1TWGH

Rna polymerase ii complexed with ctp
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II largest subunit
total genus 21
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1twgH00
2MFIA 2OCEA 2Z0SA 4UP9A 2WFWA 4YHHQ 1SMXA 4JI4Q 4X66Q 1HZCA 5K36G 4JOIC 4HJ5A 1IBLQ 1IXRA 4R1JA 1OXXK 4B3SQ 1VQOA 1K73C 3A74A 5IYDG 1FJGQ 1PH2A 4L5RC 1I5FA 1SE8A 4LUZA 3H0GH 5C4JH 3CQZH 3RZOH 4JV5L 2KHJA 2K50A 1T9HA 5AJ3L 1E24A 3PUWA 1X3GA 2MNAA 4UPAA 4LFCL 1Q12A 3ERSX 4DV3L 2R92G 2E2JH 3HOYH 1SFOH 5IP7G 3A5UA 4DR1Q 1PH9A 4LFAQ 1NMGA 3CW2C 4LF5L 1VQNA 2HIVA 3PUYA 4GS3A 2B63H 1A8VA 4KI0A 3S1MH 4A3GH 3HKSA 4JBJA 1SRUA 3S15H 1QUQB 1EYGA 4LFBQ 1FJGL 2UXDQ 4DUZQ 2R93H 3HOVG 2ZTCA 3M3YH 2R93G 4GNXC 2CQOA 4OWXB 2ATWA 1VCIA 2OTLA 1OTCA 1YIJA 3HKZE 4EQ5A 2VQFL 2YU9H 2XTIA 4LFCQ 4A3GG 2B63G 5E7NA 4LW1A 2JA6G 1VQPA 3F2CA 4GKJQ 4OO1G 2JE6I 3F2DA 3RLFA 2PQAA 4YHHL 3JAMi 3JAMc 4GNXB 3AQQA 5LMUL 4DNIA 2K75A 2ASBA 4BXXH 4AH6A 3AFQA 4GN3B 4DAYB 1YJ9A 4LF8Q 4JI4L 2E8GA 1QVCA 3ULPA 2AWNA 1V9PA 1N8RC 1IZ6A 1D8LA 2VQFQ 4C3HH 4KHPQ 3CMAA 3W5OA 3BJUA 4A3KH 2B29A 4DK6C 3GTQH 2GVAA 4FDBA 1PA6A 3PF4A 4P73A 3H15A 3RNUA 1VQKA 2ZJRA 2UXBL 3K0XA 1PH4A 3CXCA 4JBKA 1VQ5A 1Q86C 2PMZE 3KJPA 4JI6Q 2JEAI 3KDFA 3CC2A 2JJQA 1XMOL 1BBUA 1VQGA 4GLVB 4B3RL 1C0AA 1CSPA 4KLKA 2IT1A 5M3MG 2ALYB 1I3QH 4XTCS 5EAYA 2LSSA 3RN2A 1PH5A 3G6EA 1VQ4A 1HZAA 4IJHA 1TWGH 4DV0L 3M4QA 1PYBA 4HJ7A 2R7ZG 1GVPA 5M3MH 4X65L 4POFA 5IYCG 2UXCL 4JI0L 1V43A 4HIDA 2MO0A 2Z6KC 1CUKA 4JBWA 5GAHC 5C4XH 2EQSA 1BVSA 3TQYA 4DR7Q 1VQ7A 1SLJA 1D7QA 4DR6L 3PGZA 1GD7A 4EX5A 3FHWA 3D31A 4JI3L 3I56A 4A3LH 1UEBA 2C35B 4A3KG 1YITA 2B3GA 4TQUS 4JI8L 1B7YB 1LTLA 1UE6A 5C0XG 3KDFB 4PZ6A 2Q2TA 1WJJA 1XMQQ 4H02A 1I94L 1HZ9A 3U50C 1VQ9A 4QJFA 4NB3A 2NN6I 3UE0A 1TWCH 2GVBA 1Q7YC 1MJEA 1V1QA 4GKKQ 4UP8A 1PH8A 4HJAA 4HIOA 4KHPL 1Y1WG 4JI2L 4LF4L 4A3EG 3J7ZC 3I4MH 4GLXA 5J3BA 3M9BA 1MJCA 1XMOQ 4IOCA 2QGQA 3PUXA 2ZM6L 4DV1Q 2AMCB 1ASZA 2KCTA 2MO1A 4X64L 1B8AA 1L1OB 3PV0A 4K0KQ 4R4TA 3BZCA 4GOPC 1E22A 1VS0A 1NE3A 2E5LL 1HNWQ 3E0EA 4B3RQ 3I4NH 2RF4A 3K7UC 4QIWE 4HJ9A 1K9MC 1L0WA 4DV4L 4NPSA 3K7AH 5C44H 4LNQA 1ASYA 3PUVA 2VUMG 3ZJYC 4LF6L 4QY7A 2OQKA 4ME3A 2RCNA 4A3DG 5HGQA 1C7YA 5AJ3Q 4HIKA 3I4NG 1G291 2JA6H 1X3FA 2K14A 3IRBA 2K5NA 5ELOA 3GD7A 2ZM6Q 4DV1L 2YTVA 4R4CA 5IP7H 3OTOL 4LF5Q 4MZ9A 4DR6Q 2N8NA 4RMFA 1RL2A 4DR1L 2R92H 3H3VI 3OYYA 4GN5A 4A3EH 3A5ZB 1WI5A 4DR5L 4X62Q 4DR3Q 1QZGA 5M5YH 4L5SA 3M4OH 4R4IA 3PSIA 4DV4Q 3UDGA 3M7NA 5JJLA 3KFUA 1JJCB 2KHIA 1FVIA 3U4ZA 1KXLA 4A3JG 2BH8A 3RZDH 2UU9Q 1O7IA 2VNUD 4BY1G 2VW9A 2ZTDA 1J5EQ 4JI5Q 1DGSA 1WFQA 2HIXA 3L0OA 1YHQA 1HR0Q 2ES2A 1Q8KA 1Z9FA 2LXKA 1K83H 3I7FA 5BR8L 2DGYA 4DV6L 3KF6A 1NJIC 1FGUA 3CD6A 4AQYL 3CPFA 5M3FH 3JC66 1EWIA 4L5TA 1HJPA 4DV5Q 1EQRA 4LF7Q 4DV3Q 5LMNW 1HNXQ 4MNOA 4LUOA 4B3ML 3EN2A 4QGUA 3GTMH 1VQIA 2JQOA 4C2MH 1HZBA 1LUZA 1YVCA 2VS1A 4C3JH 2JA8G 2F4VL 4R4OA 1GM5A 4O2DA 1CKNB 1U0LA 2YTXA 1JE5A 1BBWA 4NXNQ 2N49A 4JI5L 1XTDA 5FLXc 3J81c 4GOPA 1KIXA 1KQSA 3FKIH 1Q81C 2VY3A 3PCOB 1JMCA 3L2PA 3CC4A 2VUMH 1KRSA 2PNHA 4IPDA 2VQEL 4X6AH 3HOWG 3ULLA 1XJVA 4A3FG 2RHSB 4YCVA 1X56A 1AE2A 4GLAC 4DR4Q 3CCLA 5FJ8H 3KYHC 4PMWA 5IYBH 3HOXG 5JJKA 1WYDA 2AKWB 1A62A 3FP9A 2F4VQ 2XGTA 4PZ8A 2I0QA 4IPCA 2NVXH 1Q1BA 2N3SA 4X62L 1UE5A 4JBMA 3T1HL 4LF8L 4BA2I 4PZ7A 4GOPB 2UUBQ 3S14H 3M4PA 1L2FA 4JC0A 2F52A 4DAMA 4WJ3M 5BR8Q 4DV6Q 4OWTB 2Q2UA 2FXQA 4LFBL 1J6QA 4XIGS 1PFSA 1PYSB 4BA1I 1VQBA 4A3CG 4YCWA 3MEFA 4YCUA 5FLMG 4A3LG 2K5HA 2ZTEA 2E2HH 4JI8Q 3PF5A 2ZJPA 2D0OA 4AYBE 1N33Q 2A8VA 4JI1Q 5DLQE 1KHIA 2EXDA 3DLLA 4JCVE 3CF5A 4B3SL 1XPRA 2VZAA 2CKZB 1Y1VH 4NXNL 1OXVA 2V1CC 2UUAL 1EOVA 1WCMH 4Y7NH 2NVTH 3GTPH 1YBYA 1Q82C 1Z47A 3VDYA 4GKKL 1YNXA 1QVGA 1N36L 3PIOA 4LF9Q 4BY7G 1UWVA 5LMUQ 4J15A 3CP0A 3PIPA 3FKIG 4OWWB 2E2IH 3E9IA 1OXUA 1IL2A 1YHBA 4DUYL 3PO2G 4A3BG 4WJ4A 3WWVA 2NZHA 4BY1H 1XNQQ 1Q1EA 4P74A 1PH3A 1P16A 3HOYG 1HNWL 5C3EH 2VQEQ 1MIUA 3I4OA 3H3VH 2KENA 4OXPA 3CMEA 1NTGA 2IY5B 4YWMA 5C0XJ 3KOJA 4B3TQ 2A19A 4LF6Q 3K80C 1AE3A 2NVYH 3F1ZA 4X66L 4DV2L 3F2BA 1N36Q 5GAGC 3HOZG 4PG3A 3PO3G 3T1YQ 4L5QA 2BH2A 3RLOA 5C3EG 1VQFA 1PVOA 4A93G 3EIVA 2UUCQ 4JV5Q 4A3JH 3S1RH 3PO3H 4GKJL 1MKHA 1RIPA 3UDFA 2ID0A 4YWKA 3CAMA 4TVAB 4OX9L 3GTLH 4JYAQ 3TEHB 4A3MG 3S2HH 4UP7A 4JI1L 3UDXA 2Q2IA 3J80c 2HHHQ 3LGJA 4JI7L 4B3TL 2JA5H 2OTJA 1VQEA 1C9OA 4X64Q 1XPOA 2UUAQ 3M85A 2K5VA 4DR2L 4UY8C 5C0XI 1TWAH 2UU9L 1N33L 4IFDJ 3S1NH 1IBKQ 5JJIA 2YV5A 5IWAL 3UDIA 1U5KA 1HNZQ 4NXML 1BKBA 4IOAA 2NN6G 4DR7L 1KL9A 4JG2A 4OO1I 4DKAC 1K3RA 2DUDA 1CKMA 1TWFH 1X54A 1E1TA 1Y14B 1L1OA 1SROA 1E3PA 1QVFA 3J81j 4HIMA 3PUZA 4DV5L 3HOVH 3I55A 1SN8A 3TRZA 1YJNA 2L15A 1Y1VG 4JI7Q 1VQHA 2KCMA 1KD1C 3OTOQ 4IO9A 4JOIA 2WB1G 1UE1A 3GTOH 1TXYA 4RG1A 2QEXA 3BU2A 4DV7L 2H5XA 4A3CH 5M5XH 4BBSH 1EUJA 4DR3L 3CCJA 4A76A 4DR5Q 1VQJA 2Y0SE 1P8LA 4MTNA 5GAEC 3HOXH 1IBMQ 1Y1WH 1VQ6A 4O0AA 3TS0A 5FJ8G 3HOUH 4DV2Q 1K0RA 1CKNA 2N78A 4KHZA 2E5LQ 4APVA 4IFDG 4YY3L 4GN4B 5IYDH 1I6HH 1J5EL 2WAQE 2UXDL 3ER0A 2K4KA 2PQAB 4BBSG 3RLNA 1VQMA 3GDEA 1GO3E 2HQLA 3F8TA 4A4IA 4JI3Q 1LM0A 2IX1A 4DR2Q 1IBLL 1WOCA 2WAQG 3EBEA 3NENA 5IYBG 3CCEA 3CCQA 1S40A 3T1HQ 2CCZA 3CCRA 2IHEA 5HY6A 2KBNA 3D0FA 4POGA 1CKOA 1X9NA 4B3MQ 4C3IH 1PV4A 1XMQL 1PHJA 2UUBL 3HOWH 3KJOA 1B70B 3K8AA 3CC7A 1I94Q 2JA5G 1M90C 3K81C 1VQCA 5IE8A 3NBHB 4Y52H 2OQ0A 4AIMA 1IBKL 3S1QH 1JT8A 4IJLA 2Y0SG 4YY3Q 5IWAQ 3J7A5 3UE1A 3G4SA 2PI2E 3NELA 2R7DA 2D0PA 5IY0A 3L7ZC 1M1KC 2WB1E 2I5MX 4K0KL 3B6YA 1NMFA 3U58A 1Q46A 3CCVA 1QZHA 3S2DH 2QA4A 1G6PA 3BZKA 4LFAL 2OWOA 2JA8H 3CPWA 4A75A 4DV7Q 1X3EA 3J80i 5JEAG 1PH1A 3S17H 5C4XG 4DUZL 3HKZG 4BBRG 5M5WH 1YZ6A 4A3MH 1IBML 5IP9G 4BBRH 4DPGA 2CWAA 5H1SE 2A1AA 3AFPA 3W1GA 1PH6A 4LF9L 4IFDI 3E9HA 3MXNB 2YYZA 3G71A 1K8AC 1JJ2A 4A93H 4A3IG 1YHAA 2D62A 1A0IA 3CCMA 4IPHA 4ALPA 1NY4A 4P72A 2RHQB 1XNQL 1XNRQ 1H95A 4YWLA 1LYLA 3HOZH 1X65A 4BY7H 2CFMA 2VL6A 4DV0Q 2JEBI 4BXXG 3RR5A 3S16H 1N32L 5ELNA 3TREA 1W3SA 5C44G 1K8GA 2I5HA 1G51A 1OXTA 1VQ8A 1EQQA 3T1YL 5LMNQ 2LXJA 1QUQA 3ULJA 1IYJB 3TS2A 1HH2P 3PO2H 4A3BH 1EIFA 1KAWA 1L1OC 2CWPA 1PH7A 1HR0L 3STBD 5FLMH 3AEVA 4LWCA 4P75A 1GKHA 1EFWA 2Z6KA 4A3DH 1AH9A 2PI2A 3OW2A 3I4MG 1YEZA 4JYAL 2UXBQ 2R7FA 1N34L 3HFZB 4LF7L 3KF6B 4OX9Q 1WCMG 1HNXL 4JI6L 2BA1A 1FL0A 3GTKH 5GADC 1JJGA 4DUYQ 3H0GG 3A0JA 3HOUG 1YI2A 4OONA 2JK8A 3STBC 4GNXA 1HR0W 2ZJQA 4NXMQ 2NVQH 5GROA 4A3IH 1TWHH 2EIFA 4P71A 4JI0Q 4QL5A 1I50H 4X65Q 3Q8DA 4R4QA 3GTGH 3S24A 5IP9H 1XPUA 2UXCQ 1UE7A 1VQDA 3G48A 3KF8B 4HJ8A 2R6GA 3CCUA 4IPGA 3RN5A 2F3IA 3ICEA 1EIYB 1KRTA 5IYCH 1NBWA 3W1BA 4DR4L 3J81i 2UUCL 2JA7H 2YTYA 1XNRL 2R7ZH 3KLWA 1N32Q 2MQHA 1A63A 2WP8J 1OXSC 1YJWA 2NZOA 3GTJH 3I2ZA 4AQYQ 1E1OA 1S3OA 2HT1A 3DM3A 5JEAJ 2AHOB 1X55A 2JA9A 5GQOA 2Q2HA 4AYBG 2HHHL 1E7ZA 4LUVA 3GO5A 3U4VA 1VQLA 4A3FH 2JA7G 1JB7A 1CSQA 4DK3C 2I5LX 5LMNL 3NEMA 2BA0A 2IX0A 2GN5A 2IHFA 3SGIA 4JI2Q 1X6OA 4LF4Q 2K52A 1W2BA 5M3FG 1KC8C 1HNZL 4QQBX 1R9TH 1VQAA 5IT9c 3CCSA 1N34Q 1SR3A 1N9WA 3AYHB 1S72A 2AWOA
chains in the Genus database with same CATH superfamily
4YHHQ 1OXXK 4B3SQ 5KNDA 3VR2A 2RDHA 4LUZA 3GTMB 2SDFA 2K50A 2JYOA 3DEPA 1DYQA 2PMZB 3VR6A 5CORA 1Q12A 3HOYH 5M5YB 5IP7G 4A3MB 1VQNA 1L0XB 3S1MH 2HIVA 4A3GH 1O78A 4CDCC 2LY7A 3QG1A 4RWSC 3QJYA 1CZGA 5ELBA 4GNXC 2PCFB 4OWXB 1WTWA 3K6OA 3HKZE 2Q8RE 2XTIA 4LFCQ 1DZ1A 1Z6HA 4GKJQ 2JE6I 1A2TA 2ENBA 2PZUA 1DONA 5LMUL 2K75A 1EZ8A 2A6HD 3P75A 1DD2A 3X3MA 4DAYB 4B08A 1KDBA 3DWQA 3A56A 1ENCA 3I91A 1YNND 4ZK9B 2AWNA 1EY7A 1QE6A 1N8RC 1D8LA 3KLRA 4L6TB 5EGTA 3D3RA 5T1GA 2VQFQ 1EEID 3BJUA 4AYBB 3PF4A 3VR3A 3RNUA 2IW3A 2UXBL 5FLXE 3VR4A 4JBKA 3SE0A 4KHVA 1SBBB 5KYIA 1K8OA 5C3XA 4IN3A 4XTCS 4ABNA 1FR3A 5FO8B 1HZAA 3E0JA 1RTNA 4DV0L 4HJ7A 2SEBD 2CVRA 1XWEA 1GVPA 3H3VC 5M3MH 4KKTA 5IYCG 2K28A 4HIDA 3MXNA 3NWSA 3H09A 3K5OA 5E1FA 5FK9C 1GUGA 1CUKA 1MHWC 3SK6A 4C3IG 1HPCA 2EQSA 3TQYA 2KQ3A 3PGZA 1GD7A 1RKNA 2A69C 5AFWA 4JI8L 3K57A 1B7YB 4MTKA 2NYZD 1DJRD 4PZ6A 1WJJA 2D2CC 4M8AA 2MPMA 1Q7YC 1LT6D 3TBIB 3NE5B 4BY7B 4KHPL 4JI2L 3NBHA 4GLXA 3M9BA 1T5EA 1XMOQ 5ELEA 4IOCA 2QGQA 3PUXA 4DV1Q 4HMJA 2MO1A 4X64L 4GOPC 2ZXPA 3OOCA 2RF4A 1LT3D 4QIWE 4DV4L 2DJGC 2RQXA 1ASYA 4ME3A 1XYIA 2RCNA 4A3JB 1C7YA 5AJ3Q 3I4NG 1G291 4FF2A 1B4OA 4K8JA 4IUQA 1Y8OB 4LF5Q 4MZ9A 4DR6Q 2N8NA 2NVTB 3SK4A 1TR5A 4A3EH 3OWEB 3GTQB 5M5YH 4CKEA 3M4OH 2EE1A 3J7AV 3KFUA 1II3A 1PZID 4A3DB 1SNCA 1PTOC 3D4DA 2F0KA 1SJED 3TP5A 4BY1G 1J5EQ 3PO2B 1HA6A 1JCKB 2ES2A 1K83H 5BR8L 2DGYA 1QOHA 2FJ2A 3KF6A 3V05A 3K5MA 3CD6A 2JA7B 4UDUC 4AQYL 3JC66 5C3EB 3SK5A 1HNXQ 4KKSA 2WKDA 3NXWA 4LUOA 5EBDA 4ZKCB 5CBEE 1WTOA 1VQIA 3V96A 2JQOA 4C2MH 1HZBA 2JA8G 2E2HB 4C3JH 4R4OA 4CHTB 1GM5A 3I70A 4JI5L 4A3FB 3S15B 1C4QA 3PQIA 2VY3A 2EY5A 3X3NA 4IPDA 2RDGA 4BWGB 1ML0D 1KNEA 3ULLA 2H1EA 1XJVA 4YCVA 1NNXA 1X56A 4GLAC 4DR4Q 4XDXA 3MFGA 3Q24A 3S16B 5JJKA 3CQZB 2X6LA 3AB9A 4X62L 2EZVA 3VYSA 4JBMA 1ESFA 4KV6A 1D1IA 4GOPB 2R7ZB 1ET9A 2JA5B 2UUBQ 1L2FA 2F52A 5IT9E 5IGCA 4WJ3M 4BY1B 2Q2UA 3BDLA 5C4HA 4LFBL 3MTSA 4BA1I 4A3CG 4YCWA 2FMMA 1J9OA 4A3LG 1S4ZA 2D0OA 1STAA 4AYBE 2F0PA 2LMCB 4K2KA 3NTKA 1EOVA 1WCMH 2QDBA 1Q82C 1SNOA 1V8QA 5BN5A 1RCVD 1YNXA 1N36L 1YNJC 3PIOA 5ELCA 1ILPA 4J1MA 1F2LA 4BY7G 2K5DA 3PO2G 3WWVA 1PH3A 4P74A 1JOOA 4DK0A 1CA5A 