2VQEL 5IYDH 1WI5A 2WP8J 3U4ZA 4BY1H 2VUMG 4HJ5A 3PUXA 1EFWA 5BR8Q 1YVCA 2IT1A 3PO2H 4UY8C 1N34Q 2JEBI 4PMWA 4Y52H 1DGSA 3BU2A 1I50H 3RLNA 1E3PA 1G51A 5AJ3L 1KIXA 1FJGQ 2JA6G 2NVTH 2JA9A 4JI1Q 4A3MG 4BXXH 1J5EL 3GDEA 4OX9L 2JQOA 2KCMA 3E9HA 4IJLA 4P73A 3CCVA 4JI7L 4NXMQ 4P71A 2HIVA 4YCWA 1X54A 1KRSA 3EIVA 4XTCS 3UE0A 4BBRH 4X62Q 1WFQA 3HFZB 5IP7H 2IX0A 1V9PA 3DLLA 3E9IA 1XPUA 1VCIA 4MNOA 1E1OA 1ASZA 2CFMA 4LUZA 3F2DA 4DV5L 3PIPA 2K52A 3GTLH 2D62A 3T1YL 3CCSA 3OW2A 2UXCL 3OTOL 5JEAJ 1YITA 3PO3H 3CC7A 4KI0A 1Z9FA 4DV4Q 1IBLQ 1BBUA 2N3SA 2NVYH 2N78A 2ES2A 4X64L 4A3KH 3S1RH 2XGTA 3UE1A 1XJVA 2ZJPA 1SFOH 2ZTDA 2FXQA 4DUZL 1N32L 1LTLA 2VY3A 1M90C 2KENA 4LFAQ 1G6PA 4A3JH 4JI6L 4QY7A 1PV4A 5ELOA 3I4OA 4DK3C 1VQ4A 3S2HH 3RN5A 4GKJQ 3CMEA 2UXDQ 1A0IA 2Z6KA 3I7FA 1X3EA 1UE5A 3G4SA 4A3CH 3CCLA 4C3IH 3F2BA 2JA7H 4JBKA 4LF6L 4JI5Q 3PUWA 1NTGA 2YV5A 1VQMA 2K5VA 1AE3A 3M9BA 3PCOB 5C0XI 4O0AA 3J81i 3MXNB 1PH5A 2NVQH 3HOWH 3GTMH 3AYHB 3D0FA 4LF7Q 3J80i 2D0OA 4PG3A 1Y1WH 3PO2G 3MEFA 4ALPA 5E7NA 3ER0A 2K5NA 1HZCA 1EIYB 4JI2Q 2JK8A 4FDBA 1I94Q 3HOUH 3EBEA 1L1OB 3NENA 3RZDH 2MNAA 4JI7Q 2EXDA 2V1CC 3F8TA 3GD7A 4R4OA 4NXML 3CC2A 1BKBA 3FKIG 2B63G 4NXNQ 2E8GA 1VQKA 5LMUQ 1EWIA 3PIOA 1PH1A 1VQGA 3TEHB 2ATWA 1E1TA 1YNXA 4GLVB 2CCZA 2CQOA 1VQHA 2OWOA 1VS0A 2UXCQ 1SROA 1EQQA 3CC4A 4A93H 4A3FG 2GVAA 1HH2P 1A8VA 2R92G 3RZOH 2AWNA 4DUYQ 1A63A 1I6HH 1K8GA 1YIJA 1N32Q 4LF8Q 4LFAL 4IJHA 2PI2A 4IO9A 4JI6Q 5IYBH 1KAWA 1TXYA 2Y0SE 3STBD 4DUZQ 3HOXG 3TS0A 2UUAQ 4POGA 1GVPA 2RHSB 3HOVH 3BZKA 3CD6A 4YY3L 1PH8A 1PHJA 4DR6Q 4POFA 3RNUA 2BA0A 4HIMA 2C35B 4JI4Q 1SRUA 5FLXc 2HHHQ 4WJ4A 4QGUA 2ASBA 1Q1EA 4C3HH 4X6AH 5FJ8H 1PH3A 4C3JH 1X3FA 5FJ8G 3M3YH 3CCJA 1XPRA 3HOYH 1V1QA 2WB1E 2MFIA 3HOUG 1QVGA 1X6OA 4X66L 4BXXG 1YI2A 3M85A 4JI2L 4GLXA 3HOXH 4JBJA 4P75A 3I4MG 3S2DH 1KC8C 3KF6A 4AYBG 2VUMH 3J81j 5IWAL 1Q1BA 1Q46A 1UE7A 1MIUA 5GAGC 4DV1L 2VZAA 3GTKH 2CWAA 3AFPA 4RG1A 2KCTA 1GKHA 1A62A 3RLOA 1HR0L 2UU9Q 1KHIA 4PZ8A 4DV7L 3H0GH 1X56A 5BR8L 3M4OH 5JJLA 3A0JA 4C2MH 1VQAA 1PH7A 1FL0A 4UP9A 2R7ZG 1GM5A 3L7ZC 3W5OA 4A3EH 2UUBQ 2JA8G 4B3SL 2R7FA 3PUVA 2JA5H 1TWAH 3HKSA 4A75A 4LNQA 3CQZH 4H02A 2ZJRA 1N36L 2Q2HA 1OXVA 2JE6I 4GN3B 1Q8KA 1FGUA 4GNXA 3CCUA 4JC0A 4JYAL 4DR5L 4B3TQ 2Q2IA 2NVXH 1B7YB 2IHEA 1M1KC 3AFQA 2L15A 1WYDA 5M3FG 1E22A 1R9TH 4JBMA 5C4JH 4L5QA 4YCUA 2AMCB 4YY3Q 4L5RC 2MQHA 4PZ7A 3I4NH 1H95A 2JJQA 4HJ9A 4KHPL 1N33Q 1J6QA 2A19A 3PF5A 1C9OA 1WOCA 1I5FA 1KRTA 1S72A 4LF4L 2OQKA 4X66Q 3PGZA 4DK6C 4DV3Q 4DR4L 3K7AH 5JEAG 1YZ6A 1K0RA 1JJCB 4OO1G 4GKKL 1IBMQ 3S1NH 1N8RC 3S1MH 4A76A 2JA6H 2WAQG 4JOIA 2YTXA 4DV1Q 4AIMA 4DR2Q 1QZGA 2E2IH 4IFDI 1CKOA 5FLMH 5IWAQ 4DV7Q 4JI5L 4K0KL 1X3GA 2R6GA 5IT9c 3J81c 4A3BH 3SGIA 4A3KG 1CSPA 1RL2A 4DR3Q 1W3SA 4JI0L 4IPHA 4BY7G 4TQUS 4B3SQ 1NMGA 1Y1VH 1VQDA 3KFUA 3JAMc 4HIKA 4JI3Q 1TWGH 4YWMA 2UUBL 2LXJA 4LFBL 1Z47A 1I94L 2UUCL 4ME3A 5HY6A 1IYJB 4JV5Q 3PUYA 3TREA 2R7ZH 3J7ZC 3F2CA 2A8VA 4R4IA 3TRZA 5IP7G 4LUOA 4GNXB 3IRBA 3GTPH 5LMUL 4B3RL 5JJIA 1K8AC 4A3MH 4JYAQ 4LF9Q 2Z0SA 2AHOB 3LGJA 4DR5Q 1YJWA 4OO1I 4LF5Q 1GD7A 1X9NA 1JMCA 2Z6KC 4KHPQ 3JC66 4HIDA 3CF5A 1HR0W 4JCVE 4OXPA 3ZJYC 1O7IA 1EYGA 3VDYA 1L2FA 3GTOH 4A3LH 1HNWL 4DV0Q 2LSSA 3KLWA 1OXSC 3S1QH 5M5XH 1IBKL 2ZTEA 3DM3A 1CKNB 3UDFA 2QEXA 4A3FH 3WWVA 2UUAL 2JA8H 1VQ7A 5C44G 1LUZA 4DV3L 4XIGS 1YHBA 3G6EA 4DR4Q 3EN2A 1OXTA 4DR2L 3D31A 4IFDG 1QUQB 3L0OA 4AQYL 2JEAI 1PYBA 5C0XJ 5IP9H 4UP8A 1VQ5A 2IHFA 2KHJA 4NB3A 4K0KQ 1JE5A 1BBWA 3UDXA 4JI0Q 1AH9A 3KDFA 2BH8A 1Q86C 1JT8A 2AWOA 1PVOA 2E2JH 3GTQH 3PV0A 1N34L 1J5EQ 3I4MH 2RF4A 1Q81C 4IOAA 3H3VI 4A3DH 3AQQA 2YTYA 2HT1A 2KBNA 1K83H 3HOYG 1OXXK 1CSQA 2MO0A 4A3IH 1HNXQ 4YHHL 1XNQL 2F52A 4IPCA 1VQBA 1PYSB 4X62L 5ELNA 3F1ZA 2DGYA 1VQ8A 4WJ3M 3A5ZB 1VQFA 1X65A 4Y7NH 1NJIC 4LF9L 1IZ6A 3M4PA 2VS1A 4A3EG 1LYLA 1OTCA 4BY7H 4APVA 5GROA 1BVSA 3STBC 5GAHC 2CWPA 2R7DA 2EQSA 2I5LX 3W1GA 3H0GG 3ERSX 4A3BG 3J7A5 3OTOQ 1VQ6A 4AH6A 1PH4A 2R93G 1UWVA 4BY1G 1SN8A 1IBLL 4DV0L 5M5YH 3M7NA 2VW9A 4B3TL 1VQEA 5J3BA 1MJCA 2YU9H 2HIXA 4GKJL 4GOPA 2UXDL 1E24A 3CCMA 4EQ5A 4R4CA 4R1JA 3S17H 1TWFH 1JB7A 3GO5A 4AQYQ 1WJJA 2B3GA 3ULPA 1SMXA 4B3MQ 1N33L 1EUJA 5K36G 1NBWA 1B70B 1L1OC 4BBRG 4JI8Q 1CKNA 3T1HL 1VQ9A 3S15H 4DPGA 4LF6Q 1UE6A 4A3DG 4GKKQ 2OTLA 3J80c 1YJ9A 3I55A 3NEMA 3CXCA 1SE8A 4BA2I 2NZOA 4L5SA 3I4NG 2A1AA 3K7UC 1XMOQ 1IBML 3HOVG 3S14H 4RMFA 1N9WA 1U0LA 3L2PA 5C3EH 3PF4A 2NN6I 2UXBQ 4YWLA 4QIWE 2GN5A 4GOPB 1XNQQ 1K9MC 1Q82C 5IYDG 2BH2A 1UEBA 1HZAA 4J15A 4P74A 1YJNA 1K73C 3K8AA 4BBSH 1CUKA 4YCVA 5IP9G 5C4XG 4A3CG 4YHHQ 3I56A 5H1SE 1KXLA 2R92H 4DR1Q 1NE3A 2H5XA 4LWCA 5IE8A 3JAMi 4NXNL 1KD1C 1XTDA 4A3JG 4NPSA 2K75A 3CP0A 4JI3L 3RR5A 2F4VQ 3GTGH 1WCMG 1Q12A 4JOIC 3KYHC 1W2BA 4LFBQ 2RCNA 1HJPA 2PMZE 3S24A 5IYBG 2VNUD 1XMQQ 1TWCH 1C7YA 1QVFA 4A3LG 4HJAA 4LF8L 1MKHA 3PUZA 4YWKA 4DUYL 3CMAA 2WB1G 3HKZG 5LMNW 1T9HA 2OQ0A 2HQLA 2CKZB 5IY0A 3KOJA 5C3EG 2DUDA 3OYYA 4HJ7A 4A3GG 2I0QA 1B8AA 1JJ2A 4DAMA 1G291 1NY4A 4X65Q 4DR6L 1P8LA 4JI4L 1EIFA 1EOVA 2HHHL 3H3VH 4O2DA 4JI8L 3KF6B 5GAEC 5DLQE 4A4IA 5C0XG 2ZJQA 2ALYB 2YYZA 1IXRA 1EQRA 2ID0A 3FHWA 2PI2E 3ULLA 4P72A 4DNIA 2VQFQ 4GNXC 4DV6Q 3CCQA 4HIOA 4DR7Q 4IFDJ 2EIFA 2UXBL 1HNZQ 4R4TA 1XPOA 4TVAB 1XMOL 3K81C 4BA1I 4JI1L 3G71A 2UU9L 5LMNL 2IY5B 3HKZE 4KLKA 1AE2A 4GN4B 3KJPA 1VQPA 1C0AA 2E5LL 4DKAC 3ULJA 3PO3G 1QUQA 1HR0Q 2VL6A 1XNRL 2F4VL 3U50C 1KL9A 2PNHA 3KJOA 3FP9A 4R4QA 1SR3A 1X55A 4OWXB 1S3OA 1PA6A 3HOZH 2I5MX 3CAMA 4UPAA 1N36Q 3T1YQ 3HOZG 2MO1A 4LFCQ 1V43A 5C44H 1D8LA 1YEZA 1OXUA 1HNXL 4DV4L 1PH9A 3TQYA 3FKIH 3CPWA 3H15A 2B63H 1CKMA 3U58A 4BBSG 2OTJA 3K0XA 4OWWB 3RLFA 1Y1WG 3CPFA 5M3FH 1NMFA 4LUVA 4MZ9A 4X65L 2K14A 2B29A 2LXKA 3UDIA 3HOWG 3W1BA 2PQAB 2XTIA 1JJGA 1VQLA 2N49A 4UP7A 2ZM6Q 1FVIA 2E2HH 4DV2L 1Y14B 4DAYB 4LF4Q 2K50A 1LM0A 4KHZA 4QQBX
chains in the Genus database with same CATH superfamily
2O5JC 1ESFA 4A3IG 1GO3E 2VQFL 2QDLA 4ZLTF 1VQNA 4EQOA 1J9OA 4HN7A 3E0EA 1E7ZA 3CCRA 1YBYA 4A3GH 4XQJA 1G91A 4QF4A 3I8ZA 2IX1A 5C3XA 2DY7A 3T1HQ 1AP0A 1A3UA 3QOLA 2PQAA 2Y0SG 2N8NA 3B6YA 1VF5C 4UHVA 1Q7YC 3I2ZA 2KHIA 4AYBB 1FGBD 1TY0A 2EJMA 4X3SA 4A93G 1I3QB 4JVZA 1AZPA 5GQOA 1GUWA 1SEBD 2WFWA 1QWYA 4JV5L 3C3LA 3S14B 3C1EA 2QA4A 1QVCA 3L9AX 2NN6G 4C3JB 1KQSA 4F88A 2L12A 2SNMA 1Y1VG 2XRSD 2LS01 2ZTCA 1CFMA 2AKWB 2B2YC 4C1NI 4AYBE 1RIPA 4TKOB 3L3OC 4DXFA 4QJFA 4MTNA 4EX5A 1BR9A 3MXNA 1FNWA 1GUGA 3Q8DA 2RDGA 2B39A 4K5VA 3HKZB 2VQEL 2F0MA 3HOYB 1L0XB 2IT1A 1B53A 4UY8C 1LT3D 2BE5D 2JEBI 4Z9CB 1I50H 1E3PA 5AJ3L 1CA6A 2JA9A 4A3MG 3GDEA 3OOCA 2JQOA 2EY5A 3SVMA 3CQZB 4P73A 3RD4A 4NXMQ 2R7ZG 1X54A 3EJIA 5I2XA 5IP7H 3MFGA 1NSNS 3RMHA 3F2DA 3OPOA 5CC4A 4P2CB 5A2QL 3HGBA 3NXWA 4B08A 3A7AB 3KBXA 3PO3H 1KNAA 4DV4Q 1BBUA 2R3ZA 2FMMA 1LTTD 1SFOH 2ZJPA 1N32L 1M90C 3DWAA 1E2VA 4DK3C 3S2HH 3K59A 3CMEA 1A0IA 1SNPA 1X3EA 1UE5A 3G4SA 3CCLA 1LT4D 1TWCB 4FP5D 4RAUC 4RHSA 1BDOA 1F2MA 1HTPA 4KD3A 3GTGB 4GKKL 1PH5A 1D5MC 3AYHB 3D0FA 2DNEA 3FDTA 1O7LA 3J80i 2D0OA 1O80A 3TZUA 1Y1WH 4LF7Q 4ALPA 3DEPA 2OF1A 2XSCA 3NSWA 4G57A 2EYPA 4O1NA 2JK8A 4RH6A 3HOUH 3EBEA 3HOZB 5CV7A 3NENA 3DWPA 3RZDH 2MNAA 1STYA 3CC2A 1BKBA 3FKIG 4E6IA 2B63G 1VQKA 1QCBD 3S1QB 1YNXA 2ZXPA 1VQHA 4A93H 2F0NA 3IKJA 4CDEC 1MBYA 3ITPA 2GVAA 1A8VA 3RZOH 1I6HH 1PRTD 3A56A 3MAQA 4IJHA 2PI2A 4IO9A 2L1BA 3STBD 3HOXG 2F1MA 2J4XA 1GVPA 4YY3L 3AMUA 2B8FA 4DR6Q 3RNUA 4JI4Q 4HIMA 2C35B 4WJ4A 1SXTA 2HCCA 5FJ8H 3AU7A 1H9JA 1X3FA 2MFIA 1MSGA 3HOXH 4JBJA 4P75A 1EYAA 1YNJD 4AYBG 4I65A 1KC8C 3OMGA 2VUMH 1JE4A 5IWAL 1Q1BA 1UE7A 5GAGC 3GV3A 4RG1A 5LHY1 3K5OA 4C2MH 1VQAA 2K05A 2UUBQ 3RZOB 4H02A 1N36L 3WOEA 4N8FA 2NBFA 1OXVA 3T13A 4DGZA 1TS2A 3PIP3 4EGVA 2NVXH 2CQAA 1E22A 4MTKA 5C4JH 4KJOA 4YCUA 5C6AA 4ODGA 2MQHA 3TP8A 3I4NH 1N33Q 2A19A 3PF5A 1C9OA 1WOCA 1I5FA 3CHBD 1KRTA 1WTQA 2EY1A 4LF4L 4UAIA 3MXUA 2NVQB 4FVMA 5IT9L 1KABA 3S1NH 4JW0A 3S1MH 2WAQG 5D65A 1QZGA 2JA7B 4A93B 4HSVA 3J81c 3D4DA 3SGIA 4KD4A 5ELFA 2EJFC 4DR3Q 4MIUA 4IPHA 4JI3Q 1KDCA 3G6JB 1A2UA 4LFBL 2F03A 1B50A 3GTLB 3TREA 3J7AF 2R7ZH 5C3WA 1MGSA 4R4IA 3NP8A 3GTPH 3SR1A 4A3MH 4JYAQ 4LF9Q 2Z0SA 3TZDA 4LF5Q 5KGUA 5FO7B 1JMCA 2Z6KC 3N6RA 1F9PA 3JC66 4HIDA 3W2DA 4JCVE 4OXPA 5CV9A 1O7IA 1TQOA 3IAYA 4U68A 1JR0D 2LSSA 3KLWA 5M5XH 1IBKL 4KKUA 3WWVA 2JA8H 1U4PA 2M2LA 1LUZA 4DR4Q 1YHBA 3NBHA 3RZDB 1Y8OB 3D31A 1QUQB 4AQYL 2JEAI 1SNOA 4UP8A 4K0KQ 3TP5A 3GTQB 1AH9A 2BOSA 1CA5A 4X3UA 2EOTA 4QB4A 1JT8A 2AWOA 5I4DA 4IQZA 3HRZC 4IN3A 2AUKA 4IOAA 3H3VI 3GTKB 1SDFA 3AQQA 4A3DH 5C4JB 3DXJC 2J0TD 2F52A 1PYSB 3EROA 1FNVA 2AQ2B 1VQFA 1X65A 4CKEA 4Y7NH 1IZ6A 2Z8LA 3M4PA 2Y0SB 4KY7A 3STBC 5GAHC 1X32A 4ME5A 2CWPA 1IHZA 3W1GA 3NQIA 1Z6HA 2OEOA 3H0GG 1WTOA 4DU9A 4U673 2I07B 1YNNC 1A3TA 1PH4A 4BY1G 1SN8A 5IODA 1BBXC 3OIQA 2VW9A 1RDPD 4A3EB 3MXPA 5J3BA 2YU9H 3K7AB 2UXDL 3NQTA 1E24A 4KMUC 4EQ5A 2EPBA 1EWHA 4LJZC 4R1JA 3S17H 1TWFH 2B3GA 4OHJA 1N33L 5K36G 4TSSA 1B70B 4C56C 4JI8Q 3S15H 2C5CA 1ENFA 3V05A 3K7UC 4FO2A 3HOVG 3L2PA 2NN6I 3A55A 1V1PA 5FK9C 4QIWE 2GN5A 3PO3B 1K9MC 1F9RA 2BH2A 3QR8A 1HZAA 2AUJD 2Z1CA 4OGQC 5M3FB 2R92H 2H5XA 3JAMi 2K75A 4R9WA 1WCMG 