4GKKL

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aua-codon in the a-site and paromomycin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 14
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4gkkL00
3CCLA 4DAMA 1RIPA 3DM3A 4BY1H 1XPUA 1G291 1VQ7A 1TXYA 2DUDA 5LMUQ 1N33L 4IJLA 4QJFA 4A3EG 4ALPA 1XNQQ 1YI2A 4R4TA 1Z9FA 3GTGH 1I6HH 1PVOA 1TWFH 1Z47A 2UXCQ 2BA1A 3JAMi 4LF8Q 4A3MH 4JCVE 1I50H 1XMOQ 1NMFA 4LW1A 3VDYA 4JBKA 3S16H 4JV5Q 5IYDH 1VQIA 1YITA 2CWPA 1P8LA 4JYAQ 2BA0A 3T1HL 1XMQQ 5LMUL 1WFQA 4GKJL 1D7QA 3K0XA 5IP7G 5EAYA 4L5SA 2VQEQ 3CPFA 2NZOA 5M3FG 3OTOQ 4DV6Q 1XNQL 4GOPB 3J7A5 3I55A 3F1ZA 4LUOA 4O2DA 4UP7A 1IBKQ 2RCNA 4X64Q 4LF8L 3I4NG 3J81c 3UDGA 4JI3Q 4IFDI 1XMOL 4JV5L 2RHSB 4TQUS 1PH7A 1YHAA 2VL6A 4QY7A 4JYAL 2CWAA 3GO5A 1XMQL 2HQLA 2N8NA 2NVXH 2NVTH 3PF4A 4BXXG 2OWOA 3PO3H 2VQEL 4DV6L 2UXDQ 3OTOL 3E9IA 2EXDA 3H3VI 3I4MH 2E8GA 1B8AA 1Q8KA 3S1NH 5FLMH 4A3GH 1JJ2A 4KHPL 3RZDH 3D31A 1IBKL 4X64L 2VNUD 3UE1A 4JI3L 3CCVA 2PNHA 4DV0Q 1V1QA 4HIMA 4A3IG 3MEFA 4P74A 2YU9H 1JJGA 2N78A 4DUYL 3EN2A 3K7AH 3TQYA 3SGIA 1N36Q 3W5OA 3J80c 1EUJA 4APVA 4OO1G 2UXDL 2JE6I 4YWLA 4GKKQ 1IXRA 3JC66 4LNQA 2JA8G 2KBNA 4XTCS 4UY8C 1A63A 2KHJA 3L2PA 1Q7YC 4L5TA 4DV0L 2E2HH 2WB1G 4JI5Q 1VS0A 2F52A 1QVFA 1KRTA 1NJIC 1A62A 3TREA 4A3JH 5LMNL 4POGA 3HOXG 1KD1C 3CCUA 1N36L 5IP9H 2WAQG 4DV5Q 4K0KQ 2DGYA 4GKKL 1CSPA 2AWNA 1QZHA 2A1AA 1UE1A 4Y52H 5HGQA 1VQBA 3KDFB 1VQCA 4EQ5A 1YBYA 3CC2A 1KHIA 4JI5L 4X65Q 4A75A 1VQPA 1SR3A 3HKZE 3AFQA 1PH6A 3AEVA 4UP9A 2CCZA 5BR8L 1J5EL 5C44G 3M85A 1K3RA 3G4SA 1NTGA 3G48A 1MIUA 4DV5L 4AIMA 4JI0Q 1X54A 3J81j 1QVGA 4IOAA 1TWAH 1EQRA 2R7ZG 1X9NA 1Y1VH 3WWVA 4LUVA 1N8RC 2VQFQ 4GN4B 1OXXK 3KF6A 3PSIA 5C0XI 1GVPA 3GTLH 2MQHA 5HY6A 3RLNA 4JBMA 3S1MH 4A3EH 3PCOB 1OTCA 2I0QA 4JI1Q 1YZ6A 3E0EA 1L2FA 2K52A 1HR0Q 4JI0L 1FVIA 3T1YQ 3S2DH 3GD7A 4PMWA 4DV2Q 3UDFA 5FLXc 1U5KA 2PMZE 4P75A 1TWHH 2VQFL 4BA2I 1VQ9A 1X3EA 1EWIA 2PQAA 3B6YA 2E2IH 3RN5A 1TWCH 3STBC 5IP7H 1JMCA 5GQOA 5M3FH 5H1SE 2PI2A 1X56A 1I94Q 4JI1L 1E22A 2QEXA 4LFBQ 1VQGA 2UXBL 2LXKA 4A3LG 4DV2L 3PUVA 1FGUA 2ZJPA 3I4NH 4C3IH 4BBSG 3M4QA 3HFZB 4UP8A 4A76A 1UE5A 3GTKH 3UE0A 1KL9A 3U4ZA 1AE3A 2NN6G 4PG3A 3HOYG 2PI2E 3TS0A 1N32Q 2F4VL 1B7YB 1GKHA 5IT9c 4BXXH 2WB1E 1PH1A 1PH8A 3CCSA 4HIKA 1I94L 4LFBL 4OXPA 1KAWA 1SMXA 4PZ7A 4OONA 1L1OB 3RLOA 5JEAG 3J81i 1VQLA 4P73A 1FJGQ 4DR3Q 4A3IH 2NZHA 4A93G 4WJ4A 3I56A 1WI5A 3TS2A 3NELA 3G71A 4JOIA 3GTJH 4IPDA 4YHHQ 1N32L 2Z0SA 4YY3Q 4BY7G 2GVAA 3PV0A 5M5XH 3CP0A 2AMCB 3HKSA 3L0OA 4IPCA 2GN5A 2JA8H 1YJ9A 2R92G 2R7DA 4DV1Q 3A0JA 3T1HQ 3L7ZC 4GKJQ 4OX9Q 1Q12A 4DR3L 4L5RC 1FJGL 2VUMG 1PH4A 1T9HA 2LSSA 2LXJA 3J80i 5JEAJ 3HOXH 4YHHL 3HKZG 4YY3L 2ZM6Q 1CKNB 4LF5Q 4R1JA 1SROA 4LWCA 4MTNA 4MNOA 1EFWA 1IZ6A 3CC7A 1HZ9A 4DV1L 4X6AH 4OX9L 5AJ3Q 4AYBG 4H02A 1HZAA 4GLAC 4DKAC 4NPSA 3F2DA 4NXNQ 1HR0W 5C44H 3HOWG 2JA7G 4KHPQ 1QUQB 2ZM6L 2FXQA 4LF5L 4GN5A 1VQEA 4FDBA 3Q8DA 3KF8B 4HJAA 3CCQA 2R7ZH 4DUYQ 2JJQA 3CCEA 3ULJA 4JI7L 1J6QA 3CC4A 1PFSA 5JJIA 1OXUA 5M5YH 2HT1A 5AJ3L 4DR2Q 4QIWE 4P72A 4JI6L 1H95A 3S1RH 2JA5G 4NXNL 2GVBA 2L15A 2Y0SG 4DV3L 2EQSA 1OXVA 2OQKA 3KDFA 4OWTB 4AH6A 1KIXA 1C0AA 3F2BA 1G6PA 1PYBA 2I5HA 2YYZA 1QZGA 1PH9A 4R4IA 5GAGC 3CMAA 1LTLA 3BZCA 3S14H 5LMNQ 1NBWA 1YNXA 2V1CC 3IRBA 3J7ZC 3AFPA 3FHWA 2AWOA 3CAMA 3W1GA 2ZJRA 4A3CG 4HJ5A 1SN8A 4YCUA 3K81C 2HIVA 4DR2L 2ASBA 3GTPH 3GTOH 4PZ6A 4HIDA 1A8VA 1OXTA 1P16A 1L0WA 3M9BA 4J15A 4R4QA 3GDEA 1X3GA 1IBLQ 1U0LA 4OWXB 1YEZA 4A3LH 2IX1A 2NVQH 1HZBA 1LUZA 4BBSH 4DAYB 1J5EQ 2K4KA 1BBWA 2VZAA 1XNRQ 3PUXA 1DGSA 1Y14B 3PUWA 4LF6Q 3HOYH 4OO1I 5FJ8G 1V9PA 1EYGA 4IFDG 2WFWA 5GROA 4NB3A 1EOVA 4JI8Q 3RZOH 4GNXA 4HIOA 1K8AC 3S15H 2OTJA 1VQDA 1CKOA 4GS3A 2Q2UA 1IBLL 4A3DG 1B70B 3I7FA 2VS1A 1K73C 1E3PA 2XTIA 2RHQB 3M4PA 5IYBG 2E2JH 4A93H 1XNRL 4Y7NH 1BVSA 4C3JH 4JBJA 4DK6C 4LF6L 4X66L 2AHOB 1R9TH 1PA6A 1K0RA 3BJUA 4A3FG 4JI8L 4BY7H 1XPRA 5M3MG 4AYBE 5J3BA 1PHJA 2ZJQA 4DR6L 2ZTCA 2ZTEA 3STBD 2WP8J 2R92H 1HNWQ 1YJWA 1IL2A 4C3HH 4JI2Q 3PF5A 1UEBA 4YWMA 1VQNA 2VUMH 2F3IA 3G6EA 2KCMA 2EIFA 3H0GG 1XJVA 1W3SA 4JG2A 2UXBQ 1L1OA 2CFMA 1UE7A 1CUKA 5JJLA 4QQBX 2RF4A 2YTYA 3K8AA 2IHFA 2Y0SE 1HNWL 3KLWA 4EX5A 3M7NA 2K5HA 1K8GA 1PH2A 2K14A 3A5ZB 4JI2L 2F4VQ 4A4IA 2UUAQ 2ZTDA 5M5WH 1KC8C 4IPHA 4LFAQ 3HOWH 3HOUG 1EIFA 2JA7H 3S1QH 2H5XA 4B3SQ 4JBWA 2HHHQ 4C2MH 3NEMA 1HJPA 2IY5B 2JEBI 2UUBQ 1YHBA 4B3RQ 1VQ6A 3S17H 1CKNA 2UUAL 1Y1WG 2JA5H 2MO0A 4LFAL 1X65A 4X62Q 2KENA 1S3OA 3ULLA 3CF5A 2HHHL 5C0XG 4B3SL 4MZ9A 4LF7L 3U50C 2YTVA 2D62A 3CCMA 4DPGA 4GOPA 3ER0A 3ZJYC 2E5LQ 2AKWB 2UUBL 4B3RL 3I4OA 3PUYA 4A3CH 2K50A 4KLKA 2UUCQ 2UXCL 3EIVA 3ULPA 2MNAA 1JB7A 2JK8A 1YIJA 3KF6B 2Z6KA 3U58A 4BA1I 2YTXA 4X62L 2K5NA 4DUZQ 1Q46A 4DV7Q 3PO2G 1LYLA 4UPAA 4ME3A 1LM0A 1JJCB 5IY0A 2KHIA 5GADC 2E5LL 3KFUA 1AH9A 3CPWA 3CCRA 2OCEA 1K9MC 1KXLA 1MJCA 2UUCL 4DV4L 1KRSA 1YHQA 1ASYA 5FJ8H 1GO3E 1JT8A 2PQAB 1S40A 4JI7Q 4DUZL 4A3DH 5DLQE 2ID0A 2R93G 1X55A 2B3GA 4DV7L 4JI6Q 4AQYL 3H15A 1E1OA 1M1KC 4DV3Q 5IYBH 1XPOA 1NE3A 3K7UC 1MJEA 3H3VH 3M3YH 1BBUA 2IHEA 3FKIG 4B3ML 1N9WA 1A0IA 2A19A 2IT1A 2QGQA 3GTMH 4A3FH 1Q1EA 1Q81C 5C4XG 5M3MH 3HOVG 5C3EG 5C4JH 3KJOA 1CKMA 4NXMQ 3AYHB 3KYHC 3OYYA 4A3KG 1WCMG 2YV5A 3NENA 3F8TA 1VQ4A 2A8VA 1PH3A 2IX0A 3H0GH 4WJ3M 5K36G 1M90C 4DR1Q 1PV4A 3LGJA 4A3BG 4P71A 4RG1A 4NXML 2ES2A 2UU9Q 3GTQH 2QA4A 1G51A 3UDIA 1MKHA 1N34Q 1UWVA 1WOCA 1EIYB 5IYCG 2B63G 3HOZG 3PIOA 2BH8A 1SE8A 1CSQA 1VQAA 3HOUH 3KJPA 1SFOH 1E1TA 3NBHB 4GN3B 4DR1L 3EBEA 1HZCA 4L5QA 4BBRG 2UU9L 2OTLA 3ICEA 1N34L 1GM5A 5IE8A 1E7ZA 4X66Q 2I5LX 1S72A 3ERSX 2VY3A 1PH5A 1Y1WH 4KHZA 3PIPA 3A5UA 1VQ5A 2JA6G 4DR6Q 5IWAQ 3S24A 2JQOA 3RR5A 3BU2A 1O7IA 1QVCA 3MXNB 3JAMc 5GAEC 3M4OH 1NY4A 4BY1G 1GD7A 3CXCA 4DNIA 1XTDA 3FP9A 4XIGS 3BZKA 1W2BA 3K80C 4GNXC 3TEHB 2VW9A 3E9HA 4GLXA 3PGZA 2ATWA 1X3FA 3I2ZA 2ALYB 4IJHA 5IWAL 3CMEA 1I5FA 4IOCA 4LUZA 4B3TQ 4A3MG 4IFDJ 5IYDG 1JE5A 1K83H 4YCVA 3CQZH 4R4CA 3CCJA 4IPGA 4HJ8A 4OWWB 3PO2H 5ELOA 1TWGH 4R4OA 3OW2A 4DR7Q 4YCWA 5JJKA 1KQSA 2D0OA 1RL2A 2R7FA 3W1BA 4PZ8A 2NN6I 3RN2A 4YWKA 4LFCQ 1D8LA 5GAHC 2R6GA 2XGTA 3CW2C 1VQOA 4B3TL 4K0KL 4JI4Q 2R93H 3KOJA 1WJJA 1VQJA 1E24A 1VQFA 2JEAI 2N49A 1FL0A 1PYSB 2BH2A 1Q1BA 2K5VA 1L1OC 1SRUA 2JA9A 1V43A 3AQQA 4X65L 4DR7L 2K75A 4QL5A 3PO3G 1AE2A 3FKIH 3S2HH 1VCIA 3I4MG 3RNUA 5LMNW 5FLMG 3RLFA 4LF7Q 4A3GG 1EQQA 4QGUA 3UDXA 2C35B 4LFCL 3A74A 1HNXQ 2B29A 2Q2IA 1I3QH 5C4XH 3HOVH 4POFA 5C3EH 4JI4L 4O0AA 4GNXB 3D0FA 4A3KH 1SLJA 1WCMH 1NMGA 1X6OA 4DK3C 2OQ0A 1YJNA 4DR5Q 4LF9Q 4DR4Q 2CKZB 1HNXL 4IO9A 1HR0L 1IBMQ 4A3BH 3T1YL 1Q82C 2N3SA 1QUQA 2NVYH 1HNZQ 4KI0A 4A3JG 4DV4Q 3F2CA 4RMFA 5IP9G 3DLLA 1OXSC 5IYCH 2B63H 3HOZH 5E7NA 2KCTA 4JC0A 1Q86C 2I5MX 4DR5L 4GOPC 4LF4Q 2HIXA 4LF9L 2MFIA 4JOIC 1UE6A 4HJ9A 5BR8Q 4DR4L 4AQYQ 1IBML 1WYDA 2Q2HA 3PUZA 3U4VA 4BBRH 1C9OA 2MO1A 1HNZL 4TVAB 5C0XJ 4B3MQ 2WAQE 4HJ7A 1N33Q 2Z6KC 1ASZA 4GLVB 1BKBA 1YVCA 1VQKA 3CD6A 2CQOA 1VQ8A 1C7YA 1HH2P 2JA6H 4LF4L 3TRZA 2Q2TA 1VQHA 1VQMA 2D0PA 1Y1VG 1IYJB 5ELNA
chains in the Genus database with same CATH superfamily
1ZYRC 1RIPA 3QJYA 1TR5A 1QB5D 1N33L 1ENFA 4IJLA 4ALPA 2A6HC 1EZ6A 4DAYA 4CJ2C 3GTGH 4LF8Q 4RKLA 4JV5Q 4LW1A 5KYIA 3K6OA 2CWPA 4CDFC 1P8LA 3BS1A 2M00A 1B9MA 4JYAQ 4GKJL 1WFQA 3BDCA 3P1HA 5EAYA 2LFNA 3Q24A 4MN3A 1I4PA 1E2WA 4LUOA 4UP7A 1IBKQ 4LF8L 3J81c 4C3IG 4JV5L 3GTGB 1YHAA 4QY7A 4JYAL 2CWAA 4BWGB 2N8NA 3SK4A 1NCVA 4R8NA 2EJGC 2UXDQ 1JWUD 5G3LF 3E9IA 1JJ2A 3LX0A 3D31A 1IBKL 3UE1A 4DV0Q 2PNHA 4A3IG 4HR7B 5BN3A 4HCSA 1N36Q 1EUJA 2UXDL 2JE6I 2HDMA 1IXRA 1CHQD 4FXGC 4LNQA 1JICA 2KHJA 5COYA 3L2PA 4DV0L 5FLXL 2E2HH 1QVFA 5EGTA 5EQ0A 2K01A 4POGA 2MJ8A 3D6WA 3CCUA 1N36L 4N8X1 1MI2A 2WAQG 4DV5Q 4K0KQ 5M9OA 1QZHA 2A1AA 1D1IA 2NTTA 3QWNA 4FVMA 4EQ5A 3QB3A 3M4OB 4A75A 1VQPA 3FVQA 3AFQA 2RBMA 5EKLA 5C44G 3M85A 2QDLA 1K3RA 3VR2A 3G48A 4DV5L 4IOAA 3T53B 3TZUA 2ZT9C 1PDQA 2LMCB 3WWVA 1FNWA 3PSIA 5C0XI 3PO2B 2TMPA 2M9VA 4JBMA 1S5BD 4XQQA 1OTCA 1BXTA 1ENAA 1YZ6A 3E0EA 4JI1Q 4DV2Q 3UDFA 5FLXc 1B3AA 2E76C 1VQ9A 5J1ZA 1XXGA 1PZJD 2Q8RE 5IP7H 5H1SE 2PI2A 2XWBB 3HEJA 4JI1L 2QEXA 2F0MA 4LFBQ 1VQGA 4DV2L 4BBSG 3M4QA 3TN2A 2MGSA 1ICWA 1AE3A 4FO2A 4K14A 4PG3A 2PI2E 3EROA 1CZGA 3OHXC 1T5XD 4CJ1B 1B53A 2F4VL 1MSHA 4LFBL 1NR4A 4OXPA 4DXGA 1VQLA 1SMXA 1KNEA 4PZ7A 3RLOA 5JEAG 3A8KE 3MA2B 1RJTA 4DR3Q 2EYOA 1WI5A 1PZKD 4HN7A 3NELA 4JOIA 3GTJH 2L1BA 4C3JG 3C2PA 1CHPD 2GVAA 3CP0A 4IPCA 2GN5A 4KY7A 4RWSC 1WTXA 2R7DA 4DV1Q 1Q12A 2EJFC 4DR3L 2VUMG 2EYFA 2LSSA 2LXJA 5EKIA 4DF7A 3J80i 3HOXH 1PTOF 3DMUA 2ZM6Q 2F0QA 4LWCA 3S9WA 1JOKA 1BF4A 4XQJA 4DV1L 1TKWB 1PFMA 5AJ3Q 4DKAC 4NPSA 4NXNQ 1SAPA 3HOWG 4KHPQ 2EYMA 2ZM6L 2FXQA 3KF8B 1I6HB 3CCQA 5KYLA 4DUYQ 4FF4A 3CCEA 3ULJA 4A3MB 1PFSA 3M7GA 1OXUA 5M5YH 2HT1A 5AJ3L 1EQTA 3S1RH 2L5TA 4NXNL 2EQSA 1OXVA 3EVQA 4AH6A 2FFKB 1C0AA 1AW7A 1PYBA 5GAGC 3S14H 3BZCA 3L3OC 5LMNQ 5A2QL 1NBWA 1ONLA 3IRBA 2NUCA 2NB0A 5AFWA 2QKIC 3CAMA 3W1GA 2ZJRA 1JWMD 4HJ5A 1SN8A 3K81C 3V05A 2KCNA 3MAQA 1A8VA 1P16A 1L0WA 1STAA 2EPBA 3O13A 1LT3D 2RKSA 3K59A 1BBWA 1HUNA 1JOQA 5CGKA 1EEID 3D4RA 1SYDA 3HOYH 4OO1I 5FJ8G 3S15H 2A73B 2NWGA 4HMJA 1D6EC 1K73C 1E3PA 3NPPA 4V0BA 2H4OA 4G7HC 4X3UA 4RGNA 3TP8A 1K0RA 4K5VA 4V190 2ZJQA 1PHJA 2DNCA 3HOYB 2AQ3B 2SNMA 