5C3EH 2VQEQ 1MIUA 2E74C 3I4OA 3BYYB 3H91A 4GZYC 4YWMA 2AUJD 4HN7A 4IZ8A 2LFNA 3NUCA 1EIGA 2NWGA 3K80C 1AE3A 1V1OA 3HG9A 5C3WA 1R4PB 4L5QA 5C3EG 2HDMA 1X3PA 3JAME 4A93G 4DK1A 3S1RH 4GKJL 1RIPA 1STGA 4QIWB 1SYCA 2F0WA 3J7AF 1I6HB 1EY9A 3UDXA 3GTPB 4EQNA 1C9OA 4X64Q 2UUAQ 2OTJA 2Z4HA 5M5WB 2L0CA 1TWAH 1SE4A 4IFDJ 1IBKQ 5IWAL 4N8X1 4IOAA 1JB3A 4DR7L 1KL9A 4DKAC 1VMCA 4EVOA 1TWFH 1X54A 1Y14B 2V4DA 3SK8A 1E3PA 4KTAA 3MWYW 1PLFA 1SN8A 1QWYA 3OW7A 1YJNA 2K04A 3R2IA 1VQHA 2K33A 3QOLA 4DF7A 5DNFA 5NUCA 3J81E 3GTOH 4BBRB 3FRPB 5JAVA 2QEXA 1BF4A 2H5XA 5M5XH 4BBSH 4DR5Q 2Q8TA 4JVZA 2Y0SE 1P8LA 5DAUA 2XNAC 4Z9CB 1U4LA 1Y1WH 1PTOH 1IW7D 4DV2Q 2F3VA 1HUNA 1K0RA 1CKNA 4KHZA 5HURA 3J81L 5LHY1 1O80A 4GN4B 2FMCA 1J5EL 1QNKA 2PQAB 4BBSG 1RJTA 1GO3E 3GDEA 3F8TA 1PTOF 4DR2Q 1WOCA 3EBEA 2ZXRA 4CJ2C 3CCEA 1S40A 2CCZA 1WTHA 2IHEA 5FO9B 5KNCA 5HY6A 3CCRA 2KBNA 1PRTC 3D0FA 4C3JG 4POGA 5M3MB 4B3MQ 2PNRC 1XMQL 3KJOA 1B70B 3K8AA 2JA5G 1ZXTA 1VQCA 4G4KA 5ELDA 2VB2X 2M00A 4IJLA 2Y0SG 2B8FA 4YY3Q 3UE1A 3G4SA 3NELA 2C9OA 1SYDA 5IY0A 4XYQA 4K0KL 1WCMB 1NMFA 1QZHA 1G6PA 5E4WC 3H94A 5D3IB 1X3EA 3J80i 2HUGA 2KEDA 3HKZG 5M5WH 1YZ6A 1SFOB 1IBML 4BBRH 1S5FD 4DPGA 5M3FB 2A1AA 2PZWA 3AFPA 3W1GA 1PH6A 3D8GA 4G57A 3E5SA 3G71A 4L8JA 2MUYA 1JJ2A 4A93H 1WTRA 4C3HG 4OHJA 1XNQL 4ZUIA 4NDXA 4YWLA 1LYLA 2KUMA 2DNEA 4DV0Q 1WD0A 3RR5A 3S16H 1W3SA 1G51A 1WTPA 3OWFA 3GV6A 4OO1H 1I3QB 3MZ5A 1PXUA 1SE3A 3ULJA 2VUMB 3O13A 4X3TA 1HH2P 1L0YB 5G3LD 3PO2H 1LTSD 2CWPA 1HR0L 2A74C 1D1KA 3J80E 2Z6KA 4LJZC 4JYAL 4A3GB 3HFZB 3KF6B 1WCMG 4JI6L 4IALA 3H0GG 3HOUG 1S5DD 1HR0W 1BCPC 1MBYA 3NSWA 1TWHH 2D5DA 4XT3B 2EIFA 2E75C 4XYOA 2J4XA 2NZ1D 1ICFB 3Q8DA 3S24A 1UE7A 1UUPA 2FINB 3MXPA 1SNQA 4X3SA 1AN8A 2R6GA 3CCUA 2MJ8A 1KAAA 2F3IA 1EIYB 5IYCH 4DR4L 2IX3A 2YTYA 1XNRL 1N32Q 1A63A 3Q23A 2WP8J 5K36H 1YJWA 3GTJH 3I2ZA 4AQYQ 3MA2B 3DM3A 4ILWA 2EVBA 2AHOB 3NQIA 1X55A 4ZQ3A 1SYGA 3U4VA 1VQLA 1HTPA 1CSQA 5KGUA 2I5LX 2QW7A 5KYLA 4F7XA 4UHVA 2IHFA 1X6OA 4RGTA 2E76C 2E2JB 1N34Q 1OO9B 1VQAA 3CCSA 1N9WA 4PQXA 2AWOA 3HKZB 2Z0SA 4JI4Q 4X66Q 1IXRA 1CI3M 2AUKA 1BNZA 1PH2A 2F0VA 1SE8A 4JV5L 2KCCA 1PFMA 5AJ3L 2MNAA 3C1EA 2PPBC 3I4NB 2EYMA 3ERSX 4C56C 1TWGB 1K83B 3A5UA 4CKCA 1PH9A 4QCLA 4DGZA 2L9HA 5I9PA 4JBJA 4ME5A 1SRUA 3R3OA 2PQEA 1EYGA 3S15H 1FJGL 4DUZQ 3RUZA 5C4JB 5I9OA 2CQOA 2ATWA 1I4GA 3MXGA 3P7JA 4C2MB 4XQNA 1OTCA 1C48A 2VQFL 2K05A 4A3GG 2CH4W 2F0GA 2Y0SB 1VQPA 3V2TA 4J8QA 2B8GA 2IPKD 3JAMi 3JAMc 4GNXB 5KRUA 4GN3B 4HCEA 2F03A 4XQQA 1RTOA 2E8GA 3ND8A 1QVCA 3ULPA 1V9PA 1IZ6A 1Y69U 2B63B 3W5OA 1GUWA 1ZYRD 4A3KH 3H6MA 2GVAA 2KHSA 2NB0A 2ZJRA 1Y1WB 3K0XA 3A55A 4V190 2KEEA 1VQ5A 1D5MC 1G6ZA 3KJPA 2JEAI 3KDFA 3CC2A 2JJQA 4B3RL 1BBUA 1HFGA 1C0AA 3P1HA 1JORA 2LSSA 5JVG3 3RN2A 1VQ4A 4IJHA 1GOZA 4OIKA 1PYBA 2K32A 4X65L 4POFA 2UXCL 3S9WA 4K5VA 4JBWA 5C4XH 1QG7A 1MI2A 3I4MB 1VQ7A 1SLJA 4DR6L 4KK7A 3D31A 4JI3L 1S5CD 4A3LH 1UEBA 2C35B 4A3KG 2B3GA 4TQUS 1LTLA 1UE6A 1PRTB 1VQ9A 1O7YA 4NB3A 3UE0A 1EFID 1V1QA 5FOBB 1B53A 4HJAA 5JPNC 2ZM6L 2KCTA 1L1OB 4R4TA 1TWAB 1E22A 4ZKBB 1G8ZD 1IYVA 1NE3A 3E0EA 1ZEQX 2XRSD 1K9MC 1XXGA 1E2VA 2SOBA 3K7AH 5C44H 2J7ZA 4L63B 2OQKA 4P2CB 4A3DG 5HGQA 1Q8IA 1NCVA 1X3FA 5C6AA 3OTOL 4RMFA 2K7VA 3H3VI 2WKCA 1RHPA 1E2WA 4OL7A 5JOBA 5IGEA 3Q22A 2A6EC 5A2QL 4DR5L 1QZGA 3HGBA 4X62Q 1BCPB 3HOVB 4L5SA 3PSIA 1JJCB 1RODA 2ICEC 2JXMB 2KHIA 1DOLA 1KXLA 3SDZA 4A3JG 3GTOB 2UU9Q 1O7IA 2Z6BA 2ZTDA 4JI5Q 3MXUA 1DGSA 1WFQA 2OXPA 5I4DA 3S14B 1Y8NB 1Q8KA 2KECA 4IUTA 1EQRA 4XT1B 1A3VA 2DJFC 2F0DA 2B39A 3HOUB 4B3ML 4ZUJA 1JWUD 3EJIA 1LUZA 4CBVA 5CV9A 2F4VL 1CKNB 1SSOA 2YTXA 1LTAD 1ZYRC 2CW0D 3FKIH 2L1BA 3PCOB 1SE2A 1UEAB 2PNHA 2VQEL 4A3KB 1JR0D 4A3FG 2RHSB 1JQYD 3CCLA 5FJ8H 4FVMA 5IYBH 2X69A 3HOXG 1GUNA 2AKWB 4K5WA 3DM1A 2I0QA 3S2DB 4IPCA 1SNMA 1UE5A 2XWBB 3R93A 2R3ZA 4DAMA 4DV6Q 1J6QA 4XIGS 1R9TB 1PFSA 3QIAA 4NKLA 1VQBA 5IIFA 3MEFA 2DNCA 2E2HH 2M9VA 1SYFA 2A8VA 2JA8B 1HTLD 1KHIA 5DLQE 2L5TA 3DLLA 4B3SL 1I4PA 2UUAL 4NXNL 1B2TA 2NVTH 1BUVT 1D5ZC 5ISRA 4B9WA 1QVGA 4LF9Q 1FGBD 3FKIG 2F0IA 4M1UB 3S17B 1IL2A 4A3BG 4RGOS 1R4QB 2LKVA 1BQQT 2NZHA 1P16A 2CHBD 2KENA 3I72A 4OXPA 4JPBW 1SEBD 5I6YA 3NTHA 5C0XJ 3KOJA 3T56B 1EWCA 3F1ZA 4X66L 4DV2L 3F2BA 1KLGD 5GAGC 3PO3G 3T1YQ 2BDOA 4O42A 3BVZA 1HA5A 1I4HA 4A3JH 4JV5Q 3Q0AA 2Z9HA 3GTLH 4TVAB 1I4RA 4ODGA 2ZXOA 3TP8A 4A3MG 2HCIA 4JI1L 3LGJA 4B3TL 1FNWA 2JA5H 1VMPA 2K5VA 1I4QA 3LWUA 4RCNA 1U5KA 2EY1A 4C3IB 2F0UA 4IQZA 2DUDA 2A69D 2Z4IA 2EXZA 1O7ZA 3M7GA 3U9SA 3TSSA 2EDGA 4FYDA 3CRLC 4KMUC 2EYLA 1HFNA 4DV5L 1F9QA 2L15A 1HXYD 1WD1A 1Y1VG 1EY8A 1FNVA 2KCMA 4RAUC 3OTOQ 3FEWX 4IO9A 2WB1G 1JICA 5CC4A 1TS2A 3I3CA 3IAYA 2FFKB 4DR3L 3C3LA 3CCJA 2JA6B 1VQJA 2I46A 4DNRB 1K0SA 1VQ6A 3TS0A 1SNPA 1AEXA 2N78A 3P20A 1QILA 5IGBA 4YY3L 2JSOA 1I6HH 2UXDL 3ER0A 1UAPA 2K4KA 3AU7A 2QF7A 1ZKOA 1CTMA 3CCQA 3T1HQ 3NTIA 1FD7D 5CV5A 1LLRD 1X9NA 5C4XG 2G9HD 3HOWH 3BS1A 3K81C 3HZXA 2AQ2B 1LTID 2OQ0A 4AIMA 2B2TA 1JT8A 2B2YC 5A2QE 1G2SA 2D0PA 4PMCA 5DM63 1M1KC 2WB1E 2I5MX 3U58A 1Q46A 2QA4A 2KJXA 1MGSA 3BZKA 3T16A 3ERQA 4K5XA 3CPWA 1ONLA 5JEAG 4DUZL 1H9KA 1F9RA 2A68D 2O5IC 3BVMA 4LF9L 5JEAH 2YYZA 1K8AC 1YHAA 1IHZA 3SHLA 3CCMA 4IPHA 3I8ZA 1FYCA 1KLUD 1XNRQ 2EYFA 3HOZH 1AZQA 2NVXB 4I7ZC 4BY7H 4DAPA 2CFMA 2H4OA 1EYAA 2JEBI 2JP1A 3FVQA 5ELNA 4KD3A 4S3SA 3TREA 2I5HA 1VQ8A 5LMNQ 2LXJA 1F9PA 1IYJB 4PNYA 3TS2A 1KAWA 1BR9A 1EY6A 2KVMA 3STBD 3FKIB 3TP6A 3HP3A 2PI2A 4RKLA 2EPBA 2R7FA 1N34L 4LF7L 2BA1A 1B50A 4DUYQ 4RH6A 1YI2A 1CA6A 1ESRA 4OONA 3NBIA 1U4RA 4NXMQ 2MP1A 1EY5A 3J80L 3I90A 4NP5A 4A3IH 2RA4A 4P71A 4C3JB 1IW7C 4QL5A 3GTGH 5IP9H 3HEJA 4ZAIA 3AMUA 3KF8B 1DM0B 4IPGA 4WORA 3ICEA 1ENAA 1KRTA 2JA7H 3KLWA 2MQHA 1QB5D 2NZOA 3WDNA 1BXTA 1HHVA 3BG3A 2Q2HA 1BDOA 1SMYD 2HHHL 1HQRD 3EROA 1PRTD 3GO5A 2JA7G 4G7OC 3WOFA 3NEMA 2P5ZX 4LF4Q 3VYTA 2EOTA 2K52A 1HNZL 4QQBX 3HOYB 1R9TH 5IT9c 4GOPA 5LL6S 5BN4A 2MFIA 2I07B 1D5XC 2WFWA 1HZCA 5K36G 4HJ5A 4DAVA 2YU9B 3FPUB 1K73C 4EQPA 1FJGQ 2ZT9C 1GHJA 4TSSA 1TY0A 4TKOB 1I6VC 3MAQA 1T9HA 3PUWA 1X3GA 1I4XA 3J7YW 4LFCL 3TMEA 2B2YA 4DV3L 3K0YA 1AFPA 3OPOA 4LFAQ 1CM9A 1NMGA 3CW2C 2BH2A 2B63H 1A8VA 4KI0A 4XXEA 1W6JA 3RZDB 4LFBQ 2UXDQ 4CGYB 2R93H 3HOVG 2ZTCA 4CDFC 1KTKA 3NP8A 5FO7B 4MN3A 4MIUA 2OTLA 4PV1C 4X3UA 2YU9H 1CFMA 2WV6D 4LW1A 2JA6G 3HOWB 4OO1G 3T53B 1A2UA 3F2DA 1C8CA 4YHHL 1E0BA 3AQQA 4DNIA 1CHPD 2ASBA 4AH6A 3AFQA 2G5DA 2KOLA 3K7AB 4IUVA 5C44B 4FF1A 2EJMA 4C3HH 4KHPQ 2K01A 2L55A 1EU3A 2B29A 4FDBA 2WACA 1PA6A 3H15A 1PH4A 2HDLA 3CXCA 2K5WA 1HRJA 1Q86C 2PMZE 4JI6Q 1NAPA 2DY8A 5ELFA 1XMOL 4GLVB 5EKLA 1CSPA 4KLKA 2IT1A 3QOJA 5M3MG 5EAYA 1BCPD 3G6EA 1XTCD 1TWGH 4H44C 2R7ZG 1VF7A 2MHVA 4NMZA 1SAPA 2MO0A 2Z6KC 1BVSA 3PMFA 4DR7Q 1D7QA 3FDTA 1MD2D 4EX5A 5C5MA 1G91A 1IL8A 3I56A 1TWCB 1YITA 4DA2A 2PW7A 3Q6SA 3SVMA 1B3QA 3KDFB 3F2UA 1LT5D 1A3TA 4H02A 3VYRA 2B2UC 2SNSA 3U50C 1I94L 1EQTA 4QJFA 2NN6I 1MJEA 2GVBA 3D6WA 3UI2A 4GKKQ 4UP8A 1PH8A 4HIOA 1Y1WG 3KLSX 4U68A 4DXFA 4LF4L 3I4MH 2B2WA 2J0TD 3R2TA 3TDQA 1ASZA 4K0KQ 1B8AA 3PV0A 4IUNA 1IKMA 2CQAA 1HNWQ 1RF2D 3K7UC 1MSGA 5EBCA 1L0WA 4NPSA 2BE5D 5DEHA 3PUVA 3ZJYC 2XVSA 4QY7A 4LF6L 1KABA 1IYUA 5D3DA 4HIKA 4BBSB 2K14A 1TWHB 2K5NA 3IRBA 3GD7A 3KBGA 5EPLA 4DV1L 5IP7H 3DHQA 4CDDC 4DR1L 4N9PA 1TS3A 1TY2A 2NVYB 3OYYA 4N9TA 2QDLA 3ND9A 4R8NA 3A5ZB 4DR3Q 4QUFA 4R4IA 4DV4Q 3UDGA 3M3YB 5I2YA 1FVIA 4HTHA 3M4YA 2JN4A 3CHBD 2BH8A 2O2LD 3ONAB 3DUZA 2HIXA 1YHQA 1HR0Q 5CR3A 5KNBA 2LXKA 1Y8PB 1NJIC 1FGUA 2XN9C 5M3FH 1EWIA 1HJPA 3GQBA 4LF7Q 4RCOA 4DV3Q 5LMNW 1U4MA 3EN2A 4QGUA 2RSNA 3H0GB 3PO3B 3HOXB 4F8MA 2VS1A 1TKWB 1WTQA 4O2DA 5CYUA 1JE5A 4R9WA 2M2LA 3ITPA 1BBWA 2N49A 5FLXc 3J81c 1KIXA 2VB3X 4CJ1B 1JMCA 3CC4A 2VUMH 4HCSA 3HOWG 2K5QA 1B9NA 3KYHC 2NTTA 5KEEA 2XGTA 5F2DA 3HS0C 4FXDA 4BA2I 5CV7A 3BDCA 4IURA 4A3IB 3S14H 1TS5A 1QJOA 4JC0A 3NQTA 5BR8Q 4OWTB 3GTLB 3MC0B 5TSSA 1F9SA 2N88A 3PIP3 3KUPA 2EY6A 2RVLA 3EA6A 2Z1CA 4JI8Q 2F0FA 4FXKC 2EYJA 2F3WA 4JI1Q 2EXDA 3CF5A 3N52A 2L11A 4NW2A 2VZAA 1Y1VH 1OXVA 3QR8A 4Y7NH 3LWEA 4HSPA 1STNA 1EEFD 3D6CA 4J15A 3PIPA 4K8IA 5I6WA 4V0BA 3E9IA 2E2IH 1OXUA 1BOSA 1YHBA 4DUYL 2F0JA 4TRDA 5BN3A 2A73B 1XNQQ 3A54A 3H3VH 5JPMC 3CMEA 1NTGA 2IY5B 1S5BD 4I7AA 2BCOA 4LF6Q 1CK1A 2EYHA 5FLXL 3C46A 1GHKA 4OGQC 3RLOA 4RHSA 1PVOA 2UUCQ 1KNAA 3BYTB 3PO3H 1M4VA 3UDFA 2ID0A 4YWKA 3CAMA 4JYAQ 4H7BA 3MVVA 3HRZC 4UP7A 4C1NI 2Q2IA 2WAQB 4ZCKA 2HHHQ 1VQEA 1KDAA 1W6KA 3M85A 2NBFA 4DR2L 4UY8C 3A8IE 4DN4M 2UU9L 1N33L 1HCZA 3K5LA 3S1NH 1HNZQ 4HAEA 2NN6G 2WINB 2TMPA 4JG2A 4OO1I 2OT2A 1CKMA 1LABA 1E1TA 4HSVA 1L1OA 2PYKA 3J81j 3PUZA 4JI7Q 5K5PA 4XQJA 1KD1C 2LS01 1UE1A 1TXYA 4RG1A 4UAIA 3BU2A 1DXMA 4A76A 2RDFA 3D4WA 2HCCA 4RGNA 1PFBA 5GAEC 3MHBA 1IBMQ 3HOUH 2E5LQ 3E6ZX 4IFDG 5E3FA 2PW5A 5LL6X 5IYDH 3CRKC 2TSSA 2XRQD 2B2VC 1VQMA 2HQLA 4A4IA 4JI3Q 5FKAC 1LM0A 2K03A 5IOCA 2IX1A 3URYA 2L12A 2WAQG 3NENA 1AP0A 5IYBG 5HGTA 1CKOA 4C3IH 3I4LA 2UUBL 1TS4A 5C4ZA 1I94Q 4KY7A 3DWAA 3DWPA 5IE8A 4Y52H 1IBKL 3S1QH 4DXGA 1B44D 2R7DA 3VA5A 2X6GA 2F0HA 1STEA 3L7ZC 4Y7NB 3VYUA 1TWFB 1X3QA 3B6YA 4KJOA 1H9RA 1EL0A 3QB3A 4DV7Q 3OSOA 1PH1A 4KJNA 3S17H 3IKJA 1CHQD 4FF4A 4BBRG 4FP5D 5M9OA 4K6LA 5J1ZA 4IFDI 3E9HA 5CGKA 1G2TA 3RZOB 2EY2A 1H95A 1X65A 2XWJB 4KN7C 1EWHA 5EJWA 3K5NA 1N32L 4QUCA 1TIID 1OXTA 4BS9A 1EQQA 