4GKKL

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aua-codon in the a-site and paromomycin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
124
Chain Sequence
b'PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 14
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4gkkL00
4J15A 4IPGA 1A62A 1ASZA 2K50A 1WYDA 4JI0L 1YBYA 1AH9A 1VQHA 2B63H 2VQFQ 1KQSA 1NE3A 1TXYA 4X62L 4JI4Q 4B3TQ 2IX0A 3LGJA 4DR1L 3TS0A 4A3JG 3J81c 3H3VI 4DV4Q 2VW9A 4B3ML 2ZJPA 3CCVA 2HHHL 2R92H 3GTGH 1S3OA 1PH2A 4OX9L 2JA5G 5K36G 1LUZA 1XNRQ 4DR6Q 5LMNL 3RLFA 4A3FG 1IL2A 4B3RL 4FDBA 1WJJA 3S24A 4DAYB 4NXNQ 4JI1Q 3UDXA 4LF4L 2FXQA 3KYHC 2MNAA 2JA6G 1PYBA 2B29A 3HOZG 4YY3Q 3S1MH 1PH5A 2KCMA 3I7FA 2HIXA 3ER0A 2E5LQ 3I4NG 4UP8A 1YHBA 2ZTDA 2CKZB 3PO2G 4QIWE 2GVBA 1UWVA 2UXBQ 4XTCS 4IJLA 3ERSX 3ULJA 5M3MH 4JI5Q 4DV6Q 4NXML 4DR7Q 5FLMG 2UU9L 2K4KA 1PH4A 3HOYH 1HJPA 4MTNA 3G48A 1XTDA 3T1HL 3GTOH 2Z6KC 5C4JH 1NMGA 1B8AA 4ME3A 3HOWG 3CCMA 1CKOA 1J5EL 3TREA 4JI2L 4LF8L 2MQHA 3E9IA 3GTQH 4JYAQ 2WP8J 3J7ZC 3J80c 4DAMA 3S16H 4DR3L 5C4XH 2V1CC 3S17H 3ZJYC 3L0OA 4JI1L 2EIFA 4LFCQ 1BKBA 1XPUA 5FLXc 1N34L 2YTVA 5IP9H 2JE6I 4HIKA 3CMAA 1VQCA 1HR0W 4A3BH 1SE8A 4NPSA 1S40A 2Y0SE 1FGUA 4AQYQ 1PH9A 1BVSA 1EIFA 2K5VA 1VQFA 2BH8A 2QGQA 3K0XA 1SFOH 4LF6L 5AJ3Q 3RZOH 4A3GG 4O0AA 4DV3L 3I4MG 3BZKA 2ES2A 1SRUA 4GLVB 3AEVA 5FJ8H 1OXUA 1TWHH 1V43A 2EQSA 4PZ7A 1E22A 3FKIG 2YU9H 3S2HH 3OTOL 3M9BA 2AWOA 2KBNA 5J3BA 4JI7Q 1IYJB 3F8TA 2E2HH 4BA1I 4GOPA 1VQ8A 3IRBA 1B70B 3JAMi 4GN3B 4DV5Q 2UUAQ 1VQIA 2NVTH 1CKMA 1VQEA 4YHHL 4JC0A 3EIVA 4JOIA 1S72A 1PV4A 4DR5Q 1XJVA 4UY8C 2F4VQ 3HOVH 2KCTA 2NVXH 4GKJL 2XTIA 1JJCB 1PYSB 2JK8A 4K0KQ 1IBLQ 3D31A 2B3GA 2DGYA 2RF4A 1QZHA 3UE0A 3T1YQ 1K8GA 3PV0A 5GQOA 1KL9A 4GN5A 4LFAL 3B6YA 2OCEA 1N33Q 4R1JA 1CKNA 3GTPH 4BA2I 1X3GA 3KJOA 3RN2A 2RHSB 3KF8B 1EQRA 4DV1Q 4L5QA 2L15A 3M4PA 1N36Q 1HNXQ 1PHJA 4QQBX 1VQMA 4PG3A 5IYBH 1KXLA 1QVCA 4DV7Q 1E1TA 1N9WA 4YWKA 5JJLA 2I5MX 3H15A 3A5UA 1Y1WG 5M3FH 5IYCG 2VS1A 1X6OA 2IHFA 3K81C 4MNOA 4LF7Q 4LF5L 5LMNW 4NB3A 2VUMH 4A93G 2WAQG 3HKSA 3M85A 1Y1VG 4B3SQ 1QVGA 4KHZA 5LMUL 1KAWA 1GM5A 4HJ9A 1Q1BA 3GTJH 1VQNA 1XNQL 4WJ3M 4DUZL 2AHOB 2PQAA 3CQZH 4JI3L 2JEAI 5JJKA 3HOXG 1NJIC 5E7NA 3I56A 2ZTCA 3CP0A 1I94Q 4JBMA 1YZ6A 4DR2L 2NVYH 2WFWA 1HNWL 2RHQB 3CPFA 3U4VA 1HZ9A 4GKKL 2RCNA 4JV5Q 4LF9Q 1VQJA 3PO2H 1H95A 4GOPB 4HJ7A 3OYYA 3GTLH 5M5WH 1EWIA 2ASBA 3KFUA 4A3JH 1PH3A 2N78A 4BY7G 4KHPL 3GD7A 3RN5A 3F1ZA 4A3CG 4LUZA 1V1QA 5ELOA 2JA5H 1XMQL 2MO1A 1Q46A 1SN8A 1VQ5A 3H0GG 3L2PA 4A3FH 3UDIA 1XPRA 4P75A 3AYHB 3TRZA 2QEXA 4TQUS 3EBEA 2JA6H 1OXXK 1A0IA 2NN6I 3HOZH 4Y52H 2R7ZG 4DK6C 3K8AA 4DK3C 2LXJA 3J7A5 3KDFB 4C2MH 1PH8A 2N8NA 1X54A 2IT1A 2Z6KA 4A4IA 4HIDA 2Q2IA 1QZGA 1SLJA 1X3EA 2UXDL 4JG2A 1BBUA 5FLMH 3CCLA 3CCJA 4IFDI 5IWAL 2K52A 1HNZL 2C35B 2OQKA 3K7AH 1PA6A 4BXXG 1C0AA 2E2JH 1E7ZA 3HOWH 1YJWA 2HT1A 2KENA 1N32L 1EQQA 4JI8Q 4X65L 1VQGA 1YITA 1A63A 5IYDG 1EUJA 1OXVA 3STBD 5EAYA 3GTMH 3KOJA 2AWNA 4BBSG 1SR3A 4A3LH 5C0XI 4PZ8A 1E3PA 2JA7G 3PF4A 5BR8Q 2VQFL 1WCMG 1SROA 1YIJA 2UXCQ 4PMWA 4HJAA 2PQAB 4JI4L 4GN4B 4B3TL 4DV4L 2UUBQ 3G71A 1BBWA 3CCSA 1G51A 2R6GA 3CW2C 4A3GH 3PUXA 3GDEA 1XNRL 4DR6L 4QGUA 3E9HA 3GO5A 4MZ9A 1K8AC 1JB7A 2BH2A 3I4MH 5C3EG 3HKZE 4NXNL 1CSPA 3M7NA 2HQLA 1L1OC 4DR4Q 3DM3A 4YY3L 5HY6A 3G4SA 5H1SE 1NMFA 2E5LL 1YEZA 2R93G 1VQ9A 1NY4A 4DV2Q 1AE2A 2YTYA 3FHWA 4PZ6A 1FJGQ 1L2FA 3A5ZB 1UEBA 3J81j 2UXBL 4DR7L 1I3QH 3PUZA 4JI5L 4DV6L 2OTLA 4EQ5A 1CSQA 3EN2A 1HH2P 1VQKA 2JJQA 2UUCQ 2IY5B 5C44H 1Q86C 3PIOA 3HOUG 5JEAG 4POGA 4P73A 5JEAJ 4AYBE 3GTKH 1U0LA 4JYAL 4O2DA 5JJIA 2Q2HA 3ULLA 1VS0A 2AKWB 5GROA 4LFCL 1WFQA 1VCIA 4OXPA 4DNIA 1IBKQ 2CCZA 2MFIA 5HGQA 5M5YH 3M4OH 1VQ7A 1WI5A 3KF6A 1IBMQ 4JI6Q 2PMZE 2H5XA 2VQEQ 1Z47A 3CCRA 4GNXC 4AQYL 4A3DG 1U5KA 4GS3A 3DLLA 1PH7A 2JA8G 3RNUA 5AJ3L 3NEMA 3H3VH 3KLWA 4X64Q 3AQQA 2D0PA 4A93H 5IP9G 1JJGA 2K5NA 3PUWA 1MKHA 3BJUA 1V9PA 4C3IH 4A3KG 2PI2E 3RLNA 2OWOA 1UE7A 1D8LA 3UDGA 4JI7L 2ZTEA 1YI2A 1RL2A 1CUKA 1HR0Q 1K73C 1I50H 3NENA 3HOXH 4DV5L 2UUAL 3PUVA 2WB1G 2F4VL 4LFBQ 4A3MG 4DR5L 3L7ZC 3UE1A 2PI2A 5FJ8G 1JMCA 4K0KL 1IBLL 3PIPA 3HFZB 3BZCA 2OQ0A 3T1YL 1NTGA 4LW1A 2A1AA 4IFDG 4IPHA 1G6PA 4TVAB 3CCUA 4DV0Q 2E2IH 4JBKA 4BY7H 4IFDJ 4A3CH 3AFPA 2ZM6Q 4AIMA 1VQLA 4OO1G 1N33L 3U58A 3H0GH 1P8LA 1RIPA 4DV1L 5GADC 3HOVG 3PO3G 5ELNA 1KHIA 4HIMA 2AMCB 4YCUA 1N36L 2NZHA 1HNXL 2CWAA 4JBJA 1XMOQ 3AFQA 5C0XG 4DV7L 4UP9A 2R7ZH 1QUQA 2Z0SA 2LSSA 5C0XJ 3JC66 4R4IA 1GKHA 1FVIA 1VQPA 1LYLA 4LF7L 3KF6B 2I0QA 4R4TA 4RG1A 4DUYQ 1HZAA 4YCWA 4B3SL 4IO9A 4A3EG 1DGSA 5DLQE 1K3RA 4BXXH 3CAMA 3WWVA 1N8RC 4JI0Q 1QVFA 3F2CA 1PH6A 4X62Q 3RZDH 5IYDH 3I4OA 2XGTA 3FP9A 4DR1Q 1I94L 4WJ4A 1JT8A 2ZJRA 4B3MQ 3I4NH 1CKNB 4POFA 4BBSH 2HHHQ 2LXKA 1YJNA 3PSIA 4OWXB 3RLOA 4A76A 1XPOA 4R4QA 2GVAA 1X65A 4OX9Q 1GD7A 2JA7H 4JV5L 1WCMH 2K14A 4LF9L 2JA9A 1K9MC 5LMNQ 4B3RQ 3I2ZA 2DUDA 3J81i 2F3IA 2D0OA 3S1QH 2GN5A 4RMFA 4R4OA 5GAHC 4LF4Q 4LWCA 4XIGS 1C7YA 2JEBI 3ICEA 1L1OA 3A0JA 1D7QA 3D0FA 3TS2A 2D62A 4QJFA 2A19A 1PH1A 2ALYB 1TWFH 1EIYB 4BBRG 1JE5A 5C3EH 4BY1G 4NXMQ 5IP7G 1KIXA 2JQOA 3CMEA 4KI0A 1WOCA 2E8GA 5M5XH 2UU9Q 1B7YB 2CFMA 2IX1A 1A8VA 3T1HQ 2R93H 3S1RH 4KLKA 4A75A 3U50C 2YTXA 2Q2UA 1HZBA 4A3IG 1J5EQ 4JI2Q 1J6QA 4LF8Q 4L5RC 4DR3Q 1QUQB 4HJ5A 4DPGA 4P74A 3UDFA 1OXTA 3F2BA 2KHJA 2B63G 3HOUH 1N34Q 1UE1A 4JI8L 3S2DH 4IJHA 3FKIH 3J80i 2ZJQA 2F52A 2YYZA 1O7IA 1L0WA 2R92G 4X66Q 5IY0A 3K80C 1EOVA 3Q8DA 3TQYA 4C3HH 5GAEC 3PGZA 1Q1EA 4GNXA 3HKZG 4AH6A 5BR8L 3PF5A 4LF6Q 2UXCL 1YHAA 4LUVA 3M3YH 4APVA 3BU2A 4DV3Q 3OW2A 3S1NH 2K75A 4LNQA 1JJ2A 2UUBL 4L5SA 2Q2TA 1Q8KA 3M4QA 4A3DH 4HJ8A 1GO3E 2N3SA 3OTOQ 2JA8H 2Y0SG 4A3LG 4R4CA 1KRSA 1OXSC 5M3MG 4DKAC 1NBWA 4YHHQ 2OTJA 1OTCA 4DR4L 2VNUD 3E0EA 1X56A 4A3KH 1IZ6A 3HOYG 2A8VA 1L1OB 4GKJQ 4AYBG 1X55A 1YJ9A 4X66L 4DV2L 1T9HA 1FJGL 1YVCA 2HIVA 2MO0A 1IXRA 4OWTB 3KJPA 1LTLA 4A3MH 1Y1WH 5IYCH 1LM0A 2R7DA 2BA0A 5C4XG 1C9OA 1P16A 4L5TA 2ID0A 4LFAQ 3CCEA 4YCVA 1VQOA 2UUCL 4YWLA 2KHIA 4IPDA 2K5HA 1Z9FA 3W5OA 3RR5A 3JAMc 1Y1VH 1GVPA 4Y7NH 4IPCA 4JCVE 3W1GA 3K7UC 3TEHB 1AE3A 4H02A 4A3BG 1TWCH 2IHEA 1Y14B 1TWAH 1IBKL 2NVQH 3NELA 4P71A 1E24A 2I5LX 1VQ4A 1KC8C 3CF5A 3CC2A 2NN6G 1YHQA 1FL0A 4QY7A 3PO3H 1MJCA 4JBWA 1VQDA 3PCOB 4OONA 5C44G 4IOCA 1IBML 4JI6L 4LF5Q 2VQEL 4LUOA 2N49A 2PNHA 3CC7A 3CC4A 5LMUQ 3PUYA 5IT9c 1SMXA 4GNXB 1M1KC 1XNQQ 3S14H 1YNXA 4DUZQ 4X64L 2WB1E 1M90C 4JI3Q 3KDFA 1I6HH 1KD1C 4EX5A 4A3EH 1Q82C 1EFWA 1HZCA 4UPAA 4C3JH 4DR2Q 1HNWQ 2WAQE 1K83H 1UE5A 4YWMA 4GOPC 1EYGA 1G291 4GKKQ 4OO1I 1MJEA 3ULPA 2EXDA 4UP7A 1I5FA 3CXCA 1MIUA 1HR0L 2ATWA 4X6AH 2CWPA 4JOIC 4P72A 2CQOA 1UE6A 2R7FA 3W1BA 4LFBL 5IE8A 3NBHB 3CD6A 4KHPQ 2VY3A 1ASYA 1TWGH 1E1OA 2I5HA 3MXNB 1XMQQ 4OWWB 2NZOA 4IOAA 3STBC 3CPWA 1VQBA 3MEFA 4GLXA 3A74A 1W3SA 4ALPA 4DV0L 4HIOA 5IYBG 2ZM6L 1X9NA 5GAGC 3SGIA 1W2BA 5M3FG 1X3FA 2VZAA 1K0RA 3VDYA 3S15H 4BBRH 4BY1H 3F2DA 2UXDQ 2VUMG 5IP7H 1XMOL 2VL6A 2YV5A 4QL5A 3U4ZA 2QA4A 1VQAA 1R9TH 1KRTA 5IWAQ 1HNZQ 1VQ6A 3G6EA 4DUYL 1Q81C 1Q12A 2BA1A 1N32Q 3CCQA 4A3IH 1Q7YC 3I55A 4X65Q 1PFSA 4GLAC 1PVOA
chains in the Genus database with same CATH superfamily
1PTOH 3DUZA 2V4DA 1IL8A 2MGSA 1STYA 1AH9A 2VQFQ 1WTPA 2IX0A 4DR1L 4DV4Q 3HS0C 2F0TA 2ZJPA 4A3KB 1ONLA 2R92H 4OX9L 1NNXA 4FXGC 3UI2A 4Q5VA 4LAAA 5LMNL 4A3MB 4JI1Q 1Y1WB 2FXQA 2JA6G 2MNAA 5KNBA 4YY3Q 1JOKA 1ILPA 4HN7A 3AU7A 3I4NG 2WAQB 3FEWX 2Q8TA 3NE5B 1Y1VB 1QB5D 4C3IB 2FFKB 3ERSX 1K8MA 3MFGA 4DR7Q 2JP1A 5FLMG 2K4KA 1TY0A 1PH4A 3T1HL 2Z6KC 2N88A 5J22A 1PZID 1D1IA 4WFN3 3TREA 4LF8L 4JYAQ 3E9IA 1SYBA 3U9SA 4M1UB 5I4DA 4DAMA 3S16H 4DR3L 5C4XH 2V1CC 3S17H 4LFCQ 5ISRA 1UNSA 5FLXc 2YTVA 2XRQD 4A3BH 1SE8A 4ABNA 2AQ1B 4A3EB 4AQYQ 1FGUA 1EIFA 2BH8A 4A3GG 1SFOH 1D1KA 3I4MG 3MXPA 1GUGA 1SRUA 1TWHH 5ELEA 1MSHA 3R3OA 4ULLA 3FKIG 2F4IA 5M9OA 3PIO3 3OTOL 5E1FA 3S2HH 2AWOA 2WACA 5J3BA 3NXWA 2E2HH 4BA1I 4GOPA 1VQ8A 1B70B 3WOEA 1VQIA 4YHHL 4JC0A 3EIVA 4JOIA 4DR5Q 2XTIA 4KKUA 2CHBD 2JK8A 3S15B 2OEOA 4MIUA 2B3GA 4BY1B 1TIID 4K5WA 1Y8NB 1HA6A 1EWCA 4LFAL 4G7ZC 1ET9A 1CA6A 4H0LC 3GTPH 1CKNA 1L0YB 1X3GA 5EBCA 3QR8A 1PHJA 4PG3A 5IOCA 4RKLA 5IYBH 1KXLA 4IALA 1N9WA 5G3LD 3IAYA 2PZTA 4CHTB 5I2XA 5IYCG 5JOBA 5ELFA 1SNMA 1X6OA 3K81C 3BVGA 4LF7Q 4KV6A 4LF5L 4G57A 2Z6BA 1GHJA 1QVGA 5EPKA 4E6IA 1KAWA 1VQNA 1A2TA 2ICIA 1XNQL 1YNJC 2AHOB 2JEAI 2ZTCA 2K28A 2CQAA 4I7AA 2L4NA 4HMJA 1PTOD 4DR2L 4IUNA 2WFWA 2RHQB 1MHWC 3QO2A 2RCNA 5M5WH 4X3KA 3HOYB 1OO9B 4A3CG 4LUZA 5ELOA 1UEAB 3GTOB 5C4JB 1XMQL 3IKJA 3H91A 3ND8A 3NSWA 3GTQB 3Q24A 3TRZA 1ENCA 3I4LA 2F0QA 2JA6H 1A0IA 2R7ZG 2LXJA 3J7A5 3KDFB 1LTTD 4C2MH 1PH8A 1X54A 1SXTA 1QZGA 1SLJA 3GP7A 4JG2A 1BBUA 2KEDA 5FLMH 3CCLA 1SNOA 2LS01 3I90A 1PMRA 2C35B 3HRZC 3RZOB 5D3IB 2HT1A 2KENA 2F0KA 1YITA 2R61A 1A63A 5IYDG 1EUJA 4HCSA 3GTMH 4BBSG 2YU9B 4K2LA 1HFNA 3OSOA 2VQFL 2F1MA 2UXCQ 4HJAA 4GN4B 2NVTB 4DV4L 3LNNA 3CCSA 3CW2C 4A3GH 3PUXA 3GDEA 4K8JA 4QGUA 3E9HA 2BH2A 3I4MH 5C3EG 1CK1A 1LTAD 3M7NA 1B4OA 4YY3L 4N9PA 2L55A 3G4SA 1NY4A 3V96A 3NTHA 3GV3A 3D4RA 3BS1A 4DR7L 2E2DC 1CSQA 1TT2A 4NMZA 3VR2A 2B2WA 1Q86C 4POGA 4HAEA 3A8KE 4P73A 5JEAJ 2KJXA 1U0LA 5T1IA 4JYAL 3N6RA 4LFCL 1JOOA 3MXGA 3CQZB 1VQ7A 2SNMA 1PLFA 2KA7A 4OEMB 5EKLA 1IBMQ 1QNUA 1EEFD 3VR5A 3MC0B 4AQYL 