1TWGH

Rna polymerase ii complexed with ctp
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II largest subunit
total genus 21
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1twgH00
2EQSA 2K5NA 4KHPQ 1H95A 3CCQA 4IFDI 3HOXH 1VQ4A 3UE1A 1Q1EA 1GM5A 2JEBI 2WB1G 1I94L 1I3QH 4NXMQ 1Q46A 4UY8C 3KFUA 2NVTH 4A3BG 4IFDJ 2Y0SE 4GN5A 3GTOH 3S15H 3GTJH 2GN5A 2OTLA 2UUBL 2QGQA 3F2CA 1IBKQ 1KRSA 2CCZA 3KJOA 1B8AA 3PO3H 5FLXc 3Q8DA 1K8GA 5LMUQ 3I4OA 2UXDL 4HJ8A 3RLFA 4DR1Q 4YCVA 1FVIA 2OTJA 2BH8A 1Q12A 4OONA 1V1QA 1N33L 3PV0A 1L2FA 4IO9A 4DR1L 2IT1A 1QZGA 3HKZE 1UE7A 3D31A 3I2ZA 3HOWG 3K7UC 1OXXK 5C3EH 1X55A 1B70B 3K8AA 2K5HA 3HOZH 4BXXG 1EQRA 3RN5A 2UXCL 3AQQA 4JI7L 5GAGC 2B3GA 3U4ZA 2JEAI 1K83H 4LF8L 1N9WA 1Z9FA 2JA5H 3PUWA 4KLKA 5IWAQ 1UE5A 4X64L 4DR7L 2WAQE 1KL9A 4HIKA 1E22A 3S17H 4BBRH 5M3FG 1GO3E 1SFOH 3JAMi 4LFAQ 3ULPA 4A3BH 4IOAA 1YEZA 1X3EA 2H5XA 1X54A 3AYHB 4HJ5A 3A0JA 4DUYL 3NEMA 5JJKA 1TWHH 3PUXA 4O0AA 3S2HH 1VQIA 2D0OA 4DV6Q 3PSIA 1IBLQ 1N36Q 4L5RC 2B29A 1E3PA 1NMFA 2XTIA 2ZJPA 1XTDA 2V1CC 3S1QH 3A5UA 4JYAL 1E1TA 1JJCB 2A1AA 1YHAA 3STBC 3TEHB 1LUZA 3PCOB 2F52A 4LFCL 1YIJA 1EUJA 2F4VQ 3S14H 3FKIG 4GNXB 5AJ3Q 4B3MQ 2JA7H 3S2DH 4Y52H 1A63A 3KF6A 1WCMH 1LM0A 1EQQA 1OXUA 2K4KA 4JI3Q 2QA4A 1K9MC 2VQFQ 3KOJA 4JI5L 4LF5L 3I4NH 1E1OA 2CFMA 5C0XI 1TWCH 1WOCA 2VUMG 4DR3L 2B63H 1J5EL 5FLMG 4LUOA 4X65Q 3CPWA 4X66L 1Y1VH 5LMUL 1HR0W 4DV2L 1SE8A 4A3LH 4A3GH 1J6QA 3K81C 1OXVA 2IHEA 4PG3A 2OCEA 4YY3Q 4HJ9A 2NZOA 3PO3G 3PO2G 4JI2Q 2F3IA 5M3MG 1HNWQ 1UE6A 3HOUH 4A93G 4R4TA 2Z6KC 1OXTA 2NN6I 1HNWL 1PYBA 2ZTEA 2R6GA 3M4PA 5GROA 4HIDA 4PZ7A 4BA2I 1EIFA 4DK6C 4QY7A 4JI1L 4R4CA 3PO2H 4BXXH 1O7IA 3CCEA 3L0OA 2OQ0A 1C0AA 4X6AH 4LF4Q 5GQOA 4PMWA 2MO0A 2PQAB 1AE3A 1C9OA 5C0XJ 4GN4B 2VQFL 4JV5Q 2NN6G 2HIXA 2JA6H 4GOPB 1EFWA 2VUMH 4JV5L 2E2JH 4Y7NH 1Q81C 1VQGA 3DM3A 4C3JH 4X66Q 3F1ZA 5HY6A 1VQEA 4C3IH 4A3LG 1P16A 4BY1G 3H3VI 3K0XA 4A93H 1D8LA 4RG1A 4JYAQ 2YTYA 1L1OA 4MTNA 1V9PA 1ASYA 1CKNB 1PVOA 2WB1E 1K3RA 3PGZA 4HIMA 4IOCA 1JJ2A 1PH5A 4TVAB 1VQJA 2OQKA 3U50C 3RR5A 3UDXA 3PUYA 2C35B 2I5HA 1HZ9A 1FGUA 2GVAA 3M9BA 4GLAC 1XPOA 1R9TH 5C0XG 3GTPH 1VQAA 4JC0A 4LF8Q 3GD7A 2B63G 4EX5A 1A8VA 2D62A 3J80c 1XNQQ 3KDFB 3HKSA 2DUDA 1PH6A 4LUZA 1L0WA 4R4QA 2CWPA 3UDFA 5BR8L 3H0GG 5GAHC 4A3EG 1PHJA 1IBML 2ZJQA 2ES2A 4QQBX 4DUYQ 3GTQH 1LTLA 1X6OA 5IY0A 3CC7A 4HJAA 3J7A5 5M3MH 2N78A 1VQOA 4WJ4A 4IFDG 2YV5A 5E7NA 4FDBA 1PYSB 4IJHA 3CCJA 4A75A 4AQYQ 2UUBQ 3HOYH 1EOVA 1WI5A 1VQ8A 3S1RH 4UP7A 1UWVA 3HOVG 4JBMA 1HR0L 2PI2E 3J81j 2ID0A 2R7ZH 3TREA 1YHQA 1PH3A 4LFCQ 4UPAA 1CSQA 1Q86C 1KHIA 1M1KC 3WWVA 4B3ML 1Y14B 1SR3A 1JB7A 4DR6L 2RHQB 4OXPA 5J3BA 2ZM6L 1UE1A 2KENA 4AYBE 1HNXQ 4IJLA 4P71A 4DR6Q 3I55A 4JOIC 4BA1I 2NVYH 4C2MH 2AMCB 3A74A 1OTCA 5M5WH 3TS0A 4POGA 4BBRG 5IYCH 1K8AC 4JI5Q 4LF5Q 1SN8A 4DR2Q 5JJLA 1JE5A 2XGTA 4DPGA 2BH2A 4NPSA 3PF5A 4DR2L 3PF4A 1VQMA 1SROA 4JOIA 5LMNL 3UDGA 1VQLA 3S16H 4YCWA 1PV4A 4LFBL 1HZAA 4PZ6A 3PIOA 4JI2L 5K36G 2PI2A 5FJ8G 3BJUA 5HGQA 4OO1G 2EXDA 1GD7A 2VZAA 3L2PA 1IXRA 3SGIA 3PUZA 4DK3C 3GTKH 1Y1VG 1EYGA 4R4IA 4AIMA 4DV7Q 5C44G 1X65A 3D0FA 4AQYL 2I0QA 4GKKL 5C4XH 3FP9A 1EWIA 3S1NH 4LWCA 1SRUA 4LF9Q 3HOVH 4GKKQ 3F8TA 3CCLA 4IPHA 2PNHA 1A0IA 1YZ6A 2RCNA 4A3CG 1VQ7A 4A3DG 2R7FA 4AYBG 4X62L 4LF4L 3M4OH 1GKHA 4XTCS 2YTVA 4LF7Q 4O2DA 2Z0SA 3LGJA 2KBNA 2Q2HA 5IYBH 5IYCG 3T1YL 1S40A 1XPRA 4K0KL 2MFIA 4MZ9A 2JQOA 3RN2A 3B6YA 4HIOA 2UUAL 4NXML 3KDFA 2JA9A 3CCVA 2HIVA 2RHSB 2R93H 1JJGA 2RF4A 1VQBA 2YYZA 2AHOB 2N49A 5C44H 2ALYB 2UUAQ 5JEAG 2VQEL 2K50A 2KCMA 1PH7A 2PQAA 1SMXA 1KC8C 2R7DA 1QVFA 5IP7G 4A3IG 3J80i 2E5LQ 3G48A 1JT8A 1XMOL 5FJ8H 4IPDA 4A3KH 2PMZE 1IL2A 1HJPA 3PIPA 2R92H 4P72A 3CF5A 3MEFA 3PUVA 3BU2A 3CP0A 5IP9G 1N8RC 3CPFA 5ELNA 4DV1Q 3NELA 4H02A 5ELOA 1ASZA 4JI7Q 1I5FA 2ZM6Q 4APVA 5GAEC 4RMFA 2UUCL 1YJ9A 3G6EA 4DR7Q 1XJVA 1NY4A 2Q2IA 3HOUG 1KIXA 3M7NA 2UXCQ 4LF9L 1D7QA 4JI4L 1PFSA 2CWAA 3CQZH 3G71A 4DV4Q 1VQDA 2CQOA 4A3EH 1VQPA 1HNZL 1PH9A 4JI6Q 1N32Q 5IP9H 4EQ5A 4JI4Q 4LFAL 3DLLA 3H3VH 2VY3A 4UP8A 2LSSA 3HOZG 5M5XH 2YTXA 3T1HQ 1Q7YC 1S3OA 4NXNQ 1RL2A 4UP9A 4XIGS 5IT9c 4BY7H 2UXBQ 4GNXC 1YNXA 2NVQH 3NENA 1X3FA 3HFZB 2E2HH 1QVCA 3J81i 4BBSH 1I94Q 2MNAA 3OTOQ 2NVXH 4OWWB 4TQUS 2JA7G 1FL0A 2UXDQ 1QUQA 4GNXA 1VS0A 1XNRQ 1NE3A 4DV6L 4OWTB 1IBLL 2UU9Q 1M90C 1RIPA 3ZJYC 2IX1A 4L5TA 4LF6L 1G291 4A3DH 1CUKA 4R1JA 1LYLA 3KLWA 4DR5Q 2WFWA 3F2BA 4LF6Q 3W1BA 3HOXG 2K14A 1N34L 1NJIC 3EIVA 5C4JH 2WAQG 1V43A 4JBJA 1NTGA 2MQHA 3GDEA 3JC66 1HNXL 3K80C 3CW2C 4DR3Q 1EIYB 4QGUA 4ME3A 2N8NA 4R4OA 1VQNA 1HH2P 4JCVE 5GADC 2VW9A 1A62A 2L15A 2E8GA 4OO1I 3T1HL 4P74A 4A3MG 5BR8Q 2Z6KA 1PH1A 4DAMA 4L5QA 5LMNQ 4DR4L 3CMEA 1G6PA 1KAWA 4LFBQ 4DV3Q 2JA5G 1Q1BA 1VQFA 4A3CH 2A8VA 3RLNA 2YU9H 1MJEA 2UUCQ 1YVCA 1IZ6A 1K73C 3CC4A 2JA6G 2IHFA 1MKHA 4LNQA 1XNRL 5IYDH 1TWAH 4GN3B 4A4IA 2AKWB 3J7ZC 3CCRA 4X62Q 1N32L 4GOPC 1OXSC 3J81c 1YJNA 1W2BA 3GO5A 3CC2A 4B3RL 1I6HH 3E9IA 1X56A 4LF7L 4KHZA 2Y0SG 3BZCA 2UXBL 4YWMA 4DUZL 2ZTDA 2IX0A 1KQSA 1WCMG 2VS1A 4GKJQ 2MO1A 1J5EQ 1Q8KA 1SLJA 4A3JG 2GVBA 4DAYB 5H1SE 1TWFH 1TWGH 3JAMc 1CSPA 1K0RA 2JK8A 4IPGA 1L1OC 4QIWE 4A3MH 3KF8B 4IPCA 2Q2UA 1E24A 1WYDA 4BBSG 1XMOQ 2HT1A 3ER0A 3CAMA 2DGYA 4BY7G 2KCTA 3KYHC 1VQ6A 3OYYA 5IE8A 5LMNW 3CD6A 2LXKA 1N34Q 5IP7H 4A3IH 1XMQL 2OWOA 3AFQA 4YY3L 1PH2A 3GTGH 1U5KA 5EAYA 2ATWA 1HNZQ 4P73A 2BA1A 3KJPA 2HQLA 4POFA 4YHHQ 1PH4A 2JA8G 1QZHA 3CCUA 4KHPL 3RLOA 5M3FH 4YWKA 4JI6L 4WJ3M 3ICEA 3L7ZC 2EIFA 1IYJB 3TQYA 1JMCA 1XNQL 1YJWA 1S72A 2VNUD 4A76A 1DGSA 4NXNL 1Y1WH 2KHJA 2LXJA 1YITA 1FJGQ 3AEVA 3VDYA 4DV3L 5DLQE 3M85A 4DV0L 4AH6A 4GLXA 1VQ5A 4JI8L 3IRBA 3I7FA 4LW1A 3G4SA 4DV0Q 3RNUA 1IBKL 4B3TL 4P75A 1KRTA 3ULLA 4JBKA 4QL5A 4OX9L 3GTLH 3OTOL 1C7YA 2QEXA 1VQHA 2VL6A 2D0PA 3ULJA 4C3HH 1YHBA 5JEAJ 3U4VA 1PA6A 3EBEA 3H15A 4JI0L 4OX9Q 1B7YB 1QVGA 3ERSX 2UU9L 3I4NG 3HOYG 1UEBA 2FXQA 4GLVB 3W5OA 5IYBG 2F4VL 1Z47A 3M4QA 2I5MX 4DR5L 1NMGA 1MJCA 2ZTCA 4B3RQ 1AH9A 1G51A 4BY1H 4JG2A 3MXNB 1YI2A 1Q82C 3KF6B 1VQKA 1NBWA 5IWAL 2CKZB 1W3SA 5C3EG 3OW2A 3W1GA 1WFQA 4A3KG 3E0EA 4J15A 4X65L 4PZ8A 2K5VA 3RZDH 1IBMQ 3A5ZB 3CCMA 5IYDG 3FHWA 3F2DA 1FJGL 2K52A 3EN2A 2KHIA 2JE6I 2BA0A 5FLMH 4DR4Q 3M3YH 3CCSA 1AE2A 4LUVA 1KD1C 4JI8Q 1XMQQ 2IY5B 3CMAA 4B3SQ 3RZOH 4DV5Q 4L5SA 1MIUA 1CKOA 4A3JH 4B3SL 1HR0Q 4JI0Q 1BBWA 4QJFA 1U0LA 4YCUA 1CKMA 4GS3A 3S24A 3E9HA 1X9NA 2I5LX 1L1OB 1N36L 4JI1Q 3NBHB 1N33Q 4OWXB 2Q2TA 1X3GA 4DNIA 3T1YQ 1TXYA 1YBYA 5AJ3L 2ZJRA 2R92G 4DUZQ 2K75A 4A3FH 1BVSA 4YWLA 2AWOA 5M5YH 4GKJL 2NZHA 3HOWH 3S1MH 3U58A 1BBUA 3BZKA 3STBD 4DKAC 3CXCA 4K0KQ 2R7ZG 2JJQA 4MNOA 1I50H 3K7AH 3I4MH 1HZCA 4JI3L 4A3FG 1CKNA 4KI0A 4B3TQ 3TRZA 1Y1WG 1E7ZA 1P8LA 4JBWA 2VQEQ 4DV2Q 2ASBA 1XPUA 3UDIA 2N3SA 2E5LL 1KXLA 4NB3A 1GVPA 3FKIH 4DV1L 1VQ9A 1VCIA 4HJ7A 2JA8H 3H0GH 3TS2A 3GTMH 4GOPA 4DV7L 3I56A 4ALPA 2HHHL 2AWNA 4DV5L 1VQCA 3HKZG 2WP8J 2E2IH 4A3GG 3I4MG 2HHHQ 2A19A 5C4XG 1PH8A 1QUQB 3UE0A 4DV4L 5JJIA 1HZBA 1BKBA 4YHHL 3AFPA 1T9HA 1WJJA 4X64Q 2R93G
chains in the Genus database with same CATH superfamily
3BYTB 1LACA 3CCQA 2SNSA 3N6RA 1VQ4A 1GM5A 1CZGA 2JEBI 5G3LF 4DFAA 1I94L 4A3BG 1QILA 1FYCA 3GTOH 3GTJH 4OL7A 3OOCA 2OTLA 2CW0C 3F2CA 1B8AA 2UXDL 5I4DA 3I4OA 2E2DC 3RLFA 5KGUA 1FVIA 1LTRD 2BH8A 3LX0A 3BG3A 1N33L 3D4WA 5EBCA 2JA8B 5C3EH 2NB0A 3FPUB 3HOZH 1EQRA 1D5ZC 3AQQA 1G2SA 1R4PB 5GAGC 4DNTB 1DONA 1K83H 2XVSA 3BS1A 4CHTB 2JA5H 4KLKA 2N88A 4DR7L 4A3LH 1KL9A 4BBRH 1SFOH 1YEZA 5I6YA 3A0JA 2F0QA 4RFBA 2IW3A 3NEMA 1LTID 3ITPA 1MGSA 1ILPA 2D0OA 4L5RC 1XTDA 3A5UA 2A1AA 2PW5A 3E5SA 1YIJA 4LFCL 2F4VQ 3H3VC 3S14H 1ET9A 5AJ3Q 4B3MQ 1Y8OB 4IALA 3TBIB 4JI3Q 1OXUA 1TVXA 4JI5L 4LF5L 1HRJA 3I4NH 5C0XI 1WOCA 5FLXE 2JA5B 1TS2A 3U9SA 2X6LA 3MFGA 2IHEA 3S2DB 4JPBW 3PO2G 4OIJA 2NN6I 1PYBA 1SNMA 2PZUA 3L3OC 4R4CA 3PO2H 1O7IA 3L0OA 1LT5D 3SK8A 2EVBA 4PMWA 1I6VC 3J81L 3FVQA 3J7AF 1S5CD 1C9OA 4MTKA 4GN4B 1U4PA 4TSSA 2E2JH 1PTOB 5JOBA 3MXGA 2Z4HA 1VQEA 1P16A 1F9PA 1H9KA 4A93H 1D8LA 4RG1A 5HURA 1V9PA 1ASYA 1CKNB 4ZUJA 2WB1E 1K3RA 4TVAB 1VQJA 3UDXA 3PUYA 2I5HA 2GVAA 2A69D 5C0XG 1VQAA 4JC0A 1DD2A 2YU9B 1XNQQ 3NTIA 2CWPA 1PHJA 1IBML 2ZJQA 1B3QA 2JXMB 1LTLA 2KA7A 3J7A5 2N78A 2R61A 4AQYQ 1VQ8A 2BDNA 1F77A 3X3MA 1PH3A 4RCNA 5AFWA 1HFGA 4XYOA 1JB7A 2EY1A 4ZCKA 4DR6L 1ESRA 2F0TA 4AYBE 1HNXQ 3KLRA 4DR6Q 4DK0A 1CQVA 2NVYH 1HA5A 4KD4A 5M5YB 1CTMA 5J39A 1IKMA 5JJLA 1JE5A 4NPSA 5CR3A 1SROA 2Z4IA 2PYKA 4C3HB 1EEFD 1PYWD 4YCWA 5D3IB 3PIOA 4JI2L 1EY5A 5JAVA 5HGQA 4OO1G 2VZAA 1O78A 4ZLTF 3SGIA 3PUZA 1M8AA 1TWCB 2ZXPA 1Y1VG 4DK3C 3J81E 3GTKH 4AIMA 5C44G 3D0FA 1ZYRD 5C4XH 3FP9A 1EWIA 1MD2D 5C5LA 4LWCA 2BOSA 3F8TA 3CCLA 2PNHA 1A2UA 3C2PA 4AYBG 5BN5A 2K6AA 4WFN3 1C8CA 3HKZB 3M4OH 1GKHA 4LF7Q 1LTAD 3Q23A 4KKTA 5IYCG 1XPRA 1Y1VB 1LO5D 2JQOA 3NUCA 3RN2A 2MP1A 3GV6A 3KDFA 1G6ZA 1D5XC 5C44H 2AHOB 2IJ0A 2ALYB 2K50A 2KCMA 2R7DA 5IP7G 4A3IG 1LT4D 1B2TA 2PMZE 2PQEA 1ET6A 3PIPA 1PXUA 4L63B 4BWGB 5IP9G 3NELA 2QKIC 4H02A 3S1RB 1PRTB 3HOUG 1KIXA 1V1PB 3LWEA 1PFSA 4DV4Q 1VQ5A 1VQDA 3K7AB 2F0VA 4A3GB 1PH9A 2KEDA 4EQ5A 3H3VH 2Q8TA 4IZ8A 5M5XH 3O13A 3NK9A 4BBSB 1ZKOA 1RL2A 4IQZA 4N8FA 4XIGS 3NWTA 1EYCA 1QVCA 3J81i 2D2CC 4A3FB 4OWWB 4KMUC 2JA7G 1FL0A 2Y0SB 2B63B 1QUQA 1VS0A 1NE3A 3MXPA 2UU9Q 4JK1C 2L4NA 4X3KA 