5EQ0A

Crystal structure of chromodomain of cbx8 in complex with inhibitor unc3866
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
55
structure length
55
Chain Sequence
GERVFAAEALLKRRIRKGRMEYLVKWKGWSQKYSTWEPEENILDARLLAAFEERE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromobox protein homolog 8
publication title A cellular chemical probe targeting the chromodomains of Polycomb repressive complex 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
total genus 11
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2015-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5eq0A00
2FINB 1B4OA 3DEOA 4MN3A 5T1IA 1NR4A 5CBEE 1RTNA 2B2WA 2JYOA 1U4RA 1MGSA 2CVRA 2HDLA 2K04A 1O7YA 2NZ1D 2R3ZA 3MWYW 2L11A 1AP0A 2DY7A 1WD0A 2KECA 4OIJA 3FPUB 2MJ8A 5DNFA 1O80A 3QO2A 5CBAE 1C8CA 1BBXC 1U4PA 1VMPA 3HP3A 4CJ2C 4CJ1B 1BF4A 2KUMA 3KUPA 1SSOA 2NYZD 2FJ2A 1G2SA 2NWGA 2B2UA 2K01A 2MP1A 2RA4A 4IUUA 4X3TA 5EJWA 2K03A 5EPJA 4R8IA 1CA5A 1WTOA 1J8IA 1KNAA 1A15A 2EPBA 4HEDA 1ICWA 1WTQA 1HFNA 2X6LA 1F2LA 1BO0A 1HFGA 2D9UA 4ZAIA 1EL0A 3R93A 1J9OA 1CM9A 1IKLA 3N52A 4DN4M 2JP1A 1X3QA 1QE6A 3FDTA 1ILQA 1TVXA 2HUGA 2X69A 2B2VC 3I8ZA 4LMQD 5CMDA 2FFKB 1WTWA 1F9PA 1HHVA 1QNKA 2M2LA 2B2TC 3LWEA 1JE4A 4IUTA 1ML0D 2FHTA 4IUQA 3TZDA 1B2TA 5D14A 2IL8A 2N55A 3F2UA 1MSHA 4MHEA 1DONA 2B2VA 1QG7A 3DEPA 5EPLA 1RODA 1AZPA 2KOLA 5E4WC 1HRJA 1M8AA 1WTXA 1U4LA 1JICA 2B2YC 4XT1B 2Q8TA 2K1BA 2RSNA 3GV6A 4ZLTF 2X6GA 4IUVA 1IL8A 2Q8RE 3MTSA 3IL8A 5EPKA 4QUCA 4HAEA 4X3SA 1VMCA 1DOKA 1RJTA 1EIGA 2HDMA 5AFWA 4RAUC 1B3AA 1EOTA 4QUFA 1MI2A 1WD1A 2J7ZA 3G7LA 2K28A 4OIKA 1B50A 1HUNA 1RHPA 5COYA 1X32A 1G91A 3D6WA 2KVMA 2L1BA 1S4ZA 1SAPA 1MSGA 4X3UA 2EE1A 3I90A 4NW2A 3UI2A 1WVLA 1WTVA 4RWSC 4U68A 1DOMA 4HCSA 2B2TA 2BDNA 3IFDA 1F9RA 4UAIA 5EKIA 1HUMA 2DY8A 2MGSA 2VXWA 1E0BA 1B53A 1ESRA 3I3CA 1XYIA 1AZQA 1CA6A 1F9QA 1G6ZA 1WTRA 4HSVA 2KEEA 2HCCA 1ZXTA 3GV3A 3Q6SA 2MPMA 1XX8A 1PFMA 2N88A 1DOLA 4R9WA 1KNEA 2RSOA 2XIWA 1NAPA 1PLFA 4XDXA 1F9SA 3DM1A 4O42A 4ZK9B 1EQTA 2B2YA 4IUPA 1NR2A 2EOTA 4IURA 3I91A 3P7JA 5CORA 1O7ZA 1PDQA 1PFBA 2HCIA 4X3KA 5E4XA 2L12A 2KEDA 1G2TA 1GUWA 3ONAB 5T1GA 4XT3B 4ZKCB 3KBXA 1U4MA 2B2UC 1EIHA 5D65A 1SDFA 1NCVA 4ZKBB 1WTPA 1Q3LA 2K05A 3H91A 1DZ1A 1X3PA 2RVLA 1BNZA 1RTOA 2SDFA 5JJZA 1PFNA 3SVMA 1IKMA 1HA6A 2FMMA 3TN2A 4CJ0B 2H1EA 2L9HA 1LV9A 2B2WC 5EQ0A 2L4NA 4RA8A 1ILPA
chains in the Genus database with same CATH superfamily
1O78A 4PQXA 3PSIA 1JWMD 3HOZG 5CBEE 1KAWA 2HDLA 4B08A 3J7ZC 3BG3A 3DMUA 1LT6D 2JA5G 1MJCA 2Y0SG 5EGTA 4QF4A 3FPUB 4DUYQ 2I5MX 1SXTA 3HKSA 4AYBE 5DLQE 3V05A 5KNBA 1TXYA 2XWJB 4A3BG 2YTYA 1EY4A 5EJWA 2MFIA 4TQUS 3RR5A 1WTOA 2IHEA 3PGZA 5IGDA 1V1OA 3CQZB 3CQZH 1UEBA 2JP1A 4X6AH 3A0JA 4I7ZC 4A3GB 4A3GH 3E0EA 1K9MC 3K0YA 1Z6HA 4QY7A 1K28A 3F2UA 1K0RA 4FDBA 2PCFB 2DNEA 3OMGA 3VR2A 2WB1E 3I4LA 4RGNA 4L63B 3PUVA 4O0AA 2NZHA 3U9SA 3QWNA 3SDZA 4WJ4A 1H9SB 1I50B 4IUVA 1I50H 1UNSA 1HA5A 1QCBD 1UWVA 1JOOA 3D4WA 3QB3A 1B3AA 2ICEC 3D4DA 1YHQA 4KD4A 1SE8A 4B3SL 1IYUA 2L1BA 3NP8A 1UUPA 1S5ED 1GVPA 3OOCA 4JG2A 1WTVA 3CP0A 1YNNC 3IFDA 4QCLA 1F9RA 5EKIA 3OW7A 2MGSA 1H9JA 1ZXTA 1XX8A 4GN3B 4TRDA 1JJGA 2CHBD 1EY5A 1XMQL 2HD3A 1NBWA 1UAPA 5C5MA 2ZM6L 1DXMA 2IHFA 3FKIG 3G6JB 1GUSA 1I4XA 1IBLL 2PMZE 5JEAH 5KNCA 1XNRQ 1HR0Q 3SR1A 3EJIA 2CCZA 4KKUA 1SNOA 2VB2X 4ILWA 3AFQA 1CSQA 1FGBD 2EYPA 1PVOA 1PMRA 1LT5D 4LF4Q 3HOWB 2OT2A 3HOWH 4A3DG 4J1MA 3RNUA 1STAA 1V1PB 4RHSA 5C3XA 2OWOA 2WKDA 2YTVA 3K5OA 2NB0A 2XN9C 4JI0Q 2JEAI 1U4PA 5I2YA 4K14A 3AFPA 4JI6Q 3SGIA 4IUNA 4YIJA 1YBYA 2CKZB 5C44B 4FP5D 5C44H 3J81c 3QOJA 4JI4L 4A3CH 1ICWA 4JI3Q 3PCOB 1HH2P 1N32L 1ASZA 1GUNA 5M3FB 4FVMA 5M3FH 1Q1BA 1QE6A 1Y69U 5CV4A 2X69A 3KF8B 4DR5L 1ML0D 4DAYB 1YHAA 2XGTA 1DONA 1QG7A 3DEPA 1OXTA 1HNWQ 3N6RA 3D0FA 3KYHC 4PV1C 4KMUC 3J81L 1TS2A 1II3A 1X3GA 5CV9A 3RD4A 3NBHA 1SYCA 5FLXc 4QUFA 2F0OA 5IYDH 4JI2L 3MXNA 3UDXA 1RHPA 5I9OA 4B3MQ 4A3LH 1SYGA 4HSPA 4DR2L 4IFDG 3NENA 1HPCA 4C2MB 4C2MH 5C0XI 4JC0A 4A3KB 3GTMH 4A3KH 2BDNA 3GTMB 2AHOB 4CKEA 1K8GA 1H95A 2I07B 2DY8A 2EQSA 2XVSA 2WB1B 4ZYSA 1IW7C 1BCPD 3GV3A 4YCVA 3UDGA 5FLXL 1RKNA 2KHSA 3SEBA 3G71A 4LFBQ 4EX5A 1T9HA 1YIJA 1XTDA 5HY6A 2EYJA 2V1CC 2JA8G 2Y0SB 5M9OA 1O7IA 1XXGA 3BVZA 1SDFA 2Z8LA 3NUCA 4KY7A 4XIGS 1PFNA 3U9OA 3CF5A 4MIUA 4CDFC 3CMAA 1I5FA 2K6AA 5GQOA 1SMYC 5A2QL 2PI2A 5IGGA 3JAMi 1MJEA 1LTAD 1CQFA 2PNRC 1LTID 2RHQB 1PRTD 3UE1A 1X3FA 1HZ9A 2JYOA 4CDEC 1S3OA 3TP7A 5BN5A 4X66Q 3G48A 4WRDA 5EKKA 3TP8A 1QOHA 2NUCA 2O2LD 1WOCA 3A55A 3ULJA 1VF5C 4DV1L 3SK4A 2Q2TA 3V2TA 1VQNA 3HZXA 4IO9A 2LXJA 2JJQA 4ZRZA 3UE0A 3H3VC 2KENA 1XPRA 4DXFA 2MP1A 3ND8A 3R2IA 2PMZB 3BZDB 1Y1WG 2BE5C 1UE6A 4IN3A 4NKLA 1KNAA 2UXCL 5ELOA 1HFNA 4OELB 1EL0A 4DN4M 3MHBA 1ILQA 2F1MA 1LTBD 1F9PA 3WOEA 5DEHA 4DA2A 2EY6A 5C3EH 1EQVA 3TZDA 3J80E 3HOVH 3HOVB 3CCJA 4GKKL 1Y8NB 1VQHA 2E2JH 3Q23A 2LY7A 3CC7A 4NB3A 4PZ8A 4POFA 5CV8A 4KHPL 1Q46A 3F2BA 3IL8A 4J6HA 3HKZE 5AFWA 2JE6I 5GAHC 3A7AB 4A3FB 4A3FH 3CRLC 3FPPA 3FKIB 3FKIH 2KCNA 1JORA 1SYDA 3DLLA 3Q0AA 1Q1EA 4B3TL 3NBIA 1IBKL 3CW2C 4G7HC 1KAAA 1A8VA 5FKAC 3BZCA 2D2CC 4S3SA 4QL5A 5IYBH 1M4VA 1LYLA 3MXPA 4H02A 1FYCA 3P75A 1U0LA 1PLFA 1STYA 4RG1A 3URYA 4IURA 3T56B 4JBKA 4KI0A 3FRPB 3CCMA 2VUMG 2HCIA 4HMJA 5L37A 5I2XA 1LTGD 2IT1A 4B3SQ 2JA6G 1E3PA 3ONAB 4HR7B 1DYQA 1VQBA 4IPDA 4LF6L 2K05A 2D62A 1OXXK 2N49A 3AYHB 3D6CA 1HA6A 3EQLC 4BWGB 1EYDA 2QEJC 1LTLA 4A3MG 2PPBC 3K5NA 1ILPA 4WJWA 2EYMA 5KGUA 4MN3A 5C0XG 5KEEA 5T1IA 1XMQQ 4BS9A 1U4RA 2IY5B 1TIID 1R4PB 5ELCA 4LF7L 1OXUA 4IOAA 5CC4A 1JWSD 1WD0A 2ZM6Q 5GADC 1HHVA 4FO2A 4KTAA 1IBLQ 3HP3A 1PA6A 1HQMC 4YWMA 1RD9D 1EQQA 2F0FA 2NWGA 4IUUA 5EBCA 5JAVA 2EPBA 3QIAA 4H7BA 4DR3Q 1KIXA 1BO0A 1DGSA 3C46A 4OL7A 2WV6D 2BOSA 3N52A 4LK1C 1AH9A 4LMQD 1HTPA 4NMZA 2EXZA 3K58A 4CBVA 4NXML 2FHTA 1QB5D 3M7NA 5CGKA 2IL8A 1Y8PB 4Q0FA 4OX9L 5TSSA 3T13A 5E1FA 3CRKC 1KLUD 3I4NB 1EEFD 1E2WA 2Z6KC 3U50C 4JI4Q 4DR4L 3D8GA 4DK1A 3ZYYX 3PIO3 1SRUA 1N34L 3CCSA 2MNAA 2PQAA 5ELEA 3EROA 4WJ3M 1B8AA 4A4IA 1EZ8A 4DR5Q 3I90A 5FLMH 2IPKD 3K7AB 3K7AH 4BY1B 2MUYA 2B2TA 3RMHA 4BY1H 2CFMA 1SN8A 1EIFA 1WCMG 3OIQA 2LFNA 1BKBA 3PUWA 2YV5A 1XYIA 1F9QA 3M3YB 4G57A 3M3YH 3E9HA 4R4TA 2MPMA 3W5OA 1PH4A 1PFMA 2UXBL 1SLJA 2UUBL 3BDOA 1N36L 5IODA 5GAGC 1SE2A 1CKNA 4JI2Q 4QGUA 1XNQL 3HKZB 4HN7A 1VQGA 1L0YB 2E8GA 1BCPB 3KBXA 4DR2Q 2Q2HA 2MHVA 3T53B 4GLXA 1L0XB 2AQ3B 2NTTA 1E7ZA 2I0QA 4C3HB 4C3HH 4ODGA 3CCLA 5DAUA 1VQOA 1FVIA 2Z4IA 3NWSA 3DEOA 3DWQA 2OTLA 1FJGL 3I4MG 5KIXA 4QIWE 1R9TB 4HIDA 1R9TH 3OIPA 4A76A 2RHSB 4UPAA 4A3IG 3M4PA 2TMPA 1PRTB 3W3AA 4PMCA 1F2MA 5IP7H 1CA5A 3R2TA 4R8IA 1N9WA 1CI3M 5CR3A 1VQPA 4GNXB 1ET9A 2QDLA 3HG9A 1EY8A 1CSPA 2F0JA 3P1HA 2VB3X 4HMIA 1Y14B 2FFKB 3S15B 3S15H 3TZUA 5IGBA 1G6PA 1VQKA 3Q24A 2B39A 2GVBA 4DV1Q 3F2DA 3U4ZA 2OQKA 5E4WC 3EA6A 1HNXL 1FD7D 2BH8A 3RLNA 1ZEQX 4JCVE 1EY6A 2AQ2B 1I3QB 1WFQA 1I3QH 1QNUA 3J81E 2D0PA 5EPKA 2NTSA 4RKBA 4HAEA 2UXCQ 3HFZB 3RUZA 4AH6A 2XRQD 1PTOC 2K28A 2Z6KA 4OIKA 1BQQT 1CFMA 1SJED 4J8QA 3NEMA 1OO9B 1Q86C 1A3UA 2JA6B 5LHY1 1FNUA 3PV0A 2P5ZX 3R3OA 3GP7A 4GKKQ 2EE1A 1M1KC 4DV5L 4LF9L 5KRUA 4DAMA 3PUZA 4H13C 4MTNA 1AZQA 2ENBA 4UP7A 4KHPQ 2N88A 1BVSA 2F0TA 2B2YA 5FLXE 3I91A 2KCMA 4R1JA 5CORA 5C5LA 3TRZA 3K5MA 2C9OA 2DJGC 1PDQA 4DAVA 4P74A 1JJ2A 2KEDA 3KK7A 3STBC 2RDGA 5M5XB 5M5XH 2B2UC 3TP6A 4IOCA 1IL2A 1BCPF 1JOQA 1Q3LA 3H91A 4BXXG 4B3TQ 2SDFA 1IBKQ 4POGA 1X56A 1LT4D 5IP9H 5IT9c 4EQOA 4YWLA 2WIIB 5CV5A 3J7AV 1CHPD 5A2QE 5JEAJ 4J15A 2R7DA 1O7YA 1TR5A 1Z47A 1BOSA 5JJKA 1K0SA 4HIOA 2F0NA 2WFWA 1X54A 4L5QA 5DNFA 2RCNA 4L5RC 4RHRA 5BN4A 1BBWA 1BUVT 4LF6Q 1CK1A 5IT9L 1SNDA 3QOLA 2FJ2A 4NP5A 1PRTF 1Z7TA 4LJZC 4BA2I 2Z4HA 1CQVA 4HEDA 4RKLA 3I4NH 2F0UA 1A3VA 1PZKD 4ZAIA 2WAQG 4DK3C 1K83B 1K83H 1VQLA 2C5CA 1IYVA 2A68D 4LF7Q 3S1QB 4IUQA 4WFN3 3G6EA 1I6HB 4QIWB 1I6HH 5I4DA 1S5DD 3CPWA 2F4IA 1M8AA 5FJ8G 1SNPA 1TQOA 4XQJA 4IFDI 2G9HD 3RN2A 3MXGA 3MTSA 3PF5A 2EY1A 1V8QA 4DU9A 4A3JG 1VMCA 3MFYA 1EOTA 1MI2A 3M4YA 1X32A 1QWYA 1NNXA 3FEWX 1EFID 1STNA 4NXMQ 1B1ZA 3K59A 1WVLA 4OX9Q 4FXKC 1X55A 2J0TD 4N9PA 1YJ9A 2WAQE 5IY0A 2KEEA 4I7AA 3QJYA 1E2ZA 3J80i 3OTOL 4DV0L 2R7ZG 4CHTB 1HZAA 3GTJB 2AKWB 2WKCA 5LL6S 3MVVA 4DR4Q 1SE3A 4L6TB 2Y0SE 1ENCA 3GTPH 3GTPB 3I4MB 3I4MH 4X3KA 1N34Q 4XQNA 3KLWA 2A69C 2F3VA 4QJFA 1QVCA 2ZTDA 2G9DA 4B3RL 1PZID 3IFTA 2NVTB 2NVTH 4GOPB 1TWHB 2R92B 2R92H 2N78A 2VQEL 2IJ0A 4XYOA 3D3RA 5IYCG 3VR3A 3ULLA 2UXBQ 2QKIC 3D4RA 2UUBQ 3MEHA 