1LLRD

Cholera toxin b-pentamer with ligand bmsc-0012
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords CHOLERA TOXIN B SUBUNIT
publication title Characterization and crystal structure of a high-affinity pentavalent receptor-binding inhibitor for cholera toxin and E. coli heat-labile enterotoxin.
pubmed doi rcsb
source organism Vibrio cholerae
total genus 26
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2002-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1llrD00
4Z9CB 1D5MC 4RGMA 1JCKB 2AQ3B 1L0XB 3BVGA 1LTTD 1PTOD 1S5DD 1JR0D 1LT6D 1S5FD 1PTOH 1LT3D 1PZID 1CT1D 1BCPC 3MC0B 4K6LA 2IJ0A 1BCPF 1TS5A 1I4QA 1I4HA 2WV6D 5TSSA 1KTKA 1STEA 3GP7A 4C56C 1TS4A 1V1OA 1TS2A 3MFGA 1LTID 1XXGA 1V1PA 4RHSA 1I4PA 1GOZA 1ENFA 1LTAD 3R2IA 1F77A 1EWCA 2O2LD 4RHRA 2AQ2B 1HA5A 1ET6A 3R2TA 1TY0A 1FGBD 3SEBA 5ELDA 1B44D 1S5BD 2Z8LA 4L6TB 4UDUC 4L63B 1FNUA 1JWMD 3DWAA 1AW7A 1D5XC 3V05A 3O13A 2TSSA 2XRSD 1SE2A 1HQRD 2G9HD 1EEFD 3CHBD 2SEBD 2NTSA 3OWEB 1RF2D 1DJRD 4RFBA 1XTCD 1EEID 2J4XA 1CHQD 1FNWA 1BCPD 1JWSD 1I4XA 1HTLD 1I4GA 3DWQA 4OHJA 3BVMA 1MD2D 1UNSA 1PRTC 2R61A 3URYA 1SEBD 1SJED 3BZDB 1RCVD 1CHPD 1SE3A 1LO5D 5D3DA 1QILA 1EU3A 1M4VA 1LTBD 3BYTB 5FK9C 3KLSX 1I4RA 1KLGD 1JWUD 1PRTB 1TS3A 2QILA 5ELCA 1S5ED 1B1ZA 1KLUD 1PZJD 1L0YB 4RGOS 1V1PB 3R8BA 1LT4D 1DYQA 1JQYD 4RH6A 2IPKD 1FD7D 1ET9A 5ELBA 1BXTA 1LTGD 1RDPD 4BWGB 1AN8A 1D5ZC 1PTOC 2CHBD 3W2DA 5I4DA 1LTSD 4RGNA 4TSSA 3BYYB 1SBBB 1PRTF 1CK1A 2XRQD 4RGTA 1SXTA 5D3IB 1PTOB 2AQ1B 2RDHA 1HXYD 4RCOA 4DXGA 3EFXD 1T5XD 4ZYSA 2ICIA 5ELEA 1G8ZD 1RD9D 1PRTD 1LTRD 2NTTA 1SJHD 3BVZA 1PZKD 3EA6A 1D6EC 1FNVA 1S5CD 2XNAC 5FKAC 3TSSA 1BCPB 2RDGA 1TY2A 1PYWD 4O1NA 1LT5D 1EU4A 2QEJC 2XN9C 5ELFA 1EFID 1PTOF 1CQVA 3DWPA 1UUPA 1ESFA 1SE4A 4DXFA 1LLRD
chains in the Genus database with same CATH superfamily
3HOUG 3MHBA 3BZKA 2Q2HA 2KHJA 3ERSX 4KN4C 1K83B 3CQZH 1JR0D 1LT6D 2F3WA 3IFDA 3ULJA 3D0FA 1CI3M 1I4HA 2VW9A 2Y0SE 1VQMA 1JOOA 3K7UC 4EGVA 2JA6H 2ZXOA 3A8IE 2WFWA 2NZHA 4OIJA 3EVQA 1PH3A 3K5NA 4DV3Q 3S14B 2CVRA 4R4IA 1JJ2A 1KXLA 4A3DH 1KRTA 3GTJB 3AMUA 2F1MA 4DR6L 2ALYB 4MZ9A 1KABA 2NVXH 2LY7A 4L5QA 2Q2IA 2NTSA 3RN5A 4L5RC 4C3IB 1OXVA 1HNZL 2XTIA 3HKZB 1GM5A 2RVLA 1KDCA 1KL9A 2VXWA 5HGTA 4GKJL 2CW0C 1IL8A 1CHQD 2ICEC 4GNXB 1EZ8A 2F0PA 2F0EA 1JWSD 1I4GA 1HTLD 2JEBI 2H5XA 5JJLA 5E1FA 1LACA 2B2UA 2A6HC 1N34Q 1L0WA 1EY7A 5AJ3Q 2B63G 1QZGA 1E24A 3VYUA 3I3CA 3M7NA 1LT4D 1A0IA 1VQHA 3JAMi 2BCOA 2CH4W 2PI2E 3FRPB 2IX1A 3SGIA 5I4DA 2F52A 1NMFA 3KLSA 1N36Q 4X64L 4HSVA 1QUQB 1G291 3GTOH 2XWJB 3M7GA 2A68C 4LF4L 2NN6G 3T4AC 2JA9A 3KF8A 1J6QA 2EDGA 4GZYC 2PMZE 1NAPA 1QNUA 3F2CA 3SVMA 2JN4A 4HSPA 4RA8A 2F0UA 2NVTH 1BF4A 4XQQA 4A3FB 1EWIA 3PUYA 4ME3A 1HNXL 5IP9G 2L12A 5LMNW 1JE5A 3MEFA 3VA7A 2F0SA 2FHTA 3CCUA 1I3QH 2CQAA 1SMYD 3NTHA 4GS3A 1BBXC 5FJ8G 4XT3B 4KHZA 1E1TA 1MJCA 1T9HA 3KOJA 4OL7A 2AWNA 3K5MA 4A3IG 2K5QA 1RKNA 2EY2A 3NBHB 2RKSA 2AQ3B 3NQIA 1Y14B 4AYBE 2K4KA 1UAPA 5IODA 1LT3D 4FYDA 2E8GA 4FO2A 1BCPF 3TP8A 4A3KH 3HOYG 1E2VA 1V1PA 2JA8G 2E5LL 3NPPA 3GTGH 4I7ZC 4BY7B 3CMAA 2LS01 2N49A 1I94L 1U4PA 3R2TA 5CV8A 5H1SE 2FJ2A 4C2MH 1N33L 4FDBA 5M3FB 1S5BD 1SE8A 2B8GA 3OIQA 1STHA 2Z6BA 2KQ3A 3RNUA 5GQOA 5T1GA 4NKLA 2YTYA 2M2LA 1XNQQ 2F0GA 2K5VA 4JI5Q 4OO1G 3WOEA 1VQDA 5ISRA 1IBKL 5CBEE 1BCPD 3PV0A 4K5WA 1SYFA 1UNSA 1Y1WG 1EOTA 2JA5G 2L1BA 1KAWA 2D0PA 1I6HB 2OWOA 4EQNA 1EU3A 3X3MA 2NN6I 2ZJPA 4UP7A 3J81i 1TWCB 3ULLA 3M4PA 4G7HC 1BR9A 2X6GA 3HOUH 4JPBW 4HJ9A 3NEMA 1W3SA 3NBIA 2QGQA 2WAQE 1D5ZC 4Q0FA 1UE1A 2IX3A 1X3EA 4LFCL 1B9MA 3TZDA 1P16A 1S72A 4GLAC 5D3IB 3ND9A 2JJQA 4F87A 1LYLA 3J7YW 1H9JA 4QY7A 3KLRA 3CRLC 1HH2P 2R7ZG 1IXRA 3GQBA 3G4SA 1JJCB 3TSSA 3W1BA 3OHXC 1LT5D 5CYUA 3T1HQ 4DR4L 1CSQA 1EY4A 1WJJA 2DUDA 2EYMA 1DCZA 2XN9C 3DEPA 1CA6A 1UUPA 1CQFA 4LNQA 3MXGA 3U9OA 2O5IC 4G57A 3MFYA 1SNCA 1HFNA 4KY6A 5IYDG 4WJWA 4DK6C 1RODA 1VQGA 5FLXc 2YTVA 4DF7A 2JE6I 3FHWA 2GVBA 3S2HB 1HNWL 3RR5A 4OO1I 3H0GH 1YI2A 3CC7A 4K2KA 4MTNA 5JEAH 4RHRA 4QIWB 5LMUQ 3K7AH 3I72A 2AQ2B 1HA5A 4RKBA 3SK6A 4C3JB 2RF4A 1EQTA 3S15H 1JWMD 3A56A 3DXJC 2K5HA 2K6AA 3VR4A 4ZUIA 1STBA 1H95A 4DR3Q 5DNFA 4K0KQ 3IKJA 3PIO3 2C9OA 2NN6H 4PV1C 5CV6A 3M3YH 1KC8C 2I0QA 1FNWA 2V4DA 1IW7C 4IUNA 3DWQA 2MQHA 3NWSA 1ICWA 4DV3L 1WCMG 2HHHQ 4POGA 3OOCA 2UUAQ 4TQUS 2NZ1D 1YNJC 3T51B 5IP9H 3S1MH 4FXKC 3VDYA 3SK5A 1PYSB 1X55A 2B2VC 2ZJQA 3PO3G 5C4XB 1HZCA 2YTXA 4PQXA 1GUSA 1I4RA 5C3EB 1H9SB 3TDQA 1X56A 3GDEA 2XIWA 4JBJA 3GV6A 1DYQA 2Y0SG 1C48A 3I4MH 5I6WA 5IYBH 1VQCA 1I50H 5IGBA 3S16B 2R93H 2HD3A 1A3TA 2R7FA 2A6EC 1N34L 4IPGA 5AJ3L 4PNYA 1WTPA 2PO4A 5EKIA 1WTRA 2RDHA 3J80c 2E2HB 2M9VA 2NUCA 2UXBQ 3OWFA 1RHPA 4HMJA 3HOZG 4UHVA 4RMFA 4DK0A 4A3BB 2VS1A 1K0SA 2RCNA 2FFKB 2EY6A 1EQVA 4K5VA 3ER0A 5CC4A 1YNXA 3CRKC 3UDFA 1N36L 1JE4A 4WRDA 3G6EA 2PZTA 1EIYB 1M1KC 5IGEA 4PMWA 2K05A 3TEHB 4P72A 1VQ9A 1G6PA 1ESRA 4OO1H 4IUUA 4A76A 4RWSC 5EBDA 2BE5D 1PTOD 2BDOA 5M5XB 1PMRA 1C7YA 3MXPA 3NELA 5CMDA 1Y1WH 2JA5H 4BY1G 1SRUA 4DV5Q 1VQBA 1B4OA 5IP7H 2L5TA 4RHSA 2R92G 4TVAB 2AWOA 1PH6A 2SOBA 5IGCA 4DV1L 3UE0A 1JB3A 4U673 3DUZA 1XPRA 2ZJRA 2Z8LA 5FLXE 2E2IH 4L63B 4GN5A 4C3HH 1N32L 2UUCQ 3CCMA 2RHQB 2JXMB 2Z6KC 2SEBD 3KF6B 5EPKA 1GXDC 2EPBA 1VQIA 3I55A 2RBMA 1JOQA 3DMUA 1V9PA 5IGDA 4QF4A 3FKIG 1XYIA 4PZ6A 1PH5A 1M4VA 2HDLA 1K0RA 3AB9A 4ZCKA 1KLGD 2F4VQ 5ELCA 2EYLA 4AYBG 2Q2TA 1PZJD 4NXMQ 1XNQL 1V1PB 4JI5L 1GD7A 3I7FA 5ELNA 2OQ0A 1Q81C 4OIKA 1MKHA 1YHAA 4DN4M 2WP8J 3G7LA 1HA6A 5IYDH 2NYZD 1EYCA 2KA7A 3GTQH 2KOLA 3W2DA 1F9RA 3J7A5 1CA5A 2JQOA 3ND8A 3EFXD 4YY3Q 2F0JA 5JOBA 4TRDA 3FEWX 5M3MG 5C0XG 1Z7TA 1ZXTA 3BVZA 2WIIB 3TBIB 1TWHB 3VR2A 1YBYA 1SNOA 3H3VC 1F2LA 4A3DG 5FKAC 4N9PA 1U9RA 1F2MA 1HTPA 1STAA 3E5SA 4EQ5A 5FLXL 4HIKA 4LK1C 3R3OA 1KD1C 3BU2A 2DJGC 1PFMA 2L15A 4DXFA 2VL6A 5C6AA 4DNIA 3I91A 1STNA 4ZQ3A 3K58A 2OTLA 4Y7NH 2OQKA 4A3JB 2ZTEA 4IOAA 3E9HA 3TMEA 4CGYB 1Y1VH 4R9WA 5DM73 2PYKA 1HR0Q 3E0JA 5NUCA 1TWAH 3MFGA 3T1HL 1VMPA 2HUGA 3I2ZA 4CKCA 2WAQG 5FO8B 1F9PA 2WINB 5C44G 2ZT9C 2OEOA 4FF1A 2AUJD 2L0CA 2JYOA 2AMCB 2LXJA 4KY5A 4UP9A 4X65L 1NSNS 1D5XC 4H13C 1YVCA 3P20A 2KJXA 3T1YQ 3HG9A 3PF4A 2B3GA 4ULLA 3HOVG 2PW7A 1VQJA 1BBUA 2D9UA 1SYEA 2MO1A 5D14A 5J39A 5LMUL 2VUMB 1NUCA 3QB3A 3I56A 2C5CA 4YCUA 1WFQA 3A5ZB 1HHVA 1ENAA 3I4NH 1Z9FA 3VYRA 4JI1Q 2Q8IB 3GTMH 1L2FA 1SMYC 2J0TD 4DV7Q 1S5ED 1GUGA 3KDFA 4RGOS 3R8BA 5C0XI 4M8AA 4ZRZA 4E6IA 4DR3L 2JA6B 4X3UA 2PPBC 1JQYD 3M4OB 4K0KL 2NVQH 1LTGD 4ZKCB 5G3LD 4JBMA 2UXCQ 3K0XA 3D6WA 3IRBA 3P1HA 2HHHL 1OXTA 3G48A 2UUAL 3BYYB 4A3KG 1PLFA 3S1QH 4BY1H 1IYJB 4WORA 2HQLA 4RCOA 3CW2C 3K6OA 5FO9B 3G6JB 3GTLH 2PNHA 3Q23A 3W5OA 1PA6A 4O0AA 1YJ9A 1SNDA 5FLMG 2ZXRA 2VB3X 3CCSA 4DAPA 4BBSH 1Y8NB 3J81j 1EIGA 1D8LA 1CQVA 3NHHA 1RIPA 1MSGA 3FPPA 2B2WC 4GN3B 3CCLA 3Q0AA 1U4RA 5C5LA 2EIFA 4JI7Q 1FL0A 4KN7C 2CFMA 3DEOA 1LTTD 4RKLA 5BR8Q 2UXBL 4KJNA 3MWYW 3AFPA 5IT9c 1BCPC 2JSOA 4GKKQ 3FKIH 3BS1A 4B3SQ 1C0AA 1BDOA 5M5YB 4IFDH 2NB0A 4F88A 4A3GH 2LKVA 2Q8TA 4IPCA 2K50A 1EIHA 1ENFA 4HJ5A 4IUVA 2L55A 3HOWG 1U5KA 2F4IA 2KHIA 1E7ZA 1RJTA 3RZDH 3SEBA 1A6XA 5KNBA 1X32A 4L6TB 3OPOA 4EQOA 3NENA 4DAVA 4JI4L 5LL6S 2B39A 3V05A 1RTOA 4K8JA 1YNND 1FYCA 4NPSA 2G9HD 4DAMA 3CHBD 2L11A 4IZ8A 1QVGA 1I3QB 2HDMA 3L0OA 1A15A 5IE8A 4DV5L 3E3XA 1XTCD 5FO7B 2VB2X 1XMQQ 1E2WA 4G7ZC 2UUBQ 2JA7H 1VQKA 4U68A 1EWHA 4YWKA 5M3MH 5C0XH 5IGGA 4KK7A 5KEEA 1OXXK 4X3SA 2IY5B 2E2JB 1X3QA 2EJGC 1AE2A 1EIFA 1QILA 5BN4A 1HUNA 1H9KA 4OWXB 5FK9C 3MTSA 4HIMA 2Z1CA 1TS3A 2UUCL 4CHTB 5JVH3 4J1MA 1E22A 1IBLQ 1IKMA 3KUPA 3S2DH 4LF6Q 1HZBA 3K57A 4A3LH 3CC4A 1X54A 5L37A 3GTGB 2N8NA 4IN3A 1PV4A 4HAEA 4A3MH 5IOCA 2RCFA 2IL8A 2F3IA 1ILPA 1GO3E 4HCSA 2QDLA 3ZYYX 3S24A 1FJGQ 1PTOB 4X3KA 5C4JH 2F4VL 1UE6A 3S17H 3H0GG 3KK7A 5JEAG 1PRTD 2Z0SA 5C44H 1TQOA 2M00A 2FMCA 2A74C 1D6EC 2RDGA 2EJMA 1TY2A 1PYWD 1G2SA 1EY5A 2VNUD 1EU4A 3E0EA 1BNZA 2BA0A 2KCCA 5K36G 2NWGA 1XPUA 3LWUA 3SR1A 4DK3C 3HOVH 3GO5A 2VQEL 5J1ZA 1F9SA 3CXCA 1JCKB 4YY3L 1MGSA 1GKHA 5JAVA 4DV0L 3HOUB 1OO9B 1TS5A 2MFIA 5DM63 1YEZA 3STBD 2PZUA 2B2TC 3GP7A 2VZAA 2EY1A 4WFN3 1LTID 3CP0A 3I70A 3K59A 2WB1E 1A8VA 2K52A 3A7LA 1GOZA 3U9SA 2K75A 1FGBD 1GJXA 3TP6A 1B44D 4NB3A 1VCIA 5IT9E 3H6MA 3KBGA 4RG1A 3GTPH 4B9WA 3I4MG 1E1OA 1PH4A 1KNEA 5IYBG 4UP8A 2F03A 3RN2A 2TSSA 2PNRC 