3A5UA

Promiscuity and specificity in dna binding to ssb: insights from the structure of the mycobacterium smegmatis ssb-ssdna complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
119
structure length
118
Chain Sequence
b'MAGDTTITVVGNLTADPELRFTPSGAAVANFTVASTPRMFDRQSGEWKDGEALFLRCNIWREAAENVAESLTRGSRVIVTGRLKQRSFTREGEKRTVVEVEVDEIGPSLRYATAKVNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Single-stranded DNA-binding protein
publication title Promiscuity and specificity in DNA binding to SSB: Insights from the structure of the Mycobacterium smegmatis SSB-ssDNA complex.
rcsb
source organism Mycobacterium smegmatis
molecule tags Dna binding protein
total genus 18
structure length 118
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3a5uA00
5IYDG 1A8VA 5BR8Q 4OONA 3CCVA 4B3RL 3CW2C 2F4VQ 4YY3Q 1VS0A 2Y0SG 2C35B 3GD7A 3HOVH 3BZKA 5M5YH 2CFMA 5C3EG 1QZHA 3HOUH 3EN2A 4JI8L 4JI6L 1YJWA 1OXVA 1VQ7A 5GAHC 3I55A 3RLFA 4LF9L 4DR5L 2JK8A 2JEBI 1Y1VG 5IYBH 1E1TA 1IBMQ 1DGSA 3NEMA 3GTPH 4LWCA 1X9NA 4JI3L 4DK6C 3A5ZB 2I5HA 3CCJA 3RN5A 2HHHL 4LF8L 2F52A 2I5LX 4X65L 1PH6A 1TWFH 1CKNB 2PQAB 3K7UC 4AYBG 3M85A 1FJGQ 1GKHA 3PGZA 5C4XG 4POFA 1I94Q 2UU9Q 4PZ7A 1P16A 1X6OA 3I4MH 1E1OA 2UXCQ 2KCTA 2OQKA 1CKOA 5JJLA 1IYJB 4H02A 1PYSB 1VQKA 1JJGA 4JI4Q 4JI0L 1XMQL 3E9IA 5ELOA 1SN8A 3I56A 5ELNA 3PIPA 3KJOA 2N8NA 3KLWA 5C3EH 1Q81C 2PI2E 2NVQH 4A3LH 2CKZB 4IOCA 2BA1A 3I7FA 4B3TL 1AH9A 1JT8A 3CPFA 4NB3A 1J5EQ 2FXQA 1Y1VH 3CCUA 1N36L 1Q12A 2ZM6L 2WP8J 3F2CA 2I5MX 3L7ZC 5IP7G 4DV2L 2OCEA 4JI1L 2HIXA 4A4IA 5FLMH 5M3FG 4JBMA 2WFWA 2DUDA 4KLKA 1X54A 1OXTA 3A5UA 2RHSB 2YYZA 2Q2HA 3EBEA 3HKSA 3FKIG 5C4XH 2MO1A 4UP8A 4JBJA 3KDFA 1JJCB 3CC2A 4C3IH 4A3KG 3S15H 2K5NA 2F4VL 2VQFQ 3PV0A 2D62A 3JAMi 2RHQB 3UDIA 4DV3Q 4A93G 3S2DH 1CUKA 4X62Q 1VQ4A 1PH8A 1MJEA 4P73A 4DV7Q 3M4PA 3PUZA 1AE3A 2K52A 4IFDG 1RIPA 1J6QA 1L0WA 1B7YB 4DV0L 1Z47A 4L5SA 1SROA 4DV1L 3GTOH 4GLAC 3F1ZA 1UEBA 1VQCA 4LFCL 1WOCA 2UUCQ 5GQOA 1U5KA 1HR0L 2NN6I 3GTMH 5FJ8H 1CKNA 2PQAA 2BH8A 2YV5A 2D0OA 4GN4B 3S24A 4BA1I 1K8AC 4BXXH 3FKIH 1X3EA 4B3RQ 2AHOB 1Y1WH 1I6HH 1I94L 4DK3C 2UXCL 1BBUA 4NPSA 3SGIA 1K8GA 3DLLA 4A3KH 3A0JA 1WI5A 4JI8Q 4JI6Q 3PUVA 1K3RA 1YHBA 1OXXK 1Q8KA 4QL5A 3RN2A 4EX5A 4LF9Q 3GTQH 1V43A 5J3BA 4HJ8A 2ZTCA 4A93H 4BY7H 3U58A 3T1YQ 4JI3Q 5M3MG 4IPHA 5H1SE 2NZOA 3TS0A 2HHHQ 2I0QA 4LF8Q 4HIOA 1MIUA 3FP9A 1KRTA 5HY6A 4X65Q 2IT1A 1NY4A 3BJUA 3Q8DA 1SLJA 3GTKH 4KHPL 1HZAA 5JJKA 2R7ZH 4B3ML 1XPOA 2ALYB 1XPUA 3AEVA 4JI2L 1BKBA 1GD7A 3CAMA 4UP7A 3UDXA 4P74A 2VS1A 4LF6L 4JI0Q 1T9HA 1XMQQ 2NVYH 5JEAG 4Y52H 1PA6A 1EYGA 3HOUG 1PVOA 4NXML 4TQUS 1PV4A 2Q2UA 1JJ2A 4B3TQ 3PUXA 3K80C 2VUMG 2LXKA 1QVFA 5IYBG 4C3JH 1R9TH 3GO5A 1O7IA 4A3CH 3AQQA 1TWCH 4DV7L 5IT9c 4MZ9A 4A3MG 1N36Q 2ZM6Q 1HNZL 1OTCA 3RR5A 2Z6KA 4GNXC 1VQBA 5M3MH 4DV2Q 4GOPC 4JI1Q 1XJVA 2UUBQ 4R1JA 1GO3E 2R6GA 4IPGA 5M5WH 3DM3A 5LMUL 1B70B 2VW9A 4OWWB 1E3PA 4R4QA 1UE7A 1EQQA 5C0XJ 2EQSA 1N32L 1LUZA 4X64L 4JBWA 3I4NH 1SE8A 3RZOH 1E24A 1Q46A 2ZJRA 2Z6KC 3TREA 3HOZH 3D0FA 4NXNL 4MTNA 3KF8B 3UDFA 3JC66 4A3LG 4YWKA 4XTCS 2E8GA 3PO3G 3S1NH 1X56A 2ASBA 4RMFA 4YCVA 1K73C 4BBSH 2VUMH 3PSIA 3J7ZC 1WJJA 4L5TA 1G6PA 4DV0Q 4IFDI 4DV1Q 1NE3A 3T1YL 1IBKQ 4A3MH 1ASYA 1G291 4HIDA 3STBC 1A62A 3GTLH 4DV6L 5FLMG 3J81c 2ZTEA 1CKMA 3D31A 4LFCQ 1EIFA 3AFQA 1W2BA 3PF4A 3S2HH 3HFZB 1HR0Q 4HJ9A 1PH1A 4GKKL 5IP9H 2JA8G 1UWVA 1TWHH 1M90C 3TRZA 4IPCA 2KHJA 4GKJQ 2PMZE 1HNWL 1IL2A 1KRSA 3CC4A 4DR1Q 1S3OA 2EXDA 2JJQA 2ID0A 3CCLA 5JJIA 1E7ZA 3H0GH 3W1GA 4JOIA 3L2PA 1HNXL 4R4CA 3HOYG 4BA2I 1HJPA 4P75A 4YWLA 3PO3H 3S1QH 3J80c 2JA5G 4QGUA 1W3SA 4A3GH 1EQRA 4TVAB 5AJ3Q 4A3IH 1QVGA 4JYAL 1N8RC 3NELA 1FL0A 3RZDH 2UUBL 1E22A 4JOIC 3STBD 4APVA 3CD6A 3CP0A 1JB7A 2WB1E 2JA9A 3MXNB 1N9WA 4OX9L 3PO2G 4DR7Q 4KHPQ 4B3MQ 5FJ8G 3HOXG 1NJIC 2RCNA 2JA8H 4BXXG 1G51A 4JI2Q 4IJLA 2E5LL 4PMWA 3CXCA 3K8AA 1Y1WG 4LF6Q 3ERSX 3HOWG 1YI2A 1H95A 2ES2A 2KCMA 3CQZH 5IE8A 1ASZA 3BU2A 4NXMQ 4ALPA 4OO1G 1VQ8A 3HOYH 3TS2A 1XTDA 4ME3A 4BY7G 1BBWA 2JA7G 4DKAC 1TWGH 1X55A 1HNZQ 2JA5H 2MO0A 4FDBA 2OTJA 1VQEA 1IBKL 2KBNA 5LMUQ 2IHEA 4DAYB 4UPAA 4LFAL 2K50A 2DGYA 2PNHA 2R7ZG 3RNUA 3PO2H 3PUWA 1N32Q 4O2DA 3WWVA 4X64Q 4LUZA 1WYDA 5GROA 2PI2A 1K0RA 3HOXH 1PH9A 3ER0A 4QQBX 2LXJA 4LF5L 2F3IA 4JBKA 2BA0A 2NVXH 5M5XH 1XNRQ 2XTIA 2H5XA 3M3YH 4GKJL 4IJHA 4HJ5A 2CWPA 4DR1L 3F2BA 4IPDA 5DLQE 4NXNQ 3HOWH 3HKZE 3U4ZA 1SR3A 3S14H 3H3VH 2WAQE 4OWXB 1EFWA 2A1AA 2WB1G 2AWOA 4HIMA 1QVCA 1QZGA 2GVBA 1S72A 3E0EA 4A3CG 5LMNL 3ICEA 1L2FA 2ATWA 2JA7H 1SMXA 4OXPA 1C7YA 2NVTH 1BVSA 5AJ3L 4DV6Q 4K0KL 2OTLA 5K36G 3T1HL 4DR4L 4GKKQ 1HH2P 3S1MH 2UUAL 3ULLA 4YCUA 3U4VA 4DR7L 4PG3A 1RL2A 4PZ6A 1HNWQ 3JAMc 5HGQA 4J15A 3I4NG 2YU9H 2JQOA 4YCWA 3ULJA 3G48A 1VQ5A 1VQ6A 5FLXc 4JI7Q 2VY3A 3HOZG 1HNXQ 4DPGA 1PH7A 4DUZL 1V1QA 2K75A 2QGQA 1EWIA 4LUOA 4OWTB 2QEXA 4BBSG 1MJCA 4A3BH 3IRBA 4QJFA 2Y0SE 1KAWA 3MEFA 4LNQA 4JYAQ 1LTLA 2L15A 4EQ5A 4YHHL 2OWOA 1PYBA 2HQLA 4A3EG 4OX9Q 2B63H 3HKZG 5IP9G 1Q1EA 4RG1A 1Q7YC 1N33Q 1L1OB 2WAQG 3CCMA 4WJ3M 1LYLA 5C0XG 1VQFA 4GLXA 3NENA 3UE1A 4AQYQ 2E5LQ 2EIFA 1VQJA 2VQEL 2V1CC 3CF5A 4IO9A 1WCMG 1YHQA 3TEHB 1V9PA 4C3HH 4DV5L 3OTOL 4DUYL 1X3GA 3H0GG 4GS3A 1JMCA 4AYBE 1XNRL 2R92H 3K81C 3H3VI 2LSSA 3K7AH 2BH2A 1HZCA 1YZ6A 3G4SA 4OO1I 2VL6A 3G71A 1HR0W 4LUVA 4A3GG 1PH5A 2CCZA 4B3SL 4A3IG 1KQSA 5C44H 3I2ZA 1VQ9A 3RLOA 1Y14B 1YHAA 4O0AA 3CPWA 4IOAA 2JEAI 4LFAQ 4R4OA 2NZHA 3FHWA 4A3EH 4AH6A 1EOVA 5EAYA 5LMNW 2YTVA 4LF4Q 4LF5Q 1XPRA 3TQYA 1X65A 2IX0A 3K0XA 1D8LA 1VQMA 1UE6A 1PH2A 1WCMH 5GAEC 2E2IH 1YVCA 2N3SA 3W1BA 5IYCH 2ZTDA 3GTGH 2VNUD 4P72A 4JI7L 1YIJA 4JC0A 1NMGA 1VQAA 5IWAL 1MKHA 2K5HA 2K5VA 5LMNQ 2MQHA 3CMEA 1XNQQ 1SRUA 1X3FA 5IY0A 1QUQB 3AYHB 4DR6L 1KXLA 4K0KQ 3EIVA 2UXDQ 4QIWE 2CWAA 3L0OA 4XIGS 5E7NA 3T1HQ 1CSQA 3KF6B 1IBLQ 4DR4Q 2UUAQ 4P71A 1HZ9A 1FGUA 2R93H 4LFBL 1TXYA 4WJ4A 1KHIA 2D0PA 2Q2IA 2JA6H 1OXUA 2YTYA 3H15A 3CCQA 1N33L 1L1OA 4AQYL 4A3FG 1FVIA 5IYDH 1K9MC 1YJNA 1N34L 2IHFA 3OYYA 2KENA 3GDEA 3J7A5 4DUZQ 1K83H 1CSPA 3UE0A 1VCIA 1HZBA 2IY5B 2E2HH 4LW1A 4PZ8A 4LF7L 4JCVE 3PCOB 1L1OC 3LGJA 3U50C 4DR3Q 4POGA 1NTGA 3ULPA 1LM0A 1YITA 5GAGC 4YHHQ 4X66L 3M4QA 2JE6I 1U0LA 1Q1BA 4R4TA 4JI5L 3CMAA 4DR2Q 1P8LA 2MNAA 3VDYA 2GVAA 2R7DA 4GNXB 4GOPB 1XMOL 2UXBL 1VQNA 2AKWB 5C0XI 2OQ0A 2VQEQ 2HT1A 4GLVB 4UY8C 4DV5Q 3OTOQ 1KL9A 3W5OA 4DUYQ 3OW2A 1VQPA 4LF4L 5BR8L 1AE2A 2N49A 4A3FH 4YY3L 1Q82C 4A75A 1C0AA 1VQGA 3GTJH 1I3QH 3NBHB 1NMFA 4A3BG 4MNOA 4DNIA 1WFQA 2RF4A 3M7NA 1SFOH 4B3SQ 4YWMA 4IFDJ 1KIXA 1IBML 4A3JG 3BZCA 4JG2A 4A3DG 1UE1A 1XNQL 5IP7H 1QUQA 4JV5Q 2KHIA 5GADC 2A8VA 4DV4Q 5M3FH 1EIYB 2B63G 2UXDL 4KHZA 1IBLL 3KOJA 2MFIA 2Q2TA 1FJGL 3RLNA 2CQOA 3KF6A 4GN5A 2IX1A 1B8AA 1UE5A 3KJPA 4QY7A 2UU9L 3S17H 4R4IA 4KI0A 3J81j 3M4OH 2E2JH 1A63A 3PF5A 1JE5A 4L5RC 2XGTA 1I5FA 1VQHA 4JI4L 1KC8C 2VZAA 2R92G 3PIOA 4BY1G 1Q86C 3CC7A 1VQIA 5IWAQ 4DR5Q 4AIMA 2Z0SA 4C2MH 4HIKA 1KD1C 1C9OA 3A74A 5C44G 1J5EL 2GN5A 1PHJA 4DR6Q 4A3JH 4A3DH 2K14A 4BBRG 4DR3L 3CCSA 3CCRA 3S1RH 3KFUA 4LFBQ 4HJ7A 1YEZA 3E9HA 1VQDA 4DR2L 1YJ9A 1D7QA 2ZJPA 2QA4A 4Y7NH 3I4OA 1GM5A 3J81i 4GOPA 4GNXA 3G6EA 2B29A 3KYHC 1YNXA 3B6YA 1IXRA 1VQOA 1N34Q 5JEAJ 5IYCG 4UP9A 3UDGA 4A76A 3HOVG 2A19A 1PH4A 2ZJQA 2AWNA 1M1KC 2AMCB 1PH3A 4GN3B 3PUYA 5C4JH 2VQFL 2B3GA 2N78A 4BY1H 4DV3L 3S16H 1VQLA 3ZJYC 2R7FA 3F8TA 4X62L 4HJAA 3AFPA 1I50H 4LF7Q 3CCEA 4L5QA 1Z9FA 1YBYA 2HIVA 1TWAH 4X66Q 3F2DA 4JI5Q 1OXSC 4BBRH 4X6AH 1GVPA 3J80i 1S40A 2UUCL 2NN6G 4JV5L 2R93G 4DV4L 1EUJA 1XMOQ 2UXBQ 1NBWA 2JA6G 1IZ6A 1A0IA 1PFSA 2K4KA 3KDFB 3M9BA 3I4MG 2YTXA 4DAMA
chains in the Genus database with same CATH superfamily
1ZYRD 3A56A 2MP1A 5BR8Q 4OONA 4B3RL 3CRKC 2Y0SG 3MFYA 3GD7A 5AFWA 4C2MB 3N52A 4DXFA 2A6HD 4A3BB 1TS5A 2OT2A 2PO4A 4JI8L 1EWCA 3CHBD 4LF9L 4DR5L 1BQQT 2FJ2A 1D5XC 4DK6C 3A5ZB 2H1EA 2I5HA 2CW0D 2F52A 1TWFH 4ZKCB 2X6GA 2TMPA 4QB4A 1HFNA 2UU9Q 1X6OA 1E1OA 2E74C 3I3CA 3KLRA 1CKOA 4FF1A 2RDFA 1PYSB 2KQ3A 2R61A 3S16B 5FK9C 3DMUA 3H6MA 2N8NA 2BA1A 3J81E 3CPFA 4NB3A 3MWYW 1LTTD 1J5EQ 2ZM6L 2Q8TA 2I5MX 2OCEA 2Z9HA 5M3FG 3FPUB 4JBMA 1X54A 1JR0D 3FKIG 1SYEA 5CYUA 4UP8A 4JBJA 2AQ2B 3CC2A 4A3KG 3J80E 3KBGA 2K5NA 4F7XA 2F0WA 2F4VL 1J8IA 2VQFQ 1Y8OB 1SAPA 3JAMi 3R93A 1CK1A 3M4PA 1RIPA 4OL7A 3SR1A 1SROA 4J1MA 4DV1L 3EVQA 1VQCA 1WOCA 1GUTA 3GTMH 2M00A 4ZUJA 3I8ZA 3DXJC 2PQAA 2D0OA 1K8AC 5JPNC 3FKIH 3OW7A 3DHQA 4IURA 3SK8A 1EYCA 4RFBA 4A3KH 4NW2A 4JI6Q 3PUVA 3VR2A 3GTQH 1OXXK 5J3BA 4HJ8A 3JAML 5DM73 2I0QA 4N8FA 4HIOA 1MIUA 2IT1A 3P1HA 4AYBB 3BJUA 2L1BA 1SLJA 1HZAA 3PQIA 2R7ZH 4B3ML 1ET9A 4NP5A 3AEVA 1CHQD 4CDCC 1BKBA 2EYLA 1XMQQ 2NVYH 5JEAG 4Y52H 2B2VC 1PA6A 1EYDA 5EPJA 3HOUG 4NDXA 1ZXTA 4X3KA 1V1OA 1O7IA 4A3CH 1N36Q 2B2YC 2B8GA 1BCPC 1HNZL 3MC0B 1OTCA 1O7ZA 2B2TC 4UHVA 4GOPC 1XJVA 5J39A 1CZWA 1GO3E 2IWHA 4WORA 3DM3A 4OWWB 4I7AA 1EQQA 2DJGC 3FRPB 1SEBD 4X64L 1N32L 4C1NI 4I65A 1CQFA 1GJXA 3AB9A 1E24A 1IL8A 2Z6KC 4RCNA 4C1NK 4MTNA 5JEAH 4YWKA 3L3OC 3NQTA 4RMFA 1K73C 3BVMA 1EY8A 2SOBA 1WJJA 4L5TA 3T4AC 1G6PA 4XT1B 1NE3A 4HIDA 2NUCA 3E0JA 4DN4M 1CKMA 5CORA 3D8GA 4IUQA 1W2BA 4HJ9A 1PH1A 3TRZA 4G7OC 1HNWL 1HCZA 1PFBA 2JJQA 2ID0A 5JJIA 3H0GH 4JOIA 2K6AA 1BO0A 3N6RA 4BA2I 4P75A 4HSVA 2JA5G 5CV5A 1W3SA 4TVAB 3LWEA 2JP1A 3NQIA 3V96A 4MN3A 1FL0A 3RZDH 4Z9CB 4OX9L 1JB7A 1RCVD 2QEJC 1NJIC 