1NE3A 3RZOH 4EQNA 1N36Q 3RZOB 3CCVA 4IPGA 3C2PA 2KECA 4DF7A 1XNQQ 4XQQA 2F0WA 2I5HA 2OCEA 1BBXC 3HOXB 1VQDA 3HOXH 1CTMA 4H44C 2KUMA 2K4KA 1U9RA 4ZUIA 2NN6I 2Q2IA 3CCEA 2JA7G 1ZYRD 4PZ7A 1EWHA 1QILA 1DJRD 1DCZA 2YTXA 3M9BA 4R8NA 3S9WA 3A54A 1S5FD 1FJGQ 4XXEA 5C4XB 5C4XH 4TSSA 1YNJD 1YZ6A 3H6MA 3PQIA 2A73B 4C1NI 2VW9A 1JMCA 3GTLH 3GTLB 5JOBA 4KY6A 2FMCA 4DAPA 2EDGA 1I4RA 1KDBA 4DV2L 4CDDC 1O7LA 1JWUD 5AJ3Q 4KKTA 4DNIA 3T1HL 3S2HB 3S2HH 2R7FA 3PMFA 2GN5A 3OSOA 3C1EA 1G91A 4OHJA 1HZCA 3TMEA 4X3UA 4APVA 1CHQD 3DHQA 4BXXH 2G5DA 1B9NA 1QJOA 1HNXQ 2UUCL 1E0BA 2YU9B 1ESRA 2YU9H 2IX1A 1GO3E 3K80C 1IHZA 2XIWA 2K33A 4HJ8A 1PH5A 3R8BA 3H0GG 1JQYD 2KHJA 3MAQA 4F8MA 4OO1I 2VNUD 2LSSA 2F3WA 3C1FA 2NVQB 2NVQH 1N33L 2B29A 5JJLA 1PYWD 1H9SA 2KCTA 1X65A 2K5NA 3GTQB 3GTQH 2SNMA 4ZUJA 5FO9B 4DV5Q 4LF9Q 2H1EA 1CKMA 1EUJA 2QDBA 1LTRD 4JBMA 2WAQB 3HOZB 3HOZH 2A6HD 3CCUA 1W6JA 3MWYW 3GD7A 2R93G 2BA0A 1AP0A 2DY7A 4K2LA 3CMEA 1UE5A 2JA5B 2JA5H 2QCPX 1YEZA 5A35A 3BYTB 1IZ6A 1WYDA 3SXHA 1A2TA 2I46A 2F0SA 4BBSG 4KLKA 5FJ8H 2SEBD 2BDOA 4A3BB 3IAYA 4A3BH 4P72A 5C4ZA 1JB7A 3SE0A 4PZ6A 3TSSA 2X6LA 1A2UA 1AW7A 1SE4A 4G7OC 4ZCKA 4LFCL 4A3JB 1E22A 4A3JH 4GKJL 2F0MA 1TVXA 1WI5A 3ICEA 1PH3A 1EIYB 4IUTA 1B2TA 4PMBA 3GDEA 2A19A 5I6WA 1GXDC 5EPLA 3TREA 2CWAA 3Q22A 1Y1VG 2F0EA 3S14B 3S14H 4G7ZC 3KDFA 1LT3D 2A6ED 2XWBB 3T16A 1BXTA 4ZLTF 1X9NA 4UY8C 3VA7A 2Q8RE 1P16A 4IFDJ 3AB9A 1V1PA 5BN3A 1K8MA 1D5ZC 2J7ZA 1MBYA 2NN6G 1WJJA 1I94L 5NUCA 2H4OA 2FXQA 1HZBA 1SAPA 4KD3A 4HJAA 3A7LA 1TS3A 3MFGA 2NZOA 3CHBD 1ASYA 1DOMA 1IXRA 4HCSA 1V43A 4LUOA 4Z9CB 3I3CA 2QA4A 3M7GA 5D3DA 4EQPA 5C4HA 1NMFA 2C35B 3KF8A 5JVH3 1L1OB 1GUOA 2Z6BA 4CKBA 1D7QA 2ALYB 3HGBA 3P7JA 2J4XA 4MNOA 1EY9A 2F4VL 1VDZA 4L5SA 1STBA 3M4OB 4JPBW 3M4OH 1EIHA 3J81i 4JYAL 3RZDB 3RZDH 4E6IA 2CW0D 3HOUG 2RCFA 5JJZA 2JK8A 3F8TA 5DM63 2RDHA 4RH6A 1PH7A 2AUKA 2FMMA 2CH4A 2JA7H 2JA7B 3PUXA 4AQYL 2F0GA 3GTGB 4ZQ3A 3GTGH 3OTOQ 4DV0Q 3VYUA 1K73C 1QUQB 3VA5A 2OXPA 1S72A 4BA1I 4A3DB 4A3DH 3S16B 3S16H 1KL9A 3K6OA 3HOYG 3QO2A 3TS0A 1VMPA 4B3RQ 2O5IC 1D8LA 3KFUA 1B3QA 1UE7A 4OO1G 5IT9E 4IQZA 2B3GA 4ME3A 2H5XA 4R4CA 2VQEQ 3WWVA 1EQRA 1X3EA 2UU9L 2SOBA 1J9OA 1X6OA 1X3QA 1VQ9A 2QF7A 1D1KA 4NPSA 2KA7A 5ELDA 2JSOA 4OWWB 4X65L 3KJPA 4A3EG 5CV6A 2A8VA 1QZGA 2JXMB 1C0AA 1KD1C 3AEVA 2AWNA 1JR0D 1RF2D 2HQEA 2ZXRA 2RDFA 2CQAA 4LFAL 4P2CB 2E76C 4JBJA 1GM5A 1DOKA 1Q82C 3Q8DA 2XRSD 3H0GB 3H0GH 3S1NB 3S1NH 2SNSA 1VS0A 4EQ5A 2EYOA 3LGJA 2F0HA 4V0BA 2XTIA 4IFDH 3DWPA 3K8AA 4GS3A 4LAAA 1DD2A 3ZJYC 3PO3G 3H15A 1CKOA 1SROA 1VQCA 1LABA 3O13A 2HCCA 3S17B 1KNEA 2RSOA 4DV2Q 3S17H 3KLSA 1W2BA 2JEBI 4B9WA 3OWEB 1S40A 3T1HQ 1N32Q 2PZWA 5ELNA 4H0LC 3S1MB 3S1MH 3D31A 1SR3A 5T1GA 4K5XA 4LNQA 2JA8H 1VQJA 2HIVA 2K5QA 4XYQA 2JA8B 4DR6L 3PIPA 1RL2A 4KJOA 1Q7YC 5K36G 3SVMA 5C0XJ 1RIPA 1UE1A 2AMCB 1TY2A 4CJ0B 5LMNL 4IPCA 3NQIA 2UUCQ 2RF4A 2FINB 2BA1A 4DPGA 5DM73 4DV3L 3K5LA 4DV4L 2ZXPA 2R3ZA 4MTKA 1SYBA 1K8AC 2EXDA 3DM3A 4CDCC 2L11A 2TSSA 1YJNA 3FVQA 1N33Q 2AUJD 4CJ2C 4KKSA 2L15A 1BCPC 1MIUA 1YNND 1J8IA 1Y1WB 1Y1WH 1I4GA 1ET6A 4GLVB 2GVAA 3EBEA 3FDTA 1I6VC 1QZHA 1STHA 2V4DA 4YCWA 5H1SE 4UHVA 2ASBA 2IWHA 2VS1A 4YHHL 1EYGA 2K32A 3RLFA 1RODA 4RCNA 4IZ8A 3NTIA 2VY3A 1EWIA 1SNQA 2EYFA 1NTGA 1V9PA 1JE5A 1IL8A 3AU7A 3KJOA 1PRTC 3BVMA 4IPHA 1PV4A 1CZGA 5IE8A 4C56C 4LFCQ 3E6ZX 4GKJQ 2NVYB 2NVYH 2PZTA 4HCEA 2M9VA 4GNXC 2MQHA 3QR8A 1S4ZA 4PMWA 1V1QA 1W6KA 3H94A 3TBIB 2BH2A 4YCUA 2JA9A 1B7YB 3OWFA 4EVOA 1TS5A 3A5UA 1SYFA 3J7A5 1C4QA 4DUZL 2JQOA 3H3VI 1B53A 3VYSA 3BU2A 2E5LL 3OHXC 1G6ZA 1AN8A 1D5XC 1HCZA 2F03A 4AIMA 3A8JE 4FXDA 4HJ7A 1XJVA 5C4JB 5C4JH 1EFWA 1N8RC 1AEXA 3OYYA 2VUMB 3EIVA 2VUMH 4G4KA 3E0JA 4F87A 1I94Q 4M1UB 3ER0A 2VQFL 3NQTA 2JA6H 4DR7L 3HOYB 3HOYH 1NCVA 1G291 1BNZA 3CC2A 4DNTB 3I7FA 4YY3L 4FF1A 4OO1H 1LV9A 3NTKA 4A3MB 4A3MH 3LNNA 3E3XA 1ENAA 3C3LA 1LLRD 2NBFA 4K5VA 4Y52H 5IOCA 5C0XH 4LWCA 5IIFA 1MGSA 3A8KE 2K04A 2AWOA 2PQEA 3OMCA 1K8OA 2ID0A 2F4VQ 1STEA 1CZWA 4A3EB 2EVBA 1I4HA 1O80A 2WACA 4JYAQ 5ELFA 1G8ZD 5C6AA 5JVG3 4R4QA 3X3MA 2DJFC 4JI5L 1S5BD 5EPJA 3S24A 5C44G 4A3CG 2HQLA 2CWPA 1A15A 4AQYQ 4X64L 1SJHD 2PI2E 4RGTA 1IW7D 5M3FG 3R93A 1KXLA 1PH6A 3WOFA 3I8ZA 5CMDA 1NUCA 4IALA 2LMCB 4IJLA 5EAYA 3TP5A 1JJCB 2N55A 2Q2UA 3GO5A 2KOLA 4K8IA 3MXUA 1K3RA 1WTXA 1LUZA 1QVGA 1U4LA 1JICA 4AYBG 4HTHA 3PO3B 3PO3H 2D5DA 2X6GA 3U58A 3WDNA 1BBUA 1EZ6A 1F2YA 4NXNL 5IYDG 2UU9Q 2XNAC 3B6YA 2PW5A 1B44D 3KF6A 1YHBA 1MSGA 3S1QH 1HNZL 1NSNS 5E3FA 1W3SA 2GA4B 4X65Q 4RWSC 2EJMA 5K36H 2XSCA 4JI7L 4GNXA 3L0OA 1ONLA 1WCMB 1WCMH 4OEMB 1PYBA 3NPPA 4OXPA 4BBRG 1A0IA 2BE5D 1NAPA 4LFAQ 4HJ5A 4R4IA 1VQEA 3GTKB 3FP9A 3UDIA 3GTKH 5J39A 5I6YA 1OXSC 4JW0A 2L12A 5KYLA 1JB3A 3S1RB 3S1RH 1SNCA 4DR1L 3HEJA 1B70B 1IKMA 2UUAL 1SFOB 1SFOH 3TN2A 1NY4A 1PTOF 4P75A 2NVXB 1B4OA 2LXKA 2NVXH 2R6GA 4JOIC 2DGYA 2HHHL 3BS1A 4A93G 3GTJH 1LTSD 3KOJA 4ALPA 5FOBB 1DM0B 2ZJQA 3NBHB 4QQBX 4RMFA 5CBAE 1BF4A 2K75A 3MXNB 4A3IB 4A3IH 4DR6Q 1JC7A 3V96A 1GHJA 3I73A 1T5XD 4FNFA 2B2UA 1TWHH 3KLSX 1HXYD 5LMNQ 2EJFC 1EU3A 1EYCA 3BYYB 4GOPC 3EFXD 3SK5A 2JN4A 3NE5B 4F88A 2ZT9C 4I65A 3SHLA 2B2VC 4DV3Q 1NJIC 4DV4Q 3T1YL 3H09A 5C3EG 3HOVG 2M2LA 3JAMc 1EEID 1MSHA 5HGTA 5M3MG 4DNRB 3JC66 3QG1A 2Q8TA 3VDYA 3X3NA 1XTCD 2HDMA 4KHZA 3JAML 1EU4A 1FNVA 4NDXA 4A3FG 2QILA 4Q5VA 1B50A 3D6WA 3L7ZC 4DK6C 1C48A 1IYJB 3M4QA 3UI2A 5LL6X 4YHHQ 1TY0A 4DGZA 1F2ZA 3P20A 2DUDA 4DFAA 5IYBG 4JV5L 3FHWA 3NWTA 2VXWA 1CA6A 2VZAA 2ZTCA 4DR3L 4HSVA 1B9MA 4LUZA 4DV6L 5C3WA 1LO5D 2Z1CA 4XDXA 4LF5L 1F9SA 1PYSB 3NHHA 4DXGA 3VYTA 5JPMC 3KDFB 2Z9HA 1O7ZA 3J7YW 3CCRA 3K7UC 2EIFA 3CXCA 2K7VA 1EYAA 1GUWA 4ID6A 4XT3B 3A74A 1OXVA 4ZKBB 3NK9A 4JI8L 5G3LD 1VF7A 1GOZA 1LACA 1EOVA 2K50A 1D1IA 2L9HA 4DUZQ 1YI2A 2B2WC 3F2CA 5FK9C 2E5LQ 2EYHA 2KBNA 4PNYA 1MKHA 3TEHB 3J81j 1KABA 1RDPD 3CC4A 1CUKA 4JOIA 4K6LA 3TDQA 2K5DA 4GZYC 2E75C 2MJ8A 1MD2D 1C8CA 1K3BC 2WP8J 2VQFQ 1LTTD 4BY7G 4DR7Q 1VQFA 2QEXA 3ULPA 2NYZD 1PH8A 1I4QA 4AYBB 4OWTB 2WINB 1GD7A 4YY3Q 1IBML 3L3OC 3VYRA 1ESFA 2PW7A 4ULLA 5LMUL 4B9XA 4C3JG 2DN8A 4GOPA 1QNKA 1ICFB 5D14A 3ERSX 2B2VA 3DWAA 2PZUA 3SK6A 3CAMA 2RSNA 4JI5Q 3BVGA 1KHIA 4BBRB 5JPNC 4BBRH 2D0OA 2F0QA 3KBGA 1T5EA 4X64Q 1SYEA 4X3SA 1EIGA 1WD1A 3G7LA 1HUNA 1L0WA 3A56A 2EZVA 1E24A 5FLMG 1OTCA 3U4VA 4BY1G 4FXGC 1CT1D 2F0PA 4RCOA 3BDCA 3SK8A 1HJPA 1HUMA 2UXDL 4JI1L 3EN2A 4OONA 2CH4W 4IJHA 2PYKA 1PH1A 1XWEA 3NTHA 2OQ0A 1QVFA 1H9KA 1DOLA 3BJUA 4K0KL 4ZK9B 3M85A 3DM1A 2F52A 1EQTA 2R7ZB 2R7ZH 1NR2A 2EOTA 3DXJC 4F7XA 4NXNQ 4A93H 2A68C 4A93B 4O2DA 1J5EL 1FR3A 3HKZG 4FYDA 3OPOA 1F77A 1TKWB 2BCOA 4P71A 1D6EC 3K81C 1YITA 3H3VH 1Q8KA 3PUYA 1L2FA 1HNZQ 1H9MA 3LX0A 4GLAC 2PNHA 1D2BA 4C3HG 4JI7Q 1Q8IA 1YNXA 3T4AC 4P73A 3CD6A 1J6QA 5IYCH 3NELA 3HRZC 4DAYA 4U673 1RTNA 2B2WA 5IWAL 4X62L 1FL0A 1L1OC 5C3EB 3A5ZB 1PTOD 3L9AX 5ISRA 2E2JB 1A62A 2O5JC 3K57A 3F1ZA 5M3MB 5M3MH 4RGOS 3PO2G 2PO4A 4L8JA 3KUPA 2PQAB 3MEFA 1M90C 1SSOA 5IP7G 2AQ1B 2MO1A 1G2SA 4X3TA 1E1TA 5F2DA 5J1ZA 4DR1Q 1XMOL 1VQIA 2UUAQ 1A6XA 1Q81C 3BZKA 4DV7L 3A8IE 1RCVD 4TVAB 1F2LA 4C3IG 3I4OA 4HIMA 2HHHQ 4LF8L 2HUGA 4OGQC 2L5TA 2ZTEA 5FO8B 1WTWA 2B2TC 1GHKA 4KJNA 4MHEA 1JOKA 3STBD 2ZJPA 1PH2A 1JT8A 2EJGC 1AZPA 3GQBA 1CKNB 5E7NA 4XT1B 5CV7A 2K1BA 4KK7A 4UP9A 3GV6A 2A74C 1YJWA 4QUCA 4UDUC 2ATWA 1GJXA 1JCKB 1RJTA 5BR8L 4TKOB 1VQ4A 5J22A 1SNMA 4JK1C 1HQRD 1KRSA 3T1YQ 4C1NK 1ENFA 2QW7A 1WTHA 1VCIA 2F0VA 1KC8C 2KCCA 1ZYRC 1SEBD 2K52A 3Q6SA 2OF1A 2L0CA 4K5WA 1KDCA 5LMNW 1PZJD 1SBBB 3OW2A 2IW3A 5M5YB 5M5YH 1U5KA 1AFPA 5E4XA 1YNJC 4DUYL 2ICIA 3FMCA 4ZKCB 1WTPA 1Z9FA 2E2IB 2E2IH 4BY7B 4BY7H 1X3PA 2RVLA 3VR5A 3PIP3 3GTOB 5IP9G 3GTOH 4EGVA 2A1AA 4JV5Q 3I55A 4RA8A 2EYLA 4PG3A 1E2VA 3CKIB 4DV6Q 2QGQA 4LF5Q 1YVCA 2OTJA 3W2DA 4N9TA 4C3JB 3RLOA 4C3JH 2R93B 2YYZA 2R93H 4UP8A 3KLRA 3T51B 1L1OA 5EKLA 4CJ1B 4KV6A 3VR6A 1HR0W 3I70A 4KN4C 4JI8Q 1TT2A 4BBSB 4V190 4BBSH 2K01A 4RGMA 2B63G 4QB4A 2K03A 3I4NG 1WTQA 3I2ZA 1XPOA 3J7AF 3I56A 2E2HB 2E2HH 5GROA 4FF4A 1PXUA 3NXWA 4K8JA 2LKVA 3LWUA 4RFBA 2A69D 2E2DC 4QMGA 2EY5A 5FO7B 2N8NA 2RBMA 3CCQA 1VQ5A 1Y1VB 1Y1VH 2B2YC 3ND9A 4GN5A 1QUQA 4ABNA 3E9IA 4LW1A 5D3IB 1MHWC 1FGUA 1IBMQ 3PIOA 2A6HC 1Q90A 2OEOA 4HIKA 4FF3A 5J3BA 4CKCA 4A3GG 5LMUQ 2Q8IB 1NMGA 3UDFA 3JAME 1STGA 2KVMA 2NN6H 4YWKA 4N8FA 1XNRL 1HR0L 1KQSA 2KQ3A 4U68A 2F0IA 3I72A 2EY2A 2O4XA 5IGCA 4N8X1 4O1NA 4JBWA 3IRBA 2N3SA 2K5VA 4KY5A 2I5LX 4O42A 5EBDA 3S2DH 3S2DB 2B8GA 3W1BA 4LF4L 3TS2A 2M00A 3MZ5A 2ES2A 2ZXOA 