1K83H 4R4TA 2R93G 4GLXA 2UU9L 2UXDQ 1HR0L 4LF7Q 1G6ZA 1W6JA 4K5XA 2KCMA 4H0LC 4BS9A 1ZYRD 4OHJA 1RTNA 5JPMC 5EKKA 4L5SA 3D31A 1U0LA 2D62A 1L1OA 3A5UA 2EYOA 5E7NA 1QNKA 2WACA 5FLMH 1SNQA 4GOPA 3NK9A 4R4CA 5C3WA 1RL2A 4DR1Q 2PW5A 2NZOA 1CUKA 1PFNA 2H1EA 2B63B 1MSHA 3T1YL 4GNXC 3ICEA 5CV7A 4K8IA 3UDIA 4BWGB 4C3IH 3M4YA 4DR7Q 2VY3A 1AN8A 2QKIC 2BE5C 1PTOC 1I5FA 4DV2Q 1EFWA 3QWNA 4QJFA 4DUZQ 2EYHA 4YIJA 1CK1A 1BO0A 1F2YA 3NTIA 4JI1L 4IURA 4P75A 2AQ1B 1HZAA 4ID6A 4H7BA 3S9WA 5IP7G 1ASYA 4A75A 1HJPA 1HUMA 2PI2A 3HOWH 4P2CB 4CBVA 3NSWA 2DNEA 1FNVA 3HEJA 2UXCL 4C3JG 5IT9L 3I90A 3RUZA 1YITA 2QEJC 4C3HG 3S1MB 5ELFA 4FF4A 1SE4A 1TS2A 1HPCA 2N55A 1LUZA 5F2DA 5KYLA 3N52A 4JI2Q 4WJ4A 2CWAA 3PIP3 2ZM6Q 2CH4A 3KDFB 3L9AX 1AFPA 1L0XB 3AFQA 3BVGA 4A3EB 2ZTDA 3PUZA 4KHPQ 4A3IB 2R7DA 1JMCA 5TSSA 1PH7A 4MN3A 4CDFC 1I50B 1X3GA 3NQTA 2B8FA 4A3FH 4IUTA 1CKOA 3SXHA 1Q90A 3HOYB 1EOVA 3QG1A 1TWFB 4LUZA 3K5OA 4IJHA 2EOTA 2MUYA 1TY0A 4PZ8A 4JI7L 2JA8B 4C1NK 2A1AA 2G5DA 2NVYB 1GUOA 1G91A 3JAML 3G71A 2KBNA 4JK1C 1AW7A 4GKKL 3O13A 5EPJA 2N78A 4F7XA 3L2PA 3MXNA 1YJWA 4V0BA 2OXPA 2MJ8A 1IBMQ 1CZWA 1PHJA 3EIVA 1SYGA 1VDZA 1X3PA 2MGSA 1TXYA 2CKZB 3HP3A 2R6GA 1WD0A 2GA4B 3CKIB 1B8AA 4BBRG 1K3RA 3FPUB 4J6HA 4CDEC 1Y1WB 1MHWC 5M3FH 3OW2A 3J81E 4KY7A 2F0MA 2KEDA 5I6YA 5K36H 4QGUA 3NXWA 2J7ZA 4QQBX 1E2ZA 3RZOH 4RH6A 1SNMA 1XMQL 2UUBL 2AHOB 5IYCH 4R8NA 3W1GA 2O4XA 2CHBD 3C46A 2FMMA 2KUMA 3ULPA 2E2IB 3M4QA 3HOXB 4IUQA 1Y1VG 3B6YA 3FMCA 2GVAA 2YU9H 1PXUA 4KV6A 1Q7YC 4A93B 5GAGC 2EE1A 1QVCA 3HKZE 4NDXA 1SNPA 1VQEA 1IBLL 4ZLTF 4LF6L 2MPMA 1XPOA 1D1IA 2F0FA 1WTHA 2BH2A 2F0LA 1LV9A 4R4QA 5C5MA 1B7YB 2WKCA 2F0KA 3SK4A 2R7ZB 1PTOF 3DWPA 2K04A 3NTKA 3DLLA 3V96A 1EY9A 2YYZA 1FJGL 4I65A 4B3RQ 4ABNA 4HIDA 1S5DD 1SYCA 5DLQE 5K5PA 2K03A 1EY6A 1PZID 1CT1D 1TWGB 3M85A 1A3VA 1VQ7A 1JT8A 1DGSA 1STEA 4FVMA 3I4NG 1STGA 1QWYA 1KQSA 4CKBA 3PIOA 1EY8A 1I6VC 3SE0A 1F77A 1EWCA 4APVA 1VF7A 3J81L 3D8GA 1V8QA 4IO9A 1PDQA 2OT2A 4XQJA 4LF9Q 2E76C 3DWAA 2PZWA 4IALA 1SE2A 2X69A 3A55A 5C3XA 3TP5A 5CV4A 4DV4Q 3M9BA 4DR2Q 1EL0A 1VQNA 2ATWA 3H3VI 2JEAI 2J4XA 4DKAC 3S2HH 5CORA 4J8QA 1MD2D 4Y7NB 2IHEA 3URYA 3KF8B 1U4LA 1DXMA 2PQEA 5D3DA 1WCMB 2RQXA 3BYTB 4C3JH 2K5WA 4KI0A 4HJAA 1PRTB 2QCPX 3S1NB 4BBSG 2BA1A 1KLUD 2UXDL 1TWAB 3AYHB 4G4KA 3PO3B 4LF7L 4POFA 2JK8A 3EROA 1WD1A 1G51A 1JICA 2F0HA 2WB1G 2Y0SB 3PO2G 1ONLA 3J80i 3TRZA 3UDGA 1R4PB 2CCZA 2B29A 4IFDG 2DY7A 4A3GG 5HURA 2FINB 5BN3A 1WTQA 3TQYA 5C4XH 5ELEA 1GUWA 2K33A 1A63A 5C3EH 1CFMA 1KRSA 3CCJA 1O80A 4AQYQ 3W3AA 4EX5A 4DR7L 3J7AV 1VMCA 1XX8A 3HOZB 2PQAA 1L1OB 5A35A 4XYQA 4WJ3M 2F0IA 3GTKH 4HTHA 1OTCA 4DUZL 4H44C 1YNNC 3F8TA 3GV3A 4GOPB 1BQQT 3S16H 2D2CC 4K2LA 5KRUA 1LLRD 1BKBA 4B3MQ 2FXQA 3OIPA 5EAYA 1X6OA 3BG3A 1DOMA 1Y69U 2EYPA 3EBEA 1XNRQ 4PMBA 2JA7G 1HQMC 1UE7A 1O7LA 2B2UC 2E2HH 3PUVA 2NVQB 1I4QA 2RHSB 1G2TA 1KTKA 4MIUA 5EPLA 2IW3A 4BBRH 4JW0A 4DAYA 3F1ZA 3QR8A 1S40A 4S3SA 1XXGA 1MI2A 4JCVE 3S1QB 4A3BH 3CAMA 5GADC 1V43A 2EXZA 3K8AA 3R2IA 3L3OC 4BXXG 3MXUA 4R1JA 3U4VA 4JI2L 2R92B 2ZM6L 2EYJA 4A3LG 3H3VH 1BUVT 5EBCA 4A3MG 1B70B 4KHPL 4LUOA 4KJOA 2E2DC 5CV9A 2ZTCA 3J7ZC 1T5EA 5DEHA 5KNDA 5M5XH 3EQLC 3T16A 1DJRD 1CTMA 1KAAA 1FVIA 3RLFA 4YCWA 2PMZB 4OONA 4IPDA 1YHBA 1K3BC 2F0WA 1E3PA 4LFAQ 1R4QB 2DNCA 4YHHQ 3CPWA 1PRTC 1SMXA 1XJVA 1SJED 3BZDB 1J5EQ 1HRJA 3J7AF 4IFDI 4MNOA 1BBWA 5G3LF 3HKSA 1JJGA 1IBML 3I4LA 4QIWE 3Q8DA 1BXTA 4AYBB 1VQPA 1HZ9A 4JI3Q 1K73C 2K5DA 3RZDB 3V2TA 2B2YA 1Q1BA 4AIMA 1SYDA 4RGTA 3FVQA 1N33Q 3CQZB 4DR5Q 3MXNB 2CWPA 4GLVB 4P73A 3H15A 2EXDA 4QUFA 3KLWA 2ES2A 4HEDA 1NY4A 3I73A 1X3FA 1QZHA 1S5CD 2KVMA 2XNAC 1QG7A 5M3MB 2KECA 3MA2B 2B2VA 5GAHC 4A4IA 5M5WH 1O7YA 4A3DB 5GROA 1GUNA 1ML0D 2JP1A 3D4RA 3HGBA 1X65A 4RGMA 4R8IA 2K28A 4JI6Q 4H02A 4DK1A 2NVXB 2GN5A 5ELBA 4N9TA 2DY8A 3MC0B 1S3OA 1ZYRC 3A54A 1Q1EA 1UWVA 1J8IA 3LNNA 4C56C 1V1OA 3PSIA 2QW7A 4PZ7A 1XTDA 3CCQA 3H91A 1VQ6A 1YIJA 1X9NA 1C9OA 1BOSA 2KHSA 1MBYA 2A69D 1SROA 4B3RL 2WAQB 4UDUC 5LMNQ 2E75C 5C44B 3HS0C 4C3IG 4CJ2C 3L7ZC 2Q2UA 4CJ1B 1B2TA 4OX9Q 3HKZG 3CF5A 1CSPA 1KHIA 3PO2H 2K01A 1RF2D 2ASBA 4RFBA 2D5DA 3ZJYC 1WTWA 1SLJA 3NP8A 4FF2A 3HOVB 4ME5A 3BVMA 3GTOB 3ONAB 5E4XA 1K8MA 3JC66 3UDXA 4LF9L 1CHPD 3T13A 1LO5D 1SN8A 4NP5A 1AH9A 2QF7A 2KEEA 4UAIA 1LTBD 3E6ZX 1J9OA 3KLSX 2NVTB 1Q12A 3U58A 4N8X1 1NE3A 3K5LA 1NJIC 4DV4L 1H9RA 1ET9A 3NUCA 2A8VA 2R3ZA 3JAMc 1VS0A 5JJIA 4FXGC 2XGTA 3NE5B 2Z6KA 2VUMH 1HR0W 3GTPB 1PRTF 1SFOH 1NCVA 3NWTA 4LWCA 2ENBA 2XSCA 3I4OA 1HXYD 4A3FG 4A3KB 1LM0A 4MHEA 4ZYSA 3CCEA 1O7IA 4JI0Q 5E3FA 2NTTA 2RSOA 3U4ZA 1Q8KA 4KKSA 4BXXH 4JI8Q 1H9SA 5I2YA 2I5MX 1B50A 1CM9A 2ZXPA 3M4OH 3WOFA 2LMCB 3VYTA 3P75A 1EQRA 2P5ZX 5FOBB 3S1RH 4C2MB 3ERQA 5CV5A 3PUWA 5C0XJ 5KYIA 5HGQA 1B3AA 1TIID 4HN7A 4IUPA 4C1NI 1S5FD 4X66Q 4DV6Q 4KLKA 4NXML 4TKOB 4AQYL 4NXNQ 4BY7G 4JG2A 3VR6A 4IQZA 1R9TH 4HIOA 1MJEA 5M3FG 1M90C 4B3ML 1W6KA 1W2BA 1P8LA 3HOWB 1NNXA 3TZUA 1XNRL 5IYCG 1B3QA 1QE6A 3MVVA 3MAQA 4JC0A 4DPGA 4ODGA 2HQEA 1JC7A 4KKUA 4ZUJA 2PQAB 4JV5Q 4X62Q 1Y8OB 1IKLA 5M5YH 1Q82C 4B3TQ 1DZ1A 3FP9A 1SYBA 4DA2A 4LF5Q 2Z4HA 2SDFA 1DD2A 1O7ZA 3PGZA 2OF1A 4JVZA 3CU7A 3BJUA 5CGKA 4OGQC 1PH1A 4QB4A 2MO0A 3A8KE 5EJWA 1TU2B 1DOLA 4DAYB 4IOCA 3A7AB 1L0YB 1UEAB 4A3CH 4LW1A 3KJOA 1QB5D 2HCCA 1GUTA 2IPKD 3MZ5A 3UE1A 3J81c 1U4MA 1RDPD 1UE5A 1M8AA 3QOLA 1B9NA 4LFAL 4YHHL 3KBXA 3KF6A 1QVFA 4DV1Q 4TSSA 1XMOQ 4A3EG 4DGZA 1F9QA 5LL6X 2EYFA 1J5EL 1TR5A 4DXGA 3S14H 2E2JH 2IHFA 4Q5VA 3GTJH 1N32Q 4QCLA 1GHKA 1RD9D 1LTRD 4LUVA 4CDDC 2L4NA 2LFNA 4LFBQ 3JAME 3EA6A 3KYHC 1VQ5A 2O5JC 5AFWA 3H0GB 3PUXA 1TVXA 2XVSA 4JI3L 3K7AB 3TP7A 1OXUA 2K14A 3ITPA 2PCFB 4DR5L 3S15B 4JOIA 1FGUA 1QCBD 3DHQA 3IL8A 4LF8Q 3VYSA 4R4OA 3PCOB 4DV7L 1PTOH 3RZOB 3A74A 1IYUA 1STYA 3M3YB 4KMUC 4J15A 1VQOA 2EQSA 3QOJA 1K8OA 1PVOA 4HMIA 1AEXA 4QMGA 2N3SA 3AEVA 2YU9B 5KNCA 1YZ6A 3BZCA 4JI6L 5ELDA 1Z47A 4PMCA 2A19A 4XTCS 5IGFA 1WTOA 1CKNA 3HRZC 1O78A 2K1BA 4DUYQ 1NR4A 3I4MB 2B2WA 3HOXG 4B08A 1S4ZA 1SAPA 2R93B 4JYAQ 4RCNA 3EJIA 4A93G 5C4XG 1PH2A 2R61A 2MP1A 5C3EG 1C4QA 5LMNL 1SE3A 2LSSA 4EQPA 4RAUC 4O2DA 5BR8L 4OX9L 4QUCA 3T53B 3IFTA 1NR2A 3U50C 1II3A 4B3SL 2Z4IA 1F2ZA 3WDNA 2K32A 4BA1I 5IWAQ 5D65A 1WTXA 1TKWB 5GAEC 3QO2A 1WOCA 1SBBB 1D7QA 1N9WA 4BY7H 4L5TA 4O42A 3H94A 3F2BA 4OXPA 2CW0D 3RMHA 3PIPA 3KJPA 4PG3A 2C35B 4X65Q 2JA5B 1KIXA 3D4DA 4A3BG 2G9DA 3UI2A 2IT1A 1Q8IA 2A6HD 1PZKD 1OXSC 2B63H 4KTAA 1AP0A 4XT1B 1NBWA 5J22A 1VQ4A 2AUKA 4P71A 4MTKA 1K8AC 5JEAJ 2HIXA 4C3HB 4HJ7A 3I8ZA 2KENA 4JI0L 1I6HH 3A8JE 2B2YC 4JI8L 2QA4A 2OTJA 3C3LA 2A68D 1TWCH 2OCEA 1TS4A 4DU9A 2MNAA 1VQFA 1A2UA 2TMPA 3TREA 4CDCC 2DN8A 4F8MA 2O2LD 4BA2I 4YWMA 1NTGA 3F2UA 2QEXA 2HT1A 2Z9HA 5FJ8H 4X66L 1FNUA 3AQQA 4DV6L 3K80C 3TS2A 3FDTA 3BDOA 1HQRD 1EEFD 4A3EH 4NXNL 2I07B 4K14A 4A3IH 2RDFA 3Q24A 3OTOQ 5C4HA 1EQQA 3GTKB 3GTQB 2A73B 2VQFQ 4OELB 4UY8C 4KD4A 3H09A 2IWHA 5COYA 3E9IA 2KCTA 3HOYH 3LX0A 1TWFH 3PMFA 2NBFA 3CMEA 4K6DA 4JBKA 2B2TA 4IJLA 4DNRB 3TS0A 2JA8H 2YV5A 4YWLA 2NVYH 5CR3A 4ZAIA 2F3VA 4BBRB 3LGJA 4HJ8A 4JV5L 2I5HA 4X62L 1E0BA 3X3NA 3DM3A 1EY0A 1FD7D 3A0JA 5BN5A 1K28A 2MHVA 2K7VA 4B3TL 2XWBB 4LF5L 1ZEQX 4I7AA 3QJYA 1AE3A 2I46A 4XDXA 1KNAA 2X6LA 3F2DA 1SXTA 1FR3A 2ID0A 4JI4Q 1C8CA 3K81C 1DONA 1Y1VB 2ICIA 1PFSA 1SJHD 3BDLA 5E4WC 2A69C 2EJFC 1YHQA 4FF3A 3GD7A 4OEMB 1EYDA 4OWWB 1VQAA 4KHVA 3Q22A 1XMOL 5LHY1 4Y52H 4A3JG 1ZKOA 2LXKA 4FP5D 5DAUA 4GNXA 4Z9CB 3K0YA 3HOXH 2RSNA 1CZGA 4AH6A 5T1IA 2N88A 4DR1L 1BVSA 4GN4B 3CPFA 4DR6Q 4A93H 2SNMA 2BH8A 2IJ0A 1K8GA 2RA4A 4LFBL 1WI5A 2WV6D 2L9HA 3DM1A 2HIVA 1HNZQ 1EUJA 4ALPA 4GKJQ 4DV2L 5A2QE 4M1UB 3RLOA 3KFUA 4IPHA 3I4NB 1ET6A 1YJNA 2R7ZH 3GTMB 3HFZB 3PQIA 4LF8L 1ASZA 3N6RA 5JJKA 1SR3A 1QUQA 1VQLA 1A3UA 4FXDA 4B9XA 1Y8PB 1SSOA 1LABA 3CD6A 1N8RC 1GVPA 3OWEB 1TWGH 2VUMG 4UPAA 2I5LX 5M5WB 3QIAA 3LWEA 1KDAA 5EQ0A 1SDFA 2BOSA 4BY1B 2SNSA 4X64Q 4QL5A 1TT2A 1RCVD 1IYVA 2H4OA 2AKWB 2VQEQ 4KKTA 5J3BA 2DJFC 2JA6G 4LF4Q 3GTLB 3CCVA 3OW7A 1JWUD 2QILA 4DV0Q 4HR7B 4DUYL 3NBHA 5I2XA 4EVOA 1HNXQ 4XYOA 5I9OA 2IX0A 4JYAL 4BBSB 2D0OA 1DOKA 2DGYA 1IHZA 1Q3LA 4X3TA 5ELOA 1LTSD 3RLNA 4RGNA 3SHLA 3J80E 1NMGA 1CKNB 1JOKA 2XRQD 4ZKBB 5M9OA 2WB1B 2F0OA 3EN2A 3OSOA 3PO2B 4XXEA 3FKIB 1IW7D 3MEHA 1MIUA 1WCMH 1G8ZD 4LMQD 5JPNC 5A2QL 3S1NH 1YNJD 3OMGA 4NMZA 2UU9Q 4A3GB 1Q46A 5C4ZA 1PYBA 2F0QA 3PO3H 1AZPA 5IWAL 1BCPB 4OWTB 4G7OC 1EYGA 4ILWA 4XIGS 3SK8A 4LJZC 3PF5A 2E5LQ 1GHJA 1EFID 3D4WA 3R93A 1Q86C 3Q6SA 1ESFA 1I94Q 1D1KA 4P74A 3STBC 1D5MC 5JJZA 1LTLA 5CBAE 2HCIA 2EY5A 1WTVA 5IIFA 4K6LA 1QOHA 2A6ED 1CKMA 1HFGA 5EKLA 1L1OC 3CCRA 4GOPC 1B53A 2JA7B 4FNFA 4NW2A 1I4PA 4HCEA 2BDNA 1SFOB 1LTAD 1IBKQ 1VQ8A 2EZVA 3HOZH 1KDBA 4A3CG 3C1FA 2F0TA 1H9MA 2WKDA 1QJOA 1D2BA 1ICFB 3OMCA 3S2DB 3WWVA 5HY6A 1HCZA 2F0VA 2XRSD 3VR3A 4DFAA 4JOIC 4KD3A 3RD4A 1JORA 5KGUA 4A3MB 1IZ6A 3VA5A 3J80L 2CQOA 1EEID 4ZK9B 3S1RB 1TWHH 2K5NA 4DNTB 1A62A 3C1EA 2F0NA 1JB7A 1I4XA 1PFBA 3IAYA 1EZ6A 4LFCQ 1SEBD 5C4JB 3T56B 4X6AH 1DM0B 1ENCA 4JBWA 5JVG3 5IY0A 3S17B 2R92H 2KCNA 1PH8A 1WVLA 2A5HA 1B1ZA 1VF5C 2E74C 4A3JH 3SDZA 1UEBA 5EGTA 3OTOL 1R9TB 1A2TA 1EYAA 2VQFL 1AZQA 3AU7A 3HZXA 2EVBA 4LAAA 3CC2A 4L8JA 4CJ0B 4CKEA 2QDBA 3D6CA 4DR4Q 2F0DA 3BDCA 3P7JA 1IL2A 4XQNA 1PH9A 3TN2A 1Z6HA 3D3RA 5I9PA 1T5XD 1WYDA 3C2PA 2Q8RE 3OYYA 1ILQA 4DR2L 5KIXA 4O1NA 4YCVA 4IFDJ 1HNWQ 1XWEA 1V1QA 4V190 3VR5A 2V1CC 1K9MC 4N8FA