5KIXA 3T1YL 1EYCA 2D9UA 2WB1B 1QUQA 1PMRA 1EIFA 1PH7A 3AEVA 5FLMH 1H9SA 4LWCA 1JE4A 1GKHA 1EFWA 4A3DH 1D6EC 4QF4A 2A68C 3OW2A 2UXBQ 3I4MG 1YEZA 4ZRZA 1S5ED 1V1PA 4X3KA 4CKBA 1FL0A 3GTKH 5GADC 3A0JA 3DXJC 1YNNC 3STBC 4GNXA 2ZJQA 3DEOA 5GROA 3TP7A 3W2DA 2RBMA 1JC7A 1DCZA 4JI0Q 4EQOA 1I50H 1LTGD 5COYA 4X65Q 2UXCQ 1XPUA 1TT2A 2NTSA 4U673 4KN4C 4HJ8A 2QKIC 2F0SA 4CJ0B 1NBWA 3W1BA 2UUCL 4DU9A 2R7ZH 1ILQA 5JJZA 1E1OA 1S3OA 2HT1A 4DAYA 3TZUA 1EOTA 2JA9A 2B2UA 2F0OA 4OEMB 5GQOA 4ZLTF 3G7LA 1STHA 4LUVA 2BA0A 3GP7A 1W2BA 1WTVA 1KC8C 3AYHB 4O1NA 5CV6A 1S72A 1DOMA 2F1MA 2OCEA 2RKSA 4UP9A 1SMXA 5IGGA 4C1NK 4JOIC 2OF1A 1IBLQ 1CQFA 4R1JA 1VQOA 3A74A 1O7LA 5IYDG 3OIQA 1TU2B 4L5RC 1I5FA 4IFDH 3H0GH 5C4JH 3CQZH 3RZOH 2KHJA 1SDFA 1E24A 2QILA 4UPAA 1CZWA 2B2TC 2A5HA 2R92G 3EQLC 2E2JH 1B3AA 1SFOH 1SMYC 4DR1Q 4LF5L 2B2VA 3PUYA 4GS3A 2A6ED 3HKSA 3I73A 1GUSA 1QUQB 2F0QA 5JVH3 1IKLA 1RDPD 3LX0A 3M3YH 1LT4D 3OMCA 2R93G 3ZYYX 1VCIA 1VF5C 1YIJA 4EQ5A 3IL8A 4A3EB 1EZ6A 4DNTB 3QWNA 1GUOA 1PTOD 2B63G 2XSCA 2PZTA 5E7NA 2B2WC 3F2CA 5EKIA 3OHXC 3RLFA 2K1BA 2PQAA 5CMDA 1I50B 3FMCA 4BXXH 4LF8Q 1YJ9A 1Q90A 1F2ZA 4JI4L 4I65A 1RD9D 1B1ZA 4HMIA 4IUUA 2EYOA 3CMAA 3K59A 3M4OB 3KF8A 4DK6C 3GTKB 2XIWA 3GTQH 2IL8A 2VXWA 4FO2A 4P73A 1VQKA 4HEDA 3T51B 3TN2A 4C3HB 4RHRA 1LTRD 1F2YA 1DOKA 1VQGA 5D65A 4DFAA 2ALYB 1GJXA 1I3QH 1Q3LA 1V1PB 5IGDA 3S1MB 4LMQD 3RMHA 1PH5A 3GTJB 2O4XA 3IFTA 3M4QA 3NPPA 4G7HC 2A6HC 1EY4A 4JI0L 1V43A 3KK7A 5T1IA 5GAHC 5DM73 4JK1C 4K14A 1PRTF 3FHWA 2F4IA 1T5XD 1E2ZA 5C0XG 2Q2TA 1UNSA 1XMQQ 1HZ9A 2R92B 2AQ3B 1QCBD 1TWCH 3K58A 5L37A 4F87A 4K6DA 2CH4A 4A3EG 3J7ZC 2PO4A 5J3BA 1TVXA 1MJCA 4LAAA 4B9XA 1ICWA 5G3LF 2AMCB 3BZCA 1VS0A 2E5LL 5EQ0A 3L9AX 4B3RQ 3I4NH 4HJ9A 2SNMA 1NUCA 4LNQA 5EKKA 3U9OA 2VUMG 2ICIA 1Z7TA 4E6IA 3S1RB 1YNJD 1A3UA 1AZPA 3MEHA 2JA6H 4WRDA 5ELOA 2ZM6Q 1HQMC 2YTVA 4QMGA 4R4CA 1RL2A 2R92H 2NVQB 4GN5A 2IJ0A 1WI5A 1J8IA 3M7NA 1D2BA 1BO0A 3U4ZA 2HD3A 3D4RA 3RZDH 2VNUD 2VW9A 4A3BB 3L3OC 3L0OA 5A35A 2MGSA 1Z9FA 4KD4A 3I7FA 4DV6L 3BDOA 2BE5C 3OIPA 3S1QB 3CPFA 5IODA 4L5TA 4DV5Q 1BCPF 4MNOA 3PIO3 5CV4A 3GTMH 1K8MA 1YVCA 3HOZB 1U0LA 4NXNQ 1TQOA 1XTDA 1KQSA 4YIJA 4MHEA 1Q81C 2L4NA 3L2PA 1ET6A 4Q0FA 5CV8A 1KRSA 2KCNA 3TZDA 4X6AH 4G7ZC 1VDZA 1AE2A 4LK1C 3R8BA 4PMWA 3VA7A 3A8JE 3OMGA 1WYDA 3FP9A 1A62A 3VR5A 1WTXA 2F4VQ 4PZ8A 4WJWA 3C2PA 2NVXH 1Q1BA 2N3SA 2F0EA 3T13A 3T1HL 1KDCA 4LF8L 4PZ7A 4H0LC 1NSNS 3M4PA 2HQEA 3FPPA 1NR2A 1PZKD 1EQVA 2FXQA 3A8KE 1PYSB 2Q8IB 4K2LA 4YCUA 5FLMG 4IUPA 2NUCA 2K5HA 2ZTEA 4R8IA 3PF5A 2ZJPA 3S1NB 3LNNA 1N33Q 4JCVE 3G6JB 1XPRA 2CKZB 3GTPH 2V1CC 1YBYA 2IWHA 1GUTA 2O5JC 1QNUA 2OEOA 1Z47A 3VDYA 4GKKL 1EU4A 1UWVA 5LMUQ 3CP0A 2DN8A 3E3XA 2F0MA 4OWWB 3KBXA 5C4XB 4WJ4A 1HUMA 4BY1H 3HOYG 1Q1EA 3GTGB 1EY0A 3RD4A 1HNWL 4ZYSA 4B3TQ 1NR4A 2A19A 2NVYH 3HOZG 1N36Q 5D14A 4PG3A 1A15A 3A7AB 1VQFA 2EYPA 5EPJA 5EPKA 1SYBA 3EIVA 1MKHA 3EFXD 1SNDA 4OX9L 2QCPX 3TEHB 3S2HH 3J80c 1ENFA 4JI7L 4H13C 3WOEA 1Y1VB 1XPOA 1JWMD 1EIHA 3DMUA 5C0XI 5JJIA 5J39A 2YV5A 3UDIA 4NXML 1BKBA 5M5XB 1H9JA 1BBXC 1K3RA 1FNUA 1SROA 1U4PA 2K6AA 1QVFA 4HIMA 1M8AA 1JOQA 3HOVH 3I55A 3TRZA 3NK9A 1JOKA 3KLSA 4JOIA 1PFNA 1EYDA 4JW0A 3S2HB 4DV7L 3CKIB 4A3CH 4WFN3 1EUJA 4RA8A 4KY6A 1SXTA 3W3AA 1B9MA 4MTNA 3HOXH 1PZJD 4O0AA 5FJ8G 4CDEC 2RSOA 4Q5VA 1STBA 4APVA 5CBAE 2F0TA 2WAQE 3EVQA 3SXHA 5C0XH 3RLNA 2E2DC 2NN6H 1IBLL 1LV9A 2R61A 1JWSD 1H9MA 2RCFA 4N8FA 5JJLA 2EJGC 1PV4A 1PHJA 1XX8A 3MFYA 3CC7A 3SEBA 1M90C 2F0LA 3NBHB 2N55A 3J7A5 3QO2A 5IWAQ 4FF3A 2PI2E 4KY5A 3N6RA 1LACA 1AW7A 3C1FA 3CCVA 3S2DH 1F2MA 4LFAL 2OWOA 2JA8H 4A75A 1CQVA 2KA7A 5I2XA 4A3MH 4RGMA 5IP9G 1H9SB 3T4AC 2CWAA 5H1SE 3NHHA 3MXNB 1WVLA 2F0NA 4A3IG 2D62A 1A0IA 3GV3A 3JAML 4ALPA 4ID6A 1NY4A 4OIJA 2RHQB 4P72A 3SR1A 4PMBA 4FNFA 1K28A 2VL6A 4BXXG 2WIIB 2EJFC 2E2IB 5C44G 1K8GA 1K3BC 4A3BH 1L1OC 1LTTD 3BVGA 4RKBA 4P75A 1PTOB 2GA4B 1AH9A 4F88A 5IGFA 2CW0C 2C5CA 4OX9Q 1HNXL 1JJGA 1A6XA 1U9RA 1MSHA 1PDQA 2JK8A 2NVQH 4RFBA 1F77A 2FHTA 2DY7A 4R4QA 2AQ1B 2G9DA 1LTBD 1VQDA 1STYA 1GXDC 3G48A 4A93B 4OELB 3RN5A 5E4XA 3BZDB 4HR7B 3J81i 3CU7A 2BOSA 1OXSC 2BDNA 4QB4A 5C5LA 1SYEA 2QEJC 5JEAJ 4AYBG 2R93B 5IT9L 1E7ZA 2Z8LA 1X32A 4A3FH 1JB7A 4ULLA 4DK3C 1SJHD 3IFDA 5LMNL 1CT1D 1PYWD 2GN5A 2IX0A 4J6HA 3SGIA 4EGVA 4JI2Q 5M3FG 1LO5D 1SR3A 3NWTA 3A7LA 4FXGC 5J22A 4KKUA
chains in the Genus database with same CATH topology
2MFIA 2OCEA 2Z0SA 4UP9A 2WFWA 4YHHQ 1SMXA 4JI4Q 4X66Q 1HZCA 5K36G 4JOIC 4HJ5A 1IBLQ 1IXRA 4R1JA 1OXXK 4B3SQ 1VQOA 1K73C 3A74A 5IYDG 1FJGQ 1PH2A 4L5RC 1I5FA 1SE8A 4LUZA 3H0GH 5C4JH 3CQZH 3RZOH 4JV5L 2KHJA 2K50A 1T9HA 5AJ3L 1E24A 3PUWA 1X3GA 2MNAA 4UPAA 4LFCL 1Q12A 3ERSX 4DV3L 2R92G 2E2JH 3HOYH 1SFOH 5IP7G 3A5UA 4DR1Q 1PH9A 4LFAQ 1NMGA 3CW2C 4LF5L 1VQNA 2HIVA 3PUYA 4GS3A 2B63H 1A8VA 4KI0A 3S1MH 4A3GH 3HKSA 4JBJA 1SRUA 3S15H 1QUQB 1EYGA 4LFBQ 1FJGL 2UXDQ 4DUZQ 2R93H 3HOVG 2ZTCA 3M3YH 2R93G 4GNXC 2CQOA 4OWXB 2ATWA 1VCIA 2OTLA 1OTCA 1YIJA 3HKZE 4EQ5A 2VQFL 2YU9H 2XTIA 4LFCQ 4A3GG 2B63G 5E7NA 4LW1A 2JA6G 1VQPA 3F2CA 4GKJQ 4OO1G 2JE6I 3F2DA 3RLFA 2PQAA 4YHHL 3JAMi 3JAMc 4GNXB 3AQQA 5LMUL 4DNIA 2K75A 2ASBA 4BXXH 4AH6A 3AFQA 4GN3B 4DAYB 1YJ9A 4LF8Q 4JI4L 2E8GA 1QVCA 3ULPA 2AWNA 1V9PA 1N8RC 1IZ6A 1D8LA 2VQFQ 4C3HH 4KHPQ 3CMAA 3W5OA 3BJUA 4A3KH 2B29A 4DK6C 3GTQH 2GVAA 4FDBA 1PA6A 3PF4A 4P73A 3H15A 3RNUA 1VQKA 2ZJRA 2UXBL 3K0XA 1PH4A 3CXCA 4JBKA 1VQ5A 1Q86C 2PMZE 3KJPA 4JI6Q 2JEAI 3KDFA 3CC2A 2JJQA 1XMOL 1BBUA 1VQGA 4GLVB 4B3RL 1C0AA 1CSPA 4KLKA 2IT1A 5M3MG 2ALYB 1I3QH 4XTCS 5EAYA 2LSSA 3RN2A 1PH5A 3G6EA 1VQ4A 1HZAA 4IJHA 1TWGH 4DV0L 3M4QA 1PYBA 4HJ7A 2R7ZG 1GVPA 5M3MH 4X65L 4POFA 5IYCG 2UXCL 4JI0L 1V43A 4HIDA 2MO0A 2Z6KC 1CUKA 4JBWA 5GAHC 5C4XH 2EQSA 1BVSA 3TQYA 4DR7Q 1VQ7A 1SLJA 1D7QA 4DR6L 3PGZA 1GD7A 4EX5A 3FHWA 3D31A 4JI3L 3I56A 4A3LH 1UEBA 2C35B 4A3KG 1YITA 2B3GA 4TQUS 4JI8L 1B7YB 1LTLA 1UE6A 5C0XG 3KDFB 4PZ6A 2Q2TA 1WJJA 1XMQQ 4H02A 1I94L 1HZ9A 3U50C 1VQ9A 4QJFA 4NB3A 2NN6I 3UE0A 1TWCH 2GVBA 1Q7YC 1MJEA 1V1QA 4GKKQ 4UP8A 1PH8A 4HJAA 4HIOA 4KHPL 1Y1WG 4JI2L 4LF4L 4A3EG 3J7ZC 3I4MH 4GLXA 5J3BA 3M9BA 1MJCA 1XMOQ 4IOCA 2QGQA 3PUXA 2ZM6L 4DV1Q 2AMCB 1ASZA 2KCTA 2MO1A 4X64L 1B8AA 1L1OB 3PV0A 4K0KQ 4R4TA 3BZCA 4GOPC 1E22A 1VS0A 1NE3A 2E5LL 1HNWQ 3E0EA 4B3RQ 3I4NH 2RF4A 3K7UC 4QIWE 4HJ9A 1K9MC 1L0WA 4DV4L 4NPSA 3K7AH 5C44H 4LNQA 1ASYA 3PUVA 2VUMG 3ZJYC 4LF6L 4QY7A 2OQKA 4ME3A 2RCNA 4A3DG 5HGQA 1C7YA 5AJ3Q 4HIKA 3I4NG 1G291 2JA6H 1X3FA 2K14A 3IRBA 2K5NA 5ELOA 3GD7A 2ZM6Q 4DV1L 2YTVA 4R4CA 5IP7H 3OTOL 4LF5Q 4MZ9A 4DR6Q 2N8NA 4RMFA 1RL2A 4DR1L 2R92H 3H3VI 3OYYA 4GN5A 4A3EH 3A5ZB 1WI5A 4DR5L 4X62Q 4DR3Q 1QZGA 5M5YH 4L5SA 3M4OH 4R4IA 3PSIA 4DV4Q 3UDGA 3M7NA 5JJLA 3KFUA 1JJCB 2KHIA 1FVIA 3U4ZA 1KXLA 4A3JG 2BH8A 3RZDH 2UU9Q 1O7IA 2VNUD 4BY1G 2VW9A 2ZTDA 1J5EQ 4JI5Q 1DGSA 1WFQA 2HIXA 3L0OA 1YHQA 1HR0Q 2ES2A 1Q8KA 1Z9FA 2LXKA 1K83H 3I7FA 5BR8L 2DGYA 4DV6L 3KF6A 1NJIC 1FGUA 3CD6A 4AQYL 3CPFA 5M3FH 3JC66 1EWIA 4L5TA 1HJPA 4DV5Q 1EQRA 4LF7Q 4DV3Q 5LMNW 1HNXQ 4MNOA 4LUOA 4B3ML 3EN2A 4QGUA 3GTMH 1VQIA 2JQOA 4C2MH 1HZBA 1LUZA 1YVCA 2VS1A 4C3JH 2JA8G 2F4VL 4R4OA 1GM5A 4O2DA 1CKNB 1U0LA 2YTXA 1JE5A 1BBWA 4NXNQ 2N49A 4JI5L 1XTDA 5FLXc 3J81c 4GOPA 1KIXA 1KQSA 3FKIH 1Q81C 2VY3A 3PCOB 1JMCA 3L2PA 3CC4A 2VUMH 1KRSA 2PNHA 4IPDA 2VQEL 4X6AH 3HOWG 3ULLA 1XJVA 4A3FG 2RHSB 4YCVA 1X56A 1AE2A 4GLAC 4DR4Q 3CCLA 5FJ8H 3KYHC 4PMWA 5IYBH 3HOXG 5JJKA 1WYDA 2AKWB 1A62A 3FP9A 2F4VQ 2XGTA 4PZ8A 2I0QA 4IPCA 2NVXH 1Q1BA 2N3SA 4X62L 1UE5A 4JBMA 3T1HL 4LF8L 4BA2I 4PZ7A 4GOPB 2UUBQ 3S14H 3M4PA 1L2FA 4JC0A 2F52A 4DAMA 4WJ3M 5BR8Q 4DV6Q 4OWTB 2Q2UA 2FXQA 4LFBL 1J6QA 4XIGS 1PFSA 1PYSB 4BA1I 1VQBA 4A3CG 4YCWA 3MEFA 4YCUA 5FLMG 4A3LG 2K5HA 2ZTEA 2E2HH 4JI8Q 3PF5A 2ZJPA 2D0OA 4AYBE 1N33Q 2A8VA 4JI1Q 5DLQE 1KHIA 2EXDA 3DLLA 4JCVE 3CF5A 4B3SL 1XPRA 2VZAA 2CKZB 1Y1VH 4NXNL 1OXVA 2V1CC 2UUAL 1EOVA 1WCMH 4Y7NH 2NVTH 3GTPH 1YBYA 1Q82C 1Z47A 3VDYA 4GKKL 1YNXA 1QVGA 1N36L 3PIOA 4LF9Q 4BY7G 1UWVA 5LMUQ 4J15A 3CP0A 3PIPA 3FKIG 4OWWB 2E2IH 3E9IA 1OXUA 1IL2A 1YHBA 4DUYL 3PO2G 4A3BG 4WJ4A 3WWVA 2NZHA 4BY1H 1XNQQ 1Q1EA 4P74A 1PH3A 1P16A 3HOYG 1HNWL 5C3EH 2VQEQ 1MIUA 3I4OA 3H3VH 2KENA 4OXPA 3CMEA 1NTGA 2IY5B 4YWMA 5C0XJ 3KOJA 4B3TQ 2A19A 4LF6Q 3K80C 1AE3A 2NVYH 3F1ZA 4X66L 4DV2L 3F2BA 1N36Q 5GAGC 3HOZG 4PG3A 3PO3G 3T1YQ 4L5QA 2BH2A 3RLOA 5C3EG 1VQFA 1PVOA 4A93G 3EIVA 2UUCQ 4JV5Q 4A3JH 3S1RH 3PO3H 4GKJL 1MKHA 1RIPA 3UDFA 2ID0A 4YWKA 3CAMA 4TVAB 4OX9L 3GTLH 4JYAQ 3TEHB 4A3MG 3S2HH 4UP7A 4JI1L 3UDXA 2Q2IA 3J80c 2HHHQ 3LGJA 4JI7L 4B3TL 2JA5H 2OTJA 1VQEA 1C9OA 4X64Q 1XPOA 2UUAQ 3M85A 2K5VA 4DR2L 4UY8C 5C0XI 1TWAH 2UU9L 1N33L 4IFDJ 3S1NH 1IBKQ 5JJIA 2YV5A 5IWAL 3UDIA 1U5KA 1HNZQ 4NXML 1BKBA 4IOAA 2NN6G 4DR7L 1KL9A 4JG2A 4OO1I 4DKAC 1K3RA 2DUDA 1CKMA 1TWFH 1X54A 1E1TA 1Y14B 1L1OA 1SROA 1E3PA 1QVFA 3J81j 4HIMA 3PUZA 4DV5L 3HOVH 3I55A 1SN8A 3TRZA 1YJNA 2L15A 1Y1VG 4JI7Q 1VQHA 2KCMA 1KD1C 3OTOQ 4IO9A 4JOIA 2WB1G 1UE1A 3GTOH 1TXYA 4RG1A 2QEXA 3BU2A 4DV7L 2H5XA 4A3CH 5M5XH 4BBSH 1EUJA 4DR3L 3CCJA 4A76A 4DR5Q 1VQJA 2Y0SE 1P8LA 4MTNA 5GAEC 3HOXH 1IBMQ 1Y1WH 1VQ6A 4O0AA 3TS0A 5FJ8G 3HOUH 4DV2Q 1K0RA 1CKNA 2N78A 4KHZA 2E5LQ 4APVA 4IFDG 4YY3L 4GN4B 5IYDH 1I6HH 1J5EL 2WAQE 2UXDL 3ER0A 2K4KA 2PQAB 4BBSG 3RLNA 1VQMA 3GDEA 