1TWGH

Rna polymerase ii complexed with ctp
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
total genus 21
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1twgH00
2E2HH 2E2JH 2K5VA 1XMOL 4C2MH 5M5YH 1CSQA 3PIOA 2BH2A 1TWCH 1EFWA 2IT1A 1HZAA 4GLVB 4HIDA 5C4XH 1H95A 2E8GA 4JBMA 4K0KL 4K0KQ 1A63A 2IY5B 5FLMG 4GNXA 1Q1BA 5EAYA 4DV0L 2XTIA 4DV0Q 3GTKH 3UE0A 4EQ5A 1VQ6A 4A3LH 2HIVA 4LF5L 3J7ZC 1XPRA 4GNXC 1CKNA 2Z6KA 1YVCA 1M90C 4IPDA 3LGJA 4JG2A 4JI8L 4KHZA 4KHPL 1YIJA 4KHPQ 2PQAA 1C7YA 3S17H 3CD6A 2PI2A 1SE8A 2Z6KC 3K8AA 2ZJPA 2EQSA 1VQNA 1IXRA 1UE7A 3BU2A 2CWAA 2OQ0A 2VQFL 3CAMA 2VQFQ 1YI2A 4YHHQ 1R9TH 1E3PA 2MO0A 2Q2TA 1ASYA 4A3GH 3KDFB 4PZ7A 4A3FG 1PH7A 2DUDA 2RHSB 4Y52H 1BVSA 3PF5A 3AFPA 1I94L 1I94Q 4LW1A 1EIYB 1B70B 1WYDA 2RHQB 3PUYA 4JOIA 3STBC 1X6OA 4KI0A 3S15H 2NZOA 4AIMA 3M85A 2I0QA 4BA2I 4DR6Q 4OXPA 4GOPB 2IHEA 4IO9A 3RLOA 2WFWA 1OTCA 2EIFA 4YWMA 5C0XI 1Y1WH 4GLXA 2JA6H 4A3KG 4YWLA 3F2BA 2B63G 3CW2C 2R92H 5IP9H 3S1RH 1PH8A 2VL6A 3PUVA 1Q8KA 1C0AA 2WP8J 1JJCB 4A3EG 1YEZA 4B3TL 3NBHB 4B3TQ 3HOUG 3PF4A 4POGA 1N8RC 1XNQL 1XNQQ 1K83H 3S1MH 2RF4A 1WCMH 3RN2A 1QZGA 2LXJA 1XNRQ 1Q82C 3M3YH 2NVYH 4FDBA 1GM5A 4DV3L 4DV3Q 3CCRA 4DKAC 4DV4L 1CKMA 4DR7L 5DLQE 1LYLA 4JI5L 1X65A 4DPGA 4JI5Q 2NVXH 2UUCQ 2MNAA 4LF4Q 4HIOA 2UXDL 2UXDQ 4HJ7A 2R7DA 3RR5A 1YITA 3CC4A 4OO1G 4R4IA 1VQJA 2GVAA 1X54A 2K14A 3UDXA 5FJ8G 2JEAI 2ES2A 3G48A 3UDGA 4UY8C 5JEAJ 5IYCG 3S1QH 3S24A 1ASZA 4JI4Q 2BA1A 1GKHA 4LUOA 1EYGA 4DR3L 3KYHC 4DV7L 4DV7Q 2D62A 3FKIH 4DR3Q 1X55A 4LUZA 3OW2A 4BY1H 4A3IG 4GOPC 3RLNA 2VNUD 3K0XA 1U5KA 4LF6L 4LF6Q 1NE3A 2ID0A 1YHQA 4IOAA 1JE5A 5IT9c 5BR8L 2CQOA 4A93G 2JEBI 1OXSC 3IRBA 3HOZH 3S16H 3L0OA 1S40A 1HNXL 1HNXQ 2JA7H 5IP7G 3A5ZB 2PNHA 3S2HH 2WB1E 2KBNA 3KLWA 3SGIA 1Q81C 3D0FA 3M9BA 2FXQA 2VS1A 5FLXc 4LF8L 2WAQG 4GNXB 1A8VA 3ULJA 4JI2L 4JI2Q 2JE6I 2JA9A 3CPFA 3GTPH 4P71A 3PUXA 4DR5L 4DR5Q 4A3CH 4PMWA 5C4XG 2D0OA 4A3BH 3G71A 1CKNB 4LFCL 1QZHA 4LFCQ 2YU9H 2Q2HA 1VQLA 1JMCA 5JJLA 4X62Q 2EXDA 2F4VL 3K7AH 2F4VQ 4C3JH 4L5RC 2K4KA 2PQAB 2NVQH 2ZM6Q 3PO2H 1QUQA 4OWTB 3KJOA 3PO3H 4YY3Q 1J5EL 3L2PA 1J5EQ 3CCMA 2E5LL 3AQQA 1PH9A 3J80i 4A3DH 4HIMA 1VQHA 4JV5L 4JV5Q 2QA4A 1PHJA 2R7FA 1L0WA 2I5HA 2IX1A 1FJGL 1FJGQ 4A75A 4JBWA 2B29A 1GD7A 5GAGC 3U4VA 1XMOQ 1SLJA 4X65L 4X65Q 4A3GG 1K3RA 4BBSH 1I6HH 4IPGA 1PH4A 2Y0SE 3HOVH 5GAEC 3CXCA 4AH6A 4DR2L 4DR2Q 2KCTA 2LXKA 1CSPA 3MXNB 5LMNW 4A3MH 3HKSA 1PH2A 1BBUA 1NBWA 1Y14B 3BZKA 3PSIA 2IHFA 4H02A 4HJAA 1X3EA 4GKKL 1NTGA 4GKKQ 2K5NA 4ME3A 4LF7L 4BBRG 4LF7Q 1HR0L 4LF5Q 1HR0Q 4DAYB 1Y1WG 4BY7G 4BXXG 1Q12A 2JA5H 1SMXA 1KRSA 2AHOB 4JBJA 2UUAL 2UUAQ 1K73C 1YJNA 2R92G 4JI8Q 5M3FG 3J81j 2C35B 1EQQA 3RZOH 5LMNL 5LMNQ 2CWPA 1XPUA 4QIWE 3U50C 2R93H 1AH9A 3F8TA 1X3FA 2ASBA 1IBML 1IBMQ 4J15A 3BJUA 1HH2P 1MJCA 1XMQQ 1WCMG 2MO1A 1HZ9A 2YV5A 1XMQL 5HY6A 1I5FA 3HOYG 1VQ5A 4L5TA 2F52A 3EIVA 3E0EA 4JI1L 4JI1Q 3JC66 4A76A 2CFMA 5C3EG 2N49A 2VW9A 1NMFA 3H0GH 1VQGA 2MQHA 4P72A 4MNOA 1LM0A 4PG3A 2VQEL 2VQEQ 1VQ8A 1UWVA 1Z47A 4JOIC 4IFDJ 1NY4A 3D31A 3PUWA 3M7NA 3CQZH 2HT1A 3T1HL 4DAMA 4UP8A 3PIPA 1U0LA 3T1HQ 4DUZL 4DUZQ 1XTDA 3TS2A 5GAHC 2KENA 4JI7L 4R1JA 4JI7Q 4JBKA 3W5OA 1N36L 1JT8A 3FKIG 5E7NA 2ATWA 3AEVA 1E1OA 2YTVA 1KL9A 4AQYL 5IYBG 5M3MH 1LUZA 5IYDG 4GS3A 4TVAB 3CCQA 1TWGH 1SN8A 3CCEA 4A4IA 4RMFA 5C0XG 4DV4Q 4DR7Q 2JA7G 1TXYA 5J3BA 1LTLA 2VUMH 1W2BA 3UE1A 3I4MH 1A62A 5HGQA 2NN6I 3CF5A 2F3IA 4LWCA 4JI3L 1YJ9A 4JI3Q 4P73A 4R4QA 4YCVA 3U4ZA 1YBYA 3S2DH 3STBD 1A0IA 1N34L 1N34Q 2MFIA 3PV0A 1QUQB 1PVOA 3UDIA 2H5XA 3KJPA 1MKHA 4A3BG 1VQDA 1X3GA 2QEXA 1EOVA 4B3SL 3WWVA 4B3SQ 1IL2A 4WJ4A 2AWOA 2RCNA 3L7ZC 2N3SA 2CCZA 1MIUA 4C3HH 3RLFA 3I2ZA 5BR8Q 1D7QA 5AJ3L 4Y7NH 4UPAA 1EUJA 4X66L 3H3VI 1N9WA 4X66Q 4A3DG 4R4TA 3HOWH 2QGQA 2B63H 3J80c 1VQCA 1E7ZA 1VQIA 3K81C 4DV6Q 4DV6L 2V1CC 1HNWL 5GQOA 2JK8A 4LFBL 4DV1L 4LF8Q 3G4SA 4DV1Q 3J81i 3FP9A 4BBSG 4DNIA 1DGSA 4GN3B 3A0JA 1PH5A 4OWWB 1O7IA 4IFDI 4B3ML 3HOVG 3FHWA 4B3MQ 1KXLA 4B3RL 3TRZA 2R7ZH 4JC0A 4B3RQ 5IE8A 3HKZE 4A3JH 2IX0A 4AYBE 4A3MG 3K80C 5C4JH 2UXCL 1OXUA 2UXCQ 3TEHB 1VQMA 1V1QA 1Y1VH 1VQ7A 2OTLA 2BH8A 4A3LG 3M4OH 1VQKA 4DR4L 2K5HA 1SFOH 3CC7A 4GN5A 1GVPA 1Q86C 2JA5G 4P75A 4MTNA 2E5LQ 1EIFA 1Q1EA 2XGTA 1YZ6A 2YTXA 3U58A 2JA8H 1HNZL 3TQYA 4YWKA 1YJWA 3GTMH 4HJ8A 3E9IA 2R93G 1D8LA 1VS0A 4UP7A 1IBKL 1IBKQ 4JCVE 4DV2L 4DV2Q 1AE3A 3F2CA 3PGZA 3HOXH 1HR0W 2GN5A 4OWXB 1UE5A 2A19A 2K50A 3I7FA 3M4PA 3Q8DA 2UU9L 2UU9Q 3PO2G 2UXBL 3TS0A 4O2DA 3JAMi 5GROA 5ELNA 1IBLL 1IBLQ 2AKWB 1N32L 1EQRA 2R6GA 4R4CA 4R4OA 2KHJA 1VQBA 1N32Q 3I4OA 2ALYB 4QL5A 1B7YB 3H3VH 1BKBA 3UDFA 2UUBL 2UUBQ 4NXMQ 3I4NH 4OX9L 4OX9Q 3GTQH 1G291 2KCMA 1PA6A 3CMEA 2NVTH 3G6EA 2LSSA 4NXNL 1M1KC 1Q46A 4NXNQ 2JA6G 3W1GA 2I5LX 2VY3A 4IOCA 5IP9G 4LFAL 2JQOA 4XTCS 4LFAQ 3W1BA 1G6PA 3ULPA 1PH3A 5GADC 3KFUA 1IZ6A 1AE2A 4DK3C 1B8AA 1UE6A 4BA1I 1G51A 4WJ3M 1FVIA 1I50H 1T9HA 4KLKA 4YCUA 3ICEA 4JYAL 4JYAQ 2JJQA 5JEAG 5M3MG 4GLAC 3CCVA 1BBWA 4QGUA 4POFA 3KF6A 3CPWA 3AYHB 5C44H 3CC2A 5IWAL 1NJIC 5IWAQ 1JB7A 4DV5L 1VQOA 4DV5Q 2VUMG 4YCWA 3ER0A 3CCSA 4PZ6A 2Y0SG 5IY0A 1K8AC 1TWFH 3I4MG 3S14H 1YNXA 1Z9FA 1V43A 1OXXK 1VQ4A 5M5XH 2GVBA 1FGUA 1RIPA 1WJJA 1CUKA 2A1AA 4C3IH 1UE1A 4NXML 1L1OA 2ZTDA 4GKJL 4YHHL 1N33L 4GKJQ 1N33Q 3GO5A 1JJGA 2B3GA 4DUYL 1VQAA 4DUYQ 1V9PA 1PH6A 3EBEA 1L1OC 1N36Q 4LUVA 3A74A 1HZCA 4BY1G 4X64L 4X64Q 2L15A 4AQYQ 1JJ2A 1VQEA 2K75A 3PCOB 1E1TA 5FLMH 4UP9A 1X9NA 4OONA 4DR1L 1PV4A 1SROA 4DR1Q 4DR6L 1KRTA 4APVA 4LNQA 4IJHA 1GO3E 1XPOA 3CCLA 3HOZG 4BBRH 4BXXH 1KHIA 4BY7H 1QVFA 1KAWA 4QQBX 3HOWG 2N78A 2YYZA 3OTOL 3OTOQ 2I5MX 3J7A5 4OO1I 5M3FH 2HIXA 4MZ9A 1UEBA 2PI2E 1P16A 3J81c 2ZJRA 4A3CG 1L2FA 1XNRL 2R7ZG 2BA0A 1OXVA 4A3JG 4A3FH 3HOYH 3BZCA 1E24A 1PH1A 1KIXA 1PYSB 3NEMA 4P74A 3RNUA 4HJ5A 1Y1VG 1IYJB 1K9MC 5C3EH 1VQFA 3GDEA 4JI0L 4JI0Q 2WAQE 2DGYA 3I56A 2Q2IA 3PO3G 3KDFA 4LF4L 3S1NH 2UUCL 5JJKA 1I3QH 2K52A 4IPHA 2NN6G 1S3OA 1SR3A 5AJ3Q 2Q2UA 2JA8G 1C9OA 3F2DA 1RL2A 3GTLH 3KOJA 4IPCA 4A3KH 2PMZE 4NB3A 2ZTEA 3GTOH 1EWIA 1K0RA 1FL0A 1TWAH 1OXTA 2OCEA 3H15A 4GOPA 3F1ZA 3HOXG 1HNWQ 4A3EH 3I55A 3HOUH 4LFBQ 4JI4L 5LMUL 5LMUQ 2OQKA 3GTGH 2A8VA 2OTJA 1VCIA 2OWOA 3K7UC 5IYBH 3RZDH 1VQPA 1TWHH 1X56A 1WI5A 2ZTCA 4GN4B 4TQUS 4LF9L 2YTYA 1XJVA 1PFSA 1SRUA 3JAMc 4LF9Q 5IYDH 4IJLA 4L5SA 4PZ8A 4JI6L 4JI6Q 2HHHL 1P8LA 2HHHQ 3GD7A 3I4NG 2Z0SA 4L5QA 1S72A 3T1YL 3DM3A 3ULLA 5M5WH 5H1SE 3T1YQ 3KF8B 5JJIA 4X6AH 4DR4Q 5K36G 3E9HA 3CP0A 3VDYA 2E2IH 3PUZA 3A5UA 1PYBA 3NENA 3CCUA 1NMGA 1QVCA 3NELA 4EX5A 3ZJYC 1E22A 1YHAA 1HNZQ 5FJ8H 4DK6C 3CCJA 2KHIA 4IFDG 3MEFA 2N8NA 1YHBA 1WOCA 2AMCB 1W3SA 3ERSX 5IYCH 1KC8C 3KF6B 3EN2A 1HZBA 4HIKA 3RN5A 2HQLA 2NZHA 4HJ9A 2ZJQA 3B6YA 4QY7A 1KD1C 2UXBQ 2WB1G 4X62L 1CKOA 2AWNA 4NPSA 1HJPA 3OYYA 4XIGS 5C0XJ 4A3IH 1Q7YC 1KQSA 2ZM6L 1QVGA 3TREA 4YY3L 3GTJH 1VQ9A 3H0GG 3M4QA 5C44G 3AFQA 4ALPA 4O0AA 1K8GA 1L1OB 4A93H 2VZAA 1MJEA 4RG1A 1J6QA 2D0PA 3HKZG 3HFZB 5ELOA 4AYBG 2CKZB 5IP7H 3DLLA 3CMAA 1WFQA 4QJFA
chains in the Genus database with same CATH superfamily
1H9MA 3HS0C 1JOQA 4C2MH 2A6ED 3FEWX 5F2DA 4CDCC 3FPUB 5COYA 2G5DA 2IT1A 3HEJA 4QF4A 2E8GA 3KBGA 1STBA 2MHVA 4K0KQ 1A63A 1B2TA 4KKUA 4GNXA 1B1ZA 2XTIA 4DV0Q 5AFWA 2HIVA 5C44B 4LF5L 2QILA 1XPRA 1CKNA 3S14B 3MZ5A 3VR6A 1RHPA 3R2TA 4KHZA 4KHPL 4CJ1B 2NBFA 1TS4A 4N9PA 3SEBA 5CC4A 3S17H 1SE8A 2CWAA 2VQFL 3EFXD 2Q2TA 2C5CA 1ASYA 4A3GH 2B2WC 2RHSB 5C4ZA 3CU7A 1BVSA 1AW7A 3AFPA 3OPOA 1I94Q 3MFYA 3Q6SA 4JOIA 4R9WA 1X6OA 1IL8A 2NZOA 4AIMA 2I0QA 4K8JA 4F88A 2IHEA 3V96A 3RLOA 1Y1WH 3TBIB 2JA6H 3J7AV 4A3KG 4YWLA 3F2BA 3NK9A 5CBAE 4IUQA 2R92H 1S5CD 2WINB 2VL6A 1EQVA 2WP8J 2K03A 3W3AA 4NMZA 4DAYA 4ID6A 4POGA 1XNQL 1GJXA 1HUMA 1SEBD 1QOHA 1X3PA 4E6IA 3VYSA 1MBYA 3E5SA 4FDBA 4DV3L 4RGOS 1JICA 1CKMA 2MNAA 1VF7A 4KTAA 4HJ7A 1EU3A 3RR5A 2OF1A 1EL0A 1Y8OB 2GVAA 3GTLB 4A3KB 4O1NA 2ES2A 3MXGA 4K5VA 3UDGA 4F7XA 1D6EC 1JWUD 1D5ZC 2NTSA 1LO5D 4G4KA 1GKHA 4DR3L 4DV7L 1K8MA 1HTPA 1A2TA 1RDPD 3K0XA 1U5KA 4QB4A 4LF6Q 2GA4B 4XT3B 3QJYA 4A93G 3J81E 3GQBA 1EWCA 1A3TA 1JR0D 4FF2A 1AN8A 5C0XH 1LABA 4K5WA 1S40A 2PNHA 2WB1E 2ICEC 3D0FA 3M9BA 4LF8L 4JI2Q 3DUZA 1H9KA 1R4PB 1BCPC 2JA9A 3CPFA 4O42A 1ZYRD 1MHWC 4LFCQ 1QNKA 1VQLA 2A6EC 1E0BA 2JYOA 2Z4HA 2CW0D 4C3JH 4L5RC 2K4KA 2PQAB 2HCIA 3SK4A 1WD0A 1QUQA 1EQTA 1J5EQ 4A93B 2NN6H 2RDGA 3I4NB 1ESRA 3M4YA 4DN4M 2L1BA 4JV5Q 2QA4A 5E4XA 1L0WA 5IT9E 2IX1A 2E2JB 3MXUA 5CR3A 4X65Q 2FJ2A 4RHRA 1WTPA 1PLFA 3K0YA 2O4XA 1I50B 3MXNB 5CV5A 5DAUA 3V2TA 1DOKA 1PH2A 2PMZB 1Y14B 3PSIA 3I4LA 2IHFA 3GTKB 4L8JA 4HJAA 1X3EA 2K5NA 1C48A 4G7OC 3C1EA 1H9JA 4LF7Q 1HR0L 4BXXG 1DM0B 4JBJA 1K73C 1B44D 3J81j 2C35B 1ONLA 5M5XB 1MGSA 1XPUA 4QIWE 2V4DA 3F2UA 1RTOA 1AH9A 2MO1A 3NWSA 5HY6A 2DNEA 1K0SA 3EQLC 5C5MA 4JI1Q 4C56C 5EBDA 4A76A 1S5ED 3D8GA 1VQGA 3Q22A 4P72A 3NPPA 4PG3A 1LT4D 1SYEA 2FFKB 1FNUA 1VQ8A 5I6YA 4JOIC 4OEMB 4IFDJ 1STNA 1B4OA 3IFTA 2PZTA 3M7NA 3CQZH 3T1HL 1QG7A 1EEFD 2EY6A 3SR1A 3G7LA 4R1JA 3QB3A 4JI7Q 1JT8A 4I7ZC 2EY1A 3FKIG 5E7NA 2PPBC 5JEAH 1WTHA 5IYDG 4CKCA 3CCEA 3T51B 4U68A 4A4IA 4DV4Q 4HEDA 3P20A 2F0QA 3VR2A 2NN6I 3CF5A 5EBCA 4LWCA 4JI3Q 4P73A 4R4QA 5FOBB 3STBD 1UNSA 1TWAB 3U9OA 1YNND 1F9PA 4K8IA 3QG1A 2H5XA 3GTGB 4PNYA 2QEXA 3FKIB 3TZUA 4PQXA 2O5JC 1XWEA 2AWOA 