5EQ0A

Crystal structure of chromodomain of cbx8 in complex with inhibitor unc3866
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
55
structure length
55
Chain Sequence
GERVFAAEALLKRRIRKGRMEYLVKWKGWSQKYSTWEPEENILDARLLAAFEERE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/transcription inhibitor
molecule keywords Chromobox protein homolog 8
publication title A cellular chemical probe targeting the chromodomains of Polycomb repressive complex 1.
pubmed doi rcsb
source organism Homo sapiens
total genus 11
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2015-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5eq0A00
3I90A 5T1GA 1KNEA 1EQTA 2MPMA 2FHTA 2X6GA 5EPLA 1TVXA 3I91A 1IKMA 1PLFA 2FFKB 3DEPA 3MTSA 5EKIA 1ZXTA 2KECA 2L11A 3GV6A 4RAUC 1F2LA 3I8ZA 1ILQA 1F9PA 4U68A 3N52A 1ICWA 2MP1A 5D14A 1EL0A 1HUMA 5T1IA 4RWSC 1BF4A 5AFWA 4MHEA 2NZ1D 4QUFA 2B2YA 1DOMA 4IUQA 5EQ0A 2Q8TA 1O7YA 4X3TA 3IFDA 4X3UA 3TZDA 4X3KA 1AP0A 1B4OA 3TN2A 4HAEA 1JE4A 2K05A 4HCSA 3F2UA 5EPKA 1WTVA 1X3PA 3H91A 1CA5A 1EIGA 1S4ZA 1VMCA 2B2VC 4HEDA 1AZPA 1JICA 1RHPA 2IL8A 3MWYW 2B2WC 2Q8RE 1J8IA 1O7ZA 1ILPA 1MSHA 2B2UC 3D6WA 1RTNA 4IUUA 4IUPA 4ZLTF 1X32A 1BO0A 1G6ZA 2XIWA 1QNKA 1PFBA 4HSVA 2K28A 3KBXA 5DNFA 1AZQA 1MGSA 3G7LA 1WD1A 1A15A 5EPJA 2RSOA 1IL8A 1DONA 4OIKA 1C8CA 4X3SA 1CM9A 1BNZA 1PDQA 1XYIA 4UAIA 2KUMA 1E0BA 2NYZD 1RODA 2L12A 3LWEA 2B2TC 2J7ZA 1DOKA 1ML0D 2KEDA 1EOTA 1HFGA 2EOTA 4CJ2C 1MSGA 5JJZA 1WTQA 1GUWA 1SDFA 4NW2A 1HA6A 4QUCA 2FMMA 2EE1A 1VMPA 2DY7A 3FDTA 1HUNA 1PFMA 1XX8A 2X6LA 3HP3A 4O42A 4ZKCB 1NCVA 3IL8A 5CBEE 2H1EA 2M2LA 4CJ1B 2HCIA 1WTOA 1B53A 1PFNA 2K04A 2K01A 2DY8A 1ESRA 3UI2A 1U4MA 2EPBA 1SSOA 1WD0A 1QG7A 1CA6A 1G2SA 3FPUB 5CMDA 3R93A 1B3AA 2L1BA 1RTOA 1U4RA 2NWGA 3P7JA 2JYOA 2R3ZA 3GV3A 1MI2A 1RJTA 1BBXC 1NR2A 1B2TA 1G2TA 2B2YC 4XDXA 1EIHA 4RA8A 1HHVA 1DOLA 2N88A 1LV9A 3I3CA 4XT3B 2B2UA 4R9WA 4DN4M 4IUVA 1QE6A 2X69A 1HRJA 1O80A 1X3QA 2FJ2A 2KEEA 5CBAE 1HFNA 1F9RA 1SAPA 2HDMA 2JP1A 1KNAA 5D65A 2VXWA 3DEOA 1WTWA 4IURA 1F9SA 3DM1A 4XT1B 4ZK9B 5CORA 1Q3LA 4LMQD 1U4PA 3QO2A 2KOLA 2N55A 4ZAIA 4CJ0B 1WVLA 1F9QA 1B50A 1G91A 2K03A 2SDFA 2RSNA 1J9OA 1WTXA 3ONAB 2HDLA 4IUTA 3KUPA 2BDNA 2KVMA 4MN3A 2D9UA 2B2TA 4OIJA 4R8IA 1M8AA 2FINB 3SVMA 4ZKBB 2B2VA 5COYA 5E4WC 5E4XA 1U4LA 3Q6SA 5EJWA 2B2WA 2MJ8A 2MGSA 1NAPA 2L9HA 1IKLA 1NR4A 2CVRA 2HUGA 2K1BA 2L4NA 1WTRA 1WTPA 2HCCA 2RVLA 1DZ1A 2RA4A
chains in the Genus database with same CATH superfamily
4YWLA 3MHBA 1EZ6A 4PV1C 2JK8A 2WIIB 4X64Q 1ICFB 1VS0A 2F0LA 3N52A 2JA7B 5T1IA 1TR5A 1S5FD 3MXNB 4RWSC 3H0GG 1DOMA 2EJMA 4OL7A 2VQFL 4A93B 4A3JB 1KAAA 3S24A 5C6AA 3GTPH 1YNJD 2F3WA 3OHXC 1ENFA 2QW7A 3KOJA 3OWEB 5LMUQ 4O1NA 3F2DA 4L5TA 4R4CA 5KRUA 3H6MA 2Q2UA 2EXDA 4JW0A 5LMNQ 2VS1A 4WRDA 3GTOB 5EAYA 3X3MA 1C8CA 4FF2A 4R1JA 3EROA 3S2HB 3H09A 3J7YW 1TT2A 1SRUA 2XSCA 1X3EA 1HPCA 2A6HC 1MKHA 1K83H 3R2TA 3RMHA 4A3KB 5M5WB 4O42A 4K8JA 1LTTD 4K6LA 1DCZA 3K5MA 4PMWA 2RQXA 4QMGA 2PPBC 5HGQA 2F0OA 4IZ8A 1SYEA 3M4PA 2V4DA 2R7DA 5C0XG 3GV3A 1Q12A 4HJ5A 2ZM6L 2XWBB 5C0XH 1EWHA 4AYBE 3PMFA 2B2UA 3HOXB 1X3GA 2FJ2A 4DR3Q 3D4DA 4JI4Q 2I07B 5LHY1 3DEOA 4KHPL 2R92B 4KY6A 1GD7A 1VQHA 1TS5A 1YNJC 3M7GA 1I94Q 3NBHB 2ZJQA 1SE3A 1EWCA 4QGUA 3PO2B 1WCMG 1WCMH 1SBBB 3VDYA 3V05A 5EJWA 1CKNA 1Q81C 3GTQH 5IY0A 1TY2A 4JI3L 2YTXA 4FDBA 1R4QB 1VQJA 3E0EA 2F0MA 1TWFH 2ATWA 2JA8G 2RA4A 2OEOA 4IALA 3TSSA 2N3SA 1SROA 3J80E 4XYQA 1ZXTA 5FK9C 3TP8A 3TS0A 3GV6A 1Q7YC 1XJVA 4TQUS 2JA5B 3I8ZA 2QEXA 4F87A 2NZ1D 3W2DA 4QUFA 3Q23A 2B2YA 1RIPA 4JI2Q 3NHHA 1V1OA 4X3KA 2NVYB 3J80i 4J1MA 3AQQA 4ZYSA 1QCBD 2QF7A 2K05A 2K14A 5D3DA 4TVAB 3LNNA 5I9OA 1ZEQX 4KV6A 4DV3Q 4IQZA 2IL8A 5ELEA 1NNXA 4IPGA 4UP8A 1IZ6A 2AWNA 4IUUA 1P16A 1A2TA 1Q8IA 2BA0A 4OONA 4XQQA 4L5QA 2E74C 4QIWB 3T53B 3K5NA 1QUQA 3MAQA 4L5RC 2IX3A 2H5XA 4DR2L 4JI0Q 4GOPA 1XYIA 4C3IB 2L12A 3V2TA 2BH8A 3BVGA 3NBIA 1SXTA 1BCPB 2Y0SG 4NW2A 5M3MG 5M3MH 3J7A5 2R7ZB 1NCVA 2NTSA 3RLOA 3CCUA 2GN5A 1VQKA 3J7ZC 2RDHA 2K6AA 1CKOA 1U0LA 2UXDL 5CMDA 2VW9A 2PZTA 3S1MH 1A3VA 1O7LA 1U4RA 1G2TA 1B2TA 2UU9L 1PTOB 4JG2A 1LT3D 5C4JH 1HHVA 5C4XG 1PMRA 4RCNA 2E2DC 5CR3A 1F2ZA 5C4XH 2WB1B 2I0QA 1JB3A 4DAMA 1CSQA 1IBKL 4XTCS 2Q8IB 5LL6X 4S3SA 3DM1A 4CDCC 2IJ0A 1FD7D 1XMQL 3EFXD 4C1NK 2F0TA 4B08A 2FMCA 3CD6A 2E75C 1YNND 1OXXK 2I5MX 3PV0A 5IGFA 2B2VA 4KKTA 3W1GA 3K7AH 3TP6A 3AMUA 4NKLA 1J5EL 1EY6A 4HSPA 1SR3A 5C44B 3CC2A 3ULLA 2MPMA 4YHHL 2FHTA 3G71A 3UDIA 1GUGA 1VQEA 4OEMB 2L11A 1IBML 2WAQB 2AHOB 3J81E 5M5XB 2A6ED 1YNXA 4DR6Q 5JJIA 1W3SA 4MHEA 1PXUA 4N8X1 3I2ZA 1BCPD 4F8MA 1VQ4A 1B4OA 2XVSA 3FEWX 2RKSA 4P74A 3TDQA 3H3VI 3MZ5A 3ICEA 1JE4A 3GQBA 2NZOA 2KHJA 4JOIC 4GKKL 3CC4A 3I4NG 3GTLH 5C4HA 3MA2B 3RZOH 3I4NH 1Y69U 5M3FB 2ZXOA 3OIQA 3K80C 3OIPA 2CFMA 1E1OA 1SFOB 1MJCA 1WYDA 3U9OA 4DAPA 1PTOD 2E8GA 2KCTA 1QOHA 2QGQA 2A5HA 1BVSA 2ENBA 4OIKA 3A5ZB 3D31A 1B9NA 3L9AX 2EYFA 1EU3A 1NSNS 4KK7A 1E2VA 1B1ZA 4DAYB 1TXYA 3EBEA 1YNNC 3OPOA 2ZT9C 4A3DB 4JBJA 4X65L 2XTIA 4MTKA 2X6LA 1G91A 1I50B 3EJIA 3H94A 2WV6D 3BJUA 3A74A 2JA7G 2F4IA 1EEID 2GA4B 2JA7H 3L2PA 2NWGA 3RUZA 4DV2L 4A93G 3TS2A 3HOVB 4A3JG 1W2BA 4A93H 1BCPC 3VYUA 4A3JH 2KCNA 3VYRA 1X3QA 1S3OA 4DV6Q 1F9SA 2UXCL 1FJGQ 3CCRA 1Q3LA 5EBDA 3FP9A 3DWPA 5D3IB 2CKZB 3HG9A 2SDFA 2RSNA 4BBRB 4M1UB 4IUTA 4RG1A 3S2DB 1FGBD 5AJ3Q 3SVMA 1PTOC 5COYA 4FXKC 4MZ9A 5IP9G 2UXBQ 4YCWA 5IP9H 3S2HH 2L4NA 2K1BA 3GTPB 1I4RA 4IN3A 3PF5A 2X6GA 1XWEA 1CQVA 3MTSA 1EYAA 3VR6A 1HR0L 5IE8A 4Y52H 4A3KG 5L37A 4A3KH 3ITPA 5M5WH 5IWAL 2GVAA 4DA2A 4AIMA 3C46A 3PO3B 1KXLA 1BF4A 3TQYA 1O7YA 2R6GA 2PMZB 4WORA 3KF8B 4JC0A 2VQFQ 4TSSA 2QDBA 5E7NA 4C1NI 2LSSA 1K83B 5IIFA 3BVMA 1Z6HA 3HOXG 3CQZH 4CKBA 1Q86C 3AU7A 3HOXH 3HFZB 4DK3C 1MSHA 2ES2A 4CKEA 1HNXL 2ZTDA 2R92G 3HZXA 4LJZC 2R92H 1E7ZA 1PTOF 2CH4A 4HMIA 5G3LF 5GQOA 4HIMA 2WP8J 3PO2G 3WWVA 2JE6I 1CM9A 3PIO3 3PO2H 5BR8L 1STNA 4A3FH 3IAYA 1QWYA 1FVIA 1JCKB 4OELB 4CJ2C 5JPNC 1OXTA 4IFDG 1GVPA 3A55A 1VQDA 2DY7A 4HJ8A 1HUNA 1HZCA 3CCEA 1NBWA 2KHIA 4P71A 2K04A 3U9SA 2JA5G 2O5IC 2E2IB 1SMYD 1WCMB 4OWXB 2JA5H 2OCEA 2E2HB 1N34L 2JXMB 2NN6I 4HJ9A 3VR4A 2L1BA 3A0JA 1NR2A 2ZM6Q 2N88A 3I70A 1TWFB 1N32L 3GTMB 2NZHA 1QE6A 1R4PB 3CCQA 5DM73 2ID0A 4L63B 3T13A 4KHPQ 1XNRL 2LKVA 3T1HL 2OT2A 4WJ3M 1IBLL 1AEXA 2K52A 5IGGA 2RBMA 1VQ7A 2HDLA 1VQMA 2B2TA 2Q2TA 2CHBD 2K5WA 2VUMB 3DXJC 2EDGA 4JI3Q 2EYOA 2B63B 2F0FA 3G4SA 2D0OA 1AE2A 1NE3A 1CHPD 3I4MG 1IKMA 4J6HA 3I4MH 4KJNA 3HRZC 5J22A 1ILQA 2MP1A 1UEBA 2H4OA 4K5XA 2Z1CA 4M8AA 3IFDA 4HAEA 4I7AA 4CHTB 1SMYC 1N33Q 1X3PA 1CA5A 1A0IA 2IX1A 1LTID 5K36G 1NY4A 4UP7A 1PTOH 2KCCA 2Y0SB 2RCFA 3NSWA 2WB1G 5M3MB 1J8IA 3URYA 2XRSD 4DK1A 1JJCB 1JWSD 4J8QA 3SK8A 5GROA 1BO0A 4LF8Q 4R8NA 1X54A 5KYLA 1EFID 4LW1A 1GUNA 3I56A 3S1MB 1QJOA 1LM0A 3T4AC 1WOCA 2YV5A 1WFQA 3A7AB 5IT9c 3BZCA 4DR2Q 1K8MA 1RODA 4OO1G 5CV5A 1I6VC 4OO1H 1EOTA 4JI8L 1GUWA 4O2DA 5C44G 3PCOB 5JJKA 1GUOA 5C44H 1NMGA 4A75A 4ABNA 1LABA 3J81c 1D5ZC 3HP3A 2WAQG 2HCIA 1PH1A 5EGTA 1EY7A 2IHEA 3A5UA 1BBWA 1ESRA 5M5XH 1K9MC 1SSOA 2MHVA 1Y8NB 1N36L 1G51A 1E1TA 2ZXRA 3K7AB 1RD9D 4KLKA 2UU9Q 1DOLA 2AKWB 3VA5A 4RHRA 1PYSB 2I46A 4LUOA 3NTIA 1JJ2A 4XYOA 2HDMA 1WTWA 5M3FG 4LMQD 5M3FH 3MFYA 2K5DA 4ZUIA 1K3BC 1SNMA 4C56C 1F9QA 1SFOH 1XMQQ 2AMCB 2NB0A 3KUPA 3IKJA 3VA7A 1DYQA 1NMFA 5E4XA 4UY8C 3MEFA 1VQCA 1MIUA 1PZID 1J5EQ 3GTLB 1WTPA 3KF6B 1S40A 3I4NB 2HCCA 5M5YB 2VB2X 2AQ1B 3S1QB 2EY1A 4A3DG 4YHHQ 1PZJD 1HR0W 2RHSB 2KECA 3JAMc 3BVZA 1IBMQ 3K58A 1MJEA 4DV4L 1HTPA 3CPWA 4NXML 1HZAA 1V1PA 4JVZA 1IYVA 1HTLD 4EQOA 2A6HD 4HCSA 5EPKA 3CCJA 1GKHA 1S4ZA 4OWTB 5I9PA 1I4HA 3HOVG 4GKKQ 4DNRB 1GUTA 3HOVH 2Q8RE 5CGKA 2BE5C 4ZQ3A 1LT5D 1D1KA 3A8JE 1TS3A 3ER0A 4A3GB 3AEVA 4IFDI 5FLXc 4DKAC 1E22A 1PH3A 4BBRG 1VQPA 2SEBD 3Q24A 4BBRH 3S2DH 5HGTA 4DGZA 2EY5A 1NTGA 2PQAA 2J7ZA 1HZ9A 3OMGA 3C2PA 5KNCA 5EKLA 1TWGH 4LK1C 4X65Q 5K5PA 4APVA 4ZKCB 1PH2A 2F0EA 4RGMA 5CBEE 1K3RA 2IT1A 1SYBA 1FGUA 4LAAA 2DY8A 4QJFA 4GNXA 1U4MA 4F88A 5IGBA 3OOCA 3F8TA 3PO3G 2VL6A 1VQAA 5C3EH 3FKIG 3PO3H 1LLRD 2OQ0A 1EIFA 3NELA 2K50A 3FKIH 1RTOA 1BBXC 2AWOA 3WOFA 3PIOA 2PI2A 4DV2Q 4XT3B 1B7YB 2NBFA 4C3JH 1EUJA 2X69A 1CTMA 1O80A 2OTLA 5FOBB 1K8AC 5DAUA 1TWAB 3FPPA 4IURA 4ZK9B 1BQQT 1IYJB 3NP8A 2UXCQ 1ENAA 5GAGC 1EY5A 1DGSA 3W3AA 3J81L 1Y1VB 3KLWA 3U4ZA 3DM3A 5J1ZA 2CCZA 2Q2HA 2D9UA 3KDFA 3GO5A 5IODA 2PYKA 1S5CD 4CKCA 4DR7L 1U4LA 3D0FA 4LF9L 4IFDJ 2MJ8A 1C48A 1NR4A 3CQZB 5JAVA 1PVOA 2RCNA 3I90A 5CC4A 1HR0Q 4BY7G 