5I2YA 3ZJYC 2IX1A 4A3DH 1LYLA 1DOMA 4DR5Q 2HCIA 3W1BA 1G8ZD 2K14A 3HOXG 1N34L 1GXDC 3EIVA 5C4JH 4XYQA 1B44D 5D65A 1LABA 1FGBD 1F2MA 4H0LC 2EYJA 3CW2C 4JVZA 3GTJB 1UAPA 1JORA 1AZQA 4R4OA 5M3MB 4G7ZC 1GUWA 1HFNA 4KN4C 1A62A 3DWQA 3T1HL 2QDBA 3DEOA 2DY8A 5LMNQ 1G6PA 5KYLA 2WKDA 2A8VA 2K7VA 2L12A 3L9AX 2YU9H 5IGFA 5C3EB 1IZ6A 4HSVA 5F2DA 1K73C 2IHFA 4LNQA 4RKLA 4QF4A 2I46A 1RDPD 1K3BC 2AKWB 5CV9A 1N32L 5J22A 3P1HA 1NCVA 3KF8A 2MPMA 1W2BA 3E9IA 4DN4M 2Y0SG 1IW7D 4YWMA 2Z9HA 4GKJQ 3HOVB 4S3SA 4FVMA 2E2IB 4A3JG 2GVBA 1NSNS 5H1SE 1TIID 3JAMc 4A3MH 3KF8B 3R2TA 4K5XA 1A3TA 2HT1A 2VXWA 3R8BA 2F0DA 1Y69U 3S1QB 1PDQA 3SK5A 5CC4A 3OYYA 4R9WA 5IE8A 3MFYA 5LMNW 3U9OA 5ISRA 4ZYSA 2OWOA 1PTOD 3AFQA 1U5KA 2RSNA 3ZYYX 2BA1A 3KJPA 5IIFA 4FXKC 1PH4A 5E3FA 3DWPA 4WJ3M 4KHPL 3RLOA 1NR4A 1EEID 3TQYA 1XNQL 4N8X1 2EYFA 4ZUIA 3KBXA 1Y1WH 2KHJA 1CK1A 3H91A 5DLQE 4DV0L 3FRPB 4GLXA 1ZXTA 3IRBA 4FXGC 2O5IC 4LW1A 3M7NA 4FF2A 2B2UA 4KD3A 2Q8IB 4FXDA 2D0PA 1YHBA 5JEAJ 3EBEA 3S9WA 1NNXA 3ERSX 4AYBB 2QCPX 4ZRZA 1E2VA 4GLVB 4CDFC 2DNEA 4B3RQ 1AH9A 1MJCA 3KF6B 2CQAA 4Q0FA 1VQKA 1NBWA 4LJZC 3GTPB 2CKZB 3T4AC 4C3JB 4DF7A 5C3EG 3W1GA 4A3KG 4X65L 3W2DA 5EJWA 1QJOA 2RQXA 3NP8A 2EJFC 3P75A 4LUVA 1XMQQ 3DXJC 4B3SQ 2R93B 5IGGA 4B3SL 1HR0Q 1OO9B 1BBWA 4YCUA 3DM1A 4GS3A 3HOZB 4MIUA 4WJWA 2EYLA 1ILQA 3A8KE 4DNIA 1YBYA 4O42A 5AJ3L 1BO0A 2K75A 3OW7A 4A3FH 4FYDA 4UHVA 2NZHA 3HOWH 3U58A 4DKAC 3MXNA 3CXCA 3CQZB 3I4MH 4JI3L 4A3FG 1WTVA 1P8LA 2VQEQ 3UDIA 1LT6D 3X3NA 2PW7A 1VQ9A 1BXTA 2E2JB 3TP5A 3IFDA 3DUZA 3I56A 3JAME 1D1KA 4DAPA 2HHHL 2AWNA 4ILWA 2NVTB 4OELB 4K5WA 3V96A 2X6GA 4WORA 2F0NA 2B2VC 3UE0A 2F0GA 4NW2A 2EJGC 1K8OA 4DR7Q 2EY2A 1ESFA 4YIJA 5J1ZA 1MHWC 5FKAC 1PFNA 4NMZA 1A15A 1I3QH 4QUCA 4RWSC 2NVTH 4IUTA 3BVGA 1IBKQ 1KRSA 3HG9A 3IL8A 3PO3H 5LMUQ 2NVXB 4YCVA 2RBMA 1L2FA 1PZJD 3K7UC 1Y8PB 1X55A 1B70B 3K8AA 2K5HA 3HEJA 1HQMC 2UXCL 2JEAI 2LS01 5C6AA 3PO3B 3VR4A 2SEBD 1UE5A 2AUJD 1RKNA 3H6MA 4HIKA 1E22A 1GO3E 2DNCA 3NTKA 4LFAQ 4IOAA 3HZXA 4HR7B 1X54A 1EIGA 3AYHB 2A5HA 2SDFA 4RGMA 4O0AA 1VQIA 4XQQA 3PSIA 4KKSA 2XRSD 1HCZA 2WV6D 5L37A 2ZJPA 4JYAL 3EJIA 1DXMA 1JJCB 3H94A 3STBC 3VR3A 4GNXB 3VA5A 1EY6A 3S2DH 4Y52H 1A63A 1EWHA 3KF6A 2FHTA 3E6ZX 1K9MC 1EY8A 3BDCA 2CFMA 3D6CA 2O4XA 1TWCH 4K2KA 3GTKB 4DR3L 3I90A 1J5EL 5FLMG 3TZUA 4KN7C 5LMUL 3AU7A 1J6QA 4B9XA 1EZ6A 2B2TC 4PG3A 4J1MA 4YY3Q 2NZOA 3PO3G 4JI2Q 1LTBD 1HNWQ 1Q8IA 2WINB 4NP5A 4K8IA 4R4TA 2Z6KC 1GHJA 2R6GA 3M4PA 1ZYRC 4BA2I 2JP1A 4QY7A 1TQOA 3KBGA 5ELEA 2NN6H 2KOLA 3KLSA 2PCFB 4LF4Q 2KQ3A 2PQAB 2K33A 5I9OA 3NSWA 1HTPA 1A3UA 1TWGB 2HIXA 1Q81C 2NWGA 1JOOA 3IKJA 3DM3A 1ML0D 3QOJA 1W6KA 2VUMB 1S5FD 3Q24A 3K0XA 4RKBA 2VB3X 1L1OA 4MTNA 3EFXD 3T56B 3EROA 3QWNA 1PH5A 2OQKA 1WTHA 3WDNA 5LL6S 3RR5A 1WTPA 4GLAC 3DHQA 1RTOA 1ENFA 2TSSA 1R9TH 3CU7A 4KY7A 1AEXA 1AN8A 1EYDA 3I4LA 4HAEA 2B63G 1ICWA 1WTRA 2JA7B 2BCOA 2HD3A 2NTTA 1Q3LA 2HUGA 3J80c 3KDFB 2DUDA 2M00A 3OPOA 4HTHA 3C3LA 2AQ3B 1TWAB 1KAAA 4FF1A 1A2TA 3H0GG 4WRDA 4BS9A 2C9OA 1B3AA 3CC7A 4N9PA 4RGOS 5EKIA 1R9TB 2YV5A 1PYSB 2N55A 3S1RH 1UWVA 1TS3A 1F9QA 4JBMA 2R7ZH 4LFCQ 3J7YW 4UPAA 1NUCA 1KHIA 4M1UB 3SHLA 1Y14B 1SR3A 2QEJC 4Z9CB 1WTXA 3SDZA 2F0OA 3I55A 4JOIC 4BA1I 2MUYA 5M5WH 3GP7A 5IYCH 2CVRA 2JA6B 4DR2Q 3GTGB 2XGTA 2BH2A 2E2HB 3PF5A 4DR2L 2WKCA 1DM0B 5LMNL 1VQLA 3HGBA 4M8AA 4R8IA 1HZAA 5K36G 2EXDA 1ENAA 1GD7A 1H9SB 3BDLA 2O5JC 2B8GA 1EYGA 1L0YB 4AQYL 1X65A 4GKKL 3S15B 3URYA 1SRUA 4GKKQ 1S5DD 1IHZA 4IPHA 1A3VA 1A0IA 1VQ7A 2SOBA 2KUMA 2RSOA 4O2DA 5D14A 2NVQB 3I91A 1F2ZA 4K0KL 4NXML 2JA9A 2HIVA 2R93H 2YYZA 2N49A 1QVFA 1BUVT 5ELFA 1SMXA 3CRLC 1YNNC 3J80i 4A3KH 3H0GB 1IL2A 4A3BB 2J4XA 1HJPA 2B2WA 3NBHA 2ZXRA 1SJHD 4P72A 2R92H 3PUVA 1GUSA 1JR0D 3CPFA 4DV1Q 1BNZA 1IKLA 5ELOA 1I5FA 2R92B 4RMFA 1YJ9A 1XJVA 2F0KA 1K83B 5KNBA 1TS4A 2UXCQ 4LF9L 4H13C 4JI4L 1KNEA 3G71A 1EFID 5E1FA 3QB3A 2LMCB 4JI6Q 4DA2A 1SNOA 2LSSA 4UP8A 2PPBC 3OIPA 2A6ED 2YTXA 3I3CA 3D4DA 5ELBA 1Q7YC 4NXNQ 2B2UC 5IT9c 4GNXC 2NVQH 2OF1A 2E2HH 4RGTA 4N9TA 3OTOQ 5COYA 1FR3A 2UXDQ 4DV6L 4K5VA 5IGEA 1V1PA 1M90C 2TMPA 3D6WA 4A3KB 2GA4B 2MHVA 1G291 4L5TA 3S14B 3KLWA 1CA5A 3F2BA 1ZEQX 4ABNA 4I7AA 2HDMA 4JBJA 2B2YC 3ND8A 1HNXL 3HOYB 1DOKA 4QGUA 1MSHA 3GTMB 3T53B 1VDZA 1D2BA 2E8GA 2QDLA 4G4KA 4P74A 4A3MG 4BY1B 4OO1I 3A8JE 2Z6KA 1PH1A 2XRQD 4L5QA 1YNJD 3CMEA 1KAWA 1I6HB 4DV3Q 2CH4W 3MA2B 3LWUA 4PMCA 4DXFA 1TY0A 3CC4A 5I2XA 2JA6G 1MKHA 4B9WA 1XNRL 5IYDH 4GN3B 2QW7A 1BBXC 2HDLA 3A7AB 5IT9E 4GOPC 1I6HH 1LTTD 1X56A 4HN7A 4LF7L 2ICIA 2ZTDA 2IX0A 1STEA 3FPPA 2VS1A 3NE5B 5DAUA 3VA7A 1Z6HA 5C3XA 1TR5A 3KLSX 1TWFH 4KY5A 4DXGA 3OIQA 2RDHA 1E24A 4BBSG 5C5MA 1I3QB 1JOQA 4BY7G 1BCPD 3KYHC 4DU9A 1HQRD 1FNWA 1PFMA 3CD6A 5IP7H 4A3IH 4FO2A 1DOLA 2ATWA 1VF7A 5CV7A 4CBVA 2HQLA 1QE6A 3RD4A 1BCPC 1FNUA 5K5PA 4YHHQ 5DM63 3HOWB 4YWKA 5M9OA 1IYJB 1YNJC 4A76A 1EZ8A 3C1FA 1EIHA 3AEVA 3M85A 1IBKL 4JBKA 4MHEA 4TKOB 3VYSA 4OX9L 4JI0L 3J80E 3D8GA 4KKUA 3HOYG 2FXQA 5IYBG 1VMPA 5A35A 3M4QA 4DR5L 1NMGA 2AQ1B 1Q82C 2D9UA 3NXWA 3BVZA 5ELDA 1LTGD 3T51B 5IWAL 1W3SA 3OW2A 1WFQA 3E0EA 1E2WA 1RJTA 1HHVA 3M3YB 5IT9L 3RZDH 1IBMQ 3A5ZB 2L9HA 1B4OA 2K52A 2EJMA 3K59A 4XDXA 3M3YH 1TWFB 2B8FA 4X3UA 1K0SA 1H9JA 3AB9A 2IY5B 3RZOH 1U4LA 3CHBD 4L5SA 1F9RA 4QB4A 4A3JH 1CHQD 3TN2A 4QJFA 4FP5D 2RKSA 1N36L 3CRKC 3T1YQ 1GUOA 4DUZQ 1XYIA 4YWLA 5M5YH 1RD9D 3G7LA 3ERQA 3S1MH 5EQ0A 1BBUA 3JAML 1I50H 1HZCA 1B9MA 1EY4A 2B2TA 2F0WA 1Y1WG 2B39A 4JBWA 5IGBA 4ZKCB 4DV2Q 1XPUA 4X3SA 3MXUA 2E5LL 1O80A 1GVPA 3MTSA 3MWYW 1QNKA 4ULLA 3S16B 4HJ7A 1SXTA 1CA6A 2A74C 1HA6A 1QG7A 5M3FB 4DV7L 4DV5L 2Z8LA 1VQCA 3VR2A 4A3GG 1CZWA 4HCEA 2A19A 2NVYB 2B2YA 5JJIA 1HZBA 1PTOH 1AZPA 4OGQC 5EPLA 4XXEA 4X64Q 2R93G 3AMUA 3MHBA 4C1NK 4KHPQ 1H95A 2A68C 3HOXH 1STAA 2LY7A 2WB1G 3HRZC 1Q46A 4UY8C 3KFUA 4IFDJ 2Y0SE 4IUPA 1KLUD 1SNCA 3S15H 3DMUA 1EWCA 2H1EA 2LFNA 4DAVA 2QGQA 2UUBL 3VR5A 2F0PA 1EOTA 2IPKD 5FLXc 1SYBA 4QUFA 4DR1Q 2XIWA 4CJ0B 5C0XH 3PV0A 4DR1L 3BZDB 4IO9A 2IT1A 3HKZE 1UE7A 3D31A 4IUNA 3HOWG 3ONAB 4L6TB 1OXXK 1I4GA 3RN5A 3N52A 4LAAA 2RVLA 3VYUA 4JI7L 2B3GA 2BDOA 4LF8L 1N9WA 1Z9FA 3PUWA 1GUGA 1PZID 3S17H 2ZT9C 5M3FG 3JAMi 3ULPA 4O1NA 3K5OA 3NWSA 2C5CA 1STYA 1BCPB 3S17B 4C3HG 4HJ5A 5JJKA 1TWHH 1DYQA 3S2HH 3NHHA 1IBLQ 1E3PA 1TWHB 3SEBA 1NMFA 2V1CC 1BOSA 3TEHB 1LUZA 3PCOB 2F52A 1I4QA 5M5XB 4CKBA 2NUCA 2JA7H 2FJ2A 1WCMH 1LM0A 2K4KA 2PNRC 2O2LD 5LL6X 2VUMG 3GTOB 4KV6A 2B63H 4LUOA 2KCCA 3CPWA 4X66L 1Y1VH 1SE8A 4A3GH 4A3EB 4F88A 4R8NA 1O7ZA 5FOBB 2K5DA 1ONLA 5M3MG 4RAUC 3HOUH 1OXTA 5GROA 4PZ7A 1EIFA 4DK6C 4JW0A 4JI1L 3D3RA 4BXXH 3CCEA 2JYOA 2OQ0A 1BCPF 5DEHA 1C0AA 4X6AH 4RHRA 4X3TA 2IWHA 2MO0A 2X69A 2VQFL 2NN6G 3K6OA 2K32A 2VUMH 2V4DA 5EKKA 4Y7NH 1VQGA 1T5EA 4A3LG 3H3VI 4ZKBB 3QG1A 4QIWB 2XWJB 4FNFA 2XN9C 3PGZA 3HS0C 1SEBD 4J6HA 1H9RA 3U50C 2C35B 3GTPH 1WTQA 3M9BA 1VMCA 3GD7A 4EX5A 5E4XA 4LK1C 1HTLD 3Q6SA 1HPCA 2D62A 3HKSA 4LUZA 1L0WA 4R4QA 3UDFA 5BR8L 5GAHC 1CQFA 4QQBX 2G9DA 4DUYQ 3GTQH 4CGYB 1X6OA 5IY0A 5KYIA 5T1IA 1E2ZA 2FMMA 5M3MH 2B2WC 3TZDA 2UUBQ 4A3JB 1EY0A 4IJHA 4UDUC 3HOVG 1UUPA 2ID0A 1YHQA 4HMIA 1C48A 4C1NI 3WWVA 4H7BA 5I6WA 5CMDA 1TKWB 5EBDA 4P71A 2AMCB 2BE5C 2NTSA 2PZTA 3VYRA 4DPGA 3PF4A 1VQMA 1CFMA 4JOIA 4IN3A 3S16H 5IGDA 4LFBL 1QOHA 3IFTA 2PI2A 5FJ8G 2KVMA 1U4MA 3BJUA 5C4ZA 3PIP3 1AW7A 3L2PA 1LT3D 1IXRA 4A3MB 4DV7Q 3S1NH 4LF9Q 3HOVH 4ZK9B 5EPKA 2RCNA 1YZ6A 3OWEB 2R7FA 3I4NB 4LF4L 4XTCS 5DM73 3LGJA 2Q2HA 1BQQT 4IUVA 2L1BA 2MFIA 1TY2A 3B6YA 1ENCA 4HIOA 5EGTA 2UUAL 3CCVA 2RHSB 5CYUA 2RF4A 2UUAQ 2EPBA 5E4WC 2VQEL 1F9SA 2K5QA 2PQAA 1KC8C 1II3A 5CORA 1F2YA 5FJ8H 2IL8A 4OEMB 3CF5A 3MEFA 4CKCA 3CP0A 3MC0B 1VF5C 1N8RC 5ELNA 2CHBD 1ASZA 4JI7Q 4APVA 1PFBA 1NY4A 2BE5D 2L55A 1D7QA 2CWAA 3CQZH 1HNZL 4A3EH 3I4MB 1N32Q 1GJXA 4RHSA 1V1OA 1TU2B 2VY3A 1BDOA 2RDFA 3PMFA 3A7LA 3I72A 5A2QL 4LMQD 3HOZG 2K1BA 1STNA 1S3OA 1TT2A 1F2LA 1SFOB 1K28A 4KY6A 1GOZA 3NENA 1WTOA 3TP7A 1KTKA 2MNAA 1EQTA 3QO2A 4TQUS 4GNXA 1XNRQ 1IBLL 5KIXA 1CUKA 2WFWA 2ICEC 3GDEA 1QWYA 3JC66 5D3DA 2F0FA 4G7HC 1EIYB 4FF3A 4ME3A 2N8NA 4DAYA 2EXZA 3GV3A 2L15A 5BR8Q 2OT2A 3K5MA 4XQJA 3WOEA 1IW7C 2DN8A 3M7GA 4EQPA 2EE1A 2JA5G 1Q1BA 1VQFA 3QJYA 3RLNA 1MJEA 2XNAC 2EOTA 1QCBD 4U673 3A54A 1TWAH 4A4IA 4X62Q 2J0TD 1OXSC 3MEHA 4K8JA 3J81c 1YJNA 3CC2A 4B3RL 1SYCA 3SE0A 2HQEA 3SR1A 4KHZA 3BZCA 2H4OA 4DUZL 1KQSA 2EZVA 1J5EQ 1SLJA 2JN4A 1B53A 5KNCA 1E0BA 4IPGA 1CSPA 1K0RA 1Z7TA 2JK8A 1SJED 2DY7A 1WYDA 4DGZA 2EYPA 3K57A 1XMOQ 2CW0D 3ER0A 3F2UA 2WACA 2LXKA 1N34Q 1XMQL 2G9HD 2EYHA 4YY3L 1PH2A 4V0BA 1STGA 4P73A 4POFA 2OEOA 3S1MB 1QZHA 3FEWX 4B08A 4JI6L 3L7ZC 2EIFA 1JMCA 1YJWA 1S72A 4NXNL 1RCVD 2EDGA 4I7ZC 1YITA 1FJGQ 3M4YA 3VDYA 1PLFA 4AH6A 4JI8L 3SXHA 1MBYA 4DV0Q 4B3TL 1A6XA 3GTLH 3ULLA 3TP6A 3OTOL 1C7YA 2QEXA 3ULJA 1WCMB 4I65A 3U4VA 4C3HH 1EQVA 2EY5A 1B7YB 3RUZA 3PIO3 3I4NG 3RZDB 3I70A 2WIIB 1J9OA 3NQTA 4JG2A 1YI2A 1JCKB 1BR9A 3NBIA 1HUNA 5FO9B 2QF7A 1S4ZA 2K04A 5C3WA 5G3LD 2AUKA 3PQIA 5KRUA 2K5VA 4OO1H 5LHY1 3CCMA 5IYDG 3FHWA 3F2DA 3I8ZA 4EQOA 4E6IA 2BA0A 3R93A 5FLMH 4DK1A 4DR4Q 1AE2A 3HP3A 4DV5Q 4IFDH 2R7ZB 1MIUA 2EYMA 4RA8A 4JI0Q 2F3VA 1U0LA 4EQNA 1CKMA 2PMZB 3S24A 3E9HA 4K6DA 1X9NA 2I5LX 1L1OB 1SE3A 5C4XB 4OWXB 1X3GA 1TXYA 2R92G 1BVSA 5TSSA 4C3IB 1EU4A 3BZKA 3STBD 5DNFA 2DJFC 3K5LA 