1LLRD

Cholera toxin b-pentamer with ligand bmsc-0012
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
b'TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHOLERA TOXIN B SUBUNIT
publication title Characterization and crystal structure of a high-affinity pentavalent receptor-binding inhibitor for cholera toxin and E. coli heat-labile enterotoxin.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Toxin
total genus 26
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2002-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1llrD00
2IJ0A 4K6LA 4RGNA 1SE2A 1PZKD 3DWQA 1KTKA 3DWAA 2AQ2B 1V1OA 2G9HD 3BYYB 1EFID 1G8ZD 1D5ZC 2SEBD 4OHJA 1PYWD 2XRQD 1PRTB 3EA6A 3R8BA 1EU3A 3BVGA 1D5XC 1I4QA 1LT6D 1SJED 3DWPA 1LTTD 1B44D 1BCPC 4RGMA 4L6TB 1EEID 4TSSA 1SJHD 2O2LD 1SE4A 5FKAC 1FNWA 4O1NA 5D3IB 3BZDB 1TS5A 1B1ZA 1TY0A 1EWCA 1EU4A 1PRTD 1I4PA 4RHRA 1RF2D 5ELFA 1CK1A 1DJRD 1PTOH 5ELDA 3BVMA 1RCVD 1JWMD 1CHPD 1PTOF 5FK9C 1PTOC 1S5BD 1UUPA 1CHQD 1JWUD 5ELEA 4BWGB 1KLGD 4UDUC 1I4GA 1V1PB 1BCPF 3O13A 1HA5A 1BXTA 1V1PA 1EEFD 1ESFA 1L0YB 3BYTB 1KLUD 5I4DA 1FGBD 1LTAD 3CHBD 1D5MC 1PTOB 1HTLD 1LT5D 1LTBD 1FNVA 3SEBA 4DXFA 1JQYD 1MD2D 2AQ1B 2NTTA 1HXYD 1FNUA 4ZYSA 2QILA 1BCPB 3R2IA 1QILA 1CT1D 2J4XA 3TSSA 3URYA 2ICIA 2TSSA 3W2DA 2CHBD 4C56C 1I4HA 1TS2A 2XNAC 2WV6D 1S5CD 2RDGA 1JWSD 2Z8LA 1I4RA 1PZJD 1L0XB 1S5ED 1TS3A 3MFGA 1SBBB 1TY2A 1LLRD 4L63B 1BCPD 1LT3D 1RDPD 1SXTA 5ELCA 5ELBA 3OWEB 2QEJC 2XRSD 1PZID 3V05A 4DXGA 1I4XA 1S5DD 4RGTA 2IPKD 3BVZA 1HQRD 3GP7A 4RH6A 4RHSA 1DYQA 2AQ3B 1JR0D 1CQVA 1RD9D 3EFXD 1LTGD 1XXGA 1ET9A 1FD7D 5D3DA 4Z9CB 1LT4D 1LTID 1AW7A 1SEBD 1ENFA 1XTCD 1ET6A 1JCKB 1AN8A 1PTOD 3MC0B 5TSSA 2NTSA 1T5XD 4RFBA 1TS4A 2RDHA 1GOZA 1PRTF 2XN9C 1LTSD 1UNSA 1PRTC 4RGOS 4RCOA 1S5FD 1F77A 1SE3A 3KLSX 1LTRD 3R2TA 1LO5D 1STEA 1M4VA 1D6EC 2R61A
chains in the Genus database with same CATH superfamily
1VQ6A 2CQAA 1UEBA 1SE2A 3KDFB 2VQFL 1A6XA 2TMPA 2CWAA 2VY3A 1Q8KA 2XRQD 2JEAI 5IP7G 2EYHA 1XNRQ 4K0KQ 3GTKH 4F88A 2F03A 1L1OB 3P1HA 5M5YB 4YWKA 2F4IA 3S1NH 1SE4A 2F4VQ 2XTIA 1XTDA 2PPBC 3KLSA 1E3PA 1N33L 5C44B 1TWGB 5C4XB 1TWCH 1XPUA 2NVYH 3KK7A 4OO1I 1QUQA 2GA4B 5FJ8G 1BBXC 3H0GB 1RCVD 1Z6HA 1V1QA 4OX9L 1VQAA 2A68D 1C0AA 3I91A 2VUMB 3M7NA 4A76A 2K75A 1MGSA 4L5SA 3J80c 1K83B 2P5ZX 3HOYG 1AP0A 5IT9E 1FGBD 4A3MH 4A3FG 3CU7A 3CP0A 2VXWA 1OXTA 2E2IH 3RUZA 3MXNA 1DONA 4DK6C 1K8OA 3RN2A 1MD2D 1QCBD 4IUPA 1HXYD 3HRZC 4PQXA 3B6YA 2QKIC 3AQQA 4X6AH 1G291 3F1ZA 3M4OB 1Y1WH 3P75A 4LFBQ 2YTYA 3JAME 3S17H 3PUYA 2JE6I 1RJTA 1LLRD 2IX3A 3G7LA 1HZBA 3OYYA 4CDDC 3OWEB 2LS01 2PI2E 4NDXA 1XYIA 5A2QE 1B8AA 3U58A 1VQPA 1VQDA 3BVZA 1O7LA 2EY5A 5EKKA 3MXGA 4JI2Q 2WACA 1U5KA 1E1OA 4RCNA 4UPAA 1U4MA 3Q6SA 1MSHA 3FRPB 4APVA 1SEBD 2Y0SB 3M4PA 3T4AC 1QVFA 4Y7NH 4X3SA 4QUCA 1HUNA 3GV3A 5C5LA 1AE3A 2JSOA 3MFYA 1TWHH 5EQ0A 1G6PA 2R61A 3KOJA 3KFUA 4C3HB 5CV6A 3DWQA 1MSGA 5M3MG 1EFID 2KECA 2ASBA 4X65L 1LM0A 2EYJA 1KDBA 1PH6A 1SJED 3SDZA 1SE8A 5CV9A 4JBWA 4XDXA 1TKWB 4A3KB 2O2LD 3PQIA 2K03A 1KRSA 1NSNS 4JI3Q 1BDOA 1CTMA 1X6OA 4DV3Q 3U50C 3PF4A 5FO9B 3CCQA 4DR1L 1II3A 1EY9A 2A19A 2OEOA 5JPNC 2B2WA 4LW1A 2JA8G 3NWSA 4UAIA 1CHPD 1PH4A 3NSWA 1HR0Q 1X54A 1F9RA 3OIQA 5FLMH 1UUPA 2K28A 4ILWA 4IJHA 2VL6A 1C48A 1QOHA 1WTXA 2EYMA 4UDUC 4GOPB 3PF5A 2E8GA 3SHLA 5KGUA 1F9PA 1L0YB 3NENA 4LMQD 4DR5L 2Z4HA 1WD1A 5EPJA 1S40A 1N36Q 1YNND 2OQKA 1D5MC 1Y1VH 4JI5L 2N3SA 3SEBA 2NZ1D 4GZYC 1O7ZA 1MJEA 3HOVH 1YNXA 1UEAB 3RMHA 1VQNA 5M3FG 3HOWH 2RDGA 1IL8A 1NTGA 3NTKA 3HGBA 3NBIA 5GROA 2ICEC 4KV6A 2H4OA 1WCMG 2VQEQ 4R9WA 1WI5A 5ELCA 3EJIA 4DV2L 5CBEE 1STNA 2UU9Q 3I4NG 3SE0A 1I4XA 3DEPA 4KHVA 2IT1A 1HQRD 4P75A 4DUZL 1EQTA 4EQOA 1WTOA 5LL6X 1HJPA 1OO9B 2EJMA 1LTID 3NUCA 1PFMA 3T1HQ 3H94A 1ENFA 3CC2A 2K5NA 4LF9Q 3BU2A 1B50A 4L5RC 2L15A 4LFAL 3KF8B 4JI0Q 4OGQC 1Y8OB 3C46A 4A3IB 1C4QA 2CFMA 2B29A 3TZDA 1JORA 1CQFA 3T1YQ 3K0YA 1PH5A 1N36L 2NVTB 5DLQE 1QVGA 3PO3B 3K80C 2QW7A 3UE1A 4IPGA 1PRTB 1RODA 4CDFC 4BY1G 5C0XG 3KUPA 4ID6A 3A54A 1B44D 4UY8C 3CXCA 2C5CA 2EYOA 1QWYA 1SMYC 3BDLA 5K36H 1WD0A 5I9PA 3HOXB 2HHHL 3M3YH 2MFIA 2NYZD 2UUAQ 5H1SE 3S15H 3MVVA 1JWMD 3F2CA 1GUGA 2UXBL 5CV7A 3TS0A 2UU9L 4L8JA 1I94Q 1YJWA 4A3JH 4U673 5M5XH 3AEVA 4IOAA 1HA5A 1WTWA 1EEFD 1WYDA 4RKLA 5GADC 5JPMC 1Q1EA 2OF1A 3VR4A 2Z9HA 2IHFA 2K7VA 4KN7C 2A73B 4JC0A 2WAQG 2RVLA 4DXFA 4A3DH 2NTTA 2AQ1B 3DXJC 4LF8L 4DF7A 3HZXA 1A3VA 1BCPB 2OTJA 3PUXA 1JB3A 2GN5A 2TSSA 4BBSG 4P71A 3L2PA 1JOQA 5LMNQ 1N34L 4L5TA 3RZDH 3UDGA 1EQQA 2XWJB 4PG3A 5LMNW 2E2HB 2JA6B 2ZM6L 1I6VC 3ND8A 2Q2UA 3WWVA 3GTOH 1GO3E 4YCVA 4B3SL 4HIDA 3ZYYX 4DR2L 4FF3A 3NEMA 4JK1C 1B4OA 1HCZA 1C8CA 4DV4Q 4WFN3 4RGTA 2M9VA 2D62A 2XIWA 1QE6A 4CGYB 4GNXA 1I6HB 1AEXA 2HDLA 1LTGD 5HGQA 3GTJH 3W5OA 1VQEA 3PO2H 4OXPA 2DUDA 2R93H 3C1FA 4HTHA 4DR3Q 1CA6A 1SYBA 1X55A 4OIJA 2KHSA 1XJVA 1PH8A 2UXCQ 3S14H 1XMQL 1C9OA 4LF4Q 4IN3A 3FKIB 4RGNA 5DM73 4JI4L 1OXUA 2AQ2B 2ZTCA 2F0VA 1Z9FA 2EQSA 3PGZA 5JVG3 3OOCA 5JJLA 2B63B 3SGIA 4IFDI 4TSSA 4NB3A 2R92B 4CKCA 2DN8A 1JE4A 4LNQA 4B08A 4DV1L 4JPBW 2BE5C 1CZWA 2K32A 2CH4A 1RTNA 1JJCB 3L3OC 5IYBG 3BVMA 1ZKOA 1RKNA 2DY7A 3PUVA 5ELEA 2B2VC 3Q24A 3S1NB 4A3BB 5JJKA 1V1PB 3IFTA 5KRUA 3DUZA 2Z6KC 4ME5A 4BS9A 1IBLQ 2SNMA 5GAEC 4EQ5A 4BY7B 2CVRA 3J81E 4LF7L 5E3FA 4JYAL 4X64Q 4X3KA 2EY2A 2Z1CA 4DV7Q 2EY6A 3FVQA 5D14A 2RA4A 5KYIA 1Q12A 4A4IA 4HIKA 2ICIA 3TZUA 4C56C 3PIPA 1A2UA 1BOSA 1EY6A 4JI6Q 4H7BA 4HR7B 2JQOA 3BS1A 1L0WA 3I4OA 1IBMQ 3VR6A 4C1NI 2BCOA 5C4JB 2QEJC 3HKZB 2JN4A 2WP8J 2K5DA 2L5TA 3FHWA 1SMYD 4OWWB 2XGTA 2IPKD 1FYCA 3QB3A 3CCUA 3CPWA 1VQMA 1D1KA 5C44G 5C4XG 1TWAH 4QGUA 3A5ZB 3H0GG 2A6ED 3KLWA 2F0WA 1GUNA 4DV6L 1PMRA 3U4ZA 2NVXB 5EJWA 2FHTA 2VUMG 4RCOA 3X3MA 4HSPA 3CCVA 3LGJA 1LTRD 2B8FA 3GTMB 4MHEA 5I2XA 1H9RA 2GVBA 4WJ4A 2A68C 5IP7H 4OWXB 3AFQA 5KNDA 4ZAIA 1I3QH 1MBYA 4JV5L 4DV5L 1X3QA 4DUYQ 2ENBA 3IKJA 1RHPA 4LF5Q 2BA1A 2ZXRA 1JOKA 3CMEA 2KJXA 3K7AB 1AZQA 3A8IE 3CQZH 4C3JB 4DK1A 3PO2G 1YBYA 1GXDC 3H3VC 1E1TA 1HNXL 5FJ8H 1AE2A 4A93B 3U9SA 2QGQA 3ZJYC 1SYEA 2B2YC 1TXYA 1DJRD 1WTQA 1STHA 2EYPA 4M8AA 4DAYB 1AFPA 2BH2A 3FPUB 2AWNA 5IP9G 5J1ZA 5IE8A 4KHPL 2F0FA 3CD6A 1JWUD 1CKNB 2Q2TA 2YYZA 4DNRB 3HOYH 1HNZQ 2HIVA 4CDEC 1YHBA 4A3FH 2AWOA 3RR5A 2OTLA 1NR2A 1M90C 4EGVA 3CW2C 3DM1A 3SR1A 1C7YA 3X3NA 3D31A 1WTRA 1MI2A 3A55A 4KD3A 4NXMQ 5T1GA 3RNUA 2O5IC 3R2IA 3T53B 2UUCQ 2I0QA 1EY0A 1Q8IA 1HRJA 1LABA 4X62L 1ESRA 2PCFB 4C3HG 3U9OA 4X66L 4DU9A 2K14A 1DOMA 3EROA 5IGDA 3NP8A 1KNEA 5LL6S 4DPGA 5KNCA 1GVPA 1SBBB 1XPOA 5COYA 3I4MG 3A5UA 2BDNA 1N32L 3GTLB 4U68A 5BN4A 3ULPA 1FR3A 3VR3A 1Q90A 1XWEA 2BE5D 3EN2A 1EY4A 3BZCA 3HEJA 1WVLA 4Y52H 3HOUB 1STYA 5FO8B 1AW7A 2EJFC 1SLJA 3OTOL 2A8VA 5TSSA 3OW7A 2XSCA 3J81j 1IBKQ 3FPPA 2FINB 1PLFA 5BR8L 3TRZA 4XT1B 1G6ZA 3S2HH 1UNSA 1PDQA 1CI3M 2JJQA 4GOPC 5M3MH 1XMOL 5E1FA 2IJ0A 2ZJQA 5A35A 1SNDA 2M2LA 3FEWX 4F7XA 3CC7A 2F0KA 1X32A 3PV0A 3AYHB 4ME3A 3GTQB 1IYVA 1D5XC 1XNQL 4OO1G 5IGFA 5JJIA 5C3EB 1EIFA 4ZRZA 4GKKQ 1T9HA 4FXKC 4QJFA 3HG9A 3CCLA 3RZOB 5D3IB 1HFNA 5KEEA 4QL5A 3VA5A 2JA8H 1TU2B 5E4XA 2SOBA 1QUQB 2AKWB 4K8IA 3HOZB 4CKEA 1EQRA 2RKSA 1PYBA 3WDNA 3KJPA 4B3TL 2B2TA 3SK5A 4EQNA 4FDBA 1VF7A 4OL7A 1KLGD 4I65A 1ZXTA 5HURA 4O2DA 1BXTA 4MTNA 3F2UA 3AU7A 3EQLC 4DAMA 1B70B 4WRDA 4GN3B 1P16A 1F2YA 3MXNB 1LTBD 4JVZA 4R4IA 5M3FH 4HMJA 3SXHA 1GM5A 4A3JB 5GQOA 2E2JH 2J4XA 3URYA 2WIIB 5IT9c 1SYDA 3W2DA 2L0CA 3VYSA 4A3IG 1CM9A 1FL0A 2ZTDA 1JB7A 1HNWL 1QNKA 3J7A5 3Q23A 3C3LA 2HT1A 1WCMH 3PO3G 4HJ7A 2NZHA 3KYHC 4TVAB 4CJ2C 3VR5A 1HHVA 2I07B 3I4NH 2WINB 3G48A 5C0XJ 1RDPD 2CQOA 3IFDA 4HCSA 3CC4A 2IX1A 1J5EQ 2PQAA 3GTGH 3KDFA 4IOCA 4NP5A 1RD9D 1H9KA 4KI0A 2H5XA 1XXGA 4Z9CB 3HOXG 2K5QA 1AN8A 5M9OA 1YJNA 4A3GB 1YHAA 2V1CC 3KBXA 4PMCA 3G6EA 1AH9A 3MWYW 2RDHA 2D0OA 3I55A 1XNRL 4K0KL 4DK0A 4KY5A 1NCVA 4GN4B 1ML0D 4IUNA 2JP1A 4CHTB 4AQYQ 1D8LA 1SNCA 3GDEA 3J80E 2PZTA 5J22A 5KYLA 4QB4A 2F4VL 4HJ5A 4BY1H 5C0XH 3BYYB 4P73A 1PYWD 1FGUA 2CWPA 1LT6D 3MEFA 5NUCA 2YU9B 1PH3A 1RIPA 1BCPC 1WOCA 3TP7A 2K5VA 3MXUA 2Z4IA 3S14B 5E7NA 1SRUA 2E2DC 3SK6A 1O7YA 5EBDA 3W1BA 4NXNQ 4F8MA 4LFCQ 2IL8A 4H02A 1Y14B 3S1MH 5ELDA 1STBA 2F0OA 4JBKA 3NBHB 1PTOC 4BBRH 2R7ZB 2MNAA 2WKDA 3K8AA 1K3RA 2KEEA 1ESFA 1VQ7A 2B2YA 3NPPA 1FJGQ 2SNSA 2YTVA 1NUCA 4J8QA 1HUMA 4LFBL 2BA0A 1LT5D 