4JOIC 1EY4A 1HJPA 5G3LF 1GJXA 2EY2A 3DUZA 5M9OA 4HR7B 4HJAA 4LF8L 3CMAA 2WB1G 5LMNW 1IYVA 4ABNA 2NTTA 2OQ0A 5IY0A 2HDLA 1B4OA 2L11A 1J8IA 2NN6H 2HUGA 3S1RB 1G291 1HFNA 1EIFA 1EOVA 4XQNA 1MI2A 2B2YA 1UNSA 2M9VA 1BCPF 2MJ8A 3P75A 2ZJQA 1LACA 2YYZA 1IXRA 5E3FA 4GNXC 1VMPA 1HRJA 3CCQA 4IFDJ 1UUPA 1FYCA 1EQTA 5EBDA 3J81L 4TVAB 1A6XA 3K81C 2F0LA 4BA1I 4CDDC 3I4NB 4DNRB 1U9RA 3VA7A 3ONAB 5LMNL 1D1KA 4BWGB 1PRTB 1EIGA 1C0AA 3PO2B 2WINB 4LMQD 1B1ZA 1CT1D 4WJWA 1XNRL 1KL9A 3SXHA 3M3YB 1V1OA 3HOZH 4V190 3LX0A 3T1YQ 4LFCQ 5FO9B 1HNXL 2A74C 1K3BC 3TQYA 1STBA 3CPWA 3H15A 2NZ1D 5CV4A 4KN7C 5M3FH 3VYRA 3HOWG 4UP7A 1FVIA 3FPUB 4RGNA 3TBIB 2K50A 3JAME 1VDZA 2ZXRA 4HCEA 2PYKA 2JA7G 2RKSA 3ICEA 2A69C 2WIIB 1F77A 2O4XA 4DV6L 5KNDA 4DR7L 1K8OA 3TS2A 2D0PA 1CTMA 3TDQA 4IPDA 4B3ML 4JG2A 1LV9A 5EAYA 3SHLA 5IYCH 3K58A 3KDFB 1NUCA 1ASYA 1DYQA 5J39A 2K1BA 4R8NA 1IL2A 4IUPA 1BNZA 1XYIA 1FJGL 3EFXD 1M4VA 2R7ZB 1EL0A 1EEFD 1B3QA 3D6CA 2JN4A 4A3JB 4NKLA 4B3RQ 3V96A 1MJEA 3MXGA 2PZTA 4XYOA 1CM9A 1NR2A 4DV5Q 1B9NA 4LF5L 4RCNA 2N55A 2RSNA 3CRKC 5GADC 4GOPC 1CI3M 4XT1B 4X64Q 2SEBD 3A5UA 1HZBA 4PZ6A 1ZYRC 1SLJA 2A69D 4HJ8A 4QL5A 2IL8A 1IBKQ 1K3RA 4GLAC 1VQJA 1L0WA 2IJ0A 1SJHD 1D5ZC 1R4PB 1BOSA 2YTVA 2E74C 1R4QB 4JPBW 2IWHA 2VUMG 1N34Q 4PMWA 1DGSA 1TKWB 4FYDA 2JA6G 3RLNA 1G51A 1KIXA 3EVQA 4WFN3 1J5EL 4FF1A 3CCVA 4HCSA 1IKMA 1BO0A 1I4HA 1QG7A 5JPMC 3MWYW 3UE0A 1D6EC 1AFPA 1WFQA 2JA6B 1XPUA 1V9PA 3DLLA 4MNOA 1ASZA 5FOBB 1I6HB 1X3PA 1CZGA 3GTLH 3T1YL 3CCSA 1Q8IA 1STGA 3CC7A 3NTKA 3PO2G 1IBLQ 4A3KH 5C4HA 3UE1A 4PMCA 4DNTB 4M8AA 1LTLA 2VY3A 1BXTA 2KENA 2O2LD 4LFAQ 4A3JH 2KVMA 4QY7A 5L37A 3HOUB 4IFDH 2HDMA 2UXDQ 2Z6KA 5HGTA 5J22A 5CR3A 1WVLA 1S5BD 2JA7H 4LF6L 4JI5Q 4EQNA 3G7LA 2YV5A 4B9XA 4HEDA 2K5VA 1AE3A 5IGFA 3E6ZX 2R61A 4PG3A 3IL8A 1MD2D 1SYFA 1EIYB 1I4GA 1I94Q 2K7VA 1QNKA 3F8TA 3GD7A 5CGKA 4KHVA 4NXNQ 5LL6S 5LMUQ 3PIOA 1Y69U 1VQGA 1PH1A 3TEHB 2ATWA 1E1TA 2CCZA 3X3MA 2L55A 1EQQA 3CC4A 1HA5A 2K5DA 3S17B 1HH2P 2L0CA 5NUCA 4GZYC 1GUNA 1EIHA 4KTAA 5M3MB 1QJOA 4LF8Q 4LFAL 1W6KA 5FLXE 1GUOA 4JI6Q 3TS0A 2UUAQ 4DUZQ 1PZJD 2RHSB 2ICIA 5KYIA 1PH8A 4H13C 1U4RA 2ICEC 1E2WA 4ZUJA 2HHHQ 2NYZD 5C44B 5IIFA 4C3HH 1EQVA 5D14A 3BDCA 4K8IA 4G7HC 1V1QA 4X66L 1TIID 3M85A 4IURA 2MGSA 4WORA 5G3LD 3D4RA 2F0TA 3GTKH 4A3DB 2UU9Q 4PZ8A 3MC0B 3TMEA 3A0JA 4A3EH 2R7FA 1TWAH 5KYLA 4LNQA 2ZJRA 4GN3B 2PW7A 1WTWA 1FGUA 3SK8A 3VR3A 2F3VA 5EKLA 4K14A 5M3FG 4L5RC 4YY3Q 1H95A 4HJ9A 1J6QA 2QEJC 1S72A 4X66Q 4L6TB 3GV6A 3PGZA 3FPPA 4DV3Q 3FMCA 4OO1G 1K0RA 1N8RC 1U4LA 3SEBA 2JA6H 5DEHA 4DV1Q 2PZWA 4IFDI 2KOLA 5IWAQ 2PQEA 4JI5L 4A3BH 3OIPA 1STHA 4K8JA 1TWGB 1CSPA 2QILA 2B2VC 1W3SA 4QUCA 1HFGA 4HIKA 3GTOB 4YWMA 2SNSA 2UUBL 2RDFA 2LXJA 1Z47A 1I94L 5HY6A 2F3WA 3OMCA 2RQXA 1RHPA 4DXGA 1WCMB 1QB5D 2A8VA 1LTAD 4LUOA 4GNXB 1D2BA 5JJIA 5LMUL 2WACA 1K8AC 1TS3A 4DR5Q 1LO5D 3QO2A 4C1NK 1LTID 3OWFA 1E2ZA 4KHPQ 3KLSA 2L5TA 3OW7A 3GTOH 4G4KA 2LMCB 1PRTC 1JOQA 4O42A 1PTOD 1ENAA 3DM3A 3EQLC 2LKVA 4A3FH 2UUAL 3QB3A 1VQ7A 4XIGS 3LWEA 1LTRD 4IFDG 1ENCA 5T1GA 1BCPB 2BCOA 2EYJA 3WOFA 4RHRA 2E2DC 1PTOC 4DN4M 1BBWA 3UDXA 3T51B 3HOVB 3NWSA 2X6GA 4C2MB 1Q86C 2E2JH 4R8IA 2MUYA 4HTHA 2ZXOA 2YTYA 2KBNA 1K83H 4FNFA 3J7YW 4C3HG 4YHHL 1PXUA 1XNQL 1Y1VB 1VQBA 5ELNA 1GUTA 1HUMA 2DGYA 2Z4HA 1JICA 1VQ8A 1XXGA 4LAAA 2K5WA 1JWSD 3I90A 2VS1A 1OTCA 5EPKA 1H9MA 5I2YA 1C48A 2EQSA 2I5LX 1EU3A 5F2DA 4A3BG 3J7A5 3R2TA 3OTOQ 1EU4A 1BF4A 4AH6A 4J1MA 2R93G 3M7NA 4DV0L 4G7ZC 4B3TL 1MJCA 2HIXA 4CJ0B 1SNDA 1RKNA 1IW7D 1WJJA 1SMXA 3SK5A 3BDOA 3T1HL 3SK6A 4LF6Q 4A3DG 1UE6A 4GKKQ 1YJ9A 1R9TB 3NEMA 2XNAC 3CXCA 1SE8A 4ULLA 3C2PA 1SFOB 2B2WA 4L5SA 3ND8A 3I4NG 3S14H 1ILPA 5M5XB 1F2YA 1JWMD 1XNQQ 3KBGA 1TR5A 4J15A 4BBSH 1CUKA 4YCVA 3OHXC 3I56A 1CQVA 4OIKA 2EYHA 4DR1Q 3CRLC 2L4NA 4A3JG 1HXYD 3RR5A 2F4VQ 3CP0A 3GTGH 3K5LA 2A73B 2FJ2A 1SE4A 3KYHC 5CYUA 4OIJA 5C3EB 5IYBG 3K5NA 2VNUD 1C7YA 1QVFA 1YNND 2HD3A 3PUZA 2KJXA 4DUYL 4X3TA 1T9HA 1DOKA 2CKZB 2DUDA 4KN4C 1JJ2A 3R8BA 4X65Q 4PQXA 4EVOA 3I4MB 1CQFA 3H3VH 4O2DA 3KK7A 4JI8L 5C0XG 5GAEC 4A4IA 2ALYB 3MHBA 2ID0A 2PI2E 3ULLA 4P72A 4DV6Q 4DR7Q 2F0FA 2EIFA 3BG3A 1HNZQ 4R4TA 1XPOA 4EQPA 5FO8B 1EY5A 4XQQA 3G71A 2NB0A 2EXZA 1RJTA 1VQPA 4KY6A 4L8JA 1JORA 1EZ6A 1H9SA 2PNHA 1VMCA 2Q8TA 1CHQD 1PA6A 4KKSA 5CORA 2B2VA 3J81E 4ZAIA 1N36Q 3HOZG 4CDCC 1V43A 3VR5A 5C44H 3KUPA 1D8LA 1YEZA 3FKIH 2B63H 3QIAA 1JC7A 4BBSG 3BVGA 5I6YA 2A68C 1JQYD 3H0GB 4OWWB 1LT5D 4ILWA 4LUVA 3A54A 4X65L 1IL8A 1WD1A 3HEJA 1CZWA 3W1BA 3NTHA 2XTIA 1VQLA 1YNJC 2A5HA 2E2HH 1PFNA 4DAYB 4LF4Q 5JJZA 1SMYD 5DAUA 4KK7A 4FXGC 1HNZL 3G48A 3MVVA 5DNFA 2KHSA 1YHQA 1Z7TA 4LF7L 2K01A 1LABA 2PMZB 4IOCA 5CV6A 1LLRD 2EJGC 5IGEA 2KEEA 3NBHB 2E5LQ 2IW3A 3NELA 2F0OA 1E0BA 4DR3L 1I3QH 4Q0FA 2R93H 3J80L 3GTMB 4KV6A 5FLMG 1XNRQ 5M3MH 3PIO3 2K5HA 1STNA 1WCMH 2PNRC 3I91A 1P16A 5AJ3Q 2WAQE 3RN2A 4OL7A 3HG9A 3Q0AA 2UUCQ 4ZRZA 4OX9Q 3GTJH 5COYA 4DR1L 3S16H 1X3QA 5CV8A 2CW0D 3CU7A 4PNYA 1H9SB 2CH4A 3A8KE 3M4QA 3E3XA 5M3MG 1H9RA 3KLSX 1TY2A 1XMQL 1UAPA 1K83B 1HA6A 2P5ZX 5KNBA 1ZXTA 4IZ8A 4CJ2C 1I6VC 1F2LA 5HGQA 5IGBA 2RHQB 5JVH3 3BZCA 2JA5G 3UI2A 1G6ZA 3BJUA 3EA6A 4ZYSA 4OWTB 4NP5A 4GN5A 4OONA 3U4VA 4CGYB 5BN3A 4QUFA 1II3A 5HURA 4OELB 1YHAA 1Q3LA 2KA7A 5IYDH 1WI5A 2WP8J 3U4ZA 4BY1H 3QJYA 4Y7NB 1EFWA 2EYFA 2Z6BA 3RUZA 1YVCA 1WTXA 3KF8A 3BU2A 1FJGQ 2DY8A 4JI1Q 3ND9A 4OX9L 3E9HA 4IJLA 2G9DA 4JI7L 4P71A 2HIVA 3OWEB 4J8QA 1KRSA 4XTCS 1PTOB 4BBRH 4X62Q 4K5XA 4L63B 3HFZB 3SE0A 2YU9B 2IX0A 3E9IA 1KDBA 1VCIA 3NUCA 4LUZA 2Z9HA 3PIPA 1IKLA 3BS1A 1NR4A 1PMRA 5JEAJ 1SYEA 4ZKBB 1C8CA 2ES2A 2N3SA 2NVYH 2N78A 4X64L 1FD7D 1LTGD 2VXWA 3I70A 4DUZL 1WTVA 3KLRA 5IGDA 4A3KB 2RSOA 3U9OA 5ELOA 3RN5A 3I7FA 4H7BA 5CV5A 5IGCA 2E2HB 1EY8A 1NTGA 4RWSC 4DAVA 5E1FA 1SAPA 3M9BA 3PCOB 4O0AA 3HOWH 3FRPB 1PZID 5BN5A 3MEFA 4CDFC 5E7NA 3ER0A 3R3OA 1FR3A 5E4WC 4JI2Q 1EZ8A 1RCVD 1A2TA 1L1OB 1Y8NB 4IUVA 2EXDA 2V1CC 5K36H 2JSOA 2VB2X 2G5DA 5JVG3 2OXPA 4YIJA 2TSSA 4GLVB 1LTBD 1VS0A 5T1IA 5EPLA 3BZDB 3J80E 2B8GA 2XRQD 1K8GA 1YIJA 4QCLA 1N32Q 4N9PA 1DZ1A 3M4OB 1AZQA 2MP1A 1KAWA 4POGA 2Y0SE 2WKCA 1PHJA 2BDOA 4QGUA 2ASBA 2NVTB 2RVLA 1LT6D 2QCPX 4Q5VA 1K0SA 1PH3A 2HQEA 1SBBB 3T16A 3M3YH 1SNMA 1XPRA 1WTHA 2WB1E 3HOYH 3HOUG 3DMUA 4BXXG 5KRUA 1NNXA 4JI2L 4GLXA 1MHWC 4V0BA 2QF7A 1SJED 2L9HA 3LNNA 3J81j 4K6DA 1XX8A 2VZAA 5C4ZA 3AFPA 1TS4A 1GKHA 1A62A 1HR0L 4DV7L 5JJLA 1JCKB 1GOZA 2WKDA 1FL0A 4UP9A 4RA8A 3W5OA 3GTPB 2JA8G 4B3SL 1EY0A 3HKSA 1ZYRD 2JE6I 3Q6SA 1BUVT 3P1HA 4JC0A 4DR5L 1B7YB 1M1KC 3AFQA 4F87A 5IT9E 2L15A 4JBMA 1KLUD 5ISRA 1HHVA 2JA5B 5EQ0A 5C0XH 1DONA 2OQKA 3S1NB 1GUSA 3K7AH 1QNUA 1YZ6A 1JJCB 1PFMA 1KAAA 2CHBD 3M4YA 1LTSD 4JOIA 5TSSA 1TU2B 4DR2Q 1CKOA 5FLMH 4DV7Q 2XWBB 1X3GA 1S4ZA 2R6GA 5IT9c 2NUCA 5I6WA 4QMGA 3NHHA 4A3KG 1RL2A 4JI0L 4TQUS 4B3SQ 1NMGA 1Y1VH 1VQDA 3KFUA 2G9HD 1TWGH 2QDBA 1HPCA 1PYWD 1ZKOA 4ME3A 5DM63 3FEWX 3TRZA 4ZQ3A 2EDGA 2BDNA 3QG1A 5CBEE 2AHOB 5JPNC 4OO1I 1GD7A 3ZYYX 1VF7A 4DF7A 1AN8A 1EYGA 1DD2A 1L2FA 1HNWL 5C5MA 4DV0Q 3MA2B 3VA5A 3S1QH 1BCPD 4ZK9B 4I7AA 1CKNB 2QEXA 1SNCA 5C44G 4DV3L 3M7GA 1OXTA 4DR2L 4N9TA 2A6ED 2DJFC 1QILA 5C0XJ 4KJNA 4XXEA 2IHFA 3H6MA 4RFBA 2F0IA 4JI0Q 1FNUA 3FKIB 2B63B 3DWQA 1IYUA 1PVOA 3GTQH 3PV0A 1M8AA 1TS5A 1J5EQ 3I4MH 2EYLA 2RF4A 1Q81C 5FKAC 4RKLA 1W6JA 2MO0A 1CSQA 1GHJA 4A3IH 1HNXQ 4XT3B 4X62L 4BY7B 1SSOA 3A5ZB 1NJIC 5D3IB 4A3EG 1S5CD 4APVA 3X3NA 2R7DA 4DA2A 4JK1C 3S9WA 4DFAA 1KLGD 1AW7A 1UWVA 1EWCA 5M5YH 1VQEA 3V2TA 5IGGA 4GKJL 3NBIA 3CCMA 1SYDA 4RGOS 1O78A 1O7YA 2C9OA 1JB7A 4PV1C 4B3MQ 1KDAA 5JEAH 1NBWA 1L1OC 4BBRG 3HP3A 1CKNA 1VQ9A 4IALA 4BA2I 4DAYA 2NZOA 2PO4A 2A1AA 2FHTA 1U0LA 5C3EH 3PF4A 3D6WA 5I9OA 2UXBQ 1PFBA 4GOPB 4OEMB 2F0SA 1Q82C 5IYDG 1UEBA 3K8AA 5IP9G 3C1FA 4YHHQ 5JAVA 1JWUD 1T5EA 5H1SE 1KXLA 1RTOA 1NE3A 4LWCA 5ELDA 5IE8A 4RKBA 1ZEQX 4BBSB 4JI3L 4M1UB 1G2SA 1PTOH 4LFBQ 1TWHB 2RCNA 1B2TA 3S24A 4HAEA 1RD9D 4XDXA 4A3LG 1MKHA 2EYMA 1PTOF 1ML0D 1STEA 4A3FB 4K2LA 3OYYA 4A3GG 2I0QA 1EY9A 2NVYB 4A3BB 3VR6A 4DAMA 3NK9A 4DR6L 1P8LA 2FINB 3NE5B 2WB1B 4JI4L 1I4QA 5DLQE 4C3JG 2VQFQ 1EQRA 2AQ1B 4HIOA 1HUNA 1JB3A 2UXBL 3FVQA 5BN4A 3IFDA 2BE5C 4DK1A 1XMOL 2R93B 2UU9L 4KLKA 3HKZE 4GN4B 3KJPA 2JA8B 2WAQB 1RTNA 1K28A 1EOTA 4DKAC 1B9MA 3ULJA 2NVXB 1HR0Q 1WD0A 4DK0A 2ENBA 3U50C 1SYCA 2EZVA 4R4QA 1SR3A 1X55A 4OWXB 1S3OA 1TVXA 4H44C 2I5MX 1IW7C 3CAMA 1K8MA 1OXUA 4UDUC 1PH9A 5I9PA 3U58A 3RLFA 1I4RA 1Y1WG 4A3MB 1NMFA 2JXMB 2LXKA 1STAA 3Q22A 3A8IE 1JJGA 1H9KA 3QOJA 4HMIA 2NWGA 3H94A 4KHZA 1RODA 1ESRA 2PW5A 2F4IA 2CVRA 3I3CA 5M5WH 2Q2TA 1PH6A 1V8QA 3A7LA 3BDLA 4XYQA 1F9QA 5JJKA 1SE2A 1VQOA 4GS3A 4C3HB 3P20A 1UE1A 2CH4W 5LMNQ 1EFID 3GP7A 2NZHA 2VQEQ 1TWHH 3CW2C 2D9UA 3GQBA 2QGQA 2F3IA 3AEVA 3K0YA 1VQIA 2XN9C 3K80C 1QE6A 2DJGC 4LFCL 1DJRD 5M5YB 4IPGA 4OO1H 2H1EA 2XVSA 3URYA 2Q2UA 3S2DB 5C4XH 1VQCA 4L5TA 1L1OA 2Z4IA 1HZ9A 3UDGA 4PMBA 1S5FD 1QZHA 1CK1A 5KNCA 2I5HA 2KQ3A 2EYOA 4MN3A 1TT2A 2GVBA 1U4MA 2KCCA 5IYCG 2ZM6L 1U5KA 4DV2Q 2B2UC 2BA1A 3PSIA 4LW1A 4N8X1 1BQQT 1HNWQ 1A15A 2K4KA 3CCEA 1PFSA 1KNEA 3MFYA 2SDFA 2RCFA 4FF3A 4J6HA 2IPKD 3E0JA 1S40A 3KF8B 1D7QA 1PH2A 5IOCA 