4GKKL

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aua-codon in the a-site and paromomycin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 14
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4gkkL00
4EQ5A 4JI1L 3J80i 1NBWA 4B3ML 2F52A 4OO1I 4DUYL 3CC4A 3A5ZB 3OTOL 4A3FG 2OWOA 3TS0A 3J81c 2HT1A 1EOVA 2ASBA 1KIXA 2ZM6L 4BXXH 5HGQA 2HQLA 3K7UC 4LUOA 4A3EG 1LYLA 3T1YQ 1YJ9A 5FLXc 2PQAB 4GOPC 4WJ3M 1QUQA 1V1QA 4DAMA 4DR5Q 3T1HL 3W5OA 1NY4A 3PF4A 1J5EQ 1L1OC 2I5LX 3H3VH 3PUXA 4EX5A 4H02A 2VUMG 3I7FA 4POGA 5LMNW 1JMCA 4HJ9A 4BA2I 4R1JA 3A0JA 2NN6I 4A3EH 4JBJA 3CCSA 3CCQA 2R7ZH 2FXQA 1LUZA 5GROA 1VQEA 3TQYA 3CQZH 1UE7A 3RZOH 3T1YL 4YWKA 1M90C 4JOIC 2JA6G 2KHJA 5GAGC 4DR5L 2CWPA 1PA6A 1YHQA 2WB1E 3CCJA 1CUKA 2K75A 2CWAA 4PG3A 1VQOA 3BZKA 4IFDI 4UP8A 3PIOA 3UDFA 1J5EL 4DAYB 2ZJPA 2VL6A 4JI6Q 1PYBA 2I5HA 2KENA 1EFWA 2NVTH 1SRUA 1S3OA 1HNZQ 2JEBI 3CCUA 3AFQA 4JYAQ 1SE8A 3A5UA 2JA6H 3TRZA 2LXKA 3BZCA 3HOYG 4BY1H 2XTIA 3MXNB 3M85A 1Q81C 4UP7A 2LXJA 1K73C 2QA4A 4HIOA 1D8LA 1X3EA 1G291 2CCZA 1N36Q 2E2IH 1KXLA 4DV5Q 1Q82C 3UE1A 4LFAQ 2WAQG 1Z47A 3I4MG 3F1ZA 3S1NH 3KJPA 1N8RC 3CPFA 4A93G 2Y0SG 4JI6L 3JC66 1VQ6A 3AFPA 1VQ7A 2E2JH 3GTJH 1HNZL 4AYBE 4NXNQ 3HOYH 4P75A 5C4XH 2VQFQ 1XPOA 3I4NG 4JYAL 3FP9A 5IE8A 3CXCA 2JEAI 4A3DH 5JEAG 2WP8J 1WJJA 1W2BA 4LF9Q 4OXPA 4A3CG 3FKIG 3ERSX 2N8NA 3M7NA 1A0IA 1YVCA 4WJ4A 2N78A 4OONA 3PV0A 4DV5L 1EIFA 3RN2A 3UDGA 1XTDA 4LFAL 4A93H 1X65A 2QGQA 4DV3Q 2F3IA 2E2HH 1WFQA 4QY7A 5C0XG 3PGZA 2Z6KA 3PO3G 2R92H 3HOUH 3M4QA 3S16H 4NXNL 2PMZE 4PZ6A 2VQFL 4X64Q 4DK6C 4OO1G 1CKNB 4A3CH 3FKIH 2ZTEA 5C3EG 1EIYB 3S17H 3Q8DA 4JBKA 1JJCB 2B3GA 3EBEA 1VQPA 4X65Q 2IX0A 4IOAA 3S2DH 2CFMA 1TXYA 3NELA 4DV3L 1TWHH 1VQFA 3I55A 2UUBQ 2B63G 1IBKQ 3K7AH 4IO9A 5C3EH 1VCIA 3CCVA 1QUQB 4DR3Q 4L5TA 1PV4A 3AQQA 4P72A 2UXCQ 3K8AA 1G6PA 4BBRG 3G6EA 1HZCA 1VQLA 1WI5A 2R93G 2MFIA 1K83H 3A74A 5IT9c 3SGIA 2NVXH 2DUDA 2A8VA 3J81i 2K52A 3STBC 4X65L 2B29A 4DKAC 3CC7A 3HKZG 4DV0Q 1KC8C 3H15A 1MIUA 2VS1A 2F4VQ 2KHIA 2UUBL 4TVAB 4QQBX 1I5FA 4IPHA 4IFDG 3H0GG 5IWAQ 4A3JG 4QJFA 1YJNA 3GO5A 3KDFA 5M5YH 4DR3L 1LTLA 2UXCL 1Q1EA 1XPUA 3RNUA 1PH7A 1Y1WG 3KF6B 1L0WA 1EWIA 5M5XH 1EQRA 2BH8A 3HFZB 4B3TQ 1CKMA 1YBYA 1YIJA 3L7ZC 5HY6A 4A3MG 3ICEA 4X6AH 1C7YA 5IYBG 1GD7A 4DV0L 1K8GA 2JA7G 1V9PA 4A3JH 4O2DA 4C3JH 1JE5A 3D31A 1N33Q 2F4VL 3NENA 2YTVA 5IWAL 4YWLA 1OXXK 1VQ4A 1VQIA 4AH6A 3G48A 3U58A 1K3RA 5H1SE 2JA5G 1YHBA 5BR8Q 4LWCA 4IPDA 1OXTA 3GTPH 2EIFA 3CP0A 1VQMA 1NJIC 2OTLA 1A8VA 3PUWA 5IYBH 4B3TL 2ZTCA 1VQJA 2ALYB 4YWMA 3RLFA 4HIMA 4GOPA 4JI3Q 3KFUA 3ULPA 3TS2A 1I94Q 5M3MG 1I50H 5GADC 1PH6A 1N33L 1L1OA 1OXSC 2V1CC 3W1GA 1VQ9A 4A3FH 4DR2Q 3I4OA 2OCEA 5C4JH 3KJOA 1HR0W 4LNQA 4NXMQ 2D0OA 5K36G 5BR8L 1WCMG 1IZ6A 2K14A 4JCVE 4JV5Q 4KLKA 4JBWA 1R9TH 3MEFA 5GAEC 3OW2A 1E22A 2MNAA 1RIPA 1VQ8A 5JJIA 4JOIA 5M3MH 4JI3L 1ASZA 2KCTA 3E9IA 1PH9A 4GNXB 2D62A 2CQOA 3ZJYC 1XPRA 5IYCG 1JJ2A 1I94L 2BH2A 2Q2TA 2VUMH 1OXVA 4O0AA 3PSIA 3S1RH 4ME3A 3U4VA 1UE6A 4DR2L 1GVPA 4RMFA 3TREA 1IBLQ 3LGJA 4DR1Q 3RR5A 5LMNQ 4NXML 3NBHB 2NVYH 2VW9A 4DNIA 4JV5L 1NMGA 3HOWG 2ATWA 4KHPQ 4GN5A 4A76A 4B3SQ 1O7IA 5C44G 1SFOH 1EQQA 2YU9H 3E0EA 2E5LQ 1IYJB 5EAYA 4JI4Q 1W3SA 3AEVA 1WOCA 1YZ6A 4DV6Q 1BBUA 2R6GA 4KHZA 3J80c 3HKSA 3KLWA 4R4IA 1S40A 4A3KG 3BJUA 2ZJRA 2AWNA 4X62Q 2I5MX 4XIGS 5LMUQ 2IHFA 1YNXA 1TWCH 4DR1L 1PH4A 5LMNL 1EYGA 1IBLL 1VQNA 4MNOA 4FDBA 5IP9G 4DK3C 3HOWH 1E1OA 2K5HA 1G51A 1KHIA 4DV4Q 4A3LG 4BBSG 4APVA 1TWAH 4KHPL 4R4CA 3DM3A 1PH3A 4LUZA 4B3SL 2K4KA 4PZ7A 2UUAQ 3CC2A 1T9HA 5AJ3Q 2E5LL 1PFSA 3L0OA 4QGUA 4JI4L 3KDFB 1Y14B 3I4MH 5IP7G 4DV6L 2LSSA 4IPGA 1TWGH 2RCNA 3KOJA 1VQCA 4GLVB 1X6OA 2UUCQ 3S24A 4X62L 5IP9H 5LMUL 1QZGA 1SR3A 1CKOA 3H3VI 3I4NH 5DLQE 1K8AC 1P16A 4YCVA 3GTMH 3CCEA 4P71A 1HH2P 4DV4L 1S72A 3ULLA 4L5RC 3HOVG 3M3YH 1IXRA 1PYSB 3U50C 2UUAL 2YTXA 1VQ5A 4JI8Q 1QVGA 5IP7H 4MTNA 5AJ3L 4A4IA 4A3BG 2NZOA 1XNQQ 2H5XA 3S14H 2K50A 3JAMi 1NMFA 2IHEA 4KI0A 4HIDA 3CD6A 3PO3H 2UUCL 2PI2A 4JI2Q 2Z6KC 1VQBA 4IJHA 2N3SA 4GNXC 1Q86C 3D0FA 4L5QA 2JA8G 1L1OB 2NN6G 4JI8L 3M4OH 4A3BH 1Y1VG 3F2CA 2BA1A 1I6HH 4GKKQ 1VQKA 4LFCQ 1XNQL 2JJQA 3STBD 1C9OA 3F2BA 2B63H 3UDXA 4JBMA 4TQUS 1L2FA 2YV5A 4LF6Q 1BVSA 1TWFH 1VS0A 4JI2L 2AMCB 1PH1A 1KAWA 4A75A 4OWTB 2WFWA 3RLNA 4BBRH 1P8LA 2JA8H 3UDIA 4DR6Q 2R93H 3AYHB 3GTKH 1Y1VH 1GM5A 4QL5A 1QVCA 2MQHA 4DV7Q 1E1TA 4HJ7A 2VY3A 4A3IG 1FVIA 1XMOQ 3PUVA 2UU9Q 3GTQH 4GKKL 4LFCL 2MO1A 3CCLA 1B7YB 1IL2A 2HHHQ 3U4ZA 3S1QH 3BU2A 3H0GH 4LF6L 1CSPA 1QVFA 1ASYA 1BKBA 2E8GA 1YHAA 3CW2C 1N32Q 2K5VA 4HJ5A 1KQSA 1E24A 2I0QA 4LW1A 3K0XA 1Y1WH 4DR6L 3HOZG 4K0KQ 1RL2A 2XGTA 3F8TA 4GS3A 4A3IH 3B6YA 1HNWQ 2UXDQ 4DV7L 1X3GA 3G4SA 4A3MH 2IT1A 5J3BA 1DGSA 1N9WA 1HZ9A 2PNHA 5M3FG 1XMOL 2OQ0A 2UU9L 3G71A 2JA7H 2K5NA 2C35B 3RZDH 2HHHL 4OX9Q 4BXXG 1A63A 1N34Q 3PIPA 5JEAJ 4OWWB 1CKNA 5GQOA 3M4PA 5C0XI 2JA5H 4UP9A 1XNRQ 1N32L 1V43A 2AKWB 2WB1G 3HOZH 4DR4Q 2VNUD 1PH2A 1MJEA 4K0KL 4DUZQ 1Q1BA 2GN5A 5M3FH 1WYDA 1HNWL 2UXDL 3ULJA 2OQKA 4YHHL 1MKHA 5C0XJ 3CF5A 1XJVA 2AHOB 1Q46A 1UE5A 3KYHC 4LUVA 2R7ZG 2GVAA 4OX9L 1VQAA 4NPSA 4YY3Q 2JA9A 1N34L 1U5KA 3CCRA 3GTLH 1I3QH 1JT8A 4JC0A 4LF7Q 1E3PA 1KL9A 3I56A 2Q2IA 1XNRL 4JG2A 1SMXA 1WCMH 5ELNA 4DR4L 4C3IH 2L15A 2EQSA 1A62A 1UE1A 5ELOA 3CMEA 4DUZL 2A19A 3FHWA 1HR0Q 3HOXG 2ZJQA 1OTCA 4NB3A 4DR7Q 4BA1I 3CPWA 4AYBG 4P74A 4MZ9A 2UXBQ 5IYCH 4J15A 4IOCA 2AWOA 2BA0A 3L2PA 3GTOH 1X54A 2JE6I 3PO2G 2OTJA 4YY3L 1U0LA 4LF5Q 1C0AA 1OXUA 4BY1G 4LF7L 4PZ8A 3W1BA 1BBWA 3RN5A 4YCUA 4DV1Q 2KBNA 3KF6A 4GKJQ 1CSQA 4IJLA 3M9BA 3HOXH 2IX1A 4HJAA 4C3HH 1HR0L 2YYZA 4GLAC 2IY5B 1Z9FA 3S15H 3OYYA 5C44H 4DR7L 4R4OA 1AH9A 4B3RQ 1LM0A 3VDYA 1HNXQ 1FL0A 4GN4B 4P73A 4PMWA 4IFDJ 3PO2H 1K9MC 2UXBL 4AQYQ 2HIXA 1FJGQ 5C4XG 4A3DG 4A3KH 5JJLA 4LF5L 1NE3A 2NZHA 4LF4Q 2R7DA 5JJKA 1PH5A 1H95A 1FGUA 4XTCS 2ID0A 1YEZA 1J6QA 1Q7YC 4DV1L 4GKJL 4A3LH 1JJGA 4BBSH 1MJCA 1GO3E 4OWXB 1XMQQ 1PVOA 1VQHA 1X55A 2PQAA 3EN2A 2ES2A 1SN8A 4B3RL 1HNXL 2VQEQ 4L5SA 3TEHB 1M1KC 1VQDA 2R92G 3HOUG 3K81C 4AQYL 3CCMA 3PF5A 1FJGL 4IPCA 5FLMG 4JI5Q 3RLOA 5GAHC 3K80C 1YI2A 4LF4L 2WAQE 4R4QA 3NEMA 3CAMA 1N36L 1SROA 2Y0SE 3GD7A 2GVBA 4ALPA 1B70B 1E7ZA 3GTGH 3HOVH 1VQGA 1KRTA 1XMQL 1X3FA 2EXDA 4GOPB 4DV2Q 2CKZB 2YTYA 4RG1A 3F2DA 1HZAA 4GNXA 3PUYA 1GKHA 2VQEL 1YITA 1QZHA 1X9NA 5FLMH 2Z0SA 1IBMQ 4GLXA 2A1AA 4LF8Q 4YCWA 3UE0A 4LF9L 1AE2A 4Y7NH 4R4TA 3J81j 4JI5L 4JI7Q 1D7QA 4QIWE 1Q8KA 2Q2UA 1YJWA 4JI0Q 3S2HH 1X56A 4LFBQ 4POFA 1HZBA 4A3GG 2JK8A 1K0RA 2MO0A 4AIMA 3E9HA 4DV2L 4UY8C 3CMAA 1IBML 4LF8L 4X64L 3S1MH 2NVQH 4BY7G 3DLLA 1KRSA 1SLJA 2JQOA 4GN3B 1AE3A 4JI7L 3IRBA 2PI2E 3J7A5 1JB7A 5IYDG 4X66Q 4JI0L 1KD1C 4A3GH 4DPGA 3GDEA 4LFBL 5E7NA 1UWVA 2RHQB 5FJ8G 1HJPA 1NTGA 3ER0A 2RF4A 4UPAA 4JI1Q 5M5WH 1B8AA 2Q2HA 2QEXA 4HJ8A 4DUYQ 1IBKL 4B3MQ 4BY7H 2HIVA 3WWVA 3KF8B 2VZAA 3OTOQ 1UEBA 1Q12A 2ZTDA 3PCOB 2RHSB 2R7FA 4YHHQ 4C2MH 2ZM6Q 3PUZA 5IYDH 2N49A 2DGYA 3HKZE 2KCMA 3JAMc 2D0PA 1PHJA 4X66L 3J7ZC 1PH8A 5IY0A 5FJ8H 3EIVA 4HIKA 1EUJA 3T1HQ 4Y52H 3I2ZA
chains in the Genus database with same CATH superfamily
1IW7D 4FVMA 2F52A 2L4NA 4A3FG 2B2WA 1EOVA 5CGKA 1KIXA 4XYQA 1HUNA 5KRUA 3URYA 1LYLA 3P75A 1YJ9A 4I65A 4GOPC 2WKDA 2ZXRA 3K6OA 1JB3A 3HOVB 3PF4A 1NY4A 5DM73 1J5EQ 3PUXA 1K0SA 2XNAC 4OIJA 3Q0AA 2XIWA 4JBJA 5GROA 1VQEA 3TQYA 3V2TA 2KHJA 2JSOA 2MUYA 4KD4A 1VQOA 4I7ZC 1J5EL 3PIOA 3UDFA 4DAYB 1CHPD 2I5HA 2KENA 2NVQB 3QG1A 2HD3A 1SRUA 3SEBA 4ZQ3A 3AFQA 4RH6A 4BY1H 1LT5D 3M85A 1MHWC 1EQTA 1AEXA 2XWJB 1G291 4KY5A 5CR3A 1N36Q 1KXLA 4XYOA 4DV5Q 2F0EA 1Q82C 2WAQG 4RGTA 1QE6A 4A93G 2Y0SG 1VQ7A 2E2JH 4NXNQ 5JPNC 1XPOA 3FP9A 5IE8A 1B9MA 5JEAG 5C3WA 2Z6BA 4OEMB 1A3UA 1A3TA 2N8NA 3WOEA 4OONA 3Q24A 4DV5L 1PRTC 4A93H 2WACA 1X3QA 1WFQA 3PGZA 3MEHA 3PO3G 1PFMA 4NXNL 5JEAH 3A55A 2GA4B 4OO1G 1STBA 3J7YW 2ZTEA 1EIYB 3IFDA 5E3FA 2B3GA 3WOFA 4CJ0B 3NBHA 3S2DH 3NELA 4FNFA 1FNUA 3TP6A 4U673 1U4LA 1VCIA 4X3TA 4P72A 3G6EA 4ZLTF 1HZCA 3BVMA 5IT9c 3SGIA 2CQAA 2K52A 3STBC 4F7XA 2NYZD 5IGCA 3CC7A 4DV0Q 1KC8C 3HOXB 1VMPA 4RAUC 4C3HB 2E2DC 2KHIA 5JVG3 4QQBX 4AYBB 3H0GG 3KDFA 5M5YH 1CZWA 2A6ED 1PRTF 1XPUA 1PH7A 4BY1B 4B9XA 1L0WA 1CTMA 2BH8A 2L11A 4K5XA 4B3TQ 2HDMA 1BBXC 3L7ZC 1C7YA 5IYBG 2A73B 4DV0L 4TSSA 2F0NA 1JE5A 2XWBB 4DXFA 3NENA 1OXXK 4AH6A 2E2JB 1LT4D 1K3RA 5H1SE 1QB5D 1YHBA 5FKAC 4LWCA 2RDFA 3HP3A 1H9RA 2EIFA 2ICEC 1A8VA 2KHSA 3PUWA 5IYBH 4B3TL 5I4DA 4JI3Q 2SEBD 1W6JA 1X3PA 3TS2A 3CKIB 4C1NI 3SDZA 5GADC 2CHBD 1TS2A 1L1OA 1OXSC 1STGA 2F0TA 2V1CC 1VQ9A 5EGTA 3D8GA 1HCZA 1HR0W 4LNQA 4NXMQ 1STNA 1PXUA 1RHPA 4JCVE 4NDXA 1Q90A 4ZKBB 2B2WC 3H3VC 1E22A 1RIPA 1VQ8A 2WV6D 4JI3L 3HS0C 3S2DB 4GNXB 4RKBA 4HAEA 3NP8A 3ND8A 2VXWA 4FF3A 1UE6A 1GVPA 2PQEA 2RDGA 4DR1Q 4NXML 4DNIA 3OSOA 2AQ3B 3HOWG 1EIHA 4A76A 2N88A 1O7YA 1O7IA 5C5LA 1WOCA 3KF8A 4G57A 4KHZA 4A3KG 2EYFA 2AWNA 1EYGA 3QIAA 2Q8IB 1YNXA 5LMUQ 4DR1L 3KLRA 2O5JC 3HOWH 3D3RA 5IP9G 3JAME 4QUFA 4DV4Q 4BBSG 3IFTA 4PZ7A 3CC2A 4CDFC 4ODGA 1MBYA 1PFSA 1RKNA 5IP7G 4O1NA 4ZRZA 1TWGH 1VQCA 1EEID 1DXMA 5IP9H 5LMUL 3QJYA 3H3VI 1XXGA 1P16A 4L5RC 1HH2P 4DV4L 3DWAA 1EU3A 4IQZA 3U50C 2YTXA 1BUVT 4K5WA 5IP7H 1XNQQ 2OT2A 1HQRD 1QNKA 4HIDA 1NMFA 1BNZA 1U4PA 4KJNA 5C4ZA 3LNNA 2F0LA 4IJHA 3QB3A 1Q86C 1JWMD 3D0FA 2QW7A 2RCFA 2EOTA 2JA8G 2NN6G 5CMDA 3M4OH 1BCPC 1I6HH 1VQKA 1XNQL 3F2BA 2F0GA 2EPBA 4EQOA 1BVSA 2L5TA 1PH1A 1IHZA 1PTOF 4BBRH 3RUZA 4XQQA 2JA8H 3UDIA 4DR6Q 2NN6H 3NWSA 2O5IC 2CH4W 2VY3A 5J39A 1FVIA 1XMOQ 3GTQH 4QB4A 2MO1A 5IOCA 2E2IB 4KY6A 3BU2A 5ELDA 4IFDH 5IODA 3JAML 1CSPA 2E8GA 3G6JB 2KEDA 4HJ5A 1V1PA 4LW1A 3K0XA 4DR6L 3MXPA 1STEA 1RL2A 3W2DA 2F0WA 2XGTA 3B6YA 1SMYD 2TMPA 4HEDA 3NSWA 1LTSD 1XMOL 2JXMB 2K5NA 1TWGB 1BDOA 2CW0D 1CKNA 5KGUA 1LT3D 2AKWB 2WB1G 1PH2A 1BCPF 4DUZQ 3NPPA 1WYDA 1QWYA 4YHHL 1UE5A 2B2TA 3KYHC 2R7ZG 2GVAA 4NPSA 1NNXA 3GTLH 1I3QH 4JC0A 1E3PA 3I56A 2Q2IA 1WCMH 3HRZC 2A68C 1HR0Q 4DUZL 2A19A 3KUPA 5COYA 3T13A 4IURA 3M4OB 1H9SA 5IYCH 1I6HB 1E0BA 5CBEE 3L2PA 1X54A 3PO2G 2OTJA 2OF1A 4HMJA 2DJFC 3OPOA 1OXUA 4C56C 5EPKA 1BBWA 4XQNA 1DZ1A 4DV1Q 3KF6A 3A54A 4BBRB 1I4QA 1HR0L 3CRLC 2PO4A 2YYZA 2DY8A 4HCEA 1HTLD 5C44H 1JICA 3GP7A 3PIO3 1TR5A 3HKZB 4P73A 5E4WC 4IFDJ 3PO2H 3OMCA 1EY7A 3TBIB 1F9PA 5C4XG 2EVBA 2M00A 4ZAIA 4XTCS 3ERQA 3H94A 1Q7YC 4DV1L 1VMCA 1WTPA 4A3LH 1JJGA 3OW7A 1L0XB 2EY5A 4G7ZC 4L5SA 4ME5A 5IGBA 1D2BA 2DNEA 1JWUD 4KKUA 4JI5Q 4L6TB 2SNSA 2B2UA 4R4QA 2A6HC 1ET9A 3CAMA 2IJ0A 4ALPA 1AP0A 4OL7A 4MIUA 1HZAA 1LTTD 2J4XA 4LF9L 4XT3B 4R4TA 4DAYA 3RD4A 4JI5L 3KLSA 2DNCA 2TSSA 3NE5B 2WB1B 3GTLB 1I3QB 1F9SA 1YJWA 1IYUA 1WCMB 4LFBQ 2NBFA 2KCCA 3AU7A 1STHA 1TT2A 4X64L 3S1MH 1B3AA 1GXDC 1S5DD 4K5VA 3J7A5 1LTBD 1E2ZA 5IYDG 4X66Q 4KKSA 1SNOA 4LFBL 5E7NA 1UWVA 2K7VA 3D6WA 3VYUA 1MSHA 4UPAA 2FMMA 3R93A 4B3MQ 1A3VA 4CDEC 5C44B 1NR2A 3KF8B 2VZAA 1C8CA 1UEBA 3M4YA 3PCOB 4ZYSA 5IYDH 4LAAA 3HKZE 3JAMc 4X66L 1PH8A 5IY0A 3EIVA 3C46A 1NBWA 1S4ZA 4B3ML 3CC4A 1MI2A 3TS0A 3T16A 2HT1A 3NQTA 1OO9B 4BXXH 5HGQA 3K7UC 3X3MA 4F87A 2HUGA 4K2LA 4DAMA 2K04A 2VB3X 3BS1A 4R8IA 3EA6A 3W5OA 2F0QA 2VUMG 3VR3A 1EY9A 1WTOA 3I7FA 1JMCA 4QCLA 4BA2I 3NUCA 4R1JA 3CCQA 3A7AB 1K3BC 1ENAA 3NQIA 2I46A 1GUSA 5IGGA 4JOIC 2JA6G 4L8JA 2B2TC 2PZTA 2WB1E 1CUKA 1YNJC 4EVOA 4O42A 1HA5A 2ZJPA 3MFGA 3HZXA 2VL6A 3DM1A 1HNZQ 4JYAQ 1SE8A 3A5UA 2JA6H 2G5DA 3TRZA 3HOYG 3BZCA 4G7OC 2MHVA 4UP7A 5KYLA 4J6HA 1PFNA 3I4MG 5CV8A 3S1NH 1N8RC 4RA8A 4A3IB 3NTHA 3AFPA 3GTJH 1HNZL 3HOYH 2VQFQ 4JYAL 4A3DH 3CXCA 1E2WA 1W2BA 3I8ZA 4A3CG 1ICWA 1V1PB 3FKIG 3ERSX 3M7GA 5FOBB 4GZYC 1HRJA 3UDGA 3S9WA 4DV3Q 2BDOA 1XYIA 4IZ8A 3I72A 3J81E 5C0XG 2R92H 3FPPA 2BDNA 3SXHA 1DOKA 3S16H 4PZ6A 2VQFL 1RDPD 4DK6C 1CKNB 4A3CH 3FKIH 2O4XA 1AN8A 3U9OA 1BXTA 3J7AV 2Z1CA 1SSOA 4DV3L 3P20A 3I55A 2B63G 1D5ZC 1IBKQ 3K7AH 5BN4A 5I9PA 3CCVA 1QUQB 1EY0A 4L5TA 5HURA 1PV4A 3MC0B 2UXCQ 3MA2B 1HQMC 2Q8TA 1SJHD 1PZID 4KN7C 2QEJC 2DUDA 2NVXH 4JW0A 3O13A 1QILA 4KTAA 1C4QA 3H15A 1MIUA 2AUJD 2G9HD 4KY7A 2F4VQ 2XRSD 2EYLA 1LO5D 4IPHA 2XSCA 4A3JG 1A15A 2K5DA 2V4DA 3GO5A 2QKIC 4KN4C 2UXCL 2JA6B 5G3LD 2L0CA 3KBXA 4Q5VA 3KF6B 3NTIA 1EQRA 1YBYA 3ICEA 4A3MG 1PZJD 1FD7D 2A69D 1PFBA 1V9PA 4A3JH 4C3JH 2F4VL 1EYCA 3G48A 3GTJB 2MGSA 5CV6A 2EYPA 4A3DB 5BR8Q 1F77A 4ABNA 4NW2A 1F2YA 3CP0A 3J81L 4HIMA 3ULPA 2FJ2A 5M3MG 2WIIB 4A3FH 4ID6A 4DR2Q 2R92B 3S16B 4ILWA 3I4OA 2OCEA 5C4JH 2D0OA 5BR8L 3FKIB 4MN3A 4C3IG 5KNDA 5T1GA 4KLKA 4JBWA 1R9TH 3OW2A 4IUPA 4JK1C 2EE1A 2FFKB 5M3MH 1LABA 1ASZA 2E76C 4V0BA 5T1IA 2D62A 2CQOA 2BH2A 1OXVA 4O0AA 3S1RH 4ME3A 4DR2L 3K7AB 2XRQD 1CA5A 3U9SA 3LGJA 1YNND 2VW9A 4R9WA 2AQ2B 5CV4A 2JP1A 3GV6A 4B3SQ 3SK8A 1SFOH 3CRKC 1SNDA 3E0EA 5HGTA 1IYJB 2KECA 1XX8A 5EAYA 4EGVA 3K58A 3AEVA 2F0DA 2RSOA 1BBUA 2Z9HA 3KLWA 1S40A 3BDOA 1U9RA 1WVLA 4X62Q 1O7LA 4H7BA 4XIGS 1TIID 2CH4A 2IHFA 4DK3C 1E1OA 2K5HA 1KHIA 3TN2A 1B50A 1TWAH 4RFBA 3K5LA 4R4CA 3DM3A 4B3SL 3NBIA 4H0LC 2K5QA 4DK0A 4CDCC 4DK1A 3V96A 1NAPA 4BS9A 4C3JB 1PTOD 2AQ1B 3KOJA 2J7ZA 1X6OA 5KEEA 3S24A 1IL8A 4X62L 1STYA 1QZGA 3E6ZX 3W3AA 5DLQE 4YCVA 4P71A 5FLXE 1BQQT 1G2TA 1JCKB 2KUMA 5IGFA 4LJZC 5EBDA 1TS4A 4I7AA 2RKSA 4A3BG 2NZOA 1TVXA 2K50A 3JAMi 3CD6A 3VA7A 3PO3H 4A3FB 2F0PA 1KNEA 1SE3A 3SE0A 1KLGD 4OO1H 5C4JB 2N3SA 1R9TB 4GNXC 5FO8B 2FMCA 1G6ZA 4A3BH 3F2CA 5CV5A 4GKKQ 1WTHA 4LFCQ 1ZEQX 4CHTB 3FPUB 3S1RB 2KQ3A 4TQUS 4LF6Q 2YV5A 1ZYRD 1M8AA 1VS0A 4B08A 4OWTB 1P8LA 2O2LD 2BE5D 1GM5A 4QL5A 1QVCA 1SFOB 4HJ7A 1JWSD 1EY8A 3PUVA 1LTRD 1ESRA 4GKKL 4LFCL 4X3KA 3S1QH 3H0GH 4LF6L 1AZPA 1QVFA 1ASYA 1YHAA 2K5VA 2E75C 3HOZG 3FVQA 1TWAB 2UXDQ 1ESFA 3SK4A 4RCOA 1DGSA 1HZ9A 5M3FG 2WAQB 1I4GA 2C35B 4K2KA 4A93B 2Y0SB 5LL6S 3PIPA 5JEAJ 5FLXL 2WKCA 2B2VC 1IW7C 5GQOA 3M4PA 1LV9A 1ILPA 1O7ZA 3HOZH 4DR4Q 5LHY1 2Q8RE 1EU4A 4DF7A 3TP7A 1LACA 1PYWD 4J1MA 5M3FH 2UXDL 1PRTB 1XJVA 4YY3Q 3PO3B 4K8IA 1VF7A 1SMXA 4K6LA 4DR4L 2EQSA 1A62A 5ELOA 3FHWA 3DEOA 2KJXA 3D6CA 2ZJQA 4NB3A 4P74A 4J15A 2BA0A 3ND9A 4OHJA 3GTOH 1ENCA 1ILQA 1SNCA 2X6GA 4YY3L 4LF5Q 3SHLA 3W1BA 1GUTA 4FO2A 4GKJQ 4IJLA 5EKLA 5EPJA 5M5YB 4HJAA 4GLAC 3WDNA 1Z9FA 4B3RQ 4TKOB 1VF5C 1SE4A 1G8ZD 1JORA 4NMZA 4CKBA 1K9MC 4DN4M 2HIXA 2EJGC 4A3KH 3S1QB 2PW7A 4LF5L 3K5MA 3H0GB 4RWSC 1QJOA 2ZT9C 1PH5A 1B2TA 1J6QA 2F0JA 4GKJL 3C1FA 4BBSH 4KHVA 3EN2A 2IW3A 1PTOH 5ELCA 4B3RL 2VQEQ 3TEHB 5FO9B 1M1KC 3HOUG 4MHEA 3PF5A 1F9QA 2RSNA 3MFYA 4IPCA 1YI2A 2WAQE 1ZXTA 4S3SA 1WTVA 3HOZB 2Y0SE 3FDTA 4OIKA 3BYTB 1TU2B 4IUNA 3GTGH 1NSNS 1WTWA 2LMCB 1YITA 3PUYA 1RF2D 1QOHA 2OEOA 2VQEL 1X9NA 1QZHA 2Z0SA 3N52A 5BN3A 2A1AA 2Z8LA 1AE2A 3DWQA 4Y7NH 4JI7Q 1D7QA 5ELBA 2Q2UA 4JI0Q 3S2HH 1X56A 1Z7TA 4POFA 4A3GG 2JK8A 1PLFA 1KNAA 3E9HA 1SEBD 4P2CB 5C3XA 1U4MA 4BY7G 3DLLA 3J80E 2JQOA 1SLJA 3MZ5A 5L37A 1AE3A 4JI7L 3IRBA 1EQVA 3QWNA 4JI0L 1SYGA 4A3GH 3A8IE 5KNBA 3OIPA 2RHQB 1B3QA 5FJ8G 3HOWB 4JI1Q 4MTKA 3NK9A 4HJ8A 4DUYQ 3VA5A 4BY7H 3WWVA 1LLRD 1RD9D 2A6EC 3OTOQ 2MPMA 2ZTDA 4YHHQ 2N49A 4A3KB 5JVH3 3K0YA 3OIQA 5FJ8H 4IUQA 3Q22A 1ZKOA 1UAPA 1EUJA 1EOTA 4BBSB 4HTHA 4JI1L 1ML0D 1E2VA 2VB2X 5E4XA 1JOOA 4EQ5A 1J8IA 1K8OA 2LFNA 4DUYL 4CKEA 1PTOB 1KABA 3A5ZB 4KD3A 3OTOL 1EY6A 3E5SA 2ASBA 3MHBA 1D1KA 4N9PA 2HQLA 2D2CC 4LUOA 5FLXc 2PQAB 1QUQA 2K28A 2L1BA 1AFPA 1DOMA 4IN3A 3GTGB 3SR1A 1L1OC 4H02A 2F0IA 4POGA 5LMNW 4HJ9A 3A0JA 2NN6I 4Y7NB 3CCSA 2J0TD 3DHQA 2R7ZH 2WINB 2FXQA 1LUZA 4E6IA 3CQZH 1UE7A 4ZKCB 2PCFB 4YWKA 4ZK9B 1M90C 4LMQD 3S2HB 2CWPA 3R2IA 3CCJA 2CWAA 2IL8A 4IFDI 1SE2A 4UP8A 2EYJA 3J80L 2JA8B 3TMEA 1PYBA 1EFWA 2NVTH 2JEBI 3CCUA 3IAYA 2L9HA 3BVZA 4F8MA 3GTQB 1K28A 1IKMA 1KDCA 2XTIA 3DEPA 3QR8A 4A3GB 4JVZA 2QA4A 4HIOA 1D8LA 1X3EA 2F0KA 4PMBA 1MGSA 3UE1A 2F3VA 4LFAQ 1Z47A 3F1ZA 4BY7B 1NR4A 3JC66 4K6DA 3IL8A 5C4XH 3I4NG 2JEAI 3I90A 1B1ZA 2R61A 4LF9Q 2WP8J 1Q3LA 2DN8A 3R3OA 4CKCA 4OXPA 2F1MA 4N9TA 1QG7A 2IPKD 1A0IA 1B44D 3T56B 3PV0A 1EIFA 4LFAL 2QGQA 2E2HH 2F3IA 2Z6KA 5FK9C 1KTKA 3M4QA 4M8AA 4X64Q 3QOJA 4RHRA 2K6AA 3Q8DA 4JBKA 1QNUA 1Y8OB 1VQPA 4IUTA 4X65Q 1CK1A 2IX0A 5JPMC 4IOAA 1SXTA 1TWHH 2UUBQ 4LK1C 2B2YA 3ONAB 3E0JA 2R7ZB 3AQQA 3CQZB 3K8AA 4NKLA 1QCBD 3EVQA 1VQLA 1CT1D 1WI5A 1O78A 2R93G 3A74A 3J81i 1EY4A 4X65L 2B29A 1B53A 2UUBL 5IWAQ 2NVTB 1YJNA 2HQEA 3PO2B 5EPLA 1Y1WG 1EWIA 5M5XH 1Z6HA 1S5ED 1X32A 1CKMA 1YIJA 5HY6A 5JAVA 4X6AH 1ENFA 1GD7A 2JA7G 2PNRC 4HR7B 4O2DA 3D31A 2YTVA 2EXZA 5IWAL 4YWLA 2JA5G 5C4XB 3D4DA 2QILA 1SMYC 1OXTA 3GTPH 1TY2A 2OTLA 1NJIC 1VQJA 2ALYB 4GOPA 3RLFA 3KFUA 2CW0C 3PMFA 1LTGD 1EYDA 1ICFB 1I50H 2E2HB 1A6XA 1PH6A 3K57A 2RDHA 1VDZA 1SNMA 3KJOA 3PIP3 5K36G 2PW5A 1IZ6A 3ZYYX 4JV5Q 3MEFA 5IGEA 3AB9A 5JJIA 1WD1A 2KCTA 3E9IA 2NTTA 1PH9A 3ZJYC 1UUPA 4DAPA 1XPRA 1JJ2A 2VUMH 5I6YA 1TWHB 3Q6SA 1L0YB 3C1EA 3MWYW 5A35A 2A5HA 4RMFA 2I07B 1IBLQ 3S1MB 5LMNQ 3AMUA 2F0SA 2C5CA 2X69A 2C9OA 4JV5L 2SDFA 2K33A 3NWTA 2Z4HA 1DONA 4KHPQ 1CI3M 3R2TA 3G7LA 4JI4Q 5JOBA 1YZ6A 4DV6Q 4G7HC 2R6GA 3J80c 4R4IA 2E74C 3BJUA 2ZJRA 4UDUC 1IBLL 1VQNA 5LMNL 2P5ZX 4MNOA 4FDBA 1RCVD 2NTSA 5DNFA 4KHPL 1UEAB 5M5XB 4Q0FA 2M9VA 5AJ3Q 3L0OA 4JI4L 3I4MH 4DV6L 2RCNA 1DD2A 2UUCQ 1PRTD 1SR3A 1CKOA 1K8AC 2D5DA 5M9OA 3CCEA 2QDBA 5D3IB 1S72A 3HOVG 5DM63 2K5WA 1VQ5A 1DOLA 5AJ3L 4CGYB 1EIGA 2LKVA 1WTQA 1I50B 2H5XA 3N6RA 2B2UC 4QF4A 3S14H 5C0XH 2UUCL 1I4HA 4FF1A 3GQBA 3IKJA 3E3XA 4JI2Q 1JC7A 5I6WA 5K5PA 1NUCA 4N8FA 2Z6KC 3VR2A 2MJ8A 3OOCA 4L5QA 4WFN3 2VUMB 3STBD 1C9OA 4QUCA 1HFGA 4XXEA 2B63H 4WRDA 1L2FA 1BF4A 2XN9C 1TWFH 1F9RA 1EWCA 4JI2L 2AMCB 3HEJA 1WTRA 1Y8NB 1KDAA 1KDBA 3FMCA 2B2YC 3C3LA 1HUMA 2QDLA 4DV7Q 1E1TA 2UU9Q 3CCLA 1H9KA 1V8QA 1IL2A 4TRDA 3U4ZA 2HHHQ 2K1BA 5KIXA 3S1NB 3VYTA 1BKBA 1SJED 3CW2C 2AUKA 3TZUA 1G2SA 4XQJA 3VR5A 1E24A 5E1FA 1GHJA 2I0QA 3HOYB 1EEFD 4K0KQ 1A2UA 4GS3A 4DNTB 1HNWQ 4C1NK 1EYAA 1RODA 1JR0D 1X3GA 2IT1A 5J3BA 4DV7L 4A3MH 1GHKA 2PNHA 2UU9L 3I4MB 3G71A 3RZDH 2B8GA 2HHHL 4OX9Q 1A63A 3T4AC 1N34Q 4RGOS 5C0XI 1D1IA 1XNRQ 2KVMA 1Y69U 1MJEA 3I3CA 3I4LA 4K0KL 1S5FD 1H9MA 2GN5A 1HNWL 3ULJA 5C0XJ 1LTAD 1HXYD 2AHOB 4LUVA 3S14B 4OX9L 4IUUA 1VQAA 2JA9A 1N34L 3CCRA 1JT8A 2BCOA 4LF7Q 1EZ6A 1KL9A 1XNRL 2XVSA 5I2XA 5ELNA 1PMRA 4C3IH 1KAAA 4OGQC 3LWEA 1H9JA 1UE1A 3EJIA 2N55A 3HOXG 4H13C 4V190 2IWHA 3TP8A 1SYFA 4C3HG 2NVXB 4BA1I 4AYBG 4MZ9A 4IOCA 1M4VA 2K03A 4CDDC 2JE6I 1C0AA 2B63B 1B4OA 4BY1G 4LF7L 4PZ8A 1TWFB 2SOBA 4YCUA 1CSQA 3HOXH 2LS01 2IX1A 3K5NA 4C3HH 3VYSA 3S15H 4R4OA 1AH9A 3C2PA 1LM0A 3VDYA 4PMWA 1II3A 4B9WA 4AQYQ 1FJGQ 4G4KA 3GV3A 5JJLA 1NE3A 4A3JB 2NZHA 1SNQA 2ID0A 2HDLA 1LTID 1RTOA 1FNWA 1J9OA 1SAPA 4OWXB 1GO3E 1T5XD 3BG3A 3HGBA 1X55A 2PQAA 4DA2A 2ES2A 4QMGA 1HPCA 1PVOA 4HN7A 3H09A 1HTPA 4A3MB 2M2LA 1D5MC 1JOKA 