3D8GA 2N78A 2B3GA 3H91A 4GN5A 3S1RB 4BBSH 4C2MB 4FF2A 1FNUA 4TKOB 2QA4A 1SAPA 4JI8Q 1CT1D 4RKBA 1Q82C 4AH6A 5GAHC 5EKLA 3H09A 3FKIG 3TP5A 4A3EB 3HKSA 1KAWA 4DNIA 1J9OA 2Q8RE 2D0PA 4NKLA 1HR0W 4JI2L 3CKIB 2C35B 2K4KA 4PNYA 4I7AA 1OXSC 1BBWA 4DXGA 3E0JA 3S1QB 2Q8IB 4BA2I 1VDZA 3GP7A 2R92G 3JC66 4LF6Q 2QEXA 4QQBX 4LFCL 1PYSB 3KF6A 1A63A 3SVMA 2F0PA 3D4WA 1DOLA 1KC8C 3I90A 1EUJA 3CPFA 5FLXE 1KQSA 1F77A 1UWVA 4A3BG 4YY3Q 3S16B 1HFGA 4Q5VA 4A3LG 4QIWE 2ID0A 3IAYA 4CDCC 3JAMi 1PH1A 4JI3L 3NQTA 4JI1Q 2NN6I 4R8NA 4BY7G 4DV3L 1W6JA 3R3OA 2CW0C 2NVQH 2VNUD 4ABNA 1X56A 4IURA 3BVGA 2RDFA 2ZTEA 3TQYA 4QF4A 4GOPA 2RSOA 3K58A 1HR0L 1EEID 1SJHD 2F0DA 5EBCA 3GO5A 2B39A 3MEHA 4FVMA 3OIPA 3H15A 1PFBA 5IYBH 1PRTD 3A8KE 3E3XA 4HJ9A 2K5HA 1RF2D 5ELFA 3HFZB 1TWFH 1CFMA 2UUBQ 2N55A 3HKZG 5ELNA 4G7ZC 3MA2B 1PTOF 2K33A 1DD2A 3D6WA 2LSSA 1VQIA 1SFOH 4BWGB 4CJ0B 3ERSX 1IHZA 2LY7A 3R93A 4DR4Q 2WB1G 2J7ZA 3LNNA 2VW9A 2KUMA 3PUWA 2C9OA 4KY7A 4JBMA 3A74A 3J7AV 2VQEL 2QILA 2F0IA 1S5CD 2A6EC 4KKSA 2AHOB 1VMPA 1IXRA 2YTXA 3BDCA 5C5MA 1O78A 4BBRG 5M5YH 1BCPD 5M5WH 1VQ9A 3T1HL 1HA6A 2WAQE 4K6DA 4LF9L 1EZ6A 1I50B 4C3JG 5C4XH 5C44H 4JI0L 1JOOA 1E7ZA 1DYQA 4GNXB 4H0LC 1CSPA 4B3RQ 1YEZA 1E2WA 3H0GH 4A93G 3CCSA 4YCUA 3T1YL 3RN5A 2V4DA 3HS0C 4MIUA 2VUMH 3GTPB 4HCEA 1PTOD 5EPKA 2LXJA 2JA5G 3KLRA 3RLOA 5CBAE 1K83H 3BDOA 1RTOA 3T56B 2MJ8A 4K5XA 4DR4L 2G5DA 3I7FA 4IFDG 1PH2A 5GAGC 1BR9A 3MTSA 2D9UA 3TDQA 1K28A 2E74C 4K2KA 3W1GA 4V0BA 4AYBG 4EQPA 2EOTA 3QG1A 2IHEA 2UUAL 3UDIA 1GUTA 5T1IA 3DLLA 2DJGC 3E9HA 4A3CH 3H3VH 5AJ3Q 2NB0A 3M4OH 1I94L 4K8JA 4XQJA 1KXLA 4JCVE 3TS2A 3PIO3 1ILPA 4HMIA 1ICFB 2KCTA 4KN4C 1EYGA 2IX0A 4FNFA 4ODGA 5IP9H 1YNJD 2ZJPA 4R4OA 1SDFA 2PNHA 1EQVA 4RMFA 4YWLA 5JAVA 4MZ9A 5LMUQ 4LUVA 5LHY1 1S5BD 1U9RA 2EYFA 1I4GA 4C1NK 1SSOA 1Z7TA 3V96A 2Z6BA 3IL8A 3BYTB 4V190 1K0SA 5LMNL 3S2DB 1ZYRC 3HOUG 2JA7G 4C3IB 3QR8A 1IKMA 1VQ4A 1B53A 4J1MA 5IYCG 1CKMA 2IW3A 3LWUA 2RF4A 1YIJA 4HSVA 4UHVA 4C3HH 3GTKB 1QG7A 2JK8A 4OONA 2WV6D 3ERQA 4L5QA 4NMZA 5DAUA 3J81c 4DV4L 2CW0D 3T16A 1BF4A 3I4MH 2RBMA 1H95A 5EKIA 1X9NA 1TY2A 3OW2A 1TWCB 4B9XA 2BH8A 5ELBA 2NVYB 1VQBA 3ND9A 5C3EG 1PZID 3BZKA 4GS3A 5IT9L 4DR3L 3NE5B 3ULLA 1NBWA 2AQ3B 5C3WA 3S24A 2UXCL 4LF4L 5BN3A 1M8AA 5KNBA 4KK7A 1FD7D 1SNOA 2DNCA 3HOZG 2DNEA 4RG1A 3ER0A 3I4NB 4QIWB 4IUVA 2BOSA 3GQBA 4A3MB 2PYKA 1T5XD 3KBGA 2E2IB 3GD7A 3DHQA 2ZJRA 1E2VA 2VS1A 3M9BA 3JAML 1PH9A 3A56A 1LO5D 3UI2A 1D6EC 3DEOA 1L1OC 2RHQB 1LYLA 1CZGA 1YZ6A 1OXVA 4B3MQ 2G9HD 1V1OA 5A2QL 4OO1H 2HCIA 3TN2A 1K0RA 3MXPA 1Y1WB 2KA7A 2E5LQ 2OWOA 4DN4M 1MKHA 1D7QA 3DWPA 3NWTA 3S17B 1EY7A 1B7YB 3ONAB 5CV8A 1HPCA 3I56A 1YVCA 3PUZA 3A8JE 1YITA 1B1ZA 2F3IA 1VQOA 1E24A 4DR7Q 4BY1B 1YI2A 2HDMA 1CK1A 3NELA 5IIFA 1IBLL 3K0XA 1BNZA 4CJ1B 3D6CA 1UE7A 2EZVA 2L55A 4X64L 2JA9A 5FK9C 4DV7L 1CHQD 4FO2A 4K5WA 3I2ZA 4Y7NB 3BG3A 4QY7A 4GLVB 4CKBA 3TREA 3UE0A 5FOBB 4JI6L 1TWHB 4A3CG 5EGTA 1IBML 4QUFA 4A3GG 4DR6Q 3OMGA 4NW2A 4A3IH 2B2UC 3LX0A 1X3GA 1P8LA 3TSSA 2CKZB 2NVTH 2KENA 3PO3H 2EJGC 4FXDA 5K5PA 3MZ5A 2H1EA 1ASYA 1S5ED 2VZAA 1WFQA 4YIJA 1TS3A 1KL9A 2PMZE 1LT3D 1H9SA 4BBSB 3OHXC 1BQQT 2Y0SG 1A0IA 4OELB 1S5DD 1Q1BA 1EIHA 4DV0Q 4GLXA 1QNUA 2XWBB 4BXXG 5CV5A 3HOXH 3J81i 3EFXD 5G3LD 3I3CA 1ICWA 4LK1C 2QDBA 2B2WC 3P7JA 1S3OA 1RL2A 1B3AA 3MC0B 1V8QA 4KKTA 2FJ2A 4DUYL 1EYCA 1Y1VB 3LWEA 2R7ZG 1SE3A 4LF5L 1ZYRD 1STEA 2L1BA 3HOVB 1A2TA 1SN8A 2WKCA 2A5HA 4MTKA 4A3KG 2R7DA 3QOJA 4HN7A 4DAYA 3HOWB 1PHJA 2F3WA 2A6HC 3RLNA 1K73C 1EU3A 4DGZA 1JJ2A 1EFWA 1EZ8A 1LTTD 2M00A 2D5DA 1ENCA 2MQHA 5F2DA 1K8GA 3ICEA 4DAPA 4A3EG 3D3RA 1X65A 4OIKA 1HNZL 1TY0A 1EWCA 1SNPA 2KVMA 2X6GA 1EU4A 3V2TA 2MUYA 4RHRA 3AB9A 1HH2P 2OQ0A 4A75A 1PTOH 1H9MA 3K5OA 2KCMA 1PFSA 3STBD 3J7AF 2F0EA 2KQ3A 3H6MA 1V43A 5JJZA 4NXML 1I6HH 1KDAA 4PMBA 4IUUA 4IQZA 1G2TA 1N33Q 1A8VA 2UUCL 2IWHA 2K52A 5I4DA 3TMEA 1F2MA 4YHHQ 5CORA 2XVSA 5JEAG 1TT2A 1DCZA 2PQEA 2F0LA 4OX9Q 3WOFA 5C4ZA 4LJZC 5I2YA 4N8X1 2JYOA 1EWHA 2VB2X 4WORA 3FKIH 2I46A 3K7UC 4DK3C 2XNAC 2NBFA 3C1EA 3IRBA 1GHKA 2Z8LA 1QZGA 2HQEA 1TIID 3MFGA 3CF5A 3EVQA 2F0MA 3Q0AA 4WJWA 2B63H 2I5MX 2LFNA 2PO4A 2D2CC 5IYDG 2R92H 2ZXOA 3M3YB 3QIAA 1V9PA 2PQAB 2I5LX 1JMCA 3S15B 1IBKL 3QO2A 2B2VA 1EOTA 2ALYB 1Q81C 4PZ7A 2ATWA 3I70A 1N8RC 1JICA 5M5XB 3AMUA 2Z6KA 1GUWA 4IJLA 2EXZA 5IGEA 3QOLA 3EIVA 1ENAA 2F1MA 2Q2HA 3VYRA 5M5WB 4TQUS 1NMFA 1J8IA 4A3BH 1A3TA 4A3LH 3E5SA 1PRTC 1O7IA 2EIFA 1VQ5A 4A3DB 4GKKL 4BY7H 3D0FA 4LUOA 4YHHL 1Q7YC 4P2CB 2HUGA 1KTKA 5HY6A 3FP9A 1LTLA 3JAMc 1G8ZD 1D5ZC 4OHJA 4DA2A 1XPRA 3RZDB 1U4RA 1W6KA 4MN3A 1I4QA 4UP9A 1FVIA 3TP8A 3OSOA 3GTOB 1L1OA 4L6TB 3F8TA 1BBUA 2NZOA 4BA1I 4K5VA 1SNMA 4X65Q 1KDCA 5C4JH 2OXPA 3VYUA 4TRDA 3GTJB 1X3EA 3NHHA 4FXGC 2MO0A 3PO2B 4KY6A 3K81C 3ULJA 1SYGA 5IODA 2R93B 3CCMA 1HTPA 5IOCA 2N8NA 4GNXC 1BVSA 5IY0A 4DR1Q 4IZ8A 1DZ1A 5I6WA 2NVXH 1ONLA 2HD3A 4ZKBB 1TQOA 5JOBA 3U4VA 3CRLC 1WTPA 2PZUA 1JQYD 2JA6G 4S3SA 1ASZA 1STGA 3GTMH 4UP8A 1MHWC 4ZYSA 2L4NA 1QILA 2Z0SA 2CHBD 1S4ZA 2PMZB 1TS2A 4DR5Q 4R4CA 4IFDJ 1J5EL 2A6HD 4JI5Q 1PH7A 1PFNA 2B2UA 4R4TA 4IPDA 3VR2A 3K7AH 4C3JH 4G7HC 2K05A 1NNXA 5ISRA 5CR3A 1F9QA 3V05A 2MPMA 3GV6A 3L0OA 4KTAA 3J81L 4HIOA 4A93H 1M1KC 1AZPA 4AQYL 1DXMA 3F2BA 3KF6B 4PMWA 2ZXPA 3I4MB 1F2LA 2ES2A 2JA5H 1JC7A 1VQFA 1U4LA 1ET6A 2NN6G 3A0JA 1IYJB 4DV2Q 5JVH3 2JXMB 1Q86C 4KKUA 5BN5A 1H9JA 1TS4A 1GOZA 1PRTF 2XN9C 4IUTA 4RGOS 3J7YW 4DUZQ 4IFDH 4KHZA 3KLSX 3TEHB 1YNJC 2OCEA 4Q0FA 1M4VA 3T51B 2R6GA 2MO1A 4FP5D 3M85A 2B63G 4C3IG 5FLXc 2SEBD 1U0LA 3DMUA 1GHJA 3NBHA 1IZ6A 4NXNL 3R8BA 4LFAQ 1BO0A 2DJFC 4IO9A 2DGYA 1VQ8A 2KCCA 4EVOA 4WJ3M 4CBVA 5I6YA 4N9PA 1T5EA 3F2DA 4O1NA 2EYLA 1VQGA 4G57A 2K1BA 3K5MA 3GTLH 1XX8A 1FJGL 4O42A 3L9AX 1TWAB 1L2FA 4ZKCB 4J15A 4ZLTF 1QVCA 3G6JB 2QCPX 2VB3X 2WFWA 3J80i 5CMDA 3HOUH 2JA7H 4JI8L 1BCPF 1Y69U 3MAQA 2O4XA 5IYCH 2HHHQ 3KJOA 1EL0A 3K6OA 1WJJA 1A15A 2IY5B 2UXBQ 3K5NA 1UE6A 3M7GA 3UDXA 3PIP3 1VF5C 1KD1C 4R8IA 4A3MG 1R9TH 1BUVT 2F52A 1EY5A 1I3QB 2HQLA 3QJYA 4LWCA 2YV5A 1PA6A 3HKZE 2E75C 3CCJA 3L7ZC 1YJ9A 1E22A 3NTIA 3CQZB 1PZJD 4LF6L 3GTQH 1B3QA 2K5WA 2WB1E 5C3EH 4LF8Q 1Y1WG 1K9MC 1SXTA 1QB5D 3RZOH 2BDOA 2F0QA 3EBEA 5E4WC 1N34Q 4OEMB 1IW7C 4RA8A 4XYQA 3S9WA 4NPSA 1G2SA 4RH6A 3CRKC 3HOZH 5C6AA 4YY3L 2ZM6Q 1R4PB 1JR0D 1CQVA 2FXQA 2KEDA 2MP1A 3E0EA 2A69C 5HGTA 3HOYB 1CA5A 4B3SQ 2PZWA 4A3FB 4JI1L 1O80A 4DR2Q 1IKLA 1YHQA 1NY4A 4HEDA 4RFBA 1WTHA 3CAMA 1DOKA 4XQNA 3KF8A 4XYOA 1W3SA 5IGCA 1PVOA 1JE5A 1K8MA 1ILQA 2X69A 4K6LA 1PZKD 2F0TA 4DAVA 1TWGH 1GD7A 3OWFA 2QDLA 2AUJD 3SK8A 4F87A 3M4QA 3VYTA 1XMQQ 2CCZA 1EOVA 1K3BC 1A3UA 2UUBL 2X6LA 2N88A 4IPHA 1EWIA 3I73A 4JI4Q 4X3UA 1J6QA 3FDTA 3BZDB 3NXWA 1EIYB 1VMCA 4DFAA 2F0SA 3MHBA 4R1JA 2J0TD 5C0XI 3TBIB 1VQHA 2R3ZA 2F0JA 4QMGA 4K2LA 1BKBA 5D65A 4N8FA 1E0BA 4AYBE 3I8ZA 3TP6A 4DV1Q 4JG2A 2I5HA 4FF4A 5FLMG 3SK4A 3O13A 4YWMA 1UE5A 3S2HB 4GLAC 1Y8NB 4ZCKA 1IL2A 4A3GH 1TVXA 1B9MA 3D4RA 5M3MB 2KCNA 3E9IA 1LTAD 2B8GA 4DKAC 1PTOB 1PV4A 1STAA 2F0GA 2HCCA 2EVBA 1SROA 3K57A 1Y1VG 4RAUC 4ZUIA 2K04A 2PW5A 3A7AB 4PZ8A 3HOVG 2SDFA 3OMCA 4XIGS 4LF7Q 3HOWG 2PI2A 1SYFA 4JYAQ 5DM63 4B3RL 2YU9H 4JI7Q 3M4YA 2EPBA 2JA8B 1N9WA 1KABA 3VA7A 3BJUA 4BXXH 3QWNA 2KOLA 2RCNA 4XTCS 5KIXA 3J7ZC 4JBJA 2PW7A 4JOIC 3W3AA 2F3VA 3RLFA 4POFA 4LAAA 2F0HA 1NE3A 1ET9A 4KJNA 4YCWA 4QCLA 1XTCD 1EIGA 4HJ8A 3T13A 2R7ZH 4HIMA 2B2TC 5DEHA 4H13C 1KIXA 4ZUJA 1S5FD 1VS0A 4PZ6A 5M3FB 4A3KH 3VDYA 5AJ3L 2E2JB 1OXXK 1DGSA 3STBC 3K59A 3S1RH 5JEAJ 1A62A 4C2MH 5ELOA 4PV1C 4DV6Q 3EA6A 3CCEA 1WCMB 1KAAA 2FMCA 2CH4W 1NMGA 4A3EH 5LMUL 1KNAA 3Q8DA 2K50A 1GUOA 2EXDA 1Y8PB 3G71A 2AMCB 1F9SA 4IALA 4EX5A 1NJIC 4JV5Q 4DV5Q 2LMCB 4JI7L 1I4PA 3GTGB 3Q22A 1D1IA 1HZAA 5IGBA 5K36G 3DM3A 3S1QH 1B2TA 2R7FA 1CUKA 2RHSB 1ZEQX 5CV4A 2Q2IA 4K14A 1IW7D 4G7OC 3J80L 4KJOA 1UAPA 3E6ZX 3I72A 4H44C 1HNXQ 2A69D 5JEAH 4A3JG 1V1PA 1KRTA 3G4SA 1KLUD 4R4QA 1GJXA 4HJAA 3HP3A 2K6AA 4FYDA 3PSIA 2MHVA 1HZCA 4KHPQ 1B9NA 2A1AA 2LKVA 4XT3B 1F2ZA 3S16H 1GUSA 1UE1A 2KHJA 5G3LF 4N9TA 2AUKA 2WB1B 4A3DG 2FFKB 2ZT9C 2F0NA 1JWSD 4KLKA 1SR3A 4IPCA 3K5LA 5IYDH 3I4LA 1TR5A 2L9HA 1I5FA 5FO7B 1H9SB 3CCRA 4L63B 5L37A 4RWSC 5C3XA 2RSNA 3CMAA 1LACA 3S1MB 4X62Q 2FMMA 4X66Q 2NUCA 1NAPA 2KHIA 3N52A 4RHSA 1QZHA 2UXDQ 4BBRB 3C2PA 5J39A 5D3DA 1LT4D 1E2ZA 3N6RA 4B3ML 1N32Q 2EY1A 1D2BA 1U4PA 1CSQA 2WAQB 3D4DA 2NTSA 5IWAQ 2JEBI 2E5LL 1LTSD 2R93G 2RQXA 2Y0SE 2L11A 1SMXA 3FMCA 2Q8TA 1SYCA 5EAYA 1VQLA 1MIUA 2GVAA 3DWAA 1Z47A 4JW0A 1Q3LA 3OTOQ 2JA5B 2QF7A 2HIXA 1S72A 4DR7L 1VQJA 1EYAA 5BR8Q 5C4HA 4FF1A 2EDGA 4RGMA 1XMOQ 1SNQA 5IGGA 1EYDA 4J6HA 5FKAC 1X3FA 2G9DA 1FNWA 1EY8A 1QJOA 1TS5A 4I7ZC 4AYBB 5FLXL 1LV9A 4DNTB 3RD4A 1XNQQ 2K01A 1Q46A 1JJGA 3PIOA 4GKJQ 1I50H 1CKOA 4XXEA 3NK9A 4E6IA 4DR6L 3PCOB 3PMFA 2PNRC 4OWTB 2A74C 3H3VI 1CKNA 1VQCA 2E76C 4IUQA 2UXDL 2F0UA 4ALPA 5CYUA 1HQMC 4P74A 4POGA 2L12A 3GTPH 2NWGA 3WOEA 5CGKA 4KD4A 2E2HH 2VQFQ 2JA6H 3CHBD 5I9OA 4P72A 2RCFA 1LUZA 1HTLD 1FNVA 5IWAL 1W2BA 4B3TQ 3ITPA 3NTHA 1VCIA 1JT8A 2NVQB 1PXUA 5EPLA 1IYUA 4O0AA 2KBNA 1I4HA 2JA7B 1OTCA 3NQIA 4ZK9B 4DV0L 1I4RA 1L0XB 4XQQA 4M1UB 4LUZA 1G51A 1R9TB 4UP7A 1DM0B 5J3BA 2XRSD 1K8AC 1HNWQ 1WTVA 1TWFB 1G91A 4AIMA 2DY8A 4HAEA 3A7LA 1VQKA 3UDFA 1NR4A 1SFOB 5CC4A 3P20A 1HZ9A 2N49A 2NN6H 1X3PA 2LXKA 3AFPA 2MGSA 4MNOA 4GKJL 2O5JC 4ULLA 4B9WA 1JCKB 1KHIA 1MJCA 1YNNC 5AFWA 3OPOA 4X3TA 1GKHA 2EE1A 4KMUC 2OT2A 4G4KA 4JOIA 1R4QB 5DNFA 3S2DH 4C3IH 3R2TA 4ZQ3A
