2B2YA

Tandem chromodomains of human chd1
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
176
structure length
175
Chain Sequence
EFETIERFMDCRIGRKGATGATTTIYAVEADGDPNAGFENKEPGEIQYLIKWKGWSHIHNTWETEETLKQQNVRGMKKLDNYKKKDQETKRWLKNASPEDVEYYNCQQELTDDLHKQYQIVGRIIAHSNQKSAAGYPDYYCKWQGLPYSECSWEDGALISKKFQACIDEYFSRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Peptide binding protein
molecule keywords Chromodomain-helicase-DNA-binding protein 1
publication title Double chromodomains cooperate to recognize the methylated histone H3 tail.
pubmed doi rcsb
source organism Homo sapiens
total genus 53
structure length 175
sequence length 176
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2005-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2b2yA02
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2b2yA01
1QG7A 1DOLA 1E0BA 1MSGA 1ILPA 1F9SA 3R93A 2X6GA 1PFBA 4IUPA 4LMQD 1LV9A 3F2UA 1RJTA 3G7LA 1O80A 1HFNA 2FHTA 3D6WA 3TZDA 1Q3LA 2L11A 1EL0A 2JYOA 3I8ZA 1F9QA 1O7ZA 2L1BA 4HEDA 1GUWA 3DEPA 2RSNA 4ZKBB 4XT3B 1HA6A 4QUCA 1WTVA 5DNFA 1EQTA 2X6LA 1A15A 4R8IA 1EOTA 1XYIA 2KEEA 1B3AA 3ONAB 4XT1B 5T1GA 1G6ZA 2JP1A 1WTWA 1AZQA 1HUNA 5JJZA 1WVLA 1J9OA 3FPUB 2MPMA 1G2TA 1O7YA 3HP3A 5CBAE 5D14A 2K1BA 4HSVA 5EQ0A 2VXWA 4ZAIA 1B50A 1JICA 2DY8A 5EPLA 1U4PA 1JE4A 3I3CA 3SVMA 1WTQA 3DM1A 1IKMA 4QUFA 1DOKA 4OIKA 2K04A 3P7JA 1IKLA 4R9WA 2MGSA 3GV3A 1WTOA 4CJ1B 1MI2A 4NW2A 1ICWA 1U4LA 3MWYW 1WTPA 2NYZD 2K03A 2DY7A 1DZ1A 1RTNA 1VMPA 5EPJA 2FINB 1AZPA 2B2TC 2KOLA 4ZLTF 1F2LA 1IL8A 1X3PA 5AFWA 5EPKA 2EE1A 4RWSC 2HCIA 1ILQA 1EIGA 2KECA 2NZ1D 2SDFA 2K01A 2NWGA 2B2WC 3I91A 2K05A 3MTSA 2B2TA 1QNKA 1G2SA 2R3ZA 1MGSA 4MN3A 2IL8A 3N52A 3TN2A 1ZXTA 5CBEE 4CJ0B 1B2TA 3UI2A 4IUTA 1X3QA 4HCSA 2B2WA 4X3SA 2KVMA 4X3UA 1KNEA 1PFMA 2M2LA 2EOTA 2N88A 4IUQA 4X3TA 4RA8A 1MSHA 3Q6SA 1PFNA 1WTRA 1WD0A 2BDNA 2CVRA 1SAPA 3QO2A 1HFGA 1HRJA 2B2UC 2KUMA 1CM9A 1M8AA 2K28A 2L4NA 2MJ8A 3KBXA 4XDXA 1C8CA 1G91A 1X32A 2EPBA 4IUVA 1BBXC 2N55A 1U4MA 1BNZA 4HAEA 2L9HA 1RHPA 3DEOA 3FDTA 4X3KA 1HUMA 1ML0D 1XX8A 2B2UA 2HDMA 4RAUC 4UAIA 2FFKB 3H91A 1CA6A 4O42A 2MP1A 1BO0A 3KUPA 4OIJA 1BF4A 1KNAA 4MHEA 3LWEA 1CA5A 1EIHA 1PLFA 1B53A 1F9PA 2HDLA 1HHVA 2L12A 1RODA 1QE6A 2RVLA 1VMCA 2Q8RE 3GV6A 4CJ2C 4ZK9B 5CMDA 2B2VC 1NCVA 2HUGA 1B4OA 2FJ2A 2FMMA 5T1IA 4IUUA 1WTXA 3IFDA 2Q8TA 1AP0A 5E4WC 1J8IA 1RTOA 2B2YC 2B2VA 5CORA 1ESRA 3IL8A 1DONA 4DN4M 1WD1A 2RSOA 3I90A 5COYA 2J7ZA 5EJWA 1NAPA 1TVXA 5D65A 5E4XA 5EKIA 2RA4A 1F9RA 1U4RA 2B2YA 1NR2A 2D9UA 4U68A 1DOMA 2HCCA 1SSOA 2XIWA 2H1EA 2KEDA 4IURA 1S4ZA 1PDQA 2X69A 4ZKCB 1SDFA 1NR4A
chains in the Genus database with same CATH superfamily
1D8LA 2VZAA 2QILA 1MSGA 1LT5D 4P2CB 4LNQA 3S1QH 4XXEA 1IBKQ 1ENCA 5A2QE 4LF4Q 1C48A 1BCPF 5C4ZA 2WB1G 3KF6A 2L11A 4PMWA 4JPBW 1A2UA 4NB3A 1QOHA 2NN6G 4AYBG 4A3IB 4Q0FA 3IFTA 1PH4A 1OXSC 1Y14B 1HUNA 2JSOA 1UE1A 4BBSB 4CDFC 1UEAB 1O7YA 3I4NH 4ULLA 4H0LC 5FLMH 1D5MC 1VQNA 3FHWA 1IZ6A 1QVFA 4A3CG 3U4ZA 5IGCA 1Y8OB 2WKDA 5IT9L 1DCZA 1ZEQX 3ERSX 4JBJA 1ICWA 2F0VA 1EY8A 1TWGB 4DV7L 4B08A 4BS9A 4CBVA 3G71A 3Q23A 3CMAA 5GAEC 4DV7Q 2F3IA 2NBFA 3RLFA 1YI2A 5FLMG 4LF7L 1K8AC 1HZCA 3MA2B 5I2XA 2VQEL 4LF7Q 2WB1E 2MO1A 2R93G 4I65A 3PF5A 4YCVA 3J7ZC 2O2LD 3H3VI 1O7LA 1SAPA 2K33A 2WV6D 4L5QA 5C3EG 4XYQA 4IFDJ 1A0IA 2WFWA 2NVTH 1PH3A 4DUYQ 4RGMA 4MNOA 3DWQA 3F2CA 3TP8A 4DR7L 2Q2HA 1EY5A 1VDZA 3S2HB 4OIJA 1EOVA 1EY7A 1EZ8A 1GUGA 2F0PA 4QIWE 4DR7Q 5CR3A 3PUZA 4B9WA 1FGUA 4UY8C 1C9OA 1PLFA 1BBWA 1JB7A 3K5NA 3GTOH 2JN4A 3M4YA 2KENA 2F0WA 3PIO3 2VNUD 5E4WC 4OWXB 2V1CC 1E1OA 3OMCA 4HTHA 1CTMA 4JBKA 4WJWA 4OO1G 2LXKA 4BA1I 4MZ9A 1B9MA 2GVAA 1S4ZA 1OXXK 2KJXA 1PH9A 4K2LA 2JA8H 2O4XA 5EBCA 1QG7A 2K4KA 1PTOF 2Z4HA 4KD3A 2DJGC 4LF9L 1VQ7A 1I6HH 5M3MB 2QEJC 1LLRD 1II3A 4NMZA 1SYDA 1YHBA 5I2YA 3M3YB 1A8VA 5C4HA 3ER0A 5FK9C 3U58A 4A3JB 3GQBA 1B3AA 2EIFA 4KKUA 1WTWA 2IT1A 3MXPA 3UDXA 4KHPQ 2R7ZB 1B50A 3I4MB 1UAPA 1FGBD 3TP6A 4R1JA 3GTLB 5ELFA 1ZYRD 1EUJA 3MEHA 2YYZA 3MWYW 1KRSA 2I5MX 1VMPA 4QF4A 1R4PB 1EWHA 1AZPA 3FKIH 1G8ZD 1CZGA 1Z6HA 3A7AB 3U4VA 5JAVA 3TRZA 2NWGA 2F0LA 1Q46A 4O2DA 3N52A 4DAPA 4OEMB 1E2VA 3QG1A 3CCLA 1PTOH 1TWFB 2V4DA 2Y0SE 5I6YA 1HR0Q 4LF8Q 4HJ5A 1BBXC 1HZBA 1RHPA 2XTIA 1DONA 2VUMG 2ASBA 1HQMC 3IRBA 1L1OC 2PI2A 4E6IA 4HMIA 3O13A 3S1NH 4A3KH 2R92B 1JCKB 3GTMH 1I50B 1G6PA 2E2IH 3KJPA 2EYPA 1JJGA 5CV8A 2NVQH 1KRTA 5FLXL 3CCJA 1CT1D 2JA6G 3CCMA 2ATWA 1PH5A 3GTGH 5COYA 3F2DA 1SYFA 3V2TA 2B63H 2BA1A 2SEBD 3CMEA 4DK1A 4OHJA 4KY6A 1M90C 1CUKA 2E75C 1I94L 2LXJA 3GTKB 1S5BD 2BE5D 4L5SA 1XWEA 5IT9E 2FXQA 1I94Q 3TZDA 2B63G 3URYA 1ZKOA 5BN5A 4A3IH 2J4XA 1GUWA 3HZXA 4HJ7A 4R8IA 3J81c 3J81j 1EOTA 2A8VA 1ZYRC 1MKHA 5BR8L 1RCVD 2MUYA 4HSPA 2F0QA 3HP3A 1KDAA 5BR8Q 1SYEA 3HOVB 1JICA 4HJAA 5IWAQ 2BDOA 2HT1A 4EVOA 2D0PA 4K5VA 1SFOB 1CZWA 4NW2A 3CW2C 5IGFA 1U4LA 4XQJA 3S15H 4BBSG 5LMNQ 4DR5L 1FJGL 3A8IE 2JXMB 4DNIA 4JV5L 3M85A 5EPKA 2B29A 4RGTA 2EE1A 1FJGQ 1EIGA 2SDFA 2NZ1D 1VQLA 4GS3A 4JV5Q 1UWVA 1QNKA 2YU9H 1BDOA 1QCBD 1LTSD 1CK1A 2RHSB 3UI2A 1PFMA 5LHY1 1PMRA 2AUKA 2NZHA 2R61A 4JI5Q 4FDBA 4X64L 3CPFA 2KHJA 3S2HH 1HZAA 1LT4D 1BNZA 2HHHQ 4X3KA 3KJOA 5IGEA 4HN7A 3V05A 1CA6A 1PYSB 3NSWA 1MBYA 4TRDA 1PRTF 2AMCB 1TKWB 4JG2A 2F0SA 3NUCA 2EYOA 4O1NA 3ND8A 3CQZB 3PF4A 2XN9C 4UPAA 2F52A 5IYDH 2F3VA 1J8IA 4Y7NB 2C9OA 2DGYA 3TEHB 1KDCA 3SXHA 1TVXA 3E9IA 4JI4Q 1VF7A 1SSOA 1QZGA 1OTCA 4LUVA 5KIXA 1AEXA 1NR4A 1S72A 1GD7A 1JWSD 4BXXH 5M3FB 1F9SA 4LK1C 2X6GA 4C3HG 3H6MA 1AE2A 3JAME 1LTGD 1O80A 4XIGS 3M3YH 4LFBQ 2GVBA 3TS0A 4A3JH 1DYQA 4UP9A 2HIXA 4L5TA 4Y52H 3GTPB 3DM3A 1A2TA 2SNSA 3ONAB 1IBMQ 5T1GA 3R2IA 2R7ZH 4QB4A 4KLKA 5M3MG 4DK0A 3TREA 4A3GH 1G2TA 3RN5A 1V1PA 3T1HL 3OYYA 3SGIA 3GTLH 1VQKA 3G48A 3T1HQ 1E1TA 1SNCA 3H94A 5CV9A 4GKJQ 2A6EC 4PZ8A 1S5CD 3S1QB 2AQ1B 1IXRA 1RIPA 1WTPA 1DZ1A 2R7ZG 1QZHA 3ERQA 2WACA 3I4MG 1NUCA 2XGTA 2K01A 2UXCL 3UDFA 3G6EA 2E2JB 1I4PA 1VQFA 4QY7A 2F0TA 4CKCA 3TP7A 1QWYA 5GAHC 3PO3B 2QGQA 3TMEA 3BYYB 5C5MA 2WINB 1TWFH 4IQZA 4KKTA 3PIOA 3IAYA 4A3LH 2UUAL 2KVMA 2EOTA 3OPOA 4LFCL 3KK7A 4B3MQ 1HNWL 3I4NB 2UUAQ 1D1KA 1VQHA 1N34L 3UE0A 5FLXE 1Y1VB 3KBXA 5I6WA 3OWFA 4KY5A 1U4MA 2KCCA 2A73B 2I5LX 4IJHA 1YHQA 1XX8A 2UU9Q 3AMUA 1SRUA 1SNDA 4L6TB 3S17H 3CRKC 4YWLA 2R92H 4FXKC 4ID6A 1I50H 1N32L 3A0JA 2F0FA 3DWPA 3A54A 4DV3L 1QE6A 2RVLA 1N32Q 2A68D 1Q1BA 5T1IA 3I2ZA 4IPCA 4NKLA 2ZJPA 1X3EA 4DV3Q 1YZ6A 4HIDA 1SMYD 1ESRA 4CKEA 4DN4M 4YY3L 2NN6I 4F7XA 2R92G 4ZYSA 5E4XA 2G9HD 2NVTB 1EU3A 1BCPB 2DUDA 1SXTA 2QKIC 3JAMi 5DM73 2F4VL 3CCRA 3HFZB 1GM5A 1L2FA 5C44G 2BA0A 4DV2Q 3VDYA 5DLQE 1E22A 3R2TA 1GXDC 1VS0A 2F0DA 3CC4A 1J5EL 4CDEC 5ELNA 2F4IA 4K8JA 5CV7A 2PCFB 1F9QA 3NK9A 3Q22A 1FNVA 3EBEA 1NMFA 4KJOA 1WTVA 1A15A 1EYCA 1HH2P 3HOVH 2EYHA 3E9HA 4RKBA 3NELA 5CGKA 3EFXD 3I70A 5F2DA 5G3LF 2VS1A 4JI7L 1SFOH 4WJ3M 4K0KQ 1IKMA 1I4HA 4P73A 1T9HA 4CJ1B 3RN2A 3E0EA 4J15A 4GLAC 2RHQB 1VQ6A 3TSSA 3NBHB 4IO9A 3TQYA 3M4QA 2I46A 4V0BA 4C1NI 5E1FA 4FF2A 3HOVG 4N9TA 2JA5H 3K81C 5C4XB 2K32A 1X3FA 3ICEA 1JORA 4X65L 4N8X1 2ZXOA 4GOPB 1A3VA 4X65Q 3T16A 3SVMA 4BBRG 4IUQA 3KF8A 4RA8A 3QO2A 5GADC 4XDXA 1FVIA 3EROA 4OO1I 1LTAD 2EPBA 2A68C 5L37A 1JOOA 2XRQD 1ML0D 1Y8NB 3KBGA 4LW1A 1SMXA 3N6RA 4CDCC 3J7AF 4EQOA 2XSCA 2L15A 4IJLA 2K52A 5DAUA 1YNXA 3GO5A 3S1MH 3FKIB 3PUYA 1CA5A 1EYDA 4RFBA 1XNRL 1STGA 4IALA 4HMJA 3T4AC 2DN8A 2Q2UA 1Q90A 3NTHA 4DUZQ 2BH8A 1H9MA 1L0XB 4LUZA 4ABNA 1CSPA 1PTOB 1LTLA 3D3RA 5IYCG 4DR2Q 3SHLA 4LAAA 3QWNA 1TT2A 2EDGA 4JK1C 2YTYA 2K5WA 1EFID 1YHAA 1EQQA 1S5ED 4C3IB 3BJUA 3F1ZA 1EU4A 1WI5A 3P1HA 2KCNA 4A3KB 3VYRA 1IW7D 3GTMB 2N3SA 1XTCD 3GTPH 3CU7A 2KHIA 4N8FA 1Y69U 2NVQB 4QUCA 2Z6KA 5M3FG 2CCZA 3GTGB 3OTOQ 1SLJA 1STYA 4JC0A 1ASYA 3J7YW 2MPMA 3D8GA 4X66Q 2PNRC 4WORA 1E2ZA 4DR1Q 1BVSA 5ELDA 4LF4L 2PMZB 1WTQA 1MHWC 2RQXA 5K36G 4C2MB 5JPMC 4A3BB 1D7QA 1CKMA 5AJ3Q 2E2JH 1F2LA 3OWEB 4OL7A 3PO3H 2DNEA 2E74C 5JEAJ 2K5DA 1PZJD 4ZRZA 3KF8B 4MN3A 1M1KC 1RD9D 1EEID 1KLUD 2F0HA 4IUTA 5FKAC 4OWTB 1Y1VH 4A93B 1WTHA 1VQGA 4O0AA 3GTJB 3BVZA 4GNXB 3RZOB 1H95A 1M8AA 1VQEA 1E3PA 2K5NA 3PO3G 3H15A 4DV1L 4IFDH 1I6VC 2F0EA 4BY7B 2K7VA 4R4QA 2MP1A 2OT2A 4DV1Q 5E3FA 3S15B 3NQIA 3ITPA 3NENA 3I4NG 3L0OA 1JJ2A 5ELEA 3RZDB 3I4LA 4JW0A 1B53A 1AN8A 4AIMA 1KTKA 3L3OC 2E5LQ 3DWAA 1B4OA 2XWJB 2YU9B 3QJYA 4KHZA 3X3NA 2O5JC 4IFDG 3K5LA 4DUYL 4G7OC 3STBD 4P74A 1TS3A 5CC4A 5HY6A 4YHHQ 2R7FA 1CKNB 1YNND 2RSOA 1NAPA 1V1OA 3BYTB 3S1RB 1Q12A 2IJ0A 3WWVA 1IW7C 2ZJQA 4JCVE 4OELB 2ZJRA 2ZXPA 