1TWGH

Rna polymerase ii complexed with ctp
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription
total genus 21
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1twgH00
1LTLA 2ES2A 4YCVA 1VS0A 2ZTDA 3I4MG 3AFPA 2Z0SA 3UDIA 1OXXK 4L5RC 4X66L 1MJCA 1SMXA 4BBRH 2VUMG 1EWIA 3DM3A 4LWCA 1UE6A 4P73A 1N33L 1GKHA 2DGYA 2YTXA 3BU2A 5IP7G 4LF5L 1KQSA 4NXNQ 4GNXA 2YTYA 3TEHB 2QGQA 2QEXA 2PI2A 2Q2TA 3I55A 5M3MH 2R7ZG 5GAGC 4A75A 1NE3A 1WCMG 4JCVE 5M3FH 4GNXB 3VDYA 3E0EA 3M4QA 4JI5L 2KHJA 4YY3L 1HNZQ 4RMFA 2A8VA 2E8GA 2BH2A 1BKBA 4A3MG 1O7IA 2YTVA 4QQBX 3KJOA 1NMGA 3FHWA 4JBMA 1CUKA 4ME3A 1K0RA 1X54A 4HIMA 3STBD 4LF8Q 1T9HA 3TREA 4UY8C 2WFWA 3S1QH 1A8VA 2I5MX 4X65Q 4A3JH 2KCTA 4LF4Q 1YHBA 1QVFA 4JV5Q 4K0KL 2VNUD 1JE5A 1J5EL 4A3CH 4YCWA 1MIUA 4A4IA 3K7AH 1Q7YC 1PYSB 4NXMQ 5LMNW 1SROA 1XTDA 3GO5A 3PUYA 2UXBQ 1VQPA 5AJ3L 2MFIA 1JMCA 2ATWA 3CPFA 4PZ6A 1Q12A 5IYCH 4X62L 2IY5B 3KF6A 1XNRL 3S15H 3CD6A 2LXKA 4OONA 3K7UC 3GTGH 1S40A 2RCNA 4POGA 1CKOA 1SE8A 5ELOA 2K4KA 3HOZG 1N9WA 1FL0A 3PO3G 1J6QA 5IYDH 3KYHC 1YJNA 4LFBL 4DR3L 2JE6I 4GN3B 2HHHL 1YVCA 1Y1VG 3L0OA 3GTKH 1BVSA 2B63G 3CCMA 4UP7A 4B3SL 2KHIA 3JAMi 3CCUA 4BBSG 1G6PA 4LUVA 3HOWH 4R4CA 3GDEA 4DPGA 3J81j 1QZHA 2ZJQA 1X56A 4JBKA 4BXXG 1Y1WG 1FGUA 4YWMA 3D31A 4YWLA 2WAQE 1I50H 3E9IA 4HIKA 3I4MH 5GROA 1U5KA 3BZKA 4LNQA 5IY0A 1SN8A 3A74A 3CW2C 2JEBI 2Y0SE 5J3BA 2GN5A 4GKKQ 1QUQA 1KC8C 5JJKA 2V1CC 5GADC 1XPOA 1VQGA 2H5XA 5GQOA 3U58A 3S2HH 1IBLL 2UUCQ 3HOUG 1A63A 5HGQA 1QUQB 5BR8L 2R7ZH 3NENA 2F52A 2VW9A 3JAMc 4DR1L 2Z6KC 5FJ8G 5M5YH 1D8LA 2Q2UA 4IOAA 1NMFA 1N34L 3HKSA 1EUJA 3MXNB 2R92G 1K3RA 1Q46A 1QZGA 1UE1A 4J15A 4P74A 3CPWA 3TS0A 4A3MH 3HKZE 1KHIA 4A3BG 1AH9A 2CWAA 3CF5A 1PV4A 1N36Q 3KOJA 4A3GG 1LYLA 1VQFA 3G6EA 3HOYG 1VQAA 2JA7G 4JC0A 4PG3A 2ASBA 4B3TQ 3RN2A 3H15A 3HOVG 2I0QA 5FLMH 2GVBA 1V9PA 4P75A 3F2BA 4AYBE 3RLNA 1Z47A 1N32Q 2K5VA 1WOCA 5C4XH 1B70B 4GLXA 3GTQH 1TWHH 1WI5A 1K8GA 1G291 3J80i 2FXQA 2VQEQ 1NY4A 2Q2IA 3NBHB 2R93G 2KENA 3U4VA 1GVPA 2LSSA 2QA4A 2CCZA 4B3TL 4JI4L 4DV6L 4NPSA 3W1GA 1B8AA 1YIJA 1KD1C 4DR6Q 1AE2A 4DR7Q 1HR0Q 1JJGA 1N8RC 2E5LQ 3K81C 4GOPA 4HIDA 1QVGA 2VQEL 1G51A 1V43A 4FDBA 4YWKA 4LF7L 3RZDH 4C3HH 3PO2G 4WJ4A 3FKIG 2B63H 1FJGQ 2CFMA 3B6YA 4OWXB 4GOPB 4LF7Q 3GTPH 3HOXG 1KAWA 4JI1Q 4DR6L 2AKWB 4QGUA 4DR7L 2ALYB 1VQ4A 4DV5L 2ID0A 1X65A 4R4TA 3RR5A 4EX5A 2WB1E 5C3EH 3J80c 4DV3L 1VQOA 1Y1WH 1HR0L 1KL9A 1OXTA 3CC2A 1SLJA 4JYAQ 4LFCQ 1PHJA 1SFOH 4QL5A 3UDXA 2JA8H 3I4OA 5C44G 2OQ0A 3K80C 3G4SA 4HJ7A 1PH5A 1KIXA 3K0XA 3PUXA 3PV0A 1PH9A 1I3QH 1GD7A 2OQKA 4IJHA 4O2DA 4JI2Q 2N3SA 1HZBA 4B3MQ 1HNWQ 3ULPA 1EIYB 5LMUQ 3E9HA 3UDGA 2E2IH 4LF9Q 4JI3Q 4GS3A 2A19A 2K75A 4A3FG 2OTJA 2KCMA 1TWGH 4R4QA 2XGTA 1ASYA 5FJ8H 4IPGA 3AEVA 4Y52H 4BY7G 2R6GA 4BA1I 4GN4B 4KHZA 3FP9A 4HJ8A 1K9MC 2F4VQ 1E22A 2CQOA 4KLKA 2AHOB 5IP9G 1NBWA 1X6OA 4X64Q 1HNZL 5IT9c 4A93H 4JOIA 3CCEA 2OCEA 4YCUA 3HOYH 2C35B 4A3IG 2JA7H 3HOVH 1PVOA 3H0GG 4LFAQ 2JK8A 4JI7Q 1HNXQ 4DV7Q 4DUYQ 4WJ3M 2CKZB 5C0XJ 3L7ZC 1UEBA 4LF8L 3CCLA 2JA5H 3LGJA 4X65L 4BY1G 4LF4L 4JV5L 2B29A 3KDFA 4DV4Q 3L2PA 3S1RH 5JEAG 3I4NH 5GAEC 3I56A 2HQLA 3KF6B 2YV5A 1NTGA 4GNXC 1M1KC 2UUAQ 4NXML 1YZ6A 2JA6G 1HNXL 3KDFB 2UXBL 4EQ5A 1CKMA 1L1OA 1YNXA 5GAHC 2YYZA 3M85A 1XPRA 4DR4Q 3S17H 1VQCA 4TVAB 1L1OB 1WYDA 1X55A 2WAQG 4NB3A 1A62A 2K5NA 3MEFA 4YHHQ 3OYYA 3PIPA 2A1AA 1VQ5A 4A3DH 5JJIA 4A3LG 4A3EG 1EIFA 4DR2Q 1I94Q 1VQKA 2ZJRA 2I5LX 1XPUA 1MJEA 4XTCS 4O0AA 2Y0SG 2NVQH 3HOXH 1VQ7A 3BZCA 1FVIA 4L5QA 3S14H 4X6AH 5K36G 1IXRA 3CCSA 1YBYA 4IFDG 2RHQB 1X3GA 3TQYA 3GTOH 4DR4L 1VQLA 1C0AA 4H02A 1TXYA 1IL2A 5M5XH 3CCJA 2VUMH 3M7NA 1VQDA 3J7A5 1YHAA 5E7NA 3OTOQ 1E24A 1I94L 5IP7H 1X9NA 3EBEA 4R4IA 4AIMA 2NZHA 1E7ZA 2E2JH 4JG2A 1PH7A 1SR3A 4UP9A 4DV0Q 2NZOA 2AWNA 1WCMH 2BH8A 4DK6C 1IYJB 2EXDA 3HKZG 2K5HA 1VQBA 4APVA 3CAMA 4JI0Q 4BBRG 5IYBG 4A3FH 3S1NH 4GKKL 5M5WH 1BBUA 4LUOA 4IOCA 1YHQA 1V1QA 2UXDQ 4PZ8A 2UUCL 2AWOA 2DUDA 3CP0A 4DUZQ 1TWCH 4AYBG 3H3VI 2IHEA 3K8AA 1HJPA 2PMZE 5M3MG 5C4JH 4HJAA 4QIWE 5IWAQ 5M3FG 1UE7A 2I5HA 4DK3C 1Q86C 1XJVA 4A76A 1XMQQ 1HH2P 1WJJA 4NXNL 2UXDL 1EQRA 3I2ZA 4POFA 1AE3A 1N36L 1VQHA 5FLXc 4DAYB 1IZ6A 1A0IA 3D0FA 4QJFA 4DR5Q 1EYGA 3IRBA 1I5FA 1IBKQ 4HJ5A 2JEAI 2K14A 4R1JA 1VQIA 3U50C 4A3JG 1OTCA 4DV1Q 1VQEA 3ICEA 4A3CG 3HOZH 4C3IH 1VQMA 2L15A 3STBC 1N32L 4UP8A 3PO3H 4JI6Q 3RNUA 3PGZA 1MKHA 5EAYA 4AQYQ 1IBMQ 1W3SA 3GTJH 1Y1VH 2NVYH 4DR5L 3RZOH 2BA1A 1Z9FA 2WB1G 2ZTEA 5LMNQ 2ZJPA 4BBSH 3M4OH 3CC4A 1HZAA 3RLOA 1PH8A 4OWWB 4OXPA 4KHPQ 2UXCQ 1K8AC 4BXXH 1CKNA 4OWTB 3UDFA 4RG1A 3OW2A 2E5LL 1KXLA 5IYDG 4OX9Q 1IBML 1K73C 2OTLA 4A3KG 2JA9A 1CKNB 4IPCA 2N8NA 1C7YA 3GTMH 2EQSA 4JBWA 1FJGL 2NN6I 2N49A 5JJLA 4TQUS 4JI1L 3UE1A 4DKAC 2K52A 1N33Q 3CCQA 3HOUH 1K83H 5DLQE 3F1ZA 2MO0A 2MO1A 1VQNA 4JYAL 4LFCL 2NVTH 4R4OA 1YJWA 5HY6A 3AYHB 3W5OA 1OXUA 3PCOB 1PH2A 1LUZA 3PUZA 4IPHA 4YY3Q 5IYBH 2NN6G 4JI5Q 4B3ML 4JI2L 1PA6A 1PH6A 1HNWL 1S3OA 2WP8J 3F8TA 2R92H 3CXCA 1VQ6A 5LMUL 4A3BH 3GD7A 4GOPC 4C3JH 4LF9L 4JI3L 2D0PA 4JI8Q 2IX1A 4A3GH 3RN5A 1E1TA 1JB7A 3PSIA 1GM5A 3ERSX 1XNQQ 1TWAH 3S16H 2VQFQ 3G48A 4K0KQ 2XTIA 2F4VL 2RHSB 4MNOA 1R9TH 2JJQA 2K50A 5H1SE 1J5EQ 3CC7A 1XMOQ 2R7DA 1JJCB 4GLVB 4GN5A 4X64L 4PZ7A 2MNAA 1KRSA 4JI8L 5AJ3Q 3PIOA 3H3VH 4AH6A 1Y14B 1VCIA 1W2BA 2VY3A 2F3IA 3CMAA 4OO1I 2R93H 1S72A 4X62Q 3WWVA 2PQAA 1YJ9A 4LFAL 4JI7L 1XNRQ 4DV7L 4UPAA 4DUYL 1L0WA 1HR0W 5FLMG 2ZM6Q 2VQFL 3ER0A 1XNQL 4IFDI 1HZCA 2PQAB 2UUBQ 4XIGS 3PF5A 4DAMA 1Q1EA 1L2FA 1RIPA 3M4PA 3NELA 3CCRA 1OXVA 2EIFA 4C2MH 1YI2A 1XMOL 1Q8KA 3UE0A 1CSPA 3Q8DA 4L5SA 4DV4L 5C4XG 4IO9A 2UUAL 4LFBQ 1H95A 4LF6L 4DR3Q 4B3RQ 2HHHQ 4OO1G 3PO2H 4DNIA 1M90C 3FKIH 2Q2HA 3S24A 5ELNA 1VQ8A 1VQJA 2ZM6L 3AQQA 1VQ9A 3I7FA 4B3SQ 2Z6KA 1HZ9A 2UUBL 3KJPA 4JOIC 3S2DH 2R7FA 1RL2A 1WFQA 3A0JA 1LM0A 4YHHL 4DV2Q 3EIVA 4B3RL 4A3KH 4DR2L 3T1YQ 3S1MH 1C9OA 3F2CA 5C44H 3J81i 2IHFA 1DGSA 1EQQA 1PH4A 2UU9Q 4GLAC 1UE5A 3JC66 3HFZB 2AMCB 3KLWA 3A5UA 3T1HQ 2MQHA 1IBLQ 5C3EG 3J7ZC 1B7YB 4DV2L 4P71A 5BR8Q 3OTOL 5JEAJ 3RLFA 3T1YL 1L1OC 4DR1Q 1E3PA 1ASZA 2JA8G 4BY7H 4OX9L 3ULLA 2UU9L 1X3FA 4GKJQ 4DV0L 1N34Q 3A5ZB 2JQOA 5IP9H 3F2DA 1NJIC 3T1HL 4IPDA 4JI0L 3SGIA 1X3EA 4A3IH 2IX0A 1EOVA 3J81c 3H0GH 4HJ9A 2PI2E 2VL6A 3PUWA 4BA2I 4MZ9A 1YEZA 4DUZL 4GKJL 4KI0A 3BJUA 4QY7A 1JT8A 3KFUA 2E2HH 2KBNA 2HIVA 4PMWA 3PUVA 4L5TA 4IFDJ 1Q81C 4BY1H 5IWAL 1P8LA 4LUZA 4HIOA 2HT1A 4A93G 1Q1BA 4Y7NH 2YU9H 1XMQL 2CWPA 2JA6H 3CCVA 2B3GA 3KF8B 5IE8A 3CQZH 4JI4Q 4DV6Q 1TWFH 2PNHA 4LW1A 1GO3E 2RF4A 3DLLA 4MTNA 1P16A 3NEMA 5IYCG 4ALPA 1EFWA 3TS2A 3W1BA 1IBKL 3PF4A 2JA5G 1D7QA 1UWVA 4A3LH 2D0OA 4DV1L 3I4NG 4A3EH 1CSQA 3GTLH 1YITA 3M3YH 2D62A 4IJLA 5C0XI 4JI6L 1JJ2A 1I6HH 1U0LA 1PYBA 1BBWA 2HIXA 4AQYL 3AFQA 2NVXH 2OWOA 1OXSC 2LXJA 2BA0A 1Q82C 2N78A 3EN2A 5LMNL 4JBJA 4DV5Q 2GVAA 4X66Q 4DV3Q 1PH3A 2ZTCA 3M9BA 4LF6Q 1SRUA 4KHPL 2UXCL 3CMEA 4A3DG 3ZJYC 3ULJA 2IT1A 1KRTA 3HOWG 1E1OA 4LF5Q 1QVCA 2VZAA 3TRZA 5C0XG 4P72A 1PH1A 3G71A 1PFSA 3U4ZA 2VS1A
chains in the Genus database with same CATH superfamily
4HCEA 3I4MG 1D1IA 1OXXK 3QIAA 4BBSB 2FINB 2Z9HA 4BBRH 2ZXRA 4IUVA 4P73A 3K57A 5IP7G 4LF5L 4GNXA 2QGQA 1SYDA 1TT2A 1WCMG 4GNXB 3VDYA 3R3OA 4YY3L 2KHJA 2A8VA 1H9SA 1CK1A 4RGNA 3H09A 4KKUA 3HOUB 3BS1A 2QKIC 1BKBA 2YTVA 1PLFA 4FO2A 4QUCA 3TREA 3O13A 2RKSA 1QVFA 1T5EA 4A3JH 2F1MA 4RHRA 4PMBA 4XQNA 4YCWA 1MIUA 4A3BB 1EU4A 1YNJC 4C3JB 5LMNW 1XTDA 3D3RA 2ATWA 2IY5B 1F9PA 3KF6A 1XNRL 1W6JA 2EYHA 1NAPA 1SNCA 3CKIB 3GTGH 1F2MA 4ZKCB 2ENBA 2RCNA 1C8CA 4QUFA 1S5FD 3HOZG 1N9WA 1FL0A 3PO3G 2A6ED 1CZGA 3EA6A 2B2YC 4ME5A 1Y1VG 3L0OA 1LABA 2F0HA 3NPPA 3TSSA 1BVSA 4MN3A 2A74C 3JAMi 3CCUA 4B3SL 4BBSG 3GDEA 3WOEA 1QZHA 3Q0AA 4BXXG 4ODGA 4YWLA 1I50H 3ITPA 4N8FA 2B2VC 1I4RA 2MHVA 4HIKA 3I4MH 1U5KA 3BZKA 3Q22A 5IY0A 4LNQA 2JEBI 2GN5A 1EY0A 2V1CC 5GADC 3S2DB 1VQGA 5GQOA 1G2TA 3S2HH 2UUCQ 3HOUG 3I8ZA 1A63A 2RSOA 5BR8L 1U4LA 2EYJA 5C44B 3MXNA 4FP5D 5FJ8G 1SE4A 1NMFA 1N34L 3MXNB 1EUJA 2PPBC 2CVRA 4A3BG 4C3JG 2CWAA 3CF5A 1VQFA 5ISRA 3HOYG 4RCOA 2ASBA 3FRPB 4B3TQ 2E76C 1Z47A 5IGDA 5C4XH 2LFNA 1WI5A 2H4OA 4LAAA 3BDLA 1DYQA 3H0GB 2Q2IA 3KLSX 3U4VA 3S9WA 1IYUA 2FHTA 2JSOA 1BXTA 3NHHA 1TS5A 1KD1C 1LTGD 1AE2A 1SYBA 2E75C 1JJGA 4Y7NB 1QWYA 5CV5A 2VQEL 1DCZA 2YU9B 2LMCB 3RZDH 1G8ZD 4RKLA 3MFYA 4PV1C 4DXGA 1TWFB 3B6YA 3NUCA 3HOXG 2F0EA 4JI1Q 2WAQB 1ENCA 2QDBA 1WD0A 4DV5L 4R4TA 5C3EH 2WB1E 3E0JA 4A3EB 1OXTA 1KL9A 1GOZA 1SLJA 2F3VA 3DUZA 2A68C 1PHJA 1YNND 2OQ0A 5CBAE 5JAVA 5C44G 3G4SA 4HJ7A 1KIXA 3PUXA 1TQOA 1GD7A 2OQKA 2DY7A 4O2DA 4JI2Q 3NQIA 1AZPA 1HNWQ 2NVXB 4I7AA 2DJFC 4ZLTF 2R3ZA 5T1IA 4A3FG 4FXKC 4R4QA 5FJ8H 4CDDC 1STEA 4K5WA 1ILQA 4ABNA 2F4VQ 1G91A 2KHSA 1E0BA 2CH4A 4KLKA 5IP9G 1B9NA 1RTNA 4X64Q 2FFKB 1A3UA 3TN2A 4KJNA 3HOYH 3H0GG 2K04A 1HNXQ 4DV7Q 3MTSA 1NUCA 2CKZB 3SHLA 2AQ1B 2D9UA 3N6RA 3LGJA 1Y8NB 2PCFB 3FVQA 3KDFA 5JEAG 4DV4Q 5GAEC 1NTGA 5FO8B 3OPOA 3KDFB 3J7YW 4EQ5A 1GJXA 1L1OA 4PQXA 5C4ZA 4K2KA 4TRDA 5EQ0A 4DR4Q 1L1OB 1WTHA 2WAQG 4XYQA 2K5NA 4O1NA 3OYYA 4A3DH 4A3LG 4A3EG 1EIFA 1VQKA 1EZ6A 2I5LX 2EY1A 3HOXH 4L8JA 3S14H 1CI3M 3QOLA 2FMMA 3P75A 4KK7A 3GTOH 1BCPC 3L3OC 1LACA 1IL2A 3M7NA 1LTAD 3I91A 1KDBA 1E24A 4OELB 1X9NA 1E7ZA 4JG2A 4DV0Q 1VMCA 1IYJB 2EXDA 3H3VC 5LHY1 4RKBA 3FPPA 