chains in the Genus database with same CATH topology
2CQAA 1SE2A 1A6XA 2TMPA 2XRQD 2JEAI 2EYHA 4F88A 2F03A 3P1HA 5M5YB 2F4IA 1SE4A 2PPBC 3KLSA 5C44B 1TWGB 5C4XB 3KK7A 4OO1I 2GA4B 1BBXC 3H0GB 1RCVD 1Z6HA 2A68D 3I91A 2VUMB 3M7NA 1MGSA 1K83B 1AP0A 5IT9E 1FGBD 3CU7A 2VXWA 1OXTA 3RUZA 3MXNA 1DONA 1K8OA 1MD2D 1QCBD 4IUPA 1HXYD 3HRZC 4PQXA 2QKIC 1G291 3M4OB 3P75A 3JAME 3PUYA 2JE6I 1RJTA 1LLRD 2IX3A 3G7LA 3OWEB 2LS01 4NDXA 1XYIA 5A2QE 3BVZA 1O7LA 2EY5A 5EKKA 3MXGA 2WACA 4RCNA 1U4MA 3Q6SA 1MSHA 3FRPB 1SEBD 2Y0SB 3T4AC 4X3SA 4QUCA 1HUNA 3GV3A 5C5LA 2JSOA 3MFYA 5EQ0A 2R61A 4C3HB 5CV6A 3DWQA 1MSGA 1EFID 2KECA 2EYJA 1KDBA 1SJED 3SDZA 5CV9A 4JBWA 4XDXA 1TKWB 4A3KB 2O2LD 2K03A 1NSNS 1BDOA 1CTMA 5FO9B 1II3A 1EY9A 2OEOA 5JPNC 2B2WA 3NWSA 4UAIA 1CHPD 3NSWA 1F9RA 3OIQA 1UUPA 2K28A 4ILWA 1C48A 1QOHA 1WTXA 2EYMA 4UDUC 3SHLA 5KGUA 1F9PA 1L0YB 4LMQD 2Z4HA 1WD1A 5EPJA 1YNND 1D5MC 3SEBA 2NZ1D 4GZYC 1O7ZA 1UEAB 3RMHA 2RDGA 1IL8A 3NTKA 3HGBA 3NBIA 2ICEC 4KV6A 2H4OA 4R9WA 5ELCA 3EJIA 5CBEE 1STNA 3SE0A 1I4XA 3DEPA 4KHVA 2IT1A 1HQRD 1EQTA 4EQOA 1WTOA 5LL6X 1OO9B 2EJMA 1LTID 3NUCA 1PFMA 3H94A 1ENFA 1B50A 4OGQC 1Y8OB 3C46A 4A3IB 1C4QA 3TZDA 1JORA 1CQFA 3K0YA 2NVTB 3PO3B 1PRTB 1RODA 5C0XG 3KUPA 4ID6A 3A54A 1B44D 2C5CA 2EYOA 1QWYA 1SMYC 3BDLA 5K36H 1WD0A 5I9PA 3HOXB 2NYZD 3MVVA 1JWMD 1GUGA 5CV7A 4L8JA 4U673 1HA5A 1WTWA 1EEFD 4RKLA 5JPMC 1Q1EA 2OF1A 3VR4A 2K7VA 4KN7C 2A73B 2RVLA 4DXFA 2NTTA 2AQ1B 3DXJC 4DF7A 3HZXA 1A3VA 1BCPB 3PUXA 1JB3A 2TSSA 1JOQA 2XWJB 2E2HB 2JA6B 1I6VC 3ND8A 3ZYYX 4FF3A 4JK1C 1B4OA 1HCZA 1C8CA 4WFN3 4RGTA 2M9VA 2D62A 2XIWA 1QE6A 4CGYB 1I6HB 1AEXA 2HDLA 1LTGD 3C1FA 4HTHA 1CA6A 1SYBA 4OIJA 2KHSA 4IN3A 3FKIB 4RGNA 5DM73 1OXUA 2AQ2B 2F0VA 5JVG3 3OOCA 2B63B 4IFDI 4TSSA 2R92B 4CKCA 2DN8A 1JE4A 4B08A 2BE5C 1CZWA 2K32A 1RTNA 3L3OC 3BVMA 1ZKOA 1RKNA 2DY7A 3PUVA 5ELEA 2B2VC 3Q24A 3S1NB 4A3BB 1V1PB 3IFTA 5KRUA 3DUZA 4ME5A 4BS9A 2SNMA 4BY7B 2CVRA 3J81E 5E3FA 4X3KA 2EY2A 2Z1CA 2EY6A 3FVQA 5D14A 2RA4A 5KYIA 1Q12A 2ICIA 3TZUA 4C56C 1A2UA 1BOSA 1EY6A 4H7BA 4HR7B 3BS1A 3VR6A 4C1NI 2BCOA 5C4JB 2QEJC 3HKZB 2WP8J 2K5DA 2L5TA 1SMYD 2IPKD 1FYCA 3QB3A 1D1KA 2A6ED 2F0WA 1GUNA 1PMRA 2NVXB 5EJWA 2FHTA 4RCOA 3X3MA 4HSPA 1LTRD 2B8FA 3GTMB 4MHEA 5I2XA 1H9RA 2A68C 5KNDA 4ZAIA 1MBYA 1X3QA 2ENBA 3IKJA 1RHPA 2BA1A 2ZXRA 1JOKA 2KJXA 3K7AB 1AZQA 3A8IE 4C3JB 4DK1A 1GXDC 3H3VC 4A93B 3U9SA 1SYEA 2B2YC 1DJRD 1WTQA 1STHA 2EYPA 4M8AA 1AFPA 3FPUB 2AWNA 5J1ZA 2F0FA 1JWUD 2YYZA 4DNRB 2AWOA 1NR2A 4EGVA 3DM1A 3SR1A 3X3NA 3D31A 1WTRA 1MI2A 3A55A 4KD3A 5T1GA 2O5IC 3R2IA 3T53B 1EY0A 1Q8IA 1HRJA 1LABA 1ESRA 2PCFB 4C3HG 3U9OA 4DU9A 1DOMA 3EROA 5IGDA 3NP8A 1KNEA 5LL6S 5KNCA 1SBBB 5COYA 2BDNA 3GTLB 4U68A 5BN4A 1FR3A 3VR3A 1Q90A 1XWEA 2BE5D 1EY4A 3HEJA 1WVLA 3HOUB 1STYA 5FO8B 1AW7A 2EJFC 5TSSA 3OW7A 2XSCA 3FPPA 2FINB 1PLFA 4XT1B 1G6ZA 1UNSA 1PDQA 1CI3M 5E1FA 2IJ0A 5A35A 1SNDA 2M2LA 3FEWX 4F7XA 2F0KA 1X32A 3PV0A 3GTQB 1IYVA 1D5XC 4OO1G 5IGFA 5C3EB 4ZRZA 4FXKC 3HG9A 3RZOB 5D3IB 1HFNA 5KEEA 3VA5A 1TU2B 5E4XA 2SOBA 4K8IA 3HOZB 4CKEA 2RKSA 3WDNA 2B2TA 3SK5A 4EQNA 1VF7A 4OL7A 1KLGD 4I65A 1ZXTA 5HURA 1BXTA 3F2UA 3AU7A 3EQLC 4WRDA 1F2YA 1LTBD 4HMJA 3SXHA 4A3JB 2J4XA 3URYA 2WIIB 1SYDA 3W2DA 2L0CA 3VYSA 1CM9A 1QNKA 3Q23A 3C3LA 4CJ2C 3VR5A 1HHVA 2I07B 2WINB 5C0XJ 1RDPD 3IFDA 4HCSA 2IX1A 4NP5A 1RD9D 1H9KA 4KI0A 1XXGA 4Z9CB 2K5QA 1AN8A 5M9OA 4A3GB 3KBXA 4PMCA 3MWYW 2RDHA 4DK0A 4KY5A 1NCVA 1ML0D 4IUNA 2JP1A 4CHTB 1SNCA 3J80E 2PZTA 5J22A 5KYLA 4QB4A 5C0XH 3BYYB 1PYWD 1LT6D 5NUCA 2YU9B 1BCPC 3TP7A 3MXUA 2Z4IA 3S14B 2E2DC 3SK6A 1O7YA 5EBDA 4F8MA 2IL8A 5ELDA 1STBA 2F0OA 1PTOC 2R7ZB 2WKDA 2KEEA 1ESFA 2B2YA 3NPPA 2SNSA 1NUCA 4J8QA 1HUMA 2BA0A 1LT5D 3D8GA 3H91A 3S1RB 4C2MB 4FF2A 1FNUA 4TKOB 1SAPA 1CT1D 4RKBA 5EKLA 3H09A 3TP5A 4A3EB 1J9OA 2Q8RE 4NKLA 3CKIB 4PNYA 1OXSC 4DXGA 3E0JA 3S1QB 2Q8IB 4BA2I 1VDZA 3GP7A 3SVMA 2F0PA 3D4WA 1DOLA 3I90A 5FLXE 1F77A 3S16B 1HFGA 4Q5VA 2ID0A 3IAYA 3NQTA 2NN6I 4R8NA 1W6JA 3R3OA 2CW0C 2VNUD 4ABNA 4IURA 3BVGA 2RDFA 4QF4A 2RSOA 3K58A 1EEID 1SJHD 2F0DA 5EBCA 3GO5A 2B39A 3MEHA 4FVMA 3OIPA 1PFBA 1PRTD 3A8KE 1RF2D 5ELFA 1CFMA 2N55A 4G7ZC 1DD2A 3MA2B 1PTOF 2K33A 3D6WA 4BWGB 4CJ0B 1IHZA 2LY7A 3R93A 2J7ZA 3LNNA 2KUMA 3PUWA 2C9OA 4KY7A 3J7AV 2QILA 2F0IA 1S5CD 2A6EC 4KKSA 1VMPA 3BDCA 5C5MA 1O78A 1BCPD 1HA6A 4K6DA 1EZ6A 1I50B 4C3JG 1JOOA 1DYQA 4H0LC 1E2WA 2V4DA 3HS0C 4MIUA 3GTPB 4HCEA 1PTOD 5EPKA 3KLRA 5CBAE 3BDOA 1RTOA 3T56B 2MJ8A 4K5XA 4IFDG 1BR9A 3MTSA 2D9UA 3TDQA 2E74C 4K2KA 4V0BA 4EQPA 2EOTA 3QG1A 1GUTA 5T1IA 2NB0A 4K8JA 4XQJA 3PIO3 1ILPA 4HMIA 4KN4C 2IX0A 4FNFA 4ODGA 1YNJD 1SDFA 1EQVA 5JAVA 5LHY1 1S5BD 1U9RA 2EYFA 1I4GA 4C1NK 1SSOA 1Z7TA 3V96A 3IL8A 3BYTB 4V190 3S2DB 1ZYRC 4C3IB 1IKMA 1B53A 4J1MA 2IW3A 3LWUA 4HSVA 3GTKB 1QG7A 2WV6D 3ERQA 4NMZA 5DAUA 2CW0D 3T16A 1BF4A 2RBMA 5EKIA 1TY2A 1TWCB 4B9XA 5ELBA 2NVYB 3ND9A 1PZID 5IT9L 3NE5B 2AQ3B 5C3WA 5BN3A 5KNBA 1M8AA 4KK7A 1FD7D 1SNOA 2DNCA 2DNEA 3I4NB 4QIWB 4IUVA 2BOSA 3GQBA 4A3MB 2PYKA 1T5XD 3KBGA 2E2IB 3GD7A 3DHQA 1E2VA 3JAML 3A56A 1LO5D 3UI2A 1D6EC 3DEOA 1CZGA 1OXVA 2G9HD 1V1OA 5A2QL 4OO1H 2HCIA 3TN2A 1Y1WB 3MXPA 2KA7A 4DN4M 3DWPA 3NWTA 3S17B 1EY7A 3ONAB 5CV8A 1HPCA 3PUZA 3A8JE 1B1ZA 4BY1B 2HDMA 1CK1A 5IIFA 1BNZA 4CJ1B 3D6CA 2EZVA 2L55A 5FK9C 1CHQD 4FO2A 4K5WA 4Y7NB 3BG3A 4CKBA 5FOBB 1TWHB 5EGTA 4QUFA 3OMGA 4NW2A 2B2UC 3LX0A 3TSSA 2EJGC 4FXDA 5K5PA 3MZ5A 2H1EA 1S5ED 4YIJA 1TS3A 1LT3D 1H9SA 4BBSB 3OHXC 1BQQT 1S5DD 1Q1BA 1EIHA 1QNUA 2XWBB 5CV5A 3EFXD 5G3LD 3I3CA 1ICWA 4LK1C 2QDBA 2B2WC 3P7JA 1B3AA 3MC0B 1V8QA 4KKTA 2FJ2A 1EYCA 1Y1VB 3LWEA 1SE3A 1ZYRD 1STEA 2L1BA 3HOVB 1A2TA 2WKCA 2A5HA 3HOWB 3QOJA 4HN7A 4DAYA 2F3WA 2A6HC 1EU3A 4DGZA 1EZ8A 1LTTD 2M00A 2D5DA 1ENCA 5F2DA 4DAPA 3D3RA 4OIKA 1TY0A 1EWCA 3V2TA 1SNPA 2KVMA 2X6GA 1EU4A 2MUYA 4RHRA 3AB9A 1PTOH 1H9MA 3K5OA 3J7AF 2F0EA 2KQ3A 3H6MA 1V43A 5JJZA 1KDAA 4PMBA 4IUUA 4IQZA 1G2TA 2IWHA 5I4DA 3TMEA 1F2MA 5CORA 2XVSA 5JEAG 1TT2A 1DCZA 2PQEA 2F0LA 3WOFA 5C4ZA 4LJZC 5I2YA 2JYOA 1EWHA 2VB2X 4WORA 2I46A 2XNAC 2NBFA 3C1EA 1GHKA 2Z8LA 2HQEA 1TIID 3MFGA 3EVQA 2F0MA 3Q0AA 4WJWA 2LFNA 2PO4A 2D2CC 2ZXOA 3M3YB 3QIAA 3S15B 3QO2A 2B2VA 1EOTA 3I70A 1JICA 5M5XB 3AMUA 1GUWA 2EXZA 5IGEA 3QOLA 1ENAA 2F1MA 3VYRA 5M5WB 4TQUS 1J8IA 1A3TA 3E5SA 1PRTC 4A3DB 4P2CB 2HUGA 1KTKA 1G8ZD 1D5ZC 4OHJA 4DA2A 3RZDB 1U4RA 1W6KA 4MN3A 1I4QA 3TP8A 3OSOA 3GTOB 4L6TB 4BA1I 4K5VA 1SNMA 1KDCA 2OXPA 3VYUA 4TRDA 3GTJB 3NHHA 4FXGC 3PO2B 4KY6A 1SYGA 5IODA 2R93B 1HTPA 5IOCA 4IZ8A 1DZ1A 5I6WA 1ONLA 4ZKBB 1TQOA 5JOBA 3CRLC 1WTPA 2PZUA 1JQYD 4S3SA 1STGA 4ZYSA 2L4NA 1QILA 2CHBD 1S4ZA 2PMZB 1TS2A 4IFDJ 2A6HD 1PFNA 2B2UA 3VR2A 4G7HC 2K05A 5ISRA 5CR3A 1F9QA 3V05A 2MPMA 3GV6A 4KTAA 3J81L 1AZPA 1DXMA 4PMWA 2ZXPA 3I4MB 1F2LA 1JC7A 1U4LA 1ET6A 2NN6G 5JVH3 2JXMB 4KKUA 5BN5A 1H9JA 1TS4A 1GOZA 1PRTF 2XN9C 4IUTA 4RGOS 3J7YW 4IFDH 4KHZA 3KLSX 1YNJC 4Q0FA 1M4VA 3T51B 2R6GA 4FP5D 3M85A 4C3IG 2SEBD 3DMUA 1GHJA 3NBHA 3R8BA 1BO0A 2KCCA 4EVOA 4CBVA 5I6YA 4N9PA 1T5EA 4O1NA 2EYLA 4G57A 2K1BA 3K5MA 1XX8A 4O42A 3L9AX 1TWAB 4ZKCB 4ZLTF 3G6JB 2QCPX 2VB3X 5CMDA 1Y69U 1BCPF 3MAQA 2O4XA 1EL0A 3K6OA 1A15A 3K5NA 3M7GA 3PIP3 1VF5C 4R8IA 1BUVT 1EY5A 1I3QB 3QJYA 