3A5UA

Promiscuity and specificity in dna binding to ssb: insights from the structure of the mycobacterium smegmatis ssb-ssdna complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
119
structure length
118
Chain Sequence
MAGDTTITVVGNLTADPELRFTPSGAAVANFTVASTPRMFDRQSGEWKDGEALFLRCNIWREAAENVAESLTRGSRVIVTGRLKQRSFTREGEKRTVVEVEVDEIGPSLRYATAKVNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Promiscuity and specificity in DNA binding to SSB: Insights from the structure of the Mycobacterium smegmatis SSB-ssDNA complex.
rcsb
source organism Mycobacterium smegmatis
molecule tags Dna binding protein
molecule keywords Single-stranded DNA-binding protein
total genus 18
structure length 118
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3a5uA00
4LUOA 4IPHA 2F3IA 3GDEA 5M5YH 1VQ7A 4B3ML 3EIVA 4LFBL 2ZM6Q 1G51A 2VQEL 1UEBA 4IPDA 2VW9A 2R7ZG 1A0IA 3RN2A 4OO1G 1TWFH 3DLLA 3EN2A 1M90C 5GADC 4B3SL 3J80c 1VQMA 4R4QA 1TXYA 4JOIA 3T1HL 2LSSA 2UXCL 3EBEA 2NVYH 2EIFA 2VQFL 1XNRL 2IT1A 3PO3H 2JEBI 1VQOA 3UDFA 4R4TA 1Y1VG 1LTLA 5IE8A 1PA6A 1M1KC 3TREA 2IHEA 2F4VL 3S1QH 3NELA 2OTLA 4KLKA 5H1SE 3Q8DA 3RLOA 1VQ9A 4JI2L 3TEHB 3AFQA 1PH4A 4JI4Q 4PMWA 4X65L 1X55A 1X6OA 5C3EG 4IOCA 1EOVA 4HJ7A 1K9MC 4L5SA 3HOZG 1G6PA 2ZTCA 3I2ZA 4C3IH 3J7ZC 2WAQG 2ASBA 3HOVH 2JA5G 4JV5Q 2ZTEA 1SN8A 3PCOB 1V43A 2MFIA 3KOJA 4HIKA 4YCVA 5C0XJ 3A5ZB 5C44H 1GO3E 4JI6Q 1XPUA 3PSIA 4P74A 4WJ3M 3JAMc 3CMEA 5C44G 4DR1Q 1I3QH 4NB3A 4AH6A 1HZAA 4A93G 2AKWB 3HFZB 2JA5H 1JMCA 1D8LA 2I5LX 4GOPB 3HOVG 1FGUA 3HOZH 4K0KQ 4DV4Q 1GVPA 1Z9FA 3ULPA 1NE3A 2BA1A 4LF6L 5C3EH 2CFMA 4X66Q 4UP7A 1BVSA 2WAQE 5ELNA 1EIFA 3U50C 4DPGA 5M5XH 1H95A 4GNXC 1FVIA 4X64Q 3ZJYC 4DV0Q 1BKBA 2L15A 3I4OA 1Q1EA 1L2FA 3W1BA 1PH8A 1Y1VH 2IY5B 4QQBX 3PO3G 3UDXA 3ER0A 1X65A 4YWMA 1IBKQ 4B3RL 1K73C 2BH2A 4HIDA 4NXNL 1A62A 1Q7YC 3H3VH 1NY4A 4PZ7A 4YWLA 2R7ZH 3S14H 4JI1L 1QZGA 4LUZA 4DV6Q 5C4XG 2CWAA 4AYBG 4GOPC 5LMNQ 4GKJQ 1IYJB 2A19A 3PUWA 4AQYL 4BXXG 4DV2Q 4DV1L 1B70B 1IBML 2AWNA 2Q2IA 3ULJA 5FLMH 1C9OA 4L5QA 4DV2L 1N34Q 4AQYQ 5E7NA 3CF5A 4A3MG 1VQ8A 4OX9Q 5IT9c 5C4JH 1WCMG 3J80i 2ID0A 3RLNA 4DAYB 2R92G 3J7A5 3S2DH 2VUMH 5C4XH 1Q8KA 2N8NA 1YITA 4DK6C 3CC7A 1MJEA 1KQSA 1B7YB 3ICEA 2WFWA 1K8AC 5M3FG 1CKMA 1JJCB 1VQKA 1PH7A 3J81j 1YBYA 2B29A 4DR2L 4NXNQ 4DV7L 1A63A 1VCIA 3HOXH 3BZKA 5FJ8G 4A3DG 1GM5A 1IXRA 5LMUQ 4BBSH 1PVOA 5JJKA 3KJOA 4ALPA 2I5MX 4IJHA 4A3KH 1XPOA 3D0FA 3BZCA 1SFOH 1KHIA 3G6EA 2JA7H 1NMGA 1MIUA 4X64L 4DV0L 2K52A 1B8AA 3CCMA 1T9HA 3A5UA 2NN6G 3RZDH 2XGTA 3I4NG 2B3GA 2OQ0A 4LFCL 4X66L 3I55A 4WJ4A 3B6YA 3M4QA 5GAHC 4HJ8A 4BY7G 4HJ9A 3L0OA 1KL9A 4C2MH 2A1AA 3HOUH 5JEAJ 4R4CA 1Q46A 3U4ZA 4DR3Q 4A3FH 2UUCQ 3CD6A 4A3EG 3BJUA 4KHZA 1K8GA 3UE1A 1UE5A 2EXDA 1KIXA 3NENA 3MEFA 3GTQH 4A3IG 1YEZA 4JYAQ 1NMFA 4LF7Q 4NXMQ 4JV5L 3J81i 3M4PA 1AE2A 5IP7G 3KF6B 4Y7NH 2BH8A 1YNXA 2XTIA 1N32L 2OTJA 3GTOH 2R93G 2JE6I 4A4IA 1Y1WG 3CP0A 5C0XG 3F2CA 4JI4L 2JA8H 1WJJA 2HIXA 3CW2C 4MZ9A 3LGJA 3TS0A 4LF9L 1I6HH 4OWXB 3A74A 2F4VQ 3KLWA 2AMCB 4IPCA 3SGIA 2ES2A 2YYZA 1EIYB 1RIPA 2MNAA 3HKZE 3G48A 4R1JA 3K81C 1PFSA 1I50H 4JC0A 3K0XA 3FKIH 4DR5L 1OXVA 4H02A 3T1HQ 1C0AA 2CKZB 2E2IH 4X6AH 2R7FA 4B3SQ 1LYLA 3H3VI 4PZ6A 5IWAQ 1S3OA 4IFDI 2KBNA 4EX5A 2ZTDA 5FLXc 4POGA 4MNOA 4YWKA 1UE7A 5HGQA 1Q82C 4KHPL 1XTDA 4JI3Q 2ZM6L 4P73A 4LFBQ 3STBC 3RN5A 4B3MQ 1SE8A 1HNZL 3W1GA 2JA6G 1PH2A 3RZOH 4QY7A 3S17H 3K80C 3S1MH 4GKKL 3L7ZC 4YY3Q 1GKHA 1HZCA 2GVBA 3GTLH 2UXDL 3M7NA 4HIMA 4KI0A 1U5KA 1KRSA 1VQEA 1X54A 1SLJA 4BY1G 1XNQQ 1EQRA 4QIWE 1X3GA 3CQZH 1VQCA 1E7ZA 2HHHL 4B3TQ 4TQUS 2PNHA 2F52A 1J5EQ 2IX1A 1I94Q 1QVCA 1IZ6A 2Q2UA 1YIJA 2I0QA 1PYSB 4P71A 5IP9H 4XIGS 5M3MG 4Y52H 2Q2HA 2EQSA 2Z6KC 5IYBG 4A3JH 2ZJQA 1YI2A 3I4MG 4IFDJ 1GD7A 1YVCA 4JI5Q 3CPWA 3CCJA 1VQPA 3K8AA 2AHOB 5AJ3L 2UUBQ 4O2DA 1VQIA 1VQ5A 1Q81C 1AE3A 4LF5L 1Y14B 5BR8Q 3PF5A 1WOCA 3KDFA 3WWVA 4JI7L 2RCNA 3GO5A 4LF4Q 4DV3L 1CSPA 2R7DA 4DR4L 4DUYL 3KDFB 1HR0L 4GNXA 4IFDG 1QVFA 4X62L 2UXBL 4LF8Q 3OTOQ 2NZHA 5IYCH 4L5TA 2ATWA 4DV5Q 2E5LL 1VQ6A 1UE6A 4C3JH 4A3BH 1OXUA 4GLVB 1EWIA 2NVTH 4BBRG 5GAGC 2H5XA 2VNUD 1XMQQ 2JQOA 4LFAQ 3JAMi 2C35B 1E1OA 3VDYA 3W5OA 1VS0A 3S1RH 3HOWH 4HJ5A 3CCUA 1XMOQ 5JEAG 1N36Q 4QL5A 4AYBE 4YHHL 1HZBA 3PF4A 1VQHA 1XMQL 1Q1BA 2JJQA 1I5FA 3TS2A 1Q86C 1TWCH 3GTGH 3HOYH 3ERSX 3F2BA 4JBWA 3OW2A 1YJWA 1SR3A 1JB7A 1CUKA 4P75A 2E5LQ 1P8LA 5IYDG 4DV5L 3HKZG 3T1YQ 3PUVA 3H15A 1TWHH 3CC4A 2DGYA 3BU2A 2YTYA 3AYHB 1K83H 2FXQA 4DR6Q 1L1OC 1CKNB 3H0GH 1PV4A 4JBKA 4XTCS 1FJGL 1CKNA 2K5HA 3E9IA 3U58A 1LUZA 3MXNB 3PO2H 4A3CH 4EQ5A 1HNWL 2NZOA 4JI7Q 2B63H 2CQOA 1PHJA 2Q2TA 2CCZA 4A3LG 4A75A 3I7FA 4GLXA 2PI2E 1XPRA 2HQLA 1J6QA 5ELOA 4JI5L 1X9NA 1PYBA 4PG3A 3RLFA 5LMNW 3KFUA 3E0EA 4A3GG 1HZ9A 2N49A 1MJCA 3PUXA 1IBLL 3GTMH 3M4OH 1U0LA 3GTJH 1JE5A 5JJIA 1KAWA 3AFPA 2D0OA 3NEMA 3CCQA 4HIOA 1QUQB 2UUAL 1I94L 3S16H 3S1NH 4BA1I 1WYDA 1J5EL 4B3TL 4UP9A 2A8VA 3KF8B 3GD7A 1KD1C 4QGUA 1L1OB 1FL0A 1XNQL 4JI8Q 2PI2A 1Q12A 2KHJA 3AQQA 4YY3L 4A3GH 2E2HH 5HY6A 4LNQA 4GN5A 3PUZA 1SRUA 3PIOA 1HNZQ 2Y0SE 4A3LH 4LWCA 4JI3L 3TRZA 2B63G 1ASYA 4KHPQ 1EFWA 2R6GA 2WB1E 4A3CG 3PO2G 5IWAL 2OCEA 1DGSA 3H0GG 1VQGA 1CKOA 1X56A 4YCWA 4A93H 3FP9A 2GN5A 2YTVA 3K7AH 4DUZQ 4DR5Q 4JI0L 4OO1I 4OONA 2QGQA 2RHSB 2ZJRA 2D0PA 1N33L 1K3RA 1VQAA 1D7QA 3TQYA 4OXPA 3DM3A 2NVXH 5IYDH 1IL2A 2V1CC 4DR7Q 4ME3A 3FHWA 4GLAC 2YU9H 4LF9Q 4IJLA 1WFQA 3HOYG 1L0WA 4P72A 3GTKH 3PUYA 5K36G 3GTPH 1SMXA 1E3PA 2VY3A 5C0XI 4NPSA 2UU9Q 2Y0SG 1N32Q 1N9WA 4JBJA 4JG2A 3HOWG 1VQDA 2UU9L 2MO0A 3JC66 4LF7L 4NXML 4BBRH 3U4VA 2K4KA 4JYAL 4POFA 4GS3A 2K14A 2E2JH 4A3BG 3CCEA 4DR7L 3S24A 3F8TA 3STBD 4DR3L 2UUCL 3AEVA 2MQHA 1OXTA 1YHQA 1N33Q 5IYCG 4DUZL 4JI0Q 4LFCQ 1YHBA 2KENA 1PH3A 4R4OA 4L5RC 2NN6I 3ULLA 1VQLA 3RR5A 1XJVA 3RNUA 1BBUA 2IHFA 2MO1A 5LMUL 2BA0A 2I5HA 5GQOA 4MTNA 5GROA 1KC8C 3M9BA 4DV7Q 4DR2Q 4A76A 5IYBH 4A3JG 1E22A 2IX0A 2JA9A 5GAEC 3I4MH 2Z0SA 5M3MH 1V1QA 3PV0A 4JI8L 5IP9G 3S15H 4TVAB 4AIMA 1YJNA 1ASZA 2K5NA 1G291 1L1OA 3L2PA 2HT1A 1W3SA 3PGZA 4DKAC 1NJIC 4IO9A 4HJAA 3D31A 1N8RC 2JK8A 2UUAQ 4GN3B 1VQ4A 2RF4A 1N34L 4BY1H 2CWPA 4OX9L 4BA2I 3CMAA 4IPGA 1EQQA 3F1ZA 1SROA 1O7IA 5DLQE 1IBLQ 4DV1Q 1K0RA 4DK3C 1IBMQ 3CAMA 1KRTA 4DNIA 2JA6H 5LMNL 4GKJL 2K75A 5EAYA 4DV6L 3F2DA 3A0JA 4JI1Q 3UE0A 1HNWQ 1PH9A 4OWWB 2KCTA 1E24A 1TWAH 1FJGQ 1KXLA 3G4SA 4BBSG 4IOAA 3S2HH 4DR6L 1MKHA 3FKIG 2PMZE 5M5WH 4B3RQ 1IBKL 1VQFA 4PZ8A 3T1YL 2ZJPA 4UY8C 2YTXA 2KHIA 1EYGA 1NTGA 2PQAB 3CCVA 2VZAA 4J15A 2OWOA 4DAMA 1QZHA 2JA8G 2K5VA 2N78A 4RMFA 1Y1WH 1A8VA 1EUJA 1UWVA 4YHHQ 2HIVA 3G71A 4R4IA 3UDIA 3M85A 1XMOL 1N36L 2R93H 4O0AA 5IP7H 4DV4L 1VQJA 4LF6Q 4K0KL 2VS1A 4LFAL 1S40A 4A3IH 1PH5A 1QVGA 3IRBA 2WP8J 4GKKQ 4DR1L 1TWGH 2AWOA 2JEAI 2RHQB 4A3EH 3K7UC 2KCMA 4A3FG 2ALYB 4JI6L 3KJPA 2E8GA 4FDBA 3KF6A 1C7YA 3CPFA 3HOUG 3M3YH 4UP8A 4RG1A 1S72A 4BY7H 4YCUA 1VQBA 2K50A 4JBMA 3OTOL 4X65Q 1W2BA 3I4NH 4LF8L 1E1TA 1YJ9A 2UXBQ 4X62Q 4QJFA 4JI2Q 1RL2A 1HR0Q 2JA7G 4DUYQ 1OXSC 3HKSA 1V9PA 4DR4Q 4OWTB 4DV3Q 1HR0W 4APVA 4A3KG 4LF4L 5BR8L 1Z47A 2D62A 3J81c 4LF5Q 3KYHC 1XNRQ 2VQFQ 2WB1G 3UDGA 5AJ3Q 3I56A 2UUBL 5J3BA 2QA4A 5JJLA 1JT8A 4A3DH 5FJ8H 3HOXG 2UXCQ 3CC2A 4LUVA 2LXJA 1AH9A 1UE1A 2NVQH 1CSQA 1X3FA 2LXKA 3NBHB 4GNXB 4JCVE 1BBWA 1HH2P 2PQAA 3E9HA 2VL6A 5M3FH 3CCRA 1WI5A 2VQEQ 2N3SA 1HJPA 2Z6KA 3PIPA 2QEXA 3CCSA 4LW1A 1P16A 1QUQA 4C3HH 3CCLA 2VUMG 4JOIC 4UPAA 1YHAA 1PH6A 1PH1A 1JJ2A 2HHHQ 1WCMH 2GVAA 3CXCA 2R92H 1JJGA 4A3MH 2YV5A 1HNXQ 1YZ6A 1X3EA 4GN4B 2OQKA 1OXXK 5FLMG 5IY0A 1R9TH 1VQNA 2UXDQ 1OTCA 1NBWA 4BXXH 1HNXL 4GOPA 1LM0A 3OYYA 2DUDA
chains in the Genus database with same CATH superfamily
1VQ7A 1B9NA 2K6AA 1Y1VB 3WDNA 2R7ZG 1A0IA 5LL6X 3SK6A 3RN2A 1EYDA 4ULLA 3R2IA 3DLLA 4B3SL 2FMMA 4R4QA 4JOIA 1E2ZA 3A8KE 1NUCA 1CHQD 1PRTB 2NUCA 3UDFA 3NELA 1EWHA 5EBCA 2OT2A 1VQ9A 4A3DB 1PH4A 5FO7B 1EOVA 2XRSD 2MGSA 3V05A 5C4HA 2WAQG 3EROA 3SHLA 1QCBD 2WACA 1V43A 3PCOB 4JI6Q 4A93H 3FPPA 2K28A 3A5ZB 5C44H 1GO3E 3CMEA 3VYSA 3AU7A 2AKWB 5IGGA 4DU9A 3HOVG 1C4QA 3ULPA 1BCPC 4LF6L 1NE3A 5C3XA 5C3EH 2WAQE 5KNCA 5ELNA 4WFN3 3U50C 4DPGA 3HOXB 4C56C 5M5YB 3I73A 2O5JC 3A54A 1M4VA 4K5XA 4AYBB 2IY5B 5COYA 5CBAE 1DONA 1G6ZA 3NTHA 3PO3G 4YWMA 3DEPA 1K73C 4IZ8A 2BH2A 2ZXRA 1AN8A 2Z9HA 1A62A 1JICA 5D3DA 4KK7A 1K8MA 3H94A 5KYIA 1QZGA 2CWAA 2C9OA 4GOPC 1U9RA 1A2TA 1JB3A 2A19A 3PUWA 5CORA 4DV1L 1IBML 2Q2IA 3URYA 4C3IB 1VQ8A 3CF5A 4A93B 5KRUA 3TZDA 2VUMH 5C4XH 1Q8KA 4J6HA 3J7AF 3ICEA 3IKJA 5ELCA 3HOZB 1FR3A 2CW0C 3EFXD 5C3EB 1B9MA 1Y8NB 1A63A 1VCIA 3HOXH 3BZKA 5FJ8G 1K8OA 1H9JA 1JC7A 4XQNA 1GM5A 3IAYA 5ELFA 3D4WA 2I5MX 4IJHA 3R93A 1ILPA 2JA7H 2XN9C 1T9HA 2OQ0A 1G2TA 2HDLA 4HJ8A 3GTLB 2F0KA 5JEAJ 1Q46A 1ENAA 1HA6A 5A35A 1WD1A 3D4DA 3M4PA 1FNUA 3GTOH 2JE6I 2F0WA 2B2WA 1T5EA 4A4IA 1Y1WG 3F2CA 1J9OA 2PW7A 3I72A 1WJJA 2HIXA 5KYLA 3CW2C 4LF9L 1I6HH 4OWXB 3A74A 4BWGB 4FF2A 4IPCA 2AMCB 2VB3X 3SGIA 5I4DA 4ZAIA 3OPOA 4JC0A 4ZYSA 4QMGA 1GUOA 3MXNA 1C0AA 2F0IA 2CKZB 4B3SQ 1LYLA 4HCEA 5IWAQ 2KBNA 5FLXc 4MNOA 4DN4M 1U4LA 2QDLA 2JA7B 1ICWA 2EY1A 3L7ZC 4YY3Q 4R8IA 1MD2D 1HZCA 3S1RB 3GTLH 4FF1A 1ILQA 2A74C 1U5KA 1VQEA 1X54A 4C2MB 4DXGA 1EQRA 1W6KA 4HEDA 4LAAA 3CQZH 1TS5A 1VQCA 2HHHL 4DK1A 5JAVA 2I07B 4XXEA 2D5DA 5M3MG 4XIGS 3Q23A 3I4MG 2EQSA 2E74C 3D8GA 2PZWA 1YI2A 1Q90A 1XXGA 5FKAC 1GD7A 3K8AA 4O2DA 