1GO3E 2HQLA 3F8TA 4A4IA 4JI3Q 1LM0A 2IX1A 4DR2Q 1IBLL 1WOCA 2WAQG 3EBEA 3NENA 5IYBG 3CCEA 3CCQA 1S40A 3T1HQ 2CCZA 3CCRA 2IHEA 5HY6A 2KBNA 3D0FA 4POGA 1CKOA 1X9NA 4B3MQ 4C3IH 1PV4A 1XMQL 1PHJA 2UUBL 3HOWH 3KJOA 1B70B 3K8AA 3CC7A 1I94Q 2JA5G 1M90C 3K81C 1VQCA 5IE8A 3NBHB 4Y52H 2OQ0A 4AIMA 1IBKL 3S1QH 1JT8A 4IJLA 2Y0SG 4YY3Q 5IWAQ 3J7A5 3UE1A 3G4SA 2PI2E 3NELA 2R7DA 2D0PA 5IY0A 3L7ZC 1M1KC 2WB1E 2I5MX 4K0KL 3B6YA 1NMFA 3U58A 1Q46A 3CCVA 1QZHA 3S2DH 2QA4A 1G6PA 3BZKA 4LFAL 2OWOA 2JA8H 3CPWA 4A75A 4DV7Q 1X3EA 3J80i 5JEAG 1PH1A 3S17H 5C4XG 4DUZL 3HKZG 4BBRG 5M5WH 1YZ6A 4A3MH 1IBML 5IP9G 4BBRH 4DPGA 2CWAA 5H1SE 2A1AA 3AFPA 3W1GA 1PH6A 4LF9L 4IFDI 3E9HA 3MXNB 2YYZA 3G71A 1K8AC 1JJ2A 4A93H 4A3IG 1YHAA 2D62A 1A0IA 3CCMA 4IPHA 4ALPA 1NY4A 4P72A 2RHQB 1XNQL 1XNRQ 1H95A 4YWLA 1LYLA 3HOZH 1X65A 4BY7H 2CFMA 2VL6A 4DV0Q 2JEBI 4BXXG 3RR5A 3S16H 1N32L 5ELNA 3TREA 1W3SA 5C44G 1K8GA 2I5HA 1G51A 1OXTA 1VQ8A 1EQQA 3T1YL 5LMNQ 2LXJA 1QUQA 3ULJA 1IYJB 3TS2A 1HH2P 3PO2H 4A3BH 1EIFA 1KAWA 1L1OC 2CWPA 1PH7A 1HR0L 3STBD 5FLMH 3AEVA 4LWCA 4P75A 1GKHA 1EFWA 2Z6KA 4A3DH 1AH9A 2PI2A 3OW2A 3I4MG 1YEZA 4JYAL 2UXBQ 2R7FA 1N34L 3HFZB 4LF7L 3KF6B 4OX9Q 1WCMG 1HNXL 4JI6L 2BA1A 1FL0A 3GTKH 5GADC 1JJGA 4DUYQ 3H0GG 3A0JA 3HOUG 1YI2A 4OONA 2JK8A 3STBC 4GNXA 1HR0W 2ZJQA 4NXMQ 2NVQH 5GROA 4A3IH 1TWHH 2EIFA 4P71A 4JI0Q 4QL5A 1I50H 4X65Q 3Q8DA 4R4QA 3GTGH 3S24A 5IP9H 1XPUA 2UXCQ 1UE7A 1VQDA 3G48A 3KF8B 4HJ8A 2R6GA 3CCUA 4IPGA 3RN5A 2F3IA 3ICEA 1EIYB 1KRTA 5IYCH 1NBWA 3W1BA 4DR4L 3J81i 2UUCL 2JA7H 2YTYA 1XNRL 2R7ZH 3KLWA 1N32Q 2MQHA 1A63A 2WP8J 1OXSC 1YJWA 2NZOA 3GTJH 3I2ZA 4AQYQ 1E1OA 1S3OA 2HT1A 3DM3A 5JEAJ 2AHOB 1X55A 2JA9A 5GQOA 2Q2HA 4AYBG 2HHHL 1E7ZA 4LUVA 3GO5A 3U4VA 1VQLA 4A3FH 2JA7G 1JB7A 1CSQA 4DK3C 2I5LX 5LMNL 3NEMA 2BA0A 2IX0A 2GN5A 2IHFA 3SGIA 4JI2Q 1X6OA 4LF4Q 2K52A 1W2BA 5M3FG 1KC8C 1HNZL 4QQBX 1R9TH 1VQAA 5IT9c 3CCSA 1N34Q 1SR3A 1N9WA 3AYHB 1S72A 2AWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MFI A;  2OCE A;  2Z0S A;  4UP9 A;  2WFW A;  4YHH Q;  1SMX A;  4JI4 Q;  4X66 Q;  1HZC A;  5K36 G;  4JOI C;  4HJ5 A;  1IBL Q;  1IXR A;  4R1J A;  1OXX K;  4B3S Q;  1VQO A;  1K73 C;  3A74 A;  5IYD G;  1FJG Q;  1PH2 A;  4L5R C;  1I5F A;  1SE8 A;  4LUZ A;  3H0G H;  5C4J H;  3CQZ H;  3RZO H;  4JV5 L;  2KHJ A;  2K50 A;  1T9H A;  5AJ3 L;  1E24 A;  3PUW A;  1X3G A;  2MNA A;  4UPA A;  4LFC L;  1Q12 A;  3ERS X;  4DV3 L;  2R92 G;  2E2J H;  3HOY H;  1SFO H;  5IP7 G;  3A5U A;  4DR1 Q;  1PH9 A;  4LFA Q;  1NMG A;  3CW2 C;  4LF5 L;  1VQN A;  2HIV A;  3PUY A;  4GS3 A;  2B63 H;  1A8V A;  4KI0 A;  3S1M H;  4A3G H;  3HKS A;  4JBJ A;  1SRU A;  3S15 H;  1QUQ B;  1EYG A;  4LFB Q;  1FJG L;  2UXD Q;  4DUZ Q;  2R93 H;  3HOV G;  2ZTC A;  3M3Y H;  2R93 G;  4GNX C;  2CQO A;  4OWX B;  2ATW A;  1VCI A;  2OTL A;  1OTC A;  1YIJ A;  3HKZ E;  4EQ5 A;  2VQF L;  2YU9 H;  2XTI A;  4LFC Q;  4A3G G;  2B63 G;  5E7N A;  4LW1 A;  2JA6 G;  1VQP A;  3F2C A;  4GKJ Q;  4OO1 G;  2JE6 I;  3F2D A;  3RLF A;  2PQA A;  4YHH L;  3JAM i;  3JAM c;  4GNX B;  3AQQ A;  5LMU L;  4DNI A;  2K75 A;  2ASB A;  4BXX H;  4AH6 A;  3AFQ A;  4GN3 B;  4DAY B;  1YJ9 A;  4LF8 Q;  4JI4 L;  2E8G A;  1QVC A;  3ULP A;  2AWN A;  1V9P A;  1N8R C;  1IZ6 A;  1D8L A;  2VQF Q;  4C3H H;  4KHP Q;  3CMA A;  3W5O A;  3BJU A;  4A3K H;  2B29 A;  4DK6 C;  3GTQ H;  2GVA A;  4FDB A;  1PA6 A;  3PF4 A;  4P73 A;  3H15 A;  3RNU A;  1VQK A;  2ZJR A;  2UXB L;  3K0X A;  1PH4 A;  3CXC A;  4JBK A;  1VQ5 A;  1Q86 C;  2PMZ E;  3KJP A;  4JI6 Q;  2JEA I;  3KDF A;  3CC2 A;  2JJQ A;  1XMO L;  1BBU A;  1VQG A;  4GLV B;  4B3R L;  1C0A A;  1CSP A;  4KLK A;  2IT1 A;  5M3M G;  2ALY B;  1I3Q H;  4XTC S;  5EAY A;  2LSS A;  3RN2 A;  1PH5 A;  3G6E A;  1VQ4 A;  1HZA A;  4IJH A;  1TWG H;  4DV0 L;  3M4Q A;  1PYB A;  4HJ7 A;  2R7Z G;  1GVP A;  5M3M H;  4X65 L;  4POF A;  5IYC G;  2UXC L;  4JI0 L;  1V43 A;  4HID A;  2MO0 A;  2Z6K C;  1CUK A;  4JBW A;  5GAH C;  5C4X H;  2EQS A;  1BVS A;  3TQY A;  4DR7 Q;  1VQ7 A;  1SLJ A;  1D7Q A;  4DR6 L;  3PGZ A;  1GD7 A;  4EX5 A;  3FHW A;  3D31 A;  4JI3 L;  3I56 A;  4A3L H;  1UEB A;  2C35 B;  4A3K G;  1YIT A;  2B3G A;  4TQU S;  4JI8 L;  1B7Y B;  1LTL A;  1UE6 A;  5C0X G;  3KDF B;  4PZ6 A;  2Q2T A;  1WJJ A;  1XMQ Q;  4H02 A;  1I94 L;  1HZ9 A;  3U50 C;  1VQ9 A;  4QJF A;  4NB3 A;  2NN6 I;  3UE0 A;  1TWC H;  2GVB A;  1Q7Y C;  1MJE A;  1V1Q A;  4GKK Q;  4UP8 A;  1PH8 A;  4HJA A;  4HIO A;  4KHP L;  1Y1W G;  4JI2 L;  4LF4 L;  4A3E G;  3J7Z C;  3I4M H;  4GLX A;  5J3B A;  3M9B A;  1MJC A;  1XMO Q;  4IOC A;  2QGQ A;  3PUX A;  2ZM6 L;  4DV1 Q;  2AMC B;  1ASZ A;  2KCT A;  2MO1 A;  4X64 L;  1B8A A;  1L1O B;  3PV0 A;  4K0K Q;  4R4T A;  3BZC A;  4GOP C;  1E22 A;  1VS0 A;  1NE3 A;  2E5L L;  1HNW Q;  3E0E A;  4B3R Q;  3I4N H;  2RF4 A;  3K7U C;  4QIW E;  4HJ9 A;  1K9M C;  1L0W A;  4DV4 L;  4NPS A;  3K7A H;  5C44 H;  4LNQ A;  1ASY A;  3PUV A;  2VUM G;  3ZJY C;  4LF6 L;  4QY7 A;  2OQK A;  4ME3 A;  2RCN A;  4A3D G;  5HGQ A;  1C7Y A;  5AJ3 Q;  4HIK A;  3I4N G;  1G29 1;  2JA6 H;  1X3F A;  2K14 A;  3IRB A;  2K5N A;  5ELO A;  3GD7 A;  2ZM6 Q;  4DV1 L;  2YTV A;  4R4C A;  5IP7 H;  3OTO L;  4LF5 Q;  4MZ9 A;  4DR6 Q;  2N8N A;  4RMF A;  1RL2 A;  4DR1 L;  2R92 H;  3H3V I;  3OYY A;  4GN5 A;  4A3E H;  3A5Z B;  1WI5 A;  4DR5 L;  4X62 Q;  4DR3 Q;  1QZG A;  5M5Y H;  4L5S A;  3M4O H;  4R4I A;  3PSI A;  4DV4 Q;  3UDG A;  3M7N A;  5JJL A;  3KFU A;  1JJC B;  2KHI A;  1FVI A;  3U4Z A;  1KXL A;  4A3J G;  2BH8 A;  3RZD H;  2UU9 Q;  1O7I A;  2VNU D;  4BY1 G;  2VW9 A;  2ZTD A;  1J5E Q;  4JI5 Q;  1DGS A;  1WFQ A;  2HIX A;  3L0O A;  1YHQ A;  1HR0 Q;  2ES2 A;  1Q8K A;  1Z9F A;  2LXK A;  1K83 H;  3I7F A;  5BR8 L;  2DGY A;  4DV6 L;  3KF6 A;  1NJI C;  1FGU A;  3CD6 A;  4AQY L;  3CPF A;  5M3F H;  3JC6 6;  1EWI A;  4L5T A;  1HJP A;  4DV5 Q;  1EQR A;  4LF7 Q;  4DV3 Q;  5LMN W;  1HNX Q;  4MNO A;  4LUO A;  4B3M L;  3EN2 A;  4QGU A;  3GTM H;  1VQI A;  2JQO A;  4C2M H;  1HZB A;  1LUZ A;  1YVC A;  2VS1 A;  4C3J H;  2JA8 G;  2F4V L;  4R4O A;  1GM5 A;  4O2D A;  1CKN B;  1U0L A;  2YTX A;  1JE5 A;  1BBW A;  4NXN Q;  2N49 A;  4JI5 L;  1XTD A;  5FLX c;  3J81 c;  4GOP A;  1KIX A;  1KQS A;  3FKI H;  1Q81 C;  2VY3 A;  3PCO B;  1JMC A;  3L2P A;  3CC4 A;  2VUM H;  1KRS A;  2PNH A;  4IPD A;  2VQE L;  4X6A H;  3HOW G;  3ULL A;  1XJV A;  4A3F G;  2RHS B;  4YCV A;  1X56 A;  1AE2 A;  4GLA C;  4DR4 Q;  3CCL A;  5FJ8 H;  3KYH C;  4PMW A;  5IYB H;  3HOX G;  5JJK A;  1WYD A;  2AKW B;  1A62 A;  3FP9 A;  2F4V Q;  2XGT A;  4PZ8 A;  2I0Q A;  4IPC A;  2NVX H;  1Q1B A;  2N3S A;  4X62 L;  1UE5 A;  4JBM A;  3T1H L;  4LF8 L;  4BA2 I;  4PZ7 A;  4GOP B;  2UUB Q;  3S14 H;  3M4P A;  1L2F A;  4JC0 A;  2F52 A;  4DAM A;  4WJ3 M;  5BR8 Q;  4DV6 Q;  4OWT B;  2Q2U A;  2FXQ A;  4LFB L;  1J6Q A;  4XIG S;  1PFS A;  1PYS B;  4BA1 I;  1VQB A;  4A3C G;  4YCW A;  3MEF A;  4YCU A;  5FLM G;  4A3L G;  2K5H A;  2ZTE A;  2E2H H;  4JI8 Q;  3PF5 A;  2ZJP A;  2D0O A;  4AYB E;  1N33 Q;  2A8V A;  4JI1 Q;  5DLQ E;  1KHI A;  2EXD A;  3DLL A;  4JCV E;  3CF5 A;  4B3S L;  1XPR A;  2VZA A;  2CKZ B;  1Y1V H;  4NXN L;  1OXV A;  2V1C C;  2UUA L;  1EOV A;  1WCM H;  4Y7N H;  2NVT H;  3GTP H;  1YBY A;  1Q82 C;  1Z47 A;  3VDY A;  4GKK L;  1YNX A;  1QVG A;  1N36 L;  3PIO A;  4LF9 Q;  4BY7 G;  1UWV A;  5LMU Q;  4J15 A;  3CP0 A;  3PIP A;  3FKI G;  4OWW B;  2E2I H;  3E9I A;  1OXU A;  1IL2 A;  1YHB A;  4DUY L;  3PO2 G;  4A3B G;  4WJ4 A;  3WWV A;  2NZH A;  4BY1 H;  1XNQ Q;  1Q1E A;  4P74 A;  1PH3 A;  1P16 A;  3HOY G;  1HNW L;  5C3E H;  2VQE Q;  1MIU A;  3I4O A;  3H3V H;  2KEN A;  4OXP A;  3CME A;  1NTG A;  2IY5 B;  4YWM A;  5C0X J;  3KOJ A;  4B3T Q;  2A19 A;  4LF6 Q;  3K80 C;  1AE3 A;  2NVY H;  3F1Z A;  4X66 L;  4DV2 L;  3F2B A;  1N36 Q;  5GAG C;  3HOZ G;  4PG3 A;  3PO3 G;  3T1Y Q;  4L5Q A;  2BH2 A;  3RLO A;  5C3E G;  1VQF A;  1PVO A;  4A93 G;  3EIV A;  2UUC Q;  4JV5 Q;  4A3J H;  3S1R H;  3PO3 H;  4GKJ L;  1MKH A;  1RIP A;  3UDF A;  2ID0 A;  4YWK A;  3CAM A;  4TVA B;  4OX9 L;  3GTL H;  4JYA Q;  3TEH B;  4A3M G;  3S2H H;  4UP7 A;  4JI1 L;  3UDX A;  2Q2I A;  3J80 c;  2HHH Q;  3LGJ A;  4JI7 L;  4B3T L;  2JA5 H;  2OTJ A;  1VQE A;  1C9O A;  4X64 Q;  1XPO A;  2UUA Q;  3M85 A;  2K5V A;  4DR2 L;  4UY8 C;  5C0X I;  1TWA H;  2UU9 L;  1N33 L;  4IFD J;  3S1N H;  1IBK Q;  5JJI A;  2YV5 A;  5IWA L;  3UDI A;  1U5K A;  1HNZ Q;  4NXM L;  1BKB A;  4IOA A;  2NN6 G;  4DR7 L;  1KL9 A;  4JG2 A;  4OO1 I;  4DKA C;  1K3R A;  2DUD A;  1CKM A;  1TWF H;  1X54 A;  1E1T A;  1Y14 B;  1L1O A;  1SRO A;  1E3P A;  1QVF A;  3J81 j;  4HIM A;  3PUZ A;  4DV5 L;  3HOV H;  3I55 A;  1SN8 A;  3TRZ A;  1YJN A;  2L15 A;  1Y1V G;  4JI7 Q;  1VQH A;  2KCM A;  1KD1 C;  3OTO Q;  4IO9 A;  4JOI A;  2WB1 G;  1UE1 A;  3GTO H;  1TXY A;  4RG1 A;  2QEX A;  3BU2 A;  4DV7 L;  2H5X A;  4A3C H;  5M5X H;  4BBS H;  1EUJ A;  4DR3 L;  3CCJ A;  4A76 A;  4DR5 Q;  1VQJ A;  2Y0S E;  1P8L A;  4MTN A;  5GAE C;  3HOX H;  1IBM Q;  1Y1W H;  1VQ6 A;  4O0A A;  3TS0 A;  5FJ8 G;  3HOU H;  4DV2 Q;  1K0R A;  1CKN A;  2N78 A;  4KHZ A;  2E5L Q;  4APV A;  4IFD G;  4YY3 L;  4GN4 B;  5IYD H;  1I6H H;  1J5E L;  2WAQ E;  2UXD L;  3ER0 A;  2K4K A;  2PQA B;  4BBS