5JOBA 2R92H 1HNWQ 1S5CD 1YJWA 1IL2A 4DAVA 1PTOD 3G6EA 4C1NI 3K58A 1A2UA 1W3SA 4JG2A 1VF5C 1G91A 3SE0A 1HTPA 3K8AA 5EBDA 2Y0SE 1HNWL 1Y1VB 2K5HA 1DOLA 3NTHA 1PH2A 1K8GA 2N88A 2D5DA 3E0JA 2ZTDA 2R92B 1X3QA 5M5WH 1EYCA 3HOUG 1EIFA 3S1QH 5JVH3 2HHHQ 3V96A 4J6HA 4B9WA 3HKZB 5KNDA 2F0JA 4KD4A 2B39A 4KD3A 1VQ6A 3S17H 1CKNA 4DN4M 1Y1WG 1B44D 2BCOA 1B2TA 2JA5H 4ILWA 4X62Q 1S3OA 3NSWA 2HHHL 3BVMA 2XRSD 3S1QB 2PZTA 3CCMA 1WTRA 4C3IB 5I2XA 2VB2X 2XVSA 4QF4A 3EIVA 3TSSA 2XN9C 2MNAA 3ULPA 2JK8A 2EY1A 4Q5VA 4OIKA 4X62L 1TY0A 1Q46A 2Y0SB 4DV7Q 5GADC 1EY7A 1JJCB 3KFUA 4Z9CB 3CCRA 3TP6A 4A3IB 3ITPA 5CC4A 1KRSA 1HA5A 1GO3E 4IFDH 5FOBB 2PQAB 1R4QB 2FJ2A 4JI7Q 2RSNA 1X55A 2B3GA 4DV7L 4G7ZC 2QF7A 4QMGA 1EEFD 3R8BA 2BDNA 1MGSA 1E1OA 1U4MA 1M1KC 4OEMB 3K7UC 2IHEA 2KECA 3LWEA 1SNPA 1F77A 1A0IA 2R3ZA 5DM73 2IT1A 5M3MH 5C3EG 4J8QA 5C4JH 3KJOA 4NXMQ 1SEBD 3AYHB 1WTVA 4A3KG 3NENA 2FHTA 3F8TA 2A8VA 4CDCC 2IX0A 3H0GH 1F9QA 3G6JB 1M90C 4TSSA 2IWHA 1UUPA 4K6DA 2MP1A 4DR1Q 4P71A 4NXML 3GTQH 2QA4A 5M3MB 1B50A 2B63G 3HOZG 2XWJB 1SE8A 1RHPA 3CRKC 1VQAA 1GUSA 2KEEA 4ZYSA 3KJPA 3DWAA 1E1TA 4DR1L 4RHRA 2N55A 2MUYA 1GM5A 1ET9A 5ELFA 3A5UA 3SEBA 1VQ5A 2JA6G 2KVMA 3U9OA 4WORA 1AZPA 4NKLA 2JQOA 3RR5A 1QVCA 1KDBA 3MXNB 5LL6X 2XRQD 3FP9A 3NUCA 5IGEA 5KEEA 4BBSB 3I3CA 3TEHB 2R61A 4GLXA 1MBYA 1LACA 2ATWA 3I2ZA 4RFBA 4B3TQ 1MHWC 1JE5A 1K83H 3R93A 4R4CA 4OWWB 3OW2A 4XT1B 2E2JB 3RUZA 2LKVA 1RL2A 4QUFA 4C3JB 2NN6I 5IGGA 1R9TB 1SNCA 4BS9A 4B3TL 4ULLA 1V1PB 4JI4Q 1VQJA 4G7OC 2WIIB 2BH2A 2JN4A 1Q1BA 3H91A 2ZXRA 2K75A 3FKIH 1QWYA 5C3XA 3OWEB 4LF7Q 4QGUA 2C35B 3A74A 3I73A 1BR9A 4HSVA 4DA2A 4JI4L 5TSSA 1LTGD 4GNXB 1I4XA 1SLJA 1TQOA 4XDXA 3CRLC 2OQ0A 1YJNA 5FO7B 3OOCA 3X3NA 3HOWB 4IO9A 3T1YL 1CZWA 4DV4Q 4RMFA 2LS01 1U4RA 4DNRB 3GTLH 4GOPC 2HIXA 2JYOA 4JOIC 4K8JA 3U4VA 4BBRH 4OGQC 2ICIA 4S3SA 4TVAB 4B3MQ 4HEDA 3T51B 1U9RA 1ASZA 4GLVB 1BKBA 4LK1C 3VR6A 1C7YA 1HTLD 3VYUA 1VQMA 2D0PA 2Z1CA 5ELBA 2KOLA 1CM9A 1SYFA 1TXYA 1LLRD 4QJFA 1YI2A 1Z9FA 3JAMi 1EQVA 4DXFA 5FO8B 1XMOQ 2F0HA 4ZUIA 4B9XA 2BA0A 3T1HL 1WTQA 3K0XA 5IP7G 3P75A 2VQEQ 4DV6Q 1YNJD 2NZOA 3OTOQ 3M3YB 2O5IC 3GTMB 1FYCA 2Z4IA 1XMOL 2HDLA 1PH7A 3HP3A 3IFDA 2H1EA 2NVTH 1CT1D 2NVXH 5EJWA 3PO3H 4DK0A 2VQEL 4DV6L 2EY6A 3OTOL 3I4MH 4ZAIA 3S1NH 4PQXA 2RDFA 3DWQA 3CCVA 3EN2A 5ELCA 2KQ3A 3W5OA 4APVA 1SNQA 3HOZB 4HAEA 4RH6A 1EY4A 3JC66 2NVTB 2NVXB 2KBNA 1KAAA 4XTCS 2KEDA 1A63A 1U4PA 3C1EA 3N52A 4L5TA 4JI5Q 3I4MB 4K2LA 1KRTA 1FGBD 1A62A 1S5ED 3TREA 3DEPA 4A3JH 4IUUA 5CV9A 3HOXG 1DXMA 4L8JA 2J0TD 1IHZA 3DWPA 1K0SA 1Y1WB 4Y52H 1UE1A 3IL8A 3K5NA 2EE1A 4JI5L 1ENCA 1LTAD 2B2WC 4JVZA 1NTGA 3P20A 4JK1C 1MIUA 5IT9L 3NE5B 1X54A 4XYQA 3J81j 4A3JB 1HPCA 2VQFQ 3ND9A 3RLNA 3OW7A 1SMYD 3PCOB 1SSOA 2I0QA 3J7YW 1HR0Q 1L2FA 3S2DH 3GD7A 4PMWA 2PMZE 4P75A 5DNFA 2VQFL 1EY6A 1X3EA 1EWIA 5JPMC 3B6YA 4IUNA 2BE5C 1RTNA 4PMBA 1PMRA 1SDFA 1BCPF 1TWCH 5GQOA 3DXJC 3J80E 3S2HB 1E22A 2UXBL 2LXKA 1PTOC 4H44C 1L0XB 2F3WA 3I4NH 2ZJPA 1LTRD 1GUWA 3HFZB 4FYDA 1UE5A 3GTKH 4RKBA 1KL9A 3HOYG 4KHVA 1GKHA 3NWTA 4RA8A 4A3KB 5IT9c 4BXXH 1PH1A 2HUGA 3D3RA 4HIKA 3A7AB 4JPBW 2Z6BA 1TWCB 4CDDC 1L1OB 3GV3A 5I6YA 5A35A 5ELEA 2XSCA 4CGYB 4IPDA 3H09A 2L55A 4YY3Q 2B63B 4LJZC 3GTKB 3L0OA 1YJ9A 3BYTB 2R92G 1A2TA 1F2ZA 3A0JA 4GKJQ 4L5RC 3NBHA 4H13C 5CBEE 1F2MA 1W6KA 1WTPA 3HKZG 3K57A 4YY3L 5KNBA 4RCNA 4LF5Q 1S4ZA 1IYUA 2X6LA 4MTNA 4MNOA 2JA6B 1GUOA 3CC7A 1E2VA 3HGBA 4ZKBB 4X6AH 4H02A 5ELNA 4TRDA 1QUQB 1SYBA 1B1ZA 4LF5L 4GN5A 3Q8DA 5T1GA 2R7ZH 1K8MA 2JJQA 3CC4A 5EBCA 4DR2Q 1EIGA 1H95A 2JA5G 2GVBA 2Y0SG 4DV3L 2OQKA 1SJHD 4KKUA 1BNZA 2I5HA 5FKAC 1PH9A 1K8OA 4J1MA 4JW0A 5DM63 3SDZA 3J7ZC 1BCPD 4DR2L 4YCUA 1WD0A 2ASBA 3GTPH 1EWHA 4TKOB 1NUCA 3M9BA 1X3GA 1U0LA 2SEBD 2IW3A 3MFYA 1YEZA 4NDXA 4C1NK 2NVQH 1DONA 1G8ZD 4DAYB 5CV8A 2K4KA 5C4HA 1XNRQ 5JPNC 2E2DC 1DGSA 2J4XA 4LF6Q 1EYGA 1V9PA 2JSOA 4IFDG 5GROA 4NB3A 2OTJA 1SNMA 4HIOA 5IOCA 1CKOA 3GTPB 2Q2UA 3I7FA 2VS1A 3MFGA 3K5MA 4OIJA 2E2HB 2RHQB 4A93H 2A74C 1XNRL 4M8AA 3AU7A 3NQIA 4JBJA 4LF6L 4X66L 1QILA 1OO9B 2AHOB 3TP7A 3BJUA 1PA6A 4BY7H 2PW5A 5M3MG 5J3BA 3OMCA 4DR6L 1ZEQX 4OELB 5CV5A 2ZTEA 3STBD 2WP8J 4O1NA 4C3HH 4IUPA 3QOLA 1UEBA 1VQNA 2F3IA 3WOFA 2KCMA 2CH4W 3H0GG 3SHLA 1XJVA 4F8MA 1I4QA 2CFMA 4A93B 2CQAA 1DJRD 2HCIA 2PQEA 2AQ1B 2IHFA 4XT3B 3KLWA 4EX5A 3M7NA 2PW7A 4BY7B 1PRTF 2F4VQ 3I70A 4OL7A 4A4IA 2FMCA 4I65A 3QR8A 1KC8C 1BCPB 4C3HB 4LFAQ 1QNUA 3VYRA 3VR5A 5K5PA 2EY5A 1BBXC 3L9AX 1KLUD 1STNA 1AP0A 2K05A 2PPBC 2MO0A 4LFAL 1X65A 3HG9A 3VR3A 1CTMA 5CBAE 2KENA 4MZ9A 1EYAA 3U50C 4GOPA 3ZJYC 2E5LQ 2AKWB 3PUYA 2K50A 2UUCQ 2A69D 2Z8LA 4FP5D 1JB7A 4KN4C 4BA1I 3H3VC 3KLSX 4UPAA 2E5LL 1AH9A 3CPWA 1KXLA 2UUCL 3GTJB 1YHQA 1ASYA 3CKIB 1TT2A 4ZCKA 1G2SA 4A3DH 3K5LA 1STYA 2KJXA 4AQYL 5IYBH 1MJEA 3FKIG 1N9WA 3HOXB 4K6LA 4KN7C 2QGQA 4A3FH 1CKMA 3KYHC 1D2BA 3OYYA 1M4VA 2YV5A 4KMUC 2B2VC 1QE6A 4N9TA 4U673 1PH3A 3V2TA 3Q0AA 3TZDA 2F0FA 1PV4A 3LGJA 4RG1A 2A68D 1PRTD 2ES2A 4WRDA 1G51A 3GV6A 3T56B 2G9HD 1X32A 5M5YB 4IUQA 5I6WA 3S1RB 1SFOH 2K6AA 2DY7A 2F0SA 4GN3B 3EBEA 4L5QA 4BBRG 4ZRZA 4KK7A 1K3BC 1YNJC 3I91A 3S14B 1BDOA 3ICEA 5C5LA 3FEWX 1E7ZA 5IE8A 3ERSX 2VY3A 5CYUA 2K33A 4IQZA 4L6TB 1H9SA 2B2TC 4R9WA 1O7IA 4MIUA 5GAEC 5C0XH 1GD7A 1NR2A 3CXCA 3R2IA 5D3IB 3BZKA 4IZ8A 1RD9D 2NTSA 2WKDA 4IJHA 3CMEA 2L9HA 1LV9A 4LUZA 2B2WA 3S15B 4IFDJ 3CCJA 4I7AA 3CQZH 3ERQA 1TWGH 4R4OA 1QJOA 1ZXTA 5CV4A 4YCWA 2IX3A 2D0OA 1GUNA 3W1BA 4FF2A 1TIID 2RSOA 1AFPA 2R6GA 3J7AF 2R93H 1VQFA 2Z4HA 2N49A 1FL0A 1PRTB 3AQQA 1L1OC 1SRUA 1DD2A 4X65L 3J81E 1HXYD 1BOSA 3PO3G 1CK1A 4H0LC 3I4MG 3RNUA 3OIQA 4NP5A 1S5FD 1EQQA 1DCZA 1FR3A 1HNXQ 1I3QH 3HOVH 4POFA 2K5QA 1QCBD 2SNSA 1C8CA 1WCMH 2R93B 1LT6D 4DAPA 4DR4Q 5M5WB 5K36H 1IW7D 1X3PA 1HNXL 4A3BH 1SMYC 1STBA 1HNZQ 3JAME 4A3JG 3HS0C 3F2CA 3DLLA 5J22A 1WTOA 3S17B 1ZYRD 5E7NA 4JC0A 2F1MA 2I5MX 4DR4L 3Q22A 1WCMB 2MFIA 5JAVA 4HJ9A 2JA5B 5BR8Q 1EU4A 4UAIA 1WYDA 3PUZA 1FNVA 2EYJA 1HNZL 2WAQE 4XQNA 4HJ7A 2Z6KC 1SYCA 1YVCA 1I4RA 2PYKA 4K8IA 3WOEA 1CQFA 1VQKA 1HH2P 1NAPA 3J7AV 4RAUC 5BR8L 1IYJB 1JQYD 3D8GA 1HHVA 3IKJA 3CCLA 4DAMA 4BY1H 3DM3A 1XPUA 1HUMA 1G291 4HSPA 1VQ7A 1RKNA 5LMUQ 2B2UC 1EY9A 2Q8TA 3J80L 5DEHA 4EQPA 2QILA 3Q6SA 1TWFH 1Z47A 3LWUA 2UXCQ 2BA1A 2J7ZA 1I50H 4JBKA 1NMFA 4PMCA 1F2YA 3VDYA 1J9OA 5IYDH 1VQIA 5LMUL 5J39A 4BY1B 4L5SA 3MXNA 3RMHA 3I55A 3F1ZA 1Q3LA 1F9SA 3SK5A 2UXCL 3I4NG 4JI3Q 4TQUS 5C4JB 2KA7A 1TWFB 4OO1H 2HQLA 3PF4A 4BXXG 2IPKD 3QIAA 2EXDA 3GQBA 3KUPA 3H3VI 1B8AA 3H0GB 4A3GH 5C3WA 3RZDH 1B4OA 3BVZA 4JI3L 4HIMA 1V1QA 3MEFA 4P74A 2YU9H 3SR1A 3GTQB 3TQYA 1PYWD 3SGIA 3J80c 4YWLA 4GKKQ 1V1PA 4UY8C 3CHBD 1Q7YC 3SXHA 1CA6A 4A3GB 5KIXA 1EY8A 1TS5A 1KD1C 2WV6D 5IP9H 2YU9B 5IIFA 2DGYA 4GKKL 4ZUJA 2AWNA 4F88A 5HGQA 1BCPC 4DGZA 3KDFB 1VQCA 3CC2A 1KHIA 5IGCA 1W6JA 1SR3A 5KGUA 1RF2D 1J5EL 3G4SA 3LNNA 1F2LA 4AIMA 4JI0Q 1TWAH 1EQRA 2R7ZG 1A3UA 1SJED 4MTKA 3MWYW 1C48A 1GUGA 1K83B 3GP7A 3KF6A 2M2LA 1LTBD 1I6VC 2MQHA 3NBIA 5HY6A 4O42A 4A3EH 2K5WA 5IGFA 4JI0L 1FVIA 3T1YQ 2B8FA 1U5KA 1DYQA 4NMZA 1TWHH 3NHHA 4BA2I 2E2IH 1E0BA 3A54A 4QCLA 3STBC 4F87A 5M3FH 2MHVA 1X56A 1GXDC 1I94Q 3FKIB 2EVBA 1EFID 2K5DA 3PUVA 1FGUA 4ZKCB 4UP8A 4KKTA 3A7LA 3UE0A 2Z9HA 1N32Q 1B7YB 1TWHB 2EOTA 2WB1E 1BO0A 1PH8A 1I94L 3J81i 4P73A 1FJGQ 4A93G 4WJ4A 3G71A 2RCFA 1N32L 1I4HA 4BY7G 2F03A 3PV0A 3I4LA 5M5XH 2AMCB 1A6XA 3GTLB 2JA8H 2F4IA 2XNAC 3N6RA 3T1HQ 4C3HG 1FJGL 4BBRB 1PH4A 1SNOA 1LTSD 1T9HA 2IJ0A 5C6AA 5A2QE 1HA6A 4KJOA 4R1JA 5CMDA 1SROA 1EFWA 4ID6A 4ZQ3A 2A69C 4FF3A 2I46A 1HZAA 1B9NA 2PCFB 2KUMA 3SK6A 2EY2A 3H6MA 2B2VA 4HJAA 1HQMC 1FNUA 1SE4A 3FPUB 3KBGA 1J6QA 1VMPA 4EGVA 1M8AA 2TSSA 1JC7A 4QIWE 4P72A 4JI6L 3A56A 3FDTA 2HQEA 5F2DA 2F0WA 1SYEA 2YYZA 1QZGA 4R4IA 3NTIA 1CQVA 1YNXA 2F0OA 3AFPA 2AWOA 3OSOA 2HIVA 3UI2A 3GTOH 4PZ6A 1OXTA 3BDOA 3PO3B 2K03A 5BN4A 4J15A 1F9RA 1PZID 3S1NB 2HD3A 4OWXB 4A3LH 2IX1A 1VDZA 1ICFB 2B2TA 4UHVA 2F0EA 2VZAA 1O80A 1G6ZA 4HTHA 1Y14B 2NN6H 2A68C 3U9SA 3SK8A 2C9OA 1EOVA 3RZOH 2AUJD 4A3DG 3BVGA 1B70B 3AB9A 5CR3A 3R3OA 2XTIA 3M4PA 5IYBG 4YIJA 1R4PB 4CDEC 5DAUA 4A3FG 1C4QA 1LTTD 3NXWA 1XPRA 1SBBB 4AYBE 1Z6HA 2B8GA 2B2YC 4YWMA 1QOHA 2UXBQ 1L1OA 3AMUA 4FXKC 4RGTA 2RF4A 1Q90A 2YTYA 2BDOA 5JJZA 2EXZA 3F2UA 3NTKA 3TDQA 2K14A 1JORA 2G5DA 4MHEA 4IPHA 4OHJA 1EU3A 2JA7H 5D65A 4EQOA 2H5XA 2X69A 4JBWA 1HRJA 1XX8A 2AUKA 4C2MH 3NEMA 3S2DB 2IY5B 2CW0D 2JEBI 4B3RQ 1YHBA 1SYGA 1ILQA 2O4XA 2CVRA 1AN8A 5C0XG 3FMCA 2YTVA 2D62A 4IN3A 4B3RL 3I4NB 4C2MB 2WKCA 4XYOA 4A3CH 1ML0D 4RGMA 5EPKA 4K5XA 2SOBA 3D4DA 1YIJA 2Z6KA 2PMZB 2KHIA 1K9MC 1IW7C 1E2ZA 5L37A 4FXDA 3NK9A 1KDCA 2CH4A 2B2UA 2F0DA 4CBVA 1JT8A 3KBXA 2R93G 5DLQE 3IAYA 3NWSA 5KNCA 2JP1A 3H15A 3D4WA 4DV3Q 1XPOA 2GA4B 1Q8IA 5E3FA 1G2TA 1U4LA 1BBUA 3T4AC 2EDGA 2K04A 2RVLA 1Q81C 3HOVG 3JAML 4X3KA 2D9UA 4XXEA 4PNYA 1WCMG 4QB4A 1VQ4A 4K5WA 4WJ3M 5K36G 2V4DA 3QG1A 4A3BG 4IALA 2FINB 2K28A 2R7ZB 1H9KA 1MKHA 1UWVA 1WOCA 1LABA 4F7XA 2BH8A 4Q0FA 5FO9B 3NBHB 2L4NA 1DZ1A 3DM1A 5D14A 4N9PA 4X66Q 2I5LX 1S72A 4KHZA 2F0VA 4DR6Q 3S24A 1WD1A 3I90A 3JAMc 3M4OH 1NY4A 4BY1G 5KRUA 3X3MA 3HZXA 2ZXPA 4DNIA 1XTDA 1II3A 2NVQB 3K80C 4GNXC 4M1UB 3E9HA 3NQTA 3PGZA 1JWSD 1GHJA 2ALYB 4IOCA 3E6ZX 4DU9A 5IYDG 1RCVD 1PXUA 4IPGA 3MTSA 4HJ8A 3PO2H 3KLRA 5ELOA 4FNFA 4DR7Q 