2B2YA

Tandem chromodomains of human chd1
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
176
structure length
175
Chain Sequence
b'EFETIERFMDCRIGRKGATGATTTIYAVEADGDPNAGFENKEPGEIQYLIKWKGWSHIHNTWETEETLKQQNVRGMKKLDNYKKKDQETKRWLKNASPEDVEYYNCQQELTDDLHKQYQIVGRIIAHSNQKSAAGYPDYYCKWQGLPYSECSWEDGALISKKFQACIDEYFSRKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromodomain-helicase-DNA-binding protein 1
publication title Double chromodomains cooperate to recognize the methylated histone H3 tail.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
total genus 53
structure length 175
sequence length 176
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2005-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2b2yA02
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2b2yA01
2MJ8A 5E4WC 1AP0A 4ZKBB 4HEDA 1IL8A 1CM9A 1KNEA 1E0BA 3KUPA 1WD1A 2Q8RE 1CA5A 1HA6A 5JJZA 1DOLA 1ICWA 1AZQA 2B2YC 1JICA 1A15A 4ZK9B 4CJ1B 1IKMA 1XYIA 5CMDA 1F9RA 1EOTA 2RA4A 1U4LA 3N52A 3TN2A 3D6WA 5D14A 2L9HA 1G2SA 2BDNA 1RJTA 2N55A 2X6LA 5EPKA 3H91A 5T1IA 4OIJA 4XDXA 2K03A 2B2UA 2NZ1D 4IUQA 1EIGA 2B2WA 1MGSA 2SDFA 5CORA 1DZ1A 2L11A 5T1GA 1Q3LA 4OIKA 1M8AA 2MGSA 4IURA 2HDMA 4O42A 5AFWA 2JP1A 4CJ2C 3GV3A 1F9PA 1VMPA 1SDFA 4RWSC 4IUTA 5EPJA 3HP3A 1S4ZA 1G91A 2RSOA 1WTQA 1BBXC 2B2TA 2XIWA 1XX8A 3MWYW 3I3CA 1HUNA 2X6GA 1ML0D 1DOMA 3P7JA 2X69A 2R3ZA 1NR2A 1QG7A 2K04A 2NWGA 2FHTA 5CBAE 1C8CA 1LV9A 2KVMA 1PLFA 3I90A 5E4XA 1EIHA 1RODA 1BF4A 1JE4A 1NAPA 3ONAB 1U4RA 2B2WC 2HDLA 1CA6A 1O80A 3DM1A 5CBEE 1J9OA 1O7ZA 2K28A 1B50A 1VMCA 1WTRA 1WTOA 3TZDA 2KUMA 1X32A 5DNFA 2FJ2A 2IL8A 2CVRA 2HCCA 2JYOA 2K05A 3IL8A 3SVMA 5COYA 1WVLA 2MPMA 2KEDA 4HAEA 2DY8A 2B2TC 2M2LA 1U4PA 3GV6A 4MHEA 2L4NA 1WTVA 1U4MA 2EOTA 2B2VA 2L1BA 1WTXA 1DONA 2KOLA 2HCIA 1F2LA 2FMMA 5EKIA 1BNZA 1MI2A 5EJWA 2HUGA 3FDTA 3IFDA 2L12A 1QE6A 1WTPA 4HSVA 1PFNA 1ZXTA 5D65A 1EL0A 2MP1A 2FINB 1G6ZA 2FFKB 1QNKA 4XT3B 2B2UC 4X3TA 4ZKCB 1HHVA 3DEOA 2N88A 3F2UA 4X3SA 2KEEA 4IUUA 1MSGA 3LWEA 4DN4M 3MTSA 2EPBA 2KECA 4ZLTF 1X3QA 2NYZD 1RHPA 5EPLA 3I91A 1WTWA 3G7LA 4IUPA 2B2VC 4NW2A 1PFMA 1X3PA 1NCVA 1O7YA 4QUCA 3I8ZA 1HFNA 1B3AA 4RAUC 2K01A 1B53A 1HRJA 1WD0A 1RTNA 1B4OA 1PDQA 1GUWA 2RSNA 4X3UA 4IUVA 4UAIA 1BO0A 1J8IA 3Q6SA 4X3KA 1KNAA 1DOKA 2EE1A 1HFGA 1F9QA 2B2YA 1RTOA 2J7ZA 4XT1B 3FPUB 1SAPA 1ILQA 4R8IA 4RA8A 1AZPA 1TVXA 1SSOA 2K1BA 1B2TA 4QUFA 2D9UA 2DY7A 1ESRA 3DEPA 1MSHA 1NR4A 2H1EA 1PFBA 4HCSA 4MN3A 5EQ0A 4CJ0B 3KBXA 1IKLA 2RVLA 3R93A 3UI2A 1ILPA 4R9WA 1F9SA 4LMQD 4U68A 4ZAIA 1G2TA 3QO2A 1HUMA 1EQTA 2VXWA 2Q8TA
chains in the Genus database with same CATH superfamily
3BDCA 1NE3A 4A3MB 4I7AA 2NZHA 1E0BA 1ENCA 2CH4A 2R6GA 3RLOA 3BDLA 1YJWA 1AZQA 5M3MG 1AFPA 4CJ1B 3FRPB 1JE5A 2CQOA 3VDYA 5EPKA 4AIMA 4XDXA 1UNSA 4DV0L 2ID0A 1WCMH 1XNQL 5T1GA 4P71A 4O42A 4JBJA 1VMPA 4A3IB 5EPJA 4NB3A 1S4ZA 3R3OA 2ALYB 2B2TA 5FLXE 2ZJPA 3MWYW 2B39A 4K5WA 5IIFA 2B8FA 4JI6L 1HZAA 1AW7A 1BUVT 4LJZC 3MEHA 4C1NI 4A3EH 1EWCA 4A3EG 2BH2A 1HQMC 4NP5A 3LGJA 3TZDA 1X32A 4C2MB 2IL8A 2HIVA 4DNRB 3I72A 4CKBA 4A3GB 3VR3A 3RZDB 3GTJH 1I6HB 2F0GA 2HCIA 2Y0SB 3NEMA 4IQZA 4NPSA 3ITPA 1GHKA 5A2QL 5LMUQ 2F0FA 5I6WA 1YNJC 1EQQA 1B1ZA 4LNQA 1KHIA 4OL7A 1KAWA 4A93H 1FD7D 2Q2UA 1EY4A 1Q8IA 1LTAD 1QILA 2Z1CA 2M9VA 3S1NB 4JBKA 3H0GG 2EIFA 3K5MA 4RCOA 1EQRA 5IGEA 1TQOA 2Z6KC 1PTOF 1DOKA 1TWHH 2NB0A 3V05A 1I4PA 3KF8B 1EFID 1MSHA 1GD7A 1IKLA 2Z0SA 2KENA 1W6KA 1GUOA 4ZAIA 4APVA 2F3WA 4A3JG 3ERSX 3AEVA 1TWGH 3CW2C 5M3MB 1IL8A 3CMAA 2L5TA 4CHTB 3CCQA 3HOZG 1H95A 4A4IA 4JOIA 3U50C 3NE5B 5I4DA 2YU9H 2E8GA 1CFMA 2PQEA 3TMEA 4AH6A 4DR5Q 1WCMB 5EKLA 2RDGA 3UE1A 5J22A 1IYJB 1AE3A 1GJXA 4M1UB 4NMZA 1PH5A 4R1JA 5DM63 2YYZA 3K8AA 1YNND 3DXJC 1DOMA 3P7JA 5KYIA 1SE3A 4A3EB 1LV9A 2IPKD 5KNCA 1EIHA 1H9JA 4POFA 4B08A 1HPCA 1Q82C 4B9WA 2HDLA 3D0FA 4XQQA 3RUZA 1EOVA 4AYBG 1VQIA 3NTIA 1SE2A 3HOXG 3GTJB 3TSSA 3K6OA 3CF5A 1DCZA 5JVH3 2KOLA 1V1OA 5C5MA 3OTOQ 3F2BA 3HKZG 5LMNQ 1BNZA 1ONLA 4XTCS 1U5KA 3IFDA 3K58A 4IFDJ 2E2DC 3NTHA 5A2QE 2R61A 4R4TA 4G4KA 5AJ3Q 4RKBA 3T51B 3UDIA 3STBD 3KLSA 1YITA 3NBIA 1YNXA 4LFAQ 5HGQA 2WB1G 5C3XA 1QZHA 1OXUA 3AYHB 4N9TA 1HNWL 3CCUA 1NCVA 2G5DA 2K5VA 4CDFC 2XTIA 1HRJA 3OIQA 2EVBA 1GUWA 3PIP3 4J15A 1TWHB 2QGQA 3X3MA 4DV4Q 1CTMA 5FJ8G 1N36Q 2E5LQ 3GTKB 1SAPA 4PZ7A 4RA8A 5I9PA 2IHFA 1TKWB 4GKJL 2LSSA 2PNHA 3KBXA 4N9PA 4KKUA 3UI2A 2F0LA 4LF4L 4A3FH 1HNXL 1A2TA 1PTOD 4DUYL 1GO3E 3CP0A 5E4WC 2YTVA 5LL6X 1P8LA 4YY3L 5C0XH 4A3FG 2CCZA 5K36H 3HOZB 2XNAC 3V2TA 3T1HL 2XRQD 2B2YC 3KF6B 1IL2A 2F0OA 1A15A 1D5ZC 1MJCA 1IKMA 1MD2D 1XYIA 5CMDA 1Y1WG 1Q7YC 2A8VA 2XGTA 2YU9B 1ZKOA 5C3EH 4DR3Q 1RJTA 2ICEC 3NBHA 1I4QA 1H9SA 1EEID 3W1GA 2B2UA 3A8KE 3AFQA 1HR0W 3TS0A 2IJ0A 1WJJA 2EDGA 2K6AA 4GLAC 3H15A 1WTQA 1FNWA 1UE5A 4DF7A 3S24A 4DV5L 3HFZB 5IYDH 1SYEA 4DK6C 2IX3A 1BOSA 4Q0FA 2A6ED 1TS3A 4X66L 1VQDA 5IGBA 5F2DA 4AYBB 1AH9A 3K81C 3VA5A 3HOXB 4M8AA 4JBWA 2UUAQ 5JAVA 3CPWA 3OPOA 5COYA 1BCPF 1X9NA 4RCNA 1L1OA 1SR3A 1YBYA 2OTLA 2L1BA 3ND9A 1UAPA 3TP8A 4XXEA 1SNMA 1OO9B 5GAGC 4G7HC 1SMYC 3BJUA 1SEBD 4DK3C 5FO9B 2WB1B 3A55A 2F0HA 1Y1VG 4K2KA 3SEBA 5C4XG 1HQRD 1S3OA 2F4VQ 3F2UA 4B3TL 1S5DD 3AB9A 2UXBL 2V4DA 1N33L 1VQPA 5ELBA 2Z9HA 3KJOA 3T1YQ 1UEBA 3NQTA 4QUCA 4ULLA 2Q8IB 4FF2A 4RAUC 1KLUD 3FKIH 1XMQL 3GTOH 2FXQA 2OF1A 4HIDA 1E1OA 2F3IA 3FKIG 1IHZA 2WIIB 2AWOA 3HKSA 3HEJA 3CXCA 4IPGA 1KTKA 3EIVA 2LFNA 1ILQA 4YHHQ 4XQJA 4RGNA 1YI2A 3D3RA 1NTGA 4OHJA 3OYYA 5JEAJ 1JORA 1PZID 2K33A 2ES2A 4A3FB 2F0JA 1Q81C 3OSOA 3C3LA 2WKCA 1MBYA 5E7NA 4MZ9A 3LNNA 3KUPA 2MFIA 4X62L 1X3GA 1MIUA 3S17H 2WP8J 2D2CC 5KYLA 3ICEA 3PSIA 1Y1WB 1S72A 4JYAQ 2WV6D 1RD9D 2AKWB 2ZM6Q 1IBLQ 2CKZB 2AWNA 1VQBA 2ZXOA 5C3EB 5BR8L 2AQ2B 2TMPA 3OIPA 4KY6A 1SJED 3BVGA 4J1MA 5KIXA 3H91A 1LTRD 2K03A 2EJMA 3KDFB 2OEOA 2YTYA 4HCEA 1TY2A 1LT5D 2K5WA 4DR1Q 3MEFA 2RCNA 3I70A 2I07B 3I55A 1V9PA 3J7ZC 1ML0D 1EZ8A 2NWGA 1SYBA 4F8MA 1CKNB 3T53B 4KHVA 4JG2A 2JA8G 2NVTB 1L0XB 2CW0D 3VR4A 1N32L 4IFDH 2H4OA 4RMFA 3W5OA 3IRBA 1Y8NB 4HAEA 4HMJA 1TT2A 2R7ZG 2XVSA 4DNTB 1KXLA 5FOBB 4A3BH 3TP6A 3KFUA 3E3XA 1IZ6A 2RHSB 4A3BG 4JI4Q 1PMRA 3Q0AA 1F2LA 3VR6A 2D62A 3NPPA 5C4XB 1Y1VB 2PW7A 1QE6A 4K6LA 5IE8A 2DNEA 1O7LA 5CV8A 4BBRH 2FFKB 3SK5A 3S1RH 5JOBA 4JBMA 3NK9A 2HIXA 2NYZD 3OOCA 1SLJA 4UP7A 2SOBA 1BR9A 1LLRD 2PMZE 3FKIB 2HQEA 1ENFA 4QY7A 2CHBD 2NUCA 1KRTA 1VQGA 2NVQH 4H13C 5J39A 1UWVA 4AQYQ 1CUKA 4V0BA 4K8IA 4P75A 4UP9A 5CV4A 4XYQA 5C44G 4A3KG 1IBML 4YWKA 2A73B 1KDAA 1EUJA 1ESRA 5M5XH 2WACA 3FHWA 4QF4A 3HOVH 1CI3M 2VS1A 4R9WA 5C4JB 4YCVA 4BA2I 2A6HC 1AP0A 4H0LC 1STNA 4PMWA 1CM9A 3PUWA 1QVGA 1HR0L 1CA5A 3BYTB 4DV3L 4LW1A 1H9RA 4FXKC 2KHIA 1RKNA 1C7YA 1SXTA 1Q12A 2A1AA 1F9RA 3F8TA 2JQOA 4IALA 2K5NA 3NTKA 1AE2A 2K75A 2N8NA 4HJ5A 1I94L 3DWPA 4IPDA 3KOJA 1J6QA 4OO1G 2UXDL 1OXXK 3GO5A 2CFMA 2MGSA 4C3IH 2HDMA 4FO2A 3QWNA 5CV7A 2XN9C 1VQCA 4WORA 4B3SL 2JA7G 3S2HH 4V190 3PUVA 2JA8B 4A3MG 4S3SA 4JV5L 2EYJA 3WOFA 5ISRA 1C8CA 2FHTA 4NXMQ 2BH8A 1PVOA 4KHZA 3I4NH 2EY6A 1NAPA 1U4RA 1QB5D 2VB2X 3GTGB 2PQAA 3TZUA 4X65Q 4GN3B 3A8JE 3KF6A 1YNJD 3JAMc 4A3BB 2K7VA 4JI0Q 1O78A 5I6YA 5GAEC 1CKMA 4A3DH 1PA6A 3J7A5 4JI8Q 4LF7Q 1Q8KA 4L5QA 1I6VC 1UEAB 1QNUA 4KJNA 4BBRB 4DV1L 1EY6A 3S1RB 2F0KA 2AMCB 2IWHA 3AQQA 2VQEQ 4X3SA 4C56C 1EU4A 2JA5H 1STHA 2JA5G 1O7IA 4JI3L 4UY8C 2F3VA 3DHQA 3ND8A 2NVQB 4R4QA 1Q90A 5JEAH 3MAQA 3M85A 2EZVA 3D31A 5JEAG 4DUZQ 3GTPH 1SE4A 4DGZA 1STGA 1EU3A 3LX0A 1B9MA 1WOCA 5C44B 1EWHA 3PCOB 5E1FA 1SYCA 5M5YH 5TSSA 1AZPA 2BE5C 4PZ6A 2YV5A 3HGBA 5M5XB 2O5IC 1IXRA 2D9UA 3PO3G 1HNZL 1ZEQX 1TXYA 1TWAH 4IUNA 3CC7A 4LF6Q 3FMCA 3NBHB 3JAML 4HJ7A 1HCZA 1H9SB 2F0EA 1KDCA 2J4XA 2ZJQA 3C46A 3S2DB 4HJ8A 1YJ9A 3R8BA 1J5EL 4IPCA 5BN3A 1XMOQ 4FF1A 3D6WA 2PNRC 5D14A 1G2SA 1TS5A 3UDXA 4HTHA 3QIAA 5CORA 4DKAC 4C3IB 1DZ1A 3BG3A 1VS0A 4DA2A 1M8AA 1SFOH 5LMNW 1K3BC 5C4ZA 3MXPA 4DAMA 3S2HB 3V96A 3CCSA 1PRTC 3A5UA 2IX0A 1K8OA 1HUNA 4K5VA 4LF9Q 5IP7H 3JAMi 5LL6S 2WKDA 4HN7A 3I4NB 1PLFA 1L1OB 4EQOA 1UE1A 1BQQT 1TWCH 2WINB 1BF4A 2DJFC 3CCLA 5C0XJ 3EVQA 4EQPA 2JA7B 4O0AA 1JOQA 4GN5A 3CRLC 3E5SA 5KEEA 4KTAA 4KY5A 2RKSA 4K0KL 2B2TC 1WCMG 3CQZH 4CBVA 5M3FH 1F2ZA 1EYAA 1PTOH 4ME5A 4JI2L 2JJQA 4OX9Q 4QJFA 2B2VA 1GUNA 1DONA 3FEWX 2HD3A 1MI2A 1C9OA 2NZOA 1MHWC 3KK7A 1V43A 3H3VC 3KDFA 2PYKA 3EJIA 4EX5A 1U0LA 2EYHA 2NVXH 2JA5B 4ALPA 1QUQB 5GQOA 2N3SA 2N88A 1BVSA 3EA6A 2MO1A 3A74A 1X3EA 1F77A 3J7AV 2R93H 5FLMH 4RG1A 1V1QA 5JJIA 2ASBA 4OGQC 5FLMG 2ZTEA 2V1CC 1HFNA 1XPRA 