2B2YA

Tandem chromodomains of human chd1
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
176
structure length
175
Chain Sequence
EFETIERFMDCRIGRKGATGATTTIYAVEADGDPNAGFENKEPGEIQYLIKWKGWSHIHNTWETEETLKQQNVRGMKKLDNYKKKDQETKRWLKNASPEDVEYYNCQQELTDDLHKQYQIVGRIIAHSNQKSAAGYPDYYCKWQGLPYSECSWEDGALISKKFQACIDEYFSRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Double chromodomains cooperate to recognize the methylated histone H3 tail.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
molecule keywords Chromodomain-helicase-DNA-binding protein 1
total genus 53
structure length 175
sequence length 176
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2005-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2b2yA02
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2b2yA01
2KUMA 1WTRA 2K28A 1B3AA 1RJTA 2B2UC 2R3ZA 3KBXA 4DN4M 4RA8A 5CBEE 4IUUA 1WVLA 2FMMA 3QO2A 1CA6A 4IUVA 2B2UA 1XX8A 4CJ0B 1ILPA 1F9PA 4X3SA 1G91A 4HSVA 3MTSA 1F9QA 4MN3A 4U68A 2RA4A 3D6WA 1HFNA 2SDFA 4NW2A 1RTOA 3R93A 1TVXA 2B2TC 2K01A 5CORA 1WTPA 2X69A 1IKLA 4HAEA 4XDXA 1HA6A 1U4MA 3I91A 2CVRA 5JJZA 2L12A 1IL8A 2MJ8A 3DEOA 1B53A 1O80A 1BF4A 2B2TA 2BDNA 1MSGA 3HP3A 2M2LA 4X3KA 4IURA 1DOMA 2JYOA 1JE4A 1PLFA 1ZXTA 2FHTA 1X3PA 4ZK9B 1SSOA 1B2TA 2KOLA 5E4XA 2H1EA 2L1BA 5D65A 1M8AA 2EOTA 3DM1A 5EKIA 1PFBA 2DY8A 2B2VA 2FFKB 1RHPA 1EOTA 3LWEA 1J9OA 1PDQA 1U4LA 5DNFA 1NR2A 3I90A 1GUWA 1PFMA 4MHEA 1MSHA 5EQ0A 3TZDA 3N52A 2MPMA 4IUTA 1VMCA 2Q8TA 2L9HA 1ESRA 1SDFA 2EE1A 4HEDA 1F9SA 5CMDA 3SVMA 1CA5A 4IUPA 1G6ZA 3IL8A 2HDMA 4ZLTF 1NAPA 1MGSA 1IKMA 3I8ZA 1XYIA 1U4RA 3GV3A 4ZKCB 4R8IA 1DONA 1B50A 1HFGA 4CJ2C 2B2VC 4IUQA 1F9RA 1LV9A 4R9WA 3G7LA 2MP1A 4OIJA 4CJ1B 2NWGA 2L4NA 2HDLA 1F2LA 4X3TA 3F2UA 4UAIA 1AP0A 1EQTA 1U4PA 3UI2A 3ONAB 3I3CA 5T1GA 5EPKA 2X6GA 2NZ1D 1JICA 4X3UA 2K1BA 1B4OA 3GV6A 2N55A 1AZQA 1SAPA 1EL0A 1Q3LA 1QG7A 1RODA 5COYA 2RVLA 1HHVA 1O7ZA 2KECA 5EPLA 1MI2A 3FDTA 4HCSA 4OIKA 1AZPA 1BBXC 2L11A 1KNEA 2D9UA 2N88A 1WTOA 2HUGA 1WTVA 1ICWA 3P7JA 1O7YA 2EPBA 4QUCA 5T1IA 5CBAE 1C8CA 3FPUB 2NYZD 4XT1B 2MGSA 1NCVA 2X6LA 2K03A 1G2SA 1ILQA 3DEPA 1WD1A 1RTNA 5EPJA 2IL8A 1BNZA 2HCCA 1WD0A 2HCIA 4ZKBB 1S4ZA 1WTXA 1NR4A 1J8IA 2FJ2A 1KNAA 1EIGA 1HUNA 1QE6A 3IFDA 3MWYW 2JP1A 1QNKA 1EIHA 5E4WC 3Q6SA 2XIWA 4ZAIA 1X32A 2FINB 2KEDA 1VMPA 1ML0D 3H91A 2J7ZA 1PFNA 2RSOA 4RWSC 1CM9A 1WTQA 4O42A 2B2YC 1WTWA 5AFWA 2K05A 3TN2A 2B2YA 4RAUC 2B2WC 1DZ1A 1HUMA 2KEEA 2K04A 4XT3B 1A15A 2DY7A 2KVMA 3KUPA 5EJWA 2Q8RE 5D14A 2B2WA 1DOKA 1G2TA 2RSNA 1DOLA 4LMQD 1BO0A 2VXWA 1HRJA 1X3QA 1E0BA 4QUFA
chains in the Genus database with same CATH superfamily
1BVSA 2JA7G 4JVZA 4KLKA 3GD7A 3T4AC 3MC0B 3S9WA 3VYRA 4LFBQ 3CCVA 4X66Q 4MN3A 4DR3Q 4IFDG 2F0SA 5FLXc 2L5TA 4DV7L 4MNOA 1GUOA 2RCFA 4JV5L 1WCMB 3H15A 1C4QA 3KLSX 3DHQA 1BF4A 2B2TA 3BDCA 3QJYA 5FJ8H 5E3FA 4UP8A 2YV5A 2EJFC 1OXXK 4DAYB 1RF2D 1RL2A 2F0IA 2E74C 1NSNS 4A3IH 1D8LA 3S1RH 4CDCC 2E2JB 2I07B 3QR8A 4L8JA 1QWYA 1SE8A 5LMUQ 2CWPA 1MSHA 2PCFB 3OWEB 1M4VA 4IUTA 2O2LD 2EZVA 4NP5A 1YEZA 2OF1A 1TWAH 1SE3A 1KDCA 2YYZA 1SDFA 2EE1A 5CMDA 4ODGA 4CKBA 2ZJRA 3K80C 5M3MB 2DJGC 3MFYA 4OX9Q 3G71A 3MEFA 4HJAA 1D1IA 5M5XB 1AN8A 1V9PA 1NY4A 2C35B 4C2MB 4XQQA 5IT9E 3J7A5 2F0OA 4X3UA 3M3YH 1K8AC 2N55A 4XYOA 4Q5VA 1EEID 2D2CC 1QG7A 2ES2A 3ZYYX 2EQSA 4OIKA 2UUBQ 2R7DA 3A54A 5IODA 1WTOA 3OW2A 4LF9L 3EA6A 2RKSA 1FNVA 1NCVA 3A55A 3HS0C 2K03A 1G2SA 2E76C 1WD1A 2SOBA 2HCCA 2QEXA 2NVXB 1NR4A 1XNQL 1DGSA 2NB0A 1V1PB 2HHHQ 1QE6A 2V1CC 3J81i 2RBMA 1VQGA 1K0RA 1YJNA 5JVH3 1E1OA 3HOZG 2B8FA 2RF4A 4O42A 3OIQA 1A63A 1CKNB 5IGCA 1SFOH 2F3IA 1DM0B 4A3DB 1ASYA 3EN2A 3DLLA 2KEEA 1A15A 2R61A 5KIXA 3VR3A 4JI4Q 3C3LA 1A2TA 1G51A 1G6PA 4BBSG 2RHQB 4RMFA 2B63H 1ZEQX 1XNQQ 3M4OH 2MNAA 3EIVA 3B6YA 1A62A 1M1KC 1N9WA 2G5DA 2YTXA 3HOWH 1EQRA 1GHJA 2OTJA 4F8MA 3I2ZA 1LTRD 2KCTA 2SDFA 1KLGD 4GN4B 4C3IB 5JJZA 4CKEA 5G3LD 3SK8A 3DEOA 3V96A 1D6EC 3A8KE 3HP3A 3OIPA 1DXMA 1HNWL 1IHZA 4ME3A 3GTQB 1SSOA 3NPPA 2TSSA 4NPSA 2BH8A 1TWGB 1V8QA 3ND8A 2GN5A 4KMUC 4OHJA 5C4ZA 5IYDH 2CH4A 5DNFA 2NVTH 4WJ4A 2CH4W 3T53B 3H3VI 5IGDA 1HZBA 1XTDA 1JB3A 4RGNA 4KKSA 1XMOL 1XPUA 4JI8Q 2F0DA 1SRUA 3D0FA 3I4MG 1G6ZA 3CRKC 3URYA 4A3EB 2E75C 1I3QH 4ZKCB 2CCZA 4APVA 1LTAD 1HNZQ 3VA7A 1DJRD 2HHHL 2VQFL 3H3VH 5C4JB 1SNCA 2PI2A 1QUQA 5C6AA 4MIUA 3K59A 1FVIA 4IPHA 1U5KA 3GTOH 3FEWX 3I4NB 1WI5A 4KHPL 1I4PA 4DR4Q 1K3BC 3D6CA 1QVGA 1PH9A 1QZHA 1JR0D 4B3TL 3W1GA 1VF5C 4OONA 3I4NG 1EQQA 1D5ZC 2H5XA 2EYPA 3DEPA 3WDNA 2K5DA 1CKNA 3K7AB 1PYWD 1WD0A 1T9HA 3JC66 3FP9A 3JAMc 4NMZA 4RHSA 2M9VA 4IPGA 4JW0A 4WORA 4JBJA 2Z0SA 4PZ7A 1C48A 2Z9HA 4ZUJA 5FK9C 4P71A 2F0UA 1DCZA 5JOBA 4DF7A 3L3OC 4KKUA 4RCOA 3KLSA 4OO1I 4CHTB 3F2BA 4G57A 1K8GA 2WINB 3D4RA 3KK7A 1J5EQ 3S1RB 3SE0A 1VCIA 3KF8B 4KN7C 4YWMA 2I0QA 4IUUA 1QVCA 2I5MX 4LAAA 3CMAA 2MO1A 4BY1H 5K36H 4CJ0B 1F9PA 3MTSA 1F9QA 2Z6KC 2B63B 1HFNA 4DK3C 5FO9B 2WFWA 1PH6A 1N36L 3HOUH 1TS4A 1XXGA 1NNXA 1HNXL 3S16H 1WJJA 4P73A 2KENA 1J5EL 1OXTA 3H94A 3AYHB 1N33L 2EY2A 3LX0A 1C9OA 2KCNA 3RMHA 1B7YB 3SK6A 1LYLA 1PDQA 4WFN3 4JBMA 2RDGA 3MXPA 5M3FG 2LS01 3PIPA 4QF4A 2BE5C 2F0LA 1YNJC 3L9AX 4B3RQ 4KN4C 4DUZL 1CSQA 3C2PA 3PIOA 4K5WA 4DV6Q 3Q22A 1BR9A 2JK8A 4HN7A 2IW3A 3G7LA 1VQFA 2YTVA 4X64L 1PA6A 2ZXPA 1CZWA 4LF8L 4JYAL 4C2MH 3PO3G 4DKAC 4IOCA 2NZ1D 1UUPA 2JSOA 4LF9Q 3CCJA 1SAPA 1Q3LA 5I4DA 1FGBD 5FKAC 1K8MA 1Y1VH 2KHJA 1AZPA 2WKCA 4UP7A 3OWFA 1O7YA 3JAMi 2EPBA 4LF4Q 4O2DA 4DXGA 1ILQA 1EY4A 4QY7A 4LF8Q 3NTKA 2EY5A 2WACA 3TZUA 2NTTA 1EIGA 1TT2A 3IFDA 5CC4A 5IY0A 1D5XC 5E4WC 5C4HA 2XIWA 3A5ZB 5M3FB 5DM63 4B3MQ 2ICIA 5IP7G 5IT9c 1AH9A 3VDYA 2NVYB 2N8NA 2DJFC 1HNXQ 2SNSA 2K14A 4DFAA 1LLRD 4F7XA 5BR8L 3J81E 1HTLD 1BCPC 5DM73 2JQOA 2B63G 3RR5A 1HRJA 3PUZA 2PNHA 1RJTA 4FDBA 2UXCQ 1YIJA 5DAUA 3SXHA 3MVVA 1VQEA 1VQJA 3D8GA 5JVG3 2IY5B 3L0OA 5JPNC 3CW2C 2MUYA 1JOKA 4LF6L 4C1NK 3PMFA 2KHIA 4IZ8A 4C3HB 4K2LA 3J81c 3A7AB 1RTOA 3RD4A 1IKLA 4BWGB 4YHHQ 4J6HA 4DGZA 4M1UB 4BY1G 2PMZB 2VQEL 3VYSA 4LUOA 4X3KA 2JA7H 3CPFA 4Y7NB 1KHIA 1K83H 4P72A 1JMCA 4LK1C 3UDXA 1H9SA 1AEXA 2CWAA 3NWTA 4B3SQ 1RHPA 3HG9A 1A3UA 5ELNA 3DWPA 3RLNA 2ENBA 1B1ZA 1PFMA 5EQ0A 1A0IA 4A75A 3NELA 3J80i 1BBWA 2K75A 5LMNW 5KNDA 4KV6A 1F9SA 1YVCA 5IYBH 4LF4L 1GOZA 4DUYL 3I4OA 3GV3A 4LFAQ 2E2HH 2O4XA 3I7FA 1B50A 3K58A 4LF5L 1SXTA 1KL9A 3I4NH 4OWTB 4OGQC 1ZKOA 3V05A 1YHBA 4YIJA 3SDZA 5CGKA 4CJ1B 1K28A 2J0TD 4JI3Q 2A1AA 3CU7A 3NHHA 4TKOB 1PRTC 2UXDQ 4K5VA 1JICA 3HGBA 2D62A 1EL0A 4YCVA 1RODA 3EQLC 4TQUS 4A3FB 1IYVA 4C3IG 3GTMH 1UEAB 4NKLA 1MI2A 5EPLA 3FDTA 1TU2B 2XN9C 3M3YB 3I70A 4JC0A 1VQ6A 1RDPD 2F0JA 4QIWB 4BBRB 4FF4A 2Y0SB 4YCUA 4BA2I 3VR5A 4AQYL 5AJ3Q 2KQ3A 4OELB 5M5XH 4IOAA 1SFOB 3Q6SA 4K8JA 1LTTD 3HRZC 1A3VA 2KEDA 2MFIA 3PO2H 1ML0D 4HIKA 2O5JC 5A2QL 4A3BB 4XIGS 1GJXA 1HR0Q 1SYDA 1H9JA 2ZTCA 3PF4A 5A2QE 3M4PA 1B44D 2RHSB 4DUYQ 1YNNC 4ME5A 5I2XA 4HJ5A 3DMUA 3OPOA 4RGOS 4QUFA 2KUMA 1EIYB 1JJ2A 1EWIA 3VYUA 4JI3L 5IP9H 1EWHA 3ER0A 1Q46A 1EUJA 3STBD 3TRZA 1TVXA 2K01A 2UU9Q 4XDXA 4DK6C 5ISRA 1Y1WH 1F2ZA 3T16A 2NVQH 3HOYG 1STYA 5C3EH 1JE5A 2M2LA 2QGQA 1ICFB 2KBNA 4A3MG 1XPRA 3CCLA 2EOTA 5CV4A 1VQ5A 2B2VA 2UUCL 1XMQL 2N78A 1X6OA 2R92G 1CKOA 4HIOA 1PFSA 1X3EA 3PIP3 1HTPA 1L0YB 3K8AA 4N9PA 3SVMA 1FR3A 4EQ5A 3CHBD 1HQRD 4A3EH 1Z47A 4CJ2C 2F3VA 4DV3L 1SYCA 1P16A 1STGA 1Y8OB 3HKZG 1LTGD 2LXJA 4JI1Q 4C56C 1F2LA 2E5LQ 3FKIH 4A3KG 3H0GH 2TMPA 1TS5A 5JAVA 2B39A 2XRSD 2L55A 5JEAG 3QOLA 1TQOA 1H9RA 4PMCA 1WCMG 2IX3A 1XNRQ 1EZ6A 2K4KA 1VQHA 4AYBE 2QCPX 2RQXA 1N32Q 1L0XB 1QUQB 1PH7A 3IAYA 4DV0L 1EWCA 5EPJA 1FNUA 3QIAA 5IYBG 4ALPA 3TSSA 3NQTA 4C3HG 3CCMA 1VQKA 3DXJC 3E9IA 1JWMD 3H0GB 2V4DA 2VUMG 1VQ9A 2WB1G 4ZQ3A 2XSCA 1X3FA 4G7OC 2KVMA 1GO3E 5FLMG 2A69C 3H09A 5M3MH 1EFWA 3BDLA 5TSSA 1ENFA 4X65Q 3HFZB 2VXWA 3M85A 2AQ1B 4JOIA 1II3A 3KDFB 5CBEE 3RN5A 1TIID 2F0QA 1PYBA 2NZOA 1AE3A 4OL7A 3FMCA 1Z6HA 4YHHL 3DWQA 2R92B 5C44B 4DR7L 2VQEQ 1PH4A 4ULLA 1V1OA 1K83B 3I91A 3NK9A 2WAQE 3ERQA 3E5SA 3M4QA 4A3LG 4A3MB 1GUTA 1K3RA 2BDNA 3CQZB 1MSGA 1PTOB 3SK4A 3HOYH 1ZXTA 4GOPB 3AB9A 3AQQA 4RKLA 4JI1L 1B2TA 3S17H 4DA2A 3M7GA 1Y1WB 1Q8IA 2AKWB 1A2UA 3DM1A 1KXLA 1KRTA 4Q0FA 1KAAA 1JC7A 4DV2Q 5FO7B 4P75A 1Z9FA 1N33Q 2L9HA 3TP8A 4LFBL 1F77A 4JI0Q 1ZYRD 1I4GA 4NDXA 3L7ZC 3T1YQ 1VQ4A 2K33A 4A93H 4H13C 4IUQA 4PNYA 1S72A 1V1PA 3PF5A 4OIJA 2AUJD 3G6JB 4KY7A 4X3TA 3D3RA 3S2HB 1AP0A 4DV1Q 3S14H 4B3RL 2XRQD 3NE5B 2K1BA 3GV6A 2PNRC 4A3KH 2PZTA 4B9XA 1O7ZA 2L11A 2CKZB 3S16B 2D9UA 2OEOA 