4AQYL 5KNCA 4PV1C 1FJGL 3RZDB 3RLOA 3K80C 1SDFA 3NEMA 4R8NA 1N36L 1SROA 3GD7A 2GVBA 1R4PB 1B70B 1E7ZA 1VQGA 2EJMA 1KRTA 4GOPB 1JQYD 4DV2Q 2CKZB 3R8BA 3F2DA 3X3NA 1IBMQ 1GKHA 4LF8Q 1TS3A 4IALA 4DU9A 4GLXA 4YCWA 1W6KA 5M3MB 3J81j 1BCPD 1Q8KA 2HCCA 3KBGA 1Y8PB 2ICIA 1MSGA 2DY7A 4C3IB 1GUWA 2NZ1D 2MO0A 1V1OA 2JN4A 3MTSA 4J8QA 4DV2L 1SBBB 1IBML 4LF8L 1LT6D 2NUCA 1KRSA 2SNMA 3MXUA 2PI2E 2L55A 1D5XC 1KD1C 4DPGA 1BO0A 3RMHA 3A8KE 1FYCA 5M5WH 3Q23A 2Q2HA 3EROA 2QEXA 3S15B 3D4WA 2HIVA 1ET6A 1Q12A 3QOLA 2EY2A 3NHHA 4C2MH 2ZM6Q 2RA4A 1F2LA 4PMCA 2KEEA 2D0PA 1PHJA 3T51B 2PPBC 3H6MA 2A69C 3A56A 3T1HQ 4Y52H 1SYEA 3FRPB 3J80i 3CHBD 2F03A 4OO1I 1CQVA 2PMZB 4DFAA 1U4RA 2OWOA 2EY1A 3J81c 4RCNA 2ZM6L 3A8JE 4A3EG 4KMUC 3T1YQ 4WJ3M 5ELFA 1V1QA 4DR5Q 1PDQA 3T1HL 2A74C 2I5LX 3H3VH 4EX5A 2F4IA 2KOLA 3P7JA 2A68D 3VR6A 4A3BB 4A3EH 3LX0A 3EQLC 3BVGA 2RQXA 3DUZA 3RZOH 3T1YL 5GAGC 4X3SA 4DR5L 2LY7A 5G3LF 1YHQA 1PA6A 1PZKD 2K75A 4H44C 4PG3A 5F2DA 3BZKA 3MXGA 2CVRA 4DAVA 2F0OA 1YNNC 4JI6Q 3VYRA 3FEWX 1I4XA 4RGNA 4KKTA 1S3OA 3F2UA 3L3OC 4JPBW 2LXKA 1TKWB 4N8X1 3MXNB 2IX3A 4FXGC 1Q81C 2LXJA 1K73C 4M1UB 2K05A 2CCZA 2E2IH 5M5WB 1R4QB 3NTKA 3KJPA 3CPFA 3I70A 4JI6L 1GJXA 1VQ6A 3DMUA 4AYBE 4P75A 2KA7A 4C2MB 1NCVA 1WJJA 2EZVA 4CBVA 1EZ8A 1PTOC 1DM0B 3M7NA 1YVCA 3MAQA 4WJ4A 2N78A 2F0FA 2A6HD 3RN2A 5ELEA 1XTDA 1X65A 4QY7A 4DGZA 1K8MA 5M3FB 3HOUH 2PMZE 4IUVA 2FHTA 5C3EG 3S17H 1JJCB 1XWEA 3EBEA 2NWGA 1MD2D 4KJOA 2CFMA 1TXYA 1C48A 1VQFA 1I6VC 1HFNA 5IGDA 4IO9A 1WTXA 5C3EH 4A3EB 3CU7A 5BN5A 4DR3Q 3EFXD 1AW7A 1G6PA 4BBRG 3RZOB 4DXGA 3GTOB 1HA6A 2MFIA 1K83H 2KCNA 1BR9A 2JYOA 2A8VA 1TY0A 2RBMA 4DKAC 3HKZG 5C6AA 5EKIA 1ZYRC 3PQIA 2VS1A 1GUNA 2K32A 4TVAB 1I5FA 4IFDG 4QJFA 1Q8IA 5NUCA 2F0UA 4DR3L 1LTLA 2BE5C 1Q1EA 2ZXOA 3VR4A 2QCPX 3RNUA 2EDGA 2R3ZA 3HFZB 1CQFA 1S5BD 5CYUA 2F3WA 1K8GA 3OMGA 1EL0A 1N33Q 5DAUA 1VQ4A 1VQIA 3OHXC 3U58A 4IPDA 2HCIA 1VQMA 1WD0A 2ZTCA 4YWMA 1I94Q 1CA6A 4YIJA 1N33L 3W1GA 3KLSX 1XTCD 3HOUB 1WCMG 2K14A 2QF7A 5LL6X 3HG9A 5GAEC 3S17B 5TSSA 2MNAA 1DYQA 3I91A 4JOIA 4UHVA 3QO2A 1I94L 5IYCG 2Q2TA 1A2TA 3PSIA 3U4VA 1YNJD 5I2YA 1BCPB 5C3EB 3TREA 2BOSA 3RR5A 1T5EA 2NVYH 3NBHB 1JE4A 1F2ZA 1NMGA 2ATWA 1K83B 4GN5A 4WORA 5C44G 1EQQA 5DEHA 2YU9H 1CM9A 3NXWA 2E5LQ 1HHVA 1W3SA 5FO7B 3TP5A 3HKSA 1IYVA 2H4OA 4FP5D 4FF4A 2I5MX 3OWEB 1TWCH 1PH4A 1CFMA 5J22A 2VNUD 1G51A 4A3LG 2EYMA 4APVA 1I4PA 1PH3A 4LUZA 2K4KA 2UUAQ 1T9HA 4X3UA 2E5LL 4QGUA 3KDFB 1Y14B 2PYKA 2LSSA 4IPGA 1GUOA 4HCSA 4GLVB 3I4NH 3GTMH 1FGBD 3ULLA 3M3YH 3DWPA 1IXRA 1PYSB 2UUAL 4JI8Q 1QVGA 1I4RA 4MTNA 4HSVA 4A4IA 3ITPA 4U68A 3I73A 2IHEA 4FXKC 4KI0A 5C4HA 2PI2A 4UAIA 3DXJC 1KLUD 4HMIA 1D6EC 1VQBA 3UI2A 1ONLA 4WJWA 1L1OB 4JI8L 2OXPA 1Y1VG 2BA1A 2H1EA 2JJQA 2PZWA 3KK7A 1RTNA 3TZDA 3UDXA 4JBMA 4FXDA 5EJWA 1SYDA 1KAWA 4A75A 2NVYB 3J7AF 3RLNA 2EJFC 2WFWA 5JJZA 2R93H 3AYHB 3GTKH 4DNRB 1Y1VH 4L63B 4RGMA 2MQHA 5EQ0A 2YU9B 2MP1A 4A3IG 3BZDB 4ULLA 5CBAE 1CHQD 1BOSA 1B7YB 3D4RA 3SK5A 2B8FA 1F2MA 1SYBA 3LWUA 3A7LA 4KV6A 4F88A 1TWCB 1GOZA 4HSPA 5D3DA 1N32Q 1KQSA 3TSSA 2DJGC 1Y1WH 3F8TA 4A3IH 4K8JA 2RVLA 3G4SA 1SYCA 1N9WA 2D9UA 2OQ0A 2F0VA 2JA7H 4EQPA 4BXXG 1RJTA 4OWWB 2FINB 4BWGB 2JA5H 4UP9A 5CORA 1N32L 3I4NB 1V43A 3GTMB 5A2QE 1TQOA 5IIFA 3M3YB 3BDCA 1Q1BA 2B39A 2X6LA 4CJ2C 4RKLA 2OQKA 1MKHA 2K01A 3CF5A 4XDXA 1EFID 4Z9CB 1Q46A 4QIWB 3H91A 3SVMA 1GUGA 1FR3A 1U5KA 5EKKA 4JG2A 5K36H 2L15A 3K59A 5IT9E 3CMEA 1G91A 4ZUIA 1OTCA 4DR7Q 3CPWA 5CC4A 1JOQA 2UXBQ 4NP5A 3L9AX 2AWOA 1UNSA 1U0LA 5I9OA 3RN5A 2KBNA 3M9BA 2R93B 4PQXA 3GTKB 2IY5B 1Y1VB 3OYYA 4DR7L 1O80A 1HNXQ 3TDQA 1FL0A 4GN4B 2UXBL 3BYYB 1FNVA 3K5OA 4A3DG 4LF4Q 2EYOA 2R7DA 4OELB 5JJKA 1H95A 3P1HA 1FGUA 5D65A 4FF2A 1YEZA 3MVVA 4CJ1B 1MJCA 1XMQQ 1Y1WB 2EYHA 1VQHA 5C5MA 1SN8A 2PZUA 3GTPB 1HNXL 1AZQA 2R92G 1VQDA 1CZGA 2JA7B 3K81C 4ZCKA 3CCMA 4ZUJA 5FLMG 2L12A 5GAHC 1EY5A 4LF4L 5A2QL 4K14A 2JA5B 2F0HA 5J1ZA 1XMQL 3HOVH 1X3FA 2EXDA 1EWHA 2YTYA 4KK7A 4RG1A 4GNXA 1DJRD 2F0MA 5FLMH 3UE0A 2ENBA 1TS5A 1SNPA 4QIWE 5IT9L 4EQNA 1B9NA 4FYDA 5EBCA 3V05A 1HZBA 3T53B 1K0RA 3MXNA 1IKLA 2Z4IA 4AIMA 4UY8C 2ZXPA 3CMAA 4PNYA 2NVQH 2G9DA 1STAA 2NB0A 4GN3B 5AFWA 5CV9A 1JB7A 3GDEA 1DCZA 1H9SB 4XT1B 1HJPA 1NTGA 3ER0A 2RF4A 5ISRA 1B8AA 1IBKL 4C3JG 3BDLA 5KYIA 1S5CD 3SK6A 2RHSB 2R7FA 3PUZA 2DGYA 3OWFA 2KCMA 5CV7A 3J7ZC 4RHSA 2EY6A 2B2VA 5D14A 4HIKA 3I2ZA
chains in the Genus database with same CATH topology
4EQ5A 4JI1L 3J80i 1NBWA 4B3ML 2F52A 4OO1I 4DUYL 3CC4A 3A5ZB 3OTOL 4A3FG 2OWOA 3TS0A 3J81c 2HT1A 1EOVA 2ASBA 1KIXA 2ZM6L 4BXXH 5HGQA 2HQLA 3K7UC 4LUOA 4A3EG 1LYLA 3T1YQ 1YJ9A 5FLXc 2PQAB 4GOPC 4WJ3M 1QUQA 1V1QA 4DAMA 4DR5Q 3T1HL 3W5OA 1NY4A 3PF4A 1J5EQ 1L1OC 2I5LX 3H3VH 3PUXA 4EX5A 4H02A 2VUMG 3I7FA 4POGA 5LMNW 1JMCA 4HJ9A 4BA2I 4R1JA 3A0JA 2NN6I 4A3EH 4JBJA 3CCSA 3CCQA 2R7ZH 2FXQA 1LUZA 5GROA 1VQEA 3TQYA 3CQZH 1UE7A 3RZOH 3T1YL 4YWKA 1M90C 4JOIC 2JA6G 2KHJA 5GAGC 4DR5L 2CWPA 1PA6A 1YHQA 2WB1E 3CCJA 1CUKA 2K75A 2CWAA 4PG3A 1VQOA 3BZKA 4IFDI 4UP8A 3PIOA 3UDFA 1J5EL 4DAYB 2ZJPA 2VL6A 4JI6Q 1PYBA 2I5HA 2KENA 1EFWA 2NVTH 1SRUA 1S3OA 1HNZQ 2JEBI 3CCUA 3AFQA 4JYAQ 1SE8A 3A5UA 2JA6H 3TRZA 2LXKA 3BZCA 3HOYG 4BY1H 2XTIA 3MXNB 3M85A 1Q81C 4UP7A 2LXJA 1K73C 2QA4A 4HIOA 1D8LA 1X3EA 1G291 2CCZA 1N36Q 2E2IH 1KXLA 4DV5Q 1Q82C 3UE1A 4LFAQ 2WAQG 1Z47A 3I4MG 3F1ZA 3S1NH 3KJPA 1N8RC 3CPFA 4A93G 2Y0SG 4JI6L 3JC66 1VQ6A 3AFPA 1VQ7A 2E2JH 3GTJH 1HNZL 4AYBE 4NXNQ 3HOYH 4P75A 5C4XH 2VQFQ 1XPOA 3I4NG 4JYAL 3FP9A 5IE8A 3CXCA 2JEAI 4A3DH 5JEAG 2WP8J 1WJJA 1W2BA 4LF9Q 4OXPA 4A3CG 3FKIG 3ERSX 2N8NA 3M7NA 1A0IA 1YVCA 4WJ4A 2N78A 4OONA 3PV0A 4DV5L 1EIFA 3RN2A 3UDGA 1XTDA 4LFAL 4A93H 1X65A 2QGQA 4DV3Q 2F3IA 2E2HH 1WFQA 4QY7A 5C0XG 3PGZA 2Z6KA 3PO3G 2R92H 3HOUH 3M4QA 3S16H 4NXNL 2PMZE 4PZ6A 2VQFL 4X64Q 4DK6C 4OO1G 1CKNB 4A3CH 3FKIH 2ZTEA 5C3EG 1EIYB 3S17H 3Q8DA 4JBKA 1JJCB 2B3GA 3EBEA 1VQPA 4X65Q 2IX0A 4IOAA 3S2DH 2CFMA 1TXYA 3NELA 4DV3L 1TWHH 1VQFA 3I55A 2UUBQ 2B63G 1IBKQ 3K7AH 4IO9A 5C3EH 1VCIA 3CCVA 1QUQB 4DR3Q 4L5TA 1PV4A 3AQQA 4P72A 2UXCQ 3K8AA 1G6PA 4BBRG 3G6EA 1HZCA 1VQLA 1WI5A 2R93G 2MFIA 1K83H 3A74A 5IT9c 3SGIA 2NVXH 2DUDA 2A8VA 3J81i 2K52A 3STBC 4X65L 2B29A 4DKAC 3CC7A 3HKZG 4DV0Q 1KC8C 3H15A 1MIUA 2VS1A 2F4VQ 2KHIA 2UUBL 4TVAB 4QQBX 1I5FA 4IPHA 4IFDG 3H0GG 5IWAQ 4A3JG 4QJFA 1YJNA 3GO5A 3KDFA 5M5YH 4DR3L 1LTLA 2UXCL 1Q1EA 1XPUA 3RNUA 1PH7A 1Y1WG 3KF6B 1L0WA 1EWIA 5M5XH 1EQRA 2BH8A 3HFZB 4B3TQ 1CKMA 1YBYA 1YIJA 3L7ZC 5HY6A 4A3MG 3ICEA 4X6AH 1C7YA 5IYBG 1GD7A 4DV0L 1K8GA 2JA7G 1V9PA 4A3JH 4O2DA 4C3JH 1JE5A 3D31A 1N33Q 2F4VL 3NENA 2YTVA 5IWAL 4YWLA 1OXXK 1VQ4A 1VQIA 4AH6A 3G48A 3U58A 1K3RA 5H1SE 2JA5G 1YHBA 5BR8Q 4LWCA 4IPDA 1OXTA 3GTPH 2EIFA 3CP0A 1VQMA 1NJIC 2OTLA 1A8VA 3PUWA 5IYBH 4B3TL 2ZTCA 1VQJA 2ALYB 4YWMA 3RLFA 4HIMA 4GOPA 4JI3Q 3KFUA 3ULPA 3TS2A 1I94Q 5M3MG 1I50H 5GADC 1PH6A 1N33L 1L1OA 1OXSC 2V1CC 3W1GA 1VQ9A 4A3FH 4DR2Q 3I4OA 2OCEA 5C4JH 3KJOA 1HR0W 4LNQA 4NXMQ 2D0OA 5K36G 5BR8L 1WCMG 1IZ6A 2K14A 4JCVE 4JV5Q 4KLKA 4JBWA 1R9TH 3MEFA 5GAEC 3OW2A 1E22A 2MNAA 1RIPA 1VQ8A 5JJIA 4JOIA 5M3MH 4JI3L 1ASZA 2KCTA 3E9IA 1PH9A 4GNXB 2D62A 2CQOA 3ZJYC 1XPRA 5IYCG 1JJ2A 1I94L 2BH2A 2Q2TA 2VUMH 1OXVA 4O0AA 3PSIA 3S1RH 4ME3A 3U4VA 1UE6A 4DR2L 1GVPA 4RMFA 3TREA 1IBLQ 3LGJA 4DR1Q 3RR5A 5LMNQ 4NXML 3NBHB 2NVYH 2VW9A 4DNIA 4JV5L 1NMGA 3HOWG 2ATWA 4KHPQ 4GN5A 4A76A 4B3SQ 1O7IA 5C44G 1SFOH 1EQQA 2YU9H 3E0EA 2E5LQ 1IYJB 5EAYA 4JI4Q 1W3SA 3AEVA 1WOCA 1YZ6A 4DV6Q 1BBUA 2R6GA 4KHZA 3J80c 3HKSA 3KLWA 4R4IA 1S40A 4A3KG 3BJUA 2ZJRA 2AWNA 4X62Q 2I5MX 4XIGS 5LMUQ 2IHFA 1YNXA 1TWCH 4DR1L 1PH4A 5LMNL 1EYGA 1IBLL 1VQNA 4MNOA 4FDBA 5IP9G 4DK3C 3HOWH 1E1OA 2K5HA 1G51A 1KHIA 4DV4Q 4A3LG 4BBSG 4APVA 1TWAH 4KHPL 4R4CA 3DM3A 1PH3A 4LUZA 4B3SL 2K4KA 4PZ7A 2UUAQ 3CC2A 1T9HA 5AJ3Q 2E5LL 1PFSA 3L0OA 4QGUA 4JI4L 3KDFB 1Y14B 3I4MH 5IP7G 4DV6L 2LSSA 4IPGA 1TWGH 2RCNA 3KOJA 1VQCA 4GLVB 1X6OA 2UUCQ 3S24A 4X62L 5IP9H 5LMUL 1QZGA 1SR3A 1CKOA 3H3VI 3I4NH 5DLQE 1K8AC 1P16A 4YCVA 3GTMH 3CCEA 4P71A 1HH2P 4DV4L 1S72A 3ULLA 4L5RC 3HOVG 3M3YH 1IXRA 1PYSB 3U50C 2UUAL 2YTXA 1VQ5A 4JI8Q 1QVGA 5IP7H 4MTNA 5AJ3L 4A4IA 4A3BG 2NZOA 1XNQQ 2H5XA 3S14H 2K50A 3JAMi 1NMFA 2IHEA 4KI0A 4HIDA 3CD6A 3PO3H 2UUCL 2PI2A 4JI2Q 2Z6KC 1VQBA 4IJHA 2N3SA 4GNXC 1Q86C 3D0FA 4L5QA 2JA8G 1L1OB 2NN6G 4JI8L 3M4OH 4A3BH 1Y1VG 3F2CA 2BA1A 1I6HH 4GKKQ 1VQKA 4LFCQ 1XNQL 2JJQA 3STBD 1C9OA 3F2BA 2B63H 3UDXA 4JBMA 4TQUS 1L2FA 2YV5A 4LF6Q 1BVSA 1TWFH 1VS0A 4JI2L 2AMCB 1PH1A 1KAWA 4A75A 4OWTB 2WFWA 3RLNA 4BBRH 1P8LA 2JA8H 3UDIA 4DR6Q 2R93H 3AYHB 3GTKH 1Y1VH 1GM5A 4QL5A 1QVCA 2MQHA 4DV7Q 1E1TA 4HJ7A 2VY3A 4A3IG 1FVIA 1XMOQ 3PUVA 2UU9Q 3GTQH 4GKKL 4LFCL 2MO1A 3CCLA 1B7YB 1IL2A 2HHHQ 3U4ZA 3S1QH 3BU2A 3H0GH 4LF6L 1CSPA 1QVFA 1ASYA 1BKBA 2E8GA 1YHAA 3CW2C 1N32Q 2K5VA 4HJ5A 1KQSA 1E24A 2I0QA 4LW1A 3K0XA 1Y1WH 4DR6L 3HOZG 4K0KQ 1RL2A 2XGTA 3F8TA 4GS3A 4A3IH 3B6YA 1HNWQ 2UXDQ 4DV7L 1X3GA 3G4SA 4A3MH 2IT1A 5J3BA 1DGSA 1N9WA 1HZ9A 2PNHA 5M3FG 1XMOL 2OQ0A 2UU9L 3G71A 2JA7H 2K5NA 2C35B 3RZDH 2HHHL 4OX9Q 4BXXG 1A63A 1N34Q 3PIPA 5JEAJ 4OWWB 1CKNA 5GQOA 3M4PA 5C0XI 2JA5H 4UP9A 1XNRQ 1N32L 1V43A 2AKWB 2WB1G 3HOZH 4DR4Q 2VNUD 1PH2A 1MJEA 4K0KL 4DUZQ 1Q1BA 2GN5A 5M3FH 1WYDA 1HNWL 2UXDL 3ULJA 2OQKA 4YHHL 1MKHA 5C0XJ 3CF5A 1XJVA 2AHOB 1Q46A 