2B2YA

Tandem chromodomains of human chd1
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
176
structure length
175
Chain Sequence
EFETIERFMDCRIGRKGATGATTTIYAVEADGDPNAGFENKEPGEIQYLIKWKGWSHIHNTWETEETLKQQNVRGMKKLDNYKKKDQETKRWLKNASPEDVEYYNCQQELTDDLHKQYQIVGRIIAHSNQKSAAGYPDYYCKWQGLPYSECSWEDGALISKKFQACIDEYFSRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromodomain-helicase-DNA-binding protein 1
publication title Double chromodomains cooperate to recognize the methylated histone H3 tail.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
total genus 53
structure length 175
sequence length 176
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2005-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2b2yA02
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2b2yA01
1DOMA 3LWEA 4NW2A 3HP3A 4HSVA 5CORA 2HDLA 2B2VA 3FDTA 3F2UA 4CJ0B 1NAPA 2L12A 3Q6SA 4UAIA 1B4OA 2RSOA 2X6GA 1ESRA 2MP1A 2K28A 2HCIA 1AZPA 1PFMA 1KNAA 2EE1A 2L4NA 1O80A 1O7YA 1SSOA 4HEDA 1MI2A 2N88A 2B2WA 1IL8A 1DZ1A 1ICWA 1LV9A 1Q3LA 5COYA 5EPLA 3I3CA 2FJ2A 4QUCA 1HUMA 5EPKA 3SVMA 5AFWA 1NCVA 4QUFA 2KECA 2NYZD 4IUTA 2B2UC 1U4RA 1J8IA 4LMQD 1EIHA 4X3SA 1B53A 1KNEA 1PFBA 1HHVA 1BBXC 1G91A 5EPJA 4R9WA 2B2VC 1IKLA 4ZKBB 1MSHA 1F9RA 3H91A 1DOKA 1RODA 1EQTA 4CJ1B 1X3QA 3P7JA 2MJ8A 1VMPA 4HAEA 2KEDA 2EOTA 1U4PA 5D14A 3GV3A 1HUNA 2B2WC 4R8IA 2B2TA 1X32A 1HRJA 1M8AA 4OIJA 1F9SA 3FPUB 1QE6A 3G7LA 4O42A 2KVMA 1TVXA 1XX8A 2L1BA 2L11A 4RAUC 1G6ZA 2HCCA 3I91A 1VMCA 2HUGA 3N52A 4RA8A 2BDNA 4HCSA 1DOLA 2RA4A 4X3TA 1MGSA 5E4WC 1RJTA 2NWGA 2FFKB 1WD0A 4ZAIA 4DN4M 4CJ2C 3MWYW 1SDFA 1RTOA 1SAPA 1WTVA 1CA6A 2KOLA 5CBEE 1NR4A 4IURA 1EL0A 4IUVA 2KUMA 1ILQA 4RWSC 1CA5A 3TN2A 1C8CA 2B2TC 3KBXA 2JP1A 4IUQA 4IUUA 1WTQA 2EPBA 2HDMA 2K01A 2X69A 1G2TA 1XYIA 1J9OA 3ONAB 1BF4A 3KUPA 1ZXTA 2NZ1D 4IUPA 1AZQA 1BNZA 1NR2A 1F9QA 4XT1B 2JYOA 2RVLA 1A15A 4XT3B 1WTPA 5JJZA 1B3AA 1ILPA 3QO2A 5EJWA 3I90A 1HFNA 1S4ZA 3DM1A 3R93A 1WTRA 1PLFA 1WD1A 1HA6A 2B2YA 2M2LA 2CVRA 2DY7A 2MPMA 2X6LA 4XDXA 1ML0D 1B2TA 2D9UA 1IKMA 2R3ZA 5D65A 1DONA 4U68A 1WTWA 2J7ZA 1F2LA 4ZK9B 1O7ZA 2KEEA 1QG7A 4MHEA 1E0BA 1BO0A 2H1EA 2K1BA 2Q8RE 3DEPA 1PFNA 3IFDA 5E4XA 4ZKCB 1JE4A 2MGSA 2SDFA 1X3PA 1EIGA 5DNFA 3IL8A 5T1GA 2XIWA 4ZLTF 3D6WA 1HFGA 2VXWA 5T1IA 5CBAE 5CMDA 3UI2A 1PDQA 1RHPA 2B2YC 1B50A 2K05A 2IL8A 3I8ZA 2L9HA 4MN3A 1MSGA 2N55A 4OIKA 2RSNA 3GV6A 1F9PA 1G2SA 1EOTA 1U4LA 4X3KA 1U4MA 2K03A 3TZDA 2K04A 1WTOA 1WVLA 3DEOA 2Q8TA 1WTXA 1AP0A 2FINB 1QNKA 3MTSA 1GUWA 1CM9A 5EKIA 5EQ0A 2DY8A 1RTNA 2B2UA 4X3UA 2FMMA 2FHTA 1JICA
chains in the Genus database with same CATH superfamily
1NTGA 4A3GG 1CHQD 2X6GA 3V05A 2R93G 1P8LA 1KHIA 4DR2L 2L4NA 1O7YA 4C3IB 5IGGA 1SE8A 3GTOB 1AFPA 4J6HA 4DV7Q 1VQCA 1GUOA 1STEA 1BCPF 2EXDA 3NSWA 1VS0A 2F0OA 2M9VA 3NK9A 5EAYA 1Q7YC 3X3MA 4GOPC 1VMPA 2ZJQA 3SGIA 1UNSA 2E8GA 3F8TA 3NTIA 1XNQL 2OT2A 4ILWA 4IPDA 4P2CB 2BA0A 4A3CH 3K57A 4K5VA 1TWCH 2HCCA 4K5XA 4JI2Q 1E3PA 2OTLA 1D6EC 4Y7NB 3AYHB 4Q5VA 3CQZH 2NWGA 3HOZB 2EYMA 2YU9H 1U5KA 1CA6A 4LF7Q 4OX9Q 4LF6L 1GUSA 4EQ5A 1VQOA 1TWHB 1SYCA 5EKKA 1CSPA 2EPBA 2CFMA 2F0UA 4JC0A 1XYIA 1VF7A 1VCIA 3CXCA 2O2LD 1I3QH 4IUPA 4GN3B 3C1FA 4XT3B 2A69C 5EJWA 2OQKA 3D6CA 3BDCA 5IYBH 2MPMA 4RGOS 4YIJA 3VA5A 2F0VA 1PYBA 1TU2B 4PZ8A 4H44C 3ULPA 4NXNQ 2UXBL 4FF2A 4LF5L 4ZKCB 1UEAB 2XVSA 4LF4Q 3NQIA 1KAWA 2E2IH 3I70A 2F0HA 4ZLTF 2F03A 4HJAA 1D7QA 5E7NA 3K6OA 5GAHC 5A2QE 5ELNA 3HOYG 3M4OB 3I4MG 4IZ8A 3NP8A 4OONA 2R92H 4R4QA 1FL0A 3CAMA 3KLSX 3NEMA 1AP0A 1SYGA 1EY8A 1TS4A 3BVZA 4LUVA 1Q12A 1EY4A 4GLXA 1P16A 1DOMA 2EY2A 2B2VA 3NBIA 1ESRA 2PQAB 2K28A 4L5TA 1SEBD 1SSOA 2OQ0A 3TBIB 4IN3A 1C0AA 2NVXB 1KAAA 1KD1C 3HOUH 2WP8J 4RFBA 3J80L 5IT9E 3OWFA 2A5HA 1HRJA 3GTMH 4A3JB 4JI7Q 1U4RA 2RBMA 5C5LA 2R7ZB 2OTJA 3FEWX 5LHY1 2MO1A 1BCPC 2VB2X 1DOKA 1YI2A 4DV1Q 2MJ8A 3L3OC 1HXYD 4KKUA 4LFAQ 3L9AX 4A4IA 4DK3C 1LTGD 1QE6A 3PO3B 1I6HB 1UE5A 2IPKD 2N3SA 5M9OA 2L11A 2K32A 3RN5A 3AMUA 4ME5A 4UY8C 3H09A 5CR3A 3EROA 4ZAIA 2VNUD 2B63B 2K5VA 1S3OA 3CCJA 1V1PB 4ABNA 4QY7A 1HNWQ 1WCMB 2R92G 1WTQA 4E6IA 2Z0SA 4NXNL 4B3RQ 2AHOB 4LF4L 4DV2Q 2NTTA 3OSOA 1PTOH 2B2YA 1SJHD 2EY6A 2R3ZA 3CU7A 2KEEA 2ZM6Q 4S3SA 3HOUG 4DF7A 3HGBA 2DNCA 2UXCL 2IJ0A 2B8FA 3J80i 1UWVA 2BE5D 2KCCA 3VR4A 4BY1B 1CK1A 3I7FA 3D0FA 4K8IA 1I6VC 1V9PA 1HTLD 4QQBX 3GTLH 1LTBD 1E1OA 1ENAA 4X3KA 1U4MA 2EJGC 5M5XB 1WVLA 1VQ9A 3KF6A 1MHWC 5IYDH 5EQ0A 1OTCA 4KJOA 3HOVH 3J81L 4JI7L 2EJFC 4NW2A 4A3BH 2EYOA 1NAPA 1BQQT 3Q6SA 4RG1A 4M8AA 4DV1L 1TXYA 3K81C 3T16A 4LFAL 2NVQB 4OO1I 4DR5Q 1EWCA 2B2WA 1IL8A 4G7OC 1LV9A 3ZJYC 2JA5G 3PSIA 3HOWH 5K5PA 1JB3A 5AFWA 5LMNW 1EUJA 4A3DB 4G57A 5GAEC 1DXMA 1KL9A 4A3IB 5M3MB 4BBSB 1PHJA 4POGA 4FXDA 1I4XA 3A54A 3KDFA 1HNWL 1AN8A 1X32A 1G8ZD 2ZXOA 4B3RL 2F0GA 3S14H 1YNJD 1K83H 4I7ZC 5EKLA 2F0TA 3QOLA 4DV2L 3E9IA 3OW7A 1Y8PB 5CC4A 2I5LX 3CMAA 4DN4M 2ATWA 3BZKA 3K59A 4L5RC 3MXUA 3EVQA 3KF8A 2D0PA 4C3HB 5I9PA 1GD7A 1N34Q 4CDCC 1EZ8A 3W2DA 4C3IH 4X66Q 2ZM6L 1XTDA 1AZQA 5IYDG 2XTIA 1NR2A 4M1UB 3J7YW 4BY7H 5IWAQ 3GTOH 1MJCA 4KD4A 3HOVG 2K5NA 1UE7A 4PMCA 4A3BG 1IBKQ 2CWPA 4XDXA 2D9UA 3WWVA 4ZK9B 2B8GA 1QG7A 1Q81C 4A76A 4AYBG 4HSPA 3DEPA 1S5FD 3D8GA 2EJMA 1O7LA 3TP8A 4DK1A 1D2BA 3S15H 1B50A 4DAPA 2XWJB 3M4PA 3HOZH 1EYCA 1EOTA 4L63B 2UUBQ 2K04A 1CI3M 2IT1A 4LK1C 4OO1H 1KDBA 1TWHH 3S1QH 2JA6G 2CH4A 4UHVA 2GVAA 3HKZE 5F2DA 3QWNA 3KOJA 4R4CA 4KLKA 3LWEA 4CJ0B 2HDLA 1SN8A 3ER0A 1QOHA 2L12A 4DXFA 2AMCB 1QVCA 1WJJA 1VQFA 3PO2H 5IYCH 2EE1A 3CHBD 1FNWA 1AE3A 1HZBA 4F87A 3KLWA 4IPCA 2B39A 3AB9A 4HIKA 3M7GA 2B3GA 5EPKA 1HNZL 1Y14B 4GZYC 4RGTA 2EYPA 2F4IA 4BY7G 2IHEA 2WACA 4P72A 5EPJA 4KKTA 4PZ7A 5J1ZA 1F9RA 2F3IA 3MFGA 2JXMB 4A3LH 5CV6A 1X3QA 5E1FA 1FYCA 3K80C 4DNRB 3TP7A 2I5HA 2VS1A 3NWSA 3FPUB 3OYYA 4O42A 4ODGA 3P1HA 1E7ZA 4X66L 4JI3Q 1W2BA 1STBA 4A3MH 1X9NA 3U58A 1UUPA 4YCUA 5IWAL 4EQNA 4B9XA 2FFKB 5LMNQ 4CJ2C 2ALYB 3FP9A 4IURA 1JJ2A 1EY7A 1IBKL 1XMOQ 1JCKB 2BOSA 4O2DA 3HOZG 1ILQA 4GN5A 5K36H 2DUDA 5GQOA 4OO1G 2PI2E 4RHRA 1ZXTA 1GUTA 1BNZA 4KMUC 2E2JB 3M3YB 3RLOA 1CQVA 3KF6B 2V1CC 4A3JH 4YWLA 1LT3D 4KHZA 1V43A 2R7ZH 2R6GA 1KTKA 2KBNA 3K0YA 2J7ZA 1NY4A 3PO2G 4N8FA 5IYCG 3JAME 3HFZB 2UUBL 1HR0L 4B3MQ 4FF3A 3KK7A 4QL5A 4JI8Q 2QEXA 1PH2A 4FF4A 2VY3A 3PO3H 3BVMA 2PPBC 1EQRA 4B3TQ 2C35B 3AFPA 2E2DC 2EYLA 1M90C 5T1IA 1ET6A 5KYLA 4JI5L 1H9SB 3FVQA 1MSGA 2WAQE 4KI0A 4G7HC 2RSNA 3GV6A 4IALA 1QZHA 4A3LG 1JORA 2K03A 3ULLA 1IW7C 3DEOA 3FKIH 1WCMH 3ND9A 5IT9L 3VYUA 5GAGC 5EKIA 2K5DA 4MIUA 4GKKQ 1HZ9A 4DK0A 3KDFB 5DEHA 4A3MG 3VA7A 3TEHB 2MUYA 4A3FB 2O4XA 1LYLA 3J7AV 4DR4Q 5C4HA 1JJCB 1OXTA 3AEVA 3PUYA 1IBMQ 1WOCA 1VQDA 3STBD 1UEBA 4DV3Q 3SK6A 5IIFA 5K36G 3VR6A 2VUMH 5KNDA 5KIXA 3S16B 5JOBA 1EWHA 4X3SA 1BOSA 1RIPA 1BBXC 2D62A 1L1OC 4XYOA 2A74C 1MSHA 5GROA 5KGUA 1AEXA 2DN8A 3U9OA 3RLNA 4CJ1B 3V96A 1Q8IA 3VYTA 2J0TD 3BYTB 1TWAB 2KVMA 2QW7A 1A0IA 1AE2A 3H0GB 3OIQA 4RA8A 5I4DA 3MA2B 4DR3Q 1WFQA 3DWPA 1FNUA 4IOAA 1JWUD 1JJGA 1K9MC 3L7ZC 2AQ1B 1SDFA 3HOXG 4NB3A 3T51B 3ULJA 1HH2P 1HNXQ 4LFBQ 3MZ5A 1EY0A 1VQLA 2F0PA 2B2TC 4GOPB 2WB1B 1BF4A 4B3ML 3FKIG 4JI8L 4QB4A 2Z6KC 1CZWA 3DXJC 5M5WH 4ME3A 2KCMA 4B3TL 2PMZE 3PIP3 2WINB 3GO5A 1PH1A 3D4WA 2D2CC 1PTOF 3J7ZC 1B7YB 3VR5A 5D65A 4U68A 2UU9L 4TQUS 4LF8Q 1T5EA 5M3MH 4BBSH 2K33A 4MHEA 2CH4W 3MFYA 5C3WA 3GTKH 1L0YB 4PG3A 1KLGD 2VUMG 2YYZA 2LKVA 2RKSA 2Y0SB 1IBLL 4OL7A 5G3LF 4GKKL 1SRUA 4B9WA 4G4KA 1J6QA 2BCOA 1TIID 2QILA 1RHPA 1HJPA 5FLMH 3CPWA 4DR4L 1A6XA 3GP7A 2CCZA 4X65L 3TZDA 4C3HH 4DV3L 1YBYA 1VQ5A 5FO7B 5M5YB 1X65A 4DUZQ 4FXGC 3KLRA 1FGUA 1KC8C 4OWXB 4N9TA 1EYAA 4DR1Q 1HHVA 3HP3A 5CORA 4MZ9A 1HPCA 3SK8A 5I2YA 4TKOB 1V1PA 1SYDA 3DUZA 3T13A 1CUKA 1OXUA 1EY9A 1Y1VH 1XWEA 3R2TA 1CQFA 3MXNA 2Q8IB 3JC66 4DV5Q 4ZCKA 5C3EH 4DR3L 1IKLA 1H9MA 4C1NI 5D3DA 3S2DH 3LGJA 5DM73 1S5ED 4HAEA 1KLUD 1SE2A 1VQIA 4IQZA 5FLXE 4LFBL 3J7A5 3DWAA 2ICEC 1EYGA 3A0JA 1A63A 1VMCA 3GTPB 2R61A 4IPGA 3DMUA 1O78A 3PMFA 4IUVA 5FLMG 4YHHQ 5I2XA 4GNXA 2E2HB 1NE3A 4UP7A 1XNRQ 4RWSC 4FVMA 2WKCA 3NBHA 3OIPA 3S2HB 4WJ4A 4LF8L 4EVOA 1E1TA 2K75A 4C3HG 4H0LC 4O0AA 4GLVB 3R2IA 2OEOA 4A3EB 4HMJA 1D1KA 2CKZB 1PRTD 1PVOA 1IYUA 3K58A 4DU9A 2WIIB 1HCZA 5IP9H 1PTOC 2BH8A 1O7ZA 4XQQA 1SMYD 2KQ3A 5E3FA 5KEEA 1Y1VG 4RCOA 4DUZL 3IL8A 2XIWA 1KQSA 1SFOB 3LX0A 1GUNA 1EIYB 1CKNA 3OPOA 2KA7A 2V4DA 1RL2A 3DWQA 3VR3A 5C3EG 2JJQA 1FNVA 2K05A 2C9OA 3PV0A 3I8ZA 1XJVA 1B70B 1VQHA 1X3GA 1OXVA 5FJ8H 5IGDA 1FR3A 2D0OA 2NN6I 1CHPD 3K7AH 4DV4Q 1A3VA 2B2UA 2E2JH 