3A5UA

Promiscuity and specificity in dna binding to ssb: insights from the structure of the mycobacterium smegmatis ssb-ssdna complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
119
structure length
118
Chain Sequence
MAGDTTITVVGNLTADPELRFTPSGAAVANFTVASTPRMFDRQSGEWKDGEALFLRCNIWREAAENVAESLTRGSRVIVTGRLKQRSFTREGEKRTVVEVEVDEIGPSLRYATAKVNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Single-stranded DNA-binding protein
publication title Promiscuity and specificity in DNA binding to SSB: Insights from the structure of the Mycobacterium smegmatis SSB-ssDNA complex.
rcsb
source organism Mycobacterium smegmatis
total genus 18
structure length 118
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3a5uA00
1XPUA 2OQ0A 3GTJH 2K5NA 1SRUA 3HOWG 5LMNQ 1OXVA 3HOVH 4GLVB 1U5KA 1H95A 3K7AH 2GVBA 3RNUA 3K7UC 4JBMA 1OXTA 4DK6C 1JJ2A 1E1TA 1X56A 4IPGA 4DV4Q 2NVTH 4BA2I 4HJAA 3UDGA 2BH2A 2XTIA 4MNOA 2CCZA 5IP9H 4C3HH 3KJPA 3J81c 1QZHA 3ICEA 2UXBL 4OWXB 1XNRL 1NJIC 2YYZA 2VZAA 1KAWA 3MXNB 3CMEA 4A3BH 4R4QA 4B3RQ 4A3LH 4GLAC 4YHHQ 4BY1H 4DR4L 1Y1VG 4DR6L 1YI2A 1YITA 1Y1WG 4C3JH 1K3RA 4TVAB 1WJJA 4YCWA 1SMXA 3PIOA 2K75A 2K14A 4GN5A 4JBWA 4O0AA 1TWCH 1VQ7A 4LF7Q 2ATWA 1XPRA 2JA7G 4A3FH 4JI4L 1JJCB 1L0WA 3U4ZA 3MEFA 3T1YQ 1HNXQ 2A8VA 3J80c 1JB7A 3DM3A 4KHZA 1E22A 4L5TA 3G4SA 2F4VQ 4JC0A 4GKKQ 4DV7Q 1K9MC 2MNAA 2QEXA 4PZ7A 4NXNQ 3FP9A 4OWTB 1IBML 2UXDQ 1XTDA 4A3EG 1PH9A 2KHJA 4LUVA 1NMFA 5GAGC 5HGQA 3KLWA 2NZHA 3I2ZA 4HIOA 2ZJQA 4JI3L 1HZBA 3ER0A 1VS0A 3G48A 2UU9L 4XIGS 1IBKL 3GTPH 1Q1BA 2VS1A 4LFBL 2R6GA 4X62Q 4JI0L 2R7ZH 2UXCL 3NEMA 1K8GA 1JE5A 1YVCA 3JC66 4R4OA 3CCLA 5GQOA 1EIYB 3U58A 1M1KC 3STBC 2ZM6Q 3M3YH 1C7YA 4JI2L 1YZ6A 3S1NH 2AMCB 2EIFA 3CCJA 1GO3E 3A74A 2C35B 3HOXG 2KENA 2GN5A 1HNZL 4DAMA 4HJ9A 3ULPA 5C0XG 4DR7Q 2HIXA 1HR0Q 1AH9A 1GKHA 2MO0A 4DV0Q 1WYDA 2N8NA 1S40A 5FLXc 5C4XG 1LTLA 1LYLA 2JA8H 2R92H 1QVCA 2OTJA 1RL2A 2JEBI 3STBD 1JT8A 3KOJA 1RIPA 3PCOB 4JI1L 2KCMA 4A3LG 3M9BA 3CCEA 4A3MH 2WAQG 2RCNA 4BBRG 1NE3A 2ALYB 1N34L 4A3IG 4A3CG 4APVA 3S2HH 3GTQH 5IYDH 1S72A 5E7NA 2RHQB 1UE7A 3PUWA 2YU9H 1YBYA 2ID0A 4LUZA 1ASZA 1N33L 2I5LX 1TWGH 5JEAJ 5IP7G 1KHIA 1N32L 2NN6I 2LXJA 4R4TA 3S17H 3EBEA 3FHWA 3PIPA 3F2BA 3CXCA 4DR4Q 4DR6Q 2DUDA 4GKJQ 3HKSA 2IX1A 2D0OA 4K0KQ 2AWOA 3G6EA 5EAYA 3W5OA 5M5YH 1V9PA 1EFWA 2JE6I 4X65L 1VQ6A 2VNUD 3CW2C 2I5MX 2K4KA 3I55A 4GLXA 1VQ4A 4JI4Q 3CCMA 4OO1I 5M3MH 3BJUA 3UDIA 4BY7H 3K80C 2RF4A 1VQJA 2VQEL 3CCUA 1FVIA 3G71A 1VQPA 1XMOL 2E5LQ 2KHIA 5IYCH 2NVQH 2WFWA 5BR8Q 2PMZE 3KYHC 2K52A 1OXSC 5IYBG 1PH8A 4FDBA 1IBLL 1VQLA 5ELNA 3CP0A 1WCMH 1S3OA 3U50C 1VQOA 3F2CA 4JI3Q 4L5QA 1SN8A 3TS2A 2IHFA 2KCTA 1G291 4LFBQ 3BZCA 4ME3A 4A4IA 3PUZA 1N9WA 1UE5A 4JG2A 2Q2HA 4A3DH 2K5VA 3Q8DA 4A3MG 2UUBL 1VQEA 5FLMH 4JI2Q 2QGQA 1D8LA 1KC8C 2VQFQ 2F3IA 5M3FG 3PV0A 3S2DH 4A76A 3ULLA 1KRSA 3PO3H 1TXYA 1T9HA 4IFDI 1Z9FA 3BU2A 3CPFA 2XGTA 3I7FA 3TREA 5IT9c 1YJNA 2CKZB 4B3SL 4LW1A 3PF5A 4H02A 2NVXH 1XMQL 1WFQA 4JI1Q 4DUZQ 2Z0SA 4HIKA 1NBWA 4MTNA 4A3KH 3E9IA 3S1MH 3K81C 1EQRA 4HJ7A 1N34Q 3H3VI 4IOCA 4JI6L 1P16A 3A5ZB 4OWWB 5M5WH 4NXML 1NY4A 2ZTEA 1WOCA 4NPSA 2IY5B 4DK3C 2EXDA 1SE8A 1N33Q 4X66L 4B3ML 1PYSB 1UWVA 5C3EH 4GN3B 2ZJRA 3VDYA 2Q2TA 4A3GG 4P71A 3I4NH 4Y52H 1EWIA 1N32Q 2LXKA 2K5HA 5JEAG 1U0LA 3KFUA 1QZGA 5IWAL 1GD7A 1D7QA 4JBKA 4KHPQ 2N78A 4GNXB 4DV1L 3CCRA 4DNIA 4LF6L 4JYAL 1I5FA 2ES2A 5IE8A 4X65Q 1K83H 1MKHA 4R1JA 3J81j 1VQ9A 1XNQL 1QUQB 2IT1A 1HJPA 2GVAA 4A3JG 4OONA 1PH2A 3S14H 2VUMH 4YY3L 1MJCA 3CCVA 2R7DA 1PH5A 4BXXG 4PG3A 4AYBE 1L1OB 2NVYH 1A8VA 2OQKA 3AYHB 4YWMA 2VQEQ 2MQHA 1XMOQ 1IL2A 1YHBA 4AQYL 5FLMG 3H3VH 4IPCA 1VQCA 1SFOH 3CD6A 1VQIA 4LFCL 3CPWA 3CAMA 3I4MH 1VQKA 3T1HL 1X3FA 1Y14B 2JJQA 2D62A 1IBLQ 1NMGA 3GDEA 2B3GA 3PO2H 4IPDA 3HKZE 1VQMA 4UP8A 2BH8A 1EYGA 2E8GA 1CUKA 3UE1A 4LF9L 2N3SA 4OX9L 1FL0A 4HIMA 3UDFA 2JA6H 3HOVG 4P74A 4DKAC 5C44H 3OTOL 3JAMi 3K8AA 3S24A 4X64L 5AJ3L 1VQDA 2RHSB 2UUBQ 1L2FA 1I3QH 2E2IH 3ZJYC 1Q12A 5IP9G 4JI7L 4A3BG 2UUAL 4DV6L 4RG1A 4KLKA 4BY1G 5C3EG 1LM0A 3H15A 1YHQA 1XMQQ 1B7YB 1V1QA 3HOUH 3A5UA 2E2HH 4YCUA 3HOZH 5FJ8H 2R7FA 1Q81C 2K50A 4JI6Q 3CCQA 1GVPA 2CWPA 2IHEA 5ELOA 1N8RC 1I6HH 4A3FG 2UXBQ 3WWVA 2H5XA 4LF4L 2JEAI 1XNRQ 4C3IH 3S15H 1V43A 2UUCL 3AQQA 3NELA 4JOIC 1TWAH 4NB3A 4DUYL 4UP9A 1IXRA 2Q2UA 1P8LA 4X66Q 3F2DA 4B3MQ 1AE2A 2KBNA 2MO1A 4BBSH 3M85A 4HJ5A 5LMNL 4QIWE 3HOYH 2B63H 2AKWB 3KF6B 4JOIA 1XPOA 1TWFH 3LGJA 4EQ5A 3S16H 5IWAQ 1BVSA 4R4CA 2WB1G 4DV1Q 4DV2L 4A93H 1XNQQ 4QJFA 4HJ8A 4GOPB 3I56A 2R7ZG 5H1SE 4B3RL 4YY3Q 3AEVA 1EIFA 3CF5A 5LMUL 1UE1A 1TWHH 3HOWH 4GNXC 1PH3A 4EX5A 3KJOA 1CKOA 2VUMG 1IBMQ 4P75A 4AQYQ 2BA1A 3CMAA 1J5EL 1KD1C 1G6PA 1K8AC 4LF7L 3RLNA 4GNXA 1YNXA 2UU9Q 3PUVA 3T1HQ 1IBKQ 1L1OC 2JA8G 2R92G 1PYBA 3GTKH 4JI0Q 2UXCQ 4DR5L 1QUQA 3M4PA 2R93H 4P72A 3M4QA 4YCVA 1Y1VH 5IY0A 4LF9Q 3OW2A 1L1OA 1W3SA 2WAQE 3B6YA 3JAMc 4DV7L 1PHJA 3OTOQ 2D0PA 2JA9A 4X64Q 4DV3L 3H0GH 1VQBA 1HNZQ 4POGA 1PVOA 3ULJA 4UPAA 5C0XI 4P73A 3U4VA 3L2PA 3AFPA 5IYDG 1KQSA 1CKNB 4GN4B 1SROA 4J15A 4DR3L 3W1GA 4LF5L 2JA7H 3TRZA 5DLQE 4B3TL 2QA4A 1I50H 2LSSA 1W2BA 3NENA 5J3BA 4JI7Q 3K0XA 1X55A 4LWCA 5JJKA 3IRBA 4IOAA 2EQSA 3SGIA 1VQ8A 4QY7A 2UUAQ 1BBWA 1LUZA 2JA5H 1JJGA 1CSQA 1PV4A 4DAYB 1Q46A 3CC4A 3PGZA 4IFDJ 2V1CC 2HQLA 2JQOA 2BA0A 4A3EH 2PQAB 3PUXA 4O2DA 3DLLA 1HR0L 1OXUA 4JI5L 1YEZA 1Q82C 4A93G 1C9OA 3D0FA 4DPGA 2HHHL 3RLOA 5M3MG 4LF4Q 4JI8L 4BY7G 3GO5A 4JV5L 4DUYQ 2AWNA 4LUOA 4UY8C 4UP7A 1E24A 4AIMA 5IYCG 3F1ZA 2JK8A 1BBUA 1YJWA 4XTCS 2YTVA 3CCSA 1A62A 2CFMA 4IJHA 2ZTCA 4JBJA 3RLFA 5C4JH 3HOXH 4WJ3M 3PF4A 1KL9A 1WCMG 3KDFB 4GS3A 1B70B 5HY6A 4DV2Q 1OXXK 2YTXA 5C4XH 5GAHC 1VCIA 1B8AA 3E9HA 1FJGL 2NN6G 4PMWA 4DV5L 4QL5A 1I94L 2R93G 3L7ZC 1QVFA 4A3DG 2AHOB 2PNHA 3W1BA 5LMUQ 4BBRH 1A63A 4POFA 1M90C 4GKJL 1Q8KA 4A3IH 1SLJA 3L0OA 4K0KL 3RN2A 4A3CH 3KF6A 3H0GG 2ZTDA 4GOPC 1N36L 3PO3G 4L5RC 2F52A 2Y0SG 1PH7A 1J5EQ 2OWOA 1X9NA 1PH1A 3PSIA 4OO1G 1HZCA 5IP7H 4GOPA 2MFIA 4DR5Q 4LFAL 2HIVA 3RN5A 2VW9A 5GROA 4WJ4A 1VQAA 2E5LL 1VQHA 2VY3A 2A1AA 3BZKA 2JA5G 4YWKA 4A3KG 1UE6A 1EQQA 1X65A 1PH6A 4LNQA 5BR8L 4PZ8A 5JJLA 1HZAA 4DV3Q 3CC2A 4IO9A 1BKBA 4A75A 4YWLA 1KXLA 4JCVE 5LMNW 2DGYA 1X3GA 3E0EA 3FKIH 3GD7A 1VQ5A 2OTLA 4LF8L 1X54A 2VL6A 4LF5Q 4IPHA 1HH2P 4DR3Q 1O7IA 1YHAA 3TEHB 5GADC 2CWAA 2YV5A 4B3TQ 3GTOH 1X6OA 3HFZB 1E1OA 1Q86C 2OCEA 2L15A 4B3SQ 2ASBA 3KF8B 3S1RH 3I4NG 3RZOH 1UEBA 3F8TA 3PUYA 4Y7NH 4DR1L 3GTLH 4KI0A 2ZJPA 4DR2L 1HNWL 2VQFL 3GTGH 4QQBX 4BA1I 5IYBH 3UE0A 4NXMQ 3EN2A 4IFDG 1K0RA 4JI5Q 3J7A5 3RZDH 1HZ9A 2WP8J 1CKNA 3ERSX 1YIJA 2HHHQ 3M4OH 1CSPA 1G51A 1PFSA 1MJEA 4JI8Q 2I0QA 2YTYA 4IJLA 4JV5Q 4DUZL 5K36G 3A0JA 4AH6A 4R4IA 3OYYA 4DV4L 1Q1EA 4LF6Q 5M3FH 1NTGA 2B29A 4PZ6A 1JMCA 1SR3A 3I4OA 1VQNA 3I4MG 5GAEC 4JYAQ 2PQAA 1KIXA 2Y0SE 2N49A 4C2MH 3J81i 3RR5A 2Q2IA 3PO2G 1EUJA 4YHHL 1EOVA 2PI2A 5M5XH 1C0AA 1FJGQ 3CC7A 1I94Q 2JA6G 4DV5Q 3NBHB 5C44G 1A0IA 1VQFA 1J6QA 1XJVA 3S1QH 4KHPL 2IX0A 1CKMA 4LFCQ 1QVGA 1DGSA 3FKIG 1N36Q 1VQGA 1K73C 4ALPA 3T1YL 1HNXL 2HT1A 3KDFA 1YJ9A 1X3EA 1AE3A 1Z47A 4RMFA 4HIDA 1HR0W 4A3GH 2Z6KC 3AFQA 3J80i 1E7ZA 2F4VL 4OX9Q 4GKKL 4LFAQ 1Y1WH 1MIUA 3UDXA 3M7NA 2PI2E 3HOUG 4NXNL 3D31A 5AJ3Q 1GM5A 3HOZG 2UXDL 4X6AH 4QGUA 5FJ8G 2Z6KA 1Q7YC 4L5SA 3TS0A 1IZ6A 3GTMH 4X62L 4A3JH 4LF8Q 4OXPA 4BXXH 2FXQA 4AYBG 4DV6Q 1PA6A 2ZM6L 3EIVA 4BBSG 3TQYA 1FGUA 1PH4A 2CQOA 5C0XJ 2A19A 3HOYG 1WI5A 2B63G 4TQUS 4DR1Q 1E3PA 1ASYA 4DR7L 1KRTA 4DR2Q 4DV0L 1HNWQ 2NZOA 1IYJB 1R9TH 2E2JH 2WB1E 3CQZH 1OTCA 5JJIA 2I5HA 2UUCQ 3HKZG 4MZ9A 3J7ZC
chains in the Genus database with same CATH superfamily
4B08A 5A35A 1EY4A 4J6HA 3GTJH 2RDGA 3HOVH 4GLVB 1H95A 1K83B 3TP8A 3RNUA 4DK6C 4IPGA 5KNBA 4DV4Q 1EY5A 1QE6A 4IUVA 2XTIA 1CHQD 5IP9H 3KJPA 3J81c 2EOTA 1W6JA 2A6EC 2YYZA 1BCPD 4BY1H 1SE4A 1HHVA 4PMCA 1UNSA 3VYTA 4DR6L 1YITA 4C3JH 2PZTA 2XRSD 2K75A 3A7LA 1TWCH 4IUTA 1WTXA 4KJOA 4K6LA 4A3FH 3A8KE 1SDFA 2HCCA 3T1YQ 1O7LA 1EYAA 2F4VQ 1BBXC 4FF4A 1G2TA 5CV5A 3NBHA 3FP9A 1D1KA 1RHPA 1IBML 2FINB 4A3EG 3X3MA 3KLWA 2ZJQA 4HIOA 2UU9L 3G48A 4XIGS 1F2YA 5T1IA 1GUTA 4X62Q 2UXCL 1K8GA 1JE5A 1SJHD 2SNMA 1I4HA 2F0UA 5GQOA 3U58A 4R9WA 1QJOA 4KV6A 5JVH3 1WTWA 4JI2L 2AMCB 1MD2D 3CCJA 3A74A 3HOXG 1AH9A 2KUMA 1GKHA 3OSOA 1WYDA 2HUGA 3GP7A 1EYDA 1QVCA 2OTJA 2JEBI 2B63B 1RIPA 1TWFB 2EY5A 4K5VA 5DM73 2RCNA 1YNNC 2ALYB 1EU4A 2NTSA 4HCEA 1UUPA 2F0GA 1HCZA 3S2HH 3HKZB 3L3OC 1UE7A 1ASZA 1LTAD 1MBYA 1TWGH 2Q8RE 1TS4A 3S17H 4R4TA 2EYFA 3HEJA 1BO0A 3F2BA 1ICFB 4DR4Q 4GKJQ 2D0OA 4K0KQ 3G6EA 4JVZA 3CW2C 2EYHA 3T51B 3H3VC 4IUUA 3MXNA 1FVIA 3G71A 3K5LA 1VQPA 2KHIA 2WFWA 2PMZE 2RVLA 4FDBA 4E6IA 2K28A 3CP0A 1BQQT 4RHRA 3TS2A 3PUZA 1A2UA 4XT3B 1N9WA 1CA5A 4A3DH 4A3EB 2UUBL 1C4QA 2VQFQ 2A5HA 2K05A 1CT1D 3S2DH 1TXYA 3CU7A 4IFDI 3I7FA 3HOXB 3VA7A 4H02A 4JI1Q 1H9KA 1N34Q 5CC4A 1WTRA 3G7LA 1NY4A 5KIXA 2EXDA 1SE8A 1N33Q 3DUZA 1F9QA 1AN8A 2LY7A 3N6RA 2ZJRA 2Q2TA 4A3GG 4C3JB 2B2UA 2RDFA 1CQVA 4P71A 3WOEA 4DK1A 1N32Q 3GV6A 1U0LA 1RODA 1FR3A 1TWCB 1KABA 4GNXB 1L0XB 2K33A 4JYAL 1I5FA 4X65Q 1HJPA 2GVAA 1PH2A 4KY5A 4PG3A 5JPNC 3E0JA 1Y8PB 2MQHA 4U673 3KLSX 3Q24A 1LTBD 1I4XA 4IPCA 1VQCA 3NTHA 4G7ZC 1JQYD 3HP3A 1VQIA 3I4MH 1NR2A 3GDEA 3PO2H 2B2YC 4Y7NB 4QB4A 1XXGA 2BH8A 4OX9L 3D4DA 3UE1A 1D5MC 2N3SA 1FL0A 4F87A 5I9OA 2JA6H 3OTOL 3JAMi 2QILA 2E2IH 