3GTPB 1CKNA 5IY0A 3K7UC 5DLQE 4GOPB 4FXGC 1WFQA 1X65A 3U9SA 3PO3B 5IWAQ 1JC7A 2K1BA 1B2TA 3SDZA 2DY7A 5EQ0A 4A93G 4UDUC 2RVLA 3R93A 4RGMA 5M5WH 1HUMA 4F88A 3M9BA 4KI0A 3F2DA 2BA0A 1EIYB 3HZXA 3NELA 4DV7Q 3TBIB 1PH1A 3JAME 3E9IA 1KD1C 5IODA 1NMFA 1UUPA 4KKSA 5LMUL 1IBKQ 1PH6A 2E2JH 2NN6I 2KHSA 4GNXC 5T1IA 4DFAA 1A6XA 1HZCA 1G291 4XIGS 2AUJD 1SFOB 2Z4IA 1SN8A 3WWVA 1S40A 1GKHA 4KLKA 4CDEC 2GN5A 1LYLA 4DK1A 3M4OH 1XPUA 1R4QB 3L3OC 4JOIC 3F1ZA 3G6EA 3Q22A 1FGBD 1FJGQ 4X6AH 1X56A 1TWCB 3CCRA 2ZXRA 2GVBA 5J1ZA 2NN6H 4Y7NH 1R4PB 4B9XA 1L0YB 3HOWH 1VQHA 3RR5A 1SMYD 5M3FB 4GZYC 1PTOB 2KEDA 2KHJA 3GTQH 2XWJB 1WTVA 1U4MA 3PF5A 5EKKA 4FNFA 4QQBX 4ABNA 4HSVA 4DR4Q 5D65A 2NVXB 5C4HA 4JI7Q 1QNKA 1BBWA 4DR5L 1GVPA 3S15H 3TDQA 1MSGA 1OXTA 4ZLTF 1X3QA 5BN4A 1ZYRC 3HOYH 1N34Q 3PMFA 3VYTA 2MNAA 4UHVA 2QEJC 1HZBA 3J81j 2M00A 1D5MC 1FNUA 3ZYYX 4J8QA 3T4AC 3K0YA 1KRSA 2JEBI 2O5JC 4A93B 3H6MA 3D6CA 2Z6BA 4P72A 1NR4A 3T13A 2JSOA 1GUTA 5M5WB 1VQEA 3VYRA 1SNPA 4LMQD 4U68A 3MXNB 2ENBA 5EBDA 3CC2A 2RHQB 1EZ6A 2E2IH 3ULPA 3S16H 2AQ1B 2CWAA 3I4LA 4LFBQ 3TP5A 1EQVA 2PMZB 3S1QH 1VQ7A 5JJZA 3OTOL 3CC4A 3K80C 2F03A 4DR7Q 1JICA 5LMNL 3OMCA 2KCNA 3K59A 1PHJA 3URYA 4IOAA 2UUCQ 3TN2A 3CU7A 1F2YA 5AJ3L 4I65A 2X6LA 4X64Q 4LFCQ 2EYMA 4LFAL 2B2WA 1MGSA 1VQAA 5GROA 1TWGB 1F9PA 3M4OB 4IUTA 4DAPA 5C0XG 2PQAB 2AQ3B 3PIO3 5K36G 5CV6A 3K5LA 4YWLA 1D5XC 1JT8A 1SE8A 4DV6Q 4DV4L 1EFWA 3M4PA 1PH3A 1N36L 2E5LL 5E4XA 1YHAA 2L15A 5IP9H 3ONAB 3B6YA 5C3EG 4JI5Q 3S14H 3TQYA 1QWYA 4FP5D 4QL5A 4OWWB 2CWPA 3H3VI 1EIFA 3Q23A 5JVG3 1S5CD 2DY8A 1E3PA 4HIOA 1KIXA 3M7NA 3FPPA 1YIJA 1XWEA 2A68C 4H02A 1I50H 3K7AH 5IYDG 3BZDB 4DR3L 1WI5A 3S15B 4TKOB 3QB3A 2EYPA 3HOYB 1WTWA 1H9KA 4FF3A 1L1OC 1X6OA 3PV0A 4IUPA 2F0IA 1QZGA 4C3JH 1NMGA 1Q86C 2F0TA 3D4RA 1MKHA 2I5MX 2K5QA 1RTNA 1B4OA 4ILWA 3N6RA 1YVCA 3VYUA 3GQBA 1VQKA 4LF5Q 3IFTA 4Y52H 2A6HD 1E24A 2K5HA 1CQVA 1C0AA 1GUGA 1XNRQ 2ZXPA 3KBGA 5EAYA 2UUAL 2E2IB 1C4QA 1Y8OB 1EQTA 2VXWA 2UXCQ 1PRTF 1UE7A 1G8ZD 1DOLA 3RD4A 1LT3D 1QUQA 3BYYB 3OHXC 2A69C 2EQSA 4IO9A 3K5OA 1TS4A 3NWSA 2LY7A 1BCPB 3CCMA 3HG9A 4JVZA 4DV2L 4JK1C 2F4VL 2Z4HA 4GOPA 4GN4B 1K28A 3GV3A 5IT9c 4XYOA 2DGYA 3T1YL 1TWFH 2NTTA 5JPMC 3HP3A 1OTCA 1S5ED 4XQNA 3AFPA 1E2WA 1PZJD 3W3AA 3IKJA 3JC66 4N8FA 2K04A 2UU9Q 4L8JA 2IX1A 5ELDA 4JPBW 4YHHL 3S14B 2FMCA 3C1EA 3NXWA 3KLSX 2VQFQ 2BOSA 1G6PA 2MPMA 4PV1C 4DR2Q 2B63H 4GKKQ 4U673 1PYWD 4P74A 2VNUD 2EOTA 1TU2B 1K83H 2K52A 1D1KA 2QCPX 3SGIA 4JYAL 3I4MH 4O1NA 2ZM6L 1I50B 2L12A 5CC4A 1IBLL 3PO2H 3QJYA 2PZTA 3K7AB 3PUZA 4DAVA 1EL0A 4C3HH 2I46A 4JCVE 4LWCA 3PF4A 1NY4A 1SNQA 3EROA 1M1KC 4QB4A 4IFDG 3I2ZA 2OQ0A 1Z47A 1D8LA 2BE5D 4IZ8A 1JB3A 3ULLA 4DR1L 1CKOA 1RDPD 5IT9L 4UAIA 2O2LD 5NUCA 1LO5D 1R9TH 3RLFA 3GDEA 3J81c 1SROA 4XT1B 1TVXA 1DYQA 1SSOA 1Q1EA 1VQJA 1YJNA 3J7AF 1KL9A 4LAAA 4IPHA 4HCSA 4BBRG 2JA9A 1ILPA 4KHPQ 4A3LH 2VUMH 2BDOA 3J80c 2R92H 3H09A 3GTOB 1Q46A 1TIID 4B3RQ 4JI4L 2HHHQ 4NDXA 2PI2E 4BA1I 5ELOA 1HXYD 5KNDA 4BY1H 1STYA 2A19A 1PRTD 1K3RA 4KK7A 3E9HA 4ZCKA 2SDFA 4ZQ3A 2EXZA 4OIKA 4IURA 1JWMD 1TWFB 3HOVG 1Y14B 3S17B 3PGZA 2JEAI 3Q8DA 1T5EA 4PZ8A 4GLXA 1SRUA 2F0QA 1VCIA 3TRZA 1QOHA 1V8QA 1LUZA 4DR6Q 2X69A 2K32A 2R3ZA 2P5ZX 4L5TA 4AQYL 4CDDC 3X3NA 2VL6A 1NNXA 3MXNA 1M90C 3A0JA 2B8GA 4MTNA 2F4IA 3MC0B 1FVIA 1LT4D 2KUMA 4EQNA 5FLXc 4ZUJA 2CVRA 2B63B 2SNSA 3KLWA 1KDBA 3GV6A 4J6HA 4OWXB 4C3IG 3RZOH 1K83B 3ZJYC 4WJ4A 3TS2A 3VR2A 1SYGA 5IGDA 4C3HB 4F87A 1PFNA 1L0WA 1CHPD 1W6JA 1GOZA 2JA6H 4ZKCB 3ERQA 2JA6G 3I4NG 4EVOA 3J81i 3G7LA 3RNUA 2ICIA 2IY5B 4O2DA 4BXXH 3HOUH 1B9NA 2I0QA 3CCJA 3HS0C 1DGSA 1R9TB 4IUVA 4A3DG 5IT9E 2LS01 3J80i 3EQLC 1F9QA 1I4GA 1NUCA 2K50A 4UPAA 1LTBD 2PZUA 2UUBQ 4NXML 2NTSA 4FDBA 3BZKA 1I3QH 3QOJA 1PFBA 3HKZE 1YHQA 4X65L 3I7FA 5IYBH 2IW3A 2AHOB 5I9OA 1JJCB 4JI0L 1E22A 5I2YA 4A3IH 4LF8Q 1WD1A 1TY0A 3ULJA 4JI8L 4LF7L 1EOTA 4BY1B 2EJGC 1JOOA 4ZRZA 2F0MA 1JB7A 3PQIA 3HOVB 2VQEL 2OWOA 2C35B 4IUQA 3KLRA 4NKLA 4B3MQ 3QOLA 3DWQA 4RWSC 4JI1Q 4HIKA 3RN2A 3RZDH 2F0NA 1Y8PB 2N78A 1I4XA 4CKCA 4DUZL 1I6HH 2MHVA 3PIPA 1DM0B 2X6GA 1PYSB 1D7QA 1NR2A 5CBAE 1FNVA 1JMCA 2KVMA 4R8NA 1A0IA 3S9WA 2TSSA 2PW5A 1WTOA 4RGTA 5A35A 4KMUC 3J7YW 1JOKA 5DNFA 5M9OA 1VQ8A 2DN8A 2HQLA 2JYOA 4EGVA 1I5FA 4NXNQ 1BCPC 1WVLA 5EBCA 1OXVA 3RZOB 2QW7A 3TREA 4LF6L 1U4PA 4KKTA 3GTMH 1SNCA 1EY5A 5HGTA 3PIOA 3A5ZB 3UE0A 2NVYH 1ZYRD 3DM3A 1X55A 1A8VA 2JA6B 5IP7G 1EY9A 1XMOL 1SBBB 2E76C 1KQSA 1B3QA 2N49A 1D6EC 3DEOA 3S1NH 1SMXA 2KEEA 2PZWA 4MIUA 4DV0Q 1XNQQ 2CQAA 1A3UA 4RKLA 5JJLA 2MQHA 2B2VC 4QCLA 3HOUB 2IT1A 4A3DB 5C6AA 4G7ZC 3E6ZX 2K01A 4KD4A 4DU9A 4RFBA 5M3MH 4QIWE 5M3FG 4JI6Q 4POGA 1FGUA 4LF9L 3BVZA 1RTOA 2J7ZA 3FPUB 1I3QB 2VY3A 4K5XA 5LHY1 1A3VA 2JE6I 3I73A 5G3LF 1S5BD 2SEBD 5D3DA 1G2TA 4C1NK 3NENA 5CV5A 2R93G 4OONA 4K6DA 1EY7A 2EYLA 4L5SA 1YZ6A 2K14A 4OX9L 1VQNA 4LUZA 4H7BA 1CT1D 1Z6HA 1STBA 2JN4A 1CHQD 5M5YB 2RA4A 1U4LA 2BA1A 2IHEA 3S1MH 2N55A 1HH2P 2J0TD 4OIJA 1K8AC 1TWAB 1QJOA 1EIGA 2L11A 2OQKA 3NQIA 3E0EA 3U58A 1Q3LA 5AFWA 1WTHA 1QVFA 1CZWA 1XTDA 4UP8A 2RSOA 1BBXC 2LXKA 3KYHC 2E2HH 4P73A 3I3CA 3SHLA 4TVAB 4Q5VA 2EY2A 4A3CH 3MFGA 2JK8A 4A3CG 1KAAA 3FVQA 3K0XA 5IWAL 4WJ3M 5CBEE 1HZ9A 2K28A 2RDFA 2YTXA 3H0GH 2ZTDA 1W2BA 3UDGA 1GUSA 1QVCA 3SVMA 2FJ2A 2K05A 3GD7A 5EGTA 2A68D 2E75C 1RF2D 3GTMB 2KCTA 2M2LA 4ME3A 2ZTCA 1B44D 1CZGA 1ENAA 1LM0A 4I7ZC 5CYUA 2NVYB 2EJFC 2QF7A 4DV7L 1QCBD 4G57A 3OW2A 3C1FA 1WTPA 1IBKL 3H94A 2Z6KA 4LUVA 3GTKH 4CDCC 3SK8A 1BBUA 4KN7C 3K57A 1LTGD 1VF7A 1HHVA 4GNXA 4H44C 1NBWA 4GLVB 5CR3A 3NP8A 4DN4M 2KECA 4A3JH 2NN6G 3HOWG 1UE6A 2WAQE 3CQZB 3CKIB 1XPOA 4YIJA 2L55A 3MVVA 3HOZH 2MUYA 4DAYA 4WFN3 4X3UA 4FF4A 3OWFA 1II3A 3Q6SA 2SNMA 1VQFA 1FR3A 3WOEA 1T9HA 4DPGA 4DNIA 3OW7A 5FO8B 3MXGA 1FJGL 4PMBA 1PH9A 3AU7A 1K8GA 4IJHA 4DXFA 2H1EA 3G6JB 4CJ0B 2R93B 3MZ5A 2RF4A 3GTLH 2A69D 3NSWA 3E0JA 1H9MA 3CCVA 1Z7TA 3HOYG 1ET9A 3RN5A 1KNEA 1AN8A 4HIMA 3L7ZC 1ICWA 2H5XA 1BDOA 3LWUA 1ASYA 5G3LD 1JR0D 2OT2A 3MHBA 3PUYA 3S1MB 2GVAA 4DR4L 1HTPA 5C3WA 1EWIA 1S5FD 4QMGA 2ZJRA 3U9OA 4JI7L 2QDLA 3DLLA 1K9MC 1IYVA 4WJWA 3HOXH 3TP7A 1HNWQ 4GS3A 4ZYSA 3ER0A 1YHBA 2E2HB 2RQXA 1SNOA 1N34L 1DXMA 1T5XD 1PH4A 1E2VA 4K14A 1IYUA 1XX8A 2LMCB 3BZCA 3EN2A 5ELEA 1K0RA 3G4SA 2E2JB 3G71A 2ATWA 1X54A 1M4VA 1D1IA 1RODA 5CGKA 4GKJQ 4FYDA 3H0GB 2B2WC 1B50A 5C0XI 4LF4Q 4OEMB 1HNXQ 4DUYQ 2I5HA 3DWAA 5FKAC 3IL8A 1KABA 1PH7A 4YY3Q 1ESFA 4G7OC 4LFBL 2KCCA 2DUDA 4QGUA 1A63A 4MHEA 3T1HQ 3A8IE 4PG3A 5FJ8H 3D4DA 4DR7L 2HUGA 3FDTA 5IYCH 1GXDC 2Q2IA 2K5DA 2ZT9C 4FXDA 5IYCG 1PYBA 2UUCL 3M4YA 1Z9FA 4TSSA 4Y7NB 2B2UC 2F0WA 1SJHD 3HOWB 4X64L 4LFCL 3QG1A 4A3JB 3MFYA 3MXUA 5IP9G 3MTSA 1DJRD 4ZUIA 3A7AB 4PNYA 4KD3A 2RDHA 3GTQB 2CH4W 3BU2A 1GHJA 4RHSA 3G48A 2KJXA 3O13A 4MNOA 1IW7D 1VDZA 2EY5A 4DV5Q 1Y1WH 4TRDA 1BO0A 3R2IA 4TQUS 4X3KA 3A56A 4DV6L 4R4OA 2EE1A 1HFGA 2G9DA 2B2YA 1L2FA 3RMHA 5KRUA 1LTID 2MO0A 4F7XA 4X66Q 3DEPA 1HA5A 2RCFA 2LXJA 4MN3A 1STEA 4MTKA 3GTLB 1PFSA 4JI5L 1JWSD 1A62A 2MJ8A 4Z9CB 3A54A 3SXHA 4R4CA 3P1HA 3Q24A 3H3VH 1V1PA 4C3JG 2Q8RE 3L2PA 1FL0A 2I5LX 1LACA 2E74C 2F0SA 2KBNA 1ET6A 3L9AX 1I4HA 1PXUA 2BDNA 2NVTH 4B3TQ 1A2UA 4K2LA 3UDFA 5CV9A 2F0UA 2UXBQ 1N33Q 2NZ1D 1SYFA 2F52A 4N8X1 1Q1BA 3S16B 4CJ2C 3HKZB 1GM5A 2Y0SE 2OXPA 1RIPA 3WDNA 1XMQQ 4RHRA 3S1QB 1G91A 3P75A 3BVMA 1XTCD 4YCUA 1X3FA 2QILA 3A7LA 4LF5L 5C4XH 1Y1VH 2QA4A 1FYCA 1K0SA 3SR1A 2C5CA 3P20A 1N8RC 4DV2Q 4LUOA 1J9OA 4GOPC 1XNRL 1YNNC 5H1SE 3EFXD 2HCCA 4X62Q 2Z8LA 2Q8TA 2F0DA 1STAA 2UXCL 3CHBD 2RBMA 5EJWA 2L0CA 4RH6A 3AMUA 5BR8Q 3SE0A 1E2ZA 2D0PA 2FINB 1G6ZA 5JPNC 1C48A 3CPFA 1JJ2A 4BY7H 1PRTB 4YWMA 3CD6A 1CK1A 5KGUA 4BY7G 2PO4A 2Q2HA 2XWBB 5C4JH 4NW2A 2G9HD 1X3PA 1O7YA 2XSCA 1B3AA 3STBC 3I56A 2B63G 1WD0A 1NJIC 5K5PA 1EYGA 1VQ5A 1B8AA 3CRKC 1RL2A 1ICFB 1PZKD 3DMUA 1MJEA 2UU9L 3I4MG 1EYCA 5E3FA 4IFDI 1KLGD 4KV6A 3PO2G 4OELB 4DK0A 1XJVA 1N32Q 4C3HG 3QR8A 2KQ3A 4E6IA 5GADC 2B29A 2VZAA 2F0PA 5FK9C 2VQFL 2D5DA 3NHHA 3IAYA 1F9SA 3BS1A 4C3JB 1LT6D 3QO2A 2EY1A 4KJOA 4ZKBB 3SK4A 2VB3X 4HEDA 4DR2L 5ELNA 1CQFA 2PCFB 4GKKL 2EYFA 3KF8A 4KN4C 3BDOA 1LABA 3W1BA 4ID6A 5KNBA 2OTJA 2WAQG 2F1MA 4QIWB 1PTOC 2JA8H 2Q2TA 3N52A 2VW9A 4CGYB 4HJAA 2L9HA 1PH8A 1VQ4A 4OXPA 5ELCA 1IW7C 3GTGH 3NUCA 4IN3A 4A76A 2R7ZH 3R2TA 2R7DA 1EY0A 5I2XA 5HY6A 1F2MA 4L5RC 4A3LG 2VUMG 2EXDA 1G51A 1CSPA 2R92G 4JW0A 1Y69U 2XIWA 5ELFA 3M7GA 4A75A 2KA7A 2KCMA 4OWTB 4HJ9A 3HRZC 1BCPD 1LTTD 3F2CA 3I90A 3M4QA 1IBMQ 3D4WA 3KJPA 1O80A 1O7ZA 1VMCA 4BY1G 1WTRA 1JJGA 4KHPL 1HTLD 1CSQA 