2RCNA 3L7ZC 2N3SA 1MIUA 4F87A 2L4NA 1ZYRC 3FDTA 3I2ZA 1D7QA 3OW7A 1EUJA 4X66L 3SK5A 4A3DG 5TSSA 4DV6Q 2CW0C 2RQXA 3I8ZA 4LFBL 3G4SA 4IZ8A 4RHSA 3J81i 4DV1Q 4MN3A 1DGSA 1EIGA 1TY2A 1ET9A 3HKZE 4A3MG 4AYBE 2KUMA 4CJ0B 1PXUA 1KNEA 1VQ7A 2L11A 1GOZA 3NQIA 4EQPA 3OIPA 2VXWA 1IYUA 1Q86C 4GN5A 1BDOA 2E5LQ 4A3DB 2XGTA 2JA8H 4OL7A 2OEOA 1EY6A 1PFNA 4L6TB 4UP7A 5LHY1 3I72A 3F2CA 3PGZA 2HDLA 3HOXH 5M5YB 3J80L 1SNOA 3M4PA 1TWCB 3OSOA 2UU9L 2UXBL 4DAPA 4MHEA 3ZYYX 3TP7A 4A3MB 1K3BC 2OXPA 1EQRA 2JN4A 5C5LA 5FLXE 1N32Q 2ALYB 2QCPX 2J7ZA 1BKBA 3I4NH 4OX9L 4X3KA 5C6AA 5K36H 2AQ1B 5IP9G 3NP8A 2JQOA 3RZOB 2H1EA 3D4DA 5EKKA 3VA7A 1AE2A 1R9TB 1QE6A 4JYAL 1I50H 3DWQA 2JJQA 1TS2A 5M3MG 4GLAC 1KDAA 3KF6A 5K5PA 4ZKBB 4BS9A 4IUUA 3I4MG 4X3TA 4PZ6A 1K8AC 1TWFH 3HP3A 2DJGC 1M8AA 1OXXK 5M5XH 2GVBA 1RIPA 1EY8A 2ZTDA 2EXZA 1ICWA 4DXFA 4DUYQ 3ITPA 2G9HD 4N8FA 3HG9A 4BY1G 4MTKA 1JWSD 4AQYQ 5M3MB 3M3YB 2K75A 4DNRB 1E1TA 5FLMH 4UP9A 4OONA 1YNNC 4C3HG 4DR1Q 4QCLA 4IJHA 1GO3E 2Z1CA 4BXXH 4KD3A 1KAWA 3DXJC 3I4MB 5CV4A 2RCFA 3J7A5 2R3ZA 2F0IA 3FVQA 3S2DB 1PMRA 2ZJRA 1XNRL 4HN7A 3A8IE 1E24A 4EVOA 2NZ1D 2RSNA 1PH1A 3RNUA 4BY1B 1LTID 2KCCA 2JSOA 1F9RA 3PO2G 4JI0L 3I56A 1DOLA 1KLGD 3KDFA 4QIWB 4C3HB 4LF4L 2UUCL 5JVG3 1S3OA 2XVSA 4B9XA 3DM1A 2Q2UA 4FF1A 3S16B 3F2DA 1SJHD 3Q23A 2KECA 3KOJA 4NB3A 2I46A 1EWIA 1TWAH 2MP1A 3F1ZA 1BQQT 2EVBA 3GTGH 1WTVA 5C4JB 1VQPA 1SRUA 3CKIB 2L9HA 3NBHA 5IYDH 3N52A 4L5SA 3TZDA 4KV6A 4JI6Q 2NVQB 3SHLA 3PO2B 3NUCA 5G3LF 3DM3A 5H1SE 5JPNC 4FXDA 2MGSA 4RWSC 3CCUA 3GTMB 3KBXA 2B2VA 3IFDA 1SE2A 1YHBA 4IUNA 4H7BA 5IYCH 1KC8C 4K2LA 3V05A 2MJ8A 4QY7A 1A3UA 2WKCA 4NPSA 1O7ZA 4RCNA 5C0XJ 1SNMA 3TREA 1VQ9A 1CK1A 4O0AA 1L1OB 4RG1A 1J6QA 4L63B 1FGBD 2A5HA 3HKZG 5ELOA 4AYBG 1Z7TA 1BF4A 1HUNA 4CDEC 1XMOL 3LNNA 2F0VA 4Q0FA 5M5YH 2Z6BA 1O7YA 1TWCH 3PQIA 3LWEA 2NUCA 4PMCA 4GLVB 4JBMA 2F0NA 2IY5B 1EZ6A 3DHQA 2F0OA 3L9AX 1U9RA 1JE4A 4LK1C 4CKBA 1YVCA 1M90C 1GUNA 1HRJA 1B3QA 4JI8L 3HKZB 1SNQA 4AYBB 4KHPQ 2PI2A 2Z6KC 3P75A 5D3DA 1VQNA 2OT2A 3BU2A 1R9TH 1YI2A 1HA6A 2VQFQ 4YHHQ 3K58A 1PH7A 1TIID 4JK1C 3PF5A 4ILWA 3H3VC 4LW1A 3G6JB 3PUYA 3PIO3 4KI0A 3OIQA 3S15H 4OXPA 2WFWA 4FNFA 3BS1A 5IP9H 3S1RH 1PH8A 4A3EG 3FRPB 3HOUG 3PF4A 1ENFA 2A68D 4LMQD 1MSHA 1XNQQ 1K83H 2RF4A 1WCMH 3RN2A 1D1KA 2F0WA 1Q82C 1BO0A 3M3YH 1BCPB 1WTQA 1FD7D 2K7VA 3NTHA 4DV3Q 5EQ0A 2VB3X 4DKAC 3Q0AA 5DLQE 1A2UA 1KDBA 1I3QB 2UXDL 5IODA 1KLUD 2B2TC 2R7DA 4DNTB 4M8AA 1X54A 1RODA 5FJ8G 2JEAI 3GTOB 3G48A 3R93A 1FNWA 4DA2A 5JEAJ 4A3EB 3HOUB 1XX8A 4FXKC 3S24A 1ASZA 4JI4Q 2BA1A 1C4QA 4I65A 1PRTD 4LUOA 3KYHC 4DR3Q 2DY7A 4DV7Q 1HPCA 4LUZA 4BY1H 4A3IG 4V190 5EKLA 1ENCA 4IURA 2VNUD 4WRDA 5BR8L 1SMYD 3IRBA 1BOSA 3S16H 5A2QE 2JA7H 5IP7G 1SFOB 2KBNA 3SGIA 1F77A 2I07B 1PZJD 5DM73 3K5NA 1ILPA 4GNXB 3ULJA 1W6KA 2JE6I 3I90A 3GTPH 4P71A 3PUXA 2K6AA 1A6XA 4PMWA 2B2VC 5C4XG 2D0OA 1RJTA 3G71A 1CKNB 1QZHA 3H91A 2YU9H 2Q2HA 4A3IB 4WORA 4X62Q 1Y8NB 2NVQH 2F4VL 3K7AH 3PO2H 4OWTB 5FO9B 3KJOA 4YY3Q 2K5DA 1PH9A 1VQHA 1T5XD 1PHJA 5CGKA 3JAME 1FJGL 2E2HB 4ZCKA 1IKMA 3TSSA 2B29A 1GD7A 1BBXC 3U4VA 1STGA 1K3RA 1L0XB 1EOTA 4DR2L 1Z6HA 2RBMA 1I4XA 5C4XB 3HKSA 2L5TA 1B50A 4TRDA 1BBUA 1RTNA 4GKKL 1NTGA 1NSNS 1BR9A 4ME3A 5IGBA 4BBRG 4B9WA 4DAYB 1JQYD 1HR0Q 1BCPF 3HRZC 2EYHA 1SDFA 2UUAL 2F0UA 4HCSA 5LMNL 3U50C 5C3XA 2PNRC 1X3FA 3A8KE 1IBML 2ASBA 3BJUA 1HH2P 2XN9C 4DFAA 1UUPA 3HOYG 2X6GA 4L5TA 2F52A 3EIVA 3E0EA 3JC66 1GHKA 1LTGD 2A68C 4KK7A 2VW9A 1NMFA 1LM0A 2VQEL 1BNZA 1UWVA 4BBRB 1Z47A 3PUWA 1U4RA 2BOSA 3T1HQ 3QO2A 4DUZL 5HGTA 3IL8A 2KENA 4ULLA 3S1MB 3W5OA 1N36L 2ATWA 3D4RA 5KRUA 3HOYB 3U9SA 3OMCA 2HDMA 2NVYB 4TVAB 3CCQA 1F2MA 1GXDC 2BDOA 1PRTC 3NE5B 1HHVA 3HZXA 2EPBA 4J8QA 4DR7Q 2NVXB 1TXYA 1S5BD 2VUMH 2X69A 1S5DD 4BWGB 1YJ9A 3E0JA 2SNSA 5FO7B 1YBYA 4HMJA 1SMYC 2F0SA 1A0IA 3PV0A 3S1QB 2A73B 1QUQB 1PVOA 1PDQA 3A56A 4KMUC 4A3BG 1EOVA 3EVQA 4B3SL 1Y8PB 1CQVA 4WJ4A 3N6RA 4K6DA 2EYPA 4Z9CB 4ABNA 2CCZA 4KY5A 3AMUA 4ZUIA 2B2UA 3T4AC 2FHTA 4EGVA 1SYCA 5JVH3 4UPAA 4RGMA 1N9WA 4X66Q 2MPMA 3HOWH 2QGQA 1NAPA 1VQCA 2B8FA 1VQIA 3BG3A 2V1CC 1HNWL 1JWMD 3P7JA 4HTHA 4BBSG 1PH5A 4OWWB 1O7IA 1EY4A 4B3ML 3HOVG 3FHWA 4B3RL 3TRZA 2WKDA 5KNDA 5IE8A 4A3BB 3LWUA 1HTLD 1B3AA 1V1QA 2AQ2B 1Y1VH 3Q24A 2IW3A 3GTJB 2F0FA 4FVMA 1VQKA 4DR4L 1GUGA 1NNXA 2K5HA 1EZ8A 1SFOH 2JA5G 1GVPA 1EIFA 1Q1EA 4OELB 4YWKA 2CQAA 3KLSX 2R93G 1IBKL 4DV2L 2FMMA 4BBSB 5E3FA 4PMBA 2A19A 3HOVB 1DJRD 2UU9Q 3TS0A 5DEHA 1KABA 4O2DA 5J39A 2F3WA 5GROA 3JAMi 1PTOH 5IGEA 2KHJA 3I4OA 2HD3A 1B7YB 4ZYSA 3K6OA 4OX9Q 3GTQH 1G291 3P1HA 2LSSA 3DMUA 2JA5B 4H13C 1MD2D 1STEA 3W1BA 4XTCS 1G6PA 1OO9B 2MUYA 2R93B 2WIIB 1PH3A 5GADC 1D1IA 3KF8A 3SXHA 3KFUA 1B8AA 2E76C 4G7HC 5BN3A 5KIXA 1G51A 1FVIA 1T9HA 2PW5A 4KLKA 4YCUA 4JYAQ 4KHVA 5J1ZA 2XSCA 2D5DA 3HGBA 2NB0A 5C44H 1JB7A 3ER0A 5IGGA 4XDXA 3S14H 3KLRA 2BDNA 1Z9FA 1V43A 1VQ4A 3E6ZX 4GKJL 3ND9A 3GP7A 2B3GA 1VQAA 4XT1B 3H09A 2K04A 3EBEA 3UI2A 4X64L 2LS01 2L15A 1VQEA 1F2YA 1TWGB 1SROA 4DK0A 1KRTA 4APVA 1NR4A 4LNQA 1XPOA 4OIKA 2KQ3A 1EEID 3HOZG 4BBRH 1QVFA 4HMIA 2L12A 2N78A 3OTOL 4J6HA 1BUVT 1EYDA 2PI2E 2AUJD 4NKLA 3RUZA 5ELDA 3J81c 4PV1C 4A3CG 2VB2X 2R7ZG 3HOYH 4A3JG 5BN4A 2F0HA 3QWNA 3WDNA 4FYDA 1PYSB 4P74A 5I2XA 3BVMA 3J7YW 3PIP3 3PO3G 4JI0Q 2WAQE 2Q2IA 3O13A 5JJKA 4IPHA 2RVLA 4Y7NB 1SR3A 3QOJA 4N9TA 5AJ3Q 3HOZB 3NXWA 3GTLH 4A3KH 2B2UC 3S2HB 4H0LC 1CFMA 1MSGA 1K0RA 3H15A 5FO8B 4GOPA 3H94A 3BZDB 5LMUL 2A8VA 2OTJA 2R7ZB 1VCIA 4A3JB 2OWOA 2L0CA 2ZTCA 4LF9L 2YTYA 1QWYA 1PFSA 3WOEA 4IJLA 3I91A 1P8LA 3GD7A 3PO3B 2C9OA 3M4OB 3ULLA 4JPBW 4KN4C 4X6AH 3PUZA 2Z4IA 4RH6A 3NELA 4WFN3 1HA5A 1SBBB 1HNZQ 2XNAC 1BXTA 1ZEQX 3A7LA 4IFDG 2N8NA 1WOCA 4CDFC 3KF6B 4K14A 4HIKA 2BCOA 2HQLA 2NZHA 2CHBD 3J80E 1KD1C 2WB1G 1CKOA 3OYYA 1Q7YC 1QVGA 5JAVA 3GTJH 2LKVA 4CDDC 4ALPA 4A93H 1MJEA 2D2CC 2D0PA 1XTCD 3TMEA 1X3QA 5KNBA 2K5VA 2E2JH 2IL8A 1CSQA 4CBVA 3NWTA 2BH2A 1V1OA 2CH4A 5FLXL 4HIDA 1H95A 5KNCA 2WB1B 3TP6A 1Q1BA 5EAYA 2XWJB 3GTKH 4QMGA 3UE0A 1VQ6A 3MWYW 1NR2A 4FF4A 2Z6KA 1ML0D 4IPDA 4K6LA 1WTWA 3R8BA 1C7YA 1J9OA 2AUKA 3CD6A 4XQQA 3K8AA 2ZJPA 1IXRA 1UE7A 3D6WA 2OQ0A 1TKWB 4KN7C 4NXMQ 1E3PA 2J4XA 3D4WA 3KDFB 4A3FG 2DUDA 4Y52H 4RFBA 1EIYB 2KEDA 2RHQB 3VR4A 3J7AF 3STBC 3MFGA 2Q8IB 4EQNA 4BA2I 1PYWD 4DR6Q 3A55A 1OTCA 4IO9A 1ICFB 2EIFA 3MVVA 3RMHA 1GUTA 2B63G 4IUPA 3CW2C 1E2VA 1C0AA 3PUVA 1JJCB 4IUTA 1YEZA 4B3TL 3NBHB 1N8RC 1NUCA 3K5LA 4A3FB 1QNUA 2SDFA 2Z8LA 2F0LA 5EGTA 1GM5A 2B2TA 1GUSA 4DV4L 3S1NB 4TKOB 1LYLA 3A7AB 4JI5L 1X65A 1AZPA 2UXDQ 4HIOA 1YITA 4OO1G 4R4IA 1VQJA 5I9OA 4P2CB 2B63B 3UDXA 2PZWA 1SSOA 1F2LA 5BN5A 1A3VA 1RCVD 2N55A 2F0JA 1JC7A 1EYGA 2D62A 3FKIH 1X55A 4JW0A 4GOPC 3RLNA 2H4OA 2ID0A 1YHQA 4ZLTF 2CQOA 1OXSC 3HOZH 4EQOA 1G6ZA 1TT2A 1HNXL 3SVMA 4DF7A 3A5ZB 3S2HH 3KLWA 1Q81C 2SNMA 4Q5VA 5FLXc 1GHJA 2WAQG 1DZ1A 4DR5L 4A3CH 5DM63 1WTRA 3GV6A 5A35A 2EYJA 1G8ZD 2RKSA 1JMCA 5JJLA 2EXDA 1SXTA 2F4VQ 3PO3H 2ZM6Q 4YIJA 2PO4A 1LTSD 3NBIA 4TSSA 1EU4A 5EPLA 5I2YA 2E5LL 3J80i 4A3DH 2NVTB 4HIMA 2JP1A 4M1UB 5CV9A 4HSPA 2I5HA 1HFNA 4C3IG 1FJGQ 4A75A 3S9WA 5JJZA 1SLJA 2WAQB 1O80A 4A3GG 1LLRD 4IPGA 2EYLA 1STHA 2Y0SE 3EJIA 1GUWA 3CXCA 4AH6A 5JPMC 4DR2Q 1CSPA 1G91A 4A3MH 2E75C 3DEPA 5EKIA 4CKEA 1UEAB 4FF3A 2LMCB 4GKKQ 3AB9A 2L55A 3AU7A 3A54A 4LF5Q 4BY7G 1Y1WG 3EROA 1Q12A 1KRSA 2UUAQ 2LFNA 2R92G 1PRTB 1EQQA 3RZOH 3S17B 5LMNQ 2DNCA 4C3IB 2EZVA 3F8TA 4OIJA 1IBMQ 4J15A 1V1PA 1XMQL 1MJCA 1HZ9A 4A3GB 1I5FA 1JOKA 2F3VA 3FMCA 3MA2B 4F8MA 5I6WA 2CFMA 1QCBD 2BE5D 2MQHA 2VQEQ 2XRQD 5I9PA 4BY7B 1Y1WB 3DWPA 3D31A 2R92B 1B9MA 4DAMA 1CI3M 2A6HD 1U0LA 4UP8A 3PIPA 4DUZQ 1H9SA 2WV6D 5GAHC 1E1OA 2K32A 4R8NA 4IALA 1KL9A 4AQYL 1M4VA 5M3MH 2LY7A 1LUZA 2XIWA 1SN8A 3A8JE 4RMFA 5C0XG 3D3RA 1LTLA 4JVZA 2KOLA 3UE1A 3I73A 1A62A 5L37A 1W2BA 3I4MH 4IQZA 3W2DA 1PZKD 4UHVA 4YCVA 1FNVA 5IGFA 3S2DH 1ENAA 1N34L 5I4DA 1L0YB 3WWVA 5CORA 4B3SQ 1TWHB 4C3JG 4J1MA 1EY9A 4C3HH 5C3WA 4XQNA 1LTAD 3H3VI 1SNCA 1S5FD 4R4TA 1WVLA 1PZID 5EJWA 2B63H 4X3UA 3K81C 1DCZA 5GQOA 2F0GA 2XWBB 4NP5A 4LF8Q 5CBEE 4GN3B 3A0JA 1Q8IA 4N8X1 3TDQA 3EA6A 4IFDI 3NHHA 4B3MQ 1PRTF 4B3RQ 3K80C 5C4JH 2O2LD 1EY5A 2UXCL 1OXUA 3TEHB 2ZXOA 5CYUA 1VQMA 2OTLA 4C3JB 4A3LG 4ME5A 1TVXA 1Y69U 3CC7A 4OO1H 3U58A 2YTXA 3I70A 3BYTB 3TQYA 3GTMH 3E9IA 1D8LA 1IBKQ 2E74C 4JCVE 3URYA 4DV2Q 5D3IB 1HQRD 2GN5A 4OWXB 4KY6A 1UE5A 3I7FA 2WACA 3LX0A 1F2ZA 5ELNA 1IBLL 2AKWB 4U673 1VMPA 2R6GA 4R4CA 4R4OA 1VQBA 2UUBL 2EYFA 2KCMA 2NVTH 4NXNL 1M1KC 1Q46A 2F4IA 3W1GA 3ND8A 4HAEA 2VY3A 4IOCA 4LFAL 1IHZA 2BE5C 3T16A 1LT6D 1YNJD 4DK3C 1NCVA 4BA1I 3SDZA 3X3NA 1AFPA 3DEOA 5JEAG 2ZT9C 1U4LA 2A6HC 2PQEA 2XRSD 3CCVA 2QDBA 1BBWA 4POFA 1IKLA 3CC2A 1ESFA 5IWAL 1DYQA 1NJIC 2F03A 4DV5L 3CCSA 2Y0SG 2RDHA 1SNPA 1SYFA 2F0MA 2Z9HA 2EE1A 3CQZB 4C3IH 1WJJA 2A1AA 1CUKA 1X32A 1UE1A 4YHHL 1N33L 4GKJQ 1IYVA 2KCNA 1STAA 3GO5A 4ZRZA 3BDCA 1V9PA 1A15A 1PH6A 1L1OC 5IGCA 1HZCA 3R2IA 4X64Q 2J0TD 3PCOB 1F9SA 3T56B 1X9NA 4KKTA 5LL6X 2O5IC 1PV4A 5M9OA 1EY0A 1WD1A 1KHIA 4BY7H 2PW7A 1CTMA 1PTOD 4DXGA 2Y0SB 2YYZA 3OTOQ 2I5MX 4OO1I 1ILQA 3QR8A 4MZ9A 4RKLA 1TQOA 4RKBA 4DK1A 1II3A 5ELBA 1L2FA 2EJFC 2BA0A 1OXVA 3BZCA 1KIXA 4DAVA 3NEMA 5ELEA 1K9MC 1VQFA 3GDEA 1PFBA 2DGYA 5CMDA 1I3QH 2K52A 5ISRA 1PTOF 2JA8G 1C9OA 1EYAA 1O7LA 1STYA 4CGYB 2KA7A 