2N8NA 1HCZA 1EYDA 3M4YA 5D14A 5IWAQ 4BY7H 2ICEC 4FXGC 3BS1A 4KMUC 5CV6A 1HQRD 2E2IH 2D62A 1KRTA 1XPUA 1DONA 4A3FB 5I6YA 1X65A 1AP0A 1XTDA 2E2HH 2CQOA 1FNUA 4DFAA 2E2JB 4FXDA 3HOWB 4EVOA 3VR2A 1K0SA 1RHPA 2F0IA 2HHHL 2LXJA 1A6XA 3HKZE 4JI1L 3ZJYC 4DUYL 5BN3A 3RNUA 3GTMH 3M4OB 4UPAA 3SE0A 1YIJA 4QIWE 1FL0A 2EY2A 3B6YA 4HN7A 2HQLA 4N9TA 1MGSA 3OYYA 4K2LA 2V1CC 1J6QA 4IOAA 2BCOA 5IGDA 5BR8Q 5DM63 2VUMG 4J15A 2MQHA 2M00A 5JPMC 1DOKA 2UUBL 2VUMH 1CHQD 4Y7NH 4POGA 2J0TD 1LTSD 4LFBL 2B63G 4G7HC 2B63H 1YHAA 2EE1A 1HH2P 1S5ED 3IL8A 4CJ1B 2VQEL 3MXUA 3NEMA 4IOCA 1CT1D 4DV7L 1SNCA 1AN8A 1X3FA 3R93A 1N34Q 4K0KQ 1L1OB 4NB3A 4DK0A 4V190 1MI2A 4A3EH 5KNDA 1H9SB 2KJXA 1N32Q 4DN4M 4GOPC 2BA1A 4UHVA 1BUVT 5CBAE 4K5VA 3I4MB 3MXNA 3VR5A 4WFN3 2IPKD 2L5TA 1NUCA 5JVG3 3E5SA 2WINB 3QG1A 3FVQA 1EYGA 1XNRQ 4NP5A 5I4DA 3T1HQ 1IBLQ 2R93B 3S1NH 1CZGA 4ID6A 1SNPA 1CZWA 3Q6SA 3VR3A 1TWHH 1UAPA 1F77A 1EYCA 2MUYA 2RVLA 3QJYA 1Q90A 1V43A 5EPLA 1TVXA 3M7NA 4KI0A 2XN9C 1SYDA 4B3MQ 4ZUJA 5JOBA 1A2UA 1HUMA 2F1MA 1D7QA 4TKOB 4GKJQ 3TZDA 2G5DA 3D4WA 1ET6A 3X3NA 1VQOA 4KTAA 1EIGA 2F0WA 1QVCA 2B2VC 1UWVA 3G6JB 5IT9E 2P5ZX 2Z9HA 4B9WA 4FF4A 2RDGA 4NPSA 3KK7A 1L2FA 1Z47A 3A56A 2GVBA 3CF5A 1PFBA 2SNSA 1T5EA 3MVVA 5DNFA 2BDOA 1VF5C 2NVXH 2CH4W 3KJPA 1A15A 1CUKA 1IL8A 2RSOA 4X3SA 1PDQA 4BS9A 4FF3A 3A7LA 1IYUA 2NYZD 1KLUD 3J81i 2SNMA 3QIAA 1HFGA 4JK1C 4JI8Q 3E9IA 4LFAL 1CI3M 4CGYB 3NBHA 4JPBW 1WTHA 2A73B 4K2KA 1LTLA 1VMPA 5J3BA 5M5YH 1BXTA 3CCMA 4BWGB 3T1YL 3CMEA 3S1QH 4A3IB 3M9BA 1WTOA 2EQSA 2WKCA 1FYCA 3UI2A 1WD0A 1G2SA 4JBWA 4ALPA 1EQVA 1YBYA 1N36Q 4JOIA 4FF1A 4PZ7A 5I6WA 4GZYC 3CP0A 3CRKC 2NVQB 2EYJA 4PZ6A 4R9WA 2ASBA 3M3YH 1C0AA 1LT4D 5C0XI 5A35A 1F9RA 2JP1A 3AFQA 4X64L 2IW3A 1DXMA 1U4PA 3UDFA 4ZAIA 3JAME 4A3GG 3AYHB 1HNWL 4IJHA 3NPPA 4A3GH 3ONAB 1L1OC 4NXNL 4N8FA 1TKWB 3W1BA 2QCPX 1I3QH 1Y1WG 3RZDH 2B2WA 1UE7A 1Y1WH 3ERQA 2DNEA 2EYPA 5FO9B 3CCLA 2LXKA 4LF5L 4JYAL 1JORA 2J4XA 3UE1A 5J39A 1JC7A 2PMZE 5LMNL 1F9PA 1O7IA 2YTVA 4DV4Q 4OWWB 5FLXE 5KGUA 2B8FA 3HEJA 4LF4Q 4ZKBB 2QKIC 3RD4A 3K0XA 4KD3A 4X3TA 1C7YA 4NXMQ 3TN2A 3V96A 1L0XB 3H91A 1V9PA 4LUVA 5A2QL 1TWGB 1SYFA 3J81j 3S1RH 3Q0AA 4YWKA 5HURA 2WFWA 3NK9A 2C5CA 4ZLTF 2BOSA 3E3XA 1TWAH 2XIWA 1YHQA 4P72A 2F0NA 5C3EB 1Y1VG 5C0XJ 2R7FA 3G7LA 3FKIB 1Y1VH 1BNZA 1YHBA 1BCPF 3K5OA 4YY3L 4PG3A 4L8JA 4C3JB 1N8RC 1ML0D 2KEDA 1YEZA 1Y14B 1MSGA 1VQ5A 3A8KE 2PQEA 4HJ7A 1RF2D 2M2LA 2PNHA 3E6ZX 2OWOA 4F7XA 4QY7A 4C3HB 3QR8A 3GTGH 4AQYL 1EY8A 3HKSA 2Z6KC 4A3FG 1KTKA 3OMCA 2JYOA 1HZBA 5HY6A 4XDXA 4RA8A 1K73C 3HOWG 4KJOA 3RN2A 2E2JH 3PUZA 2VY3A 4LFCL 3HOWH 3CRLC 1I6HB 5JEAG 3K7UC 5JEAH 3CCVA 1KRSA 4R4TA 2N78A 4FYDA 3M4OH 4BY7B 1YI2A 1H9KA 1SNOA 1I4XA 2OQKA 2I5LX 2HIVA 4Q0FA 1D8LA 3S15B 5GAHC 4DUZL 1B3QA 5ELBA 4DR7Q 1PYBA 4LF9Q 4GS3A 4LF6L 2FXQA 1NAPA 1JOOA 2CVRA 4HMJA 1U5KA 1H9JA 1A3UA 2A1AA 4I7ZC 3D4RA 1Y8OB 1UE6A 1KNEA 1F2MA 3KLRA 4KN4C 4A4IA 1RDPD 3SR1A 4JV5L 2KHSA 4AYBG 2CW0C 4B3RL 2YU9H 1F2LA 4A3BB 4HIKA 1EY4A 2AQ2B 4DAYA 2LMCB 3J7AF 1MBYA 4H7BA 1X56A 1XPOA 4X3UA 4MTNA 1WJJA 2Y0SE 5E1FA 3SK5A 3HOUH 1BDOA 1PZKD 1II3A 2L0CA 4Y7NB 4A3MG 1HXYD 1WTVA 2OTJA 2F3IA 1Q82C 2NVTH 3R3OA 1JWUD 4A3MH 2PI2E 4EQ5A 1AZPA 2HHHQ 4Z9CB 4JI1Q 4DUYQ 3CPFA 4A3CG 1X6OA 4A3CH 3NWSA 5IGEA 2K33A 1VQIA 4BXXH 1WD1A 3BYTB 4GN5A 1TS4A 4L6TB 1PH5A 3KFUA 2R93G 2R93H 4OGQC 4A3EB 3MFGA 3GDEA 2ALYB 5KEEA 2KUMA 3D3RA 1AE3A 4TRDA 4PMCA 5FO8B 1YJNA 4G7OC 5ELOA 2R61A 1CKMA 2UUBQ 3STBC 1SDFA 1KIXA 1TY0A 2K7VA 4LFBQ 4QUCA 1EWIA 4MIUA 3C1FA 1PFMA 4HIDA 4BA2I 5I2XA 4RHSA 1UE1A 3QOJA 3S1NB 2VQEQ 4ZRZA 2EPBA 2EJFC 4DV7Q 2SOBA 1JE5A 1TWHB 3M85A 3SDZA 4GNXB 1HJPA 3LX0A 1EIHA 1EY9A 3LWUA 3OW7A 4DPGA 4DR1L 5A2QE 1JOKA 2HT1A 1OO9B 2ICIA 5IYCG 3PSIA 1QVGA 3DMUA 5IYCH 2KENA 5EKKA 3S16H 3H3VC 2IWHA 1ZYRC 1L0WA 1JJGA 3DHQA 3TMEA 1SNDA 5IGCA 1M90C 2K03A 1WTXA 1ASZA 1TS2A 1Q46A 4MN3A 1PH4A 3RLNA 4KKSA 2UXDQ 3ULPA 3Q8DA 4H44C 1VQBA 2BE5D 1A3TA 2NTTA 3D8GA 3JC66 1WTRA 1AH9A 3TP5A 3S17B 4KKUA 1VF7A 1IBKQ 3SHLA 5LMNW 1EIYB 4A3IG 3BZKA 2JA6B 2NVXB 1ICWA 3DWAA 4A3IH 3EIVA 5KIXA 4P2CB 1IW7C 2Q8TA 5FJ8G 5FJ8H 3BDCA 3GP7A 1U9RA 4H02A 4X6AH 4DNTB 3KLSA 3S9WA 4DR5L 2LFNA 3HOZG 2PNRC 3SK4A 3HOZH 2NVQH 1R9TB 1E2WA 4Q5VA 3EN2A 1CKNB 5I2YA 4XQNA 3D6WA 1EOVA 1RTNA 1N9WA 2UUAL 1QNKA 4AH6A 3SK6A 1JQYD 5JJLA 2KBNA 1E24A 2HQEA 3NTHA 4BY1H 2VNUD 3NWTA 4JBMA 3GD7A 1HA5A 2WKDA 3M3YB 3LWEA 1D5MC 2F0VA 3PUXA 3U58A 4K14A 4DV1L 4JI6L 1K0RA 4ILWA 4LFAQ 1HA6A 3CW2C 1DJRD 1BBUA 4X62L 4EQNA 2D5DA 4DU9A 3HOYB 1Y8PB 4ODGA 5C4ZA 1B53A 4KY7A 1PFNA 2HD3A 2JJQA 1ASYA 1VCIA 3K59A 1CA6A 1I3QB 1XXGA 3RZDB 1Y1WB 2R3ZA 1B70B 1PRTB 1RJTA 2RHQB 5FO7B 2ZJPA 1STYA 1G8ZD 1QB5D 4FNFA 3L0OA 1QUQB 3VYTA 1HFNA 1LACA 4PMBA 5FKAC 4GOPB 2UUCL 4LWCA 3NENA 4POFA 5BN4A 1STAA 3BG3A 5IYBG 2F4VL 1HNWQ 3P1HA 4BBSB 5IYBH 1STGA 3H0GH 3ZYYX 5C3EG 4NXNQ 4GNXC 2E5LL 3KJOA 2LY7A 2Z8LA 1PA6A 4C3JG 2IHFA 4ULLA 3S1RB 5IT9L 1PH8A 1EQTA 1EU4A 2DJGC 2RF4A 2F0PA 4K6DA 2MO1A 4DXGA 4JYAQ 4LF5Q 1PLFA 1QNUA 4YCUA 4B3SL 1KC8C 5CV4A 3H3VH 1I4GA 1VQLA 1UE5A 3CHBD 5JVH3 1XPRA 3D6CA 3EVQA 1XMOL 3PQIA 1GHKA 1I5FA 1TWCB 4C3HG 1H95A 1XTCD 5ELDA 5GAEC 2EYMA 4C3HH 3PUVA 5JEAJ 1CSPA 1SJED 3G6EA 1STEA 1CFMA 4DAVA 1O7ZA 2B2UC 4FVMA 4IUPA 1I6HH 3K5LA 3FMCA 1X32A 1SN8A 3PUYA 3OTOL 2EYHA 1PRTD 3G48A 1W6KA 2K28A 3KBXA 4IPHA 1JMCA 4LF7L 5F2DA 1LTRD 3J7AV 2Q2IA 3GTGB 2L15A 1C4QA 1Q8KA 3GTKH 1VQ9A 4R4QA 3CU7A 4X66L 3W5OA 3N6RA 2F3VA 4PZ8A 4ME5A 4YY3Q 3S15H 4G57A 3K57A 4DNIA 1XNQL 1B44D 4HCEA 1K8OA 2EOTA 4GLXA 1P8LA 2FMMA 1PH7A 4OO1I 4JI7L 5BN5A 1GOZA 5ELNA 2C35B 1A63A 1HNXQ 4YCVA 4PNYA 4A3BG 2CWPA 4A3BH 3JAML 1HNZL 4YIJA 1UUPA 3KF6A 5NUCA 2HIXA 4AQYQ 4KD4A 1NJIC 2B2YC 1D2BA 2A69D 1LV9A 2CQAA 1QVFA 3T51B 4QL5A 4WJWA 4LFCQ 2JA8H 2QA4A 3RN5A 1SAPA 2Z0SA 4AYBB 3KYHC 2YU9B 2JN4A 1B9MA 3QO2A 2OXPA 3TBIB 1WVLA 1EZ8A 1ENCA 5C3XA 2BDNA 4R8IA 5FLXL 4KHZA 4P75A 4HR7B 1O78A 1N33L 3HOUB 1PRTC 2PO4A 1H9RA 2WB1E 3ERSX 1EEFD 4DUZQ 4A3EG 2NVTB 4A3MB 5KNBA 2K32A 4LF6Q 1BR9A 3MEHA 5CV8A 4YWMA 5EBCA 2XRQD 2O2LD 3A8IE 3DEPA 3I91A 1M1KC 4XXEA 4JV5Q 1OXSC 4LF8L 4O0AA 4B3RQ 4QQBX 4EGVA 3NXWA 3HKZB 4U68A 2JQOA 3OSOA 1D5XC 4OX9L 2Z4IA 1A62A 2PZWA 4IUQA 3HGBA 5E3FA 1OXUA 3GTJB 2K5VA 3Q22A 1X9NA 1PYWD 2EXZA 4CDFC 1JICA 3MWYW 2WAQE 2G9HD 4FO2A 4DV5L 1KDBA 1ILPA 1RL2A 2A69C 4WJ4A 4C2MH 3VYSA 4G7ZC 3MC0B 1RKNA 1PRTF 4HSVA 1AZQA 1LUZA 4GLVB 3E0JA 5EPJA 1JT8A 3BZDB 1GJXA 2CWAA 2QILA 2LS01 2L55A 1S72A 1LTAD 4UAIA 3HS0C 4DV0L 5C5LA 1YJ9A 1MHWC 1V8QA 3S16B 4IJLA 2ZXPA 4JI5L 1EFWA 4DR4L 1AFPA 4KY5A 4B3TL 3S17H 2F0UA 1FNVA 2F0JA 1Q1EA 1SYCA 4EQPA 2F0DA 2NN6G 2NN6H 2JA6G 1GM5A 1QG7A 2JA6H 2EVBA 2Z6BA 1SEBD 1B3AA 3PUWA 3T16A 1LYLA 4K8IA 2F52A 4HIOA 3K8AA 1JOQA 1JWMD 4DR1Q 4IUVA 1OXVA 1VDZA 4QB4A 2VXWA 3KLSX 1R9TH 4IPDA 1LTGD 4RFBA 2N49A 3O13A 3DWQA 4RMFA 2N55A 3TP7A 3NUCA 2B8GA 4H13C 1IHZA 1CK1A 1H9MA 2A74C 3PIP3 4JCVE 4DK6C 3I7FA 2MGSA 3HOZB 3OW2A 2DN8A 1YZ6A 5H1SE 3U4VA 1DZ1A 5T1GA 1VQFA 4RCOA 2DJFC 1UNSA 3WDNA 1VQ8A 3C1EA 1QZGA 1T9HA 2PW5A 3HOYG 2F0HA 4FP5D 3HOYH 5G3LD 1SLJA 1GUSA 5EQ0A 4BY1B 1GO3E 1YVCA 1Z7TA 2JEBI 3TREA 2F0KA 4GN3B 2EZVA 3UDGA 4R4OA 1STHA 2K5NA 3I72A 4HEDA 3JAMi 4DR5Q 3PGZA 2B2WC 1SE8A 1K28A 4XIGS 1SE2A 5LMUL 1QILA 4R4IA 3CC7A 4PQXA 1KD1C 2K4KA 3UE0A 5LL6S 1F2YA 2TMPA 1IXRA 1A8VA 1L0YB 1L1OA 4JBKA 2UUAQ 1DM0B 1H9SA 3F2BA 2PZUA 3OWFA 3ND9A 2ZJRA 2A6EC 4BBSG 1KL9A 4V0BA 4BBSH 2RDFA 4IUNA 2QDLA 3LGJA 3K81C 1E0BA 4XQJA 3S14B 4UDUC 3QOLA 2F0SA 5JJZA 2XWJB 5CYUA 1TIID 2G9DA 4DV1Q 4JI6Q 1UEAB 1B8AA 3BDLA 3CKIB 1BOSA 2K5HA 3BU2A 3K6OA 4X62Q 1ET9A 4KN7C 5GADC 2XNAC 4LNQA 3H0GB 1TU2B 5C3WA 1KDCA 4LUZA 3GTOH 1MD2D 3IFTA 1EY0A 1X55A 1TWCH 2DGYA 4HJAA 3TEHB 3H15A 2CW0D 4DR3L 4JI4L 2KEEA 1KNAA 1M4VA 1I4QA 2UUCQ 2KQ3A 2O4XA 4XT1B 4A76A 1EQRA 3TRZA 3R8BA 3DUZA 1I94L 4CJ0B 1B50A 3ND8A 2F0QA 2F4VQ 2JEAI 3SEBA 4OIJA 3P75A 1M8AA 2FINB 2A68D 1E3PA 4IO9A 4RH6A 5TSSA 5IP7G 2A8VA 2E5LQ 5IP7H 3L7ZC 1G291 2L9HA 1T5XD 5ISRA 5DLQE 2C9OA 1SJHD 2OF1A 2FFKB 5EKIA 1BKBA 3T56B 1VQNA 4HTHA 2O5JC 3CAMA 1PH9A 4RAUC 2B39A 3IRBA 4B3SQ 1RCVD 3BYYB 2Z6KA 2NUCA 3GTKB 1Z9FA 1ZKOA 5IOCA 4JI2L 4NMZA 2MFIA 4L5SA 1XMOQ 3NE5B 3EA6A 3CMAA 3F2UA 5DEHA 3STBD 4MNOA 4DV3L 4GN4B 2M9VA 3J80c 4CBVA 4NDXA 4DF7A 4IFDH 4EX5A 1FR3A 1LTBD 3U50C 1G6ZA 1AW7A 4RGNA 3OTOQ 3CCSA 1PV4A 3CXCA 4RKLA 4LF7Q 4K0KL 2F03A 2IX0A 1SE4A 4P73A 1S5DD 3GTQB 4JI0L 4X66Q 3HOUG 2NVYH 2B2TC 4RKBA 4G4KA 1V1PB 1XNQQ 2JA8B 1WTQA 4K5WA 2A68C 1KAWA 3NQIA 1ZYRD 