4GKKL

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aua-codon in the a-site and paromomycin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
total genus 14
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4gkkL00
4XTCS 1BBWA 4BA2I 1SR3A 4P72A 1HJPA 4JG2A 4X62Q 3OTOL 4B3ML 4LF9Q 2A1AA 4R4CA 5M5XH 4GLXA 4BBRH 2Q2HA 1KQSA 2D0PA 1FVIA 4AYBE 5J3BA 4JBJA 4LUOA 1FL0A 4LF4Q 3CMEA 1I50H 1X65A 2BA0A 3OYYA 4XIGS 4B3TL 1VQKA 1Q1EA 4TVAB 3CCQA 1IZ6A 2ZTCA 4IFDJ 5IWAL 1PVOA 1YI2A 4GN3B 2LXKA 4DV5Q 3KDFA 1PH2A 2Q2UA 1IBKQ 4NB3A 3GTKH 4JI0L 3I4NG 1TXYA 4DR3L 1J5EL 4A3DG 1OXVA 2NVXH 5C44H 1WYDA 3RLFA 3OW2A 5GROA 1EFWA 2R7DA 1RIPA 3RNUA 3HKZG 5AJ3L 4DV7L 4JI8L 3PO2H 1E1TA 3S1MH 1VQGA 2JEAI 1VQFA 1TWHH 1YNXA 4OWWB 1EWIA 4LF8L 1KD1C 4A3FH 1X9NA 3M4OH 1PFSA 5IE8A 3WWVA 5DLQE 2Z6KC 4DK3C 4LFCL 5GAEC 3RLOA 4C2MH 2B63H 2V1CC 4KI0A 4X66L 3K7AH 4GKJQ 1B70B 1NBWA 1Z47A 4JI6Q 1VQ7A 1OXUA 4LWCA 3CD6A 2R93G 1P8LA 1FGUA 1NTGA 1WOCA 3ERSX 1YVCA 5LMNL 4HIMA 1Q7YC 2K5HA 4JV5Q 1KRSA 2K52A 5M3FG 4JBMA 2JA6H 1OXSC 2OTJA 3K7UC 1GVPA 3I55A 3AYHB 2WAQE 2IX1A 3A74A 1HH2P 2NVTH 2N78A 3JAMi 3I2ZA 4A3KG 1VQBA 4A3BH 3CCMA 2VZAA 1G6PA 1VQAA 1EQRA 3UDXA 4DR4Q 3H0GH 2NVYH 1T9HA 1X54A 4DAYB 1HNWQ 1GKHA 5C0XI 1CKNB 3HOWH 2UXBL 2YYZA 1S40A 4DR6L 4A3IH 4DV1Q 1A62A 1X55A 1XMQQ 3SGIA 3W1BA 1K9MC 1I94L 2OWOA 3HOVH 2VQEL 1B7YB 5M3MG 2K50A 2NVQH 3UE0A 4HJ5A 2VL6A 1KAWA 1PYSB 2Q2IA 2JJQA 3CCRA 2B29A 3PUZA 1HZBA 4O2DA 5JEAJ 1EUJA 3D31A 2ZJPA 3TS0A 4A3EG 2JEBI 4OX9L 1V43A 4DAMA 5EAYA 1NMGA 3CC4A 1E7ZA 1IYJB 1NMFA 5IYBG 1YJNA 4A3CG 1A63A 4GLVB 1Q12A 4NXNL 2WFWA 2PMZE 1D7QA 2MQHA 4DV2L 1PH9A 2JA7H 4UP8A 3MXNB 4OWXB 5C4XH 2PQAB 2YTVA 4BY1G 3UDFA 3FKIG 3AFPA 1XPRA 4KHZA 1PH7A 1PH5A 4DR7Q 4X65Q 2PNHA 4A4IA 2KENA 4IO9A 2UXDL 1G291 4MZ9A 3H15A 2PI2A 1TWGH 3CCUA 4QY7A 3CW2C 4A3MH 3Q8DA 4JYAQ 2NZHA 1EQQA 1XNRQ 1CKMA 2ZTEA 3BU2A 4JI0Q 1N32L 3NELA 1U0LA 2VS1A 2A8VA 4EQ5A 4JI4Q 4LF7L 2ZJRA 4YHHQ 2UUAL 2OQKA 1K8GA 3I4MG 1PH3A 4JOIC 2HIXA 5M5WH 4LF5Q 2UXCQ 5JJIA 1AH9A 1MKHA 4DV6L 4BBSH 2YTYA 5K36G 1QZHA 4P75A 3S2HH 1LM0A 1W2BA 3I4NH 4GS3A 1Q86C 1N33L 4DUYQ 4YCUA 1DGSA 2I5MX 1VQEA 4C3JH 2K5NA 4A3DH 1CKNA 1SROA 4JI2L 3KYHC 1XMOL 4GNXA 2F3IA 3J80i 5IP9G 1HNXQ 3JC66 3KJOA 1YITA 3EN2A 3S17H 3E9IA 1UWVA 4QGUA 3PGZA 4AIMA 4B3SL 4KLKA 2F4VL 4JC0A 5IP7H 3CPFA 1HNZQ 4UPAA 4A93G 4MTNA 1JJGA 3DLLA 2ZTDA 5BR8L 1Y14B 3F8TA 3H3VH 2JE6I 1G51A 2GVBA 5IYCG 4HJ9A 3KF6B 1N36L 3NBHB 1PV4A 2I5LX 1KC8C 3RN2A 1E24A 4R4TA 4HJ8A 3ULJA 2E5LQ 2KCMA 2PQAA 1FJGQ 1XNQL 2R93H 1L1OB 2AHOB 2IT1A 4R4QA 1Y1WH 1SN8A 3PO3G 4LFBQ 4JI1L 3PUXA 3M85A 4A76A 3UDGA 1Q81C 1SE8A 1WI5A 5LMUL 4X64L 4K0KL 1A8VA 1N34L 2R7ZG 1YJWA 4JI5Q 1I94Q 1IBLQ 4JOIA 3D0FA 3DM3A 4DR2Q 2UXDQ 3K0XA 1BBUA 5IT9c 1V9PA 1L1OC 5IYDG 2I0QA 3CC7A 1HR0L 3HOUG 2VQFQ 4IOAA 1Q46A 2MO1A 3HKZE 1Q82C 1VQ4A 2E2HH 4NXNQ 2QA4A 1Y1VG 3EIVA 3GDEA 1QZGA 4IFDI 1XPOA 4LF6L 4EX5A 3T1YL 1VQ6A 1KRTA 1B8AA 1L0WA 3GTQH 2RHQB 4AH6A 5M3MH 4JI7Q 2HT1A 1E3PA 5FLMG 2E8GA 5C3EG 2CFMA 2HHHQ 4Y52H 2AMCB 1K3RA 2F52A 2N49A 5GQOA 2JA5G 3U58A 1JJ2A 1H95A 5HY6A 4UP9A 3K80C 5LMNW 3L7ZC 4A3CH 3CMAA 1P16A 2JK8A 3PUYA 2ZJQA 4BY7G 1C0AA 3E9HA 4P71A 1EYGA 2VY3A 2R92G 1JT8A 2OCEA 3A5UA 4DUZL 5C0XG 1VQHA 5C4JH 1GM5A 5FJ8G 3G6EA 4DV0Q 4BY1H 4AQYQ 2CQOA 1K8AC 1KIXA 1Q1BA 4DR1Q 4HJ7A 1S72A 4B3RL 1M1KC 4O0AA 2D62A 1XPUA 1EIFA 3KF6A 4YY3Q 3EBEA 5GAHC 4A3JG 4NXMQ 1TWCH 2B3GA 2ASBA 4YWMA 1IBML 3A0JA 1KHIA 5GADC 3TREA 4DR5Q 4DPGA 3PF5A 1CUKA 1L1OA 2HIVA 4PZ7A 4RMFA 1PH1A 4BXXH 4GN4B 3CCJA 1PH4A 1AE3A 3RR5A 4BBRG 3M7NA 3T1HQ 1K0RA 1VQJA 4KHPQ 1I5FA 3A5ZB 4GNXB 4GKKL 2VUMH 2XTIA 3TQYA 2IX0A 5JEAG 2UU9Q 3PIOA 4DV3L 1M90C 1SMXA 3PF4A 4B3SQ 1CSQA 3HKSA 4JI3L 2UUBL 4TQUS 1E22A 3G48A 1XJVA 4LW1A 4X62L 2UUCQ 3F2DA 4LFAQ 1W3SA 4P73A 4LF9L 4GNXC 4APVA 2GN5A 4LNQA 3OTOQ 4GOPB 1X3FA 5C44G 1K73C 1EIYB 4B3MQ 5IP9H 4LF4L 2E2JH 4QIWE 1MJCA 3ULPA 3HOXG 1ASYA 4RG1A 3S15H 2ALYB 2K75A 4DV5L 2CWPA 3KLWA 4OXPA 4OO1I 3BZKA 4LUVA 4B3TQ 1TWFH 1WCMH 2K5VA 1QVGA 1IBKL 2KHIA 5IWAQ 2KBNA 4DV4L 3J81i 4GOPC 3MEFA 4R1JA 2MFIA 4DKAC 5M5YH 1J6QA 1BVSA 4L5TA 1O7IA 3IRBA 3JAMc 1LUZA 4A3LG 1XTDA 2HQLA 4DR3Q 1J5EQ 1X3GA 1KXLA 2MO0A 3GD7A 3U4ZA 1NE3A 2CCZA 4POGA 3PO3H 5AJ3Q 4DV7Q 1I6HH 3I7FA 4JI8Q 3TEHB 2LSSA 3UDIA 1CKOA 4WJ4A 4LF8Q 1Z9FA 3ER0A 3U4VA 3FHWA 3AQQA 3M9BA 3K81C 3U50C 1KL9A 1VQMA 1ASZA 3HOUH 4GKJL 3S24A 4LFCQ 3TS2A 4A3BG 2YV5A 3HOYG 4X66Q 3KF8B 4Y7NH 1VQPA 3S1NH 3PIPA 1YJ9A 3CP0A 3PSIA 1PHJA 1V1QA 3E0EA 3HOWG 5LMNQ 2IHFA 4J15A 3F2CA 5FLMH 3HOVG 1HZCA 2C35B 3F1ZA 3S1RH 4A3GG 1X3EA 1UE5A 2JQOA 4K0KQ 4H02A 5JJLA 4PZ6A 4NPSA 4GOPA 2GVAA 1GD7A 1E1OA 3RN5A 4QQBX 4DR4L 2R92H 1HZAA 2AWOA 1HNWL 1YHBA 3HOZG 4IFDG 1A0IA 4DV1L 2MNAA 1XMQL 1VQIA 2Y0SE 2Y0SG 4LUZA 1VQCA 2JA7G 5C4XG 2H5XA 1RL2A 5E7NA 1WFQA 2K14A 4YWLA 3L0OA 5M3FH 2UXBQ 1HR0W 4DR6Q 2Q2TA 3AEVA 2EIFA 2VQEQ 4FDBA 1JJCB 3S16H 1PA6A 1SRUA 4JI3Q 4A3KH 2OTLA 4PMWA 4OX9Q 3STBC 4YCWA 3CCEA 3CCSA 4HIKA 1I3QH 3S1QH 1YHAA 4C3HH 1UE6A 1TWAH 1YZ6A 4DR7L 4AYBG 3L2PA 3J80c 4DV2Q 3GTPH 1QVFA 4X65L 4PG3A 3G71A 4L5RC 2JA8G 1C7YA 3RZOH 1PYBA 4JBKA 4JYAL 3I4OA 2NN6I 1UE1A 4A3EH 2YU9H 1XNRL 1HZ9A 1X6OA 2OQ0A 2A19A 4MNOA 2ZM6L 2R7FA 2QEXA 4A75A 4BBSG 3W1GA 5IYBH 2WB1E 4DV4Q 2WB1G 3ZJYC 4HIDA 1SLJA 1QVCA 3F2BA 3M4QA 4JI4L 5GAGC 5ELOA 2BA1A 1N32Q 4YHHL 3PUVA 3FKIH 3HOXH 1QUQB 1IL2A 1VCIA 2IHEA 1VQOA 4LF7Q 4IJLA 4IPHA 2RCNA 1L2FA 4LF5L 2UXCL 2UUAQ 1YEZA 1MIUA 3K8AA 4JBWA 5IP7G 3KJPA 2RF4A 3CXCA 4ALPA 3GTMH 3B6YA 3VDYA 3M3YH 4DUYL 4DV6Q 1D8LA 4ME3A 4OONA 4A3LH 1JE5A 4HJAA 1N33Q 1VS0A 4UY8C 1HNXL 2E2IH 1SFOH 2NZOA 1YHQA 4JI2Q 3BJUA 1XMOQ 1Y1WG 3FP9A 3BZCA 3I4MH 1HNZL 2R6GA 3NEMA 2ATWA 4OO1G 2RHSB 3AFQA 5C0XJ 2F4VQ 3CC2A 3CF5A 4YWKA 4WJ3M 2WAQG 3J7A5 2XGTA 3LGJA 3ICEA 2BH2A 3STBD 5FLXc 5BR8Q 3CCVA 3H3VI 4QJFA 2E5LL 4PZ8A 1VQ5A 4R4OA 1OTCA 1FJGL 3CQZH 1N36Q 1C9OA 1VQ9A 1VQNA 4DNIA 3HOYH 1VQ8A 4LFBL 1XNQQ 3PV0A 3PO2G 1N9WA 4IJHA 4L5QA 3GTGH 4JI5L 4JI1Q 4GN5A 5LMUQ 4A93H 4A3FG 1IBLL 2KHJA 3CAMA 3UE1A 4DR2L 4X64Q 4POFA 3KFUA 1N34Q 4A3GH 5IY0A 3PCOB 2WP8J 2EXDA 1R9TH 1OXTA 1PH8A 1YIJA 5IYCH 2VQFL 1X56A 2ID0A 4YCVA 2L15A 3GTLH 1VQLA 4R4IA 2Z6KA 1UEBA 2EQSA 2Z0SA 4JCVE 3ULLA 1HR0Q 2B63G 3S14H 1NY4A 3I56A 4GLAC 1QUQA 3HOZH 4IOCA 1CSPA 4JI7L 3GO5A 2BH8A 4L5SA 4DK6C 3M4PA 3W5OA 3T1YQ 2HHHL 4LF6Q 2R7ZH 2K4KA 4HIOA 3S2DH 2IY5B 2JA6G 1GO3E 1AE2A 3TRZA 2LXJA 1U5KA 4IPGA 5IYDH 4X6AH 3NENA 1YBYA 3RLNA 3KDFB 5HGQA 2JA9A 1JMCA 3CCLA 1Q8KA 4B3RQ 1OXXK 4JI6L 2ZM6Q 1BKBA 2N8NA 2CWAA 3J81j 4QL5A 2ES2A 2N3SA 1Y1VH 4BXXG 4C3IH 4DV0L 3H0GG 3PUWA 2AKWB 2VW9A 4AQYL 1EOVA 5H1SE 1LTLA 4DUZQ 4JV5L 4DR1L 2PI2E 4A3IG 2JA8H 4BA1I 4IPCA 5C3EH 3HFZB 2VUMG 2DUDA 3RZDH 2CKZB 4YY3L 3G4SA 4NXML 2JA5H 2D0OA 1IXRA 2I5HA 1UE7A 1JB7A 3CPWA 4IPDA 1LYLA 2QGQA 4DR5L 3J81c 4BY7H 4UP7A 1PH6A 1IBMQ 5ELNA 1VQDA 2YTXA 3T1HL 4OWTB 1MJEA 1S3OA 1WJJA 5FJ8H 3GTJH 3GTOH 2FXQA 4KHPL 2KCTA 1K83H 2UU9L 5JJKA 3J7ZC 1N8RC 4P74A 3KOJA 1NJIC 4GKKQ 2VNUD 2AWNA 2NN6G 4DV3Q 4A3JH 2UUCL 1WCMG 2DGYA 2UUBQ 4A3MG 4LFAL
chains in the Genus database with same CATH superfamily
1LT6D 1BBWA 1SR3A 4P72A 4JG2A 4BBRH 2D0PA 4AYBE 5I4DA 1ML0D 3IAYA 2CQAA 2IX3A 4LUOA 1FL0A 2A6EC 1X65A 2BA0A 2DJFC 4LMQD 4RGNA 4XIGS 4C2MB 1Q1EA 4IFDJ 5C4HA 1YI2A 1Y8PB 2WKCA 3OWEB 4CDEC 1OO9B 1S5ED 2V4DA 1IBKQ 4K6DA 4NB3A 4JI0L 1TXYA 4DR3L 1A6XA 2Q8RE 5C44H 1WYDA 1B44D 2G5DA 2L11A 3QIAA 1O7YA 2LKVA 4DV7L 5KNBA 1VQFA 3AB9A 1EWIA 1XXGA 4A3FH 1X9NA 2F0GA 3I91A 2LMCB 1KLGD 2BE5C 4A3IB 4LFCL 5IGEA 2B63H 1JOQA 3H94A 2Z8LA 2RCFA 1OXUA 3I70A 3MXUA 2PW7A 1I4QA 3AYHB 4F7XA 3A74A 2XIWA 1HH2P 5EKLA 2QKIC 3OMCA 2C5CA 1VQBA 2VZAA 2K01A 1EQRA 4I7AA 4TKOB 3HEJA 1LTBD 1VF7A 1T9HA 1WCMB 4A3MB 3ONAB 2A6ED 4DR6L 4DV1Q 1SAPA 4KV6A 2OWOA 3MA2B 1HPCA 1B53A 3TS0A 2B29A 1MI2A 5JEAJ 4A3EG 1Y69U 1V43A 1A63A 1F2ZA 3CKIB 3CC4A 4A3CG 1S5DD 5M5WB 1PFMA 1XPRA 1LTRD 2LS01 1EY4A 3AFPA 1R4QB 5CGKA 2NN6H 3HKZB 2PI2A 1TWGH 4Y7NB 4JYAQ 1BR9A 1TVXA 2X6LA 2QDBA 1ICFB 3EJIA 1JORA 3NELA 1EFID 2HDMA 5IGFA 1V8QA 4HR7B 2A8VA 1IKMA 5EGTA 4YHHQ 1FNVA 4CJ1B 2OQKA 5EKKA 4EQNA 5ELBA 4P2CB 1NUCA 5EPJA 1PH3A 1X3PA 1K28A 1AH9A 2R93B 4BBSH 5K36G 4P75A 1HXYD 1W2BA 1GHJA 2F0HA 3NTKA 4YCUA 1TIID 5JOBA 1DGSA 1SNDA 2I5MX 4A3DH 3A54A 1CKNA 1E2WA 1SROA 2HQEA 3JC66 3KJOA 3E9IA 1UWVA 3NE5B 4QGUA 4KLKA 3CPFA 1B1ZA 1LTAD 1JJGA 2F3VA 1H9RA 1V1OA 2FMCA 1JOOA 1G51A 1FGBD 2K32A 4HJ9A 2JP1A 5M3MB 1PV4A 2X69A 1KC8C 3RN2A 4KY6A 1SMYC 3ULJA 3ZYYX 2L12A 4DGZA 2BDNA 3A55A 3V96A 1Y1WH 3PUXA 4A76A 1SE8A 4OO1H 5AFWA 4NDXA 2NUCA 4X64L 4HMIA 4JI5Q 1I94Q 2KCNA 5D3IB 3D0FA 4K2LA 1BBUA 4QIWB 5IT9c 1V9PA 5IYDG 2QDLA 3HKZE 3GDEA 4LF6L 3I90A 3EVQA 3GTQH 2Q8IB 4JI7Q 5KYIA 1E3PA 2KA7A 2F3WA 2QEJC 2F52A 2N49A 2O2LD 5KNDA 3U58A 1H95A 5LMNW 1WVLA 4CKBA 1P16A 3OPOA 3CMAA 1C0AA 4P71A 1EYGA 2VY3A 3A5UA 4DUZL 5C4JH 3DMUA 3C1FA 3NWSA 2CQOA 4ZKBB 1K8AC 3WOEA 3CQZB 4HMJA 1M1KC 1D1KA 3BZDB 1DJRD 3GV6A 4F8MA 4A3JG 4YWMA 4B08A 1IBML 1KHIA 2EYHA 3NSWA 4DR5Q 1SMYD 1CA5A 1AP0A 1ESFA 5ELFA 1AE3A 3RR5A 4C3HG 3QWNA 5IGBA 1I5FA 3A5ZB 4GKKL 2HDLA 3OWFA 4KHPQ 4I7ZC 2RDGA 3TQYA 2IX0A 1EL0A 1SMXA 3PO3B 3G48A 2DNEA 2K1BA 4LW1A 4X62L 5I9OA 5KYLA 1B50A 2R7ZB 3D4DA 2PO4A 3R3OA 5FO9B 4LNQA 1EIYB 3QB3A 4QIWE 1MJCA 3ULPA 3S15H 