1VQIA 4JW0A 1Q81C 1LT5D 5BR8Q 3PF5A 4XQQA 2RCNA 4DV3L 2R7DA 4RGOS 1KDAA 4HTHA 4IFDG 2UXBL 4LMQD 1EOTA 3K6OA 3E0JA 3LWEA 1KAAA 4DV5Q 3HP3A 3R8BA 2QKIC 4A3BH 1EQVA 3K5LA 2MJ8A 5M9OA 1D5XC 4QIWB 3TMEA 4LFAQ 3JAMi 1E1OA 1VMCA 1VS0A 4K5VA 3S1RH 4HJ5A 4I65A 5JEAG 4QL5A 2E2HB 1EYCA 3PF4A 1VQHA 2DN8A 2OF1A 3TS2A 2JJQA 1Q86C 3CQZB 5CV6A 1SYBA 1JB7A 4P75A 2EOTA 4DV5L 3HKZG 2G9HD 3T1YQ 3H15A 2K32A 3BU2A 2X69A 3AYHB 4S3SA 4DR6Q 1L1OC 4JBKA 1FJGL 3E9IA 1FD7D 1R4QB 4X3UA 4EQ5A 1IKLA 2B63H 1T5XD 2YU9B 2CCZA 1LTAD 4A75A 1GJXA 4ME5A 3GTKB 1L0XB 5EKIA 1J6QA 4FF3A 3A8JE 4A3GG 3GTMH 2HQEA 5BN5A 5JJIA 3S1NH 2EY6A 4YIJA 4A3BB 4C1NK 1QE6A 2A8VA 3KF8B 4UAIA 4QGUA 5JVG3 4DGZA 1F2LA 4F7XA 4YY3L 1GUNA 5HY6A 4FVMA 3BS1A 2KEEA 1A3VA 3PUZA 3PIOA 1O7YA 2Y0SE 1SE3A 3OMCA 4LWCA 3T53B 4BS9A 4A3LH 1STNA 3ITPA 3SDZA 1ASYA 2B2WC 3PO2G 5IWAL 2ICIA 1VQGA 1CKOA 3FP9A 2GN5A 2YTVA 4OO1I 2JN4A 2QGQA 1D7QA 3NXWA 1VQAA 2EJFC 1IYVA 1EEID 3QIAA 1ZYRD 1SSOA 5EQ0A 5IYDH 3OWEB 4LF9Q 2K05A 1L0WA 3MWYW 2M00A 5EPLA 4NPSA 3GTMB 1N9WA 4JBJA 3HOWG 2UU9L 2EYHA 1RKNA 4BBRH 2K4KA 2K14A 2RSNA 3RD4A 5KEEA 3CCEA 3S24A 3K0YA 1F77A 1TWAB 5IYCG 2A6HC 2AQ3B 1PH3A 3KK7A 1EU3A 1VQLA 4K14A 3KLRA 1EFID 1XJVA 3QJYA 5CR3A 5ELBA 4HMIA 2IHFA 3DWQA 5GROA 4MTNA 4KD3A 3M9BA 1EY6A 4A3JG 5GAEC 2X6GA 2M9VA 3TBIB 2E76C 4HSPA 2ENBA 5IP9G 4DK0A 4OIKA 5CC4A 4TVAB 5DM63 4AIMA 2XSCA 1ASZA 1WD0A 2B8GA 3MXPA 2L12A 2UUAQ 1VQ4A 4MIUA 4WORA 4DFAA 1O7IA 3HS0C 1SNDA 4DV1Q 1K0RA 1IBMQ 1GXDC 1TIID 3CAMA 3A7AB 3OOCA 4DNIA 4BBRB 1ZXTA 2JP1A 4Z9CB 5CMDA 1WTVA 1QJOA 1HNWQ 1GUSA 3J80L 1TWAH 1WTPA 4QCLA 3G4SA 3S2HH 3FKIG 2PMZE 3G6JB 4QF4A 4PZ8A 4UY8C 2ZJPA 2YTXA 1TR5A 2O4XA 1HA5A 4PV1C 3C1FA 2F0OA 2K5WA 4DAMA 2R92B 1QZHA 2JA8G 1UWVA 1FNVA 1N36L 1XMOL 4ZUIA 4LF6Q 1NR2A 4KD4A 3S15B 1S40A 4KJOA 2WP8J 1TWGH 3T16A 3VA7A 2LKVA 2K03A 2KCMA 4JI6L 2E8GA 3M3YH 3CPFA 3HOUG 4UP8A 1ICFB 3BDLA 4QB4A 4BY7H 3VR4A 4ILWA 4YCUA 1VQBA 1TWFB 1SJED 3OTOL 3I4NH 2NN6H 4LF8L 1PZID 3KLSA 3X3NA 2FHTA 4XYQA 2F0LA 4H7BA 3TSSA 3HKSA 5I9OA 1D6EC 4DR4Q 4OWTB 1L0YB 1VF7A 4A3KG 2D62A 1PLFA 3J81c 4BBSG 2SNSA 2ZXPA 3DEOA 5AJ3Q 2B2UC 2QA4A 2PZUA 5JJLA 4FXKC 1JT8A 5I6YA 1F9RA 3CC2A 5ELDA 5J39A 4DXFA 1CSQA 1HH2P 4OELB 2AUKA 1CA6A 2N3SA 3CCSA 3PIPA 2OXPA 1P16A 1QUQA 4FXDA 4JOIC 4UPAA 1LV9A 1YHAA 1EY4A 1NR4A 2R92H 1S4ZA 3I90A 2JA5B 2OQKA 3DWPA 1NSNS 2UXDQ 1EL0A 3OIPA 3SXHA 4BXXH 2RVLA 4GKKQ 1IL8A 1GHJA 3PMFA 4A3IB 3EIVA 1J8IA 1KNEA 1G2SA 3GV3A 1UEBA 2VW9A 2RA4A 3M3YB 1ET9A 3E3XA 4J1MA 1TWFH 1M90C 5GADC 4JVZA 1Y8OB 2UXCL 2LSSA 4NW2A 2B2YA 5EKKA 5JPNC 1LTBD 2IHEA 3VYRA 3S1QH 4RHRA 3Q8DA 4JI2L 4X65L 1X55A 4HJ7A 3VR5A 1K9MC 2ZTCA 5M3FB 2ASBA 1JR0D 2JA5G 3TP8A 4JV5Q 3R2TA 2MFIA 4NP5A 5C0XJ 4WJ3M 3EVQA 3JAMc 4DR1Q 3NE5B 4HSVA 3HFZB 3PQIA 1JMCA 4GOPB 4QUFA 4DV4Q 3H3VC 1XYIA 1KNAA 1TT2A 4UP7A 1B53A 3T56B 4G4KA 3MZ5A 1EIFA 1SEBD 5M5XH 4GNXC 3SE0A 4DV0Q 1D1KA 3ZJYC 3C2PA 3Q24A 1LTID 3E6ZX 1BKBA 4XT3B 1WTRA 4BBSB 1PH8A 4ZK9B 4UDUC 1Y1VH 4IN3A 3FMCA 4Q5VA 1HTLD 1V1OA 3ER0A 3UDXA 3WOEA 1YNNC 1IBKQ 3SVMA 3DUZA 3MC0B 4NXNL 2Z4HA 3CU7A 1ZEQX 5IGFA 3MAQA 2J4XA 2JYOA 1NY4A 4YWLA 3VR3A 3S14H 2BE5C 3HOUB 2MPMA 4IALA 3S1QB 2XRQD 5LMNQ 4GKJQ 1IYJB 2EJMA 2A73B 4AQYL 2X6LA 1B70B 2KHSA 3IFTA 1YNJC 3ULJA 4WJWA 2WIIB 4L5QA 1N34Q 4OX9Q 1IHZA 1H9RA 2R92G 2C5CA 4DAYB 1ESFA 1HFNA 4CJ0B 2N8NA 1B1ZA 2EE1A 4N8X1 4DK6C 4F8MA 1B7YB 4ZKCB 3CC7A 4OIJA 1I50B 1VQKA 3FKIB 3E5SA 3MFYA 2BDNA 2B29A 2QILA 3M7GA 1IXRA 5LMUQ 5JJKA 4A3KH 1LACA 3D0FA 2LY7A 5ISRA 3S17B 1SBBB 3RZDH 3I4NG 2B3GA 4X66L 4LFCL 3I55A 3BG3A 3M4QA 4BY7G 4HJ9A 1S5CD 3MA2B 3S14B 4DNTB 1CZGA 3CD6A 1UE5A 4KKTA 3NENA 3MEFA 1TQOA 1YEZA 4NXMQ 3X3MA 3MXUA 3KF6B 2BH8A 3J81L 1N32L 2OTJA 3OWFA 2B2TC 4PMBA 3CP0A 3U9SA 5C4XB 4CDCC 3KLWA 1WTOA 2MNAA 2F0JA 1RODA 3G48A 1C8CA 2FINB 1PFSA 1I50H 1LT4D 4H02A 5C4ZA 2R7FA 4X6AH 3VYUA 4L6TB 1S3OA 4EX5A 4POGA 4YWKA 1Q82C 4JI3Q 2ZM6L 4P73A 4K6DA 4LFBQ 3RN5A 1WVLA 4B3MQ 3TP7A 1HNZL 5KGUA 4GZYC 3RZDB 1K3BC 3ZYYX 2F0TA 2N88A 3ND8A 4I7ZC 4DAYA 4KI0A 1KRSA 1STHA 1SLJA 1DCZA 1X3GA 4IUTA 1TWCB 1II3A 1I6VC 2IX3A 1E7ZA 1J5EQ 3CRKC 1IZ6A 3BVMA 2I0QA 3OW7A 4P71A 1EU4A 1B3AA 2NYZD 3SK8A 5IP9H 2Z6KC 2ZJQA 4N9TA 4JI5Q 1RTOA 3CPWA 3CCJA 4G7HC 2UUBQ 4LF5L 1AE3A 1O7LA 3WWVA 3HG9A 4IUVA 4JI7L 1XWEA 5FLXE 2DNEA 4DUYL 1HR0L 4OEMB 1QVFA 4X62L 2PNRC 2NZHA 5IYCH 4L5TA 1PTOH 2ATWA 3GTJB 5EPJA 2E5LL 1ZKOA 3K57A 4GLVB 1I4GA 1V1PB 1DOKA 3Q0AA 2H5XA 2VNUD 2JQOA 2BCOA 1U4PA 2A69C 4A3GB 4YHHL 1Q1BA 1I5FA 5K36H 1SNMA 1TWCH 2Z6BA 3R3OA 1YJWA 1SR3A 1CUKA 1P8LA 5IYDG 2KUMA 3PUVA 1NNXA 2A6EC 1CQVA 2DGYA 3H91A 1PV4A 1BOSA 1CKNA 2EXZA 2K5HA 3PO2H 3HKZB 1I4HA 1EY9A 2CQOA 3N6RA 2Q2TA 2QF7A 5KIXA 4KMUC 4E6IA 4GLXA 1XPRA 5LMNW 3NQIA 4PG3A 3KFUA 3W3AA 1H9KA 4NMZA 1ESRA 1HZ9A 1TVXA 1MJCA 2R61A 2SNMA 1IBLL 3C3LA 1PTOB 1KAWA 3CCQA 1K28A 4HIOA 1I94L 3QB3A 1WYDA 4KTAA 4B3TL 1CZWA 2BOSA 1KD1C 4KJNA 4B9XA 2QEJC 2CHBD 1HPCA 2KHJA 3AQQA 4A3GH 3DMUA 2E2HH 3P75A 3A7LA 1SRUA 1I4RA 1S5FD 1H9SB 4I7AA 2R6GA 5CV7A 4XQJA 2HCCA 1DGSA 5FO9B 5E3FA 1X56A 3MXGA 4YCWA 2EYFA 3A8IE 4DAVA 4DUZQ 2ZXOA 4OONA 3C1EA 5M3MB 2RHSB 1N33L 5HURA 3TQYA 1JWMD 2TMPA 4OXPA 1IL2A 1KLUD 4N8FA 2YU9H 4GLAC 3DXJC 3GTKH 3PUYA 5K36G 3PIP3 1VMPA 5JEAH 1YNND 3NUCA 4LF7L 2B2UA 1PYWD 3U4VA 1HFGA 2F1MA 4DR7L 2UUCL 3AEVA 2WINB 5D14A 3MFGA 2L11A 2MQHA 2PO4A 4IQZA 4JI0Q 2NN6I 4IFDH 2K04A 1TU2B 2MO1A 1JQYD 4FO2A 4A76A 2A6ED 4K2LA 4LJZC 4ODGA 2PCFB 4JI8L 3BDCA 3P7JA 1D5ZC 1G291 1L1OA 3L2PA 1TKWB 1W3SA 4DKAC 1NJIC 1FYCA 3D31A 2JK8A 2K5DA 1BCPF 2RF4A 2G5DA 2CWPA 4BA2I 3F1ZA 1SROA 1NCVA 5DLQE 4TKOB 3HRZC 3GQBA 2F3VA 3CHBD 1WTXA 3FPUB 1IYUA 4FYDA 3F2DA 2CH4A 1I4XA 2NTSA 1S5DD 5JOBA 4IOAA 3TP5A 1H9MA 1VF5C 2JSOA 2HDMA 1KTKA 5M5WH 2F03A 4RGNA 2E75C 3EA6A 1NTGA 4PQXA 3CCVA 2NBFA 4J15A 3NQTA 2NB0A 5G3LD 2AUJD 3I91A 3G71A 4K8JA 3M85A 1ZYRC 1X3PA 4K0KL 1PRTC 1VQJA 4K8IA 2G9DA 1PDQA 3IRBA 2KECA 3KJPA 1S72A 3BVZA 1DJRD 5DAUA 3NWTA 4RAUC 4JBMA 1HHVA 1O80A 1S5ED 4B9WA 4QJFA 1RL2A 3VR6A 2VB2X 1HR0W 4APVA 1DD2A 4LF4L 3KYHC 3UDGA 5CV9A 3HOXG 4LUVA 3S2HB 5DEHA 1X3FA 5M5WB 1BBWA 3RMHA 3HOVB 3CCRA 3L3OC 4HCSA 2QEXA 5C4XG 5CYUA 1PH6A 1JJ2A 1I3QB 4X3SA 3QOJA 2VXWA 5CV4A 2YV5A 1HNXQ 1X3EA 2R3ZA 3K58A 5IY0A 5TSSA 2NTTA 1LM0A 4KY5A 3TP6A 3U9OA 2DUDA 3GTPH 1JWUD 1PZKD 4LUOA 1GOZA 2EYOA 2KJXA 2Z8LA 2VQEL 1QNKA 1CI3M 4EVOA 4BY7B 3BYTB 1RDPD 3SK4A 3EN2A 3I4NB 1VQMA 3T1HL 2F0EA 2F0NA 2EIFA 2VQFL 1XNRL 1HTPA 1JOOA 4CJ1B 3PO3H 5IE8A 4R4TA 1Y1VG 1LTLA 2F4VL 3QG1A 2OTLA 1QILA 5H1SE 3RLOA 2L0CA 1DOMA 3AFQA 1LTSD 4JI4Q 4PMWA 1K0SA 3Q6SA 3V96A 2RSOA 4CDDC 1G6PA 1UNSA 2KQ3A 1CT1D 3I2ZA 3J7ZC 4U673 1SN8A 4ID6A 1KQSA 4YCVA 2K5QA 1I3QH 4AH6A 2F0PA 2A6HD 2JA5H 1D8LA 3A56A 4M1UB 1FGUA 3EQLC 1Z9FA 2L4NA 1PRTF 2BA1A 4K5WA 2CFMA 1BVSA 2TSSA 3J7YW 4X64Q 1GHKA 3PIO3 2BE5D 1CK1A 1L2FA 3W1BA 2I46A 2IPKD 4QQBX 2DJGC 4B3RL 1ENCA 2JXMB 4HIDA 2MP1A 2J7ZA 4JI1L 4DV6Q 3NK9A 4A3FB 1DZ1A 1QG7A 3KBXA 3N52A 4EQNA 1BNZA 3GTQB 2RQXA 4BXXG 4DV2Q 3DHQA 4DV2L 5JJZA 5IT9c 4RFBA 5C4JH 2ID0A 3J7A5 1JE4A 4H44C 2WFWA 5E4WC 1U4RA 5M3FG 4ZQ3A 2D9UA 1B3QA 3J81j 2E2IB 4DR2L 1F2ZA 4DV7L 5M5XB 1DM0B 1I4QA 2ZT9C 1AFPA 4BBSH 1PVOA 3NSWA 3OIQA 3KJOA 4ALPA 1XPOA 1SFOH 3BZCA 1KHIA 3G6EA 1NMGA 4RA8A 4CKEA 1MIUA 4X64L 1B8AA 3S1MB 2NN6G 2XGTA 3H09A 5GAHC 1BCPB 2A68C 3WOFA 1KL9A 3NTIA 2WV6D 2A1AA 2RDHA 3HOUH 2RBMA 4ZUJA 4DR3Q 2BDOA 3BJUA 4KHZA 3UE1A 2EXDA 1NAPA 3GTQH 4JYAQ 1BXTA 4A3IG 2Q8RE 4KN4C 1CHPD 4Y7NH 3T13A 1YNXA 2XTIA 2NZ1D 4JI4L 2JA8H 1A3UA 1WTQA 2RDFA 3D3RA 4L8JA 4MZ9A 3TS0A 2F4VQ 2YYZA 1EIYB 2F0SA 1RIPA 4R1JA 4RKLA 3BZDB 3FKIH 4DR5L 1OXVA 3T1HQ 2IL8A 2E2IH 1U4MA 3H3VI 4PZ6A 4FP5D 1EZ8A 2O5IC 2ZTDA 4KHPL 1UE7A 4A3KB 1XTDA 5EBDA 1SFOB 2XIWA 2F0UA 3STBC 4KV6A 1SE8A 3T4AC 1AW7A 5F2DA 1PH2A 4QY7A 1STYA 3S17H 1E0BA 3UI2A 2N55A 1BO0A 2GVBA 3M7NA 4HIMA 1XNQQ 1EYAA 4QIWE 2F0GA 5CBEE 1SAPA 1STBA 2PNHA 2IX1A 1BBXC 1QVCA 1PYSB 1GUGA 2Q2HA 5G3LF 4EQOA 4A3JH 4V190 3QOLA 1YVCA 3H0GB 2JA8B 1VQPA 2L1BA 1VQ5A 2XNAC 5KNBA 1Y14B 2PMZB 2NWGA 4XYOA 4LF4Q 4EQPA 1CSPA 5IODA 1SDFA 5IOCA 2EJGC 5IT9L 1SNCA 2QCPX 2QW7A 5E4XA 3M4OB 1B50A 5FOBB 1VQ6A 1QB5D 2NVTH 3OHXC 4F88A 4BBRG 5GAGC 1PFBA 1XMQQ 1RCVD 2C35B 3W5OA 3HOWH 1RJTA 3EJIA 3VYTA 1HZBA 4C1NI 1XMQL 5ELEA 1EY7A 3NWSA 4KN7C 2FMCA 5C3WA 3HOYH 3ERSX 1HQMC 4JBWA 5DNFA 4ZCKA 1S5BD 3VR2A 4N9PA 3OW2A 1LT6D 1SMYC 2KCCA 4LK1C 1Q8IA 1TWHH 3CC4A 2YTYA 5IGBA 4A3JB 2FXQA 1G91A 1LTTD 3K7AB 5NUCA 1BUVT 3FDTA 4XTCS 3U58A 1LUZA 4RHSA 1AZQA 2L55A 2NZOA 1A15A 4A3LG 1XX8A 2HD3A 3I7FA 3C46A 1LT3D 1DOLA 1E2VA 1X9NA 3RLFA 1C48A 4HMJA 3E0EA 5I9PA 1RF2D 1YNJD 3GTJH 3S16H 3NEMA 2D0OA 3A55A 4IUUA 3KF8A 4UP9A 1JCKB 5IGDA 2CW0D 1XNQL 4JI8Q 3HOWB 1HQRD 1Q12A 2F3WA 4LNQA 4GN5A 1HUNA 4ZRZA 3J81E 3AMUA 2B63G 4KHPQ 1VDZA 1TWHB 2OCEA 3ND9A 4HN7A 1G8ZD 1MI2A 3K7AH 1SE4A 4DR5Q 4JI0L 5BN4A 2F0HA 2ZJRA 2D0PA 3PO2B 3DM3A 4DR7Q 1ML0D 3FHWA 4ME3A 3MVVA 4IJLA 1WFQA 1DYQA 4TRDA 3RUZA 2K7VA 2F0VA 1SMXA 3BDOA 3K5NA 5EPKA 4JYAL 4POFA 5J22A 4A3BG 4DR3L 3F8TA 1TY0A 1ET6A 4FXGC 1OXTA 1N33Q 1KABA 3J80E 4DUZL 1F9SA 4IUPA 4CGYB 1EEFD 2B2VC 4OL7A 1A2UA 3RR5A 1BBUA 3FEWX 2BA0A 2I5HA 1EQTA 2KA7A 1KC8C 3V2TA 4DV7Q 1FGBD 4DR2Q 3HGBA 5IYBH 1E22A 3I4MH 2JA9A 5FLXL 5M3MH 1Y69U 1V8QA 1CTMA 2F0DA 3PV0A 1CA5A 3IFDA 1YJNA 2K5NA 4O42A 2HUGA 5KNDA 4A3EB 3PGZA 4R8NA 4IO9A 4HJAA 1N8RC 2LMCB 