2FMMA 4DV5L 1ENFA 4HSVA 4DAYA 2L0CA 5JAVA 4DPGA 1QVGA 1LM0A 3GTJB 3S17B 1EWIA 1PRTB 4HJ7A 3PUWA 5EBCA 1TS2A 1K0RA 4LF9Q 5IGFA 1STYA 2ENBA 5COYA 4L5QA 4QGUA 4RKLA 2FJ2A 4NPSA 2P5ZX 3SVMA 4IO9A 1PH5A 1R4QB 4YY3Q 4A3CG 3S1NB 4DV7L 2OF1A 4X62Q 3NTKA 1K0SA 1N8RC 1TR5A 3M4YA 4YHHL 2QEJC 1XNRL 4WFN3 4LW1A 3VYSA 1M8AA 5AJ3Q 3G7LA 4ULLA 1D5MC 1SE3A 1V1OA 4QIWB 3LNNA 3I91A 4OGQC 2ZT9C 1LTRD 4KTAA 1SNPA 1WD0A 4JI2L 2CW0D 1MIUA 4HIDA 2KOLA 4MTNA 2EQSA 5FLXc 2XWBB 2AWOA 4BBRB 1KABA 3EA6A 2LXKA 3BU2A 3JAML 2F0DA 5FJ8G 1UE6A 4ZYSA 5BN3A 2GN5A 5IYBG 1GO3E 2FXQA 3KUPA 2PZWA 4LF7L 2ICIA 4OX9L 2EYJA 3S16H 5HY6A 1X56A 1X6OA 2NBFA 2A6HD 1WD1A 4V190 1YHBA 3HKZG 2E5LQ 2X6LA 2HIVA 3CRLC 3W5OA 4R4TA 1TWFH 3G48A 3VDYA 1DONA 2AQ3B 4TVAB 2YV5A 3NUCA 1Y8NB 1RF2D 1PFNA 3OOCA 1SE4A 4C3JB 3TP5A 1ASZA 3K8AA 1K8GA 3UDGA 2NN6H 2MQHA 1VF5C 3H0GH 4QMGA 3MXNB 5BN5A 1G2SA 1U4LA 2K5WA 1TY2A 2IX3A 4LF9L 2FINB 2WV6D 5ELDA 5C44B 3MTSA 3UDFA 3K5LA 3CW2C 4EGVA 4YCVA 3QG1A 4JVZA 2FHTA 4C1NK 1N32Q 3K5NA 4YY3L 5HGQA 2I46A 1NMGA 4UAIA 2RSOA 1ONLA 4P75A 4KY6A 1AZPA 4X62L 3E6ZX 2QF7A 1I50B 1MI2A 4A93B 4LUOA 1TS3A 3JAMi 4DK6C 1LO5D 1DZ1A 1CFMA 1EQVA 1EOVA 1YEZA 3SK5A 3D31A 3IFTA 5AJ3L 4GNXB 1NCVA 2F0QA 2KECA 5FOBB 3NBHB 3E9HA 1EIHA 2YTXA 3U4ZA 5C0XI 2JA8B 2VQEQ 5C4XB 2EDGA 2JA9A 3NXWA 1IZ6A 1Q8KA 3BG3A 4RAUC 1D8LA 4J8QA 1S5BD 3H6MA 5HGTA 4JCVE 1H9SA 1OXSC 2NN6G 4K8JA 3H0GG 3N6RA 3OTOQ 1N36Q 1PH4A 1EL0A 2E5LL 2UXDQ 1CKNB 1WTHA 1ZYRD 2KUMA 1CA5A 1C8CA 4HJ9A 4IFDI 2AKWB 2RCNA 3TS0A 1UE1A 4K2LA 2WAQG 2MFIA 1Q86C 1EQQA 4DV0Q 2RHQB 5JJZA 1B3AA 3K5MA 3S9WA 3I90A 4H13C 4KV6A 1PMRA 1PLFA 1YJNA 4X64Q 4HJ5A 1I5FA 3I4NB 4QCLA 1EEID 1KDCA 5I9OA 5LL6S 2QCPX 2F1MA 2F0IA 4DAYB 1VQAA 4YWKA 1G291 2R93B 3S1RB 4R4IA 4C56C 1XPRA 4UDUC 4BA2I 2RCFA 2VXWA 3GTPH 3R3OA 4OWTB 2XN9C 3RZOB 4C2MB 3TQYA 5JVH3 4Y52H 1B1ZA 1F9PA 1RD9D 2D5DA 4POFA 3I55A 3J81i 3M85A 1SNOA 1S72A 3OWEB 1K8OA 4X3UA 3GQBA 2VQFQ 2K1BA 3D4DA 5I6YA 3HOWG 3NE5B 4A3EH 4JPBW 4FXKC 1E22A 5C0XH 4GOPA 1N9WA 2JN4A 3BDOA 4Y7NH 4F8MA 2PYKA 4JOIC 1Y1WB 2GVBA 2N88A 2UUCQ 4DKAC 4V0BA 4A3KB 2N49A 4PZ6A 1K3RA 1PFSA 4DR5L 5DAUA 4I65A 1BR9A 1PH7A 4R9WA 3IAYA 3NENA 1STHA 4KHVA 2UXDL 1U4PA 4LFCQ 3PUZA 2IWHA 1HUNA 4R8IA 5JEAH 3C1EA 4IFDH 1EEFD 1TVXA 2K7VA 3PCOB 2SOBA 4HCSA 2RA4A 3A74A 4DV0L 1Z7TA 1MGSA 4C3IG 1RJTA 1YVCA 2B29A 1VQGA 1IYJB 3RD4A 4BXXH 2JE6I 1YNNC 4HR7B 3F2DA 4X64L 1W6KA 2JK8A 5IGEA 3GTJH 4IUUA 3S17H 3HOYB 3OW2A 4HN7A 4APVA 1M1KC 2PW5A 3I4MB 3WOEA 3T4AC 3M4OH 2CWAA 1N34L 2JYOA 3ZYYX 3KJOA 3A5UA 4JI0Q 1HFNA 2F0NA 1K8AC 3BZDB 3D4RA 1TWCB 2CVRA 1CT1D 3Q22A 4HIOA 1Y8OB 5C0XG 2IX1A 3CQZB 2GA4B 1H95A 3Q8DA 2O5JC 1C9OA 2BE5C 1JE4A 5BR8Q 1RCVD 1EIGA 4OELB 2H5XA 4ZRZA 3ERSX 3P20A 1PDQA 3UI2A 2HD3A 5M3FB 2NVXH 2IL8A 1LTSD 2N55A 3EN2A 5A2QL 2BH2A 3MXPA 3X3NA 5KRUA 4BBRH 4O1NA 2KHSA 1NSNS 2NVTB 4IFDG 3A56A 3PGZA 1EFWA 2N8NA 1H9KA 1R4PB 5IP7H 3K7UC 2A68D 3RLFA 3CD6A 1VQPA 2DJGC 2DNEA 2XRQD 1FJGQ 1G6ZA 1I6HH 3FDTA 1X3EA 4TRDA 2HQEA 1YJWA 2A8VA 4JYAQ 1PZID 3T1HQ 2SNMA 1D1IA 1L2FA 4JI6Q 1U9RA 2KCTA 3J80E 4J1MA 3GTGB 2JA7B 1SYEA 3Q0AA 4HCEA 2B63H 4H7BA 1HUMA 2R92B 2WB1E 4IUTA 1B53A 1KRTA 2B2VC 2A19A 1RODA 1EQTA 2UUAQ 3I72A 5C3XA 4OEMB 3HS0C 4YCWA 1IYVA 1Q1EA 3I2ZA 1A3TA 1YNJC 4JG2A 1XXGA 4DA2A 2VW9A 2HUGA 5KYIA 5C44H 2EYFA 3A7LA 5JJKA 1QJOA 4X3TA 2O5IC 2Y0SE 3HOUB 4JI0L 1CKOA 4JI3L 5CV5A 3Q23A 2N78A 4K5WA 2K5QA 1JT8A 1LUZA 3TN2A 5IE8A 4A3JG 1PV4A 1G51A 1A2UA 3E0EA 5LMNL 4BY1H 1G2TA 4IUNA 5CV7A 4BBRG 2R7ZG 2ZJPA 1I94Q 3GTQB 4A93H 1XMOL 1V8QA 2A6EC 1F9QA 4NDXA 1X55A 1VQJA 5JVG3 1K3BC 1B3QA 1EU4A 3CMEA 4AIMA 4CDDC 1J5EQ 1VQNA 5M5XH 1S4ZA 4PV1C 1LABA 1MJEA 3MC0B 2AUKA 3PO3G 4AQYQ 1YJ9A 2DY7A 2K4KA 2A69D 2G9DA 1GVPA 1IKMA 2E76C 3MHBA 1SYFA 3NTHA 5C4XH 3H3VI 4JV5Q 3L2PA 2VL6A 3PQIA 2B63G 4P74A 2NVQH 4JI4Q 1Z47A 3MXGA 5L37A 2AQ2B 1WCMG 2JA5B 2B2YC 3CCMA 1FJGL 3URYA 3M7NA 4JYAL 1BDOA 4B3SQ 3T1HL 2HQLA 4A3DH 1YHAA 1CSQA 4FF1A 1D5ZC 1F77A 1PH3A 1E2WA 1E2ZA 4A3IH 3TMEA 3H15A 3SDZA 4DV6Q 4KN4C 1R9TB 4OIJA 2Q2UA 1MD2D 1DM0B 1FGBD 1KIXA 1TS5A 1B4OA 2EZVA 3A8IE 5JPNC 1JE5A 2UUAL 1CKMA 3T56B 3I4NH 3BYYB 1ICWA 4BY1G 4DFAA 3B6YA 5EPLA 1IBML 1J8IA 2Z4HA 3G4SA 3S1RH 4LAAA 4NKLA 1XNQQ 4ZKBB 1TQOA 4UP8A 5C5MA 1PYWD 4CGYB 3J80c 2KHIA 2KEDA 2WKDA 3RZOH 3HOVB 3U9SA 1BCPD 2B2WC 4LNQA 1F9SA 4A3BB 1PYSB 3FMCA 1L0WA 1L0XB 4KY7A 3WOFA 1H9RA 2QGQA 3RR5A 4AYBB 1QILA 1VQMA 1YZ6A 1J5EL 2Z4IA 3U4VA 1RTOA 1GUGA 1N33Q 2MNAA 1F2MA 1QZGA 3EJIA 2F0KA 3GD7A 4XTCS 4GLAC 4ZQ3A 4BA1I 4A3DG 1S5DD 4TSSA 1Q46A 3F1ZA 1Y1WH 4WRDA 1HNXL 1VQ6A 4JV5L 3H3VH 4IOCA 4A3KH 4A3IG 3CC7A 5M3MG 4BBSG 3KYHC 1V1QA 4K2KA 1LLRD 1RDPD 1E24A 1WTRA 4EQOA 2JA6B 5IGCA 3KLSA 2M2LA 1GXDC 4LF5Q 1VQEA 3S14B 1B2TA 2NZHA 3J81j 1K83B 4RKBA 2I0QA 4B3SL 2Q2TA 2XRSD 1A8VA 4DUYQ 4JW0A 1BUVT 3OMGA 2F3WA 4BS9A 4J15A 1BCPB 3S1MB 5DNFA 1Z6HA 1BBWA 1JC7A 3D6WA 3CCQA 4DR7Q 1HFGA 2Q2HA 3BDLA 4FDBA 4DV6L 1SJED 2YTVA 3TZUA 1S40A 1B8AA 3A8KE 4LJZC 2Z1CA 4XIGS 4BY7B 3UDIA 1B9NA 5J3BA 1Q1BA 4F88A 2NZOA 3CC2A 2F0EA 3HOYH 5C4ZA 3I4OA 3CKIB 3DHQA 1U0LA 3I4MH 1RTNA 1EFID 1BBUA 2QDBA 4QIWE 3NHHA 1W6JA 1ZEQX 3STBC 1QB5D 3TDQA 2A73B 2TMPA 3AQQA 1O7IA 3TS2A 2IX0A 1GOZA 4DR1L 3J81c 2EXZA 3SR1A 3S15B 2NTSA 1XPOA 1PH6A 1Y1WG 1BVSA 4QUFA 1A2TA 3Q24A 3EFXD 1H9JA 4A3KG 4N8X1 2MHVA 3K0XA 2I07B 1II3A 4KN7C 5J39A 3H91A 3S1QB 4DGZA 3UDXA 2PNHA 5M3FH 1HQMC 2PCFB 1N33L 3M3YH 2XSCA 4QJFA 2CHBD 5FO9B 3PF4A 1XX8A 2F0JA 1A62A 3RUZA 1NBWA 1LT6D 3PO2B 2ZJRA 2NVTH 3IRBA 4FNFA 3KBGA 2G9HD 1ASYA 3FPPA 2RDFA 5E4WC 2F3VA 5C6AA 1GKHA 1NR4A 1YITA 3HKSA 3KBXA 1HZAA 4I7AA 4IUQA 4DUYL 2HDMA 2OCEA 1SXTA 1KRSA 1PRTF 3GTGH 2JA7H 5IP9G 3W1BA 4UP9A 3WDNA 1EYDA 3BS1A 4JBMA 3QO2A 2ZXPA 4DR7L 3BVGA 5C0XJ 2K6AA 4A3MB 5JPMC 2RDHA 5D3IB 2UXCQ 1WTWA 1JR0D 2YTYA 1FVIA 5NUCA 3CCSA 1K28A 2L5TA 2Q8RE 3OHXC 4A3FH 1STGA 1XMQQ 2HHHQ 1X3PA 1TWGB 5C4JB 3FHWA 1W3SA 2E74C 1KXLA 5CMDA 4RCNA 1X54A 2L9HA 1SNQA 2EIFA 2JEBI 1SYBA 3O13A 5M3FG 5JEAJ 3CRKC 1LT4D 4IFDJ 1DCZA 2PZTA 4LWCA 1QWYA 1B44D 3G6JB 5ELCA 1LTLA 5ISRA 4KKSA 3BZCA 3U50C 3TP6A 1YHQA 3GTQH 2H4OA 1JICA 4L6TB 4PMWA 1JMCA 1L1OA 1TWAH 2F0WA 4DV4L 4GS3A 1LTID 3CCEA 3QJYA 4JBKA 1O80A 1D5XC 1EY6A 3CPFA 2KHJA 3RNUA 3HOXB 3CCLA 1T5XD 1ET9A 3I3CA 4KY5A 3OMCA 4QUCA 4GKJQ 2NYZD 2JA7G 3QB3A 4K0KQ 1PFBA 1X3FA 1I4QA 3I4LA 3FKIB 2XNAC 1BXTA 3RMHA 5IY0A 2JA5H 1YNXA 1YNND 4KHPQ 5D14A 1WYDA 5CYUA 2B2TA 4XXEA 4R4OA 1Q82C 2L1BA 4A3FG 4CDEC 1PZJD 1YIJA 2Z6KA 1HR0W 2BDNA 3NELA 4MTKA 4PQXA 4PNYA 2VUMB 1R9TH 2M00A 5DLQE 1VQKA 2IW3A 5KNCA 1I4HA 3KJPA 2X69A 2K01A 2PO4A 3S24A 1EIFA 3SK4A 1M4VA 2NZ1D 1XMQL 2HHHL 1GJXA 1PRTC 3BJUA 2RVLA 1CZGA 5IGBA 1MKHA 4L5SA 2RF4A 5FKAC 3TRZA 3QOJA 3MEHA 3TSSA 4XYQA 1G6PA 1VDZA 4ID6A 5M5YH 1QNUA 5JJIA 1SMYC 2MO0A 1ML0D 1CTMA 2LY7A 4DAVA 4WJ3M 1AW7A 4ZUIA 3ND8A 2LSSA 2SEBD 3A5ZB 2F0SA 4XQNA 1GHJA 5EGTA 1SNDA 1E0BA 1BO0A 2H1EA 1PH8A 2KJXA 4CKCA 4LUZA 1SMXA 1XPUA 5I6WA 1Y69U 3W3AA 3L0OA 4P71A 2WB1G 1TT2A 4CBVA 5M5WB 3ICEA 4KJNA 3RN2A 4KD3A 1STNA 3V2TA 4DNTB 1OO9B 1GUWA 4A3GB 1IW7D 2DY8A 5ELBA 2RDGA 4GKJL 2ASBA 4R1JA 5FO8B 1ZKOA 3LWUA 1JWMD 1VQ8A 5EBDA 4K0KL 4DNIA 1MBYA 2LMCB 3GTKB 4Q0FA 2Q2IA 4PMBA 2MP1A 5IT9c 4EQPA 3MEFA 2QDLA 2F0FA 1HNZQ 2JA6H 1PFMA 3M9BA 1N32L 2Y0SG 4KHPL 4DXGA 3G71A 4NXMQ 2NVYB 3AU7A 3A7AB 1QUQA 1I4GA 5J22A 2E2HH 3UE1A 3S2HH 4R8NA 2JSOA 3S1MH 1G91A 2PI2A 1Q90A 3A55A 3MVVA 3CCRA 5ELFA 1FD7D 2ZTCA 2QKIC 1XTCD 3PUXA 4IPHA 3SXHA 5FLXL 4JK1C 2A6ED 2VQEL 3RZDB 2CW0C 2VB3X 4HIMA 1RKNA 3C3LA 1WTVA 2LS01 3MWYW 1Y1VB 3ERQA 1I4PA 5KNBA 5CBEE 1QCBD 1LTAD 4U673 3G6EA 2G5DA 1SFOH 5C3EB 3M4QA 4CKBA 3OTOL 1N36L 4K6DA 3K5OA 2FMCA 1J9OA 1C48A 1NNXA 2IHFA 4RGNA 3SE0A 3S2DB 2A6HC 2AUJD 1IL2A 2ZTEA 2Z8LA 3EQLC 4X6AH 1HR0Q 5A35A 5HURA 2VZAA 1I4RA 4RMFA 4GNXC 4QF4A 3E5SA 4IJLA 3E0JA 1L1OB 3MAQA 1STAA 3IFDA 5E4XA 4JI5Q 2SDFA 2EY1A 3HG9A 2L15A 4FO2A 3DM3A 4GN4B 4HMIA 5LMUQ 2RQXA 2XGTA 2R7DA 4MN3A 3NWTA 1A3UA 3D3RA 3FRPB 3PF5A 1DJRD 4A3EG 1WTXA 3S1NH 1QNKA 1HA5A 4NXML 2Z6BA 2NB0A 2I5MX 2A1AA 3EIVA 4UPAA 3PIPA 1VQ4A 2YU9B 3F2BA 2F52A 4HTHA 5ELOA 1K73C 2F0MA 2HCIA 3A8JE 2VQFL 4G7ZC 4HEDA 1SBBB 5GADC 1I3QB 3C2PA 5DM63 2DJFC 1EY5A 3EBEA 1JB7A 1SLJA 2B2UC 3ITPA 4LMQD 2UUCL 5JEAG 1KNEA 3PIOA 1TWGH 4YWMA 1IXRA 4CKEA 4Z9CB 4RGMA 5CV9A 5C4JH 1AH9A 1GHKA 3R8BA 3P7JA 4AH6A 3CCUA 3K7AB 5ELEA 2QA4A 2HIXA 2L55A 5LL6X 2E2IB 3HKZB 3PUVA 1E2VA 4BXXG 4JBJA 3TREA 2J4XA 4LFCL 2EYHA 3KFUA 2K52A 1HZCA 1F2ZA 2K50A 2KENA 4WJWA 1ZYRC 1NUCA 4B08A 1KDAA 3I56A 