2JJQA 4MNOA 1G91A 3K7AH 5NUCA 4B3TQ 2L5TA 3TRZA 1E7ZA 4NDXA 4A3IB 2Z6BA 2N3SA 4NB3A 1SAPA 1JOKA 1SNQA 1PRTC 2JA8H 5BN4A 1AP0A 5IGCA 4C3IG 3TS2A 3GTMH 4GOPA 4C3JG 1EYAA 2L0CA 3S2HB 4P2CB 1D5MC 2HHHQ 1KNAA 5M5WB 1QUQB 4DV4L 1BKBA 3NTHA 4YHHL 2EQSA 3KK7A 2K5NA 5K36H 4IFDI 4K2LA 3M4OB 4ZQ3A 3UE1A 1Q1EA 3W3AA 3H09A 5C44B 2F03A 1IYVA 4NXMQ 4C56C 1GUTA 4GN5A 1EY9A 3EA6A 1I50B 3S1NB 1KDCA 1LV9A 1CI3M 2GN5A 1QB5D 2CCZA 3J7AV 3KJOA 3Q8DA 1K8GA 4HJ8A 3C46A 2OTJA 4OONA 1Q12A 4PMBA 1V1QA 1O7LA 4TRDA 3MZ5A 1QZGA 4HCSA 3I2ZA 1JWSD 1SYGA 1I4RA 1DJRD 4BXXG 2MJ8A 4A93B 3U4ZA 1LLRD 5FLXL 1XXGA 5IWAQ 2F0UA 1C4QA 4X64L 2WAQE 1SYEA 4A3BH 3A55A 1X3EA 2H5XA 4IURA 3T13A 4G7OC 1UEAB 4F8MA 4DUYL 4K6LA 1NR2A 3PUXA 2LKVA 3UI2A 4DV6Q 1N36Q 2B29A 4CJ2C 1IYUA 4ODGA 2F0IA 2XTIA 3D4RA 3S1QH 1E1TA 1JE4A 1YHAA 1ICFB 1EUJA 1JWMD 3FKIG 3I73A 2A69C 4NKLA 1EQQA 4ME5A 5C4HA 2QA4A 2VQFQ 3KOJA 5KEEA 1E1OA 2OXPA 3OWFA 4X65Q 5CV4A 2L11A 1RODA 1HR0W 4DV2L 1SE4A 1WTWA 3ND9A 3K81C 5EPJA 1OXVA 3K5NA 3Q22A 2OCEA 5IOCA 2K05A 4HJ9A 2F3IA 1UE6A 4A93G 4XT3B 1HNWL 2ZTEA 4HIDA 1WD0A 1PTOF 1LTSD 1HXYD 3BYYB 3K58A 4G57A 5GQOA 5CBAE 1U4RA 3OHXC 3PO2B 2B2VA 3OSOA 1AE3A 5EKLA 5C0XJ 4JV5Q 2JA6H 4GOPB 1EFWA 4XT1B 4JV5L 2RDGA 1D1IA 2A6HC 3SK4A 4C3JH 4X66Q 3F1ZA 3E3XA 5HY6A 4C3IH 4BY1G 1QNUA 4JYAQ 1STBA 2YTYA 3EQLC 1Y8NB 1PVOA 3J80L 2E75C 2KECA 4HIMA 3QIAA 4IOCA 2M9VA 2DJGC 1JJ2A 1S5BD 1EL0A 4KJOA 5CV6A 3WOFA 1XPOA 1HZ9A 1FGUA 1S5ED 1K8MA 4LF8Q 1SNPA 1KLGD 5FO8B 1A8VA 1AFPA 2KHSA 1PH6A 1W6JA 3G6JB 3NQIA 4A3EG 2ES2A 1Y1WB 2A6EC 4HJAA 5KNDA 4WJ4A 1VQOA 5JPNC 4IFDG 5E7NA 3CCJA 4FDBA 4A75A 1MI2A 3HOYH 1EOVA 1SDFA 1WI5A 4F7XA 1EU3A 4UP7A 1HR0L 2PI2E 3J81j 3TREA 4RCOA 1WVLA 5CV8A 1CSQA 1Q86C 3TP8A 1M1KC 1BF4A 4B3ML 1B50A 1NAPA 2RHQB 4OXPA 5J3BA 2ZM6L 1SNDA 1UE1A 2KENA 4HMJA 4IJLA 4C2MH 1OTCA 1RTNA 3A74A 4POGA 3TS0A 4BBRG 1X3QA 2CH4A 1L0XB 5JVG3 1K8AC 4JI5Q 4LF5Q 1SN8A 1V8QA 3QOLA 3CKIB 2F0EA 3LNNA 5JVH3 2FFKB 3UDGA 1KDBA 1WD1A 1PV4A 4PZ6A 2I07B 3V2TA 2FMCA 2A73B 3RMHA 5FO7B 1DCZA 1MSGA 4R4IA 4BBRB 2RA4A 4OHJA 2I0QA 4CDEC 3FMCA 1PTOC 1T5XD 1I4PA 3SK6A 4A3CG 1SMYC 4A3DG 4X62L 2FINB 2WAQB 4J8QA 3HOXB 2YTVA 4RGNA 2Z0SA 2KBNA 5IYBH 1XX8A 3T1YL 1S40A 4MZ9A 3E0JA 5CGKA 2PO4A 1JJGA 1VQBA 1HUMA 5BN3A 5JEAG 1SYDA 3TMEA 1PH7A 1XWEA 2QILA 2E5LQ 3G48A 1Q90A 1XMOL 2EY6A 5IODA 1J8IA 1JT8A 4IPDA 2R3ZA 4CJ1B 1FD7D 2WB1B 2K01A 1CT1D 3VYTA 1JC7A 3BU2A 3NPPA 3P20A 3GTLB 1D6EC 2ZM6Q 5GAEC 2UUCL 3G6EA 3VR6A 2Q2IA 4IUUA 1UNSA 1SE2A 5CBEE 2CQOA 1VQPA 5IP9H 4JI4Q 4LFAL 2XSCA 3DLLA 4RH6A 1SSOA 4BY7B 3C1EA 4PV1C 1YNND 5HGTA 2E74C 2F0LA 4KTAA 3T1HQ 3KUPA 1PZKD 4UP9A 4FF4A 4BY7H 1SBBB 2UXBQ 2F0SA 1YNXA 4CDDC 1X32A 1X3FA 2PZWA 4KJNA 3HFZB 4BBSH 1O7YA 2K03A 4F87A 1I94Q 4QCLA 2NVXH 3DWAA 1M4VA 4V190 4OWTB 5CV5A 2SNMA 2Z1CA 1RIPA 3R3OA 4LF6L 2ZXOA 4R1JA 3DEPA 1STHA 4KHVA 4LF6Q 1JB3A 2RCFA 1NJIC 2WAQG 3RZOB 1V43A 5A2QE 3OMGA 1NTGA 2EYOA 2MQHA 1JQYD 3K80C 4DR3Q 3V05A 5JEAH 2KJXA 1VQNA 1HH2P 3BDOA 4JCVE 5GADC 2VW9A 1I4XA 2E76C 4HSPA 2M2LA 4DAMA 1PRTF 4ID6A 4DR4L 4LFBQ 2MGSA 4A3CH 4PNYA 2NYZD 1B1ZA 2A6HD 2UUCQ 1YVCA 3J7ZC 4HEDA 3CCRA 4EGVA 1EY7A 3SVMA 2JSOA 3Q0AA 3GO5A 1SMYD 2UXBL 1FNVA 1JWUD 2XWBB 1WCMG 4L8JA 2NZ1D 2MO1A 4ZAIA 1Q8KA 2K28A 4CKEA 4DAYB 1TWGH 3FDTA 1L1OC 4QIWE 1G2TA 4IPCA 2Q2UA 3CAMA 1PRTD 2DGYA 2KCTA 1KABA 1VQ6A 5JJZA 3GTGH 5EAYA 1HNZQ 3OMCA 3MVVA 1GUNA 2JA8G 2D5DA 5C4JB 3CCUA 5M3FH 3ICEA 1PMRA 1GHKA 1XTCD 2J7ZA 2G5DA 4XQNA 3A56A 2VNUD 4GZYC 1DGSA 2LXJA 2F4IA 4DV3L 4KK7A 1RF2D 2F3WA 1H9SA 3QR8A 1RHPA 3I7FA 3G4SA 4PQXA 3RNUA 4P75A 1KRTA 1H9MA 4QL5A 1VQHA 2VL6A 2KEEA 2F0JA 4OX9Q 1PA6A 3H15A 5JPMC 1KDAA 1QVGA 2UU9L 1UEBA 2KCNA 3W5OA 2F4VL 3BVMA 1CHPD 1Z47A 2I5MX 2ZTCA 3P7JA 1G51A 4BY1H 1CM9A 4C2MB 3MXNB 2P5ZX 5FK9C 3GQBA 4K14A 5T1GA 4J15A 2K5WA 4PZ8A 4Q5VA 4IUQA 4H44C 2VB2X 4CDCC 1FJGL 3EN2A 2KHIA 1U9RA 2JE6I 1R4QB 4QMGA 1SYFA 2AQ2B 3CCSA 1KD1C 4JI8Q 1X3PA 3CMAA 4DNRB 3K0YA 3A8IE 1CKOA 3R2IA 1DZ1A 3EVQA 3TSSA 1TS5A 4JI1Q 3NBHB 3IAYA 1N33Q 4UAIA 2Q2TA 3HOUB 3FKIB 2ZJRA 2ENBA 3T16A 2Q8RE 2AWOA 4GKJL 4K0KQ 2R7ZG 1JICA 3TDQA 1CKNA 4KI0A 4U68A 2ASBA 4MN3A 2A68D 1KXLA 1B9NA 3FKIH 4DV1L 1VCIA 4EVOA 3MAQA 3H0GH 2IX3A 2F0HA 5ELCA 4ALPA 1IL8A 2E2IH 2HCCA 2NBFA 3HKZG 2WP8J 3I4MG 3GTQB 5C4XG 5I9PA 1PH8A 1I4HA 2F1MA 2F0MA 4Y7NB 4A3DB 4OIKA 3AFPA 1T9HA 1WJJA
chains in the Genus database with same CATH topology
2EQSA 2K5NA 4KHPQ 1H95A 3CCQA 4IFDI 3HOXH 1VQ4A 3UE1A 1Q1EA 1GM5A 2JEBI 2WB1G 1I94L 1I3QH 4NXMQ 1Q46A 4UY8C 3KFUA 2NVTH 4A3BG 4IFDJ 2Y0SE 4GN5A 3GTOH 3S15H 3GTJH 2GN5A 2OTLA 2UUBL 2QGQA 3F2CA 1IBKQ 1KRSA 2CCZA 3KJOA 1B8AA 3PO3H 5FLXc 3Q8DA 1K8GA 5LMUQ 3I4OA 2UXDL 4HJ8A 3RLFA 4DR1Q 4YCVA 1FVIA 2OTJA 2BH8A 1Q12A 4OONA 1V1QA 1N33L 3PV0A 1L2FA 4IO9A 4DR1L 2IT1A 1QZGA 3HKZE 1UE7A 3D31A 3I2ZA 3HOWG 3K7UC 1OXXK 5C3EH 1X55A 1B70B 3K8AA 2K5HA 3HOZH 4BXXG 1EQRA 3RN5A 2UXCL 3AQQA 4JI7L 5GAGC 2B3GA 3U4ZA 2JEAI 1K83H 4LF8L 1N9WA 1Z9FA 2JA5H 3PUWA 4KLKA 5IWAQ 1UE5A 4X64L 4DR7L 2WAQE 1KL9A 4HIKA 1E22A 3S17H 4BBRH 5M3FG 1GO3E 1SFOH 3JAMi 4LFAQ 3ULPA 4A3BH 4IOAA 1YEZA 1X3EA 2H5XA 1X54A 3AYHB 4HJ5A 3A0JA 4DUYL 3NEMA 5JJKA 1TWHH 3PUXA 4O0AA 3S2HH 1VQIA 2D0OA 4DV6Q 3PSIA 1IBLQ 1N36Q 4L5RC 2B29A 1E3PA 1NMFA 2XTIA 2ZJPA 1XTDA 2V1CC 3S1QH 3A5UA 4JYAL 1E1TA 1JJCB 2A1AA 1YHAA 3STBC 3TEHB 1LUZA 3PCOB 2F52A 4LFCL 1YIJA 1EUJA 2F4VQ 3S14H 3FKIG 4GNXB 5AJ3Q 4B3MQ 2JA7H 3S2DH 4Y52H 1A63A 3KF6A 1WCMH 1LM0A 1EQQA 1OXUA 2K4KA 4JI3Q 2QA4A 1K9MC 2VQFQ 3KOJA 4JI5L 4LF5L 3I4NH 1E1OA 2CFMA 5C0XI 1TWCH 1WOCA 2VUMG 4DR3L 2B63H 1J5EL 5FLMG 4LUOA 4X65Q 3CPWA 4X66L 1Y1VH 5LMUL 1HR0W 4DV2L 1SE8A 4A3LH 4A3GH 1J6QA 3K81C 1OXVA 2IHEA 4PG3A 2OCEA 4YY3Q 4HJ9A 2NZOA 3PO3G 3PO2G 4JI2Q 2F3IA 5M3MG 1HNWQ 1UE6A 3HOUH 4A93G 4R4TA 2Z6KC 1OXTA 2NN6I 1HNWL 1PYBA 2ZTEA 2R6GA 3M4PA 5GROA 4HIDA 4PZ7A 4BA2I 1EIFA 4DK6C 4QY7A 4JI1L 4R4CA 3PO2H 4BXXH 1O7IA 3CCEA 3L0OA 2OQ0A 1C0AA 4X6AH 4LF4Q 5GQOA 4PMWA 2MO0A 2PQAB 1AE3A 1C9OA 5C0XJ 4GN4B 2VQFL 4JV5Q 2NN6G 2HIXA 2JA6H 4GOPB 1EFWA 2VUMH 4JV5L 2E2JH 4Y7NH 1Q81C 1VQGA 3DM3A 4C3JH 4X66Q 3F1ZA 5HY6A 1VQEA 4C3IH 4A3LG 1P16A 4BY1G 3H3VI 3K0XA 4A93H 1D8LA 4RG1A 4JYAQ 2YTYA 1L1OA 4MTNA 1V9PA 1ASYA 1CKNB 1PVOA 2WB1E 1K3RA 3PGZA 4HIMA 4IOCA 1JJ2A 1PH5A 4TVAB 1VQJA 2OQKA 3U50C 3RR5A 3UDXA 3PUYA 2C35B 2I5HA 1HZ9A 1FGUA 2GVAA 3M9BA 4GLAC 1XPOA 1R9TH 5C0XG 3GTPH 1VQAA 4JC0A 4LF8Q 3GD7A 2B63G 4EX5A 1A8VA 2D62A 3J80c 1XNQQ 3KDFB 3HKSA 2DUDA 1PH6A 4LUZA 1L0WA 4R4QA 2CWPA 3UDFA 5BR8L 3H0GG 5GAHC 4A3EG 1PHJA 1IBML 2ZJQA 2ES2A 4QQBX 4DUYQ 3GTQH 1LTLA 1X6OA 5IY0A 3CC7A 4HJAA 3J7A5 5M3MH 2N78A 1VQOA 4WJ4A 4IFDG 2YV5A 5E7NA 4FDBA 1PYSB 4IJHA 3CCJA 4A75A 4AQYQ 2UUBQ 3HOYH 1EOVA 1WI5A 1VQ8A 3S1RH 4UP7A 1UWVA 3HOVG 4JBMA 1HR0L 2PI2E 3J81j 2ID0A 2R7ZH 3TREA 1YHQA 1PH3A 4LFCQ 4UPAA 1CSQA 1Q86C 1KHIA 1M1KC 3WWVA 4B3ML 1Y14B 1SR3A 1JB7A 4DR6L 2RHQB 4OXPA 5J3BA 2ZM6L 1UE1A 2KENA 4AYBE 1HNXQ 4IJLA 4P71A 4DR6Q 3I55A 4JOIC 4BA1I 2NVYH 4C2MH 2AMCB 3A74A 1OTCA 5M5WH 3TS0A 4POGA 4BBRG 5IYCH 1K8AC 4JI5Q 4LF5Q 1SN8A 4DR2Q 5JJLA 1JE5A 2XGTA 4DPGA 2BH2A 4NPSA 3PF5A 4DR2L 3PF4A 1VQMA 1SROA 4JOIA 5LMNL 3UDGA 1VQLA 3S16H 4YCWA 1PV4A 4LFBL 1HZAA 4PZ6A 3PIOA 4JI2L 5K36G 2PI2A 5FJ8G 3BJUA 5HGQA 4OO1G 2EXDA 1GD7A 2VZAA 3L2PA 1IXRA 3SGIA 3PUZA 4DK3C 3GTKH 1Y1VG 1EYGA 4R4IA 4AIMA 4DV7Q 5C44G 1X65A 3D0FA 4AQYL 2I0QA 4GKKL 5C4XH 3FP9A 1EWIA 3S1NH 4LWCA 1SRUA 4LF9Q 3HOVH 4GKKQ 3F8TA 3CCLA 4IPHA 2PNHA 1A0IA 1YZ6A 2RCNA 4A3CG 1VQ7A 4A3DG 2R7FA 4AYBG 4X62L 4LF4L 3M4OH 1GKHA 4XTCS 2YTVA 4LF7Q 4O2DA 2Z0SA 3LGJA 2KBNA 2Q2HA 5IYBH 5IYCG 3T1YL 1S40A 1XPRA 4K0KL 2MFIA 4MZ9A 2JQOA 3RN2A 3B6YA 4HIOA 2UUAL 4NXML 3KDFA 2JA9A 3CCVA 2HIVA 2RHSB 2R93H 1JJGA 2RF4A 1VQBA 2YYZA 2AHOB 2N49A 5C44H 2ALYB 2UUAQ 5JEAG 2VQEL 2K50A 2KCMA 1PH7A 2PQAA 1SMXA 1KC8C 2R7DA 1QVFA 5IP7G 4A3IG 3J80i 2E5LQ 3G48A 1JT8A 1XMOL 5FJ8H 4IPDA 4A3KH 2PMZE 1IL2A 1HJPA 3PIPA 2R92H 4P72A 3CF5A 3MEFA 3PUVA 3BU2A 3CP0A 5IP9G 1N8RC 3CPFA 5ELNA 4DV1Q 3NELA 4H02A 5ELOA 1ASZA 4JI7Q 1I5FA 2ZM6Q 4APVA 5GAEC 4RMFA 2UUCL 1YJ9A 3G6EA 4DR7Q 1XJVA 1NY4A 2Q2IA 3HOUG 1KIXA 3M7NA 2UXCQ 4LF9L 1D7QA 4JI4L 1PFSA 2CWAA 3CQZH 3G71A 4DV4Q 1VQDA 2CQOA 4A3EH 1VQPA 1HNZL 1PH9A 4JI6Q 1N32Q 5IP9H 4EQ5A 4JI4Q 4LFAL 3DLLA 3H3VH 2VY3A 4UP8A 2LSSA 3HOZG 5M5XH 2YTXA 3T1HQ 1Q7YC 1S3OA 4NXNQ 1RL2A 4UP9A 4XIGS 5IT9c 4BY7H 2UXBQ 4GNXC 1YNXA 2NVQH 3NENA 1X3FA 3HFZB 2E2HH 1QVCA 3J81i 4BBSH 1I94Q 2MNAA 3OTOQ 2NVXH 4OWWB 4TQUS 2JA7G 1FL0A 2UXDQ 1QUQA 4GNXA 1VS0A 1XNRQ 1NE3A 4DV6L 4OWTB 1IBLL 2UU9Q 1M90C 1RIPA 3ZJYC 2IX1A 4L5TA 4LF6L 1G291 4A3DH 1CUKA 4R1JA 1LYLA 3KLWA 4DR5Q 2WFWA 3F2BA 4LF6Q 3W1BA 3HOXG 2K14A 1N34L 1NJIC 3EIVA 5C4JH 2WAQG 1V43A 4JBJA 1NTGA 2MQHA 3GDEA 3JC66 1HNXL 3K80C 3CW2C 4DR3Q 1EIYB 4QGUA 4ME3A 2N8NA 4R4OA 1VQNA 1HH2P 4JCVE 5GADC 2VW9A 1A62A 2L15A 2E8GA 4OO1I 3T1HL 4P74A 4A3MG 5BR8Q 2Z6KA 1PH1A 4DAMA 4L5QA 5LMNQ 4DR4L 3CMEA 1G6PA 1KAWA 4LFBQ 4DV3Q 2JA5G 1Q1BA 1VQFA 4A3CH 2A8VA 3RLNA 2YU9H 1MJEA 2UUCQ 1YVCA 1IZ6A 1K73C 3CC4A 2JA6G 2IHFA 1MKHA 4LNQA 1XNRL 5IYDH 1TWAH 4GN3B 4A4IA 2AKWB 3J7ZC 3CCRA 4X62Q 1N32L 4GOPC 1OXSC 3J81c 1YJNA 1W2BA 3GO5A 3CC2A 4B3RL 1I6HH 3E9IA 1X56A 4LF7L 4KHZA 2Y0SG 3BZCA 2UXBL 4YWMA 4DUZL 2ZTDA 2IX0A 1KQSA 1WCMG 2VS1A 4GKJQ 2MO1A 1J5EQ 