G;  3RLN A;  1VQM A;  3GDE A;  1GO3 E;  2HQL A;  3F8T A;  4A4I A;  4JI3 Q;  1LM0 A;  2IX1 A;  4DR2 Q;  1IBL L;  1WOC A;  2WAQ G;  3EBE A;  3NEN A;  5IYB G;  3CCE A;  3CCQ A;  1S40 A;  3T1H Q;  2CCZ A;  3CCR A;  2IHE A;  5HY6 A;  2KBN A;  3D0F A;  4POG A;  1CKO A;  1X9N A;  4B3M Q;  4C3I H;  1PV4 A;  1XMQ L;  1PHJ A;  2UUB L;  3HOW H;  3KJO A;  1B70 B;  3K8A A;  3CC7 A;  1I94 Q;  2JA5 G;  1M90 C;  3K81 C;  1VQC A;  5IE8 A;  3NBH B;  4Y52 H;  2OQ0 A;  4AIM A;  1IBK L;  3S1Q H;  1JT8 A;  4IJL A;  2Y0S G;  4YY3 Q;  5IWA Q;  3J7A 5;  3UE1 A;  3G4S A;  2PI2 E;  3NEL A;  2R7D A;  2D0P A;  5IY0 A;  3L7Z C;  1M1K C;  2WB1 E;  2I5M X;  4K0K L;  3B6Y A;  1NMF A;  3U58 A;  1Q46 A;  3CCV A;  1QZH A;  3S2D H;  2QA4 A;  1G6P A;  3BZK A;  4LFA L;  2OWO A;  2JA8 H;  3CPW A;  4A75 A;  4DV7 Q;  1X3E A;  3J80 i;  5JEA G;  1PH1 A;  3S17 H;  5C4X G;  4DUZ L;  3HKZ G;  4BBR G;  5M5W H;  1YZ6 A;  4A3M H;  1IBM L;  5IP9 G;  4BBR H;  4DPG A;  2CWA A;  5H1S E;  2A1A A;  3AFP A;  3W1G A;  1PH6 A;  4LF9 L;  4IFD I;  3E9H A;  3MXN B;  2YYZ A;  3G71 A;  1K8A C;  1JJ2 A;  4A93 H;  4A3I G;  1YHA A;  2D62 A;  1A0I A;  3CCM A;  4IPH A;  4ALP A;  1NY4 A;  4P72 A;  2RHQ B;  1XNQ L;  1XNR Q;  1H95 A;  4YWL A;  1LYL A;  3HOZ H;  1X65 A;  4BY7 H;  2CFM A;  2VL6 A;  4DV0 Q;  2JEB I;  4BXX G;  3RR5 A;  3S16 H;  1N32 L;  5ELN A;  3TRE A;  1W3S A;  5C44 G;  1K8G A;  2I5H A;  1G51 A;  1OXT A;  1VQ8 A;  1EQQ A;  3T1Y L;  5LMN Q;  2LXJ A;  1QUQ A;  3ULJ A;  1IYJ B;  3TS2 A;  1HH2 P;  3PO2 H;  4A3B H;  1EIF A;  1KAW A;  1L1O C;  2CWP A;  1PH7 A;  1HR0 L;  3STB D;  5FLM H;  3AEV A;  4LWC A;  4P75 A;  1GKH A;  1EFW A;  2Z6K A;  4A3D H;  1AH9 A;  2PI2 A;  3OW2 A;  3I4M G;  1YEZ A;  4JYA L;  2UXB Q;  2R7F A;  1N34 L;  3HFZ B;  4LF7 L;  3KF6 B;  4OX9 Q;  1WCM G;  1HNX L;  4JI6 L;  2BA1 A;  1FL0 A;  3GTK H;  5GAD C;  1JJG A;  4DUY Q;  3H0G G;  3A0J A;  3HOU G;  1YI2 A;  4OON A;  2JK8 A;  3STB C;  4GNX A;  1HR0 W;  2ZJQ A;  4NXM Q;  2NVQ H;  5GRO A;  4A3I H;  1TWH H;  2EIF A;  4P71 A;  4JI0 Q;  4QL5 A;  1I50 H;  4X65 Q;  3Q8D A;  4R4Q A;  3GTG H;  3S24 A;  5IP9 H;  1XPU A;  2UXC Q;  1UE7 A;  1VQD A;  3G48 A;  3KF8 B;  4HJ8 A;  2R6G A;  3CCU A;  4IPG A;  3RN5 A;  2F3I A;  3ICE A;  1EIY B;  1KRT A;  5IYC H;  1NBW A;  3W1B A;  4DR4 L;  3J81 i;  2UUC L;  2JA7 H;  2YTY A;  1XNR L;  2R7Z H;  3KLW A;  1N32 Q;  2MQH A;  1A63 A;  2WP8 J;  1OXS C;  1YJW A;  2NZO A;  3GTJ H;  3I2Z A;  4AQY Q;  1E1O A;  1S3O A;  2HT1 A;  3DM3 A;  5JEA J;  2AHO B;  1X55 A;  2JA9 A;  5GQO A;  2Q2H A;  4AYB G;  2HHH L;  1E7Z A;  4LUV A;  3GO5 A;  3U4V A;  1VQL A;  4A3F H;  2JA7 G;  1JB7 A;  1CSQ A;  4DK3 C;  2I5L X;  5LMN L;  3NEM A;  2BA0 A;  2IX0 A;  2GN5 A;  2IHF A;  3SGI A;  4JI2 Q;  1X6O A;  4LF4 Q;  2K52 A;  1W2B A;  5M3F G;  1KC8 C;  1HNZ L;  4QQB X;  1R9T H;  1VQA A;  5IT9 c;  3CCS A;  1N34 Q;  1SR3 A;  1N9W A;  3AYH B;  1S72 A;  2AWO A; 
#chains in the Genus database with same CATH topology
 4YHH Q;  1OXX K;  4B3S Q;  5KND A;  3VR2 A;  2RDH A;  4LUZ A;  3GTM B;  2SDF A;  2K50 A;  2JYO A;  3DEP A;  1DYQ A;  2PMZ B;  3VR6 A;  5COR A;  1Q12 A;  3HOY H;  5M5Y B;  5IP7 G;  4A3M B;  1VQN A;  1L0X B;  3S1M H;  2HIV A;  4A3G H;  1O78 A;  4CDC C;  2LY7 A;  3QG1 A;  4RWS C;  3QJY A;  1CZG A;  5ELB A;  4GNX C;  2PCF B;  4OWX B;  1WTW A;  3K6O A;  3HKZ E;  2Q8R E;  2XTI A;  4LFC Q;  1DZ1 A;  1Z6H A;  4GKJ Q;  2JE6 I;  1A2T A;  2ENB A;  2PZU A;  1DON A;  5LMU L;  2K75 A;  1EZ8 A;  2A6H D;  3P75 A;  1DD2 A;  3X3M A;  4DAY B;  4B08 A;  1KDB A;  3DWQ A;  3A56 A;  1ENC A;  3I91 A;  1YNN D;  4ZK9 B;  2AWN A;  1EY7 A;  1QE6 A;  1N8R C;  1D8L A;  3KLR A;  4L6T B;  5EGT A;  3D3R A;  5T1G A;  2VQF Q;  1EEI D;  3BJU A;  4AYB B;  3PF4 A;  3VR3 A;  3RNU A;  2IW3 A;  2UXB L;  5FLX E;  3VR4 A;  4JBK A;  3SE0 A;  4KHV A;  1SBB B;  5KYI A;  1K8O A;  5C3X A;  4IN3 A;  4XTC S;  4ABN A;  1FR3 A;  5FO8 B;  1HZA A;  3E0J A;  1RTN A;  4DV0 L;  4HJ7 A;  2SEB D;  2CVR A;  1XWE A;  1GVP A;  3H3V C;  5M3M H;  4KKT A;  5IYC G;  2K28 A;  4HID A;  3MXN A;  3NWS A;  3H09 A;  3K5O A;  5E1F A;  5FK9 C;  1GUG A;  1CUK A;  1MHW C;  3SK6 A;  4C3I G;  1HPC A;  2EQS A;  3TQY A;  2KQ3 A;  3PGZ A;  1GD7 A;  1RKN A;  2A69 C;  5AFW A;  4JI8 L;  3K57 A;  1B7Y B;  4MTK A;  2NYZ D;  1DJR D;  4PZ6 A;  1WJJ A;  2D2C C;  4M8A A;  2MPM A;  1Q7Y C;  1LT6 D;  3TBI B;  3NE5 B;  4BY7 B;  4KHP L;  4JI2 L;  3NBH A;  4GLX A;  3M9B A;  1T5E A;  1XMO Q;  5ELE A;  4IOC A;  2QGQ A;  3PUX A;  4DV1 Q;  4HMJ A;  2MO1 A;  4X64 L;  4GOP C;  2ZXP A;  3OOC A;  2RF4 A;  1LT3 D;  4QIW E;  4DV4 L;  2DJG C;  2RQX A;  1ASY A;  4ME3 A;  1XYI A;  2RCN A;  4A3J B;  1C7Y A;  5AJ3 Q;  3I4N G;  1G29 1;  4FF2 A;  1B4O A;  4K8J A;  4IUQ A;  1Y8O B;  4LF5 Q;  4MZ9 A;  4DR6 Q;  2N8N A;  2NVT B;  3SK4 A;  1TR5 A;  4A3E H;  3OWE B;  3GTQ B;  5M5Y H;  4CKE A;  3M4O H;  2EE1 A;  3J7A V;  3KFU A;  1II3 A;  1PZI D;  4A3D B;  1SNC A;  1PTO C;  3D4D A;  2F0K A;  1SJE D;  3TP5 A;  4BY1 G;  1J5E Q;  3PO2 B;  1HA6 A;  1JCK B;  2ES2 A;  1K83 H;  5BR8 L;  2DGY A;  1QOH A;  2FJ2 A;  3KF6 A;  3V05 A;  3K5M A;  3CD6 A;  2JA7 B;  4UDU C;  4AQY L;  3JC6 6;  5C3E B;  3SK5 A;  1HNX Q;  4KKS A;  2WKD A;  3NXW A;  4LUO A;  5EBD A;  4ZKC B;  5CBE E;  1WTO A;  1VQI A;  3V96 A;  2JQO A;  4C2M H;  1HZB A;  2JA8 G;  2E2H B;  4C3J H;  4R4O A;  4CHT B;  1GM5 A;  3I70 A;  4JI5 L;  4A3F B;  3S15 B;  1C4Q A;  3PQI A;  2VY3 A;  2EY5 A;  3X3N A;  4IPD A;  2RDG A;  4BWG B;  1ML0 D;  1KNE A;  3ULL A;  2H1E A;  1XJV A;  4YCV A;  1NNX A;  1X56 A;  4GLA C;  4DR4 Q;  4XDX A;  3MFG A;  3Q24 A;  3S16 B;  5JJK A;  3CQZ B;  2X6L A;  3AB9 A;  4X62 L;  2EZV A;  3VYS A;  4JBM A;  1ESF A;  4KV6 A;  1D1I A;  4GOP B;  2R7Z B;  1ET9 A;  2JA5 B;  2UUB Q;  1L2F A;  2F52 A;  5IT9 E;  5IGC A;  4WJ3 M;  4BY1 B;  2Q2U A;  3BDL A;  5C4H A;  4LFB L;  3MTS A;  4BA1 I;  4A3C G;  4YCW A;  2FMM A;  1J9O A;  4A3L G;  1S4Z A;  2D0O A;  1STA A;  4AYB E;  2F0P A;  2LMC B;  4K2K A;  3NTK A;  1EOV A;  1WCM H;  2QDB A;  1Q82 C;  1SNO A;  1V8Q A;  5BN5 A;  1RCV D;  1YNX A;  1N36 L;  1YNJ C;  3PIO A;  5ELC A;  1ILP A;  4J1M A;  1F2L A;  4BY7 G;  2K5D A;  3PO2 G;  3WWV A;  1PH3 A;  4P74 A;  1JOO A;  4DK0 A;  1CA5 A;  5C3E H;  2VQE Q;  1MIU A;  2E74 C;  3I4O A;  3BYY B;  3H91 A;  4GZY C;  4YWM A;  2AUJ D;  4HN7 A;  4IZ8 A;  2LFN A;  3NUC A;  1EIG A;  2NWG A;  3K80 C;  1AE3 A;  1V1O A;  3HG9 A;  5C3W A;  1R4P B;  4L5Q A;  5C3E G;  2HDM A;  1X3P A;  3JAM E;  4A93 G;  4DK1 A;  3S1R H;  4GKJ L;  1RIP A;  1STG A;  4QIW B;  1SYC A;  2F0W A;  3J7A F;  1I6H B;  1EY9 A;  3UDX A;  3GTP B;  4EQN A;  1C9O A;  4X64 Q;  2UUA Q;  2OTJ A;  2Z4H A;  5M5W B;  2L0C A;  1TWA H;  1SE4 A;  4IFD J;  1IBK Q;  5IWA L;  4N8X 1;  4IOA A;  1JB3 A;  4DR7 L;  1KL9 A;  4DKA C;  1VMC A;  4EVO A;  1TWF H;  1X54 A;  1Y14 B;  2V4D A;  3SK8 A;  1E3P A;  4KTA A;  3MWY W;  1PLF A;  1SN8 A;  1QWY A;  3OW7 A;  1YJN A;  2K04 A;  3R2I A;  1VQH A;  2K33 A;  3QOL A;  4DF7 A;  5DNF A;  5NUC A;  3J81 E;  3GTO H;  4BBR B;  3FRP B;  5JAV A;  2QEX A;  1BF4 A;  2H5X A;  5M5X H;  4BBS H;  4DR5 Q;  2Q8T A;  4JVZ A;  2Y0S E;  1P8L A;  5DAU A;  2XNA C;  4Z9C B;  1U4L A;  1Y1W H;  1PTO H;  1IW7 D;  4DV2 Q;  2F3V A;  1HUN A;  1K0R A;  1CKN A;  4KHZ A;  5HUR A;  3J81 L;  5LHY 1;  1O80 A;  4GN4 B;  2FMC A;  1J5E L;  1QNK A;  2PQA B;  4BBS G;  1RJT A;  1GO3 E;  3GDE A;  3F8T A;  1PTO F;  4DR2 Q;  1WOC A;  3EBE A;  2ZXR A;  4CJ2 C;  3CCE A;  1S40 A;  2CCZ A;  1WTH A;  2IHE A;  5FO9 B;  5KNC A;  5HY6 A;  3CCR A;  2KBN A;  1PRT C;  3D0F A;  4C3J G;  4POG A;  5M3M B;  4B3M Q;  2PNR C;  1XMQ L;  3KJO A;  1B70 B;  3K8A A;  2JA5 G;  1ZXT A;  1VQC A;  4G4K A;  5ELD A;  2VB2 X;  2M00 A;  4IJL A;  2Y0S G;  2B8F A;  4YY3 Q;  3UE1 A;  3G4S A;  3NEL A;  2C9O A;  1SYD A;  5IY0 A;  4XYQ A;  4K0K L;  1WCM B;  1NMF A;  1QZH A;  1G6P A;  5E4W C;  3H94 A;  5D3I B;  1X3E A;  3J80 i;  2HUG A;  2KED A;  3HKZ G;  5M5W H;  1YZ6 A;  1SFO B;  1IBM L;  4BBR H;  1S5F D;  4DPG A;  5M3F B;  2A1A A;  2PZW A;  3AFP A;  3W1G A;  1PH6 A;  3D8G A;  4G57 A;  3E5S A;  3G71 A;  4L8J A;  2MUY A;  1JJ2 A;  4A93 H;  1WTR A;  4C3H G;  4OHJ A;  1XNQ L;  4ZUI A;  4NDX A;  4YWL A;  1LYL A;  2KUM A;  2DNE A;  4DV0 Q;  1WD0 A;  3RR5 A;  3S16 H;  1W3S A;  1G51 A;  1WTP A;  3OWF A;  3GV6 A;  4OO1 H;  1I3Q B;  3MZ5 A;  1PXU A;  1SE3 A;  3ULJ A;  2VUM B;  3O13 A;  4X3T A;  1HH2 P;  1L0Y B;  5G3L D;  3PO2 H;  1LTS D;  2CWP A;  1HR0 L;  2A74 C;  1D1K A;  3J80 E;  2Z6K A;  4LJZ C;  4JYA L;  4A3G B;  3HFZ B;  3KF6 B;  1WCM G;  4JI6 L;  4IAL A;  3H0G G;  3HOU G;  1S5D D;  1HR0 W;  1BCP C;  1MBY A;  3NSW A;  1TWH H;  2D5D A;  4XT3 B;  2EIF A;  2E75 C;  4XYO A;  2J4X A;  2NZ1 D;  1ICF B;  3Q8D A;  3S24 A;  1UE7 A;  1UUP A;  2FIN B;  3MXP A;  1SNQ A;  4X3S A;  1AN8 A;  2R6G A;  3CCU A;  2MJ8 A;  1KAA A;  2F3I A;  1EIY B;  5IYC H;  4DR4 L;  2IX3 A;  2YTY A;  1XNR L;  1N32 Q;  1A63 A;  3Q23 A;  2WP8 J;  5K36 H;  1YJW A;  3GTJ H;  3I2Z A;  4AQY Q;  3MA2 B;  3DM3 A;  4ILW A;  2EVB A;  2AHO B;  3NQI A;  1X55 A;  4ZQ3 A;  1SYG A;  3U4V A;  1VQL A;  1HTP A;  1CSQ A;  5KGU A;  2I5L X;  2QW7 A;  