1FD7D 3M4OB 4JI7L 2RKSA 2FHTA 5C6AA 4DV6L 4RG1A 3FRPB 1LABA 1SYDA 2JYOA 1E2ZA 4TSSA 4YCUA 3S2HB 4I7AA 4JI6Q 1GVPA 2I07B 1I6HH 3WWVA 3SK6A 4IQZA 1XNRQ 1V43A 1AEXA 4JOIC 1TWAH 1R4PB 1P8LA 4EQNA 4X66Q 2JXMB 2A68C 2KBNA 3F2DA 4B3MQ 4HJ5A 1DZ1A 3VR3A 1XPOA 5ELFA 1RD9D 4EQ5A 2G9DA 4R4CA 4DV2L 4A3GB 3NP8A 4ZUIA 3I73A 4C1NI 5LMUL 4RCNA 4ODGA 1DYQA 1PH3A 4EX5A 3KJOA 1CKOA 1PRTC 1SEBD 4P75A 4UAIA 4PNYA 2BA1A 5J22A 4KJNA 1KD1C 1A2TA 1YNXA 3T1HQ 3HG9A 1IBKQ 2JA8G 3GTKH 4JI0Q 1YNJC 4F88A 1L1OA 1JE4A 1W3SA 3JAMc 1G2SA 2E2JB 3S2DB 4X64Q 4POGA 1G6ZA 3I91A 4LF5L 4J15A 3JAME 4DR3L 5DLQE 2LSSA 4OEMB 1VQ8A 3SGIA 3I72A 1BBWA 2MPMA 2JA5H 2NVTB 5CMDA 4KN4C 2DN8A 1S4ZA 1WTVA 2Z8LA 4DAYB 3CC4A 2HQLA 2KOLA 2BA0A 2PQAB 3PUXA 3R2TA 1OXUA 4OELB 2A73B 1PZJD 2HHHL 5JOBA 3F2UA 4JI8L 3GO5A 2WKDA 4K14A 4DUYQ 4LUOA 3R3OA 3BVZA 3F1ZA 1YJWA 2EJFC 1GXDC 2L4NA 4IJHA 1EZ6A 1CFMA 2A69C 5C0XH 1KL9A 1WCMG 4GS3A 4L6TB 5C4XH 3FVQA 1EQTA 1VCIA 1VMPA 1KDBA 1KAAA 2R3ZA 3I8ZA 1I94L 4EQPA 1FJGL 4QL5A 5BN3A 5ELCA 4PV1C 1OO9B 2AHOB 4BBRH 1BUVT 4GKJL 5CR3A 5D3IB 1EY6A 4NP5A 4K0KL 2VB3X 2B8GA 3KF6A 4X3KA 3NQIA 2F52A 2Y0SG 1J5EQ 4L5RC 4RWSC 3Q0AA 5A2QL 3U9OA 4FF3A 4OO1G 3N52A 1HZCA 1T5XD 3TZDA 5C3WA 4GOPA 4LFAL 1VQAA 2JA5G 1VQHA 2F0JA 2A1AA 4WRDA 4YWKA 1X65A 2JA8B 3TP6A 5IGDA 4DV3Q 3CC2A 4YWLA 4KY6A 3FKIH 2F0QA 3GD7A 1VQ5A 1X54A 1HH2P 1O7IA 5GADC 4B3TQ 2XSCA 2FFKB 1E1OA 1Q86C 4B3SQ 2L15A 3RZOH 1FYCA 4DR2L 3TSSA 1HNWL 1PTOB 1TS5A 5D14A 2VQFL 2YU9B 4QQBX 5EPKA 4J8QA 5KNCA 5E1FA 3RZDH 1HZ9A 1CKNA 3VYRA 1CSPA 3SK4A 1CZWA 1B9MA 4K8IA 2L1BA 2YTYA 5K36G 2F0HA 5KYIA 1H9SA 4IURA 4R4IA 1PZID 5M9OA 1PXUA 1W6KA 1RDPD 2EJMA 4Q0FA 1BCPF 3IFDA 4C2MH 5CBAE 4I65A 1F2ZA 2WV6D 4YHHL 1EY7A 4DV5Q 5G3LD 3FPUB 5C44G 1STHA 1A0IA 1WCMB 1Y8NB 3NXWA 5CV4A 2CW0D 3S1QH 1CK1A 1DOLA 1QVGA 1DGSA 3FKIG 3CRLC 1N36Q 4ALPA 2HT1A 1YJ9A 3BVGA 4RMFA 1HR0W 3D3RA 1PRTD 3J80i 1EWCA 2BDOA 1MIUA 4NXNL 3D31A 3IL8A 5AJ3Q 3HOZG 2IW3A 3NUCA 3KBGA 3SK5A 4QGUA 4X6AH 5IIFA 3OPOA 1QOHA 3DWPA 1U4RA 3K5NA 3TS0A 3MA2B 1K8OA 4C56C 4C3IG 2MUYA 4JW0A 3K5MA 2JA5B 4OXPA 1ESRA 3R2IA 4AYBG 1PA6A 2ZM6L 3TQYA 2CQOA 5C0XJ 2A19A 1WI5A 4TQUS 3RD4A 4DR1Q 1ASYA 4DR7L 3MFGA 4DV0L 4CJ0B 4HMJA 1RF2D 5KRUA 1LLRD 5JJIA 2I5HA 3AU7A 4MZ9A 1SNDA 2J0TD 3I4LA 1SRUA 1BCPC 3KF8A 1U5KA 3K7UC 4JBMA 3S14B 4BA2I 3UI2A 4IZ8A 2NVYB 4C3HH 3ICEA 1QZHA 2LMCB 4OWXB 1XNRL 1NJIC 5CGKA 4WFN3 1Y1VG 1SFOB 2A69D 2PZWA 1K3RA 3IKJA 4TVAB 1WJJA 4X3SA 1SMXA 2NZ1D 1VQ7A 3SK8A 2XVSA 1XPRA 1HTPA 4JI4L 1QNKA 4DK0A 3U4ZA 4OIKA 1HNXQ 5C44B 2PYKA 3DXJC 3J80c 4KHZA 1E22A 2F3VA 4L5TA 4JC0A 1I4PA 4QMGA 2PQEA 3TMEA 1LTGD 2MNAA 2QEXA 3FKIB 1Y8OB 3BYTB 3HS0C 4OWTB 2UXDQ 2KHJA 4LUVA 1NMFA 1SYEA 4JI3L 3DEOA 3BVMA 3GTPH 1IBKL 4JI0L 1AZPA 2R7ZH 1KDCA 3NEMA 4DXGA 2E2HB 3HOZB 5KYLA 1C7YA 3H09A 1YZ6A 2CH4W 4L8JA 4MIUA 2F3WA 2MGSA 2O5IC 2KENA 2BCOA 4C3IB 1HR0Q 4R8NA 3S15B 3GTMB 4AYBB 4LK1C 3A54A 1JT8A 3PCOB 4CKCA 5I6YA 1QG7A 1NE3A 4A3IG 2NTTA 1DD2A 4A3CG 1WTHA 3GTQH 1S72A 4DGZA 2M9VA 1TWHB 2RHQB 5CV8A 1D5XC 1YBYA 5IP7G 1H9JA 2F0DA 3PIPA 2AWOA 5EAYA 1EFWA 5IT9L 4H0LC 4EGVA 2I5MX 3I55A 1VQ4A 1NCVA 3CCMA 4OO1I 5M3MH 3BJUA 5CORA 3K80C 2RF4A 1SE2A 3CCUA 1XMOL 1LTID 1SYFA 3E6ZX 2E76C 1OXSC 5IYBG 1IBLL 2XWBB 3X3NA 1S3OA 3U50C 3BDCA 4L5QA 2KCTA 4QIWB 4K6DA 4X3TA 4LFBQ 3BZCA 2NN6H 1UE5A 2Q2HA 1HA6A 2K5VA 3A55A 5BN4A 1VQEA 3I3CA 4M1UB 2E75C 1WTQA 2RSNA 5M3FG 3H91A 4Q5VA 1Z9FA 3BU2A 3BYYB 4MHEA 2SNSA 1YJNA 5BN5A 2CKZB 4B3SL 1HUMA 4LW1A 1GUNA 2Z0SA 3MFYA 5FK9C 4A3KH 1EQRA 3H3VI 1DONA 4IOCA 4EQOA 4OL7A 5M5WH 1EYCA 2ZTEA 2B2UC 1U4LA 3DM1A 4DK3C 2B2VC 5IGEA 2CVRA 1UEAB 3NE5B 5C3EH 4A3IB 4XT1B 2KHSA 4KMUC 2LXKA 3EJIA 2K5HA 5KEEA 1DXMA 3O13A 1GD7A 3D6CA 1XWEA 2ES2A 1VF7A 3OIQA 3OWEB 4RGNA 1QUQB 1TR5A 3CCVA 1DOKA 4BXXG 1SSOA 1LT5D 2EXZA 2OQKA 4HAEA 1E2WA 4YWMA 2VQEQ 1AP0A 2PW7A 1MHWC 2Q8IB 1YHBA 1LT3D 4AQYL 2LS01 3CD6A 3GTPB 4RGTA 3CAMA 5E4XA 2MJ8A 4UDUC 3OMGA 3KBXA 4IPDA 3GTLB 1SNOA 2F1MA 2X6GA 1EEID 1EYGA 1CUKA 2F0TA 3HOVG 4P74A 1NUCA 3S24A 5AJ3L 2K04A 2RHSB 1HRJA 4B9XA 1QCBD 4FF2A 4TKOB 1PDQA 5EKKA 1ILPA 2HCIA 1Q12A 1LTRD 2PW5A 5IP9G 1I4RA 3BZDB 2UUAL 2F0SA 4BY1G 5C3EG 1LM0A 3R8BA 1S5BD 5M3FB 1YHQA 2HDMA 1B7YB 3SHLA 4C3JG 1XMQQ 3A5UA 2O2LD 3J7AV 1IYUA 2L9HA 1Q81C 1O7YA 5ISRA 1NR4A 4IUQA 4A3FG 2H5XA 4LF4L 1HPCA 4ZKCB 3AQQA 3NELA 4NB3A 4XQNA 2C5CA 4BBSH 2HD3A 1TS2A 4RHSA 4O42A 2OF1A 3HOYH 3S16H 5IWAQ 3KUPA 4DV1Q 4A93H 1JC7A 5A2QE 1XNQQ 4HJ8A 3QG1A 5H1SE 2Z6BA 4YY3Q 3AEVA 5CYUA 2L5TA 3CF5A 3HOWH 1C48A 1TS3A 1JOQA 3CMAA 1G6PA 1GJXA 5HURA 2A6HD 3PUVA 4XYQA 3BDOA 5JPMC 1L1OC 1PYBA 1VMCA 2EVBA 3M4QA 4LF9Q 2D2CC 3OW2A 2WAQE 5IODA 4EVOA 3H0GH 1TVXA 5J1ZA 1PFMA 4P73A 3AFPA 1X3QA 1KQSA 1SROA 3TRZA 2HDLA 2JA7H 3GTJB 3NPPA 4JK1C 1I50H 4FXGC 3HOVB 2K1BA 2EYJA 2ZXOA 4LWCA 4XDXA 4IOAA 4QY7A 3BDLA 1NNXA 1A6XA 5M5WB 4RFBA 1BDOA 1Q90A 1HR0L 4JI5L 1Q82C 4A93G 5C3EB 4BY1B 4DPGA 3OIPA 1ET9A 2MP1A 2XWJB 2AWNA 1PZKD 4KN7C 2B2VA 4AIMA 3K57A 2WACA 3H94A 3E3XA 1BBUA 2YTVA 4ZKBB 3CCSA 3RLFA 4A3FB 2ZTCA 4JBJA 5JJZA 4KD4A 5C4JH 4WJ3M 3PF4A 2QCPX 5CV7A 2EPBA 1B70B 5HY6A 5G3LF 5COYA 3E9HA 3V96A 1IYVA 1PTOD 1QVFA 4A3DG 1JICA 4POFA 1U4PA 4PMBA 1Q8KA 1F9RA 3H0GG 2ZTDA 1KDAA 4GOPC 1PRTF 1CA6A 1S5CD 3QO2A 1X9NA 1L0YB 3PSIA 4CGYB 3C2PA 2IJ0A 1TIID 4DR5Q 2VW9A 4Z9CB 4WJ4A 1E2VA 2MHVA 3K6OA 1UE6A 4LNQA 1HZAA 3KLRA 1M8AA 2NBFA 4RA8A 2HQEA 4A75A 4JCVE 3E0EA 1X3GA 2OTLA 4LF8L 5FOBB 2VL6A 2D9UA 3TEHB 2CWAA 2YV5A 1DCZA 3QR8A 2ASBA 2OCEA 2QF7A 1F9SA 4WORA 3S1RH 1UEBA 2F0MA 3F8TA 1LACA 2JN4A 1BCPB 1TWGB 1TY2A 4RKBA 3S17B 2WP8J 1YIJA 2XNAC 4MN3A 3QJYA 1MJEA 1SYCA 4JV5Q 5IOCA 4AH6A 4A93B 4DV4L 2K5WA 2VB2X 1FNWA 1Q1EA 4PZ6A 1VQNA 3I4MG 2CW0C 2KA7A 4KD3A 1KIXA 2Y0SE 2K32A 3PO2G 2Q2IA 1EOVA 5M5XH 1K28A 3CC7A 2JA6G 4ZQ3A 2PZUA 3NBHB 4F8MA 4HTHA 4O1NA 2F0OA 1J6QA 1KTKA 1PYWD 1CKMA 3T1YL 3KDFA 4A3DB 1X3EA 1MGSA 5TSSA 2F4VL 2K7VA 5C3XA 3UDXA 3H0GB 3M7NA 1GM5A 5F2DA 4H13C 4DA2A 2G5DA 1Q7YC 3J81L 2ZXRA 1STYA 2KECA 2QDLA 2EYOA 2WKCA 1XYIA 4X62L 4A3JH 1WD0A 1IL8A 2K01A 1JWSD 3EIVA 1IHZA 1ZEQX 1ZKOA 2KCNA 1Q8IA 4BS9A 1E3PA 1HUNA 1DM0B 1R9TH 2WB1E 3CQZH 1JWMD 1OTCA 2UUCQ 3NK9A 3I90A 5IGBA 3MXPA 4ID6A 2PMZB 3J7ZC 3T16A 2OQ0A 3TP5A 5C4JB 3QOJA 2RBMA 3K7AH 3MHBA 1V1PA 1OXTA 4RGMA 5IT9E 1E1TA 1JJ2A 3EQLC 2BH2A 3RMHA 4MNOA 2CCZA 1ML0D 1TT2A 2DJGC 4K5XA 1ONLA 3MXNB 3CMEA 2Z4HA 4R4QA 4A3BH 4B3RQ 1B9NA 3J7YW 4DR4L 2B2TC 3OOCA 1WTPA 3I4MB 3QOLA 3OMCA 3VR6A 1EQVA 3PIOA 4LAAA 3PO2B 4JBWA 4O0AA 2F0PA 2ATWA 3NSWA 2IWHA 2JA6B 3MEFA 2A8VA 1GOZA 2QW7A 3G4SA 2H4OA 3ONAB 2E2IB 4GKKQ 3PMFA 4PZ7A 3A8IE 4N9PA 5EKIA 4NMZA 1SJED 1XTDA 5HGQA 5GAGC 1C8CA 2F0EA 3I2ZA 2M2LA 1HZBA 1B3AA 3ER0A 2XIWA 2VS1A 2R6GA 1TQOA 1HTLD 3JC66 3CCLA 3ZYYX 1EIYB 1M1KC 3QB3A 4BWGB 3M3YH 2TSSA 3S1NH 2EIFA 1I6HB 1GO3E 1HFGA 2C35B 2DY8A 2EYPA 4DAMA 3DEPA 3DHQA 5C0XG 2MO0A 3VYUA 1AW7A 1TWAB 2N8NA 5E3FA 2PCFB 5C4XG 1LTLA 2EY1A 3C1FA 2EZVA 2R92H 1RL2A 3STBD 1RKNA 4ZUJA 4JI1L 2KCMA 3M9BA 3CCEA 1NAPA 4A3MH 4BBRG 1N34L 3EROA 4NDXA 2R61A 1HQMC 1GHKA 4APVA 5IYDH 5E7NA 2NWGA 1LV9A 3D4RA 1N33L 2ID0A 2I5LX 2B39A 5JEAJ 1KHIA 1N32L 5LL6S 4DAVA 3K0YA 4JPBW 4DR6Q 2DUDA 1SNQA 3GTKB 1V9PA 3HRZC 2JE6I 4X65L 1ZXTA 2K4KA 4QUFA 4CBVA 2IX3A 3T4AC 1RCVD 3UDIA 4BY7H 4N8X1 1GUGA 1VQJA 2E5LQ 5IYCH 2NVQH 1STNA 5D3DA 1HXYD 1VQLA 2FMCA 1VQOA 4U68A 1SN8A 2IHFA 4ME3A 1JORA 1EWHA 3E5SA 3WOFA 4A3MG 4K8JA 4JI2Q 1STEA 2QGQA 1KC8C 3FDTA 4V0BA 2F3IA 3PV0A 3ULLA 1KRSA 3PO3H 1CM9A 5JAVA 1T9HA 3W2DA 3D8GA 3CPFA 3OW7A 2C9OA 1D5ZC 2NVXH 3K7AB 1WFQA 4DUZQ 1U4MA 4HIKA 1NBWA 4MTNA 5DAUA 3T56B 3S1MH 3K81C 3KLSA 3U9SA 5C4XB 4JI6L 1P16A 3A5ZB 1I4QA 1VF5C 1II3A 1WOCA 3D4WA 2IY5B 3EA6A 1IKMA 4KK7A 4BBRB 4X66L 4B3ML 4GN3B 1FGBD 5C4HA 3I4NH 2NB0A 5DM63 4CDEC 1QZGA 5LL6X 5ELDA 5FLXL 1STAA 2B2TA 4JBKA 2N78A 4KHPQ 2L12A 2EY2A 5IGCA 1X3PA 4DNIA 3CCRA 4FVMA 5IE8A 1K83H 1ENFA 1LO5D 1MKHA 2RSOA 3J81j 2IT1A 1VQ9A 4IFDH 1PH5A 1H9RA 1L1OB 1A8VA 1I4GA 1O7ZA 2F03A 1IL2A 3OHXC 1F77A 3HGBA 2EYLA 4RH6A 3T1HL 1X3FA 1Y14B 2JJQA 4CKBA 3SVMA 3RZOB 1NMGA 2B3GA 2GA4B 2J7ZA 3HKZE 2V4DA 1VQMA 2ENBA 2E8GA 2I46A 2QDBA 4HIMA 3K8AA 3S9WA 4X64L 2UUBQ 3VR4A 1L2FA 5KGUA 3RZDB 4QF4A 1SAPA 1A3UA 3ZJYC 3FMCA 4C3HG 5J39A 2PNRC 2BE5D 5I2XA 4A3MB 4CDFC 1J9OA 3H15A 3CHBD 1QILA 5C5MA 3BS1A 3HOUH 1V1QA 1EL0A 2XN9C 1Q3LA 5FJ8H 4C2MB 2EY6A 3Q6SA 3C1EA 4HSPA 2IHEA 1N8RC 1ENCA 2UXBQ 2JEAI 5D65A 2UUCL 3JAML 2Q2UA 1EY9A 4DUYL 1AE2A 2WINB 3S1QB 3M85A 2B63H 3KF6B 1FNUA 1TWFH 3LGJA 5DEHA 4ZCKA 1DOMA 2L55A 4QJFA 1R4QB 3SXHA 5EPJA 4GOPB 2R7ZG 4B3RL 2A6HC 3D6WA 3MEHA 4GZYC 2RDHA 2AQ3B 1IKLA 1J5EL 4FXDA 1K8AC 5EPLA 3RLNA 4GNXA 3L9AX 4IN3A 3M4PA 4P72A 4YCVA 3B6YA 3OTOQ 2JA9A 5ELEA 4DV3L 2A74C 1VQBA 1HNZQ 3ULJA 5C0XI 3U4VA 3L2PA 1CKNB 2EE1A 4GN4B 3W1GA 2DJFC 3TZUA 2NUCA 1W2BA 4B3TL 1JR0D 4JI7Q 3K0XA 4KKTA 1X55A 5JJKA 2EQSA 3J7AF 1SBBB 1H9SB 1AZQA 5C5LA 4LMQD 1PV4A 5I6WA 3A7AB 3SEBA 4IFDJ 1JCKB 2V1CC 4C3HB 5EKLA 1S5FD 4A3EH 4O2DA 3DLLA 3RUZA 1ZYRC 1YEZA 2L11A 2RQXA 3RLOA 5M3MG 3SE0A 2KCCA 1GHJA 1SYGA 4UY8C 1E24A 2LFNA 1PTOC 2JK8A 4XQQA 2RCFA 4DF7A 2CFMA 3HOXH 1SNPA 3SR1A 1E0BA 1PRTB 1CTMA 4DV2Q 1OXXK 2YTXA 4ZYSA 1B8AA 3IAYA 2OT2A 2NN6G 4DV5L 1HQRD 1CZGA 4KHVA 5LMUQ 1WD1A 1A63A 1GUSA 1S5DD 4YIJA 5FKAC 3J81E 3RN2A 3A8JE 4OGQC 2R7ZB 1N36L 1PH7A 2OWOA 4ULLA 1ENAA 2MFIA 2HIVA 1ILQA 1B50A 2E5LL 4L63B 