4RCNA 4RG1A 1SYGA 2KQ3A 1K8MA 4DV5L 2CWPA 1Y1VB 4C3IB 2KHIA 4DV4L 2NYZD 2BDOA 3IRBA 4A3LG 5C3EB 5JVH3 2HQLA 4DR3Q 3RZDB 4IN3A 2MO0A 1ZXTA 3GD7A 3U4ZA 1Y8OB 3S1RB 2JA5B 1II3A 2F0VA 2R3ZA 2RDHA 4DV7Q 1B3QA 1VMPA 1E0BA 1ONLA 3QOLA 2A74C 2KUMA 2R92B 3ER0A 1EYAA 3E6ZX 2MJ8A 3GTJB 1XX8A 2I07B 3K81C 1WTQA 3SK6A 1VQMA 2PZWA 1ASZA 1PZJD 4GKJL 3S24A 4LFCQ 4A3BG 4FF3A 4NMZA 2F4IA 3HOYG 3PIPA 4IQZA 1PHJA 2K5DA 3E0EA 3HOWG 3J80E 3JAML 3F2CA 5I2YA 4KTAA 1VDZA 3SEBA 2VXWA 3Q22A 3Q6SA 4NPSA 1GD7A 3D6WA 1S5FD 3M7GA 1HNWL 5C0XH 2MNAA 1XMQL 2B2YA 1VQIA 2Y0SG 2JA7G 5C4XG 2H5XA 1RL2A 4DR6Q 2NVXB 4DN4M 4ZYSA 3SR1A 3NP8A 3S1MB 4PMWA 4YCWA 3CCEA 3CCSA 3OIPA 1MBYA 1I3QH 3M4OB 1YHAA 2AQ3B 2QCPX 1GOZA 1TWAH 4U673 5CV9A 3L2PA 2B2UA 2KEEA 4PG3A 3G71A 3RZOH 3I4LA 2RBMA 4RGOS 4JBKA 4BS9A 4DXFA 3T13A 2NN6I 4A3EH 2YU9H 1XNRL 1HZ9A 2OQ0A 4RH6A 1KDBA 2A19A 2F0WA 2R7FA 4MNOA 2ZM6L 3NQTA 1EU4A 1C8CA 2B8FA 2N88A 2KJXA 2WB1G 2QF7A 2PCFB 1WTOA 3HG9A 2EZVA 3TBIB 3HZXA 3KK7A 1D5MC 4IJLA 4IPHA 4LF5L 3MVVA 4CDCC 3K5OA 2AQ2B 1MIUA 1VMCA 2PNRC 2F0MA 5E3FA 2RF4A 4MHEA 4MIUA 3VDYA 3M3YH 4DUYL 2Z4HA 1HCZA 5ELDA 5IGGA 3OHXC 3HOVB 2Z9HA 4DA2A 2NVQB 1HNXL 4A3GB 2NZOA 1R9TB 1GUTA 1TQOA 1HNZL 1O7LA 2MP1A 1JWUD 2ATWA 4KHVA 5E4WC 4PMCA 5D3DA 4WJ3M 2WAQG 3J7A5 3FPPA 2F0UA 1EY0A 2E5LL 1FJGL 1STHA 1PRTF 2FINB 5C5LA 4N8FA 1O78A 4DNIA 4LFBL 4RWSC 5EQ0A 2Z6BA 5TSSA 4KN7C 4GN5A 1BDOA 4A3FG 4HCEA 4X64Q 2WP8J 2H4OA 3TP7A 5DAUA 1UEAB 4YCVA 3GTLH 4L8JA 2Z6KA 4JCVE 2B63G 3S14H 4K8IA 4QMGA 1O7ZA 1BF4A 1CSPA 3VYTA 3GO5A 2BH8A 5FLXL 3V05A 1G2SA 4LF6Q 2HHHL 2IY5B 1GO3E 3TMEA 1ET9A 2RSNA 5IYDH 4K6LA 3NENA 4FF1A 1YBYA 5HGQA 3S17B 3F2UA 4I65A 2N8NA 2CWAA 1EY6A 2ES2A 1SYDA 4DV0L 3PUWA 4DUZQ 3D8GA 4FXKC 2PI2E 2JA8H 3HFZB 4IUQA 2VUMG 1F2MA 4YY3L 4NXML 3MFYA 1TKWB 1JB7A 2A5HA 4S3SA 4KK7A 2XRQD 3J81c 4UP7A 1PH6A 2WV6D 3E0JA 1IBMQ 3T1HL 1MJEA 1S3OA 1WJJA 2KCTA 3HP3A 5JJKA 1N8RC 1LT4D 1NJIC 5KRUA 4GKKQ 1ICWA 2EOTA 2NN6G 4A3JH 1UNSA 2UUCL 2E2HB 1U9RA 1D6EC 4TSSA 3MTSA 2SDFA 4X62Q 3FRPB 4B3ML 4R4CA 5M5XH 1RCVD 1CI3M 5J3BA 4JBJA 1I50H 4B3TL 4TVAB 3CCQA 5IWAL 1PZKD 2OEOA 1AZQA 2LXKA 4DV5Q 1SDFA 2Q2UA 5IGCA 1PTOB 1WTHA 4HN7A 1J5EL 2JA6B 2LY7A 1OXVA 1ZKOA 3IFDA 4A3DG 3RLFA 1RIPA 3C1EA 4JI8L 1E1TA 3QJYA 1VQGA 4OWWB 3QR8A 4LF8L 1KD1C 4RGTA 2F1MA 2RVLA 2K33A 4FXGC 1PFSA 1X32A 3H0GB 2NVYB 5IE8A 1JC7A 4DK0A 3KUPA 2NZ1D 4DK3C 1HUNA 2DNCA 4C2MH 1EYCA 3U9OA 2V1CC 4X66L 2K05A 3K7AH 3K5NA 4GKJQ 3ND9A 4LWCA 1P8LA 1NTGA 1WOCA 1PYWD 5IOCA 4FXDA 4KD4A 4JV5Q 2DY8A 3VA7A 1BBXC 3A7AB 1PRTC 4IUTA 1ET6A 2B2WA 2N78A 4A3KG 1MSGA 4A3BH 3CCMA 3I73A 2KECA 4NP5A 4CJ2C 1G6PA 5E4XA 1CHQD 3UDXA 3IL8A 1WD0A 4DAYB 1HNWQ 3VYRA 5C0XI 3A7LA 3HOWH 1S40A 4A3IH 2I46A 1XMQQ 3SGIA 3W1BA 1I94L 2K50A 1DZ1A 2VB2X 4OGQC 2D2CC 2VL6A 1FYCA 1FR3A 2Q2IA 3PUZA 4UAIA 1EUJA 2JEBI 5EAYA 1NMGA 1I6HB 1YJNA 4H44C 2F0SA 4GLVB 2F0IA 3C2PA 2PMZE 3BG3A 4XYOA 2JA7H 3MXNB 5C4XH 2PQAB 4TRDA 4RKBA 3UDFA 3FKIG 1PH5A 1IYUA 1EEFD 4C3JB 3SDZA 2PNHA 3EA6A 4MZ9A 3H15A 3VYUA 4A3MH 3Q8DA 2NZHA 1XNRQ 1C4QA 4DF7A 3D3RA 5IIFA 2K03A 1M4VA 2ZJRA 3BVGA 5DM73 3I4MG 4EVOA 5C5MA 1DOLA 1A2TA 1PRTD 4JOIC 5M5WH 4LF5Q 5JJIA 1MKHA 4DV6L 2SOBA 1QWYA 4XQJA 1QCBD 4DUYQ 5M3FB 2K5NA 4RA8A 4JI2L 3MWYW 2F3IA 5LHY1 1HNXQ 3I8ZA 1JWMD 4F87A 1YITA 3AMUA 1XTCD 3J7AV 4JC0A 1HNZQ 4A93G 3S1QB 2ZTDA 1LT5D 5BR8L 1PFBA 2GVBA 4G4KA 4R8NA 4IUPA 5IYCG 1N36L 3DWAA 1Q90A 4HJ8A 2E5LQ 4ZK9B 1FJGQ 2KEDA 1STNA 1XNQL 2R93H 1L1OB 1SN8A 4LFBQ 4JI1L 4ZKCB 4J6HA 3M85A 3UDGA 1Q81C 1RTOA 2LFNA 5BN3A 2F0FA 1A8VA 3ERQA 1YJWA 3R2IA 4OL7A 5T1IA 4JOIA 3DM3A 4BY1B 1HR0L 1LV9A 5JJZA 1LTID 4M1UB 4FVMA 3BDCA 2MO1A 4CBVA 1F9SA 3OIQA 2L55A 1H9MA 1B8AA 3KLSX 1L0WA 2RHQB 5M3MH 5LL6X 3SHLA 1JE4A 2HHHQ 2E2IB 1K3RA 3K80C 3L7ZC 2JK8A 2ZJQA 4BY7G 1B9MA 1L0YB 2H1EA 5C0XG 5FJ8G 4EQOA 5I9PA 4DV0Q 3T53B 2C9OA 4ILWA 4O0AA 3KF6A 4NKLA 4YY3Q 2NTSA 2EY5A 3NBHA 3SK5A 4NXMQ 2ASBA 2BOSA 4ZQ3A 3W3AA 3GTGB 3TREA 2EYJA 3QG1A 1X3QA 4PZ7A 3JAME 3C3LA 2IJ0A 3J7YW 4GN4B 3CCJA 1PH4A 3LWEA 3T1HQ 3GQBA 5M5YB 1K0RA 4GNXB 2VUMH 2B2TA 2XTIA 5JEAG 4DV3L 1M90C 3CU7A 1CSQA 2J0TD 4IALA 1E22A 3R2TA 2UUCQ 1SYBA 4QB4A 1IKLA 4LF9L 3S2DB 4B3MQ 1EYDA 5ISRA 2E2JH 5CV7A 4DNTB 1ASYA 3HOUB 3MEHA 2EJGC 3KLWA 4LUVA 4B3TQ 1TWFH 2KCCA 3S1NB 1A3VA 3PIO3 1QVGA 1ENAA 5IWAQ 2KBNA 3J81i 5A35A 4GOPC 2WACA 4DKAC 1J6QA 3VYSA 1Z6HA 2X6GA 1CQFA 1XTDA 2EYLA 1J5EQ 1KXLA 4POGA 3PO3H 3I7FA 4R9WA 4JI8Q 2LSSA 4H7BA 4ZUJA 3UDIA 3SXHA 2AUJD 1WTRA 3Q24A 4OEMB 4LF8Q 4CDDC 1BO0A 3H6MA 5CBEE 3U50C 3KLSA 2AUKA 2F0OA 1SXTA 2CH4A 3Q0AA 2XNAC 3KF8B 4X66Q 2FJ2A 3D6CA 1STEA 5FLMH 3FDTA 4ID6A 1E2ZA 1HZCA 2WKDA 3F1ZA 5FO8B 4BBRB 3S1RH 3FEWX 4F88A 3GTPB 3K59A 2L5TA 1QG7A 4GOPA 3RN5A 4QQBX 4DR4L 2R92H 2Z1CA 1TY2A 2AWOA 5EPKA 4BWGB 1YHBA 2Y0SE 4RAUC 1VQCA 4IUNA 2PQEA 2N55A 3L0OA 3DWQA 4IUUA 5C44B 3AEVA 1I4RA 4R8IA 3S16H 1PA6A 1KNAA 3HOXB 4A3KH 2OTLA 2F0LA 1F2YA 2RA4A 1A15A 2F0PA 1UE6A 1YZ6A 4M8AA 4DR7L 4AYBG 2K5WA 3J80c 1QVFA 1LO5D 3J81L 2JA8G 1BQQT 3TSSA 1C7YA 1QJOA 1H9SA 3OW7A 1KAAA 4RHSA 1EIGA 3W1GA 2WB1E 2O5IC 3NXWA 5FLXE 3ZJYC 4HIDA 1QVCA 4E6IA 1WTPA 5KEEA 2BA1A 4V190 2RKSA 3FKIH 2JSOA 1VCIA 2IHEA 1B2TA 2RCNA 1L2FA 3RD4A 2UXCL 2IL8A 1I4HA 5CR3A 3KJPA 3GTMH 3KBGA 4DV6Q 2HD3A 4ME3A 1V1PB 4OONA 3N6RA 1VS0A 1PLFA 1SFOH 5C6AA 1EY8A 4JI2Q 3I3CA 3I4MH 3VR5A 4RHRA 3AFQA 3U9SA 4ZAIA 1D5ZC 2ENBA 1S5BD 3TDQA 2XGTA 3ICEA 3K57A 4JVZA 4IUVA 5BR8Q 3CCVA 3SE0A 1QILA 4R4OA 1OTCA 4LK1C 1N36Q 1VQ9A 1EEID 1VQNA 2R61A 1ILPA 1XNQQ 1SJHD 3PV0A 3J7AF 3NUCA 1PDQA 4K5XA 4JI1Q 4A93H 2SNMA 1IBLL 4DR2L 3CAMA 1W6JA 5F2DA 4A3GH 3PCOB 2EXDA 1R9TH 2MUYA 2XSCA 5IYCH 2VQFL 2ID0A 2L15A 1VQLA 2DN8A 2Z0SA 3ULLA 1HR0Q 2B2YC 4WFN3 1QUQA 3HOZH 4IFDH 1BCPD 2FFKB 4BBSB 4IOCA 1RF2D 4MTKA 3K6OA 4C56C 4DK6C 3W5OA 3SK8A 1WTVA 1EY7A 2D5DA 1AE2A 3TRZA 4XDXA 4L6TB 1K83B 1SYCA 4X6AH 2B2VA 2AQ1B 2JXMB 1WD1A 3CCLA 1UUPA 4B3RQ 5I6YA 4QL5A 1BOSA 4BXXG 2B2UC 3SK4A 2AKWB 2VW9A 4JV5L 5H1SE 4JPBW 4A3IG 5KGUA 4IPCA 1IHZA 1SE3A 1LYLA 2QGQA 1Y1WB 5FOBB 4BY7H 1HHVA 3H3VC 5KNCA 5DEHA 2HUGA 4DAYA 3D4WA 5FJ8H 3GTOH 2FXQA 2EYOA 3GTKB 3J7ZC 1S5CD 2M00A 4IURA 1ESRA 4DV3Q 2EPBA 1WCMG 2DGYA 4A3MG 3R93A 1HRJA 5EBDA 3GTQB 4BA2I 1HJPA 3OTOL 1NAPA 4LF9Q 2Q2HA 1KQSA 3MFGA 3RMHA 1STBA 5JEAH 3CMEA 3OYYA 4J8QA 1I4GA 1AFPA 1VQKA 1IZ6A 2ZTCA 1PVOA 1CQVA 3KDFA 1PH2A 1HQRD 1LLRD 5A2QL 1EFWA 3OW2A 5GROA 2R7DA 3HKZG 1F9QA 2NVTB 3PO2H 4XT3B 2NWGA 2JEAI 1TWHH 1SNPA 5DLQE 2Z6KC 5FK9C 5GAEC 1YNNC 4OIJA 4Q5VA 3RLOA 4KI0A 4EGVA 1B70B 4JI6Q 3CD6A 2R93G 3FVQA 5LMNL 2G9DA 3ERSX 1U4PA 1QOHA 1PTOH 2K5HA 1LTGD 4JBMA 2JA6H 1OXSC 5JAVA 1DYQA 1GVPA 1I6VC 2K5QA 3I55A 2IX1A 1HFNA 3S15B 2MHVA 1NNXA 3BDOA 1F9PA 2K7VA 1VQAA 3EFXD 3DXJC 4DR4Q 3H0GH 2NVYH 1GUOA 1X54A 3L9AX 1QNUA 1GKHA 1CKNB 4DK1A 2F0KA 2CW0C 5CBAE 5M3MG 1G6ZA 4KJOA 3CCRA 2EDGA 4O2DA 5IODA 3IKJA 4OX9L 2PZUA 4DAMA 2M9VA 1FNUA 4G7HC 1Q12A 2WFWA 1D7QA 2MQHA 1PH9A 3QOJA 4OWXB 2CVRA 2YTVA 1PH7A 4KY5A 5ELEA 3LX0A 4UHVA 4KHZA 4DR7Q 3OOCA 2ICEC 4A4IA 2KENA 4IO9A 2ZT9C 2EYMA 3CW2C 3E3XA 1YNND 1CM9A 1ENFA 1EQQA 2EY6A 1CKMA 2ZTEA 3NQIA 1SJED 4J1MA 1NR2A 5HGTA 1N32L 5FKAC 2VS1A 4KN4C 4EQ5A 4LF7L 1MGSA 1DM0B 1QB5D 1K8GA 3G7LA 2B8GA 3DHQA 1GHKA 2UXCQ 5T1GA 1QZHA 1SE4A 3DEOA 3S2HH 1LM0A 2JYOA 3I4NH 4GS3A 1Q86C 3T16A 1DD2A 4C3JH 1VQEA 4DXGA 2FHTA 4GNXA 3J80i 1DONA 3EN2A 2CW0D 2PPBC 3PGZA 4AIMA 5BN4A 2ZXRA 4UPAA 2OT2A 4MTNA 1I3QB 4CHTB 1SBBB 1TWAB 1Y14B 3H3VH 2JE6I 2F0QA 4N8X1 2I5LX 4DAPA 2EYPA 2KCMA 2CHBD 4A3EB 2YU9B 3PO3G 1EZ6A 4ODGA 1WI5A 1N34L 2R7ZG 3VR2A 2B2WC 2PMZB 5D14A 5EKIA 4KD3A 1IBLQ 4DR2Q 4ABNA 3K0XA 3CC7A 1R4PB 2VQFQ 1B4OA 2GA4B 1VQ4A 1JQYD 3GP7A 3BYYB 4RFBA 1Y1VG 4NXNQ 4IFDI 4C3IG 1QZGA 3M3YB 1TWCB 1XPOA 1CTMA 1VQ6A 1KRTA 3VR4A 4AH6A 2HT1A 1MSHA 5FLMG 2E8GA 5C3EG 2CFMA 4IZ8A 4Y52H 3A8KE 2AMCB 2EYFA 5GQOA 2JA5G 1JJ2A 5HY6A 5KIXA 3PUYA 1SSOA 4UDUC 2QILA 3E9HA 2R92G 1JT8A 2OCEA 2WIIB 3Q23A 4BY1H 5IT9L 5C3WA 3FPUB 1KIXA 1Q1BA 2F0DA 4HJ7A 2NBFA 2D62A 3QO2A 1XPUA 1EIFA 2B3GA 1CT1D 3A0JA 5GADC 3J80L 2MPMA 5C4ZA 2HIVA 1PH1A 4FO2A 4RMFA 4BXXH 1EOTA 3TZUA 1A2UA 3P7JA 1RODA 3PF4A 3S14B 4B3SQ 2UUBL 4TQUS 1J8IA 2JN4A 4JW0A 4Q0FA 1BXTA 4APVA 2Z4IA 3OMGA 3OTOQ 1K73C 1JB3A 1VF5C 2A6HC 3I72A 5LL6S 5IP9H 4LF4L 1TR5A 1EZ8A 2ALYB 5JVG3 2EJMA 1WCMH 2K5VA 2MFIA 5M5YH 5JPMC 1BVSA 4L5TA 3JAMc 1GJXA 3J81E 2E76C 1M8AA 5BN5A 1MD2D 1CKOA 1Z9FA 3LWUA 3HOUH 1WTWA 3TS2A 1QNKA 1YNJC 5I2XA 1NR4A 1T5EA 2YV5A 3S1NH 4Y7NH 4A3JB 1VQPA 1YJ9A 3CP0A 1G2TA 3P1HA 3RUZA 3PSIA 2J7ZA 5LMNQ 4J15A 3HOVG 2O5JC 1H9JA 4C3HB 4A3GG 1X3EA 1UE5A 3OSOA 2JQOA 4HEDA 1FNWA 5JJLA 3CHBD 3URYA 1I50B 2HCCA 2ZXPA 2A6HD 1HZAA 1RKNA 3HOZG 4IFDG 1A0IA 4LUZA 4YWLA 1WFQA 2K14A 3A8IE 1WTXA 2EIFA 3PQIA 4FDBA 1JOKA 1ENCA 4JI3Q 1IYVA 2XWJB 4OX9Q 3STBC 4HIKA 1CA6A 1EQTA 5C3XA 2B2TC 3GTPH 4X65L 5J22A 1PYBA 2OXPA 4QF4A 2F0EA 3K7AB 1CZWA 4QUCA 1UE1A 1X6OA 4B3RL 1HTPA 1A3TA 1YNJD 4WRDA 2TSSA 1TY0A 1HFGA 5M9OA 3F2BA 4JI4L 5GAGC 5ELOA 1CZGA 1BUVT 1N32Q 1EIHA 3PUVA 3HOXH 1BNZA 1IL2A 4XT1B 4LF7Q 4A3BB 1EU3A 1YEZA 3A8JE 3K8AA 1BCPF 2B39A 5IP7G 3HOYB 2PZTA 4ALPA 2HCIA 5ELCA 3HOWB 1GUSA 5CORA 1PTOF 3DUZA 3MC0B 5CV5A 1JE5A 4HJAA 4O1NA 1AW7A 1YHQA 1KABA 1C48A 3BZCA 1SE2A 4OHJA 2R6GA 1LABA 3NEMA 1AZPA 4U68A 2OF1A 5C0XJ 4XXEA 1Z7TA 3CC2A 4JK1C 4YWKA 