1D2BA 1E1TA 2A6EC 3U4VA 1RCVD 3VYSA 1HR0Q 2L4NA 2D0OA 4DV3Q 2A74C 4GNXB 1ASZA 3L0OA 2HT1A 2NBFA 2FMMA 5EKIA 4ODGA 1DD2A 4OO1I 2AUKA 5IGCA 4B3RL 1PH2A 1SYDA 5C44H 4A3KH 2HHHL 4HR7B 1I94Q 4DXGA 3FP9A 4PQXA 2MP1A 1TS2A 1NSNS 4DAYB 4P2CB 2UXDQ 4BY7B 2F0VA 1YEZA 4X3TA 4XT3B 3J81L 3MA2B 2QDBA 3LWEA 5IOCA 4K8JA 1VF5C 1VQ9A 3T16A 3I91A 1PFMA 2OCEA 4B3SQ 4FVMA 1VQ6A 4BBSH 1A3TA 2GA4B 1B7YB 3VA7A 2PI2A 3J80L 1PDQA 4BBSG 3I4MB 3K5NA 1J8IA 1KNAA 3PO2B 4JV5Q 3U4ZA 1P16A 4DR6L 3S2DH 1PV4A 4OO1H 4WRDA 3W2DA 1W3SA 1BKBA 4QUFA 4CKEA 3GP7A 3D8GA 1K8MA 5DAUA 5C5LA 3M3YH 2K4KA 4HMIA 1JQYD 5JJKA 2JA7H 3I4OA 2WAQB 3CCEA 4A3MH 4L6TB 1HA6A 4BXXG 4YCWA 2XRSD 3RLNA 3HOUG 1BXTA 4ZK9B 5J3BA 4DV1Q 5BN5A 4AYBE 5DM73 1KC8C 2A5HA 5DEHA 4KY7A 4BWGB 2R7ZB 1VQLA 4JI3Q 2VUMB 1EEFD 2C9OA 5IGGA 2R92B 2JP1A 1SDFA 4PMCA 5D3IB 5IYBG 3OWEB 5FLXL 2QKIC 1VQMA 2PPBC 4A3IG 1TR5A 2WFWA 2QEXA 2WB1E 1OXSC 1QG7A 3NWTA 3OMGA 1EYDA 1VQOA 2UUBL 1JE4A 1N9WA 3VR5A 1K73C 1CA6A 1HNZQ 1XXGA 3CAMA 3DM1A 1LTLA 1LTSD 4RGOS 4EQ5A 4LK1C 4C2MH 3SK6A 2DJGC 2CW0C 1WTXA 4LF8L 4A3GH 5HURA 1AEXA 3T56B 5L37A 4A3GG 4A3KB 1J5EQ 2Y0SG 2R7FA 1ZXTA 3C2PA 3PO3H 4L63B 4IJLA 1JCKB 1E7ZA 4IUUA 3J81E 2EPBA 1I4RA 1RHPA 4JC0A 5EPLA 4BBSB 2LKVA 4BS9A 4B3ML 1SNDA 3I8ZA 4JI1L 1B53A 2BCOA 3CMEA 5FO7B 2RSNA 3PUXA 3J80E 1WYDA 2EYOA 1HJPA 2B3GA 3EBEA 3TEHB 1B70B 4R8IA 1EY8A 1V1PB 3DUZA 4IOCA 1U9RA 5IGFA 1JWUD 2O4XA 3M3YB 4R4IA 4HSPA 4K0KQ 2DNCA 5GAHC 4NXNL 2JXMB 4JI2Q
chains in the Genus database with same CATH topology
3BDCA 4A3MB 1E0BA 1ENCA 2R6GA 3BDLA 1AZQA 1AFPA 4CJ1B 3FRPB 5EPKA 4XDXA 1UNSA 2ID0A 5T1GA 4O42A 1VMPA 4A3IB 5EPJA 1S4ZA 3R3OA 2B2TA 5FLXE 3MWYW 2B39A 4K5WA 5IIFA 2B8FA 1AW7A 1BUVT 4LJZC 3MEHA 4C1NI 1EWCA 1HQMC 4NP5A 3TZDA 1X32A 4C2MB 2IL8A 4DNRB 3I72A 4CKBA 4A3GB 3VR3A 3RZDB 1I6HB 2F0GA 2HCIA 2Y0SB 4IQZA 3ITPA 1GHKA 5A2QL 2F0FA 5I6WA 1YNJC 1B1ZA 4OL7A 1FD7D 1EY4A 1Q8IA 1LTAD 1QILA 2Z1CA 2M9VA 3S1NB 3K5MA 4RCOA 5IGEA 1TQOA 1PTOF 1DOKA 2NB0A 3V05A 1I4PA 1EFID 1MSHA 1IKLA 1W6KA 1GUOA 4ZAIA 2F3WA 5M3MB 1IL8A 2L5TA 4CHTB 3NE5B 5I4DA 2PQEA 1CFMA 3TMEA 1WCMB 5EKLA 2RDGA 5J22A 1GJXA 4M1UB 4NMZA 5DM63 2YYZA 1YNND 3DXJC 1DOMA 3P7JA 5KYIA 1SE3A 4A3EB 1LV9A 2IPKD 5KNCA 1EIHA 1H9JA 4B08A 1HPCA 4B9WA 2HDLA 4XQQA 3RUZA 3NTIA 1SE2A 3GTJB 3TSSA 3K6OA 1DCZA 5JVH3 2KOLA 1V1OA 5C5MA 1BNZA 1ONLA 4XTCS 4IFDJ 3IFDA 3K58A 2E2DC 3NTHA 5A2QE 2R61A 4G4KA 4RKBA 3T51B 3KLSA 3NBIA 5C3XA 1OXUA 4N9TA 1NCVA 1HRJA 3OIQA 2EVBA 1GUWA 3PIP3 1TWHB 3X3MA 1CTMA 3GTKB 1SAPA 4RA8A 5I9PA 1TKWB 3KBXA 4N9PA 4KKUA 3UI2A 2F0LA 1A2TA 1PTOD 5LL6X 5E4WC 5C0XH 5K36H 3HOZB 2XNAC 3V2TA 2XRQD 2B2YC 2F0OA 1A15A 1D5ZC 1IKMA 1MD2D 1XYIA 5CMDA 2YU9B 1ZKOA 1RJTA 2ICEC 3NBHA 1I4QA 1H9SA 1EEID 2B2UA 3A8KE 2IJ0A 2EDGA 2K6AA 1WTQA 1FNWA 4DF7A 1SYEA 2IX3A 1BOSA 4Q0FA 2A6ED 1TS3A 5IGBA 5F2DA 4AYBB 3VA5A 3HOXB 4M8AA 4JBWA 5JAVA 3OPOA 5COYA 1BCPF 4RCNA 2L1BA 3ND9A 1UAPA 3TP8A 4XXEA 1SNMA 1OO9B 4G7HC 1SMYC 1SEBD 5FO9B 2WB1B 3A55A 2F0HA 4K2KA 3SEBA 1HQRD 3F2UA 1S5DD 3AB9A 2V4DA 5ELBA 3NQTA 4QUCA 4ULLA 2Q8IB 4FF2A 4RAUC 1KLUD 2OF1A 1IHZA 2WIIB 2AWOA 3HEJA 1KTKA 2LFNA 1ILQA 4XQJA 4RGNA 3D3RA 4OHJA 5JEAJ 1JORA 1PZID 2K33A 4A3FB 2F0JA 3OSOA 3C3LA 2WKCA 1MBYA 3LNNA 3KUPA 2WP8J 2D2CC 5KYLA 1Y1WB 2WV6D 1RD9D 2AWNA 2ZXOA 5C3EB 2AQ2B 2TMPA 3OIPA 4KY6A 1SJED 3BVGA 4J1MA 5KIXA 3H91A 1LTRD 2K03A 2EJMA 2OEOA 4HCEA 1TY2A 1LT5D 2K5WA 3I70A 2I07B 1ML0D 1EZ8A 2NWGA 1SYBA 4F8MA 3T53B 4KHVA 2NVTB 1L0XB 2CW0D 3VR4A 4IFDH 2H4OA 1Y8NB 4HAEA 4HMJA 1TT2A 2XVSA 4DNTB 5FOBB 3TP6A 1PMRA 3Q0AA 1F2LA 3VR6A 2D62A 3NPPA 5C4XB 1Y1VB 2PW7A 1QE6A 4K6LA 2DNEA 1O7LA 5CV8A 2FFKB 3SK5A 5JOBA 3NK9A 2NYZD 3OOCA 2SOBA 1BR9A 1LLRD 3FKIB 2HQEA 1ENFA 2CHBD 2NUCA 4H13C 5J39A 4V0BA 4K8IA 5CV4A 4XYQA 2A73B 1KDAA 1ESRA 2WACA 4QF4A 1CI3M 4R9WA 5C4JB 4BA2I 2A6HC 1AP0A 4H0LC 1STNA 4PMWA 1CM9A 3PUWA 1CA5A 3BYTB 1H9RA 4FXKC 1RKNA 1SXTA 1Q12A 1F9RA 4IALA 3NTKA 3DWPA 4OO1G 1OXXK 3GO5A 2MGSA 2HDMA 4FO2A 3QWNA 5CV7A 2XN9C 4WORA 4V190 3PUVA 2JA8B 4S3SA 2EYJA 3WOFA 5ISRA 1C8CA 2FHTA 4KHZA 2EY6A 1NAPA 1U4RA 1QB5D 2VB2X 3GTGB 3TZUA 3A8JE 1YNJD 4A3BB 2K7VA 1O78A 5I6YA 1I6VC 1UEAB 1QNUA 4KJNA 4BBRB 1EY6A 3S1RB 2F0KA 2IWHA 4X3SA 4C56C 1EU4A 1STHA 2F3VA 3DHQA 3ND8A 2NVQB 5JEAH 1Q90A 3MAQA 3M85A 2EZVA 3D31A 5JEAG 1SE4A 4DGZA 1STGA 1EU3A 3LX0A 1B9MA 5C44B 1EWHA 5E1FA 1SYCA 5TSSA 1AZPA 2BE5C 3HGBA 5M5XB 2O5IC 2D9UA 1ZEQX 4IUNA 3FMCA 3JAML 1HCZA 1H9SB 2F0EA 1KDCA 2J4XA 3C46A 3S2DB 3R8BA 5BN3A 4FF1A 3D6WA 2PNRC 5D14A 1G2SA 1TS5A 4HTHA 3QIAA 5CORA 4C3IB 1DZ1A 3BG3A 4DA2A 1M8AA 5C4ZA 3MXPA 3S2HB 3V96A 1PRTC 2IX0A 1K8OA 1HUNA 4K5VA 5LL6S 2WKDA 4HN7A 3I4NB 1PLFA 4EQOA 1BQQT 2WINB 1BF4A 5C0XJ 3EVQA 4EQPA 2JA7B 1JOQA 3CRLC 3E5SA 5KEEA 4KTAA 4KY5A 2RKSA 2B2TC 4CBVA 1F2ZA 1EYAA 1PTOH 4ME5A 2B2VA 1GUNA 1DONA 3FEWX 1MI2A 3KK7A 1V43A 3H3VC 2PYKA 3EJIA 2EYHA 2JA5B 2N88A 3EA6A 1F77A 3J7AV 4OGQC 1HFNA 3GTPB 4FXGC 3U9SA 3PO3B 1JC7A 2K1BA 1B2TA 3SDZA 2DY7A 5EQ0A 4UDUC 2RVLA 3R93A 4RGMA 1HUMA 4F88A 4KI0A 2BA0A 3HZXA 3TBIB 3JAME 5IODA 1UUPA 4KKSA 2NN6I 2KHSA 5T1IA 4DFAA 1A6XA 1G291 4XIGS 2AUJD 1SFOB 2Z4IA 4DK1A 1R4QB 3L3OC 3Q22A 1FGBD 1TWCB 2ZXRA 5J1ZA 2NN6H 1R4PB 4B9XA 1L0YB 1SMYD 5M3FB 4GZYC 1PTOB 2KEDA 2XWJB 1WTVA 1U4MA 5EKKA 4FNFA 4ABNA 4HSVA 5D65A 2NVXB 5C4HA 1QNKA 3TDQA 1MSGA 1OXTA 4ZLTF 1X3QA 5BN4A 1ZYRC 3PMFA 3VYTA 2QEJC 2M00A 1D5MC 1FNUA 3ZYYX 4J8QA 3T4AC 3K0YA 2JEBI 2O5JC 4A93B 3H6MA 3D6CA 1NR4A 3T13A 2JSOA 1GUTA 5M5WB 3VYRA 1SNPA 4LMQD 4U68A 5EBDA 2ENBA 1EZ6A 2AQ1B 3I4LA 3TP5A 1EQVA 2PMZB 5JJZA 2F03A 1JICA 3OMCA 2KCNA 3K59A 3URYA 3TN2A 3CU7A 1F2YA 4I65A 2X6LA 2EYMA 2B2WA 1MGSA 1TWGB 1F9PA 3M4OB 4IUTA 4DAPA 5C0XG 2AQ3B 3PIO3 5K36G 5CV6A 3K5LA 1D5XC 5E4XA 3ONAB 1QWYA 4FP5D 3Q23A 5JVG3 1S5CD 2DY8A 3M7NA 3FPPA 1XWEA 2A68C 3BZDB 3S15B 4TKOB 3QB3A 2EYPA 3HOYB 1WTWA 1H9KA 4FF3A 3PV0A 4IUPA 2F0IA 2F0TA 3D4RA 2K5QA 1RTNA 1B4OA 4ILWA 3N6RA 3VYUA 3GQBA 3IFTA 2A6HD 1CQVA 1GUGA 2ZXPA 3KBGA 2E2IB 1C4QA 1Y8OB 1EQTA 2VXWA 1PRTF 1G8ZD 1DOLA 3RD4A 1LT3D 3BYYB 3OHXC 2A69C 3K5OA 1TS4A 3NWSA 2LY7A 1BCPB 3HG9A 4JK1C 2Z4HA 3GV3A 4XYOA 5JPMC 2NTTA 3HP3A 1S5ED 4XQNA 1E2WA 1PZJD 3W3AA 3IKJA 2K04A 4L8JA 2IX1A 5ELDA 3S14B 2FMCA 3C1EA 3NXWA 3KLSX 2BOSA 2MPMA 4PV1C 4U673 1PYWD 2VNUD 2EOTA 1TU2B 2QCPX 1D1KA 4O1NA 1I50B 2L12A 5CC4A 3QJYA 2PZTA 3K7AB 3PUZA 4DAVA 1EL0A 2I46A 1SNQA 3EROA 4QB4A 4IFDG 1Z47A 2BE5D 4IZ8A 1JB3A 1RDPD 5IT9L 4UAIA 2O2LD 5NUCA 1LO5D 3RLFA 4XT1B 1TVXA 1DYQA 1SSOA 1Q1EA 3J7AF 4LAAA 4HCSA 1ILPA 2BDOA 3H09A 3GTOB 1TIID 4NDXA 4BA1I 1HXYD 5KNDA 1STYA 1PRTD 4KK7A 2SDFA 4ZQ3A 2EXZA 4OIKA 4IURA 1JWMD 1TWFB 3S17B 2JEAI 1T5EA 2F0QA 1VCIA 1QOHA 1V8QA 2X69A 2K32A 2R3ZA 3X3NA 3MXNA 2B8GA 2F4IA 3MC0B 1LT4D 2KUMA 4EQNA 4ZUJA 2CVRA 2B63B 2SNSA 1KDBA 4J6HA 3GV6A 4C3IG 1K83B 3VR2A 1SYGA 5IGDA 4C3HB 4F87A 1PFNA 1CHPD 1W6JA 1GOZA 4ZKCB 3ERQA 4EVOA 3G7LA 2ICIA 1B9NA 3HS0C 1R9TB 4IUVA 5IT9E 2LS01 3EQLC 1F9QA 1I4GA 1NUCA 1LTBD 2PZUA 2NTSA 3QOJA 1PFBA 2IW3A 5I9OA 5I2YA 1WD1A 1TY0A 1EOTA 4BY1B 2EJGC 1JOOA 4ZRZA 2F0MA 3HOVB 4IUQA 3KLRA 4NKLA 3QOLA 3DWQA 4RWSC 2F0NA 1Y8PB 4CKCA 1I4XA 2MHVA 1DM0B 2X6GA 1NR2A 5CBAE 1FNVA 2KVMA 4R8NA 3S9WA 2TSSA 2PW5A 1WTOA 4RGTA 5A35A 4KMUC 3J7YW 1JOKA 5DNFA 5M9OA 2DN8A 2JYOA 4EGVA 1BCPC 1WVLA 5EBCA 1OXVA 3RZOB 1U4PA 4KKTA 1SNCA 1EY5A 5HGTA 1ZYRD 2JA6B 1EY9A 1SBBB 2E76C 1D6EC 3DEOA 2KEEA 2PZWA 4MIUA 2CQAA 1A3UA 4RKLA 2B2VC 4QCLA 3HOUB 2IT1A 4A3DB 5C6AA 4G7ZC 3E6ZX 2K01A 4KD4A 4DU9A 4RFBA 3BVZA 1RTOA 2J7ZA 3FPUB 1I3QB 4K5XA 5LHY1 1A3VA 2JE6I 3I73A 5G3LF 1S5BD 2SEBD 5D3DA 1G2TA 4C1NK 5CV5A 4K6DA 1EY7A 2EYLA 4H7BA 1CT1D 1Z6HA 1STBA 1CHQD 5M5YB 2RA4A 1U4LA 2BA1A 2N55A 2J0TD 4OIJA 1TWAB 1QJOA 1EIGA 2L11A 3NQIA 1Q3LA 5AFWA 1CZWA 2RSOA 1BBXC 3I3CA 3SHLA 4Q5VA 2EY2A 3MFGA 1KAAA 3FVQA 5CBEE 2K28A 2RDFA 1GUSA 3SVMA 2FJ2A 2K05A 3GD7A 5EGTA 2A68D 2E75C 1RF2D 3GTMB 2M2LA 1B44D 1CZGA 1ENAA 4I7ZC 5CYUA 2NVYB 2EJFC 2QF7A 1QCBD 4G57A 3C1FA 1WTPA 3H94A 3SK8A 4KN7C 3K57A 1LTGD 1VF7A 1HHVA 4H44C 5CR3A 3NP8A 4DN4M 2KECA 2NN6G 3CQZB 3CKIB 4YIJA 2L55A 3MVVA 2MUYA 4DAYA 4WFN3 4X3UA 4FF4A 3OWFA 1II3A 3Q6SA 2SNMA 1FR3A 3WOEA 3OW7A 5FO8B 3MXGA 4PMBA 3AU7A 4DXFA 2H1EA 3G6JB 4CJ0B 2R93B 3MZ5A 2A69D 3NSWA 3E0JA 1H9MA 1Z7TA 1ET9A 1KNEA 1AN8A 3L7ZC 1ICWA 3LWUA 1BDOA 5G3LD 1JR0D 2OT2A 3MHBA 3PUYA 3S1MB 1HTPA 5C3WA 1S5FD 4QMGA 3U9OA 1IYVA 4WJWA 3TP7A 4ZYSA 2E2HB 2RQXA 1SNOA 1DXMA 1T5XD 1E2VA 4K14A 1IYUA 1XX8A 2LMCB 5ELEA 2E2JB 1M4VA 1D1IA 1RODA 5CGKA 4FYDA 3H0GB 