2Q8RE 2NVYB 1U5KA 1PXUA 1Q8IA 3NEMA 3H3VH 1K0SA 3IL8A 4NP5A 1XYIA 3LWEA 3W2DA 4JK1C 3Q22A 3RLNA 1D8LA 1WD0A 4MTKA 3VYTA 4KK7A 5DM73 4K14A 3PUVA 1D5XC 2WB1G 4DR5L 3SK8A 1J9OA 1E2ZA 3K6OA 1A3VA 1I6VC 2PI2A 5KYLA 5FJ8G 1CFMA 1F2MA 2OQ0A 3Q23A 1SSOA 3HKZB 3KLSA 2E2IH 4IFDJ 4A3CH 2ZM6Q 5CBAE 2HDMA 1P8LA 1RIPA 5ELBA 3HOVG 2EYMA 4HIMA 3P20A 4YCUA 1JICA 2R7ZH 1F9PA 4NDXA 4UP9A 1F2YA 1CQFA 4EQOA 3JC66 5CV7A 4LF7L 3KF6B 2K5QA 4R4TA 4RG1A 4AYBB 4YCWA 4IO9A 1K3RA 1H9KA 3CAMA 1R4QB 1PH6A 1B9MA 1S5DD 3V2TA 1NCVA 5IYDH 3I4OA 3FP9A 1PFMA 1WTVA 1IKMA 1G2TA 4B3MQ 4BBSH 1CKNB 2LFNA 2CH4A 2HHHQ 2LXKA 3PO2H 1XPOA 4OWXB 1X65A 1F2ZA 5L37A 3SEBA 4QMGA 3I2ZA 3S1QH 1IHZA 4EQNA 4LF4Q 1K3BC 4LWCA 5C44B 3A0JA 2WV6D 2F3WA 4CKCA 1UAPA 1PH1A 2ALYB 3EA6A 4BBRG 3OWFA 5C3EH 4K8IA 5IP7G 1KIXA 4N8FA 5M5XH 1QNKA 3L9AX 2UU9Q 1A8VA 4ME5A 4KLKA 4A75A 2JXMB 3U50C 5IODA 3T56B 4JI2Q 5IGGA 1QUQB 4LJZC 3EQLC 5EPLA 3F2BA 2KHJA 1EYCA 2XWJB 2B63G 4FYDA 4CDCC 1UE1A 3NQIA 4IJHA 1L0WA 2MUYA 3K80C 1EOVA 3K5MA 2UXCL 3T13A 1ILQA 3OW2A 3MEHA 1JJ2A 4F88A 5M3FB 3M4QA 3NBIA 4B08A 2H4OA 1LTID 2A5HA 1D5ZC 4DFAA 1Y69U 4R4CA 5K5PA 4HCEA 5M3MG 1NBWA 1X56A 5EPJA 2HIVA 3OIPA 5IGCA 2L11A 3NUCA 4XT3B 2IWHA 1P16A 2EZVA 1QJOA 1X3PA 3E6ZX 2KHIA 3K5LA 3RR5A 3RMHA 4JCVE 1B3QA 4DNRB 4EGVA 4H02A 2F0EA 1TWCH 1Y14B 1NSNS 2J4XA 3FPUB 1VQ4A 1E24A 3CC2A 3AB9A 4IOCA 3PCOB 1IBML 1BDOA 1QG7A 2PNHA 3BYYB 1I4QA 5LMUQ 3PUYA 4GNXB 1WCMB 2SOBA 3O13A 1SMYD 4R8IA 3JAME 1ZEQX 4XQQA 1KD1C 2RDHA 1EFWA 1Q82C 4UPAA 1EFID 1HNWQ 4YWMA 1EYGA 4GOPC 1PFNA 5FKAC 4CBVA 2ATWA 1E2WA 1I5FA 1S5CD 2CWPA 4JOIC 2R7FA 1UE6A 4O1NA 2XIWA 4R8NA 3W1BA 2EYPA 2JSOA 3D3RA 5I9OA 2I5HA 3GQBA 4OWWB 2F0PA 3CPWA 1VQBA 4L8JA 4BWGB 5J1ZA 4K2KA 4HIOA 2ZM6L 4OIJA 4J6HA 4CJ0B 3VDYA 1K0RA 3P75A 3HOUB 4BBRH 3S2DB 3H94A 5IP7H 3NP8A 4ZAIA 3U4ZA 5FO7B 2X69A 4CJ2C 1JE4A 3TMEA 4C3HB 1VQ6A 1PZKD 3KBXA 3G6EA 1GOZA 1Q81C 3M3YB 1Q7YC 4XDXA 4X65Q 4ZUJA 1PFSA 4GLAC 1PVOA 2Z4HA 4IPGA 1WTQA 4DXGA 2B63H 4H13C 2O2LD 4F87A 5G3LF 1A2UA 1X3QA 3LGJA 1SNCA 3TS0A 5C5MA 4A3JG 3BVZA 4B3ML 3SXHA 3HZXA 2HHHL 3GTGH 2F03A 2JA5G 5A2QE 3I3CA 1XNRQ 4DAVA 3S24A 4NXNQ 4LF4L 1NUCA 1C48A 1U9RA 2B29A 3HOZG 3S1MH 3ER0A 1YHBA 3BDCA 1DJRD 2EXZA 4QIWE 1FNVA 1O7LA 5M3MH 4IJLA 3A8JE 3ULJA 4JI5Q 1LO5D 4IURA 2UU9L 4KKTA 2WKCA 4IUVA 1B8AA 3QJYA 3PO3B 3CCMA 1ESFA 4JI2L 4J1MA 3R2TA 1F9RA 3L0OA 2EIFA 1BBXC 1A3TA 2ZT9C 1A3UA 5IP9H 2A69C 2JE6I 4HIKA 3FVQA 1I6HB 4KD4A 4NPSA 4HEDA 1XWEA 2Y0SE 4C3JB 1FNUA 1PH9A 1BVSA 2G5DA 4OO1G 1STBA 2K6AA 3QIAA 1OXUA 2KEEA 1E22A 3P1HA 3G6JB 1TWGB 3M9BA 4JI7Q 4IFDH 4I7ZC 3F8TA 1TS4A 3OWEB 3LWUA 2E76C 2UUAQ 2N55A 1CKMA 2L5TA 1S72A 1JORA 1V1PB 2KCTA 1JJCB 3EJIA 1F2LA 2RDFA 3RD4A 4C56C 3D31A 1IBLQ 2RF4A 2K1BA 3PV0A 4ZLTF 2B2WC 5C6AA 4GN5A 1QCBD 2OCEA 1N33Q 4BA2I 2ICEC 3RN2A 1EQRA 4A3IB 3TN2A 1N36Q 1HNXQ 4QQBX 2F0FA 1L0XB 3DEPA 1QVCA 1LABA 1PTOB 3I8ZA 4L63B 2DJFC 1TWFB 4YWKA 4KHVA 3H15A 3A5UA 1Y1WG 2RA4A 1SYFA 4QB4A 4NB3A 2WAQG 2R93B 1Y1VG 2R92B 4C3IG 5LMUL 1FNWA 2D5DA 4HJ9A 1Q1BA 3GTJH 1H9SA 3DWPA 3A56A 5CC4A 4U673 3SR1A 3I56A 1NJIC 3CP0A 5FLXL 1I94Q 1B1ZA 1HNWL 4C1NI 4JV5Q 1VQJA 4QUCA 4RAUC 3OYYA 5A35A 3WOFA 4A3JH 2FMMA 3QWNA 3NWSA 1TY2A 4QF4A 3GD7A 3F1ZA 2JA5H 3D6CA 1VQ5A 3H0GG 3KLRA 3UDIA 4KTAA 3AYHB 1HQRD 4A3DB 1SNQA 2QEXA 5IIFA 3S16B 4JW0A 3HOZH 4Y52H 5C4XB 4DK6C 3SVMA 3S17B 1YNNC 3K8AA 5IGEA 4JVZA 1BCPC 2N8NA 2IT1A 2F0HA 1X3EA 1IW7C 4OGQC 5E3FA 5LL6X 4XXEA 4LMQD 4A3BB 4IFDI 3TP6A 1ZYRD 3HGBA 3K7AH 4BXXG 3OPOA 1C0AA 1M8AA 1SFOB 1ESRA 1EY9A 4X65L 1I4XA 1TWHB 4A3LH 3S2HB 4PZ8A 4Y7NB 2JA7G 5C3WA 5TSSA 1XTCD 1YIJA 1PZJD 2E2HB 4HSVA 1TWAB 3J81E 1QOHA 1PRTD 3MZ5A 4X3UA 1BBWA 2R6GA 4OO1H 4GZYC 1XNRL 4FF1A 1D2BA 1K8AC 1HTPA 3DM1A 4NXNL 1O7ZA 3KBGA 4DR4Q 3DM3A 5HY6A 2K5WA 3GTPB 1FYCA 1YEZA 4V190 2DY8A 2P5ZX 3FHWA 1LT4D 1L2FA 4JI5L 2KOLA 2UUCQ 2IY5B 2KQ3A 1GJXA 3URYA 3VA5A 2A73B 4O2DA 3J80E 3U9OA 2FMCA 3I91A 1WFQA 4OXPA 3NBHA 5FK9C 2DN8A 5HGQA 3M4OH 2XNAC 1WI5A 4CKEA 3MXNA 3KF6A 1SE4A 1H9MA 2K04A 2KCNA 2PMZE 5F2DA 1Z47A 3DLLA 5JPNC 2JA8G 2XVSA 4X64Q 2D0PA 3D4DA 1AN8A 1JJGA 1HFGA 2TSSA 3PUWA 1HTLD 1V9PA 5CV9A 4C3IH 2PI2E 4K5VA 3VYSA 3NK9A 4JI7L 1I4HA 3V05A 3QB3A 1YI2A 2K32A 4DU9A 1K73C 3NENA 2F0SA 2UUAL 5D3DA 2JA6B 3NTIA 1TU2B 5FOBB 3L7ZC 4R9WA 1CHQD 3K5OA 2K01A 4C2MB 1IBLL 3BZCA 3T4AC 3PIP3 2A1AA 2CVRA 4TVAB 4JBKA 2A74C 1KNAA 1N33L 3D6WA 2EY1A 3H0GH 2G9DA 5GADC 4F7XA 1KHIA 1N36L 1HNXL 1EY6A 2CWAA 2JN4A 3GTMB 3AFQA 3MFYA 5C0XG 1QUQA 2LSSA 5HGTA 2NTTA 3J7AV 1EEID 2B8FA 1LYLA 2WINB 3K5NA 2I0QA 1HZAA 3DHQA 2PO4A 5EGTA 1GXDC 5DLQE 4CDFC 4BXXH 4A3GB 1GUOA 2C5CA 3I4MB 4X62Q 3RZDH 1I94L 1JT8A 3I4NH 2AUKA 3PSIA 2JA7H 4JV5L 1E0BA 1K9MC 4FVMA 4PNYA 1ML0D 4S3SA 3ICEA 2B39A 1EL0A 3KK7A 1D7QA 3D0FA 1Z6HA 3OIQA 1MSGA 4QJFA 2A19A 2Z8LA 3QG1A 1YNJD 2JQOA 4KI0A 2E8GA 3MA2B 1GUWA 1H9SB 2IX1A 5NUCA 2SDFA 1STEA 2YTXA 2Q2UA 3SDZA 3KLSX 3L3OC 1AP0A 1O80A 1NR4A 2NBFA 2QDBA 3UDFA 3ITPA 4DPGA 1OXTA 4XYOA 3DMUA 1N34Q 2DNEA 3FKIH 2YYZA 2QKIC 1FR3A 3SK5A 2DNCA 3Q8DA 4OELB 3CHBD 2RQXA 3PGZA 5EJWA 3HKZG 4GNXA 4YIJA 1RTOA 4LF6Q 4LUVA 4DV3Q 3S1NH 1EWHA 2EJFC 2K75A 2Q2TA 1Q8KA 4ZYSA 2N3SA 2JA8H 2Y0SG 1NR2A 3A8IE 1EZ8A 1KRSA 2E74C 2B2YA 4DR4L 3E0EA 2KHSA 1IZ6A 2A8VA 1L1OB 4GKJQ 4AYBG 1YJ9A 3DXJC 4X66L 1YVCA 5DAUA 3KJPA 2MO0A 1IXRA 3I70A 3OHXC 3T53B 5JJZA 2PCFB 5IYCH 2R7ZB 5KYIA 2UUCL 4YCVA 4YWLA 2PNRC 3W1GA 1O78A 3K7UC 3TEHB 1AE3A 5C4HA 2IHEA 5JPMC 2NVQH 3NELA 3MWYW 1KC8C 2I5LX 3CF5A 3TZUA 5CV8A 1MJCA 4OONA 5C44G 3J81L 1B50A 2BE5C 5C0XH 2VXWA 2N49A 4BBSB 3PO2B 5IGFA 1CTMA 3S9WA 1WD1A 4X64L 1EIHA 2O5IC 1RODA 1LT6D 1HZCA 2WAQE 1K83H 4RHRA 4GKKQ 3ULPA 1IYUA 5BN4A 5C3EB 1B53A 2PZWA 5EKIA 3GV6A 4P72A 2CQOA 5I6WA 3NBHB 1RKNA 5M5XB 4KHPQ 1DOMA 2VY3A 4QCLA 3MXNB 2F0DA 4RKBA 5IT9E 1EU4A 3STBC 4IOAA 1KDAA 1U4PA 2DY7A 4I65A 5BN5A 4CKBA 2EYFA 1RF2D 5GAGC 3SGIA 1R4PB 1X3FA 2EDGA 2OF1A 2VZAA 5M3FG 4EQPA 1H9JA 4BS9A 2UXDQ 1Y8OB 2VUMG 2YV5A 1R9TH 1KRTA 5IWAQ 1HNZQ 1PFBA 2BA1A 3CCQA 2OT2A 3T51B 1G6ZA 1TKWB 5D14A 2K50A 2XN9C 1YBYA 4KY6A 2EVBA 1VQHA 3OOCA 1NE3A 1TXYA 4X62L 4B3TQ 3H3VI 3OMCA 3J81c 2VW9A 1VMCA 3NPPA 1PH2A 3MAQA 1W6KA 2HCCA 2ZXPA 4A3FG 3RLFA 4UDUC 4DAYB 2WB1B 3UDXA 3KYHC 1V1PA 2X6LA 1PH5A 1EOTA 2KCMA 3I7FA 2ZTDA 1SE2A 1B2TA 2GVBA 2KUMA 4H44C 2MP1A 2UXBQ 2C9OA 1TWCB 2K05A 2Z1CA 1HJPA 4G7HC 1LTRD 1NMGA 3HOWG 5CORA 3J7AF 1ENFA 3J7ZC 3J80c 4FNFA 3C1EA 1XPUA 3EVQA 1N34L 3VA7A 1VQCA 1HR0W 5CYUA 1KDCA 2KECA 1S40A 1K28A 2K5VA 1AZPA 2QGQA 4LF6L 3K0XA 1SNDA 5AJ3Q 4O0AA 2IX3A 4DV3L 4GLVB 3AEVA 5FJ8H 3HP3A 1F9SA 2EQSA 5DM63 3RUZA 1V8QA 4GN3B 2MJ8A 1G91A 2J7ZA 1PV4A 1XJVA 3HOVH 2NVXH 4GKJL 1PYSB 2CW0C 2DGYA 3UE0A 3T1YQ 5KIXA 2NUCA 5GQOA 1JQYD 1KL9A 1ICWA 1J8IA 3KF8B 4L5QA 2O5JC 2ZXRA 4DV7Q 1E1TA 5JJLA 5JVG3 5HURA 1GHKA 1HQMC 5M3FH 2B63B 2VS1A 2IHFA 5LMNW 2VUMH 4A93G 4B9XA 3HKSA 3M85A 4B3SQ 4IUQA 3GTGB 2PW5A 1GM5A 1WVLA 4WJ3M 3Q0AA 2GA4B 2EYHA 3HOXG 1DOLA 3FMCA 1KAAA 2QCPX 4JBMA 3S1MB 2RSOA 1BF4A 4GKKL 1BQQT 3GTLH 5M3MB 1PH3A 2N78A 4BY7G 4KHPL 3RN5A 1F77A 1V1QA 1PDQA 2AQ3B 2L9HA 4IUUA 2MO1A 1Q46A 1SN8A 3L2PA 4A3FH 4Q0FA 1XPRA 5CMDA 4P75A 1NAPA 5JVH3 4TQUS 1OXXK 4QUFA 4M8AA 2F0MA 3HG9A 1GUNA 2UXDL 2Q2IA 1U4MA 3MHBA 1PRTB 3I72A 2IPKD 5IWAL 2K52A 1HNZL 1PA6A 4CJ1B 2E2JH 1B44D 3HOWH 1YJWA 4RCOA 1VQGA 5COYA 1SR3A 1PTOF 3PF4A 1SROA 2F0JA 1DD2A 2PQAB 1TS3A 1B9NA 1EZ6A 3VYRA 4B3TL 2UUBQ 2L1BA 1D5MC 1JWUD 5CR3A 1JB7A 2EYOA 3HKZE 3S14B 5KNCA 1EU3A 5H1SE 2R93G 4DV2Q 1AE2A 3A5ZB 3J81j 1UEBA 2UXBL 2IL8A 1I3QH 1VDZA 2EY5A 4EQ5A 1LTSD 2I07B 1HH2P 1E2VA 1EY7A 3PIOA 4KJOA 3SK6A 4AYBE 3GTKH 5JJIA 1QILA 2Q2HA 3ULLA 1EQVA 5GROA 4DNIA 3QOLA 1IBKQ 1UUPA 2CCZA 3GTJB 2MFIA 4HMIA 5D65A 5M5YH 3DEOA 1RTNA 1CZGA 1CZWA 2L0CA 2VQEQ 3CCRA 4GNXC 4A3DG 1PH7A 5AJ3L 1S5ED 3KLWA 3NTKA 3AQQA 4A3JB 4A93H 2QW7A 2VB3X 2K5NA 4KY7A 4A3KG 1HRJA 2JA5B 5AFWA 1U4LA 4KKSA 3AMUA 1TR5A 1CUKA 1I50H 3TP5A 3HOXH 3K0YA 2A69D 4A3MG 3HOZB 2PW7A 3UE1A 1BR9A 2XRSD 3E0JA 3EROA 1JMCA 1DXMA 3PIPA 3HFZB 3NHHA 2A6HC 3T1YL 1MGSA 2FINB 1G6PA 4DV0Q 4TKOB 4BY7H 1JWSD 1VQLA 3K7AB 2QF7A 1WTHA 3U58A 1MD2D 1KABA 1CHPD 5ELNA 5LHY1 2LY7A 2NZHA 3CKIB 2B2VA 4RWSC 4DV7L 5C0XJ 4U68A 4R4IA 3MVVA 4IUTA 1FVIA 1T5EA 5EQ0A 3K57A 1ZKOA 4DN4M 4B3SL 4XQNA 4A3EG 1DGSA 3A55A 1N8RC 4JI0Q 1QVFA 3F2CA 1WTWA 1Z7TA 4K6DA 3D8GA 4V0BA 2J0TD 2ZJRA 4POFA 1CM9A 4R4QA 2GVAA 1K8OA 2I46A 4K6LA 2JA9A 5C3XA 1HCZA 1II3A 4B3RQ 1HPCA 4RMFA 3TZDA 4R4OA 5GAHC 4P2CB 4XIGS 1C7YA 2O4XA 2K5DA 1L1OA 3EFXD 3JAML 2B2UA 3TS2A 1A15A 1WTOA 4XT1B 1TWFH 1JE5A 1RDPD 4BY1G 3TSSA 4NXMQ 1KNEA 3CMEA 1WOCA 5LL6S 2A6EC 2R93H 4MN3A 3S1RH 3M4OB 1SAPA 1CQVA 1J5EQ 5EBDA 4L5RC 5CV6A 1G8ZD 2KVMA 4KMUC 4TRDA 2NYZD 2ZJQA 3BVMA 2NWGA 4X66Q 3TQYA 1Q1EA 1YNND 1YHAA 3BU2A 1BCPD 1CI3M 2D9UA 2WKDA 2A68C 4K5XA 1LACA 2QDLA 1ICFB 2UUBL 4L5SA 1IW7D 4A3DH 1Q90A 1GO3E 3A7AB 1SJED 3OW7A 2OTJA 1OTCA 3C3LA 4IUPA 4A3KH 3HOYG 4N9TA 1X55A 3H0GB 4O42A 4DV2L 2HD3A 1T9HA 4RH6A 1KLGD 3VR6A 4OWTB 5E4WC 1SBBB 2A6ED 4A3MH 1VF7A 1Y1WH 1G2SA 3NWTA 5A2QL 1LM0A 1MI2A 1C9OA 4L5TA 1DYQA 2ID0A 1VQOA 3CCEA 4ZKCB 5M5WB 3BG3A 2FHTA 3FDTA 4IPDA 2K5HA 3W5OA 3JAMc 1HUNA 1Y1VH 4DGZA 4Y7NH 1I4PA 1JC7A 1PTOC 3ERQA 1TWAH 4RHSA 1IBKL 3G7LA 4ZKBB 4WJWA 2EE1A 2NN6G 4QY7A 2K33A 3RZDB 4KN7C 2VQEL 3I4NB 3ONAB 1DOKA 2K7VA 