2A68D 1CHPD 2XVSA 2Y0SB 4V0BA 2JA7B 5C4XB 3STBD 5FLXc 1EY9A 3H3VI 4QJFA 4PZ8A 3CQZH 4B9WA 3G6JB 2BCOA 3PO2G 4IJHA 4L5QA 2A69C 3KFUA 2UXDL 4MN3A 1N34Q 1PH8A 1YIJA 1X56A 4K2KA 2EQSA 4ZCKA 3I56A 4K5WA 5JPNC 1D5XC 1CK1A 4XYQA 2EXZA 2WB1B 3TP5A 3MHBA 1IW7C 1KLUD 3M4PA 3TN2A 3D4RA 2R7ZH 3S9WA 2XN9C 1IL8A 2JA6G 5A2QE 3HS0C 1XWEA 1U5KA 5CC4A 2BE5D 4IPGA 1RTNA 1JMCA 1SNOA 1OXXK 4JI6L 1S4ZA 1BKBA 2A73B 3X3NA 2N3SA 1Y1VH 4C3IH 3H0GG 3VR6A 4AQYL 3CRLC 1LTLA 4DR1L 4BA1I 1GUWA 5C3EH 3BVZA 2DUDA 3RZDH 2CKZB 3G4SA 2JA5H 2D0OA 1IXRA 2I5HA 2XRSD 4IPDA 1VQDA 2K6AA 2YTXA 2WAQB 3GTJH 1K83H 2A69D 2UU9L 4O42A 1U4MA 2VNUD 2AWNA 1AN8A 2TMPA 4LFAL 2UUBQ 4RCOA 3H09A 3NPPA 4XTCS 3HGBA 4B9XA 4A3FB 2A1AA 4ZLTF 4G7OC 4GLXA 1FVIA 3EROA 5K5PA 3X3MA 1IW7D 4LF4Q 2B63B 4HSPA 4HSVA 4N9TA 1EY5A 4GN3B 1PZID 4X3TA 1NSNS 1MHWC 1XYIA 3GTKH 3I4NG 4HAEA 2SEBD 1RJTA 3K5LA 1RD9D 2F0JA 4C3JG 2NVXH 5EPLA 3RNUA 2DY7A 1FD7D 5AJ3L 1BCPC 3S1MH 1YNXA 1LT3D 1PTOC 3M4OH 1D2BA 3C46A 3NBIA 4ZRZA 1O80A 3KLRA 3WWVA 3NK9A 2EY1A 4X3SA 1B9NA 2VUMB 1PRTB 1TS3A 2KVMA 2IWHA 1NBWA 1Z47A 1VQ7A 1FGUA 4HIMA 1YVCA 1Q7YC 1KRSA 2K52A 5M3FG 4DFAA 3PMFA 2OTJA 3K7UC 2B2VC 2WAQE 4N9PA 4K5VA 1TT2A 2NVTH 2E2JB 3JAMi 3I2ZA 3MXPA 4CDFC 1G91A 1TWGB 1TWFB 5G3LF 1EWHA 2F0TA 2UXBL 2YYZA 1TS5A 1ZEQX 3CRKC 2IW3A 1A62A 1X55A 1K9MC 3HOVH 2VQEL 1B7YB 2NVQH 3UE0A 4HJ5A 1KAWA 1PYSB 2JJQA 1HZBA 3D31A 2ZJPA 1IYJB 1E7ZA 1NMFA 5IYBG 1DOKA 1KNEA 1JICA 1TS2A 4NXNL 3SVMA 4X3KA 4DV2L 4ME5A 4UP8A 4BY1G 1K3BC 1PTOD 4A3DB 1B3AA 4X65Q 1G291 3CCUA 4QY7A 4FNFA 4PNYA 4WORA 3FMCA 3BU2A 2O4XA 3A56A 4JI0Q 1U0LA 4JI4Q 2UUAL 2VB3X 2K28A 2HIXA 1RHPA 1U4LA 2YTYA 5EBCA 2RQXA 4GZYC 2KHSA 3VR3A 1N33L 5IT9E 4EQPA 4FP5D 3KYHC 1XMOL 3S16B 4YIJA 5IP9G 5J1ZA 1NCVA 3S17H 4A3KB 1TS4A 4B3SL 2EY2A 1SYEA 4LJZC 5FO7B 1UAPA 2F4VL 5IP7H 3M4YA 3DLLA 4OIKA 3F8TA 5J39A 4QUFA 3KF6B 4HCSA 2XWBB 3NBHB 1E24A 4R4TA 3MXNA 2PQAA 3WOFA 1PFNA 3DEPA 2AHOB 2IT1A 4R4QA 1KDAA 5LMUL 4KKSA 4K0KL 3P20A 5CV8A 5C4JB 1K0SA 2UXDQ 2D9UA 2P5ZX 3DM1A 3FKIB 1L1OC 2I0QA 3HOUG 1J9OA 4IOAA 1Q46A 2DJGC 1Q82C 5DM63 1PMRA 2E2HH 3GTMB 2QA4A 3EIVA 3K0YA 4EX5A 3T1YL 3BYTB 1LTTD 2RSOA 1SFOB 4DU9A 4UP9A 1Y8NB 4A3CH 3I4MB 1HA6A 5L37A 1W6KA 1STYA 4DAVA 1VQHA 1I4XA 2PYKA 1GM5A 4CGYB 3G6EA 4KY7A 4AQYQ 1ZYRC 4DR1Q 5DNFA 1S72A 3EBEA 5GAHC 1TWCH 1T5XD 3O13A 4QCLA 3H91A 4DPGA 2WINB 1CUKA 1L1OA 3PF5A 1Q8IA 4A93B 5HURA 1H9KA 5NUCA 4BBRG 3M7NA 1VQJA 2L9HA 3GV3A 2NTTA 2UU9Q 3PIOA 2L0CA 2M2LA 3HKSA 4JI3L 3HOZB 5K36H 1XJVA 3F2DA 4LFAQ 1W3SA 2MGSA 4P73A 2E2DC 4WJWA 4GNXC 4PQXA 2GN5A 5EJWA 1X3FA 5C44G 4GOPB 1QE6A 2NB0A 5CMDA 4G57A 4L63B 1L0XB 4KKTA 3MZ5A 3TZDA 3HOXG 4HTHA 5CV6A 2K75A 5E1FA 1G8ZD 4OXPA 4OO1I 3BZKA 1IBKL 1I4PA 3V2TA 4XQNA 3MEFA 4R1JA 1O7IA 4PMBA 1LUZA 2K04A 1X3GA 2G9HD 1EWCA 2CCZA 1NE3A 1ILQA 1LTSD 1ZYRD 5AJ3Q 3K58A 1I6HH 4BY7B 3TEHB 3MAQA 5COYA 1STAA 2EE1A 4WJ4A 1SEBD 3NTHA 3GTOB 5G3LD 3TP6A 3U4VA 1H9SB 3FHWA 3AQQA 3M9BA 3UI2A 3TP8A 4C1NI 1KL9A 2EJFC 2F03A 3P75A 4CKCA 1LACA 2E75C 1F9RA 1V1QA 2IHFA 1STGA 1F2LA 4RGMA 1A3UA 1SNMA 4FF4A 4CKEA 2C35B 3MXGA 4C1NK 5IGDA 5I6WA 4PV1C 4H02A 3ND8A 4PZ6A 3RZOB 2GVAA 1E1OA 2IPKD 4DV1L 4G7ZC 1HTLD 4KKUA 5E7NA 4RKLA 5M3FH 2UXBQ 1HR0W 2Q2TA 1JCKB 2VQEQ 4FYDA 1JJCB 3N52A 2RDFA 1SRUA 2J4XA 3PO2B 1TWHB 3BVMA 1SNCA 4KJNA 2F0NA 3S1QH 4C3HH 4K14A 3NHHA 4DV2Q 1F77A 4LAAA 4L5RC 3T51B 1AEXA 4JYAL 1BCPB 3I4OA 4A75A 2QEXA 4BBSG 5IYBH 4DV4Q 4FF2A 3KF8A 1DOMA 1SLJA 3M4QA 4KMUC 4YHHL 3W2DA 1QUQB 3T4AC 1VQOA 1TU2B 2L1BA 2UUAQ 4JBWA 3CXCA 3B6YA 1EQVA 1Q3LA 3NTIA 1DXMA 2CH4W 1JWSD 1D8LA 1GXDC 4CJ0B 4A3LH 1SYFA 3R8BA 1N33Q 2ZXOA 4UY8C 2E2IH 1CFMA 1U4RA 3BDLA 5CYUA 3L3OC 3BJUA 1XMOQ 3VA5A 3FP9A 1Y1WG 4DNRB 3GTLB 4NW2A 4OO1G 2RHSB 1K8OA 2F4VQ 3CF5A 1GUNA 2E74C 3LGJA 2BH2A 2SNSA 1VQ5A 1HA5A 3NWTA 2ICIA 1C9OA 3HOYH 2L4NA 1VQ8A 2FMMA 3E5SA 4OELB 1N9WA 3GTGH 4JI5L 3T56B 3WDNA 5LMUQ 2KHJA 3UE1A 4K0KQ 4K8JA 4POFA 3BS1A 5IY0A 4AYBB 1OXTA 1KTKA 5D65A 2JA8B 4R4IA 1UEBA 3EQLC 1NY4A 1E2VA 4GLAC 2EVBA 3S2HB 3AU7A 4JI7L 2KOLA 4L5SA 3I4NB 1DCZA 2PW5A 3T1YQ 3S2DH 2K4KA 4HIOA 3IFTA 2LXJA 4X3UA 1KDCA 1V1PA 4ULLA 3RLNA 3KDFB 2JA9A 2QW7A 1Q8KA 2ZM6Q 1RDPD 3ITPA 1JR0D 3J81j 2Q8TA 3K5MA 1EOVA 4Z9CB 5CV4A 1PXUA 3KBXA 5M5XB 1UE7A 1GUGA 3CPWA 4DR5L 4XQQA 1HQMC 5ELNA 4OWTB 4KHPL 1D1IA 4H13C 3PIP3 4P74A 1SNQA 3KOJA 4H0LC 1HUMA 4ZUIA 3HRZC 2A68C 3LNNA 3DWPA
chains in the Genus database with same CATH topology
4XTCS 1BBWA 4BA2I 1SR3A 4P72A 1HJPA 4JG2A 4X62Q 3OTOL 4B3ML 4LF9Q 2A1AA 4R4CA 5M5XH 4GLXA 4BBRH 2Q2HA 1KQSA 2D0PA 1FVIA 4AYBE 5J3BA 4JBJA 4LUOA 1FL0A 4LF4Q 3CMEA 1I50H 1X65A 2BA0A 3OYYA 4XIGS 4B3TL 1VQKA 1Q1EA 4TVAB 3CCQA 1IZ6A 2ZTCA 4IFDJ 5IWAL 1PVOA 1YI2A 4GN3B 2LXKA 4DV5Q 3KDFA 1PH2A 2Q2UA 1IBKQ 4NB3A 3GTKH 4JI0L 3I4NG 1TXYA 4DR3L 1J5EL 4A3DG 1OXVA 2NVXH 5C44H 1WYDA 3RLFA 3OW2A 5GROA 1EFWA 2R7DA 1RIPA 3RNUA 3HKZG 5AJ3L 4DV7L 4JI8L 3PO2H 1E1TA 3S1MH 1VQGA 2JEAI 1VQFA 1TWHH 1YNXA 4OWWB 1EWIA 4LF8L 1KD1C 4A3FH 1X9NA 3M4OH 1PFSA 5IE8A 3WWVA 5DLQE 2Z6KC 4DK3C 4LFCL 5GAEC 3RLOA 4C2MH 2B63H 2V1CC 4KI0A 4X66L 3K7AH 4GKJQ 1B70B 1NBWA 1Z47A 4JI6Q 1VQ7A 1OXUA 4LWCA 3CD6A 2R93G 1P8LA 1FGUA 1NTGA 1WOCA 3ERSX 1YVCA 5LMNL 4HIMA 1Q7YC 2K5HA 4JV5Q 1KRSA 2K52A 5M3FG 4JBMA 2JA6H 1OXSC 2OTJA 3K7UC 1GVPA 3I55A 3AYHB 2WAQE 2IX1A 3A74A 1HH2P 2NVTH 2N78A 3JAMi 3I2ZA 4A3KG 1VQBA 4A3BH 3CCMA 2VZAA 1G6PA 1VQAA 1EQRA 3UDXA 4DR4Q 3H0GH 2NVYH 1T9HA 1X54A 4DAYB 1HNWQ 1GKHA 5C0XI 1CKNB 3HOWH 2UXBL 2YYZA 1S40A 4DR6L 4A3IH 4DV1Q 1A62A 1X55A 1XMQQ 3SGIA 3W1BA 1K9MC 1I94L 2OWOA 3HOVH 2VQEL 1B7YB 5M3MG 2K50A 2NVQH 3UE0A 4HJ5A 2VL6A 1KAWA 1PYSB 2Q2IA 2JJQA 3CCRA 2B29A 3PUZA 1HZBA 4O2DA 5JEAJ 1EUJA 3D31A 2ZJPA 3TS0A 4A3EG 2JEBI 4OX9L 1V43A 4DAMA 5EAYA 1NMGA 3CC4A 1E7ZA 1IYJB 1NMFA 5IYBG 1YJNA 4A3CG 1A63A 4GLVB 1Q12A 4NXNL 2WFWA 2PMZE 1D7QA 2MQHA 4DV2L 1PH9A 2JA7H 4UP8A 3MXNB 4OWXB 5C4XH 2PQAB 2YTVA 4BY1G 3UDFA 3FKIG 3AFPA 1XPRA 4KHZA 1PH7A 1PH5A 4DR7Q 4X65Q 2PNHA 4A4IA 2KENA 4IO9A 2UXDL 1G291 4MZ9A 3H15A 2PI2A 1TWGH 3CCUA 4QY7A 3CW2C 4A3MH 3Q8DA 4JYAQ 2NZHA 1EQQA 1XNRQ 1CKMA 2ZTEA 3BU2A 4JI0Q 1N32L 3NELA 1U0LA 2VS1A 2A8VA 4EQ5A 4JI4Q 4LF7L 2ZJRA 4YHHQ 2UUAL 2OQKA 1K8GA 3I4MG 1PH3A 4JOIC 2HIXA 5M5WH 4LF5Q 2UXCQ 5JJIA 1AH9A 1MKHA 4DV6L 4BBSH 2YTYA 5K36G 1QZHA 4P75A 3S2HH 1LM0A 1W2BA 3I4NH 4GS3A 1Q86C 1N33L 4DUYQ 4YCUA 1DGSA 2I5MX 1VQEA 4C3JH 2K5NA 4A3DH 1CKNA 1SROA 4JI2L 3KYHC 1XMOL 4GNXA 2F3IA 3J80i 5IP9G 1HNXQ 3JC66 3KJOA 1YITA 3EN2A 3S17H 3E9IA 1UWVA 4QGUA 3PGZA 4AIMA 4B3SL 4KLKA 2F4VL 4JC0A 5IP7H 3CPFA 1HNZQ 4UPAA 4A93G 4MTNA 1JJGA 3DLLA 2ZTDA 5BR8L 1Y14B 3F8TA 3H3VH 2JE6I 1G51A 2GVBA 5IYCG 4HJ9A 3KF6B 1N36L 3NBHB 1PV4A 2I5LX 1KC8C 3RN2A 1E24A 4R4TA 4HJ8A 3ULJA 2E5LQ 2KCMA 2PQAA 1FJGQ 1XNQL 2R93H 1L1OB 2AHOB 2IT1A 4R4QA 1Y1WH 1SN8A 3PO3G 4LFBQ 4JI1L 3PUXA 3M85A 4A76A 3UDGA 1Q81C 1SE8A 1WI5A 5LMUL 4X64L 4K0KL 1A8VA 1N34L 2R7ZG 1YJWA 4JI5Q 1I94Q 1IBLQ 4JOIA 3D0FA 3DM3A 4DR2Q 2UXDQ 3K0XA 1BBUA 5IT9c 1V9PA 1L1OC 5IYDG 2I0QA 3CC7A 1HR0L 3HOUG 2VQFQ 4IOAA 1Q46A 2MO1A 3HKZE 1Q82C 1VQ4A 2E2HH 4NXNQ 2QA4A 1Y1VG 3EIVA 3GDEA 1QZGA 4IFDI 1XPOA 4LF6L 4EX5A 3T1YL 1VQ6A 1KRTA 1B8AA 1L0WA 3GTQH 2RHQB 4AH6A 5M3MH 4JI7Q 2HT1A 1E3PA 5FLMG 2E8GA 5C3EG 2CFMA 2HHHQ 4Y52H 2AMCB 1K3RA 2F52A 2N49A 5GQOA 2JA5G 3U58A 1JJ2A 1H95A 5HY6A 4UP9A 3K80C 5LMNW 3L7ZC 4A3CH 3CMAA 1P16A 2JK8A 3PUYA 2ZJQA 4BY7G 1C0AA 3E9HA 4P71A 1EYGA 2VY3A 2R92G 1JT8A 2OCEA 3A5UA 4DUZL 5C0XG 1VQHA 5C4JH 1GM5A 5FJ8G 3G6EA 4DV0Q 4BY1H 4AQYQ 2CQOA 1K8AC 1KIXA 1Q1BA 4DR1Q 4HJ7A 1S72A 4B3RL 1M1KC 4O0AA 2D62A 1XPUA 1EIFA 3KF6A 4YY3Q 3EBEA 5GAHC 4A3JG 4NXMQ 1TWCH 2B3GA 2ASBA 4YWMA 1IBML 3A0JA 1KHIA 5GADC 3TREA 4DR5Q 4DPGA 3PF5A 1CUKA 1L1OA 2HIVA 4PZ7A 4RMFA 1PH1A 4BXXH 4GN4B 3CCJA 1PH4A 1AE3A 3RR5A 4BBRG 3M7NA 3T1HQ 1K0RA 1VQJA 4KHPQ 1I5FA 3A5ZB 4GNXB 4GKKL 2VUMH 2XTIA 3TQYA 2IX0A 5JEAG 2UU9Q 3PIOA 4DV3L 1M90C 1SMXA 3PF4A 4B3SQ 1CSQA 3HKSA 4JI3L 2UUBL 4TQUS 1E22A 3G48A 1XJVA 4LW1A 4X62L 2UUCQ 3F2DA 4LFAQ 1W3SA 4P73A 4LF9L 4GNXC 4APVA 2GN5A 4LNQA 3OTOQ 4GOPB 1X3FA 5C44G 1K73C 1EIYB 4B3MQ 5IP9H 4LF4L 2E2JH 4QIWE 1MJCA 3ULPA 3HOXG 1ASYA 4RG1A 3S15H 2ALYB 2K75A 4DV5L 2CWPA 3KLWA 4OXPA 4OO1I 3BZKA 4LUVA 4B3TQ 1TWFH 1WCMH 2K5VA 1QVGA 1IBKL 2KHIA 5IWAQ 2KBNA 4DV4L 3J81i 4GOPC 3MEFA 4R1JA 2MFIA 4DKAC 5M5YH 1J6QA 1BVSA 4L5TA 1O7IA 3IRBA 3JAMc 1LUZA 4A3LG 1XTDA 2HQLA 4DR3Q 1J5EQ 1X3GA 1KXLA 2MO0A 3GD7A 3U4ZA 1NE3A 2CCZA 4POGA 3PO3H 5AJ3Q 4DV7Q 1I6HH 3I7FA 4JI8Q 3TEHB 2LSSA 3UDIA 1CKOA 4WJ4A 4LF8Q 1Z9FA 3ER0A 3U4VA 3FHWA 3AQQA 3M9BA 3K81C 3U50C 1KL9A 1VQMA 1ASZA 3HOUH 4GKJL 3S24A 4LFCQ 3TS2A 4A3BG 2YV5A 3HOYG 4X66Q 3KF8B 4Y7NH 1VQPA 3S1NH 3PIPA 1YJ9A 3CP0A 3PSIA 1PHJA 1V1QA 3E0EA 3HOWG 5LMNQ 2IHFA 4J15A 3F2CA 5FLMH 3HOVG 1HZCA 2C35B 3F1ZA 3S1RH 4A3GG 1X3EA 1UE5A 2JQOA 4K0KQ 4H02A 5JJLA 4PZ6A 4NPSA 4GOPA 2GVAA 1GD7A 1E1OA 3RN5A 4QQBX 4DR4L 2R92H 1HZAA 2AWOA 1HNWL 1YHBA 3HOZG 4IFDG 1A0IA 4DV1L 2MNAA 1XMQL 1VQIA 2Y0SE 2Y0SG 4LUZA 1VQCA 2JA7G 5C4XG 2H5XA 1RL2A 5E7NA 1WFQA 2K14A 4YWLA 3L0OA 5M3FH 2UXBQ 1HR0W 4DR6Q 2Q2TA 3AEVA 2EIFA 2VQEQ 4FDBA 1JJCB 3S16H 1PA6A 1SRUA 4JI3Q 4A3KH 2OTLA 4PMWA 4OX9Q 3STBC 4YCWA 3CCEA 3CCSA 4HIKA 1I3QH 3S1QH 1YHAA 4C3HH 1UE6A 1TWAH 1YZ6A 4DR7L 4AYBG 3L2PA 3J80c 4DV2Q 3GTPH 1QVFA 4X65L 