3I73A 4IPCA 1SMXA 4UP9A 4CDEC 4OHJA 4JI7Q 2H1EA 3UDXA 4A3LG 3HKZG 2K01A 4A3LH 4BXXG 4GLAC 2TSSA 3I55A 1HNZQ 4KHVA 4E6IA 3C3LA 3P7JA 5CV7A 3WOEA 4QF4A 4DXFA 5CV9A 2F0GA 4C3IG 2AUJD 3GTJH 2JSOA 4C3IH 2PW7A 3R2IA 4ME3A 3NTKA 2EIFA 3E9HA 4B3ML 3BDOA 2PQAB 5CORA 3SXHA 2R7ZG 3P20A 1IW7D 2KA7A 1FNWA 2KOLA 2R7ZH 1PH6A 4I65A 1S5BD 2ZTCA 4GKJL 5IYDG 3I4OA 3I4LA 4OXPA 4CDDC 5IYDH 1D1IA 5E4WC 2BH2A 1E2ZA 3TZUA 3S14H 2EY6A 3SGIA 1DD2A 4ZCKA 2YTYA 1OTCA 5K36H 2KCMA 1QZHA 2A19A 2EYLA 3AFPA 4H0LC 2EJGC 2DUDA 4C2MB 1G6PA 5ELCA 3A54A 2I5HA 5FLMG 4DR6L 2QEJC 3PF4A 3KF8A 3M4QA 5FLMH 2PCFB 1EL0A 2AQ3B 2K75A 4OX9Q 5AFWA 2WACA 5ELFA 2AUKA 5C4JB 3QB3A 1Q1BA 1LO5D 5C4XB 1I4PA 3MXGA 4RGOS 3PIPA 1V1QA 1VMCA 3KDFB 1KHIA 1IL2A 4DV5Q 3KBGA 2IY5B 3FRPB 3NQTA 2DNCA 1ONLA 1GXDC 3ULJA 2K5QA 1PHJA 1LT6D 3K0YA 1JR0D 4B9XA 2E76C 4U673 5M9OA 1GHJA 3L3OC 4DV0Q 1KABA 2YYZA 2VZAA 4JI5Q 1W6JA 4DR4Q 3F1ZA 3J80L 1YITA 3FDTA 4B3TQ 1XX8A 3MXPA 2B3GA 2VB3X 2D0PA 1KLGD 4N9PA 1JB7A 1SNQA 3FPUB 1KQSA 2D2CC 4BY1G 1CQFA 3RLFA 2JA9A 2B29A 1C9OA 3AB9A 3I3CA 3DLLA 3RZOB 1VQGA 1HRJA 2XGTA 1KDAA 2MO0A 4DV6L 4A3DH 5D65A 3RR5A 3EQLC 1FJGL 1HQMC 1WI5A 1YJWA 2Z4HA 3T1YQ 5KYIA 1I50H 3F2CA 1K8GA 4LF4L 3QWNA 1J9OA 1SYGA 1EQQA 1TQOA 5AJ3L 2KVMA 4RGTA 4BA1I 4QCLA 1ESFA 3FHWA 2MNAA 2UXBL 2ZTEA 1IKLA 2HUGA 1VQ6A 1PFSA 1D6EC 5C5MA 1STBA
chains in the Genus database with same CATH topology
3MHBA 1EZ6A 4PV1C 2WIIB 2F0LA 3N52A 2JA7B 5T1IA 1TR5A 1S5FD 4RWSC 1DOMA 2EJMA 4OL7A 4A93B 4A3JB 1KAAA 5C6AA 1YNJD 2F3WA 3OHXC 1ENFA 3OWEB 4O1NA 5KRUA 3H6MA 4WRDA 3GTOB 3X3MA 1C8CA 4FF2A 3EROA 3S2HB 3H09A 3J7YW 1TT2A 2XSCA 1HPCA 2A6HC 3R2TA 3RMHA 4A3KB 5M5WB 4O42A 4K8JA 1LTTD 4K6LA 1DCZA 3K5MA 4PMWA 2RQXA 4QMGA 2PPBC 2F0OA 4IZ8A 1SYEA 2V4DA 5C0XG 3GV3A 1Q12A 2XWBB 5C0XH 1EWHA 3PMFA 2B2UA 3HOXB 2FJ2A 3D4DA 2I07B 5LHY1 3DEOA 2R92B 4KY6A 1TS5A 1YNJC 3M7GA 1SE3A 1EWCA 3PO2B 1SBBB 3V05A 5EJWA 1TY2A 1R4QB 2F0MA 2RA4A 2OEOA 4IALA 3TSSA 3J80E 4XYQA 1ZXTA 5FK9C 3TP8A 3GV6A 4TQUS 2JA5B 3I8ZA 4F87A 2NZ1D 3W2DA 4QUFA 3Q23A 2B2YA 3NHHA 1V1OA 4X3KA 2NVYB 4J1MA 4ZYSA 1QCBD 2QF7A 2K05A 5D3DA 3LNNA 5I9OA 1ZEQX 4KV6A 4IQZA 2IL8A 5ELEA 2AWNA 4IUUA 1A2TA 1Q8IA 2BA0A 4XQQA 2E74C 4QIWB 3T53B 3K5NA 3MAQA 2IX3A 1XYIA 4C3IB 2L12A 3V2TA 3BVGA 3NBIA 1SXTA 1BCPB 4NW2A 2R7ZB 1NCVA 2NTSA 2RDHA 2K6AA 5CMDA 2PZTA 1A3VA 1O7LA 1U4RA 1G2TA 1B2TA 1PTOB 1LT3D 1HHVA 1PMRA 4RCNA 2E2DC 5CR3A 1F2ZA 2WB1B 1JB3A 4XTCS 2Q8IB 5LL6X 4S3SA 3DM1A 2IJ0A 1FD7D 3EFXD 4C1NK 2F0TA 4B08A 2FMCA 2E75C 1YNND 1OXXK 3PV0A 5IGFA 2B2VA 4KKTA 3TP6A 3AMUA 4NKLA 1EY6A 4HSPA 5C44B 2MPMA 2FHTA 1GUGA 2L11A 2WAQB 3J81E 5M5XB 2A6ED 4MHEA 1PXUA 1BCPD 4F8MA 1B4OA 2XVSA 3FEWX 2RKSA 3TDQA 3MZ5A 1JE4A 3GQBA 5C4HA 3MA2B 1Y69U 5M3FB 2ZXOA 3OIQA 3OIPA 1SFOB 4DAPA 3U9OA 1PTOD 1QOHA 2A5HA 2ENBA 4OIKA 3D31A 1B9NA 3L9AX 2EYFA 1EU3A 1NSNS 4KK7A 1E2VA 1B1ZA 1YNNC 3OPOA 2ZT9C 4A3DB 2X6LA 1G91A 1I50B 3EJIA 3H94A 2WV6D 2F4IA 1EEID 2GA4B 2NWGA 3RUZA 3HOVB 1BCPC 3VYUA 2KCNA 3VYRA 1X3QA 1F9SA 1Q3LA 5EBDA 3DWPA 5D3IB 3HG9A 2SDFA 2RSNA 4BBRB 4M1UB 4IUTA 3S2DB 1FGBD 3SVMA 1PTOC 5COYA 4FXKC 2L4NA 2K1BA 3GTPB 1I4RA 4IN3A 2X6GA 1XWEA 1CQVA 3MTSA 1EYAA 3VR6A 3ITPA 4DA2A 3C46A 3PO3B 1BF4A 1O7YA 2R6GA 2PMZB 4WORA 4TSSA 2QDBA 4C1NI 1K83B 5IIFA 3BVMA 1Z6HA 4CKBA 3AU7A 1MSHA 4CKEA 3HZXA 4LJZC 1PTOF 4HMIA 5G3LF 2WP8J 2JE6I 1CM9A 3PIO3 1STNA 3IAYA 1QWYA 1JCKB 4CJ2C 5JPNC 1OXTA 4IFDG 3A55A 2DY7A 1HUNA 2K04A 3U9SA 2O5IC 2E2IB 1SMYD 1WCMB 2E2HB 2JXMB 2NN6I 3VR4A 2L1BA 1NR2A 2N88A 3I70A 1TWFB 3GTMB 1QE6A 1R4PB 5DM73 2ID0A 4L63B 3T13A 2LKVA 2OT2A 1AEXA 5IGGA 2RBMA 2HDLA 2B2TA 2CHBD 2K5WA 2VUMB 3DXJC 2EDGA 2EYOA 2B63B 2F0FA 1CHPD 1IKMA 4J6HA 4KJNA 3HRZC 5J22A 1ILQA 2MP1A 2H4OA 4K5XA 2Z1CA 4M8AA 3IFDA 4HAEA 4CHTB 1SMYC 1X3PA 1CA5A 2IX1A 1LTID 5K36G 1PTOH 2KCCA 2Y0SB 3NSWA 5M3MB 1J8IA 3URYA 2XRSD 4DK1A 1JWSD 4J8QA 3SK8A 1BO0A 4R8NA 5KYLA 1EFID 1GUNA 3S1MB 1QJOA 3T4AC 3A7AB 1K8MA 1RODA 4OO1G 5CV5A 1I6VC 4OO1H 1EOTA 1GUWA 1GUOA 4ABNA 1LABA 1D5ZC 3HP3A 2HCIA 5EGTA 1EY7A 1ESRA 1SSOA 2MHVA 1Y8NB 2ZXRA 3K7AB 1RD9D 1DOLA 3VA5A 4RHRA 2I46A 3NTIA 4XYOA 2HDMA 1WTWA 4LMQD 3MFYA 2K5DA 4ZUIA 4C56C 1SNMA 1F9QA 2NB0A 3KUPA 3IKJA 3VA7A 1DYQA 5E4XA 1PZID 3GTLB 1WTPA 3I4NB 2HCCA 5M5YB 2VB2X 2AQ1B 3S1QB 2EY1A 1PZJD 2KECA 3BVZA 3K58A 1HTPA 1V1PA 1IYVA 1HTLD 4EQOA 2A6HD 4HCSA 5EPKA 1S4ZA 5I9PA 1I4HA 4DNRB 1GUTA 2Q8RE 5CGKA 2BE5C 4ZQ3A 1LT5D 1D1KA 3A8JE 1TS3A 4A3GB 4IFDI 2SEBD 3Q24A 5HGTA 4DGZA 2EY5A 2J7ZA 3OMGA 3C2PA 5KNCA 5EKLA 4LK1C 5K5PA 4ZKCB 2F0EA 4RGMA 5CBEE 2IT1A 1SYBA 4LAAA 2DY8A 1U4MA 4F88A 5IGBA 3OOCA 1LLRD 1RTOA 1BBXC 2AWOA 3WOFA 4XT3B 2NBFA 2X69A 1CTMA 1O80A 5FOBB 5DAUA 1TWAB 3FPPA 4IURA 4ZK9B 1BQQT 3NP8A 1ENAA 1EY5A 3W3AA 3J81L 1Y1VB 5J1ZA 5IODA 2D9UA 3GO5A 2PYKA 1S5CD 4CKCA 1U4LA 4IFDJ 2MJ8A 1C48A 1NR4A 3CQZB 5JAVA 3I90A 5CC4A 1HCZA 1EYDA 3M4YA 5D14A 2ICEC 4FXGC 3BS1A 4KMUC 5CV6A 1HQRD 2D62A 1DONA 4A3FB 5I6YA 1AP0A 1FNUA 4DFAA 2E2JB 4FXDA 3HOWB 4EVOA 3VR2A 1RHPA 2F0IA 1A6XA 5BN3A 3M4OB 3SE0A 2EY2A 4HN7A 4N9TA 1MGSA 4K2LA 2BCOA 5IGDA 5DM63 2M00A 5JPMC 1DOKA 1CHQD 2J0TD 1LTSD 4G7HC 2EE1A 1S5ED 3IL8A 4CJ1B 3MXUA 1CT1D 1SNCA 1AN8A 3R93A 4DK0A 4V190 1MI2A 5KNDA 1H9SB 2KJXA 4DN4M 2BA1A 1BUVT 5CBAE 4K5VA 3I4MB 3MXNA 3VR5A 4WFN3 2IPKD 2L5TA 1NUCA 5JVG3 3E5SA 2WINB 3QG1A 3FVQA 4NP5A 5I4DA 2R93B 1CZGA 4ID6A 1SNPA 1CZWA 3Q6SA 3VR3A 1UAPA 1F77A 1EYCA 2MUYA 2RVLA 1Q90A 1V43A 3QJYA 5EPLA 1TVXA 3M7NA 4KI0A 2XN9C 1SYDA 4ZUJA 5JOBA 1A2UA 1HUMA 2F1MA 4TKOB 3TZDA 3D4WA 1ET6A 3X3NA 4KTAA 1EIGA 2F0WA 3G6JB 2B2VC 5IT9E 4B9WA 4FF4A 2RDGA 3KK7A 1Z47A 3A56A 1PFBA 2SNSA 1T5EA 3MVVA 5DNFA 2BDOA 1VF5C 1A15A 2RSOA 1IL8A 4X3SA 1PDQA 4BS9A 4FF3A 3A7LA 1IYUA 2NYZD 1KLUD 2SNMA 3QIAA 1HFGA 4JK1C 1CI3M 4CGYB 3NBHA 2A73B 4K2KA 1VMPA 1BXTA 4BWGB 4A3IB 1WTOA 2WKCA 1FYCA 3UI2A 1WD0A 1G2SA 4JBWA 1EQVA 4FF1A 5I6WA 4GZYC 3CRKC 2NVQB 2EYJA 4R9WA 1LT4D 5C0XI 5A35A 1F9RA 2JP1A 2IW3A 1DXMA 1U4PA 4ZAIA 3JAME 3NPPA 3ONAB 1TKWB 2QCPX 2B2WA 3ERQA 2DNEA 2EYPA 5FO9B 1JORA 2J4XA 5J39A 1JC7A 1F9PA 5FLXE 5KGUA 2B8FA 3HEJA 4ZKBB 2QKIC 3RD4A 4KD3A 4X3TA 3TN2A 3V96A 1L0XB 3H91A 5A2QL 1TWGB 1SYFA 3Q0AA 5HURA 3NK9A 2C5CA 4ZLTF 2BOSA 2XIWA 2F0NA 5C3EB 5C0XJ 3G7LA 3FKIB 1BNZA 1BCPF 3K5OA 4L8JA 4C3JB 1ML0D 2KEDA 1MSGA 3A8KE 2PQEA 1RF2D 2M2LA 3E6ZX 4F7XA 4C3HB 1EY8A 1KTKA 3OMCA 2JYOA 4XDXA 4RA8A 4KJOA 3PUZA 3CRLC 1I6HB 5JEAG 5JEAH 4FYDA 4BY7B 1H9KA 1SNOA 1I4XA 4Q0FA 3S15B 5ELBA 1NAPA 1JOOA 2CVRA 4HMJA 1H9JA 1A3UA 4I7ZC 3D4RA 1Y8OB 1KNEA 1F2MA 3KLRA 4KN4C 1RDPD 3SR1A 2KHSA 2CW0C 1F2LA 4A3BB 1EY4A 2AQ2B 4DAYA 2LMCB 3J7AF 1MBYA 4H7BA 4X3UA 5E1FA 3SK5A 1BDOA 1PZKD 1II3A 2L0CA 4Y7NB 1WTVA 1HXYD 3R3OA 1JWUD 1AZPA 4Z9CB 3NWSA 5IGEA 2K33A 1WD1A 3BYTB 1TS4A 4L6TB 4OGQC 4A3EB 3MFGA 5KEEA 2KUMA 3D3RA 4TRDA 4G7OC 4PMCA 5FO8B 2R61A 1SDFA 1TY0A 2K7VA 4QUCA 4MIUA 3C1FA 1PFMA 4BA2I 5I2XA 4RHSA 3QOJA 3S1NB 4ZRZA 2EPBA 2EJFC 2SOBA 1TWHB 3M85A 3SDZA 3LX0A 1EIHA 1EY9A 3LWUA 3OW7A 5A2QE 1JOKA 1OO9B 2ICIA 3DMUA 5EKKA 3H3VC 2IWHA 1ZYRC 3DHQA 3TMEA 1SNDA 5IGCA 2K03A 1WTXA 1TS2A 4MN3A 4KKSA 4H44C 2BE5D 1A3TA 2NTTA 3D8GA 1WTRA 3TP5A 3S17B 4KKUA 1VF7A 3SHLA 2JA6B 2NVXB 1ICWA 3DWAA 5KIXA 4P2CB 1IW7C 2Q8TA 3BDCA 3GP7A 1U9RA 4DNTB 3KLSA 3S9WA 2LFNA 2PNRC 3SK4A 1R9TB 1E2WA 4Q5VA 5I2YA 4XQNA 3D6WA 1RTNA 1QNKA 3SK6A 1JQYD 2HQEA 3NTHA 2VNUD 3NWTA 3GD7A 1HA5A 2WKDA 3M3YB 3LWEA 1D5MC 2F0VA 3PUXA 4K14A 4ILWA 1HA6A 1DJRD 4EQNA 2D5DA 4DU9A 3HOYB 1Y8PB 4ODGA 5C4ZA 1B53A 4KY7A 1PFNA 1VCIA 3K59A 1CA6A 1I3QB 1XXGA 3RZDB 1Y1WB 2R3ZA 1RJTA 1PRTB 5FO7B 1STYA 1G8ZD 1QB5D 4FNFA 3VYTA 1HFNA 1LACA 4PMBA 5FKAC 5BN4A 1STAA 3BG3A 3P1HA 4BBSB 1STGA 3ZYYX 2LY7A 2Z8LA 4C3JG 4ULLA 3S1RB 5IT9L 1EQTA 1EU4A 2F0PA 4K6DA 4DXGA 1PLFA 1QNUA 5CV4A 1I4GA 5JVH3 3CHBD 3D6CA 3EVQA 1GHKA 1TWCB 4C3HG 1XTCD 5ELDA 2EYMA 3PUVA 5JEAJ 1SJED 1STEA 1CFMA 4DAVA 1O7ZA 2B2UC 4FVMA 4IUPA 3K5LA 3FMCA 1X32A 3PUYA 2EYHA 1PRTD 1W6KA 2K28A 3KBXA 5F2DA 1LTRD 3J7AV 3GTGB 1C4QA 3CU7A 3N6RA 2F3VA 4ME5A 4G57A 3K57A 1B44D 4HCEA 1K8OA 2EOTA 2FMMA 4OO1I 5BN5A 1GOZA 4PNYA 3JAML 4YIJA 1UUPA 5NUCA 4KD4A 2B2YC 1D2BA 2A69D 1LV9A 2CQAA 3T51B 4WJWA 1SAPA 4AYBB 2YU9B 1B9MA 3QO2A 2OXPA 3TBIB 1WVLA 1EZ8A 1ENCA 5C3XA 2BDNA 4R8IA 5FLXL 4KHZA 4HR7B 1O78A 3HOUB 1PRTC 2PO4A 1H9RA 1EEFD 2NVTB 4A3MB 5KNBA 2K32A 1BR9A 3MEHA 5CV8A 5EBCA 2XRQD 2O2LD 3A8IE 3DEPA 3I91A 4XXEA 1OXSC 4EGVA 3NXWA 3HKZB 4U68A 3OSOA 1D5XC 2Z4IA 2PZWA 4IUQA 3HGBA 5E3FA 1OXUA 3GTJB 3Q22A 1PYWD 