1YJ9A 1Q82C 3FEWX 2WP8J 2X69A 4XQNA 1LTRD 4DV0Q 1N36Q 4QGUA 5I9OA 1PTOD 1E0BA 1JWUD 5GQOA 3RUZA 3J81E 2Z8LA 2QEXA 3HOWH 1R9TH 1RDPD 5KNBA 3G7LA 1PZKD 2CWPA 1A62A 1NMGA 3HOYH 2CHBD 5KNDA 1EIYB 1S5DD 2OF1A 5IGDA 2MFIA 4XT1B 4RHRA 5E7NA 1AZQA 3L7ZC 3PMFA 2PYKA 2IY5B 5M5YB 3LGJA 1VQIA 1AFPA 1GOZA 3E3XA 3RLOA 4RCOA 3NEMA 4HIKA 4R9WA 5C5LA 4QQBX 2CH4A 3S14B 5IODA 5C4XH 1YBYA 3OIPA 3K7UC 5EAYA 3G4SA 4TKOB 2YTXA 1X3PA 2JA8G 2Y0SG 2HCIA 3MHBA 2N49A 4KHPL 1STBA 1V1QA 1QJOA 2F0MA 5IP9H 5KGUA 4FVMA 4H44C 4A3GB 5CV4A 3BVMA 1PRTB 5C4XG 2FMCA 2E2DC 3SK6A 2SOBA 3HOZB 2ZXRA 3JAML 5KYLA 3UDIA 1SNMA 3I56A 2H4OA 2PW7A 4K6LA 2FFKB 1SNOA 2PZTA 3L9AX 1VQ9A 5IP9G 3QIAA 1SE2A 3STBC 1SYBA 1TS2A 3W3AA 1YNNC 2PQEA 3EQLC 5GROA 4FF4A 4PZ7A 1VQDA 2F1MA 1HHVA 4KN7C 4CJ2C 1F77A 5LL6X 1NCVA 2K50A 2DJFC 1HR0L 2EY2A 4LF8L 2Z1CA 4LJZC 1AP0A 1RTOA 3J80c 3FKIG 3PUVA 2XVSA 4A3MB 1KDBA 3J81i 1F9RA 2B2YA 4C3IH 2D9UA 2HCCA 3PQIA 5HGQA 3C46A 5JPNC 3RLNA 3G6JB 1HZ9A 4ZCKA 3KUPA 1SE8A 3S17B 1F2MA 5KNCA 4DNRB 1YIJA 1TWCB 1LTTD 1LM0A 1TWHB 2PPBC 2VW9A 2F0GA 1HNZL 4C3IG 3BDOA 5JOBA 2CH4W 4YCUA 1HNZQ 4JI3Q 3D4WA 4POFA 1N33L 2OQ0A 3UE1A 4A3KG 1N33Q 1WCMB 5JJZA 4IPHA 4EQPA 5IYBH 4CHTB 1FNUA 1SNPA 5CBAE 5EQ0A 3K6OA 4C2MH 2DY8A 2AWOA 3I3CA 5KYIA 4A3BH 2EVBA 4V190 1IKLA 4RKLA 5IGGA 3HOUB 3WOEA 2UXDL 3H3VH 3KLWA 1ASZA 3BU2A 1TU2B 1EFWA 2LMCB 4PNYA 5EPJA 2UXDQ 1B9NA 4CGYB 5J1ZA 4ZLTF 5IYBG 4CKBA 2Q2IA 5JJLA 1ILQA 4DKAC 3T13A 1KC8C 4A3BG 4A93H 3TZUA 4CJ0B 1ZXTA 3GTJH 4KTAA 1VQOA 3RZOH 1EEFD 4X3UA 5IWAL 4A3DH 4IOAA 2KHSA 2N88A 3Q6SA 4JVZA 4DK6C 4A3IG 3NP8A 1C8CA 3TS2A 3NWTA 4IPGA 5LMNL 4BY7H 3L2PA 3DEOA 4NXML 3M4PA 1HUMA 1ENFA 1YNJD 2AQ3B 3RZDH 4K2KA 4R4OA 1EY4A 4NXMQ 4A93G 1XMOL 2I07B 3U50C 4PZ6A 1VQJA 2JA5B 5DM63 1XMOQ 3W1GA 3ZYYX 1UE5A 2MNAA 2G9DA 5HGTA 1LT3D 4NP5A 5C0XI 4BY7G 4JI5L 1ONLA 2PMZE 2ZTEA 1N8RC 1J6QA 3K58A 2HHHL 3S1RH 1Q7YC 4NDXA 1ESFA 3LWUA 5D65A 1U4RA 1K8MA 3C1EA 2AWNA 4I7AA 3DLLA 2CW0D 1V43A 2D2CC 5FJ8H 3M9BA 3I73A 2PO4A 3S1MB 3I7FA 2NTTA 2CWAA 3Q0AA 4H7BA 3CPWA 2RF4A 1K0RA 2EYJA 2YTVA 2Z6KC 3VR2A 4B3TL 4R4IA 5FO9B 2RDFA 4AQYQ 2D62A 3A8KE 4JI4L 3PV0A 5IOCA 4B3TQ 3AFPA 1R4QB 1XYIA 3OMGA 5LMUQ 2BE5C 4DR6L 2ZT9C 5M5YH 1EY0A 1W6JA 1JQYD 4HJ9A 1XMQQ 4DR6Q 1PXUA 5K5PA 2D5DA 3W5OA 1VQAA 4QMGA 4ZAIA 3K57A 1TY0A 4C1NK 5IYDG 4B3RQ 3S14H 4LFBL 1BXTA 1B8AA 2MGSA 1UE6A 3LX0A 3A5ZB 2F3WA 1TXYA 3BG3A 3A5UA 3NXWA 4QCLA 2IX0A 3H0GH 4RH6A 2NTSA 2LFNA 3CC2A 4JI2L 3K7AB 2LS01 1IBML 3D0FA 4JI2Q 4DXGA 1RKNA 3M7NA 1CQVA 4BXXG 2B2TA 2QF7A 4UP7A 1SNQA 5C6AA 1YNJC 5BN3A 3J7A5 4PMBA 1B2TA 3VYSA 3JC66 4GKJL 2B2WA 3S16B 1LACA 3HOZH 4J6HA 1MSHA 4A3JG 1IBLQ 4XQQA 2PZUA 3EIVA 2Z0SA 2LY7A 2ALYB 3PIPA 3D6CA 4LWCA 4EQNA 1CFMA 2XWBB 4A3GG 2K14A 2KCTA 4JOIA 4LFAQ 4KMUC 2ES2A 4A3FB 1IYJB 2LKVA 1LABA 3NBHA 2IX3A 3V96A 3E0JA 5DEHA 2K5HA 4B3ML 2Q8RE 3F2BA 3CRLC 2CFMA 4MIUA 5NUCA 2JEBI 4GOPA 1I3QH 5EBDA 2CW0C 1MD2D 1UNSA 4A3MH 3KDFB 1XNQL 1YJWA 2UU9L 3SEBA 1QVGA 2EYLA 1XNQQ 4AH6A 2J7ZA 3AB9A 1SR3A 4X62Q 1EYAA 1MJEA 1S3OA 3DUZA 1A6XA 1PH8A 1TS4A 1EZ6A 4B3SL 1CI3M 2L0CA 5IT9c 2VY3A 4A3LG 1TWCH 4DNTB 2RDGA 4B3SQ 4A3MG 1RF2D 1TWHH 3FP9A 1EWIA 4U673 4NXNL 1PFBA 2C5CA 3A8JE 1GUSA 1JC7A 3U9SA 4NXNQ 3SK4A 4UP8A 2UUBQ 2QCPX 1VQMA 1CSQA 4JI0Q 1O78A 1WCMH 3IKJA 1XXGA 3FPUB 2M00A 1K9MC 4OX9Q 3NPPA 1NE3A 1PZID 4DV2L 4KHVA 1U4PA 2VB3X 4QUFA 3HOUH 3HOXB 2K04A 1HTLD 2JJQA 1JWMD 4KN4C 3E6ZX 3HOWB 1YITA 3TBIB 1R9TB 1KQSA 1OXTA 3K5MA 4JBWA 2NYZD 1PH1A 1RTNA 5IGBA 3VR4A 3HOYB 2IHFA 4K5WA 4BWGB 1IL8A 2NVYB 5EGTA 1Q81C 1B7YB 1IYVA 1B3QA 2C35B 1E24A 1G2SA 3HOUG 5CBEE 1STHA 4FF3A 4K0KL 4HCSA 1MIUA 1WTRA 3J81L 1PFNA 3H09A 3D4DA 5C0XJ 1WD0A 4IFDI 1Z7TA 5IY0A 1QUQB 1KAAA 4EX5A 3PCOB 3FDTA 1SN8A 3NQTA 3P75A 1QILA 4DR3L 3WOFA 1K83B 4DR3Q 4DR4Q 2VB2X 4GN3B 1NY4A 3WDNA 1H9JA 2EJMA 3Q24A 4K6DA 3GV6A 3F8TA 4J8QA 3VA7A 1WTXA 1T5XD 3SK5A 2B2YC 1GUOA 3PO2B 1OXVA 2JA5G 2F03A 3MXNA 5C3XA 3NWSA 4GNXA 5EKIA 1U5KA 1NR2A 4GN4B 3T1YL 1TIID 1HA5A 3X3MA 1BBUA 1CKOA 4IURA 1SMYC 1K3BC 3T1YQ 1LO5D 4ZKCB 2HD3A 1DGSA 2BCOA 4YWKA 1ILPA 5EKKA 1XTDA 3R93A 5IP7H 1I4RA 4ODGA 4DUZL 2JA7B 3DHQA 2ZM6Q 1DXMA 1RJTA 2VQFL 3BDLA 3FVQA 4DR2L 2VQFQ 1SJED 4ME5A 1HQRD 3C3LA 4HJ8A 4DV6Q 1CKNA 3EJIA 5IP7G 1NNXA 1FYCA 2YV5A 2K1BA 2KCMA 2WAQB 4HSVA 5EPLA 3CC7A 4JI8L 2ZTDA 4F88A 3P7JA 4JI8Q 1BCPD 4I7ZC 1WTOA 2F0OA 3NHHA 3K7AH 1TQOA 3C1FA 2K03A 3AQQA 1X54A 1N9WA 2KOLA 4L5RC 3E5SA 1L1OB 3OTOL 2KECA 1SEBD 5FLXc 4X66L 3S16H 4DR1L 1QB5D 2R3ZA 2IL8A 3TN2A 4G4KA 5JEAH 4X3SA 1KNEA 4QL5A 3W2DA 3GTQB 3NTKA 2CVRA 4IOCA 1JT8A 2K5QA 4XTCS 4S3SA 4UDUC 1Y8PB 5AJ3L 1JJCB 1Q8IA 2HDMA 2HQEA 4A3FH 3I55A 3H91A 4DAYA 2Z6BA 4UHVA 2MO0A 2NB0A 2NN6H 1D1IA 2I0QA 4RMFA 2XRSD 1EY6A 2JE6I 2RDHA 4G7HC 4Z9CB 3RNUA 4RGOS 1QNUA 3MXNB 3J7AV 1UE7A 2F0IA 4A3FG 2OEOA 4A3DB 4R8NA 4L63B 2ZTCA 1PH7A 4A3CH 1RL2A 2ID0A 1P16A 1G291 4JI6L 3KFUA 1K73C 2QA4A 4RG1A 4DK3C 4JI6Q 4H02A 2VL6A 3RD4A 1GJXA 1EIFA 1Y1VG 1GKHA 2E5LL 2TMPA 1E2WA 2NVXB 4OXPA 4JI1L 4A75A 3HKZB 4FNFA 1AH9A 4IUPA 4JI1Q 1Q1EA 1VQPA 2R93H 2PQAB 4YHHL 1EL0A 5C3EH 1HR0W 3DEPA 4ZKBB 2J0TD 1HA6A 2ENBA 1BR9A 1EQTA 4NPSA 1BCPC 2KEEA 3PIP3 5FO7B 2EYFA 1X56A 1LTBD 4LF5L 4DV0L 1WVLA 1IYUA 1N36L 3KYHC 4LF5Q 2UXBL 4M1UB 2VQEQ 3HOXH 3ULPA 3D4RA 4FYDA 5FO8B 1STNA 3DM1A 2UXBQ 4AYBE 2RCNA 4TSSA 1MI2A 5JJIA 1VQCA 3QB3A 4XYOA 1I4GA 1GO3E 2TSSA 3S24A 2NVYH 5KRUA 3VYUA 1DM0B 2B2TC 1W2BA 5IE8A 1VQBA 5ELOA 4OO1H 3HKSA 3SE0A 3HOXG 2B2WC 2WKCA 4IZ8A 5J39A 5M5XB 3HOWG 4HIOA 5M9OA 1HXYD 4L8JA 3HOYG 4X3TA 3J80i 4P71A 5JVG3 1TY2A 4DAYB 2K28A 3SK8A 3TP5A 2L55A 1GVPA 1X3GA 4JOIC 1TS5A 2WIIB 4UAIA 2Z4IA 1K83H 4PG3A 4G57A 4C3HB 1K28A 4ALPA 3H0GB 1XJVA 1PA6A 3CHBD 1HNXL 2A6HD 4P75A 1K8OA 1L0YB 3CCQA 4GOPC 1L0WA 1HNXQ 5C4JB 3C2PA 3OOCA 3KF6B 3K80C 2D0OA 4RCNA 2FMMA 3PO2H 3K0YA 1CHQD 4LF9Q 1HTPA 3ND9A 1I4QA 2Q8TA 1E7ZA 2CKZB 3IL8A 3KLRA 1WD1A 3I90A 3CD6A 1D5XC 5HURA 2RA4A 2RBMA 4PMCA 5LMNW 1K3RA 4RHSA 2RKSA 3S2DB 3S9WA 2IW3A 3PO2G 2JA7H 2IX1A 2MHVA 2BOSA 5I4DA 2CQAA 1HCZA 3AU7A 5ELCA 3F2UA 1D6EC 1XPRA 2N8NA 2FHTA 3D6WA 4F87A 1Q3LA 2EY1A 1Z9FA 4DAMA 1Z47A 1I3QB 1PTOC 4OGQC 2RSNA 3MXUA 1KAWA 1SE4A 2JA7G 3DMUA 4FXDA 2JP1A 4HCEA 2VUMH 1J9OA 1X65A 3A74A 4Q5VA 2H5XA 2OXPA 1PHJA 3EA6A 3BZDB 4APVA 2PW5A 4KY7A 1TR5A 2SNMA 3CP0A 4OIKA 4OWWB 3CF5A 3K8AA 1KIXA 1PYBA 3AYHB 3MZ5A 4JI3L 1GHJA 2WAQG 1KLGD 2EZVA 2JA6H 1D5ZC 4OONA 4X6AH 3QR8A 1EQVA 2OQKA 4RWSC 3NE5B 1CQFA 3QOJA 4K14A 1AE3A 1C0AA 4RGNA 4C56C 1MGSA 3GTQH 2B8FA 2CQOA 1BQQT 3MXGA 1WOCA 2A6HC 2R6GA 1HFGA 1HRJA 3UDGA 1ENAA 1X32A 4PV1C 4IUVA 2PNHA 2IWHA 4HAEA 5C44B 2B2UA 1WJJA 1BO0A 4G7ZC 4GZYC 3H3VC 2OWOA 3CCUA 2E2HB 2EYMA 1KNAA 3LWEA 4ZQ3A 1PV4A 4IUNA 1D2BA 2GA4B 1NBWA 1OO9B 1U9RA 2ICEC 3M4OB 1YVCA 2HUGA 1W6KA 2FJ2A 2WAQE 1BKBA 5ISRA 2MQHA 4WJ4A 1G51A 4JBMA 1ET6A 4GNXC 4BY1B 3HG9A 2B2VA 3VR5A 2A5HA 4FF1A 1GUTA 1IL2A 1H9SA 2L5TA 4GN5A 4GLVB 3Q8DA 4BBSH 2AHOB 1JOQA 2XIWA 2A69D 3OW2A 2NVXH 1PRTD 4A3DG 1DOLA 4C3JB 3NBIA 5LL6S 2E76C 4P72A 1F2YA 1TWGH 1Q8KA 3OW7A 4YCWA 2Z9HA 1FR3A 2JYOA 4R4TA 4BBRB 4XT3B 1KHIA 3HKZG 1KD1C 4DR5Q 3KDFA 4A3EB 3R8BA 1B1ZA 4WRDA 2A6ED 1G6ZA 4CDDC 1ET9A 5D14A 1EYGA 2VXWA 2KA7A 1HJPA 2IPKD 1LT6D 3U9OA 3GV3A 3GD7A 1X55A 3MC0B 4DXFA 4AQYL 4X64Q 1C4QA 1JE5A 2EY6A 2DY7A 4DF7A 2FINB 3T53B 5LMUL 2UUCL 5AFWA 1V8QA 5M5XH 1OXUA 5FJ8G 1XMQL 2UUCQ 5I9PA 2K05A 3MTSA 3FMCA 3HEJA 1TWAB 4B3RL 2K75A 5JJKA 1X3QA 2M2LA 1YJNA 3HKZE 2HIVA 2KUMA 1K0SA 4C3HH 2N55A 2Q8IB 4KJNA 2Q2TA 5JVH3 3GDEA 3PUXA 1FL0A 1SYGA 1SJHD 1BOSA 5FOBB 5C4JH 4LUOA 2AUJD 3CKIB 4MHEA 5M5WB 1UEBA 1F9PA 1V9PA 1SBBB 2XNAC 2ICIA 2QDLA 4ZK9B 5CMDA 5M3MH 4LF6L 3SDZA 2OTLA 1IBLL 1O7IA 2A69C 4IUUA 1Y1WB 1U0LA 5BN4A 4LF6Q 3H0GG 1H9SB 1PRTC 4GKKL 2KQ3A 1S40A 1VQ4A 4TVAB 1A3TA 4GKKQ 2F0KA 1EWCA 4M8AA 2EY5A 3LNNA 1STEA 3T56B 5D3DA 3EN2A 1QUQA 4IPDA 4LFAL 3S2DH 1PH2A 4U68A 2H1EA 2WB1B 2IHEA 1PDQA 4N9PA 3I4MH 3HOZG 2KBNA 5ELBA 3W1BA 3A56A 4AYBB 4POGA 3KLSX 1LTID 1LV9A 2OCEA 2A1AA 3CCVA 1O7ZA 5H1SE 4X62L 1GHKA 4QIWB 4HR7B 4KD4A 4ZUJA 3VR3A 5TSSA 2JK8A 3PSIA 1VQ8A 2B3GA 2B8GA 3J80L 2UXCQ 4B9XA 1JB3A 2QW7A 1JE4A 2PZWA 1WFQA 5A2QL 3K5OA 4LFCQ 4BA2I 3TDQA 3M7GA 1HNWQ 1N34Q 2UUBL 4JI0L 5CV6A 2HQLA 2R93B 3B6YA 3VA5A 2GN5A 4MTNA 4HIMA 3K59A 2I5HA 4FP5D 3EVQA 4ILWA 5C3EB 4OX9L 1QVCA 3MFYA 1FNWA 3I91A 1X9NA 2EJFC 1CHPD 1WYDA 1KXLA 5G3LD 4DPGA 1C7YA 4DV4L 1LUZA 1XPOA 3CCEA 2BDNA 3BVGA 4FXGC 1VF5C 5C44H 4DV4Q 2L4NA 2MJ8A 1H9KA 1WCMG 3P20A 5CYUA 5C0XH 2EXDA 2L9HA 2NUCA 3BZKA 4RAUC 4YY3Q 