3CC7A 1LT5D 2JA7B 2RBMA 2MPMA 1M1KC 2A68D 2OXPA 1EY0A 4DUZQ 4JI3Q 2LMCB 1S5FD 4A3EH 2ZXOA 1UE5A 1G291 4IQZA 4OO1I 2ENBA 3CXCA 1MIUA 4X6AH 4DAYA 1A6XA 2EYLA 5T1GA 1ASYA 3BYTB 2CH4W 1E1OA 2NZOA 4DXFA 1D6EC 3A54A 4GLXA 1JOQA 3A74A 4DV0L 2F0WA 2LKVA 5BN3A 1AEXA 3P7JA 1T5XD 3S15H 4BY1H 3F2DA 3FKIB 4FF3A 2EJGC 2VL6A 5FO8B 1VQAA 2Q8IB 1TS5A 2H1EA 2QA4A 4ZRZA 5C5LA 1Q12A 5ELDA 1N32Q 1V1OA 3S1NB 3I55A 4J15A 2EOTA 2F3VA 2HCIA 1A62A 4F8MA 1ASZA 1PYWD 2JA8B 1WYDA 4JI0L 2G9HD 3DWQA 3PMFA 4FXDA 1BO0A 1KQSA 2L12A 4JI4Q 1CT1D 3K58A 1I4GA 3CCVA 1STNA 1S3OA 2BDOA 5K36G 1LUZA 4DR6Q 1EYAA 4B3RL 1IL2A 4FDBA 1WJJA 4HR7B 2HUGA 1PYBA 1SYGA 2HIXA 2E5LQ 4C1NK 4UP8A 2CKZB 3PO2G 3VR4A 1RHPA 1UWVA 4XTCS 4NXML 4DV6Q 3HOYH 4MTNA 2PYKA 3G48A 2NVQB 1XTDA 1GUTA 3H6MA 3GTOH 5C4JH 2B8GA 4ME3A 1SJHD 1BUVT 2M00A 3KF8A 1X32A 1CKOA 1J5EL 3GTQH 2MQHA 2WP8J 1FD7D 2F0GA 3ZJYC 4JI1L 3D4WA 4PV1C 1BKBA 2E2IB 1EYDA 4NKLA 3CMAA 1BXTA 3WDNA 1QE6A 2F0LA 1K83B 1VQFA 2NN6H 3RZOH 4Z9CB 3BZKA 2HQEA 2ES2A 1VMPA 1V43A 3TP7A 4PZ7A 3A7LA 4WORA 2YU9H 2B2TA 1LT3D 2KBNA 3MTSA 3MXUA 1IYJB 3IRBA 1TQOA 3JAMi 3CRLC 4DV5Q 2NVTH 1VQEA 2F0IA 3SK4A 2F4VQ 4RGTA 4UY8C 2QEJC 1I4RA 4K0KQ 4ODGA 1M4VA 1QZHA 1TVXA 1K8GA 4G4KA 1R9TB 2M2LA 3B6YA 4TSSA 2WIIB 3S1QB 1STHA 4R1JA 1EY4A 2FJ2A 3KJOA 2RHSB 4DV1Q 1SEBD 2L15A 3M4PA 4IN3A 4IZ8A 4QIWB 1VQMA 4FF2A 4H7BA 2E75C 4X3TA 1O7YA 2I5MX 4MNOA 2RVLA 2F0NA 3K59A 1BOSA 1ET6A 1ZXTA 4KHZA 1WTRA 1KDBA 3J80L 1GUSA 5I6YA 4DUZL 4JI3L 2PQAA 3CQZH 5JJKA 1FGBD 5CBEE 1DZ1A 2Z4IA 5E7NA 1W6JA 2XSCA 1YZ6A 2BCOA 2PZUA 1BNZA 2NVYH 1DONA 2Y0SB 3CPFA 3U4VA 1HZ9A 3M7GA 4LF9Q 1H95A 4GOPB 4HJ7A 2ASBA 1EWIA 3KFUA 2IW3A 4EVOA 1LTGD 3E5SA 2BE5D 5DEHA 1IKLA 1B3AA 5K36H 3QOJA 1QWYA 1RJTA 4G7OC 2X6GA 3EBEA 2NN6I 3FRPB 3PQIA 4DK3C 2Z6KA 4A4IA 4HIDA 2B2VC 2RSNA 2RDGA 3CCJA 4RCNA 2KCCA 2OQKA 2PQEA 3X3NA 3H3VC 1E7ZA 1N32L 4OHJA 1EQQA 4JI8Q 1OXVA 4RGMA 5EAYA 1MBYA 3STBD 3KOJA 2TMPA 2AWNA 1C8CA 5C0XI 1E3PA 3T16A 1DCZA 5BR8Q 1SNPA 1WCMG 4PMWA 1EY8A 1JB3A 5JAVA 4JI4L 4DF7A 3ZYYX 4PQXA 4KJNA 4OL7A 3HOVB 2NVXB 3G71A 1G51A 1AFPA 4DR6L 3GO5A 4MZ9A 2VB2X 5I2YA 4X3SA 1CSPA 2HQLA 1C4QA 1L1OC 2B2UC 3SE0A 1JCKB 4NW2A 1NMFA 2E5LL 2IJ0A 1VQ9A 2YTYA 4PZ6A 1SDFA 1XX8A 1FJGQ 5DNFA 3PUZA 4UAIA 4DV6L 2OTLA 3EN2A 1VQKA 2JJQA 1SMYC 5C44H 3C46A 3HOUG 5EKKA 5JEAG 2NB0A 2VUMB 1S4ZA 1VS0A 2AKWB 4RGOS 1VCIA 4C3HG 5FLXE 2EJMA 2RCFA 1S5BD 1KTKA 1VF5C 3E3XA 4JI6Q 2QILA 2H5XA 2F0OA 1PRTF 4BBRB 1EQTA 4GS3A 4J8QA 3RNUA 4ID6A 2MHVA 4DAPA 3GTLB 1EY5A 1Q3LA 2XWBB 3BZDB 4B9WA 5IP9G 1MKHA 3BJUA 2OWOA 2AQ2B 1UE7A 3R2IA 3UDGA 1U4RA 2PPBC 4PMBA 2ZTEA 3HEJA 4A3FB 1RD9D 1RL2A 1HR0Q 4ZK9B 4DV5L 4ZUIA 5CV5A 2F4VL 4LFBQ 3R93A 1BCPF 4K0KL 5FO9B 3M4YA 1NTGA 4LW1A 1F9QA 4CDEC 4IPHA 4IFDG 3CCUA 3AFPA 4AIMA 4FXKC 2E2JB 2Z9HA 5CGKA 3HOWB 4DV1L 3PO3G 2AMCB 1SYEA 3W3AA 4JBJA 1XMOQ 3C1FA 2Z0SA 1GKHA 1VQPA 4WRDA 2CW0D 1HUMA 4DK0A 2BOSA 4DUYQ 2F0UA 4CDDC 4C3JG 3WWVA 1AW7A 2EY2A 2EYJA 4XYQA 4DR1Q 2XGTA 4L6TB 4WJ4A 5E4XA 2JYOA 2PMZB 1YJNA 3RLOA 4A76A 3NQTA 4OX9Q 1GD7A 1WCMH 2K14A 4LF9L 5LMNQ 1HA5A 3J81i 2DUDA 3C2PA 1STGA 2D0OA 2F3IA 1I3QB 2GN5A 3CRKC 2K03A 4KD3A 4KN4C 2JEBI 2D62A 2EY6A 2D2CC 3CU7A 5KEEA 1EIYB 1AZQA 3GTKB 2DJGC 4MHEA 4DK1A 1B7YB 3KUPA 2CFMA 1KLUD 3T1HQ 3IFDA 5M5YB 1JWMD 1BCPB 1HXYD 3X3MA 1HZBA 4A3IG 4LF8Q 1J6QA 1DM0B 1RCVD 5KNDA 2BDNA 1WTXA 4DR3Q 5IT9L 4HJ5A 4P74A 3TBIB 3HOUH 3LX0A 5JEAH 3S2DH 4JI8L 4PMCA 4A93B 4HSPA 3J80i 2F52A 1O7IA 3BDOA 2R92G 5IY0A 5I9PA 1ENAA 4C3HH 5GAEC 4AH6A 5BR8L 3PF5A 3FPPA 3M3YH 1I50B 2HDLA 4APVA 3HOXB 5J39A 4LNQA 4RFBA 4ZQ3A 4RA8A 4HJ8A 4ZCKA 3OTOQ 1Y8PB 4A3LG 4LK1C 1OXSC 2AUJD 4DKAC 2RKSA 4YHHQ 4BY7B 2VNUD 1LTBD 4FF4A 1FJGL 1LTLA 2NZ1D 1JR0D 2R7DA 2BA0A 5C4XG 4LFAQ 4UHVA 1CA5A 1Z9FA 1H9RA 1GVPA 4IPCA 4HTHA 2SEBD 1LLRD 4FO2A 4A3BG 5IGDA 4P71A 2B2YC 1YHQA 1FL0A 3F2UA 3OMGA 3VYUA 4ILWA 4JBWA 3BDLA 1VQDA 1SYDA 5KGUA 3PO3H 4JI6L 4LF5Q 2SNSA 4LUOA 1IYVA 3CC4A 5IT9c 1SMXA 1XNQQ 1XXGA 3S14H 1YNXA 3DWAA 2M9VA 3H09A 2WB1E 4OIKA 3R8BA 1M90C 3KDFA 1I6HH 2B2TC 5ELCA 4EX5A 3IFTA 3VR3A 4C3JH 4DR2Q 1LV9A 1MJEA 1HR0L 2EXDA 4UP7A 4DNTB 3SHLA 5C4ZA 4LFBL 1STAA 1TS2A 1ZYRC 3N52A 5IE8A 4XQJA 2R3ZA 3CD6A 4RGNA 2EPBA 1TWGH 1SE3A 3S1RB 1XMQQ 3I73A 3TDQA 3MEFA 3TP8A 5CV4A 1W3SA 4ALPA 5KRUA 5IYBG 1HHVA 1X9NA 1W2BA 4JPBW 4KY5A 5IGBA 1PRTC 1XMOL 4QL5A 3Q6SA 2NTSA 3ND9A 4CGYB 4DA2A 4N8X1 4FP5D 1SYCA 2F0VA 4A3IH 1EIGA 4DUYL 3J7YW 2A6HD
chains in the Genus database with same CATH topology
4J15A 4IPGA 1A62A 1ASZA 2K50A 1WYDA 4JI0L 1YBYA 1AH9A 1VQHA 2B63H 2VQFQ 1KQSA 1NE3A 1TXYA 4X62L 4JI4Q 4B3TQ 2IX0A 3LGJA 4DR1L 3TS0A 4A3JG 3J81c 3H3VI 4DV4Q 2VW9A 4B3ML 2ZJPA 3CCVA 2HHHL 2R92H 3GTGH 1S3OA 1PH2A 4OX9L 2JA5G 5K36G 1LUZA 1XNRQ 4DR6Q 5LMNL 3RLFA 4A3FG 1IL2A 4B3RL 4FDBA 1WJJA 3S24A 4DAYB 4NXNQ 4JI1Q 3UDXA 4LF4L 2FXQA 3KYHC 2MNAA 2JA6G 1PYBA 2B29A 3HOZG 4YY3Q 3S1MH 1PH5A 2KCMA 3I7FA 2HIXA 3ER0A 2E5LQ 3I4NG 4UP8A 1YHBA 2ZTDA 2CKZB 3PO2G 4QIWE 2GVBA 1UWVA 2UXBQ 4XTCS 4IJLA 3ERSX 3ULJA 5M3MH 4JI5Q 4DV6Q 4NXML 4DR7Q 5FLMG 2UU9L 2K4KA 1PH4A 3HOYH 1HJPA 4MTNA 3G48A 1XTDA 3T1HL 3GTOH 2Z6KC 5C4JH 1NMGA 1B8AA 4ME3A 3HOWG 3CCMA 1CKOA 1J5EL 3TREA 4JI2L 4LF8L 2MQHA 3E9IA 3GTQH 4JYAQ 2WP8J 3J7ZC 3J80c 4DAMA 3S16H 4DR3L 5C4XH 2V1CC 3S17H 3ZJYC 3L0OA 4JI1L 2EIFA 4LFCQ 1BKBA 1XPUA 5FLXc 1N34L 2YTVA 5IP9H 2JE6I 4HIKA 3CMAA 1VQCA 1HR0W 4A3BH 1SE8A 4NPSA 1S40A 2Y0SE 1FGUA 4AQYQ 1PH9A 1BVSA 1EIFA 2K5VA 1VQFA 2BH8A 2QGQA 3K0XA 1SFOH 4LF6L 5AJ3Q 3RZOH 4A3GG 4O0AA 4DV3L 3I4MG 3BZKA 2ES2A 1SRUA 4GLVB 3AEVA 5FJ8H 1OXUA 1TWHH 1V43A 2EQSA 4PZ7A 1E22A 3FKIG 2YU9H 3S2HH 3OTOL 3M9BA 2AWOA 2KBNA 5J3BA 4JI7Q 1IYJB 3F8TA 2E2HH 4BA1I 4GOPA 1VQ8A 3IRBA 1B70B 3JAMi 4GN3B 4DV5Q 2UUAQ 1VQIA 2NVTH 1CKMA 1VQEA 4YHHL 4JC0A 3EIVA 4JOIA 1S72A 1PV4A 4DR5Q 1XJVA 4UY8C 2F4VQ 3HOVH 2KCTA 2NVXH 4GKJL 2XTIA 1JJCB 1PYSB 2JK8A 4K0KQ 1IBLQ 3D31A 2B3GA 2DGYA 2RF4A 1QZHA 3UE0A 3T1YQ 1K8GA 3PV0A 5GQOA 1KL9A 4GN5A 4LFAL 3B6YA 2OCEA 1N33Q 4R1JA 1CKNA 3GTPH 4BA2I 1X3GA 3KJOA 3RN2A 2RHSB 3KF8B 1EQRA 4DV1Q 4L5QA 2L15A 3M4PA 1N36Q 1HNXQ 1PHJA 4QQBX 1VQMA 4PG3A 5IYBH 1KXLA 1QVCA 4DV7Q 1E1TA 1N9WA 4YWKA 5JJLA 2I5MX 3H15A 3A5UA 1Y1WG 5M3FH 5IYCG 2VS1A 1X6OA 2IHFA 3K81C 4MNOA 4LF7Q 4LF5L 5LMNW 4NB3A 2VUMH 4A93G 2WAQG 3HKSA 3M85A 1Y1VG 4B3SQ 1QVGA 4KHZA 5LMUL 1KAWA 1GM5A 4HJ9A 1Q1BA 3GTJH 1VQNA 1XNQL 4WJ3M 4DUZL 2AHOB 2PQAA 3CQZH 4JI3L 2JEAI 5JJKA 3HOXG 1NJIC 5E7NA 3I56A 2ZTCA 3CP0A 1I94Q 4JBMA 1YZ6A 4DR2L 2NVYH 2WFWA 1HNWL 2RHQB 3CPFA 3U4VA 1HZ9A 4GKKL 2RCNA 4JV5Q 4LF9Q 1VQJA 3PO2H 1H95A 4GOPB 4HJ7A 3OYYA 3GTLH 5M5WH 1EWIA 2ASBA 3KFUA 4A3JH 1PH3A 2N78A 4BY7G 4KHPL 3GD7A 3RN5A 3F1ZA 4A3CG 4LUZA 1V1QA 5ELOA 2JA5H 1XMQL 2MO1A 1Q46A 1SN8A 1VQ5A 3H0GG 3L2PA 4A3FH 3UDIA 1XPRA 4P75A 3AYHB 3TRZA 2QEXA 4TQUS 3EBEA 2JA6H 1OXXK 1A0IA 2NN6I 3HOZH 4Y52H 2R7ZG 4DK6C 3K8AA 4DK3C 2LXJA 3J7A5 3KDFB 4C2MH 1PH8A 2N8NA 1X54A 2IT1A 2Z6KA 4A4IA 4HIDA 2Q2IA 1QZGA 1SLJA 1X3EA 2UXDL 4JG2A 1BBUA 5FLMH 3CCLA 3CCJA 4IFDI 5IWAL 2K52A 1HNZL 2C35B 2OQKA 3K7AH 1PA6A 4BXXG 1C0AA 2E2JH 1E7ZA 3HOWH 1YJWA 2HT1A 2KENA 1N32L 1EQQA 4JI8Q 4X65L 1VQGA 1YITA 1A63A 5IYDG 1EUJA 1OXVA 3STBD 5EAYA 3GTMH 3KOJA 2AWNA 4BBSG 1SR3A 4A3LH 5C0XI 4PZ8A 1E3PA 2JA7G 3PF4A 5BR8Q 2VQFL 1WCMG 1SROA 1YIJA 2UXCQ 4PMWA 4HJAA 2PQAB 4JI4L 4GN4B 4B3TL 4DV4L 2UUBQ 3G71A 1BBWA 3CCSA 1G51A 2R6GA 3CW2C 4A3GH 3PUXA 3GDEA 1XNRL 4DR6L 4QGUA 3E9HA 3GO5A 4MZ9A 1K8AC 1JB7A 2BH2A 3I4MH 5C3EG 3HKZE 4NXNL 1CSPA 3M7NA 2HQLA 1L1OC 4DR4Q 3DM3A 4YY3L 5HY6A 3G4SA 5H1SE 1NMFA 2E5LL 1YEZA 2R93G 1VQ9A 1NY4A 4DV2Q 1AE2A 2YTYA 3FHWA 4PZ6A 1FJGQ 1L2FA 3A5ZB 1UEBA 3J81j 2UXBL 4DR7L 1I3QH 3PUZA 4JI5L 4DV6L 2OTLA 4EQ5A 1CSQA 3EN2A 1HH2P 1VQKA 2JJQA 2UUCQ 2IY5B 5C44H 1Q86C 3PIOA 3HOUG 5JEAG 4POGA 4P73A 5JEAJ 4AYBE 3GTKH 1U0LA 4JYAL 4O2DA 5JJIA 2Q2HA 3ULLA 1VS0A 2AKWB 5GROA 4LFCL 1WFQA 1VCIA 4OXPA 4DNIA 1IBKQ 2CCZA 2MFIA 5HGQA 5M5YH 3M4OH 1VQ7A 1WI5A 3KF6A 1IBMQ 4JI6Q 2PMZE 2H5XA 2VQEQ 1Z47A 3CCRA 4GNXC 4AQYL 4A3DG 1U5KA 4GS3A 3DLLA 1PH7A 2JA8G 3RNUA 5AJ3L 3NEMA 3H3VH 3KLWA 4X64Q 3AQQA 2D0PA 4A93H 5IP9G 1JJGA 2K5NA 3PUWA 1MKHA 3BJUA 1V9PA 4C3IH 4A3KG 2PI2E 3RLNA 2OWOA 1UE7A 1D8LA 3UDGA 4JI7L 2ZTEA 1YI2A 1RL2A 1CUKA 1HR0Q 1K73C 1I50H 3NENA 3HOXH 4DV5L 2UUAL 3PUVA 2WB1G 2F4VL 4LFBQ 4A3MG 4DR5L 3L7ZC 3UE1A 2PI2A 5FJ8G 1JMCA 4K0KL 1IBLL 3PIPA 3HFZB 3BZCA 2OQ0A 3T1YL 1NTGA 4LW1A 2A1AA 4IFDG 4IPHA 1G6PA 4TVAB 3CCUA 4DV0Q 2E2IH 4JBKA 4BY7H 4IFDJ 4A3CH 3AFPA 2ZM6Q 4AIMA 1VQLA 4OO1G 1N33L 3U58A 3H0GH 1P8LA 1RIPA 4DV1L 5GADC 3HOVG 3PO3G 5ELNA 1KHIA 4HIMA 2AMCB 4YCUA 1N36L 2NZHA 1HNXL 2CWAA 4JBJA 1XMOQ 3AFQA 5C0XG 4DV7L 4UP9A 2R7ZH 1QUQA 2Z0SA 2LSSA 5C0XJ 3JC66 4R4IA 1GKHA 1FVIA 1VQPA 1LYLA 4LF7L 3KF6B 2I0QA 4R4TA 4RG1A 4DUYQ 1HZAA 4YCWA 4B3SL 4IO9A 4A3EG 1DGSA 5DLQE 1K3RA 4BXXH 3CAMA 3WWVA 1N8RC 4JI0Q 1QVFA 3F2CA 1PH6A 4X62Q 3RZDH 5IYDH 3I4OA 2XGTA 3FP9A 4DR1Q 1I94L 4WJ4A 1JT8A 2ZJRA 4B3MQ 3I4NH 1CKNB 4POFA 4BBSH 2HHHQ 2LXKA 1YJNA 3PSIA 4OWXB 3RLOA 4A76A 1XPOA 4R4QA 2GVAA 1X65A 4OX9Q 1GD7A 2JA7H 4JV5L 1WCMH 2K14A 4LF9L 2JA9A 1K9MC 5LMNQ 4B3RQ 3I2ZA 2DUDA 3J81i 2F3IA 2D0OA 3S1QH 2GN5A 4RMFA 4R4OA 5GAHC 4LF4Q 4LWCA 4XIGS 1C7YA 2JEBI 3ICEA 1L1OA 3A0JA 1D7QA 3D0FA 3TS2A 2D62A 4QJFA 2A19A 1PH1A 2ALYB 1TWFH 1EIYB 4BBRG 1JE5A 