3HOUB 1B9MA 3P7JA 3S1QH 3KLWA 3CF5A 2BE5D 1VQOA 5D3IB 1PZKD 1STNA 4DR6Q 1X54A 3M7NA 5C3EG 2UXBQ 3S1NH 4N8X1 1K0SA 2Q2TA 4A3JB 1IBMQ 1CTMA 2CW0D 2FINB 1K9MC 2J7ZA 4O0AA 2A68C 1CSPA 2R7ZH 3S24A 4KY6A 1TY0A 2WAQG 5IP9G 3I56A 3A74A 1HZ9A 2VB3X 2JA6H 1HUMA 3BG3A 4A93G 3I73A 1O78A 2JE6I 3SGIA 1ASZA 1X3QA 1TWCH 3HOUG 1VQ8A 2K28A 2F4VQ 3BU2A 4U673 1OXSC 1TXYA 3DM3A 1XWEA 1HXYD 2JA6G 2K5WA 4X3SA 1VQPA 4HSVA 5DLQE 1VQLA 1X56A 4XYQA 3E3XA 4NW2A 1C0AA 2SNMA 2B2TC 4GN5A 1E22A 1LTBD 1OO9B 2Z1CA 5C0XI 3T1YL 2MJ8A 3E6ZX 5J22A 4UPAA 2XTIA 5C44G 1ESFA 3E9HA 1QCBD 5E4XA 4KJOA 1GHKA 5K5PA 1TKWB 3LWEA 2OCEA 4Y7NH 1DD2A 4H02A 3S1MH 2EYFA 3ICEA 1MBYA 5ELDA 3N52A 4NXMQ 3CCSA 4KHZA 3KJPA 5IGFA 2OQKA 4C3HH 1LTLA 2BH2A 1K73C 1BDOA 1MGSA 1N34L 3KDFA 2UUAL 4R9WA 5LL6S 2VUMH 3QB3A 4GKJQ 3A0JA 3I3CA 3SEBA 2ZJPA 4XQNA 1HR0W 3GTGB 2D5DA 1EFID 4BY1B 4HCSA 4RKBA 4EQOA 5L37A 2JA7B 3P1HA 2UUAQ 5HY6A 2KCCA 2EXDA 4LW1A 2PZUA 2LSSA 2WIIB 1STBA 4A3EG 2HCIA 3S14B 1CI3M 1EIHA 4JI2L 4JI5Q 3N6RA 1QILA 3H91A 2IWHA 1VQIA 1EIFA 1SNDA 4A93B 2R92H 5AFWA 3EVQA 1TR5A 3KF8A 1EZ8A 1PHJA 4F87A 4MTNA 2EVBA 3ND9A 3PUXA 4K14A 4HJ8A 1G2TA 2R7FA 1SROA 1PRTD 3D4DA 1B3AA 2B2UC 4A3CG 1NMGA 1R4QB 2A68D 5M3FH 2SEBD 1XX8A 1YZ6A 1WOCA 3I55A 4DAYA 3HOVB 3D6WA 5IYCH 5I6YA 3W3AA 2JA6B 3Q0AA 3HOYB 1LACA 2N49A 2CVRA 2OT2A 4A3MH 4DV5L 3C46A 4DR5L 3CCRA 1A3TA 3G6EA 1VS0A 1Y1VB 5IT9L 3HKSA 1X3GA 3OHXC 1X65A 5GAHC 1SJHD 1CZGA 2KHSA 5ELOA 3M4OB 3D4WA 3TZDA 1S5FD 3R8BA 3TS0A 1Q8KA 1I4RA 4OEMB 1EU3A 5DEHA 4PZ6A 3P75A 2NVTB 1SNPA 1Y14B 4A3KB 4XQJA 2F0HA 1IBLL 1NAPA 2A74C 1TWGH 2IX0A 3CAMA 1LO5D 1UEBA 3EBEA 3J7AF 5C3XA 4R4QA 4GLVB 2Q2UA 5FLXL 3KLRA 2Z4IA 3PO2G 4PV1C 1PMRA 3UI2A 2DUDA 4C3IH 4BBSB 4AIMA 5JJIA 2HQEA 4J1MA 4JV5Q 5EKKA 5BN4A 2EYMA 5LL6X 2KECA 1IBLQ 4CDEC 4QL5A 5C3EB 2N88A 1CHPD 2HUGA 1ICWA 4AQYQ 5GAEC 5T1IA 2PW7A 1A8VA 1JWSD 3FPUB 3K5LA 4XT1B 2OWOA 2QA4A 1CUKA 4DUZQ 1QZGA 4MZ9A 1PTOD 2O5IC 2JN4A 4FXKC 2EY1A 4DR2Q 1LTSD 4GLXA 5M5WB 4EQPA 4QMGA 2RSOA 2ZM6Q 3R2IA 3EJIA 5AJ3L 1AFPA 4P2CB 1S5ED 2AWOA 4JPBW 5JPMC 1IYJB 1SNMA 1FYCA 1HZCA 2F0TA 5J1ZA 1SEBD 4DV4Q 1EYDA 4LMQD 2F0NA 1PH3A 2E2HB 2E2DC 2B2UA 2JA5H 1JORA 3OW7A 2K5NA 5FOBB 2F4IA 3E0JA 5I6WA 4NXNL 4AYBG 4CGYB 5IYDG 1IBKQ 1UE5A 4GOPC 4B3SL 5KNBA 2F0WA 1HQMC 3EROA 1EY7A 1RCVD 1B53A 4KD4A 2D0PA 2UUCQ 3OTOQ 3CC2A 4PQXA 4QCLA 3AMUA 3PGZA 3RZDB 1M8AA 2F03A 3I4MB 1OTCA 3F8TA 1J9OA 1HA5A 4GOPA 3TREA 4NXNQ 3S1MB 3V2TA 5EBCA 1YJWA 4J15A 4DAMA 4IO9A 1VQMA 4AYBB 2PMZE 5G3LF 3W1BA 1XMQQ 5IIFA 1JJCB 1BCPF 1FNWA 2GA4B 3CCQA 1CA5A 4S3SA 1E2ZA 3AEVA 1XYIA 2R93H 4E6IA 1E2WA 1E1TA 2ICEC 3IFTA 2K5HA 4A3DH 2MP1A 1HNWQ 4IFDJ 5ELBA 4LUZA 3KF6B 2PQAA 3BYTB 4I65A 3HOZH 1Q12A 3HOZB 3K0XA 5LMUL 1EY6A 4K0KQ 1WCMH 2L0CA 3K57A 4JI0L 3VA5A 2WB1B 2CFMA 4ZUIA 2ZJQA 3EFXD 5HURA 4BBRH 1SLJA 2WB1E 5I9PA 2E5LL 3CMEA 1ET9A 3TP6A 1STEA 3K81C 4R1JA 2LFNA 3NBHA 3Q8DA 2A5HA 3K5MA 4P74A 3RLOA 5KRUA 5CBAE 5C0XH 1G8ZD 3LWUA 5D3DA 4JG2A 4OWXB 1SYEA 4MTKA 4EVOA 2EYOA 5CV5A 1J8IA 4IPCA 2HD3A 2F0FA 3BDOA 4LF5Q 2NUCA 1LT4D 2F52A 2JA8H 3KFUA 2NVQB 1B70B 2B2YC 4C1NI 4A76A 1I4HA 3AFQA 3CKIB 1K8OA 1L1OC 2A6EC 2YU9B 3T56B 4AH6A 3GTJH 2B2WA 3HKZB 4HMJA 1M90C 1EOVA 3NBHB 4LNQA 1PRTF 4WRDA 1WVLA 1Y8NB 4RA8A 4DNIA 3F2CA 1PYSB 4GNXA 5IGBA 1Q1BA 2F0PA 3FHWA 3OSOA 3STBC 1EY9A 2K7VA 5GROA 2EJMA 3K6OA 1V1QA 2Q2HA 3CD6A 1SYGA 2QDLA 3R93A 2K6AA 5IP7H 1WTPA 5C5LA 2JEBI 1MIUA 1QVFA 4FO2A 5CV8A 1IL2A 2CQOA 2GVBA 1WYDA 3A56A 1H9SB 1PLFA 4LF7L 2H4OA 4ZK9B 1STAA 5C0XG 2H1EA 4X62L 1S5BD 2RCNA 1PFBA 1PH5A 5HGTA 1EOTA 3J7ZC 4IFDH 4DAPA 3Q23A 1GUSA 4B9WA 3G48A 3S1NB 3TBIB 3NEMA 1V43A 2N3SA 3HOXH 2MPMA 2A8VA 3FPPA 1SNQA 5JEAJ 1BUVT 4DPGA 1I94L 1S3OA 1WFQA 1BCPD 2F0GA 2L15A 4RG1A 5EKLA 2VUMB 4K6LA 4YY3Q 4LF7Q 1N36Q 3MXGA 1C7YA 2B2VC 3JAML 1LV9A 2EYJA 2OQ0A 4JI2Q 4FF1A 1ONLA 4UDUC 1MJEA 4HTHA 3TQYA 1E24A 1BQQT 2G9DA 2HIXA 5BN3A 1EY5A 3AFPA 4IALA 3LGJA 2BCOA 4CKCA 1H9MA 2ZXOA 5COYA 3T1HL 3GTGH 1G291 3GTKH 1BBXC 4GNXB 3NQIA 1HNZL 2EY6A 4A3IG 3H3VC 3PUVA 4L63B 1DYQA 3R2TA 3HZXA 4BXXH 2XGTA 3TEHB 2NVYH 4POFA 4L6TB 2KA7A 2JJQA 2ZM6L 2EYLA 1YHQA 2F0MA 4DXFA 4UY8C 2CQAA 1SMXA 2CHBD 4R4OA 1WTQA 2A69D 2LKVA 1J6QA 5GAGC 2P5ZX 2B2YA 3A5UA 1KC8C 3BVMA 2C5CA 3J81j 1LTID 3GTLB 1DOLA 4JI5L 3I4MH 5D65A 5M9OA 3TDQA 4DN4M 2BA0A 3KBXA 4X66L 5GQOA 4IUVA 3HOXG 3PV0A 3Q24A 4DV0Q 2JXMB 1TS2A 4ILWA 2NTSA 1BCPB 1JB7A 2ZT9C 1XMOQ 4U68A 4FYDA 3FVQA 5CORA 4HAEA 1FJGQ 1AE2A 3ERSX 1U4MA 1IL8A 3BYYB 2G9HD 3R3OA 2QKIC 4H7BA 3O13A 1JE4A 4R4TA 2E2IH 2FHTA 4BY7B 1MHWC 1Q81C 2AHOB 4ABNA 4X64Q 3ULPA 2DY8A 3TP5A 4X65L 2VW9A 4B3ML 3MEHA 4V190 3HOWG 5E7NA 4K8IA 3VR2A 1N34Q 1I6HH 2RDHA 2K32A 2Q8TA 1JCKB 1VQCA 2WAQB 2DGYA 2QW7A 2HDMA 4FP5D 4A3BG 4UHVA 1IKMA 2D0OA 2NBFA 4EX5A 2VNUD 1X55A 5LMNQ 5F2DA 1MJCA 2BDOA 1UNSA 2E2IB 3OMGA 3GTPB 2KJXA 1F2MA 1SE2A 2Y0SE 1Y1VG 3PSIA 1I50H 5T1GA 3U9OA 4BBRG 2X6GA 1AZQA 1IW7C 1XTCD 1GM5A 3J81L 3C1EA 2LY7A 3S2DB 1KIXA 1PRTB 4KKTA 3F2DA 2UU9L 3MZ5A 3RZOB 4QB4A 4C3JB 5FO8B 4QUCA 2X6LA 3T13A 3GP7A 2A6ED 1W6JA 1BNZA 4A3BH 2R7ZB 2WP8J 2UXCL 2XNAC 5IOCA 2LXKA 5IWAL 2JP1A 1TWHB 2F0VA 4F88A 4OWWB 1PZJD 2PW5A 1X32A 2PPBC 2WKDA 3S15B 4GN3B 3NSWA 1NJIC 4KD3A 1EEFD 5IGEA 4GS3A 4RGMA 4XT3B 2F0EA 4TRDA 1IW7D 3FKIB 2Q8RE 2QILA 5D14A 2ATWA 4A3CH 3HOVG 4HSPA 1PXUA 5M5YB 1CHQD 1E3PA 4HIMA 4HMIA 3GTKB 5IYCG 4JYAQ 3X3MA 2QF7A 5KNCA 1YI2A 2RA4A 1S5DD 3PUWA 3E0EA 3GTQH 1VDZA 5C4JH 2X69A 1CQVA 3NBIA 4OX9L 1IBML 3UE0A 2JA5G 5EBDA 1HR0L 5LMNL 1CFMA 1W3SA 3KF6A 4IURA 3LNNA 1GKHA 4O1NA 4N9TA 4K0KL 4PG3A 2L1BA 4ZCKA 4B08A 2LMCB 2RDFA 3K7AH 1I4QA 1EQVA 1UE1A 3GQBA 4YCWA 1P8LA 4L5QA 5LHY1 4TSSA 2B29A 4OO1H 2OXPA 1VMCA 4HEDA 1Q86C 3WOFA 3P20A 5BR8Q 1HFGA 4H44C 4CDFC 3GTLH 1SJED 3HKZE 1NBWA 2IPKD 3BZCA 4R4IA 2EXZA 1BXTA 1IYUA 2PQEA 5KEEA 1EQTA 4DR4L 3S2HH 3PCOB 2FMCA 1X9NA 4JI7Q 1TWAB 1B4OA 3H0GG 4DV1L 2RVLA 1B8AA 1VQBA 1N8RC 4K6DA 1JOQA 1KNEA 2E2JH 1WTVA 3UDFA 4LFCL 1VQDA 2PZWA 4HJ9A 3GTPH 1I4XA 1EY0A 1TS3A 2ZTDA 2F3WA 5FJ8G 2FJ2A 4KK7A 3NUCA 3IKJA 2R93B 1S40A 1XJVA 1VMPA 2JA8B 4RWSC 1ZYRC 1CM9A 1B9NA 4DV2L 1WTWA 3MHBA 4IN3A 3SK5A 4GKKQ 1U0LA 4ZYSA 4L5SA 1YNND 3CC7A 1LABA 3KUPA 5EJWA 4X62Q 1NUCA 4IQZA 1YNJD 4NB3A 1PVOA 1BO0A 3GDEA 4IJLA 4ZAIA 5ELFA 3UDIA 1STHA 2ID0A 4C3JG 1JWUD 3QO2A 1NMFA 4DV4L 3W5OA 4OXPA 4M8AA 1EYCA 1S5CD 2KCMA 3NENA 3S2DH 1H95A 5A35A 3PQIA 1JOOA 2J4XA 2M00A 1U9RA 4JI4L 1HA6A 3CCUA 4DK1A 1OXUA 5C4XG 1D5MC 4L5RC 4DR3L 3GO5A 4DU9A 2ZXRA 3RUZA 1JT8A 2Z8LA 3QWNA 3TMEA 2FFKB 1SMYD 2R7ZG 4RHRA 2ALYB 1KRSA 4DR6L 1NR2A 3KOJA 2JA8G 4KHVA 1ESRA 4ZLTF 4A3JH 3SHLA 3I8ZA 1U4RA 1GD7A 3GTJB 3NXWA 3DWAA 1N32L 4BA1I 2XWJB 4IJHA 1HJPA 4DV5Q 4CBVA 3U4VA 3CPWA 1Q82C 5CV7A 5EPKA 3L2PA 2IT1A 3OYYA 4XTCS 1SR3A 3U50C 5I2YA 4LUVA 2FXQA 4A3GG 2VQFQ 1O7IA 1R9TH 4IUNA 2AQ2B 4HJ7A 4JBWA 4DV3Q 1KTKA 1FD7D 2OTLA 2MGSA 3QOJA 4A3GH 5ELCA 5I9OA 1JQYD 1LT5D 1HZAA 1NTGA 1PH2A 2IL8A 1WTXA 4ZKBB 1S4ZA 4PMBA 3BVGA 4JOIC 5IE8A 1A6XA 1ENAA 2HIVA 4PZ8A 2MO0A 3U4ZA 2DNCA 3JAME 1T5XD 3M9BA 5HGQA 2A73B 2JA9A 1RKNA 2ZTEA 1O7LA 1AW7A 2Z6BA 3ULLA 2I5LX 2NN6H 3K5NA 2K04A 2DY7A 4A3FG 4HIDA 3UE1A 3D31A 2I46A 1CK1A 4HR7B 4L5TA 5M3MG 1KDAA 4FXDA 4A3FH 4JI7L 2FMMA 5FLMH 2JA5B 4RCNA 1Q7YC 2I5HA 4WJWA 3CQZH 4GNXC 2NN6G 5CR3A 5J3BA 3CRLC 3DUZA 4J8QA 4DR2L 4I7ZC 5ELEA 3RZDH 4A3GB 1RIPA 5C44H 1O80A 3HOVH 1SYFA 5C4XH 4JI6Q 1E7ZA 2F1MA 1X3PA 1XPOA 2XVSA 1BKBA 3PO2B 1YHAA 2KOLA 2BA1A 2UXBL 1I94Q 2PYKA 1GUWA 3ITPA 4H0LC 1QJOA 2E8GA 1ENCA 2QEJC 4GZYC 1SYBA 1UE6A 4YWKA 4FF2A 3MA2B 4KJNA 1YITA 1PH8A 1LT3D 3OOCA 3GTMB 4DV7Q 4R8IA 1SMYC 1KAWA 3MXUA 5IWAQ 4DR1L 1F9RA 2VY3A 4KI0A 1F2YA 1TWHH 2VB2X 2L4NA 1VF7A 1BBUA 5C5MA 1L1OB 1KLUD 5NUCA 3HOWB 4TVAB 3K7UC 1SBBB 4PMWA 1HCZA 2NN6I 4DV6L 3FKIG 1TWFB 1OXVA 3KBGA 4BY7H 2HT1A 1HHVA 5KGUA 4K5XA 4KY5A 4GLAC 3RZOH 4KHPQ 1PV4A 1HH2P 4IPDA 5E1FA 1VQ7A 1C8CA 1KD1C 2XWBB 3IRBA 3VYTA 2IHFA 4V0BA 4HCEA 3M4YA 3U9SA 1I50B 3X3NA 1FL0A 3TP7A 2VL6A 1KNAA 1Q90A 4DR7Q 1Y69U 1IZ6A 4NXML 4K2KA 4ID6A 3S15H 1LT6D 2CW0C 2K05A 4RAUC 1HUNA 2AMCB 1DZ1A 3CCEA 1SE4A 1DOKA 3RLFA 3WOEA 2RSNA 1YJ9A 2IJ0A 2UUBL 1E0BA 1WTRA 2R3ZA 4GKJL 1PTOF 3C1FA 1CA6A 5M5WH 2Y0SG 3VR4A 1ILPA 3J80L 1G91A 3OMCA 3MFGA 4Y52H 5K36G 1MKHA 2DNEA 2B3GA 4LFAL 5C0XJ 1Z7TA 2Z6KA 1L2FA 1JJGA 2L12A 3K5OA 4DNTB 2K5QA 4JBKA 1DOMA 1B3QA 1QB5D 4CDDC 2JYOA 3RN2A 2A19A 5J39A 4A3LH 3KYHC 2Z4HA 1LM0A 3SR1A 3MXNA 1Q1EA 5EKIA 3OTOL 5BN5A 1U4LA 4MHEA 4BY7G 4A4IA 4G7ZC 3J7AV 5EGTA 4YWLA 3GTOB 3F1ZA 2YTYA 2EIFA 2QDBA 4G7HC 