1NSNS 1KQSA 1WTHA 2IL8A 2R7FA 4PZ8A 2NZ1D 5EPJA 4IUVA 1H9JA 1VQOA 4K0KL 2FMMA 2EYPA 5D3DA 1UAPA 1WJJA 2JEAI 4OO1G 1PYSB 1LT4D 2K5VA 2JA9A 1V43A 4C56C 3T16A 4DR7L 1JOOA 5C4ZA 3TMEA 3RLFA 4A3GG 1CI3M 2Q2IA 5C4XH 4KY5A 2EYHA 3VR4A 4O0AA 3QOJA 1JE4A 1JCKB 4DR5Q 1O7LA 4LF9Q 1EOTA 1IBMQ 4G4KA 1Q82C 2NVYH 4KI0A 3CU7A 5C4XB 1YNND 3KF8A 5IP9G 5IYCH 1JB3A 4ZLTF 4DR5L 4LF9L 2F0KA 3QO2A 1UE6A 4AQYQ 1IBML 4RHSA 2Q2HA 1C9OA 5C0XJ 1RODA 2SDFA 1GHKA 2NVYB 4CJ0B 3A8IE 4DK1A 3MVVA 2CQOA 1Y8NB 1UEAB 1VQ8A 3H94A 3TRZA 2Q2TA 4DFAA 2KCCA 2DNEA 1BQQT 2A6ED 2DUDA 4R8IA 2OXPA 4A3EG 1XNQQ 4R4TA 1PVOA 1I6HH 5I9OA 5NUCA 3URYA 1Y8PB 4JCVE 4A3MH 1EWCA 3S16H 3T13A 4A3DB 2NBFA 1YITA 2OEOA 1XMQQ 1D7QA 3CPFA 2K32A 5M3FG 1XNQL 4GOPB 3J7A5 2RQXA 1LO5D 4O2DA 3MXPA 2RCNA 4X64Q 4A3FB 5CV7A 3UDGA 4IFDI 3FPPA 2RHSB 1F9PA 2VL6A 4ODGA 1IYVA 4HCEA 3GO5A 1XMQL 4DNTB 2KHSA 3S16B 3DEOA 5CV6A 2OWOA 1O7YA 3W3AA 2E8GA 3PIO3 1Q8KA 5FLMH 4QUCA 3MZ5A 4KHPL 3C3LA 2VNUD 4X64L 5IT9E 1JJGA 2N78A 4DUYL 3K7AH 1V8QA 4WFN3 2RDGA 3EJIA 1WVLA 5HURA 5I9PA 1KNAA 3PIP3 2JA8G 1SFOB 2WB1G 3MXUA 1VS0A 2F52A 2L11A 1NJIC 2L12A 5LMNL 5IGBA 3I72A 2DJFC 4EQNA 4CKCA 2K7VA 3BZDB 1CSPA 3K7AB 1QG7A 3VA5A 5CORA 1VQBA 3VYTA 1YBYA 2NYZD 4X65Q 2F0IA 3HKZE 5T1IA 1ET6A 1PH6A 4KJNA 4UP9A 2CCZA 3AEVA 2B2YA 1HCZA 1XWEA 5C5MA 1QVGA 1K28A 2AQ2B 3A8JE 1X9NA 1D1KA 1Y1VH 2P5ZX 4LUVA 3VA7A 2BE5D 1EY5A 3K0YA 1N8RC 4GN4B 1OXXK 3CQZB 4IUTA 1GVPA 1CFMA 4RGOS 5ISRA 1TWGB 3S1MH 1LT5D 4X3TA 5I4DA 1T5EA 2K52A 2RDHA 1STHA 3G7LA 1EL0A 3MC0B 1H9SB 1Y69U 2PQAA 3C46A 3RN5A 5LHY1 2PO4A 1JMCA 1ILPA 2F0LA 4K2KA 3S1MB 4A3LG 4C3IH 1I3QB 1XTCD 3HOVB 4A76A 3U4ZA 2NN6G 3TS0A 5IODA 4ZK9B 1SE2A 5LL6S 3CCSA 1O7ZA 4G57A 2I07B 1KAWA 4OONA 2A6HD 4A3BB 4A3IH 2NZHA 2E74C 1EYDA 3I56A 3OIPA 3TS2A 1PTOH 4YHHQ 2Z0SA 5EPLA 5BN5A 4KKSA 2CW0C 1IKLA 1A15A 3HKSA 1HQRD 2QEJC 2ICEC 3L7ZC 4OX9Q 4LAAA 1O78A 1EIHA 5JEAJ 4YHHL 1TVXA 1CKNB 2OT2A 2PZWA 1HFNA 1PTOB 1XYIA 1IZ6A 1HZ9A 1HFGA 2QW7A 4OX9L 5FLXE 4AYBG 1Z7TA 1A3VA 4GLAC 3F2DA 1HR0W 5C44H 2JA7G 3PMFA 1VQEA 2CHBD 4FDBA 2G9DA 1TS2A 4KY6A 2WAQB 4JI7L 1I50B 5JJIA 2L15A 1KIXA 4OWTB 3KDFA 1G6PA 3F2BA 1A3TA 1KDAA 3ZYYX 5E1FA 5C44B 3M4YA 1LTLA 4H7BA 3CMAA 1FD7D 4CKEA 2V1CC 1WTWA 3FHWA 4A3CG 3BYYB 3OPOA 4HIDA 2QCPX 3FRPB 4R4QA 3GDEA 1IBLQ 1EZ8A 3RZDB 1HZBA 1LUZA 4UDUC 1DOKA 1J5EQ 4BBSH 4IURA 1MD2D 3PUXA 2C5CA 3PUWA 2WFWA 4JI8Q 1IL8A 2DJGC 5IGDA 4GNXA 1K8AC 1DM0B 1RDPD 1VQDA 4GS3A 1IBLL 2PZUA 5JEAH 1PLFA 2E2JH 3E3XA 1KLGD 4Y7NH 4RCOA 5E4XA 1BVSA 4C3JH 4DK6C 3NP8A 5JVG3 1R9TH 4JI8L 3OMGA 1VMCA 3TP5A 2MPMA 2VB3X 2ZTCA 3TBIB 4JI2Q 3PF5A 2VUMH 1D5XC 2LY7A 2DN8A 2EIFA 3C1FA 1VF7A 1UE7A 4Y7NB 1CUKA 5JJLA 4QQBX 2VXWA 1TWAB 3VYSA 3ND8A 4JI2L 3A5ZB 1D5ZC 2UUAQ 3KLSA 2BOSA 3HRZC 3HOWH 4CKBA 1ESFA 2VUMB 4A3EB 2F0UA 4B3SQ 1S5DD 1TU2B 1HJPA 2UUBQ 2UUAL 3MXGA 2F0TA 2E2IB 2DY8A 3I8ZA 1PFBA 5M3FB 4B3SL 3CF5A 3Q23A 4LF7L 1IKMA 4DPGA 1STEA 3ER0A 2UUBL 3I4OA 2K1BA 4KLKA 5E4WC 1MSGA 3EQLC 3KF6B 3U58A 2YTXA 4DUZQ 2K5NA 1LTID 3PO2G 1LYLA 5IY0A 4ME3A 1LM0A 2OCEA 3BG3A 5ELDA 1AZQA 1MJCA 4DV4L 1CA5A 4GZYC 2E75C 5FJ8H 2QDBA 4EVOA 1ESRA 1S40A 1YNNC 1QNKA 4DUZL 5M5XB 2ID0A 1KTKA 3RD4A 4U68A 2JA8B 4JI6Q 1BUVT 2WB1B 1TS3A 1NE3A 3M3YH 3H3VH 4B3ML 1JR0D 2A19A 3GTMH 1Q1EA 5C4XG 2WACA 1V1OA 3E5SA 4CHTB 4NW2A 3MEHA 2F0GA 3K5OA 1DOMA 2PNRC 1SE3A 3D6CA 2A6EC 1GOZA 2UU9Q 3UDIA 1N34Q 2HCCA 1B3QA 1EIYB 5IYCG 2RA4A 3PIOA 1CSQA 2ZXOA 3HOUH 3R2TA 3SVMA 2D2CC 1HZCA 4N8FA 4KV6A 2UU9L 2OTLA 1H9RA 2EZVA 1N34L 2Q8IB 1PRTC 1PFNA 1SNDA 1PH5A 1Y1WH 3PIPA 5EKKA 5IWAQ 3PQIA 3GTOB 1KABA 2F0PA 3BU2A 2XIWA 4I7ZC 3HOUB 2ENBA 4QIWB 2F0NA 4XIGS 5I2YA 1W2BA 2VW9A 1X3FA 4KTAA 5IWAL 1I5FA 1NNXA 4PV1C 4A3MG 3RZOB 4L63B 4YCVA 4ME5A 1TY2A 2X6GA 5JJKA 1Y8OB 3A55A 4WJWA 3WDNA 2O5JC 3EA6A 4YWKA 4LFCQ 1D8LA 5GAHC 2XGTA 3CW2C 3KOJA 3OWFA 1E24A 4E6IA 4X3SA 5HGTA 4QL5A 1AE2A 1SXTA 4P2CB 3S2HH 1VCIA 1D5MC 5LMNW 5FLMG 3UDXA 5FK9C 4LFCL 2B29A 4B08A 1STGA 5C3EH 3MHBA 1J8IA 3KK7A 3D0FA 4A3KH 1X6OA 1NMGA 4ABNA 4DK3C 4AYBB 1ZKOA 3DUZA 2A5HA 2JA7B 2CKZB 3DHQA 1HR0L 1L0YB 2F3VA 2N3SA 1QUQA 1TS4A 2EYLA 5C3EB 1OXSC 2B63H 3HOZH 2WINB 3IFTA 1EY0A 3BDLA 2KCTA 1Q86C 4LF4Q 4FF1A 3EFXD 1I4GA 2OF1A 1UNSA 3J81L 4HMIA 1H9MA 2O2LD 2MO1A 3ONAB 1GJXA 1N33Q 1RTOA 2L0CA 3CD6A 1GUTA 5G3LD 4LF4L 2EJMA 2JA6H 4LMQD 1VQHA 2JXMB 3W2DA 3ULLA 1Y1VG 3RN2A 1AEXA 3P7JA
chains in the Genus database with same CATH topology
3CCLA 4DAMA 1RIPA 3DM3A 4BY1H 1XPUA 1G291 1VQ7A 1TXYA 2DUDA 5LMUQ 1N33L 4IJLA 4QJFA 4A3EG 4ALPA 1XNQQ 1YI2A 4R4TA 1Z9FA 3GTGH 1I6HH 1PVOA 1TWFH 1Z47A 2UXCQ 2BA1A 3JAMi 4LF8Q 4A3MH 4JCVE 1I50H 1XMOQ 1NMFA 4LW1A 3VDYA 4JBKA 3S16H 4JV5Q 5IYDH 1VQIA 1YITA 2CWPA 1P8LA 4JYAQ 2BA0A 3T1HL 1XMQQ 5LMUL 1WFQA 4GKJL 1D7QA 3K0XA 5IP7G 5EAYA 4L5SA 2VQEQ 3CPFA 2NZOA 5M3FG 3OTOQ 4DV6Q 1XNQL 4GOPB 3J7A5 3I55A 3F1ZA 4LUOA 4O2DA 4UP7A 1IBKQ 2RCNA 4X64Q 4LF8L 3I4NG 3J81c 3UDGA 4JI3Q 4IFDI 1XMOL 4JV5L 2RHSB 4TQUS 1PH7A 1YHAA 2VL6A 4QY7A 4JYAL 2CWAA 3GO5A 1XMQL 2HQLA 2N8NA 2NVXH 2NVTH 3PF4A 4BXXG 2OWOA 3PO3H 2VQEL 4DV6L 2UXDQ 3OTOL 3E9IA 2EXDA 3H3VI 3I4MH 2E8GA 1B8AA 1Q8KA 3S1NH 5FLMH 4A3GH 1JJ2A 4KHPL 3RZDH 3D31A 1IBKL 4X64L 2VNUD 3UE1A 4JI3L 3CCVA 2PNHA 4DV0Q 1V1QA 4HIMA 4A3IG 3MEFA 4P74A 2YU9H 1JJGA 2N78A 4DUYL 3EN2A 3K7AH 3TQYA 3SGIA 1N36Q 3W5OA 3J80c 1EUJA 4APVA 4OO1G 2UXDL 2JE6I 4YWLA 4GKKQ 1IXRA 3JC66 4LNQA 2JA8G 2KBNA 4XTCS 4UY8C 1A63A 2KHJA 3L2PA 1Q7YC 4L5TA 4DV0L 2E2HH 2WB1G 4JI5Q 1VS0A 2F52A 1QVFA 1KRTA 1NJIC 1A62A 3TREA 4A3JH 5LMNL 4POGA 3HOXG 1KD1C 3CCUA 1N36L 5IP9H 2WAQG 4DV5Q 4K0KQ 2DGYA 4GKKL 1CSPA 2AWNA 1QZHA 2A1AA 1UE1A 4Y52H 5HGQA 1VQBA 3KDFB 1VQCA 4EQ5A 1YBYA 3CC2A 1KHIA 4JI5L 4X65Q 4A75A 1VQPA 1SR3A 3HKZE 3AFQA 1PH6A 3AEVA 4UP9A 2CCZA 5BR8L 1J5EL 5C44G 3M85A 1K3RA 3G4SA 1NTGA 3G48A 1MIUA 4DV5L 4AIMA 4JI0Q 1X54A 3J81j 1QVGA 4IOAA 1TWAH 1EQRA 2R7ZG 1X9NA 1Y1VH 3WWVA 4LUVA 1N8RC 2VQFQ 4GN4B 1OXXK 3KF6A 3PSIA 5C0XI 1GVPA 3GTLH 2MQHA 5HY6A 3RLNA 4JBMA 3S1MH 4A3EH 3PCOB 1OTCA 2I0QA 4JI1Q 1YZ6A 3E0EA 1L2FA 2K52A 1HR0Q 4JI0L 1FVIA 3T1YQ 3S2DH 3GD7A 4PMWA 4DV2Q 3UDFA 5FLXc 1U5KA 2PMZE 4P75A 1TWHH 2VQFL 4BA2I 1VQ9A 1X3EA 1EWIA 2PQAA 3B6YA 2E2IH 3RN5A 1TWCH 3STBC 5IP7H 1JMCA 5GQOA 5M3FH 5H1SE 2PI2A 1X56A 1I94Q 4JI1L 1E22A 2QEXA 4LFBQ 1VQGA 2UXBL 2LXKA 4A3LG 4DV2L 3PUVA 1FGUA 2ZJPA 3I4NH 4C3IH 4BBSG 3M4QA 3HFZB 4UP8A 4A76A 1UE5A 3GTKH 3UE0A 1KL9A 3U4ZA 1AE3A 2NN6G 4PG3A 3HOYG 2PI2E 3TS0A 1N32Q 2F4VL 1B7YB 1GKHA 5IT9c 4BXXH 2WB1E 1PH1A 1PH8A 3CCSA 4HIKA 1I94L 4LFBL 4OXPA 1KAWA 1SMXA 4PZ7A 4OONA 1L1OB 3RLOA 5JEAG 3J81i 1VQLA 4P73A 1FJGQ 4DR3Q 4A3IH 2NZHA 4A93G 4WJ4A 3I56A 1WI5A 3TS2A 3NELA 3G71A 4JOIA 3GTJH 4IPDA 4YHHQ 1N32L 2Z0SA 4YY3Q 4BY7G 2GVAA 3PV0A 5M5XH 3CP0A 2AMCB 3HKSA 3L0OA 4IPCA 2GN5A 2JA8H 1YJ9A 2R92G 2R7DA 4DV1Q 3A0JA 3T1HQ 3L7ZC 4GKJQ 4OX9Q 1Q12A 4DR3L 4L5RC 1FJGL 2VUMG 1PH4A 1T9HA 2LSSA 2LXJA 3J80i 5JEAJ 3HOXH 4YHHL 3HKZG 4YY3L 2ZM6Q 1CKNB 4LF5Q 4R1JA 1SROA 4LWCA 4MTNA 4MNOA 1EFWA 1IZ6A 3CC7A 1HZ9A 4DV1L 4X6AH 4OX9L 5AJ3Q 4AYBG 4H02A 1HZAA 4GLAC 4DKAC 4NPSA 3F2DA 4NXNQ 1HR0W 5C44H 3HOWG 2JA7G 4KHPQ 1QUQB 2ZM6L 2FXQA 4LF5L 4GN5A 1VQEA 4FDBA 3Q8DA 3KF8B 4HJAA 3CCQA 2R7ZH 4DUYQ 2JJQA 3CCEA 3ULJA 4JI7L 1J6QA 3CC4A 1PFSA 5JJIA 1OXUA 5M5YH 2HT1A 5AJ3L 4DR2Q 4QIWE 4P72A 4JI6L 1H95A 3S1RH 2JA5G 4NXNL 2GVBA 2L15A 2Y0SG 4DV3L 2EQSA 1OXVA 2OQKA 3KDFA 4OWTB 4AH6A 1KIXA 1C0AA 3F2BA 1G6PA 1PYBA 2I5HA 2YYZA 1QZGA 1PH9A 4R4IA 5GAGC 3CMAA 1LTLA 3BZCA 3S14H 5LMNQ 1NBWA 1YNXA 2V1CC 3IRBA 3J7ZC 3AFPA 3FHWA 2AWOA 3CAMA 3W1GA 2ZJRA 4A3CG 4HJ5A 1SN8A 4YCUA 3K81C 2HIVA 4DR2L 2ASBA 3GTPH 3GTOH 4PZ6A 4HIDA 1A8VA 1OXTA 1P16A 1L0WA 3M9BA 4J15A 4R4QA 3GDEA 1X3GA 1IBLQ 1U0LA 4OWXB 1YEZA 4A3LH 2IX1A 2NVQH 1HZBA 1LUZA 4BBSH 4DAYB 1J5EQ 2K4KA 1BBWA 2VZAA 1XNRQ 3PUXA 1DGSA 1Y14B 3PUWA 4LF6Q 3HOYH 4OO1I 5FJ8G 1V9PA 1EYGA 4IFDG 2WFWA 5GROA 4NB3A 1EOVA 4JI8Q 3RZOH 4GNXA 4HIOA 1K8AC 3S15H 2OTJA 1VQDA 1CKOA 4GS3A 2Q2UA 1IBLL 4A3DG 1B70B 3I7FA 2VS1A 1K73C 1E3PA 2XTIA 2RHQB 3M4PA 5IYBG 2E2JH 4A93H 1XNRL 4Y7NH 1BVSA 4C3JH 4JBJA 4DK6C 4LF6L 4X66L 2AHOB 1R9TH 1PA6A 1K0RA 3BJUA 4A3FG 4JI8L 4BY7H 1XPRA 5M3MG 4AYBE 5J3BA 1PHJA 2ZJQA 4DR6L 2ZTCA 2ZTEA 3STBD 2WP8J 2R92H 1HNWQ 1YJWA 1IL2A 4C3HH 4JI2Q 3PF5A 1UEBA 4YWMA 1VQNA 2VUMH 2F3IA 3G6EA 2KCMA 2EIFA 3H0GG 1XJVA 1W3SA 4JG2A 2UXBQ 1L1OA 2CFMA 1UE7A 1CUKA 5JJLA 4QQBX 2RF4A 2YTYA 3K8AA 2IHFA 2Y0SE 1HNWL 3KLWA 4EX5A 3M7NA 2K5HA 1K8GA 1PH2A 2K14A 3A5ZB 4JI2L 2F4VQ 4A4IA 2UUAQ 2ZTDA 5M5WH 1KC8C 4IPHA 4LFAQ 3HOWH 3HOUG 1EIFA 2JA7H 3S1QH 2H5XA 4B3SQ 4JBWA 2HHHQ 4C2MH 3NEMA 1HJPA 2IY5B 2JEBI 2UUBQ 1YHBA 4B3RQ 1VQ6A 3S17H 1CKNA 2UUAL 1Y1WG 2JA5H 2MO0A 4LFAL 1X65A 4X62Q 2KENA 1S3OA 3ULLA 3CF5A 2HHHL 5C0XG 4B3SL 4MZ9A 4LF7L 3U50C 2YTVA 2D62A 3CCMA 4DPGA 4GOPA 3ER0A 3ZJYC 2E5LQ 2AKWB 2UUBL 4B3RL 3I4OA 3PUYA 4A3CH 2K50A 4KLKA 2UUCQ 2UXCL 3EIVA 3ULPA 2MNAA 1JB7A 2JK8A 1YIJA 3KF6B 2Z6KA 3U58A 4BA1I 2YTXA 4X62L 2K5NA 4DUZQ 1Q46A 4DV7Q 3PO2G 1LYLA 4UPAA 4ME3A 1LM0A 1JJCB 5IY0A 2KHIA 5GADC 2E5LL 3KFUA 1AH9A 3CPWA 3CCRA 2OCEA 1K9MC 1KXLA 1MJCA 2UUCL 4DV4L 1KRSA 1YHQA 1ASYA 5FJ8H 1GO3E 1JT8A 2PQAB 1S40A 4JI7Q 4DUZL 4A3DH 5DLQE 2ID0A 2R93G 1X55A 2B3GA 4DV7L 4JI6Q 4AQYL 3H15A 1E1OA 1M1KC 4DV3Q 5IYBH 1XPOA 1NE3A 3K7UC 1MJEA 3H3VH 