2FMMA 3BZKA 3C46A 4A3KG 1PH6A 4PZ8A 3T53B 5JJLA 4IO9A 1BKBA 2F0IA 5LMNW 2DGYA 4LF5Q 4DR3Q 2F4IA 3GTOH 3LX0A 3HOUB 3KF8B 2AUKA 3PUYA 5FO9B 4Y7NH 4DR1L 3GTQB 1PFBA 4KI0A 3EVQA 2ZJPA 1JOOA 2SOBA 3P75A 3SDZA 3GTGH 4BA1I 4IUNA 3UE0A 5L37A 3DWAA 4NXMQ 3EN2A 1K0RA 1ET6A 4HN7A 2EDGA 4IALA 2HHHQ 3M4OH 4JI8Q 2I0QA 4DUZL 3A0JA 3OYYA 4ZLTF 1B2TA 4DAYA 4LF6Q 3TDQA 1NTGA 2B29A 5M3MB 1SR3A 5GAEC 2PQAA 1RTNA 4HCSA 2N49A 3ERQA 1TKWB 4HMIA 1QB5D 1SXTA 2PI2A 3C3LA 1FJGQ 1I94Q 2BOSA 4XXEA 1VQFA 2AQ1B 2K03A 3DMUA 4N9TA 1XJVA 2ZXPA 4KHPL 2IX0A 4LFCQ 2ICEC 1TU2B 4R8IA 5KNDA 3P20A 1VQGA 1K73C 1JOKA 1HNXL 1J8IA 2QKIC 1Z47A 2Z4IA 4LJZC 4A3GH 3AFQA 4LFAQ 3LWUA 1Y1WH 2H1EA 2PI2E 3VR2A 4I7ZC 2UXDL 2Z6KA 1JWUD 2B8FA 1SMYD 2IPKD 3NQTA 4DAPA 3P1HA 5DNFA 1F2LA 1KLGD 4A3KB 2FXQA 4BBSG 3HOYG 2FJ2A 2X6LA 4N8FA 5CBEE 4DR2Q 2J4XA 4ABNA 1HNWQ 1IYJB 2E2JH 3J80L 4ZK9B 4X3UA 5I2YA 1IW7D 4K5WA 2DY7A 4KTAA 1XPUA 3K5OA 2KQ3A 2K5NA 3HOWG 5LMNQ 1OXVA 1ZYRD 3M4YA 4F7XA 1TY0A 1EZ8A 2GVBA 1MSHA 2NVTH 3LNNA 2F0NA 1X56A 2SEBD 4HJAA 3UDGA 2UXBL 1U9RA 2VZAA 1KAWA 1G8ZD 1B4OA 3MWYW 4GLAC 4YHHQ 4A3LH 1JB3A 3MC0B 1YI2A 1Y1WG 5FO8B 1PMRA 4J1MA 4YCWA 3V2TA 2K14A 1CHPD 4GN5A 2A6ED 4LF7Q 2KEDA 1PFNA 2JA7G 1JJCB 1L0WA 2AQ2B 1JB7A 4HSVA 3DM3A 4RCOA 4DV7Q 1UAPA 1K9MC 4NXNQ 1D1IA 4H44C 3KK7A 3OWFA 1PH9A 1KNAA 2NZHA 3GTOB 4ME5A 1VS0A 1Q1BA 4LFBL 3URYA 1O80A 1D6EC 1X32A 1YVCA 4R4OA 4K2KA 3MXUA 3R93A 3P7JA 3STBC 5IGGA 2ZM6Q 3GTGB 2Z1CA 2GN5A 1HNZL 3PQIA 4HJ9A 3ULPA 4DR7Q 2HIXA 4FXKC 2VXWA 4DV0Q 3H6MA 1S40A 1A15A 1O78A 5FLXc 4BBSB 1LYLA 2JA8H 3NHHA 3ITPA 3HOYB 3KOJA 2ZT9C 1WVLA 4A3LG 3S16B 2WAQG 5FLXE 4CHTB 2F0LA 1EY0A 1STGA 3GQBA 1PTOH 3PUWA 2YU9H 4LUZA 3HOWB 1YNND 3NTKA 2NN6I 2LXJA 3EBEA 3QWNA 3FHWA 4TRDA 4DXFA 3CXCA 3VYSA 3HKSA 2ICIA 2IX1A 1B44D 5EBCA 3W5OA 5M5YH 1VQ6A 2VNUD 1EIGA 1EFID 2BDNA 4GLXA 4JI4Q 1Y1WB 4KKSA 1BXTA 3K58A 2OEOA 2VQEL 4QUCA 2E2DC 5JEAH 2D5DA 1B1ZA 5BR8Q 2JA7B 3KYHC 2K52A 1I50B 2F0FA 1PH8A 2O5JC 5ELNA 3TBIB 1SYBA 1WCMH 1V8QA 3F2CA 4JI3Q 2AUJD 1CI3M 1G291 4A4IA 4ZRZA 3Q22A 4JG2A 1K3BC 1A3TA 2K6AA 4RGOS 3Q8DA 5FLMH 1D8LA 1F2MA 3CKIB 2DNCA 4A76A 2F0KA 2KEEA 4ZAIA 3CRKC 2XGTA 3TREA 4OO1H 5IT9c 4DN4M 2PO4A 1KNEA 3PF5A 1XMQL 3E9IA 4HJ7A 1BOSA 3NTIA 5NUCA 4ILWA 4OWWB 4NXML 1FNVA 4CDCC 1G91A 4NPSA 1ICWA 4S3SA 4K2LA 2CQAA 2WAQB 4OHJA 1PYSB 1UWVA 3VDYA 1K8MA 4Y52H 1EWIA 2PPBC 3BG3A 3AB9A 5JEAG 3KFUA 1XTCD 3EFXD 5IWAL 1D7QA 2K5QA 3MTSA 4DV1L 4LF6L 2N55A 2P5ZX 1XNQL 4R1JA 4A3JG 3S14H 4OONA 2VUMH 4YY3L 1MJCA 2R7DA 4AYBE 2NVYH 5CV6A 3AYHB 4UHVA 1XMOQ 5K36H 1K0SA 5FLMG 1M4VA 3H3VH 1SFOH 5JVG3 2K5DA 4LFCL 3CPWA 1VQKA 1IBLQ 2D62A 2N88A 1LT6D 1VDZA 3S1RB 4DNRB 2O4XA 1H9MA 4CJ2C 3AMUA 4UP8A 2BE5C 4PQXA 4LF9L 4QCLA 1GUOA 3UDFA 4DKAC 4XQJA 5C44H 1Z7TA 3IFTA 1VQDA 2B2YA 1V1OA 1I3QH 2JP1A 3TN2A 1PLFA 4FYDA 3MZ5A 5AFWA 4A3BG 1F9PA 4KLKA 5I4DA 5EQ0A 1B53A 4FP5D 2E2HH 3HOZH 2R7FA 2K50A 2WIIB 3CCQA 2CWPA 5ELOA 5M5XB 2Q8TA 3PIO3 4DFAA 2XRQD 4C3IH 3S15H 2VUMG 3GTMH 4HEDA 4UP9A 1IXRA 1DJRD 2MO1A 2X69A 1I6VC 5LMNL 4QIWE 5EJWA 4G7HC 2AKWB 5M5YB 1EY8A 4JOIA 4FNFA 3GV3A 1RTOA 5I9PA 4M8AA 1WTOA 3QIAA 3NWTA 1BVSA 2F0WA 2WB1G 3T13A 5HGTA 1BNZA 4H7BA 1EEFD 2A68D 3I56A 1LTTD 4RAUC 1EIFA 4CDDC 1UE1A 1TWHH 4DNTB 2B2WC 2LKVA 1A3VA 1MSGA 4GNXC 1IBMQ 4A3JB 4AQYQ 5K5PA 4CJ1B 4LF7L 2UU9Q 1EOTA 1XX8A 1Z6HA 1SNMA 4CKEA 2R92G 2UXCQ 2CHBD 4DR5L 1QUQA 2R93H 3M7GA 1Y1VH 5IY0A 4DV7L 1R9TB 2Z9HA 1PHJA 2D0PA 2Y0SB 3CQZB 1PVOA 3FPPA 4UPAA 3WDNA 1D2BA 3HZXA 3VR5A 5IYDG 1STBA 3ND9A 1YNJD 5T1GA 2QA4A 2DNEA 3DWQA 3NENA 5J3BA 5C4ZA 3IRBA 4P2CB 1BR9A 1LUZA 5FO7B 2UUAQ 1JJGA 4NKLA 1CSQA 3NWSA 5EGTA 1Q46A 3K59A 3PGZA 2JQOA 1S5ED 4V190 2L0CA 4A3BB 5E4WC 5ELBA 1C9OA 3Q23A 3D0FA 4LF4Q 4BY7G 3FEWX 4JV5L 4KKUA 4UP7A 4FO2A 5IYCG 2NYZD 1ESFA 2KJXA 4XTCS 1A62A 5LHY1 2G9HD 2QEJC 2VUMB 3KDFB 2KVMA 4MTKA 1GUWA 5GAHC 4PMWA 1RJTA 2R93G 3L7ZC 4WJWA 2RA4A 2PNHA 3W1BA 4OIJA 2WB1B 1M90C 4A3IH 1SLJA 3L0OA 4A3CH 1SE3A 4C1NK 3PO3G 3M3YB 1PH1A 4NW2A 2OXPA 3S1NB 3I70A 5IP7H 3RN5A 5GROA 2VY3A 1I3QB 5CV9A 1EQQA 5BR8L 2R92B 1CQFA 3J80E 1KXLA 3G6JB 2IL8A 2EJGC 2E74C 4IPHA 2TMPA 1YHAA 1X6OA 3HFZB 3I4NG 2F0VA 1V1PB 3GTLH 5IYBH 4G7OC 4IFDG 1EU3A 3TP7A 4JI5Q 3J7A5 3ERSX 4XYOA 4RKLA 4DU9A 1PFSA 1G51A 5IGFA 4IJLA 3V05A 1HFNA 3MVVA 2EYMA 5M3FH 4JYAQ 1JMCA 1PTOF 3I4OA 4BY7B 4G57A 3A56A 4FF1A 3J81i 3RR5A 1B3QA 1EUJA 3W3AA 2NVQB 4G4KA 1SNCA 1C0AA 1LT4D 1LTSD 2B2WA 1BF4A 2R93B 1AFPA 1SMYC 1Y1VB 1MI2A 1AE3A 4HIDA 2Z6KC 1E7ZA 3LWEA 3MAQA 1Y69U 4OX9Q 4GKKL 5EBDA 2M00A 3HOUG 3PO3B 5FJ8G 2CH4A 3ND8A 4L5SA 3VA5A 1IZ6A 1NSNS 2JSOA 2NVXB 4LF8Q 1QNUA 4BXXH 1HA5A 3S1MB 4DV6Q 1T5EA 4HR7B 1FGUA 1IW7C 1PH4A 2B63G 1QWYA 3PIP3 4IUPA 1KRTA 4KY7A 2NZOA 1KLUD 2SDFA 4B9WA 3I4NB 1EIHA 3NBIA 3HKZG 3MXGA
chains in the Genus database with same CATH topology
1XPUA 2OQ0A 3GTJH 2K5NA 1SRUA 3HOWG 5LMNQ 1OXVA 3HOVH 4GLVB 1U5KA 1H95A 3K7AH 2GVBA 3RNUA 3K7UC 4JBMA 1OXTA 4DK6C 1JJ2A 1E1TA 1X56A 4IPGA 4DV4Q 2NVTH 4BA2I 4HJAA 3UDGA 2BH2A 2XTIA 4MNOA 2CCZA 5IP9H 4C3HH 3KJPA 3J81c 1QZHA 3ICEA 2UXBL 4OWXB 1XNRL 1NJIC 2YYZA 2VZAA 1KAWA 3MXNB 3CMEA 4A3BH 4R4QA 4B3RQ 4A3LH 4GLAC 4YHHQ 4BY1H 4DR4L 1Y1VG 4DR6L 1YI2A 1YITA 1Y1WG 4C3JH 1K3RA 4TVAB 1WJJA 4YCWA 1SMXA 3PIOA 2K75A 2K14A 4GN5A 4JBWA 4O0AA 1TWCH 1VQ7A 4LF7Q 2ATWA 1XPRA 2JA7G 4A3FH 4JI4L 1JJCB 1L0WA 3U4ZA 3MEFA 3T1YQ 1HNXQ 2A8VA 3J80c 1JB7A 3DM3A 4KHZA 1E22A 4L5TA 3G4SA 2F4VQ 4JC0A 4GKKQ 4DV7Q 1K9MC 2MNAA 2QEXA 4PZ7A 4NXNQ 3FP9A 4OWTB 1IBML 2UXDQ 1XTDA 4A3EG 1PH9A 2KHJA 4LUVA 1NMFA 5GAGC 5HGQA 3KLWA 2NZHA 3I2ZA 4HIOA 2ZJQA 4JI3L 1HZBA 3ER0A 1VS0A 3G48A 2UU9L 4XIGS 1IBKL 3GTPH 1Q1BA 2VS1A 4LFBL 2R6GA 4X62Q 4JI0L 2R7ZH 2UXCL 3NEMA 1K8GA 1JE5A 1YVCA 3JC66 4R4OA 3CCLA 5GQOA 1EIYB 3U58A 1M1KC 3STBC 2ZM6Q 3M3YH 1C7YA 4JI2L 1YZ6A 3S1NH 2AMCB 2EIFA 3CCJA 1GO3E 3A74A 2C35B 3HOXG 2KENA 2GN5A 1HNZL 4DAMA 4HJ9A 3ULPA 5C0XG 4DR7Q 2HIXA 1HR0Q 1AH9A 1GKHA 2MO0A 4DV0Q 1WYDA 2N8NA 1S40A 5FLXc 5C4XG 1LTLA 1LYLA 2JA8H 2R92H 1QVCA 2OTJA 1RL2A 2JEBI 3STBD 1JT8A 3KOJA 1RIPA 3PCOB 4JI1L 2KCMA 4A3LG 3M9BA 3CCEA 4A3MH 2WAQG 2RCNA 4BBRG 1NE3A 2ALYB 1N34L 4A3IG 4A3CG 4APVA 3S2HH 3GTQH 5IYDH 1S72A 5E7NA 2RHQB 1UE7A 3PUWA 2YU9H 1YBYA 2ID0A 4LUZA 1ASZA 1N33L 2I5LX 1TWGH 5JEAJ 5IP7G 1KHIA 1N32L 2NN6I 2LXJA 4R4TA 3S17H 3EBEA 3FHWA 3PIPA 3F2BA 3CXCA 4DR4Q 4DR6Q 2DUDA 4GKJQ 3HKSA 2IX1A 2D0OA 4K0KQ 2AWOA 3G6EA 5EAYA 3W5OA 5M5YH 1V9PA 1EFWA 2JE6I 4X65L 1VQ6A 2VNUD 3CW2C 2I5MX 2K4KA 3I55A 4GLXA 1VQ4A 4JI4Q 3CCMA 4OO1I 5M3MH 3BJUA 3UDIA 4BY7H 3K80C 2RF4A 1VQJA 2VQEL 3CCUA 1FVIA 3G71A 1VQPA 1XMOL 2E5LQ 2KHIA 5IYCH 2NVQH 2WFWA 5BR8Q 2PMZE 3KYHC 2K52A 1OXSC 5IYBG 1PH8A 4FDBA 1IBLL 1VQLA 5ELNA 3CP0A 1WCMH 1S3OA 3U50C 1VQOA 3F2CA 4JI3Q 4L5QA 1SN8A 3TS2A 2IHFA 2KCTA 1G291 4LFBQ 3BZCA 4ME3A 4A4IA 3PUZA 1N9WA 1UE5A 4JG2A 2Q2HA 4A3DH 2K5VA 3Q8DA 4A3MG 2UUBL 1VQEA 5FLMH 4JI2Q 2QGQA 1D8LA 1KC8C 2VQFQ 2F3IA 5M3FG 3PV0A 3S2DH 4A76A 3ULLA 1KRSA 3PO3H 1TXYA 1T9HA 4IFDI 1Z9FA 3BU2A 3CPFA 2XGTA 3I7FA 3TREA 5IT9c 1YJNA 2CKZB 4B3SL 4LW1A 3PF5A 4H02A 2NVXH 1XMQL 1WFQA 4JI1Q 4DUZQ 2Z0SA 4HIKA 1NBWA 4MTNA 4A3KH 3E9IA 3S1MH 3K81C 1EQRA 4HJ7A 1N34Q 3H3VI 4IOCA 4JI6L 1P16A 3A5ZB 4OWWB 5M5WH 4NXML 1NY4A 2ZTEA 1WOCA 4NPSA 2IY5B 4DK3C 2EXDA 1SE8A 1N33Q 4X66L 4B3ML 1PYSB 1UWVA 5C3EH 4GN3B 2ZJRA 3VDYA 2Q2TA 4A3GG 4P71A 3I4NH 4Y52H 1EWIA 1N32Q 2LXKA 2K5HA 5JEAG 1U0LA 3KFUA 1QZGA 5IWAL 1GD7A 1D7QA 4JBKA 4KHPQ 2N78A 4GNXB 4DV1L 3CCRA 4DNIA 4LF6L 4JYAL 1I5FA 2ES2A 5IE8A 4X65Q 1K83H 1MKHA 4R1JA 3J81j 1VQ9A 1XNQL 1QUQB 2IT1A 1HJPA 2GVAA 4A3JG 4OONA 1PH2A 3S14H 2VUMH 4YY3L 1MJCA 3CCVA 2R7DA 1PH5A 4BXXG 4PG3A 4AYBE 1L1OB 2NVYH 1A8VA 2OQKA 3AYHB 4YWMA 2VQEQ 2MQHA 1XMOQ 1IL2A 1YHBA 4AQYL 5FLMG 3H3VH 4IPCA 1VQCA 1SFOH 3CD6A 1VQIA 4LFCL 3CPWA 3CAMA 3I4MH 1VQKA 3T1HL 1X3FA 1Y14B 2JJQA 2D62A 1IBLQ 1NMGA 3GDEA 2B3GA 3PO2H 4IPDA 3HKZE 1VQMA 4UP8A 2BH8A 1EYGA 2E8GA 1CUKA 3UE1A 4LF9L 2N3SA 4OX9L 1FL0A 4HIMA 3UDFA 2JA6H 3HOVG 4P74A 4DKAC 5C44H 3OTOL 3JAMi 3K8AA 3S24A 4X64L 5AJ3L 1VQDA 2RHSB 2UUBQ 1L2FA 1I3QH 2E2IH 3ZJYC 1Q12A 5IP9G 4JI7L 4A3BG 2UUAL 4DV6L 4RG1A 4KLKA 4BY1G 5C3EG 1LM0A 3H15A 1YHQA 1XMQQ 1B7YB 1V1QA 3HOUH 3A5UA 2E2HH 4YCUA 3HOZH 5FJ8H 2R7FA 1Q81C 2K50A 4JI6Q 3CCQA 1GVPA 2CWPA 2IHEA 5ELOA 1N8RC 1I6HH 4A3FG 2UXBQ 3WWVA 2H5XA 4LF4L 2JEAI 1XNRQ 4C3IH 3S15H 1V43A 2UUCL 3AQQA 3NELA 4JOIC 1TWAH 4NB3A 4DUYL 4UP9A 1IXRA 2Q2UA 1P8LA 4X66Q 3F2DA 4B3MQ 1AE2A 2KBNA 2MO1A 4BBSH 3M85A 4HJ5A 5LMNL 4QIWE 3HOYH 2B63H 2AKWB 3KF6B 4JOIA 1XPOA 1TWFH 3LGJA 4EQ5A 3S16H 5IWAQ 1BVSA 4R4CA 2WB1G 4DV1Q 4DV2L 4A93H 1XNQQ 4QJFA 4HJ8A 4GOPB 3I56A 2R7ZG 5H1SE 4B3RL 4YY3Q 3AEVA 1EIFA 3CF5A 5LMUL 1UE1A 1TWHH 3HOWH 4GNXC 1PH3A 4EX5A 3KJOA 1CKOA 2VUMG 1IBMQ 4P75A 4AQYQ 2BA1A 3CMAA 1J5EL 1KD1C 1G6PA 1K8AC 4LF7L 3RLNA 4GNXA 1YNXA 2UU9Q 3PUVA 3T1HQ 1IBKQ 1L1OC 2JA8G 2R92G 1PYBA 3GTKH 4JI0Q 2UXCQ 4DR5L 1QUQA 3M4PA 2R93H 4P72A 3M4QA 4YCVA 1Y1VH 5IY0A 4LF9Q 3OW2A 1L1OA 1W3SA 2WAQE 3B6YA 3JAMc 4DV7L 1PHJA 3OTOQ 2D0PA 2JA9A 4X64Q 4DV3L 3H0GH 1VQBA 1HNZQ 4POGA 1PVOA 3ULJA 4UPAA 5C0XI 4P73A 3U4VA 3L2PA 3AFPA 5IYDG 1KQSA 1CKNB 4GN4B 1SROA 4J15A 4DR3L 3W1GA 4LF5L 2JA7H 3TRZA 5DLQE 4B3TL 2QA4A 1I50H 2LSSA 1W2BA 3NENA 5J3BA 4JI7Q 3K0XA 1X55A 4LWCA 5JJKA 3IRBA 4IOAA 2EQSA 3SGIA 1VQ8A 4QY7A 2UUAQ 1BBWA 1LUZA 2JA5H 1JJGA 1CSQA 1PV4A 4DAYB 