3A74A 4JBWA 3T4AC 2O5IC 2OCEA 4WRDA 1PLFA 4HJ5A 3PUXA 5BR8Q 3PO2H 1JOOA 2F0KA 4Y52H 2Q8IB 1DOMA 2NVTH 5M5WB 4BXXH 2MHVA 1EEID 3VR2A 2KCMA 2F0UA 2F0VA 4YCWA 4KKTA 3EIVA 2RBMA 3JAML 1KTKA 3TP7A 3DHQA 4TRDA 1E1OA 2CFMA 2MPMA 4DV5L 2FFKB 4G7OC 2K52A 2D62A 3OW2A 2UXCL 3OTOL 1F9SA 1YITA 1GHKA 4KI0A 4B9WA 1Z9FA 3Q23A 3DM1A 3S1RH 2XGTA 3HOXB 1XJVA 1HTLD 2ZTDA 2FXQA 1I4XA 4RGTA 1G6PA 2KCNA 4JI6L 5EJWA 1PV4A 3IFTA 3I4OA 3CKIB 1VQ4A 4GKJQ 1RF2D 3VYUA 3HS0C 4A3CH 2F0EA 4C3IH 3F2BA 5ELEA 1L0YB 4HMJA 4JBKA 3PUWA 4BS9A 4FF4A 1VQMA 4NW2A 1Y1WB 5C0XI 3J81i 3MXNB 2NVQH 3GTMH 1ONLA 3QWNA 2K5NA 1HZCA 4K2KA 4FDBA 4K6LA 1D1IA 2K5QA 3I73A 5FLXL 3TSSA 3K5MA 4JI7Q 1G8ZD 3NTIA 4R4OA 4NXML 2E8GA 1EWIA 3S15B 3S16B 4FXDA 5K5PA 4IUNA 2CQOA 2OWOA 2UXCQ 1SROA 1JOKA 1NCVA 4A3FG 2JYOA 1SMYC 2R92G 3K6OA 5KEEA 2D5DA 3AB9A 2AWNA 4DUYQ 1A63A 5EKIA 2D2CC 3U9SA 2RA4A 5IYBH 1TXYA 3HOWB 2JP1A 2R92B 3H3VC 3HOVH 2KECA 3BZKA 3CD6A 2SOBA 4POFA 2BA0A 2PPBC 1SRUA 5FLXc 2HCIA 1Q1EA 1I50B 4KY5A 3MZ5A 4X6AH 2H4OA 4C3JH 3HZXA 5FJ8G 3CCJA 3W3AA 5AFWA 1EY6A 1X6OA 2QKIC 1QVGA 1XTCD 1YI2A 4IUUA 1DM0B 3I4MG 3S2DH 3KF6A 2F0JA 2A68D 4CBVA 1Q46A 1XWEA 2A6HC 1MIUA 3OSOA 4DV1L 2CWAA 3RLOA 5ELBA 2KCTA 3PQIA 2DN8A 1KHIA 3H0GH 1X56A 2CW0C 5BR8L 3M4OH 3WDNA 3MEHA 2A6EC 1PH7A 1GM5A 3L7ZC 5CBAE 3PUVA 2JA5H 2K04A 4A75A 3CQZH 2Q2HA 3S2HB 2VUMB 2B2WC 1Q8KA 4GNXA 3CCUA 4JYAL 4B3TQ 3SDZA 2Q2IA 2IHEA 3T56B 1R9TH 1WYDA 3K57A 4L5QA 2AMCB 4PZ7A 1ET9A 2F0PA 2JJQA 4KHPL 3NPPA 2K03A 3VYSA 1SNQA 1EYDA 2Q8RE 4RGMA 4DK6C 1UEAB 4DR4L 5EBCA 5JEAG 3Q24A 1IBMQ 4BBRB 2WV6D 4CKBA 4A76A 2I46A 3ERQA 2YTXA 4AIMA 4C3IB 2E2IH 3BYTB 1ICFB 4K0KL 4A3GB 4CKCA 3NWTA 5C5LA 4BY7G 2FMCA 3JAMc 3R93A 2UUCL 2F0DA 4F7XA 3S1MB 1IYJB 2IX3A 4JV5Q 3PUYA 2B2TC 3T53B 3J7ZC 2EVBA 3F2CA 1EY7A 5IP7G 3IRBA 4B3RL 1C4QA 1YJWA 3LGJA 2J7ZA 4QIWB 3VR4A 3H09A 1X9NA 5CMDA 1S5ED 3CF5A 1DXMA 1F2ZA 1HR0W 3ZJYC 3BVZA 1D5XC 4CHTB 3LWUA 3VDYA 4A3LH 4FF2A 1OXSC 1SYBA 1HCZA 2ZTEA 3UDFA 2B2UA 4C3IG 4I7ZC 1AEXA 5ELCA 3G6EA 3BVMA 2E76C 3EN2A 3R2IA 1ICWA 3L0OA 4RCOA 5DM73 1PYBA 5IP9H 3O13A 1VQ5A 2E75C 2KHJA 5A35A 4NB3A 1JE5A 2QW7A 2E2JB 3KDFA 1HQRD 2BH8A 4NDXA 3A8JE 1N34L 3D3RA 4S3SA 2N88A 2K33A 1SYGA 2HT1A 3HOYG 1OXXK 1SE3A 1PZKD 4MHEA 4ZUIA 4IPCA 3F1ZA 3PMFA 4WJ3M 2M00A 4HSPA 2XWJB 4A3IB 4LF9L 1LYLA 4IUQA 5EKKA 3C46A 4BY7H 3SK4A 4X3KA 1BVSA 5GROA 3GTJB 3ERSX 2F0HA 1VQ6A 3D8GA 2DNCA 1Q90A 4FXKC 2VB3X 1IBLL 1A3VA 1EYCA 5E4XA 4GOPA 5D3DA 4LK1C 4R4CA 1ET6A 1NAPA 3GO5A 4AQYQ 2X6LA 3ULPA 1EUJA 3DEOA 3MTSA 1PRTF 2LFNA 5EPJA 4DPGA 3I72A 2OTLA 3J80c 3I55A 2B2TA 5C4XB 2TMPA 1IBML 1XMOQ 4RMFA 1N9WA 2PZUA 1QOHA 2K6AA 4YWLA 1PDQA 1HQMC 1K73C 1YJNA 4P74A 1CHPD 1TWAB 5C4XG 5JOBA 4A3CG 2KEDA 4NXNL 1KD1C 1XTDA 1I4PA 4NPSA 3I4LA 1ILQA 5KIXA 4CJ1B 1Q12A 3TN2A 2AQ3B 1W2BA 1B3AA 2ZT9C 2PMZE 1XMQQ 1TWCH 4ZKCB 2A6HD 1V1PB 4YWKA 3D4WA 4F8MA 3HKZG 1O7ZA 2HQLA 3TP6A 5C3EG 3KOJA 4BY1B 2V4DA 4K5WA 1OO9B 4HJ7A 3H91A 1B8AA 1NY4A 4ID6A 1B44D 2EE1A 2HHHL 4ZCKA 2X69A 2KUMA 3KF6B 3FHWA 2GA4B 4DNIA 5EGTA 1DOLA 3VYTA 2K32A 4NMZA 4JI1L 1GXDC 1MSHA 2EY6A 3N52A 2IY5B 1AE2A 3P7JA 2LY7A 1G2TA 2F0QA 2E5LL 3PO3G 4DAPA 1QUQA 3E5SA 1S5DD 2VL6A 2F4VL 2XIWA 2F0GA 4H0LC 3KJOA 3FP9A 3BYYB 2NTSA 4UPAA 2MO1A 2E2IB 1T5XD 1DCZA 1Y8PB 1BCPC 2PCFB 2K28A 4DV4L 1TWFB 4IUTA 3F2UA 1WTRA 1WTPA 1CKMA 2F0WA 2OTJA 3J7AV 2RDHA 3K0XA 3CPFA 4MZ9A 2OT2A 2K14A 5A2QE 2B29A 3UDIA 2PQAB 5LL6X 2N49A 5J1ZA 2ZM6Q 4DV2L 1Y14B 1LM0A 4QQBX
chains in the Genus database with same CATH topology
5M5WH 4A3IG 2Q2TA 1PH6A 1GO3E 1HNZL 3G48A 2VQFL 2JA7G 3ICEA 5JJKA 1VQNA 4DV6L 4DR7L 1VQOA 4GS3A 1YHQA 3E0EA 4LF7L 3TS2A 2D0PA 1E7ZA 3CCRA 1YBYA 4IOCA 4A3GH 1UE1A 5LMNQ 4IPDA 4B3ML 2NZHA 4JG2A 3NBHB 2VQEQ 2E5LQ 2IX1A 3T1HQ 1TWHH 3CW2C 3NELA 5EAYA 2PQAA 2Y0SG 2QGQA 4DR3L 2F3IA 5IYCH 1I3QH 3AEVA 2N8NA 3B6YA 3KDFB 2R93H 1ASYA 1VQIA 5FLMG 1Q7YC 1XNRQ 3K80C 3I2ZA 2KHIA 5M3MH 1IL2A 1FJGL 4LFCL 4A93G 2K5HA 1WCMH 4IPGA 1P16A 5GQOA 2WAQE 5AJ3Q 3RN2A 2UUCQ 2Q2UA 2WFWA 4OX9Q 4B3RQ 3GTJH 4JV5L 5C4XH 1MJEA 4DR1L 1VQCA 4L5TA 3S16H 2QA4A 1QVCA 1L1OA 2NN6G 3UDGA 1HZ9A 1KQSA 1QZHA 1Y1VG 3M4QA 5M3MG 2ZTCA 4DV5Q 4LF5L 2I5HA 2GVBA 2AKWB 5GADC 5IYCG 4GOPC 1XMQL 2ZM6L 4X64Q 1U5KA 4DV2Q 4AYBE 5HGQA 3A5UA 2BA1A 1HZBA 1RIPA 3PSIA 4LW1A 4PZ6A 2RHQB 1HNWQ 2K4KA 1SLJA 3BZCA 2JA5G 4QJFA 4HJ8A 4QL5A 1IBKQ 3CCEA 1K3RA 3BJUA 1PFSA 1VQJA 4GLAC 4MTNA 4EX5A 1L0WA 4OWTB 4GN5A 4OONA 3U4VA 3Q8DA 1S40A 3KF8B 1D7QA 1YHAA 1PH2A 3A74A 4JBWA 2YTVA 2OCEA 2VQEL 5IYDH 1WI5A 2WP8J 3U4ZA 4BY1H 2VUMG 4HJ5A 3PUXA 1EFWA 5BR8Q 1YVCA 2IT1A 3PO2H 4UY8C 1N34Q 2JEBI 4PMWA 4Y52H 1DGSA 3BU2A 1I50H 3RLNA 1E3PA 1G51A 5AJ3L 1KIXA 1FJGQ 2JA6G 2NVTH 2JA9A 4JI1Q 4A3MG 4BXXH 1J5EL 3GDEA 4OX9L 2JQOA 2KCMA 3E9HA 4IJLA 4P73A 3CCVA 4JI7L 4NXMQ 4P71A 2HIVA 4YCWA 1X54A 1KRSA 3EIVA 4XTCS 3UE0A 4BBRH 4X62Q 1WFQA 3HFZB 5IP7H 2IX0A 1V9PA 3DLLA 3E9IA 1XPUA 1VCIA 4MNOA 1E1OA 1ASZA 2CFMA 4LUZA 3F2DA 4DV5L 3PIPA 2K52A 3GTLH 2D62A 3T1YL 3CCSA 3OW2A 2UXCL 3OTOL 5JEAJ 1YITA 3PO3H 3CC7A 4KI0A 1Z9FA 4DV4Q 1IBLQ 1BBUA 2N3SA 2NVYH 2N78A 2ES2A 4X64L 4A3KH 3S1RH 2XGTA 3UE1A 1XJVA 2ZJPA 1SFOH 2ZTDA 2FXQA 4DUZL 1N32L 1LTLA 2VY3A 1M90C 2KENA 4LFAQ 1G6PA 4A3JH 4JI6L 4QY7A 1PV4A 5ELOA 3I4OA 4DK3C 1VQ4A 3S2HH 3RN5A 4GKJQ 3CMEA 2UXDQ 1A0IA 2Z6KA 3I7FA 1X3EA 1UE5A 3G4SA 4A3CH 3CCLA 4C3IH 3F2BA 2JA7H 4JBKA 4LF6L 4JI5Q 3PUWA 1NTGA 2YV5A 1VQMA 2K5VA 1AE3A 3M9BA 3PCOB 5C0XI 4O0AA 3J81i 3MXNB 1PH5A 2NVQH 3HOWH 3GTMH 3AYHB 3D0FA 4LF7Q 3J80i 2D0OA 4PG3A 1Y1WH 3PO2G 3MEFA 4ALPA 5E7NA 3ER0A 2K5NA 1HZCA 1EIYB 4JI2Q 2JK8A 4FDBA 1I94Q 3HOUH 3EBEA 1L1OB 3NENA 3RZDH 2MNAA 4JI7Q 2EXDA 2V1CC 3F8TA 3GD7A 4R4OA 4NXML 3CC2A 1BKBA 3FKIG 2B63G 4NXNQ 2E8GA 1VQKA 5LMUQ 1EWIA 3PIOA 1PH1A 1VQGA 3TEHB 2ATWA 1E1TA 1YNXA 4GLVB 2CCZA 2CQOA 1VQHA 2OWOA 1VS0A 2UXCQ 1SROA 1EQQA 3CC4A 4A93H 4A3FG 2GVAA 1HH2P 1A8VA 2R92G 3RZOH 2AWNA 4DUYQ 1A63A 1I6HH 1K8GA 1YIJA 1N32Q 4LF8Q 4LFAL 4IJHA 2PI2A 4IO9A 4JI6Q 5IYBH 1KAWA 1TXYA 2Y0SE 3STBD 4DUZQ 3HOXG 3TS0A 2UUAQ 4POGA 1GVPA 2RHSB 3HOVH 3BZKA 3CD6A 4YY3L 1PH8A 1PHJA 4DR6Q 4POFA 3RNUA 2BA0A 4HIMA 2C35B 4JI4Q 1SRUA 5FLXc 2HHHQ 4WJ4A 4QGUA 2ASBA 1Q1EA 4C3HH 4X6AH 5FJ8H 1PH3A 4C3JH 1X3FA 5FJ8G 3M3YH 3CCJA 1XPRA 3HOYH 1V1QA 2WB1E 2MFIA 3HOUG 1QVGA 1X6OA 4X66L 4BXXG 1YI2A 3M85A 4JI2L 4GLXA 3HOXH 4JBJA 4P75A 3I4MG 3S2DH 1KC8C 3KF6A 4AYBG 2VUMH 3J81j 5IWAL 1Q1BA 1Q46A 1UE7A 1MIUA 5GAGC 4DV1L 2VZAA 3GTKH 2CWAA 3AFPA 4RG1A 2KCTA 1GKHA 1A62A 3RLOA 1HR0L 2UU9Q 1KHIA 4PZ8A 4DV7L 3H0GH 1X56A 5BR8L 3M4OH 5JJLA 3A0JA 4C2MH 1VQAA 1PH7A 1FL0A 4UP9A 2R7ZG 1GM5A 3L7ZC 3W5OA 4A3EH 2UUBQ 2JA8G 4B3SL 2R7FA 3PUVA 2JA5H 1TWAH 3HKSA 4A75A 4LNQA 3CQZH 4H02A 2ZJRA 1N36L 2Q2HA 1OXVA 2JE6I 4GN3B 1Q8KA 1FGUA 4GNXA 3CCUA 4JC0A 4JYAL 4DR5L 4B3TQ 2Q2IA 2NVXH 1B7YB 2IHEA 1M1KC 3AFQA 2L15A 1WYDA 5M3FG 1E22A 1R9TH 4JBMA 5C4JH 4L5QA 4YCUA 2AMCB 4YY3Q 4L5RC 2MQHA 4PZ7A 3I4NH 1H95A 2JJQA 4HJ9A 4KHPL 1N33Q 1J6QA 2A19A 3PF5A 1C9OA 1WOCA 1I5FA 1KRTA 1S72A 4LF4L 2OQKA 4X66Q 3PGZA 4DK6C 4DV3Q 4DR4L 3K7AH 5JEAG 1YZ6A 1K0RA 1JJCB 4OO1G 4GKKL 1IBMQ 3S1NH 1N8RC 3S1MH 4A76A 2JA6H 2WAQG 4JOIA 2YTXA 4DV1Q 4AIMA 4DR2Q 1QZGA 2E2IH 4IFDI 1CKOA 5FLMH 5IWAQ 4DV7Q 4JI5L 4K0KL 1X3GA 2R6GA 5IT9c 3J81c 4A3BH 3SGIA 4A3KG 1CSPA 1RL2A 4DR3Q 1W3SA 4JI0L 4IPHA 4BY7G 4TQUS 4B3SQ 1NMGA 1Y1VH 1VQDA 3KFUA 3JAMc 4HIKA 4JI3Q 1TWGH 4YWMA 2UUBL 2LXJA 4LFBL 1Z47A 1I94L 2UUCL 4ME3A 5HY6A 1IYJB 4JV5Q 3PUYA 3TREA 2R7ZH 3J7ZC 3F2CA 2A8VA 4R4IA 3TRZA 5IP7G 4LUOA 4GNXB 3IRBA 3GTPH 5LMUL 4B3RL 5JJIA 1K8AC 4A3MH 4JYAQ 4LF9Q 2Z0SA 2AHOB 3LGJA 4DR5Q 1YJWA 4OO1I 4LF5Q 1GD7A 1X9NA 1JMCA 2Z6KC 4KHPQ 3JC66 4HIDA 3CF5A 1HR0W 4JCVE 4OXPA 3ZJYC 1O7IA 1EYGA 3VDYA 1L2FA 3GTOH 4A3LH 1HNWL 4DV0Q 2LSSA 3KLWA 1OXSC 3S1QH 5M5XH 1IBKL 2ZTEA 3DM3A 1CKNB 3UDFA 2QEXA 4A3FH 3WWVA 2UUAL 2JA8H 1VQ7A 5C44G 1LUZA 4DV3L 4XIGS 1YHBA 3G6EA 4DR4Q 3EN2A 1OXTA 4DR2L 3D31A 4IFDG 1QUQB 3L0OA 4AQYL 2JEAI 1PYBA 5C0XJ 5IP9H 4UP8A 1VQ5A 2IHFA 2KHJA 4NB3A 4K0KQ 1JE5A 1BBWA 3UDXA 4JI0Q 1AH9A 3KDFA 2BH8A 1Q86C 1JT8A 2AWOA 1PVOA 2E2JH 3GTQH 3PV0A 1N34L 1J5EQ 3I4MH 2RF4A 1Q81C 4IOAA 3H3VI 4A3DH 3AQQA 2YTYA 2HT1A 2KBNA 1K83H 3HOYG 1OXXK 1CSQA 2MO0A 4A3IH 1HNXQ 4YHHL 1XNQL 2F52A 4IPCA 1VQBA 1PYSB 4X62L 5ELNA 3F1ZA 2DGYA 1VQ8A 4WJ3M 3A5ZB 1VQFA 1X65A 4Y7NH 1NJIC 4LF9L 1IZ6A 3M4PA 2VS1A 4A3EG 1LYLA 1OTCA 4BY7H 4APVA 5GROA 1BVSA 3STBC 5GAHC 2CWPA 2R7DA 2EQSA 2I5LX 3W1GA 3H0GG 3ERSX 4A3BG 3J7A5 3OTOQ 1VQ6A 4AH6A 1PH4A 2R93G 1UWVA 4BY1G 1SN8A 1IBLL 4DV0L 5M5YH 3M7NA 2VW9A 4B3TL 1VQEA 5J3BA 1MJCA 2YU9H 2HIXA 4GKJL 4GOPA 2UXDL 1E24A 3CCMA 4EQ5A 4R4CA 4R1JA 3S17H 1TWFH 1JB7A 3GO5A 4AQYQ 1WJJA 2B3GA 3ULPA 1SMXA 4B3MQ 1N33L 1EUJA 5K36G 1NBWA 1B70B 1L1OC 4BBRG 4JI8Q 1CKNA 3T1HL 1VQ9A 3S15H 4DPGA 4LF6Q 1UE6A 4A3DG 4GKKQ 2OTLA 3J80c 1YJ9A 3I55A 3NEMA 3CXCA 1SE8A 4BA2I 2NZOA 4L5SA 3I4NG 2A1AA 3K7UC 1XMOQ 1IBML 3HOVG 3S14H 4RMFA 1N9WA 1U0LA 3L2PA 5C3EH 3PF4A 2NN6I 2UXBQ 4YWLA 4QIWE 2GN5A 4GOPB 1XNQQ 1K9MC 1Q82C 5IYDG 2BH2A 1UEBA 1HZAA 4J15A 4P74A 1YJNA 1K73C 3K8AA 4BBSH 1CUKA 4YCVA 5IP9G 5C4XG 4A3CG 4YHHQ 3I56A 5H1SE 1KXLA 2R92H 4DR1Q 