2E75C 3L7ZC 3NTIA 3CQZB 1PZJD 2K5WA 1SXTA 1QB5D 2BDOA 2F0QA 5E4WC 1IW7C 4RA8A 4XYQA 3S9WA 1G2SA 4RH6A 3CRKC 5C6AA 1R4PB 1JR0D 1CQVA 2KEDA 2MP1A 2A69C 5HGTA 3HOYB 1CA5A 2PZWA 4A3FB 1O80A 1IKLA 4HEDA 4RFBA 1DOKA 4XQNA 3KF8A 4XYOA 5IGCA 1K8MA 1ILQA 2X69A 4K6LA 1PZKD 2F0TA 4DAVA 3OWFA 2AUJD 3SK8A 4F87A 3VYTA 1A3UA 2X6LA 2N88A 3I73A 4X3UA 3FDTA 3BZDB 3NXWA 1VMCA 4DFAA 2F0SA 3MHBA 2J0TD 5C0XI 3TBIB 2R3ZA 2F0JA 4QMGA 4K2LA 5D65A 1E0BA 3TP6A 3I8ZA 4FF4A 3SK4A 3O13A 3S2HB 1Y8NB 1TVXA 1B9MA 3D4RA 5M3MB 2KCNA 1LTAD 2B8GA 1PTOB 1STAA 2F0GA 2HCCA 2EVBA 3K57A 4RAUC 4ZUIA 2K04A 2PW5A 3A7AB 2SDFA 3OMCA 4XIGS 1SYFA 5DM63 3M4YA 2EPBA 2JA8B 1KABA 3VA7A 3QWNA 2KOLA 4XTCS 5KIXA 2PW7A 3W3AA 2F3VA 3RLFA 4LAAA 2F0HA 1ET9A 4KJNA 4QCLA 1XTCD 1EIGA 3T13A 2B2TC 5DEHA 4H13C 4ZUJA 1S5FD 5M3FB 2E2JB 1OXXK 3K59A 5JEAJ 4PV1C 3EA6A 1WCMB 1KAAA 2FMCA 1KNAA 1GUOA 1Y8PB 1F9SA 4IALA 2LMCB 1I4PA 3GTGB 3Q22A 1D1IA 5IGBA 5K36G 1B2TA 5CV4A 1ZEQX 4K14A 1IW7D 4G7OC 3J80L 4KJOA 1UAPA 3E6ZX 3I72A 4H44C 2A69D 5JEAH 1V1PA 1KLUD 1GJXA 3HP3A 2K6AA 4FYDA 2MHVA 1B9NA 2LKVA 4XT3B 1F2ZA 1GUSA 5G3LF 4N9TA 2AUKA 2WB1B 2FFKB 2ZT9C 2F0NA 1JWSD 3K5LA 3I4LA 1TR5A 2L9HA 5FO7B 1H9SB 4L63B 4RWSC 5C3XA 2RSNA 1LACA 3S1MB 2FMMA 2NUCA 1NAPA 3N52A 4RHSA 4BBRB 3C2PA 5J39A 5D3DA 1LT4D 1E2ZA 3N6RA 1D2BA 2EY1A 1U4PA 2WAQB 3D4DA 2NTSA 2JEBI 1LTSD 2RQXA 2L11A 3FMCA 2Q8TA 1SYCA 3DWAA 1Z47A 1Q3LA 2JA5B 2QF7A 1EYAA 5C4HA 4FF1A 2EDGA 4RGMA 1SNQA 5IGGA 1EYDA 4J6HA 5FKAC 2G9DA 1FNWA 1EY8A 1QJOA 1TS5A 4I7ZC 4AYBB 5FLXL 1LV9A 4DNTB 3RD4A 2K01A 4XXEA 3NK9A 4E6IA 3PMFA 2PNRC 2A74C 2E76C 4IUQA 2F0UA 5CYUA 1HQMC 2L12A 2NWGA 3WOEA 5CGKA 4KD4A 3CHBD 5I9OA 1HTLD 1FNVA 3ITPA 3NTHA 1VCIA 2NVQB 1PXUA 5EPLA 1IYUA 1I4HA 2JA7B 3NQIA 4ZK9B 1I4RA 1L0XB 4XQQA 4M1UB 1R9TB 1DM0B 2XRSD 1WTVA 1TWFB 1G91A 2DY8A 4HAEA 3A7LA 1NR4A 1SFOB 5CC4A 3P20A 2NN6H 1X3PA 2MGSA 2O5JC 4ULLA 4B9WA 1JCKB 1YNNC 5AFWA 3OPOA 4X3TA 4KMUC 2EE1A 2OT2A 4G4KA 1R4QB 5DNFA 3R2TA 4ZQ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IJ0 A;  4K6L A;  4RGN A;  1SE2 A;  1PZK D;  3DWQ A;  1KTK A;  3DWA A;  2AQ2 B;  1V1O A;  2G9H D;  3BYY B;  1EFI D;  1G8Z D;  1D5Z C;  2SEB D;  4OHJ A;  1PYW D;  2XRQ D;  1PRT B;  3EA6 A;  3R8B A;  1EU3 A;  3BVG A;  1D5X C;  1I4Q A;  1LT6 D;  1SJE D;  3DWP A;  1LTT D;  1B44 D;  1BCP C;  4RGM A;  4L6T B;  1EEI D;  4TSS A;  1SJH D;  2O2L D;  1SE4 A;  5FKA C;  1FNW A;  4O1N A;  5D3I B;  3BZD B;  1TS5 A;  1B1Z A;  1TY0 A;  1EWC A;  1EU4 A;  1PRT D;  1I4P A;  4RHR A;  1RF2 D;  5ELF A;  1CK1 A;  1DJR D;  1PTO H;  5ELD A;  3BVM A;  1RCV D;  1JWM D;  1CHP D;  1PTO F;  5FK9 C;  1PTO C;  1S5B D;  1UUP A;  1CHQ D;  1JWU D;  5ELE A;  4BWG B;  1KLG D;  4UDU C;  1I4G A;  1V1P B;  1BCP F;  3O13 A;  1HA5 A;  1BXT A;  1V1P A;  1EEF D;  1ESF A;  1L0Y B;  3BYT B;  1KLU D;  5I4D A;  1FGB D;  1LTA D;  3CHB D;  1D5M C;  1PTO B;  1HTL D;  1LT5 D;  1LTB D;  1FNV A;  3SEB A;  4DXF A;  1JQY D;  1MD2 D;  2AQ1 B;  2NTT A;  1HXY D;  1FNU A;  4ZYS A;  2QIL A;  1BCP B;  3R2I A;  1QIL A;  1CT1 D;  2J4X A;  3TSS A;  3URY A;  2ICI A;  2TSS A;  3W2D A;  2CHB D;  4C56 C;  1I4H A;  1TS2 A;  2XNA C;  2WV6 D;  1S5C D;  2RDG A;  1JWS D;  2Z8L A;  1I4R A;  1PZJ D;  1L0X B;  1S5E D;  1TS3 A;  3MFG A;  1SBB B;  1TY2 A;  1LLR D;  4L63 B;  1BCP D;  1LT3 D;  1RDP D;  1SXT A;  5ELC A;  5ELB A;  3OWE B;  2QEJ C;  2XRS D;  1PZI D;  3V05 A;  4DXG A;  1I4X A;  1S5D D;  4RGT A;  2IPK D;  3BVZ A;  1HQR D;  3GP7 A;  4RH6 A;  4RHS A;  1DYQ A;  2AQ3 B;  1JR0 D;  1CQV A;  1RD9 D;  3EFX D;  1LTG D;  1XXG A;  1ET9 A;  1FD7 D;  5D3D A;  4Z9C B;  1LT4 D;  1LTI D;  1AW7 A;  1SEB D;  1ENF A;  1XTC D;  1ET6 A;  1JCK B;  1AN8 A;  1PTO D;  3MC0 B;  5TSS A;  2NTS A;  1T5X D;  4RFB A;  1TS4 A;  2RDH A;  1GOZ A;  1PRT F;  2XN9 C;  1LTS D;  1UNS A;  1PRT C;  4RGO S;  4RCO A;  1S5F D;  1F77 A;  1SE3 A;  3KLS X;  1LTR D;  3R2T A;  1LO5 D;  1STE A;  1M4V A;  1D6E C;  2R61 A; 
#chains in the Genus database with same CATH topology
 1VQ6 A;  2CQA A;  1UEB A;  1SE2 A;  3KDF B;  2VQF L;  1A6X A;  2TMP A;  2CWA A;  2VY3 A;  1Q8K A;  2XRQ D;  2JEA I;  5IP7 G;  2EYH A;  1XNR Q;  4K0K Q;  3GTK H;  4F88 A;  2F03 A;  1L1O B;  3P1H A;  5M5Y B;  4YWK A;  2F4I A;  3S1N H;  1SE4 A;  2F4V Q;  2XTI A;  1XTD A;  2PPB C;  3KLS A;  1E3P A;  1N33 L;  5C44 B;  1TWG B;  5C4X B;  1TWC H;  1XPU A;  2NVY H;  3KK7 A;  4OO1 I;  1QUQ A;  2GA4 B;  5FJ8 G;  1BBX C;  3H0G B;  1RCV D;  1Z6H A;  1V1Q A;  4OX9 L;  1VQA A;  2A68 D;  1C0A A;  3I91 A;  2VUM B;  3M7N A;  4A76 A;  2K75 A;  1MGS A;  4L5S A;  3J80 c;  1K83 B;  2P5Z X;  3HOY G;  1AP0 A;  5IT9 E;  1FGB D;  4A3M H;  4A3F G;  3CU7 A;  3CP0 A;  2VXW A;  1OXT A;  2E2I H;  3RUZ A;  3MXN A;  1DON A;  4DK6 C;  1K8O A;  3RN2 A;  1MD2 D;  1QCB D;  4IUP A;  1HXY D;  3HRZ C;  4PQX A;  3B6Y A;  2QKI C;  3AQQ A;  4X6A H;  1G29 1;  3F1Z A;  3M4O B;  1Y1W H;  3P75 A;  4LFB Q;  2YTY A;  3JAM E;  3S17 H;  3PUY A;  2JE6 I;  1RJT A;  1LLR D;  2IX3 A;  3G7L A;  1HZB A;  3OYY A;  4CDD C;  3OWE B;  2LS0 1;  2PI2 E;  4NDX A;  1XYI A;  5A2Q E;  1B8A A;  3U58 A;  1VQP A;  1VQD A;  3BVZ A;  1O7L A;  2EY5 A;  5EKK A;  3MXG A;  4JI2 Q;  2WAC A;  1U5K A;  1E1O A;  4RCN A;  4UPA A;  1U4M A;  3Q6S A;  1MSH A;  3FRP B;  4APV A;  1SEB D;  2Y0S B;  3M4P A;  3T4A C;  1QVF A;  4Y7N H;  4X3S A;  4QUC A;  1HUN A;  3GV3 A;  5C5L A;  1AE3 A;  2JSO A;  3MFY A;  1TWH H;  5EQ0 A;  1G6P A;  2R61 A;  3KOJ A;  3KFU A;  4C3H B;  5CV6 A;  3DWQ A;  1MSG A;  5M3M G;  1EFI D;  2KEC A;  2ASB A;  4X65 L;  1LM0 A;  2EYJ A;  1KDB A;  1PH6 A;  1SJE D;  3SDZ A;  1SE8 A;  5CV9 A;  4JBW A;  4XDX A;  1TKW B;  4A3K B;  2O2L D;  3PQI A;  2K03 A;  1KRS A;  1NSN S;  4JI3 Q;  1BDO A;  1CTM A;  1X6O A;  4DV3 Q;  3U50 C;  3PF4 A;  5FO9 B;  3CCQ A;  4DR1 L;  1II3 A;  1EY9 A;  2A19 A;  2OEO A;  5JPN C;  2B2W A;  4LW1 A;  2JA8 G;  3NWS A;  4UAI A;  1CHP D;  1PH4 A;  3NSW A;  1HR0 Q;  1X54 A;  1F9R A;  3OIQ A;  5FLM H;  1UUP A;  2K28 A;  4ILW A;  4IJH A;  2VL6 A;  1C48 A;  1QOH A;  1WTX A;  2EYM A;  4UDU C;  4GOP B;  3PF5 A;  2E8G A;  3SHL A;  5KGU A;  1F9P A;  1L0Y B;  3NEN A;  4LMQ D;  4DR5 L;  2Z4H A;  1WD1 A;  5EPJ A;  1S40 A;  1N36 Q;  1YNN D;  2OQK A;  1D5M C;  1Y1V H;  4JI5 L;  2N3S A;  3SEB A;  2NZ1 D;  4GZY C;  1O7Z A;  1MJE A;  3HOV H;  1YNX A;  1UEA B;  3RMH A;  1VQN A;  5M3F G;  3HOW H;  2RDG A;  1IL8 A;  1NTG A;  3NTK A;  3HGB A;  3NBI A;  5GRO A;  2ICE C;  4KV6 A;  2H4O A;  1WCM G;  2VQE Q;  4R9W A;  1WI5 A;  5ELC A;  3EJI A;  4DV2 L;  5CBE E;  1STN A;  2UU9 Q;  3I4N G;  3SE0 A;  1I4X A;  3DEP A;  4KHV A;  2IT1 A;  1HQR D;  4P75 A;  4DUZ L;  1EQT A;  4EQO A;  1WTO A;  5LL6 X;  1HJP A;  1OO9 B;  2EJM A;  1LTI D;  3NUC A;  1PFM A;  3T1H Q;  3H94 A;  1ENF A;  3CC2 A;  2K5N A;  4LF9 Q;  3BU2 A;  1B50 A;  4L5R C;  2L15 A;  4LFA L;  3KF8 B;  4JI0 Q;  4OGQ C;  1Y8O B;  3C46 A;  4A3I B;  1C4Q A;  2CFM A;  2B29 A;  3TZD A;  1JOR A;  1CQF A;  3T1Y Q;  3K0Y A;  1PH5 A;  1N36 L;  2NVT B;  5DLQ E;  1QVG A;  3PO3 B;  3K80 C;  2QW7 A;  3UE1 A;  4IPG A;  1PRT B;  1ROD A;  4CDF C;  4BY1 G;  5C0X G;  3KUP A;  4ID6 A;  3A54 A;  1B44 D;  4UY8 C;  3CXC A;  2C5C A;  2EYO A;  1QWY A;  1SMY C;  3BDL A;  5K36 H;  1WD0 A;  5I9P A;  3HOX B;  2HHH L;  3M3Y H;  2MFI A;  2NYZ D;  2UUA Q;  5H1S E;  3S15 H;  3MVV A;  1JWM D;  3F2C A;  1GUG A;  2UXB L;  5CV7 A;  3TS0 A;  2UU9 L;  4L8J A;  1I94 Q;  1YJW A;  4A3J H;  4U67 3;  5M5X H;  3AEV A;  4IOA A;  1HA5 A;  1WTW A;  1EEF D;  1WYD A;  4RKL A;  5GAD C;  5JPM C;  1Q1E A;  2OF1 A;  3VR4 A;  2Z9H A;  2IHF A;  2K7V A;  4KN7 C;  2A73 B;  4JC0 A;  2WAQ G;  2RVL A;  4DXF A;  4A3D H;  2NTT A;  2AQ1 B;  3DXJ C;  4LF8 L;  4DF7 A;  3HZX A;  1A3V A;  1BCP B;  2OTJ A;  3PUX A;  1JB3 A;  2GN5 A;  2TSS A;  4BBS G;  4P71 A;  3L2P A;  1JOQ A;  5LMN Q;  1N34 L;  4L5T A;  3RZD H;  3UDG A;  1EQQ A;  2XWJ B;  4PG3 A;  5LMN W;  2E2H B;  2JA6 B;  2ZM6 L;  1I6V C;  3ND8 A;  2Q2U A;  3WWV A;  3GTO H;  1GO3 E;  4YCV A;  4B3S L;  4HID A;  3ZYY X;  4DR2 L;  4FF3 A;  3NEM A;  4JK1 C;  1B4O A;  1HCZ A;  1C8C A;  4DV4 Q;  4WFN 3;  4RGT A;  2M9V A;  2D62 A;  2XIW A;  1QE6 A;  4CGY B;  4GNX A;  1I6H B;  1AEX A;  2HDL A;  1LTG D;  5HGQ A;  3GTJ H;  3W5O A;  1VQE