5KYL A;  4F7X A;  4UHV A;  2IHF A;  1X6O A;  4RGT A;  2E76 C;  2E2J B;  1N34 Q;  1OO9 B;  1VQA A;  3CCS A;  1N9W A;  4PQX A;  2AWO A;  3HKZ B;  2Z0S A;  4JI4 Q;  4X66 Q;  1IXR A;  1CI3 M;  2AUK A;  1BNZ A;  1PH2 A;  2F0V A;  1SE8 A;  4JV5 L;  2KCC A;  1PFM A;  5AJ3 L;  2MNA A;  3C1E A;  2PPB C;  3I4N B;  2EYM A;  3ERS X;  4C56 C;  1TWG B;  1K83 B;  3A5U A;  4CKC A;  1PH9 A;  4QCL A;  4DGZ A;  2L9H A;  5I9P A;  4JBJ A;  4ME5 A;  1SRU A;  3R3O A;  2PQE A;  1EYG A;  3S15 H;  1FJG L;  4DUZ Q;  3RUZ A;  5C4J B;  5I9O A;  2CQO A;  2ATW A;  1I4G A;  3MXG A;  3P7J A;  4C2M B;  4XQN A;  1OTC A;  1C48 A;  2VQF L;  2K05 A;  4A3G G;  2CH4 W;  2F0G A;  2Y0S B;  1VQP A;  3V2T A;  4J8Q A;  2B8G A;  2IPK D;  3JAM i;  3JAM c;  4GNX B;  5KRU A;  4GN3 B;  4HCE A;  2F03 A;  4XQQ A;  1RTO A;  2E8G A;  3ND8 A;  1QVC A;  3ULP A;  1V9P A;  1IZ6 A;  1Y69 U;  2B63 B;  3W5O A;  1GUW A;  1ZYR D;  4A3K H;  3H6M A;  2GVA A;  2KHS A;  2NB0 A;  2ZJR A;  1Y1W B;  3K0X A;  3A55 A;  4V19 0;  2KEE A;  1VQ5 A;  1D5M C;  1G6Z A;  3KJP A;  2JEA I;  3KDF A;  3CC2 A;  2JJQ A;  4B3R L;  1BBU A;  1HFG A;  1C0A A;  3P1H A;  1JOR A;  2LSS A;  5JVG 3;  3RN2 A;  1VQ4 A;  4IJH A;  1GOZ A;  4OIK A;  1PYB A;  2K32 A;  4X65 L;  4POF A;  2UXC L;  3S9W A;  4K5V A;  4JBW A;  5C4X H;  1QG7 A;  1MI2 A;  3I4M B;  1VQ7 A;  1SLJ A;  4DR6 L;  4KK7 A;  3D31 A;  4JI3 L;  1S5C D;  4A3L H;  1UEB A;  2C35 B;  4A3K G;  2B3G A;  4TQU S;  1LTL A;  1UE6 A;  1PRT B;  1VQ9 A;  1O7Y A;  4NB3 A;  3UE0 A;  1EFI D;  1V1Q A;  5FOB B;  1B53 A;  4HJA A;  5JPN C;  2ZM6 L;  2KCT A;  1L1O B;  4R4T A;  1TWA B;  1E22 A;  4ZKB B;  1G8Z D;  1IYV A;  1NE3 A;  3E0E A;  1ZEQ X;  2XRS D;  1K9M C;  1XXG A;  1E2V A;  2SOB A;  3K7A H;  5C44 H;  2J7Z A;  4L63 B;  2OQK A;  4P2C B;  4A3D G;  5HGQ A;  1Q8I A;  1NCV A;  1X3F A;  5C6A A;  3OTO L;  4RMF A;  2K7V A;  3H3V I;  2WKC A;  1RHP A;  1E2W A;  4OL7 A;  5JOB A;  5IGE A;  3Q22 A;  2A6E C;  5A2Q L;  4DR5 L;  1QZG A;  3HGB A;  4X62 Q;  1BCP B;  3HOV B;  4L5S A;  3PSI A;  1JJC B;  1ROD A;  2ICE C;  2JXM B;  2KHI A;  1DOL A;  1KXL A;  3SDZ A;  4A3J G;  3GTO B;  2UU9 Q;  1O7I A;  2Z6B A;  2ZTD A;  4JI5 Q;  3MXU A;  1DGS A;  1WFQ A;  2OXP A;  5I4D A;  3S14 B;  1Y8N B;  1Q8K A;  2KEC A;  4IUT A;  1EQR A;  4XT1 B;  1A3V A;  2DJF C;  2F0D A;  2B39 A;  3HOU B;  4B3M L;  4ZUJ A;  1JWU D;  3EJI A;  1LUZ A;  4CBV A;  5CV9 A;  2F4V L;  1CKN B;  1SSO A;  2YTX A;  1LTA D;  1ZYR C;  2CW0 D;  3FKI H;  2L1B A;  3PCO B;  1SE2 A;  1UEA B;  2PNH A;  2VQE L;  4A3K B;  1JR0 D;  4A3F G;  2RHS B;  1JQY D;  3CCL A;  5FJ8 H;  4FVM A;  5IYB H;  2X69 A;  3HOX G;  1GUN A;  2AKW B;  4K5W A;  3DM1 A;  2I0Q A;  3S2D B;  4IPC A;  1SNM A;  1UE5 A;  2XWB B;  3R93 A;  2R3Z A;  4DAM A;  4DV6 Q;  1J6Q A;  4XIG S;  1R9T B;  1PFS A;  3QIA A;  4NKL A;  1VQB A;  5IIF A;  3MEF A;  2DNC A;  2E2H H;  2M9V A;  1SYF A;  2A8V A;  2JA8 B;  1HTL D;  1KHI A;  5DLQ E;  2L5T A;  3DLL A;  4B3S L;  1I4P A;  2UUA L;  4NXN L;  1B2T A;  2NVT H;  1BUV T;  1D5Z C;  5ISR A;  4B9W A;  1QVG A;  4LF9 Q;  1FGB D;  3FKI G;  2F0I A;  4M1U B;  3S17 B;  1IL2 A;  4A3B G;  4RGO S;  1R4Q B;  2LKV A;  1BQQ T;  2NZH A;  1P16 A;  2CHB D;  2KEN A;  3I72 A;  4OXP A;  4JPB W;  1SEB D;  5I6Y A;  3NTH A;  5C0X J;  3KOJ A;  3T56 B;  1EWC A;  3F1Z A;  4X66 L;  4DV2 L;  3F2B A;  1KLG D;  5GAG C;  3PO3 G;  3T1Y Q;  2BDO A;  4O42 A;  3BVZ A;  1HA5 A;  1I4H A;  4A3J H;  4JV5 Q;  3Q0A A;  2Z9H A;  3GTL H;  4TVA B;  1I4R A;  4ODG A;  2ZXO A;  3TP8 A;  4A3M G;  2HCI A;  4JI1 L;  3LGJ A;  4B3T L;  1FNW A;  2JA5 H;  1VMP A;  2K5V A;  1I4Q A;  3LWU A;  4RCN A;  1U5K A;  2EY1 A;  4C3I B;  2F0U A;  4IQZ A;  2DUD A;  2A69 D;  2Z4I A;  2EXZ A;  1O7Z A;  3M7G A;  3U9S A;  3TSS A;  2EDG A;  4FYD A;  3CRL C;  4KMU C;  2EYL A;  1HFN A;  4DV5 L;  1F9Q A;  2L15 A;  1HXY D;  1WD1 A;  1Y1V G;  1EY8 A;  1FNV A;  2KCM A;  4RAU C;  3OTO Q;  3FEW X;  4IO9 A;  2WB1 G;  1JIC A;  5CC4 A;  1TS2 A;  3I3C A;  3IAY A;  2FFK B;  4DR3 L;  3C3L A;  3CCJ A;  2JA6 B;  1VQJ A;  2I46 A;  4DNR B;  1K0S A;  1VQ6 A;  3TS0 A;  1SNP A;  1AEX A;  2N78 A;  3P20 A;  1QIL A;  5IGB A;  4YY3 L;  2JSO A;  1I6H H;  2UXD L;  3ER0 A;  1UAP A;  2K4K A;  3AU7 A;  2QF7 A;  1ZKO A;  1CTM A;  3CCQ A;  3T1H Q;  3NTI A;  1FD7 D;  5CV5 A;  1LLR D;  1X9N A;  5C4X G;  2G9H D;  3HOW H;  3BS1 A;  3K81 C;  3HZX A;  2AQ2 B;  1LTI D;  2OQ0 A;  4AIM A;  2B2T A;  1JT8 A;  2B2Y C;  5A2Q E;  1G2S A;  2D0P A;  4PMC A;  5DM6 3;  1M1K C;  2WB1 E;  2I5M X;  3U58 A;  1Q46 A;  2QA4 A;  2KJX A;  1MGS A;  3BZK A;  3T16 A;  3ERQ A;  4K5X A;  3CPW A;  1ONL A;  5JEA G;  4DUZ L;  1H9K A;  1F9R A;  2A68 D;  2O5I C;  3BVM A;  4LF9 L;  5JEA H;  2YYZ A;  1K8A C;  1YHA A;  1IHZ A;  3SHL A;  3CCM A;  4IPH A;  3I8Z A;  1FYC A;  1KLU D;  1XNR Q;  2EYF A;  3HOZ H;  1AZQ A;  2NVX B;  4I7Z C;  4BY7 H;  4DAP A;  2CFM A;  2H4O A;  1EYA A;  2JEB I;  2JP1 A;  3FVQ A;  5ELN A;  4KD3 A;  4S3S A;  3TRE A;  2I5H A;  1VQ8 A;  5LMN Q;  2LXJ A;  1F9P A;  1IYJ B;  4PNY A;  3TS2 A;  1KAW A;  1BR9 A;  1EY6 A;  2KVM A;  3STB D;  3FKI B;  3TP6 A;  3HP3 A;  2PI2 A;  4RKL A;  2EPB A;  2R7F A;  1N34 L;  4LF7 L;  2BA1 A;  1B50 A;  4DUY Q;  4RH6 A;  1YI2 A;  1CA6 A;  1ESR A;  4OON A;  3NBI A;  1U4R A;  4NXM Q;  2MP1 A;  1EY5 A;  3J80 L;  3I90 A;  4NP5 A;  4A3I H;  2RA4 A;  4P71 A;  4C3J B;  1IW7 C;  4QL5 A;  3GTG H;  5IP9 H;  3HEJ A;  4ZAI A;  3AMU A;  3KF8 B;  1DM0 B;  4IPG A;  4WOR A;  3ICE A;  1ENA A;  1KRT A;  2JA7 H;  3KLW A;  2MQH A;  1QB5 D;  2NZO A;  3WDN A;  1BXT A;  1HHV A;  3BG3 A;  2Q2H A;  1BDO A;  1SMY D;  2HHH L;  1HQR D;  3ERO A;  1PRT D;  3GO5 A;  2JA7 G;  4G7O C;  3WOF A;  3NEM A;  2P5Z X;  4LF4 Q;  3VYT A;  2EOT A;  2K52 A;  1HNZ L;  4QQB X;  3HOY B;  1R9T H;  5IT9 c;  4GOP A;  5LL6 S;  5BN4 A;  2MFI A;  2I07 B;  1D5X C;  2WFW A;  1HZC A;  5K36 G;  4HJ5 A;  4DAV A;  2YU9 B;  3FPU B;  1K73 C;  4EQP A;  1FJG Q;  2ZT9 C;  1GHJ A;  4TSS A;  1TY0 A;  4TKO B;  1I6V C;  3MAQ A;  1T9H A;  3PUW A;  1X3G A;  1I4X A;  3J7Y W;  4LFC L;  3TME A;  2B2Y A;  4DV3 L;  3K0Y A;  1AFP A;  3OPO A;  4LFA Q;  1CM9 A;  1NMG A;  3CW2 C;  2BH2 A;  2B63 H;  1A8V A;  4KI0 A;  4XXE A;  1W6J A;  3RZD B;  4LFB Q;  2UXD Q;  4CGY B;  2R93 H;  3HOV G;  2ZTC A;  4CDF C;  1KTK A;  3NP8 A;  5FO7 B;  4MN3 A;  4MIU A;  2OTL A;  4PV1 C;  4X3U A;  2YU9 H;  1CFM A;  2WV6 D;  4LW1 A;  2JA6 G;  3HOW B;  4OO1 G;  3T53 B;  1A2U A;  3F2D A;  1C8C A;  4YHH L;  1E0B A;  3AQQ A;  4DNI A;  1CHP D;  2ASB A;  4AH6 A;  3AFQ A;  2G5D A;  2KOL A;  3K7A B;  4IUV A;  5C44 B;  4FF1 A;  2EJM A;  4C3H H;  4KHP Q;  2K01 A;  2L55 A;  1EU3 A;  2B29 A;  4FDB A;  2WAC A;  1PA6 A;  3H15 A;  1PH4 A;  2HDL A;  3CXC A;  2K5W A;  1HRJ A;  1Q86 C;  2PMZ E;  4JI6 Q;  1NAP A;  2DY8 A;  5ELF A;  1XMO L;  4GLV B;  5EKL A;  1CSP A;  4KLK A;  2IT1 A;  3QOJ A;  5M3M G;  5EAY A;  1BCP D;  3G6E A;  1XTC D;  1TWG H;  4H44 C;  2R7Z G;  1VF7 A;  2MHV A;  4NMZ A;  1SAP A;  2MO0 A;  2Z6K C;  1BVS A;  3PMF A;  4DR7 Q;  1D7Q A;  3FDT A;  1MD2 D;  4EX5 A;  5C5M A;  1G91 A;  1IL8 A;  3I56 A;  1TWC B;  1YIT A;  4DA2 A;  2PW7 A;  3Q6S A;  3SVM A;  1B3Q A;  3KDF B;  3F2U A;  1LT5 D;  1A3T A;  4H02 A;  3VYR A;  2B2U C;  2SNS A;  3U50 C;  1I94 L;  1EQT A;  4QJF A;  2NN6 I;  1MJE A;  2GVB A;  3D6W A;  3UI2 A;  4GKK Q;  4UP8 A;  1PH8 A;  4HIO A;  1Y1W G;  3KLS X;  4U68 A;  4DXF A;  4LF4 L;  3I4M H;  2B2W A;  2J0T D;  3R2T A;  3TDQ A;  1ASZ A;  4K0K Q;  1B8A A;  3PV0 A;  4IUN A;  1IKM A;  2CQA A;  1HNW Q;  1RF2 D;  3K7U C;  1MSG A;  5EBC A;  1L0W A;  4NPS A;  2BE5 D;  5DEH A;  3PUV A;  3ZJY C;  2XVS A;  4QY7 A;  4LF6 L;  1KAB A;  1IYU A;  5D3D A;  4HIK A;  4BBS B;  2K14 A;  1TWH B;  2K5N A;  3IRB A;  3GD7 A;  3KBG A;  5EPL A;  4DV1 L;  5IP7 H;  3DHQ A;  4CDD C;  4DR1 L;  4N9P A;  1TS3 A;  1TY2 A;  2NVY B;  3OYY A;  4N9T A;  2QDL A;  3ND9 A;  4R8N A;  3A5Z B;  4DR3 Q;  4QUF A;  4R4I A;  4DV4 Q;  3UDG A;  3M3Y B;  5I2Y A;  1FVI A;  4HTH A;  3M4Y A;  2JN4 A;  3CHB D;  2BH8 A;  2O2L D;  3ONA B;  3DUZ A;  2HIX A;  1YHQ A;  1HR0 Q;  5CR3 A;  5KNB A;  2LXK A;  1Y8P B;  1NJI C;  1FGU A;  2XN9 C;  5M3F H;  1EWI A;  1HJP A;  3GQB A;  4LF7 Q;  4RCO A;  4DV3 Q;  5LMN W;  1U4M A;  3EN2 A;  4QGU A;  2RSN A;  3H0G B;  3PO3 B;  3HOX B;  4F8M A;  2VS1 A;  1TKW B;  1WTQ A;  4O2D A;  5CYU A;  1JE5 A;  4R9W A;  2M2L A;  3ITP A;  1BBW A;  2N49 A;  5FLX c;  3J81 c;  1KIX A;  2VB3 X;  4CJ1 B;  1JMC A;  3CC4 A;  2VUM H;  4HCS A;  3HOW G;  2K5Q A;  1B9N A;  3KYH C;  2NTT A;  5KEE A;  2XGT A;  5F2D A;  3HS0 C;  4FXD A;  4BA2 I;  5CV7 A;  3BDC A;  4IUR A;  4A3I B;  3S14 H;  1TS5 A;  1QJO A;  4JC0 A;  3NQT A;  5BR8 Q;  4OWT B;  3GTL B;  3MC0 B;  5TSS A;  1F9S A;  2N88 A;  3PIP 3;  3KUP A;  2EY6 A;  2RVL A;  3EA6 A;  2Z1C A;  4JI8 Q;  2F0F A;  4FXK C;  2EYJ A;  2F3W A;  4JI1 Q;  2EXD A;  3CF5 A;  3N52 A;  2L11 A;  4NW2 A;  2VZA A;  1Y1V H;  1OXV A;  3QR8 A;  4Y7N H;  3LWE A;  4HSP A;  1STN A;  1EEF D;  3D6C A;  4J15 A;  3PIP A;  4K8I A;  5I6W A;  4V0B A;  3E9I A;  2E2I H;  1OXU A;  1BOS A;  1YHB A;  4DUY L;  2F0J A;  4TRD A;  5BN3 A;  2A73 B;  1XNQ Q;  3A54 A;  3H3V H;  