1RKNA 4IPCA 2F0PA 5DNFA 3GTOH 3OHXC 1FL0A 1OXTA 4HCEA 3HOXG 2M9VA 4A3EH 3HOUH 4LFBQ 4LJZC 4JI4L 4FP5D 4HSVA 5LMUQ 2OQKA 2EJGC 2EYMA 4RA8A 1LTTD 3BDLA 1TWHH 1X56A 4GN4B 4TQUS 4LF9Q 1XJVA 3JAMc 1DD2A 3WOFA 4RGNA 1RD9D 4NW2A 1HFGA 3J81L 4PZ8A 3VYRA 2HHHL 3BDOA 5E1FA 3I4NG 2Z0SA 3T1YL 3KF8B 3IKJA 1HQMC 5K36G 2IWHA 5KEEA 3CP0A 4GZYC 2JA8B 1PYBA 2QEJC 3NENA 2ZXPA 5EPKA 1NMGA 4EX5A 1YHAA 5FJ8H 4K5XA 3CCJA 5J22A 1D5XC 3MEFA 3K5MA 1DONA 1AZQA 5IGDA 1W3SA 2F0TA 3QOLA 3HOXB 3EN2A 1JB3A 2K5QA 1I6HB 1FR3A 4CHTB 3VYTA 3RN5A 1I6VC 4HJ9A 3B6YA 1SNDA 2UXBQ 2F1MA 4X62L 2AWNA 4A3IH 1C8CA 2D9UA 4XIGS 1YNJC 4XYOA 2HUGA 5KYIA 4YY3L 3H0GG 3AFQA 3BYYB 2VZAA 1LTRD 3HFZB 5IT9L 5IP7H 4QUFA 1WFQA 4QJFA 2E2HH 3M7GA 3K57A 4UAIA 3PIOA 3VR5A 1EFWA 1VMCA 2RSOA 1HZAA 5C4XH 4K0KL 3TN2A 5FLMG 4QUCA 4DV0L 4EQ5A 4A3LH 2B2YA 3H0GB 3I3CA 3J7ZC 3X3MA 2Q8TA 4GNXC 2PCFB 5JOBA 1TWFB 3LGJA 4JG2A 1YIJA 2IJ0A 2PQAA 2RDFA 2NYZD 2EQSA 3OWFA 3CAMA 2M00A 2MO0A 1PTOC 1SE3A 4PZ7A 4XQJA 3H6MA 1I94L 1B70B 1WYDA 1JORA 3M85A 4GOPB 3MXNA 4YWMA 5C0XI 3PMFA 4GLXA 1EY7A 1U4PA 5T1GA 2A74C 3ERQA 1Q8KA 5ELCA 2EDGA 4B3TQ 1FYCA 3S1MH 1QZGA 5KYLA 4XXEA 2LXJA 3E3XA 1XNRQ 4XYQA 1QILA 2R61A 2NVYH 2ZXRA 3CCRA 4DR7L 4DPGA 4JI5Q 4LF4Q 2NVXH 2UUCQ 1EWHA 3CC4A 5EPJA 2K14A 5CV6A 1W6JA 4UY8C 2KHSA 5IYCG 3S1QH 1CM9A 2SEBD 1HCZA 3OW2A 1MI2A 4KJNA 2QKIC 3QIAA 4X3SA 4LF6L 1EIHA 1NE3A 2F0EA 4IOAA 1JE5A 5IT9c 2JEBI 1K28A 3L0OA 1WTOA 1HNXQ 1KNAA 1EYCA 4S3SA 1ZXTA 1I4HA 1XYIA 1B9NA 2FXQA 2VS1A 1A8VA 4JI2L 1DXMA 1UAPA 5LL6S 4DR5Q 4UDUC 4MIUA 2SOBA 1TU2B 4A3BH 4LFCL 4KJOA 2FMCA 1J5EL 3L2PA 3CCMA 1TS5A 3AQQA 3KLSA 4JV5L 1LTBD 3NQTA 2R7FA 2PZUA 4JBWA 2B8GA 5GAGC 1XMOQ 4X65L 4OGQC 4BBSH 1I6HH 1I4GA 1PH4A 3HOVH 5GAEC 2KCTA 2LXKA 3MAQA 5LMNW 4LAAA 1NBWA 3BZKA 3MEHA 4H02A 1U4MA 4IUVA 3TP8A 2QW7A 5CV7A 1K8OA 4LF7L 5CV8A 2JA5H 1SMXA 2AHOB 1YJNA 1JCKB 4JI8Q 5M3FG 2B2YC 1Q90A 3CRKC 2CWPA 1IW7D 1RF2D 3OMGA 2R93H 2ICIA 1XMQQ 1WCMG 4FXGC 2YV5A 4KY7A 2JXMB 2DY8A 1VQ5A 5D14A 4C1NI 4JI1L 5E4WC 2Q8RE 2K5WA 5C3EG 1G2TA 3S15B 2CH4W 2N49A 3H0GH 1KDCA 4MNOA 1D2BA 2AQ3B 1PFMA 4ZK9B 2HCCA 1NY4A 1SYGA 4NDXA 4ODGA 2F0KA 2FINB 3S1RB 2HT1A 1KAAA 5M3FB 1VDZA 2EJMA 3TS2A 1XTDA 4JBKA 4JI7L 1K83B 2K01A 3T13A 1WCMB 3AEVA 2YTVA 1H9RA 3BVZA 5IYBG 1F9QA 5D65A 3C46A 4G7ZC 4GS3A 1TWGH 5C3EB 1S4ZA 1B53A 5FKAC 2JA7G 5J3BA 1CHQD 1E2WA 5HGQA 2KJXA 2F3IA 4JI3L 5IOCA 3U4ZA 1N34Q 3DWAA 2MFIA 1CA5A 3UDIA 3KJPA 1MKHA 1CA6A 1VQDA 1X3GA 4G57A 3MC0B 2TMPA 1IL2A 3RZDB 1O78A 2IPKD 2HQEA 3NTKA 4ZAIA 3D6CA 3BVGA 3RLFA 4RAUC 5G3LD 5BR8Q 5AJ3L 4Y7NH 1LT5D 4FO2A 5M5WB 4WJWA 2JA7B 1SAPA 3VR3A 3J80c 1E7ZA 3VA5A 4DV6L 2E2IB 2EY2A 3VYUA 3C2PA 3KUPA 2JK8A 4HR7B 4DV1L 3FP9A 4DNIA 2K33A 3GTPB 1KXLA 1LV9A 4RCOA 3C3LA 2R7ZH 3L3OC 2NTTA 4JC0A 4CJ2C 4A3JH 2IX0A 3FPPA 2TSSA 3KK7A 2YU9B 2UXCQ 2ENBA 3K7AB 2BH8A 3M4OH 1V1PB 4P75A 4MTNA 1Q3LA 1YZ6A 3CRLC 3OOCA 1HNZL 1YJWA 4HJ8A 1VS0A 4ZUJA 1SYBA 1AE3A 4C2MB 1HR0W 1GUOA 2QF7A 2K50A 3ONAB 3Q8DA 3MTSA 1VF5C 1IW7C 1IBLQ 1N32L 1AEXA 4KKSA 4QL5A 4I7AA 3H3VH 4H44C 3UDFA 2UUBQ 4B08A 1PA6A 3MHBA 1H9SB 3CMEA 3G6EA 2JA6G 2K05A 4NXNQ 2DN8A 3NSWA 2I5LX 1G2SA 2A69D 4LFAQ 2EOTA 3ULPA 1WTXA 4IFDH 1IZ6A 4KD4A 1DOMA 1UE6A 1TS3A 4WJ3M 3ICEA 4QGUA 1EFID 3AYHB 3CPWA 2G9DA 5IWAQ 1VQOA 4DV5Q 2VUMG 4YCWA 5IY0A 1YNXA 4DU9A 2JA6B 1SE4A 2B2WA 1JOOA 1FGUA 4NXML 1CZWA 1I4PA 3K5OA 1L1OA 1N33Q 1LT3D 2F0DA 1JJGA 3RD4A 4DUYL 4ZQ3A 1TR5A 2CVRA 1N36Q 1R4QB 5HURA 4LUVA 3A74A 3C1FA 1JJ2A 4DGZA 1D5MC 1SJED 2M2LA 4DR1L 1HXYD 4DR6L 2RA4A 2NWGA 2PYKA 3CCLA 1I4RA 1QB5D 2DJFC 4QQBX 2IX3A 5IIFA 3GV3A 3HOWG 2VUMB 2KVMA 3MXPA 1ZKOA 2N88A 5M3FH 1QJOA 1TY0A 2HIXA 1CQFA 1CZGA 1CT1D 1I4QA 1UEBA 3SK8A 1P16A 2P5ZX 2EYOA 4A3FH 2KEEA 3NTIA 4HJ5A 1Y1VG 1IYJB 5C3EH 3S1NH 4R8IA 3CHBD 4ZKCB 5FK9C 2NN6G 1XXGA 1RL2A 4V0BA 1T5EA 3HOWB 2PMZE 3SK6A 2ZTEA 4OHJA 2EY5A 2OCEA 1HNWQ 3R3OA 1LACA 3I55A 2K1BA 2QDLA 3TP5A 3K7UC 2E2DC 5IYBH 3RZDH 3IAYA 1WI5A 4C1NK 1KTKA 1Y1VB 4JI6L 3OWEB 2HHHQ 5A2QL 5NUCA 4L5QA 1S72A 4IN3A 3T1YQ 5M5WH 5JJIA 4DR4Q 1SYDA 1ET6A 3E9HA 3VDYA 2E2IH 3A5UA 2K28A 1QVCA 3ZJYC 1E22A 1J8IA 4DK6C 2KHIA 1AP0A 2B39A 1V8QA 2AMCB 3ERSX 2X6LA 1HZBA 3K59A 5ELFA 2ZJQA 4RGTA 2A69C 3T53B 5T1IA 1HJPA 1PTOB 1KQSA 2ZM6L 1E2ZA 3M4QA 3SE0A 5C44G 1K8GA 5KGUA 3GTQB 1BCPD 3JAML 1CHPD 2CKZB 3DLLA 3CMAA 4K2KA 5C4HA
chains in the Genus database with same CATH topology
2E2HH 2E2JH 2K5VA 1XMOL 4C2MH 5M5YH 1CSQA 3PIOA 2BH2A 1TWCH 1EFWA 2IT1A 1HZAA 4GLVB 4HIDA 5C4XH 1H95A 2E8GA 4JBMA 4K0KL 4K0KQ 1A63A 2IY5B 5FLMG 4GNXA 1Q1BA 5EAYA 4DV0L 2XTIA 4DV0Q 3GTKH 3UE0A 4EQ5A 1VQ6A 4A3LH 2HIVA 4LF5L 3J7ZC 1XPRA 4GNXC 1CKNA 2Z6KA 1YVCA 1M90C 4IPDA 3LGJA 4JG2A 4JI8L 4KHZA 4KHPL 1YIJA 4KHPQ 2PQAA 1C7YA 3S17H 3CD6A 2PI2A 1SE8A 2Z6KC 3K8AA 2ZJPA 2EQSA 1VQNA 1IXRA 1UE7A 3BU2A 2CWAA 2OQ0A 2VQFL 3CAMA 2VQFQ 1YI2A 4YHHQ 1R9TH 1E3PA 2MO0A 2Q2TA 1ASYA 4A3GH 3KDFB 4PZ7A 4A3FG 1PH7A 2DUDA 2RHSB 4Y52H 1BVSA 3PF5A 3AFPA 1I94L 1I94Q 4LW1A 1EIYB 1B70B 1WYDA 2RHQB 3PUYA 4JOIA 3STBC 1X6OA 4KI0A 3S15H 2NZOA 4AIMA 3M85A 2I0QA 4BA2I 4DR6Q 4OXPA 4GOPB 2IHEA 4IO9A 3RLOA 2WFWA 1OTCA 2EIFA 4YWMA 5C0XI 1Y1WH 4GLXA 2JA6H 4A3KG 4YWLA 3F2BA 2B63G 3CW2C 2R92H 5IP9H 3S1RH 1PH8A 2VL6A 3PUVA 1Q8KA 1C0AA 2WP8J 1JJCB 4A3EG 1YEZA 4B3TL 3NBHB 4B3TQ 3HOUG 3PF4A 4POGA 1N8RC 1XNQL 1XNQQ 1K83H 3S1MH 2RF4A 1WCMH 3RN2A 1QZGA 2LXJA 1XNRQ 1Q82C 3M3YH 2NVYH 4FDBA 1GM5A 4DV3L 4DV3Q 3CCRA 4DKAC 4DV4L 1CKMA 4DR7L 5DLQE 1LYLA 4JI5L 1X65A 4DPGA 4JI5Q 2NVXH 2UUCQ 2MNAA 4LF4Q 4HIOA 2UXDL 2UXDQ 4HJ7A 2R7DA 3RR5A 1YITA 3CC4A 4OO1G 4R4IA 1VQJA 2GVAA 1X54A 2K14A 3UDXA 5FJ8G 2JEAI 2ES2A 3G48A 3UDGA 4UY8C 5JEAJ 5IYCG 3S1QH 3S24A 1ASZA 4JI4Q 2BA1A 1GKHA 4LUOA 1EYGA 4DR3L 3KYHC 4DV7L 4DV7Q 2D62A 3FKIH 4DR3Q 1X55A 4LUZA 3OW2A 4BY1H 4A3IG 4GOPC 3RLNA 2VNUD 3K0XA 1U5KA 4LF6L 4LF6Q 1NE3A 2ID0A 1YHQA 4IOAA 1JE5A 5IT9c 5BR8L 2CQOA 4A93G 2JEBI 1OXSC 3IRBA 3HOZH 3S16H 3L0OA 1S40A 1HNXL 1HNXQ 2JA7H 5IP7G 3A5ZB 2PNHA 3S2HH 2WB1E 2KBNA 3KLWA 3SGIA 1Q81C 3D0FA 3M9BA 2FXQA 2VS1A 5FLXc 4LF8L 2WAQG 4GNXB 1A8VA 3ULJA 4JI2L 4JI2Q 2JE6I 2JA9A 3CPFA 3GTPH 4P71A 3PUXA 4DR5L 4DR5Q 4A3CH 4PMWA 5C4XG 2D0OA 4A3BH 3G71A 1CKNB 4LFCL 1QZHA 4LFCQ 2YU9H 2Q2HA 1VQLA 1JMCA 5JJLA 4X62Q 2EXDA 2F4VL 3K7AH 2F4VQ 4C3JH 4L5RC 2K4KA 2PQAB 2NVQH 2ZM6Q 3PO2H 1QUQA 4OWTB 3KJOA 3PO3H 4YY3Q 1J5EL 3L2PA 1J5EQ 3CCMA 2E5LL 3AQQA 1PH9A 3J80i 4A3DH 4HIMA 1VQHA 4JV5L 4JV5Q 2QA4A 1PHJA 2R7FA 1L0WA 2I5HA 2IX1A 1FJGL 1FJGQ 4A75A 4JBWA 2B29A 1GD7A 5GAGC 3U4VA 1XMOQ 1SLJA 4X65L 4X65Q 4A3GG 1K3RA 4BBSH 1I6HH 4IPGA 1PH4A 2Y0SE 3HOVH 5GAEC 3CXCA 4AH6A 4DR2L 4DR2Q 2KCTA 2LXKA 1CSPA 3MXNB 5LMNW 4A3MH 3HKSA 1PH2A 1BBUA 1NBWA 1Y14B 3BZKA 3PSIA 2IHFA 4H02A 4HJAA 1X3EA 4GKKL 1NTGA 4GKKQ 2K5NA 4ME3A 4LF7L 4BBRG 4LF7Q 1HR0L 4LF5Q 1HR0Q 4DAYB 1Y1WG 4BY7G 4BXXG 1Q12A 2JA5H 1SMXA 1KRSA 2AHOB 4JBJA 2UUAL 2UUAQ 1K73C 1YJNA 2R92G 4JI8Q 5M3FG 3J81j 2C35B 1EQQA 3RZOH 5LMNL 5LMNQ 2CWPA 1XPUA 4QIWE 3U50C 2R93H 1AH9A 3F8TA 1X3FA 2ASBA 1IBML 1IBMQ 4J15A 3BJUA 1HH2P 1MJCA 1XMQQ 1WCMG 2MO1A 1HZ9A 2YV5A 1XMQL 5HY6A 1I5FA 3HOYG 1VQ5A 4L5TA 2F52A 3EIVA 3E0EA 4JI1L 4JI1Q 3JC66 4A76A 2CFMA 5C3EG 2N49A 2VW9A 1NMFA 3H0GH 1VQGA 2MQHA 4P72A 4MNOA 1LM0A 4PG3A 2VQEL 2VQEQ 1VQ8A 1UWVA 1Z47A 4JOIC 4IFDJ 1NY4A 3D31A 3PUWA 3M7NA 3CQZH 2HT1A 3T1HL 4DAMA 4UP8A 3PIPA 1U0LA 3T1HQ 4DUZL 4DUZQ 1XTDA 3TS2A 5GAHC 2KENA 4JI7L 4R1JA 4JI7Q 4JBKA 3W5OA 1N36L 1JT8A 3FKIG 5E7NA 2ATWA 3AEVA 1E1OA 2YTVA 1KL9A 4AQYL 5IYBG 5M3MH 1LUZA 5IYDG 4GS3A 4TVAB 3CCQA 1TWGH 1SN8A 3CCEA 4A4IA 4RMFA 5C0XG 4DV4Q 4DR7Q 2JA7G 1TXYA 5J3BA 1LTLA 2VUMH 1W2BA 3UE1A 3I4MH 1A62A 5HGQA 2NN6I 3CF5A 2F3IA 4LWCA 4JI3L 1YJ9A 4JI3Q 4P73A 4R4QA 4YCVA 3U4ZA 1YBYA 3S2DH 3STBD 1A0IA 1N34L 1N34Q 2MFIA 3PV0A 1QUQB 1PVOA 3UDIA 2H5XA 3KJPA 1MKHA 4A3BG 1VQDA 1X3GA 2QEXA 1EOVA 4B3SL 3WWVA 4B3SQ 1IL2A 4WJ4A 2AWOA 2RCNA 3L7ZC 2N3SA 2CCZA 1MIUA 4C3HH 3RLFA 3I2ZA 5BR8Q 1D7QA 5AJ3L 4Y7NH 4UPAA 1EUJA 4X66L 3H3VI 1N9WA 4X66Q 4A3DG 4R4TA 3HOWH 2QGQA 2B63H 3J80c 1VQCA 1E7ZA 1VQIA 3K81C 4DV6Q 4DV6L 2V1CC 1HNWL 5GQOA 2JK8A 4LFBL 4DV1L 4LF8Q 3G4SA 4DV1Q 3J81i 3FP9A 4BBSG 4DNIA 1DGSA 4GN3B 3A0JA 1PH5A 4OWWB 1O7IA 4IFDI 4B3ML 3HOVG 3FHWA 4B3MQ 1KXLA 4B3RL 3TRZA 2R7ZH 4JC0A 4B3RQ 5IE8A 3HKZE 4A3JH 2IX0A 4AYBE 4A3MG 3K80C 5C4JH 2UXCL 1OXUA 2UXCQ 3TEHB 1VQMA 1V1QA 1Y1VH 1VQ7A 2OTLA 2BH8A 4A3LG 3M4OH 1VQKA 4DR4L 2K5HA 1SFOH 3CC7A 4GN5A 1GVPA 1Q86C 2JA5G 4P75A 4MTNA 2E5LQ 1EIFA 1Q1EA 2XGTA 1YZ6A 2YTXA 3U58A 2JA8H 1HNZL 3TQYA 4YWKA 1YJWA 3GTMH 4HJ8A 3E9IA 2R93G 1D8LA 1VS0A 4UP7A 1IBKL 1IBKQ 4JCVE 4DV2L 4DV2Q 1AE3A 3F2CA 3PGZA 3HOXH 1HR0W 2GN5A 4OWXB 1UE5A 2A19A 2K50A 3I7FA 3M4PA 3Q8DA 2UU9L 2UU9Q 3PO2G 2UXBL 3TS0A 4O2DA 3JAMi 5GROA 5ELNA 1IBLL 1IBLQ 2AKWB 1N32L 1EQRA 2R6GA 4R4CA 4R4OA 2KHJA 1VQBA 1N32Q 3I4OA 2ALYB 4QL5A 1B7YB 3H3VH 1BKBA 3UDFA 2UUBL 2UUBQ 4NXMQ 3I4NH 4OX9L 4OX9Q 3GTQH 1G291 2KCMA 1PA6A 3CMEA 2NVTH 3G6EA 2LSSA 4NXNL 1M1KC 1Q46A 4NXNQ 2JA6G 3W1GA 2I5LX 2VY3A 4IOCA 5IP9G 4LFAL 2JQOA 4XTCS 4LFAQ 3W1BA 1G6PA 3ULPA 1PH3A 5GADC 3KFUA 1IZ6A 1AE2A 4DK3C 1B8AA 1UE6A 4BA1I 1G51A 4WJ3M 1FVIA 1I50H 1T9HA 4KLKA 4YCUA 3ICEA 4JYAL 4JYAQ 2JJQA 5JEAG 5M3MG 4GLAC 3CCVA 1BBWA 4QGUA 4POFA 3KF6A 3CPWA 3AYHB 5C44H 3CC2A 5IWAL 1NJIC 5IWAQ 1JB7A 4DV5L 