2EXZA 1JICA 3MWYW 2G9HD 4FO2A 1KDBA 1ILPA 2A69C 3VYSA 4G7ZC 3MC0B 1RKNA 1PRTF 4HSVA 1AZQA 3E0JA 5EPJA 3BZDB 1GJXA 2QILA 2LS01 2L55A 1LTAD 4UAIA 3HS0C 5C5LA 1V8QA 3S16B 2ZXPA 1AFPA 4KY5A 2F0UA 1FNVA 2F0JA 1Q1EA 1SYCA 4EQPA 2F0DA 2NN6G 2NN6H 1QG7A 2EVBA 1SEBD 1B3AA 3PUWA 3T16A 4K8IA 1JOQA 1JWMD 4IUVA 1OXVA 1VDZA 4QB4A 2VXWA 3KLSX 1LTGD 4RFBA 3O13A 3DWQA 2N55A 3TP7A 3NUCA 2B8GA 4H13C 1IHZA 1CK1A 1H9MA 2A74C 3PIP3 2MGSA 3HOZB 2DN8A 1DZ1A 5T1GA 4RCOA 1UNSA 3WDNA 3C1EA 2PW5A 2F0HA 4FP5D 5G3LD 1GUSA 5EQ0A 4BY1B 1Z7TA 2JEBI 2F0KA 2EZVA 1STHA 3I72A 4HEDA 2B2WC 4XIGS 1SE2A 1QILA 4PQXA 5LL6S 1F2YA 2TMPA 1L0YB 1DM0B 1H9SA 2PZUA 3OWFA 3ND9A 2A6EC 4V0BA 2RDFA 4IUNA 1E0BA 4XQJA 3S14B 4UDUC 3QOLA 2F0SA 5JJZA 2XWJB 5CYUA 1TIID 2G9DA 1UEAB 3BDLA 3CKIB 1BOSA 3K6OA 1ET9A 4KN7C 2XNAC 3H0GB 1TU2B 5C3WA 1KDCA 1MD2D 3IFTA 1EY0A 2CW0D 2KEEA 1KNAA 1M4VA 1I4QA 2KQ3A 2O4XA 4XT1B 3R8BA 3DUZA 4CJ0B 1B50A 3ND8A 2F0QA 2JEAI 3SEBA 4OIJA 3P75A 1M8AA 2FINB 2A68D 4RH6A 5TSSA 3L7ZC 1G291 2L9HA 1T5XD 5ISRA 2C9OA 1SJHD 2OF1A 2FFKB 5EKIA 3T56B 2O5JC 4HTHA 4RAUC 2B39A 1RCVD 3BYYB 2NUCA 3GTKB 1ZKOA 5IOCA 4NMZA 3NE5B 3EA6A 3F2UA 5DEHA 2M9VA 4CBVA 4NDXA 4DF7A 4IFDH 1FR3A 1LTBD 1G6ZA 1AW7A 4RGNA 4RKLA 2F03A 2IX0A 1SE4A 1S5DD 3GTQB 2B2TC 4RKBA 4G4KA 1V1PB 2JA8B 1WTQA 4K5WA 2A68C 3NQIA 1ZYRD 3I73A 4OHJA 2H1EA 2K01A 2TSSA 4KHVA 4E6IA 3C3LA 3P7JA 5CV7A 3WOEA 4QF4A 4DXFA 5CV9A 2F0GA 4C3IG 2AUJD 2JSOA 2PW7A 3R2IA 3NTKA 3BDOA 5CORA 3SXHA 3P20A 1IW7D 2KA7A 1FNWA 2KOLA 4I65A 1S5BD 3I4LA 1D1IA 5E4WC 1E2ZA 3TZUA 2EY6A 1DD2A 5K36H 2EYLA 4H0LC 2EJGC 4C2MB 5ELCA 3A54A 2QEJC 3KF8A 1EL0A 2PCFB 2AQ3B 5AFWA 2WACA 5ELFA 2AUKA 5C4JB 3QB3A 1Q1BA 1LO5D 5C4XB 1I4PA 3MXGA 4RGOS 1VMCA 3KBGA 3FRPB 3NQTA 2DNCA 1ONLA 1GXDC 2K5QA 1LT6D 3K0YA 1JR0D 4B9XA 2E76C 4U673 5M9OA 1GHJA 3L3OC 1KABA 2YYZA 1W6JA 3J80L 3FDTA 1XX8A 3MXPA 2VB3X 1KLGD 4N9PA 1SNQA 3FPUB 2D2CC 1CQFA 3RLFA 3AB9A 3I3CA 3RZOB 1HRJA 1KDAA 5D65A 3EQLC 1HQMC 2Z4HA 5KYIA 3QWNA 1J9OA 1SYGA 1TQOA 2KVMA 4RGTA 4BA1I 4QCLA 1ESFA 1IKLA 2HUGA 1D6EC 5C5MA 1STBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I90 A;  5T1G A;  1KNE A;  1EQT A;  2MPM A;  2FHT A;  2X6G A;  5EPL A;  1TVX A;  3I91 A;  1IKM A;  1PLF A;  2FFK B;  3DEP A;  3MTS A;  5EKI A;  1ZXT A;  2KEC A;  2L11 A;  3GV6 A;  4RAU C;  1F2L A;  3I8Z A;  1ILQ A;  1F9P A;  4U68 A;  3N52 A;  1ICW A;  2MP1 A;  5D14 A;  1EL0 A;  1HUM A;  5T1I A;  4RWS C;  1BF4 A;  5AFW A;  4MHE A;  2NZ1 D;  4QUF A;  2B2Y A;  1DOM A;  4IUQ A;  5EQ0 A;  2Q8T A;  1O7Y A;  4X3T A;  3IFD A;  4X3U A;  3TZD A;  4X3K A;  1AP0 A;  1B4O A;  3TN2 A;  4HAE A;  1JE4 A;  2K05 A;  4HCS A;  3F2U A;  5EPK A;  1WTV A;  1X3P A;  3H91 A;  1CA5 A;  1EIG A;  1S4Z A;  1VMC A;  2B2V C;  4HED A;  1AZP A;  1JIC A;  1RHP A;  2IL8 A;  3MWY W;  2B2W C;  2Q8R E;  1J8I A;  1O7Z A;  1ILP A;  1MSH A;  2B2U C;  3D6W A;  1RTN A;  4IUU A;  4IUP A;  4ZLT F;  1X32 A;  1BO0 A;  1G6Z A;  2XIW A;  1QNK A;  1PFB A;  4HSV A;  2K28 A;  3KBX A;  5DNF A;  1AZQ A;  1MGS A;  3G7L A;  1WD1 A;  1A15 A;  5EPJ A;  2RSO A;  1IL8 A;  1DON A;  4OIK A;  1C8C A;  4X3S A;  1CM9 A;  1BNZ A;  1PDQ A;  1XYI A;  4UAI A;  2KUM A;  1E0B A;  2NYZ D;  1ROD A;  2L12 A;  3LWE A;  2B2T C;  2J7Z A;  1DOK A;  1ML0 D;  2KED A;  1EOT A;  1HFG A;  2EOT A;  4CJ2 C;  1MSG A;  5JJZ A;  1WTQ A;  1GUW A;  1SDF A;  4NW2 A;  1HA6 A;  4QUC A;  2FMM A;  2EE1 A;  1VMP A;  2DY7 A;  3FDT A;  1HUN A;  1PFM A;  1XX8 A;  2X6L A;  3HP3 A;  4O42 A;  4ZKC B;  1NCV A;  3IL8 A;  5CBE E;  2H1E A;  2M2L A;  4CJ1 B;  2HCI A;  1WTO A;  1B53 A;  1PFN A;  2K04 A;  2K01 A;  2DY8 A;  1ESR A;  3UI2 A;  1U4M A;  2EPB A;  1SSO A;  1WD0 A;  1QG7 A;  1CA6 A;  1G2S A;  3FPU B;  5CMD A;  3R93 A;  1B3A A;  2L1B A;  1RTO A;  1U4R A;  2NWG A;  3P7J A;  2JYO A;  2R3Z A;  3GV3 A;  1MI2 A;  1RJT A;  1BBX C;  1NR2 A;  1B2T A;  1G2T A;  2B2Y C;  4XDX A;  1EIH A;  4RA8 A;  1HHV A;  1DOL A;  2N88 A;  1LV9 A;  3I3C A;  4XT3 B;  2B2U A;  4R9W A;  4DN4 M;  4IUV A;  1QE6 A;  2X69 A;  1HRJ A;  1O80 A;  1X3Q A;  2FJ2 A;  2KEE A;  5CBA E;  1HFN A;  1F9R A;  1SAP A;  2HDM A;  2JP1 A;  1KNA A;  5D65 A;  2VXW A;  3DEO A;  1WTW A;  4IUR A;  1F9S A;  3DM1 A;  4XT1 B;  4ZK9 B;  5COR A;  1Q3L A;  4LMQ D;  1U4P A;  3QO2 A;  2KOL A;  2N55 A;  4ZAI A;  4CJ0 B;  1WVL A;  1F9Q A;  1B50 A;  1G91 A;  2K03 A;  2SDF A;  2RSN A;  1J9O A;  1WTX A;  3ONA B;  2HDL A;  4IUT A;  3KUP A;  2BDN A;  2KVM A;  4MN3 A;  2D9U A;  2B2T A;  4OIJ A;  4R8I A;  1M8A A;  2FIN B;  3SVM A;  4ZKB B;  2B2V A;  5COY A;  5E4W C;  5E4X A;  1U4L A;  3Q6S A;  5EJW A;  2B2W A;  2MJ8 A;  2MGS A;  1NAP A;  2L9H A;  1IKL A;  1NR4 A;  2CVR A;  2HUG A;  2K1B A;  2L4N A;  1WTR A;  1WTP A;  2HCC A;  2RVL A;  1DZ1 A;  2RA4 A; 
#chains in the Genus database with same CATH topology
 4YWL A;  3MHB A;  1EZ6 A;  4PV1 C;  2JK8 A;  2WII B;  4X64 Q;  1ICF B;  1VS0 A;  2F0L A;  3N52 A;  2JA7 B;  5T1I A;  1TR5 A;  1S5F D;  3MXN B;  4RWS C;  3H0G G;  1DOM A;  2EJM A;  4OL7 A;  2VQF L;  4A93 B;  4A3J B;  1KAA A;  3S24 A;  5C6A A;  3GTP H;  1YNJ D;  2F3W A;  3OHX C;  1ENF A;  2QW7 A;  3KOJ A;  3OWE B;  5LMU Q;  4O1N A;  3F2D A;  4L5T A;  4R4C A;  5KRU A;  3H6M A;  2Q2U A;  2EXD A;  4JW0 A;  5LMN Q;  2VS1 A;  4WRD A;  3GTO B;  5EAY A;  3X3M A;  1C8C A;  4FF2 A;  4R1J A;  3ERO A;  3S2H B;  3H09 A;  3J7Y W;  1TT2 A;  1SRU A;  2XSC A;  1X3E A;  1HPC A;  2A6H C;  1MKH A;  1K83 H;  3R2T A;  3RMH A;  4A3K B;  5M5W B;  4O42 A;  4K8J A;  1LTT D;  4K6L A;  1DCZ A;  3K5M A;  4PMW A;  2RQX A;  4QMG A;  2PPB C;  5HGQ A;  2F0O A;  4IZ8 A;  1SYE A;  3M4P A;  2V4D A;  2R7D A;  5C0X G;  3GV3 A;  1Q12 A;  4HJ5 A;  2ZM6 L;  2XWB B;  5C0X H;  1EWH A;  4AYB E;  3PMF A;  2B2U A;  3HOX B;  1X3G A;  2FJ2 A;  4DR3 Q;  3D4D A;  4JI4 Q;  2I07 B;  5LHY 1;  3DEO A;  4KHP L;  2R92 B;  4KY6 A;  1GD7 A;  1VQH A;  1TS5 A;  1YNJ C;  3M7G A;  1I94 Q;  3NBH B;  2ZJQ A;  1SE3 A;  1EWC A;  4QGU A;  3PO2 B;  1WCM G;  1WCM H;  1SBB B;  3VDY A;  3V05 A;  5EJW A;  1CKN A;  1Q81 C;  3GTQ H;  5IY0 A;  1TY2 A;  4JI3 L;  2YTX A;  4FDB A;  1R4Q B;  1VQJ A;  3E0E A;  2F0M A;  1TWF H;  2ATW A;  2JA8 G;  2RA4 A;  2OEO A;  4IAL A;  3TSS A;  2N3S A;  1SRO A;  3J80 E;  4XYQ A;  1ZXT A;  5FK9 C;  3TP8 A;  3TS0 A;  3GV6 A;  1Q7Y C;  1XJV A;  4TQU S;  2JA5 B;  3I8Z A;  2QEX A;  4F87 A;  2NZ1 D;  3W2D A;  4QUF A;  3Q23 A;  2B2Y A;  1RIP A;  4JI2 Q;  3NHH A;  1V1O A;  4X3K A;  2NVY B;  3J80 i;  4J1M A;  3AQQ A;  4ZYS A;  1QCB D;  2QF7 A;  2K05 A;  2K14 A;  5D3D A;  4TVA B;  3LNN A;  5I9O A;  1ZEQ X;  4KV6 A;  4DV3 Q;  4IQZ A;  2IL8 A;  5ELE A;  1NNX A;  4IPG A;  4UP8 A;  1IZ6 A;  2AWN A;  4IUU A;  1P16 A;  1A2T A;  1Q8I A;  2BA0 A;  4OON A;  4XQQ A;  4L5Q A;  2E74 C;  4QIW B;  3T53 B;  3K5N A;  1QUQ A;  3MAQ A;  4L5R C;  2IX3 A;  2H5X A;  4DR2 L;  4JI0 Q;  4GOP A;  1XYI A;  4C3I B;  2L12 A;  3V2T A;  2BH8 A;  3BVG A;  3NBI A;  1SXT A;  1BCP B;  2Y0S G;  4NW2 A;  5M3M G;  5M3M H;  3J7A 5;  2R7Z B;  1NCV A;  2NTS A;  3RLO A;  3CCU A;  2GN5 A;  1VQK A;  3J7Z C;  2RDH A;  2K6A A;  1CKO A;  1U0L A;  2UXD L;  5CMD A;  2VW9 A;  2PZT A;  3S1M H;  1A3V A;  1O7L A;  1U4R A;  1G2T A;  1B2T A;  2UU9 L;  1PTO B;  4JG2 A;  1LT3 D;  5C4J H;  1HHV A;  5C4X G;  1PMR A;  4RCN A;  2E2D C;  5CR3 A;  1F2Z A;  5C4X H;  2WB1 B;  2I0Q A;  1JB3 A;  4DAM A;  1CSQ A;  1IBK L;  4XTC S;  2Q8I B;  5LL6 X;  4S3S A;  3DM1 A;  4CDC C;  2IJ0 A;  1FD7 D;  1XMQ L;  3EFX D;  4C1N K;  2F0T A;  4B08 A;  2FMC A;  3CD6 A;  2E75 C;  1YNN D;  1OXX K;  2I5M X;  3PV0 A;  5IGF A;  2B2V A;  4KKT A;  3W1G A;  3K7A H;  3TP6 A;  3AMU A;  4NKL A;  1J5E L;  1EY6 A;  4HSP A;  1SR3 A;  5C44 B;  3CC2 A;  3ULL A;  2MPM A;  4YHH L;  2FHT A;  3G71 A;  3UDI A;  1GUG A;  1VQE A;  4OEM B;  2L11 A;  1IBM L;  2WAQ B;  2AHO B;  3J81 E;  5M5X B;  2A6E D;  1YNX A;  4DR6 Q;  5JJI A;  1W3S A;  4MHE A;  1PXU A;  4N8X 1;  3I2Z A;  1BCP D;  4F8M A;  1VQ4 A;  1B4O A;  2XVS A;  3FEW X;  2RKS A;  4P74 A;  3TDQ A;  3H3V I;  3MZ5 A;  3ICE A;  1JE4 A;  3GQB A;  2NZO A;  2KHJ A;  4JOI C;  4GKK L;  3CC4 A;  3I4N G;  3GTL H;  5C4H A;  3MA2 B;  3RZO H;  3I4N H;  1Y69 U;  5M3F B;  2ZXO A;  3OIQ A;  3K80 C;  3OIP A;  2CFM A;  1E1O A;  1SFO B;  1MJC A;  1WYD A;  3U9O A;  4DAP A;  1PTO D;  2E8G A;  2KCT A;  1QOH A;  2QGQ A;  2A5H A;  1BVS A;  2ENB A;  4OIK A;  3A5Z B;  3D31 A;  1B9N A;  3L9A X;  2EYF A;  