1QOHA 3NP8A 4IUPA 4BXXG 3IL8A 2AWNA 4RGTA 2EYHA 1I6VC 4QJFA 1H9KA 3VR6A 5JJLA 1PH1A 5M5YH 1QNUA 1T5EA 1W2BA 5KYIA 4UAIA 1EYAA 1BOSA 1U4PA 2MHVA 1D2BA 3PUYA 1GUNA 1I5FA 4X6AH 1CT1D 1GVPA 4LJZC 1W6KA 1KDBA 3G4SA 1KABA 4DK0A 5CV9A 3A8JE 4WJ3M 1WTHA 2EJGC 1E2VA 4DR5Q 2A6HC 2IHEA 4JI8L 2UXDL 2F0KA 1RTNA 2AUKA 4YY3L 4FNFA 5JEAH 5FLXE 2EDGA 4R8NA 3MWYW 4OO1G 1QNKA 4XXEA 4LWCA 2GVAA 1Y8PB 4A3IB 3QG1A 1PFNA 5EAYA 3J7YW 2ASBA 3BJUA 3CP0A 1VQAA 1GUGA 4EGVA 3BZKA 4N8FA 4A3JG 3T1HQ 1R4PB 1FJGL 4LF6Q 3BZDB 3U58A 1EY8A 5JJKA 1TWFH 2A6HD 1YNXA 2DN8A 3S17B 3T51B 1I6HB 2IX1A 1SNOA 4GKKL 1D1KA 5H1SE 1FGUA 2PI2E 4QGUA 3NTIA 3FRPB 3ZJYC 3UDGA 5C4XB 4FXGC 2PO4A 4BBSH 1GXDC 4JK1C 4BS9A 2K5VA 2NVXH 5GADC 4C3JH 1CQFA 4R4CA 5KYLA 2JEAI 3TS2A 4FF3A 5CV6A 3MAQA 1YBYA 1L0WA 2MQHA 3I90A 4DNRB 2PQAB 1CKMA 1XNRL 3HOXB 3RNUA 4DAVA 3W2DA 3S1QB 1IXRA 4DR1Q 2B8GA 2YU9H 3CXCA 4KTAA 3AU7A 4QQBX 1DONA 2F4VL 2K50A 3J80E 1UWVA 3NWSA 1EU4A 3PO3B 2NWGA 4JCVE 2HDLA 4ZRZA 3F2UA 3KJOA 2AQ3B 1NE3A 2NZHA 5IGGA 3ONAB 1VQNA 4IFDI 3CC4A 4FVMA 3PO3H 3H6MA 4UP9A 5CYUA 1HPCA 1I3QB 1LUZA 3J80c 2HQLA 4POGA 1R9TB 4A3DG 2K52A 2Q8IB 3K0YA 2BOSA 1MD2D 3WWVA 1EYGA 3BVZA 2R93G 2NYZD 3I4LA 4B3TQ 2VZAA 3NTHA 2Q2IA 4QIWE 3ULJA 2WV6D 4RH6A 4RFBA 4LFCQ 3MXNB 1KQSA 3HEJA 2C9OA 3PIO3 1Y1WG 1D7QA 1PTOC 1PZID 4Z9CB 1TY2A 3A7LA 3A8IE 1SN8A 1ET6A 1IBKL 2R6GA 1TWCB 1PTOH 4JI6L 2VS1A 3TN2A 1RD9D 4G4KA 2B2WC 4EQNA 1UE7A 4I7AA 3I72A 1L1OA 3BS1A 5C3WA 1UAPA
chains in the Genus database with same CATH topology
3GD7A 3T4AC 3MC0B 3S9WA 3VYRA 4MN3A 4IFDG 2F0SA 2L5TA 1GUOA 1WCMB 1C4QA 3KLSX 3DHQA 1BF4A 2B2TA 3BDCA 3QJYA 5E3FA 2EJFC 1OXXK 1RF2D 2F0IA 2E74C 1NSNS 2E2JB 2I07B 4L8JA 1QWYA 1MSHA 2PCFB 3OWEB 1M4VA 4IUTA 2O2LD 2EZVA 4NP5A 2OF1A 1SE3A 1KDCA 2YYZA 1SDFA 2EE1A 5CMDA 4ODGA 4CKBA 5M3MB 3MFYA 1D1IA 5M5XB 1AN8A 4C2MB 4XQQA 5IT9E 2F0OA 4X3UA 2N55A 4XYOA 4Q5VA 1EEID 2D2CC 1QG7A 3ZYYX 4OIKA 5IODA 3A54A 1WTOA 3EA6A 2RKSA 1FNVA 1NCVA 3A55A 3HS0C 2K03A 1G2SA 2E76C 1WD1A 2SOBA 2HCCA 2NVXB 1NR4A 2NB0A 1V1PB 1QE6A 2RBMA 5JVH3 2B8FA 4O42A 3OIQA 5IGCA 1DM0B 4A3DB 2KEEA 1A15A 2R61A 5KIXA 3VR3A 3C3LA 1A2TA 1ZEQX 1GHJA 4F8MA 1LTRD 2SDFA 1KLGD 5JJZA 4C3IB 4CKEA 5G3LD 3SK8A 3DEOA 3V96A 1D6EC 3A8KE 3HP3A 3OIPA 1DXMA 1IHZA 3GTQB 1SSOA 3NPPA 2TSSA 1TWGB 1V8QA 3ND8A 4KMUC 4OHJA 5C4ZA 5DNFA 3T53B 5IGDA 4RGNA 1JB3A 4KKSA 2F0DA 1G6ZA 3CRKC 3URYA 4A3EB 2E75C 4ZKCB 1LTAD 3VA7A 1DJRD 5C4JB 1SNCA 5C6AA 4MIUA 3K59A 3FEWX 3I4NB 1I4PA 3D6CA 1JR0D 1VF5C 1D5ZC 2EYPA 3DEPA 3WDNA 2K5DA 3K7AB 1PYWD 1WD0A 4NMZA 4RHSA 2M9VA 4WORA 1C48A 4ZUJA 5FK9C 5JOBA 2F0UA 1DCZA 4DF7A 3L3OC 4KKUA 4RCOA 3KLSA 4OO1I 4CHTB 4G57A 2WINB 3D4RA 3KK7A 3S1RB 3SE0A 1VCIA 4KN7C 4IUUA 4LAAA 5K36H 4CJ0B 1F9PA 3MTSA 1F9QA 2B63B 1HFNA 5FO9B 1TS4A 1XXGA 1OXTA 3H94A 2EY2A 3LX0A 2KCNA 3RMHA 3SK6A 1PDQA 4WFN3 2RDGA 3MXPA 2LS01 4QF4A 2BE5C 2F0LA 1YNJC 3L9AX 4KN4C 3C2PA 4K5WA 3Q22A 1BR9A 4HN7A 2IW3A 3G7LA 2ZXPA 1CZWA 2NZ1D 1UUPA 2JSOA 1SAPA 1Q3LA 5I4DA 1FGBD 5FKAC 1K8MA 1AZPA 2WKCA 3OWFA 1O7YA 2EPBA 4DXGA 1ILQA 1EY4A 3NTKA 2EY5A 2WACA 3TZUA 2NTTA 1EIGA 1TT2A 3IFDA 5CC4A 5C4HA 1D5XC 5E4WC 2XIWA 5M3FB 5DM63 2ICIA 2NVYB 2SNSA 4DFAA 1LLRD 4F7XA 3J81E 1HTLD 1BCPC 5DM73 1HRJA 3PUZA 1RJTA 5DAUA 3SXHA 3MVVA 3D8GA 5JVG3 5JPNC 2MUYA 1JOKA 4C1NK 3PMFA 4IZ8A 4C3HB 4K2LA 3A7AB 1RTOA 3RD4A 1IKLA 4BWGB 4J6HA 4DGZA 4M1UB 2PMZB 3VYSA 4X3KA 4Y7NB 4LK1C 1H9SA 1AEXA 3NWTA 1RHPA 3HG9A 1A3UA 3DWPA 2ENBA 1B1ZA 1PFMA 5EQ0A 5KNDA 4KV6A 1F9SA 1GOZA 3GV3A 2O4XA 1B50A 3K58A 1SXTA 4CJ1B 4OGQC 5CGKA 1ZKOA 3V05A 4YIJA 3SDZA 2J0TD 3CU7A 3NHHA 4TKOB 1PRTC 4K5VA 1JICA 3HGBA 2D62A 1EL0A 1RODA 3EQLC 4TQUS 4A3FB 1IYVA 4C3IG 1UEAB 4NKLA 1MI2A 5EPLA 3FDTA 1TU2B 2XN9C 3M3YB 3I70A 1RDPD 2F0JA 4QIWB 4BBRB 4FF4A 2Y0SB 4BA2I 3VR5A 2KQ3A 1SFOB 3Q6SA 4K8JA 1LTTD 3HRZC 1A3VA 2KEDA 1ML0D 2O5JC 5A2QL 4A3BB 4XIGS 1GJXA 1SYDA 1H9JA 5A2QE 1B44D 1YNNC 4ME5A 5I2XA 4RGOS 4QUFA 3DMUA 3OPOA 2KUMA 3VYUA 1EWHA 1TVXA 2K01A 4XDXA 5ISRA 1F2ZA 3T16A 1STYA 2M2LA 2EOTA 5CV4A 2B2VA 3PIP3 1HTPA 1L0YB 4N9PA 3SVMA 1FR3A 3CHBD 1HQRD 1Z47A 4CJ2C 2F3VA 1SYCA 1STGA 1Y8OB 1LTGD 4C56C 1F2LA 2TMPA 1TS5A 5JAVA 2B39A 2XRSD 2L55A 5JEAG 3QOLA 1TQOA 1H9RA 4PMCA 2IX3A 1EZ6A 2QCPX 2RQXA 1L0XB 3IAYA 1EWCA 5EPJA 1FNUA 3QIAA 3TSSA 3NQTA 4C3HG 3DXJC 1JWMD 3H0GB 2V4DA 4ZQ3A 2XSCA 4G7OC 2KVMA 2A69C 3H09A 3BDLA 5TSSA 1ENFA 2VXWA 3M85A 2AQ1B 1II3A 5CBEE 1TIID 2F0QA 4OL7A 3FMCA 1Z6HA 3DWQA 2R92B 5C44B 4ULLA 1V1OA 1K83B 3I91A 3NK9A 3ERQA 3E5SA 4A3MB 1GUTA 3CQZB 2BDNA 1MSGA 1PTOB 3SK4A 1ZXTA 3AB9A 4RKLA 1B2TA 4DA2A 3M7GA 1Y1WB 1Q8IA 1A2UA 3DM1A 4Q0FA 1KAAA 1JC7A 5FO7B 2L9HA 3TP8A 1F77A 1ZYRD 1I4GA 4NDXA 3L7ZC 2K33A 4H13C 4IUQA 4PNYA 1V1PA 4OIJA 2AUJD 3G6JB 4KY7A 4X3TA 3D3RA 3S2HB 1AP0A 2XRQD 3NE5B 2K1BA 3GV6A 2PNRC 2PZTA 4B9XA 1O7ZA 2L11A 3S16B 2D9UA 2OEOA 3HOUB 1B9MA 3P7JA 2BE5D 5D3IB 1PZKD 1STNA 3M7NA 4A3JB 1CTMA 2CW0D 2FINB 2J7ZA 2A68C 4KY6A 1TY0A 2VB3X 1HUMA 3BG3A 3I73A 1O78A 2JE6I 1X3QA 2K28A 4U673 1OXSC 1XWEA 1HXYD 2K5WA 4X3SA 4HSVA 4XYQA 4NW2A 2SNMA 2B2TC 1LTBD 1OO9B 2Z1CA 5C0XI 2MJ8A 3E6ZX 5J22A 1ESFA 1QCBD 5E4XA 4KJOA 1GHKA 5K5PA 1TKWB 3LWEA 1DD2A 2EYFA 1MBYA 5ELDA 3N52A 4KHZA 5IGFA 1BDOA 1MGSA 4R9WA 5LL6S 3QB3A 3I3CA 3SEBA 4XQNA 3GTGB 2D5DA 1EFID 4BY1B 4HCSA 4RKBA 4EQOA 2JA7B 3P1HA 2KCCA 2PZUA 2WIIB 1STBA 2HCIA 3S14B 1CI3M 1EIHA 3N6RA 1QILA 3H91A 2IWHA 1SNDA 4A93B 5AFWA 3EVQA 1TR5A 3KF8A 1EZ8A 4F87A 2EVBA 3ND9A 3PUXA 4K14A 1G2TA 1PRTD 3D4DA 1B3AA 2B2UC 1R4QB 2A68D 2SEBD 1XX8A 4DAYA 3HOVB 3D6WA 5I6YA 3W3AA 2JA6B 3Q0AA 3HOYB 1LACA 2CVRA 2OT2A 3C46A 1A3TA 1Y1VB 5IT9L 3OHXC 1SJHD 1CZGA 2KHSA 3M4OB 3D4WA 3TZDA 1S5FD 3R8BA 1I4RA 1EU3A 5DEHA 3P75A 2NVTB 1SNPA 4A3KB 4XQJA 2F0HA 1NAPA 2A74C 2IX0A 1LO5D 3J7AF 5C3XA 5FLXL 3KLRA 2Z4IA 4PV1C 1PMRA 3UI2A 4BBSB 2HQEA 4J1MA 5EKKA 5BN4A 2EYMA 5LL6X 2KECA 5C3EB 2N88A 1CHPD 2HUGA 1ICWA 5T1IA 2PW7A 1JWSD 3FPUB 3K5LA 4XT1B 1PTOD 2O5IC 4FXKC 2EY1A 1LTSD 5M5WB 4EQPA 4QMGA 2RSOA 3R2IA 3EJIA 1AFPA 4P2CB 1S5ED 2AWOA 5JPMC 1SNMA 1FYCA 2F0TA 5J1ZA 1SEBD 1EYDA 4LMQD 2F0NA 2E2HB 2E2DC 2B2UA 1JORA 3OW7A 5FOBB 5I6WA 2F4IA 3E0JA 4CGYB 5KNBA 2F0WA 1HQMC 3EROA 1EY7A 1RCVD 1B53A 4KD4A 4PQXA 4QCLA 3AMUA 3RZDB 1M8AA 2F03A 3I4MB 1J9OA 1HA5A 3S1MB 3V2TA 5EBCA 4AYBB 5G3LF 5IIFA 2GA4B 1BCPF 1FNWA 1CA5A 4S3SA 1E2ZA 1XYIA 4E6IA 1E2WA 2ICEC 3IFTA 2MP1A 4IFDJ 5ELBA 3BYTB 4I65A 1Q12A 3HOZB 1EY6A 2L0CA 3K57A 3VA5A 2WB1B 4ZUIA 3EFXD 5HURA 5I9PA 1ET9A 3TP6A 1STEA 2LFNA 3NBHA 2A5HA 3K5MA 5KRUA 5CBAE 5C0XH 1G8ZD 3LWUA 5D3DA 1SYEA 4EVOA 2EYOA 5CV5A 1J8IA 2F0FA 3BDOA 2NUCA 1LT4D 2NVQB 2B2YC 4C1NI 1I4HA 3CKIB 1K8OA 2A6EC 2YU9B 3T56B 2B2WA 3HKZB 4HMJA 1PRTF 4WRDA 1WVLA 1Y8NB 4RA8A 5IGBA 1Q1BA 2F0PA 3OSOA 1EY9A 2K7VA 2EJMA 3K6OA 1SYGA 3R93A 2K6AA 1WTPA 5C5LA 2JEBI 4FO2A 5CV8A 3A56A 1H9SB 1PLFA 2H4OA 4ZK9B 1STAA 5C0XG 2H1EA 1S5BD 1PFBA 5HGTA 1EOTA 4IFDH 4DAPA 3Q23A 1GUSA 4B9WA 3S1NB 3TBIB 1V43A 2MPMA 3FPPA 1SNQA 5JEAJ 1BUVT 2F0GA 1BCPD 5EKLA 2VUMB 4K6LA 3MXGA 2B2VC 3JAML 1LV9A 2EYJA 4FF1A 1ONLA 4UDUC 4HTHA 1BQQT 2G9DA 5BN3A 1EY5A 4IALA 2BCOA 4CKCA 1H9MA 2ZXOA 5COYA 1G291 1BBXC 3NQIA 2EY6A 3H3VC 3PUVA 4L63B 1DYQA 3HZXA 3R2TA 4L6TB 2KA7A 2EYLA 2F0MA 4DXFA 2CQAA 2CHBD 1WTQA 2A69D 2LKVA 2B2YA 3BVMA 2C5CA 1LTID 3GTLB 1DOLA 5D65A 5M9OA 3TDQA 4DN4M 2BA0A 3KBXA 4IUVA 3PV0A 3Q24A 2JXMB 1TS2A 4ILWA 2NTSA 1BCPB 2ZT9C 4U68A 4FYDA 3FVQA 5CORA 4HAEA 1U4MA 1IL8A 3BYYB 2G9HD 2QKIC 3R3OA 4H7BA 3O13A 1JE4A 2FHTA 4BY7B 4ABNA 2DY8A 3TP5A 3MEHA 4V190 4K8IA 3VR2A 2RDHA 2K32A 2Q8TA 1JCKB 2WAQB 2HDMA 4FP5D 1IKMA 2NBFA 2VNUD 5F2DA 2BDOA 1UNSA 2E2IB 3OMGA 3GTPB 2KJXA 1F2MA 1SE2A 5T1GA 3U9OA 2X6GA 1AZQA 1IW7C 1XTCD 3J81L 3C1EA 2LY7A 3S2DB 1PRTB 4KKTA 3RZOB 3MZ5A 4QB4A 4C3JB 5FO8B 4QUCA 2X6LA 3T13A 3GP7A 2A6ED 1W6JA 1BNZA 2R7ZB 2WP8J 2XNAC 5IOCA 2JP1A 4F88A 1TWHB 2F0VA 1PZJD 2PW5A 1X32A 2PPBC 2WKDA 3S15B 3NSWA 4KD3A 1EEFD 5IGEA 4RGMA 4XT3B 2F0EA 4TRDA 1IW7D 3FKIB 2Q8RE 2QILA 5D14A 4HSPA 1PXUA 5M5YB 1CHQD 4HMIA 3GTKB 3X3MA 2QF7A 5KNCA 2RA4A 1S5DD 3PUWA 1VDZA 2X69A 1CQVA 3NBIA 5EBDA 1CFMA 4IURA 3LNNA 4O1NA 4N9TA 2L1BA 4B08A 2LMCB 2RDFA 1I4QA 1EQVA 3GQBA 5LHY1 4TSSA 4OO1H 2OXPA 1VMCA 4HEDA 3WOFA 3P20A 1HFGA 4H44C 1SJED 2IPKD 2EXZA 1BXTA 1IYUA 2PQEA 5KEEA 1EQTA 2FMCA 1TWAB 1B4OA 2RVLA 4K6DA 1JOQA 1KNEA 1WTVA 2PZWA 1I4XA 1EY0A 1TS3A 2F3WA 2FJ2A 4KK7A 3NUCA 3IKJA 2R93B 1VMPA 2JA8B 4RWSC 1ZYRC 1CM9A 1B9NA 1WTWA 3MHBA 4IN3A 3SK5A 4ZYSA 1YNND 1LABA 3KUPA 5EJWA 1NUCA 4IQZA 1YNJD 1BO0A 