1NE3A 2H5XA 4LWCA 5IE8A 3JAMi 4NXNL 1KD1C 1XTDA 4A3JG 4NPSA 2K75A 3CP0A 4JI3L 3RR5A 2F4VQ 3GTGH 1WCMG 1Q12A 4JOIC 3KYHC 1W2BA 4LFBQ 2RCNA 1HJPA 2PMZE 3S24A 5IYBG 2VNUD 1XMQQ 1TWCH 1C7YA 1QVFA 4A3LG 4HJAA 4LF8L 1MKHA 3PUZA 4YWKA 4DUYL 3CMAA 2WB1G 3HKZG 5LMNW 1T9HA 2OQ0A 2HQLA 2CKZB 5IY0A 3KOJA 5C3EG 2DUDA 3OYYA 4HJ7A 4A3GG 2I0QA 1B8AA 1JJ2A 4DAMA 1G291 1NY4A 4X65Q 4DR6L 1P8LA 4JI4L 1EIFA 1EOVA 2HHHL 3H3VH 4O2DA 4JI8L 3KF6B 5GAEC 5DLQE 4A4IA 5C0XG 2ZJQA 2ALYB 2YYZA 1IXRA 1EQRA 2ID0A 3FHWA 2PI2E 3ULLA 4P72A 4DNIA 2VQFQ 4GNXC 4DV6Q 3CCQA 4HIOA 4DR7Q 4IFDJ 2EIFA 2UXBL 1HNZQ 4R4TA 1XPOA 4TVAB 1XMOL 3K81C 4BA1I 4JI1L 3G71A 2UU9L 5LMNL 2IY5B 3HKZE 4KLKA 1AE2A 4GN4B 3KJPA 1VQPA 1C0AA 2E5LL 4DKAC 3ULJA 3PO3G 1QUQA 1HR0Q 2VL6A 1XNRL 2F4VL 3U50C 1KL9A 2PNHA 3KJOA 3FP9A 4R4QA 1SR3A 1X55A 4OWXB 1S3OA 1PA6A 3HOZH 2I5MX 3CAMA 4UPAA 1N36Q 3T1YQ 3HOZG 2MO1A 4LFCQ 1V43A 5C44H 1D8LA 1YEZA 1OXUA 1HNXL 4DV4L 1PH9A 3TQYA 3FKIH 3CPWA 3H15A 2B63H 1CKMA 3U58A 4BBSG 2OTJA 3K0XA 4OWWB 3RLFA 1Y1WG 3CPFA 5M3FH 1NMFA 4LUVA 4MZ9A 4X65L 2K14A 2B29A 2LXKA 3UDIA 3HOWG 3W1BA 2PQAB 2XTIA 1JJGA 1VQLA 2N49A 4UP7A 2ZM6Q 1FVIA 2E2HH 4DV2L 1Y14B 4DAYB 4LF4Q 2K50A 1LM0A 4KHZA 4QQBX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M5W H;  4A3I G;  2Q2T A;  1PH6 A;  1GO3 E;  1HNZ L;  3G48 A;  2VQF L;  2JA7 G;  3ICE A;  5JJK A;  1VQN A;  4DV6 L;  4DR7 L;  1VQO A;  4GS3 A;  1YHQ A;  3E0E A;  4LF7 L;  3TS2 A;  2D0P A;  1E7Z A;  3CCR A;  1YBY A;  4IOC A;  4A3G H;  1UE1 A;  5LMN Q;  4IPD A;  4B3M L;  2NZH A;  4JG2 A;  3NBH B;  2VQE Q;  2E5L Q;  2IX1 A;  3T1H Q;  1TWH H;  3CW2 C;  3NEL A;  5EAY A;  2PQA A;  2Y0S G;  2QGQ A;  4DR3 L;  2F3I A;  5IYC H;  1I3Q H;  3AEV A;  2N8N A;  3B6Y A;  3KDF B;  2R93 H;  1ASY A;  1VQI A;  5FLM G;  1Q7Y C;  1XNR Q;  3K80 C;  3I2Z A;  2KHI A;  5M3M H;  1IL2 A;  1FJG L;  4LFC L;  4A93 G;  2K5H A;  1WCM H;  4IPG A;  1P16 A;  5GQO A;  2WAQ E;  5AJ3 Q;  3RN2 A;  2UUC Q;  2Q2U A;  2WFW A;  4OX9 Q;  4B3R Q;  3GTJ H;  4JV5 L;  5C4X H;  1MJE A;  4DR1 L;  1VQC A;  4L5T A;  3S16 H;  2QA4 A;  1QVC A;  1L1O A;  2NN6 G;  3UDG A;  1HZ9 A;  1KQS A;  1QZH A;  1Y1V G;  3M4Q A;  5M3M G;  2ZTC A;  4DV5 Q;  4LF5 L;  2I5H A;  2GVB A;  2AKW B;  5GAD C;  5IYC G;  4GOP C;  1XMQ L;  2ZM6 L;  4X64 Q;  1U5K A;  4DV2 Q;  4AYB E;  5HGQ A;  3A5U A;  2BA1 A;  1HZB A;  1RIP A;  3PSI A;  4LW1 A;  4PZ6 A;  2RHQ B;  1HNW Q;  2K4K A;  1SLJ A;  3BZC A;  2JA5 G;  4QJF A;  4HJ8 A;  4QL5 A;  1IBK Q;  3CCE A;  1K3R A;  3BJU A;  1PFS A;  1VQJ A;  4GLA C;  4MTN A;  4EX5 A;  1L0W A;  4OWT B;  4GN5 A;  4OON A;  3U4V A;  3Q8D A;  1S40 A;  3KF8 B;  1D7Q A;  1YHA A;  1PH2 A;  3A74 A;  4JBW A;  2YTV A;  2OCE A;  2VQE L;  5IYD H;  1WI5 A;  2WP8 J;  3U4Z A;  4BY1 H;  2VUM G;  4HJ5 A;  3PUX A;  1EFW A;  5BR8 Q;  1YVC A;  2IT1 A;  3PO2 H;  4UY8 C;  1N34 Q;  2JEB I;  4PMW A;  4Y52 H;  1DGS A;  3BU2 A;  1I50 H;  3RLN A;  1E3P A;  1G51 A;  5AJ3 L;  1KIX A;  1FJG Q;  2JA6 G;  2NVT H;  2JA9 A;  4JI1 Q;  4A3M G;  4BXX H;  1J5E L;  3GDE A;  4OX9 L;  2JQO A;  2KCM A;  3E9H A;  4IJL A;  4P73 A;  3CCV A;  4JI7 L;  4NXM Q;  4P71 A;  2HIV A;  4YCW A;  1X54 A;  1KRS A;  3EIV A;  4XTC S;  3UE0 A;  4BBR H;  4X62 Q;  1WFQ A;  3HFZ B;  5IP7 H;  2IX0 A;  1V9P A;  3DLL A;  3E9I A;  1XPU A;  1VCI A;  4MNO A;  1E1O A;  1ASZ A;  2CFM A;  4LUZ A;  3F2D A;  4DV5 L;  3PIP A;  2K52 A;  3GTL H;  2D62 A;  3T1Y L;  3CCS A;  3OW2 A;  2UXC L;  3OTO L;  5JEA J;  1YIT A;  3PO3 H;  3CC7 A;  4KI0 A;  1Z9F A;  4DV4 Q;  1IBL Q;  1BBU A;  2N3S A;  2NVY H;  2N78 A;  2ES2 A;  4X64 L;  4A3K H;  3S1R H;  2XGT A;  3UE1 A;  1XJV A;  2ZJP A;  1SFO H;  2ZTD A;  2FXQ A;  4DUZ L;  1N32 L;  1LTL A;  2VY3 A;  1M90 C;  2KEN A;  4LFA Q;  1G6P A;  4A3J H;  4JI6 L;  4QY7 A;  1PV4 A;  5ELO A;  3I4O A;  4DK3 C;  1VQ4 A;  3S2H H;  3RN5 A;  4GKJ Q;  3CME A;  2UXD Q;  1A0I A;  2Z6K A;  3I7F A;  1X3E A;  1UE5 A;  3G4S A;  4A3C H;  3CCL A;  4C3I H;  3F2B A;  2JA7 H;  4JBK A;  4LF6 L;  4JI5 Q;  3PUW A;  1NTG A;  2YV5 A;  1VQM A;  2K5V A;  1AE3 A;  3M9B A;  3PCO B;  5C0X I;  4O0A A;  3J81 i;  3MXN B;  1PH5 A;  2NVQ H;  3HOW H;  3GTM H;  3AYH B;  3D0F A;  4LF7 Q;  3J80 i;  2D0O A;  4PG3 A;  1Y1W H;  3PO2 G;  3MEF A;  4ALP A;  5E7N A;  3ER0 A;  2K5N A;  1HZC A;  1EIY B;  4JI2 Q;  2JK8 A;  4FDB A;  1I94 Q;  3HOU H;  3EBE A;  1L1O B;  3NEN A;  3RZD H;  2MNA A;  4JI7 Q;  2EXD A;  2V1C C;  3F8T A;  3GD7 A;  4R4O A;  4NXM L;  3CC2 A;  1BKB A;  3FKI G;  2B63 G;  4NXN Q;  2E8G A;  1VQK A;  5LMU Q;  1EWI A;  3PIO A;  1PH1 A;  1VQG A;  3TEH B;  2ATW A;  1E1T A;  1YNX A;  4GLV B;  2CCZ A;  2CQO A;  1VQH A;  2OWO A;  1VS0 A;  2UXC Q;  1SRO A;  1EQQ A;  3CC4 A;  4A93 H;  4A3F G;  2GVA A;  1HH2 P;  1A8V A;  2R92 G;  3RZO H;  2AWN A;  4DUY Q;  1A63 A;  1I6H H;  1K8G A;  1YIJ A;  1N32 Q;  4LF8 Q;  4LFA L;  4IJH A;  2PI2 A;  4IO9 A;  4JI6 Q;  5IYB H;  1KAW A;  1TXY A;  2Y0S E;  3STB D;  4DUZ Q;  3HOX G;  3TS0 A;  2UUA Q;  4POG A;  1GVP A;  2RHS B;  3HOV H;  3BZK A;  3CD6 A;  4YY3 L;  1PH8 A;  1PHJ A;  4DR6 Q;  4POF A;  3RNU A;  2BA0 A;  4HIM A;  2C35 B;  4JI4 Q;  1SRU A;  5FLX c;  2HHH Q;  4WJ4 A;  4QGU A;  2ASB A;  1Q1E A;  4C3H H;  4X6A H;  5FJ8 H;  1PH3 A;  4C3J H;  1X3F A;  5FJ8 G;  3M3Y H;  3CCJ A;  1XPR A;  3HOY H;  1V1Q A;  2WB1 E;  2MFI A;  3HOU G;  1QVG A;  1X6O A;  4X66 L;  4BXX G;  1YI2 A;  3M85 A;  4JI2 L;  4GLX A;  3HOX H;  4JBJ A;  4P75 A;  3I4M G;  3S2D H;  1KC8 C;  3KF6 A;  4AYB G;  2VUM H;  3J81 j;  5IWA L;  1Q1B A;  1Q46 A;  1UE7 A;  1MIU A;  5GAG C;  4DV1 L;  2VZA A;  3GTK H;  2CWA A;  3AFP A;  4RG1 A;  2KCT A;  1GKH A;  1A62 A;  3RLO A;  1HR0 L;  2UU9 Q;  1KHI A;  4PZ8 A;  4DV7 L;  3H0G H;  1X56 A;  5BR8 L;  3M4O H;  5JJL A;  3A0J A;  4C2M H;  1VQA A;  1PH7 A;  1FL0 A;  4UP9 A;  2R7Z G;  1GM5 A;  3L7Z C;  3W5O A;  4A3E H;  2UUB Q;  2JA8 G;  4B3S L;  2R7F A;  3PUV A;  2JA5 H;  1TWA H;  3HKS A;  4A75 A;  4LNQ A;  3CQZ H;  4H02 A;  2ZJR A;  1N36 L;  2Q2H A;  1OXV A;  2JE6 I;  4GN3 B;  1Q8K A;  1FGU A;  4GNX A;  3CCU A;  4JC0 A;  4JYA L;  4DR5 L;  4B3T Q;  2Q2I A;  2NVX H;  1B7Y B;  2IHE A;  1M1K C;  3AFQ A;  2L15 A;  1WYD A;  5M3F G;  1E22 A;  1R9T H;  4JBM A;  5C4J H;  4L5Q A;  4YCU A;  2AMC B;  4YY3 Q;  4L5R C;  2MQH A;  4PZ7 A;  3I4N H;  1H95 A;  2JJQ A;  4HJ9 A;  4KHP L;  1N33 Q;  1J6Q A;  2A19 A;  3PF5 A;  1C9O A;  1WOC A;  1I5F A;  1KRT A;  1S72 A;  4LF4 L;  2OQK A;  4X66 Q;  3PGZ A;  4DK6 C;  4DV3 Q;  4DR4 L;  3K7A H;  5JEA G;  1YZ6 A;  1K0R A;  1JJC B;  4OO1 G;  4GKK L;  1IBM Q;  3S1N H;  1N8R C;  3S1M H;  4A76 A;  2JA6 H;  2WAQ G;  4JOI A;  2YTX A;  4DV1 Q;  4AIM A;  4DR2 Q;  1QZG A;  2E2I H;  4IFD I;  1CKO A;  5FLM H;  5IWA Q;  4DV7 Q;  4JI5 L;  4K0K L;  1X3G A;  2R6G A;  5IT9 c;  3J81 c;  4A3B H;  3SGI A;  4A3K G;  1CSP A;  1RL2 A;  4DR3 Q;  1W3S A;  4JI0 L;  4IPH A;  4BY7 G;  4TQU S;  4B3S Q;  1NMG A;  1Y1V H;  1VQD A;  3KFU A;  3JAM c;  4HIK A;  4JI3 Q;  1TWG H;  4YWM A;  2UUB L;  2LXJ A;  4LFB L;  1Z47 A;  1I94 L;  2UUC L;  4ME3 A;  5HY6 A;  1IYJ B;  4JV5 Q;  3PUY A;  3TRE A;  2R7Z H;  3J7Z C;  3F2C A;  2A8V A;  4R4I A;  3TRZ A;  5IP7 G;  4LUO A;  4GNX B;  3IRB A;  3GTP H;  5LMU L;  4B3R L;  5JJI A;  1K8A C;  4A3M H;  4JYA Q;  4LF9 Q;  2Z0S A;  2AHO B;  3LGJ A;  4DR5 Q;  1YJW A;  4OO1 I;  4LF5 Q;  1GD7 A;  1X9N A;  1JMC A;  2Z6K C;  4KHP Q;  3JC6 6;  4HID A;  3CF5 A;  1HR0 W;  4JCV E;  4OXP A;  3ZJY C;  1O7I A;  1EYG A;  3VDY A;  1L2F A;  3GTO H;  4A3L H;  1HNW L;  4DV0 Q;  2LSS A;  3KLW A;  1OXS C;  3S1Q H;  5M5X H;  1IBK L;  2ZTE A;  3DM3 A;  1CKN B;  3UDF A;  2QEX A;  4A3F H;  3WWV A;  2UUA L;  2JA8 H;  1VQ7 A;  5C44 G;  1LUZ A;  4DV3 L;  4XIG S;  1YHB A;  3G6E A;  4DR4 Q;  3EN2 A;  1OXT A;  4DR2 L;  3D31 A;  4IFD G;  1QUQ B;  3L0O A;  4AQY L;  2JEA I;  1PYB A;  5C0X J;  5IP9 H;  4UP8 A;  1VQ5 A;  2IHF A;  2KHJ A;  4NB3 A;  4K0K Q;  1JE5 A;  1BBW A;  3UDX A;  4JI0 Q;  1AH9 A;  3KDF A;  2BH8 A;  1Q86 C;  1JT8 A;  2AWO A;  1PVO A;  2E2J H;  3GTQ H;  3PV0 A;  1N34 L;  1J5E Q;  3I4M H;  2RF4 A;  1Q81 C;  4IOA A;  3H3V I;  4A3D H;  3AQQ A;  2YTY A;  2HT1 A;  2KBN A;  1K83 H;  3HOY G;  1OXX K;  1CSQ A;  2MO0 A;  4A3I H;  1HNX Q;  4YHH L;  1XNQ L;  2F52 A;  4IPC A;  1VQB A;  1PYS B;  4X62 L;  5ELN A;  3F1Z A;  2DGY A;  1VQ8 A;  4WJ3 M;  3A5Z B;  1VQF A;  1X65 A;  4Y7N H;  1NJI C;  4LF9 L;  1IZ6 A;  3M4P A;  2VS1 A;  4A3E G;  1LYL A;  1OTC A;  4BY7 H;  4APV A;  5GRO A;  1BVS A;  3STB C;  5GAH C;  2CWP A;  2R7D A;  2EQS A;  2I5L X;  3W1G A;  3H0G G;  3ERS X;  4A3B G;  3J7A 5;  3OTO Q;  1VQ6 A;  4AH6 A;  1PH4 A;  2R93 G;  1UWV A;  4BY1 G;  1SN8 A;  1IBL L;  4DV0 L;  5M5Y H;  3M7N A;  2VW9 A;  4B3T L;  1VQE A;  5J3B A;  1MJC A;  2YU9 H;  2HIX A;  4GKJ L;  4GOP A;  2UXD L;  1E24 A;  3CCM A;  4EQ5 A;  4R4C A;  4R1J A;  3S17 H;  1TWF H;  1JB7 A;  3GO5 A;  4AQY Q;  1WJJ A;  2B3G A;  3ULP A;  1SMX A;  4B3M Q;  1N33 L;  1EUJ A;  5K36 G;  1NBW A;  1B70 B;  1L1O C;  4BBR G;  4JI8 Q;  1CKN A;  3T1H L;  1VQ9 A;  3S15 H;  4DPG