1SAPA 3CP0A 1WI5A 4C3JH 2WFWA 3F2CA 4NP5A 1NJIC 3ONAB 3VYRA 4JI1Q 1PXUA 4OWWB 3HOXH 4OHJA 4XT1B 2EVBA 4OXPA 4WORA 4N9PA 1JOOA 2UU9Q 1ILPA 3DM1A 3R93A 1VQ7A 3H3VC 1HA6A 4FP5D 2K14A 5LMUL 4DR6Q 1SNCA 4L8JA 2JQOA 4RHSA 3W1GA 3HZXA 4XQJA 4F7XA 1IBLQ 3SEBA 4CDFC 3GTMB 4JBWA 1B9MA 2MGSA 1PTOD 4NMZA 4ALPA 1I50H 4X65Q 4IJHA 1TY0A 3HEJA 5CBAE 5BR8L 1EU3A 1QUQB 1PA6A 4OIKA 5FK9C 3CC4A 2PQEA 5IP7G 5G3LD 3KF8B 5IOCA 2ZTDA 2Q8TA 1HQRD 1LT5D 2Z9HA 2F4VQ 4KK7A 1CM9A 2OWOA 2JA8H 2RHSB 2R7FA 3C46A 1TWFB 3P75A 5H1SE 3VR2A 3SHLA 3T1YQ 3F2UA 4AYBE 4CHTB 5JJLA 1TKWB 1KNAA 1ENCA 1LTTD 4C3JG 2EY5A 5CGKA 1UAPA 5BN4A 1Q3LA 1EZ6A 4JI6L 3QIAA 2ID0A 3DLLA 1PTOB 2KCNA 3J81E 1K8MA 2WAQB 4FYDA 2AWNA 1JQYD 1ESFA 2F0LA 2TSSA 2K5HA 1VQBA 3IKJA 3E3XA 1SNMA 1QVFA 1LACA 5C44G 2BDOA 3I73A 4DR2Q 3CCVA 1SROA 2EOTA 1OXXK 2PNRC 3GV3A 4RH6A 2PW7A 2SNSA 4ZUJA 1Z9FA 1HTPA 4K6LA 3AFQA 4JI1L 4A75A 2PQAA 1S5CD 3N52A 4BWGB 2LFNA 3NPPA 4EX5A 2HT1A 2OXPA 1DOLA 2CQAA 2JEAI 1DYQA 4A3GH 3J7AF 1BKBA 3GTLB 1T9HA 4A93G 3QR8A 2R93H 1JWSD 3T53B 4DAMA 1GM5A 4DR6L 2DGYA 2JP1A 3CF5A 3NQTA 5CV4A 3PIO3 4C2MH 2JA8G 2NVYH 1WTPA 1JOKA 1A15A 3JAMc 5C4XG 1I94L 1PZKD 5CV8A 1JOQA 2NUCA 5TSSA 2IY5B 2CQOA 4LF6Q 1DD2A 2ZXRA 1F2LA 2LXJA 4H02A 3HOWB 1DGSA 2BA1A 3HRZC 1IHZA 2E75C 3GDEA 2PZUA 4P73A 4AQYL 3UE0A 2F4VL 5T1GA 4MNOA 2C5CA 1SR3A 1C4QA 1PH9A 3RZDH 1ICFB 3T1YL 4JI4L 5IODA 4K14A 4HJ8A 2UXBQ 3H94A 1C7YA 2ES2A 1WTOA 4JOIA 2A68C 1F2YA 2PMZB 3I4NG 1NMFA
chains in the Genus database with same CATH topology
1CHQD 2X6GA 3V05A 2L4NA 1O7YA 4C3IB 5IGGA 3GTOB 1AFPA 4J6HA 1GUOA 1STEA 1BCPF 3NSWA 2F0OA 2M9VA 3NK9A 3X3MA 1VMPA 1UNSA 3NTIA 2OT2A 4ILWA 4P2CB 2BA0A 3K57A 4K5VA 2HCCA 4K5XA 1D6EC 4Y7NB 4Q5VA 2NWGA 3HOZB 2EYMA 1CA6A 1GUSA 1TWHB 1SYCA 5EKKA 2EPBA 2F0UA 1XYIA 1VF7A 1VCIA 2O2LD 4IUPA 3C1FA 4XT3B 2A69C 5EJWA 3D6CA 3BDCA 2MPMA 4RGOS 4YIJA 3VA5A 2F0VA 1TU2B 4H44C 4FF2A 4ZKCB 1UEAB 2XVSA 3NQIA 3I70A 2F0HA 4ZLTF 2F03A 3K6OA 5A2QE 3M4OB 4IZ8A 3NP8A 3KLSX 1AP0A 1SYGA 1EY8A 1TS4A 3BVZA 1Q12A 1EY4A 1DOMA 2EY2A 2B2VA 3NBIA 1ESRA 2K28A 1SEBD 1SSOA 3TBIB 4IN3A 2NVXB 1KAAA 2WP8J 4RFBA 3J80L 5IT9E 3OWFA 2A5HA 1HRJA 4A3JB 1U4RA 2RBMA 5C5LA 2R7ZB 3FEWX 5LHY1 1BCPC 2VB2X 1DOKA 2MJ8A 3L3OC 1HXYD 4KKUA 3L9AX 1LTGD 1QE6A 3PO3B 1I6HB 2IPKD 5M9OA 2L11A 2K32A 3AMUA 4ME5A 3H09A 5CR3A 3EROA 4ZAIA 2VNUD 2B63B 1V1PB 4ABNA 1WCMB 1WTQA 4E6IA 2NTTA 3OSOA 1PTOH 2B2YA 1SJHD 2EY6A 2R3ZA 3CU7A 2KEEA 4S3SA 4DF7A 3HGBA 2DNCA 2IJ0A 2B8FA 2BE5D 2KCCA 3VR4A 4BY1B 1CK1A 4K8IA 1I6VC 1HTLD 1LTBD 1ENAA 4X3KA 1U4MA 2EJGC 5M5XB 1WVLA 5EQ0A 4KJOA 3J81L 2EJFC 4NW2A 2EYOA 1NAPA 1BQQT 3Q6SA 4M8AA 2NVQB 3T16A 4OO1I 1EWCA 2B2WA 1IL8A 4G7OC 1LV9A 5K5PA 1JB3A 5AFWA 4A3DB 4G57A 1DXMA 4A3IB 5M3MB 4BBSB 4FXDA 1I4XA 3A54A 1AN8A 1X32A 1G8ZD 2ZXOA 2F0GA 1YNJD 4I7ZC 5EKLA 2F0TA 3QOLA 3OW7A 1Y8PB 5CC4A 4DN4M 3K59A 3MXUA 3EVQA 3KF8A 4C3HB 5I9PA 1EZ8A 3W2DA 1AZQA 4M1UB 1NR2A 3J7YW 4KD4A 4PMCA 4XDXA 2D9UA 4ZK9B 2B8GA 1QG7A 4HSPA 3DEPA 1S5FD 3D8GA 2EJMA 1O7LA 3TP8A 4DK1A 1D2BA 1B50A 4DAPA 2XWJB 1EYCA 1EOTA 4L63B 2K04A 1CI3M 2IT1A 4LK1C 4OO1H 1KDBA 5F2DA 3QWNA 3LWEA 4CJ0B 2HDLA 1QOHA 2L12A 4DXFA 2EE1A 3CHBD 1FNWA 4F87A 2B39A 3AB9A 3M7GA 5EPKA 4GZYC 4RGTA 2EYPA 2F4IA 2WACA 5EPJA 4KKTA 5J1ZA 1F9RA 3MFGA 2JXMB 5CV6A 1X3QA 5E1FA 1FYCA 4DNRB 3TP7A 3NWSA 3FPUB 4O42A 4ODGA 3P1HA 1STBA 1UUPA 4EQNA 4B9XA 2FFKB 4CJ2C 4IURA 1EY7A 1JCKB 2BOSA 1ILQA 5K36H 4OO1G 4RHRA 1ZXTA 1GUTA 1BNZA 4KMUC 2E2JB 3M3YB 1CQVA 1LT3D 4KHZA 1V43A 2R6GA 1KTKA 2J7ZA 3K0YA 3JAME 4FF3A 3KK7A 4FF4A 3BVMA 2PPBC 2E2DC 2EYLA 5T1IA 1ET6A 5KYLA 1H9SB 3FVQA 1MSGA 4KI0A 4G7HC 2RSNA 3GV6A 4IALA 1JORA 2K03A 1IW7C 3DEOA 3ND9A 5IT9L 3VYUA 5EKIA 2K5DA 4MIUA 4DK0A 5DEHA 3VA7A 2MUYA 4A3FB 2O4XA 3J7AV 5C4HA 1OXTA 3PUYA 3SK6A 5IIFA 5K36G 3VR6A 5KNDA 5KIXA 3S16B 5JOBA 1EWHA 4X3SA 1BOSA 1BBXC 2D62A 4XYOA 2A74C 1MSHA 5KGUA 1AEXA 2DN8A 3U9OA 4CJ1B 3V96A 1Q8IA 3VYTA 2J0TD 3BYTB 1TWAB 2KVMA 3H0GB 3OIQA 4RA8A 5I4DA 3MA2B 3DWPA 1FNUA 1JWUD 3L7ZC 2AQ1B 1SDFA 3T51B 3MZ5A 1EY0A 2F0PA 2B2TC 2WB1B 1BF4A 4QB4A 1CZWA 3DXJC 3PIP3 2WINB 3GO5A 3D4WA 2D2CC 1PTOF 3VR5A 5D65A 4U68A 4TQUS 1T5EA 2K33A 4MHEA 3MFYA 5C3WA 1L0YB 1KLGD 2YYZA 2LKVA 2RKSA 2Y0SB 4OL7A 5G3LF 4B9WA 4G4KA 2BCOA 1TIID 2QILA 1RHPA 1A6XA 3GP7A 3TZDA 5FO7B 5M5YB 4FXGC 3KLRA 4N9TA 1EYAA 1HHVA 3HP3A 5CORA 1HPCA 3SK8A 5I2YA 4TKOB 1V1PA 1SYDA 3DUZA 3T13A 1OXUA 1EY9A 1XWEA 3R2TA 1CQFA 3MXNA 2Q8IB 1IKLA 1H9MA 4C1NI 5D3DA 5DM73 1S5ED 4HAEA 1KLUD 1SE2A 5FLXE 4IQZA 3DWAA 2ICEC 1VMCA 3GTPB 2R61A 3DMUA 1O78A 3PMFA 4IUVA 5I2XA 2E2HB 4RWSC 4FVMA 2WKCA 3NBHA 3OIPA 3S2HB 4EVOA 4C3HG 4H0LC 3R2IA 2OEOA 4A3EB 4HMJA 1D1KA 1PRTD 1IYUA 3K58A 4DU9A 2WIIB 1HCZA 1PTOC 1O7ZA 4XQQA 1SMYD 2KQ3A 5E3FA 5KEEA 4RCOA 3IL8A 2XIWA 1SFOB 3LX0A 1GUNA 3OPOA 2KA7A 2V4DA 3VR3A 3DWQA 1FNVA 2K05A 2C9OA 3PV0A 3I8ZA 1OXVA 5IGDA 1FR3A 2NN6I 1CHPD 1A3VA 2B2UA 2FMMA 1ENFA 4HSVA 4DAYA 2L0CA 5JAVA 3GTJB 3S17B 1PRTB 3PUWA 5EBCA 1TS2A 5IGFA 1STYA 2ENBA 5COYA 4RKLA 2FJ2A 3SVMA 1R4QB 3S1NB 2OF1A 3NTKA 1TR5A 3M4YA 2QEJC 4WFN3 3VYSA 1M8AA 3G7LA 4ULLA 1D5MC 1SE3A 1V1OA 4QIWB 3LNNA 3I91A 4OGQC 2ZT9C 1LTRD 4KTAA 1SNPA 1WD0A 2CW0D 2KOLA 2XWBB 2AWOA 4BBRB 1KABA 3EA6A 3JAML 2F0DA 4ZYSA 5BN3A 3KUPA 2PZWA 2ICIA 2EYJA 2NBFA 2A6HD 1WD1A 4V190 2X6LA 3CRLC 1DONA 2AQ3B 3NUCA 1Y8NB 1RF2D 1PFNA 3OOCA 1SE4A 4C3JB 3TP5A 2NN6H 1VF5C 4QMGA 5BN5A 1G2SA 1U4LA 2K5WA 1TY2A 2IX3A 2FINB 2WV6D 5ELDA 5C44B 3MTSA 3K5LA 4EGVA 3QG1A 2FHTA 4C1NK 3K5NA 2I46A 4UAIA 2RSOA 1ONLA 4KY6A 1AZPA 3E6ZX 2QF7A 1I50B 1MI2A 4A93B 1TS3A 1DZ1A 1LO5D 1CFMA 1EQVA 3SK5A 3D31A 3IFTA 1NCVA 2F0QA 2KECA 5FOBB 1EIHA 5C0XI 2JA8B 5C4XB 2EDGA 3NXWA 3BG3A 4RAUC 4J8QA 1S5BD 3H6MA 5HGTA 1H9SA 1OXSC 2NN6G 4K8JA 3N6RA 1EL0A 2KUMA 1CA5A 1ZYRD 1C8CA 4IFDI 4K2LA 5JJZA 1B3AA 3K5MA 3S9WA 3I90A 4H13C 4KV6A 1PMRA 1PLFA 3I4NB 4QCLA 1EEID 1KDCA 5I9OA 5LL6S 2QCPX 2F1MA 2F0IA 2R93B 1G291 3S1RB 4C56C 4UDUC 4BA2I 2VXWA 3R3OA 2XN9C 3RZOB 4C2MB 5JVH3 1B1ZA 1F9PA 1RD9D 2D5DA 3M85A 1SNOA 3OWEB 1K8OA 4X3UA 3GQBA 2K1BA 3D4DA 5I6YA 3NE5B 4FXKC 5C0XH 3BDOA 4F8MA 2PYKA 1Y1WB 2N88A 4V0BA 4A3KB 5DAUA 4I65A 1BR9A 4R9WA 3IAYA 1STHA 4KHVA 1U4PA 3PUZA 2IWHA 1HUNA 4R8IA 5JEAH 3C1EA 4IFDH 1EEFD 1TVXA 2K7VA 2SOBA 4HCSA 2RA4A 1Z7TA 1MGSA 4C3IG 1RJTA 3RD4A 2JE6I 1YNNC 4HR7B 1W6KA 5IGEA 4IUUA 3HOYB 4HN7A 2PW5A 3I4MB 3WOEA 3T4AC 2JYOA 3ZYYX 1HFNA 2F0NA 3BZDB 3D4RA 1TWCB 2CVRA 1CT1D 3Q22A 1Y8OB 5C0XG 2IX1A 3CQZB 2GA4B 2O5JC 2BE5C 1JE4A 1RCVD 1EIGA 4ZRZA 3P20A 1PDQA 3UI2A 5M3FB 2IL8A 1LTSD 2N55A 5A2QL 3MXPA 3X3NA 5KRUA 4O1NA 2KHSA 1NSNS 2NVTB 4IFDG 3A56A 1H9KA 1R4PB 2A68D 3RLFA 2DNEA 2XRQD 1G6ZA 3FDTA 4TRDA 2HQEA 1PZID 2SNMA 1D1IA 1U9RA 3J80E 4J1MA 3GTGB 2JA7B 1SYEA 3Q0AA 4HCEA 4H7BA 1HUMA 2R92B 4IUTA 1B53A 2B2VC 1RODA 1EQTA 3I72A 5C3XA 3HS0C 1IYVA 1Q1EA 1A3TA 1YNJC 1XXGA 4DA2A 2HUGA 5KYIA 2EYFA 3A7LA 1QJOA 4X3TA 2O5IC 3HOUB 5CV5A 3Q23A 4K5WA 2K5QA 3TN2A 1A2UA 1G2TA 4IUNA 5CV7A 3GTQB 1V8QA 2A6EC 1F9QA 4NDXA 5JVG3 1EU4A 1S4ZA 4PV1C 1LABA 3MC0B 2AUKA 2DY7A 2A69D 2G9DA 1IKMA 2E76C 3MHBA 1SYFA 3NTHA 1Z47A 3MXGA 2AQ2B 2JA5B 2B2YC 3URYA 3M7NA 1BDOA 4FF1A 1D5ZC 1F77A 1E2WA 1E2ZA 3TMEA 3SDZA 4KN4C 1R9TB 4OIJA 1MD2D 1DM0B 1FGBD 1TS5A 1B4OA 2EZVA 3A8IE 5JPNC 3T56B 3BYYB 1ICWA 4DFAA 5EPLA 1J8IA 2Z4HA 4LAAA 4NKLA 4ZKBB 1TQOA 5C5MA 1PYWD 4CGYB 2KEDA 2WKDA 3HOVB 3U9SA 1BCPD 2B2WC 1F9SA 4A3BB 3FMCA 1L0XB 4KY7A 3WOFA 1H9RA 4AYBB 1QILA 2Z4IA 1RTOA 1GUGA 1F2MA 3EJIA 2F0KA 3GD7A 4XTCS 4ZQ3A 4BA1I 1S5DD 4TSSA 4WRDA 4K2KA 1LLRD 1RDPD 1WTRA 4EQOA 2JA6B 5IGCA 3KLSA 2M2LA 1GXDC 3S14B 1B2TA 1K83B 4RKBA 2XRSD 1BUVT 3OMGA 2F3WA 4BS9A 1BCPB 3S1MB 5DNFA 1Z6HA 1JC7A 3D6WA 1HFGA 3BDLA 1SJED 3TZUA 3A8KE 4LJZC 2Z1CA 4XIGS 4BY7B 1B9NA 1Q1BA 4F88A 2F0EA 5C4ZA 3CKIB 3DHQA 1RTNA 1EFID 2QDBA 3NHHA 1W6JA 1ZEQX 1QB5D 3TDQA 2A73B 2TMPA 2IX0A 1GOZA 2EXZA 3SR1A 3S15B 2NTSA 4QUFA 1A2TA 3Q24A 3EFXD 1H9JA 2MHVA 2I07B 1II3A 4KN7C 5J39A 3H91A 3S1QB 4DGZA 1HQMC 2PCFB 2XSCA 2CHBD 5FO9B 1XX8A 2F0JA 3RUZA 1LT6D 3PO2B 4FNFA 3KBGA 2G9HD 3FPPA 2RDFA 5E4WC 2F3VA 5C6AA 1NR4A 3KBXA 4IUQA 2HDMA 1SXTA 1PRTF 3WDNA 1EYDA 3BS1A 3QO2A 2ZXPA 3BVGA 5C0XJ 2K6AA 4A3MB 5JPMC 2RDHA 5D3IB 1WTWA 1JR0D 5NUCA 2L5TA 2Q8RE 3OHXC 1STGA 1X3PA 1TWGB 5C4JB 2E74C 5CMDA 4RCNA 2L9HA 1SNQA 2JEBI 1SYBA 3O13A 5JEAJ 3CRKC 1LT4D 4IFDJ 1DCZA 2PZTA 1QWYA 1B44D 3G6JB 5ELCA 5ISRA 4KKSA 3TP6A 2H4OA 1JICA 4L6TB 4PMWA 2F0WA 1LTID 3QJYA 1O80A 1D5XC 1EY6A 3HOXB 1T5XD 1ET9A 3I3CA 4KY5A 3OMCA 4QUCA 2NYZD 3QB3A 