5ELBA 4BXXG 3CXCA 4LF6Q 1C4QA 1YI2A 1H95A 1ENCA 4B9WA 3CQZH 4B08A 4OGQC 1LT4D 4ALPA 3C2PA 2F0JA 4HTHA 5IGGA 1LT5D 4A3MB 1R4QB 4BY7G 1BBWA 4DKAC 1TWGH 1O7LA 2JA5H 4L6TB 1VQEA 2XNAC 4RHSA 1IBKL 2IHEA 1M4VA 2M2LA 4UPAA 1BR9A 2ICEC 3PUWA 4O2DA 1AW7A 1QJOA 4CJ2C 3ER0A 4GKJL 2NVXH 1LABA 1S4ZA 4DR1L 3F2BA 2D9UA 4IPDA 5DLQE 4NXNQ 3U4ZA 1Y69U 3S1QB 2NVQB 3H3VH 2A1AA 1SYBA 2DY7A 2WB1G 2AWOA 4HIMA 1IW7D 5LMNL 3ICEA 1SMXA 2C9OA 2QCPX 4K0KL 3T1HL 3DM1A 3NTKA 2UUAL 1PMRA 1F2ZA 4YCUA 5CR3A 2P5ZX 5HGQA 2YU9H 2JQOA 4YCWA 4JI7Q 4FXKC 3HOZG 1HNXQ 4N9PA 4DUZL 1EWIA 4LUOA 4CJ0B 3IRBA 1BDOA 1MSGA 2Y0SE 4QJFA 4IUNA 4ZAIA 4EQ5A 1PYBA 3HOXB 2B63H 2F0QA 2EDGA 3MZ5A 1Q7YC 2RDHA 1N33Q 3CCMA 1LYLA 1VQFA 3A55A 3NENA 1Y1WB 3HOWB 2PNRC 3CF5A 4IO9A 1YHQA 4DV5L 3KLSX 4CDDC 1XNRL 1SYGA 4Q0FA 3D4WA 2R92H 3K81C 4FNFA 2BH2A 3K7AH 1Q90A 1YZ6A 4FO2A 2NVTB 4LUVA 4A3GG 2J0TD 1JOKA 2EY6A 5I9OA 3K58A 3DUZA 4O0AA 3FHWA 1B4OA 1EU4A 1BXTA 1EU3A 3F2UA 3MXGA 5EAYA 4XXEA 1EY0A 2IX0A 2E2IH 1D8LA 1UNSA 1VQMA 5GAEC 4DFAA 2N3SA 2ZTDA 1D1KA 2ZXRA 2F3WA 1YIJA 4K14A 1NMGA 1NNXA 2K5VA 3CMEA 1EZ8A 4ZK9B 4UAIA 2RQXA 3CRLC 4ZRZA 2EOTA 4IOAA 1CSQA 3KF6B 3OOCA 4WJ4A 2D0PA 1OXUA 3RZOB 3H15A 2JXMB 3CCQA 2DJFC 1A2UA 1S5CD 4AQYL 3GQBA 5FO7B 2QKIC 1N34L 1F2YA 2QF7A 3GDEA 3A7LA 4BBSB 4G57A 2EVBA 1HFGA 4XDXA 2PZUA 2K5DA 3S9WA 5KGUA 1JOQA 1Q8IA 3ITPA 1KAAA 3M7GA 3GTLB 4DR3Q 1VDZA 1NTGA 1YITA 4A3EB 4YHHQ 5D3IB 3CMAA 1P8LA 1WCMB 5CBAE 3GTGB 2AKWB 3OIPA 5C0XI 4GLVB 1SNPA 2NBFA 1KL9A 4G7HC 5EJWA 1AE2A 4RKLA 4YY3L 1SNMA 1VQGA 2LKVA 1I3QH 3NBHB 1NMFA 1B9MA 3IAYA 4A3IB 2AUJD 3M7NA 4YWMA 3E3XA 4JG2A 3NSWA 2XVSA 1DYQA 1AZPA 4HCSA 2UXDL 3NHHA 4KHZA 4CKEA 5HURA 1B53A 1GUGA 5I2XA 4G7ZC 4C3HG 2WINB 3M4OH 4L5RC 4JI4L 1VQHA 5IODA 1BF4A 3CC7A 1STAA 1VQIA 1IYVA 5IWAQ 4DR5Q 1VMCA 5IGCA 4HIKA 2TSSA 4O42A 4H13C 3A74A 5C44G 2GN5A 5JVG3 2LFNA 1EFID 5EGTA 2K33A 1G91A 3L9AX 3KFUA 1GHKA 3VYRA 4DR2L 1FGBD 2QA4A 1GM5A 4A3FB 5CV9A 1A3VA 3G6EA 3KYHC 1Z7TA 3S14B 1IXRA 1VQOA 3HOVG 5IYCG 1PH4A 1SYDA 2AMCB 1Z6HA 4GN3B 4OELB 2B3GA 2N78A 3QB3A 1HA5A 1JC7A 4QUCA 3CCEA 1YBYA 3URYA 2HIVA 3IFDA 1OO9B 4X66Q 2K04A 3JAME 3F2DA 1EWHA 1SNOA 3OMCA 3FPPA 1A2TA 4M8AA 3ONAB 1GVPA 2UUCL 1EUJA 2MHVA 1AEXA 1IZ6A 1MHWC 1G6ZA 1PLFA 2YTXA 5IYDG 3CCVA 3CW2C 2SNMA 4IUUA 2F4VQ 4QIWB 2C35B 3HOVH 2A74C 1QZHA 5IT9E 3EN2A 4DU9A 4GZYC 1JWMD 1VQ7A 5GAHC 3I55A 4A3JB 2JK8A 4A3DB 2JEBI 3GV3A 1E1TA 3NEMA 3S1RB 3RN5A 2HHHL 4LF8L 4X65L 2K03A 3OPOA 5C4XG 1I4PA 2EYMA 4PZ7A 4C3IG 1IYJB 3LWUA 1VQKA 4MHEA 5D65A 3E9IA 2KEDA 3I56A 4A3LH 3PIPA 3KLWA 1PTOB 1JT8A 4B3TL 1QG7A 2PQEA 2EJFC 1TWAB 1STYA 3SK5A 2F03A 3PIP3 1BOSA 1HQMC 2WP8J 5IP7G 4DV2L 4ID6A 2AUKA 1SXTA 2WFWA 3D4DA 5ISRA 3BYTB 4RGTA 4Q5VA 3A5UA 2RHSB 3CKIB 3HZXA 1JE4A 3EBEA 2KA7A 3U9OA 5C4XH 1B3QA 1PYWD 3KDFA 4C3IH 2F0UA 1B9NA 4TSSA 5A2QE 3SDZA 1QILA 2D62A 4E6IA 2RHQB 4DV3Q 2EXZA 3K0YA 5CV7A 4X62Q 1VQ4A 1MJEA 2G5DA 4P73A 1LO5D 1AE3A 1J6QA 3GTOH 3SEBA 4GLAC 3F1ZA 2R93B 1UEBA 4J8QA 1AZQA 2JA6B 5GQOA 2BE5C 2NN6I 5IGEA 4DNRB 1IKLA 2F0EA 2YV5A 2A68C 4K2LA 4RGNA 1X3EA 2Y0SB 2UXCL 4NPSA 1K8GA 3J7YW 3DLLA 1H9MA 1S5DD 3A0JA 2EYHA 1O80A 1K3RA 1YHBA 4QL5A 4EX5A 2FFKB 4JI3Q 5H1SE 2NZOA 4G4KA 1KDAA 2WACA 1KRTA 2B2VA 4R8NA 3GTKH 4KHPL 1K8MA 3Q0AA 2B2YA 2K7VA 4JI2L 5I2YA 4P74A 4JI0Q 4PMBA 2B8FA 3NPPA 3EROA 2SNSA 3OMGA 1SSOA 4DA2A 1JJ2A 3PUXA 2VUMG 1QVFA 1AFPA 2O2LD 2F0FA 1TWCH 2N55A 2Z6KA 5M3FB 4JI1Q 3FMCA 1X3PA 1PZID 2VB3X 5BN3A 5K36H 1MI2A 1E3PA 2E76C 3FKIB 3MXPA 4R4QA 4DXGA 2EQSA 3S17B 3V05A 5IOCA 2E2JB 3C46A 4JBWA 1I4QA 3I4NH 1SE8A 4A3KB 1HRJA 3MEHA 4J6HA 3SK6A 3K59A 3KF8B 3JC66 3S1NH 1BNZA 2ASBA 2LMCB 3FEWX 3HS0C 2VUMH 3J7ZC 4DV0Q 4IFDI 3T1YL 2SEBD 1IBKQ 1BCPD 3DWAA 3STBC 1A62A 3U9SA 4DV6L 3J81c 4LFCQ 1EIFA 3PF4A 4Y7NB 1HR0Q 1I4RA 2K01A 4GKKL 5IP9H 5ELCA 5C0XH 1M90C 3S1MB 4IPCA 4GKJQ 1LTBD 3CC4A 5LL6S 4DR1Q 1S3OA 3ND8A 3E5SA 1U4RA 5C4JB 2RCFA 3SVMA 3HOYG 2F4IA 3BG3A 1SNDA 1DJRD 3J80c 4QGUA 2RA4A 3P20A 2XIWA 1QVGA 4JYAL 1SYFA 3NELA 3CD6A 3CP0A 3PO2G 3X3MA 5NUCA 1GXDC 2F0GA 1G51A 5CBEE 1O7YA 5CC4A 3LNNA 2E2DC 1YNJC 3ERSX 4KV6A 5M5YB 3HOUB 1QB5D 2KCMA 3BU2A 4NXMQ 2EYFA 3HOYH 1C8CA 3GTPB 3VYSA 1X55A 2MO0A 4FDBA 2BOSA 1GUOA 5LMUQ 1H9KA 5G3LD 4LFAL 1KLUD 3K5LA 4FXGC 2PNHA 3ND9A 2R7ZG 3AU7A 3RNUA 3PO2H 5M9OA 1G2TA 4V0BA 1WYDA 5GROA 4QQBX 2LXJA 2BA0A 1XNRQ 5M5XH 3M3YH 2H5XA 2CWPA 1SR3A 2N88A 2F0SA 3M4YA 1F9PA 4OWXB 1QZGA 1S72A 4A3CG 1CHPD 1KLGD 2ATWA 1KNEA 1C7YA 1BVSA 5FLXL 5AJ3L 4KY7A 2OTLA 4DR4L 1SNQA 2IJ0A 1SJED 1K28A 4DR7L 4U673 1RL2A 3EFXD 4PZ6A 2EY5A 3T51B 5KYLA 2FMCA 1VQ5A 2VY3A 1KNAA 2A6EC 3GV6A 3VA5A 1TWGB 4OIJA 4OWTB 4ZKBB 1MJCA 1RD9D 4A3BH 5T1GA 4EQPA 1WTWA 2Q8IB 1PRTD 1LTLA 1JCKB 2L15A 3NUCA 2HQLA 1B2TA 3HKZG 4RG1A 2WAQG 4RH6A 4AQYQ 1ZEQX 1I6HB 2E5LQ 2VQEL 1ENFA 3OTOL 4DUYL 3H0GG 1EQVA 1EQTA 2WKCA 1DM0B 3EQLC 1L0XB 2LSSA 5FKAC 4A93B 4BY7B 5EBCA 4OO1I 1HR0W 3NXWA 3NTIA 1FNUA 1PXUA 2CW0C 4B3SL 1TR5A 1KQSA 1YHAA 3CPWA 4FF3A 3SK4A 3GP7A 4DK0A 1EY9A 2XRSD 3RUZA 4EQNA 5CV8A 3QJYA 1EOVA 3R3OA 5I9PA 5LMNW 1HPCA 2D5DA 4LF5Q 5G3LF 1X65A 3K0XA 1A3UA 5KRUA 2VNUD 2ZXPA 1HQRD 2WB1B 3MA2B 5A35A 1VQAA 2JSOA 2XWBB 1I4HA 2MQHA 5BN5A 5M5WB 4DR6L 2UXDQ 1ESRA 4QIWE 5E7NA 4FXDA 4C56C 1PDQA 2F0HA 5I6WA 3QOJA 4LFBL 3MVVA 1TXYA 2Q2IA 2YTYA 4V190 2QDLA 5JOBA 3HOZB 1FVIA 1K9MC 4IALA 1YJNA 2IHFA 3OYYA 4HMIA 2KVMA 1CSPA 3MFGA 2B2UA 2G9DA 3C1FA 3G7LA 4ILWA 5C4HA 1VCIA 2IY5B 3TZDA 1D2BA 4LF7L 4JCVE 3U50C 1LM0A 4CBVA 5E4WC 4JI5L 4DR2Q 2BDOA 3VDYA 4DGZA 4GNXB 3OWEB 2E2IB 1XMOL 1PRTF 1LACA 2HT1A 3FDTA 1KTKA 1SDFA 3OW2A 1EY6A 5BR8L 1HXYD 2N49A 1E2ZA 1PZJD 4EVOA 1Q82C 3ZYYX 1RTOA 4BS9A 4A3GB 1H9SB 4MNOA 1UE1A 1XNQL 5IGDA 4KN4C 2B63G 3VR5A 3TBIB 2MFIA 3A54A 3KF6A 4GN5A 1DONA 2IX1A 1B8AA 3KJPA 2UU9L 4R4IA 4KI0A 2R92G 1KC8C 1Q86C 4BY1G 1TY2A 3WDNA 4IFDH 1J5EL 1PHJA 3TSSA 4UDUC 2F0PA 2K14A 1SJHD 4BBRG 4X3UA 2CH4W 3CCRA 3QOLA 4LJZC 1WTPA 2KOLA 1YJ9A 1D7QA 2EYJA 3I4OA 3KUPA 1ENAA 3J81i 1YNXA 1YNNC 1D1IA 4A76A 1SE4A 5IIFA 2ZJQA 1M1KC 2VQFL 4BY1H 2FMMA 2LY7A 3AFPA 4L5QA 4FF2A 4TRDA 4KMUC 4BBRH 4X6AH 3J80i 1QWYA 2UXBQ 1NBWA 5JJZA 3M4OB 1DD2A 1A0IA 3I4MG 3KBXA 5DAUA 4DAMA 4OEMB 1A8VA 3J81L 2Q8RE 1VS0A 2OEOA 2Z1CA 5C3EG 3HG9A 1LTID 4JI6L 1OXVA 4ABNA 3RLFA 4BWGB 1K8OA 1H9JA 1Y1VG 5IYBH 1IBMQ 4LWCA 1X9NA 2I5LX 1PH6A 4IUVA 1CKNB 3M85A 1FJGQ 4IZ8A 4R9WA 1S5FD 3J80L 4C3HB 3I4MH 2UXCQ 2KCTA 2OQKA 1JJGA 1XMQL 3QO2A 3NWTA 1NR4A 5ELOA 1SN8A 4TKOB 3DEPA 2H4OA 5C3EH 2NVQH 2CKZB 4IOCA 3T53B 3I7FA 5C44B 2L9HA 4KTAA 3EJIA 3BDLA 1HA6A 1Y1VH 3CCUA 1N36L 3F2CA 1A15A 4A4IA 5FLMH 2Z4IA 2DUDA 5KIXA 1OXTA 2YYZA 1IYUA 3HKSA 2B2UC 3KK7A 4QCLA 4N9TA 2MO1A 2QDBA 4KY5A 1FNWA 4CJ1B 3S15H 4S3SA 4DAPA 1LV9A 5JAVA 3H09A 1J9OA 4I7ZC 2ZT9C 5C6AA 3S2DH 1CUKA 1RDPD 3PUZA 2O5JC 2K52A 1B7YB 1Z47A 4L5SA 3I72A 4X3TA 3P75A 4H0LC 3BZDB 1Q3LA 5FJ8H 2BH8A 4EGVA 2EPBA 3BVZA 4B3RQ 4CKBA 1Y1WH 1I94L 4DK3C 1KDBA 1BBUA 3SGIA 4JI8Q 5EPKA 4OO1H 1Q8KA 5F2DA 5C4ZA 4LF9Q 4C3JG 1V43A 1HUMA 2ZTCA 3T1YQ 5M3MG 4IPHA 2K28A 3TS0A 4LMQD 5EKLA 1Y8PB 2MPMA 5HY6A 1A3TA 1EIGA 1GOZA 3Q8DA 5CGKA 1V1PB 1ICWA 5C4XB 3EA6A 2BE5D 4JVZA 3TN2A 4C3IB 1XPOA 2ALYB 5EKIA 1WTVA 1GD7A 4UP7A 3CAMA 3UDXA 1STGA 2CVRA 2MUYA 4LF6L 1T9HA 3GTJB 1SE2A 1EYGA 4TQUS 1PV4A 2Q2UA 1SFOB 3K80C 3I73A 3GTOB 1R9TH 4C3JH 1ML0D 2DNEA 3GO5A 4XYQA 3J7AV 3AQQA 4DV7L 5IT9c 2L55A 2ZM6Q 2O5IC 5M3MH 1MGSA 1TY0A 4IPGA 1CZGA 3Q23A 3FVQA 4KKTA 2VW9A 5FLXE 3A8KE 5C0XJ 5I6YA 2DNCA 2NB0A 1LUZA 4HEDA 1ILPA 2K05A 3RZOH 5COYA 1LT6D 3TREA 3D0FA 3A8IE 4NXNL 1DOLA 4A3LG 3D6CA 1XXGA 2E8GA 4XTCS 3PO3G 2ZXOA 1XTCD 4BBSH 5E1FA 1JWUD 1B44D 4K5XA 1WTXA 1TKWB 4DV1Q 3GTKB 3GTLH 1D5ZC 1U4LA 1HTLD 4FP5D 2RSOA 3S2HH 2JA8G 4KKSA 1UWVA 1TWHH 1CA5A 3Q24A 2PZTA 2KHJA 3MTSA 2PMZE 4F87A 1KRSA 1XX8A 2EXDA 1K3BC 2EJGC 1E7ZA 1CT1D 4CDEC 3L2PA 1HNXL 4WRDA 1HJPA 1I50B 1TQOA 1ET6A 4YWLA 3PO3H 1F2MA 1QNUA 4XYOA 3K5MA 2VB2X 5AJ3Q 4A3IH 3IKJA 2J7ZA 2EE1A 2UUBL 2AQ1B 1E22A 3STBD 4APVA 2KJXA 5KNCA 1WTRA 2WB1E 2JA9A 3MXNB 5E3FA 4DR7Q 1RJTA 4B3MQ 1UUPA 2A69C 2RCNA 1G2SA 2JA8H 2LS01 4KHVA 5FOBB 4KKUA 3S1NB 2ES2A 1X32A 4DAYA 5IE8A 1ASZA 1NR2A 3NP8A 2VUMB 3DWQA 5KNBA 3TS2A 4ME3A 3KF8A 1QCBD 2JA7G 5EKKA 1QNKA 1A6XA 1HNZQ 3IFTA 2EYOA 1TWFB 5K5PA 4IUPA 3OHXC 2DGYA 1N32Q 3WWVA 4X64Q 3T13A 4LUZA 2RVLA 1K0RA 2F3IA 4P2CB 2XTIA 4IJHA 4HJ5A 1YNJD 1GHJA 3S14H 1STNA 4KJOA 4KD3A 4XQNA 3HGBA 2L12A 1L2FA 2JA7H 4OXPA 3P7JA 2F0OA 2L11A 5K36G 1HH2P 3ULLA 2CHBD 1M8AA 3U4VA 4PG3A 5TSSA 4F88A 1HNWQ 4K2KA 3I4NG 3ULJA 3G48A 1VQ6A 1PTOC 3HOYB 2F0KA 1EEFD 4O1NA 4DPGA 1PH7A 1V1QA 4K8JA 3AMUA 3W2DA 3MEFA 4XT3B 1EY5A 3PO2B 1QE6A 3GTMB 2EY2A 1EYAA 4YHHL 4OX9Q 4K6LA 5IP9G 4WJ3M 1L1OB 5ELFA 3M3YB 5M5XB 5C0XG 1VMPA 3UE1A 1VQJA 2NWGA 2V1CC 3TEHB 1V9PA 1X3GA 3GTQB 5J1ZA 3H3VI 2A6ED 1W6JA 4RCOA 2VL6A 4L8JA 1DXMA 4FVMA 2KCNA 1PTOH 2K5WA 2CCZA 1JORA 3I2ZA 4ULLA 1JICA 4OHJA 1Y14B 3K57A 3QIAA 2R7ZB 2EZVA 2NZHA 3DWPA 1II3A 1LTRD 4HMJA 1EY4A 4AH6A 2YTVA 1K0SA 1L0YB 3O13A 2NVYB 1IKMA 1UE6A 4CHTB 1PH2A 1YVCA 5IGFA 4ZUIA 1TT2A 4P72A 5CMDA 4JC0A 3RMHA 5IWAL 1MKHA 2L4NA 5LMNQ 1XNQQ 5C5MA 1QUQB 2HD3A 1RHPA 1KXLA 3QR8A 4K0KQ 2CWAA 3T1HQ 1LLRD 1F77A 3HRZC 2UUAQ 4P71A 1HZ9A 2R93H 1DOKA 2JA6H 3E6ZX 2F0NA 5JVH3 4H44C 1TS3A 3MXUA 4DUZQ 1K83H 4KN7C 3R2TA 2X6LA 2HUGA 3UE0A 5BN4A 1HZBA 2PW7A 1ONLA 2E2HH 4PZ8A 3D4RA 1L1OC 2M9VA 4POGA 2Z6BA 