1LLRD

Cholera toxin b-pentamer with ligand bmsc-0012
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHOLERA TOXIN B SUBUNIT
publication title Characterization and crystal structure of a high-affinity pentavalent receptor-binding inhibitor for cholera toxin and E. coli heat-labile enterotoxin.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Toxin
total genus 26
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2002-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1llrD00
4RHRA 1XXGA 1CHQD 1LT3D 1RF2D 1TS2A 1JWSD 1PRTD 1LTGD 2CHBD 1BCPF 1LT5D 1TY2A 5ELDA 1CQVA 1ESFA 4OHJA 3OWEB 1B1ZA 1CK1A 1V1OA 1PRTC 5D3DA 3MC0B 1S5DD 1FNWA 3EA6A 1LTTD 1PTOH 1ET6A 1GOZA 1KTKA 1MD2D 1I4RA 3R2IA 3R8BA 1LTAD 1T5XD 1HTLD 2AQ1B 3BYYB 3DWPA 3SEBA 1BCPB 1RCVD 1SXTA 2O2LD 1F77A 1SE4A 5ELEA 1D5MC 1JQYD 1CHPD 1JCKB 1LO5D 1CT1D 1PTOF 5D3IB 4O1NA 2NTTA 2XRSD 5ELFA 1JWMD 2XRQD 1EEID 5ELCA 3BZDB 1L0XB 2R61A 1EU3A 1UNSA 1V1PA 2QILA 3DWQA 5I4DA 1TY0A 4RGNA 2G9HD 1SEBD 3KLSX 1L0YB 1PZJD 1BXTA 3W2DA 1I4GA 3MFGA 4RGTA 1LT6D 1D5XC 1I4HA 1LLRD 1M4VA 1RD9D 1PTOB 1EEFD 3URYA 1FNUA 4L63B 4RCOA 2QEJC 1LT4D 1TS5A 1I4QA 1AN8A 1DJRD 3GP7A 1AW7A 1I4PA 2NTSA 3EFXD 3TSSA 1ET9A 1S5ED 4Z9CB 1TS3A 1V1PB 1SBBB 1HA5A 3BVGA 4UDUC 1JR0D 1LTRD 1PRTF 5TSSA 1KLGD 1TS4A 3BVZA 2IJ0A 1HQRD 4RH6A 2SEBD 1PZID 4ZYSA 1FGBD 4K6LA 1RDPD 1G8ZD 1QILA 1JWUD 3V05A 3DWAA 1BCPD 3BYTB 3R2TA 1EU4A 1ENFA 1SJED 2RDGA 1PTOC 2Z8LA 1B44D 1SE3A 1BCPC 2XN9C 4TSSA 1LTSD 4RHSA 1PRTB 2WV6D 5ELBA 1DYQA 4RGOS 2RDHA 2TSSA 5FK9C 1FNVA 2XNAC 1HXYD 1SJHD 2IPKD 1D6EC 1EWCA 4RFBA 1UUPA 2AQ2B 1LTBD 4DXGA 2J4XA 1S5FD 5FKAC 2AQ3B 1PZKD 4BWGB 4C56C 1SE2A 3BVMA 1I4XA 3O13A 2ICIA 1D5ZC 1FD7D 1XTCD 4DXFA 4RGMA 1S5CD 1PYWD 1PTOD 1STEA 1LTID 1EFID 3CHBD 4L6TB 1S5BD 1KLUD
chains in the Genus database with same CATH superfamily
4K5WA 3Q23A 2ICEC 4YHHQ 4OX9L 1CK1A 1E22A 3AYHB 1I5FA 3BZCA 1KAWA 2B63H 4IALA 5LMUQ 2O5JC 5I6YA 1T5EA 1EY0A 5CC4A 4RKBA 5KYLA 3SEBA 3J80c 2KJXA 3A0JA 4JPBW 4S3SA 2NB0A 3STBC 4DGZA 4YCWA 1O7YA 1EY9A 2KECA 1RCVD 3K8AA 4X3KA 5DM73 1PDQA 4A3BH 2Q8TA 4BBRB 4GKKQ 2A6ED 2D0PA 4FDBA 4C3IB 2K50A 1UNSA 4YIJA 4BY1H 3W1GA 2ENBA 2X69A 4WFN3 4IPCA 2J0TD 2F4IA 3E0EA 4ZCKA 1VMCA 3I4LA 1CKMA 1WCMG 2HIXA 2L4NA 3H0GH 4GOPC 4JI4L 1TWCB 5C4JB 1VQCA 2F0IA 4HJ9A 1YNND 1D1KA 2AUKA 3HOVG 1Z47A 4QCLA 1O7ZA 2A8VA 1WTPA 1IBML 4E6IA 3HOZH 4B3MQ 4HJ8A 2EYFA 1A3TA 2Z4IA 2KCMA 1TU2B 5KIXA 1E3PA 2EY1A 1IW7D 1K8OA 1Y1VH 1SROA 3OIPA 3PV0A 4PZ8A 1Q1BA 1W6JA 3I56A 3HGBA 4K6DA 2UUAQ 4OIJA 4A93B 3PQIA 4BXXH 1CM9A 2XTIA 5CBAE 1AZQA 1VS0A 5KRUA 1GVPA 1DXMA 1Y8OB 5C3EH 1QE6A 4DR2L 4DN4M 4XDXA 4R4CA 2E74C 4OIKA 3M85A 1I50B 2A19A 5JOBA 1HR0L 3GTGB 4OWTB 2N49A 3RUZA 3G4SA 3K0YA 2HQLA 3LNNA 3J7AF 4BBSG 4IOAA 3K7UC 4R4TA 1Q46A 2E2JB 1FD7D 4A3IB 1YNJC 3D4DA 4IFDI 3U9SA 3MVVA 3GTOH 1RF2D 2OQ0A 4DR4Q 1EFWA 2OCEA 1V1OA 2I46A 5EKLA 2JA6H 4X3TA 3P75A 2A5HA 1I4RA 2PZTA 3W3AA 1KNEA 3J81L 3CW2C 2E2HB 3T1YQ 3G6EA 1CKNA 1X32A 1RTNA 1G291 4POGA 5C4HA 4CBVA 1CTMA 2NUCA 1SYGA 2HHHQ 1VQJA 1R4QB 4PQXA 5M5WB 4IFDG 3ULLA 3I7FA 1VQIA 1J9OA 4AYBE 4JI8L 3U58A 4K2KA 5KEEA 4A3KG 2UU9Q 1N33L 2N55A 3CRLC 2KCTA 3W2DA 3E9HA 4KD4A 2BE5D 1WTOA 1VQNA 5E1FA 3I55A 4JI0Q 4DR7Q 1WTWA 1EEFD 2KCNA 2CH4A 3NBIA 4RMFA 2BDOA 5EPJA 4JI3L 1GKHA 1I3QH 5IYDG 4ZKCB 1NE3A 3MXUA 2B63G 3ICEA 1VDZA 1N36L 3KBXA 2F0PA 3S1MB 2LXJA 3BVZA 3J7YW 3FRPB 3LX0A 5C0XI 1QVCA 1NR4A 4NMZA 3R93A 1ASYA 4NXNQ 3MTSA 1L2FA 4BS9A 2DUDA 4LFAQ 1JOOA 4DV3L 4FNFA 2I0QA 2R6GA 3E9IA 4O0AA 1CSQA 2Z6KC 4FF2A 4DV4L 4L8JA 5JEAH 1FYCA 1JB7A 1HXYD 5E7NA 1QVGA 1L1OA 2AQ2B 2AHOB 5FKAC 4CKEA 1HNWQ 4C56C 1EL0A 4IPGA 4BBRG 4EGVA 3G6JB 1KABA 3O13A 1GHJA 5C0XG 1YJ9A 5T1GA 2R93B 1PTOD 2QDLA 4F8MA 1GHKA 4A3CG 2DNEA 2NZHA 3NTHA 4DK3C 2B3GA 4C1NI 4JW0A 4KY5A 1TY2A 1KC8C 4OHJA 4JYAL 2FMMA 1QUQB 3F2UA 4QQBX 3SK6A 3KJOA 4X3UA 3M3YH 3R2IA 2D2CC 1IZ6A 1XMQQ 1II3A 4R1JA 2EZVA 1OXXK 3AMUA 2IX3A 4KKTA 2XGTA 3VA5A 4IUUA 2RVLA 3JAME 4DV0L 2RBMA 5IYCH 2NVXB 2E75C 2B2YA 2R3ZA 5A2QE 1CQFA 5FJ8G 3ITPA 1PFNA 4A3JB 1YZ6A 5GAGC 2G5DA 2NTTA 4H02A 1F9SA 3I90A 5GADC 1Y1WB 2VUMH 2JA9A 4JG2A 3KJPA 5EBCA 3BU2A 4LF4Q 1IBLL 3HEJA 3RZDH 2A69D 3RNUA 1I94Q 1JMCA 3D4RA 1PFBA 4R8NA 4DV7L 3PUWA 1P8LA 2KQ3A 2UXCQ 1EOVA 1U9RA 2Y0SE 3RR5A 3URYA 4CHTB 1G2TA 4L63B 4GNXA 3T1HL 2EJGC 2QEJC 2VNUD 1I4QA 2NVYB 2F0JA 2ZJPA 1I4PA 2EPBA 3L9AX 3A8IE 4RAUC 4JI7Q 4C3HB 2CFMA 5C3WA 2JYOA 4M8AA 5TSSA 2JA7B 4PV1C 3HOYB 1GM5A 3K5NA 2QDBA 1XMOQ 5G3LD 3NENA 4X64L 3HFZB 1JWUD 3GTLB 5C4XB 4BY7H 2B39A 4XQJA 3GTMB 1B4OA 4IJLA 1SLJA 4IPDA 1NUCA 3I4NB 3LWUA 4OO1I 1DD2A 2R92B 4LF6Q 2E2IB 2K01A 2MO1A 4DNTB 3TP8A 3S24A 2R7ZB 4DXGA 3WWVA 1JJGA 1VQ9A 1AE2A 3MXNA 1HJPA 4A3EG 2WAQE 1WTXA 4JI5Q 3CAMA 4J1MA 3VR3A 4PNYA 1LTID 2N88A 4KN4C 1IHZA 3S2DH 3TMEA 1RODA 4OEMB 4Q5VA 1Q8IA 2F0LA 2K28A 4OO1G 4X62L 3OWEB 2CQAA 1Q8KA 3I73A 1PXUA 1HZCA 1LTTD 2UXDQ 4R8IA 2Q8RE 1S40A 2F0FA 3KUPA 1HTLD 2K5DA 5BN3A 1S72A 2SNMA 3BS1A 4DAYA 2I5LX 5IOCA 4WJ4A 3T56B 2O2LD 3FPUB 1D5MC 1JQYD 1PTOF 2K5VA 2WFWA 4L5QA 3GTQH 2F03A 1J5EL 1KDAA 5FLXc 4KK7A 4M1UB 4JI2Q 1XX8A 2IHEA 3DMUA 1TY0A 2G9HD 2NVQH 1X3EA 1SMYC 4YWKA 1VF7A 3L2PA 2IHFA 4A75A 1OO9B 5L37A 4GZYC 1PTOB 4CJ2C 4OONA 2I5HA 4A3DG 4KMUC 4JOIA 1H9RA 1DJRD 3VYSA 2B2UA 2A6HD 2EY5A 1XTDA 1H9SB 1BNZA 1HA5A 5I2XA 1EOTA 4JCVE 4JI4Q 1F2YA 3SGIA 2MP1A 2LSSA 3OOCA 4UPAA 1BVSA 1HCZA 3KF6A 1N9WA 3QG1A 4LK1C 3V05A 3DWAA 3X3MA 1TQOA 1EQTA 1X65A 3MXGA 1XNRL 2RDGA 4I7AA 1HFGA 1A3VA 1KXLA 1B44D 1SE3A 5CV7A 1EQRA 1RHPA 4RGOS 3V2TA 4DFAA 4ZUIA 3SXHA 1S3OA 1N8RC 5JJKA 1Y1WG 2OEOA 3EN2A 4JV5L 2C9OA 3ONAB 4DR2Q 1FL0A 5M5YB 3CHBD 2K32A 4ZK9B 4PMBA 4AIMA 1PRTD 1EIFA 2EYLA 1W3SA 2WP8J 1HH2P 4GN4B 3A7AB 1A8VA 5IP9H 2HCCA 1I6VC 1TXYA 1HR0W 3MC0B 4DAMA 2R7DA 3EA6A 1Q7YC 2NYZD 4MNOA 2M2LA 3BDCA 1Y69U 4F88A 1STAA 1TR5A 5EQ0A 3RMHA 4ME5A 1RKNA 1PVOA 4K14A 1EWHA 1PYBA 2WIIB 4AH6A 2Z1CA 3HOYG 2RHSB 3PIOA 5BN5A 1ICFB 2VY3A 1WCMH 4A3GB 4UY8C 3KF8B 1EYDA 2CW0C 3VR5A 2F4VL 3VYUA 2EIFA 1T9HA 5CV8A 5GROA 1B3AA 3ND9A 1SYDA 4UP8A 5C44B 3HOVH 2ZTDA 2R61A 4POFA 4DV1L 2VXWA 2R92G 2KHJA 3EBEA 3PUZA 3TDQA 1D5XC 2E76C 5T1IA 4JI8Q 3UDIA 2YU9B 4IPHA 1AN8A 4WRDA 2NTSA 3RZOH 3TSSA 1TS3A 2B2VA 4FXDA 1KIXA 2K5WA 5IT9L 5I2YA 4FXKC 1HQRD 2NWGA 2QW7A 4JI3Q 2SEBD 2L15A 1PH4A 5EGTA 1VQHA 4BA1I 3F2DA 4BBSH 4GOPA 2K75A 3K0XA 1SJED 1SYCA 2C35B 1K9MC 2MJ8A 5C4ZA 3CQZB 2NVTH 5CV6A 2KHIA 1QB5D 4DNRB 5KNDA 1XJVA 1Q82C 4DV3Q 4MN3A 4C3JB 4RFBA 1N34L 2N78A 1S4ZA 5A35A 1NJIC 1UE1A 1HRJA 1TWGH 1U0LA 1TWHH 4DV4Q 1K73C 1BBUA 1I6HH 2ASBA 3TZDA 1B70B 4L6TB 1KDCA 5IWAL 3K57A 1BDOA 3K58A 4JI6L 4X6AH 4N8FA 3JAMi 1CHQD 3S1QB 4DV5L 4LAAA 4DAPA 3KFUA 3SR1A 1TS2A 5CGKA 3FVQA 4IO9A 5ELDA 3TREA 1O80A 5IIFA 4IFDH 3K80C 3IAYA 2RCFA 5HGTA 2F52A 2TMPA 4IUVA 4DF7A 3H94A 1X6OA 1K83B 2ZTCA 1D1IA 3R8BA 5M3FB 4A3KH 1G51A 3STBD 5IGGA 5I9OA 4JYAQ 1SNCA 1DOKA 4LFCL 3CCSA 1LYLA 1JICA 5IP7G 3S14B 1F77A 1SE4A 3ZYYX 2YV5A 1JCKB 1LO5D 1CT1D 5JAVA 2FXQA 1PH8A 3AFPA 4P73A 3I8ZA 1NCVA 5LL6S 1VMPA 3M4QA 2FJ2A 3FDTA 5IYDH 1YBYA 3HOUH 2A68C 2V4DA 1B9MA 1P16A 1V1PA 5JJZA 2PZWA 4RGNA 1AH9A 1QNKA 1SR3A 3GQBA 1RTOA 4NXML 4DAYB 1IBLQ 3HP3A 4FF3A 3MAQA 4CDCC 3MHBA 5EJWA 3KOJA 2BA1A 1GUGA 4X65Q 3QWNA 5IP9G 4DV7Q 4UAIA 2R7FA 4O2DA 1BBWA 4KV6A 4HSVA 3T16A 4FYDA 5J3BA 1LTRD 2AKWB 3T1HQ 1CSPA 1TS4A 2WB1B 1PZID 4WORA 2IX0A 1YJNA 4A3BB 5I6WA 5GAEC 5EPKA 3M9BA 2JXMB 4BBRH 4X3SA 4BY1B 3DEOA 4XQQA 1TIID 4DU9A 5C0XH 2UUCL 4K0KL 4A3FG 1MSGA 1IKMA 3NK9A 4A3CH 1E2VA 2UXBQ 1ESRA 4EQNA 5M3MG 4TSSA 4RHSA 2MFIA 3CKIB 2CWPA 4X64Q 3M4YA 3A5UA 4QB4A 2L55A 1R9TH 3UDFA 5I9PA 1TWCH 2CQOA 3K7AB 2FHTA 4LFBL 5COYA 4JC0A 2JP1A 2BDNA 1YNJD 3CCMA 1D5ZC 4RGMA 1D7QA 1STGA 1WFQA 1UE7A 4DPGA 2JSOA 2Z6KA 3ZJYC 1VQKA 1LTGD 4KHVA 4EQOA 5FJ8H 1Y1VB 2F0VA 1PH2A 1B1ZA 3ER0A 2X6LA 2PQEA 1EUJA 1SYEA 4DUZQ 4Y7NB 1KTKA 3D0FA 1QZHA 2EY6A 1BR9A 4A93H 3NTKA 2HUGA 1HUMA 3DHQA 1Y8NB 1LTAD 3M7GA 2AQ1B 1MJEA 3NE5B 2DJGC 2KVMA 2LY7A 3GTGH 2KA7A 1JC7A 2VL6A 3EROA 2E5LQ 4B3TL 3TZUA 3S1NB 5ELFA 2Y0SG 5C3XA 3KBGA 1B3QA 5EAYA 3BZDB 5CV5A 1TWAH 2JQOA 1E1TA 3PUVA 3SK8A 4GN5A 5D65A 1BXTA 1TWFH 1ML0D 3MWYW 1FJGQ 3OW7A 1SNOA 2JA6B 3S15H 4GKJL 4IUQA 1J5EQ 4C3JG 1EY4A 3OMCA 4LF9Q 1FNUA 1KL9A 3CC7A 1YEZA 3SK5A 1SAPA 4BA2I 2ZTEA 2EYOA 2K14A 4DR5L 