1EU3 A;  1NSN S;  4KK7 A;  1E2V A;  1B1Z A;  4DAY B;  1TXY A;  3EBE A;  1YNN C;  3OPO A;  2ZT9 C;  4A3D B;  4JBJ A;  4X65 L;  2XTI A;  4MTK A;  2X6L A;  1G91 A;  1I50 B;  3EJI A;  3H94 A;  2WV6 D;  3BJU A;  3A74 A;  2JA7 G;  2F4I A;  1EEI D;  2GA4 B;  2JA7 H;  3L2P A;  2NWG A;  3RUZ A;  4DV2 L;  4A93 G;  3TS2 A;  3HOV B;  4A3J G;  1W2B A;  4A93 H;  1BCP C;  3VYU A;  4A3J H;  2KCN A;  3VYR A;  1X3Q A;  1S3O A;  4DV6 Q;  1F9S A;  2UXC L;  1FJG Q;  3CCR A;  1Q3L A;  5EBD A;  3FP9 A;  3DWP A;  5D3I B;  2CKZ B;  3HG9 A;  2SDF A;  2RSN A;  4BBR B;  4M1U B;  4IUT A;  4RG1 A;  3S2D B;  1FGB D;  5AJ3 Q;  3SVM A;  1PTO C;  5COY A;  4FXK C;  4MZ9 A;  5IP9 G;  2UXB Q;  4YCW A;  5IP9 H;  3S2H H;  2L4N A;  2K1B A;  3GTP B;  1I4R A;  4IN3 A;  3PF5 A;  2X6G A;  1XWE A;  1CQV A;  3MTS A;  1EYA A;  3VR6 A;  1HR0 L;  5IE8 A;  4Y52 H;  4A3K G;  5L37 A;  4A3K H;  3ITP A;  5M5W H;  5IWA L;  2GVA A;  4DA2 A;  4AIM A;  3C46 A;  3PO3 B;  1KXL A;  1BF4 A;  3TQY A;  1O7Y A;  2R6G A;  2PMZ B;  4WOR A;  3KF8 B;  4JC0 A;  2VQF Q;  4TSS A;  2QDB A;  5E7N A;  4C1N I;  2LSS A;  1K83 B;  5IIF A;  3BVM A;  1Z6H A;  3HOX G;  3CQZ H;  4CKB A;  1Q86 C;  3AU7 A;  3HOX H;  3HFZ B;  4DK3 C;  1MSH A;  2ES2 A;  4CKE A;  1HNX L;  2ZTD A;  2R92 G;  3HZX A;  4LJZ C;  2R92 H;  1E7Z A;  1PTO F;  2CH4 A;  4HMI A;  5G3L F;  5GQO A;  4HIM A;  2WP8 J;  3PO2 G;  3WWV A;  2JE6 I;  1CM9 A;  3PIO 3;  3PO2 H;  5BR8 L;  1STN A;  4A3F H;  3IAY A;  1QWY A;  1FVI A;  1JCK B;  4OEL B;  4CJ2 C;  5JPN C;  1OXT A;  4IFD G;  1GVP A;  3A55 A;  1VQD A;  2DY7 A;  4HJ8 A;  1HUN A;  1HZC A;  3CCE A;  1NBW A;  2KHI A;  4P71 A;  2K04 A;  3U9S A;  2JA5 G;  2O5I C;  2E2I B;  1SMY D;  1WCM B;  4OWX B;  2JA5 H;  2OCE A;  2E2H B;  1N34 L;  2JXM B;  2NN6 I;  4HJ9 A;  3VR4 A;  2L1B A;  3A0J A;  1NR2 A;  2ZM6 Q;  2N88 A;  3I70 A;  1TWF B;  1N32 L;  3GTM B;  2NZH A;  1QE6 A;  1R4P B;  3CCQ A;  5DM7 3;  2ID0 A;  4L63 B;  3T13 A;  4KHP Q;  1XNR L;  2LKV A;  3T1H L;  2OT2 A;  4WJ3 M;  1IBL L;  1AEX A;  2K52 A;  5IGG A;  2RBM A;  1VQ7 A;  2HDL A;  1VQM A;  2B2T A;  2Q2T A;  2CHB D;  2K5W A;  2VUM B;  3DXJ C;  2EDG A;  4JI3 Q;  2EYO A;  2B63 B;  2F0F A;  3G4S A;  2D0O A;  1AE2 A;  1NE3 A;  1CHP D;  3I4M G;  1IKM A;  4J6H A;  3I4M H;  4KJN A;  3HRZ C;  5J22 A;  1ILQ A;  2MP1 A;  1UEB A;  2H4O A;  4K5X A;  2Z1C A;  4M8A A;  3IFD A;  4HAE A;  4I7A A;  4CHT B;  1SMY C;  1N33 Q;  1X3P A;  1CA5 A;  1A0I A;  2IX1 A;  1LTI D;  5K36 G;  1NY4 A;  4UP7 A;  1PTO H;  2KCC A;  2Y0S B;  2RCF A;  3NSW A;  2WB1 G;  5M3M B;  1J8I A;  3URY A;  2XRS D;  4DK1 A;  1JJC B;  1JWS D;  4J8Q A;  3SK8 A;  5GRO A;  1BO0 A;  4LF8 Q;  4R8N A;  1X54 A;  5KYL A;  1EFI D;  4LW1 A;  1GUN A;  3I56 A;  3S1M B;  1QJO A;  1LM0 A;  3T4A C;  1WOC A;  2YV5 A;  1WFQ A;  3A7A B;  5IT9 c;  3BZC A;  4DR2 Q;  1K8M A;  1ROD A;  4OO1 G;  5CV5 A;  1I6V C;  4OO1 H;  1EOT A;  4JI8 L;  1GUW A;  4O2D A;  5C44 G;  3PCO B;  5JJK A;  1GUO A;  5C44 H;  1NMG A;  4A75 A;  4ABN A;  1LAB A;  3J81 c;  1D5Z C;  3HP3 A;  2WAQ G;  2HCI A;  1PH1 A;  5EGT A;  1EY7 A;  2IHE A;  3A5U A;  1BBW A;  1ESR A;  5M5X H;  1K9M C;  1SSO A;  2MHV A;  1Y8N B;  1N36 L;  1G51 A;  1E1T A;  2ZXR A;  3K7A B;  1RD9 D;  4KLK A;  2UU9 Q;  1DOL A;  2AKW B;  3VA5 A;  4RHR A;  1PYS B;  2I46 A;  4LUO A;  3NTI A;  1JJ2 A;  4XYO A;  2HDM A;  1WTW A;  5M3F G;  4LMQ D;  5M3F H;  3MFY A;  2K5D A;  4ZUI A;  1K3B C;  1SNM A;  4C56 C;  1F9Q A;  1SFO H;  1XMQ Q;  2AMC B;  2NB0 A;  3KUP A;  3IKJ A;  3VA7 A;  1DYQ A;  1NMF A;  5E4X A;  4UY8 C;  3MEF A;  1VQC A;  1MIU A;  1PZI D;  1J5E Q;  3GTL B;  1WTP A;  3KF6 B;  1S40 A;  3I4N B;  2HCC A;  5M5Y B;  2VB2 X;  2AQ1 B;  3S1Q B;  2EY1 A;  4A3D G;  4YHH Q;  1PZJ D;  1HR0 W;  2RHS B;  2KEC A;  3JAM c;  3BVZ A;  1IBM Q;  3K58 A;  1MJE A;  4DV4 L;  1HTP A;  3CPW A;  4NXM L;  1HZA A;  1V1P A;  4JVZ A;  1IYV A;  1HTL D;  4EQO A;  2A6H D;  4HCS A;  5EPK A;  3CCJ A;  1GKH A;  1S4Z A;  4OWT B;  5I9P A;  1I4H A;  3HOV G;  4GKK Q;  4DNR B;  1GUT A;  3HOV H;  2Q8R E;  5CGK A;  2BE5 C;  4ZQ3 A;  1LT5 D;  1D1K A;  3A8J E;  1TS3 A;  3ER0 A;  4A3G B;  3AEV A;  4IFD I;  5FLX c;  4DKA C;  1E22 A;  1PH3 A;  4BBR G;  1VQP A;  2SEB D;  3Q24 A;  4BBR H;  3S2D H;  5HGT A;  4DGZ A;  2EY5 A;  1NTG A;  2PQA A;  2J7Z A;  1HZ9 A;  3OMG A;  3C2P A;  5KNC A;  5EKL A;  1TWG H;  4LK1 C;  4X65 Q;  5K5P A;  4APV A;  4ZKC B;  1PH2 A;  2F0E A;  4RGM A;  5CBE E;  1K3R A;  2IT1 A;  1SYB A;  1FGU A;  4LAA A;  2DY8 A;  4QJF A;  4GNX A;  1U4M A;  4F88 A;  5IGB A;  3OOC A;  3F8T A;  3PO3 G;  2VL6 A;  1VQA A;  5C3E H;  3FKI G;  3PO3 H;  1LLR D;  2OQ0 A;  1EIF A;  3NEL A;  2K50 A;  3FKI H;  1RTO A;  1BBX C;  2AWO A;  3WOF A;  3PIO A;  2PI2 A;  4DV2 Q;  4XT3 B;  1B7Y B;  2NBF A;  4C3J H;  1EUJ A;  2X69 A;  1CTM A;  1O80 A;  2OTL A;  5FOB B;  1K8A C;  5DAU A;  1TWA B;  3FPP A;  4IUR A;  4ZK9 B;  1BQQ T;  1IYJ B;  3NP8 A;  2UXC Q;  1ENA A;  5GAG C;  1EY5 A;  1DGS A;  3W3A A;  3J81 L;  1Y1V B;  3KLW A;  3U4Z A;  3DM3 A;  5J1Z A;  2CCZ A;  2Q2H A;  2D9U A;  3KDF A;  3GO5 A;  5IOD A;  2PYK A;  1S5C D;  4CKC A;  4DR7 L;  1U4L A;  3D0F A;  4LF9 L;  4IFD J;  2MJ8 A;  1C48 A;  1NR4 A;  3CQZ B;  5JAV A;  1PVO A;  2RCN A;  3I90 A;  5CC4 A;  1HR0 Q;  4BY7 G;  2N8N A;  1HCZ A;  1EYD A;  3M4Y A;  5D14 A;  5IWA Q;  4BY7 H;  2ICE C;  4FXG C;  3BS1 A;  4KMU C;  5CV6 A;  1HQR D;  2E2I H;  2D62 A;  1KRT A;  1XPU A;  1DON A;  4A3F B;  5I6Y A;  1X65 A;  1AP0 A;  1XTD A;  2E2H H;  2CQO A;  1FNU A;  4DFA A;  2E2J B;  4FXD A;  3HOW B;  4EVO A;  3VR2 A;  1K0S A;  1RHP A;  2F0I A;  2HHH L;  2LXJ A;  1A6X A;  3HKZ E;  4JI1 L;  3ZJY C;  4DUY L;  5BN3 A;  3RNU A;  3GTM H;  3M4O B;  4UPA A;  3SE0 A;  1YIJ A;  4QIW E;  1FL0 A;  2EY2 A;  3B6Y A;  4HN7 A;  2HQL A;  4N9T A;  1MGS A;  3OYY A;  4K2L A;  2V1C C;  1J6Q A;  4IOA A;  2BCO A;  5IGD A;  5BR8 Q;  5DM6 3;  2VUM G;  4J15 A;  2MQH A;  2M00 A;  5JPM C;  1DOK A;  2UUB L;  2VUM H;  1CHQ D;  4Y7N H;  4POG A;  2J0T D;  1LTS D;  4LFB L;  2B63 G;  4G7H C;  2B63 H;  1YHA A;  2EE1 A;  1HH2 P;  1S5E D;  3IL8 A;  4CJ1 B;  2VQE L;  3MXU A;  3NEM A;  4IOC A;  1CT1 D;  4DV7 L;  1SNC A;  1AN8 A;  1X3F A;  3R93 A;  1N34 Q;  4K0K Q;  1L1O B;  4NB3 A;  4DK0 A;  4V19 0;  1MI2 A;  4A3E H;  5KND A;  1H9S B;  2KJX A;  1N32 Q;  4DN4 M;  4GOP C;  2BA1 A;  4UHV A;  1BUV T;  5CBA E;  4K5V A;  3I4M B;  3MXN A;  3VR5 A;  4WFN 3;  2IPK D;  2L5T A;  1NUC A;  5JVG 3;  3E5S A;  2WIN B;  3QG1 A;  3FVQ A;  1EYG A;  1XNR Q;  4NP5 A;  5I4D A;  3T1H Q;  1IBL Q;  2R93 B;  3S1N H;  1CZG A;  4ID6 A;  1SNP A;  1CZW A;  3Q6S A;  3VR3 A;  1TWH H;  1UAP A;  1F77 A;  1EYC A;  2MUY A;  2RVL A;  3QJY A;  1Q90 A;  1V43 A;  5EPL A;  1TVX A;  3M7N A;  4KI0 A;  2XN9 C;  1SYD A;  4B3M Q;  4ZUJ A;  5JOB A;  1A2U A;  1HUM A;  2F1M A;  1D7Q A;  4TKO B;  4GKJ Q;  3TZD A;  2G5D A;  3D4W A;  1ET6 A;  3X3N A;  1VQO A;  4KTA A;  1EIG A;  2F0W A;  1QVC A;  2B2V C;  1UWV A;  3G6J B;  5IT9 E;  2P5Z X;  2Z9H A;  4B9W A;  4FF4 A;  2RDG A;  4NPS A;  3KK7 A;  1L2F A;  1Z47 A;  3A56 A;  2GVB A;  3CF5 A;  1PFB A;  2SNS A;  1T5E A;  3MVV A;  5DNF A;  2BDO A;  1VF5 C;  2NVX H;  2CH4 W;  3KJP A;  1A15 A;  1CUK A;  1IL8 A;  2RSO A;  4X3S A;  1PDQ A;  4BS9 A;  4FF3 A;  3A7L A;  1IYU A;  2NYZ D;  1KLU D;  3J81 i;  2SNM A;  3QIA A;  1HFG A;  4JK1 C;  4JI8 Q;  3E9I A;  4LFA L;  1CI3 M;  4CGY B;  3NBH A;  4JPB W;  1WTH A;  2A73 B;  4K2K A;  1LTL A;  1VMP A;  5J3B A;  5M5Y H;  1BXT A;  3CCM A;  4BWG B;  3T1Y L;  3CME A;  3S1Q H;  4A3I B;  3M9B A;  1WTO A;  2EQS A;  2WKC A;  1FYC A;  3UI2 A;  1WD0 A;  1G2S A;  4JBW A;  4ALP A;  1EQV A;  1YBY A;  1N36 Q;  4JOI A;  4FF1 A;  4PZ7 A;  5I6W A;  4GZY C;  3CP0 A;  3CRK C;  2NVQ B;  2EYJ A;  4PZ6 A;  4R9W A;  2ASB A;  3M3Y H;  1C0A A;  1LT4 D;  5C0X I;  5A35 A;  1F9R A;  2JP1 A;  3AFQ A;  4X64 L;  2IW3 A;  1DXM A;  1U4P A;  3UDF A;  4ZAI A;  3JAM E;  4A3G G;  3AYH B;  1HNW L;  4IJH A;  3NPP A;  4A3G H;  3ONA B;  1L1O C;  4NXN L;  4N8F A;  1TKW B;  3W1B A;  2QCP X;  1I3Q H;  1Y1W G;  3RZD H;  2B2W A;  1UE7 A;  1Y1W H;  3ERQ A;  2DNE A;  2EYP A;  5FO9 B;  3CCL A;  2LXK A;  4LF5 L;  4JYA L;  1JOR A;  2J4X A;  3UE1 A;  5J39 A;  1JC7 A;  2PMZ E;  5LMN L;  1F9P A;  1O7I A;  2YTV A;  4DV4 Q;  4OWW B;  5FLX E;  5KGU A;  2B8F A;  3HEJ A;  4LF4 Q;  4ZKB B;  2QKI C;  3RD4 A;  3K0X A;  4KD3 A;  4X3T A;  1C7Y