1SMYC 4PNYA 5GAGC 3HKZB 4X66L 3M4QA 4L63B 2JE6I 1U0LA 2WAQB 1V8QA 4R4TA 1BCPB 2MNAA 3QWNA 2GA4B 2R7DA 4GOPB 3HP3A 2NTSA 2F0TA 3SXHA 3H0GB 4DV5Q 4UY8C 4RAUC 4CGYB 1VQPA 4LF4L 1S5ED 2JN4A 4A3BG 2FINB 1I4XA 2RF4A 4DNIA 4IFDJ 3BZCA 3RZDB 4LAAA 3T16A 1NAPA 2KHIA 2A8VA 5M3FH 1EIYB 1IBLL 5LL6X 3RLNA 2CQOA 3V2TA 3G6JB 1UE5A 2ICIA 1BCPF 1JOOA 4PQXA 3A8JE 3CQZB 5C5LA 3S17H 3J81j 1A63A 2E2JH 1TU2B 1I5FA 4DK1A 2VZAA 1RODA 4F8MA 1TVXA 1CFMA 2JA5B 4AIMA 2Z0SA 4C2MH 1WVLA 1UAPA 1U9RA 1SYCA 1DOMA 4X3SA 2IW3A 3LX0A 3PMFA 3IL8A 3CU7A 4HJ7A 1YEZA 4QF4A 1E0BA 2ZJPA 4Y7NH 2CQAA 3MAQA 2NVXB 1ZYRC 2I46A 5IT9L 4GNXA 3S1MH 1N34Q 4UP9A 3UDGA 1STHA 2A19A 2A6HC 3UI2A 2AWNA 1E2VA 5EPLA 3BS1A 1PH3A 2IPKD 5C4JH 3S16H 3I91A 4DV3L 1AN8A 4X62L 2R7FA 3F8TA 5D14A 4HJAA 3SE0A 4HN7A 2PMZB 1H9SA 1X3QA 3WOEA 4YIJA 1OXSC 1S40A 4JV5L 2NN6G 2X69A 4DV4L 2RSNA 2YU9B 5KYIA 2XWJB 1PFSA 1T5EA 4K5WA 3VA7A 4H7BA 4YY3Q 1MSHA 1G8ZD 3A7AB 3BZKA 5M5YH 1YNND 2CFMA 3HOUH 3J7AF 1D5MC 1YJWA 4DNTB 3NBIA 4RHRA 1DGSA 3GTPH 4QUFA 4JI3L 1QOHA 5DM63 3CCJA 2B63B 3T56B 1PRTB 2PQAB 3H94A 3K7UC 4AYBG 1GKHA 2NN6H 4B9XA 3PGZA 4EQOA 5A2QL 4POFA 1I94Q 1P16A 1PFMA 3BDOA 3Q22A 2R92B 5JJLA 4H02A 4MTKA 4BY1B 3K7AB 2PCFB 4JI4Q 4FF4A 4JI0L 4RGMA 1VF7A 5ELNA 3KJOA 1Q81C 2PI2E 1JQYD 2KECA 3TP7A 1AH9A 2F3VA 3NE5B 2DN8A 2FXQA 4BBRB 1Q12A 5EQ0A 3L7ZC 4JI1L 3K5NA 2HIXA 3R8BA 2F0MA 4HCEA 4KLKA 5FO9B 3H3VC 4CDFC 4ZLTF 2Q2HA 5FO8B 1KDCA 1PFNA 1F9RA 5T1IA 3TDQA 1U4MA 1CTMA 4JW0A 1JJCB 5IGBA 1XWEA 2K1BA 1NSNS 5JPMC 3PV0A 3UDIA 4A93G 1PH8A 1KABA 4DV7Q 3TP8A 1SNCA 4IFDG 3ERQA 1L0WA 4DV0L 2MJ8A 1WTHA 1RF2D 1XYIA 3VR6A 4LFCL 2UUCQ 3TZUA 5C3WA 1U5KA 1HR0L 3I4MB 4KD4A 3KLSA 5C3XA 1CKNA 3S24A 4BA1I 4GN4B 4BXXH 2ENBA 5ELDA 2AHOB 1I6HH 5C3EB 1WI5A 2A5HA 3RN2A 1Y1VB 4JPBW 2I07B 4A93H 4BY7H 1PRTC 3U58A 2O4XA 2HQEA 2PZWA 2HHHQ 3X3NA 4LF8Q 1H9RA 3FP9A 2BCOA 4X65Q 1NY4A 2F0IA 5JJKA 1MD2D 2WIIB 4PV1C 1CA6A 3S15B 1XPUA 2VS1A 1F9QA 3S2DB 1I3QB 2CH4A 1PVOA 4NXML 1EZ6A 4B3TQ 2LXKA 4CKCA 2KUMA 5IYBG 2KHSA 3NBHA 4A3MG 4MZ9A 2AQ3B 3QG1A 2K5QA 2OXPA 3RR5A 1VQBA 4GNXC 4DV2Q 2UUBQ 4NKLA 4R1JA 2R6GA 5M5WH 5LMUL 1B70B 2MGSA 1UE7A 2V4DA 1HUNA 1RKNA 4KK7A 1Q46A 3BDCA 2ZJRA 3HOZH 1HHVA 3UDFA 1X56A 1JWSD 3D6WA 4YCVA 4XQJA 2WV6D 3PSIA 1TIID 4A3MH 1ASYA 1G291 5FLMG 2ZTEA 3D31A 3AFQA 3K6OA 3HFZB 1V1PA 1EIHA 1IL2A 4DF7A 5KNDA 1WD1A 3CCLA 1O78A 3W1GA 4KY6A 4R4CA 4C3JB 1R9TB 1CM9A 4QMGA 3S1QH 2A73B 2IL8A 5M3MB 4A3GH 1EQRA 2EY1A 5ELEA 1N8RC 4JOIC 4FYDA 2XSCA 2J4XA 3D3RA 1N9WA 4N8X1 5EBDA 4KHPQ 1I4GA 2L5TA 5FJ8G 3HOXG 2C5CA 3VYUA 1E2WA 4JI2Q 4IJLA 2E5LL 1F2LA 4PMWA 3K8AA 1Y1WG 1SBBB 2SDFA 3C3LA 3HOWG 3HOVB 2XN9C 4NMZA 4ZYSA 3K5OA 3I70A 4JK1C 2FHTA 2Z8LA 3TMEA 4OO1G 1VQ8A 1XTDA 1IW7C 2NZ1D 2RKSA 2EJMA 4K5VA 3S2HB 2OTJA 1F9SA 1NUCA 3OIQA 2KBNA 1TWHB 4ZCKA 4DAVA 2K50A 1Y8NB 3HOXH 2PI2A 1PH9A 2A69D 1CQVA 3WOFA 4LF5L 4JBKA 3NWSA 3HOWH 3PO3B 2HDLA 3HKZE 1LTGD 4RWSC 2PYKA 1DCZA 2G9HD 2WAQE 2XRQD 1FNVA 1EFWA 3OSOA 1WTQA 1TS2A 1GUNA 1QVCA 1RTNA 2GVBA 4RGOS 3E0EA 2NVTH 4DV6Q 4IN3A 2JA8B 4GKKQ 2HCCA 3MXNA 3JAMc 4J15A 2OF1A 2A68D 3BVGA 3H91A 3DEOA 5FLXc 5DNFA 1UEAB 2K75A 2QGQA 2QEXA 4BBSG 5D3DA 2KCCA 3NTHA 1JB3A 4OIKA 1KAWA 2QILA 4LNQA 1LTSD 4JYAQ 4K6DA 2OWOA 4A3EG 2B2WA 1Q1EA 1FR3A 3I90A 4GLXA 1T5XD 2EIFA 3TP5A 1WCMG 2F0LA 4C3HH 1BUVT 4GS3A 1LTAD 1U4PA 1W6KA 4AYBE 1ZKOA 1JMCA 1PTOD 1D6EC 1ICFB 3Q6SA 1STEA 2EYPA 3C1EA 3HEJA 1HZCA 3G4SA 2JA7B 3G71A 3RD4A 2BDNA 1PH5A 4A3IG 1GUSA 5L37A 5C44H 5J22A 2RDGA 1VQ9A 4ME5A 3RLOA 4LK1C 4R8IA 4IUTA 2JEAI 4LFAQ 4R4OA 1CI3M 2D2CC 2L0CA 4HR7B 4A3EH 2B39A 4LF4Q 1EL0A 1XPRA 3TQYA 1WCMH 3GTGH 3W1BA 5IYCH 4JI7L 4WFN3 1TWCB 3TP6A 2K5HA 1STBA 1SRUA 1X3FA 5IY0A 3AYHB 3R2IA 3EIVA 4XIGS 3L0OA 1IBLQ 4HSPA 4DR4Q 4KJNA 1FGUA 4RA8A 1KHIA 3I4NB 1N33L 4PMCA 1L1OA 5HGTA 5E4XA 4A3FG 5IYDH 2PPBC 1ILQA 4MIUA 2K32A 2KENA 1B50A 3J7A5 4K8IA 1SE3A 3W3AA 1EOTA 2F0DA 2HDMA 4LW1A 2WKDA 2PW5A 3PCOB 3LGJA 5CV4A 1FYCA 3ULPA 3I4LA 4RKBA 1Q1BA 1FD7D 2GVAA 1HTPA 4XQQA 2UXBL 5LHY1 1VF5C 2VQEQ 1VQNA 2OQ0A 1AP0A 3OTOQ 3W5OA 4DUYQ 4WJWA 4A3FH 5CV6A 4A75A 1C0AA 3SHLA 3GTJH 1WD0A 1ESFA 2VXWA 1IHZA 1WFQA 1SFOH 4B3SQ 5KEEA 1PTOF 1KIXA 4A3JG 1IBML 2IX3A 1NCVA 4A3DG 4M1UB 3MHBA 5DEHA 4U68A 2Z4HA 3VR3A 5IP7H 1QUQA 4JV5Q 5GADC 4DV4Q 1SMYD 2KEEA 3KOJA 2Q2TA 1FJGL 2DY8A 2NYZD 4IQZA 1S5BD 2RBMA 4QY7A 1K83B 2JYOA 3PF5A 1JE5A 2R3ZA 2XGTA 3PIOA 2E2HB 4HAEA 1PZKD 1B3AA 1I6VC 3OWFA 1KD1C 1C9OA 3PIO3 1TS4A 4DR6Q 4A3JH 3VYTA 4A3DH 1EEID 4DR3L 4ODGA 3CCSA 1WTOA 3S1RH 4LFBQ 3E9HA 1VQDA 3VR4A 2F0VA 2B2TA 4GOPA 2B29A 1C48A 3BYYB 3B6YA 5JEAJ 2E75C 2NTTA 1BBXC 1DZ1A 1EY7A 3PUYA 1B1ZA 1VQLA 2F1MA 3ZJYC 2B2WC 1I50H 2HCIA 4LF7Q 4ZQ3A 2QW7A 1Z9FA 1MBYA 1TWAH 3NK9A 4JI5Q 2R93G 1XMOQ 2JA6G 3KDFB 1LT3D 2K4KA 1R4PB 3M9BA 4DAYB 5I4DA 1GUWA
chains in the Genus database with same CATH topology
5IYDG 1A8VA 5BR8Q 4OONA 3CCVA 4B3RL 3CW2C 2F4VQ 4YY3Q 1VS0A 2Y0SG 2C35B 3GD7A 3HOVH 3BZKA 5M5YH 2CFMA 5C3EG 1QZHA 3HOUH 3EN2A 4JI8L 4JI6L 1YJWA 1OXVA 1VQ7A 5GAHC 3I55A 3RLFA 4LF9L 4DR5L 2JK8A 2JEBI 1Y1VG 5IYBH 1E1TA 1IBMQ 1DGSA 3NEMA 3GTPH 4LWCA 1X9NA 4JI3L 4DK6C 3A5ZB 2I5HA 3CCJA 3RN5A 2HHHL 4LF8L 2F52A 2I5LX 4X65L 1PH6A 1TWFH 1CKNB 2PQAB 3K7UC 4AYBG 3M85A 1FJGQ 1GKHA 3PGZA 5C4XG 4POFA 1I94Q 2UU9Q 4PZ7A 1P16A 1X6OA 3I4MH 1E1OA 2UXCQ 2KCTA 2OQKA 1CKOA 5JJLA 1IYJB 4H02A 1PYSB 1VQKA 1JJGA 4JI4Q 4JI0L 1XMQL 3E9IA 5ELOA 1SN8A 3I56A 5ELNA 3PIPA 3KJOA 2N8NA 3KLWA 5C3EH 1Q81C 2PI2E 2NVQH 4A3LH 2CKZB 4IOCA 2BA1A 3I7FA 4B3TL 1AH9A 1JT8A 3CPFA 4NB3A 1J5EQ 2FXQA 1Y1VH 3CCUA 1N36L 1Q12A 2ZM6L 2WP8J 3F2CA 2I5MX 3L7ZC 5IP7G 4DV2L 2OCEA 4JI1L 2HIXA 4A4IA 5FLMH 5M3FG 4JBMA 2WFWA 2DUDA 4KLKA 1X54A 1OXTA 3A5UA 2RHSB 2YYZA 2Q2HA 3EBEA 3HKSA 3FKIG 5C4XH 2MO1A 4UP8A 4JBJA 3KDFA 1JJCB 3CC2A 4C3IH 4A3KG 3S15H 2K5NA 2F4VL 2VQFQ 3PV0A 2D62A 3JAMi 2RHQB 3UDIA 4DV3Q 4A93G 3S2DH 1CUKA 4X62Q 1VQ4A 1PH8A 1MJEA 4P73A 4DV7Q 3M4PA 3PUZA 1AE3A 2K52A 4IFDG 1RIPA 1J6QA 1L0WA 1B7YB 4DV0L 1Z47A 4L5SA 1SROA 4DV1L 3GTOH 4GLAC 3F1ZA 1UEBA 1VQCA 4LFCL 1WOCA 2UUCQ 5GQOA 1U5KA 1HR0L 2NN6I 3GTMH 5FJ8H 1CKNA 2PQAA 2BH8A 2YV5A 2D0OA 4GN4B 3S24A 4BA1I 1K8AC 4BXXH 3FKIH 1X3EA 4B3RQ 2AHOB 1Y1WH 1I6HH 1I94L 4DK3C 2UXCL 1BBUA 4NPSA 3SGIA 1K8GA 3DLLA 4A3KH 3A0JA 1WI5A 4JI8Q 4JI6Q 3PUVA 1K3RA 1YHBA 1OXXK 1Q8KA 4QL5A 3RN2A 4EX5A 4LF9Q 3GTQH 1V43A 5J3BA 4HJ8A 2ZTCA 4A93H 4BY7H 3U58A 3T1YQ 4JI3Q 5M3MG 4IPHA 5H1SE 2NZOA 3TS0A 2HHHQ 2I0QA 4LF8Q 4HIOA 1MIUA 3FP9A 1KRTA 5HY6A 4X65Q 2IT1A 1NY4A 3BJUA 3Q8DA 1SLJA 3GTKH 4KHPL 1HZAA 5JJKA 2R7ZH 4B3ML 1XPOA 2ALYB 1XPUA 3AEVA 4JI2L 1BKBA 1GD7A 3CAMA 4UP7A 3UDXA 4P74A 2VS1A 4LF6L 4JI0Q 1T9HA 1XMQQ 2NVYH 5JEAG 4Y52H 1PA6A 1EYGA 3HOUG 1PVOA 4NXML 4TQUS 1PV4A 2Q2UA 1JJ2A 4B3TQ 3PUXA 3K80C 2VUMG 2LXKA 1QVFA 5IYBG 4C3JH 1R9TH 3GO5A 1O7IA 4A3CH 3AQQA 1TWCH 4DV7L 5IT9c 4MZ9A 4A3MG 1N36Q 2ZM6Q 1HNZL 1OTCA 3RR5A 2Z6KA 4GNXC 1VQBA 5M3MH 4DV2Q 4GOPC 4JI1Q 1XJVA 2UUBQ 4R1JA 1GO3E 2R6GA 4IPGA 5M5WH 3DM3A 5LMUL 1B70B 2VW9A 4OWWB 1E3PA 4R4QA 1UE7A 1EQQA 5C0XJ 2EQSA 1N32L 1LUZA 4X64L 4JBWA 3I4NH 1SE8A 3RZOH 1E24A 1Q46A 2ZJRA 2Z6KC 3TREA 3HOZH 3D0FA 4NXNL 4MTNA 3KF8B 3UDFA 3JC66 4A3LG 4YWKA 4XTCS 2E8GA 3PO3G 3S1NH 1X56A 2ASBA 4RMFA 4YCVA 1K73C 4BBSH 2VUMH 3PSIA 3J7ZC 1WJJA 4L5TA 1G6PA 4DV0Q 4IFDI 4DV1Q 1NE3A 3T1YL 1IBKQ 4A3MH 1ASYA 1G291 4HIDA 3STBC 1A62A 3GTLH 4DV6L 5FLMG 3J81c 2ZTEA 1CKMA 3D31A 4LFCQ 1EIFA 3AFQA 1W2BA 3PF4A 3S2HH 3HFZB 1HR0Q 4HJ9A 1PH1A 4GKKL 5IP9H 2JA8G 1UWVA 1TWHH 1M90C 3TRZA 4IPCA 2KHJA 4GKJQ 2PMZE 1HNWL 1IL2A 1KRSA 3CC4A 4DR1Q 1S3OA 2EXDA 2JJQA 2ID0A 3CCLA 5JJIA 1E7ZA 3H0GH 3W1GA 4JOIA 3L2PA 1HNXL 4R4CA 3HOYG 4BA2I 1HJPA 4P75A 4YWLA 3PO3H 3S1QH 3J80c 2JA5G 4QGUA 1W3SA 4A3GH 1EQRA 4TVAB 5AJ3Q 4A3IH 1QVGA 4JYAL 1N8RC 3NELA 1FL0A 3RZDH 2UUBL 1E22A 4JOIC 3STBD 4APVA 3CD6A 3CP0A 1JB7A 2WB1E 2JA9A 3MXNB 1N9WA 4OX9L 3PO2G 4DR7Q 4KHPQ 4B3MQ 5FJ8G 3HOXG 1NJIC 2RCNA 2JA8H 4BXXG 1G51A 4JI2Q 4IJLA 2E5LL 4PMWA 3CXCA 3K8AA 1Y1WG 4LF6Q 3ERSX 3HOWG 1YI2A 1H95A 2ES2A 2KCMA 3CQZH 5IE8A 1ASZA 3BU2A 4NXMQ 4ALPA 4OO1G 1VQ8A 3HOYH 3TS2A 1XTDA 4ME3A 4BY7G 1BBWA 2JA7G 4DKAC 1TWGH 1X55A 1HNZQ 2JA5H 2MO0A 4FDBA 2OTJA 1VQEA 1IBKL 2KBNA 5LMUQ 2IHEA 4DAYB 4UPAA 4LFAL 2K50A 2DGYA 2PNHA 2R7ZG 3RNUA 3PO2H 3PUWA 1N32Q 4O2DA 3WWVA 4X64Q 4LUZA 1WYDA 5GROA 2PI2A 1K0RA 3HOXH 1PH9A 3ER0A 4QQBX 2LXJA 4LF5L 2F3IA 4JBKA 2BA0A 2NVXH 5M5XH 1XNRQ 2XTIA 2H5XA 3M3YH 4GKJL 4IJHA 4HJ5A 2CWPA 4DR1L 3F2BA 4IPDA 5DLQE 4NXNQ 3HOWH 3HKZE 3U4ZA 1SR3A 3S14H 3H3VH 2WAQE 4OWXB 1EFWA 2A1AA 2WB1G 2AWOA 4HIMA 1QVCA 1QZGA 2GVBA 1S72A 3E0EA 4A3CG 5LMNL 3ICEA 1L2FA 2ATWA 2JA7H 1SMXA 4OXPA 1C7YA 2NVTH 1BVSA 5AJ3L 4DV6Q 4K0KL 2OTLA 5K36G 3T1HL 4DR4L 4GKKQ 1HH2P 3S1MH 2UUAL 3ULLA 4YCUA 3U4VA 4DR7L 4PG3A 1RL2A 4PZ6A 1HNWQ 3JAMc 5HGQA 4J15A 3I4NG 2YU9H 2JQOA 4YCWA 3ULJA 3G48A 1VQ5A 1VQ6A 5FLXc 4JI7Q 2VY3A 3HOZG 1HNXQ 4DPGA 1PH7A 4DUZL 1V1QA 2K75A 2QGQA 1EWIA 4LUOA 4OWTB 2QEXA 4BBSG 1MJCA 4A3BH 3IRBA 4QJFA 2Y0SE 1KAWA 3MEFA 4LNQA 4JYAQ 1LTLA 2L15A 4EQ5A 4YHHL 2OWOA 1PYBA 2HQLA 4A3EG 4OX9Q 2B63H 3HKZG 5IP9G 1Q1EA 4RG1A 1Q7YC 1N33Q 1L1OB 2WAQG 3CCMA 4WJ3M 1LYLA 5C0XG 1VQFA 4GLXA 3NENA 3UE1A 4AQYQ 2E5LQ 2EIFA 1VQJA 2VQEL 2V1CC 3CF5A 4IO9A 1WCMG 1YHQA 3TEHB 1V9PA 4C3HH 4DV5L 3OTOL 4DUYL 1X3GA 3H0GG 4GS3A 1JMCA 4AYBE 1XNRL 2R92H 3K81C 3H3VI 2LSSA 3K7AH 2BH2A 1HZCA 