A;  3PO2 H;  4OXP A;  2DUD A;  2R93 H;  3C1F A;  4HTH A;  4DR3 Q;  1CA6 A;  1SYB A;  1X55 A;  4OIJ A;  2KHS A;  1XJV A;  1PH8 A;  2UXC Q;  3S14 H;  1XMQ L;  1C9O A;  4LF4 Q;  4IN3 A;  3FKI B;  4RGN A;  5DM7 3;  4JI4 L;  1OXU A;  2AQ2 B;  2ZTC A;  2F0V A;  1Z9F A;  2EQS A;  3PGZ A;  5JVG 3;  3OOC A;  5JJL A;  2B63 B;  3SGI A;  4IFD I;  4TSS A;  4NB3 A;  2R92 B;  4CKC A;  2DN8 A;  1JE4 A;  4LNQ A;  4B08 A;  4DV1 L;  4JPB W;  2BE5 C;  1CZW A;  2K32 A;  2CH4 A;  1RTN A;  1JJC B;  3L3O C;  5IYB G;  3BVM A;  1ZKO A;  1RKN A;  2DY7 A;  3PUV A;  5ELE A;  2B2V C;  3Q24 A;  3S1N B;  4A3B B;  5JJK A;  1V1P B;  3IFT A;  5KRU A;  3DUZ A;  2Z6K C;  4ME5 A;  4BS9 A;  1IBL Q;  2SNM A;  5GAE C;  4EQ5 A;  4BY7 B;  2CVR A;  3J81 E;  4LF7 L;  5E3F A;  4JYA L;  4X64 Q;  4X3K A;  2EY2 A;  2Z1C A;  4DV7 Q;  2EY6 A;  3FVQ A;  5D14 A;  2RA4 A;  5KYI A;  1Q12 A;  4A4I A;  4HIK A;  2ICI A;  3TZU A;  4C56 C;  3PIP A;  1A2U A;  1BOS A;  1EY6 A;  4JI6 Q;  4H7B A;  4HR7 B;  2JQO A;  3BS1 A;  1L0W A;  3I4O A;  1IBM Q;  3VR6 A;  4C1N I;  2BCO A;  5C4J B;  2QEJ C;  3HKZ B;  2JN4 A;  2WP8 J;  2K5D A;  2L5T A;  3FHW A;  1SMY D;  4OWW B;  2XGT A;  2IPK D;  1FYC A;  3QB3 A;  3CCU A;  3CPW A;  1VQM A;  1D1K A;  5C44 G;  5C4X G;  1TWA H;  4QGU A;  3A5Z B;  3H0G G;  2A6E D;  3KLW A;  2F0W A;  1GUN A;  4DV6 L;  1PMR A;  3U4Z A;  2NVX B;  5EJW A;  2FHT A;  2VUM G;  4RCO A;  3X3M A;  4HSP A;  3CCV A;  3LGJ A;  1LTR D;  2B8F A;  3GTM B;  4MHE A;  5I2X A;  1H9R A;  2GVB A;  4WJ4 A;  2A68 C;  5IP7 H;  4OWX B;  3AFQ A;  5KND A;  4ZAI A;  1I3Q H;  1MBY A;  4JV5 L;  4DV5 L;  1X3Q A;  4DUY Q;  2ENB A;  3IKJ A;  1RHP A;  4LF5 Q;  2BA1 A;  2ZXR A;  1JOK A;  3CME A;  2KJX A;  3K7A B;  1AZQ A;  3A8I E;  3CQZ H;  4C3J B;  4DK1 A;  3PO2 G;  1YBY A;  1GXD C;  3H3V C;  1E1T A;  1HNX L;  5FJ8 H;  1AE2 A;  4A93 B;  3U9S A;  2QGQ A;  3ZJY C;  1SYE A;  2B2Y C;  1TXY A;  1DJR D;  1WTQ A;  1STH A;  2EYP A;  4M8A A;  4DAY B;  1AFP A;  2BH2 A;  3FPU B;  2AWN A;  5IP9 G;  5J1Z A;  5IE8 A;  4KHP L;  2F0F A;  3CD6 A;  1JWU D;  1CKN B;  2Q2T A;  2YYZ A;  4DNR B;  3HOY H;  1HNZ Q;  2HIV A;  4CDE C;  1YHB A;  4A3F H;  2AWO A;  3RR5 A;  2OTL A;  1NR2 A;  1M90 C;  4EGV A;  3CW2 C;  3DM1 A;  3SR1 A;  1C7Y A;  3X3N A;  3D31 A;  1WTR A;  1MI2 A;  3A55 A;  4KD3 A;  4NXM Q;  5T1G A;  3RNU A;  2O5I C;  3R2I A;  3T53 B;  2UUC Q;  2I0Q A;  1EY0 A;  1Q8I A;  1HRJ A;  1LAB A;  4X62 L;  1ESR A;  2PCF B;  4C3H G;  3U9O A;  4X66 L;  4DU9 A;  2K14 A;  1DOM A;  3ERO A;  5IGD A;  3NP8 A;  1KNE A;  5LL6 S;  4DPG A;  5KNC A;  1GVP A;  1SBB B;  1XPO A;  5COY A;  3I4M G;  3A5U A;  2BDN A;  1N32 L;  3GTL B;  4U68 A;  5BN4 A;  3ULP A;  1FR3 A;  3VR3 A;  1Q90 A;  1XWE A;  2BE5 D;  3EN2 A;  1EY4 A;  3BZC A;  3HEJ A;  1WVL A;  4Y52 H;  3HOU B;  1STY A;  5FO8 B;  1AW7 A;  2EJF C;  1SLJ A;  3OTO L;  2A8V A;  5TSS A;  3OW7 A;  2XSC A;  3J81 j;  1IBK Q;  3FPP A;  2FIN B;  1PLF A;  5BR8 L;  3TRZ A;  4XT1 B;  1G6Z A;  3S2H H;  1UNS A;  1PDQ A;  1CI3 M;  2JJQ A;  4GOP C;  5M3M H;  1XMO L;  5E1F A;  2IJ0 A;  2ZJQ A;  5A35 A;  1SND A;  2M2L A;  3FEW X;  4F7X A;  3CC7 A;  2F0K A;  1X32 A;  3PV0 A;  3AYH B;  4ME3 A;  3GTQ B;  1IYV A;  1D5X C;  1XNQ L;  4OO1 G;  5IGF A;  5JJI A;  5C3E B;  1EIF A;  4ZRZ A;  4GKK Q;  1T9H A;  4FXK C;  4QJF A;  3HG9 A;  3CCL A;  3RZO B;  5D3I B;  1HFN A;  5KEE A;  4QL5 A;  3VA5 A;  2JA8 H;  1TU2 B;  5E4X A;  2SOB A;  1QUQ B;  2AKW B;  4K8I A;  3HOZ B;  4CKE A;  1EQR A;  2RKS A;  1PYB A;  3WDN A;  3KJP A;  4B3T L;  2B2T A;  3SK5 A;  4EQN A;  4FDB A;  1VF7 A;  4OL7 A;  1KLG D;  4I65 A;  1ZXT A;  5HUR A;  4O2D A;  1BXT A;  4MTN A;  3F2U A;  3AU7 A;  3EQL C;  4DAM A;  1B70 B;  4WRD A;  4GN3 B;  1P16 A;  1F2Y A;  3MXN B;  1LTB D;  4JVZ A;  4R4I A;  5M3F H;  4HMJ A;  3SXH A;  1GM5 A;  4A3J B;  5GQO A;  2E2J H;  2J4X A;  3URY A;  2WII B;  5IT9 c;  1SYD A;  3W2D A;  2L0C A;  3VYS A;  4A3I G;  1CM9 A;  1FL0 A;  2ZTD A;  1JB7 A;  1HNW L;  1QNK A;  3J7A 5;  3Q23 A;  3C3L A;  2HT1 A;  1WCM H;  3PO3 G;  4HJ7 A;  2NZH A;  3KYH C;  4TVA B;  4CJ2 C;  3VR5 A;  1HHV A;  2I07 B;  3I4N H;  2WIN B;  3G48 A;  5C0X J;  1RDP D;  2CQO A;  3IFD A;  4HCS A;  3CC4 A;  2IX1 A;  1J5E Q;  2PQA A;  3GTG H;  3KDF A;  4IOC A;  4NP5 A;  1RD9 D;  1H9K A;  4KI0 A;  2H5X A;  1XXG A;  4Z9C B;  3HOX G;  2K5Q A;  1AN8 A;  5M9O A;  1YJN A;  4A3G B;  1YHA A;  2V1C C;  3KBX A;  4PMC A;  3G6E A;  1AH9 A;  3MWY W;  2RDH A;  2D0O A;  3I55 A;  1XNR L;  4K0K L;  4DK0 A;  4KY5 A;  1NCV A;  4GN4 B;  1ML0 D;  4IUN A;  2JP1 A;  4CHT B;  4AQY Q;  1D8L A;  1SNC A;  3GDE A;  3J80 E;  2PZT A;  5J22 A;  5KYL A;  4QB4 A;  2F4V L;  4HJ5 A;  4BY1 H;  5C0X H;  3BYY B;  4P73 A;  1PYW D;  1FGU A;  2CWP A;  1LT6 D;  3MEF A;  5NUC A;  2YU9 B;  1PH3 A;  1RIP A;  1BCP C;  1WOC A;  3TP7 A;  2K5V A;  3MXU A;  2Z4I A;  3S14 B;  5E7N A;  1SRU A;  2E2D C;  3SK6 A;  1O7Y A;  5EBD A;  3W1B A;  4NXN Q;  4F8M A;  4LFC Q;  2IL8 A;  4H02 A;  1Y14 B;  3S1M H;  5ELD A;  1STB A;  2F0O A;  4JBK A;  3NBH B;  1PTO C;  4BBR H;  2R7Z B;  2MNA A;  2WKD A;  3K8A A;  1K3R A;  2KEE A;  1ESF A;  1VQ7 A;  2B2Y A;  3NPP A;  1FJG Q;  2SNS A;  2YTV A;  1NUC A;  4J8Q A;  1HUM A;  4LFB L;  2BA0 A;  1LT5 D;  3D8G A;  2N78 A;  2B3G A;  3H91 A;  4GN5 A;  3S1R B;  4BBS H;  4C2M B;  4FF2 A;  1FNU A;  4TKO B;  2QA4 A;  1SAP A;  4JI8 Q;  1CT1 D;  4RKB A;  1Q82 C;  4AH6 A;  5GAH C;  5EKL A;  3H09 A;  3FKI G;  3TP5 A;  4A3E B;  3HKS A;  1KAW A;  4DNI A;  1J9O A;  2Q8R E;  2D0P A;  4NKL A;  1HR0 W;  4JI2 L;  3CKI B;  2C35 B;  2K4K A;  4PNY A;  4I7A A;  1OXS C;  1BBW A;  4DXG A;  3E0J A;  3S1Q B;  2Q8I B;  4BA2 I;  1VDZ A;  3GP7 A;  2R92 G;  3JC6 6;  4LF6 Q;  2QEX A;  4QQB X;  4LFC L;  1PYS B;  3KF6 A;  1A63 A;  3SVM A;  2F0P A;  3D4W A;  1DOL A;  1KC8 C;  3I90 A;  1EUJ A;  3CPF A;  5FLX E;  1KQS A;  1F77 A;  1UWV A;  4A3B G;  4YY3 Q;  3S16 B;  1HFG A;  4Q5V A;  4A3L G;  4QIW E;  2ID0 A;  3IAY A;  4CDC C;  3JAM i;  1PH1 A;  4JI3 L;  3NQT A;  4JI1 Q;  2NN6 I;  4R8N A;  4BY7 G;  4DV3 L;  1W6J A;  3R3O A;  2CW0 C;  2NVQ H;  2VNU D;  4ABN A;  1X56 A;  4IUR A;  3BVG A;  2RDF A;  2ZTE A;  3TQY A;  4QF4 A;  4GOP A;  2RSO A;  3K58 A;  1HR0 L;  1EEI D;  1SJH D;  2F0D A;  5EBC A;  3GO5 A;  2B39 A;  3MEH A;  4FVM A;  3OIP A;  3H15 A;  1PFB A;  5IYB H;  1PRT D;  3A8K E;  3E3X A;  4HJ9 A;  2K5H A;  1RF2 D;  5ELF A;  3HFZ B;  1TWF H;  1CFM A;  2UUB Q;  2N55 A;  3HKZ G;  5ELN A;  4G7Z C;  3MA2 B;  1PTO F;  2K33 A;  1DD2 A;  3D6W A;  2LSS A;  1VQI A;  1SFO H;  4BWG B;  4CJ0 B;  3ERS X;  1IHZ A;  2LY7 A;  3R93 A;  4DR4 Q;  2WB1 G;  2J7Z A;  3LNN A;  2VW9 A;  2KUM A;  3PUW A;  2C9O A;  4KY7 A;  4JBM A;  3A74 A;  3J7A V;  2VQE L;  2QIL A;  2F0I A;  1S5C D;  2A6E C;  4KKS A;  2AHO B;  1VMP A;  1IXR A;  2YTX A;  3BDC A;  5C5M A;  1O78 A;  4BBR G;  5M5Y H;  1BCP D;  5M5W H;  1VQ9 A;  3T1H L;  1HA6 A;  2WAQ E;  4K6D A;  4LF9 L;  1EZ6 A;  1I50 B;  4C3J G;  5C4X H;  5C44 H;  4JI0 L;  1JOO A;  1E7Z A;  1DYQ A;  4GNX B;  4H0L C;  1CSP A;  4B3R Q;  1YEZ A;  1E2W A;  3H0G H;  4A93 G;  3CCS A;  4YCU A;  3T1Y L;  3RN5 A;  2V4D A;  3HS0 C;  4MIU A;  2VUM H;  3GTP B;  4HCE A;  1PTO D;  5EPK A;  2LXJ A;  2JA5 G;  3KLR A;  3RLO A;  5CBA E;  1K83 H;  3BDO A;  1RTO A;  3T56 B;  2MJ8 A;  4K5X A;  4DR4 L;  2G5D A;  3I7F A;  4IFD G;  1PH2 A;  5GAG C;  1BR9 A;  3MTS A;  2D9U A;  3TDQ A;  1K28 A;  2E74 C;  4K2K A;  3W1G A;  4V0B A;  4AYB G;  4EQP A;  2EOT A;  3QG1 A;  2IHE A;  2UUA L;  3UDI A;  1GUT A;  5T1I A;  3DLL A;  2DJG C;  3E9H A;  4A3C H;  3H3V H;  5AJ3 Q;  2NB0 A;  3M4O H;  1I94 L;  4K8J A;  4XQJ A;  1KXL A;  4JCV E;  3TS2 A;  3PIO 3;  1ILP A;  4HMI A;  1ICF B;  2KCT A;  4KN4 C;  1EYG A;  2IX0 A;  4FNF A;  4ODG A;  5IP9 H;  1YNJ D;  2ZJP A;  4R4O A;  1SDF A;  2PNH A;  1EQV A;  4RMF A;  4YWL A;  5JAV A;  4MZ9 A;  5LMU Q;  4LUV A;  5LHY 1;  1S5B D;  1U9R A;  2EYF A;  1I4G A;  4C1N K;  1SSO A;  1Z7T A;  3V96 A;  2Z6B A;  3IL8 A;  3BYT B;  4V19 0;  1K0S A;  5LMN L;  3S2D B;  1ZYR C;  3HOU G;  2JA7 G;  4C3I B;  3QR8 A;  1IKM A;  1VQ4 A;  1B53 A;  4J1M A;  5IYC G;  1CKM A;  2IW3 A;  3LWU A;  2RF4 A;  1YIJ A;  4HSV A;  4UHV A;  4C3H H;  3GTK B;  1QG7 A;  2JK8 A;  