1Q46A 3CC4A 3PGZA 4IFDJ 2V1CC 2HQLA 2JQOA 2BA0A 4A3EH 2PQAB 3PUXA 4O2DA 3DLLA 1HR0L 1OXUA 4JI5L 1YEZA 1Q82C 4A93G 1C9OA 3D0FA 4DPGA 2HHHL 3RLOA 5M3MG 4LF4Q 4JI8L 4BY7G 3GO5A 4JV5L 4DUYQ 2AWNA 4LUOA 4UY8C 4UP7A 1E24A 4AIMA 5IYCG 3F1ZA 2JK8A 1BBUA 1YJWA 4XTCS 2YTVA 3CCSA 1A62A 2CFMA 4IJHA 2ZTCA 4JBJA 3RLFA 5C4JH 3HOXH 4WJ3M 3PF4A 1KL9A 1WCMG 3KDFB 4GS3A 1B70B 5HY6A 4DV2Q 1OXXK 2YTXA 5C4XH 5GAHC 1VCIA 1B8AA 3E9HA 1FJGL 2NN6G 4PMWA 4DV5L 4QL5A 1I94L 2R93G 3L7ZC 1QVFA 4A3DG 2AHOB 2PNHA 3W1BA 5LMUQ 4BBRH 1A63A 4POFA 1M90C 4GKJL 1Q8KA 4A3IH 1SLJA 3L0OA 4K0KL 3RN2A 4A3CH 3KF6A 3H0GG 2ZTDA 4GOPC 1N36L 3PO3G 4L5RC 2F52A 2Y0SG 1PH7A 1J5EQ 2OWOA 1X9NA 1PH1A 3PSIA 4OO1G 1HZCA 5IP7H 4GOPA 2MFIA 4DR5Q 4LFAL 2HIVA 3RN5A 2VW9A 5GROA 4WJ4A 1VQAA 2E5LL 1VQHA 2VY3A 2A1AA 3BZKA 2JA5G 4YWKA 4A3KG 1UE6A 1EQQA 1X65A 1PH6A 4LNQA 5BR8L 4PZ8A 5JJLA 1HZAA 4DV3Q 3CC2A 4IO9A 1BKBA 4A75A 4YWLA 1KXLA 4JCVE 5LMNW 2DGYA 1X3GA 3E0EA 3FKIH 3GD7A 1VQ5A 2OTLA 4LF8L 1X54A 2VL6A 4LF5Q 4IPHA 1HH2P 4DR3Q 1O7IA 1YHAA 3TEHB 5GADC 2CWAA 2YV5A 4B3TQ 3GTOH 1X6OA 3HFZB 1E1OA 1Q86C 2OCEA 2L15A 4B3SQ 2ASBA 3KF8B 3S1RH 3I4NG 3RZOH 1UEBA 3F8TA 3PUYA 4Y7NH 4DR1L 3GTLH 4KI0A 2ZJPA 4DR2L 1HNWL 2VQFL 3GTGH 4QQBX 4BA1I 5IYBH 3UE0A 4NXMQ 3EN2A 4IFDG 1K0RA 4JI5Q 3J7A5 3RZDH 1HZ9A 2WP8J 1CKNA 3ERSX 1YIJA 2HHHQ 3M4OH 1CSPA 1G51A 1PFSA 1MJEA 4JI8Q 2I0QA 2YTYA 4IJLA 4JV5Q 4DUZL 5K36G 3A0JA 4AH6A 4R4IA 3OYYA 4DV4L 1Q1EA 4LF6Q 5M3FH 1NTGA 2B29A 4PZ6A 1JMCA 1SR3A 3I4OA 1VQNA 3I4MG 5GAEC 4JYAQ 2PQAA 1KIXA 2Y0SE 2N49A 4C2MH 3J81i 3RR5A 2Q2IA 3PO2G 1EUJA 4YHHL 1EOVA 2PI2A 5M5XH 1C0AA 1FJGQ 3CC7A 1I94Q 2JA6G 4DV5Q 3NBHB 5C44G 1A0IA 1VQFA 1J6QA 1XJVA 3S1QH 4KHPL 2IX0A 1CKMA 4LFCQ 1QVGA 1DGSA 3FKIG 1N36Q 1VQGA 1K73C 4ALPA 3T1YL 1HNXL 2HT1A 3KDFA 1YJ9A 1X3EA 1AE3A 1Z47A 4RMFA 4HIDA 1HR0W 4A3GH 2Z6KC 3AFQA 3J80i 1E7ZA 2F4VL 4OX9Q 4GKKL 4LFAQ 1Y1WH 1MIUA 3UDXA 3M7NA 2PI2E 3HOUG 4NXNL 3D31A 5AJ3Q 1GM5A 3HOZG 2UXDL 4X6AH 4QGUA 5FJ8G 2Z6KA 1Q7YC 4L5SA 3TS0A 1IZ6A 3GTMH 4X62L 4A3JH 4LF8Q 4OXPA 4BXXH 2FXQA 4AYBG 4DV6Q 1PA6A 2ZM6L 3EIVA 4BBSG 3TQYA 1FGUA 1PH4A 2CQOA 5C0XJ 2A19A 3HOYG 1WI5A 2B63G 4TQUS 4DR1Q 1E3PA 1ASYA 4DR7L 1KRTA 4DR2Q 4DV0L 1HNWQ 2NZOA 1IYJB 1R9TH 2E2JH 2WB1E 3CQZH 1OTCA 5JJIA 2I5HA 2UUCQ 3HKZG 4MZ9A 3J7ZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XPU A;  2OQ0 A;  3GTJ H;  2K5N A;  1SRU A;  3HOW G;  5LMN Q;  1OXV A;  3HOV H;  4GLV B;  1U5K A;  1H95 A;  3K7A H;  2GVB A;  3RNU A;  3K7U C;  4JBM A;  1OXT A;  4DK6 C;  1JJ2 A;  1E1T A;  1X56 A;  4IPG A;  4DV4 Q;  2NVT H;  4BA2 I;  4HJA A;  3UDG A;  2BH2 A;  2XTI A;  4MNO A;  2CCZ A;  5IP9 H;  4C3H H;  3KJP A;  3J81 c;  1QZH A;  3ICE A;  2UXB L;  4OWX B;  1XNR L;  1NJI C;  2YYZ A;  2VZA A;  1KAW A;  3MXN B;  3CME A;  4A3B H;  4R4Q A;  4B3R Q;  4A3L H;  4GLA C;  4YHH Q;  4BY1 H;  4DR4 L;  1Y1V G;  4DR6 L;  1YI2 A;  1YIT A;  1Y1W G;  4C3J H;  1K3R A;  4TVA B;  1WJJ A;  4YCW A;  1SMX A;  3PIO A;  2K75 A;  2K14 A;  4GN5 A;  4JBW A;  4O0A A;  1TWC H;  1VQ7 A;  4LF7 Q;  2ATW A;  1XPR A;  2JA7 G;  4A3F H;  4JI4 L;  1JJC B;  1L0W A;  3U4Z A;  3MEF A;  3T1Y Q;  1HNX Q;  2A8V A;  3J80 c;  1JB7 A;  3DM3 A;  4KHZ A;  1E22 A;  4L5T A;  3G4S A;  2F4V Q;  4JC0 A;  4GKK Q;  4DV7 Q;  1K9M C;  2MNA A;  2QEX A;  4PZ7 A;  4NXN Q;  3FP9 A;  4OWT B;  1IBM L;  2UXD Q;  1XTD A;  4A3E G;  1PH9 A;  2KHJ A;  4LUV A;  1NMF A;  5GAG C;  5HGQ A;  3KLW A;  2NZH A;  3I2Z A;  4HIO A;  2ZJQ A;  4JI3 L;  1HZB A;  3ER0 A;  1VS0 A;  3G48 A;  2UU9 L;  4XIG S;  1IBK L;  3GTP H;  1Q1B A;  2VS1 A;  4LFB L;  2R6G A;  4X62 Q;  4JI0 L;  2R7Z H;  2UXC L;  3NEM A;  1K8G A;  1JE5 A;  1YVC A;  3JC6 6;  4R4O A;  3CCL A;  5GQO A;  1EIY B;  3U58 A;  1M1K C;  3STB C;  2ZM6 Q;  3M3Y H;  1C7Y A;  4JI2 L;  1YZ6 A;  3S1N H;  2AMC B;  2EIF A;  3CCJ A;  1GO3 E;  3A74 A;  2C35 B;  3HOX G;  2KEN A;  2GN5 A;  1HNZ L;  4DAM A;  4HJ9 A;  3ULP A;  5C0X G;  4DR7 Q;  2HIX A;  1HR0 Q;  1AH9 A;  1GKH A;  2MO0 A;  4DV0 Q;  1WYD A;  2N8N A;  1S40 A;  5FLX c;  5C4X G;  1LTL A;  1LYL A;  2JA8 H;  2R92 H;  1QVC A;  2OTJ A;  1RL2 A;  2JEB I;  3STB D;  1JT8 A;  3KOJ A;  1RIP A;  3PCO B;  4JI1 L;  2KCM A;  4A3L G;  3M9B A;  3CCE A;  4A3M H;  2WAQ G;  2RCN A;  4BBR G;  1NE3 A;  2ALY B;  1N34 L;  4A3I G;  4A3C G;  4APV A;  3S2H H;  3GTQ H;  5IYD H;  1S72 A;  5E7N A;  2RHQ B;  1UE7 A;  3PUW A;  2YU9 H;  1YBY A;  2ID0 A;  4LUZ A;  1ASZ A;  1N33 L;  2I5L X;  1TWG H;  5JEA J;  5IP7 G;  1KHI A;  1N32 L;  2NN6 I;  2LXJ A;  4R4T A;  3S17 H;  3EBE A;  3FHW A;  3PIP A;  3F2B A;  3CXC A;  4DR4 Q;  4DR6 Q;  2DUD A;  4GKJ Q;  3HKS A;  2IX1 A;  2D0O A;  4K0K Q;  2AWO A;  3G6E A;  5EAY A;  3W5O A;  5M5Y H;  1V9P A;  1EFW A;  2JE6 I;  4X65 L;  1VQ6 A;  2VNU D;  3CW2 C;  2I5M X;  2K4K A;  3I55 A;  4GLX A;  1VQ4 A;  4JI4 Q;  3CCM A;  4OO1 I;  5M3M H;  3BJU A;  3UDI A;  4BY7 H;  3K80 C;  2RF4 A;  1VQJ A;  2VQE L;  3CCU A;  1FVI A;  3G71 A;  1VQP A;  1XMO L;  2E5L Q;  2KHI A;  5IYC H;  2NVQ H;  2WFW A;  5BR8 Q;  2PMZ E;  3KYH C;  2K52 A;  1OXS C;  5IYB G;  1PH8 A;  4FDB A;  1IBL L;  1VQL A;  5ELN A;  3CP0 A;  1WCM H;  1S3O A;  3U50 C;  1VQO A;  3F2C A;  4JI3 Q;  4L5Q A;  1SN8 A;  3TS2 A;  2IHF A;  2KCT A;  1G29 1;  4LFB Q;  3BZC A;  4ME3 A;  4A4I A;  3PUZ A;  1N9W A;  1UE5 A;  4JG2 A;  2Q2H A;  4A3D H;  2K5V A;  3Q8D A;  4A3M G;  2UUB L;  1VQE A;  5FLM H;  4JI2 Q;  2QGQ A;  1D8L A;  1KC8 C;  2VQF Q;  2F3I A;  5M3F G;  3PV0 A;  3S2D H;  4A76 A;  3ULL A;  1KRS A;  3PO3 H;  1TXY A;  1T9H A;  4IFD I;  1Z9F A;  3BU2 A;  3CPF A;  2XGT A;  3I7F A;  3TRE A;  5IT9 c;  1YJN A;  2CKZ B;  4B3S L;  4LW1 A;  3PF5 A;  4H02 A;  2NVX H;  1XMQ L;  1WFQ A;  4JI1 Q;  4DUZ Q;  2Z0S A;  4HIK A;  1NBW A;  4MTN A;  4A3K H;  3E9I A;  3S1M H;  3K81 C;  1EQR A;  4HJ7 A;  1N34 Q;  3H3V I;  4IOC A;  4JI6 L;  1P16 A;  3A5Z B;  4OWW B;  5M5W H;  4NXM L;  1NY4 A;  2ZTE A;  1WOC A;  4NPS A;  2IY5 B;  4DK3 C;  2EXD A;  1SE8 A;  1N33 Q;  4X66 L;  4B3M L;  1PYS B;  1UWV A;  5C3E H;  4GN3 B;  2ZJR A;  3VDY A;  2Q2T A;  4A3G G;  4P71 A;  3I4N H;  4Y52 H;  1EWI A;  1N32 Q;  2LXK A;  2K5H A;  5JEA G;  1U0L A;  3KFU A;  1QZG A;  5IWA L;  1GD7 A;  1D7Q A;  4JBK A;  4KHP Q;  2N78 A;  4GNX B;  4DV1 L;  3CCR A;  4DNI A;  4LF6 L;  4JYA L;  1I5F A;  2ES2 A;  5IE8 A;  4X65 Q;  1K83 H;  1MKH A;  4R1J A;  3J81 j;  1VQ9 A;  1XNQ L;  1QUQ B;  2IT1 A;  1HJP A;  2GVA A;  4A3J G;  4OON A;  1PH2 A;  3S14 H;  2VUM H;  4YY3 L;  1MJC A;  3CCV A;  2R7D A;  1PH5 A;  4BXX G;  4PG3 A;  4AYB E;  1L1O B;  2NVY H;  1A8V A;  2OQK A;  3AYH B;  4YWM A;  2VQE Q;  2MQH A;  1XMO Q;  1IL2 A;  1YHB A;  4AQY L;  5FLM G;  3H3V H;  4IPC A;  1VQC A;  1SFO H;  3CD6 A;  1VQI A;  4LFC L;  3CPW A;  3CAM A;  3I4M H;  1VQK A;  3T1H L;  1X3F A;  1Y14 B;  2JJQ A;  2D62 A;  1IBL Q;  1NMG A;  3GDE A;  2B3G A;  3PO2 H;  4IPD A;  3HKZ E;  1VQM A;  4UP8 A;  2BH8 A;  1EYG A;  2E8G A;  1CUK A;  3UE1 A;  4LF9 L;  2N3S A;  4OX9 L;  1FL0 A;  4HIM A;  3UDF A;  2JA6 H;  3HOV G;  4P74 A;  4DKA C;  5C44 H;  3OTO L;  3JAM i;  3K8A A;  3S24 A;  4X64 L;  5AJ3 L;  1VQD A;  2RHS B;  2UUB Q;  1L2F A;  1I3Q H;  2E2I H;  3ZJY C;  1Q12 A;  5IP9 G;  4JI7 L;  4A3B G;  2UUA L;  4DV6 L;  4RG1 A;  4KLK A;  4BY1 G;  5C3E G;  1LM0 A;  3H15 A;  1YHQ A;  1XMQ Q;  1B7Y B;  1V1Q A;  3HOU H;  3A5U A;  2E2H H;  4YCU A;  3HOZ H;  5FJ8 H;  2R7F A;  1Q81 C;  2K50 A;  4JI6 Q;  3CCQ A;  1GVP A;  2CWP A;  2IHE A;  5ELO A;  1N8R C;  1I6H H;  4A3F G;  2UXB Q;  3WWV A;  2H5X A;  4LF4 L;  2JEA I;  1XNR Q;  4C3I H;  3S15 H;  1V43 A;  2UUC L;  3AQQ A;  3NEL A;  4JOI C;  1TWA H;  4NB3 A;  4DUY L;  4UP9 A;  1IXR A;  2Q2U A;  1P8L A;  4X66 Q;  3F2D A;  4B3M Q;  1AE2 A;  2KBN A;  2MO1 A;  4BBS H;  3M85 A;  4HJ5 A;  5LMN L;  4QIW E;  3HOY H;  2B63 H;  2AKW B;  3KF6 B;  4JOI A;  1XPO A;  1TWF H;  3LGJ A;  4EQ5 A;  3S16 H;  5IWA Q;  1BVS A;  4R4C A;  2WB1 G;  4DV1 Q;  4DV2 L;  4A93 H;  1XNQ Q;  4QJF A;  4HJ8 A;  4GOP B;  3I56 A;  2R7Z G;  5H1S E;  4B3R L;  4YY3 Q;  3AEV A;  1EIF A;  3CF5 A;  5LMU L;  1UE1 A;  1TWH H;  3HOW H;  4GNX C;  1PH3 A;  4EX5 A;  3KJO A;  1CKO A;  2VUM G;  1IBM Q;  4P75 A;  4AQY Q;  2BA1 A;  3CMA A;  1J5E L;  1KD1 C;  1G6P A;  1K8A C;  4LF7 L;  3RLN A;  4GNX A;  1YNX A;  2UU9 Q;  3PUV A;  3T1H Q;  1IBK Q;  1L1O C;  2JA8 G;  2R92 G;  1PYB A;  3GTK H;  4JI0 Q;  2UXC Q;  4DR5 L;  1QUQ A;  3M4P A;  2R93 H;  4P72 A;  3M4Q A;  4YCV A;  1Y1V H;  5IY0 A;  4LF9 Q;  3OW2 A;  1L1O A;  1W3S A;  2WAQ E;  3B6Y A;  3JAM c;  4DV7 L;  1PHJ A;  3OTO Q;  2D0P A;  2JA9 A;  4X64 Q;  4DV3 L;  3H0G H;  1VQB A;  1HNZ Q;  4POG A;  1PVO A;  3ULJ A;  4UPA A;  5C0X I;  4P73 A;  3U4V A;  3L2P A;  3AFP A;  5IYD G;  1KQS A;  1CKN B;  4GN4 B;  1SRO A;  4J15 A;  4DR3 L;  3W1G A;  4LF5 L;  2JA7 H;  3TRZ A;  5DLQ E;  4B3T L;  2QA4 A;  1I50 H;  2LSS A;  1W2B A;  3NEN A;  5J3B A;  4JI7 Q;  3K0X A;  1X55 A;  4LWC A;  5JJK A;  3IRB A;  4IOA A;  2EQS A;  3SGI A;  1VQ8 A;  4QY7 A;  2UUA Q;  1BBW A;  1LUZ A;  2JA5 H;  1JJG A;  1CSQ A;  1PV4 A;  4DAY B;  1Q46 A;  3CC4 A;  3PGZ A;  4IFD J;  2V1C C;  2HQL A;  2JQO A;  2BA0 A;  4A3E H;  2PQA B;  3PUX A;  4O2D A;  3DLL A;  1HR0 L;  1OXU A;  4JI5 L;  1YEZ A;  1Q82 C;  4A93 G;  1C9O A;  3D0F A;  4DPG A;  2HHH