1VQOA 4DV5Q 2VUMG 4YCWA 3ER0A 3CCSA 4PZ6A 2Y0SG 5IY0A 1K8AC 1TWFH 3I4MG 3S14H 1YNXA 1Z9FA 1V43A 1OXXK 1VQ4A 5M5XH 2GVBA 1FGUA 1RIPA 1WJJA 1CUKA 2A1AA 4C3IH 1UE1A 4NXML 1L1OA 2ZTDA 4GKJL 4YHHL 1N33L 4GKJQ 1N33Q 3GO5A 1JJGA 2B3GA 4DUYL 1VQAA 4DUYQ 1V9PA 1PH6A 3EBEA 1L1OC 1N36Q 4LUVA 3A74A 1HZCA 4BY1G 4X64L 4X64Q 2L15A 4AQYQ 1JJ2A 1VQEA 2K75A 3PCOB 1E1TA 5FLMH 4UP9A 1X9NA 4OONA 4DR1L 1PV4A 1SROA 4DR1Q 4DR6L 1KRTA 4APVA 4LNQA 4IJHA 1GO3E 1XPOA 3CCLA 3HOZG 4BBRH 4BXXH 1KHIA 4BY7H 1QVFA 1KAWA 4QQBX 3HOWG 2N78A 2YYZA 3OTOL 3OTOQ 2I5MX 3J7A5 4OO1I 5M3FH 2HIXA 4MZ9A 1UEBA 2PI2E 1P16A 3J81c 2ZJRA 4A3CG 1L2FA 1XNRL 2R7ZG 2BA0A 1OXVA 4A3JG 4A3FH 3HOYH 3BZCA 1E24A 1PH1A 1KIXA 1PYSB 3NEMA 4P74A 3RNUA 4HJ5A 1Y1VG 1IYJB 1K9MC 5C3EH 1VQFA 3GDEA 4JI0L 4JI0Q 2WAQE 2DGYA 3I56A 2Q2IA 3PO3G 3KDFA 4LF4L 3S1NH 2UUCL 5JJKA 1I3QH 2K52A 4IPHA 2NN6G 1S3OA 1SR3A 5AJ3Q 2Q2UA 2JA8G 1C9OA 3F2DA 1RL2A 3GTLH 3KOJA 4IPCA 4A3KH 2PMZE 4NB3A 2ZTEA 3GTOH 1EWIA 1K0RA 1FL0A 1TWAH 1OXTA 2OCEA 3H15A 4GOPA 3F1ZA 3HOXG 1HNWQ 4A3EH 3I55A 3HOUH 4LFBQ 4JI4L 5LMUL 5LMUQ 2OQKA 3GTGH 2A8VA 2OTJA 1VCIA 2OWOA 3K7UC 5IYBH 3RZDH 1VQPA 1TWHH 1X56A 1WI5A 2ZTCA 4GN4B 4TQUS 4LF9L 2YTYA 1XJVA 1PFSA 1SRUA 3JAMc 4LF9Q 5IYDH 4IJLA 4L5SA 4PZ8A 4JI6L 4JI6Q 2HHHL 1P8LA 2HHHQ 3GD7A 3I4NG 2Z0SA 4L5QA 1S72A 3T1YL 3DM3A 3ULLA 5M5WH 5H1SE 3T1YQ 3KF8B 5JJIA 4X6AH 4DR4Q 5K36G 3E9HA 3CP0A 3VDYA 2E2IH 3PUZA 3A5UA 1PYBA 3NENA 3CCUA 1NMGA 1QVCA 3NELA 4EX5A 3ZJYC 1E22A 1YHAA 1HNZQ 5FJ8H 4DK6C 3CCJA 2KHIA 4IFDG 3MEFA 2N8NA 1YHBA 1WOCA 2AMCB 1W3SA 3ERSX 5IYCH 1KC8C 3KF6B 3EN2A 1HZBA 4HIKA 3RN5A 2HQLA 2NZHA 4HJ9A 2ZJQA 3B6YA 4QY7A 1KD1C 2UXBQ 2WB1G 4X62L 1CKOA 2AWNA 4NPSA 1HJPA 3OYYA 4XIGS 5C0XJ 4A3IH 1Q7YC 1KQSA 2ZM6L 1QVGA 3TREA 4YY3L 3GTJH 1VQ9A 3H0GG 3M4QA 5C44G 3AFQA 4ALPA 4O0AA 1K8GA 1L1OB 4A93H 2VZAA 1MJEA 4RG1A 1J6QA 2D0PA 3HKZG 3HFZB 5ELOA 4AYBG 2CKZB 5IP7H 3DLLA 3CMAA 1WFQA 4QJFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2H H;  2E2J H;  2K5V A;  1XMO L;  4C2M H;  5M5Y H;  1CSQ A;  3PIO A;  2BH2 A;  1TWC H;  1EFW A;  2IT1 A;  1HZA A;  4GLV B;  4HID A;  5C4X H;  1H95 A;  2E8G A;  4JBM A;  4K0K L;  4K0K Q;  1A63 A;  2IY5 B;  5FLM G;  4GNX A;  1Q1B A;  5EAY A;  4DV0 L;  2XTI A;  4DV0 Q;  3GTK H;  3UE0 A;  4EQ5 A;  1VQ6 A;  4A3L H;  2HIV A;  4LF5 L;  3J7Z C;  1XPR A;  4GNX C;  1CKN A;  2Z6K A;  1YVC A;  1M90 C;  4IPD A;  3LGJ A;  4JG2 A;  4JI8 L;  4KHZ A;  4KHP L;  1YIJ A;  4KHP Q;  2PQA A;  1C7Y A;  3S17 H;  3CD6 A;  2PI2 A;  1SE8 A;  2Z6K C;  3K8A A;  2ZJP A;  2EQS A;  1VQN A;  1IXR A;  1UE7 A;  3BU2 A;  2CWA A;  2OQ0 A;  2VQF L;  3CAM A;  2VQF Q;  1YI2 A;  4YHH Q;  1R9T H;  1E3P A;  2MO0 A;  2Q2T A;  1ASY A;  4A3G H;  3KDF B;  4PZ7 A;  4A3F G;  1PH7 A;  2DUD A;  2RHS B;  4Y52 H;  1BVS A;  3PF5 A;  3AFP A;  1I94 L;  1I94 Q;  4LW1 A;  1EIY B;  1B70 B;  1WYD A;  2RHQ B;  3PUY A;  4JOI A;  3STB C;  1X6O A;  4KI0 A;  3S15 H;  2NZO A;  4AIM A;  3M85 A;  2I0Q A;  4BA2 I;  4DR6 Q;  4OXP A;  4GOP B;  2IHE A;  4IO9 A;  3RLO A;  2WFW A;  1OTC A;  2EIF A;  4YWM A;  5C0X I;  1Y1W H;  4GLX A;  2JA6 H;  4A3K G;  4YWL A;  3F2B A;  2B63 G;  3CW2 C;  2R92 H;  5IP9 H;  3S1R H;  1PH8 A;  2VL6 A;  3PUV A;  1Q8K A;  1C0A A;  2WP8 J;  1JJC B;  4A3E G;  1YEZ A;  4B3T L;  3NBH B;  4B3T Q;  3HOU G;  3PF4 A;  4POG A;  1N8R C;  1XNQ L;  1XNQ Q;  1K83 H;  3S1M H;  2RF4 A;  1WCM H;  3RN2 A;  1QZG A;  2LXJ A;  1XNR Q;  1Q82 C;  3M3Y H;  2NVY H;  4FDB A;  1GM5 A;  4DV3 L;  4DV3 Q;  3CCR A;  4DKA C;  4DV4 L;  1CKM A;  4DR7 L;  5DLQ E;  1LYL A;  4JI5 L;  1X65 A;  4DPG A;  4JI5 Q;  2NVX H;  2UUC Q;  2MNA A;  4LF4 Q;  4HIO A;  2UXD L;  2UXD Q;  4HJ7 A;  2R7D A;  3RR5 A;  1YIT A;  3CC4 A;  4OO1 G;  4R4I A;  1VQJ A;  2GVA A;  1X54 A;  2K14 A;  3UDX A;  5FJ8 G;  2JEA I;  2ES2 A;  3G48 A;  3UDG A;  4UY8 C;  5JEA J;  5IYC G;  3S1Q H;  3S24 A;  1ASZ A;  4JI4 Q;  2BA1 A;  1GKH A;  4LUO A;  1EYG A;  4DR3 L;  3KYH C;  4DV7 L;  4DV7 Q;  2D62 A;  3FKI H;  4DR3 Q;  1X55 A;  4LUZ A;  3OW2 A;  4BY1 H;  4A3I G;  4GOP C;  3RLN A;  2VNU D;  3K0X A;  1U5K A;  4LF6 L;  4LF6 Q;  1NE3 A;  2ID0 A;  1YHQ A;  4IOA A;  1JE5 A;  5IT9 c;  5BR8 L;  2CQO A;  4A93 G;  2JEB I;  1OXS C;  3IRB A;  3HOZ H;  3S16 H;  3L0O A;  1S40 A;  1HNX L;  1HNX Q;  2JA7 H;  5IP7 G;  3A5Z B;  2PNH A;  3S2H H;  2WB1 E;  2KBN A;  3KLW A;  3SGI A;  1Q81 C;  3D0F A;  3M9B A;  2FXQ A;  2VS1 A;  5FLX c;  4LF8 L;  2WAQ G;  4GNX B;  1A8V A;  3ULJ A;  4JI2 L;  4JI2 Q;  2JE6 I;  2JA9 A;  3CPF A;  3GTP H;  4P71 A;  3PUX A;  4DR5 L;  4DR5 Q;  4A3C H;  4PMW A;  5C4X G;  2D0O A;  4A3B H;  3G71 A;  1CKN B;  4LFC L;  1QZH A;  4LFC Q;  2YU9 H;  2Q2H A;  1VQL A;  1JMC A;  5JJL A;  4X62 Q;  2EXD A;  2F4V L;  3K7A H;  2F4V Q;  4C3J H;  4L5R C;  2K4K A;  2PQA B;  2NVQ H;  2ZM6 Q;  3PO2 H;  1QUQ A;  4OWT B;  3KJO A;  3PO3 H;  4YY3 Q;  1J5E L;  3L2P A;  1J5E Q;  3CCM A;  2E5L L;  3AQQ A;  1PH9 A;  3J80 i;  4A3D H;  4HIM A;  1VQH A;  4JV5 L;  4JV5 Q;  2QA4 A;  1PHJ A;  2R7F A;  1L0W A;  2I5H A;  2IX1 A;  1FJG L;  1FJG Q;  4A75 A;  4JBW A;  2B29 A;  1GD7 A;  5GAG C;  3U4V A;  1XMO Q;  1SLJ A;  4X65 L;  4X65 Q;  4A3G G;  1K3R A;  4BBS H;  1I6H H;  4IPG A;  1PH4 A;  2Y0S E;  3HOV H;  5GAE C;  3CXC A;  4AH6 A;  4DR2 L;  4DR2 Q;  2KCT A;  2LXK A;  1CSP A;  3MXN B;  5LMN W;  4A3M H;  3HKS A;  1PH2 A;  1BBU A;  1NBW A;  1Y14 B;  3BZK A;  3PSI A;  2IHF A;  4H02 A;  4HJA A;  1X3E A;  4GKK L;  1NTG A;  4GKK Q;  2K5N A;  4ME3 A;  4LF7 L;  4BBR G;  4LF7 Q;  1HR0 L;  4LF5 Q;  1HR0 Q;  4DAY B;  1Y1W G;  4BY7 G;  4BXX G;  1Q12 A;  2JA5 H;  1SMX A;  1KRS A;  2AHO B;  4JBJ A;  2UUA L;  2UUA Q;  1K73 C;  1YJN A;  2R92 G;  4JI8 Q;  5M3F G;  3J81 j;  2C35 B;  1EQQ A;  3RZO H;  5LMN L;  5LMN Q;  2CWP A;  1XPU A;  4QIW E;  3U50 C;  2R93 H;  1AH9 A;  3F8T A;  1X3F A;  2ASB A;  1IBM L;  1IBM Q;  4J15 A;  3BJU A;  1HH2 P;  1MJC A;  1XMQ Q;  1WCM G;  2MO1 A;  1HZ9 A;  2YV5 A;  1XMQ L;  5HY6 A;  1I5F A;  3HOY G;  1VQ5 A;  4L5T A;  2F52 A;  3EIV A;  3E0E A;  4JI1 L;  4JI1 Q;  3JC6 6;  4A76 A;  2CFM A;  5C3E G;  2N49 A;  2VW9 A;  1NMF A;  3H0G H;  1VQG A;  2MQH A;  4P72 A;  4MNO A;  1LM0 A;  4PG3 A;  2VQE L;  2VQE Q;  1VQ8 A;  1UWV A;  1Z47 A;  4JOI C;  4IFD J;  1NY4 A;  3D31 A;  3PUW A;  3M7N A;  3CQZ H;  2HT1 A;  3T1H L;  4DAM A;  4UP8 A;  3PIP A;  1U0L A;  3T1H Q;  4DUZ L;  4DUZ Q;  1XTD A;  3TS2 A;  5GAH C;  2KEN A;  4JI7 L;  4R1J A;  4JI7 Q;  4JBK A;  3W5O A;  1N36 L;  1JT8 A;  3FKI G;  5E7N A;  2ATW A;  3AEV A;  1E1O A;  2YTV A;  1KL9 A;  4AQY L;  5IYB G;  5M3M H;  1LUZ A;  5IYD G;  4GS3 A;  4TVA B;  3CCQ A;  1TWG H;  1SN8 A;  3CCE A;  4A4I A;  4RMF A;  5C0X G;  4DV4 Q;  4DR7 Q;  2JA7 G;  1TXY A;  5J3B A;  1LTL A;  2VUM H;  1W2B A;  3UE1 A;  3I4M H;  1A62 A;  5HGQ A;  2NN6 I;  3CF5 A;  2F3I A;  4LWC A;  4JI3 L;  1YJ9 A;  4JI3 Q;  4P73 A;  4R4Q A;  4YCV A;  3U4Z A;  1YBY A;  3S2D H;  3STB D;  1A0I A;  1N34 L;  1N34 Q;  2MFI A;  3PV0 A;  1QUQ B;  1PVO A;  3UDI A;  2H5X A;  3KJP A;  1MKH A;  4A3B G;  1VQD A;  1X3G A;  2QEX A;  1EOV A;  4B3S L;  3WWV A;  4B3S Q;  1IL2 A;  4WJ4 A;  2AWO A;  2RCN A;  3L7Z C;  2N3S A;  2CCZ A;  1MIU A;  4C3H H;  3RLF A;  3I2Z A;  5BR8 Q;  1D7Q A;  5AJ3 L;  4Y7N H;  4UPA A;  1EUJ A;  4X66 L;  3H3V I;  1N9W A;  4X66 Q;  4A3D G;  4R4T A;  3HOW H;  2QGQ A;  2B63 H;  3J80 c;  1VQC A;  1E7Z A;  1VQI A;  3K81 C;  4DV6 Q;  4DV6 L;  2V1C C;  1HNW L;  5GQO A;  2JK8 A;  4LFB L;  4DV1 L;  4LF8 Q;  3G4S A;  4DV1 Q;  3J81 i;  3FP9 A;  4BBS G;  4DNI A;  1DGS A;  4GN3 B;  3A0J A;  1PH5 A;  4OWW B;  1O7I A;  4IFD I;  4B3M L;  3HOV G;  3FHW A;  4B3M Q;  1KXL A;  4B3R L;  3TRZ A;  2R7Z H;  4JC0 A;  4B3R Q;  5IE8 A;  3HKZ E;  4A3J H;  2IX0 A;  4AYB E;  4A3M G;  3K80 C;  5C4J H;  2UXC L;  1OXU A;  2UXC Q;  3TEH B;  1VQM A;  1V1Q A;  1Y1V H;  1VQ7 A;  2OTL A;  2BH8 A;  4A3L G;  3M4O H;  1VQK A;  4DR4 L;  2K5H A;  1SFO H;  3CC7 A;  4GN5 A;  1GVP A;  1Q86 C;  2JA5 G;  4P75 A;  4MTN A;  2E5L Q;  1EIF A;  1Q1E A;  2XGT A;  1YZ6 A;  2YTX A;  3U58 A;  2JA8 H;  1HNZ L;  3TQY A;  4YWK A;  1YJW A;  3GTM H;  4HJ8 A;  3E9I A;  2R93 G;  1D8L A;  1VS0 A;  4UP7 A;  1IBK L;  1IBK Q;  4JCV E;  4DV2 L;  4DV2 Q;  1AE3 A;  3F2C A;  3PGZ A;  3HOX H;  1HR0 W;  2GN5 A;  4OWX B;  1UE5 A;  2A19 A;  2K50 A;  3I7F A;  3M4P A;  3Q8D A;  2UU9 L;  2UU9 Q;  3PO2 G;  2UXB L;  3TS0 A;  4O2D A;  3JAM i;  5GRO A;  5ELN A;  1IBL L;  1IBL Q;  2AKW B;  1N32 L;  1EQR A;  2R6G A;  4R4C A;  4R4O A;  2KHJ A;  1VQB A;  1N32 Q;  3I4O A;  2ALY B;  4QL5 A;  1B7Y B;  3H3V H;  1BKB A;  3UDF A;  2UUB L;  2UUB Q;  4NXM Q;  3I4N H;  4OX9 L;  4OX9 Q;  3GTQ H;  1G29 1;  2KCM A;  1PA6 A;  3CME A;  2NVT H;  3G6E A;  2LSS A;  4NXN L;  1M1K C;  1Q46 A;  4NXN Q;  2JA6 G;  3W1G A;  2I5L X;  2VY3 A;  4IOC A;  5IP9 G;  4LFA L;  2JQO A;  4XTC S;  4LFA Q;  3W1B A;  1G6P A;  3ULP A;  1PH3 A;  5GAD C;  3KFU A;  1IZ6 A;  1AE2 A;  4DK3 C;  1B8A A;  1UE6 A;  4BA1 I;  1G51 A;  4WJ3 M;  1FVI A;  1I50 H;  1T9H A;  4KLK A;  4YCU A;  3ICE A;  4JYA L;  4JYA Q;  2JJQ A;  5JEA G;  5M3M G;  4GLA C;  3CCV A;  1BBW A;  4QGU A;  4POF A;  3KF6 A;  3CPW A;  3AYH B;  5C44 H;  3CC2 A;  5IWA