3M3YH 1BBUA 2IHEA 3FKIG 4B3ML 1N9WA 1A0IA 2A19A 2IT1A 2QGQA 3GTMH 4A3FH 1Q1EA 1Q81C 5C4XG 5M3MH 3HOVG 5C3EG 5C4JH 3KJOA 1CKMA 4NXMQ 3AYHB 3KYHC 3OYYA 4A3KG 1WCMG 2YV5A 3NENA 3F8TA 1VQ4A 2A8VA 1PH3A 2IX0A 3H0GH 4WJ3M 5K36G 1M90C 4DR1Q 1PV4A 3LGJA 4A3BG 4P71A 4RG1A 4NXML 2ES2A 2UU9Q 3GTQH 2QA4A 1G51A 3UDIA 1MKHA 1N34Q 1UWVA 1WOCA 1EIYB 5IYCG 2B63G 3HOZG 3PIOA 2BH8A 1SE8A 1CSQA 1VQAA 3HOUH 3KJPA 1SFOH 1E1TA 3NBHB 4GN3B 4DR1L 3EBEA 1HZCA 4L5QA 4BBRG 2UU9L 2OTLA 3ICEA 1N34L 1GM5A 5IE8A 1E7ZA 4X66Q 2I5LX 1S72A 3ERSX 2VY3A 1PH5A 1Y1WH 4KHZA 3PIPA 3A5UA 1VQ5A 2JA6G 4DR6Q 5IWAQ 3S24A 2JQOA 3RR5A 3BU2A 1O7IA 1QVCA 3MXNB 3JAMc 5GAEC 3M4OH 1NY4A 4BY1G 1GD7A 3CXCA 4DNIA 1XTDA 3FP9A 4XIGS 3BZKA 1W2BA 3K80C 4GNXC 3TEHB 2VW9A 3E9HA 4GLXA 3PGZA 2ATWA 1X3FA 3I2ZA 2ALYB 4IJHA 5IWAL 3CMEA 1I5FA 4IOCA 4LUZA 4B3TQ 4A3MG 4IFDJ 5IYDG 1JE5A 1K83H 4YCVA 3CQZH 4R4CA 3CCJA 4IPGA 4HJ8A 4OWWB 3PO2H 5ELOA 1TWGH 4R4OA 3OW2A 4DR7Q 4YCWA 5JJKA 1KQSA 2D0OA 1RL2A 2R7FA 3W1BA 4PZ8A 2NN6I 3RN2A 4YWKA 4LFCQ 1D8LA 5GAHC 2R6GA 2XGTA 3CW2C 1VQOA 4B3TL 4K0KL 4JI4Q 2R93H 3KOJA 1WJJA 1VQJA 1E24A 1VQFA 2JEAI 2N49A 1FL0A 1PYSB 2BH2A 1Q1BA 2K5VA 1L1OC 1SRUA 2JA9A 1V43A 3AQQA 4X65L 4DR7L 2K75A 4QL5A 3PO3G 1AE2A 3FKIH 3S2HH 1VCIA 3I4MG 3RNUA 5LMNW 5FLMG 3RLFA 4LF7Q 4A3GG 1EQQA 4QGUA 3UDXA 2C35B 4LFCL 3A74A 1HNXQ 2B29A 2Q2IA 1I3QH 5C4XH 3HOVH 4POFA 5C3EH 4JI4L 4O0AA 4GNXB 3D0FA 4A3KH 1SLJA 1WCMH 1NMGA 1X6OA 4DK3C 2OQ0A 1YJNA 4DR5Q 4LF9Q 4DR4Q 2CKZB 1HNXL 4IO9A 1HR0L 1IBMQ 4A3BH 3T1YL 1Q82C 2N3SA 1QUQA 2NVYH 1HNZQ 4KI0A 4A3JG 4DV4Q 3F2CA 4RMFA 5IP9G 3DLLA 1OXSC 5IYCH 2B63H 3HOZH 5E7NA 2KCTA 4JC0A 1Q86C 2I5MX 4DR5L 4GOPC 4LF4Q 2HIXA 4LF9L 2MFIA 4JOIC 1UE6A 4HJ9A 5BR8Q 4DR4L 4AQYQ 1IBML 1WYDA 2Q2HA 3PUZA 3U4VA 4BBRH 1C9OA 2MO1A 1HNZL 4TVAB 5C0XJ 4B3MQ 2WAQE 4HJ7A 1N33Q 2Z6KC 1ASZA 4GLVB 1BKBA 1YVCA 1VQKA 3CD6A 2CQOA 1VQ8A 1C7YA 1HH2P 2JA6H 4LF4L 3TRZA 2Q2TA 1VQHA 1VQMA 2D0PA 1Y1VG 1IYJB 5ELNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCL A;  4DAM A;  1RIP A;  3DM3 A;  4BY1 H;  1XPU A;  1G29 1;  1VQ7 A;  1TXY A;  2DUD A;  5LMU Q;  1N33 L;  4IJL A;  4QJF A;  4A3E G;  4ALP A;  1XNQ Q;  1YI2 A;  4R4T A;  1Z9F A;  3GTG H;  1I6H H;  1PVO A;  1TWF H;  1Z47 A;  2UXC Q;  2BA1 A;  3JAM i;  4LF8 Q;  4A3M H;  4JCV E;  1I50 H;  1XMO Q;  1NMF A;  4LW1 A;  3VDY A;  4JBK A;  3S16 H;  4JV5 Q;  5IYD H;  1VQI A;  1YIT A;  2CWP A;  1P8L A;  4JYA Q;  2BA0 A;  3T1H L;  1XMQ Q;  5LMU L;  1WFQ A;  4GKJ L;  1D7Q A;  3K0X A;  5IP7 G;  5EAY A;  4L5S A;  2VQE Q;  3CPF A;  2NZO A;  5M3F G;  3OTO Q;  4DV6 Q;  1XNQ L;  4GOP B;  3J7A 5;  3I55 A;  3F1Z A;  4LUO A;  4O2D A;  4UP7 A;  1IBK Q;  2RCN A;  4X64 Q;  4LF8 L;  3I4N G;  3J81 c;  3UDG A;  4JI3 Q;  4IFD I;  1XMO L;  4JV5 L;  2RHS B;  4TQU S;  1PH7 A;  1YHA A;  2VL6 A;  4QY7 A;  4JYA L;  2CWA A;  3GO5 A;  1XMQ L;  2HQL A;  2N8N A;  2NVX H;  2NVT H;  3PF4 A;  4BXX G;  2OWO A;  3PO3 H;  2VQE L;  4DV6 L;  2UXD Q;  3OTO L;  3E9I A;  2EXD A;  3H3V I;  3I4M H;  2E8G A;  1B8A A;  1Q8K A;  3S1N H;  5FLM H;  4A3G H;  1JJ2 A;  4KHP L;  3RZD H;  3D31 A;  1IBK L;  4X64 L;  2VNU D;  3UE1 A;  4JI3 L;  3CCV A;  2PNH A;  4DV0 Q;  1V1Q A;  4HIM A;  4A3I G;  3MEF A;  4P74 A;  2YU9 H;  1JJG A;  2N78 A;  4DUY L;  3EN2 A;  3K7A H;  3TQY A;  3SGI A;  1N36 Q;  3W5O A;  3J80 c;  1EUJ A;  4APV A;  4OO1 G;  2UXD L;  2JE6 I;  4YWL A;  4GKK Q;  1IXR A;  3JC6 6;  4LNQ A;  2JA8 G;  2KBN A;  4XTC S;  4UY8 C;  1A63 A;  2KHJ A;  3L2P A;  1Q7Y C;  4L5T A;  4DV0 L;  2E2H H;  2WB1 G;  4JI5 Q;  1VS0 A;  2F52 A;  1QVF A;  1KRT A;  1NJI C;  1A62 A;  3TRE A;  4A3J H;  5LMN L;  4POG A;  3HOX G;  1KD1 C;  3CCU A;  1N36 L;  5IP9 H;  2WAQ G;  4DV5 Q;  4K0K Q;  2DGY A;  4GKK L;  1CSP A;  2AWN A;  1QZH A;  2A1A A;  1UE1 A;  4Y52 H;  5HGQ A;  1VQB A;  3KDF B;  1VQC A;  4EQ5 A;  1YBY A;  3CC2 A;  1KHI A;  4JI5 L;  4X65 Q;  4A75 A;  1VQP A;  1SR3 A;  3HKZ E;  3AFQ A;  1PH6 A;  3AEV A;  4UP9 A;  2CCZ A;  5BR8 L;  1J5E L;  5C44 G;  3M85 A;  1K3R A;  3G4S A;  1NTG A;  3G48 A;  1MIU A;  4DV5 L;  4AIM A;  4JI0 Q;  1X54 A;  3J81 j;  1QVG A;  4IOA A;  1TWA H;  1EQR A;  2R7Z G;  1X9N A;  1Y1V H;  3WWV A;  4LUV A;  1N8R C;  2VQF Q;  4GN4 B;  1OXX K;  3KF6 A;  3PSI A;  5C0X I;  1GVP A;  3GTL H;  2MQH A;  5HY6 A;  3RLN A;  4JBM A;  3S1M H;  4A3E H;  3PCO B;  1OTC A;  2I0Q A;  4JI1 Q;  1YZ6 A;  3E0E A;  1L2F A;  2K52 A;  1HR0 Q;  4JI0 L;  1FVI A;  3T1Y Q;  3S2D H;  3GD7 A;  4PMW A;  4DV2 Q;  3UDF A;  5FLX c;  1U5K A;  2PMZ E;  4P75 A;  1TWH H;  2VQF L;  4BA2 I;  1VQ9 A;  1X3E A;  1EWI A;  2PQA A;  3B6Y A;  2E2I H;  3RN5 A;  1TWC H;  3STB C;  5IP7 H;  1JMC A;  5GQO A;  5M3F H;  5H1S E;  2PI2 A;  1X56 A;  1I94 Q;  4JI1 L;  1E22 A;  2QEX A;  4LFB Q;  1VQG A;  2UXB L;  2LXK A;  4A3L G;  4DV2 L;  3PUV A;  1FGU A;  2ZJP A;  3I4N H;  4C3I H;  4BBS G;  3M4Q A;  3HFZ B;  4UP8 A;  4A76 A;  1UE5 A;  3GTK H;  3UE0 A;  1KL9 A;  3U4Z A;  1AE3 A;  2NN6 G;  4PG3 A;  3HOY G;  2PI2 E;  3TS0 A;  1N32 Q;  2F4V L;  1B7Y B;  1GKH A;  5IT9 c;  4BXX H;  2WB1 E;  1PH1 A;  1PH8 A;  3CCS A;  4HIK A;  1I94 L;  4LFB L;  4OXP A;  1KAW A;  1SMX A;  4PZ7 A;  4OON A;  1L1O B;  3RLO A;  5JEA G;  3J81 i;  1VQL A;  4P73 A;  1FJG Q;  4DR3 Q;  4A3I H;  2NZH A;  4A93 G;  4WJ4 A;  3I56 A;  1WI5 A;  3TS2 A;  3NEL A;  3G71 A;  4JOI A;  3GTJ H;  4IPD A;  4YHH Q;  1N32 L;  2Z0S A;  4YY3 Q;  4BY7 G;  2GVA A;  3PV0 A;  5M5X H;  3CP0 A;  2AMC B;  3HKS A;  3L0O A;  4IPC A;  2GN5 A;  2JA8 H;  1YJ9 A;  2R92 G;  2R7D A;  4DV1 Q;  3A0J A;  3T1H Q;  3L7Z C;  4GKJ Q;  4OX9 Q;  1Q12 A;  4DR3 L;  4L5R C;  1FJG L;  2VUM G;  1PH4 A;  1T9H A;  2LSS A;  2LXJ A;  3J80 i;  5JEA J;  3HOX H;  4YHH L;  3HKZ G;  4YY3 L;  2ZM6 Q;  1CKN B;  4LF5 Q;  4R1J A;  1SRO A;  4LWC A;  4MTN A;  4MNO A;  1EFW A;  1IZ6 A;  3CC7 A;  1HZ9 A;  4DV1 L;  4X6A H;  4OX9 L;  5AJ3 Q;  4AYB G;  4H02 A;  1HZA A;  4GLA C;  4DKA C;  4NPS A;  3F2D A;  4NXN Q;  1HR0 W;  5C44 H;  3HOW G;  2JA7 G;  4KHP Q;  1QUQ B;  2ZM6 L;  2FXQ A;  4LF5 L;  4GN5 A;  1VQE A;  4FDB A;  3Q8D A;  3KF8 B;  4HJA A;  3CCQ A;  2R7Z H;  4DUY Q;  2JJQ A;  3CCE A;  3ULJ A;  4JI7 L;  1J6Q A;  3CC4 A;  1PFS A;  5JJI A;  1OXU A;  5M5Y H;  2HT1 A;  5AJ3 L;  4DR2 Q;  4QIW E;  4P72 A;  4JI6 L;  1H95 A;  3S1R H;  2JA5 G;  4NXN L;  2GVB A;  2L15 A;  2Y0S G;  4DV3 L;  2EQS A;  1OXV A;  2OQK A;  3KDF A;  4OWT B;  4AH6 A;  1KIX A;  1C0A A;  3F2B A;  1G6P A;  1PYB A;  2I5H A;  2YYZ A;  1QZG A;  1PH9 A;  4R4I A;  5GAG C;  3CMA A;  1LTL A;  3BZC A;  3S14 H;  5LMN Q;  1NBW A;  1YNX A;  2V1C C;  3IRB A;  3J7Z C;  3AFP A;  3FHW A;  2AWO A;  3CAM A;  3W1G A;  2ZJR A;  4A3C G;  4HJ5 A;  1SN8 A;  4YCU A;  3K81 C;  2HIV A;  4DR2 L;  2ASB A;  3GTP H;  3GTO H;  4PZ6 A;  4HID A;  1A8V A;  1OXT A;  1P16 A;  1L0W A;  3M9B A;  4J15 A;  4R4Q A;  3GDE A;  1X3G A;  1IBL Q;  1U0L A;  4OWX B;  1YEZ A;  4A3L H;  2IX1 A;  2NVQ H;  1HZB A;  1LUZ A;  4BBS H;  4DAY B;  1J5E Q;  2K4K A;  1BBW A;  2VZA A;  1XNR Q;  3PUX A;  1DGS A;  1Y14 B;  3PUW A;  4LF6 Q;  3HOY H;  4OO1 I;  5FJ8 G;  1V9P A;  1EYG A;  4IFD G;  2WFW A;  5GRO A;  4NB3 A;  1EOV A;  4JI8 Q;  3RZO H;  4GNX A;  4HIO A;  1K8A C;  3S15 H;  2OTJ A;  1VQD A;  1CKO A;  4GS3 A;  2Q2U A;  1IBL L;  4A3D G;  1B70 B;  3I7F A;  2VS1 A;  1K73 C;  1E3P A;  2XTI A;  2RHQ B;  3M4P A;  5IYB G;  2E2J H;  4A93 H;  1XNR L;  4Y7N H;  1BVS A;  4C3J H;  4JBJ A;  4DK6 C;  4LF6 L;  4X66 L;  2AHO B;  1R9T H;  1PA6 A;  1K0R A;  3BJU A;  4A3F G;  4JI8 L;  4BY7 H;  1XPR A;  5M3M G;  4AYB E;  5J3B A;  1PHJ A;  2ZJQ A;  4DR6 L;  2ZTC A;  2ZTE A;  3STB D;  2WP8 J;  2R92 H;  1HNW Q;  1YJW A;  1IL2 A;  4C3H H;  4JI2 Q;  3PF5 A;  1UEB A;  4YWM A;  1VQN A;  2VUM H;  2F3I A;  3G6E A;  2KCM A;  2EIF A;  3H0G G;  1XJV A;  1W3S A;  4JG2 A;  2UXB Q;  1L1O A;  2CFM A;  1UE7 A;  1CUK A;  5JJL A;  4QQB X;  2RF4 A;  2YTY A;  3K8A A;  2IHF A;  2Y0S E;  1HNW L;  3KLW A;  4EX5 A;  3M7N A;  2K5H A;  1K8G A;  1PH2 A;  2K14 A;  3A5Z B;  4JI2 L;  2F4V Q;  4A4I A;  2UUA Q;  2ZTD A;  5M5W H;  1KC8 C;  4IPH A;  4LFA Q;  3HOW H;  3HOU G;  1EIF A;  2JA7 H;  3S1Q H;  2H5X A;  4B3S Q;  4JBW A;  2HHH Q;  4C2M H;  3NEM A;  1HJP A;  2IY5 B;  2JEB I;  2UUB Q;  1YHB A;  4B3R Q;  1VQ6 A;  3S17 H;  1CKN A;  2UUA L;  1Y1W G;  2JA5 H;  2MO0 A;  4LFA L;  1X65 A;  4X62 Q;  2KEN A;  1S3O A;  3ULL A;  3CF5 A;  2HHH L;  5C0X G;  4B3S L;  4MZ9 A;  4LF7 L;  3U50 C;  2YTV A;  2D62 A;  3CCM A;  4DPG A;  4GOP A;  3ER0 A;  3ZJY C;  2E5L Q;  2AKW B;  2UUB L;  4B3R L;  3I4O A;  3PUY A;  4A3C H;  2K50 A;  4KLK A;  2UUC Q;  2UXC L;  3EIV A;  3ULP A;  2MNA A;  1JB7 A;  2JK8 A;  1YIJ A;  3KF6 B;  2Z6K A;  3U58 A;  4BA1 I;  2YTX A;  4X62 L;  2K5N A;  4DUZ Q;  1Q46 A;  4DV7 Q;  3PO2 G;  1LYL A;  4UPA A;  4ME3 A;  1LM0 A;  1JJC B;  5IY0 A;  2KHI A;  5GAD C;  2E5L L;  3KFU A;  1AH9 A;  3CPW A;  3CCR A;  2OCE A;  1K9M C;  1KXL A;  1MJC A;  2UUC L;  4DV4 L;  1KRS A;  1YHQ A;  1ASY A;  5FJ8 H;  1GO3 E;  1JT8 A;  2PQA B;  1S40 A;  4JI7 Q;  4DUZ L;  4A3D H;  5DLQ E;  2ID0 A;  2R93 G;  1X55 A;  2B3G A;  4DV7 L;  4JI6 Q;  4AQY L;  3H15 A;  1E1O A;  1M1K C;  4DV3 Q;  5IYB H;  1XPO A;  1NE3 A;  3K7U C;  