2JA5G 1LABA 1R4PB 3CXCA 2E2HH 5AJ3L 3OHXC 5J1ZA 2QGQA 1GUWA 4UDUC 5DLQE 2F0TA 4MZ9A 4GLAC 2HDLA 4O42A 4HJ7A 1KLGD 5M5WH 1RL2A 1RDPD 4G7HC 2PNRC 4A3EH 2XWBB 3BYTB 1PH5A 1Z7TA 3M4OB 1Z9FA 2WAQG 4H44C 5ELNA 3HOUG 3P20A 4QL5A 4OO1H 2F0SA 3S17H 1LTBD 4QY7A 4NDXA 1XNRQ 3Q8DA 3U4VA 2VQEL 1I3QB 1GO3E 5IODA 1STHA 1HA6A 3AFQA 1PFMA 4GOPB 4EQPA 1ZYRC 4MHEA 1LM0A 1K0SA 4ODGA 2DY8A 2EY2A 3S1MH 4KHPQ 1KNAA 4H7BA 4JV5Q 3GTPH 1H9KA 4ILWA 2RA4A 4ID6A 1WOCA 5J39A 3J80i 4K8IA 1PH6A 3K6OA 4Y52H 2KEDA 2YTXA 4OGQC 3UI2A 2K5NA 3HOWB 2VZAA 1GUOA 1VQMA 2GN5A 4DUYQ 2H1EA 3AU7A 5EKIA 1A15A 4C3IG 1HNXL 3I3CA 1SNQA 4DR6L 2YYZA 2WB1G 2Z4HA 1HFNA 2Q8IB 2B29A 1UE6A 3DM1A 3EJIA 1HNZQ 2PCFB 2QKIC 2MNAA 3BDOA 4A3DH 1V1QA 5IE8A 4DK1A 1M1KC 1TVXA 4DR3L 3UE1A 2HT1A 2R93H 2J7ZA 5C5MA 2P5ZX 2K52A 3I4MB 4RKLA 3T53B 3RN5A 4PG3A 5FLMG 2RQXA 2BCOA 5FLXE 4X66L 3Q22A 1LT6D 3M3YB 2Z6BA 4V190 2ES2A 2GA4B 2PQAA 4JI1L 1SFOH 4DV1Q 2XVSA 1U4RA 3VA7A 1NMFA 2KEEA 3D31A 1V1PB 1DOLA 1JR0D 2I07B 1CFMA 4A93G 3GTJB 5IGBA 3J7A5 5E4XA 3J81c 2PZUA 4OL7A 4GLXA 2VUMB 5A2QL 1TT2A 3QR8A 2Z9HA 2EXDA 1G8ZD 1E2WA 1OXVA 3X3NA 1Y1WH 4LW1A 4KI0A 1HZAA 3HOXB 3RZDB 1CA6A 3R2TA 3PF5A 1PTOC 1L0WA 1O78A 2D62A 3R3OA 1KQSA 2RDHA 5JEAJ 4A3IG 4FF4A 1SJHD 4YWMA 1NY4A 4A4IA 3HG9A 1Q86C 4CGYB 5DM63 2NVYH 5CORA 2N3SA 4PZ6A 1FVIA 3TN2A 1H95A 3OYYA 1Z6HA 4C3HH 3PIO3 1F2ZA 4RHRA 1N34Q 5JVH3 3HOYH 4OWWB 3KDFA 4GLVB 2C5CA 4BY7B 3NBHA 4Q0FA 3GTLH 1X56A 1PYSB 5IWAQ 4JI6Q 1MHWC 3GTMH 3M7NA 3ERQA 4DV5Q 1PH9A 2QA4A 1QOHA 1J6QA 2R92H 4K5XA 2MQHA 4B3ML 4HIDA 1C9OA 5ISRA 2PW5A 1J8IA 3FMCA 2PW7A 3C1FA 1JWMD 3OTOL 2XRQD 1Y8PB 4P72A 5ELCA 4LFCQ 3S2DB 2IWHA 1SMYD 2QILA 4IUPA 3NQIA 4ZQ3A 4LWCA 5E3FA 4IURA 2CKZB 3PO2B 3S16H 3QOLA 4KKSA 1UE5A 1ENAA 4OX9Q 1V9PA 4RCOA 4HR7B 1PA6A 1AE3A 2EVBA 1GUSA 1WYDA 4GN3B 3W1BA 1JE5A 1X3GA 3EFXD 1G91A 4C1NK 3CCLA 3OSOA 3GTKH 4A3LG 2WINB 4C2MH 4K2LA 2L0CA 1OXTA 2WB1E 5KGUA 2Q2TA 1CKNB 1EY5A 3EQLC 1WVLA 2DJFC 1SSOA 4LJZC 2B2YC 2NVQB 1EZ6A 5IYBG 4TRDA 1K8AC 1BCPC 1W6KA 1DCZA 1LTSD 2R93G 4QF4A 5D14A 1QWYA 3I72A 3S1RH 3H6MA 4A3MB 2HHHL 2UUCQ 4K0KQ 2AQ3B 5JPMC 1PFSA 2JEAI 2RHQB 4XTCS 4CDDC 1EY8A 2L5TA 4DV6L 1AFPA 2AWOA 1STEA 2UU9L 1N32L 2XIWA 1NTGA 1F2MA 3MA2B 1IBMQ 1D8LA 4JBMA 4ZLTF 2F0DA 1JWSD 5IP7H 2JA8B 1GD7A 4DV2L 1EIYB 4R4IA 4JI0L 2LS01 1AZPA 2EYJA 2CCZA 3N6RA 1PH3A 1QNUA 2F0WA 1NSNS 2JE6I 3U9OA 1YJWA 1ET6A 4B3SL 4A3JG 1TKWB 3MEHA 1T5XD 1W2BA 3G71A 3U4ZA 4NPSA 2F0OA 3CPWA 2CW0D 2ZT9C 4KKUA 5G3LF 1SXTA 4QJFA 5FO8B 1LV9A 1CHPD 1HR0Q 4TKOB 1OXSC 4NXNL 3HOXG 1B9NA 2XRSD 1SE8A 4LFAL 3OIQA 1L1OB 1UEAB 3F8TA 2XSCA 1SEBD 1YI2A 1O7LA 1PZJD 2DGYA 3CPFA 5LHY1 3MFGA 1F2LA 4RGTA 4RG1A 5C5LA 3FKIB 4B3TQ 3CCEA 1NMGA 4C3HG 1JORA 2EJFC 2JA7G 1HNWL 3L3OC 1CKOA 2QCPX 4ZKBB 4A3FH 2F1MA 5C4XG 1BO0A 2RCNA 2IW3A 2DN8A 4JBKA 5DEHA 5GQOA 1S5ED 1F9PA 1UEBA 3J80E 1YHAA 2ID0A 5M3MH 3PCOB 2O5IC 2BH2A 2ZXOA 1WCMB 3CCVA 3E6ZX 4DR5Q 2PO4A 3I4NG 3Q24A 4A3GH 1MGSA 2ATWA 1VQ5A 1NBWA 5AJ3Q 3HOVB 1E2ZA 2PQAB 3VDYA 2R7ZG 4J8QA 3IKJA 1VQ4A 1IBKL 3I2ZA 4V0BA 3SE0A 1N33Q 4H13C 2B2WC 2NN6I 1VQLA 4HN7A 5FK9C 1X3QA 1IXRA 1WJJA 1HTPA 3G7LA 3VYRA 2YU9H 3A5ZB 3NSWA 1RJTA 4KD3A 3RZOB 4LF7L 2ICIA 1B2TA 2HD3A 1PYWD 4GNXB 5M9OA 1A2UA 3IFDA 2D9UA 1I94L 1SMXA 2RSOA 3D4WA 2K5QA 3M4PA 1ILPA 1N36Q 3NXWA 4LUOA 1X9NA 2VQEQ 3ERSX 3SDZA 4JVZA 3PO2G 3TBIB 1HHVA 2WKCA 2NN6G 1MSHA 1SNDA 2VS1A 4IUTA 4FVMA 5D3DA 1S5DD 2ZM6L 5IGEA 3J81j 2IT1A 2VB3X 3CQZH 4MTNA 1IL8A 3EIVA 4LF5L 4OXPA 1SYBA 1V8QA 3NTIA 3CU7A 4C3JH 3KDFB 1JJCB 5HY6A 1TWGB 1XMOL 5M5XH 1TWHB 1B53A 2SOBA 2UUBL 2A68D 1E7ZA 2JA5H 1C4QA 3DXJC 2GVAA 3PO3B 5LL6X 4DR6Q 1XNQL 3MXNB 3S1QH 2OF1A 3GV3A 2PI2E 2XWJB 1ILQA 3DUZA 1GXDC 5CYUA 3LWEA 3WOFA 5LMNW 4A3MG 3S2HH 3JC66 2SDFA 1IYUA 1RD9D 4PMCA 4DR3Q 1EYGA 4G7ZC 4DKAC 4IQZA 3A54A 1Q1EA 1C48A 4XYQA 1WD1A 1TS5A 2HQEA 3IFTA 1K83H 1K3BC 1VCIA 1X3FA 1EQQA 4NP5A 4QIWB 5AFWA 4DV0Q 1VQ8A 1PRTF 1A2TA 4KJNA 3A8JE 3D3RA 2JA8G 3S14H 1SDFA 4AQYL 4RH6A 1K3RA 4JBWA 3FHWA 5JPNC 1VQPA 5C6AA 4APVA 4YY3L 2KBNA 3AB9A 2B63B 4JK1C 4DAVA 1BBXC 3KLRA 1F9RA 1VQFA 4B3RL 3A55A 1PRTB 4RWSC 2EQSA 2F3WA 4KY6A 3K5LA 4RA8A 1EY6A 2OTJA 2IPKD 4R4QA 1CA5A 1UUPA 3C1EA 2ZXPA 5BR8L 1MI2A 3PMFA 1XPRA 1EZ8A 1LACA 3AQQA 4KHZA 1V43A 4JI2L 1S5BD 1KLUD 4C3IH 3NWSA 3HKSA 2JJQA 4XXEA 1VQ7A 3SK4A 3FKIG 2VQFL 4PMWA 2F3IA 3P1HA 4IFDJ 2B2VC 3H0GB 4R4OA 5K36G 3BG3A 5IT9c 1K8GA 4A3GG 2KUMA 2EYMA 4L5TA 3KF6B 5C4JH 3DWPA 1WTVA 4DNIA 5FLMH 1SYFA 5C44G 1R9TB 2PYKA 2L11A 2L12A 3TS0A 3HOZB 3L7ZC 3QB3A 5KYIA 1X55A 3K7AH 3MEFA 5FO7B 1IYJB 3E0JA 2O4XA 4B9WA 2LKVA 1BUVT 1VQAA 2B2TC 1EYAA 3CP0A 1EEID 2D5DA 3HKZB 1VQDA 1JOQA 1B7YB 3RN2A 2A6EC 1H9MA 4ULLA 1CUKA 1K0RA 3IRBA 1KRTA 5C3EB 1ASZA 1M4VA 4U68A 4X62Q 3RLNA 3OTOQ 1UAPA 1ENCA 2BA0A 3QIAA 2M9VA 3RLFA 3UDGA 4Y7NH 2WACA 3H15A 5FOBB 1I50H 1MJCA 3T13A 1YHBA 3EVQA 2KENA 3SHLA 1IYVA 1ET9A 1MBYA 1C8CA 2E2JH 1B50A 1YNNC 3BVGA 5NUCA 3T51B 5EKKA 3CCQA 1KAAA 4YWLA 4A3IH 3GTOB 2IJ0A 3TEHB 4HIMA 1JOKA 4DR1L 1IL2A 3NWTA 2NZ1D 4K6LA 2V1CC 2OT2A 1QILA 4HAEA 5JJIA 4HJ5A 3S1NH 2LXKA 4DK6C 1TWAB 1IW7C 2LMCB 1A0IA 1BKBA 2F3VA 3J81E 5C0XJ 1GJXA 1HZ9A 2Q2UA 5IGCA 2EJMA 3OMGA 1TWFB 3T4AC 3S15B 2WV6D 2RF4A 3CMEA 4L5RC 1EYCA 1ZYRD 1HUNA 2FMCA 1PZKD 1A3UA 3KK7A 4ME3A 3PO3G 1XTCD 1LTLA 2K04A 5J22A 2JEBI 3QO2A 2A1AA 4ALPA 1VQEA 2YTYA 1LT3D 5M3FG 2ZJRA 1Q90A 4PZ7A 4FXGC 3CCJA 1LT5D 1O7IA 4XQNA 4NB3A 1DGSA 1HPCA 3F2CA 3H3VC 4MTKA 3PIPA 1EQVA 4DV6Q 4A3EB 1GUNA 4CKBA 1H9SA 1N32Q 3DLLA 2FINB 3M4OH 4XIGS 1VF5C 3BYYB 4F87A 4DV2Q 4CJ1B 3S17B 2EOTA 5IGFA 2PPBC 3FPPA 5K5PA 4ZAIA 4IUNA 5IGDA 4B3SQ 5D3IB 3A74A 3D6WA 4O1NA 1ZKOA 2A73B 1E1OA 5CV9A 3D8GA 1ONLA 1G6ZA 1HQMC 3NP8A 3K5MA 4A3LH 3CCRA 1UWVA 4G57A 2F0NA 4FO2A 3KLSX 3GTPB 1NAPA 1BOSA 2NZOA 1SNMA 2MGSA 2N8NA 1SRUA 3CD6A 1XWEA 2BE5C 3P7JA 3MFYA 2HDMA 5LMNL 1LT4D 1VQBA 3HOWH 1RIPA 4A3BG 4CDEC 2Q2IA 3KLSA 1WTRA 1AW7A 5IYBH 4Z9CB 4N9PA 3K59A 4BY1G 2F0HA 1SBBB 1Q3LA 2PMZB 1C0AA 4KLKA 1YNXA 1IKLA 3A56A 2E2DC 1M8AA 4LF8L 4A3DB 4LNQA 4F7XA 3CCUA 1KD1C 4B9XA 2RKSA 3H0GG 2F4VQ 4J6HA 3CF5A 1DOMA 1OTCA 3S9WA 1ZXTA 2ZJQA 2EE1A 3I4MH 5F2DA 2XN9C 3KF8A 1E0BA 5ELBA 1DYQA 4K8JA 3TP7A 4EQ5A 3HOZG 2DY7A 2Z0SA 3IL8A 1FNVA 4QMGA 5FLXL 1SFOB 1D6EC 1EWCA 2OQKA 3JAML 2NVXH 1IBKQ 3KLWA 1K8MA 1Y1VG 4YHHL 2E8GA 2JN4A 4A3JH 3HKZG 1PV4A 1S5CD 3B6YA 4KTAA 2MO0A 4NW2A 1A6XA 5LMUL 4BXXG 1DZ1A 3OWFA 1AEXA 2A74C 2KHSA 3GTJH 1WD0A 5C3EG 1H9JA 1DONA 3I91A 2AUJD 4LF7Q 4HJAA 1CQVA 2IL8A 4HEDA 3HOXH 3NEMA 1U4PA 1FNWA 1GOZA 4HCSA 2K03A 2OWOA 4I65A 4X65L 4IJHA 3H3VH 1VQGA 3WOEA 3VYTA 4GKKL 1HZBA 5HURA 2OXPA 3PGZA 4XT1B 3GD7A 1EIGA 2ZM6Q 3Q6SA 5ELEA 2JA7H 4H0LC 3TRZA 3MZ5A 2BH8A 2JA6G 4LF5Q 4RCNA 5C4XH 3F1ZA 2RSNA 5CMDA 2I5MX 4G4KA 4HTHA 5EPLA 2UXBL 4ZRZA 3MXPA 2WKDA 4CJ0B 1QZGA 3I4NH 2UUBQ 2A69C 1ZEQX 1A62A 4N8X1 1I4HA 5CR3A 4JBJA 2E2IH 3DM3A 1XNQQ 1D2BA 1JT8A 2RDFA 2R7ZH 1BQQT 3GP7A 1FR3A 3J7AV 4CDFC 1Q12A 4QIWE 3C3LA 2F0KA 2UUAL 5KNCA 1L1OC 4ZUJA 4OELB 4ZYSA 1LUZA 1FGBD 3E3XA 3NPPA 3TQYA 4DUZL 3C2PA 1AP0A 1BCPD 1YIJA 1EU4A 4YCVA 2M00A 1KHIA 3U50C 2B8GA 1SNPA 4AQYQ 4OWXB 5H1SE 3S16B 5IY0A 4I7ZC 1KRSA 3PO2H 4NXMQ 4YY3Q 2XNAC 2NN6H 3FEWX 2ZXRA 1Q81C 1K28A 2KCCA 2J4XA 1EWIA 3VR2A 2E5LL 4BWGB 4EVOA 4DR4L 4B3RQ 3GTQB 3BJUA 1I4XA 3GTKB 2K1BA 4WJWA 2K33A 4C2MB 1MIUA 1EFID 3HOWG 1U4LA 1PLFA 5DNFA 4LMQD 2B2WA 5JEAG 5BR8Q 1FJGL 2CHBD 2JK8A 3OPOA 3T1YL 4U673 4LF9L 3K5OA 4HMJA 1VQ6A 3JAMc 1MKHA 1PTOH 1MD2D 1YHQA 5KNBA 3F2BA 2QF7A 2MPMA 3GO5A 1JB3A 2VQFQ 4LUZA 4WJ3M 3VR6A 1B8AA 3HS0C 3S1RB 1DM0B 2K7VA 4TQUS 3I4MG 4A3MH 4GNXC 1STNA 4QGUA 4LFBQ 1GUTA 2D0OA 3DEPA 4G7OC 4DR7L 4AYBB 1NR2A 3HKZE 1L0XB 3CRKC 3H3VI 1FGUA 5GAHC 5I4DA 5BN4A 3E5SA 2SNSA 4B08A 3OW2A 2JA8H 5IYCG 3W5OA 3H09A 3H91A 2EDGA 3A7LA 3Q0AA 2K05A 3PUXA 3TP6A 2IX1A 2VUMG 4ABNA 2F0GA 5CBEE 1CZGA 3J81i 5CV4A 3BZKA 2MHVA 4DA2A 3I70A 4HCEA 1QVFA 2DNCA 2A6HC 2GVBA 2CWAA 5M5YH 3ULJA 4KHPL 4XT3B 1SN8A 4FP5D 2K6AA 4LUVA 5FO9B 2HIVA 1NNXA 4HMIA 4IZ8A 3PUYA 2K5HA 1XYIA 3D6CA 4J15A 1QJOA 4DK0A 3GV6A 3GDEA 1ENFA 1EY7A 5HGQA 5DAUA 1EIHA 3FP9A 4A76A 2EXZA 1PH1A 2B8FA 4DR1Q 4DUYL 1WTHA 4QUFA 4IOCA 2TSSA 1C7YA 3I4OA 3FKIH 3TS2A 4P74A 4GKJQ 1QCBD 1XPOA 1VQOA 2NBFA 4HIKA 4A3FB 1HNZL 5K36H 4BY7G 3RD4A 1STYA 2IY5B 3BVMA 4R9WA 2MUYA 5M3MB 4GS3A 3J80L 4P75A 1X54A 3QJYA 1G2SA 2BOSA 5C44H 1XXGA 3N52A 1PH7A 1XMQL 4P71A 1BCPF 1ESFA 1JE4A 3RLOA 1PRTC 1Y14B 4XYOA 1BF4A 3J7ZC 5JJLA 2G9DA 4K5VA 4EX5A 1XPUA 1OXUA 1M90C 3CC2A 3PSIA 4N9TA 4QUCA 2H4OA 4LF4L 3V96A 2X6GA 3HZXA 5IT9E 1BCPB 1CI3M 3VR4A 2F0EA 2HCIA 2OTLA 4JOIC 4KN7C 4UP7A 2CH4W 2B2UC 1G6PA 4BBSB 2VW9A 2PNHA 5ELOA 2UXCL 2VB2X 3CC4A 4L5SA 3HRZC 3KYHC 2LFNA 1EU3A 3UE0A 3NUCA 3DWQA 3UDXA 2YTVA 3A8KE 5E4WC 2NVTB 1L0YB 1I4GA 2FFKB 4NKLA 3L0OA 3NHHA 1E24A 1STBA 2H5XA 1PHJA 1LLRD 1U4MA 4JI7L 3NELA 2Y0SB 3LGJA 1ICWA 2EYPA 1KDBA 2F0MA 2K4KA 3K81C 5EBDA 2L9HA 3NBHB 4UHVA 1I6HB 2B2TA 3C46A 2KOLA 2AWNA 4UP9A 3TP5A 1HNXQ 3PF4A 1WI5A 1PMRA 2PMZE 3WDNA 5M5XB 4HIOA 5LMNQ 4MIUA 1U5KA 4YCUA 2L1BA 2JA5B 4LF6L 4CKCA 4KY7A 5JVG3 3AEVA 1A63A 1YVCA 4KJOA 3PO3H 2ALYB 1JJ2A 2Q2HA 4A3KB 2Z8LA 2AMCB 4LF8Q 3G48A 2F0UA 4TVAB 5M3FH 3S2HB 4IN3A 4FF1A 2F0QA 4JI5L 3PIP3 1WTQA 3QOJA 4X66Q 4HSPA 1CZWA 1QUQA 3ULPA 2QEXA 1S5FD 2CVRA 3ND8A 4JI1Q 1YITA 1SE2A 2EYHA 1QG7A 2PI2A 4AYBG 1X3PA 2WAQB 4DXFA 4P2CB 3SVMA 3HOUB 3BDLA 3NQTA 1F9QA 3CMAA 2UXDL