4A3FH 3A56A 1BBUA 4LUOA 2SEBD 4IOCA 1YHQA 1V1QA 3T16A 1IYVA 4PZ8A 1SSOA 4CKBA 4G7HC 1CZWA 2UUCL 3H3VI 5CBEE 3SR1A 4HJAA 1XMQQ 2UXDL 1BO0A 4RGMA 1EY8A 2A6HD 1IZ6A 2R7ZB 3IL8A 4QJFA 3IRBA 1EY4A 2IW3A 3IAYA 2CH4W 1VQIA 4FYDA 1VQEA 5EPLA 4UP8A 3E6ZX 3RNUA 1PFSA 1KDCA 4DR5L 4DNRB 5LMNQ 3CC4A 3RLOA 3MZ5A 4DF7A 1O7LA 2IL8A 2H1EA 4ZCKA 3UDFA 1CQVA 5F2DA 1STGA 1IBML 3X3MA 5JPNC 2HD3A 3GTMH 5JJLA 3EQLC 4JI1L 3TP7A 1K83H 1VQNA 1SYFA 1PH2A 4IPHA 1LTRD 4JI2L 2SNMA 1HNWL 5BN4A 1Y69U 3CXCA 3BZDB 3GD7A 3I4LA 4GOPC 5CV6A 2F0WA 1AEXA 1SNPA 2TMPA 2PO4A 3VR4A 1JB7A 4V0BA 2VQFQ 1H9RA 1B9MA 2F4VL 1JORA 2RHSB 5FO9B 3CC7A 4X64L 1SNMA 1KRSA 2RQXA 5AJ3Q 3H3VH 4FVMA 5C4HA 2F3IA 1TWGB 2VY3A 4OO1I 4X62Q 2PQAA 4DV7L 1QNUA 1L0WA 4DGZA 2JYOA 2PQAB 4XIGS 4DAMA 3M4PA 1ENAA 2X6LA 2RVLA 4C2MH 1Q8KA 4L5SA 3Q8DA 2K5WA 4DV4L 5IGGA 4E6IA 4LFBQ 4OO1G 1M90C 3OSOA 3AQQA 3OMGA 3EVQA 4X3UA 2JA5B 1A3TA 4IUQA 1H9KA 2KVMA 2L12A 2RDFA 3RUZA 3I4NB 2K01A 4DV2Q 3R2IA 3EIVA 4B3RL 4DA2A 3MVVA 3T1YQ 1TS2A 1C9OA 4FF2A 3D4WA 2NTSA 4EQPA 1HHVA 1J8IA 1NNXA 3J7ZC 5CGKA 3CU7A 1SNQA 5JEAJ 1HUNA 2M9VA 1JICA 3CRLC 4BY7H 4GKJQ 4DV0L 2JQOA 3I73A 1B50A 3PMFA 5M5XB 2VUMB 1UAPA 3K5LA 1AW7A 4G4KA 2QILA 3J81c 4MZ9A 1YEZA 3NSWA 1PZID 2KBNA 3NE5B 4I65A 2ZXPA 1Q81C 2EYMA 1P8LA 4LUZA 2PZWA 1CFMA 1XMQL 2CWPA 1OO9B 4KTAA 2EDGA 4R8IA 4DV6Q 3EFXD 4Q5VA 4LW1A 1GO3E 1KAAA 5IYCG 5G3LD 1HPCA 1PFMA 4HR7B 3TP6A 2JA5G 3K6OA 1MSGA 1V1OA 2D0OA 3I4NG 4OO1H 1YITA 3M3YH 5C0XI 3D6CA 5K36H 1BBWA 3GV6A 1DXMA 4PMCA 4CBVA 3I90A 1Q90A 4JK1C 3UI2A 5LMNL 4LF6Q 3PIP3 1PH3A 4DV3Q 3MEHA 3M9BA 1UUPA 1SRUA 2AUKA 4C3IB 3ULJA 1KRTA 1BDOA 4LF5Q 3SVMA 1QVCA 5C0XG 1PH1A 4RFBA 3G71A 1YI2A 3RZOB 1LTLA 4YCVA 2B63B 2K03A 2ZTDA 4EQOA 4J8QA 3UDIA 1FNVA 1JWUD 5CV7A 2VUMG 1F77A 3MWYW 1UE6A 3X3NA 3BU2A 1EIGA 4B9WA 1LT4D 3TEHB 3QB3A 5I2XA 3I55A 5M3MH 5GAGC 2K05A 4A75A 1LO5D 5M3FH 3BVMA 1I3QB 1PTOD 2LY7A 2P5ZX 1HNZQ 4X3TA 2Q8TA 1L0YB 1Y8PB 1CUKA 2F4IA 4V190 2L55A 1HTPA 3STBD 2EZVA 4LF8Q 1T9HA 3K5MA 3DWPA 2WFWA 1SAPA 1A8VA 2I5MX 3OWFA 1IKLA 5ELBA 4LF4Q 1YHBA 2CHBD 4A3CH 2K5QA 2R92B 1Q7YC 1SYEA 1L0XB 1SROA 3R8BA 3HEJA 3FDTA 3PUYA 4A3GB 1EY7A 5AJ3L 3DEPA 2MFIA 3D8GA 1WTWA 2VB2X 4PZ6A 5IYCH 1Q12A 4X62L 3F2UA 1UEAB 2NUCA 5IIFA 2A69D 1PZJD 1S40A 5ELOA 1PDQA 4C3IG 2EXZA 3KYHC 1YJNA 4LFBL 2XN9C 2JE6I 2NBFA 1YVCA 4ZYSA 3GTKH 2B63G 3URYA 2B2WC 1G6PA 4LUVA 1HUMA 3J81j 4JVZA 2ZJQA 4JBKA 1MSHA 3D31A 4OL7A 3RD4A 2WAQE 3PO2B 3K58A 3E9IA 4IUPA 4U673 4DAVA 2NVQB 1JOKA 5I9PA 2WINB 4K6DA 1PTOB 1XPOA 4M1UB 2V4DA 3JAMc 4LMQD 3VA5A 1D8LA 3H94A 3BVZA 3BVGA 3NXWA 5I9OA 2WACA 3HKSA 4DFAA 5EKLA 2R92G 4NXNQ 1LV9A 1Q46A 4H0LC 4J15A 2E74C 4EGVA 4A3GG 1LYLA 1QG7A 1RDPD 1VQAA 2JA7G 3EROA 3NWTA 4JC0A 3HOVG 2I0QA 5FLMH 1D6EC 2KCCA 3NBHA 1N32Q 1IKMA 1WOCA 5EBDA 3PIO3 4GLXA 3GTQH 4OIJA 1TWHH 4K14A 2L0CA 1G291 3L9AX 2FXQA 2VQEQ 3NBHB 2QA4A 2B2TA 4DV6L 4NPSA 3W1GA 5CORA 1B8AA 3TP8A 2L9HA 1N8RC 1NCVA 3DM1A 2F0IA 2JA6B 2PZUA 1IW7D 5D3IB 3VYUA 4C3HH 3PO2G 3CQZB 3SE0A 2B63H 4OWXB 5FLXL 1ET9A 1KAWA 1D5MC 4QGUA 4DR7L 2OTLA 2ID0A 4EX5A 1JWSD 4LF6L 4DV3L 1HR0L 1NSNS 3CC2A 1SFOH 3UDXA 2XWJB 2JA8H 2Y0SB 3I4OA 3K80C 1I3QH 4B3MQ 2B2UA 1LTID 1HZBA 3Q24A 2N55A 5G3LF 4XDXA 4LF9Q 2F0PA 4GS3A 2OTJA 2KCMA 1ASYA 1R4PB 3AEVA 5HGTA 1H9SB 1K9MC 1SNOA 1U4MA 1W6KA 3HKZB 1E22A 1II3A 1NBWA 1K3BC 1F2LA 5CYUA 1HNZL 2C35B 2JA7H 1PFNA 4DNTB 3HOVH 2O4XA 4HSVA 4AYBB 3T4AC 4N9TA 1LT6D 4WJ3M 5C0XJ 4IUNA 1FGBD 1S5ED 4MTKA 3HG9A 1QOHA 4LF8L 3CCLA 4LF4L 3KF6B 1M1KC 4GNXC 2D2CC 2JA6G 2HDLA 1F9SA 1YNXA 5GAHC 5IGBA 2Q8RE 1ENFA 3MXGA 2F0MA 1I6VC 1NR4A 1VQCA 4TVAB 1WYDA 1X55A 1A62A 1SMYD 1PTOF 4LK1C 3PIPA 1RHPA 5JJIA 1GHJA 3K7AB 3IKJA 4DR2Q 1JQYD 1FNUA 2NVQH 2Y0SG 3BZCA 2R61A 4L5QA 1IXRA 2F0SA 4F87A 3TQYA 3S15B 1TXYA 3CCJA 4IUUA 2BE5C 1SBBB 1YHAA 5E7NA 3KBGA 1JC7A 5D3DA 1I94L 5IP7H 4LJZC 1BR9A 3EBEA 4KY7A 4R4IA 2J7ZA 2E2JH 1PH7A 1SR3A 2NZOA 2AWNA 1WCMH 1E2WA 2BH8A 4QF4A 3HKZG 2K5HA 5DM63 1B3QA 3OIPA 4K2LA 4APVA 3CAMA 1SNDA 3AMUA 2UXDQ 2L4NA 4DUZQ 2XSCA 1TWCH 5J1ZA 4AYBG 3K8AA 3NBIA 2IWHA 1PMRA 5C4JH 1KLGD 1SDFA 4CJ1B 1Q86C 2QW7A 1DJRD 1HH2P 4NXNL 1TIID 3VR3A 2DNCA 5BN3A 4POFA 4RGOS 1VQHA 1F2ZA 1F2YA 3D0FA 4DR5Q 4NP5A 5M5YB 1FYCA 3P20A 2K14A 4R1JA 1OTCA 4HEDA 3ICEA 4KN7C 3HOZH 1X3QA 1VQMA 2L15A 1MHWC 1N32L 3PO3H 1GUTA 4JI6Q 1MKHA 4KMUC 1LT5D 5EAYA 4AQYQ 1RODA 3GTJH 1Y1VH 1IBMQ 1RTOA 5KYLA 2ZJPA 1B2TA 4BBSH 2UXCQ 4OXPA 1HQMC 1QNKA 4BXXH 4BS9A 1CKNA 4OWTB 3J80L 1WTOA 5IYDG 3GTLB 4UHVA 1CKNB 5L37A 1A2UA 2NN6I 2N49A 2A6EC 1TVXA 5E4WC 1N33Q 3HOUH 1SE2A 3HS0C 2EYOA 3VR2A 1YJWA 5FO7B 4B9XA 3W5OA 3GTPB 2NN6G 4B3ML 5T1GA 1X3PA 1PH6A 1ICFB 3TDQA 2F03A 3F8TA 4FF4A 1K0SA 3A54A 1VQ6A 1Y1WB 4A3BH 4C3JH 1EWHA 4LF9L 5IT9L 4XQQA 1M8AA 4KV6A 4QIWB 4RWSC 4L63B 3PSIA 3ERSX 3KBXA 3G48A 2N88A 4K0KQ 1AZQA 1J5EQ 1KABA 2JJQA 2G9HD 1JJCB 4GLVB 5EPJA 2FJ2A 2SNSA 4JI8L 3PIOA 1Y14B 2Z6BA 3WWVA 1YJ9A 2RDHA 1HR0W 2BCOA 3ER0A 3EJIA 4KJOA 4RH6A 1Q1EA 1XMOL 3S1QB 3NELA 1EQVA 3AU7A 4A93B 2WKCA 1WTVA 4FXDA 4B3RQ 4DNIA 3VA7A 4YIJA 2ZM6L 1VQ9A 3I7FA 3R2TA 2Z6KA 1I4PA 2LKVA 2K1BA 3S2DH 1WFQA 2KEEA 3S1RB 1CM9A 4DR2L 4DAPA 1EEFD 3HRZC 5C44H 2K28A 4IUTA 1STNA 5FKAC 1PH4A 4GLAC 3JC66 4HSPA 2AMCB 3KLWA 1WD1A 4JW0A 1IBLQ 1B7YB 1AN8A 2F0LA 3HOWB 3QWNA 3MXUA 1L1OC 1HQRD 3ULLA 2UU9L 1X3FA 2OXPA 3A5ZB 5IP9H 3T1HL 2XIWA 5JVG3 1YNNC 4FF1A 4XQJA 1DOMA 1EOVA 3H0GH 4HJ9A 1HFNA 2VL6A 4DUZL 3OIQA 4KI0A 3BJUA 2BDNA 4L6TB 1CTMA 2EYLA 4PMWA 4CDFC 3P7JA 1K8OA 5JEAH 3KF8A 3S1NB 4A93G 2HT1A 2L1BA 5M5WB 3U9OA 4Y7NH 2YU9H 3M7GA 4A3MB 3KF8B 2HCCA 1Q3LA 1TWFH 4EVOA 3DLLA 1B44D 4MTNA 4ALPA 2OF1A 4K5VA 2EYFA 5LL6X 4A3LH 4A3EH 3GTLH 4JI6L 3QJYA 1PYBA 5ELEA 4AQYL 1CHPD 2NVXH 3TMEA 1QILA 2LXJA 4HTHA 1Q82C 2N78A 2UXCL 3HOWG 1E1OA 2VZAA 2NVYB 1WVLA 2ES2A 1VS0A 5DAUA 2Z0SA 3M4OB 1SMXA 1HA6A 3DM3A 4HCSA 1E2ZA 1N33L 5EPKA 1KQSA 2YTYA 3PQIA 3J7AV 2R7ZG 3MAQA 3E0EA 5KEEA 4CJ2C 3A8JE 3M4QA 5J22A 3W3AA 2I07B 2ZXOA 3MXPA 1PXUA 2E2IB 1STHA 4A3MG 2F0NA 3SK6A 1PRTD 1B53A 3FHWA 2NVTB 5JPMC 1K0RA 3S1QH 2KCTA 4K0KL 3DHQA 1JE5A 3R93A 1J5EL 2DNEA 4A4IA 3U9SA 4NXMQ 2UXBQ 1VQPA 5KIXA 1HRJA 3TBIB 1JMCA 4OHJA 3CPFA 1QB5D 4C1NI 3S16B 1TWAB 3DXJC 1NR2A 3CD6A 4OONA 2A6HC 1T5XD 1STBA 3K7UC 4KY6A 2MPMA 1CKOA 1SE8A 3GV3A 2K4KA 3T51B 3MFGA 2LS01 2R93B 1GUSA 4G7ZC 4NW2A 1WTXA 1QCBD 2KCNA 2Z4HA 3ERQA 2WIIB 1JR0D 1LT3D 2BOSA 2FMCA 3NTHA 1LTSD 3HOWH 4DPGA 1EEID 4DN4M 4RA8A 4YWMA 3VR6A 2PW7A 3FKIB 1GXDC 5GROA 1HCZA 1SN8A 3LWUA 3CW2C 2Y0SE 2HQEA 4GKKQ 5JJKA 1B3AA 1EIHA 1A15A 2H5XA 5DM73 1IBLL 2ICIA 1X32A 3E5SA 5HGQA 2Z1CA 4ZAIA 2R7ZH 3S1MB 3NENA 1PRTB 3K5NA 2F52A 4C56C 1STYA 1EZ8A 3KLRA 4IOAA 2PZTA 1K3RA 1UE1A 4A3MH 1O80A 4P74A 3HKZE 1N36Q 4KD3A 2ZT9C 3G6EA 4ZKBB 1SYGA 3OHXC 3RN2A 4TKOB 2GVBA 1V9PA 1D5ZC 2K33A 3F2BA 4AYBE 3RLNA 4J1MA 1BUVT 5KNCA 2DY8A 1ET6A 1B70B 2DJGC 4X3SA 2L5TA 1BBXC 4U68A 4A3IB 1K8GA 3HZXA 3J80i 1NY4A 4IN3A 2R93G 2KENA 1GVPA 2LSSA 2CCZA 1YIJA 2E2HB 1PRTC 4BY1B 4DR7Q 1HR0Q 2EY2A 2E5LQ 4HIDA 1M4VA 1G51A 4K8IA 4WJ4A 2K5DA 3FKIG 2F0KA 1FJGQ 2CFMA 3TP5A 3QO2A 3I72A 4DR6L 2AKWB 2ALYB 1VQ4A 3A55A 1VQOA 2NZ1D 3GP7A 1ZYRD 4QL5A 1I6HB 1EOTA 1EYAA 1PH5A 4LF7L 1MBYA 3PV0A 4OIKA 4IJHA 5I6YA 2N3SA 1KTKA 1XXGA 5LMUQ 3E9HA 5M9OA 3HGBA 3BDCA 5C5LA 2E2IH 4JI3Q 2XRQD 1JOOA 2A19A 2K75A 5CV9A 1TWGH 2XGTA 1EY9A 4Y52H 2R6GA 4BA1I 4KHZA 3FP9A 3GTJB 4HJ8A 1I4XA 4RHSA 5C6AA 2WKDA 3D4RA 4BBRB 5FLXE 1EY5A 4JOIA 2OCEA 4YCUA 2QF7A 2K32A 4A3IG 1PVOA 2RSNA 4LFAQ 2JK8A 1LTTD 2PYKA 4DUYQ 4F88A 5E1FA 1EWCA 3L7ZC 1UEBA 5C3WA 2B8FA 2OT2A 2JA5H 4BY1G 3I4NH 2CW0D 5C3XA 3I56A 2HQLA 4NXML 1YZ6A 2UXBL 1CKMA 1XPRA 1ZEQX 4KKTA 3HP3A 4A3JB 3MEFA 2A1AA 1VQ5A 2F0UA 1I94Q 3KLSA 5C0XH 5I4DA 1XPUA 1MJEA 4QCLA 4XTCS 1VQ7A 1PRTF 2F0TA 1MD2D 2C9OA 2KQ3A 1YBYA 2A73B 1V1PA 1EY6A 2RHQB 3NTKA 3CCSA 3T56B 2RCFA 4IFDG 1C0AA 1PYWD 5EKIA 5M5XH 2VUMH 3GTGB 1VQDA 1CA6A 3J7A5 1V1PB 1SJHD 1DOKA 1U9RA 1RD9D 4BWGB 2NZHA 1XYIA 4UP9A 4NKLA 4DK6C 4FF3A 5E3FA 1J9OA 5JVH3 3OMCA 4ILWA 4JI0Q 4BBRG 4GKKL 4UDUC 2AWOA 1ESFA 1I4QA 2DUDA 3CP0A 5CR3A 2F0FA 3QR8A 2KOLA 1I50B 1YNJD 1HJPA 1E2VA 3I4MB 3OOCA 5CC4A 1AFPA 1RCVD 4QIWE 1V8QA 1CQFA 3ZYYX 4DK3C 1XJVA 4A76A 1WJJA 3S2HB 4J6HA 3CHBD 1EQRA 2QCPX 1G6ZA 2KUMA 1N36L 1PTOC 4KY5A 1A0IA 1EYGA 2PW5A 2WV6D 3K59A 4HJ5A 2JEAI 3U50C 4A3JG 4DV1Q 4C3IH 5ELCA 3STBC 3KUPA 1HFGA 1A2TA 5IGFA 2EE1A 3PGZA 4XYOA 4HMIA 3RZOH 1Z9FA 5DEHA 2ZTEA 4QMGA 2KJXA 2JXMB 3A7AB 5KRUA 1PH8A 4OWWB 1A6XA 1K8AC 1K28A 5C4XB 3C3LA 4RG1A 5D65A 3OW2A 2E5LL 2A69C 1EYCA 1ZXTA 3FPUB 1SE3A 3BG3A 2EY5A 2N8NA 3H6MA 2EQSA 1FJGL 4DKAC 4N8X1 4QB4A 2K52A 3CCQA 2IJ0A 3M4YA 1JOQA 3F1ZA 2MO0A 3V05A 2G9DA 2B2TC 3J7AF 3RZDB 1OXUA 3PCOB 4JI5Q 1PA6A 2R92H 5LMUL 5C3EB 2PMZB 2NB0A 4JI3L 4JI8Q 4A3GH 3RN5A 4DK0A 5KYIA 3J80E 1E1TA 2QDLA 2O5IC 2B2YA 1GM5A 2G5DA 3FMCA 2XTIA 4MNOA 2K50A 4ID6A 5H1SE 1XMOQ 2R7DA 2L11A 2C5CA 5E4XA 1Y8OB 4TSSA 3C46A 5CV8A 1W2BA 3LWEA 2EY6A 4WJWA 1S72A 4LFAL 1VF5C 2B2UC 4DUYL 1XNQL 1ILPA 2ZM6Q 2B2VA 4XXEA 3AB9A 1CA5A 1L2FA 1RIPA 5C4XG 1RKNA 4WRDA 2Q8IB 2Z4IA 5HURA 2K7VA 3HOYB 4DR3Q 3H91A 3IFDA 2HHHQ 3PO2H 2M2LA 1A3VA 4UAIA 5ELNA 3S24A 5IT9E 1VQ8A 1VQJA 2A5HA 4ZQ3A 2A68D 5IODA 1HZ9A 2UUBL 3VYTA 3KJPA 1VMPA 1PTOH 1IL8A 1CHQD 2AUJD 1RL2A 1B4OA 1PFBA 2F0VA 4HN7A 3F2CA 1TY2A 