3T51B 2E2HH 4FO2A 1K8GA 1JOKA 3RMHA 4DA2A 1BF4A 3GP7A 1X6OA 3CAMA 3M4OH 1STAA 1DD2A 1EIHA 2F0UA 2BH2A 3GTKH 2HDLA 5J3BA 2AKWB 2L12A 2NZOA 1L1OA 2F4VQ 4BY1H 2DNCA 2EQSA 3BS1A 2JEAI 5C0XG 3GTOB 1AW7A 1GUNA 3IFDA 4KV6A 4GLXA 3OSOA 4ZUIA 3K0XA 1J5EQ 2F0NA 1I5FA 1V1PB 4A76A 5EKLA 1S5FD 1BUVT 4DR4L 3HRZC 4KI0A 2KEDA 4C3JH 1F2ZA 1EY9A 2N78A 4BY1G 5KEEA 4DAVA 3OIQA 4F8MA 3HS0C 1SROA 2JA8B 2Y0SB 4JI7Q 1FD7D 3BDCA 4LMQD 2K5VA 4EGVA 5C3WA 3NTIA 3AEVA 4JYAL 1IHZA 4BBRH 4A4IA 2LSSA 1HFNA 3I8ZA 4WFN3 4JYAQ 1A3UA 4A3EH 2R7DA 2L1BA 1I6HB 4HEDA 2QDBA 2B39A 4C3JG 1NTGA 4J1MA 1B70B 2X6LA 1SYCA 1T5EA 4TQUS 2K6AA 3FRPB 3MFGA 3JAMc 1A63A 1PFSA 2ZM6L 3PGZA 4DV5L 1DOKA 4A3EG 1M4VA 2EJGC 4DV5Q 3PUWA 3ULJA 3KLSA 1NJIC 3SR1A 1SE3A 3QOLA 4ME3A 4K5XA 3A55A 2PQAA 1NSNS 1XPUA 4DV6L 3CXCA 5IYCH 4DFAA 2AQ2B 1I4XA 3KOJA 1KL9A 1TWAH 3BZCA 2OTJA 3CQZH 1JR0D 3AFQA 1PYWD 1VCIA 4K8IA 2JA9A 4YIJA 2VUMB 5D3IB 4Y7NH 3I4OA 1HPCA 1XNRQ 3RR5A 2JQOA 2A19A 3ULLA 3MVVA 1ICFB 2B2UC 2F0JA 2RCFA 1CM9A 1G91A 2M9VA 3VR6A 1H9RA 2O5IC 2EXZA 4MTKA 5DNFA 2P5ZX 1PH6A 5GAGC 1W3SA 4YWMA 5IIFA 1DJRD 4IN3A 4O42A 5M5WH 4QJFA 5M3FH 1PVOA 1UUPA 5A35A 2JA6B 1B44D 4DU9A 1Q86C 1Y1WH 1LYLA 1RODA 4DGZA 1VMCA 5CV5A 2A74C 2B2VC 3S1NB 1YEZA 3D31A 4KK7A 1P8LA 3OHXC 4R4CA 4PQXA 2E2IB 3MAQA 5CORA 3CCSA 5K36H 3A7LA 3MEFA 3DXJC 3R3OA 1MJCA 4H13C 5EJWA 3VYTA 2PI2E 3I72A 4EQ5A 3ZJYC 1VQ5A 1JMCA 1DOMA 2E8GA 1Y1WG 3HGBA 4KKSA 5J22A 1KABA 3J80E 5JEAG 2G5DA 2B63B 1EQRA 3FPPA 1SDFA 1IBKL
chains in the Genus database with same CATH topology
4P2CB 2QILA 1MSGA 1LT5D 4XXEA 1ENCA 5A2QE 1C48A 1BCPF 5C4ZA 2L11A 4PMWA 1A2UA 1QOHA 2NN6G 4A3IB 4Q0FA 3IFTA 1OXSC 1HUNA 2JSOA 4BBSB 1UEAB 1O7YA 4ULLA 4H0LC 1D5MC 5IGCA 1Y8OB 2WKDA 5IT9L 1DCZA 1ZEQX 1ICWA 2F0VA 1EY8A 1TWGB 4B08A 4BS9A 4CBVA 3Q23A 2NBFA 3RLFA 3MA2B 5I2XA 4I65A 2O2LD 1O7LA 1SAPA 2K33A 2WV6D 4XYQA 4IFDJ 4RGMA 3DWQA 3TP8A 1EY5A 1VDZA 3S2HB 4OIJA 1EY7A 1EZ8A 1GUGA 2F0PA 5CR3A 3PUZA 4B9WA 1PLFA 3K5NA 3M4YA 2F0WA 3PIO3 2VNUD 5E4WC 3OMCA 4HTHA 1CTMA 4WJWA 4OO1G 4BA1I 1B9MA 1S4ZA 1OXXK 2KJXA 4K2LA 2O4XA 5EBCA 1QG7A 1PTOF 2Z4HA 4KD3A 5M3MB 2QEJC 1LLRD 1II3A 4NMZA 1SYDA 5I2YA 3M3YB 5C4HA 5FK9C 4A3JB 3GQBA 1B3AA 1WTWA 4KKUA 2IT1A 3MXPA 2R7ZB 1B50A 3I4MB 1UAPA 1FGBD 3TP6A 3GTLB 5ELFA 1ZYRD 3MEHA 2YYZA 3MWYW 1VMPA 4QF4A 1R4PB 1EWHA 1AZPA 1G8ZD 1CZGA 1Z6HA 3A7AB 5JAVA 2NWGA 2F0LA 3N52A 4DAPA 1E2VA 3QG1A 1PTOH 1TWFB 2V4DA 5I6YA 1BBXC 1RHPA 1DONA 1HQMC 4E6IA 4HMIA 3O13A 2R92B 1JCKB 1I50B 2EYPA 5CV8A 5FLXL 1CT1D 5COYA 1SYFA 3V2TA 2BA1A 2SEBD 4DK1A 4OHJA 4KY6A 2E75C 3GTKB 1S5BD 2BE5D 1XWEA 5IT9E 3TZDA 3URYA 1ZKOA 5BN5A 2J4XA 1GUWA 3HZXA 4R8IA 1EOTA 1ZYRC 1RCVD 2MUYA 4HSPA 2F0QA 3HP3A 1KDAA 1SYEA 3HOVB 1JICA 2BDOA 4EVOA 4K5VA 1SFOB 1CZWA 4NW2A 5IGFA 1U4LA 4XQJA 3A8IE 2JXMB 3M85A 5EPKA 4RGTA 2EE1A 1EIGA 2SDFA 2NZ1D 1QNKA 1BDOA 1QCBD 1LTSD 1CK1A 3UI2A 1PFMA 5LHY1 1PMRA 2AUKA 2R61A 1LT4D 1BNZA 4X3KA 5IGEA 4HN7A 3V05A 1CA6A 3NSWA 1MBYA 4TRDA 1PRTF 1TKWB 2F0SA 3NUCA 2EYOA 4O1NA 3ND8A 3CQZB 2XN9C 2F3VA 1J8IA 4Y7NB 2C9OA 1KDCA 3SXHA 1TVXA 1VF7A 1SSOA 5KIXA 1AEXA 1NR4A 1JWSD 5M3FB 1F9SA 4LK1C 2X6GA 4C3HG 3H6MA 3JAME 1LTGD 1O80A 4XIGS 1DYQA 3GTPB 1A2TA 2SNSA 3ONAB 5T1GA 3R2IA 4QB4A 4DK0A 1G2TA 1V1PA 1SNCA 3H94A 5CV9A 2A6EC 1S5CD 3S1QB 2AQ1B 1WTPA 1DZ1A 3ERQA 2WACA 1NUCA 2K01A 2E2JB 1I4PA 2F0TA 4CKCA 3TP7A 1QWYA 3PO3B 3TMEA 3BYYB 5C5MA 2WINB 4IQZA 4KKTA 3IAYA 2KVMA 2EOTA 3OPOA 3KK7A 3I4NB 1D1KA 5FLXE 1Y1VB 3KBXA 5I6WA 3OWFA 4KY5A 1U4MA 2KCCA 2A73B 3AMUA 1XX8A 1SNDA 4L6TB 3CRKC 4FXKC 4ID6A 2F0FA 3DWPA 3A54A 1QE6A 2RVLA 2A68D 1Q1BA 5T1IA 4NKLA 1SMYD 1ESRA 4CKEA 4DN4M 2NN6I 4F7XA 4ZYSA 5E4XA 2G9HD 2NVTB 1EU3A 1BCPB 1SXTA 2QKIC 5DM73 2BA0A 3R2TA 1GXDC 2F0DA 2F4IA 4K8JA 5CV7A 2PCFB 1F9QA 3NK9A 3Q22A 1FNVA 4KJOA 1WTVA 1A15A 1EYCA 2EYHA 4RKBA 5CGKA 3EFXD 3I70A 5F2DA 5G3LF 1IKMA 1I4HA 4CJ1B 3TSSA 4C1NI 4V0BA 2I46A 4FF2A 5E1FA 4N9TA 5C4XB 2K32A 1JORA 2ZXOA 1A3VA 3T16A 3SVMA 4IUQA 3KF8A 4RA8A 3QO2A 4XDXA 3EROA 4OO1I 1LTAD 2EPBA 2A68C 1JOOA 2XRQD 1ML0D 1Y8NB 3KBGA 3N6RA 3J7AF 4EQOA 2XSCA 5DAUA 3GO5A 3FKIB 3PUYA 1CA5A 1EYDA 4RFBA 1STGA 4IALA 4HMJA 3T4AC 2DN8A 1Q90A 3NTHA 1H9MA 1L0XB 4ABNA 1PTOB 3D3RA 3SHLA 4LAAA 3QWNA 1TT2A 2EDGA 4JK1C 2K5WA 1EFID 1S5ED 4C3IB 1EU4A 3P1HA 2KCNA 4A3KB 3VYRA 1IW7D 3GTMB 1XTCD 3CU7A 2NVQB 1Y69U 4QUCA 3GTGB 1STYA 3J7YW 2MPMA 3D8GA 2PNRC 4WORA 1E2ZA 5ELDA 2PMZB 1WTQA 2RQXA 5K36G 4C2MB 5JPMC 4A3BB 1F2LA 3OWEB 4OL7A 2DNEA 2E74C 5JEAJ 2K5DA 1PZJD 4ZRZA 4MN3A 1RD9D 1EEID 1KLUD 2F0HA 4IUTA 5FKAC 4A93B 3GTJB 3BVZA 3RZOB 1M8AA 4IFDH 1I6VC 2F0EA 4BY7B 2K7VA 2MP1A 2OT2A 5E3FA 3S15B 3NQIA 3ITPA 5ELEA 3RZDB 3I4LA 1B53A 1AN8A 1KTKA 3L3OC 3DWAA 1B4OA 2XWJB 2YU9B 3QJYA 4KHZA 3X3NA 2O5JC 4IFDG 3K5LA 4G7OC 1TS3A 5CC4A 1YNND 2RSOA 1NAPA 1V1OA 3BYTB 3S1RB 1Q12A 2IJ0A 1IW7C 2ZXPA 3FEWX 2WP8J 2X69A 4XQNA 1LTRD 5I9OA 1PTOD 1E0BA 1JWUD 3RUZA 3J81E 2Z8LA 1RDPD 5KNBA 3G7LA 1PZKD 2CHBD 5KNDA 1S5DD 2OF1A 5IGDA 4XT1B 4RHRA 1AZQA 3L7ZC 3PMFA 2PYKA 5M5YB 1AFPA 1GOZA 4RCOA 4R9WA 5C5LA 3S14B 5IODA 3OIPA 4TKOB 1X3PA 2HCIA 3MHBA 1STBA 5KGUA 1QJOA 2F0MA 4FVMA 4H44C 4A3GB 5CV4A 3BVMA 1PRTB 2FMCA 2E2DC 3SK6A 2SOBA 3HOZB 2ZXRA 3JAML 5KYLA 1SNMA 2H4OA 2PW7A 4K6LA 2FFKB 1SNOA 2PZTA 3L9AX 3QIAA 1SE2A 1SYBA 1TS2A 3W3AA 1YNNC 2PQEA 3EQLC 4FF4A 2F1MA 1HHVA 4KN7C 4CJ2C 1F77A 5LL6X 1NCVA 2EY2A 2Z1CA 4LJZC 1AP0A 1RTOA 3PUVA 2XVSA 4A3MB 1KDBA 1F9RA 2B2YA 2D9UA 2HCCA 3C46A 5JPNC 3G6JB 3KUPA 3S17B 1F2MA 5KNCA 4DNRB 1TWCB 1LTTD 1TWHB 2PPBC 2F0GA 4C3IG 3BDOA 5JOBA 3D4WA 1WCMB 5JJZA 4EQPA 4CHTB 1FNUA 1SNPA 5CBAE 5EQ0A 3K6OA 2DY8A 2AWOA 3I3CA 5KYIA 2EVBA 4V190 1IKLA 4RKLA 5IGGA 3HOUB 3WOEA 1TU2B 2LMCB 4PNYA 5EPJA 1B9NA 4CGYB 5J1ZA 4ZLTF 4CKBA 1ILQA 3T13A 3TZUA 4CJ0B 1ZXTA 4KTAA 1EEFD 4X3UA 2KHSA 2N88A 3Q6SA 3NP8A 1C8CA 3NWTA 3DEOA 1HUMA 1ENFA 1YNJD 2AQ3B 4K2KA 1EY4A 2I07B 2JA5B 5DM63 3ZYYX 2G9DA 5HGTA 1LT3D 4NP5A 5C0XI 1ONLA 3K58A 4NDXA 1ESFA 3LWUA 5D65A 1U4RA 1K8MA 3C1EA 2AWNA 2CW0D 1V43A 2D2CC 3I73A 2PO4A 3S1MB 2NTTA 3Q0AA 4H7BA 2EYJA 3VR2A 5FO9B 2RDFA 2D62A 3A8KE 3PV0A 5IOCA 1R4QB 1XYIA 3OMGA 2BE5C 2ZT9C 1EY0A 1W6JA 1JQYD 1PXUA 5K5PA 2D5DA 4ZAIA 4QMGA 3K57A 1TY0A 4C1NK 1BXTA 2MGSA 3LX0A 2F3WA 3BG3A 3NXWA 4QCLA 2IX0A 4RH6A 2NTSA 2LFNA 3K7AB 2LS01 4DXGA 1RKNA 3M7NA 1CQVA 2B2TA 2QF7A 1SNQA 5C6AA 1YNJC 5BN3A 4PMBA 1B2TA 3VYSA 2B2WA 3S16B 1LACA 4J6HA 1MSHA 4XQQA 2PZUA 2LY7A 3D6CA 4EQNA 1CFMA 2XWBB 4KMUC 4A3FB 2LKVA 1LABA 3NBHA 2IX3A 3V96A 3E0JA 5DEHA 2Q8RE 3CRLC 4MIUA 5NUCA 2JEBI 5EBDA 2CW0C 1MD2D 1UNSA 3SEBA 2EYLA 2J7ZA 3AB9A 1EYAA 3DUZA 1A6XA 1TS4A 1EZ6A 1CI3M 2L0CA 4DNTB 2RDGA 1RF2D 4U673 1PFBA 2C5CA 3A8JE 1GUSA 1JC7A 3U9SA 3SK4A 2QCPX 1O78A 3IKJA 1XXGA 3FPUB 2M00A 3NPPA 1PZID 4KHVA 1U4PA 2VB3X 4QUFA 3HOXB 2K04A 1HTLD 1JWMD 4KN4C 3E6ZX 3HOWB 3TBIB 1R9TB 1OXTA 3K5MA 4JBWA 2NYZD 1RTNA 5IGBA 3VR4A 3HOYB 4K5WA 4BWGB 1IL8A 2NVYB 5EGTA 1IYVA 1G2SA 5CBEE 1STHA 4FF3A 4HCSA 1WTRA 3J81L 1PFNA 3H09A 3D4DA 5C0XJ 1WD0A 4IFDI 1Z7TA 1KAAA 3FDTA 3NQTA 3P75A 1QILA 3WOFA 1K83B 2VB2X 3WDNA 1H9JA 2EJMA 3Q24A 4K6DA 3GV6A 4J8QA 3VA7A 1WTXA 1T5XD 3SK5A 2B2YC 1GUOA 3PO2B 1OXVA 2F03A 3MXNA 5C3XA 3NWSA 5EKIA 1NR2A 1TIID 1HA5A 3X3MA 4IURA 1SMYC 1LO5D 4ZKCB 2BCOA 1ILPA 5EKKA 3R93A 1I4RA 4ODGA 2JA7B 3DHQA 1DXMA 1RJTA 3BDLA 3FVQA 1SJED 4ME5A 1HQRD 3C3LA 3EJIA 1FYCA 2K1BA 4HSVA 2WAQB 5EPLA 4F88A 3P7JA 1BCPD 4I7ZC 1WTOA 2F0OA 3NHHA 1TQOA 3C1FA 2K03A 2KOLA 3E5SA 2KECA 1SEBD 1QB5D 2R3ZA 2IL8A 3TN2A 4G4KA 5JEAH 4X3SA 1KNEA 3W2DA 3GTQB 3NTKA 2CVRA 2K5QA 4XTCS 4S3SA 4UDUC 1Y8PB 1Q8IA 2HDMA 2HQEA 4DAYA 3H91A 2NB0A 2NN6H 1D1IA 2XRSD 1EY6A 2JE6I 2RDHA 4G7HC 4Z9CB 4RGOS 1QNUA 3J7AV 2F0IA 2OEOA 4A3DB 4R8NA 4L63B 2ID0A 1G291 3RD4A 1GJXA 2TMPA 1E2WA 2NVXB 3HKZB 4FNFA 4IUPA 1Q1EA 1EL0A 3DEPA 4ZKBB 2J0TD 1HA6A 2ENBA 1BR9A 1EQTA 1BCPC 2KEEA 3PIP3 5FO7B 2EYFA 1LTBD 1WVLA 1IYUA 4M1UB 3D4RA 4FYDA 5FO8B 1STNA 3DM1A 4TSSA 1MI2A 3QB3A 4XYOA 1I4GA 2TSSA 5KRUA 3VYUA 1DM0B 2B2TC 4OO1H 3SE0A 2B2WC 2WKCA 4IZ8A 5J39A 5M5XB 5M9OA 1HXYD 4L8JA 4X3TA 5JVG3 1TY2A 2K28A 3SK8A 3TP5A 2L55A 1TS5A 2WIIB 4UAIA 2Z4IA 4G57A 4C3HB 3H0GB 3CHBD 2A6HD 1K8OA 1L0YB 5C4JB 3C2PA 3OOCA 4RCNA 2FMMA 3K0YA 1CHQD 1HTPA 3ND9A 1I4QA 2Q8TA 3IL8A 3KLRA 1WD1A 3I90A 1D5XC 5HURA 2RA4A 2RBMA 4PMCA 4RHSA 2RKSA 3S2DB 3S9WA 2IW3A 2IX1A 2MHVA 2BOSA 5I4DA 2CQAA 1HCZA 3AU7A 5ELCA 3F2UA 1D6EC 2FHTA 3D6WA 4F87A 1Q3LA 2EY1A 1Z47A 1I3QB 1PTOC 4OGQC 2RSNA 3MXUA 1SE4A 3DMUA 4FXDA 2JP1A 4HCEA 1J9OA 4Q5VA 2OXPA 3EA6A 