A;  4LF6 Q;  1UE6 A;  4A3D G;  4GKK Q;  2OTL A;  3J80 c;  1YJ9 A;  3I55 A;  3NEM A;  3CXC A;  1SE8 A;  4BA2 I;  2NZO A;  4L5S A;  3I4N G;  2A1A A;  3K7U C;  1XMO Q;  1IBM L;  3HOV G;  3S14 H;  4RMF A;  1N9W A;  1U0L A;  3L2P A;  5C3E H;  3PF4 A;  2NN6 I;  2UXB Q;  4YWL A;  4QIW E;  2GN5 A;  4GOP B;  1XNQ Q;  1K9M C;  1Q82 C;  5IYD G;  2BH2 A;  1UEB A;  1HZA A;  4J15 A;  4P74 A;  1YJN A;  1K73 C;  3K8A A;  4BBS H;  1CUK A;  4YCV A;  5IP9 G;  5C4X G;  4A3C G;  4YHH Q;  3I56 A;  5H1S E;  1KXL A;  2R92 H;  4DR1 Q;  1NE3 A;  2H5X A;  4LWC A;  5IE8 A;  3JAM i;  4NXN L;  1KD1 C;  1XTD A;  4A3J G;  4NPS A;  2K75 A;  3CP0 A;  4JI3 L;  3RR5 A;  2F4V Q;  3GTG H;  1WCM G;  1Q12 A;  4JOI C;  3KYH C;  1W2B A;  4LFB Q;  2RCN A;  1HJP A;  2PMZ E;  3S24 A;  5IYB G;  2VNU D;  1XMQ Q;  1TWC H;  1C7Y A;  1QVF A;  4A3L G;  4HJA A;  4LF8 L;  1MKH A;  3PUZ A;  4YWK A;  4DUY L;  3CMA A;  2WB1 G;  3HKZ G;  5LMN W;  1T9H A;  2OQ0 A;  2HQL A;  2CKZ B;  5IY0 A;  3KOJ A;  5C3E G;  2DUD A;  3OYY A;  4HJ7 A;  4A3G G;  2I0Q A;  1B8A A;  1JJ2 A;  4DAM A;  1G29 1;  1NY4 A;  4X65 Q;  4DR6 L;  1P8L A;  4JI4 L;  1EIF A;  1EOV A;  2HHH L;  3H3V H;  4O2D A;  4JI8 L;  3KF6 B;  5GAE C;  5DLQ E;  4A4I A;  5C0X G;  2ZJQ A;  2ALY B;  2YYZ A;  1IXR A;  1EQR A;  2ID0 A;  3FHW A;  2PI2 E;  3ULL A;  4P72 A;  4DNI A;  2VQF Q;  4GNX C;  4DV6 Q;  3CCQ A;  4HIO A;  4DR7 Q;  4IFD J;  2EIF A;  2UXB L;  1HNZ Q;  4R4T A;  1XPO A;  4TVA B;  1XMO L;  3K81 C;  4BA1 I;  4JI1 L;  3G71 A;  2UU9 L;  5LMN L;  2IY5 B;  3HKZ E;  4KLK A;  1AE2 A;  4GN4 B;  3KJP A;  1VQP A;  1C0A A;  2E5L L;  4DKA C;  3ULJ A;  3PO3 G;  1QUQ A;  1HR0 Q;  2VL6 A;  1XNR L;  2F4V L;  3U50 C;  1KL9 A;  2PNH A;  3KJO A;  3FP9 A;  4R4Q A;  1SR3 A;  1X55 A;  4OWX B;  1S3O A;  1PA6 A;  3HOZ H;  2I5M X;  3CAM A;  4UPA A;  1N36 Q;  3T1Y Q;  3HOZ G;  2MO1 A;  4LFC Q;  1V43 A;  5C44 H;  1D8L A;  1YEZ A;  1OXU A;  1HNX L;  4DV4 L;  1PH9 A;  3TQY A;  3FKI H;  3CPW A;  3H15 A;  2B63 H;  1CKM A;  3U58 A;  4BBS G;  2OTJ A;  3K0X A;  4OWW B;  3RLF A;  1Y1W G;  3CPF A;  5M3F H;  1NMF A;  4LUV A;  4MZ9 A;  4X65 L;  2K14 A;  2B29 A;  2LXK A;  3UDI A;  3HOW G;  3W1B A;  2PQA B;  2XTI A;  1JJG A;  1VQL A;  2N49 A;  4UP7 A;  2ZM6 Q;  1FVI A;  2E2H H;  4DV2 L;  1Y14 B;  4DAY B;  4LF4 Q;  2K50 A;  1LM0 A;  4KHZ A;  4QQB X; 
#chains in the Genus database with same CATH topology
 2O5J C;  1ESF A;  4A3I G;  1GO3 E;  2VQF L;  2QDL A;  4ZLT F;  1VQN A;  4EQO A;  1J9O A;  4HN7 A;  3E0E A;  1E7Z A;  3CCR A;  1YBY A;  4A3G H;  4XQJ A;  1G91 A;  4QF4 A;  3I8Z A;  2IX1 A;  5C3X A;  2DY7 A;  3T1H Q;  1AP0 A;  1A3U A;  3QOL A;  2PQA A;  2Y0S G;  2N8N A;  3B6Y A;  1VF5 C;  4UHV A;  1Q7Y C;  3I2Z A;  2KHI A;  4AYB B;  1FGB D;  1TY0 A;  2EJM A;  4X3S A;  4A93 G;  1I3Q B;  4JVZ A;  1AZP A;  5GQO A;  1GUW A;  1SEB D;  2WFW A;  1QWY A;  4JV5 L;  3C3L A;  3S14 B;  3C1E A;  2QA4 A;  1QVC A;  3L9A X;  2NN6 G;  4C3J B;  1KQS A;  4F88 A;  2L12 A;  2SNM A;  1Y1V G;  2XRS D;  2LS0 1;  2ZTC A;  1CFM A;  2AKW B;  2B2Y C;  4C1N I;  4AYB E;  1RIP A;  4TKO B;  3L3O C;  4DXF A;  4QJF A;  4MTN A;  4EX5 A;  1BR9 A;  3MXN A;  1FNW A;  1GUG A;  3Q8D A;  2RDG A;  2B39 A;  4K5V A;  3HKZ B;  2VQE L;  2F0M A;  3HOY B;  1L0X B;  2IT1 A;  1B53 A;  4UY8 C;  1LT3 D;  2BE5 D;  2JEB I;  4Z9C B;  1I50 H;  1E3P A;  5AJ3 L;  1CA6 A;  2JA9 A;  4A3M G;  3GDE A;  3OOC A;  2JQO A;  2EY5 A;  3SVM A;  3CQZ B;  4P73 A;  3RD4 A;  4NXM Q;  2R7Z G;  1X54 A;  3EJI A;  5I2X A;  5IP7 H;  3MFG A;  1NSN S;  3RMH A;  3F2D A;  3OPO A;  5CC4 A;  4P2C B;  5A2Q L;  3HGB A;  3NXW A;  4B08 A;  3A7A B;  3KBX A;  3PO3 H;  1KNA A;  4DV4 Q;  1BBU A;  2R3Z A;  2FMM A;  1LTT D;  1SFO H;  2ZJP A;  1N32 L;  1M90 C;  3DWA A;  1E2V A;  4DK3 C;  3S2H H;  3K59 A;  3CME A;  1A0I A;  1SNP A;  1X3E A;  1UE5 A;  3G4S A;  3CCL A;  1LT4 D;  1TWC B;  4FP5 D;  4RAU C;  4RHS A;  1BDO A;  1F2M A;  1HTP A;  4KD3 A;  3GTG B;  4GKK L;  1PH5 A;  1D5M C;  3AYH B;  3D0F A;  2DNE A;  3FDT A;  1O7L A;  3J80 i;  2D0O A;  1O80 A;  3TZU A;  1Y1W H;  4LF7 Q;  4ALP A;  3DEP A;  2OF1 A;  2XSC A;  3NSW A;  4G57 A;  2EYP A;  4O1N A;  2JK8 A;  4RH6 A;  3HOU H;  3EBE A;  3HOZ B;  5CV7 A;  3NEN A;  3DWP A;  3RZD H;  2MNA A;  1STY A;  3CC2 A;  1BKB A;  3FKI G;  4E6I A;  2B63 G;  1VQK A;  1QCB D;  3S1Q B;  1YNX A;  2ZXP A;  1VQH A;  4A93 H;  2F0N A;  3IKJ A;  4CDE C;  1MBY A;  3ITP A;  2GVA A;  1A8V A;  3RZO H;  1I6H H;  1PRT D;  3A56 A;  3MAQ A;  4IJH A;  2PI2 A;  4IO9 A;  2L1B A;  3STB D;  3HOX G;  2F1M A;  2J4X A;  1GVP A;  4YY3 L;  3AMU A;  2B8F A;  4DR6 Q;  3RNU A;  4JI4 Q;  4HIM A;  2C35 B;  4WJ4 A;  1SXT A;  2HCC A;  5FJ8 H;  3AU7 A;  1H9J A;  1X3F A;  2MFI A;  1MSG A;  3HOX H;  4JBJ A;  4P75 A;  1EYA A;  1YNJ D;  4AYB G;  4I65 A;  1KC8 C;  3OMG A;  2VUM H;  1JE4 A;  5IWA L;  1Q1B A;  1UE7 A;  5GAG C;  3GV3 A;  4RG1 A;  5LHY 1;  3K5O A;  4C2M H;  1VQA A;  2K05 A;  2UUB Q;  3RZO B;  4H02 A;  1N36 L;  3WOE A;  4N8F A;  2NBF A;  1OXV A;  3T13 A;  4DGZ A;  1TS2 A;  3PIP 3;  4EGV A;  2NVX H;  2CQA A;  1E22 A;  4MTK A;  5C4J H;  4KJO A;  4YCU A;  5C6A A;  4ODG A;  2MQH A;  3TP8 A;  3I4N H;  1N33 Q;  2A19 A;  3PF5 A;  1C9O A;  1WOC A;  1I5F A;  3CHB D;  1KRT A;  1WTQ A;  2EY1 A;  4LF4 L;  4UAI A;  3MXU A;  2NVQ B;  4FVM A;  5IT9 L;  1KAB A;  3S1N H;  4JW0 A;  3S1M H;  2WAQ G;  5D65 A;  1QZG A;  2JA7 B;  4A93 B;  4HSV A;  3J81 c;  3D4D A;  3SGI A;  4KD4 A;  5ELF A;  2EJF C;  4DR3 Q;  4MIU A;  4IPH A;  4JI3 Q;  1KDC A;  3G6J B;  1A2U A;  4LFB L;  2F03 A;  1B50 A;  3GTL B;  3TRE A;  3J7A F;  2R7Z H;  5C3W A;  1MGS A;  4R4I A;  3NP8 A;  3GTP H;  3SR1 A;  4A3M H;  4JYA Q;  4LF9 Q;  2Z0S A;  3TZD A;  4LF5 Q;  5KGU A;  5FO7 B;  1JMC A;  2Z6K C;  3N6R A;  1F9P A;  3JC6 6;  4HID A;  3W2D A;  4JCV E;  4OXP A;  5CV9 A;  1O7I A;  1TQO A;  3IAY A;  4U68 A;  1JR0 D;  2LSS A;  3KLW A;  5M5X H;  1IBK L;  4KKU A;  3WWV A;  2JA8 H;  1U4P A;  2M2L A;  1LUZ A;  4DR4 Q;  1YHB A;  3NBH A;  3RZD B;  1Y8O B;  3D31 A;  1QUQ B;  4AQY L;  2JEA I;  1SNO A;  4UP8 A;  4K0K Q;  3TP5 A;  3GTQ B;  1AH9 A;  2BOS A;  1CA5 A;  4X3U A;  2EOT A;  4QB4 A;  1JT8 A;  2AWO A;  5I4D A;  4IQZ A;  3HRZ C;  4IN3 A;  2AUK A;  4IOA A;  3H3V I;  3GTK B;  1SDF A;  3AQQ A;  4A3D H;  5C4J B;  3DXJ C;  2J0T D;  2F52 A;  1PYS B;  3ERO A;  1FNV A;  2AQ2 B;  1VQF A;  1X65 A;  4CKE A;  4Y7N H;  1IZ6 A;  2Z8L A;  3M4P A;  2Y0S B;  4KY7 A;  3STB C;  5GAH C;  1X32 A;  4ME5 A;  2CWP A;  1IHZ A;  3W1G A;  3NQI A;  1Z6H A;  2OEO A;  3H0G G;  1WTO A;  4DU9 A;  4U67 3;  2I07 B;  1YNN C;  1A3T A;  1PH4 A;  4BY1 G;  1SN8 A;  5IOD A;  1BBX C;  3OIQ A;  2VW9 A;  1RDP D;  4A3E B;  3MXP A;  5J3B A;  2YU9 H;  3K7A B;  2UXD L;  3NQT A;  1E24 A;  4KMU C;  4EQ5 A;  2EPB A;  1EWH A;  4LJZ C;  4R1J A;  3S17 H;  1TWF H;  2B3G A;  4OHJ A;  1N33 L;  5K36 G;  4TSS A;  1B70 B;  4C56 C;  4JI8 Q;  3S15 H;  2C5C A;  1ENF A;  3V05 A;  3K7U C;  4FO2 A;  3HOV G;  3L2P A;  2NN6 I;  3A55 A;  1V1P A;  5FK9 C;  4QIW E;  2GN5 A;  3PO3 B;  1K9M C;  1F9R A;  2BH2 A;  3QR8 A;  1HZA A;  2AUJ D;  2Z1C A;  4OGQ C;  5M3F B;  2R92 H;  2H5X A;  3JAM i;  2K75 A;  4R9W A;  1WCM G;  4JOI C;  1EY4 A;  1HJP A;  5G3L F;  1GJX A;  2EY2 A;  3DUZ A;  5M9O A;  4HR7 B;  4HJA A;  4LF8 L;  3CMA A;  2WB1 G;  5LMN W;  1IYV A;  4ABN A;  2NTT A;  2OQ0 A;  5IY0 A;  2HDL A;  1B4O A;  2L11 A;  1J8I A;  2NN6 H;  2HUG A;  3S1R B;  1G29 1;  1HFN A;  1EIF A;  1EOV A;  4XQN A;  1MI2 A;  2B2Y A;  1UNS A;  2M9V A;  1BCP F;  2MJ8 A;  3P75 A;  2ZJQ A;  1LAC A;  2YYZ A;  1IXR A;  5E3F A;  4GNX C;  1VMP A;  1HRJ A;  3CCQ A;  4IFD J;  1UUP A;  1FYC A;  1EQT A;  5EBD A;  3J81 L;  4TVA B;  1A6X A;  3K81 C;  2F0L A;  4BA1 I;  4CDD C;  3I4N B;  4DNR B;  1U9R A;  3VA7 A;  3ONA B;  5LMN L;  1D1K A;  4BWG B;  1PRT B;  1EIG A;  1C0A A;  3PO2 B;  2WIN B;  4LMQ D;  1B1Z A;  1CT1 D;  4WJW A;  1XNR L;  1KL9 A;  3SXH A;  3M3Y B;  1V1O A;  3HOZ H;  4V19 0;  3LX0 A;  3T1Y Q;  4LFC Q;  5FO9 B;  1HNX L;  2A74 C;  1K3B C;  3TQY A;  1STB A;  3CPW A;  3H15 A;  2NZ1 D;  5CV4 A;  4KN7 C;  5M3F H;  3VYR A;  3HOW G;  4UP7 A;  1FVI A;  3FPU B;  4RGN A;  3TBI B;  2K50 A;  3JAM E;  1VDZ A;  2ZXR A;  4HCE A;  2PYK A;  2JA7 G;  2RKS A;  3ICE A;  2A69 C;  2WII B;  1F77 A;  2O4X A;  4DV6 L;  5KND A;  4DR7 L;  1K8O A;  3TS2 A;  2D0P A;  1CTM A;  3TDQ A;  4IPD A;  4B3M L;  4JG2 A;  1LV9 A;  5EAY A;  3SHL A;  5IYC H;  3K58 A;  3KDF B;  1NUC A;  1ASY A;  1DYQ A;  5J39 A;  2K1B A;  4R8N A;  1IL2 A;  4IUP A;  1BNZ A;  1XYI A;  1FJG L;  3EFX D;  1M4V A;  2R7Z B;  1EL0 A;  1EEF D;  1B3Q A;  3D6C A;  2JN4 A;  4A3J B;  4NKL A;  4B3R Q;  3V96 A;  1MJE A;  3MXG A;  2PZT A;  4XYO A;  1CM9 A;  1NR2 A;  4DV5 Q;  1B9N A;  4LF5 L;  4RCN A;  2N55 A;  2RSN A;  3CRK C;  5GAD C;  4GOP C;  1CI3 M;  4XT1 B;  4X64 Q;  2SEB D;  3A5U A;  1HZB A;  4PZ6 A;  1ZYR C;  1SLJ A;  2A69 D;  4HJ8 A;  4QL5 A;  2IL8 A;  1IBK Q;  1K3R A;  4GLA C;  1VQJ A;  1L0W A;  2IJ0 A;  1SJH D;  1D5Z C;  1R4P B;  1BOS A;  2YTV