1PFBA 1I4QA 3I4LA 3FKIB 2XNAC 1BXTA 3RMHA 1YNND 5D14A 5CYUA 2B2TA 4XXEA 2L1BA 1PZJD 2BDNA 4PQXA 4PNYA 2VUMB 2M00A 2IW3A 5KNCA 1I4HA 2X69A 2K01A 2PO4A 3SK4A 1M4VA 2NZ1D 1GJXA 1PRTC 2RVLA 1CZGA 5IGBA 5FKAC 3QOJA 3MEHA 3TSSA 4XYQA 1VDZA 4ID6A 1QNUA 1SMYC 1ML0D 1CTMA 2LY7A 4DAVA 1AW7A 4ZUIA 3ND8A 2SEBD 2F0SA 4XQNA 1GHJA 5EGTA 1SNDA 1E0BA 1BO0A 2H1EA 2KJXA 4CKCA 5I6WA 1Y69U 3W3AA 1TT2A 4CBVA 5M5WB 4KJNA 4KD3A 1STNA 3V2TA 4DNTB 1OO9B 1GUWA 4A3GB 1IW7D 2DY8A 5ELBA 2RDGA 5FO8B 1ZKOA 3LWUA 1JWMD 5EBDA 1MBYA 2LMCB 3GTKB 4Q0FA 4PMBA 2MP1A 4EQPA 2F0FA 1PFMA 4DXGA 2NVYB 3AU7A 3A7AB 1I4GA 5J22A 4R8NA 2JSOA 1G91A 1Q90A 3A55A 3MVVA 5ELFA 1FD7D 2QKIC 1XTCD 3PUXA 3SXHA 5FLXL 4JK1C 2A6ED 3RZDB 2CW0C 2VB3X 1RKNA 3C3LA 1WTVA 2LS01 3MWYW 1Y1VB 3ERQA 1I4PA 5KNBA 5CBEE 1QCBD 1LTAD 4U673 5C3EB 4CKBA 4K6DA 3K5OA 2FMCA 1J9OA 1C48A 3S2DB 4RGNA 3SE0A 2A6HC 2AUJD 2Z8LA 3EQLC 5A35A 5HURA 1I4RA 4QF4A 3E5SA 3E0JA 3MAQA 1STAA 3IFDA 5E4XA 2SDFA 2EY1A 3HG9A 4FO2A 4HMIA 2RQXA 4MN3A 3NWTA 1A3UA 3D3RA 3FRPB 1DJRD 1WTXA 1QNKA 1HA5A 2NB0A 2YU9B 4HTHA 2F0MA 2HCIA 3A8JE 4G7ZC 4HEDA 1SBBB 1I3QB 3C2PA 5DM63 1EY5A 2B2UC 3ITPA 4LMQD 5JEAG 1KNEA 4CKEA 1GHKA 4Z9CB 4RGMA 5CV9A 3R8BA 3P7JA 3K7AB 5ELEA 2L55A 5LL6X 2E2IB 3HKZB 3PUVA 1E2VA 2J4XA 2EYHA 1F2ZA 4WJWA 1ZYRC 1NUCA 4B08A 1KDAA 1SAPA 4NP5A 3ONAB 3VYRA 1PXUA 4OHJA 4XT1B 2EVBA 4WORA 4N9PA 1JOOA 1ILPA 3DM1A 3R93A 3H3VC 1HA6A 4FP5D 1SNCA 4L8JA 4RHSA 3HZXA 4XQJA 4F7XA 3SEBA 3GTMB 4JBWA 1B9MA 2MGSA 1PTOD 4NMZA 1TY0A 3HEJA 5CBAE 1EU3A 4OIKA 5FK9C 2PQEA 5G3LD 5IOCA 2Q8TA 1HQRD 1LT5D 4KK7A 1CM9A 3C46A 1TWFB 3P75A 3VR2A 3SHLA 3F2UA 4CHTB 1TKWB 1KNAA 1ENCA 1LTTD 4C3JG 2EY5A 5CGKA 1UAPA 5BN4A 1Q3LA 1EZ6A 3QIAA 2ID0A 1PTOB 2KCNA 3J81E 1K8MA 2WAQB 4FYDA 2AWNA 1JQYD 1ESFA 2F0LA 2TSSA 3IKJA 1SNMA 1LACA 2BDOA 3I73A 2EOTA 1OXXK 2PNRC 3GV3A 4RH6A 2PW7A 2SNSA 4ZUJA 1HTPA 4K6LA 1S5CD 3N52A 4BWGB 2LFNA 3NPPA 2JEAI 2OXPA 1DOLA 2CQAA 1DYQA 3J7AF 3GTLB 1JWSD 3T53B 2JP1A 3NQTA 5CV4A 3PIO3 1WTPA 1JOKA 1A15A 1PZKD 5CV8A 1JOQA 2NUCA 5TSSA 1DD2A 2ZXRA 1F2LA 3HOWB 2BA1A 3HRZC 1IHZA 2E75C 2PZUA 5T1GA 2C5CA 1C4QA 5IODA 4K14A 3H94A 1WTOA 2A68C 1F2YA 2PMZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DOM A;  3LWE A;  4NW2 A;  3HP3 A;  4HSV A;  5COR A;  2HDL A;  2B2V A;  3FDT A;  3F2U A;  4CJ0 B;  1NAP A;  2L12 A;  3Q6S A;  4UAI A;  1B4O A;  2RSO A;  2X6G A;  1ESR A;  2MP1 A;  2K28 A;  2HCI A;  1AZP A;  1PFM A;  1KNA A;  2EE1 A;  2L4N A;  1O80 A;  1O7Y A;  1SSO A;  4HED A;  1MI2 A;  2N88 A;  2B2W A;  1IL8 A;  1DZ1 A;  1ICW A;  1LV9 A;  1Q3L A;  5COY A;  5EPL A;  3I3C A;  2FJ2 A;  4QUC A;  1HUM A;  5EPK A;  3SVM A;  5AFW A;  1NCV A;  4QUF A;  2KEC A;  2NYZ D;  4IUT A;  2B2U C;  1U4R A;  1J8I A;  4LMQ D;  1EIH A;  4X3S A;  1B53 A;  1KNE A;  1PFB A;  1HHV A;  1BBX C;  1G91 A;  5EPJ A;  4R9W A;  2B2V C;  1IKL A;  4ZKB B;  1MSH A;  1F9R A;  3H91 A;  1DOK A;  1ROD A;  1EQT A;  4CJ1 B;  1X3Q A;  3P7J A;  2MJ8 A;  1VMP A;  4HAE A;  2KED A;  2EOT A;  1U4P A;  5D14 A;  3GV3 A;  1HUN A;  2B2W C;  4R8I A;  2B2T A;  1X32 A;  1HRJ A;  1M8A A;  4OIJ A;  1F9S A;  3FPU B;  1QE6 A;  3G7L A;  4O42 A;  2KVM A;  1TVX A;  1XX8 A;  2L1B A;  2L11 A;  4RAU C;  1G6Z A;  2HCC A;  3I91 A;  1VMC A;  2HUG A;  3N52 A;  4RA8 A;  2BDN A;  4HCS A;  1DOL A;  2RA4 A;  4X3T A;  1MGS A;  5E4W C;  1RJT A;  2NWG A;  2FFK B;  1WD0 A;  4ZAI A;  4DN4 M;  4CJ2 C;  3MWY W;  1SDF A;  1RTO A;  1SAP A;  1WTV A;  1CA6 A;  2KOL A;  5CBE E;  1NR4 A;  4IUR A;  1EL0 A;  4IUV A;  2KUM A;  1ILQ A;  4RWS C;  1CA5 A;  3TN2 A;  1C8C A;  2B2T C;  3KBX A;  2JP1 A;  4IUQ A;  4IUU A;  1WTQ A;  2EPB A;  2HDM A;  2K01 A;  2X69 A;  1G2T A;  1XYI A;  1J9O A;  3ONA B;  1BF4 A;  3KUP A;  1ZXT A;  2NZ1 D;  4IUP A;  1AZQ A;  1BNZ A;  1NR2 A;  1F9Q A;  4XT1 B;  2JYO A;  2RVL A;  1A15 A;  4XT3 B;  1WTP A;  5JJZ A;  1B3A A;  1ILP A;  3QO2 A;  5EJW A;  3I90 A;  1HFN A;  1S4Z A;  3DM1 A;  3R93 A;  1WTR A;  1PLF A;  1WD1 A;  1HA6 A;  2B2Y A;  2M2L A;  2CVR A;  2DY7 A;  2MPM A;  2X6L A;  4XDX A;  1ML0 D;  1B2T A;  2D9U A;  1IKM A;  2R3Z A;  5D65 A;  1DON A;  4U68 A;  1WTW A;  2J7Z A;  1F2L A;  4ZK9 B;  1O7Z A;  2KEE A;  1QG7 A;  4MHE A;  1E0B A;  1BO0 A;  2H1E A;  2K1B A;  2Q8R E;  3DEP A;  1PFN A;  3IFD A;  5E4X A;  4ZKC B;  1JE4 A;  2MGS A;  2SDF A;  1X3P A;  1EIG A;  5DNF A;  3IL8 A;  5T1G A;  2XIW A;  4ZLT F;  3D6W A;  1HFG A;  2VXW A;  5T1I A;  5CBA E;  5CMD A;  3UI2 A;  1PDQ A;  1RHP A;  2B2Y C;  1B50 A;  2K05 A;  2IL8 A;  3I8Z A;  2L9H A;  4MN3 A;  1MSG A;  2N55 A;  4OIK A;  2RSN A;  3GV6 A;  1F9P A;  1G2S A;  1EOT A;  1U4L A;  4X3K A;  1U4M A;  2K03 A;  3TZD A;  2K04 A;  1WTO A;  1WVL A;  3DEO A;  2Q8T A;  1WTX A;  1AP0 A;  2FIN B;  1QNK A;  3MTS A;  1GUW A;  1CM9 A;  5EKI A;  5EQ0 A;  2DY8 A;  1RTN A;  2B2U A;  4X3U A;  2FMM A;  2FHT A;  1JIC A; 
#chains in the Genus database with same CATH topology
 1NTG A;  4A3G G;  1CHQ D;  2X6G A;  3V05 A;  2R93 G;  1P8L A;  1KHI A;  4DR2 L;  2L4N A;  1O7Y A;  4C3I B;  5IGG A;  1SE8 A;  3GTO B;  1AFP A;  4J6H A;  4DV7 Q;  1VQC A;  1GUO A;  1STE A;  1BCP F;  2EXD A;  3NSW A;  1VS0 A;  2F0O A;  2M9V A;  3NK9 A;  5EAY A;  1Q7Y C;  3X3M A;  4GOP C;  1VMP A;  2ZJQ A;  3SGI A;  1UNS A;  2E8G A;  3F8T A;  3NTI A;  1XNQ L;  2OT2 A;  4ILW A;  4IPD A;  4P2C B;  2BA0 A;  4A3C H;  3K57 A;  4K5V A;  1TWC H;  2HCC A;  4K5X A;  4JI2 Q;  1E3P A;  2OTL A;  1D6E C;  4Y7N B;  3AYH B;  4Q5V A;  3CQZ H;  2NWG A;  3HOZ B;  2EYM A;  2YU9 H;  1U5K A;  1CA6 A;  4LF7 Q;  4OX9 Q;  4LF6 L;  1GUS A;  4EQ5 A;  1VQO A;  1TWH B;  1SYC A;  5EKK A;  1CSP A;  2EPB A;  2CFM A;  2F0U A;  4JC0 A;  1XYI A;  1VF7 A;  1VCI A;  3CXC A;  2O2L D;  1I3Q H;  4IUP A;  4GN3 B;  3C1F A;  4XT3 B;  2A69 C;  5EJW A;  2OQK A;  3D6C A;  3BDC A;  5IYB H;  2MPM A;  4RGO S;  4YIJ A;  3VA5 A;  2F0V A;  1PYB A;  1TU2 B;  4PZ8 A;  4H44 C;  3ULP A;  4NXN Q;  2UXB L;  4FF2 A;  4LF5 L;  4ZKC B;  1UEA B;  2XVS A;  4LF4 Q;  3NQI A;  1KAW A;  2E2I H;  3I70 A;  2F0H A;  4ZLT F;  2F03 A;  4HJA A;  1D7Q A;  5E7N A;  3K6O A;  5GAH C;  5A2Q E;  5ELN A;  3HOY G;  3M4O B;  3I4M G;  4IZ8 A;  3NP8 A;  4OON A;  2R92 H;  4R4Q A;  1FL0 A;  3CAM A;  3KLS X;  3NEM A;  1AP0 A;  1SYG A;  1EY8 A;  1TS4 A;  3BVZ A;  4LUV A;  1Q12 A;  1EY4 A;  4GLX A;  1P16 A;  1DOM A;  2EY2 A;  2B2V A;  3NBI A;  1ESR A;  2PQA B;  2K28 A;  4L5T A;  1SEB D;  1SSO A;  2OQ0 A;  3TBI B;  4IN3 A;  1C0A A;  2NVX B;  1KAA A;  1KD1 C;  3HOU H;  2WP8 J;  4RFB A;  3J80 L;  5IT9 E;  3OWF A;  2A5H A;  1HRJ A;  3GTM H;  4A3J B;  4JI7 Q;  1U4R A;  2RBM A;  5C5L A;  2R7Z B;  2OTJ A;  3FEW X;  5LHY 1;  2MO1 A;  1BCP C;  2VB2 X;  1DOK A;  1YI2 A;  4DV1 Q;  2MJ8 A;  3L3O C;  1HXY D;  4KKU A;  4LFA Q;  3L9A X;  4A4I A;  4DK3 C;  1LTG D;  1QE6 A;  3PO3 B;  1I6H B;  1UE5 A;  2IPK D;  2N3S A;  5M9O A;  2L11 A;  2K32 A;  3RN5 A;  3AMU A;  4ME5 A;  4UY8 C;  3H09 A;  5CR3 A;  3ERO A;  4ZAI A;  2VNU D;  2B63 B;  2K5V A;  1S3O A;  3CCJ A;  1V1P B;  4ABN A;  4QY7 A;  1HNW Q;  1WCM B;  2R92 G;  1WTQ A;  4E6I A;  2Z0S A;  4NXN L;  4B3R Q;  2AHO B;  4LF4 L;  4DV2 Q;  2NTT A;  3OSO A;  1PTO H;  2B2Y A;  1SJH D;  2EY6 A;  2R3Z A;  3CU7 A;  2KEE A;  2ZM6 Q;  4S3S A;  3HOU G;  4DF7 A;  3HGB A;  2DNC A;  2UXC L;  2IJ0 A;  2B8F A;  3J80 i;  1UWV A;  2BE5 D;  2KCC A;  3VR4 A;  4BY1 B;  1CK1 A;  3I7F A;  3D0F A;  4K8I A;  1I6V C;  1V9P A;  1HTL D;  4QQB X;  3GTL H;  1LTB D;  1E1O A;  1ENA A;  4X3K A;  1U4M A;  2EJG C;  5M5X B;  1WVL A;  1VQ9 A;  3KF6 A;  1MHW C;  5IYD H;  5EQ0 A;  1OTC A;  4KJO A;  3HOV H;  3J81 L;  4JI7 L;  2EJF C;  4NW2 A;  4A3B H;  2EYO A;  1NAP A;  1BQQ T;  3Q6S A;  4RG1 A;  4M8A A;  4DV1 L;  1TXY A;  3K81 C;  3T16 A;  4LFA L;  2NVQ B;  4OO1 I;  4DR5 Q;  1EWC A;  2B2W A;  1IL8 A;  4G7O C;  1LV9 A;  3ZJY C;  2JA5 G;  3PSI A;  3HOW H;  5K5P A;  1JB3 A;  5AFW A;  5LMN W;  1EUJ A;  4A3D B;  4G57 A;  5GAE C;  1DXM A;  1KL9 A;  4A3I B;  5M3M B;  4BBS B;  1PHJ A;  4POG A;  4FXD A;  1I4X A;  3A54 A;  3KDF A;  1HNW L;  1AN8 A;  1X32 A;  1G8Z D;  2ZXO A;  4B3R L;  2F0G A;  3S14 H;  1YNJ D;  1K83 H;  4I7Z C;  5EKL A;  2F0T A;  3QOL A;  4DV2 L;  3E9I A;  3OW7 A;  1Y8P B;  5CC4 A;  2I5L X;  3CMA A;  4DN4 M;  2ATW A;  3BZK A;  3K59 A;  4L5R C;  3MXU A;  3EVQ A;  3KF8 A;  2D0P A;  4C3H B;  5I9P A;  1GD7 A;  1N34 Q;  4CDC C;  1EZ8 A;  3W2D A;  4C3I H;  4X66 Q;  2ZM6 L;  1XTD A;  1AZQ A;  5IYD G;  