4GN3B 3NP8A 1SYDA 4IPGA 1IBLQ 2CQAA 4DK3C 1KRTA 3HEJA 4F87A 1KDBA 1KDCA 4DV6L 3A0JA 4JI1Q 3UE0A 4RGTA 1E24A 5E1FA 2DY8A 4B3RQ 4CDFC 2F4IA 2L9HA 2MUYA 4C3HB 2PQAB 1PMRA 2IJ0A 2OWOA 1SYGA 1WCMB 2K5VA 4CKCA 4A3MB 5C0XH 1Y1WH 1A8VA 1EUJA 1WTHA 4YHHQ 2HIVA 3I4MB 2KOLA 4G7OC 5CGKA 2R93H 2MHVA 5IP7H 2Z1CA 2VS1A 1SNQA 4MN3A 4ZKBB 2AWOA 5IGCA 2RHQB 3W2DA 4U68A 3K7UC 3TDQA 2ALYB 1F9QA 1LLRD 2Z4IA 4FDBA 2K50A 1STEA 4G57A 1E1TA 1YJ9A 4X62Q 4HR7B 1HR0Q 3H6MA 4PNYA 1OXSC 1V9PA 4DUYQ 2JA7G 1D2BA 2M2LA 4LF5Q 1XNRQ 2VQFQ 2UUBL 3IL8A 1F2YA 1STGA 5FJ8H 2LXJA 3JAME 2B8FA 2V4DA 1UE1A 2PPBC 1STAA 2EYJA 2LXKA 3NBHB 4GNXB 4WRDA 3E9HA 1PRTD 1JOKA 2VL6A 4OHJA 5JVH3 2VQEQ 4X3KA 1HJPA 2Z6KA 1CM9A 1IW7C 1W6JA 4C3HH 5C44B 3CCLA 2VUMG 1PH1A 1WCMH 2GVAA 1WTWA 1Y1WB 3LNNA 5FLMG 1R9TH 2RKSA 2J0TD 4RKBA 2PZTA 1EZ6A 1HUMA 1HNXL 3OYYA 4CBVA 1EY5A 5L37A 4IPHA 2F3IA 3GDEA 5M5YH 4B3ML 4LFBL 2ZM6Q 1G51A 4IPDA 2A69D 4RGMA 3JAML 4OO1G 3J80c 1TXYA 5EJWA 1Z6HA 1SJHD 3EBEA 2NVYH 2IW3A 3P20A 2IT1A 2JEBI 1VQOA 1PA6A 5I6WA 1M1KC 3TREA 4JPBW 4KLKA 1E2WA 2XWJB 3D6WA 3TEHB 4KKSA 4RCNA 4V0BA 1GUWA 1X6OA 1RHPA 5C3EG 4IOCA 4L5SA 4RCOA 3HOZG 4C3IH 3HOVH 1XTCD 2ZTEA 3AB9A 1B4OA 3KOJA 4HIKA 1XPUA 3TN2A 3GP7A 3PSIA 4P74A 2VUMB 1LO5D 5C44G 4NB3A 4IUQA 1HZAA 4A93G 1Q3LA 2I5LX 5C5LA 4C3IG 1R9TB 3HOZH 4K0KQ 1GVPA 1QOHA 2WKCA 4X66Q 1HRJA 1MGSA 4H13C 3GTPB 3QWNA 1H95A 1AEXA 1FVIA 1PTOD 1I4PA 5JPMC 1EWCA 2K1BA 2L15A 3I4OA 1Q1EA 1X65A 2EVBA 4XDXA 4XT1B 3BYYB 3I8ZA 1Q7YC 3DWAA 4H0LC 4OO1H 3NPPA 3H3VH 2NVYB 3SK5A 3ERQA 4PZ7A 2R7ZH 3PO3B 3I70A 4LUZA 2F0QA 4AYBG 1BCPD 2AWNA 2OEOA 5LHY1 4FF4A 2B39A 1X32A 2KCNA 3GTOB 5FLMH 1C9OA 2F0FA 4AQYQ 5E7NA 4A3MG 1WCMG 3J80i 1KLGD 3RLNA 3S2DH 1HXYD 1I6HB 4C3HG 4DA2A 1YITA 1MJEA 2LFNA 1UEAB 1O78A 5A2QE 1K8AC 2WAQB 1CKMA 1JJCB 1PH7A 1YBYA 4NXNQ 5D65A 4A3DG 1QWYA 2H4OA 2K33A 5I2YA 4DV0L 2EDGA 2K52A 2RDGA 3CCMA 3A5UA 1R4PB 1GUTA 2XVSA 2O2LD 4WJ4A 3B6YA 4MHEA 5C6AA 3J7AV 3L0OA 2R7ZB 4C2MH 3K5OA 4R4CA 3U4ZA 4A3FH 2UUCQ 5T1GA 4A3EG 1K8GA 1BDOA 1KIXA 2SOBA 1NMFA 4LF7Q 1B44D 4JV5L 3LWUA 3J81i 4KKUA 4MTKA 3CRLC 1AE2A 5IP7G 2R93G 1PXUA 2FJ2A 2IWHA 5C0XG 5C4JB 1Z7TA 4M8AA 3OMGA 3LGJA 3S2DB 2ES2A 1A3TA 2A68D 3HKZE 3K81C 3K0XA 2WKDA 2WB1B 4IFDI 4QUCA 1TS4A 5HGQA 3TZUA 2HCIA 1RTNA 5DM73 3MHBA 3QO2A 3W1GA 2JA6G 3RZOH 3K59A 4GKKL 3K80C 2B2VA 3S1MH 2Q8IB 1GKHA 1PFNA 2UXDL 3M4YA 4BY1G 3I4LA 1F9PA 3GTGB 2DNCA 3F2UA 4TQUS 1DXMA 2F52A 4B3TQ 2L5TA 2P5ZX 1I94Q 2Q2UA 1YIJA 4Y7NB 3OSOA 4Y52H 1PTOC 5IYBG 4IFDJ 1X3QA 4NDXA 1PZJD 2AHOB 5AJ3L 5IT9E 4JK1C 3MTSA 3SEBA 2B63B 1WOCA 3KDFA 3GO5A 4HAEA 4DR4L 3KDFB 2B2TA 3NBHA 4GNXA 3FVQA 1H9SA 1SE2A 1RD9D 5K5PA 4LF8Q 3QR8A 4CKBA 3OTOQ 4DF7A 2A5HA 4P2CB 3S1NB 1UE6A 1V1PA 4C3JH 1OXUA 4O1NA 1EWIA 3KUPA 1LTGD 4J8QA 3RZOB 4IURA 3VDYA 3CCUA 1XMOQ 1N36Q 4AYBE 3FRPB 5AFWA 1AZPA 3GTGH 2SDFA 2LS01 1O7ZA 3O13A 4KHVA 3F2BA 4B08A 4EGVA 2E5LQ 4KY6A 2EYPA 1LTRD 1K83H 3P1HA 1CKNB 1TY2A 3H0GH 1CQFA 1AP0A 3MXNB 4A3CH 1HNWL 2NVXB 4PMCA 4JI7Q 1PHJA 1SMYD 2PW5A 5EKLA 2PI2E 2HQLA 5ELOA 4JI5L 1PYBA 3NBIA 3T51B 1JORA 5LL6S 2N49A 3PUXA 3M4OH 4R9WA 1U0LA 1JE5A 3AFPA 2UUAL 1QUQB 4BA1I 4C3JB 1J5EL 1TS2A 1EIHA 2E2JB 2NVTB 1BQQT 2EY2A 2KVMA 1IKMA 1SYCA 3GD7A 4KY7A 1L1OB 1FL0A 2PI2A 5CV8A 2Y0SB 2QDBA 2AQ2B 3I3CA 1HNZQ 2RCFA 4X3TA 2E2DC 3HOYB 4JI3L 4CJ2C 1MSHA 2CH4W 3TRZA 2PQEA 3GV6A 1EFWA 1SNPA 1B2TA 2WB1E 1F2MA 4A3CG 3ONAB 2XWBB 2Q8TA 3H0GG 5FO8B 1K83B 3D4RA 1M8AA 2KEDA 2EYLA 1K3RA 5EGTA 4DAPA 2NVXH 2V1CC 4K2KA 3HOYG 3K5MA 4P72A 5HGTA 2B2YC 3DM1A 2VY3A 1E3PA 5C0XI 2UU9Q 1SYEA 2Y0SG 1N32Q 4JG2A 1VQDA 1JOQA 2MO0A 5I2XA 3S16B 1MHWC 3JC66 4NXML 4G7ZC 4GS3A 2E2JH 4C3JG 1UAPA 3STBD 5D3IB 1OO9B 1YHQA 4LFCQ 1YHBA 1D5MC 2KENA 3NHHA 3NTKA 4R4OA 4ABNA 4L5RC 3ULLA 3LX0A 2GA4B 1SXTA 2EPBA 3D6CA 4UHVA 3RNUA 3KLSX 4RWSC 5LMUL 1LABA 1JWSD 2K01A 5GQOA 4NKLA 2ICEC 4FNFA 5C5MA 2IX0A 3MEHA 4IUNA 2Z0SA 5A2QL 1V1QA 5J1ZA 3S15H 1SYFA 3L9AX 1PFMA 1TWGB 2HT1A 2CVRA 4K6LA 4RH6A 3G7LA 1N34L 4BY1H 4OX9L 3CMAA 1EQQA 1CFMA 3CKIB 1A6XA 4L63B 1EY8A 2JA6H 5LMNL 4GKJL 2EZVA 2FFKB 2K75A 5EAYA 1PH9A 4OWWB 2KCTA 1FJGQ 1KXLA 1EY0A 4DR6L 1MKHA 2NVQB 3KBGA 4CDEC 1IW7D 1IBKL 1VQFA 3T1YL 2EY5A 2KHIA 5CV5A 1EYGA 4DNRB 2VZAA 4ZLTF 2N78A 4RMFA 1BR9A 2F0MA 4R4IA 3UDIA 5BN3A 1BF4A 4O0AA 4DV4L 3HZXA 4LFAL 2PYKA 4A3IH 1PH5A 1QVGA 5IIFA 4DR1L 1D1IA 1SNOA 2JEAI 4A3EH 5T1IA 4A3FG 2EYMA 1QNUA 4Q0FA 1C7YA 3KF6A 4BY1B 4RG1A 4OGQC 1EIGA 1TS3A 4X65Q 3SR1A 1W2BA 1MBYA 2DY7A 2UXBQ 1Y8PB 2JA6B 4JI2Q 2DJFC 4CHTB 1FNWA 4DV3Q 1ONLA 5BR8L 1Z47A 3S9WA 2WB1G 3I56A 5FK9C 5J3BA 2SEBD 4A3DH 1PTOF 2UXCQ 1AH9A 3Q22A 3VA5A 1ENFA 2NVQH 4JCVE 2AQ1B 2PQAA 5M3FH 1WI5A 1MSGA 5IGEA 4LW1A 2D2CC 4TSSA 2HHHQ 3CXCA 2H1EA 1JJGA 4A3MH 1YZ6A 4GN4B 1OXXK 2R93B 1VQNA 1UUPA 3BVGA 1OTCA 1NBWA 1HCZA 4GOPA
chains in the Genus database with same CATH topology
4LUOA 4IPHA 2F3IA 3GDEA 5M5YH 1VQ7A 4B3ML 3EIVA 4LFBL 2ZM6Q 1G51A 2VQEL 1UEBA 4IPDA 2VW9A 2R7ZG 1A0IA 3RN2A 4OO1G 1TWFH 3DLLA 3EN2A 1M90C 5GADC 4B3SL 3J80c 1VQMA 4R4QA 1TXYA 4JOIA 3T1HL 2LSSA 2UXCL 3EBEA 2NVYH 2EIFA 2VQFL 1XNRL 2IT1A 3PO3H 2JEBI 1VQOA 3UDFA 4R4TA 1Y1VG 1LTLA 5IE8A 1PA6A 1M1KC 3TREA 2IHEA 2F4VL 3S1QH 3NELA 2OTLA 4KLKA 5H1SE 3Q8DA 3RLOA 1VQ9A 4JI2L 3TEHB 3AFQA 1PH4A 4JI4Q 4PMWA 4X65L 1X55A 1X6OA 5C3EG 4IOCA 1EOVA 4HJ7A 1K9MC 4L5SA 3HOZG 1G6PA 2ZTCA 3I2ZA 4C3IH 3J7ZC 2WAQG 2ASBA 3HOVH 2JA5G 4JV5Q 2ZTEA 1SN8A 3PCOB 1V43A 2MFIA 3KOJA 4HIKA 4YCVA 5C0XJ 3A5ZB 5C44H 1GO3E 4JI6Q 1XPUA 3PSIA 4P74A 4WJ3M 3JAMc 3CMEA 5C44G 4DR1Q 1I3QH 4NB3A 4AH6A 1HZAA 4A93G 2AKWB 3HFZB 2JA5H 1JMCA 1D8LA 2I5LX 4GOPB 3HOVG 1FGUA 3HOZH 4K0KQ 4DV4Q 1GVPA 1Z9FA 3ULPA 1NE3A 2BA1A 4LF6L 5C3EH 2CFMA 4X66Q 4UP7A 1BVSA 2WAQE 5ELNA 1EIFA 3U50C 4DPGA 5M5XH 1H95A 4GNXC 1FVIA 4X64Q 3ZJYC 4DV0Q 1BKBA 2L15A 3I4OA 1Q1EA 1L2FA 3W1BA 1PH8A 1Y1VH 2IY5B 4QQBX 3PO3G 3UDXA 3ER0A 1X65A 4YWMA 1IBKQ 4B3RL 1K73C 2BH2A 4HIDA 4NXNL 1A62A 1Q7YC 3H3VH 1NY4A 4PZ7A 4YWLA 2R7ZH 3S14H 4JI1L 1QZGA 4LUZA 4DV6Q 5C4XG 2CWAA 4AYBG 4GOPC 5LMNQ 4GKJQ 1IYJB 2A19A 3PUWA 4AQYL 4BXXG 4DV2Q 4DV1L 1B70B 1IBML 2AWNA 2Q2IA 3ULJA 5FLMH 1C9OA 4L5QA 4DV2L 1N34Q 4AQYQ 5E7NA 3CF5A 4A3MG 1VQ8A 4OX9Q 5IT9c 5C4JH 1WCMG 3J80i 2ID0A 3RLNA 4DAYB 2R92G 3J7A5 3S2DH 2VUMH 5C4XH 1Q8KA 2N8NA 1YITA 4DK6C 3CC7A 1MJEA 1KQSA 1B7YB 3ICEA 2WFWA 1K8AC 5M3FG 1CKMA 1JJCB 1VQKA 1PH7A 3J81j 1YBYA 2B29A 4DR2L 4NXNQ 4DV7L 1A63A 1VCIA 3HOXH 3BZKA 5FJ8G 4A3DG 1GM5A 1IXRA 5LMUQ 4BBSH 1PVOA 5JJKA 3KJOA 4ALPA 2I5MX 4IJHA 4A3KH 1XPOA 3D0FA 3BZCA 1SFOH 1KHIA 3G6EA 2JA7H 1NMGA 1MIUA 4X64L 4DV0L 2K52A 1B8AA 3CCMA 1T9HA 3A5UA 2NN6G 3RZDH 2XGTA 3I4NG 2B3GA 2OQ0A 4LFCL 4X66L 3I55A 4WJ4A 3B6YA 3M4QA 5GAHC 4HJ8A 4BY7G 4HJ9A 3L0OA 1KL9A 4C2MH 2A1AA 3HOUH 5JEAJ 4R4CA 1Q46A 3U4ZA 4DR3Q 4A3FH 2UUCQ 3CD6A 4A3EG 3BJUA 4KHZA 1K8GA 3UE1A 1UE5A 2EXDA 1KIXA 3NENA 3MEFA 3GTQH 4A3IG 1YEZA 4JYAQ 1NMFA 4LF7Q 4NXMQ 4JV5L 3J81i 3M4PA 1AE2A 5IP7G 3KF6B 4Y7NH 2BH8A 1YNXA 2XTIA 1N32L 2OTJA 3GTOH 2R93G 2JE6I 4A4IA 1Y1WG 3CP0A 5C0XG 3F2CA 4JI4L 2JA8H 1WJJA 2HIXA 3CW2C 4MZ9A 3LGJA 3TS0A 4LF9L 1I6HH 4OWXB 3A74A 2F4VQ 3KLWA 2AMCB 4IPCA 3SGIA 2ES2A 2YYZA 1EIYB 1RIPA 2MNAA 3HKZE 3G48A 4R1JA 3K81C 1PFSA 1I50H 4JC0A 3K0XA 3FKIH 4DR5L 1OXVA 4H02A 3T1HQ 1C0AA 2CKZB 2E2IH 4X6AH 2R7FA 4B3SQ 1LYLA 3H3VI 4PZ6A 5IWAQ 1S3OA 4IFDI 2KBNA 4EX5A 2ZTDA 5FLXc 4POGA 4MNOA 4YWKA 1UE7A 5HGQA 1Q82C 4KHPL 1XTDA 4JI3Q 2ZM6L 4P73A 4LFBQ 3STBC 3RN5A 4B3MQ 1SE8A 1HNZL 3W1GA 2JA6G 1PH2A 3RZOH 4QY7A 3S17H 3K80C 3S1MH 4GKKL 3L7ZC 4YY3Q 1GKHA 1HZCA 2GVBA 3GTLH 2UXDL 3M7NA 4HIMA 4KI0A 1U5KA 1KRSA 1VQEA 1X54A 1SLJA 4BY1G 1XNQQ 1EQRA 4QIWE 1X3GA 3CQZH 1VQCA 1E7ZA 2HHHL 4B3TQ 4TQUS 2PNHA 2F52A 1J5EQ 2IX1A 1I94Q 1QVCA 1IZ6A 2Q2UA 1YIJA 2I0QA 1PYSB 4P71A 5IP9H 4XIGS 5M3MG 4Y52H 2Q2HA 2EQSA 2Z6KC 5IYBG 4A3JH 2ZJQA 1YI2A 3I4MG 4IFDJ 1GD7A 1YVCA 4JI5Q 3CPWA 3CCJA 1VQPA 3K8AA 2AHOB 5AJ3L 2UUBQ 4O2DA 1VQIA 1VQ5A 1Q81C 1AE3A 4LF5L 1Y14B 5BR8Q 3PF5A 1WOCA 3KDFA 3WWVA 4JI7L 2RCNA 3GO5A 4LF4Q 4DV3L 1CSPA 2R7DA 4DR4L 4DUYL 3KDFB 1HR0L 4GNXA 4IFDG 1QVFA 4X62L 2UXBL 4LF8Q 3OTOQ 2NZHA 5IYCH 4L5TA 2ATWA 4DV5Q 2E5LL 1VQ6A 1UE6A 4C3JH 4A3BH 1OXUA 4GLVB 1EWIA 2NVTH 4BBRG 5GAGC 2H5XA 2VNUD 1XMQQ 2JQOA 4LFAQ 3JAMi 2C35B 1E1OA 3VDYA 3W5OA 1VS0A 3S1RH 3HOWH 4HJ5A 3CCUA 1XMOQ 5JEAG 1N36Q 4QL5A 4AYBE 4YHHL 1HZBA 3PF4A 1VQHA 1XMQL 1Q1BA 2JJQA 1I5FA 3TS2A 1Q86C 1TWCH 3GTGH 3HOYH 3ERSX 3F2BA 4JBWA 3OW2A 1YJWA 1SR3A 1JB7A 1CUKA 4P75A 2E5LQ 1P8LA 5IYDG 4DV5L 3HKZG 3T1YQ 3PUVA 3H15A 1TWHH 3CC4A 2DGYA 3BU2A 2YTYA 3AYHB 1K83H 2FXQA 4DR6Q 1L1OC 1CKNB 3H0GH 1PV4A 4JBKA 4XTCS 1FJGL 1CKNA 2K5HA 3E9IA 3U58A 1LUZA 3MXNB 3PO2H 4A3CH 4EQ5A 1HNWL 2NZOA 4JI7Q 2B63H 2CQOA 1PHJA 2Q2TA 2CCZA 4A3LG 4A75A 3I7FA 4GLXA 2PI2E 1XPRA 2HQLA 1J6QA 5ELOA 4JI5L 1X9NA 1PYBA 4PG3A 3RLFA 5LMNW 3KFUA 3E0EA 4A3GG 1HZ9A 2N49A 1MJCA 3PUXA 1IBLL 3GTMH 3M4OH 1U0LA 3GTJH 1JE5A 5JJIA 1KAWA 3AFPA 2D0OA 3NEMA 3CCQA 4HIOA 1QUQB 2UUAL 1I94L 3S16H 3S1NH 4BA1I 1WYDA 1J5EL 4B3TL 4UP9A 2A8VA 3KF8B 3GD7A 1KD1C 4QGUA 1L1OB 1FL0A 1XNQL 4JI8Q 2PI2A 1Q12A 2KHJA 3AQQA 4YY3L 4A3GH 2E2HH 5HY6A 4LNQA 4GN5A 3PUZA 1SRUA 3PIOA 1HNZQ 2Y0SE 4A3LH 4LWCA 4JI3L 3TRZA 2B63G 1ASYA 4KHPQ 1EFWA 2R6GA 2WB1E 4A3CG 3PO2G 5IWAL 2OCEA 1DGSA 3H0GG 1VQGA 1CKOA 1X56A 4YCWA 4A93H 3FP9A 2GN5A 2YTVA 3K7AH 4DUZQ 4DR5Q 4JI0L 4OO1I 4OONA 2QGQA 2RHSB 