2B2WC 1B50A 5C0XI 3DWAA 5FKAC 3IL8A 1KABA 1ESFA 4G7OC 2KCCA 4MHEA 3A8IE 3D4DA 2HUGA 3FDTA 1GXDC 2K5DA 2ZT9C 4FXDA 3M4YA 4TSSA 4Y7NB 2B2UC 2F0WA 1SJHD 3HOWB 3QG1A 4A3JB 3MFYA 3MXUA 3MTSA 1DJRD 4ZUIA 3A7AB 4PNYA 4KD3A 2RDHA 3GTQB 1GHJA 4RHSA 2KJXA 3O13A 1IW7D 1VDZA 2EY5A 4TRDA 1BO0A 3R2IA 4TQUS 4X3KA 3A56A 2EE1A 1HFGA 2G9DA 2B2YA 3RMHA 5KRUA 1LTID 4F7XA 1HA5A 3DEPA 4MN3A 1STEA 3GTLB 1JWSD 2MJ8A 4Z9CB 3A54A 3SXHA 3P1HA 3Q24A 1V1PA 4C3JG 2Q8RE 1LACA 2E74C 2F0SA 1ET6A 3L9AX 1I4HA 1PXUA 2BDNA 1A2UA 4K2LA 5CV9A 2F0UA 2NZ1D 1SYFA 1Q1BA 3S16B 4CJ2C 3HKZB 2OXPA 3WDNA 4RHRA 3S1QB 1G91A 3P75A 3BVMA 1XTCD 2QILA 3A7LA 1FYCA 3SR1A 2C5CA 3P20A 1J9OA 1YNNC 3EFXD 2HCCA 2Z8LA 2F0DA 1STAA 3CHBD 2RBMA 5EJWA 2L0CA 4RH6A 3AMUA 3SE0A 1E2ZA 2FINB 1G6ZA 5JPNC 1C48A 1PRTB 1CK1A 5KGUA 2PO4A 2XWBB 4NW2A 2G9HD 1X3PA 1O7YA 2XSCA 1B3AA 1WD0A 5K5PA 3CRKC 3DMUA 1PZKD 1EYCA 5E3FA 4IFDI 1KLGD 4KV6A 4DK0A 4C3HG 4E6IA 2KQ3A 5FK9C 2F0PA 2D5DA 3NHHA 3IAYA 1F9SA 3BS1A 4C3JB 1LT6D 3QO2A 2EY1A 4KJOA 4ZKBB 3SK4A 2VB3X 4HEDA 1CQFA 2PCFB 2EYFA 3KF8A 4KN4C 3BDOA 1LABA 4ID6A 5KNBA 2F1MA 4QIWB 1PTOC 3N52A 4CGYB 2L9HA 5ELCA 1IW7C 3NUCA 4IN3A 3R2TA 1EY0A 5I2XA 1F2MA 1Y69U 2XIWA 5ELFA 3M7GA 2KA7A 3HRZC 1BCPD 1LTTD 3I90A 3D4WA 1O80A 1O7ZA 1VMCA 1WTRA 1HTLD 1D2BA 2A6EC 1RCVD 3VYSA 2L4NA 2A74C 2NBFA 2FMMA 5EKIA 4ODGA 1DD2A 4OO1I 2AUKA 5IGCA 1SYDA 4HR7B 4DXGA 4PQXA 2MP1A 1TS2A 1NSNS 4P2CB 4BY7B 2F0VA 4XT3B 4X3TA 3J81L 3MA2B 2QDBA 3LWEA 5IOCA 4K8JA 1VF5C 3T16A 3I91A 1PFMA 4FVMA 1A3TA 2GA4B 3VA7A 3J80L 1PDQA 3I4MB 3K5NA 1J8IA 1KNAA 3PO2B 4OO1H 4WRDA 3W2DA 4QUFA 4CKEA 3GP7A 3D8GA 1K8MA 5DAUA 5C5LA 4HMIA 1JQYD 2WAQB 4L6TB 1HA6A 2XRSD 1BXTA 4ZK9B 5BN5A 5DM73 2A5HA 5DEHA 4KY7A 4BWGB 2R7ZB 2VUMB 1EEFD 2C9OA 5IGGA 2R92B 2JP1A 1SDFA 4PMCA 5D3IB 3OWEB 5FLXL 2QKIC 2PPBC 1TR5A 1OXSC 1QG7A 3NWTA 3OMGA 1EYDA 1JE4A 3VR5A 1CA6A 1XXGA 3DM1A 1LTSD 4RGOS 4LK1C 3SK6A 2CW0C 1WTXA 5HURA 1AEXA 3T56B 4A3KB 3C2PA 1ZXTA 4L63B 1JCKB 4IUUA 3J81E 2EPBA 1I4RA 1RHPA 5EPLA 4BBSB 2LKVA 4BS9A 1SNDA 3I8ZA 1B53A 2BCOA 5FO7B 2RSNA 3PUXA 3J80E 2EYOA 4R8IA 1EY8A 1V1PB 3DUZA 1U9RA 5IGFA 1JWUD 2O4XA 3M3YB 4HSPA 2DNCA 2JXMB 2Q8TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MJ8 A;  5E4W C;  1AP0 A;  4ZKB B;  4HED A;  1IL8 A;  1CM9 A;  1KNE A;  1E0B A;  3KUP A;  1WD1 A;  2Q8R E;  1CA5 A;  1HA6 A;  5JJZ A;  1DOL A;  1ICW A;  1AZQ A;  2B2Y C;  1JIC A;  1A15 A;  4ZK9 B;  4CJ1 B;  1IKM A;  1XYI A;  5CMD A;  1F9R A;  1EOT A;  2RA4 A;  1U4L A;  3N52 A;  3TN2 A;  3D6W A;  5D14 A;  2L9H A;  1G2S A;  2BDN A;  1RJT A;  2N55 A;  2X6L A;  5EPK A;  3H91 A;  5T1I A;  4OIJ A;  4XDX A;  2K03 A;  2B2U A;  2NZ1 D;  4IUQ A;  1EIG A;  2B2W A;  1MGS A;  2SDF A;  5COR A;  1DZ1 A;  2L11 A;  5T1G A;  1Q3L A;  4OIK A;  1M8A A;  2MGS A;  4IUR A;  2HDM A;  4O42 A;  5AFW A;  2JP1 A;  4CJ2 C;  3GV3 A;  1F9P A;  1VMP A;  1SDF A;  4RWS C;  4IUT A;  5EPJ A;  3HP3 A;  1S4Z A;  1G91 A;  2RSO A;  1WTQ A;  1BBX C;  2B2T A;  2XIW A;  1XX8 A;  3MWY W;  3I3C A;  1HUN A;  2X6G A;  1ML0 D;  1DOM A;  3P7J A;  2X69 A;  2R3Z A;  1NR2 A;  1QG7 A;  2K04 A;  2NWG A;  2FHT A;  5CBA E;  1C8C A;  1LV9 A;  2KVM A;  1PLF A;  3I90 A;  5E4X A;  1EIH A;  1ROD A;  1BF4 A;  1JE4 A;  1NAP A;  3ONA B;  1U4R A;  2B2W C;  2HDL A;  1CA6 A;  1O80 A;  3DM1 A;  5CBE E;  1J9O A;  1O7Z A;  2K28 A;  1B50 A;  1VMC A;  1WTR A;  1WTO A;  3TZD A;  2KUM A;  1X32 A;  5DNF A;  2FJ2 A;  2IL8 A;  2CVR A;  2HCC A;  2JYO A;  2K05 A;  3IL8 A;  3SVM A;  5COY A;  1WVL A;  2MPM A;  2KED A;  4HAE A;  2DY8 A;  2B2T C;  2M2L A;  1U4P A;  3GV6 A;  4MHE A;  2L4N A;  1WTV A;  1U4M A;  2EOT A;  2B2V A;  2L1B A;  1WTX A;  1DON A;  2KOL A;  2HCI A;  1F2L A;  2FMM A;  5EKI A;  1BNZ A;  1MI2 A;  5EJW A;  2HUG A;  3FDT A;  3IFD A;  2L12 A;  1QE6 A;  1WTP A;  4HSV A;  1PFN A;  1ZXT A;  5D65 A;  1EL0 A;  2MP1 A;  2FIN B;  1G6Z A;  2FFK B;  1QNK A;  4XT3 B;  2B2U C;  4X3T A;  4ZKC B;  1HHV A;  3DEO A;  2N88 A;  3F2U A;  4X3S A;  2KEE A;  4IUU A;  1MSG A;  3LWE A;  4DN4 M;  3MTS A;  2EPB A;  2KEC A;  4ZLT F;  1X3Q A;  2NYZ D;  1RHP A;  5EPL A;  3I91 A;  1WTW A;  3G7L A;  4IUP A;  2B2V C;  4NW2 A;  1PFM A;  1X3P A;  1NCV A;  1O7Y A;  4QUC A;  3I8Z A;  1HFN A;  1B3A A;  4RAU C;  2K01 A;  1B53 A;  1HRJ A;  1WD0 A;  1RTN A;  1B4O A;  1PDQ A;  1GUW A;  2RSN A;  4X3U A;  4IUV A;  4UAI A;  1BO0 A;  1J8I A;  3Q6S A;  4X3K A;  1KNA A;  1DOK A;  2EE1 A;  1HFG A;  1F9Q A;  2B2Y A;  1RTO A;  2J7Z A;  4XT1 B;  3FPU B;  1SAP A;  1ILQ A;  4R8I A;  4RA8 A;  1AZP A;  1TVX A;  1SSO A;  2K1B A;  1B2T A;  4QUF A;  2D9U A;  2DY7 A;  1ESR A;  3DEP A;  1MSH A;  1NR4 A;  2H1E A;  1PFB A;  4HCS A;  4MN3 A;  5EQ0 A;  4CJ0 B;  3KBX A;  1IKL A;  2RVL A;  3R93 A;  3UI2 A;  1ILP A;  4R9W A;  1F9S A;  4LMQ D;  4U68 A;  4ZAI A;  1G2T A;  3QO2 A;  1HUM A;  1EQT A;  2VXW A;  2Q8T A; 
#chains in the Genus database with same CATH topology
 3BDC A;  1NE3 A;  4A3M B;  4I7A A;  2NZH A;  1E0B A;  1ENC A;  2CH4 A;  2R6G A;  3RLO A;  3BDL A;  1YJW A;  1AZQ A;  5M3M G;  1AFP A;  4CJ1 B;  3FRP B;  1JE5 A;  2CQO A;  3VDY A;  5EPK A;  4AIM A;  4XDX A;  1UNS A;  4DV0 L;  2ID0 A;  1WCM H;  1XNQ L;  5T1G A;  4P71 A;  4O42 A;  4JBJ A;  1VMP A;  4A3I B;  5EPJ A;  4NB3 A;  1S4Z A;  3R3O A;  2ALY B;  2B2T A;  5FLX E;  2ZJP A;  3MWY W;  2B39 A;  4K5W A;  5IIF A;  2B8F A;  4JI6 L;  1HZA A;  1AW7 A;  1BUV T;  4LJZ C;  3MEH A;  4C1N I;  4A3E H;  1EWC A;  4A3E G;  2BH2 A;  1HQM C;  4NP5 A;  3LGJ A;  3TZD A;  1X32 A;  4C2M B;  2IL8 A;  2HIV A;  4DNR B;  3I72 A;  4CKB A;  4A3G B;  3VR3 A;  3RZD B;  3GTJ H;  1I6H B;  2F0G A;  2HCI A;  2Y0S B;  3NEM A;  4IQZ A;  4NPS A;  3ITP A;  1GHK A;  5A2Q L;  5LMU Q;  2F0F A;  5I6W A;  1YNJ C;  1EQQ A;  1B1Z A;  4LNQ A;  1KHI A;  4OL7 A;  1KAW A;  4A93 H;  1FD7 D;  2Q2U A;  1EY4 A;  1Q8I A;  1LTA D;  1QIL A;  2Z1C A;  2M9V A;  3S1N B;  4JBK A;  3H0G G;  2EIF A;  3K5M A;  4RCO A;  1EQR A;  5IGE A;  1TQO A;  2Z6K C;  1PTO F;  1DOK A;  1TWH H;  2NB0 A;  3V05 A;  1I4P A;  3KF8 B;  1EFI D;  1MSH A;  1GD7 A;  1IKL A;  2Z0S A;  2KEN A;  1W6K A;  1GUO A;  4ZAI A;  4APV A;  2F3W A;  4A3J G;  3ERS X;  3AEV A;  1TWG H;  3CW2 C;  5M3M B;  1IL8 A;  3CMA A;  2L5T A;  4CHT B;  3CCQ A;  3HOZ G;  1H95 A;  4A4I A;  4JOI A;  3U50 C;  3NE5 B;  5I4D A;  2YU9 H;  2E8G A;  1CFM A;  2PQE A;  3TME A;  4AH6 A;  4DR5 Q;  1WCM B;  5EKL A;  2RDG A;  3UE1 A;  5J22 A;  1IYJ B;  1AE3 A;  1GJX A;  4M1U B;  4NMZ A;  1PH5 A;  4R1J A;  5DM6 3;  2YYZ A;  3K8A A;  1YNN D;  3DXJ C;  1DOM A;  3P7J A;  5KYI A;  1SE3 A;  4A3E B;  1LV9 A;  2IPK D;  5KNC A;  1EIH A;  1H9J A;  4POF A;  4B08 A;  1HPC A;  1Q82 C;  4B9W A;  2HDL A;  3D0F A;  4XQQ A;  3RUZ A;  1EOV A;  4AYB G;  1VQI A;  3NTI A;  1SE2 A;  3HOX G;  3GTJ B;  3TSS A;  3K6O A;  3CF5 A;  1DCZ A;  5JVH 3;  2KOL A;  1V1O A;  5C5M A;  3OTO Q;  3F2B A;  3HKZ G;  5LMN Q;  1BNZ A;  1ONL A;  4XTC S;  1U5K A;  3IFD A;  3K58 A;  4IFD J;  2E2D C;  3NTH A;  5A2Q E;  2R61 A;  4R4T A;  4G4K A;  5AJ3 Q;  4RKB A;  3T51 B;  3UDI A;  3STB D;  3KLS A;  1YIT A;  3NBI A;  1YNX A;  4LFA Q;  5HGQ A;  2WB1 G;  5C3X A;  1QZH A;  1OXU A;  3AYH B;  4N9T A;  1HNW L;  3CCU A;  1NCV A;  2G5D A;  2K5V A;  4CDF C;  2XTI A;  1HRJ A;  3OIQ A;  2EVB A;  1GUW A;  3PIP 3;  4J15 A;  1TWH B;  2QGQ A;  3X3M A;  4DV4 Q;  1CTM A;  5FJ8 G;  1N36 Q;  2E5L Q;  3GTK B;  1SAP A;  4PZ7 A;  4RA8 A;  5I9P A;  2IHF A;  1TKW B;  4GKJ L;  2LSS A;  2PNH A;  3KBX A;  4N9P A;  4KKU A;  3UI2 A;  2F0L A;  4LF4 L;  4A3F H;  1HNX L;  1A2T A;  1PTO D;  4DUY L;  1GO3 E;  3CP0 A;  5E4W C;  2YTV A;  5LL6 X;  1P8L A;  4YY3 L;  5C0X H;  4A3F G;  2CCZ A;  5K36 H;  3HOZ B;  2XNA C;  3V2T A;  3T1H L;  2XRQ D;  2B2Y C;  3KF6 B;  1IL2 A;  2F0O A;  1A15 A;  1D5Z C;  1MJC A;  1IKM A;  1MD2 D;  1XYI A;  5CMD A;  1Y1W G;  1Q7Y C;  2A8V A;  2XGT A;  2YU9 B;  1ZKO A;  5C3E H;  4DR3 Q;  1RJT A;  2ICE C;  3NBH A;  1I4Q A;  1H9S A;  1EEI D;  3W1G A;  2B2U A;  3A8K E;  3AFQ A;  1HR0 W;  3TS0 A;  2IJ0 A;  1WJJ A;  2EDG A;  2K6A A;  4GLA C;  3H15 A;  1WTQ A;  1FNW A;  1UE5 A;  4DF7 A;  3S24 A;  4DV5 L;  3HFZ B;  5IYD H;  1SYE A;  4DK6 C;  2IX3 A;  1BOS A;  4Q0F A;  2A6E D;  1TS3 A;  4X66 L;  1VQD A;  5IGB A;  5F2D A;  4AYB B;  1AH9 A;  3K81 C;  3VA5 A;  3HOX B;  4M8A A;  4JBW A;  2UUA Q;  5JAV A;  3CPW A;  3OPO A;  5COY A;  1BCP F;  1X9N A;  4RCN A;  1L1O A;  1SR3 A;  1YBY A;  2OTL A;  2L1B