2XTI A;  1NR2 A;  4M1U B;  3J7Y W;  4BY7 H;  5IWA Q;  3GTO H;  1MJC A;  4KD4 A;  3HOV G;  2K5N A;  1UE7 A;  4PMC A;  4A3B G;  1IBK Q;  2CWP A;  4XDX A;  2D9U A;  3WWV A;  4ZK9 B;  2B8G A;  1QG7 A;  1Q81 C;  4A76 A;  4AYB G;  4HSP A;  3DEP A;  1S5F D;  3D8G A;  2EJM A;  1O7L A;  3TP8 A;  4DK1 A;  1D2B A;  3S15 H;  1B50 A;  4DAP A;  2XWJ B;  3M4P A;  3HOZ H;  1EYC A;  1EOT A;  4L63 B;  2UUB Q;  2K04 A;  1CI3 M;  2IT1 A;  4LK1 C;  4OO1 H;  1KDB A;  1TWH H;  3S1Q H;  2JA6 G;  2CH4 A;  4UHV A;  2GVA A;  3HKZ E;  5F2D A;  3QWN A;  3KOJ A;  4R4C A;  4KLK A;  3LWE A;  4CJ0 B;  2HDL A;  1SN8 A;  3ER0 A;  1QOH A;  2L12 A;  4DXF A;  2AMC B;  1QVC A;  1WJJ A;  1VQF A;  3PO2 H;  5IYC H;  2EE1 A;  3CHB D;  1FNW A;  1AE3 A;  1HZB A;  4F87 A;  3KLW A;  4IPC A;  2B39 A;  3AB9 A;  4HIK A;  3M7G A;  2B3G A;  5EPK A;  1HNZ L;  1Y14 B;  4GZY C;  4RGT A;  2EYP A;  2F4I A;  4BY7 G;  2IHE A;  2WAC A;  4P72 A;  5EPJ A;  4KKT A;  4PZ7 A;  5J1Z A;  1F9R A;  2F3I A;  3MFG A;  2JXM B;  4A3L H;  5CV6 A;  1X3Q A;  5E1F A;  1FYC A;  3K80 C;  4DNR B;  3TP7 A;  2I5H A;  2VS1 A;  3NWS A;  3FPU B;  3OYY A;  4O42 A;  4ODG A;  3P1H A;  1E7Z A;  4X66 L;  4JI3 Q;  1W2B A;  1STB A;  4A3M H;  1X9N A;  3U58 A;  1UUP A;  4YCU A;  5IWA L;  4EQN A;  4B9X A;  2FFK B;  5LMN Q;  4CJ2 C;  2ALY B;  3FP9 A;  4IUR A;  1JJ2 A;  1EY7 A;  1IBK L;  1XMO Q;  1JCK B;  2BOS A;  4O2D A;  3HOZ G;  1ILQ A;  4GN5 A;  5K36 H;  2DUD A;  5GQO A;  4OO1 G;  2PI2 E;  4RHR A;  1ZXT A;  1GUT A;  1BNZ A;  4KMU C;  2E2J B;  3M3Y B;  3RLO A;  1CQV A;  3KF6 B;  2V1C C;  4A3J H;  4YWL A;  1LT3 D;  4KHZ A;  1V43 A;  2R7Z H;  2R6G A;  1KTK A;  2KBN A;  3K0Y A;  2J7Z A;  1NY4 A;  3PO2 G;  4N8F A;  5IYC G;  3JAM E;  3HFZ B;  2UUB L;  1HR0 L;  4B3M Q;  4FF3 A;  3KK7 A;  4QL5 A;  4JI8 Q;  2QEX A;  1PH2 A;  4FF4 A;  2VY3 A;  3PO3 H;  3BVM A;  2PPB C;  1EQR A;  4B3T Q;  2C35 B;  3AFP A;  2E2D C;  2EYL A;  1M90 C;  5T1I A;  1ET6 A;  5KYL A;  4JI5 L;  1H9S B;  3FVQ A;  1MSG A;  2WAQ E;  4KI0 A;  4G7H C;  2RSN A;  3GV6 A;  4IAL A;  1QZH A;  4A3L G;  1JOR A;  2K03 A;  3ULL A;  1IW7 C;  3DEO A;  3FKI H;  1WCM H;  3ND9 A;  5IT9 L;  3VYU A;  5GAG C;  5EKI A;  2K5D A;  4MIU A;  4GKK Q;  1HZ9 A;  4DK0 A;  3KDF B;  5DEH A;  4A3M G;  3VA7 A;  3TEH B;  2MUY A;  4A3F B;  2O4X A;  1LYL A;  3J7A V;  4DR4 Q;  5C4H A;  1JJC B;  1OXT A;  3AEV A;  3PUY A;  1IBM Q;  1WOC A;  1VQD A;  3STB D;  1UEB A;  4DV3 Q;  3SK6 A;  5IIF A;  5K36 G;  3VR6 A;  2VUM H;  5KND A;  5KIX A;  3S16 B;  5JOB A;  1EWH A;  4X3S A;  1BOS A;  1RIP A;  1BBX C;  2D62 A;  1L1O C;  4XYO A;  2A74 C;  1MSH A;  5GRO A;  5KGU A;  1AEX A;  2DN8 A;  3U9O A;  3RLN A;  4CJ1 B;  3V96 A;  1Q8I A;  3VYT A;  2J0T D;  3BYT B;  1TWA B;  2KVM A;  2QW7 A;  1A0I A;  1AE2 A;  3H0G B;  3OIQ A;  4RA8 A;  5I4D A;  3MA2 B;  4DR3 Q;  1WFQ A;  3DWP A;  1FNU A;  4IOA A;  1JWU D;  1JJG A;  1K9M C;  3L7Z C;  2AQ1 B;  1SDF A;  3HOX G;  4NB3 A;  3T51 B;  3ULJ A;  1HH2 P;  1HNX Q;  4LFB Q;  3MZ5 A;  1EY0 A;  1VQL A;  2F0P A;  2B2T C;  4GOP B;  2WB1 B;  1BF4 A;  4B3M L;  3FKI G;  4JI8 L;  4QB4 A;  2Z6K C;  1CZW A;  3DXJ C;  5M5W H;  4ME3 A;  2KCM A;  4B3T L;  2PMZ E;  3PIP 3;  2WIN B;  3GO5 A;  1PH1 A;  3D4W A;  2D2C C;  1PTO F;  3J7Z C;  1B7Y B;  3VR5 A;  5D65 A;  4U68 A;  2UU9 L;  4TQU S;  4LF8 Q;  1T5E A;  5M3M H;  4BBS H;  2K33 A;  4MHE A;  2CH4 W;  3MFY A;  5C3W A;  3GTK H;  1L0Y B;  4PG3 A;  1KLG D;  2VUM G;  2YYZ A;  2LKV A;  2RKS A;  2Y0S B;  1IBL L;  4OL7 A;  5G3L F;  4GKK L;  1SRU A;  4B9W A;  4G4K A;  1J6Q A;  2BCO A;  1TII D;  2QIL A;  1RHP A;  1HJP A;  5FLM H;  3CPW A;  4DR4 L;  1A6X A;  3GP7 A;  2CCZ A;  4X65 L;  3TZD A;  4C3H H;  4DV3 L;  1YBY A;  1VQ5 A;  5FO7 B;  5M5Y B;  1X65 A;  4DUZ Q;  4FXG C;  3KLR A;  1FGU A;  1KC8 C;  4OWX B;  4N9T A;  1EYA A;  4DR1 Q;  1HHV A;  3HP3 A;  5COR A;  4MZ9 A;  1HPC A;  3SK8 A;  5I2Y A;  4TKO B;  1V1P A;  1SYD A;  3DUZ A;  3T13 A;  1CUK A;  1OXU A;  1EY9 A;  1Y1V H;  1XWE A;  3R2T A;  1CQF A;  3MXN A;  2Q8I B;  3JC6 6;  4DV5 Q;  4ZCK A;  5C3E H;  4DR3 L;  1IKL A;  1H9M A;  4C1N I;  5D3D A;  3S2D H;  3LGJ A;  5DM7 3;  1S5E D;  4HAE A;  1KLU D;  1SE2 A;  1VQI A;  4IQZ A;  5FLX E;  4LFB L;  3J7A 5;  3DWA A;  2ICE C;  1EYG A;  3A0J A;  1A63 A;  1VMC A;  3GTP B;  2R61 A;  4IPG A;  3DMU A;  1O78 A;  3PMF A;  4IUV A;  5FLM G;  4YHH Q;  5I2X A;  4GNX A;  2E2H B;  1NE3 A;  4UP7 A;  1XNR Q;  4RWS C;  4FVM A;  2WKC A;  3NBH A;  3OIP A;  3S2H B;  4WJ4 A;  4LF8 L;  4EVO A;  1E1T A;  2K75 A;  4C3H G;  4H0L C;  4O0A A;  4GLV B;  3R2I A;  2OEO A;  4A3E B;  4HMJ A;  1D1K A;  2CKZ B;  1PRT D;  1PVO A;  1IYU A;  3K58 A;  4DU9 A;  2WII B;  1HCZ A;  5IP9 H;  1PTO C;  2BH8 A;  1O7Z A;  4XQQ A;  1SMY D;  2KQ3 A;  5E3F A;  5KEE A;  1Y1V G;  4RCO A;  4DUZ L;  3IL8 A;  2XIW A;  1KQS A;  1SFO B;  3LX0 A;  1GUN A;  1EIY B;  1CKN A;  3OPO A;  2KA7 A;  2V4D A;  1RL2 A;  3DWQ A;  3VR3 A;  5C3E G;  2JJQ A;  1FNV A;  2K05 A;  2C9O A;  3PV0 A;  3I8Z A;  1XJV A;  1B70 B;  1VQH A;  1X3G A;  1OXV A;  5FJ8 H;  5IGD A;  1FR3 A;  2D0O A;  2NN6 I;  1CHP D;  3K7A H;  4DV4 Q;  1A3V A;  2B2U A;  2E2J H;  2FMM A;  4DV5 L;  1ENF A;  4HSV A;  4DAY A;  2L0C A;  5JAV A;  4DPG A;  1QVG A;  1LM0 A;  3GTJ B;  3S17 B;  1EWI A;  1PRT B;  4HJ7 A;  3PUW A;  5EBC A;  1TS2 A;  1K0R A;  4LF9 Q;  5IGF A;  1STY A;  2ENB A;  5COY A;  4L5Q A;  4QGU A;  4RKL A;  2FJ2 A;  4NPS A;  2P5Z X;  3SVM A;  4IO9 A;  1PH5 A;  1R4Q B;  4YY3 Q;  4A3C G;  3S1N B;  4DV7 L;  2OF1 A;  4X62 Q;  3NTK A;  1K0S A;  1N8R C;  1TR5 A;  3M4Y A;  4YHH L;  2QEJ C;  1XNR L;  4WFN 3;  4LW1 A;  3VYS A;  1M8A A;  5AJ3 Q;  3G7L A;  4ULL A;  1D5M C;  1SE3 A;  1V1O A;  4QIW B;  3LNN A;  3I91 A;  4OGQ C;  2ZT9 C;  1LTR D;  4KTA A;  1SNP A;  1WD0 A;  4JI2 L;  2CW0 D;  1MIU A;  4HID A;  2KOL A;  4MTN A;  2EQS A;  5FLX c;  2XWB B;  2AWO A;  4BBR B;  1KAB A;  3EA6 A;  2LXK A;  3BU2 A;  3JAM L;  2F0D A;  5FJ8 G;  1UE6 A;  4ZYS A;  5BN3 A;  2GN5 A;  5IYB G;  1GO3 E;  2FXQ A;  3KUP A;  2PZW A;  4LF7 L;  2ICI A;  4OX9 L;  2EYJ A;  3S16 H;  5HY6 A;  1X56 A;  1X6O A;  2NBF A;  2A6H D;  1WD1 A;  4V19 0;  1YHB A;  3HKZ G;  2E5L Q;  2X6L A;  2HIV A;  3CRL C;  3W5O A;  4R4T A;  1TWF H;  3G48 A;  3VDY A;  1DON A;  2AQ3 B;  4TVA B;  2YV5 A;  3NUC A;  1Y8N B;  1RF2 D;  1PFN A;  3OOC A;  1SE4 A;  4C3J B;  3TP5 A;  1ASZ A;  3K8A A;  1K8G A;  3UDG A;  2NN6 H;  2MQH A;  1VF5 C;  3H0G H;  4QMG A;  3MXN B;  5BN5 A;  1G2S A;  1U4L A;  2K5W A;  1TY2 A;  2IX3 A;  4LF9 L;  2FIN B;  2WV6 D;  5ELD A;  5C44 B;  3MTS A;  3UDF A;  3K5L A;  3CW2 C;  4EGV A;  4YCV A;  3QG1 A;  4JVZ A;  2FHT A;  4C1N K;  1N32 Q;  3K5N A;  4YY3 L;  5HGQ A;  2I46 A;  1NMG A;  4UAI A;  2RSO A;  1ONL A;  4P75 A;  4KY6 A;  1AZP A;  4X62 L;  3E6Z X;  2QF7 A;  1I50 B;  1MI2 A;  4A93 B;  4LUO A;  1TS3 A;  3JAM i;  4DK6 C;  1LO5 D;  1DZ1 A;  1CFM A;  1EQV A;  1EOV A;  1YEZ A;  3SK5 A;  3D31 A;  3IFT A;  5AJ3 L;  4GNX B;  1NCV A;  2F0Q A;  2KEC A;  5FOB B;  3NBH B;  3E9H A;  1EIH A;  2YTX A;  3U4Z A;  5C0X I;  2JA8 B;  2VQE Q;  5C4X B;  2EDG A;  2JA9 A;  3NXW A;  1IZ6 A;  1Q8K A;  3BG3 A;  4RAU C;  1D8L A;  4J8Q A;  1S5B D;  3H6M A;  5HGT A;  4JCV E;  1H9S A;  1OXS C;  2NN6 G;  4K8J A;  3H0G G;  3N6R A;  3OTO Q;  1N36 Q;  1PH4 A;  1EL0 A;  2E5L L;  2UXD Q;  1CKN B;  1WTH A;  1ZYR D;  2KUM A;  1CA5 A;  1C8C A;  4HJ9 A;  4IFD I;  2AKW B;  2RCN A;  3TS0 A;  1UE1 A;  4K2L A;  2WAQ G;  2MFI A;  1Q86 C;  1EQQ A;  4DV0 Q;  2RHQ B;  5JJZ A;  1B3A A;  3K5M A;  3S9W A;  3I90 A;  4H13 C;  4KV6 A;  1PMR A;  1PLF A;  1YJN A;  4X64 Q;  4HJ5 A;  1I5F A;  3I4N B;  4QCL A;  1EEI D;  1KDC A;  5I9O A;  5LL6 S;  2QCP X;  2F1M A;  2F0I A;  4DAY B;  1VQA A;  4YWK A;  1G29 1;  2R93 B;  3S1R B;  4R4I A;  4C56 C;  1XPR A;  4UDU C;  4BA2 I;  2RCF A;  2VXW A;  3GTP H;  3R3O A;  4OWT B;  2XN9 C;  3RZO B;  4C2M B;  3TQY A;  5JVH 3;  4Y52 H;  1B1Z A;  1F9P A;  1RD9 D;  2D5D A;  4POF A;  3I55 A;  3J81 i;  3M85 A;  1SNO A;  1S72 A;  3OWE B;  1K8O A;  4X3U A;  3GQB A;  2VQF Q;  2K1B A;  3D4D A;  5I6Y A;  3HOW G;  3NE5 B;  4A3E H;  4JPB W;  4FXK C;  1E22 A;  5C0X H;  4GOP A;  1N9W A;  2JN4 A;  3BDO A;  4Y7N H;  4F8M A;  2PYK A;  4JOI C;  1Y1W B;  2GVB A;  2N88 A;  2UUC Q;  4DKA C;  4V0B A;  4A3K B;  2N49 A;  4PZ6 A;  1K3R A;  1PFS A;  4DR5 L;  5DAU A;  4I65 A;  1BR9 A;  1PH7 A;  4R9W A;  3IAY A;  3NEN A;  1STH A;  