4ZAIA 5ELFA 1STHA 2ID0A 4C3JG 1JWUD 3QO2A 4M8AA 1EYCA 1S5CD 5A35A 1JOOA 2J4XA 2M00A 1U9RA 1HA6A 4DK1A 1OXUA 1D5MC 3GO5A 4DU9A 2ZXRA 3RUZA 2Z8LA 3QWNA 3TMEA 2FFKB 1SMYD 4RHRA 1NR2A 4KHVA 1ESRA 4ZLTF 3SHLA 3I8ZA 1U4RA 3GTJB 3NXWA 3DWAA 4BA1I 2XWJB 4CBVA 5CV7A 5EPKA 2IT1A 4XTCS 5I2YA 4IUNA 2AQ2B 4JBWA 1KTKA 1FD7D 2MGSA 3QOJA 5ELCA 5I9OA 1JQYD 1LT5D 2IL8A 1WTXA 4ZKBB 1S4ZA 4PMBA 3BVGA 1A6XA 1ENAA 2DNCA 3JAME 1T5XD 2A73B 1RKNA 1O7LA 1AW7A 2NN6H 3K5NA 2K04A 2DY7A 3D31A 2I46A 1CK1A 4HR7B 1KDAA 4FXDA 2FMMA 2JA5B 4RCNA 4WJWA 2NN6G 5CR3A 3CRLC 3DUZA 4J8QA 4A3GB 4I7ZC 5ELEA 1O80A 1SYFA 2F1MA 1X3PA 2XVSA 3PO2B 2KOLA 2BA1A 2PYKA 1GUWA 3ITPA 4H0LC 1QJOA 1ENCA 2QEJC 4GZYC 1SYBA 4FF2A 3MA2B 4KJNA 1LT3D 3OOCA 3GTMB 4R8IA 1SMYC 3MXUA 1F9RA 4KI0A 1F2YA 2VB2X 2L4NA 1VF7A 5C5MA 1KLUD 5NUCA 3HOWB 4PMWA 1SBBB 1HCZA 2NN6I 1TWFB 1OXVA 3KBGA 1HHVA 5KGUA 4K5XA 4KY5A 5E1FA 1C8CA 2XWBB 3VYTA 4V0BA 4HCEA 3M4YA 3U9SA 1I50B 3X3NA 3TP7A 1KNAA 1Q90A 1Y69U 4K2KA 4ID6A 1LT6D 2CW0C 2K05A 4RAUC 1HUNA 1DZ1A 1SE4A 1DOKA 3RLFA 3WOEA 2RSNA 2IJ0A 1E0BA 1WTRA 2R3ZA 1PTOF 3C1FA 1CA6A 3VR4A 1ILPA 3J80L 1G91A 3OMCA 3MFGA 5K36G 2DNEA 5C0XJ 1Z7TA 2L12A 3K5OA 4DNTB 2K5QA 1DOMA 1QB5D 2JYOA 5J39A 2Z4HA 3SR1A 3MXNA 1Q1EA 5EKIA 5BN5A 1U4LA 4MHEA 4G7ZC 3J7AV 5EGTA 3GTOB 2QDBA 4G7HC 1QOHA 3NP8A 4IUPA 3IL8A 2AWNA 4RGTA 2EYHA 1I6VC 1H9KA 3VR6A 1QNUA 1T5EA 5KYIA 4UAIA 1EYAA 1BOSA 1U4PA 2MHVA 1D2BA 3PUYA 1GUNA 1CT1D 4LJZC 1W6KA 1KDBA 1KABA 4DK0A 5CV9A 3A8JE 2EJGC 1E2VA 2A6HC 2F0KA 1RTNA 2AUKA 4FNFA 5JEAH 5FLXE 2EDGA 4R8NA 3MWYW 4OO1G 1QNKA 4XXEA 1Y8PB 4A3IB 3QG1A 1PFNA 3J7YW 1GUGA 4EGVA 1R4PB 3BZDB 1EY8A 2A6HD 2DN8A 3S17B 3T51B 1I6HB 2IX1A 1SNOA 1D1KA 3NTIA 3FRPB 5C4XB 4FXGC 2PO4A 1GXDC 4JK1C 4BS9A 1CQFA 5KYLA 2JEAI 4FF3A 5CV6A 3MAQA 3I90A 4DNRB 3HOXB 4DAVA 3W2DA 3S1QB 2B8GA 4KTAA 3AU7A 1DONA 3J80E 3NWSA 1EU4A 3PO3B 2NWGA 2HDLA 4ZRZA 3F2UA 2AQ3B 5IGGA 3ONAB 4IFDI 4FVMA 3H6MA 5CYUA 1HPCA 1I3QB 1R9TB 2Q8IB 3K0YA 2BOSA 1MD2D 3BVZA 2NYZD 3I4LA 3NTHA 2WV6D 4RH6A 4RFBA 3HEJA 2C9OA 3PIO3 1PTOC 1PZID 4Z9CB 1TY2A 3A7LA 3A8IE 1ET6A 2R6GA 1TWCB 1PTOH 3TN2A 1RD9D 4G4KA 2B2WC 4EQNA 3I72A 3BS1A 5C3WA 1UAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KUM A;  1WTR A;  2K28 A;  1B3A A;  1RJT A;  2B2U C;  2R3Z A;  3KBX A;  4DN4 M;  4RA8 A;  5CBE E;  4IUU A;  1WVL A;  2FMM A;  3QO2 A;  1CA6 A;  4IUV A;  2B2U A;  1XX8 A;  4CJ0 B;  1ILP A;  1F9P A;  4X3S A;  1G91 A;  4HSV A;  3MTS A;  1F9Q A;  4MN3 A;  4U68 A;  2RA4 A;  3D6W A;  1HFN A;  2SDF A;  4NW2 A;  1RTO A;  3R93 A;  1TVX A;  2B2T C;  2K01 A;  5COR A;  1WTP A;  2X69 A;  1IKL A;  4HAE A;  4XDX A;  1HA6 A;  1U4M A;  3I91 A;  2CVR A;  5JJZ A;  2L12 A;  1IL8 A;  2MJ8 A;  3DEO A;  1B53 A;  1O80 A;  1BF4 A;  2B2T A;  2BDN A;  1MSG A;  3HP3 A;  2M2L A;  4X3K A;  4IUR A;  1DOM A;  2JYO A;  1JE4 A;  1PLF A;  1ZXT A;  2FHT A;  1X3P A;  4ZK9 B;  1SSO A;  1B2T A;  2KOL A;  5E4X A;  2H1E A;  2L1B A;  5D65 A;  1M8A A;  2EOT A;  3DM1 A;  5EKI A;  1PFB A;  2DY8 A;  2B2V A;  2FFK B;  1RHP A;  1EOT A;  3LWE A;  1J9O A;  1PDQ A;  1U4L A;  5DNF A;  1NR2 A;  3I90 A;  1GUW A;  1PFM A;  4MHE A;  1MSH A;  5EQ0 A;  3TZD A;  3N52 A;  2MPM A;  4IUT A;  1VMC A;  2Q8T A;  2L9H A;  1ESR A;  1SDF A;  2EE1 A;  4HED A;  1F9S A;  5CMD A;  3SVM A;  1CA5 A;  4IUP A;  1G6Z A;  3IL8 A;  2HDM A;  4ZLT F;  1NAP A;  1MGS A;  1IKM A;  3I8Z A;  1XYI A;  1U4R A;  3GV3 A;  4ZKC B;  4R8I A;  1DON A;  1B50 A;  1HFG A;  4CJ2 C;  2B2V C;  4IUQ A;  1F9R A;  1LV9 A;  4R9W A;  3G7L A;  2MP1 A;  4OIJ A;  4CJ1 B;  2NWG A;  2L4N A;  2HDL A;  1F2L A;  4X3T A;  3F2U A;  4UAI A;  1AP0 A;  1EQT A;  1U4P A;  3UI2 A;  3ONA B;  3I3C A;  5T1G A;  5EPK A;  2X6G A;  2NZ1 D;  1JIC A;  4X3U A;  2K1B A;  1B4O A;  3GV6 A;  2N55 A;  1AZQ A;  1SAP A;  1EL0 A;  1Q3L A;  1QG7 A;  1ROD A;  5COY A;  2RVL A;  1HHV A;  1O7Z A;  2KEC A;  5EPL A;  1MI2 A;  3FDT A;  4HCS A;  4OIK A;  1AZP A;  1BBX C;  2L11 A;  1KNE A;  2D9U A;  2N88 A;  1WTO A;  2HUG A;  1WTV A;  1ICW A;  3P7J A;  1O7Y A;  2EPB A;  4QUC A;  5T1I A;  5CBA E;  1C8C A;  3FPU B;  2NYZ D;  4XT1 B;  2MGS A;  1NCV A;  2X6L A;  2K03 A;  1G2S A;  1ILQ A;  3DEP A;  1WD1 A;  1RTN A;  5EPJ A;  2IL8 A;  1BNZ A;  2HCC A;  1WD0 A;  2HCI A;  4ZKB B;  1S4Z A;  1WTX A;  1NR4 A;  1J8I A;  2FJ2 A;  1KNA A;  1EIG A;  1HUN A;  1QE6 A;  3IFD A;  3MWY W;  2JP1 A;  1QNK A;  1EIH A;  5E4W C;  3Q6S A;  2XIW A;  4ZAI A;  1X32 A;  2FIN B;  2KED A;  1VMP A;  1ML0 D;  3H91 A;  2J7Z A;  1PFN A;  2RSO A;  4RWS C;  1CM9 A;  1WTQ A;  4O42 A;  2B2Y C;  1WTW A;  5AFW A;  2K05 A;  3TN2 A;  2B2Y A;  4RAU C;  2B2W C;  1DZ1 A;  1HUM A;  2KEE A;  2K04 A;  4XT3 B;  1A15 A;  2DY7 A;  2KVM A;  3KUP A;  5EJW A;  2Q8R E;  5D14 A;  2B2W A;  1DOK A;  1G2T A;  2RSN A;  1DOL A;  4LMQ D;  1BO0 A;  2VXW A;  1HRJ A;  1X3Q A;  1E0B A;  4QUF A; 
#chains in the Genus database with same CATH topology
 1BVS A;  2JA7 G;  4JVZ A;  4KLK A;  3GD7 A;  3T4A C;  3MC0 B;  3S9W A;  3VYR A;  4LFB Q;  3CCV A;  4X66 Q;  4MN3 A;  4DR3 Q;  4IFD G;  2F0S A;  5FLX c;  2L5T A;  4DV7 L;  4MNO A;  1GUO A;  2RCF A;  4JV5 L;  1WCM B;  3H15 A;  1C4Q A;  3KLS X;  3DHQ A;  1BF4 A;  2B2T A;  3BDC A;  3QJY A;  5FJ8 H;  5E3F A;  4UP8 A;  2YV5 A;  2EJF C;  1OXX K;  4DAY B;  1RF2 D;  1RL2 A;  2F0I A;  2E74 C;  1NSN S;  4A3I H;  1D8L A;  3S1R H;  4CDC C;  2E2J B;  2I07 B;  3QR8 A;  4L8J A;  1QWY A;  1SE8 A;  5LMU Q;  2CWP A;  1MSH A;  2PCF B;  3OWE B;  1M4V A;  4IUT A;  2O2L D;  2EZV A;  4NP5 A;  1YEZ A;  2OF1 A;  1TWA H;  1SE3 A;  1KDC A;  2YYZ A;  1SDF A;  2EE1 A;  5CMD A;  4ODG A;  4CKB A;  2ZJR A;  3K80 C;  5M3M B;  2DJG C;  3MFY A;  4OX9 Q;  3G71 A;  3MEF A;  4HJA A;  1D1I A;  5M5X B;  1AN8 A;  1V9P A;  1NY4 A;  2C35 B;  4C2M B;  4XQQ A;  5IT9 E;  3J7A 5;  2F0O A;  4X3U A;  3M3Y H;  1K8A C;  2N55 A;  4XYO A;  4Q5V A;  1EEI D;  2D2C C;  1QG7 A;  2ES2 A;  3ZYY X;  2EQS A;  4OIK A;  2UUB Q;  2R7D A;  3A54 A;  5IOD A;  1WTO A;  3OW2 A;  4LF9 L;  3EA6 A;  2RKS A;  1FNV A;  1NCV A;  3A55 A;  3HS0 C;  2K03 A;  1G2S A;  2E76 C;  1WD1 A;  2SOB A;  2HCC A;  2QEX A;  2NVX B;  1NR4 A;  1XNQ L;  1DGS A;  2NB0 A;  1V1P B;  2HHH Q;  1QE6 A;  2V1C C;  3J81 i;  2RBM A;  1VQG A;  1K0R A;  1YJN A;  5JVH 3;  1E1O A;  3HOZ G;  2B8F A;  2RF4 A;  4O42 A;  3OIQ A;  1A63 A;  1CKN B;  5IGC A;  1SFO H;  2F3I A;  1DM0 B;  4A3D B;  1ASY A;  3EN2 A;  3DLL A;  2KEE A;  1A15 A;  2R61 A;  5KIX A;  3VR3 A;  4JI4 Q;  3C3L A;  1A2T A;  1G51 A;  1G6P A;  4BBS G;  2RHQ B;  4RMF A;  2B63 H;  1ZEQ X;  1XNQ Q;  3M4O H;  2MNA A;  3EIV A;  3B6Y A;  1A62 A;  1M1K C;  1N9W A;  2G5D A;  2YTX A;  3HOW H;  1EQR A;  1GHJ A;  2OTJ A;  4F8M A;  3I2Z A;  1LTR D;  2KCT A;  2SDF A;  1KLG D;  4GN4 B;  4C3I B;  5JJZ A;  4CKE A;  5G3L D;  3SK8 A;  3DEO A;  3V96 A;  1D6E C;  3A8K E;  3HP3 A;  3OIP A;  1DXM A;  1HNW L;  1IHZ A;  4ME3 A;  3GTQ B;  1SSO A;  3NPP A;  2TSS A;  4NPS A;  2BH8 A;  1TWG B;  1V8Q A;  3ND8 A;  2GN5 A;  4KMU C;  4OHJ A;  5C4Z A;  5IYD H;  2CH4 A;  5DNF A;  2NVT H;  4WJ4 A;  2CH4 W;  3T53 B;  3H3V I;  5IGD A;  1HZB A;  1XTD A;  1JB3 A;  4RGN A;  4KKS A;  1XMO L;  1XPU A;  4JI8 Q;  2F0D A;  1SRU A;  3D0F A;  3I4M G;  1G6Z A;  3CRK C;  3URY A;  4A3E B;  2E75 C;  1I3Q H;  4ZKC B;  2CCZ A;  4APV A;  1LTA D;  1HNZ Q;  3VA7 A;  1DJR D;  2HHH L;  2VQF L;  3H3V H;  5C4J B;  1SNC A;  2PI2 A;  1QUQ A;  5C6A A;  4MIU A;  3K59 A;  1FVI A;  4IPH A;  1U5K A;  3GTO H;  3FEW X;  3I4N B;  1WI5 A;  4KHP L;  1I4P A;  4DR4 Q;  1K3B C;  3D6C A;  1QVG A;  1PH9 A;  1QZH A;  1JR0 D;  4B3T L;  3W1G A;  1VF5 C;  4OON A;  3I4N G;  1EQQ A;  1D5Z C;  2H5X A;  2EYP A;  3DEP A;  3WDN A;  2K5D A;  1CKN A;  3K7A B;  1PYW D;  1WD0 A;  1T9H A;  3JC6 6;  3FP9 A;  3JAM c;  4NMZ A;  4RHS A;  2M9V A;  4IPG A;  4JW0 A;  4WOR A;  4JBJ A;  2Z0S A;  4PZ7 A;  1C48 A;  2Z9H A;  4ZUJ A;  5FK9 C;  4P71 A;  2F0U A;  1DCZ A;  5JOB A;  4DF7 A;  3L3O C;  4KKU A;  4RCO A;  3KLS A;  4OO1 I;  4CHT B;  3F2B A;  4G57 A;  1K8G A;  2WIN B;  3D4R A;  3KK7 A;  1J5E Q;  3S1R B;  3SE0 A;  1VCI A;  3KF8 B;  4KN7 C;  4YWM A;  2I0Q A;  4IUU A;  1QVC A;  2I5M X;  4LAA A;  3CMA A;  2MO1 A;  4BY1 H;  5K36 H;  4CJ0 B;  1F9P A;  3MTS A;  1F9Q A;  2Z6K C;  2B63 B;  1HFN A;  4DK3 C;  5FO9 B;  2WFW A;  1PH6 A;  1N36 L;  3HOU H;  1TS4 A;  1XXG A;  1NNX A;  1HNX L;  3S16 H;  1WJJ A;  4P73 A;  2KEN A;  1J5E L;  1OXT A;  3H94 A;  3AYH B;  