A;  3ND9 A;  1UAP A;  3TP8 A;  4XXE A;  1SNM A;  1OO9 B;  5GAG C;  4G7H C;  1SMY C;  3BJU A;  1SEB D;  4DK3 C;  5FO9 B;  2WB1 B;  3A55 A;  2F0H A;  1Y1V G;  4K2K A;  3SEB A;  5C4X G;  1HQR D;  1S3O A;  2F4V Q;  3F2U A;  4B3T L;  1S5D D;  3AB9 A;  2UXB L;  2V4D A;  1N33 L;  1VQP A;  5ELB A;  2Z9H A;  3KJO A;  3T1Y Q;  1UEB A;  3NQT A;  4QUC A;  4ULL A;  2Q8I B;  4FF2 A;  4RAU C;  1KLU D;  3FKI H;  1XMQ L;  3GTO H;  2FXQ A;  2OF1 A;  4HID A;  1E1O A;  2F3I A;  3FKI G;  1IHZ A;  2WII B;  2AWO A;  3HKS A;  3HEJ A;  3CXC A;  4IPG A;  1KTK A;  3EIV A;  2LFN A;  1ILQ A;  4YHH Q;  4XQJ A;  4RGN A;  1YI2 A;  3D3R A;  1NTG A;  4OHJ A;  3OYY A;  5JEA J;  1JOR A;  1PZI D;  2K33 A;  2ES2 A;  4A3F B;  2F0J A;  1Q81 C;  3OSO A;  3C3L A;  2WKC A;  1MBY A;  5E7N A;  4MZ9 A;  3LNN A;  3KUP A;  2MFI A;  4X62 L;  1X3G A;  1MIU A;  3S17 H;  2WP8 J;  2D2C C;  5KYL A;  3ICE A;  3PSI A;  1Y1W B;  1S72 A;  4JYA Q;  2WV6 D;  1RD9 D;  2AKW B;  2ZM6 Q;  1IBL Q;  2CKZ B;  2AWN A;  1VQB A;  2ZXO A;  5C3E B;  5BR8 L;  2AQ2 B;  2TMP A;  3OIP A;  4KY6 A;  1SJE D;  3BVG A;  4J1M A;  5KIX A;  3H91 A;  1LTR D;  2K03 A;  2EJM A;  3KDF B;  2OEO A;  2YTY A;  4HCE A;  1TY2 A;  1LT5 D;  2K5W A;  4DR1 Q;  3MEF A;  2RCN A;  3I70 A;  2I07 B;  3I55 A;  1V9P A;  3J7Z C;  1ML0 D;  1EZ8 A;  2NWG A;  1SYB A;  4F8M A;  1CKN B;  3T53 B;  4KHV A;  4JG2 A;  2JA8 G;  2NVT B;  1L0X B;  2CW0 D;  3VR4 A;  1N32 L;  4IFD H;  2H4O A;  4RMF A;  3W5O A;  3IRB A;  1Y8N B;  4HAE A;  4HMJ A;  1TT2 A;  2R7Z G;  2XVS A;  4DNT B;  1KXL A;  5FOB B;  4A3B H;  3TP6 A;  3KFU A;  3E3X A;  1IZ6 A;  2RHS B;  4A3B G;  4JI4 Q;  1PMR A;  3Q0A A;  1F2L A;  3VR6 A;  2D62 A;  3NPP A;  5C4X B;  1Y1V B;  2PW7 A;  1QE6 A;  4K6L A;  5IE8 A;  2DNE A;  1O7L A;  5CV8 A;  4BBR H;  2FFK B;  3SK5 A;  3S1R H;  5JOB A;  4JBM A;  3NK9 A;  2HIX A;  2NYZ D;  3OOC A;  1SLJ A;  4UP7 A;  2SOB A;  1BR9 A;  1LLR D;  2PMZ E;  3FKI B;  2HQE A;  1ENF A;  4QY7 A;  2CHB D;  2NUC A;  1KRT A;  1VQG A;  2NVQ H;  4H13 C;  5J39 A;  1UWV A;  4AQY Q;  1CUK A;  4V0B A;  4K8I A;  4P75 A;  4UP9 A;  5CV4 A;  4XYQ A;  5C44 G;  4A3K G;  1IBM L;  4YWK A;  2A73 B;  1KDA A;  1EUJ A;  1ESR A;  5M5X H;  2WAC A;  3FHW A;  4QF4 A;  3HOV H;  1CI3 M;  2VS1 A;  4R9W A;  5C4J B;  4YCV A;  4BA2 I;  2A6H C;  1AP0 A;  4H0L C;  1STN A;  4PMW A;  1CM9 A;  3PUW A;  1QVG A;  1HR0 L;  1CA5 A;  3BYT B;  4DV3 L;  4LW1 A;  1H9R A;  4FXK C;  2KHI A;  1RKN A;  1C7Y A;  1SXT A;  1Q12 A;  2A1A A;  1F9R A;  3F8T A;  2JQO A;  4IAL A;  2K5N A;  3NTK A;  1AE2 A;  2K75 A;  2N8N A;  4HJ5 A;  1I94 L;  3DWP A;  4IPD A;  3KOJ A;  1J6Q A;  4OO1 G;  2UXD L;  1OXX K;  3GO5 A;  2CFM A;  2MGS A;  4C3I H;  2HDM A;  4FO2 A;  3QWN A;  5CV7 A;  2XN9 C;  1VQC A;  4WOR A;  4B3S L;  2JA7 G;  3S2H H;  4V19 0;  3PUV A;  2JA8 B;  4A3M G;  4S3S A;  4JV5 L;  2EYJ A;  3WOF A;  5ISR A;  1C8C A;  2FHT A;  4NXM Q;  2BH8 A;  1PVO A;  4KHZ A;  3I4N H;  2EY6 A;  1NAP A;  1U4R A;  1QB5 D;  2VB2 X;  3GTG B;  2PQA A;  3TZU A;  4X65 Q;  4GN3 B;  3A8J E;  3KF6 A;  1YNJ D;  3JAM c;  4A3B B;  2K7V A;  4JI0 Q;  1O78 A;  5I6Y A;  5GAE C;  1CKM A;  4A3D H;  1PA6 A;  3J7A 5;  4JI8 Q;  4LF7 Q;  1Q8K A;  4L5Q A;  1I6V C;  1UEA B;  1QNU A;  4KJN A;  4BBR B;  4DV1 L;  1EY6 A;  3S1R B;  2F0K A;  2AMC B;  2IWH A;  3AQQ A;  2VQE Q;  4X3S A;  4C56 C;  1EU4 A;  2JA5 H;  1STH A;  2JA5 G;  1O7I A;  4JI3 L;  4UY8 C;  2F3V A;  3DHQ A;  3ND8 A;  2NVQ B;  4R4Q A;  1Q90 A;  5JEA H;  3MAQ A;  3M85 A;  2EZV A;  3D31 A;  5JEA G;  4DUZ Q;  3GTP H;  1SE4 A;  4DGZ A;  1STG A;  1EU3 A;  3LX0 A;  1B9M A;  1WOC A;  5C44 B;  1EWH A;  3PCO B;  5E1F A;  1SYC A;  5M5Y H;  5TSS A;  1AZP A;  2BE5 C;  4PZ6 A;  2YV5 A;  3HGB A;  5M5X B;  2O5I C;  1IXR A;  2D9U A;  3PO3 G;  1HNZ L;  1ZEQ X;  1TXY A;  1TWA H;  4IUN A;  3CC7 A;  4LF6 Q;  3FMC A;  3NBH B;  3JAM L;  4HJ7 A;  1HCZ A;  1H9S B;  2F0E A;  1KDC A;  2J4X A;  2ZJQ A;  3C46 A;  3S2D B;  4HJ8 A;  1YJ9 A;  3R8B A;  1J5E L;  4IPC A;  5BN3 A;  1XMO Q;  4FF1 A;  3D6W A;  2PNR C;  5D14 A;  1G2S A;  1TS5 A;  3UDX A;  4HTH A;  3QIA A;  5COR A;  4DKA C;  4C3I B;  1DZ1 A;  3BG3 A;  1VS0 A;  4DA2 A;  1M8A A;  1SFO H;  5LMN W;  1K3B C;  5C4Z A;  3MXP A;  4DAM A;  3S2H B;  3V96 A;  3CCS A;  1PRT C;  3A5U A;  2IX0 A;  1K8O A;  1HUN A;  4K5V A;  4LF9 Q;  5IP7 H;  3JAM i;  5LL6 S;  2WKD A;  4HN7 A;  3I4N B;  1PLF A;  1L1O B;  4EQO A;  1UE1 A;  1BQQ T;  1TWC H;  2WIN B;  1BF4 A;  2DJF C;  3CCL A;  5C0X J;  3EVQ A;  4EQP A;  2JA7 B;  4O0A A;  1JOQ A;  4GN5 A;  3CRL C;  3E5S A;  5KEE A;  4KTA A;  4KY5 A;  2RKS A;  4K0K L;  2B2T C;  1WCM G;  3CQZ H;  4CBV A;  5M3F H;  1F2Z A;  1EYA A;  1PTO H;  4ME5 A;  4JI2 L;  2JJQ A;  4OX9 Q;  4QJF A;  2B2V A;  1GUN A;  1DON A;  3FEW X;  2HD3 A;  1MI2 A;  1C9O A;  2NZO A;  1MHW C;  3KK7 A;  1V43 A;  3H3V C;  3KDF A;  2PYK A;  3EJI A;  4EX5 A;  1U0L A;  2EYH A;  2NVX H;  2JA5 B;  4ALP A;  1QUQ B;  5GQO A;  2N3S A;  2N88 A;  1BVS A;  3EA6 A;  2MO1 A;  3A74 A;  1X3E A;  1F77 A;  3J7A V;  2R93 H;  5FLM H;  4RG1 A;  1V1Q A;  5JJI A;  2ASB A;  4OGQ C;  5FLM G;  2ZTE A;  2V1C C;  1HFN A;  1XPR A;  3GTP B;  1CKN A;  5IY0 A;  3K7U C;  5DLQ E;  4GOP B;  4FXG C;  1WFQ A;  1X65 A;  3U9S A;  3PO3 B;  5IWA Q;  1JC7 A;  2K1B A;  1B2T A;  3SDZ A;  2DY7 A;  5EQ0 A;  4A93 G;  4UDU C;  2RVL A;  3R93 A;  4RGM A;  5M5W H;  1HUM A;  4F88 A;  3M9B A;  4KI0 A;  3F2D A;  2BA0 A;  1EIY B;  3HZX A;  3NEL A;  4DV7 Q;  3TBI B;  1PH1 A;  3JAM E;  3E9I A;  1KD1 C;  5IOD A;  1NMF A;  1UUP A;  4KKS A;  5LMU L;  1IBK Q;  1PH6 A;  2E2J H;  2NN6 I;  2KHS A;  4GNX C;  5T1I A;  4DFA A;  1A6X A;  1HZC A;  1G29 1;  4XIG S;  2AUJ D;  1SFO B;  2Z4I A;  1SN8 A;  3WWV A;  1S40 A;  1GKH A;  4KLK A;  4CDE C;  2GN5 A;  1LYL A;  4DK1 A;  3M4O H;  1XPU A;  1R4Q B;  3L3O C;  4JOI C;  3F1Z A;  3G6E A;  3Q22 A;  1FGB D;  1FJG Q;  4X6A H;  1X56 A;  1TWC B;  3CCR A;  2ZXR A;  2GVB A;  5J1Z A;  2NN6 H;  4Y7N H;  1R4P B;  4B9X A;  1L0Y B;  3HOW H;  1VQH A;  3RR5 A;  1SMY D;  5M3F B;  4GZY C;  1PTO B;  2KED A;  2KHJ A;  3GTQ H;  2XWJ B;  1WTV A;  1U4M A;  3PF5 A;  5EKK A;  4FNF A;  4QQB X;  4ABN A;  4HSV A;  4DR4 Q;  5D65 A;  2NVX B;  5C4H A;  4JI7 Q;  1QNK A;  1BBW A;  4DR5 L;  1GVP A;  3S15 H;  3TDQ A;  1MSG A;  1OXT A;  4ZLT F;  1X3Q A;  5BN4 A;  1ZYR C;  3HOY H;  1N34 Q;  3PMF A;  3VYT A;  2MNA A;  4UHV A;  2QEJ C;  1HZB A;  3J81 j;  2M00 A;  1D5M C;  1FNU A;  3ZYY X;  4J8Q A;  3T4A C;  3K0Y A;  1KRS A;  2JEB I;  2O5J C;  4A93 B;  3H6M A;  3D6C A;  2Z6B A;  4P72 A;  1NR4 A;  3T13 A;  2JSO A;  1GUT A;  5M5W B;  1VQE A;  3VYR A;  1SNP A;  4LMQ D;  4U68 A;  3MXN B;  2ENB A;  5EBD A;  3CC2 A;  2RHQ B;  1EZ6 A;  2E2I H;  3ULP A;  3S16 H;  2AQ1 B;  2CWA A;  3I4L A;  4LFB Q;  3TP5 A;  1EQV A;  2PMZ B;  3S1Q H;  1VQ7 A;  5JJZ A;  3OTO L;  3CC4 A;  3K80 C;  2F03 A;  4DR7 Q;  1JIC A;  5LMN L;  3OMC A;  2KCN A;  3K59 A;  1PHJ A;  3URY A;  4IOA A;  2UUC Q;  3TN2 A;  3CU7 A;  1F2Y A;  5AJ3 L;  4I65 A;  2X6L A;  4X64 Q;  4LFC Q;  2EYM A;  4LFA L;  2B2W A;  1MGS A;  1VQA A;  5GRO A;  1TWG B;  1F9P A;  3M4O B;  4IUT A;  4DAP A;  5C0X G;  2PQA B;  2AQ3 B;  3PIO 3;  5K36 G;  5CV6 A;  3K5L A;  4YWL A;  1D5X C;  1JT8 A;  1SE8 A;  4DV6 Q;  4DV4 L;  1EFW A;  3M4P A;  1PH3 A;  1N36 L;  2E5L L;  5E4X A;  1YHA A;  2L15 A;  5IP9 H;  3ONA B;  3B6Y A;  5C3E G;  4JI5 Q;  3S14 H;  3TQY A;  1QWY A;  4FP5 D;  4QL5 A;  4OWW B;  2CWP A;  3H3V I;  1EIF A;  3Q23 A;  5JVG 3;  1S5C D;  2DY8 A;  1E3P A;  4HIO A;  1KIX A;  3M7N A;  3FPP A;  1YIJ A;  1XWE A;  2A68 C;  4H02 A;  1I50 H;  3K7A H;  5IYD G;  3BZD B;  4DR3 L;  1WI5 A;  3S15 B;  4TKO B;  3QB3 A;  2EYP A;  3HOY B;  1WTW A;  1H9K A;  4FF3 A;  1L1O C;  1X6O A;  3PV0 A;  4IUP A;  2F0I A;  1QZG A;  4C3J H;  1NMG A;  1Q86 C;  2F0T A;  3D4R A;  1MKH A;  2I5M X;  2K5Q A;  1RTN A;  1B4O A;  4ILW A;  3N6R A;  1YVC A;  3VYU A;  3GQB A;  1VQK A;  4LF5 Q;  3IFT A;  4Y52 H;  2A6H D;  1E24 A;  2K5H A;  1CQV A;  1C0A A;  1GUG A;  1XNR Q;  2ZXP A;  3KBG A;  5EAY A;  2UUA L;  2E2I B;  1C4Q A;  1Y8O B;  1EQT A;  2VXW A;  2UXC Q;  1PRT F;  1UE7 A;  1G8Z D;  1DOL A;  3RD4 A;  1LT3 D;  1QUQ A;  3BYY B;  3OHX C;  2A69 C;  2EQS A;  4IO9 A;  3K5O A;  1TS4 A;  3NWS A;  2LY7 A;  1BCP B;  3CCM A;  3HG9 A;  4JVZ A;  4DV2 L;  4JK1 C;  2F4V L;  2Z4H A;  4GOP A;  4GN4 B;  1K28 A;  3GV3 A;  5IT9 c;  4XYO A;  2DGY A;  3T1Y L;  