4OON A;  2WV6 D;  3ERQ A;  4L5Q A;  4NMZ A;  5DAU A;  3J81 c;  4DV4 L;  2CW0 D;  3T16 A;  1BF4 A;  3I4M H;  2RBM A;  1H95 A;  5EKI A;  1X9N A;  1TY2 A;  3OW2 A;  1TWC B;  4B9X A;  2BH8 A;  5ELB A;  2NVY B;  1VQB A;  3ND9 A;  5C3E G;  1PZI D;  3BZK A;  4GS3 A;  5IT9 L;  4DR3 L;  3NE5 B;  3ULL A;  1NBW A;  2AQ3 B;  5C3W A;  3S24 A;  2UXC L;  4LF4 L;  5BN3 A;  1M8A A;  5KNB A;  4KK7 A;  1FD7 D;  1SNO A;  2DNC A;  3HOZ G;  2DNE A;  4RG1 A;  3ER0 A;  3I4N B;  4QIW B;  4IUV A;  2BOS A;  3GQB A;  4A3M B;  2PYK A;  1T5X D;  3KBG A;  2E2I B;  3GD7 A;  3DHQ A;  2ZJR A;  1E2V A;  2VS1 A;  3M9B A;  3JAM L;  1PH9 A;  3A56 A;  1LO5 D;  3UI2 A;  1D6E C;  3DEO A;  1L1O C;  2RHQ B;  1LYL A;  1CZG A;  1YZ6 A;  1OXV A;  4B3M Q;  2G9H D;  1V1O A;  5A2Q L;  4OO1 H;  2HCI A;  3TN2 A;  1K0R A;  3MXP A;  1Y1W B;  2KA7 A;  2E5L Q;  2OWO A;  4DN4 M;  1MKH A;  1D7Q A;  3DWP A;  3NWT A;  3S17 B;  1EY7 A;  1B7Y B;  3ONA B;  5CV8 A;  1HPC A;  3I56 A;  1YVC A;  3PUZ A;  3A8J E;  1YIT A;  1B1Z A;  2F3I A;  1VQO A;  1E24 A;  4DR7 Q;  4BY1 B;  1YI2 A;  2HDM A;  1CK1 A;  3NEL A;  5IIF A;  1IBL L;  3K0X A;  1BNZ A;  4CJ1 B;  3D6C A;  1UE7 A;  2EZV A;  2L55 A;  4X64 L;  2JA9 A;  5FK9 C;  4DV7 L;  1CHQ D;  4FO2 A;  4K5W A;  3I2Z A;  4Y7N B;  3BG3 A;  4QY7 A;  4GLV B;  4CKB A;  3TRE A;  3UE0 A;  5FOB B;  4JI6 L;  1TWH B;  4A3C G;  5EGT A;  1IBM L;  4QUF A;  4A3G G;  4DR6 Q;  3OMG A;  4NW2 A;  4A3I H;  2B2U C;  3LX0 A;  1X3G A;  1P8L A;  3TSS A;  2CKZ B;  2NVT H;  2KEN A;  3PO3 H;  2EJG C;  4FXD A;  5K5P A;  3MZ5 A;  2H1E A;  1ASY A;  1S5E D;  2VZA A;  1WFQ A;  4YIJ A;  1TS3 A;  1KL9 A;  2PMZ E;  1LT3 D;  1H9S A;  4BBS B;  3OHX C;  1BQQ T;  2Y0S G;  1A0I A;  4OEL B;  1S5D D;  1Q1B A;  1EIH A;  4DV0 Q;  4GLX A;  1QNU A;  2XWB B;  4BXX G;  5CV5 A;  3HOX H;  3J81 i;  3EFX D;  5G3L D;  3I3C A;  1ICW A;  4LK1 C;  2QDB A;  2B2W C;  3P7J A;  1S3O A;  1RL2 A;  1B3A A;  3MC0 B;  1V8Q A;  4KKT A;  2FJ2 A;  4DUY L;  1EYC A;  1Y1V B;  3LWE A;  2R7Z G;  1SE3 A;  4LF5 L;  1ZYR D;  1STE A;  2L1B A;  3HOV B;  1A2T A;  1SN8 A;  2WKC A;  2A5H A;  4MTK A;  4A3K G;  2R7D A;  3QOJ A;  4HN7 A;  4DAY A;  3HOW B;  1PHJ A;  2F3W A;  2A6H C;  3RLN A;  1K73 C;  1EU3 A;  4DGZ A;  1JJ2 A;  1EFW A;  1EZ8 A;  1LTT D;  2M00 A;  2D5D A;  1ENC A;  2MQH A;  5F2D A;  1K8G A;  3ICE A;  4DAP A;  4A3E G;  3D3R A;  1X65 A;  4OIK A;  1HNZ L;  1TY0 A;  1EWC A;  1SNP A;  2KVM A;  2X6G A;  1EU4 A;  3V2T A;  2MUY A;  4RHR A;  3AB9 A;  1HH2 P;  2OQ0 A;  4A75 A;  1PTO H;  1H9M A;  3K5O A;  2KCM A;  1PFS A;  3STB D;  3J7A F;  2F0E A;  2KQ3 A;  3H6M A;  1V43 A;  5JJZ A;  4NXM L;  1I6H H;  1KDA A;  4PMB A;  4IUU A;  4IQZ A;  1G2T A;  1N33 Q;  1A8V A;  2UUC L;  2IWH A;  2K52 A;  5I4D A;  3TME A;  1F2M A;  4YHH Q;  5COR A;  2XVS A;  5JEA G;  1TT2 A;  1DCZ A;  2PQE A;  2F0L A;  4OX9 Q;  3WOF A;  5C4Z A;  4LJZ C;  5I2Y A;  4N8X 1;  2JYO A;  1EWH A;  2VB2 X;  4WOR A;  3FKI H;  2I46 A;  3K7U C;  4DK3 C;  2XNA C;  2NBF A;  3C1E A;  3IRB A;  1GHK A;  2Z8L A;  1QZG A;  2HQE A;  1TII D;  3MFG A;  3CF5 A;  3EVQ A;  2F0M A;  3Q0A A;  4WJW A;  2B63 H;  2I5M X;  2LFN A;  2PO4 A;  2D2C C;  5IYD G;  2R92 H;  2ZXO A;  3M3Y B;  3QIA A;  1V9P A;  2PQA B;  2I5L X;  1JMC A;  3S15 B;  1IBK L;  3QO2 A;  2B2V A;  1EOT A;  2ALY B;  1Q81 C;  4PZ7 A;  2ATW A;  3I70 A;  1N8R C;  1JIC A;  5M5X B;  3AMU A;  2Z6K A;  1GUW A;  4IJL A;  2EXZ A;  5IGE A;  3QOL A;  3EIV A;  1ENA A;  2F1M A;  2Q2H A;  3VYR A;  5M5W B;  4TQU S;  1NMF A;  1J8I A;  4A3B H;  1A3T A;  4A3L H;  3E5S A;  1PRT C;  1O7I A;  2EIF A;  1VQ5 A;  4A3D B;  4GKK L;  4BY7 H;  3D0F A;  4LUO A;  4YHH L;  1Q7Y C;  4P2C B;  2HUG A;  1KTK A;  5HY6 A;  3FP9 A;  1LTL A;  3JAM c;  1G8Z D;  1D5Z C;  4OHJ A;  4DA2 A;  1XPR A;  3RZD B;  1U4R A;  1W6K A;  4MN3 A;  1I4Q A;  4UP9 A;  1FVI A;  3TP8 A;  3OSO A;  3GTO B;  1L1O A;  4L6T B;  3F8T A;  1BBU A;  2NZO A;  4BA1 I;  4K5V A;  1SNM A;  4X65 Q;  1KDC A;  5C4J H;  2OXP A;  3VYU A;  4TRD A;  3GTJ B;  1X3E A;  3NHH A;  4FXG C;  2MO0 A;  3PO2 B;  4KY6 A;  3K81 C;  3ULJ A;  1SYG A;  5IOD A;  2R93 B;  3CCM A;  1HTP A;  5IOC A;  2N8N A;  4GNX C;  1BVS A;  5IY0 A;  4DR1 Q;  4IZ8 A;  1DZ1 A;  5I6W A;  2NVX H;  1ONL A;  2HD3 A;  4ZKB B;  1TQO A;  5JOB A;  3U4V A;  3CRL C;  1WTP A;  2PZU A;  1JQY D;  2JA6 G;  4S3S A;  1ASZ A;  1STG A;  3GTM H;  4UP8 A;  1MHW C;  4ZYS A;  2L4N A;  1QIL A;  2Z0S A;  2CHB D;  1S4Z A;  2PMZ B;  1TS2 A;  4DR5 Q;  4R4C A;  4IFD J;  1J5E L;  2A6H D;  4JI5 Q;  1PH7 A;  1PFN A;  2B2U A;  4R4T A;  4IPD A;  3VR2 A;  3K7A H;  4C3J H;  4G7H C;  2K05 A;  1NNX A;  5ISR A;  5CR3 A;  1F9Q A;  3V05 A;  2MPM A;  3GV6 A;  3L0O A;  4KTA A;  3J81 L;  4HIO A;  4A93 H;  1M1K C;  1AZP A;  4AQY L;  1DXM A;  3F2B A;  3KF6 B;  4PMW A;  2ZXP A;  3I4M B;  1F2L A;  2ES2 A;  2JA5 H;  1JC7 A;  1VQF A;  1U4L A;  1ET6 A;  2NN6 G;  3A0J A;  1IYJ B;  4DV2 Q;  5JVH 3;  2JXM B;  1Q86 C;  4KKU A;  5BN5 A;  1H9J A;  1TS4 A;  1GOZ A;  1PRT F;  2XN9 C;  4IUT A;  4RGO S;  3J7Y W;  4DUZ Q;  4IFD H;  4KHZ A;  3KLS X;  3TEH B;  1YNJ C;  2OCE A;  4Q0F A;  1M4V A;  3T51 B;  2R6G A;  2MO1 A;  4FP5 D;  3M85 A;  2B63 G;  4C3I G;  5FLX c;  2SEB D;  1U0L A;  3DMU A;  1GHJ A;  3NBH A;  1IZ6 A;  4NXN L;  3R8B A;  4LFA Q;  1BO0 A;  2DJF C;  4IO9 A;  2DGY A;  1VQ8 A;  2KCC A;  4EVO A;  4WJ3 M;  4CBV A;  5I6Y A;  4N9P A;  1T5E A;  3F2D A;  4O1N A;  2EYL A;  1VQG A;  4G57 A;  2K1B A;  3K5M A;  3GTL H;  1XX8 A;  1FJG L;  4O42 A;  3L9A X;  1TWA B;  1L2F A;  4ZKC B;  4J15 A;  4ZLT F;  1QVC A;  3G6J B;  2QCP X;  2VB3 X;  2WFW A;  3J80 i;  5CMD A;  3HOU H;  2JA7 H;  4JI8 L;  1BCP F;  1Y69 U;  3MAQ A;  2O4X A;  5IYC H;  2HHH Q;  3KJO A;  1EL0 A;  3K6O A;  1WJJ A;  1A15 A;  2IY5 B;  2UXB Q;  3K5N A;  1UE6 A;  3M7G A;  3UDX A;  3PIP 3;  1VF5 C;  1KD1 C;  4R8I A;  4A3M G;  1R9T H;  1BUV T;  2F52 A;  1EY5 A;  1I3Q B;  2HQL A;  3QJY A;  4LWC A;  2YV5 A;  1PA6 A;  3HKZ E;  2E75 C;  3CCJ A;  3L7Z C;  1YJ9 A;  1E22 A;  3NTI A;  3CQZ B;  1PZJ D;  4LF6 L;  3GTQ H;  1B3Q A;  2K5W A;  2WB1 E;  5C3E H;  4LF8 Q;  1Y1W G;  1K9M C;  1SXT A;  1QB5 D;  3RZO H;  2BDO A;  2F0Q A;  3EBE A;  5E4W C;  1N34 Q;  4OEM B;  1IW7 C;  4RA8 A;  4XYQ A;  3S9W A;  4NPS A;  1G2S A;  4RH6 A;  3CRK C;  3HOZ H;  5C6A A;  4YY3 L;  2ZM6 Q;  1R4P B;  1JR0 D;  1CQV A;  2FXQ A;  2KED A;  2MP1 A;  3E0E A;  2A69 C;  5HGT A;  3HOY B;  1CA5 A;  4B3S Q;  2PZW A;  4A3F B;  4JI1 L;  1O80 A;  4DR2 Q;  1IKL A;  1YHQ A;  1NY4 A;  4HED A;  4RFB A;  1WTH A;  3CAM A;  1DOK A;  4XQN A;  3KF8 A;  4XYO A;  1W3S A;  5IGC A;  1PVO A;  1JE5 A;  1K8M A;  1ILQ A;  2X69 A;  4K6L A;  1PZK D;  2F0T A;  4DAV A;  1TWG H;  1GD7 A;  3OWF A;  2QDL A;  2AUJ D;  3SK8 A;  4F87 A;  3M4Q A;  3VYT A;  1XMQ Q;  2CCZ A;  1EOV A;  1K3B C;  1A3U A;  2UUB L;  2X6L A;  2N88 A;  4IPH A;  1EWI A;  3I73 A;  4JI4 Q;  4X3U A;  1J6Q A;  3FDT A;  3BZD B;  3NXW A;  1EIY B;  1VMC A;  4DFA A;  2F0S A;  3MHB A;  4R1J A;  2J0T D;  5C0X I;  3TBI B;  1VQH A;  2R3Z A;  2F0J A;  4QMG A;  4K2L A;  1BKB A;  5D65 A;  4N8F A;  1E0B A;  4AYB E;  3I8Z A;  3TP6 A;  4DV1 Q;  4JG2 A;  2I5H A;  4FF4 A;  5FLM G;  3SK4 A;  3O13 A;  4YWM A;  1UE5 A;  3S2H B;  4GLA C;  1Y8N B;  4ZCK A;  1IL2 A;  4A3G H;  1TVX A;  1B9M A;  3D4R A;  5M3M B;  2KCN A;  3E9I A;  1LTA D;  2B8G A;  4DKA C;  1PTO B;  1PV4 A;  1STA A;  2F0G A;  2HCC A;  2EVB A;  1SRO A;  3K57 A;  1Y1V G;  4RAU C;  4ZUI A;  2K04 A;  2PW5 A;  3A7A B;  4PZ8 A;  3HOV G;  2SDF A;  3OMC A;  4XIG S;  4LF7 Q;  3HOW G;  2PI2 A;  1SYF A;  4JYA Q;  5DM6 3;  4B3R L;  2YU9 H;  4JI7 Q;  3M4Y A;  2EPB A;  2JA8 B;  1N9W A;  1KAB A;  3VA7 A;  3BJU A;  4BXX H;  3QWN A;  2KOL A;  2RCN A;  4XTC S;  5KIX A;  3J7Z C;  4JBJ A;  2PW7 A;  4JOI C;  3W3A A;  2F3V A;  3RLF A;  4POF A;  4LAA A;  2F0H A;  1NE3 A;  1ET9 A;  4KJN A;  4YCW A;  4QCL A;  1XTC D;  1EIG A;  4HJ8 A;  3T13 A;  2R7Z H;  4HIM A;  2B2T C;  5DEH A;  4H13 C;  1KIX A;  4ZUJ A;  1S5F D;  1VS0 A;  4PZ6 A;  5M3F B;  4A3K H;  3VDY A;  5AJ3 L;  2E2J B;  1OXX K;  1DGS A;  3STB C;  3K59 A;  3S1R H;  5JEA J;  1A62 A;  4C2M H;  5ELO A;  4PV1 C;  4DV6 Q;  3EA6 A;  3CCE A;  1WCM B;  1KAA A;  2FMC A;  2CH4 W;  1NMG A;  4A3E H;  