1N33 L;  2EY2 A;  3LX0 A;  1C9O A;  2KCN A;  3RMH A;  1B7Y B;  3SK6 A;  1LYL A;  1PDQ A;  4WFN 3;  4JBM A;  2RDG A;  3MXP A;  5M3F G;  2LS0 1;  3PIP A;  4QF4 A;  2BE5 C;  2F0L A;  1YNJ C;  3L9A X;  4B3R Q;  4KN4 C;  4DUZ L;  1CSQ A;  3C2P A;  3PIO A;  4K5W A;  4DV6 Q;  3Q22 A;  1BR9 A;  2JK8 A;  4HN7 A;  2IW3 A;  3G7L A;  1VQF A;  2YTV A;  4X64 L;  1PA6 A;  2ZXP A;  1CZW A;  4LF8 L;  4JYA L;  4C2M H;  3PO3 G;  4DKA C;  4IOC A;  2NZ1 D;  1UUP A;  2JSO A;  4LF9 Q;  3CCJ A;  1SAP A;  1Q3L A;  5I4D A;  1FGB D;  5FKA C;  1K8M A;  1Y1V H;  2KHJ A;  1AZP A;  2WKC A;  4UP7 A;  3OWF A;  1O7Y A;  3JAM i;  2EPB A;  4LF4 Q;  4O2D A;  4DXG A;  1ILQ A;  1EY4 A;  4QY7 A;  4LF8 Q;  3NTK A;  2EY5 A;  2WAC A;  3TZU A;  2NTT A;  1EIG A;  1TT2 A;  3IFD A;  5CC4 A;  5IY0 A;  1D5X C;  5E4W C;  5C4H A;  2XIW A;  3A5Z B;  5M3F B;  5DM6 3;  4B3M Q;  2ICI A;  5IP7 G;  5IT9 c;  1AH9 A;  3VDY A;  2NVY B;  2N8N A;  2DJF C;  1HNX Q;  2SNS A;  2K14 A;  4DFA A;  1LLR D;  4F7X A;  5BR8 L;  3J81 E;  1HTL D;  1BCP C;  5DM7 3;  2JQO A;  2B63 G;  3RR5 A;  1HRJ A;  3PUZ A;  2PNH A;  1RJT A;  4FDB A;  2UXC Q;  1YIJ A;  5DAU A;  3SXH A;  3MVV A;  1VQE A;  1VQJ A;  3D8G A;  5JVG 3;  2IY5 B;  3L0O A;  5JPN C;  3CW2 C;  2MUY A;  1JOK A;  4LF6 L;  4C1N K;  3PMF A;  2KHI A;  4IZ8 A;  4C3H B;  4K2L A;  3J81 c;  3A7A B;  1RTO A;  3RD4 A;  1IKL A;  4BWG B;  4YHH Q;  4J6H A;  4DGZ A;  4M1U B;  4BY1 G;  2PMZ B;  2VQE L;  3VYS A;  4LUO A;  4X3K A;  2JA7 H;  3CPF A;  4Y7N B;  1KHI A;  1K83 H;  4P72 A;  1JMC A;  4LK1 C;  3UDX A;  1H9S A;  1AEX A;  2CWA A;  3NWT A;  4B3S Q;  1RHP A;  3HG9 A;  1A3U A;  5ELN A;  3DWP A;  3RLN A;  2ENB A;  1B1Z A;  1PFM A;  5EQ0 A;  1A0I A;  4A75 A;  3NEL A;  3J80 i;  1BBW A;  2K75 A;  5LMN W;  5KND A;  4KV6 A;  1F9S A;  1YVC A;  5IYB H;  4LF4 L;  1GOZ A;  4DUY L;  3I4O A;  3GV3 A;  4LFA Q;  2E2H H;  2O4X A;  3I7F A;  1B50 A;  3K58 A;  4LF5 L;  1SXT A;  1KL9 A;  3I4N H;  4OWT B;  4OGQ C;  1ZKO A;  3V05 A;  1YHB A;  4YIJ A;  3SDZ A;  5CGK A;  4CJ1 B;  1K28 A;  2J0T D;  4JI3 Q;  2A1A A;  3CU7 A;  3NHH A;  4TKO B;  1PRT C;  2UXD Q;  4K5V A;  1JIC A;  3HGB A;  2D62 A;  1EL0 A;  4YCV A;  1ROD A;  3EQL C;  4TQU S;  4A3F B;  1IYV A;  4C3I G;  3GTM H;  1UEA B;  4NKL A;  1MI2 A;  5EPL A;  3FDT A;  1TU2 B;  2XN9 C;  3M3Y B;  3I70 A;  4JC0 A;  1VQ6 A;  1RDP D;  2F0J A;  4QIW B;  4BBR B;  4FF4 A;  2Y0S B;  4YCU A;  4BA2 I;  3VR5 A;  4AQY L;  5AJ3 Q;  2KQ3 A;  4OEL B;  5M5X H;  4IOA A;  1SFO B;  3Q6S A;  4K8J A;  1LTT D;  3HRZ C;  1A3V A;  2KED A;  2MFI A;  3PO2 H;  1ML0 D;  4HIK A;  2O5J C;  5A2Q L;  4A3B B;  4XIG S;  1GJX A;  1HR0 Q;  1SYD A;  1H9J A;  2ZTC A;  3PF4 A;  5A2Q E;  3M4P A;  1B44 D;  2RHS B;  4DUY Q;  1YNN C;  4ME5 A;  5I2X A;  4HJ5 A;  3DMU A;  3OPO A;  4RGO S;  4QUF A;  2KUM A;  1EIY B;  1JJ2 A;  1EWI A;  3VYU A;  4JI3 L;  5IP9 H;  1EWH A;  3ER0 A;  1Q46 A;  1EUJ A;  3STB D;  3TRZ A;  1TVX A;  2K01 A;  2UU9 Q;  4XDX A;  4DK6 C;  5ISR A;  1Y1W H;  1F2Z A;  3T16 A;  2NVQ H;  3HOY G;  1STY A;  5C3E H;  1JE5 A;  2M2L A;  2QGQ A;  1ICF B;  2KBN A;  4A3M G;  1XPR A;  3CCL A;  2EOT A;  5CV4 A;  1VQ5 A;  2B2V A;  2UUC L;  1XMQ L;  2N78 A;  1X6O A;  2R92 G;  1CKO A;  4HIO A;  1PFS A;  1X3E A;  3PIP 3;  1HTP A;  1L0Y B;  3K8A A;  4N9P A;  3SVM A;  1FR3 A;  4EQ5 A;  3CHB D;  1HQR D;  4A3E H;  1Z47 A;  4CJ2 C;  2F3V A;  4DV3 L;  1SYC A;  1P16 A;  1STG A;  1Y8O B;  3HKZ G;  1LTG D;  2LXJ A;  4JI1 Q;  4C56 C;  1F2L A;  2E5L Q;  3FKI H;  4A3K G;  3H0G H;  2TMP A;  1TS5 A;  5JAV A;  2B39 A;  2XRS D;  2L55 A;  5JEA G;  3QOL A;  1TQO A;  1H9R A;  4PMC A;  1WCM G;  2IX3 A;  1XNR Q;  1EZ6 A;  2K4K A;  1VQH A;  4AYB E;  2QCP X;  2RQX A;  1N32 Q;  1L0X B;  1QUQ B;  1PH7 A;  3IAY A;  4DV0 L;  1EWC A;  5EPJ A;  1FNU A;  3QIA A;  5IYB G;  4ALP A;  3TSS A;  3NQT A;  4C3H G;  3CCM A;  1VQK A;  3DXJ C;  3E9I A;  1JWM D;  3H0G B;  2V4D A;  2VUM G;  1VQ9 A;  2WB1 G;  4ZQ3 A;  2XSC A;  1X3F A;  4G7O C;  2KVM A;  1GO3 E;  5FLM G;  2A69 C;  3H09 A;  5M3M H;  1EFW A;  3BDL A;  5TSS A;  1ENF A;  4X65 Q;  3HFZ B;  2VXW A;  3M85 A;  2AQ1 B;  4JOI A;  1II3 A;  3KDF B;  5CBE E;  3RN5 A;  1TII D;  2F0Q A;  1PYB A;  2NZO A;  1AE3 A;  4OL7 A;  3FMC A;  1Z6H A;  4YHH L;  3DWQ A;  2R92 B;  5C44 B;  4DR7 L;  2VQE Q;  1PH4 A;  4ULL A;  1V1O A;  1K83 B;  3I91 A;  3NK9 A;  2WAQ E;  3ERQ A;  3E5S A;  3M4Q A;  4A3L G;  4A3M B;  1GUT A;  1K3R A;  2BDN A;  3CQZ B;  1MSG A;  1PTO B;  3SK4 A;  3HOY H;  1ZXT A;  4GOP B;  3AB9 A;  3AQQ A;  4RKL A;  4JI1 L;  1B2T A;  3S17 H;  4DA2 A;  3M7G A;  1Y1W B;  1Q8I A;  2AKW B;  1A2U A;  3DM1 A;  1KXL A;  1KRT A;  4Q0F A;  1KAA A;  1JC7 A;  4DV2 Q;  5FO7 B;  4P75 A;  1Z9F A;  1N33 Q;  2L9H A;  3TP8 A;  4LFB L;  1F77 A;  4JI0 Q;  1ZYR D;  1I4G A;  4NDX A;  3L7Z C;  3T1Y Q;  1VQ4 A;  2K33 A;  4A93 H;  4H13 C;  4IUQ A;  4PNY A;  1S72 A;  1V1P A;  3PF5 A;  4OIJ A;  2AUJ D;  3G6J B;  4KY7 A;  4X3T A;  3D3R A;  3S2H B;  1AP0 A;  4DV1 Q;  3S14 H;  4B3R L;  2XRQ D;  3NE5 B;  2K1B A;  3GV6 A;  2PNR C;  4A3K H;  2PZT A;  4B9X A;  1O7Z A;  2L11 A;  2CKZ B;  3S16 B;  2D9U A;  2OEO A;  3HOU B;  1B9M A;  3P7J A;  3S1Q H;  3KLW A;  3CF5 A;  2BE5 D;  1VQO A;  5D3I B;  1PZK D;  1STN A;  4DR6 Q;  1X54 A;  3M7N A;  5C3E G;  2UXB Q;  3S1N H;  4N8X 1;  1K0S A;  2Q2T A;  4A3J B;  1IBM Q;  1CTM A;  2CW0 D;  2FIN B;  1K9M C;  2J7Z A;  4O0A A;  2A68 C;  1CSP A;  2R7Z H;  3S24 A;  4KY6 A;  1TY0 A;  2WAQ G;  5IP9 G;  3I56 A;  3A74 A;  1HZ9 A;  2VB3 X;  2JA6 H;  1HUM A;  3BG3 A;  4A93 G;  3I73 A;  1O78 A;  2JE6 I;  3SGI A;  1ASZ A;  1X3Q A;  1TWC H;  3HOU G;  1VQ8 A;  2K28 A;  2F4V Q;  3BU2 A;  4U67 3;  1OXS C;  1TXY A;  3DM3 A;  1XWE A;  1HXY D;  2JA6 G;  2K5W A;  4X3S A;  1VQP A;  4HSV A;  5DLQ E;  1VQL A;  1X56 A;  4XYQ A;  3E3X A;  4NW2 A;  1C0A A;  2SNM A;  2B2T C;  4GN5 A;  1E22 A;  1LTB D;  1OO9 B;  2Z1C A;  5C0X I;  3T1Y L;  2MJ8 A;  3E6Z X;  5J22 A;  4UPA A;  2XTI A;  5C44 G;  1ESF A;  3E9H A;  1QCB D;  5E4X A;  4KJO A;  1GHK A;  5K5P A;  1TKW B;  3LWE A;  2OCE A;  4Y7N H;  1DD2 A;  4H02 A;  3S1M H;  2EYF A;  3ICE A;  1MBY A;  5ELD A;  3N52 A;  4NXM Q;  3CCS A;  4KHZ A;  3KJP A;  5IGF A;  2OQK A;  4C3H H;  1LTL A;  2BH2 A;  1K73 C;  1BDO A;  1MGS A;  1N34 L;  3KDF A;  2UUA L;  4R9W A;  5LL6 S;  2VUM H;  3QB3 A;  4GKJ Q;  3A0J A;  3I3C A;  3SEB A;  2ZJP A;  4XQN A;  1HR0 W;  3GTG B;  2D5D A;  1EFI D;  4BY1 B;  4HCS A;  4RKB A;  4EQO A;  5L37 A;  2JA7 B;  3P1H A;  2UUA Q;  5HY6 A;  2KCC A;  2EXD A;  4LW1 A;  2PZU A;  2LSS A;  2WII B;  1STB A;  4A3E G;  2HCI A;  3S14 B;  1CI3 M;  1EIH A;  4JI2 L;  4JI5 Q;  3N6R A;  1QIL A;  3H91 A;  2IWH A;  1VQI A;  1EIF A;  1SND A;  4A93 B;  2R92 H;  5AFW A;  3EVQ A;  1TR5 A;  3KF8 A;  1EZ8 A;  1PHJ A;  4F87 A;  4MTN A;  2EVB A;  3ND9 A;  3PUX A;  4K14 A;  4HJ8 A;  1G2T A;  2R7F A;  1SRO A;  1PRT D;  3D4D A;  1B3A A;  2B2U C;  4A3C G;  1NMG A;  1R4Q B;  2A68 D;  5M3F H;  2SEB D;  1XX8 A;  1YZ6 A;  1WOC A;  3I55 A;  4DAY A;  3HOV B;  3D6W A;  5IYC H;  5I6Y A;  3W3A A;  2JA6 B;  3Q0A A;  3HOY B;  1LAC A;  2N49 A;  2CVR A;  2OT2 A;  4A3M H;  4DV5 L;  3C46 A;  4DR5 L;  3CCR A;  1A3T A;  3G6E A;  1VS0 A;  1Y1V B;  5IT9 L;  3HKS A;  1X3G A;  3OHX C;  1X65 A;  5GAH C;  1SJH D;  1CZG A;  2KHS A;  5ELO A;  3M4O B;  3D4W A;  3TZD A;  1S5F D;  3R8B A;  3TS0 A;  1Q8K A;  1I4R A;  4OEM B;  1EU3 A;  5DEH A;  4PZ6 A;  3P75 A;  2NVT B;  1SNP A;  1Y14 B;  4A3K B;  4XQJ A;  2F0H A;  1IBL L;  1NAP A;  2A74 C;  1TWG H;  2IX0 A;  3CAM A;  1LO5 D;  1UEB A;  3EBE A;  3J7A F;  5C3X A;  4R4Q A;  4GLV B;  2Q2U A;  5FLX L;  3KLR A;  2Z4I A;  3PO2 G;  4PV1 C;  1PMR A;  3UI2 A;  2DUD A;  4C3I H;  4BBS B;  4AIM A;  5JJI A;  2HQE A;  4J1M A;  4JV5 Q;  5EKK A;  5BN4 A;  2EYM A;  5LL6 X;  2KEC A;  1IBL Q;  4CDE C;  4QL5 A;  5C3E B;  2N88 A;  1CHP D;  2HUG A;  1ICW A;  4AQY Q;  5GAE C;  5T1I A;  2PW7 A;  1A8V A;  1JWS D;  3FPU B;  3K5L A;  4XT1 B;  2OWO A;  2QA4 A;  1CUK A;  4DUZ Q;  1QZG A;  4MZ9 A;  1PTO D;  2O5I C;  2JN4 A;  4FXK C;  2EY1 A;  4DR2 Q;  1LTS D;  4GLX A;  5M5W B;  4EQP A;  4QMG A;  2RSO A;  2ZM6 Q;  3R2I A;  3EJI A;  5AJ3 L;  1AFP A;  4P2C B;  1S5E D;  2AWO A;  4JPB W;  5JPM C;  1IYJ B;  1SNM A;  1FYC A;  1HZC A;  2F0T A;  5J1Z A;  1SEB D;  4DV4 Q;  1EYD A;  4LMQ D;  2F0N A;  1PH3 A;  2E2H B;  2E2D C;  2B2U A;  2JA5 H;  1JOR A;  3OW7 A;  2K5N A;  