2ZJRA 2D0PA 1N33L 1K3RA 1VQAA 1D7QA 3TQYA 4OXPA 3DM3A 2NVXH 5IYDH 1IL2A 2V1CC 4DR7Q 4ME3A 3FHWA 4GLAC 2YU9H 4LF9Q 4IJLA 1WFQA 3HOYG 1L0WA 4P72A 3GTKH 3PUYA 5K36G 3GTPH 1SMXA 1E3PA 2VY3A 5C0XI 4NPSA 2UU9Q 2Y0SG 1N32Q 1N9WA 4JBJA 4JG2A 3HOWG 1VQDA 2UU9L 2MO0A 3JC66 4LF7L 4NXML 4BBRH 3U4VA 2K4KA 4JYAL 4POFA 4GS3A 2K14A 2E2JH 4A3BG 3CCEA 4DR7L 3S24A 3F8TA 3STBD 4DR3L 2UUCL 3AEVA 2MQHA 1OXTA 1YHQA 1N33Q 5IYCG 4DUZL 4JI0Q 4LFCQ 1YHBA 2KENA 1PH3A 4R4OA 4L5RC 2NN6I 3ULLA 1VQLA 3RR5A 1XJVA 3RNUA 1BBUA 2IHFA 2MO1A 5LMUL 2BA0A 2I5HA 5GQOA 4MTNA 5GROA 1KC8C 3M9BA 4DV7Q 4DR2Q 4A76A 5IYBH 4A3JG 1E22A 2IX0A 2JA9A 5GAEC 3I4MH 2Z0SA 5M3MH 1V1QA 3PV0A 4JI8L 5IP9G 3S15H 4TVAB 4AIMA 1YJNA 1ASZA 2K5NA 1G291 1L1OA 3L2PA 2HT1A 1W3SA 3PGZA 4DKAC 1NJIC 4IO9A 4HJAA 3D31A 1N8RC 2JK8A 2UUAQ 4GN3B 1VQ4A 2RF4A 1N34L 4BY1H 2CWPA 4OX9L 4BA2I 3CMAA 4IPGA 1EQQA 3F1ZA 1SROA 1O7IA 5DLQE 1IBLQ 4DV1Q 1K0RA 4DK3C 1IBMQ 3CAMA 1KRTA 4DNIA 2JA6H 5LMNL 4GKJL 2K75A 5EAYA 4DV6L 3F2DA 3A0JA 4JI1Q 3UE0A 1HNWQ 1PH9A 4OWWB 2KCTA 1E24A 1TWAH 1FJGQ 1KXLA 3G4SA 4BBSG 4IOAA 3S2HH 4DR6L 1MKHA 3FKIG 2PMZE 5M5WH 4B3RQ 1IBKL 1VQFA 4PZ8A 3T1YL 2ZJPA 4UY8C 2YTXA 2KHIA 1EYGA 1NTGA 2PQAB 3CCVA 2VZAA 4J15A 2OWOA 4DAMA 1QZHA 2JA8G 2K5VA 2N78A 4RMFA 1Y1WH 1A8VA 1EUJA 1UWVA 4YHHQ 2HIVA 3G71A 4R4IA 3UDIA 3M85A 1XMOL 1N36L 2R93H 4O0AA 5IP7H 4DV4L 1VQJA 4LF6Q 4K0KL 2VS1A 4LFAL 1S40A 4A3IH 1PH5A 1QVGA 3IRBA 2WP8J 4GKKQ 4DR1L 1TWGH 2AWOA 2JEAI 2RHQB 4A3EH 3K7UC 2KCMA 4A3FG 2ALYB 4JI6L 3KJPA 2E8GA 4FDBA 3KF6A 1C7YA 3CPFA 3HOUG 3M3YH 4UP8A 4RG1A 1S72A 4BY7H 4YCUA 1VQBA 2K50A 4JBMA 3OTOL 4X65Q 1W2BA 3I4NH 4LF8L 1E1TA 1YJ9A 2UXBQ 4X62Q 4QJFA 4JI2Q 1RL2A 1HR0Q 2JA7G 4DUYQ 1OXSC 3HKSA 1V9PA 4DR4Q 4OWTB 4DV3Q 1HR0W 4APVA 4A3KG 4LF4L 5BR8L 1Z47A 2D62A 3J81c 4LF5Q 3KYHC 1XNRQ 2VQFQ 2WB1G 3UDGA 5AJ3Q 3I56A 2UUBL 5J3BA 2QA4A 5JJLA 1JT8A 4A3DH 5FJ8H 3HOXG 2UXCQ 3CC2A 4LUVA 2LXJA 1AH9A 1UE1A 2NVQH 1CSQA 1X3FA 2LXKA 3NBHB 4GNXB 4JCVE 1BBWA 1HH2P 2PQAA 3E9HA 2VL6A 5M3FH 3CCRA 1WI5A 2VQEQ 2N3SA 1HJPA 2Z6KA 3PIPA 2QEXA 3CCSA 4LW1A 1P16A 1QUQA 4C3HH 3CCLA 2VUMG 4JOIC 4UPAA 1YHAA 1PH6A 1PH1A 1JJ2A 2HHHQ 1WCMH 2GVAA 3CXCA 2R92H 1JJGA 4A3MH 2YV5A 1HNXQ 1YZ6A 1X3EA 4GN4B 2OQKA 1OXXK 5FLMG 5IY0A 1R9TH 1VQNA 2UXDQ 1OTCA 1NBWA 4BXXH 1HNXL 4GOPA 1LM0A 3OYYA 2DUDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LUO A;  4IPH A;  2F3I A;  3GDE A;  5M5Y H;  1VQ7 A;  4B3M L;  3EIV A;  4LFB L;  2ZM6 Q;  1G51 A;  2VQE L;  1UEB A;  4IPD A;  2VW9 A;  2R7Z G;  1A0I A;  3RN2 A;  4OO1 G;  1TWF H;  3DLL A;  3EN2 A;  1M90 C;  5GAD C;  4B3S L;  3J80 c;  1VQM A;  4R4Q A;  1TXY A;  4JOI A;  3T1H L;  2LSS A;  2UXC L;  3EBE A;  2NVY H;  2EIF A;  2VQF L;  1XNR L;  2IT1 A;  3PO3 H;  2JEB I;  1VQO A;  3UDF A;  4R4T A;  1Y1V G;  1LTL A;  5IE8 A;  1PA6 A;  1M1K C;  3TRE A;  2IHE A;  2F4V L;  3S1Q H;  3NEL A;  2OTL A;  4KLK A;  5H1S E;  3Q8D A;  3RLO A;  1VQ9 A;  4JI2 L;  3TEH B;  3AFQ A;  1PH4 A;  4JI4 Q;  4PMW A;  4X65 L;  1X55 A;  1X6O A;  5C3E G;  4IOC A;  1EOV A;  4HJ7 A;  1K9M C;  4L5S A;  3HOZ G;  1G6P A;  2ZTC A;  3I2Z A;  4C3I H;  3J7Z C;  2WAQ G;  2ASB A;  3HOV H;  2JA5 G;  4JV5 Q;  2ZTE A;  1SN8 A;  3PCO B;  1V43 A;  2MFI A;  3KOJ A;  4HIK A;  4YCV A;  5C0X J;  3A5Z B;  5C44 H;  1GO3 E;  4JI6 Q;  1XPU A;  3PSI A;  4P74 A;  4WJ3 M;  3JAM c;  3CME A;  5C44 G;  4DR1 Q;  1I3Q H;  4NB3 A;  4AH6 A;  1HZA A;  4A93 G;  2AKW B;  3HFZ B;  2JA5 H;  1JMC A;  1D8L A;  2I5L X;  4GOP B;  3HOV G;  1FGU A;  3HOZ H;  4K0K Q;  4DV4 Q;  1GVP A;  1Z9F A;  3ULP A;  1NE3 A;  2BA1 A;  4LF6 L;  5C3E H;  2CFM A;  4X66 Q;  4UP7 A;  1BVS A;  2WAQ E;  5ELN A;  1EIF A;  3U50 C;  4DPG A;  5M5X H;  1H95 A;  4GNX C;  1FVI A;  4X64 Q;  3ZJY C;  4DV0 Q;  1BKB A;  2L15 A;  3I4O A;  1Q1E A;  1L2F A;  3W1B A;  1PH8 A;  1Y1V H;  2IY5 B;  4QQB X;  3PO3 G;  3UDX A;  3ER0 A;  1X65 A;  4YWM A;  1IBK Q;  4B3R L;  1K73 C;  2BH2 A;  4HID A;  4NXN L;  1A62 A;  1Q7Y C;  3H3V H;  1NY4 A;  4PZ7 A;  4YWL A;  2R7Z H;  3S14 H;  4JI1 L;  1QZG A;  4LUZ A;  4DV6 Q;  5C4X G;  2CWA A;  4AYB G;  4GOP C;  5LMN Q;  4GKJ Q;  1IYJ B;  2A19 A;  3PUW A;  4AQY L;  4BXX G;  4DV2 Q;  4DV1 L;  1B70 B;  1IBM L;  2AWN A;  2Q2I A;  3ULJ A;  5FLM H;  1C9O A;  4L5Q A;  4DV2 L;  1N34 Q;  4AQY Q;  5E7N A;  3CF5 A;  4A3M G;  1VQ8 A;  4OX9 Q;  5IT9 c;  5C4J H;  1WCM G;  3J80 i;  2ID0 A;  3RLN A;  4DAY B;  2R92 G;  3J7A 5;  3S2D H;  2VUM H;  5C4X H;  1Q8K A;  2N8N A;  1YIT A;  4DK6 C;  3CC7 A;  1MJE A;  1KQS A;  1B7Y B;  3ICE A;  2WFW A;  1K8A C;  5M3F G;  1CKM A;  1JJC B;  1VQK A;  1PH7 A;  3J81 j;  1YBY A;  2B29 A;  4DR2 L;  4NXN Q;  4DV7 L;  1A63 A;  1VCI A;  3HOX H;  3BZK A;  5FJ8 G;  4A3D G;  1GM5 A;  1IXR A;  5LMU Q;  4BBS H;  1PVO A;  5JJK A;  3KJO A;  4ALP A;  2I5M X;  4IJH A;  4A3K H;  1XPO A;  3D0F A;  3BZC A;  1SFO H;  1KHI A;  3G6E A;  2JA7 H;  1NMG A;  1MIU A;  4X64 L;  4DV0 L;  2K52 A;  1B8A A;  3CCM A;  1T9H A;  3A5U A;  2NN6 G;  3RZD H;  2XGT A;  3I4N G;  2B3G A;  2OQ0 A;  4LFC L;  4X66 L;  3I55 A;  4WJ4 A;  3B6Y A;  3M4Q A;  5GAH C;  4HJ8 A;  4BY7 G;  4HJ9 A;  3L0O A;  1KL9 A;  4C2M H;  2A1A A;  3HOU H;  5JEA J;  4R4C A;  1Q46 A;  3U4Z A;  4DR3 Q;  4A3F H;  2UUC Q;  3CD6 A;  4A3E G;  3BJU A;  4KHZ A;  1K8G A;  3UE1 A;  1UE5 A;  2EXD A;  1KIX A;  3NEN A;  3MEF A;  3GTQ H;  4A3I G;  1YEZ A;  4JYA Q;  1NMF A;  4LF7 Q;  4NXM Q;  4JV5 L;  3J81 i;  3M4P A;  1AE2 A;  5IP7 G;  3KF6 B;  4Y7N H;  2BH8 A;  1YNX A;  2XTI A;  1N32 L;  2OTJ A;  3GTO H;  2R93 G;  2JE6 I;  4A4I A;  1Y1W G;  3CP0 A;  5C0X G;  3F2C A;  4JI4 L;  2JA8 H;  1WJJ A;  2HIX A;  3CW2 C;  4MZ9 A;  3LGJ A;  3TS0 A;  4LF9 L;  1I6H H;  4OWX B;  3A74 A;  2F4V Q;  3KLW A;  2AMC B;  4IPC A;  3SGI A;  2ES2 A;  2YYZ A;  1EIY B;  1RIP A;  2MNA A;  3HKZ E;  3G48 A;  4R1J A;  3K81 C;  1PFS A;  1I50 H;  4JC0 A;  3K0X A;  3FKI H;  4DR5 L;  1OXV A;  4H02 A;  3T1H Q;  1C0A A;  2CKZ B;  2E2I H;  4X6A H;  2R7F A;  4B3S Q;  1LYL A;  3H3V I;  4PZ6 A;  5IWA Q;  1S3O A;  4IFD I;  2KBN A;  4EX5 A;  2ZTD A;  5FLX c;  4POG A;  4MNO A;  4YWK A;  1UE7 A;  5HGQ A;  1Q82 C;  4KHP L;  1XTD A;  4JI3 Q;  2ZM6 L;  4P73 A;  4LFB Q;  3STB C;  3RN5 A;  4B3M Q;  1SE8 A;  1HNZ L;  3W1G A;  2JA6 G;  1PH2 A;  3RZO H;  4QY7 A;  3S17 H;  3K80 C;  3S1M H;  4GKK L;  3L7Z C;  4YY3 Q;  1GKH A;  1HZC A;  2GVB A;  3GTL H;  2UXD L;  3M7N A;  4HIM A;  4KI0 A;  1U5K A;  1KRS A;  1VQE A;  1X54 A;  1SLJ A;  4BY1 G;  1XNQ Q;  1EQR A;  4QIW E;  1X3G A;  3CQZ H;  1VQC A;  1E7Z A;  2HHH L;  4B3T Q;  4TQU S;  2PNH A;  2F52 A;  1J5E Q;  2IX1 A;  1I94 Q;  1QVC A;  1IZ6 A;  2Q2U A;  1YIJ A;  2I0Q A;  1PYS B;  4P71 A;  5IP9 H;  4XIG S;  5M3M G;  4Y52 H;  2Q2H A;  2EQS A;  2Z6K C;  5IYB G;  4A3J H;  2ZJQ A;  1YI2 A;  3I4M G;  4IFD J;  1GD7 A;  1YVC A;  4JI5 Q;  3CPW A;  3CCJ A;  1VQP A;  3K8A A;  2AHO B;  5AJ3 L;  2UUB Q;  4O2D A;  1VQI A;  1VQ5 A;  1Q81 C;  1AE3 A;  4LF5 L;  1Y14 B;  5BR8 Q;  3PF5 A;  1WOC A;  3KDF A;  3WWV A;  4JI7 L;  2RCN A;  3GO5 A;  4LF4 Q;  4DV3 L;  1CSP A;  2R7D A;  4DR4 L;  4DUY L;  3KDF B;  1HR0 L;  4GNX A;  4IFD G;  1QVF A;  4X62 L;  2UXB L;  4LF8 Q;  3OTO Q;  2NZH A;  5IYC H;  4L5T A;  2ATW A;  4DV5 Q;  2E5L L;  1VQ6 A;  1UE6 A;  4C3J H;  4A3B H;  1OXU A;  4GLV B;  1EWI A;  2NVT H;  4BBR G;  5GAG C;  2H5X A;  2VNU D;  1XMQ Q;  2JQO A;  4LFA Q;  3JAM i;  2C35 B;  1E1O A;  3VDY A;  3W5O A;  1VS0 A;  3S1R H;  3HOW H;  4HJ5 A;  3CCU A;  1XMO Q;  5JEA G;  1N36 Q;  4QL5 A;  4AYB E;  4YHH L;  1HZB A;  3PF4 A;  1VQH A;  1XMQ L;  1Q1B A;  2JJQ A;  1I5F A;  3TS2 A;  1Q86 C;  1TWC H;  3GTG H;  3HOY H;  3ERS X;  3F2B A;  4JBW A;  3OW2 A;  1YJW A;  1SR3 A;  1JB7 A;  1CUK A;  4P75 A;  2E5L Q;  1P8L A;  5IYD G;  4DV5 L;  3HKZ G;  3T1Y Q;  3PUV A;  3H15 A;  1TWH H;  3CC4 A;  2DGY A;  3BU2 A;  2YTY A;  3AYH B;  1K83 H;  2FXQ A;  4DR6 Q;  1L1O C;  1CKN B;  3H0G H;  1PV4 A;  4JBK A;  4XTC S;  1FJG L;  1CKN A;  2K5H A;  3E9I A;  3U58 A;  1LUZ A;  3MXN B;  3PO2 H;  4A3C H;  4EQ5 A;  1HNW L;  2NZO A;  4JI7 Q;  2B63 H;  2CQO A;  1PHJ A;  2Q2T A;  2CCZ A;  4A3L G;  4A75 A;  3I7F A;  4GLX A;  2PI2 E;  1XPR A;  2HQL A;  1J6Q A;  5ELO A;  4JI5 L;  1X9N A;  1PYB A;  4PG3 A;  3RLF A;  5LMN W;  3KFU A;  3E0E A;  4A3G G;  1HZ9 A;  2N49 A;  1MJC A;  3PUX A;  1IBL L;  3GTM H;  3M4O H;  1U0L A;  3GTJ H;  1JE5 A;  5JJI A;  1KAW A;  3AFP A;  2D0O A;  3NEM A;  3CCQ A;  4HIO A;  1QUQ B;  2UUA L;  1I94 L;  3S16 H;  3S1N H;  4BA1 I;  1WYD A;  1J5E L;  4B3T L;  4UP9 A;  2A8V A;  3KF8 B;  3GD7 A;  1KD1 C;  4QGU A;  1L1O B;  1FL0 A;  1XNQ L;  4JI8 Q;  2PI2 A;  1Q12 A;  2KHJ A;  3AQQ A;  4YY3 L;  4A3G H;  2E2H H;  5HY6 A;  4LNQ A;  4GN5 A;  3PUZ A;  1SRU A;  3PIO A;  1HNZ Q;  2Y0S E;  4A3L H;  4LWC A;  4JI3 L;  3TRZ A;  2B63 G;  1ASY A;  4KHP Q;  1EFW A;  2R6G A;  2WB1 E;  4A3C G;  3PO2 G;  5IWA L;  2OCE A;  1DGS A;  3H0G G;  1VQG A;  1CKO A;  1X56 A;  4YCW A;  4A93 H;  3FP9 A;  2GN5 A;  2YTV A;  3K7A H;  4DUZ Q;  4DR5 Q;  4JI0 L;  4OO1 I;  4OON A;  2QGQ A;  2RHS B;  2ZJR A;  2D0P A;  1N33 L;  1K3R A;  1VQA A;  1D7Q A;  3TQY A;  4OXP A;  3DM3 A;  2NVX H;  5IYD H;  1IL2 A;  2V1C C;  4DR7 Q;  4ME3 A;  3FHW A;  4GLA C;  2YU9 H;  4LF9 Q;  4IJL A;  1WFQ A;  3HOY G;  1L0W A;  4P72 A;  3GTK