A;  2E74 C;  1R4Q B;  4JPB W;  2IWH A;  2VUM G;  1N34 Q;  4PMW A;  1DGS A;  1TKW B;  4FYD A;  2JA6 G;  3RLN A;  1G51 A;  1KIX A;  3EVQ A;  4WFN 3;  1J5E L;  4FF1 A;  3CCV A;  4HCS A;  1IKM A;  1BO0 A;  1I4H A;  1QG7 A;  5JPM C;  3MWY W;  3UE0 A;  1D6E C;  1AFP A;  1WFQ A;  2JA6 B;  1XPU A;  1V9P A;  3DLL A;  4MNO A;  1ASZ A;  5FOB B;  1I6H B;  1X3P A;  1CZG A;  3GTL H;  3T1Y L;  3CCS A;  1Q8I A;  1STG A;  3CC7 A;  3NTK A;  3PO2 G;  1IBL Q;  4A3K H;  5C4H A;  3UE1 A;  4PMC A;  4DNT B;  4M8A A;  1LTL A;  2VY3 A;  1BXT A;  2KEN A;  2O2L D;  4LFA Q;  4A3J H;  2KVM A;  4QY7 A;  5L37 A;  3HOU B;  4IFD H;  2HDM A;  2UXD Q;  2Z6K A;  5HGT A;  5J22 A;  5CR3 A;  1WVL A;  1S5B D;  2JA7 H;  4LF6 L;  4JI5 Q;  4EQN A;  3G7L A;  2YV5 A;  4B9X A;  4HED A;  2K5V A;  1AE3 A;  5IGF A;  3E6Z X;  2R61 A;  4PG3 A;  3IL8 A;  1MD2 D;  1SYF A;  1EIY B;  1I4G A;  1I94 Q;  2K7V A;  1QNK A;  3F8T A;  3GD7 A;  5CGK A;  4KHV A;  4NXN Q;  5LL6 S;  5LMU Q;  3PIO A;  1Y69 U;  1VQG A;  1PH1 A;  3TEH B;  2ATW A;  1E1T A;  2CCZ A;  3X3M A;  2L55 A;  1EQQ A;  3CC4 A;  1HA5 A;  2K5D A;  3S17 B;  1HH2 P;  2L0C A;  5NUC A;  4GZY C;  1GUN A;  1EIH A;  4KTA A;  5M3M B;  1QJO A;  4LF8 Q;  4LFA L;  1W6K A;  5FLX E;  1GUO A;  4JI6 Q;  3TS0 A;  2UUA Q;  4DUZ Q;  1PZJ D;  2RHS B;  2ICI A;  5KYI A;  1PH8 A;  4H13 C;  1U4R A;  2ICE C;  1E2W A;  4ZUJ A;  2HHH Q;  2NYZ D;  5C44 B;  5IIF A;  4C3H H;  1EQV A;  5D14 A;  3BDC A;  4K8I A;  4G7H C;  1V1Q A;  4X66 L;  1TII D;  3M85 A;  4IUR A;  2MGS A;  4WOR A;  5G3L D;  3D4R A;  2F0T A;  3GTK H;  4A3D B;  2UU9 Q;  4PZ8 A;  3MC0 B;  3TME A;  3A0J A;  4A3E H;  2R7F A;  1TWA H;  5KYL A;  4LNQ A;  2ZJR A;  4GN3 B;  2PW7 A;  1WTW A;  1FGU A;  3SK8 A;  3VR3 A;  2F3V A;  5EKL A;  4K14 A;  5M3F G;  4L5R C;  4YY3 Q;  1H95 A;  4HJ9 A;  1J6Q A;  2QEJ C;  1S72 A;  4X66 Q;  4L6T B;  3GV6 A;  3PGZ A;  3FPP A;  4DV3 Q;  3FMC A;  4OO1 G;  1K0R A;  1N8R C;  1U4L A;  3SEB A;  2JA6 H;  5DEH A;  4DV1 Q;  2PZW A;  4IFD I;  2KOL A;  5IWA Q;  2PQE A;  4JI5 L;  4A3B H;  3OIP A;  1STH A;  4K8J A;  1TWG B;  1CSP A;  2QIL A;  2B2V C;  1W3S A;  4QUC A;  1HFG A;  4HIK A;  3GTO B;  4YWM A;  2SNS A;  2UUB L;  2RDF A;  2LXJ A;  1Z47 A;  1I94 L;  5HY6 A;  2F3W A;  3OMC A;  2RQX A;  1RHP A;  4DXG A;  1WCM B;  1QB5 D;  2A8V A;  1LTA D;  4LUO A;  4GNX B;  1D2B A;  5JJI A;  5LMU L;  2WAC A;  1K8A C;  1TS3 A;  4DR5 Q;  1LO5 D;  3QO2 A;  4C1N K;  1LTI D;  3OWF A;  1E2Z A;  4KHP Q;  3KLS A;  2L5T A;  3OW7 A;  3GTO H;  4G4K A;  2LMC B;  1PRT C;  1JOQ A;  4O42 A;  1PTO D;  1ENA A;  3DM3 A;  3EQL C;  2LKV A;  4A3F H;  2UUA L;  3QB3 A;  1VQ7 A;  4XIG S;  3LWE A;  1LTR D;  4IFD G;  1ENC A;  5T1G A;  1BCP B;  2BCO A;  2EYJ A;  3WOF A;  4RHR A;  2E2D C;  1PTO C;  4DN4 M;  1BBW A;  3UDX A;  3T51 B;  3HOV B;  3NWS A;  2X6G A;  4C2M B;  1Q86 C;  2E2J H;  4R8I A;  2MUY A;  4HTH A;  2ZXO A;  2YTY A;  2KBN A;  1K83 H;  4FNF A;  3J7Y W;  4C3H G;  4YHH L;  1PXU A;  1XNQ L;  1Y1V B;  1VQB A;  5ELN A;  1GUT A;  1HUM A;  2DGY A;  2Z4H A;  1JIC A;  1VQ8 A;  1XXG A;  4LAA A;  2K5W A;  1JWS D;  3I90 A;  2VS1 A;  1OTC A;  5EPK A;  1H9M A;  5I2Y A;  1C48 A;  2EQS A;  2I5L X;  1EU3 A;  5F2D A;  4A3B G;  3J7A 5;  3R2T A;  3OTO Q;  1EU4 A;  1BF4 A;  4AH6 A;  4J1M A;  2R93 G;  3M7N A;  4DV0 L;  4G7Z C;  4B3T L;  1MJC A;  2HIX A;  4CJ0 B;  1SND A;  1RKN A;  1IW7 D;  1WJJ A;  1SMX A;  3SK5 A;  3BDO A;  3T1H L;  3SK6 A;  4LF6 Q;  4A3D G;  1UE6 A;  4GKK Q;  1YJ9 A;  1R9T B;  3NEM A;  2XNA C;  3CXC A;  1SE8 A;  4ULL A;  3C2P A;  1SFO B;  2B2W A;  4L5S A;  3ND8 A;  3I4N G;  3S14 H;  1ILP A;  5M5X B;  1F2Y A;  1JWM D;  1XNQ Q;  3KBG A;  1TR5 A;  4J15 A;  4BBS H;  1CUK A;  4YCV A;  3OHX C;  3I56 A;  1CQV A;  4OIK A;  2EYH A;  4DR1 Q;  3CRL C;  2L4N A;  4A3J G;  1HXY D;  3RR5 A;  2F4V Q;  3CP0 A;  3GTG H;  3K5L A;  2A73 B;  2FJ2 A;  1SE4 A;  3KYH C;  5CYU A;  4OIJ A;  5C3E B;  5IYB G;  3K5N A;  2VNU D;  1C7Y A;  1QVF A;  1YNN D;  2HD3 A;  3PUZ A;  2KJX A;  4DUY L;  4X3T A;  1T9H A;  1DOK A;  2CKZ B;  2DUD A;  4KN4 C;  1JJ2 A;  3R8B A;  4X65 Q;  4PQX A;  4EVO A;  3I4M B;  1CQF A;  3H3V H;  4O2D A;  3KK7 A;  4JI8 L;  5C0X G;  5GAE C;  4A4I A;  2ALY B;  3MHB A;  2ID0 A;  2PI2 E;  3ULL A;  4P72 A;  4DV6 Q;  4DR7 Q;  2F0F A;  2EIF A;  3BG3 A;  1HNZ Q;  4R4T A;  1XPO A;  4EQP A;  5FO8 B;  1EY5 A;  4XQQ A;  3G71 A;  2NB0 A;  2EXZ A;  1RJT A;  1VQP A;  4KY6 A;  4L8J A;  1JOR A;  1EZ6 A;  1H9S A;  2PNH A;  1VMC A;  2Q8T A;  1CHQ D;  1PA6 A;  4KKS A;  5COR A;  2B2V A;  3J81 E;  4ZAI A;  1N36 Q;  3HOZ G;  4CDC C;  1V43 A;  3VR5 A;  5C44 H;  3KUP A;  1D8L A;  1YEZ A;  3FKI H;  2B63 H;  3QIA A;  1JC7 A;  4BBS G;  3BVG A;  5I6Y A;  2A68 C;  1JQY D;  3H0G B;  4OWW B;  1LT5 D;  4ILW A;  4LUV A;  3A54 A;  4X65 L;  1IL8 A;  1WD1 A;  3HEJ A;  1CZW A;  3W1B A;  3NTH A;  2XTI A;  1VQL A;  1YNJ C;  2A5H A;  2E2H H;  1PFN A;  4DAY B;  4LF4 Q;  5JJZ A;  1SMY D;  5DAU A;  4KK7 A;  4FXG C;  1HNZ L;  3G48 A;  3MVV A;  5DNF A;  2KHS A;  1YHQ A;  1Z7T A;  4LF7 L;  2K01 A;  1LAB A;  2PMZ B;  4IOC A;  5CV6 A;  1LLR D;  2EJG C;  5IGE A;  2KEE A;  3NBH B;  2E5L Q;  2IW3 A;  3NEL A;  2F0O A;  1E0B A;  4DR3 L;  1I3Q H;  4Q0F A;  2R93 H;  3J80 L;  3GTM B;  4KV6 A;  5FLM G;  1XNR Q;  5M3M H;  3PIO 3;  2K5H A;  1STN A;  1WCM H;  2PNR C;  3I91 A;  1P16 A;  5AJ3 Q;  2WAQ E;  3RN2 A;  4OL7 A;  3HG9 A;  3Q0A A;  2UUC Q;  4ZRZ A;  4OX9 Q;  3GTJ H;  5COY A;  4DR1 L;  3S16 H;  1X3Q A;  5CV8 A;  2CW0 D;  3CU7 A;  4PNY A;  1H9S B;  2CH4 A;  3A8K E;  3M4Q A;  3E3X A;  5M3M G;  1H9R A;  3KLS X;  1TY2 A;  1XMQ L;  1UAP A;  1K83 B;  1HA6 A;  2P5Z X;  5KNB A;  1ZXT A;  4IZ8 A;  4CJ2 C;  1I6V C;  1F2L A;  5HGQ A;  5IGB A;  2RHQ B;  5JVH 3;  3BZC A;  2JA5 G;  3UI2 A;  1G6Z A;  3BJU A;  3EA6 A;  4ZYS A;  4OWT B;  4NP5 A;  4GN5 A;  4OON A;  3U4V A;  4CGY B;  5BN3 A;  4QUF A;  1II3 A;  5HUR A;  4OEL B;  1YHA A;  1Q3L A;  2KA7 A;  5IYD H;  1WI5 A;  2WP8 J;  3U4Z A;  4BY1 H;  3QJY A;  4Y7N B;  1EFW A;  2EYF A;  2Z6B A;  3RUZ A;  1YVC A;  1WTX A;  3KF8 A;  3BU2 A;  1FJG Q;  2DY8 A;  4JI1 Q;  3ND9 A;  4OX9 L;  3E9H A;  4IJL A;  2G9D A;  4JI7 L;  4P71 A;  2HIV A;  3OWE B;  4J8Q A;  1KRS A;  4XTC S;  1PTO B;  4BBR H;  4X62 Q;  4K5X A;  4L63 B;  3HFZ B;  3SE0 A;  2YU9 B;  2IX0 A;  3E9I A;  1KDB A;  1VCI A;  3NUC A;  4LUZ A;  2Z9H A;  3PIP A;  1IKL A;  3BS1 A;  1NR4 A;  1PMR A;  5JEA J;  1SYE A;  4ZKB B;  1C8C A;  2ES2 A;  2N3S A;  2NVY H;  2N78 A;  4X64 L;  1FD7 D;  1LTG D;  2VXW A;  3I70 A;  4DUZ L;  1WTV A;  3KLR A;  5IGD A;  4A3K B;  2RSO A;  3U9O A;  5ELO A;  3RN5 A;  3I7F A;  4H7B A;  5CV5 A;  5IGC A;  2E2H B;  1EY8 A;  1NTG A;  4RWS C;  4DAV A;  5E1F A;  1SAP A;  3M9B A;  3PCO B;  4O0A A;  3HOW H;  3FRP B;  1PZI D;  5BN5 A;  3MEF A;  4CDF C;  5E7N A;  3ER0 A;  3R3O A;  1FR3 A;  5E4W C;  4JI2 Q;  1EZ8 A;  1RCV D;  1A2T A;  1L1O B;  1Y8N B;  4IUV A;  2EXD A;  2V1C C;  5K36 H;  2JSO A;  2VB2 X;  2G5D A;  5JVG 3;  2OXP A;  4YIJ A;  2TSS A;  4GLV B;  1LTB D;  1VS0 A;  5T1I A;  5EPL A;  3BZD B;  3J80 E;  2B8G A;  2XRQ D;  1K8G A;  1YIJ A;  4QCL A;  1N32 Q;  4N9P A;  1DZ1 A;  3M4O B;  1AZQ A;  2MP1 A;  1KAW A;  4POG A;  2Y0S E;  2WKC A;  1PHJ A;  2BDO A;  4QGU A;  2ASB A;  2NVT B;  2RVL A;  1LT6 D;  2QCP X;  4Q5V A;  1K0S A;  1PH3 A;  2HQE A;  1SBB B;  3T16 A;  3M3Y H;  1SNM A;  1XPR A;  1WTH A;  2WB1 E;  3HOY H;  3HOU G;  3DMU A;  4BXX G;  5KRU A;  1NNX A;  4JI2 L;  4GLX A;  1MHW C;  4V0B A;  2QF7 A;  1SJE D;  2L9H A;  3LNN A;  3J81 j;  4K6D A;  1XX8 A;  2VZA A;  5C4Z A;  3AFP A;  1TS4 A;  1GKH A;  1A62 A;  1HR0 L;  4DV7 L;  5JJL A;  1JCK B;  1GOZ A;  2WKD A;  1FL0 A;  4UP9 A;  4RA8 A;  3W5O A;  3GTP B;  2JA8 G;  4B3S L;  1EY0 A;  3HKS A;  1ZYR D;  2JE6 I;  3Q6S A;  1BUV T;  3P1H A;  4JC0 A;  4DR5 L;  1B7Y B;  1M1K C;  3AFQ A;  4F87 A;  5IT9 E;  2L15 A;  4JBM A;  1KLU D;  5ISR A;  1HHV A;  2JA5 B;  5EQ0 A;  5C0X H;  1DON A;  2OQK A;  3S1N B;  1GUS A;  3K7A H;  1QNU A;  1YZ6 A;  1JJC B;  1PFM A;  1KAA A;  2CHB D;  3M4Y A;  1LTS D;  4JOI A;  5TSS A;  1TU2 B;  4DR2 Q;  1CKO A;  5FLM H;  4DV7 Q;  2XWB B;  1X3G A;  1S4Z A;  2R6G A;  5IT9 c;  2NUC A;  5I6W A;  4QMG A;  3NHH A;  4A3K G;  1RL2 A;  4JI0 L;  4TQU S;  4B3S Q;  1NMG A;  1Y1V H;  1VQD A;  3KFU A;  2G9H D;  1TWG H;  2QDB A;  1HPC A;  1PYW D;  1ZKO A;  4ME3 A;  5DM6 3;  3FEW X;  3TRZ A;  4ZQ3 A;  2EDG A;  2BDN A;  3QG1 A;  5CBE E;  2AHO B;  5JPN C;  4OO1 I;  1GD7 A;  3ZYY X;  1VF7 A;  4DF7 A;  1AN8 A;  1EYG A;  1DD2 A;  1L2F A;  1HNW L;  5C5M A;  4DV0 Q;  3MA2 B;  3VA5 A;  3S1Q H;  1BCP D;  4ZK9 B;  4I7A A;  1CKN B;  2QEX A;  1SNC A;  5C44 G;  4DV3 L;  3M7G A;  1OXT A;  4DR2 L;  4N9T A;  2A6E D;  2DJF C;  1QIL A;  5C0X J;  4KJN A;  4XXE A;  2IHF A;  3H6M A;  4RFB A;  2F0I A;  4JI0 Q;  1FNU A;  3FKI B;  2B63 B;  3DWQ A;  1IYU A;  1PVO A;  3GTQ H;  3PV0 A;  1M8A A;  1TS5 A;  1J5E Q;  3I4M H;  2EYL A;  2RF4 A;  1Q81 C;  5FKA C;  4RKL A;  1W6J A;  2MO0 A;  1CSQ A;  1GHJ A;  4A3I H;  