4PG3A 3G71A 4L5RC 2JA8G 1C7YA 3RZOH 1PYBA 4JBKA 4JYAL 3I4OA 2NN6I 1UE1A 4A3EH 2YU9H 1XNRL 1HZ9A 1X6OA 2OQ0A 2A19A 4MNOA 2ZM6L 2R7FA 2QEXA 4A75A 4BBSG 3W1GA 5IYBH 2WB1E 4DV4Q 2WB1G 3ZJYC 4HIDA 1SLJA 1QVCA 3F2BA 3M4QA 4JI4L 5GAGC 5ELOA 2BA1A 1N32Q 4YHHL 3PUVA 3FKIH 3HOXH 1QUQB 1IL2A 1VCIA 2IHEA 1VQOA 4LF7Q 4IJLA 4IPHA 2RCNA 1L2FA 4LF5L 2UXCL 2UUAQ 1YEZA 1MIUA 3K8AA 4JBWA 5IP7G 3KJPA 2RF4A 3CXCA 4ALPA 3GTMH 3B6YA 3VDYA 3M3YH 4DUYL 4DV6Q 1D8LA 4ME3A 4OONA 4A3LH 1JE5A 4HJAA 1N33Q 1VS0A 4UY8C 1HNXL 2E2IH 1SFOH 2NZOA 1YHQA 4JI2Q 3BJUA 1XMOQ 1Y1WG 3FP9A 3BZCA 3I4MH 1HNZL 2R6GA 3NEMA 2ATWA 4OO1G 2RHSB 3AFQA 5C0XJ 2F4VQ 3CC2A 3CF5A 4YWKA 4WJ3M 2WAQG 3J7A5 2XGTA 3LGJA 3ICEA 2BH2A 3STBD 5FLXc 5BR8Q 3CCVA 3H3VI 4QJFA 2E5LL 4PZ8A 1VQ5A 4R4OA 1OTCA 1FJGL 3CQZH 1N36Q 1C9OA 1VQ9A 1VQNA 4DNIA 3HOYH 1VQ8A 4LFBL 1XNQQ 3PV0A 3PO2G 1N9WA 4IJHA 4L5QA 3GTGH 4JI5L 4JI1Q 4GN5A 5LMUQ 4A93H 4A3FG 1IBLL 2KHJA 3CAMA 3UE1A 4DR2L 4X64Q 4POFA 3KFUA 1N34Q 4A3GH 5IY0A 3PCOB 2WP8J 2EXDA 1R9TH 1OXTA 1PH8A 1YIJA 5IYCH 2VQFL 1X56A 2ID0A 4YCVA 2L15A 3GTLH 1VQLA 4R4IA 2Z6KA 1UEBA 2EQSA 2Z0SA 4JCVE 3ULLA 1HR0Q 2B63G 3S14H 1NY4A 3I56A 4GLAC 1QUQA 3HOZH 4IOCA 1CSPA 4JI7L 3GO5A 2BH8A 4L5SA 4DK6C 3M4PA 3W5OA 3T1YQ 2HHHL 4LF6Q 2R7ZH 2K4KA 4HIOA 3S2DH 2IY5B 2JA6G 1GO3E 1AE2A 3TRZA 2LXJA 1U5KA 4IPGA 5IYDH 4X6AH 3NENA 1YBYA 3RLNA 3KDFB 5HGQA 2JA9A 1JMCA 3CCLA 1Q8KA 4B3RQ 1OXXK 4JI6L 2ZM6Q 1BKBA 2N8NA 2CWAA 3J81j 4QL5A 2ES2A 2N3SA 1Y1VH 4BXXG 4C3IH 4DV0L 3H0GG 3PUWA 2AKWB 2VW9A 4AQYL 1EOVA 5H1SE 1LTLA 4DUZQ 4JV5L 4DR1L 2PI2E 4A3IG 2JA8H 4BA1I 4IPCA 5C3EH 3HFZB 2VUMG 2DUDA 3RZDH 2CKZB 4YY3L 3G4SA 4NXML 2JA5H 2D0OA 1IXRA 2I5HA 1UE7A 1JB7A 3CPWA 4IPDA 1LYLA 2QGQA 4DR5L 3J81c 4BY7H 4UP7A 1PH6A 1IBMQ 5ELNA 1VQDA 2YTXA 3T1HL 4OWTB 1MJEA 1S3OA 1WJJA 5FJ8H 3GTJH 3GTOH 2FXQA 4KHPL 2KCTA 1K83H 2UU9L 5JJKA 3J7ZC 1N8RC 4P74A 3KOJA 1NJIC 4GKKQ 2VNUD 2AWNA 2NN6G 4DV3Q 4A3JH 2UUCL 1WCMG 2DGYA 2UUBQ 4A3MG 4LFAL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XTC S;  1BBW A;  4BA2 I;  1SR3 A;  4P72 A;  1HJP A;  4JG2 A;  4X62 Q;  3OTO L;  4B3M L;  4LF9 Q;  2A1A A;  4R4C A;  5M5X H;  4GLX A;  4BBR H;  2Q2H A;  1KQS A;  2D0P A;  1FVI A;  4AYB E;  5J3B A;  4JBJ A;  4LUO A;  1FL0 A;  4LF4 Q;  3CME A;  1I50 H;  1X65 A;  2BA0 A;  3OYY A;  4XIG S;  4B3T L;  1VQK A;  1Q1E A;  4TVA B;  3CCQ A;  1IZ6 A;  2ZTC A;  4IFD J;  5IWA L;  1PVO A;  1YI2 A;  4GN3 B;  2LXK A;  4DV5 Q;  3KDF A;  1PH2 A;  2Q2U A;  1IBK Q;  4NB3 A;  3GTK H;  4JI0 L;  3I4N G;  1TXY A;  4DR3 L;  1J5E L;  4A3D G;  1OXV A;  2NVX H;  5C44 H;  1WYD A;  3RLF A;  3OW2 A;  5GRO A;  1EFW A;  2R7D A;  1RIP A;  3RNU A;  3HKZ G;  5AJ3 L;  4DV7 L;  4JI8 L;  3PO2 H;  1E1T A;  3S1M H;  1VQG A;  2JEA I;  1VQF A;  1TWH H;  1YNX A;  4OWW B;  1EWI A;  4LF8 L;  1KD1 C;  4A3F H;  1X9N A;  3M4O H;  1PFS A;  5IE8 A;  3WWV A;  5DLQ E;  2Z6K C;  4DK3 C;  4LFC L;  5GAE C;  3RLO A;  4C2M H;  2B63 H;  2V1C C;  4KI0 A;  4X66 L;  3K7A H;  4GKJ Q;  1B70 B;  1NBW A;  1Z47 A;  4JI6 Q;  1VQ7 A;  1OXU A;  4LWC A;  3CD6 A;  2R93 G;  1P8L A;  1FGU A;  1NTG A;  1WOC A;  3ERS X;  1YVC A;  5LMN L;  4HIM A;  1Q7Y C;  2K5H A;  4JV5 Q;  1KRS A;  2K52 A;  5M3F G;  4JBM A;  2JA6 H;  1OXS C;  2OTJ A;  3K7U C;  1GVP A;  3I55 A;  3AYH B;  2WAQ E;  2IX1 A;  3A74 A;  1HH2 P;  2NVT H;  2N78 A;  3JAM i;  3I2Z A;  4A3K G;  1VQB A;  4A3B H;  3CCM A;  2VZA A;  1G6P A;  1VQA A;  1EQR A;  3UDX A;  4DR4 Q;  3H0G H;  2NVY H;  1T9H A;  1X54 A;  4DAY B;  1HNW Q;  1GKH A;  5C0X I;  1CKN B;  3HOW H;  2UXB L;  2YYZ A;  1S40 A;  4DR6 L;  4A3I H;  4DV1 Q;  1A62 A;  1X55 A;  1XMQ Q;  3SGI A;  3W1B A;  1K9M C;  1I94 L;  2OWO A;  3HOV H;  2VQE L;  1B7Y B;  5M3M G;  2K50 A;  2NVQ H;  3UE0 A;  4HJ5 A;  2VL6 A;  1KAW A;  1PYS B;  2Q2I A;  2JJQ A;  3CCR A;  2B29 A;  3PUZ A;  1HZB A;  4O2D A;  5JEA J;  1EUJ A;  3D31 A;  2ZJP A;  3TS0 A;  4A3E G;  2JEB I;  4OX9 L;  1V43 A;  4DAM A;  5EAY A;  1NMG A;  3CC4 A;  1E7Z A;  1IYJ B;  1NMF A;  5IYB G;  1YJN A;  4A3C G;  1A63 A;  4GLV B;  1Q12 A;  4NXN L;  2WFW A;  2PMZ E;  1D7Q A;  2MQH A;  4DV2 L;  1PH9 A;  2JA7 H;  4UP8 A;  3MXN B;  4OWX B;  5C4X H;  2PQA B;  2YTV A;  4BY1 G;  3UDF A;  3FKI G;  3AFP A;  1XPR A;  4KHZ A;  1PH7 A;  1PH5 A;  4DR7 Q;  4X65 Q;  2PNH A;  4A4I A;  2KEN A;  4IO9 A;  2UXD L;  1G29 1;  4MZ9 A;  3H15 A;  2PI2 A;  1TWG H;  3CCU A;  4QY7 A;  3CW2 C;  4A3M H;  3Q8D A;  4JYA Q;  2NZH A;  1EQQ A;  1XNR Q;  1CKM A;  2ZTE A;  3BU2 A;  4JI0 Q;  1N32 L;  3NEL A;  1U0L A;  2VS1 A;  2A8V A;  4EQ5 A;  4JI4 Q;  4LF7 L;  2ZJR A;  4YHH Q;  2UUA L;  2OQK A;  1K8G A;  3I4M G;  1PH3 A;  4JOI C;  2HIX A;  5M5W H;  4LF5 Q;  2UXC Q;  5JJI A;  1AH9 A;  1MKH A;  4DV6 L;  4BBS H;  2YTY A;  5K36 G;  1QZH A;  4P75 A;  3S2H H;  1LM0 A;  1W2B A;  3I4N H;  4GS3 A;  1Q86 C;  1N33 L;  4DUY Q;  4YCU A;  1DGS A;  2I5M X;  1VQE A;  4C3J H;  2K5N A;  4A3D H;  1CKN A;  1SRO A;  4JI2 L;  3KYH C;  1XMO L;  4GNX A;  2F3I A;  3J80 i;  5IP9 G;  1HNX Q;  3JC6 6;  3KJO A;  1YIT A;  3EN2 A;  3S17 H;  3E9I A;  1UWV A;  4QGU A;  3PGZ A;  4AIM A;  4B3S L;  4KLK A;  2F4V L;  4JC0 A;  5IP7 H;  3CPF A;  1HNZ Q;  4UPA A;  4A93 G;  4MTN A;  1JJG A;  3DLL A;  2ZTD A;  5BR8 L;  1Y14 B;  3F8T A;  3H3V H;  2JE6 I;  1G51 A;  2GVB A;  5IYC G;  4HJ9 A;  3KF6 B;  1N36 L;  3NBH B;  1PV4 A;  2I5L X;  1KC8 C;  3RN2 A;  1E24 A;  4R4T A;  4HJ8 A;  3ULJ A;  2E5L Q;  2KCM A;  2PQA A;  1FJG Q;  1XNQ L;  2R93 H;  1L1O B;  2AHO B;  2IT1 A;  4R4Q A;  1Y1W H;  1SN8 A;  3PO3 G;  4LFB Q;  4JI1 L;  3PUX A;  3M85 A;  4A76 A;  3UDG A;  1Q81 C;  1SE8 A;  1WI5 A;  5LMU L;  4X64 L;  4K0K L;  1A8V A;  1N34 L;  2R7Z G;  1YJW A;  4JI5 Q;  1I94 Q;  1IBL Q;  4JOI A;  3D0F A;  3DM3 A;  4DR2 Q;  2UXD Q;  3K0X A;  1BBU A;  5IT9 c;  1V9P A;  1L1O C;  5IYD G;  2I0Q A;  3CC7 A;  1HR0 L;  3HOU G;  2VQF Q;  4IOA A;  1Q46 A;  2MO1 A;  3HKZ E;  1Q82 C;  1VQ4 A;  2E2H H;  4NXN Q;  2QA4 A;  1Y1V G;  3EIV A;  3GDE A;  1QZG A;  4IFD I;  1XPO A;  4LF6 L;  4EX5 A;  3T1Y L;  1VQ6 A;  1KRT A;  1B8A A;  1L0W A;  3GTQ H;  2RHQ B;  4AH6 A;  5M3M H;  4JI7 Q;  2HT1 A;  1E3P A;  5FLM G;  2E8G A;  5C3E G;  2CFM A;  2HHH Q;  4Y52 H;  2AMC B;  1K3R A;  2F52 A;  2N49 A;  5GQO A;  2JA5 G;  3U58 A;  1JJ2 A;  1H95 A;  5HY6 A;  4UP9 A;  3K80 C;  5LMN W;  3L7Z C;  4A3C H;  3CMA A;  1P16 A;  2JK8 A;  3PUY A;  2ZJQ A;  4BY7 G;  1C0A A;  3E9H A;  4P71 A;  1EYG A;  2VY3 A;  2R92 G;  1JT8 A;  2OCE A;  3A5U A;  4DUZ L;  5C0X G;  1VQH A;  5C4J H;  1GM5 A;  5FJ8 G;  3G6E A;  4DV0 Q;  4BY1 H;  4AQY Q;  2CQO A;  1K8A C;  1KIX A;  1Q1B A;  4DR1 Q;  4HJ7 A;  1S72 A;  4B3R L;  1M1K C;  4O0A A;  2D62 A;  1XPU A;  1EIF A;  3KF6 A;  4YY3 Q;  3EBE A;  5GAH C;  4A3J G;  4NXM Q;  1TWC H;  2B3G A;  2ASB A;  4YWM A;  1IBM L;  3A0J A;  1KHI A;  5GAD C;  3TRE A;  4DR5 Q;  4DPG A;  3PF5 A;  1CUK A;  1L1O A;  2HIV A;  4PZ7 A;  4RMF A;  1PH1 A;  4BXX H;  4GN4 B;  3CCJ A;  1PH4 A;  1AE3 A;  3RR5 A;  4BBR G;  3M7N A;  3T1H Q;  1K0R A;  1VQJ A;  4KHP Q;  1I5F A;  3A5Z B;  4GNX B;  4GKK L;  2VUM H;  2XTI A;  3TQY A;  2IX0 A;  5JEA G;  2UU9 Q;  3PIO A;  4DV3 L;  1M90 C;  1SMX A;  3PF4 A;  4B3S Q;  1CSQ A;  3HKS A;  4JI3 L;  2UUB L;  4TQU S;  1E22 A;  3G48 A;  1XJV A;  4LW1 A;  4X62 L;  2UUC Q;  3F2D A;  4LFA Q;  1W3S A;  4P73 A;  4LF9 L;  4GNX C;  4APV A;  2GN5 A;  4LNQ A;  3OTO Q;  4GOP B;  1X3F A;  5C44 G;  1K73 C;  1EIY B;  4B3M Q;  5IP9 H;  4LF4 L;  2E2J H;  4QIW E;  1MJC A;  3ULP A;  3HOX G;  1ASY A;  4RG1 A;  3S15 H;  2ALY B;  2K75 A;  4DV5 L;  2CWP A;  3KLW A;  4OXP A;  4OO1 I;  3BZK A;  4LUV A;  4B3T Q;  1TWF H;  1WCM H;  2K5V A;  1QVG A;  1IBK L;  2KHI A;  5IWA Q;  2KBN A;  4DV4 L;  3J81 i;  4GOP C;  3MEF A;  4R1J A;  2MFI A;  4DKA C;  5M5Y H;  1J6Q A;  1BVS A;  4L5T A;  1O7I A;  3IRB A;  3JAM c;  1LUZ A;  4A3L G;  1XTD A;  2HQL A;  4DR3 Q;  1J5E Q;  1X3G A;  1KXL A;  2MO0 A;  3GD7 A;  3U4Z A;  1NE3 A;  2CCZ A;  4POG A;  3PO3 H;  5AJ3 Q;  4DV7 Q;  1I6H H;  3I7F A;  4JI8 Q;  3TEH B;  2LSS A;  3UDI A;  1CKO A;  4WJ4 A;  4LF8 Q;  1Z9F A;  3ER0 A;  3U4V A;  3FHW A;  3AQQ A;  3M9B A;  3K81 C;  3U50 C;  1KL9 A;  1VQM A;  1ASZ A;  3HOU H;  4GKJ L;  3S24 A;  4LFC Q;  3TS2 A;  4A3B G;  2YV5 A;  3HOY G;  4X66 Q;  3KF8 B;  4Y7N H;  1VQP A;  3S1N H;  3PIP A;  1YJ9 A;  3CP0 A;  3PSI A;  1PHJ A;  1V1Q A;  3E0E A;  3HOW G;  5LMN Q;  2IHF A;  4J15 A;  3F2C A;  5FLM H;  3HOV G;  1HZC A;  2C35 B;  3F1Z A;  3S1R H;  4A3G G;  1X3E A;  1UE5 A;  2JQO A;  4K0K Q;  4H02 A;  5JJL A;  4PZ6 A;  4NPS A;  4GOP A;  2GVA A;  1GD7 A;  1E1O A;  3RN5 A;  4QQB X;  4DR4 L;  2R92 H;  1HZA A;  2AWO A;  1HNW L;  1YHB A;  3HOZ G;  4IFD G;  1A0I A;  4DV1 L;  2MNA A;  1XMQ L;  1VQI A;  2Y0S E;  2Y0S G;  4LUZ A;  1VQC A;  2JA7 G;  5C4X G;  2H5X A;  1RL2 A;  5E7N A;  1WFQ A;  2K14 A;  4YWL A;  3L0O A;  5M3F H;  2UXB Q;  1HR0 W;  4DR6 Q;  2Q2T A;  3AEV A;  2EIF A;  2VQE Q;  4FDB A;  1JJC B;  3S16 H;  1PA6 A;  1SRU A;  4JI3 Q;  4A3K H;  2OTL A;  4PMW A;  4OX9 Q;  3STB C;  4YCW A;  3CCE A;  3CCS A;  4HIK A;  1I3Q H;  3S1Q H;  1YHA A;  4C3H H;  1UE6 A;  1TWA H;  1YZ6 A;  4DR7 L;  4AYB G;  3L2P A;  3J80 c;  4DV2 Q;  3GTP H;  1QVF