A;  4NXM Q;  3TN2 A;  3V96 A;  1L0X B;  3H91 A;  1V9P A;  4LUV A;  5A2Q L;  1TWG B;  1SYF A;  3J81 j;  3S1R H;  3Q0A A;  4YWK A;  5HUR A;  2WFW A;  3NK9 A;  2C5C A;  4ZLT F;  2BOS A;  3E3X A;  1TWA H;  2XIW A;  1YHQ A;  4P72 A;  2F0N A;  5C3E B;  1Y1V G;  5C0X J;  2R7F A;  3G7L A;  3FKI B;  1Y1V H;  1BNZ A;  1YHB A;  1BCP F;  3K5O A;  4YY3 L;  4PG3 A;  4L8J A;  4C3J B;  1N8R C;  1ML0 D;  2KED A;  1YEZ A;  1Y14 B;  1MSG A;  1VQ5 A;  3A8K E;  2PQE A;  4HJ7 A;  1RF2 D;  2M2L A;  2PNH A;  3E6Z X;  2OWO A;  4F7X A;  4QY7 A;  4C3H B;  3QR8 A;  3GTG H;  4AQY L;  1EY8 A;  3HKS A;  2Z6K C;  4A3F G;  1KTK A;  3OMC A;  2JYO A;  1HZB A;  5HY6 A;  4XDX A;  4RA8 A;  1K73 C;  3HOW G;  4KJO A;  3RN2 A;  2E2J H;  3PUZ A;  2VY3 A;  4LFC L;  3HOW H;  3CRL C;  1I6H B;  5JEA G;  3K7U C;  5JEA H;  3CCV A;  1KRS A;  4R4T A;  2N78 A;  4FYD A;  3M4O H;  4BY7 B;  1YI2 A;  1H9K A;  1SNO A;  1I4X A;  2OQK A;  2I5L X;  2HIV A;  4Q0F A;  1D8L A;  3S15 B;  5GAH C;  4DUZ L;  1B3Q A;  5ELB A;  4DR7 Q;  1PYB A;  4LF9 Q;  4GS3 A;  4LF6 L;  2FXQ A;  1NAP A;  1JOO A;  2CVR A;  4HMJ A;  1U5K A;  1H9J A;  1A3U A;  2A1A A;  4I7Z C;  3D4R A;  1Y8O B;  1UE6 A;  1KNE A;  1F2M A;  3KLR A;  4KN4 C;  4A4I A;  1RDP D;  3SR1 A;  4JV5 L;  2KHS A;  4AYB G;  2CW0 C;  4B3R L;  2YU9 H;  1F2L A;  4A3B B;  4HIK A;  1EY4 A;  2AQ2 B;  4DAY A;  2LMC B;  3J7A F;  1MBY A;  4H7B A;  1X56 A;  1XPO A;  4X3U A;  4MTN A;  1WJJ A;  2Y0S E;  5E1F A;  3SK5 A;  3HOU H;  1BDO A;  1PZK D;  1II3 A;  2L0C A;  4Y7N B;  4A3M G;  1HXY D;  1WTV A;  2OTJ A;  2F3I A;  1Q82 C;  2NVT H;  3R3O A;  1JWU D;  4A3M H;  2PI2 E;  4EQ5 A;  1AZP A;  2HHH Q;  4Z9C B;  4JI1 Q;  4DUY Q;  3CPF A;  4A3C G;  1X6O A;  4A3C H;  3NWS A;  5IGE A;  2K33 A;  1VQI A;  4BXX H;  1WD1 A;  3BYT B;  4GN5 A;  1TS4 A;  4L6T B;  1PH5 A;  3KFU A;  2R93 G;  2R93 H;  4OGQ C;  4A3E B;  3MFG A;  3GDE A;  2ALY B;  5KEE A;  2KUM A;  3D3R A;  1AE3 A;  4TRD A;  4PMC A;  5FO8 B;  1YJN A;  4G7O C;  5ELO A;  2R61 A;  1CKM A;  2UUB Q;  3STB C;  1SDF A;  1KIX A;  1TY0 A;  2K7V A;  4LFB Q;  4QUC A;  1EWI A;  4MIU A;  3C1F A;  1PFM A;  4HID A;  4BA2 I;  5I2X A;  4RHS A;  1UE1 A;  3QOJ A;  3S1N B;  2VQE Q;  4ZRZ A;  2EPB A;  2EJF C;  4DV7 Q;  2SOB A;  1JE5 A;  1TWH B;  3M85 A;  3SDZ A;  4GNX B;  1HJP A;  3LX0 A;  1EIH A;  1EY9 A;  3LWU A;  3OW7 A;  4DPG A;  4DR1 L;  5A2Q E;  1JOK A;  2HT1 A;  1OO9 B;  2ICI A;  5IYC G;  3PSI A;  1QVG A;  3DMU A;  5IYC H;  2KEN A;  5EKK A;  3S16 H;  3H3V C;  2IWH A;  1ZYR C;  1L0W A;  1JJG A;  3DHQ A;  3TME A;  1SND A;  5IGC A;  1M90 C;  2K03 A;  1WTX A;  1ASZ A;  1TS2 A;  1Q46 A;  4MN3 A;  1PH4 A;  3RLN A;  4KKS A;  2UXD Q;  3ULP A;  3Q8D A;  4H44 C;  1VQB A;  2BE5 D;  1A3T A;  2NTT A;  3D8G A;  3JC6 6;  1WTR A;  1AH9 A;  3TP5 A;  3S17 B;  4KKU A;  1VF7 A;  1IBK Q;  3SHL A;  5LMN W;  1EIY B;  4A3I G;  3BZK A;  2JA6 B;  2NVX B;  1ICW A;  3DWA A;  4A3I H;  3EIV A;  5KIX A;  4P2C B;  1IW7 C;  2Q8T A;  5FJ8 G;  5FJ8 H;  3BDC A;  3GP7 A;  1U9R A;  4H02 A;  4X6A H;  4DNT B;  3KLS A;  3S9W A;  4DR5 L;  2LFN A;  3HOZ G;  2PNR C;  3SK4 A;  3HOZ H;  2NVQ H;  1R9T B;  1E2W A;  4Q5V A;  3EN2 A;  1CKN B;  5I2Y A;  4XQN A;  3D6W A;  1EOV A;  1RTN A;  1N9W A;  2UUA L;  1QNK A;  4AH6 A;  3SK6 A;  1JQY D;  5JJL A;  2KBN A;  1E24 A;  2HQE A;  3NTH A;  4BY1 H;  2VNU D;  3NWT A;  4JBM A;  3GD7 A;  1HA5 A;  2WKD A;  3M3Y B;  3LWE A;  1D5M C;  2F0V A;  3PUX A;  3U58 A;  4K14 A;  4DV1 L;  4JI6 L;  1K0R A;  4ILW A;  4LFA Q;  1HA6 A;  3CW2 C;  1DJR D;  1BBU A;  4X62 L;  4EQN A;  2D5D A;  4DU9 A;  3HOY B;  1Y8P B;  4ODG A;  5C4Z A;  1B53 A;  4KY7 A;  1PFN A;  2HD3 A;  2JJQ A;  1ASY A;  1VCI A;  3K59 A;  1CA6 A;  1I3Q B;  1XXG A;  3RZD B;  1Y1W B;  2R3Z A;  1B70 B;  1PRT B;  1RJT A;  2RHQ B;  5FO7 B;  2ZJP A;  1STY A;  1G8Z D;  1QB5 D;  4FNF A;  3L0O A;  1QUQ B;  3VYT A;  1HFN A;  1LAC A;  4PMB A;  5FKA C;  4GOP B;  2UUC L;  4LWC A;  3NEN A;  4POF A;  5BN4 A;  1STA A;  3BG3 A;  5IYB G;  2F4V L;  1HNW Q;  3P1H A;  4BBS B;  5IYB H;  1STG A;  3H0G H;  3ZYY X;  5C3E G;  4NXN Q;  4GNX C;  2E5L L;  3KJO A;  2LY7 A;  2Z8L A;  1PA6 A;  4C3J G;  2IHF A;  4ULL A;  3S1R B;  5IT9 L;  1PH8 A;  1EQT A;  1EU4 A;  2DJG C;  2RF4 A;  2F0P A;  4K6D A;  2MO1 A;  4DXG A;  4JYA Q;  4LF5 Q;  1PLF A;  1QNU A;  4YCU A;  4B3S L;  1KC8 C;  5CV4 A;  3H3V H;  1I4G A;  1VQL A;  1UE5 A;  3CHB D;  5JVH 3;  1XPR A;  3D6C A;  3EVQ A;  1XMO L;  3PQI A;  1GHK A;  1I5F A;  1TWC B;  4C3H G;  1H95 A;  1XTC D;  5ELD A;  5GAE C;  2EYM A;  4C3H H;  3PUV A;  5JEA J;  1CSP A;  1SJE D;  3G6E A;  1STE A;  1CFM A;  4DAV A;  1O7Z A;  2B2U C;  4FVM A;  4IUP A;  1I6H H;  3K5L A;  3FMC A;  1X32 A;  1SN8 A;  3PUY A;  3OTO L;  2EYH A;  1PRT D;  3G48 A;  1W6K A;  2K28 A;  3KBX A;  4IPH A;  1JMC A;  4LF7 L;  5F2D A;  1LTR D;  3J7A V;  2Q2I A;  3GTG B;  2L15 A;  1C4Q A;  1Q8K A;  3GTK H;  1VQ9 A;  4R4Q A;  3CU7 A;  4X66 L;  3W5O A;  3N6R A;  2F3V A;  4PZ8 A;  4ME5 A;  4YY3 Q;  3S15 H;  4G57 A;  3K57 A;  4DNI A;  1XNQ L;  1B44 D;  4HCE A;  1K8O A;  2EOT A;  4GLX A;  1P8L A;  2FMM A;  1PH7 A;  4OO1 I;  4JI7 L;  5BN5 A;  1GOZ A;  5ELN A;  2C35 B;  1A63 A;  1HNX Q;  4YCV A;  4PNY A;  4A3B G;  2CWP A;  4A3B H;  3JAM L;  1HNZ L;  4YIJ A;  1UUP A;  3KF6 A;  5NUC A;  2HIX A;  4AQY Q;  4KD4 A;  1NJI C;  2B2Y C;  1D2B A;  2A69 D;  1LV9 A;  2CQA A;  1QVF A;  3T51 B;  4QL5 A;  4WJW A;  4LFC Q;  2JA8 H;  2QA4 A;  3RN5 A;  1SAP A;  2Z0S A;  4AYB B;  3KYH C;  2YU9 B;  2JN4 A;  1B9M A;  3QO2 A;  2OXP A;  3TBI B;  1WVL A;  1EZ8 A;  1ENC A;  5C3X A;  2BDN A;  4R8I A;  5FLX L;  4KHZ A;  4P75 A;  4HR7 B;  1O78 A;  1N33 L;  3HOU B;  1PRT C;  2PO4 A;  1H9R A;  2WB1 E;  3ERS X;  1EEF D;  4DUZ Q;  4A3E G;  2NVT B;  4A3M B;  5KNB A;  2K32 A;  4LF6 Q;  1BR9 A;  3MEH A;  5CV8 A;  4YWM A;  5EBC A;  2XRQ D;  2O2L D;  3A8I E;  3DEP A;  3I91 A;  1M1K C;  4XXE A;  4JV5 Q;  1OXS C;  4LF8 L;  4O0A A;  4B3R Q;  4QQB X;  4EGV A;  3NXW A;  3HKZ B;  4U68 A;  2JQO A;  3OSO A;  1D5X C;  4OX9 L;  2Z4I A;  1A62 A;  2PZW A;  4IUQ A;  3HGB A;  5E3F A;  1OXU A;  3GTJ B;  2K5V A;  3Q22 A;  1X9N A;  1PYW D;  2EXZ A;  4CDF C;  1JIC A;  3MWY W;  2WAQ E;  2G9H D;  4FO2 A;  4DV5 L;  1KDB A;  1ILP A;  1RL2 A;  2A69 C;  4WJ4 A;  4C2M H;  3VYS A;  4G7Z C;  3MC0 B;  1RKN A;  1PRT F;  4HSV A;  1AZQ A;  1LUZ A;  4GLV B;  3E0J A;  5EPJ A;  1JT8 A;  3BZD B;  1GJX A;  2CWA A;  2QIL A;  2LS0 1;  2L55 A;  1S72 A;  1LTA D;  4UAI A;  3HS0 C;  4DV0 L;  5C5L A;  1YJ9 A;  1MHW C;  1V8Q A;  3S16 B;  4IJL A;  2ZXP A;  4JI5 L;  1EFW A;  4DR4 L;  1AFP A;  4KY5 A;  4B3T L;  3S17 H;  2F0U A;  1FNV A;  2F0J A;  1Q1E A;  1SYC A;  4EQP A;  2F0D A;  2NN6 G;  2NN6 H;  2JA6 G;  1GM5 A;  1QG7 A;  2JA6 H;  2EVB A;  2Z6B A;  1SEB D;  1B3A A;  3PUW A;  3T16 A;  1LYL A;  4K8I A;  2F52 A;  4HIO A;  3K8A A;  1JOQ A;  1JWM D;  4DR1 Q;  4IUV A;  1OXV A;  1VDZ A;  4QB4 A;  2VXW A;  3KLS X;  1R9T H;  4IPD A;  1LTG D;  4RFB A;  2N49 A;  3O13 A;  3DWQ A;  4RMF A;  2N55 A;  3TP7 A;  3NUC A;  2B8G A;  4H13 C;  1IHZ A;  1CK1 A;  1H9M A;  2A74 C;  3PIP 3;  4JCV E;  4DK6 C;  3I7F A;  2MGS A;  3HOZ B;  3OW2 A;  2DN8 A;  1YZ6 A;  5H1S E;  3U4V A;  1DZ1 A;  5T1G A;  1VQF A;  4RCO A;  2DJF C;  1UNS A;  3WDN A;  1VQ8 A;  3C1E A;  1QZG A;  1T9H A;  2PW5 A;  3HOY G;  2F0H A;  4FP5 D;  3HOY H;  5G3L D;  1SLJ A;  1GUS A;  5EQ0 A;  4BY1 B;  1GO3 E;  1YVC A;  1Z7T A;  2JEB I;  3TRE A;  2F0K A;  4GN3 B;  2EZV A;  3UDG A;  4R4O A;  1STH A;  2K5N A;  3I72 A;  4HED A;  3JAM i;  4DR5 Q;  3PGZ A;  2B2W C;  1SE8 A;  1K28 A;  4XIG S;  1SE2 A;  5LMU L;  1QIL A;  4R4I A;  3CC7 A;  4PQX A;  1KD1 C;  2K4K A;  3UE0 A;  5LL6 S;  1F2Y A;  2TMP A;  1IXR A;  1A8V A;  1L0Y B;  1L1O A;  4JBK A;  2UUA Q;  1DM0 B;  1H9S A;  3F2B A;  2PZU A;  3OWF A;  3ND9 A;  2ZJR A;  2A6E C;  4BBS G;  1KL9 A;  4V0B A;  4BBS H;  2RDF A;  4IUN A;  2QDL A;  3LGJ A;  3K81 C;  1E0B A;  4XQJ A;  3S14 B;  4UDU C;  3QOL A;  2F0S A;  5JJZ A;  2XWJ B;  5CYU A;  1TII D;  2G9D A;  4DV1 Q;  4JI6 Q;  1UEA B;  1B8A A;  3BDL A;  3CKI B;  1BOS A;  2K5H A;  3BU2 A;  3K6O A;  4X62 Q;  1ET9 A;  4KN7 C;  5GAD C;  2XNA C;  4LNQ A;  3H0G B;  1TU2 B;  5C3W A;  1KDC A;  4LUZ A;  3GTO H;  1MD2 D;  3IFT A;  1EY0 A;  1X55 A;  1TWC H;  2DGY A;  4HJA A;  3TEH B;  3H15 A;  2CW0 D;  4DR3 L;  4JI4 L;  2KEE A;  1KNA A;  1M4V A;  1I4Q A;  2UUC