1UE5A 3KYHC 4LUVA 2R7ZG 2GVAA 4OX9L 1VQAA 4NPSA 4YY3Q 2JA9A 1N34L 1U5KA 3CCRA 3GTLH 1I3QH 1JT8A 4JC0A 4LF7Q 1E3PA 1KL9A 3I56A 2Q2IA 1XNRL 4JG2A 1SMXA 1WCMH 5ELNA 4DR4L 4C3IH 2L15A 2EQSA 1A62A 1UE1A 5ELOA 3CMEA 4DUZL 2A19A 3FHWA 1HR0Q 3HOXG 2ZJQA 1OTCA 4NB3A 4DR7Q 4BA1I 3CPWA 4AYBG 4P74A 4MZ9A 2UXBQ 5IYCH 4J15A 4IOCA 2AWOA 2BA0A 3L2PA 3GTOH 1X54A 2JE6I 3PO2G 2OTJA 4YY3L 1U0LA 4LF5Q 1C0AA 1OXUA 4BY1G 4LF7L 4PZ8A 3W1BA 1BBWA 3RN5A 4YCUA 4DV1Q 2KBNA 3KF6A 4GKJQ 1CSQA 4IJLA 3M9BA 3HOXH 2IX1A 4HJAA 4C3HH 1HR0L 2YYZA 4GLAC 2IY5B 1Z9FA 3S15H 3OYYA 5C44H 4DR7L 4R4OA 1AH9A 4B3RQ 1LM0A 3VDYA 1HNXQ 1FL0A 4GN4B 4P73A 4PMWA 4IFDJ 3PO2H 1K9MC 2UXBL 4AQYQ 2HIXA 1FJGQ 5C4XG 4A3DG 4A3KH 5JJLA 4LF5L 1NE3A 2NZHA 4LF4Q 2R7DA 5JJKA 1PH5A 1H95A 1FGUA 4XTCS 2ID0A 1YEZA 1J6QA 1Q7YC 4DV1L 4GKJL 4A3LH 1JJGA 4BBSH 1MJCA 1GO3E 4OWXB 1XMQQ 1PVOA 1VQHA 1X55A 2PQAA 3EN2A 2ES2A 1SN8A 4B3RL 1HNXL 2VQEQ 4L5SA 3TEHB 1M1KC 1VQDA 2R92G 3HOUG 3K81C 4AQYL 3CCMA 3PF5A 1FJGL 4IPCA 5FLMG 4JI5Q 3RLOA 5GAHC 3K80C 1YI2A 4LF4L 2WAQE 4R4QA 3NEMA 3CAMA 1N36L 1SROA 2Y0SE 3GD7A 2GVBA 4ALPA 1B70B 1E7ZA 3GTGH 3HOVH 1VQGA 1KRTA 1XMQL 1X3FA 2EXDA 4GOPB 4DV2Q 2CKZB 2YTYA 4RG1A 3F2DA 1HZAA 4GNXA 3PUYA 1GKHA 2VQEL 1YITA 1QZHA 1X9NA 5FLMH 2Z0SA 1IBMQ 4GLXA 2A1AA 4LF8Q 4YCWA 3UE0A 4LF9L 1AE2A 4Y7NH 4R4TA 3J81j 4JI5L 4JI7Q 1D7QA 4QIWE 1Q8KA 2Q2UA 1YJWA 4JI0Q 3S2HH 1X56A 4LFBQ 4POFA 1HZBA 4A3GG 2JK8A 1K0RA 2MO0A 4AIMA 3E9HA 4DV2L 4UY8C 3CMAA 1IBML 4LF8L 4X64L 3S1MH 2NVQH 4BY7G 3DLLA 1KRSA 1SLJA 2JQOA 4GN3B 1AE3A 4JI7L 3IRBA 2PI2E 3J7A5 1JB7A 5IYDG 4X66Q 4JI0L 1KD1C 4A3GH 4DPGA 3GDEA 4LFBL 5E7NA 1UWVA 2RHQB 5FJ8G 1HJPA 1NTGA 3ER0A 2RF4A 4UPAA 4JI1Q 5M5WH 1B8AA 2Q2HA 2QEXA 4HJ8A 4DUYQ 1IBKL 4B3MQ 4BY7H 2HIVA 3WWVA 3KF8B 2VZAA 3OTOQ 1UEBA 1Q12A 2ZTDA 3PCOB 2RHSB 2R7FA 4YHHQ 4C2MH 2ZM6Q 3PUZA 5IYDH 2N49A 2DGYA 3HKZE 2KCMA 3JAMc 2D0PA 1PHJA 4X66L 3J7ZC 1PH8A 5IY0A 5FJ8H 3EIVA 4HIKA 1EUJA 3T1HQ 4Y52H 3I2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EQ5 A;  4JI1 L;  3J80 i;  1NBW A;  4B3M L;  2F52 A;  4OO1 I;  4DUY L;  3CC4 A;  3A5Z B;  3OTO L;  4A3F G;  2OWO A;  3TS0 A;  3J81 c;  2HT1 A;  1EOV A;  2ASB A;  1KIX A;  2ZM6 L;  4BXX H;  5HGQ A;  2HQL A;  3K7U C;  4LUO A;  4A3E G;  1LYL A;  3T1Y Q;  1YJ9 A;  5FLX c;  2PQA B;  4GOP C;  4WJ3 M;  1QUQ A;  1V1Q A;  4DAM A;  4DR5 Q;  3T1H L;  3W5O A;  1NY4 A;  3PF4 A;  1J5E Q;  1L1O C;  2I5L X;  3H3V H;  3PUX A;  4EX5 A;  4H02 A;  2VUM G;  3I7F A;  4POG A;  5LMN W;  1JMC A;  4HJ9 A;  4BA2 I;  4R1J A;  3A0J A;  2NN6 I;  4A3E H;  4JBJ A;  3CCS A;  3CCQ A;  2R7Z H;  2FXQ A;  1LUZ A;  5GRO A;  1VQE A;  3TQY A;  3CQZ H;  1UE7 A;  3RZO H;  3T1Y L;  4YWK A;  1M90 C;  4JOI C;  2JA6 G;  2KHJ A;  5GAG C;  4DR5 L;  2CWP A;  1PA6 A;  1YHQ A;  2WB1 E;  3CCJ A;  1CUK A;  2K75 A;  2CWA A;  4PG3 A;  1VQO A;  3BZK A;  4IFD I;  4UP8 A;  3PIO A;  3UDF A;  1J5E L;  4DAY B;  2ZJP A;  2VL6 A;  4JI6 Q;  1PYB A;  2I5H A;  2KEN A;  1EFW A;  2NVT H;  1SRU A;  1S3O A;  1HNZ Q;  2JEB I;  3CCU A;  3AFQ A;  4JYA Q;  1SE8 A;  3A5U A;  2JA6 H;  3TRZ A;  2LXK A;  3BZC A;  3HOY G;  4BY1 H;  2XTI A;  3MXN B;  3M85 A;  1Q81 C;  4UP7 A;  2LXJ A;  1K73 C;  2QA4 A;  4HIO A;  1D8L A;  1X3E A;  1G29 1;  2CCZ A;  1N36 Q;  2E2I H;  1KXL A;  4DV5 Q;  1Q82 C;  3UE1 A;  4LFA Q;  2WAQ G;  1Z47 A;  3I4M G;  3F1Z A;  3S1N H;  3KJP A;  1N8R C;  3CPF A;  4A93 G;  2Y0S G;  4JI6 L;  3JC6 6;  1VQ6 A;  3AFP A;  1VQ7 A;  2E2J H;  3GTJ H;  1HNZ L;  4AYB E;  4NXN Q;  3HOY H;  4P75 A;  5C4X H;  2VQF Q;  1XPO A;  3I4N G;  4JYA L;  3FP9 A;  5IE8 A;  3CXC A;  2JEA I;  4A3D H;  5JEA G;  2WP8 J;  1WJJ A;  1W2B A;  4LF9 Q;  4OXP A;  4A3C G;  3FKI G;  3ERS X;  2N8N A;  3M7N A;  1A0I A;  1YVC A;  4WJ4 A;  2N78 A;  4OON A;  3PV0 A;  4DV5 L;  1EIF A;  3RN2 A;  3UDG A;  1XTD A;  4LFA L;  4A93 H;  1X65 A;  2QGQ A;  4DV3 Q;  2F3I A;  2E2H H;  1WFQ A;  4QY7 A;  5C0X G;  3PGZ A;  2Z6K A;  3PO3 G;  2R92 H;  3HOU H;  3M4Q A;  3S16 H;  4NXN L;  2PMZ E;  4PZ6 A;  2VQF L;  4X64 Q;  4DK6 C;  4OO1 G;  1CKN B;  4A3C H;  3FKI H;  2ZTE A;  5C3E G;  1EIY B;  3S17 H;  3Q8D A;  4JBK A;  1JJC B;  2B3G A;  3EBE A;  1VQP A;  4X65 Q;  2IX0 A;  4IOA A;  3S2D H;  2CFM A;  1TXY A;  3NEL A;  4DV3 L;  1TWH H;  1VQF A;  3I55 A;  2UUB Q;  2B63 G;  1IBK Q;  3K7A H;  4IO9 A;  5C3E H;  1VCI A;  3CCV A;  1QUQ B;  4DR3 Q;  4L5T A;  1PV4 A;  3AQQ A;  4P72 A;  2UXC Q;  3K8A A;  1G6P A;  4BBR G;  3G6E A;  1HZC A;  1VQL A;  1WI5 A;  2R93 G;  2MFI A;  1K83 H;  3A74 A;  5IT9 c;  3SGI A;  2NVX H;  2DUD A;  2A8V A;  3J81 i;  2K52 A;  3STB C;  4X65 L;  2B29 A;  4DKA C;  3CC7 A;  3HKZ G;  4DV0 Q;  1KC8 C;  3H15 A;  1MIU A;  2VS1 A;  2F4V Q;  2KHI A;  2UUB L;  4TVA B;  4QQB X;  1I5F A;  4IPH A;  4IFD G;  3H0G G;  5IWA Q;  4A3J G;  4QJF A;  1YJN A;  3GO5 A;  3KDF A;  5M5Y H;  4DR3 L;  1LTL A;  2UXC L;  1Q1E A;  1XPU A;  3RNU A;  1PH7 A;  1Y1W G;  3KF6 B;  1L0W A;  1EWI A;  5M5X H;  1EQR A;  2BH8 A;  3HFZ B;  4B3T Q;  1CKM A;  1YBY A;  1YIJ A;  3L7Z C;  5HY6 A;  4A3M G;  3ICE A;  4X6A H;  1C7Y A;  5IYB G;  1GD7 A;  4DV0 L;  1K8G A;  2JA7 G;  1V9P A;  4A3J H;  4O2D A;  4C3J H;  1JE5 A;  3D31 A;  1N33 Q;  2F4V L;  3NEN A;  2YTV A;  5IWA L;  4YWL A;  1OXX K;  1VQ4 A;  1VQI A;  4AH6 A;  3G48 A;  3U58 A;  1K3R A;  5H1S E;  2JA5 G;  1YHB A;  5BR8 Q;  4LWC A;  4IPD A;  1OXT A;  3GTP H;  2EIF A;  3CP0 A;  1VQM A;  1NJI C;  2OTL A;  1A8V A;  3PUW A;  5IYB H;  4B3T L;  2ZTC A;  1VQJ A;  2ALY B;  4YWM A;  3RLF A;  4HIM A;  4GOP A;  4JI3 Q;  3KFU A;  3ULP A;  3TS2 A;  1I94 Q;  5M3M G;  1I50 H;  5GAD C;  1PH6 A;  1N33 L;  1L1O A;  1OXS C;  2V1C C;  3W1G A;  1VQ9 A;  4A3F H;  4DR2 Q;  3I4O A;  2OCE A;  5C4J H;  3KJO A;  1HR0 W;  4LNQ A;  4NXM Q;  2D0O A;  5K36 G;  5BR8 L;  1WCM G;  1IZ6 A;  2K14 A;  4JCV E;  4JV5 Q;  4KLK A;  4JBW A;  1R9T H;  3MEF A;  5GAE C;  3OW2 A;  1E22 A;  2MNA A;  1RIP A;  1VQ8 A;  5JJI A;  4JOI A;  5M3M H;  4JI3 L;  1ASZ A;  2KCT A;  3E9I A;  1PH9 A;  4GNX B;  2D62 A;  2CQO A;  3ZJY C;  1XPR A;  5IYC G;  1JJ2 A;  1I94 L;  2BH2 A;  2Q2T A;  2VUM H;  1OXV A;  4O0A A;  3PSI A;  3S1R H;  4ME3 A;  3U4V A;  1UE6 A;  4DR2 L;  1GVP A;  4RMF A;  3TRE A;  1IBL Q;  3LGJ A;  4DR1 Q;  3RR5 A;  5LMN Q;  4NXM L;  3NBH B;  2NVY H;  2VW9 A;  4DNI A;  4JV5 L;  1NMG A;  3HOW G;  2ATW A;  4KHP Q;  4GN5 A;  4A76 A;  4B3S Q;  1O7I A;  5C44 G;  1SFO H;  1EQQ A;  2YU9 H;  3E0E A;  2E5L Q;  1IYJ B;  5EAY A;  4JI4 Q;  1W3S A;  3AEV A;  1WOC A;  1YZ6 A;  4DV6 Q;  1BBU A;  2R6G A;  4KHZ A;  3J80 c;  3HKS A;  3KLW A;  4R4I A;  1S40 A;  4A3K G;  3BJU A;  2ZJR A;  2AWN A;  4X62 Q;  2I5M X;  4XIG S;  5LMU Q;  2IHF A;  1YNX A;  1TWC H;  4DR1 L;  1PH4 A;  5LMN L;  1EYG A;  1IBL L;  1VQN A;  4MNO A;  4FDB A;  5IP9 G;  4DK3 C;  3HOW H;  1E1O A;  2K5H A;  1G51 A;  1KHI A;  4DV4 Q;  4A3L G;  4BBS G;  4APV A;  1TWA H;  4KHP L;  4R4C A;  3DM3 A;  1PH3 A;  4LUZ A;  4B3S L;  2K4K A;  4PZ7 A;  2UUA Q;  3CC2 A;  1T9H A;  5AJ3 Q;  2E5L L;  1PFS A;  3L0O A;  4QGU A;  4JI4 L;  3KDF B;  1Y14 B;  3I4M H;  5IP7 G;  4DV6 L;  2LSS A;  4IPG A;  1TWG H;  2RCN A;  3KOJ A;  1VQC A;  4GLV B;  1X6O A;  2UUC Q;  3S24 A;  4X62 L;  5IP9 H;  5LMU L;  1QZG A;  1SR3 A;  1CKO A;  3H3V I;  3I4N H;  5DLQ E;  1K8A C;  1P16 A;  4YCV A;  3GTM H;  3CCE A;  4P71 A;  1HH2 P;  4DV4 L;  1S72 A;  3ULL A;  4L5R C;  3HOV G;  3M3Y H;  1IXR A;  1PYS B;  3U50 C;  2UUA L;  2YTX A;  1VQ5 A;  4JI8 Q;  1QVG A;  5IP7 H;  4MTN A;  5AJ3 L;  4A4I A;  4A3B G;  2NZO A;  1XNQ Q;  2H5X A;  3S14 H;  2K50 A;  3JAM i;  1NMF A;  2IHE A;  4KI0 A;  4HID A;  3CD6 A;  3PO3 H;  2UUC L;  2PI2 A;  4JI2 Q;  2Z6K C;  1VQB A;  4IJH A;  2N3S A;  4GNX C;  1Q86 C;  3D0F A;  4L5Q A;  2JA8 G;  1L1O B;  2NN6 G;  4JI8 L;  3M4O H;  4A3B H;  1Y1V G;  3F2C A;  2BA1 A;  1I6H H;  4GKK Q;  1VQK A;  4LFC Q;  1XNQ L;  2JJQ A;  3STB D;  1C9O A;  3F2B A;  2B63 H;  3UDX A;  4JBM A;  4TQU S;  1L2F A;  2YV5 A;  4LF6 Q;  1BVS A;  1TWF H;  1VS0 A;  4JI2 L;  2AMC B;  1PH1 A;  1KAW A;  4A75 A;  4OWT B;  2WFW A;  3RLN A;  4BBR H;  1P8L A;  2JA8 H;  3UDI A;  4DR6 Q;  2R93 H;  3AYH B;  3GTK H;  1Y1V H;  1GM5 A;  4QL5 A;  1QVC A;  2MQH A;  4DV7 Q;  1E1T A;  4HJ7 A;  2VY3 A;  4A3I G;  1FVI A;  1XMO Q;  3PUV A;  2UU9 Q;  3GTQ H;  4GKK L;  4LFC L;  2MO1 A;  3CCL A;  1B7Y B;  1IL2 A;  2HHH Q;  3U4Z A;  3S1Q H;  3BU2 A;  3H0G H;  4LF6 L;  1CSP A;  1QVF A;  1ASY A;  1BKB A;  2E8G A;  1YHA A;  3CW2 C;  1N32 Q;  2K5V A;  4HJ5 A;  1KQS A;  1E24 A;  2I0Q A;  4LW1 A;  3K0X A;  1Y1W H;  4DR6 L;  3HOZ G;  4K0K Q;  1RL2 A;  2XGT A;  3F8T A;  4GS3 A;  4A3I H;  3B6Y A;  1HNW Q;  2UXD Q;  4DV7 L;  1X3G A;  3G4S A;  4A3M H;  2IT1 A;  5J3B A;  1DGS A;  1N9W A;  1HZ9 A;  2PNH A;  5M3F G;  1XMO L;  2OQ0 A;  2UU9 L;  3G71 A;  2JA7 H;  2K5N A;  2C35 B;  3RZD H;  2HHH L;  4OX9 Q;  4BXX G;  1A63 A;  1N34 Q;  3PIP A;  5JEA J;  4OWW B;  1CKN A;  5GQO A;  3M4P A;  5C0X I;  2JA5 H;  4UP9 A;  1XNR Q;  1N32 L;  1V43 A;  2AKW B;  2WB1 G;  3HOZ H;  4DR4 Q;  2VNU D;  1PH2 A;  1MJE A;  4K0K L;  4DUZ Q;  1Q1B A;  2GN5 A;  5M3F H;  1WYD A;  1HNW L;  2UXD L;  3ULJ A;  2OQK A;  4YHH L;  1MKH A;  5C0X J;  3CF5 A;  1XJV A;  2AHO B;  1Q46 A;  1UE5 A;  3KYH C;  4LUV A;  2R7Z G;  2GVA A;  4OX9 L;  1VQA A;  4NPS A;  4YY3 Q;  2JA9 A;  1N34 L;  1U5K A;  3CCR A;  3GTL H;  1I3Q H;  1JT8 A;  4JC0 A;  4LF7 Q;  1E3P A;  1KL9 A;  3I56 A;  2Q2I A;  1XNR L;  4JG2 A;  1SMX A;  1WCM H;  5ELN A;  4DR4 L;  4C3I H;  2L15 A;  2EQS A;  1A62 A;  1UE1 A;  5ELO A;  3CME A;  4DUZ L;  2A19 A;  3FHW A;  1HR0 Q;  3HOX G;  2ZJQ A;  1OTC A;  4NB3 A;  4DR7 Q;  4BA1 I;  3CPW A;  4AYB G;  4P74 A;  4MZ9 A;  2UXB Q;  5IYC H;  4J15 A;  4IOC A;  2AWO A;  2BA0 A;  3L2P A;  3GTO H;  1X54 A;  2JE6 I;  3PO2 G;  2OTJ A;  4YY3 L;  1U0L A;  4LF5 Q;  1C0A A;  1OXU A;  4BY1 G;  4LF7 L;  4PZ8 A;  3W1B A;  1BBW A;  3RN5 A;  4YCU A;  4DV1 Q;  2KBN A;  3KF6 A;  4GKJ Q;  1CSQ A;  4IJL A;  3M9B A;  3HOX H;  2IX1 A;  4HJA A;  4C3H H;  1HR0 L;  2YYZ A;  4GLA C;  2IY5 B;  1Z9F A;  3S15 H;  3OYY A;  5C44 H;  4DR7 L;  4R4O A;  1AH9 A;  4B3R Q;  1LM0 A;  3VDY A;  1HNX Q;  1FL0 A;  4GN4 B;  4P73 A;  4PMW A;  4IFD J;  3PO2 H;  1K9M C;  2UXB L;  4AQY Q;  2HIX A;  1FJG Q;  5C4X G;  4A3D G;  4A3K H;  5JJL A;  4LF5 L;  1NE3 A;  2NZH A;  4LF4 Q;  2R7D A;  5JJK A;  1PH5 A;  1H95 A;  1FGU A;  4XTC S;  2ID0 A;  1YEZ A;  1J6Q A;  1Q7Y C;  4DV1 L;  4GKJ L;  4A3L H;  1JJG A;  4BBS H;  1MJC A;  1GO3 E;  4OWX B;  1XMQ Q;  1PVO A;  1VQH A;  1X55 A;  2PQA A;  3EN2 A;  2ES2 A;  1SN8 A;  4B3R L;  1HNX L;  2VQE Q;  4L5S A;  3TEH B;  1M1K C;  1VQD A;  2R92 G;  3HOU G;  3K81 C;  4AQY L;  3CCM A;  3PF5 A;  1FJG L;  4IPC A;  5FLM G;  4JI5 Q;  3RLO A;  5GAH C;  3K80 C;  1YI2 A;  4LF4 L;  2WAQ E;  4R4Q A;  3NEM A;  3CAM A;  1N36 L;  1SRO A;  2Y0S E;  3GD7 A;  2GVB A;  4ALP A;  1B70 B;  1E7Z A;  3GTG H;  3HOV H;  1VQG A;  1KRT A;  1XMQ L;  1X3F A;  2EXD A;  4GOP B;  4DV2 Q;  2CKZ B;  2YTY A;  4RG1 A;  3F2D A;  1HZA A;  4GNX A;  3PUY A;  1GKH A;  2VQE L;  1YIT A;  1QZH A;  1X9N A;  5FLM H;  2Z0S A;  1IBM Q;  4GLX A;  2A1A A;  4LF8 Q;  4YCW A;  3UE0 A;  4LF9 L;  1AE2 A;  4Y7N H;  4R4T A;  3J81 j;  4JI5 L;  4JI7 Q;  1D7Q A;  4QIW E;  1Q8K A;  2Q2U A;  1YJW A;  4JI0 Q;  3S2H H;  1X56 A;  4LFB Q;  4POF A;  1HZB A;  4A3G G;  2JK8 A;  1K0R A;  2MO0 A;  4AIM A;  3E9H A;  4DV2 L;  4UY8 C;  3CMA A;  1IBM L;  4LF8 L;  4X64 L;  3S1M H;  2NVQ H;  4BY7 G;  3DLL A;  1KRS A;  1SLJ A;  2JQO A;  4GN3 B;  1AE3 A;  4JI7 L;  3IRB A;  2PI2 E;  3J7A 5;  1JB7 A;  5IYD G;  4X66 Q;  4JI0 L;  1KD1 C;  4A3G H;  4DPG A;  3GDE A;  4LFB L;  5E7N A;  1UWV A;  2RHQ B;  5FJ8 G;  1HJP A;  1NTG A;  3ER0 A;  2RF4 A;  4UPA A;  4JI1 Q;  5M5W H;  1B8A A;  2Q2H A;  2QEX A;  4HJ8 A;  4DUY Q;  1IBK L;  4B3M Q;  4BY7 H;  2HIV A;  3WWV A;  3KF8 B;  2VZA A;  3OTO Q;  1UEB A;  1Q12 A;  2ZTD A;  3PCO B;  2RHS B;  2R7F A;  4YHH Q;  4C2M H;  2ZM6 Q;  3PUZ A;  5IYD H;  2N49 A;  2DGY A;  3HKZ E;  2KCM A;  3JAM c;  2D0P A;  1PHJ A;  4X66 L;  3J7Z C;  1PH8 A;  5IY0 A;  5FJ8 H;  3EIV A;  4HIK A;  1EUJ A;  3T1H Q;  4Y52 H;  3I2Z A; 
#chains in the Genus database with same CATH topology
 1IW7 D;  4FVM A;  2F52 A;  2L4N A;  4A3F G;  2B2W A;  1EOV A;  5CGK A;  1KIX A;  4XYQ A;  1HUN A;  5KRU A;  3URY A;  1LYL A;  3P75 A;  1YJ9 A;  4I65 A;  4GOP C;  2WKD A;  2ZXR A;  3K6O A;  1JB3 A;  3HOV B;  3PF4 A;  1NY4 A;  5DM7 3;  1J5E Q;  3PUX A;  1K0S A;  2XNA C;  4OIJ A;  3Q0A A;  2XIW A;  4JBJ A;  5GRO A;  1VQE A;  3TQY A;  3V2T A;  2KHJ A;  2JSO A;  2MUY A;  4KD4 A;  1VQO A;  4I7Z C;  1J5E L;  3PIO A;  3UDF A;  4DAY B;  1CHP D;  2I5H A;  2KEN A;  2NVQ B;  3QG1 A;  2HD3 A;  1SRU A;  3SEB A;  4ZQ3 A;  3AFQ A;  4RH6 A;  4BY1 H;  1LT5 D;  3M85 A;  1MHW C;  1EQT A;  1AEX A;  2XWJ B;  1G29 1;  4KY5 A;  5CR3 A;  1N36 Q;  1KXL A;  4XYO A;  4DV5 Q;  2F0E A;  1Q82 C;  2WAQ G;  4RGT A;  1QE6 A;  4A93 G;  2Y0S G;  1VQ7 A;  2E2J H;  4NXN Q;  5JPN C;  1XPO A;  3FP9 A;  5IE8 A;  1B9M A;  5JEA G;  5C3W A;  2Z6B A;  4OEM B;  1A3U A;  1A3T A;  2N8N A;  3WOE A;  4OON A;  3Q24 A;  4DV5 L;  1PRT C;  4A93 H;  2WAC A;  1X3Q A;  1WFQ A;  3PGZ A;  3MEH A;  3PO3 G;  1PFM A;  4NXN L;  5JEA H;  3A55 A;  2GA4 B;  4OO1 G;  1STB A;  3J7Y W;  2ZTE A;  1EIY B;  3IFD A;  5E3F A;  2B3G A;  3WOF A;  4CJ0 B;  3NBH A;  3S2D H;  3NEL A;  4FNF A;  1FNU A;  3TP6 A;  4U67 3;  1U4L A;  1VCI A;  4X3T A;  4P72 A;  3G6E A;  4ZLT F;  1HZC A;  3BVM A;  5IT9 c;  3SGI A;  2CQA A;  2K52 A;  3STB C;  4F7X A;  2NYZ D;  5IGC A;  3CC7 A;  4DV0 Q;  1KC8 C;  3HOX B;  1VMP A;  4RAU C;  4C3H B;  2E2D C;  2KHI A;  5JVG 3;  4QQB X;  4AYB B;  3H0G G;  3KDF A;  5M5Y H;  1CZW A;  2A6E D;  1PRT F;  1XPU A;  1PH7 A;  4BY1 B;  4B9X A;  1L0W A;  1CTM A;  2BH8 A;  2L11 A;  4K5X A;  4B3T Q;  2HDM A;  1BBX C;  3L7Z C;  1C7Y A;  5IYB G;  2A73 B;  4DV0 L;  4TSS A;  2F0N A;  1JE5 A;  2XWB B;  4DXF A;  3NEN A;  1OXX K;  4AH6 A;  2E2J B;  1LT4 D;  1K3R A;  5H1S E;  1QB5 D;  1YHB A;  5FKA C;  4LWC A;  2RDF A;  3HP3 A;  1H9R A;  2EIF A;  2ICE C;  1A8V A;  2KHS A;  3PUW A;  5IYB H;  4B3T L;  5I4D A;  4JI3 Q;  2SEB D;  1W6J A;  1X3P A;  3TS2 A;  3CKI B;  4C1N I;  3SDZ A;  5GAD C;  2CHB D;  1TS2 A;  1L1O A;  1OXS C;  1STG A;  2F0T A;  2V1C C;  1VQ9 A;  5EGT A;  3D8G A;  1HCZ A;  1HR0 W;  4LNQ A;  4NXM Q;  1STN A;  1PXU A;  1RHP A;  4JCV E;  4NDX A;  1Q90 A;  4ZKB B;  2B2W C;  3H3V C;  1E22 A;  1RIP A;  1VQ8 A;  2WV6 D;  4JI3 L;  3HS0 C;  3S2D B;  4GNX B;  4RKB A;  4HAE A;  3NP8 A;  3ND8 A;  2VXW A;  4FF3 A;  1UE6 A;  1GVP A;  2PQE A;  2RDG A;  4DR1 Q;  4NXM L;  4DNI A;  3OSO A;  2AQ3 B;  3HOW G;  1EIH A;  4A76 A;  2N88 A;  1O7Y A;  1O7I A;  5C5L A;  1WOC A;  3KF8 A;  4G57 A;  4KHZ A;  4A3K G;  2EYF A;  2AWN A;  1EYG A;  3QIA A;  2Q8I B;  1YNX A;  5LMU Q;  4DR1 L;  3KLR A;  2O5J C;  3HOW H;  3D3R A;  5IP9 G;  3JAM E;  4QUF A;  4DV4 Q;  4BBS G;  3IFT A;  4PZ7 A;  3CC2 A;  4CDF C;  4ODG A;  1MBY A;  1PFS A;  1RKN A;  5IP7 G;  4O1N A;  4ZRZ A;  1TWG H;  1VQC A;  1EEI D;  1DXM A;  5IP9 H;  5LMU L;  3QJY A;  3H3V I;  1XXG A;  1P16 A;  4L5R C;  1HH2 P;  4DV4 L;  3DWA A;  1EU3 A;  4IQZ A;  3U50 C;  2YTX A;  1BUV T;  4K5W A;  5IP7 H;  1XNQ Q;  2OT2 A;  1HQR D;  1QNK A;  4HID A;  1NMF A;  1BNZ A;  1U4P A;  4KJN A;  5C4Z A;  3LNN A;  2F0L A;  4IJH A;  3QB3 A;  1Q86 C;  1JWM D;  3D0F A;  2QW7 A;  2RCF A;  2EOT A;  2JA8 G;  2NN6 G;  5CMD A;  3M4O H;  1BCP C;  1I6H H;  1VQK A;  1XNQ L;  3F2B A;  2F0G A;  2EPB A;  4EQO A;  1BVS A;  2L5T A;  1PH1 A;  1IHZ A;  1PTO F;  4BBR H;  3RUZ A;  4XQQ A;  2JA8 H;  3UDI A;  4DR6 Q;  2NN6 H;  3NWS A;  2O5I C;  2CH4 W;  2VY3 A;  5J39 A;  1FVI A;  1XMO Q;  3GTQ H;  4QB4 A;  2MO1 A;  5IOC A;  2E2I B;  4KY6 A;  3BU2 A;  5ELD A;  4IFD H;  5IOD A;  3JAM L;  1CSP A;  2E8G A;  3G6J B;  2KED A;  4HJ5 A;  1V1P A;  4LW1 A;  3K0X A;  4DR6 L;  3MXP A;  1STE A;  1RL2 A;  3W2D A;  2F0W A;  2XGT A;  3B6Y A;  1SMY D;  2TMP A;  4HED A;  3NSW A;  1LTS D;  1XMO L;  2JXM B;  2K5N A;  1TWG B;  1BDO A;  2CW0 D;  1CKN A;  5KGU A;  1LT3 D;  2AKW B;  2WB1 G;  1PH2 A;  1BCP F;  4DUZ Q;  3NPP A;  1WYD A;  1QWY A;  4YHH L;  1UE5 A;  2B2T A;  3KYH C;  2R7Z G;  2GVA A;  4NPS A;  1NNX A;  3GTL H;  1I3Q H;  4JC0 A;  1E3P A;  3I56 A;  2Q2I A;  1WCM H;  3HRZ C;  2A68 C;  1HR0 Q;  4DUZ L;  2A19 A;  3KUP A;  5COY A;  3T13 A;  4IUR A;  3M4O B;  1H9S A;  5IYC H;  1I6H B;  1E0B A;  5CBE E;  3L2P A;  1X54 A;  3PO2 G;  2OTJ A;  2OF1 A;  4HMJ A;  2DJF C;  3OPO A;  1OXU A;  4C56 C;  5EPK A;  1BBW A;  4XQN A;  1DZ1 A;  4DV1 Q;  3KF6 A;  3A54 A;  4BBR B;  1I4Q A;  1HR0 L;  3CRL C;  2PO4 A;  2YYZ A;  2DY8 A;  4HCE A;  1HTL D;  5C44 H;  1JIC A;  3GP7 A;  3PIO 3;  1TR5 A;  3HKZ B;  4P73 A;  5E4W C;  4IFD J;  3PO2 H;  3OMC A;  1EY7 A;  3TBI B;  1F9P A;  5C4X G;  2EVB A;  2M00 A;  4ZAI A;  4XTC S;  3ERQ A;  3H94 A;  1Q7Y C;  4DV1 L;  1VMC A;  1WTP A;  4A3L H;  1JJG A;  3OW7 A;  1L0X B;  2EY5 A;  4G7Z C;  4L5S A;  4ME5 A;  5IGB A;  1D2B A;  2DNE A;  1JWU D;  4KKU A;  4JI5 Q;  4L6T B;  2SNS A;  2B2U A;  4R4Q A;  2A6H C;  1ET9 A;  3CAM A;  2IJ0 A;  4ALP A;  1AP0 A;  4OL7 A;  4MIU A;  1HZA A;  1LTT D;  2J4X A;  4LF9 L;  4XT3 B;  4R4T A;  4DAY A;  3RD4 A;  4JI5 L;  3KLS A;  2DNC A;  2TSS A;  3NE5 B;  2WB1 B;  3GTL B;  1I3Q B;  1F9S A;  1YJW A;  1IYU A;  1WCM B;  4LFB Q;  2NBF A;  2KCC A;  3AU7 A;  1STH A;  1TT2 A;  4X64 L;  3S1M H;  1B3A A;  1GXD C;  1S5D D;  4K5V A;  3J7A 5;  1LTB D;  1E2Z A;  5IYD G;  4X66 Q;  4KKS A;  1SNO A;  4LFB L;  5E7N A;  1UWV A;  2K7V A;  3D6W A;  3VYU A;  1MSH A;  4UPA A;  2FMM A;  3R93 A;  4B3M Q;  1A3V A;  4CDE C;  5C44 B;  1NR2 A;  3KF8 B;  2VZA A;  1C8C A;  1UEB A;  3M4Y A;  3PCO B;  4ZYS A;  5IYD H;  4LAA A;  3HKZ E;  3JAM c;  4X66 L;  1PH8 A;  5IY0 A;  3EIV A;  3C46 A;  1NBW A;  1S4Z A;  4B3M L;  3CC4 A;  1MI2 A;  3TS0 A;  3T16 A;  2HT1 A;  3NQT A;  1OO9 B;  4BXX H;  5HGQ A;  3K7U C;  3X3M A;  4F87 A;  2HUG A;  4K2L A;  4DAM A;  2K04 A;  2VB3 X;  3BS1 A;  4R8I A;  3EA6 A;  3W5O A;  2F0Q A;  2VUM G;  3VR3 A;  1EY9 A;  1WTO A;  3I7F A;  1JMC A;  4QCL A;  4BA2 I;  3NUC A;  4R1J A;  3CCQ A;  3A7A B;  1K3B C;  1ENA A;  3NQI A;  2I46 A;  1GUS A;  5IGG A;  4JOI C;  2JA6 G;  4L8J A;  2B2T C;  2PZT A;  2WB1 E;  1CUK A;  1YNJ C;  4EVO A;  4O42 A;  1HA5 A;  2ZJP A;  3MFG A;  3HZX A;  2VL6 