chains in the Genus database with same CATH topology
3MHBA 4KN4C 1K83B 1JR0D 1LT6D 2F3WA 3IFDA 1CI3M 1I4HA 1JOOA 4EGVA 2ZXOA 3A8IE 4OIJA 3EVQA 3K5NA 3S14B 2CVRA 3GTJB 3AMUA 2F1MA 1KABA 2LY7A 2NTSA 4C3IB 1OXVA 3HKZB 2RVLA 1KDCA 2VXWA 5HGTA 2CW0C 1IL8A 1CHQD 2ICEC 1EZ8A 2F0PA 2F0EA 1JWSD 1I4GA 1HTLD 2JEBI 5E1FA 1LACA 2B2UA 2A6HC 1EY7A 3VYUA 3I3CA 3M7NA 1LT4D 2BCOA 3FRPB 2IX1A 5I4DA 3KLSA 4HSVA 1G291 2XWJB 3M7GA 2A68C 2NN6G 3T4AC 3KF8A 2EDGA 4GZYC 1NAPA 1QNUA 3SVMA 4HSPA 4RA8A 2F0UA 1BF4A 4XQQA 4A3FB 3PUYA 2L12A 3VA7A 2F0SA 2FHTA 2CQAA 1SMYD 3NTHA 1BBXC 4XT3B 4KHZA 4OL7A 2AWNA 3K5MA 2K5QA 1RKNA 2EY2A 2RKSA 2AQ3B 3NQIA 1UAPA 5IODA 1LT3D 4FYDA 4FO2A 1BCPF 3TP8A 1E2VA 1V1PA 3NPPA 4I7ZC 4BY7B 2LS01 1U4PA 3R2TA 5CV8A 2FJ2A 5M3FB 1S5BD 2B8GA 3OIQA 1STHA 2KQ3A 5T1GA 4NKLA 2M2LA 2F0GA 4OO1G 3WOEA 5ISRA 5CBEE 1BCPD 3PV0A 4K5WA 1SYFA 1UNSA 1EOTA 2L1BA 1I6HB 4EQNA 1EU3A 3X3MA 2NN6I 1TWCB 4G7HC 1BR9A 2X6GA 3NBIA 1D5ZC 4Q0FA 2IX3A 1B9MA 3TZDA 5D3IB 3ND9A 4F87A 3J7YW 1H9JA 3KLRA 3CRLC 3GQBA 3TSSA 1LT5D 3OHXC 5CYUA 1EY4A 2EYMA 1DCZA 2XN9C 3DEPA 1CA6A 1UUPA 1CQFA 3MXGA 3U9OA 2O5IC 4G57A 3MFYA 1SNCA 1HFNA 4KY6A 4WJWA 1RODA 4DF7A 2JE6I 3S2HB 4OO1I 4K2KA 5JEAH 4RHRA 4QIWB 3I72A 2AQ2B 1HA5A 4RKBA 3SK6A 4C3JB 1EQTA 1JWMD 3A56A 3DXJC 3VR4A 2K6AA 4ZUIA 1STBA 5DNFA 3IKJA 3PIO3 2C9OA 2NN6H 4PV1C 5CV6A 1FNWA 2V4DA 1IW7C 4IUNA 3DWQA 3NWSA 1ICWA 3OOCA 4TQUS 2NZ1D 1YNJC 3T51B 4FXKC 3SK5A 2B2VC 5C4XB 4PQXA 1GUSA 1I4RA 5C3EB 1H9SB 3TDQA 2XIWA 3GV6A 1DYQA 1C48A 5I6WA 5IGBA 3S16B 1A3TA 2A6EC 4PNYA 1WTPA 2PO4A 5EKIA 1WTRA 2RDHA 2E2HB 2M9VA 2NUCA 3OWFA 1RHPA 4HMJA 4DK0A 4A3BB 2FFKB 2EY6A 1EQVA 4K5VA 5CC4A 3CRKC 1JE4A 4WRDA 2PZTA 5IGEA 4PMWA 2K05A 1ESRA 4OO1H 4IUUA 4RWSC 5EBDA 2BE5D 1PTOD 2BDOA 5M5XB 1PMRA 3MXPA 5CMDA 1B4OA 2L5TA 4RHSA 2AWOA 2SOBA 5IGCA 1JB3A 4U673 3DUZA 2Z8LA 5FLXE 4L63B 2JXMB 2SEBD 5EPKA 1GXDC 2EPBA 2RBMA 1JOQA 3DMUA 5IGDA 4QF4A 1XYIA 1M4VA 2HDLA 3AB9A 1KLGD 5ELCA 2EYLA 1PZJD 1V1PB 4OIKA 4DN4M 2WP8J 3G7LA 1HA6A 2NYZD 1EYCA 2KA7A 2KOLA 3W2DA 1F9RA 1CA5A 3ND8A 3EFXD 2F0JA 5JOBA 4TRDA 3FEWX 5C0XG 1Z7TA 1ZXTA 3BVZA 2WIIB 3TBIB 1TWHB 3VR2A 1SNOA 3H3VC 1F2LA 5FKAC 4N9PA 1U9RA 1F2MA 1HTPA 1STAA 3E5SA 5FLXL 4LK1C 3R3OA 1PFMA 4DXFA 5C6AA 3I91A 1STNA 4ZQ3A 3K58A 4A3JB 3TMEA 4CGYB 4R9WA 5DM73 2PYKA 3E0JA 5NUCA 3MFGA 1VMPA 2HUGA 4CKCA 5FO8B 1F9PA 2WINB 2ZT9C 2OEOA 4FF1A 2AUJD 2L0CA 2JYOA 4KY5A 1NSNS 1D5XC 4H13C 3P20A 2KJXA 3HG9A 4ULLA 2PW7A 2D9UA 1SYEA 5D14A 5J39A 2VUMB 1NUCA 3QB3A 2C5CA 1HHVA 1ENAA 3VYRA 2Q8IB 1SMYC 2J0TD 1S5ED 1GUGA 4RGOS 3R8BA 5C0XI 4M8AA 4ZRZA 4E6IA 2JA6B 4X3UA 2PPBC 1JQYD 3M4OB 1LTGD 4ZKCB 5G3LD 3D6WA 3P1HA 1OXTA 3BYYB 1PLFA 4WORA 4RCOA 3K6OA 5FO9B 3G6JB 3Q23A 1SNDA 2ZXRA 2VB3X 4DAPA 1Y8NB 1EIGA 1CQVA 3NHHA 3FPPA 1MSGA 2B2WC 3Q0AA 1U4RA 5C5LA 4KN7C 3DEOA 1LTTD 4RKLA 4KJNA 3MWYW 1BCPC 2JSOA 3BS1A 1BDOA 5M5YB 4IFDH 2NB0A 4F88A 2LKVA 2Q8TA 1EIHA 1ENFA 4IUVA 2L55A 2F4IA 1RJTA 3SEBA 1A6XA 5KNBA 1X32A 4L6TB 3OPOA 4EQOA 4DAVA 5LL6S 2B39A 3V05A 1RTOA 4K8JA 1YNND 1FYCA 2G9HD 3CHBD 2L11A 4IZ8A 1I3QB 2HDMA 1A15A 1XTCD 5FO7B 2VB2X 1E2WA 4G7ZC 4U68A 1EWHA 5C0XH 5IGGA 4KK7A 1OXXK 4X3SA 2E2JB 1X3QA 2EJGC 5BN4A 1HUNA 1QILA 1H9KA 5FK9C 3MTSA 2Z1CA 1TS3A 4CHTB 5JVH3 4J1MA 1IKMA 3KUPA 3K57A 3GTGB 4IN3A 4HAEA 5IOCA 2IL8A 1ILPA 4HCSA 3ZYYX 1PTOB 4X3KA 3KK7A 5JEAG 1PRTD 1TQOA 2M00A 2FMCA 2A74C 1D6EC 2RDGA 2EJMA 1TY2A 1PYWD 1G2SA 1EY5A 2VNUD 1EU4A 1BNZA 2BA0A 2KCCA 5K36G 2NWGA 3LWUA 3SR1A 3GO5A 5J1ZA 1F9SA 1JCKB 1MGSA 5JAVA 3HOUB 1OO9B 1TS5A 5DM63 2PZUA 2B2TC 3GP7A 2EY1A 4WFN3 1LTID 3I70A 3K59A 3A7LA 1GOZA 3U9SA 1FGBD 1GJXA 3TP6A 1B44D 1VCIA 5IT9E 3H6MA 3KBGA 4B9WA 1KNEA 2F03A 2TSSA 2PNRC 1G6ZA 1W6JA 4K5XA 4H0LC 4BS9A 1ZYRD 4OHJA 1RTNA 5JPMC 5EKKA 3D31A 2D62A 2EYOA 1QNKA 2WACA 1SNQA 3NK9A 5C3WA 2PW5A 1PFNA 2H1EA 2B63B 1MSHA 5CV7A 4K8IA 4BWGB 3M4YA 1AN8A 2QKIC 2BE5C 1PTOC 3QWNA 2EYHA 4YIJA 1CK1A 1BO0A 1F2YA 3NTIA 4IURA 2AQ1B 3S9WA 4ID6A 4H7BA 1HUMA 4P2CB 4CBVA 3NSWA 2DNEA 1FNVA 3HEJA 4C3JG 5IT9L 3I90A 3RUZA 2QEJC 4C3HG 3S1MB 5ELFA 4FF4A 1SE4A 1TS2A 1HPCA 2N55A 5F2DA 5KYLA 3N52A 3PIP3 3L9AX 1AFPA 1L0XB 3BVGA 4A3EB 3PUZA 4A3IB 5TSSA 4MN3A 1I50B 3NQTA 2B8FA 4IUTA 3SXHA 1Q90A 3HOYB 3QG1A 1TWFB 3K5OA 2EOTA 2MUYA 1TY0A 2JA8B 4C1NK 2NVYB 1GUOA 1G91A 3JAML 4JK1C 1AW7A 3O13A 5EPJA 4F7XA 3MXNA 4V0BA 2OXPA 2MJ8A 1CZWA 1SYGA 1VDZA 1X3PA 2MGSA 3HP3A 2R6GA 1WD0A 2GA4B 3CKIB 3FPUB 4J6HA 1Y1WB 3J81E 4KY7A 2F0MA 2KEDA 5I6YA 5K36H 3NXWA 2J7ZA 1E2ZA 4RH6A 1SNMA 4R8NA 2O4XA 2CHBD 3C46A 2FMMA 2KUMA 2E2IB 3HOXB 4IUQA 3FMCA 1PXUA 4KV6A 4A93B 2EE1A 4NDXA 1SNPA 4ZLTF 2MPMA 1D1IA 2F0FA 2F0LA 1LV9A 5C5MA 2WKCA 2F0KA 3SK4A 2R7ZB 1PTOF 3DWPA 2K04A 3NTKA 3V96A 1EY9A 2YYZA 4I65A 4ABNA 1S5DD 1SYCA 5K5PA 2K03A 1EY6A 1PZID 1CT1D 1TWGB 3M85A 1A3VA 1STEA 4FVMA 1STGA 1QWYA 4CKBA 1EY8A 1I6VC 3SE0A 1F77A 1EWCA 1VF7A 3J81L 3D8GA 1V8QA 1PDQA 2OT2A 4XQJA 2E76C 3DWAA 2PZWA 4IALA 1SE2A 2X69A 3A55A 5C3XA 3TP5A 5CV4A 1EL0A 2JEAI 2J4XA 5CORA 4J8QA 1MD2D 4Y7NB 3URYA 1U4LA 1DXMA 2PQEA 5D3DA 1WCMB 2RQXA 3BYTB 2K5WA 4KI0A 1PRTB 2QCPX 3S1NB 2BA1A 1KLUD 1TWAB 3PO3B 4G4KA 3EROA 1WD1A 1JICA 2F0HA 2Y0SB 1ONLA 1R4PB 4IFDG 2DY7A 5HURA 2FINB 5BN3A 1WTQA 5ELEA 1GUWA 2K33A 1CFMA 1O80A 3W3AA 3J7AV 1VMCA 1XX8A 3HOZB 5A35A 4XYQA 2F0IA 4HTHA 4H44C 1YNNC 3GV3A 1BQQT 2D2CC 4K2LA 5KRUA 1LLRD 3OIPA 3BG3A 1DOMA 1Y69U 2EYPA 4PMBA 1HQMC 1O7LA 2B2UC 3PUVA 2NVQB 1I4QA 1G2TA 1KTKA 4MIUA 5EPLA 2IW3A 4DAYA 4S3SA 1XXGA 1MI2A 3S1QB 1V43A 2EXZA 3R2IA 3L3OC 3MXUA 2R92B 2EYJA 1BUVT 5EBCA 4KJOA 2E2DC 5CV9A 1T5EA 5KNDA 5DEHA 3EQLC 3T16A 1DJRD 1CTMA 1KAAA 3RLFA 2PMZB 2F0WA 1R4QB 2DNCA 1PRTC 1SJED 3BZDB 1HRJA 3J7AF 4IFDI 5G3LF 3I4LA 1BXTA 4AYBB 2K5DA 3RZDB 3V2TA 2B2YA 1Q1BA 1SYDA 4RGTA 3FVQA 3CQZB 4QUFA 4HEDA 3I73A 1S5CD 2KVMA 2XNAC 1QG7A 5M3MB 2KECA 2B2VA 3MA2B 1O7YA 4A3DB 1GUNA 1ML0D 2JP1A 3D4RA 3HGBA 4R8IA 4RGMA 2K28A 4DK1A 2NVXB 5ELBA 4N9TA 2DY8A 3MC0B 1ZYRC 3A54A 1Q1EA 1J8IA 3LNNA 4C56C 1V1OA 3H91A 1BOSA 2KHSA 1MBYA 2A69D 2WAQB 4UDUC 2E75C 5C44B 3HS0C 4C3IG 4CJ2C 3L7ZC 4CJ1B 1B2TA 2K01A 1RF2D 4RFBA 2D5DA 1WTWA 3NP8A 4FF2A 3HOVB 4ME5A 3BVMA 3GTOB 3ONAB 5E4XA 1K8MA 1CHPD 3T13A 1LO5D 4NP5A 2QF7A 2KEEA 4UAIA 1LTBD 3E6ZX 1J9OA 3KLSX 2NVTB 1Q12A 3K5LA 1H9RA 1ET9A 3NUCA 2R3ZA 4FXGC 3NE5B 3GTPB 1PRTF 1NCVA 3NWTA 2ENBA 2XSCA 1HXYD 4A3KB 4MHEA 4ZYSA 5E3FA 2NTTA 2RSOA 4KKSA 1H9SA 5I2YA 1B50A 1CM9A 2ZXPA 3WOFA 2LMCB 3VYTA 3P75A 5FOBB 4C2MB 3ERQA 5CV5A 3PUWA 5C0XJ 5KYIA 1B3AA 1TIID 4HN7A 4IUPA 4C1NI 1S5FD 4TKOB 3VR6A 4IQZA 1W6KA 3HOWB 3TZUA 1QE6A 3MVVA 3MAQA 4ODGA 2HQEA 1JC7A 4KKUA 4ZUJA 1Y8OB 1IKLA 1DZ1A 1SYBA 4DA2A 2Z4HA 2SDFA 1DD2A 1O7ZA 2OF1A 3CU7A 5CGKA 4OGQC 4QB4A 3A8KE 5EJWA 1TU2B 1DOLA 3A7AB 1L0YB 1UEAB 1QB5D 2HCCA 1GUTA 2IPKD 3MZ5A 1U4MA 1RDPD 1M8AA 3QOLA 1B9NA 3KBXA 4TSSA 4DGZA 1F9QA 5LL6X 2EYFA 1TR5A 4DXGA 4Q5VA 4QCLA 1GHKA 1RD9D 1LTRD 2L4NA 2LFNA 3JAME 3EA6A 2O5JC 5AFWA 3H0GB 3PUXA 1TVXA 2XVSA 3K7AB 3TP7A 1OXUA 3ITPA 2PCFB 3S15B 1QCBD 3DHQA 3IL8A 3VYSA 3RZOB 1PTOH 1IYUA 1STYA 3M3YB 4KMUC 3QOJA 1K8OA 4HMIA 1AEXA 4QMGA 2YU9B 5KNCA 5ELDA 1Z47A 4PMCA 4XTCS 5IGFA 1WTOA 3HRZC 1O78A 2K1BA 1NR4A 3I4MB 2B2WA 4B08A 1S4ZA 1SAPA 2R93B 4RCNA 3EJIA 2R61A 2MP1A 1C4QA 1SE3A 4EQPA 