3NP8A 1SEBD 2IHFA 1DGSA 2UU9Q 2E2DC 5A2QL 2NYZD 1IW7C 1EU3A 3T1HQ 5C3EG 4A3DB 4P71A 3RLFA 4DR1Q 4RGTA 5I6WA 1ASZA 2B8GA 3HOXB 4OX9L 3S14B 3G7LA 4XT3B 3GTOB 1NJIC 2EJFC 4IPDA 4KKSA 1TS3A 4JI0L 3SGIA 1X3EA 4WFN3 1Z7TA 4NDXA 5CMDA 2VB3X 1TR5A 3BYYB 1JT8A 2HIVA 4IFDJ 5IOCA 1HA5A 1ZKOA 1S4ZA 5I2YA 4A3FB 4K8JA 2JA6H 1S5DD 2NWGA 1CT1D 3CCVA 2B3GA 4JI4Q 2SDFA 3CQZH 1AP0A 1EL0A 1D2BA 2RF4A 4RAUC 2MGSA 3P1HA 1EFWA 3PF4A 3QOJA 4GZYC 1UWVA 5IGCA 4DV1L 2I46A 1XX8A 1BCPD 2D62A 2GA4B 1GUOA 1TU2B 1JJ2A 1KNEA 5J39A 3J81E 1I4GA 2BA0A 2D5DA 3OWEB 2ZTCA 5ELFA 1QE6A 4A3DG 1Z6HA 3TRZA 4MIUA 1JE4A 5FLXc 1SMYC 4K6LA 3Q23A 2VS1A 2XRSD 3AFPA 3QG1A 5KGUA 4L5RC 4X66L 1MJCA 1GUNA 3BYTB 1EWIA 1KNAA 2O5JC 4LWCA 1GKHA 2DGYA 2YTXA 3T53B 2QEXA 2PI2A 2Q2TA 2X69A 3GTMB 1NE3A 4JCVE 2EPBA 3ND8A 4JI5L 4RMFA 1SJED 1ONLA 1K83B 2E8GA 2BH2A 1O7IA 4QQBX 3KJOA 1NMGA 4JBMA 4ME3A 1G2SA 1X54A 4HIMA 4UY8C 1BF4A 4X65Q 4JV5Q 4JPBW 2VNUD 1KLUD 3LX0A 3K7AH 1PYSB 3GO5A 1U4RA 1Q8IA 1BCPB 2OEOA 3NK9A 4O42A 1SXTA 4X3KA 2TSSA 4EQNA 3S15H 2LXKA 3OW7A 4H13C 5FK9C 4POGA 2DN8A 1J6QA 5IYDH 4KN4C 1WTPA 4DR3L 4GN3B 2HHHL 1TS4A 4NMZA 2SOBA 1D5XC 3CCMA 1HXYD 4UP7A 1ML0D 2KHIA 1F9RA 4ZRZA 5TSSA 5FOBB 4R4CA 3S17B 4C2MB 1X56A 5KNBA 1FGUA 5JOBA 4HAEA 3WOFA 1Y1WG 5ELDA 1F9QA 4P2CB 2NN6H 3A74A 3RMHA 2K6AA 5J3BA 3SK8A 5JJZA 1QUQA 1KC8C 3U58A 1RJTA 1VDZA 4CDCC 1O78A 1QUQB 3J81L 2IX3A 2VW9A 4DR1L 1O7YA 2Z6KC 5K5PA 5M5YH 2J4XA 1ICWA 2Q2UA 1QZGA 2IX1A 1AH9A 3TS0A 3CPWA 1KHIA 4CJ0B 1PV4A 3KOJA 1WTQA 2PQEA 3C1EA 4PG3A 4BY7B 3H15A 2X6GA 4G7OC 2JP1A 3MHBA 4P75A 4C1NK 2K5VA 4WORA 3DWQA 4B08A 4B3TL 1BOSA 3TZDA 4JI4L 3JAME 4DR6Q 1HTLD 3K81C 4GOPA 1QVGA 1V43A 2KEDA 4FDBA 4YWKA 3I3CA 1JWMD 4GOPB 3GTPH 4LF7Q 5DNFA 1X65A 3RR5A 3J80c 1Y1WH 5C5MA 3SK5A 4JYAQ 3M3YB 1VF7A 4OEMB 1C4QA 4LFCQ 2B39A 3K0XA 1PH9A 1DM0B 1H9JA 3ULPA 1EIYB 3UDGA 5A35A 3BDOA 3Q6SA 3A8KE 1BCPF 1JCKB 4IPGA 4BY7G 4GN4B 1WTRA 4Q0FA 2CQOA 2AHOB 3GQBA 2EJMA 5IGEA 4DXFA 1X6OA 2NTTA 4A93H 5IT9c 3CCEA 4KHVA 4JI7Q 5M3MB 5M3FB 1UNSA 1DZ1A 4X65L 4JV5L 2B29A 3L2PA 4IZ8A 3S1RH 1R9TB 2UUAQ 2YV5A 4Z9CB 4FXGC 4XT1B 1HNXL 2J0TD 3E3XA 2YYZA 3M85A 1I4HA 3W2DA 3ND9A 3S17H 4RCNA 4NB3A 4YHHQ 4KD4A 3SDZA 2EYPA 2ZJRA 3K5OA 2XWBB 4O0AA 4X6AH 1FVIA 5K36G 2WB1B 1U4PA 1X3GA 4DR4L 1VQLA 4H02A 1C48A 2Z8LA 4IALA 3OTOQ 4DK1A 1S5CD 4AIMA 4IQZA 4A3KB 1MI2A 2ICEC 1SYCA 3JAML 3GTKB 1FNWA 3LNNA 1VQBA 4F7XA 5IYBG 3S1NH 1XWEA 1STAA 3K0YA 5M5WH 4H7BA 2AQ3B 4PNYA 2IHEA 4M8AA 2PMZE 5M3MG 1LTBD 4CKEA 2RBMA 5M3FG 5IWAQ 3MA2B 1UE7A 2I5HA 2F0OA 4DAYA 5D14A 3SXHA 3FEWX 3I2ZA 1AE3A 5COYA 4DAYB 3NWSA 1D1KA 4CKCA 2F0JA 2AQ2B 1I5FA 2IPKD 1IBKQ 4CDEC 4ULLA 4A3CG 2RDGA 1EYDA 1PZKD 4ZUJA 3DEOA 1W3SA 2NVYH 2BA1A 2WB1G 2JN4A 3VYSA 2O2LD 5EJWA 3V96A 4H44C 3M4OH 1HZAA 2HDMA 4KHPQ 2MP1A 3GTQB 3C2PA 1TY0A 1TWHB 4R8NA 1KXLA 4OX9Q 1K73C 4A3KG 2JA9A 4IPCA 1C7YA 2F3WA 1R4QB 4JBWA 1EQTA 4TQUS 3UE1A 3IFTA 1BNZA 5DLQE 3WDNA 3A7LA 2MO1A 4JYAL 3DWAA 2BDOA 2MJ8A 1JB3A 4LFCL 2NVTH 4R4OA 5HY6A 4C3HB 3AYHB 3CRKC 4DU9A 1LUZA 3PUZA 2M00A 4YY3Q 5IYBH 5EKKA 3G6JB 1S3OA 2WP8J 1TKWB 4CGYB 3DMUA 2D0PA 1S5BD 2VXWA 3ONAB 1SFOB 4I7ZC 5AFWA 2JA8B 1XNQQ 1TWAH 3S16H 4ZUIA 3D4DA 1R9TH 4OGQC 4IURA 5EGTA 2B2WA 4G57A 4GN5A 4PZ7A 2MNAA 4AH6A 1VCIA 2R93H 3CMAA 1K8MA 2F0GA 4K5XA 4JI7L 1XNRQ 4UPAA 3I70A 2MUYA 5FLMG 2VQFL 3V2TA 4IFDI 1HZCA 3T13A 2UUBQ 3PF5A 3CCRA 2XVSA 4F8MA 1OXVA 2EIFA 3UE0A 1CSPA 4IO9A 2UUAL 1DOLA 2JA7B 1H95A 3HOVB 1DD2A 3N52A 3FKIH 2Q2HA 5EBCA 1GUGA 1ESRA 4B3SQ 1H9MA 4S3SA 2EOTA 4JOIC 1BQQT 2PNRC 2R7FA 3A0JA 4YHHL 1LM0A 3MC0B 4A3KH 1RF2D 3S1MH 1FR3A 3NQTA 5CV4A 4C3HG 3J81i 2RA4A 1EQQA 4MHEA 1UE5A 3HFZB 2XNAC 2KECA 3VYRA 3A5UA 2MQHA 2CQAA 4DV2L 5BR8Q 2KA7A 3OTOL 4FNFA 3NTIA 3T1YL 2F0DA 1E3PA 1EFID 5LL6S 2HCIA 5BN5A 2JA8G 5KNDA 1N34Q 1LLRD 1DONA 2EJGC 1ZYRC 1QJOA 3F2DA 3VR5A 3C1FA 5NUCA 4A3IH 1MGSA 2IX0A 1IHZA 3TZUA 2PI2E 3PUWA 4BA2I 2E2JB 4GKJL 4QY7A 2F0QA 1KDAA 1WCMB 2E2HH 3KFUA 3SEBA 3PUVA 4L5TA 4BY1H 5IWAL 3KK7A 2HUGA 5A2QE 4HIOA 1Q1BA 4HMJA 2EVBA 1TWCB 3SK4A 5IE8A 2QEJC 2PNHA 5C4JB 1P16A 3NEMA 1B1ZA 3TS2A 3W1BA 1IBKL 1D7QA 4ZK9B 1CSQA 4IJLA 1GHKA 1I6HH 2BE5D 1U0LA 2HIXA 3A8IE 3AFQA 2CW0C 4IFDH 4CHTB 2OWOA 1OXSC 1FD7D 1O7ZA 3EN2A 4JBJA 4DV5Q 2GVAA 4X66Q 4KHPL 3CMEA 3HOZB 3ZJYC 3D6WA 2IT1A 4R9WA 3PO3B 4N9PA 1GUWA 4P72A 1XTCD 3U4ZA 1Y1VB
chains in the Genus database with same CATH topology
1LTLA 2ES2A 4YCVA 1VS0A 2ZTDA 3I4MG 3AFPA 2Z0SA 3UDIA 1OXXK 4L5RC 4X66L 1MJCA 1SMXA 4BBRH 2VUMG 1EWIA 3DM3A 4LWCA 1UE6A 4P73A 1N33L 1GKHA 2DGYA 2YTXA 3BU2A 5IP7G 4LF5L 1KQSA 4NXNQ 4GNXA 2YTYA 3TEHB 2QGQA 2QEXA 2PI2A 2Q2TA 3I55A 5M3MH 2R7ZG 5GAGC 4A75A 1NE3A 1WCMG 4JCVE 5M3FH 4GNXB 3VDYA 3E0EA 3M4QA 4JI5L 2KHJA 4YY3L 1HNZQ 4RMFA 2A8VA 2E8GA 2BH2A 1BKBA 4A3MG 1O7IA 2YTVA 4QQBX 3KJOA 1NMGA 3FHWA 4JBMA 1CUKA 4ME3A 1K0RA 1X54A 4HIMA 3STBD 4LF8Q 1T9HA 3TREA 4UY8C 2WFWA 3S1QH 1A8VA 2I5MX 4X65Q 4A3JH 2KCTA 4LF4Q 1YHBA 1QVFA 4JV5Q 4K0KL 2VNUD 1JE5A 1J5EL 4A3CH 4YCWA 1MIUA 4A4IA 3K7AH 1Q7YC 1PYSB 4NXMQ 5LMNW 1SROA 1XTDA 3GO5A 3PUYA 2UXBQ 1VQPA 5AJ3L 2MFIA 1JMCA 2ATWA 3CPFA 4PZ6A 1Q12A 5IYCH 4X62L 2IY5B 3KF6A 1XNRL 3S15H 3CD6A 2LXKA 4OONA 3K7UC 3GTGH 1S40A 2RCNA 4POGA 1CKOA 1SE8A 5ELOA 2K4KA 3HOZG 1N9WA 1FL0A 3PO3G 1J6QA 5IYDH 3KYHC 1YJNA 4LFBL 4DR3L 2JE6I 4GN3B 2HHHL 1YVCA 1Y1VG 3L0OA 3GTKH 1BVSA 2B63G 3CCMA 4UP7A 4B3SL 2KHIA 3JAMi 3CCUA 4BBSG 1G6PA 4LUVA 3HOWH 4R4CA 3GDEA 4DPGA 3J81j 1QZHA 2ZJQA 1X56A 4JBKA 4BXXG 1Y1WG 1FGUA 4YWMA 3D31A 4YWLA 2WAQE 1I50H 3E9IA 4HIKA 3I4MH 5GROA 1U5KA 3BZKA 4LNQA 5IY0A 1SN8A 3A74A 3CW2C 2JEBI 2Y0SE 5J3BA 2GN5A 4GKKQ 1QUQA 1KC8C 5JJKA 2V1CC 5GADC 1XPOA 1VQGA 2H5XA 5GQOA 3U58A 3S2HH 1IBLL 2UUCQ 3HOUG 1A63A 5HGQA 1QUQB 5BR8L 2R7ZH 3NENA 2F52A 2VW9A 3JAMc 4DR1L 2Z6KC 5FJ8G 5M5YH 1D8LA 2Q2UA 4IOAA 1NMFA 1N34L 3HKSA 1EUJA 3MXNB 2R92G 1K3RA 1Q46A 1QZGA 1UE1A 4J15A 4P74A 3CPWA 3TS0A 4A3MH 3HKZE 1KHIA 4A3BG 1AH9A 2CWAA 3CF5A 1PV4A 1N36Q 3KOJA 4A3GG 1LYLA 1VQFA 3G6EA 3HOYG 1VQAA 2JA7G 4JC0A 4PG3A 2ASBA 4B3TQ 3RN2A 3H15A 3HOVG 2I0QA 5FLMH 2GVBA 1V9PA 4P75A 3F2BA 4AYBE 3RLNA 1Z47A 1N32Q 2K5VA 1WOCA 5C4XH 1B70B 4GLXA 3GTQH 1TWHH 1WI5A 1K8GA 1G291 3J80i 2FXQA 2VQEQ 1NY4A 2Q2IA 3NBHB 2R93G 2KENA 3U4VA 1GVPA 2LSSA 2QA4A 2CCZA 4B3TL 4JI4L 4DV6L 4NPSA 3W1GA 1B8AA 1YIJA 1KD1C 4DR6Q 1AE2A 4DR7Q 1HR0Q 1JJGA 1N8RC 2E5LQ 3K81C 4GOPA 4HIDA 1QVGA 2VQEL 1G51A 1V43A 4FDBA 4YWKA 4LF7L 3RZDH 4C3HH 3PO2G 4WJ4A 3FKIG 2B63H 1FJGQ 2CFMA 3B6YA 4OWXB 4GOPB 4LF7Q 3GTPH 3HOXG 1KAWA 4JI1Q 4DR6L 2AKWB 4QGUA 4DR7L 2ALYB 1VQ4A 4DV5L 2ID0A 1X65A 4R4TA 3RR5A 4EX5A 2WB1E 5C3EH 3J80c 4DV3L 1VQOA 1Y1WH 1HR0L 1KL9A 1OXTA 3CC2A 1SLJA 4JYAQ 4LFCQ 1PHJA 1SFOH 4QL5A 3UDXA 2JA8H 3I4OA 5C44G 2OQ0A 3K80C 3G4SA 4HJ7A 1PH5A 1KIXA 3K0XA 3PUXA 3PV0A 1PH9A 1I3QH 1GD7A 2OQKA 4IJHA 4O2DA 4JI2Q 2N3SA 1HZBA 4B3MQ 1HNWQ 3ULPA 1EIYB 5LMUQ 3E9HA 3UDGA 2E2IH 4LF9Q 4JI3Q 4GS3A 2A19A 2K75A 4A3FG 2OTJA 2KCMA 1TWGH 4R4QA 2XGTA 1ASYA 5FJ8H 4IPGA 3AEVA 4Y52H 4BY7G 2R6GA 4BA1I 4GN4B 4KHZA 3FP9A 4HJ8A 1K9MC 2F4VQ 1E22A 2CQOA 4KLKA 2AHOB 5IP9G 1NBWA 1X6OA 4X64Q 1HNZL 5IT9c 4A93H 4JOIA 3CCEA 2OCEA 4YCUA 3HOYH 2C35B 4A3IG 2JA7H 3HOVH 1PVOA 3H0GG 4LFAQ 2JK8A 4JI7Q 1HNXQ 4DV7Q 4DUYQ 4WJ3M 2CKZB 5C0XJ 3L7ZC 1UEBA 4LF8L 3CCLA 2JA5H 3LGJA 4X65L 4BY1G 4LF4L 4JV5L 2B29A 3KDFA 4DV4Q 3L2PA 3S1RH 5JEAG 3I4NH 5GAEC 3I56A 2HQLA 3KF6B 2YV5A 1NTGA 4GNXC 1M1KC 2UUAQ 4NXML 1YZ6A 2JA6G 1HNXL 3KDFB 2UXBL 4EQ5A 1CKMA 1L1OA 1YNXA 5GAHC 2YYZA 3M85A 1XPRA 4DR4Q 3S17H 1VQCA 4TVAB 1L1OB 1WYDA 1X55A 2WAQG 4NB3A 1A62A 2K5NA 3MEFA 4YHHQ 3OYYA 3PIPA 2A1AA 1VQ5A 4A3DH 5JJIA 4A3LG 4A3EG 1EIFA 4DR2Q 1I94Q 1VQKA 2ZJRA 2I5LX 1XPUA 1MJEA 4XTCS 4O0AA 2Y0SG 2NVQH 3HOXH 1VQ7A 3BZCA 1FVIA 4L5QA 3S14H 4X6AH 5K36G 1IXRA 3CCSA 1YBYA 4IFDG 2RHQB 1X3GA 3TQYA 3GTOH 4DR4L 1VQLA 1C0AA 4H02A 1TXYA 1IL2A 5M5XH 3CCJA 2VUMH 3M7NA 1VQDA 3J7A5 1YHAA 5E7NA 3OTOQ 1E24A 1I94L 5IP7H 1X9NA 3EBEA 4R4IA 4AIMA 2NZHA 1E7ZA 2E2JH 4JG2A 1PH7A 1SR3A 4UP9A 4DV0Q 2NZOA 2AWNA 1WCMH 2BH8A 4DK6C 1IYJB 2EXDA 3HKZG 2K5HA 1VQBA 4APVA 3CAMA 4JI0Q 4BBRG 5IYBG 4A3FH 3S1NH 4GKKL 5M5WH 1BBUA 4LUOA 4IOCA 1YHQA 1V1QA 2UXDQ 4PZ8A 2UUCL 2AWOA 2DUDA 3CP0A 4DUZQ 1TWCH 4AYBG 3H3VI 2IHEA 3K8AA 1HJPA 2PMZE 5M3MG 5C4JH 4HJAA 4QIWE 5IWAQ 5M3FG 1UE7A 2I5HA 4DK3C 1Q86C 1XJVA 4A76A 1XMQQ 1HH2P 1WJJA 4NXNL 2UXDL 1EQRA 3I2ZA 4POFA 1AE3A 1N36L 1VQHA 5FLXc 4DAYB 1IZ6A 1A0IA 3D0FA 4QJFA 4DR5Q 1EYGA 3IRBA 1I5FA 1IBKQ 4HJ5A 2JEAI 2K14A 4R1JA 1VQIA 3U50C 4A3JG 1OTCA 4DV1Q 1VQEA 3ICEA 4A3CG 3HOZH 4C3IH 1VQMA 2L15A 3STBC 1N32L 4UP8A 3PO3H 4JI6Q 3RNUA 3PGZA 1MKHA 5EAYA 4AQYQ 1IBMQ 1W3SA 3GTJH 1Y1VH 2NVYH 4DR5L 3RZOH 2BA1A 1Z9FA 2WB1G 2ZTEA 5LMNQ 2ZJPA 4BBSH 3M4OH 3CC4A 1HZAA 3RLOA 1PH8A 4OWWB 4OXPA 4KHPQ 2UXCQ 1K8AC 4BXXH 1CKNA 4OWTB 3UDFA 4RG1A 3OW2A 2E5LL 1KXLA 5IYDG 4OX9Q 1IBML 1K73C 2OTLA 4A3KG 2JA9A 1CKNB 4IPCA 2N8NA 1C7YA 3GTMH 2EQSA 4JBWA 1FJGL 2NN6I 2N49A 5JJLA 4TQUS 4JI1L 3UE1A 4DKAC 2K52A 1N33Q 3CCQA 3HOUH 1K83H 5DLQE 3F1ZA 2MO0A 2MO1A 1VQNA 4JYAL 4LFCL 2NVTH 4R4OA 1YJWA 5HY6A 3AYHB 3W5OA 1OXUA 3PCOB 1PH2A 1LUZA 3PUZA 4IPHA 4YY3Q 5IYBH 2NN6G 4JI5Q 4B3ML 4JI2L 1PA6A 1PH6A 1HNWL 1S3OA 2WP8J 3F8TA 2R92H 3CXCA 1VQ6A 5LMUL 4A3BH 3GD7A 4GOPC 4C3JH 4LF9L 4JI3L 2D0PA 4JI8Q 2IX1A 4A3GH 