1HNX Q;  4XT3 B;  4X62 L;  4BY7 B;  1SSO A;  3A5Z B;  1NJI C;  5D3I B;  4A3E G;  1S5C D;  4APV A;  3X3N A;  2R7D A;  4DA2 A;  4JK1 C;  3S9W A;  4DFA A;  1KLG D;  1AW7 A;  1UWV A;  1EWC A;  5M5Y H;  1VQE A;  3V2T A;  5IGG A;  4GKJ L;  3NBI A;  3CCM A;  1SYD A;  4RGO S;  1O78 A;  1O7Y A;  2C9O A;  1JB7 A;  4PV1 C;  4B3M Q;  1KDA A;  5JEA H;  1NBW A;  1L1O C;  4BBR G;  3HP3 A;  1CKN A;  1VQ9 A;  4IAL A;  4BA2 I;  4DAY A;  2NZO A;  2PO4 A;  2A1A A;  2FHT A;  1U0L A;  5C3E H;  3PF4 A;  3D6W A;  5I9O A;  2UXB Q;  1PFB A;  4GOP B;  4OEM B;  2F0S A;  1Q82 C;  5IYD G;  1UEB A;  3K8A A;  5IP9 G;  3C1F A;  4YHH Q;  5JAV A;  1JWU D;  1T5E A;  5H1S E;  1KXL A;  1RTO A;  1NE3 A;  4LWC A;  5ELD A;  5IE8 A;  4RKB A;  1ZEQ X;  4BBS B;  4JI3 L;  4M1U B;  1G2S A;  1PTO H;  4LFB Q;  1TWH B;  2RCN A;  1B2T A;  3S24 A;  4HAE A;  1RD9 D;  4XDX A;  4A3L G;  1MKH A;  2EYM A;  1PTO F;  1ML0 D;  1STE A;  4A3F B;  4K2L A;  3OYY A;  4A3G G;  2I0Q A;  1EY9 A;  2NVY B;  4A3B B;  3VR6 A;  4DAM A;  3NK9 A;  4DR6 L;  1P8L A;  2FIN B;  3NE5 B;  2WB1 B;  4JI4 L;  1I4Q A;  5DLQ E;  4C3J G;  2VQF Q;  1EQR A;  2AQ1 B;  4HIO A;  1HUN A;  1JB3 A;  2UXB L;  3FVQ A;  5BN4 A;  3IFD A;  2BE5 C;  4DK1 A;  1XMO L;  2R93 B;  2UU9 L;  4KLK A;  3HKZ E;  4GN4 B;  3KJP A;  2JA8 B;  2WAQ B;  1RTN A;  1K28 A;  1EOT A;  4DKA C;  1B9M A;  3ULJ A;  2NVX B;  1HR0 Q;  1WD0 A;  4DK0 A;  2ENB A;  3U50 C;  1SYC A;  2EZV A;  4R4Q A;  1SR3 A;  1X55 A;  4OWX B;  1S3O A;  1TVX A;  4H44 C;  2I5M X;  1IW7 C;  3CAM A;  1K8M A;  1OXU A;  4UDU C;  1PH9 A;  5I9P A;  3U58 A;  3RLF A;  1I4R A;  1Y1W G;  4A3M B;  1NMF A;  2JXM B;  2LXK A;  1STA A;  3Q22 A;  3A8I E;  1JJG A;  1H9K A;  3QOJ A;  4HMI A;  2NWG A;  3H94 A;  4KHZ A;  1ROD A;  1ESR A;  2PW5 A;  2F4I A;  2CVR A;  3I3C A;  5M5W H;  2Q2T A;  1PH6 A;  1V8Q A;  3A7L A;  3BDL A;  4XYQ A;  1F9Q A;  5JJK A;  1SE2 A;  1VQO A;  4GS3 A;  4C3H B;  3P20 A;  1UE1 A;  2CH4 W;  5LMN Q;  1EFI D;  3GP7 A;  2NZH A;  2VQE Q;  1TWH H;  3CW2 C;  2D9U A;  3GQB A;  2QGQ A;  2F3I A;  3AEV A;  3K0Y A;  1VQI A;  2XN9 C;  3K80 C;  1QE6 A;  2DJG C;  4LFC L;  1DJR D;  5M5Y B;  4IPG A;  4OO1 H;  2H1E A;  2XVS A;  3URY A;  2Q2U A;  3S2D B;  5C4X H;  1VQC A;  4L5T A;  1L1O A;  2Z4I A;  1HZ9 A;  3UDG A;  4PMB A;  1S5F D;  1QZH A;  1CK1 A;  5KNC A;  2I5H A;  2KQ3 A;  2EYO A;  4MN3 A;  1TT2 A;  2GVB A;  1U4M A;  2KCC A;  5IYC G;  2ZM6 L;  1U5K A;  4DV2 Q;  2B2U C;  2BA1 A;  3PSI A;  4LW1 A;  4N8X 1;  1BQQ T;  1HNW Q;  1A15 A;  2K4K A;  3CCE A;  1PFS A;  1KNE A;  3MFY A;  2SDF A;  2RCF A;  4FF3 A;  4J6H A;  2IPK D;  3E0J A;  1S40 A;  3KF8 B;  1D7Q A;  1PH2 A;  5IOC A;  3A74 A;  4JBW A;  3T4A C;  2O5I C;  2OCE A;  4WRD A;  1PLF A;  4HJ5 A;  3PUX A;  5BR8 Q;  3PO2 H;  1JOO A;  2F0K A;  4Y52 H;  2Q8I B;  1DOM A;  2NVT H;  5M5W B;  4BXX H;  2MHV A;  1EEI D;  3VR2 A;  2KCM A;  2F0U A;  2F0V A;  4YCW A;  4KKT A;  3EIV A;  2RBM A;  3JAM L;  1KTK A;  3TP7 A;  3DHQ A;  4TRD A;  1E1O A;  2CFM A;  2MPM A;  4DV5 L;  2FFK B;  4G7O C;  2K52 A;  2D62 A;  3OW2 A;  2UXC L;  3OTO L;  1F9S A;  1YIT A;  1GHK A;  4KI0 A;  4B9W A;  1Z9F A;  3Q23 A;  3DM1 A;  3S1R H;  2XGT A;  3HOX B;  1XJV A;  1HTL D;  2ZTD A;  2FXQ A;  1I4X A;  4RGT A;  1G6P A;  2KCN A;  4JI6 L;  5EJW A;  1PV4 A;  3IFT A;  3I4O A;  3CKI B;  1VQ4 A;  4GKJ Q;  1RF2 D;  3VYU A;  3HS0 C;  4A3C H;  2F0E A;  4C3I H;  3F2B A;  5ELE A;  1L0Y B;  4HMJ A;  4JBK A;  3PUW A;  4BS9 A;  4FF4 A;  1VQM A;  4NW2 A;  1Y1W B;  5C0X I;  3J81 i;  3MXN B;  2NVQ H;  3GTM H;  1ONL A;  3QWN A;  2K5N A;  1HZC A;  4K2K A;  4FDB A;  4K6L A;  1D1I A;  2K5Q A;  3I73 A;  5FLX L;  3TSS A;  3K5M A;  4JI7 Q;  1G8Z D;  3NTI A;  4R4O A;  4NXM L;  2E8G A;  1EWI A;  3S15 B;  3S16 B;  4FXD A;  5K5P A;  4IUN A;  2CQO A;  2OWO A;  2UXC Q;  1SRO A;  1JOK A;  1NCV A;  4A3F G;  2JYO A;  1SMY C;  2R92 G;  3K6O A;  5KEE A;  2D5D A;  3AB9 A;  2AWN A;  4DUY Q;  1A63 A;  5EKI A;  2D2C C;  3U9S A;  2RA4 A;  5IYB H;  1TXY A;  3HOW B;  2JP1 A;  2R92 B;  3H3V C;  3HOV H;  2KEC A;  3BZK A;  3CD6 A;  2SOB A;  4POF A;  2BA0 A;  2PPB C;  1SRU A;  5FLX c;  2HCI A;  1Q1E A;  1I50 B;  4KY5 A;  3MZ5 A;  4X6A H;  2H4O A;  4C3J H;  3HZX A;  5FJ8 G;  3CCJ A;  3W3A A;  5AFW A;  1EY6 A;  1X6O A;  2QKI C;  1QVG A;  1XTC D;  1YI2 A;  4IUU A;  1DM0 B;  3I4M G;  3S2D H;  3KF6 A;  2F0J A;  2A68 D;  4CBV A;  1Q46 A;  1XWE A;  2A6H C;  1MIU A;  3OSO A;  4DV1 L;  2CWA A;  3RLO A;  5ELB A;  2KCT A;  3PQI A;  2DN8 A;  1KHI A;  3H0G H;  1X56 A;  2CW0 C;  5BR8 L;  3M4O H;  3WDN A;  3MEH A;  2A6E C;  1PH7 A;  1GM5 A;  3L7Z C;  5CBA E;  3PUV A;  2JA5 H;  2K04 A;  4A75 A;  3CQZ H;  2Q2H A;  3S2H B;  2VUM B;  2B2W C;  1Q8K A;  4GNX A;  3CCU A;  4JYA L;  4B3T Q;  3SDZ A;  2Q2I A;  2IHE A;  3T56 B;  1R9T H;  1WYD A;  3K57 A;  4L5Q A;  2AMC B;  4PZ7 A;  1ET9 A;  2F0P A;  2JJQ A;  4KHP L;  3NPP A;  2K03 A;  3VYS A;  1SNQ A;  1EYD A;  2Q8R E;  4RGM A;  4DK6 C;  1UEA B;  4DR4 L;  5EBC A;  5JEA G;  3Q24 A;  1IBM Q;  4BBR B;  2WV6 D;  4CKB A;  4A76 A;  2I46 A;  3ERQ A;  2YTX A;  4AIM A;  4C3I B;  2E2I H;  3BYT B;  1ICF B;  4K0K L;  4A3G B;  4CKC A;  3NWT A;  5C5L A;  4BY7 G;  2FMC A;  3JAM c;  3R93 A;  2UUC L;  2F0D A;  4F7X A;  3S1M B;  1IYJ B;  2IX3 A;  4JV5 Q;  3PUY A;  2B2T C;  3T53 B;  3J7Z C;  2EVB A;  3F2C A;  1EY7 A;  5IP7 G;  3IRB A;  4B3R L;  1C4Q A;  1YJW A;  3LGJ A;  2J7Z A;  4QIW B;  3VR4 A;  3H09 A;  1X9N A;  5CMD A;  1S5E D;  3CF5 A;  1DXM A;  1F2Z A;  1HR0 W;  3ZJY C;  3BVZ A;  1D5X C;  4CHT B;  3LWU A;  3VDY A;  4A3L H;  4FF2 A;  1OXS C;  1SYB A;  1HCZ A;  2ZTE A;  3UDF A;  2B2U A;  4C3I G;  4I7Z C;  1AEX A;  5ELC A;  3G6E A;  3BVM A;  2E76 C;  3EN2 A;  3R2I A;  1ICW A;  3L0O A;  4RCO A;  5DM7 3;  1PYB A;  5IP9 H;  3O13 A;  1VQ5 A;  2E75 C;  2KHJ A;  5A35 A;  4NB3 A;  1JE5 A;  2QW7 A;  2E2J B;  3KDF A;  1HQR D;  2BH8 A;  4NDX A;  3A8J E;  1N34 L;  3D3R A;  4S3S A;  2N88 A;  2K33 A;  1SYG A;  2HT1 A;  3HOY G;  1OXX K;  1SE3 A;  1PZK D;  4MHE A;  4ZUI A;  4IPC A;  3F1Z A;  3PMF A;  4WJ3 M;  2M00 A;  4HSP A;  2XWJ B;  4A3I B;  4LF9 L;  1LYL A;  4IUQ A;  5EKK A;  3C46 A;  4BY7 H;  3SK4 A;  4X3K A;  1BVS A;  5GRO A;  3GTJ B;  3ERS X;  2F0H A;  1VQ6 A;  3D8G A;  2DNC A;  1Q90 A;  4FXK C;  2VB3 X;  1IBL L;  1A3V A;  1EYC A;  5E4X A;  4GOP A;  5D3D A;  4LK1 C;  4R4C A;  1ET6 A;  1NAP A;  3GO5 A;  4AQY Q;  2X6L A;  3ULP A;  1EUJ A;  3DEO A;  3MTS A;  1PRT F;  2LFN A;  5EPJ A;  4DPG A;  3I72 A;  2OTL A;  3J80 c;  3I55 A;  2B2T A;  5C4X B;  2TMP A;  1IBM L;  1XMO Q;  4RMF A;  1N9W A;  2PZU A;  1QOH A;  2K6A A;  4YWL A;  1PDQ A;  1HQM C;  1K73 C;  1YJN A;  4P74 A;  1CHP D;  1TWA B;  5C4X G;  5JOB A;  4A3C G;  2KED A;  4NXN L;  1KD1 C;  1XTD A;  1I4P A;  4NPS A;  3I4L A;  1ILQ A;  5KIX A;  4CJ1 B;  1Q12 A;  3TN2 A;  2AQ3 B;  1W2B A;  1B3A A;  2ZT9 C;  2PMZ E;  1XMQ Q;  1TWC H;  4ZKC B;  2A6H D;  1V1P B;  4YWK A;  3D4W A;  4F8M A;  3HKZ G;  1O7Z A;  2HQL A;  3TP6 A;  5C3E G;  3KOJ A;  4BY1 B;  2V4D A;  4K5W A;  1OO9 B;  4HJ7 A;  3H91 A;  1B8A A;  1NY4 A;  4ID6 A;  1B44 D;  2EE1 A;  2HHH L;  4ZCK A;  2X69 A;  2KUM A;  3KF6 B;  3FHW A;  2GA4 B;  4DNI A;  5EGT A;  1DOL A;  3VYT A;  2K32 A;  4NMZ A;  4JI1 L;  1GXD C;  1MSH A;  2EY6 A;  3N52 A;  2IY5 B;  1AE2 A;  3P7J A;  2LY7 A;  1G2T A;  2F0Q A;  2E5L L;  3PO3 G;  4DAP A;  1QUQ A;  3E5S A;  1S5D D;  2VL6 A;  2F4V L;  2XIW A;  2F0G A;  4H0L C;  3KJO A;  3FP9 A;  3BYY B;  2NTS A;  4UPA A;  2MO1 A;  2E2I B;  1T5X D;  1DCZ A;  1Y8P B;  1BCP C;  2PCF B;  2K28 A;  4DV4 L;  1TWF B;  4IUT A;  3F2U A;  1WTR A;  1WTP A;  1CKM A;  2F0W A;  2OTJ A;  3J7A V;  2RDH A;  3K0X A;  3CPF A;  4MZ9 A;  2OT2 A;  2K14 A;  5A2Q E;  2B29 A;  3UDI A;  2PQA B;  5LL6 X;  2N49 A;  5J1Z A;  2ZM6 Q;  4DV2 L;  1Y14 B;  1LM0 A;  4QQB X; 
#chains in the Genus database with same CATH homology