Q;  2KQ3 A;  2O4X A;  4XT1 B;  4A76 A;  1EQR A;  3TRZ A;  3R8B A;  3DUZ A;  1I94 L;  4CJ0 B;  1B50 A;  3ND8 A;  2F0Q A;  2F4V Q;  2JEA I;  3SEB A;  4OIJ A;  3P75 A;  1M8A A;  2FIN B;  2A68 D;  1E3P A;  4IO9 A;  4RH6 A;  5TSS A;  5IP7 G;  2A8V A;  2E5L Q;  5IP7 H;  3L7Z C;  1G29 1;  2L9H A;  1T5X D;  5ISR A;  5DLQ E;  2C9O A;  1SJH D;  2OF1 A;  2FFK B;  5EKI A;  1BKB A;  3T56 B;  1VQN A;  4HTH A;  2O5J C;  3CAM A;  1PH9 A;  4RAU C;  2B39 A;  3IRB A;  4B3S Q;  1RCV D;  3BYY B;  2Z6K A;  2NUC A;  3GTK B;  1Z9F A;  1ZKO A;  5IOC A;  4JI2 L;  4NMZ A;  2MFI A;  4L5S A;  1XMO Q;  3NE5 B;  3EA6 A;  3CMA A;  3F2U A;  5DEH A;  3STB D;  4MNO A;  4DV3 L;  4GN4 B;  2M9V A;  3J80 c;  4CBV A;  4NDX A;  4DF7 A;  4IFD H;  4EX5 A;  1FR3 A;  1LTB D;  3U50 C;  1G6Z A;  1AW7 A;  4RGN A;  3OTO Q;  3CCS A;  1PV4 A;  3CXC A;  4RKL A;  4LF7 Q;  4K0K L;  2F03 A;  2IX0 A;  1SE4 A;  4P73 A;  1S5D D;  3GTQ B;  4JI0 L;  4X66 Q;  3HOU G;  2NVY H;  2B2T C;  4RKB A;  4G4K A;  1V1P B;  1XNQ Q;  2JA8 B;  1WTQ A;  4K5W A;  2A68 C;  1KAW A;  3NQI A;  1ZYR D;  3I73 A;  4IPC A;  1SMX A;  4UP9 A;  4CDE C;  4OHJ A;  4JI7 Q;  2H1E A;  3UDX A;  4A3L G;  3HKZ G;  2K01 A;  4A3L H;  4BXX G;  4GLA C;  2TSS A;  3I55 A;  1HNZ Q;  4KHV A;  4E6I A;  3C3L A;  3P7J A;  5CV7 A;  3WOE A;  4QF4 A;  4DXF A;  5CV9 A;  2F0G A;  4C3I G;  2AUJ D;  3GTJ H;  2JSO A;  4C3I H;  2PW7 A;  3R2I A;  4ME3 A;  3NTK A;  2EIF A;  3E9H A;  4B3M L;  3BDO A;  2PQA B;  5COR A;  3SXH A;  2R7Z G;  3P20 A;  1IW7 D;  2KA7 A;  1FNW A;  2KOL A;  2R7Z H;  1PH6 A;  4I65 A;  1S5B D;  2ZTC A;  4GKJ L;  5IYD G;  3I4O A;  3I4L A;  4OXP A;  4CDD C;  5IYD H;  1D1I A;  5E4W C;  2BH2 A;  1E2Z A;  3TZU A;  3S14 H;  2EY6 A;  3SGI A;  1DD2 A;  4ZCK A;  2YTY A;  1OTC A;  5K36 H;  2KCM A;  1QZH A;  2A19 A;  2EYL A;  3AFP A;  4H0L C;  2EJG C;  2DUD A;  4C2M B;  1G6P A;  5ELC A;  3A54 A;  2I5H A;  5FLM G;  4DR6 L;  2QEJ C;  3PF4 A;  3KF8 A;  3M4Q A;  5FLM H;  2PCF B;  1EL0 A;  2AQ3 B;  2K75 A;  4OX9 Q;  5AFW A;  2WAC A;  5ELF A;  2AUK A;  5C4J B;  3QB3 A;  1Q1B A;  1LO5 D;  5C4X B;  1I4P A;  3MXG A;  4RGO S;  3PIP A;  1V1Q A;  1VMC A;  3KDF B;  1KHI A;  1IL2 A;  4DV5 Q;  3KBG A;  2IY5 B;  3FRP B;  3NQT A;  2DNC A;  1ONL A;  1GXD C;  3ULJ A;  2K5Q A;  1PHJ A;  1LT6 D;  3K0Y A;  1JR0 D;  4B9X A;  2E76 C;  4U67 3;  5M9O A;  1GHJ A;  3L3O C;  4DV0 Q;  1KAB A;  2YYZ A;  2VZA A;  4JI5 Q;  1W6J A;  4DR4 Q;  3F1Z A;  3J80 L;  1YIT A;  3FDT A;  4B3T Q;  1XX8 A;  3MXP A;  2B3G A;  2VB3 X;  2D0P A;  1KLG D;  4N9P A;  1JB7 A;  1SNQ A;  3FPU B;  1KQS A;  2D2C C;  4BY1 G;  1CQF A;  3RLF A;  2JA9 A;  2B29 A;  1C9O A;  3AB9 A;  3I3C A;  3DLL A;  3RZO B;  1VQG A;  1HRJ A;  2XGT A;  1KDA A;  2MO0 A;  4DV6 L;  4A3D H;  5D65 A;  3RR5 A;  3EQL C;  1FJG L;  1HQM C;  1WI5 A;  1YJW A;  2Z4H A;  3T1Y Q;  5KYI A;  1I50 H;  3F2C A;  1K8G A;  4LF4 L;  3QWN A;  1J9O A;  1SYG A;  1EQQ A;  1TQO A;  5AJ3 L;  2KVM A;  4RGT A;  4BA1 I;  4QCL A;  1ESF A;  3FHW A;  2MNA A;  2UXB L;  2ZTE A;  1IKL A;  2HUG A;  1VQ6 A;  1PFS A;  1D6E C;  5C5M A;  1STB A; 
#chains in the Genus database with same CATH homology
 3MHB A;  1EZ6 A;  4PV1 C;  2WII B;  2F0L A;  3N52 A;  2JA7 B;  5T1I A;  1TR5 A;  1S5F D;  4RWS C;  1DOM A;  2EJM A;  4OL7 A;  4A93 B;  4A3J B;  1KAA A;  5C6A A;  1YNJ D;  2F3W A;  3OHX C;  1ENF A;  3OWE B;  4O1N A;  5KRU A;  3H6M A;  4WRD A;  3GTO B;  3X3M A;  1C8C A;  4FF2 A;  3ERO A;  3S2H B;  3H09 A;  3J7Y W;  1TT2 A;  2XSC A;  1HPC A;  2A6H C;  3R2T A;  3RMH A;  4A3K B;  5M5W B;  4O42 A;  4K8J A;  1LTT D;  4K6L A;  1DCZ A;  3K5M A;  4PMW A;  2RQX A;  4QMG A;  2PPB C;  2F0O A;  4IZ8 A;  1SYE A;  2V4D A;  5C0X G;  3GV3 A;  1Q12 A;  2XWB B;  5C0X H;  1EWH A;  3PMF A;  2B2U A;  3HOX B;  2FJ2 A;  3D4D A;  2I07 B;  5LHY 1;  3DEO A;  2R92 B;  4KY6 A;  1TS5 A;  1YNJ C;  3M7G A;  1SE3 A;  1EWC A;  3PO2 B;  1SBB B;  3V05 A;  5EJW A;  1TY2 A;  1R4Q B;  2F0M A;  2RA4 A;  2OEO A;  4IAL A;  3TSS A;  3J80 E;  4XYQ A;  1ZXT A;  5FK9 C;  3TP8 A;  3GV6 A;  4TQU S;  2JA5 B;  3I8Z A;  4F87 A;  2NZ1 D;  3W2D A;  4QUF A;  3Q23 A;  2B2Y A;  3NHH A;  1V1O A;  4X3K A;  2NVY B;  4J1M A;  4ZYS A;  1QCB D;  2QF7 A;  2K05 A;  5D3D A;  3LNN A;  5I9O A;  1ZEQ X;  4KV6 A;  4IQZ A;  2IL8 A;  5ELE A;  2AWN A;  4IUU A;  1A2T A;  1Q8I A;  2BA0 A;  4XQQ A;  2E74 C;  4QIW B;  3T53 B;  3K5N A;  3MAQ A;  2IX3 A;  1XYI A;  4C3I B;  2L12 A;  3V2T A;  3BVG A;  3NBI A;  1SXT A;  1BCP B;  4NW2 A;  2R7Z B;  1NCV A;  2NTS A;  2RDH A;  2K6A A;  5CMD A;  2PZT A;  1A3V A;  1O7L A;  1U4R A;  1G2T A;  1B2T A;  1PTO B;  1LT3 D;  1HHV A;  1PMR A;  4RCN A;  2E2D C;  5CR3 A;  1F2Z A;  2WB1 B;  1JB3 A;  4XTC S;  2Q8I B;  5LL6 X;  4S3S A;  3DM1 A;  2IJ0 A;  1FD7 D;  3EFX D;  4C1N K;  2F0T A;  4B08 A;  2FMC A;  2E75 C;  1YNN D;  1OXX K;  3PV0 A;  5IGF A;  2B2V A;  4KKT A;  3TP6 A;  3AMU A;  4NKL A;  1EY6 A;  4HSP A;  5C44 B;  2MPM A;  2FHT A;  1GUG A;  2L11 A;  2WAQ B;  3J81 E;  5M5X B;  2A6E D;  4MHE A;  1PXU A;  1BCP D;  4F8M A;  1B4O A;  2XVS A;  3FEW X;  2RKS A;  3TDQ A;  3MZ5 A;  1JE4 A;  3GQB A;  5C4H A;  3MA2 B;  1Y69 U;  5M3F B;  2ZXO A;  3OIQ A;  3OIP A;  1SFO B;  4DAP A;  3U9O A;  1PTO D;  1QOH A;  2A5H A;  2ENB A;  4OIK A;  3D31 A;  1B9N A;  3L9A X;  2EYF A;  1EU3 A;  1NSN S;  4KK7 A;  1E2V A;  1B1Z A;  1YNN C;  3OPO A;  2ZT9 C;  4A3D B;  2X6L A;  1G91 A;  1I50 B;  3EJI A;  3H94 A;  2WV6 D;  2F4I A;  1EEI D;  2GA4 B;  2NWG A;  3RUZ A;  3HOV B;  1BCP C;  3VYU A;  2KCN A;  3VYR A;  1X3Q A;  1F9S A;  1Q3L A;  5EBD A;  3DWP A;  5D3I B;  3HG9 A;  2SDF A;  2RSN A;  4BBR B;  4M1U B;  4IUT A;  3S2D B;  1FGB D;  3SVM A;  1PTO C;  5COY A;  4FXK C;  2L4N A;  2K1B A;  3GTP B;  1I4R A;  4IN3 A;  2X6G A;  1XWE A;  1CQV A;  3MTS A;  1EYA A;  3VR6 A;  3ITP A;  4DA2 A;  3C46 A;  3PO3 B;  1BF4 A;  1O7Y A;  2R6G A;  2PMZ B;  4WOR A;  4TSS A;  2QDB A;  4C1N I;  1K83 B;  5IIF A;  3BVM A;  1Z6H A;  4CKB A;  3AU7 A;  1MSH A;  4CKE A;  3HZX A;  4LJZ C;  1PTO F;  4HMI A;  5G3L F;  2WP8 J;  2JE6 I;  1CM9 A;  3PIO 3;  1STN A;  3IAY A;  1QWY A;  1JCK B;  4CJ2 C;  5JPN C;  1OXT A;  4IFD G;  3A55 A;  2DY7 A;  1HUN A;  2K04 A;  3U9S A;  2O5I C;  2E2I B;  1SMY D;  1WCM B;  2E2H B;  2JXM B;  2NN6 I;  3VR4 A;  2L1B A;  1NR2 A;  2N88 A;  3I70 A;  1TWF B;  3GTM B;  1QE6 A;  1R4P B;  5DM7 3;  2ID0 A;  4L63 B;  3T13 A;  2LKV A;  2OT2 A;  1AEX A;  5IGG A;  2RBM A;  2HDL A;  2B2T A;  2CHB D;  2K5W A;  2VUM B;  3DXJ C;  2EDG A;  2EYO A;  2B63 B;  2F0F A;  1CHP D;  1IKM A;  4J6H A;  4KJN A;  3HRZ C;  5J22 A;  1ILQ A;  2MP1 A;  2H4O A;  4K5X A;  2Z1C A;  4M8A A;  3IFD A;  4HAE A;  4CHT B;  1SMY C;  1X3P A;  1CA5 A;  2IX1 A;  1LTI D;  5K36 G;  1PTO H;  2KCC A;  2Y0S B;  3NSW A;  5M3M B;  1J8I A;  3URY A;  2XRS D;  4DK1 A;  1JWS D;  4J8Q A;  3SK8 A;  1BO0 A;  4R8N A;  5KYL A;  1EFI D;  1GUN A;  3S1M B;  1QJO A;  3T4A C;  3A7A B;  1K8M A;  1ROD A;  4OO1 G;  5CV5 A;  1I6V C;  4OO1 H;  1EOT A;  1GUW A;  1GUO A;  4ABN A;  1LAB A;  1D5Z C;  3HP3 A;  2HCI A;  5EGT A;  1EY7 A;  1ESR A;  1SSO A;  2MHV A;  1Y8N B;  2ZXR A;  3K7A B;  1RD9 D;  1DOL A;  3VA5 A;  4RHR A;  2I46 A;  3NTI A;  4XYO A;  2HDM A;  1WTW A;  4LMQ D;  3MFY A;  2K5D A;  4ZUI A;  4C56 C;  1SNM A;  1F9Q A;  2NB0 A;  3KUP A;  3IKJ A;  3VA7 A;  1DYQ A;  5E4X A;  1PZI D;  3GTL B;  1WTP A;  3I4N B;  2HCC A;  5M5Y B;  2VB2 X;  2AQ1 B;  3S1Q B;  2EY1 A;  1PZJ D;  2KEC A;  3BVZ A;  3K58 A;  1HTP A;  1V1P A;  1IYV A;  1HTL D;  4EQO A;  2A6H D;  4HCS A;  5EPK A;  1S4Z A;  5I9P A;  1I4H A;  4DNR B;  1GUT A;  2Q8R E;  5CGK A;  2BE5 C;  4ZQ3 A;  1LT5 D;  1D1K A;  3A8J E;  1TS3 A;  4A3G B;  4IFD I;  2SEB D;  3Q24 A;  5HGT A;  4DGZ A;  2EY5 A;  2J7Z A;  3OMG A;  3C2P A;  5KNC A;  5EKL A;  4LK1 C;  5K5P A;  4ZKC B;  2F0E A;  4RGM A;  5CBE E;  2IT1 A;  1SYB A;  4LAA A;  2DY8 A;  1U4M A;  4F88 A;  5IGB A;  3OOC A;  1LLR D;  1RTO A;  1BBX C;  2AWO A;  3WOF A;  4XT3 B;  2NBF A;  2X69 A;  1CTM A;  1O80 A;  5FOB B;  5DAU A;  1TWA B;  3FPP A;  4IUR A;  4ZK9 B;  1BQQ T;  3NP8 A;  1ENA A;  1EY5 A;  3W3A A;  3J81 L;  1Y1V B;  5J1Z A;  5IOD A;  2D9U A;  3GO5 A;  2PYK A;  1S5C D;  4CKC A;  1U4L A;  4IFD J;  2MJ8 A;  1C48 A;  1NR4 A;  3CQZ B;  5JAV A;  3I90 A;  5CC4 A;  1HCZ A;  1EYD A;  3M4Y A;  5D14 A;  2ICE C;  4FXG C;  3BS1 A;  4KMU C;  5CV6 A;  1HQR D;  2D62 A;  1DON A;  4A3F