3RN5A 1E1TA 1JB7A 3PSIA 1GM5A 3ERSX 1XNQQ 1TWAH 3S16H 2VQFQ 3G48A 4K0KQ 2XTIA 2F4VL 2RHSB 4MNOA 1R9TH 2JJQA 2K50A 5H1SE 1J5EQ 3CC7A 1XMOQ 2R7DA 1JJCB 4GLVB 4GN5A 4X64L 4PZ7A 2MNAA 1KRSA 4JI8L 5AJ3Q 3PIOA 3H3VH 4AH6A 1Y14B 1VCIA 1W2BA 2VY3A 2F3IA 3CMAA 4OO1I 2R93H 1S72A 4X62Q 3WWVA 2PQAA 1YJ9A 4LFAL 4JI7L 1XNRQ 4DV7L 4UPAA 4DUYL 1L0WA 1HR0W 5FLMG 2ZM6Q 2VQFL 3ER0A 1XNQL 4IFDI 1HZCA 2PQAB 2UUBQ 4XIGS 3PF5A 4DAMA 1Q1EA 1L2FA 1RIPA 3M4PA 3NELA 3CCRA 1OXVA 2EIFA 4C2MH 1YI2A 1XMOL 1Q8KA 3UE0A 1CSPA 3Q8DA 4L5SA 4DV4L 5C4XG 4IO9A 2UUAL 4LFBQ 1H95A 4LF6L 4DR3Q 4B3RQ 2HHHQ 4OO1G 3PO2H 4DNIA 1M90C 3FKIH 2Q2HA 3S24A 5ELNA 1VQ8A 1VQJA 2ZM6L 3AQQA 1VQ9A 3I7FA 4B3SQ 2Z6KA 1HZ9A 2UUBL 3KJPA 4JOIC 3S2DH 2R7FA 1RL2A 1WFQA 3A0JA 1LM0A 4YHHL 4DV2Q 3EIVA 4B3RL 4A3KH 4DR2L 3T1YQ 3S1MH 1C9OA 3F2CA 5C44H 3J81i 2IHFA 1DGSA 1EQQA 1PH4A 2UU9Q 4GLAC 1UE5A 3JC66 3HFZB 2AMCB 3KLWA 3A5UA 3T1HQ 2MQHA 1IBLQ 5C3EG 3J7ZC 1B7YB 4DV2L 4P71A 5BR8Q 3OTOL 5JEAJ 3RLFA 3T1YL 1L1OC 4DR1Q 1E3PA 1ASZA 2JA8G 4BY7H 4OX9L 3ULLA 2UU9L 1X3FA 4GKJQ 4DV0L 1N34Q 3A5ZB 2JQOA 5IP9H 3F2DA 1NJIC 3T1HL 4IPDA 4JI0L 3SGIA 1X3EA 4A3IH 2IX0A 1EOVA 3J81c 3H0GH 4HJ9A 2PI2E 2VL6A 3PUWA 4BA2I 4MZ9A 1YEZA 4DUZL 4GKJL 4KI0A 3BJUA 4QY7A 1JT8A 3KFUA 2E2HH 2KBNA 2HIVA 4PMWA 3PUVA 4L5TA 4IFDJ 1Q81C 4BY1H 5IWAL 1P8LA 4LUZA 4HIOA 2HT1A 4A93G 1Q1BA 4Y7NH 2YU9H 1XMQL 2CWPA 2JA6H 3CCVA 2B3GA 3KF8B 5IE8A 3CQZH 4JI4Q 4DV6Q 1TWFH 2PNHA 4LW1A 1GO3E 2RF4A 3DLLA 4MTNA 1P16A 3NEMA 5IYCG 4ALPA 1EFWA 3TS2A 3W1BA 1IBKL 3PF4A 2JA5G 1D7QA 1UWVA 4A3LH 2D0OA 4DV1L 3I4NG 4A3EH 1CSQA 3GTLH 1YITA 3M3YH 2D62A 4IJLA 5C0XI 4JI6L 1JJ2A 1I6HH 1U0LA 1PYBA 1BBWA 2HIXA 4AQYL 3AFQA 2NVXH 2OWOA 1OXSC 2LXJA 2BA0A 1Q82C 2N78A 3EN2A 5LMNL 4JBJA 4DV5Q 2GVAA 4X66Q 4DV3Q 1PH3A 2ZTCA 3M9BA 4LF6Q 1SRUA 4KHPL 2UXCL 3CMEA 4A3DG 3ZJYC 3ULJA 2IT1A 1KRTA 3HOWG 1E1OA 4LF5Q 1QVCA 2VZAA 3TRZA 5C0XG 4P72A 1PH1A 3G71A 1PFSA 3U4ZA 2VS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LTL A;  2ES2 A;  4YCV A;  1VS0 A;  2ZTD A;  3I4M G;  3AFP A;  2Z0S A;  3UDI A;  1OXX K;  4L5R C;  4X66 L;  1MJC A;  1SMX A;  4BBR H;  2VUM G;  1EWI A;  3DM3 A;  4LWC A;  1UE6 A;  4P73 A;  1N33 L;  1GKH A;  2DGY A;  2YTX A;  3BU2 A;  5IP7 G;  4LF5 L;  1KQS A;  4NXN Q;  4GNX A;  2YTY A;  3TEH B;  2QGQ A;  2QEX A;  2PI2 A;  2Q2T A;  3I55 A;  5M3M H;  2R7Z G;  5GAG C;  4A75 A;  1NE3 A;  1WCM G;  4JCV E;  5M3F H;  4GNX B;  3VDY A;  3E0E A;  3M4Q A;  4JI5 L;  2KHJ A;  4YY3 L;  1HNZ Q;  4RMF A;  2A8V A;  2E8G A;  2BH2 A;  1BKB A;  4A3M G;  1O7I A;  2YTV A;  4QQB X;  3KJO A;  1NMG A;  3FHW A;  4JBM A;  1CUK A;  4ME3 A;  1K0R A;  1X54 A;  4HIM A;  3STB D;  4LF8 Q;  1T9H A;  3TRE A;  4UY8 C;  2WFW A;  3S1Q H;  1A8V A;  2I5M X;  4X65 Q;  4A3J H;  2KCT A;  4LF4 Q;  1YHB A;  1QVF A;  4JV5 Q;  4K0K L;  2VNU D;  1JE5 A;  1J5E L;  4A3C H;  4YCW A;  1MIU A;  4A4I A;  3K7A H;  1Q7Y C;  1PYS B;  4NXM Q;  5LMN W;  1SRO A;  1XTD A;  3GO5 A;  3PUY A;  2UXB Q;  1VQP A;  5AJ3 L;  2MFI A;  1JMC A;  2ATW A;  3CPF A;  4PZ6 A;  1Q12 A;  5IYC H;  4X62 L;  2IY5 B;  3KF6 A;  1XNR L;  3S15 H;  3CD6 A;  2LXK A;  4OON A;  3K7U C;  3GTG H;  1S40 A;  2RCN A;  4POG A;  1CKO A;  1SE8 A;  5ELO A;  2K4K A;  3HOZ G;  1N9W A;  1FL0 A;  3PO3 G;  1J6Q A;  5IYD H;  3KYH C;  1YJN A;  4LFB L;  4DR3 L;  2JE6 I;  4GN3 B;  2HHH L;  1YVC A;  1Y1V G;  3L0O A;  3GTK H;  1BVS A;  2B63 G;  3CCM A;  4UP7 A;  4B3S L;  2KHI A;  3JAM i;  3CCU A;  4BBS G;  1G6P A;  4LUV A;  3HOW H;  4R4C A;  3GDE A;  4DPG A;  3J81 j;  1QZH A;  2ZJQ A;  1X56 A;  4JBK A;  4BXX G;  1Y1W G;  1FGU A;  4YWM A;  3D31 A;  4YWL A;  2WAQ E;  1I50 H;  3E9I A;  4HIK A;  3I4M H;  5GRO A;  1U5K A;  3BZK A;  4LNQ A;  5IY0 A;  1SN8 A;  3A74 A;  3CW2 C;  2JEB I;  2Y0S E;  5J3B A;  2GN5 A;  4GKK Q;  1QUQ A;  1KC8 C;  5JJK A;  2V1C C;  5GAD C;  1XPO A;  1VQG A;  2H5X A;  5GQO A;  3U58 A;  3S2H H;  1IBL L;  2UUC Q;  3HOU G;  1A63 A;  5HGQ A;  1QUQ B;  5BR8 L;  2R7Z H;  3NEN A;  2F52 A;  2VW9 A;  3JAM c;  4DR1 L;  2Z6K C;  5FJ8 G;  5M5Y H;  1D8L A;  2Q2U A;  4IOA A;  1NMF A;  1N34 L;  3HKS A;  1EUJ A;  3MXN B;  2R92 G;  1K3R A;  1Q46 A;  1QZG A;  1UE1 A;  4J15 A;  4P74 A;  3CPW A;  3TS0 A;  4A3M H;  3HKZ E;  1KHI A;  4A3B G;  1AH9 A;  2CWA A;  3CF5 A;  1PV4 A;  1N36 Q;  3KOJ A;  4A3G G;  1LYL A;  1VQF A;  3G6E A;  3HOY G;  1VQA A;  2JA7 G;  4JC0 A;  4PG3 A;  2ASB A;  4B3T Q;  3RN2 A;  3H15 A;  3HOV G;  2I0Q A;  5FLM H;  2GVB A;  1V9P A;  4P75 A;  3F2B A;  4AYB E;  3RLN A;  1Z47 A;  1N32 Q;  2K5V A;  1WOC A;  5C4X H;  1B70 B;  4GLX A;  3GTQ H;  1TWH H;  1WI5 A;  1K8G A;  1G29 1;  3J80 i;  2FXQ A;  2VQE Q;  1NY4 A;  2Q2I A;  3NBH B;  2R93 G;  2KEN A;  3U4V A;  1GVP A;  2LSS A;  2QA4 A;  2CCZ A;  4B3T L;  4JI4 L;  4DV6 L;  4NPS A;  3W1G A;  1B8A A;  1YIJ A;  1KD1 C;  4DR6 Q;  1AE2 A;  4DR7 Q;  1HR0 Q;  1JJG A;  1N8R C;  2E5L Q;  3K81 C;  4GOP A;  4HID A;  1QVG A;  2VQE L;  1G51 A;  1V43 A;  4FDB A;  4YWK A;  4LF7 L;  3RZD H;  4C3H H;  3PO2 G;  4WJ4 A;  3FKI G;  2B63 H;  1FJG Q;  2CFM A;  3B6Y A;  4OWX B;  4GOP B;  4LF7 Q;  3GTP H;  3HOX G;  1KAW A;  4JI1 Q;  4DR6 L;  2AKW B;  4QGU A;  4DR7 L;  2ALY B;  1VQ4 A;  4DV5 L;  2ID0 A;  1X65 A;  4R4T A;  3RR5 A;  4EX5 A;  2WB1 E;  5C3E H;  3J80 c;  4DV3 L;  1VQO A;  1Y1W H;  1HR0 L;  1KL9 A;  1OXT A;  3CC2 A;  1SLJ A;  4JYA Q;  4LFC Q;  1PHJ A;  1SFO H;  4QL5 A;  3UDX A;  2JA8 H;  3I4O A;  5C44 G;  2OQ0 A;  3K80 C;  3G4S A;  4HJ7 A;  1PH5 A;  1KIX A;  3K0X A;  3PUX A;  3PV0 A;  1PH9 A;  1I3Q H;  1GD7 A;  2OQK A;  4IJH A;  4O2D A;  4JI2 Q;  2N3S A;  1HZB A;  4B3M Q;  1HNW Q;  3ULP A;  1EIY B;  5LMU Q;  3E9H A;  3UDG A;  2E2I H;  4LF9 Q;  4JI3 Q;  4GS3 A;  2A19 A;  2K75 A;  4A3F G;  2OTJ A;  2KCM A;  1TWG H;  4R4Q A;  2XGT A;  1ASY A;  5FJ8 H;  4IPG A;  3AEV A;  4Y52 H;  4BY7 G;  2R6G A;  4BA1 I;  4GN4 B;  4KHZ A;  3FP9 A;  4HJ8 A;  1K9M C;  2F4V Q;  1E22 A;  2CQO A;  4KLK A;  2AHO B;  5IP9 G;  1NBW A;  1X6O A;  4X64 Q;  1HNZ L;  5IT9 c;  4A93 H;  4JOI A;  3CCE A;  2OCE A;  4YCU A;  3HOY H;  2C35 B;  4A3I G;  2JA7 H;  3HOV H;  1PVO A;  3H0G G;  4LFA Q;  2JK8 A;  4JI7 Q;  1HNX Q;  4DV7 Q;  4DUY Q;  4WJ3 M;  2CKZ B;  5C0X J;  3L7Z C;  1UEB A;  4LF8 L;  3CCL A;  2JA5 H;  3LGJ A;  4X65 L;  4BY1 G;  4LF4 L;  4JV5 L;  2B29 A;  3KDF A;  4DV4 Q;  3L2P A;  3S1R H;  5JEA G;  3I4N H;  5GAE C;  3I56 A;  2HQL A;  3KF6 B;  2YV5 A;  1NTG A;  4GNX C;  1M1K C;  2UUA Q;  4NXM L;  1YZ6 A;  2JA6 G;  1HNX L;  3KDF B;  2UXB L;  4EQ5 A;  1CKM A;  1L1O A;  1YNX A;  5GAH C;  2YYZ A;  3M85 A;  1XPR A;  4DR4 Q;  3S17 H;  1VQC A;  4TVA B;  1L1O B;  1WYD A;  1X55 A;  2WAQ G;  4NB3 A;  1A62 A;  2K5N A;  3MEF A;  4YHH Q;  3OYY A;  3PIP A;  2A1A A;  1VQ5 A;  4A3D H;  5JJI A;  4A3L G;  4A3E G;  1EIF A;  4DR2 Q;  1I94 Q;  1VQK A;  2ZJR A;  2I5L X;  1XPU A;  1MJE A;  4XTC S;  4O0A A;  2Y0S G;  2NVQ H;  3HOX H;  1VQ7 A;  3BZC A;  1FVI A;  4L5Q A;  3S14 H;  4X6A H;  5K36 G;  1IXR A;  3CCS A;  1YBY A;  4IFD G;  2RHQ B;  1X3G A;  3TQY A;  3GTO H;  4DR4 L;  1VQL A;  1C0A A;  4H02 A;  1TXY A;  1IL2 A;  5M5X H;  3CCJ A;  2VUM H;  3M7N A;  1VQD A;  3J7A 5;  1YHA A;  5E7N A;  3OTO Q;  1E24 A;  1I94 L;  5IP7 H;  1X9N A;  3EBE A;  4R4I A;  4AIM A;  2NZH A;  1E7Z A;  2E2J H;  4JG2 A;  1PH7 A;  1SR3 A;  4UP9 A;  4DV0 Q;  2NZO A;  2AWN A;  1WCM H;  2BH8 A;  4DK6 C;  1IYJ B;  2EXD A;  3HKZ G;  2K5H A;  1VQB A;  4APV A;  3CAM A;  4JI0 Q;  4BBR G;  5IYB G;  4A3F H;  3S1N H;  4GKK L;  5M5W H;  1BBU A;  4LUO A;  4IOC A;  1YHQ A;  1V1Q A;  2UXD Q;  4PZ8 A;  2UUC L;  2AWO A;  2DUD A;  3CP0 A;  4DUZ Q;  1TWC H;  4AYB G;  3H3V I;  2IHE A;  3K8A A;  1HJP A;  2PMZ E;  5M3M G;  5C4J H;  4HJA A;  4QIW E;  5IWA Q;  5M3F G;  1UE7 A;  2I5H A;  4DK3 C;  1Q86 C;  1XJV A;  4A76 A;  1XMQ Q;  1HH2 P;  1WJJ A;  4NXN L;  2UXD L;  1EQR A;  3I2Z A;  4POF A;  1AE3 A;  1N36 L;  1VQH A;  5FLX c;  4DAY B;  1IZ6 A;  1A0I A;  3D0F A;  4QJF A;  4DR5 Q;  1EYG A;  3IRB A;  1I5F A;  1IBK Q;  4HJ5 A;  2JEA I;  2K14 A;  4R1J A;  1VQI A;  3U50 C;  4A3J G;  1OTC A;  4DV1 Q;  1VQE A;  3ICE A;  4A3C G;  3HOZ H;  4C3I H;  1VQM A;  2L15 A;  3STB C;  1N32 L;  4UP8 A;  3PO3 H;  4JI6 Q;  3RNU A;  3PGZ A;  1MKH A;  5EAY A;  4AQY Q;  1IBM Q;  1W3S A;  3GTJ H;  1Y1V H;  2NVY H;  4DR5 L;  3RZO H;  2BA1 A;  1Z9F A;  2WB1 G;  2ZTE A;  5LMN Q;  2ZJP A;  4BBS H;  3M4O H;  3CC4 A;  1HZA A;  3RLO A;  1PH8 A;  4OWW B;  4OXP A;  4KHP Q;  2UXC Q;  1K8A C;  4BXX H;  1CKN A;  4OWT B;  3UDF A;  4RG1 A;  3OW2 A;  2E5L L;  1KXL A;  5IYD G;  4OX9 Q;  1IBM L;  1K73 C;  2OTL A;  4A3K G;  2JA9 A;  1CKN B;  4IPC A;  2N8N A;  1C7Y A;  3GTM H;  2EQS A;  4JBW A;  1FJG L;  2NN6 I;  2N49 A;  5JJL A;  4TQU S;  4JI1 L;  3UE1 A;  4DKA C;  2K52 A;  1N33 Q;  3CCQ A;  3HOU H;  1K83 H;  5DLQ E;  3F1Z A;  2MO0 A;  2MO1 A;  1VQN A;  4JYA L;  4LFC L;  2NVT H;  4R4O A;  1YJW A;  5HY6 A;  3AYH B;  3W5O A;  1OXU A;  3PCO B;  1PH2 A;  1LUZ A;  3PUZ A;  4IPH A;  4YY3 Q;  5IYB H;  2NN6 G;  4JI5 Q;  4B3M L;  4JI2 L;  1PA6 A;  1PH6 A;  1HNW L;  1S3O A;  2WP8 J;  3F8T A;  2R92 H;  3CXC A;  1VQ6 A;  5LMU L;  4A3B H;  3GD7 A;  4GOP C;  4C3J H;  4LF9 L;  4JI3 L;  