5JPM C;  3CME A;  1NTG A;  2IY5 B;  1S5B D;  4I7A A;  2BCO A;  4LF6 Q;  1CK1 A;  2EYH A;  5FLX L;  3C46 A;  1GHK A;  4OGQ C;  3RLO A;  4RHS A;  1PVO A;  2UUC Q;  1KNA A;  3BYT B;  3PO3 H;  1M4V A;  3UDF A;  2ID0 A;  4YWK A;  3CAM A;  4JYA Q;  4H7B A;  3MVV A;  3HRZ C;  4UP7 A;  4C1N I;  2Q2I A;  2WAQ B;  4ZCK A;  2HHH Q;  1VQE A;  1KDA A;  1W6K A;  3M85 A;  2NBF A;  4DR2 L;  4UY8 C;  3A8I E;  4DN4 M;  2UU9 L;  1N33 L;  1HCZ A;  3K5L A;  3S1N H;  1HNZ Q;  4HAE A;  2NN6 G;  2WIN B;  2TMP A;  4JG2 A;  4OO1 I;  2OT2 A;  1CKM A;  1LAB A;  1E1T A;  4HSV A;  1L1O A;  2PYK A;  3J81 j;  3PUZ A;  4JI7 Q;  5K5P A;  4XQJ A;  1KD1 C;  2LS0 1;  1UE1 A;  1TXY A;  4RG1 A;  4UAI A;  3BU2 A;  1DXM A;  4A76 A;  2RDF A;  3D4W A;  2HCC A;  4RGN A;  1PFB A;  5GAE C;  3MHB A;  1IBM Q;  3HOU H;  2E5L Q;  3E6Z X;  4IFD G;  5E3F A;  2PW5 A;  5LL6 X;  5IYD H;  3CRK C;  2TSS A;  2XRQ D;  2B2V C;  1VQM A;  2HQL A;  4A4I A;  4JI3 Q;  5FKA C;  1LM0 A;  2K03 A;  5IOC A;  2IX1 A;  3URY A;  2L12 A;  2WAQ G;  3NEN A;  1AP0 A;  5IYB G;  5HGT A;  1CKO A;  4C3I H;  3I4L A;  2UUB L;  1TS4 A;  5C4Z A;  1I94 Q;  4KY7 A;  3DWA A;  3DWP A;  5IE8 A;  4Y52 H;  1IBK L;  3S1Q H;  4DXG A;  1B44 D;  2R7D A;  3VA5 A;  2X6G A;  2F0H A;  1STE A;  3L7Z C;  4Y7N B;  3VYU A;  1TWF B;  1X3Q A;  3B6Y A;  4KJO A;  1H9R A;  1EL0 A;  3QB3 A;  4DV7 Q;  3OSO A;  1PH1 A;  4KJN A;  3S17 H;  3IKJ A;  1CHQ D;  4FF4 A;  4BBR G;  4FP5 D;  5M9O A;  4K6L A;  5J1Z A;  4IFD I;  3E9H A;  5CGK A;  1G2T A;  3RZO B;  2EY2 A;  1H95 A;  1X65 A;  2XWJ B;  4KN7 C;  1EWH A;  5EJW A;  3K5N A;  1N32 L;  4QUC A;  1TII D;  1OXT A;  4BS9 A;  1EQQ A;  5KIX A;  3T1Y L;  1EYC A;  2D9U A;  2WB1 B;  1QUQ A;  1PMR A;  1EIF A;  1PH7 A;  3AEV A;  5FLM H;  1H9S A;  4LWC A;  1JE4 A;  1GKH A;  1EFW A;  4A3D H;  1D6E C;  4QF4 A;  2A68 C;  3OW2 A;  2UXB Q;  3I4M G;  1YEZ A;  4ZRZ A;  1S5E D;  1V1P A;  4X3K A;  4CKB A;  1FL0 A;  3GTK H;  5GAD C;  3A0J A;  3DXJ C;  1YNN C;  3STB C;  4GNX A;  2ZJQ A;  3DEO A;  5GRO A;  3TP7 A;  3W2D A;  2RBM A;  1JC7 A;  1DCZ A;  4JI0 Q;  4EQO A;  1I50 H;  1LTG D;  5COY A;  4X65 Q;  2UXC Q;  1XPU A;  1TT2 A;  2NTS A;  4U67 3;  4KN4 C;  4HJ8 A;  2QKI C;  2F0S A;  4CJ0 B;  1NBW A;  3W1B A;  2UUC L;  4DU9 A;  2R7Z H;  1ILQ A;  5JJZ A;  1E1O A;  1S3O A;  2HT1 A;  4DAY A;  3TZU A;  1EOT A;  2JA9 A;  2B2U A;  2F0O A;  4OEM B;  5GQO A;  4ZLT F;  3G7L A;  1STH A;  4LUV A;  2BA0 A;  3GP7 A;  1W2B A;  1WTV A;  1KC8 C;  3AYH B;  4O1N A;  5CV6 A;  1S72 A;  1DOM A;  2F1M A;  2OCE A;  2RKS A;  4UP9 A;  1SMX A;  5IGG A;  4C1N K;  4JOI C;  2OF1 A;  1IBL Q;  1CQF A;  4R1J A;  1VQO A;  3A74 A;  1O7L A;  5IYD G;  3OIQ A;  1TU2 B;  4L5R C;  1I5F A;  4IFD H;  3H0G H;  5C4J H;  3CQZ H;  3RZO H;  2KHJ A;  1SDF A;  1E24 A;  2QIL A;  4UPA A;  1CZW A;  2B2T C;  2A5H A;  2R92 G;  3EQL C;  2E2J H;  1B3A A;  1SFO H;  1SMY C;  4DR1 Q;  4LF5 L;  2B2V A;  3PUY A;  4GS3 A;  2A6E D;  3HKS A;  3I73 A;  1GUS A;  1QUQ B;  2F0Q A;  5JVH 3;  1IKL A;  1RDP D;  3LX0 A;  3M3Y H;  1LT4 D;  3OMC A;  2R93 G;  3ZYY X;  1VCI A;  1VF5 C;  1YIJ A;  4EQ5 A;  3IL8 A;  4A3E B;  1EZ6 A;  4DNT B;  3QWN A;  1GUO A;  1PTO D;  2B63 G;  2XSC A;  2PZT A;  5E7N A;  2B2W C;  3F2C A;  5EKI A;  3OHX C;  3RLF A;  2K1B A;  2PQA A;  5CMD A;  1I50 B;  3FMC A;  4BXX H;  4LF8 Q;  1YJ9 A;  1Q90 A;  1F2Z A;  4JI4 L;  4I65 A;  1RD9 D;  1B1Z A;  4HMI A;  4IUU A;  2EYO A;  3CMA A;  3K59 A;  3M4O B;  3KF8 A;  4DK6 C;  3GTK B;  2XIW A;  3GTQ H;  2IL8 A;  2VXW A;  4FO2 A;  4P73 A;  1VQK A;  4HED A;  3T51 B;  3TN2 A;  4C3H B;  4RHR A;  1LTR D;  1F2Y A;  1DOK A;  1VQG A;  5D65 A;  4DFA A;  2ALY B;  1GJX A;  1I3Q H;  1Q3L A;  1V1P B;  5IGD A;  3S1M B;  4LMQ D;  3RMH A;  1PH5 A;  3GTJ B;  2O4X A;  3IFT A;  3M4Q A;  3NPP A;  4G7H C;  2A6H C;  1EY4 A;  4JI0 L;  1V43 A;  3KK7 A;  5T1I A;  5GAH C;  5DM7 3;  4JK1 C;  4K14 A;  1PRT F;  3FHW A;  2F4I A;  1T5X D;  1E2Z A;  5C0X G;  2Q2T A;  1UNS A;  1XMQ Q;  1HZ9 A;  2R92 B;  2AQ3 B;  1QCB D;  1TWC H;  3K58 A;  5L37 A;  4F87 A;  4K6D A;  2CH4 A;  4A3E G;  3J7Z C;  2PO4 A;  5J3B A;  1TVX A;  1MJC A;  4LAA A;  4B9X A;  1ICW A;  5G3L F;  2AMC B;  3BZC A;  1VS0 A;  2E5L L;  5EQ0 A;  3L9A X;  4B3R Q;  3I4N H;  4HJ9 A;  2SNM A;  1NUC A;  4LNQ A;  5EKK A;  3U9O A;  2VUM G;  2ICI A;  1Z7T A;  4E6I A;  3S1R B;  1YNJ D;  1A3U A;  1AZP A;  3MEH A;  2JA6 H;  4WRD A;  5ELO A;  2ZM6 Q;  1HQM C;  2YTV A;  4QMG A;  4R4C A;  1RL2 A;  2R92 H;  2NVQ B;  4GN5 A;  2IJ0 A;  1WI5 A;  1J8I A;  3M7N A;  1D2B A;  1BO0 A;  3U4Z A;  2HD3 A;  3D4R A;  3RZD H;  2VNU D;  2VW9 A;  4A3B B;  3L3O C;  3L0O A;  5A35 A;  2MGS A;  1Z9F A;  4KD4 A;  3I7F A;  4DV6 L;  3BDO A;  2BE5 C;  3OIP A;  3S1Q B;  3CPF A;  5IOD A;  4L5T A;  4DV5 Q;  1BCP F;  4MNO A;  3PIO 3;  5CV4 A;  3GTM H;  1K8M A;  1YVC A;  3HOZ B;  1U0L A;  4NXN Q;  1TQO A;  1XTD A;  1KQS A;  4YIJ A;  4MHE A;  1Q81 C;  2L4N A;  3L2P A;  1ET6 A;  4Q0F A;  5CV8 A;  1KRS A;  2KCN A;  3TZD A;  4X6A H;  4G7Z C;  1VDZ A;  1AE2 A;  4LK1 C;  3R8B A;  4PMW A;  3VA7 A;  3A8J E;  3OMG A;  1WYD A;  3FP9 A;  1A62 A;  3VR5 A;  1WTX A;  2F4V Q;  4PZ8 A;  4WJW A;  3C2P A;  2NVX H;  1Q1B A;  2N3S A;  2F0E A;  3T13 A;  3T1H L;  1KDC A;  4LF8 L;  4PZ7 A;  4H0L C;  1NSN S;  3M4P A;  2HQE A;  3FPP A;  1NR2 A;  1PZK D;  1EQV A;  2FXQ A;  3A8K E;  1PYS B;  2Q8I B;  4K2L A;  4YCU A;  5FLM G;  4IUP A;  2NUC A;  2K5H A;  2ZTE A;  4R8I A;  3PF5 A;  2ZJP A;  3S1N B;  3LNN A;  1N33 Q;  4JCV E;  3G6J B;  1XPR A;  2CKZ B;  3GTP H;  2V1C C;  1YBY A;  2IWH A;  1GUT A;  2O5J C;  1QNU A;  2OEO A;  1Z47 A;  3VDY A;  4GKK L;  1EU4 A;  1UWV A;  5LMU Q;  3CP0 A;  2DN8 A;  3E3X A;  2F0M A;  4OWW B;  3KBX A;  5C4X B;  4WJ4 A;  1HUM A;  4BY1 H;  3HOY G;  1Q1E A;  3GTG B;  1EY0 A;  3RD4 A;  1HNW L;  4ZYS A;  4B3T Q;  1NR4 A;  2A19 A;  2NVY H;  3HOZ G;  1N36 Q;  5D14 A;  4PG3 A;  1A15 A;  3A7A B;  1VQF A;  2EYP A;  5EPJ A;  5EPK A;  1SYB A;  3EIV A;  1MKH A;  3EFX D;  1SND A;  4OX9 L;  2QCP X;  3TEH B;  3S2H H;  3J80 c;  1ENF A;  4JI7 L;  4H13 C;  3WOE A;  1Y1V B;  1XPO A;  1JWM D;  1EIH A;  3DMU A;  5C0X I;  5JJI A;  5J39 A;  2YV5 A;  3UDI A;  4NXM L;  1BKB A;  5M5X B;  1H9J A;  1BBX C;  1K3R A;  1FNU A;  1SRO A;  1U4P A;  2K6A A;  1QVF A;  4HIM A;  1M8A A;  1JOQ A;  3HOV H;  3I55 A;  3TRZ A;  3NK9 A;  1JOK A;  3KLS A;  4JOI A;  1PFN A;  1EYD A;  4JW0 A;  3S2H B;  4DV7 L;  3CKI B;  4A3C H;  4WFN 3;  1EUJ A;  4RA8 A;  4KY6 A;  1SXT A;  3W3A A;  1B9M A;  4MTN A;  3HOX H;  1PZJ D;  4O0A A;  5FJ8 G;  4CDE C;  2RSO A;  4Q5V A;  1STB A;  4APV A;  5CBA E;  2F0T A;  2WAQ E;  3EVQ A;  3SXH A;  5C0X H;  3RLN A;  2E2D C;  2NN6 H;  1IBL L;  1LV9 A;  2R61 A;  1JWS D;  1H9M A;  2RCF A;  4N8F A;  5JJL A;  2EJG C;  1PV4 A;  1PHJ A;  1XX8 A;  3MFY A;  3CC7 A;  3SEB A;  1M90 C;  2F0L A;  3NBH B;  2N55 A;  3J7A 5;  3QO2 A;  5IWA Q;  4FF3 A;  2PI2 E;  4KY5 A;  3N6R A;  1LAC A;  1AW7 A;  3C1F A;  3CCV A;  3S2D H;  1F2M A;  4LFA L;  2OWO A;  2JA8 H;  4A75 A;  1CQV A;  2KA7 A;  5I2X A;  4A3M H;  4RGM A;  5IP9 G;  1H9S B;  3T4A C;  2CWA A;  5H1S E;  3NHH A;  3MXN B;  1WVL A;  2F0N A;  4A3I G;  2D62 A;  1A0I A;  3GV3 A;  3JAM L;  4ALP A;  4ID6 A;  1NY4 A;  4OIJ A;  2RHQ B;  4P72 A;  3SR1 A;  4PMB A;  4FNF A;  1K28 A;  2VL6 A;  4BXX G;  2WII B;  2EJF C;  2E2I B;  5C44 G;  1K8G A;  1K3B C;  4A3B H;  1L1O C;  1LTT D;  3BVG A;  4RKB A;  4P75 A;  1PTO B;  2GA4 B;  1AH9 A;  4F88 A;  5IGF A;  2CW0 C;  2C5C A;  4OX9 Q;  1HNX L;  1JJG A;  1A6X A;  1U9R A;  1MSH A;  1PDQ A;  2JK8 A;  2NVQ H;  4RFB A;  1F77 A;  2FHT A;  2DY7 A;  4R4Q A;  2AQ1 B;  2G9D A;  1LTB D;  1VQD A;  1STY A;  1GXD C;  3G48 A;  4A93 B;  4OEL B;  3RN5 A;  5E4X A;  3BZD B;  4HR7 B;  3J81 i;  3CU7 A;  2BOS A;  1OXS C;  2BDN A;  4QB4 A;  5C5L A;  1SYE A;  2QEJ C;  5JEA J;  4AYB G;  2R93 B;  5IT9 L;  1E7Z A;  2Z8L A;  1X32 A;  4A3F H;  1JB7 A;  4ULL A;  4DK3 C;  1SJH D;  3IFD A;  5LMN L;  1CT1 D;  1PYW D;  2GN5 A;  2IX0 A;  4J6H A;  3SGI A;  4EGV A;  4JI2 Q;  5M3F G;  1LO5 D;  1SR3 A;  3NWT A;  3A7L A;  4FXG C;  5J22 A;  4KKU A; 
#chains in the Genus database with same CATH homology