A;  4X65 L;  4PG3 A;  3G71 A;  4L5R C;  2JA8 G;  1C7Y A;  3RZO H;  1PYB A;  4JBK A;  4JYA L;  3I4O A;  2NN6 I;  1UE1 A;  4A3E H;  2YU9 H;  1XNR L;  1HZ9 A;  1X6O A;  2OQ0 A;  2A19 A;  4MNO A;  2ZM6 L;  2R7F A;  2QEX A;  4A75 A;  4BBS G;  3W1G A;  5IYB H;  2WB1 E;  4DV4 Q;  2WB1 G;  3ZJY C;  4HID A;  1SLJ A;  1QVC A;  3F2B A;  3M4Q A;  4JI4 L;  5GAG C;  5ELO A;  2BA1 A;  1N32 Q;  4YHH L;  3PUV A;  3FKI H;  3HOX H;  1QUQ B;  1IL2 A;  1VCI A;  2IHE A;  1VQO A;  4LF7 Q;  4IJL A;  4IPH A;  2RCN A;  1L2F A;  4LF5 L;  2UXC L;  2UUA Q;  1YEZ A;  1MIU A;  3K8A A;  4JBW A;  5IP7 G;  3KJP A;  2RF4 A;  3CXC A;  4ALP A;  3GTM H;  3B6Y A;  3VDY A;  3M3Y H;  4DUY L;  4DV6 Q;  1D8L A;  4ME3 A;  4OON A;  4A3L H;  1JE5 A;  4HJA A;  1N33 Q;  1VS0 A;  4UY8 C;  1HNX L;  2E2I H;  1SFO H;  2NZO A;  1YHQ A;  4JI2 Q;  3BJU A;  1XMO Q;  1Y1W G;  3FP9 A;  3BZC A;  3I4M H;  1HNZ L;  2R6G A;  3NEM A;  2ATW A;  4OO1 G;  2RHS B;  3AFQ A;  5C0X J;  2F4V Q;  3CC2 A;  3CF5 A;  4YWK A;  4WJ3 M;  2WAQ G;  3J7A 5;  2XGT A;  3LGJ A;  3ICE A;  2BH2 A;  3STB D;  5FLX c;  5BR8 Q;  3CCV A;  3H3V I;  4QJF A;  2E5L L;  4PZ8 A;  1VQ5 A;  4R4O A;  1OTC A;  1FJG L;  3CQZ H;  1N36 Q;  1C9O A;  1VQ9 A;  1VQN A;  4DNI A;  3HOY H;  1VQ8 A;  4LFB L;  1XNQ Q;  3PV0 A;  3PO2 G;  1N9W A;  4IJH A;  4L5Q A;  3GTG H;  4JI5 L;  4JI1 Q;  4GN5 A;  5LMU Q;  4A93 H;  4A3F G;  1IBL L;  2KHJ A;  3CAM A;  3UE1 A;  4DR2 L;  4X64 Q;  4POF A;  3KFU A;  1N34 Q;  4A3G H;  5IY0 A;  3PCO B;  2WP8 J;  2EXD A;  1R9T H;  1OXT A;  1PH8 A;  1YIJ A;  5IYC H;  2VQF L;  1X56 A;  2ID0 A;  4YCV A;  2L15 A;  3GTL H;  1VQL A;  4R4I A;  2Z6K A;  1UEB A;  2EQS A;  2Z0S A;  4JCV E;  3ULL A;  1HR0 Q;  2B63 G;  3S14 H;  1NY4 A;  3I56 A;  4GLA C;  1QUQ A;  3HOZ H;  4IOC A;  1CSP A;  4JI7 L;  3GO5 A;  2BH8 A;  4L5S A;  4DK6 C;  3M4P A;  3W5O A;  3T1Y Q;  2HHH L;  4LF6 Q;  2R7Z H;  2K4K A;  4HIO A;  3S2D H;  2IY5 B;  2JA6 G;  1GO3 E;  1AE2 A;  3TRZ A;  2LXJ A;  1U5K A;  4IPG A;  5IYD H;  4X6A H;  3NEN A;  1YBY A;  3RLN A;  3KDF B;  5HGQ A;  2JA9 A;  1JMC A;  3CCL A;  1Q8K A;  4B3R Q;  1OXX K;  4JI6 L;  2ZM6 Q;  1BKB A;  2N8N A;  2CWA A;  3J81 j;  4QL5 A;  2ES2 A;  2N3S A;  1Y1V H;  4BXX G;  4C3I H;  4DV0 L;  3H0G G;  3PUW A;  2AKW B;  2VW9 A;  4AQY L;  1EOV A;  5H1S E;  1LTL A;  4DUZ Q;  4JV5 L;  4DR1 L;  2PI2 E;  4A3I G;  2JA8 H;  4BA1 I;  4IPC A;  5C3E H;  3HFZ B;  2VUM G;  2DUD A;  3RZD H;  2CKZ B;  4YY3 L;  3G4S A;  4NXM L;  2JA5 H;  2D0O A;  1IXR A;  2I5H A;  1UE7 A;  1JB7 A;  3CPW A;  4IPD A;  1LYL A;  2QGQ A;  4DR5 L;  3J81 c;  4BY7 H;  4UP7 A;  1PH6 A;  1IBM Q;  5ELN A;  1VQD A;  2YTX A;  3T1H L;  4OWT B;  1MJE A;  1S3O A;  1WJJ A;  5FJ8 H;  3GTJ H;  3GTO H;  2FXQ A;  4KHP L;  2KCT A;  1K83 H;  2UU9 L;  5JJK A;  3J7Z C;  1N8R C;  4P74 A;  3KOJ A;  1NJI C;  4GKK Q;  2VNU D;  2AWN A;  2NN6 G;  4DV3 Q;  4A3J H;  2UUC L;  1WCM G;  2DGY A;  2UUB Q;  4A3M G;  4LFA L; 
#chains in the Genus database with same CATH topology
 1LT6 D;  1BBW A;  1SR3 A;  4P72 A;  4JG2 A;  4BBR H;  2D0P A;  4AYB E;  5I4D A;  1ML0 D;  3IAY A;  2CQA A;  2IX3 A;  4LUO A;  1FL0 A;  2A6E C;  1X65 A;  2BA0 A;  2DJF C;  4LMQ D;  4RGN A;  4XIG S;  4C2M B;  1Q1E A;  4IFD J;  5C4H A;  1YI2 A;  1Y8P B;  2WKC A;  3OWE B;  4CDE C;  1OO9 B;  1S5E D;  2V4D A;  1IBK Q;  4K6D A;  4NB3 A;  4JI0 L;  1TXY A;  4DR3 L;  1A6X A;  2Q8R E;  5C44 H;  1WYD A;  1B44 D;  2G5D A;  2L11 A;  3QIA A;  1O7Y A;  2LKV A;  4DV7 L;  5KNB A;  1VQF A;  3AB9 A;  1EWI A;  1XXG A;  4A3F H;  1X9N A;  2F0G A;  3I91 A;  2LMC B;  1KLG D;  2BE5 C;  4A3I B;  4LFC L;  5IGE A;  2B63 H;  1JOQ A;  3H94 A;  2Z8L A;  2RCF A;  1OXU A;  3I70 A;  3MXU A;  2PW7 A;  1I4Q A;  3AYH B;  4F7X A;  3A74 A;  2XIW A;  1HH2 P;  5EKL A;  2QKI C;  3OMC A;  2C5C A;  1VQB A;  2VZA A;  2K01 A;  1EQR A;  4I7A A;  4TKO B;  3HEJ A;  1LTB D;  1VF7 A;  1T9H A;  1WCM B;  4A3M B;  3ONA B;  2A6E D;  4DR6 L;  4DV1 Q;  1SAP A;  4KV6 A;  2OWO A;  3MA2 B;  1HPC A;  1B53 A;  3TS0 A;  2B29 A;  1MI2 A;  5JEA J;  4A3E G;  1Y69 U;  1V43 A;  1A63 A;  1F2Z A;  3CKI B;  3CC4 A;  4A3C G;  1S5D D;  5M5W B;  1PFM A;  1XPR A;  1LTR D;  2LS0 1;  1EY4 A;  3AFP A;  1R4Q B;  5CGK A;  2NN6 H;  3HKZ B;  2PI2 A;  1TWG H;  4Y7N B;  4JYA Q;  1BR9 A;  1TVX A;  2X6L A;  2QDB A;  1ICF B;  3EJI A;  1JOR A;  3NEL A;  1EFI D;  2HDM A;  5IGF A;  1V8Q A;  4HR7 B;  2A8V A;  1IKM A;  5EGT A;  4YHH Q;  1FNV A;  4CJ1 B;  2OQK A;  5EKK A;  4EQN A;  5ELB A;  4P2C B;  1NUC A;  5EPJ A;  1PH3 A;  1X3P A;  1K28 A;  1AH9 A;  2R93 B;  4BBS H;  5K36 G;  4P75 A;  1HXY D;  1W2B A;  1GHJ A;  2F0H A;  3NTK A;  4YCU A;  1TII D;  5JOB A;  1DGS A;  1SND A;  2I5M X;  4A3D H;  3A54 A;  1CKN A;  1E2W A;  1SRO A;  2HQE A;  3JC6 6;  3KJO A;  3E9I A;  1UWV A;  3NE5 B;  4QGU A;  4KLK A;  3CPF A;  1B1Z A;  1LTA D;  1JJG A;  2F3V A;  1H9R A;  1V1O A;  2FMC A;  1JOO A;  1G51 A;  1FGB D;  2K32 A;  4HJ9 A;  2JP1 A;  5M3M B;  1PV4 A;  2X69 A;  1KC8 C;  3RN2 A;  4KY6 A;  1SMY C;  3ULJ A;  3ZYY X;  2L12 A;  4DGZ A;  2BDN A;  3A55 A;  3V96 A;  1Y1W H;  3PUX A;  4A76 A;  1SE8 A;  4OO1 H;  5AFW A;  4NDX A;  2NUC A;  4X64 L;  4HMI A;  4JI5 Q;  1I94 Q;  2KCN A;  5D3I B;  3D0F A;  4K2L A;  1BBU A;  4QIW B;  5IT9 c;  1V9P A;  5IYD G;  2QDL A;  3HKZ E;  3GDE A;  4LF6 L;  3I90 A;  3EVQ A;  3GTQ H;  2Q8I B;  4JI7 Q;  5KYI A;  1E3P A;  2KA7 A;  2F3W A;  2QEJ C;  2F52 A;  2N49 A;  2O2L D;  5KND A;  3U58 A;  1H95 A;  5LMN W;  1WVL A;  4CKB A;  1P16 A;  3OPO A;  3CMA A;  1C0A A;  4P71 A;  1EYG A;  2VY3 A;  3A5U A;  4DUZ L;  5C4J H;  3DMU A;  3C1F A;  3NWS A;  2CQO A;  4ZKB B;  1K8A C;  3WOE A;  3CQZ B;  4HMJ A;  1M1K C;  1D1K A;  3BZD B;  1DJR D;  3GV6 A;  4F8M A;  4A3J G;  4YWM A;  4B08 A;  1IBM L;  1KHI A;  2EYH A;  3NSW A;  4DR5 Q;  1SMY D;  1CA5 A;  1AP0 A;  1ESF A;  5ELF A;  1AE3 A;  3RR5 A;  4C3H G;  3QWN A;  5IGB A;  1I5F A;  3A5Z B;  4GKK L;  2HDL A;  3OWF A;  4KHP Q;  4I7Z C;  2RDG A;  3TQY A;  2IX0 A;  1EL0 A;  1SMX A;  3PO3 B;  3G48 A;  2DNE A;  2K1B A;  4LW1 A;  4X62 L;  5I9O A;  5KYL A;  1B50 A;  2R7Z B;  3D4D A;  2PO4 A;  3R3O A;  5FO9 B;  4LNQ A;  1EIY B;  3QB3 A;  4QIW E;  1MJC A;  3ULP A;  3S15 H;  4RCN A;  4RG1 A;  1SYG A;  2KQ3 A;  1K8M A;  4DV5 L;  2CWP A;  1Y1V B;  4C3I B;  2KHI A;  4DV4 L;  2NYZ D;  2BDO A;  3IRB A;  4A3L G;  5C3E B;  5JVH 3;  2HQL A;  4DR3 Q;  3RZD B;  4IN3 A;  2MO0 A;  1ZXT A;  3GD7 A;  3U4Z A;  1Y8O B;  3S1R B;  2JA5 B;  1II3 A;  2F0V A;  2R3Z A;  2RDH A;  4DV7 Q;  1B3Q A;  1VMP A;  1E0B A;  1ONL A;  3QOL A;  2A74 C;  2KUM A;  2R92 B;  3ER0 A;  1EYA A;  3E6Z X;  2MJ8 A;  3GTJ B;  1XX8 A;  2I07 B;  3K81 C;  1WTQ A;  3SK6 A;  1VQM A;  2PZW A;  1ASZ A;  1PZJ D;  4GKJ L;  3S24 A;  4LFC Q;  4A3B G;  4FF3 A;  4NMZ A;  2F4I A;  3HOY G;  3PIP A;  4IQZ A;  1PHJ A;  2K5D A;  3E0E A;  3HOW G;  3J80 E;  3JAM L;  3F2C A;  5I2Y A;  4KTA A;  1VDZ A;  3SEB A;  2VXW A;  3Q22 A;  3Q6S A;  4NPS A;  1GD7 A;  3D6W A;  1S5F D;  3M7G A;  1HNW L;  5C0X H;  2MNA A;  1XMQ L;  2B2Y A;  1VQI A;  2Y0S G;  2JA7 G;  5C4X G;  2H5X A;  1RL2 A;  4DR6 Q;  2NVX B;  4DN4 M;  4ZYS A;  3SR1 A;  3NP8 A;  3S1M B;  4PMW A;  4YCW A;  3CCE A;  3CCS A;  3OIP A;  1MBY A;  1I3Q H;  3M4O B;  1YHA A;  2AQ3 B;  2QCP X;  1GOZ A;  1TWA H;  4U67 3;  5CV9 A;  3L2P A;  2B2U A;  2KEE A;  4PG3 A;  3G71 A;  3RZO H;  3I4L A;  2RBM A;  4RGO S;  4JBK A;  4BS9 A;  4DXF A;  3T13 A;  2NN6 I;  4A3E H;  2YU9 H;  1XNR L;  1HZ9 A;  2OQ0 A;  4RH6 A;  1KDB A;  2A19 A;  2F0W A;  2R7F A;  4MNO A;  2ZM6 L;  3NQT A;  1EU4 A;  1C8C A;  2B8F A;  2N88 A;  2KJX A;  2WB1 G;  2QF7 A;  2PCF B;  1WTO A;  3HG9 A;  2EZV A;  3TBI B;  3HZX A;  3KK7 A;  1D5M C;  4IJL A;  4IPH A;  4LF5 L;  3MVV A;  4CDC C;  3K5O A;  2AQ2 B;  1MIU A;  1VMC A;  2PNR C;  2F0M A;  5E3F A;  2RF4 A;  4MHE A;  4MIU A;  3VDY A;  3M3Y H;  4DUY L;  2Z4H A;  1HCZ A;  5ELD A;  5IGG A;  3OHX C;  3HOV B;  2Z9H A;  4DA2 A;  2NVQ B;  1HNX L;  4A3G B;  2NZO A;  1R9T B;  1GUT A;  1TQO A;  1HNZ L;  1O7L A;  2MP1 A;  1JWU D;  2ATW A;  4KHV A;  5E4W C;  4PMC A;  5D3D A;  4WJ3 M;  2WAQ G;  3J7A 5;  3FPP A;  2F0U A;  1EY0 A;  2E5L L;  1FJG L;  1STH A;  1PRT F;  2FIN B;  5C5L A;  4N8F A;  1O78 A;  4DNI A;  4LFB L;  4RWS C;  5EQ0 A;  2Z6B A;  5TSS A;  4KN7 C;  4GN5 A;  1BDO A;  4A3F G;  4HCE A;  4X64 Q;  2WP8 J;  2H4O A;  3TP7 A;  5DAU A;  1UEA B;  4YCV A;  3GTL H;  4L8J A;  2Z6K A;  4JCV E;  2B63 G;  3S14 H;  4K8I A;  4QMG A;  1O7Z A;  1BF4 A;  1CSP A;  3VYT A;  3GO5 A;  2BH8 A;  5FLX L;  3V05 A;  1G2S A;  4LF6 Q;  2HHH L;  2IY5 B;  1GO3 E;  3TME A;  1ET9 A;  2RSN A;  5IYD H;  4K6L A;  3NEN A;  4FF1 A;  1YBY A;  5HGQ A;  3S17 B;  3F2U A;  4I65 A;  2N8N A;  2CWA A;  1EY6 A;  2ES2 A;  1SYD A;  4DV0 L;  3PUW A;  4DUZ Q;  3D8G A;  4FXK C;  2PI2 E;  2JA8 H;  3HFZ B;  4IUQ A;  2VUM G;  1F2M A;  4YY3 L;  4NXM L;  3MFY A;  1TKW B;  1JB7 A;  2A5H A;  4S3S A;  4KK7 A;  2XRQ D;  3J81 c;  4UP7 A;  1PH6 A;  2WV6 D;  3E0J A;  1IBM Q;  3T1H L;  1MJE A;  1S3O A;  1WJJ A;  2KCT A;  3HP3 A;  5JJK A;  1N8R C;  1LT4 D;  1NJI C;  5KRU A;  4GKK Q;  1ICW A;  2EOT A;  2NN6 G;  4A3J H;  1UNS A;  2UUC L;  2E2H B;  1U9R