2IX3A 2RKSA 2HT1A 5IGEA 4JI0L 2F0KA 1TU2B 1EWCA 5D65A 1UEAB 4JI6L 4CGYB 1TWAB 3PO2B 1TWAH 1TWCB 1FNWA 1KTKA 1TWCH 3KF6B 1RTOA 2R61A 3PO2H 3HOUB 2KJXA 5HURA 4R4OA 2F3IA 2A6EC 3EVQA 2R92G 3HOUH 1A3TA 5AJ3L 3RN5A 4JI3L 5M5WB 5M5WH 1S5CD 5EQ0A 4JI1Q 2UXDQ 5JJIA 1G51A 1Y8OB 1ZKOA 5K5PA 4C3IB 4C3IH 4K0KQ 1NR4A 2K5HA 4DK0A 1P8LA 1PHJA 5HGQA 2CVRA 2NZ1D 5G3LF 1PH9A 2RQXA 2IX0A 1J5EQ 3J80c 3HS0C 3L2PA 4OIJA 4K6DA 2L55A 1HNWL 3HOXG 5JEAG 1GUGA 1Q12A 1BR9A 1XPUA 3CU7A 5I9PA 2A5HA 2RA4A 4DKAC 1R4QB 1PTOB 1PTOH 1KRTA 2Z0SA 1D5MC 3K0XA 3VR4A 1HFGA 2D9UA 1HTLD 1CM9A 1IKLA 1EY0A 2F0DA 1PFSA 1I4PA 3HOWG 1H9RA 3J80L 4B3ML 5C4XG 4A75A 3LWEA 5IWAQ 4X62Q 1JE4A 4JVZA 4WORA 4HJ9A 4MZ9A 1AE2A 1EY7A 1VQ6A 2CW0C 4ME5A 4A3EH 2MO0A 1HRJA 1C9OA 3IKJA 2ZJRA 4Y7NB 4Y7NH 3PF4A 3AQQA 5ELBA 1TS4A 2K14A 1XMOQ 4FF2A 2F0LA 3TQYA 4LFBL 4DV7Q 1SMXA 3MC0B 5IGFA 4L5TA 4OWXB 3E5SA 1GKHA 4RAUC 2VL6A 1LM0A 4GN4B 5COYA 4LF8Q 5KNDA 4KHVA 1KDAA 2HIXA 1TWGB 1TWGH 3AMUA 3MA2B 4NW2A 3G4SA 1VQMA 1VQ8A 2E74C 4KN7C 4UAIA 2KHIA 2CQOA 1GUTA 1TWFB 1TWFH 1BDOA 4K2KA 1WTRA 1KLGD 1VQAA 3ITPA 1E1OA 3CPFA 4R9WA 1SMYD 4IUPA 4X66L 1A63A 5BR8Q 5CYUA 1VQ7A 1PFBA 5KYIA 4A3LG 1G2TA 1AE3A 1C7YA 3ERQA 4M8AA 1U4MA 5GAEC 3W1GA 3DUZA 1DZ1A 3NSWA 4A3KG 2K5WA 2B8FA 2DNCA 4XTCS 3BDLA 2LS01 4LUVA 2B63B 2B63H 2WB1G 2L4NA
chains in the Genus database with same CATH topology
1O78A 4PQXA 1JWMD 5CBEE 2HDLA 4B08A 3BG3A 3DMUA 1LT6D 5EGTA 4QF4A 3FPUB 1SXTA 3V05A 5KNBA 2XWJB 1EY4A 5EJWA 4TQUS 1WTOA 5IGDA 1V1OA 3CQZB 2JP1A 4I7ZC 4A3GB 3K0YA 1Z6HA 3F2UA 2PCFB 2DNEA 3OMGA 3VR2A 3I4LA 4RGNA 4L63B 3PUVA 3U9SA 3QWNA 3SDZA 1H9SB 1I50B 4IUVA 1UNSA 1HA5A 1QCBD 3QB3A 1JOOA 3D4WA 1B3AA 2ICEC 3D4DA 4KD4A 1IYUA 2L1BA 3NP8A 1UUPA 1S5ED 3OOCA 1WTVA 1YNNC 3IFDA 4QCLA 1F9RA 5EKIA 3OW7A 2MGSA 1H9JA 1ZXTA 1XX8A 4TRDA 2CHBD 1EY5A 1UAPA 5C5MA 1DXMA 3G6JB 1GUSA 1I4XA 5JEAH 5KNCA 3SR1A 3EJIA 4KKUA 1SNOA 2VB2X 4ILWA 2EYPA 1FGBD 1PMRA 1LT5D 3HOWB 2OT2A 4J1MA 1STAA 1V1PB 4RHSA 5C3XA 2WKDA 3K5OA 2NB0A 2XN9C 2JEAI 1U4PA 5I2YA 4K14A 4IUNA 4YIJA 5C44B 4FP5D 3QOJA 1ICWA 1GUNA 5M3FB 4FVMA 1Y69U 1Q1BA 1QE6A 5CV4A 2X69A 1ML0D 1DONA 1QG7A 3DEPA 1OXTA 3N6RA 4PV1C 4KMUC 3J81L 1TS2A 1II3A 5CV9A 3RD4A 3NBHA 1SYCA 4QUFA 2F0OA 3MXNA 1RHPA 5I9OA 1SYGA 4HSPA 4IFDG 1HPCA 4C2MB 5C0XI 3GTMB 4A3KB 2BDNA 4CKEA 2I07B 2DY8A 2XVSA 2WB1B 4ZYSA 1IW7C 1BCPD 3GV3A 5FLXL 1RKNA 2KHSA 3SEBA 2EYJA 2Y0SB 5M9OA 1XXGA 3BVZA 3NUCA 1SDFA 2Z8LA 4KY7A 4XIGS 1PFNA 3U9OA 4MIUA 2K6AA 1SMYC 5A2QL 5IGGA 1LTAD 1CQFA 2PNRC 1LTID 1PRTD 2JYOA 3TP7A 5BN5A 4WRDA 5EKKA 3TP8A 1QOHA 2NUCA 2O2LD 3A55A 1VF5C 3SK4A 3V2TA 3HZXA 4ZRZA 3H3VC 4DXFA 2MP1A 3ND8A 3R2IA 2PMZB 3BZDB 2BE5C 4IN3A 4NKLA 1KNAA 1HFNA 1EL0A 4DN4M 3MHBA 1ILQA 2F1MA 1LTBD 1F9PA 3WOEA 5DEHA 4DA2A 2EY6A 3J80E 1EQVA 3TZDA 3HOVB 1Y8NB 3Q23A 2LY7A 5CV8A 3IL8A 4J6HA 5AFWA 2JE6I 3A7AB 4A3FB 3CRLC 3FPPA 3FKIB 2KCNA 1JORA 1SYDA 3Q0AA 1Q1EA 3NBIA 4G7HC 1KAAA 5FKAC 2D2CC 4S3SA 1M4VA 3MXPA 1FYCA 3P75A 1PLFA 1STYA 3URYA 4IURA 3T56B 4KI0A 3FRPB 2HCIA 4HMJA 5I2XA 1LTGD 2IT1A 3ONAB 4HR7B 1DYQA 2K05A 2D62A 1OXXK 3D6CA 1HA6A 3EQLC 4BWGB 1EYDA 2QEJC 2PPBC 3K5NA 1ILPA 4WJWA 2EYMA 5KGUA 4MN3A 5C0XG 5KEEA 5T1IA 4BS9A 1U4RA 1TIID 1R4PB 5ELCA 1OXUA 5CC4A 1JWSD 1WD0A 1HHVA 4FO2A 4KTAA 3HP3A 1HQMC 1RD9D 2F0FA 2NWGA 4IUUA 5EBCA 5JAVA 2EPBA 3QIAA 4H7BA 1BO0A 3C46A 4OL7A 2WV6D 2BOSA 3N52A 4LK1C 4LMQD 1HTPA 4NMZA 2EXZA 3K58A 4CBVA 2FHTA 1QB5D 3M7NA 5CGKA 2IL8A 1Y8PB 4Q0FA 5TSSA 3T13A 5E1FA 3CRKC 1KLUD 3I4NB 1EEFD 1E2WA 3D8GA 4DK1A 3ZYYX 3PIO3 5ELEA 3EROA 1EZ8A 3I90A 2IPKD 3K7AB 4BY1B 2MUYA 2B2TA 3RMHA 2LFNA 3OIQA 1XYIA 3PUWA 1F9QA 3M3YB 4G57A 2MPMA 1PFMA 3BDOA 5IODA 1SE2A 3HKZB 4HN7A 1L0YB 3KBXA 1BCPB 2MHVA 3T53B 1L0XB 2AQ3B 2NTTA 4C3HB 4ODGA 5DAUA 2Z4IA 3NWSA 3DEOA 3DWQA 5KIXA 1R9TB 3OIPA 2TMPA 1PRTB 3W3AA 4PMCA 1F2MA 1CA5A 3R2TA 4R8IA 1CI3M 5CR3A 1ET9A 3HG9A 1EY8A 2F0JA 3P1HA 2VB3X 4HMIA 2FFKB 3S15B 3TZUA 5IGBA 3Q24A 2B39A 5E4WC 3EA6A 1FD7D 1ZEQX 1EY6A 2AQ2B 1I3QB 1QNUA 3J81E 5EPKA 2NTSA 4RKBA 4HAEA 3RUZA 2XRQD 1PTOC 2K28A 4OIKA 1BQQT 1CFMA 1SJED 4J8QA 1OO9B 1A3UA 2JA6B 5LHY1 1FNUA 3PV0A 3R3OA 3GP7A 2EE1A 5KRUA 3PUZA 4H13C 1AZQA 2ENBA 2N88A 2F0TA 2B2YA 5FLXE 3I91A 5CORA 5C5LA 3K5MA 2C9OA 4DAVA 1PDQA 2KEDA 3KK7A 2RDGA 5M5XB 2B2UC 3TP6A 1BCPF 1JOQA 1Q3LA 3H91A 2SDFA 1LT4D 4EQOA 2WIIB 5CV5A 3J7AV 1CHPD 5A2QE 5JEAJ 1O7YA 1TR5A 1Z47A 1BOSA 2F0NA 5DNFA 4RHRA 5BN4A 1BUVT 1CK1A 5IT9L 1SNDA 3QOLA 2FJ2A 4NP5A 1PRTF 1Z7TA 4LJZC 4BA2I 2Z4HA 1CQVA 4HEDA 4RKLA 2F0UA 1A3VA 1PZKD 4ZAIA 1K83B 2C5CA 1IYVA 2A68D 3S1QB 4IUQA 4WFN3 1I6HB 4QIWB 5I4DA 1S5DD 2F4IA 1M8AA 1SNPA 1TQOA 4XQJA 4IFDI 2G9HD 3MXGA 3MTSA 2EY1A 1V8QA 4DU9A 1VMCA 3MFYA 1EOTA 1MI2A 3M4YA 1X32A 1QWYA 3FEWX 1EFID 1STNA 1B1ZA 3K59A 1WVLA 4FXKC 2J0TD 4N9PA 2KEEA 3QJYA 1E2ZA 4CHTB 3GTJB 2WKCA 5LL6S 3MVVA 1SE3A 4L6TB 3GTPB 1ENCA 3I4MB 4X3KA 4XQNA 2A69C 2F3VA 2G9DA 1PZID 3IFTA 2NVTB 1TWHB 2R92B 2IJ0A 4XYOA 3D3RA 3VR3A 2QKIC 3D4RA 3MEHA 3RZOB 4EQNA 3C2PA 2KECA 4DF7A 4XQQA 2F0WA 1BBXC 3HOXB 1CTMA 4H44C 2KUMA 1U9RA 4ZUIA 2NN6I 1ZYRD 1EWHA 1QILA 1DJRD 1DCZA 4R8NA 3S9WA 3A54A 1S5FD 4XXEA 5C4XB 4TSSA 1YNJD 3H6MA 2A73B 4C1NI 3GTLB 5JOBA 4KY6A 2FMCA 4DAPA 2EDGA 1I4RA 1KDBA 1O7LA 1JWUD 4KKTA 3S2HB 3PMFA 3OSOA 3C1EA 1G91A 4OHJA 3TMEA 4X3UA 1CHQD 3DHQA 1B9NA 1QJOA 1E0BA 2YU9B 1ESRA 2IX1A 1IHZA 2XIWA 2K33A 3R8BA 1JQYD 3MAQA 4F8MA 4OO1I 2VNUD 2F3WA 3C1FA 2NVQB 1PYWD 1H9SA 3GTQB 2SNMA 4ZUJA 5FO9B 2H1EA 2QDBA 1LTRD 2WAQB 3HOZB 2A6HD 1W6JA 3MWYW 3GD7A 2BA0A 1AP0A 2DY7A 4K2LA 2JA5B 2QCPX 5A35A 3BYTB 3SXHA 1A2TA 2I46A 2F0SA 2SEBD 2BDOA 4A3BB 3IAYA 5C4ZA 3SE0A 3TSSA 2X6LA 1A2UA 1SE4A 1AW7A 4G7OC 4A3JB 2F0MA 1TVXA 4IUTA 1B2TA 4PMBA 5I6WA 1GXDC 5EPLA 3Q22A 2F0EA 3S14B 4G7ZC 1LT3D 2A6ED 2XWBB 3T16A 1BXTA 4ZLTF 3VA7A 2Q8RE 4IFDJ 3AB9A 1V1PA 5BN3A 1K8MA 1D5ZC 2J7ZA 1MBYA 2NN6G 5NUCA 2H4OA 1SAPA 4KD3A 3A7LA 1TS3A 3MFGA 3CHBD 1DOMA 4HCSA 1V43A 4Z9CB 3I3CA 3M7GA 5D3DA 4EQPA 5C4HA 3KF8A 5JVH3 1GUOA 4CKBA 3P7JA 3HGBA 2J4XA 1EY9A 1VDZA 1STBA 3M4OB 1EIHA 3RZDB 4E6IA 2CW0D 5JJZA 5DM63 2RDHA 4RH6A 2AUKA 2FMMA 2JA7B 3PUXA 2F0GA 3GTGB 4ZQ3A 3VYUA 3VA5A 2OXPA 4BA1I 4A3DB 3S16B 3K6OA 3QO2A 1VMPA 2O5IC 4OO1G 5IT9E 4IQZA 2SOBA 1J9OA 1X3QA 2QF7A 1D1KA 2KA7A 5ELDA 2JSOA 5CV6A 2JXMB 2AWNA 1JR0D 1RF2D 2HQEA 2ZXRA 2RDFA 2CQAA 4P2CB 2E76C 1DOKA 2XRSD 3H0GB 3S1NB 2SNSA 2EYOA 2F0HA 4V0BA 4IFDH 3DWPA 4LAAA 1DD2A 1LABA 3O13A 2HCCA 3S17B 1KNEA 2RSOA 3KLSA 2JEBI 4B9WA 3OWEB 2PZWA 4H0LC 3S1MB 3D31A 5T1GA 4K5XA 2JA8B 4XYQA 2K5QA 4KJOA 5K36G 3SVMA 5C0XJ 1TY2A 4CJ0B 3NQIA 2FINB 2BA1A 5DM73 3K5LA 2ZXPA 2R3ZA 1SYBA 2L11A 2TSSA 3FVQA 2AUJD 4CJ2C 4KKSA 1BCPC 1YNND 1J8IA 1Y1WB 1I4GA 1ET6A 3FDTA 1I6VC 1STHA 2V4DA 2IWHA 2K32A 3RLFA 1RODA 4RCNA 4IZ8A 3NTIA 1SNQA 2EYFA 1IL8A 3AU7A 1PRTC 3BVMA 1CZGA 4C56C 3E6ZX 2NVYB 2PZTA 4HCEA 2M9VA 1S4ZA 4PMWA 1W6KA 3H94A 3TBIB 3OWFA 4EVOA 1TS5A 1SYFA 1C4QA 1B53A 3VYSA 1G6ZA 3OHXC 1AN8A 1D5XC 1HCZA 2F03A 3A8JE 4FXDA 5C4JB 1AEXA 2VUMB 4G4KA 3E0JA 4F87A 4M1UB 3NQTA 3HOYB 1NCVA 1G291 1BNZA 4DNTB 4FF1A 4OO1H 1LV9A 3NTKA 4A3MB 3LNNA 3C3LA 1ENAA 1LLRD 2NBFA 4K5VA 5IOCA 5C0XH 5IIFA 1MGSA 3A8KE 2K04A 2AWOA 2PQEA 3OMCA 1K8OA 2ID0A 1STEA 1CZWA 4A3EB 2EVBA 1I4HA 1O80A 2WACA 5ELFA 1G8ZD 5C6AA 5JVG3 3X3MA 5EPJA 1S5BD 1A15A 1SJHD 4RGTA 1IW7D 3R93A 3WOFA 3I8ZA 5CMDA 1NUCA 4IALA 2LMCB 3TP5A 2N55A 3GO5A 2KOLA 4K8IA 3MXUA 1WTXA 1U4LA 1JICA 4HTHA 3PO3B 2D5DA 2X6GA 3WDNA 1EZ6A 1F2YA 2XNAC 2PW5A 1B44D 1MSGA 1NSNS 5E3FA 2GA4B 4RWSC 2EJMA 5K36H 2XSCA 1ONLA 1WCMB 3NPPA 2BE5D 1NAPA 3GTKB 5J39A 5I6YA 1OXSC 2L12A 5KYLA 1JB3A 3S1RB 1SNCA 3HEJA 1IKMA 1SFOB 3TN2A 1PTOF 2NVXB 1B4OA 2R6GA 3BS1A 1LTSD 5FOBB 1DM0B 5CBAE 1BF4A 4A3IB 1JC7A 3V96A 1GHJA 3I73A 1T5XD 4FNFA 2B2UA 3KLSX 1HXYD 2EJFC 1EU3A 1EYCA 3BYYB 3EFXD 3SK5A 3NE5B 4F88A 2ZT9C 4I65A 3SHLA 2B2VC 3H09A 2M2LA 1EEID 1MSHA 5HGTA 4DNRB 3QG1A 2Q8TA 3X3NA 1XTCD 2HDMA 4KHZA 3JAML 1EU4A 1FNVA 4NDXA 2QILA 4Q5VA 1B50A 3D6WA 3L7ZC 1C48A 3UI2A 5LL6X 1TY0A 4DGZA 1F2ZA 3P20A 4DFAA 3NWTA 2VXWA 1CA6A 4HSVA 1B9MA 5C3WA 1LO5D 2Z1CA 4XDXA 1F9SA 3NHHA 4DXGA 3VYTA 5JPMC 1O7ZA 3J7YW 2K7VA 1EYAA 1GUWA 4ID6A 4XT3B 1OXVA 4ZKBB 3NK9A 5G3LD 1VF7A 1GOZA 1LACA 1D1IA 2L9HA 2B2WC 5FK9C 2EYHA 4PNYA 1KABA 1RDPD 4K6LA 3TDQA 2K5DA 4GZYC 2E75C 2MJ8A 1MD2D 1C8CA 2WP8J 1LTTD 2NYZD 1I4QA 4AYBB 2WINB 3L3OC 3VYRA 1ESFA 2PW7A 4ULLA 4B9XA 4C3JG 2DN8A 1QNKA 5D14A 2B2VA 3DWAA 2PZUA 3SK6A 2RSNA 3BVGA 5JPNC 4BBRB 2F0QA 3KBGA 