1TWF H;  2NTT A;  5JPM C;  3HP3 A;  1OTC A;  1S5E D;  4XQN A;  3AFP A;  1E2W A;  1PZJ D;  3W3A A;  3IKJ A;  3JC6 6;  4N8F A;  2K04 A;  2UU9 Q;  4L8J A;  2IX1 A;  5ELD A;  4JPB W;  4YHH L;  3S14 B;  2FMC A;  3C1E A;  3NXW A;  3KLS X;  2VQF Q;  2BOS A;  1G6P A;  2MPM A;  4PV1 C;  4DR2 Q;  2B63 H;  4GKK Q;  4U67 3;  1PYW D;  4P74 A;  2VNU D;  2EOT A;  1TU2 B;  1K83 H;  2K52 A;  1D1K A;  2QCP X;  3SGI A;  4JYA L;  3I4M H;  4O1N A;  2ZM6 L;  1I50 B;  2L12 A;  5CC4 A;  1IBL L;  3PO2 H;  3QJY A;  2PZT A;  3K7A B;  3PUZ A;  4DAV A;  1EL0 A;  4C3H H;  2I46 A;  4JCV E;  4LWC A;  3PF4 A;  1NY4 A;  1SNQ A;  3ERO A;  1M1K C;  4QB4 A;  4IFD G;  3I2Z A;  2OQ0 A;  1Z47 A;  1D8L A;  2BE5 D;  4IZ8 A;  1JB3 A;  3ULL A;  4DR1 L;  1CKO A;  1RDP D;  5IT9 L;  4UAI A;  2O2L D;  5NUC A;  1LO5 D;  1R9T H;  3RLF A;  3GDE A;  3J81 c;  1SRO A;  4XT1 B;  1TVX A;  1DYQ A;  1SSO A;  1Q1E A;  1VQJ A;  1YJN A;  3J7A F;  1KL9 A;  4LAA A;  4IPH A;  4HCS A;  4BBR G;  2JA9 A;  1ILP A;  4KHP Q;  4A3L H;  2VUM H;  2BDO A;  3J80 c;  2R92 H;  3H09 A;  3GTO B;  1Q46 A;  1TII D;  4B3R Q;  4JI4 L;  2HHH Q;  4NDX A;  2PI2 E;  4BA1 I;  5ELO A;  1HXY D;  5KND A;  4BY1 H;  1STY A;  2A19 A;  1PRT D;  1K3R A;  4KK7 A;  3E9H A;  4ZCK A;  2SDF A;  4ZQ3 A;  2EXZ A;  4OIK A;  4IUR A;  1JWM D;  1TWF B;  3HOV G;  1Y14 B;  3S17 B;  3PGZ A;  2JEA I;  3Q8D A;  1T5E A;  4PZ8 A;  4GLX A;  1SRU A;  2F0Q A;  1VCI A;  3TRZ A;  1QOH A;  1V8Q A;  1LUZ A;  4DR6 Q;  2X69 A;  2K32 A;  2R3Z A;  2P5Z X;  4L5T A;  4AQY L;  4CDD C;  3X3N A;  2VL6 A;  1NNX A;  3MXN A;  1M90 C;  3A0J A;  2B8G A;  4MTN A;  2F4I A;  3MC0 B;  1FVI A;  1LT4 D;  2KUM A;  4EQN A;  5FLX c;  4ZUJ A;  2CVR A;  2B63 B;  2SNS A;  3KLW A;  1KDB A;  3GV6 A;  4J6H A;  4OWX B;  4C3I G;  3RZO H;  1K83 B;  3ZJY C;  4WJ4 A;  3TS2 A;  3VR2 A;  1SYG A;  5IGD A;  4C3H B;  4F87 A;  1PFN A;  1L0W A;  1CHP D;  1W6J A;  1GOZ A;  2JA6 H;  4ZKC B;  3ERQ A;  2JA6 G;  3I4N G;  4EVO A;  3J81 i;  3G7L A;  3RNU A;  2ICI A;  2IY5 B;  4O2D A;  4BXX H;  3HOU H;  1B9N A;  2I0Q A;  3CCJ A;  3HS0 C;  1DGS A;  1R9T B;  4IUV A;  4A3D G;  5IT9 E;  2LS0 1;  3J80 i;  3EQL C;  1F9Q A;  1I4G A;  1NUC A;  2K50 A;  4UPA A;  1LTB D;  2PZU A;  2UUB Q;  4NXM L;  2NTS A;  4FDB A;  3BZK A;  1I3Q H;  3QOJ A;  1PFB A;  3HKZ E;  1YHQ A;  4X65 L;  3I7F A;  5IYB H;  2IW3 A;  2AHO B;  5I9O A;  1JJC B;  4JI0 L;  1E22 A;  5I2Y A;  4A3I H;  4LF8 Q;  1WD1 A;  1TY0 A;  3ULJ A;  4JI8 L;  4LF7 L;  1EOT A;  4BY1 B;  2EJG C;  1JOO A;  4ZRZ A;  2F0M A;  1JB7 A;  3PQI A;  3HOV B;  2VQE L;  2OWO A;  2C35 B;  4IUQ A;  3KLR A;  4NKL A;  4B3M Q;  3QOL A;  3DWQ A;  4RWS C;  4JI1 Q;  4HIK A;  3RN2 A;  3RZD H;  2F0N A;  1Y8P B;  2N78 A;  1I4X A;  4CKC A;  4DUZ L;  1I6H H;  2MHV A;  3PIP A;  1DM0 B;  2X6G A;  1PYS B;  1D7Q A;  1NR2 A;  5CBA E;  1FNV A;  1JMC A;  2KVM A;  4R8N A;  1A0I A;  3S9W A;  2TSS A;  2PW5 A;  1WTO A;  4RGT A;  5A35 A;  4KMU C;  3J7Y W;  1JOK A;  5DNF A;  5M9O A;  1VQ8 A;  2DN8 A;  2HQL A;  2JYO A;  4EGV A;  1I5F A;  4NXN Q;  1BCP C;  1WVL A;  5EBC A;  1OXV A;  3RZO B;  2QW7 A;  3TRE A;  4LF6 L;  1U4P A;  4KKT A;  3GTM H;  1SNC A;  1EY5 A;  5HGT A;  3PIO A;  3A5Z B;  3UE0 A;  2NVY H;  1ZYR D;  3DM3 A;  1X55 A;  1A8V A;  2JA6 B;  5IP7 G;  1EY9 A;  1XMO L;  1SBB B;  2E76 C;  1KQS A;  1B3Q A;  2N49 A;  1D6E C;  3DEO A;  3S1N H;  1SMX A;  2KEE A;  2PZW A;  4MIU A;  4DV0 Q;  1XNQ Q;  2CQA A;  1A3U A;  4RKL A;  5JJL A;  2MQH A;  2B2V C;  4QCL A;  3HOU B;  2IT1 A;  4A3D B;  5C6A A;  4G7Z C;  3E6Z X;  2K01 A;  4KD4 A;  4DU9 A;  4RFB A;  5M3M H;  4QIW E;  5M3F G;  4JI6 Q;  4POG A;  1FGU A;  4LF9 L;  3BVZ A;  1RTO A;  2J7Z A;  3FPU B;  1I3Q B;  2VY3 A;  4K5X A;  5LHY 1;  1A3V A;  2JE6 I;  3I73 A;  5G3L F;  1S5B D;  2SEB D;  5D3D A;  1G2T A;  4C1N K;  3NEN A;  5CV5 A;  2R93 G;  4OON A;  4K6D A;  1EY7 A;  2EYL A;  4L5S A;  1YZ6 A;  2K14 A;  4OX9 L;  1VQN A;  4LUZ A;  4H7B A;  1CT1 D;  1Z6H A;  1STB A;  2JN4 A;  1CHQ D;  5M5Y B;  2RA4 A;  1U4L A;  2BA1 A;  2IHE A;  3S1M H;  2N55 A;  1HH2 P;  2J0T D;  4OIJ A;  1K8A C;  1TWA B;  1QJO A;  1EIG A;  2L11 A;  2OQK A;  3NQI A;  3E0E A;  3U58 A;  1Q3L A;  5AFW A;  1WTH A;  1QVF A;  1CZW A;  1XTD A;  4UP8 A;  2RSO A;  1BBX C;  2LXK A;  3KYH C;  2E2H H;  4P73 A;  3I3C A;  3SHL A;  4TVA B;  4Q5V A;  2EY2 A;  4A3C H;  3MFG A;  2JK8 A;  4A3C G;  1KAA A;  3FVQ A;  3K0X A;  5IWA L;  4WJ3 M;  5CBE E;  1HZ9 A;  2K28 A;  2RDF A;  2YTX A;  3H0G H;  2ZTD A;  1W2B A;  3UDG A;  1GUS A;  1QVC A;  3SVM A;  2FJ2 A;  2K05 A;  3GD7 A;  5EGT A;  2A68 D;  2E75 C;  1RF2 D;  3GTM B;  2KCT A;  2M2L A;  4ME3 A;  2ZTC A;  1B44 D;  1CZG A;  1ENA A;  1LM0 A;  4I7Z C;  5CYU A;  2NVY B;  2EJF C;  2QF7 A;  4DV7 L;  1QCB D;  4G57 A;  3OW2 A;  3C1F A;  1WTP A;  1IBK L;  3H94 A;  2Z6K A;  4LUV A;  3GTK H;  4CDC C;  3SK8 A;  1BBU A;  4KN7 C;  3K57 A;  1LTG D;  1VF7 A;  1HHV A;  4GNX A;  4H44 C;  1NBW A;  4GLV B;  5CR3 A;  3NP8 A;  4DN4 M;  2KEC A;  4A3J H;  2NN6 G;  3HOW G;  1UE6 A;  2WAQ E;  3CQZ B;  3CKI B;  1XPO A;  4YIJ A;  2L55 A;  3MVV A;  3HOZ H;  2MUY A;  4DAY A;  4WFN 3;  4X3U A;  4FF4 A;  3OWF A;  1II3 A;  3Q6S A;  2SNM A;  1VQF A;  1FR3 A;  3WOE A;  1T9H A;  4DPG A;  4DNI A;  3OW7 A;  5FO8 B;  3MXG A;  1FJG L;  4PMB A;  1PH9 A;  3AU7 A;  1K8G A;  4IJH A;  4DXF A;  2H1E A;  3G6J B;  4CJ0 B;  2R93 B;  3MZ5 A;  2RF4 A;  3GTL H;  2A69 D;  3NSW A;  3E0J A;  1H9M A;  3CCV A;  1Z7T A;  3HOY G;  1ET9 A;  3RN5 A;  1KNE A;  1AN8 A;  4HIM A;  3L7Z C;  1ICW A;  2H5X A;  1BDO A;  3LWU A;  1ASY A;  5G3L D;  1JR0 D;  2OT2 A;  3MHB A;  3PUY A;  3S1M B;  2GVA A;  4DR4 L;  1HTP A;  5C3W A;  1EWI A;  1S5F D;  4QMG A;  2ZJR A;  3U9O A;  4JI7 L;  2QDL A;  3DLL A;  1K9M C;  1IYV A;  4WJW A;  3HOX H;  3TP7 A;  1HNW Q;  4GS3 A;  4ZYS A;  3ER0 A;  1YHB A;  2E2H B;  2RQX A;  1SNO A;  1N34 L;  1DXM A;  1T5X D;  1PH4 A;  1E2V A;  4K14 A;  1IYU A;  1XX8 A;  2LMC B;  3BZC A;  3EN2 A;  5ELE A;  1K0R A;  3G4S A;  2E2J B;  3G71 A;  2ATW A;  1X54 A;  1M4V A;  1D1I A;  1ROD A;  5CGK A;  4GKJ Q;  4FYD A;  3H0G B;  2B2W C;  1B50 A;  5C0X I;  4LF4 Q;  4OEM B;  1HNX Q;  4DUY Q;  2I5H A;  3DWA A;  5FKA C;  3IL8 A;  1KAB A;  1PH7 A;  4YY3 Q;  1ESF A;  4G7O C;  4LFB L;  2KCC A;  2DUD A;  4QGU A;  1A63 A;  4MHE A;  3T1H Q;  3A8I E;  4PG3 A;  5FJ8 H;  3D4D A;  4DR7 L;  2HUG A;  3FDT A;  5IYC H;  1GXD C;  2Q2I A;  2K5D A;  2ZT9 C;  4FXD A;  5IYC G;  1PYB A;  2UUC L;  3M4Y A;  1Z9F A;  4TSS A;  4Y7N B;  2B2U C;  2F0W A;  1SJH D;  3HOW B;  4X64 L;  4LFC L;  3QG1 A;  4A3J B;  3MFY A;  3MXU A;  5IP9 G;  3MTS A;  1DJR D;  4ZUI A;  3A7A B;  4PNY A;  4KD3 A;  2RDH A;  3GTQ B;  2CH4 W;  3BU2 A;  1GHJ A;  4RHS A;  3G48 A;  2KJX A;  3O13 A;  4MNO A;  1IW7 D;  1VDZ A;  2EY5 A;  4DV5 Q;  1Y1W H;  4TRD A;  1BO0 A;  3R2I A;  4TQU S;  4X3K A;  3A56 A;  4DV6 L;  4R4O A;  2EE1 A;  1HFG A;  2G9D A;  2B2Y A;  1L2F A;  3RMH A;  5KRU A;  1LTI D;  2MO0 A;  4F7X A;  4X66 Q;  3DEP A;  1HA5 A;  2RCF A;  2LXJ A;  4MN3 A;  1STE A;  4MTK A;  3GTL B;  1PFS A;  4JI5 L;  1JWS D;  1A62 A;  2MJ8 A;  4Z9C B;  3A54 A;  3SXH A;  4R4C A;  3P1H A;  3Q24 A;  3H3V H;  1V1P A;  4C3J G;  2Q8R E;  3L2P A;  1FL0 A;  2I5L X;  1LAC A;  2E74 C;  2F0S A;  2KBN A;  1ET6 A;  3L9A X;  1I4H A;  1PXU A;  2BDN A;  2NVT H;  4B3T Q;  1A2U A;  4K2L A;  3UDF A;  5CV9 A;  2F0U A;  2UXB Q;  1N33 Q;  2NZ1 D;  1SYF A;  2F52 A;  4N8X 1;  1Q1B A;  3S16 B;  4CJ2 C;  3HKZ B;  1GM5 A;  2Y0S E;  2OXP A;  1RIP A;  3WDN A;  1XMQ Q;  4RHR A;  3S1Q B;  1G91 A;  3P75 A;  3BVM A;  1XTC D;  4YCU A;  1X3F A;  2QIL A;  3A7L A;  4LF5 L;  5C4X H;  1Y1V H;  2QA4 A;  1FYC A;  1K0S A;  3SR1 A;  2C5C A;  3P20 A;  1N8R C;  4DV2 Q;  4LUO A;  1J9O A;  4GOP C;  1XNR L;  1YNN C;  5H1S E;  3EFX D;  2HCC A;  4X62 Q;  2Z8L A;  2Q8T A;  2F0D A;  1STA A;  2UXC L;  3CHB D;  2RBM A;  5EJW A;  2L0C A;  4RH6 A;  3AMU A;  5BR8 Q;  3SE0 A;  1E2Z A;  2D0P A;  2FIN B;  1G6Z A;  5JPN C;  1C48 A;  3CPF A;  1JJ2 A;  4BY7 H;  1PRT B;  4YWM A;  3CD6 A;  1CK1 A;  5KGU A;  4BY7 G;  2PO4 A;  2Q2H A;  2XWB B;  5C4J H;  4NW2 A;  2G9H D;  1X3P A;  1O7Y A;  2XSC A;  1B3A A;  3STB C;  3I56 A;  2B63 G;  1WD0 A;  1NJI C;  5K5P A;  1EYG A;  1VQ5 A;  1B8A A;  3CRK C;  1RL2 A;  1ICF B;  1PZK D;  3DMU A;  1MJE A;  2UU9 L;  3I4M G;  1EYC A;  5E3F A;  4IFD I;  1KLG D;  4KV6 A;  3PO2 G;  4OEL B;  4DK0 A;  1XJV A;  