L;  3RLO A;  5M3M G;  4LF4 Q;  4JI8 L;  4BY7 G;  3GO5 A;  4JV5 L;  4DUY Q;  2AWN A;  4LUO A;  4UY8 C;  4UP7 A;  1E24 A;  4AIM A;  5IYC G;  3F1Z A;  2JK8 A;  1BBU A;  1YJW A;  4XTC S;  2YTV A;  3CCS A;  1A62 A;  2CFM A;  4IJH A;  2ZTC A;  4JBJ A;  3RLF A;  5C4J H;  3HOX H;  4WJ3 M;  3PF4 A;  1KL9 A;  1WCM G;  3KDF B;  4GS3 A;  1B70 B;  5HY6 A;  4DV2 Q;  1OXX K;  2YTX A;  5C4X H;  5GAH C;  1VCI A;  1B8A A;  3E9H A;  1FJG L;  2NN6 G;  4PMW A;  4DV5 L;  4QL5 A;  1I94 L;  2R93 G;  3L7Z C;  1QVF A;  4A3D G;  2AHO B;  2PNH A;  3W1B A;  5LMU Q;  4BBR H;  1A63 A;  4POF A;  1M90 C;  4GKJ L;  1Q8K A;  4A3I H;  1SLJ A;  3L0O A;  4K0K L;  3RN2 A;  4A3C H;  3KF6 A;  3H0G G;  2ZTD A;  4GOP C;  1N36 L;  3PO3 G;  4L5R C;  2F52 A;  2Y0S G;  1PH7 A;  1J5E Q;  2OWO A;  1X9N A;  1PH1 A;  3PSI A;  4OO1 G;  1HZC A;  5IP7 H;  4GOP A;  2MFI A;  4DR5 Q;  4LFA L;  2HIV A;  3RN5 A;  2VW9 A;  5GRO A;  4WJ4 A;  1VQA A;  2E5L L;  1VQH A;  2VY3 A;  2A1A A;  3BZK A;  2JA5 G;  4YWK A;  4A3K G;  1UE6 A;  1EQQ A;  1X65 A;  1PH6 A;  4LNQ A;  5BR8 L;  4PZ8 A;  5JJL A;  1HZA A;  4DV3 Q;  3CC2 A;  4IO9 A;  1BKB A;  4A75 A;  4YWL A;  1KXL A;  4JCV E;  5LMN W;  2DGY A;  1X3G A;  3E0E A;  3FKI H;  3GD7 A;  1VQ5 A;  2OTL A;  4LF8 L;  1X54 A;  2VL6 A;  4LF5 Q;  4IPH A;  1HH2 P;  4DR3 Q;  1O7I A;  1YHA A;  3TEH B;  5GAD C;  2CWA A;  2YV5 A;  4B3T Q;  3GTO H;  1X6O A;  3HFZ B;  1E1O A;  1Q86 C;  2OCE A;  2L15 A;  4B3S Q;  2ASB A;  3KF8 B;  3S1R H;  3I4N G;  3RZO H;  1UEB A;  3F8T A;  3PUY A;  4Y7N H;  4DR1 L;  3GTL H;  4KI0 A;  2ZJP A;  4DR2 L;  1HNW L;  2VQF L;  3GTG H;  4QQB X;  4BA1 I;  5IYB H;  3UE0 A;  4NXM Q;  3EN2 A;  4IFD G;  1K0R A;  4JI5 Q;  3J7A 5;  3RZD H;  1HZ9 A;  2WP8 J;  1CKN A;  3ERS X;  1YIJ A;  2HHH Q;  3M4O H;  1CSP A;  1G51 A;  1PFS A;  1MJE A;  4JI8 Q;  2I0Q A;  2YTY A;  4IJL A;  4JV5 Q;  4DUZ L;  5K36 G;  3A0J A;  4AH6 A;  4R4I A;  3OYY A;  4DV4 L;  1Q1E A;  4LF6 Q;  5M3F H;  1NTG A;  2B29 A;  4PZ6 A;  1JMC A;  1SR3 A;  3I4O A;  1VQN A;  3I4M G;  5GAE C;  4JYA Q;  2PQA A;  1KIX A;  2Y0S E;  2N49 A;  4C2M H;  3J81 i;  3RR5 A;  2Q2I A;  3PO2 G;  1EUJ A;  4YHH L;  1EOV A;  2PI2 A;  5M5X H;  1C0A A;  1FJG Q;  3CC7 A;  1I94 Q;  2JA6 G;  4DV5 Q;  3NBH B;  5C44 G;  1A0I A;  1VQF A;  1J6Q A;  1XJV A;  3S1Q H;  4KHP L;  2IX0 A;  1CKM A;  4LFC Q;  1QVG A;  1DGS A;  3FKI G;  1N36 Q;  1VQG A;  1K73 C;  4ALP A;  3T1Y L;  1HNX L;  2HT1 A;  3KDF A;  1YJ9 A;  1X3E A;  1AE3 A;  1Z47 A;  4RMF A;  4HID A;  1HR0 W;  4A3G H;  2Z6K C;  3AFQ A;  3J80 i;  1E7Z A;  2F4V L;  4OX9 Q;  4GKK L;  4LFA Q;  1Y1W H;  1MIU A;  3UDX A;  3M7N A;  2PI2 E;  3HOU G;  4NXN L;  3D31 A;  5AJ3 Q;  1GM5 A;  3HOZ G;  2UXD L;  4X6A H;  4QGU A;  5FJ8 G;  2Z6K A;  1Q7Y C;  4L5S A;  3TS0 A;  1IZ6 A;  3GTM H;  4X62 L;  4A3J H;  4LF8 Q;  4OXP A;  4BXX H;  2FXQ A;  4AYB G;  4DV6 Q;  1PA6 A;  2ZM6 L;  3EIV A;  4BBS G;  3TQY A;  1FGU A;  1PH4 A;  2CQO A;  5C0X J;  2A19 A;  3HOY G;  1WI5 A;  2B63 G;  4TQU S;  4DR1 Q;  1E3P A;  1ASY A;  4DR7 L;  1KRT A;  4DR2 Q;  4DV0 L;  1HNW Q;  2NZO A;  1IYJ B;  1R9T H;  2E2J H;  2WB1 E;  3CQZ H;  1OTC A;  5JJI A;  2I5H A;  2UUC Q;  3HKZ G;  4MZ9 A;  3J7Z C; 
#chains in the Genus database with same CATH topology
 4B08 A;  5A35 A;  1EY4 A;  4J6H A;  3GTJ H;  2RDG A;  3HOV H;  4GLV B;  1H95 A;  1K83 B;  3TP8 A;  3RNU A;  4DK6 C;  4IPG A;  5KNB A;  4DV4 Q;  1EY5 A;  1QE6 A;  4IUV A;  2XTI A;  1CHQ D;  5IP9 H;  3KJP A;  3J81 c;  2EOT A;  1W6J A;  2A6E C;  2YYZ A;  1BCP D;  4BY1 H;  1SE4 A;  1HHV A;  4PMC A;  1UNS A;  3VYT A;  4DR6 L;  1YIT A;  4C3J H;  2PZT A;  2XRS D;  2K75 A;  3A7L A;  1TWC H;  4IUT A;  1WTX A;  4KJO A;  4K6L A;  4A3F H;  3A8K E;  1SDF A;  2HCC A;  3T1Y Q;  1O7L A;  1EYA A;  2F4V Q;  1BBX C;  4FF4 A;  1G2T A;  5CV5 A;  3NBH A;  3FP9 A;  1D1K A;  1RHP A;  1IBM L;  2FIN B;  4A3E G;  3X3M A;  3KLW A;  2ZJQ A;  4HIO A;  2UU9 L;  3G48 A;  4XIG S;  1F2Y A;  5T1I A;  1GUT A;  4X62 Q;  2UXC L;  1K8G A;  1JE5 A;  1SJH D;  2SNM A;  1I4H A;  2F0U A;  5GQO A;  3U58 A;  4R9W A;  1QJO A;  4KV6 A;  5JVH 3;  1WTW A;  4JI2 L;  2AMC B;  1MD2 D;  3CCJ A;  3A74 A;  3HOX G;  1AH9 A;  2KUM A;  1GKH A;  3OSO A;  1WYD A;  2HUG A;  3GP7 A;  1EYD A;  1QVC A;  2OTJ A;  2JEB I;  2B63 B;  1RIP A;  1TWF B;  2EY5 A;  4K5V A;  5DM7 3;  2RCN A;  1YNN C;  2ALY B;  1EU4 A;  2NTS A;  4HCE A;  1UUP A;  2F0G A;  1HCZ A;  3S2H H;  3HKZ B;  3L3O C;  1UE7 A;  1ASZ A;  1LTA D;  1MBY A;  1TWG H;  2Q8R E;  1TS4 A;  3S17 H;  4R4T A;  2EYF A;  3HEJ A;  1BO0 A;  3F2B A;  1ICF B;  4DR4 Q;  4GKJ Q;  2D0O A;  4K0K Q;  3G6E A;  4JVZ A;  3CW2 C;  2EYH A;  3T51 B;  3H3V C;  4IUU A;  3MXN A;  1FVI A;  3G71 A;  3K5L A;  1VQP A;  2KHI A;  2WFW A;  2PMZ E;  2RVL A;  4FDB A;  4E6I A;  2K28 A;  3CP0 A;  1BQQ T;  4RHR A;  3TS2 A;  3PUZ A;  1A2U A;  4XT3 B;  1N9W A;  1CA5 A;  4A3D H;  4A3E B;  2UUB L;  1C4Q A;  2VQF Q;  2A5H A;  2K05 A;  1CT1 D;  3S2D H;  1TXY A;  3CU7 A;  4IFD I;  3I7F A;  3HOX B;  3VA7 A;  4H02 A;  4JI1 Q;  1H9K A;  1N34 Q;  5CC4 A;  1WTR A;  3G7L A;  1NY4 A;  5KIX A;  2EXD A;  1SE8 A;  1N33 Q;  3DUZ A;  1F9Q A;  1AN8 A;  2LY7 A;  3N6R A;  2ZJR A;  2Q2T A;  4A3G G;  4C3J B;  2B2U A;  2RDF A;  1CQV A;  4P71 A;  3WOE A;  4DK1 A;  1N32 Q;  3GV6 A;  1U0L A;  1ROD A;  1FR3 A;  1TWC B;  1KAB A;  4GNX B;  1L0X B;  2K33 A;  4JYA L;  1I5F A;  4X65 Q;  1HJP A;  2GVA A;  1PH2 A;  4KY5 A;  4PG3 A;  5JPN C;  3E0J A;  1Y8P B;  2MQH A;  4U67 3;  3KLS X;  3Q24 A;  1LTB D;  1I4X A;  4IPC A;  1VQC A;  3NTH A;  4G7Z C;  1JQY D;  3HP3 A;  1VQI A;  3I4M H;  1NR2 A;  3GDE A;  3PO2 H;  2B2Y C;  4Y7N B;  4QB4 A;  1XXG A;  2BH8 A;  4OX9 L;  3D4D A;  3UE1 A;  1D5M C;  2N3S A;  1FL0 A;  4F87 A;  5I9O A;  2JA6 H;  3OTO L;  3JAM i;  2QIL A;  2E2I H;  1FD7 D;  3M4O B;  4JI7 L;  2RKS A;  2FHT A;  5C6A A;  4DV6 L;  4RG1 A;  3FRP B;  1LAB A;  1SYD A;  2JYO A;  1E2Z A;  4TSS A;  4YCU A;  3S2H B;  4I7A A;  4JI6 Q;  1GVP A;  2I07 B;  1I6H H;  3WWV A;  3SK6 A;  4IQZ A;  1XNR Q;  1V43 A;  1AEX A;  4JOI C;  1TWA H;  1R4P B;  1P8L A;  4EQN A;  4X66 Q;  2JXM B;  2A68 C;  2KBN A;  3F2D A;  4B3M Q;  4HJ5 A;  1DZ1 A;  3VR3 A;  1XPO A;  5ELF A;  1RD9 D;  4EQ5 A;  2G9D A;  4R4C A;  4DV2 L;  4A3G B;  3NP8 A;  4ZUI A;  3I73 A;  4C1N I;  5LMU L;  4RCN A;  4ODG A;  1DYQ A;  1PH3 A;  4EX5 A;  3KJO A;  1CKO A;  1PRT C;  1SEB D;  4P75 A;  4UAI A;  4PNY A;  2BA1 A;  5J22 A;  4KJN A;  1KD1 C;  1A2T A;  1YNX A;  3T1H Q;  3HG9 A;  1IBK Q;  2JA8 G;  3GTK H;  4JI0 Q;  1YNJ C;  4F88 A;  1L1O A;  1JE4 A;  1W3S A;  3JAM c;  1G2S A;  2E2J B;  3S2D B;  4X64 Q;  4POG A;  1G6Z A;  3I91 A;  4LF5 L;  4J15 A;  3JAM E;  4DR3 L;  5DLQ E;  2LSS A;  4OEM B;  1VQ8 A;  3SGI A;  3I72 A;  1BBW A;  2MPM A;  2JA5 H;  2NVT B;  5CMD A;  4KN4 C;  2DN8 A;  1S4Z A;  1WTV A;  2Z8L A;  4DAY B;  3CC4 A;  2HQL A;  2KOL A;  2BA0 A;  2PQA B;  3PUX A;  3R2T A;  1OXU A;  4OEL B;  2A73 B;  1PZJ D;  2HHH L;  5JOB A;  3F2U A;  4JI8 L;  3GO5 A;  2WKD A;  4K14 A;  4DUY Q;  4LUO A;  3R3O A;  3BVZ A;  3F1Z A;  1YJW A;  2EJF C;  1GXD C;  2L4N A;  4IJH A;  1EZ6 A;  1CFM A;  2A69 C;  5C0X H;  1KL9 A;  1WCM G;  4GS3 A;  4L6T B;  5C4X H;  3FVQ A;  1EQT A;  1VCI A;  1VMP A;  1KDB A;  1KAA A;  2R3Z A;  3I8Z A;  1I94 L;  4EQP A;  1FJG L;  4QL5 A;  5BN3 A;  5ELC A;  4PV1 C;  1OO9 B;  2AHO B;  4BBR H;  1BUV T;  4GKJ L;  5CR3 A;  5D3I B;  1EY6 A;  4NP5 A;  4K0K L;  2VB3 X;  2B8G A;  3KF6 A;  4X3K A;  3NQI A;  2F52 A;  2Y0S G;  1J5E Q;  4L5R C;  4RWS C;  3Q0A A;  5A2Q L;  3U9O A;  4FF3 A;  4OO1 G;  3N52 A;  1HZC A;  1T5X D;  3TZD A;  5C3W A;  4GOP A;  4LFA L;  1VQA A;  2JA5 G;  1VQH A;  2F0J A;  2A1A A;  4WRD A;  4YWK A;  1X65 A;  2JA8 B;  3TP6 A;  5IGD A;  4DV3 Q;  3CC2 A;  4YWL A;  4KY6 A;  3FKI H;  2F0Q A;  3GD7 A;  1VQ5 A;  1X54 A;  1HH2 P;  1O7I A;  5GAD C;  4B3T Q;  2XSC A;  2FFK B;  1E1O A;  1Q86 C;  4B3S Q;  2L15 A;  3RZO H;  1FYC A;  4DR2 L;  3TSS A;  1HNW L;  1PTO B;  1TS5 A;  5D14 A;  2VQF L;  2YU9 B;  4QQB X;  5EPK A;  4J8Q A;  5KNC A;  5E1F A;  3RZD H;  1HZ9 A;  1CKN A;  3VYR A;  1CSP A;  3SK4 A;  1CZW A;  1B9M A;  4K8I A;  2L1B A;  2YTY A;  5K36 G;  2F0H A;  5KYI A;  1H9S A;  4IUR A;  4R4I A;  1PZI D;  5M9O A;  1PXU A;  1W6K A;  1RDP D;  2EJM A;  4Q0F A;  1BCP F;  3IFD A;  4C2M H;  5CBA E;  4I65 A;  1F2Z A;  2WV6 D;  4YHH L;  1EY7 A;  4DV5 Q;  5G3L D;  3FPU B;  5C44 G;  1STH A;  1A0I A;  1WCM B;  1Y8N B;  3NXW A;  5CV4 A;  2CW0 D;  3S1Q H;  1CK1 A;  1DOL A;  1QVG A;  1DGS A;  3FKI G;  3CRL C;  1N36 Q;  4ALP A;  2HT1 A;  1YJ9 A;  3BVG A;  4RMF A;  1HR0 W;  3D3R A;  1PRT D;  3J80 i;  1EWC A;  2BDO A;  1MIU A;  4NXN L;  3D31 A;  3IL8 A;  5AJ3 Q;  3HOZ G;  2IW3 A;  3NUC A;  3KBG A;  3SK5 A;  4QGU A;  4X6A H;  5IIF A;  3OPO A;  1QOH A;  3DWP A;  1U4R A;  3K5N A;  3TS0 A;  3MA2 B;  1K8O A;  4C56 C;  4C3I G;  2MUY A;  4JW0 A;  3K5M A;  2JA5 B;  4OXP A;  1ESR A;  3R2I A;  4AYB G;  1PA6 A;  2ZM6 L;  3TQY A;  2CQO A;  5C0X J;  2A19 A;  1WI5 A;  4TQU S;  3RD4 A;  4DR1 Q;  1ASY A;  4DR7 L;  3MFG A;  4DV0 L;  4CJ0 B;  4HMJ A;  1RF2 D;  5KRU A;  1LLR D;  5JJI A;  2I5H A;  3AU7 A;  4MZ9 A;  1SND A;  2J0T D;  3I4L A;  1SRU A;  1BCP C;  3KF8 A;  1U5K A;  3K7U C;  4JBM A;  