2D0P A;  4JI8 Q;  2IX1 A;  4A3G H;  3RN5 A;  1E1T A;  1JB7 A;  3PSI A;  1GM5 A;  3ERS X;  1XNQ Q;  1TWA H;  3S16 H;  2VQF Q;  3G48 A;  4K0K Q;  2XTI A;  2F4V L;  2RHS B;  4MNO A;  1R9T H;  2JJQ A;  2K50 A;  5H1S E;  1J5E Q;  3CC7 A;  1XMO Q;  2R7D A;  1JJC B;  4GLV B;  4GN5 A;  4X64 L;  4PZ7 A;  2MNA A;  1KRS A;  4JI8 L;  5AJ3 Q;  3PIO A;  3H3V H;  4AH6 A;  1Y14 B;  1VCI A;  1W2B A;  2VY3 A;  2F3I A;  3CMA A;  4OO1 I;  2R93 H;  1S72 A;  4X62 Q;  3WWV A;  2PQA A;  1YJ9 A;  4LFA L;  4JI7 L;  1XNR Q;  4DV7 L;  4UPA A;  4DUY L;  1L0W A;  1HR0 W;  5FLM G;  2ZM6 Q;  2VQF L;  3ER0 A;  1XNQ L;  4IFD I;  1HZC A;  2PQA B;  2UUB Q;  4XIG S;  3PF5 A;  4DAM A;  1Q1E A;  1L2F A;  1RIP A;  3M4P A;  3NEL A;  3CCR A;  1OXV A;  2EIF A;  4C2M H;  1YI2 A;  1XMO L;  1Q8K A;  3UE0 A;  1CSP A;  3Q8D A;  4L5S A;  4DV4 L;  5C4X G;  4IO9 A;  2UUA L;  4LFB Q;  1H95 A;  4LF6 L;  4DR3 Q;  4B3R Q;  2HHH Q;  4OO1 G;  3PO2 H;  4DNI A;  1M90 C;  3FKI H;  2Q2H A;  3S24 A;  5ELN A;  1VQ8 A;  1VQJ A;  2ZM6 L;  3AQQ A;  1VQ9 A;  3I7F A;  4B3S Q;  2Z6K A;  1HZ9 A;  2UUB L;  3KJP A;  4JOI C;  3S2D H;  2R7F A;  1RL2 A;  1WFQ A;  3A0J A;  1LM0 A;  4YHH L;  4DV2 Q;  3EIV A;  4B3R L;  4A3K H;  4DR2 L;  3T1Y Q;  3S1M H;  1C9O A;  3F2C A;  5C44 H;  3J81 i;  2IHF A;  1DGS A;  1EQQ A;  1PH4 A;  2UU9 Q;  4GLA C;  1UE5 A;  3JC6 6;  3HFZ B;  2AMC B;  3KLW A;  3A5U A;  3T1H Q;  2MQH A;  1IBL Q;  5C3E G;  3J7Z C;  1B7Y B;  4DV2 L;  4P71 A;  5BR8 Q;  3OTO L;  5JEA J;  3RLF A;  3T1Y L;  1L1O C;  4DR1 Q;  1E3P A;  1ASZ A;  2JA8 G;  4BY7 H;  4OX9 L;  3ULL A;  2UU9 L;  1X3F A;  4GKJ Q;  4DV0 L;  1N34 Q;  3A5Z B;  2JQO A;  5IP9 H;  3F2D A;  1NJI C;  3T1H L;  4IPD A;  4JI0 L;  3SGI A;  1X3E A;  4A3I H;  2IX0 A;  1EOV A;  3J81 c;  3H0G H;  4HJ9 A;  2PI2 E;  2VL6 A;  3PUW A;  4BA2 I;  4MZ9 A;  1YEZ A;  4DUZ L;  4GKJ L;  4KI0 A;  3BJU A;  4QY7 A;  1JT8 A;  3KFU A;  2E2H H;  2KBN A;  2HIV A;  4PMW A;  3PUV A;  4L5T A;  4IFD J;  1Q81 C;  4BY1 H;  5IWA L;  1P8L A;  4LUZ A;  4HIO A;  2HT1 A;  4A93 G;  1Q1B A;  4Y7N H;  2YU9 H;  1XMQ L;  2CWP A;  2JA6 H;  3CCV A;  2B3G A;  3KF8 B;  5IE8 A;  3CQZ H;  4JI4 Q;  4DV6 Q;  1TWF H;  2PNH A;  4LW1 A;  1GO3 E;  2RF4 A;  3DLL A;  4MTN A;  1P16 A;  3NEM A;  5IYC G;  4ALP A;  1EFW A;  3TS2 A;  3W1B A;  1IBK L;  3PF4 A;  2JA5 G;  1D7Q A;  1UWV A;  4A3L H;  2D0O A;  4DV1 L;  3I4N G;  4A3E H;  1CSQ A;  3GTL H;  1YIT A;  3M3Y H;  2D62 A;  4IJL A;  5C0X I;  4JI6 L;  1JJ2 A;  1I6H H;  1U0L A;  1PYB A;  1BBW A;  2HIX A;  4AQY L;  3AFQ A;  2NVX H;  2OWO A;  1OXS C;  2LXJ A;  2BA0 A;  1Q82 C;  2N78 A;  3EN2 A;  5LMN L;  4JBJ A;  4DV5 Q;  2GVA A;  4X66 Q;  4DV3 Q;  1PH3 A;  2ZTC A;  3M9B A;  4LF6 Q;  1SRU A;  4KHP L;  2UXC L;  3CME A;  4A3D G;  3ZJY C;  3ULJ A;  2IT1 A;  1KRT A;  3HOW G;  1E1O A;  4LF5 Q;  1QVC A;  2VZA A;  3TRZ A;  5C0X G;  4P72 A;  1PH1 A;  3G71 A;  1PFS A;  3U4Z A;  2VS1 A; 
#chains in the Genus database with same CATH topology
 4HCE A;  3I4M G;  1D1I A;  1OXX K;  3QIA A;  4BBS B;  2FIN B;  2Z9H A;  4BBR H;  2ZXR A;  4IUV A;  4P73 A;  3K57 A;  5IP7 G;  4LF5 L;  4GNX A;  2QGQ A;  1SYD A;  1TT2 A;  1WCM G;  4GNX B;  3VDY A;  3R3O A;  4YY3 L;  2KHJ A;  2A8V A;  1H9S A;  1CK1 A;  4RGN A;  3H09 A;  4KKU A;  3HOU B;  3BS1 A;  2QKI C;  1BKB A;  2YTV A;  1PLF A;  4FO2 A;  4QUC A;  3TRE A;  3O13 A;  2RKS A;  1QVF A;  1T5E A;  4A3J H;  2F1M A;  4RHR A;  4PMB A;  4XQN A;  4YCW A;  1MIU A;  4A3B B;  1EU4 A;  1YNJ C;  4C3J B;  5LMN W;  1XTD A;  3D3R A;  2ATW A;  2IY5 B;  1F9P A;  3KF6 A;  1XNR L;  1W6J A;  2EYH A;  1NAP A;  1SNC A;  3CKI B;  3GTG H;  1F2M A;  4ZKC B;  2ENB A;  2RCN A;  1C8C A;  4QUF A;  1S5F D;  3HOZ G;  1N9W A;  1FL0 A;  3PO3 G;  2A6E D;  1CZG A;  3EA6 A;  2B2Y C;  4ME5 A;  1Y1V G;  3L0O A;  1LAB A;  2F0H A;  3NPP A;  3TSS A;  1BVS A;  4MN3 A;  2A74 C;  3JAM i;  3CCU A;  4B3S L;  4BBS G;  3GDE A;  3WOE A;  1QZH A;  3Q0A A;  4BXX G;  4ODG A;  4YWL A;  1I50 H;  3ITP A;  4N8F A;  2B2V C;  1I4R A;  2MHV A;  4HIK A;  3I4M H;  1U5K A;  3BZK A;  3Q22 A;  5IY0 A;  4LNQ A;  2JEB I;  2GN5 A;  1EY0 A;  2V1C C;  5GAD C;  3S2D B;  1VQG A;  5GQO A;  1G2T A;  3S2H H;  2UUC Q;  3HOU G;  3I8Z A;  1A63 A;  2RSO A;  5BR8 L;  1U4L A;  2EYJ A;  5C44 B;  3MXN A;  4FP5 D;  5FJ8 G;  1SE4 A;  1NMF A;  1N34 L;  3MXN B;  1EUJ A;  2PPB C;  2CVR A;  4A3B G;  4C3J G;  2CWA A;  3CF5 A;  1VQF A;  5ISR A;  3HOY G;  4RCO A;  2ASB A;  3FRP B;  4B3T Q;  2E76 C;  1Z47 A;  5IGD A;  5C4X H;  2LFN A;  1WI5 A;  2H4O A;  4LAA A;  3BDL A;  1DYQ A;  3H0G B;  2Q2I A;  3KLS X;  3U4V A;  3S9W A;  1IYU A;  2FHT A;  2JSO A;  1BXT A;  3NHH A;  1TS5 A;  1KD1 C;  1LTG D;  1AE2 A;  1SYB A;  2E75 C;  1JJG A;  4Y7N B;  1QWY A;  5CV5 A;  2VQE L;  1DCZ A;  2YU9 B;  2LMC B;  3RZD H;  1G8Z D;  4RKL A;  3MFY A;  4PV1 C;  4DXG A;  1TWF B;  3B6Y A;  3NUC A;  3HOX G;  2F0E A;  4JI1 Q;  2WAQ B;  1ENC A;  2QDB A;  1WD0 A;  4DV5 L;  4R4T A;  5C3E H;  2WB1 E;  3E0J A;  4A3E B;  1OXT A;  1KL9 A;  1GOZ A;  1SLJ A;  2F3V A;  3DUZ A;  2A68 C;  1PHJ A;  1YNN D;  2OQ0 A;  5CBA E;  5JAV A;  5C44 G;  3G4S A;  4HJ7 A;  1KIX A;  3PUX A;  1TQO A;  1GD7 A;  2OQK A;  2DY7 A;  4O2D A;  4JI2 Q;  3NQI A;  1AZP A;  1HNW Q;  2NVX B;  4I7A A;  2DJF C;  4ZLT F;  2R3Z A;  5T1I A;  4A3F G;  4FXK C;  4R4Q A;  5FJ8 H;  4CDD C;  1STE A;  4K5W A;  1ILQ A;  4ABN A;  2F4V Q;  1G91 A;  2KHS A;  1E0B A;  2CH4 A;  4KLK A;  5IP9 G;  1B9N A;  1RTN A;  4X64 Q;  2FFK B;  1A3U A;  3TN2 A;  4KJN A;  3HOY H;  3H0G G;  2K04 A;  1HNX Q;  4DV7 Q;  3MTS A;  1NUC A;  2CKZ B;  3SHL A;  2AQ1 B;  2D9U A;  3N6R A;  3LGJ A;  1Y8N B;  2PCF B;  3FVQ A;  3KDF A;  5JEA G;  4DV4 Q;  5GAE C;  1NTG A;  5FO8 B;  3OPO A;  3KDF B;  3J7Y W;  4EQ5 A;  1GJX A;  1L1O A;  4PQX A;  5C4Z A;  4K2K A;  4TRD A;  5EQ0 A;  4DR4 Q;  1L1O B;  1WTH A;  2WAQ G;  4XYQ A;  2K5N A;  4O1N A;  3OYY A;  4A3D H;  4A3L G;  4A3E G;  1EIF A;  1VQK A;  1EZ6 A;  2I5L X;  2EY1 A;  3HOX H;  4L8J A;  3S14 H;  1CI3 M;  3QOL A;  2FMM A;  3P75 A;  4KK7 A;  3GTO H;  1BCP C;  3L3O C;  1LAC A;  1IL2 A;  3M7N A;  1LTA D;  3I91 A;  1KDB A;  1E24 A;  4OEL B;  1X9N A;  1E7Z A;  4JG2 A;  4DV0 Q;  1VMC A;  1IYJ B;  2EXD A;  3H3V C;  5LHY 1;  4RKB A;  3FPP A;  4A3F H;  3A56 A;  1BBU A;  4LUO A;  2SEB D;  4IOC A;  1YHQ A;  1V1Q A;  3T16 A;  1IYV A;  4PZ8 A;  1SSO A;  4CKB A;  4G7H C;  1CZW A;  2UUC L;  3H3V I;  5CBE E;  3SR1 A;  4HJA A;  1XMQ Q;  2UXD L;  1BO0 A;  4RGM A;  1EY8 A;  2A6H D;  1IZ6 A;  2R7Z B;  3IL8 A;  4QJF A;  3IRB A;  1EY4 A;  2IW3 A;  3IAY A;  2CH4 W;  1VQI A;  4FYD A;  1VQE A;  5EPL A;  4UP8 A;  3E6Z X;  3RNU A;  1PFS A;  1KDC A;  4DR5 L;  4DNR B;  5LMN Q;  3CC4 A;  3RLO A;  3MZ5 A;  4DF7 A;  1O7L A;  2IL8 A;  2H1E A;  4ZCK A;  3UDF A;  1CQV A;  5F2D A;  1STG A;  1IBM L;  3X3M A;  5JPN C;  2HD3 A;  3GTM H;  5JJL A;  3EQL C;  4JI1 L;  3TP7 A;  1K83 H;  1VQN A;  1SYF A;  1PH2 A;  4IPH A;  1LTR D;  4JI2 L;  2SNM A;  1HNW L;  5BN4 A;  1Y69 U;  3CXC A;  3BZD B;  3GD7 A;  3I4L A;  4GOP C;  5CV6 A;  2F0W A;  1AEX A;  1SNP A;  2TMP A;  2PO4 A;  3VR4 A;  1JB7 A;  4V0B A;  2VQF Q;  1H9R A;  1B9M A;  2F4V L;  1JOR A;  2RHS B;  5FO9 B;  3CC7 A;  4X64 L;  1SNM A;  1KRS A;  2RQX A;  5AJ3 Q;  3H3V H;  4FVM A;  5C4H A;  2F3I A;  1TWG B;  2VY3 A;  4OO1 I;  4X62 Q;  2PQA A;  4DV7 L;  1QNU A;  1L0W A;  4DGZ A;  2JYO A;  2PQA B;  4XIG S;  4DAM A;  3M4P A;  1ENA A;  2X6L A;  2RVL A;  4C2M H;  1Q8K A;  4L5S A;  3Q8D A;  2K5W A;  4DV4 L;  5IGG A;  4E6I A;  4LFB Q;  4OO1 G;  1M90 C;  3OSO A;  3AQQ A;  3OMG A;  3EVQ A;  4X3U A;  2JA5 B;  1A3T A;  4IUQ A;  1H9K A;  2KVM A;  2L12 A;  2RDF A;  3RUZ A;  3I4N B;  2K01 A;  4DV2 Q;  3R2I A;  3EIV A;  4B3R L;  4DA2 A;  3MVV A;  3T1Y Q;  1TS2 A;  1C9O A;  4FF2 A;  3D4W A;  2NTS A;  4EQP A;  1HHV A;  1J8I A;  1NNX A;  3J7Z C;  5CGK A;  3CU7 A;  1SNQ A;  5JEA J;  1HUN A;  2M9V A;  1JIC A;  3CRL C;  4BY7 H;  4GKJ Q;  4DV0 L;  2JQO A;  3I73 A;  1B50 A;  3PMF A;  5M5X B;  2VUM B;  1UAP A;  3K5L A;  1AW7 A;  4G4K A;  2QIL A;  3J81 c;  4MZ9 A;  1YEZ A;  3NSW A;  1PZI D;  2KBN A;  3NE5 B;  4I65 A;  2ZXP A;  1Q81 C;  2EYM A;  1P8L A;  4LUZ A;  2PZW A;  1CFM A;  1XMQ L;  2CWP A;  1OO9 B;  4KTA A;  2EDG A;  4R8I A;  4DV6 Q;  3EFX D;  4Q5V A;  4LW1 A;  1GO3 E;  1KAA A;  5IYC G;  5G3L D;  1HPC A;  1PFM A;  4HR7 B;  3TP6 A;  2JA5 G;  3K6O A;  1MSG A;  1V1O A;  2D0O A;  3I4N G;  4OO1 H;  1YIT A;  3M3Y H;  5C0X I;  3D6C A;  5K36 H;  1BBW A;  3GV6 A;  1DXM A;  4PMC A;  4CBV A;  3I90 A;  1Q90 A;  4JK1 C;  3UI2 A;  5LMN L;  4LF6 Q;  3PIP 3;  1PH3 A;  4DV3 Q;  3MEH A;  3M9B A;  1UUP A;  1SRU A;  2AUK A;  4C3I B;  3ULJ A;  1KRT A;  1BDO A;  4LF5 Q;  3SVM A;  1QVC A;  5C0X G;  1PH1 A;  4RFB A;  3G71 A;  1YI2 A;  3RZO B;  1LTL A;  4YCV A;  2B63 B;  2K03 A;  2ZTD A;  4EQO A;  4J8Q A;  3UDI A;  1FNV A;  1JWU D;  5CV7 A;  2VUM G;  1F77 A;  3MWY W;  1UE6 A;  3X3N A;  3BU2 A;  1EIG A;  4B9W A;  1LT4 D;  3TEH B;  3QB3 A;  5I2X A;  3I55 A;  5M3M H;  5GAG C;  2K05 A;  4A75 A;  1LO5 D;  5M3F H;  3BVM A;  1I3Q B;  1PTO D;  2LY7 A;  2P5Z X;  1HNZ Q;  4X3T A;  2Q8T A;  1L0Y B;  1Y8P B;  1CUK A;  2F4I A;  