A;  3DM1 A;  1HNZ Q;  4JYA Q;  1SE8 A;  3A5U A;  2JA6 H;  2G5D A;  3TRZ A;  3HOY G;  3BZC A;  4G7O C;  2MHV A;  4UP7 A;  5KYL A;  4J6H A;  1PFN A;  3I4M G;  5CV8 A;  3S1N H;  1N8R C;  4RA8 A;  4A3I B;  3NTH A;  3AFP A;  3GTJ H;  1HNZ L;  3HOY H;  2VQF Q;  4JYA L;  4A3D H;  3CXC A;  1E2W A;  1W2B A;  3I8Z A;  4A3C G;  1ICW A;  1V1P B;  3FKI G;  3ERS X;  3M7G A;  5FOB B;  4GZY C;  1HRJ A;  3UDG A;  3S9W A;  4DV3 Q;  2BDO A;  1XYI A;  4IZ8 A;  3I72 A;  3J81 E;  5C0X G;  2R92 H;  3FPP A;  2BDN A;  3SXH A;  1DOK A;  3S16 H;  4PZ6 A;  2VQF L;  1RDP D;  4DK6 C;  1CKN B;  4A3C H;  3FKI H;  2O4X A;  1AN8 A;  3U9O A;  1BXT A;  3J7A V;  2Z1C A;  1SSO A;  4DV3 L;  3P20 A;  3I55 A;  2B63 G;  1D5Z C;  1IBK Q;  3K7A H;  5BN4 A;  5I9P A;  3CCV A;  1QUQ B;  1EY0 A;  4L5T A;  5HUR A;  1PV4 A;  3MC0 B;  2UXC Q;  3MA2 B;  1HQM C;  2Q8T A;  1SJH D;  1PZI D;  4KN7 C;  2QEJ C;  2DUD A;  2NVX H;  4JW0 A;  3O13 A;  1QIL A;  4KTA A;  1C4Q A;  3H15 A;  1MIU A;  2AUJ D;  2G9H D;  4KY7 A;  2F4V Q;  2XRS D;  2EYL A;  1LO5 D;  4IPH A;  2XSC A;  4A3J G;  1A15 A;  2K5D A;  2V4D A;  3GO5 A;  2QKI C;  4KN4 C;  2UXC L;  2JA6 B;  5G3L D;  2L0C A;  3KBX A;  4Q5V A;  3KF6 B;  3NTI A;  1EQR A;  1YBY A;  3ICE A;  4A3M G;  1PZJ D;  1FD7 D;  2A69 D;  1PFB A;  1V9P A;  4A3J H;  4C3J H;  2F4V L;  1EYC A;  3G48 A;  3GTJ B;  2MGS A;  5CV6 A;  2EYP A;  4A3D B;  5BR8 Q;  1F77 A;  4ABN A;  4NW2 A;  1F2Y A;  3CP0 A;  3J81 L;  4HIM A;  3ULP A;  2FJ2 A;  5M3M G;  2WII B;  4A3F H;  4ID6 A;  4DR2 Q;  2R92 B;  3S16 B;  4ILW A;  3I4O A;  2OCE A;  5C4J H;  2D0O A;  5BR8 L;  3FKI B;  4MN3 A;  4C3I G;  5KND A;  5T1G A;  4KLK A;  4JBW A;  1R9T H;  3OW2 A;  4IUP A;  4JK1 C;  2EE1 A;  2FFK B;  5M3M H;  1LAB A;  1ASZ A;  2E76 C;  4V0B A;  5T1I A;  2D62 A;  2CQO A;  2BH2 A;  1OXV A;  4O0A A;  3S1R H;  4ME3 A;  4DR2 L;  3K7A B;  2XRQ D;  1CA5 A;  3U9S A;  3LGJ A;  1YNN D;  2VW9 A;  4R9W A;  2AQ2 B;  5CV4 A;  2JP1 A;  3GV6 A;  4B3S Q;  3SK8 A;  1SFO H;  3CRK C;  1SND A;  3E0E A;  5HGT A;  1IYJ B;  2KEC A;  1XX8 A;  5EAY A;  4EGV A;  3K58 A;  3AEV A;  2F0D A;  2RSO A;  1BBU A;  2Z9H A;  3KLW A;  1S40 A;  3BDO A;  1U9R A;  1WVL A;  4X62 Q;  1O7L A;  4H7B A;  4XIG S;  1TII D;  2CH4 A;  2IHF A;  4DK3 C;  1E1O A;  2K5H A;  1KHI A;  3TN2 A;  1B50 A;  1TWA H;  4RFB A;  3K5L A;  4R4C A;  3DM3 A;  4B3S L;  3NBI A;  4H0L C;  2K5Q A;  4DK0 A;  4CDC C;  4DK1 A;  3V96 A;  1NAP A;  4BS9 A;  4C3J B;  1PTO D;  2AQ1 B;  3KOJ A;  2J7Z A;  1X6O A;  5KEE A;  3S24 A;  1IL8 A;  4X62 L;  1STY A;  1QZG A;  3E6Z X;  3W3A A;  5DLQ E;  4YCV A;  4P71 A;  5FLX E;  1BQQ T;  1G2T A;  1JCK B;  2KUM A;  5IGF A;  4LJZ C;  5EBD A;  1TS4 A;  4I7A A;  2RKS A;  4A3B G;  2NZO A;  1TVX A;  2K50 A;  3JAM i;  3CD6 A;  3VA7 A;  3PO3 H;  4A3F B;  2F0P A;  1KNE A;  1SE3 A;  3SE0 A;  1KLG D;  4OO1 H;  5C4J B;  2N3S A;  1R9T B;  4GNX C;  5FO8 B;  2FMC A;  1G6Z A;  4A3B H;  3F2C A;  5CV5 A;  4GKK Q;  1WTH A;  4LFC Q;  1ZEQ X;  4CHT B;  3FPU B;  3S1R B;  2KQ3 A;  4TQU S;  4LF6 Q;  2YV5 A;  1ZYR D;  1M8A A;  1VS0 A;  4B08 A;  4OWT B;  1P8L A;  2O2L D;  2BE5 D;  1GM5 A;  4QL5 A;  1QVC A;  1SFO B;  4HJ7 A;  1JWS D;  1EY8 A;  3PUV A;  1LTR D;  1ESR A;  4GKK L;  4LFC L;  4X3K A;  3S1Q H;  3H0G H;  4LF6 L;  1AZP A;  1QVF A;  1ASY A;  1YHA A;  2K5V A;  2E75 C;  3HOZ G;  3FVQ A;  1TWA B;  2UXD Q;  1ESF A;  3SK4 A;  4RCO A;  1DGS A;  1HZ9 A;  5M3F G;  2WAQ B;  1I4G A;  2C35 B;  4K2K A;  4A93 B;  2Y0S B;  5LL6 S;  3PIP A;  5JEA J;  5FLX L;  2WKC A;  2B2V C;  1IW7 C;  5GQO A;  3M4P A;  1LV9 A;  1ILP A;  1O7Z A;  3HOZ H;  4DR4 Q;  5LHY 1;  2Q8R E;  1EU4 A;  4DF7 A;  3TP7 A;  1LAC A;  1PYW D;  4J1M A;  5M3F H;  2UXD L;  1PRT B;  1XJV A;  4YY3 Q;  3PO3 B;  4K8I A;  1VF7 A;  1SMX A;  4K6L A;  4DR4 L;  2EQS A;  1A62 A;  5ELO A;  3FHW A;  3DEO A;  2KJX A;  3D6C A;  2ZJQ A;  4NB3 A;  4P74 A;  4J15 A;  2BA0 A;  3ND9 A;  4OHJ A;  3GTO H;  1ENC A;  1ILQ A;  1SNC A;  2X6G A;  4YY3 L;  4LF5 Q;  3SHL A;  3W1B A;  1GUT A;  4FO2 A;  4GKJ Q;  4IJL A;  5EKL A;  5EPJ A;  5M5Y B;  4HJA A;  4GLA C;  3WDN A;  1Z9F A;  4B3R Q;  4TKO B;  1VF5 C;  1SE4 A;  1G8Z D;  1JOR A;  4NMZ A;  4CKB A;  1K9M C;  4DN4 M;  2HIX A;  2EJG C;  4A3K H;  3S1Q B;  2PW7 A;  4LF5 L;  3K5M A;  3H0G B;  4RWS C;  1QJO A;  2ZT9 C;  1PH5 A;  1B2T A;  1J6Q A;  2F0J A;  4GKJ L;  3C1F A;  4BBS H;  4KHV A;  3EN2 A;  2IW3 A;  1PTO H;  5ELC A;  4B3R L;  2VQE Q;  3TEH B;  5FO9 B;  1M1K C;  3HOU G;  4MHE A;  3PF5 A;  1F9Q A;  2RSN A;  3MFY A;  4IPC A;  1YI2 A;  2WAQ E;  1ZXT A;  4S3S A;  1WTV A;  3HOZ B;  2Y0S E;  3FDT A;  4OIK A;  3BYT B;  1TU2 B;  4IUN A;  3GTG H;  1NSN S;  1WTW A;  2LMC B;  1YIT A;  3PUY A;  1RF2 D;  1QOH A;  2OEO A;  2VQE L;  1X9N A;  1QZH A;  2Z0S A;  3N52 A;  5BN3 A;  2A1A A;  2Z8L A;  1AE2 A;  3DWQ A;  4Y7N H;  4JI7 Q;  1D7Q A;  5ELB A;  2Q2U A;  4JI0 Q;  3S2H H;  1X56 A;  1Z7T A;  4POF A;  4A3G G;  2JK8 A;  1PLF A;  1KNA A;  3E9H A;  1SEB D;  4P2C B;  5C3X A;  1U4M A;  4BY7 G;  3DLL A;  3J80 E;  2JQO A;  1SLJ A;  3MZ5 A;  5L37 A;  1AE3 A;  4JI7 L;  3IRB A;  1EQV A;  3QWN A;  4JI0 L;  1SYG A;  4A3G H;  3A8I E;  5KNB A;  3OIP A;  2RHQ B;  1B3Q A;  5FJ8 G;  3HOW B;  4JI1 Q;  4MTK A;  3NK9 A;  4HJ8 A;  4DUY Q;  3VA5 A;  4BY7 H;  3WWV A;  1LLR D;  1RD9 D;  2A6E C;  3OTO Q;  2MPM A;  2ZTD A;  4YHH Q;  2N49 A;  4A3K B;  5JVH 3;  3K0Y A;  3OIQ A;  5FJ8 H;  4IUQ A;  3Q22 A;  1ZKO A;  1UAP A;  1EUJ A;  1EOT A;  4BBS B;  4HTH A;  4JI1 L;  1ML0 D;  1E2V A;  2VB2 X;  5E4X A;  1JOO A;  4EQ5 A;  1J8I A;  1K8O A;  2LFN A;  4DUY L;  4CKE A;  1PTO B;  1KAB A;  3A5Z B;  4KD3 A;  3OTO L;  1EY6 A;  3E5S A;  2ASB A;  3MHB A;  1D1K A;  4N9P A;  2HQL A;  2D2C C;  4LUO A;  5FLX c;  2PQA B;  1QUQ A;  2K28 A;  2L1B A;  1AFP A;  1DOM A;  4IN3 A;  3GTG B;  3SR1 A;  1L1O C;  4H02 A;  2F0I A;  4POG A;  5LMN W;  4HJ9 A;  3A0J A;  2NN6 I;  4Y7N B;  3CCS A;  2J0T D;  3DHQ A;  2R7Z H;  2WIN B;  2FXQ A;  1LUZ A;  4E6I A;  3CQZ H;  1UE7 A;  4ZKC B;  2PCF B;  4YWK A;  4ZK9 B;  1M90 C;  4LMQ D;  3S2H B;  2CWP A;  3R2I A;  3CCJ A;  2CWA A;  2IL8 A;  4IFD I;  1SE2 A;  4UP8 A;  2EYJ A;  3J80 L;  2JA8 B;  3TME A;  1PYB A;  1EFW A;  2NVT H;  2JEB I;  3CCU A;  3IAY A;  2L9H A;  3BVZ A;  4F8M A;  3GTQ B;  1K28 A;  1IKM A;  1KDC A;  2XTI A;  3DEP A;  3QR8 A;  4A3G B;  4JVZ A;  2QA4 A;  4HIO A;  1D8L A;  1X3E A;  2F0K A;  4PMB A;  1MGS A;  3UE1 A;  2F3V A;  4LFA Q;  1Z47 A;  3F1Z A;  4BY7 B;  1NR4 A;  3JC6 6;  4K6D A;  3IL8 A;  5C4X H;  3I4N G;  2JEA I;  3I90 A;  1B1Z A;  2R61 A;  4LF9 Q;  2WP8 J;  1Q3L A;  2DN8 A;  3R3O A;  4CKC A;  4OXP A;  2F1M A;  4N9T A;  1QG7 A;  2IPK D;  1A0I A;  1B44 D;  3T56 B;  3PV0 A;  1EIF A;  4LFA L;  2QGQ A;  2E2H H;  2F3I A;  2Z6K A;  5FK9 C;  1KTK A;  3M4Q A;  4M8A A;  4X64 Q;  3QOJ A;  4RHR A;  2K6A A;  3Q8D A;  4JBK A;  1QNU A;  1Y8O B;  1VQP A;  4IUT A;  4X65 Q;  1CK1 A;  2IX0 A;  5JPM C;  4IOA A;  1SXT A;  1TWH H;  2UUB Q;  4LK1 C;  2B2Y A;  3ONA B;  3E0J A;  2R7Z B;  3AQQ A;  3CQZ B;  3K8A A;  4NKL A;  1QCB D;  3EVQ A;  1VQL A;  1CT1 D;  1WI5 A;  1O78 A;  2R93 G;  3A74 A;  3J81 i;  1EY4 A;  4X65 L;  2B29 A;  1B53 A;  2UUB L;  5IWA Q;  2NVT B;  1YJN A;  2HQE A;  3PO2 B;  5EPL A;  1Y1W G;  1EWI A;  5M5X H;  1Z6H A;  1S5E D;  1X32 A;  1CKM A;  1YIJ A;  5HY6 A;  5JAV A;  4X6A H;  1ENF A;  1GD7 A;  2JA7 G;  2PNR C;  4HR7 B;  4O2D A;  3D31 A;  2YTV A;  2EXZ A;  5IWA L;  4YWL A;  2JA5 G;  5C4X B;  3D4D A;  2QIL A;  1SMY C;  1OXT A;  3GTP H;  1TY2 A;  2OTL A;  1NJI C;  1VQJ A;  2ALY B;  4GOP A;  3RLF A;  3KFU A;  2CW0 C;  3PMF A;  1LTG D;  1EYD A;  1ICF B;  1I50 H;  2E2H B;  1A6X A;  1PH6 A;  3K57 A;  2RDH A;  1VDZ A;  1SNM A;  3KJO A;  3PIP 3;  5K36 G;  2PW5 A;  1IZ6 A;  3ZYY X;  4JV5 Q;  3MEF A;  5IGE A;  3AB9 A;  5JJI A;  1WD1 A;  2KCT A;  3E9I A;  2NTT A;  1PH9 A;  3ZJY C;  1UUP A;  4DAP A;  1XPR A;  1JJ2 A;  2VUM H;  5I6Y A;  1TWH B;  3Q6S A;  1L0Y B;  3C1E A;  3MWY W;  5A35 A;  2A5H A;  4RMF A;  2I07 B;  1IBL Q;  3S1M B;  5LMN Q;  3AMU A;  2F0S A;  2C5C A;  2X69 A;  2C9O A;  4JV5 L;  2SDF A;  2K33 A;  3NWT A;  2Z4H A;  1DON A;  4KHP Q;  1CI3 M;  3R2T A;  3G7L A;  4JI4 Q;  5JOB A;  1YZ6 A;  4DV6 Q;  4G7H C;  2R6G A;  3J80 c;  4R4I A;  2E74 C;  3BJU A;  2ZJR A;  4UDU C;  1IBL L;  1VQN A;  5LMN L;  2P5Z X;  4MNO A;  4FDB A;  1RCV D;  2NTS A;  5DNF A;  4KHP L;  1UEA B;  5M5X B;  4Q0F A;  2M9V A;  5AJ3 Q;  3L0O A;  4JI4 L;  3I4M H;  4DV6 L;  2RCN A;  1DD2 A;  2UUC Q;  1PRT D;  1SR3 A;  1CKO A;  1K8A C;  2D5D A;  5M9O A;  3CCE A;  2QDB A;  5D3I B;  1S72 A;  3HOV G;  5DM6 3;  2K5W A;  1VQ5 A;  1DOL A;  5AJ3 L;  4CGY B;  1EIG A;  2LKV A;  1WTQ A;  1I50 B;  2H5X A;  3N6R A;  2B2U C;  4QF4 A;  3S14 H;  5C0X H;  2UUC L;  1I4H A;  4FF1 A;  3GQB A;  3IKJ A;  3E3X A;  4JI2 Q;  1JC7 A;  5I6W A;  5K5P A;  1NUC A;  4N8F A;  2Z6K C;  3VR2 A;  2MJ8 A;  3OOC A;  4L5Q A;  4WFN 3;  2VUM B;  3STB D;  1C9O A;  4QUC A;  1HFG A;  4XXE A;  2B63 H;  4WRD A;  1L2F A;  1BF4 A;  2XN9 C;  1TWF H;  1F9R A;  1EWC A;  4JI2 L;  2AMC B;  3HEJ A;  1WTR A;  1Y8N B;  1KDA A;  1KDB A;  3FMC A;  2B2Y C;  3C3L A;  1HUM A;  2QDL A;  4DV7 Q;  1E1T