3S14 B;  4BA2 I;  3UI2 A;  4IZ8 A;  2NVY B;  4C3H H;  3ICE A;  1QZH A;  2LMC B;  4OWX B;  1XNR L;  1NJI C;  5CGK A;  4WFN 3;  1Y1V G;  1SFO B;  2A69 D;  2PZW A;  1K3R A;  3IKJ A;  4TVA B;  1WJJ A;  4X3S A;  1SMX A;  2NZ1 D;  1VQ7 A;  3SK8 A;  2XVS A;  1XPR A;  1HTP A;  4JI4 L;  1QNK A;  4DK0 A;  3U4Z A;  4OIK A;  1HNX Q;  5C44 B;  2PYK A;  3DXJ C;  3J80 c;  4KHZ A;  1E22 A;  2F3V A;  4L5T A;  4JC0 A;  1I4P A;  4QMG A;  2PQE A;  3TME A;  1LTG D;  2MNA A;  2QEX A;  3FKI B;  1Y8O B;  3BYT B;  3HS0 C;  4OWT B;  2UXD Q;  2KHJ A;  4LUV A;  1NMF A;  1SYE A;  4JI3 L;  3DEO A;  3BVM A;  3GTP H;  1IBK L;  4JI0 L;  1AZP A;  2R7Z H;  1KDC A;  3NEM A;  4DXG A;  2E2H B;  3HOZ B;  5KYL A;  1C7Y A;  3H09 A;  1YZ6 A;  2CH4 W;  4L8J A;  4MIU A;  2F3W A;  2MGS A;  2O5I C;  2KEN A;  2BCO A;  4C3I B;  1HR0 Q;  4R8N A;  3S15 B;  3GTM B;  4AYB B;  4LK1 C;  3A54 A;  1JT8 A;  3PCO B;  4CKC A;  5I6Y A;  1QG7 A;  1NE3 A;  4A3I G;  2NTT A;  1DD2 A;  4A3C G;  1WTH A;  3GTQ H;  1S72 A;  4DGZ A;  2M9V A;  1TWH B;  2RHQ B;  5CV8 A;  1D5X C;  1YBY A;  5IP7 G;  1H9J A;  2F0D A;  3PIP A;  2AWO A;  5EAY A;  1EFW A;  5IT9 L;  4H0L C;  4EGV A;  2I5M X;  3I55 A;  1VQ4 A;  1NCV A;  3CCM A;  4OO1 I;  5M3M H;  3BJU A;  5COR A;  3K80 C;  2RF4 A;  1SE2 A;  3CCU A;  1XMO L;  1LTI D;  1SYF A;  3E6Z X;  2E76 C;  1OXS C;  5IYB G;  1IBL L;  2XWB B;  3X3N A;  1S3O A;  3U50 C;  3BDC A;  4L5Q A;  2KCT A;  4QIW B;  4K6D A;  4X3T A;  4LFB Q;  3BZC A;  2NN6 H;  1UE5 A;  2Q2H A;  1HA6 A;  2K5V A;  3A55 A;  5BN4 A;  1VQE A;  3I3C A;  4M1U B;  2E75 C;  1WTQ A;  2RSN A;  5M3F G;  3H91 A;  4Q5V A;  1Z9F A;  3BU2 A;  3BYY B;  4MHE A;  2SNS A;  1YJN A;  5BN5 A;  2CKZ B;  4B3S L;  1HUM A;  4LW1 A;  1GUN A;  2Z0S A;  3MFY A;  5FK9 C;  4A3K H;  1EQR A;  3H3V I;  1DON A;  4IOC A;  4EQO A;  4OL7 A;  5M5W H;  1EYC A;  2ZTE A;  2B2U C;  1U4L A;  3DM1 A;  4DK3 C;  2B2V C;  5IGE A;  2CVR A;  1UEA B;  3NE5 B;  5C3E H;  4A3I B;  4XT1 B;  2KHS A;  4KMU C;  2LXK A;  3EJI A;  2K5H A;  5KEE A;  1DXM A;  3O13 A;  1GD7 A;  3D6C A;  1XWE A;  2ES2 A;  1VF7 A;  3OIQ A;  3OWE B;  4RGN A;  1QUQ B;  1TR5 A;  3CCV A;  1DOK A;  4BXX G;  1SSO A;  1LT5 D;  2EXZ A;  2OQK A;  4HAE A;  1E2W A;  4YWM A;  2VQE Q;  1AP0 A;  2PW7 A;  1MHW C;  2Q8I B;  1YHB A;  1LT3 D;  4AQY L;  2LS0 1;  3CD6 A;  3GTP B;  4RGT A;  3CAM A;  5E4X A;  2MJ8 A;  4UDU C;  3OMG A;  3KBX A;  4IPD A;  3GTL B;  1SNO A;  2F1M A;  2X6G A;  1EEI D;  1EYG A;  1CUK A;  2F0T A;  3HOV G;  4P74 A;  1NUC A;  3S24 A;  5AJ3 L;  2K04 A;  2RHS B;  1HRJ A;  4B9X A;  1QCB D;  4FF2 A;  4TKO B;  1PDQ A;  5EKK A;  1ILP A;  2HCI A;  1Q12 A;  1LTR D;  2PW5 A;  5IP9 G;  1I4R A;  3BZD B;  2UUA L;  2F0S A;  4BY1 G;  5C3E G;  1LM0 A;  3R8B A;  1S5B D;  5M3F B;  1YHQ A;  2HDM A;  1B7Y B;  3SHL A;  4C3J G;  1XMQ Q;  3A5U A;  2O2L D;  3J7A V;  1IYU A;  2L9H A;  1Q81 C;  1O7Y A;  5ISR A;  1NR4 A;  4IUQ A;  4A3F G;  2H5X A;  4LF4 L;  1HPC A;  4ZKC B;  3AQQ A;  3NEL A;  4NB3 A;  4XQN A;  2C5C A;  4BBS H;  2HD3 A;  1TS2 A;  4RHS A;  4O42 A;  2OF1 A;  3HOY H;  3S16 H;  5IWA Q;  3KUP A;  4DV1 Q;  4A93 H;  1JC7 A;  5A2Q E;  1XNQ Q;  4HJ8 A;  3QG1 A;  5H1S E;  2Z6B A;  4YY3 Q;  3AEV A;  5CYU A;  2L5T A;  3CF5 A;  3HOW H;  1C48 A;  1TS3 A;  1JOQ A;  3CMA A;  1G6P A;  1GJX A;  5HUR A;  2A6H D;  3PUV A;  4XYQ A;  3BDO A;  5JPM C;  1L1O C;  1PYB A;  1VMC A;  2EVB A;  3M4Q A;  4LF9 Q;  2D2C C;  3OW2 A;  2WAQ E;  5IOD A;  4EVO A;  3H0G H;  1TVX A;  5J1Z A;  1PFM A;  4P73 A;  3AFP A;  1X3Q A;  1KQS A;  1SRO A;  3TRZ A;  2HDL A;  2JA7 H;  3GTJ B;  3NPP A;  4JK1 C;  1I50 H;  4FXG C;  3HOV B;  2K1B A;  2EYJ A;  2ZXO A;  4LWC A;  4XDX A;  4IOA A;  4QY7 A;  3BDL A;  1NNX A;  1A6X A;  5M5W B;  4RFB A;  1BDO A;  1Q90 A;  1HR0 L;  4JI5 L;  1Q82 C;  4A93 G;  5C3E B;  4BY1 B;  4DPG A;  3OIP A;  1ET9 A;  2MP1 A;  2XWJ B;  2AWN A;  1PZK D;  4KN7 C;  2B2V A;  4AIM A;  3K57 A;  2WAC A;  3H94 A;  3E3X A;  1BBU A;  2YTV A;  4ZKB B;  3CCS A;  3RLF A;  4A3F B;  2ZTC A;  4JBJ A;  5JJZ A;  4KD4 A;  5C4J H;  4WJ3 M;  3PF4 A;  2QCP X;  5CV7 A;  2EPB A;  1B70 B;  5HY6 A;  5G3L F;  5COY A;  3E9H A;  3V96 A;  1IYV A;  1PTO D;  1QVF A;  4A3D G;  1JIC A;  4POF A;  1U4P A;  4PMB A;  1Q8K A;  1F9R A;  3H0G G;  2ZTD A;  1KDA A;  4GOP C;  1PRT F;  1CA6 A;  1S5C D;  3QO2 A;  1X9N A;  1L0Y B;  3PSI A;  4CGY B;  3C2P A;  2IJ0 A;  1TII D;  4DR5 Q;  2VW9 A;  4Z9C B;  4WJ4 A;  1E2V A;  2MHV A;  3K6O A;  1UE6 A;  4LNQ A;  1HZA A;  3KLR A;  1M8A A;  2NBF A;  4RA8 A;  2HQE A;  4A75 A;  4JCV E;  3E0E A;  1X3G A;  2OTL A;  4LF8 L;  5FOB B;  2VL6 A;  2D9U A;  3TEH B;  2CWA A;  2YV5 A;  1DCZ A;  3QR8 A;  2ASB A;  2OCE A;  2QF7 A;  1F9S A;  4WOR A;  3S1R H;  1UEB A;  2F0M A;  3F8T A;  1LAC A;  2JN4 A;  1BCP B;  1TWG B;  1TY2 A;  4RKB A;  3S17 B;  2WP8 J;  1YIJ A;  2XNA C;  4MN3 A;  3QJY A;  1MJE A;  1SYC A;  4JV5 Q;  5IOC A;  4AH6 A;  4A93 B;  4DV4 L;  2K5W A;  2VB2 X;  1FNW A;  1Q1E A;  4PZ6 A;  1VQN A;  3I4M G;  2CW0 C;  2KA7 A;  4KD3 A;  1KIX A;  2Y0S E;  2K32 A;  3PO2 G;  2Q2I A;  1EOV A;  5M5X H;  1K28 A;  3CC7 A;  2JA6 G;  4ZQ3 A;  2PZU A;  3NBH B;  4F8M A;  4HTH A;  4O1N A;  2F0O A;  1J6Q A;  1KTK A;  1PYW D;  1CKM A;  3T1Y L;  3KDF A;  4A3D B;  1X3E A;  1MGS A;  5TSS A;  2F4V L;  2K7V A;  5C3X A;  3UDX A;  3H0G B;  3M7N A;  1GM5 A;  5F2D A;  4H13 C;  4DA2 A;  2G5D A;  1Q7Y C;  3J81 L;  2ZXR A;  1STY A;  2KEC A;  2QDL A;  2EYO A;  2WKC A;  1XYI A;  4X62 L;  4A3J H;  1WD0 A;  1IL8 A;  2K01 A;  1JWS D;  3EIV A;  1IHZ A;  1ZEQ X;  1ZKO A;  2KCN A;  1Q8I A;  4BS9 A;  1E3P A;  1HUN A;  1DM0 B;  1R9T H;  2WB1 E;  3CQZ H;  1JWM D;  1OTC A;  2UUC Q;  3NK9 A;  3I90 A;  5IGB A;  3MXP A;  4ID6 A;  2PMZ B;  3J7Z C;  3T16 A;  2OQ0 A;  3TP5 A;  5C4J B;  3QOJ A;  2RBM A;  3K7A H;  3MHB A;  1V1P A;  1OXT A;  4RGM A;  5IT9 E;  1E1T A;  1JJ2 A;  3EQL C;  2BH2 A;  3RMH A;  4MNO A;  2CCZ A;  1ML0 D;  1TT2 A;  2DJG C;  4K5X A;  1ONL A;  3MXN B;  3CME A;  2Z4H A;  4R4Q A;  4A3B H;  4B3R Q;  1B9N A;  3J7Y W;  4DR4 L;  2B2T C;  3OOC A;  1WTP A;  3I4M B;  3QOL A;  3OMC A;  3VR6 A;  1EQV A;  3PIO A;  4LAA A;  3PO2 B;  4JBW A;  4O0A A;  2F0P A;  2ATW A;  3NSW A;  2IWH A;  2JA6 B;  3MEF A;  2A8V A;  1GOZ A;  2QW7 A;  3G4S A;  2H4O A;  3ONA B;  2E2I B;  4GKK Q;  3PMF A;  4PZ7 A;  3A8I E;  4N9P A;  5EKI A;  4NMZ A;  1SJE D;  1XTD A;  5HGQ A;  5GAG C;  1C8C A;  2F0E A;  3I2Z A;  2M2L A;  1HZB A;  1B3A A;  3ER0 A;  2XIW A;  2VS1 A;  2R6G A;  1TQO A;  1HTL D;  3JC6 6;  3CCL A;  3ZYY X;  1EIY B;  1M1K C;  3QB3 A;  4BWG B;  3M3Y H;  2TSS A;  3S1N H;  2EIF A;  1I6H B;  1GO3 E;  1HFG A;  2C35 B;  2DY8 A;  2EYP A;  4DAM A;  3DEP A;  3DHQ A;  5C0X G;  2MO0 A;  3VYU A;  1AW7 A;  1TWA B;  2N8N A;  5E3F A;  2PCF B;  5C4X G;  1LTL A;  2EY1 A;  3C1F A;  2EZV A;  2R92 H;  1RL2 A;  3STB D;  1RKN A;  4ZUJ A;  4JI1 L;  2KCM A;  3M9B A;  3CCE A;  1NAP A;  4A3M H;  4BBR G;  1N34 L;  3ERO A;  4NDX A;  2R61 A;  1HQM C;  1GHK A;  4APV A;  5IYD H;  5E7N A;  2NWG A;  1LV9 A;  3D4R A;  1N33 L;  2ID0 A;  2I5L X;  2B39 A;  5JEA J;  1KHI A;  1N32 L;  5LL6 S;  4DAV A;  3K0Y A;  4JPB W;  4DR6 Q;  2DUD A;  1SNQ A;  3GTK B;  1V9P A;  3HRZ C;  2JE6 I;  4X65 L;  1ZXT A;  2K4K A;  4QUF A;  4CBV A;  2IX3 A;  3T4A C;  1RCV D;  3UDI A;  4BY7 H;  4N8X 1;  1GUG A;  1VQJ A;  2E5L Q;  5IYC H;  2NVQ H;  1STN A;  5D3D A;  1HXY D;  1VQL A;  2FMC A;  1VQO A;  4U68 A;  1SN8 A;  2IHF A;  4ME3 A;  1JOR A;  1EWH A;  3E5S A;  3WOF A;  4A3M G;  4K8J A;  4JI2 Q;  1STE A;  2QGQ A;  1KC8 C;  3FDT A;  4V0B A;  2F3I A;  3PV0 A;  3ULL A;  1KRS A;  3PO3 H;  1CM9 A;  5JAV A;  1T9H A;  3W2D A;  3D8G A;  3CPF A;  3OW7 A;  2C9O A;  1D5Z C;  2NVX H;  3K7A B;  1WFQ A;  4DUZ Q;  1U4M A;  4HIK A;  1NBW A;  4MTN A;  5DAU A;  3T56 B;  3S1M H;  3K81 C;  3KLS A;  3U9S A;  5C4X B;  4JI6 L;  1P16 A;  3A5Z B;  1I4Q A;  1VF5 C;  1II3 A;  1WOC A;  3D4W A;  2IY5 B;  3EA6 A;  1IKM A;  4KK7 A;  4BBR B;  4X66 L;  4B3M L;  4GN3 B;  1FGB D;  5C4H A;  3I4N H;  2NB0 A;  5DM6 3;  4CDE C;  1QZG A;  5LL6 X;  5ELD A;  5FLX L;  1STA A;  2B2T A;  4JBK A;  2N78 A;  4KHP Q;  2L12 A;  2EY2 A;  5IGC A;  1X3P A;  4DNI A;  3CCR A;  4FVM A;  5IE8 A;  1K83 H;  1ENF A;  1LO5 D;  1MKH A;  2RSO A;  3J81 j;  2IT1 A;  1VQ9 A;  4IFD H;  1PH5 A;  1H9R A;  1L1O B;  1A8V A;  1I4G A;  1O7Z A;  2F03 A;  1IL2 A;  3OHX C;  1F77 A;  3HGB A;  2EYL A;  4RH6 A;  3T1H L;  1X3F A;  1Y14 B;  2JJQ A;  4CKB A;  3SVM A;  3RZO B;  1NMG A;  2B3G A;  2GA4 B;  2J7Z A;  3HKZ E;  2V4D A;  1VQM A;  2ENB A;  2E8G A;  2I46 A;  2QDB A;  4HIM A;  3K8A A;  3S9W A;  4X64 L;  2UUB Q;  3VR4 A;  1L2F A;  5KGU A;  3RZD B;  4QF4 A;  1SAP A;  1A3U A;  3ZJY C;  3FMC A;  4C3H G;  5J39 A;  2PNR C;  2BE5 D;  5I2X A;  4A3M B;  4CDF C;  1J9O A;  3H15 A;  3CHB D;  1QIL A;  5C5M A;  3BS1 A;  3HOU H;  1V1Q A;  1EL0 A;  2XN9 C;  1Q3L A;  5FJ8 H;  4C2M B;  2EY6 A;  3Q6S A;  3C1E A;  4HSP A;  2IHE A;  1N8R C;  1ENC A;  2UXB Q;  2JEA I;  5D65 A;  2UUC L;  3JAM L;  2Q2U A;  1EY9 A;  4DUY L;  1AE2 A;  2WIN B;  3S1Q B;  3M85 A;  2B63 H;  3KF6 B;  1FNU A;  1TWF H;  3LGJ A;  5DEH A;  4ZCK A;  1DOM A;  2L55 A;  4QJF A;  1R4Q B;  3SXH A;  5EPJ A;  4GOP B;  2R7Z G;  4B3R L;  2A6H