chains in the Genus database with same CATH topology
4K5WA 3Q23A 2ICEC 1CK1A 4IALA 2O5JC 5I6YA 1T5EA 1EY0A 5CC4A 4RKBA 5KYLA 3SEBA 2KJXA 4S3SA 4DGZA 2NB0A 1O7YA 1EY9A 2KECA 1RCVD 4X3KA 5DM73 1PDQA 2Q8TA 4BBRB 2A6ED 4C3IB 1UNSA 4YIJA 2ENBA 2X69A 4WFN3 2J0TD 2F4IA 1VMCA 3I4LA 2L4NA 1TWCB 5C4JB 2F0IA 1YNND 1D1KA 2AUKA 1Z47A 4QCLA 1O7ZA 1WTPA 4E6IA 2EYFA 1A3TA 2Z4IA 1TU2B 5KIXA 2EY1A 1IW7D 1K8OA 3OIPA 3PV0A 1Q1BA 1W6JA 3HGBA 4K6DA 4OIJA 4A93B 1CM9A 5CBAE 1AZQA 5KRUA 1DXMA 1Y8OB 1QE6A 4DN4M 4XDXA 2E74C 4OIKA 3M85A 1I50B 5JOBA 3GTGB 3RUZA 3K0YA 3LNNA 3J7AF 2E2JB 1FD7D 4A3IB 1YNJC 3D4DA 4IFDI 3U9SA 3MVVA 1RF2D 1V1OA 2I46A 5EKLA 4X3TA 3P75A 2A5HA 1I4RA 2PZTA 3W3AA 1KNEA 3J81L 2E2HB 1X32A 1RTNA 1G291 5C4HA 4CBVA 1CTMA 2NUCA 1SYGA 1R4QB 4PQXA 5M5WB 4IFDG 1J9OA 4K2KA 5KEEA 2N55A 3CRLC 3W2DA 4KD4A 2BE5D 1WTOA 5E1FA 1WTWA 1EEFD 2KCNA 3NBIA 2BDOA 5EPJA 4ZKCB 3MXUA 1VDZA 3KBXA 2F0PA 3S1MB 3BVZA 3J7YW 3FRPB 3LX0A 5C0XI 1NR4A 4NMZA 3R93A 3MTSA 4BS9A 1JOOA 4FNFA 2R6GA 4FF2A 4L8JA 5JEAH 1FYCA 1HXYD 2AQ2B 5FKAC 4CKEA 1EL0A 4EGVA 3G6JB 1KABA 3O13A 1GHJA 5C0XG 5T1GA 2R93B 1PTOD 4F8MA 1GHKA 2DNEA 3NTHA 4C1NI 4KY5A 1TY2A 4OHJA 2FMMA 3F2UA 3SK6A 4X3UA 3R2IA 2D2CC 1II3A 2EZVA 1OXXK 3AMUA 2IX3A 4KKTA 3VA5A 4IUUA 2RVLA 3JAME 2RBMA 2NVXB 2E75C 2B2YA 2R3ZA 5A2QE 1CQFA 3ITPA 1PFNA 4A3JB 2NTTA 1Y1WB 1F9SA 3I90A 5EBCA 3HEJA 2A69D 3D4RA 1PFBA 4R8NA 3PUWA 2KQ3A 1U9RA 3URYA 4CHTB 1G2TA 4L63B 2EJGC 2QEJC 2VNUD 1I4QA 2NVYB 2F0JA 1I4PA 2EPBA 3L9AX 3A8IE 4RAUC 4C3HB 5C3WA 2JYOA 4M8AA 5TSSA 2JA7B 4PV1C 3HOYB 3K5NA 2QDBA 5G3LD 1JWUD 3GTLB 5C4XB 2B39A 4XQJA 3GTMB 1B4OA 1NUCA 3I4NB 3LWUA 4OO1I 1DD2A 2R92B 2E2IB 2K01A 4DNTB 3TP8A 2R7ZB 4DXGA 3MXNA 1WTXA 4J1MA 3VR3A 4PNYA 1LTID 2N88A 4KN4C 1IHZA 3TMEA 1RODA 4Q5VA 1Q8IA 2F0LA 2K28A 4OO1G 3OWEB 2CQAA 3I73A 1PXUA 1LTTD 4R8IA 2Q8RE 2F0FA 3KUPA 1HTLD 2K5DA 5BN3A 2SNMA 3BS1A 4DAYA 5IOCA 3T56B 2O2LD 3FPUB 1D5MC 1JQYD 1PTOF 2F03A 1KDAA 4KK7A 4M1UB 1XX8A 3DMUA 1TY0A 2G9HD 1SMYC 1VF7A 1OO9B 4GZYC 1PTOB 4CJ2C 4KMUC 1H9RA 1DJRD 3VYSA 2B2UA 2A6HD 2EY5A 1H9SB 1BNZA 1HA5A 5I2XA 1EOTA 1F2YA 2MP1A 3OOCA 1HCZA 3QG1A 4LK1C 3V05A 3DWAA 3X3MA 1TQOA 1EQTA 3MXGA 2RDGA 1HFGA 1A3VA 1B44D 1SE3A 5CV7A 1RHPA 4RGOS 3V2TA 4DFAA 4ZUIA 3SXHA 2OEOA 2C9OA 3ONAB 5M5YB 3CHBD 2K32A 4ZK9B 4PMBA 1PRTD 2EYLA 2WP8J 3A7AB 2HCCA 1I6VC 3MC0B 3EA6A 2NYZD 2M2LA 3BDCA 1Y69U 4F88A 1STAA 1TR5A 5EQ0A 3RMHA 4ME5A 1RKNA 4K14A 1EWHA 2WIIB 2Z1CA 5BN5A 4A3GB 1EYDA 2CW0C 3VR5A 3VYUA 5CV8A 1B3AA 3ND9A 1SYDA 5C44B 2R61A 2VXWA 3PUZA 3TDQA 1D5XC 2E76C 5T1IA 2YU9B 1AN8A 4WRDA 2NTSA 3TSSA 1TS3A 2B2VA 4FXDA 2K5WA 5IT9L 5I2YA 4FXKC 1HQRD 2NWGA 2SEBD 5EGTA 4BA1I 1SJED 1SYCA 2MJ8A 5C4ZA 3CQZB 5CV6A 1QB5D 4DNRB 5KNDA 4MN3A 4C3JB 4RFBA 1S4ZA 5A35A 1HRJA 3TZDA 4L6TB 1KDCA 3K57A 1BDOA 3K58A 3S1QB 1CHQD 4LAAA 4DAPA 3SR1A 1TS2A 5CGKA 3FVQA 5ELDA 1O80A 5IIFA 4IFDH 3IAYA 5HGTA 2TMPA 4IUVA 4DF7A 3H94A 1K83B 1D1IA 3R8BA 5M3FB 5IGGA 5I9OA 1SNCA 1DOKA 1JICA 3S14B 1F77A 1SE4A 3ZYYX 1JCKB 1LO5D 1CT1D 5JAVA 3I8ZA 1NCVA 5LL6S 1VMPA 2FJ2A 3FDTA 2A68C 2V4DA 1B9MA 1V1PA 5JJZA 2PZWA 4RGNA 1QNKA 3GQBA 1RTOA 3HP3A 4FF3A 3MAQA 3MHBA 5EJWA 2BA1A 1GUGA 3QWNA 4UAIA 4KV6A 4HSVA 3T16A 4FYDA 1LTRD 1TS4A 2WB1B 1PZID 4WORA 2IX0A 4A3BB 5I6WA 5EPKA 2JXMB 4X3SA 4BY1B 3DEOA 4XQQA 1TIID 4DU9A 5C0XH 1MSGA 1IKMA 3NK9A 1E2VA 1ESRA 4EQNA 4TSSA 4RHSA 3CKIB 3M4YA 4QB4A 2L55A 5I9PA 3K7AB 2FHTA 5COYA 2JP1A 2BDNA 1YNJD 1D5ZC 4RGMA 1STGA 2JSOA 1LTGD 4KHVA 4EQOA 1Y1VB 2F0VA 1B1ZA 2X6LA 2PQEA 1SYEA 4Y7NB 1KTKA 2EY6A 1BR9A 2HUGA 3NTKA 1HUMA 3DHQA 1Y8NB 1LTAD 3M7GA 2AQ1B 3NE5B 2KVMA 2LY7A 2KA7A 1JC7A 3EROA 3TZUA 3S1NB 5ELFA 5C3XA 3KBGA 3BZDB 5CV5A 3PUVA 3SK8A 5D65A 1BXTA 1ML0D 3MWYW 3OW7A 1SNOA 2JA6B 4IUQA 4C3JG 1EY4A 3OMCA 1FNUA 3SK5A 1SAPA 4BA2I 2EYOA 1LABA 1R4PB 3OHXC 5J1ZA 1GUWA 4UDUC 2F0TA 2HDLA 4O42A 1KLGD 1RDPD 4G7HC 2PNRC 2XWBB 3BYTB 1Z7TA 3M4OB 4H44C 3P20A 4OO1H 2F0SA 1LTBD 4NDXA 1I3QB 5IODA 1STHA 1HA6A 1PFMA 4EQPA 1ZYRC 4MHEA 4ODGA 2DY8A 2EY2A 1KNAA 4H7BA 1H9KA 4ILWA 2RA4A 4ID6A 5J39A 4K8IA 3K6OA 2KEDA 4OGQC 3HOWB 3UI2A 1GUOA 2H1EA 3AU7A 5EKIA 1A15A 4C3IG 3I3CA 1SNQA 2YYZA 2Z4HA 1HFNA 2Q8IB 3DM1A 3EJIA 2PCFB 2QKIC 3BDOA 4DK1A 1TVXA 2J7ZA 5C5MA 3I4MB 4RKLA 3T53B 2RQXA 2BCOA 5FLXE 3Q22A 1LT6D 3M3YB 4V190 2GA4B 2XVSA 1U4RA 3VA7A 2KEEA 3D31A 1V1PB 1DOLA 1JR0D 2I07B 1CFMA 3GTJB 5IGBA 5E4XA 2PZUA 4OL7A 2VUMB 5A2QL 1TT2A 1G8ZD 1E2WA 1OXVA 3X3NA 4KI0A 3HOXB 3RZDB 1CA6A 3R2TA 1PTOC 1O78A 2D62A 3R3OA 2RDHA 5JEAJ 4FF4A 1SJHD 3HG9A 4CGYB 5DM63 5CORA 3TN2A 1Z6HA 3PIO3 1F2ZA 4RHRA 5JVH3 2C5CA 4BY7B 3NBHA 4Q0FA 3M7NA 3ERQA 1QOHA 4K5XA 5ISRA 2PW5A 1J8IA 3FMCA 2PW7A 3C1FA 1JWMD 2XRQD 1Y8PB 5ELCA 3S2DB 2IWHA 1SMYD 2QILA 4IUPA 3NQIA 4ZQ3A 5E3FA 4IURA 3PO2B 3QOLA 4KKSA 1ENAA 4RCOA 4HR7B 2EVBA 1GUSA 1G91A 3EFXD 4C1NK 3OSOA 2WINB 4K2LA 2L0CA 1OXTA 5KGUA 1EY5A 3EQLC 1WVLA 1SSOA 4LJZC 2B2YC 2NVQB 1EZ6A 4TRDA 1BCPC 1W6KA 1DCZA 1LTSD 4QF4A 5D14A 1QWYA 3I72A 4A3MB 3H6MA 2AQ3B 5JPMC 2JEAI 4XTCS 1EY8A 2L5TA 1AFPA 2AWOA 1STEA 2XIWA 1F2MA 3MA2B 4ZLTF 2F0DA 1JWSD 2JA8B 2LS01 1AZPA 2EYJA 3N6RA 1QNUA 2F0WA 1NSNS 2JE6I 3U9OA 1ET6A 1TKWB 3MEHA 1T5XD 2F0OA 2CW0D 2ZT9C 4KKUA 5G3LF 1SXTA 5FO8B 1LV9A 1CHPD 4TKOB 1OXSC 1B9NA 2XRSD 3OIQA 1UEAB 2XSCA 1SEBD 1O7LA 1PZJD 5LHY1 3MFGA 1F2LA 4RGTA 5C5LA 3FKIB 4C3HG 1JORA 2EJFC 3L3OC 2QCPX 4ZKBB 2F1MA 1BO0A 2IW3A 2DN8A 5DEHA 3J80E 1S5ED 1F9PA 2ID0A 2O5IC 2ZXOA 1WCMB 3E6ZX 2PO4A 3Q24A 1MGSA 3HOVB 1E2ZA 4J8QA 3IKJA 4V0BA 3SE0A 4H13C 2B2WC 2NN6I 4HN7A 5FK9C 1X3QA 1HTPA 3G7LA 3VYRA 3NSWA 1RJTA 4KD3A 3RZOB 2ICIA 1B2TA 1PYWD 5M9OA 1A2UA 3IFDA 2D9UA 2RSOA 3D4WA 2K5QA 1ILPA 3NXWA 3SDZA 1HHVA 3TBIB 2WKCA 2NN6G 1MSHA 1SNDA 4IUTA 4FVMA 5D3DA 1S5DD 5IGEA 2IT1A 2VB3X 1IL8A 1SYBA 1V8QA 3NTIA 3CU7A 1TWGB 1TWHB 1B53A 2SOBA 2A68D 1C4QA 3DXJC 3PO3B 5LL6X 2OF1A 3GV3A 2XWJB 1ILQA 3DUZA 1GXDC 5CYUA 3LWEA 3WOFA 2SDFA 1IYUA 1RD9D 4PMCA 4G7ZC 4IQZA 1Q1EA 3A54A 1C48A 4XYQA 1WD1A 1TS5A 2HQEA 3IFTA 1VCIA 4NP5A 4QIWB 5AFWA 1PRTF 1A2TA 4KJNA 3A8JE 3D3RA 1SDFA 4RH6A 4JBWA 5JPNC 5C6AA 3AB9A 2B63B 4JK1C 4DAVA 1BBXC 3KLRA 1F9RA 3A55A 1PRTB 4RWSC 2F3WA 4KY6A 3K5LA 4RA8A 1EY6A 2IPKD 1CA5A 1UUPA 3C1EA 2ZXPA 1MI2A 3PMFA 1EZ8A 1LACA 4KHZA 1V43A 1S5BD 1KLUD 3NWSA 4XXEA 3SK4A 4PMWA 3P1HA 4IFDJ 2B2VC 3H0GB 5K36G 3BG3A 2KUMA 2EYMA 3DWPA 1WTVA 1SYFA 1R9TB 2PYKA 2L11A 2L12A 3HOZB 3L7ZC 3QB3A 5KYIA 5FO7B 3E0JA 2O4XA 4B9WA 2LKVA 1BUVT 2B2TC 1EYAA 1EEID 2D5DA 3HKZB 1JOQA 2A6EC 1H9MA 4ULLA 5C3EB 1M4VA 4U68A 1UAPA 1ENCA 2BA0A 3QIAA 2M9VA 3RLFA 2WACA 5FOBB 3T13A 3EVQA 3SHLA 1IYVA 1ET9A 1MBYA 1C8CA 1B50A 1YNNC 3BVGA 5NUCA 3T51B 5EKKA 1KAAA 3GTOB 2IJ0A 1JOKA 3NWTA 2NZ1D 4K6LA 2OT2A 1QILA 4HAEA 1TWAB 1IW7C 2LMCB 2F3VA 3J81E 5C0XJ 1GJXA 5IGCA 2EJMA 3OMGA 1TWFB 3T4AC 3S15B 2WV6D 1EYCA 1ZYRD 1HUNA 2FMCA 1PZKD 1A3UA 3KK7A 1XTCD 2K04A 5J22A 2JEBI 3QO2A 1LT3D 1Q90A 4FXGC 1LT5D 4XQNA 1HPCA 3H3VC 1EQVA 4A3EB 1GUNA 4CKBA 1H9SA 2FINB 4XIGS 1VF5C 3BYYB 4F87A 4CJ1B 3S17B 2EOTA 5IGFA 2PPBC 3FPPA 5K5PA 4ZAIA 4IUNA 5IGDA 5D3IB 3D6WA 4O1NA 1ZKOA 2A73B 5CV9A 3D8GA 1ONLA 1G6ZA 1HQMC 3NP8A 3K5MA 4G57A 2F0NA 4FO2A 3KLSX 3GTPB 1NAPA 1BOSA 1SNMA 2MGSA 1XWEA 2BE5C 3P7JA 3MFYA 2HDMA 1LT4D 3KLSA 1WTRA 1AW7A 4Z9CB 4N9PA 