1T5EA 1SYEA 4X3SA 1EIGA 1WD1A 3G7LA 1HUNA 3A56A 2EZVA 4FXGC 1CT1D 2F0PA 4RCOA 3BDCA 3SK8A 1HUMA 2PYKA 1XWEA 3NTHA 1H9KA 1DOLA 4ZK9B 3M85A 3DM1A 1EQTA 2R7ZB 1NR2A 2EOTA 3DXJC 4F7XA 4A93B 2A68C 1FR3A 4FYDA 3OPOA 1F77A 1TKWB 2BCOA 1D6EC 3PUYA 1H9MA 3LX0A 1D2BA 4C3HG 1Q8IA 3T4AC 3HRZC 4DAYA 4U673 1RTNA 2B2WA 5C3EB 1PTOD 3L9AX 5ISRA 2E2JB 2O5JC 3K57A 5M3MB 4RGOS 2PO4A 4L8JA 3KUPA 1SSOA 2AQ1B 1G2SA 4X3TA 5F2DA 5J1ZA 1A6XA 3A8IE 1RCVD 1F2LA 4C3IG 2HUGA 4OGQC 2L5TA 5FO8B 1WTWA 2B2TC 1GHKA 4KJNA 4MHEA 1JOKA 2EJGC 1AZPA 3GQBA 4XT1B 5CV7A 2K1BA 4KK7A 3GV6A 2A74C 4QUCA 4UDUC 1GJXA 1JCKB 1RJTA 4TKOB 5J22A 1SNMA 4JK1C 1HQRD 4C1NK 1ENFA 1VCIA 2F0VA 2KCCA 1ZYRC 1SEBD 3Q6SA 2OF1A 2L0CA 4K5WA 1KDCA 1PZJD 1SBBB 2IW3A 5M5YB 1AFPA 5E4XA 1YNJC 2ICIA 3FMCA 4ZKCB 1WTPA 2E2IB 4BY7B 1X3PA 2RVLA 3VR5A 3PIP3 3GTOB 4EGVA 4RA8A 2EYLA 1E2VA 3CKIB 3W2DA 4N9TA 4C3JB 2R93B 2YYZA 3KLRA 3T51B 5EKLA 4CJ1B 4KV6A 3VR6A 3I70A 4KN4C 1TT2A 4BBSB 4V190 4RGMA 2K01A 4QB4A 2K03A 1WTQA 3J7AF 2E2HB 4FF4A 1PXUA 3NXWA 4K8JA 2LKVA 3LWUA 4RFBA 2A69D 2E2DC 4QMGA 2EY5A 5FO7B 2RBMA 1Y1VB 2B2YC 3ND9A 4ABNA 5D3IB 2A6HC 1Q90A 2OEOA 4FF3A 4CKCA 2Q8IB 3JAME 1STGA 2KVMA 2NN6H 2KQ3A 4U68A 2F0IA 3I72A 2EY2A 2O4XA 5IGCA 4O1NA 4JBWA 4KY5A 4O42A 5EBDA 3S2DB 2B8GA 2M00A 3MZ5A 2ZXOA 2IX3A 2RKSA 5IGEA 2F0KA 1TU2B 1EWCA 5D65A 1UEAB 4CGYB 1TWAB 3PO2B 1TWCB 1FNWA 1KTKA 1RTOA 2R61A 3HOUB 2KJXA 5HURA 2A6EC 3EVQA 1A3TA 5M5WB 1S5CD 5EQ0A 1Y8OB 1ZKOA 5K5PA 4C3IB 1NR4A 4DK0A 2CVRA 2NZ1D 5G3LF 2RQXA 2IX0A 3HS0C 4OIJA 4K6DA 2L55A 5JEAG 1GUGA 1Q12A 1BR9A 3CU7A 5I9PA 2A5HA 2RA4A 1R4QB 1PTOB 1PTOH 1D5MC 3VR4A 1HFGA 2D9UA 1HTLD 1CM9A 1IKLA 1EY0A 2F0DA 1I4PA 1H9RA 3J80L 3LWEA 1JE4A 4WORA 1EY7A 2CW0C 4ME5A 1HRJA 3IKJA 4Y7NB 5ELBA 1TS4A 4FF2A 2F0LA 3MC0B 5IGFA 3E5SA 4RAUC 5COYA 5KNDA 4KHVA 1KDAA 1TWGB 3AMUA 3MA2B 4NW2A 2E74C 4KN7C 4UAIA 1GUTA 1TWFB 1BDOA 4K2KA 1WTRA 1KLGD 3ITPA 4R9WA 1SMYD 4IUPA 5CYUA 1PFBA 5KYIA 1G2TA 3ERQA 4M8AA 1U4MA 3DUZA 1DZ1A 3NSWA 2K5WA 2B8FA 2DNCA 4XTCS 3BDLA 2LS01 2B63B 2L4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FIN B;  1B4O A;  3DEO A;  4MN3 A;  5T1I A;  1NR4 A;  5CBE E;  1RTN A;  2B2W A;  2JYO A;  1U4R A;  1MGS A;  2CVR A;  2HDL A;  2K04 A;  1O7Y A;  2NZ1 D;  2R3Z A;  3MWY W;  2L11 A;  1AP0 A;  2DY7 A;  1WD0 A;  2KEC A;  4OIJ A;  3FPU B;  2MJ8 A;  5DNF A;  1O80 A;  3QO2 A;  5CBA E;  1C8C A;  1BBX C;  1U4P A;  1VMP A;  3HP3 A;  4CJ2 C;  4CJ1 B;  1BF4 A;  2KUM A;  3KUP A;  1SSO A;  2NYZ D;  2FJ2 A;  1G2S A;  2NWG A;  2B2U A;  2K01 A;  2MP1 A;  2RA4 A;  4IUU A;  4X3T A;  5EJW A;  2K03 A;  5EPJ A;  4R8I A;  1CA5 A;  1WTO A;  1J8I A;  1KNA A;  1A15 A;  2EPB A;  4HED A;  1ICW A;  1WTQ A;  1HFN A;  2X6L A;  1F2L A;  1BO0 A;  1HFG A;  2D9U A;  4ZAI A;  1EL0 A;  3R93 A;  1J9O A;  1CM9 A;  1IKL A;  3N52 A;  4DN4 M;  2JP1 A;  1X3Q A;  1QE6 A;  3FDT A;  1ILQ A;  1TVX A;  2HUG A;  2X69 A;  2B2V C;  3I8Z A;  4LMQ D;  5CMD A;  2FFK B;  1WTW A;  1F9P A;  1HHV A;  1QNK A;  2M2L A;  2B2T C;  3LWE A;  1JE4 A;  4IUT A;  1ML0 D;  2FHT A;  4IUQ A;  3TZD A;  1B2T A;  5D14 A;  2IL8 A;  2N55 A;  3F2U A;  1MSH A;  4MHE A;  1DON A;  2B2V A;  1QG7 A;  3DEP A;  5EPL A;  1ROD A;  1AZP A;  2KOL A;  5E4W C;  1HRJ A;  1M8A A;  1WTX A;  1U4L A;  1JIC A;  2B2Y C;  4XT1 B;  2Q8T A;  2K1B A;  2RSN A;  3GV6 A;  4ZLT F;  2X6G A;  4IUV A;  1IL8 A;  2Q8R E;  3MTS A;  3IL8 A;  5EPK A;  4QUC A;  4HAE A;  4X3S A;  1VMC A;  1DOK A;  1RJT A;  1EIG A;  2HDM A;  5AFW A;  4RAU C;  1B3A A;  1EOT A;  4QUF A;  1MI2 A;  1WD1 A;  2J7Z A;  3G7L A;  2K28 A;  4OIK A;  1B50 A;  1HUN A;  1RHP A;  5COY A;  1X32 A;  1G91 A;  3D6W A;  2KVM A;  2L1B A;  1S4Z A;  1SAP A;  1MSG A;  4X3U A;  2EE1 A;  3I90 A;  4NW2 A;  3UI2 A;  1WVL A;  1WTV A;  4RWS C;  4U68 A;  1DOM A;  4HCS A;  2B2T A;  2BDN A;  3IFD A;  1F9R A;  4UAI A;  5EKI A;  1HUM A;  2DY8 A;  2MGS A;  2VXW A;  1E0B A;  1B53 A;  1ESR A;  3I3C A;  1XYI A;  1AZQ A;  1CA6 A;  1F9Q A;  1G6Z A;  1WTR A;  4HSV A;  2KEE A;  2HCC A;  1ZXT A;  3GV3 A;  3Q6S A;  2MPM A;  1XX8 A;  1PFM A;  2N88 A;  1DOL A;  4R9W A;  1KNE A;  2RSO A;  2XIW A;  1NAP A;  1PLF A;  4XDX A;  1F9S A;  3DM1 A;  4O42 A;  4ZK9 B;  1EQT A;  2B2Y A;  4IUP A;  1NR2 A;  2EOT A;  4IUR A;  3I91 A;  3P7J A;  5COR A;  1O7Z A;  1PDQ A;  1PFB A;  2HCI A;  4X3K A;  5E4X A;  2L12 A;  2KED A;  1G2T A;  1GUW A;  3ONA B;  5T1G A;  4XT3 B;  4ZKC B;  3KBX A;  1U4M A;  2B2U C;  1EIH A;  5D65 A;  1SDF A;  1NCV A;  4ZKB B;  1WTP A;  1Q3L A;  2K05 A;  3H91 A;  1DZ1 A;  1X3P A;  2RVL A;  1BNZ A;  1RTO A;  2SDF A;  5JJZ A;  1PFN A;  3SVM A;  1IKM A;  1HA6 A;  2FMM A;  3TN2 A;  4CJ0 B;  2H1E A;  2L9H A;  1LV9 A;  2B2W C;  5EQ0 A;  2L4N A;  4RA8 A;  1ILP A; 
#chains in the Genus database with same CATH topology
 1O78 A;  4PQX A;  3PSI A;  1JWM D;  3HOZ G;  5CBE E;  1KAW A;  2HDL A;  4B08 A;  3J7Z C;  3BG3 A;  3DMU A;  1LT6 D;  2JA5 G;  1MJC A;  2Y0S G;  5EGT A;  4QF4 A;  3FPU B;  4DUY Q;  2I5M X;  1SXT A;  3HKS A;  4AYB E;  5DLQ E;  3V05 A;  5KNB A;  1TXY A;  2XWJ B;  4A3B G;  2YTY A;  1EY4 A;  5EJW A;  2MFI A;  4TQU S;  3RR5 A;  1WTO A;  2IHE A;  3PGZ A;  5IGD A;  1V1O A;  3CQZ B;  3CQZ H;  1UEB A;  2JP1 A;  4X6A H;  3A0J A;  4I7Z C;  4A3G B;  4A3G H;  3E0E A;  1K9M C;  3K0Y A;  1Z6H A;  4QY7 A;  1K28 A;  3F2U A;  1K0R A;  4FDB A;  2PCF B;  2DNE A;  3OMG A;  3VR2 A;  2WB1 E;  3I4L A;  4RGN A;  4L63 B;  3PUV A;  4O0A A;  2NZH A;  3U9S A;  3QWN A;  3SDZ A;  4WJ4 A;  1H9S B;  1I50 B;  4IUV A;  1I50 H;  1UNS A;  1HA5 A;  1QCB D;  1UWV A;  1JOO A;  3D4W A;  3QB3 A;  1B3A A;  2ICE C;  3D4D A;  1YHQ A;  4KD4 A;  1SE8 A;  4B3S L;  1IYU A;  2L1B A;  3NP8 A;  1UUP A;  1S5E D;  1GVP A;  3OOC A;  4JG2 A;  1WTV A;  3CP0 A;  1YNN C;  3IFD A;  4QCL A;  1F9R A;  5EKI A;  3OW7 A;  2MGS A;  1H9J A;  1ZXT A;  1XX8 A;  4GN3 B;  4TRD A;  1JJG A;  2CHB D;  1EY5 A;  1XMQ L;  2HD3 A;  1NBW A;  1UAP A;  5C5M A;  2ZM6 L;  1DXM A;  2IHF A;  3FKI G;  3G6J B;  1GUS A;  1I4X A;  1IBL L;  2PMZ E;  5JEA H;  5KNC A;  1XNR Q;  1HR0 Q;  3SR1 A;  3EJI A;  2CCZ A;  4KKU A;  1SNO A;  2VB2 X;  4ILW A;  3AFQ A;  1CSQ A;  1FGB D;  2EYP A;  1PVO A;  1PMR A;  1LT5 D;  4LF4 Q;  3HOW B;  2OT2 A;  3HOW H;  4A3D G;  4J1M A;  3RNU A;  1STA A;  1V1P B;  4RHS A;  5C3X A;  2OWO A;  2WKD A;  2YTV A;  3K5O A;  2NB0 A;  2XN9 C;  4JI0 Q;  2JEA I;  1U4P A;  5I2Y A;  4K14 A;  3AFP A;  4JI6 Q;  3SGI A;  4IUN A;  4YIJ A;  1YBY A;  2CKZ B;  5C44 B;  4FP5 D;  5C44 H;  3J81 c;  3QOJ A;  4JI4 L;  4A3C H;  1ICW A;  4JI3 Q;  3PCO B;  1HH2 P;  1N32 L;  1ASZ A;  1GUN A;  5M3F B;  4FVM A;  5M3F H;  1Q1B A;  1QE6 A;  1Y69 U;  5CV4 A;  2X69 A;  3KF8 B;  4DR5 L;  1ML0 D;  4DAY B;  1YHA A;  2XGT A;  1DON A;  1QG7 A;  3DEP A;  1OXT A;  1HNW Q;  3N6R A;  3D0F A;  3KYH C;  4PV1 C;  4KMU C;  3J81 L;  1TS2 A;  1II3 A;  1X3G A;  5CV9 A;  3RD4 A;  3NBH A;  1SYC A;  5FLX c;  4QUF A;  2F0O A;  5IYD H;  4JI2 L;  3MXN A;  3UDX A;  1RHP A;  5I9O A;  4B3M Q;  4A3L H;  1SYG A;  4HSP A;  4DR2 L;  4IFD G;  3NEN A;  1HPC A;  4C2M B;  4C2M H;  5C0X I;  4JC0 A;  4A3K B;  3GTM H;  4A3K H;  2BDN A;  3GTM B;  2AHO B;  4CKE A;  1K8G A;  1H95 A;  2I07 B;  2DY8 A;  2EQS A;  2XVS A;  2WB1 B;  4ZYS A;  1IW7 C;  1BCP D;  3GV3 A;  4YCV A;  3UDG A;  5FLX L;  1RKN A;  2KHS A;  3SEB A;  3G71 A;  4LFB Q;  4EX5 A;  1T9H A;  1YIJ A;  1XTD A;  5HY6 A;  2EYJ A;  2V1C C;  2JA8 G;  2Y0S B;  5M9O A;  1O7I A;  1XXG A;  3BVZ A;  1SDF A;  2Z8L A;  3NUC A;  4KY7 A;  4XIG S;  1PFN A;  3U9O A;  3CF5 A;  4MIU A;  4CDF C;  3CMA A;  1I5F A;  2K6A A;  5GQO A;  1SMY C;  5A2Q L;  2PI2 A;  5IGG A;  3JAM i;  1MJE A;  1LTA D;  1CQF A;  2PNR C;  1LTI D;  2RHQ B;  1PRT D;  3UE1 A;  1X3F A;  1HZ9 A;  2JYO A;  4CDE C;  1S3O A;  3TP7 A;  5BN5 A;  4X66 Q;  3G48 A;  4WRD A;  5EKK A;  3TP8 A;  1QOH A;  2NUC A;  2O2L D;  1WOC A;  3A55 A;  3ULJ A;  1VF5 C;  4DV1 L;  3SK4 A;  2Q2T A;  3V2T A;  1VQN A;  3HZX A;  4IO9 A;  2LXJ A;  2JJQ A;  4ZRZ A;  3UE0 A;  3H3V C;  2KEN A;  1XPR A;  4DXF A;  2MP1 A;  3ND8 A;  3R2I A;  2PMZ B;  3BZD B;  1Y1W G;  2BE5 C;  1UE6 A;  4IN3 A;  4NKL A;  1KNA A;  2UXC L;  5ELO A;  1HFN A;  4OEL B;  1EL0 A;  4DN4 M;  3MHB A;  1ILQ A;  2F1M A;  1LTB D;  1F9P A;  3WOE A;  5DEH A;  4DA2 A;  2EY6 A;  5C3E H;  1EQV A;  3TZD A;  3J80 E;  3HOV H;  3HOV B;  3CCJ A;  4GKK L;  1Y8N B;  1VQH A;  2E2J H;  3Q23 A;  2LY7 A;  3CC7 