1MJE A;  3H3V H;  3M3Y H;  1BBU A;  2IHE A;  3FKI G;  4B3M L;  1N9W A;  1A0I A;  2A19 A;  2IT1 A;  2QGQ A;  3GTM H;  4A3F H;  1Q1E A;  1Q81 C;  5C4X G;  5M3M H;  3HOV G;  5C3E G;  5C4J H;  3KJO A;  1CKM A;  4NXM Q;  3AYH B;  3KYH C;  3OYY A;  4A3K G;  1WCM G;  2YV5 A;  3NEN A;  3F8T A;  1VQ4 A;  2A8V A;  1PH3 A;  2IX0 A;  3H0G H;  4WJ3 M;  5K36 G;  1M90 C;  4DR1 Q;  1PV4 A;  3LGJ A;  4A3B G;  4P71 A;  4RG1 A;  4NXM L;  2ES2 A;  2UU9 Q;  3GTQ H;  2QA4 A;  1G51 A;  3UDI A;  1MKH A;  1N34 Q;  1UWV A;  1WOC A;  1EIY B;  5IYC G;  2B63 G;  3HOZ G;  3PIO A;  2BH8 A;  1SE8 A;  1CSQ A;  1VQA A;  3HOU H;  3KJP A;  1SFO H;  1E1T A;  3NBH B;  4GN3 B;  4DR1 L;  3EBE A;  1HZC A;  4L5Q A;  4BBR G;  2UU9 L;  2OTL A;  3ICE A;  1N34 L;  1GM5 A;  5IE8 A;  1E7Z A;  4X66 Q;  2I5L X;  1S72 A;  3ERS X;  2VY3 A;  1PH5 A;  1Y1W H;  4KHZ A;  3PIP A;  3A5U A;  1VQ5 A;  2JA6 G;  4DR6 Q;  5IWA Q;  3S24 A;  2JQO A;  3RR5 A;  3BU2 A;  1O7I A;  1QVC A;  3MXN B;  3JAM c;  5GAE C;  3M4O H;  1NY4 A;  4BY1 G;  1GD7 A;  3CXC A;  4DNI A;  1XTD A;  3FP9 A;  4XIG S;  3BZK A;  1W2B A;  3K80 C;  4GNX C;  3TEH B;  2VW9 A;  3E9H A;  4GLX A;  3PGZ A;  2ATW A;  1X3F A;  3I2Z A;  2ALY B;  4IJH A;  5IWA L;  3CME A;  1I5F A;  4IOC A;  4LUZ A;  4B3T Q;  4A3M G;  4IFD J;  5IYD G;  1JE5 A;  1K83 H;  4YCV A;  3CQZ H;  4R4C A;  3CCJ A;  4IPG A;  4HJ8 A;  4OWW B;  3PO2 H;  5ELO A;  1TWG H;  4R4O A;  3OW2 A;  4DR7 Q;  4YCW A;  5JJK A;  1KQS A;  2D0O A;  1RL2 A;  2R7F A;  3W1B A;  4PZ8 A;  2NN6 I;  3RN2 A;  4YWK A;  4LFC Q;  1D8L A;  5GAH C;  2R6G A;  2XGT A;  3CW2 C;  1VQO A;  4B3T L;  4K0K L;  4JI4 Q;  2R93 H;  3KOJ A;  1WJJ A;  1VQJ A;  1E24 A;  1VQF A;  2JEA I;  2N49 A;  1FL0 A;  1PYS B;  2BH2 A;  1Q1B A;  2K5V A;  1L1O C;  1SRU A;  2JA9 A;  1V43 A;  3AQQ A;  4X65 L;  4DR7 L;  2K75 A;  4QL5 A;  3PO3 G;  1AE2 A;  3FKI H;  3S2H H;  1VCI A;  3I4M G;  3RNU A;  5LMN W;  5FLM G;  3RLF A;  4LF7 Q;  4A3G G;  1EQQ A;  4QGU A;  3UDX A;  2C35 B;  4LFC L;  3A74 A;  1HNX Q;  2B29 A;  2Q2I A;  1I3Q H;  5C4X H;  3HOV H;  4POF A;  5C3E H;  4JI4 L;  4O0A A;  4GNX B;  3D0F A;  4A3K H;  1SLJ A;  1WCM H;  1NMG A;  1X6O A;  4DK3 C;  2OQ0 A;  1YJN A;  4DR5 Q;  4LF9 Q;  4DR4 Q;  2CKZ B;  1HNX L;  4IO9 A;  1HR0 L;  1IBM Q;  4A3B H;  3T1Y L;  1Q82 C;  2N3S A;  1QUQ A;  2NVY H;  1HNZ Q;  4KI0 A;  4A3J G;  4DV4 Q;  3F2C A;  4RMF A;  5IP9 G;  3DLL A;  1OXS C;  5IYC H;  2B63 H;  3HOZ H;  5E7N A;  2KCT A;  4JC0 A;  1Q86 C;  2I5M X;  4DR5 L;  4GOP C;  4LF4 Q;  2HIX A;  4LF9 L;  2MFI A;  4JOI C;  1UE6 A;  4HJ9 A;  5BR8 Q;  4DR4 L;  4AQY Q;  1IBM L;  1WYD A;  2Q2H A;  3PUZ A;  3U4V A;  4BBR H;  1C9O A;  2MO1 A;  1HNZ L;  4TVA B;  5C0X J;  4B3M Q;  2WAQ E;  4HJ7 A;  1N33 Q;  2Z6K C;  1ASZ A;  4GLV B;  1BKB A;  1YVC A;  1VQK A;  3CD6 A;  2CQO A;  1VQ8 A;  1C7Y A;  1HH2 P;  2JA6 H;  4LF4 L;  3TRZ A;  2Q2T A;  1VQH A;  1VQM A;  2D0P A;  1Y1V G;  1IYJ B;  5ELN A; 
#chains in the Genus database with same CATH topology
 1ZYR C;  1RIP A;  3QJY A;  1TR5 A;  1QB5 D;  1N33 L;  1ENF A;  4IJL A;  4ALP A;  2A6H C;  1EZ6 A;  4DAY A;  4CJ2 C;  3GTG H;  4LF8 Q;  4RKL A;  4JV5 Q;  4LW1 A;  5KYI A;  3K6O A;  2CWP A;  4CDF C;  1P8L A;  3BS1 A;  2M00 A;  1B9M A;  4JYA Q;  4GKJ L;  1WFQ A;  3BDC A;  3P1H A;  5EAY A;  2LFN A;  3Q24 A;  4MN3 A;  1I4P A;  1E2W A;  4LUO A;  4UP7 A;  1IBK Q;  4LF8 L;  3J81 c;  4C3I G;  4JV5 L;  3GTG B;  1YHA A;  4QY7 A;  4JYA L;  2CWA A;  4BWG B;  2N8N A;  3SK4 A;  1NCV A;  4R8N A;  2EJG C;  2UXD Q;  1JWU D;  5G3L F;  3E9I A;  1JJ2 A;  3LX0 A;  3D31 A;  1IBK L;  3UE1 A;  4DV0 Q;  2PNH A;  4A3I G;  4HR7 B;  5BN3 A;  4HCS A;  1N36 Q;  1EUJ A;  2UXD L;  2JE6 I;  2HDM A;  1IXR A;  1CHQ D;  4FXG C;  4LNQ A;  1JIC A;  2KHJ A;  5COY A;  3L2P A;  4DV0 L;  5FLX L;  2E2H H;  1QVF A;  5EGT A;  5EQ0 A;  2K01 A;  4POG A;  2MJ8 A;  3D6W A;  3CCU A;  1N36 L;  4N8X 1;  1MI2 A;  2WAQ G;  4DV5 Q;  4K0K Q;  5M9O A;  1QZH A;  2A1A A;  1D1I A;  2NTT A;  3QWN A;  4FVM A;  4EQ5 A;  3QB3 A;  3M4O B;  4A75 A;  1VQP A;  3FVQ A;  3AFQ A;  2RBM A;  5EKL A;  5C44 G;  3M85 A;  2QDL A;  1K3R A;  3VR2 A;  3G48 A;  4DV5 L;  4IOA A;  3T53 B;  3TZU A;  2ZT9 C;  1PDQ A;  2LMC B;  3WWV A;  1FNW A;  3PSI A;  5C0X I;  3PO2 B;  2TMP A;  2M9V A;  4JBM A;  1S5B D;  4XQQ A;  1OTC A;  1BXT A;  1ENA A;  1YZ6 A;  3E0E A;  4JI1 Q;  4DV2 Q;  3UDF A;  5FLX c;  1B3A A;  2E76 C;  1VQ9 A;  5J1Z A;  1XXG A;  1PZJ D;  2Q8R E;  5IP7 H;  5H1S E;  2PI2 A;  2XWB B;  3HEJ A;  4JI1 L;  2QEX A;  2F0M A;  4LFB Q;  1VQG A;  4DV2 L;  4BBS G;  3M4Q A;  3TN2 A;  2MGS A;  1ICW A;  1AE3 A;  4FO2 A;  4K14 A;  4PG3 A;  2PI2 E;  3ERO A;  1CZG A;  3OHX C;  1T5X D;  4CJ1 B;  1B53 A;  2F4V L;  1MSH A;  4LFB L;  1NR4 A;  4OXP A;  4DXG A;  1VQL A;  1SMX A;  1KNE A;  4PZ7 A;  3RLO A;  5JEA G;  3A8K E;  3MA2 B;  1RJT A;  4DR3 Q;  2EYO A;  1WI5 A;  1PZK D;  4HN7 A;  3NEL A;  4JOI A;  3GTJ H;  2L1B A;  4C3J G;  3C2P A;  1CHP D;  2GVA A;  3CP0 A;  4IPC A;  2GN5 A;  4KY7 A;  4RWS C;  1WTX A;  2R7D A;  4DV1 Q;  1Q12 A;  2EJF C;  4DR3 L;  2VUM G;  2EYF A;  2LSS A;  2LXJ A;  5EKI A;  4DF7 A;  3J80 i;  3HOX H;  1PTO F;  3DMU A;  2ZM6 Q;  2F0Q A;  4LWC A;  3S9W A;  1JOK A;  1BF4 A;  4XQJ A;  4DV1 L;  1TKW B;  1PFM A;  5AJ3 Q;  4DKA C;  4NPS A;  4NXN Q;  1SAP A;  3HOW G;  4KHP Q;  2EYM A;  2ZM6 L;  2FXQ A;  3KF8 B;  1I6H B;  3CCQ A;  5KYL A;  4DUY Q;  4FF4 A;  3CCE A;  3ULJ A;  4A3M B;  1PFS A;  3M7G A;  1OXU A;  5M5Y H;  2HT1 A;  5AJ3 L;  1EQT A;  3S1R H;  2L5T A;  4NXN L;  2EQS A;  1OXV A;  3EVQ A;  4AH6 A;  2FFK B;  1C0A A;  1AW7 A;  1PYB A;  5GAG C;  3S14 H;  3BZC A;  3L3O C;  5LMN Q;  5A2Q L;  1NBW A;  1ONL A;  3IRB A;  2NUC A;  2NB0 A;  5AFW A;  2QKI C;  3CAM A;  3W1G A;  2ZJR A;  1JWM D;  4HJ5 A;  1SN8 A;  3K81 C;  3V05 A;  2KCN A;  3MAQ A;  1A8V A;  1P16 A;  1L0W A;  1STA A;  2EPB A;  3O13 A;  1LT3 D;  2RKS A;  3K59 A;  1BBW A;  1HUN A;  1JOQ A;  5CGK A;  1EEI D;  3D4R A;  1SYD A;  3HOY H;  4OO1 I;  5FJ8 G;  3S15 H;  2A73 B;  2NWG A;  4HMJ A;  1D6E C;  1K73 C;  1E3P A;  3NPP A;  4V0B A;  2H4O A;  4G7H C;  4X3U A;  4RGN A;  3TP8 A;  1K0R A;  4K5V A;  4V19 0;  2ZJQ A;  1PHJ A;  2DNC A;  3HOY B;  2AQ3 B;  2SNM A;  5JOB A;  2R92 H;  1HNW Q;  1S5C D;  1YJW A;  1IL2 A;  4DAV A;  1PTO D;  3G6E A;  4C1N I;  3K58 A;  1A2U A;  1W3S A;  4JG2 A;  1VF5 C;  1G91 A;  3SE0 A;  1HTP A;  3K8A A;  5EBD A;  2Y0S E;  1HNW L;  1Y1V B;  2K5H A;  1DOL A;  3NTH A;  1PH2 A;  1K8G A;  2N88 A;  2D5D A;  3E0J A;  2ZTD A;  2R92 B;  1X3Q A;  5M5W H;  1EYC A;  3HOU G;  1EIF A;  3S1Q H;  5JVH 3;  2HHH Q;  3V96 A;  4J6H A;  4B9W A;  3HKZ B;  5KND A;  2F0J A;  4KD4 A;  2B39 A;  4KD3 A;  1VQ6 A;  3S17 H;  1CKN A;  4DN4 M;  1Y1W G;  1B44 D;  2BCO A;  1B2T A;  2JA5 H;  4ILW A;  4X62 Q;  1S3O A;  3NSW A;  2HHH L;  3BVM A;  2XRS D;  3S1Q B;  2PZT A;  3CCM A;  1WTR A;  4C3I B;  5I2X A;  2VB2 X;  2XVS A;  4QF4 A;  3EIV A;  3TSS A;  2XN9 C;  2MNA A;  3ULP A;  2JK8 A;  2EY1 A;  4Q5V A;  4OIK A;  4X62 L;  1TY0 A;  1Q46 A;  2Y0S B;  4DV7 Q;  5GAD C;  1EY7 A;  1JJC B;  3KFU A;  4Z9C B;  3CCR A;  3TP6 A;  4A3I B;  3ITP A;  5CC4 A;  1KRS A;  1HA5 A;  1GO3 E;  4IFD H;  5FOB B;  2PQA B;  1R4Q B;  2FJ2 A;  4JI7 Q;  2RSN A;  1X55 A;  2B3G A;  4DV7 L;  4G7Z C;  2QF7 A;  4QMG A;  1EEF D;  3R8B A;  2BDN A;  1MGS A;  1E1O A;  1U4M A;  1M1K C;  4OEM B;  3K7U C;  2IHE A;  2KEC A;  3LWE A;  1SNP A;  1F77 A;  1A0I A;  2R3Z A;  5DM7 3;  2IT1 A;  5M3M H;  5C3E G;  4J8Q A;  5C4J H;  3KJO A;  4NXM Q;  1SEB D;  3AYH B;  1WTV A;  4A3K G;  3NEN A;  2FHT A;  3F8T A;  2A8V A;  4CDC C;  2IX0 A;  3H0G H;  1F9Q A;  3G6J B;  1M90 C;  4TSS A;  2IWH A;  1UUP A;  4K6D A;  2MP1 A;  4DR1 Q;  4P71 A;  4NXM L;  3GTQ H;  2QA4 A;  5M3M B;  1B50 A;  2B63 G;  3HOZ G;  2XWJ B;  1SE8 A;  1RHP A;  3CRK C;  1VQA A;  1GUS A;  2KEE A;  4ZYS A;  3KJP A;  3DWA A;  1E1T A;  4DR1 L;  4RHR A;  2N55 A;  2MUY A;  1GM5 A;  1ET9 A;  5ELF A;  3A5U A;  3SEB A;  1VQ5 A;  2JA6 G;  2KVM A;  3U9O A;  4WOR A;  1AZP A;  4NKL A;  2JQO A;  3RR5 A;  1QVC A;  1KDB A;  3MXN B;  5LL6 X;  2XRQ D;  3FP9 A;  3NUC A;  5IGE A;  5KEE A;  4BBS B;  3I3C A;  3TEH B;  2R61 A;  4GLX A;  1MBY A;  1LAC A;  2ATW A;  3I2Z A;  4RFB A;  4B3T Q;  1MHW C;  1JE5 A;  1K83 H;  3R93 A;  4R4C A;  4OWW B;  3OW2 A;  4XT1 B;  2E2J B;  3RUZ A;  2LKV A;  1RL2 A;  4QUF A;  4C3J B;  2NN6 I;  5IGG A;  1R9T B;  1SNC A;  4BS9 A;  4B3T L;  4ULL A;  1V1P B;  4JI4 Q;  1VQJ A;  4G7O C;  2WII B;  2BH2 A;  2JN4 A;  1Q1B A;  3H91 A;  2ZXR A;  2K75 A;  3FKI H;  1QWY A;  5C3X A;  3OWE B;  4LF7 Q;  4QGU A;  2C35 B;  3A74 A;  3I73 A;  1BR9 A;  4HSV A;  4DA2 A;  4JI4 L;  5TSS A;  1LTG D;  4GNX B;  1I4X A;  1SLJ A;  1TQO A;  4XDX A;  3CRL C;  2OQ0 A;  1YJN A;  5FO7 B;  3OOC A;  3X3N A;  3HOW B;  4IO9 A;  3T1Y L;  1CZW A;  4DV4 Q;  4RMF A;  2LS0 1;  1U4R A;  4DNR B;  3GTL H;  4GOP C;  2HIX A;  2JYO A;  4JOI C;  4K8J A;  3U4V A;  4BBR H;  4OGQ C;  2ICI A;  4S3S A;  4TVA B;  4B3M Q;  4HED A;  3T51 B;  1U9R A;  1ASZ A;  4GLV B;  1BKB A;  4LK1 C;  3VR6 A;  1C7Y A;  1HTL D;  3VYU A;  1VQM A;  2D0P A;  2Z1C A;  5ELB A;  2KOL A;  1CM9 A;  1SYF A;  1TXY A;  