1YZ6A 3G4SA 4OO1I 2VL6A 3G71A 1HR0W 4LUVA 4A3GG 1PH5A 2CCZA 4B3SL 4A3IG 1KQSA 5C44H 3I2ZA 1VQ9A 3RLOA 1Y14B 1YHAA 4O0AA 3CPWA 4IOAA 2JEAI 4LFAQ 4R4OA 2NZHA 3FHWA 4A3EH 4AH6A 1EOVA 5EAYA 5LMNW 2YTVA 4LF4Q 4LF5Q 1XPRA 3TQYA 1X65A 2IX0A 3K0XA 1D8LA 1VQMA 1UE6A 1PH2A 1WCMH 5GAEC 2E2IH 1YVCA 2N3SA 3W1BA 5IYCH 2ZTDA 3GTGH 2VNUD 4P72A 4JI7L 1YIJA 4JC0A 1NMGA 1VQAA 5IWAL 1MKHA 2K5HA 2K5VA 5LMNQ 2MQHA 3CMEA 1XNQQ 1SRUA 1X3FA 5IY0A 1QUQB 3AYHB 4DR6L 1KXLA 4K0KQ 3EIVA 2UXDQ 4QIWE 2CWAA 3L0OA 4XIGS 5E7NA 3T1HQ 1CSQA 3KF6B 1IBLQ 4DR4Q 2UUAQ 4P71A 1HZ9A 1FGUA 2R93H 4LFBL 1TXYA 4WJ4A 1KHIA 2D0PA 2Q2IA 2JA6H 1OXUA 2YTYA 3H15A 3CCQA 1N33L 1L1OA 4AQYL 4A3FG 1FVIA 5IYDH 1K9MC 1YJNA 1N34L 2IHFA 3OYYA 2KENA 3GDEA 3J7A5 4DUZQ 1K83H 1CSPA 3UE0A 1VCIA 1HZBA 2IY5B 2E2HH 4LW1A 4PZ8A 4LF7L 4JCVE 3PCOB 1L1OC 3LGJA 3U50C 4DR3Q 4POGA 1NTGA 3ULPA 1LM0A 1YITA 5GAGC 4YHHQ 4X66L 3M4QA 2JE6I 1U0LA 1Q1BA 4R4TA 4JI5L 3CMAA 4DR2Q 1P8LA 2MNAA 3VDYA 2GVAA 2R7DA 4GNXB 4GOPB 1XMOL 2UXBL 1VQNA 2AKWB 5C0XI 2OQ0A 2VQEQ 2HT1A 4GLVB 4UY8C 4DV5Q 3OTOQ 1KL9A 3W5OA 4DUYQ 3OW2A 1VQPA 4LF4L 5BR8L 1AE2A 2N49A 4A3FH 4YY3L 1Q82C 4A75A 1C0AA 1VQGA 3GTJH 1I3QH 3NBHB 1NMFA 4A3BG 4MNOA 4DNIA 1WFQA 2RF4A 3M7NA 1SFOH 4B3SQ 4YWMA 4IFDJ 1KIXA 1IBML 4A3JG 3BZCA 4JG2A 4A3DG 1UE1A 1XNQL 5IP7H 1QUQA 4JV5Q 2KHIA 5GADC 2A8VA 4DV4Q 5M3FH 1EIYB 2B63G 2UXDL 4KHZA 1IBLL 3KOJA 2MFIA 2Q2TA 1FJGL 3RLNA 2CQOA 3KF6A 4GN5A 2IX1A 1B8AA 1UE5A 3KJPA 4QY7A 2UU9L 3S17H 4R4IA 4KI0A 3J81j 3M4OH 2E2JH 1A63A 3PF5A 1JE5A 4L5RC 2XGTA 1I5FA 1VQHA 4JI4L 1KC8C 2VZAA 2R92G 3PIOA 4BY1G 1Q86C 3CC7A 1VQIA 5IWAQ 4DR5Q 4AIMA 2Z0SA 4C2MH 4HIKA 1KD1C 1C9OA 3A74A 5C44G 1J5EL 2GN5A 1PHJA 4DR6Q 4A3JH 4A3DH 2K14A 4BBRG 4DR3L 3CCSA 3CCRA 3S1RH 3KFUA 4LFBQ 4HJ7A 1YEZA 3E9HA 1VQDA 4DR2L 1YJ9A 1D7QA 2ZJPA 2QA4A 4Y7NH 3I4OA 1GM5A 3J81i 4GOPA 4GNXA 3G6EA 2B29A 3KYHC 1YNXA 3B6YA 1IXRA 1VQOA 1N34Q 5JEAJ 5IYCG 4UP9A 3UDGA 4A76A 3HOVG 2A19A 1PH4A 2ZJQA 2AWNA 1M1KC 2AMCB 1PH3A 4GN3B 3PUYA 5C4JH 2VQFL 2B3GA 2N78A 4BY1H 4DV3L 3S16H 1VQLA 3ZJYC 2R7FA 3F8TA 4X62L 4HJAA 3AFPA 1I50H 4LF7Q 3CCEA 4L5QA 1Z9FA 1YBYA 2HIVA 1TWAH 4X66Q 3F2DA 4JI5Q 1OXSC 4BBRH 4X6AH 1GVPA 3J80i 1S40A 2UUCL 2NN6G 4JV5L 2R93G 4DV4L 1EUJA 1XMOQ 2UXBQ 1NBWA 2JA6G 1IZ6A 1A0IA 1PFSA 2K4KA 3KDFB 3M9BA 3I4MG 2YTXA 4DAMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IYD G;  1A8V A;  5BR8 Q;  4OON A;  3CCV A;  4B3R L;  3CW2 C;  2F4V Q;  4YY3 Q;  1VS0 A;  2Y0S G;  2C35 B;  3GD7 A;  3HOV H;  3BZK A;  5M5Y H;  2CFM A;  5C3E G;  1QZH A;  3HOU H;  3EN2 A;  4JI8 L;  4JI6 L;  1YJW A;  1OXV A;  1VQ7 A;  5GAH C;  3I55 A;  3RLF A;  4LF9 L;  4DR5 L;  2JK8 A;  2JEB I;  1Y1V G;  5IYB H;  1E1T A;  1IBM Q;  1DGS A;  3NEM A;  3GTP H;  4LWC A;  1X9N A;  4JI3 L;  4DK6 C;  3A5Z B;  2I5H A;  3CCJ A;  3RN5 A;  2HHH L;  4LF8 L;  2F52 A;  2I5L X;  4X65 L;  1PH6 A;  1TWF H;  1CKN B;  2PQA B;  3K7U C;  4AYB G;  3M85 A;  1FJG Q;  1GKH A;  3PGZ A;  5C4X G;  4POF A;  1I94 Q;  2UU9 Q;  4PZ7 A;  1P16 A;  1X6O A;  3I4M H;  1E1O A;  2UXC Q;  2KCT A;  2OQK A;  1CKO A;  5JJL A;  1IYJ B;  4H02 A;  1PYS B;  1VQK A;  1JJG A;  4JI4 Q;  4JI0 L;  1XMQ L;  3E9I A;  5ELO A;  1SN8 A;  3I56 A;  5ELN A;  3PIP A;  3KJO A;  2N8N A;  3KLW A;  5C3E H;  1Q81 C;  2PI2 E;  2NVQ H;  4A3L H;  2CKZ B;  4IOC A;  2BA1 A;  3I7F A;  4B3T L;  1AH9 A;  1JT8 A;  3CPF A;  4NB3 A;  1J5E Q;  2FXQ A;  1Y1V H;  3CCU A;  1N36 L;  1Q12 A;  2ZM6 L;  2WP8 J;  3F2C A;  2I5M X;  3L7Z C;  5IP7 G;  4DV2 L;  2OCE A;  4JI1 L;  2HIX A;  4A4I A;  5FLM H;  5M3F G;  4JBM A;  2WFW A;  2DUD A;  4KLK A;  1X54 A;  1OXT A;  3A5U A;  2RHS B;  2YYZ A;  2Q2H A;  3EBE A;  3HKS A;  3FKI G;  5C4X H;  2MO1 A;  4UP8 A;  4JBJ A;  3KDF A;  1JJC B;  3CC2 A;  4C3I H;  4A3K G;  3S15 H;  2K5N A;  2F4V L;  2VQF Q;  3PV0 A;  2D62 A;  3JAM i;  2RHQ B;  3UDI A;  4DV3 Q;  4A93 G;  3S2D H;  1CUK A;  4X62 Q;  1VQ4 A;  1PH8 A;  1MJE A;  4P73 A;  4DV7 Q;  3M4P A;  3PUZ A;  1AE3 A;  2K52 A;  4IFD G;  1RIP A;  1J6Q A;  1L0W A;  1B7Y B;  4DV0 L;  1Z47 A;  4L5S A;  1SRO A;  4DV1 L;  3GTO H;  4GLA C;  3F1Z A;  1UEB A;  1VQC A;  4LFC L;  1WOC A;  2UUC Q;  5GQO A;  1U5K A;  1HR0 L;  2NN6 I;  3GTM H;  5FJ8 H;  1CKN A;  2PQA A;  2BH8 A;  2YV5 A;  2D0O A;  4GN4 B;  3S24 A;  4BA1 I;  1K8A C;  4BXX H;  3FKI H;  1X3E A;  4B3R Q;  2AHO B;  1Y1W H;  1I6H H;  1I94 L;  4DK3 C;  2UXC L;  1BBU A;  4NPS A;  3SGI A;  1K8G A;  3DLL A;  4A3K H;  3A0J A;  1WI5 A;  4JI8 Q;  4JI6 Q;  3PUV A;  1K3R A;  1YHB A;  1OXX K;  1Q8K A;  4QL5 A;  3RN2 A;  4EX5 A;  4LF9 Q;  3GTQ H;  1V43 A;  5J3B A;  4HJ8 A;  2ZTC A;  4A93 H;  4BY7 H;  3U58 A;  3T1Y Q;  4JI3 Q;  5M3M G;  4IPH A;  5H1S E;  2NZO A;  3TS0 A;  2HHH Q;  2I0Q A;  4LF8 Q;  4HIO A;  1MIU A;  3FP9 A;  1KRT A;  5HY6 A;  4X65 Q;  2IT1 A;  1NY4 A;  3BJU A;  3Q8D A;  1SLJ A;  3GTK H;  4KHP L;  1HZA A;  5JJK A;  2R7Z H;  4B3M L;  1XPO A;  2ALY B;  1XPU A;  3AEV A;  4JI2 L;  1BKB A;  1GD7 A;  3CAM A;  4UP7 A;  3UDX A;  4P74 A;  2VS1 A;  4LF6 L;  4JI0 Q;  1T9H A;  1XMQ Q;  2NVY H;  5JEA G;  4Y52 H;  1PA6 A;  1EYG A;  3HOU G;  1PVO A;  4NXM L;  4TQU S;  1PV4 A;  2Q2U A;  1JJ2 A;  4B3T Q;  3PUX A;  3K80 C;  2VUM G;  2LXK A;  1QVF A;  5IYB G;  4C3J H;  1R9T H;  3GO5 A;  1O7I A;  4A3C H;  3AQQ A;  1TWC H;  4DV7 L;  5IT9 c;  4MZ9 A;  4A3M G;  1N36 Q;  2ZM6 Q;  1HNZ L;  1OTC A;  3RR5 A;  2Z6K A;  4GNX C;  1VQB A;  5M3M H;  4DV2 Q;  4GOP C;  4JI1 Q;  1XJV A;  2UUB Q;  4R1J A;  1GO3 E;  2R6G A;  4IPG A;  5M5W H;  3DM3 A;  5LMU L;  1B70 B;  2VW9 A;  4OWW B;  1E3P A;  4R4Q A;  1UE7 A;  1EQQ A;  5C0X J;  2EQS A;  1N32 L;  1LUZ A;  4X64 L;  4JBW A;  3I4N H;  1SE8 A;  3RZO H;  1E24 A;  1Q46 A;  2ZJR A;  2Z6K C;  3TRE A;  3HOZ H;  3D0F A;  4NXN L;  4MTN A;  3KF8 B;  3UDF A;  3JC6 6;  4A3L G;  4YWK A;  4XTC S;  2E8G A;  3PO3 G;  3S1N H;  1X56 A;  2ASB A;  4RMF A;  4YCV A;  1K73 C;  4BBS H;  2VUM H;  3PSI A;  3J7Z C;  1WJJ A;  4L5T A;  1G6P A;  4DV0 Q;  4IFD I;  4DV1 Q;  1NE3 A;  3T1Y L;  1IBK Q;  4A3M H;  1ASY A;  1G29 1;  4HID A;  3STB C;  1A62 A;  3GTL H;  4DV6 L;  5FLM G;  3J81 c;  2ZTE A;  1CKM A;  3D31 A;  4LFC Q;  1EIF A;  3AFQ A;  1W2B A;  3PF4 A;  3S2H H;  3HFZ B;  1HR0 Q;  4HJ9 A;  1PH1 A;  4GKK L;  5IP9 H;  2JA8 G;  1UWV A;  1TWH H;  1M90 C;  3TRZ A;  4IPC A;  2KHJ A;  4GKJ Q;  2PMZ E;  1HNW L;  1IL2 A;  1KRS A;  3CC4 A;  4DR1 Q;  1S3O A;  2EXD A;  2JJQ A;  2ID0 A;  3CCL A;  5JJI A;  1E7Z A;  3H0G H;  3W1G A;  4JOI A;  3L2P A;  1HNX L;  4R4C A;  3HOY G;  4BA2 I;  1HJP A;  4P75 A;  4YWL A;  3PO3 H;  3S1Q H;  3J80 c;  2JA5 G;  4QGU A;  1W3S A;  4A3G H;  1EQR A;  4TVA B;  5AJ3 Q;  4A3I H;  1QVG A;  4JYA L;  1N8R C;  3NEL A;  1FL0 A;  3RZD H;  2UUB L;  1E22 A;  4JOI C;  3STB D;  4APV A;  3CD6 A;  3CP0 A;  1JB7 A;  2WB1 E;  2JA9 A;  3MXN B;  1N9W A;  4OX9 L;  3PO2 G;  4DR7 Q;  4KHP Q;  4B3M Q;  5FJ8 G;  3HOX G;  1NJI C;  2RCN A;  2JA8 H;  4BXX G;  1G51 A;  4JI2 Q;  4IJL A;  2E5L L;  4PMW A;  3CXC A;  3K8A A;  1Y1W G;  4LF6 Q;  3ERS X;  3HOW G;  1YI2 A;  1H95 A;  2ES2 A;  2KCM A;  3CQZ H;  5IE8 A;  1ASZ A;  3BU2 A;  4NXM Q;  4ALP A;  4OO1 G;  1VQ8 A;  3HOY H;  3TS2 A;  1XTD A;  4ME3 A;  4BY7 G;  1BBW A;  2JA7 G;  4DKA C;  1TWG H;  1X55 A;  1HNZ Q;  2JA5 H;  2MO0 A;  4FDB A;  2OTJ A;  1VQE A;  1IBK L;  2KBN A;  5LMU Q;  2IHE A;  4DAY B;  4UPA A;  4LFA L;  2K50 A;  2DGY A;  2PNH A;  2R7Z G;  3RNU A;  3PO2 H;  3PUW A;  1N32 Q;  4O2D A;  3WWV A;  4X64 Q;  4LUZ A;  1WYD A;  5GRO A;  2PI2 A;  1K0R A;  3HOX H;  1PH9 A;  3ER0 A;  4QQB X;  2LXJ A;  4LF5 L;  2F3I A;  4JBK A;  2BA0 A;  2NVX H;  5M5X H;  1XNR Q;  2XTI A;  2H5X A;  3M3Y H;  4GKJ L;  4IJH A;  4HJ5 A;  2CWP A;  4DR1 L;  3F2B A;  4IPD A;  5DLQ E;  4NXN Q;  3HOW H;  3HKZ E;  3U4Z A;  1SR3 A;  3S14 H;  3H3V H;  2WAQ E;  4OWX B;  1EFW A;  2A1A A;  2WB1 G;  2AWO A;  4HIM A;  1QVC A;  1QZG A;  2GVB A;  1S72 A;  3E0E A;  4A3C G;  5LMN L;  3ICE A;  1L2F A;  2ATW A;  2JA7 H;  1SMX A;  4OXP A;  1C7Y A;  2NVT H;  1BVS A;  5AJ3 L;  4DV6 Q;  4K0K L;  2OTL A;  5K36 G;  3T1H L;  4DR4 L;  4GKK Q;  1HH2 P;  3S1M H;  2UUA L;  3ULL A;  4YCU A;  3U4V A;  4DR7 L;  4PG3 A;  1RL2 A;  4PZ6 A;  1HNW Q;  3JAM c;  5HGQ A;  4J15 A;  3I4N G;  2YU9 H;  2JQO A;  4YCW A;  3ULJ A;  3G48 A;  1VQ5 A;  1VQ6 A;  5FLX c;  4JI7 Q;  2VY3 A;  3HOZ G;  1HNX Q;  4DPG A;  1PH7 A;  4DUZ L;  1V1Q A;  2K75 A;  2QGQ A;  1EWI A;  4LUO A;  4OWT B;  2QEX A;  4BBS G;  1MJC A;  4A3B H;  3IRB A;  4QJF A;  2Y0S E;  1KAW A;  3MEF A;  4LNQ A;  4JYA Q;  1LTL A;  2L15 A;  4EQ5 A;  4YHH L;  2OWO A;  1PYB A;  2HQL A;  4A3E G;  4OX9 Q;  2B63 H;  3HKZ G;  5IP9 G;  1Q1E A;  4RG1 A;  1Q7Y C;  1N33 Q;  1L1O B;  2WAQ G;  3CCM A;  4WJ3 M;  1LYL A;  5C0X G;  1VQF A;  4GLX A;  3NEN A;  3UE1 A;  4AQY Q;  2E5L Q;  2EIF A;  1VQJ A;  2VQE L;  2V1C C;  3CF5 A;  4IO9 A;  1WCM G;  1YHQ A;  3TEH B;  1V9P A;  4C3H H;  4DV5 L;  3OTO L;  4DUY L;  1X3G A;  3H0G G;  4GS3 A;  1JMC A;  4AYB E;  1XNR L;  2R92 H;  3K81 C;  3H3V I;  2LSS A;  3K7A H;  2BH2 A;  1HZC A;  1YZ6 A;  3G4S A;  4OO1 I;  2VL6 A;  3G71 A;  1HR0 W;  4LUV A;  4A3G G;  1PH5 A;  2CCZ A;  4B3S L;  4A3I G;  1KQS A;  5C44 H;  3I2Z A;  1VQ9 A;  3RLO A;  1Y14 B;  1YHA A;  4O0A A;  3CPW A;  4IOA A;  2JEA I;  4LFA Q;  