A;  4NB3 A;  4PZ8 A;  4POF A;  5CV8 A;  4KHP L;  1Q46 A;  3F2B A;  3IL8 A;  4J6H A;  3HKZ E;  5AFW A;  2JE6 I;  5GAH C;  3A7A B;  4A3F B;  4A3F H;  3CRL C;  3FPP A;  3FKI B;  3FKI H;  2KCN A;  1JOR A;  1SYD A;  3DLL A;  3Q0A A;  1Q1E A;  4B3T L;  3NBI A;  1IBK L;  3CW2 C;  4G7H C;  1KAA A;  1A8V A;  5FKA C;  3BZC A;  2D2C C;  4S3S A;  4QL5 A;  5IYB H;  1M4V A;  1LYL A;  3MXP A;  4H02 A;  1FYC A;  3P75 A;  1U0L A;  1PLF A;  1STY A;  4RG1 A;  3URY A;  4IUR A;  3T56 B;  4JBK A;  4KI0 A;  3FRP B;  3CCM A;  2VUM G;  2HCI A;  4HMJ A;  5L37 A;  5I2X A;  1LTG D;  2IT1 A;  4B3S Q;  2JA6 G;  1E3P A;  3ONA B;  4HR7 B;  1DYQ A;  1VQB A;  4IPD A;  4LF6 L;  2K05 A;  2D62 A;  1OXX K;  2N49 A;  3AYH B;  3D6C A;  1HA6 A;  3EQL C;  4BWG B;  1EYD A;  2QEJ C;  1LTL A;  4A3M G;  2PPB C;  3K5N A;  1ILP A;  4WJW A;  2EYM A;  5KGU A;  4MN3 A;  5C0X G;  5KEE A;  5T1I A;  1XMQ Q;  4BS9 A;  1U4R A;  2IY5 B;  1TII D;  1R4P B;  5ELC A;  4LF7 L;  1OXU A;  4IOA A;  5CC4 A;  1JWS D;  1WD0 A;  2ZM6 Q;  5GAD C;  1HHV A;  4FO2 A;  4KTA A;  1IBL Q;  3HP3 A;  1PA6 A;  1HQM C;  4YWM A;  1RD9 D;  1EQQ A;  2F0F A;  2NWG A;  4IUU A;  5EBC A;  5JAV A;  2EPB A;  3QIA A;  4H7B A;  4DR3 Q;  1KIX A;  1BO0 A;  1DGS A;  3C46 A;  4OL7 A;  2WV6 D;  2BOS A;  3N52 A;  4LK1 C;  1AH9 A;  4LMQ D;  1HTP A;  4NMZ A;  2EXZ A;  3K58 A;  4CBV A;  4NXM L;  2FHT A;  1QB5 D;  3M7N A;  5CGK A;  2IL8 A;  1Y8P B;  4Q0F A;  4OX9 L;  5TSS A;  3T13 A;  5E1F A;  3CRK C;  1KLU D;  3I4N B;  1EEF D;  1E2W A;  2Z6K C;  3U50 C;  4JI4 Q;  4DR4 L;  3D8G A;  4DK1 A;  3ZYY X;  3PIO 3;  1SRU A;  1N34 L;  3CCS A;  2MNA A;  2PQA A;  5ELE A;  3ERO A;  4WJ3 M;  1B8A A;  4A4I A;  1EZ8 A;  4DR5 Q;  3I90 A;  5FLM H;  2IPK D;  3K7A B;  3K7A H;  4BY1 B;  2MUY A;  2B2T A;  3RMH A;  4BY1 H;  2CFM A;  1SN8 A;  1EIF A;  1WCM G;  3OIQ A;  2LFN A;  1BKB A;  3PUW A;  2YV5 A;  1XYI A;  1F9Q A;  3M3Y B;  4G57 A;  3M3Y H;  3E9H A;  4R4T A;  2MPM A;  3W5O A;  1PH4 A;  1PFM A;  2UXB L;  1SLJ A;  2UUB L;  3BDO A;  1N36 L;  5IOD A;  5GAG C;  1SE2 A;  1CKN A;  4JI2 Q;  4QGU A;  1XNQ L;  3HKZ B;  4HN7 A;  1VQG A;  1L0Y B;  2E8G A;  1BCP B;  3KBX A;  4DR2 Q;  2Q2H A;  2MHV A;  3T53 B;  4GLX A;  1L0X B;  2AQ3 B;  2NTT A;  1E7Z A;  2I0Q A;  4C3H B;  4C3H H;  4ODG A;  3CCL A;  5DAU A;  1VQO A;  1FVI A;  2Z4I A;  3NWS A;  3DEO A;  3DWQ A;  2OTL A;  1FJG L;  3I4M G;  5KIX A;  4QIW E;  1R9T B;  4HID A;  1R9T H;  3OIP A;  4A76 A;  2RHS B;  4UPA A;  4A3I G;  3M4P A;  2TMP A;  1PRT B;  3W3A A;  4PMC A;  1F2M A;  5IP7 H;  1CA5 A;  3R2T A;  4R8I A;  1N9W A;  1CI3 M;  5CR3 A;  1VQP A;  4GNX B;  1ET9 A;  2QDL A;  3HG9 A;  1EY8 A;  1CSP A;  2F0J A;  3P1H A;  2VB3 X;  4HMI A;  1Y14 B;  2FFK B;  3S15 B;  3S15 H;  3TZU A;  5IGB A;  1G6P A;  1VQK A;  3Q24 A;  2B39 A;  2GVB A;  4DV1 Q;  3F2D A;  3U4Z A;  2OQK A;  5E4W C;  3EA6 A;  1HNX L;  1FD7 D;  2BH8 A;  3RLN A;  1ZEQ X;  4JCV E;  1EY6 A;  2AQ2 B;  1I3Q B;  1WFQ A;  1I3Q H;  1QNU A;  3J81 E;  2D0P A;  5EPK A;  2NTS A;  4RKB A;  4HAE A;  2UXC Q;  3HFZ B;  3RUZ A;  4AH6 A;  2XRQ D;  1PTO C;  2K28 A;  2Z6K A;  4OIK A;  1BQQ T;  1CFM A;  1SJE D;  4J8Q A;  3NEM A;  1OO9 B;  1Q86 C;  1A3U A;  2JA6 B;  5LHY 1;  1FNU A;  3PV0 A;  2P5Z X;  3R3O A;  3GP7 A;  4GKK Q;  2EE1 A;  1M1K C;  4DV5 L;  4LF9 L;  5KRU A;  4DAM A;  3PUZ A;  4H13 C;  4MTN A;  1AZQ A;  2ENB A;  4UP7 A;  4KHP Q;  2N88 A;  1BVS A;  2F0T A;  2B2Y A;  5FLX E;  3I91 A;  2KCM A;  4R1J A;  5COR A;  5C5L A;  3TRZ A;  3K5M A;  2C9O A;  2DJG C;  1PDQ A;  4DAV A;  4P74 A;  1JJ2 A;  2KED A;  3KK7 A;  3STB C;  2RDG A;  5M5X B;  5M5X H;  2B2U C;  3TP6 A;  4IOC A;  1IL2 A;  1BCP F;  1JOQ A;  1Q3L A;  3H91 A;  4BXX G;  4B3T Q;  2SDF A;  1IBK Q;  4POG A;  1X56 A;  1LT4 D;  5IP9 H;  5IT9 c;  4EQO A;  4YWL A;  2WII B;  5CV5 A;  3J7A V;  1CHP D;  5A2Q E;  5JEA J;  4J15 A;  2R7D A;  1O7Y A;  1TR5 A;  1Z47 A;  1BOS A;  5JJK A;  1K0S A;  4HIO A;  2F0N A;  2WFW A;  1X54 A;  4L5Q A;  5DNF A;  2RCN A;  4L5R C;  4RHR A;  5BN4 A;  1BBW A;  1BUV T;  4LF6 Q;  1CK1 A;  5IT9 L;  1SND A;  3QOL A;  2FJ2 A;  4NP5 A;  1PRT F;  1Z7T A;  4LJZ C;  4BA2 I;  2Z4H A;  1CQV A;  4HED A;  4RKL A;  3I4N H;  2F0U A;  1A3V A;  1PZK D;  4ZAI A;  2WAQ G;  4DK3 C;  1K83 B;  1K83 H;  1VQL A;  2C5C A;  1IYV A;  2A68 D;  4LF7 Q;  3S1Q B;  4IUQ A;  4WFN 3;  3G6E A;  1I6H B;  4QIW B;  1I6H H;  5I4D A;  1S5D D;  3CPW A;  2F4I A;  1M8A A;  5FJ8 G;  1SNP A;  1TQO A;  4XQJ A;  4IFD I;  2G9H D;  3RN2 A;  3MXG A;  3MTS A;  3PF5 A;  2EY1 A;  1V8Q A;  4DU9 A;  4A3J G;  1VMC A;  3MFY A;  1EOT A;  1MI2 A;  3M4Y A;  1X32 A;  1QWY A;  1NNX A;  3FEW X;  1EFI D;  1STN A;  4NXM Q;  1B1Z A;  3K59 A;  1WVL A;  4OX9 Q;  4FXK C;  1X55 A;  2J0T D;  4N9P A;  1YJ9 A;  2WAQ E;  5IY0 A;  2KEE A;  4I7A A;  3QJY A;  1E2Z A;  3J80 i;  3OTO L;  4DV0 L;  2R7Z G;  4CHT B;  1HZA A;  3GTJ B;  2AKW B;  2WKC A;  5LL6 S;  3MVV A;  4DR4 Q;  1SE3 A;  4L6T B;  2Y0S E;  1ENC A;  3GTP H;  3GTP B;  3I4M B;  3I4M H;  4X3K A;  1N34 Q;  4XQN A;  3KLW A;  2A69 C;  2F3V A;  4QJF A;  1QVC A;  2ZTD A;  2G9D A;  4B3R L;  1PZI D;  3IFT A;  2NVT B;  2NVT H;  4GOP B;  1TWH B;  2R92 B;  2R92 H;  2N78 A;  2VQE L;  2IJ0 A;  4XYO A;  3D3R A;  5IYC G;  3VR3 A;  3ULL A;  2UXB Q;  2QKI C;  3D4R A;  2UUB Q;  3MEH A;  1NE3 A;  3RZO H;  4EQN A;  1N36 Q;  3RZO B;  3CCV A;  4IPG A;  3C2P A;  2KEC A;  4DF7 A;  1XNQ Q;  4XQQ A;  2F0W A;  2I5H A;  2OCE A;  1BBX C;  3HOX B;  1VQD A;  3HOX H;  1CTM A;  4H44 C;  2KUM A;  2K4K A;  1U9R A;  4ZUI A;  2NN6 I;  2Q2I A;  3CCE A;  2JA7 G;  1ZYR D;  4PZ7 A;  1EWH A;  1QIL A;  1DJR D;  1DCZ A;  2YTX A;  3M9B A;  4R8N A;  3S9W A;  3A54 A;  1S5F D;  1FJG Q;  4XXE A;  5C4X B;  5C4X H;  4TSS A;  1YNJ D;  1YZ6 A;  3H6M A;  3PQI A;  2A73 B;  4C1N I;  2VW9 A;  1JMC A;  3GTL H;  3GTL B;  5JOB A;  4KY6 A;  2FMC A;  4DAP A;  2EDG A;  1I4R A;  1KDB A;  4DV2 L;  4CDD C;  1O7L A;  1JWU D;  5AJ3 Q;  4KKT A;  4DNI A;  3T1H L;  3S2H B;  3S2H H;  2R7F A;  3PMF A;  2GN5 A;  3OSO A;  3C1E A;  1G91 A;  4OHJ A;  1HZC A;  3TME A;  4X3U A;  4APV A;  1CHQ D;  3DHQ A;  4BXX H;  2G5D A;  1B9N A;  1QJO A;  1HNX Q;  2UUC L;  1E0B A;  2YU9 B;  1ESR A;  2YU9 H;  2IX1 A;  1GO3 E;  3K80 C;  1IHZ A;  2XIW A;  2K33 A;  4HJ8 A;  1PH5 A;  3R8B A;  3H0G G;  1JQY D;  2KHJ A;  3MAQ A;  4F8M A;  4OO1 I;  2VNU D;  2LSS A;  2F3W A;  3C1F A;  2NVQ B;  2NVQ H;  1N33 L;  2B29 A;  5JJL A;  1PYW D;  1H9S A;  2KCT A;  1X65 A;  2K5N A;  3GTQ B;  3GTQ H;  2SNM A;  4ZUJ A;  5FO9 B;  4DV5 Q;  4LF9 Q;  2H1E A;  1CKM A;  1EUJ A;  2QDB A;  1LTR D;  4JBM A;  2WAQ B;  3HOZ B;  3HOZ H;  2A6H D;  3CCU A;  1W6J A;  3MWY W;  3GD7 A;  2R93 G;  2BA0 A;  1AP0 A;  2DY7 A;  4K2L A;  3CME A;  1UE5 A;  2JA5 B;  2JA5 H;  2QCP X;  1YEZ A;  5A35 A;  3BYT B;  1IZ6 A;  1WYD A;  3SXH A;  1A2T A;  2I46 A;  2F0S A;  4BBS G;  4KLK A;  5FJ8 H;  2SEB D;  2BDO A;  4A3B B;  3IAY A;  4A3B H;  4P72 A;  5C4Z A;  1JB7 A;  3SE0 A;  4PZ6 A;  3TSS A;  2X6L A;  1A2U A;  1AW7 A;  1SE4 A;  4G7O C;  4ZCK A;  4LFC L;  4A3J B;  1E22 A;  4A3J H;  4GKJ L;  2F0M A;  1TVX A;  1WI5 A;  3ICE A;  1PH3 A;  1EIY B;  4IUT A;  1B2T A;  4PMB A;  3GDE A;  2A19 A;  5I6W A;  1GXD C;  5EPL A;  3TRE A;  2CWA A;  3Q22 A;  1Y1V G;  2F0E A;  3S14 B;  3S14 H;  4G7Z C;  3KDF A;  1LT3 D;  2A6E D;  2XWB B;  3T16 A;  1BXT A;  4ZLT F;  1X9N A;  4UY8 C;  3VA7 A;  2Q8R E;  1P16 A;  4IFD J;  3AB9 A;  1V1P A;  5BN3 A;  1K8M A;  1D5Z C;  2J7Z A;  1MBY A;  2NN6 G;  1WJJ A;  1I94 L;  5NUC A;  2H4O A;  2FXQ A;  1HZB A;  1SAP A;  4KD3 A;  4HJA A;  3A7L A;  1TS3 A;  3MFG A;  2NZO A;  3CHB D;  1ASY A;  1DOM A;  1IXR A;  4HCS A;  1V43 A;  4LUO A;  4Z9C B;  3I3C A;  2QA4 A;  3M7G A;  5D3D A;  4EQP A;  5C4H A;  1NMF A;  2C35 B;  3KF8 A;  5JVH 3;  1L1O B;  1GUO A;  2Z6B A;  4CKB A;  1D7Q A;  2ALY B;  3HGB A;  3P7J A;  2J4X A;  4MNO A;  1EY9 A;  2F4V L;  1VDZ A;  4L5S A;  1STB A;  3M4O B;  4JPB W;  3M4O H;  1EIH A;  3J81 i;  4JYA L;  3RZD B;  3RZD H;  4E6I A;  2CW0 D;  3HOU G;  2RCF A;  5JJZ A;  2JK8 A;  3F8T A;  5DM6 3;  2RDH A;  4RH6 A;  1PH7 A;  2AUK A;  2FMM A;  2CH4 A;  2JA7 H;  2JA7 B;  3PUX A;  4AQY L;  2F0G A;  3GTG B;  4ZQ3 A;  3GTG H;  3OTO Q;  4DV0 Q;  3VYU A;  1K73 C;  1QUQ B;  3VA5 A;  2OXP A;  1S72 A;  4BA1 I;  4A3D B;  4A3D H;  3S16 B;  3S16 H;  1KL9 A;  3K6O A;  3HOY G;  3QO2 A;  3TS0 A;  1VMP A;  