A;  1D6E C;  4TSS A;  3MTS A;  2SDF A;  4X62 Q;  3FRP B;  4B3M L;  4R4C A;  5M5X H;  1RCV D;  1CI3 M;  5J3B A;  4JBJ A;  1I50 H;  4B3T L;  4TVA B;  3CCQ A;  5IWA L;  1PZK D;  2OEO A;  1AZQ A;  2LXK A;  4DV5 Q;  1SDF A;  2Q2U A;  5IGC A;  1PTO B;  1WTH A;  4HN7 A;  1J5E L;  2JA6 B;  2LY7 A;  1OXV A;  1ZKO A;  3IFD A;  4A3D G;  3RLF A;  1RIP A;  3C1E A;  4JI8 L;  1E1T A;  3QJY A;  1VQG A;  4OWW B;  3QR8 A;  4LF8 L;  1KD1 C;  4RGT A;  2F1M A;  2RVL A;  2K33 A;  4FXG C;  1PFS A;  1X32 A;  3H0G B;  2NVY B;  5IE8 A;  1JC7 A;  4DK0 A;  3KUP A;  2NZ1 D;  4DK3 C;  1HUN A;  2DNC A;  4C2M H;  1EYC A;  3U9O A;  2V1C C;  4X66 L;  2K05 A;  3K7A H;  3K5N A;  4GKJ Q;  3ND9 A;  4LWC A;  1P8L A;  1NTG A;  1WOC A;  1PYW D;  5IOC A;  4FXD A;  4KD4 A;  4JV5 Q;  2DY8 A;  3VA7 A;  1BBX C;  3A7A B;  1PRT C;  4IUT A;  1ET6 A;  2B2W A;  2N78 A;  4A3K G;  1MSG A;  4A3B H;  3CCM A;  3I73 A;  2KEC A;  4NP5 A;  4CJ2 C;  1G6P A;  5E4X A;  1CHQ D;  3UDX A;  3IL8 A;  1WD0 A;  4DAY B;  1HNW Q;  3VYR A;  5C0X I;  3A7L A;  3HOW H;  1S40 A;  4A3I H;  2I46 A;  1XMQ Q;  3SGI A;  3W1B A;  1I94 L;  2K50 A;  1DZ1 A;  2VB2 X;  4OGQ C;  2D2C C;  2VL6 A;  1FYC A;  1FR3 A;  2Q2I A;  3PUZ A;  4UAI A;  1EUJ A;  2JEB I;  5EAY A;  1NMG A;  1I6H B;  1YJN A;  4H44 C;  2F0S A;  4GLV B;  2F0I A;  3C2P A;  2PMZ E;  3BG3 A;  4XYO A;  2JA7 H;  3MXN B;  5C4X H;  2PQA B;  4TRD A;  4RKB A;  3UDF A;  3FKI G;  1PH5 A;  1IYU A;  1EEF D;  4C3J B;  3SDZ A;  2PNH A;  3EA6 A;  4MZ9 A;  3H15 A;  3VYU A;  4A3M H;  3Q8D A;  2NZH A;  1XNR Q;  1C4Q A;  4DF7 A;  3D3R A;  5IIF A;  2K03 A;  1M4V A;  2ZJR A;  3BVG A;  5DM7 3;  3I4M G;  4EVO A;  5C5M A;  1DOL A;  1A2T A;  1PRT D;  4JOI C;  5M5W H;  4LF5 Q;  5JJI A;  1MKH A;  4DV6 L;  2SOB A;  1QWY A;  4XQJ A;  1QCB D;  4DUY Q;  5M3F B;  2K5N A;  4RA8 A;  4JI2 L;  3MWY W;  2F3I A;  5LHY 1;  1HNX Q;  3I8Z A;  1JWM D;  4F87 A;  1YIT A;  3AMU A;  1XTC D;  3J7A V;  4JC0 A;  1HNZ Q;  4A93 G;  3S1Q B;  2ZTD A;  1LT5 D;  5BR8 L;  1PFB A;  2GVB A;  4G4K A;  4R8N A;  4IUP A;  5IYC G;  1N36 L;  3DWA A;  1Q90 A;  4HJ8 A;  2E5L Q;  4ZK9 B;  1FJG Q;  2KED A;  1STN A;  1XNQ L;  2R93 H;  1L1O B;  1SN8 A;  4LFB Q;  4JI1 L;  4ZKC B;  4J6H A;  3M85 A;  3UDG A;  1Q81 C;  1RTO A;  2LFN A;  5BN3 A;  2F0F A;  1A8V A;  3ERQ A;  1YJW A;  3R2I A;  4OL7 A;  5T1I A;  4JOI A;  3DM3 A;  4BY1 B;  1HR0 L;  1LV9 A;  5JJZ A;  1LTI D;  4M1U B;  4FVM A;  3BDC A;  2MO1 A;  4CBV A;  1F9S A;  3OIQ A;  2L55 A;  1H9M A;  1B8A A;  3KLS X;  1L0W A;  2RHQ B;  5M3M H;  5LL6 X;  3SHL A;  1JE4 A;  2HHH Q;  2E2I B;  1K3R A;  3K80 C;  3L7Z C;  2JK8 A;  2ZJQ A;  4BY7 G;  1B9M A;  1L0Y B;  2H1E A;  5C0X G;  5FJ8 G;  4EQO A;  5I9P A;  4DV0 Q;  3T53 B;  2C9O A;  4ILW A;  4O0A A;  3KF6 A;  4NKL A;  4YY3 Q;  2NTS A;  2EY5 A;  3NBH A;  3SK5 A;  4NXM Q;  2ASB A;  2BOS A;  4ZQ3 A;  3W3A A;  3GTG B;  3TRE A;  2EYJ A;  3QG1 A;  1X3Q A;  4PZ7 A;  3JAM E;  3C3L A;  2IJ0 A;  3J7Y W;  4GN4 B;  3CCJ A;  1PH4 A;  3LWE A;  3T1H Q;  3GQB A;  5M5Y B;  1K0R A;  4GNX B;  2VUM H;  2B2T A;  2XTI A;  5JEA G;  4DV3 L;  1M90 C;  3CU7 A;  1CSQ A;  2J0T D;  4IAL A;  1E22 A;  3R2T A;  2UUC Q;  1SYB A;  4QB4 A;  1IKL A;  4LF9 L;  3S2D B;  4B3M Q;  1EYD A;  5ISR A;  2E2J H;  5CV7 A;  4DNT B;  1ASY A;  3HOU B;  3MEH A;  2EJG C;  3KLW A;  4LUV A;  4B3T Q;  1TWF H;  2KCC A;  3S1N B;  1A3V A;  3PIO 3;  1QVG A;  1ENA A;  5IWA Q;  2KBN A;  3J81 i;  5A35 A;  4GOP C;  2WAC A;  4DKA C;  1J6Q A;  3VYS A;  1Z6H A;  2X6G A;  1CQF A;  1XTD A;  2EYL A;  1J5E Q;  1KXL A;  4POG A;  3PO3 H;  3I7F A;  4R9W A;  4JI8 Q;  2LSS A;  4H7B A;  4ZUJ A;  3UDI A;  3SXH A;  2AUJ D;  1WTR A;  3Q24 A;  4OEM B;  4LF8 Q;  4CDD C;  1BO0 A;  3H6M A;  5CBE E;  3U50 C;  3KLS A;  2AUK A;  2F0O A;  1SXT A;  2CH4 A;  3Q0A A;  2XNA C;  3KF8 B;  4X66 Q;  2FJ2 A;  3D6C A;  1STE A;  5FLM H;  3FDT A;  4ID6 A;  1E2Z A;  1HZC A;  2WKD A;  3F1Z A;  5FO8 B;  4BBR B;  3S1R H;  3FEW X;  4F88 A;  3GTP B;  3K59 A;  2L5T A;  1QG7 A;  4GOP A;  3RN5 A;  4QQB X;  4DR4 L;  2R92 H;  2Z1C A;  1TY2 A;  2AWO A;  5EPK A;  4BWG B;  1YHB A;  2Y0S E;  4RAU C;  1VQC A;  4IUN A;  2PQE A;  2N55 A;  3L0O A;  3DWQ A;  4IUU A;  5C44 B;  3AEV A;  1I4R A;  4R8I A;  3S16 H;  1PA6 A;  1KNA A;  3HOX B;  4A3K H;  2OTL A;  2F0L A;  1F2Y A;  2RA4 A;  1A15 A;  2F0P A;  1UE6 A;  1YZ6 A;  4M8A A;  4DR7 L;  4AYB G;  2K5W A;  3J80 c;  1QVF A;  1LO5 D;  3J81 L;  2JA8 G;  1BQQ T;  3TSS A;  1C7Y A;  1QJO A;  1H9S A;  3OW7 A;  1KAA A;  4RHS A;  1EIG A;  3W1G A;  2WB1 E;  2O5I C;  3NXW A;  5FLX E;  3ZJY C;  4HID A;  1QVC A;  4E6I A;  1WTP A;  5KEE A;  2BA1 A;  4V19 0;  2RKS A;  3FKI H;  2JSO A;  1VCI A;  2IHE A;  1B2T A;  2RCN A;  1L2F A;  3RD4 A;  2UXC L;  2IL8 A;  1I4H A;  5CR3 A;  3KJP A;  3GTM H;  3KBG A;  4DV6 Q;  2HD3 A;  4ME3 A;  1V1P B;  4OON A;  3N6R A;  1VS0 A;  1PLF A;  1SFO H;  5C6A A;  1EY8 A;  4JI2 Q;  3I3C A;  3I4M H;  3VR5 A;  4RHR A;  3AFQ A;  3U9S A;  4ZAI A;  1D5Z C;  2ENB A;  1S5B D;  3TDQ A;  2XGT A;  3ICE A;  3K57 A;  4JVZ A;  4IUV A;  5BR8 Q;  3CCV A;  3SE0 A;  1QIL A;  4R4O A;  1OTC A;  4LK1 C;  1N36 Q;  1VQ9 A;  1EEI D;  1VQN A;  2R61 A;  1ILP A;  1XNQ Q;  1SJH D;  3PV0 A;  3J7A F;  3NUC A;  1PDQ A;  4K5X A;  4JI1 Q;  4A93 H;  2SNM A;  1IBL L;  4DR2 L;  3CAM A;  1W6J A;  5F2D A;  4A3G H;  3PCO B;  2EXD A;  1R9T H;  2MUY A;  2XSC A;  5IYC H;  2VQF L;  2ID0 A;  2L15 A;  1VQL A;  2DN8 A;  2Z0S A;  3ULL A;  1HR0 Q;  2B2Y C;  4WFN 3;  1QUQ A;  3HOZ H;  4IFD H;  1BCP D;  2FFK B;  4BBS B;  4IOC A;  1RF2 D;  4MTK A;  3K6O A;  4C56 C;  4DK6 C;  3W5O A;  3SK8 A;  1WTV A;  1EY7 A;  2D5D A;  1AE2 A;  3TRZ A;  4XDX A;  4L6T B;  1K83 B;  1SYC A;  4X6A H;  2B2V A;  2AQ1 B;  2JXM B;  1WD1 A;  3CCL A;  1UUP A;  4B3R Q;  5I6Y A;  4QL5 A;  1BOS A;  4BXX G;  2B2U C;  3SK4 A;  2AKW B;  2VW9 A;  4JV5 L;  5H1S E;  4JPB W;  4A3I G;  5KGU A;  4IPC A;  1IHZ A;  1SE3 A;  1LYL A;  2QGQ A;  1Y1W B;  5FOB B;  4BY7 H;  1HHV A;  3H3V C;  5KNC A;  5DEH A;  2HUG A;  4DAY A;  3D4W A;  5FJ8 H;  3GTO H;  2FXQ A;  2EYO A;  3GTK B;  3J7Z C;  1S5C D;  2M00 A;  4IUR A;  1ESR A;  4DV3 Q;  2EPB A;  1WCM G;  2DGY A;  4A3M G;  3R93 A;  1HRJ A;  5EBD A;  3GTQ B;  4BA2 I;  1HJP A;  3OTO L;  1NAP A;  4LF9 Q;  2Q2H A;  1KQS A;  3MFG A;  3RMH A;  1STB A;  5JEA H;  3CME A;  3OYY A;  4J8Q A;  1I4G A;  1AFP A;  1VQK A;  1IZ6 A;  2ZTC A;  1PVO A;  1CQV A;  3KDF A;  1PH2 A;  1HQR D;  1LLR D;  5A2Q L;  1EFW A;  3OW2 A;  5GRO A;  2R7D A;  3HKZ G;  1F9Q A;  2NVT B;  3PO2 H;  4XT3 B;  2NWG A;  2JEA I;  1TWH H;  1SNP A;  5DLQ E;  2Z6K C;  5FK9 C;  5GAE C;  1YNN C;  4OIJ A;  4Q5V A;  3RLO A;  4KI0 A;  4EGV A;  1B70 B;  4JI6 Q;  3CD6 A;  2R93 G;  3FVQ A;  5LMN L;  2G9D A;  3ERS X;  1U4P A;  1QOH A;  1PTO H;  2K5H A;  1LTG D;  4JBM A;  2JA6 H;  1OXS C;  5JAV A;  1DYQ A;  1GVP A;  1I6V C;  2K5Q A;  3I55 A;  2IX1 A;  1HFN A;  3S15 B;  2MHV A;  1NNX A;  3BDO A;  1F9P A;  2K7V A;  1VQA A;  3EFX D;  3DXJ C;  4DR4 Q;  3H0G H;  2NVY H;  1GUO A;  1X54 A;  3L9A X;  1QNU A;  1GKH A;  1CKN B;  4DK1 A;  2F0K A;  2CW0 C;  5CBA E;  5M3M G;  1G6Z A;  4KJO A;  3CCR A;  2EDG A;  4O2D A;  5IOD A;  3IKJ A;  4OX9 L;  2PZU A;  4DAM A;  2M9V A;  1FNU A;  4G7H C;  1Q12 A;  2WFW A;  1D7Q A;  2MQH A;  1PH9 A;  3QOJ A;  4OWX B;  2CVR A;  2YTV A;  1PH7 A;  4KY5 A;  5ELE A;  3LX0 A;  4UHV A;  4KHZ A;  4DR7 Q;  3OOC A;  2ICE C;  4A4I A;  2KEN A;  4IO9 A;  2ZT9 C;  2EYM A;  3CW2 C;  3E3X A;  1YNN D;  1CM9 A;  1ENF A;  1EQQ A;  2EY6 A;  1CKM A;  2ZTE A;  3NQI A;  1SJE D;  4J1M A;  1NR2 A;  5HGT A;  1N32 L;  5FKA C;  2VS1 A;  4KN4 C;  4EQ5 A;  4LF7 L;  1MGS A;  1DM0 B;  1QB5 D;  1K8G A;  3G7L A;  2B8G A;  3DHQ A;  1GHK A;  2UXC Q;  5T1G A;  1QZH A;  1SE4 A;  3DEO A;  3S2H H;  1LM0 A;  2JYO A;  3I4N H;  4GS3 A;  1Q86 C;  3T16 A;  1DD2 A;  4C3J H;  1VQE A;  4DXG A;  2FHT A;  4GNX A;  3J80 i;  1DON A;  3EN2 A;  2CW0 D;  2PPB C;  3PGZ A;  4AIM A;  5BN4 A;  2ZXR A;  4UPA A;  2OT2 A;  4MTN A;  1I3Q B;  4CHT B;  1SBB B;  1TWA B;  1Y14 B;  3H3V H;  2JE6 I;  2F0Q A;  4N8X 1;  2I5L X;  4DAP A;  2EYP A;  2KCM A;  2CHB D;  4A3E B;  2YU9 B;  3PO3 G;  1EZ6 A;  4ODG A;  1WI5 A;  1N34 L;  2R7Z G;  3VR2 A;  2B2W C;  2PMZ B;  5D14 A;  5EKI A;  4KD3 A;  1IBL Q;  4DR2 Q;  4ABN A;  3K0X A;  3CC7 A;  1R4P B;  2VQF Q;  1B4O A;  2GA4 B;  1VQ4 A;  1JQY D;  3GP7 A;  3BYY B;  4RFB A;  1Y1V G;  4NXN Q;  4IFD I;  4C3I G;  1QZG A;  3M3Y B;  1TWC B;  1XPO A;  1CTM A;  1VQ6 A;  1KRT A;  3VR4 A;  4AH6 A;  2HT1 A;  1MSH A;  5FLM G;  2E8G A;  5C3E G;  2CFM A;  4IZ8 A;  4Y52 H;  3A8K E;  2AMC B;  2EYF A;  5GQO A;  2JA5 G;  1JJ2 A;  5HY6 A;  5KIX A;  3PUY A;  1SSO A;  4UDU C;  2QIL A;  3E9H A;  2R92 G;  1JT8 A;  2OCE A;  2WII B;  3Q23 A;  4BY1 H;  5IT9 L;  5C3W A;  3FPU B;  1KIX A;  1Q1B A;  2F0D A;  4HJ7 A;  2NBF A;  2D62 A;  3QO2 A;  1XPU A;  1EIF A;  2B3G A;  1CT1 D;  3A0J A;  5GAD C;  3J80 L;  2MPM A;  5C4Z A;  2HIV A;  1PH1 A;  4FO2 A;  4RMF A;  4BXX H;  1EOT A;  3TZU A;  1A2U A;  3P7J A;  1ROD A;  3PF4 A;  3S14 B;  4B3S Q;  2UUB L;  4TQU S;  1J8I A;  2JN4 A;  4JW0 A;  4Q0F A;  1BXT A;  4APV A;  2Z4I A;  3OMG A;  3OTO Q;  