4V19 0;  2L55 A;  1HTP A;  3STB D;  2EZV A;  4LF8 Q;  1T9H A;  3K5M A;  3DWP A;  2WFW A;  1SAP A;  1A8V A;  2I5M X;  3OWF A;  1IKL A;  5ELB A;  4LF4 Q;  1YHB A;  2CHB D;  4A3C H;  2K5Q A;  2R92 B;  1Q7Y C;  1SYE A;  1L0X B;  1SRO A;  3R8B A;  3HEJ A;  3FDT A;  3PUY A;  4A3G B;  1EY7 A;  5AJ3 L;  3DEP A;  2MFI A;  3D8G A;  1WTW A;  2VB2 X;  4PZ6 A;  5IYC H;  1Q12 A;  4X62 L;  3F2U A;  1UEA B;  2NUC A;  5IIF A;  2A69 D;  1PZJ D;  1S40 A;  5ELO A;  1PDQ A;  4C3I G;  2EXZ A;  3KYH C;  1YJN A;  4LFB L;  2XN9 C;  2JE6 I;  2NBF A;  1YVC A;  4ZYS A;  3GTK H;  2B63 G;  3URY A;  2B2W C;  1G6P A;  4LUV A;  1HUM A;  3J81 j;  4JVZ A;  2ZJQ A;  4JBK A;  1MSH A;  3D31 A;  4OL7 A;  3RD4 A;  2WAQ E;  3PO2 B;  3K58 A;  3E9I A;  4IUP A;  4U67 3;  4DAV A;  2NVQ B;  1JOK A;  5I9P A;  2WIN B;  4K6D A;  1PTO B;  1XPO A;  4M1U B;  2V4D A;  3JAM c;  4LMQ D;  3VA5 A;  1D8L A;  3H94 A;  3BVZ A;  3BVG A;  3NXW A;  5I9O A;  2WAC A;  3HKS A;  4DFA A;  5EKL A;  2R92 G;  4NXN Q;  1LV9 A;  1Q46 A;  4H0L C;  4J15 A;  2E74 C;  4EGV A;  4A3G G;  1LYL A;  1QG7 A;  1RDP D;  1VQA A;  2JA7 G;  3ERO A;  3NWT A;  4JC0 A;  3HOV G;  2I0Q A;  5FLM H;  1D6E C;  2KCC A;  3NBH A;  1N32 Q;  1IKM A;  1WOC A;  5EBD A;  3PIO 3;  4GLX A;  3GTQ H;  4OIJ A;  1TWH H;  4K14 A;  2L0C A;  1G29 1;  3L9A X;  2FXQ A;  2VQE Q;  3NBH B;  2QA4 A;  2B2T A;  4DV6 L;  4NPS A;  3W1G A;  5COR A;  1B8A A;  3TP8 A;  2L9H A;  1N8R C;  1NCV A;  3DM1 A;  2F0I A;  2JA6 B;  2PZU A;  1IW7 D;  5D3I B;  3VYU A;  4C3H H;  3PO2 G;  3CQZ B;  3SE0 A;  2B63 H;  4OWX B;  5FLX L;  1ET9 A;  1KAW A;  1D5M C;  4QGU A;  4DR7 L;  2OTL A;  2ID0 A;  4EX5 A;  1JWS D;  4LF6 L;  4DV3 L;  1HR0 L;  1NSN S;  3CC2 A;  1SFO H;  3UDX A;  2XWJ B;  2JA8 H;  2Y0S B;  3I4O A;  3K80 C;  1I3Q H;  4B3M Q;  2B2U A;  1LTI D;  1HZB A;  3Q24 A;  2N55 A;  5G3L F;  4XDX A;  4LF9 Q;  2F0P A;  4GS3 A;  2OTJ A;  2KCM A;  1ASY A;  1R4P B;  3AEV A;  5HGT A;  1H9S B;  1K9M C;  1SNO A;  1U4M A;  1W6K A;  3HKZ B;  1E22 A;  1II3 A;  1NBW A;  1K3B C;  1F2L A;  5CYU A;  1HNZ L;  2C35 B;  2JA7 H;  1PFN A;  4DNT B;  3HOV H;  2O4X A;  4HSV A;  4AYB B;  3T4A C;  4N9T A;  1LT6 D;  4WJ3 M;  5C0X J;  4IUN A;  1FGB D;  1S5E D;  4MTK A;  3HG9 A;  1QOH A;  4LF8 L;  3CCL A;  4LF4 L;  3KF6 B;  1M1K C;  4GNX C;  2D2C C;  2JA6 G;  2HDL A;  1F9S A;  1YNX A;  5GAH C;  5IGB A;  2Q8R E;  1ENF A;  3MXG A;  2F0M A;  1I6V C;  1NR4 A;  1VQC A;  4TVA B;  1WYD A;  1X55 A;  1A62 A;  1SMY D;  1PTO F;  4LK1 C;  3PIP A;  1RHP A;  5JJI A;  1GHJ A;  3K7A B;  3IKJ A;  4DR2 Q;  1JQY D;  1FNU A;  2NVQ H;  2Y0S G;  3BZC A;  2R61 A;  4L5Q A;  1IXR A;  2F0S A;  4F87 A;  3TQY A;  3S15 B;  1TXY A;  3CCJ A;  4IUU A;  2BE5 C;  1SBB B;  1YHA A;  5E7N A;  3KBG A;  1JC7 A;  5D3D A;  1I94 L;  5IP7 H;  4LJZ C;  1BR9 A;  3EBE A;  4KY7 A;  4R4I A;  2J7Z A;  2E2J H;  1PH7 A;  1SR3 A;  2NZO A;  2AWN A;  1WCM H;  1E2W A;  2BH8 A;  4QF4 A;  3HKZ G;  2K5H A;  5DM6 3;  1B3Q A;  3OIP A;  4K2L A;  4APV A;  3CAM A;  1SND A;  3AMU A;  2UXD Q;  2L4N A;  4DUZ Q;  2XSC A;  1TWC H;  5J1Z A;  4AYB G;  3K8A A;  3NBI A;  2IWH A;  1PMR A;  5C4J H;  1KLG D;  1SDF A;  4CJ1 B;  1Q86 C;  2QW7 A;  1DJR D;  1HH2 P;  4NXN L;  1TII D;  3VR3 A;  2DNC A;  5BN3 A;  4POF A;  4RGO S;  1VQH A;  1F2Z A;  1F2Y A;  3D0F A;  4DR5 Q;  4NP5 A;  5M5Y B;  1FYC A;  3P20 A;  2K14 A;  4R1J A;  1OTC A;  4HED A;  3ICE A;  4KN7 C;  3HOZ H;  1X3Q A;  1VQM A;  2L15 A;  1MHW C;  1N32 L;  3PO3 H;  1GUT A;  4JI6 Q;  1MKH A;  4KMU C;  1LT5 D;  5EAY A;  4AQY Q;  1ROD A;  3GTJ H;  1Y1V H;  1IBM Q;  1RTO A;  5KYL A;  2ZJP A;  1B2T A;  4BBS H;  2UXC Q;  4OXP A;  1HQM C;  1QNK A;  4BXX H;  4BS9 A;  1CKN A;  4OWT B;  3J80 L;  1WTO A;  5IYD G;  3GTL B;  4UHV A;  1CKN B;  5L37 A;  1A2U A;  2NN6 I;  2N49 A;  2A6E C;  1TVX A;  5E4W C;  1N33 Q;  3HOU H;  1SE2 A;  3HS0 C;  2EYO A;  3VR2 A;  1YJW A;  5FO7 B;  4B9X A;  3W5O A;  3GTP B;  2NN6 G;  4B3M L;  5T1G A;  1X3P A;  1PH6 A;  1ICF B;  3TDQ A;  2F03 A;  3F8T A;  4FF4 A;  1K0S A;  3A54 A;  1VQ6 A;  1Y1W B;  4A3B H;  4C3J H;  1EWH A;  4LF9 L;  5IT9 L;  4XQQ A;  1M8A A;  4KV6 A;  4QIW B;  4RWS C;  4L63 B;  3PSI A;  3ERS X;  3KBX A;  3G48 A;  2N88 A;  4K0K Q;  1AZQ A;  1J5E Q;  1KAB A;  2JJQ A;  2G9H D;  1JJC B;  4GLV B;  5EPJ A;  2FJ2 A;  2SNS A;  4JI8 L;  3PIO A;  1Y14 B;  2Z6B A;  3WWV A;  1YJ9 A;  2RDH A;  1HR0 W;  2BCO A;  3ER0 A;  3EJI A;  4KJO A;  4RH6 A;  1Q1E A;  1XMO L;  3S1Q B;  3NEL A;  1EQV A;  3AU7 A;  4A93 B;  2WKC A;  1WTV A;  4FXD A;  4B3R Q;  4DNI A;  3VA7 A;  4YIJ A;  2ZM6 L;  1VQ9 A;  3I7F A;  3R2T A;  2Z6K A;  1I4P A;  2LKV A;  2K1B A;  3S2D H;  1WFQ A;  2KEE A;  3S1R B;  1CM9 A;  4DR2 L;  4DAP A;  1EEF D;  3HRZ C;  5C44 H;  2K28 A;  4IUT A;  1STN A;  5FKA C;  1PH4 A;  4GLA C;  3JC6 6;  4HSP A;  2AMC B;  3KLW A;  1WD1 A;  4JW0 A;  1IBL Q;  1B7Y B;  1AN8 A;  2F0L A;  3HOW B;  3QWN A;  3MXU A;  1L1O C;  1HQR D;  3ULL A;  2UU9 L;  1X3F A;  2OXP A;  3A5Z B;  5IP9 H;  3T1H L;  2XIW A;  5JVG 3;  1YNN C;  4FF1 A;  4XQJ A;  1DOM A;  1EOV A;  3H0G H;  4HJ9 A;  1HFN A;  2VL6 A;  4DUZ L;  3OIQ A;  4KI0 A;  3BJU A;  2BDN A;  4L6T B;  1CTM A;  2EYL A;  4PMW A;  4CDF C;  3P7J A;  1K8O A;  5JEA H;  3KF8 A;  3S1N B;  4A93 G;  2HT1 A;  2L1B A;  5M5W B;  3U9O A;  4Y7N H;  2YU9 H;  3M7G A;  4A3M B;  3KF8 B;  2HCC A;  1Q3L A;  1TWF H;  4EVO A;  3DLL A;  1B44 D;  4MTN A;  4ALP A;  2OF1 A;  4K5V A;  2EYF A;  5LL6 X;  4A3L H;  4A3E H;  3GTL H;  4JI6 L;  3QJY A;  1PYB A;  5ELE A;  4AQY L;  1CHP D;  2NVX H;  3TME A;  1QIL A;  2LXJ A;  4HTH A;  1Q82 C;  2N78 A;  2UXC L;  3HOW G;  1E1O A;  2VZA A;  2NVY B;  1WVL A;  2ES2 A;  1VS0 A;  5DAU A;  2Z0S A;  3M4O B;  1SMX A;  1HA6 A;  3DM3 A;  4HCS A;  1E2Z A;  1N33 L;  5EPK A;  1KQS A;  2YTY A;  3PQI A;  3J7A V;  2R7Z G;  3MAQ A;  3E0E A;  5KEE A;  4CJ2 C;  3A8J E;  3M4Q A;  5J22 A;  3W3A A;  2I07 B;  2ZXO A;  3MXP A;  1PXU A;  2E2I B;  1STH A;  4A3M G;  2F0N A;  3SK6 A;  1PRT D;  1B53 A;  3FHW A;  2NVT B;  5JPM C;  1K0R A;  3S1Q H;  2KCT A;  4K0K L;  3DHQ A;  1JE5 A;  3R93 A;  1J5E L;  2DNE A;  4A4I A;  3U9S A;  4NXM Q;  2UXB Q;  1VQP A;  5KIX A;  1HRJ A;  3TBI B;  1JMC A;  4OHJ A;  3CPF A;  1QB5 D;  4C1N I;  3S16 B;  1TWA B;  3DXJ C;  1NR2 A;  3CD6 A;  4OON A;  2A6H C;  1T5X D;  1STB A;  3K7U C;  4KY6 A;  2MPM A;  1CKO A;  1SE8 A;  3GV3 A;  2K4K A;  3T51 B;  3MFG A;  2LS0 1;  2R93 B;  1GUS A;  4G7Z C;  4NW2 A;  1WTX A;  1QCB D;  2KCN A;  2Z4H A;  3ERQ A;  2WII B;  1JR0 D;  1LT3 D;  2BOS A;  2FMC A;  3NTH A;  1LTS D;  3HOW H;  4DPG A;  1EEI D;  4DN4 M;  4RA8 A;  4YWM A;  3VR6 A;  2PW7 A;  3FKI B;  1GXD C;  5GRO A;  1HCZ A;  1SN8 A;  3LWU A;  3CW2 C;  2Y0S E;  2HQE A;  4GKK Q;  5JJK A;  1B3A A;  1EIH A;  1A15 A;  2H5X A;  5DM7 3;  1IBL L;  2ICI A;  1X32 A;  3E5S A;  5HGQ A;  2Z1C A;  4ZAI A;  2R7Z H;  3S1M B;  3NEN A;  1PRT B;  3K5N A;  2F52 A;  4C56 C;  1STY A;  1EZ8 A;  3KLR A;  4IOA A;  2PZT A;  1K3R A;  1UE1 A;  4A3M H;  1O80 A;  4P74 A;  3HKZ E;  1N36 Q;  4KD3 A;  2ZT9 C;  3G6E A;  4ZKB B;  1SYG A;  3OHX C;  3RN2 A;  4TKO B;  2GVB A;  1V9P A;  1D5Z C;  2K33 A;  3F2B A;  4AYB E;  3RLN A;  4J1M A;  1BUV T;  5KNC A;  2DY8 A;  1ET6 A;  1B70 B;  2DJG C;  4X3S A;  2L5T A;  1BBX C;  4U68 A;  4A3I B;  1K8G A;  3HZX A;  3J80 i;  1NY4 A;  4IN3 A;  2R93 G;  2KEN A;  1GVP A;  2LSS A;  2CCZ A;  1YIJ A;  2E2H B;  1PRT C;  4BY1 B;  4DR7 Q;  1HR0 Q;  2EY2 A;  2E5L Q;  4HID A;  1M4V A;  1G51 A;  4K8I A;  4WJ4 A;  2K5D A;  3FKI G;  2F0K A;  1FJG Q;  2CFM A;  3TP5 A;  3QO2 A;  3I72 A;  4DR6 L;  2AKW B;  2ALY B;  1VQ4 A;  3A55 A;  1VQO A;  2NZ1 D;  3GP7 A;  1ZYR D;  4QL5 A;  1I6H B;  1EOT A;  1EYA A;  1PH5 A;  4LF7 L;  1MBY A;  3PV0 A;  4OIK A;  4IJH A;  5I6Y A;  2N3S A;  1KTK A;  1XXG A;  5LMU Q;  3E9H A;  5M9O A;  3HGB A;  3BDC A;  5C5L A;  2E2I H;  4JI3 Q;  2XRQ D;  1JOO A;  2A19 A;  2K75 A;  5CV9 A;  1TWG H;  2XGT A;  1EY9 A;  4Y52 H;  2R6G A;  4BA1 I;  4KHZ A;  3FP9 A;  3GTJ B;  4HJ8 A;  1I4X A;  4RHS A;  5C6A A;  2WKD A;  3D4R A;  4BBR B;  5FLX E;  1EY5 A;  4JOI A;  2OCE A;  4YCU A;  2QF7 A;  2K32 A;  4A3I G;  1PVO A;  2RSN A;  4LFA Q;  2JK8 A;  1LTT D;  2PYK A;  4DUY Q;  4F88 A;  5E1F A;  1EWC A;  3L7Z C;  1UEB A;  5C3W A;  2B8F A;  2OT2 A;  2JA5 H;  4BY1 G;  3I4N H;  2CW0 D;  5C3X A;  3I56 A;  2HQL A;  4NXM L;  1YZ6 A;  2UXB L;  1CKM A;  1XPR A;  1ZEQ X;  4KKT A;  3HP3 A;  4A3J B;  3MEF A;  2A1A A;  1VQ5 A;  2F0U A;  1I94 Q;  3KLS A;  5C0X H;  5I4D A;  1XPU A;  1MJE A;  4QCL A;  4XTC S;  1VQ7 A;  1PRT F;  2F0T A;  1MD2 D;  2C9O A;  2KQ3 A;  1YBY A;  2A73 B;  1V1P A;  1EY6 A;  2RHQ B;  3NTK A;  3CCS A;  3T56 B;  2RCF A;  4IFD G;  1C0A A;  1PYW D;  5EKI A;  5M5X H;  2VUM H;  3GTG B;  1VQD A;  1CA6 A;  3J7A 5;  1V1P B;  1SJH D;  1DOK A;  1U9R A;  1RD9 D;  4BWG B;  2NZH A;  1XYI A;  4UP9 A;  4NKL A;  4DK6 C;  4FF3 A;  5E3F A;  1J9O A;  5JVH 3;  3OMC A;  4ILW A;  4JI0 Q;  4BBR G;  4GKK L;  4UDU C;  2AWO A;  1ESF A;  1I4Q A;  2DUD A;  3CP0 A;  5CR3 A;  2F0F A;  3QR8 A;  2KOL A;  1I50 B;  1YNJ D;  1HJP A;  1E2V A;  3I4M B;  3OOC A;  5CC4 A;  1AFP A;  1RCV D;  4QIW E;  1V8Q A;  1CQF A;  3ZYY