4B3R Q;  2O5I C;  1D8L A;  3KFU A;  1B3Q A;  1UE7 A;  4OO1 G;  5IT9 E;  4IQZ A;  2B3G A;  4ME3 A;  2H5X A;  4R4C A;  2VQE Q;  3WWV A;  1EQR A;  1X3E A;  2UU9 L;  2SOB A;  1J9O A;  1X6O A;  1X3Q A;  1VQ9 A;  2QF7 A;  1D1K A;  4NPS A;  2KA7 A;  5ELD A;  2JSO A;  4OWW B;  4X65 L;  3KJP A;  4A3E G;  5CV6 A;  2A8V A;  1QZG A;  2JXM B;  1C0A A;  1KD1 C;  3AEV A;  2AWN A;  1JR0 D;  1RF2 D;  2HQE A;  2ZXR A;  2RDF A;  2CQA A;  4LFA L;  4P2C B;  2E76 C;  4JBJ A;  1GM5 A;  1DOK A;  1Q82 C;  3Q8D A;  2XRS D;  3H0G B;  3H0G H;  3S1N B;  3S1N H;  2SNS A;  1VS0 A;  4EQ5 A;  2EYO A;  3LGJ A;  2F0H A;  4V0B A;  2XTI A;  4IFD H;  3DWP A;  3K8A A;  4GS3 A;  4LAA A;  1DD2 A;  3ZJY C;  3PO3 G;  3H15 A;  1CKO A;  1SRO A;  1VQC A;  1LAB A;  3O13 A;  2HCC A;  3S17 B;  1KNE A;  2RSO A;  4DV2 Q;  3S17 H;  3KLS A;  1W2B A;  2JEB I;  4B9W A;  3OWE B;  1S40 A;  3T1H Q;  1N32 Q;  2PZW A;  5ELN A;  4H0L C;  3S1M B;  3S1M H;  3D31 A;  1SR3 A;  5T1G A;  4K5X A;  4LNQ A;  2JA8 H;  1VQJ A;  2HIV A;  2K5Q A;  4XYQ A;  2JA8 B;  4DR6 L;  3PIP A;  1RL2 A;  4KJO A;  1Q7Y C;  5K36 G;  3SVM A;  5C0X J;  1RIP A;  1UE1 A;  2AMC B;  1TY2 A;  4CJ0 B;  5LMN L;  4IPC A;  3NQI A;  2UUC Q;  2RF4 A;  2FIN B;  2BA1 A;  4DPG A;  5DM7 3;  4DV3 L;  3K5L A;  4DV4 L;  2ZXP A;  2R3Z A;  4MTK A;  1SYB A;  1K8A C;  2EXD A;  3DM3 A;  4CDC C;  2L11 A;  2TSS A;  1YJN A;  3FVQ A;  1N33 Q;  2AUJ D;  4CJ2 C;  4KKS A;  2L15 A;  1BCP C;  1MIU A;  1YNN D;  1J8I A;  1Y1W B;  1Y1W H;  1I4G A;  1ET6 A;  4GLV B;  2GVA A;  3EBE A;  3FDT A;  1I6V C;  1QZH A;  1STH A;  2V4D A;  4YCW A;  5H1S E;  4UHV A;  2ASB A;  2IWH A;  2VS1 A;  4YHH L;  1EYG A;  2K32 A;  3RLF A;  1ROD A;  4RCN A;  4IZ8 A;  3NTI A;  2VY3 A;  1EWI A;  1SNQ A;  2EYF A;  1NTG A;  1V9P A;  1JE5 A;  1IL8 A;  3AU7 A;  3KJO A;  1PRT C;  3BVM A;  4IPH A;  1PV4 A;  1CZG A;  5IE8 A;  4C56 C;  4LFC Q;  3E6Z X;  4GKJ Q;  2NVY B;  2NVY H;  2PZT A;  4HCE A;  2M9V A;  4GNX C;  2MQH A;  3QR8 A;  1S4Z A;  4PMW A;  1V1Q A;  1W6K A;  3H94 A;  3TBI B;  2BH2 A;  4YCU A;  2JA9 A;  1B7Y B;  3OWF A;  4EVO A;  1TS5 A;  3A5U A;  1SYF A;  3J7A 5;  1C4Q A;  4DUZ L;  2JQO A;  3H3V I;  1B53 A;  3VYS A;  3BU2 A;  2E5L L;  3OHX C;  1G6Z A;  1AN8 A;  1D5X C;  1HCZ A;  2F03 A;  4AIM A;  3A8J E;  4FXD A;  4HJ7 A;  1XJV A;  5C4J B;  5C4J H;  1EFW A;  1N8R C;  1AEX A;  3OYY A;  2VUM B;  3EIV A;  2VUM H;  4G4K A;  3E0J A;  4F87 A;  1I94 Q;  4M1U B;  3ER0 A;  2VQF L;  3NQT A;  2JA6 H;  4DR7 L;  3HOY B;  3HOY H;  1NCV A;  1G29 1;  1BNZ A;  3CC2 A;  4DNT B;  3I7F A;  4YY3 L;  4FF1 A;  4OO1 H;  1LV9 A;  3NTK A;  4A3M B;  4A3M H;  3LNN A;  3E3X A;  1ENA A;  3C3L A;  1LLR D;  2NBF A;  4K5V A;  4Y52 H;  5IOC A;  5C0X H;  4LWC A;  5IIF A;  1MGS A;  3A8K E;  2K04 A;  2AWO A;  2PQE A;  3OMC A;  1K8O A;  2ID0 A;  2F4V Q;  1STE A;  1CZW A;  4A3E B;  2EVB A;  1I4H A;  1O80 A;  2WAC A;  4JYA Q;  5ELF A;  1G8Z D;  5C6A A;  5JVG 3;  4R4Q A;  3X3M A;  2DJF C;  4JI5 L;  1S5B D;  5EPJ A;  3S24 A;  5C44 G;  4A3C G;  2HQL A;  2CWP A;  1A15 A;  4AQY Q;  4X64 L;  1SJH D;  2PI2 E;  4RGT A;  1IW7 D;  5M3F G;  3R93 A;  1KXL A;  1PH6 A;  3WOF A;  3I8Z A;  5CMD A;  1NUC A;  4IAL A;  2LMC B;  4IJL A;  5EAY A;  3TP5 A;  1JJC B;  2N55 A;  2Q2U A;  3GO5 A;  2KOL A;  4K8I A;  3MXU A;  1K3R A;  1WTX A;  1LUZ A;  1QVG A;  1U4L A;  1JIC A;  4AYB G;  4HTH A;  3PO3 B;  3PO3 H;  2D5D A;  2X6G A;  3U58 A;  3WDN A;  1BBU A;  1EZ6 A;  1F2Y A;  4NXN L;  5IYD G;  2UU9 Q;  2XNA C;  3B6Y A;  2PW5 A;  1B44 D;  3KF6 A;  1YHB A;  1MSG A;  3S1Q H;  1HNZ L;  1NSN S;  5E3F A;  1W3S A;  2GA4 B;  4X65 Q;  4RWS C;  2EJM A;  5K36 H;  2XSC A;  4JI7 L;  4GNX A;  3L0O A;  1ONL A;  1WCM B;  1WCM H;  4OEM B;  1PYB A;  3NPP A;  4OXP A;  4BBR G;  1A0I A;  2BE5 D;  1NAP A;  4LFA Q;  4HJ5 A;  4R4I A;  1VQE A;  3GTK B;  3FP9 A;  3UDI A;  3GTK H;  5J39 A;  5I6Y A;  1OXS C;  4JW0 A;  2L12 A;  5KYL A;  1JB3 A;  3S1R B;  3S1R H;  1SNC A;  4DR1 L;  3HEJ A;  1B70 B;  1IKM A;  2UUA L;  1SFO B;  1SFO H;  3TN2 A;  1NY4 A;  1PTO F;  4P75 A;  2NVX B;  1B4O A;  2LXK A;  2NVX H;  2R6G A;  4JOI C;  2DGY A;  2HHH L;  3BS1 A;  4A93 G;  3GTJ H;  1LTS D;  3KOJ A;  4ALP A;  5FOB B;  1DM0 B;  2ZJQ A;  3NBH B;  4QQB X;  4RMF A;  5CBA E;  1BF4 A;  2K75 A;  3MXN B;  4A3I B;  4A3I H;  4DR6 Q;  1JC7 A;  3V96 A;  1GHJ A;  3I73 A;  1T5X D;  4FNF A;  2B2U A;  1TWH H;  3KLS X;  1HXY D;  5LMN Q;  2EJF C;  1EU3 A;  1EYC A;  3BYY B;  4GOP C;  3EFX D;  3SK5 A;  2JN4 A;  3NE5 B;  4F88 A;  2ZT9 C;  4I65 A;  3SHL A;  2B2V C;  4DV3 Q;  1NJI C;  4DV4 Q;  3T1Y L;  3H09 A;  5C3E G;  3HOV G;  2M2L A;  3JAM c;  1EEI D;  1MSH A;  5HGT A;  5M3M G;  4DNR B;  3JC6 6;  3QG1 A;  2Q8T A;  3VDY A;  3X3N A;  1XTC D;  2HDM A;  4KHZ A;  3JAM L;  1EU4 A;  1FNV A;  4NDX A;  4A3F G;  2QIL A;  4Q5V A;  1B50 A;  3D6W A;  3L7Z C;  4DK6 C;  1C48 A;  1IYJ B;  3M4Q A;  3UI2 A;  5LL6 X;  4YHH Q;  1TY0 A;  4DGZ A;  1F2Z A;  3P20 A;  2DUD A;  4DFA A;  5IYB G;  4JV5 L;  3FHW A;  3NWT A;  2VXW A;  1CA6 A;  2VZA A;  2ZTC A;  4DR3 L;  4HSV A;  1B9M A;  4LUZ A;  4DV6 L;  5C3W A;  1LO5 D;  2Z1C A;  4XDX A;  4LF5 L;  1F9S A;  1PYS B;  3NHH A;  4DXG A;  3VYT A;  5JPM C;  3KDF B;  2Z9H A;  1O7Z A;  3J7Y W;  3CCR A;  3K7U C;  2EIF A;  3CXC A;  2K7V A;  1EYA A;  1GUW A;  4ID6 A;  4XT3 B;  3A74 A;  1OXV A;  4ZKB B;  3NK9 A;  4JI8 L;  5G3L D;  1VF7 A;  1GOZ A;  1LAC A;  1EOV A;  2K50 A;  1D1I A;  2L9H A;  4DUZ Q;  1YI2 A;  2B2W C;  3F2C A;  5FK9 C;  2E5L Q;  2EYH A;  2KBN A;  4PNY A;  1MKH A;  3TEH B;  3J81 j;  1KAB A;  1RDP D;  3CC4 A;  1CUK A;  4JOI A;  4K6L A;  3TDQ A;  2K5D A;  4GZY C;  2E75 C;  2MJ8 A;  1MD2 D;  1C8C A;  1K3B C;  2WP8 J;  2VQF Q;  1LTT D;  4BY7 G;  4DR7 Q;  1VQF A;  2QEX A;  3ULP A;  2NYZ D;  1PH8 A;  1I4Q A;  4AYB B;  4OWT B;  2WIN B;  1GD7 A;  4YY3 Q;  1IBM L;  3L3O C;  3VYR A;  1ESF A;  2PW7 A;  4ULL A;  5LMU L;  4B9X A;  4C3J G;  2DN8 A;  4GOP A;  1QNK A;  1ICF B;  5D14 A;  3ERS X;  2B2V A;  3DWA A;  2PZU A;  3SK6 A;  3CAM A;  2RSN A;  4JI5 Q;  3BVG A;  1KHI A;  4BBR B;  5JPN C;  4BBR H;  2D0O A;  2F0Q A;  3KBG A;  1T5E A;  4X64 Q;  1SYE A;  4X3S A;  1EIG A;  1WD1 A;  3G7L A;  1HUN A;  1L0W A;  3A56 A;  2EZV A;  1E24 A;  5FLM G;  1OTC A;  3U4V A;  4BY1 G;  4FXG C;  1CT1 D;  2F0P A;  4RCO A;  3BDC A;  3SK8 A;  1HJP A;  1HUM A;  2UXD L;  4JI1 L;  3EN2 A;  4OON A;  2CH4 W;  4IJH A;  2PYK A;  1PH1 A;  1XWE A;  3NTH A;  2OQ0 A;  1QVF A;  1H9K A;  1DOL A;  3BJU A;  4K0K L;  4ZK9 B;  3M85 A;  3DM1 A;  2F52 A;  1EQT A;  2R7Z B;  2R7Z H;  1NR2 A;  2EOT A;  3DXJ C;  4F7X A;  4NXN Q;  4A93 H;  2A68 C;  4A93 B;  4O2D A;  1J5E L;  1FR3 A;  3HKZ G;  4FYD A;  3OPO A;  1F77 A;  1TKW B;  2BCO A;  4P71 A;  1D6E C;  3K81 C;  1YIT A;  3H3V H;  1Q8K A;  3PUY A;  1L2F A;  1HNZ Q;  1H9M A;  3LX0 A;  4GLA C;  2PNH A;  1D2B A;  4C3H G;  4JI7 Q;  1Q8I A;  1YNX A;  3T4A C;  4P73 A;  3CD6 A;  1J6Q A;  5IYC H;  3NEL A;  3HRZ C;  4DAY A;  4U67 3;  1RTN A;  2B2W A;  5IWA L;  4X62 L;  1FL0 A;  1L1O C;  5C3E B;  3A5Z B;  1PTO D;  3L9A X;  5ISR A;  2E2J B;  1A62 A;  2O5J C;  3K57 A;  3F1Z A;  5M3M B;  5M3M H;  4RGO S;  3PO2 G;  2PO4 A;  4L8J A;  3KUP A;  2PQA B;  3MEF A;  1M90 C;  1SSO A;  5IP7 G;  2AQ1 B;  2MO1 A;  1G2S A;  4X3T A;  1E1T A;  5F2D A;  5J1Z A;  4DR1 Q;  1XMO L;  1VQI A;  2UUA Q;  1A6X A;  1Q81 C;  3BZK A;  4DV7 L;  3A8I E;  1RCV D;  4TVA B;  1F2L A;  4C3I G;  3I4O A;  4HIM A;  2HHH Q;  4LF8 L;  2HUG A;  4OGQ C;  2L5T A;  2ZTE A;  5FO8 B;  1WTW A;  2B2T C;  1GHK A;  4KJN A;  4MHE A;  1JOK A;  3STB D;  2ZJP A;  1PH2 A;  1JT8 A;  2EJG C;  1AZP A;  3GQB A;  1CKN B;  5E7N A;  4XT1 B;  5CV7 A;  2K1B A;  4KK7 A;  4UP9 A;  3GV6 A;  2A74 C;  1YJW A;  4QUC A;  4UDU C;  2ATW A;  1GJX A;  1JCK B;  1RJT A;  5BR8 L;  4TKO B;  1VQ4 A;  5J22 A;  1SNM A;  4JK1 C;  1HQR D;  1KRS A;  3T1Y Q;  4C1N K;  1ENF A;  2QW7 A;  1WTH A;  1VCI A;  2F0V A;  1KC8 C;  2KCC A;  1ZYR C;  1SEB D;  2K52 A;  3Q6S A;  2OF1 A;  2L0C A;  4K5W A;  1KDC A;  5LMN W;  1PZJ D;  1SBB B;  3OW2 A;  2IW3 A;  5M5Y B;  5M5Y H;  1U5K A;  1AFP A;  5E4X A;  1YNJ C;  4DUY L;  2ICI A;  3FMC A;  4ZKC B;  1WTP A;  1Z9F A;  2E2I B;  2E2I H;  4BY7 B;  4BY7 H;  1X3P A;  2RVL A;  3VR5 A;  3PIP 3;  3GTO B;  5IP9 G;  3GTO H;  4EGV A;  2A1A A;  4JV5 Q;  3I55 A;  4RA8 A;  2EYL A;  4PG3 A;  1E2V A;  3CKI B;  4DV6 Q;  2QGQ A;  4LF5 