1Q8KA 1SLJA 4A3JG 2GVBA 4DAYB 5H1SE 1TWFH 1TWGH 3JAMc 1CSPA 1K0RA 2JK8A 4IPGA 1L1OC 4QIWE 4A3MH 3KF8B 4IPCA 2Q2UA 1E24A 1WYDA 4BBSG 1XMOQ 2HT1A 3ER0A 3CAMA 2DGYA 4BY7G 2KCTA 3KYHC 1VQ6A 3OYYA 5IE8A 5LMNW 3CD6A 2LXKA 1N34Q 5IP7H 4A3IH 1XMQL 2OWOA 3AFQA 4YY3L 1PH2A 3GTGH 1U5KA 5EAYA 2ATWA 1HNZQ 4P73A 2BA1A 3KJPA 2HQLA 4POFA 4YHHQ 1PH4A 2JA8G 1QZHA 3CCUA 4KHPL 3RLOA 5M3FH 4YWKA 4JI6L 4WJ3M 3ICEA 3L7ZC 2EIFA 1IYJB 3TQYA 1JMCA 1XNQL 1YJWA 1S72A 2VNUD 4A76A 1DGSA 4NXNL 1Y1WH 2KHJA 2LXJA 1YITA 1FJGQ 3AEVA 3VDYA 4DV3L 5DLQE 3M85A 4DV0L 4AH6A 4GLXA 1VQ5A 4JI8L 3IRBA 3I7FA 4LW1A 3G4SA 4DV0Q 3RNUA 1IBKL 4B3TL 4P75A 1KRTA 3ULLA 4JBKA 4QL5A 4OX9L 3GTLH 3OTOL 1C7YA 2QEXA 1VQHA 2VL6A 2D0PA 3ULJA 4C3HH 1YHBA 5JEAJ 3U4VA 1PA6A 3EBEA 3H15A 4JI0L 4OX9Q 1B7YB 1QVGA 3ERSX 2UU9L 3I4NG 3HOYG 1UEBA 2FXQA 4GLVB 3W5OA 5IYBG 2F4VL 1Z47A 3M4QA 2I5MX 4DR5L 1NMGA 1MJCA 2ZTCA 4B3RQ 1AH9A 1G51A 4BY1H 4JG2A 3MXNB 1YI2A 1Q82C 3KF6B 1VQKA 1NBWA 5IWAL 2CKZB 1W3SA 5C3EG 3OW2A 3W1GA 1WFQA 4A3KG 3E0EA 4J15A 4X65L 4PZ8A 2K5VA 3RZDH 1IBMQ 3A5ZB 3CCMA 5IYDG 3FHWA 3F2DA 1FJGL 2K52A 3EN2A 2KHIA 2JE6I 2BA0A 5FLMH 4DR4Q 3M3YH 3CCSA 1AE2A 4LUVA 1KD1C 4JI8Q 1XMQQ 2IY5B 3CMAA 4B3SQ 3RZOH 4DV5Q 4L5SA 1MIUA 1CKOA 4A3JH 4B3SL 1HR0Q 4JI0Q 1BBWA 4QJFA 1U0LA 4YCUA 1CKMA 4GS3A 3S24A 3E9HA 1X9NA 2I5LX 1L1OB 1N36L 4JI1Q 3NBHB 1N33Q 4OWXB 2Q2TA 1X3GA 4DNIA 3T1YQ 1TXYA 1YBYA 5AJ3L 2ZJRA 2R92G 4DUZQ 2K75A 4A3FH 1BVSA 4YWLA 2AWOA 5M5YH 4GKJL 2NZHA 3HOWH 3S1MH 3U58A 1BBUA 3BZKA 3STBD 4DKAC 3CXCA 4K0KQ 2R7ZG 2JJQA 4MNOA 1I50H 3K7AH 3I4MH 1HZCA 4JI3L 4A3FG 1CKNA 4KI0A 4B3TQ 3TRZA 1Y1WG 1E7ZA 1P8LA 4JBWA 2VQEQ 4DV2Q 2ASBA 1XPUA 3UDIA 2N3SA 2E5LL 1KXLA 4NB3A 1GVPA 3FKIH 4DV1L 1VQ9A 1VCIA 4HJ7A 2JA8H 3H0GH 3TS2A 3GTMH 4GOPA 4DV7L 3I56A 4ALPA 2HHHL 2AWNA 4DV5L 1VQCA 3HKZG 2WP8J 2E2IH 4A3GG 3I4MG 2HHHQ 2A19A 5C4XG 1PH8A 1QUQB 3UE0A 4DV4L 5JJIA 1HZBA 1BKBA 4YHHL 3AFPA 1T9HA 1WJJA 4X64Q 2R93G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EQS A;  2K5N A;  4KHP Q;  1H95 A;  3CCQ A;  4IFD I;  3HOX H;  1VQ4 A;  3UE1 A;  1Q1E A;  1GM5 A;  2JEB I;  2WB1 G;  1I94 L;  1I3Q H;  4NXM Q;  1Q46 A;  4UY8 C;  3KFU A;  2NVT H;  4A3B G;  4IFD J;  2Y0S E;  4GN5 A;  3GTO H;  3S15 H;  3GTJ H;  2GN5 A;  2OTL A;  2UUB L;  2QGQ A;  3F2C A;  1IBK Q;  1KRS A;  2CCZ A;  3KJO A;  1B8A A;  3PO3 H;  5FLX c;  3Q8D A;  1K8G A;  5LMU Q;  3I4O A;  2UXD L;  4HJ8 A;  3RLF A;  4DR1 Q;  4YCV A;  1FVI A;  2OTJ A;  2BH8 A;  1Q12 A;  4OON A;  1V1Q A;  1N33 L;  3PV0 A;  1L2F A;  4IO9 A;  4DR1 L;  2IT1 A;  1QZG A;  3HKZ E;  1UE7 A;  3D31 A;  3I2Z A;  3HOW G;  3K7U C;  1OXX K;  5C3E H;  1X55 A;  1B70 B;  3K8A A;  2K5H A;  3HOZ H;  4BXX G;  1EQR A;  3RN5 A;  2UXC L;  3AQQ A;  4JI7 L;  5GAG C;  2B3G A;  3U4Z A;  2JEA I;  1K83 H;  4LF8 L;  1N9W A;  1Z9F A;  2JA5 H;  3PUW A;  4KLK A;  5IWA Q;  1UE5 A;  4X64 L;  4DR7 L;  2WAQ E;  1KL9 A;  4HIK A;  1E22 A;  3S17 H;  4BBR H;  5M3F G;  1GO3 E;  1SFO H;  3JAM i;  4LFA Q;  3ULP A;  4A3B H;  4IOA A;  1YEZ A;  1X3E A;  2H5X A;  1X54 A;  3AYH B;  4HJ5 A;  3A0J A;  4DUY L;  3NEM A;  5JJK A;  1TWH H;  3PUX A;  4O0A A;  3S2H H;  1VQI A;  2D0O A;  4DV6 Q;  3PSI A;  1IBL Q;  1N36 Q;  4L5R C;  2B29 A;  1E3P A;  1NMF A;  2XTI A;  2ZJP A;  1XTD A;  2V1C C;  3S1Q H;  3A5U A;  4JYA L;  1E1T A;  1JJC B;  2A1A A;  1YHA A;  3STB C;  3TEH B;  1LUZ A;  3PCO B;  2F52 A;  4LFC L;  1YIJ A;  1EUJ A;  2F4V Q;  3S14 H;  3FKI G;  4GNX B;  5AJ3 Q;  4B3M Q;  2JA7 H;  3S2D H;  4Y52 H;  1A63 A;  3KF6 A;  1WCM H;  1LM0 A;  1EQQ A;  1OXU A;  2K4K A;  4JI3 Q;  2QA4 A;  1K9M C;  2VQF Q;  3KOJ A;  4JI5 L;  4LF5 L;  3I4N H;  1E1O A;  2CFM A;  5C0X I;  1TWC H;  1WOC A;  2VUM G;  4DR3 L;  2B63 H;  1J5E L;  5FLM G;  4LUO A;  4X65 Q;  3CPW A;  4X66 L;  1Y1V H;  5LMU L;  1HR0 W;  4DV2 L;  1SE8 A;  4A3L H;  4A3G H;  1J6Q A;  3K81 C;  1OXV A;  2IHE A;  4PG3 A;  2OCE A;  4YY3 Q;  4HJ9 A;  2NZO A;  3PO3 G;  3PO2 G;  4JI2 Q;  2F3I A;  5M3M G;  1HNW Q;  1UE6 A;  3HOU H;  4A93 G;  4R4T A;  2Z6K C;  1OXT A;  2NN6 I;  1HNW L;  1PYB A;  2ZTE A;  2R6G A;  3M4P A;  5GRO A;  4HID A;  4PZ7 A;  4BA2 I;  1EIF A;  4DK6 C;  4QY7 A;  4JI1 L;  4R4C A;  3PO2 H;  4BXX H;  1O7I A;  3CCE A;  3L0O A;  2OQ0 A;  1C0A A;  4X6A H;  4LF4 Q;  5GQO A;  4PMW A;  2MO0 A;  2PQA B;  1AE3 A;  1C9O A;  5C0X J;  4GN4 B;  2VQF L;  4JV5 Q;  2NN6 G;  2HIX A;  2JA6 H;  4GOP B;  1EFW A;  2VUM H;  4JV5 L;  2E2J H;  4Y7N H;  1Q81 C;  1VQG A;  3DM3 A;  4C3J H;  4X66 Q;  3F1Z A;  5HY6 A;  1VQE A;  4C3I H;  4A3L G;  1P16 A;  4BY1 G;  3H3V I;  3K0X A;  4A93 H;  1D8L A;  4RG1 A;  4JYA Q;  2YTY A;  1L1O A;  4MTN A;  1V9P A;  1ASY A;  1CKN B;  1PVO A;  2WB1 E;  1K3R A;  3PGZ A;  4HIM A;  4IOC A;  1JJ2 A;  1PH5 A;  4TVA B;  1VQJ A;  2OQK A;  3U50 C;  3RR5 A;  3UDX A;  3PUY A;  2C35 B;  2I5H A;  1HZ9 A;  1FGU A;  2GVA A;  3M9B A;  4GLA C;  1XPO A;  1R9T H;  5C0X G;  3GTP H;  1VQA A;  4JC0 A;  4LF8 Q;  3GD7 A;  2B63 G;  4EX5 A;  1A8V A;  2D62 A;  3J80 c;  1XNQ Q;  3KDF B;  3HKS A;  2DUD A;  1PH6 A;  4LUZ A;  1L0W A;  4R4Q A;  2CWP A;  3UDF A;  5BR8 L;  3H0G G;  5GAH C;  4A3E G;  1PHJ A;  1IBM L;  2ZJQ A;  2ES2 A;  4QQB X;  4DUY Q;  3GTQ H;  1LTL A;  1X6O A;  5IY0 A;  3CC7 A;  4HJA A;  3J7A 5;  5M3M H;  2N78 A;  1VQO A;  4WJ4 A;  4IFD G;  2YV5 A;  5E7N A;  4FDB A;  1PYS B;  4IJH A;  3CCJ A;  4A75 A;  4AQY Q;  2UUB Q;  3HOY H;  1EOV A;  1WI5 A;  1VQ8 A;  3S1R H;  4UP7 A;  1UWV A;  3HOV G;  4JBM A;  1HR0 L;  2PI2 E;  3J81 j;  2ID0 A;  2R7Z H;  3TRE A;  1YHQ A;  1PH3 A;  4LFC Q;  4UPA A;  1CSQ A;  1Q86 C;  1KHI A;  1M1K C;  3WWV A;  4B3M L;  1Y14 B;  1SR3 A;  1JB7 A;  4DR6 L;  2RHQ B;  4OXP A;  5J3B A;  2ZM6 L;  1UE1 A;  2KEN A;  4AYB E;  1HNX Q;  4IJL A;  4P71 A;  4DR6 Q;  3I55 A;  4JOI C;  4BA1 I;  2NVY H;  4C2M H;  2AMC B;  3A74 A;  1OTC A;  5M5W H;  3TS0 A;  4POG A;  4BBR G;  5IYC H;  1K8A C;  4JI5 Q;  4LF5 Q;  1SN8 A;  4DR2 Q;  5JJL A;  1JE5 A;  2XGT A;  4DPG A;  2BH2 A;  4NPS A;  3PF5 A;  4DR2 L;  3PF4 A;  1VQM A;  1SRO A;  4JOI A;  5LMN L;  3UDG A;  1VQL A;  3S16 H;  4YCW A;  1PV4 A;  4LFB L;  1HZA A;  4PZ6 A;  3PIO A;  4JI2 L;  5K36 G;  2PI2 A;  5FJ8 G;  3BJU A;  5HGQ A;  4OO1 G;  2EXD A;  1GD7 A;  2VZA A;  3L2P A;  1IXR A;  3SGI A;  3PUZ A;  4DK3 C;  3GTK H;  1Y1V G;  1EYG A;  4R4I A;  4AIM A;  4DV7 Q;  5C44 G;  1X65 A;  3D0F A;  4AQY L;  2I0Q A;  4GKK L;  5C4X H;  3FP9 A;  1EWI A;  3S1N H;  4LWC A;  1SRU A;  4LF9 Q;  3HOV H;  4GKK Q;  3F8T A;  3CCL A;  4IPH A;  2PNH A;  1A0I A;  1YZ6 A;  2RCN A;  4A3C G;  1VQ7 A;  4A3D G;  2R7F A;  4AYB G;  4X62 L;  4LF4 L;  3M4O H;  1GKH A;  4XTC S;  2YTV A;  4LF7 Q;  4O2D A;  2Z0S A;  3LGJ A;  2KBN A;  2Q2H A;  5IYB H;  5IYC G;  3T1Y L;  1S40 A;  1XPR A;  4K0K L;  2MFI A;  4MZ9 A;  2JQO A;  3RN2 A;  3B6Y A;  4HIO A;  2UUA L;  4NXM L;  3KDF A;  2JA9 A;  3CCV A;  2HIV A;  2RHS B;  2R93 H;  1JJG A;  2RF4 A;  1VQB A;  2YYZ A;  2AHO B;  2N49 A;  5C44 H;  2ALY B;  2UUA Q;  5JEA G;  2VQE L;  2K50 A;  2KCM A;  1PH7 A;  2PQA A;  1SMX A;  1KC8 C;  2R7D A;  1QVF A;  5IP7 G;  4A3I G;  3J80 i;  2E5L Q;  3G48 A;  1JT8 A;  1XMO L;  5FJ8 H;  4IPD A;  4A3K H;  2PMZ E;  1IL2 A;  1HJP A;  3PIP A;  2R92 H;  4P72 A;  3CF5 A;  3MEF A;  3PUV A;  3BU2 A;  3CP0 A;  5IP9 G;  1N8R C;  3CPF A;  5ELN A;  4DV1 Q;  3NEL A;  4H02 A;  5ELO A;  1ASZ A;  4JI7 Q;  1I5F A;  2ZM6 Q;  4APV A;  5GAE C;  4RMF A;  2UUC L;  1YJ9 A;  3G6E A;  4DR7 Q;  1XJV A;  1NY4 A;  2Q2I A;  3HOU G;  1KIX A;  3M7N A;  2UXC Q;  4LF9 L;  1D7Q A;  4JI4 L;  1PFS A;  2CWA A;  3CQZ H;  3G71 A;  4DV4 Q;  1VQD A;  2CQO A;  4A3E H;  1VQP A;  1HNZ L;  1PH9 A;  4JI6 Q;  1N32 Q;  5IP9 H;  4EQ5 A;  4JI4 Q;  4LFA L;  3DLL A;  3H3V H;  2VY3 A;  4UP8 A;  2LSS A;  3HOZ G;  5M5X H;  2YTX A;  3T1H Q;  1Q7Y C;  1S3O A;  4NXN Q;  1RL2 A;  4UP9 A;  4XIG S;  5IT9 c;  4BY7 H;  2UXB Q;  4GNX C;  1YNX A;  2NVQ H;  3NEN A;  1X3F A;  3HFZ B;  2E2H H;  1QVC A;  3J81 i;  4BBS H;  1I94 Q;  2MNA A;  3OTO Q;  2NVX H;  4OWW B;  4TQU S;  2JA7 G;  1FL0 A;  2UXD Q;  1QUQ A;  4GNX A;  1VS0 A;  1XNR Q;  1NE3 A;  4DV6 L;  4OWT B;  1IBL L;  2UU9 Q;  1M90 C;  1RIP A;  3ZJY C;  2IX1 A;  4L5T A;  4LF6 L;  1G29 1;  4A3D H;  1CUK A;  4R1J A;  1LYL A;  3KLW A;  4DR5 Q;  2WFW A;  3F2B A;  4LF6 Q;  3W1B A;  3HOX G;  2K14 A;  1N34 L;  1NJI C;  3EIV A;  5C4J H;  2WAQ G;  1V43 A;  4JBJ A;  1NTG A;  2MQH A;  3GDE A;  3JC6 6;  1HNX L;  3K80 C;  3CW2 C;  4DR3 Q;  1EIY B;  4QGU A;  4ME3 A;  2N8N A;  4R4O A;  1VQN A;  1HH2 P;  4JCV E;  5GAD C;  2VW9 A;  1A62 A;  2L15 A;  2E8G A;  4OO1 I;  3T1H L;  4P74 A;  4A3M G;  5BR8 Q;  2Z6K A;  1PH1 A;  4DAM A;  4L5Q A;  5LMN Q;  4DR4 L;  3CME A;  1G6P A;  1KAW A;  4LFB Q;  4DV3 Q;  2JA5 G;  1Q1B A;  1VQF A;  4A3C H;  2A8V A;  3RLN A;  2YU9 H;  1MJE A;  2UUC Q;  1YVC A;  1IZ6 A;  1K73 C;  3CC4 A;  2JA6 G;  2IHF A;  1MKH A;  4LNQ A;  1XNR L;  5IYD H;  1TWA H;  4GN3 B;  4A4I A;  2AKW B;  3J7Z C;  3CCR A;  4X62 Q;  1N32 L;  4GOP C;  1OXS C;  3J81 c;  1YJN A;  1W2B A;  3GO5 A;  3CC2 A;  4B3R L;  1I6H H;  3E9I A;  1X56 A;  4LF7 L;  4KHZ A;  2Y0S G;  3BZC A;  2UXB L;  4YWM A;  4DUZ L;  2ZTD A;  2IX0 A;  1KQS A;  1WCM G;  2VS1 