B;  5I6Y A;  1AP0 A;  1FNU A;  4DFA A;  2E2J B;  4FXD A;  3HOW B;  4EVO A;  3VR2 A;  1RHP A;  2F0I A;  1A6X A;  5BN3 A;  3M4O B;  3SE0 A;  2EY2 A;  4HN7 A;  4N9T A;  1MGS A;  4K2L A;  2BCO A;  5IGD A;  5DM6 3;  2M00 A;  5JPM C;  1DOK A;  1CHQ D;  2J0T D;  1LTS D;  4G7H C;  2EE1 A;  1S5E D;  3IL8 A;  4CJ1 B;  3MXU A;  1CT1 D;  1SNC A;  1AN8 A;  3R93 A;  4DK0 A;  4V19 0;  1MI2 A;  5KND A;  1H9S B;  2KJX A;  4DN4 M;  2BA1 A;  1BUV T;  5CBA E;  4K5V A;  3I4M B;  3MXN A;  3VR5 A;  4WFN 3;  2IPK D;  2L5T A;  1NUC A;  5JVG 3;  3E5S A;  2WIN B;  3QG1 A;  3FVQ A;  4NP5 A;  5I4D A;  2R93 B;  1CZG A;  4ID6 A;  1SNP A;  1CZW A;  3Q6S A;  3VR3 A;  1UAP A;  1F77 A;  1EYC A;  2MUY A;  2RVL A;  1Q90 A;  1V43 A;  3QJY A;  5EPL A;  1TVX A;  3M7N A;  4KI0 A;  2XN9 C;  1SYD A;  4ZUJ A;  5JOB A;  1A2U A;  1HUM A;  2F1M A;  4TKO B;  3TZD A;  3D4W A;  1ET6 A;  3X3N A;  4KTA A;  1EIG A;  2F0W A;  3G6J B;  2B2V C;  5IT9 E;  4B9W A;  4FF4 A;  2RDG A;  3KK7 A;  1Z47 A;  3A56 A;  1PFB A;  2SNS A;  1T5E A;  3MVV A;  5DNF A;  2BDO A;  1VF5 C;  1A15 A;  2RSO A;  1IL8 A;  4X3S A;  1PDQ A;  4BS9 A;  4FF3 A;  3A7L A;  1IYU A;  2NYZ D;  1KLU D;  2SNM A;  3QIA A;  1HFG A;  4JK1 C;  1CI3 M;  4CGY B;  3NBH A;  2A73 B;  4K2K A;  1VMP A;  1BXT A;  4BWG B;  4A3I B;  1WTO A;  2WKC A;  1FYC A;  3UI2 A;  1WD0 A;  1G2S A;  4JBW A;  1EQV A;  4FF1 A;  5I6W A;  4GZY C;  3CRK C;  2NVQ B;  2EYJ A;  4R9W A;  1LT4 D;  5C0X I;  5A35 A;  1F9R A;  2JP1 A;  2IW3 A;  1DXM A;  1U4P A;  4ZAI A;  3JAM E;  3NPP A;  3ONA B;  1TKW B;  2QCP X;  2B2W A;  3ERQ A;  2DNE A;  2EYP A;  5FO9 B;  1JOR A;  2J4X A;  5J39 A;  1JC7 A;  1F9P A;  5FLX E;  5KGU A;  2B8F A;  3HEJ A;  4ZKB B;  2QKI C;  3RD4 A;  4KD3 A;  4X3T A;  3TN2 A;  3V96 A;  1L0X B;  3H91 A;  5A2Q L;  1TWG B;  1SYF A;  3Q0A A;  5HUR A;  3NK9 A;  2C5C A;  4ZLT F;  2BOS A;  2XIW A;  2F0N A;  5C3E B;  5C0X J;  3G7L A;  3FKI B;  1BNZ A;  1BCP F;  3K5O A;  4L8J A;  4C3J B;  1ML0 D;  2KED A;  1MSG A;  3A8K E;  2PQE A;  1RF2 D;  2M2L A;  3E6Z X;  4F7X A;  4C3H B;  1EY8 A;  1KTK A;  3OMC A;  2JYO A;  4XDX A;  4RA8 A;  4KJO A;  3PUZ A;  3CRL C;  1I6H B;  5JEA G;  5JEA H;  4FYD A;  4BY7 B;  1H9K A;  1SNO A;  1I4X A;  4Q0F A;  3S15 B;  5ELB A;  1NAP A;  1JOO A;  2CVR A;  4HMJ A;  1H9J A;  1A3U A;  4I7Z C;  3D4R A;  1Y8O B;  1KNE A;  1F2M A;  3KLR A;  4KN4 C;  1RDP D;  3SR1 A;  2KHS A;  2CW0 C;  1F2L A;  4A3B B;  1EY4 A;  2AQ2 B;  4DAY A;  2LMC B;  3J7A F;  1MBY A;  4H7B A;  4X3U A;  5E1F A;  3SK5 A;  1BDO A;  1PZK D;  1II3 A;  2L0C A;  4Y7N B;  1WTV A;  1HXY D;  3R3O A;  1JWU D;  1AZP A;  4Z9C B;  3NWS A;  5IGE A;  2K33 A;  1WD1 A;  3BYT B;  1TS4 A;  4L6T B;  4OGQ C;  4A3E B;  3MFG A;  5KEE A;  2KUM A;  3D3R A;  4TRD A;  4G7O C;  4PMC A;  5FO8 B;  2R61 A;  1SDF A;  1TY0 A;  2K7V A;  4QUC A;  4MIU A;  3C1F A;  1PFM A;  4BA2 I;  5I2X A;  4RHS A;  3QOJ A;  3S1N B;  4ZRZ A;  2EPB A;  2EJF C;  2SOB A;  1TWH B;  3M85 A;  3SDZ A;  3LX0 A;  1EIH A;  1EY9 A;  3LWU A;  3OW7 A;  5A2Q E;  1JOK A;  1OO9 B;  2ICI A;  3DMU A;  5EKK A;  3H3V C;  2IWH A;  1ZYR C;  3DHQ A;  3TME A;  1SND A;  5IGC A;  2K03 A;  1WTX A;  1TS2 A;  4MN3 A;  4KKS A;  4H44 C;  2BE5 D;  1A3T A;  2NTT A;  3D8G A;  1WTR A;  3TP5 A;  3S17 B;  4KKU A;  1VF7 A;  3SHL A;  2JA6 B;  2NVX B;  1ICW A;  3DWA A;  5KIX A;  4P2C B;  1IW7 C;  2Q8T A;  3BDC A;  3GP7 A;  1U9R A;  4DNT B;  3KLS A;  3S9W A;  2LFN A;  2PNR C;  3SK4 A;  1R9T B;  1E2W A;  4Q5V A;  5I2Y A;  4XQN A;  3D6W A;  1RTN A;  1QNK A;  3SK6 A;  1JQY D;  2HQE A;  3NTH A;  2VNU D;  3NWT A;  3GD7 A;  1HA5 A;  2WKD A;  3M3Y B;  3LWE A;  1D5M C;  2F0V A;  3PUX A;  4K14 A;  4ILW A;  1HA6 A;  1DJR D;  4EQN A;  2D5D A;  4DU9 A;  3HOY B;  1Y8P B;  4ODG A;  5C4Z A;  1B53 A;  4KY7 A;  1PFN A;  1VCI A;  3K59 A;  1CA6 A;  1I3Q B;  1XXG A;  3RZD B;  1Y1W B;  2R3Z A;  1RJT A;  1PRT B;  5FO7 B;  1STY A;  1G8Z D;  1QB5 D;  4FNF A;  3VYT A;  1HFN A;  1LAC A;  4PMB A;  5FKA C;  5BN4 A;  1STA A;  3BG3 A;  3P1H A;  4BBS B;  1STG A;  3ZYY X;  2LY7 A;  2Z8L A;  4C3J G;  4ULL A;  3S1R B;  5IT9 L;  1EQT A;  1EU4 A;  2F0P A;  4K6D A;  4DXG A;  1PLF A;  1QNU A;  5CV4 A;  1I4G A;  5JVH 3;  3CHB D;  3D6C A;  3EVQ A;  1GHK A;  1TWC B;  4C3H G;  1XTC D;  5ELD A;  2EYM A;  3PUV A;  5JEA J;  1SJE D;  1STE A;  1CFM A;  4DAV A;  1O7Z A;  2B2U C;  4FVM A;  4IUP A;  3K5L A;  3FMC A;  1X32 A;  3PUY A;  2EYH A;  1PRT D;  1W6K A;  2K28 A;  3KBX A;  5F2D A;  1LTR D;  3J7A V;  3GTG B;  1C4Q A;  3CU7 A;  3N6R A;  2F3V A;  4ME5 A;  4G57 A;  3K57 A;  1B44 D;  4HCE A;  1K8O A;  2EOT A;  2FMM A;  4OO1 I;  5BN5 A;  1GOZ A;  4PNY A;  3JAM L;  4YIJ A;  1UUP A;  5NUC A;  4KD4 A;  2B2Y C;  1D2B A;  2A69 D;  1LV9 A;  2CQA A;  3T51 B;  4WJW A;  1SAP A;  4AYB B;  2YU9 B;  1B9M A;  3QO2 A;  2OXP A;  3TBI B;  1WVL A;  1EZ8 A;  1ENC A;  5C3X A;  2BDN A;  4R8I A;  5FLX L;  4KHZ A;  4HR7 B;  1O78 A;  3HOU B;  1PRT C;  2PO4 A;  1H9R A;  1EEF D;  2NVT B;  4A3M B;  5KNB A;  2K32 A;  1BR9 A;  3MEH A;  5CV8 A;  5EBC A;  2XRQ D;  2O2L D;  3A8I E;  3DEP A;  3I91 A;  4XXE A;  1OXS C;  4EGV A;  3NXW A;  3HKZ B;  4U68 A;  3OSO A;  1D5X C;  2Z4I A;  2PZW A;  4IUQ A;  3HGB A;  5E3F A;  1OXU A;  3GTJ B;  3Q22 A;  1PYW D;  2EXZ A;  1JIC A;  3MWY W;  2G9H D;  4FO2 A;  1KDB A;  1ILP A;  2A69 C;  3VYS A;  4G7Z C;  3MC0 B;  1RKN A;  1PRT F;  4HSV A;  1AZQ A;  3E0J A;  5EPJ A;  3BZD B;  1GJX A;  2QIL A;  2LS0 1;  2L55 A;  1LTA D;  4UAI A;  3HS0 C;  5C5L A;  1V8Q A;  3S16 B;  2ZXP A;  1AFP A;  4KY5 A;  2F0U A;  1FNV A;  2F0J A;  1Q1E A;  1SYC A;  4EQP A;  2F0D A;  2NN6 G;  2NN6 H;  1QG7 A;  2EVB A;  1SEB D;  1B3A A;  3PUW A;  3T16 A;  4K8I A;  1JOQ A;  1JWM D;  4IUV A;  1OXV A;  1VDZ A;  4QB4 A;  2VXW A;  3KLS X;  1LTG D;  4RFB A;  3O13 A;  3DWQ A;  2N55 A;  3TP7 A;  3NUC A;  2B8G A;  4H13 C;  1IHZ A;  1CK1 A;  1H9M A;  2A74 C;  3PIP 3;  2MGS A;  3HOZ B;  2DN8 A;  1DZ1 A;  5T1G A;  4RCO A;  1UNS A;  3WDN A;  3C1E A;  2PW5 A;  2F0H A;  4FP5 D;  5G3L D;  1GUS A;  5EQ0 A;  4BY1 B;  1Z7T A;  2JEB I;  2F0K A;  2EZV A;  1STH A;  3I72 A;  4HED A;  2B2W C;  4XIG S;  1SE2 A;  1QIL A;  4PQX A;  5LL6 S;  1F2Y A;  2TMP A;  1L0Y B;  1DM0 B;  1H9S A;  2PZU A;  3OWF A;  3ND9 A;  2A6E C;  4V0B A;  2RDF A;  4IUN A;  1E0B A;  4XQJ A;  3S14 B;  4UDU C;  3QOL A;  2F0S A;  5JJZ A;  2XWJ B;  5CYU A;  1TII D;  2G9D A;  1UEA B;  3BDL A;  3CKI B;  1BOS A;  3K6O A;  1ET9 A;  4KN7 C;  2XNA C;  3H0G B;  1TU2 B;  5C3W A;  1KDC A;  1MD2 D;  3IFT A;  1EY0 A;  2CW0 D;  2KEE A;  1KNA A;  1M4V A;  1I4Q A;  2KQ3 A;  2O4X A;  4XT1 B;  3R8B A;  3DUZ A;  4CJ0 B;  1B50 A;  3ND8 A;  2F0Q A;  2JEA I;  3SEB A;  4OIJ A;  3P75 A;  1M8A A;  2FIN B;  2A68 D;  4RH6 A;  5TSS A;  3L7Z C;  1G29 1;  2L9H A;  1T5X D;  5ISR A;  2C9O A;  1SJH D;  2OF1 A;  2FFK B;  5EKI A;  3T56 B;  2O5J C;  4HTH A;  4RAU C;  2B39 A;  1RCV D;  3BYY B;  2NUC A;  3GTK B;  1ZKO A;  5IOC A;  4NMZ A;  3NE5 B;  3EA6 A;  3F2U A;  5DEH A;  2M9V A;  4CBV A;  4NDX A;  4DF7 A;  4IFD H;  1FR3 A;  1LTB D;  1G6Z A;  1AW7 A;  4RGN A;  4RKL A;  2F03 A;  2IX0 A;  1SE4 A;  1S5D D;  3GTQ B;  2B2T C;  4RKB A;  4G4K A;  1V1P B;  2JA8 B;  1WTQ A;  4K5W A;  2A68 C;  3NQI A;  1ZYR D;  3I73 A;  4OHJ A;  2H1E A;  2K01 A;  2TSS A;  4KHV A;  4E6I A;  3C3L A;  3P7J A;  5CV7 A;  3WOE A;  4QF4 A;  4DXF A;  5CV9 A;  2F0G A;  4C3I G;  2AUJ D;  2JSO A;  2PW7 A;  3R2I A;  3NTK A;  3BDO A;  5COR A;  3SXH A;  3P20 A;  1IW7 D;  2KA7 A;  1FNW A;  2KOL A;  4I65 A;  1S5B D;  3I4L A;  1D1I A;  5E4W C;  1E2Z A;  3TZU A;  2EY6 A;  1DD2 A;  5K36 H;  2EYL A;  4H0L C;  2EJG C;  4C2M B;  5ELC A;  3A54 A;  2QEJ C;  3KF8 A;  1EL0 A;  2PCF B;  2AQ3 B;  5AFW A;  2WAC A;  5ELF A;  2AUK A;  5C4J B;  3QB3 A;  1Q1B A;  1LO5 D;  5C4X B;  1I4P A;  3MXG A;  4RGO S;  1VMC A;  3KBG A;  3FRP B;  3NQT A;  2DNC A;  1ONL A;  1GXD C;  2K5Q A;  1LT6 D;  3K0Y A;  1JR0 D;  4B9X A;  2E76 C;  4U67 3;  5M9O A;  1GHJ A;  3L3O C;  1KAB A;  2YYZ A;  1W6J A;  3J80 L;  3FDT A;  1XX8 A;  3MXP A;  2VB3 X;  1KLG D;  4N9P A;  1SNQ A;  3FPU B;  2D2C C;  1CQF A;  3RLF A;  3AB9 A;  3I3C A;  3RZO B;  1HRJ A;  1KDA A;  5D65 A;  3EQL C;  1HQM C;  2Z4H A;  5KYI A;  3QWN A;  1J9O A;  1SYG A;  1TQO A;  2KVM A;  4RGT A;  4BA1 I;  4QCL A;  1ESF A;  1IKL A;  2HUG A;  1D6E C;  5C5M A;  1STB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...