4RAUC 4QUCA 3T53B 3IFTA 1NR2A 1II3A 2Z4IA 1F2ZA 3WDNA 2K32A 4BA1I 5D65A 1WTXA 1TKWB 3QO2A 1SBBB 4O42A 3H94A 2CW0D 3RMHA 2JA5B 3D4DA 2G9DA 3UI2A 2IT1A 1Q8IA 2A6HD 1PZKD 1OXSC 4KTAA 1AP0A 4XT1B 5J22A 2AUKA 5JEAJ 4C3HB 3I8ZA 3A8JE 2B2YC 3C3LA 2A68D 4DU9A 1TS4A 1A2UA 2TMPA 2DN8A 4F8MA 2O2LD 4BA2I 3F2UA 1FNUA 3FDTA 3BDOA 1HQRD 1EEFD 2I07B 4K14A 2RDFA 3Q24A 5C4HA 3GTKB 3GTQB 2A73B 4KD4A 3H09A 2IWHA 5COYA 3LX0A 3PMFA 2NBFA 4K6DA 2B2TA 4DNRB 5CR3A 4ZAIA 2F3VA 4BBRB 1E0BA 3X3NA 5BN5A 1EY0A 1FD7D 2MHVA 2K7VA 2XWBB 1ZEQX 3QJYA 2I46A 4XDXA 1KNAA 2X6LA 1SXTA 1FR3A 2ID0A 1C8CA 1DONA 1Y1VB 2ICIA 1SJHD 3BDLA 5E4WC 2A69C 2EJFC 4FF3A 3GD7A 1EYDA 4KHVA 3Q22A 5LHY1 1ZKOA 4FP5D 5DAUA 4Z9CB 3K0YA 2RSNA 1CZGA 5T1IA 2N88A 2SNMA 2IJ0A 2RA4A 2WV6D 2L9HA 3DM1A 5A2QE 4M1UB 3I4NB 1ET6A 3GTMB 3N6RA 4FXDA 1A3UA 4B9XA 1Y8PB 1SSOA 1LABA 3OWEB 5M5WB 3QIAA 3LWEA 1KDAA 5EQ0A 1SDFA 2BOSA 4BY1B 2SNSA 1TT2A 1RCVD 1IYVA 2H4OA 4KKTA 3GTLB 3OW7A 1JWUD 2QILA 4HR7B 3NBHA 5I2XA 4EVOA 4XYOA 5I9OA 2IX0A 4BBSB 1DOKA 1IHZA 1Q3LA 4X3TA 1LTSD 4RGNA 3SHLA 3J80E 1JOKA 2XRQD 4ZKBB 5M9OA 2WB1B 2F0OA 3OSOA 3PO2B 4XXEA 3FKIB 1IW7D 3MEHA 1G8ZD 4LMQD 5JPNC 5A2QL 1YNJD 3OMGA 4NMZA 4A3GB 5C4ZA 2F0QA 1AZPA 1BCPB 4G7OC 4ILWA 4XIGS 3SK8A 4LJZC 1GHJA 1EFID 3D4WA 3R93A 3Q6SA 1ESFA 1D1KA 1D5MC 5JJZA 5CBAE 2HCIA 2EY5A 1WTVA 5IIFA 4K6LA 1QOHA 2A6ED 1HFGA 5EKLA 1B53A 2JA7B 4FNFA 4NW2A 1I4PA 4HCEA 2BDNA 1SFOB 1LTAD 2EZVA 1KDBA 3C1FA 2F0TA 1H9MA 2WKDA 1QJOA 1D2BA 3OMCA 3S2DB 1HCZA 2F0VA 2XRSD 3VR3A 4DFAA 4KD3A 3RD4A 1JORA 5KGUA 4A3MB 3J80L 3VA5A 1EEID 4ZK9B 3S1RB 4DNTB 3C1EA 2F0NA 1I4XA 1PFBA 3IAYA 1EZ6A 1SEBD 5C4JB 3T56B 1DM0B 1ENCA 4JBWA 5JVG3 3S17B 2KCNA 1WVLA 2A5HA 1B1ZA 1VF5C 2E74C 3SDZA 5EGTA 1R9TB 1A2TA 1EYAA 1AZQA 3AU7A 2EVBA 3HZXA 4LAAA 4L8JA 4CJ0B 4CKEA 2QDBA 3D6CA 2F0DA 3BDCA 3P7JA 4XQNA 3TN2A 1Z6HA 3D3RA 5I9PA 1T5XD 3C2PA 2Q8RE 1ILQA 5KIXA 4O1NA 4IFDJ 1XWEA 4V190 3VR5A 5KEEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z9C B;  1D5M C;  4RGM A;  1JCK B;  2AQ3 B;  1L0X B;  3BVG A;  1LTT D;  1PTO D;  1S5D D;  1JR0 D;  1LT6 D;  1S5F D;  1PTO H;  1LT3 D;  1PZI D;  1CT1 D;  1BCP C;  3MC0 B;  4K6L A;  2IJ0 A;  1BCP F;  1TS5 A;  1I4Q A;  1I4H A;  2WV6 D;  5TSS A;  1KTK A;  1STE A;  3GP7 A;  4C56 C;  1TS4 A;  1V1O A;  1TS2 A;  3MFG A;  1LTI D;  1XXG A;  1V1P A;  4RHS A;  1I4P A;  1GOZ A;  1ENF A;  1LTA D;  3R2I A;  1F77 A;  1EWC A;  2O2L D;  4RHR A;  2AQ2 B;  1HA5 A;  1ET6 A;  3R2T A;  1TY0 A;  1FGB D;  3SEB A;  5ELD A;  1B44 D;  1S5B D;  2Z8L A;  4L6T B;  4UDU C;  4L63 B;  1FNU A;  1JWM D;  3DWA A;  1AW7 A;  1D5X C;  3V05 A;  3O13 A;  2TSS A;  2XRS D;  1SE2 A;  1HQR D;  2G9H D;  1EEF D;  3CHB D;  2SEB D;  2NTS A;  3OWE B;  1RF2 D;  1DJR D;  4RFB A;  1XTC D;  1EEI D;  2J4X A;  1CHQ D;  1FNW A;  1BCP D;  1JWS D;  1I4X A;  1HTL D;  1I4G A;  3DWQ A;  4OHJ A;  3BVM A;  1MD2 D;  1UNS A;  1PRT C;  2R61 A;  3URY A;  1SEB D;  1SJE D;  3BZD B;  1RCV D;  1CHP D;  1SE3 A;  1LO5 D;  5D3D A;  1QIL A;  1EU3 A;  1M4V A;  1LTB D;  3BYT B;  5FK9 C;  3KLS X;  1I4R A;  1KLG D;  1JWU D;  1PRT B;  1TS3 A;  2QIL A;  5ELC A;  1S5E D;  1B1Z A;  1KLU D;  1PZJ D;  1L0Y B;  4RGO S;  1V1P B;  3R8B A;  1LT4 D;  1DYQ A;  1JQY D;  4RH6 A;  2IPK D;  1FD7 D;  1ET9 A;  5ELB A;  1BXT A;  1LTG D;  1RDP D;  4BWG B;  1AN8 A;  1D5Z C;  1PTO C;  2CHB D;  3W2D A;  5I4D A;  1LTS D;  4RGN A;  4TSS A;  3BYY B;  1SBB B;  1PRT F;  1CK1 A;  2XRQ D;  4RGT A;  1SXT A;  5D3I B;  1PTO B;  2AQ1 B;  2RDH A;  1HXY D;  4RCO A;  4DXG A;  3EFX D;  1T5X D;  4ZYS A;  2ICI A;  5ELE A;  1G8Z D;  1RD9 D;  1PRT D;  1LTR D;  2NTT A;  1SJH D;  3BVZ A;  1PZK D;  3EA6 A;  1D6E C;  1FNV A;  1S5C D;  2XNA C;  5FKA C;  3TSS A;  1BCP B;  2RDG A;  1TY2 A;  1PYW D;  4O1N A;  1LT5 D;  1EU4 A;  2QEJ C;  2XN9 C;  5ELF A;  1EFI D;  1PTO F;  1CQV A;  3DWP A;  1UUP A;  1ESF A;  1SE4 A;  4DXF A;  1LLR D; 
#chains in the Genus database with same CATH topology
 3HOU G;  3MHB A;  3BZK A;  2Q2H A;  2KHJ A;  3ERS X;  4KN4 C;  1K83 B;  3CQZ H;  1JR0 D;  1LT6 D;  2F3W A;  3IFD A;  3ULJ A;  3D0F A;  1CI3 M;  1I4H A;  2VW9 A;  2Y0S E;  1VQM A;  1JOO A;  3K7U C;  4EGV A;  2JA6 H;  2ZXO A;  3A8I E;  2WFW A;  2NZH A;  4OIJ A;  3EVQ A;  1PH3 A;  3K5N A;  4DV3 Q;  3S14 B;  2CVR A;  4R4I A;  1JJ2 A;  1KXL A;  4A3D H;  1KRT A;  3GTJ B;  3AMU A;  2F1M A;  4DR6 L;  2ALY B;  4MZ9 A;  1KAB A;  2NVX H;  2LY7 A;  4L5Q A;  2Q2I A;  2NTS A;  3RN5 A;  4L5R C;  4C3I B;  1OXV A;  1HNZ L;  2XTI A;  3HKZ B;  1GM5 A;  2RVL A;  1KDC A;  1KL9 A;  2VXW A;  5HGT A;  4GKJ L;  2CW0 C;  1IL8 A;  1CHQ D;  2ICE C;  4GNX B;  1EZ8 A;  2F0P A;  2F0E A;  1JWS D;  1I4G A;  1HTL D;  2JEB I;  2H5X A;  5JJL A;  5E1F A;  1LAC A;  2B2U A;  2A6H C;  1N34 Q;  1L0W A;  1EY7 A;  5AJ3 Q;  2B63 G;  1QZG A;  1E24 A;  3VYU A;  3I3C A;  3M7N A;  1LT4 D;  1A0I A;  1VQH A;  3JAM i;  2BCO A;  2CH4 W;  2PI2 E;  3FRP B;  2IX1 A;  3SGI A;  5I4D A;  2F52 A;  1NMF A;  3KLS A;  1N36 Q;  4X64 L;  4HSV A;  1QUQ B;  1G29 1;  3GTO H;  2XWJ B;  3M7G A;  2A68 C;  4LF4 L;  2NN6 G;  3T4A C;  2JA9 A;  3KF8 A;  1J6Q A;  2EDG A;  4GZY C;  2PMZ E;  1NAP A;  1QNU A;  3F2C A;  3SVM A;  2JN4 A;  4HSP A;  4RA8 A;  2F0U A;  2NVT H;  1BF4 A;  4XQQ A;  4A3F B;  1EWI A;  3PUY A;  4ME3 A;  1HNX L;  5IP9 G;  2L12 A;  5LMN W;  1JE5 A;  3MEF A;  3VA7 A;  2F0S A;  2FHT A;  3CCU A;  1I3Q H;  2CQA A;  1SMY D;  3NTH A;  4GS3 A;  1BBX C;  5FJ8 G;  4XT3 B;  4KHZ A;  1E1T A;  1MJC A;  1T9H A;  3KOJ A;  4OL7 A;  2AWN A;  3K5M A;  4A3I G;  2K5Q A;  1RKN A;  2EY2 A;  3NBH B;  2RKS A;  2AQ3 B;  3NQI A;  1Y14 B;  4AYB E;  2K4K A;  1UAP A;  5IOD A;  1LT3 D;  4FYD A;  2E8G A;  4FO2 A;  1BCP F;  3TP8 A;  4A3K H;  3HOY G;  1E2V A;  1V1P A;  2JA8 G;  2E5L L;  3NPP A;  3GTG H;  4I7Z C;  4BY7 B;  3CMA A;  2LS0 1;  2N49 A;  1I94 L;  1U4P A;  3R2T A;  5CV8 A;  5H1S E;  2FJ2 A;  4C2M H;  1N33 L;  4FDB A;  5M3F B;  1S5B D;  1SE8 A;  2B8G A;  3OIQ A;  1STH A;  2Z6B A;  2KQ3 A;  3RNU A;  5GQO A;  5T1G A;  4NKL A;  2YTY A;  2M2L A;  1XNQ Q;  2F0G A;  2K5V A;  4JI5 Q;  4OO1 G;  3WOE A;  1VQD A;  5ISR A;  1IBK L;  5CBE E;  1BCP D;  3PV0 A;  4K5W A;  1SYF A;  1UNS A;  1Y1W G;  1EOT A;  2JA5 G;  2L1B A;  1KAW A;  2D0P A;  1I6H B;  2OWO A;  4EQN A;  1EU3 A;  3X3M A;  2NN6 I;  2ZJP A;  4UP7 A;  3J81 i;  1TWC B;  3ULL A;  3M4P A;  4G7H C;  1BR9 A;  2X6G A;  3HOU H;  4JPB W;  4HJ9 A;  3NEM A;  1W3S A;  3NBI A;  2QGQ A;  2WAQ E;  1D5Z C;  4Q0F A;  1UE1 A;  2IX3 A;  1X3E A;  4LFC L;  1B9M A;  3TZD A;  1P16 A;  1S72 A;  4GLA C;  5D3I B;  3ND9 A;  2JJQ A;  4F87 A;  1LYL A;  3J7Y W;  1H9J A;  4QY7 A;  3KLR A;  3CRL C;  1HH2 P;  2R7Z G;  1IXR A;  3GQB A;  3G4S A;  1JJC B;  3TSS A;  3W1B A;  3OHX C;  1LT5 D;  5CYU A;  3T1H Q;  4DR4 L;  1CSQ A;  1EY4 A;  1WJJ A;  2DUD A;  2EYM A;  1DCZ A;  2XN9 C;  3DEP A;  1CA6 A;  1UUP A;  1CQF A;  4LNQ A;  3MXG A;  3U9O A;  2O5I C;  4G57 A;  3MFY A;  1SNC A;  1HFN A;  4KY6 A;  5IYD G;  4WJW A;  4DK6 C;  1ROD A;  1VQG A;  5FLX c;  2YTV A;  4DF7 A;  2JE6 I;  3FHW A;  2GVB A;  3S2H B;  1HNW L;  3RR5 A;  4OO1 I;  3H0G H;  1YI2 A;  3CC7 A;  4K2K A;  4MTN A;  5JEA H;  4RHR A;  4QIW B;  5LMU Q;  3K7A H;  3I72 A;  2AQ2 B;  1HA5 A;  4RKB A;  3SK6 A;  4C3J B;  2RF4 A;  1EQT A;  3S15 H;  1JWM D;  3A56 A;  3DXJ C;  2K5H A;  2K6A A;  3VR4 A;  4ZUI A;  1STB A;  1H95 A;  4DR3 Q;  5DNF A;  4K0K Q;  3IKJ A;  3PIO 3;  2C9O A;  2NN6 H;  4PV1 C;  5CV6 A;  3M3Y H;  1KC8 C;  2I0Q A;  1FNW A;  2V4D A;  1IW7 C;  4IUN A;  3DWQ A;  2MQH A;  3NWS A;  1ICW A;  4DV3 L;  1WCM G;  2HHH Q;  4POG A;  3OOC A;  2UUA Q;  4TQU S;  2NZ1 D;  1YNJ C;  3T51 B;  5IP9 H;  3S1M H;  4FXK C;  3VDY A;  3SK5 A;  1PYS B;  1X55 A;  2B2V C;  2ZJQ A;  3PO3 G;  5C4X B;  1HZC A;  2YTX A;  4PQX A;  1GUS A;  1I4R A;  5C3E B;  1H9S B;  3TDQ A;  1X56 A;  3GDE A;  2XIW A;  4JBJ A;  3GV6 A;  1DYQ A;  2Y0S G;  1C48 A;  3I4M H;  5I6W A;  5IYB H;  1VQC A;  1I50 H;  5IGB A;  3S16 B;  2R93 H;  2HD3 A;  1A3T A;  2R7F A;  2A6E C;  1N34 L;  4IPG A;  5AJ3 L;  4PNY A;  1WTP A;  2PO4 A;  5EKI A;  1WTR A;  2RDH A;  3J80 c;  2E2H B;  2M9V A;  2NUC A;  2UXB Q;  3OWF A;  1RHP A;  4HMJ A;  3HOZ G;  4UHV A;  4RMF A;  4DK0 A;  4A3B B;  2VS1 