3BZDB 2PW5A 4KY7A 1TR5A 2SNMA 4OIKA 3MZ5A 1GHJA 1KLGD 2EZVA 1D5ZC 1EQVA 4RWSC 3NE5B 1CQFA 3QOJA 4K14A 4RGNA 4C56C 1MGSA 2B8FA 1BQQT 3MXGA 2A6HC 2R6GA 1HFGA 1HRJA 1ENAA 1X32A 4PV1C 4IUVA 2IWHA 5C44B 4HAEA 2B2UA 1BO0A 4G7ZC 4GZYC 3H3VC 2E2HB 2EYMA 1KNAA 3LWEA 4ZQ3A 1D2BA 4IUNA 2GA4B 1OO9B 1U9RA 2ICEC 3M4OB 2HUGA 1W6KA 2FJ2A 5ISRA 1ET6A 4BY1B 3HG9A 2B2VA 3VR5A 2A5HA 4FF1A 1GUTA 1H9SA 2L5TA 1JOQA 2XIWA 2A69D 1PRTD 1DOLA 4C3JB 3NBIA 5LL6S 2E76C 1F2YA 3OW7A 1FR3A 2JYOA 4BBRB 4XT3B 4A3EB 3R8BA 1B1ZA 4WRDA 2A6ED 1G6ZA 1ET9A 5D14A 2VXWA 2KA7A 2IPKD 1LT6D 3U9OA 3GV3A 3GD7A 3MC0B 4DXFA 1C4QA 2EY6A 2DY7A 4DF7A 2FINB 3T53B 5AFWA 1V8QA 1OXUA 5I9PA 2K05A 3MTSA 3FMCA 3HEJA 1TWAB 1X3QA 2M2LA 2KUMA 2N55A 2Q8IB 4KJNA 5JVH3 3PUXA 1SYGA 1SJHD 1BOSA 5FOBB 2AUJD 3CKIB 4MHEA 5M5WB 1F9PA 1SBBB 2XNAC 2ICIA 4ZK9B 5CMDA 3SDZA 2A69C 4IUUA 1Y1WB 5BN4A 1H9SB 1PRTC 2KQ3A 1A3TA 2F0KA 1EWCA 4M8AA 2EY5A 3LNNA 1STEA 3T56B 5D3DA 4U68A 2H1EA 2WB1B 1PDQA 4N9PA 5ELBA 3A56A 4AYBB 3KLSX 1LTID 1LV9A 1O7ZA 1GHKA 4QIWB 4HR7B 4KD4A 4ZUJA 3VR3A 5TSSA 2B8GA 3J80L 4B9XA 1JB3A 1JE4A 2PZWA 5A2QL 3K5OA 4BA2I 3TDQA 3M7GA 5CV6A 2R93B 3VA5A 3K59A 4ILWA 3EVQA 4FP5D 5C3EB 3MFYA 1FNWA 3I91A 2EJFC 1CHPD 5G3LD 2BDNA 3BVGA 4FXGC 1VF5C 2L4NA 2MJ8A 1H9KA 3P20A 5CYUA 5C0XH 2L9HA 2NUCA 4RAUC 3T51B 4FO2A 1JOKA 3RMHA 4DA2A 1BF4A 3GP7A 1STAA 1DD2A 1EIHA 2F0UA 2HDLA 2L12A 2DNCA 3BS1A 2JEAI 5C0XG 3GTOB 1AW7A 1GUNA 3IFDA 4KV6A 3OSOA 4ZUIA 2F0NA 1V1PB 5EKLA 1S5FD 1BUVT 3HRZC 4KI0A 2KEDA 1F2ZA 1EY9A 5KEEA 4DAVA 3OIQA 4F8MA 3HS0C 2JA8B 2Y0SB 1FD7D 3BDCA 4LMQD 4EGVA 5C3WA 3NTIA 1IHZA 1HFNA 3I8ZA 4WFN3 1A3UA 2L1BA 1I6HB 4HEDA 2QDBA 2B39A 4C3JG 4J1MA 2X6LA 1SYCA 1T5EA 4TQUS 2K6AA 3FRPB 3MFGA 1DOKA 1M4VA 2EJGC 3PUWA 3KLSA 3SR1A 1SE3A 3QOLA 4K5XA 3A55A 1NSNS 4DFAA 2AQ2B 1I4XA 1JR0D 1PYWD 1VCIA 4K8IA 4YIJA 2VUMB 5D3IB 1HPCA 3MVVA 2B2UC 2F0JA 1CM9A 1G91A 2M9VA 3VR6A 1H9RA 2O5IC 2EXZA 5DNFA 5IIFA 1DJRD 4IN3A 4O42A 1UUPA 5A35A 2JA6B 1B44D 4DU9A 1RODA 4DGZA 1VMCA 5CV5A 2A74C 2B2VC 3S1NB 3D31A 4KK7A 3OHXC 4PQXA 2E2IB 3MAQA 5CORA 5K36H 3A7LA 3DXJC 3R3OA 4H13C 5EJWA 3VYTA 3I72A 1DOMA 3HGBA 4KKSA 5J22A 1KABA 3J80E 5JEAG 2B63B 3FPPA 1SDFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QG7 A;  1DOL A;  1E0B A;  1MSG A;  1ILP A;  1F9S A;  3R93 A;  2X6G A;  1PFB A;  4IUP A;  4LMQ D;  1LV9 A;  3F2U A;  1RJT A;  3G7L A;  1O80 A;  1HFN A;  2FHT A;  3D6W A;  3TZD A;  1Q3L A;  2L11 A;  1EL0 A;  2JYO A;  3I8Z A;  1F9Q A;  1O7Z A;  2L1B A;  4HED A;  1GUW A;  3DEP A;  2RSN A;  4ZKB B;  4XT3 B;  1HA6 A;  4QUC A;  1WTV A;  5DNF A;  1EQT A;  2X6L A;  1A15 A;  4R8I A;  1EOT A;  1XYI A;  2KEE A;  1B3A A;  3ONA B;  4XT1 B;  5T1G A;  1G6Z A;  2JP1 A;  1WTW A;  1AZQ A;  1HUN A;  5JJZ A;  1WVL A;  1J9O A;  3FPU B;  2MPM A;  1G2T A;  1O7Y A;  3HP3 A;  5CBA E;  5D14 A;  2K1B A;  4HSV A;  5EQ0 A;  2VXW A;  4ZAI A;  1B50 A;  1JIC A;  2DY8 A;  5EPL A;  1U4P A;  1JE4 A;  3I3C A;  3SVM A;  1WTQ A;  3DM1 A;  1IKM A;  4QUF A;  1DOK A;  4OIK A;  2K04 A;  3P7J A;  1IKL A;  4R9W A;  2MGS A;  3GV3 A;  1WTO A;  4CJ1 B;  1MI2 A;  4NW2 A;  1ICW A;  1U4L A;  3MWY W;  1WTP A;  2NYZ D;  2K03 A;  2DY7 A;  1DZ1 A;  1RTN A;  1VMP A;  5EPJ A;  2FIN B;  1AZP A;  2B2T C;  2KOL A;  4ZLT F;  1F2L A;  1IL8 A;  1X3P A;  5AFW A;  5EPK A;  2EE1 A;  4RWS C;  2HCI A;  1ILQ A;  1EIG A;  2KEC A;  2NZ1 D;  2SDF A;  2K01 A;  2NWG A;  2B2W C;  3I91 A;  2K05 A;  3MTS A;  2B2T A;  1QNK A;  1G2S A;  2R3Z A;  1MGS A;  4MN3 A;  2IL8 A;  3N52 A;  3TN2 A;  1ZXT A;  5CBE E;  4CJ0 B;  1B2T A;  3UI2 A;  4IUT A;  1X3Q A;  4HCS A;  2B2W A;  4X3S A;  2KVM A;  4X3U A;  1KNE A;  1PFM A;  2M2L A;  2EOT A;  2N88 A;  4IUQ A;  4X3T A;  4RA8 A;  1MSH A;  3Q6S A;  1PFN A;  1WTR A;  1WD0 A;  2BDN A;  2CVR A;  1SAP A;  3QO2 A;  1HFG A;  1HRJ A;  2B2U C;  2KUM A;  1CM9 A;  1M8A A;  2K28 A;  2L4N A;  2MJ8 A;  3KBX A;  4XDX A;  1C8C A;  1G91 A;  1X32 A;  2EPB A;  4IUV A;  1BBX C;  2N55 A;  1U4M A;  1BNZ A;  4HAE A;  2L9H A;  1RHP A;  3DEO A;  3FDT A;  4X3K A;  1HUM A;  1ML0 D;  1XX8 A;  2B2U A;  2HDM A;  4RAU C;  4UAI A;  2FFK B;  3H91 A;  1CA6 A;  4O42 A;  2MP1 A;  1BO0 A;  3KUP A;  4OIJ A;  1BF4 A;  1KNA A;  4MHE A;  3LWE A;  1CA5 A;  1EIH A;  1PLF A;  1B53 A;  1F9P A;  2HDL A;  1HHV A;  2L12 A;  1ROD A;  1QE6 A;  2RVL A;  1VMC A;  2Q8R E;  3GV6 A;  4CJ2 C;  4ZK9 B;  5CMD A;  2B2V C;  1NCV A;  2HUG A;  1B4O A;  2FJ2 A;  2FMM A;  5T1I A;  4IUU A;  1WTX A;  3IFD A;  2Q8T A;  1AP0 A;  5E4W C;  1J8I A;  1RTO A;  2B2Y C;  2B2V A;  5COR A;  1ESR A;  3IL8 A;  1DON A;  4DN4 M;  1WD1 A;  2RSO A;  3I90 A;  5COY A;  2J7Z A;  5EJW A;  1NAP A;  1TVX A;  5D65 A;  5E4X A;  5EKI A;  2RA4 A;  1F9R A;  1U4R A;  2B2Y A;  1NR2 A;  2D9U A;  4U68 A;  1DOM A;  2HCC A;  1SSO A;  2XIW A;  2H1E A;  2KED A;  4IUR A;  1S4Z A;  1PDQ A;  2X69 A;  4ZKC B;  1SDF A;  1NR4 A; 
#chains in the Genus database with same CATH topology
 1D8L A;  2VZA A;  2QIL A;  1MSG A;  1LT5 D;  4P2C B;  4LNQ A;  3S1Q H;  4XXE A;  1IBK Q;  1ENC A;  5A2Q E;  4LF4 Q;  1C48 A;  1BCP F;  5C4Z A;  2WB1 G;  3KF6 A;  2L11 A;  4PMW A;  4JPB W;  1A2U A;  4NB3 A;  1QOH A;  2NN6 G;  4AYB G;  4A3I B;  4Q0F A;  3IFT A;  1PH4 A;  1OXS C;  1Y14 B;  1HUN A;  2JSO A;  1UE1 A;  4BBS B;  4CDF C;  1UEA B;  1O7Y A;  3I4N H;  4ULL A;  4H0L C;  5FLM H;  1D5M C;  1VQN A;  3FHW A;  1IZ6 A;  1QVF A;  4A3C G;  3U4Z A;  5IGC A;  1Y8O B;  2WKD A;  5IT9 L;  1DCZ A;  1ZEQ X;  3ERS X;  4JBJ A;  1ICW A;  2F0V A;  1EY8 A;  1TWG B;  4DV7 L;  4B08 A;  4BS9 A;  4CBV A;  3G71 A;  3Q23 A;  3CMA A;  5GAE C;  4DV7 Q;  2F3I A;  2NBF A;  3RLF A;  1YI2 A;  5FLM G;  4LF7 L;  1K8A C;  1HZC A;  3MA2 B;  5I2X A;  2VQE L;  4LF7 Q;  2WB1 E;  2MO1 A;  2R93 G;  4I65 A;  3PF5 A;  4YCV A;  3J7Z C;  2O2L D;  3H3V I;  1O7L A;  1SAP A;  2K33 A;  2WV6 D;  4L5Q A;  5C3E G;  4XYQ A;  4IFD J;  1A0I A;  2WFW A;  2NVT H;  1PH3 A;  4DUY Q;  4RGM A;  4MNO A;  3DWQ A;  3F2C A;  3TP8 A;  4DR7 L;  2Q2H A;  1EY5 A;  1VDZ A;  3S2H B;  4OIJ A;  1EOV A;  1EY7 A;  1EZ8 A;  1GUG A;  2F0P A;  4QIW E;  4DR7 Q;  5CR3 A;  3PUZ A;  4B9W A;  1FGU A;  4UY8 C;  1C9O A;  1PLF A;  1BBW A;  1JB7 A;  3K5N A;  3GTO H;  2JN4 A;  3M4Y A;  2KEN A;  2F0W A;  3PIO 3;  2VNU D;  5E4W C;  4OWX B;  2V1C C;  1E1O A;  3OMC A;  4HTH A;  1CTM A;  4JBK A;  4WJW A;  4OO1 G;  2LXK A;  4BA1 I;  4MZ9 A;  1B9M A;  2GVA A;  1S4Z A;  1OXX K;  2KJX A;  1PH9 A;  4K2L A;  2JA8 H;  2O4X A;  5EBC A;  1QG7 A;  2K4K A;  1PTO F;  2Z4H A;  4KD3 A;  2DJG C;  4LF9 L;  1VQ7 A;  1I6H H;  5M3M B;  2QEJ C;  1LLR D;  1II3 A;  4NMZ A;  1SYD A;  1YHB A;  5I2Y A;  3M3Y B;  1A8V A;  5C4H A;  3ER0 A;  5FK9 C;  3U58 A;  4A3J B;  3GQB A;  1B3A A;  2EIF A;  4KKU A;  1WTW A;  2IT1 A;  3MXP A;  3UDX A;  4KHP Q;  2R7Z B;  1B50 A;  3I4M B;  1UAP A;  1FGB D;  3TP6 A;  4R1J A;  3GTL B;  5ELF A;  1ZYR D;  1EUJ A;  3MEH A;  2YYZ A;  3MWY W;  1KRS A;  2I5M X;  1VMP A;  4QF4 A;  1R4P B;  1EWH A;  1AZP A;  3FKI H;  1G8Z D;  1CZG A;  1Z6H A;  3A7A B;  3U4V A;  5JAV A;  3TRZ A;  2NWG A;  2F0L A;  1Q46 A;  4O2D A;  3N52 A;  4DAP A;  4OEM B;  1E2V A;  3QG1 A;  3CCL A;  1PTO H;  1TWF B;  2V4D A;  2Y0S E;  5I6Y A;  1HR0 Q;  4LF8 Q;  4HJ5 A;  1BBX C;  1HZB A;  1RHP A;  2XTI A;  1DON A;  2VUM G;  2ASB A;  1HQM C;  3IRB A;  1L1O C;  2PI2 A;  4E6I A;  4HMI A;  3O13 A;  3S1N H;  4A3K H;  2R92 B;  1JCK B;  3GTM H;  1I50 B;  1G6P A;  2E2I H;  3KJP A;  2EYP A;  1JJG A;  5CV8 A;  2NVQ H;  1KRT A;  5FLX L;  3CCJ A;  1CT1 D;  2JA6 G;  3CCM A;  2ATW A;  1PH5 A;  3GTG H;  5COY A;  3F2D A;  1SYF A;  3V2T A;  2B63 H;  2BA1 A;  2SEB D;  3CME A;  4DK1 A;  4OHJ A;  4KY6 A;  1M90 C;  1CUK A;  2E75 C;  1I94 L;  2LXJ A;  3GTK B;  1S5B D;  2BE5 D;  4L5S A;  1XWE A;  5IT9 E;  2FXQ A;  1I94 Q;  3TZD A;  2B63 G;  3URY A;  1ZKO A;  5BN5 A;  4A3I H;  2J4X A;  1GUW A;  3HZX A;  4HJ7 A;  4R8I A;  3J81 c;  3J81 j;  1EOT A;  2A8V A;  1ZYR C;  1MKH A;  5BR8 L;  1RCV D;  2MUY A;  4HSP A;  2F0Q A;  3HP3 A;  1KDA A;  5BR8 Q;  1SYE A;  3HOV B;  1JIC A;  4HJA A;  5IWA Q;  2BDO A;  2HT1 A;  4EVO A;  2D0P A;  4K5V A;  1SFO B;  1CZW A;  4NW2 A;  3CW2 C;  5IGF A;  1U4L A;  4XQJ A;  3S15 H;  4BBS G;  5LMN Q;  4DR5 L;  1FJG L;  3A8I E;  2JXM B;  4DNI A;  4JV5 L;  3M85 A;  5EPK A;  2B29 A;  4RGT A;  2EE1 A;  1FJG Q;  1EIG A;  2SDF A;  2NZ1 D;  1VQL A;  4GS3 A;  4JV5 Q;  1UWV A;  1QNK A;  2YU9 H;  1BDO A;  1QCB D;  1LTS D;  