H;  3PUY A;  5K36 G;  3GTP H;  1SMX A;  1E3P A;  2VY3 A;  5C0X I;  4NPS A;  2UU9 Q;  2Y0S G;  1N32 Q;  1N9W A;  4JBJ A;  4JG2 A;  3HOW G;  1VQD A;  2UU9 L;  2MO0 A;  3JC6 6;  4LF7 L;  4NXM L;  4BBR H;  3U4V A;  2K4K A;  4JYA L;  4POF A;  4GS3 A;  2K14 A;  2E2J H;  4A3B G;  3CCE A;  4DR7 L;  3S24 A;  3F8T A;  3STB D;  4DR3 L;  2UUC L;  3AEV A;  2MQH A;  1OXT A;  1YHQ A;  1N33 Q;  5IYC G;  4DUZ L;  4JI0 Q;  4LFC Q;  1YHB A;  2KEN A;  1PH3 A;  4R4O A;  4L5R C;  2NN6 I;  3ULL A;  1VQL A;  3RR5 A;  1XJV A;  3RNU A;  1BBU A;  2IHF A;  2MO1 A;  5LMU L;  2BA0 A;  2I5H A;  5GQO A;  4MTN A;  5GRO A;  1KC8 C;  3M9B A;  4DV7 Q;  4DR2 Q;  4A76 A;  5IYB H;  4A3J G;  1E22 A;  2IX0 A;  2JA9 A;  5GAE C;  3I4M H;  2Z0S A;  5M3M H;  1V1Q A;  3PV0 A;  4JI8 L;  5IP9 G;  3S15 H;  4TVA B;  4AIM A;  1YJN A;  1ASZ A;  2K5N A;  1G29 1;  1L1O A;  3L2P A;  2HT1 A;  1W3S A;  3PGZ A;  4DKA C;  1NJI C;  4IO9 A;  4HJA A;  3D31 A;  1N8R C;  2JK8 A;  2UUA Q;  4GN3 B;  1VQ4 A;  2RF4 A;  1N34 L;  4BY1 H;  2CWP A;  4OX9 L;  4BA2 I;  3CMA A;  4IPG A;  1EQQ A;  3F1Z A;  1SRO A;  1O7I A;  5DLQ E;  1IBL Q;  4DV1 Q;  1K0R A;  4DK3 C;  1IBM Q;  3CAM A;  1KRT A;  4DNI A;  2JA6 H;  5LMN L;  4GKJ L;  2K75 A;  5EAY A;  4DV6 L;  3F2D A;  3A0J A;  4JI1 Q;  3UE0 A;  1HNW Q;  1PH9 A;  4OWW B;  2KCT A;  1E24 A;  1TWA H;  1FJG Q;  1KXL A;  3G4S A;  4BBS G;  4IOA A;  3S2H H;  4DR6 L;  1MKH A;  3FKI G;  2PMZ E;  5M5W H;  4B3R Q;  1IBK L;  1VQF A;  4PZ8 A;  3T1Y L;  2ZJP A;  4UY8 C;  2YTX A;  2KHI A;  1EYG A;  1NTG A;  2PQA B;  3CCV A;  2VZA A;  4J15 A;  2OWO A;  4DAM A;  1QZH A;  2JA8 G;  2K5V A;  2N78 A;  4RMF A;  1Y1W H;  1A8V A;  1EUJ A;  1UWV A;  4YHH Q;  2HIV A;  3G71 A;  4R4I A;  3UDI A;  3M85 A;  1XMO L;  1N36 L;  2R93 H;  4O0A A;  5IP7 H;  4DV4 L;  1VQJ A;  4LF6 Q;  4K0K L;  2VS1 A;  4LFA L;  1S40 A;  4A3I H;  1PH5 A;  1QVG A;  3IRB A;  2WP8 J;  4GKK Q;  4DR1 L;  1TWG H;  2AWO A;  2JEA I;  2RHQ B;  4A3E H;  3K7U C;  2KCM A;  4A3F G;  2ALY B;  4JI6 L;  3KJP A;  2E8G A;  4FDB A;  3KF6 A;  1C7Y A;  3CPF A;  3HOU G;  3M3Y H;  4UP8 A;  4RG1 A;  1S72 A;  4BY7 H;  4YCU A;  1VQB A;  2K50 A;  4JBM A;  3OTO L;  4X65 Q;  1W2B A;  3I4N H;  4LF8 L;  1E1T A;  1YJ9 A;  2UXB Q;  4X62 Q;  4QJF A;  4JI2 Q;  1RL2 A;  1HR0 Q;  2JA7 G;  4DUY Q;  1OXS C;  3HKS A;  1V9P A;  4DR4 Q;  4OWT B;  4DV3 Q;  1HR0 W;  4APV A;  4A3K G;  4LF4 L;  5BR8 L;  1Z47 A;  2D62 A;  3J81 c;  4LF5 Q;  3KYH C;  1XNR Q;  2VQF Q;  2WB1 G;  3UDG A;  5AJ3 Q;  3I56 A;  2UUB L;  5J3B A;  2QA4 A;  5JJL A;  1JT8 A;  4A3D H;  5FJ8 H;  3HOX G;  2UXC Q;  3CC2 A;  4LUV A;  2LXJ A;  1AH9 A;  1UE1 A;  2NVQ H;  1CSQ A;  1X3F A;  2LXK A;  3NBH B;  4GNX B;  4JCV E;  1BBW A;  1HH2 P;  2PQA A;  3E9H A;  2VL6 A;  5M3F H;  3CCR A;  1WI5 A;  2VQE Q;  2N3S A;  1HJP A;  2Z6K A;  3PIP A;  2QEX A;  3CCS A;  4LW1 A;  1P16 A;  1QUQ A;  4C3H H;  3CCL A;  2VUM G;  4JOI C;  4UPA A;  1YHA A;  1PH6 A;  1PH1 A;  1JJ2 A;  2HHH Q;  1WCM H;  2GVA A;  3CXC A;  2R92 H;  1JJG A;  4A3M H;  2YV5 A;  1HNX Q;  1YZ6 A;  1X3E A;  4GN4 B;  2OQK A;  1OXX K;  5FLM G;  5IY0 A;  1R9T H;  1VQN A;  2UXD Q;  1OTC A;  1NBW A;  4BXX H;  1HNX L;  4GOP A;  1LM0 A;  3OYY A;  2DUD A; 
#chains in the Genus database with same CATH topology
 1VQ7 A;  1B9N A;  2K6A A;  1Y1V B;  3WDN A;  2R7Z G;  1A0I A;  5LL6 X;  3SK6 A;  3RN2 A;  1EYD A;  4ULL A;  3R2I A;  3DLL A;  4B3S L;  2FMM A;  4R4Q A;  4JOI A;  1E2Z A;  3A8K E;  1NUC A;  1CHQ D;  1PRT B;  2NUC A;  3UDF A;  3NEL A;  1EWH A;  5EBC A;  2OT2 A;  1VQ9 A;  4A3D B;  1PH4 A;  5FO7 B;  1EOV A;  2XRS D;  2MGS A;  3V05 A;  5C4H A;  2WAQ G;  3ERO A;  3SHL A;  1QCB D;  2WAC A;  1V43 A;  3PCO B;  4JI6 Q;  4A93 H;  3FPP A;  2K28 A;  3A5Z B;  5C44 H;  1GO3 E;  3CME A;  3VYS A;  3AU7 A;  2AKW B;  5IGG A;  4DU9 A;  3HOV G;  1C4Q A;  3ULP A;  1BCP C;  4LF6 L;  1NE3 A;  5C3X A;  5C3E H;  2WAQ E;  5KNC A;  5ELN A;  4WFN 3;  3U50 C;  4DPG A;  3HOX B;  4C56 C;  5M5Y B;  3I73 A;  2O5J C;  3A54 A;  1M4V A;  4K5X A;  4AYB B;  2IY5 B;  5COY A;  5CBA E;  1DON A;  1G6Z A;  3NTH A;  3PO3 G;  4YWM A;  3DEP A;  1K73 C;  4IZ8 A;  2BH2 A;  2ZXR A;  1AN8 A;  2Z9H A;  1A62 A;  1JIC A;  5D3D A;  4KK7 A;  1K8M A;  3H94 A;  5KYI A;  1QZG A;  2CWA A;  2C9O A;  4GOP C;  1U9R A;  1A2T A;  1JB3 A;  2A19 A;  3PUW A;  5COR A;  4DV1 L;  1IBM L;  2Q2I A;  3URY A;  4C3I B;  1VQ8 A;  3CF5 A;  4A93 B;  5KRU A;  3TZD A;  2VUM H;  5C4X H;  1Q8K A;  4J6H A;  3J7A F;  3ICE A;  3IKJ A;  5ELC A;  3HOZ B;  1FR3 A;  2CW0 C;  3EFX D;  5C3E B;  1B9M A;  1Y8N B;  1A63 A;  1VCI A;  3HOX H;  3BZK A;  5FJ8 G;  1K8O A;  1H9J A;  1JC7 A;  4XQN A;  1GM5 A;  3IAY A;  5ELF A;  3D4W A;  2I5M X;  4IJH A;  3R93 A;  1ILP A;  2JA7 H;  2XN9 C;  1T9H A;  2OQ0 A;  1G2T A;  2HDL A;  4HJ8 A;  3GTL B;  2F0K A;  5JEA J;  1Q46 A;  1ENA A;  1HA6 A;  5A35 A;  1WD1 A;  3D4D A;  3M4P A;  1FNU A;  3GTO H;  2JE6 I;  2F0W A;  2B2W A;  1T5E A;  4A4I A;  1Y1W G;  3F2C A;  1J9O A;  2PW7 A;  3I72 A;  1WJJ A;  2HIX A;  5KYL A;  3CW2 C;  4LF9 L;  1I6H H;  4OWX B;  3A74 A;  4BWG B;  4FF2 A;  4IPC A;  2AMC B;  2VB3 X;  3SGI A;  5I4D A;  4ZAI A;  3OPO A;  4JC0 A;  4ZYS A;  4QMG A;  1GUO A;  3MXN A;  1C0A A;  2F0I A;  2CKZ B;  4B3S Q;  1LYL A;  4HCE A;  5IWA Q;  2KBN A;  5FLX c;  4MNO A;  4DN4 M;  1U4L A;  2QDL A;  2JA7 B;  1ICW A;  2EY1 A;  3L7Z C;  4YY3 Q;  4R8I A;  1MD2 D;  1HZC A;  3S1R B;  3GTL H;  4FF1 A;  1ILQ A;  2A74 C;  1U5K A;  1VQE A;  1X54 A;  4C2M B;  4DXG A;  1EQR A;  1W6K A;  4HED A;  4LAA A;  3CQZ H;  1TS5 A;  1VQC A;  2HHH L;  4DK1 A;  5JAV A;  2I07 B;  4XXE A;  2D5D A;  5M3M G;  4XIG S;  3Q23 A;  3I4M G;  2EQS A;  2E74 C;  3D8G A;  2PZW A;  1YI2 A;  1Q90 A;  1XXG A;  5FKA C;  1GD7 A;  3K8A A;  4O2D A;  1VQI A;  4JW0 A;  1Q81 C;  1LT5 D;  5BR8 Q;  3PF5 A;  4XQQ A;  2RCN A;  4DV3 L;  2R7D A;  4RGO S;  1KDA A;  4HTH A;  4IFD G;  2UXB L;  4LMQ D;  1EOT A;  3K6O A;  3E0J A;  3LWE A;  1KAA A;  4DV5 Q;  3HP3 A;  3R8B A;  2QKI C;  4A3B H;  1EQV A;  3K5L A;  2MJ8 A;  5M9O A;  1D5X C;  4QIW B;  3TME A;  4LFA Q;  3JAM i;  1E1O A;  1VMC A;  1VS0 A;  4K5V A;  3S1R H;  4HJ5 A;  4I65 A;  5JEA G;  4QL5 A;  2E2H B;  1EYC A;  3PF4 A;  1VQH A;  2DN8 A;  2OF1 A;  3TS2 A;  2JJQ A;  1Q86 C;  3CQZ B;  5CV6 A;  1SYB A;  1JB7 A;  4P75 A;  2EOT A;  4DV5 L;  3HKZ G;  2G9H D;  3T1Y Q;  3H15 A;  2K32 A;  3BU2 A;  2X69 A;  3AYH B;  4S3S A;  4DR6 Q;  1L1O C;  4JBK A;  1FJG L;  3E9I A;  1FD7 D;  1R4Q B;  4X3U A;  4EQ5 A;  1IKL A;  2B63 H;  1T5X D;  2YU9 B;  2CCZ A;  1LTA D;  4A75 A;  1GJX A;  4ME5 A;  3GTK B;  1L0X B;  5EKI A;  1J6Q A;  4FF3 A;  3A8J E;  4A3G G;  3GTM H;  2HQE A;  5BN5 A;  5JJI A;  3S1N H;  2EY6 A;  4YIJ A;  4A3B B;  4C1N K;  1QE6 A;  2A8V A;  3KF8 B;  4UAI A;  4QGU A;  5JVG 3;  4DGZ A;  1F2L A;  4F7X A;  4YY3 L;  1GUN A;  5HY6 A;  4FVM A;  3BS1 A;  2KEE A;  1A3V A;  3PUZ A;  3PIO A;  1O7Y A;  2Y0S E;  1SE3 A;  3OMC A;  4LWC A;  3T53 B;  4BS9 A;  4A3L H;  1STN A;  3ITP A;  3SDZ A;  1ASY A;  2B2W C;  3PO2 G;  5IWA L;  2ICI A;  1VQG A;  1CKO A;  3FP9 A;  2GN5 A;  2YTV A;  4OO1 I;  2JN4 A;  2QGQ A;  1D7Q A;  3NXW A;  1VQA A;  2EJF C;  1IYV A;  1EEI D;  3QIA A;  1ZYR D;  1SSO A;  5EQ0 A;  5IYD H;  3OWE B;  4LF9 Q;  2K05 A;  1L0W A;  3MWY W;  2M00 A;  5EPL A;  4NPS A;  3GTM B;  1N9W A;  4JBJ A;  3HOW G;  2UU9 L;  2EYH A;  1RKN A;  4BBR H;  2K4K A;  2K14 A;  2RSN A;  3RD4 A;  5KEE A;  3CCE A;  3S24 A;  3K0Y A;  1F77 A;  1TWA B;  5IYC G;  2A6H C;  2AQ3 B;  1PH3 A;  3KK7 A;  1EU3 A;  1VQL A;  4K14 A;  3KLR A;  1EFI D;  1XJV A;  3QJY A;  5CR3 A;  5ELB A;  4HMI A;  2IHF A;  3DWQ A;  5GRO A;  4MTN A;  4KD3 A;  3M9B A;  1EY6 A;  4A3J G;  5GAE C;  2X6G A;  2M9V A;  3TBI B;  2E76 C;  4HSP A;  2ENB A;  5IP9 G;  4DK0 A;  4OIK A;  5CC4 A;  4TVA B;  5DM6 3;  4AIM A;  2XSC A;  1ASZ A;  1WD0 A;  2B8G A;  3MXP A;  2L12 A;  2UUA Q;  1VQ4 A;  4MIU A;  4WOR A;  4DFA A;  1O7I A;  3HS0 C;  1SND A;  4DV1 Q;  1K0R A;  1IBM Q;  1GXD C;  1TII D;  3CAM A;  3A7A B;  3OOC A;  4DNI A;  4BBR B;  1ZXT A;  2JP1 A;  4Z9C B;  5CMD A;  1WTV A;  1QJO A;  1HNW Q;  1GUS A;  3J80 L;  1TWA H;  1WTP A;  4QCL A;  3G4S A;  3S2H H;  3FKI G;  2PMZ E;  3G6J B;  4QF4 A;  4PZ8 A;  4UY8 C;  2ZJP A;  2YTX A;  1TR5 A;  2O4X A;  1HA5 A;  4PV1 C;  3C1F A;  2F0O A;  2K5W A;  4DAM A;  2R92 B;  1QZH A;  2JA8 G;  1UWV A;  1FNV A;  1N36 L;  1XMO L;  4ZUI A;  4LF6 Q;  1NR2 A;  4KD4 A;  3S15 B;  1S40 A;  4KJO A;  2WP8 J;  1TWG H;  3T16 A;  3VA7 A;  2LKV A;  2K03 A;  2KCM A;  4JI6 L;  2E8G A;  3M3Y H;  3CPF A;  3HOU G;  4UP8 A;  1ICF B;  3BDL A;  4QB4 A;  4BY7 H;  3VR4 A;  4ILW A;  4YCU A;  1VQB A;  1TWF B;  1SJE D;  3OTO L;  3I4N H;  2NN6 H;  4LF8 L;  1PZI D;  3KLS A;  3X3N A;  2FHT A;  4XYQ A;  2F0L A;  4H7B A;  3TSS A;  3HKS A;  5I9O A;  1D6E C;  4DR4 Q;  4OWT B;  1L0Y B;  1VF7 A;  4A3K G;  2D62 A;  1PLF A;  3J81 c;  4BBS G;  2SNS A;  2ZXP A;  3DEO A;  5AJ3 Q;  2B2U C;  2QA4 A;  2PZU A;  5JJL A;  4FXK C;  1JT8 A;  5I6Y A;  1F9R A;  3CC2 A;  5ELD A;  5J39 A;  4DXF A;  1CSQ A;  1HH2 P;  4OEL B;  2AUK A;  1CA6 A;  2N3S A;  3CCS A;  3PIP A;  2OXP A;  1P16 A;  1QUQ A;  4FXD A;  4JOI C;  4UPA A;  1LV9 A;  1YHA A;  1EY4 A;  1NR4 A;  2R92 H;  1S4Z A;  3I90 