L;  1NJI C;  5IWA Q;  1JB7 A;  4DV5 L;  1VQO A;  4DV5 Q;  2VUM G;  4YCW A;  3ER0 A;  3CCS A;  4PZ6 A;  2Y0S G;  5IY0 A;  1K8A C;  1TWF H;  3I4M G;  3S14 H;  1YNX A;  1Z9F A;  1V43 A;  1OXX K;  1VQ4 A;  5M5X H;  2GVB A;  1FGU A;  1RIP A;  1WJJ A;  1CUK A;  2A1A A;  4C3I H;  1UE1 A;  4NXM L;  1L1O A;  2ZTD A;  4GKJ L;  4YHH L;  1N33 L;  4GKJ Q;  1N33 Q;  3GO5 A;  1JJG A;  2B3G A;  4DUY L;  1VQA A;  4DUY Q;  1V9P A;  1PH6 A;  3EBE A;  1L1O C;  1N36 Q;  4LUV A;  3A74 A;  1HZC A;  4BY1 G;  4X64 L;  4X64 Q;  2L15 A;  4AQY Q;  1JJ2 A;  1VQE A;  2K75 A;  3PCO B;  1E1T A;  5FLM H;  4UP9 A;  1X9N A;  4OON A;  4DR1 L;  1PV4 A;  1SRO A;  4DR1 Q;  4DR6 L;  1KRT A;  4APV A;  4LNQ A;  4IJH A;  1GO3 E;  1XPO A;  3CCL A;  3HOZ G;  4BBR H;  4BXX H;  1KHI A;  4BY7 H;  1QVF A;  1KAW A;  4QQB X;  3HOW G;  2N78 A;  2YYZ A;  3OTO L;  3OTO Q;  2I5M X;  3J7A 5;  4OO1 I;  5M3F H;  2HIX A;  4MZ9 A;  1UEB A;  2PI2 E;  1P16 A;  3J81 c;  2ZJR A;  4A3C G;  1L2F A;  1XNR L;  2R7Z G;  2BA0 A;  1OXV A;  4A3J G;  4A3F H;  3HOY H;  3BZC A;  1E24 A;  1PH1 A;  1KIX A;  1PYS B;  3NEM A;  4P74 A;  3RNU A;  4HJ5 A;  1Y1V G;  1IYJ B;  1K9M C;  5C3E H;  1VQF A;  3GDE A;  4JI0 L;  4JI0 Q;  2WAQ E;  2DGY A;  3I56 A;  2Q2I A;  3PO3 G;  3KDF A;  4LF4 L;  3S1N H;  2UUC L;  5JJK A;  1I3Q H;  2K52 A;  4IPH A;  2NN6 G;  1S3O A;  1SR3 A;  5AJ3 Q;  2Q2U A;  2JA8 G;  1C9O A;  3F2D A;  1RL2 A;  3GTL H;  3KOJ A;  4IPC A;  4A3K H;  2PMZ E;  4NB3 A;  2ZTE A;  3GTO H;  1EWI A;  1K0R A;  1FL0 A;  1TWA H;  1OXT A;  2OCE A;  3H15 A;  4GOP A;  3F1Z A;  3HOX G;  1HNW Q;  4A3E H;  3I55 A;  3HOU H;  4LFB Q;  4JI4 L;  5LMU L;  5LMU Q;  2OQK A;  3GTG H;  2A8V A;  2OTJ A;  1VCI A;  2OWO A;  3K7U C;  5IYB H;  3RZD H;  1VQP A;  1TWH H;  1X56 A;  1WI5 A;  2ZTC A;  4GN4 B;  4TQU S;  4LF9 L;  2YTY A;  1XJV A;  1PFS A;  1SRU A;  3JAM c;  4LF9 Q;  5IYD H;  4IJL A;  4L5S A;  4PZ8 A;  4JI6 L;  4JI6 Q;  2HHH L;  1P8L A;  2HHH Q;  3GD7 A;  3I4N G;  2Z0S A;  4L5Q A;  1S72 A;  3T1Y L;  3DM3 A;  3ULL A;  5M5W H;  5H1S E;  3T1Y Q;  3KF8 B;  5JJI A;  4X6A H;  4DR4 Q;  5K36 G;  3E9H A;  3CP0 A;  3VDY A;  2E2I H;  3PUZ A;  3A5U A;  1PYB A;  3NEN A;  3CCU A;  1NMG A;  1QVC A;  3NEL A;  4EX5 A;  3ZJY C;  1E22 A;  1YHA A;  1HNZ Q;  5FJ8 H;  4DK6 C;  3CCJ A;  2KHI A;  4IFD G;  3MEF A;  2N8N A;  1YHB A;  1WOC A;  2AMC B;  1W3S A;  3ERS X;  5IYC H;  1KC8 C;  3KF6 B;  3EN2 A;  1HZB A;  4HIK A;  3RN5 A;  2HQL A;  2NZH A;  4HJ9 A;  2ZJQ A;  3B6Y A;  4QY7 A;  1KD1 C;  2UXB Q;  2WB1 G;  4X62 L;  1CKO A;  2AWN A;  4NPS A;  1HJP A;  3OYY A;  4XIG S;  5C0X J;  4A3I H;  1Q7Y C;  1KQS A;  2ZM6 L;  1QVG A;  3TRE A;  4YY3 L;  3GTJ H;  1VQ9 A;  3H0G G;  3M4Q A;  5C44 G;  3AFQ A;  4ALP A;  4O0A A;  1K8G A;  1L1O B;  4A93 H;  2VZA A;  1MJE A;  4RG1 A;  1J6Q A;  2D0P A;  3HKZ G;  3HFZ B;  5ELO A;  4AYB G;  2CKZ B;  5IP7 H;  3DLL A;  3CMA A;  1WFQ A;  4QJF A; 
#chains in the Genus database with same CATH topology
 1H9M A;  3HS0 C;  1JOQ A;  4C2M H;  2A6E D;  3FEW X;  5F2D A;  4CDC C;  3FPU B;  5COY A;  2G5D A;  2IT1 A;  3HEJ A;  4QF4 A;  2E8G A;  3KBG A;  1STB A;  2MHV A;  4K0K Q;  1A63 A;  1B2T A;  4KKU A;  4GNX A;  1B1Z A;  2XTI A;  4DV0 Q;  5AFW A;  2HIV A;  5C44 B;  4LF5 L;  2QIL A;  1XPR A;  1CKN A;  3S14 B;  3MZ5 A;  3VR6 A;  1RHP A;  3R2T A;  4KHZ A;  4KHP L;  4CJ1 B;  2NBF A;  1TS4 A;  4N9P A;  3SEB A;  5CC4 A;  3S17 H;  1SE8 A;  2CWA A;  2VQF L;  3EFX D;  2Q2T A;  2C5C A;  1ASY A;  4A3G H;  2B2W C;  2RHS B;  5C4Z A;  3CU7 A;  1BVS A;  1AW7 A;  3AFP A;  3OPO A;  1I94 Q;  3MFY A;  3Q6S A;  4JOI A;  4R9W A;  1X6O A;  1IL8 A;  2NZO A;  4AIM A;  2I0Q A;  4K8J A;  4F88 A;  2IHE A;  3V96 A;  3RLO A;  1Y1W H;  3TBI B;  2JA6 H;  3J7A V;  4A3K G;  4YWL A;  3F2B A;  3NK9 A;  5CBA E;  4IUQ A;  2R92 H;  1S5C D;  2WIN B;  2VL6 A;  1EQV A;  2WP8 J;  2K03 A;  3W3A A;  4NMZ A;  4DAY A;  4ID6 A;  4POG A;  1XNQ L;  1GJX A;  1HUM A;  1SEB D;  1QOH A;  1X3P A;  4E6I A;  3VYS A;  1MBY A;  3E5S A;  4FDB A;  4DV3 L;  4RGO S;  1JIC A;  1CKM A;  2MNA A;  1VF7 A;  4KTA A;  4HJ7 A;  1EU3 A;  3RR5 A;  2OF1 A;  1EL0 A;  1Y8O B;  2GVA A;  3GTL B;  4A3K B;  4O1N A;  2ES2 A;  3MXG A;  4K5V A;  3UDG A;  4F7X A;  1D6E C;  1JWU D;  1D5Z C;  2NTS A;  1LO5 D;  4G4K A;  1GKH A;  4DR3 L;  4DV7 L;  1K8M A;  1HTP A;  1A2T A;  1RDP D;  3K0X A;  1U5K A;  4QB4 A;  4LF6 Q;  2GA4 B;  4XT3 B;  3QJY A;  4A93 G;  3J81 E;  3GQB A;  1EWC A;  1A3T A;  1JR0 D;  4FF2 A;  1AN8 A;  5C0X H;  1LAB A;  4K5W A;  1S40 A;  2PNH A;  2WB1 E;  2ICE C;  3D0F A;  3M9B A;  4LF8 L;  4JI2 Q;  3DUZ A;  1H9K A;  1R4P B;  1BCP C;  2JA9 A;  3CPF A;  4O42 A;  1ZYR D;  1MHW C;  4LFC Q;  1QNK A;  1VQL A;  2A6E C;  1E0B A;  2JYO A;  2Z4H A;  2CW0 D;  4C3J H;  4L5R C;  2K4K A;  2PQA B;  2HCI A;  3SK4 A;  1WD0 A;  1QUQ A;  1EQT A;  1J5E Q;  4A93 B;  2NN6 H;  2RDG A;  3I4N B;  1ESR A;  3M4Y A;  4DN4 M;  2L1B A;  4JV5 Q;  2QA4 A;  5E4X A;  1L0W A;  5IT9 E;  2IX1 A;  2E2J B;  3MXU A;  5CR3 A;  4X65 Q;  2FJ2 A;  4RHR A;  1WTP A;  1PLF A;  3K0Y A;  2O4X A;  1I50 B;  3MXN B;  5CV5 A;  5DAU A;  3V2T A;  1DOK A;  1PH2 A;  2PMZ B;  1Y14 B;  3PSI A;  3I4L A;  2IHF A;  3GTK B;  4L8J A;  4HJA A;  1X3E A;  2K5N A;  1C48 A;  4G7O C;  3C1E A;  1H9J A;  4LF7 Q;  1HR0 L;  4BXX G;  1DM0 B;  4JBJ A;  1K73 C;  1B44 D;  3J81 j;  2C35 B;  1ONL A;  5M5X B;  1MGS A;  1XPU A;  4QIW E;  2V4D A;  3F2U A;  1RTO A;  1AH9 A;  2MO1 A;  3NWS A;  5HY6 A;  2DNE A;  1K0S A;  3EQL C;  5C5M A;  4JI1 Q;  4C56 C;  5EBD A;  4A76 A;  1S5E D;  3D8G A;  1VQG A;  3Q22 A;  4P72 A;  3NPP A;  4PG3 A;  1LT4 D;  1SYE A;  2FFK B;  1FNU A;  1VQ8 A;  5I6Y A;  4JOI C;  4OEM B;  4IFD J;  1STN A;  1B4O A;  3IFT A;  2PZT A;  3M7N A;  3CQZ H;  3T1H L;  1QG7 A;  1EEF D;  2EY6 A;  3SR1 A;  3G7L A;  4R1J A;  3QB3 A;  4JI7 Q;  1JT8 A;  4I7Z C;  2EY1 A;  3FKI G;  5E7N A;  2PPB C;  5JEA H;  1WTH A;  5IYD G;  4CKC A;  3CCE A;  3T51 B;  4U68 A;  4A4I A;  4DV4 Q;  4HED A;  3P20 A;  2F0Q A;  3VR2 A;  2NN6 I;  3CF5 A;  5EBC A;  4LWC A;  4JI3 Q;  4P73 A;  4R4Q A;  5FOB B;  3STB D;  1UNS A;  1TWA B;  3U9O A;  1YNN D;  1F9P A;  4K8I A;  3QG1 A;  2H5X A;  3GTG B;  4PNY A;  2QEX A;  3FKI B;  3TZU A;  4PQX A;  2O5J C;  1XWE A;  2AWO A;  2RCN A;  3L7Z C;  2N3S A;  1MIU A;  4F87 A;  2L4N A;  1ZYR C;  3FDT A;  3I2Z A;  1D7Q A;  3OW7 A;  1EUJ A;  4X66 L;  3SK5 A;  4A3D G;  5TSS A;  4DV6 Q;  2CW0 C;  2RQX A;  3I8Z A;  4LFB L;  3G4S A;  4IZ8 A;  4RHS A;  3J81 i;  4DV1 Q;  4MN3 A;  1DGS A;  1EIG A;  1TY2 A;  1ET9 A;  3HKZ E;  4A3M G;  4AYB E;  2KUM A;  4CJ0 B;  1PXU A;  1KNE A;  1VQ7 A;  2L11 A;  1GOZ A;  3NQI A;  4EQP A;  3OIP A;  2VXW A;  1IYU A;  1Q86 C;  4GN5 A;  1BDO A;  2E5L Q;  4A3D B;  2XGT A;  2JA8 H;  4OL7 A;  2OEO A;  1EY6 A;  1PFN A;  4L6T B;  4UP7 A;  5LHY 1;  3I72 A;  3F2C A;  3PGZ A;  2HDL A;  3HOX H;  5M5Y B;  3J80 L;  1SNO A;  3M4P A;  1TWC B;  3OSO A;  2UU9 L;  2UXB L;  4DAP A;  4MHE A;  3ZYY X;  3TP7 A;  4A3M B;  1K3B C;  2OXP A;  1EQR A;  2JN4 A;  5C5L A;  5FLX E;  1N32 Q;  2ALY B;  2QCP X;  2J7Z A;  1BKB A;  3I4N H;  4OX9 L;  4X3K A;  5C6A A;  5K36 H;  2AQ1 B;  5IP9 G;  3NP8 A;  2JQO A;  3RZO B;  2H1E A;  3D4D A;  5EKK A;  3VA7 A;  1AE2 A;  1R9T B;  1QE6 A;  4JYA L;  1I50 H;  3DWQ A;  2JJQ A;  1TS2 A;  5M3M G;  4GLA C;  1KDA A;  3KF6 A;  5K5P A;  4ZKB B;  4BS9 A;  4IUU A;  3I4M G;  4X3T A;  4PZ6 A;  1K8A C;  1TWF H;  3HP3 A;  2DJG C;  1M8A A;  1OXX K;  5M5X H;  2GVB A;  1RIP A;  1EY8 A;  2ZTD A;  2EXZ A;  1ICW A;  4DXF A;  4DUY Q;  3ITP A;  2G9H D;  4N8F A;  3HG9 A;  4BY1 G;  4MTK A;  1JWS D;  4AQY Q;  5M3M B;  3M3Y B;  2K75 A;  4DNR B;  1E1T A;  5FLM H;  4UP9 A;  4OON A;  1YNN C;  4C3H G;  4DR1 Q;  4QCL A;  4IJH A;  1GO3 E;  2Z1C A;  4BXX H;  4KD3 A;  1KAW A;  3DXJ C;  3I4M B;  5CV4 A;  2RCF A;  3J7A 5;  2R3Z A;  2F0I A;  3FVQ A;  3S2D B;  1PMR A;  2ZJR A;  1XNR L;  4HN7 A;  3A8I E;  1E24 A;  4EVO A;  2NZ1 D;  2RSN A;  1PH1 A;  3RNU A;  4BY1 B;  1LTI D;  2KCC A;  2JSO A;  1F9R A;  3PO2 G;  4JI0 L;  3I56 A;  1DOL A;  1KLG D;  3KDF A;  4QIW B;  4C3H B;  4LF4 L;  2UUC L;  5JVG 3;  1S3O A;  2XVS A;  4B9X A;  3DM1 A;  2Q2U A;  4FF1 A;  3S16 B;  3F2D A;  1SJH D;  3Q23 A;  2KEC A;  3KOJ A;  4NB3 A;  2I46 A;  1EWI A;  1TWA H;  2MP1 A;  3F1Z A;  1BQQ T;  2EVB A;  3GTG H;  1WTV A;  5C4J B;  1VQP A;  1SRU A;  3CKI B;  2L9H A;  3NBH A;  5IYD H;  3N52 A;  4L5S A;  3TZD A;  4KV6 A;  4JI6 Q;  2NVQ B;  3SHL A;  3PO2 B;  3NUC A;  5G3L F;  3DM3 A;  5H1S E;  5JPN C;  4FXD A;  2MGS A;  4RWS C;  3CCU A;  3GTM B;  3KBX A;  2B2V A;  3IFD A;  1SE2 A;  1YHB A;  4IUN A;  4H7B A;  5IYC H;  1KC8 C;  4K2L A;  3V05 A;  2MJ8 A;  4QY7 A;  1A3U A;  2WKC A;  4NPS A;  1O7Z A;  4RCN A;  5C0X J;  1SNM A;  3TRE A;  1VQ9 A;  1CK1 A;  4O0A A;  1L1O B;  4RG1 A;  1J6Q A;  4L63 B;  1FGB D;  2A5H A;  3HKZ G;  5ELO A;  4AYB G;  1Z7T A;  1BF4 A;  1HUN A;  4CDE C;  1XMO L;  3LNN A;  2F0V A;  4Q0F A;  5M5Y H;  2Z6B A;  1O7Y A;  1TWC H;  3PQI A;  3LWE A;  2NUC A;  4PMC A;  4GLV B;  4JBM A;  2F0N A;  2IY5 B;  1EZ6 A;  3DHQ A;  2F0O A;  3L9A X;  1U9R A;  1JE4 A;  4LK1 C;  4CKB A;  1YVC A;  1M90 C;  1GUN A;  1HRJ A;  1B3Q A;  4JI8 L;  3HKZ B;  1SNQ A;  4AYB B;  4KHP Q;  2PI2 A;  2Z6K C;  3P75 A;  5D3D A;  1VQN A;  2OT2 A;  3BU2 A;  1R9T H;  1YI2 A;  1HA6 A;  2VQF Q;  4YHH Q;  3K58 A;  1PH7 A;  1TII D;  4JK1 C;  3PF5 A;  4ILW A;  3H3V C;  4LW1 A;  3G6J B;  3PUY A;  3PIO 3;  4KI0 A;  3OIQ A;  3S15 H;  4OXP A;  2WFW A;  4FNF A;  3BS1 A;  5IP9 H;  3S1R H;  1PH8 A;  4A3E G;  3FRP B;  3HOU G;  3PF4 A;  1ENF A;  2A68 D;  4LMQ D;  1MSH A;  1XNQ Q;  1K83 H;  2RF4 A;  1WCM H;  3RN2 A;  1D1K A;  2F0W A;  1Q82 C;  1BO0 A;  3M3Y H;  1BCP B;  1WTQ A;  1FD7 D;  2K7V A;  3NTH A;  4DV3 Q;  5EQ0 A;  2VB3 X;  4DKA C;  3Q0A A;  5DLQ E;  1A2U A;  1KDB A;  1I3Q B;  2UXD L;  5IOD A;  1KLU D;  2B2T C;  2R7D A;  4DNT B;  4M8A A;  1X54 A;  1ROD A;  5FJ8 G;  2JEA I;  3GTO B;  3G48 A;  3R93 A;  1FNW A;  4DA2 A;  5JEA J;  4A3E B;  3HOU B;  1XX8 A;  4FXK C;  3S24 A;  1ASZ A;  4JI4 Q;  2BA1 A;  1C4Q A;  4I65 A;  1PRT D;  4LUO A;  3KYH C;  4DR3 Q;  2DY7 A;  4DV7 Q;  1HPC A;  4LUZ A;  4BY1 H;  4A3I G;  4V19 0;  5EKL A;  1ENC A;  4IUR A;  2VNU D;  4WRD A;  5BR8 L;  1SMY D;  3IRB A;  1BOS A;  3S16 H;  5A2Q E;  2JA7 H;  5IP7 G;  1SFO B;  2KBN A;  3SGI A;  1F77 A;  2I07 B;  1PZJ D;  5DM7 3;  3K5N A;  1ILP A;  4GNX B;  3ULJ A;  1W6K A;  2JE6 I;  3I90 A;  3GTP H;  4P71 A;  3PUX A;  2K6A A;  1A6X A;  4PMW A;  2B2V C;  5C4X G;  2D0O A;  1RJT A;  3G71 A;  1CKN B;  1QZH A;  3H91 A;  2YU9 H;  2Q2H A;  4A3I B;  4WOR A;  4X62 Q;  1Y8N B;  2NVQ H;  2F4V L;  3K7A H;  3PO2 H;  4OWT B;  5FO9 B;  3KJO A;  4YY3 Q;  2K5D A;  1PH9 A;  1VQH A;  1T5X D;  1PHJ A;  5CGK A;  3JAM E;  1FJG L;  2E2H B;  4ZCK A;  1IKM A;  3TSS A;  2B29 A;  1GD7 A;  1BBX C;  3U4V A;  1STG A;  1K3R A;  1L0X B;  1EOT A;  4DR2 L;  1Z6H A;  2RBM A;  1I4X A;  5C4X B;  3HKS A;  2L5T A;  1B50 A;  4TRD A;  1BBU A;  1RTN A;  4GKK L;  1NTG A;  1NSN S;  1BR9 A;  4ME3 A;  5IGB A;  4BBR G;  4B9W A;  4DAY B;  1JQY D;  1HR0 Q;  1BCP F;  3HRZ C;  2EYH A;  1SDF A;  2UUA L;  2F0U A;  4HCS A;  5LMN L;  3U50 C;  5C3X A;  2PNR C;  1X3F A;  3A8K E;  1IBM L;  2ASB A;  3BJU A;  1HH2 P;  2XN9 C;  4DFA A;  1UUP A;  3HOY G;  2X6G A;  4L5T A;  2F52 A;  3EIV A;  3E0E A;  3JC6 6;  1GHK A;  1LTG D;  2A68 C;  4KK7 A;  2VW9 A;  1NMF A;  1LM0 A;  2VQE L;  1BNZ A;  1UWV A;  4BBR B;  1Z47 A;  3PUW A;  1U4R A;  2BOS A;  3T1H Q;  3QO2 A;  4DUZ L;  5HGT A;  3IL8 A;  2KEN A;  4ULL A;  3S1M B;  3W5O A;  1N36 L;  2ATW A;  3D4R A;  5KRU A;  3HOY B;  3U9S A;  3OMC A;  2HDM A;  2NVY B;  4TVA B;  3CCQ A;  1F2M A;  1GXD C;  2BDO A;  1PRT C;  3NE5 B;  1HHV A;  3HZX A;  2EPB A;  4J8Q A;  4DR7 Q;  2NVX B;  1TXY A;  1S5B D;  2VUM H;  2X69 A;  1S5D D;  4BWG B;  1YJ9 A;  3E0J A;  2SNS A;  5FO7 B;  1YBY A;  4HMJ A;  1SMY C;  2F0S A;  1A0I A;  3PV0 A;  3S1Q B;  2A73 B;  1QUQ B;  1PVO A;  1PDQ A;  3A56 A;  4KMU C;  4A3B G;  1EOV A;  3EVQ A;  4B3S L;  1Y8P B;  1CQV A;  4WJ4 A;  3N6R A;  4K6D A;  2EYP A;  4Z9C B;  4ABN A;  2CCZ A;  4KY5 A;  3AMU A;  4ZUI A;  2B2U A;  3T4A C;  2FHT A;  4EGV A;  1SYC A;  5JVH 3;  4UPA A;  4RGM A;  1N9W A;  4X66 Q;  2MPM A;  3HOW H;  2QGQ A;  1NAP A;  1VQC A;  2B8F A;  1VQI A;  3BG3 A;  2V1C C;  1HNW L;  1JWM D;  3P7J A;  4HTH A;  4BBS G;  1PH5 A;  4OWW B;  1O7I A;  1EY4 A;  4B3M L;  3HOV G;  3FHW A;  4B3R L;  3TRZ A;  2WKD A;  5KND A;  5IE8 A;  4A3B B;  3LWU A;  1HTL D;  1B3A A;  1V1Q A;  2AQ2 B;  1Y1V H;  3Q24 A;  2IW3 A;  3GTJ B;  2F0F A;  4FVM A;  1VQK A;  4DR4 L;  1GUG A;  1NNX A;  2K5H A;  1EZ8 A;  1SFO H;  2JA5 G;  1GVP A;  1EIF A;  1Q1E A;  4OEL B;  4YWK A;  2CQA A;  3KLS X;  2R93 G;  1IBK L;  4DV2 L;  2FMM A;  4BBS B;  5E3F A;  4PMB A;  2A19 A;  3HOV B;  1DJR D;  2UU9 Q;  3TS0 A;  5DEH A;  1KAB A;  4O2D A;  5J39 A;  2F3W A;  5GRO A;  3JAM i;  1PTO H;  5IGE A;  2KHJ A;  3I4O A;  2HD3 A;  1B7Y B;  4ZYS A;  3K6O A;  4OX9 Q;  3GTQ H;  1G29 1;  3P1H A;  2LSS A;  3DMU A;  2JA5 B;  4H13 C;  1MD2 D;  1STE A;  3W1B A;  4XTC S;  1G6P A;  1OO9 B;  2MUY A;  2R93 B;  2WII B;  1PH3 A;  5GAD C;  1D1I A;  3KF8 A;  3SXH A;  3KFU A;  1B8A A;  2E76 C;  4G7H C;  5BN3 A;  5KIX A;  1G51 A;  1FVI A;  1T9H A;  2PW5 A;  4KLK A;  4YCU A;  4JYA Q;  4KHV A;  5J1Z A;  2XSC A;  2D5D A;  3HGB A;  2NB0 A;  5C44 H;  1JB7 A;  3ER0 A;  5IGG A;  4XDX A;  3S14 H;  3KLR A;  2BDN A;  1Z9F A;  1V43 A;  1VQ4 A;  3E6Z X;  4GKJ L;  3ND9 A;  3GP7 A;  2B3G A;  1VQA A;  4XT1 B;  3H09 A;  2K04 A;  3EBE A;  3UI2 A;  4X64 L;  2LS0 1;  2L15 A;  1VQE A;  1F2Y A;  1TWG B;  1SRO A;  4DK0 A;  1KRT A;  4APV A;  1NR4 A;  4LNQ A;  1XPO A;  4OIK A;  2KQ3 A;  1EEI D;  3HOZ G;  4BBR H;  1QVF A;  4HMI A;  2L12 A;  2N78 A;  3OTO L;  4J6H A;  1BUV T;  1EYD A;  2PI2 E;  2AUJ D;  4NKL A;  3RUZ A;  5ELD A;  3J81 c;  4PV1 C;  4A3C G;  2VB2 X;  2R7Z G;  3HOY H;  4A3J G;  5BN4 A;  2F0H A;  3QWN A;  3WDN A;  4FYD A;  1PYS B;  4P74 A;  5I2X A;  3BVM A;  3J7Y W;  3PIP 3;  3PO3 G;  4JI0 Q;  2WAQ E;  2Q2I A;  3O13 A;  5JJK A;  4IPH A;  2RVL A;  4Y7N B;  1SR3 A;  3QOJ A;  4N9T A;  5AJ3 Q;  3HOZ B;  3NXW A;  3GTL H;  4A3K H;  2B2U C;  3S2H B;  4H0L C;  1CFM A;  1MSG A;  1K0R A;  3H15 A;  5FO8 B;  4GOP A;  3H94 A;  3BZD B;  5LMU L;  2A8V A;  2OTJ A;  2R7Z B;  1VCI A;  4A3J B;  2OWO A;  2L0C A;  2ZTC A;  4LF9 L;  2YTY A;  1QWY A;  1PFS A;  3WOE A;  4IJL A;  3I91 A;  1P8L A;  3GD7 A;  3PO3 B;  2C9O A;  3M4O B;  3ULL A;  4JPB W;  4KN4 C;  4X6A H;  3PUZ A;  2Z4I A;  4RH6 A;  3NEL A;  4WFN 3;  1HA5 A;  1SBB B;  1HNZ Q;  2XNA C;  1BXT A;  1ZEQ X;  3A7L A;  4IFD G;  2N8N A;  1WOC A;  4CDF C;  3KF6 B;  4K14 A;  4HIK A;  2BCO A;  2HQL A;  2NZH A;  2CHB D;  3J80 E;  1KD1 C;  2WB1 G;  1CKO A;  3OYY A;  1Q7Y C;  1QVG A;  5JAV A;  3GTJ H;  2LKV A;  4CDD C;  4ALP A;  4A93 H;  1MJE A;  2D2C C;  2D0P A;  1XTC D;  3TME A;  1X3Q A;  5KNB A;  2K5V A;  2E2J H;  2IL8 A;  1CSQ A;  4CBV A;  3NWT A;  2BH2 A;  1V1O A;  2CH4 A;  5FLX L;  4HID A;  1H95 A;  5KNC A;  2WB1 B;  3TP6 A;  1Q1B A;  5EAY A;  2XWJ B;  3GTK H;  4QMG A;  3UE0 A;  1VQ6 A;  3MWY W;  1NR2 A;  4FF4 A;  2Z6K A;  1ML0 D;  4IPD A;  4K6L A;  1WTW A;  3R8B A;  1C7Y A;  1J9O A;  2AUK A;  3CD6 A;  4XQQ A;  3K8A A;  2ZJP A;  1IXR A;  1UE7 A;  3D6W A;  2OQ0 A;  1TKW B;  4KN7 C;  4NXM Q;  1E3P A;  2J4X A;  3D4W A;  3KDF B;  4A3F G;  2DUD A;  4Y52 H;  4RFB A;  1EIY B;  2KED A;  2RHQ B;  3VR4 A;  3J7A F;  3STB C;  3MFG A;  2Q8I B;  4EQN A;  4BA2 I;  1PYW D;  4DR6 Q;  3A55 A;  1OTC A;  4IO9 A;  1ICF B;  2EIF A;  3MVV A;  3RMH A;  1GUT A;  2B63 G;  4IUP A;  3CW2 C;  1E2V A;  1C0A A;  3PUV A;  1JJC B;  4IUT A;  1YEZ A;  4B3T L;  3NBH B;  1N8R C;  1NUC A;  3K5L A;  4A3F B;  1QNU A;  2SDF A;  2Z8L A;  2F0L A;  5EGT A;  1GM5 A;  2B2T A;  1GUS A;  4DV4 L;  3S1N B;  4TKO B;  1LYL A;  3A7A B;  4JI5 L;  1X65 A;  1AZP A;  2UXD Q;  4HIO A;  1YIT A;  4OO1 G;  4R4I A;  1VQJ A;  5I9O A;  4P2C B;  2B63 B;  3UDX A;  2PZW A;  1SSO A;  1F2L A;  5BN5 A;  1A3V A;  1RCV D;  2N55 A;  2F0J A;  1JC7 A;  1EYG A;  2D62 A;  3FKI H;  1X55 A;  4JW0 A;  4GOP C;  3RLN A;  2H4O A;  2ID0 A;  1YHQ A;  4ZLT F;  2CQO A;  1OXS C;  3HOZ H;  4EQO A;  1G6Z A;  1TT2 A;  1HNX L;  3SVM A;  4DF7 A;  3A5Z B;  3S2H H;  3KLW A;  1Q81 C;  2SNM A;  4Q5V A;  5FLX c;  1GHJ A;  2WAQ G;  1DZ1 A;  4DR5 L;  4A3C H;  5DM6 3;  1WTR A;  3GV6 A;  5A35 A;  2EYJ A;  1G8Z D;  2RKS A;  1JMC A;  5JJL A;  2EXD A;  1SXT A;  2F4V Q;  3PO3 H;  2ZM6 Q;  4YIJ A;  2PO4 A;  1LTS D;  3NBI A;  4TSS A;  1EU4 A;  5EPL A;  5I2Y A;  2E5L L;  3J80 i;  4A3D H;  2NVT B;  4HIM A;  2JP1 A;  4M1U B;  5CV9 A;  4HSP A;  2I5H A;  1HFN A;  4C3I G;  1FJG Q;  4A75 A;  3S9W A;  5JJZ A;  1SLJ A;  2WAQ B;  1O80 A;  4A3G G;  1LLR D;  4IPG A;  2EYL A;  1STH A;  2Y0S E;  3EJI A;  1GUW A;  3CXC A;  4AH6 A;  5JPM C;  4DR2 Q;  1CSP A;  1G91 A;  4A3M H;  2E75 C;  3DEP A;  5EKI A;  4CKE A;  1UEA B;  4FF3 A;  2LMC B;  4GKK Q;  3AB9 A;  2L55 A;  3AU7 A;  3A54 A;  4LF5 Q;  4BY7 G;  1Y1W G;  3ERO A;  1Q12 A;  1KRS A;  2UUA Q;  2LFN A;  2R92 G;  1PRT B;  1EQQ A;  3RZO H;  3S17 B;  5LMN Q;  2DNC A;  4C3I B;  2EZV A;  3F8T A;  4OIJ A;  1IBM Q;  4J15 A;  1V1P A;  1XMQ L;  1MJC A;  1HZ9 A;  4A3G B;  1I5F A;  1JOK A;  2F3V A;  3FMC A;  3MA2 B;  4F8M A;  5I6W A;  2CFM A;  1QCB D;  2BE5 D;  2MQH A;  2VQE Q;  2XRQ D;  5I9P A;  4BY7 B;  1Y1W B;  3DWP A;  3D31 A;  2R92 B;  1B9M A;  4DAM A;  1CI3 M;  2A6H D;  1U0L A;  4UP8 A;  3PIP A;  4DUZ Q;  1H9S A;  2WV6 D;  5GAH C;  1E1O A;  2K32 A;  4R8N A;  4IAL A;  1KL9 A;  4AQY L;  1M4V A;  5M3M H;  2LY7 A;  1LUZ A;  2XIW A;  1SN8 A;  3A8J E;  4RMF A;  5C0X G;  3D3R A;  1LTL A;  4JVZ A;  2KOL A;  3UE1 A;  3I73 A;  1A62 A;  5L37 A;  1W2B A;  3I4M H;  4IQZ A;  3W2D A;  1PZK D;  4UHV A;  4YCV A;  1FNV A;  5IGF A;  3S2D H;  1ENA A;  1N34 L;  5I4D A;  1L0Y B;  3WWV A;  5COR A;  4B3S Q;  1TWH B;  4C3J G;  4J1M A;  1EY9 A;  4C3H H;  5C3W A;  4XQN A;  1LTA D;  3H3V I;  1SNC A;  1S5F D;  4R4T A;  1WVL A;  1PZI D;  5EJW A;  2B63 H;  4X3U A;  3K81 C;  1DCZ A;  5GQO A;  2F0G A;  2XWB B;  4NP5 A;  4LF8 Q;  5CBE E;  4GN3 B;  3A0J A;  1Q8I A;  4N8X 1;  3TDQ A;  3EA6 A;  4IFD I;  3NHH A;  4B3M Q;  1PRT F;  4B3R Q;  3K80 C;  5C4J H;  2O2L D;  1EY5 A;  2UXC L;  1OXU