1K73 C;  1JB3 A;  1VF5 C;  2A6H C;  3I72 A;  5LL6 S;  5IP9 H;  4LF4 L;  1TR5 A;  1EZ8 A;  2ALY B;  5JVG 3;  2EJM A;  1WCM H;  2K5V A;  2MFI A;  5M5Y H;  5JPM C;  1BVS A;  4L5T A;  3JAM c;  1GJX A;  3J81 E;  2E76 C;  1M8A A;  5BN5 A;  1MD2 D;  1CKO A;  1Z9F A;  3LWU A;  3HOU H;  1WTW A;  3TS2 A;  1QNK A;  1YNJ C;  5I2X A;  1NR4 A;  1T5E A;  2YV5 A;  3S1N H;  4Y7N H;  4A3J B;  1VQP A;  1YJ9 A;  3CP0 A;  1G2T A;  3P1H A;  3RUZ A;  3PSI A;  2J7Z A;  5LMN Q;  4J15 A;  3HOV G;  2O5J C;  1H9J A;  4C3H B;  4A3G G;  1X3E A;  1UE5 A;  3OSO A;  2JQO A;  4HED A;  1FNW A;  5JJL A;  3CHB D;  3URY A;  1I50 B;  2HCC A;  2ZXP A;  2A6H D;  1HZA A;  1RKN A;  3HOZ G;  4IFD G;  1A0I A;  4LUZ A;  4YWL A;  1WFQ A;  2K14 A;  3A8I E;  1WTX A;  2EIF A;  3PQI A;  4FDB A;  1JOK A;  1ENC A;  4JI3 Q;  1IYV A;  2XWJ B;  4OX9 Q;  3STB C;  4HIK A;  1CA6 A;  1EQT A;  5C3X A;  2B2T C;  3GTP H;  4X65 L;  5J22 A;  1PYB A;  2OXP A;  4QF4 A;  2F0E A;  3K7A B;  1CZW A;  4QUC A;  1UE1 A;  1X6O A;  4B3R L;  1HTP A;  1A3T A;  1YNJ D;  4WRD A;  2TSS A;  1TY0 A;  1HFG A;  5M9O A;  3F2B A;  4JI4 L;  5GAG C;  5ELO A;  1CZG A;  1BUV T;  1N32 Q;  1EIH A;  3PUV A;  3HOX H;  1BNZ A;  1IL2 A;  4XT1 B;  4LF7 Q;  4A3B B;  1EU3 A;  1YEZ A;  3A8J E;  3K8A A;  1BCP F;  2B39 A;  5IP7 G;  3HOY B;  2PZT A;  4ALP A;  2HCI A;  5ELC A;  3HOW B;  1GUS A;  5COR A;  1PTO F;  3DUZ A;  3MC0 B;  5CV5 A;  1JE5 A;  4HJA A;  4O1N A;  1AW7 A;  1YHQ A;  1KAB A;  1C48 A;  3BZC A;  1SE2 A;  4OHJ A;  2R6G A;  1LAB A;  3NEM A;  1AZP A;  4U68 A;  2OF1 A;  5C0X J;  4XXE A;  1Z7T A;  3CC2 A;  4JK1 C;  4YWK A;  2A68 D;  1CHP D;  2XVS A;  2Y0S B;  4V0B A;  2JA7 B;  5C4X B;  3STB D;  5FLX c;  1EY9 A;  3H3V I;  4QJF A;  4PZ8 A;  3CQZ H;  4B9W A;  3G6J B;  2BCO A;  3PO2 G;  4IJH A;  4L5Q A;  2A69 C;  3KFU A;  2UXD L;  4MN3 A;  1N34 Q;  1PH8 A;  1YIJ A;  1X56 A;  4K2K A;  2EQS A;  4ZCK A;  3I56 A;  4K5W A;  5JPN C;  1D5X C;  1CK1 A;  4XYQ A;  2EXZ A;  2WB1 B;  3TP5 A;  3MHB A;  1IW7 C;  1KLU D;  3M4P A;  3TN2 A;  3D4R A;  2R7Z H;  3S9W A;  2XN9 C;  1IL8 A;  2JA6 G;  5A2Q E;  3HS0 C;  1XWE A;  1U5K A;  5CC4 A;  2BE5 D;  4IPG A;  1RTN A;  1JMC A;  1SNO A;  1OXX K;  4JI6 L;  1S4Z A;  1BKB A;  2A73 B;  3X3N A;  2N3S A;  1Y1V H;  4C3I H;  3H0G G;  3VR6 A;  4AQY L;  3CRL C;  1LTL A;  4DR1 L;  4BA1 I;  1GUW A;  5C3E H;  3BVZ A;  2DUD A;  3RZD H;  2CKZ B;  3G4S A;  2JA5 H;  2D0O A;  1IXR A;  2I5H A;  2XRS D;  4IPD A;  1VQD A;  2K6A A;  2YTX A;  2WAQ B;  3GTJ H;  1K83 H;  2A69 D;  2UU9 L;  4O42 A;  1U4M A;  2VNU D;  2AWN A;  1AN8 A;  2TMP A;  4LFA L;  2UUB Q;  4RCO A;  3H09 A;  3NPP A;  4XTC S;  3HGB A;  4B9X A;  4A3F B;  2A1A A;  4ZLT F;  4G7O C;  4GLX A;  1FVI A;  3ERO A;  5K5P A;  3X3M A;  1IW7 D;  4LF4 Q;  2B63 B;  4HSP A;  4HSV A;  4N9T A;  1EY5 A;  4GN3 B;  1PZI D;  4X3T A;  1NSN S;  1MHW C;  1XYI A;  3GTK H;  3I4N G;  4HAE A;  2SEB D;  1RJT A;  3K5L A;  1RD9 D;  2F0J A;  4C3J G;  2NVX H;  5EPL A;  3RNU A;  2DY7 A;  1FD7 D;  5AJ3 L;  1BCP C;  3S1M H;  1YNX A;  1LT3 D;  1PTO C;  3M4O H;  1D2B A;  3C46 A;  3NBI A;  4ZRZ A;  1O80 A;  3KLR A;  3WWV A;  3NK9 A;  2EY1 A;  4X3S A;  1B9N A;  2VUM B;  1PRT B;  1TS3 A;  2KVM A;  2IWH A;  1NBW A;  1Z47 A;  1VQ7 A;  1FGU A;  4HIM A;  1YVC A;  1Q7Y C;  1KRS A;  2K52 A;  5M3F G;  4DFA A;  3PMF A;  2OTJ A;  3K7U C;  2B2V C;  2WAQ E;  4N9P A;  4K5V A;  1TT2 A;  2NVT H;  2E2J B;  3JAM i;  3I2Z A;  3MXP A;  4CDF C;  1G91 A;  1TWG B;  1TWF B;  5G3L F;  1EWH A;  2F0T A;  2UXB L;  2YYZ A;  1TS5 A;  1ZEQ X;  3CRK C;  2IW3 A;  1A62 A;  1X55 A;  1K9M C;  3HOV H;  2VQE L;  1B7Y B;  2NVQ H;  3UE0 A;  4HJ5 A;  1KAW A;  1PYS B;  2JJQ A;  1HZB A;  3D31 A;  2ZJP A;  1IYJ B;  1E7Z A;  1NMF A;  5IYB G;  1DOK A;  1KNE A;  1JIC A;  1TS2 A;  4NXN L;  3SVM A;  4X3K A;  4DV2 L;  4ME5 A;  4UP8 A;  4BY1 G;  1K3B C;  1PTO D;  4A3D B;  1B3A A;  4X65 Q;  1G29 1;  3CCU A;  4QY7 A;  4FNF A;  4PNY A;  4WOR A;  3FMC A;  3BU2 A;  2O4X A;  3A56 A;  4JI0 Q;  1U0L A;  4JI4 Q;  2UUA L;  2VB3 X;  2K28 A;  2HIX A;  1RHP A;  1U4L A;  2YTY A;  5EBC A;  2RQX A;  4GZY C;  2KHS A;  3VR3 A;  1N33 L;  5IT9 E;  4EQP A;  4FP5 D;  3KYH C;  1XMO L;  3S16 B;  4YIJ A;  5IP9 G;  5J1Z A;  1NCV A;  3S17 H;  4A3K B;  1TS4 A;  4B3S L;  2EY2 A;  1SYE A;  4LJZ C;  5FO7 B;  1UAP A;  2F4V L;  5IP7 H;  3M4Y A;  3DLL A;  4OIK A;  3F8T A;  5J39 A;  4QUF A;  3KF6 B;  4HCS A;  2XWB B;  3NBH B;  1E24 A;  4R4T A;  3MXN A;  2PQA A;  3WOF A;  1PFN A;  3DEP A;  2AHO B;  2IT1 A;  4R4Q A;  1KDA A;  5LMU L;  4KKS A;  4K0K L;  3P20 A;  5CV8 A;  5C4J B;  1K0S A;  2UXD Q;  2D9U A;  2P5Z X;  3DM1 A;  3FKI B;  1L1O C;  2I0Q A;  3HOU G;  1J9O A;  4IOA A;  1Q46 A;  2DJG C;  1Q82 C;  5DM6 3;  1PMR A;  2E2H H;  3GTM B;  2QA4 A;  3EIV A;  3K0Y A;  4EX5 A;  3T1Y L;  3BYT B;  1LTT D;  2RSO A;  1SFO B;  4DU9 A;  4UP9 A;  1Y8N B;  4A3C H;  3I4M B;  1HA6 A;  5L37 A;  1W6K A;  1STY A;  4DAV A;  1VQH A;  1I4X A;  2PYK A;  1GM5 A;  4CGY B;  3G6E A;  4KY7 A;  4AQY Q;  1ZYR C;  4DR1 Q;  5DNF A;  1S72 A;  3EBE A;  5GAH C;  1TWC H;  1T5X D;  3O13 A;  4QCL A;  3H91 A;  4DPG A;  2WIN B;  1CUK A;  1L1O A;  3PF5 A;  1Q8I A;  4A93 B;  5HUR A;  1H9K A;  5NUC A;  4BBR G;  3M7N A;  1VQJ A;  2L9H A;  3GV3 A;  2NTT A;  2UU9 Q;  3PIO A;  2L0C A;  2M2L A;  3HKS A;  4JI3 L;  3HOZ B;  5K36 H;  1XJV A;  3F2D A;  4LFA Q;  1W3S A;  2MGS A;  4P73 A;  2E2D C;  4WJW A;  4GNX C;  4PQX A;  2GN5 A;  5EJW A;  1X3F A;  5C44 G;  4GOP B;  1QE6 A;  2NB0 A;  5CMD A;  4G57 A;  4L63 B;  1L0X B;  4KKT A;  3MZ5 A;  3TZD A;  3HOX G;  4HTH A;  5CV6 A;  2K75 A;  5E1F A;  1G8Z D;  4OXP A;  4OO1 I;  3BZK A;  1IBK L;  1I4P A;  3V2T A;  4XQN A;  3MEF A;  4R1J A;  1O7I A;  4PMB A;  1LUZ A;  2K04 A;  1X3G A;  2G9H D;  1EWC A;  2CCZ A;  1NE3 A;  1ILQ A;  1LTS D;  1ZYR D;  5AJ3 Q;  3K58 A;  1I6H H;  4BY7 B;  3TEH B;  3MAQ A;  5COY A;  1STA A;  2EE1 A;  4WJ4 A;  1SEB D;  3NTH A;  3GTO B;  5G3L D;  3TP6 A;  3U4V A;  1H9S B;  3FHW A;  3AQQ A;  3M9B A;  3UI2 A;  3TP8 A;  4C1N I;  1KL9 A;  2EJF C;  2F03 A;  3P75 A;  4CKC A;  1LAC A;  2E75 C;  1F9R A;  1V1Q A;  2IHF A;  1STG A;  1F2L A;  4RGM A;  1A3U A;  1SNM A;  4FF4 A;  4CKE A;  2C35 B;  3MXG A;  4C1N K;  5IGD A;  5I6W A;  4PV1 C;  4H02 A;  3ND8 A;  4PZ6 A;  3RZO B;  2GVA A;  1E1O A;  2IPK D;  4DV1 L;  4G7Z C;  1HTL D;  4KKU A;  5E7N A;  4RKL A;  5M3F H;  2UXB Q;  1HR0 W;  2Q2T A;  1JCK B;  2VQE Q;  4FYD A;  1JJC B;  3N52 A;  2RDF A;  1SRU A;  2J4X A;  3PO2 B;  1TWH B;  3BVM A;  1SNC A;  4KJN A;  2F0N A;  3S1Q H;  4C3H H;  4K14 A;  3NHH A;  4DV2 Q;  1F77 A;  4LAA A;  4L5R C;  3T51 B;  1AEX A;  4JYA L;  1BCP B;  3I4O A;  4A75 A;  2QEX A;  4BBS G;  5IYB H;  4DV4 Q;  4FF2 A;  3KF8 A;  1DOM A;  1SLJ A;  3M4Q A;  4KMU C;  4YHH L;  3W2D A;  1QUQ B;  3T4A C;  1VQO A;  1TU2 B;  2L1B A;  2UUA Q;  4JBW A;  3CXC A;  3B6Y A;  1EQV A;  1Q3L A;  3NTI A;  1DXM A;  2CH4 W;  1JWS D;  1D8L A;  1GXD C;  4CJ0 B;  4A3L H;  1SYF A;  3R8B A;  1N33 Q;  2ZXO A;  4UY8 C;  2E2I H;  1CFM A;  1U4R A;  3BDL A;  5CYU A;  3L3O C;  3BJU A;  1XMO Q;  3VA5 A;  3FP9 A;  1Y1W G;  4DNR B;  3GTL B;  4NW2 A;  4OO1 G;  2RHS B;  1K8O A;  2F4V Q;  3CF5 A;  1GUN A;  2E74 C;  3LGJ A;  2BH2 A;  2SNS A;  1VQ5 A;  1HA5 A;  3NWT A;  2ICI A;  1C9O A;  3HOY H;  2L4N A;  1VQ8 A;  2FMM A;  3E5S A;  4OEL B;  1N9W A;  3GTG H;  4JI5 L;  3T56 B;  3WDN A;  5LMU Q;  2KHJ A;  3UE1 A;  4K0K Q;  4K8J A;  4POF A;  3BS1 A;  5IY0 A;  4AYB B;  1OXT A;  1KTK A;  5D65 A;  2JA8 B;  4R4I A;  1UEB A;  3EQL C;  1NY4 A;  1E2V A;  4GLA C;  2EVB A;  3S2H B;  3AU7 A;  4JI7 L;  2KOL A;  4L5S A;  3I4N B;  1DCZ A;  2PW5 A;  3T1Y Q;  3S2D H;  2K4K A;  4HIO A;  3IFT A;  2LXJ A;  4X3U A;  1KDC A;  1V1P A;  4ULL A;  3RLN A;  3KDF B;  2JA9 A;  2QW7 A;  1Q8K A;  2ZM6 Q;  1RDP D;  3ITP A;  1JR0 D;  3J81 j;  2Q8T A;  3K5M A;  1EOV A;  4Z9C B;  5CV4 A;  1PXU A;  3KBX A;  5M5X B;  1UE7 A;  1GUG A;  3CPW A;  4DR5 L;  4XQQ A;  1HQM C;  5ELN A;  4OWT B;  4KHP L;  1D1I A;  4H13 C;  3PIP 3;  4P74 A;  1SNQ A;  3KOJ A;  4H0L C;  1HUM A;  4ZUI A;  3HRZ C;  2A68 C;  3LNN A;  3DWP A; 
#chains in the Genus database with same CATH homology