4R4O A;  2NZH A;  3FHW A;  4A3E H;  4AH6 A;  1EOV A;  5EAY A;  5LMN W;  2YTV A;  4LF4 Q;  4LF5 Q;  1XPR A;  3TQY A;  1X65 A;  2IX0 A;  3K0X A;  1D8L A;  1VQM A;  1UE6 A;  1PH2 A;  1WCM H;  5GAE C;  2E2I H;  1YVC A;  2N3S A;  3W1B A;  5IYC H;  2ZTD A;  3GTG H;  2VNU D;  4P72 A;  4JI7 L;  1YIJ A;  4JC0 A;  1NMG A;  1VQA A;  5IWA L;  1MKH A;  2K5H A;  2K5V A;  5LMN Q;  2MQH A;  3CME A;  1XNQ Q;  1SRU A;  1X3F A;  5IY0 A;  1QUQ B;  3AYH B;  4DR6 L;  1KXL A;  4K0K Q;  3EIV A;  2UXD Q;  4QIW E;  2CWA A;  3L0O A;  4XIG S;  5E7N A;  3T1H Q;  1CSQ A;  3KF6 B;  1IBL Q;  4DR4 Q;  2UUA Q;  4P71 A;  1HZ9 A;  1FGU A;  2R93 H;  4LFB L;  1TXY A;  4WJ4 A;  1KHI A;  2D0P A;  2Q2I A;  2JA6 H;  1OXU A;  2YTY A;  3H15 A;  3CCQ A;  1N33 L;  1L1O A;  4AQY L;  4A3F G;  1FVI A;  5IYD H;  1K9M C;  1YJN A;  1N34 L;  2IHF A;  3OYY A;  2KEN A;  3GDE A;  3J7A 5;  4DUZ Q;  1K83 H;  1CSP A;  3UE0 A;  1VCI A;  1HZB A;  2IY5 B;  2E2H H;  4LW1 A;  4PZ8 A;  4LF7 L;  4JCV E;  3PCO B;  1L1O C;  3LGJ A;  3U50 C;  4DR3 Q;  4POG A;  1NTG A;  3ULP A;  1LM0 A;  1YIT A;  5GAG C;  4YHH Q;  4X66 L;  3M4Q A;  2JE6 I;  1U0L A;  1Q1B A;  4R4T A;  4JI5 L;  3CMA A;  4DR2 Q;  1P8L A;  2MNA A;  3VDY A;  2GVA A;  2R7D A;  4GNX B;  4GOP B;  1XMO L;  2UXB L;  1VQN A;  2AKW B;  5C0X I;  2OQ0 A;  2VQE Q;  2HT1 A;  4GLV B;  4UY8 C;  4DV5 Q;  3OTO Q;  1KL9 A;  3W5O A;  4DUY Q;  3OW2 A;  1VQP A;  4LF4 L;  5BR8 L;  1AE2 A;  2N49 A;  4A3F H;  4YY3 L;  1Q82 C;  4A75 A;  1C0A A;  1VQG A;  3GTJ H;  1I3Q H;  3NBH B;  1NMF A;  4A3B G;  4MNO A;  4DNI A;  1WFQ A;  2RF4 A;  3M7N A;  1SFO H;  4B3S Q;  4YWM A;  4IFD J;  1KIX A;  1IBM L;  4A3J G;  3BZC A;  4JG2 A;  4A3D G;  1UE1 A;  1XNQ L;  5IP7 H;  1QUQ A;  4JV5 Q;  2KHI A;  5GAD C;  2A8V A;  4DV4 Q;  5M3F H;  1EIY B;  2B63 G;  2UXD L;  4KHZ A;  1IBL L;  3KOJ A;  2MFI A;  2Q2T A;  1FJG L;  3RLN A;  2CQO A;  3KF6 A;  4GN5 A;  2IX1 A;  1B8A A;  1UE5 A;  3KJP A;  4QY7 A;  2UU9 L;  3S17 H;  4R4I A;  4KI0 A;  3J81 j;  3M4O H;  2E2J H;  1A63 A;  3PF5 A;  1JE5 A;  4L5R C;  2XGT A;  1I5F A;  1VQH A;  4JI4 L;  1KC8 C;  2VZA A;  2R92 G;  3PIO A;  4BY1 G;  1Q86 C;  3CC7 A;  1VQI A;  5IWA Q;  4DR5 Q;  4AIM A;  2Z0S A;  4C2M H;  4HIK A;  1KD1 C;  1C9O A;  3A74 A;  5C44 G;  1J5E L;  2GN5 A;  1PHJ A;  4DR6 Q;  4A3J H;  4A3D H;  2K14 A;  4BBR G;  4DR3 L;  3CCS A;  3CCR A;  3S1R H;  3KFU A;  4LFB Q;  4HJ7 A;  1YEZ A;  3E9H A;  1VQD A;  4DR2 L;  1YJ9 A;  1D7Q A;  2ZJP A;  2QA4 A;  4Y7N H;  3I4O A;  1GM5 A;  3J81 i;  4GOP A;  4GNX A;  3G6E A;  2B29 A;  3KYH C;  1YNX A;  3B6Y A;  1IXR A;  1VQO A;  1N34 Q;  5JEA J;  5IYC G;  4UP9 A;  3UDG A;  4A76 A;  3HOV G;  2A19 A;  1PH4 A;  2ZJQ A;  2AWN A;  1M1K C;  2AMC B;  1PH3 A;  4GN3 B;  3PUY A;  5C4J H;  2VQF L;  2B3G A;  2N78 A;  4BY1 H;  4DV3 L;  3S16 H;  1VQL A;  3ZJY C;  2R7F A;  3F8T A;  4X62 L;  4HJA A;  3AFP A;  1I50 H;  4LF7 Q;  3CCE A;  4L5Q A;  1Z9F A;  1YBY A;  2HIV A;  1TWA H;  4X66 Q;  3F2D A;  4JI5 Q;  1OXS C;  4BBR H;  4X6A H;  1GVP A;  3J80 i;  1S40 A;  2UUC L;  2NN6 G;  4JV5 L;  2R93 G;  4DV4 L;  1EUJ A;  1XMO Q;  2UXB Q;  1NBW A;  2JA6 G;  1IZ6 A;  1A0I A;  1PFS A;  2K4K A;  3KDF B;  3M9B A;  3I4M G;  2YTX A;  4DAM A; 
#chains in the Genus database with same CATH topology
 1ZYR D;  3A56 A;  2MP1 A;  5BR8 Q;  4OON A;  4B3R L;  3CRK C;  2Y0S G;  3MFY A;  3GD7 A;  5AFW A;  4C2M B;  3N52 A;  4DXF A;  2A6H D;  4A3B B;  1TS5 A;  2OT2 A;  2PO4 A;  4JI8 L;  1EWC A;  3CHB D;  4LF9 L;  4DR5 L;  1BQQ T;  2FJ2 A;  1D5X C;  4DK6 C;  3A5Z B;  2H1E A;  2I5H A;  2CW0 D;  2F52 A;  1TWF H;  4ZKC B;  2X6G A;  2TMP A;  4QB4 A;  1HFN A;  2UU9 Q;  1X6O A;  1E1O A;  2E74 C;  3I3C A;  3KLR A;  1CKO A;  4FF1 A;  2RDF A;  1PYS B;  2KQ3 A;  2R61 A;  3S16 B;  5FK9 C;  3DMU A;  3H6M A;  2N8N A;  2BA1 A;  3J81 E;  3CPF A;  4NB3 A;  3MWY W;  1LTT D;  1J5E Q;  2ZM6 L;  2Q8T A;  2I5M X;  2OCE A;  2Z9H A;  5M3F G;  3FPU B;  4JBM A;  1X54 A;  1JR0 D;  3FKI G;  1SYE A;  5CYU A;  4UP8 A;  4JBJ A;  2AQ2 B;  3CC2 A;  4A3K G;  3J80 E;  3KBG A;  2K5N A;  4F7X A;  2F0W A;  2F4V L;  1J8I A;  2VQF Q;  1Y8O B;  1SAP A;  3JAM i;  3R93 A;  1CK1 A;  3M4P A;  1RIP A;  4OL7 A;  3SR1 A;  1SRO A;  4J1M A;  4DV1 L;  3EVQ A;  1VQC A;  1WOC A;  1GUT A;  3GTM H;  2M00 A;  4ZUJ A;  3I8Z A;  3DXJ C;  2PQA A;  2D0O A;  1K8A C;  5JPN C;  3FKI H;  3OW7 A;  3DHQ A;  4IUR A;  3SK8 A;  1EYC A;  4RFB A;  4A3K H;  4NW2 A;  4JI6 Q;  3PUV A;  3VR2 A;  3GTQ H;  1OXX K;  5J3B A;  4HJ8 A;  3JAM L;  5DM7 3;  2I0Q A;  4N8F A;  4HIO A;  1MIU A;  2IT1 A;  3P1H A;  4AYB B;  3BJU A;  2L1B A;  1SLJ A;  1HZA A;  3PQI A;  2R7Z H;  4B3M L;  1ET9 A;  4NP5 A;  3AEV A;  1CHQ D;  4CDC C;  1BKB A;  2EYL A;  1XMQ Q;  2NVY H;  5JEA G;  4Y52 H;  2B2V C;  1PA6 A;  1EYD A;  5EPJ A;  3HOU G;  4NDX A;  1ZXT A;  4X3K A;  1V1O A;  1O7I A;  4A3C H;  1N36 Q;  2B2Y C;  2B8G A;  1BCP C;  1HNZ L;  3MC0 B;  1OTC A;  1O7Z A;  2B2T C;  4UHV A;  4GOP C;  1XJV A;  5J39 A;  1CZW A;  1GO3 E;  2IWH A;  4WOR A;  3DM3 A;  4OWW B;  4I7A A;  1EQQ A;  2DJG C;  3FRP B;  1SEB D;  4X64 L;  1N32 L;  4C1N I;  4I65 A;  1CQF A;  1GJX A;  3AB9 A;  1E24 A;  1IL8 A;  2Z6K C;  4RCN A;  4C1N K;  4MTN A;  5JEA H;  4YWK A;  3L3O C;  3NQT A;  4RMF A;  1K73 C;  3BVM A;  1EY8 A;  2SOB A;  1WJJ A;  4L5T A;  3T4A C;  1G6P A;  4XT1 B;  1NE3 A;  4HID A;  2NUC A;  3E0J A;  4DN4 M;  1CKM A;  5COR A;  3D8G A;  4IUQ A;  1W2B A;  4HJ9 A;  1PH1 A;  3TRZ A;  4G7O C;  1HNW L;  1HCZ A;  1PFB A;  2JJQ A;  2ID0 A;  5JJI A;  3H0G H;  4JOI A;  2K6A A;  1BO0 A;  3N6R A;  4BA2 I;  4P75 A;  4HSV A;  2JA5 G;  5CV5 A;  1W3S A;  4TVA B;  3LWE A;  2JP1 A;  3NQI A;  3V96 A;  4MN3 A;  1FL0 A;  3RZD H;  4Z9C B;  4OX9 L;  1JB7 A;  1RCV D;  2QEJ C;  1NJI C;  5ELB A;  4BXX G;  3CXC A;  4LF6 Q;  1C4Q A;  1YI2 A;  1H95 A;  1ENC A;  4B9W A;  3CQZ H;  4B08 A;  4OGQ C;  1LT4 D;  4ALP A;  3C2P A;  2F0J A;  4HTH A;  5IGG A;  1LT5 D;  4A3M B;  1R4Q B;  4BY7 G;  1BBW A;  4DKA C;  1TWG H;  1O7L A;  2JA5 H;  4L6T B;  1VQE A;  2XNA C;  4RHS A;  1IBK L;  2IHE A;  1M4V A;  2M2L A;  4UPA A;  1BR9 A;  2ICE C;  3PUW A;  4O2D A;  1AW7 A;  1QJO A;  4CJ2 C;  3ER0 A;  4GKJ L;  2NVX H;  1LAB A;  1S4Z A;  4DR1 L;  3F2B A;  2D9U A;  4IPD A;  5DLQ E;  4NXN Q;  3U4Z A;  1Y69 U;  3S1Q B;  2NVQ B;  3H3V H;  2A1A A;  1SYB A;  2DY7 A;  2WB1 G;  2AWO A;  4HIM A;  1IW7 D;  5LMN L;  3ICE A;  1SMX A;  2C9O A;  2QCP X;  4K0K L;  3T1H L;  3DM1 A;  3NTK A;  2UUA L;  1PMR A;  1F2Z A;  4YCU A;  5CR3 A;  2P5Z X;  5HGQ A;  2YU9 H;  2JQO A;  4YCW A;  4JI7 Q;  4FXK C;  3HOZ G;  1HNX Q;  4N9P A;  4DUZ L;  1EWI A;  4LUO A;  4CJ0 B;  3IRB A;  1BDO A;  1MSG A;  2Y0S E;  4QJF A;  4IUN A;  4ZAI A;  4EQ5 A;  1PYB A;  3HOX B;  2B63 H;  2F0Q A;  2EDG A;  3MZ5 A;  1Q7Y C;  2RDH A;  1N33 Q;  3CCM A;  1LYL A;  1VQF A;  3A55 A;  3NEN A;  1Y1W B;  3HOW B;  2PNR C;  3CF5 A;  4IO9 A;  1YHQ A;  4DV5 L;  3KLS X;  4CDD C;  1XNR L;  1SYG A;  4Q0F A;  3D4W A;  2R92 H;  3K81 C;  4FNF A;  2BH2 A;  3K7A H;  1Q90 A;  1YZ6 A;  4FO2 A;  2NVT B;  4LUV A;  4A3G G;  2J0T D;  1JOK A;  2EY6 A;  5I9O A;  3K58 A;  3DUZ A;  4O0A A;  3FHW A;  1B4O A;  1EU4 A;  1BXT A;  1EU3 A;  3F2U A;  3MXG A;  5EAY A;  4XXE A;  1EY0 A;  2IX0 A;  2E2I H;  1D8L A;  1UNS A;  1VQM A;  5GAE C;  4DFA A;  2N3S A;  2ZTD A;  1D1K A;  2ZXR A;  2F3W A;  1YIJ A;  4K14 A;  1NMG A;  1NNX A;  2K5V A;  3CME A;  1EZ8 A;  4ZK9 B;  4UAI A;  2RQX A;  3CRL C;  4ZRZ A;  2EOT A;  4IOA A;  1CSQ A;  3KF6 B;  3OOC A;  4WJ4 A;  2D0P A;  1OXU A;  3RZO B;  3H15 A;  2JXM B;  3CCQ A;  2DJF C;  1A2U A;  1S5C D;  4AQY L;  3GQB A;  5FO7 B;  2QKI C;  1N34 L;  1F2Y A;  2QF7 A;  3GDE A;  3A7L A;  4BBS B;  4G57 A;  2EVB A;  1HFG A;  4XDX A;  2PZU A;  2K5D A;  3S9W A;  5KGU A;  1JOQ A;  1Q8I A;  3ITP A;  1KAA A;  3M7G A;  3GTL B;  4DR3 Q;  1VDZ A;  1NTG A;  1YIT A;  4A3E B;  4YHH Q;  5D3I B;  3CMA A;  1P8L A;  1WCM B;  5CBA E;  3GTG B;  2AKW B;  3OIP A;  5C0X I;  4GLV B;  1SNP A;  2NBF A;  1KL9 A;  4G7H C;  5EJW A;  1AE2 A;  4RKL A;  4YY3 L;  1SNM A;  1VQG A;  2LKV A;  1I3Q H;  3NBH B;  1NMF A;  1B9M A;  3IAY A;  4A3I B;  2AUJ D;  3M7N A;  4YWM A;  3E3X A;  4JG2 A;  3NSW A;  2XVS A;  1DYQ A;  1AZP A;  4HCS A;  2UXD L;  3NHH A;  4KHZ A;  4CKE A;  5HUR A;  1B53 A;  1GUG A;  5I2X A;  4G7Z C;  4C3H G;  2WIN B;  3M4O H;  4L5R C;  4JI4 L;  1VQH A;  5IOD A;  1BF4 A;  3CC7 A;  1STA A;  1VQI A;  1IYV A;  5IWA Q;  4DR5 Q;  1VMC A;  5IGC A;  4HIK A;  2TSS A;  4O42 A;  4H13 C;  3A74 A;  5C44 G;  2GN5 A;  5JVG 3;  2LFN A;  1EFI D;  5EGT A;  2K33 A;  1G91 A;  3L9A X;  3KFU A;  1GHK A;  3VYR A;  4DR2 L;  1FGB D;  2QA4 A;  1GM5 A;  4A3F B;  5CV9 A;  1A3V A;  3G6E A;  3KYH C;  1Z7T A;  3S14 B;  1IXR A;  1VQO A;  3HOV G;  5IYC G;  1PH4 A;  1SYD A;  2AMC B;  1Z6H A;  4GN3 B;  4OEL B;  2B3G A;  2N78 A;  3QB3 A;  1HA5 A;  1JC7 A;  4QUC A;  3CCE A;  1YBY A;  3URY A;  2HIV A;  3IFD A;  1OO9 B;  4X66 Q;  2K04 A;  3JAM E;  3F2D A;  1EWH A;  1SNO A;  3OMC A;  3FPP A;  1A2T A;  4M8A A;  3ONA B;  1GVP A;  2UUC L;  1EUJ A;  2MHV A;  1AEX A;  1IZ6 A;  1MHW C;  1G6Z A;  1PLF A;  2YTX A;  5IYD G;  3CCV A;  3CW2 C;  2SNM A;  4IUU A;  2F4V Q;  4QIW B;  2C35 B;  3HOV H;  2A74 C;  1QZH A;  5IT9 E;  