1LLR D;  4QJF A;  1YI2 A;  1Z9F A;  3JAM i;  1EQV A;  4DXF A;  5FO8 B;  1XMO Q;  2F0H A;  4ZUI A;  4B9X A;  2BA0 A;  3T1H L;  1WTQ A;  3K0X A;  5IP7 G;  3P75 A;  2VQE Q;  4DV6 Q;  1YNJ D;  2NZO A;  3OTO Q;  3M3Y B;  2O5I C;  3GTM B;  1FYC A;  2Z4I A;  1XMO L;  2HDL A;  1PH7 A;  3HP3 A;  3IFD A;  2H1E A;  2NVT H;  1CT1 D;  2NVX H;  5EJW A;  3PO3 H;  4DK0 A;  2VQE L;  4DV6 L;  2EY6 A;  3OTO L;  3I4M H;  4ZAI A;  3S1N H;  4PQX A;  2RDF A;  3DWQ A;  3CCV A;  3EN2 A;  5ELC A;  2KQ3 A;  3W5O A;  4APV A;  1SNQ A;  3HOZ B;  4HAE A;  4RH6 A;  1EY4 A;  3JC6 6;  2NVT B;  2NVX B;  2KBN A;  1KAA A;  4XTC S;  2KED A;  1A63 A;  1U4P A;  3C1E A;  3N52 A;  4L5T A;  4JI5 Q;  3I4M B;  4K2L A;  1KRT A;  1FGB D;  1A62 A;  1S5E D;  3TRE A;  3DEP A;  4A3J H;  4IUU A;  5CV9 A;  3HOX G;  1DXM A;  4L8J A;  2J0T D;  1IHZ A;  3DWP A;  1K0S A;  1Y1W B;  4Y52 H;  1UE1 A;  3IL8 A;  3K5N A;  2EE1 A;  4JI5 L;  1ENC A;  1LTA D;  2B2W C;  4JVZ A;  1NTG A;  3P20 A;  4JK1 C;  1MIU A;  5IT9 L;  3NE5 B;  1X54 A;  4XYQ A;  3J81 j;  4A3J B;  1HPC A;  2VQF Q;  3ND9 A;  3RLN A;  3OW7 A;  1SMY D;  3PCO B;  1SSO A;  2I0Q A;  3J7Y W;  1HR0 Q;  1L2F A;  3S2D H;  3GD7 A;  4PMW A;  2PMZ E;  4P75 A;  5DNF A;  2VQF L;  1EY6 A;  1X3E A;  1EWI A;  5JPM C;  3B6Y A;  4IUN A;  2BE5 C;  1RTN A;  4PMB A;  1PMR A;  1SDF A;  1BCP F;  1TWC H;  5GQO A;  3DXJ C;  3J80 E;  3S2H B;  1E22 A;  2UXB L;  2LXK A;  1PTO C;  4H44 C;  1L0X B;  2F3W A;  3I4N H;  2ZJP A;  1LTR D;  1GUW A;  3HFZ B;  4FYD A;  1UE5 A;  3GTK H;  4RKB A;  1KL9 A;  3HOY G;  4KHV A;  1GKH A;  3NWT A;  4RA8 A;  4A3K B;  5IT9 c;  4BXX H;  1PH1 A;  2HUG A;  3D3R A;  4HIK A;  3A7A B;  4JPB W;  2Z6B A;  1TWC B;  4CDD C;  1L1O B;  3GV3 A;  5I6Y A;  5A35 A;  5ELE A;  2XSC A;  4CGY B;  4IPD A;  3H09 A;  2L55 A;  4YY3 Q;  2B63 B;  4LJZ C;  3GTK B;  3L0O A;  1YJ9 A;  3BYT B;  2R92 G;  1A2T A;  1F2Z A;  3A0J A;  4GKJ Q;  4L5R C;  3NBH A;  4H13 C;  5CBE E;  1F2M A;  1W6K A;  1WTP A;  3HKZ G;  3K57 A;  4YY3 L;  5KNB A;  4RCN A;  4LF5 Q;  1S4Z A;  1IYU A;  2X6L A;  4MTN A;  4MNO A;  2JA6 B;  1GUO A;  3CC7 A;  1E2V A;  3HGB A;  4ZKB B;  4X6A H;  4H02 A;  5ELN A;  4TRD A;  1QUQ B;  1SYB A;  1B1Z A;  4LF5 L;  4GN5 A;  3Q8D A;  5T1G A;  2R7Z H;  1K8M A;  2JJQ A;  3CC4 A;  5EBC A;  4DR2 Q;  1EIG A;  1H95 A;  2JA5 G;  2GVB A;  2Y0S G;  4DV3 L;  2OQK A;  1SJH D;  4KKU A;  1BNZ A;  2I5H A;  5FKA C;  1PH9 A;  1K8O A;  4J1M A;  4JW0 A;  5DM6 3;  3SDZ A;  3J7Z C;  1BCP D;  4DR2 L;  4YCU A;  1WD0 A;  2ASB A;  3GTP H;  1EWH A;  4TKO B;  1NUC A;  3M9B A;  1X3G A;  1U0L A;  2SEB D;  2IW3 A;  3MFY A;  1YEZ A;  4NDX A;  4C1N K;  2NVQ H;  1DON A;  1G8Z D;  4DAY B;  5CV8 A;  2K4K A;  5C4H A;  1XNR Q;  5JPN C;  2E2D C;  1DGS A;  2J4X A;  4LF6 Q;  1EYG A;  1V9P A;  2JSO A;  4IFD G;  5GRO A;  4NB3 A;  2OTJ A;  1SNM A;  4HIO A;  5IOC A;  1CKO A;  3GTP B;  2Q2U A;  3I7F A;  2VS1 A;  3MFG A;  3K5M A;  4OIJ A;  2E2H B;  2RHQ B;  4A93 H;  2A74 C;  1XNR L;  4M8A A;  3AU7 A;  3NQI A;  4JBJ A;  4LF6 L;  4X66 L;  1QIL A;  1OO9 B;  2AHO B;  3TP7 A;  3BJU A;  1PA6 A;  4BY7 H;  2PW5 A;  5M3M G;  5J3B A;  3OMC A;  4DR6 L;  1ZEQ X;  4OEL B;  5CV5 A;  2ZTE A;  3STB D;  2WP8 J;  4O1N A;  4C3H H;  4IUP A;  3QOL A;  1UEB A;  1VQN A;  2F3I A;  3WOF A;  2KCM A;  2CH4 W;  3H0G G;  3SHL A;  1XJV A;  4F8M A;  1I4Q A;  2CFM A;  4A93 B;  2CQA A;  1DJR D;  2HCI A;  2PQE A;  2AQ1 B;  2IHF A;  4XT3 B;  3KLW A;  4EX5 A;  3M7N A;  2PW7 A;  4BY7 B;  1PRT F;  2F4V Q;  3I70 A;  4OL7 A;  4A4I A;  2FMC A;  4I65 A;  3QR8 A;  1KC8 C;  1BCP B;  4C3H B;  4LFA Q;  1QNU A;  3VYR A;  3VR5 A;  5K5P A;  2EY5 A;  1BBX C;  3L9A X;  1KLU D;  1STN A;  1AP0 A;  2K05 A;  2PPB C;  2MO0 A;  4LFA L;  1X65 A;  3HG9 A;  3VR3 A;  1CTM A;  5CBA E;  2KEN A;  4MZ9 A;  1EYA A;  3U50 C;  4GOP A;  3ZJY C;  2E5L Q;  2AKW B;  3PUY A;  2K50 A;  2UUC Q;  2A69 D;  2Z8L A;  4FP5 D;  1JB7 A;  4KN4 C;  4BA1 I;  3H3V C;  3KLS X;  4UPA A;  2E5L L;  1AH9 A;  3CPW A;  1KXL A;  2UUC L;  3GTJ B;  1YHQ A;  1ASY A;  3CKI B;  1TT2 A;  4ZCK A;  1G2S A;  4A3D H;  3K5L A;  1STY A;  2KJX A;  4AQY L;  5IYB H;  1MJE A;  3FKI G;  1N9W A;  3HOX B;  4K6L A;  4KN7 C;  2QGQ A;  4A3F H;  1CKM A;  3KYH C;  1D2B A;  3OYY A;  1M4V A;  2YV5 A;  4KMU C;  2B2V C;  1QE6 A;  4N9T A;  4U67 3;  1PH3 A;  3V2T A;  3Q0A A;  3TZD A;  2F0F A;  1PV4 A;  3LGJ A;  4RG1 A;  2A68 D;  1PRT D;  2ES2 A;  4WRD A;  1G51 A;  3GV6 A;  3T56 B;  2G9H D;  1X32 A;  5M5Y B;  4IUQ A;  5I6W A;  3S1R B;  1SFO H;  2K6A A;  2DY7 A;  2F0S A;  4GN3 B;  3EBE A;  4L5Q A;  4BBR G;  4ZRZ A;  4KK7 A;  1K3B C;  1YNJ C;  3I91 A;  3S14 B;  1BDO A;  3ICE A;  5C5L A;  3FEW X;  1E7Z A;  5IE8 A;  3ERS X;  2VY3 A;  5CYU A;  2K33 A;  4IQZ A;  4L6T B;  1H9S A;  2B2T C;  4R9W A;  1O7I A;  4MIU A;  5GAE C;  5C0X H;  1GD7 A;  1NR2 A;  3CXC A;  3R2I A;  5D3I B;  3BZK A;  4IZ8 A;  1RD9 D;  2NTS A;  2WKD A;  4IJH A;  3CME A;  2L9H A;  1LV9 A;  4LUZ A;  2B2W A;  3S15 B;  4IFD J;  3CCJ A;  4I7A A;  3CQZ H;  3ERQ A;  1TWG H;  4R4O A;  1QJO A;  1ZXT A;  5CV4 A;  4YCW A;  2IX3 A;  2D0O A;  1GUN A;  3W1B A;  4FF2 A;  1TII D;  2RSO A;  1AFP A;  2R6G A;  3J7A F;  2R93 H;  1VQF A;  2Z4H A;  2N49 A;  1FL0 A;  1PRT B;  3AQQ A;  1L1O C;  1SRU A;  1DD2 A;  4X65 L;  3J81 E;  1HXY D;  1BOS A;  3PO3 G;  1CK1 A;  4H0L C;  3I4M G;  3RNU A;  3OIQ A;  4NP5 A;  1S5F D;  1EQQ A;  1DCZ A;  1FR3 A;  1HNX Q;  1I3Q H;  3HOV H;  4POF A;  2K5Q A;  1QCB D;  2SNS A;  1C8C A;  1WCM H;  2R93 B;  1LT6 D;  4DAP A;  4DR4 Q;  5M5W B;  5K36 H;  1IW7 D;  1X3P A;  1HNX L;  4A3B H;  1SMY C;  1STB A;  1HNZ Q;  3JAM E;  4A3J G;  3HS0 C;  3F2C A;  3DLL A;  5J22 A;  1WTO A;  3S17 B;  1ZYR D;  5E7N A;  4JC0 A;  2F1M A;  2I5M X;  4DR4 L;  3Q22 A;  1WCM B;  2MFI A;  5JAV A;  4HJ9 A;  2JA5 B;  5BR8 Q;  1EU4 A;  4UAI A;  1WYD A;  3PUZ A;  1FNV A;  2EYJ A;  1HNZ L;  2WAQ E;  4XQN A;  4HJ7 A;  2Z6K C;  1SYC A;  1YVC A;  1I4R A;  2PYK A;  4K8I A;  3WOE A;  1CQF A;  1VQK A;  1HH2 P;  1NAP A;  3J7A V;  4RAU C;  5BR8 L;  1IYJ B;  1JQY D;  3D8G A;  1HHV A;  3IKJ A;  3CCL A;  4DAM A;  4BY1 H;  3DM3 A;  1XPU A;  1HUM A;  1G29 1;  4HSP A;  1VQ7 A;  1RKN A;  5LMU Q;  2B2U C;  1EY9 A;  2Q8T A;  3J80 L;  5DEH A;  4EQP A;  2QIL A;  3Q6S A;  1TWF H;  1Z47 A;  3LWU A;  2UXC Q;  2BA1 A;  2J7Z A;  1I50 H;  4JBK A;  1NMF A;  4PMC A;  1F2Y A;  3VDY A;  1J9O A;  5IYD H;  1VQI A;  5LMU L;  5J39 A;  4BY1 B;  4L5S A;  3MXN A;  3RMH A;  3I55 A;  3F1Z A;  1Q3L A;  1F9S A;  3SK5 A;  2UXC L;  3I4N G;  4JI3 Q;  4TQU S;  5C4J B;  2KA7 A;  1TWF B;  4OO1 H;  2HQL A;  3PF4 A;  4BXX G;  2IPK D;  3QIA A;  2EXD A;  3GQB A;  3KUP A;  3H3V I;  1B8A A;  3H0G B;  4A3G H;  5C3W A;  3RZD H;  1B4O A;  3BVZ A;  4JI3 L;  4HIM A;  1V1Q A;  3MEF A;  4P74 A;  2YU9 H;  3SR1 A;  3GTQ B;  3TQY A;  1PYW D;  3SGI A;  3J80 c;  4YWL A;  4GKK Q;  1V1P A;  4UY8 C;  3CHB D;  1Q7Y C;  3SXH A;  1CA6 A;  4A3G B;  5KIX A;  1EY8 A;  1TS5 A;  1KD1 C;  2WV6 D;  5IP9 H;  2YU9 B;  5IIF A;  2DGY A;  4GKK L;  4ZUJ A;  2AWN A;  4F88 A;  5HGQ A;  1BCP C;  4DGZ A;  3KDF B;  1VQC A;  3CC2 A;  1KHI A;  5IGC A;  1W6J A;  1SR3 A;  5KGU A;  1RF2 D;  1J5E L;  3G4S A;  3LNN A;  1F2L A;  4AIM A;  4JI0 Q;  1TWA H;  1EQR A;  2R7Z G;  1A3U A;  1SJE D;  4MTK A;  3MWY W;  1C48 A;  1GUG A;  1K83 B;  3GP7 A;  3KF6 A;  2M2L A;  1LTB D;  1I6V C;  2MQH A;  3NBI A;  5HY6 A;  4O42 A;  4A3E H;  2K5W A;  5IGF A;  4JI0 L;  1FVI A;  3T1Y Q;  2B8F A;  1U5K A;  1DYQ A;  4NMZ A;  1TWH H;  3NHH A;  4BA2 I;  2E2I H;  1E0B A;  3A54 A;  4QCL A;  3STB C;  4F87 A;  5M3F H;  2MHV A;  1X56 A;  1GXD C;  1I94 Q;  3FKI B;  2EVB A;  1EFI D;  2K5D A;  3PUV A;  1FGU A;  4ZKC B;  4UP8 A;  4KKT A;  3A7L A;  3UE0 A;  2Z9H A;  1N32 Q;  1B7Y B;  1TWH B;  2EOT A;  2WB1 E;  1BO0 A;  1PH8 A;  1I94 L;  3J81 i;  4P73 A;  1FJG Q;  4A93 G;  4WJ4 A;  3G71 A;  2RCF A;  1N32 L;  1I4H A;  4BY7 G;  2F03 A;  3PV0 A;  3I4L A;  5M5X H;  2AMC B;  1A6X A;  3GTL B;  2JA8 H;  2F4I A;  2XNA C;  3N6R A;  3T1H Q;  4C3H G;  1FJG L;  4BBR B;  1PH4 A;  1SNO A;  1LTS D;  1T9H A;  2IJ0 A;  5C6A A;  5A2Q E;  1HA6 A;  4KJO A;  4R1J A;  5CMD A;  1SRO A;  1EFW A;  4ID6 A;  4ZQ3 A;  2A69 C;  4FF3 A;  2I46 A;  1HZA A;  1B9N A;  2PCF B;  2KUM A;  3SK6 A;  2EY2 A;  3H6M A;  2B2V A;  4HJA A;  1HQM C;  1FNU A;  1SE4 A;  3FPU B;  3KBG A;  1J6Q A;  1VMP A;  4EGV A;  1M8A A;  2TSS A;  1JC7 A;  4QIW E;  4P72 A;  4JI6 L;  3A56 A;  3FDT A;  2HQE A;  5F2D A;  2F0W A;  1SYE A;  2YYZ A;  1QZG A;  4R4I A;  3NTI A;  1CQV A;  1YNX A;  2F0O A;  3AFP A;  2AWO A;  3OSO A;  2HIV A;  3UI2 A;  3GTO H;  4PZ6 A;  1OXT A;  3BDO A;  3PO3 B;  2K03 A;  5BN4 A;  4J15 A;  1F9R A;  1PZI D;  3S1N B;  2HD3 A;  4OWX B;  4A3L H;  2IX1 A;  1VDZ A;  1ICF B;  2B2T A;  4UHV A;  2F0E A;  2VZA A;  1O80 A;  1G6Z A;  4HTH A;  1Y14 B;  2NN6 H;  2A68 C;  3U9S A;  3SK8 A;  2C9O A;  1EOV A;  3RZO H;  2AUJ D;  4A3D G;  3BVG A;  1B70 B;  3AB9 A;  5CR3 A;  3R3O A;  2XTI A;  3M4P A;  5IYB G;  4YIJ A;  1R4P B;  4CDE C;  5DAU A;  4A3F G;  1C4Q A;  1LTT D;  3NXW A;  1XPR A;  1SBB B;  4AYB E;  1Z6H A;  2B8G A;  2B2Y C;  4YWM A;  1QOH A;  2UXB Q;  1L1O A;  3AMU