3K59A 2F0HA 1SBBB 1Q3LA 2PMZB 1IKLA 3A56A 2E2DC 1M8AA 4A3DB 4F7XA 4B9XA 2RKSA 4J6HA 1DOMA 3S9WA 1ZXTA 2EE1A 5F2DA 2XN9C 3KF8A 1E0BA 5ELBA 1DYQA 3TP7A 4K8JA 2DY7A 3IL8A 1FNVA 4QMGA 5FLXL 1SFOB 1D6EC 1EWCA 3JAML 1K8MA 1S5CD 4KTAA 4NW2A 1A6XA 1DZ1A 3OWFA 1AEXA 2A74C 2KHSA 1WD0A 1H9JA 1DONA 3I91A 2AUJD 1CQVA 2IL8A 4HEDA 1U4PA 1FNWA 1GOZA 4HCSA 2K03A 4I65A 3WOEA 3VYTA 5HURA 2OXPA 4XT1B 3GD7A 1EIGA 3Q6SA 5ELEA 4H0LC 3MZ5A 4RCNA 2RSNA 5CMDA 4HTHA 4G4KA 5EPLA 4ZRZA 3MXPA 2WKDA 4CJ0B 2A69C 1ZEQX 1I4HA 5CR3A 1D2BA 2RDFA 1BQQT 3GP7A 1FR3A 3J7AV 1Q12A 3C3LA 2F0KA 5KNCA 4ZUJA 4ZYSA 1FGBD 3NPPA 3C2PA 1AP0A 1BCPD 1EU4A 2M00A 2B8GA 1SNPA 3S16B 4I7ZC 2XNAC 2NN6H 3FEWX 2ZXRA 2KCCA 2J4XA 3VR2A 4BWGB 4EVOA 3GTQB 1I4XA 3GTKB 2K1BA 4WJWA 2K33A 4C2MB 1EFID 1U4LA 1PLFA 5DNFA 4LMQD 2B2WA 5JEAG 2CHBD 3OPOA 4U673 3K5OA 4HMJA 1PTOH 1MD2D 5KNBA 2QF7A 2MPMA 3GO5A 1JB3A 3VR6A 3HS0C 3S1RB 1DM0B 2K7VA 4TQUS 1STNA 1GUTA 3DEPA 4G7OC 4AYBB 1NR2A 1L0XB 3CRKC 5I4DA 5BN4A 3E5SA 2SNSA 4B08A 1F9QA 3H09A 3H91A 2EDGA 3A7LA 3Q0AA 2K05A 3TP6A 3PUXA 2IX1A 4ABNA 2F0GA 5CBEE 1CZGA 5CV4A 2MHVA 4DA2A 3I70A 4HCEA 2DNCA 2A6HC 4XT3B 4FP5D 2K6AA 5FO9B 4HMIA 4IZ8A 3PUYA 1XYIA 3D6CA 1QJOA 4DK0A 3GV6A 1ENFA 1EY7A 1EIHA 5DAUA 2EXZA 2B8FA 4QUFA 2TSSA 1QCBD 2NBFA 4A3FB 5K36H 3RD4A 1STYA 3BVMA 4R9WA 2MUYA 5M3MB 3J80L 3QJYA 1G2SA 2BOSA 1XXGA 3N52A 1BCPF 1ESFA 1JE4A 1BF4A 1PRTC 4XYOA 2G9DA 4K5VA 1OXUA 4N9TA 4QUCA 2H4OA 3V96A 2X6GA 3HZXA 5IT9E 1BCPB 1CI3M 3VR4A 2F0EA 2HCIA 4KN7C 2B2UC 4BBSB 2VB2X 3HRZC 2LFNA 1EU3A 3NUCA 3DWQA 3A8KE 5E4WC 2NVTB 1L0YB 1I4GA 2FFKB 4NKLA 3NHHA 1STBA 1LLRD 1U4MA 2Y0SB 1ICWA 2EYPA 1KDBA 2F0MA 5EBDA 2L9HA 1I6HB 2B2TA 3C46A 2KOLA 2AWNA 3TP5A 1PMRA 3WDNA 5M5XB 4MIUA 2JA5B 2L1BA 4CKCA 4KY7A 5JVG3 4KJOA 4A3KB 2Z8LA 2F0UA 3S2HB 4IN3A 4FF1A 2F0QA 3PIP3 1WTQA 3QOJA 4HSPA 1CZWA 1S5FD 2CVRA 3ND8A 1SE2A 2EYHA 1QG7A 1X3PA 2WAQB 4DXFA 4P2CB 3SVMA 3HOUB 3BDLA 3NQTA 4C56C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RHR A;  1XXG A;  1CHQ D;  1LT3 D;  1RF2 D;  1TS2 A;  1JWS D;  1PRT D;  1LTG D;  2CHB D;  1BCP F;  1LT5 D;  1TY2 A;  5ELD A;  1CQV A;  1ESF A;  4OHJ A;  3OWE B;  1B1Z A;  1CK1 A;  1V1O A;  1PRT C;  5D3D A;  3MC0 B;  1S5D D;  1FNW A;  3EA6 A;  1LTT D;  1PTO H;  1ET6 A;  1GOZ A;  1KTK A;  1MD2 D;  1I4R A;  3R2I A;  3R8B A;  1LTA D;  1T5X D;  1HTL D;  2AQ1 B;  3BYY B;  3DWP A;  3SEB A;  1BCP B;  1RCV D;  1SXT A;  2O2L D;  1F77 A;  1SE4 A;  5ELE A;  1D5M C;  1JQY D;  1CHP D;  1JCK B;  1LO5 D;  1CT1 D;  1PTO F;  5D3I B;  4O1N A;  2NTT A;  2XRS D;  5ELF A;  1JWM D;  2XRQ D;  1EEI D;  5ELC A;  3BZD B;  1L0X B;  2R61 A;  1EU3 A;  1UNS A;  1V1P A;  2QIL A;  3DWQ A;  5I4D A;  1TY0 A;  4RGN A;  2G9H D;  1SEB D;  3KLS X;  1L0Y B;  1PZJ D;  1BXT A;  3W2D A;  1I4G A;  3MFG A;  4RGT A;  1LT6 D;  1D5X C;  1I4H A;  1LLR D;  1M4V A;  1RD9 D;  1PTO B;  1EEF D;  3URY A;  1FNU A;  4L63 B;  4RCO A;  2QEJ C;  1LT4 D;  1TS5 A;  1I4Q A;  1AN8 A;  1DJR D;  3GP7 A;  1AW7 A;  1I4P A;  2NTS A;  3EFX D;  3TSS A;  1ET9 A;  1S5E D;  4Z9C B;  1TS3 A;  1V1P B;  1SBB B;  1HA5 A;  3BVG A;  4UDU C;  1JR0 D;  1LTR D;  1PRT F;  5TSS A;  1KLG D;  1TS4 A;  3BVZ A;  2IJ0 A;  1HQR D;  4RH6 A;  2SEB D;  1PZI D;  4ZYS A;  1FGB D;  4K6L A;  1RDP D;  1G8Z D;  1QIL A;  1JWU D;  3V05 A;  3DWA A;  1BCP D;  3BYT B;  3R2T A;  1EU4 A;  1ENF A;  1SJE D;  2RDG A;  1PTO C;  2Z8L A;  1B44 D;  1SE3 A;  1BCP C;  2XN9 C;  4TSS A;  1LTS D;  4RHS A;  1PRT B;  2WV6 D;  5ELB A;  1DYQ A;  4RGO S;  2RDH A;  2TSS A;  5FK9 C;  1FNV A;  2XNA C;  1HXY D;  1SJH D;  2IPK D;  1D6E C;  1EWC A;  4RFB A;  1UUP A;  2AQ2 B;  1LTB D;  4DXG A;  2J4X A;  1S5F D;  5FKA C;  2AQ3 B;  1PZK D;  4BWG B;  4C56 C;  1SE2 A;  3BVM A;  1I4X A;  3O13 A;  2ICI A;  1D5Z C;  1FD7 D;  1XTC D;  4DXF A;  4RGM A;  1S5C D;  1PYW D;  1PTO D;  1STE A;  1LTI D;  1EFI D;  3CHB D;  4L6T B;  1S5B D;  1KLU D; 
#chains in the Genus database with same CATH topology
 4K5W A;  3Q23 A;  2ICE C;  4YHH Q;  4OX9 L;  1CK1 A;  1E22 A;  3AYH B;  1I5F A;  3BZC A;  1KAW A;  2B63 H;  4IAL A;  5LMU Q;  2O5J C;  5I6Y A;  1T5E A;  1EY0 A;  5CC4 A;  4RKB A;  5KYL A;  3SEB A;  3J80 c;  2KJX A;  3A0J A;  4JPB W;  4S3S A;  2NB0 A;  3STB C;  4DGZ A;  4YCW A;  1O7Y A;  1EY9 A;  2KEC A;  1RCV D;  3K8A A;  4X3K A;  5DM7 3;  1PDQ A;  4A3B H;  2Q8T A;  4BBR B;  4GKK Q;  2A6E D;  2D0P A;  4FDB A;  4C3I B;  2K50 A;  1UNS A;  4YIJ A;  4BY1 H;  3W1G A;  2ENB A;  2X69 A;  4WFN 3;  4IPC A;  2J0T D;  2F4I A;  3E0E A;  4ZCK A;  1VMC A;  3I4L A;  1CKM A;  1WCM G;  2HIX A;  2L4N A;  3H0G H;  4GOP C;  4JI4 L;  1TWC B;  5C4J B;  1VQC A;  2F0I A;  4HJ9 A;  1YNN D;  1D1K A;  2AUK A;  3HOV G;  1Z47 A;  4QCL A;  1O7Z A;  2A8V A;  1WTP A;  1IBM L;  4E6I A;  3HOZ H;  4B3M Q;  4HJ8 A;  2EYF A;  1A3T A;  2Z4I A;  2KCM A;  1TU2 B;  5KIX A;  1E3P A;  2EY1 A;  1IW7 D;  1K8O A;  1Y1V H;  1SRO A;  3OIP A;  3PV0 A;  4PZ8 A;  1Q1B A;  1W6J A;  3I56 A;  3HGB A;  4K6D A;  2UUA Q;  4OIJ A;  4A93 B;  3PQI A;  4BXX H;  1CM9 A;  2XTI A;  5CBA E;  1AZQ A;  1VS0 A;  5KRU A;  1GVP A;  1DXM A;  1Y8O B;  5C3E H;  1QE6 A;  4DR2 L;  4DN4 M;  4XDX A;  4R4C A;  2E74 C;  4OIK A;  3M85 A;  1I50 B;  2A19 A;  5JOB A;  1HR0 L;  3GTG B;  4OWT B;  2N49 A;  3RUZ A;  3G4S A;  3K0Y A;  2HQL A;  3LNN A;  3J7A F;  4BBS G;  4IOA A;  3K7U C;  4R4T A;  1Q46 A;  2E2J B;  1FD7 D;  4A3I B;  1YNJ C;  3D4D A;  4IFD I;  3U9S A;  3MVV A;  3GTO H;  1RF2 D;  2OQ0 A;  4DR4 Q;  1EFW A;  2OCE A;  1V1O A;  2I46 A;  5EKL A;  2JA6 H;  4X3T A;  3P75 A;  2A5H A;  1I4R A;  2PZT A;  3W3A A;  1KNE A;  3J81 L;  3CW2 C;  2E2H B;  3T1Y Q;  3G6E A;  1CKN A;  1X32 A;  1RTN A;  1G29 1;  4POG A;  5C4H A;  4CBV A;  1CTM A;  2NUC A;  1SYG A;  2HHH Q;  1VQJ A;  1R4Q B;  4PQX A;  5M5W B;  4IFD G;  3ULL A;  3I7F A;  1VQI A;  1J9O A;  4AYB E;  4JI8 L;  3U58 A;  4K2K A;  5KEE A;  4A3K G;  2UU9 Q;  1N33 L;  2N55 A;  3CRL C;  2KCT A;  3W2D A;  3E9H A;  4KD4 A;  2BE5 D;  1WTO A;  1VQN A;  5E1F A;  3I55 A;  4JI0 Q;  4DR7 Q;  1WTW A;  1EEF D;  2KCN A;  2CH4 A;  3NBI A;  4RMF A;  2BDO A;  5EPJ A;  4JI3 L;  1GKH A;  1I3Q H;  5IYD G;  4ZKC B;  1NE3 A;  3MXU A;  2B63 G;  3ICE A;  1VDZ A;  1N36 L;  3KBX A;  2F0P A;  3S1M B;  2LXJ A;  3BVZ A;  3J7Y W;  3FRP B;  3LX0 A;  5C0X I;  1QVC A;  1NR4 A;  4NMZ A;  3R93 A;  1ASY A;  4NXN Q;  3MTS A;  1L2F A;  4BS9 A;  2DUD A;  4LFA Q;  1JOO A;  4DV3 L;  4FNF A;  2I0Q A;  2R6G A;  3E9I A;  4O0A A;  1CSQ A;  2Z6K C;  4FF2 A;  4DV4 L;  4L8J A;  5JEA H;  1FYC A;  1JB7 A;  1HXY D;  5E7N A;  1QVG A;  1L1O A;  2AQ2 B;  2AHO B;  5FKA C;  4CKE A;  1HNW Q;  4C56 C;  1EL0 A;  4IPG A;  4BBR G;  4EGV A;  3G6J B;  1KAB A;  3O13 A;  1GHJ A;  5C0X G;  1YJ9 A;  5T1G A;  2R93 B;  1PTO D;  2QDL A;  4F8M A;  1GHK A;  4A3C G;  2DNE A;  2NZH A;  3NTH A;  4DK3 C;  2B3G A;  4C1N I;  4JW0 A;  4KY5 A;  1TY2 A;  1KC8 C;  4OHJ A;  4JYA L;  2FMM A;  1QUQ B;  3F2U A;  4QQB X;  3SK6 A;  3KJO A;  4X3U A;  3M3Y H;  3R2I A;  2D2C C;  1IZ6 A;  1XMQ Q;  1II3 A;  4R1J A;  2EZV A;  1OXX K;  3AMU A;  2IX3 A;  4KKT A;  2XGT A;  3VA5 A;  4IUU A;  2RVL A;  3JAM E;  4DV0 L;  2RBM A;  5IYC H;  2NVX B;  2E75 C;  2B2Y A;  2R3Z A;  5A2Q E;  1CQF A;  5FJ8 G;  3ITP A;  1PFN A;  4A3J B;  1YZ6 A;  5GAG C;  2G5D A;  2NTT A;  4H02 A;  1F9S A;  3I90 A;  5GAD C;  1Y1W B;  2VUM H;  2JA9 A;  4JG2 A;  3KJP A;  5EBC A;  3BU2 A;  4LF4 Q;  1IBL L;  3HEJ A;  3RZD H;  2A69 D;  3RNU A;  1I94 Q;  1JMC A;  3D4R A;  1PFB A;  4R8N A;  4DV7 L;  3PUW A;  1P8L A;  2KQ3 A;  2UXC Q;  1EOV A;  1U9R A;  2Y0S E;  3RR5 A;  3URY A;  4CHT B;  1G2T A;  4L63 B;  4GNX A;  3T1H L;  2EJG C;  2QEJ C;  2VNU D;  1I4Q A;  2NVY B;  2F0J A;  2ZJP A;  1I4P A;  2EPB A;  3L9A X;  3A8I E;  4RAU C;  4JI7 Q;  4C3H B;  2CFM A;  5C3W A;  2JYO A;  4M8A A;  5TSS A;  2JA7 B;  4PV1 C;  3HOY B;  1GM5 A;  3K5N A;  2QDB A;  1XMO Q;  5G3L D;  3NEN A;  4X64 L;  3HFZ B;  1JWU D;  3GTL B;  5C4X B;  4BY7 H;  2B39 A;  4XQJ A;  3GTM B;  1B4O A;  4IJL A;  1SLJ A;  4IPD A;  1NUC A;  3I4N B;  3LWU A;  4OO1 I;  1DD2 A;  2R92 B;  4LF6 Q;  2E2I B;  2K01 A;  2MO1 A;  4DNT B;  3TP8 A;  3S24 A;  2R7Z B;  4DXG A;  3WWV A;  1JJG A;  1VQ9 A;  1AE2 A;  3MXN A;  1HJP A;  4A3E G;  2WAQ E;  1WTX A;  4JI5 Q;  3CAM A;  4J1M A;  3VR3 A;  4PNY A;  1LTI D;  2N88 A;  4KN4 C;  1IHZ A;  3S2D H;  3TME A;  1ROD A;  4OEM B;  4Q5V A;  1Q8I A;  2F0L A;  2K28 A;  4OO1 G;  4X62 L;  3OWE B;  2CQA A;  1Q8K A;  3I73 A;  1PXU A;  1HZC A;  1LTT D;  2UXD Q;  4R8I A;  2Q8R E;  1S40 A;  2F0F A;  3KUP A;  1HTL D;  2K5D A;  5BN3 A;  1S72 A;  2SNM A;  3BS1 A;  4DAY A;  2I5L X;  5IOC A;  4WJ4 A;  3T56 B;  2O2L D;  3FPU B;  1D5M C;  1JQY D;  1PTO F;  2K5V A;  2WFW A;  4L5Q A;  3GTQ H;  2F03 A;  1J5E L;  1KDA A;  5FLX c;  4KK7 A;  4M1U B;  4JI2 Q;  1XX8 A;  2IHE A;  3DMU A;  1TY0 A;  2G9H D;  2NVQ H;  1X3E A;  1SMY C;  4YWK A;  1VF7 A;  3L2P A;  2IHF A;  4A75 A;  1OO9 B;  5L37 A;  4GZY C;  1PTO B;  4CJ2 C;  4OON A;  2I5H A;  4A3D G;  4KMU C;  4JOI A;  1H9R A;  1DJR D;  3VYS A;  2B2U A;  2A6H D;  2EY5 A;  1XTD A;  1H9S B;  1BNZ A;  1HA5 A;  5I2X A;  1EOT A;  4JCV E;  4JI4 Q;  1F2Y A;  3SGI A;  2MP1 A;  2LSS A;  3OOC A;  4UPA A;  1BVS A;  1HCZ A;  3KF6 A;  1N9W A;  3QG1 A;  4LK1 C;  3V05 A;  3DWA A;  3X3M A;  1TQO A;  1EQT A;  1X65 A;  3MXG A;  1XNR L;  2RDG A;  4I7A A;  1HFG A;  1A3V A;  1KXL A;  1B44 D;  1SE3 A;  5CV7 A;  1EQR A;  1RHP A;  4RGO S;  3V2T A;  4DFA A;  4ZUI A;  3SXH A;  1S3O A;  1N8R C;  5JJK A;  1Y1W G;  2OEO A;  3EN2 A;  4JV5 L;  2C9O A;  3ONA B;  4DR2 Q;  1FL0 A;  5M5Y B;  3CHB D;  2K32 A;  4ZK9 B;  4PMB A;  4AIM A;  1PRT D;  1EIF A;  2EYL A;  1W3S A;  2WP8 J;  1HH2 P;  4GN4 B;  3A7A B;  1A8V A;  5IP9 H;  2HCC A;  1I6V C;  1TXY A;  1HR0 W;  3MC0 B;  4DAM A;  2R7D A;  3EA6 A;  1Q7Y C;  2NYZ D;  4MNO A;  2M2L A;  3BDC A;  1Y69 U;  4F88 A;  1STA A;  1TR5 A;  5EQ0 A;  3RMH A;  4ME5 A;  1RKN A;  1PVO A;  4K14 A;  1EWH A;  1PYB A;  2WII B;  4AH6 A;  2Z1C A;  3HOY G;  2RHS B;  3PIO A;  5BN5 A;  1ICF B;  2VY3 A;  1WCM H;  4A3G B;  4UY8 C;  3KF8 B;  1EYD A;  2CW0 C;  3VR5 A;  2F4V L;  3VYU A;  2EIF A;  1T9H A;  5CV8 A;  5GRO A;  1B3A A;  3ND9 A;  1SYD A;  4UP8 A;  5C44 B;  3HOV H;  2ZTD A;  2R61 A;  4POF A;  4DV1 L;  2VXW A;  2R92 G;  2KHJ A;  3EBE A;  3PUZ A;  3TDQ A;  1D5X C;  2E76 C;  5T1I A;  4JI8 Q;  3UDI A;  2YU9 B;  4IPH A;  1AN8 A;  4WRD A;  2NTS A;  3RZO H;  3TSS A;  1TS3 A;  2B2V A;  4FXD A;  1KIX A;  2K5W A;  5IT9 L;  5I2Y A;  4FXK C;  1HQR D;  2NWG A;  2QW7 A;  4JI3 Q;  2SEB D;  2L15 A;  1PH4 A;  5EGT A;  1VQH A;  4BA1 I;  3F2D A;  4BBS H;  4GOP A;  2K75 A;  3K0X A;  1SJE D;  1SYC A;  2C35 B;  1K9M C;  2MJ8 A;  5C4Z A;  3CQZ B;  2NVT H;  5CV6 A;  2KHI A;  1QB5 D;  4DNR B;  5KND A;  1XJV A;  1Q82 C;  4DV3 Q;  4MN3 A;  4C3J B;  4RFB A;  1N34 L;  2N78 A;  1S4Z A;  5A35 A;  1NJI C;  1UE1 A;  1HRJ A;  1TWG H;  1U0L A;  1TWH H;  4DV4 Q;  1K73 C;  1BBU A;  1I6H H;  2ASB A;  3TZD A;  1B70 B;  4L6T B;  1KDC A;  5IWA L;  3K57 A;  1BDO A;  3K58 A;  4JI6 L;  4X6A H;  4N8F A;  3JAM i;  1CHQ D;  3S1Q B;  4DV5 L;  4LAA A;  4DAP A;  3KFU A;  3SR1 A;  1TS2 A;  5CGK A;  3FVQ A;  4IO9 A;  5ELD A;  3TRE A;  1O80 A;  5IIF A;  4IFD H;  3K80 C;  3IAY A;  2RCF A;  5HGT A;  2F52 A;  2TMP A;  4IUV A;  4DF7 A;  3H94 A;  1X6O A;  1K83 B;  2ZTC A;  1D1I A;  3R8B A;  5M3F B;  4A3K H;  1G51 A;  3STB D;  5IGG A;  5I9O A;  4JYA Q;  1SNC A;  1DOK A;  4LFC L;  3CCS A;  1LYL A;  1JIC A;  5IP7 G;  3S14 B;  1F77 A;  1SE4 A;  3ZYY X;  2YV5 A;  1JCK B;  1LO5 D;  1CT1 D;  5JAV A;  2FXQ A;  1PH8 A;  3AFP A;  4P73 A;  3I8Z A;  1NCV A;  5LL6 S;  1VMP A;  3M4Q A;  2FJ2 A;  3FDT A;  5IYD H;  1YBY A;  3HOU H;  2A68 C;  2V4D A;  1B9M A;  1P16 A;  1V1P A;  5JJZ A;  2PZW A;  4RGN A;  1AH9 A;  1QNK A;  1SR3 A;  3GQB A;  1RTO A;  4NXM L;  4DAY B;  1IBL Q;  3HP3 A;  4FF3 A;  3MAQ A;  4CDC C;  3MHB A;  5EJW A;  3KOJ A;  2BA1 A;  1GUG A;  4X65 Q;  3QWN A;  5IP9 G;  4DV7 Q;  4UAI A;  2R7F A;  4O2D A;  1BBW A;  4KV6 A;  4HSV A;  3T16 A;  4FYD A;  5J3B A;  1LTR D;  2AKW B;  3T1H Q;  1CSP A;  1TS4 A;  2WB1 B;  1PZI D;  4WOR A;  2IX0 A;  1YJN A;  4A3B B;  5I6W A;  5GAE C;  5EPK A;  3M9B A;  2JXM B;  4BBR H;  4X3S A;  4BY1 B;  3DEO A;  4XQQ A;  1TII D;  4DU9 A;  5C0X H;  2UUC L;  4K0K L;  4A3F G;  1MSG A;  1IKM A;  3NK9 A;  4A3C H;  1E2V A;  2UXB Q;  1ESR A;  4EQN A;  5M3M G;  4TSS A;  4RHS A;  2MFI A;  3CKI B;  2CWP A;  4X64 Q;  3M4Y A;  3A5U A;  4QB4 A;  2L55 A;  1R9T H;  3UDF A;  5I9P A;  1TWC H;  2CQO A;  3K7A B;  2FHT A;  4LFB L;  5COY A;  4JC0 A;  2JP1 A;  2BDN A;  1YNJ D;  3CCM A;  1D5Z C;  4RGM A;  1D7Q A;  1STG A;  1WFQ A;  1UE7 A;  4DPG A;  2JSO A;  2Z6K A;  3ZJY C;  1VQK A;  1LTG D;  4KHV A;  4EQO A;  5FJ8 H;  1Y1V B;  2F0V A;  1PH2 A;  1B1Z A;  3ER0 A;  2X6L A;  2PQE A;  1EUJ A;  1SYE A;  4DUZ Q;  4Y7N B;  1KTK A;  3D0F A;  1QZH A;  2EY6 A;  1BR9 A;  4A93 H;  3NTK A;  2HUG A;  1HUM A;  3DHQ A;  1Y8N B;  1LTA D;  3M7G A;  2AQ1 B;  1MJE A;  3NE5 B;  2DJG C;  2KVM A;  2LY7 A;  3GTG H;  2KA7 A;  1JC7 A;  2VL6 A;  3ERO A;  2E5L Q;  4B3T L;  3TZU A;  3S1N B;  5ELF A;  2Y0S G;  5C3X A;  3KBG A;  1B3Q A;  5EAY A;  3BZD B;  5CV5 A;  1TWA H;  2JQO A;  1E1T A;  3PUV A;  3SK8 A;  4GN5 A;  5D65 A;  1BXT A;  1TWF H;  1ML0 D;  3MWY W;  1FJG Q;  3OW7 A;  1SNO A;  2JA6 B;  3S15 H;  4GKJ L;  4IUQ A;  1J5E Q;  4C3J G;  1EY4 A;  3OMC A;  4LF9 Q;  1FNU A;  1KL9 A;  3CC7 A;  1YEZ A;  3SK5 A;  1SAP A;  4BA2 I;  2ZTE A;  2EYO A;  2K14 A;  4DR5 L;  2JA5 G;  1LAB A;  1R4P B;  3CXC A;  2E2H H;  5AJ3 L;  3OHX C;  5J1Z A;  2QGQ A;  1GUW A;  4UDU C;  5DLQ E;  2F0T A;  4MZ9 A;  4GLA C;  2HDL A;  4O42 A;  4HJ7 A;  1KLG D;  5M5W H;  1RL2 A;  1RDP D;  4G7H C;  2PNR C;  4A3E H;  2XWB B;  3BYT B;  1PH5 A;  1Z7T A;  3M4O B;  1Z9F A;  2WAQ G;  4H44 C;  5ELN A;  3HOU G;  3P20 A;  4QL5 A;  4OO1 H;  2F0S A;  3S17 H;  1LTB D;  4QY7 A;  4NDX A;  1XNR Q;  3Q8D A;  3U4V A;  2VQE L;  1I3Q B;  1GO3 E;  5IOD A;  1STH A;  1HA6 A;  3AFQ A;  1PFM A;  4GOP B;  4EQP A;  1ZYR C;  4MHE A;  1LM0 A;  1K0S A;  4ODG A;  2DY8 A;  2EY2 A;  3S1M H;  4KHP Q;  1KNA A;  4H7B A;  4JV5 Q;  3GTP H;  1H9K A;  4ILW A;  2RA4 A;  4ID6 A;  1WOC A;  5J39 A;  3J80 i;  4K8I A;  1PH6 A;  3K6O A;  4Y52 H;  2KED A;  2YTX A;  4OGQ C;  3UI2 A;  2K5N A;  3HOW B;  2VZA A;  1GUO A;  1VQM A;  2GN5 A;  4DUY Q;  2H1E A;  3AU7 A;  5EKI A;  1A15 A;  4C3I G;  1HNX L;  3I3C A;  1SNQ A;  4DR6 L;  2YYZ A;  2WB1 G;  2Z4H A;  1HFN A;  2Q8I B;  2B29 A;  1UE6 A;  3DM1 A;  3EJI A;  1HNZ Q;  2PCF B;  2QKI C;  2MNA A;  3BDO A;  4A3D H;  1V1Q A;  5IE8 A;  4DK1 A;  1M1K C;  1TVX A;  4DR3 L;  3UE1 A;  2HT1 A;  2R93 H;  2J7Z A;  5C5M A;  2P5Z X;  2K52 A;  3I4M B;  4RKL A;  3T53 B;  3RN5 A;  4PG3 A;  5FLM G;  2RQX A;  2BCO A;  5FLX E;  4X66 L;  3Q22 A;  1LT6 D;  3M3Y B;  2Z6B A;  4V19 0;  2ES2 A;  2GA4 B;  2PQA A;  4JI1 L;  1SFO H;  4DV1 Q;  2XVS A;  1U4R A;  3VA7 A;  1NMF A;  2KEE A;  3D31 A;  1V1P B;  1DOL A;  1JR0 D;  2I07 B;  1CFM A;  4A93 G;  3GTJ B;  5IGB A;  3J7A 5;  5E4X A;  3J81 c;  2PZU A;  4OL7 A;  4GLX A;  2VUM B;  5A2Q L;  1TT2 A;  3QR8 A;  2Z9H A;  2EXD A;  1G8Z D;  1E2W A;  1OXV A;  3X3N A;  1Y1W H;  4LW1 A;  4KI0 A;  1HZA A;  3HOX B;  3RZD B;  1CA6 A;  3R2T A;  3PF5 A;  1PTO C;  1L0W A;  1O78 A;  2D62 A;  3R3O A;  1KQS A;  2RDH A;  5JEA J;  4A3I G;  4FF4 A;  1SJH D;  4YWM A;  1NY4 A;  4A4I A;  3HG9 A;  1Q86 C;  4CGY B;  5DM6 3;  2NVY H;  5COR A;  2N3S A;  4PZ6 A;  1FVI A;  3TN2 A;  1H95 A;  3OYY A;  1Z6H A;  4C3H H;  3PIO 3;  1F2Z A;  4RHR A;  1N34 Q;  5JVH 3;  3HOY H;  4OWW B;  3KDF A;  4GLV B;  2C5C A;  4BY7 B;  3NBH A;  4Q0F A;  3GTL H;  1X56 A;  1PYS B;  5IWA Q;  4JI6 Q;  1MHW C;  3GTM H;  3M7N A;  3ERQ A;  4DV5 Q;  1PH9 A;  2QA4 A;  1QOH A;  1J6Q A;  2R92 H;  4K5X A;  2MQH A;  4B3M L;  4HID A;  1C9O A;  5ISR A;  2PW5 A;  1J8I A;  3FMC A;  2PW7 A;  3C1F A;  1JWM D;  3OTO L;  2XRQ D;  1Y8P B;  4P72 A;  5ELC A;  4LFC Q;  3S2D B;  2IWH A;  1SMY D;  2QIL A;  4IUP A;  3NQI A;  4ZQ3 A;  4LWC A;  5E3F A;  4IUR A;  2CKZ B;  3PO2 B;  3S16 H;  3QOL A;  4KKS A;  1UE5 A;  1ENA A;  4OX9 Q;  1V9P A;  4RCO A;  4HR7 B;  1PA6 A;  1AE3 A;  2EVB A;  1GUS A;  1WYD A;  4GN3 B;  3W1B A;  1JE5 A;  1X3G A;  3EFX D;  1G91 A;  4C1N K;  3CCL A;  3OSO A;  3GTK H;  4A3L G;  2WIN B;  4C2M H;  4K2L A;  2L0C A;  1OXT A;  2WB1 E;  5KGU A;  2Q2T A;  1CKN B;  1EY5 A;  3EQL C;  1WVL A;  2DJF