Q;  1YVC A;  2OTJ A;  3W2D A;  4N9T A;  4C3J B;  3RLO A;  4C3J H;  2R93 B;  2YYZ A;  2R93 H;  4UP8 A;  3KLR A;  3T51 B;  1L1O A;  5EKL A;  4CJ1 B;  4KV6 A;  3VR6 A;  1HR0 W;  3I70 A;  4KN4 C;  4JI8 Q;  1TT2 A;  4BBS B;  4V19 0;  4BBS H;  2K01 A;  4RGM A;  2B63 G;  4QB4 A;  2K03 A;  3I4N G;  1WTQ A;  3I2Z A;  1XPO A;  3J7A F;  3I56 A;  2E2H B;  2E2H H;  5GRO A;  4FF4 A;  1PXU A;  3NXW A;  4K8J A;  2LKV A;  3LWU A;  4RFB A;  2A69 D;  2E2D C;  4QMG A;  2EY5 A;  5FO7 B;  2N8N A;  2RBM A;  3CCQ A;  1VQ5 A;  1Y1V B;  1Y1V H;  2B2Y C;  3ND9 A;  4GN5 A;  1QUQ A;  4ABN A;  3E9I A;  4LW1 A;  5D3I B;  1MHW C;  1FGU A;  1IBM Q;  3PIO A;  2A6H C;  1Q90 A;  2OEO A;  4HIK A;  4FF3 A;  5J3B A;  4CKC A;  4A3G G;  5LMU Q;  2Q8I B;  1NMG A;  3UDF A;  3JAM E;  1STG A;  2KVM A;  2NN6 H;  4YWK A;  4N8F A;  1XNR L;  1HR0 L;  1KQS A;  2KQ3 A;  4U68 A;  2F0I A;  3I72 A;  2EY2 A;  2O4X A;  5IGC A;  4N8X 1;  4O1N A;  4JBW A;  3IRB A;  2N3S A;  2K5V A;  4KY5 A;  2I5L X;  4O42 A;  5EBD A;  3S2D H;  3S2D B;  2B8G A;  3W1B A;  4LF4 L;  3TS2 A;  2M00 A;  3MZ5 A;  2ES2 A;  2ZXO A;  2IX3 A;  2RKS A;  2HT1 A;  5IGE A;  4JI0 L;  2F0K A;  1TU2 B;  1EWC A;  5D65 A;  1UEA B;  4JI6 L;  4CGY B;  1TWA B;  3PO2 B;  1TWA H;  1TWC B;  1FNW A;  1KTK A;  1TWC H;  3KF6 B;  1RTO A;  2R61 A;  3PO2 H;  3HOU B;  2KJX A;  5HUR A;  4R4O A;  2F3I A;  2A6E C;  3EVQ A;  2R92 G;  3HOU H;  1A3T A;  5AJ3 L;  3RN5 A;  4JI3 L;  5M5W B;  5M5W H;  1S5C D;  5EQ0 A;  4JI1 Q;  2UXD Q;  5JJI A;  1G51 A;  1Y8O B;  1ZKO A;  5K5P A;  4C3I B;  4C3I H;  4K0K Q;  1NR4 A;  2K5H A;  4DK0 A;  1P8L A;  1PHJ A;  5HGQ A;  2CVR A;  2NZ1 D;  5G3L F;  1PH9 A;  2RQX A;  2IX0 A;  1J5E Q;  3J80 c;  3HS0 C;  3L2P A;  4OIJ A;  4K6D A;  2L55 A;  1HNW L;  3HOX G;  5JEA G;  1GUG A;  1Q12 A;  1BR9 A;  1XPU A;  3CU7 A;  5I9P A;  2A5H A;  2RA4 A;  4DKA C;  1R4Q B;  1PTO B;  1PTO H;  1KRT A;  2Z0S A;  1D5M C;  3K0X A;  3VR4 A;  1HFG A;  2D9U A;  1HTL D;  1CM9 A;  1IKL A;  1EY0 A;  2F0D A;  1PFS A;  1I4P A;  3HOW G;  1H9R A;  3J80 L;  4B3M L;  5C4X G;  4A75 A;  3LWE A;  5IWA Q;  4X62 Q;  1JE4 A;  4JVZ A;  4WOR A;  4HJ9 A;  4MZ9 A;  1AE2 A;  1EY7 A;  1VQ6 A;  2CW0 C;  4ME5 A;  4A3E H;  2MO0 A;  1HRJ A;  1C9O A;  3IKJ A;  2ZJR A;  4Y7N B;  4Y7N H;  3PF4 A;  3AQQ A;  5ELB A;  1TS4 A;  2K14 A;  1XMO Q;  4FF2 A;  2F0L A;  3TQY A;  4LFB L;  4DV7 Q;  1SMX A;  3MC0 B;  5IGF A;  4L5T A;  4OWX B;  3E5S A;  1GKH A;  4RAU C;  2VL6 A;  1LM0 A;  4GN4 B;  5COY A;  4LF8 Q;  5KND A;  4KHV A;  1KDA A;  2HIX A;  1TWG B;  1TWG H;  3AMU A;  3MA2 B;  4NW2 A;  3G4S A;  1VQM A;  1VQ8 A;  2E74 C;  4KN7 C;  4UAI A;  2KHI A;  2CQO A;  1GUT A;  1TWF B;  1TWF H;  1BDO A;  4K2K A;  1WTR A;  1KLG D;  1VQA A;  3ITP A;  1E1O A;  3CPF A;  4R9W A;  1SMY D;  4IUP A;  4X66 L;  1A63 A;  5BR8 Q;  5CYU A;  1VQ7 A;  1PFB A;  5KYI A;  4A3L G;  1G2T A;  1AE3 A;  1C7Y A;  3ERQ A;  4M8A A;  1U4M A;  5GAE C;  3W1G A;  3DUZ A;  1DZ1 A;  3NSW A;  4A3K G;  2K5W A;  2B8F A;  2DNC A;  4XTC S;  3BDL A;  2LS0 1;  4LUV A;  2B63 B;  2B63 H;  2WB1 G;  2L4N A; 
#chains in the Genus database with same CATH homology
 1O78 A;  4PQX A;  1JWM D;  5CBE E;  2HDL A;  4B08 A;  3BG3 A;  3DMU A;  1LT6 D;  5EGT A;  4QF4 A;  3FPU B;  1SXT A;  3V05 A;  5KNB A;  2XWJ B;  1EY4 A;  5EJW A;  4TQU S;  1WTO A;  5IGD A;  1V1O A;  3CQZ B;  2JP1 A;  4I7Z C;  4A3G B;  3K0Y A;  1Z6H A;  3F2U A;  2PCF B;  2DNE A;  3OMG A;  3VR2 A;  3I4L A;  4RGN A;  4L63 B;  3PUV A;  3U9S A;  3QWN A;  3SDZ A;  1H9S B;  1I50 B;  4IUV A;  1UNS A;  1HA5 A;  1QCB D;  3QB3 A;  1JOO A;  3D4W A;  1B3A A;  2ICE C;  3D4D A;  4KD4 A;  1IYU A;  2L1B A;  3NP8 A;  1UUP A;  1S5E D;  3OOC A;  1WTV A;  1YNN C;  3IFD A;  4QCL A;  1F9R A;  5EKI A;  3OW7 A;  2MGS A;  1H9J A;  1ZXT A;  1XX8 A;  4TRD A;  2CHB D;  1EY5 A;  1UAP A;  5C5M A;  1DXM A;  3G6J B;  1GUS A;  1I4X A;  5JEA H;  5KNC A;  3SR1 A;  3EJI A;  4KKU A;  1SNO A;  2VB2 X;  4ILW A;  2EYP A;  1FGB D;  1PMR A;  1LT5 D;  3HOW B;  2OT2 A;  4J1M A;  1STA A;  1V1P B;  4RHS A;  5C3X A;  2WKD A;  3K5O A;  2NB0 A;  2XN9 C;  2JEA I;  1U4P A;  5I2Y A;  4K14 A;  4IUN A;  4YIJ A;  5C44 B;  4FP5 D;  3QOJ A;  1ICW A;  1GUN A;  5M3F B;  4FVM A;  1Y69 U;  1Q1B A;  1QE6 A;  5CV4 A;  2X69 A;  1ML0 D;  1DON A;  1QG7 A;  3DEP A;  1OXT A;  3N6R A;  4PV1 C;  4KMU C;  3J81 L;  1TS2 A;  1II3 A;  5CV9 A;  3RD4 A;  3NBH A;  1SYC A;  4QUF A;  2F0O A;  3MXN A;  1RHP A;  5I9O A;  1SYG A;  4HSP A;  4IFD G;  1HPC A;  4C2M B;  5C0X I;  3GTM B;  4A3K B;  2BDN A;  4CKE A;  2I07 B;  2DY8 A;  2XVS A;  2WB1 B;  4ZYS A;  1IW7 C;  1BCP D;  3GV3 A;  5FLX L;  1RKN A;  2KHS A;  3SEB A;  2EYJ A;  2Y0S B;  5M9O A;  1XXG A;  3BVZ A;  3NUC A;  1SDF A;  2Z8L A;  4KY7 A;  4XIG S;  1PFN A;  3U9O A;  4MIU A;  2K6A A;  1SMY C;  5A2Q L;  5IGG A;  1LTA D;  1CQF A;  2PNR C;  1LTI D;  1PRT D;  2JYO A;  3TP7 A;  5BN5 A;  4WRD A;  5EKK A;  3TP8 A;  1QOH A;  2NUC A;  2O2L D;  3A55 A;  1VF5 C;  3SK4 A;  3V2T A;  3HZX A;  4ZRZ A;  3H3V C;  4DXF A;  2MP1 A;  3ND8 A;  3R2I A;  2PMZ B;  3BZD B;  2BE5 C;  4IN3 A;  4NKL A;  1KNA A;  1HFN A;  1EL0 A;  4DN4 M;  3MHB A;  1ILQ A;  2F1M A;  1LTB D;  1F9P A;  3WOE A;  5DEH A;  4DA2 A;  2EY6 A;  3J80 E;  1EQV A;  3TZD A;  3HOV B;  1Y8N B;  3Q23 A;  2LY7 A;  5CV8 A;  3IL8 A;  4J6H A;  5AFW A;  2JE6 I;  3A7A B;  4A3F B;  3CRL C;  3FPP A;  3FKI B;  2KCN A;  1JOR A;  1SYD A;  3Q0A A;  1Q1E A;  3NBI A;  4G7H C;  1KAA A;  5FKA C;  2D2C C;  4S3S A;  1M4V A;  3MXP A;  1FYC A;  3P75 A;  1PLF A;  1STY A;  3URY A;  4IUR A;  3T56 B;  4KI0 A;  3FRP B;  2HCI A;  4HMJ A;  5I2X A;  1LTG D;  2IT1 A;  3ONA B;  4HR7 B;  1DYQ A;  2K05 A;  2D62 A;  1OXX K;  3D6C A;  1HA6 A;  3EQL C;  4BWG B;  1EYD A;  2QEJ C;  2PPB C;  3K5N A;  1ILP A;  4WJW A;  2EYM A;  5KGU A;  4MN3 A;  5C0X G;  5KEE A;  5T1I A;  4BS9 A;  1U4R A;  1TII D;  1R4P B;  5ELC A;  1OXU A;  5CC4 A;  1JWS D;  1WD0 A;  1HHV A;  4FO2 A;  4KTA A;  3HP3 A;  1HQM C;  1RD9 D;  2F0F A;  2NWG A;  4IUU A;  5EBC A;  5JAV A;  2EPB A;  3QIA A;  4H7B A;  1BO0 A;  3C46 A;  4OL7 A;  2WV6 D;  2BOS A;  3N52 A;  4LK1 C;  4LMQ D;  1HTP A;  4NMZ A;  2EXZ A;  3K58 A;  4CBV A;  2FHT A;  1QB5 D;  3M7N A;  5CGK A;  2IL8 A;  1Y8P B;  4Q0F A;  5TSS A;  3T13 A;  5E1F A;  3CRK C;  1KLU D;  3I4N B;  1EEF D;  1E2W A;  3D8G A;  4DK1 A;  3ZYY X;  3PIO 3;  5ELE A;  3ERO A;  1EZ8 A;  3I90 A;  2IPK D;  3K7A B;  4BY1 B;  2MUY A;  2B2T A;  3RMH A;  2LFN A;  3OIQ A;  1XYI A;  3PUW A;  1F9Q A;  3M3Y B;  4G57 A;  2MPM A;  1PFM A;  3BDO A;  5IOD A;  1SE2 A;  3HKZ B;  4HN7 A;  1L0Y B;  3KBX A;  1BCP B;  2MHV A;  3T53 B;  1L0X B;  2AQ3 B;  2NTT A;  4C3H B;  4ODG A;  5DAU A;  2Z4I A;  3NWS A;  3DEO A;  3DWQ A;  5KIX A;  1R9T B;  3OIP A;  2TMP A;  1PRT B;  3W3A A;  4PMC A;  1F2M A;  1CA5 A;  3R2T A;  4R8I A;  1CI3 M;  5CR3 A;  1ET9 A;  3HG9 A;  1EY8 A;  2F0J A;  3P1H A;  2VB3 X;  4HMI A;  2FFK B;  3S15 B;  3TZU A;  5IGB A;  3Q24 A;  2B39 A;  5E4W C;  3EA6 A;  1FD7 D;  1ZEQ X;  1EY6 A;  2AQ2 B;  1I3Q B;  1QNU A;  3J81 E;  5EPK A;  2NTS A;  4RKB A;  4HAE A;  3RUZ A;  2XRQ D;  1PTO C;  2K28 A;  4OIK A;  1BQQ T;  1CFM A;  1SJE D;  4J8Q A;  1OO9 B;  1A3U A;  2JA6 B;  5LHY 1;  1FNU A;  3PV0 A;  3R3O A;  3GP7 A;  2EE1 A;  5KRU A;  3PUZ A;  4H13 C;  1AZQ A;  2ENB A;  2N88 A;  2F0T A;  2B2Y A;  5FLX E;  3I91 A;  5COR A;  5C5L A;  3K5M A;  2C9O A;  4DAV A;  1PDQ A;  2KED A;  3KK7 A;  2RDG A;  5M5X B;  2B2U C;  3TP6 A;  1BCP F;  1JOQ A;  1Q3L A;  3H91 A;  2SDF A;  1LT4 D;  4EQO A;  2WII B;  5CV5 A;  3J7A V;  1CHP D;  5A2Q E;  5JEA J;  1O7Y A;  1TR5 A;  1Z47 A;  1BOS A;  2F0N A;  5DNF A;  4RHR A;  5BN4 A;  1BUV T;  1CK1 A;  5IT9 L;  1SND A;  3QOL A;  2FJ2 A;  4NP5 A;  1PRT F;  1Z7T A;  4LJZ C;  4BA2 I;  2Z4H A;  1CQV A;  4HED A;  4RKL A;  2F0U A;  1A3V A;  1PZK D;  4ZAI A;  1K83 B;  2C5C A;  1IYV A;  2A68 D;  3S1Q B;  4IUQ A;  4WFN 3;  1I6H B;  4QIW B;  5I4D A;  1S5D D;  2F4I A;  1M8A A;  1SNP A;  1TQO A;  4XQJ A;  4IFD I;  2G9H D;  3MXG A;  3MTS A;  2EY1 A;  1V8Q A;  4DU9 A;  1VMC A;  3MFY A;  1EOT A;  1MI2 A;  3M4Y A;  1X32 A;  1QWY A;  3FEW X;  1EFI D;  1STN A;  1B1Z A;  3K59 A;  1WVL A;  4FXK C;  2J0T D;  4N9P A;  2KEE A;  3QJY A;  1E2Z A;  4CHT B;  3GTJ B;  2WKC A;  5LL6 S;  3MVV A;  1SE3 A;  4L6T B;  3GTP B;  1ENC A;  3I4M B;  4X3K A;  4XQN A;  2A69 C;  2F3V A;  2G9D A;  