5FOB B;  2F4I A;  3E0J A;  5I6W A;  4NXN L;  4AYB G;  4CGY B;  5IYD G;  1IBK Q;  1UE5 A;  4GOP C;  4B3S L;  5KNB A;  2F0W A;  1HQM C;  3ERO A;  1EY7 A;  1RCV D;  1B53 A;  4KD4 A;  2D0P A;  2UUC Q;  3OTO Q;  3CC2 A;  4PQX A;  4QCL A;  3AMU A;  3PGZ A;  3RZD B;  1M8A A;  2F03 A;  3I4M B;  1OTC A;  3F8T A;  1J9O A;  1HA5 A;  4GOP A;  3TRE A;  4NXN Q;  3S1M B;  3V2T A;  5EBC A;  1YJW A;  4J15 A;  4DAM A;  4IO9 A;  1VQM A;  4AYB B;  2PMZ E;  5G3L F;  3W1B A;  1XMQ Q;  5IIF A;  1JJC B;  1BCP F;  1FNW A;  2GA4 B;  3CCQ A;  1CA5 A;  4S3S A;  1E2Z A;  3AEV A;  1XYI A;  2R93 H;  4E6I A;  1E2W A;  1E1T A;  2ICE C;  3IFT A;  2K5H A;  4A3D H;  2MP1 A;  1HNW Q;  4IFD J;  5ELB A;  4LUZ A;  3KF6 B;  2PQA A;  3BYT B;  4I65 A;  3HOZ H;  1Q12 A;  3HOZ B;  3K0X A;  5LMU L;  1EY6 A;  4K0K Q;  1WCM H;  2L0C A;  3K57 A;  4JI0 L;  3VA5 A;  2WB1 B;  2CFM A;  4ZUI A;  2ZJQ A;  3EFX D;  5HUR A;  4BBR H;  1SLJ A;  2WB1 E;  5I9P A;  2E5L L;  3CME A;  1ET9 A;  3TP6 A;  1STE A;  3K81 C;  4R1J A;  2LFN A;  3NBH A;  3Q8D A;  2A5H A;  3K5M A;  4P74 A;  3RLO A;  5KRU A;  5CBA E;  5C0X H;  1G8Z D;  3LWU A;  5D3D A;  4JG2 A;  4OWX B;  1SYE A;  4MTK A;  4EVO A;  2EYO A;  5CV5 A;  1J8I A;  4IPC A;  2HD3 A;  2F0F A;  3BDO A;  4LF5 Q;  2NUC A;  1LT4 D;  2F52 A;  2JA8 H;  3KFU A;  2NVQ B;  1B70 B;  2B2Y C;  4C1N I;  4A76 A;  1I4H A;  3AFQ A;  3CKI B;  1K8O A;  1L1O C;  2A6E C;  2YU9 B;  3T56 B;  4AH6 A;  3GTJ H;  2B2W A;  3HKZ B;  4HMJ A;  1M90 C;  1EOV A;  3NBH B;  4LNQ A;  1PRT F;  4WRD A;  1WVL A;  1Y8N B;  4RA8 A;  4DNI A;  3F2C A;  1PYS B;  4GNX A;  5IGB A;  1Q1B A;  2F0P A;  3FHW A;  3OSO A;  3STB C;  1EY9 A;  2K7V A;  5GRO A;  2EJM A;  3K6O A;  1V1Q A;  2Q2H A;  3CD6 A;  1SYG A;  2QDL A;  3R93 A;  2K6A A;  5IP7 H;  1WTP A;  5C5L A;  2JEB I;  1MIU A;  1QVF A;  4FO2 A;  5CV8 A;  1IL2 A;  2CQO A;  2GVB A;  1WYD A;  3A56 A;  1H9S B;  1PLF A;  4LF7 L;  2H4O A;  4ZK9 B;  1STA A;  5C0X G;  2H1E A;  4X62 L;  1S5B D;  2RCN A;  1PFB A;  1PH5 A;  5HGT A;  1EOT A;  3J7Z C;  4IFD H;  4DAP A;  3Q23 A;  1GUS A;  4B9W A;  3G48 A;  3S1N B;  3TBI B;  3NEM A;  1V43 A;  2N3S A;  3HOX H;  2MPM A;  2A8V A;  3FPP A;  1SNQ A;  5JEA J;  1BUV T;  4DPG A;  1I94 L;  1S3O A;  1WFQ A;  1BCP D;  2F0G A;  2L15 A;  4RG1 A;  5EKL A;  2VUM B;  4K6L A;  4YY3 Q;  4LF7 Q;  1N36 Q;  3MXG A;  1C7Y A;  2B2V C;  3JAM L;  1LV9 A;  2EYJ A;  2OQ0 A;  4JI2 Q;  4FF1 A;  1ONL A;  4UDU C;  1MJE A;  4HTH A;  3TQY A;  1E24 A;  1BQQ T;  2G9D A;  2HIX A;  5BN3 A;  1EY5 A;  3AFP A;  4IAL A;  3LGJ A;  2BCO A;  4CKC A;  1H9M A;  2ZXO A;  5COY A;  3T1H L;  3GTG H;  1G29 1;  3GTK H;  1BBX C;  4GNX B;  3NQI A;  1HNZ L;  2EY6 A;  4A3I G;  3H3V C;  3PUV A;  4L63 B;  1DYQ A;  3R2T A;  3HZX A;  4BXX H;  2XGT A;  3TEH B;  2NVY H;  4POF A;  4L6T B;  2KA7 A;  2JJQ A;  2ZM6 L;  2EYL A;  1YHQ A;  2F0M A;  4DXF A;  4UY8 C;  2CQA A;  1SMX A;  2CHB D;  4R4O A;  1WTQ A;  2A69 D;  2LKV A;  1J6Q A;  5GAG C;  2P5Z X;  2B2Y A;  3A5U A;  1KC8 C;  3BVM A;  2C5C A;  3J81 j;  1LTI D;  3GTL B;  1DOL A;  4JI5 L;  3I4M H;  5D65 A;  5M9O A;  3TDQ A;  4DN4 M;  2BA0 A;  3KBX A;  4X66 L;  5GQO A;  4IUV A;  3HOX G;  3PV0 A;  3Q24 A;  4DV0 Q;  2JXM B;  1TS2 A;  4ILW A;  2NTS A;  1BCP B;  1JB7 A;  2ZT9 C;  1XMO Q;  4U68 A;  4FYD A;  3FVQ A;  5COR A;  4HAE A;  1FJG Q;  1AE2 A;  3ERS X;  1U4M A;  1IL8 A;  3BYY B;  2G9H D;  3R3O A;  2QKI C;  4H7B A;  3O13 A;  1JE4 A;  4R4T A;  2E2I H;  2FHT A;  4BY7 B;  1MHW C;  1Q81 C;  2AHO B;  4ABN A;  4X64 Q;  3ULP A;  2DY8 A;  3TP5 A;  4X65 L;  2VW9 A;  4B3M L;  3MEH A;  4V19 0;  3HOW G;  5E7N A;  4K8I A;  3VR2 A;  1N34 Q;  1I6H H;  2RDH A;  2K32 A;  2Q8T A;  1JCK B;  1VQC A;  2WAQ B;  2DGY A;  2QW7 A;  2HDM A;  4FP5 D;  4A3B G;  4UHV A;  1IKM A;  2D0O A;  2NBF A;  4EX5 A;  2VNU D;  1X55 A;  5LMN Q;  5F2D A;  1MJC A;  2BDO A;  1UNS A;  2E2I B;  3OMG A;  3GTP B;  2KJX A;  1F2M A;  1SE2 A;  2Y0S E;  1Y1V G;  3PSI A;  1I50 H;  5T1G A;  3U9O A;  4BBR G;  2X6G A;  1AZQ A;  1IW7 C;  1XTC D;  1GM5 A;  3J81 L;  3C1E A;  2LY7 A;  3S2D B;  1KIX A;  1PRT B;  4KKT A;  3F2D A;  2UU9 L;  3MZ5 A;  3RZO B;  4QB4 A;  4C3J B;  5FO8 B;  4QUC A;  2X6L A;  3T13 A;  3GP7 A;  2A6E D;  1W6J A;  1BNZ A;  4A3B H;  2R7Z B;  2WP8 J;  2UXC L;  2XNA C;  5IOC A;  2LXK A;  5IWA L;  2JP1 A;  1TWH B;  2F0V A;  4F88 A;  4OWW B;  1PZJ D;  2PW5 A;  1X32 A;  2PPB C;  2WKD A;  3S15 B;  4GN3 B;  3NSW A;  1NJI C;  4KD3 A;  1EEF D;  5IGE A;  4GS3 A;  4RGM A;  4XT3 B;  2F0E A;  4TRD A;  1IW7 D;  3FKI B;  2Q8R E;  2QIL A;  5D14 A;  2ATW A;  4A3C H;  3HOV G;  4HSP A;  1PXU A;  5M5Y B;  1CHQ D;  1E3P A;  4HIM A;  4HMI A;  3GTK B;  5IYC G;  4JYA Q;  3X3M A;  2QF7 A;  5KNC A;  1YI2 A;  2RA4 A;  1S5D D;  3PUW A;  3E0E A;  3GTQ H;  1VDZ A;  5C4J H;  2X69 A;  1CQV A;  3NBI A;  4OX9 L;  1IBM L;  3UE0 A;  2JA5 G;  5EBD A;  1HR0 L;  5LMN L;  1CFM A;  1W3S A;  3KF6 A;  4IUR A;  3LNN A;  1GKH A;  4O1N A;  4N9T A;  4K0K L;  4PG3 A;  2L1B A;  4ZCK A;  4B08 A;  2LMC B;  2RDF A;  3K7A H;  1I4Q A;  1EQV A;  1UE1 A;  3GQB A;  4YCW A;  1P8L A;  4L5Q A;  5LHY 1;  4TSS A;  2B29 A;  4OO1 H;  2OXP A;  1VMC A;  4HED A;  1Q86 C;  3WOF A;  3P20 A;  5BR8 Q;  1HFG A;  4H44 C;  4CDF C;  3GTL H;  1SJE D;  3HKZ E;  1NBW A;  2IPK D;  3BZC A;  4R4I A;  2EXZ A;  1BXT A;  1IYU A;  2PQE A;  5KEE A;  1EQT A;  4DR4 L;  3S2H H;  3PCO B;  2FMC A;  1X9N A;  4JI7 Q;  1TWA B;  1B4O A;  3H0G G;  4DV1 L;  2RVL A;  1B8A A;  1VQB A;  1N8R C;  4K6D A;  1JOQ A;  1KNE A;  2E2J H;  1WTV A;  3UDF A;  4LFC L;  1VQD A;  2PZW A;  4HJ9 A;  3GTP H;  1I4X A;  1EY0 A;  1TS3 A;  2ZTD A;  2F3W A;  5FJ8 G;  2FJ2 A;  4KK7 A;  3NUC A;  3IKJ A;  2R93 B;  1S40 A;  1XJV A;  1VMP A;  2JA8 B;  4RWS C;  1ZYR C;  1CM9 A;  1B9N A;  4DV2 L;  1WTW A;  3MHB A;  4IN3 A;  3SK5 A;  4GKK Q;  1U0L A;  4ZYS A;  4L5S A;  1YNN D;  3CC7 A;  1LAB A;  3KUP A;  5EJW A;  4X62 Q;  1NUC A;  4IQZ A;  1YNJ D;  4NB3 A;  1PVO A;  1BO0 A;  3GDE A;  4IJL A;  4ZAI A;  5ELF A;  3UDI A;  1STH A;  2ID0 A;  4C3J G;  1JWU D;  3QO2 A;  1NMF A;  4DV4 L;  3W5O A;  4OXP A;  4M8A A;  1EYC A;  1S5C D;  2KCM A;  3NEN A;  3S2D H;  1H95 A;  5A35 A;  3PQI A;  1JOO A;  2J4X A;  2M00 A;  1U9R A;  4JI4 L;  1HA6 A;  3CCU A;  4DK1 A;  1OXU A;  5C4X G;  1D5M C;  4L5R C;  4DR3 L;  3GO5 A;  4DU9 A;  2ZXR A;  3RUZ A;  1JT8 A;  2Z8L A;  3QWN A;  3TME A;  2FFK B;  1SMY D;  2R7Z G;  4RHR A;  2ALY B;  1KRS A;  4DR6 L;  1NR2 A;  3KOJ A;  2JA8 G;  4KHV A;  1ESR A;  4ZLT F;  4A3J H;  3SHL A;  3I8Z A;  1U4R A;  1GD7 A;  3GTJ B;  3NXW A;  3DWA A;  1N32 L;  4BA1 I;  2XWJ B;  4IJH A;  1HJP A;  4DV5 Q;  4CBV A;  3U4V A;  3CPW A;  1Q82 C;  5CV7 A;  5EPK A;  3L2P A;  2IT1 A;  3OYY A;  4XTC S;  1SR3 A;  3U50 C;  5I2Y A;  4LUV A;  2FXQ A;  4A3G G;  2VQF Q;  1O7I A;  1R9T H;  4IUN A;  2AQ2 B;  4HJ7 A;  4JBW A;  4DV3 Q;  1KTK A;  1FD7 D;  2OTL A;  2MGS A;  3QOJ A;  4A3G H;  5ELC A;  5I9O A;  1JQY D;  1LT5 D;  1HZA A;  1NTG A;  1PH2 A;  2IL8 A;  1WTX A;  4ZKB B;  1S4Z A;  4PMB A;  3BVG A;  4JOI C;  5IE8 A;  1A6X A;  1ENA A;  2HIV A;  4PZ8 A;  2MO0 A;  3U4Z A;  2DNC A;  3JAM E;  1T5X D;  3M9B A;  5HGQ A;  2A73 B;  2JA9 A;  1RKN A;  2ZTE A;  1O7L A;  1AW7 A;  2Z6B A;  3ULL A;  2I5L X;  2NN6 H;  3K5N A;  2K04 A;  2DY7 A;  4A3F G;  4HID A;  3UE1 A;  3D31 A;  2I46 A;  1CK1 A;  4HR7 B;  4L5T A;  5M3M G;  1KDA A;  4FXD A;  4A3F H;  4JI7 L;  2FMM A;  5FLM H;  2JA5 B;  4RCN A;  1Q7Y C;  2I5H A;  4WJW A;  3CQZ H;  4GNX C;  2NN6 G;  5CR3 A;  5J3B A;  3CRL C;  3DUZ A;  4J8Q A;  4DR2 L;  4I7Z C;  5ELE A;  3RZD H;  4A3G B;  1RIP A;  5C44 H;  1O80 A;  3HOV H;  1SYF A;  5C4X H;  4JI6 Q;  1E7Z A;  2F1M A;  1X3P A;  1XPO A;  2XVS A;  1BKB A;  3PO2 B;  1YHA A;  2KOL A;  2BA1 A;  2UXB L;  1I94 Q;  2PYK A;  1GUW A;  3ITP A;  4H0L C;  1QJO A;  2E8G A;  1ENC A;  2QEJ C;  4GZY C;  1SYB A;  1UE6 A;  4YWK A;  4FF2 A;  3MA2 B;  4KJN A;  1YIT A;  1PH8 A;  1LT3 D;  3OOC A;  3GTM B;  4DV7 Q;  4R8I A;  1SMY C;  1KAW A;  3MXU A;  5IWA Q;  4DR1 L;  1F9R A;  2VY3 A;  4KI0 A;  1F2Y A;  1TWH H;  2VB2 X;  2L4N A;  1VF7 A;  1BBU A;  5C5M A;  1L1O B;  1KLU D;  5NUC A;  3HOW B;  4TVA B;  3K7U C;  1SBB B;  4PMW A;  1HCZ A;  2NN6 I;  4DV6 L;  3FKI G;  1TWF B;  1OXV A;  3KBG A;  4BY7 H;  2HT1 A;  1HHV A;  5KGU A;  4K5X A;  4KY5 A;  4GLA C;  3RZO H;  4KHP Q;  1PV4 A;  1HH2 P;  4IPD A;  5E1F A;  1VQ7 A;  1C8C A;  1KD1 C;  