A;  3TEH B;  2ZXO A;  5CYU A;  1VQM A;  2OTL A;  4C3J B;  4A3L G;  4ME5 A;  1TVX A;  1Y69 U;  3CC7 A;  4OO1 H;  3U58 A;  2YTX A;  3I70 A;  3BYT B;  3TQY A;  3GTM H;  3E9I A;  1D8L A;  1IBK Q;  2E74 C;  4JCV E;  3URY A;  4DV2 Q;  5D3I B;  1HQR D;  2GN5 A;  4OWX B;  4KY6 A;  1UE5 A;  3I7F A;  2WAC A;  3LX0 A;  1F2Z A;  5ELN A;  1IBL L;  2AKW B;  4U67 3;  1VMP A;  2R6G A;  4R4C A;  4R4O A;  1VQB A;  2UUB L;  2EYF A;  2KCM A;  2NVT H;  4NXN L;  1M1K C;  1Q46 A;  2F4I A;  3W1G A;  3ND8 A;  4HAE A;  2VY3 A;  4IOC A;  4LFA L;  1IHZ A;  2BE5 C;  3T16 A;  1LT6 D;  1YNJ D;  4DK3 C;  1NCV A;  4BA1 I;  3SDZ A;  3X3N A;  1AFP A;  3DEO A;  5JEA G;  2ZT9 C;  1U4L A;  2A6H C;  2PQE A;  2XRS D;  3CCV A;  2QDB A;  1BBW A;  4POF A;  1IKL A;  3CC2 A;  1ESF A;  5IWA L;  1DYQ A;  1NJI C;  2F03 A;  4DV5 L;  3CCS A;  2Y0S G;  2RDH A;  1SNP A;  1SYF A;  2F0M A;  2Z9H A;  2EE1 A;  3CQZ B;  4C3I H;  1WJJ A;  2A1A A;  1CUK A;  1X32 A;  1UE1 A;  4YHH L;  1N33 L;  4GKJ Q;  1IYV A;  2KCN A;  1STA A;  3GO5 A;  4ZRZ A;  3BDC A;  1V9P A;  1A15 A;  1PH6 A;  1L1O C;  5IGC A;  1HZC A;  3R2I A;  4X64 Q;  2J0T D;  3PCO B;  1F9S A;  3T56 B;  1X9N A;  4KKT A;  5LL6 X;  2O5I C;  1PV4 A;  5M9O A;  1EY0 A;  1WD1 A;  1KHI A;  4BY7 H;  2PW7 A;  1CTM A;  1PTO D;  4DXG A;  2Y0S B;  2YYZ A;  3OTO Q;  2I5M X;  4OO1 I;  1ILQ A;  3QR8 A;  4MZ9 A;  4RKL A;  1TQO A;  4RKB A;  4DK1 A;  1II3 A;  5ELB A;  1L2F A;  2EJF C;  2BA0 A;  1OXV A;  3BZC A;  1KIX A;  4DAV A;  3NEM A;  5ELE A;  1K9M C;  1VQF A;  3GDE A;  1PFB A;  2DGY A;  5CMD A;  1I3Q H;  2K52 A;  5ISR A;  1PTO F;  2JA8 G;  1C9O A;  1EYA A;  1O7L A;  1STY A;  4CGY B;  2KA7 A;  1RKN A;  4IPC A;  2F0P A;  5DNF A;  3GTO H;  3OHX C;  1FL0 A;  1OXT A;  4HCE A;  3HOX G;  2M9V A;  4A3E H;  3HOU H;  4LFB Q;  4LJZ C;  4JI4 L;  4FP5 D;  4HSV A;  5LMU Q;  2OQK A;  2EJG C;  2EYM A;  4RA8 A;  1LTT D;  3BDL A;  1TWH H;  1X56 A;  4GN4 B;  4TQU S;  4LF9 Q;  1XJV A;  3JAM c;  1DD2 A;  3WOF A;  4RGN A;  1RD9 D;  4NW2 A;  1HFG A;  3J81 L;  4PZ8 A;  3VYR A;  2HHH L;  3BDO A;  5E1F A;  3I4N G;  2Z0S A;  3T1Y L;  3KF8 B;  3IKJ A;  1HQM C;  5K36 G;  2IWH A;  5KEE A;  3CP0 A;  4GZY C;  2JA8 B;  1PYB A;  2QEJ C;  3NEN A;  2ZXP A;  5EPK A;  1NMG A;  4EX5 A;  1YHA A;  5FJ8 H;  4K5X A;  3CCJ A;  5J22 A;  1D5X C;  3MEF A;  3K5M A;  1DON A;  1AZQ A;  5IGD A;  1W3S A;  2F0T A;  3QOL A;  3HOX B;  3EN2 A;  1JB3 A;  2K5Q A;  1I6H B;  1FR3 A;  4CHT B;  3VYT A;  3RN5 A;  1I6V C;  4HJ9 A;  3B6Y A;  1SND A;  2UXB Q;  2F1M A;  4X62 L;  2AWN A;  4A3I H;  1C8C A;  2D9U A;  4XIG S;  1YNJ C;  4XYO A;  2HUG A;  5KYI A;  4YY3 L;  3H0G G;  3AFQ A;  3BYY B;  2VZA A;  1LTR D;  3HFZ B;  5IT9 L;  5IP7 H;  4QUF A;  1WFQ A;  4QJF A;  2E2H H;  3M7G A;  3K57 A;  4UAI A;  3PIO A;  3VR5 A;  1EFW A;  1VMC A;  2RSO A;  1HZA A;  5C4X H;  4K0K L;  3TN2 A;  5FLM G;  4QUC A;  4DV0 L;  4EQ5 A;  4A3L H;  2B2Y A;  3H0G B;  3I3C A;  3J7Z C;  3X3M A;  2Q8T A;  4GNX C;  2PCF B;  5JOB A;  1TWF B;  3LGJ A;  4JG2 A;  1YIJ A;  2IJ0 A;  2PQA A;  2RDF A;  2NYZ D;  2EQS A;  3OWF A;  3CAM A;  2M00 A;  2MO0 A;  1PTO C;  1SE3 A;  4PZ7 A;  4XQJ A;  3H6M A;  1I94 L;  1B70 B;  1WYD A;  1JOR A;  3M85 A;  4GOP B;  3MXN A;  4YWM A;  5C0X I;  3PMF A;  4GLX A;  1EY7 A;  1U4P A;  5T1G A;  2A74 C;  3ERQ A;  1Q8K A;  5ELC A;  2EDG A;  4B3T Q;  1FYC A;  3S1M H;  1QZG A;  5KYL A;  4XXE A;  2LXJ A;  3E3X A;  1XNR Q;  4XYQ A;  1QIL A;  2R61 A;  2NVY H;  2ZXR A;  3CCR A;  4DR7 L;  4DPG A;  4JI5 Q;  4LF4 Q;  2NVX H;  2UUC Q;  1EWH A;  3CC4 A;  5EPJ A;  2K14 A;  5CV6 A;  1W6J A;  4UY8 C;  2KHS A;  5IYC G;  3S1Q H;  1CM9 A;  2SEB D;  1HCZ A;  3OW2 A;  1MI2 A;  4KJN A;  2QKI C;  3QIA A;  4X3S A;  4LF6 L;  1EIH A;  1NE3 A;  2F0E A;  4IOA A;  1JE5 A;  5IT9 c;  2JEB I;  1K28 A;  3L0O A;  1WTO A;  1HNX Q;  1KNA A;  1EYC A;  4S3S A;  1ZXT A;  1I4H A;  1XYI A;  1B9N A;  2FXQ A;  2VS1 A;  1A8V A;  4JI2 L;  1DXM A;  1UAP A;  5LL6 S;  4DR5 Q;  4UDU C;  4MIU A;  2SOB A;  1TU2 B;  4A3B H;  4LFC L;  4KJO A;  2FMC A;  1J5E L;  3L2P A;  3CCM A;  1TS5 A;  3AQQ A;  3KLS A;  4JV5 L;  1LTB D;  3NQT A;  2R7F A;  2PZU A;  4JBW A;  2B8G A;  5GAG C;  1XMO Q;  4X65 L;  4OGQ C;  4BBS H;  1I6H H;  1I4G A;  1PH4 A;  3HOV H;  5GAE C;  2KCT A;  2LXK A;  3MAQ A;  5LMN W;  4LAA A;  1NBW A;  3BZK A;  3MEH A;  4H02 A;  1U4M A;  4IUV A;  3TP8 A;  2QW7 A;  5CV7 A;  1K8O A;  4LF7 L;  5CV8 A;  2JA5 H;  1SMX A;  2AHO B;  1YJN A;  1JCK B;  4JI8 Q;  5M3F G;  2B2Y C;  1Q90 A;  3CRK C;  2CWP A;  1IW7 D;  1RF2 D;  3OMG A;  2R93 H;  2ICI A;  1XMQ Q;  1WCM G;  4FXG C;  2YV5 A;  4KY7 A;  2JXM B;  2DY8 A;  1VQ5 A;  5D14 A;  4C1N I;  4JI1 L;  5E4W C;  2Q8R E;  2K5W A;  5C3E G;  1G2T A;  3S15 B;  2CH4 W;  2N49 A;  3H0G H;  1KDC A;  4MNO A;  1D2B A;  2AQ3 B;  1PFM A;  4ZK9 B;  2HCC A;  1NY4 A;  1SYG A;  4NDX A;  4ODG A;  2F0K A;  2FIN B;  3S1R B;  2HT1 A;  1KAA A;  5M3F B;  1VDZ A;  2EJM A;  3TS2 A;  1XTD A;  4JBK A;  4JI7 L;  1K83 B;  2K01 A;  3T13 A;  1WCM B;  3AEV A;  2YTV A;  1H9R A;  3BVZ A;  5IYB G;  1F9Q A;  5D65 A;  3C46 A;  4G7Z C;  4GS3 A;  1TWG H;  5C3E B;  1S4Z A;  1B53 A;  5FKA C;  2JA7 G;  5J3B A;  1CHQ D;  1E2W A;  5HGQ A;  2KJX A;  2F3I A;  4JI3 L;  5IOC A;  3U4Z A;  1N34 Q;  3DWA A;  2MFI A;  1CA5 A;  3UDI A;  3KJP A;  1MKH A;  1CA6 A;  1VQD A;  1X3G A;  4G57 A;  3MC0 B;  2TMP A;  1IL2 A;  3RZD B;  1O78 A;  2IPK D;  2HQE A;  3NTK A;  4ZAI A;  3D6C A;  3BVG A;  3RLF A;  4RAU C;  5G3L D;  5BR8 Q;  5AJ3 L;  4Y7N H;  1LT5 D;  4FO2 A;  5M5W B;  4WJW A;  2JA7 B;  1SAP A;  3VR3 A;  3J80 c;  1E7Z A;  3VA5 A;  4DV6 L;  2E2I B;  2EY2 A;  3VYU A;  3C2P A;  3KUP A;  2JK8 A;  4HR7 B;  4DV1 L;  3FP9 A;  4DNI A;  2K33 A;  3GTP B;  1KXL A;  1LV9 A;  4RCO A;  3C3L A;  2R7Z H;  3L3O C;  2NTT A;  4JC0 A;  4CJ2 C;  4A3J H;  2IX0 A;  3FPP A;  2TSS A;  3KK7 A;  2YU9 B;  2UXC Q;  2ENB A;  3K7A B;  2BH8 A;  3M4O H;  1V1P B;  4P75 A;  4MTN A;  1Q3L A;  1YZ6 A;  3CRL C;  3OOC A;  1HNZ L;  1YJW A;  4HJ8 A;  1VS0 A;  4ZUJ A;  1SYB A;  1AE3 A;  4C2M B;  1HR0 W;  1GUO A;  2QF7 A;  2K50 A;  3ONA B;  3Q8D A;  3MTS A;  1VF5 C;  1IW7 C;  1IBL Q;  1N32 L;  1AEX A;  4KKS A;  4QL5 A;  4I7A A;  3H3V H;  4H44 C;  3UDF A;  2UUB Q;  4B08 A;  1PA6 A;  3MHB A;  1H9S B;  3CME A;  3G6E A;  2JA6 G;  2K05 A;  4NXN Q;  2DN8 A;  3NSW A;  2I5L X;  1G2S A;  2A69 D;  4LFA Q;  2EOT A;  3ULP A;  1WTX A;  4IFD H;  1IZ6 A;  4KD4 A;  1DOM A;  1UE6 A;  1TS3 A;  4WJ3 M;  3ICE A;  4QGU A;  1EFI D;  3AYH B;  3CPW A;  2G9D A;  5IWA Q;  1VQO A;  4DV5 Q;  2VUM G;  4YCW A;  5IY0 A;  1YNX A;  4DU9 A;  2JA6 B;  1SE4 A;  2B2W A;  1JOO A;  1FGU A;  4NXM L;  1CZW A;  1I4P A;  3K5O A;  1L1O A;  1N33 Q;  1LT3 D;  2F0D A;  1JJG A;  3RD4 A;  4DUY L;  4ZQ3 A;  1TR5 A;  2CVR A;  1N36 Q;  1R4Q B;  5HUR A;  4LUV A;  3A74 A;  3C1F A;  1JJ2 A;  4DGZ A;  1D5M C;  1SJE D;  2M2L A;  4DR1 L;  1HXY D;  4DR6 L;  2RA4 A;  2NWG A;  2PYK A;  3CCL A;  1I4R A;  1QB5 D;  2DJF C;  4QQB X;  2IX3 A;  5IIF A;  3GV3 A;  3HOW G;  2VUM B;  2KVM A;  3MXP A;  1ZKO A;  2N88 A;  5M3F H;  1QJO A;  1TY0 A;  2HIX A;  1CQF A;  1CZG A;  1CT1 D;  1I4Q A;  1UEB A;  3SK8 A;  1P16 A;  2P5Z X;  2EYO A;  4A3F H;  2KEE A;  3NTI A;  4HJ5 A;  1Y1V G;  1IYJ B;  5C3E H;  3S1N H;  4R8I A;  3CHB D;  4ZKC B;  5FK9 C;  2NN6 G;  1XXG A;  1RL2 A;  4V0B A;  1T5E A;  3HOW B;  2PMZ E;  3SK6 A;  2ZTE A;  4OHJ A;  2EY5 A;  2OCE A;  1HNW Q;  3R3O A;  1LAC A;  3I55 A;  2K1B A;  2QDL A;  3TP5 A;  3K7U C;  2E2D C;  5IYB H;  3RZD H;  3IAY A;  1WI5 A;  4C1N K;  1KTK A;  1Y1V B;  4JI6 L;  3OWE B;  2HHH Q;  5A2Q L;  5NUC A;  4L5Q A;  1S72 A;  4IN3 A;  3T1Y Q;  5M5W H;  5JJI A;  4DR4 Q;  1SYD A;  1ET6 A;  3E9H A;  3VDY A;  2E2I H;  3A5U A;  2K28 A;  1QVC A;  3ZJY C;  1E22 A;  1J8I A;  4DK6 C;  2KHI A;  1AP0 A;  2B39 A;  1V8Q A;  2AMC B;  3ERS X;  2X6L A;  1HZB A;  3K59 A;  5ELF A;  2ZJQ A;  4RGT A;  2A69 C;  3T53 B;  5T1I A;  1HJP A;  1PTO B;  1KQS A;  2ZM6 L;  1E2Z A;  3M4Q A;  3SE0 A;  5C44 G;  1K8G A;  5KGU A;  3GTQ B;  1BCP D;  3JAM L;  1CHP D;  2CKZ B;  3DLL A;  3CMA A;  4K2K A;  5C4H A; 
#chains in the Genus database with same CATH homology