1N32 Q;  4C3H G;  3QR8 A;  2KQ3 A;  4E6I A;  5GAD C;  2B29 A;  2VZA A;  2F0P A;  5FK9 C;  2VQF L;  2D5D A;  3NHH A;  3IAY A;  1F9S A;  3BS1 A;  4C3J B;  1LT6 D;  3QO2 A;  2EY1 A;  4KJO A;  4ZKB B;  3SK4 A;  2VB3 X;  4HED A;  4DR2 L;  5ELN A;  1CQF A;  2PCF B;  4GKK L;  2EYF A;  3KF8 A;  4KN4 C;  3BDO A;  1LAB A;  3W1B A;  4ID6 A;  5KNB A;  2OTJ A;  2WAQ G;  2F1M A;  4QIW B;  1PTO C;  2JA8 H;  2Q2T A;  3N52 A;  2VW9 A;  4CGY B;  4HJA A;  2L9H A;  1PH8 A;  1VQ4 A;  4OXP A;  5ELC A;  1IW7 C;  3GTG H;  3NUC A;  4IN3 A;  4A76 A;  2R7Z H;  3R2T A;  2R7D A;  1EY0 A;  5I2X A;  5HY6 A;  1F2M A;  4L5R C;  4A3L G;  2VUM G;  2EXD A;  1G51 A;  1CSP A;  2R92 G;  4JW0 A;  1Y69 U;  2XIW A;  5ELF A;  3M7G A;  4A75 A;  2KA7 A;  2KCM A;  4OWT B;  4HJ9 A;  3HRZ C;  1BCP D;  1LTT D;  3F2C A;  3I90 A;  3M4Q A;  1IBM Q;  3D4W A;  3KJP A;  1O80 A;  1O7Z A;  1VMC A;  4BY1 G;  1WTR A;  1JJG A;  4KHP L;  1HTL D;  1CSQ A;  1D2B A;  1E1T A;  2A6E C;  3U4V A;  1RCV D;  3VYS A;  1HR0 Q;  2L4N A;  2D0O A;  4DV3 Q;  2A74 C;  4GNX B;  1ASZ A;  3L0O A;  2HT1 A;  2NBF A;  2FMM A;  5EKI A;  4ODG A;  1DD2 A;  4OO1 I;  2AUK A;  5IGC A;  4B3R L;  1PH2 A;  1SYD A;  5C44 H;  4A3K H;  2HHH L;  4HR7 B;  1I94 Q;  4DXG A;  3FP9 A;  4PQX A;  2MP1 A;  1TS2 A;  1NSN S;  4DAY B;  4P2C B;  2UXD Q;  4BY7 B;  2F0V A;  1YEZ A;  4X3T A;  4XT3 B;  3J81 L;  3MA2 B;  2QDB A;  3LWE A;  5IOC A;  4K8J A;  1VF5 C;  1VQ9 A;  3T16 A;  3I91 A;  1PFM A;  2OCE A;  4B3S Q;  4FVM A;  1VQ6 A;  4BBS H;  1A3T A;  2GA4 B;  1B7Y B;  3VA7 A;  2PI2 A;  3J80 L;  1PDQ A;  4BBS G;  3I4M B;  3K5N A;  1J8I A;  1KNA A;  3PO2 B;  4JV5 Q;  3U4Z A;  1P16 A;  4DR6 L;  3S2D H;  1PV4 A;  4OO1 H;  4WRD A;  3W2D A;  1W3S A;  1BKB A;  4QUF A;  4CKE A;  3GP7 A;  3D8G A;  1K8M A;  5DAU A;  5C5L A;  3M3Y H;  2K4K A;  4HMI A;  1JQY D;  5JJK A;  2JA7 H;  3I4O A;  2WAQ B;  3CCE A;  4A3M H;  4L6T B;  1HA6 A;  4BXX G;  4YCW A;  2XRS D;  3RLN A;  3HOU G;  1BXT A;  4ZK9 B;  5J3B A;  4DV1 Q;  5BN5 A;  4AYB E;  5DM7 3;  1KC8 C;  2A5H A;  5DEH A;  4KY7 A;  4BWG B;  2R7Z B;  1VQL A;  4JI3 Q;  2VUM B;  1EEF D;  2C9O A;  5IGG A;  2R92 B;  2JP1 A;  1SDF A;  4PMC A;  5D3I B;  5IYB G;  3OWE B;  5FLX L;  2QKI C;  1VQM A;  2PPB C;  4A3I G;  1TR5 A;  2WFW A;  2QEX A;  2WB1 E;  1OXS C;  1QG7 A;  3NWT A;  3OMG A;  1EYD A;  1VQO A;  2UUB L;  1JE4 A;  1N9W A;  3VR5 A;  1K73 C;  1CA6 A;  1HNZ Q;  1XXG A;  3CAM A;  3DM1 A;  1LTL A;  1LTS D;  4RGO S;  4EQ5 A;  4LK1 C;  4C2M H;  3SK6 A;  2DJG C;  2CW0 C;  1WTX A;  4LF8 L;  4A3G H;  5HUR A;  1AEX A;  3T56 B;  5L37 A;  4A3G G;  4A3K B;  1J5E Q;  2Y0S G;  2R7F A;  1ZXT A;  3C2P A;  3PO3 H;  4L63 B;  4IJL A;  1JCK B;  1E7Z A;  4IUU A;  3J81 E;  2EPB A;  1I4R A;  1RHP A;  4JC0 A;  5EPL A;  4BBS B;  2LKV A;  4BS9 A;  4B3M L;  1SND A;  3I8Z A;  4JI1 L;  1B53 A;  2BCO A;  3CME A;  5FO7 B;  2RSN A;  3PUX A;  3J80 E;  1WYD A;  2EYO A;  1HJP A;  2B3G A;  3EBE A;  3TEH B;  1B70 B;  4R8I A;  1EY8 A;  1V1P B;  3DUZ A;  4IOC A;  1U9R A;  5IGF A;  1JWU D;  2O4X A;  3M3Y B;  4R4I A;  4HSP A;  4K0K Q;  2DNC A;  5GAH C;  4NXN L;  2JXM B;  4JI2 Q; 
#chains in the Genus database with same CATH homology
 3BDC A;  4A3M B;  1E0B A;  1ENC A;  2R6G A;  3BDL A;  1AZQ A;  1AFP A;  4CJ1 B;  3FRP B;  5EPK A;  4XDX A;  1UNS A;  2ID0 A;  5T1G A;  4O42 A;  1VMP A;  4A3I B;  5EPJ A;  1S4Z A;  3R3O A;  2B2T A;  5FLX E;  3MWY W;  2B39 A;  4K5W A;  5IIF A;  2B8F A;  1AW7 A;  1BUV T;  4LJZ C;  3MEH A;  4C1N I;  1EWC A;  1HQM C;  4NP5 A;  3TZD A;  1X32 A;  4C2M B;  2IL8 A;  4DNR B;  3I72 A;  4CKB A;  4A3G B;  3VR3 A;  3RZD B;  1I6H B;  2F0G A;  2HCI A;  2Y0S B;  4IQZ A;  3ITP A;  1GHK A;  5A2Q L;  2F0F A;  5I6W A;  1YNJ C;  1B1Z A;  4OL7 A;  1FD7 D;  1EY4 A;  1Q8I A;  1LTA D;  1QIL A;  2Z1C A;  2M9V A;  3S1N B;  3K5M A;  4RCO A;  5IGE A;  1TQO A;  1PTO F;  1DOK A;  2NB0 A;  3V05 A;  1I4P A;  1EFI D;  1MSH A;  1IKL A;  1W6K A;  1GUO A;  4ZAI A;  2F3W A;  5M3M B;  1IL8 A;  2L5T A;  4CHT B;  3NE5 B;  5I4D A;  2PQE A;  1CFM A;  3TME A;  1WCM B;  5EKL A;  2RDG A;  5J22 A;  1GJX A;  4M1U B;  4NMZ A;  5DM6 3;  2YYZ A;  1YNN D;  3DXJ C;  1DOM A;  3P7J A;  5KYI A;  1SE3 A;  4A3E B;  1LV9 A;  2IPK D;  5KNC A;  1EIH A;  1H9J A;  4B08 A;  1HPC A;  4B9W A;  2HDL A;  4XQQ A;  3RUZ A;  3NTI A;  1SE2 A;  3GTJ B;  3TSS A;  3K6O A;  1DCZ A;  5JVH 3;  2KOL A;  1V1O A;  5C5M A;  1BNZ A;  1ONL A;  4XTC S;  4IFD J;  3IFD A;  3K58 A;  2E2D C;  3NTH A;  5A2Q E;  2R61 A;  4G4K A;  4RKB A;  3T51 B;  3KLS A;  3NBI A;  5C3X A;  1OXU A;  4N9T A;  1NCV A;  1HRJ A;  3OIQ A;  2EVB A;  1GUW A;  3PIP 3;  1TWH B;  3X3M A;  1CTM A;  3GTK B;  1SAP A;  4RA8 A;  5I9P A;  1TKW B;  3KBX A;  4N9P A;  4KKU A;  3UI2 A;  2F0L A;  1A2T A;  1PTO D;  5LL6 X;  5E4W C;  5C0X H;  5K36 H;  3HOZ B;  2XNA C;  3V2T A;  2XRQ D;  2B2Y C;  2F0O A;  1A15 A;  1D5Z C;  1IKM A;  1MD2 D;  1XYI A;  5CMD A;  2YU9 B;  1ZKO A;  1RJT A;  2ICE C;  3NBH A;  1I4Q A;  1H9S A;  1EEI D;  2B2U A;  3A8K E;  2IJ0 A;  2EDG A;  2K6A A;  1WTQ A;  1FNW A;  4DF7 A;  1SYE A;  2IX3 A;  1BOS A;  4Q0F A;  2A6E D;  1TS3 A;  5IGB A;  5F2D A;  4AYB B;  3VA5 A;  3HOX B;  4M8A A;  4JBW A;  5JAV A;  3OPO A;  5COY A;  1BCP F;  4RCN A;  2L1B A;  3ND9 A;  1UAP A;  3TP8 A;  4XXE A;  1SNM A;  1OO9 B;  4G7H C;  1SMY C;  1SEB D;  5FO9 B;  2WB1 B;  3A55 A;  2F0H A;  4K2K A;  3SEB A;  1HQR D;  3F2U A;  1S5D D;  3AB9 A;  2V4D A;  5ELB A;  3NQT A;  4QUC A;  4ULL A;  2Q8I B;  4FF2 A;  4RAU C;  1KLU D;  2OF1 A;  1IHZ A;  2WII B;  2AWO A;  3HEJ A;  1KTK A;  2LFN A;  1ILQ A;  4XQJ A;  4RGN A;  3D3R A;  4OHJ A;  5JEA J;  1JOR A;  1PZI D;  2K33 A;  4A3F B;  2F0J A;  3OSO A;  3C3L A;  2WKC A;  1MBY A;  3LNN A;  3KUP A;  2WP8 J;  2D2C C;  5KYL A;  1Y1W B;  2WV6 D;  1RD9 D;  2AWN A;  2ZXO A;  5C3E B;  2AQ2 B;  2TMP A;  3OIP A;  4KY6 A;  1SJE D;  3BVG A;  4J1M A;  5KIX A;  3H91 A;  1LTR D;  2K03 A;  2EJM A;  2OEO A;  4HCE A;  1TY2 A;  1LT5 D;  2K5W A;  3I70 A;  2I07 B;  1ML0 D;  1EZ8 A;  2NWG A;  1SYB A;  4F8M A;  3T53 B;  4KHV A;  2NVT B;  1L0X B;  2CW0 D;  3VR4 A;  4IFD H;  2H4O A;  1Y8N B;  4HAE A;  4HMJ A;  1TT2 A;  2XVS A;  4DNT B;  5FOB B;  3TP6 A;  1PMR A;  3Q0A A;  1F2L A;  3VR6 A;  2D62 A;  3NPP A;  5C4X B;  1Y1V B;  2PW7 A;  1QE6 A;  4K6L A;  2DNE A;  1O7L A;  5CV8 A;  2FFK B;  3SK5 A;  5JOB A;  3NK9 A;  2NYZ D;  3OOC A;  2SOB A;  1BR9 A;  1LLR D;  3FKI B;  2HQE A;  1ENF A;  2CHB D;  2NUC A;  4H13 C;  5J39 A;  4V0B A;  4K8I A;  5CV4 A;  4XYQ A;  2A73 B;  1KDA A;  1ESR A;  2WAC A;  4QF4 A;  1CI3 M;  4R9W A;  5C4J B;  4BA2 I;  2A6H C;  1AP0 A;  4H0L C;  1STN A;  4PMW A;  1CM9 A;  3PUW A;  1CA5 A;  3BYT B;  1H9R A;  4FXK C;  1RKN A;  1SXT A;  1Q12 A;  1F9R A;  4IAL A;  3NTK A;  3DWP A;  4OO1 G;  1OXX K;  3GO5 A;  2MGS A;  2HDM A;  4FO2 A;  3QWN A;  5CV7 A;  2XN9 C;  4WOR A;  4V19 0;  3PUV A;  2JA8 B;  4S3S A;  2EYJ A;  3WOF A;  5ISR A;  1C8C A;  2FHT A;  4KHZ A;  2EY6 A;  1NAP A;  1U4R A;  1QB5 D;  2VB2 X;  3GTG B;  3TZU A;  3A8J E;  1YNJ D;  4A3B B;  2K7V A;  1O78 A;  5I6Y A;  1I6V C;  1UEA B;  1QNU A;  4KJN A;  4BBR B;  1EY6 A;  3S1R B;  2F0K A;  2IWH A;  4X3S A;  4C56 C;  1EU4 A;  1STH A;  2F3V A;  3DHQ A;  3ND8 A;  2NVQ B;  5JEA H;  1Q90 A;  3MAQ A;  3M85 A;  2EZV A;  3D31 A;  5JEA G;  1SE4 A;  4DGZ A;  1STG A;  1EU3 A;  3LX0 A;  1B9M A;  5C44 B;  1EWH A;  5E1F A;  1SYC A;  5TSS A;  1AZP A;  2BE5 C;  3HGB A;  5M5X B;  2O5I C;  2D9U A;  1ZEQ X;  4IUN A;  3FMC A;  3JAM L;  1HCZ A;  1H9S B;  2F0E A;  1KDC A;  2J4X A;  3C46 A;  3S2D B;  3R8B A;  5BN3 A;  4FF1 A;  3D6W A;  2PNR C;  5D14 A;  1G2S A;  1TS5 A;  4HTH A;  3QIA A;  5COR A;  4C3I B;  1DZ1 A;  3BG3 A;  4DA2 A;  1M8A A;  5C4Z A;  3MXP A;  3S2H B;  3V96 A;  1PRT C;  2IX0 A;  1K8O A;  1HUN A;  4K5V A;  5LL6 S;  2WKD A;  4HN7 A;  3I4N B;  1PLF A;  4EQO A;  1BQQ T;  2WIN B;  1BF4 A;  5C0X J;  3EVQ A;  4EQP A;  2JA7 B;  1JOQ A;  3CRL C;  3E5S A;  5KEE A;  4KTA A;  4KY5 A;  2RKS A;  2B2T C;  4CBV A;  1F2Z A;  1EYA A;  1PTO H;  4ME5 A;  2B2V A;  1GUN A;  1DON A;  3FEW X;  1MI2 A;  3KK7 A;  1V43 A;  3H3V C;  2PYK A;  3EJI A;  2EYH A;  2JA5 B;  2N88 A;  3EA6 A;  1F77 A;  3J7A V;  4OGQ C;  1HFN A;  3GTP B;  4FXG C;  3U9S A;  3PO3 B;  1JC7 A;  2K1B A;  1B2T A;  3SDZ A;  2DY7 A;  5EQ0 A;  4UDU C;  2RVL A;  3R93 A;  4RGM A;  1HUM A;  4F88 A;  4KI0 A;  2BA0 A;  3HZX A;  3TBI B;  3JAM