3EN2 A;  4DU9 A;  4GZY C;  1JWM D;  1VQ7 A;  5GAH C;  3I55 A;  4A3J B;  2JK8 A;  4A3D B;  2JEB I;  3GV3 A;  1E1T A;  3NEM A;  3S1R B;  3RN5 A;  2HHH L;  4LF8 L;  4X65 L;  2K03 A;  3OPO A;  5C4X G;  1I4P A;  2EYM A;  4PZ7 A;  4C3I G;  1IYJ B;  3LWU A;  1VQK A;  4MHE A;  5D65 A;  3E9I A;  2KED A;  3I56 A;  4A3L H;  3PIP A;  3KLW A;  1PTO B;  1JT8 A;  4B3T L;  1QG7 A;  2PQE A;  2EJF C;  1TWA B;  1STY A;  3SK5 A;  2F03 A;  3PIP 3;  1BOS A;  1HQM C;  2WP8 J;  5IP7 G;  4DV2 L;  4ID6 A;  2AUK A;  1SXT A;  2WFW A;  3D4D A;  5ISR A;  3BYT B;  4RGT A;  4Q5V A;  3A5U A;  2RHS B;  3CKI B;  3HZX A;  1JE4 A;  3EBE A;  2KA7 A;  3U9O A;  5C4X H;  1B3Q A;  1PYW D;  3KDF A;  4C3I H;  2F0U A;  1B9N A;  4TSS A;  5A2Q E;  3SDZ A;  1QIL A;  2D62 A;  4E6I A;  2RHQ B;  4DV3 Q;  2EXZ A;  3K0Y A;  5CV7 A;  4X62 Q;  1VQ4 A;  1MJE A;  2G5D A;  4P73 A;  1LO5 D;  1AE3 A;  1J6Q A;  3GTO H;  3SEB A;  4GLA C;  3F1Z A;  2R93 B;  1UEB A;  4J8Q A;  1AZQ A;  2JA6 B;  5GQO A;  2BE5 C;  2NN6 I;  5IGE A;  4DNR B;  1IKL A;  2F0E A;  2YV5 A;  2A68 C;  4K2L A;  4RGN A;  1X3E A;  2Y0S B;  2UXC L;  4NPS A;  1K8G A;  3J7Y W;  3DLL A;  1H9M A;  1S5D D;  3A0J A;  2EYH A;  1O80 A;  1K3R A;  1YHB A;  4QL5 A;  4EX5 A;  2FFK B;  4JI3 Q;  5H1S E;  2NZO A;  4G4K A;  1KDA A;  2WAC A;  1KRT A;  2B2V A;  4R8N A;  3GTK H;  4KHP L;  1K8M A;  3Q0A A;  2B2Y A;  2K7V A;  4JI2 L;  5I2Y A;  4P74 A;  4JI0 Q;  4PMB A;  2B8F A;  3NPP A;  3ERO A;  2SNS A;  3OMG A;  1SSO A;  4DA2 A;  1JJ2 A;  3PUX A;  2VUM G;  1QVF A;  1AFP A;  2O2L D;  2F0F A;  1TWC H;  2N55 A;  2Z6K A;  5M3F B;  4JI1 Q;  3FMC A;  1X3P A;  1PZI D;  2VB3 X;  5BN3 A;  5K36 H;  1MI2 A;  1E3P A;  2E76 C;  3FKI B;  3MXP A;  4R4Q A;  4DXG A;  2EQS A;  3S17 B;  3V05 A;  5IOC A;  2E2J B;  3C46 A;  4JBW A;  1I4Q A;  3I4N H;  1SE8 A;  4A3K B;  1HRJ A;  3MEH A;  4J6H A;  3SK6 A;  3K59 A;  3KF8 B;  3JC6 6;  3S1N H;  1BNZ A;  2ASB A;  2LMC B;  3FEW X;  3HS0 C;  2VUM H;  3J7Z C;  4DV0 Q;  4IFD I;  3T1Y L;  2SEB D;  1IBK Q;  1BCP D;  3DWA A;  3STB C;  1A62 A;  3U9S A;  4DV6 L;  3J81 c;  4LFC Q;  1EIF A;  3PF4 A;  4Y7N B;  1HR0 Q;  1I4R A;  2K01 A;  4GKK L;  5IP9 H;  5ELC A;  5C0X H;  1M90 C;  3S1M B;  4IPC A;  4GKJ Q;  1LTB D;  3CC4 A;  5LL6 S;  4DR1 Q;  1S3O A;  3ND8 A;  3E5S A;  1U4R A;  5C4J B;  2RCF A;  3SVM A;  3HOY G;  2F4I A;  3BG3 A;  1SND A;  1DJR D;  3J80 c;  4QGU A;  2RA4 A;  3P20 A;  2XIW A;  1QVG A;  4JYA L;  1SYF A;  3NEL A;  3CD6 A;  3CP0 A;  3PO2 G;  3X3M A;  5NUC A;  1GXD C;  2F0G A;  1G51 A;  5CBE E;  1O7Y A;  5CC4 A;  3LNN A;  2E2D C;  1YNJ C;  3ERS X;  4KV6 A;  5M5Y B;  3HOU B;  1QB5 D;  2KCM A;  3BU2 A;  4NXM Q;  2EYF A;  3HOY H;  1C8C A;  3GTP B;  3VYS A;  1X55 A;  2MO0 A;  4FDB A;  2BOS A;  1GUO A;  5LMU Q;  1H9K A;  5G3L D;  4LFA L;  1KLU D;  3K5L A;  4FXG C;  2PNH A;  3ND9 A;  2R7Z G;  3AU7 A;  3RNU A;  3PO2 H;  5M9O A;  1G2T A;  4V0B A;  1WYD A;  5GRO A;  4QQB X;  2LXJ A;  2BA0 A;  1XNR Q;  5M5X H;  3M3Y H;  2H5X A;  2CWP A;  1SR3 A;  2N88 A;  2F0S A;  3M4Y A;  1F9P A;  4OWX B;  1QZG A;  1S72 A;  4A3C G;  1CHP D;  1KLG D;  2ATW A;  1KNE A;  1C7Y A;  1BVS A;  5FLX L;  5AJ3 L;  4KY7 A;  2OTL A;  4DR4 L;  1SNQ A;  2IJ0 A;  1SJE D;  1K28 A;  4DR7 L;  4U67 3;  1RL2 A;  3EFX D;  4PZ6 A;  2EY5 A;  3T51 B;  5KYL A;  2FMC A;  1VQ5 A;  2VY3 A;  1KNA A;  2A6E C;  3GV6 A;  3VA5 A;  1TWG B;  4OIJ A;  4OWT B;  4ZKB B;  1MJC A;  1RD9 D;  4A3B H;  5T1G A;  4EQP A;  1WTW A;  2Q8I B;  1PRT D;  1LTL A;  1JCK B;  2L15 A;  3NUC A;  2HQL A;  1B2T A;  3HKZ G;  4RG1 A;  2WAQ G;  4RH6 A;  4AQY Q;  1ZEQ X;  1I6H B;  2E5L Q;  2VQE L;  1ENF A;  3OTO L;  4DUY L;  3H0G G;  1EQV A;  1EQT A;  2WKC A;  1DM0 B;  3EQL C;  1L0X B;  2LSS A;  5FKA C;  4A93 B;  4BY7 B;  5EBC A;  4OO1 I;  1HR0 W;  3NXW A;  3NTI A;  1FNU A;  1PXU A;  2CW0 C;  4B3S L;  1TR5 A;  1KQS A;  1YHA A;  3CPW A;  4FF3 A;  3SK4 A;  3GP7 A;  4DK0 A;  1EY9 A;  2XRS D;  3RUZ A;  4EQN A;  5CV8 A;  3QJY A;  1EOV A;  3R3O A;  5I9P A;  5LMN W;  1HPC A;  2D5D A;  4LF5 Q;  5G3L F;  1X65 A;  3K0X A;  1A3U A;  5KRU A;  2VNU D;  2ZXP A;  1HQR D;  2WB1 B;  3MA2 B;  5A35 A;  1VQA A;  2JSO A;  2XWB B;  1I4H A;  2MQH A;  5BN5 A;  5M5W B;  4DR6 L;  2UXD Q;  1ESR A;  4QIW E;  5E7N A;  4FXD A;  4C56 C;  1PDQ A;  2F0H A;  5I6W A;  3QOJ A;  4LFB L;  3MVV A;  1TXY A;  2Q2I A;  2YTY A;  4V19 0;  2QDL A;  5JOB A;  3HOZ B;  1FVI A;  1K9M C;  4IAL A;  1YJN A;  2IHF A;  3OYY A;  4HMI A;  2KVM A;  1CSP A;  3MFG A;  2B2U A;  2G9D A;  3C1F A;  3G7L A;  4ILW A;  5C4H A;  1VCI A;  2IY5 B;  3TZD A;  1D2B A;  4LF7 L;  4JCV E;  3U50 C;  1LM0 A;  4CBV A;  5E4W C;  4JI5 L;  4DR2 Q;  2BDO A;  3VDY A;  4DGZ A;  4GNX B;  3OWE B;  2E2I B;  1XMO L;  1PRT F;  1LAC A;  2HT1 A;  3FDT A;  1KTK A;  1SDF A;  3OW2 A;  1EY6 A;  5BR8 L;  1HXY D;  2N49 A;  1E2Z A;  1PZJ D;  4EVO A;  1Q82 C;  3ZYY X;  1RTO A;  4BS9 A;  4A3G B;  1H9S B;  4MNO A;  1UE1 A;  1XNQ L;  5IGD A;  4KN4 C;  2B63 G;  3VR5 A;  3TBI B;  2MFI A;  3A54 A;  3KF6 A;  4GN5 A;  1DON A;  2IX1 A;  1B8A A;  3KJP A;  2UU9 L;  4R4I A;  4KI0 A;  2R92 G;  1KC8 C;  1Q86 C;  4BY1 G;  1TY2 A;  3WDN A;  4IFD H;  1J5E L;  1PHJ A;  3TSS A;  4UDU C;  2F0P A;  2K14 A;  1SJH D;  4BBR G;  4X3U A;  2CH4 W;  3CCR A;  3QOL A;  4LJZ C;  1WTP A;  2KOL A;  1YJ9 A;  1D7Q A;  2EYJ A;  3I4O A;  3KUP A;  1ENA A;  3J81 i;  1YNX A;  1YNN C;  1D1I A;  4A76 A;  1SE4 A;  5IIF A;  2ZJQ A;  1M1K C;  2VQF L;  4BY1 H;  2FMM A;  2LY7 A;  3AFP A;  4L5Q A;  4FF2 A;  4TRD A;  4KMU C;  4BBR H;  4X6A H;  3J80 i;  1QWY A;  2UXB Q;  1NBW A;  5JJZ A;  3M4O B;  1DD2 A;  1A0I A;  3I4M G;  3KBX A;  5DAU A;  4DAM A;  4OEM B;  1A8V A;  3J81 L;  2Q8R E;  1VS0 A;  2OEO A;  2Z1C A;  5C3E G;  3HG9 A;  1LTI D;  4JI6 L;  1OXV A;  4ABN A;  3RLF A;  4BWG B;  1K8O A;  1H9J A;  1Y1V G;  5IYB H;  1IBM Q;  4LWC A;  1X9N A;  2I5L X;  1PH6 A;  4IUV A;  1CKN B;  3M85 A;  1FJG Q;  4IZ8 A;  4R9W A;  1S5F D;  3J80 L;  4C3H B;  3I4M H;  2UXC Q;  2KCT A;  2OQK A;  1JJG A;  1XMQ L;  3QO2 A;  3NWT A;  1NR4 A;  5ELO A;  1SN8 A;  4TKO B;  3DEP A;  2H4O A;  5C3E H;  2NVQ H;  2CKZ B;  4IOC A;  3T53 B;  3I7F A;  5C44 B;  2L9H A;  4KTA A;  3EJI A;  3BDL A;  1HA6 A;  1Y1V H;  3CCU A;  1N36 L;  3F2C A;  1A15 A;  4A4I A;  5FLM H;  2Z4I A;  2DUD A;  5KIX A;  1OXT A;  2YYZ A;  1IYU A;  3HKS A;  2B2U C;  3KK7 A;  4QCL A;  4N9T A;  2MO1 A;  2QDB A;  4KY5 A;  1FNW A;  4CJ1 B;  3S15 H;  4S3S A;  4DAP A;  1LV9 A;  5JAV A;  3H09 A;  1J9O A;  4I7Z C;  2ZT9 C;  5C6A A;  3S2D H;  1CUK A;  1RDP D;  3PUZ A;  2O5J C;  2K52 A;  1B7Y B;  1Z47 A;  4L5S A;  3I72 A;  4X3T A;  3P75 A;  4H0L C;  3BZD B;  1Q3L A;  5FJ8 H;  2BH8 A;  4EGV A;  2EPB A;  3BVZ A;  4B3R Q;  4CKB A;  1Y1W H;  1I94 L;  4DK3 C;  1KDB A;  1BBU A;  3SGI A;  4JI8 Q;  5EPK A;  4OO1 H;  1Q8K A;  5F2D A;  5C4Z A;  4LF9 Q;  4C3J G;  1V43 A;  1HUM A;  2ZTC A;  3T1Y Q;  5M3M G;  4IPH A;  2K28 A;  3TS0 A;  4LMQ D;  5EKL A;  1Y8P B;  2MPM A;  5HY6 A;  1A3T A;  1EIG A;  1GOZ A;  3Q8D A;  5CGK A;  1V1P B;  1ICW A;  5C4X B;  3EA6 A;  2BE5 D;  4JVZ A;  3TN2 A;  4C3I B;  1XPO A;  2ALY B;  5EKI A;  1WTV A;  1GD7 A;  4UP7 A;  3CAM A;  3UDX A;  1STG A;  2CVR A;  2MUY A;  4LF6 L;  1T9H A;  3GTJ B;  1SE2 A;  1EYG A;  4TQU S;  1PV4 A;  2Q2U A;  1SFO B;  3K80 C;  3I73 A;  3GTO B;  1R9T H;  4C3J H;  1ML0 D;  2DNE A;  3GO5 A;  4XYQ A;  3J7A V;  3AQQ A;  4DV7 L;  5IT9 c;  2L55 A;  2ZM6 Q;  2O5I C;  5M3M H;  1MGS A;  1TY0 A;  4IPG A;  1CZG A;  3Q23 A;  3FVQ A;  4KKT A;  2VW9 A;  5FLX E;  3A8K E;  5C0X J;  5I6Y A;  2DNC A;  2NB0 A;  1LUZ A;  4HED A;  1ILP A;  2K05 A;  3RZO H;  5COY A;  1LT6 D;  3TRE A;  3D0F A;  3A8I E;  4NXN L;  1DOL A;  4A3L G;  3D6C A;  1XXG A;  2E8G A;  4XTC S;  3PO3 G;  2ZXO A;  1XTC D;  4BBS H;  5E1F A;  1JWU D;  1B44 D;  4K5X A;  1WTX A;  1TKW B;  4DV1 Q;  3GTK B;  3GTL H;  1D5Z C;  1U4L A;  1HTL D;  4FP5 D;  2RSO A;  3S2H H;  2JA8 G;  4KKS A;  1UWV A;  1TWH H;  1CA5 A;  3Q24 A;  2PZT A;  2KHJ A;  3MTS A;  2PMZ E;  4F87 A;  1KRS A;  1XX8 A;  2EXD A;  1K3B C;  2EJG C;  1E7Z A;  1CT1 D;  4CDE C;  3L2P A;  1HNX L;  4WRD A;  1HJP A;  1I50 B;  1TQO A;  1ET6 A;  4YWL A;  3PO3 H;  1F2M A;  1QNU A;  4XYO A;  3K5M A;  2VB2 X;  5AJ3 Q;  4A3I H;  3IKJ A;  2J7Z A;  2EE1 A;  2UUB L;  2AQ1 B;  1E22 A;  3STB D;  4APV A;  2KJX A;  5KNC A;  1WTR A;  2WB1 E;  2JA9 A;  3MXN B;  5E3F A;  4DR7 Q;  1RJT A;  4B3M Q;  1UUP A;  2A69 C;  2RCN A;  1G2S A;  2JA8 H;  2LS0 1;  4KHV A;  5FOB B;  4KKU A;  3S1N B;  2ES2 A;  1X32 A;  4DAY A;  5IE8 A;  1ASZ A;  1NR2 A;  3NP8 A;  2VUM B;  3DWQ A;  5KNB A;  3TS2 A;  4ME3 A;  3KF8 A;  1QCB D;  2JA7 G;  5EKK A;  1QNK A;  1A6X A;  1HNZ Q;  3IFT A;  2EYO A;  1TWF B;  5K5P A;  4IUP A;  3OHX C;  2DGY A;  1N32 Q;  3WWV A;  4X64 Q;  3T13 A;  4LUZ A;  2RVL A;  1K0R A;  2F3I A;  4P2C B;  2XTI A;  4IJH A;  4HJ5 A;  1YNJ D;  1GHJ A;  3S14 H;  1STN A;  4KJO A;  4KD3 A;  4XQN A;  3HGB A;  2L12 A;  1L2F A;  2JA7 H;  4OXP A;  3P7J A;  2F0O A;  2L11 A;  5K36 G;  1HH2 P;  3ULL A;  2CHB D;  1M8A A;  3U4V A;  4PG3 A;  5TSS A;  4F88 A;  1HNW Q;  4K2K A;  3I4N G;  3ULJ A;  3G48 A;  1VQ6 A;  1PTO C;  3HOY B;  2F0K A;  1EEF D;  4O1N A;  4DPG A;  1PH7 A;  1V1Q A;  4K8J A;  3AMU A;  3W2D