A;  2UU9 Q;  3CCL A;  1H9K A;  1V8Q A;  1IL2 A;  4TRD A;  3U4Z A;  2HHH Q;  2K1B A;  5KIX A;  3S1N B;  3VYT A;  1BKB A;  1SJE D;  3CW2 C;  2AUK A;  3TZU A;  1G2S A;  4XQJ A;  3VR5 A;  1E24 A;  5E1F A;  1GHJ A;  2I0Q A;  3HOY B;  1EEF D;  4K0K Q;  1A2U A;  4GS3 A;  4DNT B;  1HNW Q;  4C1N K;  1EYA A;  1ROD A;  1JR0 D;  1X3G A;  2IT1 A;  5J3B A;  4DV7 L;  4A3M H;  1GHK A;  2PNH A;  2UU9 L;  3I4M B;  3G71 A;  3RZD H;  2B8G A;  2HHH L;  4OX9 Q;  1A63 A;  3T4A C;  1N34 Q;  4RGO S;  5C0X I;  1D1I A;  1XNR Q;  2KVM A;  1Y69 U;  1MJE A;  3I3C A;  3I4L A;  4K0K L;  1S5F D;  1H9M A;  2GN5 A;  1HNW L;  3ULJ A;  5C0X J;  1LTA D;  1HXY D;  2AHO B;  4LUV A;  3S14 B;  4OX9 L;  4IUU A;  1VQA A;  2JA9 A;  1N34 L;  3CCR A;  1JT8 A;  2BCO A;  4LF7 Q;  1EZ6 A;  1KL9 A;  1XNR L;  2XVS A;  5I2X A;  5ELN A;  1PMR A;  4C3I H;  1KAA A;  4OGQ C;  3LWE A;  1H9J A;  1UE1 A;  3EJI A;  2N55 A;  3HOX G;  4H13 C;  4V19 0;  2IWH A;  3TP8 A;  1SYF A;  4C3H G;  2NVX B;  4BA1 I;  4AYB G;  4MZ9 A;  4IOC A;  1M4V A;  2K03 A;  4CDD C;  2JE6 I;  1C0A A;  2B63 B;  1B4O A;  4BY1 G;  4LF7 L;  4PZ8 A;  1TWF B;  2SOB A;  4YCU A;  1CSQ A;  3HOX H;  2LS0 1;  2IX1 A;  3K5N A;  4C3H H;  3VYS A;  3S15 H;  4R4O A;  1AH9 A;  3C2P A;  1LM0 A;  3VDY A;  4PMW A;  1II3 A;  4B9W A;  4AQY Q;  1FJG Q;  4G4K A;  3GV3 A;  5JJL A;  1NE3 A;  4A3J B;  2NZH A;  1SNQ A;  2ID0 A;  2HDL A;  1LTI D;  1RTO A;  1FNW A;  1J9O A;  1SAP A;  4OWX B;  1GO3 E;  1T5X D;  3BG3 A;  3HGB A;  1X55 A;  2PQA A;  4DA2 A;  2ES2 A;  4QMG A;  1HPC A;  1PVO A;  4HN7 A;  3H09 A;  1HTP A;  4A3M B;  2M2L A;  1D5M C;  1JOK A;  4AQY L;  5KNC A;  4PV1 C;  1FJG L;  3RZD B;  3RLO A;  3K80 C;  1SDF A;  3NEM A;  4R8N A;  1N36 L;  1SRO A;  3GD7 A;  2GVB A;  1R4P B;  1B70 B;  1E7Z A;  1VQG A;  2EJM A;  1KRT A;  4GOP B;  1JQY D;  4DV2 Q;  2CKZ B;  3R8B A;  3F2D A;  3X3N A;  1IBM Q;  1GKH A;  4LF8 Q;  1TS3 A;  4IAL A;  4DU9 A;  4GLX A;  4YCW A;  1W6K A;  5M3M B;  3J81 j;  1BCP D;  1Q8K A;  2HCC A;  3KBG A;  1Y8P B;  2ICI A;  1MSG A;  2DY7 A;  4C3I B;  1GUW A;  2NZ1 D;  2MO0 A;  1V1O A;  2JN4 A;  3MTS A;  4J8Q A;  4DV2 L;  1SBB B;  1IBM L;  4LF8 L;  1LT6 D;  2NUC A;  1KRS A;  2SNM A;  3MXU A;  2PI2 E;  2L55 A;  1D5X C;  1KD1 C;  4DPG A;  1BO0 A;  3RMH A;  3A8K E;  1FYC A;  5M5W H;  3Q23 A;  2Q2H A;  3ERO A;  2QEX A;  3S15 B;  3D4W A;  2HIV A;  1ET6 A;  1Q12 A;  3QOL A;  2EY2 A;  3NHH A;  4C2M H;  2ZM6 Q;  2RA4 A;  1F2L A;  4PMC A;  2KEE A;  2D0P A;  1PHJ A;  3T51 B;  2PPB C;  3H6M A;  2A69 C;  3A56 A;  3T1H Q;  4Y52 H;  1SYE A;  3FRP B;  3J80 i;  3CHB D;  2F03 A;  4OO1 I;  1CQV A;  2PMZ B;  4DFA A;  1U4R A;  2OWO A;  2EY1 A;  3J81 c;  4RCN A;  2ZM6 L;  3A8J E;  4A3E G;  4KMU C;  3T1Y Q;  4WJ3 M;  5ELF A;  1V1Q A;  4DR5 Q;  1PDQ A;  3T1H L;  2A74 C;  2I5L X;  3H3V H;  4EX5 A;  2F4I A;  2KOL A;  3P7J A;  2A68 D;  3VR6 A;  4A3B B;  4A3E H;  3LX0 A;  3EQL C;  3BVG A;  2RQX A;  3DUZ A;  3RZO H;  3T1Y L;  5GAG C;  4X3S A;  4DR5 L;  2LY7 A;  5G3L F;  1YHQ A;  1PA6 A;  1PZK D;  2K75 A;  4H44 C;  4PG3 A;  5F2D A;  3BZK A;  3MXG A;  2CVR A;  4DAV A;  2F0O A;  1YNN C;  4JI6 Q;  3VYR A;  3FEW X;  1I4X A;  4RGN A;  4KKT A;  1S3O A;  3F2U A;  3L3O C;  4JPB W;  2LXK A;  1TKW B;  4N8X 1;  3MXN B;  2IX3 A;  4FXG C;  1Q81 C;  2LXJ A;  1K73 C;  4M1U B;  2K05 A;  2CCZ A;  2E2I H;  5M5W B;  1R4Q B;  3NTK A;  3KJP A;  3CPF A;  3I70 A;  4JI6 L;  1GJX A;  1VQ6 A;  3DMU A;  4AYB E;  4P75 A;  2KA7 A;  4C2M B;  1NCV A;  1WJJ A;  2EZV A;  4CBV A;  1EZ8 A;  1PTO C;  1DM0 B;  3M7N A;  1YVC A;  3MAQ A;  4WJ4 A;  2N78 A;  2F0F A;  2A6H D;  3RN2 A;  5ELE A;  1XTD A;  1X65 A;  4QY7 A;  4DGZ A;  1K8M A;  5M3F B;  3HOU H;  2PMZ E;  4IUV A;  2FHT A;  5C3E G;  3S17 H;  1JJC B;  1XWE A;  3EBE A;  2NWG A;  1MD2 D;  4KJO A;  2CFM A;  1TXY A;  1C48 A;  1VQF A;  1I6V C;  1HFN A;  5IGD A;  4IO9 A;  1WTX A;  5C3E H;  4A3E B;  3CU7 A;  5BN5 A;  4DR3 Q;  3EFX D;  1AW7 A;  1G6P A;  4BBR G;  3RZO B;  4DXG A;  3GTO B;  1HA6 A;  2MFI A;  1K83 H;  2KCN A;  1BR9 A;  2JYO A;  2A8V A;  1TY0 A;  2RBM A;  4DKA C;  3HKZ G;  5C6A A;  5EKI A;  1ZYR C;  3PQI A;  2VS1 A;  1GUN A;  2K32 A;  4TVA B;  1I5F A;  4IFD G;  4QJF A;  1Q8I A;  5NUC A;  2F0U A;  4DR3 L;  1LTL A;  2BE5 C;  1Q1E A;  2ZXO A;  3VR4 A;  2QCP X;  3RNU A;  2EDG A;  2R3Z A;  3HFZ B;  1CQF A;  1S5B D;  5CYU A;  2F3W A;  1K8G A;  3OMG A;  1EL0 A;  1N33 Q;  5DAU A;  1VQ4 A;  1VQI A;  3OHX C;  3U58 A;  4IPD A;  2HCI A;  1VQM A;  1WD0 A;  2ZTC A;  4YWM A;  1I94 Q;  1CA6 A;  4YIJ A;  1N33 L;  3W1G A;  3KLS X;  1XTC D;  3HOU B;  1WCM G;  2K14 A;  2QF7 A;  5LL6 X;  3HG9 A;  5GAE C;  3S17 B;  5TSS A;  2MNA A;  1DYQ A;  3I91 A;  4JOI A;  4UHV A;  3QO2 A;  1I94 L;  5IYC G;  2Q2T A;  1A2T A;  3PSI A;  3U4V A;  1YNJ D;  5I2Y A;  1BCP B;  5C3E B;  3TRE A;  2BOS A;  3RR5 A;  1T5E A;  2NVY H;  3NBH B;  1JE4 A;  1F2Z A;  1NMG A;  2ATW A;  1K83 B;  4GN5 A;  4WOR A;  5C44 G;  1EQQ A;  5DEH A;  2YU9 H;  1CM9 A;  3NXW A;  2E5L Q;  1HHV A;  1W3S A;  5FO7 B;  3TP5 A;  3HKS A;  1IYV A;  2H4O A;  4FP5 D;  4FF4 A;  2I5M X;  3OWE B;  1TWC H;  1PH4 A;  1CFM A;  5J22 A;  2VNU D;  1G51 A;  4A3L G;  2EYM A;  4APV A;  1I4P A;  1PH3 A;  4LUZ A;  2K4K A;  2UUA Q;  1T9H A;  4X3U A;  2E5L L;  4QGU A;  3KDF B;  1Y14 B;  2PYK A;  2LSS A;  4IPG A;  1GUO A;  4HCS A;  4GLV B;  3I4N H;  3GTM H;  1FGB D;  3ULL A;  3M3Y H;  3DWP A;  1IXR A;  1PYS B;  2UUA L;  4JI8 Q;  1QVG A;  1I4R A;  4MTN A;  4HSV A;  4A4I A;  3ITP A;  4U68 A;  3I73 A;  2IHE A;  4FXK C;  4KI0 A;  5C4H A;  2PI2 A;  4UAI A;  3DXJ C;  1KLU D;  4HMI A;  1D6E C;  1VQB A;  3UI2 A;  1ONL A;  4WJW A;  1L1O B;  4JI8 L;  2OXP A;  1Y1V G;  2BA1 A;  2H1E A;  2JJQ A;  2PZW A;  3KK7 A;  1RTN A;  3TZD A;  3UDX A;  4JBM A;  4FXD A;  5EJW A;  1SYD A;  1KAW A;  4A75 A;  2NVY B;  3J7A F;  3RLN A;  2EJF C;  2WFW A;  5JJZ A;  2R93 H;  3AYH B;  3GTK H;  4DNR B;  1Y1V H;  4L63 B;  4RGM A;  2MQH A;  5EQ0 A;  2YU9 B;  2MP1 A;  4A3I G;  3BZD B;  4ULL A;  5CBA E;  1CHQ D;  1BOS A;  1B7Y B;  3D4R A;  3SK5 A;  2B8F A;  1F2M A;  1SYB A;  3LWU A;  3A7L A;  4KV6 A;  4F88 A;  1TWC B;  1GOZ A;  4HSP A;  5D3D A;  1N32 Q;  1KQS A;  3TSS A;  2DJG C;  1Y1W H;  3F8T A;  4A3I H;  4K8J A;  2RVL A;  3G4S A;  1SYC A;  1N9W A;  2D9U A;  2OQ0 A;  2F0V A;  2JA7 H;  4EQP A;  4BXX G;  1RJT A;  4OWW B;  2FIN B;  4BWG B;  2JA5 H;  4UP9 A;  5COR A;  1N32 L;  3I4N B;  1V43 A;  3GTM B;  5A2Q E;  1TQO A;  5IIF A;  3M3Y B;  3BDC A;  1Q1B A;  2B39 A;  2X6L A;  4CJ2 C;  4RKL A;  2OQK A;  1MKH A;  2K01 A;  3CF5 A;  4XDX A;  1EFI D;  4Z9C B;  1Q46 A;  4QIW B;  3H91 A;  3SVM A;  1GUG A;  1FR3 A;  1U5K A;  5EKK A;  4JG2 A;  5K36 H;  2L15 A;  3K59 A;  5IT9 E;  3CME A;  1G91 A;  4ZUI A;  1OTC A;  4DR7 Q;  3CPW A;  5CC4 A;  1JOQ A;  2UXB Q;  4NP5 A;  3L9A X;  2AWO A;  1UNS A;  1U0L A;  5I9O A;  3RN5 A;  2KBN A;  3M9B A;  2R93 B;  4PQX A;  3GTK B;  2IY5 B;  1Y1V B;  3OYY A;  4DR7 L;  1O80 A;  1HNX Q;  3TDQ A;  1FL0 A;  4GN4 B;  2UXB L;  3BYY B;  1FNV A;  3K5O A;  4A3D G;  4LF4 Q;  2EYO A;  2R7D A;  4OEL B;  5JJK A;  1H95 A;  3P1H A;  1FGU A;  5D65 A;  4FF2 A;  1YEZ A;  3MVV A;  4CJ1 B;  1MJC A;  1XMQ Q;  1Y1W B;  2EYH A;  1VQH A;  5C5M A;  1SN8 A;  2PZU A;  3GTP B;  1HNX L;  1AZQ A;  2R92 G;  1VQD A;  1CZG A;  2JA7 B;  3K81 C;  4ZCK A;  3CCM A;  4ZUJ A;  5FLM G;  2L12 A;  5GAH C;  1EY5 A;  4LF4 L;  5A2Q L;  4K14 A;  2JA5 B;  2F0H A;  5J1Z A;  1XMQ L;  3HOV H;  1X3F A;  2EXD A;  1EWH A;  2YTY A;  4KK7 A;  4RG1 A;  4GNX A;  1DJR D;  2F0M A;  5FLM H;  3UE0 A;  2ENB A;  1TS5 A;  1SNP A;  4QIW E;  5IT9 L;  4EQN A;  1B9N A;  4FYD A;  5EBC A;  3V05 A;  1HZB A;  3T53 B;  1K0R A;  3MXN A;  1IKL A;  2Z4I A;  4AIM A;  4UY8 C;  2ZXP A;  3CMA A;  4PNY A;  2NVQ H;  2G9D A;  1STA A;  2NB0 A;  4GN3 B;  5AFW A;  5CV9 A;  1JB7 A;  3GDE A;  1DCZ A;  1H9S B;  4XT1 B;  1HJP A;  1NTG A;  3ER0 A;  2RF4 A;  5ISR A;  1B8A A;  1IBK L;  4C3J G;  3BDL A;  5KYI A;  1S5C D;  3SK6 A;  2RHS B;  2R7F A;  3PUZ A;  2DGY A;  3OWF A;  2KCM A;  5CV7 A;  3J7Z C;  4RHS A;  2EY6 A;  2B2V A;  5D14 A;  4HIK A;  3I2Z A; 
#chains in the Genus database with same CATH homology