E;  5IOD A;  1UUP A;  4KKS A;  2NN6 I;  2KHS A;  5T1I A;  4DFA A;  1A6X A;  1G29 1;  4XIG S;  2AUJ D;  1SFO B;  2Z4I A;  4DK1 A;  1R4Q B;  3L3O C;  3Q22 A;  1FGB D;  1TWC B;  2ZXR A;  5J1Z A;  2NN6 H;  1R4P B;  4B9X A;  1L0Y B;  1SMY D;  5M3F B;  4GZY C;  1PTO B;  2KED A;  2XWJ B;  1WTV A;  1U4M A;  5EKK A;  4FNF A;  4ABN A;  4HSV A;  5D65 A;  2NVX B;  5C4H A;  1QNK A;  3TDQ A;  1MSG A;  1OXT A;  4ZLT F;  1X3Q A;  5BN4 A;  1ZYR C;  3PMF A;  3VYT A;  2QEJ C;  2M00 A;  1D5M C;  1FNU A;  3ZYY X;  4J8Q A;  3T4A C;  3K0Y A;  2JEB I;  2O5J C;  4A93 B;  3H6M A;  3D6C A;  1NR4 A;  3T13 A;  2JSO A;  1GUT A;  5M5W B;  3VYR A;  1SNP A;  4LMQ D;  4U68 A;  5EBD A;  2ENB A;  1EZ6 A;  2AQ1 B;  3I4L A;  3TP5 A;  1EQV A;  2PMZ B;  5JJZ A;  2F03 A;  1JIC A;  3OMC A;  2KCN A;  3K59 A;  3URY A;  3TN2 A;  3CU7 A;  1F2Y A;  4I65 A;  2X6L A;  2EYM A;  2B2W A;  1MGS A;  1TWG B;  1F9P A;  3M4O B;  4IUT A;  4DAP A;  5C0X G;  2AQ3 B;  3PIO 3;  5K36 G;  5CV6 A;  3K5L A;  1D5X C;  5E4X A;  3ONA B;  1QWY A;  4FP5 D;  3Q23 A;  5JVG 3;  1S5C D;  2DY8 A;  3M7N A;  3FPP A;  1XWE A;  2A68 C;  3BZD B;  3S15 B;  4TKO B;  3QB3 A;  2EYP A;  3HOY B;  1WTW A;  1H9K A;  4FF3 A;  3PV0 A;  4IUP A;  2F0I A;  2F0T A;  3D4R A;  2K5Q A;  1RTN A;  1B4O A;  4ILW A;  3N6R A;  3VYU A;  3GQB A;  3IFT A;  2A6H D;  1CQV A;  1GUG A;  2ZXP A;  3KBG A;  2E2I B;  1C4Q A;  1Y8O B;  1EQT A;  2VXW A;  1PRT F;  1G8Z D;  1DOL A;  3RD4 A;  1LT3 D;  3BYY B;  3OHX C;  2A69 C;  3K5O A;  1TS4 A;  3NWS A;  2LY7 A;  1BCP B;  3HG9 A;  4JK1 C;  2Z4H A;  3GV3 A;  4XYO A;  5JPM C;  2NTT A;  3HP3 A;  1S5E D;  4XQN A;  1E2W A;  1PZJ D;  3W3A A;  3IKJ A;  2K04 A;  4L8J A;  2IX1 A;  5ELD A;  3S14 B;  2FMC A;  3C1E A;  3NXW A;  3KLS X;  2BOS A;  2MPM A;  4PV1 C;  4U67 3;  1PYW D;  2VNU D;  2EOT A;  1TU2 B;  2QCP X;  1D1K A;  4O1N A;  1I50 B;  2L12 A;  5CC4 A;  3QJY A;  2PZT A;  3K7A B;  3PUZ A;  4DAV A;  1EL0 A;  2I46 A;  1SNQ A;  3ERO A;  4QB4 A;  4IFD G;  1Z47 A;  2BE5 D;  4IZ8 A;  1JB3 A;  1RDP D;  5IT9 L;  4UAI A;  2O2L D;  5NUC A;  1LO5 D;  3RLF A;  4XT1 B;  1TVX A;  1DYQ A;  1SSO A;  1Q1E A;  3J7A F;  4LAA A;  4HCS A;  1ILP A;  2BDO A;  3H09 A;  3GTO B;  1TII D;  4NDX A;  4BA1 I;  1HXY D;  5KND A;  1STY A;  1PRT D;  4KK7 A;  2SDF A;  4ZQ3 A;  2EXZ A;  4OIK A;  4IUR A;  1JWM D;  1TWF B;  3S17 B;  2JEA I;  1T5E A;  2F0Q A;  1VCI A;  1QOH A;  1V8Q A;  2X69 A;  2K32 A;  2R3Z A;  3X3N A;  3MXN A;  2B8G A;  2F4I A;  3MC0 B;  1LT4 D;  2KUM A;  4EQN A;  4ZUJ A;  2CVR A;  2B63 B;  2SNS A;  1KDB A;  4J6H A;  3GV6 A;  4C3I G;  1K83 B;  3VR2 A;  1SYG A;  5IGD A;  4C3H B;  4F87 A;  1PFN A;  1CHP D;  1W6J A;  1GOZ A;  4ZKC B;  3ERQ A;  4EVO A;  3G7L A;  2ICI A;  1B9N A;  3HS0 C;  1R9T B;  4IUV A;  5IT9 E;  2LS0 1;  3EQL C;  1F9Q A;  1I4G A;  1NUC A;  1LTB D;  2PZU A;  2NTS A;  3QOJ A;  1PFB A;  2IW3 A;  5I9O A;  5I2Y A;  1WD1 A;  1TY0 A;  1EOT A;  4BY1 B;  2EJG C;  1JOO A;  4ZRZ A;  2F0M A;  3HOV B;  4IUQ A;  3KLR A;  4NKL A;  3QOL A;  3DWQ A;  4RWS C;  2F0N A;  1Y8P B;  4CKC A;  1I4X A;  2MHV A;  1DM0 B;  2X6G A;  1NR2 A;  5CBA E;  1FNV A;  2KVM A;  4R8N A;  3S9W A;  2TSS A;  2PW5 A;  1WTO A;  4RGT A;  5A35 A;  4KMU C;  3J7Y W;  1JOK A;  5DNF A;  5M9O A;  2DN8 A;  2JYO A;  4EGV A;  1BCP C;  1WVL A;  5EBC A;  1OXV A;  3RZO B;  1U4P A;  4KKT A;  1SNC A;  1EY5 A;  5HGT A;  1ZYR D;  2JA6 B;  1EY9 A;  1SBB B;  2E76 C;  1D6E C;  3DEO A;  2KEE A;  2PZW A;  4MIU A;  2CQA A;  1A3U A;  4RKL A;  2B2V C;  4QCL A;  3HOU B;  2IT1 A;  4A3D B;  5C6A A;  4G7Z C;  3E6Z X;  2K01 A;  4KD4 A;  4DU9 A;  4RFB A;  3BVZ A;  1RTO A;  2J7Z A;  3FPU B;  1I3Q B;  4K5X A;  5LHY 1;  1A3V A;  2JE6 I;  3I73 A;  5G3L F;  1S5B D;  2SEB D;  5D3D A;  1G2T A;  4C1N K;  5CV5 A;  4K6D A;  1EY7 A;  2EYL A;  4H7B A;  1CT1 D;  1Z6H A;  1STB A;  1CHQ D;  5M5Y B;  2RA4 A;  1U4L A;  2BA1 A;  2N55 A;  2J0T D;  4OIJ A;  1TWA B;  1QJO A;  1EIG A;  2L11 A;  3NQI A;  1Q3L A;  5AFW A;  1CZW A;  2RSO A;  1BBX C;  3I3C A;  3SHL A;  4Q5V A;  2EY2 A;  3MFG A;  1KAA A;  3FVQ A;  5CBE E;  2K28 A;  2RDF A;  1GUS A;  3SVM A;  2FJ2 A;  2K05 A;  3GD7 A;  5EGT A;  2A68 D;  2E75 C;  1RF2 D;  3GTM B;  2M2L A;  1B44 D;  1CZG A;  1ENA A;  4I7Z C;  5CYU A;  2NVY B;  2EJF C;  2QF7 A;  1QCB D;  4G57 A;  3C1F A;  1WTP A;  3H94 A;  3SK8 A;  4KN7 C;  3K57 A;  1LTG D;  1VF7 A;  1HHV A;  4H44 C;  5CR3 A;  3NP8 A;  4DN4 M;  2KEC A;  2NN6 G;  3CQZ B;  3CKI B;  4YIJ A;  2L55 A;  3MVV A;  2MUY A;  4DAY A;  4WFN 3;  4X3U A;  4FF4 A;  3OWF A;  1II3 A;  3Q6S A;  2SNM A;  1FR3 A;  3WOE A;  3OW7 A;  5FO8 B;  3MXG A;  4PMB A;  3AU7 A;  4DXF A;  2H1E A;  3G6J B;  4CJ0 B;  2R93 B;  3MZ5 A;  2A69 D;  3NSW A;  3E0J A;  1H9M A;  1Z7T A;  1ET9 A;  1KNE A;  1AN8 A;  3L7Z C;  1ICW A;  3LWU A;  1BDO A;  5G3L D;  1JR0 D;  2OT2 A;  3MHB A;  3PUY A;  3S1M B;  1HTP A;  5C3W A;  1S5F D;  4QMG A;  3U9O A;  1IYV A;  4WJW A;  3TP7 A;  4ZYS A;  2E2H B;  2RQX A;  1SNO A;  1DXM A;  1T5X D;  1E2V A;  4K14 A;  1IYU A;  1XX8 A;  2LMC B;  5ELE A;  2E2J B;  1M4V A;  1D1I A;  1ROD A;  5CGK A;  4FYD A;  3H0G B;  2B2W C;  1B50 A;  5C0X I;  3DWA A;  5FKA C;  3IL8 A;  1KAB A;  1ESF A;  4G7O C;  2KCC A;  4MHE A;  3A8I E;  3D4D A;  2HUG A;  3FDT A;  1GXD C;  2K5D A;  2ZT9 C;  4FXD A;  3M4Y A;  4TSS A;  4Y7N B;  2B2U C;  2F0W A;  1SJH D;  3HOW B;  3QG1 A;  4A3J B;  3MFY A;  3MXU A;  3MTS A;  1DJR D;  4ZUI A;  3A7A B;  4PNY A;  4KD3 A;  2RDH A;  3GTQ B;  1GHJ A;  4RHS A;  2KJX A;  3O13 A;  1IW7 D;  1VDZ A;  2EY5 A;  4TRD A;  1BO0 A;  3R2I A;  4TQU S;  4X3K A;  3A56 A;  2EE1 A;  1HFG A;  2G9D A;  2B2Y A;  3RMH A;  5KRU A;  1LTI D;  4F7X A;  1HA5 A;  3DEP A;  4MN3 A;  1STE A;  3GTL B;  1JWS D;  2MJ8 A;  4Z9C B;  3A54 A;  3SXH A;  3P1H A;  3Q24 A;  1V1P A;  4C3J G;  2Q8R E;  1LAC A;  2E74 C;  2F0S A;  1ET6 A;  3L9A X;  1I4H A;  1PXU A;  2BDN A;  1A2U A;  4K2L A;  5CV9 A;  2F0U A;  2NZ1 D;  1SYF A;  1Q1B A;  3S16 B;  4CJ2 C;  3HKZ B;  2OXP A;  3WDN A;  4RHR A;  3S1Q B;  1G91 A;  3P75 A;  3BVM A;  1XTC D;  2QIL A;  3A7L A;  1FYC A;  3SR1 A;  2C5C A;  3P20 A;  1J9O A;  1YNN C;  3EFX D;  2HCC A;  2Z8L A;  2F0D A;  1STA A;  3CHB D;  2RBM A;  5EJW A;  2L0C A;  4RH6 A;  3AMU A;  3SE0 A;  1E2Z A;  2FIN B;  1G6Z A;  5JPN C;  1C48 A;  1PRT B;  1CK1 A;  5KGU A;  2PO4 A;  2XWB B;  4NW2 A;  2G9H D;  1X3P A;  1O7Y A;  2XSC A;  1B3A A;  1WD0 A;  5K5P A;  3CRK C;  3DMU A;  1PZK D;  1EYC A;  5E3F A;  4IFD I;  1KLG D;  4KV6 A;  4DK0 A;  4C3H G;  4E6I A;  2KQ3 A;  5FK9 C;  2F0P A;  2D5D A;  3NHH A;  3IAY A;  1F9S A;  3BS1 A;  4C3J B;  1LT6 D;  3QO2 A;  2EY1 A;  4KJO A;  4ZKB B;  3SK4 A;  2VB3 X;  4HED A;  1CQF A;  2PCF B;  2EYF A;  3KF8 A;  4KN4 C;  3BDO A;  1LAB A;  4ID6 A;  5KNB A;  2F1M A;  4QIW B;  1PTO C;  3N52 A;  4CGY B;  2L9H A;  5ELC A;  1IW7 C;  3NUC A;  4IN3 A;  3R2T A;  1EY0 A;  5I2X A;  1F2M A;  1Y69 U;  2XIW A;  5ELF A;  3M7G A;  2KA7 A;  3HRZ C;  1BCP D;  1LTT D;  3I90 A;  3D4W A;  1O80 A;  1O7Z A;  1VMC A;  1WTR A;  1HTL D;  1D2B A;  2A6E C;  1RCV D;  3VYS A;  2L4N A;  2A74 C;  2NBF A;  2FMM A;  5EKI A;  4ODG A;  1DD2 A;  4OO1 I;  2AUK A;  5IGC A;  1SYD A;  4HR7 B;  4DXG A;  4PQX A;  2MP1 A;  1TS2 A;  1NSN S;  4P2C B;  4BY7 B;  2F0V A;  4XT3 B;  4X3T A;  3J81 L;  3MA2 B;  2QDB A;  3LWE A;  5IOC A;  4K8J A;  1VF5 C;  3T16 A;  3I91 A;  1PFM A;  4FVM A;  1A3T A;  2GA4 B;  3VA7 A;  3J80 L;  1PDQ A;  3I4M B;  3K5N A;  1J8I A;  1KNA A;  3PO2 B;  4OO1 H;  4WRD A;  3W2D A;  4QUF A;  4CKE A;  3GP7 A;  3D8G A;  1K8M A;  5DAU A;  5C5L A;  4HMI A;  1JQY D;  2WAQ B;  4L6T B;  1HA6 A;  2XRS D;  1BXT A;  4ZK9 B;  5BN5 A;  5DM7 3;  2A5H A;  5DEH A;  4KY7 A;  4BWG B;  2R7Z B;  2VUM B;  1EEF D;  2C9O A;  5IGG A;  2R92 B;  2JP1 A;  1SDF A;  4PMC A;  5D3I B;  3OWE B;  5FLX L;  2QKI C;  2PPB C;  1TR5 A;  1OXS C;  1QG7 A;  3NWT A;  3OMG A;  1EYD A;  1JE4 A;  3VR5 A;  1CA6 A;  1XXG A;  3DM1 A;  1LTS D;  4RGO S;  4LK1 C;  3SK6 A;  2CW0 C;  1WTX A;  5HUR A;  1AEX A;  3T56 B;  4A3K B;  3C2P A;  1ZXT A;  4L63 B;  1JCK B;  4IUU A;  3J81 E;  2EPB A;  1I4R A;  1RHP A;  5EPL A;  4BBS B;  2LKV A;  4BS9 A;  1SND A;  3I8Z A;  1B53 A;  2BCO A;  5FO7 B;  2RSN A;  3PUX A;  3J80 E;  2EYO A;  4R8I A;  1EY8 A;  1V1P B;  3DUZ A;  1U9R A;  5IGF A;  1JWU D;  2O4X A;  3M3Y B;  4HSP A;  2DNC A;  2JXM B;  2Q8T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...