A;  3MEF A;  4XT3 B;  1EY5 A;  3PO2 B;  1QE6 A;  3GTM B;  2EY2 A;  1EYA A;  4YHH L;  4OX9 Q;  4K6L A;  5IP9 G;  4WJ3 M;  1L1O B;  5ELF A;  3M3Y B;  5M5X B;  5C0X G;  1VMP A;  3UE1 A;  1VQJ A;  2NWG A;  2V1C C;  3TEH B;  1V9P A;  1X3G A;  3GTQ B;  5J1Z A;  3H3V I;  2A6E D;  1W6J A;  4RCO A;  2VL6 A;  4L8J A;  1DXM A;  4FVM A;  2KCN A;  1PTO H;  2K5W A;  2CCZ A;  1JOR A;  3I2Z A;  4ULL A;  1JIC A;  4OHJ A;  1Y14 B;  3K57 A;  3QIA A;  2R7Z B;  2EZV A;  2NZH A;  3DWP A;  1II3 A;  1LTR D;  4HMJ A;  1EY4 A;  4AH6 A;  2YTV A;  1K0S A;  1L0Y B;  3O13 A;  2NVY B;  1IKM A;  1UE6 A;  4CHT B;  1PH2 A;  1YVC A;  5IGF A;  4ZUI A;  1TT2 A;  4P72 A;  5CMD A;  4JC0 A;  3RMH A;  5IWA L;  1MKH A;  2L4N A;  5LMN Q;  1XNQ Q;  5C5M A;  1QUQ B;  2HD3 A;  1RHP A;  1KXL A;  3QR8 A;  4K0K Q;  2CWA A;  3T1H Q;  1LLR D;  1F77 A;  3HRZ C;  2UUA Q;  4P71 A;  1HZ9 A;  2R93 H;  1DOK A;  2JA6 H;  3E6Z X;  2F0N A;  5JVH 3;  4H44 C;  1TS3 A;  3MXU A;  4DUZ Q;  1K83 H;  4KN7 C;  3R2T A;  2X6L A;  2HUG A;  3UE0 A;  5BN4 A;  1HZB A;  2PW7 A;  1ONL A;  2E2H H;  4PZ8 A;  3D4R A;  1L1O C;  2M9V A;  4POG A;  2Z6B A;  1SMY C;  4PNY A;  5GAG C;  3HKZ B;  4X66 L;  3M4Q A;  4L63 B;  2JE6 I;  1U0L A;  2WAQ B;  1V8Q A;  4R4T A;  1BCP B;  2MNA A;  3QWN A;  2GA4 B;  2R7D A;  4GOP B;  3HP3 A;  2NTS A;  2F0T A;  3SXH A;  3H0G B;  4DV5 Q;  4UY8 C;  4RAU C;  4CGY B;  1VQP A;  4LF4 L;  1S5E D;  2JN4 A;  4A3B G;  2FIN B;  1I4X A;  2RF4 A;  4DNI A;  4IFD J;  3BZC A;  3RZD B;  4LAA A;  3T16 A;  1NAP A;  2KHI A;  2A8V A;  5M3F H;  1EIY B;  1IBL L;  5LL6 X;  3RLN A;  2CQO A;  3V2T A;  3G6J B;  1UE5 A;  2ICI A;  1BCP F;  1JOO A;  4PQX A;  3A8J E;  3CQZ B;  5C5L A;  3S17 H;  3J81 j;  1A63 A;  2E2J H;  1TU2 B;  1I5F A;  4DK1 A;  2VZA A;  1ROD A;  4F8M A;  1TVX A;  1CFM A;  2JA5 B;  4AIM A;  2Z0S A;  4C2M H;  1WVL A;  1UAP A;  1U9R A;  1SYC A;  1DOM A;  4X3S A;  2IW3 A;  3LX0 A;  3PMF A;  3IL8 A;  3CU7 A;  4HJ7 A;  1YEZ A;  4QF4 A;  1E0B A;  2ZJP A;  4Y7N H;  2CQA A;  3MAQ A;  2NVX B;  1ZYR C;  2I46 A;  5IT9 L;  4GNX A;  3S1M H;  1N34 Q;  4UP9 A;  3UDG A;  1STH A;  2A19 A;  2A6H C;  3UI2 A;  2AWN A;  1E2V A;  5EPL A;  3BS1 A;  1PH3 A;  2IPK D;  5C4J H;  3S16 H;  3I91 A;  4DV3 L;  1AN8 A;  4X62 L;  2R7F A;  3F8T A;  5D14 A;  4HJA A;  3SE0 A;  4HN7 A;  2PMZ B;  1H9S A;  1X3Q A;  3WOE A;  4YIJ A;  1OXS C;  1S40 A;  4JV5 L;  2NN6 G;  2X69 A;  4DV4 L;  2RSN A;  2YU9 B;  5KYI A;  2XWJ B;  1PFS A;  1T5E A;  4K5W A;  3VA7 A;  4H7B A;  4YY3 Q;  1MSH A;  1G8Z D;  3A7A B;  3BZK A;  5M5Y H;  1YNN D;  2CFM A;  3HOU H;  3J7A F;  1D5M C;  1YJW A;  4DNT B;  3NBI A;  4RHR A;  1DGS A;  3GTP H;  4QUF A;  4JI3 L;  1QOH A;  5DM6 3;  3CCJ A;  2B63 B;  3T56 B;  1PRT B;  2PQA B;  3H94 A;  3K7U C;  4AYB G;  1GKH A;  2NN6 H;  4B9X A;  3PGZ A;  4EQO A;  5A2Q L;  4POF A;  1I94 Q;  1P16 A;  1PFM A;  3BDO A;  3Q22 A;  2R92 B;  5JJL A;  4H02 A;  4MTK A;  4BY1 B;  3K7A B;  2PCF B;  4JI4 Q;  4FF4 A;  4JI0 L;  4RGM A;  1VF7 A;  5ELN A;  3KJO A;  1Q81 C;  2PI2 E;  1JQY D;  2KEC A;  3TP7 A;  1AH9 A;  2F3V A;  3NE5 B;  2DN8 A;  2FXQ A;  4BBR B;  1Q12 A;  5EQ0 A;  3L7Z C;  4JI1 L;  3K5N A;  2HIX A;  3R8B A;  2F0M A;  4HCE A;  4KLK A;  5FO9 B;  3H3V C;  4CDF C;  4ZLT F;  2Q2H A;  5FO8 B;  1KDC A;  1PFN A;  1F9R A;  5T1I A;  3TDQ A;  1U4M A;  1CTM A;  4JW0 A;  1JJC B;  5IGB A;  1XWE A;  2K1B A;  1NSN S;  5JPM C;  3PV0 A;  3UDI A;  4A93 G;  1PH8 A;  1KAB A;  4DV7 Q;  3TP8 A;  1SNC A;  4IFD G;  3ERQ A;  1L0W A;  4DV0 L;  2MJ8 A;  1WTH A;  1RF2 D;  1XYI A;  3VR6 A;  4LFC L;  2UUC Q;  3TZU A;  5C3W A;  1U5K A;  1HR0 L;  3I4M B;  4KD4 A;  3KLS A;  5C3X A;  1CKN A;  3S24 A;  4BA1 I;  4GN4 B;  4BXX H;  2ENB A;  5ELD A;  2AHO B;  1I6H H;  5C3E B;  1WI5 A;  2A5H A;  3RN2 A;  1Y1V B;  4JPB W;  2I07 B;  4A93 H;  4BY7 H;  1PRT C;  3U58 A;  2O4X A;  2HQE A;  2PZW A;  2HHH Q;  3X3N A;  4LF8 Q;  1H9R A;  3FP9 A;  2BCO A;  4X65 Q;  1NY4 A;  2F0I A;  5JJK A;  1MD2 D;  2WII B;  4PV1 C;  1CA6 A;  3S15 B;  1XPU A;  2VS1 A;  1F9Q A;  3S2D B;  1I3Q B;  2CH4 A;  1PVO A;  4NXM L;  1EZ6 A;  4B3T Q;  2LXK A;  4CKC A;  2KUM A;  5IYB G;  2KHS A;  3NBH A;  4A3M G;  4MZ9 A;  2AQ3 B;  3QG1 A;  2K5Q A;  2OXP A;  3RR5 A;  1VQB A;  4GNX C;  4DV2 Q;  2UUB Q;  4NKL A;  4R1J A;  2R6G A;  5M5W H;  5LMU L;  1B70 B;  2MGS A;  1UE7 A;  2V4D A;  1HUN A;  1RKN A;  4KK7 A;  1Q46 A;  3BDC A;  2ZJR A;  3HOZ H;  1HHV A;  3UDF A;  1X56 A;  1JWS D;  3D6W A;  4YCV A;  4XQJ A;  2WV6 D;  3PSI A;  1TII D;  4A3M H;  1ASY A;  1G29 1;  5FLM G;  2ZTE A;  3D31 A;  3AFQ A;  3K6O A;  3HFZ B;  1V1P A;  1EIH A;  1IL2 A;  4DF7 A;  5KND A;  1WD1 A;  3CCL A;  1O78 A;  3W1G A;  4KY6 A;  4R4C A;  4C3J B;  1R9T B;  1CM9 A;  4QMG A;  3S1Q H;  2A73 B;  2IL8 A;  5M3M B;  4A3G H;  1EQR A;  2EY1 A;  5ELE A;  1N8R C;  4JOI C;  4FYD A;  2XSC A;  2J4X A;  3D3R A;  1N9W A;  4N8X 1;  5EBD A;  4KHP Q;  1I4G A;  2L5T A;  5FJ8 G;  3HOX G;  2C5C A;  3VYU A;  1E2W A;  4JI2 Q;  4IJL A;  2E5L L;  1F2L A;  4PMW A;  3K8A A;  1Y1W G;  1SBB B;  2SDF A;  3C3L A;  3HOW G;  3HOV B;  2XN9 C;  4NMZ A;  4ZYS A;  3K5O A;  3I70 A;  4JK1 C;  2FHT A;  2Z8L A;  3TME A;  4OO1 G;  1VQ8 A;  1XTD A;  1IW7 C;  2NZ1 D;  2RKS A;  2EJM A;  4K5V A;  3S2H B;  2OTJ A;  1F9S A;  1NUC A;  3OIQ A;  2KBN A;  1TWH B;  4ZCK A;  4DAV A;  2K50 A;  1Y8N B;  3HOX H;  2PI2 A;  1PH9 A;  2A69 D;  1CQV A;  3WOF A;  4LF5 L;  4JBK A;  3NWS A;  3HOW H;  3PO3 B;  2HDL A;  3HKZ E;  1LTG D;  4RWS C;  2PYK A;  1DCZ A;  2G9H D;  2WAQ E;  2XRQ D;  1FNV A;  1EFW A;  3OSO A;  1WTQ A;  1TS2 A;  1GUN A;  1QVC A;  1RTN A;  2GVB A;  4RGO S;  3E0E A;  2NVT H;  4DV6 Q;  4IN3 A;  2JA8 B;  4GKK Q;  2HCC A;  3MXN A;  3JAM c;  4J15 A;  2OF1 A;  2A68 D;  3BVG A;  3H91 A;  3DEO A;  5FLX c;  5DNF A;  1UEA B;  2K75 A;  2QGQ A;  2QEX A;  4BBS G;  5D3D A;  2KCC A;  3NTH A;  1JB3 A;  4OIK A;  1KAW A;  2QIL A;  4LNQ A;  1LTS D;  4JYA Q;  4K6D A;  2OWO A;  4A3E G;  2B2W A;  1Q1E A;  1FR3 A;  3I90 A;  4GLX A;  1T5X D;  2EIF A;  3TP5 A;  1WCM G;  2F0L A;  4C3H H;  1BUV T;  4GS3 A;  1LTA D;  1U4P A;  1W6K A;  4AYB E;  1ZKO A;  1JMC A;  1PTO D;  1D6E C;  1ICF B;  3Q6S A;  1STE A;  2EYP A;  3C1E A;  3HEJ A;  1HZC A;  3G4S A;  2JA7 B;  3G71 A;  3RD4 A;  2BDN A;  1PH5 A;  4A3I G;  1GUS A;  5L37 A;  5C44 H;  5J22 A;  2RDG A;  1VQ9 A;  4ME5 A;  3RLO A;  4LK1 C;  4R8I A;  4IUT A;  2JEA I;  4LFA Q;  4R4O A;  1CI3 M;  2D2C C;  2L0C A;  4HR7 B;  4A3E H;  2B39 A;  4LF4 Q;  1EL0 A;  1XPR A;  3TQY A;  1WCM H;  3GTG H;  3W1B A;  5IYC H;  4JI7 L;  4WFN 3;  1TWC B;  3TP6 A;  2K5H A;  1STB A;  1SRU A;  1X3F A;  5IY0 A;  3AYH B;  3R2I A;  3EIV A;  4XIG S;  3L0O A;  1IBL Q;  4HSP A;  4DR4 Q;  4KJN A;  1FGU A;  4RA8 A;  1KHI A;  3I4N B;  1N33 L;  4PMC A;  1L1O A;  5HGT A;  5E4X A;  4A3F G;  5IYD H;  2PPB C;  1ILQ A;  4MIU A;  2K32 A;  2KEN A;  1B50 A;  3J7A 5;  4K8I A;  1SE3 A;  3W3A A;  1EOT A;  2F0D A;  2HDM A;  4LW1 A;  2WKD A;  2PW5 A;  3PCO B;  3LGJ A;  5CV4 A;  1FYC A;  3ULP A;  3I4L A;  4RKB A;  1Q1B A;  1FD7 D;  2GVA A;  1HTP A;  4XQQ A;  2UXB L;  5LHY 1;  1VF5 C;  2VQE Q;  1VQN A;  2OQ0 A;  1AP0 A;  3OTO Q;  3W5O A;  4DUY Q;  4WJW A;  4A3F H;  5CV6 A;  4A75 A;  1C0A A;  3SHL A;  3GTJ H;  1WD0 A;  1ESF A;  2VXW A;  1IHZ A;  1WFQ A;  1SFO H;  4B3S Q;  5KEE A;  1PTO F;  1KIX A;  4A3J G;  1IBM L;  2IX3 A;  1NCV A;  4A3D G;  4M1U B;  3MHB A;  5DEH A;  4U68 A;  2Z4H A;  3VR3 A;  5IP7 H;  1QUQ A;  4JV5 Q;  5GAD C;  4DV4 Q;  1SMY D;  2KEE A;  3KOJ A;  2Q2T A;  1FJG L;  2DY8 A;  2NYZ D;  4IQZ A;  1S5B D;  2RBM A;  4QY7 A;  1K83 B;  2JYO A;  3PF5 A;  1JE5 A;  2R3Z A;  2XGT A;  3PIO A;  2E2H B;  4HAE A;  1PZK D;  1B3A A;  1I6V C;  3OWF A;  1KD1 C;  1C9O A;  3PIO 3;  1TS4 A;  4DR6 Q;  4A3J H;  3VYT A;  4A3D H;  1EEI D;  4DR3 L;  4ODG A;  3CCS A;  1WTO A;  3S1R H;  4LFB Q;  3E9H A;  1VQD A;  3VR4 A;  2F0V A;  2B2T A;  4GOP A;  2B29 A;  1C48 A;  3BYY B;  3B6Y A;  5JEA J;  2E75 C;  2NTT A;  1BBX C;  1DZ1 A;  1EY7 A;  3PUY A;  1B1Z A;  1VQL A;  2F1M A;  3ZJY C;  2B2W C;  1I50 H;  2HCI A;  4LF7 Q;  4ZQ3 A;  2QW7 A;  1Z9F A;  1MBY A;  1TWA H;  3NK9 A;  4JI5 Q;  2R93 G;  1XMO Q;  2JA6 G;  3KDF B;  1LT3 D;  2K4K A;  1R4P B;  3M9B A;  4DAY B;  5I4D A;  1GUW A; 
#chains in the Genus database with same CATH homology