C;  3D6W A;  3MEH A;  4GZY C;  2RDH A;  2AQ3 B;  1IKL A;  1J5E L;  4FXD A;  1K8A C;  5EPL A;  3RLN A;  4GNX A;  3L9A X;  4IN3 A;  3M4P A;  4P72 A;  4YCV A;  3B6Y A;  3OTO Q;  2JA9 A;  5ELE A;  4DV3 L;  2A74 C;  1VQB A;  1HNZ Q;  3ULJ A;  5C0X I;  3U4V A;  3L2P A;  1CKN B;  2EE1 A;  4GN4 B;  3W1G A;  2DJF C;  3TZU A;  2NUC A;  1W2B A;  4B3T L;  1JR0 D;  4JI7 Q;  3K0X A;  4KKT A;  1X55 A;  5JJK A;  2EQS A;  3J7A F;  1SBB B;  1H9S B;  1AZQ A;  5C5L A;  4LMQ D;  1PV4 A;  5I6W A;  3A7A B;  3SEB A;  4IFD J;  1JCK B;  2V1C C;  4C3H B;  5EKL A;  1S5F D;  4A3E H;  4O2D A;  3DLL A;  3RUZ A;  1ZYR C;  1YEZ A;  2L11 A;  2RQX A;  3RLO A;  5M3M G;  3SE0 A;  2KCC A;  1GHJ A;  1SYG A;  4UY8 C;  1E24 A;  2LFN A;  1PTO C;  2JK8 A;  4XQQ A;  2RCF A;  4DF7 A;  2CFM A;  3HOX H;  1SNP A;  3SR1 A;  1E0B A;  1PRT B;  1CTM A;  4DV2 Q;  1OXX K;  2YTX A;  4ZYS A;  1B8A A;  3IAY A;  2OT2 A;  2NN6 G;  4DV5 L;  1HQR D;  1CZG A;  4KHV A;  5LMU Q;  1WD1 A;  1A63 A;  1GUS A;  1S5D D;  4YIJ A;  5FKA C;  3J81 E;  3RN2 A;  3A8J E;  4OGQ C;  2R7Z B;  1N36 L;  1PH7 A;  2OWO A;  4ULL A;  1ENA A;  2MFI A;  2HIV A;  1ILQ A;  1B50 A;  2E5L L;  4L63 B;  2FMM A;  3BZK A;  3C46 A;  4A3K G;  1PH6 A;  4PZ8 A;  3T53 B;  5JJL A;  4IO9 A;  1BKB A;  2F0I A;  5LMN W;  2DGY A;  4LF5 Q;  4DR3 Q;  2F4I A;  3GTO H;  3LX0 A;  3HOU B;  3KF8 B;  2AUK A;  3PUY A;  5FO9 B;  4Y7N H;  4DR1 L;  3GTQ B;  1PFB A;  4KI0 A;  3EVQ A;  2ZJP A;  1JOO A;  2SOB A;  3P75 A;  3SDZ A;  3GTG H;  4BA1 I;  4IUN A;  3UE0 A;  5L37 A;  3DWA A;  4NXM Q;  3EN2 A;  1K0R A;  1ET6 A;  4HN7 A;  2EDG A;  4IAL A;  2HHH Q;  3M4O H;  4JI8 Q;  2I0Q A;  4DUZ L;  3A0J A;  3OYY A;  4ZLT F;  1B2T A;  4DAY A;  4LF6 Q;  3TDQ A;  1NTG A;  2B29 A;  5M3M B;  1SR3 A;  5GAE C;  2PQA A;  1RTN A;  4HCS A;  2N49 A;  3ERQ A;  1TKW B;  4HMI A;  1QB5 D;  1SXT A;  2PI2 A;  3C3L A;  1FJG Q;  1I94 Q;  2BOS A;  4XXE A;  1VQF A;  2AQ1 B;  2K03 A;  3DMU A;  4N9T A;  1XJV A;  2ZXP A;  4KHP L;  2IX0 A;  4LFC Q;  2ICE C;  1TU2 B;  4R8I A;  5KND A;  3P20 A;  1VQG A;  1K73 C;  1JOK A;  1HNX L;  1J8I A;  2QKI C;  1Z47 A;  2Z4I A;  4LJZ C;  4A3G H;  3AFQ A;  4LFA Q;  3LWU A;  1Y1W H;  2H1E A;  2PI2 E;  3VR2 A;  4I7Z C;  2UXD L;  2Z6K A;  1JWU D;  2B8F A;  1SMY D;  2IPK D;  3NQT A;  4DAP A;  3P1H A;  5DNF A;  1F2L A;  1KLG D;  4A3K B;  2FXQ A;  4BBS G;  3HOY G;  2FJ2 A;  2X6L A;  4N8F A;  5CBE E;  4DR2 Q;  2J4X A;  4ABN A;  1HNW Q;  1IYJ B;  2E2J H;  3J80 L;  4ZK9 B;  4X3U A;  5I2Y A;  1IW7 D;  4K5W A;  2DY7 A;  4KTA A;  1XPU A;  3K5O A;  2KQ3 A;  2K5N A;  3HOW G;  5LMN Q;  1OXV A;  1ZYR D;  3M4Y A;  4F7X A;  1TY0 A;  1EZ8 A;  2GVB A;  1MSH A;  2NVT H;  3LNN A;  2F0N A;  1X56 A;  2SEB D;  4HJA A;  3UDG A;  2UXB L;  1U9R A;  2VZA A;  1KAW A;  1G8Z D;  1B4O A;  3MWY W;  4GLA C;  4YHH Q;  4A3L H;  1JB3 A;  3MC0 B;  1YI2 A;  1Y1W G;  5FO8 B;  1PMR A;  4J1M A;  4YCW A;  3V2T A;  2K14 A;  1CHP D;  4GN5 A;  2A6E D;  4LF7 Q;  2KED A;  1PFN A;  2JA7 G;  1JJC B;  1L0W A;  2AQ2 B;  1JB7 A;  4HSV A;  3DM3 A;  4RCO A;  4DV7 Q;  1UAP A;  1K9M C;  4NXN Q;  1D1I A;  4H44 C;  3KK7 A;  3OWF A;  1PH9 A;  1KNA A;  2NZH A;  3GTO B;  4ME5 A;  1VS0 A;  1Q1B A;  4LFB L;  3URY A;  1O80 A;  1D6E C;  1X32 A;  1YVC A;  4R4O A;  4K2K A;  3MXU A;  3R93 A;  3P7J A;  3STB C;  5IGG A;  2ZM6 Q;  3GTG B;  2Z1C A;  2GN5 A;  1HNZ L;  3PQI A;  4HJ9 A;  3ULP A;  4DR7 Q;  2HIX A;  4FXK C;  2VXW A;  4DV0 Q;  3H6M A;  1S40 A;  1A15 A;  1O78 A;  5FLX c;  4BBS B;  1LYL A;  2JA8 H;  3NHH A;  3ITP A;  3HOY B;  3KOJ A;  2ZT9 C;  1WVL A;  4A3L G;  3S16 B;  2WAQ G;  5FLX E;  4CHT B;  2F0L A;  1EY0 A;  1STG A;  3GQB A;  1PTO H;  3PUW A;  2YU9 H;  4LUZ A;  3HOW B;  1YNN D;  3NTK A;  2NN6 I;  2LXJ A;  3EBE A;  3QWN A;  3FHW A;  4TRD A;  4DXF A;  3CXC A;  3VYS A;  3HKS A;  2ICI A;  2IX1 A;  1B44 D;  5EBC A;  3W5O A;  5M5Y H;  1VQ6 A;  2VNU D;  1EIG A;  1EFI D;  2BDN A;  4GLX A;  4JI4 Q;  1Y1W B;  4KKS A;  1BXT A;  3K58 A;  2OEO A;  2VQE L;  4QUC A;  2E2D C;  5JEA H;  2D5D A;  1B1Z A;  5BR8 Q;  2JA7 B;  3KYH C;  2K52 A;  1I50 B;  2F0F A;  1PH8 A;  2O5J C;  5ELN A;  3TBI B;  1SYB A;  1WCM H;  1V8Q A;  3F2C A;  4JI3 Q;  2AUJ D;  1CI3 M;  1G29 1;  4A4I A;  4ZRZ A;  3Q22 A;  4JG2 A;  1K3B C;  1A3T A;  2K6A A;  4RGO S;  3Q8D A;  5FLM H;  1D8L A;  1F2M A;  3CKI B;  2DNC A;  4A76 A;  2F0K A;  2KEE A;  4ZAI A;  3CRK C;  2XGT A;  3TRE A;  4OO1 H;  5IT9 c;  4DN4 M;  2PO4 A;  1KNE A;  3PF5 A;  1XMQ L;  3E9I A;  4HJ7 A;  1BOS A;  3NTI A;  5NUC A;  4ILW A;  4OWW B;  4NXM L;  1FNV A;  4CDC C;  1G91 A;  4NPS A;  1ICW A;  4S3S A;  4K2L A;  2CQA A;  2WAQ B;  4OHJ A;  1PYS B;  1UWV A;  3VDY A;  1K8M A;  4Y52 H;  1EWI A;  2PPB C;  3BG3 A;  3AB9 A;  5JEA G;  3KFU A;  1XTC D;  3EFX D;  5IWA L;  1D7Q A;  2K5Q A;  3MTS A;  4DV1 L;  4LF6 L;  2N55 A;  2P5Z X;  1XNQ L;  4R1J A;  4A3J G;  3S14 H;  4OON A;  2VUM H;  4YY3 L;  1MJC A;  2R7D A;  4AYB E;  2NVY H;  5CV6 A;  3AYH B;  4UHV A;  1XMO Q;  5K36 H;  1K0S A;  5FLM G;  1M4V A;  3H3V H;  1SFO H;  5JVG 3;  2K5D A;  4LFC L;  3CPW A;  1VQK A;  1IBL Q;  2D62 A;  2N88 A;  1LT6 D;  1VDZ A;  3S1R B;  4DNR B;  2O4X A;  1H9M A;  4CJ2 C;  3AMU A;  4UP8 A;  2BE5 C;  4PQX A;  4LF9 L;  4QCL A;  1GUO A;  3UDF A;  4DKA C;  4XQJ A;  5C44 H;  1Z7T A;  3IFT A;  1VQD A;  2B2Y A;  1V1O A;  1I3Q H;  2JP1 A;  3TN2 A;  1PLF A;  4FYD A;  3MZ5 A;  5AFW A;  4A3B G;  1F9P A;  4KLK A;  5I4D A;  5EQ0 A;  1B53 A;  4FP5 D;  2E2H H;  3HOZ H;  2R7F A;  2K50 A;  2WII B;  3CCQ A;  2CWP A;  5ELO A;  5M5X B;  2Q8T A;  3PIO 3;  4DFA A;  2XRQ D;  4C3I H;  3S15 H;  2VUM G;  3GTM H;  4HED A;  4UP9 A;  1IXR A;  1DJR D;  2MO1 A;  2X69 A;  1I6V C;  5LMN L;  4QIW E;  5EJW A;  4G7H C;  2AKW B;  5M5Y B;  1EY8 A;  4JOI A;  4FNF A;  3GV3 A;  1RTO A;  5I9P A;  4M8A A;  1WTO A;  3QIA A;  3NWT A;  1BVS A;  2F0W A;  2WB1 G;  3T13 A;  5HGT A;  1BNZ A;  4H7B A;  1EEF D;  2A68 D;  3I56 A;  1LTT D;  4RAU C;  1EIF A;  4CDD C;  1UE1 A;  1TWH H;  4DNT B;  2B2W C;  2LKV A;  1A3V A;  1MSG A;  4GNX C;  1IBM Q;  4A3J B;  4AQY Q;  5K5P A;  4CJ1 B;  4LF7 L;  2UU9 Q;  1EOT A;  1XX8 A;  1Z6H A;  1SNM A;  4CKE A;  2R92 G;  2UXC Q;  2CHB D;  4DR5 L;  1QUQ A;  2R93 H;  3M7G A;  1Y1V H;  5IY0 A;  4DV7 L;  1R9T B;  2Z9H A;  1PHJ A;  2D0P A;  2Y0S B;  3CQZ B;  1PVO A;  3FPP A;  4UPA A;  3WDN A;  1D2B A;  3HZX A;  3VR5 A;  5IYD G;  1STB A;  3ND9 A;  1YNJ D;  5T1G A;  2QA4 A;  2DNE A;  3DWQ A;  3NEN A;  5J3B A;  5C4Z A;  3IRB A;  4P2C B;  1BR9 A;  1LUZ A;  5FO7 B;  2UUA Q;  1JJG A;  4NKL A;  1CSQ A;  3NWS A;  5EGT A;  1Q46 A;  3K59 A;  3PGZ A;  2JQO A;  1S5E D;  4V19 0;  2L0C A;  4A3B B;  5E4W C;  5ELB A;  1C9O A;  3Q23 A;  3D0F A;  4LF4 Q;  4BY7 G;  3FEW X;  4JV5 L;  4KKU A;  4UP7 A;  4FO2 A;  5IYC G;  2NYZ D;  1ESF A;  2KJX A;  4XTC S;  1A62 A;  5LHY 1;  2G9H D;  2QEJ C;  2VUM B;  3KDF B;  2KVM A;  4MTK A;  1GUW A;  5GAH C;  4PMW A;  1RJT A;  2R93 G;  3L7Z C;  4WJW A;  2RA4 A;  2PNH A;  3W1B A;  4OIJ A;  2WB1 B;  1M90 C;  4A3I H;  1SLJ A;  3L0O A;  4A3C H;  1SE3 A;  4C1N K;  3PO3 G;  3M3Y B;  1PH1 A;  4NW2 A;  2OXP A;  3S1N B;  3I70 A;  5IP7 H;  3RN5 A;  5GRO A;  2VY3 A;  1I3Q B;  5CV9 A;  1EQQ A;  5BR8 L;  2R92 B;  1CQF A;  3J80 E;  1KXL A;  3G6J B;  2IL8 A;  2EJG C;  2E74 C;  4IPH A;  2TMP A;  1YHA A;  1X6O A;  3HFZ B;  3I4N G;  2F0V A;  1V1P B;  3GTL H;  5IYB H;  4G7O C;  4IFD G;  1EU3 A;  3TP7 A;  4JI5 Q;  3J7A 5;  3ERS X;  4XYO A;  4RKL A;  4DU9 A;  1PFS A;  1G51 A;  5IGF A;  4IJL A;  3V05 A;  1HFN A;  3MVV A;  2EYM A;  5M3F H;  4JYA Q;  1JMC A;  1PTO F;  3I4O A;  4BY7 B;  4G57 A;  3A56 A;  4FF1 A;  3J81 i;  3RR5 A;  1B3Q A;  1EUJ A;  3W3A A;  2NVQ B;  4G4K A;  1SNC A;  1C0A A;  1LT4 D;  1LTS D;  2B2W A;  1BF4 A;  2R93 B;  1AFP A;  1SMY C;  1Y1V B;  1MI2 A;  1AE3 A;  4HID A;  2Z6K C;  1E7Z A;  3LWE A;  3MAQ A;  1Y69 U;  4OX9 Q;  4GKK L;  5EBD A;  2M00 A;  3HOU G;  3PO3 B;  5FJ8 G;  2CH4 A;  3ND8 A;  4L5S A;  3VA5 A;  1IZ6 A;  1NSN S;  2JSO A;  2NVX B;  4LF8 Q;  1QNU A;  4BXX H;  1HA5 A;  3S1M B;  4DV6 Q;  1T5E A;  4HR7 B;  1FGU A;  1IW7 C;  1PH4 A;  2B63 G;  1QWY A;  3PIP 3;  4IUP A;  1KRT A;  4KY7 A;  2NZO A;  1KLU D;  2SDF A;  4B9W A;  3I4N B;  1EIH A;  3NBI A;  3HKZ G;  3MXG A; 
#chains in the Genus database with same CATH homology