1CK1 A;  2RHS B;  3UI2 A;  1PFM A;  5LHY 1;  1PMR A;  2AUK A;  2NZH A;  2R61 A;  4JI5 Q;  4FDB A;  4X64 L;  3CPF A;  2KHJ A;  3S2H H;  1HZA A;  1LT4 D;  1BNZ A;  2HHH Q;  4X3K A;  3KJO A;  5IGE A;  4HN7 A;  3V05 A;  1CA6 A;  1PYS B;  3NSW A;  1MBY A;  4TRD A;  1PRT F;  2AMC B;  1TKW B;  4JG2 A;  2F0S A;  3NUC A;  2EYO A;  4O1N A;  3ND8 A;  3CQZ B;  3PF4 A;  2XN9 C;  4UPA A;  2F52 A;  5IYD H;  2F3V A;  1J8I A;  4Y7N B;  2C9O A;  2DGY A;  3TEH B;  1KDC A;  3SXH A;  1TVX A;  3E9I A;  4JI4 Q;  1VF7 A;  1SSO A;  1QZG A;  1OTC A;  4LUV A;  5KIX A;  1AEX A;  1NR4 A;  1S72 A;  1GD7 A;  1JWS D;  4BXX H;  5M3F B;  1F9S A;  4LK1 C;  2X6G A;  4C3H G;  3H6M A;  1AE2 A;  3JAM E;  1LTG D;  1O80 A;  4XIG S;  3M3Y H;  4LFB Q;  2GVB A;  3TS0 A;  4A3J H;  1DYQ A;  4UP9 A;  2HIX A;  4L5T A;  4Y52 H;  3GTP B;  3DM3 A;  1A2T A;  2SNS A;  3ONA B;  1IBM Q;  5T1G A;  3R2I A;  2R7Z H;  4QB4 A;  4KLK A;  5M3M G;  4DK0 A;  3TRE A;  4A3G H;  1G2T A;  3RN5 A;  1V1P A;  3T1H L;  3OYY A;  3SGI A;  3GTL H;  1VQK A;  3G48 A;  3T1H Q;  1E1T A;  1SNC A;  3H94 A;  5CV9 A;  4GKJ Q;  2A6E C;  4PZ8 A;  1S5C D;  3S1Q B;  2AQ1 B;  1IXR A;  1RIP A;  1WTP A;  1DZ1 A;  2R7Z G;  1QZH A;  3ERQ A;  2WAC A;  3I4M G;  1NUC A;  2XGT A;  2K01 A;  2UXC L;  3UDF A;  3G6E A;  2E2J B;  1I4P A;  1VQF A;  4QY7 A;  2F0T A;  4CKC A;  3TP7 A;  1QWY A;  5GAH C;  3PO3 B;  2QGQ A;  3TME A;  3BYY B;  5C5M A;  2WIN B;  1TWF H;  4IQZ A;  4KKT A;  3PIO A;  3IAY A;  4A3L H;  2UUA L;  2KVM A;  2EOT A;  3OPO A;  4LFC L;  3KK7 A;  4B3M Q;  1HNW L;  3I4N B;  2UUA Q;  1D1K A;  1VQH A;  1N34 L;  3UE0 A;  5FLX E;  1Y1V B;  3KBX A;  5I6W A;  3OWF A;  4KY5 A;  1U4M A;  2KCC A;  2A73 B;  2I5L X;  4IJH A;  1YHQ A;  1XX8 A;  2UU9 Q;  3AMU A;  1SRU A;  1SND A;  4L6T B;  3S17 H;  3CRK C;  4YWL A;  2R92 H;  4FXK C;  4ID6 A;  1I50 H;  1N32 L;  3A0J A;  2F0F A;  3DWP A;  3A54 A;  4DV3 L;  1QE6 A;  2RVL A;  1N32 Q;  2A68 D;  1Q1B A;  5T1I A;  3I2Z A;  4IPC A;  4NKL A;  2ZJP A;  1X3E A;  4DV3 Q;  1YZ6 A;  4HID A;  1SMY D;  1ESR A;  4CKE A;  4DN4 M;  4YY3 L;  2NN6 I;  4F7X A;  2R92 G;  4ZYS A;  5E4X A;  2G9H D;  2NVT B;  1EU3 A;  1BCP B;  2DUD A;  1SXT A;  2QKI C;  3JAM i;  5DM7 3;  2F4V L;  3CCR A;  3HFZ B;  1GM5 A;  1L2F A;  5C44 G;  2BA0 A;  4DV2 Q;  3VDY A;  5DLQ E;  1E22 A;  3R2T A;  1GXD C;  1VS0 A;  2F0D A;  3CC4 A;  1J5E L;  4CDE C;  5ELN A;  2F4I A;  4K8J A;  5CV7 A;  2PCF B;  1F9Q A;  3NK9 A;  3Q22 A;  1FNV A;  3EBE A;  1NMF A;  4KJO A;  1WTV A;  1A15 A;  1EYC A;  1HH2 P;  3HOV H;  2EYH A;  3E9H A;  4RKB A;  3NEL A;  5CGK A;  3EFX D;  3I70 A;  5F2D A;  5G3L F;  2VS1 A;  4JI7 L;  1SFO H;  4WJ3 M;  4K0K Q;  1IKM A;  1I4H A;  4P73 A;  1T9H A;  4CJ1 B;  3RN2 A;  3E0E A;  4J15 A;  4GLA C;  2RHQ B;  1VQ6 A;  3TSS A;  3NBH B;  4IO9 A;  3TQY A;  3M4Q A;  2I46 A;  4V0B A;  4C1N I;  5E1F A;  4FF2 A;  3HOV G;  4N9T A;  2JA5 H;  3K81 C;  5C4X B;  2K32 A;  1X3F A;  3ICE A;  1JOR A;  4X65 L;  4N8X 1;  2ZXO A;  4GOP B;  1A3V A;  4X65 Q;  3T16 A;  3SVM A;  4BBR G;  4IUQ A;  3KF8 A;  4RA8 A;  3QO2 A;  5GAD C;  4XDX A;  1FVI A;  3ERO A;  4OO1 I;  1LTA D;  2EPB A;  2A68 C;  5L37 A;  1JOO A;  2XRQ D;  1ML0 D;  1Y8N B;  3KBG A;  4LW1 A;  1SMX A;  3N6R A;  4CDC C;  3J7A F;  4EQO A;  2XSC A;  2L15 A;  4IJL A;  2K52 A;  5DAU A;  1YNX A;  3GO5 A;  3S1M H;  3FKI B;  3PUY A;  1CA5 A;  1EYD A;  4RFB A;  1XNR L;  1STG A;  4IAL A;  4HMJ A;  3T4A C;  2DN8 A;  2Q2U A;  1Q90 A;  3NTH A;  4DUZ Q;  2BH8 A;  1H9M A;  1L0X B;  4LUZ A;  4ABN A;  1CSP A;  1PTO B;  1LTL A;  3D3R A;  5IYC G;  4DR2 Q;  3SHL A;  4LAA A;  3QWN A;  1TT2 A;  2EDG A;  4JK1 C;  2YTY A;  2K5W A;  1EFI D;  1YHA A;  1EQQ A;  1S5E D;  4C3I B;  3BJU A;  3F1Z A;  1EU4 A;  1WI5 A;  3P1H A;  2KCN A;  4A3K B;  3VYR A;  1IW7 D;  3GTM B;  2N3S A;  1XTC D;  3GTP H;  3CU7 A;  2KHI A;  4N8F A;  1Y69 U;  2NVQ B;  4QUC A;  2Z6K A;  5M3F G;  2CCZ A;  3GTG B;  3OTO Q;  1SLJ A;  1STY A;  4JC0 A;  1ASY A;  3J7Y W;  2MPM A;  3D8G A;  4X66 Q;  2PNR C;  4WOR A;  1E2Z A;  4DR1 Q;  1BVS A;  5ELD A;  4LF4 L;  2PMZ B;  1WTQ A;  1MHW C;  2RQX A;  5K36 G;  4C2M B;  5JPM C;  4A3B B;  1D7Q A;  1CKM A;  5AJ3 Q;  2E2J H;  1F2L A;  3OWE B;  4OL7 A;  3PO3 H;  2DNE A;  2E74 C;  5JEA J;  2K5D A;  1PZJ D;  4ZRZ A;  3KF8 B;  4MN3 A;  1M1K C;  1RD9 D;  1EEI D;  1KLU D;  2F0H A;  4IUT A;  5FKA C;  4OWT B;  1Y1V H;  4A93 B;  1WTH A;  1VQG A;  4O0A A;  3GTJ B;  3BVZ A;  4GNX B;  3RZO B;  1H95 A;  1M8A A;  1VQE A;  1E3P A;  2K5N A;  3PO3 G;  3H15 A;  4DV1 L;  4IFD H;  1I6V C;  2F0E A;  4BY7 B;  2K7V A;  4R4Q A;  2MP1 A;  2OT2 A;  4DV1 Q;  5E3F A;  3S15 B;  3NQI A;  3ITP A;  3NEN A;  3I4N G;  3L0O A;  1JJ2 A;  5ELE A;  3RZD B;  3I4L A;  4JW0 A;  1B53 A;  1AN8 A;  4AIM A;  1KTK A;  3L3O C;  2E5L Q;  3DWA A;  1B4O A;  2XWJ B;  2YU9 B;  3QJY A;  4KHZ A;  3X3N A;  2O5J C;  4IFD G;  3K5L A;  4DUY L;  4G7O C;  3STB D;  4P74 A;  1TS3 A;  5CC4 A;  5HY6 A;  4YHH Q;  2R7F A;  1CKN B;  1YNN D;  2RSO A;  1NAP A;  1V1O A;  3BYT B;  3S1R B;  1Q12 A;  2IJ0 A;  3WWV A;  1IW7 C;  2ZJQ A;  4JCV E;  4OEL B;  2ZJR A;  2ZXP A;  1YJ9 A;  1Q82 C;  3FEW X;  2WP8 J;  2X69 A;  4XQN A;  1LTR D;  4DV0 Q;  1N36 Q;  4QGU A;  5I9O A;  1PTO D;  1E0B A;  1JWU D;  5GQO A;  3RUZ A;  3J81 E;  2Z8L A;  2QEX A;  3HOW H;  1R9T H;  1RDP D;  5KNB A;  3G7L A;  1PZK D;  2CWP A;  1A62 A;  1NMG A;  3HOY H;  2CHB D;  5KND A;  1EIY B;  1S5D D;  2OF1 A;  5IGD A;  2MFI A;  4XT1 B;  4RHR A;  5E7N A;  1AZQ A;  3L7Z C;  3PMF A;  2PYK A;  2IY5 B;  5M5Y B;  3LGJ A;  1VQI A;  1AFP A;  1GOZ A;  3E3X A;  3RLO A;  4RCO A;  3NEM A;  4HIK A;  4R9W A;  5C5L A;  4QQB X;  2CH4 A;  3S14 B;  5IOD A;  5C4X H;  1YBY A;  3OIP A;  3K7U C;  5EAY A;  3G4S A;  4TKO B;  2YTX A;  1X3P A;  2JA8 G;  2Y0S G;  2HCI A;  3MHB A;  2N49 A;  4KHP L;  1STB A;  1V1Q A;  1QJO A;  2F0M A;  5IP9 H;  5KGU A;  4FVM A;  4H44 C;  4A3G B;  5CV4 A;  3BVM A;  1PRT B;  5C4X G;  2FMC A;  2E2D C;  3SK6 A;  2SOB A;  3HOZ B;  2ZXR A;  3JAM L;  5KYL A;  3UDI A;  1SNM A;  3I56 A;  2H4O A;  2PW7 A;  4K6L A;  2FFK B;  1SNO A;  2PZT A;  3L9A X;  1VQ9 A;  5IP9 G;  3QIA A;  1SE2 A;  3STB C;  1SYB A;  1TS2 A;  3W3A A;  1YNN C;  2PQE A;  3EQL C;  5GRO A;  4FF4 A;  4PZ7 A;  1VQD A;  2F1M A;  1HHV A;  4KN7 C;  4CJ2 C;  1F77 A;  5LL6 X;  1NCV A;  2K50 A;  2DJF C;  1HR0 L;  2EY2 A;  4LF8 L;  2Z1C A;  4LJZ C;  1AP0 A;  1RTO A;  3J80 c;  3FKI G;  3PUV A;  2XVS A;  4A3M B;  1KDB A;  3J81 i;  1F9R A;  2B2Y A;  4C3I H;  2D9U A;  2HCC A;  3PQI A;  5HGQ A;  3C46 A;  5JPN C;  3RLN A;  3G6J B;  1HZ9 A;  4ZCK A;  3KUP A;  1SE8 A;  3S17 B;  1F2M A;  5KNC A;  4DNR B;  1YIJ A;  1TWC B;  1LTT D;  1LM0 A;  1TWH B;  2PPB C;  2VW9 A;  2F0G A;  1HNZ L;  4C3I G;  3BDO A;  5JOB A;  2CH4 W;  4YCU A;  1HNZ Q;  4JI3 Q;  3D4W A;  4POF A;  1N33 L;  2OQ0 A;  3UE1 A;  4A3K G;  1N33 Q;  1WCM B;  5JJZ A;  4IPH A;  4EQP A;  5IYB H;  4CHT B;  1FNU A;  1SNP A;  5CBA E;  5EQ0 A;  3K6O A;  4C2M H;  2DY8 A;  2AWO A;  3I3C A;  5KYI A;  4A3B H;  2EVB A;  4V19 0;  1IKL A;  4RKL A;  5IGG A;  3HOU B;  3WOE A;  2UXD L;  3H3V H;  3KLW A;  1ASZ A;  3BU2 A;  1TU2 B;  1EFW A;  2LMC B;  4PNY A;  5EPJ A;  2UXD Q;  1B9N A;  4CGY B;  5J1Z A;  4ZLT F;  5IYB G;  4CKB A;  2Q2I A;  5JJL A;  1ILQ A;  4DKA C;  3T13 A;  1KC8 C;  4A3B G;  4A93 H;  3TZU A;  4CJ0 B;  1ZXT A;  3GTJ H;  4KTA A;  1VQO A;  3RZO H;  1EEF D;  4X3U A;  5IWA L;  4A3D H;  4IOA A;  2KHS A;  2N88 A;  3Q6S A;  4JVZ A;  4DK6 C;  4A3I G;  3NP8 A;  1C8C A;  3TS2 A;  3NWT A;  4IPG A;  5LMN L;  4BY7 H;  3L2P A;  3DEO A;  4NXM L;  3M4P A;  1HUM A;  1ENF A;  1YNJ D;  2AQ3 B;  3RZD H;  4K2K A;  4R4O A;  1EY4 A;  4NXM Q;  4A93 G;  1XMO L;  2I07 B;  3U50 C;  4PZ6 A;  1VQJ A;  2JA5 B;  5DM6 3;  1XMO Q;  3W1G A;  3ZYY X;  1UE5 A;  2MNA A;  2G9D A;  5HGT A;  1LT3 D;  4NP5 A;  5C0X I;  4BY7 G;  4JI5 L;  1ONL A;  2PMZ E;  2ZTE A;  1N8R C;  1J6Q A;  3K58 A;  2HHH L;  3S1R H;  1Q7Y C;  4NDX A;  1ESF A;  3LWU A;  5D65 A;  1U4R A;  1K8M A;  3C1E A;  2AWN A;  4I7A A;  3DLL A;  2CW0 D;  1V43 A;  2D2C C;  5FJ8 H;  3M9B A;  3I73 A;  2PO4 A;  3S1M B;  3I7F A;  2NTT A;  2CWA A;  3Q0A A;  4H7B A;  3CPW A;  2RF4 A;  1K0R A;  2EYJ A;  2YTV A;  2Z6K C;  3VR2 A;  4B3T L;  4R4I A;  5FO9 B;  2RDF A;  4AQY Q;  2D62 A;  3A8K E;  4JI4 L;  3PV0 A;  5IOC A;  4B3T Q;  3AFP A;  1R4Q B;  1XYI A;  3OMG A;  5LMU Q;  2BE5 C;  4DR6 L;  2ZT9 