2XWB B;  3IRB A;  3VYT A;  2IHF A;  4V0B A;  4HCE A;  3M4Y A;  3U9S A;  1I50 B;  3X3N A;  1FL0 A;  3TP7 A;  2VL6 A;  1KNA A;  1Q90 A;  4DR7 Q;  1Y69 U;  1IZ6 A;  4NXM L;  4K2K A;  4ID6 A;  3S15 H;  1LT6 D;  2CW0 C;  2K05 A;  4RAU C;  1HUN A;  2AMC B;  1DZ1 A;  3CCE A;  1SE4 A;  1DOK A;  3RLF A;  3WOE A;  2RSN A;  1YJ9 A;  2IJ0 A;  2UUB L;  1E0B A;  1WTR A;  2R3Z A;  4GKJ L;  1PTO F;  3C1F A;  1CA6 A;  5M5W H;  2Y0S G;  3VR4 A;  1ILP A;  3J80 L;  1G91 A;  3OMC A;  3MFG A;  4Y52 H;  5K36 G;  1MKH A;  2DNE A;  2B3G A;  4LFA L;  5C0X J;  1Z7T A;  2Z6K A;  1L2F A;  1JJG A;  2L12 A;  3K5O A;  4DNT B;  2K5Q A;  4JBK A;  1DOM A;  1B3Q A;  1QB5 D;  4CDD C;  2JYO A;  3RN2 A;  2A19 A;  5J39 A;  4A3L H;  3KYH C;  2Z4H A;  1LM0 A;  3SR1 A;  3MXN A;  1Q1E A;  5EKI A;  3OTO L;  5BN5 A;  1U4L A;  4MHE A;  4BY7 G;  4A4I A;  4G7Z C;  3J7A V;  5EGT A;  4YWL A;  3GTO B;  3F1Z A;  2YTY A;  2EIF A;  2QDB A;  4G7H C;  1QOH A;  3NP8 A;  4IUP A;  4BXX G;  3IL8 A;  2AWN A;  4RGT A;  2EYH A;  1I6V C;  4QJF A;  1H9K A;  3VR6 A;  5JJL A;  1PH1 A;  5M5Y H;  1QNU A;  1T5E A;  1W2B A;  5KYI A;  4UAI A;  1EYA A;  1BOS A;  1U4P A;  2MHV A;  1D2B A;  3PUY A;  1GUN A;  1I5F A;  4X6A H;  1CT1 D;  1GVP A;  4LJZ C;  1W6K A;  1KDB A;  3G4S A;  1KAB A;  4DK0 A;  5CV9 A;  3A8J E;  4WJ3 M;  1WTH A;  2EJG C;  1E2V A;  4DR5 Q;  2A6H C;  2IHE A;  4JI8 L;  2UXD L;  2F0K A;  1RTN A;  2AUK A;  4YY3 L;  4FNF A;  5JEA H;  5FLX E;  2EDG A;  4R8N A;  3MWY W;  4OO1 G;  1QNK A;  4XXE A;  4LWC A;  2GVA A;  1Y8P B;  4A3I B;  3QG1 A;  1PFN A;  5EAY A;  3J7Y W;  2ASB A;  3BJU A;  3CP0 A;  1VQA A;  1GUG A;  4EGV A;  3BZK A;  4N8F A;  4A3J G;  3T1H Q;  1R4P B;  1FJG L;  4LF6 Q;  3BZD B;  3U58 A;  1EY8 A;  5JJK A;  1TWF H;  2A6H D;  1YNX A;  2DN8 A;  3S17 B;  3T51 B;  1I6H B;  2IX1 A;  1SNO A;  4GKK L;  1D1K A;  5H1S E;  1FGU A;  2PI2 E;  4QGU A;  3NTI A;  3FRP B;  3ZJY C;  3UDG A;  5C4X B;  4FXG C;  2PO4 A;  4BBS H;  1GXD C;  4JK1 C;  4BS9 A;  2K5V A;  2NVX H;  5GAD C;  4C3J H;  1CQF A;  4R4C A;  5KYL A;  2JEA I;  3TS2 A;  4FF3 A;  5CV6 A;  3MAQ A;  1YBY A;  1L0W A;  2MQH A;  3I90 A;  4DNR B;  2PQA B;  1CKM A;  1XNR L;  3HOX B;  3RNU A;  4DAV A;  3W2D A;  3S1Q B;  1IXR A;  4DR1 Q;  2B8G A;  2YU9 H;  3CXC A;  4KTA A;  3AU7 A;  4QQB X;  1DON A;  2F4V L;  2K50 A;  3J80 E;  1UWV A;  3NWS A;  1EU4 A;  3PO3 B;  2NWG A;  4JCV E;  2HDL A;  4ZRZ A;  3F2U A;  3KJO A;  2AQ3 B;  1NE3 A;  2NZH A;  5IGG A;  3ONA B;  1VQN A;  4IFD I;  3CC4 A;  4FVM A;  3PO3 H;  3H6M A;  4UP9 A;  5CYU A;  1HPC A;  1I3Q B;  1LUZ A;  3J80 c;  2HQL A;  4POG A;  1R9T B;  4A3D G;  2K52 A;  2Q8I B;  3K0Y A;  2BOS A;  1MD2 D;  3WWV A;  1EYG A;  3BVZ A;  2R93 G;  2NYZ D;  3I4L A;  4B3T Q;  2VZA A;  3NTH A;  2Q2I A;  4QIW E;  3ULJ A;  2WV6 D;  4RH6 A;  4RFB A;  4LFC Q;  3MXN B;  1KQS A;  3HEJ A;  2C9O A;  3PIO 3;  1Y1W G;  1D7Q A;  1PTO C;  1PZI D;  4Z9C B;  1TY2 A;  3A7L A;  3A8I E;  1SN8 A;  1ET6 A;  1IBK L;  2R6G A;  1TWC B;  1PTO H;  4JI6 L;  2VS1 A;  3TN2 A;  1RD9 D;  4G4K A;  2B2W C;  4EQN A;  1UE7 A;  4I7A A;  3I72 A;  1L1O A;  3BS1 A;  5C3W A;  1UAP A; 
#chains in the Genus database with same CATH homology
 3GD7 A;  3T4A C;  3MC0 B;  3S9W A;  3VYR A;  4MN3 A;  4IFD G;  2F0S A;  2L5T A;  1GUO A;  1WCM B;  1C4Q A;  3KLS X;  3DHQ A;  1BF4 A;  2B2T A;  3BDC A;  3QJY A;  5E3F A;  2EJF C;  1OXX K;  1RF2 D;  2F0I A;  2E74 C;  1NSN S;  2E2J B;  2I07 B;  4L8J A;  1QWY A;  1MSH A;  2PCF B;  3OWE B;  1M4V A;  4IUT A;  2O2L D;  2EZV A;  4NP5 A;  2OF1 A;  1SE3 A;  1KDC A;  2YYZ A;  1SDF A;  2EE1 A;  5CMD A;  4ODG A;  4CKB A;  5M3M B;  3MFY A;  1D1I A;  5M5X B;  1AN8 A;  4C2M B;  4XQQ A;  5IT9 E;  2F0O A;  4X3U A;  2N55 A;  4XYO A;  4Q5V A;  1EEI D;  2D2C C;  1QG7 A;  3ZYY X;  4OIK A;  5IOD A;  3A54 A;  1WTO A;  3EA6 A;  2RKS A;  1FNV A;  1NCV A;  3A55 A;  3HS0 C;  2K03 A;  1G2S A;  2E76 C;  1WD1 A;  2SOB A;  2HCC A;  2NVX B;  1NR4 A;  2NB0 A;  1V1P B;  1QE6 A;  2RBM A;  5JVH 3;  2B8F A;  4O42 A;  3OIQ A;  5IGC A;  1DM0 B;  4A3D B;  2KEE A;  1A15 A;  2R61 A;  5KIX A;  3VR3 A;  3C3L A;  1A2T A;  1ZEQ X;  1GHJ A;  4F8M A;  1LTR D;  2SDF A;  1KLG D;  5JJZ A;  4C3I B;  4CKE A;  5G3L D;  3SK8 A;  3DEO A;  3V96 A;  1D6E C;  3A8K E;  3HP3 A;  3OIP A;  1DXM A;  1IHZ A;  3GTQ B;  1SSO A;  3NPP A;  2TSS A;  1TWG B;  1V8Q A;  3ND8 A;  4KMU C;  4OHJ A;  5C4Z A;  5DNF A;  3T53 B;  5IGD A;  4RGN A;  1JB3 A;  4KKS A;  2F0D A;  1G6Z A;  3CRK C;  3URY A;  4A3E B;  2E75 C;  4ZKC B;  1LTA D;  3VA7 A;  1DJR D;  5C4J B;  1SNC A;  5C6A A;  4MIU A;  3K59 A;  3FEW X;  3I4N B;  1I4P A;  3D6C A;  1JR0 D;  1VF5 C;  1D5Z C;  2EYP A;  3DEP A;  3WDN A;  2K5D A;  3K7A B;  1PYW D;  1WD0 A;  4NMZ A;  4RHS A;  2M9V A;  4WOR A;  1C48 A;  4ZUJ A;  5FK9 C;  5JOB A;  2F0U A;  1DCZ A;  4DF7 A;  3L3O C;  4KKU A;  4RCO A;  3KLS A;  4OO1 I;  4CHT B;  4G57 A;  2WIN B;  3D4R A;  3KK7 A;  3S1R B;  3SE0 A;  1VCI A;  4KN7 C;  4IUU A;  4LAA A;  5K36 H;  4CJ0 B;  1F9P A;  3MTS A;  1F9Q A;  2B63 B;  1HFN A;  5FO9 B;  1TS4 A;  1XXG A;  1OXT A;  3H94 A;  2EY2 A;  3LX0 A;  2KCN A;  3RMH A;  3SK6 A;  1PDQ A;  4WFN 3;  2RDG A;  3MXP A;  2LS0 1;  4QF4 A;  2BE5 C;  2F0L A;  1YNJ C;  3L9A X;  4KN4 C;  3C2P A;  4K5W A;  3Q22 A;  1BR9 A;  4HN7 A;  2IW3 A;  3G7L A;  2ZXP A;  1CZW A;  2NZ1 D;  1UUP A;  2JSO A;  1SAP A;  1Q3L A;  5I4D A;  1FGB D;  5FKA C;  1K8M A;  1AZP A;  2WKC A;  3OWF A;  1O7Y A;  2EPB A;  4DXG A;  1ILQ A;  1EY4 A;  3NTK A;  2EY5 A;  2WAC A;  3TZU A;  2NTT A;  1EIG A;  1TT2 A;  3IFD A;  5CC4 A;  5C4H A;  1D5X C;  5E4W C;  2XIW A;  5M3F B;  5DM6 3;  2ICI A;  2NVY B;  2SNS A;  4DFA A;  1LLR D;  4F7X A;  3J81 E;  1HTL D;  1BCP C;  5DM7 3;  1HRJ A;  3PUZ A;  1RJT A;  5DAU A;  3SXH A;  3MVV A;  3D8G A;  5JVG 3;  5JPN C;  2MUY A;  1JOK A;  4C1N K;  3PMF A;  4IZ8 A;  4C3H B;  4K2L A;  3A7A B;  1RTO A;  3RD4 A;  1IKL A;  4BWG B;  4J6H A;  4DGZ A;  4M1U B;  2PMZ B;  3VYS A;  4X3K A;  4Y7N B;  4LK1 C;  1H9S A;  1AEX A;  3NWT A;  1RHP A;  3HG9 A;  1A3U A;  3DWP A;  2ENB A;  1B1Z A;  1PFM A;  5EQ0 A;  5KND A;  4KV6 A;  1F9S A;  1GOZ A;  3GV3 A;  2O4X A;  1B50 A;  3K58 A;  1SXT A;  4CJ1 B;  4OGQ C;  5CGK A;  1ZKO A;  3V05 A;  4YIJ A;  3SDZ A;  2J0T D;  3CU7 A;  3NHH A;  4TKO B;  1PRT C;  4K5V A;  1JIC A;  3HGB A;  2D62 A;  1EL0 A;  1ROD A;  3EQL C;  4TQU S;  4A3F B;  1IYV A;  4C3I G;  1UEA B;  4NKL A;  1MI2 A;  5EPL A;  3FDT A;  1TU2 B;  2XN9 C;  3M3Y B;  3I70 A;  1RDP D;  2F0J A;  4QIW B;  4BBR B;  4FF4 A;  2Y0S B;  4BA2 I;  3VR5 A;  2KQ3 A;  1SFO B;  3Q6S A;  4K8J A;  1LTT D;  3HRZ C;  1A3V A;  2KED A;  1ML0 D;  2O5J C;  5A2Q L;  4A3B B;  4XIG S;  1GJX A;  1SYD A;  1H9J A;  5A2Q E;  1B44 D;  1YNN C;  4ME5 A;  5I2X A;  4RGO S;  4QUF A;  3DMU A;  3OPO A;  2KUM A;  3VYU A;  1EWH A;  1TVX A;  2K01 A;  4XDX A;  5ISR A;  1F2Z A;  3T16 A;  1STY A;  2M2L A;  2EOT A;  5CV4 A;  2B2V A;  3PIP 3;  1HTP A;  1L0Y B;  4N9P A;  3SVM A;  1FR3 A;  3CHB D;  1HQR D;  1Z47 A;  4CJ2 C;  2F3V A;  1SYC A;  1STG A;  1Y8O B;  1LTG D;  4C56 C;  1F2L A;  2TMP A;  1TS5 A;  5JAV A;  2B39 A;  2XRS D;  2L55 A;  5JEA G;  3QOL A;  1TQO A;  1H9R A;  4PMC A;  2IX3 A;  1EZ6 A;  2QCP X;  2RQX A;  1L0X B;  3IAY A;  1EWC A;  5EPJ A;  1FNU A;  3QIA A;  3TSS A;  3NQT A;  4C3H G;  3DXJ C;  1JWM D;  3H0G B;  2V4D A;  4ZQ3 A;  2XSC A;  4G7O C;  2KVM A;  2A69 C;  3H09 A;  3BDL A;  5TSS A;  1ENF A;  2VXW A;  3M85 A;  2AQ1 B;  1II3 A;  5CBE E;  1TII D;  2F0Q A;  4OL7 A;  3FMC A;  1Z6H A;  3DWQ A;  2R92 B;  5C44 B;  4ULL A;  1V1O A;  1K83 B;  3I91 A;  3NK9 A;  3ERQ A;  3E5S A;  4A3M B;  1GUT A;  3CQZ B;  2BDN A;  1MSG A;  1PTO B;  3SK4 A;  1ZXT A;  3AB9 A;  4RKL A;  1B2T A;  4DA2 A;  3M7G A;  1Y1W B;  1Q8I A;  1A2U A;  3DM1 A;  4Q0F A;  1KAA A;  1JC7 A;  5FO7 B;  2L9H A;  3TP8 A;  1F77 A;  1ZYR D;  1I4G A;  4NDX A;  3L7Z C;  2K33 A;  4H13 C;  4IUQ A;  4PNY A;  1V1P A;  4OIJ A;  2AUJ D;  3G6J B;  4KY7 A;  4X3T A;  3D3R A;  3S2H B;  1AP0 A;  2XRQ D;  3NE5 B;  2K1B A;  3GV6 A;  2PNR C;  2PZT A;  4B9X A;  1O7Z A;  2L11 A;  3S16 B;  2D9U A;  2OEO A;  3HOU B;  1B9M A;  3P7J A;  2BE5 D;  5D3I B;  1PZK D;  1STN A;  3M7N A;  4A3J B;  1CTM A;  2CW0 D;  2FIN B;  2J7Z A;  2A68 C;  4KY6 A;  1TY0 A;  2VB3 X;  1HUM A;  3BG3 A;  3I73 A;  1O78 A;  2JE6 I;  1X3Q A;  2K28 A;  4U67 3;  1OXS C;  1XWE A;  1HXY D;  2K5W A;  4X3S A;  4HSV A;  4XYQ A;  4NW2 A;  2SNM A;  2B2T C;  1LTB D;  1OO9 B;  2Z1C A;  5C0X I;  2MJ8 A;  3E6Z X;  5J22 A;  1ESF A;  1QCB D;  5E4X A;  4KJO A;  1GHK A;  5K5P A;  1TKW B;  3LWE A;  1DD2 A;  2EYF A;  1MBY A;  5ELD A;  3N52 A;  4KHZ A;  5IGF A;  1BDO A;  1MGS A;  4R9W A;  5LL6 S;  3QB3 A;  3I3C A;  3SEB A;  4XQN A;  3GTG B;  2D5D A;  1EFI D;  4BY1 B;  4HCS A;  4RKB A;  4EQO A;  2JA7 B;  3P1H A;  2KCC A;  2PZU A;  2WII B;  1STB A;  2HCI A;  3S14 B;  1CI3 M;  1EIH A;  3N6R A;  1QIL A;  3H91 A;  2IWH A;  1SND A;  4A93 B;  5AFW A;  3EVQ A;  1TR5 A;  3KF8 A;  1EZ8 A;  4F87 A;  2EVB A;  3ND9 A;  3PUX A;  4K14 A;  1G2T A;  1PRT D;  3D4D A;  1B3A A;  2B2U C;  1R4Q B;  2A68 D;  2SEB D;  1XX8 A;  4DAY A;  3HOV B;  3D6W A;  5I6Y A;  3W3A A;  2JA6 B;  3Q0A A;  3HOY B;  1LAC A;  2CVR A;  2OT2 A;  3C46 A;  1A3T A;  1Y1V B;  5IT9 L;  3OHX C;  1SJH D;  1CZG A;  2KHS A;  3M4O B;  3D4W A;  3TZD A;  1S5F D;  3R8B A;  1I4R A;  1EU3 A;  5DEH A;  3P75 A;  2NVT B;  1SNP A;  4A3K B;  4XQJ A;  2F0H A;  1NAP A;  2A74 C;  2IX0 A;  1LO5 D;  3J7A F;  5C3X A;  5FLX L;  3KLR A;  2Z4I A;  4PV1 C;  1PMR A;  3UI2 A;  4BBS B;  2HQE A;  4J1M A;  5EKK A;  5BN4 A;  2EYM A;  5LL6 X;  2KEC A;  5C3E B;  2N88 A;  1CHP D;  2HUG A;  1ICW A;  5T1I A;  2PW7 A;  1JWS D;  3FPU B;  3K5L A;  4XT1 B;  1PTO D;  2O5I C;  4FXK C;  2EY1 A;  1LTS D;  5M5W B;  4EQP A;  4QMG A;  2RSO A;  3R2I A;  3EJI A;  1AFP A;  4P2C B;  1S5E D;  2AWO A;  5JPM C;  1SNM A;  1FYC A;  2F0T A;  5J1Z A;  1SEB D;  1EYD A;  4LMQ D;  2F0N A;  2E2H B;  2E2D C;  2B2U A;  1JOR A;  3OW7 A;  5FOB B;  5I6W A;  2F4I A;  3E0J A;  4CGY B;  5KNB A;  2F0W A;  1HQM C;  3ERO A;  1EY7 A;  1RCV D;  1B53 A;  4KD4 A;  4PQX A;  4QCL A;  3AMU A;  3RZD B;  1M8A A;  2F03 A;  3I4M B;  1J9O A;  1HA5 A;  3S1M B;  3V2T A;  5EBC A;  4AYB B;  5G3L F;  5IIF A;  2GA4 B;  1BCP F;  1FNW A;  1CA5 A;  4S3S A;  1E2Z A;  1XYI A;  4E6I A;  1E2W A;  2ICE C;  3IFT A;  2MP1 A;  4IFD J;  5ELB A;  3BYT B;  4I65 A;  1Q12 A;  3HOZ B;  1EY6 A;  2L0C A;  3K57 A;  3VA5 A;  2WB1 B;  4ZUI A;  3EFX D;  5HUR A;  5I9P A;  1ET9 A;  3TP6 A;  1STE A;  2LFN A;  3NBH A;  2A5H A;  3K5M A;  5KRU A;  5CBA E;  5C0X H;  1G8Z D;  3LWU A;  5D3D A;  1SYE A;  4EVO A;  2EYO A;  5CV5 A;  1J8I A;  2F0F A;  3BDO A;  2NUC A;  1LT4 D;  2NVQ B;  2B2Y C;  4C1N I;  1I4H A;  3CKI B;  1K8O A;  2A6E C;  2YU9 B;  3T56 B;  2B2W A;  3HKZ B;  4HMJ A;  1PRT F;  4WRD A;  1WVL A;  1Y8N B;  4RA8 A;  5IGB A;  1Q1B A;  2F0P A;  3OSO A;  1EY9 A;  2K7V A;  2EJM A;  3K6O A;  1SYG A;  3R93 A;  2K6A A;  1WTP A;  5C5L A;  2JEB I;  4FO2 A;  5CV8 A;  3A56 A;  1H9S B;  1PLF A;  2H4O A;  4ZK9 B;  1STA A;  5C0X G;  2H1E A;  1S5B D;  1PFB A;  5HGT A;  1EOT A;  4IFD H;  4DAP A;  3Q23 A;  1GUS A;  4B9W A;  3S1N B;  3TBI B;  1V43 A;  2MPM A;  3FPP A;  1SNQ A;  5JEA J;  1BUV T;  2F0G A;  1BCP D;  5EKL A;  2VUM B;  4K6L A;  3MXG A;  2B2V C;  3JAM L;  1LV9 A;  2EYJ A;  4FF1 A;  1ONL A;  4UDU C;  4HTH A;  1BQQ T;  2G9D A;  5BN3 A;  1EY5 A;  4IAL A;  2BCO A;  4CKC A;  1H9M A;  2ZXO A;  5COY A;  1G29 1;  1BBX C;  3NQI A;  2EY6 A;  3H3V C;  3PUV A;  4L63 B;  1DYQ A;  3HZX A;  3R2T A;  4L6T B;  2KA7 A;  2EYL A;  2F0M A;  4DXF A;  2CQA A;  2CHB D;  1WTQ A;  2A69 D;  2LKV A;  2B2Y A;  3BVM A;  2C5C A;  1LTI D;  3GTL B;  1DOL A;  5D65 A;  5M9O A;  3TDQ A;  4DN4 M;  2BA0 A;  3KBX A;  4IUV A;  3PV0 A;  3Q24 A;  2JXM B;  1TS2 A;  4ILW A;  2NTS A;  1BCP B;  2ZT9 C;  4U68 A;  4FYD A;  3FVQ A;  5COR A;  4HAE A;  1U4M A;  1IL8 A;  3BYY B;  2G9H D;  2QKI C;  3R3O A;  4H7B A;  3O13 A;  1JE4 A;  2FHT A;  4BY7 B;  4ABN A;  2DY8 A;  3TP5 A;  3MEH A;  4V19 0;  4K8I A;  3VR2 A;  2RDH A;  2K32 A;  2Q8T A;  1JCK B;  2WAQ B;  2HDM A;  4FP5 D;  1IKM A;  2NBF A;  2VNU D;  5F2D A;  2BDO A;  1UNS A;  2E2I B;  3OMG A;  3GTP B;  2KJX A;  1F2M A;  1SE2 A;  5T1G A;  3U9O A;  2X6G A;  1AZQ A;  1IW7 C;  1XTC D;  3J81 L;  3C1E A;  2LY7 A;  3S2D B;  1PRT B;  4KKT A;  3RZO B;  3MZ5 A;  4QB4 A;  4C3J B;  5FO8 B;  4QUC A;  2X6L A;  3T13 A;  3GP7 A;  2A6E D;  1W6J A;  1BNZ A;  2R7Z B;  2WP8 J;  2XNA C;  5IOC A;  2JP1 A;  4F88 A;  1TWH B;  2F0V A;  1PZJ D;  2PW5 A;  1X32 A;  2PPB C;  2WKD A;  3S15 B;  3NSW A;  4KD3 A;  1EEF D;  5IGE A;  4RGM A;  4XT3 B;  2F0E A;  4TRD A;  1IW7 D;  3FKI B;  2Q8R E;  2QIL A;  5D14 A;  4HSP A;  1PXU A;  5M5Y B;  1CHQ D;  4HMI A;  3GTK B;  3X3M A;  2QF7 A;  5KNC A;  2RA4 A;  1S5D D;  3PUW A;  1VDZ A;  2X69 A;  1CQV A;  3NBI A;  5EBD A;  1CFM A;  4IUR A;  3LNN A;  4O1N A;  4N9T A;  2L1B A;  4B08 A;  2LMC B;  2RDF A;  1I4Q A;  1EQV A;  3GQB A;  5LHY 1;  4TSS A;  4OO1 H;  2OXP A;  1VMC A;  4HED A;  3WOF A;  3P20 A;  1HFG A;  4H44 C;  1SJE D;  2IPK D;  2EXZ A;  1BXT A;  1IYU A;  2PQE A;  5KEE A;  1EQT A;  2FMC A;  1TWA B;  1B4O A;  2RVL A;  4K6D A;  1JOQ A;  1KNE A;  1WTV A;  2PZW A;  1I4X A;  1EY0 A;  1TS3 A;  2F3W A;  2FJ2 A;  4KK7 A;  3NUC A;  3IKJ A;  2R93 B;  1VMP A;  2JA8 B;  4RWS C;  1ZYR C;  1CM9 A;  1B9N A;  1WTW A;  3MHB A;  4IN3 A;  3SK5 A;  4ZYS A;  1YNN D;  1LAB A;  3KUP A;  5EJW A;  1NUC A;  4IQZ A;  1YNJ D;  1BO0 A;  4ZAI A;  5ELF A;  1STH A;  2ID0 A;  4C3J G;  1JWU D;  3QO2 A;  4M8A A;  1EYC A;  1S5C D;  5A35 A;  1JOO A;  2J4X A;  2M00 A;  1U9R A;  1HA6 A;  4DK1 A;  1OXU A;  1D5M C;  3GO5 A;  4DU9 A;  2ZXR A;  3RUZ A;  2Z8L A;  3QWN A;  3TME A;  2FFK B;  1SMY D;  4RHR A;  1NR2 A;  4KHV A;  1ESR A;  4ZLT F;  3SHL A;  3I8Z A;  1U4R A;  3GTJ B;  3NXW A;  3DWA A;  4BA1 I;  2XWJ B;  4CBV A;  5CV7 A;  5EPK A;  2IT1 A;  4XTC S;  5I2Y A;  4IUN A;  2AQ2 B;  4JBW A;  1KTK A;  1FD7 D;  2MGS A;  3QOJ A;  5ELC A;  5I9O A;  1JQY D;  1LT5 D;  2IL8 A;  1WTX A;  4ZKB B;  1S4Z A;  4PMB A;  3BVG A;  1A6X A;  1ENA A;  2DNC A;  3JAM E;  1T5X D;  2A73 B;  1RKN A;  1O7L A;  1AW7 A;  2NN6 H;  3K5N A;  2K04 A;  2DY7 A;  3D31 A;  2I46 A;  1CK1 A;  4HR7 B;  1KDA A;  4FXD A;  2FMM A;  2JA5 B;  4RCN A;  4WJW A;  2NN6 G;  5CR3 A;  3CRL C;  3DUZ A;  4J8Q A;  4A3G B;  4I7Z C;  5ELE A;  1O80 A;  1SYF A;  2F1M A;  1X3P A;  2XVS A;  3PO2 B;  2KOL A;  2BA1 A;  2PYK A;  1GUW A;  3ITP A;  4H0L C;  1QJO A;  1ENC A;  2QEJ C;  4GZY C;  1SYB A;  4FF2 A;  3MA2 B;  4KJN A;  1LT3 D;  3OOC A;  3GTM B;  4R8I A;  1SMY C;  3MXU A;  1F9R A;  4KI0 A;  1F2Y A;  2VB2 X;  2L4N A;  1VF7 A;  5C5M A;  1KLU D;  5NUC A;  3HOW B;  4PMW A;  1SBB B;  1HCZ A;  2NN6 I;  1TWF B;  1OXV A;  3KBG A;  1HHV A;  5KGU A;  4K5X A;  4KY5 A;  5E1F A;  1C8C A;  2XWB B;  3VYT A;  4V0B A;  4HCE A;  3M4Y A;  3U9S A;  1I50 B;  3X3N A;  3TP7 A;  1KNA A;  1Q90 A;  1Y69 U;  4K2K A;  4ID6 A;  1LT6 D;  2CW0 C;  2K05 A;  4RAU C;  1HUN A;  1DZ1 A;  1SE4 A;  1DOK A;  3RLF A;  3WOE A;  2RSN A;  2IJ0 A;  1E0B A;  1WTR A;  2R3Z A;  1PTO F;  3C1F A;  1CA6 A;  3VR4 A;  1ILP A;  3J80 L;  1G91 A;  3OMC A;  3MFG A;  5K36 G;  2DNE A;  5C0X J;  1Z7T A;  2L12 A;  3K5O A;  4DNT B;  2K5Q A;  1DOM A;  1QB5 D;  2JYO A;  5J39 A;  2Z4H A;  3SR1 A;  3MXN A;  1Q1E A;  5EKI A;  5BN5 A;  1U4L A;  4MHE A;  4G7Z C;  3J7A V;  5EGT A;  3GTO B;  2QDB A;  4G7H C;  1QOH A;  3NP8 A;  4IUP A;  3IL8 A;  2AWN A;  4RGT A;  2EYH A;  1I6V C;  1H9K A;  3VR6 A;  1QNU A;  1T5E A;  5KYI A;  4UAI A;  1EYA A;  1BOS A;  1U4P A;  2MHV A;  1D2B A;  3PUY A;  1GUN A;  1CT1 D;  4LJZ C;  1W6K A;  1KDB A;  1KAB A;  4DK0 A;  5CV9 A;  3A8J E;  2EJG C;  1E2V A;  2A6H C;  2F0K A;  1RTN A;  2AUK A;  4FNF A;  5JEA H;  5FLX E;  2EDG A;  4R8N A;  3MWY W;  4OO1 G;  1QNK A;  4XXE A;  1Y8P B;  4A3I B;  3QG1 A;  1PFN A;  3J7Y W;  1GUG A;  4EGV A;  1R4P B;  3BZD B;  1EY8 A;  2A6H D;  2DN8 A;  3S17 B;  3T51 B;  1I6H B;  2IX1 A;  1SNO A;  1D1K A;  3NTI A;  3FRP B;  5C4X B;  4FXG C;  2PO4 A;  1GXD C;  4JK1 C;  4BS9 A;  1CQF A;  5KYL A;  2JEA I;  4FF3 A;  5CV6 A;  3MAQ A;  3I90 A;  4DNR B;  3HOX B;  4DAV A;  3W2D A;  3S1Q B;  2B8G A;  4KTA A;  3AU7 A;  1DON A;  3J80 E;  3NWS A;  1EU4 A;  3PO3 B;  2NWG A;  2HDL A;  4ZRZ A;  3F2U A;  2AQ3 B;  5IGG A;  3ONA B;  4IFD I;  4FVM A;  3H6M A;  5CYU A;  1HPC A;  1I3Q B;  1R9T B;  2Q8I B;  3K0Y A;  2BOS A;  1MD2 D;  3BVZ A;  2NYZ D;  3I4L A;  3NTH A;  2WV6 D;  4RH6 A;  4RFB A;  3HEJ A;  2C9O A;  3PIO 3;  1PTO C;  1PZI D;  4Z9C B;  1TY2 A;  3A7L A;  3A8I E;  1ET6 A;  2R6G A;  1TWC B;  1PTO H;  3TN2 A;  1RD9 D;  4G4K A;  2B2W C;  4EQN A;  3I72 A;  3BS1 A;  5C3W A;  1UAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...