A;  2JA5 B;  2OQK A;  3DWP A;  1NSN S;  2UXD Q;  1EL0 A;  3OIP A;  3SXH A;  4BXX H;  2RVL A;  4GKK Q;  1IL8 A;  1GHJ A;  3PMF A;  4A3I B;  3EIV A;  1J8I A;  1KNE A;  1G2S A;  3GV3 A;  1UEB A;  2VW9 A;  2RA4 A;  3M3Y B;  1ET9 A;  3E3X A;  4J1M A;  1TWF H;  1M90 C;  5GAD C;  4JVZ A;  1Y8O B;  2UXC L;  2LSS A;  4NW2 A;  2B2Y A;  5EKK A;  5JPN C;  1LTB D;  2IHE A;  3VYR A;  3S1Q H;  4RHR A;  3Q8D A;  4JI2 L;  4X65 L;  1X55 A;  4HJ7 A;  3VR5 A;  1K9M C;  2ZTC A;  5M3F B;  2ASB A;  1JR0 D;  2JA5 G;  3TP8 A;  4JV5 Q;  3R2T A;  2MFI A;  4NP5 A;  5C0X J;  4WJ3 M;  3EVQ A;  3JAM c;  4DR1 Q;  3NE5 B;  4HSV A;  3HFZ B;  3PQI A;  1JMC A;  4GOP B;  4QUF A;  4DV4 Q;  3H3V C;  1XYI A;  1KNA A;  1TT2 A;  4UP7 A;  1B53 A;  3T56 B;  4G4K A;  3MZ5 A;  1EIF A;  1SEB D;  5M5X H;  4GNX C;  3SE0 A;  4DV0 Q;  1D1K A;  3ZJY C;  3C2P A;  3Q24 A;  1LTI D;  3E6Z X;  1BKB A;  4XT3 B;  1WTR A;  4BBS B;  1PH8 A;  4ZK9 B;  4UDU C;  1Y1V H;  4IN3 A;  3FMC A;  4Q5V A;  1HTL D;  1V1O A;  3ER0 A;  3UDX A;  3WOE A;  1YNN C;  1IBK Q;  3SVM A;  3DUZ A;  3MC0 B;  4NXN L;  2Z4H A;  3CU7 A;  1ZEQ X;  5IGF A;  3MAQ A;  2J4X A;  2JYO A;  1NY4 A;  4YWL A;  3VR3 A;  3S14 H;  2BE5 C;  3HOU B;  2MPM A;  4IAL A;  3S1Q B;  2XRQ D;  5LMN Q;  4GKJ Q;  1IYJ B;  2EJM A;  2A73 B;  4AQY L;  2X6L A;  1B70 B;  2KHS A;  3IFT A;  1YNJ C;  3ULJ A;  4WJW A;  2WII B;  4L5Q A;  1N34 Q;  4OX9 Q;  1IHZ A;  1H9R A;  2R92 G;  2C5C A;  4DAY B;  1ESF A;  1HFN A;  4CJ0 B;  2N8N A;  1B1Z A;  2EE1 A;  4N8X 1;  4DK6 C;  4F8M A;  1B7Y B;  4ZKC B;  3CC7 A;  4OIJ A;  1I50 B;  1VQK A;  3FKI B;  3E5S A;  3MFY A;  2BDN A;  2B29 A;  2QIL A;  3M7G A;  1IXR A;  5LMU Q;  5JJK A;  4A3K H;  1LAC A;  3D0F A;  2LY7 A;  5ISR A;  3S17 B;  1SBB B;  3RZD H;  3I4N G;  2B3G A;  4X66 L;  4LFC L;  3I55 A;  3BG3 A;  3M4Q A;  4BY7 G;  4HJ9 A;  1S5C D;  3MA2 B;  3S14 B;  4DNT B;  1CZG A;  3CD6 A;  1UE5 A;  4KKT A;  3NEN A;  3MEF A;  1TQO A;  1YEZ A;  4NXM Q;  3X3M A;  3MXU A;  3KF6 B;  2BH8 A;  3J81 L;  1N32 L;  2OTJ A;  3OWF A;  2B2T C;  4PMB A;  3CP0 A;  3U9S A;  5C4X B;  4CDC C;  3KLW A;  1WTO A;  2MNA A;  2F0J A;  1ROD A;  3G48 A;  1C8C A;  2FIN B;  1PFS A;  1I50 H;  1LT4 D;  4H02 A;  5C4Z A;  2R7F A;  4X6A H;  3VYU A;  4L6T B;  1S3O A;  4EX5 A;  4POG A;  4YWK A;  1Q82 C;  4JI3 Q;  2ZM6 L;  4P73 A;  4K6D A;  4LFB Q;  3RN5 A;  1WVL A;  4B3M Q;  3TP7 A;  1HNZ L;  5KGU A;  4GZY C;  3RZD B;  1K3B C;  3ZYY X;  2F0T A;  2N88 A;  3ND8 A;  4I7Z C;  4DAY A;  4KI0 A;  1KRS A;  1STH A;  1SLJ A;  1DCZ A;  1X3G A;  4IUT A;  1TWC B;  1II3 A;  1I6V C;  2IX3 A;  1E7Z A;  1J5E Q;  3CRK C;  1IZ6 A;  3BVM A;  2I0Q A;  3OW7 A;  4P71 A;  1EU4 A;  1B3A A;  2NYZ D;  3SK8 A;  5IP9 H;  2Z6K C;  2ZJQ A;  4N9T A;  4JI5 Q;  1RTO A;  3CPW A;  3CCJ A;  4G7H C;  2UUB Q;  4LF5 L;  1AE3 A;  1O7L A;  3WWV A;  3HG9 A;  4IUV A;  4JI7 L;  1XWE A;  5FLX E;  2DNE A;  4DUY L;  1HR0 L;  4OEM B;  1QVF A;  4X62 L;  2PNR C;  2NZH A;  5IYC H;  4L5T A;  1PTO H;  2ATW A;  3GTJ B;  5EPJ A;  2E5L L;  1ZKO A;  3K57 A;  4GLV B;  1I4G A;  1V1P B;  1DOK A;  3Q0A A;  2H5X A;  2VNU D;  2JQO A;  2BCO A;  1U4P A;  2A69 C;  4A3G B;  4YHH L;  1Q1B A;  1I5F A;  5K36 H;  1SNM A;  1TWC H;  2Z6B A;  3R3O A;  1YJW A;  1SR3 A;  1CUK A;  1P8L A;  5IYD G;  2KUM A;  3PUV A;  1NNX A;  2A6E C;  1CQV A;  2DGY A;  3H91 A;  1PV4 A;  1BOS A;  1CKN A;  2EXZ A;  2K5H A;  3PO2 H;  3HKZ B;  1I4H A;  1EY9 A;  2CQO A;  3N6R A;  2Q2T A;  2QF7 A;  5KIX A;  4KMU C;  4E6I A;  4GLX A;  1XPR A;  5LMN W;  3NQI A;  4PG3 A;  3KFU A;  3W3A A;  1H9K A;  4NMZ A;  1ESR A;  1HZ9 A;  1TVX A;  1MJC A;  2R61 A;  2SNM A;  1IBL L;  3C3L A;  1PTO B;  1KAW A;  3CCQ A;  1K28 A;  4HIO A;  1I94 L;  3QB3 A;  1WYD A;  4KTA A;  4B3T L;  1CZW A;  2BOS A;  1KD1 C;  4KJN A;  4B9X A;  2QEJ C;  2CHB D;  1HPC A;  2KHJ A;  3AQQ A;  4A3G H;  3DMU A;  2E2H H;  3P75 A;  3A7L A;  1SRU A;  1I4R A;  1S5F D;  1H9S B;  4I7A A;  2R6G A;  5CV7 A;  4XQJ A;  2HCC A;  1DGS A;  5FO9 B;  5E3F A;  1X56 A;  3MXG A;  4YCW A;  2EYF A;  3A8I E;  4DAV A;  4DUZ Q;  2ZXO A;  4OON A;  3C1E A;  5M3M B;  2RHS B;  1N33 L;  5HUR A;  3TQY A;  1JWM D;  2TMP A;  4OXP A;  1IL2 A;  1KLU D;  4N8F A;  2YU9 H;  4GLA C;  3DXJ C;  3GTK H;  3PUY A;  5K36 G;  3PIP 3;  1VMP A;  5JEA H;  1YNN D;  3NUC A;  4LF7 L;  2B2U A;  1PYW D;  3U4V A;  1HFG A;  2F1M A;  4DR7 L;  2UUC L;  3AEV A;  2WIN B;  5D14 A;  3MFG A;  2L11 A;  2MQH A;  2PO4 A;  4IQZ A;  4JI0 Q;  2NN6 I;  4IFD H;  2K04 A;  1TU2 B;  2MO1 A;  1JQY D;  4FO2 A;  4A76 A;  2A6E D;  4K2L A;  4LJZ C;  4ODG A;  2PCF B;  4JI8 L;  3BDC A;  3P7J A;  1D5Z C;  1G29 1;  1L1O A;  3L2P A;  1TKW B;  1W3S A;  4DKA C;  1NJI C;  1FYC A;  3D31 A;  2JK8 A;  2K5D A;  1BCP F;  2RF4 A;  2G5D A;  2CWP A;  4BA2 I;  3F1Z A;  1SRO A;  1NCV A;  5DLQ E;  4TKO B;  3HRZ C;  3GQB A;  2F3V A;  3CHB D;  1WTX A;  3FPU B;  1IYU A;  4FYD A;  3F2D A;  2CH4 A;  1I4X A;  2NTS A;  1S5D D;  5JOB A;  4IOA A;  3TP5 A;  1H9M A;  1VF5 C;  2JSO A;  2HDM A;  1KTK A;  5M5W H;  2F03 A;  4RGN A;  2E75 C;  3EA6 A;  1NTG A;  4PQX A;  3CCV A;  2NBF A;  4J15 A;  3NQT A;  2NB0 A;  5G3L D;  2AUJ D;  3I91 A;  3G71 A;  4K8J A;  3M85 A;  1ZYR C;  1X3P A;  4K0K L;  1PRT C;  1VQJ A;  4K8I A;  2G9D A;  1PDQ A;  3IRB A;  2KEC A;  3KJP A;  1S72 A;  3BVZ A;  1DJR D;  5DAU A;  3NWT A;  4RAU C;  4JBM A;  1HHV A;  1O80 A;  1S5E D;  4B9W A;  4QJF A;  1RL2 A;  3VR6 A;  2VB2 X;  1HR0 W;  4APV A;  1DD2 A;  4LF4 L;  3KYH C;  3UDG A;  5CV9 A;  3HOX G;  4LUV A;  3S2H B;  5DEH A;  1X3F A;  5M5W B;  1BBW A;  3RMH A;  3HOV B;  3CCR A;  3L3O C;  4HCS A;  2QEX A;  5C4X G;  5CYU A;  1PH6 A;  1JJ2 A;  1I3Q B;  4X3S A;  3QOJ A;  2VXW A;  5CV4 A;  2YV5 A;  1HNX Q;  1X3E A;  2R3Z A;  3K58 A;  5IY0 A;  5TSS A;  2NTT A;  1LM0 A;  4KY5 A;  3TP6 A;  3U9O A;  2DUD A;  3GTP H;  1JWU D;  1PZK D;  4LUO A;  1GOZ A;  2EYO A;  2KJX A;  2Z8L A;  2VQE L;  1QNK A;  1CI3 M;  4EVO A;  4BY7 B;  3BYT B;  1RDP D;  3SK4 A;  3EN2 A;  3I4N B;  1VQM A;  3T1H L;  2F0E A;  2F0N A;  2EIF A;  2VQF L;  1XNR L;  1HTP A;  1JOO A;  4CJ1 B;  3PO3 H;  5IE8 A;  4R4T A;  1Y1V G;  1LTL A;  2F4V L;  3QG1 A;  2OTL A;  1QIL A;  5H1S E;  3RLO A;  2L0C A;  1DOM A;  3AFQ A;  1LTS D;  4JI4 Q;  4PMW A;  1K0S A;  3Q6S A;  3V96 A;  2RSO A;  4CDD C;  1G6P A;  1UNS A;  2KQ3 A;  1CT1 D;  3I2Z A;  3J7Z C;  4U67 3;  1SN8 A;  4ID6 A;  1KQS A;  4YCV A;  2K5Q A;  1I3Q H;  4AH6 A;  2F0P A;  2A6H D;  2JA5 H;  1D8L A;  3A56 A;  4M1U B;  1FGU A;  3EQL C;  1Z9F A;  2L4N A;  1PRT F;  2BA1 A;  4K5W A;  2CFM A;  1BVS A;  2TSS A;  3J7Y W;  4X64 Q;  1GHK A;  3PIO 3;  2BE5 D;  1CK1 A;  1L2F A;  3W1B A;  2I46 A;  2IPK D;  4QQB X;  2DJG C;  4B3R L;  1ENC A;  2JXM B;  4HID A;  2MP1 A;  2J7Z A;  4JI1 L;  4DV6 Q;  3NK9 A;  4A3F B;  1DZ1 A;  1QG7 A;  3KBX A;  3N52 A;  4EQN A;  1BNZ A;  3GTQ B;  2RQX A;  4BXX G;  4DV2 Q;  3DHQ A;  4DV2 L;  5JJZ A;  5IT9 c;  4RFB A;  5C4J H;  2ID0 A;  3J7A 5;  1JE4 A;  4H44 C;  2WFW A;  5E4W C;  1U4R A;  5M3F G;  4ZQ3 A;  2D9U A;  1B3Q A;  3J81 j;  2E2I B;  4DR2 L;  1F2Z A;  4DV7 L;  5M5X B;  1DM0 B;  1I4Q A;  2ZT9 C;  1AFP A;  4BBS H;  1PVO A;  3NSW A;  3OIQ A;  3KJO A;  4ALP A;  1XPO A;  1SFO H;  3BZC A;  1KHI A;  3G6E A;  1NMG A;  4RA8 A;  4CKE A;  1MIU A;  4X64 L;  1B8A A;  3S1M B;  2NN6 G;  2XGT A;  3H09 A;  5GAH C;  1BCP B;  2A68 C;  3WOF A;  1KL9 A;  3NTI A;  2WV6 D;  2A1A A;  2RDH A;  3HOU H;  2RBM A;  4ZUJ A;  4DR3 Q;  2BDO A;  3BJU A;  4KHZ A;  3UE1 A;  2EXD A;  1NAP A;  3GTQ H;  4JYA Q;  1BXT A;  4A3I G;  2Q8R E;  4KN4 C;  1CHP D;  4Y7N H;  3T13 A;  1YNX A;  2XTI A;  2NZ1 D;  4JI4 L;  2JA8 H;  1A3U A;  1WTQ A;  2RDF A;  3D3R A;  4L8J A;  4MZ9 A;  3TS0 A;  2F4V Q;  2YYZ A;  1EIY B;  2F0S A;  1RIP A;  4R1J A;  4RKL A;  3BZD B;  3FKI H;  4DR5 L;  1OXV A;  3T1H Q;  2IL8 A;  2E2I H;  1U4M A;  3H3V I;  4PZ6 A;  4FP5 D;  1EZ8 A;  2O5I C;  2ZTD A;  4KHP L;  1UE7 A;  4A3K B;  1XTD A;  5EBD A;  1SFO B;  2XIW A;  2F0U A;  3STB C;  4KV6 A;  1SE8 A;  3T4A C;  1AW7 A;  5F2D A;  1PH2 A;  4QY7 A;  1STY A;  3S17 H;  1E0B A;  3UI2 A;  2N55 A;  1BO0 A;  2GVB A;  3M7N A;  4HIM A;  1XNQ Q;  1EYA A;  4QIW E;  2F0G A;  5CBE E;  1SAP A;  1STB A;  2PNH A;  2IX1 A;  1BBX C;  1QVC A;  1PYS B;  1GUG A;  2Q2H A;  5G3L F;  4EQO A;  4A3J H;  4V19 0;  3QOL A;  1YVC A;  3H0G B;  2JA8 B;  1VQP A;  2L1B A;  1VQ5 A;  2XNA C;  5KNB A;  1Y14 B;  2PMZ B;  2NWG A;  4XYO A;  4LF4 Q;  4EQP A;  1CSP A;  5IOD A;  1SDF A;  5IOC A;  2EJG C;  5IT9 L;  1SNC A;  2QCP X;  2QW7 A;  5E4X A;  3M4O B;  1B50 A;  5FOB B;  1VQ6 A;  1QB5 D;  2NVT H;  3OHX C;  4F88 A;  4BBR G;  5GAG C;  1PFB A;  1XMQ Q;  1RCV D;  2C35 B;  3W5O A;  3HOW H;  1RJT A;  3EJI A;  3VYT A;  1HZB A;  4C1N I;  1XMQ L;  5ELE A;  1EY7 A;  3NWS A;  4KN7 C;  2FMC A;  5C3W A;  3HOY H;  3ERS X;  1HQM C;  4JBW A;  5DNF A;  4ZCK A;  1S5B D;  3VR2 A;  4N9P A;  3OW2 A;  1LT6 D;  1SMY C;  2KCC A;  4LK1 C;  1Q8I A;  1TWH H;  3CC4 A;  2YTY A;  5IGB A;  4A3J B;  2FXQ A;  1G91 A;  1LTT D;  3K7A B;  5NUC A;  1BUV T;  3FDT A;  4XTC S;  3U58 A;  1LUZ A;  4RHS A;  1AZQ A;  2L55 A;  2NZO A;  1A15 A;  4A3L G;  1XX8 A;  2HD3 A;  3I7F A;  3C46 A;  1LT3 D;  1DOL A;  1E2V A;  1X9N A;  3RLF A;  1C48 A;  4HMJ A;  3E0E A;  5I9P A;  1RF2 D;  1YNJ D;  3GTJ H;  3S16 H;  3NEM A;  2D0O A;  3A55 A;  4IUU A;  3KF8 A;  4UP9 A;  1JCK B;  5IGD A;  2CW0 D;  1XNQ L;  4JI8 Q;  3HOW B;  1HQR D;  1Q12 A;  2F3W A;  4LNQ A;  4GN5 A;  1HUN A;  4ZRZ A;  3J81 E;  3AMU A;  2B63 G;  4KHP Q;  1VDZ A;  1TWH B;  2OCE A;  3ND9 A;  4HN7 A;  1G8Z D;  1MI2 A;  3K7A H;  1SE4 A;  4DR5 Q;  4JI0 L;  5BN4 A;  2F0H A;  2ZJR A;  2D0P A;  3PO2 B;  3DM3 A;  4DR7 Q;  1ML0 D;  3FHW A;  4ME3 A;  3MVV A;  4IJL A;  1WFQ A;  1DYQ A;  4TRD A;  3RUZ A;  2K7V A;  2F0V A;  1SMX A;  3BDO A;  3K5N A;  5EPK A;  4JYA L;  4POF A;  5J22 A;  4A3B G;  4DR3 L;  3F8T A;  1TY0 A;  1ET6 A;  4FXG C;  1OXT A;  1N33 Q;  1KAB A;  3J80 E;  4DUZ L;  1F9S A;  4IUP A;  4CGY B;  1EEF D;  2B2V C;  4OL7 A;  1A2U A;  3RR5 A;  1BBU A;  3FEW X;  2BA0 A;  2I5H A;  1EQT A;  2KA7 A;  1KC8 C;  3V2T A;  4DV7 Q;  1FGB D;  4DR2 Q;  3HGB A;  5IYB H;  1E22 A;  3I4M H;  2JA9 A;  5FLX L;  5M3M H;  1Y69 U;  1V8Q A;  1CTM A;  2F0D A;  3PV0 A;  1CA5 A;  3IFD A;  1YJN A;  2K5N A;  4O42 A;  2HUG A;  5KND A;  4A3E B;  3PGZ A;  4R8N A;  4IO9 A;  4HJA A;  1N8R C;  2LMC B;  4GN3 B;  3NP8 A;  1SYD A;  4IPG A;  1IBL Q;  2CQA A;  4DK3 C;  1KRT A;  3HEJ A;  4F87 A;  1KDB A;  1KDC A;  4DV6 L;  3A0J A;  4JI1 Q;  3UE0 A;  4RGT A;  1E24 A;  5E1F A;  2DY8 A;  4B3R Q;  4CDF C;  2F4I A;  2L9H A;  2MUY A;  4C3H B;  2PQA B;  1PMR A;  2IJ0 A;  2OWO A;  1SYG A;  1WCM B;  2K5V A;  4CKC A;  4A3M B;  5C0X H;  1Y1W H;  1A8V A;  1EUJ A;  1WTH A;  4YHH Q;  2HIV A;  3I4M B;  2KOL A;  4G7O C;  5CGK A;  2R93 H;  2MHV A;  5IP7 H;  2Z1C A;  2VS1 A;  1SNQ A;  4MN3 A;  4ZKB B;  2AWO A;  5IGC A;  2RHQ B;  3W2D A;  4U68 A;  3K7U C;  3TDQ A;  2ALY B;  1F9Q A;  1LLR D;  2Z4I A;  4FDB A;  2K50 A;  1STE A;  4G57 A;  1E1T A;  1YJ9 A;  4X62 Q;  4HR7 B;  1HR0 Q;  3H6M A;  4PNY A;  1OXS C;  1V9P A;  4DUY Q;  2JA7 G;  1D2B A;  2M2L A;  4LF5 Q;  1XNR Q;  2VQF Q;  2UUB L;  3IL8 A;  1F2Y A;  1STG A;  5FJ8 H;  2LXJ A;  3JAM E;  2B8F A;  2V4D A;  1UE1 A;  2PPB C;  1STA A;  2EYJ A;  2LXK A;  3NBH B;  4GNX B;  4WRD A;  3E9H A;  1PRT D;  1JOK A;  2VL6 A;  4OHJ A;  5JVH 3;  2VQE Q;  4X3K A;  1HJP A;  2Z6K A;  1CM9 A;  1IW7 C;  1W6J A;  4C3H H;  5C44 B;  3CCL A;  2VUM G;  1PH1 A;  1WCM H;  2GVA A;  1WTW A;  1Y1W B;  3LNN A;  5FLM G;  1R9T H;  2RKS A;  2J0T D;  4RKB A;  2PZT A;  1EZ6 A;  1HUM A;  1HNX L;  3OYY A;  4CBV A;  1EY5 A;  5L37 A;  4IPH A;  2F3I A;  3GDE A;  5M5Y H;  4B3M L;  4LFB L;  2ZM6 Q;  1G51 A;  4IPD A;  2A69 D;  4RGM A;  3JAM L;  4OO1 G;  3J80 c;  1TXY A;  5EJW A;  1Z6H A;  1SJH D;  3EBE A;  2NVY H;  2IW3 A;  3P20 A;  2IT1 A;  2JEB I;  1VQO A;  1PA6 A;  5I6W A;  1M1K C;  3TRE A;  4JPB W;  4KLK A;  1E2W A;  2XWJ B;  3D6W A;  3TEH B;  4KKS A;  4RCN A;  4V0B A;  1GUW A;  1X6O A;  1RHP A;  5C3E G;  4IOC A;  4L5S A;  4RCO A;  3HOZ G;  4C3I H;  3HOV H;  1XTC D;  2ZTE A;  3AB9 A;  1B4O A;  3KOJ A;  4HIK A;  1XPU A;  3TN2 A;  3GP7 A;  3PSI A;  4P74 A;  2VUM B;  1LO5 D;  5C44 G;  4NB3 A;  4IUQ A;  1HZA A;  4A93 G;  1Q3L A;  2I5L X;  5C5L A;  4C3I G;  1R9T B;  3HOZ H;  4K0K Q;  1GVP A;  1QOH A;  2WKC A;  4X66 Q;  1HRJ A;  1MGS A;  4H13 C;  3GTP B;  3QWN A;  1H95 A;  1AEX A;  1FVI A;  1PTO D;  1I4P A;  5JPM C;  1EWC A;  2K1B A;  2L15 A;  3I4O A;  1Q1E A;  1X65 A;  2EVB A;  4XDX A;  4XT1 B;  3BYY B;  3I8Z A;  1Q7Y C;  3DWA A;  4H0L C;  4OO1 H;  3NPP A;  3H3V H;  2NVY B;  3SK5 A;  3ERQ A;  4PZ7 A;  2R7Z H;  3PO3 B;  3I70 A;  4LUZ A;  2F0Q A;  4AYB G;  1BCP D;  2AWN A;  2OEO A;  5LHY 1;  4FF4 A;  2B39 A;  1X32 A;  2KCN A;  3GTO B;  5FLM H;  1C9O A;  2F0F A;  4AQY Q;  5E7N A;  4A3M G;  1WCM G;  3J80 i;  1KLG D;  3RLN A;  3S2D H;  1HXY D;  1I6H B;  4C3H G;  4DA2 A;  1YIT A;  1MJE A;  2LFN A;  1UEA B;  1O78 A;  5A2Q E;  1K8A C;  2WAQ B;  1CKM A;  1JJC B;  1PH7 A;  1YBY A;  4NXN Q;  5D65 A;  4A3D G;  1QWY A;  2H4O A;  2K33 A;  5I2Y A;  4DV0 L;  2EDG A;  2K52 A;  2RDG A;  3CCM A;  3A5U A;  1R4P B;  1GUT A;  2XVS A;  2O2L D;  4WJ4 A;  3B6Y A;  4MHE A;  5C6A A;  3J7A V;  3L0O A;  2R7Z B;  4C2M H;  3K5O A;  4R4C A;  3U4Z A;  4A3F H;  2UUC Q;  5T1G A;  4A3E G;  1K8G A;  1BDO A;  1KIX A;  2SOB A;  1NMF A;  4LF7 Q;  1B44 D;  4JV5 L;  3LWU A;  3J81 i;  4KKU A;  4MTK A;  3CRL C;  1AE2 A;  5IP7 G;  2R93 G;  1PXU A;  2FJ2 A;  2IWH A;  5C0X G;  5C4J B;  1Z7T A;  4M8A A;  3OMG A;  3LGJ A;  3S2D B;  2ES2 A;  1A3T A;  2A68 D;  3HKZ E;  3K81 C;  3K0X A;  2WKD A;  2WB1 B;  4IFD I;  4QUC A;  1TS4 A;  5HGQ A;  3TZU A;  2HCI A;  1RTN A;  5DM7 3;  3MHB A;  3QO2 A;  3W1G A;  2JA6 G;  3RZO H;  3K59 A;  4GKK L;  3K80 C;  2B2V A;  3S1M H;  2Q8I B;  1GKH A;  1PFN A;  2UXD L;  3M4Y A;  4BY1 G;  3I4L A;  1F9P A;  3GTG B;  2DNC A;  3F2U A;  4TQU S;  1DXM A;  2F52 A;  4B3T Q;  2L5T A;  2P5Z X;  1I94 Q;  2Q2U A;  1YIJ A;  4Y7N B;  3OSO A;  4Y52 H;  1PTO C;  5IYB G;  4IFD J;  1X3Q A;  4NDX A;  1PZJ D;  2AHO B;  5AJ3 L;  5IT9 E;  4JK1 C;  3MTS A;  3SEB A;  2B63 B;  1WOC A;  3KDF A;  3GO5 A;  4HAE A;  4DR4 L;  3KDF B;  2B2T A;  3NBH A;  4GNX A;  3FVQ A;  1H9S A;  1SE2 A;  1RD9 D;  5K5P A;  4LF8 Q;  3QR8 A;  4CKB A;  3OTO Q;  4DF7 A;  2A5H A;  4P2C B;  3S1N B;  1UE6 A;  1V1P A;  4C3J H;  1OXU A;  4O1N A;  1EWI A;  3KUP A;  1LTG D;  4J8Q A;  3RZO B;  4IUR A;  3VDY A;  3CCU A;  1XMO Q;  1N36 Q;  4AYB E;  3FRP B;  5AFW A;  1AZP A;  3GTG H;  2SDF A;  2LS0 1;  1O7Z A;  3O13 A;  4KHV A;  3F2B A;  4B08 A;  4EGV A;  2E5L Q;  4KY6 A;  2EYP A;  1LTR D;  1K83 H;  3P1H A;  1CKN B;  1TY2 A;  3H0G H;  1CQF A;  1AP0 A;  3MXN B;  4A3C H;  1HNW L;  2NVX B;  4PMC A;  4JI7 Q;  1PHJ A;  1SMY D;  2PW5 A;  5EKL A;  2PI2 E;  2HQL A;  5ELO A;  4JI5 L;  1PYB A;  3NBI A;  3T51 B;  1JOR A;  5LL6 S;  2N49 A;  3PUX A;  3M4O H;  4R9W A;  1U0L A;  1JE5 A;  3AFP A;  2UUA L;  1QUQ B;  4BA1 I;  4C3J B;  1J5E L;  1TS2 A;  1EIH A;  2E2J B;  2NVT B;  1BQQ T;  2EY2 A;  2KVM A;  1IKM A;  1SYC A;  3GD7 A;  4KY7 A;  1L1O B;  1FL0 A;  2PI2 A;  5CV8 A;  2Y0S B;  2QDB A;  2AQ2 B;  3I3C A;  1HNZ Q;  2RCF A;  4X3T A;  2E2D C;  3HOY B;  4JI3 L;  4CJ2 C;  1MSH A;  2CH4 W;  3TRZ A;  2PQE A;  3GV6 A;  1EFW A;  1SNP A;  1B2T A;  2WB1 E;  1F2M A;  4A3C G;  3ONA B;  2XWB B;  2Q8T A;  3H0G G;  5FO8 B;  1K83 B;  3D4R A;  1M8A A;  2KED A;  2EYL A;  1K3R A;  5EGT A;  4DAP A;  2NVX H;  2V1C C;  4K2K A;  3HOY G;  3K5M A;  4P72 A;  5HGT A;  2B2Y C;  3DM1 A;  2VY3 A;  1E3P A;  5C0X I;  2UU9 Q;  1SYE A;  2Y0S G;  1N32 Q;  4JG2 A;  1VQD A;  1JOQ A;  2MO0 A;  5I2X A;  3S16 B;  1MHW C;  3JC6 6;  4NXM L;  4G7Z C;  4GS3 A;  2E2J H;  4C3J G;  1UAP A;  3STB D;  5D3I B;  1OO9 B;  1YHQ A;  4LFC Q;  1YHB A;  1D5M C;  2KEN A;  3NHH A;  3NTK A;  4R4O A;  4ABN A;  4L5R C;  3ULL A;  3LX0 A;  2GA4 B;  1SXT A;  2EPB A;  3D6C A;  4UHV A;  3RNU A;  3KLS X;  4RWS C;  5LMU L;  1LAB A;  1JWS D;  2K01 A;  5GQO A;  4NKL A;  2ICE C;  4FNF A;  5C5M A;  2IX0 A;  3MEH A;  4IUN A;  2Z0S A;  5A2Q L;  1V1Q A;  5J1Z A;  3S15 H;  1SYF A;  3L9A X;  1PFM A;  1TWG B;  2HT1 A;  2CVR A;  4K6L A;  4RH6 A;  3G7L A;  1N34 L;  4BY1 H;  4OX9 L;  3CMA A;  1EQQ A;  1CFM A;  3CKI B;  1A6X A;  4L63 B;  1EY8 A;  2JA6 H;  5LMN L;  4GKJ L;  2EZV A;  2FFK B;  2K75 A;  5EAY A;  1PH9 A;  4OWW B;  2KCT A;  1FJG Q;  1KXL A;  1EY0 A;  4DR6 L;  1MKH A;  2NVQ B;  3KBG A;  4CDE C;  1IW7 D;  1IBK L;  1VQF A;  3T1Y L;  2EY5 A;  2KHI A;  5CV5 A;  1EYG A;  4DNR B;  2VZA A;  4ZLT F;  2N78 A;  4RMF A;  1BR9 A;  2F0M A;  4R4I A;  3UDI A;  5BN3 A;  1BF4 A;  4O0A A;  4DV4 L;  3HZX A;  4LFA L;  2PYK A;  4A3I H;  1PH5 A;  1QVG A;  5IIF A;  4DR1 L;  1D1I A;  1SNO A;  2JEA I;  4A3E H;  5T1I A;  4A3F G;  2EYM A;  1QNU A;  4Q0F A;  1C7Y A;  3KF6 A;  4BY1 B;  4RG1 A;  4OGQ C;  1EIG A;  1TS3 A;  4X65 Q;  3SR1 A;  1W2B A;  1MBY A;  2DY7 A;  2UXB Q;  1Y8P B;  2JA6 B;  4JI2 Q;  2DJF C;  4CHT B;  1FNW A;  4DV3 Q;  1ONL A;  5BR8 L;  1Z47 A;  3S9W A;  2WB1 G;  3I56 A;  5FK9 C;  5J3B A;  2SEB D;  4A3D H;  1PTO F;  2UXC Q;  1AH9 A;  3Q22 A;  3VA5 A;  1ENF A;  2NVQ H;  4JCV E;  2AQ1 B;  2PQA A;  5M3F H;  1WI5 A;  1MSG A;  5IGE A;  4LW1 A;  2D2C C;  4TSS A;  2HHH Q;  3CXC A;  2H1E A;  1JJG A;  4A3M H;  1YZ6 A;  4GN4 B;  1OXX K;  2R93 B;  1VQN A;  1UUP A;  3BVG A;  1OTC A;  1NBW A;  1HCZ A;  4GOP A; 
#chains in the Genus database with same CATH homology