A;  4GKJ Q;  2MO1 A;  1J5E Q;  1Q8K A;  1SLJ A;  4A3J G;  2GVB A;  4DAY B;  5H1S E;  1TWF H;  1TWG H;  3JAM c;  1CSP A;  1K0R A;  2JK8 A;  4IPG A;  1L1O C;  4QIW E;  4A3M H;  3KF8 B;  4IPC A;  2Q2U A;  1E24 A;  1WYD A;  4BBS G;  1XMO Q;  2HT1 A;  3ER0 A;  3CAM A;  2DGY A;  4BY7 G;  2KCT A;  3KYH C;  1VQ6 A;  3OYY A;  5IE8 A;  5LMN W;  3CD6 A;  2LXK A;  1N34 Q;  5IP7 H;  4A3I H;  1XMQ L;  2OWO A;  3AFQ A;  4YY3 L;  1PH2 A;  3GTG H;  1U5K A;  5EAY A;  2ATW A;  1HNZ Q;  4P73 A;  2BA1 A;  3KJP A;  2HQL A;  4POF A;  4YHH Q;  1PH4 A;  2JA8 G;  1QZH A;  3CCU A;  4KHP L;  3RLO A;  5M3F H;  4YWK A;  4JI6 L;  4WJ3 M;  3ICE A;  3L7Z C;  2EIF A;  1IYJ B;  3TQY A;  1JMC A;  1XNQ L;  1YJW A;  1S72 A;  2VNU D;  4A76 A;  1DGS A;  4NXN L;  1Y1W H;  2KHJ A;  2LXJ A;  1YIT A;  1FJG Q;  3AEV A;  3VDY A;  4DV3 L;  5DLQ E;  3M85 A;  4DV0 L;  4AH6 A;  4GLX A;  1VQ5 A;  4JI8 L;  3IRB A;  3I7F A;  4LW1 A;  3G4S A;  4DV0 Q;  3RNU A;  1IBK L;  4B3T L;  4P75 A;  1KRT A;  3ULL A;  4JBK A;  4QL5 A;  4OX9 L;  3GTL H;  3OTO L;  1C7Y A;  2QEX A;  1VQH A;  2VL6 A;  2D0P A;  3ULJ A;  4C3H H;  1YHB A;  5JEA J;  3U4V A;  1PA6 A;  3EBE A;  3H15 A;  4JI0 L;  4OX9 Q;  1B7Y B;  1QVG A;  3ERS X;  2UU9 L;  3I4N G;  3HOY G;  1UEB A;  2FXQ A;  4GLV B;  3W5O A;  5IYB G;  2F4V L;  1Z47 A;  3M4Q A;  2I5M X;  4DR5 L;  1NMG A;  1MJC A;  2ZTC A;  4B3R Q;  1AH9 A;  1G51 A;  4BY1 H;  4JG2 A;  3MXN B;  1YI2 A;  1Q82 C;  3KF6 B;  1VQK A;  1NBW A;  5IWA L;  2CKZ B;  1W3S A;  5C3E G;  3OW2 A;  3W1G A;  1WFQ A;  4A3K G;  3E0E A;  4J15 A;  4X65 L;  4PZ8 A;  2K5V A;  3RZD H;  1IBM Q;  3A5Z B;  3CCM A;  5IYD G;  3FHW A;  3F2D A;  1FJG L;  2K52 A;  3EN2 A;  2KHI A;  2JE6 I;  2BA0 A;  5FLM H;  4DR4 Q;  3M3Y H;  3CCS A;  1AE2 A;  4LUV A;  1KD1 C;  4JI8 Q;  1XMQ Q;  2IY5 B;  3CMA A;  4B3S Q;  3RZO H;  4DV5 Q;  4L5S A;  1MIU A;  1CKO A;  4A3J H;  4B3S L;  1HR0 Q;  4JI0 Q;  1BBW A;  4QJF A;  1U0L A;  4YCU A;  1CKM A;  4GS3 A;  3S24 A;  3E9H A;  1X9N A;  2I5L X;  1L1O B;  1N36 L;  4JI1 Q;  3NBH B;  1N33 Q;  4OWX B;  2Q2T A;  1X3G A;  4DNI A;  3T1Y Q;  1TXY A;  1YBY A;  5AJ3 L;  2ZJR A;  2R92 G;  4DUZ Q;  2K75 A;  4A3F H;  1BVS A;  4YWL A;  2AWO A;  5M5Y H;  4GKJ L;  2NZH A;  3HOW H;  3S1M H;  3U58 A;  1BBU A;  3BZK A;  3STB D;  4DKA C;  3CXC A;  4K0K Q;  2R7Z G;  2JJQ A;  4MNO A;  1I50 H;  3K7A H;  3I4M H;  1HZC A;  4JI3 L;  4A3F G;  1CKN A;  4KI0 A;  4B3T Q;  3TRZ A;  1Y1W G;  1E7Z A;  1P8L A;  4JBW A;  2VQE Q;  4DV2 Q;  2ASB A;  1XPU A;  3UDI A;  2N3S A;  2E5L L;  1KXL A;  4NB3 A;  1GVP A;  3FKI H;  4DV1 L;  1VQ9 A;  1VCI A;  4HJ7 A;  2JA8 H;  3H0G H;  3TS2 A;  3GTM H;  4GOP A;  4DV7 L;  3I56 A;  4ALP A;  2HHH L;  2AWN A;  4DV5 L;  1VQC A;  3HKZ G;  2WP8 J;  2E2I H;  4A3G G;  3I4M G;  2HHH Q;  2A19 A;  5C4X G;  1PH8 A;  1QUQ B;  3UE0 A;  4DV4 L;  5JJI A;  1HZB A;  1BKB A;  4YHH L;  3AFP A;  1T9H A;  1WJJ A;  4X64 Q;  2R93 G; 
#chains in the Genus database with same CATH topology
 3BYT B;  1LAC A;  3CCQ A;  2SNS A;  3N6R A;  1VQ4 A;  1GM5 A;  1CZG A;  2JEB I;  5G3L F;  4DFA A;  1I94 L;  4A3B G;  1QIL A;  1FYC A;  3GTO H;  3GTJ H;  4OL7 A;  3OOC A;  2OTL A;  2CW0 C;  3F2C A;  1B8A A;  2UXD L;  5I4D A;  3I4O A;  2E2D C;  3RLF A;  5KGU A;  1FVI A;  1LTR D;  2BH8 A;  3LX0 A;  3BG3 A;  1N33 L;  3D4W A;  5EBC A;  2JA8 B;  5C3E H;  2NB0 A;  3FPU B;  3HOZ H;  1EQR A;  1D5Z C;  3AQQ A;  1G2S A;  1R4P B;  5GAG C;  4DNT B;  1DON A;  1K83 H;  2XVS A;  3BS1 A;  4CHT B;  2JA5 H;  4KLK A;  2N88 A;  4DR7 L;  4A3L H;  1KL9 A;  4BBR H;  1SFO H;  1YEZ A;  5I6Y A;  3A0J A;  2F0Q A;  4RFB A;  2IW3 A;  3NEM A;  1LTI D;  3ITP A;  1MGS A;  1ILP A;  2D0O A;  4L5R C;  1XTD A;  3A5U A;  2A1A A;  2PW5 A;  3E5S A;  1YIJ A;  4LFC L;  2F4V Q;  3H3V C;  3S14 H;  1ET9 A;  5AJ3 Q;  4B3M Q;  1Y8O B;  4IAL A;  3TBI B;  4JI3 Q;  1OXU A;  1TVX A;  4JI5 L;  4LF5 L;  1HRJ A;  3I4N H;  5C0X I;  1WOC A;  5FLX E;  2JA5 B;  1TS2 A;  3U9S A;  2X6L A;  3MFG A;  2IHE A;  3S2D B;  4JPB W;  3PO2 G;  4OIJ A;  2NN6 I;  1PYB A;  1SNM A;  2PZU A;  3L3O C;  4R4C A;  3PO2 H;  1O7I A;  3L0O A;  1LT5 D;  3SK8 A;  2EVB A;  4PMW A;  1I6V C;  3J81 L;  3FVQ A;  3J7A F;  1S5C D;  1C9O A;  4MTK A;  4GN4 B;  1U4P A;  4TSS A;  2E2J H;  1PTO B;  5JOB A;  3MXG A;  2Z4H A;  1VQE A;  1P16 A;  1F9P A;  1H9K A;  4A93 H;  1D8L A;  4RG1 A;  5HUR A;  1V9P A;  1ASY A;  1CKN B;  4ZUJ A;  2WB1 E;  1K3R A;  4TVA B;  1VQJ A;  3UDX A;  3PUY A;  2I5H A;  2GVA A;  2A69 D;  5C0X G;  1VQA A;  4JC0 A;  1DD2 A;  2YU9 B;  1XNQ Q;  3NTI A;  2CWP A;  1PHJ A;  1IBM L;  2ZJQ A;  1B3Q A;  2JXM B;  1LTL A;  2KA7 A;  3J7A 5;  2N78 A;  2R61 A;  4AQY Q;  1VQ8 A;  2BDN A;  1F77 A;  3X3M A;  1PH3 A;  4RCN A;  5AFW A;  1HFG A;  4XYO A;  1JB7 A;  2EY1 A;  4ZCK A;  4DR6 L;  1ESR A;  2F0T A;  4AYB E;  1HNX Q;  3KLR A;  4DR6 Q;  4DK0 A;  1CQV A;  2NVY H;  1HA5 A;  4KD4 A;  5M5Y B;  1CTM A;  5J39 A;  1IKM A;  5JJL A;  1JE5 A;  4NPS A;  5CR3 A;  1SRO A;  2Z4I A;  2PYK A;  4C3H B;  1EEF D;  1PYW D;  4YCW A;  5D3I B;  3PIO A;  4JI2 L;  1EY5 A;  5JAV A;  5HGQ A;  4OO1 G;  2VZA A;  1O78 A;  4ZLT F;  3SGI A;  3PUZ A;  1M8A A;  1TWC B;  2ZXP A;  1Y1V G;  4DK3 C;  3J81 E;  3GTK H;  4AIM A;  5C44 G;  3D0F A;  1ZYR D;  5C4X H;  3FP9 A;  1EWI A;  1MD2 D;  5C5L A;  4LWC A;  2BOS A;  3F8T A;  3CCL A;  2PNH A;  1A2U A;  3C2P A;  4AYB G;  5BN5 A;  2K6A A;  4WFN 3;  1C8C A;  3HKZ B;  3M4O H;  1GKH A;  4LF7 Q;  1LTA D;  3Q23 A;  4KKT A;  5IYC G;  1XPR A;  1Y1V B;  1LO5 D;  2JQO A;  3NUC A;  3RN2 A;  2MP1 A;  3GV6 A;  3KDF A;  1G6Z A;  1D5X C;  5C44 H;  2AHO B;  2IJ0 A;  2ALY B;  2K50 A;  2KCM A;  2R7D A;  5IP7 G;  4A3I G;  1LT4 D;  1B2T A;  2PMZ E;  2PQE A;  1ET6 A;  3PIP A;  1PXU A;  4L63 B;  4BWG B;  5IP9 G;  3NEL A;  2QKI C;  4H02 A;  3S1R B;  1PRT B;  3HOU G;  1KIX A;  1V1P B;  3LWE A;  1PFS A;  4DV4 Q;  1VQ5 A;  1VQD A;  3K7A B;  2F0V A;  4A3G B;  1PH9 A;  2KED A;  4EQ5 A;  3H3V H;  2Q8T A;  4IZ8 A;  5M5X H;  3O13 A;  3NK9 A;  4BBS B;  1ZKO A;  1RL2 A;  4IQZ A;  4N8F A;  4XIG S;  3NWT A;  1EYC A;  1QVC A;  3J81 i;  2D2C C;  4A3F B;  4OWW B;  4KMU C;  2JA7 G;  1FL0 A;  2Y0S B;  2B63 B;  1QUQ A;  1VS0 A;  1NE3 A;  3MXP A;  2UU9 Q;  4JK1 C;  2L4N A;  4X3K A;  5I2Y A;  3ZJY C;  2IX1 A;  4A3D H;  1LYL A;  1DOM A;  4DR5 Q;  2HCI A;  3W1B A;  1G8Z D;  2K14 A;  3HOX G;  1N34 L;  1GXD C;  3EIV A;  5C4J H;  4XYQ A;  1B44 D;  5D65 A;  1LAB A;  1FGB D;  1F2M A;  4H0L C;  2EYJ A;  3CW2 C;  4JVZ A;  3GTJ B;  1UAP A;  1JOR A;  1AZQ A;  4R4O A;  5M3M B;  4G7Z C;  1GUW A;  1HFN A;  4KN4 C;  1A62 A;  3DWQ A;  3T1H L;  2QDB A;  3DEO A;  2DY8 A;  5LMN Q;  1G6P A;  5KYL A;  2WKD A;  2A8V A;  2K7V A;  2L12 A;  3L9A X;  2YU9 H;  5IGF A;  5C3E B;  1IZ6 A;  4HSV A;  5F2D A;  1K73 C;  2IHF A;  4LNQ A;  4RKL A;  4QF4 A;  2I46 A;  1RDP D;  1K3B C;  2AKW B;  5CV9 A;  1N32 L;  5J22 A;  3P1H A;  1NCV A;  3KF8 A;  2MPM A;  1W2B A;  3E9I A;  4DN4 M;  2Y0S G;  1IW7 D;  4YWM A;  2Z9H A;  4GKJ Q;  3HOV B;  4S3S A;  4FVM A;  2E2I B;  4A3J G;  2GVB A;  1NSN S;  5H1S E;  1TII D;  3JAM c;  4A3M H;  3KF8 B;  3R2T A;  4K5X A;  1A3T A;  2HT1 A;  2VXW A;  3R8B A;  2F0D A;  1Y69 U;  3S1Q B;  1PDQ A;  3SK5 A;  5CC4 A;  3OYY A;  4R9W A;  5IE8 A;  3MFY A;  5LMN W;  3U9O A;  5ISR A;  4ZYS A;  2OWO A;  1PTO D;  3AFQ A;  1U5K A;  2RSN A;  3ZYY X;  2BA1 A;  3KJP A;  5IIF A;  4FXK C;  1PH4 A;  5E3F A;  3DWP A;  4WJ3 M;  4KHP L;  3RLO A;  1NR4 A;  1EEI D;  3TQY A;  1XNQ L;  4N8X 1;  2EYF A;  4ZUI A;  3KBX A;  1Y1W H;  2KHJ A;  1CK1 A;  3H91 A;  5DLQ E;  4DV0 L;  3FRP B;  4GLX A;  1ZXT A;  3IRB A;  4FXG C;  2O5I C;  4LW1 A;  3M7N A;  4FF2 A;  2B2U A;  4KD3 A;  2Q8I B;  4FXD A;  2D0P A;  1YHB A;  5JEA J;  3EBE A;  3S9W A;  1NNX A;  3ERS X;  4AYB B;  2QCP X;  4ZRZ A;  1E2V A;  4GLV B;  4CDF C;  2DNE A;  4B3R Q;  1AH9 A;  1MJC A;  3KF6 B;  2CQA A;  4Q0F A;  1VQK A;  1NBW A;  4LJZ C;  3GTP B;  2CKZ B;  3T4A C;  4C3J B;  4DF7 A;  5C3E G;  3W1G A;  4A3K G;  4X65 L;  3W2D A;  5EJW A;  1QJO A;  2RQX A;  3NP8 A;  2EJF C;  3P75 A;  4LUV A;  1XMQ Q;  3DXJ C;  4B3S Q;  2R93 B;  5IGG A;  4B3S L;  1HR0 Q;  1OO9 B;  1BBW A;  4YCU A;  3DM1 A;  4GS3 A;  3HOZ B;  4MIU A;  4WJW A;  2EYL A;  1ILQ A;  3A8K E;  4DNI A;  1YBY A;  4O42 A;  5AJ3 L;  1BO0 A;  2K75 A;  3OW7 A;  4A3F H;  4FYD A;  4UHV A;  2NZH A;  3HOW H;  3U58 A;  4DKA C;  3MXN A;  3CXC A;  3CQZ B;  3I4M H;  4JI3 L;  4A3F G;  1WTV A;  1P8L A;  2VQE Q;  3UDI A;  1LT6 D;  3X3N A;  2PW7 A;  1VQ9 A;  1BXT A;  2E2J B;  3TP5 A;  3IFD A;  3DUZ A;  3I56 A;  3JAM E;  1D1K A;  4DAP A;  2HHH L;  2AWN A;  4ILW A;  2NVT B;  4OEL B;  4K5W A;  3V96 A;  2X6G A;  4WOR A;  2F0N A;  2B2V C;  3UE0 A;  2F0G A;  4NW2 A;  2EJG C;  1K8O A;  4DR7 Q;  2EY2 A;  1ESF A;  4YIJ A;  5J1Z A;  1MHW C;  5FKA C;  1PFN A;  4NMZ A;  1A15 A;  1I3Q H;  4QUC A;  4RWS C;  2NVT H;  4IUT A;  3BVG A;  1IBK Q;  1KRS A;  3HG9 A;  3IL8 A;  3PO3 H;  5LMU Q;  2NVX B;  4YCV A;  2RBM A;  1L2F A;  1PZJ D;  3K7U C;  1Y8P B;  1X55 A;  1B70 B;  3K8A A;  2K5H A;  3HEJ A;  1HQM C;  2UXC L;  2JEA I;  2LS0 1;  5C6A A;  3PO3 B;  3VR4 A;  2SEB D;  1UE5 A;  2AUJ D;  1RKN A;  3H6M A;  