1PZI D;  3IFT A;  2NVT B;  1TWH B;  2R92 B;  2IJ0 A;  4XYO A;  3D3R A;  3VR3 A;  2QKI C;  3D4R A;  3MEH A;  3RZO B;  4EQN A;  3C2P A;  2KEC A;  4DF7 A;  4XQQ A;  2F0W A;  1BBX C;  3HOX B;  1CTM A;  4H44 C;  2KUM A;  1U9R A;  4ZUI A;  2NN6 I;  1ZYR D;  1EWH A;  1QIL A;  1DJR D;  1DCZ A;  4R8N A;  3S9W A;  3A54 A;  1S5F D;  4XXE A;  5C4X B;  4TSS A;  1YNJ D;  3H6M A;  2A73 B;  4C1N I;  3GTL B;  5JOB A;  4KY6 A;  2FMC A;  4DAP A;  2EDG A;  1I4R A;  1KDB A;  1O7L A;  1JWU D;  4KKT A;  3S2H B;  3PMF A;  3OSO A;  3C1E A;  1G91 A;  4OHJ A;  3TME A;  4X3U A;  1CHQ D;  3DHQ A;  1B9N A;  1QJO A;  1E0B A;  2YU9 B;  1ESR A;  2IX1 A;  1IHZ A;  2XIW A;  2K33 A;  3R8B A;  1JQY D;  3MAQ A;  4F8M A;  4OO1 I;  2VNU D;  2F3W A;  3C1F A;  2NVQ B;  1PYW D;  1H9S A;  3GTQ B;  2SNM A;  4ZUJ A;  5FO9 B;  2H1E A;  2QDB A;  1LTR D;  2WAQ B;  3HOZ B;  2A6H D;  1W6J A;  3MWY W;  3GD7 A;  2BA0 A;  1AP0 A;  2DY7 A;  4K2L A;  2JA5 B;  2QCP X;  5A35 A;  3BYT B;  3SXH A;  1A2T A;  2I46 A;  2F0S A;  2SEB D;  2BDO A;  4A3B B;  3IAY A;  5C4Z A;  3SE0 A;  3TSS A;  2X6L A;  1A2U A;  1SE4 A;  1AW7 A;  4G7O C;  4A3J B;  2F0M A;  1TVX A;  4IUT A;  1B2T A;  4PMB A;  5I6W A;  1GXD C;  5EPL A;  3Q22 A;  2F0E A;  3S14 B;  4G7Z C;  1LT3 D;  2A6E D;  2XWB B;  3T16 A;  1BXT A;  4ZLT F;  3VA7 A;  2Q8R E;  4IFD J;  3AB9 A;  1V1P A;  5BN3 A;  1K8M A;  1D5Z C;  2J7Z A;  1MBY A;  2NN6 G;  5NUC A;  2H4O A;  1SAP A;  4KD3 A;  3A7L A;  1TS3 A;  3MFG A;  3CHB D;  1DOM A;  4HCS A;  1V43 A;  4Z9C B;  3I3C A;  3M7G A;  5D3D A;  4EQP A;  5C4H A;  3KF8 A;  5JVH 3;  1GUO A;  4CKB A;  3P7J A;  3HGB A;  2J4X A;  1EY9 A;  1VDZ A;  1STB A;  3M4O B;  1EIH A;  3RZD B;  4E6I A;  2CW0 D;  5JJZ A;  5DM6 3;  2RDH A;  4RH6 A;  2AUK A;  2FMM A;  2JA7 B;  3PUX A;  2F0G A;  3GTG B;  4ZQ3 A;  3VYU A;  3VA5 A;  2OXP A;  4BA1 I;  4A3D B;  3S16 B;  3K6O A;  3QO2 A;  1VMP A;  2O5I C;  4OO1 G;  5IT9 E;  4IQZ A;  2SOB A;  1J9O A;  1X3Q A;  2QF7 A;  1D1K A;  2KA7 A;  5ELD A;  2JSO A;  5CV6 A;  2JXM B;  2AWN A;  1JR0 D;  1RF2 D;  2HQE A;  2ZXR A;  2RDF A;  2CQA A;  4P2C B;  2E76 C;  1DOK A;  2XRS D;  3H0G B;  3S1N B;  2SNS A;  2EYO A;  2F0H A;  4V0B A;  4IFD H;  3DWP A;  4LAA A;  1DD2 A;  1LAB A;  3O13 A;  2HCC A;  3S17 B;  1KNE A;  2RSO A;  3KLS A;  2JEB I;  4B9W A;  3OWE B;  2PZW A;  4H0L C;  3S1M B;  3D31 A;  5T1G A;  4K5X A;  2JA8 B;  4XYQ A;  2K5Q A;  4KJO A;  5K36 G;  3SVM A;  5C0X J;  1TY2 A;  4CJ0 B;  3NQI A;  2FIN B;  2BA1 A;  5DM7 3;  3K5L A;  2ZXP A;  2R3Z A;  1SYB A;  2L11 A;  2TSS A;  3FVQ A;  2AUJ D;  4CJ2 C;  4KKS A;  1BCP C;  1YNN D;  1J8I A;  1Y1W B;  1I4G A;  1ET6 A;  3FDT A;  1I6V C;  1STH A;  2V4D A;  2IWH A;  2K32 A;  3RLF A;  1ROD A;  4RCN A;  4IZ8 A;  3NTI A;  1SNQ A;  2EYF A;  1IL8 A;  3AU7 A;  1PRT C;  3BVM A;  1CZG A;  4C56 C;  3E6Z X;  2NVY B;  2PZT A;  4HCE A;  2M9V A;  1S4Z A;  4PMW A;  1W6K A;  3H94 A;  3TBI B;  3OWF A;  4EVO A;  1TS5 A;  1SYF A;  1C4Q A;  1B53 A;  3VYS A;  1G6Z A;  3OHX C;  1AN8 A;  1D5X C;  1HCZ A;  2F03 A;  3A8J E;  4FXD A;  5C4J B;  1AEX A;  2VUM B;  4G4K A;  3E0J A;  4F87 A;  4M1U B;  3NQT A;  3HOY B;  1NCV A;  1G29 1;  1BNZ A;  4DNT B;  4FF1 A;  4OO1 H;  1LV9 A;  3NTK A;  4A3M B;  3LNN A;  3C3L A;  1ENA A;  1LLR D;  2NBF A;  4K5V A;  5IOC A;  5C0X H;  5IIF A;  1MGS A;  3A8K E;  2K04 A;  2AWO A;  2PQE A;  3OMC A;  1K8O A;  2ID0 A;  1STE A;  1CZW A;  4A3E B;  2EVB A;  1I4H A;  1O80 A;  2WAC A;  5ELF A;  1G8Z D;  5C6A A;  5JVG 3;  3X3M A;  5EPJ A;  1S5B D;  1A15 A;  1SJH D;  4RGT A;  1IW7 D;  3R93 A;  3WOF A;  3I8Z A;  5CMD A;  1NUC A;  4IAL A;  2LMC B;  3TP5 A;  2N55 A;  3GO5 A;  2KOL A;  4K8I A;  3MXU A;  1WTX A;  1U4L A;  1JIC A;  4HTH A;  3PO3 B;  2D5D A;  2X6G A;  3WDN A;  1EZ6 A;  1F2Y A;  2XNA C;  2PW5 A;  1B44 D;  1MSG A;  1NSN S;  5E3F A;  2GA4 B;  4RWS C;  2EJM A;  5K36 H;  2XSC A;  1ONL A;  1WCM B;  3NPP A;  2BE5 D;  1NAP A;  3GTK B;  5J39 A;  5I6Y A;  1OXS C;  2L12 A;  5KYL A;  1JB3 A;  3S1R B;  1SNC A;  3HEJ A;  1IKM A;  1SFO B;  3TN2 A;  1PTO F;  2NVX B;  1B4O A;  2R6G A;  3BS1 A;  1LTS D;  5FOB B;  1DM0 B;  5CBA E;  1BF4 A;  4A3I B;  1JC7 A;  3V96 A;  1GHJ A;  3I73 A;  1T5X D;  4FNF A;  2B2U A;  3KLS X;  1HXY D;  2EJF C;  1EU3 A;  1EYC A;  3BYY B;  3EFX D;  3SK5 A;  3NE5 B;  4F88 A;  2ZT9 C;  4I65 A;  3SHL A;  2B2V C;  3H09 A;  2M2L A;  1EEI D;  1MSH A;  5HGT A;  4DNR B;  3QG1 A;  2Q8T A;  3X3N A;  1XTC D;  2HDM A;  4KHZ A;  3JAM L;  1EU4 A;  1FNV A;  4NDX A;  2QIL A;  4Q5V A;  1B50 A;  3D6W A;  3L7Z C;  1C48 A;  3UI2 A;  5LL6 X;  1TY0 A;  4DGZ A;  1F2Z A;  3P20 A;  4DFA A;  3NWT A;  2VXW A;  1CA6 A;  4HSV A;  1B9M A;  5C3W A;  1LO5 D;  2Z1C A;  4XDX A;  1F9S A;  3NHH A;  4DXG A;  3VYT A;  5JPM C;  1O7Z A;  3J7Y W;  2K7V A;  1EYA A;  1GUW A;  4ID6 A;  4XT3 B;  1OXV A;  4ZKB B;  3NK9 A;  5G3L D;  1VF7 A;  1GOZ A;  1LAC A;  1D1I A;  2L9H A;  2B2W C;  5FK9 C;  2EYH A;  4PNY A;  1KAB A;  1RDP D;  4K6L A;  3TDQ A;  2K5D A;  4GZY C;  2E75 C;  2MJ8 A;  1MD2 D;  1C8C A;  2WP8 J;  1LTT D;  2NYZ D;  1I4Q A;  4AYB B;  2WIN B;  3L3O C;  3VYR A;  1ESF A;  2PW7 A;  4ULL A;  4B9X A;  4C3J G;  2DN8 A;  1QNK A;  5D14 A;  2B2V A;  3DWA A;  2PZU A;  3SK6 A;  2RSN A;  3BVG A;  5JPN C;  4BBR B;  2F0Q A;  3KBG A;  1T5E A;  1SYE A;  4X3S A;  1EIG A;  1WD1 A;  3G7L A;  1HUN A;  3A56 A;  2EZV A;  4FXG C;  1CT1 D;  2F0P A;  4RCO A;  3BDC A;  3SK8 A;  1HUM A;  2PYK A;  1XWE A;  3NTH A;  1H9K A;  1DOL A;  4ZK9 B;  3M85 A;  3DM1 A;  1EQT A;  2R7Z B;  1NR2 A;  2EOT A;  3DXJ C;  4F7X A;  4A93 B;  2A68 C;  1FR3 A;  4FYD A;  3OPO A;  1F77 A;  1TKW B;  2BCO A;  1D6E C;  3PUY A;  1H9M A;  3LX0 A;  1D2B A;  4C3H G;  1Q8I A;  3T4A C;  3HRZ C;  4DAY A;  4U67 3;  1RTN A;  2B2W A;  5C3E B;  1PTO D;  3L9A X;  5ISR A;  2E2J B;  2O5J C;  3K57 A;  5M3M B;  4RGO S;  2PO4 A;  4L8J A;  3KUP A;  1SSO A;  2AQ1 B;  1G2S A;  4X3T A;  5F2D A;  5J1Z A;  1A6X A;  3A8I E;  1RCV D;  1F2L A;  4C3I G;  2HUG A;  4OGQ C;  2L5T A;  5FO8 B;  1WTW A;  2B2T C;  1GHK A;  4KJN A;  4MHE A;  1JOK A;  2EJG C;  1AZP A;  3GQB A;  4XT1 B;  5CV7 A;  2K1B A;  4KK7 A;  3GV6 A;  2A74 C;  4QUC A;  4UDU C;  1GJX A;  1JCK B;  1RJT A;  4TKO B;  5J22 A;  1SNM A;  4JK1 C;  1HQR D;  4C1N K;  1ENF A;  1VCI A;  2F0V A;  2KCC A;  1ZYR C;  1SEB D;  3Q6S A;  2OF1 A;  2L0C A;  4K5W A;  1KDC A;  1PZJ D;  1SBB B;  2IW3 A;  5M5Y B;  1AFP A;  5E4X A;  1YNJ C;  2ICI A;  3FMC A;  4ZKC B;  1WTP A;  2E2I B;  4BY7 B;  1X3P A;  2RVL A;  3VR5 A;  3PIP 3;  3GTO B;  4EGV A;  4RA8 A;  2EYL A;  1E2V A;  3CKI B;  3W2D A;  4N9T A;  4C3J B;  2R93 B;  2YYZ A;  3KLR A;  3T51 B;  5EKL A;  4CJ1 B;  4KV6 A;  3VR6 A;  3I70 A;  4KN4 C;  1TT2 A;  4BBS B;  4V19 0;  4RGM A;  2K01 A;  4QB4 A;  2K03 A;  1WTQ A;  3J7A F;  2E2H B;  4FF4 A;  1PXU A;  3NXW A;  4K8J A;  2LKV A;  3LWU A;  4RFB A;  2A69 D;  2E2D C;  4QMG A;  2EY5 A;  5FO7 B;  2RBM A;  1Y1V B;  2B2Y C;  3ND9 A;  4ABN A;  5D3I B;  2A6H C;  1Q90 A;  2OEO A;  4FF3 A;  4CKC A;  2Q8I B;  3JAM E;  1STG A;  2KVM A;  2NN6 H;  2KQ3 A;  4U68 A;  2F0I A;  3I72 A;  2EY2 A;  2O4X A;  5IGC A;  4O1N A;  4JBW A;  4KY5 A;  4O42 A;  5EBD A;  3S2D B;  2B8G A;  2M00 A;  3MZ5 A;  2ZXO A;  2IX3 A;  2RKS A;  5IGE A;  2F0K A;  1TU2 B;  1EWC A;  5D65 A;  1UEA B;  4CGY B;  1TWA B;  3PO2 B;  1TWC B;  1FNW A;  1KTK A;  1RTO A;  2R61 A;  3HOU B;  2KJX A;  5HUR A;  2A6E C;  3EVQ A;  1A3T A;  5M5W B;  1S5C D;  5EQ0 A;  1Y8O B;  1ZKO A;  5K5P A;  4C3I B;  1NR4 A;  4DK0 A;  2CVR A;  2NZ1 D;  5G3L F;  2RQX A;  2IX0 A;  3HS0 C;  4OIJ A;  4K6D A;  2L55 A;  5JEA G;  1GUG A;  1Q12 A;  1BR9 A;  3CU7 A;  5I9P A;  2A5H A;  2RA4 A;  1R4Q B;  1PTO B;  1PTO H;  1D5M C;  3VR4 A;  1HFG A;  2D9U A;  1HTL D;  1CM9 A;  1IKL A;  1EY0 A;  2F0D A;  1I4P A;  1H9R A;  3J80 L;  3LWE A;  1JE4 A;  4WOR A;  1EY7 A;  2CW0 C;  4ME5 A;  1HRJ A;  3IKJ A;  4Y7N B;  5ELB A;  1TS4 A;  4FF2 A;  2F0L A;  3MC0 B;  5IGF A;  3E5S A;  4RAU C;  5COY A;  5KND A;  4KHV A;  1KDA A;  1TWG B;  3AMU A;  3MA2 B;  4NW2 A;  2E74 C;  4KN7 C;  4UAI A;  1GUT A;  1TWF B;  1BDO A;  4K2K A;  1WTR A;  1KLG D;  3ITP A;  4R9W A;  1SMY D;  4IUP A;  5CYU A;  1PFB A;  5KYI A;  1G2T A;  3ERQ A;  4M8A A;  1U4M A;  3DUZ A;  1DZ1 A;  3NSW A;  2K5W A;  2B8F A;  2DNC A;  4XTC S;  3BDL A;  2LS0 1;  2B63 B;  2L4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...