C;  1SSO A;  4LJZ C;  2B2Y C;  2NVQ B;  1EZ6 A;  5IYB G;  4TRD A;  1K8A C;  1BCP C;  1W6K A;  1DCZ A;  1LTS D;  2R93 G;  4QF4 A;  5D14 A;  1QWY A;  3I72 A;  3S1R H;  3H6M A;  4A3M B;  2HHH L;  2UUC Q;  4K0K Q;  2AQ3 B;  5JPM C;  1PFS A;  2JEA I;  2RHQ B;  4XTC S;  4CDD C;  1EY8 A;  2L5T A;  4DV6 L;  1AFP A;  2AWO A;  1STE A;  2UU9 L;  1N32 L;  2XIW A;  1NTG A;  1F2M A;  3MA2 B;  1IBM Q;  1D8L A;  4JBM A;  4ZLT F;  2F0D A;  1JWS D;  5IP7 H;  2JA8 B;  1GD7 A;  4DV2 L;  1EIY B;  4R4I A;  4JI0 L;  2LS0 1;  1AZP A;  2EYJ A;  2CCZ A;  3N6R A;  1PH3 A;  1QNU A;  2F0W A;  1NSN S;  2JE6 I;  3U9O A;  1YJW A;  1ET6 A;  4B3S L;  4A3J G;  1TKW B;  3MEH A;  1T5X D;  1W2B A;  3G71 A;  3U4Z A;  4NPS A;  2F0O A;  3CPW A;  2CW0 D;  2ZT9 C;  4KKU A;  5G3L F;  1SXT A;  4QJF A;  5FO8 B;  1LV9 A;  1CHP D;  1HR0 Q;  4TKO B;  1OXS C;  4NXN L;  3HOX G;  1B9N A;  2XRS D;  1SE8 A;  4LFA L;  3OIQ A;  1L1O B;  1UEA B;  3F8T A;  2XSC A;  1SEB D;  1YI2 A;  1O7L A;  1PZJ D;  2DGY A;  3CPF A;  5LHY 1;  3MFG A;  1F2L A;  4RGT A;  4RG1 A;  5C5L A;  3FKI B;  4B3T Q;  3CCE A;  1NMG A;  4C3H G;  1JOR A;  2EJF C;  2JA7 G;  1HNW L;  3L3O C;  1CKO A;  2QCP X;  4ZKB B;  4A3F H;  2F1M A;  5C4X G;  1BO0 A;  2RCN A;  2IW3 A;  2DN8 A;  4JBK A;  5DEH A;  5GQO A;  1S5E D;  1F9P A;  1UEB A;  3J80 E;  1YHA A;  2ID0 A;  5M3M H;  3PCO B;  2O5I C;  2BH2 A;  2ZXO A;  1WCM B;  3CCV A;  3E6Z X;  4DR5 Q;  2PO4 A;  3I4N G;  3Q24 A;  4A3G H;  1MGS A;  2ATW A;  1VQ5 A;  1NBW A;  5AJ3 Q;  3HOV B;  1E2Z A;  2PQA B;  3VDY A;  2R7Z G;  4J8Q A;  3IKJ A;  1VQ4 A;  1IBK L;  3I2Z A;  4V0B A;  3SE0 A;  1N33 Q;  4H13 C;  2B2W C;  2NN6 I;  1VQL A;  4HN7 A;  5FK9 C;  1X3Q A;  1IXR A;  1WJJ A;  1HTP A;  3G7L A;  3VYR A;  2YU9 H;  3A5Z B;  3NSW A;  1RJT A;  4KD3 A;  3RZO B;  4LF7 L;  2ICI A;  1B2T A;  2HD3 A;  1PYW D;  4GNX B;  5M9O A;  1A2U A;  3IFD A;  2D9U A;  1I94 L;  1SMX A;  2RSO A;  3D4W A;  2K5Q A;  3M4P A;  1ILP A;  1N36 Q;  3NXW A;  4LUO A;  1X9N A;  2VQE Q;  3ERS X;  3SDZ A;  4JVZ A;  3PO2 G;  3TBI B;  1HHV A;  2WKC A;  2NN6 G;  1MSH A;  1SND A;  2VS1 A;  4IUT A;  4FVM A;  5D3D A;  1S5D D;  2ZM6 L;  5IGE A;  3J81 j;  2IT1 A;  2VB3 X;  3CQZ H;  4MTN A;  1IL8 A;  3EIV A;  4LF5 L;  4OXP A;  1SYB A;  1V8Q A;  3NTI A;  3CU7 A;  4C3J H;  3KDF B;  1JJC B;  5HY6 A;  1TWG B;  1XMO L;  5M5X H;  1TWH B;  1B53 A;  2SOB A;  2UUB L;  2A68 D;  1E7Z A;  2JA5 H;  1C4Q A;  3DXJ C;  2GVA A;  3PO3 B;  5LL6 X;  4DR6 Q;  1XNQ L;  3MXN B;  3S1Q H;  2OF1 A;  3GV3 A;  2PI2 E;  2XWJ B;  1ILQ A;  3DUZ A;  1GXD C;  5CYU A;  3LWE A;  3WOF A;  5LMN W;  4A3M G;  3S2H H;  3JC6 6;  2SDF A;  1IYU A;  1RD9 D;  4PMC A;  4DR3 Q;  1EYG A;  4G7Z C;  4DKA C;  4IQZ A;  3A54 A;  1Q1E A;  1C48 A;  4XYQ A;  1WD1 A;  1TS5 A;  2HQE A;  3IFT A;  1K83 H;  1K3B C;  1VCI A;  1X3F A;  1EQQ A;  4NP5 A;  4QIW B;  5AFW A;  4DV0 Q;  1VQ8 A;  1PRT F;  1A2T A;  4KJN A;  3A8J E;  3D3R A;  2JA8 G;  3S14 H;  1SDF A;  4AQY L;  4RH6 A;  1K3R A;  4JBW A;  3FHW A;  5JPN C;  1VQP A;  5C6A A;  4APV A;  4YY3 L;  2KBN A;  3AB9 A;  2B63 B;  4JK1 C;  4DAV A;  1BBX C;  3KLR A;  1F9R A;  1VQF A;  4B3R L;  3A55 A;  1PRT B;  4RWS C;  2EQS A;  2F3W A;  4KY6 A;  3K5L A;  4RA8 A;  1EY6 A;  2OTJ A;  2IPK D;  4R4Q A;  1CA5 A;  1UUP A;  3C1E A;  2ZXP A;  5BR8 L;  1MI2 A;  3PMF A;  1XPR A;  1EZ8 A;  1LAC A;  3AQQ A;  4KHZ A;  1V43 A;  4JI2 L;  1S5B D;  1KLU D;  4C3I H;  3NWS A;  3HKS A;  2JJQ A;  4XXE A;  1VQ7 A;  3SK4 A;  3FKI G;  2VQF L;  4PMW A;  2F3I A;  3P1H A;  4IFD J;  2B2V C;  3H0G B;  4R4O A;  5K36 G;  3BG3 A;  5IT9 c;  1K8G A;  4A3G G;  2KUM A;  2EYM A;  4L5T A;  3KF6 B;  5C4J H;  3DWP A;  1WTV A;  4DNI A;  5FLM H;  1SYF A;  5C44 G;  1R9T B;  2PYK A;  2L11 A;  2L12 A;  3TS0 A;  3HOZ B;  3L7Z C;  3QB3 A;  5KYI A;  1X55 A;  3K7A H;  3MEF A;  5FO7 B;  1IYJ B;  3E0J A;  2O4X A;  4B9W A;  2LKV A;  1BUV T;  1VQA A;  2B2T C;  1EYA A;  3CP0 A;  1EEI D;  2D5D A;  3HKZ B;  1VQD A;  1JOQ A;  1B7Y B;  3RN2 A;  2A6E C;  1H9M A;  4ULL A;  1CUK A;  1K0R A;  3IRB A;  1KRT A;  5C3E B;  1ASZ A;  1M4V A;  4U68 A;  4X62 Q;  3RLN A;  3OTO Q;  1UAP A;  1ENC A;  2BA0 A;  3QIA A;  2M9V A;  3RLF A;  3UDG A;  4Y7N H;  2WAC A;  3H15 A;  5FOB B;  1I50 H;  1MJC A;  3T13 A;  1YHB A;  3EVQ A;  2KEN A;  3SHL A;  1IYV A;  1ET9 A;  1MBY A;  1C8C A;  2E2J H;  1B50 A;  1YNN C;  3BVG A;  5NUC A;  3T51 B;  5EKK A;  3CCQ A;  1KAA A;  4YWL A;  4A3I H;  3GTO B;  2IJ0 A;  3TEH B;  4HIM A;  1JOK A;  4DR1 L;  1IL2 A;  3NWT A;  2NZ1 D;  4K6L A;  2V1C C;  2OT2 A;  1QIL A;  4HAE A;  5JJI A;  4HJ5 A;  3S1N H;  2LXK A;  4DK6 C;  1TWA B;  1IW7 C;  2LMC B;  1A0I A;  1BKB A;  2F3V A;  3J81 E;  5C0X J;  1GJX A;  1HZ9 A;  2Q2U A;  5IGC A;  2EJM A;  3OMG A;  1TWF B;  3T4A C;  3S15 B;  2WV6 D;  2RF4 A;  3CME A;  4L5R C;  1EYC A;  1ZYR D;  1HUN A;  2FMC A;  1PZK D;  1A3U A;  3KK7 A;  4ME3 A;  3PO3 G;  1XTC D;  1LTL A;  2K04 A;  5J22 A;  2JEB I;  3QO2 A;  2A1A A;  4ALP A;  1VQE A;  2YTY A;  1LT3 D;  5M3F G;  2ZJR A;  1Q90 A;  4PZ7 A;  4FXG C;  3CCJ A;  1LT5 D;  1O7I A;  4XQN A;  4NB3 A;  1DGS A;  1HPC A;  3F2C A;  3H3V C;  4MTK A;  3PIP A;  1EQV A;  4DV6 Q;  4A3E B;  1GUN A;  4CKB A;  1H9S A;  1N32 Q;  3DLL A;  2FIN B;  3M4O H;  4XIG S;  1VF5 C;  3BYY B;  4F87 A;  4DV2 Q;  4CJ1 B;  3S17 B;  2EOT A;  5IGF A;  2PPB C;  3FPP A;  5K5P A;  4ZAI A;  4IUN A;  5IGD A;  4B3S Q;  5D3I B;  3A74 A;  3D6W A;  4O1N A;  1ZKO A;  2A73 B;  1E1O A;  5CV9 A;  3D8G A;  1ONL A;  1G6Z A;  1HQM C;  3NP8 A;  3K5M A;  4A3L H;  3CCR A;  1UWV A;  4G57 A;  2F0N A;  4FO2 A;  3KLS X;  3GTP B;  1NAP A;  1BOS A;  2NZO A;  1SNM A;  2MGS A;  2N8N A;  1SRU A;  3CD6 A;  1XWE A;  2BE5 C;  3P7J A;  3MFY A;  2HDM A;  5LMN L;  1LT4 D;  1VQB A;  3HOW H;  1RIP A;  4A3B G;  4CDE C;  2Q2I A;  3KLS A;  1WTR A;  1AW7 A;  5IYB H;  4Z9C B;  4N9P A;  3K59 A;  4BY1 G;  2F0H A;  1SBB B;  1Q3L A;  2PMZ B;  1C0A A;  4KLK A;  1YNX A;  1IKL A;  3A56 A;  2E2D C;  1M8A A;  4LF8 L;  4A3D B;  4LNQ A;  4F7X A;  3CCU A;  1KD1 C;  4B9X A;  2RKS A;  3H0G G;  2F4V Q;  4J6H A;  3CF5 A;  1DOM A;  1OTC A;  3S9W A;  1ZXT A;  2ZJQ A;  2EE1 A;  3I4M H;  5F2D A;  2XN9 C;  3KF8 A;  1E0B A;  5ELB A;  1DYQ A;  4K8J A;  3TP7 A;  4EQ5 A;  3HOZ G;  2DY7 A;  2Z0S A;  3IL8 A;  1FNV A;  4QMG A;  5FLX L;  1SFO B;  1D6E C;  1EWC A;  2OQK A;  3JAM L;  2NVX H;  1IBK Q;  3KLW A;  1K8M A;  1Y1V G;  4YHH L;  2E8G A;  2JN4 A;  4A3J H;  3HKZ G;  1PV4 A;  1S5C D;  3B6Y A;  4KTA A;  2MO0 A;  4NW2 A;  1A6X A;  5LMU L;  4BXX G;  1DZ1 A;  3OWF A;  1AEX A;  2A74 C;  2KHS A;  3GTJ H;  1WD0 A;  5C3E G;  1H9J A;  1DON A;  3I91 A;  2AUJ D;  4LF7 Q;  4HJA A;  1CQV A;  2IL8 A;  4HED A;  3HOX H;  3NEM A;  1U4P A;  1FNW A;  1GOZ A;  4HCS A;  2K03 A;  2OWO A;  4I65 A;  4X65 L;  4IJH A;  3H3V H;  1VQG A;  3WOE A;  3VYT A;  4GKK L;  1HZB A;  5HUR A;  2OXP A;  3PGZ A;  4XT1 B;  3GD7 A;  1EIG A;  2ZM6 Q;  3Q6S A;  5ELE A;  2JA7 H;  4H0L C;  3TRZ A;  3MZ5 A;  2BH8 A;  2JA6 G;  4LF5 Q;  4RCN A;  5C4X H;  3F1Z A;  2RSN A;  5CMD A;  2I5M X;  4G4K A;  4HTH A;  5EPL A;  2UXB L;  4ZRZ A;  3MXP A;  2WKD A;  4CJ0 B;  1QZG A;  3I4N H;  2UUB Q;  2A69 C;  1ZEQ X;  1A62 A;  4N8X 1;  1I4H A;  5CR3 A;  4JBJ A;  2E2I H;  3DM3 A;  1XNQ Q;  1D2B A;  1JT8 A;  2RDF A;  2R7Z H;  1BQQ T;  3GP7 A;  1FR3 A;  3J7A V;  4CDF C;  1Q12 A;  4QIW E;  3C3L A;  2F0K A;  2UUA L;  5KNC A;  1L1O C;  4ZUJ A;  4OEL B;  4ZYS A;  1LUZ A;  1FGB D;  3E3X A;  3NPP A;  3TQY A;  4DUZ L;  3C2P A;  1AP0 A;  1BCP D;  1YIJ A;  1EU4 A;  4YCV A;  2M00 A;  1KHI A;  3U50 C;  2B8G A;  1SNP A;  4AQY Q;  4OWX B;  5H1S E;  3S16 B;  5IY0 A;  4I7Z C;  1KRS A;  3PO2 H;  4NXM Q;  4YY3 Q;  2XNA C;  2NN6 H;  3FEW X;  2ZXR A;  1Q81 C;  1K28 A;  2KCC A;  2J4X A;  1EWI A;  3VR2 A;  2E5L L;  4BWG B;  4EVO A;  4DR4 L;  4B3R Q;  3GTQ B;  3BJU A;  1I4X A;  3GTK B;  2K1B A;  4WJW A;  2K33 A;  4C2M B;  1MIU A;  1EFI D;  3HOW G;  1U4L A;  1PLF A;  5DNF A;  4LMQ D;  2B2W A;  5JEA G;  5BR8 Q;  1FJG L;  2CHB D;  2JK8 A;  3OPO A;  3T1Y L;  4U67 3;  4LF9 L;  3K5O A;  4HMJ A;  1VQ6 A;  3JAM c;  1MKH A;  1PTO H;  1MD2 D;  1YHQ A;  5KNB A;  3F2B A;  2QF7 A;  2MPM A;  3GO5 A;  1JB3 A;  2VQF Q;  4LUZ A;  4WJ3 