4KHV A;  2UXD L;  1U4P A;  4LFC Q;  3PUZ A;  2IWH A;  1HUN A;  4R8I A;  5JEA H;  3C1E A;  4IFD H;  1EEF D;  1TVX A;  2K7V A;  3PCO B;  2SOB A;  4HCS A;  2RA4 A;  3A74 A;  4DV0 L;  1Z7T A;  1MGS A;  4C3I G;  1RJT A;  1YVC A;  2B29 A;  1VQG A;  1IYJ B;  3RD4 A;  4BXX H;  2JE6 I;  1YNN C;  4HR7 B;  3F2D A;  4X64 L;  1W6K A;  2JK8 A;  5IGE A;  3GTJ H;  4IUU A;  3S17 H;  3HOY B;  3OW2 A;  4HN7 A;  4APV A;  1M1K C;  2PW5 A;  3I4M B;  3WOE A;  3T4A C;  3M4O H;  2CWA A;  1N34 L;  2JYO A;  3ZYY X;  3KJO A;  3A5U A;  4JI0 Q;  1HFN A;  2F0N A;  1K8A C;  3BZD B;  3D4R A;  1TWC B;  2CVR A;  1CT1 D;  3Q22 A;  4HIO A;  1Y8O B;  5C0X G;  2IX1 A;  3CQZ B;  2GA4 B;  1H95 A;  3Q8D A;  2O5J C;  1C9O A;  2BE5 C;  1JE4 A;  5BR8 Q;  1RCV D;  1EIG A;  4OEL B;  2H5X A;  4ZRZ A;  3ERS X;  3P20 A;  1PDQ A;  3UI2 A;  2HD3 A;  5M3F B;  2NVX H;  2IL8 A;  1LTS D;  2N55 A;  3EN2 A;  5A2Q L;  2BH2 A;  3MXP A;  3X3N A;  5KRU A;  4BBR H;  4O1N A;  2KHS A;  1NSN S;  2NVT B;  4IFD G;  3A56 A;  3PGZ A;  1EFW A;  2N8N A;  1H9K A;  1R4P B;  5IP7 H;  3K7U C;  2A68 D;  3RLF A;  3CD6 A;  1VQP A;  2DJG C;  2DNE A;  2XRQ D;  1FJG Q;  1G6Z A;  1I6H H;  3FDT A;  1X3E A;  4TRD A;  2HQE A;  1YJW A;  2A8V A;  4JYA Q;  1PZI D;  3T1H Q;  2SNM A;  1D1I A;  1L2F A;  4JI6 Q;  1U9R A;  2KCT A;  3J80 E;  4J1M A;  3GTG B;  2JA7 B;  1SYE A;  3Q0A A;  4HCE A;  2B63 H;  4H7B A;  1HUM A;  2R92 B;  2WB1 E;  4IUT A;  1B53 A;  1KRT A;  2B2V C;  2A19 A;  1ROD A;  1EQT A;  2UUA Q;  3I72 A;  5C3X A;  4OEM B;  3HS0 C;  4YCW A;  1IYV A;  1Q1E A;  3I2Z A;  1A3T A;  1YNJ C;  4JG2 A;  1XXG A;  4DA2 A;  2VW9 A;  2HUG A;  5KYI A;  5C44 H;  2EYF A;  3A7L A;  5JJK A;  1QJO A;  4X3T A;  2O5I C;  2Y0S E;  3HOU B;  4JI0 L;  1CKO A;  4JI3 L;  5CV5 A;  3Q23 A;  2N78 A;  4K5W A;  2K5Q A;  1JT8 A;  1LUZ A;  3TN2 A;  5IE8 A;  4A3J G;  1PV4 A;  1G51 A;  1A2U A;  3E0E A;  5LMN L;  4BY1 H;  1G2T A;  4IUN A;  5CV7 A;  4BBR G;  2R7Z G;  2ZJP A;  1I94 Q;  3GTQ B;  4A93 H;  1XMO L;  1V8Q A;  2A6E C;  1F9Q A;  4NDX A;  1X55 A;  1VQJ A;  5JVG 3;  1K3B C;  1B3Q A;  1EU4 A;  3CME A;  4AIM A;  4CDD C;  1J5E Q;  1VQN A;  5M5X H;  1S4Z A;  4PV1 C;  1LAB A;  1MJE A;  3MC0 B;  2AUK A;  3PO3 G;  4AQY Q;  1YJ9 A;  2DY7 A;  2K4K A;  2A69 D;  2G9D A;  1GVP A;  1IKM A;  2E76 C;  3MHB A;  1SYF A;  3NTH A;  5C4X H;  3H3V I;  4JV5 Q;  3L2P A;  2VL6 A;  3PQI A;  2B63 G;  4P74 A;  2NVQ H;  4JI4 Q;  1Z47 A;  3MXG A;  5L37 A;  2AQ2 B;  1WCM G;  2JA5 B;  2B2Y C;  3CCM A;  1FJG L;  3URY A;  3M7N A;  4JYA L;  1BDO A;  4B3S Q;  3T1H L;  2HQL A;  4A3D H;  1YHA A;  1CSQ A;  4FF1 A;  1D5Z C;  1F77 A;  1PH3 A;  1E2W A;  1E2Z A;  4A3I H;  3TME A;  3H15 A;  3SDZ A;  4DV6 Q;  4KN4 C;  1R9T B;  4OIJ A;  2Q2U A;  1MD2 D;  1DM0 B;  1FGB D;  1KIX A;  1TS5 A;  1B4O A;  2EZV A;  3A8I E;  5JPN C;  1JE5 A;  2UUA L;  1CKM A;  3T56 B;  3I4N H;  3BYY B;  1ICW A;  4BY1 G;  4DFA A;  3B6Y A;  5EPL A;  1IBM L;  1J8I A;  2Z4H A;  3G4S A;  3S1R H;  4LAA A;  4NKL A;  1XNQ Q;  4ZKB B;  1TQO A;  4UP8 A;  5C5M A;  1PYW D;  4CGY B;  3J80 c;  2KHI A;  2KED A;  2WKD A;  3RZO H;  3HOV B;  3U9S A;  1BCP D;  2B2W C;  4LNQ A;  1F9S A;  4A3B B;  1PYS B;  3FMC A;  1L0W A;  1L0X B;  4KY7 A;  3WOF A;  1H9R A;  2QGQ A;  3RR5 A;  4AYB B;  1QIL A;  1VQM A;  1YZ6 A;  1J5E L;  2Z4I A;  3U4V A;  1RTO A;  1GUG A;  1N33 Q;  2MNA A;  1F2M A;  1QZG A;  3EJI A;  2F0K A;  3GD7 A;  4XTC S;  4GLA C;  4ZQ3 A;  4BA1 I;  4A3D G;  1S5D D;  4TSS A;  1Q46 A;  3F1Z A;  1Y1W H;  4WRD A;  1HNX L;  1VQ6 A;  4JV5 L;  3H3V H;  4IOC A;  4A3K H;  4A3I G;  3CC7 A;  5M3M G;  4BBS G;  3KYH C;  1V1Q A;  4K2K A;  1LLR D;  1RDP D;  1E24 A;  1WTR A;  4EQO A;  2JA6 B;  5IGC A;  3KLS A;  2M2L A;  1GXD C;  4LF5 Q;  1VQE A;  3S14 B;  1B2T A;  2NZH A;  3J81 j;  1K83 B;  4RKB A;  2I0Q A;  4B3S L;  2Q2T A;  2XRS D;  1A8V A;  4DUY Q;  4JW0 A;  1BUV T;  3OMG A;  2F3W A;  4BS9 A;  4J15 A;  1BCP B;  3S1M B;  5DNF A;  1Z6H A;  1BBW A;  1JC7 A;  3D6W A;  3CCQ A;  4DR7 Q;  1HFG A;  2Q2H A;  3BDL A;  4FDB A;  4DV6 L;  1SJE D;  2YTV A;  3TZU A;  1S40 A;  1B8A A;  3A8K E;  4LJZ C;  2Z1C A;  4XIG S;  4BY7 B;  3UDI A;  1B9N A;  5J3B A;  1Q1B A;  4F88 A;  2NZO A;  3CC2 A;  2F0E A;  3HOY H;  5C4Z A;  3I4O A;  3CKI B;  3DHQ A;  1U0L A;  3I4M H;  1RTN A;  1EFI D;  1BBU A;  2QDB A;  4QIW E;  3NHH A;  1W6J A;  1ZEQ X;  3STB C;  1QB5 D;  3TDQ A;  2A73 B;  2TMP A;  3AQQ A;  1O7I A;  3TS2 A;  2IX0 A;  1GOZ A;  4DR1 L;  3J81 c;  2EXZ A;  3SR1 A;  3S15 B;  2NTS A;  1XPO A;  1PH6 A;  1Y1W G;  1BVS A;  4QUF A;  1A2T A;  3Q24 A;  3EFX D;  1H9J A;  4A3K G;  4N8X 1;  2MHV A;  3K0X A;  2I07 B;  1II3 A;  4KN7 C;  5J39 A;  3H91 A;  3S1Q B;  4DGZ A;  3UDX A;  2PNH A;  5M3F H;  1HQM C;  2PCF B;  1N33 L;  3M3Y H;  2XSC A;  4QJF A;  2CHB D;  5FO9 B;  3PF4 A;  1XX8 A;  2F0J A;  1A62 A;  3RUZ A;  1NBW A;  1LT6 D;  3PO2 B;  2ZJR A;  2NVT H;  3IRB A;  4FNF A;  3KBG A;  2G9H D;  1ASY A;  3FPP A;  2RDF A;  5E4W C;  2F3V A;  5C6A A;  1GKH A;  1NR4 A;  1YIT A;  3HKS A;  3KBX A;  1HZA A;  4I7A A;  4IUQ A;  4DUY L;  2HDM A;  2OCE A;  1SXT A;  1KRS A;  1PRT F;  3GTG H;  2JA7 H;  5IP9 G;  3W1B A;  4UP9 A;  3WDN A;  1EYD A;  3BS1 A;  4JBM A;  3QO2 A;  2ZXP A;  4DR7 L;  3BVG A;  5C0X J;  2K6A A;  4A3M B;  5JPM C;  2RDH A;  5D3I B;  2UXC Q;  1WTW A;  1JR0 D;  2YTY A;  1FVI A;  5NUC A;  3CCS A;  1K28 A;  2L5T A;  2Q8R E;  3OHX C;  4A3F H;  1STG A;  1XMQ Q;  2HHH Q;  1X3P A;  1TWG B;  5C4J B;  3FHW A;  1W3S A;  2E74 C;  1KXL A;  5CMD A;  4RCN A;  1X54 A;  2L9H A;  1SNQ A;  2EIF A;  2JEB I;  1SYB A;  3O13 A;  5M3F G;  5JEA J;  3CRK C;  1LT4 D;  4IFD J;  1DCZ A;  2PZT A;  4LWC A;  1QWY A;  1B44 D;  3G6J B;  5ELC A;  1LTL A;  5ISR A;  4KKS A;  3BZC A;  3U50 C;  3TP6 A;  1YHQ A;  3GTQ H;  2H4O A;  1JIC A;  4L6T B;  4PMW A;  1JMC A;  1L1O A;  1TWA H;  2F0W A;  4DV4 L;  4GS3 A;  1LTI D;  3CCE A;  3QJY A;  4JBK A;  1O80 A;  1D5X C;  1EY6 A;  3CPF A;  2KHJ A;  3RNU A;  3HOX B;  3CCL A;  1T5X D;  1ET9 A;  3I3C A;  4KY5 A;  3OMC A;  4QUC A;  4GKJ Q;  2NYZ D;  2JA7 G;  3QB3 A;  4K0K Q;  1PFB A;  1X3F A;  1I4Q A;  3I4L A;  3FKI B;  2XNA C;  1BXT A;  3RMH A;  5IY0 A;  2JA5 H;  1YNX A;  1YNN D;  4KHP Q;  5D14 A;  1WYD A;  5CYU A;  2B2T A;  4XXE A;  4R4O A;  1Q82 C;  2L1B A;  4A3F G;  4CDE C;  1PZJ D;  1YIJ A;  2Z6K A;  1HR0 W;  2BDN A;  3NEL A;  4MTK A;  4PQX A;  4PNY A;  2VUM B;  1R9T H;  2M00 A;  5DLQ E;  1VQK A;  2IW3 A;  5KNC A;  1I4H A;  3KJP A;  2X69 A;  2K01 A;  2PO4 A;  3S24 A;  1EIF A;  3SK4 A;  1M4V A;  2NZ1 D;  1XMQ L;  2HHH L;  1GJX A;  1PRT C;  3BJU A;  2RVL A;  1CZG A;  5IGB A;  1MKH A;  4L5S A;  2RF4 A;  5FKA C;  3TRZ A;  3QOJ A;  3MEH A;  3TSS A;  4XYQ A;  1G6P A;  1VDZ A;  4ID6 A;  5M5Y H;  1QNU A;  5JJI A;  1SMY C;  2MO0 A;  1ML0 D;  1CTM A;  2LY7 A;  4DAV A;  4WJ3 M;  1AW7 A;  4ZUI A;  3ND8 A;  2LSS A;  2SEB D;  3A5Z B;  2F0S A;  4XQN A;  1GHJ A;  5EGT A;  1SND A;  1E0B A;  1BO0 A;  2H1E A;  1PH8 A;  2KJX A;  4CKC A;  4LUZ A;  1SMX A;  1XPU A;  5I6W A;  1Y69 U;  3W3A A;  3L0O A;  4P71 A;  2WB1 G;  1TT2 A;  4CBV A;  5M5W B;  3ICE A;  4KJN A;  3RN2 A;  4KD3 A;  1STN A;  3V2T A;  4DNT B;  1OO9 B;  1GUW A;  4A3G B;  1IW7 D;  2DY8 A;  5ELB A;  2RDG A;  4GKJ L;  2ASB A;  4R1J A;  5FO8 B;  1ZKO A;  3LWU A;  1JWM D;  1VQ8 A;  5EBD A;  4K0K L;  4DNI A;  1MBY A;  2LMC B;  3GTK B;  4Q0F A;  2Q2I A;  4PMB A;  2MP1 A;  5IT9 c;  4EQP A;  3MEF A;  2QDL A;  2F0F A;  1HNZ Q;  2JA6 H;  1PFM A;  3M9B A;  1N32 L;  2Y0S G;  4KHP L;  4DXG A;  3G71 A;  4NXM Q;  2NVY B;  3AU7 A;  3A7A B;  1QUQ A;  1I4G A;  5J22 A;  2E2H H;  3UE1 A;  3S2H H;  4R8N A;  2JSO A;  3S1M H;  1G91 A;  2PI2 A;  1Q90 A;  3A55 A;  3MVV A;  3CCR A;  5ELF A;  1FD7 D;  2ZTC A;  2QKI C;  1XTC D;  3PUX A;  4IPH A;  3SXH A;  5FLX L;  4JK1 C;  2A6E D;  2VQE L;  3RZD B;  2CW0 C;  2VB3 X;  4HIM A;  1RKN A;  3C3L A;  1WTV A;  2LS0 1;  3MWY W;  1Y1V B;  3ERQ A;  1I4P A;  5KNB A;  5CBE E;  1QCB D;  1LTA D;  4U67 3;  3G6E A;  2G5D A;  1SFO H;  5C3E B;  3M4Q A;  4CKB A;  3OTO L;  1N36 L;  4K6D A;  3K5O A;  2FMC A;  1J9O A;  1C48 A;  1NNX A;  2IHF A;  4RGN A;  3SE0 A;  3S2D B;  2A6H C;  2AUJ D;  1IL2 A;  2ZTE A;  2Z8L A;  3EQL C;  4X6A H;  1HR0 Q;  5A35 A;  5HUR A;  2VZA A;  1I4R A;  4RMF A;  4GNX C;  4QF4 A;  3E5S A;  4IJL A;  3E0J A;  1L1O B;  3MAQ A;  1STA A;  3IFD A;  5E4X A;  4JI5 Q;  2SDF A;  2EY1 A;  3HG9 A;  2L15 