X;  4DK3 C;  1XJV A;  4A76 A;  1WJJ A;  3S2H B;  4J6H A;  3CHB D;  1EQR A;  2QCP X;  1G6Z A;  2KUM A;  1N36 L;  1PTO C;  4KY5 A;  1A0I A;  1EYG A;  2PW5 A;  2WV6 D;  3K59 A;  4HJ5 A;  2JEA I;  3U50 C;  4A3J G;  4DV1 Q;  4C3I H;  5ELC A;  3STB C;  3KUP A;  1HFG A;  1A2T A;  5IGF A;  2EE1 A;  3PGZ A;  4XYO A;  4HMI A;  3RZO H;  1Z9F A;  5DEH A;  2ZTE A;  4QMG A;  2KJX A;  2JXM B;  3A7A B;  5KRU A;  1PH8 A;  4OWW B;  1A6X A;  1K8A C;  1K28 A;  5C4X B;  3C3L A;  4RG1 A;  5D65 A;  3OW2 A;  2E5L L;  2A69 C;  1EYC A;  1ZXT A;  3FPU B;  1SE3 A;  3BG3 A;  2EY5 A;  2N8N A;  3H6M A;  2EQS A;  1FJG L;  4DKA C;  4N8X 1;  4QB4 A;  2K52 A;  3CCQ A;  2IJ0 A;  3M4Y A;  1JOQ A;  3F1Z A;  2MO0 A;  3V05 A;  2G9D A;  2B2T C;  3J7A F;  3RZD B;  1OXU A;  3PCO B;  4JI5 Q;  1PA6 A;  2R92 H;  5LMU L;  5C3E B;  2PMZ B;  2NB0 A;  4JI3 L;  4JI8 Q;  4A3G H;  3RN5 A;  4DK0 A;  5KYI A;  3J80 E;  1E1T A;  2QDL A;  2O5I C;  2B2Y A;  1GM5 A;  2G5D A;  3FMC A;  2XTI A;  4MNO A;  2K50 A;  4ID6 A;  5H1S E;  1XMO Q;  2R7D A;  2L11 A;  2C5C A;  5E4X A;  1Y8O B;  4TSS A;  3C46 A;  5CV8 A;  1W2B A;  3LWE A;  2EY6 A;  4WJW A;  1S72 A;  4LFA L;  1VF5 C;  2B2U C;  4DUY L;  1XNQ L;  1ILP A;  2ZM6 Q;  2B2V A;  4XXE A;  3AB9 A;  1CA5 A;  1L2F A;  1RIP A;  5C4X G;  1RKN A;  4WRD A;  2Q8I B;  2Z4I A;  5HUR A;  2K7V A;  3HOY B;  4DR3 Q;  3H91 A;  3IFD A;  2HHH Q;  3PO2 H;  2M2L A;  1A3V A;  4UAI A;  5ELN A;  3S24 A;  5IT9 E;  1VQ8 A;  1VQJ A;  2A5H A;  4ZQ3 A;  2A68 D;  5IOD A;  1HZ9 A;  2UUB L;  3VYT A;  3KJP A;  1VMP A;  1PTO H;  1IL8 A;  1CHQ D;  2AUJ D;  1RL2 A;  1B4O A;  1PFB A;  2F0V A;  4HN7 A;  3F2C A;  1TY2 A;  3NP8 A;  1SEB D;  2IHF A;  1DGS A;  2UU9 Q;  2E2D C;  5A2Q L;  2NYZ D;  1IW7 C;  1EU3 A;  3T1H Q;  5C3E G;  4A3D B;  4P71 A;  3RLF A;  4DR1 Q;  4RGT A;  5I6W A;  1ASZ A;  2B8G A;  3HOX B;  4OX9 L;  3S14 B;  3G7L A;  4XT3 B;  3GTO B;  1NJI C;  2EJF C;  4IPD A;  4KKS A;  1TS3 A;  4JI0 L;  3SGI A;  1X3E A;  4WFN 3;  1Z7T A;  4NDX A;  5CMD A;  2VB3 X;  1TR5 A;  3BYY B;  1JT8 A;  2HIV A;  4IFD J;  5IOC A;  1HA5 A;  1ZKO A;  1S4Z A;  5I2Y A;  4A3F B;  4K8J A;  2JA6 H;  1S5D D;  2NWG A;  1CT1 D;  3CCV A;  2B3G A;  4JI4 Q;  2SDF A;  3CQZ H;  1AP0 A;  1EL0 A;  1D2B A;  2RF4 A;  4RAU C;  2MGS A;  3P1H A;  1EFW A;  3PF4 A;  3QOJ A;  4GZY C;  1UWV A;  5IGC A;  4DV1 L;  2I46 A;  1XX8 A;  1BCP D;  2D62 A;  2GA4 B;  1GUO A;  1TU2 B;  1JJ2 A;  1KNE A;  5J39 A;  3J81 E;  1I4G A;  2BA0 A;  2D5D A;  3OWE B;  2ZTC A;  5ELF A;  1QE6 A;  4A3D G;  1Z6H A;  3TRZ A;  4MIU A;  1JE4 A;  5FLX c;  1SMY C;  4K6L A;  3Q23 A;  2VS1 A;  2XRS D;  3AFP A;  3QG1 A;  5KGU A;  4L5R C;  4X66 L;  1MJC A;  1GUN A;  3BYT B;  1EWI A;  1KNA A;  2O5J C;  4LWC A;  1GKH A;  2DGY A;  2YTX A;  3T53 B;  2QEX A;  2PI2 A;  2Q2T A;  2X69 A;  3GTM B;  1NE3 A;  4JCV E;  2EPB A;  3ND8 A;  4JI5 L;  4RMF A;  1SJE D;  1ONL A;  1K83 B;  2E8G A;  2BH2 A;  1O7I A;  4QQB X;  3KJO A;  1NMG A;  4JBM A;  4ME3 A;  1G2S A;  1X54 A;  4HIM A;  4UY8 C;  1BF4 A;  4X65 Q;  4JV5 Q;  4JPB W;  2VNU D;  1KLU D;  3LX0 A;  3K7A H;  1PYS B;  3GO5 A;  1U4R A;  1Q8I A;  1BCP B;  2OEO A;  3NK9 A;  4O42 A;  1SXT A;  4X3K A;  2TSS A;  4EQN A;  3S15 H;  2LXK A;  3OW7 A;  4H13 C;  5FK9 C;  4POG A;  2DN8 A;  1J6Q A;  5IYD H;  4KN4 C;  1WTP A;  4DR3 L;  4GN3 B;  2HHH L;  1TS4 A;  4NMZ A;  2SOB A;  1D5X C;  3CCM A;  1HXY D;  4UP7 A;  1ML0 D;  2KHI A;  1F9R A;  4ZRZ A;  5TSS A;  5FOB B;  4R4C A;  3S17 B;  4C2M B;  1X56 A;  5KNB A;  1FGU A;  5JOB A;  4HAE A;  3WOF A;  1Y1W G;  5ELD A;  1F9Q A;  4P2C B;  2NN6 H;  3A74 A;  3RMH A;  2K6A A;  5J3B A;  3SK8 A;  5JJZ A;  1QUQ A;  1KC8 C;  3U58 A;  1RJT A;  1VDZ A;  4CDC C;  1O78 A;  1QUQ B;  3J81 L;  2IX3 A;  2VW9 A;  4DR1 L;  1O7Y A;  2Z6K C;  5K5P A;  5M5Y H;  2J4X A;  1ICW A;  2Q2U A;  1QZG A;  2IX1 A;  1AH9 A;  3TS0 A;  3CPW A;  1KHI A;  4CJ0 B;  1PV4 A;  3KOJ A;  1WTQ A;  2PQE A;  3C1E A;  4PG3 A;  4BY7 B;  3H15 A;  2X6G A;  4G7O C;  2JP1 A;  3MHB A;  4P75 A;  4C1N K;  2K5V A;  4WOR A;  3DWQ A;  4B08 A;  4B3T L;  1BOS A;  3TZD A;  4JI4 L;  3JAM E;  4DR6 Q;  1HTL D;  3K81 C;  4GOP A;  1QVG A;  1V43 A;  2KED A;  4FDB A;  4YWK A;  3I3C A;  1JWM D;  4GOP B;  3GTP H;  4LF7 Q;  5DNF A;  1X65 A;  3RR5 A;  3J80 c;  1Y1W H;  5C5M A;  3SK5 A;  4JYA Q;  3M3Y B;  1VF7 A;  4OEM B;  1C4Q A;  4LFC Q;  2B39 A;  3K0X A;  1PH9 A;  1DM0 B;  1H9J A;  3ULP A;  1EIY B;  3UDG A;  5A35 A;  3BDO A;  3Q6S A;  3A8K E;  1BCP F;  1JCK B;  4IPG A;  4BY7 G;  4GN4 B;  1WTR A;  4Q0F A;  2CQO A;  2AHO B;  3GQB A;  2EJM A;  5IGE A;  4DXF A;  1X6O A;  2NTT A;  4A93 H;  5IT9 c;  3CCE A;  4KHV A;  4JI7 Q;  5M3M B;  5M3F B;  1UNS A;  1DZ1 A;  4X65 L;  4JV5 L;  2B29 A;  3L2P A;  4IZ8 A;  3S1R H;  1R9T B;  2UUA Q;  2YV5 A;  4Z9C B;  4FXG C;  4XT1 B;  1HNX L;  2J0T D;  3E3X A;  2YYZ A;  3M85 A;  1I4H A;  3W2D A;  3ND9 A;  3S17 H;  4RCN A;  4NB3 A;  4YHH Q;  4KD4 A;  3SDZ A;  2EYP A;  2ZJR A;  3K5O A;  2XWB B;  4O0A A;  4X6A H;  1FVI A;  5K36 G;  2WB1 B;  1U4P A;  1X3G A;  4DR4 L;  1VQL A;  4H02 A;  1C48 A;  2Z8L A;  4IAL A;  3OTO Q;  4DK1 A;  1S5C D;  4AIM A;  4IQZ A;  4A3K B;  1MI2 A;  2ICE C;  1SYC A;  3JAM L;  3GTK B;  1FNW A;  3LNN A;  1VQB A;  4F7X A;  5IYB G;  3S1N H;  1XWE A;  1STA A;  3K0Y A;  5M5W H;  4H7B A;  2AQ3 B;  4PNY A;  2IHE A;  4M8A A;  2PMZ E;  5M3M G;  1LTB D;  4CKE A;  2RBM A;  5M3F G;  5IWA Q;  3MA2 B;  1UE7 A;  2I5H A;  2F0O A;  4DAY A;  5D14 A;  3SXH A;  3FEW X;  3I2Z A;  1AE3 A;  5COY A;  4DAY B;  3NWS A;  1D1K A;  4CKC A;  2F0J A;  2AQ2 B;  1I5F A;  2IPK D;  1IBK Q;  4CDE C;  4ULL A;  4A3C G;  2RDG A;  1EYD A;  1PZK D;  4ZUJ A;  3DEO A;  1W3S A;  2NVY H;  2BA1 A;  2WB1 G;  2JN4 A;  3VYS A;  2O2L D;  5EJW A;  3V96 A;  4H44 C;  3M4O H;  1HZA A;  2HDM A;  4KHP Q;  2MP1 A;  3GTQ B;  3C2P A;  1TY0 A;  1TWH B;  4R8N A;  1KXL A;  4OX9 Q;  1K73 C;  4A3K G;  2JA9 A;  4IPC A;  1C7Y A;  2F3W A;  1R4Q B;  4JBW A;  1EQT A;  4TQU S;  3UE1 A;  3IFT A;  1BNZ A;  5DLQ E;  3WDN A;  3A7L A;  2MO1 A;  4JYA L;  3DWA A;  2BDO A;  2MJ8 A;  1JB3 A;  4LFC L;  2NVT H;  4R4O A;  5HY6 A;  4C3H B;  3AYH B;  3CRK C;  4DU9 A;  1LUZ A;  3PUZ A;  2M00 A;  4YY3 Q;  5IYB H;  5EKK A;  3G6J B;  1S3O A;  2WP8 J;  1TKW B;  4CGY B;  3DMU A;  2D0P A;  1S5B D;  2VXW A;  3ONA B;  1SFO B;  4I7Z C;  5AFW A;  2JA8 B;  1XNQ Q;  1TWA H;  3S16 H;  4ZUI A;  3D4D A;  1R9T H;  4OGQ C;  4IUR A;  5EGT A;  2B2W A;  4G57 A;  4GN5 A;  4PZ7 A;  2MNA A;  4AH6 A;  1VCI A;  2R93 H;  3CMA A;  1K8M A;  2F0G A;  4K5X A;  4JI7 L;  1XNR Q;  4UPA A;  3I70 A;  2MUY A;  5FLM G;  2VQF L;  3V2T A;  4IFD I;  1HZC A;  3T13 A;  2UUB Q;  3PF5 A;  3CCR A;  2XVS A;  4F8M A;  1OXV A;  2EIF A;  3UE0 A;  1CSP A;  4IO9 A;  2UUA L;  1DOL A;  2JA7 B;  1H95 A;  3HOV B;  1DD2 A;  3N52 A;  3FKI H;  2Q2H A;  5EBC A;  1GUG A;  1ESR A;  4B3S Q;  1H9M A;  4S3S A;  2EOT A;  4JOI C;  1BQQ T;  2PNR C;  2R7F A;  3A0J A;  4YHH L;  1LM0 A;  3MC0 B;  4A3K H;  1RF2 D;  3S1M H;  1FR3 A;  3NQT A;  5CV4 A;  4C3H G;  3J81 i;  2RA4 A;  1EQQ A;  4MHE A;  1UE5 A;  3HFZ B;  2XNA C;  2KEC A;  3VYR A;  3A5U A;  2MQH A;  2CQA A;  4DV2 L;  5BR8 Q;  2KA7 A;  3OTO L;  4FNF A;  3NTI A;  3T1Y L;  2F0D A;  1E3P A;  1EFI D;  5LL6 S;  2HCI A;  5BN5 A;  2JA8 G;  5KND A;  1N34 Q;  1LLR D;  1DON A;  2EJG C;  1ZYR C;  1QJO A;  3F2D A;  3VR5 A;  3C1F A;  5NUC A;  4A3I H;  1MGS A;  2IX0 A;  1IHZ A;  3TZU A;  2PI2 E;  3PUW A;  4BA2 I;  2E2J B;  4GKJ L;  4QY7 A;  2F0Q A;  1KDA A;  1WCM B;  2E2H H;  3KFU A;  3SEB A;  3PUV A;  4L5T A;  4BY1 H;  5IWA L;  3KK7 A;  2HUG A;  5A2Q E;  4HIO A;  1Q1B A;  4HMJ A;  2EVB A;  1TWC B;  3SK4 A;  5IE8 A;  2QEJ C;  2PNH A;  5C4J B;  1P16 A;  3NEM A;  1B1Z A;  3TS2 A;  3W1B A;  1IBK L;  1D7Q A;  4ZK9 B;  1CSQ A;  4IJL A;  1GHK A;  1I6H H;  2BE5 D;  1U0L A;  2HIX A;  3A8I E;  3AFQ A;  2CW0 C;  4IFD H;  4CHT B;  2OWO A;  1OXS C;  1FD7 D;  1O7Z A;  3EN2 A;  4JBJ A;  4DV5 Q;  2GVA A;  4X66 Q;  4KHP L;  3CME A;  3HOZ B;  3ZJY C;  3D6W A;  2IT1 A;  4R9W A;  3PO3 B;  4N9P A;  1GUW A;  4P72 A;  1XTC D;  3U4Z A;  1Y1V B; 
#chains in the Genus database with same CATH homology