 5IYD G;  1A8V A;  5BR8 Q;  4OON A;  3CCV A;  4B3R L;  3CW2 C;  2F4V Q;  4YY3 Q;  1VS0 A;  2Y0S G;  2C35 B;  3GD7 A;  3HOV H;  3BZK A;  5M5Y H;  2CFM A;  5C3E G;  1QZH A;  3HOU H;  3EN2 A;  4JI8 L;  4JI6 L;  1YJW A;  1OXV A;  1VQ7 A;  5GAH C;  3I55 A;  3RLF A;  4LF9 L;  4DR5 L;  2JK8 A;  2JEB I;  1Y1V G;  5IYB H;  1E1T A;  1IBM Q;  1DGS A;  3NEM A;  3GTP H;  4LWC A;  1X9N A;  4JI3 L;  4DK6 C;  3A5Z B;  2I5H A;  3CCJ A;  3RN5 A;  2HHH L;  4LF8 L;  2F52 A;  2I5L X;  4X65 L;  1PH6 A;  1TWF H;  1CKN B;  2PQA B;  3K7U C;  4AYB G;  3M85 A;  1FJG Q;  1GKH A;  3PGZ A;  5C4X G;  4POF A;  1I94 Q;  2UU9 Q;  4PZ7 A;  1P16 A;  1X6O A;  3I4M H;  1E1O A;  2UXC Q;  2KCT A;  2OQK A;  1CKO A;  5JJL A;  1IYJ B;  4H02 A;  1PYS B;  1VQK A;  1JJG A;  4JI4 Q;  4JI0 L;  1XMQ L;  3E9I A;  5ELO A;  1SN8 A;  3I56 A;  5ELN A;  3PIP A;  3KJO A;  2N8N A;  3KLW A;  5C3E H;  1Q81 C;  2PI2 E;  2NVQ H;  4A3L H;  2CKZ B;  4IOC A;  2BA1 A;  3I7F A;  4B3T L;  1AH9 A;  1JT8 A;  3CPF A;  4NB3 A;  1J5E Q;  2FXQ A;  1Y1V H;  3CCU A;  1N36 L;  1Q12 A;  2ZM6 L;  2WP8 J;  3F2C A;  2I5M X;  3L7Z C;  5IP7 G;  4DV2 L;  2OCE A;  4JI1 L;  2HIX A;  4A4I A;  5FLM H;  5M3F G;  4JBM A;  2WFW A;  2DUD A;  4KLK A;  1X54 A;  1OXT A;  3A5U A;  2RHS B;  2YYZ A;  2Q2H A;  3EBE A;  3HKS A;  3FKI G;  5C4X H;  2MO1 A;  4UP8 A;  4JBJ A;  3KDF A;  1JJC B;  3CC2 A;  4C3I H;  4A3K G;  3S15 H;  2K5N A;  2F4V L;  2VQF Q;  3PV0 A;  2D62 A;  3JAM i;  2RHQ B;  3UDI A;  4DV3 Q;  4A93 G;  3S2D H;  1CUK A;  4X62 Q;  1VQ4 A;  1PH8 A;  1MJE A;  4P73 A;  4DV7 Q;  3M4P A;  3PUZ A;  1AE3 A;  2K52 A;  4IFD G;  1RIP A;  1J6Q A;  1L0W A;  1B7Y B;  4DV0 L;  1Z47 A;  4L5S A;  1SRO A;  4DV1 L;  3GTO H;  4GLA C;  3F1Z A;  1UEB A;  1VQC A;  4LFC L;  1WOC A;  2UUC Q;  5GQO A;  1U5K A;  1HR0 L;  2NN6 I;  3GTM H;  5FJ8 H;  1CKN A;  2PQA A;  2BH8 A;  2YV5 A;  2D0O A;  4GN4 B;  3S24 A;  4BA1 I;  1K8A C;  4BXX H;  3FKI H;  1X3E A;  4B3R Q;  2AHO B;  1Y1W H;  1I6H H;  1I94 L;  4DK3 C;  2UXC L;  1BBU A;  4NPS A;  3SGI A;  1K8G A;  3DLL A;  4A3K H;  3A0J A;  1WI5 A;  4JI8 Q;  4JI6 Q;  3PUV A;  1K3R A;  1YHB A;  1OXX K;  1Q8K A;  4QL5 A;  3RN2 A;  4EX5 A;  4LF9 Q;  3GTQ H;  1V43 A;  5J3B A;  4HJ8 A;  2ZTC A;  4A93 H;  4BY7 H;  3U58 A;  3T1Y Q;  4JI3 Q;  5M3M G;  4IPH A;  5H1S E;  2NZO A;  3TS0 A;  2HHH Q;  2I0Q A;  4LF8 Q;  4HIO A;  1MIU A;  3FP9 A;  1KRT A;  5HY6 A;  4X65 Q;  2IT1 A;  1NY4 A;  3BJU A;  3Q8D A;  1SLJ A;  3GTK H;  4KHP L;  1HZA A;  5JJK A;  2R7Z H;  4B3M L;  1XPO A;  2ALY B;  1XPU A;  3AEV A;  4JI2 L;  1BKB A;  1GD7 A;  3CAM A;  4UP7 A;  3UDX A;  4P74 A;  2VS1 A;  4LF6 L;  4JI0 Q;  1T9H A;  1XMQ Q;  2NVY H;  5JEA G;  4Y52 H;  1PA6 A;  1EYG A;  3HOU G;  1PVO A;  4NXM L;  4TQU S;  1PV4 A;  2Q2U A;  1JJ2 A;  4B3T Q;  3PUX A;  3K80 C;  2VUM G;  2LXK A;  1QVF A;  5IYB G;  4C3J H;  1R9T H;  3GO5 A;  1O7I A;  4A3C H;  3AQQ A;  1TWC H;  4DV7 L;  5IT9 c;  4MZ9 A;  4A3M G;  1N36 Q;  2ZM6 Q;  1HNZ L;  1OTC A;  3RR5 A;  2Z6K A;  4GNX C;  1VQB A;  5M3M H;  4DV2 Q;  4GOP C;  4JI1 Q;  1XJV A;  2UUB Q;  4R1J A;  1GO3 E;  2R6G A;  4IPG A;  5M5W H;  3DM3 A;  5LMU L;  1B70 B;  2VW9 A;  4OWW B;  1E3P A;  4R4Q A;  1UE7 A;  1EQQ A;  5C0X J;  2EQS A;  1N32 L;  1LUZ A;  4X64 L;  4JBW A;  3I4N H;  1SE8 A;  3RZO H;  1E24 A;  1Q46 A;  2ZJR A;  2Z6K C;  3TRE A;  3HOZ H;  3D0F A;  4NXN L;  4MTN A;  3KF8 B;  3UDF A;  3JC6 6;  4A3L G;  4YWK A;  4XTC S;  2E8G A;  3PO3 G;  3S1N H;  1X56 A;  2ASB A;  4RMF A;  4YCV A;  1K73 C;  4BBS H;  2VUM H;  3PSI A;  3J7Z C;  1WJJ A;  4L5T A;  1G6P A;  4DV0 Q;  4IFD I;  4DV1 Q;  1NE3 A;  3T1Y L;  1IBK Q;  4A3M H;  1ASY A;  1G29 1;  4HID A;  3STB C;  1A62 A;  3GTL H;  4DV6 L;  5FLM G;  3J81 c;  2ZTE A;  1CKM A;  3D31 A;  4LFC Q;  1EIF A;  3AFQ A;  1W2B A;  3PF4 A;  3S2H H;  3HFZ B;  1HR0 Q;  4HJ9 A;  1PH1 A;  4GKK L;  5IP9 H;  2JA8 G;  1UWV A;  1TWH H;  1M90 C;  3TRZ A;  4IPC A;  2KHJ A;  4GKJ Q;  2PMZ E;  1HNW L;  1IL2 A;  1KRS A;  3CC4 A;  4DR1 Q;  1S3O A;  2EXD A;  2JJQ A;  2ID0 A;  3CCL A;  5JJI A;  1E7Z A;  3H0G H;  3W1G A;  4JOI A;  3L2P A;  1HNX L;  4R4C A;  3HOY G;  4BA2 I;  1HJP A;  4P75 A;  4YWL A;  3PO3 H;  3S1Q H;  3J80 c;  2JA5 G;  4QGU A;  1W3S A;  4A3G H;  1EQR A;  4TVA B;  5AJ3 Q;  4A3I H;  1QVG A;  4JYA L;  1N8R C;  3NEL A;  1FL0 A;  3RZD H;  2UUB L;  1E22 A;  4JOI C;  3STB D;  4APV A;  3CD6 A;  3CP0 A;  1JB7 A;  2WB1 E;  2JA9 A;  3MXN B;  1N9W A;  4OX9 L;  3PO2 G;  4DR7 Q;  4KHP Q;  4B3M Q;  5FJ8 G;  3HOX G;  1NJI C;  2RCN A;  2JA8 H;  4BXX G;  1G51 A;  4JI2 Q;  4IJL A;  2E5L L;  4PMW A;  3CXC A;  3K8A A;  1Y1W G;  4LF6 Q;  3ERS X;  3HOW G;  1YI2 A;  1H95 A;  2ES2 A;  2KCM A;  3CQZ H;  5IE8 A;  1ASZ A;  3BU2 A;  4NXM Q;  4ALP A;  4OO1 G;  1VQ8 A;  3HOY H;  3TS2 A;  1XTD A;  4ME3 A;  4BY7 G;  1BBW A;  2JA7 G;  4DKA C;  1TWG H;  1X55 A;  1HNZ Q;  2JA5 H;  2MO0 A;  4FDB A;  2OTJ A;  1VQE A;  1IBK L;  2KBN A;  5LMU Q;  2IHE A;  4DAY B;  4UPA A;  4LFA L;  2K50 A;  2DGY A;  2PNH A;  2R7Z G;  3RNU A;  3PO2 H;  3PUW A;  1N32 Q;  4O2D A;  3WWV A;  4X64 Q;  4LUZ A;  1WYD A;  5GRO A;  2PI2 A;  1K0R A;  3HOX H;  1PH9 A;  3ER0 A;  4QQB X;  2LXJ A;  4LF5 L;  2F3I A;  4JBK A;  2BA0 A;  2NVX H;  5M5X H;  1XNR Q;  2XTI A;  2H5X A;  3M3Y H;  4GKJ L;  4IJH A;  4HJ5 A;  2CWP A;  4DR1 L;  3F2B A;  4IPD A;  5DLQ E;  4NXN Q;  3HOW H;  3HKZ E;  3U4Z A;  1SR3 A;  3S14 H;  3H3V H;  2WAQ E;  4OWX B;  1EFW A;  2A1A A;  2WB1 G;  2AWO A;  4HIM A;  1QVC A;  1QZG A;  2GVB A;  1S72 A;  3E0E A;  4A3C G;  5LMN L;  3ICE A;  1L2F A;  2ATW A;  2JA7 H;  1SMX A;  4OXP A;  1C7Y A;  2NVT H;  1BVS A;  5AJ3 L;  4DV6 Q;  4K0K L;  2OTL A;  5K36 G;  3T1H L;  4DR4 L;  4GKK Q;  1HH2 P;  3S1M H;  2UUA L;  3ULL A;  4YCU A;  3U4V A;  4DR7 L;  4PG3 A;  1RL2 A;  4PZ6 A;  1HNW Q;  3JAM c;  5HGQ A;  4J15 A;  3I4N G;  2YU9 H;  2JQO A;  4YCW A;  3ULJ A;  3G48 A;  1VQ5 A;  1VQ6 A;  5FLX c;  4JI7 Q;  2VY3 A;  3HOZ G;  1HNX Q;  4DPG A;  1PH7 A;  4DUZ L;  1V1Q A;  2K75 A;  2QGQ A;  1EWI A;  4LUO A;  4OWT B;  2QEX A;  4BBS G;  1MJC A;  4A3B H;  3IRB A;  4QJF A;  2Y0S E;  1KAW A;  3MEF A;  4LNQ A;  4JYA Q;  1LTL A;  2L15 A;  4EQ5 A;  4YHH L;  2OWO A;  1PYB A;  2HQL A;  4A3E G;  4OX9 Q;  2B63 H;  3HKZ G;  5IP9 G;  1Q1E A;  4RG1 A;  1Q7Y C;  1N33 Q;  1L1O B;  2WAQ G;  3CCM A;  4WJ3 M;  1LYL A;  5C0X G;  1VQF A;  4GLX A;  3NEN A;  3UE1 A;  4AQY Q;  2E5L Q;  2EIF A;  1VQJ A;  2VQE L;  2V1C C;  3CF5 A;  4IO9 A;  1WCM G;  1YHQ A;  3TEH B;  1V9P A;  4C3H H;  4DV5 L;  3OTO L;  4DUY L;  1X3G A;  3H0G G;  4GS3 A;  1JMC A;  4AYB E;  1XNR L;  2R92 H;  3K81 C;  3H3V I;  2LSS A;  3K7A H;  2BH2 A;  1HZC A;  1YZ6 A;  3G4S A;  4OO1 I;  2VL6 A;  3G71 A;  1HR0 W;  4LUV A;  4A3G G;  1PH5 A;  2CCZ A;  4B3S L;  4A3I G;  1KQS A;  5C44 H;  3I2Z A;  1VQ9 A;  3RLO A;  1Y14 B;  1YHA A;  4O0A A;  3CPW A;  4IOA A;  2JEA I;  4LFA Q;  4R4O A;  2NZH A;  3FHW A;  4A3E H;  4AH6 A;  1EOV A;  5EAY A;  5LMN W;  2YTV A;  4LF4 Q;  4LF5 Q;  1XPR A;  3TQY A;  1X65 A;  2IX0 A;  3K0X A;  1D8L A;  1VQM A;  1UE6 A;  1PH2 A;  1WCM H;  5GAE C;  2E2I H;  1YVC A;  2N3S A;  3W1B A;  5IYC H;  2ZTD A;  3GTG H;  2VNU D;  4P72 A;  4JI7 L;  1YIJ A;  4JC0 A;  1NMG A;  1VQA A;  5IWA L;  1MKH A;  2K5H A;  2K5V A;  5LMN Q;  2MQH A;  3CME A;  1XNQ Q;  1SRU A;  1X3F A;  5IY0 A;  1QUQ B;  3AYH B;  4DR6 L;  1KXL A;  4K0K Q;  3EIV A;  2UXD Q;  4QIW E;  2CWA A;  3L0O A;  4XIG S;  5E7N A;  3T1H Q;  1CSQ A;  3KF6 B;  1IBL Q;  4DR4 Q;  2UUA Q;  4P71 A;  1HZ9 A;  1FGU A;  2R93 H;  4LFB L;  1TXY A;  4WJ4 A;  1KHI A;  2D0P A;  2Q2I A;  2JA6 H;  1OXU A;  2YTY A;  3H15 A;  3CCQ A;  1N33 L;  1L1O A;  4AQY L;  4A3F G;  1FVI A;  5IYD H;  1K9M C;  1YJN A;  1N34 L;  2IHF A;  3OYY A;  2KEN A;  3GDE A;  3J7A 5;  4DUZ Q;  1K83 H;  1CSP A;  3UE0 A;  1VCI A;  1HZB A;  2IY5 B;  2E2H H;  4LW1 A;  4PZ8 A;  4LF7 L;  4JCV E;  3PCO B;  1L1O C;  3LGJ A;  3U50 C;  4DR3 Q;  4POG A;  1NTG A;  3ULP A;  1LM0 A;  1YIT A;  5GAG C;  4YHH Q;  4X66 L;  3M4Q A;  2JE6 I;  1U0L A;  1Q1B A;  4R4T A;  4JI5 L;  3CMA A;  4DR2 Q;  1P8L A;  2MNA A;  3VDY A;  2GVA A;  2R7D A;  4GNX B;  4GOP B;  1XMO L;  2UXB L;  1VQN A;  2AKW B;  5C0X I;  2OQ0 A;  2VQE Q;  2HT1 A;  4GLV B;  4UY8 C;  4DV5 Q;  3OTO Q;  1KL9 A;  3W5O A;  4DUY Q;  3OW2 A;  1VQP A;  4LF4 L;  5BR8 L;  1AE2 A;  2N49 A;  4A3F H;  4YY3 L;  1Q82 C;  4A75 A;  1C0A A;  1VQG A;  3GTJ H;  1I3Q H;  3NBH B;  1NMF A;  4A3B G;  4MNO A;  4DNI A;  1WFQ A;  2RF4 A;  3M7N A;  1SFO H;  4B3S Q;  4YWM A;  4IFD J;  1KIX A;  1IBM L;  4A3J G;  3BZC A;  4JG2 A;  4A3D G;  1UE1 A;  1XNQ L;  5IP7 H;  1QUQ A;  4JV5 Q;  2KHI A;  5GAD C;  2A8V A;  4DV4 Q;  5M3F H;  1EIY B;  2B63 G;  2UXD L;  4KHZ A;  1IBL L;  3KOJ A;  2MFI A;  2Q2T A;  1FJG L;  3RLN A;  2CQO A;  3KF6 A;  4GN5 A;  2IX1 A;  1B8A A;  1UE5 A;  3KJP A;  4QY7 A;  2UU9 L;  3S17 H;  4R4I A;  4KI0 A;  3J81 j;  3M4O H;  2E2J H;  1A63 A;  3PF5 A;  1JE5 A;  4L5R C;  2XGT A;  1I5F A;  1VQH A;  4JI4 L;  1KC8 C;  2VZA A;  2R92 G;  3PIO A;  4BY1 G;  1Q86 C;  3CC7 A;  1VQI A;  5IWA Q;  4DR5 Q;  4AIM A;  2Z0S A;  4C2M H;  4HIK A;  1KD1 C;  1C9O A;  3A74 A;  5C44 G;  1J5E L;  2GN5 A;  1PHJ A;  4DR6 Q;  4A3J H;  4A3D H;  2K14 A;  4BBR G;  4DR3 L;  3CCS A;  3CCR A;  3S1R H;  3KFU A;  4LFB Q;  4HJ7 A;  1YEZ A;  3E9H A;  1VQD A;  4DR2 L;  1YJ9 A;  1D7Q A;  2ZJP A;  2QA4 A;  4Y7N H;  3I4O A;  1GM5 A;  3J81 i;  4GOP A;  4GNX A;  3G6E A;  2B29 A;  3KYH C;  1YNX A;  3B6Y A;  1IXR A;  1VQO A;  1N34 Q;  5JEA J;  5IYC G;  4UP9 A;  3UDG A;  4A76 A;  3HOV G;  2A19 A;  1PH4 A;  2ZJQ A;  2AWN A;  1M1K C;  2AMC B;  1PH3 A;  4GN3 B;  3PUY A;  5C4J H;  2VQF L;  2B3G A;  2N78 A;  4BY1 H;  4DV3 L;  3S16 H;  1VQL A;  3ZJY C;  2R7F A;  3F8T A;  4X62 L;  4HJA A;  3AFP A;  1I50 H;  4LF7 Q;  3CCE A;  4L5Q A;  1Z9F A;  1YBY A;  2HIV A;  1TWA H;  4X66 Q;  3F2D A;  4JI5 Q;  1OXS C;  4BBR H;  4X6A H;  1GVP A;  3J80 i;  1S40 A;  2UUC L;  2NN6 G;  4JV5 L;  2R93 G;  4DV4 L;  1EUJ A;  1XMO Q;  2UXB Q;  1NBW A;  2JA6 G;  1IZ6 A;  1A0I A;  1PFS A;  2K4K A;  3KDF B;  3M9B A;  3I4M G;  2YTX A;  4DAM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...