A;  1K0S A;  2RCN A;  2FFK B;  2EY6 A;  1EQV A;  4K5V A;  3ER0 A;  5CC4 A;  1YNX A;  3CRK C;  3UDF A;  1N36 L;  1JE4 A;  4WRD A;  3G6E A;  2PZT A;  1EIY B;  1M1K C;  5IGE A;  4PMW A;  2K05 A;  3TEH B;  4P72 A;  1VQ9 A;  1G6P A;  1ESR A;  4OO1 H;  4IUU A;  4A76 A;  4RWS C;  5EBD A;  2BE5 D;  1PTO D;  2BDO A;  5M5X B;  1PMR A;  1C7Y A;  3MXP A;  3NEL A;  5CMD A;  1Y1W H;  2JA5 H;  4BY1 G;  1SRU A;  4DV5 Q;  1VQB A;  1B4O A;  5IP7 H;  2L5T A;  4RHS A;  2R92 G;  4TVA B;  2AWO A;  1PH6 A;  2SOB A;  5IGC A;  4DV1 L;  3UE0 A;  1JB3 A;  4U67 3;  3DUZ A;  1XPR A;  2ZJR A;  2Z8L A;  5FLX E;  2E2I H;  4L63 B;  4GN5 A;  4C3H H;  1N32 L;  2UUC Q;  3CCM A;  2RHQ B;  2JXM B;  2Z6K C;  2SEB D;  3KF6 B;  5EPK A;  1GXD C;  2EPB A;  1VQI A;  3I55 A;  2RBM A;  1JOQ A;  3DMU A;  1V9P A;  5IGD A;  4QF4 A;  3FKI G;  1XYI A;  4PZ6 A;  1PH5 A;  1M4V A;  2HDL A;  1K0R A;  3AB9 A;  4ZCK A;  1KLG D;  2F4V Q;  5ELC A;  2EYL A;  4AYB G;  2Q2T A;  1PZJ D;  4NXM Q;  1XNQ L;  1V1P B;  4JI5 L;  1GD7 A;  3I7F A;  5ELN A;  2OQ0 A;  1Q81 C;  4OIK A;  1MKH A;  1YHA A;  4DN4 M;  2WP8 J;  3G7L A;  1HA6 A;  5IYD H;  2NYZ D;  1EYC A;  2KA7 A;  3GTQ H;  2KOL A;  3W2D A;  1F9R A;  3J7A 5;  1CA5 A;  2JQO A;  3ND8 A;  3EFX D;  4YY3 Q;  2F0J A;  5JOB A;  4TRD A;  3FEW X;  5M3M G;  5C0X G;  1Z7T A;  1ZXT A;  3BVZ A;  2WII B;  3TBI B;  1TWH B;  3VR2 A;  1YBY A;  1SNO A;  3H3V C;  1F2L A;  4A3D G;  5FKA C;  4N9P A;  1U9R A;  1F2M A;  1HTP A;  1STA A;  3E5S A;  4EQ5 A;  5FLX L;  4HIK A;  4LK1 C;  3R3O A;  1KD1 C;  3BU2 A;  2DJG C;  1PFM A;  2L15 A;  4DXF A;  2VL6 A;  5C6A A;  4DNI A;  3I91 A;  1STN A;  4ZQ3 A;  3K58 A;  2OTL A;  4Y7N H;  2OQK A;  4A3J B;  2ZTE A;  4IOA A;  3E9H A;  3TME A;  4CGY B;  1Y1V H;  4R9W A;  5DM7 3;  2PYK A;  1HR0 Q;  3E0J A;  5NUC A;  1TWA H;  3MFG A;  3T1H L;  1VMP A;  2HUG A;  3I2Z A;  4CKC A;  2WAQ G;  5FO8 B;  1F9P A;  2WIN B;  5C44 G;  2ZT9 C;  2OEO A;  4FF1 A;  2AUJ D;  2L0C A;  2JYO A;  2AMC B;  2LXJ A;  4KY5 A;  4UP9 A;  4X65 L;  1NSN S;  1D5X C;  4H13 C;  1YVC A;  3P20 A;  2KJX A;  3T1Y Q;  3HG9 A;  3PF4 A;  2B3G A;  4ULL A;  3HOV G;  2PW7 A;  1VQJ A;  1BBU A;  2D9U A;  1SYE A;  2MO1 A;  5D14 A;  5J39 A;  5LMU L;  2VUM B;  1NUC A;  3QB3 A;  3I56 A;  2C5C A;  4YCU A;  1WFQ A;  3A5Z B;  1HHV A;  1ENA A;  3I4N H;  1Z9F A;  3VYR A;  4JI1 Q;  2Q8I B;  3GTM H;  1L2F A;  1SMY C;  2J0T D;  4DV7 Q;  1S5E D;  1GUG A;  3KDF A;  4RGO S;  3R8B A;  5C0X I;  4M8A A;  4ZRZ A;  4E6I A;  4DR3 L;  2JA6 B;  4X3U A;  2PPB C;  1JQY D;  3M4O B;  4K0K L;  2NVQ H;  1LTG D;  4ZKC B;  5G3L D;  4JBM A;  2UXC Q;  3K0X A;  3D6W A;  3IRB A;  3P1H A;  2HHH L;  1OXT A;  3G48 A;  2UUA L;  3BYY B;  4A3K G;  1PLF A;  3S1Q H;  4BY1 H;  1IYJ B;  4WOR A;  2HQL A;  4RCO A;  3CW2 C;  3K6O A;  5FO9 B;  3G6J B;  3GTL H;  2PNH A;  3Q23 A;  3W5O A;  1PA6 A;  4O0A A;  1YJ9 A;  1SND A;  5FLM G;  2ZXR A;  2VB3 X;  3CCS A;  4DAP A;  4BBS H;  1Y8N B;  3J81 j;  1EIG A;  1D8L A;  1CQV A;  3NHH A;  1RIP A;  1MSG A;  3FPP A;  2B2W C;  4GN3 B;  3CCL A;  3Q0A A;  1U4R A;  5C5L A;  2EIF A;  4JI7 Q;  1FL0 A;  4KN7 C;  2CFM A;  3DEO A;  1LTT D;  4RKL A;  5BR8 Q;  2UXB L;  4KJN A;  3MWY W;  3AFP A;  5IT9 c;  1BCP C;  2JSO A;  4GKK Q;  3FKI H;  3BS1 A;  4B3S Q;  1C0A A;  1BDO A;  5M5Y B;  4IFD H;  2NB0 A;  4F88 A;  4A3G H;  2LKV A;  2Q8T A;  4IPC A;  2K50 A;  1EIH A;  1ENF A;  4HJ5 A;  4IUV A;  2L55 A;  3HOW G;  1U5K A;  2F4I A;  2KHI A;  1E7Z A;  1RJT A;  3RZD H;  3SEB A;  1A6X A;  5KNB A;  1X32 A;  4L6T B;  3OPO A;  4EQO A;  3NEN A;  4DAV A;  4JI4 L;  5LL6 S;  2B39 A;  3V05 A;  1RTO A;  4K8J A;  1YNN D;  1FYC A;  4NPS A;  2G9H D;  4DAM A;  3CHB D;  2L11 A;  4IZ8 A;  1QVG A;  1I3Q B;  2HDM A;  3L0O A;  1A15 A;  5IE8 A;  4DV5 L;  3E3X A;  1XTC D;  5FO7 B;  2VB2 X;  1XMQ Q;  1E2W A;  4G7Z C;  2UUB Q;  2JA7 H;  1VQK A;  4U68 A;  1EWH A;  4YWK A;  5M3M H;  5C0X H;  5IGG A;  4KK7 A;  5KEE A;  1OXX K;  4X3S A;  2IY5 B;  2E2J B;  1X3Q A;  2EJG C;  1AE2 A;  1EIF A;  1QIL A;  5BN4 A;  1HUN A;  1H9K A;  4OWX B;  5FK9 C;  3MTS A;  4HIM A;  2Z1C A;  1TS3 A;  2UUC L;  4CHT B;  5JVH 3;  4J1M A;  1E22 A;  1IBL Q;  1IKM A;  3KUP A;  3S2D H;  4LF6 Q;  1HZB A;  3K57 A;  4A3L H;  3CC4 A;  1X54 A;  5L37 A;  3GTG B;  2N8N A;  4IN3 A;  1PV4 A;  4HAE A;  4A3M H;  5IOC A;  2RCF A;  2IL8 A;  2F3I A;  1ILP A;  1GO3 E;  4HCS A;  2QDL A;  3ZYY X;  3S24 A;  1FJG Q;  1PTO B;  4X3K A;  5C4J H;  2F4V L;  1UE6 A;  3S17 H;  3H0G G;  3KK7 A;  5JEA G;  1PRT D;  2Z0S A;  5C44 H;  1TQO A;  2M00 A;  2FMC A;  2A74 C;  1D6E C;  2RDG A;  2EJM A;  1TY2 A;  1PYW D;  1G2S A;  1EY5 A;  2VNU D;  1EU4 A;  3E0E A;  1BNZ A;  2BA0 A;  2KCC A;  5K36 G;  2NWG A;  1XPU A;  3LWU A;  3SR1 A;  4DK3 C;  3HOV H;  3GO5 A;  2VQE L;  5J1Z A;  1F9S A;  3CXC A;  1JCK B;  4YY3 L;  1MGS A;  1GKH A;  5JAV A;  4DV0 L;  3HOU B;  1OO9 B;  1TS5 A;  2MFI A;  5DM6 3;  1YEZ A;  3STB D;  2PZU A;  2B2T C;  3GP7 A;  2VZA A;  2EY1 A;  4WFN 3;  1LTI D;  3CP0 A;  3I70 A;  3K59 A;  2WB1 E;  1A8V A;  2K52 A;  3A7L A;  1GOZ A;  3U9S A;  2K75 A;  1FGB D;  1GJX A;  3TP6 A;  1B44 D;  4NB3 A;  1VCI A;  5IT9 E;  3H6M A;  3KBG A;  4RG1 A;  3GTP H;  4B9W A;  3I4M G;  1E1O A;  1PH4 A;  1KNE A;  5IYB G;  4UP8 A;  2F03 A;  3RN2 A;  2TSS A;  2PNR C;  1K83 H;  4R4T A;  2R93 G;  4GLX A;  2UU9 L;  2UXD Q;  1HR0 L;  4LF7 Q;  1G6Z A;  1W6J A;  4K5X A;  2KCM A;  4H0L C;  4BS9 A;  1ZYR D;  4OHJ A;  1RTN A;  5JPM C;  5EKK A;  4L5S A;  3D31 A;  1U0L A;  2D62 A;  1L1O A;  3A5U A;  2EYO A;  5E7N A;  1QNK A;  2WAC A;  5FLM H;  1SNQ A;  4GOP A;  3NK9 A;  4R4C A;  5C3W A;  1RL2 A;  4DR1 Q;  2PW5 A;  2NZO A;  1CUK A;  1PFN A;  2H1E A;  2B63 B;  1MSH A;  3T1Y L;  4GNX C;  3ICE A;  5CV7 A;  4K8I A;  3UDI A;  4BWG B;  4C3I H;  3M4Y A;  4DR7 Q;  2VY3 A;  1AN8 A;  2QKI C;  2BE5 C;  1PTO C;  1I5F A;  4DV2 Q;  1EFW A;  3QWN A;  4QJF A;  4DUZ Q;  2EYH A;  4YIJ A;  1CK1 A;  1BO0 A;  1F2Y A;  3NTI A;  4JI1 L;  4IUR A;  4P75 A;  2AQ1 B;  1HZA A;  4ID6 A;  4H7B A;  3S9W A;  5IP7 G;  1ASY A;  4A75 A;  1HJP A;  1HUM A;  2PI2 A;  3HOW H;  4P2C B;  4CBV A;  3NSW A;  2DNE A;  1FNV A;  3HEJ A;  2UXC L;  4C3J G;  5IT9 L;  3I90 A;  3RUZ A;  1YIT A;  2QEJ C;  4C3H G;  3S1M B;  5ELF A;  4FF4 A;  1SE4 A;  1TS2 A;  1HPC A;  2N55 A;  1LUZ A;  5F2D A;  5KYL A;  3N52 A;  4JI2 Q;  4WJ4 A;  2CWA A;  3PIP 3;  2ZM6 Q;  2CH4 A;  3KDF B;  3L9A X;  1AFP A;  1L0X B;  3AFQ A;  3BVG A;  4A3E B;  2ZTD A;  3PUZ A;  4KHP Q;  4A3I B;  2R7D A;  1JMC A;  5TSS A;  1PH7 A;  4MN3 A;  4CDF C;  1I50 B;  1X3G A;  3NQT A;  2B8F A;  4A3F H;  4IUT A;  1CKO A;  3SXH A;  1Q90 A;  3HOY B;  1EOV A;  3QG1 A;  1TWF B;  4LUZ A;  3K5O A;  4IJH A;  2EOT A;  2MUY A;  1TY0 A;  4PZ8 A;  4JI7 L;  2JA8 B;  4C1N K;  2A1A A;  2G5D A;  2NVY B;  1GUO A;  1G91 A;  3JAM L;  3G71 A;  2KBN A;  4JK1 C;  1AW7 A;  4GKK L;  3O13 A;  5EPJ A;  2N78 A;  4F7X A;  3L2P A;  3MXN A;  1YJW A;  4V0B A;  2OXP A;  2MJ8 A;  1IBM Q;  1CZW A;  1PHJ A;  3EIV A;  1SYG A;  1VDZ A;  1X3P A;  2MGS A;  1TXY A;  2CKZ B;  3HP3 A;  2R6G A;  1WD0 A;  2GA4 B;  3CKI B;  1B8A A;  4BBR G;  1K3R A;  3FPU B;  4J6H A;  4CDE C;  1Y1W B;  1MHW C;  5M3F H;  3OW2 A;  3J81 E;  4KY7 A;  2F0M A;  2KED A;  5I6Y A;  5K36 H;  4QGU A;  3NXW A;  2J7Z A;  4QQB X;  1E2Z A;  3RZO H;  4RH6 A;  1SNM A;  1XMQ L;  2UUB L;  2AHO B;  5IYC H;  4R8N A;  3W1G A;  2O4X A;  2CHB D;  3C46 A;  2FMM A;  2KUM A;  3ULP A;  2E2I B;  3M4Q A;  3HOX B;  4IUQ A;  1Y1V G;  3B6Y A;  3FMC A;  2GVA A;  2YU9 H;  1PXU A;  4KV6 A;  1Q7Y C;  4A93 B;  5GAG C;  2EE1 A;  1QVC A;  3HKZ E;  4NDX A;  1SNP A;  1VQE A;  1IBL L;  4ZLT F;  4LF6 L;  2MPM A;  1XPO A;  1D1I A;  2F0F A;  1WTH A;  2BH2 A;  2F0L A;  1LV9 A;  4R4Q A;  5C5M A;  1B7Y B;  2WKC A;  2F0K A;  3SK4 A;  2R7Z B;  1PTO F;  3DWP A;  2K04 A;  3NTK A;  3DLL A;  3V96 A;  1EY9 A;  2YYZ A;  1FJG L;  4I65 A;  4B3R Q;  4ABN A;  4HID A;  1S5D D;  1SYC A;  5DLQ E;  5K5P A;  2K03 A;  1EY6 A;  1PZI D;  1CT1 D;  1TWG B;  3M85 A;  1A3V A;  1VQ7 A;  1JT8 A;  1DGS A;  1STE A;  4FVM A;  3I4N G;  1STG A;  1QWY A;  1KQS A;  4CKB A;  3PIO A;  1EY8 A;  1I6V C;  3SE0 A;  1F77 A;  1EWC A;  4APV A;  1VF7 A;  3J81 L;  3D8G A;  1V8Q