 2E2H H;  2E2J H;  2K5V A;  1XMO L;  4C2M H;  5M5Y H;  1CSQ A;  3PIO A;  2BH2 A;  1TWC H;  1EFW A;  2IT1 A;  1HZA A;  4GLV B;  4HID A;  5C4X H;  1H95 A;  2E8G A;  4JBM A;  4K0K L;  4K0K Q;  1A63 A;  2IY5 B;  5FLM G;  4GNX A;  1Q1B A;  5EAY A;  4DV0 L;  2XTI A;  4DV0 Q;  3GTK H;  3UE0 A;  4EQ5 A;  1VQ6 A;  4A3L H;  2HIV A;  4LF5 L;  3J7Z C;  1XPR A;  4GNX C;  1CKN A;  2Z6K A;  1YVC A;  1M90 C;  4IPD A;  3LGJ A;  4JG2 A;  4JI8 L;  4KHZ A;  4KHP L;  1YIJ A;  4KHP Q;  2PQA A;  1C7Y A;  3S17 H;  3CD6 A;  2PI2 A;  1SE8 A;  2Z6K C;  3K8A A;  2ZJP A;  2EQS A;  1VQN A;  1IXR A;  1UE7 A;  3BU2 A;  2CWA A;  2OQ0 A;  2VQF L;  3CAM A;  2VQF Q;  1YI2 A;  4YHH Q;  1R9T H;  1E3P A;  2MO0 A;  2Q2T A;  1ASY A;  4A3G H;  3KDF B;  4PZ7 A;  4A3F G;  1PH7 A;  2DUD A;  2RHS B;  4Y52 H;  1BVS A;  3PF5 A;  3AFP A;  1I94 L;  1I94 Q;  4LW1 A;  1EIY B;  1B70 B;  1WYD A;  2RHQ B;  3PUY A;  4JOI A;  3STB C;  1X6O A;  4KI0 A;  3S15 H;  2NZO A;  4AIM A;  3M85 A;  2I0Q A;  4BA2 I;  4DR6 Q;  4OXP A;  4GOP B;  2IHE A;  4IO9 A;  3RLO A;  2WFW A;  1OTC A;  2EIF A;  4YWM A;  5C0X I;  1Y1W H;  4GLX A;  2JA6 H;  4A3K G;  4YWL A;  3F2B A;  2B63 G;  3CW2 C;  2R92 H;  5IP9 H;  3S1R H;  1PH8 A;  2VL6 A;  3PUV A;  1Q8K A;  1C0A A;  2WP8 J;  1JJC B;  4A3E G;  1YEZ A;  4B3T L;  3NBH B;  4B3T Q;  3HOU G;  3PF4 A;  4POG A;  1N8R C;  1XNQ L;  1XNQ Q;  1K83 H;  3S1M H;  2RF4 A;  1WCM H;  3RN2 A;  1QZG A;  2LXJ A;  1XNR Q;  1Q82 C;  3M3Y H;  2NVY H;  4FDB A;  1GM5 A;  4DV3 L;  4DV3 Q;  3CCR A;  4DKA C;  4DV4 L;  1CKM A;  4DR7 L;  5DLQ E;  1LYL A;  4JI5 L;  1X65 A;  4DPG A;  4JI5 Q;  2NVX H;  2UUC Q;  2MNA A;  4LF4 Q;  4HIO A;  2UXD L;  2UXD Q;  4HJ7 A;  2R7D A;  3RR5 A;  1YIT A;  3CC4 A;  4OO1 G;  4R4I A;  1VQJ A;  2GVA A;  1X54 A;  2K14 A;  3UDX A;  5FJ8 G;  2JEA I;  2ES2 A;  3G48 A;  3UDG A;  4UY8 C;  5JEA J;  5IYC G;  3S1Q H;  3S24 A;  1ASZ A;  4JI4 Q;  2BA1 A;  1GKH A;  4LUO A;  1EYG A;  4DR3 L;  3KYH C;  4DV7 L;  4DV7 Q;  2D62 A;  3FKI H;  4DR3 Q;  1X55 A;  4LUZ A;  3OW2 A;  4BY1 H;  4A3I G;  4GOP C;  3RLN A;  2VNU D;  3K0X A;  1U5K A;  4LF6 L;  4LF6 Q;  1NE3 A;  2ID0 A;  1YHQ A;  4IOA A;  1JE5 A;  5IT9 c;  5BR8 L;  2CQO A;  4A93 G;  2JEB I;  1OXS C;  3IRB A;  3HOZ H;  3S16 H;  3L0O A;  1S40 A;  1HNX L;  1HNX Q;  2JA7 H;  5IP7 G;  3A5Z B;  2PNH A;  3S2H H;  2WB1 E;  2KBN A;  3KLW A;  3SGI A;  1Q81 C;  3D0F A;  3M9B A;  2FXQ A;  2VS1 A;  5FLX c;  4LF8 L;  2WAQ G;  4GNX B;  1A8V A;  3ULJ A;  4JI2 L;  4JI2 Q;  2JE6 I;  2JA9 A;  3CPF A;  3GTP H;  4P71 A;  3PUX A;  4DR5 L;  4DR5 Q;  4A3C H;  4PMW A;  5C4X G;  2D0O A;  4A3B H;  3G71 A;  1CKN B;  4LFC L;  1QZH A;  4LFC Q;  2YU9 H;  2Q2H A;  1VQL A;  1JMC A;  5JJL A;  4X62 Q;  2EXD A;  2F4V L;  3K7A H;  2F4V Q;  4C3J H;  4L5R C;  2K4K A;  2PQA B;  2NVQ H;  2ZM6 Q;  3PO2 H;  1QUQ A;  4OWT B;  3KJO A;  3PO3 H;  4YY3 Q;  1J5E L;  3L2P A;  1J5E Q;  3CCM A;  2E5L L;  3AQQ A;  1PH9 A;  3J80 i;  4A3D H;  4HIM A;  1VQH A;  4JV5 L;  4JV5 Q;  2QA4 A;  1PHJ A;  2R7F A;  1L0W A;  2I5H A;  2IX1 A;  1FJG L;  1FJG Q;  4A75 A;  4JBW A;  2B29 A;  1GD7 A;  5GAG C;  3U4V A;  1XMO Q;  1SLJ A;  4X65 L;  4X65 Q;  4A3G G;  1K3R A;  4BBS H;  1I6H H;  4IPG A;  1PH4 A;  2Y0S E;  3HOV H;  5GAE C;  3CXC A;  4AH6 A;  4DR2 L;  4DR2 Q;  2KCT A;  2LXK A;  1CSP A;  3MXN B;  5LMN W;  4A3M H;  3HKS A;  1PH2 A;  1BBU A;  1NBW A;  1Y14 B;  3BZK A;  3PSI A;  2IHF A;  4H02 A;  4HJA A;  1X3E A;  4GKK L;  1NTG A;  4GKK Q;  2K5N A;  4ME3 A;  4LF7 L;  4BBR G;  4LF7 Q;  1HR0 L;  4LF5 Q;  1HR0 Q;  4DAY B;  1Y1W G;  4BY7 G;  4BXX G;  1Q12 A;  2JA5 H;  1SMX A;  1KRS A;  2AHO B;  4JBJ A;  2UUA L;  2UUA Q;  1K73 C;  1YJN A;  2R92 G;  4JI8 Q;  5M3F G;  3J81 j;  2C35 B;  1EQQ A;  3RZO H;  5LMN L;  5LMN Q;  2CWP A;  1XPU A;  4QIW E;  3U50 C;  2R93 H;  1AH9 A;  3F8T A;  1X3F A;  2ASB A;  1IBM L;  1IBM Q;  4J15 A;  3BJU A;  1HH2 P;  1MJC A;  1XMQ Q;  1WCM G;  2MO1 A;  1HZ9 A;  2YV5 A;  1XMQ L;  5HY6 A;  1I5F A;  3HOY G;  1VQ5 A;  4L5T A;  2F52 A;  3EIV A;  3E0E A;  4JI1 L;  4JI1 Q;  3JC6 6;  4A76 A;  2CFM A;  5C3E G;  2N49 A;  2VW9 A;  1NMF A;  3H0G H;  1VQG A;  2MQH A;  4P72 A;  4MNO A;  1LM0 A;  4PG3 A;  2VQE L;  2VQE Q;  1VQ8 A;  1UWV A;  1Z47 A;  4JOI C;  4IFD J;  1NY4 A;  3D31 A;  3PUW A;  3M7N A;  3CQZ H;  2HT1 A;  3T1H L;  4DAM A;  4UP8 A;  3PIP A;  1U0L A;  3T1H Q;  4DUZ L;  4DUZ Q;  1XTD A;  3TS2 A;  5GAH C;  2KEN A;  4JI7 L;  4R1J A;  4JI7 Q;  4JBK A;  3W5O A;  1N36 L;  1JT8 A;  3FKI G;  5E7N A;  2ATW A;  3AEV A;  1E1O A;  2YTV A;  1KL9 A;  4AQY L;  5IYB G;  5M3M H;  1LUZ A;  5IYD G;  4GS3 A;  4TVA B;  3CCQ A;  1TWG H;  1SN8 A;  3CCE A;  4A4I A;  4RMF A;  5C0X G;  4DV4 Q;  4DR7 Q;  2JA7 G;  1TXY A;  5J3B A;  1LTL A;  2VUM H;  1W2B A;  3UE1 A;  3I4M H;  1A62 A;  5HGQ A;  2NN6 I;  3CF5 A;  2F3I A;  4LWC A;  4JI3 L;  1YJ9 A;  4JI3 Q;  4P73 A;  4R4Q A;  4YCV A;  3U4Z A;  1YBY A;  3S2D H;  3STB D;  1A0I A;  1N34 L;  1N34 Q;  2MFI A;  3PV0 A;  1QUQ B;  1PVO A;  3UDI A;  2H5X A;  3KJP A;  1MKH A;  4A3B G;  1VQD A;  1X3G A;  2QEX A;  1EOV A;  4B3S L;  3WWV A;  4B3S Q;  1IL2 A;  4WJ4 A;  2AWO A;  2RCN A;  3L7Z C;  2N3S A;  2CCZ A;  1MIU A;  4C3H H;  3RLF A;  3I2Z A;  5BR8 Q;  1D7Q A;  5AJ3 L;  4Y7N H;  4UPA A;  1EUJ A;  4X66 L;  3H3V I;  1N9W A;  4X66 Q;  4A3D G;  4R4T A;  3HOW H;  2QGQ A;  2B63 H;  3J80 c;  1VQC A;  1E7Z A;  1VQI A;  3K81 C;  4DV6 Q;  4DV6 L;  2V1C C;  1HNW L;  5GQO A;  2JK8 A;  4LFB L;  4DV1 L;  4LF8 Q;  3G4S A;  4DV1 Q;  3J81 i;  3FP9 A;  4BBS G;  4DNI A;  1DGS A;  4GN3 B;  3A0J A;  1PH5 A;  4OWW B;  1O7I A;  4IFD I;  4B3M L;  3HOV G;  3FHW A;  4B3M Q;  1KXL A;  4B3R L;  3TRZ A;  2R7Z H;  4JC0 A;  4B3R Q;  5IE8 A;  3HKZ E;  4A3J H;  2IX0 A;  4AYB E;  4A3M G;  3K80 C;  5C4J H;  2UXC L;  1OXU A;  2UXC Q;  3TEH B;  1VQM A;  1V1Q A;  1Y1V H;  1VQ7 A;  2OTL A;  2BH8 A;  4A3L G;  3M4O H;  1VQK A;  4DR4 L;  2K5H A;  1SFO H;  3CC7 A;  4GN5 A;  1GVP A;  1Q86 C;  2JA5 G;  4P75 A;  4MTN A;  2E5L Q;  1EIF A;  1Q1E A;  2XGT A;  1YZ6 A;  2YTX A;  3U58 A;  2JA8 H;  1HNZ L;  3TQY A;  4YWK A;  1YJW A;  3GTM H;  4HJ8 A;  3E9I A;  2R93 G;  1D8L A;  1VS0 A;  4UP7 A;  1IBK L;  1IBK Q;  4JCV E;  4DV2 L;  4DV2 Q;  1AE3 A;  3F2C A;  3PGZ A;  3HOX H;  1HR0 W;  2GN5 A;  4OWX B;  1UE5 A;  2A19 A;  2K50 A;  3I7F A;  3M4P A;  3Q8D A;  2UU9 L;  2UU9 Q;  3PO2 G;  2UXB L;  3TS0 A;  4O2D A;  3JAM i;  5GRO A;  5ELN A;  1IBL L;  1IBL Q;  2AKW B;  1N32 L;  1EQR A;  2R6G A;  4R4C A;  4R4O A;  2KHJ A;  1VQB A;  1N32 Q;  3I4O A;  2ALY B;  4QL5 A;  1B7Y B;  3H3V H;  1BKB A;  3UDF A;  2UUB L;  2UUB Q;  4NXM Q;  3I4N H;  4OX9 L;  4OX9 Q;  3GTQ H;  1G29 1;  2KCM A;  1PA6 A;  3CME A;  2NVT H;  3G6E A;  2LSS A;  4NXN L;  1M1K C;  1Q46 A;  4NXN Q;  2JA6 G;  3W1G A;  2I5L X;  2VY3 A;  4IOC A;  5IP9 G;  4LFA L;  2JQO A;  4XTC S;  4LFA Q;  3W1B A;  1G6P A;  3ULP A;  1PH3 A;  5GAD C;  3KFU A;  1IZ6 A;  1AE2 A;  4DK3 C;  1B8A A;  1UE6 A;  4BA1 I;  1G51 A;  4WJ3 M;  1FVI A;  1I50 H;  1T9H A;  4KLK A;  4YCU A;  3ICE A;  4JYA L;  4JYA Q;  2JJQ A;  5JEA G;  5M3M G;  4GLA C;  3CCV A;  1BBW A;  4QGU A;  4POF A;  3KF6 A;  3CPW A;  3AYH B;  5C44 H;  3CC2 A;  5IWA L;  1NJI C;  5IWA Q;  1JB7 A;  4DV5 L;  1VQO A;  4DV5 Q;  2VUM G;  4YCW A;  3ER0 A;  3CCS A;  4PZ6 A;  2Y0S G;  5IY0 A;  1K8A C;  1TWF H;  3I4M G;  3S14 H;  1YNX A;  1Z9F A;  1V43 A;  1OXX K;  1VQ4 A;  5M5X H;  2GVB A;  1FGU A;  1RIP A;  1WJJ A;  1CUK A;  2A1A A;  4C3I H;  1UE1 A;  4NXM L;  1L1O A;  2ZTD A;  4GKJ L;  4YHH L;  1N33 L;  4GKJ Q;  1N33 Q;  3GO5 A;  1JJG A;  2B3G A;  4DUY L;  1VQA A;  4DUY Q;  1V9P A;  1PH6 A;  3EBE A;  1L1O C;  1N36 Q;  4LUV A;  3A74 A;  1HZC A;  4BY1 G;  4X64 L;  4X64 Q;  2L15 A;  4AQY Q;  1JJ2 A;  1VQE A;  2K75 A;  3PCO B;  1E1T A;  5FLM H;  4UP9 A;  1X9N A;  4OON A;  4DR1 L;  1PV4 A;  1SRO A;  4DR1 Q;  4DR6 L;  1KRT A;  4APV A;  4LNQ A;  4IJH A;  1GO3 E;  1XPO A;  3CCL A;  3HOZ G;  4BBR H;  4BXX H;  1KHI A;  4BY7 H;  1QVF A;  1KAW A;  4QQB X;  3HOW G;  2N78 A;  2YYZ A;  3OTO L;  3OTO Q;  2I5M X;  3J7A 5;  4OO1 I;  5M3F H;  2HIX A;  4MZ9 A;  1UEB A;  2PI2 E;  1P16 A;  3J81 c;  2ZJR A;  4A3C G;  1L2F A;  1XNR L;  2R7Z G;  2BA0 A;  1OXV A;  4A3J G;  4A3F H;  3HOY H;  3BZC A;  1E24 A;  1PH1 A;  1KIX A;  1PYS B;  3NEM A;  4P74 A;  3RNU A;  4HJ5 A;  1Y1V G;  1IYJ B;  1K9M C;  5C3E H;  1VQF A;  3GDE A;  4JI0 L;  4JI0 Q;  2WAQ E;  2DGY A;  3I56 A;  2Q2I A;  3PO3 G;  3KDF A;  4LF4 L;  3S1N H;  2UUC L;  5JJK A;  1I3Q H;  2K52 A;  4IPH A;  2NN6 G;  1S3O A;  1SR3 A;  5AJ3 Q;  2Q2U A;  2JA8 G;  1C9O A;  3F2D A;  1RL2 A;  3GTL H;  3KOJ A;  4IPC A;  4A3K H;  2PMZ E;  4NB3 A;  2ZTE A;  3GTO H;  1EWI A;  1K0R A;  1FL0 A;  1TWA H;  1OXT A;  2OCE A;  3H15 A;  4GOP A;  3F1Z A;  3HOX G;  1HNW Q;  4A3E H;  3I55 A;  3HOU H;  4LFB Q;  4JI4 L;  5LMU L;  5LMU Q;  2OQK A;  3GTG H;  2A8V A;  2OTJ A;  1VCI A;  2OWO A;  3K7U C;  5IYB H;  3RZD H;  1VQP A;  1TWH H;  1X56 A;  1WI5 A;  2ZTC A;  4GN4 B;  4TQU S;  4LF9 L;  2YTY A;  1XJV A;  1PFS A;  1SRU A;  3JAM c;  4LF9 Q;  5IYD H;  4IJL A;  4L5S A;  4PZ8 A;  4JI6 L;  4JI6 Q;  2HHH L;  1P8L A;  2HHH Q;  3GD7 A;  3I4N G;  2Z0S A;  4L5Q A;  1S72 A;  3T1Y L;  3DM3 A;  3ULL A;  5M5W H;  5H1S E;  3T1Y Q;  3KF8 B;  5JJI A;  4X6A H;  4DR4 Q;  5K36 G;  3E9H A;  3CP0 A;  3VDY A;  2E2I H;  3PUZ A;  3A5U A;  1PYB A;  3NEN A;  3CCU A;  1NMG A;  1QVC A;  3NEL A;  4EX5 A;  3ZJY C;  1E22 A;  1YHA A;  1HNZ Q;  5FJ8 H;  4DK6 C;  3CCJ A;  2KHI A;  4IFD G;  3MEF A;  2N8N A;  1YHB A;  1WOC A;  2AMC B;  1W3S A;  3ERS X;  5IYC H;  1KC8 C;  3KF6 B;  3EN2 A;  1HZB A;  4HIK A;  3RN5 A;  2HQL A;  2NZH A;  4HJ9 A;  2ZJQ A;  3B6Y A;  4QY7 A;  1KD1 C;  2UXB Q;  2WB1 G;  4X62 L;  1CKO A;  2AWN A;  4NPS A;  1HJP A;  3OYY A;  4XIG S;  5C0X J;  4A3I H;  1Q7Y C;  1KQS A;  2ZM6 L;  1QVG A;  3TRE A;  4YY3 L;  3GTJ H;  1VQ9 A;  3H0G G;  3M4Q A;  5C44 G;  3AFQ A;  4ALP A;  4O0A A;  1K8G A;  1L1O B;  4A93 H;  2VZA A;  1MJE A;  4RG1 A;  1J6Q A;  2D0P A;  3HKZ G;  3HFZ B;  5ELO A;  4AYB G;  2CKZ B;  5IP7 H;  3DLL A;  3CMA A;  1WFQ A;  4QJF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...