5C3EH 4BY1G 4NXMQ 5IP7G 1KIXA 2JQOA 3CMEA 4KI0A 1WOCA 2E8GA 5M5XH 2UU9Q 1B7YB 2CFMA 2IX1A 1A8VA 3T1HQ 2R93H 3S1RH 4KLKA 4A75A 3U50C 2YTXA 2Q2UA 1HZBA 4A3IG 1J5EQ 4JI2Q 1J6QA 4LF8Q 4L5RC 4DR3Q 1QUQB 4HJ5A 4DPGA 4P74A 3UDFA 1OXTA 3F2BA 2KHJA 2B63G 3HOUH 1N34Q 1UE1A 4JI8L 3S2DH 4IJHA 3FKIH 3J80i 2ZJQA 2F52A 2YYZA 1O7IA 1L0WA 2R92G 4X66Q 5IY0A 3K80C 1EOVA 3Q8DA 3TQYA 4C3HH 5GAEC 3PGZA 1Q1EA 4GNXA 3HKZG 4AH6A 5BR8L 3PF5A 4LF6Q 2UXCL 1YHAA 4LUVA 3M3YH 4APVA 3BU2A 4DV3Q 3OW2A 3S1NH 2K75A 4LNQA 1JJ2A 2UUBL 4L5SA 2Q2TA 1Q8KA 3M4QA 4A3DH 4HJ8A 1GO3E 2N3SA 3OTOQ 2JA8H 2Y0SG 4A3LG 4R4CA 1KRSA 1OXSC 5M3MG 4DKAC 1NBWA 4YHHQ 2OTJA 1OTCA 4DR4L 2VNUD 3E0EA 1X56A 4A3KH 1IZ6A 3HOYG 2A8VA 1L1OB 4GKJQ 4AYBG 1X55A 1YJ9A 4X66L 4DV2L 1T9HA 1FJGL 1YVCA 2HIVA 2MO0A 1IXRA 4OWTB 3KJPA 1LTLA 4A3MH 1Y1WH 5IYCH 1LM0A 2R7DA 2BA0A 5C4XG 1C9OA 1P16A 4L5TA 2ID0A 4LFAQ 3CCEA 4YCVA 1VQOA 2UUCL 4YWLA 2KHIA 4IPDA 2K5HA 1Z9FA 3W5OA 3RR5A 3JAMc 1Y1VH 1GVPA 4Y7NH 4IPCA 4JCVE 3W1GA 3K7UC 3TEHB 1AE3A 4H02A 4A3BG 1TWCH 2IHEA 1Y14B 1TWAH 1IBKL 2NVQH 3NELA 4P71A 1E24A 2I5LX 1VQ4A 1KC8C 3CF5A 3CC2A 2NN6G 1YHQA 1FL0A 4QY7A 3PO3H 1MJCA 4JBWA 1VQDA 3PCOB 4OONA 5C44G 4IOCA 1IBML 4JI6L 4LF5Q 2VQEL 4LUOA 2N49A 2PNHA 3CC7A 3CC4A 5LMUQ 3PUYA 5IT9c 1SMXA 4GNXB 1M1KC 1XNQQ 3S14H 1YNXA 4DUZQ 4X64L 2WB1E 1M90C 4JI3Q 3KDFA 1I6HH 1KD1C 4EX5A 4A3EH 1Q82C 1EFWA 1HZCA 4UPAA 4C3JH 4DR2Q 1HNWQ 2WAQE 1K83H 1UE5A 4YWMA 4GOPC 1EYGA 1G291 4GKKQ 4OO1I 1MJEA 3ULPA 2EXDA 4UP7A 1I5FA 3CXCA 1MIUA 1HR0L 2ATWA 4X6AH 2CWPA 4JOIC 4P72A 2CQOA 1UE6A 2R7FA 3W1BA 4LFBL 5IE8A 3NBHB 3CD6A 4KHPQ 2VY3A 1ASYA 1TWGH 1E1OA 2I5HA 3MXNB 1XMQQ 4OWWB 2NZOA 4IOAA 3STBC 3CPWA 1VQBA 3MEFA 4GLXA 3A74A 1W3SA 4ALPA 4DV0L 4HIOA 5IYBG 2ZM6L 1X9NA 5GAGC 3SGIA 1W2BA 5M3FG 1X3FA 2VZAA 1K0RA 3VDYA 3S15H 4BBRH 4BY1H 3F2DA 2UXDQ 2VUMG 5IP7H 1XMOL 2VL6A 2YV5A 4QL5A 3U4ZA 2QA4A 1VQAA 1R9TH 1KRTA 5IWAQ 1HNZQ 1VQ6A 3G6EA 4DUYL 1Q81C 1Q12A 2BA1A 1N32Q 3CCQA 4A3IH 1Q7YC 3I55A 4X65Q 1PFSA 4GLAC 1PVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J15 A;  4IPG A;  1A62 A;  1ASZ A;  2K50 A;  1WYD A;  4JI0 L;  1YBY A;  1AH9 A;  1VQH A;  2B63 H;  2VQF Q;  1KQS A;  1NE3 A;  1TXY A;  4X62 L;  4JI4 Q;  4B3T Q;  2IX0 A;  3LGJ A;  4DR1 L;  3TS0 A;  4A3J G;  3J81 c;  3H3V I;  4DV4 Q;  2VW9 A;  4B3M L;  2ZJP A;  3CCV A;  2HHH L;  2R92 H;  3GTG H;  1S3O A;  1PH2 A;  4OX9 L;  2JA5 G;  5K36 G;  1LUZ A;  1XNR Q;  4DR6 Q;  5LMN L;  3RLF A;  4A3F G;  1IL2 A;  4B3R L;  4FDB A;  1WJJ A;  3S24 A;  4DAY B;  4NXN Q;  4JI1 Q;  3UDX A;  4LF4 L;  2FXQ A;  3KYH C;  2MNA A;  2JA6 G;  1PYB A;  2B29 A;  3HOZ G;  4YY3 Q;  3S1M H;  1PH5 A;  2KCM A;  3I7F A;  2HIX A;  3ER0 A;  2E5L Q;  3I4N G;  4UP8 A;  1YHB A;  2ZTD A;  2CKZ B;  3PO2 G;  4QIW E;  2GVB A;  1UWV A;  2UXB Q;  4XTC S;  4IJL A;  3ERS X;  3ULJ A;  5M3M H;  4JI5 Q;  4DV6 Q;  4NXM L;  4DR7 Q;  5FLM G;  2UU9 L;  2K4K A;  1PH4 A;  3HOY H;  1HJP A;  4MTN A;  3G48 A;  1XTD A;  3T1H L;  3GTO H;  2Z6K C;  5C4J H;  1NMG A;  1B8A A;  4ME3 A;  3HOW G;  3CCM A;  1CKO A;  1J5E L;  3TRE A;  4JI2 L;  4LF8 L;  2MQH A;  3E9I A;  3GTQ H;  4JYA Q;  2WP8 J;  3J7Z C;  3J80 c;  4DAM A;  3S16 H;  4DR3 L;  5C4X H;  2V1C C;  3S17 H;  3ZJY C;  3L0O A;  4JI1 L;  2EIF A;  4LFC Q;  1BKB A;  1XPU A;  5FLX c;  1N34 L;  2YTV A;  5IP9 H;  2JE6 I;  4HIK A;  3CMA A;  1VQC A;  1HR0 W;  4A3B H;  1SE8 A;  4NPS A;  1S40 A;  2Y0S E;  1FGU A;  4AQY Q;  1PH9 A;  1BVS A;  1EIF A;  2K5V A;  1VQF A;  2BH8 A;  2QGQ A;  3K0X A;  1SFO H;  4LF6 L;  5AJ3 Q;  3RZO H;  4A3G G;  4O0A A;  4DV3 L;  3I4M G;  3BZK A;  2ES2 A;  1SRU A;  4GLV B;  3AEV A;  5FJ8 H;  1OXU A;  1TWH H;  1V43 A;  2EQS A;  4PZ7 A;  1E22 A;  3FKI G;  2YU9 H;  3S2H H;  3OTO L;  3M9B A;  2AWO A;  2KBN A;  5J3B A;  4JI7 Q;  1IYJ B;  3F8T A;  2E2H H;  4BA1 I;  4GOP A;  1VQ8 A;  3IRB A;  1B70 B;  3JAM i;  4GN3 B;  4DV5 Q;  2UUA Q;  1VQI A;  2NVT H;  1CKM A;  1VQE A;  4YHH L;  4JC0 A;  3EIV A;  4JOI A;  1S72 A;  1PV4 A;  4DR5 Q;  1XJV A;  4UY8 C;  2F4V Q;  3HOV H;  2KCT A;  2NVX H;  4GKJ L;  2XTI A;  1JJC B;  1PYS B;  2JK8 A;  4K0K Q;  1IBL Q;  3D31 A;  2B3G A;  2DGY A;  2RF4 A;  1QZH A;  3UE0 A;  3T1Y Q;  1K8G A;  3PV0 A;  5GQO A;  1KL9 A;  4GN5 A;  4LFA L;  3B6Y A;  2OCE A;  1N33 Q;  4R1J A;  1CKN A;  3GTP H;  4BA2 I;  1X3G A;  3KJO A;  3RN2 A;  2RHS B;  3KF8 B;  1EQR A;  4DV1 Q;  4L5Q A;  2L15 A;  3M4P A;  1N36 Q;  1HNX Q;  1PHJ A;  4QQB X;  1VQM A;  4PG3 A;  5IYB H;  1KXL A;  1QVC A;  4DV7 Q;  1E1T A;  1N9W A;  4YWK A;  5JJL A;  2I5M X;  3H15 A;  3A5U A;  1Y1W G;  5M3F H;  5IYC G;  2VS1 A;  1X6O A;  2IHF A;  3K81 C;  4MNO A;  4LF7 Q;  4LF5 L;  5LMN W;  4NB3 A;  2VUM H;  4A93 G;  2WAQ G;  3HKS A;  3M85 A;  1Y1V G;  4B3S Q;  1QVG A;  4KHZ A;  5LMU L;  1KAW A;  1GM5 A;  4HJ9 A;  1Q1B A;  3GTJ H;  1VQN A;  1XNQ L;  4WJ3 M;  4DUZ L;  2AHO B;  2PQA A;  3CQZ H;  4JI3 L;  2JEA I;  5JJK A;  3HOX G;  1NJI C;  5E7N A;  3I56 A;  2ZTC A;  3CP0 A;  1I94 Q;  4JBM A;  1YZ6 A;  4DR2 L;  2NVY H;  2WFW A;  1HNW L;  2RHQ B;  3CPF A;  3U4V A;  1HZ9 A;  4GKK L;  2RCN A;  4JV5 Q;  4LF9 Q;  1VQJ A;  3PO2 H;  1H95 A;  4GOP B;  4HJ7 A;  3OYY A;  3GTL H;  5M5W H;  1EWI A;  2ASB A;  3KFU A;  4A3J H;  1PH3 A;  2N78 A;  4BY7 G;  4KHP L;  3GD7 A;  3RN5 A;  3F1Z A;  4A3C G;  4LUZ A;  1V1Q A;  5ELO A;  2JA5 H;  1XMQ L;  2MO1 A;  1Q46 A;  1SN8 A;  1VQ5 A;  3H0G G;  3L2P A;  4A3F H;  3UDI A;  1XPR A;  4P75 A;  3AYH B;  3TRZ A;  2QEX A;  4TQU S;  3EBE A;  2JA6 H;  1OXX K;  1A0I A;  2NN6 I;  3HOZ H;  4Y52 H;  2R7Z G;  4DK6 C;  3K8A A;  4DK3 C;  2LXJ A;  3J7A 5;  3KDF B;  4C2M H;  1PH8 A;  2N8N A;  1X54 A;  2IT1 A;  2Z6K A;  4A4I A;  4HID A;  2Q2I A;  1QZG A;  1SLJ A;  1X3E A;  2UXD L;  4JG2 A;  1BBU A;  5FLM H;  3CCL A;  3CCJ A;  4IFD I;  5IWA L;  2K52 A;  1HNZ L;  2C35 B;  2OQK A;  3K7A H;  1PA6 A;  4BXX G;  1C0A A;  2E2J H;  1E7Z A;  3HOW H;  1YJW A;  2HT1 A;  2KEN A;  1N32 L;  1EQQ A;  4JI8 Q;  4X65 L;  1VQG A;  1YIT A;  1A63 A;  5IYD G;  1EUJ A;  1OXV A;  3STB D;  5EAY A;  3GTM H;  3KOJ A;  2AWN A;  4BBS G;  1SR3 A;  4A3L H;  5C0X I;  4PZ8 A;  1E3P A;  2JA7 G;  3PF4 A;  5BR8 Q;  2VQF L;  1WCM G;  1SRO A;  1YIJ A;  2UXC Q;  4PMW A;  4HJA A;  2PQA B;  4JI4 L;  4GN4 B;  4B3T L;  4DV4 L;  2UUB Q;  3G71 A;  1BBW A;  3CCS A;  1G51 A;  2R6G A;  3CW2 C;  4A3G H;  3PUX A;  3GDE A;  1XNR L;  4DR6 L;  4QGU A;  3E9H A;  3GO5 A;  4MZ9 A;  1K8A C;  1JB7 A;  2BH2 A;  3I4M H;  5C3E G;  3HKZ E;  4NXN L;  1CSP A;  3M7N A;  2HQL A;  1L1O C;  4DR4 Q;  3DM3 A;  4YY3 L;  5HY6 A;  3G4S A;  5H1S E;  1NMF A;  2E5L L;  1YEZ A;  2R93 G;  1VQ9 A;  1NY4 A;  4DV2 Q;  1AE2 A;  2YTY A;  3FHW A;  4PZ6 A;  1FJG Q;  1L2F A;  3A5Z B;  1UEB A;  3J81 j;  2UXB L;  4DR7 L;  1I3Q H;  3PUZ A;  4JI5 L;  4DV6 L;  2OTL A;  4EQ5 A;  1CSQ A;  3EN2 A;  1HH2 P;  1VQK A;  2JJQ A;  2UUC Q;  2IY5 B;  5C44 H;  1Q86 C;  3PIO A;  3HOU G;  5JEA G;  4POG A;  4P73 A;  5JEA J;  4AYB E;  3GTK H;  1U0L A;  4JYA L;  4O2D A;  5JJI A;  2Q2H A;  3ULL A;  1VS0 A;  2AKW B;  5GRO A;  4LFC L;  1WFQ A;  1VCI A;  4OXP A;  4DNI A;  1IBK Q;  2CCZ A;  2MFI A;  5HGQ A;  5M5Y H;  3M4O H;  1VQ7 A;  1WI5 A;  3KF6 A;  1IBM Q;  4JI6 Q;  2PMZ E;  2H5X A;  2VQE Q;  1Z47 A;  3CCR A;  4GNX C;  4AQY L;  4A3D G;  1U5K A;  4GS3 A;  3DLL A;  1PH7 A;  2JA8 G;  3RNU A;  5AJ3 L;  3NEM A;  3H3V H;  3KLW A;  4X64 Q;  3AQQ A;  2D0P A;  4A93 H;  5IP9 G;  1JJG A;  2K5N A;  3PUW A;  1MKH A;  3BJU A;  1V9P A;  4C3I H;  4A3K G;  2PI2 E;  3RLN A;  2OWO A;  1UE7 A;  1D8L A;  3UDG A;  4JI7 L;  2ZTE A;  1YI2 A;  1RL2 A;  1CUK A;  1HR0 Q;  1K73 C;  1I50 H;  3NEN A;  3HOX H;  4DV5 L;  2UUA L;  3PUV A;  2WB1 G;  2F4V L;  4LFB Q;  4A3M G;  4DR5 L;  3L7Z C;  3UE1 A;  2PI2 A;  5FJ8 G;  1JMC A;  4K0K L;  1IBL L;  3PIP A;  3HFZ B;  3BZC A;  2OQ0 A;  3T1Y L;  1NTG A;  4LW1 A;  2A1A A;  4IFD G;  4IPH A;  1G6P A;  4TVA B;  3CCU A;  4DV0 Q;  2E2I H;  4JBK A;  4BY7 H;  4IFD J;  4A3C H;  3AFP A;  2ZM6 Q;  4AIM A;  1VQL A;  4OO1 G;  1N33 L;  3U58 A;  3H0G H;  1P8L A;  1RIP A;  4DV1 L;  5GAD C;  3HOV G;  3PO3 G;  5ELN A;  1KHI A;  4HIM A;  2AMC B;  4YCU A;  1N36 L;  2NZH A;  1HNX L;  2CWA A;  4JBJ A;  1XMO Q;  3AFQ A;  5C0X G;  4DV7 L;  4UP9 A;  2R7Z H;  1QUQ A;  2Z0S A;  2LSS A;  5C0X J;  3JC6 6;  4R4I A;  1GKH A;  1FVI A;  1VQP A;  1LYL A;  4LF7 L;  3KF6 B;  2I0Q A;  4R4T A;  4RG1 A;  4DUY Q;  1HZA A;  4YCW A;  4B3S L;  4IO9 A;  4A3E G;  1DGS A;  5DLQ E;  1K3R A;  4BXX H;  3CAM A;  3WWV A;  1N8R C;  4JI0 Q;  1QVF A;  3F2C A;  1PH6 A;  4X62 Q;  3RZD H;  5IYD H;  3I4O A;  2XGT A;  3FP9 A;  4DR1 Q;  1I94 L;  4WJ4 A;  1JT8 A;  2ZJR A;  4B3M Q;  3I4N H;  1CKN B;  4POF A;  4BBS H;  2HHH Q;  2LXK A;  1YJN A;  3PSI A;  4OWX B;  3RLO A;  4A76 A;  1XPO A;  4R4Q A;  2GVA A;  1X65 A;  4OX9 Q;  1GD7 A;  2JA7 H;  4JV5 L;  1WCM H;  2K14 A;  4LF9 L;  2JA9 A;  1K9M C;  5LMN Q;  4B3R Q;  3I2Z A;  2DUD A;  3J81 i;  2F3I A;  2D0O A;  3S1Q H;  2GN5 A;  4RMF A;  4R4O A;  5GAH C;  4LF4 Q;  4LWC A;  4XIG S;  1C7Y A;  2JEB I;  3ICE A;  1L1O A;  3A0J A;  1D7Q A;  3D0F A;  3TS2 A;  2D62 A;  4QJF A;  2A19 A;  1PH1 A;  2ALY B;  1TWF H;  1EIY B;  4BBR G;  1JE5 A;  5C3E H;  4BY1 G;  