A;  4IO9 A;  1PDQ A;  2OT2 A;  4XQJ A;  4LF9 Q;  2E76 C;  3DWA A;  2PZW A;  4IAL A;  1SE2 A;  2X69 A;  3A55 A;  5C3X A;  3TP5 A;  5CV4 A;  4DV4 Q;  3M9B A;  4DR2 Q;  1EL0 A;  1VQN A;  2ATW A;  3H3V I;  2JEA I;  2J4X A;  4DKA C;  3S2H H;  5COR A;  4J8Q A;  1MD2 D;  4Y7N B;  2IHE A;  3URY A;  3KF8 B;  1U4L A;  1DXM A;  2PQE A;  5D3D A;  1WCM B;  2RQX A;  3BYT B;  4C3J H;  2K5W A;  4KI0 A;  4HJA A;  1PRT B;  2QCP X;  3S1N B;  4BBS G;  2BA1 A;  1KLU D;  2UXD L;  1TWA B;  3AYH B;  4G4K A;  3PO3 B;  4LF7 L;  4POF A;  2JK8 A;  3ERO A;  1WD1 A;  1G51 A;  1JIC A;  2F0H A;  2WB1 G;  2Y0S B;  3PO2 G;  1ONL A;  3J80 i;  3TRZ A;  3UDG A;  1R4P B;  2CCZ A;  2B29 A;  4IFD G;  2DY7 A;  4A3G G;  5HUR A;  2FIN B;  5BN3 A;  1WTQ A;  3TQY A;  5C4X H;  5ELE A;  1GUW A;  2K33 A;  1A63 A;  5C3E H;  1CFM A;  1KRS A;  3CCJ A;  1O80 A;  4AQY Q;  3W3A A;  4EX5 A;  4DR7 L;  3J7A V;  1VMC A;  1XX8 A;  3HOZ B;  2PQA A;  1L1O B;  5A35 A;  4XYQ A;  4WJ3 M;  2F0I A;  3GTK H;  4HTH A;  1OTC A;  4DUZ L;  4H44 C;  1YNN C;  3F8T A;  3GV3 A;  4GOP B;  1BQQ T;  3S16 H;  2D2C C;  4K2L A;  5KRU A;  1LLR D;  1BKB A;  4B3M Q;  2FXQ A;  3OIP A;  5EAY A;  1X6O A;  3BG3 A;  1DOM A;  1Y69 U;  2EYP A;  3EBE A;  1XNR Q;  4PMB A;  2JA7 G;  1HQM C;  1UE7 A;  1O7L A;  2B2U C;  2E2H H;  3PUV A;  2NVQ B;  1I4Q A;  2RHS B;  1G2T A;  1KTK A;  4MIU A;  5EPL A;  2IW3 A;  4BBR H;  4JW0 A;  4DAY A;  3F1Z A;  3QR8 A;  1S40 A;  4S3S A;  1XXG A;  1MI2 A;  4JCV E;  3S1Q B;  4A3B H;  3CAM A;  5GAD C;  1V43 A;  2EXZ A;  3K8A A;  3R2I A;  3L3O C;  4BXX G;  3MXU A;  4R1J A;  3U4V A;  4JI2 L;  2R92 B;  2ZM6 L;  2EYJ A;  4A3L G;  3H3V H;  1BUV T;  5EBC A;  4A3M G;  1B70 B;  4KHP L;  4LUO A;  4KJO A;  2E2D C;  5CV9 A;  2ZTC A;  3J7Z C;  1T5E A;  5DEH A;  5KND A;  5M5X H;  3EQL C;  3T16 A;  1DJR D;  1CTM A;  1KAA A;  1FVI A;  3RLF A;  4YCW A;  2PMZ B;  4OON A;  4IPD A;  1YHB A;  1K3B C;  2F0W A;  1E3P A;  4LFA Q;  1R4Q B;  2DNC A;  4YHH Q;  3CPW A;  1PRT C;  1SMX A;  1XJV A;  1SJE D;  3BZD B;  1J5E Q;  1HRJ A;  3J7A F;  4IFD I;  4MNO A;  1BBW A;  5G3L F;  3HKS A;  1JJG A;  1IBM L;  3I4L A;  4QIW E;  3Q8D A;  1BXT A;  4AYB B;  1VQP A;  1HZ9 A;  4JI3 Q;  1K73 C;  2K5D A;  3RZD B;  3V2T A;  2B2Y A;  1Q1B A;  4AIM A;  1SYD A;  4RGT A;  3FVQ A;  1N33 Q;  3CQZ B;  4DR5 Q;  3MXN B;  2CWP A;  4GLV B;  4P73 A;  3H15 A;  2EXD A;  4QUF A;  3KLW A;  2ES2 A;  4HED A;  1NY4 A;  3I73 A;  1X3F A;  1QZH A;  1S5C D;  2KVM A;  2XNA C;  1QG7 A;  5M3M B;  2KEC A;  3MA2 B;  2B2V A;  5GAH C;  4A4I A;  5M5W H;  1O7Y A;  4A3D B;  5GRO A;  1GUN A;  1ML0 D;  2JP1 A;  3D4R A;  3HGB A;  1X65 A;  4RGM A;  4R8I A;  2K28 A;  4JI6 Q;  4H02 A;  4DK1 A;  2NVX B;  2GN5 A;  5ELB A;  4N9T A;  2DY8 A;  3MC0 B;  1S3O A;  1ZYR C;  3A54 A;  1Q1E A;  1UWV A;  1J8I A;  3LNN A;  4C56 C;  1V1O A;  3PSI A;  2QW7 A;  4PZ7 A;  1XTD A;  3CCQ A;  3H91 A;  1VQ6 A;  1YIJ A;  1X9N A;  1C9O A;  1BOS A;  2KHS A;  1MBY A;  2A69 D;  1SRO A;  4B3R L;  2WAQ B;  4UDU C;  5LMN Q;  2E75 C;  5C44 B;  3HS0 C;  4C3I G;  4CJ2 C;  3L7Z C;  2Q2U A;  4CJ1 B;  1B2T A;  4OX9 Q;  3HKZ G;  3CF5 A;  1CSP A;  1KHI A;  3PO2 H;  2K01 A;  1RF2 D;  2ASB A;  4RFB A;  2D5D A;  3ZJY C;  1WTW A;  1SLJ A;  3NP8 A;  4FF2 A;  3HOV B;  4ME5 A;  3BVM A;  3GTO B;  3ONA B;  5E4X A;  1K8M A;  3JC6 6;  3UDX A;  4LF9 L;  1CHP D;  3T13 A;  1LO5 D;  1SN8 A;  4NP5 A;  1AH9 A;  2QF7 A;  2KEE A;  4UAI A;  1LTB D;  3E6Z X;  1J9O A;  3KLS X;  2NVT B;  1Q12 A;  3U58 A;  4N8X 1;  1NE3 A;  3K5L A;  1NJI C;  4DV4 L;  1H9R A;  1ET9 A;  3NUC A;  2A8V A;  2R3Z A;  3JAM c;  1VS0 A;  5JJI A;  4FXG C;  2XGT A;  3NE5 B;  2Z6K A;  2VUM H;  1HR0 W;  3GTP B;  1PRT F;  1SFO H;  1NCV A;  3NWT A;  4LWC A;  2ENB A;  2XSC A;  3I4O A;  1HXY D;  4A3F G;  4A3K B;  1LM0 A;  4MHE A;  4ZYS A;  3CCE A;  1O7I A;  4JI0 Q;  5E3F A;  2NTT A;  2RSO A;  3U4Z A;  1Q8K A;  4KKS A;  4BXX H;  4JI8 Q;  1H9S A;  5I2Y A;  2I5M X;  1B50 A;  1CM9 A;  2ZXP A;  3M4O H;  3WOF A;  2LMC B;  3VYT A;  3P75 A;  1EQR A;  2P5Z X;  5FOB B;  3S1R H;  4C2M B;  3ERQ A;  5CV5 A;  3PUW A;  5C0X J;  5KYI A;  5HGQ A;  1B3A A;  1TII D;  4HN7 A;  4IUP A;  4C1N I;  1S5F D;  4X66 Q;  4DV6 Q;  4KLK A;  4NXM L;  4TKO B;  4AQY L;  4NXN Q;  4BY7 G;  4JG2 A;  3VR6 A;  4IQZ A;  1R9T H;  4HIO A;  1MJE A;  5M3F G;  1M90 C;  4B3M L;  1W6K A;  1W2B A;  1P8L A;  3HOW B;  1NNX A;  3TZU A;  1XNR L;  5IYC G;  1B3Q A;  1QE6 A;  3MVV A;  3MAQ A;  4JC0 A;  4DPG A;  4ODG A;  2HQE A;  1JC7 A;  4KKU A;  4ZUJ A;  2PQA B;  4JV5 Q;  4X62 Q;  1Y8O B;  1IKL A;  5M5Y H;  1Q82 C;  4B3T Q;  1DZ1 A;  3FP9 A;  1SYB A;  4DA2 A;  4LF5 Q;  2Z4H A;  2SDF A;  1DD2 A;  1O7Z A;  3PGZ A;  2OF1 A;  4JVZ A;  3CU7 A;  3BJU A;  5CGK A;  4OGQ C;  1PH1 A;  4QB4 A;  2MO0 A;  3A8K E;  5EJW A;  1TU2 B;  1DOL A;  4DAY B;  4IOC A;  3A7A B;  1L0Y B;  1UEA B;  4A3C H;  4LW1 A;  3KJO A;  1QB5 D;  2HCC A;  1GUT A;  2IPK D;  3MZ5 A;  3UE1 A;  3J81 c;  1U4M A;  1RDP D;  1UE5 A;  1M8A A;  3QOL A;  1B9N A;  4LFA L;  4YHH L;  3KBX A;  3KF6 A;  1QVF A;  4DV1 Q;  4TSS A;  1XMO Q;  4A3E G;  4DGZ A;  1F9Q A;  5LL6 X;  2EYF A;  1J5E L;  1TR5 A;  4DXG A;  3S14 H;  2E2J H;  2IHF A;  4Q5V A;  3GTJ H;  1N32 Q;  4QCL A;  1GHK A;  1RD9 D;  1LTR D;  4LUV A;  4CDD C;  2L4N A;  2LFN A;  4LFB Q;  3JAM E;  3EA6 A;  3KYH C;  1VQ5 A;  2O5J C;  5AFW A;  3H0G B;  3PUX A;  1TVX A;  2XVS A;  4JI3 L;  3K7A B;  3TP7 A;  1OXU A;  2K14 A;  3ITP A;  2PCF B;  4DR5 L;  3S15 B;  4JOI A;  1FGU A;  1QCB D;  3DHQ A;  3IL8 A;  4LF8 Q;  3VYS A;  4R4O A;  3PCO B;  4DV7 L;  1PTO H;  3RZO B;  3A74 A;  1IYU A;  1STY A;  3M3Y B;  4KMU C;  4J15 A;  1VQO A;  2EQS A;  3QOJ A;  1K8O A;  1PVO A;  4HMI A;  1AEX A;  4QMG A;  2N3S A;  3AEV A;  2YU9 B;  5KNC A;  1YZ6 A;  3BZC A;  4JI6 L;  5ELD A;  1Z47 A;  4PMC A;  2A19 A;  4XTC S;  5IGF A;  1WTO A;  1CKN A;  3HRZ C;  1O78 A;  2K1B A;  4DUY Q;  1NR4 A;  3I4M B;  2B2W A;  3HOX G;  4B08 A;  1S4Z A;  1SAP A;  2R93 B;  4JYA Q;  4RCN A;  3EJI A;  4A93 G;  5C4X G;  1PH2 A;  2R61 A;  2MP1 A;  5C3E G;  1C4Q A;  5LMN L;  1SE3 A;  2LSS A;  4EQP A;  4RAU C;  4O2D A;  5BR8 L;  4OX9 L;  4QUC A;  3T53 B;  3IFT A;  1NR2 A;  3U50 C;  1II3 A;  4B3S L;  2Z4I A;  1F2Z A;  3WDN A;  2K32 A;  4BA1 I;  5IWA Q;  5D65 A;  1WTX A;  1TKW B;  5GAE C;  3QO2 A;  1WOC A;  1SBB B;  1D7Q A;  1N9W A;  4BY7 H;  4L5T A;  4O42 A;  3H94 A;  3F2B A;  4OXP A;  2CW0 D;  3RMH A;  3PIP A;  3KJP A;  4PG3 A;  2C35 B;  4X65 Q;  2JA5 B;  1KIX A;  3D4D A;  4A3B G;  2G9D A;  3UI2 A;  2IT1 A;  1Q8I A;  2A6H D;  1PZK D;  1OXS C;  2B63 H;  4KTA A;  1AP0 A;  4XT1 B;  1NBW A;  5J22 A;  1VQ4 A;  2AUK A;  4P71 A;  4MTK A;  1K8A C;  5JEA J;  2HIX A;  4C3H B;  4HJ7 A;  3I8Z A;  2KEN A;  4JI0 L;  1I6H H;  3A8J E;  2B2Y C;  4JI8 L;  2QA4 A;  2OTJ A;  3C3L A;  2A68 D;  1TWC H;  2OCE A;  1TS4 A;  4DU9 A;  2MNA A;  1VQF A;  1A2U A;  2TMP A;  3TRE A;  4CDC C;  2DN8 A;  4F8M A;  2O2L D;  4BA2 I;  4YWM A;  1NTG A;  3F2U A;  2QEX A;  2HT1 A;  2Z9H A;  5FJ8 H;  4X66 L;  1FNU A;  3AQQ A;  4DV6 L;  3K80 C;  3TS2 A;  3FDT A;  3BDO A;  1HQR D;  1EEF D;  4A3E H;  4NXN L;  2I07 B;  4K14 A;  4A3I H;  2RDF A;  3Q24 A;  3OTO Q;  5C4H A;  1EQQ A;  3GTK B;  3GTQ B;  2A73 B;  2VQF Q;  4OEL B;  4UY8 C;  4KD4 A;  3H09 A;  2IWH A;  5COY A;  3E9I A;  2KCT A;  3HOY H;  3LX0 A;  1TWF H;  3PMF A;  2NBF A;  3CME A;  4K6D A;  4JBK A;  2B2T A;  4IJL A;  4DNR B;  3TS0 A;  2JA8 H;  2YV5 A;  4YWL A;  2NVY H;  5CR3 A;  4ZAI A;  2F3V A;  4BBR B;  3LGJ A;  4HJ8 A;  4JV5 L;  2I5H A;  4X62 L;  1E0B A;  3X3N A;  3DM3 A;  1EY0 A;  1FD7 D;  3A0J A;  5BN5 A;  1K28 A;  2MHV A;  2K7V A;  4B3T L;  2XWB B;  4LF5 L;  1ZEQ X;  4I7A A;  3QJY A;  1AE3 A;  2I46 A;  4XDX A;  1KNA A;  2X6L A;  3F2D A;  1SXT A;  1FR3 A;  2ID0 A;  4JI4 Q;  1C8C A;  3K81 C;  1DON A;  1Y1V B;  2ICI A;  1PFS A;  1SJH D;  3BDL A;  5E4W C;  2A69 C;  2EJF C;  1YHQ A;  4FF3 A;  3GD7 A;  4OEM B;  1EYD A;  4OWW B;  1VQA A;  4KHV A;  3Q22 A;  1XMO L;  5LHY 1;  4Y52 H;  4A3J G;  1ZKO A;  2LXK A;  4FP5 D;  5DAU A;  4GNX A;  4Z9C B;  3K0Y A;  3HOX H;  2RSN A;  1CZG A;  4AH6 A;  5T1I A;  2N88 A;  4DR1 L;  1BVS A;  4GN4 B;  3CPF A;  4DR6 Q;  4A93 H;  2SNM A;  2BH8 