 4XTC S;  1BBW A;  4BA2 I;  1SR3 A;  4P72 A;  1HJP A;  4JG2 A;  4X62 Q;  3OTO L;  4B3M L;  4LF9 Q;  2A1A A;  4R4C A;  5M5X H;  4GLX A;  4BBR H;  2Q2H A;  1KQS A;  2D0P A;  1FVI A;  4AYB E;  5J3B A;  4JBJ A;  4LUO A;  1FL0 A;  4LF4 Q;  3CME A;  1I50 H;  1X65 A;  2BA0 A;  3OYY A;  4XIG S;  4B3T L;  1VQK A;  1Q1E A;  4TVA B;  3CCQ A;  1IZ6 A;  2ZTC A;  4IFD J;  5IWA L;  1PVO A;  1YI2 A;  4GN3 B;  2LXK A;  4DV5 Q;  3KDF A;  1PH2 A;  2Q2U A;  1IBK Q;  4NB3 A;  3GTK H;  4JI0 L;  3I4N G;  1TXY A;  4DR3 L;  1J5E L;  4A3D G;  1OXV A;  2NVX H;  5C44 H;  1WYD A;  3RLF A;  3OW2 A;  5GRO A;  1EFW A;  2R7D A;  1RIP A;  3RNU A;  3HKZ G;  5AJ3 L;  4DV7 L;  4JI8 L;  3PO2 H;  1E1T A;  3S1M H;  1VQG A;  2JEA I;  1VQF A;  1TWH H;  1YNX A;  4OWW B;  1EWI A;  4LF8 L;  1KD1 C;  4A3F H;  1X9N A;  3M4O H;  1PFS A;  5IE8 A;  3WWV A;  5DLQ E;  2Z6K C;  4DK3 C;  4LFC L;  5GAE C;  3RLO A;  4C2M H;  2B63 H;  2V1C C;  4KI0 A;  4X66 L;  3K7A H;  4GKJ Q;  1B70 B;  1NBW A;  1Z47 A;  4JI6 Q;  1VQ7 A;  1OXU A;  4LWC A;  3CD6 A;  2R93 G;  1P8L A;  1FGU A;  1NTG A;  1WOC A;  3ERS X;  1YVC A;  5LMN L;  4HIM A;  1Q7Y C;  2K5H A;  4JV5 Q;  1KRS A;  2K52 A;  5M3F G;  4JBM A;  2JA6 H;  1OXS C;  2OTJ A;  3K7U C;  1GVP A;  3I55 A;  3AYH B;  2WAQ E;  2IX1 A;  3A74 A;  1HH2 P;  2NVT H;  2N78 A;  3JAM i;  3I2Z A;  4A3K G;  1VQB A;  4A3B H;  3CCM A;  2VZA A;  1G6P A;  1VQA A;  1EQR A;  3UDX A;  4DR4 Q;  3H0G H;  2NVY H;  1T9H A;  1X54 A;  4DAY B;  1HNW Q;  1GKH A;  5C0X I;  1CKN B;  3HOW H;  2UXB L;  2YYZ A;  1S40 A;  4DR6 L;  4A3I H;  4DV1 Q;  1A62 A;  1X55 A;  1XMQ Q;  3SGI A;  3W1B A;  1K9M C;  1I94 L;  2OWO A;  3HOV H;  2VQE L;  1B7Y B;  5M3M G;  2K50 A;  2NVQ H;  3UE0 A;  4HJ5 A;  2VL6 A;  1KAW A;  1PYS B;  2Q2I A;  2JJQ A;  3CCR A;  2B29 A;  3PUZ A;  1HZB A;  4O2D A;  5JEA J;  1EUJ A;  3D31 A;  2ZJP A;  3TS0 A;  4A3E G;  2JEB I;  4OX9 L;  1V43 A;  4DAM A;  5EAY A;  1NMG A;  3CC4 A;  1E7Z A;  1IYJ B;  1NMF A;  5IYB G;  1YJN A;  4A3C G;  1A63 A;  4GLV B;  1Q12 A;  4NXN L;  2WFW A;  2PMZ E;  1D7Q A;  2MQH A;  4DV2 L;  1PH9 A;  2JA7 H;  4UP8 A;  3MXN B;  4OWX B;  5C4X H;  2PQA B;  2YTV A;  4BY1 G;  3UDF A;  3FKI G;  3AFP A;  1XPR A;  4KHZ A;  1PH7 A;  1PH5 A;  4DR7 Q;  4X65 Q;  2PNH A;  4A4I A;  2KEN A;  4IO9 A;  2UXD L;  1G29 1;  4MZ9 A;  3H15 A;  2PI2 A;  1TWG H;  3CCU A;  4QY7 A;  3CW2 C;  4A3M H;  3Q8D A;  4JYA Q;  2NZH A;  1EQQ A;  1XNR Q;  1CKM A;  2ZTE A;  3BU2 A;  4JI0 Q;  1N32 L;  3NEL A;  1U0L A;  2VS1 A;  2A8V A;  4EQ5 A;  4JI4 Q;  4LF7 L;  2ZJR A;  4YHH Q;  2UUA L;  2OQK A;  1K8G A;  3I4M G;  1PH3 A;  4JOI C;  2HIX A;  5M5W H;  4LF5 Q;  2UXC Q;  5JJI A;  1AH9 A;  1MKH A;  4DV6 L;  4BBS H;  2YTY A;  5K36 G;  1QZH A;  4P75 A;  3S2H H;  1LM0 A;  1W2B A;  3I4N H;  4GS3 A;  1Q86 C;  1N33 L;  4DUY Q;  4YCU A;  1DGS A;  2I5M X;  1VQE A;  4C3J H;  2K5N A;  4A3D H;  1CKN A;  1SRO A;  4JI2 L;  3KYH C;  1XMO L;  4GNX A;  2F3I A;  3J80 i;  5IP9 G;  1HNX Q;  3JC6 6;  3KJO A;  1YIT A;  3EN2 A;  3S17 H;  3E9I A;  1UWV A;  4QGU A;  3PGZ A;  4AIM A;  4B3S L;  4KLK A;  2F4V L;  4JC0 A;  5IP7 H;  3CPF A;  1HNZ Q;  4UPA A;  4A93 G;  4MTN A;  1JJG A;  3DLL A;  2ZTD A;  5BR8 L;  1Y14 B;  3F8T A;  3H3V H;  2JE6 I;  1G51 A;  2GVB A;  5IYC G;  4HJ9 A;  3KF6 B;  1N36 L;  3NBH B;  1PV4 A;  2I5L X;  1KC8 C;  3RN2 A;  1E24 A;  4R4T A;  4HJ8 A;  3ULJ A;  2E5L Q;  2KCM A;  2PQA A;  1FJG Q;  1XNQ L;  2R93 H;  1L1O B;  2AHO B;  2IT1 A;  4R4Q A;  1Y1W H;  1SN8 A;  3PO3 G;  4LFB Q;  4JI1 L;  3PUX A;  3M85 A;  4A76 A;  3UDG A;  1Q81 C;  1SE8 A;  1WI5 A;  5LMU L;  4X64 L;  4K0K L;  1A8V A;  1N34 L;  2R7Z G;  1YJW A;  4JI5 Q;  1I94 Q;  1IBL Q;  4JOI A;  3D0F A;  3DM3 A;  4DR2 Q;  2UXD Q;  3K0X A;  1BBU A;  5IT9 c;  1V9P A;  1L1O C;  5IYD G;  2I0Q A;  3CC7 A;  1HR0 L;  3HOU G;  2VQF Q;  4IOA A;  1Q46 A;  2MO1 A;  3HKZ E;  1Q82 C;  1VQ4 A;  2E2H H;  4NXN Q;  2QA4 A;  1Y1V G;  3EIV A;  3GDE A;  1QZG A;  4IFD I;  1XPO A;  4LF6 L;  4EX5 A;  3T1Y L;  1VQ6 A;  1KRT A;  1B8A A;  1L0W A;  3GTQ H;  2RHQ B;  4AH6 A;  5M3M H;  4JI7 Q;  2HT1 A;  1E3P A;  5FLM G;  2E8G A;  5C3E G;  2CFM A;  2HHH Q;  4Y52 H;  2AMC B;  1K3R A;  2F52 A;  2N49 A;  5GQO A;  2JA5 G;  3U58 A;  1JJ2 A;  1H95 A;  5HY6 A;  4UP9 A;  3K80 C;  5LMN W;  3L7Z C;  4A3C H;  3CMA A;  1P16 A;  2JK8 A;  3PUY A;  2ZJQ A;  4BY7 G;  1C0A A;  3E9H A;  4P71 A;  1EYG A;  2VY3 A;  2R92 G;  1JT8 A;  2OCE A;  3A5U A;  4DUZ L;  5C0X G;  1VQH A;  5C4J H;  1GM5 A;  5FJ8 G;  3G6E A;  4DV0 Q;  4BY1 H;  4AQY Q;  2CQO A;  1K8A C;  1KIX A;  1Q1B A;  4DR1 Q;  4HJ7 A;  1S72 A;  4B3R L;  1M1K C;  4O0A A;  2D62 A;  1XPU A;  1EIF A;  3KF6 A;  4YY3 Q;  3EBE A;  5GAH C;  4A3J G;  4NXM Q;  1TWC H;  2B3G A;  2ASB A;  4YWM A;  1IBM L;  3A0J A;  1KHI A;  5GAD C;  3TRE A;  4DR5 Q;  4DPG A;  3PF5 A;  1CUK A;  1L1O A;  2HIV A;  4PZ7 A;  4RMF A;  1PH1 A;  4BXX H;  4GN4 B;  3CCJ A;  1PH4 A;  1AE3 A;  3RR5 A;  4BBR G;  3M7N A;  3T1H Q;  1K0R A;  1VQJ A;  4KHP Q;  1I5F A;  3A5Z B;  4GNX B;  4GKK L;  2VUM H;  2XTI A;  3TQY A;  2IX0 A;  5JEA G;  2UU9 Q;  3PIO A;  4DV3 L;  1M90 C;  1SMX A;  3PF4 A;  4B3S Q;  1CSQ A;  3HKS A;  4JI3 L;  2UUB L;  4TQU S;  1E22 A;  3G48 A;  1XJV A;  4LW1 A;  4X62 L;  2UUC Q;  3F2D A;  4LFA Q;  1W3S A;  4P73 A;  4LF9 L;  4GNX C;  4APV A;  2GN5 A;  4LNQ A;  3OTO Q;  4GOP B;  1X3F A;  5C44 G;  1K73 C;  1EIY B;  4B3M Q;  5IP9 H;  4LF4 L;  2E2J H;  4QIW E;  1MJC A;  3ULP A;  3HOX G;  1ASY A;  4RG1 A;  3S15 H;  2ALY B;  2K75 A;  4DV5 L;  2CWP A;  3KLW A;  4OXP A;  4OO1 I;  3BZK A;  4LUV A;  4B3T Q;  1TWF H;  1WCM H;  2K5V A;  1QVG A;  1IBK L;  2KHI A;  5IWA Q;  2KBN A;  4DV4 L;  3J81 i;  4GOP C;  3MEF A;  4R1J A;  2MFI A;  4DKA C;  5M5Y H;  1J6Q A;  1BVS A;  4L5T A;  1O7I A;  3IRB A;  3JAM c;  1LUZ A;  4A3L G;  1XTD A;  2HQL A;  4DR3 Q;  1J5E Q;  1X3G A;  1KXL A;  2MO0 A;  3GD7 A;  3U4Z A;  1NE3 A;  2CCZ A;  4POG A;  3PO3 H;  5AJ3 Q;  4DV7 Q;  1I6H H;  3I7F A;  4JI8 Q;  3TEH B;  2LSS A;  3UDI A;  1CKO A;  4WJ4 A;  4LF8 Q;  1Z9F A;  3ER0 A;  3U4V A;  3FHW A;  3AQQ A;  3M9B A;  3K81 C;  3U50 C;  1KL9 A;  1VQM A;  1ASZ A;  3HOU H;  4GKJ L;  3S24 A;  4LFC Q;  3TS2 A;  4A3B G;  2YV5 A;  3HOY G;  4X66 Q;  3KF8 B;  4Y7N H;  1VQP A;  3S1N H;  3PIP A;  1YJ9 A;  3CP0 A;  3PSI A;  1PHJ A;  1V1Q A;  3E0E A;  3HOW G;  5LMN Q;  2IHF A;  4J15 A;  3F2C A;  5FLM H;  3HOV G;  1HZC A;  2C35 B;  3F1Z A;  3S1R H;  4A3G G;  1X3E A;  1UE5 A;  2JQO A;  4K0K Q;  4H02 A;  5JJL A;  4PZ6 A;  4NPS A;  4GOP A;  2GVA A;  1GD7 A;  1E1O A;  3RN5 A;  4QQB X;  4DR4 L;  2R92 H;  1HZA A;  2AWO A;  1HNW L;  1YHB A;  3HOZ G;  4IFD G;  1A0I A;  4DV1 L;  2MNA A;  1XMQ L;  1VQI A;  2Y0S E;  2Y0S G;  4LUZ A;  1VQC A;  2JA7 G;  5C4X G;  2H5X A;  1RL2 A;  5E7N A;  1WFQ A;  2K14 A;  4YWL A;  3L0O A;  5M3F H;  2UXB Q;  1HR0 W;  4DR6 Q;  2Q2T A;  3AEV A;  2EIF A;  2VQE Q;  4FDB A;  1JJC B;  3S16 H;  1PA6 A;  1SRU A;  4JI3 Q;  4A3K H;  2OTL A;  4PMW A;  4OX9 Q;  3STB C;  4YCW A;  3CCE A;  3CCS A;  4HIK A;  1I3Q H;  3S1Q H;  1YHA A;  4C3H H;  1UE6 A;  1TWA H;  1YZ6 A;  4DR7 L;  4AYB G;  3L2P A;  3J80 c;  4DV2 Q;  3GTP H;  1QVF A;  4X65 L;  4PG3 A;  3G71 A;  4L5R C;  2JA8 G;  1C7Y A;  3RZO H;  1PYB A;  4JBK A;  4JYA L;  3I4O A;  2NN6 I;  1UE1 A;  4A3E H;  2YU9 H;  1XNR L;  1HZ9 A;  1X6O A;  2OQ0 A;  2A19 A;  4MNO A;  2ZM6 L;  2R7F A;  2QEX A;  4A75 A;  4BBS G;  3W1G A;  5IYB H;  2WB1 E;  4DV4 Q;  2WB1 G;  3ZJY C;  4HID A;  1SLJ A;  1QVC A;  3F2B A;  3M4Q A;  4JI4 L;  5GAG C;  5ELO A;  2BA1 A;  1N32 Q;  4YHH L;  3PUV A;  3FKI H;  3HOX H;  1QUQ B;  1IL2 A;  1VCI A;  2IHE A;  1VQO A;  4LF7 Q;  4IJL A;  4IPH A;  2RCN A;  1L2F A;  4LF5 L;  2UXC L;  2UUA Q;  1YEZ A;  1MIU A;  3K8A A;  4JBW A;  5IP7 G;  3KJP A;  2RF4 A;  3CXC A;  4ALP A;  3GTM H;  3B6Y A;  3VDY A;  3M3Y H;  4DUY L;  4DV6 Q;  1D8L A;  4ME3 A;  4OON A;  4A3L H;  1JE5 A;  4HJA A;  1N33 Q;  1VS0 A;  4UY8 C;  1HNX L;  2E2I H;  1SFO H;  2NZO A;  1YHQ A;  4JI2 Q;  3BJU A;  1XMO Q;  1Y1W G;  3FP9 A;  3BZC A;  3I4M H;  1HNZ L;  2R6G A;  3NEM A;  2ATW A;  4OO1 G;  2RHS B;  3AFQ A;  5C0X J;  2F4V Q;  3CC2 A;  3CF5 A;  4YWK A;  4WJ3 M;  2WAQ G;  3J7A 5;  2XGT A;  3LGJ A;  3ICE A;  2BH2 A;  3STB D;  5FLX c;  5BR8 Q;  3CCV A;  3H3V I;  4QJF A;  2E5L L;  4PZ8 A;  1VQ5 A;  4R4O A;  1OTC A;  1FJG L;  3CQZ H;  1N36 Q;  1C9O A;  1VQ9 A;  1VQN A;  4DNI A;  3HOY H;  1VQ8 A;  4LFB L;  1XNQ Q;  3PV0 A;  3PO2 G;  1N9W A;  4IJH A;  4L5Q A;  3GTG H;  4JI5 L;  4JI1 Q;  4GN5 A;  5LMU Q;  4A93 H;  4A3F G;  1IBL L;  2KHJ A;  3CAM A;  3UE1 A;  4DR2 L;  4X64 Q;  4POF A;  3KFU A;  1N34 Q;  4A3G H;  5IY0 A;  3PCO B;  2WP8 J;  2EXD A;  1R9T H;  1OXT A;  1PH8 A;  1YIJ A;  5IYC H;  2VQF L;  1X56 A;  2ID0 A;  4YCV A;  2L15 A;  3GTL H;  1VQL A;  4R4I A;  2Z6K A;  1UEB A;  2EQS A;  2Z0S A;  4JCV E;  3ULL A;  1HR0 Q;  2B63 G;  3S14 H;  1NY4 A;  3I56 A;  4GLA C;  1QUQ A;  3HOZ H;  4IOC A;  1CSP A;  4JI7 L;  3GO5 A;  2BH8 A;  4L5S A;  4DK6 C;  3M4P A;  3W5O A;  3T1Y Q;  2HHH L;  4LF6 Q;  2R7Z H;  2K4K A;  4HIO A;  3S2D H;  2IY5 B;  2JA6 G;  1GO3 E;  1AE2 A;  3TRZ A;  2LXJ A;  1U5K A;  4IPG A;  5IYD H;  4X6A H;  3NEN A;  1YBY A;  3RLN A;  3KDF B;  5HGQ A;  2JA9 A;  1JMC A;  3CCL A;  1Q8K A;  4B3R Q;  1OXX K;  4JI6 L;  2ZM6 Q;  1BKB A;  2N8N A;  2CWA A;  3J81 j;  4QL5 A;  2ES2 A;  2N3S A;  1Y1V H;  4BXX G;  4C3I H;  4DV0 L;  3H0G G;  3PUW A;  2AKW B;  2VW9 A;  4AQY L;  1EOV A;  5H1S E;  1LTL A;  4DUZ Q;  4JV5 L;  4DR1 L;  2PI2 E;  4A3I G;  2JA8 H;  4BA1 I;  4IPC A;  5C3E H;  3HFZ B;  2VUM G;  2DUD A;  3RZD H;  2CKZ B;  4YY3 L;  3G4S A;  4NXM L;  2JA5 H;  2D0O A;  1IXR A;  2I5H A;  1UE7 A;  1JB7 A;  3CPW A;  4IPD A;  1LYL A;  2QGQ A;  4DR5 L;  3J81 c;  4BY7 H;  4UP7 A;  1PH6 A;  1IBM Q;  5ELN A;  1VQD A;  2YTX A;  3T1H L;  4OWT B;  1MJE A;  1S3O A;  1WJJ A;  5FJ8 H;  3GTJ H;  3GTO H;  2FXQ A;  4KHP L;  2KCT A;  1K83 H;  2UU9 L;  5JJK A;  3J7Z C;  1N8R C;  4P74 A;  3KOJ A;  1NJI C;  4GKK Q;  2VNU D;  2AWN A;  2NN6 G;  4DV3 Q;  4A3J H;  2UUC L;  1WCM G;  2DGY A;  2UUB Q;  4A3M G;  4LFA L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...