4HIK A;  1E22 A;  1GO3 E;  2DNC A;  3NTK A;  4LFA Q;  4IOA A;  3HZX A;  4HR7 B;  1X54 A;  1EIG A;  3AYH B;  2A5H A;  2SDF A;  4RGM A;  4O0A A;  1VQI A;  4XQQ A;  3PSI A;  4KKS A;  2XRS D;  1HCZ A;  2WV6 D;  5L37 A;  2ZJP A;  4JYA L;  3EJI A;  1DXM A;  1JJC B;  3H94 A;  3STB C;  3VR3 A;  4GNX B;  3VA5 A;  1EY6 A;  3S2D H;  4Y52 H;  1A63 A;  1EWH A;  3KF6 A;  2FHT A;  3E6Z X;  1K9M C;  1EY8 A;  3BDC A;  2CFM A;  3D6C A;  2O4X A;  1TWC H;  4K2K A;  3GTK B;  4DR3 L;  3I90 A;  1J5E L;  5FLM G;  3TZU A;  4KN7 C;  5LMU L;  3AU7 A;  1J6Q A;  4B9X A;  1EZ6 A;  2B2T C;  4PG3 A;  4J1M A;  4YY3 Q;  2NZO A;  3PO3 G;  4JI2 Q;  1LTB D;  1HNW Q;  1Q8I A;  2WIN B;  4NP5 A;  4K8I A;  4R4T A;  2Z6K C;  1GHJ A;  2R6G A;  3M4P A;  1ZYR C;  4BA2 I;  2JP1 A;  4QY7 A;  1TQO A;  3KBG A;  5ELE A;  2NN6 H;  2KOL A;  3KLS A;  2PCF B;  4LF4 Q;  2KQ3 A;  2PQA B;  2K33 A;  5I9O A;  3NSW A;  1HTP A;  1A3U A;  1TWG B;  2HIX A;  1Q81 C;  2NWG A;  1JOO A;  3IKJ A;  3DM3 A;  1ML0 D;  3QOJ A;  1W6K A;  2VUM B;  1S5F D;  3Q24 A;  3K0X A;  4RKB A;  2VB3 X;  1L1O A;  4MTN A;  3EFX D;  3T56 B;  3ERO A;  3QWN A;  1PH5 A;  2OQK A;  1WTH A;  3WDN A;  5LL6 S;  3RR5 A;  1WTP A;  4GLA C;  3DHQ A;  1RTO A;  1ENF A;  2TSS A;  1R9T H;  3CU7 A;  4KY7 A;  1AEX A;  1AN8 A;  1EYD A;  3I4L A;  4HAE A;  2B63 G;  1ICW A;  1WTR A;  2JA7 B;  2BCO A;  2HD3 A;  2NTT A;  1Q3L A;  2HUG A;  3J80 c;  3KDF B;  2DUD A;  2M00 A;  3OPO A;  4HTH A;  3C3L A;  2AQ3 B;  1TWA B;  1KAA A;  4FF1 A;  1A2T A;  3H0G G;  4WRD A;  4BS9 A;  2C9O A;  1B3A A;  3CC7 A;  4N9P A;  4RGO S;  5EKI A;  1R9T B;  2YV5 A;  1PYS B;  2N55 A;  3S1R H;  1UWV A;  1TS3 A;  1F9Q A;  4JBM A;  2R7Z H;  4LFC Q;  3J7Y W;  4UPA A;  1NUC A;  1KHI A;  4M1U B;  3SHL A;  1Y14 B;  1SR3 A;  2QEJ C;  4Z9C B;  1WTX A;  3SDZ A;  2F0O A;  3I55 A;  4JOI C;  4BA1 I;  2MUY A;  5M5W H;  3GP7 A;  5IYC H;  2CVR A;  2JA6 B;  4DR2 Q;  3GTG B;  2XGT A;  2BH2 A;  2E2H B;  3PF5 A;  4DR2 L;  2WKC A;  1DM0 B;  5LMN L;  1VQL A;  3HGB A;  4M8A A;  4R8I A;  1HZA A;  5K36 G;  2EXD A;  1ENA A;  1GD7 A;  1H9S B;  3BDL A;  2O5J C;  2B8G A;  1EYG A;  1L0Y B;  4AQY L;  1X65 A;  4GKK L;  3S15 B;  3URY A;  1SRU A;  4GKK Q;  1S5D D;  1IHZ A;  4IPH A;  1A3V A;  1A0I A;  1VQ7 A;  2SOB A;  2KUM A;  2RSO A;  4O2D A;  5D14 A;  2NVQ B;  3I91 A;  1F2Z A;  4K0K L;  4NXM L;  2JA9 A;  2HIV A;  2R93 H;  2YYZ A;  2N49 A;  1QVF A;  1BUV T;  5ELF A;  1SMX A;  3CRL C;  1YNN C;  3J80 i;  4A3K H;  3H0G B;  1IL2 A;  4A3B B;  2J4X A;  1HJP A;  2B2W A;  3NBH A;  2ZXR A;  1SJH D;  4P72 A;  2R92 H;  3PUV A;  1GUS A;  1JR0 D;  3CPF A;  4DV1 Q;  1BNZ A;  1IKL A;  5ELO A;  1I5F A;  2R92 B;  4RMF A;  1YJ9 A;  1XJV A;  2F0K A;  1K83 B;  5KNB A;  1TS4 A;  2UXC Q;  4LF9 L;  4H13 C;  4JI4 L;  1KNE A;  3G71 A;  1EFI D;  5E1F A;  3QB3 A;  2LMC B;  4JI6 Q;  4DA2 A;  1SNO A;  2LSS A;  4UP8 A;  2PPB C;  3OIP A;  2A6E D;  2YTX A;  3I3C A;  3D4D A;  5ELB A;  1Q7Y C;  4NXN Q;  2B2U C;  5IT9 c;  4GNX C;  2NVQ H;  2OF1 A;  2E2H H;  4RGT A;  4N9T A;  3OTO Q;  5COY A;  1FR3 A;  2UXD Q;  4DV6 L;  4K5V A;  5IGE A;  1V1P A;  1M90 C;  2TMP A;  3D6W A;  4A3K B;  2GA4 B;  2MHV A;  1G29 1;  4L5T A;  3S14 B;  3KLW A;  1CA5 A;  3F2B A;  1ZEQ X;  4ABN A;  4I7A A;  2HDM A;  4JBJ A;  2B2Y C;  3ND8 A;  1HNX L;  3HOY B;  1DOK A;  4QGU A;  1MSH A;  3GTM B;  3T53 B;  1VDZ A;  1D2B A;  2E8G A;  2QDL A;  4G4K A;  4P74 A;  4A3M G;  4BY1 B;  4OO1 I;  3A8J E;  2Z6K A;  1PH1 A;  2XRQ D;  4L5Q A;  1YNJ D;  3CME A;  1KAW A;  1I6H B;  4DV3 Q;  2CH4 W;  3MA2 B;  3LWU A;  4PMC A;  4DXF A;  1TY0 A;  3CC4 A;  5I2X A;  2JA6 G;  1MKH A;  4B9W A;  1XNR L;  5IYD H;  4GN3 B;  2QW7 A;  1BBX C;  2HDL A;  3A7A B;  5IT9 E;  4GOP C;  1I6H H;  1LTT D;  1X56 A;  4HN7 A;  4LF7 L;  2ICI A;  2ZTD A;  2IX0 A;  1STE A;  3FPP A;  2VS1 A;  3NE5 B;  5DAU A;  3VA7 A;  1Z6H A;  5C3X A;  1TR5 A;  3KLS X;  1TWF H;  4KY5 A;  4DXG A;  3OIQ A;  2RDH A;  1E24 A;  4BBS G;  5C5M A;  1I3Q B;  1JOQ A;  4BY7 G;  1BCP D;  3KYH C;  4DU9 A;  1HQR D;  1FNW A;  1PFM A;  3CD6 A;  5IP7 H;  4A3I H;  4FO2 A;  1DOL A;  2ATW A;  1VF7 A;  5CV7 A;  4CBV A;  2HQL A;  1QE6 A;  3RD4 A;  1BCP C;  1FNU A;  5K5P A;  4YHH Q;  5DM6 3;  3HOW B;  4YWK A;  5M9O A;  1IYJ B;  1YNJ C;  4A76 A;  1EZ8 A;  3C1F A;  1EIH A;  3AEV A;  3M85 A;  1IBK L;  4JBK A;  4MHE A;  4TKO B;  3VYS A;  4OX9 L;  4JI0 L;  3J80 E;  3D8G A;  4KKU A;  3HOY G;  2FXQ A;  5IYB G;  1VMP A;  5A35 A;  3M4Q A;  4DR5 L;  1NMG A;  2AQ1 B;  1Q82 C;  2D9U A;  3NXW A;  3BVZ A;  5ELD A;  1LTG D;  3T51 B;  5IWA L;  1W3S A;  3OW2 A;  1WFQ A;  3E0E A;  1E2W A;  1RJT A;  1HHV A;  3M3Y B;  5IT9 L;  3RZD H;  1IBM Q;  3A5Z B;  2L9H A;  1B4O A;  2K52 A;  2EJM A;  3K59 A;  4XDX A;  3M3Y H;  1TWF B;  2B8F A;  4X3U A;  1K0S A;  1H9J A;  3AB9 A;  2IY5 B;  3RZO H;  1U4L A;  3CHB D;  4L5S A;  1F9R A;  4QB4 A;  4A3J H;  1CHQ D;  3TN2 A;  4QJF A;  4FP5 D;  2RKS A;  1N36 L;  3CRK C;  3T1Y Q;  1GUO A;  4DUZ Q;  1XYI A;  4YWL A;  5M5Y H;  1RD9 D;  3G7L A;  3ERQ A;  3S1M H;  5EQ0 A;  1BBU A;  3JAM L;  1I50 H;  1HZC A;  1B9M A;  1EY4 A;  2B2T A;  2F0W A;  1Y1W G;  2B39 A;  4JBW A;  5IGB A;  4ZKC B;  4DV2 Q;  1XPU A;  4X3S A;  3MXU A;  2E5L L;  1O80 A;  1GVP A;  3MTS A;  3MWY W;  1QNK A;  4ULL A;  3S16 B;  4HJ7 A;  1SXT A;  1CA6 A;  2A74 C;  1HA6 A;  1QG7 A;  5M3F B;  4DV7 L;  4DV5 L;  2Z8L A;  1VQC A;  3VR2 A;  4A3G G;  1CZW A;  4HCE A;  2A19 A;  2NVY B;  2B2Y A;  5JJI A;  1HZB A;  1PTO H;  1AZP A;  4OGQ C;  5EPL A;  4XXE A;  4X64 Q;  2R93 G;  3AMU A;  3MHB A;  4C1N K;  4KHP Q;  1H95 A;  2A68 C;  3HOX H;  1STA A;  2LY7 A;  2WB1 G;  3HRZ C;  1Q46 A;  4UY8 C;  3KFU A;  4IFD J;  2Y0S E;  4IUP A;  1KLU D;  1SNC A;  3S15 H;  3DMU A;  1EWC A;  2H1E A;  2LFN A;  4DAV A;  2QGQ A;  2UUB L;  3VR5 A;  2F0P A;  1EOT A;  2IPK D;  5FLX c;  1SYB A;  4QUF A;  4DR1 Q;  2XIW A;  4CJ0 B;  5C0X H;  3PV0 A;  4DR1 L;  3BZD B;  4IO9 A;  2IT1 A;  3HKZ E;  1UE7 A;  3D31 A;  4IUN A;  3HOW G;  3ONA B;  4L6T B;  1OXX K;  1I4G A;  3RN5 A;  3N52 A;  4LAA A;  2RVL A;  3VYU A;  4JI7 L;  2B3G A;  2BDO A;  4LF8 L;  1N9W A;  1Z9F A;  3PUW A;  1GUG A;  1PZI D;  3S17 H;  2ZT9 C;  5M3F G;  3JAM i;  3ULP A;  4O1N A;  3K5O A;  3NWS A;  2C5C A;  1STY A;  1BCP B;  3S17 B;  4C3H G;  4HJ5 A;  5JJK A;  1TWH H;  1DYQ A;  3S2H H;  3NHH A;  1IBL Q;  1E3P A;  1TWH B;  3SEB A;  1NMF A;  2V1C C;  1BOS A;  3TEH B;  1LUZ A;  3PCO B;  2F52 A;  1I4Q A;  5M5X B;  4CKB A;  2NUC A;  2JA7 H;  2FJ2 A;  1WCM H;  1LM0 A;  2K4K A;  2PNR C;  2O2L D;  5LL6 X;  2VUM G;  3GTO B;  4KV6 A;  2B63 H;  4LUO A;  2KCC A;  3CPW A;  4X66 L;  1Y1V H;  1SE8 A;  4A3G H;  4A3E B;  4F88 A;  4R8N A;  1O7Z A;  5FOB B;  2K5D A;  1ONL A;  5M3M G;  4RAU C;  3HOU H;  1OXT A;  5GRO A;  4PZ7 A;  1EIF A;  4DK6 C;  4JW0 A;  4JI1 L;  3D3R A;  4BXX H;  3CCE A;  2JYO A;  2OQ0 A;  1BCP F;  5DEH A;  1C0A A;  4X6A H;  4RHR A;  4X3T A;  2IWH A;  2MO0 A;  2X69 A;  2VQF L;  2NN6 G;  3K6O A;  2K32 A;  2VUM H;  2V4D A;  5EKK A;  4Y7N H;  1VQG A;  1T5E A;  4A3L G;  3H3V I;  4ZKB B;  3QG1 A;  4QIW B;  2XWJ B;  4FNF A;  2XN9 C;  3PGZ A;  3HS0 C;  1SEB D;  4J6H A;  1H9R A;  3U50 C;  2C35 B;  3GTP H;  1WTQ A;  3M9B A;  1VMC A;  3GD7 A;  4EX5 A;  5E4X A;  4LK1 C;  1HTL D;  3Q6S A;  1HPC A;  2D62 A;  3HKS A;  4LUZ A;  1L0W A;  4R4Q A;  3UDF A;  5BR8 L;  5GAH C;  1CQF A;  4QQB X;  2G9D A;  4DUY Q;  3GTQ H;  4CGY B;  1X6O A;  5IY0 A;  5KYI A;  5T1I A;  1E2Z A;  2FMM A;  5M3M H;  2B2W C;  3TZD A;  2UUB Q;  4A3J B;  1EY0 A;  4IJH A;  4UDU C;  3HOV G;  1UUP A;  2ID0 A;  1YHQ A;  4HMI A;  1C48 A;  4C1N I;  3WWV A;  4H7B A;  5I6W A;  5CMD A;  1TKW B;  5EBD A;  4P71 A;  2AMC B;  2BE5 C;  2NTS A;  2PZT A;  3VYR A;  4DPG A;  3PF4 A;  1VQM A;  1CFM A;  4JOI A;  4IN3 A;  3S16 H;  5IGD A;  4LFB L;  1QOH A;  3IFT A;  2PI2 A;  5FJ8 G;  2KVM A;  1U4M A;  3BJU A;  5C4Z A;  3PIP 3;  1AW7 A;  3L2P A;  1LT3 D;  1IXR A;  4A3M B;  4DV7 Q;  3S1N H;  4LF9 Q;  3HOV H;  4ZK9 B;  5EPK A;  2RCN A;  1YZ6 A;  3OWE B;  2R7F A;  3I4N B;  4LF4 L;  4XTC S;  5DM7 3;  3LGJ A;  2Q2H A;  1BQQ T;  4IUV A;  2L1B A;  2MFI A;  1TY2 A;  3B6Y A;  1ENC A;  4HIO A;  5EGT A;  2UUA L;  3CCV A;  2RHS B;  5CYU A;  2RF4 A;  2UUA Q;  2EPB A;  5E4W C;  2VQE L;  1F9S A;  2K5Q A;  2PQA A;  1KC8 C;  1II3 A;  5COR A;  1F2Y A;  5FJ8 H;  2IL8 A;  4OEM B;  3CF5 A;  3MEF A;  4CKC A;  3CP0 A;  3MC0 B;  1VF5 C;  1N8R C;  5ELN A;  2CHB D;  1ASZ A;  4JI7 Q;  4APV A;  1PFB A;  1NY4 A;  2BE5 D;  2L55 A;  1D7Q A;  2CWA A;  3CQZ H;  1HNZ L;  4A3E H;  3I4M B;  1N32 Q;  1GJX A;  4RHS A;  1V1O A;  1TU2 B;  2VY3 A;  1BDO A;  2RDF A;  3PMF A;  3A7L A;  3I72 A;  5A2Q L;  4LMQ D;  3HOZ G;  2K1B A;  1STN A;  1S3O A;  1TT2 A;  1F2L A;  1SFO B;  1K28 A;  4KY6 A;  1GOZ A;  3NEN A;  1WTO A;  3TP7 A;  1KTK A;  2MNA A;  1EQT A;  3QO2 A;  4TQU S;  4GNX A;  1XNR Q;  1IBL L;  5KIX A;  1CUK A;  2WFW A;  2ICE C;  3GDE A;  1QWY A;  3JC6 6;  5D3D A;  2F0F A;  4G7H C;  1EIY B;  4FF3 A;  4ME3 A;  2N8N A;  4DAY A;  2EXZ A;  3GV3 A;  2L15 A;  5BR8 Q;  2OT2 A;  3K5M A;  4XQJ A;  3WOE A;  1IW7 C;  2DN8 A;  3M7G A;  4EQP A;  2EE1 A;  2JA5 G;  1Q1B A;  1VQF A;  3QJY A;  3RLN A;  1MJE A;  2XNA C;  2EOT A;  1QCB D;  4U67 3;  3A54 A;  1TWA H;  4A4I A;  4X62 Q;  2J0T D;  1OXS C;  3MEH A;  4K8J A;  3J81 c;  1YJN A;  3CC2 A;  4B3R L;  1SYC A;  3SE0 A;  2HQE A;  3SR1 A;  4KHZ A;  3BZC A;  2H4O A;  4DUZ L;  1KQS A;  2EZV A;  1J5E Q;  1SLJ A;  2JN4 A;  1B53 A;  5KNC A;  1E0B A;  4IPG A;  1CSP A;  1K0R A;  1Z7T A;  2JK8 A;  1SJE D;  2DY7 A;  1WYD A;  4DGZ A;  2EYP A;  3K57 A;  1XMO Q;  2CW0 D;  3ER0 A;  3F2U A;  2WAC A;  2LXK A;  1N34 Q;  1XMQ L;  2G9H D;  2EYH A;  4YY3 L;  1PH2 A;  4V0B A;  1STG A;  4P73 A;  4POF A;  2OEO A;  3S1M B;  1QZH A;  3FEW X;  4B08 A;  4JI6 L;  3L7Z C;  2EIF A;  1JMC A;  1YJW A;  1S72 A;  4NXN L;  1RCV D;  2EDG A;  4I7Z C;  1YIT A;  1FJG Q;  3M4Y A;  3VDY A;  1PLF A;  4AH6 A;  4JI8 L;  3SXH A;  1MBY A;  4DV0 Q;  4B3T L;  1A6X A;  3GTL H;  3ULL A;  3TP6 A;  3OTO L;  1C7Y A;  2QEX A;  3ULJ A;  1WCM B;  4I65 A;  3U4V A;  4C3H H;  1EQV A;  2EY5 A;  1B7Y B;  3RUZ A;  3PIO 3;  3I4N G;  3RZD B;  3I70 A;  2WII B;  1J9O A;  3NQT A;  4JG2 A;  1YI2 A;  1JCK B;  1BR9 A;  3NBI A;  1HUN A;  5FO9 B;  2QF7 A;  1S4Z A;  2K04 A;  5C3W A;  5G3L D;  2AUK A;  3PQI A;  5KRU A;  2K5V A;  4OO1 H;  5LHY 1;  3CCM A;  5IYD G;  3FHW A;  3F2D A;  3I8Z A;  4EQO A;  4E6I A;  2BA0 A;  3R93 A;  5FLM H;  4DK1 A;  4DR4 Q;  1AE2 A;  3HP3 A;  4DV5 Q;  4IFD H;  2R7Z B;  1MIU A;  2EYM A;  4RA8 A;  4JI0 Q;  2F3V A;  1U0L A;  4EQN A;  1CKM A;  2PMZ B;  3S24 A;  3E9H A;  4K6D A;  1X9N A;  2I5L X;  1L1O B;  1SE3 A;  5C4X B;  4OWX B;  1X3G A;  1TXY A;  2R92 G;  1BVS A;  5TSS A;  4C3I B;  1EU4 A;  3BZK A;  3STB D;  5DNF A;  2DJF C;  3K5L A;  2JJQ A;  4MNO A;  1G91 A;  3K7A H;  5NUC A;  4B3T Q;  2L5T A;  3TRZ A;  1E7Z A;  4NDX A;  4A3I B;  2Z6B A;  2N3S A;  4NB3 A;  1SAP A;  1JOK A;  1SNQ A;  1PRT C;  2JA8 H;  5BN4 A;  1AP0 A;  5IGC A;  4C3I G;  3TS2 A;  3GTM H;  4GOP A;  4C3J G;  1EYA A;  2L0C A;  3S2H B;  4P2C B;  1D5M C;  2HHH Q;  1KNA A;  5M5W B;  1QUQ B;  4DV4 L;  1BKB A;  3NTH A;  4YHH L;  2EQS A;  3KK7 A;  2K5N A;  5K36 H;  4IFD I;  4K2L A;  3M4O B;  4ZQ3 A;  3UE1 A;  1Q1E A;  3W3A A;  3H09 A;  5C44 B;  2F03 A;  1IYV A;  4NXM Q;  4C56 C;  1GUT A;  4GN5 A;  1EY9 A;  3EA6 A;  1I50 B;  3S1N B;  1KDC A;  1LV9 A;  1CI3 M;  2GN5 A;  1QB5 D;  2CCZ A;  3J7A V;  3KJO A;  3Q8D A;  1K8G A;  4HJ8 A;  3C46 A;  2OTJ A;  4OON A;  1Q12 A;  4PMB A;  1V1Q A;  1O7L A;  4TRD A;  3MZ5 A;  1QZG A;  4HCS A;  3I2Z A;  1JWS D;  1SYG A;  1I4R A;  1DJR D;  4BXX G;  2MJ8 A;  4A93 B;  3U4Z A;  1LLR D;  5FLX L;  1XXG A;  5IWA Q;  2F0U A;  1C4Q A;  4X64 L;  2WAQ E;  1SYE A;  4A3B H;  3A55 A;  1X3E A;  2H5X A;  4IUR A;  3T13 A;  4G7O C;  1UEA B;  4F8M A;  4DUY L;  4K6L A;  1NR2 A;  3PUX A;  2LKV A;  3UI2 A;  4DV6 Q;  1N36 Q;  2B29 A;  4CJ2 C;  1IYU A;  4ODG A;  2F0I A;  2XTI A;  3D4R A;  3S1Q H;  1E1T A;  1JE4 A;  1YHA A;  1ICF B;  1EUJ A;  1JWM D;  3FKI G;  3I73 A;  2A69 C;  4NKL A;  1EQQ A;  4ME5 A;  5C4H A;  2QA4 A;  2VQF Q;  3KOJ A;  5KEE A;  1E1O A;  2OXP A;  3OWF A;  4X65 Q;  5CV4 A;  2L11 A;  1ROD A;  1HR0 W;  4DV2 L;  1SE4 A;  1WTW A;  3ND9 A;  3K81 C;  5EPJ A;  1OXV A;  3K5N A;  3Q22 A;  2OCE A;  5IOC A;  2K05 A;  4HJ9 A;  2F3I A;  1UE6 A;  4A93 G;  4XT3 B;  1HNW L;  2ZTE A;  4HID A;  1WD0 A;  1PTO F;  1LTS D;  1HXY D;  3BYY B;  3K58 A;  4G57 A;  5GQO A;  5CBA E;  1U4R A;  3OHX C;  3PO2 B;  2B2V A;  3OSO A;  1AE3 A;  5EKL A;  5C0X J;  4JV5 Q;  2JA6 H;  4GOP B;  1EFW A;  4XT1 B;  4JV5 L;  2RDG A;  1D1I A;  2A6H C;  3SK4 A;  4C3J H;  4X66 Q;  3F1Z A;  3E3X A;  5HY6 A;  4C3I H;  4BY1 G;  1QNU A;  4JYA Q;  1STB A;  2YTY A;  3EQL C;  1Y8N B;  1PVO A;  3J80 L;  2E75 C;  2KEC A;  4HIM A;  3QIA A;  4IOC A;  2M9V A;  2DJG C;  1JJ2 A;  1S5B D;  1EL0 A;  4KJO A;  5CV6 A;  3WOF A;  1XPO A;  1HZ9 A;  1FGU A;  1S5E D;  1K8M A;  4LF8 Q;  1SNP A;  1KLG D;  5FO8 B;  1A8V A;  1AFP A;  2KHS A;  1PH6 A;  1W6J A;  3G6J B;  3NQI A;  4A3E G;  2ES2 A;  1Y1W B;  2A6E C;  4HJA A;  5KND A;  4WJ4 A;  1VQO A;  5JPN C;  4IFD G;  5E7N A;  3CCJ A;  4FDB A;  4A75 A;  1MI2 A;  3HOY H;  1EOV A;  1SDF A;  1WI5 A;  4F7X A;  1EU3 A;  4UP7 A;  1HR0 L;  2PI2 E;  3J81 j;  3TRE A;  4RCO A;  1WVL A;  5CV8 A;  1CSQ A;  1Q86 C;  3TP8 A;  1M1K C;  1BF4 A;  4B3M L;  1B50 A;  1NAP A;  2RHQ B;  4OXP A;  5J3B A;  2ZM6 L;  1SND A;  1UE1 A;  2KEN A;  4HMJ A;  4IJL A;  4C2M H;  1OTC A;  1RTN A;  3A74 A;  4POG A;  3TS0 A;  4BBR G;  1X3Q A;  2CH4 A;  1L0X B;  5JVG 3;  1K8A C;  4JI5 Q;  4LF5 Q;  1SN8 A;  1V8Q A;  3QOL A;  3CKI B;  2F0E A;  3LNN A;  5JVH 3;  2FFK B;  3UDG A;  1KDB A;  1WD1 A;  1PV4 A;  4PZ6 A;  2I07 B;  3V2T A;  2FMC A;  2A73 B;  3RMH A;  5FO7 B;  1DCZ A;  1MSG A;  4R4I A;  4BBR B;  2RA4 A;  4OHJ A;  2I0Q A;  4CDE C;  3FMC A;  1PTO C;  1T5X D;  1I4P A;  3SK6 A;  4A3C G;  1SMY C;  4A3D G;  4X62 L;  2FIN B;  2WAQ B;  4J8Q A;  3HOX B;  2YTV A;  4RGN A;  2Z0S A;  2KBN A;  5IYB H;  1XX8 A;  3T1Y L;  1S40 A;  4MZ9 A;  3E0J A;  5CGK A;  2PO4 A;  1JJG A;  1VQB A;  1HUM A;  5BN3 A;  5JEA G;  1SYD A;  3TME A;  1PH7 A;  1XWE A;  2QIL A;  2E5L Q;  3G48 A;  1Q90 A;  1XMO L;  2EY6 A;  5IOD A;  1J8I A;  1JT8 A;  4IPD A;  2R3Z A;  4CJ1 B;  1FD7 D;  2WB1 B;  2K01 A;  1CT1 D;  3VYT A;  1JC7 A;  3BU2 A;  3NPP A;  3P20 A;  3GTL B;  1D6E C;  2ZM6 Q;  5GAE C;  2UUC L;  3G6E A;  3VR6 A;  2Q2I A;  4IUU A;  1UNS A;  1SE2 A;  5CBE E;  2CQO A;  1VQP A;  5IP9 H;  4JI4 Q;  4LFA L;  2XSC A;  3DLL A;  4RH6 A;  1SSO A;  4BY7 B;  3C1E A;  4PV1 C;  1YNN D;  5HGT A;  2E74 C;  2F0L A;  4KTA A;  3T1H Q;  3KUP A;  1PZK D;  4UP9 A;  4FF4 A;  4BY7 H;  1SBB B;  2UXB Q;  2F0S A;  1YNX A;  4CDD C;  1X32 A;  1X3F A;  2PZW A;  4KJN A;  3HFZ B;  4BBS H;  1O7Y A;  2K03 A;  4F87 A;  1I94 Q;  4QCL A;  2NVX H;  3DWA A;  1M4V A;  4V19 0;  4OWT B;  5CV5 A;  2SNM A;  2Z1C A;  1RIP A;  3R3O A;  4LF6 L;  2ZXO A;  4R1J A;  3DEP A;  1STH A;  4KHV A;  4LF6 Q;  1JB3 A;  2RCF A;  1NJI C;  2WAQ G;  3RZO B;  1V43 A;  5A2Q E;  3OMG A;  1NTG A;  2EYO A;  2MQH A;  1JQY D;  3K80 C;  4DR3 Q;  3V05 A;  5JEA H;  2KJX A;  1VQN A;  1HH2 P;  3BDO A;  4JCV E;  5GAD C;  2VW9 A;  1I4X A;  2E76 C;  4HSP A;  2M2L A;  4DAM A;  1PRT F;  4ID6 A;  4DR4 L;  4LFB Q;  2MGS A;  4A3C H;  4PNY A;  2NYZ D;  1B1Z A;  2A6H D;  2UUC Q;  1YVC A;  3J7Z C;  4HED A;  3CCR A;  4EGV A;  1EY7 A;  3SVM A;  2JSO A;  3Q0A A;  3GO5 A;  1SMY D;  2UXB L;  1FNV A;  1JWU D;  2XWB B;  1WCM G;  4L8J A;  2NZ1 D;  2MO1 A;  4ZAI A;  1Q8K A;  2K28 A;  4CKE A;  4DAY B;  1TWG H;  3FDT A;  1L1O C;  4QIW E;  1G2T A;  4IPC A;  2Q2U A;  3CAM A;  1PRT D;  2DGY A;  2KCT A;  1KAB A;  1VQ6 A;  5JJZ A;  3GTG H;  5EAY A;  1HNZ Q;  3OMC A;  3MVV A;  1GUN A;  2JA8 G;  2D5D A;  5C4J B;  3CCU A;  5M3F H;  3ICE A;  1PMR A;  1GHK A;  1XTC D;  2J7Z A;  2G5D A;  4XQN A;  3A56 A;  2VNU D;  4GZY C;  1DGS A;  2LXJ A;  2F4I A;  4DV3 L;  4KK7 A;  1RF2 D;  2F3W A;  1H9S A;  3QR8 A;  1RHP A;  3I7F A;  3G4S A;  4PQX A;  3RNU A;  4P75 A;  1KRT A;  1H9M A;  4QL5 A;  1VQH A;  2VL6 A;  2KEE A;  2F0J A;  4OX9 Q;  1PA6 A;  3H15 A;  5JPM C;  1KDA A;  1QVG A;  2UU9 L;  1UEB A;  2KCN A;  3W5O A;  2F4V L;  3BVM A;  1CHP D;  1Z47 A;  2I5M X;  2ZTC A;  3P7J A;  1G51 A;  4BY1 H;  1CM9 A;  4C2M B;  3MXN B;  2P5Z X;  5FK9 C;  3GQB A;  4K14 A;  5T1G A;  4J15 A;  2K5W A;  4PZ8 A;  4Q5V A;  4IUQ A;  4H44 C;  2VB2 X;  4CDC C;  1FJG L;  3EN2 A;  2KHI A;  1U9R A;  2JE6 I;  1R4Q B;  4QMG A;  1SYF A;  2AQ2 B;  3CCS A;  1KD1 C;  4JI8 Q;  1X3P A;  3CMA A;  4DNR B;  3K0Y A;  3A8I E;  1CKO A;  3R2I A;  1DZ1 A;  3EVQ A;  3TSS A;  1TS5 A;  4JI1 Q;  3NBH B;  3IAY A;  1N33 Q;  4UAI A;  2Q2T A;  3HOU B;  3FKI B;  2ZJR A;  2ENB A;  3T16 A;  2Q8R E;  2AWO A;  4GKJ L;  4K0K Q;  2R7Z G;  1JIC A;  3TDQ A;  1CKN A;  4KI0 A;  4U68 A;  2ASB A;  4MN3 A;  2A68 D;  1KXL A;  1B9N A;  3FKI H;  4DV1 L;  1VCI A;  4EVO A;  3MAQ A;  3H0G H;  2IX3 A;  2F0H A;  5ELC A;  4ALP A;  1IL8 A;  2E2I H;  2HCC A;  2NBF A;  3HKZ G;  2WP8 J;  3I4M G;  3GTQ B;  5C4X G;  5I9P A;  1PH8 A;  1I4H A;  2F1M A;  2F0M A;  4Y7N B;  4A3D B;  4OIK A;  3AFP A;  1T9H A;  1WJJ A; 
#chains in the Genus database with same CATH homology