 1LTL A;  2ES2 A;  4YCV A;  1VS0 A;  2ZTD A;  3I4M G;  3AFP A;  2Z0S A;  3UDI A;  1OXX K;  4L5R C;  4X66 L;  1MJC A;  1SMX A;  4BBR H;  2VUM G;  1EWI A;  3DM3 A;  4LWC A;  1UE6 A;  4P73 A;  1N33 L;  1GKH A;  2DGY A;  2YTX A;  3BU2 A;  5IP7 G;  4LF5 L;  1KQS A;  4NXN Q;  4GNX A;  2YTY A;  3TEH B;  2QGQ A;  2QEX A;  2PI2 A;  2Q2T A;  3I55 A;  5M3M H;  2R7Z G;  5GAG C;  4A75 A;  1NE3 A;  1WCM G;  4JCV E;  5M3F H;  4GNX B;  3VDY A;  3E0E A;  3M4Q A;  4JI5 L;  2KHJ A;  4YY3 L;  1HNZ Q;  4RMF A;  2A8V A;  2E8G A;  2BH2 A;  1BKB A;  4A3M G;  1O7I A;  2YTV A;  4QQB X;  3KJO A;  1NMG A;  3FHW A;  4JBM A;  1CUK A;  4ME3 A;  1K0R A;  1X54 A;  4HIM A;  3STB D;  4LF8 Q;  1T9H A;  3TRE A;  4UY8 C;  2WFW A;  3S1Q H;  1A8V A;  2I5M X;  4X65 Q;  4A3J H;  2KCT A;  4LF4 Q;  1YHB A;  1QVF A;  4JV5 Q;  4K0K L;  2VNU D;  1JE5 A;  1J5E L;  4A3C H;  4YCW A;  1MIU A;  4A4I A;  3K7A H;  1Q7Y C;  1PYS B;  4NXM Q;  5LMN W;  1SRO A;  1XTD A;  3GO5 A;  3PUY A;  2UXB Q;  1VQP A;  5AJ3 L;  2MFI A;  1JMC A;  2ATW A;  3CPF A;  4PZ6 A;  1Q12 A;  5IYC H;  4X62 L;  2IY5 B;  3KF6 A;  1XNR L;  3S15 H;  3CD6 A;  2LXK A;  4OON A;  3K7U C;  3GTG H;  1S40 A;  2RCN A;  4POG A;  1CKO A;  1SE8 A;  5ELO A;  2K4K A;  3HOZ G;  1N9W A;  1FL0 A;  3PO3 G;  1J6Q A;  5IYD H;  3KYH C;  1YJN A;  4LFB L;  4DR3 L;  2JE6 I;  4GN3 B;  2HHH L;  1YVC A;  1Y1V G;  3L0O A;  3GTK H;  1BVS A;  2B63 G;  3CCM A;  4UP7 A;  4B3S L;  2KHI A;  3JAM i;  3CCU A;  4BBS G;  1G6P A;  4LUV A;  3HOW H;  4R4C A;  3GDE A;  4DPG A;  3J81 j;  1QZH A;  2ZJQ A;  1X56 A;  4JBK A;  4BXX G;  1Y1W G;  1FGU A;  4YWM A;  3D31 A;  4YWL A;  2WAQ E;  1I50 H;  3E9I A;  4HIK A;  3I4M H;  5GRO A;  1U5K A;  3BZK A;  4LNQ A;  5IY0 A;  1SN8 A;  3A74 A;  3CW2 C;  2JEB I;  2Y0S E;  5J3B A;  2GN5 A;  4GKK Q;  1QUQ A;  1KC8 C;  5JJK A;  2V1C C;  5GAD C;  1XPO A;  1VQG A;  2H5X A;  5GQO A;  3U58 A;  3S2H H;  1IBL L;  2UUC Q;  3HOU G;  1A63 A;  5HGQ A;  1QUQ B;  5BR8 L;  2R7Z H;  3NEN A;  2F52 A;  2VW9 A;  3JAM c;  4DR1 L;  2Z6K C;  5FJ8 G;  5M5Y H;  1D8L A;  2Q2U A;  4IOA A;  1NMF A;  1N34 L;  3HKS A;  1EUJ A;  3MXN B;  2R92 G;  1K3R A;  1Q46 A;  1QZG A;  1UE1 A;  4J15 A;  4P74 A;  3CPW A;  3TS0 A;  4A3M H;  3HKZ E;  1KHI A;  4A3B G;  1AH9 A;  2CWA A;  3CF5 A;  1PV4 A;  1N36 Q;  3KOJ A;  4A3G G;  1LYL A;  1VQF A;  3G6E A;  3HOY G;  1VQA A;  2JA7 G;  4JC0 A;  4PG3 A;  2ASB A;  4B3T Q;  3RN2 A;  3H15 A;  3HOV G;  2I0Q A;  5FLM H;  2GVB A;  1V9P A;  4P75 A;  3F2B A;  4AYB E;  3RLN A;  1Z47 A;  1N32 Q;  2K5V A;  1WOC A;  5C4X H;  1B70 B;  4GLX A;  3GTQ H;  1TWH H;  1WI5 A;  1K8G A;  1G29 1;  3J80 i;  2FXQ A;  2VQE Q;  1NY4 A;  2Q2I A;  3NBH B;  2R93 G;  2KEN A;  3U4V A;  1GVP A;  2LSS A;  2QA4 A;  2CCZ A;  4B3T L;  4JI4 L;  4DV6 L;  4NPS A;  3W1G A;  1B8A A;  1YIJ A;  1KD1 C;  4DR6 Q;  1AE2 A;  4DR7 Q;  1HR0 Q;  1JJG A;  1N8R C;  2E5L Q;  3K81 C;  4GOP A;  4HID A;  1QVG A;  2VQE L;  1G51 A;  1V43 A;  4FDB A;  4YWK A;  4LF7 L;  3RZD H;  4C3H H;  3PO2 G;  4WJ4 A;  3FKI G;  2B63 H;  1FJG Q;  2CFM A;  3B6Y A;  4OWX B;  4GOP B;  4LF7 Q;  3GTP H;  3HOX G;  1KAW A;  4JI1 Q;  4DR6 L;  2AKW B;  4QGU A;  4DR7 L;  2ALY B;  1VQ4 A;  4DV5 L;  2ID0 A;  1X65 A;  4R4T A;  3RR5 A;  4EX5 A;  2WB1 E;  5C3E H;  3J80 c;  4DV3 L;  1VQO A;  1Y1W H;  1HR0 L;  1KL9 A;  1OXT A;  3CC2 A;  1SLJ A;  4JYA Q;  4LFC Q;  1PHJ A;  1SFO H;  4QL5 A;  3UDX A;  2JA8 H;  3I4O A;  5C44 G;  2OQ0 A;  3K80 C;  3G4S A;  4HJ7 A;  1PH5 A;  1KIX A;  3K0X A;  3PUX A;  3PV0 A;  1PH9 A;  1I3Q H;  1GD7 A;  2OQK A;  4IJH A;  4O2D A;  4JI2 Q;  2N3S A;  1HZB A;  4B3M Q;  1HNW Q;  3ULP A;  1EIY B;  5LMU Q;  3E9H A;  3UDG A;  2E2I H;  4LF9 Q;  4JI3 Q;  4GS3 A;  2A19 A;  2K75 A;  4A3F G;  2OTJ A;  2KCM A;  1TWG H;  4R4Q A;  2XGT A;  1ASY A;  5FJ8 H;  4IPG A;  3AEV A;  4Y52 H;  4BY7 G;  2R6G A;  4BA1 I;  4GN4 B;  4KHZ A;  3FP9 A;  4HJ8 A;  1K9M C;  2F4V Q;  1E22 A;  2CQO A;  4KLK A;  2AHO B;  5IP9 G;  1NBW A;  1X6O A;  4X64 Q;  1HNZ L;  5IT9 c;  4A93 H;  4JOI A;  3CCE A;  2OCE A;  4YCU A;  3HOY H;  2C35 B;  4A3I G;  2JA7 H;  3HOV H;  1PVO A;  3H0G G;  4LFA Q;  2JK8 A;  4JI7 Q;  1HNX Q;  4DV7 Q;  4DUY Q;  4WJ3 M;  2CKZ B;  5C0X J;  3L7Z C;  1UEB A;  4LF8 L;  3CCL A;  2JA5 H;  3LGJ A;  4X65 L;  4BY1 G;  4LF4 L;  4JV5 L;  2B29 A;  3KDF A;  4DV4 Q;  3L2P A;  3S1R H;  5JEA G;  3I4N H;  5GAE C;  3I56 A;  2HQL A;  3KF6 B;  2YV5 A;  1NTG A;  4GNX C;  1M1K C;  2UUA Q;  4NXM L;  1YZ6 A;  2JA6 G;  1HNX L;  3KDF B;  2UXB L;  4EQ5 A;  1CKM A;  1L1O A;  1YNX A;  5GAH C;  2YYZ A;  3M85 A;  1XPR A;  4DR4 Q;  3S17 H;  1VQC A;  4TVA B;  1L1O B;  1WYD A;  1X55 A;  2WAQ G;  4NB3 A;  1A62 A;  2K5N A;  3MEF A;  4YHH Q;  3OYY A;  3PIP A;  2A1A A;  1VQ5 A;  4A3D H;  5JJI A;  4A3L G;  4A3E G;  1EIF A;  4DR2 Q;  1I94 Q;  1VQK A;  2ZJR A;  2I5L X;  1XPU A;  1MJE A;  4XTC S;  4O0A A;  2Y0S G;  2NVQ H;  3HOX H;  1VQ7 A;  3BZC A;  1FVI A;  4L5Q A;  3S14 H;  4X6A H;  5K36 G;  1IXR A;  3CCS A;  1YBY A;  4IFD G;  2RHQ B;  1X3G A;  3TQY A;  3GTO H;  4DR4 L;  1VQL A;  1C0A A;  4H02 A;  1TXY A;  1IL2 A;  5M5X H;  3CCJ A;  2VUM H;  3M7N A;  1VQD A;  3J7A 5;  1YHA A;  5E7N A;  3OTO Q;  1E24 A;  1I94 L;  5IP7 H;  1X9N A;  3EBE A;  4R4I A;  4AIM A;  2NZH A;  1E7Z A;  2E2J H;  4JG2 A;  1PH7 A;  1SR3 A;  4UP9 A;  4DV0 Q;  2NZO A;  2AWN A;  1WCM H;  2BH8 A;  4DK6 C;  1IYJ B;  2EXD A;  3HKZ G;  2K5H A;  1VQB A;  4APV A;  3CAM A;  4JI0 Q;  4BBR G;  5IYB G;  4A3F H;  3S1N H;  4GKK L;  5M5W H;  1BBU A;  4LUO A;  4IOC A;  1YHQ A;  1V1Q A;  2UXD Q;  4PZ8 A;  2UUC L;  2AWO A;  2DUD A;  3CP0 A;  4DUZ Q;  1TWC H;  4AYB G;  3H3V I;  2IHE A;  3K8A A;  1HJP A;  2PMZ E;  5M3M G;  5C4J H;  4HJA A;  4QIW E;  5IWA Q;  5M3F G;  1UE7 A;  2I5H A;  4DK3 C;  1Q86 C;  1XJV A;  4A76 A;  1XMQ Q;  1HH2 P;  1WJJ A;  4NXN L;  2UXD L;  1EQR A;  3I2Z A;  4POF A;  1AE3 A;  1N36 L;  1VQH A;  5FLX c;  4DAY B;  1IZ6 A;  1A0I A;  3D0F A;  4QJF A;  4DR5 Q;  1EYG A;  3IRB A;  1I5F A;  1IBK Q;  4HJ5 A;  2JEA I;  2K14 A;  4R1J A;  1VQI A;  3U50 C;  4A3J G;  1OTC A;  4DV1 Q;  1VQE A;  3ICE A;  4A3C G;  3HOZ H;  4C3I H;  1VQM A;  2L15 A;  3STB C;  1N32 L;  4UP8 A;  3PO3 H;  4JI6 Q;  3RNU A;  3PGZ A;  1MKH A;  5EAY A;  4AQY Q;  1IBM Q;  1W3S A;  3GTJ H;  1Y1V H;  2NVY H;  4DR5 L;  3RZO H;  2BA1 A;  1Z9F A;  2WB1 G;  2ZTE A;  5LMN Q;  2ZJP A;  4BBS H;  3M4O H;  3CC4 A;  1HZA A;  3RLO A;  1PH8 A;  4OWW B;  4OXP A;  4KHP Q;  2UXC Q;  1K8A C;  4BXX H;  1CKN A;  4OWT B;  3UDF A;  4RG1 A;  3OW2 A;  2E5L L;  1KXL A;  5IYD G;  4OX9 Q;  1IBM L;  1K73 C;  2OTL A;  4A3K G;  2JA9 A;  1CKN B;  4IPC A;  2N8N A;  1C7Y A;  3GTM H;  2EQS A;  4JBW A;  1FJG L;  2NN6 I;  2N49 A;  5JJL A;  4TQU S;  4JI1 L;  3UE1 A;  4DKA C;  2K52 A;  1N33 Q;  3CCQ A;  3HOU H;  1K83 H;  5DLQ E;  3F1Z A;  2MO0 A;  2MO1 A;  1VQN A;  4JYA L;  4LFC L;  2NVT H;  4R4O A;  1YJW A;  5HY6 A;  3AYH B;  3W5O A;  1OXU A;  3PCO B;  1PH2 A;  1LUZ A;  3PUZ A;  4IPH A;  4YY3 Q;  5IYB H;  2NN6 G;  4JI5 Q;  4B3M L;  4JI2 L;  1PA6 A;  1PH6 A;  1HNW L;  1S3O A;  2WP8 J;  3F8T A;  2R92 H;  3CXC A;  1VQ6 A;  5LMU L;  4A3B H;  3GD7 A;  4GOP C;  4C3J H;  4LF9 L;  4JI3 L;  2D0P A;  4JI8 Q;  2IX1 A;  4A3G H;  3RN5 A;  1E1T A;  1JB7 A;  3PSI A;  1GM5 A;  3ERS X;  1XNQ Q;  1TWA H;  3S16 H;  2VQF Q;  3G48 A;  4K0K Q;  2XTI A;  2F4V L;  2RHS B;  4MNO A;  1R9T H;  2JJQ A;  2K50 A;  5H1S E;  1J5E Q;  3CC7 A;  1XMO Q;  2R7D A;  1JJC B;  4GLV B;  4GN5 A;  4X64 L;  4PZ7 A;  2MNA A;  1KRS A;  4JI8 L;  5AJ3 Q;  3PIO A;  3H3V H;  4AH6 A;  1Y14 B;  1VCI A;  1W2B A;  2VY3 A;  2F3I A;  3CMA A;  4OO1 I;  2R93 H;  1S72 A;  4X62 Q;  3WWV A;  2PQA A;  1YJ9 A;  4LFA L;  4JI7 L;  1XNR Q;  4DV7 L;  4UPA A;  4DUY L;  1L0W A;  1HR0 W;  5FLM G;  2ZM6 Q;  2VQF L;  3ER0 A;  1XNQ L;  4IFD I;  1HZC A;  2PQA B;  2UUB Q;  4XIG S;  3PF5 A;  4DAM A;  1Q1E A;  1L2F A;  1RIP A;  3M4P A;  3NEL A;  3CCR A;  1OXV A;  2EIF A;  4C2M H;  1YI2 A;  1XMO L;  1Q8K A;  3UE0 A;  1CSP A;  3Q8D A;  4L5S A;  4DV4 L;  5C4X G;  4IO9 A;  2UUA L;  4LFB Q;  1H95 A;  4LF6 L;  4DR3 Q;  4B3R Q;  2HHH Q;  4OO1 G;  3PO2 H;  4DNI A;  1M90 C;  3FKI H;  2Q2H A;  3S24 A;  5ELN A;  1VQ8 A;  1VQJ A;  2ZM6 L;  3AQQ A;  1VQ9 A;  3I7F A;  4B3S Q;  2Z6K A;  1HZ9 A;  2UUB L;  3KJP A;  4JOI C;  3S2D H;  2R7F A;  1RL2 A;  1WFQ A;  3A0J A;  1LM0 A;  4YHH L;  4DV2 Q;  3EIV A;  4B3R L;  4A3K H;  4DR2 L;  3T1Y Q;  3S1M H;  1C9O A;  3F2C A;  5C44 H;  3J81 i;  2IHF A;  1DGS A;  1EQQ A;  1PH4 A;  2UU9 Q;  4GLA C;  1UE5 A;  3JC6 6;  3HFZ B;  2AMC B;  3KLW A;  3A5U A;  3T1H Q;  2MQH A;  1IBL Q;  5C3E G;  3J7Z C;  1B7Y B;  4DV2 L;  4P71 A;  5BR8 Q;  3OTO L;  5JEA J;  3RLF A;  3T1Y L;  1L1O C;  4DR1 Q;  1E3P A;  1ASZ A;  2JA8 G;  4BY7 H;  4OX9 L;  3ULL A;  2UU9 L;  1X3F A;  4GKJ Q;  4DV0 L;  1N34 Q;  3A5Z B;  2JQO A;  5IP9 H;  3F2D A;  1NJI C;  3T1H L;  4IPD A;  4JI0 L;  3SGI A;  1X3E A;  4A3I H;  2IX0 A;  1EOV A;  3J81 c;  3H0G H;  4HJ9 A;  2PI2 E;  2VL6 A;  3PUW A;  4BA2 I;  4MZ9 A;  1YEZ A;  4DUZ L;  4GKJ L;  4KI0 A;  3BJU A;  4QY7 A;  1JT8 A;  3KFU A;  2E2H H;  2KBN A;  2HIV A;  4PMW A;  3PUV A;  4L5T A;  4IFD J;  1Q81 C;  4BY1 H;  5IWA L;  1P8L A;  4LUZ A;  4HIO A;  2HT1 A;  4A93 G;  1Q1B A;  4Y7N H;  2YU9 H;  1XMQ L;  2CWP A;  2JA6 H;  3CCV A;  2B3G A;  3KF8 B;  5IE8 A;  3CQZ H;  4JI4 Q;  4DV6 Q;  1TWF H;  2PNH A;  4LW1 A;  1GO3 E;  2RF4 A;  3DLL A;  4MTN A;  1P16 A;  3NEM A;  5IYC G;  4ALP A;  1EFW A;  3TS2 A;  3W1B A;  1IBK L;  3PF4 A;  2JA5 G;  1D7Q A;  1UWV A;  4A3L H;  2D0O A;  4DV1 L;  3I4N G;  4A3E H;  1CSQ A;  3GTL H;  1YIT A;  3M3Y H;  2D62 A;  4IJL A;  5C0X I;  4JI6 L;  1JJ2 A;  1I6H H;  1U0L A;  1PYB A;  1BBW A;  2HIX A;  4AQY L;  3AFQ A;  2NVX H;  2OWO A;  1OXS C;  2LXJ A;  2BA0 A;  1Q82 C;  2N78 A;  3EN2 A;  5LMN L;  4JBJ A;  4DV5 Q;  2GVA A;  4X66 Q;  4DV3 Q;  1PH3 A;  2ZTC A;  3M9B A;  4LF6 Q;  1SRU A;  4KHP L;  2UXC L;  3CME A;  4A3D G;  3ZJY C;  3ULJ A;  2IT1 A;  1KRT A;  3HOW G;  1E1O A;  4LF5 Q;  1QVC A;  2VZA A;  3TRZ A;  5C0X G;  4P72 A;  1PH1 A;  3G71 A;  1PFS A;  3U4Z A;  2VS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...