5LMU L;  1KNA A;  3Q8D A;  2K50 A;  1GUO A;  2EXD A;  1Y8P B;  3G71 A;  2AMC B;  1F9S A;  4IAL A;  4EX5 A;  1NJI C;  4JV5 Q;  4DV5 Q;  2LMC B;  4JI7 L;  1I4P A;  3GTG B;  3Q22 A;  1D1I A;  1HZA A;  5IGB A;  5K36 G;  3DM3 A;  3S1Q H;  1B2T A;  2R7F A;  1CUK A;  2RHS B;  1ZEQ X;  5CV4 A;  2Q2I A;  4K14 A;  1IW7 D;  4G7O C;  3J80 L;  4KJO A;  1UAP A;  3E6Z X;  3I72 A;  4H44 C;  1HNX Q;  2A69 D;  5JEA H;  4A3J G;  1V1P A;  1KRT A;  3G4S A;  1KLU D;  4R4Q A;  1GJX A;  4HJA A;  3HP3 A;  2K6A A;  4FYD A;  3PSI A;  2MHV A;  1HZC A;  4KHP Q;  1B9N A;  2A1A A;  2LKV A;  4XT3 B;  1F2Z A;  3S16 H;  1GUS A;  1UE1 A;  2KHJ A;  5G3L F;  4N9T A;  2AUK A;  2WB1 B;  4A3D G;  2FFK B;  2ZT9 C;  2F0N A;  1JWS D;  4KLK A;  1SR3 A;  4IPC A;  3K5L A;  5IYD H;  3I4L A;  1TR5 A;  2L9H A;  1I5F A;  5FO7 B;  1H9S B;  3CCR A;  4L63 B;  5L37 A;  4RWS C;  5C3X A;  2RSN A;  3CMA A;  1LAC A;  3S1M B;  4X62 Q;  2FMM A;  4X66 Q;  2NUC A;  1NAP A;  2KHI A;  3N52 A;  4RHS A;  1QZH A;  2UXD Q;  4BBR B;  3C2P A;  5J39 A;  5D3D A;  1LT4 D;  1E2Z A;  3N6R A;  4B3M L;  1N32 Q;  2EY1 A;  1D2B A;  1U4P A;  1CSQ A;  2WAQ B;  3D4D A;  2NTS A;  5IWA Q;  2JEB I;  2E5L L;  1LTS D;  2R93 G;  2RQX A;  2Y0S E;  2L11 A;  1SMX A;  3FMC A;  2Q8T A;  1SYC A;  5EAY A;  1VQL A;  1MIU A;  2GVA A;  3DWA A;  1Z47 A;  4JW0 A;  1Q3L A;  3OTO Q;  2JA5 B;  2QF7 A;  2HIX A;  1S72 A;  4DR7 L;  1VQJ A;  1EYA A;  5BR8 Q;  5C4H A;  4FF1 A;  2EDG A;  4RGM A;  1XMO Q;  1SNQ A;  5IGG A;  1EYD A;  4J6H A;  5FKA C;  1X3F A;  2G9D A;  1FNW A;  1EY8 A;  1QJO A;  1TS5 A;  4I7Z C;  4AYB B;  5FLX L;  1LV9 A;  4DNT B;  3RD4 A;  1XNQ Q;  2K01 A;  1Q46 A;  1JJG A;  3PIO A;  4GKJ Q;  1I50 H;  1CKO A;  4XXE A;  3NK9 A;  4E6I A;  4DR6 L;  3PCO B;  3PMF A;  2PNR C;  4OWT B;  2A74 C;  3H3V I;  1CKN A;  1VQC A;  2E76 C;  4IUQ A;  2UXD L;  2F0U A;  4ALP A;  5CYU A;  1HQM C;  4P74 A;  4POG A;  2L12 A;  3GTP H;  2NWG A;  3WOE A;  5CGK A;  4KD4 A;  2E2H H;  2VQF Q;  2JA6 H;  3CHB D;  5I9O A;  4P72 A;  2RCF A;  1LUZ A;  1HTL D;  1FNV A;  5IWA L;  1W2B A;  4B3T Q;  3ITP A;  3NTH A;  1VCI A;  1JT8 A;  2NVQ B;  1PXU A;  5EPL A;  1IYU A;  4O0A A;  2KBN A;  1I4H A;  2JA7 B;  1OTC A;  3NQI A;  4ZK9 B;  4DV0 L;  1I4R A;  1L0X B;  4XQQ A;  4M1U B;  4LUZ A;  1G51 A;  1R9T B;  4UP7 A;  1DM0 B;  5J3B A;  2XRS D;  1K8A C;  1HNW Q;  1WTV A;  1TWF B;  1G91 A;  4AIM A;  2DY8 A;  4HAE A;  3A7L A;  1VQK A;  3UDF A;  1NR4 A;  1SFO B;  5CC4 A;  3P20 A;  1HZ9 A;  2N49 A;  2NN6 H;  1X3P A;  2LXK A;  3AFP A;  2MGS A;  4MNO A;  4GKJ L;  2O5J C;  4ULL A;  4B9W A;  1JCK B;  1KHI A;  1MJC A;  1YNN C;  5AFW A;  3OPO A;  4X3T A;  1GKH A;  2EE1 A;  4KMU C;  2OT2 A;  4G4K A;  4JOI A;  1R4Q B;  5DNF A;  3S2D H;  4C3I H;  3R2T A;  4ZQ3 A; 
#chains in the Genus database with same CATH homology
 2CQA A;  1SE2 A;  1A6X A;  2TMP A;  2XRQ D;  2JEA I;  2EYH A;  4F88 A;  2F03 A;  3P1H A;  5M5Y B;  2F4I A;  1SE4 A;  2PPB C;  3KLS A;  5C44 B;  1TWG B;  5C4X B;  3KK7 A;  4OO1 I;  2GA4 B;  1BBX C;  3H0G B;  1RCV D;  1Z6H A;  2A68 D;  3I91 A;  2VUM B;  3M7N A;  1MGS A;  1K83 B;  1AP0 A;  5IT9 E;  1FGB D;  3CU7 A;  2VXW A;  1OXT A;  3RUZ A;  3MXN A;  1DON A;  1K8O A;  1MD2 D;  1QCB D;  4IUP A;  1HXY D;  3HRZ C;  4PQX A;  2QKI C;  1G29 1;  3M4O B;  3P75 A;  3JAM E;  3PUY A;  2JE6 I;  1RJT A;  1LLR D;  2IX3 A;  3G7L A;  3OWE B;  2LS0 1;  4NDX A;  1XYI A;  5A2Q E;  3BVZ A;  1O7L A;  2EY5 A;  5EKK A;  3MXG A;  2WAC A;  4RCN A;  1U4M A;  3Q6S A;  1MSH A;  3FRP B;  1SEB D;  2Y0S B;  3T4A C;  4X3S A;  4QUC A;  1HUN A;  3GV3 A;  5C5L A;  2JSO A;  3MFY A;  5EQ0 A;  2R61 A;  4C3H B;  5CV6 A;  3DWQ A;  1MSG A;  1EFI D;  2KEC A;  2EYJ A;  1KDB A;  1SJE D;  3SDZ A;  5CV9 A;  4JBW A;  4XDX A;  1TKW B;  4A3K B;  2O2L D;  2K03 A;  1NSN S;  1BDO A;  1CTM A;  5FO9 B;  1II3 A;  1EY9 A;  2OEO A;  5JPN C;  2B2W A;  3NWS A;  4UAI A;  1CHP D;  3NSW A;  1F9R A;  3OIQ A;  1UUP A;  2K28 A;  4ILW A;  1C48 A;  1QOH A;  1WTX A;  2EYM A;  4UDU C;  3SHL A;  5KGU A;  1F9P A;  1L0Y B;  4LMQ D;  2Z4H A;  1WD1 A;  5EPJ A;  1YNN D;  1D5M C;  3SEB A;  2NZ1 D;  4GZY C;  1O7Z A;  1UEA B;  3RMH A;  2RDG A;  1IL8 A;  3NTK A;  3HGB A;  3NBI A;  2ICE C;  4KV6 A;  2H4O A;  4R9W A;  5ELC A;  3EJI A;  5CBE E;  1STN A;  3SE0 A;  1I4X A;  3DEP A;  4KHV A;  2IT1 A;  1HQR D;  1EQT A;  4EQO A;  1WTO A;  5LL6 X;  1OO9 B;  2EJM A;  1LTI D;  3NUC A;  1PFM A;  3H94 A;  1ENF A;  1B50 A;  4OGQ C;  1Y8O B;  3C46 A;  4A3I B;  1C4Q A;  3TZD A;  1JOR A;  1CQF A;  3K0Y A;  2NVT B;  3PO3 B;  1PRT B;  1ROD A;  5C0X G;  3KUP A;  4ID6 A;  3A54 A;  1B44 D;  2C5C A;  2EYO A;  1QWY A;  1SMY C;  3BDL A;  5K36 H;  1WD0 A;  5I9P A;  3HOX B;  2NYZ D;  3MVV A;  1JWM D;  1GUG A;  5CV7 A;  4L8J A;  4U67 3;  1HA5 A;  1WTW A;  1EEF D;  4RKL A;  5JPM C;  1Q1E A;  2OF1 A;  3VR4 A;  2K7V A;  4KN7 C;  2A73 B;  2RVL A;  4DXF A;  2NTT A;  2AQ1 B;  3DXJ C;  4DF7 A;  3HZX A;  1A3V A;  1BCP B;  3PUX A;  1JB3 A;  2TSS A;  1JOQ A;  2XWJ B;  2E2H B;  2JA6 B;  1I6V C;  3ND8 A;  3ZYY X;  4FF3 A;  4JK1 C;  1B4O A;  1HCZ A;  1C8C A;  4WFN 3;  4RGT A;  2M9V A;  2D62 A;  2XIW A;  1QE6 A;  4CGY B;  1I6H B;  1AEX A;  2HDL A;  1LTG D;  3C1F A;  4HTH A;  1CA6 A;  1SYB A;  4OIJ A;  2KHS A;  4IN3 A;  3FKI B;  4RGN A;  5DM7 3;  1OXU A;  2AQ2 B;  2F0V A;  5JVG 3;  3OOC A;  2B63 B;  4IFD I;  4TSS A;  2R92 B;  4CKC A;  2DN8 A;  1JE4 A;  4B08 A;  2BE5 C;  1CZW A;  2K32 A;  1RTN A;  3L3O C;  3BVM A;  1ZKO A;  1RKN A;  2DY7 A;  3PUV A;  5ELE A;  2B2V C;  3Q24 A;  3S1N B;  4A3B B;  1V1P B;  3IFT A;  5KRU A;  3DUZ A;  4ME5 A;  4BS9 A;  2SNM A;  4BY7 B;  2CVR A;  3J81 E;  5E3F A;  4X3K A;  2EY2 A;  2Z1C A;  2EY6 A;  3FVQ A;  5D14 A;  2RA4 A;  5KYI A;  1Q12 A;  2ICI A;  3TZU A;  4C56 C;  1A2U A;  1BOS A;  1EY6 A;  4H7B A;  4HR7 B;  3BS1 A;  3VR6 A;  4C1N I;  2BCO A;  5C4J B;  2QEJ C;  3HKZ B;  2WP8 J;  2K5D A;  2L5T A;  1SMY D;  2IPK D;  1FYC A;  3QB3 A;  1D1K A;  2A6E D;  2F0W A;  1GUN A;  1PMR A;  2NVX B;  5EJW A;  2FHT A;  4RCO A;  3X3M A;  4HSP A;  1LTR D;  2B8F A;  3GTM B;  4MHE A;  5I2X A;  1H9R A;  2A68 C;  5KND A;  4ZAI A;  1MBY A;  1X3Q A;  2ENB A;  3IKJ A;  1RHP A;  2BA1 A;  2ZXR A;  1JOK A;  2KJX A;  3K7A B;  1AZQ A;  3A8I E;  4C3J B;  4DK1 A;  1GXD C;  3H3V C;  4A93 B;  3U9S A;  1SYE A;  2B2Y C;  1DJR D;  1WTQ A;  1STH A;  2EYP A;  4M8A A;  1AFP A;  3FPU B;  2AWN A;  5J1Z A;  2F0F A;  1JWU D;  2YYZ A;  4DNR B;  2AWO A;  1NR2 A;  4EGV A;  3DM1 A;  3SR1 A;  3X3N A;  3D31 A;  1WTR A;  1MI2 A;  3A55 A;  4KD3 A;  5T1G A;  2O5I C;  3R2I A;  3T53 B;  1EY0 A;  1Q8I A;  1HRJ A;  1LAB A;  1ESR A;  2PCF B;  4C3H G;  3U9O A;  4DU9 A;  1DOM A;  3ERO A;  5IGD A;  3NP8 A;  1KNE A;  5LL6 S;  5KNC A;  1SBB B;  5COY A;  2BDN A;  3GTL B;  4U68 A;  5BN4 A;  1FR3 A;  3VR3 A;  1Q90 A;  1XWE A;  2BE5 D;  1EY4 A;  3HEJ A;  1WVL A;  3HOU B;  1STY A;  5FO8 B;  1AW7 A;  2EJF C;  5TSS A;  3OW7 A;  2XSC A;  3FPP A;  2FIN B;  1PLF A;  4XT1 B;  1G6Z A;  1UNS A;  1PDQ A;  1CI3 M;  5E1F A;  2IJ0 A;  5A35 A;  1SND A;  2M2L A;  3FEW X;  4F7X A;  2F0K A;  1X32 A;  3PV0 A;  3GTQ B;  1IYV A;  1D5X C;  4OO1 G;  5IGF A;  5C3E B;  4ZRZ A;  4FXK C;  3HG9 A;  3RZO B;  5D3I B;  1HFN A;  5KEE A;  3VA5 A;  1TU2 B;  5E4X A;  2SOB A;  4K8I A;  3HOZ B;  4CKE A;  2RKS A;  3WDN A;  2B2T A;  3SK5 A;  4EQN A;  1VF7 A;  4OL7 A;  1KLG D;  4I65 A;  1ZXT A;  5HUR A;  1BXT A;  3F2U A;  3AU7 A;  3EQL C;  4WRD A;  1F2Y A;  1LTB D;  4HMJ A;  3SXH A;  4A3J B;  2J4X A;  3URY A;  2WII B;  1SYD A;  3W2D A;  2L0C A;  3VYS A;  1CM9 A;  1QNK A;  3Q23 A;  3C3L A;  4CJ2 C;  3VR5 A;  1HHV A;  2I07 B;  2WIN B;  5C0X J;  1RDP D;  3IFD A;  4HCS A;  2IX1 A;  4NP5 A;  1RD9 D;  1H9K A;  4KI0 A;  1XXG A;  4Z9C B;  2K5Q A;  1AN8 A;  5M9O A;  4A3G B;  3KBX A;  4PMC A;  3MWY W;  2RDH A;  4DK0 A;  4KY5 A;  1NCV A;  1ML0 D;  4IUN A;  2JP1 A;  4CHT B;  1SNC A;  3J80 E;  2PZT A;  5J22 A;  5KYL A;  4QB4 A;  5C0X H;  3BYY B;  1PYW D;  1LT6 D;  5NUC A;  2YU9 B;  1BCP C;  3TP7 A;  3MXU A;  2Z4I A;  3S14 B;  2E2D C;  3SK6 A;  1O7Y A;  5EBD A;  4F8M A;  2IL8 A;  5ELD A;  1STB A;  2F0O A;  1PTO C;  2R7Z B;  2WKD A;  2KEE A;  1ESF A;  2B2Y A;  3NPP A;  2SNS A;  1NUC