M;  3VR6 A;  1B8A A;  3HS0 C;  3S1R B;  1DM0 B;  2K7V A;  4TQU S;  3I4M G;  4A3M H;  4GNX C;  1STN A;  4QGU A;  4LFB Q;  1GUT A;  2D0O A;  3DEP A;  4G7O C;  4DR7 L;  4AYB B;  1NR2 A;  3HKZ E;  1L0X B;  3CRK C;  3H3V I;  1FGU A;  5GAH C;  5I4D A;  5BN4 A;  3E5S A;  2SNS A;  4B08 A;  3OW2 A;  2JA8 H;  5IYC G;  3W5O A;  3H09 A;  3H91 A;  2EDG A;  3A7L A;  3Q0A A;  2K05 A;  3PUX A;  3TP6 A;  2IX1 A;  2VUM G;  4ABN A;  2F0G A;  5CBE E;  1CZG A;  3J81 i;  5CV4 A;  3BZK A;  2MHV A;  4DA2 A;  3I70 A;  4HCE A;  1QVF A;  2DNC A;  2A6H C;  2GVB A;  2CWA A;  5M5Y H;  3ULJ A;  4KHP L;  4XT3 B;  1SN8 A;  4FP5 D;  2K6A A;  4LUV A;  5FO9 B;  2HIV A;  1NNX A;  4HMI A;  4IZ8 A;  3PUY A;  2K5H A;  1XYI A;  3D6C A;  4J15 A;  1QJO A;  4DK0 A;  3GV6 A;  3GDE A;  1ENF A;  1EY7 A;  5HGQ A;  5DAU A;  1EIH A;  3FP9 A;  4A76 A;  2EXZ A;  1PH1 A;  2B8F A;  4DR1 Q;  4DUY L;  1WTH A;  4QUF A;  4IOC A;  2TSS A;  1C7Y A;  3I4O A;  3FKI H;  3TS2 A;  4P74 A;  4GKJ Q;  1QCB D;  1XPO A;  1VQO A;  2NBF A;  4HIK A;  4A3F B;  1HNZ L;  5K36 H;  4BY7 G;  3RD4 A;  1STY A;  2IY5 B;  3BVM A;  4R9W A;  2MUY A;  5M3M B;  4GS3 A;  3J80 L;  4P75 A;  1X54 A;  3QJY A;  1G2S A;  2BOS A;  5C44 H;  1XXG A;  3N52 A;  1PH7 A;  1XMQ L;  4P71 A;  1BCP F;  1ESF A;  1JE4 A;  3RLO A;  1PRT C;  1Y14 B;  4XYO A;  1BF4 A;  3J7Z C;  5JJL A;  2G9D A;  4K5V A;  4EX5 A;  1XPU A;  1OXU A;  1M90 C;  3CC2 A;  3PSI A;  4N9T A;  4QUC A;  2H4O A;  4LF4 L;  3V96 A;  2X6G A;  3HZX A;  5IT9 E;  1BCP B;  1CI3 M;  3VR4 A;  2F0E A;  2HCI A;  2OTL A;  4JOI C;  4KN7 C;  4UP7 A;  2CH4 W;  2B2U C;  1G6P A;  4BBS B;  2VW9 A;  2PNH A;  5ELO A;  2UXC L;  2VB2 X;  3CC4 A;  4L5S A;  3HRZ C;  3KYH C;  2LFN A;  1EU3 A;  3UE0 A;  3NUC A;  3DWQ A;  3UDX A;  2YTV A;  3A8K E;  5E4W C;  2NVT B;  1L0Y B;  1I4G A;  2FFK B;  4NKL A;  3L0O A;  3NHH A;  1E24 A;  1STB A;  2H5X A;  1PHJ A;  1LLR D;  1U4M A;  4JI7 L;  3NEL A;  2Y0S B;  3LGJ A;  1ICW A;  2EYP A;  1KDB A;  2F0M A;  2K4K A;  3K81 C;  5EBD A;  2L9H A;  3NBH B;  4UHV A;  1I6H B;  2B2T A;  3C46 A;  2KOL A;  2AWN A;  4UP9 A;  3TP5 A;  1HNX Q;  3PF4 A;  1WI5 A;  1PMR A;  2PMZ E;  3WDN A;  5M5X B;  4HIO A;  5LMN Q;  4MIU A;  1U5K A;  4YCU A;  2L1B A;  2JA5 B;  4LF6 L;  4CKC A;  4KY7 A;  5JVG 3;  3AEV A;  1A63 A;  1YVC A;  4KJO A;  3PO3 H;  2ALY B;  1JJ2 A;  2Q2H A;  4A3K B;  2Z8L A;  2AMC B;  4LF8 Q;  3G48 A;  2F0U A;  4TVA B;  5M3F H;  3S2H B;  4IN3 A;  4FF1 A;  2F0Q A;  4JI5 L;  3PIP 3;  1WTQ A;  3QOJ A;  4X66 Q;  4HSP A;  1CZW A;  1QUQ A;  3ULP A;  2QEX A;  1S5F D;  2CVR A;  3ND8 A;  4JI1 Q;  1YIT A;  1SE2 A;  2EYH A;  1QG7 A;  2PI2 A;  4AYB G;  1X3P A;  2WAQ B;  4DXF A;  4P2C B;  3SVM A;  3HOU B;  3BDL A;  3NQT A;  1F9Q A;  3CMA A;  2UXD L; 
#chains in the Genus database with same CATH homology
 4K5W A;  3Q23 A;  2ICE C;  1CK1 A;  4IAL A;  2O5J C;  5I6Y A;  1T5E A;  1EY0 A;  5CC4 A;  4RKB A;  5KYL A;  3SEB A;  2KJX A;  4S3S A;  4DGZ A;  2NB0 A;  1O7Y A;  1EY9 A;  2KEC A;  1RCV D;  4X3K A;  5DM7 3;  1PDQ A;  2Q8T A;  4BBR B;  2A6E D;  4C3I B;  1UNS A;  4YIJ A;  2ENB A;  2X69 A;  4WFN 3;  2J0T D;  2F4I A;  1VMC A;  3I4L A;  2L4N A;  1TWC B;  5C4J B;  2F0I A;  1YNN D;  1D1K A;  2AUK A;  1Z47 A;  4QCL A;  1O7Z A;  1WTP A;  4E6I A;  2EYF A;  1A3T A;  2Z4I A;  1TU2 B;  5KIX A;  2EY1 A;  1IW7 D;  1K8O A;  3OIP A;  3PV0 A;  1Q1B A;  1W6J A;  3HGB A;  4K6D A;  4OIJ A;  4A93 B;  1CM9 A;  5CBA E;  1AZQ A;  5KRU A;  1DXM A;  1Y8O B;  1QE6 A;  4DN4 M;  4XDX A;  2E74 C;  4OIK A;  3M85 A;  1I50 B;  5JOB A;  3GTG B;  3RUZ A;  3K0Y A;  3LNN A;  3J7A F;  2E2J B;  1FD7 D;  4A3I B;  1YNJ C;  3D4D A;  4IFD I;  3U9S A;  3MVV A;  1RF2 D;  1V1O A;  2I46 A;  5EKL A;  4X3T A;  3P75 A;  2A5H A;  1I4R A;  2PZT A;  3W3A A;  1KNE A;  3J81 L;  2E2H B;  1X32 A;  1RTN A;  1G29 1;  5C4H A;  4CBV A;  1CTM A;  2NUC A;  1SYG A;  1R4Q B;  4PQX A;  5M5W B;  4IFD G;  1J9O A;  4K2K A;  5KEE A;  2N55 A;  3CRL C;  3W2D A;  4KD4 A;  2BE5 D;  1WTO A;  5E1F A;  1WTW A;  1EEF D;  2KCN A;  3NBI A;  2BDO A;  5EPJ A;  4ZKC B;  3MXU A;  1VDZ A;  3KBX A;  2F0P A;  3S1M B;  3BVZ A;  3J7Y W;  3FRP B;  3LX0 A;  5C0X I;  1NR4 A;  4NMZ A;  3R93 A;  3MTS A;  4BS9 A;  1JOO A;  4FNF A;  2R6G A;  4FF2 A;  4L8J A;  5JEA H;  1FYC A;  1HXY D;  2AQ2 B;  5FKA C;  4CKE A;  1EL0 A;  4EGV A;  3G6J B;  1KAB A;  3O13 A;  1GHJ A;  5C0X G;  5T1G A;  2R93 B;  1PTO D;  4F8M A;  1GHK A;  2DNE A;  3NTH A;  4C1N I;  4KY5 A;  1TY2 A;  4OHJ A;  2FMM A;  3F2U A;  3SK6 A;  4X3U A;  3R2I A;  2D2C C;  1II3 A;  2EZV A;  1OXX K;  3AMU A;  2IX3 A;  4KKT A;  3VA5 A;  4IUU A;  2RVL A;  3JAM E;  2RBM A;  2NVX B;  2E75 C;  2B2Y A;  2R3Z A;  5A2Q E;  1CQF A;  3ITP A;  1PFN A;  4A3J B;  2NTT A;  1Y1W B;  1F9S A;  3I90 A;  5EBC A;  3HEJ A;  2A69 D;  3D4R A;  1PFB A;  4R8N A;  3PUW A;  2KQ3 A;  1U9R A;  3URY A;  4CHT B;  1G2T A;  4L63 B;  2EJG C;  2QEJ C;  2VNU D;  1I4Q A;  2NVY B;  2F0J A;  1I4P A;  2EPB A;  3L9A X;  3A8I E;  4RAU C;  4C3H B;  5C3W A;  2JYO A;  4M8A A;  5TSS A;  2JA7 B;  4PV1 C;  3HOY B;  3K5N A;  2QDB A;  5G3L D;  1JWU D;  3GTL B;  5C4X B;  2B39 A;  4XQJ A;  3GTM B;  1B4O A;  1NUC A;  3I4N B;  3LWU A;  4OO1 I;  1DD2 A;  2R92 B;  2E2I B;  2K01 A;  4DNT B;  3TP8 A;  2R7Z B;  4DXG A;  3MXN A;  1WTX A;  4J1M A;  3VR3 A;  4PNY A;  1LTI D;  2N88 A;  4KN4 C;  1IHZ A;  3TME A;  1ROD A;  4Q5V A;  1Q8I A;  2F0L A;  2K28 A;  4OO1 G;  3OWE B;  2CQA A;  3I73 A;  1PXU A;  1LTT D;  4R8I A;  2Q8R E;  2F0F A;  3KUP A;  1HTL D;  2K5D A;  5BN3 A;  2SNM A;  3BS1 A;  4DAY A;  5IOC A;  3T56 B;  2O2L D;  3FPU B;  1D5M C;  1JQY D;  1PTO F;  2F03 A;  1KDA A;  4KK7 A;  4M1U B;  1XX8 A;  3DMU A;  1TY0 A;  2G9H D;  1SMY C;  1VF7 A;  1OO9 B;  4GZY C;  1PTO B;  4CJ2 C;  4KMU C;  1H9R A;  1DJR D;  3VYS A;  2B2U A;  2A6H D;  2EY5 A;  1H9S B;  1BNZ A;  1HA5 A;  5I2X A;  1EOT A;  1F2Y A;  2MP1 A;  3OOC A;  1HCZ A;  3QG1 A;  4LK1 C;  3V05 A;  3DWA A;  3X3M A;  1TQO A;  1EQT A;  3MXG A;  2RDG A;  1HFG A;  1A3V A;  1B44 D;  1SE3 A;  5CV7 A;  1RHP A;  4RGO S;  3V2T A;  4DFA A;  4ZUI A;  3SXH A;  2OEO A;  2C9O A;  3ONA B;  5M5Y B;  3CHB D;  2K32 A;  4ZK9 B;  4PMB A;  1PRT D;  2EYL A;  2WP8 J;  3A7A B;  2HCC A;  1I6V C;  3MC0 B;  3EA6 A;  2NYZ D;  2M2L A;  3BDC A;  1Y69 U;  4F88 A;  1STA A;  1TR5 A;  5EQ0 A;  3RMH A;  4ME5 A;  1RKN A;  4K14 A;  1EWH A;  2WII B;  2Z1C A;  5BN5 A;  4A3G B;  1EYD A;  2CW0 C;  3VR5 A;  3VYU A;  5CV8 A;  1B3A A;  3ND9 A;  1SYD A;  5C44 B;  2R61 A;  2VXW A;  3PUZ A;  3TDQ A;  1D5X C;  2E76 C;  5T1I A;  2YU9 B;  1AN8 A;  4WRD A;  2NTS A;  3TSS A;  1TS3 A;  2B2V A;  4FXD A;  2K5W A;  5IT9 L;  5I2Y A;  4FXK C;  1HQR D;  2NWG A;  2SEB D;  5EGT A;  4BA1 I;  1SJE D;  1SYC A;  2MJ8 A;  5C4Z A;  3CQZ B;  5CV6 A;  1QB5 D;  4DNR B;  5KND A;  4MN3 A;  4C3J B;  4RFB A;  1S4Z A;  5A35 A;  1HRJ A;  3TZD A;  4L6T B;  1KDC A;  3K57 A;  1BDO A;  3K58 A;  3S1Q B;  1CHQ D;  4LAA A;  4DAP A;  3SR1 A;  1TS2 A;  5CGK A;  3FVQ A;  5ELD A;  1O80 A;  5IIF A;  4IFD H;  3IAY A;  5HGT A;  2TMP A;  4IUV A;  4DF7 A;  3H94 A;  1K83 B;  1D1I A;  3R8B A;  5M3F B;  5IGG A;  5I9O A;  1SNC A;  1DOK A;  1JIC A;  3S14 B;  1F77 A;  1SE4 A;  3ZYY X;  1JCK B;  1LO5 D;  1CT1 D;  5JAV A;  3I8Z A;  1NCV A;  5LL6 S;  1VMP A;  2FJ2 A;  3FDT A;  2A68 C;  2V4D A;  1B9M A;  1V1P A;  5JJZ A;  2PZW A;  4RGN A;  1QNK A;  3GQB A;  1RTO A;  3HP3 A;  4FF3 A;  3MAQ A;  3MHB A;  5EJW A;  2BA1 A;  1GUG A;  3QWN A;  4UAI A;  4KV6 A;  4HSV A;  3T16 A;  4FYD A;  1LTR D;  1TS4 A;  2WB1 B;  1PZI D;  4WOR A;  2IX0 A;  4A3B B;  5I6W A;  5EPK A;  2JXM B;  4X3S A;  4BY1 B;  3DEO A;  4XQQ A;  1TII D;  4DU9 A;  5C0X H;  1MSG A;  1IKM A;  3NK9 A;  1E2V A;  1ESR A;  4EQN A;  4TSS A;  4RHS A;  3CKI B;  3M4Y A;  4QB4 A;  2L55 A;  5I9P A;  3K7A B;  2FHT A;  5COY A;  2JP1 A;  2BDN A;  1YNJ D;  1D5Z C;  4RGM A;  1STG A;  2JSO A;  1LTG D;  4KHV A;  4EQO A;  1Y1V B;  2F0V A;  1B1Z A;  2X6L A;  2PQE A;  1SYE A;  4Y7N B;  1KTK A;  2EY6 A;  1BR9 A;  2HUG A;  3NTK A;  1HUM A;  3DHQ A;  1Y8N B;  1LTA D;  3M7G A;  2AQ1 B;  3NE5 B;  2KVM A;  2LY7 A;  2KA7 A;  1JC7 A;  3ERO A;  3TZU A;  3S1N B;  5ELF A;  5C3X A;  3KBG A;  3BZD B;  5CV5 A;  3PUV