 2EQS A;  2K5N A;  4KHP Q;  1H95 A;  3CCQ A;  4IFD I;  3HOX H;  1VQ4 A;  3UE1 A;  1Q1E A;  1GM5 A;  2JEB I;  2WB1 G;  1I94 L;  1I3Q H;  4NXM Q;  1Q46 A;  4UY8 C;  3KFU A;  2NVT H;  4A3B G;  4IFD J;  2Y0S E;  4GN5 A;  3GTO H;  3S15 H;  3GTJ H;  2GN5 A;  2OTL A;  2UUB L;  2QGQ A;  3F2C A;  1IBK Q;  1KRS A;  2CCZ A;  3KJO A;  1B8A A;  3PO3 H;  5FLX c;  3Q8D A;  1K8G A;  5LMU Q;  3I4O A;  2UXD L;  4HJ8 A;  3RLF A;  4DR1 Q;  4YCV A;  1FVI A;  2OTJ A;  2BH8 A;  1Q12 A;  4OON A;  1V1Q A;  1N33 L;  3PV0 A;  1L2F A;  4IO9 A;  4DR1 L;  2IT1 A;  1QZG A;  3HKZ E;  1UE7 A;  3D31 A;  3I2Z A;  3HOW G;  3K7U C;  1OXX K;  5C3E H;  1X55 A;  1B70 B;  3K8A A;  2K5H A;  3HOZ H;  4BXX G;  1EQR A;  3RN5 A;  2UXC L;  3AQQ A;  4JI7 L;  5GAG C;  2B3G A;  3U4Z A;  2JEA I;  1K83 H;  4LF8 L;  1N9W A;  1Z9F A;  2JA5 H;  3PUW A;  4KLK A;  5IWA Q;  1UE5 A;  4X64 L;  4DR7 L;  2WAQ E;  1KL9 A;  4HIK A;  1E22 A;  3S17 H;  4BBR H;  5M3F G;  1GO3 E;  1SFO H;  3JAM i;  4LFA Q;  3ULP A;  4A3B H;  4IOA A;  1YEZ A;  1X3E A;  2H5X A;  1X54 A;  3AYH B;  4HJ5 A;  3A0J A;  4DUY L;  3NEM A;  5JJK A;  1TWH H;  3PUX A;  4O0A A;  3S2H H;  1VQI A;  2D0O A;  4DV6 Q;  3PSI A;  1IBL Q;  1N36 Q;  4L5R C;  2B29 A;  1E3P A;  1NMF A;  2XTI A;  2ZJP A;  1XTD A;  2V1C C;  3S1Q H;  3A5U A;  4JYA L;  1E1T A;  1JJC B;  2A1A A;  1YHA A;  3STB C;  3TEH B;  1LUZ A;  3PCO B;  2F52 A;  4LFC L;  1YIJ A;  1EUJ A;  2F4V Q;  3S14 H;  3FKI G;  4GNX B;  5AJ3 Q;  4B3M Q;  2JA7 H;  3S2D H;  4Y52 H;  1A63 A;  3KF6 A;  1WCM H;  1LM0 A;  1EQQ A;  1OXU A;  2K4K A;  4JI3 Q;  2QA4 A;  1K9M C;  2VQF Q;  3KOJ A;  4JI5 L;  4LF5 L;  3I4N H;  1E1O A;  2CFM A;  5C0X I;  1TWC H;  1WOC A;  2VUM G;  4DR3 L;  2B63 H;  1J5E L;  5FLM G;  4LUO A;  4X65 Q;  3CPW A;  4X66 L;  1Y1V H;  5LMU L;  1HR0 W;  4DV2 L;  1SE8 A;  4A3L H;  4A3G H;  1J6Q A;  3K81 C;  1OXV A;  2IHE A;  4PG3 A;  2OCE A;  4YY3 Q;  4HJ9 A;  2NZO A;  3PO3 G;  3PO2 G;  4JI2 Q;  2F3I A;  5M3M G;  1HNW Q;  1UE6 A;  3HOU H;  4A93 G;  4R4T A;  2Z6K C;  1OXT A;  2NN6 I;  1HNW L;  1PYB A;  2ZTE A;  2R6G A;  3M4P A;  5GRO A;  4HID A;  4PZ7 A;  4BA2 I;  1EIF A;  4DK6 C;  4QY7 A;  4JI1 L;  4R4C A;  3PO2 H;  4BXX H;  1O7I A;  3CCE A;  3L0O A;  2OQ0 A;  1C0A A;  4X6A H;  4LF4 Q;  5GQO A;  4PMW A;  2MO0 A;  2PQA B;  1AE3 A;  1C9O A;  5C0X J;  4GN4 B;  2VQF L;  4JV5 Q;  2NN6 G;  2HIX A;  2JA6 H;  4GOP B;  1EFW A;  2VUM H;  4JV5 L;  2E2J H;  4Y7N H;  1Q81 C;  1VQG A;  3DM3 A;  4C3J H;  4X66 Q;  3F1Z A;  5HY6 A;  1VQE A;  4C3I H;  4A3L G;  1P16 A;  4BY1 G;  3H3V I;  3K0X A;  4A93 H;  1D8L A;  4RG1 A;  4JYA Q;  2YTY A;  1L1O A;  4MTN A;  1V9P A;  1ASY A;  1CKN B;  1PVO A;  2WB1 E;  1K3R A;  3PGZ A;  4HIM A;  4IOC A;  1JJ2 A;  1PH5 A;  4TVA B;  1VQJ A;  2OQK A;  3U50 C;  3RR5 A;  3UDX A;  3PUY A;  2C35 B;  2I5H A;  1HZ9 A;  1FGU A;  2GVA A;  3M9B A;  4GLA C;  1XPO A;  1R9T H;  5C0X G;  3GTP H;  1VQA A;  4JC0 A;  4LF8 Q;  3GD7 A;  2B63 G;  4EX5 A;  1A8V A;  2D62 A;  3J80 c;  1XNQ Q;  3KDF B;  3HKS A;  2DUD A;  1PH6 A;  4LUZ A;  1L0W A;  4R4Q A;  2CWP A;  3UDF A;  5BR8 L;  3H0G G;  5GAH C;  4A3E G;  1PHJ A;  1IBM L;  2ZJQ A;  2ES2 A;  4QQB X;  4DUY Q;  3GTQ H;  1LTL A;  1X6O A;  5IY0 A;  3CC7 A;  4HJA A;  3J7A 5;  5M3M H;  2N78 A;  1VQO A;  4WJ4 A;  4IFD G;  2YV5 A;  5E7N A;  4FDB A;  1PYS B;  4IJH A;  3CCJ A;  4A75 A;  4AQY Q;  2UUB Q;  3HOY H;  1EOV A;  1WI5 A;  1VQ8 A;  3S1R H;  4UP7 A;  1UWV A;  3HOV G;  4JBM A;  1HR0 L;  2PI2 E;  3J81 j;  2ID0 A;  2R7Z H;  3TRE A;  1YHQ A;  1PH3 A;  4LFC Q;  4UPA A;  1CSQ A;  1Q86 C;  1KHI A;  1M1K C;  3WWV A;  4B3M L;  1Y14 B;  1SR3 A;  1JB7 A;  4DR6 L;  2RHQ B;  4OXP A;  5J3B A;  2ZM6 L;  1UE1 A;  2KEN A;  4AYB E;  1HNX Q;  4IJL A;  4P71 A;  4DR6 Q;  3I55 A;  4JOI C;  4BA1 I;  2NVY H;  4C2M H;  2AMC B;  3A74 A;  1OTC A;  5M5W H;  3TS0 A;  4POG A;  4BBR G;  5IYC H;  1K8A C;  4JI5 Q;  4LF5 Q;  1SN8 A;  4DR2 Q;  5JJL A;  1JE5 A;  2XGT A;  4DPG A;  2BH2 A;  4NPS A;  3PF5 A;  4DR2 L;  3PF4 A;  1VQM A;  1SRO A;  4JOI A;  5LMN L;  3UDG A;  1VQL A;  3S16 H;  4YCW A;  1PV4 A;  4LFB L;  1HZA A;  4PZ6 A;  3PIO A;  4JI2 L;  5K36 G;  2PI2 A;  5FJ8 G;  3BJU A;  5HGQ A;  4OO1 G;  2EXD A;  1GD7 A;  2VZA A;  3L2P A;  1IXR A;  3SGI A;  3PUZ A;  4DK3 C;  3GTK H;  1Y1V G;  1EYG A;  4R4I A;  4AIM A;  4DV7 Q;  5C44 G;  1X65 A;  3D0F A;  4AQY L;  2I0Q A;  4GKK L;  5C4X H;  3FP9 A;  1EWI A;  3S1N H;  4LWC A;  1SRU A;  4LF9 Q;  3HOV H;  4GKK Q;  3F8T A;  3CCL A;  4IPH A;  2PNH A;  1A0I A;  1YZ6 A;  2RCN A;  4A3C G;  1VQ7 A;  4A3D G;  2R7F A;  4AYB G;  4X62 L;  4LF4 L;  3M4O H;  1GKH A;  4XTC S;  2YTV A;  4LF7 Q;  4O2D A;  2Z0S A;  3LGJ A;  2KBN A;  2Q2H A;  5IYB H;  5IYC G;  3T1Y L;  1S40 A;  1XPR A;  4K0K L;  2MFI A;  4MZ9 A;  2JQO A;  3RN2 A;  3B6Y A;  4HIO A;  2UUA L;  4NXM L;  3KDF A;  2JA9 A;  3CCV A;  2HIV A;  2RHS B;  2R93 H;  1JJG A;  2RF4 A;  1VQB A;  2YYZ A;  2AHO B;  2N49 A;  5C44 H;  2ALY B;  2UUA Q;  5JEA G;  2VQE L;  2K50 A;  2KCM A;  1PH7 A;  2PQA A;  1SMX A;  1KC8 C;  2R7D A;  1QVF A;  5IP7 G;  4A3I G;  3J80 i;  2E5L Q;  3G48 A;  1JT8 A;  1XMO L;  5FJ8 H;  4IPD A;  4A3K H;  2PMZ E;  1IL2 A;  1HJP A;  3PIP A;  2R92 H;  4P72 A;  3CF5 A;  3MEF A;  3PUV A;  3BU2 A;  3CP0 A;  5IP9 G;  1N8R C;  3CPF A;  5ELN A;  4DV1 Q;  3NEL A;  4H02 A;  5ELO A;  1ASZ A;  4JI7 Q;  1I5F A;  2ZM6 Q;  4APV A;  5GAE C;  4RMF A;  2UUC L;  1YJ9 A;  3G6E A;  4DR7 Q;  1XJV A;  1NY4 A;  2Q2I A;  3HOU G;  1KIX A;  3M7N A;  2UXC Q;  4LF9 L;  1D7Q A;  4JI4 L;  1PFS A;  2CWA A;  3CQZ H;  3G71 A;  4DV4 Q;  1VQD A;  2CQO A;  4A3E H;  1VQP A;  1HNZ L;  1PH9 A;  4JI6 Q;  1N32 Q;  5IP9 H;  4EQ5 A;  4JI4 Q;  4LFA L;  3DLL A;  3H3V H;  2VY3 A;  4UP8 A;  2LSS A;  3HOZ G;  5M5X H;  2YTX A;  3T1H Q;  1Q7Y C;  1S3O A;  4NXN Q;  1RL2 A;  4UP9 A;  4XIG S;  5IT9 c;  4BY7 H;  2UXB Q;  4GNX C;  1YNX A;  2NVQ H;  3NEN A;  1X3F A;  3HFZ B;  2E2H H;  1QVC A;  3J81 i;  4BBS H;  1I94 Q;  2MNA A;  3OTO Q;  2NVX H;  4OWW B;  4TQU S;  2JA7 G;  1FL0 A;  2UXD Q;  1QUQ A;  4GNX A;  1VS0 A;  1XNR Q;  1NE3 A;  4DV6 L;  4OWT B;  1IBL L;  2UU9 Q;  1M90 C;  1RIP A;  3ZJY C;  2IX1 A;  4L5T A;  4LF6 L;  1G29 1;  4A3D H;  1CUK A;  4R1J A;  1LYL A;  3KLW A;  4DR5 Q;  2WFW A;  3F2B A;  4LF6 Q;  3W1B A;  3HOX G;  2K14 A;  1N34 L;  1NJI C;  3EIV A;  5C4J H;  2WAQ G;  1V43 A;  4JBJ A;  1NTG A;  2MQH A;  3GDE A;  3JC6 6;  1HNX L;  3K80 C;  3CW2 C;  4DR3 Q;  1EIY B;  4QGU A;  4ME3 A;  2N8N A;  4R4O A;  1VQN A;  1HH2 P;  4JCV E;  5GAD C;  2VW9 A;  1A62 A;  2L15 A;  2E8G A;  4OO1 I;  3T1H L;  4P74 A;  4A3M G;  5BR8 Q;  2Z6K A;  1PH1 A;  4DAM A;  4L5Q A;  5LMN Q;  4DR4 L;  3CME A;  1G6P A;  1KAW A;  4LFB Q;  4DV3 Q;  2JA5 G;  1Q1B A;  1VQF A;  4A3C H;  2A8V A;  3RLN A;  2YU9 H;  1MJE A;  2UUC Q;  1YVC A;  1IZ6 A;  1K73 C;  3CC4 A;  2JA6 G;  2IHF A;  1MKH A;  4LNQ A;  1XNR L;  5IYD H;  1TWA H;  4GN3 B;  4A4I A;  2AKW B;  3J7Z C;  3CCR A;  4X62 Q;  1N32 L;  4GOP C;  1OXS C;  3J81 c;  1YJN A;  1W2B A;  3GO5 A;  3CC2 A;  4B3R L;  1I6H H;  3E9I A;  1X56 A;  4LF7 L;  4KHZ A;  2Y0S G;  3BZC A;  2UXB L;  4YWM A;  4DUZ L;  2ZTD A;  2IX0 A;  1KQS A;  1WCM G;  2VS1 A;  4GKJ Q;  2MO1 A;  1J5E Q;  1Q8K A;  1SLJ A;  4A3J G;  2GVB A;  4DAY B;  5H1S E;  1TWF H;  1TWG H;  3JAM c;  1CSP A;  1K0R A;  2JK8 A;  4IPG A;  1L1O C;  4QIW E;  4A3M H;  3KF8 B;  4IPC A;  2Q2U A;  1E24 A;  1WYD A;  4BBS G;  1XMO Q;  2HT1 A;  3ER0 A;  3CAM A;  2DGY A;  4BY7 G;  2KCT A;  3KYH C;  1VQ6 A;  3OYY A;  5IE8 A;  5LMN W;  3CD6 A;  2LXK A;  1N34 Q;  5IP7 H;  4A3I H;  1XMQ L;  2OWO A;  3AFQ A;  4YY3 L;  1PH2 A;  3GTG H;  1U5K A;  5EAY A;  2ATW A;  1HNZ Q;  4P73 A;  2BA1 A;  3KJP A;  2HQL A;  4POF A;  4YHH Q;  1PH4 A;  2JA8 G;  1QZH A;  3CCU A;  4KHP L;  3RLO A;  5M3F H;  4YWK A;  4JI6 L;  4WJ3 M;  3ICE A;  3L7Z C;  2EIF A;  1IYJ B;  3TQY A;  1JMC A;  1XNQ L;  1YJW A;  1S72 A;  2VNU D;  4A76 A;  1DGS A;  4NXN L;  1Y1W H;  2KHJ A;  2LXJ A;  1YIT A;  1FJG Q;  3AEV A;  3VDY A;  4DV3 L;  5DLQ E;  3M85 A;  4DV0 L;  4AH6 A;  4GLX A;  1VQ5 A;  4JI8 L;  3IRB A;  3I7F A;  4LW1 A;  3G4S A;  4DV0 Q;  3RNU A;  1IBK L;  4B3T L;  4P75 A;  1KRT A;  3ULL A;  4JBK A;  4QL5 A;  4OX9 L;  3GTL H;  3OTO L;  1C7Y A;  2QEX A;  1VQH A;  2VL6 A;  2D0P A;  3ULJ A;  4C3H H;  1YHB A;  5JEA J;  3U4V A;  1PA6 A;  3EBE A;  3H15 A;  4JI0 L;  4OX9 Q;  1B7Y B;  1QVG A;  3ERS X;  2UU9 L;  3I4N G;  3HOY G;  1UEB A;  2FXQ A;  4GLV B;  3W5O A;  5IYB G;  2F4V L;  1Z47 A;  3M4Q A;  2I5M X;  4DR5 L;  1NMG A;  1MJC A;  2ZTC A;  4B3R Q;  1AH9 A;  1G51 A;  4BY1 H;  4JG2 A;  3MXN B;  1YI2 A;  1Q82 C;  3KF6 B;  1VQK A;  1NBW A;  5IWA L;  2CKZ B;  1W3S A;  5C3E G;  3OW2 A;  3W1G A;  1WFQ A;  4A3K G;  3E0E A;  4J15 A;  4X65 L;  4PZ8 A;  2K5V A;  3RZD H;  1IBM Q;  3A5Z B;  3CCM A;  5IYD G;  3FHW A;  3F2D A;  1FJG L;  2K52 A;  3EN2 A;  2KHI A;  2JE6 I;  2BA0 A;  5FLM H;  4DR4 Q;  3M3Y H;  3CCS A;  1AE2 A;  4LUV A;  1KD1 C;  4JI8 Q;  1XMQ Q;  2IY5 B;  3CMA A;  4B3S Q;  3RZO H;  4DV5 Q;  4L5S A;  1MIU A;  1CKO A;  4A3J H;  4B3S L;  1HR0 Q;  4JI0 Q;  1BBW A;  4QJF A;  1U0L A;  4YCU A;  1CKM A;  4GS3 A;  3S24 A;  3E9H A;  1X9N A;  2I5L X;  1L1O B;  1N36 L;  4JI1 Q;  3NBH B;  1N33 Q;  4OWX B;  2Q2T A;  1X3G A;  4DNI A;  3T1Y Q;  1TXY A;  1YBY A;  5AJ3 L;  2ZJR A;  2R92 G;  4DUZ Q;  2K75 A;  4A3F H;  1BVS A;  4YWL A;  2AWO A;  5M5Y H;  4GKJ L;  2NZH A;  3HOW H;  3S1M H;  3U58 A;  1BBU A;  3BZK A;  3STB D;  4DKA C;  3CXC A;  4K0K Q;  2R7Z G;  2JJQ A;  4MNO A;  1I50 H;  3K7A H;  3I4M H;  1HZC A;  4JI3 L;  4A3F G;  1CKN A;  4KI0 A;  4B3T Q;  3TRZ A;  1Y1W G;  1E7Z A;  1P8L A;  4JBW A;  2VQE Q;  4DV2 Q;  2ASB A;  1XPU A;  3UDI A;  2N3S A;  2E5L L;  1KXL A;  4NB3 A;  1GVP A;  3FKI H;  4DV1 L;  1VQ9 A;  1VCI A;  4HJ7 A;  2JA8 H;  3H0G H;  3TS2 A;  3GTM H;  4GOP A;  4DV7 L;  3I56 A;  4ALP A;  2HHH L;  2AWN A;  4DV5 L;  1VQC A;  3HKZ G;  2WP8 J;  2E2I H;  4A3G G;  3I4M G;  2HHH Q;  2A19 A;  5C4X G;  1PH8 A;  1QUQ B;  3UE0 A;  4DV4 L;  5JJI A;  1HZB A;  1BKB A;  4YHH L;  3AFP A;  1T9H A;  1WJJ A;  4X64 Q;  2R93 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...