A;  2IJ0 A;  1K8G A;  2RA4 A;  4LFB L;  1WI5 A;  2WV6 D;  2L9H A;  3DM1 A;  2HIV A;  1HNZ Q;  1EUJ A;  4ALP A;  4GKJ Q;  4DV2 L;  5A2Q E;  4M1U B;  3RLO A;  3KFU A;  4IPH A;  3I4N B;  1ET6 A;  1YJN A;  2R7Z H;  3GTM B;  3HFZ B;  3PQI A;  4LF8 L;  1ASZ A;  3N6R A;  5JJK A;  1SR3 A;  1QUQ A;  1VQL A;  1A3U A;  4FXD A;  4B9X A;  1Y8P B;  1SSO A;  1LAB A;  3CD6 A;  1N8R C;  1GVP A;  3OWE B;  1TWG H;  2VUM G;  4UPA A;  2I5L X;  5M5W B;  3QIA A;  3LWE A;  1KDA A;  5EQ0 A;  1SDF A;  2BOS A;  4BY1 B;  2SNS A;  4X64 Q;  4QL5 A;  1TT2 A;  1RCV D;  1IYV A;  2H4O A;  2AKW B;  2VQE Q;  4KKT A;  5J3B A;  2DJF C;  2JA6 G;  4LF4 Q;  3GTL B;  3CCV A;  3OW7 A;  1JWU D;  2QIL A;  4DV0 Q;  4HR7 B;  4DUY L;  3NBH A;  5I2X A;  4EVO A;  1HNX Q;  4XYO A;  5I9O A;  2IX0 A;  4JYA L;  4BBS B;  2D0O A;  1DOK A;  2DGY A;  1IHZ A;  1Q3L A;  4X3T A;  5ELO A;  1LTS D;  3RLN A;  4RGN A;  3SHL A;  3J80 E;  1NMG A;  1CKN B;  1JOK A;  2XRQ D;  4ZKB B;  5M9O A;  2WB1 B;  2F0O A;  3EN2 A;  3OSO A;  3PO2 B;  4XXE A;  3FKI B;  1IW7 D;  3MEH A;  1MIU A;  1WCM H;  1G8Z D;  4LMQ D;  5JPN C;  5A2Q L;  3S1N H;  1YNJ D;  3OMG A;  4NMZ A;  2UU9 Q;  4A3G B;  1Q46 A;  5C4Z A;  1PYB A;  2F0Q A;  3PO3 H;  1AZP A;  5IWA L;  1BCP B;  4OWT B;  4G7O C;  1EYG A;  4ILW A;  4XIG S;  3SK8 A;  4LJZ C;  3PF5 A;  2E5L Q;  1GHJ A;  1EFI D;  3D4W A;  3R93 A;  1Q86 C;  3Q6S A;  1ESF A;  1I94 Q;  1D1K A;  4P74 A;  3STB C;  1D5M C;  5JJZ A;  1LTL A;  5CBA E;  2HCI A;  2EY5 A;  1WTV A;  5IIF A;  4K6L A;  1QOH A;  2A6E D;  1CKM A;  1HFG A;  5EKL A;  1L1O C;  3CCR A;  4GOP C;  1B53 A;  2JA7 B;  4FNF A;  4NW2 A;  1I4P A;  4HCE A;  2BDN A;  1SFO B;  1LTA D;  1IBK Q;  1VQ8 A;  2EZV A;  3HOZ H;  1KDB A;  4A3C G;  3C1F A;  2F0T A;  1H9M A;  2WKD A;  1QJO A;  1D2B A;  1ICF B;  3OMC A;  3S2D B;  3WWV A;  5HY6 A;  1HCZ A;  2F0V A;  2XRS D;  3VR3 A;  4DFA A;  4JOI C;  4KD3 A;  3RD4 A;  1JOR A;  5KGU A;  4A3M B;  1IZ6 A;  3VA5 A;  3J80 L;  2CQO A;  1EEI D;  4ZK9 B;  3S1R B;  1TWH H;  2K5N A;  4DNT B;  1A62 A;  3C1E A;  2F0N A;  1JB7 A;  1I4X A;  1PFB A;  3IAY A;  1EZ6 A;  4LFC Q;  1SEB D;  5C4J B;  3T56 B;  4X6A H;  1DM0 B;  1ENC A;  4JBW A;  5JVG 3;  5IY0 A;  3S17 B;  2R92 H;  2KCN A;  1PH8 A;  1WVL A;  2A5H A;  1B1Z A;  1VF5 C;  2E74 C;  4A3J H;  3SDZ A;  1UEB A;  5EGT A;  3OTO L;  1R9T B;  1A2T A;  1EYA A;  2VQF L;  1AZQ A;  3AU7 A;  3HZX A;  2EVB A;  4LAA A;  3CC2 A;  4L8J A;  4CJ0 B;  4CKE A;  2QDB A;  3D6C A;  4DR4 Q;  2F0D A;  3BDC A;  3P7J A;  1IL2 A;  4XQN A;  1PH9 A;  3TN2 A;  1Z6H A;  3D3R A;  5I9P A;  1T5X D;  1WYD A;  3C2P A;  2Q8R E;  3OYY A;  1ILQ A;  4DR2 L;  5KIX A;  4O1N A;  4YCV A;  4IFD J;  1HNW Q;  1XWE A;  1V1Q A;  4V19 0;  3VR5 A;  2V1C C;  1K9M C;  4N8F A; 
#chains in the Genus database with same CATH homology
 3MHB A;  4KN4 C;  1K83 B;  1JR0 D;  1LT6 D;  2F3W A;  3IFD A;  1CI3 M;  1I4H A;  1JOO A;  4EGV A;  2ZXO A;  3A8I E;  4OIJ A;  3EVQ A;  3K5N A;  3S14 B;  2CVR A;  3GTJ B;  3AMU A;  2F1M A;  1KAB A;  2LY7 A;  2NTS A;  4C3I B;  1OXV A;  3HKZ B;  2RVL A;  1KDC A;  2VXW A;  5HGT A;  2CW0 C;  1IL8 A;  1CHQ D;  2ICE C;  1EZ8 A;  2F0P A;  2F0E A;  1JWS D;  1I4G A;  1HTL D;  2JEB I;  5E1F A;  1LAC A;  2B2U A;  2A6H C;  1EY7 A;  3VYU A;  3I3C A;  3M7N A;  1LT4 D;  2BCO A;  3FRP B;  2IX1 A;  5I4D A;  3KLS A;  4HSV A;  1G29 1;  2XWJ B;  3M7G A;  2A68 C;  2NN6 G;  3T4A C;  3KF8 A;  2EDG A;  4GZY C;  1NAP A;  1QNU A;  3SVM A;  4HSP A;  4RA8 A;  2F0U A;  1BF4 A;  4XQQ A;  4A3F B;  3PUY A;  2L12 A;  3VA7 A;  2F0S A;  2FHT A;  2CQA A;  1SMY D;  3NTH A;  1BBX C;  4XT3 B;  4KHZ A;  4OL7 A;  2AWN A;  3K5M A;  2K5Q A;  1RKN A;  2EY2 A;  2RKS A;  2AQ3 B;  3NQI A;  1UAP A;  5IOD A;  1LT3 D;  4FYD A;  4FO2 A;  1BCP F;  3TP8 A;  1E2V A;  1V1P A;  3NPP A;  4I7Z C;  4BY7 B;  2LS0 1;  1U4P A;  3R2T A;  5CV8 A;  2FJ2 A;  5M3F B;  1S5B D;  2B8G A;  3OIQ A;  1STH A;  2KQ3 A;  5T1G A;  4NKL A;  2M2L A;  2F0G A;  4OO1 G;  3WOE A;  5ISR A;  5CBE E;  1BCP D;  3PV0 A;  4K5W A;  1SYF A;  1UNS A;  1EOT A;  2L1B A;  1I6H B;  4EQN A;  1EU3 A;  3X3M A;  2NN6 I;  1TWC B;  4G7H C;  1BR9 A;  2X6G A;  3NBI A;  1D5Z C;  4Q0F A;  2IX3 A;  1B9M A;  3TZD A;  5D3I B;  3ND9 A;  4F87 A;  3J7Y W;  1H9J A;  3KLR A;  3CRL C;  3GQB A;  3TSS A;  1LT5 D;  3OHX C;  5CYU A;  1EY4 A;  2EYM A;  1DCZ A;  2XN9 C;  3DEP A;  1CA6 A;  1UUP A;  1CQF A;  3MXG A;  3U9O A;  2O5I C;  4G57 A;  3MFY A;  1SNC A;  1HFN A;  4KY6 A;  4WJW A;  1ROD A;  4DF7 A;  2JE6 I;  3S2H B;  4OO1 I;  4K2K A;  5JEA H;  4RHR A;  4QIW B;  3I72 A;  2AQ2 B;  1HA5 A;  4RKB A;  3SK6 A;  4C3J B;  1EQT A;  1JWM D;  3A56 A;  3DXJ C;  3VR4 A;  2K6A A;  4ZUI A;  1STB A;  5DNF A;  3IKJ A;  3PIO 3;  2C9O A;  2NN6 H;  4PV1 C;  5CV6 A;  1FNW A;  2V4D A;  1IW7 C;  4IUN A;  3DWQ A;  3NWS A;  1ICW A;  3OOC A;  4TQU S;  2NZ1 D;  1YNJ C;  3T51 B;  4FXK C;  3SK5 A;  2B2V C;  5C4X B;  4PQX A;  1GUS A;  1I4R A;  5C3E B;  1H9S B;  3TDQ A;  2XIW A;  3GV6 A;  1DYQ A;  1C48 A;  5I6W A;  5IGB A;  3S16 B;  1A3T A;  2A6E C;  4PNY A;  1WTP A;  2PO4 A;  5EKI A;  1WTR A;  2RDH A;  2E2H B;  2M9V A;  2NUC A;  3OWF A;  1RHP A;  4HMJ A;  4DK0 A;  4A3B B;  2FFK B;  2EY6 A;  1EQV A;  4K5V A;  5CC4 A;  3CRK C;  1JE4 A;  4WRD A;  2PZT A;  5IGE A;  4PMW A;  2K05 A;  1ESR A;  4OO1 H;  4IUU A;  4RWS C;  5EBD A;  2BE5 D;  1PTO D;  2BDO A;  5M5X B;  1PMR A;  3MXP A;  5CMD A;  1B4O A;  2L5T A;  4RHS A;  2AWO A;  2SOB A;  5IGC A;  1JB3 A;  4U67 3;  3DUZ A;  2Z8L A;  5FLX E;  4L63 B;  2JXM B;  2SEB D;  5EPK A;  1GXD C;  2EPB A;  2RBM A;  1JOQ A;  3DMU A;  5IGD A;  4QF4 A;  1XYI A;  1M4V A;  2HDL A;  3AB9 A;  1KLG D;  5ELC A;  2EYL A;  1PZJ D;  1V1P B;  4OIK A;  4DN4 M;  2WP8 J;  3G7L A;  1HA6 A;  2NYZ D;  1EYC A;  2KA7 A;  2KOL A;  3W2D A;  1F9R A;  1CA5 A;  3ND8 A;  3EFX D;  2F0J A;  5JOB A;  4TRD A;  3FEW X;  5C0X G;  1Z7T A;  1ZXT A;  3BVZ A;  2WII B;  3TBI B;  1TWH B;  3VR2 A;  1SNO A;  3H3V C;  1F2L A;  5FKA C;  4N9P A;  1U9R A;  1F2M A;  1HTP A;  1STA A;  3E5S A;  5FLX L;  4LK1 C;  3R3O A;  1PFM A;  4DXF A;  5C6A A;  3I91 A;  1STN A;  4ZQ3 A;  3K58 A;  4A3J B;  3TME A;  4CGY B;  4R9W A;  5DM7 3;  2PYK A;  3E0J A;  5NUC A;  3MFG A;  1VMP A;  2HUG A;  4CKC A;  5FO8 B;  1F9P A;  2WIN B;  2ZT9 C;  2OEO A;  4FF1 A;  2AUJ D;  2L0C A;  2JYO A;  4KY5 A;  1NSN S;  1D5X C;  4H13 C;  3P20 A;  2KJX A;  3HG9 A;  4ULL A;  2PW7 A;  2D9U A;  1SYE A;  5D14 A;  5J39 A;  2VUM B;  1NUC A;  3QB3 A;  2C5C A;  1HHV A;  1ENA A;  3VYR A;  2Q8I B;  1SMY C;  2J0T D;  1S5E D;  1GUG A;  4RGO S;  3R8B A;  5C0X I;  4M8A A;  4ZRZ A;  4E6I A;  2JA6 B;  4X3U A;  2PPB C;  1JQY D;  3M4O B;  1LTG D;  4ZKC B;  5G3L D;  3D6W A;  3P1H A;  1OXT A;  3BYY B;  1PLF A;  4WOR A;  4RCO A;  3K6O A;  5FO9 B;  3G6J B;  3Q23 A;  1SND A;  2ZXR A;  2VB3 X;  4DAP A;  1Y8N B;  1EIG A;  1CQV A;  3NHH A;  3FPP A;  1MSG A;  2B2W C;  3Q0A A;  1U4R A;  5C5L A;  4KN7 C;  3DEO A;  1LTT D;  4RKL A;  4KJN A;  3MWY W;  1BCP C;  2JSO A;  3BS1 A;  1BDO A;  5M5Y B;  4IFD H;  2NB0 A;  4F88 A;  2LKV A;  2Q8T A;  1EIH A;  1ENF A;  4IUV A;  2L55 A;  2F4I A;  1RJT A;  3SEB A;  1A6X A;  5KNB A;  1X32 A;  4L6T B;  3OPO A;  4EQO A;  4DAV A;  5LL6 S;  2B39 A;  3V05 A;  1RTO A;  4K8J A;  1YNN D;  1FYC A;  2G9H D;  3CHB D;  2L11 A;  4IZ8 A;  1I3Q B;  2HDM A;  1A15 A;  1XTC D;  5FO7 B;  2VB2 X;  1E2W A;  4G7Z C;  4U68 A;  1EWH A;  5C0X H;  5IGG A;  4KK7 A;  1OXX K;  4X3S A;  2E2J B;  1X3Q A;  2EJG C;  5BN4 A;  1HUN A;  1QIL A;  1H9K A;  5FK9 C;  3MTS A;  2Z1C A;  1TS3 A;  4CHT B;  5JVH 3;  4J1M A;  1IKM A;  3KUP A;  3K57 A;  3GTG B;  4IN3 A;  4HAE A;  5IOC A;  2IL8 A;  1ILP A;  4HCS A;  3ZYY X;  1PTO B;  4X3K A;  3KK7 A;  5JEA G;  1PRT D;  1TQO A;  2M00 A;  2FMC A;  2A74 C;  1D6E C;  2RDG A;  2EJM A;  1TY2 A;  1PYW D;  1G2S A;  1EY5 A;  2VNU D;  1EU4 A;  1BNZ A;  2BA0 A;  2KCC A;  5K36 G;  2NWG A;  3LWU A;  3SR1 A;  3GO5 A;  5J1Z A;  1F9S A;  1JCK B;  1MGS A;  5JAV A;  3HOU B;  1OO9 B;  1TS5 A;  5DM6 3;  2PZU A;  2B2T C;  3GP7 A;  2EY1 A;  4WFN 3;  1LTI D;  3I70 A;  3K59 A;  3A7L A;  1GOZ A;  3U9S A;  1FGB D;  1GJX A;  3TP6 A;  1B44 D;  1VCI A;  5IT9 E;  3H6M A;  3KBG A;  4B9W A;  1KNE A;  2F03 