 4EQ5 A;  4JI1 L;  3J80 i;  1NBW A;  4B3M L;  2F52 A;  4OO1 I;  4DUY L;  3CC4 A;  3A5Z B;  3OTO L;  4A3F G;  2OWO A;  3TS0 A;  3J81 c;  2HT1 A;  1EOV A;  2ASB A;  1KIX A;  2ZM6 L;  4BXX H;  5HGQ A;  2HQL A;  3K7U C;  4LUO A;  4A3E G;  1LYL A;  3T1Y Q;  1YJ9 A;  5FLX c;  2PQA B;  4GOP C;  4WJ3 M;  1QUQ A;  1V1Q A;  4DAM A;  4DR5 Q;  3T1H L;  3W5O A;  1NY4 A;  3PF4 A;  1J5E Q;  1L1O C;  2I5L X;  3H3V H;  3PUX A;  4EX5 A;  4H02 A;  2VUM G;  3I7F A;  4POG A;  5LMN W;  1JMC A;  4HJ9 A;  4BA2 I;  4R1J A;  3A0J A;  2NN6 I;  4A3E H;  4JBJ A;  3CCS A;  3CCQ A;  2R7Z H;  2FXQ A;  1LUZ A;  5GRO A;  1VQE A;  3TQY A;  3CQZ H;  1UE7 A;  3RZO H;  3T1Y L;  4YWK A;  1M90 C;  4JOI C;  2JA6 G;  2KHJ A;  5GAG C;  4DR5 L;  2CWP A;  1PA6 A;  1YHQ A;  2WB1 E;  3CCJ A;  1CUK A;  2K75 A;  2CWA A;  4PG3 A;  1VQO A;  3BZK A;  4IFD I;  4UP8 A;  3PIO A;  3UDF A;  1J5E L;  4DAY B;  2ZJP A;  2VL6 A;  4JI6 Q;  1PYB A;  2I5H A;  2KEN A;  1EFW A;  2NVT H;  1SRU A;  1S3O A;  1HNZ Q;  2JEB I;  3CCU A;  3AFQ A;  4JYA Q;  1SE8 A;  3A5U A;  2JA6 H;  3TRZ A;  2LXK A;  3BZC A;  3HOY G;  4BY1 H;  2XTI A;  3MXN B;  3M85 A;  1Q81 C;  4UP7 A;  2LXJ A;  1K73 C;  2QA4 A;  4HIO A;  1D8L A;  1X3E A;  1G29 1;  2CCZ A;  1N36 Q;  2E2I H;  1KXL A;  4DV5 Q;  1Q82 C;  3UE1 A;  4LFA Q;  2WAQ G;  1Z47 A;  3I4M G;  3F1Z A;  3S1N H;  3KJP A;  1N8R C;  3CPF A;  4A93 G;  2Y0S G;  4JI6 L;  3JC6 6;  1VQ6 A;  3AFP A;  1VQ7 A;  2E2J H;  3GTJ H;  1HNZ L;  4AYB E;  4NXN Q;  3HOY H;  4P75 A;  5C4X H;  2VQF Q;  1XPO A;  3I4N G;  4JYA L;  3FP9 A;  5IE8 A;  3CXC A;  2JEA I;  4A3D H;  5JEA G;  2WP8 J;  1WJJ A;  1W2B A;  4LF9 Q;  4OXP A;  4A3C G;  3FKI G;  3ERS X;  2N8N A;  3M7N A;  1A0I A;  1YVC A;  4WJ4 A;  2N78 A;  4OON A;  3PV0 A;  4DV5 L;  1EIF A;  3RN2 A;  3UDG A;  1XTD A;  4LFA L;  4A93 H;  1X65 A;  2QGQ A;  4DV3 Q;  2F3I A;  2E2H H;  1WFQ A;  4QY7 A;  5C0X G;  3PGZ A;  2Z6K A;  3PO3 G;  2R92 H;  3HOU H;  3M4Q A;  3S16 H;  4NXN L;  2PMZ E;  4PZ6 A;  2VQF L;  4X64 Q;  4DK6 C;  4OO1 G;  1CKN B;  4A3C H;  3FKI H;  2ZTE A;  5C3E G;  1EIY B;  3S17 H;  3Q8D A;  4JBK A;  1JJC B;  2B3G A;  3EBE A;  1VQP A;  4X65 Q;  2IX0 A;  4IOA A;  3S2D H;  2CFM A;  1TXY A;  3NEL A;  4DV3 L;  1TWH H;  1VQF A;  3I55 A;  2UUB Q;  2B63 G;  1IBK Q;  3K7A H;  4IO9 A;  5C3E H;  1VCI A;  3CCV A;  1QUQ B;  4DR3 Q;  4L5T A;  1PV4 A;  3AQQ A;  4P72 A;  2UXC Q;  3K8A A;  1G6P A;  4BBR G;  3G6E A;  1HZC A;  1VQL A;  1WI5 A;  2R93 G;  2MFI A;  1K83 H;  3A74 A;  5IT9 c;  3SGI A;  2NVX H;  2DUD A;  2A8V A;  3J81 i;  2K52 A;  3STB C;  4X65 L;  2B29 A;  4DKA C;  3CC7 A;  3HKZ G;  4DV0 Q;  1KC8 C;  3H15 A;  1MIU A;  2VS1 A;  2F4V Q;  2KHI A;  2UUB L;  4TVA B;  4QQB X;  1I5F A;  4IPH A;  4IFD G;  3H0G G;  5IWA Q;  4A3J G;  4QJF A;  1YJN A;  3GO5 A;  3KDF A;  5M5Y H;  4DR3 L;  1LTL A;  2UXC L;  1Q1E A;  1XPU A;  3RNU A;  1PH7 A;  1Y1W G;  3KF6 B;  1L0W A;  1EWI A;  5M5X H;  1EQR A;  2BH8 A;  3HFZ B;  4B3T Q;  1CKM A;  1YBY A;  1YIJ A;  3L7Z C;  5HY6 A;  4A3M G;  3ICE A;  4X6A H;  1C7Y A;  5IYB G;  1GD7 A;  4DV0 L;  1K8G A;  2JA7 G;  1V9P A;  4A3J H;  4O2D A;  4C3J H;  1JE5 A;  3D31 A;  1N33 Q;  2F4V L;  3NEN A;  2YTV A;  5IWA L;  4YWL A;  1OXX K;  1VQ4 A;  1VQI A;  4AH6 A;  3G48 A;  3U58 A;  1K3R A;  5H1S E;  2JA5 G;  1YHB A;  5BR8 Q;  4LWC A;  4IPD A;  1OXT A;  3GTP H;  2EIF A;  3CP0 A;  1VQM A;  1NJI C;  2OTL A;  1A8V A;  3PUW A;  5IYB H;  4B3T L;  2ZTC A;  1VQJ A;  2ALY B;  4YWM A;  3RLF A;  4HIM A;  4GOP A;  4JI3 Q;  3KFU A;  3ULP A;  3TS2 A;  1I94 Q;  5M3M G;  1I50 H;  5GAD C;  1PH6 A;  1N33 L;  1L1O A;  1OXS C;  2V1C C;  3W1G A;  1VQ9 A;  4A3F H;  4DR2 Q;  3I4O A;  2OCE A;  5C4J H;  3KJO A;  1HR0 W;  4LNQ A;  4NXM Q;  2D0O A;  5K36 G;  5BR8 L;  1WCM G;  1IZ6 A;  2K14 A;  4JCV E;  4JV5 Q;  4KLK A;  4JBW A;  1R9T H;  3MEF A;  5GAE C;  3OW2 A;  1E22 A;  2MNA A;  1RIP A;  1VQ8 A;  5JJI A;  4JOI A;  5M3M H;  4JI3 L;  1ASZ A;  2KCT A;  3E9I A;  1PH9 A;  4GNX B;  2D62 A;  2CQO A;  3ZJY C;  1XPR A;  5IYC G;  1JJ2 A;  1I94 L;  2BH2 A;  2Q2T A;  2VUM H;  1OXV A;  4O0A A;  3PSI A;  3S1R H;  4ME3 A;  3U4V A;  1UE6 A;  4DR2 L;  1GVP A;  4RMF A;  3TRE A;  1IBL Q;  3LGJ A;  4DR1 Q;  3RR5 A;  5LMN Q;  4NXM L;  3NBH B;  2NVY H;  2VW9 A;  4DNI A;  4JV5 L;  1NMG A;  3HOW G;  2ATW A;  4KHP Q;  4GN5 A;  4A76 A;  4B3S Q;  1O7I A;  5C44 G;  1SFO H;  1EQQ A;  2YU9 H;  3E0E A;  2E5L Q;  1IYJ B;  5EAY A;  4JI4 Q;  1W3S A;  3AEV A;  1WOC A;  1YZ6 A;  4DV6 Q;  1BBU A;  2R6G A;  4KHZ A;  3J80 c;  3HKS A;  3KLW A;  4R4I A;  1S40 A;  4A3K G;  3BJU A;  2ZJR A;  2AWN A;  4X62 Q;  2I5M X;  4XIG S;  5LMU Q;  2IHF A;  1YNX A;  1TWC H;  4DR1 L;  1PH4 A;  5LMN L;  1EYG A;  1IBL L;  1VQN A;  4MNO A;  4FDB A;  5IP9 G;  4DK3 C;  3HOW H;  1E1O A;  2K5H A;  1G51 A;  1KHI A;  4DV4 Q;  4A3L G;  4BBS G;  4APV A;  1TWA H;  4KHP L;  4R4C A;  3DM3 A;  1PH3 A;  4LUZ A;  4B3S L;  2K4K A;  4PZ7 A;  2UUA Q;  3CC2 A;  1T9H A;  5AJ3 Q;  2E5L L;  1PFS A;  3L0O A;  4QGU A;  4JI4 L;  3KDF B;  1Y14 B;  3I4M H;  5IP7 G;  4DV6 L;  2LSS A;  4IPG A;  1TWG H;  2RCN A;  3KOJ A;  1VQC A;  4GLV B;  1X6O A;  2UUC Q;  3S24 A;  4X62 L;  5IP9 H;  5LMU L;  1QZG A;  1SR3 A;  1CKO A;  3H3V I;  3I4N H;  5DLQ E;  1K8A C;  1P16 A;  4YCV A;  3GTM H;  3CCE A;  4P71 A;  1HH2 P;  4DV4 L;  1S72 A;  3ULL A;  4L5R C;  3HOV G;  3M3Y H;  1IXR A;  1PYS B;  3U50 C;  2UUA L;  2YTX A;  1VQ5 A;  4JI8 Q;  1QVG A;  5IP7 H;  4MTN A;  5AJ3 L;  4A4I A;  4A3B G;  2NZO A;  1XNQ Q;  2H5X A;  3S14 H;  2K50 A;  3JAM i;  1NMF A;  2IHE A;  4KI0 A;  4HID A;  3CD6 A;  3PO3 H;  2UUC L;  2PI2 A;  4JI2 Q;  2Z6K C;  1VQB A;  4IJH A;  2N3S A;  4GNX C;  1Q86 C;  3D0F A;  4L5Q A;  2JA8 G;  1L1O B;  2NN6 G;  4JI8 L;  3M4O H;  4A3B H;  1Y1V G;  3F2C A;  2BA1 A;  1I6H H;  4GKK Q;  1VQK A;  4LFC Q;  1XNQ L;  2JJQ A;  3STB D;  1C9O A;  3F2B A;  2B63 H;  3UDX A;  4JBM A;  4TQU S;  1L2F A;  2YV5 A;  4LF6 Q;  1BVS A;  1TWF H;  1VS0 A;  4JI2 L;  2AMC B;  1PH1 A;  1KAW A;  4A75 A;  4OWT B;  2WFW A;  3RLN A;  4BBR H;  1P8L A;  2JA8 H;  3UDI A;  4DR6 Q;  2R93 H;  3AYH B;  3GTK H;  1Y1V H;  1GM5 A;  4QL5 A;  1QVC A;  2MQH A;  4DV7 Q;  1E1T A;  4HJ7 A;  2VY3 A;  4A3I G;  1FVI A;  1XMO Q;  3PUV A;  2UU9 Q;  3GTQ H;  4GKK L;  4LFC L;  2MO1 A;  3CCL A;  1B7Y B;  1IL2 A;  2HHH Q;  3U4Z A;  3S1Q H;  3BU2 A;  3H0G H;  4LF6 L;  1CSP A;  1QVF A;  1ASY A;  1BKB A;  2E8G A;  1YHA A;  3CW2 C;  1N32 Q;  2K5V A;  4HJ5 A;  1KQS A;  1E24 A;  2I0Q A;  4LW1 A;  3K0X A;  1Y1W H;  4DR6 L;  3HOZ G;  4K0K Q;  1RL2 A;  2XGT A;  3F8T A;  4GS3 A;  4A3I H;  3B6Y A;  1HNW Q;  2UXD Q;  4DV7 L;  1X3G A;  3G4S A;  4A3M H;  2IT1 A;  5J3B A;  1DGS A;  1N9W A;  1HZ9 A;  2PNH A;  5M3F G;  1XMO L;  2OQ0 A;  2UU9 L;  3G71 A;  2JA7 H;  2K5N A;  2C35 B;  3RZD H;  2HHH L;  4OX9 Q;  4BXX G;  1A63 A;  1N34 Q;  3PIP A;  5JEA J;  4OWW B;  1CKN A;  5GQO A;  3M4P A;  5C0X I;  2JA5 H;  4UP9 A;  1XNR Q;  1N32 L;  1V43 A;  2AKW B;  2WB1 G;  3HOZ H;  4DR4 Q;  2VNU D;  1PH2 A;  1MJE A;  4K0K L;  4DUZ Q;  1Q1B A;  2GN5 A;  5M3F H;  1WYD A;  1HNW L;  2UXD L;  3ULJ A;  2OQK A;  4YHH L;  1MKH A;  5C0X J;  3CF5 A;  1XJV A;  2AHO B;  1Q46 A;  1UE5 A;  3KYH C;  4LUV A;  2R7Z G;  2GVA A;  4OX9 L;  1VQA A;  4NPS A;  4YY3 Q;  2JA9 A;  1N34 L;  1U5K A;  3CCR A;  3GTL H;  1I3Q H;  1JT8 A;  4JC0 A;  4LF7 Q;  1E3P A;  1KL9 A;  3I56 A;  2Q2I A;  1XNR L;  4JG2 A;  1SMX A;  1WCM H;  5ELN A;  4DR4 L;  4C3I H;  2L15 A;  2EQS A;  1A62 A;  1UE1 A;  5ELO A;  3CME A;  4DUZ L;  2A19 A;  3FHW A;  1HR0 Q;  3HOX G;  2ZJQ A;  1OTC A;  4NB3 A;  4DR7 Q;  4BA1 I;  3CPW A;  4AYB G;  4P74 A;  4MZ9 A;  2UXB Q;  5IYC H;  4J15 A;  4IOC A;  2AWO A;  2BA0 A;  3L2P A;  3GTO H;  1X54 A;  2JE6 I;  3PO2 G;  2OTJ A;  4YY3 L;  1U0L A;  4LF5 Q;  1C0A A;  1OXU A;  4BY1 G;  4LF7 L;  4PZ8 A;  3W1B A;  1BBW A;  3RN5 A;  4YCU A;  4DV1 Q;  2KBN A;  3KF6 A;  4GKJ Q;  1CSQ A;  4IJL A;  3M9B A;  3HOX H;  2IX1 A;  4HJA A;  4C3H H;  1HR0 L;  2YYZ A;  4GLA C;  2IY5 B;  1Z9F A;  3S15 H;  3OYY A;  5C44 H;  4DR7 L;  4R4O A;  1AH9 A;  4B3R Q;  1LM0 A;  3VDY A;  1HNX Q;  1FL0 A;  4GN4 B;  4P73 A;  4PMW A;  4IFD J;  3PO2 H;  1K9M C;  2UXB L;  4AQY Q;  2HIX A;  1FJG Q;  5C4X G;  4A3D G;  4A3K H;  5JJL A;  4LF5 L;  1NE3 A;  2NZH A;  4LF4 Q;  2R7D A;  5JJK A;  1PH5 A;  1H95 A;  1FGU A;  4XTC S;  2ID0 A;  1YEZ A;  1J6Q A;  1Q7Y C;  4DV1 L;  4GKJ L;  4A3L H;  1JJG A;  4BBS H;  1MJC A;  1GO3 E;  4OWX B;  1XMQ Q;  1PVO A;  1VQH A;  1X55 A;  2PQA A;  3EN2 A;  2ES2 A;  1SN8 A;  4B3R L;  1HNX L;  2VQE Q;  4L5S A;  3TEH B;  1M1K C;  1VQD A;  2R92 G;  3HOU G;  3K81 C;  4AQY L;  3CCM A;  3PF5 A;  1FJG L;  4IPC A;  5FLM G;  4JI5 Q;  3RLO A;  5GAH C;  3K80 C;  1YI2 A;  4LF4 L;  2WAQ E;  4R4Q A;  3NEM A;  3CAM A;  1N36 L;  1SRO A;  2Y0S E;  3GD7 A;  2GVB A;  4ALP A;  1B70 B;  1E7Z A;  3GTG H;  3HOV H;  1VQG A;  1KRT A;  1XMQ L;  1X3F A;  2EXD A;  4GOP B;  4DV2 Q;  2CKZ B;  2YTY A;  4RG1 A;  3F2D A;  1HZA A;  4GNX A;  3PUY A;  1GKH A;  2VQE L;  1YIT A;  1QZH A;  1X9N A;  5FLM H;  2Z0S A;  1IBM Q;  4GLX A;  2A1A A;  4LF8 Q;  4YCW A;  3UE0 A;  4LF9 L;  1AE2 A;  4Y7N H;  4R4T A;  3J81 j;  4JI5 L;  4JI7 Q;  1D7Q A;  4QIW E;  1Q8K A;  2Q2U A;  1YJW A;  4JI0 Q;  3S2H H;  1X56 A;  4LFB Q;  4POF A;  1HZB A;  4A3G G;  2JK8 A;  1K0R A;  2MO0 A;  4AIM A;  3E9H A;  4DV2 L;  4UY8 C;  3CMA A;  1IBM L;  4LF8 L;  4X64 L;  3S1M H;  2NVQ H;  4BY7 G;  3DLL A;  1KRS A;  1SLJ A;  2JQO A;  4GN3 B;  1AE3 A;  4JI7 L;  3IRB A;  2PI2 E;  3J7A 5;  1JB7 A;  5IYD G;  4X66 Q;  4JI0 L;  1KD1 C;  4A3G H;  4DPG A;  3GDE A;  4LFB L;  5E7N A;  1UWV A;  2RHQ B;  5FJ8 G;  1HJP A;  1NTG A;  3ER0 A;  2RF4 A;  4UPA A;  4JI1 Q;  5M5W H;  1B8A A;  2Q2H A;  2QEX A;  4HJ8 A;  4DUY Q;  1IBK L;  4B3M Q;  4BY7 H;  2HIV A;  3WWV A;  3KF8 B;  2VZA A;  3OTO Q;  1UEB A;  1Q12 A;  2ZTD A;  3PCO B;  2RHS B;  2R7F A;  4YHH Q;  4C2M H;  2ZM6 Q;  3PUZ A;  5IYD H;  2N49 A;  2DGY A;  3HKZ E;  2KCM A;  3JAM c;  2D0P A;  1PHJ A;  4X66 L;  3J7Z C;  1PH8 A;  5IY0 A;  5FJ8 H;  3EIV A;  4HIK A;  1EUJ A;  3T1H Q;  4Y52 H;  3I2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...