4NXM Q;  5IP7 G;  1KIX A;  2JQO A;  3CME A;  4KI0 A;  1WOC A;  2E8G A;  5M5X H;  2UU9 Q;  1B7Y B;  2CFM A;  2IX1 A;  1A8V A;  3T1H Q;  2R93 H;  3S1R H;  4KLK A;  4A75 A;  3U50 C;  2YTX A;  2Q2U A;  1HZB A;  4A3I G;  1J5E Q;  4JI2 Q;  1J6Q A;  4LF8 Q;  4L5R C;  4DR3 Q;  1QUQ B;  4HJ5 A;  4DPG A;  4P74 A;  3UDF A;  1OXT A;  3F2B A;  2KHJ A;  2B63 G;  3HOU H;  1N34 Q;  1UE1 A;  4JI8 L;  3S2D H;  4IJH A;  3FKI H;  3J80 i;  2ZJQ A;  2F52 A;  2YYZ A;  1O7I A;  1L0W A;  2R92 G;  4X66 Q;  5IY0 A;  3K80 C;  1EOV A;  3Q8D A;  3TQY A;  4C3H H;  5GAE C;  3PGZ A;  1Q1E A;  4GNX A;  3HKZ G;  4AH6 A;  5BR8 L;  3PF5 A;  4LF6 Q;  2UXC L;  1YHA A;  4LUV A;  3M3Y H;  4APV A;  3BU2 A;  4DV3 Q;  3OW2 A;  3S1N H;  2K75 A;  4LNQ A;  1JJ2 A;  2UUB L;  4L5S A;  2Q2T A;  1Q8K A;  3M4Q A;  4A3D H;  4HJ8 A;  1GO3 E;  2N3S A;  3OTO Q;  2JA8 H;  2Y0S G;  4A3L G;  4R4C A;  1KRS A;  1OXS C;  5M3M G;  4DKA C;  1NBW A;  4YHH Q;  2OTJ A;  1OTC A;  4DR4 L;  2VNU D;  3E0E A;  1X56 A;  4A3K H;  1IZ6 A;  3HOY G;  2A8V A;  1L1O B;  4GKJ Q;  4AYB G;  1X55 A;  1YJ9 A;  4X66 L;  4DV2 L;  1T9H A;  1FJG L;  1YVC A;  2HIV A;  2MO0 A;  1IXR A;  4OWT B;  3KJP A;  1LTL A;  4A3M H;  1Y1W H;  5IYC H;  1LM0 A;  2R7D A;  2BA0 A;  5C4X G;  1C9O A;  1P16 A;  4L5T A;  2ID0 A;  4LFA Q;  3CCE A;  4YCV A;  1VQO A;  2UUC L;  4YWL A;  2KHI A;  4IPD A;  2K5H A;  1Z9F A;  3W5O A;  3RR5 A;  3JAM c;  1Y1V H;  1GVP A;  4Y7N H;  4IPC A;  4JCV E;  3W1G A;  3K7U C;  3TEH B;  1AE3 A;  4H02 A;  4A3B G;  1TWC H;  2IHE A;  1Y14 B;  1TWA H;  1IBK L;  2NVQ H;  3NEL A;  4P71 A;  1E24 A;  2I5L X;  1VQ4 A;  1KC8 C;  3CF5 A;  3CC2 A;  2NN6 G;  1YHQ A;  1FL0 A;  4QY7 A;  3PO3 H;  1MJC A;  4JBW A;  1VQD A;  3PCO B;  4OON A;  5C44 G;  4IOC A;  1IBM L;  4JI6 L;  4LF5 Q;  2VQE L;  4LUO A;  2N49 A;  2PNH A;  3CC7 A;  3CC4 A;  5LMU Q;  3PUY A;  5IT9 c;  1SMX A;  4GNX B;  1M1K C;  1XNQ Q;  3S14 H;  1YNX A;  4DUZ Q;  4X64 L;  2WB1 E;  1M90 C;  4JI3 Q;  3KDF A;  1I6H H;  1KD1 C;  4EX5 A;  4A3E H;  1Q82 C;  1EFW A;  1HZC A;  4UPA A;  4C3J H;  4DR2 Q;  1HNW Q;  2WAQ E;  1K83 H;  1UE5 A;  4YWM A;  4GOP C;  1EYG A;  1G29 1;  4GKK Q;  4OO1 I;  1MJE A;  3ULP A;  2EXD A;  4UP7 A;  1I5F A;  3CXC A;  1MIU A;  1HR0 L;  2ATW A;  4X6A H;  2CWP A;  4JOI C;  4P72 A;  2CQO A;  1UE6 A;  2R7F A;  3W1B A;  4LFB L;  5IE8 A;  3NBH B;  3CD6 A;  4KHP Q;  2VY3 A;  1ASY A;  1TWG H;  1E1O A;  2I5H A;  3MXN B;  1XMQ Q;  4OWW B;  2NZO A;  4IOA A;  3STB C;  3CPW A;  1VQB A;  3MEF A;  4GLX A;  3A74 A;  1W3S A;  4ALP A;  4DV0 L;  4HIO A;  5IYB G;  2ZM6 L;  1X9N A;  5GAG C;  3SGI A;  1W2B A;  5M3F G;  1X3F A;  2VZA A;  1K0R A;  3VDY A;  3S15 H;  4BBR H;  4BY1 H;  3F2D A;  2UXD Q;  2VUM G;  5IP7 H;  1XMO L;  2VL6 A;  2YV5 A;  4QL5 A;  3U4Z A;  2QA4 A;  1VQA A;  1R9T H;  1KRT A;  5IWA Q;  1HNZ Q;  1VQ6 A;  3G6E A;  4DUY L;  1Q81 C;  1Q12 A;  2BA1 A;  1N32 Q;  3CCQ A;  4A3I H;  1Q7Y C;  3I55 A;  4X65 Q;  1PFS A;  4GLA C;  1PVO A; 
#chains in the Genus database with same CATH topology
 1PTO H;  3DUZ A;  2V4D A;  1IL8 A;  2MGS A;  1STY A;  1AH9 A;  2VQF Q;  1WTP A;  2IX0 A;  4DR1 L;  4DV4 Q;  3HS0 C;  2F0T A;  2ZJP A;  4A3K B;  1ONL A;  2R92 H;  4OX9 L;  1NNX A;  4FXG C;  3UI2 A;  4Q5V A;  4LAA A;  5LMN L;  4A3M B;  4JI1 Q;  1Y1W B;  2FXQ A;  2JA6 G;  2MNA A;  5KNB A;  4YY3 Q;  1JOK A;  1ILP A;  4HN7 A;  3AU7 A;  3I4N G;  2WAQ B;  3FEW X;  2Q8T A;  3NE5 B;  1Y1V B;  1QB5 D;  4C3I B;  2FFK B;  3ERS X;  1K8M A;  3MFG A;  4DR7 Q;  2JP1 A;  5FLM G;  2K4K A;  1TY0 A;  1PH4 A;  3T1H L;  2Z6K C;  2N88 A;  5J22 A;  1PZI D;  1D1I A;  4WFN 3;  3TRE A;  4LF8 L;  4JYA Q;  3E9I A;  1SYB A;  3U9S A;  4M1U B;  5I4D A;  4DAM A;  3S16 H;  4DR3 L;  5C4X H;  2V1C C;  3S17 H;  4LFC Q;  5ISR A;  1UNS A;  5FLX c;  2YTV A;  2XRQ D;  4A3B H;  1SE8 A;  4ABN A;  2AQ1 B;  4A3E B;  4AQY Q;  1FGU A;  1EIF A;  2BH8 A;  4A3G G;  1SFO H;  1D1K A;  3I4M G;  3MXP A;  1GUG A;  1SRU A;  1TWH H;  5ELE A;  1MSH A;  3R3O A;  4ULL A;  3FKI G;  2F4I A;  5M9O A;  3PIO 3;  3OTO L;  5E1F A;  3S2H H;  2AWO A;  2WAC A;  5J3B A;  3NXW A;  2E2H H;  4BA1 I;  4GOP A;  1VQ8 A;  1B70 B;  3WOE A;  1VQI A;  4YHH L;  4JC0 A;  3EIV A;  4JOI A;  4DR5 Q;  2XTI A;  4KKU A;  2CHB D;  2JK8 A;  3S15 B;  2OEO A;  4MIU A;  2B3G A;  4BY1 B;  1TII D;  4K5W A;  1Y8N B;  1HA6 A;  1EWC A;  4LFA L;  4G7Z C;  1ET9 A;  1CA6 A;  4H0L C;  3GTP H;  1CKN A;  1L0Y B;  1X3G A;  5EBC A;  3QR8 A;  1PHJ A;  4PG3 A;  5IOC A;  4RKL A;  5IYB H;  1KXL A;  4IAL A;  1N9W A;  5G3L D;  3IAY A;  2PZT A;  4CHT B;  5I2X A;  5IYC G;  5JOB A;  5ELF A;  1SNM A;  1X6O A;  3K81 C;  3BVG A;  4LF7 Q;  4KV6 A;  4LF5 L;  4G57 A;  2Z6B A;  1GHJ A;  1QVG A;  5EPK A;  4E6I A;  1KAW A;  1VQN A;  1A2T A;  2ICI A;  1XNQ L;  1YNJ C;  2AHO B;  2JEA I;  2ZTC A;  2K28 A;  2CQA A;  4I7A A;  2L4N A;  4HMJ A;  1PTO D;  4DR2 L;  4IUN A;  2WFW A;  2RHQ B;  1MHW C;  3QO2 A;  2RCN A;  5M5W H;  4X3K A;  3HOY B;  1OO9 B;  4A3C G;  4LUZ A;  5ELO A;  1UEA B;  3GTO B;  5C4J B;  1XMQ L;  3IKJ A;  3H91 A;  3ND8 A;  3NSW A;  3GTQ B;  3Q24 A;  3TRZ A;  1ENC A;  3I4L A;  2F0Q A;  2JA6 H;  1A0I A;  2R7Z G;  2LXJ A;  3J7A 5;  3KDF B;  1LTT D;  4C2M H;  1PH8 A;  1X54 A;  1SXT A;  1QZG A;  1SLJ A;  3GP7 A;  4JG2 A;  1BBU A;  2KED A;  5FLM H;  3CCL A;  1SNO A;  2LS0 1;  3I90 A;  1PMR A;  2C35 B;  3HRZ C;  3RZO B;  5D3I B;  2HT1 A;  2KEN A;  2F0K A;  1YIT A;  2R61 A;  1A63 A;  5IYD G;  1EUJ A;  4HCS A;  3GTM H;  4BBS G;  2YU9 B;  4K2L A;  1HFN A;  3OSO A;  2VQF L;  2F1M A;  2UXC Q;  4HJA A;  4GN4 B;  2NVT B;  4DV4 L;  3LNN A;  3CCS A;  3CW2 C;  4A3G H;  3PUX A;  3GDE A;  4K8J A;  4QGU A;  3E9H A;  2BH2 A;  3I4M H;  5C3E G;  1CK1 A;  1LTA D;  3M7N A;  1B4O A;  4YY3 L;  4N9P A;  2L55 A;  3G4S A;  1NY4 A;  3V96 A;  3NTH A;  3GV3 A;  3D4R A;  3BS1 A;  4DR7 L;  2E2D C;  1CSQ A;  1TT2 A;  4NMZ A;  3VR2 A;  2B2W A;  1Q86 C;  4POG A;  4HAE A;  3A8K E;  4P73 A;  5JEA J;  2KJX A;  1U0L A;  5T1I A;  4JYA L;  3N6R A;  4LFC L;  1JOO A;  3MXG A;  3CQZ B;  1VQ7 A;  2SNM A;  1PLF A;  2KA7 A;  4OEM B;  5EKL A;  1IBM Q;  1QNU A;  1EEF D;  3VR5 A;  3MC0 B;  4AQY L;  2Q8R E;  2NVY B;  1U5K A;  1PXU A;  1Q8I A;  3NEM A;  3H3V H;  1K0S A;  3IL8 A;  4NP5 A;  1XYI A;  3LWE A;  3W2D A;  4JK1 C;  3Q22 A;  3RLN A;  1D8L A;  1WD0 A;  4MTK A;  3VYT A;  4KK7 A;  5DM7 3;  4K14 A;  3PUV A;  1D5X C;  2WB1 G;  4DR5 L;  3SK8 A;  1J9O A;  1E2Z A;  3K6O A;  1A3V A;  1I6V C;  2PI2 A;  5KYL A;  5FJ8 G;  1CFM A;  1F2M A;  2OQ0 A;  3Q23 A;  1SSO A;  3HKZ B;  3KLS A;  2E2I H;  4IFD J;  4A3C H;  2ZM6 Q;  5CBA E;  2HDM A;  1P8L A;  1RIP A;  5ELB A;  3HOV G;  2EYM A;  4HIM A;  3P20 A;  4YCU A;  1JIC A;  2R7Z H;  1F9P A;  4NDX A;  4UP9 A;  1F2Y A;  1CQF A;  4EQO A;  3JC6 6;  5CV7 A;  4LF7 L;  3KF6 B;  2K5Q A;  4R4T A;  4RG1 A;  4AYB B;  4YCW A;  4IO9 A;  1K3R A;  1H9K A;  3CAM A;  1R4Q B;  1PH6 A;  1B9M A;  1S5D D;  3V2T A;  1NCV A;  5IYD H;  3I4O A;  3FP9 A;  1PFM A;  1WTV A;  1IKM A;  1G2T A;  4B3M Q;  4BBS H;  1CKN B;  2LFN A;  2CH4 A;  2HHH Q;  2LXK A;  3PO2 H;  1XPO A;  4OWX B;  1X65 A;  1F2Z A;  5L37 A;  3SEB A;  4QMG A;  3I2Z A;  3S1Q H;  1IHZ A;  4EQN A;  4LF4 Q;  1K3B C;  4LWC A;  5C44 B;  3A0J A;  2WV6 D;  2F3W A;  4CKC A;  1UAP A;  1PH1 A;  2ALY B;  3EA6 A;  4BBR G;  3OWF A;  5C3E H;  4K8I A;  5IP7 G;  1KIX A;  4N8F A;  5M5X H;  1QNK A;  3L9A X;  2UU9 Q;  1A8V A;  4ME5 A;  4KLK A;  4A75 A;  2JXM B;  3U50 C;  5IOD A;  3T56 B;  4JI2 Q;  5IGG A;  1QUQ B;  4LJZ C;  3EQL C;  5EPL A;  3F2B A;  2KHJ A;  1EYC A;  2XWJ B;  2B63 G;  4FYD A;  4CDC C;  1UE1 A;  3NQI A;  4IJH A;  1L0W A;  2MUY A;  3K80 C;  1EOV A;  3K5M A;  2UXC L;  3T13 A;  1ILQ A;  3OW2 A;  3MEH A;  1JJ2 A;  4F88 A;  5M3F B;  3M4Q A;  3NBI A;  4B08 A;  2H4O A;  1LTI D;  2A5H A;  1D5Z C;  4DFA A;  1Y69 U;  4R4C A;  5K5P A;  4HCE A;  5M3M G;  1NBW A;  1X56 A;  5EPJ A;  2HIV A;  3OIP A;  5IGC A;  2L11 A;  3NUC A;  4XT3 B;  2IWH A;  1P16 A;  2EZV A;  1QJO A;  1X3P A;  3E6Z X;  2KHI A;  3K5L A;  3RR5 A;  3RMH A;  4JCV E;  1B3Q A;  4DNR B;  4EGV A;  4H02 A;  2F0E A;  1TWC H;  1Y14 B;  1NSN S;  2J4X A;  3FPU B;  1VQ4 A;  1E24 A;  3CC2 A;  3AB9 A;  4IOC A;  3PCO B;  1IBM L;  1BDO A;  1QG7 A;  2PNH A;  3BYY B;  1I4Q A;  5LMU Q;  3PUY A;  4GNX B;  1WCM B;  2SOB A;  3O13 A;  1SMY D;  4R8I A;  3JAM E;  1ZEQ X;  4XQQ A;  1KD1 C;  2RDH A;  1EFW A;  1Q82 C;  4UPA A;  1EFI D;  1HNW Q;  4YWM A;  1EYG A;  4GOP C;  1PFN A;  5FKA C;  4CBV A;  2ATW A;  1E2W A;  1I5F A;  1S5C D;  2CWP A;  4JOI C;  2R7F A;  1UE6 A;  4O1N A;  2XIW A;  4R8N A;  3W1B A;  2EYP A;  2JSO A;  3D3R A;  5I9O A;  2I5H A;  3GQB A;  4OWW B;  2F0P A;  3CPW A;  1VQB A;  4L8J A;  4BWG B;  5J1Z A;  4K2K A;  4HIO A;  2ZM6 L;  4OIJ A;  4J6H A;  4CJ0 B;  3VDY A;  1K0R A;  3P75 A;  3HOU B;  4BBR H;  3S2D B;  3H94 A;  5IP7 H;  3NP8 A;  4ZAI A;  3U4Z A;  5FO7 B;  2X69 A;  4CJ2 C;  1JE4 A;  3TME A;  4C3H B;  1VQ6 A;  1PZK D;  3KBX A;  3G6E A;  1GOZ A;  1Q81 C;  3M3Y B;  1Q7Y C;  4XDX A;  4X65 Q;  4ZUJ A;  1PFS A;  4GLA C;  1PVO A;  2Z4H A;  4IPG A;  1WTQ A;  4DXG A;  2B63 H;  4H13 C;  2O2L D;  4F87 A;  5G3L F;  1A2U A;  1X3Q A;  3LGJ A;  1SNC A;  3TS0 A;  5C5M A;  4A3J G;  3BVZ A;  4B3M L;  3SXH A;  3HZX A;  2HHH L;  3GTG H;  2F03 A;  2JA5 G;  5A2Q E;  3I3C A;  1XNR Q;  4DAV A;  3S24 A;  4NXN Q;  4LF4 L;  1NUC A;  1C48 A;  1U9R A;  2B29 A;  3HOZ G;  3S1M H;  3ER0 A;  1YHB A;  3BDC A;  1DJR D;  2EXZ A;  4QIW E;  1FNV A;  1O7L A;  5M3M H;  4IJL A;  3A8J E;  3ULJ A;  4JI5 Q;  1LO5 D;  4IUR A;  2UU9 L;  4KKT A;  2WKC A;  4IUV A;  1B8A A;  3QJY A;  3PO3 B;  3CCM A;  1ESF A;  4JI2 L;  4J1M A;  3R2T A;  1F9R A;  3L0O A;  2EIF A;  1BBX C;  1A3T A;  2ZT9 C;  1A3U A;  5IP9 H;  2A69 C;  2JE6 I;  4HIK A;  3FVQ A;  1I6H B;  4KD4 A;  4NPS A;  4HED A;  1XWE A;  2Y0S E;  4C3J B;  1FNU A;  1PH9 A;  1BVS A;  2G5D A;  4OO1 G;  1STB A;  2K6A A;  3QIA A;  1OXU A;  2KEE A;  1E22 A;  3P1H A;  3G6J B;  1TWG B;  3M9B A;  4JI7 Q;  4IFD H;  4I7Z C;  3F8T A;  1TS4 A;  3OWE B;  3LWU A;  2E76 C;  2UUA Q;  2N55 A;  1CKM A;  2L5T A;  1S72 A;  1JOR A;  1V1P B;  2KCT A;  1JJC B;  3EJI A;  1F2L A;  2RDF A;  3RD4 A;  4C56 C;  3D31 A;  1IBL Q;  2RF4 A;  2K1B A;  3PV0 A;  4ZLT F;  2B2W C;  5C6A A;  4GN5 A;  1QCB D;  2OCE A;  1N33 Q;  4BA2 I;  2ICE C;  3RN2 A;  1EQR A;  4A3I B;  3TN2 A;  1N36 Q;  1HNX Q;  4QQB X;  2F0F A;  1L0X B;  3DEP A;  1QVC A;  1LAB A;  1PTO B;  3I8Z A;  4L63 B;  2DJF C;  1TWF B;  4YWK A;  4KHV A;  3H15 A;  3A5U A;  1Y1W G;  2RA4 A;  1SYF A;  4QB4 A;  4NB3 A;  2WAQ G;  2R93 B;  1Y1V G;  2R92 B;  4C3I G;  5LMU L;  1FNW A;  2D5D A;  4HJ9 A;  1Q1B A;  3GTJ H;  1H9S A;  3DWP A;  3A56 A;  5CC4 A;  4U67 3;  3SR1 A;  3I56 A;  1NJI C;  3CP0 A;  5FLX L;  1I94 Q;  1B1Z A;  1HNW L;  4C1N I;  4JV5 Q;  1VQJ A;  4QUC A;  4RAU C;  3OYY A;  5A35 A;  3WOF A;  4A3J H;  2FMM A;  3QWN A;  3NWS A;  1TY2 A;  4QF4 A;  3GD7 A;  3F1Z A;  2JA5 H;  3D6C A;  1VQ5 A;  3H0G G;  3KLR A;  3UDI A;  4KTA A;  3AYH B;  1HQR D;  4A3D B;  1SNQ A;  2QEX A;  5IIF A;  3S16 B;  4JW0 A;  3HOZ H;  4Y52 H;  5C4X B;  4DK6 C;  3SVM A;  3S17 B;  1YNN C;  3K8A A;  5IGE A;  4JVZ A;  1BCP C;  2N8N A;  2IT1 A;  2F0H A;  1X3E A;  1IW7 C;  4OGQ C;  5E3F A;  5LL6 X;  4XXE A;  4LMQ D;  4A3B B;  4IFD I;  3TP6 A;  1ZYR D;  3HGB A;  3K7A H;  4BXX G;  3OPO A;  1C0A A;  1M8A A;  1SFO B;  1ESR A;  1EY9 A;  4X65 L;  1I4X A;  1TWH B;  4A3L H;  3S2H B;  4PZ8 A;  4Y7N B;  2JA7 G;  5C3W A;  5TSS A;  1XTC D;  1YIJ A;  1PZJ D;  2E2H B;  4HSV A;  1TWA B;  3J81 E;  1QOH A;  1PRT D;  3MZ5 A;  4X3U A;  1BBW A;  2R6G A;  4OO1 H;  4GZY C;  1XNR L;  4FF1 A;  1D2B A;  1K8A C;  1HTP A;  3DM1 A;  4NXN L;  1O7Z A;  3KBG A;  4DR4 Q;  3DM3 A;  5HY6 A;  2K5W A;  3GTP B;  1FYC A;  1YEZ A;  4V19 0;  2DY8 A;  2P5Z X;  3FHW A;  1LT4 D;  1L2F A;  4JI5 L;  2KOL A;  2UUC Q;  2IY5 B;  2KQ3 A;  1GJX A;  3URY A;  3VA5 A;  2A73 B;  4O2D A;  3J80 E;  3U9O A;  2FMC A;  3I91 A;  1WFQ A;  4OXP A;  3NBH A;  5FK9 C;  2DN8 A;  5HGQ A;  3M4O H;  2XNA C;  1WI5 A;  4CKE A;  3MXN A;  3KF6 A;  1SE4 A;  1H9M A;  2K04 A;  2KCN A;  2PMZ E;  5F2D A;  1Z47 A;  3DLL A;  5JPN C;  2JA8 G;  2XVS A;  4X64 Q;  2D0P A;  3D4D A;  1AN8 A;  1JJG A;  1HFG A;  2TSS A;  3PUW A;  1HTL D;  1V9P A;  5CV9 A;  4C3I H;  2PI2 E;  4K5V A;  3VYS A;  3NK9 A;  4JI7 L;  1I4H A;  3V05 A;  3QB3 A;  1YI2 A;  2K32 A;  4DU9 A;  1K73 C;  3NEN A;  2F0S A;  2UUA L;  5D3D A;  2JA6 B;  3NTI A;  1TU2 B;  5FOB B;  3L7Z C;  4R9W A;  1CHQ D;  3K5O A;  2K01 A;  4C2M B;  1IBL L;  3BZC A;  3T4A C;  3PIP 3;  2A1A A;  2CVR A;  4TVA B;  4JBK A;  2A74 C;  1KNA A;  1N33 L;  3D6W A;  2EY1 A;  3H0G H;  2G9D A;  5GAD C;  4F7X A;  1KHI A;  1N36 L;  1HNX L;  1EY6 A;  2CWA A;  2JN4 A;  3GTM B;  3AFQ A;  3MFY A;  5C0X G;  1QUQ A;  2LSS A;  5HGT A;  2NTT A;  3J7A V;  1EEI D;  2B8F A;  1LYL A;  2WIN B;  3K5N A;  2I0Q A;  1HZA A;  3DHQ A;  2PO4 A;  5EGT A;  1GXD C;  5DLQ E;  4CDF C;  4BXX H;  4A3G B;  1GUO A;  2C5C A;  3I4M B;  4X62 Q;  3RZD H;  1I94 L;  1JT8 A;  3I4N H;  2AUK A;  3PSI A;  2JA7 H;  4JV5 L;  1E0B A;  1K9M C;  4FVM A;  4PNY A;  1ML0 D;  4S3S A;  3ICE A;  2B39 A;  1EL0 A;  3KK7 A;  1D7Q A;  3D0F A;  1Z6H A;  3OIQ A;  1MSG A;  4QJF A;  2A19 A;  2Z8L A;  3QG1 A;  1YNJ D;  2JQO A;  4KI0 A;  2E8G A;  3MA2 B;  1GUW A;  1H9S B;  2IX1 A;  5NUC A;  2SDF A;  1STE A;  2YTX A;  2Q2U A;  3SDZ A;  3KLS X;  3L3O C;  1AP0 A;  1O80 A;  1NR4 A;  2NBF A;  2QDB A;  3UDF A;  3ITP A;  4DPG A;  1OXT A;  4XYO A;  3DMU A;  1N34 Q;  2DNE A;  3FKI H;  2YYZ A;  2QKI C;  1FR3 A;  3SK5 A;  2DNC A;  3Q8D A;  4OEL B;  3CHB D;  2RQX A;  3PGZ A;  5EJW A;  3HKZ G;  4GNX A;  4YIJ A;  1RTO A;  4LF6 Q;  4LUV A;  4DV3 Q;  3S1N H;  1EWH A;  2EJF C;  2K75 A;  2Q2T A;  1Q8K A;  4ZYS A;  2N3S A;  2JA8 H;  2Y0S G;  1NR2 A;  3A8I E;  1EZ8 A;  1KRS A;  2E74 C;  2B2Y A;  4DR4 L;  3E0E A;  2KHS A;  1IZ6 A;  2A8V A;  1L1O B;  4GKJ Q;  4AYB G;  1YJ9 A;  3DXJ C;  4X66 L;  1YVC A;  5DAU A;  3KJP A;  2MO0 A;  1IXR A;  3I70 A;  3OHX C;  3T53 B;  5JJZ A;  2PCF B;  5IYC H;  2R7Z B;  5KYI A;  2UUC L;  4YCV A;  4YWL A;  2PNR C;  3W1G A;  1O78 A;  3K7U C;  3TEH B;  1AE3 A;  5C4H A;  2IHE A;  5JPM C;  2NVQ H;  3NEL A;  3MWY W;  1KC8 C;  2I5L X;  3CF5 A;  3TZU A;  5CV8 A;  1MJC A;  4OON A;  5C44 G;  3J81 L;  1B50 A;  2BE5 C;  5C0X H;  2VXW A;  2N49 A;  4BBS B;  3PO2 B;  5IGF A;  1CTM A;  3S9W A;  1WD1 A;  4X64 L;  1EIH A;  2O5I C;  1ROD A;  1LT6 D;  1HZC A;  2WAQ E;  1K83 H;  4RHR A;  4GKK Q;  3ULP A;  1IYU A;  5BN4 A;  5C3E B;  1B53 A;  2PZW A;  5EKI A;  3GV6 A;  4P72 A;  2CQO A;  5I6W A;  3NBH B;  1RKN A;  5M5X B;  4KHP Q;  1DOM A;  2VY3 A;  4QCL A;  3MXN B;  2F0D A;  4RKB A;  5IT9 E;  1EU4 A;  3STB C;  4IOA A;  1KDA A;  1U4P A;  2DY7 A;  4I65 A;  5BN5 A;  4CKB A;  2EYF A;  1RF2 D;  5GAG C;  3SGI A;  1R4P B;  1X3F A;  2EDG A;  2OF1 A;  2VZA A;  5M3F G;  4EQP A;  1H9J A;  4BS9 A;  2UXD Q;  1Y8O B;  2VUM G;  2YV5 A;  1R9T H;  1KRT A;  5IWA Q;  1HNZ Q;  1PFB A;  2BA1 A;  3CCQ A;  2OT2 A;  3T51 B;  1G6Z A;  1TKW B;  5D14 A;  2K50 A;  2XN9 C;  1YBY A;  4KY6 A;  2EVB A;  1VQH A;  3OOC A;  1NE3 A;  1TXY A;  4X62 L;  4B3T Q;  3H3V I;  3OMC A;  3J81 c;  2VW9 A;  1VMC A;  3NPP A;  1PH2 A;  3MAQ A;  1W6K A;  2HCC A;  2ZXP A;  4A3F G;  3RLF A;  4UDU C;  4DAY B;  2WB1 B;  3UDX A;  3KYH C;  1V1P A;  2X6L A;  1PH5 A;  1EOT A;  2KCM A;  3I7F A;  2ZTD A;  1SE2 A;  1B2T A;  2GVB A;  2KUM A;  4H44 C;  2MP1 A;  2UXB Q;  2C9O A;  1TWC B;  2K05 A;  2Z1C A;  1HJP A;  4G7H C;  1LTR D;  1NMG A;  3HOW G;  5COR A;  3J7A F;  1ENF A;  3J7Z C;  3J80 c;  4FNF A;  3C1E A;  1XPU A;  3EVQ A;  1N34 L;  3VA7 A;  1VQC A;  1HR0 W;  5CYU A;  1KDC A;  2KEC A;  1S40 A;  1K28 A;  2K5V A;  1AZP A;  2QGQ A;  4LF6 L;  3K0X A;  1SND A;  5AJ3 Q;  4O0A A;  2IX3 A;  4DV3 L;  4GLV B;  3AEV A;  5FJ8 H;  3HP3 A;  1F9S A;  2EQS A;  5DM6 3;  3RUZ A;  1V8Q A;  4GN3 B;  2MJ8 A;  1G91 A;  2J7Z A;  1PV4 A;  1XJV A;  3HOV H;  2NVX H;  4GKJ L;  1PYS B;  2CW0 C;  2DGY A;  3UE0 A;  3T1Y Q;  5KIX A;  2NUC A;  5GQO A;  1JQY D;  1KL9 A;  1ICW A;  1J8I A;  3KF8 B;  4L5Q A;  2O5J C;  2ZXR A;  4DV7 Q;  1E1T A;  5JJL A;  5JVG 3;  5HUR A;  1GHK A;  1HQM C;  5M3F H;  2B63 B;  2VS1 A;  2IHF A;  5LMN W;  2VUM H;  4A93 G;  4B9X A;  3HKS A;  3M85 A;  4B3S Q;  4IUQ A;  3GTG B;  2PW5 A;  1GM5 A;  1WVL A;  4WJ3 M;  3Q0A A;  2GA4 B;  2EYH A;  3HOX G;  1DOL A;  3FMC A;  1KAA A;  2QCP X;  4JBM A;  3S1M B;  2RSO A;  1BF4 A;  4GKK L;  1BQQ T;  3GTL H;  5M3M B;  1PH3 A;  2N78 A;  4BY7 G;  4KHP L;  3RN5 A;  1F77 A;  1V1Q A;  1PDQ A;  2AQ3 B;  2L9H A;  4IUU A;  2MO1 A;  1Q46 A;  1SN8 A;  3L2P A;  4A3F H;  4Q0F A;  1XPR A;  5CMD A;  4P75 A;  1NAP A;  5JVH 3;  4TQU S;  1OXX K;  4QUF A;  4M8A A;  2F0M A;  3HG9 A;  1GUN A;  2UXD L;  2Q2I A;  1U4M A;  3MHB A;  1PRT B;  3I72 A;  2IPK D;  5IWA L;  2K52 A;  1HNZ L;  1PA6 A;  4CJ1 B;  2E2J H;  1B44 D;  3HOW H;  1YJW A;  4RCO A;  1VQG A;  5COY A;  1SR3 A;  1PTO F;  3PF4 A;  1SRO A;  2F0J A;  1DD2 A;  2PQA B;  1TS3 A;  1B9N A;  1EZ6 A;  3VYR A;  4B3T L;  2UUB Q;  2L1B A;  1D5M C;  1JWU D;  5CR3 A;  1JB7 A;  2EYO A;  3HKZ E;  3S14 B;  5KNC A;  1EU3 A;  5H1S E;  2R93 G;  4DV2 Q;  1AE2 A;  3A5Z B;  3J81 j;  1UEB A;  2UXB L;  2IL8 A;  1I3Q H;  1VDZ A;  2EY5 A;  4EQ5 A;  1LTS D;  2I07 B;  1HH2 P;  1E2V A;  1EY7 A;  3PIO A;  4KJO A;  3SK6 A;  4AYB E;  3GTK H;  5JJI A;  1QIL A;  2Q2H A;  3ULL A;  1EQV A;  5GRO A;  4DNI A;  3QOL A;  1IBK Q;  1UUP A;  2CCZ A;  3GTJ B;  2MFI A;  4HMI A;  5D65 A;  5M5Y H;  3DEO A;  1RTN A;  1CZG A;  1CZW A;  2L0C A;  2VQE Q;  3CCR A;  4GNX C;  4A3D G;  1PH7 A;  5AJ3 L;  1S5E D;  3KLW A;  3NTK A;  3AQQ A;  4A3J B;  4A93 H;  2QW7 A;  2VB3 X;  2K5N A;  4KY7 A;  4A3K G;  1HRJ A;  2JA5 B;  5AFW A;  1U4L A;  4KKS A;  3AMU A;  1TR5 A;  1CUK A;  1I50 H;  3TP5 A;  3HOX H;  3K0Y A;  2A69 D;  4A3M G;  3HOZ B;  2PW7 A;  3UE1 A;  1BR9 A;  2XRS D;  3E0J A;  3ERO A;  1JMC A;  1DXM A;  3PIP A;  3HFZ B;  3NHH A;  2A6H C;  3T1Y L;  1MGS A;  2FIN B;  1G6P A;  4DV0 Q;  4TKO B;  4BY7 H;  1JWS D;  1VQL A;  3K7A B;  2QF7 A;  1WTH A;  3U58 A;  1MD2 D;  1KAB A;  1CHP D;  5ELN A;  5LHY 1;  2LY7 A;  2NZH A;  3CKI B;  2B2V A;  4RWS C;  4DV7 L;  5C0X J;  4U68 A;  4R4I A;  3MVV A;  4IUT A;  1FVI A;  1T5E A;  5EQ0 A;  3K57 A;  1ZKO A;  4DN4 M;  4B3S L;  4XQN A;  4A3E G;  1DGS A;  3A55 A;  1N8R C;  4JI0 Q;  1QVF A;  3F2C A;  1WTW A;  1Z7T A;  4K6D A;  3D8G A;  4V0B A;  2J0T D;  2ZJR A;  4POF A;  1CM9 A;  4R4Q A;  2GVA A;  1K8O A;  2I46 A;  4K6L A;  2JA9 A;  5C3X A;  1HCZ A;  1II3 A;  4B3R Q;  1HPC A;  4RMF A;  3TZD A;  4R4O A;  5GAH C;  4P2C B;  4XIG S;  1C7Y A;  2O4X A;  2K5D A;  1L1O A;  3EFX D;  3JAM L;  2B2U A;  3TS2 A;  1A15 A;  1WTO A;  4XT1 B;  1TWF H;  1JE5 A;  1RDP D;  4BY1 G;  3TSS A;  4NXM Q;  1KNE A;  3CME A;  1WOC A;  5LL6 S;  2A6E C;  2R93 H;  4MN3 A;  3S1R H;  3M4O B;  1SAP A;  1CQV A;  1J5E Q;  5EBD A;  4L5R C;  5CV6 A;  1G8Z D;  2KVM A;  4KMU C;  4TRD A;  2NYZ D;  2ZJQ A;  3BVM A;  2NWG A;  4X66 Q;  3TQY A;  1Q1E A;  1YNN D;  1YHA A;  3BU2 A;  1BCP D;  1CI3 M;  2D9U A;  2WKD A;  2A68 C;  4K5X A;  1LAC A;  2QDL A;  1ICF B;  2UUB L;  4L5S A;  1IW7 D;  4A3D H;  1Q90 A;  1GO3 E;  3A7A B;  1SJE D;  3OW7 A;  2OTJ A;  1OTC A;  3C3L A;  4IUP A;  4A3K H;  3HOY G;  4N9T A;  1X55 A;  3H0G B;  4O42 A;  4DV2 L;  2HD3 A;  1T9H A;  4RH6 A;  1KLG D;  3VR6 A;  4OWT B;  5E4W C;  1SBB B;  2A6E D;  4A3M H;  1VF7 A;  1Y1W H;  1G2S A;  3NWT A;  5A2Q L;  1LM0 A;  1MI2 A;  1C9O A;  4L5T A;  1DYQ A;  2ID0 A;  1VQO A;  3CCE A;  4ZKC B;  5M5W B;  3BG3 A;  2FHT A;  3FDT A;  4IPD A;  2K5H A;  3W5O A;  3JAM c;  1HUN A;  1Y1V H;  4DGZ A;  4Y7N H;  1I4P A;  1JC7 A;  1PTO C;  3ERQ A;  1TWA H;  4RHS A;  1IBK L;  3G7L A;  4ZKB B;  4WJW A;  2EE1 A;  2NN6 G;  4QY7 A;  2K33 A;  3RZD B;  4KN7 C;  2VQE L;  3I4N B;  3ONA B;  1DOK A;  2K7V A;  3CC7 A;  1LT5 D;  2JA7 B;  2RBM A;  2MPM A;  1M1K C;  2A68 D;  2OXP A;  1EY0 A;  4DUZ Q;  4JI3 Q;  2LMC B;  1S5F D;  4A3E H;  2ZXO A;  1UE5 A;  1G29 1;  4IQZ A;  4OO1 I;  2ENB A;  3CXC A;  1MIU A;  4X6A H;  4DAY A;  1A6X A;  2EYL A;  5T1G A;  1ASY A;  3BYT B;  2CH4 W;  1E1O A;  2NZO A;  4DXF A;  1D6E C;  3A54 A;  4GLX A;  1JOQ A;  3A74 A;  4DV0 L;  2F0W A;  2LKV A;  5BN3 A;  1AEX A;  3P7J A;  1T5X D;  3S15 H;  4BY1 H;  3F2D A;  3FKI B;  4FF3 A;  2EJG C;  2VL6 A;  5FO8 B;  1VQA A;  2Q8I B;  1TS5 A;  2H1E A;  2QA4 A;  4ZRZ A;  5C5L A;  1Q12 A;  5ELD A;  1N32 Q;  1V1O A;  3S1N B;  3I55 A;  4J15 A;  2EOT A;  2F3V A;  2HCI A;  1A62 A;  4F8M A;  1ASZ A;  1PYW D;  2JA8 B;  1WYD A;  4JI0 L;  2G9H D;  3DWQ A;  3PMF A;  4FXD A;  1BO0 A;  1KQS A;  2L12 A;  4JI4 Q;  1CT1 D;  3K58 A;  1I4G A;  3CCV A;  1STN A;  1S3O A;  2BDO A;  5K36 G;  1LUZ A;  4DR6 Q;  1EYA A;  4B3R L;  1IL2 A;  4FDB A;  1WJJ A;  4HR7 B;  2HUG A;  1PYB A;  1SYG A;  2HIX A;  2E5L Q;  4C1N K;  4UP8 A;  2CKZ B;  3PO2 G;  3VR4 A;  1RHP A;  1UWV A;  4XTC S;  4NXM L;  4DV6 Q;  3HOY H;  4MTN A;  2PYK A;  3G48 A;  2NVQ B;  1XTD A;  1GUT A;  3H6M A;  3GTO H;  5C4J H;  2B8G A;  4ME3 A;  1SJH D;  1BUV T;  2M00 A;  3KF8 A;  1X32 A;  1CKO A;  1J5E L;  3GTQ H;  2MQH A;  2WP8 J;  1FD7 D;  2F0G A;  3ZJY C;  4JI1 L;  3D4W A;  4PV1 C;  1BKB A;  2E2I B;  1EYD A;  4NKL A;  3CMA A;  1BXT A;  3WDN A;  1QE6 A;  2F0L A;  1K83 B;  1VQF A;  2NN6 H;  3RZO H;  4Z9C B;  3BZK A;  2HQE A;  2ES2 A;  1VMP A;  1V43 A;  3TP7 A;  4PZ7 A;  3A7L A;  4WOR A;  2YU9 H;  2B2T A;  1LT3 D;  2KBN A;  3MTS A;  3MXU A;  1IYJ B;  3IRB A;  1TQO A;  3JAM i;  3CRL C;  4DV5 Q;  2NVT H;  1VQE A;  2F0I A;  3SK4 A;  2F4V Q;  4RGT A;  4UY8 C;  2QEJ C;  1I4R A;  4K0K Q;  4ODG A;  1M4V A;  1QZH A;  1TVX A;  1K8G A;  4G4K A;  1R9T B;  2M2L A;  3B6Y A;  4TSS A;  2WII B;  3S1Q B;  1STH A;  4R1J A;  1EY4 A;  2FJ2 A;  3KJO A;  2RHS B;  4DV1 Q;  1SEB D;  2L15 A;  3M4P A;  4IN3 A;  4IZ8 A;  4QIW B;  1VQM A;  4FF2 A;  4H7B A;  2E75 C;  4X3T A;  1O7Y A;  2I5M X;  4MNO A;  2RVL A;  2F0N A;  3K59 A;  1BOS A;  1ET6 A;  1ZXT A;  4KHZ A;  1WTR A;  1KDB A;  3J80 L;  1GUS A;  5I6Y A;  4DUZ L;  4JI3 L;  2PQA A;  3CQZ H;  5JJK A;  1FGB D;  5CBE E;  1DZ1 A;  2Z4I A;  5E7N A;  1W6J A;  2XSC A;  1YZ6 A;  2BCO A;  2PZU A;  1BNZ A;  2NVY H;  1DON A;  2Y0S B;  3CPF A;  3U4V A;  1HZ9 A;  3M7G A;  4LF9 Q;  1H95 A;  4GOP B;  4HJ7 A;  2ASB A;  1EWI A;  3KFU A;  2IW3 A;  4EVO A;  1LTG D;  3E5S A;  2BE5 D;  5DEH A;  1IKL A;  1B3A A;  5K36 H;  3QOJ A;  1QWY A;  1RJT A;  4G7O C;  2X6G A;  3EBE A;  2NN6 I;  3FRP B;  3PQI A;  4DK3 C;  2Z6K A;  4A4I A;  4HID A;  2B2V C;  2RSN A;  2RDG A;  3CCJ A;  4RCN A;  2KCC A;  2OQK A;  2PQE A;  3X3N A;  3H3V C;  1E7Z A;  1N32 L;  4OHJ A;  1EQQ A;  4JI8 Q;  1OXV A;  4RGM A;  5EAY A;  1MBY A;  3STB D;  3KOJ A;  2TMP A;  2AWN A;  1C8C A;  5C0X I;  1E3P A;  3T16 A;  1DCZ A;  5BR8 Q;  1SNP A;  1WCM G;  4PMW A;  1EY8 A;  1JB3 A;  5JAV A;  4JI4 L;  4DF7 A;  3ZYY X;  4PQX A;  4KJN A;  4OL7 A;  3HOV B;  2NVX B;  3G71 A;  1G51 A;  1AFP A;  4DR6 L;  3GO5 A;  4MZ9 A;  2VB2 X;  5I2Y A;  4X3S A;  1CSP A;  2HQL A;  1C4Q A;  1L1O C;  2B2U C;  3SE0 A;  1JCK B;  4NW2 A;  1NMF A;  2E5L L;  2IJ0 A;  1VQ9 A;  2YTY A;  4PZ6 A;  1SDF A;  1XX8 A;  1FJG Q;  5DNF A;  3PUZ A;  4UAI A;  4DV6 L;  2OTL A;  3EN2 A;  1VQK A;  2JJQ A;  1SMY C;  5C44 H;  3C46 A;  3HOU G;  5EKK A;  5JEA G;  2NB0 A;  2VUM B;  1S4Z A;  1VS0 A;  2AKW B;  4RGO S;  1VCI A;  4C3H G;  5FLX E;  2EJM A;  2RCF A;  1S5B D;  1KTK A;  1VF5 C;  3E3X A;  4JI6 Q;  2QIL A;  2H5X A;  2F0O A;  1PRT F;  4BBR B;  1EQT A;  4GS3 A;  4J8Q A;  3RNU A;  4ID6 A;  2MHV A;  4DAP A;  3GTL B;  1EY5 A;  1Q3L A;  2XWB B;  3BZD B;  4B9W A;  5IP9 G;  1MKH A;  3BJU A;  2OWO A;  2AQ2 B;  1UE7 A;  3R2I A;  3UDG A;  1U4R A;  2PPB C;  4PMB A;  2ZTE A;  3HEJ A;  4A3F B;  1RD9 D;  1RL2 A;  1HR0 Q;  4ZK9 B;  4DV5 L;  4ZUI A;  5CV5 A;  2F4V L;  4LFB Q;  3R93 A;  1BCP F;  4K0K L;  5FO9 B;  3M4Y A;  1NTG A;  4LW1 A;  1F9Q A;  4CDE C;  4IPH A;  4IFD G;  3CCU A;  3AFP A;  4AIM A;  4FXK C;  2E2J B;  2Z9H A;  5CGK A;  3HOW B;  4DV1 L;  3PO3 G;  2AMC B;  1SYE A;  3W3A A;  4JBJ A;  1XMO Q;  3C1F A;  2Z0S A;  1GKH A;  1VQP A;  4WRD A;  2CW0 D;  1HUM A;  4DK0 A;  2BOS A;  4DUY Q;  2F0U A;  4CDD C;  4C3J G;  3WWV A;  1AW7 A;  2EY2 A;  2EYJ A;  4XYQ A;  4DR1 Q;  2XGT A;  4L6T B;  4WJ4 A;  5E4X A;  2JYO A;  2PMZ B;  1YJN A;  3RLO A;  4A76 A;  3NQT A;  4OX9 Q;  1GD7 A;  1WCM H;  2K14 A;  4LF9 L;  5LMN Q;  1HA5 A;  3J81 i;  2DUD A;  3C2P A;  1STG A;  2D0O A;  2F3I A;  1I3Q B;  2GN5 A;  3CRK C;  2K03 A;  4KD3 A;  4KN4 C;  2JEB I;  2D62 A;  2EY6 A;  2D2C C;  3CU7 A;  5KEE A;  1EIY B;  1AZQ A;  3GTK B;  2DJG C;  4MHE A;  4DK1 A;  1B7Y B;  3KUP A;  2CFM A;  1KLU D;  3T1H Q;  3IFD A;  5M5Y B;  1JWM D;  1BCP B;  1HXY D;  3X3M A;  1HZB A;  4A3I G;  4LF8 Q;  1J6Q A;  1DM0 B;  1RCV D;  5KND A;  2BDN A;  1WTX A;  4DR3 Q;  5IT9 L;  4HJ5 A;  4P74 A;  3TBI B;  3HOU H;  3LX0 A;  5JEA H;  3S2D H;  4JI8 L;  4PMC A;  4A93 B;  4HSP A;  3J80 i;  2F52 A;  1O7I A;  3BDO A;  2R92 G;  5IY0 A;  5I9P A;  1ENA A;  4C3H H;  5GAE C;  4AH6 A;  5BR8 L;  3PF5 A;  3FPP A;  3M3Y H;  1I50 B;  2HDL A;  4APV A;  3HOX B;  5J39 A;  4LNQ A;  4RFB A;  4ZQ3 A;  4RA8 A;  4HJ8 A;  4ZCK A;  3OTO Q;  1Y8P B;  4A3L G;  4LK1 C;  1OXS C;  2AUJ D;  4DKA C;  2RKS A;  4YHH Q;  4BY7 B;  2VNU D;  1LTB D;  4FF4 A;  1FJG L;  1LTL A;  2NZ1 D;  1JR0 D;  2R7D A;  2BA0 A;  5C4X G;  4LFA Q;  4UHV A;  1CA5 A;  1Z9F A;  1H9R A;  1GVP A;  4IPC A;  4HTH A;  2SEB D;  1LLR D;  4FO2 A;  4A3B G;  5IGD A;  4P71 A;  2B2Y C;  1YHQ A;  1FL0 A;  3F2U A;  3OMG A;  3VYU A;  4ILW A;  4JBW A;  3BDL A;  1VQD A;  1SYD A;  5KGU A;  3PO3 H;  4JI6 L;  4LF5 Q;  2SNS A;  4LUO A;  1IYV A;  3CC4 A;  5IT9 c;  1SMX A;  1XNQ Q;  1XXG A;  3S14 H;  1YNX A;  3DWA A;  2M9V A;  3H09 A;  2WB1 E;  4OIK A;  3R8B A;  1M90 C;  3KDF A;  1I6H H;  2B2T C;  5ELC A;  4EX5 A;  3IFT A;  3VR3 A;  4C3J H;  4DR2 Q;  1LV9 A;  1MJE A;  1HR0 L;  2EXD A;  4UP7 A;  4DNT B;  3SHL A;  5C4Z A;  4LFB L;  1STA A;  1TS2 A;  1ZYR C;  3N52 A;  5IE8 A;  4XQJ A;  2R3Z A;  3CD6 A;  4RGN A;  2EPB A;  1TWG H;  1SE3 A;  3S1R B;  1XMQ Q;  3I73 A;  3TDQ A;  3MEF A;  3TP8 A;  5CV4 A;  1W3S A;  4ALP A;  5KRU A;  5IYB G;  1HHV A;  1X9N A;  1W2B A;  4JPB W;  4KY5 A;  5IGB A;  1PRT C;  1XMO L;  4QL5 A;  3Q6S A;  2NTS A;  3ND9 A;  4CGY B;  4DA2 A;  4N8X 1;  4FP5 D;  1SYC A;  2F0V A;  4A3I H;  1EIG A;  4DUY L;  3J7Y W;  2A6H D; 
#chains in the Genus database with same CATH homology
 4J15 A;  4IPG A;  1A62 A;  1ASZ A;  2K50 A;  1WYD A;  4JI0 L;  1YBY A;  1AH9 A;  1VQH A;  2B63 H;  2VQF Q;  1KQS A;  1NE3 A;  1TXY A;  4X62 L;  4JI4 Q;  4B3T Q;  2IX0 A;  3LGJ A;  4DR1 L;  3TS0 A;  4A3J G;  3J81 c;  3H3V I;  4DV4 Q;  2VW9 A;  4B3M L;  2ZJP A;  3CCV A;  2HHH L;  2R92 H;  3GTG H;  1S3O A;  1PH2 A;  4OX9 L;  2JA5 G;  5K36 G;  1LUZ A;  1XNR Q;  4DR6 Q;  5LMN L;  3RLF A;  4A3F G;  1IL2 A;  4B3R L;  4FDB A;  1WJJ A;  3S24 A;  4DAY B;  4NXN Q;  4JI1 Q;  3UDX A;  4LF4 L;  2FXQ A;  3KYH C;  2MNA A;  2JA6 G;  1PYB A;  2B29 A;  3HOZ G;  4YY3 Q;  3S1M H;  1PH5 A;  2KCM A;  3I7F A;  2HIX A;  3ER0 A;  2E5L Q;  3I4N G;  4UP8 A;  1YHB A;  2ZTD A;  2CKZ B;  3PO2 G;  4QIW E;  2GVB A;  1UWV A;  2UXB Q;  4XTC S;  4IJL A;  3ERS X;  3ULJ A;  5M3M H;  4JI5 Q;  4DV6 Q;  4NXM L;  4DR7 Q;  5FLM G;  2UU9 L;  2K4K A;  1PH4 A;  3HOY H;  1HJP A;  4MTN A;  3G48 A;  1XTD A;  3T1H L;  3GTO H;  2Z6K C;  5C4J H;  1NMG A;  1B8A A;  4ME3 A;  3HOW G;  3CCM A;  1CKO A;  1J5E L;  3TRE A;  4JI2 L;  4LF8 L;  2MQH A;  3E9I A;  3GTQ H;  4JYA Q;  2WP8 J;  3J7Z C;  3J80 c;  4DAM A;  3S16 H;  4DR3 L;  5C4X H;  2V1C C;  3S17 H;  3ZJY C;  3L0O A;  4JI1 L;  2EIF A;  4LFC Q;  1BKB A;  1XPU A;  5FLX c;  1N34 L;  2YTV A;  5IP9 H;  2JE6 I;  4HIK A;  3CMA A;  1VQC A;  1HR0 W;  4A3B H;  1SE8 A;  4NPS A;  1S40 A;  2Y0S E;  1FGU A;  4AQY Q;  1PH9 A;  1BVS A;  1EIF A;  2K5V A;  1VQF A;  2BH8 A;  2QGQ A;  3K0X A;  1SFO H;  4LF6 L;  5AJ3 Q;  3RZO H;  4A3G G;  4O0A A;  4DV3 L;  3I4M G;  3BZK A;  2ES2 A;  1SRU A;  4GLV B;  3AEV A;  5FJ8 H;  1OXU A;  1TWH H;  1V43 A;  2EQS A;  4PZ7 A;  1E22 A;  3FKI G;  2YU9 H;  3S2H H;  3OTO L;  3M9B A;  2AWO A;  2KBN A;  5J3B A;  4JI7 Q;  1IYJ B;  3F8T A;  2E2H H;  4BA1 I;  4GOP A;  1VQ8 A;  3IRB A;  1B70 B;  3JAM i;  4GN3 B;  4DV5 Q;  2UUA Q;  1VQI A;  2NVT H;  1CKM A;  1VQE A;  4YHH L;  4JC0 A;  3EIV A;  4JOI A;  1S72 A;  1PV4 A;  4DR5 Q;  1XJV A;  4UY8 C;  2F4V Q;  3HOV H;  2KCT A;  2NVX H;  4GKJ L;  2XTI A;  1JJC B;  1PYS B;  2JK8 A;  4K0K Q;  1IBL Q;  3D31 A;  2B3G A;  2DGY A;  2RF4 A;  1QZH A;  3UE0 A;  3T1Y Q;  1K8G A;  3PV0 A;  5GQO A;  1KL9 A;  4GN5 A;  4LFA L;  3B6Y A;  2OCE A;  1N33 Q;  4R1J A;  1CKN A;  3GTP H;  4BA2 I;  1X3G A;  3KJO A;  3RN2 A;  2RHS B;  3KF8 B;  1EQR A;  4DV1 Q;  4L5Q A;  2L15 A;  3M4P A;  1N36 Q;  1HNX Q;  1PHJ A;  4QQB X;  1VQM A;  4PG3 A;  5IYB H;  1KXL A;  1QVC A;  4DV7 Q;  1E1T A;  1N9W A;  4YWK A;  5JJL A;  2I5M X;  3H15 A;  3A5U A;  1Y1W G;  5M3F H;  5IYC G;  2VS1 A;  1X6O A;  2IHF A;  3K81 C;  4MNO A;  4LF7 Q;  4LF5 L;  5LMN W;  4NB3 A;  2VUM H;  4A93 G;  2WAQ G;  3HKS A;  3M85 A;  1Y1V G;  4B3S Q;  1QVG A;  4KHZ A;  5LMU L;  1KAW A;  1GM5 A;  4HJ9 A;  1Q1B A;  3GTJ H;  1VQN A;  1XNQ L;  4WJ3 M;  4DUZ L;  2AHO B;  2PQA A;  3CQZ H;  4JI3 L;  2JEA I;  5JJK A;  3HOX G;  1NJI C;  5E7N A;  3I56 A;  2ZTC A;  3CP0 A;  1I94 Q;  4JBM A;  1YZ6 A;  4DR2 L;  2NVY H;  2WFW A;  1HNW L;  2RHQ B;  3CPF A;  3U4V A;  1HZ9 A;  4GKK L;  2RCN A;  4JV5 Q;  4LF9 Q;  1VQJ A;  3PO2 H;  1H95 A;  4GOP B;  4HJ7 A;  3OYY A;  3GTL H;  5M5W H;  1EWI A;  2ASB A;  3KFU A;  4A3J H;  1PH3 A;  2N78 A;  4BY7 G;  4KHP L;  3GD7 A;  3RN5 A;  3F1Z A;  4A3C G;  4LUZ A;  1V1Q A;  5ELO A;  2JA5 H;  1XMQ L;  2MO1 A;  1Q46 A;  1SN8 A;  1VQ5 A;  3H0G G;  3L2P A;  4A3F H;  3UDI A;  1XPR A;  4P75 A;  3AYH B;  3TRZ A;  2QEX A;  4TQU S;  3EBE A;  2JA6 H;  1OXX K;  1A0I A;  2NN6 I;  3HOZ H;  4Y52 H;  2R7Z G;  4DK6 C;  3K8A A;  4DK3 C;  2LXJ A;  3J7A 5;  3KDF B;  4C2M H;  1PH8 A;  2N8N A;  1X54 A;  2IT1 A;  2Z6K A;  4A4I A;  4HID A;  2Q2I A;  1QZG A;  1SLJ A;  1X3E A;  2UXD L;  4JG2 A;  1BBU A;  5FLM H;  3CCL A;  3CCJ A;  4IFD I;  5IWA L;  2K52 A;  1HNZ L;  2C35 B;  2OQK A;  3K7A H;  1PA6 A;  4BXX G;  1C0A A;  2E2J H;  1E7Z A;  3HOW H;  1YJW A;  2HT1 A;  2KEN A;  1N32 L;  1EQQ A;  4JI8 Q;  4X65 L;  1VQG A;  1YIT A;  1A63 A;  5IYD G;  1EUJ A;  1OXV A;  3STB D;  5EAY A;  3GTM H;  3KOJ A;  2AWN A;  4BBS G;  1SR3 A;  4A3L H;  5C0X I;  4PZ8 A;  1E3P A;  2JA7 G;  3PF4 A;  5BR8 Q;  2VQF L;  1WCM G;  1SRO A;  1YIJ A;  2UXC Q;  4PMW A;  4HJA A;  2PQA B;  4JI4 L;  4GN4 B;  4B3T L;  4DV4 L;  2UUB Q;  3G71 A;  1BBW A;  3CCS A;  1G51 A;  2R6G A;  3CW2 C;  4A3G H;  3PUX A;  3GDE A;  1XNR L;  4DR6 L;  4QGU A;  3E9H A;  3GO5 A;  4MZ9 A;  1K8A C;  1JB7 A;  2BH2 A;  3I4M H;  5C3E G;  3HKZ E;  4NXN L;  1CSP A;  3M7N A;  2HQL A;  1L1O C;  4DR4 Q;  3DM3 A;  4YY3 L;  5HY6 A;  3G4S A;  5H1S E;  1NMF A;  2E5L L;  1YEZ A;  2R93 G;  1VQ9 A;  1NY4 A;  4DV2 Q;  1AE2 A;  2YTY A;  3FHW A;  4PZ6 A;  1FJG Q;  1L2F A;  3A5Z B;  1UEB A;  3J81 j;  2UXB L;  4DR7 L;  1I3Q H;  3PUZ A;  4JI5 L;  4DV6 L;  2OTL A;  4EQ5 A;  1CSQ A;  3EN2 A;  1HH2 P;  1VQK A;  2JJQ A;  2UUC Q;  2IY5 B;  5C44 H;  1Q86 C;  3PIO A;  3HOU G;  5JEA G;  4POG A;  4P73 A;  5JEA J;  4AYB E;  3GTK H;  1U0L A;  4JYA L;  4O2D A;  5JJI A;  2Q2H A;  3ULL A;  1VS0 A;  2AKW B;  5GRO A;  4LFC L;  1WFQ A;  1VCI A;  4OXP A;  4DNI A;  1IBK Q;  2CCZ A;  2MFI A;  5HGQ A;  5M5Y H;  3M4O H;  1VQ7 A;  1WI5 A;  3KF6 A;  1IBM Q;  4JI6 Q;  2PMZ E;  2H5X A;  2VQE Q;  1Z47 A;  3CCR A;  4GNX C;  4AQY L;  4A3D G;  1U5K A;  4GS3 A;  3DLL A;  1PH7 A;  2JA8 G;  3RNU A;  5AJ3 L;  3NEM A;  3H3V H;  3KLW A;  4X64 Q;  3AQQ A;  2D0P A;  4A93 H;  5IP9 G;  1JJG A;  2K5N A;  3PUW A;  1MKH A;  3BJU A;  1V9P A;  4C3I H;  4A3K G;  2PI2 E;  3RLN A;  2OWO A;  1UE7 A;  1D8L A;  3UDG A;  4JI7 L;  2ZTE A;  1YI2 A;  1RL2 A;  1CUK A;  1HR0 Q;  1K73 C;  1I50 H;  3NEN A;  3HOX H;  4DV5 L;  2UUA L;  3PUV A;  2WB1 G;  2F4V L;  4LFB Q;  4A3M G;  4DR5 L;  3L7Z C;  3UE1 A;  2PI2 A;  5FJ8 G;  1JMC A;  4K0K L;  1IBL L;  3PIP A;  3HFZ B;  3BZC A;  2OQ0 A;  3T1Y L;  1NTG A;  4LW1 A;  2A1A A;  4IFD G;  4IPH A;  1G6P A;  4TVA B;  3CCU A;  4DV0 Q;  2E2I H;  4JBK A;  4BY7 H;  4IFD J;  4A3C H;  3AFP A;  2ZM6 Q;  4AIM A;  1VQL A;  4OO1 G;  1N33 L;  3U58 A;  3H0G H;  1P8L A;  1RIP A;  4DV1 L;  5GAD C;  3HOV G;  3PO3 G;  5ELN A;  1KHI A;  4HIM A;  2AMC B;  4YCU A;  1N36 L;  2NZH A;  1HNX L;  2CWA A;  4JBJ A;  1XMO Q;  3AFQ A;  5C0X G;  4DV7 L;  4UP9 A;  2R7Z H;  1QUQ A;  2Z0S A;  2LSS A;  5C0X J;  3JC6 6;  4R4I A;  1GKH A;  1FVI A;  1VQP A;  1LYL A;  4LF7 L;  3KF6 B;  2I0Q A;  4R4T A;  4RG1 A;  4DUY Q;  1HZA A;  4YCW A;  4B3S L;  4IO9 A;  4A3E G;  1DGS A;  5DLQ E;  1K3R A;  4BXX H;  3CAM A;  3WWV A;  1N8R C;  4JI0 Q;  1QVF A;  3F2C A;  1PH6 A;  4X62 Q;  3RZD H;  5IYD H;  3I4O A;  2XGT A;  3FP9 A;  4DR1 Q;  1I94 L;  4WJ4 A;  1JT8 A;  2ZJR A;  4B3M Q;  3I4N H;  1CKN B;  4POF A;  4BBS H;  2HHH Q;  2LXK A;  1YJN A;  3PSI A;  4OWX B;  3RLO A;  4A76 A;  1XPO A;  4R4Q A;  2GVA A;  1X65 A;  4OX9 Q;  1GD7 A;  2JA7 H;  4JV5 L;  1WCM H;  2K14 A;  4LF9 L;  2JA9 A;  1K9M C;  5LMN Q;  4B3R Q;  3I2Z A;  2DUD A;  3J81 i;  2F3I A;  2D0O A;  3S1Q H;  2GN5 A;  4RMF A;  4R4O A;  5GAH C;  4LF4 Q;  4LWC A;  4XIG S;  1C7Y A;  2JEB I;  3ICE A;  1L1O A;  3A0J A;  1D7Q A;  3D0F A;  3TS2 A;  2D62 A;  4QJF A;  2A19 A;  1PH1 A;  2ALY B;  1TWF H;  1EIY B;  4BBR G;  1JE5 A;  5C3E H;  4BY1 G;  4NXM Q;  5IP7 G;  1KIX A;  2JQO A;  3CME A;  4KI0 A;  1WOC A;  2E8G A;  5M5X H;  2UU9 Q;  1B7Y B;  2CFM A;  2IX1 A;  1A8V A;  3T1H Q;  2R93 H;  3S1R H;  4KLK A;  4A75 A;  3U50 C;  2YTX A;  2Q2U A;  1HZB A;  4A3I G;  1J5E Q;  4JI2 Q;  1J6Q A;  4LF8 Q;  4L5R C;  4DR3 Q;  1QUQ B;  4HJ5 A;  4DPG A;  4P74 A;  3UDF A;  1OXT A;  3F2B A;  2KHJ A;  2B63 G;  3HOU H;  1N34 Q;  1UE1 A;  4JI8 L;  3S2D H;  4IJH A;  3FKI H;  3J80 i;  2ZJQ A;  2F52 A;  2YYZ A;  1O7I A;  1L0W A;  2R92 G;  4X66 Q;  5IY0 A;  3K80 C;  1EOV A;  3Q8D A;  3TQY A;  4C3H H;  5GAE C;  3PGZ A;  1Q1E A;  4GNX A;  3HKZ G;  4AH6 A;  5BR8 L;  3PF5 A;  4LF6 Q;  2UXC L;  1YHA A;  4LUV A;  3M3Y H;  4APV A;  3BU2 A;  4DV3 Q;  3OW2 A;  3S1N H;  2K75 A;  4LNQ A;  1JJ2 A;  2UUB L;  4L5S A;  2Q2T A;  1Q8K A;  3M4Q A;  4A3D H;  4HJ8 A;  1GO3 E;  2N3S A;  3OTO Q;  2JA8 H;  2Y0S G;  4A3L G;  4R4C A;  1KRS A;  1OXS C;  5M3M G;  4DKA C;  1NBW A;  4YHH Q;  2OTJ A;  1OTC A;  4DR4 L;  2VNU D;  3E0E A;  1X56 A;  4A3K H;  1IZ6 A;  3HOY G;  2A8V A;  1L1O B;  4GKJ Q;  4AYB G;  1X55 A;  1YJ9 A;  4X66 L;  4DV2 L;  1T9H A;  1FJG L;  1YVC A;  2HIV A;  2MO0 A;  1IXR A;  4OWT B;  3KJP A;  1LTL A;  4A3M H;  1Y1W H;  5IYC H;  1LM0 A;  2R7D A;  2BA0 A;  5C4X G;  1C9O A;  1P16 A;  4L5T A;  2ID0 A;  4LFA Q;  3CCE A;  4YCV A;  1VQO A;  2UUC L;  4YWL A;  2KHI A;  4IPD A;  2K5H A;  1Z9F A;  3W5O A;  3RR5 A;  3JAM c;  1Y1V H;  1GVP A;  4Y7N H;  4IPC A;  4JCV E;  3W1G A;  3K7U C;  3TEH B;  1AE3 A;  4H02 A;  4A3B G;  1TWC H;  2IHE A;  1Y14 B;  1TWA H;  1IBK L;  2NVQ H;  3NEL A;  4P71 A;  1E24 A;  2I5L X;  1VQ4 A;  1KC8 C;  3CF5 A;  3CC2 A;  2NN6 G;  1YHQ A;  1FL0 A;  4QY7 A;  3PO3 H;  1MJC A;  4JBW A;  1VQD A;  3PCO B;  4OON A;  5C44 G;  4IOC A;  1IBM L;  4JI6 L;  4LF5 Q;  2VQE L;  4LUO A;  2N49 A;  2PNH A;  3CC7 A;  3CC4 A;  5LMU Q;  3PUY A;  5IT9 c;  1SMX A;  4GNX B;  1M1K C;  1XNQ Q;  3S14 H;  1YNX A;  4DUZ Q;  4X64 L;  2WB1 E;  1M90 C;  4JI3 Q;  3KDF A;  1I6H H;  1KD1 C;  4EX5 A;  4A3E H;  1Q82 C;  1EFW A;  1HZC A;  4UPA A;  4C3J H;  4DR2 Q;  1HNW Q;  2WAQ E;  1K83 H;  1UE5 A;  4YWM A;  4GOP C;  1EYG A;  1G29 1;  4GKK Q;  4OO1 I;  1MJE A;  3ULP A;  2EXD A;  4UP7 A;  1I5F A;  3CXC A;  1MIU A;  1HR0 L;  2ATW A;  4X6A H;  2CWP A;  4JOI C;  4P72 A;  2CQO A;  1UE6 A;  2R7F A;  3W1B A;  4LFB L;  5IE8 A;  3NBH B;  3CD6 A;  4KHP Q;  2VY3 A;  1ASY A;  1TWG H;  1E1O A;  2I5H A;  3MXN B;  1XMQ Q;  4OWW B;  2NZO A;  4IOA A;  3STB C;  3CPW A;  1VQB A;  3MEF A;  4GLX A;  3A74 A;  1W3S A;  4ALP A;  4DV0 L;  4HIO A;  5IYB G;  2ZM6 L;  1X9N A;  5GAG C;  3SGI A;  1W2B A;  5M3F G;  1X3F A;  2VZA A;  1K0R A;  3VDY A;  3S15 H;  4BBR H;  4BY1 H;  3F2D A;  2UXD Q;  2VUM G;  5IP7 H;  1XMO L;  2VL6 A;  2YV5 A;  4QL5 A;  3U4Z A;  2QA4 A;  1VQA A;  1R9T H;  1KRT A;  5IWA Q;  1HNZ Q;  1VQ6 A;  3G6E A;  4DUY L;  1Q81 C;  1Q12 A;  2BA1 A;  1N32 Q;  3CCQ A;  4A3I H;  1Q7Y C;  3I55 A;  4X65 Q;  1PFS A;  4GLA C;  1PVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...