A;  2TSS A;  2PNR C;  1G6Z A;  1W6J A;  4K5X A;  4H0L C;  4BS9 A;  1ZYR D;  4OHJ A;  1RTN A;  5JPM C;  5EKK A;  3D31 A;  2D62 A;  2EYO A;  1QNK A;  2WAC A;  1SNQ A;  3NK9 A;  5C3W A;  2PW5 A;  1PFN A;  2H1E A;  2B63 B;  1MSH A;  5CV7 A;  4K8I A;  4BWG B;  3M4Y A;  1AN8 A;  2QKI C;  2BE5 C;  1PTO C;  3QWN A;  2EYH A;  4YIJ A;  1CK1 A;  1BO0 A;  1F2Y A;  3NTI A;  4IUR A;  2AQ1 B;  3S9W A;  4ID6 A;  4H7B A;  1HUM A;  4P2C B;  4CBV A;  3NSW A;  2DNE A;  1FNV A;  3HEJ A;  4C3J G;  5IT9 L;  3I90 A;  3RUZ A;  2QEJ C;  4C3H G;  3S1M B;  5ELF A;  4FF4 A;  1SE4 A;  1TS2 A;  1HPC A;  2N55 A;  5F2D A;  5KYL A;  3N52 A;  3PIP 3;  3L9A X;  1AFP A;  1L0X B;  3BVG A;  4A3E B;  3PUZ A;  4A3I B;  5TSS A;  4MN3 A;  1I50 B;  3NQT A;  2B8F A;  4IUT A;  3SXH A;  1Q90 A;  3HOY B;  3QG1 A;  1TWF B;  3K5O A;  2EOT A;  2MUY A;  1TY0 A;  2JA8 B;  4C1N K;  2NVY B;  1GUO A;  1G91 A;  3JAM L;  4JK1 C;  1AW7 A;  3O13 A;  5EPJ A;  4F7X A;  3MXN A;  4V0B A;  2OXP A;  2MJ8 A;  1CZW A;  1SYG A;  1VDZ A;  1X3P A;  2MGS A;  3HP3 A;  2R6G A;  1WD0 A;  2GA4 B;  3CKI B;  3FPU B;  4J6H A;  1Y1W B;  3J81 E;  4KY7 A;  2F0M A;  2KED A;  5I6Y A;  5K36 H;  3NXW A;  2J7Z A;  1E2Z A;  4RH6 A;  1SNM A;  4R8N A;  2O4X A;  2CHB D;  3C46 A;  2FMM A;  2KUM A;  2E2I B;  3HOX B;  4IUQ A;  3FMC A;  1PXU A;  4KV6 A;  4A93 B;  2EE1 A;  4NDX A;  1SNP A;  4ZLT F;  2MPM A;  1D1I A;  2F0F A;  2F0L A;  1LV9 A;  5C5M A;  2WKC A;  2F0K A;  3SK4 A;  2R7Z B;  1PTO F;  3DWP A;  2K04 A;  3NTK A;  3V96 A;  1EY9 A;  2YYZ A;  4I65 A;  4ABN A;  1S5D D;  1SYC A;  5K5P A;  2K03 A;  1EY6 A;  1PZI D;  1CT1 D;  1TWG B;  3M85 A;  1A3V A;  1STE A;  4FVM A;  1STG A;  1QWY A;  4CKB A;  1EY8 A;  1I6V C;  3SE0 A;  1F77 A;  1EWC A;  1VF7 A;  3J81 L;  3D8G A;  1V8Q A;  1PDQ A;  2OT2 A;  4XQJ A;  2E76 C;  3DWA A;  2PZW A;  4IAL A;  1SE2 A;  2X69 A;  3A55 A;  5C3X A;  3TP5 A;  5CV4 A;  1EL0 A;  2JEA I;  2J4X A;  5COR A;  4J8Q A;  1MD2 D;  4Y7N B;  3URY A;  1U4L A;  1DXM A;  2PQE A;  5D3D A;  1WCM B;  2RQX A;  3BYT B;  2K5W A;  4KI0 A;  1PRT B;  2QCP X;  3S1N B;  2BA1 A;  1KLU D;  1TWA B;  3PO3 B;  4G4K A;  3ERO A;  1WD1 A;  1JIC A;  2F0H A;  2Y0S B;  1ONL A;  1R4P B;  4IFD G;  2DY7 A;  5HUR A;  2FIN B;  5BN3 A;  1WTQ A;  5ELE A;  1GUW A;  2K33 A;  1CFM A;  1O80 A;  3W3A A;  3J7A V;  1VMC A;  1XX8 A;  3HOZ B;  5A35 A;  4XYQ A;  2F0I A;  4HTH A;  4H44 C;  1YNN C;  3GV3 A;  1BQQ T;  2D2C C;  4K2L A;  5KRU A;  1LLR D;  3OIP A;  3BG3 A;  1DOM A;  1Y69 U;  2EYP A;  4PMB A;  1HQM C;  1O7L A;  2B2U C;  3PUV A;  2NVQ B;  1I4Q A;  1G2T A;  1KTK A;  4MIU A;  5EPL A;  2IW3 A;  4DAY A;  4S3S A;  1XXG A;  1MI2 A;  3S1Q B;  1V43 A;  2EXZ A;  3R2I A;  3L3O C;  3MXU A;  2R92 B;  2EYJ A;  1BUV T;  5EBC A;  4KJO A;  2E2D C;  5CV9 A;  1T5E A;  5KND A;  5DEH A;  3EQL C;  3T16 A;  1DJR D;  1CTM A;  1KAA A;  3RLF A;  2PMZ B;  2F0W A;  1R4Q B;  2DNC A;  1PRT C;  1SJE D;  3BZD B;  1HRJ A;  3J7A F;  4IFD I;  5G3L F;  3I4L A;  1BXT A;  4AYB B;  2K5D A;  3RZD B;  3V2T A;  2B2Y A;  1Q1B A;  1SYD A;  4RGT A;  3FVQ A;  3CQZ B;  4QUF A;  4HED A;  3I73 A;  1S5C D;  2KVM A;  2XNA C;  1QG7 A;  5M3M B;  2KEC A;  2B2V A;  3MA2 B;  1O7Y A;  4A3D B;  1GUN A;  1ML0 D;  2JP1 A;  3D4R A;  3HGB A;  4R8I A;  4RGM A;  2K28 A;  4DK1 A;  2NVX B;  5ELB A;  4N9T A;  2DY8 A;  3MC0 B;  1ZYR C;  3A54 A;  1Q1E A;  1J8I A;  3LNN A;  4C56 C;  1V1O A;  3H91 A;  1BOS A;  2KHS A;  1MBY A;  2A69 D;  2WAQ B;  4UDU C;  2E75 C;  5C44 B;  3HS0 C;  4C3I G;  4CJ2 C;  3L7Z C;  4CJ1 B;  1B2T A;  2K01 A;  1RF2 D;  4RFB A;  2D5D A;  1WTW A;  3NP8 A;  4FF2 A;  3HOV B;  4ME5 A;  3BVM A;  3GTO B;  3ONA B;  5E4X A;  1K8M A;  1CHP D;  3T13 A;  1LO5 D;  4NP5 A;  2QF7 A;  2KEE A;  4UAI A;  1LTB D;  3E6Z X;  1J9O A;  3KLS X;  2NVT B;  1Q12 A;  3K5L A;  1H9R A;  1ET9 A;  3NUC A;  2R3Z A;  4FXG C;  3NE5 B;  3GTP B;  1PRT F;  1NCV A;  3NWT A;  2ENB A;  2XSC A;  1HXY D;  4A3K B;  4MHE A;  4ZYS A;  5E3F A;  2NTT A;  2RSO A;  4KKS A;  1H9S A;  5I2Y A;  1B50 A;  1CM9 A;  2ZXP A;  3WOF A;  2LMC B;  3VYT A;  3P75 A;  5FOB B;  4C2M B;  3ERQ A;  5CV5 A;  3PUW A;  5C0X J;  5KYI A;  1B3A A;  1TII D;  4HN7 A;  4IUP A;  4C1N I;  1S5F D;  4TKO B;  3VR6 A;  4IQZ A;  1W6K A;  3HOW B;  3TZU A;  1QE6 A;  3MVV A;  3MAQ A;  4ODG A;  2HQE A;  1JC7 A;  4KKU A;  4ZUJ A;  1Y8O B;  1IKL A;  1DZ1 A;  1SYB A;  4DA2 A;  2Z4H A;  2SDF A;  1DD2 A;  1O7Z A;  2OF1 A;  3CU7 A;  5CGK A;  4OGQ C;  4QB4 A;  3A8K E;  5EJW A;  1TU2 B;  1DOL A;  3A7A B;  1L0Y B;  1UEA B;  1QB5 D;  2HCC A;  1GUT A;  2IPK D;  3MZ5 A;  1U4M A;  1RDP D;  1M8A A;  3QOL A;  1B9N A;  3KBX A;  4TSS A;  4DGZ A;  1F9Q A;  5LL6 X;  2EYF A;  1TR5 A;  4DXG A;  4Q5V A;  4QCL A;  1GHK A;  1RD9 D;  1LTR D;  2L4N A;  2LFN A;  3JAM E;  3EA6 A;  2O5J C;  5AFW A;  3H0G B;  3PUX A;  1TVX A;  2XVS A;  3K7A B;  3TP7 A;  1OXU A;  3ITP A;  2PCF B;  3S15 B;  1QCB D;  3DHQ A;  3IL8 A;  3VYS A;  3RZO B;  1PTO H;  1IYU A;  1STY A;  3M3Y B;  4KMU C;  3QOJ A;  1K8O A;  4HMI A;  1AEX A;  4QMG A;  2YU9 B;  5KNC A;  5ELD A;  1Z47 A;  4PMC A;  4XTC S;  5IGF A;  1WTO A;  3HRZ C;  1O78 A;  2K1B A;  1NR4 A;  3I4M B;  2B2W A;  4B08 A;  1S4Z A;  1SAP A;  2R93 B;  4RCN A;  3EJI A;  2R61 A;  2MP1 A;  1C4Q A;  1SE3 A;  4EQP A;  4RAU C;  4QUC A;  3T53 B;  3IFT A;  1NR2 A;  1II3 A;  2Z4I A;  1F2Z A;  3WDN A;  2K32 A;  4BA1 I;  5D65 A;  1WTX A;  1TKW B;  3QO2 A;  1SBB B;  4O42 A;  3H94 A;  2CW0 D;  3RMH A;  2JA5 B;  3D4D A;  2G9D A;  3UI2 A;  2IT1 A;  1Q8I A;  2A6H D;  1PZK D;  1OXS C;  4KTA A;  1AP0 A;  4XT1 B;  5J22 A;  2AUK A;  5JEA J;  4C3H B;  3I8Z A;  3A8J E;  2B2Y C;  3C3L A;  2A68 D;  4DU9 A;  1TS4 A;  1A2U A;  2TMP A;  2DN8 A;  4F8M A;  2O2L D;  4BA2 I;  3F2U A;  1FNU A;  3FDT A;  3BDO A;  1HQR D;  1EEF D;  2I07 B;  4K14 A;  2RDF A;  3Q24 A;  5C4H A;  3GTK B;  3GTQ B;  2A73 B;  4KD4 A;  3H09 A;  2IWH A;  5COY A;  3LX0 A;  3PMF A;  2NBF A;  4K6D A;  2B2T A;  4DNR B;  5CR3 A;  4ZAI A;  2F3V A;  4BBR B;  1E0B A;  3X3N A;  5BN5 A;  1EY0 A;  1FD7 D;  2MHV A;  2K7V A;  2XWB B;  1ZEQ X;  3QJY A;  2I46 A;  4XDX A;  1KNA A;  2X6L A;  1SXT A;  1FR3 A;  2ID0 A;  1C8C A;  1DON A;  1Y1V B;  2ICI A;  1SJH D;  3BDL A;  5E4W C;  2A69 C;  2EJF C;  4FF3 A;  3GD7 A;  1EYD A;  4KHV A;  3Q22 A;  5LHY 1;  1ZKO A;  4FP5 D;  5DAU A;  4Z9C B;  3K0Y A;  2RSN A;  1CZG A;  5T1I A;  2N88 A;  2SNM A;  2IJ0 A;  2RA4 A;  2WV6 D;  2L9H A;  3DM1 A;  5A2Q E;  4M1U B;  3I4N B;  1ET6 A;  3GTM B;  3N6R A;  4FXD A;  1A3U A;  4B9X A;  1Y8P B;  1SSO A;  1LAB A;  3OWE B;  5M5W B;  3QIA A;  3LWE A;  1KDA A;  5EQ0 A;  1SDF A;  2BOS A;  4BY1 B;  2SNS A;  1TT2 A;  1RCV D;  1IYV A;  2H4O A;  4KKT A;  3GTL B;  3OW7 A;  1JWU D;  2QIL A;  4HR7 B;  3NBH A;  5I2X A;  4EVO A;  4XYO A;  5I9O A;  2IX0 A;  4BBS B;  1DOK A;  1IHZ A;  1Q3L A;  4X3T A;  1LTS D;  4RGN A;  3SHL A;  3J80 E;  1JOK A;  2XRQ D;  4ZKB B;  5M9O A;  2WB1 B;  2F0O A;  3OSO A;  3PO2 B;  4XXE A;  3FKI B;  1IW7 D;  3MEH A;  1G8Z D;  4LMQ D;  5JPN C;  5A2Q L;  1YNJ D;  3OMG A;  4NMZ A;  4A3G B;  5C4Z A;  2F0Q A;  1AZP A;  1BCP B;  4G7O C;  4ILW A;  4XIG S;  3SK8 A;  4LJZ C;  1GHJ A;  1EFI D;  3D4W A;  3R93 A;  3Q6S A;  1ESF A;  1D1K A;  1D5M C;  5JJZ A;  5CBA E;  2HCI A;  2EY5 A;  1WTV A;  5IIF A;  4K6L A;  1QOH A;  2A6E D;  1HFG A;  5EKL A;  1B53 A;  2JA7 B;  4FNF A;  4NW2 A;  1I4P A;  4HCE A;  2BDN A;  1SFO B;  1LTA D;  2EZV A;  1KDB A;  3C1F A;  2F0T A;  1H9M A;  2WKD A;  1QJO A;  1D2B A;  3OMC A;  3S2D B;  1HCZ A;  2F0V A;  2XRS D;  3VR3 A;  4DFA A;  4KD3 A;  3RD4 A;  1JOR A;  5KGU A;  4A3M B;  3J80 L;  3VA5 A;  1EEI D;  4ZK9 B;  3S1R B;  4DNT B;  3C1E A;  2F0N A;  1I4X A;  1PFB A;  3IAY A;  1EZ6 A;  1SEB D;  5C4J B;  3T56 B;  1DM0 B;  1ENC A;  4JBW A;  5JVG 3;  3S17 B;  2KCN A;  1WVL A;  2A5H A;  1B1Z A;  1VF5 C;  2E74 C;  3SDZ A;  5EGT A;  1R9T B;  1A2T A;  1EYA A;  1AZQ A;  3AU7 A;  2EVB A;  3HZX A;  4LAA A;  4L8J A;  4CJ0 B;  4CKE A;  2QDB A;  3D6C A;  2F0D A;  3BDC A;  3P7J A;  4XQN A;  3TN2 A;  1Z6H A;  3D3R A;  5I9P A;  1T5X D;  3C2P A;  2Q8R E;  1ILQ A;  5KIX A;  4O1N A;  4IFD J;  1XWE A;  4V19 0;  3VR5 A;  5KEE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...