 4LUO A;  4IPH A;  2F3I A;  3GDE A;  5M5Y H;  1VQ7 A;  4B3M L;  3EIV A;  4LFB L;  2ZM6 Q;  1G51 A;  2VQE L;  1UEB A;  4IPD A;  2VW9 A;  2R7Z G;  1A0I A;  3RN2 A;  4OO1 G;  1TWF H;  3DLL A;  3EN2 A;  1M90 C;  5GAD C;  4B3S L;  3J80 c;  1VQM A;  4R4Q A;  1TXY A;  4JOI A;  3T1H L;  2LSS A;  2UXC L;  3EBE A;  2NVY H;  2EIF A;  2VQF L;  1XNR L;  2IT1 A;  3PO3 H;  2JEB I;  1VQO A;  3UDF A;  4R4T A;  1Y1V G;  1LTL A;  5IE8 A;  1PA6 A;  1M1K C;  3TRE A;  2IHE A;  2F4V L;  3S1Q H;  3NEL A;  2OTL A;  4KLK A;  5H1S E;  3Q8D A;  3RLO A;  1VQ9 A;  4JI2 L;  3TEH B;  3AFQ A;  1PH4 A;  4JI4 Q;  4PMW A;  4X65 L;  1X55 A;  1X6O A;  5C3E G;  4IOC A;  1EOV A;  4HJ7 A;  1K9M C;  4L5S A;  3HOZ G;  1G6P A;  2ZTC A;  3I2Z A;  4C3I H;  3J7Z C;  2WAQ G;  2ASB A;  3HOV H;  2JA5 G;  4JV5 Q;  2ZTE A;  1SN8 A;  3PCO B;  1V43 A;  2MFI A;  3KOJ A;  4HIK A;  4YCV A;  5C0X J;  3A5Z B;  5C44 H;  1GO3 E;  4JI6 Q;  1XPU A;  3PSI A;  4P74 A;  4WJ3 M;  3JAM c;  3CME A;  5C44 G;  4DR1 Q;  1I3Q H;  4NB3 A;  4AH6 A;  1HZA A;  4A93 G;  2AKW B;  3HFZ B;  2JA5 H;  1JMC A;  1D8L A;  2I5L X;  4GOP B;  3HOV G;  1FGU A;  3HOZ H;  4K0K Q;  4DV4 Q;  1GVP A;  1Z9F A;  3ULP A;  1NE3 A;  2BA1 A;  4LF6 L;  5C3E H;  2CFM A;  4X66 Q;  4UP7 A;  1BVS A;  2WAQ E;  5ELN A;  1EIF A;  3U50 C;  4DPG A;  5M5X H;  1H95 A;  4GNX C;  1FVI A;  4X64 Q;  3ZJY C;  4DV0 Q;  1BKB A;  2L15 A;  3I4O A;  1Q1E A;  1L2F A;  3W1B A;  1PH8 A;  1Y1V H;  2IY5 B;  4QQB X;  3PO3 G;  3UDX A;  3ER0 A;  1X65 A;  4YWM A;  1IBK Q;  4B3R L;  1K73 C;  2BH2 A;  4HID A;  4NXN L;  1A62 A;  1Q7Y C;  3H3V H;  1NY4 A;  4PZ7 A;  4YWL A;  2R7Z H;  3S14 H;  4JI1 L;  1QZG A;  4LUZ A;  4DV6 Q;  5C4X G;  2CWA A;  4AYB G;  4GOP C;  5LMN Q;  4GKJ Q;  1IYJ B;  2A19 A;  3PUW A;  4AQY L;  4BXX G;  4DV2 Q;  4DV1 L;  1B70 B;  1IBM L;  2AWN A;  2Q2I A;  3ULJ A;  5FLM H;  1C9O A;  4L5Q A;  4DV2 L;  1N34 Q;  4AQY Q;  5E7N A;  3CF5 A;  4A3M G;  1VQ8 A;  4OX9 Q;  5IT9 c;  5C4J H;  1WCM G;  3J80 i;  2ID0 A;  3RLN A;  4DAY B;  2R92 G;  3J7A 5;  3S2D H;  2VUM H;  5C4X H;  1Q8K A;  2N8N A;  1YIT A;  4DK6 C;  3CC7 A;  1MJE A;  1KQS A;  1B7Y B;  3ICE A;  2WFW A;  1K8A C;  5M3F G;  1CKM A;  1JJC B;  1VQK A;  1PH7 A;  3J81 j;  1YBY A;  2B29 A;  4DR2 L;  4NXN Q;  4DV7 L;  1A63 A;  1VCI A;  3HOX H;  3BZK A;  5FJ8 G;  4A3D G;  1GM5 A;  1IXR A;  5LMU Q;  4BBS H;  1PVO A;  5JJK A;  3KJO A;  4ALP A;  2I5M X;  4IJH A;  4A3K H;  1XPO A;  3D0F A;  3BZC A;  1SFO H;  1KHI A;  3G6E A;  2JA7 H;  1NMG A;  1MIU A;  4X64 L;  4DV0 L;  2K52 A;  1B8A A;  3CCM A;  1T9H A;  3A5U A;  2NN6 G;  3RZD H;  2XGT A;  3I4N G;  2B3G A;  2OQ0 A;  4LFC L;  4X66 L;  3I55 A;  4WJ4 A;  3B6Y A;  3M4Q A;  5GAH C;  4HJ8 A;  4BY7 G;  4HJ9 A;  3L0O A;  1KL9 A;  4C2M H;  2A1A A;  3HOU H;  5JEA J;  4R4C A;  1Q46 A;  3U4Z A;  4DR3 Q;  4A3F H;  2UUC Q;  3CD6 A;  4A3E G;  3BJU A;  4KHZ A;  1K8G A;  3UE1 A;  1UE5 A;  2EXD A;  1KIX A;  3NEN A;  3MEF A;  3GTQ H;  4A3I G;  1YEZ A;  4JYA Q;  1NMF A;  4LF7 Q;  4NXM Q;  4JV5 L;  3J81 i;  3M4P A;  1AE2 A;  5IP7 G;  3KF6 B;  4Y7N H;  2BH8 A;  1YNX A;  2XTI A;  1N32 L;  2OTJ A;  3GTO H;  2R93 G;  2JE6 I;  4A4I A;  1Y1W G;  3CP0 A;  5C0X G;  3F2C A;  4JI4 L;  2JA8 H;  1WJJ A;  2HIX A;  3CW2 C;  4MZ9 A;  3LGJ A;  3TS0 A;  4LF9 L;  1I6H H;  4OWX B;  3A74 A;  2F4V Q;  3KLW A;  2AMC B;  4IPC A;  3SGI A;  2ES2 A;  2YYZ A;  1EIY B;  1RIP A;  2MNA A;  3HKZ E;  3G48 A;  4R1J A;  3K81 C;  1PFS A;  1I50 H;  4JC0 A;  3K0X A;  3FKI H;  4DR5 L;  1OXV A;  4H02 A;  3T1H Q;  1C0A A;  2CKZ B;  2E2I H;  4X6A H;  2R7F A;  4B3S Q;  1LYL A;  3H3V I;  4PZ6 A;  5IWA Q;  1S3O A;  4IFD I;  2KBN A;  4EX5 A;  2ZTD A;  5FLX c;  4POG A;  4MNO A;  4YWK A;  1UE7 A;  5HGQ A;  1Q82 C;  4KHP L;  1XTD A;  4JI3 Q;  2ZM6 L;  4P73 A;  4LFB Q;  3STB C;  3RN5 A;  4B3M Q;  1SE8 A;  1HNZ L;  3W1G A;  2JA6 G;  1PH2 A;  3RZO H;  4QY7 A;  3S17 H;  3K80 C;  3S1M H;  4GKK L;  3L7Z C;  4YY3 Q;  1GKH A;  1HZC A;  2GVB A;  3GTL H;  2UXD L;  3M7N A;  4HIM A;  4KI0 A;  1U5K A;  1KRS A;  1VQE A;  1X54 A;  1SLJ A;  4BY1 G;  1XNQ Q;  1EQR A;  4QIW E;  1X3G A;  3CQZ H;  1VQC A;  1E7Z A;  2HHH L;  4B3T Q;  4TQU S;  2PNH A;  2F52 A;  1J5E Q;  2IX1 A;  1I94 Q;  1QVC A;  1IZ6 A;  2Q2U A;  1YIJ A;  2I0Q A;  1PYS B;  4P71 A;  5IP9 H;  4XIG S;  5M3M G;  4Y52 H;  2Q2H A;  2EQS A;  2Z6K C;  5IYB G;  4A3J H;  2ZJQ A;  1YI2 A;  3I4M G;  4IFD J;  1GD7 A;  1YVC A;  4JI5 Q;  3CPW A;  3CCJ A;  1VQP A;  3K8A A;  2AHO B;  5AJ3 L;  2UUB Q;  4O2D A;  1VQI A;  1VQ5 A;  1Q81 C;  1AE3 A;  4LF5 L;  1Y14 B;  5BR8 Q;  3PF5 A;  1WOC A;  3KDF A;  3WWV A;  4JI7 L;  2RCN A;  3GO5 A;  4LF4 Q;  4DV3 L;  1CSP A;  2R7D A;  4DR4 L;  4DUY L;  3KDF B;  1HR0 L;  4GNX A;  4IFD G;  1QVF A;  4X62 L;  2UXB L;  4LF8 Q;  3OTO Q;  2NZH A;  5IYC H;  4L5T A;  2ATW A;  4DV5 Q;  2E5L L;  1VQ6 A;  1UE6 A;  4C3J H;  4A3B H;  1OXU A;  4GLV B;  1EWI A;  2NVT H;  4BBR G;  5GAG C;  2H5X A;  2VNU D;  1XMQ Q;  2JQO A;  4LFA Q;  3JAM i;  2C35 B;  1E1O A;  3VDY A;  3W5O A;  1VS0 A;  3S1R H;  3HOW H;  4HJ5 A;  3CCU A;  1XMO Q;  5JEA G;  1N36 Q;  4QL5 A;  4AYB E;  4YHH L;  1HZB A;  3PF4 A;  1VQH A;  1XMQ L;  1Q1B A;  2JJQ A;  1I5F A;  3TS2 A;  1Q86 C;  1TWC H;  3GTG H;  3HOY H;  3ERS X;  3F2B A;  4JBW A;  3OW2 A;  1YJW A;  1SR3 A;  1JB7 A;  1CUK A;  4P75 A;  2E5L Q;  1P8L A;  5IYD G;  4DV5 L;  3HKZ G;  3T1Y Q;  3PUV A;  3H15 A;  1TWH H;  3CC4 A;  2DGY A;  3BU2 A;  2YTY A;  3AYH B;  1K83 H;  2FXQ A;  4DR6 Q;  1L1O C;  1CKN B;  3H0G H;  1PV4 A;  4JBK A;  4XTC S;  1FJG L;  1CKN A;  2K5H A;  3E9I A;  3U58 A;  1LUZ A;  3MXN B;  3PO2 H;  4A3C H;  4EQ5 A;  1HNW L;  2NZO A;  4JI7 Q;  2B63 H;  2CQO A;  1PHJ A;  2Q2T A;  2CCZ A;  4A3L G;  4A75 A;  3I7F A;  4GLX A;  2PI2 E;  1XPR A;  2HQL A;  1J6Q A;  5ELO A;  4JI5 L;  1X9N A;  1PYB A;  4PG3 A;  3RLF A;  5LMN W;  3KFU A;  3E0E A;  4A3G G;  1HZ9 A;  2N49 A;  1MJC A;  3PUX A;  1IBL L;  3GTM H;  3M4O H;  1U0L A;  3GTJ H;  1JE5 A;  5JJI A;  1KAW A;  3AFP A;  2D0O A;  3NEM A;  3CCQ A;  4HIO A;  1QUQ B;  2UUA L;  1I94 L;  3S16 H;  3S1N H;  4BA1 I;  1WYD A;  1J5E L;  4B3T L;  4UP9 A;  2A8V A;  3KF8 B;  3GD7 A;  1KD1 C;  4QGU A;  1L1O B;  1FL0 A;  1XNQ L;  4JI8 Q;  2PI2 A;  1Q12 A;  2KHJ A;  3AQQ A;  4YY3 L;  4A3G H;  2E2H H;  5HY6 A;  4LNQ A;  4GN5 A;  3PUZ A;  1SRU A;  3PIO A;  1HNZ Q;  2Y0S E;  4A3L H;  4LWC A;  4JI3 L;  3TRZ A;  2B63 G;  1ASY A;  4KHP Q;  1EFW A;  2R6G A;  2WB1 E;  4A3C G;  3PO2 G;  5IWA L;  2OCE A;  1DGS A;  3H0G G;  1VQG A;  1CKO A;  1X56 A;  4YCW A;  4A93 H;  3FP9 A;  2GN5 A;  2YTV A;  3K7A H;  4DUZ Q;  4DR5 Q;  4JI0 L;  4OO1 I;  4OON A;  2QGQ A;  2RHS B;  2ZJR A;  2D0P A;  1N33 L;  1K3R A;  1VQA A;  1D7Q A;  3TQY A;  4OXP A;  3DM3 A;  2NVX H;  5IYD H;  1IL2 A;  2V1C C;  4DR7 Q;  4ME3 A;  3FHW A;  4GLA C;  2YU9 H;  4LF9 Q;  4IJL A;  1WFQ A;  3HOY G;  1L0W A;  4P72 A;  3GTK H;  3PUY A;  5K36 G;  3GTP H;  1SMX A;  1E3P A;  2VY3 A;  5C0X I;  4NPS A;  2UU9 Q;  2Y0S G;  1N32 Q;  1N9W A;  4JBJ A;  4JG2 A;  3HOW G;  1VQD A;  2UU9 L;  2MO0 A;  3JC6 6;  4LF7 L;  4NXM L;  4BBR H;  3U4V A;  2K4K A;  4JYA L;  4POF A;  4GS3 A;  2K14 A;  2E2J H;  4A3B G;  3CCE A;  4DR7 L;  3S24 A;  3F8T A;  3STB D;  4DR3 L;  2UUC L;  3AEV A;  2MQH A;  1OXT A;  1YHQ A;  1N33 Q;  5IYC G;  4DUZ L;  4JI0 Q;  4LFC Q;  1YHB A;  2KEN A;  1PH3 A;  4R4O A;  4L5R C;  2NN6 I;  3ULL A;  1VQL A;  3RR5 A;  1XJV A;  3RNU A;  1BBU A;  2IHF A;  2MO1 A;  5LMU L;  2BA0 A;  2I5H A;  5GQO A;  4MTN A;  5GRO A;  1KC8 C;  3M9B A;  4DV7 Q;  4DR2 Q;  4A76 A;  5IYB H;  4A3J G;  1E22 A;  2IX0 A;  2JA9 A;  5GAE C;  3I4M H;  2Z0S A;  5M3M H;  1V1Q A;  3PV0 A;  4JI8 L;  5IP9 G;  3S15 H;  4TVA B;  4AIM A;  1YJN A;  1ASZ A;  2K5N A;  1G29 1;  1L1O A;  3L2P A;  2HT1 A;  1W3S A;  3PGZ A;  4DKA C;  1NJI C;  4IO9 A;  4HJA A;  3D31 A;  1N8R C;  2JK8 A;  2UUA Q;  4GN3 B;  1VQ4 A;  2RF4 A;  1N34 L;  4BY1 H;  2CWP A;  4OX9 L;  4BA2 I;  3CMA A;  4IPG A;  1EQQ A;  3F1Z A;  1SRO A;  1O7I A;  5DLQ E;  1IBL Q;  4DV1 Q;  1K0R A;  4DK3 C;  1IBM Q;  3CAM A;  1KRT A;  4DNI A;  2JA6 H;  5LMN L;  4GKJ L;  2K75 A;  5EAY A;  4DV6 L;  3F2D A;  3A0J A;  4JI1 Q;  3UE0 A;  1HNW Q;  1PH9 A;  4OWW B;  2KCT A;  1E24 A;  1TWA H;  1FJG Q;  1KXL A;  3G4S A;  4BBS G;  4IOA A;  3S2H H;  4DR6 L;  1MKH A;  3FKI G;  2PMZ E;  5M5W H;  4B3R Q;  1IBK L;  1VQF A;  4PZ8 A;  3T1Y L;  2ZJP A;  4UY8 C;  2YTX A;  2KHI A;  1EYG A;  1NTG A;  2PQA B;  3CCV A;  2VZA A;  4J15 A;  2OWO A;  4DAM A;  1QZH A;  2JA8 G;  2K5V A;  2N78 A;  4RMF A;  1Y1W H;  1A8V A;  1EUJ A;  1UWV A;  4YHH Q;  2HIV A;  3G71 A;  4R4I A;  3UDI A;  3M85 A;  1XMO L;  1N36 L;  2R93 H;  4O0A A;  5IP7 H;  4DV4 L;  1VQJ A;  4LF6 Q;  4K0K L;  2VS1 A;  4LFA L;  1S40 A;  4A3I H;  1PH5 A;  1QVG A;  3IRB A;  2WP8 J;  4GKK Q;  4DR1 L;  1TWG H;  2AWO A;  2JEA I;  2RHQ B;  4A3E H;  3K7U C;  2KCM A;  4A3F G;  2ALY B;  4JI6 L;  3KJP A;  2E8G A;  4FDB A;  3KF6 A;  1C7Y A;  3CPF A;  3HOU G;  3M3Y H;  4UP8 A;  4RG1 A;  1S72 A;  4BY7 H;  4YCU A;  1VQB A;  2K50 A;  4JBM A;  3OTO L;  4X65 Q;  1W2B A;  3I4N H;  4LF8 L;  1E1T A;  1YJ9 A;  2UXB Q;  4X62 Q;  4QJF A;  4JI2 Q;  1RL2 A;  1HR0 Q;  2JA7 G;  4DUY Q;  1OXS C;  3HKS A;  1V9P A;  4DR4 Q;  4OWT B;  4DV3 Q;  1HR0 W;  4APV A;  4A3K G;  4LF4 L;  5BR8 L;  1Z47 A;  2D62 A;  3J81 c;  4LF5 Q;  3KYH C;  1XNR Q;  2VQF Q;  2WB1 G;  3UDG A;  5AJ3 Q;  3I56 A;  2UUB L;  5J3B A;  2QA4 A;  5JJL A;  1JT8 A;  4A3D H;  5FJ8 H;  3HOX G;  2UXC Q;  3CC2 A;  4LUV A;  2LXJ A;  1AH9 A;  1UE1 A;  2NVQ H;  1CSQ A;  1X3F A;  2LXK A;  3NBH B;  4GNX B;  4JCV E;  1BBW A;  1HH2 P;  2PQA A;  3E9H A;  2VL6 A;  5M3F H;  3CCR A;  1WI5 A;  2VQE Q;  2N3S A;  1HJP A;  2Z6K A;  3PIP A;  2QEX A;  3CCS A;  4LW1 A;  1P16 A;  1QUQ A;  4C3H H;  3CCL A;  2VUM G;  4JOI C;  4UPA A;  1YHA A;  1PH6 A;  1PH1 A;  1JJ2 A;  2HHH Q;  1WCM H;  2GVA A;  3CXC A;  2R92 H;  1JJG A;  4A3M H;  2YV5 A;  1HNX Q;  1YZ6 A;  1X3E A;  4GN4 B;  2OQK A;  1OXX K;  5FLM G;  5IY0 A;  1R9T H;  1VQN A;  2UXD Q;  1OTC A;  1NBW A;  4BXX H;  1HNX L;  4GOP A;  1LM0 A;  3OYY A;  2DUD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...