C;  5M5Y H;  1EY0 A;  1W6J A;  1JQY D;  4HJ9 A;  1XMQ Q;  4DR6 Q;  1PXU A;  5K5P A;  2D5D A;  3W5O A;  1VQA A;  4QMG A;  4ZAI A;  3K57 A;  1TY0 A;  4C1N K;  5IYD G;  4B3R Q;  3S14 H;  4LFB L;  1BXT A;  1B8A A;  2MGS A;  1UE6 A;  3LX0 A;  3A5Z B;  2F3W A;  1TXY A;  3BG3 A;  3A5U A;  3NXW A;  4QCL A;  2IX0 A;  3H0G H;  4RH6 A;  2NTS A;  2LFN A;  3CC2 A;  4JI2 L;  3K7A B;  2LS0 1;  1IBM L;  3D0F A;  4JI2 Q;  4DXG A;  1RKN A;  3M7N A;  1CQV A;  4BXX G;  2B2T A;  2QF7 A;  4UP7 A;  1SNQ A;  5C6A A;  1YNJ C;  5BN3 A;  3J7A 5;  4PMB A;  1B2T A;  3VYS A;  3JC6 6;  4GKJ L;  2B2W A;  3S16 B;  1LAC A;  3HOZ H;  4J6H A;  1MSH A;  4A3J G;  1IBL Q;  4XQQ A;  2PZU A;  3EIV A;  2Z0S A;  2LY7 A;  2ALY B;  3PIP A;  3D6C A;  4LWC A;  4EQN A;  1CFM A;  2XWB B;  4A3G G;  2K14 A;  2KCT A;  4JOI A;  4LFA Q;  4KMU C;  2ES2 A;  4A3F B;  1IYJ B;  2LKV A;  1LAB A;  3NBH A;  2IX3 A;  3V96 A;  3E0J A;  5DEH A;  2K5H A;  4B3M L;  2Q8R E;  3F2B A;  3CRL C;  2CFM A;  4MIU A;  5NUC A;  2JEB I;  4GOP A;  1I3Q H;  5EBD A;  2CW0 C;  1MD2 D;  1UNS A;  4A3M H;  3KDF B;  1XNQ L;  1YJW A;  2UU9 L;  3SEB A;  1QVG A;  2EYL A;  1XNQ Q;  4AH6 A;  2J7Z A;  3AB9 A;  1SR3 A;  4X62 Q;  1EYA A;  1MJE A;  1S3O A;  3DUZ A;  1A6X A;  1PH8 A;  1TS4 A;  1EZ6 A;  4B3S L;  1CI3 M;  2L0C A;  5IT9 c;  2VY3 A;  4A3L G;  1TWC H;  4DNT B;  2RDG A;  4B3S Q;  4A3M G;  1RF2 D;  1TWH H;  3FP9 A;  1EWI A;  4U67 3;  4NXN L;  1PFB A;  2C5C A;  3A8J E;  1GUS A;  1JC7 A;  3U9S A;  4NXN Q;  3SK4 A;  4UP8 A;  2UUB Q;  2QCP X;  1VQM A;  1CSQ A;  4JI0 Q;  1O78 A;  1WCM H;  3IKJ A;  1XXG A;  3FPU B;  2M00 A;  1K9M C;  4OX9 Q;  3NPP A;  1NE3 A;  1PZI D;  4DV2 L;  4KHV A;  1U4P A;  2VB3 X;  4QUF A;  3HOU H;  3HOX B;  2K04 A;  1HTL D;  2JJQ A;  1JWM D;  4KN4 C;  3E6Z X;  3HOW B;  1YIT A;  3TBI B;  1R9T B;  1KQS A;  1OXT A;  3K5M A;  4JBW A;  2NYZ D;  1PH1 A;  1RTN A;  5IGB A;  3VR4 A;  3HOY B;  2IHF A;  4K5W A;  4BWG B;  1IL8 A;  2NVY B;  5EGT A;  1Q81 C;  1B7Y B;  1IYV A;  1B3Q A;  2C35 B;  1E24 A;  1G2S A;  3HOU G;  5CBE E;  1STH A;  4FF3 A;  4K0K L;  4HCS A;  1MIU A;  1WTR A;  3J81 L;  1PFN A;  3H09 A;  3D4D A;  5C0X J;  1WD0 A;  4IFD I;  1Z7T A;  5IY0 A;  1QUQ B;  1KAA A;  4EX5 A;  3PCO B;  3FDT A;  1SN8 A;  3NQT A;  3P75 A;  1QIL A;  4DR3 L;  3WOF A;  1K83 B;  4DR3 Q;  4DR4 Q;  2VB2 X;  4GN3 B;  1NY4 A;  3WDN A;  1H9J A;  2EJM A;  3Q24 A;  4K6D A;  3GV6 A;  3F8T A;  4J8Q A;  3VA7 A;  1WTX A;  1T5X D;  3SK5 A;  2B2Y C;  1GUO A;  3PO2 B;  1OXV A;  2JA5 G;  2F03 A;  3MXN A;  5C3X A;  3NWS A;  4GNX A;  5EKI A;  1U5K A;  1NR2 A;  4GN4 B;  3T1Y L;  1TII D;  1HA5 A;  3X3M A;  1BBU A;  1CKO A;  4IUR A;  1SMY C;  1K3B C;  3T1Y Q;  1LO5 D;  4ZKC B;  2HD3 A;  1DGS A;  2BCO A;  4YWK A;  1ILP A;  5EKK A;  1XTD A;  3R93 A;  5IP7 H;  1I4R A;  4ODG A;  4DUZ L;  2JA7 B;  3DHQ A;  2ZM6 Q;  1DXM A;  1RJT A;  2VQF L;  3BDL A;  3FVQ A;  4DR2 L;  2VQF Q;  1SJE D;  4ME5 A;  1HQR D;  3C3L A;  4HJ8 A;  4DV6 Q;  1CKN A;  3EJI A;  5IP7 G;  1NNX A;  1FYC A;  2YV5 A;  2K1B A;  2KCM A;  2WAQ B;  4HSV A;  5EPL A;  3CC7 A;  4JI8 L;  2ZTD A;  4F88 A;  3P7J A;  4JI8 Q;  1BCP D;  4I7Z C;  1WTO A;  2F0O A;  3NHH A;  3K7A H;  1TQO A;  3C1F A;  2K03 A;  3AQQ A;  1X54 A;  1N9W A;  2KOL A;  4L5R C;  3E5S A;  1L1O B;  3OTO L;  2KEC A;  1SEB D;  5FLX c;  4X66 L;  3S16 H;  4DR1 L;  1QB5 D;  2R3Z A;  2IL8 A;  3TN2 A;  4G4K A;  5JEA H;  4X3S A;  1KNE A;  4QL5 A;  3W2D A;  3GTQ B;  3NTK A;  2CVR A;  4IOC A;  1JT8 A;  2K5Q A;  4XTC S;  4S3S A;  4UDU C;  1Y8P B;  5AJ3 L;  1JJC B;  1Q8I A;  2HDM A;  2HQE A;  4A3F H;  3I55 A;  3H91 A;  4DAY A;  2Z6B A;  4UHV A;  2MO0 A;  2NB0 A;  2NN6 H;  1D1I A;  2I0Q A;  4RMF A;  2XRS D;  1EY6 A;  2JE6 I;  2RDH A;  4G7H C;  4Z9C B;  3RNU A;  4RGO S;  1QNU A;  3MXN B;  3J7A V;  1UE7 A;  2F0I A;  4A3F G;  2OEO A;  4A3D B;  4R8N A;  4L63 B;  2ZTC A;  1PH7 A;  4A3C H;  1RL2 A;  2ID0 A;  1P16 A;  1G29 1;  4JI6 L;  3KFU A;  1K73 C;  2QA4 A;  4RG1 A;  4DK3 C;  4JI6 Q;  4H02 A;  2VL6 A;  3RD4 A;  1GJX A;  1EIF A;  1Y1V G;  1GKH A;  2E5L L;  2TMP A;  1E2W A;  2NVX B;  4OXP A;  4JI1 L;  4A75 A;  3HKZ B;  4FNF A;  1AH9 A;  4IUP A;  4JI1 Q;  1Q1E A;  1VQP A;  2R93 H;  2PQA B;  4YHH L;  1EL0 A;  5C3E H;  1HR0 W;  3DEP A;  4ZKB B;  2J0T D;  1HA6 A;  2ENB A;  1BR9 A;  1EQT A;  4NPS A;  1BCP C;  2KEE A;  3PIP 3;  5FO7 B;  2EYF A;  1X56 A;  1LTB D;  4LF5 L;  4DV0 L;  1WVL A;  1IYU A;  1N36 L;  3KYH C;  4LF5 Q;  2UXB L;  4M1U B;  2VQE Q;  3HOX H;  3ULP A;  3D4R A;  4FYD A;  5FO8 B;  1STN A;  3DM1 A;  2UXB Q;  4AYB E;  2RCN A;  4TSS A;  1MI2 A;  5JJI A;  1VQC A;  3QB3 A;  4XYO A;  1I4G A;  1GO3 E;  2TSS A;  3S24 A;  2NVY H;  5KRU A;  3VYU A;  1DM0 B;  2B2T C;  1W2B A;  5IE8 A;  1VQB A;  5ELO A;  4OO1 H;  3HKS A;  3SE0 A;  3HOX G;  2B2W C;  2WKC A;  4IZ8 A;  5J39 A;  5M5X B;  3HOW G;  4HIO A;  5M9O A;  1HXY D;  4L8J A;  3HOY G;  4X3T A;  3J80 i;  4P71 A;  5JVG 3;  1TY2 A;  4DAY B;  2K28 A;  3SK8 A;  3TP5 A;  2L55 A;  1GVP A;  1X3G A;  4JOI C;  1TS5 A;  2WII B;  4UAI A;  2Z4I A;  1K83 H;  4PG3 A;  4G57 A;  4C3H B;  1K28 A;  4ALP A;  3H0G B;  1XJV A;  1PA6 A;  3CHB D;  1HNX L;  2A6H D;  4P75 A;  1K8O A;  1L0Y B;  3CCQ A;  4GOP C;  1L0W A;  1HNX Q;  5C4J B;  3C2P A;  3OOC A;  3KF6 B;  3K80 C;  2D0O A;  4RCN A;  2FMM A;  3PO2 H;  3K0Y A;  1CHQ D;  4LF9 Q;  1HTP A;  3ND9 A;  1I4Q A;  2Q8T A;  1E7Z A;  2CKZ B;  3IL8 A;  3KLR A;  1WD1 A;  3I90 A;  3CD6 A;  1D5X C;  5HUR A;  2RA4 A;  2RBM A;  4PMC A;  5LMN W;  1K3R A;  4RHS A;  2RKS A;  3S2D B;  3S9W A;  2IW3 A;  3PO2 G;  2JA7 H;  2IX1 A;  2MHV A;  2BOS A;  5I4D A;  2CQA A;  1HCZ A;  3AU7 A;  5ELC A;  3F2U A;  1D6E C;  1XPR A;  2N8N A;  2FHT A;  3D6W A;  4F87 A;  1Q3L A;  2EY1 A;  1Z9F A;  4DAM A;  1Z47 A;  1I3Q B;  1PTO C;  4OGQ C;  2RSN A;  3MXU A;  1KAW A;  1SE4 A;  2JA7 G;  3DMU A;  4FXD A;  2JP1 A;  4HCE A;  2VUM H;  1J9O A;  1X65 A;  3A74 A;  4Q5V A;  2H5X A;  2OXP A;  1PHJ A;  3EA6 A;  3BZD B;  4APV A;  2PW5 A;  4KY7 A;  1TR5 A;  2SNM A;  3CP0 A;  4OIK A;  4OWW B;  3CF5 A;  3K8A A;  1KIX A;  1PYB A;  3AYH B;  3MZ5 A;  4JI3 L;  1GHJ A;  2WAQ G;  1KLG D;  2EZV A;  2JA6 H;  1D5Z C;  4OON A;  4X6A H;  3QR8 A;  1EQV A;  2OQK A;  4RWS C;  3NE5 B;  1CQF A;  3QOJ A;  4K14 A;  1AE3 A;  1C0A A;  4RGN A;  4C56 C;  1MGS A;  3GTQ H;  2B8F A;  2CQO A;  1BQQ T;  3MXG A;  1WOC A;  2A6H C;  2R6G A;  1HFG A;  1HRJ A;  3UDG A;  1ENA A;  1X32 A;  4PV1 C;  4IUV A;  2PNH A;  2IWH A;  4HAE A;  5C44 B;  2B2U A;  1WJJ A;  1BO0 A;  4G7Z C;  4GZY C;  3H3V C;  2OWO A;  3CCU A;  2E2H B;  2EYM A;  1KNA A;  3LWE A;  4ZQ3 A;  1PV4 A;  4IUN A;  1D2B A;  2GA4 B;  1NBW A;  1OO9 B;  1U9R A;  2ICE C;  3M4O B;  1YVC A;  2HUG A;  1W6K A;  2FJ2 A;  2WAQ E;  1BKB A;  5ISR A;  2MQH A;  4WJ4 A;  1G51 A;  4JBM A;  1ET6 A;  4GNX C;  4BY1 B;  3HG9 A;  2B2V A;  3VR5 A;  2A5H A;  4FF1 A;  1GUT A;  1IL2 A;  1H9S A;  2L5T A;  4GN5 A;  4GLV B;  3Q8D A;  4BBS H;  2AHO B;  1JOQ A;  2XIW A;  2A69 D;  3OW2 A;  2NVX H;  1PRT D;  4A3D G;  1DOL A;  4C3J B;  3NBI A;  5LL6 S;  2E76 C;  4P72 A;  1F2Y A;  1TWG H;  1Q8K A;  3OW7 A;  4YCW A;  2Z9H A;  1FR3 A;  2JYO A;  4R4T A;  4BBR B;  4XT3 B;  1KHI A;  3HKZ G;  1KD1 C;  4DR5 Q;  3KDF A;  4A3E B;  3R8B A;  1B1Z A;  4WRD A;  2A6E D;  1G6Z A;  4CDD C;  1ET9 A;  5D14 A;  1EYG A;  2VXW A;  2KA7 A;  1HJP A;  2IPK D;  1LT6 D;  3U9O A;  3GV3 A;  3GD7 A;  1X55 A;  3MC0 B;  4DXF A;  4AQY L;  4X64 Q;  1C4Q A;  1JE5 A;  2EY6 A;  2DY7 A;  4DF7 A;  2FIN B;  3T53 B;  5LMU L;  2UUC L;  5AFW A;  1V8Q A;  5M5X H;  1OXU A;  5FJ8 G;  1XMQ L;  2UUC Q;  5I9P A;  2K05 A;  3MTS A;  3FMC A;  3HEJ A;  1TWA B;  4B3R L;  2K75 A;  5JJK A;  1X3Q A;  2M2L A;  1YJN A;  3HKZ E;  2HIV A;  2KUM A;  1K0S A;  4C3H H;  2N55 A;  2Q8I B;  4KJN A;  2Q2T A;  5JVH 3;  3GDE A;  3PUX A;  1FL0 A;  1SYG A;  1SJH D;  1BOS A;  5FOB B;  5C4J H;  4LUO A;  2AUJ D;  3CKI B;  4MHE A;  5M5W B;  1UEB A;  1F9P A;  1V9P A;  1SBB B;  2XNA C;  2ICI A;  2QDL A;  4ZK9 B;  5CMD A;  5M3M H;  4LF6 L;  3SDZ A;  2OTL A;  1IBL L;  1O7I A;  2A69 C;  4IUU A;  1Y1W B;  1U0L A;  5BN4 A;  4LF6 Q;  3H0G G;  1H9S B;  1PRT C;  4GKK L;  2KQ3 A;  1S40 A;  1VQ4 A;  4TVA B;  1A3T A;  4GKK Q;  2F0K A;  1EWC A;  4M8A A;  2EY5 A;  3LNN A;  1STE A;  3T56 B;  5D3D A;  3EN2 A;  1QUQ A;  4IPD A;  4LFA L;  3S2D H;  1PH2 A;  4U68 A;  2H1E A;  2WB1 B;  2IHE A;  1PDQ A;  4N9P