A;  4FXK C;  4RGT A;  2RF4 A;  1Q90 A;  2YTY A;  2BDO A;  5JJZ A;  2EXZ A;  3F2U A;  3NTK A;  3TDQ A;  2K14 A;  1JOR A;  2G5D A;  4MHE A;  4IPH A;  4OHJ A;  1EU3 A;  2JA7 H;  5D65 A;  4EQO A;  2H5X A;  2X69 A;  4JBW A;  1HRJ A;  1XX8 A;  2AUK A;  4C2M H;  3NEM A;  3S2D B;  2IY5 B;  2CW0 D;  2JEB I;  4B3R Q;  1YHB A;  1SYG A;  1ILQ A;  2O4X A;  2CVR A;  1AN8 A;  5C0X G;  3FMC A;  2YTV A;  2D62 A;  4IN3 A;  4B3R L;  3I4N B;  4C2M B;  2WKC A;  4XYO A;  4A3C H;  1ML0 D;  4RGM A;  5EPK A;  4K5X A;  2SOB A;  3D4D A;  1YIJ A;  2Z6K A;  2PMZ B;  2KHI A;  1K9M C;  1IW7 C;  1E2Z A;  5L37 A;  4FXD A;  3NK9 A;  1KDC A;  2CH4 A;  2B2U A;  2F0D A;  4CBV A;  1JT8 A;  3KBX A;  2R93 G;  5DLQ E;  3IAY A;  3NWS A;  5KNC A;  2JP1 A;  3H15 A;  3D4W A;  4DV3 Q;  1XPO A;  2GA4 B;  1Q8I A;  5E3F A;  1G2T A;  1U4L A;  1BBU A;  3T4A C;  2EDG A;  2K04 A;  2RVL A;  1Q81 C;  3HOV G;  3JAM L;  4X3K A;  2D9U A;  4XXE A;  4PNY A;  1WCM G;  4QB4 A;  1VQ4 A;  4K5W A;  4WJ3 M;  5K36 G;  2V4D A;  3QG1 A;  4A3B G;  4IAL A;  2FIN B;  2K28 A;  2R7Z B;  1H9K A;  1MKH A;  1UWV A;  1WOC A;  1LAB A;  4F7X A;  2BH8 A;  4Q0F A;  5FO9 B;  3NBH B;  2L4N A;  1DZ1 A;  3DM1 A;  5D14 A;  4N9P A;  4X66 Q;  2I5L X;  1S72 A;  4KHZ A;  2F0V A;  4DR6 Q;  3S24 A;  1WD1 A;  3I90 A;  3JAM c;  3M4O H;  1NY4 A;  4BY1 G;  5KRU A;  3X3M A;  3HZX A;  2ZXP A;  4DNI A;  1XTD A;  1II3 A;  2NVQ B;  3K80 C;  4GNX C;  4M1U B;  3E9H A;  3NQT A;  3PGZ A;  1JWS D;  1GHJ A;  2ALY B;  4IOC A;  3E6Z X;  4DU9 A;  5IYD G;  1RCV D;  1PXU A;  4IPG A;  3MTS A;  4HJ8 A;  3PO2 H;  3KLR A;  5ELO A;  4FNF A;  4DR7 Q;  1NSN S;  1KQS A;  1WTH A;  2IL8 A;  2R7F A;  4PZ8 A;  2NZ1 D;  5EPJ A;  4IUV A;  1H9J A;  1VQO A;  4K0K L;  2FMM A;  2EYP A;  5D3D A;  1UAP A;  1WJJ A;  2JEA I;  4OO1 G;  1PYS B;  1LT4 D;  2K5V A;  2JA9 A;  1V43 A;  4C56 C;  3T16 A;  4DR7 L;  1JOO A;  5C4Z A;  3TME A;  3RLF A;  4A3G G;  1CI3 M;  2Q2I A;  5C4X H;  4KY5 A;  2EYH A;  3VR4 A;  4O0A A;  3QOJ A;  1JE4 A;  1JCK B;  4DR5 Q;  1O7L A;  4LF9 Q;  1EOT A;  1IBM Q;  4G4K A;  1Q82 C;  2NVY H;  4KI0 A;  3CU7 A;  5C4X B;  1YNN D;  3KF8 A;  5IP9 G;  5IYC H;  1JB3 A;  4ZLT F;  4DR5 L;  4LF9 L;  2F0K A;  3QO2 A;  1UE6 A;  4AQY Q;  1IBM L;  4RHS A;  2Q2H A;  1C9O A;  5C0X J;  1ROD A;  2SDF A;  1GHK A;  2NVY B;  4CJ0 B;  3A8I E;  4DK1 A;  3MVV A;  2CQO A;  1Y8N B;  1UEA B;  1VQ8 A;  3H94 A;  3TRZ A;  2Q2T A;  4DFA A;  2KCC A;  2DNE A;  1BQQ T;  2A6E D;  2DUD A;  4R8I A;  2OXP A;  4A3E G;  1XNQ Q;  4R4T A;  1PVO A;  1I6H H;  5I9O A;  5NUC A;  3URY A;  1Y8P B;  4JCV E;  4A3M H;  1EWC A;  3S16 H;  3T13 A;  4A3D B;  2NBF A;  1YIT A;  2OEO A;  1XMQ Q;  1D7Q A;  3CPF A;  2K32 A;  5M3F G;  1XNQ L;  4GOP B;  3J7A 5;  2RQX A;  1LO5 D;  4O2D A;  3MXP A;  2RCN A;  4X64 Q;  4A3F B;  5CV7 A;  3UDG A;  4IFD I;  3FPP A;  2RHS B;  1F9P A;  2VL6 A;  4ODG A;  1IYV A;  4HCE A;  3GO5 A;  1XMQ L;  4DNT B;  2KHS A;  3S16 B;  3DEO A;  5CV6 A;  2OWO A;  1O7Y A;  3W3A A;  2E8G A;  3PIO 3;  1Q8K A;  5FLM H;  4QUC A;  3MZ5 A;  4KHP L;  3C3L A;  2VNU D;  4X64 L;  5IT9 E;  1JJG A;  2N78 A;  4DUY L;  3K7A H;  1V8Q A;  4WFN 3;  2RDG A;  3EJI A;  1WVL A;  5HUR A;  5I9P A;  1KNA A;  3PIP 3;  2JA8 G;  1SFO B;  2WB1 G;  3MXU A;  1VS0 A;  2F52 A;  2L11 A;  1NJI C;  2L12 A;  5LMN L;  5IGB A;  3I72 A;  2DJF C;  4EQN A;  4CKC A;  2K7V A;  3BZD B;  1CSP A;  3K7A B;  1QG7 A;  3VA5 A;  5COR A;  1VQB A;  3VYT A;  1YBY A;  2NYZ D;  4X65 Q;  2F0I A;  3HKZ E;  5T1I A;  1ET6 A;  1PH6 A;  4KJN A;  4UP9 A;  2CCZ A;  3AEV A;  2B2Y A;  1HCZ A;  1XWE A;  5C5M A;  1QVG A;  1K28 A;  2AQ2 B;  3A8J E;  1X9N A;  1D1K A;  1Y1V H;  2P5Z X;  4LUV A;  3VA7 A;  2BE5 D;  1EY5 A;  3K0Y A;  1N8R C;  4GN4 B;  1OXX K;  3CQZ B;  4IUT A;  1GVP A;  1CFM A;  4RGO S;  5ISR A;  1TWG B;  3S1M H;  1LT5 D;  4X3T A;  5I4D A;  1T5E A;  2K52 A;  2RDH A;  1STH A;  3G7L A;  1EL0 A;  3MC0 B;  1H9S B;  1Y69 U;  2PQA A;  3C46 A;  3RN5 A;  5LHY 1;  2PO4 A;  1JMC A;  1ILP A;  2F0L A;  4K2K A;  3S1M B;  4A3L G;  4C3I H;  1I3Q B;  1XTC D;  3HOV B;  4A76 A;  3U4Z A;  2NN6 G;  3TS0 A;  5IOD A;  4ZK9 B;  1SE2 A;  5LL6 S;  3CCS A;  1O7Z A;  4G57 A;  2I07 B;  1KAW A;  4OON A;  2A6H D;  4A3B B;  4A3I H;  2NZH A;  2E74 C;  1EYD A;  3I56 A;  3OIP A;  3TS2 A;  1PTO H;  4YHH Q;  2Z0S A;  5EPL A;  5BN5 A;  4KKS A;  2CW0 C;  1IKL A;  1A15 A;  3HKS A;  1HQR D;  2QEJ C;  2ICE C;  3L7Z C;  4OX9 Q;  4LAA A;  1O78 A;  1EIH A;  5JEA J;  4YHH L;  1TVX A;  1CKN B;  2OT2 A;  2PZW A;  1HFN A;  1PTO B;  1XYI A;  1IZ6 A;  1HZ9 A;  1HFG A;  2QW7 A;  4OX9 L;  5FLX E;  4AYB G;  1Z7T A;  1A3V A;  4GLA C;  3F2D A;  1HR0 W;  5C44 H;  2JA7 G;  3PMF A;  1VQE A;  2CHB D;  4FDB A;  2G9D A;  1TS2 A;  4KY6 A;  2WAQ B;  4JI7 L;  1I50 B;  5JJI A;  2L15 A;  1KIX A;  4OWT B;  3KDF A;  1G6P A;  3F2B A;  1A3T A;  1KDA A;  3ZYY X;  5E1F A;  5C44 B;  3M4Y A;  1LTL A;  4H7B A;  3CMA A;  1FD7 D;  4CKE A;  2V1C C;  1WTW A;  3FHW A;  4A3C G;  3BYY B;  3OPO A;  4HID A;  2QCP X;  3FRP B;  4R4Q A;  3GDE A;  1IBL Q;  1EZ8 A;  3RZD B;  1HZB A;  1LUZ A;  4UDU C;  1DOK A;  1J5E Q;  4BBS H;  4IUR A;  1MD2 D;  3PUX A;  2C5C A;  3PUW A;  2WFW A;  4JI8 Q;  1IL8 A;  2DJG C;  5IGD A;  4GNX A;  1K8A C;  1DM0 B;  1RDP D;  1VQD A;  4GS3 A;  1IBL L;  2PZU A;  5JEA H;  1PLF A;  2E2J H;  3E3X A;  1KLG D;  4Y7N H;  4RCO A;  5E4X A;  1BVS A;  4C3J H;  4DK6 C;  3NP8 A;  5JVG 3;  1R9T H;  4JI8 L;  3OMG A;  1VMC A;  3TP5 A;  2MPM A;  2VB3 X;  2ZTC A;  3TBI B;  4JI2 Q;  3PF5 A;  2VUM H;  1D5X C;  2LY7 A;  2DN8 A;  2EIF A;  3C1F A;  1VF7 A;  1UE7 A;  4Y7N B;  1CUK A;  5JJL A;  4QQB X;  2VXW A;  1TWA B;  3VYS A;  3ND8 A;  4JI2 L;  3A5Z B;  1D5Z C;  2UUA Q;  3KLS A;  2BOS A;  3HRZ C;  3HOW H;  4CKB A;  1ESF A;  2VUM B;  4A3E B;  2F0U A;  4B3S Q;  1S5D D;  1TU2 B;  1HJP A;  2UUB Q;  2UUA L;  3MXG A;  2F0T A;  2E2I B;  2DY8 A;  3I8Z A;  1PFB A;  5M3F B;  4B3S L;  3CF5 A;  3Q23 A;  4LF7 L;  1IKM A;  4DPG A;  1STE A;  3ER0 A;  2UUB L;  3I4O A;  2K1B A;  4KLK A;  5E4W C;  1MSG A;  3EQL C;  3KF6 B;  3U58 A;  2YTX A;  4DUZ Q;  2K5N A;  1LTI D;  3PO2 G;  1LYL A;  5IY0 A;  4ME3 A;  1LM0 A;  2OCE A;  3BG3 A;  5ELD A;  1AZQ A;  1MJC A;  4DV4 L;  1CA5 A;  4GZY C;  2E75 C;  5FJ8 H;  2QDB A;  4EVO A;  1ESR A;  1S40 A;  1YNN C;  1QNK A;  4DUZ L;  5M5X B;  2ID0 A;  1KTK A;  3RD4 A;  4U68 A;  2JA8 B;  4JI6 Q;  1BUV T;  2WB1 B;  1TS3 A;  1NE3 A;  3M3Y H;  3H3V H;  4B3M L;  1JR0 D;  2A19 A;  3GTM H;  1Q1E A;  5C4X G;  2WAC A;  1V1O A;  3E5S A;  4CHT B;  4NW2 A;  3MEH A;  2F0G A;  3K5O A;  1DOM A;  2PNR C;  1SE3 A;  3D6C A;  2A6E C;  1GOZ A;  2UU9 Q;  3UDI A;  1N34 Q;  2HCC A;  1B3Q A;  1EIY B;  5IYC G;  2RA4 A;  3PIO A;  1CSQ A;  2ZXO A;  3HOU H;  3R2T A;  3SVM A;  2D2C C;  1HZC A;  4N8F A;  4KV6 A;  2UU9 L;  2OTL A;  1H9R A;  2EZV A;  1N34 L;  2Q8I B;  1PRT C;  1PFN A;  1SND A;  1PH5 A;  1Y1W H;  3PIP A;  5EKK A;  5IWA Q;  3PQI A;  3GTO B;  1KAB A;  2F0P A;  3BU2 A;  2XIW A;  4I7Z C;  3HOU B;  2ENB A;  4QIW B;  2F0N A;  4XIG S;  5I2Y A;  1W2B A;  2VW9 A;  1X3F A;  4KTA A;  5IWA L;  1I5F A;  1NNX A;  4PV1 C;  4A3M G;  3RZO B;  4L63 B;  4YCV A;  4ME5 A;  1TY2 A;  2X6G A;  5JJK A;  1Y8O B;  3A55 A;  4WJW A;  3WDN A;  2O5J C;  3EA6 A;  4YWK A;  4LFC Q;  1D8L A;  5GAH C;  2XGT A;  3CW2 C;  3KOJ A;  3OWF A;  1E24 A;  4E6I A;  4X3S A;  5HGT A;  4QL5 A;  1AE2 A;  1SXT A;  4P2C B;  3S2H H;  1VCI A;  1D5M C;  5LMN W;  5FLM G;  3UDX A;  5FK9 C;  4LFC L;  2B29 A;  4B08 A;  1STG A;  5C3E H;  3MHB A;  1J8I A;  3KK7 A;  3D0F A;  4A3K H;  1X6O A;  1NMG A;  4ABN A;  4DK3 C;  4AYB B;  1ZKO A;  3DUZ A;  2A5H A;  2JA7 B;  2CKZ B;  3DHQ A;  1HR0 L;  1L0Y B;  2F3V A;  2N3S A;  1QUQ A;  1TS4 A;  2EYL A;  5C3E B;  1OXS C;  2B63 H;  3HOZ H;  2WIN B;  3IFT A;  1EY0 A;  3BDL A;  2KCT A;  1Q86 C;  4LF4 Q;  4FF1 A;  3EFX D;  1I4G A;  2OF1 A;  1UNS A;  3J81 L;  4HMI A;  1H9M A;  2O2L D;  2MO1 A;  3ONA B;  1GJX A;  1N33 Q;  1RTO A;  2L0C A;  3CD6 A;  1GUT A;  5G3L D;  4LF4 L;  2EJM A;  2JA6 H;  4LMQ D;  1VQH A;  2JXM B;  3W2D A;  3ULL A;  1Y1V G;  3RN2 A;  1AEX A;  3P7J A; 
#chains in the Genus database with same CATH homology