A;  3SK8 A;  5D65 A;  1BXT A;  1ML0 D;  3MWY W;  3OW7 A;  1SNO A;  2JA6 B;  4IUQ A;  4C3J G;  1EY4 A;  3OMC A;  1FNU A;  3SK5 A;  1SAP A;  4BA2 I;  2EYO A;  1LAB A;  1R4P B;  3OHX C;  5J1Z A;  1GUW A;  4UDU C;  2F0T A;  2HDL A;  4O42 A;  1KLG D;  1RDP D;  4G7H C;  2PNR C;  2XWB B;  3BYT B;  1Z7T A;  3M4O B;  4H44 C;  3P20 A;  4OO1 H;  2F0S A;  1LTB D;  4NDX A;  1I3Q B;  5IOD A;  1STH A;  1HA6 A;  1PFM A;  4EQP A;  1ZYR C;  4MHE A;  4ODG A;  2DY8 A;  2EY2 A;  1KNA A;  4H7B A;  1H9K A;  4ILW A;  2RA4 A;  4ID6 A;  5J39 A;  4K8I A;  3K6O A;  2KED A;  4OGQ C;  3HOW B;  3UI2 A;  1GUO A;  2H1E A;  3AU7 A;  5EKI A;  1A15 A;  4C3I G;  3I3C A;  1SNQ A;  2YYZ A;  2Z4H A;  1HFN A;  2Q8I B;  3DM1 A;  3EJI A;  2PCF B;  2QKI C;  3BDO A;  4DK1 A;  1TVX A;  2J7Z A;  5C5M A;  3I4M B;  4RKL A;  3T53 B;  2RQX A;  2BCO A;  5FLX E;  3Q22 A;  1LT6 D;  3M3Y B;  4V19 0;  2GA4 B;  2XVS A;  1U4R A;  3VA7 A;  2KEE A;  3D31 A;  1V1P B;  1DOL A;  1JR0 D;  2I07 B;  1CFM A;  3GTJ B;  5IGB A;  5E4X A;  2PZU A;  4OL7 A;  2VUM B;  5A2Q L;  1TT2 A;  1G8Z D;  1E2W A;  1OXV A;  3X3N A;  4KI0 A;  3HOX B;  3RZD B;  1CA6 A;  3R2T A;  1PTO C;  1O78 A;  2D62 A;  3R3O A;  2RDH A;  5JEA J;  4FF4 A;  1SJH D;  3HG9 A;  4CGY B;  5DM6 3;  5COR A;  3TN2 A;  1Z6H A;  3PIO 3;  1F2Z A;  4RHR A;  5JVH 3;  2C5C A;  4BY7 B;  3NBH A;  4Q0F A;  3M7N A;  3ERQ A;  1QOH A;  4K5X A;  5ISR A;  2PW5 A;  1J8I A;  3FMC A;  2PW7 A;  3C1F A;  1JWM D;  2XRQ D;  1Y8P B;  5ELC A;  3S2D B;  2IWH A;  1SMY D;  2QIL A;  4IUP A;  3NQI A;  4ZQ3 A;  5E3F A;  4IUR A;  3PO2 B;  3QOL A;  4KKS A;  1ENA A;  4RCO A;  4HR7 B;  2EVB A;  1GUS A;  1G91 A;  3EFX D;  4C1N K;  3OSO A;  2WIN B;  4K2L A;  2L0C A;  1OXT A;  5KGU A;  1EY5 A;  3EQL C;  1WVL A;  1SSO A;  4LJZ C;  2B2Y C;  2NVQ B;  1EZ6 A;  4TRD A;  1BCP C;  1W6K A;  1DCZ A;  1LTS D;  4QF4 A;  5D14 A;  1QWY A;  3I72 A;  4A3M B;  3H6M A;  2AQ3 B;  5JPM C;  2JEA I;  4XTC S;  1EY8 A;  2L5T A;  1AFP A;  2AWO A;  1STE A;  2XIW A;  1F2M A;  3MA2 B;  4ZLT F;  2F0D A;  1JWS D;  2JA8 B;  2LS0 1;  1AZP A;  2EYJ A;  3N6R A;  1QNU A;  2F0W A;  1NSN S;  2JE6 I;  3U9O A;  1ET6 A;  1TKW B;  3MEH A;  1T5X D;  2F0O A;  2CW0 D;  2ZT9 C;  4KKU A;  5G3L F;  1SXT A;  5FO8 B;  1LV9 A;  1CHP D;  4TKO B;  1OXS C;  1B9N A;  2XRS D;  3OIQ A;  1UEA B;  2XSC A;  1SEB D;  1O7L A;  1PZJ D;  5LHY 1;  3MFG A;  1F2L A;  4RGT A;  5C5L A;  3FKI B;  4C3H G;  1JOR A;  2EJF C;  3L3O C;  2QCP X;  4ZKB B;  2F1M A;  1BO0 A;  2IW3 A;  2DN8 A;  5DEH A;  3J80 E;  1S5E D;  1F9P A;  2ID0 A;  2O5I C;  2ZXO A;  1WCM B;  3E6Z X;  2PO4 A;  3Q24 A;  1MGS A;  3HOV B;  1E2Z A;  4J8Q A;  3IKJ A;  4V0B A;  3SE0 A;  4H13 C;  2B2W C;  2NN6 I;  4HN7 A;  5FK9 C;  1X3Q A;  1HTP A;  3G7L A;  3VYR A;  3NSW A;  1RJT A;  4KD3 A;  3RZO B;  2ICI A;  1B2T A;  1PYW D;  5M9O A;  1A2U A;  3IFD A;  2D9U A;  2RSO A;  3D4W A;  2K5Q A;  1ILP A;  3NXW A;  3SDZ A;  1HHV A;  3TBI B;  2WKC A;  2NN6 G;  1MSH A;  1SND A;  4IUT A;  4FVM A;  5D3D A;  1S5D D;  5IGE A;  2IT1 A;  2VB3 X;  1IL8 A;  1SYB A;  1V8Q A;  3NTI A;  3CU7 A;  1TWG B;  1TWH B;  1B53 A;  2SOB A;  2A68 D;  1C4Q A;  3DXJ C;  3PO3 B;  5LL6 X;  2OF1 A;  3GV3 A;  2XWJ B;  1ILQ A;  3DUZ A;  1GXD C;  5CYU A;  3LWE A;  3WOF A;  2SDF A;  1IYU A;  1RD9 D;  4PMC A;  4G7Z C;  4IQZ A;  1Q1E A;  3A54 A;  1C48 A;  4XYQ A;  1WD1 A;  1TS5 A;  2HQE A;  3IFT A;  1VCI A;  4NP5 A;  4QIW B;  5AFW A;  1PRT F;  1A2T A;  4KJN A;  3A8J E;  3D3R A;  1SDF A;  4RH6 A;  4JBW A;  5JPN C;  5C6A A;  3AB9 A;  2B63 B;  4JK1 C;  4DAV A;  1BBX C;  3KLR A;  1F9R A;  3A55 A;  1PRT B;  4RWS C;  2F3W A;  4KY6 A;  3K5L A;  4RA8 A;  1EY6 A;  2IPK D;  1CA5 A;  1UUP A;  3C1E A;  2ZXP A;  1MI2 A;  3PMF A;  1EZ8 A;  1LAC A;  4KHZ A;  1V43 A;  1S5B D;  1KLU D;  3NWS A;  4XXE A;  3SK4 A;  4PMW A;  3P1H A;  4IFD J;  2B2V C;  3H0G B;  5K36 G;  3BG3 A;  2KUM A;  2EYM A;  3DWP A;  1WTV A;  1SYF A;  1R9T B;  2PYK A;  2L11 A;  2L12 A;  3HOZ B;  3L7Z C;  3QB3 A;  5KYI A;  5FO7 B;  3E0J A;  2O4X A;  4B9W A;  2LKV A;  1BUV T;  2B2T C;  1EYA A;  1EEI D;  2D5D A;  3HKZ B;  1JOQ A;  2A6E C;  1H9M A;  4ULL A;  5C3E B;  1M4V A;  4U68 A;  1UAP A;  1ENC A;  2BA0 A;  3QIA A;  2M9V A;  3RLF A;  2WAC A;  5FOB B;  3T13 A;  3EVQ A;  3SHL A;  1IYV A;  1ET9 A;  1MBY A;  1C8C A;  1B50 A;  1YNN C;  3BVG A;  5NUC A;  3T51 B;  5EKK A;  1KAA A;  3GTO B;  2IJ0 A;  1JOK A;  3NWT A;  2NZ1 D;  4K6L A;  2OT2 A;  1QIL A;  4HAE A;  1TWA B;  1IW7 C;  2LMC B;  2F3V A;  3J81 E;  5C0X J;  1GJX A;  5IGC A;  2EJM A;  3OMG A;  1TWF B;  3T4A C;  3S15 B;  2WV6 D;  1EYC A;  1ZYR D;  1HUN A;  2FMC A;  1PZK D;  1A3U A;  3KK7 A;  1XTC D;  2K04 A;  5J22 A;  2JEB I;  3QO2 A;  1LT3 D;  1Q90 A;  4FXG C;  1LT5 D;  4XQN A;  1HPC A;  3H3V C;  1EQV A;  4A3E B;  1GUN A;  4CKB A;  1H9S A;  2FIN B;  4XIG S;  1VF5 C;  3BYY B;  4F87 A;  4CJ1 B;  3S17 B;  2EOT A;  5IGF A;  2PPB C;  3FPP A;  5K5P A;  4ZAI A;  4IUN A;  5IGD A;  5D3I B;  3D6W A;  4O1N A;  1ZKO A;  2A73 B;  5CV9 A;  3D8G A;  1ONL A;  1G6Z A;  1HQM C;  3NP8 A;  3K5M A;  4G57 A;  2F0N A;  4FO2 A;  3KLS X;  3GTP B;  1NAP A;  1BOS A;  1SNM A;  2MGS A;  1XWE A;  2BE5 C;  3P7J A;  3MFY A;  2HDM A;  1LT4 D;  3KLS A;  1WTR A;  1AW7 A;  4Z9C B;  4N9P A;  3K59 A;  2F0H A;  1SBB B;  1Q3L A;  2PMZ B;  1IKL A;  3A56 A;  2E2D C;  1M8A A;  4A3D B;  4F7X A;  4B9X A;  2RKS A;  4J6H A;  1DOM A;  3S9W A;  1ZXT A;  2EE1 A;  5F2D A;  2XN9 C;  3KF8 A;  1E0B A;  5ELB A;  1DYQ A;  3TP7 A;  4K8J A;  2DY7 A;  3IL8 A;  1FNV A;  4QMG A;  5FLX L;  1SFO B;  1D6E C;  1EWC A;  3JAM L;  1K8M A;  1S5C D;  4KTA A;  4NW2 A;  1A6X A;  1DZ1 A;  3OWF A;  1AEX A;  2A74 C;  2KHS A;  1WD0 A;  1H9J A;  1DON A;  3I91 A;  2AUJ D;  1CQV A;  2IL8 A;  4HED A;  1U4P A;  1FNW A;  1GOZ A;  4HCS A;  2K03 A;  4I65 A;  3WOE A;  3VYT A;  5HUR A;  2OXP A;  4XT1 B;  3GD7 A;  1EIG A;  3Q6S A;  5ELE A;  4H0L C;  3MZ5 A;  4RCN A;  2RSN A;  5CMD A;  4HTH A;  4G4K A;  5EPL A;  4ZRZ A;  3MXP A;  2WKD A;  4CJ0 B;  2A69 C;  1ZEQ X;  1I4H A;  5CR3 A;  1D2B A;  2RDF A;  1BQQ T;  3GP7 A;  1FR3 A;  3J7A V;  1Q12 A;  3C3L A;  2F0K A;  5KNC A;  4ZUJ A;  4ZYS A;  1FGB D;  3NPP A;  3C2P A;  1AP0 A;  1BCP D;  1EU4 A;  2M00 A;  2B8G A;  1SNP A;  3S16 B;  4I7Z C;  2XNA C;  2NN6 H;  3FEW X;  2ZXR A;  2KCC A;  2J4X A;  3VR2 A;  4BWG B;  4EVO A;  3GTQ B;  1I4X A;  3GTK B;  2K1B A;  4WJW A;  2K33 A;  4C2M B;  1EFI D;  1U4L A;  1PLF A;  5DNF A;  4LMQ D;  2B2W A;  5JEA G;  2CHB D;  3OPO A;  4U67 3;  3K5O A;  4HMJ A;  1PTO H;  1MD2 D;  5KNB A;  2QF7 A;  2MPM A;  3GO5 A;  1JB3 A;  3VR6 A;  3HS0 C;  3S1R B;  1DM0 B;  2K7V A;  4TQU S;  1STN A;  1GUT A;  3DEP A;  4G7O C;  4AYB B;  1NR2 A;  1L0X B;  3CRK C;  5I4D A;  5BN4 A;  3E5S A;  2SNS A;  4B08 A;  1F9Q A;  3H09 A;  3H91 A;  2EDG A;  3A7L A;  3Q0A A;  2K05 A;  3TP6 A;  3PUX A;  2IX1 A;  4ABN A;  2F0G A;  5CBE E;  1CZG A;  5CV4 A;  2MHV A;  4DA2 A;  3I70 A;  4HCE A;  2DNC A;  2A6H C;  4XT3 B;  4FP5 D;  2K6A A;  5FO9 B;  4HMI A;  4IZ8 A;  3PUY A;  1XYI A;  3D6C A;  1QJO A;  4DK0 A;  3GV6 A;  1ENF A;  1EY7 A;  1EIH A;  5DAU A;  2EXZ A;  2B8F A;  4QUF A;  2TSS A;  1QCB D;  2NBF A;  4A3F B;  5K36 H;  3RD4 A;  1STY A;  3BVM A;  4R9W A;  2MUY A;  5M3M B;  3J80 L;  3QJY A;  1G2S A;  2BOS A;  1XXG A;  3N52 A;  1BCP F;  1ESF A;  1JE4 A;  1BF4 A;  1PRT C;  4XYO A;  2G9D A;  4K5V A;  1OXU A;  4N9T A;  4QUC A;  2H4O A;  3V96 A;  2X6G A;  3HZX A;  5IT9 E;  1BCP B;  1CI3 M;  3VR4 A;  2F0E A;  2HCI A;  4KN7 C;  2B2U C;  4BBS B;  2VB2 X;  3HRZ C;  2LFN A;  1EU3 A;  3NUC A;  3DWQ A;  3A8K E;  5E4W C;  2NVT B;  1L0Y B;  1I4G A;  2FFK B;  4NKL A;  3NHH A;  1STB A;  1LLR D;  1U4M A;  2Y0S B;  1ICW A;  2EYP A;  1KDB A;  2F0M A;  5EBD A;  2L9H A;  1I6H B;  2B2T A;  3C46 A;  2KOL A;  2AWN A;  3TP5 A;  1PMR A;  3WDN A;  5M5X B;  4MIU A;  2JA5 B;  2L1B A;  4CKC A;  4KY7 A;  5JVG 3;  4KJO A;  4A3K B;  2Z8L A;  2F0U A;  3S2H B;  4IN3 A;  4FF1 A;  2F0Q A;  3PIP 3;  1WTQ A;  3QOJ A;  4HSP A;  1CZW A;  1S5F D;  2CVR A;  3ND8 A;  1SE2 A;  2EYH A;  1QG7 A;  1X3P A;  2WAQ B;  4DXF A;  4P2C B;  3SVM A;  3HOU B;  3BDL A;  3NQT A;  4C56 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...