A;  4FO2 A;  3DM3 A;  4GN4 B;  4HMI A;  5LMU Q;  2RQX A;  2XGT A;  2R7D A;  4MN3 A;  3NWT A;  1A3U A;  3D3R A;  3FRP B;  3PF5 A;  1DJR D;  4A3E G;  1WTX A;  3S1N H;  1QNK A;  1HA5 A;  4NXM L;  2Z6B A;  2NB0 A;  2I5M X;  2A1A A;  3EIV A;  4UPA A;  3PIP A;  1VQ4 A;  2YU9 B;  3F2B A;  2F52 A;  4HTH A;  5ELO A;  1K73 C;  2F0M A;  2HCI A;  3A8J E;  2VQF L;  4G7Z C;  4HED A;  1SBB B;  5GAD C;  1I3Q B;  3C2P A;  5DM6 3;  2DJF C;  1EY5 A;  3EBE A;  1JB7 A;  1SLJ A;  2B2U C;  3ITP A;  4LMQ D;  2UUC L;  5JEA G;  1KNE A;  3PIO A;  1TWG H;  4YWM A;  1IXR A;  4CKE A;  4Z9C B;  4RGM A;  5CV9 A;  5C4J H;  1AH9 A;  1GHK A;  3R8B A;  3P7J A;  4AH6 A;  3CCU A;  3K7A B;  5ELE A;  2QA4 A;  2HIX A;  2L55 A;  5LL6 X;  2E2I B;  3HKZ B;  3PUV A;  1E2V A;  4BXX G;  4JBJ A;  3TRE A;  2J4X A;  4LFC L;  2EYH A;  3KFU A;  2K52 A;  1HZC A;  1F2Z A;  2K50 A;  2KEN A;  4WJW A;  1ZYR C;  1NUC A;  4B08 A;  1KDA A;  3I56 A;  1SAP A;  3CP0 A;  1WI5 A;  4C3J H;  2WFW A;  3F2C A;  4NP5 A;  1NJI C;  3ONA B;  3VYR A;  4JI1 Q;  1PXU A;  4OWW B;  3HOX H;  4OHJ A;  4XT1 B;  2EVB A;  4OXP A;  4WOR A;  4N9P A;  1JOO A;  2UU9 Q;  1ILP A;  3DM1 A;  3R93 A;  1VQ7 A;  3H3V C;  1HA6 A;  4FP5 D;  2K14 A;  5LMU L;  4DR6 Q;  1SNC A;  4L8J A;  2JQO A;  4RHS A;  3W1G A;  3HZX A;  4XQJ A;  4F7X A;  1IBL Q;  3SEB A;  4CDF C;  3GTM B;  4JBW A;  1B9M A;  2MGS A;  1PTO D;  4NMZ A;  4ALP A;  1I50 H;  4X65 Q;  4IJH A;  1TY0 A;  3HEJ A;  5CBA E;  5BR8 L;  1EU3 A;  1QUQ B;  1PA6 A;  4OIK A;  5FK9 C;  3CC4 A;  2PQE A;  5IP7 G;  5G3L D;  3KF8 B;  5IOC A;  2ZTD A;  2Q8T A;  1HQR D;  1LT5 D;  2Z9H A;  2F4V Q;  4KK7 A;  1CM9 A;  2OWO A;  2JA8 H;  2RHS B;  2R7F A;  3C46 A;  1TWF B;  3P75 A;  5H1S E;  3VR2 A;  3SHL A;  3T1Y Q;  3F2U A;  4AYB E;  4CHT B;  5JJL A;  1TKW B;  1KNA A;  1ENC A;  1LTT D;  4C3J G;  2EY5 A;  5CGK A;  1UAP A;  5BN4 A;  1Q3L A;  1EZ6 A;  4JI6 L;  3QIA A;  2ID0 A;  3DLL A;  1PTO B;  2KCN A;  3J81 E;  1K8M A;  2WAQ B;  4FYD A;  2AWN A;  1JQY D;  1ESF A;  2F0L A;  2TSS A;  2K5H A;  1VQB A;  3IKJ A;  3E3X A;  1SNM A;  1QVF A;  1LAC A;  5C44 G;  2BDO A;  3I73 A;  4DR2 Q;  3CCV A;  1SRO A;  2EOT A;  1OXX K;  2PNR C;  3GV3 A;  4RH6 A;  2PW7 A;  2SNS A;  4ZUJ A;  1Z9F A;  1HTP A;  4K6L A;  3AFQ A;  4JI1 L;  4A75 A;  2PQA A;  1S5C D;  3N52 A;  4BWG B;  2LFN A;  3NPP A;  4EX5 A;  2HT1 A;  2OXP A;  1DOL A;  2CQA A;  2JEA I;  1DYQ A;  4A3G H;  3J7A F;  1BKB A;  3GTL B;  1T9H A;  4A93 G;  3QR8 A;  2R93 H;  1JWS D;  3T53 B;  4DAM A;  1GM5 A;  4DR6 L;  2DGY A;  2JP1 A;  3CF5 A;  3NQT A;  5CV4 A;  3PIO 3;  4C2M H;  2JA8 G;  2NVY H;  1WTP A;  1JOK A;  1A15 A;  3JAM c;  5C4X G;  1I94 L;  1PZK D;  5CV8 A;  1JOQ A;  2NUC A;  5TSS A;  2IY5 B;  2CQO A;  4LF6 Q;  1DD2 A;  2ZXR A;  1F2L A;  2LXJ A;  4H02 A;  3HOW B;  1DGS A;  2BA1 A;  3HRZ C;  1IHZ A;  2E75 C;  3GDE A;  2PZU A;  4P73 A;  4AQY L;  3UE0 A;  2F4V L;  5T1G A;  4MNO A;  2C5C A;  1SR3 A;  1C4Q A;  1PH9 A;  3RZD H;  1ICF B;  3T1Y L;  4JI4 L;  5IOD A;  4K14 A;  4HJ8 A;  2UXB Q;  3H94 A;  1C7Y A;  2ES2 A;  1WTO A;  4JOI A;  2A68 C;  1F2Y A;  2PMZ B;  3I4N G;  1NMF A; 
#chains in the Genus database with same CATH homology
 1CHQ D;  2X6G A;  3V05 A;  2L4N A;  1O7Y A;  4C3I B;  5IGG A;  3GTO B;  1AFP A;  4J6H A;  1GUO A;  1STE A;  1BCP F;  3NSW A;  2F0O A;  2M9V A;  3NK9 A;  3X3M A;  1VMP A;  1UNS A;  3NTI A;  2OT2 A;  4ILW A;  4P2C B;  2BA0 A;  3K57 A;  4K5V A;  2HCC A;  4K5X A;  1D6E C;  4Y7N B;  4Q5V A;  2NWG A;  3HOZ B;  2EYM A;  1CA6 A;  1GUS A;  1TWH B;  1SYC A;  5EKK A;  2EPB A;  2F0U A;  1XYI A;  1VF7 A;  1VCI A;  2O2L D;  4IUP A;  3C1F A;  4XT3 B;  2A69 C;  5EJW A;  3D6C A;  3BDC A;  2MPM A;  4RGO S;  4YIJ A;  3VA5 A;  2F0V A;  1TU2 B;  4H44 C;  4FF2 A;  4ZKC B;  1UEA B;  2XVS A;  3NQI A;  3I70 A;  2F0H A;  4ZLT F;  2F03 A;  3K6O A;  5A2Q E;  3M4O B;  4IZ8 A;  3NP8 A;  3KLS X;  1AP0 A;  1SYG A;  1EY8 A;  1TS4 A;  3BVZ A;  1Q12 A;  1EY4 A;  1DOM A;  2EY2 A;  2B2V A;  3NBI A;  1ESR A;  2K28 A;  1SEB D;  1SSO A;  3TBI B;  4IN3 A;  2NVX B;  1KAA A;  2WP8 J;  4RFB A;  3J80 L;  5IT9 E;  3OWF A;  2A5H A;  1HRJ A;  4A3J B;  1U4R A;  2RBM A;  5C5L A;  2R7Z B;  3FEW X;  5LHY 1;  1BCP C;  2VB2 X;  1DOK A;  2MJ8 A;  3L3O C;  1HXY D;  4KKU A;  3L9A X;  1LTG D;  1QE6 A;  3PO3 B;  1I6H B;  2IPK D;  5M9O A;  2L11 A;  2K32 A;  3AMU A;  4ME5 A;  3H09 A;  5CR3 A;  3ERO A;  4ZAI A;  2VNU D;  2B63 B;  1V1P B;  4ABN A;  1WCM B;  1WTQ A;  4E6I A;  2NTT A;  3OSO A;  1PTO H;  2B2Y A;  1SJH D;  2EY6 A;  2R3Z A;  3CU7 A;  2KEE A;  4S3S A;  4DF7 A;  3HGB A;  2DNC A;  2IJ0 A;  2B8F A;  2BE5 D;  2KCC A;  3VR4 A;  4BY1 B;  1CK1 A;  4K8I A;  1I6V C;  1HTL D;  1LTB D;  1ENA A;  4X3K A;  1U4M A;  2EJG C;  5M5X B;  1WVL A;  5EQ0 A;  4KJO A;  3J81 L;  2EJF C;  4NW2 A;  2EYO A;  1NAP A;  1BQQ T;  3Q6S A;  4M8A A;  2NVQ B;  3T16 A;  4OO1 I;  1EWC A;  2B2W A;  1IL8 A;  4G7O C;  1LV9 A;  5K5P A;  1JB3 A;  5AFW A;  4A3D B;  4G57 A;  1DXM A;  4A3I B;  5M3M B;  4BBS B;  4FXD A;  1I4X A;  3A54 A;  1AN8 A;  1X32 A;  1G8Z D;  2ZXO A;  2F0G A;  1YNJ D;  4I7Z C;  5EKL A;  2F0T A;  3QOL A;  3OW7 A;  1Y8P B;  5CC4 A;  4DN4 M;  3K59 A;  3MXU A;  3EVQ A;  3KF8 A;  4C3H B;  5I9P A;  1EZ8 A;  3W2D A;  1AZQ A;  4M1U B;  1NR2 A;  3J7Y W;  4KD4 A;  4PMC A;  4XDX A;  2D9U A;  4ZK9 B;  2B8G A;  1QG7 A;  4HSP A;  3DEP A;  1S5F D;  3D8G A;  2EJM A;  1O7L A;  3TP8 A;  4DK1 A;  1D2B A;  1B50 A;  4DAP A;  2XWJ B;  1EYC A;  1EOT A;  4L63 B;  2K04 A;  1CI3 M;  2IT1 A;  4LK1 C;  4OO1 H;  1KDB A;  5F2D A;  3QWN A;  3LWE A;  4CJ0 B;  2HDL A;  1QOH A;  2L12 A;  4DXF A;  2EE1 A;  3CHB D;  1FNW A;  4F87 A;  2B39 A;  3AB9 A;  3M7G A;  5EPK A;  4GZY C;  4RGT A;  2EYP A;  2F4I A;  2WAC A;  5EPJ A;  4KKT A;  5J1Z A;  1F9R A;  3MFG A;  2JXM B;  5CV6 A;  1X3Q A;  5E1F A;  1FYC A;  4DNR B;  3TP7 A;  3NWS A;  3FPU B;  4O42 A;  4ODG A;  3P1H A;  1STB A;  1UUP A;  4EQN A;  4B9X A;  2FFK B;  4CJ2 C;  4IUR A;  1EY7 A;  1JCK B;  2BOS A;  1ILQ A;  5K36 H;  4OO1 G;  4RHR A;  1ZXT A;  1GUT A;  1BNZ A;  4KMU C;  2E2J B;  3M3Y B;  1CQV A;  1LT3 D;  4KHZ A;  1V43 A;  2R6G A;  1KTK A;  2J7Z A;  3K0Y A;  3JAM E;  4FF3 A;  3KK7 A;  4FF4 A;  3BVM A;  2PPB C;  2E2D C;  2EYL A;  5T1I A;  1ET6 A;  5KYL A;  1H9S B;  3FVQ A;  1MSG A;  4KI0 A;  4G7H C;  2RSN A;  3GV6 A;  4IAL A;  1JOR A;  2K03 A;  1IW7 C;  3DEO A;  3ND9 A;  5IT9 L;  3VYU A;  5EKI A;  2K5D A;  4MIU A;  4DK0 A;  5DEH A;  3VA7 A;  2MUY A;  4A3F B;  2O4X A;  3J7A V;  5C4H A;  1OXT A;  3PUY A;  3SK6 A;  5IIF A;  5K36 G;  3VR6 A;  5KND A;  5KIX A;  3S16 B;  5JOB A;  1EWH A;  4X3S A;  1BOS A;  1BBX C;  2D62 A;  4XYO A;  2A74 C;  1MSH A;  5KGU A;  1AEX A;  2DN8 A;  3U9O A;  4CJ1 B;  3V96 A;  1Q8I A;  3VYT A;  2J0T D;  3BYT B;  1TWA B;  2KVM A;  3H0G B;  3OIQ A;  4RA8 A;  5I4D A;  3MA2 B;  3DWP A;  1FNU A;  1JWU D;  3L7Z C;  2AQ1 B;  1SDF A;  3T51 B;  3MZ5 A;  1EY0 A;  2F0P A;  2B2T C;  2WB1 B;  1BF4 A;  4QB4 A;  1CZW A;  3DXJ C;  3PIP 3;  2WIN B;  3GO5 A;  3D4W A;  2D2C C;  1PTO F;  3VR5 A;  5D65 A;  4U68 A;  4TQU S;  1T5E A;  2K33 A;  4MHE A;  3MFY A;  5C3W A;  1L0Y B;  1KLG D;  2YYZ A;  2LKV A;  2RKS A;  2Y0S B;  4OL7 A;  5G3L F;  4B9W A;  4G4K A;  2BCO A;  1TII D;  2QIL A;  1RHP A;  1A6X A;  3GP7 A;  3TZD A;  5FO7 B;  5M5Y B;  4FXG C;  3KLR A;  4N9T A;  1EYA A;  1HHV A;  3HP3 A;  5COR A;  1HPC A;  3SK8 A;  5I2Y A;  4TKO B;  1V1P A;  1SYD A;  3DUZ A;  3T13 A;  1OXU A;  1EY9 A;  1XWE A;  3R2T A;  1CQF A;  3MXN A;  2Q8I B;  1IKL A;  1H9M A;  4C1N I;  5D3D A;  5DM7 3;  1S5E D;  4HAE A;  1KLU D;  1SE2 A;  5FLX E;  4IQZ A;  3DWA A;  2ICE C;  1VMC A;  3GTP B;  2R61 A;  3DMU A;  1O78 A;  3PMF A;  4IUV A;  5I2X A;  2E2H B;  4RWS C;  4FVM A;  2WKC A;  3NBH A;  3OIP A;  3S2H B;  4EVO A;  4C3H G;  4H0L C;  3R2I A;  2OEO A;  4A3E B;  4HMJ A;  1D1K A;  1PRT D;  1IYU A;  3K58 A;  4DU9 A;  2WII B;  1HCZ A;  1PTO C;  1O7Z A;  4XQQ A;  1SMY D;  2KQ3 A;  5E3F A;  5KEE A;  4RCO A;  3IL8 A;  2XIW A;  1SFO B;  3LX0 A;  1GUN A;  3OPO A;  2KA7 A;  2V4D A;  3VR3 A;  3DWQ A;  1FNV A;  2K05 A;  2C9O A;  3PV0 A;  3I8Z A;  1OXV A;  5IGD A;  1FR3 A;  2NN6 I;  1CHP D;  1A3V A;  2B2U A;  2FMM A;  1ENF A;  4HSV A;  4DAY A;  2L0C A;  5JAV A;  3GTJ B;  3S17 B;  1PRT B;  3PUW A;  5EBC A;  1TS2 A;  5IGF A;  1STY A;  2ENB A;  5COY A;  4RKL A;  2FJ2 A;  3SVM A;  1R4Q B;  3S1N B;  2OF1 A;  3NTK