A;  3I4M H;  3HOZ G;  2KBN A;  5ELB A;  3W1B A;  3A56 A;  4AYB B;  4POG A;  3KLS X;  1LTI D;  1LV9 A;  2OCE A;  2A1A A;  3CCV A;  1O7Z A;  5H1S E;  4X62 L;  1GHK A;  4QIW B;  4HR7 B;  4KD4 A;  4ZUJ A;  3VR3 A;  5TSS A;  2JK8 A;  3PSI A;  1VQ8 A;  2B3G A;  2B8G A;  3J80 L;  2UXC Q;  4B9X A;  1JB3 A;  2QW7 A;  1JE4 A;  2PZW A;  1WFQ A;  5A2Q L;  3K5O A;  4LFC Q;  4BA2 I;  3TDQ A;  3M7G A;  1HNW Q;  1N34 Q;  2UUB L;  4JI0 L;  5CV6 A;  2HQL A;  2R93 B;  3B6Y A;  3VA5 A;  2GN5 A;  4MTN A;  4HIM A;  3K59 A;  2I5H A;  4FP5 D;  3EVQ A;  4ILW A;  5C3E B;  4OX9 L;  1QVC A;  3MFY A;  1FNW A;  3I91 A;  1X9N A;  2EJF C;  1CHP D;  1WYD A;  1KXL A;  5G3L D;  4DPG A;  1C7Y A;  4DV4 L;  1LUZ A;  1XPO A;  3CCE A;  2BDN A;  3BVG A;  4FXG C;  1VF5 C;  5C44 H;  4DV4 Q;  2L4N A;  2MJ8 A;  1H9K A;  1WCM G;  3P20 A;  5CYU A;  5C0X H;  2EXD A;  2L9H A;  2NUC A;  3BZK A;  4RAU C;  4YY3 Q;  3T51 B;  2E2H H;  4FO2 A;  1K8G A;  1JOK A;  3RMH A;  4DA2 A;  1BF4 A;  3GP7 A;  1X6O A;  3CAM A;  3M4O H;  1STA A;  1DD2 A;  1EIH A;  2F0U A;  2BH2 A;  3GTK H;  2HDL A;  5J3B A;  2AKW B;  2L12 A;  2NZO A;  1L1O A;  2F4V Q;  4BY1 H;  2DNC A;  2EQS A;  3BS1 A;  2JEA I;  5C0X G;  3GTO B;  1AW7 A;  1GUN A;  3IFD A;  4KV6 A;  4GLX A;  3OSO A;  4ZUI A;  3K0X A;  1J5E Q;  2F0N A;  1I5F A;  1V1P B;  4A76 A;  5EKL A;  1S5F D;  1BUV T;  4DR4 L;  3HRZ C;  4KI0 A;  2KED A;  4C3J H;  1F2Z A;  1EY9 A;  2N78 A;  4BY1 G;  5KEE A;  4DAV A;  3OIQ A;  4F8M A;  3HS0 C;  1SRO A;  2JA8 B;  2Y0S B;  4JI7 Q;  1FD7 D;  3BDC A;  4LMQ D;  2K5V A;  4EGV A;  5C3W A;  3NTI A;  3AEV A;  4JYA L;  1IHZ A;  4BBR H;  4A4I A;  2LSS A;  1HFN A;  3I8Z A;  4WFN 3;  4JYA Q;  1A3U A;  4A3E H;  2R7D A;  2L1B A;  1I6H B;  4HED A;  2QDB A;  2B39 A;  4C3J G;  1NTG A;  4J1M A;  1B70 B;  2X6L A;  1SYC A;  1T5E A;  4TQU S;  2K6A A;  3FRP B;  3MFG A;  3JAM c;  1A63 A;  1PFS A;  2ZM6 L;  3PGZ A;  4DV5 L;  1DOK A;  4A3E G;  1M4V A;  2EJG C;  4DV5 Q;  3PUW A;  3ULJ A;  3KLS A;  1NJI C;  3SR1 A;  1SE3 A;  3QOL A;  4ME3 A;  4K5X A;  3A55 A;  2PQA A;  1NSN S;  1XPU A;  4DV6 L;  3CXC A;  5IYC H;  4DFA A;  2AQ2 B;  1I4X A;  3KOJ A;  1KL9 A;  1TWA H;  3BZC A;  2OTJ A;  3CQZ H;  1JR0 D;  3AFQ A;  1PYW D;  1VCI A;  4K8I A;  2JA9 A;  4YIJ A;  2VUM B;  5D3I B;  4Y7N H;  3I4O A;  1HPC A;  1XNR Q;  3RR5 A;  2JQO A;  2A19 A;  3ULL A;  3MVV A;  1ICF B;  2B2U C;  2F0J A;  2RCF A;  1CM9 A;  1G91 A;  2M9V A;  3VR6 A;  1H9R A;  2O5I C;  2EXZ A;  4MTK A;  5DNF A;  2P5Z X;  1PH6 A;  5GAG C;  1W3S A;  4YWM A;  5IIF A;  1DJR D;  4IN3 A;  4O42 A;  5M5W H;  4QJF A;  5M3F H;  1PVO A;  1UUP A;  5A35 A;  2JA6 B;  1B44 D;  4DU9 A;  1Q86 C;  1Y1W H;  1LYL A;  1ROD A;  4DGZ A;  1VMC A;  5CV5 A;  2A74 C;  2B2V C;  3S1N B;  1YEZ A;  3D31 A;  4KK7 A;  1P8L A;  3OHX C;  4R4C A;  4PQX A;  2E2I B;  3MAQ A;  5COR A;  3CCS A;  5K36 H;  3A7L A;  3MEF A;  3DXJ C;  3R3O A;  1MJC A;  4H13 C;  5EJW A;  3VYT A;  2PI2 E;  3I72 A;  4EQ5 A;  3ZJY C;  1VQ5 A;  1JMC A;  1DOM A;  2E8G A;  1Y1W G;  3HGB A;  4KKS A;  5J22 A;  1KAB A;  3J80 E;  5JEA G;  2G5D A;  2B63 B;  1EQR A;  3FPP A;  1SDF A;  1IBK L; 
#chains in the Genus database with same CATH homology
 4P2C B;  2QIL A;  1MSG A;  1LT5 D;  4XXE A;  1ENC A;  5A2Q E;  1C48 A;  1BCP F;  5C4Z A;  2L11 A;  4PMW A;  1A2U A;  1QOH A;  2NN6 G;  4A3I B;  4Q0F A;  3IFT A;  1OXS C;  1HUN A;  2JSO A;  4BBS B;  1UEA B;  1O7Y A;  4ULL A;  4H0L C;  1D5M C;  5IGC A;  1Y8O B;  2WKD A;  5IT9 L;  1DCZ A;  1ZEQ X;  1ICW A;  2F0V A;  1EY8 A;  1TWG B;  4B08 A;  4BS9 A;  4CBV A;  3Q23 A;  2NBF A;  3RLF A;  3MA2 B;  5I2X A;  4I65 A;  2O2L D;  1O7L A;  1SAP A;  2K33 A;  2WV6 D;  4XYQ A;  4IFD J;  4RGM A;  3DWQ A;  3TP8 A;  1EY5 A;  1VDZ A;  3S2H B;  4OIJ A;  1EY7 A;  1EZ8 A;  1GUG A;  2F0P A;  5CR3 A;  3PUZ A;  4B9W A;  1PLF A;  3K5N A;  3M4Y A;  2F0W A;  3PIO 3;  2VNU D;  5E4W C;  3OMC A;  4HTH A;  1CTM A;  4WJW A;  4OO1 G;  4BA1 I;  1B9M A;  1S4Z A;  1OXX K;  2KJX A;  4K2L A;  2O4X A;  5EBC A;  1QG7 A;  1PTO F;  2Z4H A;  4KD3 A;  5M3M B;  2QEJ C;  1LLR D;  1II3 A;  4NMZ A;  1SYD A;  5I2Y A;  3M3Y B;  5C4H A;  5FK9 C;  4A3J B;  3GQB A;  1B3A A;  1WTW A;  4KKU A;  2IT1 A;  3MXP A;  2R7Z B;  1B50 A;  3I4M B;  1UAP A;  1FGB D;  3TP6 A;  3GTL B;  5ELF A;  1ZYR D;  3MEH A;  2YYZ A;  3MWY W;  1VMP A;  4QF4 A;  1R4P B;  1EWH A;  1AZP A;  1G8Z D;  1CZG A;  1Z6H A;  3A7A B;  5JAV A;  2NWG A;  2F0L A;  3N52 A;  4DAP A;  1E2V A;  3QG1 A;  1PTO H;  1TWF B;  2V4D A;  5I6Y A;  1BBX C;  1RHP A;  1DON A;  1HQM C;  4E6I A;  4HMI A;  3O13 A;  2R92 B;  1JCK B;  1I50 B;  2EYP A;  5CV8 A;  5FLX L;  1CT1 D;  5COY A;  1SYF A;  3V2T A;  2BA1 A;  2SEB D;  4DK1 A;  4OHJ A;  4KY6 A;  2E75 C;  3GTK B;  1S5B D;  2BE5 D;  1XWE A;  5IT9 E;  3TZD A;  3URY A;  1ZKO A;  5BN5 A;  2J4X A;  1GUW A;  3HZX A;  4R8I A;  1EOT A;  1ZYR C;  1RCV D;  2MUY A;  4HSP A;  2F0Q A;  3HP3 A;  1KDA A;  1SYE A;  3HOV B;  1JIC A;  2BDO A;  4EVO A;  4K5V A;  1SFO B;  1CZW A;  4NW2 A;  5IGF A;  1U4L A;  4XQJ A;  3A8I E;  2JXM B;  3M85 A;  5EPK A;  4RGT A;  2EE1 A;  1EIG A;  2SDF A;  2NZ1 D;  1QNK A;  1BDO A;  1QCB D;  1LTS D;  1CK1 A;  3UI2 A;  1PFM A;  5LHY 1;  1PMR A;  2AUK A;  2R61 A;  1LT4 D;  1BNZ A;  4X3K A;  5IGE A;  4HN7 A;  3V05 A;  1CA6 A;  3NSW A;  1MBY A;  4TRD A;  1PRT F;  1TKW B;  2F0S A;  3NUC A;  2EYO A;  4O1N A;  3ND8 A;  3CQZ B;  2XN9 C;  2F3V A;  1J8I A;  4Y7N B;  2C9O A;  1KDC A;  3SXH A;  1TVX A;  1VF7 A;  1SSO A;  5KIX A;  1AEX A;  1NR4 A;  1JWS D;  5M3F B;  1F9S A;  4LK1 C;  2X6G A;  4C3H G;  3H6M A;  3JAM E;  1LTG D;  1O80 A;  4XIG S;  1DYQ A;  3GTP B;  1A2T A;  2SNS A;  3ONA B;  5T1G A;  3R2I A;  4QB4 A;  4DK0 A;  1G2T A;  1V1P A;  1SNC A;  3H94 A;  5CV9 A;  2A6E C;  1S5C D;  3S1Q B;  2AQ1 B;  1WTP A;  1DZ1 A;  3ERQ A;  2WAC A;  1NUC A;  2K01 A;  2E2J B;  1I4P A;  2F0T A;  4CKC A;  3TP7 A;  1QWY A;  3PO3 B;  3TME A;  3BYY B;  5C5M A;  2WIN B;  4IQZ A;  4KKT A;  3IAY A;  2KVM A;  2EOT A;  3OPO A;  3KK7 A;  3I4N B;  1D1K A;  5FLX E;  1Y1V B;  3KBX A;  5I6W A;  3OWF A;  4KY5 A;  1U4M A;  2KCC A;  2A73 B;  3AMU A;  1XX8 A;  1SND A;  4L6T B;  3CRK C;  4FXK C;  4ID6 A;  2F0F A;  3DWP A;  3A54 A;  1QE6 A;  2RVL A;  2A68 D;  1Q1B A;  5T1I A;  4NKL A;  1SMY D;  1ESR A;  4CKE A;  4DN4 M;  2NN6 I;  4F7X A;  4ZYS A;  5E4X A;  2G9H D;  2NVT B;  1EU3 A;  1BCP B;  1SXT A;  2QKI C;  5DM7 3;  2BA0 A;  3R2T A;  1GXD C;  2F0D A;  2F4I A;  4K8J A;  5CV7 A;  2PCF B;  1F9Q A;  3NK9 A;  3Q22 A;  1FNV A;  4KJO A;  1WTV A;  1A15 A;  1EYC A;  2EYH A;  4RKB A;  5CGK A;  3EFX D;  3I70 A;  5F2D A;  5G3L F;  1IKM A;  1I4H A;  4CJ1 B;  3TSS A;  4C1N I;  4V0B A;  2I46 A;  4FF2 A;  5E1F A;  4N9T A;  5C4X B;  2K32 A;  1JOR A;  2ZXO A;  1A3V A;  3T16 A;  3SVM A;  4IUQ A;  3KF8 A;  4RA8 A;  3QO2 A;  4XDX A;  3ERO A;  4OO1 I;  1LTA D;  2EPB A;  2A68 C;  1JOO A;  2XRQ D;  1ML0 D;  1Y8N B;  3KBG A;  3N6R A;  3J7A F;  4EQO A;  2XSC A;  5DAU A;  3GO5 A;  3FKI B;  3PUY A;  1CA5 A;  1EYD A;  4RFB A;  1STG A;  4IAL A;  4HMJ A;  3T4A C;  2DN8 A;  1Q90 A;  3NTH A;  1H9M A;  1L0X B;  4ABN A;  1PTO B;  3D3R A;  3SHL A;  4LAA A;  3QWN A;  1TT2 A;  2EDG A;  4JK1 C;  2K5W A;  1EFI D;  1S5E D;  4C3I B;  1EU4 A;  3P1H A;  2KCN A;  4A3K B;  3VYR A;  1IW7 D;  3GTM B;  1XTC D;  3CU7 A;  2NVQ B;  1Y69 U;  4QUC A;  3GTG B;  1STY A;  3J7Y W;  2MPM A;  3D8G A;  2PNR C;  4WOR A;  1E2Z A;  5ELD A;  2PMZ B;  1WTQ A;  2RQX A;  5K36 G;  4C2M B;  5JPM C;  4A3B B;  1F2L A;  3OWE B;  4OL7 A;  2DNE A;  2E74 C;  5JEA J;  2K5D A;  1PZJ D;  4ZRZ A;  4MN3 A;  1RD9 D;  1EEI D;  1KLU D;  2F0H A;  4IUT A;  5FKA C;  4A93 B;  3GTJ B;  3BVZ A;  3RZO B;  1M8A A;  4IFD H;  1I6V C;  2F0E A;  4BY7 B;  2K7V A;  2MP1 A;  2OT2 A;  5E3F A;  3S15 B;  3NQI A;  3ITP A;  5ELE A;  3RZD B;  3I4L A;  1B53 A;  1AN8 A;  1KTK A;  3L3O C;  3DWA A;  1B4O A;  2XWJ B;  2YU9 B;  3QJY A;  4KHZ A;  3X3N A;  2O5J C;  4IFD G;  3K5L A;  4G7O C;  1TS3 A;  5CC4 A;  1YNN D;  2RSO A;  1NAP A;  1V1O A;  3BYT B;  3S1R B;  1Q12 A;  2IJ0 A;  1IW7 C;  2ZXP A;  3FEW X;  2WP8 J;  2X69 A;  4XQN A;  1LTR D;  5I9O A;  1PTO D;  1E0B A;  1JWU D;  3RUZ A;  3J81 E;  2Z8L A;  1RDP D;  5KNB A;  3G7L A;  1PZK D;  2CHB D;  5KND A;  1S5D D;  2OF1 A;  5IGD A;  4XT1 B;  4RHR A;  1AZQ A;  3L7Z C;  3PMF A;  2PYK A;  5M5Y B;  1AFP A;  1GOZ A;  4RCO A;  4R9W A;  5C5L A;  3S14 B;  5IOD A;  