A;  4J8Q A;  1HUM A;  2BA0 A;  1LT5 D;  3D8G A;  3H91 A;  3S1R B;  4C2M B;  4FF2 A;  1FNU A;  4TKO B;  1SAP A;  1CT1 D;  4RKB A;  5EKL A;  3H09 A;  3TP5 A;  4A3E B;  1J9O A;  2Q8R E;  4NKL A;  3CKI B;  4PNY A;  1OXS C;  4DXG A;  3E0J A;  3S1Q B;  2Q8I B;  4BA2 I;  1VDZ A;  3GP7 A;  3SVM A;  2F0P A;  3D4W A;  1DOL A;  3I90 A;  5FLX E;  1F77 A;  3S16 B;  1HFG A;  4Q5V A;  2ID0 A;  3IAY A;  3NQT A;  2NN6 I;  4R8N A;  1W6J A;  3R3O A;  2CW0 C;  2VNU D;  4ABN A;  4IUR A;  3BVG A;  2RDF A;  4QF4 A;  2RSO A;  3K58 A;  1EEI D;  1SJH D;  2F0D A;  5EBC A;  3GO5 A;  2B39 A;  3MEH A;  4FVM A;  3OIP A;  1PFB A;  1PRT D;  3A8K E;  1RF2 D;  5ELF A;  1CFM A;  2N55 A;  4G7Z C;  1DD2 A;  3MA2 B;  1PTO F;  2K33 A;  3D6W A;  4BWG B;  4CJ0 B;  1IHZ A;  2LY7 A;  3R93 A;  2J7Z A;  3LNN A;  2KUM A;  3PUW A;  2C9O A;  4KY7 A;  3J7A V;  2QIL A;  2F0I A;  1S5C D;  2A6E C;  4KKS A;  1VMP A;  3BDC A;  5C5M A;  1O78 A;  1BCP D;  1HA6 A;  4K6D A;  1EZ6 A;  1I50 B;  4C3J G;  1JOO A;  1DYQ A;  4H0L C;  1E2W A;  2V4D A;  3HS0 C;  4MIU A;  3GTP B;  4HCE A;  1PTO D;  5EPK A;  3KLR A;  5CBA E;  3BDO A;  1RTO A;  3T56 B;  2MJ8 A;  4K5X A;  4IFD G;  1BR9 A;  3MTS A;  2D9U A;  3TDQ A;  2E74 C;  4K2K A;  4V0B A;  4EQP A;  2EOT A;  3QG1 A;  1GUT A;  5T1I A;  2NB0 A;  4K8J A;  4XQJ A;  3PIO 3;  1ILP A;  4HMI A;  4KN4 C;  2IX0 A;  4FNF A;  4ODG A;  1YNJ D;  1SDF A;  1EQV A;  5JAV A;  5LHY 1;  1S5B D;  1U9R A;  2EYF A;  1I4G A;  4C1N K;  1SSO A;  1Z7T A;  3V96 A;  3IL8 A;  3BYT B;  4V19 0;  3S2D B;  1ZYR C;  4C3I B;  1IKM A;  1B53 A;  4J1M A;  2IW3 A;  3LWU A;  4HSV A;  3GTK B;  1QG7 A;  2WV6 D;  3ERQ A;  4NMZ A;  5DAU A;  2CW0 D;  3T16 A;  1BF4 A;  2RBM A;  5EKI A;  1TY2 A;  1TWC B;  4B9X A;  5ELB A;  2NVY B;  3ND9 A;  1PZI D;  5IT9 L;  3NE5 B;  2AQ3 B;  5C3W A;  5BN3 A;  5KNB A;  1M8A A;  4KK7 A;  1FD7 D;  1SNO A;  2DNC A;  2DNE A;  3I4N B;  4QIW B;  4IUV A;  2BOS A;  3GQB A;  4A3M B;  2PYK A;  1T5X D;  3KBG A;  2E2I B;  3GD7 A;  3DHQ A;  1E2V A;  3JAM L;  3A56 A;  1LO5 D;  3UI2 A;  1D6E C;  3DEO A;  1CZG A;  1OXV A;  2G9H D;  1V1O A;  5A2Q L;  4OO1 H;  2HCI A;  3TN2 A;  1Y1W B;  3MXP A;  2KA7 A;  4DN4 M;  3DWP A;  3NWT A;  3S17 B;  1EY7 A;  3ONA B;  5CV8 A;  1HPC A;  3PUZ A;  3A8J E;  1B1Z A;  4BY1 B;  2HDM A;  1CK1 A;  5IIF A;  1BNZ A;  4CJ1 B;  3D6C A;  2EZV A;  2L55 A;  5FK9 C;  1CHQ D;  4FO2 A;  4K5W A;  4Y7N B;  3BG3 A;  4CKB A;  5FOB B;  1TWH B;  5EGT A;  4QUF A;  3OMG A;  4NW2 A;  2B2U C;  3LX0 A;  3TSS A;  2EJG C;  4FXD A;  5K5P A;  3MZ5 A;  2H1E A;  1S5E D;  4YIJ A;  1TS3 A;  1LT3 D;  1H9S A;  4BBS B;  3OHX C;  1BQQ T;  1S5D D;  1Q1B A;  1EIH A;  1QNU A;  2XWB B;  5CV5 A;  3EFX D;  5G3L D;  3I3C A;  1ICW A;  4LK1 C;  2QDB A;  2B2W C;  3P7J A;  1B3A A;  3MC0 B;  1V8Q A;  4KKT A;  2FJ2 A;  1EYC A;  1Y1V B;  3LWE A;  1SE3 A;  1ZYR D;  1STE A;  2L1B A;  3HOV B;  1A2T A;  2WKC A;  2A5H A;  3HOW B;  3QOJ A;  4HN7 A;  4DAY A;  2F3W A;  2A6H C;  1EU3 A;  4DGZ A;  1EZ8 A;  1LTT D;  2M00 A;  2D5D A;  1ENC A;  5F2D A;  4DAP A;  3D3R A;  4OIK A;  1TY0 A;  1EWC A;  3V2T A;  1SNP A;  2KVM A;  2X6G A;  1EU4 A;  2MUY A;  4RHR A;  3AB9 A;  1PTO H;  1H9M A;  3K5O A;  3J7A F;  2F0E A;  2KQ3 A;  3H6M A;  1V43 A;  5JJZ A;  1KDA A;  4PMB A;  4IUU A;  4IQZ A;  1G2T A;  2IWH A;  5I4D A;  3TME A;  1F2M A;  5COR A;  2XVS A;  5JEA G;  1TT2 A;  1DCZ A;  2PQE A;  2F0L A;  3WOF A;  5C4Z A;  4LJZ C;  5I2Y A;  2JYO A;  1EWH A;  2VB2 X;  4WOR A;  2I46 A;  2XNA C;  2NBF A;  3C1E A;  1GHK A;  2Z8L A;  2HQE A;  1TII D;  3MFG A;  3EVQ A;  2F0M A;  3Q0A A;  4WJW A;  2LFN A;  2PO4 A;  2D2C C;  2ZXO A;  3M3Y B;  3QIA A;  3S15 B;  3QO2 A;  2B2V A;  1EOT A;  3I70 A;  1JIC A;  5M5X B;  3AMU A;  1GUW A;  2EXZ A;  5IGE A;  3QOL A;  1ENA A;  2F1M A;  3VYR A;  5M5W B;  4TQU S;  1J8I A;  1A3T A;  3E5S A;  1PRT C;  4A3D B;  4P2C B;  2HUG A;  1KTK A;  1G8Z D;  1D5Z C;  4OHJ A;  4DA2 A;  3RZD B;  1U4R A;  1W6K A;  4MN3 A;  1I4Q A;  3TP8 A;  3OSO A;  3GTO B;  4L6T B;  4BA1 I;  4K5V A;  1SNM A;  1KDC A;  2OXP A;  3VYU A;  4TRD A;  3GTJ B;  3NHH A;  4FXG C;  3PO2 B;  4KY6 A;  1SYG A;  5IOD A;  2R93 B;  1HTP A;  5IOC A;  4IZ8 A;  1DZ1 A;  5I6W A;  1ONL A;  4ZKB B;  1TQO A;  5JOB A;  3CRL C;  1WTP A;  2PZU A;  1JQY D;  4S3S A;  1STG A;  4ZYS A;  2L4N A;  1QIL A;  2CHB D;  1S4Z A;  2PMZ B;  1TS2 A;  4IFD J;  2A6H D;  1PFN A;  2B2U A;  3VR2 A;  4G7H C;  2K05 A;  5ISR A;  5CR3 A;  1F9Q A;  3V05 A;  2MPM A;  3GV6 A;  4KTA A;  3J81 L;  1AZP A;  1DXM A;  4PMW A;  2ZXP A;  3I4M B;  1F2L A;  1JC7 A;  1U4L A;  1ET6 A;  2NN6 G;  5JVH 3;  2JXM B;  4KKU A;  5BN5 A;  1H9J A;  1TS4 A;  1GOZ A;  1PRT F;  2XN9 C;  4IUT A;  4RGO S;  3J7Y W;  4IFD H;  4KHZ A;  3KLS X;  1YNJ C;  4Q0F A;  1M4V A;  3T51 B;  2R6G A;  4FP5 D;  3M85 A;  4C3I G;  2SEB D;  3DMU A;  1GHJ A;  3NBH A;  3R8B A;  1BO0 A;  2KCC A;  4EVO A;  4CBV A;  5I6Y A;  4N9P A;  1T5E A;  4O1N A;  2EYL A;  4G57 A;  2K1B A;  3K5M A;  1XX8 A;  4O42 A;  3L9A X;  1TWA B;  4ZKC B;  4ZLT F;  3G6J B;  2QCP X;  2VB3 X;  5CMD A;  1Y69 U;  1BCP F;  3MAQ A;  2O4X A;  1EL0 A;  3K6O A;  1A15 A;  3K5N A;  3M7G A;  3PIP 3;  1VF5 C;  4R8I A;  1BUV T;  1EY5 A;  1I3Q B;  3QJY A;  2E75 C;  3L7Z C;  3NTI A;  3CQZ B;  1PZJ D;  2K5W A;  1SXT A;  1QB5 D;  2BDO A;  2F0Q A;  5E4W C;  1IW7 C;  4RA8 A;  4XYQ A;  3S9W A;  1G2S A;  4RH6 A;  3CRK C;  5C6A A;  1R4P B;  1JR0 D;  1CQV A;  2KED A;  2MP1 A;  2A69 C;  5HGT A;  3HOY B;  1CA5 A;  2PZW A;  4A3F B;  1O80 A;  1IKL A;  4HED A;  4RFB A;  1DOK A;  4XQN A;  3KF8 A;  4XYO A;  5IGC A;  1K8M A;  1ILQ A;  2X69 A;  4K6L A;  1PZK D;  2F0T A;  4DAV A;  3OWF A;  2AUJ D;  3SK8 A;  4F87 A;  3VYT A;  1A3U A;  2X6L A;  2N88 A;  3I73 A;  4X3U A;  3FDT A;  3BZD B;  3NXW A;  1VMC A;  4DFA A;  2F0S A;  3MHB A;  2J0T D;  5C0X I;  3TBI B;  2R3Z A;  2F0J A;  4QMG A;  4K2L A;  5D65 A;  1E0B A;  3TP6 A;  3I8Z A;  4FF4 A;  3SK4 A;  3O13 A;  3S2H B;  1Y8N B;  1TVX A;  1B9M A;  3D4R A;  5M3M B;  2KCN A;  1LTA D;  2B8G A;  1PTO B;  1STA A;  2F0G A;  2HCC A;  2EVB A;  3K57 A;  4RAU C;  4ZUI A;  2K04 A;  2PW5 A;  3A7A B;  2SDF A;  3OMC A;  4XIG S;  1SYF A;  5DM6 3;  3M4Y A;  2EPB A;  2JA8 B;  1KAB A;  3VA7 A;  3QWN A;  2KOL A;  4XTC S;  5KIX A;  2PW7 A;  3W3A A;  2F3V A;  3RLF A;  4LAA A;  2F0H A;  1ET9 A;  4KJN A;  4QCL A;  1XTC D;  1EIG A;  3T13 A;  2B2T C;  5DEH A;  4H13 C;  4ZUJ A;  1S5F D;  5M3F B;  2E2J B;  1OXX K;  3K59 A;  5JEA J;  4PV1 C;  3EA6 A;  1WCM B;  1KAA A;  2FMC A;  1KNA A;  1GUO A;  1Y8P B;  1F9S A;  4IAL A;  2LMC B;  1I4P A;  3GTG B;  3Q22 A;  1D1I A;  5IGB A;  5K36 G;  1B2T A;  5CV4 A;  1ZEQ X;  4K14 A;  1IW7 D;  4G7O C;  3J80 L;  4KJO A;  1UAP A;  3E6Z X;  3I72 A;  4H44 C;  2A69 D;  5JEA H;  1V1P A;  1KLU D;  1GJX A;  3HP3 A;  2K6A A;  4FYD A;  2MHV A;  1B9N A;  2LKV A;  4XT3 B;  1F2Z A;  1GUS A;  5G3L F;  4N9T A;  2AUK A;  2WB1 B;  2FFK B;  2ZT9 C;  2F0N A;  1JWS D;  3K5L A;  3I4L A;  1TR5 A;  2L9H A;  5FO7 B;  1H9S B;  4L63 B;  4RWS C;  5C3X A;  2RSN A;  1LAC A;  3S1M B;  2FMM A;  2NUC A;  1NAP A;  3N52 A;  4RHS A;  4BBR B;  3C2P A;  5J39 A;  5D3D A;  1LT4 D;  1E2Z A;  3N6R A;  1D2B A;  2EY1 A;  1U4P A;  2WAQ B;  3D4D A;  2NTS A;  2JEB I;  1LTS D;  2RQX A;  2L11 A;  3FMC A;  2Q8T A;  1SYC A;  3DWA A;  1Z47 A;  1Q3L A;  2JA5 B;  2QF7 A;  1EYA A;  5C4H A;  4FF1 A;  2EDG A;  4RGM A;  1SNQ A;  5IGG A;  1EYD A;  4J6H A;  5FKA C;  2G9D A;  1FNW A;  1EY8 A;  1QJO A;  1TS5 A;  4I7Z C;  4AYB B;  5FLX L;  1LV9 A;  4DNT B;  3RD4 A;  2K01 A;  4XXE A;  3NK9 A;  4E6I A;  3PMF A;  2PNR C;  2A74 C;  2E76 C;  4IUQ A;  2F0U A;  5CYU A;  1HQM C;  2L12 A;  2NWG A;  3WOE A;  5CGK A;  4KD4 A;  3CHB D;  5I9O A;  1HTL D;  1FNV A;  3ITP A;  3NTH A;  1VCI A;  2NVQ B;  1PXU A;  5EPL A;  1IYU A;  1I4H A;  2JA7 B;  3NQI A;  4ZK9 B;  1I4R A;  1L0X B;  4XQQ A;  4M1U B;  1R9T B;  1DM0 B;  2XRS D;  1WTV A;  1TWF B;  1G91 A;  2DY8 A;  4HAE A;  3A7L A;  1NR4 A;  1SFO B;  5CC4 A;  3P20 A;  2NN6 H;  1X3P A;  2MGS A;  2O5J C;  4ULL A;  4B9W A;  1JCK B;  1YNN C;  5AFW A;  3OPO A;  4X3T A;  4KMU C;  2EE1 A;  2OT2 A;  4G4K A;  1R4Q B;  5DNF A;  3R2T A;  4ZQ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...