 3CCL A;  4DAM A;  1RIP A;  3DM3 A;  4BY1 H;  1XPU A;  1G29 1;  1VQ7 A;  1TXY A;  2DUD A;  5LMU Q;  1N33 L;  4IJL A;  4QJF A;  4A3E G;  4ALP A;  1XNQ Q;  1YI2 A;  4R4T A;  1Z9F A;  3GTG H;  1I6H H;  1PVO A;  1TWF H;  1Z47 A;  2UXC Q;  2BA1 A;  3JAM i;  4LF8 Q;  4A3M H;  4JCV E;  1I50 H;  1XMO Q;  1NMF A;  4LW1 A;  3VDY A;  4JBK A;  3S16 H;  4JV5 Q;  5IYD H;  1VQI A;  1YIT A;  2CWP A;  1P8L A;  4JYA Q;  2BA0 A;  3T1H L;  1XMQ Q;  5LMU L;  1WFQ A;  4GKJ L;  1D7Q A;  3K0X A;  5IP7 G;  5EAY A;  4L5S A;  2VQE Q;  3CPF A;  2NZO A;  5M3F G;  3OTO Q;  4DV6 Q;  1XNQ L;  4GOP B;  3J7A 5;  3I55 A;  3F1Z A;  4LUO A;  4O2D A;  4UP7 A;  1IBK Q;  2RCN A;  4X64 Q;  4LF8 L;  3I4N G;  3J81 c;  3UDG A;  4JI3 Q;  4IFD I;  1XMO L;  4JV5 L;  2RHS B;  4TQU S;  1PH7 A;  1YHA A;  2VL6 A;  4QY7 A;  4JYA L;  2CWA A;  3GO5 A;  1XMQ L;  2HQL A;  2N8N A;  2NVX H;  2NVT H;  3PF4 A;  4BXX G;  2OWO A;  3PO3 H;  2VQE L;  4DV6 L;  2UXD Q;  3OTO L;  3E9I A;  2EXD A;  3H3V I;  3I4M H;  2E8G A;  1B8A A;  1Q8K A;  3S1N H;  5FLM H;  4A3G H;  1JJ2 A;  4KHP L;  3RZD H;  3D31 A;  1IBK L;  4X64 L;  2VNU D;  3UE1 A;  4JI3 L;  3CCV A;  2PNH A;  4DV0 Q;  1V1Q A;  4HIM A;  4A3I G;  3MEF A;  4P74 A;  2YU9 H;  1JJG A;  2N78 A;  4DUY L;  3EN2 A;  3K7A H;  3TQY A;  3SGI A;  1N36 Q;  3W5O A;  3J80 c;  1EUJ A;  4APV A;  4OO1 G;  2UXD L;  2JE6 I;  4YWL A;  4GKK Q;  1IXR A;  3JC6 6;  4LNQ A;  2JA8 G;  2KBN A;  4XTC S;  4UY8 C;  1A63 A;  2KHJ A;  3L2P A;  1Q7Y C;  4L5T A;  4DV0 L;  2E2H H;  2WB1 G;  4JI5 Q;  1VS0 A;  2F52 A;  1QVF A;  1KRT A;  1NJI C;  1A62 A;  3TRE A;  4A3J H;  5LMN L;  4POG A;  3HOX G;  1KD1 C;  3CCU A;  1N36 L;  5IP9 H;  2WAQ G;  4DV5 Q;  4K0K Q;  2DGY A;  4GKK L;  1CSP A;  2AWN A;  1QZH A;  2A1A A;  1UE1 A;  4Y52 H;  5HGQ A;  1VQB A;  3KDF B;  1VQC A;  4EQ5 A;  1YBY A;  3CC2 A;  1KHI A;  4JI5 L;  4X65 Q;  4A75 A;  1VQP A;  1SR3 A;  3HKZ E;  3AFQ A;  1PH6 A;  3AEV A;  4UP9 A;  2CCZ A;  5BR8 L;  1J5E L;  5C44 G;  3M85 A;  1K3R A;  3G4S A;  1NTG A;  3G48 A;  1MIU A;  4DV5 L;  4AIM A;  4JI0 Q;  1X54 A;  3J81 j;  1QVG A;  4IOA A;  1TWA H;  1EQR A;  2R7Z G;  1X9N A;  1Y1V H;  3WWV A;  4LUV A;  1N8R C;  2VQF Q;  4GN4 B;  1OXX K;  3KF6 A;  3PSI A;  5C0X I;  1GVP A;  3GTL H;  2MQH A;  5HY6 A;  3RLN A;  4JBM A;  3S1M H;  4A3E H;  3PCO B;  1OTC A;  2I0Q A;  4JI1 Q;  1YZ6 A;  3E0E A;  1L2F A;  2K52 A;  1HR0 Q;  4JI0 L;  1FVI A;  3T1Y Q;  3S2D H;  3GD7 A;  4PMW A;  4DV2 Q;  3UDF A;  5FLX c;  1U5K A;  2PMZ E;  4P75 A;  1TWH H;  2VQF L;  4BA2 I;  1VQ9 A;  1X3E A;  1EWI A;  2PQA A;  3B6Y A;  2E2I H;  3RN5 A;  1TWC H;  3STB C;  5IP7 H;  1JMC A;  5GQO A;  5M3F H;  5H1S E;  2PI2 A;  1X56 A;  1I94 Q;  4JI1 L;  1E22 A;  2QEX A;  4LFB Q;  1VQG A;  2UXB L;  2LXK A;  4A3L G;  4DV2 L;  3PUV A;  1FGU A;  2ZJP A;  3I4N H;  4C3I H;  4BBS G;  3M4Q A;  3HFZ B;  4UP8 A;  4A76 A;  1UE5 A;  3GTK H;  3UE0 A;  1KL9 A;  3U4Z A;  1AE3 A;  2NN6 G;  4PG3 A;  3HOY G;  2PI2 E;  3TS0 A;  1N32 Q;  2F4V L;  1B7Y B;  1GKH A;  5IT9 c;  4BXX H;  2WB1 E;  1PH1 A;  1PH8 A;  3CCS A;  4HIK A;  1I94 L;  4LFB L;  4OXP A;  1KAW A;  1SMX A;  4PZ7 A;  4OON A;  1L1O B;  3RLO A;  5JEA G;  3J81 i;  1VQL A;  4P73 A;  1FJG Q;  4DR3 Q;  4A3I H;  2NZH A;  4A93 G;  4WJ4 A;  3I56 A;  1WI5 A;  3TS2 A;  3NEL A;  3G71 A;  4JOI A;  3GTJ H;  4IPD A;  4YHH Q;  1N32 L;  2Z0S A;  4YY3 Q;  4BY7 G;  2GVA A;  3PV0 A;  5M5X H;  3CP0 A;  2AMC B;  3HKS A;  3L0O A;  4IPC A;  2GN5 A;  2JA8 H;  1YJ9 A;  2R92 G;  2R7D A;  4DV1 Q;  3A0J A;  3T1H Q;  3L7Z C;  4GKJ Q;  4OX9 Q;  1Q12 A;  4DR3 L;  4L5R C;  1FJG L;  2VUM G;  1PH4 A;  1T9H A;  2LSS A;  2LXJ A;  3J80 i;  5JEA J;  3HOX H;  4YHH L;  3HKZ G;  4YY3 L;  2ZM6 Q;  1CKN B;  4LF5 Q;  4R1J A;  1SRO A;  4LWC A;  4MTN A;  4MNO A;  1EFW A;  1IZ6 A;  3CC7 A;  1HZ9 A;  4DV1 L;  4X6A H;  4OX9 L;  5AJ3 Q;  4AYB G;  4H02 A;  1HZA A;  4GLA C;  4DKA C;  4NPS A;  3F2D A;  4NXN Q;  1HR0 W;  5C44 H;  3HOW G;  2JA7 G;  4KHP Q;  1QUQ B;  2ZM6 L;  2FXQ A;  4LF5 L;  4GN5 A;  1VQE A;  4FDB A;  3Q8D A;  3KF8 B;  4HJA A;  3CCQ A;  2R7Z H;  4DUY Q;  2JJQ A;  3CCE A;  3ULJ A;  4JI7 L;  1J6Q A;  3CC4 A;  1PFS A;  5JJI A;  1OXU A;  5M5Y H;  2HT1 A;  5AJ3 L;  4DR2 Q;  4QIW E;  4P72 A;  4JI6 L;  1H95 A;  3S1R H;  2JA5 G;  4NXN L;  2GVB A;  2L15 A;  2Y0S G;  4DV3 L;  2EQS A;  1OXV A;  2OQK A;  3KDF A;  4OWT B;  4AH6 A;  1KIX A;  1C0A A;  3F2B A;  1G6P A;  1PYB A;  2I5H A;  2YYZ A;  1QZG A;  1PH9 A;  4R4I A;  5GAG C;  3CMA A;  1LTL A;  3BZC A;  3S14 H;  5LMN Q;  1NBW A;  1YNX A;  2V1C C;  3IRB A;  3J7Z C;  3AFP A;  3FHW A;  2AWO A;  3CAM A;  3W1G A;  2ZJR A;  4A3C G;  4HJ5 A;  1SN8 A;  4YCU A;  3K81 C;  2HIV A;  4DR2 L;  2ASB A;  3GTP H;  3GTO H;  4PZ6 A;  4HID A;  1A8V A;  1OXT A;  1P16 A;  1L0W A;  3M9B A;  4J15 A;  4R4Q A;  3GDE A;  1X3G A;  1IBL Q;  1U0L A;  4OWX B;  1YEZ A;  4A3L H;  2IX1 A;  2NVQ H;  1HZB A;  1LUZ A;  4BBS H;  4DAY B;  1J5E Q;  2K4K A;  1BBW A;  2VZA A;  1XNR Q;  3PUX A;  1DGS A;  1Y14 B;  3PUW A;  4LF6 Q;  3HOY H;  4OO1 I;  5FJ8 G;  1V9P A;  1EYG A;  4IFD G;  2WFW A;  5GRO A;  4NB3 A;  1EOV A;  4JI8 Q;  3RZO H;  4GNX A;  4HIO A;  1K8A C;  3S15 H;  2OTJ A;  1VQD A;  1CKO A;  4GS3 A;  2Q2U A;  1IBL L;  4A3D G;  1B70 B;  3I7F A;  2VS1 A;  1K73 C;  1E3P A;  2XTI A;  2RHQ B;  3M4P A;  5IYB G;  2E2J H;  4A93 H;  1XNR L;  4Y7N H;  1BVS A;  4C3J H;  4JBJ A;  4DK6 C;  4LF6 L;  4X66 L;  2AHO B;  1R9T H;  1PA6 A;  1K0R A;  3BJU A;  4A3F G;  4JI8 L;  4BY7 H;  1XPR A;  5M3M G;  4AYB E;  5J3B A;  1PHJ A;  2ZJQ A;  4DR6 L;  2ZTC A;  2ZTE A;  3STB D;  2WP8 J;  2R92 H;  1HNW Q;  1YJW A;  1IL2 A;  4C3H H;  4JI2 Q;  3PF5 A;  1UEB A;  4YWM A;  1VQN A;  2VUM H;  2F3I A;  3G6E A;  2KCM A;  2EIF A;  3H0G G;  1XJV A;  1W3S A;  4JG2 A;  2UXB Q;  1L1O A;  2CFM A;  1UE7 A;  1CUK A;  5JJL A;  4QQB X;  2RF4 A;  2YTY A;  3K8A A;  2IHF A;  2Y0S E;  1HNW L;  3KLW A;  4EX5 A;  3M7N A;  2K5H A;  1K8G A;  1PH2 A;  2K14 A;  3A5Z B;  4JI2 L;  2F4V Q;  4A4I A;  2UUA Q;  2ZTD A;  5M5W H;  1KC8 C;  4IPH A;  4LFA Q;  3HOW H;  3HOU G;  1EIF A;  2JA7 H;  3S1Q H;  2H5X A;  4B3S Q;  4JBW A;  2HHH Q;  4C2M H;  3NEM A;  1HJP A;  2IY5 B;  2JEB I;  2UUB Q;  1YHB A;  4B3R Q;  1VQ6 A;  3S17 H;  1CKN A;  2UUA L;  1Y1W G;  2JA5 H;  2MO0 A;  4LFA L;  1X65 A;  4X62 Q;  2KEN A;  1S3O A;  3ULL A;  3CF5 A;  2HHH L;  5C0X G;  4B3S L;  4MZ9 A;  4LF7 L;  3U50 C;  2YTV A;  2D62 A;  3CCM A;  4DPG A;  4GOP A;  3ER0 A;  3ZJY C;  2E5L Q;  2AKW B;  2UUB L;  4B3R L;  3I4O A;  3PUY A;  4A3C H;  2K50 A;  4KLK A;  2UUC Q;  2UXC L;  3EIV A;  3ULP A;  2MNA A;  1JB7 A;  2JK8 A;  1YIJ A;  3KF6 B;  2Z6K A;  3U58 A;  4BA1 I;  2YTX A;  4X62 L;  2K5N A;  4DUZ Q;  1Q46 A;  4DV7 Q;  3PO2 G;  1LYL A;  4UPA A;  4ME3 A;  1LM0 A;  1JJC B;  5IY0 A;  2KHI A;  5GAD C;  2E5L L;  3KFU A;  1AH9 A;  3CPW A;  3CCR A;  2OCE A;  1K9M C;  1KXL A;  1MJC A;  2UUC L;  4DV4 L;  1KRS A;  1YHQ A;  1ASY A;  5FJ8 H;  1GO3 E;  1JT8 A;  2PQA B;  1S40 A;  4JI7 Q;  4DUZ L;  4A3D H;  5DLQ E;  2ID0 A;  2R93 G;  1X55 A;  2B3G A;  4DV7 L;  4JI6 Q;  4AQY L;  3H15 A;  1E1O A;  1M1K C;  4DV3 Q;  5IYB H;  1XPO A;  1NE3 A;  3K7U C;  1MJE A;  3H3V H;  3M3Y H;  1BBU A;  2IHE A;  3FKI G;  4B3M L;  1N9W A;  1A0I A;  2A19 A;  2IT1 A;  2QGQ A;  3GTM H;  4A3F H;  1Q1E A;  1Q81 C;  5C4X G;  5M3M H;  3HOV G;  5C3E G;  5C4J H;  3KJO A;  1CKM A;  4NXM Q;  3AYH B;  3KYH C;  3OYY A;  4A3K G;  1WCM G;  2YV5 A;  3NEN A;  3F8T A;  1VQ4 A;  2A8V A;  1PH3 A;  2IX0 A;  3H0G H;  4WJ3 M;  5K36 G;  1M90 C;  4DR1 Q;  1PV4 A;  3LGJ A;  4A3B G;  4P71 A;  4RG1 A;  4NXM L;  2ES2 A;  2UU9 Q;  3GTQ H;  2QA4 A;  1G51 A;  3UDI A;  1MKH A;  1N34 Q;  1UWV A;  1WOC A;  1EIY B;  5IYC G;  2B63 G;  3HOZ G;  3PIO A;  2BH8 A;  1SE8 A;  1CSQ A;  1VQA A;  3HOU H;  3KJP A;  1SFO H;  1E1T A;  3NBH B;  4GN3 B;  4DR1 L;  3EBE A;  1HZC A;  4L5Q A;  4BBR G;  2UU9 L;  2OTL A;  3ICE A;  1N34 L;  1GM5 A;  5IE8 A;  1E7Z A;  4X66 Q;  2I5L X;  1S72 A;  3ERS X;  2VY3 A;  1PH5 A;  1Y1W H;  4KHZ A;  3PIP A;  3A5U A;  1VQ5 A;  2JA6 G;  4DR6 Q;  5IWA Q;  3S24 A;  2JQO A;  3RR5 A;  3BU2 A;  1O7I A;  1QVC A;  3MXN B;  3JAM c;  5GAE C;  3M4O H;  1NY4 A;  4BY1 G;  1GD7 A;  3CXC A;  4DNI A;  1XTD A;  3FP9 A;  4XIG S;  3BZK A;  1W2B A;  3K80 C;  4GNX C;  3TEH B;  2VW9 A;  3E9H A;  4GLX A;  3PGZ A;  2ATW A;  1X3F A;  3I2Z A;  2ALY B;  4IJH A;  5IWA L;  3CME A;  1I5F A;  4IOC A;  4LUZ A;  4B3T Q;  4A3M G;  4IFD J;  5IYD G;  1JE5 A;  1K83 H;  4YCV A;  3CQZ H;  4R4C A;  3CCJ A;  4IPG A;  4HJ8 A;  4OWW B;  3PO2 H;  5ELO A;  1TWG H;  4R4O A;  3OW2 A;  4DR7 Q;  4YCW A;  5JJK A;  1KQS A;  2D0O A;  1RL2 A;  2R7F A;  3W1B A;  4PZ8 A;  2NN6 I;  3RN2 A;  4YWK A;  4LFC Q;  1D8L A;  5GAH C;  2R6G A;  2XGT A;  3CW2 C;  1VQO A;  4B3T L;  4K0K L;  4JI4 Q;  2R93 H;  3KOJ A;  1WJJ A;  1VQJ A;  1E24 A;  1VQF A;  2JEA I;  2N49 A;  1FL0 A;  1PYS B;  2BH2 A;  1Q1B A;  2K5V A;  1L1O C;  1SRU A;  2JA9 A;  1V43 A;  3AQQ A;  4X65 L;  4DR7 L;  2K75 A;  4QL5 A;  3PO3 G;  1AE2 A;  3FKI H;  3S2H H;  1VCI A;  3I4M G;  3RNU A;  5LMN W;  5FLM G;  3RLF A;  4LF7 Q;  4A3G G;  1EQQ A;  4QGU A;  3UDX A;  2C35 B;  4LFC L;  3A74 A;  1HNX Q;  2B29 A;  2Q2I A;  1I3Q H;  5C4X H;  3HOV H;  4POF A;  5C3E H;  4JI4 L;  4O0A A;  4GNX B;  3D0F A;  4A3K H;  1SLJ A;  1WCM H;  1NMG A;  1X6O A;  4DK3 C;  2OQ0 A;  1YJN A;  4DR5 Q;  4LF9 Q;  4DR4 Q;  2CKZ B;  1HNX L;  4IO9 A;  1HR0 L;  1IBM Q;  4A3B H;  3T1Y L;  1Q82 C;  2N3S A;  1QUQ A;  2NVY H;  1HNZ Q;  4KI0 A;  4A3J G;  4DV4 Q;  3F2C A;  4RMF A;  5IP9 G;  3DLL A;  1OXS C;  5IYC H;  2B63 H;  3HOZ H;  5E7N A;  2KCT A;  4JC0 A;  1Q86 C;  2I5M X;  4DR5 L;  4GOP C;  4LF4 Q;  2HIX A;  4LF9 L;  2MFI A;  4JOI C;  1UE6 A;  4HJ9 A;  5BR8 Q;  4DR4 L;  4AQY Q;  1IBM L;  1WYD A;  2Q2H A;  3PUZ A;  3U4V A;  4BBR H;  1C9O A;  2MO1 A;  1HNZ L;  4TVA B;  5C0X J;  4B3M Q;  2WAQ E;  4HJ7 A;  1N33 Q;  2Z6K C;  1ASZ A;  4GLV B;  1BKB A;  1YVC A;  1VQK A;  3CD6 A;  2CQO A;  1VQ8 A;  1C7Y A;  1HH2 P;  2JA6 H;  4LF4 L;  3TRZ A;  2Q2T A;  1VQH A;  1VQM A;  2D0P A;  1Y1V G;  1IYJ B;  5ELN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...