 5M5W H;  4A3I G;  2Q2T A;  1PH6 A;  1GO3 E;  1HNZ L;  3G48 A;  2VQF L;  2JA7 G;  3ICE A;  5JJK A;  1VQN A;  4DV6 L;  4DR7 L;  1VQO A;  4GS3 A;  1YHQ A;  3E0E A;  4LF7 L;  3TS2 A;  2D0P A;  1E7Z A;  3CCR A;  1YBY A;  4IOC A;  4A3G H;  1UE1 A;  5LMN Q;  4IPD A;  4B3M L;  2NZH A;  4JG2 A;  3NBH B;  2VQE Q;  2E5L Q;  2IX1 A;  3T1H Q;  1TWH H;  3CW2 C;  3NEL A;  5EAY A;  2PQA A;  2Y0S G;  2QGQ A;  4DR3 L;  2F3I A;  5IYC H;  1I3Q H;  3AEV A;  2N8N A;  3B6Y A;  3KDF B;  2R93 H;  1ASY A;  1VQI A;  5FLM G;  1Q7Y C;  1XNR Q;  3K80 C;  3I2Z A;  2KHI A;  5M3M H;  1IL2 A;  1FJG L;  4LFC L;  4A93 G;  2K5H A;  1WCM H;  4IPG A;  1P16 A;  5GQO A;  2WAQ E;  5AJ3 Q;  3RN2 A;  2UUC Q;  2Q2U A;  2WFW A;  4OX9 Q;  4B3R Q;  3GTJ H;  4JV5 L;  5C4X H;  1MJE A;  4DR1 L;  1VQC A;  4L5T A;  3S16 H;  2QA4 A;  1QVC A;  1L1O A;  2NN6 G;  3UDG A;  1HZ9 A;  1KQS A;  1QZH A;  1Y1V G;  3M4Q A;  5M3M G;  2ZTC A;  4DV5 Q;  4LF5 L;  2I5H A;  2GVB A;  2AKW B;  5GAD C;  5IYC G;  4GOP C;  1XMQ L;  2ZM6 L;  4X64 Q;  1U5K A;  4DV2 Q;  4AYB E;  5HGQ A;  3A5U A;  2BA1 A;  1HZB A;  1RIP A;  3PSI A;  4LW1 A;  4PZ6 A;  2RHQ B;  1HNW Q;  2K4K A;  1SLJ A;  3BZC A;  2JA5 G;  4QJF A;  4HJ8 A;  4QL5 A;  1IBK Q;  3CCE A;  1K3R A;  3BJU A;  1PFS A;  1VQJ A;  4GLA C;  4MTN A;  4EX5 A;  1L0W A;  4OWT B;  4GN5 A;  4OON A;  3U4V A;  3Q8D A;  1S40 A;  3KF8 B;  1D7Q A;  1YHA A;  1PH2 A;  3A74 A;  4JBW A;  2YTV A;  2OCE A;  2VQE L;  5IYD H;  1WI5 A;  2WP8 J;  3U4Z A;  4BY1 H;  2VUM G;  4HJ5 A;  3PUX A;  1EFW A;  5BR8 Q;  1YVC A;  2IT1 A;  3PO2 H;  4UY8 C;  1N34 Q;  2JEB I;  4PMW A;  4Y52 H;  1DGS A;  3BU2 A;  1I50 H;  3RLN A;  1E3P A;  1G51 A;  5AJ3 L;  1KIX A;  1FJG Q;  2JA6 G;  2NVT H;  2JA9 A;  4JI1 Q;  4A3M G;  4BXX H;  1J5E L;  3GDE A;  4OX9 L;  2JQO A;  2KCM A;  3E9H A;  4IJL A;  4P73 A;  3CCV A;  4JI7 L;  4NXM Q;  4P71 A;  2HIV A;  4YCW A;  1X54 A;  1KRS A;  3EIV A;  4XTC S;  3UE0 A;  4BBR H;  4X62 Q;  1WFQ A;  3HFZ B;  5IP7 H;  2IX0 A;  1V9P A;  3DLL A;  3E9I A;  1XPU A;  1VCI A;  4MNO A;  1E1O A;  1ASZ A;  2CFM A;  4LUZ A;  3F2D A;  4DV5 L;  3PIP A;  2K52 A;  3GTL H;  2D62 A;  3T1Y L;  3CCS A;  3OW2 A;  2UXC L;  3OTO L;  5JEA J;  1YIT A;  3PO3 H;  3CC7 A;  4KI0 A;  1Z9F A;  4DV4 Q;  1IBL Q;  1BBU A;  2N3S A;  2NVY H;  2N78 A;  2ES2 A;  4X64 L;  4A3K H;  3S1R H;  2XGT A;  3UE1 A;  1XJV A;  2ZJP A;  1SFO H;  2ZTD A;  2FXQ A;  4DUZ L;  1N32 L;  1LTL A;  2VY3 A;  1M90 C;  2KEN A;  4LFA Q;  1G6P A;  4A3J H;  4JI6 L;  4QY7 A;  1PV4 A;  5ELO A;  3I4O A;  4DK3 C;  1VQ4 A;  3S2H H;  3RN5 A;  4GKJ Q;  3CME A;  2UXD Q;  1A0I A;  2Z6K A;  3I7F A;  1X3E A;  1UE5 A;  3G4S A;  4A3C H;  3CCL A;  4C3I H;  3F2B A;  2JA7 H;  4JBK A;  4LF6 L;  4JI5 Q;  3PUW A;  1NTG A;  2YV5 A;  1VQM A;  2K5V A;  1AE3 A;  3M9B A;  3PCO B;  5C0X I;  4O0A A;  3J81 i;  3MXN B;  1PH5 A;  2NVQ H;  3HOW H;  3GTM H;  3AYH B;  3D0F A;  4LF7 Q;  3J80 i;  2D0O A;  4PG3 A;  1Y1W H;  3PO2 G;  3MEF A;  4ALP A;  5E7N A;  3ER0 A;  2K5N A;  1HZC A;  1EIY B;  4JI2 Q;  2JK8 A;  4FDB A;  1I94 Q;  3HOU H;  3EBE A;  1L1O B;  3NEN A;  3RZD H;  2MNA A;  4JI7 Q;  2EXD A;  2V1C C;  3F8T A;  3GD7 A;  4R4O A;  4NXM L;  3CC2 A;  1BKB A;  3FKI G;  2B63 G;  4NXN Q;  2E8G A;  1VQK A;  5LMU Q;  1EWI A;  3PIO A;  1PH1 A;  1VQG A;  3TEH B;  2ATW A;  1E1T A;  1YNX A;  4GLV B;  2CCZ A;  2CQO A;  1VQH A;  2OWO A;  1VS0 A;  2UXC Q;  1SRO A;  1EQQ A;  3CC4 A;  4A93 H;  4A3F G;  2GVA A;  1HH2 P;  1A8V A;  2R92 G;  3RZO H;  2AWN A;  4DUY Q;  1A63 A;  1I6H H;  1K8G A;  1YIJ A;  1N32 Q;  4LF8 Q;  4LFA L;  4IJH A;  2PI2 A;  4IO9 A;  4JI6 Q;  5IYB H;  1KAW A;  1TXY A;  2Y0S E;  3STB D;  4DUZ Q;  3HOX G;  3TS0 A;  2UUA Q;  4POG A;  1GVP A;  2RHS B;  3HOV H;  3BZK A;  3CD6 A;  4YY3 L;  1PH8 A;  1PHJ A;  4DR6 Q;  4POF A;  3RNU A;  2BA0 A;  4HIM A;  2C35 B;  4JI4 Q;  1SRU A;  5FLX c;  2HHH Q;  4WJ4 A;  4QGU A;  2ASB A;  1Q1E A;  4C3H H;  4X6A H;  5FJ8 H;  1PH3 A;  4C3J H;  1X3F A;  5FJ8 G;  3M3Y H;  3CCJ A;  1XPR A;  3HOY H;  1V1Q A;  2WB1 E;  2MFI A;  3HOU G;  1QVG A;  1X6O A;  4X66 L;  4BXX G;  1YI2 A;  3M85 A;  4JI2 L;  4GLX A;  3HOX H;  4JBJ A;  4P75 A;  3I4M G;  3S2D H;  1KC8 C;  3KF6 A;  4AYB G;  2VUM H;  3J81 j;  5IWA L;  1Q1B A;  1Q46 A;  1UE7 A;  1MIU A;  5GAG C;  4DV1 L;  2VZA A;  3GTK H;  2CWA A;  3AFP A;  4RG1 A;  2KCT A;  1GKH A;  1A62 A;  3RLO A;  1HR0 L;  2UU9 Q;  1KHI A;  4PZ8 A;  4DV7 L;  3H0G H;  1X56 A;  5BR8 L;  3M4O H;  5JJL A;  3A0J A;  4C2M H;  1VQA A;  1PH7 A;  1FL0 A;  4UP9 A;  2R7Z G;  1GM5 A;  3L7Z C;  3W5O A;  4A3E H;  2UUB Q;  2JA8 G;  4B3S L;  2R7F A;  3PUV A;  2JA5 H;  1TWA H;  3HKS A;  4A75 A;  4LNQ A;  3CQZ H;  4H02 A;  2ZJR A;  1N36 L;  2Q2H A;  1OXV A;  2JE6 I;  4GN3 B;  1Q8K A;  1FGU A;  4GNX A;  3CCU A;  4JC0 A;  4JYA L;  4DR5 L;  4B3T Q;  2Q2I A;  2NVX H;  1B7Y B;  2IHE A;  1M1K C;  3AFQ A;  2L15 A;  1WYD A;  5M3F G;  1E22 A;  1R9T H;  4JBM A;  5C4J H;  4L5Q A;  4YCU A;  2AMC B;  4YY3 Q;  4L5R C;  2MQH A;  4PZ7 A;  3I4N H;  1H95 A;  2JJQ A;  4HJ9 A;  4KHP L;  1N33 Q;  1J6Q A;  2A19 A;  3PF5 A;  1C9O A;  1WOC A;  1I5F A;  1KRT A;  1S72 A;  4LF4 L;  2OQK A;  4X66 Q;  3PGZ A;  4DK6 C;  4DV3 Q;  4DR4 L;  3K7A H;  5JEA G;  1YZ6 A;  1K0R A;  1JJC B;  4OO1 G;  4GKK L;  1IBM Q;  3S1N H;  1N8R C;  3S1M H;  4A76 A;  2JA6 H;  2WAQ G;  4JOI A;  2YTX A;  4DV1 Q;  4AIM A;  4DR2 Q;  1QZG A;  2E2I H;  4IFD I;  1CKO A;  5FLM H;  5IWA Q;  4DV7 Q;  4JI5 L;  4K0K L;  1X3G A;  2R6G A;  5IT9 c;  3J81 c;  4A3B H;  3SGI A;  4A3K G;  1CSP A;  1RL2 A;  4DR3 Q;  1W3S A;  4JI0 L;  4IPH A;  4BY7 G;  4TQU S;  4B3S Q;  1NMG A;  1Y1V H;  1VQD A;  3KFU A;  3JAM c;  4HIK A;  4JI3 Q;  1TWG H;  4YWM A;  2UUB L;  2LXJ A;  4LFB L;  1Z47 A;  1I94 L;  2UUC L;  4ME3 A;  5HY6 A;  1IYJ B;  4JV5 Q;  3PUY A;  3TRE A;  2R7Z H;  3J7Z C;  3F2C A;  2A8V A;  4R4I A;  3TRZ A;  5IP7 G;  4LUO A;  4GNX B;  3IRB A;  3GTP H;  5LMU L;  4B3R L;  5JJI A;  1K8A C;  4A3M H;  4JYA Q;  4LF9 Q;  2Z0S A;  2AHO B;  3LGJ A;  4DR5 Q;  1YJW A;  4OO1 I;  4LF5 Q;  1GD7 A;  1X9N A;  1JMC A;  2Z6K C;  4KHP Q;  3JC6 6;  4HID A;  3CF5 A;  1HR0 W;  4JCV E;  4OXP A;  3ZJY C;  1O7I A;  1EYG A;  3VDY A;  1L2F A;  3GTO H;  4A3L H;  1HNW L;  4DV0 Q;  2LSS A;  3KLW A;  1OXS C;  3S1Q H;  5M5X H;  1IBK L;  2ZTE A;  3DM3 A;  1CKN B;  3UDF A;  2QEX A;  4A3F H;  3WWV A;  2UUA L;  2JA8 H;  1VQ7 A;  5C44 G;  1LUZ A;  4DV3 L;  4XIG S;  1YHB A;  3G6E A;  4DR4 Q;  3EN2 A;  1OXT A;  4DR2 L;  3D31 A;  4IFD G;  1QUQ B;  3L0O A;  4AQY L;  2JEA I;  1PYB A;  5C0X J;  5IP9 H;  4UP8 A;  1VQ5 A;  2IHF A;  2KHJ A;  4NB3 A;  4K0K Q;  1JE5 A;  1BBW A;  3UDX A;  4JI0 Q;  1AH9 A;  3KDF A;  2BH8 A;  1Q86 C;  1JT8 A;  2AWO A;  1PVO A;  2E2J H;  3GTQ H;  3PV0 A;  1N34 L;  1J5E Q;  3I4M H;  2RF4 A;  1Q81 C;  4IOA A;  3H3V I;  4A3D H;  3AQQ A;  2YTY A;  2HT1 A;  2KBN A;  1K83 H;  3HOY G;  1OXX K;  1CSQ A;  2MO0 A;  4A3I H;  1HNX Q;  4YHH L;  1XNQ L;  2F52 A;  4IPC A;  1VQB A;  1PYS B;  4X62 L;  5ELN A;  3F1Z A;  2DGY A;  1VQ8 A;  4WJ3 M;  3A5Z B;  1VQF A;  1X65 A;  4Y7N H;  1NJI C;  4LF9 L;  1IZ6 A;  3M4P A;  2VS1 A;  4A3E G;  1LYL A;  1OTC A;  4BY7 H;  4APV A;  5GRO A;  1BVS A;  3STB C;  5GAH C;  2CWP A;  2R7D A;  2EQS A;  2I5L X;  3W1G A;  3H0G G;  3ERS X;  4A3B G;  3J7A 5;  3OTO Q;  1VQ6 A;  4AH6 A;  1PH4 A;  2R93 G;  1UWV A;  4BY1 G;  1SN8 A;  1IBL L;  4DV0 L;  5M5Y H;  3M7N A;  2VW9 A;  4B3T L;  1VQE A;  5J3B A;  1MJC A;  2YU9 H;  2HIX A;  4GKJ L;  4GOP A;  2UXD L;  1E24 A;  3CCM A;  4EQ5 A;  4R4C A;  4R1J A;  3S17 H;  1TWF H;  1JB7 A;  3GO5 A;  4AQY Q;  1WJJ A;  2B3G A;  3ULP A;  1SMX A;  4B3M Q;  1N33 L;  1EUJ A;  5K36 G;  1NBW A;  1B70 B;  1L1O C;  4BBR G;  4JI8 Q;  1CKN A;  3T1H L;  1VQ9 A;  3S15 H;  4DPG A;  4LF6 Q;  1UE6 A;  4A3D G;  4GKK Q;  2OTL A;  3J80 c;  1YJ9 A;  3I55 A;  3NEM A;  3CXC A;  1SE8 A;  4BA2 I;  2NZO A;  4L5S A;  3I4N G;  2A1A A;  3K7U C;  1XMO Q;  1IBM L;  3HOV G;  3S14 H;  4RMF A;  1N9W A;  1U0L A;  3L2P A;  5C3E H;  3PF4 A;  2NN6 I;  2UXB Q;  4YWL A;  4QIW E;  2GN5 A;  4GOP B;  1XNQ Q;  1K9M C;  1Q82 C;  5IYD G;  2BH2 A;  1UEB A;  1HZA A;  4J15 A;  4P74 A;  1YJN A;  1K73 C;  3K8A A;  4BBS H;  1CUK A;  4YCV A;  5IP9 G;  5C4X G;  4A3C G;  4YHH Q;  3I56 A;  5H1S E;  1KXL A;  2R92 H;  4DR1 Q;  1NE3 A;  2H5X A;  4LWC A;  5IE8 A;  3JAM i;  4NXN L;  1KD1 C;  1XTD A;  4A3J G;  4NPS A;  2K75 A;  3CP0 A;  4JI3 L;  3RR5 A;  2F4V Q;  3GTG H;  1WCM G;  1Q12 A;  4JOI C;  3KYH C;  1W2B A;  4LFB Q;  2RCN A;  1HJP A;  2PMZ E;  3S24 A;  5IYB G;  2VNU D;  1XMQ Q;  1TWC H;  1C7Y A;  1QVF A;  4A3L G;  4HJA A;  4LF8 L;  1MKH A;  3PUZ A;  4YWK A;  4DUY L;  3CMA A;  2WB1 G;  3HKZ G;  5LMN W;  1T9H A;  2OQ0 A;  2HQL A;  2CKZ B;  5IY0 A;  3KOJ A;  5C3E G;  2DUD A;  3OYY A;  4HJ7 A;  4A3G G;  2I0Q A;  1B8A A;  1JJ2 A;  4DAM A;  1G29 1;  1NY4 A;  4X65 Q;  4DR6 L;  1P8L A;  4JI4 L;  1EIF A;  1EOV A;  2HHH L;  3H3V H;  4O2D A;  4JI8 L;  3KF6 B;  5GAE C;  5DLQ E;  4A4I A;  5C0X G;  2ZJQ A;  2ALY B;  2YYZ A;  1IXR A;  1EQR A;  2ID0 A;  3FHW A;  2PI2 E;  3ULL A;  4P72 A;  4DNI A;  2VQF Q;  4GNX C;  4DV6 Q;  3CCQ A;  4HIO A;  4DR7 Q;  4IFD J;  2EIF A;  2UXB L;  1HNZ Q;  4R4T A;  1XPO A;  4TVA B;  1XMO L;  3K81 C;  4BA1 I;  4JI1 L;  3G71 A;  2UU9 L;  5LMN L;  2IY5 B;  3HKZ E;  4KLK A;  1AE2 A;  4GN4 B;  3KJP A;  1VQP A;  1C0A A;  2E5L L;  4DKA C;  3ULJ A;  3PO3 G;  1QUQ A;  1HR0 Q;  2VL6 A;  1XNR L;  2F4V L;  3U50 C;  1KL9 A;  2PNH A;  3KJO A;  3FP9 A;  4R4Q A;  1SR3 A;  1X55 A;  4OWX B;  1S3O A;  1PA6 A;  3HOZ H;  2I5M X;  3CAM A;  4UPA A;  1N36 Q;  3T1Y Q;  3HOZ G;  2MO1 A;  4LFC Q;  1V43 A;  5C44 H;  1D8L A;  1YEZ A;  1OXU A;  1HNX L;  4DV4 L;  1PH9 A;  3TQY A;  3FKI H;  3CPW A;  3H15 A;  2B63 H;  1CKM A;  3U58 A;  4BBS G;  2OTJ A;  3K0X A;  4OWW B;  3RLF A;  1Y1W G;  3CPF A;  5M3F H;  1NMF A;  4LUV A;  4MZ9 A;  4X65 L;  2K14 A;  2B29 A;  2LXK A;  3UDI A;  3HOW G;  3W1B A;  2PQA B;  2XTI A;  1JJG A;  1VQL A;  2N49 A;  4UP7 A;  2ZM6 Q;  1FVI A;  2E2H H;  4DV2 L;  1Y14 B;  4DAY B;  4LF4 Q;  2K50 A;  1LM0 A;  4KHZ A;  4QQB X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...