 2MFI A;  2OCE A;  2Z0S A;  4UP9 A;  2WFW A;  4YHH Q;  1SMX A;  4JI4 Q;  4X66 Q;  1HZC A;  5K36 G;  4JOI C;  4HJ5 A;  1IBL Q;  1IXR A;  4R1J A;  1OXX K;  4B3S Q;  1VQO A;  1K73 C;  3A74 A;  5IYD G;  1FJG Q;  1PH2 A;  4L5R C;  1I5F A;  1SE8 A;  4LUZ A;  3H0G H;  5C4J H;  3CQZ H;  3RZO H;  4JV5 L;  2KHJ A;  2K50 A;  1T9H A;  5AJ3 L;  1E24 A;  3PUW A;  1X3G A;  2MNA A;  4UPA A;  4LFC L;  1Q12 A;  3ERS X;  4DV3 L;  2R92 G;  2E2J H;  3HOY H;  1SFO H;  5IP7 G;  3A5U A;  4DR1 Q;  1PH9 A;  4LFA Q;  1NMG A;  3CW2 C;  4LF5 L;  1VQN A;  2HIV A;  3PUY A;  4GS3 A;  2B63 H;  1A8V A;  4KI0 A;  3S1M H;  4A3G H;  3HKS A;  4JBJ A;  1SRU A;  3S15 H;  1QUQ B;  1EYG A;  4LFB Q;  1FJG L;  2UXD Q;  4DUZ Q;  2R93 H;  3HOV G;  2ZTC A;  3M3Y H;  2R93 G;  4GNX C;  2CQO A;  4OWX B;  2ATW A;  1VCI A;  2OTL A;  1OTC A;  1YIJ A;  3HKZ E;  4EQ5 A;  2VQF L;  2YU9 H;  2XTI A;  4LFC Q;  4A3G G;  2B63 G;  5E7N A;  4LW1 A;  2JA6 G;  1VQP A;  3F2C A;  4GKJ Q;  4OO1 G;  2JE6 I;  3F2D A;  3RLF A;  2PQA A;  4YHH L;  3JAM i;  3JAM c;  4GNX B;  3AQQ A;  5LMU L;  4DNI A;  2K75 A;  2ASB A;  4BXX H;  4AH6 A;  3AFQ A;  4GN3 B;  4DAY B;  1YJ9 A;  4LF8 Q;  4JI4 L;  2E8G A;  1QVC A;  3ULP A;  2AWN A;  1V9P A;  1N8R C;  1IZ6 A;  1D8L A;  2VQF Q;  4C3H H;  4KHP Q;  3CMA A;  3W5O A;  3BJU A;  4A3K H;  2B29 A;  4DK6 C;  3GTQ H;  2GVA A;  4FDB A;  1PA6 A;  3PF4 A;  4P73 A;  3H15 A;  3RNU A;  1VQK A;  2ZJR A;  2UXB L;  3K0X A;  1PH4 A;  3CXC A;  4JBK A;  1VQ5 A;  1Q86 C;  2PMZ E;  3KJP A;  4JI6 Q;  2JEA I;  3KDF A;  3CC2 A;  2JJQ A;  1XMO L;  1BBU A;  1VQG A;  4GLV B;  4B3R L;  1C0A A;  1CSP A;  4KLK A;  2IT1 A;  5M3M G;  2ALY B;  1I3Q H;  4XTC S;  5EAY A;  2LSS A;  3RN2 A;  1PH5 A;  3G6E A;  1VQ4 A;  1HZA A;  4IJH A;  1TWG H;  4DV0 L;  3M4Q A;  1PYB A;  4HJ7 A;  2R7Z G;  1GVP A;  5M3M H;  4X65 L;  4POF A;  5IYC G;  2UXC L;  4JI0 L;  1V43 A;  4HID A;  2MO0 A;  2Z6K C;  1CUK A;  4JBW A;  5GAH C;  5C4X H;  2EQS A;  1BVS A;  3TQY A;  4DR7 Q;  1VQ7 A;  1SLJ A;  1D7Q A;  4DR6 L;  3PGZ A;  1GD7 A;  4EX5 A;  3FHW A;  3D31 A;  4JI3 L;  3I56 A;  4A3L H;  1UEB A;  2C35 B;  4A3K G;  1YIT A;  2B3G A;  4TQU S;  4JI8 L;  1B7Y B;  1LTL A;  1UE6 A;  5C0X G;  3KDF B;  4PZ6 A;  2Q2T A;  1WJJ A;  1XMQ Q;  4H02 A;  1I94 L;  1HZ9 A;  3U50 C;  1VQ9 A;  4QJF A;  4NB3 A;  2NN6 I;  3UE0 A;  1TWC H;  2GVB A;  1Q7Y C;  1MJE A;  1V1Q A;  4GKK Q;  4UP8 A;  1PH8 A;  4HJA A;  4HIO A;  4KHP L;  1Y1W G;  4JI2 L;  4LF4 L;  4A3E G;  3J7Z C;  3I4M H;  4GLX A;  5J3B A;  3M9B A;  1MJC A;  1XMO Q;  4IOC A;  2QGQ A;  3PUX A;  2ZM6 L;  4DV1 Q;  2AMC B;  1ASZ A;  2KCT A;  2MO1 A;  4X64 L;  1B8A A;  1L1O B;  3PV0 A;  4K0K Q;  4R4T A;  3BZC A;  4GOP C;  1E22 A;  1VS0 A;  1NE3 A;  2E5L L;  1HNW Q;  3E0E A;  4B3R Q;  3I4N H;  2RF4 A;  3K7U C;  4QIW E;  4HJ9 A;  1K9M C;  1L0W A;  4DV4 L;  4NPS A;  3K7A H;  5C44 H;  4LNQ A;  1ASY A;  3PUV A;  2VUM G;  3ZJY C;  4LF6 L;  4QY7 A;  2OQK A;  4ME3 A;  2RCN A;  4A3D G;  5HGQ A;  1C7Y A;  5AJ3 Q;  4HIK A;  3I4N G;  1G29 1;  2JA6 H;  1X3F A;  2K14 A;  3IRB A;  2K5N A;  5ELO A;  3GD7 A;  2ZM6 Q;  4DV1 L;  2YTV A;  4R4C A;  5IP7 H;  3OTO L;  4LF5 Q;  4MZ9 A;  4DR6 Q;  2N8N A;  4RMF A;  1RL2 A;  4DR1 L;  2R92 H;  3H3V I;  3OYY A;  4GN5 A;  4A3E H;  3A5Z B;  1WI5 A;  4DR5 L;  4X62 Q;  4DR3 Q;  1QZG A;  5M5Y H;  4L5S A;  3M4O H;  4R4I A;  3PSI A;  4DV4 Q;  3UDG A;  3M7N A;  5JJL A;  3KFU A;  1JJC B;  2KHI A;  1FVI A;  3U4Z A;  1KXL A;  4A3J G;  2BH8 A;  3RZD H;  2UU9 Q;  1O7I A;  2VNU D;  4BY1 G;  2VW9 A;  2ZTD A;  1J5E Q;  4JI5 Q;  1DGS A;  1WFQ A;  2HIX A;  3L0O A;  1YHQ A;  1HR0 Q;  2ES2 A;  1Q8K A;  1Z9F A;  2LXK A;  1K83 H;  3I7F A;  5BR8 L;  2DGY A;  4DV6 L;  3KF6 A;  1NJI C;  1FGU A;  3CD6 A;  4AQY L;  3CPF A;  5M3F H;  3JC6 6;  1EWI A;  4L5T A;  1HJP A;  4DV5 Q;  1EQR A;  4LF7 Q;  4DV3 Q;  5LMN W;  1HNX Q;  4MNO A;  4LUO A;  4B3M L;  3EN2 A;  4QGU A;  3GTM H;  1VQI A;  2JQO A;  4C2M H;  1HZB A;  1LUZ A;  1YVC A;  2VS1 A;  4C3J H;  2JA8 G;  2F4V L;  4R4O A;  1GM5 A;  4O2D A;  1CKN B;  1U0L A;  2YTX A;  1JE5 A;  1BBW A;  4NXN Q;  2N49 A;  4JI5 L;  1XTD A;  5FLX c;  3J81 c;  4GOP A;  1KIX A;  1KQS A;  3FKI H;  1Q81 C;  2VY3 A;  3PCO B;  1JMC A;  3L2P A;  3CC4 A;  2VUM H;  1KRS A;  2PNH A;  4IPD A;  2VQE L;  4X6A H;  3HOW G;  3ULL A;  1XJV A;  4A3F G;  2RHS B;  4YCV A;  1X56 A;  1AE2 A;  4GLA C;  4DR4 Q;  3CCL A;  5FJ8 H;  3KYH C;  4PMW A;  5IYB H;  3HOX G;  5JJK A;  1WYD A;  2AKW B;  1A62 A;  3FP9 A;  2F4V Q;  2XGT A;  4PZ8 A;  2I0Q A;  4IPC A;  2NVX H;  1Q1B A;  2N3S A;  4X62 L;  1UE5 A;  4JBM A;  3T1H L;  4LF8 L;  4BA2 I;  4PZ7 A;  4GOP B;  2UUB Q;  3S14 H;  3M4P A;  1L2F A;  4JC0 A;  2F52 A;  4DAM A;  4WJ3 M;  5BR8 Q;  4DV6 Q;  4OWT B;  2Q2U A;  2FXQ A;  4LFB L;  1J6Q A;  4XIG S;  1PFS A;  1PYS B;  4BA1 I;  1VQB A;  4A3C G;  4YCW A;  3MEF A;  4YCU A;  5FLM G;  4A3L G;  2K5H A;  2ZTE A;  2E2H H;  4JI8 Q;  3PF5 A;  2ZJP A;  2D0O A;  4AYB E;  1N33 Q;  2A8V A;  4JI1 Q;  5DLQ E;  1KHI A;  2EXD A;  3DLL A;  4JCV E;  3CF5 A;  4B3S L;  1XPR A;  2VZA A;  2CKZ B;  1Y1V H;  4NXN L;  1OXV A;  2V1C C;  2UUA L;  1EOV A;  1WCM H;  4Y7N H;  2NVT H;  3GTP H;  1YBY A;  1Q82 C;  1Z47 A;  3VDY A;  4GKK L;  1YNX A;  1QVG A;  1N36 L;  3PIO A;  4LF9 Q;  4BY7 G;  1UWV A;  5LMU Q;  4J15 A;  3CP0 A;  3PIP A;  3FKI G;  4OWW B;  2E2I H;  3E9I A;  1OXU A;  1IL2 A;  1YHB A;  4DUY L;  3PO2 G;  4A3B G;  4WJ4 A;  3WWV A;  2NZH A;  4BY1 H;  1XNQ Q;  1Q1E A;  4P74 A;  1PH3 A;  1P16 A;  3HOY G;  1HNW L;  5C3E H;  2VQE Q;  1MIU A;  3I4O A;  3H3V H;  2KEN A;  4OXP A;  3CME A;  1NTG A;  2IY5 B;  4YWM A;  5C0X J;  3KOJ A;  4B3T Q;  2A19 A;  4LF6 Q;  3K80 C;  1AE3 A;  2NVY H;  3F1Z A;  4X66 L;  4DV2 L;  3F2B A;  1N36 Q;  5GAG C;  3HOZ G;  4PG3 A;  3PO3 G;  3T1Y Q;  4L5Q A;  2BH2 A;  3RLO A;  5C3E G;  1VQF A;  1PVO A;  4A93 G;  3EIV A;  2UUC Q;  4JV5 Q;  4A3J H;  3S1R H;  3PO3 H;  4GKJ L;  1MKH A;  1RIP A;  3UDF A;  2ID0 A;  4YWK A;  3CAM A;  4TVA B;  4OX9 L;  3GTL H;  4JYA Q;  3TEH B;  4A3M G;  3S2H H;  4UP7 A;  4JI1 L;  3UDX A;  2Q2I A;  3J80 c;  2HHH Q;  3LGJ A;  4JI7 L;  4B3T L;  2JA5 H;  2OTJ A;  1VQE A;  1C9O A;  4X64 Q;  1XPO A;  2UUA Q;  3M85 A;  2K5V A;  4DR2 L;  4UY8 C;  5C0X I;  1TWA H;  2UU9 L;  1N33 L;  4IFD J;  3S1N H;  1IBK Q;  5JJI A;  2YV5 A;  5IWA L;  3UDI A;  1U5K A;  1HNZ Q;  4NXM L;  1BKB A;  4IOA A;  2NN6 G;  4DR7 L;  1KL9 A;  4JG2 A;  4OO1 I;  4DKA C;  1K3R A;  2DUD A;  1CKM A;  1TWF H;  1X54 A;  1E1T A;  1Y14 B;  1L1O A;  1SRO A;  1E3P A;  1QVF A;  3J81 j;  4HIM A;  3PUZ A;  4DV5 L;  3HOV H;  3I55 A;  1SN8 A;  3TRZ A;  1YJN A;  2L15 A;  1Y1V G;  4JI7 Q;  1VQH A;  2KCM A;  1KD1 C;  3OTO Q;  4IO9 A;  4JOI A;  2WB1 G;  1UE1 A;  3GTO H;  1TXY A;  4RG1 A;  2QEX A;  3BU2 A;  4DV7 L;  2H5X A;  4A3C H;  5M5X H;  4BBS H;  1EUJ A;  4DR3 L;  3CCJ A;  4A76 A;  4DR5 Q;  1VQJ A;  2Y0S E;  1P8L A;  4MTN A;  5GAE C;  3HOX H;  1IBM Q;  1Y1W H;  1VQ6 A;  4O0A A;  3TS0 A;  5FJ8 G;  3HOU H;  4DV2 Q;  1K0R A;  1CKN A;  2N78 A;  4KHZ A;  2E5L Q;  4APV A;  4IFD G;  4YY3 L;  4GN4 B;  5IYD H;  1I6H H;  1J5E L;  2WAQ E;  2UXD L;  3ER0 A;  2K4K A;  2PQA B;  4BBS G;  3RLN A;  1VQM A;  3GDE A;  1GO3 E;  2HQL A;  3F8T A;  4A4I A;  4JI3 Q;  1LM0 A;  2IX1 A;  4DR2 Q;  1IBL L;  1WOC A;  2WAQ G;  3EBE A;  3NEN A;  5IYB G;  3CCE A;  3CCQ A;  1S40 A;  3T1H Q;  2CCZ A;  3CCR A;  2IHE A;  5HY6 A;  2KBN A;  3D0F A;  4POG A;  1CKO A;  1X9N A;  4B3M Q;  4C3I H;  1PV4 A;  1XMQ L;  1PHJ A;  2UUB L;  3HOW H;  3KJO A;  1B70 B;  3K8A A;  3CC7 A;  1I94 Q;  2JA5 G;  1M90 C;  3K81 C;  1VQC A;  5IE8 A;  3NBH B;  4Y52 H;  2OQ0 A;  4AIM A;  1IBK L;  3S1Q H;  1JT8 A;  4IJL A;  2Y0S G;  4YY3 Q;  5IWA Q;  3J7A 5;  3UE1 A;  3G4S A;  2PI2 E;  3NEL A;  2R7D A;  2D0P A;  5IY0 A;  3L7Z C;  1M1K C;  2WB1 E;  2I5M X;  4K0K L;  3B6Y A;  1NMF A;  3U58 A;  1Q46 A;  3CCV A;  1QZH A;  3S2D H;  2QA4 A;  1G6P A;  3BZK A;  4LFA L;  2OWO A;  2JA8 H;  3CPW A;  4A75 A;  4DV7 Q;  1X3E A;  3J80 i;  5JEA G;  1PH1 A;  3S17 H;  5C4X G;  4DUZ L;  3HKZ G;  4BBR G;  5M5W H;  1YZ6 A;  4A3M H;  1IBM L;  5IP9 G;  4BBR H;  4DPG A;  2CWA A;  5H1S E;  2A1A A;  3AFP A;  3W1G A;  1PH6 A;  4LF9 L;  4IFD I;  3E9H A;  3MXN B;  2YYZ A;  3G71 A;  1K8A C;  1JJ2 A;  4A93 H;  4A3I G;  1YHA A;  2D62 A;  1A0I A;  3CCM A;  4IPH A;  4ALP A;  1NY4 A;  4P72 A;  2RHQ B;  1XNQ L;  1XNR Q;  1H95 A;  4YWL A;  1LYL A;  3HOZ H;  1X65 A;  4BY7 H;  2CFM A;  2VL6 A;  4DV0 Q;  2JEB I;  4BXX G;  3RR5 A;  3S16 H;  1N32 L;  5ELN A;  3TRE A;  1W3S A;  5C44 G;  1K8G A;  2I5H A;  1G51 A;  1OXT A;  1VQ8 A;  1EQQ A;  3T1Y L;  5LMN Q;  2LXJ A;  1QUQ A;  3ULJ A;  1IYJ B;  3TS2 A;  1HH2 P;  3PO2 H;  4A3B H;  1EIF A;  1KAW A;  1L1O C;  2CWP A;  1PH7 A;  1HR0 L;  3STB D;  5FLM H;  3AEV A;  4LWC A;  4P75 A;  1GKH A;  1EFW A;  2Z6K A;  4A3D H;  1AH9 A;  2PI2 A;  3OW2 A;  3I4M G;  1YEZ A;  4JYA L;  2UXB Q;  2R7F A;  1N34 L;  3HFZ B;  4LF7 L;  3KF6 B;  4OX9 Q;  1WCM G;  1HNX L;  4JI6 L;  2BA1 A;  1FL0 A;  3GTK H;  5GAD C;  1JJG A;  4DUY Q;  3H0G G;  3A0J A;  3HOU G;  1YI2 A;  4OON A;  2JK8 A;  3STB C;  4GNX A;  1HR0 W;  2ZJQ A;  4NXM Q;  2NVQ H;  5GRO A;  4A3I H;  1TWH H;  2EIF A;  4P71 A;  4JI0 Q;  4QL5 A;  1I50 H;  4X65 Q;  3Q8D A;  4R4Q A;  3GTG H;  3S24 A;  5IP9 H;  1XPU A;  2UXC Q;  1UE7 A;  1VQD A;  3G48 A;  3KF8 B;  4HJ8 A;  2R6G A;  3CCU A;  4IPG A;  3RN5 A;  2F3I A;  3ICE A;  1EIY B;  1KRT A;  5IYC H;  1NBW A;  3W1B A;  4DR4 L;  3J81 i;  2UUC L;  2JA7 H;  2YTY A;  1XNR L;  2R7Z H;  3KLW A;  1N32 Q;  2MQH A;  1A63 A;  2WP8 J;  1OXS C;  1YJW A;  2NZO A;  3GTJ H;  3I2Z A;  4AQY Q;  1E1O A;  1S3O A;  2HT1 A;  3DM3 A;  5JEA J;  2AHO B;  1X55 A;  2JA9 A;  5GQO A;  2Q2H A;  4AYB G;  2HHH L;  1E7Z A;  4LUV A;  3GO5 A;  3U4V A;  1VQL A;  4A3F H;  2JA7 G;  1JB7 A;  1CSQ A;  4DK3 C;  2I5L X;  5LMN L;  3NEM A;  2BA0 A;  2IX0 A;  2GN5 A;  2IHF A;  3SGI A;  4JI2 Q;  1X6O A;  4LF4 Q;  2K52 A;  1W2B A;  5M3F G;  1KC8 C;  1HNZ L;  4QQB X;  1R9T H;  1VQA A;  5IT9 c;  3CCS A;  1N34 Q;  1SR3 A;  1N9W A;  3AYH B;  1S72 A;  2AWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...