3OIP A;  4TKO B;  1X3P A;  2HCI A;  3MHB A;  1STB A;  5KGU A;  1QJO A;  2F0M A;  4FVM A;  4H44 C;  4A3G B;  5CV4 A;  3BVM A;  1PRT B;  2FMC A;  2E2D C;  3SK6 A;  2SOB A;  3HOZ B;  2ZXR A;  3JAM L;  5KYL A;  1SNM A;  2H4O A;  2PW7 A;  4K6L A;  2FFK B;  1SNO A;  2PZT A;  3L9A X;  3QIA A;  1SE2 A;  1SYB A;  1TS2 A;  3W3A A;  1YNN C;  2PQE A;  3EQL C;  4FF4 A;  2F1M A;  1HHV A;  4KN7 C;  4CJ2 C;  1F77 A;  5LL6 X;  1NCV A;  2EY2 A;  2Z1C A;  4LJZ C;  1AP0 A;  1RTO A;  3PUV A;  2XVS A;  4A3M B;  1KDB A;  1F9R A;  2B2Y A;  2D9U A;  2HCC A;  3C46 A;  5JPN C;  3G6J B;  3KUP A;  3S17 B;  1F2M A;  5KNC A;  4DNR B;  1TWC B;  1LTT D;  1TWH B;  2PPB C;  2F0G A;  4C3I G;  3BDO A;  5JOB A;  3D4W A;  1WCM B;  5JJZ A;  4EQP A;  4CHT B;  1FNU A;  1SNP A;  5CBA E;  5EQ0 A;  3K6O A;  2DY8 A;  2AWO A;  3I3C A;  5KYI A;  2EVB A;  4V19 0;  1IKL A;  4RKL A;  5IGG A;  3HOU B;  3WOE A;  1TU2 B;  2LMC B;  4PNY A;  5EPJ A;  1B9N A;  4CGY B;  5J1Z A;  4ZLT F;  4CKB A;  1ILQ A;  3T13 A;  3TZU A;  4CJ0 B;  1ZXT A;  4KTA A;  1EEF D;  4X3U A;  2KHS A;  2N88 A;  3Q6S A;  3NP8 A;  1C8C A;  3NWT A;  3DEO A;  1HUM A;  1ENF A;  1YNJ D;  2AQ3 B;  4K2K A;  1EY4 A;  2I07 B;  2JA5 B;  5DM6 3;  3ZYY X;  2G9D A;  5HGT A;  1LT3 D;  4NP5 A;  5C0X I;  1ONL A;  3K58 A;  4NDX A;  1ESF A;  3LWU A;  5D65 A;  1U4R A;  1K8M A;  3C1E A;  2AWN A;  2CW0 D;  1V43 A;  2D2C C;  3I73 A;  2PO4 A;  3S1M B;  2NTT A;  3Q0A A;  4H7B A;  2EYJ A;  3VR2 A;  5FO9 B;  2RDF A;  2D62 A;  3A8K E;  3PV0 A;  5IOC A;  1R4Q B;  1XYI A;  3OMG A;  2BE5 C;  2ZT9 C;  1EY0 A;  1W6J A;  1JQY D;  1PXU A;  5K5P A;  2D5D A;  4ZAI A;  4QMG A;  3K57 A;  1TY0 A;  4C1N K;  1BXT A;  2MGS A;  3LX0 A;  2F3W A;  3BG3 A;  3NXW A;  4QCL A;  2IX0 A;  4RH6 A;  2NTS A;  2LFN A;  3K7A B;  2LS0 1;  4DXG A;  1RKN A;  3M7N A;  1CQV A;  2B2T A;  2QF7 A;  1SNQ A;  5C6A A;  1YNJ C;  5BN3 A;  4PMB A;  1B2T A;  3VYS A;  2B2W A;  3S16 B;  1LAC A;  4J6H A;  1MSH A;  4XQQ A;  2PZU A;  2LY7 A;  3D6C A;  4EQN A;  1CFM A;  2XWB B;  4KMU C;  4A3F B;  2LKV A;  1LAB A;  3NBH A;  2IX3 A;  3V96 A;  3E0J A;  5DEH A;  2Q8R E;  3CRL C;  4MIU A;  5NUC A;  2JEB I;  5EBD A;  2CW0 C;  1MD2 D;  1UNS A;  3SEB A;  2EYL A;  2J7Z A;  3AB9 A;  1EYA A;  3DUZ A;  1A6X A;  1TS4 A;  1EZ6 A;  1CI3 M;  2L0C A;  4DNT B;  2RDG A;  1RF2 D;  4U67 3;  1PFB A;  2C5C A;  3A8J E;  1GUS A;  1JC7 A;  3U9S A;  3SK4 A;  2QCP X;  1O78 A;  3IKJ A;  1XXG A;  3FPU B;  2M00 A;  3NPP A;  1PZI D;  4KHV A;  1U4P A;  2VB3 X;  4QUF A;  3HOX B;  2K04 A;  1HTL D;  1JWM D;  4KN4 C;  3E6Z X;  3HOW B;  3TBI B;  1R9T B;  1OXT A;  3K5M A;  4JBW A;  2NYZ D;  1RTN A;  5IGB A;  3VR4 A;  3HOY B;  4K5W A;  4BWG B;  1IL8 A;  2NVY B;  5EGT A;  1IYV A;  1G2S A;  5CBE E;  1STH A;  4FF3 A;  4HCS A;  1WTR A;  3J81 L;  1PFN A;  3H09 A;  3D4D A;  5C0X J;  1WD0 A;  4IFD I;  1Z7T A;  1KAA A;  3FDT A;  3NQT A;  3P75 A;  1QIL A;  3WOF A;  1K83 B;  2VB2 X;  3WDN A;  1H9J A;  2EJM A;  3Q24 A;  4K6D A;  3GV6 A;  4J8Q A;  3VA7 A;  1WTX A;  1T5X D;  3SK5 A;  2B2Y C;  1GUO A;  3PO2 B;  1OXV A;  2F03 A;  3MXN A;  5C3X A;  3NWS A;  5EKI A;  1NR2 A;  1TII D;  1HA5 A;  3X3M A;  4IUR A;  1SMY C;  1LO5 D;  4ZKC B;  2BCO A;  1ILP A;  5EKK A;  3R93 A;  1I4R A;  4ODG A;  2JA7 B;  3DHQ A;  1DXM A;  1RJT A;  3BDL A;  3FVQ A;  1SJE D;  4ME5 A;  1HQR D;  3C3L A;  3EJI A;  1FYC A;  2K1B A;  4HSV A;  2WAQ B;  5EPL A;  4F88 A;  3P7J A;  1BCP D;  4I7Z C;  1WTO A;  2F0O A;  3NHH A;  1TQO A;  3C1F A;  2K03 A;  2KOL A;  3E5S A;  2KEC A;  1SEB D;  1QB5 D;  2R3Z A;  2IL8 A;  3TN2 A;  4G4K A;  5JEA H;  4X3S A;  1KNE A;  3W2D A;  3GTQ B;  3NTK A;  2CVR A;  2K5Q A;  4XTC S;  4S3S A;  4UDU C;  1Y8P B;  1Q8I A;  2HDM A;  2HQE A;  4DAY A;  3H91 A;  2NB0 A;  2NN6 H;  1D1I A;  2XRS D;  1EY6 A;  2JE6 I;  2RDH A;  4G7H C;  4Z9C B;  4RGO S;  1QNU A;  3J7A V;  2F0I A;  2OEO A;  4A3D B;  4R8N A;  4L63 B;  2ID0 A;  1G29 1;  3RD4 A;  1GJX A;  2TMP A;  1E2W A;  2NVX B;  3HKZ B;  4FNF A;  4IUP A;  1Q1E A;  1EL0 A;  3DEP A;  4ZKB B;  2J0T D;  1HA6 A;  2ENB A;  1BR9 A;  1EQT A;  1BCP C;  2KEE A;  3PIP 3;  5FO7 B;  2EYF A;  1LTB D;  1WVL A;  1IYU A;  4M1U B;  3D4R A;  4FYD A;  5FO8 B;  1STN A;  3DM1 A;  4TSS A;  1MI2 A;  3QB3 A;  4XYO A;  1I4G A;  2TSS A;  5KRU A;  3VYU A;  1DM0 B;  2B2T C;  4OO1 H;  3SE0 A;  2B2W C;  2WKC A;  4IZ8 A;  5J39 A;  5M5X B;  5M9O A;  1HXY D;  4L8J A;  4X3T A;  5JVG 3;  1TY2 A;  2K28 A;  3SK8 A;  3TP5 A;  2L55 A;  1TS5 A;  2WII B;  4UAI A;  2Z4I A;  4G57 A;  4C3H B;  3H0G B;  3CHB D;  2A6H D;  1K8O A;  1L0Y B;  5C4J B;  3C2P A;  3OOC A;  4RCN A;  2FMM A;  3K0Y A;  1CHQ D;  1HTP A;  3ND9 A;  1I4Q A;  2Q8T A;  3IL8 A;  3KLR A;  1WD1 A;  3I90 A;  1D5X C;  5HUR A;  2RA4 A;  2RBM A;  4PMC A;  4RHS A;  2RKS A;  3S2D B;  3S9W A;  2IW3 A;  2IX1 A;  2MHV A;  2BOS A;  5I4D A;  2CQA A;  1HCZ A;  3AU7 A;  5ELC A;  3F2U A;  1D6E C;  2FHT A;  3D6W A;  4F87 A;  1Q3L A;  2EY1 A;  1Z47 A;  1I3Q B;  1PTO C;  4OGQ C;  2RSN A;  3MXU A;  1SE4 A;  3DMU A;  4FXD A;  2JP1 A;  4HCE A;  1J9O A;  4Q5V A;  2OXP A;  3EA6 A;  3BZD B;  2PW5 A;  4KY7 A;  1TR5 A;  2SNM A;  4OIK A;  3MZ5 A;  1GHJ A;  1KLG D;  2EZV A;  1D5Z C;  1EQV A;  4RWS C;  3NE5 B;  1CQF A;  3QOJ A;  4K14 A;  4RGN A;  4C56 C;  1MGS A;  2B8F A;  1BQQ T;  3MXG A;  2A6H C;  2R6G A;  1HFG A;  1HRJ A;  1ENA A;  1X32 A;  4PV1 C;  4IUV A;  2IWH A;  5C44 B;  4HAE A;  2B2U A;  1BO0 A;  4G7Z C;  4GZY C;  3H3V C;  2E2H B;  2EYM A;  1KNA A;  3LWE A;  4ZQ3 A;  1D2B A;  4IUN A;  2GA4 B;  1OO9 B;  1U9R A;  2ICE C;  3M4O B;  2HUG A;  1W6K A;  2FJ2 A;  5ISR A;  1ET6 A;  4BY1 B;  3HG9 A;  2B2V A;  3VR5 A;  2A5H A;  4FF1 A;  1GUT A;  1H9S A;  2L5T A;  1JOQ A;  2XIW A;  2A69 D;  1PRT D;  1DOL A;  4C3J B;  3NBI A;  5LL6 S;  2E76 C;  1F2Y A;  3OW7 A;  1FR3 A;  2JYO A;  4BBR B;  4XT3 B;  4A3E B;  3R8B A;  1B1Z A;  4WRD A;  2A6E D;  1G6Z A;  1ET9 A;  5D14 A;  2VXW A;  2KA7 A;  2IPK D;  1LT6 D;  3U9O A;  3GV3 A;  3GD7 A;  3MC0 B;  4DXF A;  1C4Q A;  2EY6 A;  2DY7 A;  4DF7 A;  2FIN B;  3T53 B;  5AFW A;  1V8Q A;  1OXU A;  5I9P A;  2K05 A;  3MTS A;  3FMC A;  3HEJ A;  1TWA B;  1X3Q A;  2M2L A;  2KUM A;  2N55 A;  2Q8I B;  4KJN A;  5JVH 3;  3PUX A;  1SYG A;  1SJH D;  1BOS A;  5FOB B;  2AUJ D;  3CKI B;  4MHE A;  5M5W B;  1F9P A;  1SBB B;  2XNA C;  2ICI A;  4ZK9 B;  5CMD A;  3SDZ A;  2A69 C;  4IUU A;  1Y1W B;  5BN4 A;  1H9S B;  1PRT C;  2KQ3 A;  1A3T A;  2F0K A;  1EWC A;  4M8A A;  2EY5 A;  3LNN A;  1STE A;  3T56 B;  5D3D A;  4U68 A;  2H1E A;  2WB1 B;  1PDQ A;  4N9P A;  5ELB A;  3A56 A;  4AYB B;  3KLS X;  1LTI D;  1LV9 A;  1O7Z A;  1GHK A;  4QIW B;  4HR7 B;  4KD4 A;  4ZUJ A;  3VR3 A;  5TSS A;  2B8G A;  3J80 L;  4B9X A;  1JB3 A;  1JE4 A;  2PZW A;  5A2Q L;  3K5O A;  4BA2 I;  3TDQ A;  3M7G A;  5CV6 A;  2R93 B;  3VA5 A;  3K59 A;  4ILW A;  3EVQ A;  4FP5 D;  5C3E B;  3MFY A;  1FNW A;  3I91 A;  2EJF C;  1CHP D;  5G3L D;  2BDN A;  3BVG A;  4FXG C;  1VF5 C;  2L4N A;  2MJ8 A;  1H9K A;  3P20 A;  5CYU A;  5C0X H;  2L9H A;  2NUC A;  4RAU C;  3T51 B;  4FO2 A;  1JOK A;  3RMH A;  4DA2 A;  1BF4 A;  3GP7 A;  1STA A;  1DD2 A;  1EIH A;  2F0U A;  2HDL A;  2L12 A;  2DNC A;  3BS1 A;  2JEA I;  5C0X G;  3GTO B;  1AW7 A;  1GUN A;  3IFD A;  4KV6 A;  3OSO A;  4ZUI A;  2F0N A;  1V1P B;  5EKL A;  1S5F D;  1BUV T;  3HRZ C;  4KI0 A;  2KED A;  1F2Z A;  1EY9 A;  5KEE A;  4DAV A;  3OIQ A;  4F8M A;  3HS0 C;  2JA8 B;  2Y0S B;  1FD7 D;  3BDC A;  4LMQ D;  4EGV A;  5C3W A;  3NTI A;  1IHZ A;  1HFN A;  3I8Z A;  4WFN 3;  1A3U A;  2L1B A;  1I6H B;  4HED A;  2QDB A;  2B39 A;  4C3J G;  4J1M A;  2X6L A;  1SYC A;  1T5E A;  4TQU S;  2K6A A;  3FRP B;  3MFG A;  1DOK A;  1M4V A;  2EJG C;  3PUW A;  3KLS A;  3SR1 A;  1SE3 A;  3QOL A;  4K5X A;  3A55 A;  1NSN S;  4DFA A;  2AQ2 B;  1I4X A;  1JR0 D;  1PYW D;  1VCI A;  4K8I A;  4YIJ A;  2VUM B;  5D3I B;  1HPC A;  3MVV A;  2B2U C;  2F0J A;  1CM9 A;  1G91 A;  2M9V A;  3VR6 A;  1H9R A;  2O5I C;  2EXZ A;  5DNF A;  5IIF A;  1DJR D;  4IN3 A;  4O42 A;  1UUP A;  5A35 A;  2JA6 B;  1B44 D;  4DU9 A;  1ROD A;  4DGZ A;  1VMC A;  5CV5 A;  2A74 C;  2B2V C;  3S1N B;  3D31 A;  4KK7 A;  3OHX C;  4PQX A;  2E2I B;  3MAQ A;  5COR A;  5K36 H;  3A7L A;  3DXJ C;  3R3O A;  4H13 C;  5EJW A;  3VYT A;  3I72 A;  1DOM A;  3HGB A;  4KKS A;  5J22 A;  1KAB A;  3J80 E;  5JEA G;  2B63 B;  3FPP A;  1SDF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...