A;  1TR5 A;  3M4Y A;  2QEJ C;  4WFN 3;  3VYS A;  1M8A A;  3G7L A;  4ULL A;  1D5M C;  1SE3 A;  1V1O A;  4QIW B;  3LNN A;  3I91 A;  4OGQ C;  2ZT9 C;  1LTR D;  4KTA A;  1SNP A;  1WD0 A;  2CW0 D;  2KOL A;  2XWB B;  2AWO A;  4BBR B;  1KAB A;  3EA6 A;  3JAM L;  2F0D A;  4ZYS A;  5BN3 A;  3KUP A;  2PZW A;  2ICI A;  2EYJ A;  2NBF A;  2A6H D;  1WD1 A;  4V19 0;  2X6L A;  3CRL C;  1DON A;  2AQ3 B;  3NUC A;  1Y8N B;  1RF2 D;  1PFN A;  3OOC A;  1SE4 A;  4C3J B;  3TP5 A;  2NN6 H;  1VF5 C;  4QMG A;  5BN5 A;  1G2S A;  1U4L A;  2K5W A;  1TY2 A;  2IX3 A;  2FIN B;  2WV6 D;  5ELD A;  5C44 B;  3MTS A;  3K5L A;  4EGV A;  3QG1 A;  2FHT A;  4C1N K;  3K5N A;  2I46 A;  4UAI A;  2RSO A;  1ONL A;  4KY6 A;  1AZP A;  3E6Z X;  2QF7 A;  1I50 B;  1MI2 A;  4A93 B;  1TS3 A;  1DZ1 A;  1LO5 D;  1CFM A;  1EQV A;  3SK5 A;  3D31 A;  3IFT A;  1NCV A;  2F0Q A;  2KEC A;  5FOB B;  1EIH A;  5C0X I;  2JA8 B;  5C4X B;  2EDG A;  3NXW A;  3BG3 A;  4RAU C;  4J8Q A;  1S5B D;  3H6M A;  5HGT A;  1H9S A;  1OXS C;  2NN6 G;  4K8J A;  3N6R A;  1EL0 A;  2KUM A;  1CA5 A;  1ZYR D;  1C8C A;  4IFD I;  4K2L A;  5JJZ A;  1B3A A;  3K5M A;  3S9W A;  3I90 A;  4H13 C;  4KV6 A;  1PMR A;  1PLF A;  3I4N B;  4QCL A;  1EEI D;  1KDC A;  5I9O A;  5LL6 S;  2QCP X;  2F1M A;  2F0I A;  2R93 B;  1G29 1;  3S1R B;  4C56 C;  4UDU C;  4BA2 I;  2VXW A;  3R3O A;  2XN9 C;  3RZO B;  4C2M B;  5JVH 3;  1B1Z A;  1F9P A;  1RD9 D;  2D5D A;  3M85 A;  1SNO A;  3OWE B;  1K8O A;  4X3U A;  3GQB A;  2K1B A;  3D4D A;  5I6Y A;  3NE5 B;  4FXK C;  5C0X H;  3BDO A;  4F8M A;  2PYK A;  1Y1W B;  2N88 A;  4V0B A;  4A3K B;  5DAU A;  4I65 A;  1BR9 A;  4R9W A;  3IAY A;  1STH A;  4KHV A;  1U4P A;  3PUZ A;  2IWH A;  1HUN A;  4R8I A;  5JEA H;  3C1E A;  4IFD H;  1EEF D;  1TVX A;  2K7V A;  2SOB A;  4HCS A;  2RA4 A;  1Z7T A;  1MGS A;  4C3I G;  1RJT A;  3RD4 A;  2JE6 I;  1YNN C;  4HR7 B;  1W6K A;  5IGE A;  4IUU A;  3HOY B;  4HN7 A;  2PW5 A;  3I4M B;  3WOE A;  3T4A C;  2JYO A;  3ZYY X;  1HFN A;  2F0N A;  3BZD B;  3D4R A;  1TWC B;  2CVR A;  1CT1 D;  3Q22 A;  1Y8O B;  5C0X G;  2IX1 A;  3CQZ B;  2GA4 B;  2O5J C;  2BE5 C;  1JE4 A;  1RCV D;  1EIG A;  4ZRZ A;  3P20 A;  1PDQ A;  3UI2 A;  5M3F B;  2IL8 A;  1LTS D;  2N55 A;  5A2Q L;  3MXP A;  3X3N A;  5KRU A;  4O1N A;  2KHS A;  1NSN S;  2NVT B;  4IFD G;  3A56 A;  1H9K A;  1R4P B;  2A68 D;  3RLF A;  2DNE A;  2XRQ D;  1G6Z A;  3FDT A;  4TRD A;  2HQE A;  1PZI D;  2SNM A;  1D1I A;  1U9R A;  3J80 E;  4J1M A;  3GTG B;  2JA7 B;  1SYE A;  3Q0A A;  4HCE A;  4H7B A;  1HUM A;  2R92 B;  4IUT A;  1B53 A;  2B2V C;  1ROD A;  1EQT A;  3I72 A;  5C3X A;  3HS0 C;  1IYV A;  1Q1E A;  1A3T A;  1YNJ C;  1XXG A;  4DA2 A;  2HUG A;  5KYI A;  2EYF A;  3A7L A;  1QJO A;  4X3T A;  2O5I C;  3HOU B;  5CV5 A;  3Q23 A;  4K5W A;  2K5Q A;  3TN2 A;  1A2U A;  1G2T A;  4IUN A;  5CV7 A;  3GTQ B;  1V8Q A;  2A6E C;  1F9Q A;  4NDX A;  5JVG 3;  1EU4 A;  1S4Z A;  4PV1 C;  1LAB A;  3MC0 B;  2AUK A;  2DY7 A;  2A69 D;  2G9D A;  1IKM A;  2E76 C;  3MHB A;  1SYF A;  3NTH A;  1Z47 A;  3MXG A;  2AQ2 B;  2JA5 B;  2B2Y C;  3URY A;  3M7N A;  1BDO A;  4FF1 A;  1D5Z C;  1F77 A;  1E2W A;  1E2Z A;  3TME A;  3SDZ A;  4KN4 C;  1R9T B;  4OIJ A;  1MD2 D;  1DM0 B;  1FGB D;  1TS5 A;  1B4O A;  2EZV A;  3A8I E;  5JPN C;  3T56 B;  3BYY B;  1ICW A;  4DFA A;  5EPL A;  1J8I A;  2Z4H A;  4LAA A;  4NKL A;  4ZKB B;  1TQO A;  5C5M A;  1PYW D;  4CGY B;  2KED A;  2WKD A;  3HOV B;  3U9S A;  1BCP D;  2B2W C;  1F9S A;  4A3B B;  3FMC A;  1L0X B;  4KY7 A;  3WOF A;  1H9R A;  4AYB B;  1QIL A;  2Z4I A;  1RTO A;  1GUG A;  1F2M A;  3EJI A;  2F0K A;  3GD7 A;  4XTC S;  4ZQ3 A;  4BA1 I;  1S5D D;  4TSS A;  4WRD A;  4K2K A;  1LLR D;  1RDP D;  1WTR A;  4EQO A;  2JA6 B;  5IGC A;  3KLS A;  2M2L A;  1GXD C;  3S14 B;  1B2T A;  1K83 B;  4RKB A;  2XRS D;  1BUV T;  3OMG A;  2F3W A;  4BS9 A;  1BCP B;  3S1M B;  5DNF A;  1Z6H A;  1JC7 A;  3D6W A;  1HFG A;  3BDL A;  1SJE D;  3TZU A;  3A8K E;  4LJZ C;  2Z1C A;  4XIG S;  4BY7 B;  1B9N A;  1Q1B A;  4F88 A;  2F0E A;  5C4Z A;  3CKI B;  3DHQ A;  1RTN A;  1EFI D;  2QDB A;  3NHH A;  1W6J A;  1ZEQ X;  1QB5 D;  3TDQ A;  2A73 B;  2TMP A;  2IX0 A;  1GOZ A;  2EXZ A;  3SR1 A;  3S15 B;  2NTS A;  4QUF A;  1A2T A;  3Q24 A;  3EFX D;  1H9J A;  2MHV A;  2I07 B;  1II3 A;  4KN7 C;  5J39 A;  3H91 A;  3S1Q B;  4DGZ A;  1HQM C;  2PCF B;  2XSC A;  2CHB D;  5FO9 B;  1XX8 A;  2F0J A;  3RUZ A;  1LT6 D;  3PO2 B;  4FNF A;  3KBG A;  2G9H D;  3FPP A;  2RDF A;  5E4W C;  2F3V A;  5C6A A;  1NR4 A;  3KBX A;  4IUQ A;  2HDM A;  1SXT A;  1PRT F;  3WDN A;  1EYD A;  3BS1 A;  3QO2 A;  2ZXP A;  3BVG A;  5C0X J;  2K6A A;  4A3M B;  5JPM C;  2RDH A;  5D3I B;  1WTW A;  1JR0 D;  5NUC A;  2L5T A;  2Q8R E;  3OHX C;  1STG A;  1X3P A;  1TWG B;  5C4J B;  2E74 C;  5CMD A;  4RCN A;  2L9H A;  1SNQ A;  2JEB I;  1SYB A;  3O13 A;  5JEA J;  3CRK C;  1LT4 D;  4IFD J;  1DCZ A;  2PZT A;  1QWY A;  1B44 D;  3G6J B;  5ELC A;  5ISR A;  4KKS A;  3TP6 A;  2H4O A;  1JIC A;  4L6T B;  4PMW A;  2F0W A;  1LTI D;  3QJY A;  1O80 A;  1D5X C;  1EY6 A;  3HOX B;  1T5X D;  1ET9 A;  3I3C A;  4KY5 A;  3OMC A;  4QUC A;  2NYZ D;  3QB3 A;  1PFB A;  1I4Q A;  3I4L A;  3FKI B;  2XNA C;  1BXT A;  3RMH A;  1YNN D;  5D14 A;  5CYU A;  2B2T A;  4XXE A;  2L1B A;  1PZJ D;  2BDN A;  4PQX A;  4PNY A;  2VUM B;  2M00 A;  2IW3 A;  5KNC A;  1I4H A;  2X69 A;  2K01 A;  2PO4 A;  3SK4 A;  1M4V A;  2NZ1 D;  1GJX A;  1PRT C;  2RVL A;  1CZG A;  5IGB A;  5FKA C;  3QOJ A;  3MEH A;  3TSS A;  4XYQ A;  1VDZ A;  4ID6 A;  1QNU A;  1SMY C;  1ML0 D;  1CTM A;  2LY7 A;  4DAV A;  1AW7 A;  4ZUI A;  3ND8 A;  2SEB D;  2F0S A;  4XQN A;  1GHJ A;  5EGT A;  1SND A;  1E0B A;  1BO0 A;  2H1E A;  2KJX A;  4CKC A;  5I6W A;  1Y69 U;  3W3A A;  1TT2 A;  4CBV A;  5M5W B;  4KJN A;  4KD3 A;  1STN A;  3V2T A;  4DNT B;  1OO9 B;  1GUW A;  4A3G B;  1IW7 D;  2DY8 A;  5ELB A;  2RDG A;  5FO8 B;  1ZKO A;  3LWU A;  1JWM D;  5EBD A;  1MBY A;  2LMC B;  3GTK B;  4Q0F A;  4PMB A;  2MP1 A;  4EQP A;  2F0F A;  1PFM A;  4DXG A;  2NVY B;  3AU7 A;  3A7A B;  1I4G A;  5J22 A;  4R8N A;  2JSO A;  1G91 A;  1Q90 A;  3A55 A;  3MVV A;  5ELF A;  1FD7 D;  2QKI C;  1XTC D;  3PUX A;  3SXH A;  5FLX L;  4JK1 C;  2A6E D;  3RZD B;  2CW0 C;  2VB3 X;  1RKN A;  3C3L A;  1WTV A;  2LS0 1;  3MWY W;  1Y1V B;  3ERQ A;  1I4P A;  5KNB A;  5CBE E;  1QCB D;  1LTA D;  4U67 3;  5C3E B;  4CKB A;  4K6D A;  3K5O A;  2FMC A;  1J9O A;  1C48 A;  3S2D B;  4RGN A;  3SE0 A;  2A6H C;  2AUJ D;  2Z8L A;  3EQL C;  5A35 A;  5HUR A;  1I4R A;  4QF4 A;  3E5S A;  3E0J A;  3MAQ A;  1STA A;  3IFD A;  5E4X A;  2SDF A;  2EY1 A;  3HG9 A;  4FO2 A;  4HMI A;  2RQX A;  4MN3 A;  3NWT A;  1A3U A;  3D3R A;  3FRP B;  1DJR D;  1WTX A;  1QNK A;  1HA5 A;  2NB0 A;  2YU9 B;  4HTH A;  2F0M A;  2HCI A;  3A8J E;  4G7Z C;  4HED A;  1SBB B;  1I3Q B;  3C2P A;  5DM6 3;  1EY5 A;  2B2U C;  3ITP A;  4LMQ D;  5JEA G;  1KNE A;  4CKE A;  1GHK A;  4Z9C B;  4RGM A;  5CV9 A;  3R8B A;  3P7J A;  3K7A B;  5ELE A;  2L55 A;  5LL6 X;  2E2I B;  3HKZ B;  3PUV A;  1E2V A;  2J4X A;  2EYH A;  1F2Z A;  4WJW A;  1ZYR C;  1NUC A;  4B08 A;  1KDA A;  1SAP A;  4NP5 A;  3ONA B;  3VYR A;  1PXU A;  4OHJ A;  4XT1 B;  2EVB A;  4WOR A;  4N9P A;  1JOO A;  1ILP A;  3DM1 A;  3R93 A;  3H3V C;  1HA6 A;  4FP5 D;  1SNC A;  4L8J A;  4RHS A;  3HZX A;  4XQJ A;  4F7X A;  3SEB A;  3GTM B;  4JBW A;  1B9M A;  2MGS A;  1PTO D;  4NMZ A;  1TY0 A;  3HEJ A;  5CBA E;  1EU3 A;  4OIK A;  5FK9 C;  2PQE A;  5G3L D;  5IOC A;  2Q8T A;  1HQR D;  1LT5 D;  4KK7 A;  1CM9 A;  3C46 A;  1TWF B;  3P75 A;  3VR2 A;  3SHL A;  3F2U A;  4CHT B;  1TKW B;  1KNA A;  1ENC A;  1LTT D;  4C3J G;  2EY5 A;  5CGK A;  1UAP A;  5BN4 A;  1Q3L A;  1EZ6 A;  3QIA A;  2ID0 A;  1PTO B;  2KCN A;  3J81 E;  1K8M A;  2WAQ B;  4FYD A;  2AWN A;  1JQY D;  1ESF A;  2F0L A;  2TSS A;  3IKJ A;  1SNM A;  1LAC A;  2BDO A;  3I73 A;  2EOT A;  1OXX K;  2PNR C;  3GV3 A;  4RH6 A;  2PW7 A;  2SNS A;  4ZUJ A;  1HTP A;  4K6L A;  1S5C D;  3N52 A;  4BWG B;  2LFN A;  3NPP A;  2JEA I;  2OXP A;  1DOL A;  2CQA A;  1DYQ A;  3J7A F;  3GTL B;  1JWS D;  3T53 B;  2JP1 A;  3NQT A;  5CV4 A;  3PIO 3;  1WTP A;  1JOK A;  1A15 A;  1PZK D;  5CV8 A;  1JOQ A;  2NUC A;  5TSS A;  1DD2 A;  2ZXR A;  1F2L A;  3HOW B;  2BA1 A;  3HRZ C;  1IHZ A;  2E75 C;  2PZU A;  5T1G A;  2C5C A;  1C4Q A;  5IOD A;  4K14 A;  3H94 A;  1WTO A;  2A68 C;  1F2Y A;  2PMZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...