 1XPU A;  2OQ0 A;  3GTJ H;  2K5N A;  1SRU A;  3HOW G;  5LMN Q;  1OXV A;  3HOV H;  4GLV B;  1U5K A;  1H95 A;  3K7A H;  2GVB A;  3RNU A;  3K7U C;  4JBM A;  1OXT A;  4DK6 C;  1JJ2 A;  1E1T A;  1X56 A;  4IPG A;  4DV4 Q;  2NVT H;  4BA2 I;  4HJA A;  3UDG A;  2BH2 A;  2XTI A;  4MNO A;  2CCZ A;  5IP9 H;  4C3H H;  3KJP A;  3J81 c;  1QZH A;  3ICE A;  2UXB L;  4OWX B;  1XNR L;  1NJI C;  2YYZ A;  2VZA A;  1KAW A;  3MXN B;  3CME A;  4A3B H;  4R4Q A;  4B3R Q;  4A3L H;  4GLA C;  4YHH Q;  4BY1 H;  4DR4 L;  1Y1V G;  4DR6 L;  1YI2 A;  1YIT A;  1Y1W G;  4C3J H;  1K3R A;  4TVA B;  1WJJ A;  4YCW A;  1SMX A;  3PIO A;  2K75 A;  2K14 A;  4GN5 A;  4JBW A;  4O0A A;  1TWC H;  1VQ7 A;  4LF7 Q;  2ATW A;  1XPR A;  2JA7 G;  4A3F H;  4JI4 L;  1JJC B;  1L0W A;  3U4Z A;  3MEF A;  3T1Y Q;  1HNX Q;  2A8V A;  3J80 c;  1JB7 A;  3DM3 A;  4KHZ A;  1E22 A;  4L5T A;  3G4S A;  2F4V Q;  4JC0 A;  4GKK Q;  4DV7 Q;  1K9M C;  2MNA A;  2QEX A;  4PZ7 A;  4NXN Q;  3FP9 A;  4OWT B;  1IBM L;  2UXD Q;  1XTD A;  4A3E G;  1PH9 A;  2KHJ A;  4LUV A;  1NMF A;  5GAG C;  5HGQ A;  3KLW A;  2NZH A;  3I2Z A;  4HIO A;  2ZJQ A;  4JI3 L;  1HZB A;  3ER0 A;  1VS0 A;  3G48 A;  2UU9 L;  4XIG S;  1IBK L;  3GTP H;  1Q1B A;  2VS1 A;  4LFB L;  2R6G A;  4X62 Q;  4JI0 L;  2R7Z H;  2UXC L;  3NEM A;  1K8G A;  1JE5 A;  1YVC A;  3JC6 6;  4R4O A;  3CCL A;  5GQO A;  1EIY B;  3U58 A;  1M1K C;  3STB C;  2ZM6 Q;  3M3Y H;  1C7Y A;  4JI2 L;  1YZ6 A;  3S1N H;  2AMC B;  2EIF A;  3CCJ A;  1GO3 E;  3A74 A;  2C35 B;  3HOX G;  2KEN A;  2GN5 A;  1HNZ L;  4DAM A;  4HJ9 A;  3ULP A;  5C0X G;  4DR7 Q;  2HIX A;  1HR0 Q;  1AH9 A;  1GKH A;  2MO0 A;  4DV0 Q;  1WYD A;  2N8N A;  1S40 A;  5FLX c;  5C4X G;  1LTL A;  1LYL A;  2JA8 H;  2R92 H;  1QVC A;  2OTJ A;  1RL2 A;  2JEB I;  3STB D;  1JT8 A;  3KOJ A;  1RIP A;  3PCO B;  4JI1 L;  2KCM A;  4A3L G;  3M9B A;  3CCE A;  4A3M H;  2WAQ G;  2RCN A;  4BBR G;  1NE3 A;  2ALY B;  1N34 L;  4A3I G;  4A3C G;  4APV A;  3S2H H;  3GTQ H;  5IYD H;  1S72 A;  5E7N A;  2RHQ B;  1UE7 A;  3PUW A;  2YU9 H;  1YBY A;  2ID0 A;  4LUZ A;  1ASZ A;  1N33 L;  2I5L X;  1TWG H;  5JEA J;  5IP7 G;  1KHI A;  1N32 L;  2NN6 I;  2LXJ A;  4R4T A;  3S17 H;  3EBE A;  3FHW A;  3PIP A;  3F2B A;  3CXC A;  4DR4 Q;  4DR6 Q;  2DUD A;  4GKJ Q;  3HKS A;  2IX1 A;  2D0O A;  4K0K Q;  2AWO A;  3G6E A;  5EAY A;  3W5O A;  5M5Y H;  1V9P A;  1EFW A;  2JE6 I;  4X65 L;  1VQ6 A;  2VNU D;  3CW2 C;  2I5M X;  2K4K A;  3I55 A;  4GLX A;  1VQ4 A;  4JI4 Q;  3CCM A;  4OO1 I;  5M3M H;  3BJU A;  3UDI A;  4BY7 H;  3K80 C;  2RF4 A;  1VQJ A;  2VQE L;  3CCU A;  1FVI A;  3G71 A;  1VQP A;  1XMO L;  2E5L Q;  2KHI A;  5IYC H;  2NVQ H;  2WFW A;  5BR8 Q;  2PMZ E;  3KYH C;  2K52 A;  1OXS C;  5IYB G;  1PH8 A;  4FDB A;  1IBL L;  1VQL A;  5ELN A;  3CP0 A;  1WCM H;  1S3O A;  3U50 C;  1VQO A;  3F2C A;  4JI3 Q;  4L5Q A;  1SN8 A;  3TS2 A;  2IHF A;  2KCT A;  1G29 1;  4LFB Q;  3BZC A;  4ME3 A;  4A4I A;  3PUZ A;  1N9W A;  1UE5 A;  4JG2 A;  2Q2H A;  4A3D H;  2K5V A;  3Q8D A;  4A3M G;  2UUB L;  1VQE A;  5FLM H;  4JI2 Q;  2QGQ A;  1D8L A;  1KC8 C;  2VQF Q;  2F3I A;  5M3F G;  3PV0 A;  3S2D H;  4A76 A;  3ULL A;  1KRS A;  3PO3 H;  1TXY A;  1T9H A;  4IFD I;  1Z9F A;  3BU2 A;  3CPF A;  2XGT A;  3I7F A;  3TRE A;  5IT9 c;  1YJN A;  2CKZ B;  4B3S L;  4LW1 A;  3PF5 A;  4H02 A;  2NVX H;  1XMQ L;  1WFQ A;  4JI1 Q;  4DUZ Q;  2Z0S A;  4HIK A;  1NBW A;  4MTN A;  4A3K H;  3E9I A;  3S1M H;  3K81 C;  1EQR A;  4HJ7 A;  1N34 Q;  3H3V I;  4IOC A;  4JI6 L;  1P16 A;  3A5Z B;  4OWW B;  5M5W H;  4NXM L;  1NY4 A;  2ZTE A;  1WOC A;  4NPS A;  2IY5 B;  4DK3 C;  2EXD A;  1SE8 A;  1N33 Q;  4X66 L;  4B3M L;  1PYS B;  1UWV A;  5C3E H;  4GN3 B;  2ZJR A;  3VDY A;  2Q2T A;  4A3G G;  4P71 A;  3I4N H;  4Y52 H;  1EWI A;  1N32 Q;  2LXK A;  2K5H A;  5JEA G;  1U0L A;  3KFU A;  1QZG A;  5IWA L;  1GD7 A;  1D7Q A;  4JBK A;  4KHP Q;  2N78 A;  4GNX B;  4DV1 L;  3CCR A;  4DNI A;  4LF6 L;  4JYA L;  1I5F A;  2ES2 A;  5IE8 A;  4X65 Q;  1K83 H;  1MKH A;  4R1J A;  3J81 j;  1VQ9 A;  1XNQ L;  1QUQ B;  2IT1 A;  1HJP A;  2GVA A;  4A3J G;  4OON A;  1PH2 A;  3S14 H;  2VUM H;  4YY3 L;  1MJC A;  3CCV A;  2R7D A;  1PH5 A;  4BXX G;  4PG3 A;  4AYB E;  1L1O B;  2NVY H;  1A8V A;  2OQK A;  3AYH B;  4YWM A;  2VQE Q;  2MQH A;  1XMO Q;  1IL2 A;  1YHB A;  4AQY L;  5FLM G;  3H3V H;  4IPC A;  1VQC A;  1SFO H;  3CD6 A;  1VQI A;  4LFC L;  3CPW A;  3CAM A;  3I4M H;  1VQK A;  3T1H L;  1X3F A;  1Y14 B;  2JJQ A;  2D62 A;  1IBL Q;  1NMG A;  3GDE A;  2B3G A;  3PO2 H;  4IPD A;  3HKZ E;  1VQM A;  4UP8 A;  2BH8 A;  1EYG A;  2E8G A;  1CUK A;  3UE1 A;  4LF9 L;  2N3S A;  4OX9 L;  1FL0 A;  4HIM A;  3UDF A;  2JA6 H;  3HOV G;  4P74 A;  4DKA C;  5C44 H;  3OTO L;  3JAM i;  3K8A A;  3S24 A;  4X64 L;  5AJ3 L;  1VQD A;  2RHS B;  2UUB Q;  1L2F A;  1I3Q H;  2E2I H;  3ZJY C;  1Q12 A;  5IP9 G;  4JI7 L;  4A3B G;  2UUA L;  4DV6 L;  4RG1 A;  4KLK A;  4BY1 G;  5C3E G;  1LM0 A;  3H15 A;  1YHQ A;  1XMQ Q;  1B7Y B;  1V1Q A;  3HOU H;  3A5U A;  2E2H H;  4YCU A;  3HOZ H;  5FJ8 H;  2R7F A;  1Q81 C;  2K50 A;  4JI6 Q;  3CCQ A;  1GVP A;  2CWP A;  2IHE A;  5ELO A;  1N8R C;  1I6H H;  4A3F G;  2UXB Q;  3WWV A;  2H5X A;  4LF4 L;  2JEA I;  1XNR Q;  4C3I H;  3S15 H;  1V43 A;  2UUC L;  3AQQ A;  3NEL A;  4JOI C;  1TWA H;  4NB3 A;  4DUY L;  4UP9 A;  1IXR A;  2Q2U A;  1P8L A;  4X66 Q;  3F2D A;  4B3M Q;  1AE2 A;  2KBN A;  2MO1 A;  4BBS H;  3M85 A;  4HJ5 A;  5LMN L;  4QIW E;  3HOY H;  2B63 H;  2AKW B;  3KF6 B;  4JOI A;  1XPO A;  1TWF H;  3LGJ A;  4EQ5 A;  3S16 H;  5IWA Q;  1BVS A;  4R4C A;  2WB1 G;  4DV1 Q;  4DV2 L;  4A93 H;  1XNQ Q;  4QJF A;  4HJ8 A;  4GOP B;  3I56 A;  2R7Z G;  5H1S E;  4B3R L;  4YY3 Q;  3AEV A;  1EIF A;  3CF5 A;  5LMU L;  1UE1 A;  1TWH H;  3HOW H;  4GNX C;  1PH3 A;  4EX5 A;  3KJO A;  1CKO A;  2VUM G;  1IBM Q;  4P75 A;  4AQY Q;  2BA1 A;  3CMA A;  1J5E L;  1KD1 C;  1G6P A;  1K8A C;  4LF7 L;  3RLN A;  4GNX A;  1YNX A;  2UU9 Q;  3PUV A;  3T1H Q;  1IBK Q;  1L1O C;  2JA8 G;  2R92 G;  1PYB A;  3GTK H;  4JI0 Q;  2UXC Q;  4DR5 L;  1QUQ A;  3M4P A;  2R93 H;  4P72 A;  3M4Q A;  4YCV A;  1Y1V H;  5IY0 A;  4LF9 Q;  3OW2 A;  1L1O A;  1W3S A;  2WAQ E;  3B6Y A;  3JAM c;  4DV7 L;  1PHJ A;  3OTO Q;  2D0P A;  2JA9 A;  4X64 Q;  4DV3 L;  3H0G H;  1VQB A;  1HNZ Q;  4POG A;  1PVO A;  3ULJ A;  4UPA A;  5C0X I;  4P73 A;  3U4V A;  3L2P A;  3AFP A;  5IYD G;  1KQS A;  1CKN B;  4GN4 B;  1SRO A;  4J15 A;  4DR3 L;  3W1G A;  4LF5 L;  2JA7 H;  3TRZ A;  5DLQ E;  4B3T L;  2QA4 A;  1I50 H;  2LSS A;  1W2B A;  3NEN A;  5J3B A;  4JI7 Q;  3K0X A;  1X55 A;  4LWC A;  5JJK A;  3IRB A;  4IOA A;  2EQS A;  3SGI A;  1VQ8 A;  4QY7 A;  2UUA Q;  1BBW A;  1LUZ A;  2JA5 H;  1JJG A;  1CSQ A;  1PV4 A;  4DAY B;  1Q46 A;  3CC4 A;  3PGZ A;  4IFD J;  2V1C C;  2HQL A;  2JQO A;  2BA0 A;  4A3E H;  2PQA B;  3PUX A;  4O2D A;  3DLL A;  1HR0 L;  1OXU A;  4JI5 L;  1YEZ A;  1Q82 C;  4A93 G;  1C9O A;  3D0F A;  4DPG A;  2HHH L;  3RLO A;  5M3M G;  4LF4 Q;  4JI8 L;  4BY7 G;  3GO5 A;  4JV5 L;  4DUY Q;  2AWN A;  4LUO A;  4UY8 C;  4UP7 A;  1E24 A;  4AIM A;  5IYC G;  3F1Z A;  2JK8 A;  1BBU A;  1YJW A;  4XTC S;  2YTV A;  3CCS A;  1A62 A;  2CFM A;  4IJH A;  2ZTC A;  4JBJ A;  3RLF A;  5C4J H;  3HOX H;  4WJ3 M;  3PF4 A;  1KL9 A;  1WCM G;  3KDF B;  4GS3 A;  1B70 B;  5HY6 A;  4DV2 Q;  1OXX K;  2YTX A;  5C4X H;  5GAH C;  1VCI A;  1B8A A;  3E9H A;  1FJG L;  2NN6 G;  4PMW A;  4DV5 L;  4QL5 A;  1I94 L;  2R93 G;  3L7Z C;  1QVF A;  4A3D G;  2AHO B;  2PNH A;  3W1B A;  5LMU Q;  4BBR H;  1A63 A;  4POF A;  1M90 C;  4GKJ L;  1Q8K A;  4A3I H;  1SLJ A;  3L0O A;  4K0K L;  3RN2 A;  4A3C H;  3KF6 A;  3H0G G;  2ZTD A;  4GOP C;  1N36 L;  3PO3 G;  4L5R C;  2F52 A;  2Y0S G;  1PH7 A;  1J5E Q;  2OWO A;  1X9N A;  1PH1 A;  3PSI A;  4OO1 G;  1HZC A;  5IP7 H;  4GOP A;  2MFI A;  4DR5 Q;  4LFA L;  2HIV A;  3RN5 A;  2VW9 A;  5GRO A;  4WJ4 A;  1VQA A;  2E5L L;  1VQH A;  2VY3 A;  2A1A A;  3BZK A;  2JA5 G;  4YWK A;  4A3K G;  1UE6 A;  1EQQ A;  1X65 A;  1PH6 A;  4LNQ A;  5BR8 L;  4PZ8 A;  5JJL A;  1HZA A;  4DV3 Q;  3CC2 A;  4IO9 A;  1BKB A;  4A75 A;  4YWL A;  1KXL A;  4JCV E;  5LMN W;  2DGY A;  1X3G A;  3E0E A;  3FKI H;  3GD7 A;  1VQ5 A;  2OTL A;  4LF8 L;  1X54 A;  2VL6 A;  4LF5 Q;  4IPH A;  1HH2 P;  4DR3 Q;  1O7I A;  1YHA A;  3TEH B;  5GAD C;  2CWA A;  2YV5 A;  4B3T Q;  3GTO H;  1X6O A;  3HFZ B;  1E1O A;  1Q86 C;  2OCE A;  2L15 A;  4B3S Q;  2ASB A;  3KF8 B;  3S1R H;  3I4N G;  3RZO H;  1UEB A;  3F8T A;  3PUY A;  4Y7N H;  4DR1 L;  3GTL H;  4KI0 A;  2ZJP A;  4DR2 L;  1HNW L;  2VQF L;  3GTG H;  4QQB X;  4BA1 I;  5IYB H;  3UE0 A;  4NXM Q;  3EN2 A;  4IFD G;  1K0R A;  4JI5 Q;  3J7A 5;  3RZD H;  1HZ9 A;  2WP8 J;  1CKN A;  3ERS X;  1YIJ A;  2HHH Q;  3M4O H;  1CSP A;  1G51 A;  1PFS A;  1MJE A;  4JI8 Q;  2I0Q A;  2YTY A;  4IJL A;  4JV5 Q;  4DUZ L;  5K36 G;  3A0J A;  4AH6 A;  4R4I A;  3OYY A;  4DV4 L;  1Q1E A;  4LF6 Q;  5M3F H;  1NTG A;  2B29 A;  4PZ6 A;  1JMC A;  1SR3 A;  3I4O A;  1VQN A;  3I4M G;  5GAE C;  4JYA Q;  2PQA A;  1KIX A;  2Y0S E;  2N49 A;  4C2M H;  3J81 i;  3RR5 A;  2Q2I A;  3PO2 G;  1EUJ A;  4YHH L;  1EOV A;  2PI2 A;  5M5X H;  1C0A A;  1FJG Q;  3CC7 A;  1I94 Q;  2JA6 G;  4DV5 Q;  3NBH B;  5C44 G;  1A0I A;  1VQF A;  1J6Q A;  1XJV A;  3S1Q H;  4KHP L;  2IX0 A;  1CKM A;  4LFC Q;  1QVG A;  1DGS A;  3FKI G;  1N36 Q;  1VQG A;  1K73 C;  4ALP A;  3T1Y L;  1HNX L;  2HT1 A;  3KDF A;  1YJ9 A;  1X3E A;  1AE3 A;  1Z47 A;  4RMF A;  4HID A;  1HR0 W;  4A3G H;  2Z6K C;  3AFQ A;  3J80 i;  1E7Z A;  2F4V L;  4OX9 Q;  4GKK L;  4LFA Q;  1Y1W H;  1MIU A;  3UDX A;  3M7N A;  2PI2 E;  3HOU G;  4NXN L;  3D31 A;  5AJ3 Q;  1GM5 A;  3HOZ G;  2UXD L;  4X6A H;  4QGU A;  5FJ8 G;  2Z6K A;  1Q7Y C;  4L5S A;  3TS0 A;  1IZ6 A;  3GTM H;  4X62 L;  4A3J H;  4LF8 Q;  4OXP A;  4BXX H;  2FXQ A;  4AYB G;  4DV6 Q;  1PA6 A;  2ZM6 L;  3EIV A;  4BBS G;  3TQY A;  1FGU A;  1PH4 A;  2CQO A;  5C0X J;  2A19 A;  3HOY G;  1WI5 A;  2B63 G;  4TQU S;  4DR1 Q;  1E3P A;  1ASY A;  4DR7 L;  1KRT A;  4DR2 Q;  4DV0 L;  1HNW Q;  2NZO A;  1IYJ B;  1R9T H;  2E2J H;  2WB1 E;  3CQZ H;  1OTC A;  5JJI A;  2I5H A;  2UUC Q;  3HKZ G;  4MZ9 A;  3J7Z C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...